4PA1A

Crystal structure of catalytic core domain of fiv integrase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
151
structure length
151
Chain Sequence
b'HMGIWQMDCTHFDGKIILVGIHVESGYIWAQIISQETADCTVKAVLQLLSAHNVTELQTDNGPNFKNQKMEGVLNYMGVKHKFGIPGNPQSQALVENVNHTLKVWIQKFLPETTSLDNALSLAVHSLNFKRRGRIGGMAPYELLAQQESLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Identification of phe187 as a crucial dimerization determinant facilitates crystallization of a monomeric retroviral integrase core domain.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
total genus 50
structure length 151
sequence length 151
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pa1A00
4DF4A 1T8EA 3L2WA 3VQAA 1ZBLA 1S1WA 3KK3A 4FJKA 1NOYA 3ZSVA 1IKVA 4FJLA 3CFPA 4CCHA 2IAJA 4IG0A 4BACA 1B9FA 2YNIA 3U6FA 4CJQA 4CFBA 3THVA 4N76A 3OYAA 1HNIA 1CZBA 4E19A 2KTQA 1DLOA 2YNFA 3AO5A 4YFUA 4RW7A 4TSXA 1WSHA 3BGRA 4Z4HA 3NHGA 1D8YA 1RBSA 4BDPA 3LP2A 3G10A 4Z0UA 3F73A 2OZSA 1QSYA 1VSIA 4K8XA 1VRTA 3C6TA 4DFJA 4M3UA 4KTZA 2ATQA 4Z4CA 3AA5X 3ZT1A 3HXMA 3O3FA 4KV8A 3ZT3A 4CHQA 3AVFA 3HVRA 3DLKA 4DTSA 1XI1A 2B5JA 2YNHA 4O5BA 1ZYQA 5CZ1A 3SV3A 5J2QA 3OS1A 1J9AA 3HSTB 3QLHA 1RT1A 1RDBA 3NFAA 4IG3A 4FZYA 4OLBA 1L3TA 4DTUA 3QEVA 4KHQA 4CJWA 1NK0A 4BWJA 1C1BA 4CEDA 3PY8A 4M3YA 1MU2A 2E6MA 2KQ2A 3VQ4A 4CJSA 3MXIA 4FK0A 4FXDA 1BGXT 2XY8A 2D0BA 2DFHA 4MFBA 1JKHA 4H8KA 4E7IA 3ZSQA 2KZMA 1B92A 2F96A 3NF8A 4FK2A 4CEQA 1WSGA 1LWCA 4ICLA 2PYJA 5HP1A 5HRSA 1UA1A 5FRMA 1U4BA 4FZZA 2A1SA 3DLEA 2P1JA 4CHPA 1NK8A 1C0TA 4FJGA 4KHWA 4KHYA 3CYMA 4CHZA 1L5UA 3KD5E 3KLGA 1HQUA 1ZBIA 4CJ3A 2XY7A 3V9ZA 2PZSA 3G0ZA 1CZ9A 1J54A 1IKYA 2GBZA 2R7YA 1ASVA 1VSFA 2DFEA 4HCCA 1XHXA 1CLQA 3QEWA 2F8SA 5CY4A 1FKOA 1HYZA 1S9GA 1Y97A 3QERA 3QEXA 2A1RA 3V81A 4W5OA 4CFDA 2I5JA 2PY5A 3ZSZA 4C8KA 3TR8A 2XO7A 2EX3A 2YKMA 1JXBA 5HRNA 1NKCA 4FK4A 4DTRA 4KTWA 1Q9XA 4FJIA 3VQDA 1Q8IA 3V9WA 4B9UA 4H4OA 1TKZA 4AHTA 1VSLA 1BCOA 4CJ4A 1ITGA 4E89A 3TAGA 1BI4B 4DWIA 2Z1IA 4K8ZA 4OLAA 4W5RA 4FCYA 3AO1A 1WSIA 3LAKA 1D9FA 3RWUA 1RT2A 1TL3A 3DLGA 3HP6A 3CQ8A 1XWLA 3AVGA 4DTPA 3NF9A 4I9LA 4HHTA 3CM6A 2IC3A 3O4QA 1JLCA 1RILA 4M3WA 4C8NA 2YKNA 1C1CA 3JSMA 3V6DA 1YTAA 3ZSYA 4O44A 4KAZA 4ID1A 1QSLA 1KFDA 1NOZA 1UAXA 3OYLA 4PWDA 3QNOA 1X9WA 4RW8A 4DF8A 3M8PA 4LH4A 3L8BA 1HYSA 4FJHA 4AHRA 2YV0X 3OYIA 3NGIA 3LPUA 4XIUA 4FLVA 4OGCA 3TAMA 2QKBA 1WSFA 1L3SA 1C6VA 3KK1A 1U48A 4B9SA 4J2DA 4J2BA 4FM0A 4QAGA 4IKFA 3K5MA 4DSKA 4DQRA 3RR7A 2OYQA 2AJQA 2VG7A 1RCHA 4CGJA 3TAPA 1RDCA 3AA2A 3LDSA 3KKRA 4H4MA 3T19A 2W42A 4RW6A 2B4JA 3VQBA 5FRNA 2VWJA 3HPHA 1A5WA 1X1PA 2BGGA 3O3GA 2FBYA 4OPKA 1JLQA 4Y1CA 3OYGA 3KJVA 4Z4EA 4FLZA 3ALYA 3K59A 5SWMA 1RT7A 4OGEA 1JL2A 4ID5A 4C8MA 2YHAA 4KKOA 1LAVA 5C24A 1BL3A 1JL1A 4M45A 4EP5A 4LD0A 3TI0A 3PO5A 3WNFA 1RT3A 4LY7A 3TABA 1NJWA 3PUFA 4FLYA 4DFKA 1LW0A 2PYLA 4FJMA 4FJNA 1EETA 3VQ5A 2YNGA 5CYMA 4R5PA 3QETA 5KGWA 2Y1JA 3OYJA 3ISNC 3VQCA 5J2PA 1BISA 1UWBA 2OPPA 3ASMA 3DI6A 3TANA 2QK9A 1RNHA 1WNSA 2G8VA 3ZSRA 4GW6A 1BIZA 3PX4A 1KVCA 4CJEA 4IFVA 4JRPA 1UOCA 2XY5A 1IO2A 3AVLA 5JS1A 1FXXA 3HT3A 1RBUA 3WNGA 4ELVA 3DYAA 3EYZA 1KTQA 3DOKA 3M8RA 4B3OA 4E0DA 4LSLA 3QNNA 1EKEA 3KLFA 2QKKA 1KLMA 1HNVA 3AVAA 4M3RA 1BQMA 2WOMA 3QINA 3VQ9A 3CM5A 5FDLA 3OS2A 5I42A 5D3GA 1VK0A 3TAEA 4RW4A 4FVMA 3OYHA 3PO4A 4HCBA 4CJ5A 4O55A 1TL1A 3U3GA 4E1NA 3JYTA 2Z1HA 2HNZA 2VG5A 3KLHA 1F21A 3KD1E 2HNDA 3PX6A 2ETJA 2O4GA 3CFOA 3QIOA 1JLGA 4OVLA 1DTTA 2KW4A 1CXUA 3L2UA 1B9DA 4DTXA 3S3OA 1GOCA 1Q9YA 3KTQA 4CGFA 4QCLA 2HHSA 3SV4A 2OPRA 4DS4A 3VQ6A 2X74A 1J53A 3NCIA 1RDAA 3D45A 3OYCA 3OYKA 4CF1A 5CYQA 2HHXA 1RBRA 2IOCA 1HJRA 2BANA 4KB1A 2G8FA 3VN5A 3RMBA 2FBXA 3OS0A 1SL1A 2Z1GA 1T03A 1NK6A 1QE1A 1WSEA 2HNYA 4EP4A 3AVCA 4RG8A 3TARA 1BIUA 4IBNA 3M8SA 3EY1A 3HL8A 3V9UA 4KHNA 2IGIA 3RMAA 4E7KA 3O3HA 1VSDA 1GOAA 1A5VA 2HHUA 4CFAA 3TAQA 5FROA 1RTHA 1NJZA 4DU4A 4BE2A 3H08A 1TK5A 1N6QA 1HMVA 3RRHA 2HVHA 4UQGA 4DLEA 3SPZA 1T7PA 1RTDA 1TK0A 1IG9A 4Z4GA 4NYFA 4AHSA 3NH1A 3OJUA 2FC0A 4B08A 3OJSA 1JLBA 1TKXA 4KRFA 4DTNA 3WNEA 3MXMA 2P5GA 3SQ0A 4KI4A 4Q5VA 3SJJA 3AVHA 4MQ3A 5KRTA 2FBTA 4E1MA 3NF6A 1QQCA 4CEOA 2HHQA 4FW1A 2KZZA 2EHGA 4FYDA 1HPZA 1RBVA 3D0PA 1LWEA 2JLEA 1D5AA 4CESA 4ZTJA 3OYNA 3IAYA 1C0MA 1EXQA 3I0RA 4NCGA 4NYNA 3V1RA 4KHUA 1SUQA 3AA3A 2HHWA 3KK2A 3L2QA 3AO2A 3ZT4A 3ZT2A 1NK9A 4W5QA 2GUIA 3UIQA 5T7BA 4PQUA 4B9VA 3HVTA 2KFZA 1SKSA 4E3SA 4CJPA 3RRGA 4DQPA 4NCBA 4GMJB 1S5JA 4CJTA 3MXJA 1LAWA 3VQ7A 3ZSWA 1C1AA 3LWLA 4IFYA 3K5OA 2G8WA 3VQ8A 2X6SA 1YTUA 1I3AA 3VA3A 4DSJA 1TGOA 3DLBA 1JXEA 1TAUA 3MEEA 1QHTA 2KFNA 2RKIA 1WN7A 4CE9A 1NKBA 4CJFA 3LP3A 1EP4A 4B9NA 1TV6A 3NBPA 1S9EA 3ZCMA 4JS5A 1RTJA 5JS2A 3K58A 1SKRA 4Y1DA 1K6YA 4FJ5A 5KTQA 4DQIA 1KLNA 4AHUA 4Z4IA 4PA1A 2P51A 1ASWA 1TAQA 4CGGA 3SI6A 4FM2A 2YHBA 4ELTA 3NH2A 4DQQA 3AVIA 4DTOA 2WONA 3SUOA 4PUOA 1U45A 2G8KA 3DRSA 3OY9A 1S1XA 3SZ2A 4I2QA 5I3UA 3LP0A 3LP1A 3MECA 3L2RA 1TKTA 3K57A 1S1VA 1G15A 2IDOA 4AHVA 4F4KA 1S1TA 3DLHA 5K14A 4CF2A 3HJFA 3AV9A 4JS4A 2JGUA 5DK5A 3QESA 2BE2A 3IRXA 3M8QA 3NF7A 4CERA 1U47A 1LV5A 4B9LA 4LSNA 3HPGA 4DQSA 1R0AA 4O4GA 2D5RA 1XHZA 3LALA 4F3TA 3P5JA 4I2PA 5C42A 5HROA 3HK2A 1SL2A 3I0SA 1LWFA 4CEZA 2D0AA 2FBVA 4CF9A 5HBMA 4HUGA 1Z25A 4CHYA 1SL0A 2BDPA 2HW3A 1RT4A 1SV5A 3KIOA 4N56A 3RMDA 1J5OA 1QTMA 3MAQA 3ZT0A 1REVA 4DMNA 1YT3A 3DRRA 4N47A 1JLEA 3NH0A 3B6PA 4M3XA 1HRHA 2G8IA 1VSKA 3L2VA 2X78A 4CEAA 3SYZA 3NGYA 1RTIA 4N41A 4DLGA 2IS3A 4FZXC 4C8OA 3KKSA 4KTQA 3LWMA 2E4LA 3C95A 1VSHA 3HM9A 4DU3A 3SUPA 1L3VA 3SNNA 3MEGA 3KLIA 2ITGA 4F3OA 1DTQA 4F8RA 4J2AA 1WAFA 4KFBA 3AA4A 3K2PA 4DFMA 2DFFA 3SQ4A 3V4IA 1JLAA 1D9DA 1W0HA 3T3FA 2XY6A 4I9QA 2VG6A 1I39A 1S6QA 3PX0A 4CJVA 3NGZA 2HHVA 2RF2A 3OVNA 4DSIA 1NK7A 1N5YA 1KCFA 4BE1A 4DTJA 1VRUA 1FKPA 1YVUA 4CK2A 5J2NA 3SPYA 3ZSOA 2ZQBA 3RMCA 4FJXA 2OPSA 4AILC 3TAFA 4CEBA 3I8DA 4ZTFA 4KHSA 3AVNA 3SQ2A 2X6NA 3LAMA 4CGIA 2G8UA 3NE6A 4BDYA 4DS5A 4B9TA 2Y1IA 2HVIA 3MEDA 4DSFA 1NJXA 4AH9A 1NJYA 4GVMA 1NK5A 1KRPA 4FJ9A 1NK4A 3ZSXA 1HYVA 1VSMA 3FFIA 4OKJA 3C6UA 1UA0A 1W9HA 4E7JA 1CXQA 1VSJA 4KO0A 4IDKA 2O4IA 2E6LA 4FJ8A 4HTUA 3AVKA 4CHOA 4OPJA 4ZHRA 4CJUA 3SCXA 4FW2A 5HRRA 4EZ6A 3HO1A 3OYMA 4G1QA 4KPYA 4JLHA 5C25A 4FJ7A 3AO4A 3LPTA 3DLRA 4WE1A 3T1AA 3DM2A 3HYFA 1ZBHA 3L3UA 4HUFA 4DU1A 1C0UA 3O4NA 1WAJA 3RTVA 1IH7A 3V1OA 3K5LA 4LH5A 4B8CA 1IKWA 3OYEA 4DSLA 4CGDA 1ZBFA 4KI6A 2RPIA 4M41A 3QIPA 2OZMA 1TKDA 4J2EA 1RBTA 1BQNA 4DG1A 5HRPA 3CG7A 4FJJA 3AVMA 4DSEA 3AVBA 1BCMA 2P5OA 3K5NA 4RW9A 1U49A 2D0CA 5J2MA 1WLJA 3DRPA 3SUNA 1ASUA 3EZ5A 3QEPA 1JLFA 4CIGA 4Q0BA 4HVJA 3V9XA 4E7LA 4HUEA 1KVAA 3BDPA 4CF0A 1NKEA 2HB5A 4CEEA 4Z4FA 3L3VA 4AHCA 4CJKA 2VWKA 3NDKA 3S9HA 4W5TA 1RT5A 2DY4A 4CF8A 3HPOA 4BDZA 1KVBA 1O1WA 2HMIA 2B6AA 3VQPA 4CEFA 2NUBA 1VSEA 2ZE2A 3QO9A 4O0JA 4BWMA 4B8AB 1BHLA 2Z1JA 4OKKA 3LANA 3P1GA 1GOBA 5KI6A 5KRSA 5E41A 3TWHA 3PV8A 3OYBA 1QSSA 4O0IA 1KFSA 5CZ2A 1FK9A 4PY5A 4CGHA 4B9MA 4KB0A 2Q3SA 2XRIA 3A2FA 4CK1A 3VQQA 4CIEA 5KGXA 3AVJA 4CK3A 1TK8A 1KSPA 3VA0A 2G8HA 4FLUA 4M3ZA 1TVRA 3B6OA 3P83D 4YNQA 1S1UA 5SZTA 4F2RA 4KREA 3E01A 5DMRA 1BI4A 4CHNA 4CJLA 3IS9A 1XC9A 4FM1A 4ELUA 4F2SA 4DFPA 4CECA 4N5SA 2QXFA 3CFRA 4NCAA 4M42A 4QOZB 2HHTA 1IKXA 3OYFA 3NAEA 3F9KA 2XHBA 4BE0A 3C94A 3VQEA 4FLTA 4DTMA 3QEIA 3SQ1A 3ITHA 3V9SA 1SKWA 3RR8A 2OA8A 1WSJA 4CIFA 3WNHA 3IG1A 1RT6A 4I7FA 3KLEA 4JRQA 4OKEA 5HLFA 4M3TA 1X9SA 5J1EA 4OJRA 1RDDA 1U04A 3LZIA 3ULDA 1T05A 4CJRA 4C8LA 3HP9A 1L3UA 3SUQA 4W5NA 4CFCA 1EX4A 1S6PA 1HQEA 2RN2A 3DOLA 3V1QA 1ZBUA 4L8RB 3S3MA 4FLWA 3OYDA 4FLXA 3U3YA 1Z26A 2GV9A 3AO3A 5EU7A 3LZJA 4EZ9A 1A5XA 2F8TA 1X9MA 1QS4A 2DTUA 3DMJA 2LSNA 3S3NA 4E7HA 1LW2A 2ZD1A 2OPQA
chains in the Genus database with same CATH superfamily
4DF4A 3THXA 4A5AA 1S1WA 3ZSVA 1B9FA 2ZJPL 3OYAA 3GG4A 4E19A 4YFUA 3AO5A 4TSXA 3BGRA 3G10A 3F73A 4IOAL 4PL8A 4OPHA 4K25A 3C6AA 4M3UA 3CCMN 2W40A 1QQMA 3AVFA 3FLCO 5ADXH 3HVRA 2YNHA 1ZYQA 1RT1A 3NFAA 4IG3A 4A2BA 1MDUB 2O8BB 4CZHA 4BC5A 2NRRA 4CJWA 2BTFA 4BWJA 1NK0A 3K9JA 4M3YA 2PBDA 1MU2A 3MXIA 3VESA 2D0BA 2WC9A 4MFBA 4H8KA 2KZMA 1B92A 3NF8A 4BC3A 4CEQA 2QWRA 1UA1A 2YHYA 2A1SA 1NK8A 1NMNA 1C0TA 4JKDA 4KHWA 3E1YA 1L5UA 3KD5E 3U9ZA 1ZBIA 4CJ3A 4BG8A 1CZ9A 1QQOA 2R7YA 3FZMA 2DFEA 1S22A 1OH6A 1M1KO 3HM8A 4LFAK 1FKOA 1HYZA 1S9GA 1IV0A 2OANA 2I5JA 5F0XA 1NLVA 4ILJA 4C8KA 3TR8A 3IDHA 2ZM6K 1Q8IA 4B9UA 3BF1A 4H4OA 1VSLA 1ITGA 1BI4B 5BR8K 4FCYA 4E1JA 3LAKA 3RWUA 2ZJQL 3DLGA 3HP6A 3RVCA 4B3TK 3CQ8A 1XWLA 4HHTA 3CM6A 2IC3A 3O4QA 1JLCA 3CPWM 3G71N 4O44A 2QWLA 4KAZA 1QSLA 4OPAA 1NOZA 4WQ5C 3NGIA 4ISEA 4FLVA 1K9MO 2QKBA 3CC7N 4R79A 1K8KB 1U48A 4MDAA 3DWLA 5AQGA 3ZEUA 4FWQA 4IKFA 4DQRA 4U7BA 4LFCK 1RDCA 3LDSA 4EIAA 5FRNA 2B4JA 3OBYA 1N32K 3O3GA 4BRKA 4Y1CA 3DXKB 5BPNA 3ALYA 4I6MB 3VF2A 4ID5A 4KKOA 4EP5A 5C0YA 3TI0A 4FJMA 3PUFA 4JV5K 2YNGA 3O6WA 2Y1JA 5KPTA 1KAYA 3DLLL 4OO1J 1UWBA 3DI6A 4NXMK 4WYBA 2QK9A 1RNHA 1WNSA 3CC2N 1BIZA 3C65A 3PX4A 1D4XA 4JRPA 4X65K 3G4SN 1IO2A 3AVLA 1FXXA 4ELVA 1ZC6A 3DYAA 4JHDA 4E0DA 2OTLN 3TTCA 3KLFA 1KLMA 4M3RA 4B1UB 2WOMA 3VQ9A 3OS2A 3CM5A 2I7NA 3OYHA 5AZJA 3U3GA 4E1NA 3JYTA 2Z1HA 2VG5A 3CJ7A 3IFRA 2UUBK 1F21A 3KD1E 2HNDA 2QTDA 3DAWA 4JN4A 1T3VA 4YHHK 4PHTX 2ASMA 5C2DA 2HHSA 2OPRA 1Q82O 1T6DA 2X74A 3AY9A 3NCIA 3OYCA 3D45A 3T69A 2NRXA 3ULEB 2IOCA 3R1XA 5HL7L 1WBBA 2NRVA 2G8FA 1SL1A 4IJAA 4IO9L 1T03A 2Z1GA 1NK6A 4EP4A 4RG8A 3RMAA 1RTHA 4IFEA 1X3MA 4BRLA 2Q97A 1N6QA 3O8MA 3KWGA 4A57A 3OJSA 5AQVA 4DTNA 3WNEA 5BR9A 3SQ0A 4KI4A 4MQ3A 2P9LB 4E1MA 2HHHK 4FW1A 4KBOA 2EHGA 4FYDA 3H1QA 1HPZA 4M7XA 2JLEA 1D5AA 2UYTA 3IAYA 3BUZB 3I0RA 4DHYA 4KHUA 3L2QA 2P9NA 3AO2A 1QQNA 4U67L 1S5JA 3EL2A 1LAWA 3VQ7A 3LWLA 2D0OA 2Q2RA 1I3AA 2D0PA 1YAGA 1NKBA 4CJFA 1EP4A 2UXCK 1SKRA 4FJ5A 3TSPA 2HOEA 1TYQB 3BEXA 2P51A 1ASWA 5EVZA 4CGGA 1Q18A 5AJ3K 3QMLA 2CGKA 4DTOA 2G8KA 3DRSA 3HRGA 1S1XA 5BREA 3SZ2A 5I3UA 3O9UA 4QS9A 1WBDA 2IDOA 4F4KA 4LF9K 4BR0A 3DLHA 4JS4A 5AQHA 3T1YK 1U47A 3M8QA 1LV5A 4K43A 3HPGA 3M5RA 2UU9K 3DXMB 4B1XB 4F3TA 4BC4A 3P5JA 5C42A 3H6EA 2V52B 1H1VA 4CEZA 5AQKA 3U9DA 1Z25A 2BDPA 1SV5A 3VENA 1REVA 4DMNA 3DRRA 5H1SQ 1G99A 4H0XB 1HRHA 1WOQA 1VSKA 4CEAA 1DT9A 3KVGA 3CJAA 3LL3A 3LWMA 3SUPA 1JCGA 3NVKA 2ITGA 4J2AA 1WUAA 3WQUA 1JLAA 3W3DA 3CCJN 4AM6A 2HHVA 4LF5K 1NK7A 4BE1A 4M7YA 2ZQBA 4CZJA 3KZBA 5EOYA 3E9OA 2G8UA 4DS5A 4B9TA 1QHAA 1NJXA 4GVMA 3O9SA 3HBTA 1QZ5A 3WXIA 1VSMA 4OKJA 1W9HA 4E7JA 1CXQA 3AARA 5IT9O 4KO0A 2QWOA 4BVOA 4FJ8A 1DEJA 4CHOA 4BRPA 2FSJA 4OPJA 4ZHRA 1HNZK 4CJ7A 4KPYA 1GLFO 1NGDA 4CZLA 3WXLA 2NRWA 3DLRA 3DM2A 4HUFA 4DU1A 1WAJA 1DKGD 1IH7A 3O9TA 3V1OA 4B8CA 1IKWA 1GLDG 3ENBA 4DG1A 4J2EA 4H5TA 3D2FA 4FJJA 2P5OA 3AVBA 4RW9A 3UKRA 3A8YA 1YHQN 3SUNA 1ASUA 3EZ5A 3WEEB 4JI5K 4CIGA 3VGKA 5C12A 2VGNA 1YJ9N 2GUPA 4GNIA 4AHCA 3S9HA 4CF8A 2CH6A 1O1WA 1S72N 2B6AA 3VQPA 5AQIA 3FZHA 2ZE2A 4IOCL 4O0JA 4OKKA 3PV8A 3LANA 2HF3A 1NBWA 4PY5A 3UKUB 3O1WA 5JMVA 1KSPA 4DSJA 3AVJA 1TK8A 5EXWA 5IWAK 1YXQA 2E1ZA 5DMRA 2QXLA 3IS9A 5AR0A 4NB4A 4DFPA 3CFRA 4QOZB 2QXFA 1U2VB 4BE0A 3NAEA 3QEIA 4DQIA 1BO5O 3SQ1A 1HNWK 3ITHA 3V9SA 2UXDK 1WSJA 4CIFA 1NJIO 3WNHA 4DR5K 4OKEA 2YCHA 1X9SA 3O5BA 2A41A 4X66K 3MWPA 3HP9A 5CE3A 4C8LA 4W5NA 4BC2A 2RN2A 3V1QA 3SAHA 1TUYA 3LZJA 5DM7L 3S3NA 2KKZA 2ZD1A 3A0IX 4A61A 4DV2K 4YY3K 2RE2A 4FJKA 4BQLA 2IAJA 1P8ZA 3U6FA 5LMUK 2YNFA 4RW7A 1OH5A 1YVNA 4Z0UA 1QSYA 4K8XA 3C6TA 3MDQA 2ATQA 4Z4CA 4JI6K 3O3FA 3VEOA 4KV8A 3ZT3A 5C15A 3CCRN 2IVNA 1XI1A 2B5JA 3SV3A 5J2QA 4BY9C 3IKMA 3QLHA 4B1YB 5JVGL 1RDBA 4DV7K 4FZYA 1SZ2A 4DTUA 1IG8A 3M1FA 1NGGA 4JD2A 1XMOK 2VWBA 3W0LA 2E6MA 2KQ2A 4FK0A 4FXDA 4WQ5A 2O8DB 1KXPA 5CR4A 3L0QA 1JKHA 3VOVA 2ZF5O 3GBTA 1Y64A 1U4BA 1NM1A 3D2EA 1DGKN 3LDQA 5C10A 2PZSA 3V9ZA 3G0ZA 1J54A 1VSFA 4NO7A 3C7NB 3VEXA 3QFUA 2A1RA 4FWRA 3V81A 1GLAG 3LM9A 3ZSZA 2XO7A 1JXBA 4FK4A 2OCEA 3V9WA 4AHTA 1BCOA 3TAGA 4DWIA 2Z1IA 3VGMA 4OLAA 4W5RA 3AO1A 4CBWA 2ASOA 2CH5A 3FFKB 3CMEN 5C2FA 3AVGA 3EO3A 4DV4K 3NF9A 4J8FA 4FOIA 1C1CA 1YF5L 1SQKA 4FVUA 3ATUA 1HR0K 5BRDA 3QNOA 4C1NK 4YOXA 3L8BA 1HYSA 4AHRA 3K9KA 5M1NA 3OYIA 4OGCA 3TAMA 1C6VA 1YIJN 5DM6L 1Q7YO 4YDUC 5BN8A 4J2BA 2YX6A 2O8CA 2AJQA 1RCHA 4CGJA 3TAPA 3AA2A 2F7TA 1OH7A 3KKRA 3THXB 3HPHA 3SBTA 1X1PA 4BRHA 2BGGA 1ZBSA 3SMPA 1JLQA 2A6AA 2QM1A 4A59A 1OKJA 2IVOA 4OGEA 2YHAA 4M45A 1BL3A 5LL6Z 3I55N 3PO5A 3WNFA 1RT3A 4LY7A 3TABA 1NJWA 4FLYA 1LW0A 3UE5A 2E2NA 3VQ5A 3CD6N 3ISNC 1BISA 2OPPA 1K73O 3TANA 4CJEA 3MN6A 4IFVA 2P9UA 3HOSA 4CZFA 3THWA 3A5NC 1ATRA 2ITMA 5JS1A 1RDWX 3EYZA 1EWQA 3M8RA 4B3OA 5M1QA 4LSLA 3VTIA 3QNNA 1EKEA 2QKKA 2HF4A 3AVAA 1BQMA 5I42A 5D3GA 4WQ4C 1VK0A 3TAEA 5EX5A 3CPEA 2P9IA 3PO4A 4HCBA 3CJCA 4CJ5A 3HOTA 4DUYK 1M90O 2HNZA 3J7AP 1XQSC 2ETJA 1XNRK 2KW4A 1CXUA 4YOUA 2Q0RA 3SAFA 4CGFA 4QCLA 4JKBA 3MN7A 3SV4A 3ZX3A 1KAXA 3QBWA 1J53A 4IEEA 5CYQA 5GAEP 4KB1A 5AQUA 3VN5A 4DR3K 3RMBA 1QE1A 1WSEA 3TARA 1VQKN 4KHNA 4E7KA 3FR0A 3O3HA 1NGIA 1VSDA 1JCFA 1GOAA 3J81O 1A5VA 4CFAA 3TAQA 5FROA 4DU4A 1YJNN 4FOEA 1TK0A 1IG9A 3BP8A 4NYFA 3NH1A 3OJUA 2FC0A 1JLBA 4KRFA 3MXMA 1VQ4N 3H3NO 4KHPK 4JI8K 2FBTA 3NF6A 5AQYA 3AAPA 1RBVA 3D0PA 4ZTJA 1C0MA 3WQTA 4NYNA 3V1RA 1W97L 3SLCA 1SUQA 3ZEUB 4DR1K 2E88A 4FWKA 4PQUA 4B9VA 1SKSA 4DQPA 4CJPA 3CJ1A 4CJTA 3MXJA 2YJFA 3VEVA 4IFYA 3K5OA 1NGCA 4IDHA 5GAGP 3LDLA 2NRHA 3VA3A 2JWLA 1WN7A 3A5LC 4CE9A 3MWTA 1S9EA 3VMFB 3ZCMA 4CZMA 1YI2N 4Y1DA 1K6YA 1SAZA 4JK8A 2W6LA 4AHUA 4PA1A 3SI6A 5HOOA 4LC9B 4GY2B 2YHBA 3F2KA 3SUOA 1GLBG 1U45A 3J8AA 5AFUA 3F5TA 4YORA 3QFPA 3L2RA 3K57A 3A5MC 3HI0A 4AHVA 4IEIA 4CF2A 4JKFA 2ZJRL 3IRXA 3SBGA 4JHDB 3RSEB 1XHZA 1SL2A 4OX9K 3I0SA 4JI7K 5F2RA 3KIOA 3RMDA 3KK7A 3ZT0A 1K8KA 1YT3A 4N47A 1JLEA 5AZJB 3B6PA 1Q81O 2G8IA 2X78A 3NGYA 4N41A 2IS3A 4FZXC 3EE8A 4DU3A 1L3VA 3SNNA 3MEGA 3JAMO 5GIOA 4FWSA 1NGBA 3T3FA 2XY6A 5F1XA 1S6QA 4CJVA 5M1KA 4AM7A 4DTJA 3MCPA 4BR9A 4NXNK 4B3RK 5M1FA 1FKPA 4XH4A 1P90A 3SPYA 3ZSOA 4AILC 3TAFA 4CEBA 3I8DA 1VQNN 3EKSA 4B1ZA 4CGIA 3NE6A 2HVIA 3MEDA 4EHTA 4DSFA 1MA9B 4AH9A 1KRPA 3ENOA 4FJ9A 5CHIA 5AQJA 1HYVA 2IIRA 3CETA 1VSJA 4MLHA 2O4IA 3CMAN 2VQFK 1YJWN 4RCHA 1R59O 3OYMA 5C25A 3OHRA 4WE1A 3G25A 3WUHA 3HYFA 3L3UA 1C0UA 3PSFA 4IZ9A 3TU5A 1IBKK 4DSLA 1NGHA 3O1BA 4H5VA 2OZMA 1IJJA 1TKDA 4BGAA 1RBTA 1BQNA 4DR4K 4DKWA 1BCMA 4XH5A 2D0CA 3ULEA 4KH6A 1KD1O 1JLFA 1VQLN 3V9XA 4E7LA 4HUEA 3OBWA 3TSUA 2DY4A 1MWKA 1KVBA 3CXCM 2Z1JA 5KRSA 3ZYYX 4B9MA 4KB0A 4YOTA 3VEYA 4CIEA 1VQPN 3VA0A 4FLUA 1TVRA 5AZIA 4F2RA 3I56N 1S1UA 2P9LA 3PIPL 4CHNA 4FM1A 4ELUA 4F2SA 4M42A 3PLAA 2HHTA 2VGMA 3F9KA 2GWKA 3RR8A 3HTVA 4X64K 2OA8A 3IUCA 1IBMK 5AQQA 3MCAB 3KLEA 4JRQA 4YOWA 4BRDA 5HLFA 4OJRA 1L3UA 4BVPA 1EX4A 3DOLA 4L8RB 3S3MA 3AO3A 3VEWA 1NGAA 2Q31A 2DTUA 2LSNA 2P9KB 3CCEN 2OPQA 4GVEA 5M1PA 1ZBLA 3KK3A 4PKIA 1Q86O 1NOYA 1IKVA 2PFUA 4CCHA 2FLOA 3THVA 4CJQA 1HNIA 1CZBA 2KTQA 1DLOA 1XUPO 1WSHA 4Z4HA 4O8KA 4M63C 4GKKK 5A2QO 2O8EA 1VQ9N 3C0BA 4KTZA 2E2QA 5AQOA 1VHXA 3AA5X 3HXMA 3WXJA 4YOYA 4CBXA 2E2PA 5CZ1A 3OS1A 1J9AA 3VF6A 4AF1A 1HUXA 3J80O 3P4IA 3ZLJA 3QEVA 3CI5A 1C1BA 1NU0A 3J7YP 2XY8A 2DFHA 4RWTA 3P38A 3D2FB 4E7IA 3ZSQA 2F96A 4FK2A 3UKRB 1WSGA 4ICLA 2PYJA 4MO4A 1ATNA 3L6QA 4YDUA 5FRMA 4FZZA 4BGBA 2P1JA 2E2OA 3CYMA 3MN5A 4ISGA 3KLGA 2XY7A 1N36K 3ZETB 1N8RO 1ASVA 2P9SA 5CY4A 1Y97A 3ATVA 3QERA 3QEXA 4K0KK 4WCEL 4CFDA 2PY5A 3LDNA 3OA9A 2E5LK 3O9QA 4BRMA 2UUAK 2YKMA 5HRNA 1JCEA 1RGIA 4BQZA 4CJ4A 3KHYA 4E89A 2D1KA 4K8ZA 1KC8O 1V4TA 3SMSA 1WSIA 1N33K 1TL3A 4M3WA 2YKNA 3QDKA 3D6RA 3V6DA 3ZSYA 4ID1A 1KFDA 3OYLA 4PWDA 4IWVA 4DF8A 4H0PA 3CCQN 2YV0X 5KQDA 4FJHA 3P31A 4CVNE 4XIUA 3JS6A 1WSFA 1L3SA 4WQ4A 3ZX0A 4JKEA 4J2DA 1J5EK 4FM0A 1IBLK 1GLLO 4GV9A 3RR7A 2OYQA 3QICA 2VG7A 1ESVA 1NWKA 1HLUA 4H4MA 3CCUN 2W42A 4RW6A 1ILYA 4JK9A 4OPKA 3OYGA 3WXMB 2HBLA 3K59A 2O8FB 1W7AA 1BU6O 3R6MA 5SWMA 4H0TB 1C0FA 2WBNA 4C8MA 5C24A 1E4FT 5AQNA 4DFKA 3SJHA 4R5PA 3QETA 1JJ2M 4LFBK 4FWLA 3OYJA 3C6HA 3VQCA 5J2PA 1OH8A 3ASMA 2A5XA 4PL7A 3NMUA 4FPAA 3ZSRA 4GW6A 3FGUA 1U2VA 2XY5A 2P9PA 1I94K 4XEIA 2BH1A 1RBUA 3WNGA 4HTLA 5FPNA 5KQ8A 2NLXA 1KTQA 3TTDA 1VQ7N 3VF4A 4EFHA 5LY3A 5GIPA 2D4WA 4JK7A 2AP1A 2VCPA 5FPDA 3EKUA 3KLHA 3BF3A 5TKYA 3R8EA 3JXUA 3PX6A 3D2EB 4H0YB 3QIOA 4OVLA 1JLGA 4BREA 1DTTA 4DV1K 4DTXA 3S3OA 5AQZA 3CJ9A 3KTQA 3FE1A 5AQMA 3CJBA 4KH4A 3OYKA 4CF1A 1RBRA 2BANA 4LF6K 4JKGB 4CD3A 5AQPA 2FBXA 3CIPA 1VQ5N 3EEQA 3AVCA 1BIUA 3M8SA 3HL8A 4WFBL 3THYA 2VYPA 1N34K 4WFAL 5ADXA 4BG9A 1HMVA 3SPZA 1T7PA 4X62K 2OTJN 4NLCA 1GLCG 4B08A 1TKXA 1W2BM 1LCUA 4Q5VA 3AAQA 2YHWA 1QQCA 4CEOA 2A3ZA 2HHQA 3QBXA 4ILGB 1EXQA 4NCGA 3J7ZO 1EQYA 2CGJA 2HHWA 2QEXN 1QVFM 1RFQA 3MX2A 3ZT4A 4W5QA 2GUIA 5T7BA 3HVTA 2KFZA 4E3SA 2O8CB 3RRGA 4NCBA 3DJCA 3ZSWA 1C1AA 4FWMA 2X6SA 1YTUA 2A40A 1TGOA 3CQYA 5E26A 1EO1A 5BPMA 2KFNA 3WXKA 3LP3A 3EN9A 1RTJA 3K58A 3GE1A 5KTQA 5GINA 1TAQA 4FM2A 4L3QA 3NH2A 4H0VB 4PUOA 3VPZA 1TUUA 3LP1A 3MECA 4Z4EA 2P9UB 2HMPA 3LDPA 4JKAA 3THWB 3AV9A 3G6EN 2JGUA 3QESA 2BE2A 4CERA 4NLBA 3NF7A 5B8HA 2D5RA 3LALA 3M3ZA 3HK2A 4I2PA 5HROA 3HZ6A 4Z94A 4CF9A 1E4GT 3CERA 3T7ZA 4QS8A 4HUGA 1SL0A 3I33A 1RT4A 4N56A 1QTMA 4JKCA 2P9IB 4IJNA 3L2VA 1RTIA 4DLGA 2YHXA 4KTQA 4C8OA 3KKSA 3HM9A 2E4LA 2H3GX 1VSHA 3F9MA 4BRIA 2VQEK 1QVGM 4YOVA 4F3OA 1DTQA 4F8RA 4JKHA 4KFBA 3FZFA 3U8XA 4DFMA 1GLEG 2DFFA 2GX9A 5LMNK 3V4IA 1D9DA 2V7ZA 4ISFA 3FZLA 2VG6A 4I9QA 4B9QA 3NGZA 4DSIA 2GTDA 1E3MA 5BPLA 1VRUA 4CK2A 5J2NA 5LJWA 3RMCA 4K41A 1S3XA 3SQ2A 4MLEA 4EAHD 3O80A 2X6NA 4BDYA 5AQLA 5M1OA 2HBMA 5MLCQ 1NJYA 1NK5A 4DV6K 1NK4A 1J6ZA 3ZSXA 3MK6A 4IDKA 4HTUA 3AVKA 3GDQA 3CCLN 2E1YA 3E66A 4FW2A 5HRRA 3HO1A 1Z05A 3VEZA 4JLHA 2GEMA 4FJ7A 3AO4A 5ELZA 3LPTA 2CGLA 2O8BA 4RTFD 3CHWA 4LH5A 2A42A 4CGDA 3VGLA 4KI6A 4M41A 4CZEA 3CG7A 2QA4N 1WLJA 3DRPA 3QEPA 2QWPA 4HVJA 3CF5L 1NKEA 3HSCA 3L3VA 4CI6A 1OVYA 2VWKA 3NDKA 3MN9A 4GV6A 4BRGA 1FJGK 4FWPA 4BDZA 2HMIA 4CEFA 2PAVA 4JI1K 3ID6A 3M6GA 3QO9A 3A5OC 4BWMA 5I9EB 4B8AB 5KI6A 3P1GA 5E41A 3B8AX 3TWHA 1GLJO 3OYBA 1QSSA 4O0IA 1KFSA 5CZ2A 1FK9A 3MX5A 3A2FA 3VQQA 4YNQA 4DQ8A 5SZTA 3H1VX 5JVHL 1BI4A 4CJLA 1ATSA 1IKXA 4FPBA 1X3NA 4H5WA 3C94A 3VQEA 3U4LA 1CLQA 1VQON 1XMQK 3IG1A 2FSNA 1YUWA 4BR2A 4PKHA 1BG3A 3VETA 1RDDA 3AGKA 3LZIA 3ULDA 4IOXA 1S6PA 5AQWA 1Z6RA 4FLWA 2FXUA 3ZX2A 3I8BA 2QI2A 2GV9A 5EU7A 3L4QA 4HWIA 1X9MA 1QS4A 4DR7K 2F9TA 2GELA 1LW2A 1I39A 1T8EA 3WT0A 3L2WA 3VQAA 3DXKA 2QWNA 4LF4K 2WTUA 1HKCA 4FJLA 3CFPA 5EY4A 4IG0A 4BACA 4I6MA 2YNIA 4N76A 1NGJA 2BUPA 4CFBA 3ENHA 3NHGA 4A2AA 1RBSA 1D8YA 3LP2A 4BDPA 2OZSA 3OW2M 3BZKA 1VSIA 4CD1A 3RSEA 4DV5K 1VRTA 4DFJA 4BRNA 1LOTB 3ZT1A 4CHQA 5KPRA 5BRHA 3DLKA 4WFNL 4DTSA 4O5BA 3EZWA 4BR4A 3HSTB 4OLBA 1L3TA 4KHQA 4WF9L 4CEDA 5GADP 3PY8A 3E9LA 4CJSA 3VQ4A 1MWMA 1BGXT 3NVMA 4JI3K 1V4SA 1LWCA 3IMXA 5HP1A 2P9NB 5HRSA 3DLEA 4CHPA 3PIOL 4FJGA 4KHYA 1BDGA 4CHZA 3OTOK 1HQUA 1FW6A 1IKYA 2GBZA 4HCCA 1XHXA 4JI0K 3QEWA 2F8SA 5JLHA 3BZCA 4W5OA 3O4WA 4GKJK 4CBUA 4FWOA 2EX3A 1NKCA 4DTRA 5GAHP 4KTWA 1Q9XA 4FJIA 3VQDA 1TKZA 4CZKA 5AZIB 3ID8A 2I7PA 4BRQA 1D9FA 3S41A 1RT2A 5AFUH 2KLAA 4DTPA 4I9LA 1RILA 4C8NA 4B3MK 3JSMA 1HX1A 1YTAA 4DR2K 1HNXK 1UAXA 1X9WA 4RW8A 3M8PA 3TPQA 4LH4A 2QW9A 2DPNA 3LPUA 1NMDA 1XNQK 4BRFA 3KK1A 4B9SA 3L4IA 4QAGA 2KHOA 3K5MA 4DSKA 4B1WB 3LDOA 4O5FA 3T19A 4IXCA 3VQBA 2VWJA 1A5WA 2HBJA 4MDBA 2FBYA 3KJVA 3KWIA 4FLZA 4C23A 1RT7A 1JL2A 4E7HA 1LAVA 1WB9A 1JL1A 4LD0A 1TYQA 2PYLA 4FJNA 2NRZA 1EETA 5CYMA 2O8EB 5KGWA 1BUPA 2Q1NA 2G8VA 1KVCA 1UOCA 3E9PA 4H0OA 2FF6A 3Q7BA 3HT3A 4CZGA 3DOKA 3DXMA 2EWSA 1QZ6A 2WFBA 3EE9A 1HNVA 3QINA 5FDLA 3N4QA 1T6CA 4RW4A 4FVMA 2W6KA 4O55A 1TL1A 1VQ8N 4QS7A 2P9KA 5E84A 2O4GA 3CFOA 4V19S 3L2UA 1B9DA 1BWFO 1GOCA 1Q9YA 2V7YA 3GL1A 4DS4A 4F9OA 2P9SB 4BR5A 3VQ6A 1RDAA 4LF8K 2HHXA 1HJRA 5AQRA 2NZTA 3BY5A 3OS0A 4XH1A 2HNYA 4IBNA 3EY1A 3V9UA 4LF7K 2ZGZA 3CCSN 2IGIA 1VQMN 3Q7CA 4JAXA 1U6ZA 1VAZA 4O8UA 2HHUA 3CQXA 4BRAA 1NJZA 4BE2A 3H08A 1TK5A 2HVHA 5AQTA 2YI1A 4UQGA 3RRHA 4DLEA 2RHKA 1RTDA 4Z4GA 4Y0WA 4JEPA 5BN9A 4AHSA 4A5BA 4CW7B 2NRTA 2P5GA 3SJJA 3AVHA 5KRTA 2KZZA 1T44A 1LWEA 2YJEA 4CESA 3OYNA 2F9WA 1NGFA 3AA3A 1CZAN 1XC3A 3KK2A 1KAZA 3O08A 3ZT2A 1NK9A 3UIQA 2Q36A 2UXBK 4GMJB 3CC4N 2AA4A 2G8WA 3VQ8A 3ZETA 5KPZA 2QWMA 3DLBA 1JXEA 1TAUA 3MEEA 1QHTA 1K8AO 2RKIA 3LM2A 3WEEA 4B9NA 4B1VA 1TV6A 3NBPA 4JS5A 5JS2A 4JYAK 1KLNA 4Z4IA 4BRCA 2ZWHA 4ELTA 2HBKA 4DQQA 3AVIA 3P39A 2WONA 5BRFA 3OY9A 4DR6K 3H3OB 4I2QA 3LP0A 1TKTA 1S1VA 1G15A 1S1TA 2P9PB 5K14A 3TTFA 3UKUA 3HJFA 5DK5A 3N4PA 1BA0A 4B9LA 4LSNA 4DQSA 1R0AA 4O4GA 3SAGA 1KQSM 1LWFA 4JI2K 2D0AA 2FBVA 5HBMA 4CHYA 2HW3A 2GWJA 4BR7A 1YITN 1J5OA 2V51B 1HJOA 2ZGYA 3MAQA 2QWQA 2HSTA 4KH5A 4M3XA 3NH0A 3SYZA 4JD2B 4C1NI 2F4VK 4DCHA 2JWKA 3C95A 2ASPA 3KLIA 5JLFA 3R3LA 1WAFA 3AA4A 3K2PA 2O8FA 3H45C 3D7EO 3SQ4A 4FWNA 1W0HA 5FPMA 1NNEA 3PX0A 2RF2A 3OVNA 5FPEA 1N5YA 1RDUA 1KCFA 3CCVN 3THYB 4H5RA 1YVUA 4IO8A 4MO5A 4FJXA 2OPSA 4ZTFA 4KHSA 3K0SA 3AVNA 4FO0A 3LAMA 4CZIA 5TKWA 5LJVA 1NG9A 2Y1IA 2J4RA 4DB3A 1BA1A 4DV3K 4BROA 3FFIA 1UA0A 3C6UA 3PSIA 5AQFA 2E6LA 3VTHA 4UY8O 3FZKA 4DV0K 4CJUA 3SCXA 4EZ6A 4DUZK 4G1QA 3UB5A 4PKGA 3TSQA 3T1AA 1ZBHA 4JNEA 3O4NA 3RTVA 3K5LA 3OYEA 4JI4K 1ZBFA 2Q0UA 2RPIA 3QIPA 2O8DA 5HRPA 1X9JA 4FSVA 1SS6A 4FL9A 4AQYK 2FF3B 3AVMA 4DSEA 3MMVA 3K5NA 4H5NA 1U49A 5J2MA 1NGEA 4JKGA 4Q0BA 1VQ6N 1KVAA 3BDPA 4CF0A 2HB5A 4CEEA 4Z4FA 4H03B 5FLXO 4K42A 4CJKA 4ILHA 3T1HK 4W5TA 1RT5A 1HKGA 3HPOA 3H46O 5AQSA 2NUBA 1VSEA 1HKBA 3C7NA 1BOTO 4A62A 1BHLA 1GOBA 4GV3A 1C0GA 1EWRA 4CGHA 2Q3SA 2XRIA 1ZXOA 4CK1A 5KGXA 4CK3A 2G8HA 4M3ZA 3B6OA 3P83D 2NNWA 1OVQA 3E01A 4KREA 1XC9A 3SK3A 3AGRA 2FSKA 4CECA 4N5SA 4NCAA 3VERA 3OYFA 4FLTA 4DTMA 2XHBA 1SKWA 4B3SK 2UUCK 4I7FA 1RT6A 2E20A 2W41A 3R9PA 4M3TA 1HPMA 5J1EA 3QB0A 1U04A 1T05A 3O9RA 4CJRA 3SUQA 5JICA 4CFCA 1HQEA 2E8AA 4G9ZA 1ZBUA 2WUSA 1O13A 2IVPA 3OYDA 5AQXA 4FLXA 3U3YA 1Z26A 2F8TA 4EZ9A 1A5XA 3GOIA 3DMJA 4EHUA
chains in the Genus database with same CATH topology
4DF4A 1T8EA 3L2WA 3VQAA 1ZBLA 1S1WA 3KK3A 4FJKA 1NOYA 3ZSVA 1IKVA 4FJLA 3CFPA 4CCHA 2IAJA 4IG0A 4BACA 1B9FA 2YNIA 3U6FA 4CJQA 4CFBA 3THVA 4N76A 3OYAA 1HNIA 1CZBA 4E19A 2KTQA 1DLOA 2YNFA 3AO5A 4YFUA 4RW7A 4TSXA 1WSHA 3BGRA 4Z4HA 3NHGA 1D8YA 1RBSA 4BDPA 3LP2A 3G10A 4Z0UA 3F73A 2OZSA 1QSYA 1VSIA 4K8XA 1VRTA 3C6TA 4DFJA 4M3UA 4KTZA 2ATQA 4Z4CA 3AA5X 3ZT1A 3HXMA 3O3FA 4KV8A 3ZT3A 4CHQA 3AVFA 3HVRA 3DLKA 4DTSA 1XI1A 2B5JA 2YNHA 4O5BA 1ZYQA 5CZ1A 3SV3A 5J2QA 3OS1A 1J9AA 3HSTB 3QLHA 1RT1A 1RDBA 3NFAA 4IG3A 4FZYA 4OLBA 1L3TA 4DTUA 3QEVA 4KHQA 4CJWA 1NK0A 4BWJA 1C1BA 4CEDA 3PY8A 4M3YA 1MU2A 2E6MA 2KQ2A 3VQ4A 4CJSA 3MXIA 4FK0A 4FXDA 1BGXT 2XY8A 2D0BA 2DFHA 4MFBA 1JKHA 4H8KA 4E7IA 3ZSQA 2KZMA 1B92A 2F96A 3NF8A 4FK2A 4CEQA 1WSGA 1LWCA 4ICLA 2PYJA 5HP1A 5HRSA 1UA1A 5FRMA 1U4BA 4FZZA 2A1SA 3DLEA 2P1JA 4CHPA 1NK8A 1C0TA 4FJGA 4KHWA 4KHYA 3CYMA 4CHZA 1L5UA 3KD5E 3KLGA 1HQUA 1ZBIA 4CJ3A 2XY7A 3V9ZA 2PZSA 3G0ZA 1CZ9A 1J54A 1IKYA 2GBZA 2R7YA 1ASVA 1VSFA 2DFEA 4HCCA 1XHXA 1CLQA 3QEWA 2F8SA 5CY4A 1FKOA 1HYZA 1S9GA 1Y97A 3QERA 3QEXA 2A1RA 3V81A 4W5OA 4CFDA 2I5JA 2PY5A 3ZSZA 4C8KA 3TR8A 2XO7A 2EX3A 2YKMA 1JXBA 5HRNA 1NKCA 4FK4A 4DTRA 4KTWA 1Q9XA 4FJIA 3VQDA 1Q8IA 3V9WA 4B9UA 4H4OA 1TKZA 4AHTA 1VSLA 1BCOA 4CJ4A 1ITGA 4E89A 3TAGA 1BI4B 4DWIA 2Z1IA 4K8ZA 4OLAA 4W5RA 4FCYA 3AO1A 1WSIA 3LAKA 1D9FA 3RWUA 1RT2A 1TL3A 3DLGA 3HP6A 3CQ8A 1XWLA 3AVGA 4DTPA 3NF9A 4I9LA 4HHTA 3CM6A 2IC3A 3O4QA 1JLCA 1RILA 4M3WA 4C8NA 2YKNA 1C1CA 3JSMA 3V6DA 1YTAA 3ZSYA 4O44A 4KAZA 4ID1A 1QSLA 1KFDA 1NOZA 1UAXA 3OYLA 4PWDA 3QNOA 1X9WA 4RW8A 4DF8A 3M8PA 4LH4A 3L8BA 1HYSA 4FJHA 4AHRA 2YV0X 3OYIA 3NGIA 3LPUA 4XIUA 4FLVA 4OGCA 3TAMA 2QKBA 1WSFA 1L3SA 1C6VA 3KK1A 1U48A 4B9SA 4J2DA 4J2BA 4FM0A 4QAGA 4IKFA 3K5MA 4DSKA 4DQRA 3RR7A 2OYQA 2AJQA 2VG7A 1RCHA 4CGJA 3TAPA 1RDCA 3AA2A 3LDSA 3KKRA 4H4MA 3T19A 2W42A 4RW6A 2B4JA 3VQBA 5FRNA 2VWJA 3HPHA 1A5WA 1X1PA 2BGGA 3O3GA 2FBYA 4OPKA 1JLQA 4Y1CA 3OYGA 3KJVA 4Z4EA 4FLZA 3ALYA 3K59A 5SWMA 1RT7A 4OGEA 1JL2A 4ID5A 4C8MA 2YHAA 4KKOA 1LAVA 5C24A 1BL3A 1JL1A 4M45A 4EP5A 4LD0A 3TI0A 3PO5A 3WNFA 1RT3A 4LY7A 3TABA 1NJWA 3PUFA 4FLYA 4DFKA 1LW0A 2PYLA 4FJMA 4FJNA 1EETA 3VQ5A 2YNGA 5CYMA 4R5PA 3QETA 5KGWA 2Y1JA 3OYJA 3ISNC 3VQCA 5J2PA 1BISA 1UWBA 2OPPA 3ASMA 3DI6A 3TANA 2QK9A 1RNHA 1WNSA 2G8VA 3ZSRA 4GW6A 1BIZA 3PX4A 1KVCA 4CJEA 4IFVA 4JRPA 1UOCA 2XY5A 1IO2A 3AVLA 5JS1A 1FXXA 3HT3A 1RBUA 3WNGA 4ELVA 3DYAA 3EYZA 1KTQA 3DOKA 3M8RA 4B3OA 4E0DA 4LSLA 3QNNA 1EKEA 3KLFA 2QKKA 1KLMA 1HNVA 3AVAA 4M3RA 1BQMA 2WOMA 3QINA 3VQ9A 3CM5A 5FDLA 3OS2A 5I42A 5D3GA 1VK0A 3TAEA 4RW4A 4FVMA 3OYHA 3PO4A 4HCBA 4CJ5A 4O55A 1TL1A 3U3GA 4E1NA 3JYTA 2Z1HA 2HNZA 2VG5A 3KLHA 1F21A 3KD1E 2HNDA 3PX6A 2ETJA 2O4GA 3CFOA 3QIOA 1JLGA 4OVLA 1DTTA 2KW4A 1CXUA 3L2UA 1B9DA 4DTXA 3S3OA 1GOCA 1Q9YA 3KTQA 4CGFA 4QCLA 2HHSA 3SV4A 2OPRA 4DS4A 3VQ6A 2X74A 1J53A 3NCIA 1RDAA 3D45A 3OYCA 3OYKA 4CF1A 5CYQA 2HHXA 1RBRA 2IOCA 1HJRA 2BANA 4KB1A 2G8FA 3VN5A 3RMBA 2FBXA 3OS0A 1SL1A 2Z1GA 1T03A 1NK6A 1QE1A 1WSEA 2HNYA 4EP4A 3AVCA 4RG8A 3TARA 1BIUA 4IBNA 3M8SA 3EY1A 3HL8A 3V9UA 4KHNA 2IGIA 3RMAA 4E7KA 3O3HA 1VSDA 1GOAA 1A5VA 2HHUA 4CFAA 3TAQA 5FROA 1RTHA 1NJZA 4DU4A 4BE2A 3H08A 1TK5A 1N6QA 1HMVA 3RRHA 2HVHA 4UQGA 4DLEA 3SPZA 1T7PA 1RTDA 1TK0A 1IG9A 4Z4GA 4NYFA 4AHSA 3NH1A 3OJUA 2FC0A 4B08A 3OJSA 1JLBA 1TKXA 4KRFA 4DTNA 3WNEA 3MXMA 2P5GA 3SQ0A 4KI4A 4Q5VA 3SJJA 3AVHA 4MQ3A 5KRTA 2FBTA 4E1MA 3NF6A 1QQCA 4CEOA 2HHQA 4FW1A 2KZZA 2EHGA 4FYDA 1HPZA 1RBVA 3D0PA 1LWEA 2JLEA 1D5AA 4CESA 4ZTJA 3OYNA 3IAYA 1C0MA 1EXQA 3I0RA 4NCGA 4NYNA 3V1RA 4KHUA 1SUQA 3AA3A 2HHWA 3KK2A 3L2QA 3AO2A 3ZT4A 3ZT2A 1NK9A 4W5QA 2GUIA 3UIQA 5T7BA 4PQUA 4B9VA 3HVTA 2KFZA 1SKSA 4E3SA 4CJPA 3RRGA 4DQPA 4NCBA 4GMJB 1S5JA 4CJTA 3MXJA 1LAWA 3VQ7A 3ZSWA 1C1AA 3LWLA 4IFYA 3K5OA 2G8WA 3VQ8A 2X6SA 1YTUA 1I3AA 3VA3A 4DSJA 1TGOA 3DLBA 1JXEA 1TAUA 3MEEA 1QHTA 2KFNA 2RKIA 1WN7A 4CE9A 1NKBA 4CJFA 3LP3A 1EP4A 4B9NA 1TV6A 3NBPA 1S9EA 3ZCMA 4JS5A 1RTJA 5JS2A 3K58A 1SKRA 4Y1DA 1K6YA 4FJ5A 5KTQA 4DQIA 1KLNA 4AHUA 4Z4IA 4PA1A 2P51A 1ASWA 1TAQA 4CGGA 3SI6A 4FM2A 2YHBA 4ELTA 3NH2A 4DQQA 3AVIA 4DTOA 2WONA 3SUOA 4PUOA 1U45A 2G8KA 3DRSA 3OY9A 1S1XA 3SZ2A 4I2QA 5I3UA 3LP0A 3LP1A 3MECA 3L2RA 1TKTA 3K57A 1S1VA 1G15A 2IDOA 4AHVA 4F4KA 1S1TA 3DLHA 5K14A 4CF2A 3HJFA 3AV9A 4JS4A 2JGUA 5DK5A 3QESA 2BE2A 3IRXA 3M8QA 3NF7A 4CERA 1U47A 1LV5A 4B9LA 4LSNA 3HPGA 4DQSA 1R0AA 4O4GA 2D5RA 1XHZA 3LALA 4F3TA 3P5JA 4I2PA 5C42A 5HROA 3HK2A 1SL2A 3I0SA 1LWFA 4CEZA 2D0AA 2FBVA 4CF9A 5HBMA 4HUGA 1Z25A 4CHYA 1SL0A 2BDPA 2HW3A 1RT4A 1SV5A 3KIOA 4N56A 3RMDA 1J5OA 1QTMA 3MAQA 3ZT0A 1REVA 4DMNA 1YT3A 3DRRA 4N47A 1JLEA 3NH0A 3B6PA 4M3XA 1HRHA 2G8IA 1VSKA 3L2VA 2X78A 4CEAA 3SYZA 3NGYA 1RTIA 4N41A 4DLGA 2IS3A 4FZXC 4C8OA 3KKSA 4KTQA 3LWMA 2E4LA 3C95A 1VSHA 3HM9A 4DU3A 3SUPA 1L3VA 3SNNA 3MEGA 3KLIA 2ITGA 4F3OA 1DTQA 4F8RA 4J2AA 1WAFA 4KFBA 3AA4A 3K2PA 4DFMA 2DFFA 3SQ4A 3V4IA 1JLAA 1D9DA 1W0HA 3T3FA 2XY6A 4I9QA 2VG6A 1I39A 1S6QA 3PX0A 4CJVA 3NGZA 2HHVA 2RF2A 3OVNA 4DSIA 1NK7A 1N5YA 1KCFA 4BE1A 4DTJA 1VRUA 1FKPA 1YVUA 4CK2A 5J2NA 3SPYA 3ZSOA 2ZQBA 3RMCA 4FJXA 2OPSA 4AILC 3TAFA 4CEBA 3I8DA 4ZTFA 4KHSA 3AVNA 3SQ2A 2X6NA 3LAMA 4CGIA 2G8UA 3NE6A 4BDYA 4DS5A 4B9TA 2Y1IA 2HVIA 3MEDA 4DSFA 1NJXA 4AH9A 1NJYA 4GVMA 1NK5A 1KRPA 4FJ9A 1NK4A 3ZSXA 1HYVA 1VSMA 3FFIA 4OKJA 3C6UA 1UA0A 1W9HA 4E7JA 1CXQA 1VSJA 4KO0A 4IDKA 2O4IA 2E6LA 4FJ8A 4HTUA 3AVKA 4CHOA 4OPJA 4ZHRA 4CJUA 3SCXA 4FW2A 5HRRA 4EZ6A 3HO1A 3OYMA 4G1QA 4KPYA 4JLHA 5C25A 4FJ7A 3AO4A 3LPTA 3DLRA 4WE1A 3T1AA 3DM2A 3HYFA 1ZBHA 3L3UA 4HUFA 4DU1A 1C0UA 3O4NA 1WAJA 3RTVA 1IH7A 3V1OA 3K5LA 4LH5A 4B8CA 1IKWA 3OYEA 4DSLA 4CGDA 1ZBFA 4KI6A 2RPIA 4M41A 3QIPA 2OZMA 1TKDA 4J2EA 1RBTA 1BQNA 4DG1A 5HRPA 3CG7A 4FJJA 3AVMA 4DSEA 3AVBA 1BCMA 2P5OA 3K5NA 4RW9A 1U49A 2D0CA 5J2MA 1WLJA 3DRPA 3SUNA 1ASUA 3EZ5A 3QEPA 1JLFA 4CIGA 4Q0BA 4HVJA 3V9XA 4E7LA 4HUEA 1KVAA 3BDPA 4CF0A 1NKEA 2HB5A 4CEEA 4Z4FA 3L3VA 4AHCA 4CJKA 2VWKA 3NDKA 3S9HA 4W5TA 1RT5A 2DY4A 4CF8A 3HPOA 4BDZA 1KVBA 1O1WA 2HMIA 2B6AA 3VQPA 4CEFA 2NUBA 1VSEA 2ZE2A 3QO9A 4O0JA 4BWMA 4B8AB 1BHLA 2Z1JA 4OKKA 3LANA 3P1GA 1GOBA 5KI6A 5KRSA 5E41A 3TWHA 3PV8A 3OYBA 1QSSA 4O0IA 1KFSA 5CZ2A 1FK9A 4PY5A 4CGHA 4B9MA 4KB0A 2Q3SA 2XRIA 3A2FA 4CK1A 3VQQA 4CIEA 5KGXA 3AVJA 4CK3A 1TK8A 1KSPA 3VA0A 2G8HA 4FLUA 4M3ZA 1TVRA 3B6OA 3P83D 4YNQA 1S1UA 5SZTA 4F2RA 4KREA 3E01A 5DMRA 1BI4A 4CHNA 4CJLA 3IS9A 1XC9A 4FM1A 4ELUA 4F2SA 4DFPA 4CECA 4N5SA 2QXFA 3CFRA 4NCAA 4M42A 4QOZB 2HHTA 1IKXA 3OYFA 3NAEA 3F9KA 2XHBA 4BE0A 3C94A 3VQEA 4FLTA 4DTMA 3QEIA 3SQ1A 3ITHA 3V9SA 1SKWA 3RR8A 2OA8A 1WSJA 4CIFA 3WNHA 3IG1A 1RT6A 4I7FA 3KLEA 4JRQA 4OKEA 5HLFA 4M3TA 1X9SA 5J1EA 4OJRA 1RDDA 1U04A 3LZIA 3ULDA 1T05A 4CJRA 4C8LA 3HP9A 1L3UA 3SUQA 4W5NA 4CFCA 1EX4A 1S6PA 1HQEA 2RN2A 3DOLA 3V1QA 1ZBUA 4L8RB 3S3MA 4FLWA 3OYDA 4FLXA 3U3YA 1Z26A 2GV9A 3AO3A 5EU7A 3LZJA 4EZ9A 1A5XA 2F8TA 1X9MA 1QS4A 2DTUA 3DMJA 2LSNA 3S3NA 4E7HA 1LW2A 2ZD1A 2OPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DF4 A;  1T8E A;  3L2W A;  3VQA A;  1ZBL A;  1S1W A;  3KK3 A;  4FJK A;  1NOY A;  3ZSV A;  1IKV A;  4FJL A;  3CFP A;  4CCH A;  2IAJ A;  4IG0 A;  4BAC A;  1B9F A;  2YNI A;  3U6F A;  4CJQ A;  4CFB A;  3THV A;  4N76 A;  3OYA A;  1HNI A;  1CZB A;  4E19 A;  2KTQ A;  1DLO A;  2YNF A;  3AO5 A;  4YFU A;  4RW7 A;  4TSX A;  1WSH A;  3BGR A;  4Z4H A;  3NHG A;  1D8Y A;  1RBS A;  4BDP A;  3LP2 A;  3G10 A;  4Z0U A;  3F73 A;  2OZS A;  1QSY A;  1VSI A;  4K8X A;  1VRT A;  3C6T A;  4DFJ A;  4M3U A;  4KTZ A;  2ATQ A;  4Z4C A;  3AA5 X;  3ZT1 A;  3HXM A;  3O3F A;  4KV8 A;  3ZT3 A;  4CHQ A;  3AVF A;  3HVR A;  3DLK A;  4DTS A;  1XI1 A;  2B5J A;  2YNH A;  4O5B A;  1ZYQ A;  5CZ1 A;  3SV3 A;  5J2Q A;  3OS1 A;  1J9A A;  3HST B;  3QLH A;  1RT1 A;  1RDB A;  3NFA A;  4IG3 A;  4FZY A;  4OLB A;  1L3T A;  4DTU A;  3QEV A;  4KHQ A;  4CJW A;  1NK0 A;  4BWJ A;  1C1B A;  4CED A;  3PY8 A;  4M3Y A;  1MU2 A;  2E6M A;  2KQ2 A;  3VQ4 A;  4CJS A;  3MXI A;  4FK0 A;  4FXD A;  1BGX T;  2XY8 A;  2D0B A;  2DFH A;  4MFB A;  1JKH A;  4H8K A;  4E7I A;  3ZSQ A;  2KZM A;  1B92 A;  2F96 A;  3NF8 A;  4FK2 A;  4CEQ A;  1WSG A;  1LWC A;  4ICL A;  2PYJ A;  5HP1 A;  5HRS A;  1UA1 A;  5FRM A;  1U4B A;  4FZZ A;  2A1S A;  3DLE A;  2P1J A;  4CHP A;  1NK8 A;  1C0T A;  4FJG A;  4KHW A;  4KHY A;  3CYM A;  4CHZ A;  1L5U A;  3KD5 E;  3KLG A;  1HQU A;  1ZBI A;  4CJ3 A;  2XY7 A;  3V9Z A;  2PZS A;  3G0Z A;  1CZ9 A;  1J54 A;  1IKY A;  2GBZ A;  2R7Y A;  1ASV A;  1VSF A;  2DFE A;  4HCC A;  1XHX A;  1CLQ A;  3QEW A;  2F8S A;  5CY4 A;  1FKO A;  1HYZ A;  1S9G A;  1Y97 A;  3QER A;  3QEX A;  2A1R A;  3V81 A;  4W5O A;  4CFD A;  2I5J A;  2PY5 A;  3ZSZ A;  4C8K A;  3TR8 A;  2XO7 A;  2EX3 A;  2YKM A;  1JXB A;  5HRN A;  1NKC A;  4FK4 A;  4DTR A;  4KTW A;  1Q9X A;  4FJI A;  3VQD A;  1Q8I A;  3V9W A;  4B9U A;  4H4O A;  1TKZ A;  4AHT A;  1VSL A;  1BCO A;  4CJ4 A;  1ITG A;  4E89 A;  3TAG A;  1BI4 B;  4DWI A;  2Z1I A;  4K8Z A;  4OLA A;  4W5R A;  4FCY A;  3AO1 A;  1WSI A;  3LAK A;  1D9F A;  3RWU A;  1RT2 A;  1TL3 A;  3DLG A;  3HP6 A;  3CQ8 A;  1XWL A;  3AVG A;  4DTP A;  3NF9 A;  4I9L A;  4HHT A;  3CM6 A;  2IC3 A;  3O4Q A;  1JLC A;  1RIL A;  4M3W A;  4C8N A;  2YKN A;  1C1C A;  3JSM A;  3V6D A;  1YTA A;  3ZSY A;  4O44 A;  4KAZ A;  4ID1 A;  1QSL A;  1KFD A;  1NOZ A;  1UAX A;  3OYL A;  4PWD A;  3QNO A;  1X9W A;  4RW8 A;  4DF8 A;  3M8P A;  4LH4 A;  3L8B A;  1HYS A;  4FJH A;  4AHR A;  2YV0 X;  3OYI A;  3NGI A;  3LPU A;  4XIU A;  4FLV A;  4OGC A;  3TAM A;  2QKB A;  1WSF A;  1L3S A;  1C6V A;  3KK1 A;  1U48 A;  4B9S A;  4J2D A;  4J2B A;  4FM0 A;  4QAG A;  4IKF A;  3K5M A;  4DSK A;  4DQR A;  3RR7 A;  2OYQ A;  2AJQ A;  2VG7 A;  1RCH A;  4CGJ A;  3TAP A;  1RDC A;  3AA2 A;  3LDS A;  3KKR A;  4H4M A;  3T19 A;  2W42 A;  4RW6 A;  2B4J A;  3VQB A;  5FRN A;  2VWJ A;  3HPH A;  1A5W A;  1X1P A;  2BGG A;  3O3G A;  2FBY A;  4OPK A;  1JLQ A;  4Y1C A;  3OYG A;  3KJV A;  4Z4E A;  4FLZ A;  3ALY A;  3K59 A;  5SWM A;  1RT7 A;  4OGE A;  1JL2 A;  4ID5 A;  4C8M A;  2YHA A;  4KKO A;  1LAV A;  5C24 A;  1BL3 A;  1JL1 A;  4M45 A;  4EP5 A;  4LD0 A;  3TI0 A;  3PO5 A;  3WNF A;  1RT3 A;  4LY7 A;  3TAB A;  1NJW A;  3PUF A;  4FLY A;  4DFK A;  1LW0 A;  2PYL A;  4FJM A;  4FJN A;  1EET A;  3VQ5 A;  2YNG A;  5CYM A;  4R5P A;  3QET A;  5KGW A;  2Y1J A;  3OYJ A;  3ISN C;  3VQC A;  5J2P A;  1BIS A;  1UWB A;  2OPP A;  3ASM A;  3DI6 A;  3TAN A;  2QK9 A;  1RNH A;  1WNS A;  2G8V A;  3ZSR A;  4GW6 A;  1BIZ A;  3PX4 A;  1KVC A;  4CJE A;  4IFV A;  4JRP A;  1UOC A;  2XY5 A;  1IO2 A;  3AVL A;  5JS1 A;  1FXX A;  3HT3 A;  1RBU A;  3WNG A;  4ELV A;  3DYA A;  3EYZ A;  1KTQ A;  3DOK A;  3M8R A;  4B3O A;  4E0D A;  4LSL A;  3QNN A;  1EKE A;  3KLF A;  2QKK A;  1KLM A;  1HNV A;  3AVA A;  4M3R A;  1BQM A;  2WOM A;  3QIN A;  3VQ9 A;  3CM5 A;  5FDL A;  3OS2 A;  5I42 A;  5D3G A;  1VK0 A;  3TAE A;  4RW4 A;  4FVM A;  3OYH A;  3PO4 A;  4HCB A;  4CJ5 A;  4O55 A;  1TL1 A;  3U3G A;  4E1N A;  3JYT A;  2Z1H A;  2HNZ A;  2VG5 A;  3KLH A;  1F21 A;  3KD1 E;  2HND A;  3PX6 A;  2ETJ A;  2O4G A;  3CFO A;  3QIO A;  1JLG A;  4OVL A;  1DTT A;  2KW4 A;  1CXU A;  3L2U A;  1B9D A;  4DTX A;  3S3O A;  1GOC A;  1Q9Y A;  3KTQ A;  4CGF A;  4QCL A;  2HHS A;  3SV4 A;  2OPR A;  4DS4 A;  3VQ6 A;  2X74 A;  1J53 A;  3NCI A;  1RDA A;  3D45 A;  3OYC A;  3OYK A;  4CF1 A;  5CYQ A;  2HHX A;  1RBR A;  2IOC A;  1HJR A;  2BAN A;  4KB1 A;  2G8F A;  3VN5 A;  3RMB A;  2FBX A;  3OS0 A;  1SL1 A;  2Z1G A;  1T03 A;  1NK6 A;  1QE1 A;  1WSE A;  2HNY A;  4EP4 A;  3AVC A;  4RG8 A;  3TAR A;  1BIU A;  4IBN A;  3M8S A;  3EY1 A;  3HL8 A;  3V9U A;  4KHN A;  2IGI A;  3RMA A;  4E7K A;  3O3H A;  1VSD A;  1GOA A;  1A5V A;  2HHU A;  4CFA A;  3TAQ A;  5FRO A;  1RTH A;  1NJZ A;  4DU4 A;  4BE2 A;  3H08 A;  1TK5 A;  1N6Q A;  1HMV A;  3RRH A;  2HVH A;  4UQG A;  4DLE A;  3SPZ A;  1T7P A;  1RTD A;  1TK0 A;  1IG9 A;  4Z4G A;  4NYF A;  4AHS A;  3NH1 A;  3OJU A;  2FC0 A;  4B08 A;  3OJS A;  1JLB A;  1TKX A;  4KRF A;  4DTN A;  3WNE A;  3MXM A;  2P5G A;  3SQ0 A;  4KI4 A;  4Q5V A;  3SJJ A;  3AVH A;  4MQ3 A;  5KRT A;  2FBT A;  4E1M A;  3NF6 A;  1QQC A;  4CEO A;  2HHQ A;  4FW1 A;  2KZZ A;  2EHG A;  4FYD A;  1HPZ A;  1RBV A;  3D0P A;  1LWE A;  2JLE A;  1D5A A;  4CES A;  4ZTJ A;  3OYN A;  3IAY A;  1C0M A;  1EXQ A;  3I0R A;  4NCG A;  4NYN A;  3V1R A;  4KHU A;  1SUQ A;  3AA3 A;  2HHW A;  3KK2 A;  3L2Q A;  3AO2 A;  3ZT4 A;  3ZT2 A;  1NK9 A;  4W5Q A;  2GUI A;  3UIQ A;  5T7B A;  4PQU A;  4B9V A;  3HVT A;  2KFZ A;  1SKS A;  4E3S A;  4CJP A;  3RRG A;  4DQP A;  4NCB A;  4GMJ B;  1S5J A;  4CJT A;  3MXJ A;  1LAW A;  3VQ7 A;  3ZSW A;  1C1A A;  3LWL A;  4IFY A;  3K5O A;  2G8W A;  3VQ8 A;  2X6S A;  1YTU A;  1I3A A;  3VA3 A;  4DSJ A;  1TGO A;  3DLB A;  1JXE A;  1TAU A;  3MEE A;  1QHT A;  2KFN A;  2RKI A;  1WN7 A;  4CE9 A;  1NKB A;  4CJF A;  3LP3 A;  1EP4 A;  4B9N A;  1TV6 A;  3NBP A;  1S9E A;  3ZCM A;  4JS5 A;  1RTJ A;  5JS2 A;  3K58 A;  1SKR A;  4Y1D A;  1K6Y A;  4FJ5 A;  5KTQ A;  4DQI A;  1KLN A;  4AHU A;  4Z4I A;  4PA1 A;  2P51 A;  1ASW A;  1TAQ A;  4CGG A;  3SI6 A;  4FM2 A;  2YHB A;  4ELT A;  3NH2 A;  4DQQ A;  3AVI A;  4DTO A;  2WON A;  3SUO A;  4PUO A;  1U45 A;  2G8K A;  3DRS A;  3OY9 A;  1S1X A;  3SZ2 A;  4I2Q A;  5I3U A;  3LP0 A;  3LP1 A;  3MEC A;  3L2R A;  1TKT A;  3K57 A;  1S1V A;  1G15 A;  2IDO A;  4AHV A;  4F4K A;  1S1T A;  3DLH A;  5K14 A;  4CF2 A;  3HJF A;  3AV9 A;  4JS4 A;  2JGU A;  5DK5 A;  3QES A;  2BE2 A;  3IRX A;  3M8Q A;  3NF7 A;  4CER A;  1U47 A;  1LV5 A;  4B9L A;  4LSN A;  3HPG A;  4DQS A;  1R0A A;  4O4G A;  2D5R A;  1XHZ A;  3LAL A;  4F3T A;  3P5J A;  4I2P A;  5C42 A;  5HRO A;  3HK2 A;  1SL2 A;  3I0S A;  1LWF A;  4CEZ A;  2D0A A;  2FBV A;  4CF9 A;  5HBM A;  4HUG A;  1Z25 A;  4CHY A;  1SL0 A;  2BDP A;  2HW3 A;  1RT4 A;  1SV5 A;  3KIO A;  4N56 A;  3RMD A;  1J5O A;  1QTM A;  3MAQ A;  3ZT0 A;  1REV A;  4DMN A;  1YT3 A;  3DRR A;  4N47 A;  1JLE A;  3NH0 A;  3B6P A;  4M3X A;  1HRH A;  2G8I A;  1VSK A;  3L2V A;  2X78 A;  4CEA A;  3SYZ A;  3NGY A;  1RTI A;  4N41 A;  4DLG A;  2IS3 A;  4FZX C;  4C8O A;  3KKS A;  4KTQ A;  3LWM A;  2E4L A;  3C95 A;  1VSH A;  3HM9 A;  4DU3 A;  3SUP A;  1L3V A;  3SNN A;  3MEG A;  3KLI A;  2ITG A;  4F3O A;  1DTQ A;  4F8R A;  4J2A A;  1WAF A;  4KFB A;  3AA4 A;  3K2P A;  4DFM A;  2DFF A;  3SQ4 A;  3V4I A;  1JLA A;  1D9D A;  1W0H A;  3T3F A;  2XY6 A;  4I9Q A;  2VG6 A;  1I39 A;  1S6Q A;  3PX0 A;  4CJV A;  3NGZ A;  2HHV A;  2RF2 A;  3OVN A;  4DSI A;  1NK7 A;  1N5Y A;  1KCF A;  4BE1 A;  4DTJ A;  1VRU A;  1FKP A;  1YVU A;  4CK2 A;  5J2N A;  3SPY A;  3ZSO A;  2ZQB A;  3RMC A;  4FJX A;  2OPS A;  4AIL C;  3TAF A;  4CEB A;  3I8D A;  4ZTF A;  4KHS A;  3AVN A;  3SQ2 A;  2X6N A;  3LAM A;  4CGI A;  2G8U A;  3NE6 A;  4BDY A;  4DS5 A;  4B9T A;  2Y1I A;  2HVI A;  3MED A;  4DSF A;  1NJX A;  4AH9 A;  1NJY A;  4GVM A;  1NK5 A;  1KRP A;  4FJ9 A;  1NK4 A;  3ZSX A;  1HYV A;  1VSM A;  3FFI A;  4OKJ A;  3C6U A;  1UA0 A;  1W9H A;  4E7J A;  1CXQ A;  1VSJ A;  4KO0 A;  4IDK A;  2O4I A;  2E6L A;  4FJ8 A;  4HTU A;  3AVK A;  4CHO A;  4OPJ A;  4ZHR A;  4CJU A;  3SCX A;  4FW2 A;  5HRR A;  4EZ6 A;  3HO1 A;  3OYM A;  4G1Q A;  4KPY A;  4JLH A;  5C25 A;  4FJ7 A;  3AO4 A;  3LPT A;  3DLR A;  4WE1 A;  3T1A A;  3DM2 A;  3HYF A;  1ZBH A;  3L3U A;  4HUF A;  4DU1 A;  1C0U A;  3O4N A;  1WAJ A;  3RTV A;  1IH7 A;  3V1O A;  3K5L A;  4LH5 A;  4B8C A;  1IKW A;  3OYE A;  4DSL A;  4CGD A;  1ZBF A;  4KI6 A;  2RPI A;  4M41 A;  3QIP A;  2OZM A;  1TKD A;  4J2E A;  1RBT A;  1BQN A;  4DG1 A;  5HRP A;  3CG7 A;  4FJJ A;  3AVM A;  4DSE A;  3AVB A;  1BCM A;  2P5O A;  3K5N A;  4RW9 A;  1U49 A;  2D0C A;  5J2M A;  1WLJ A;  3DRP A;  3SUN A;  1ASU A;  3EZ5 A;  3QEP A;  1JLF A;  4CIG A;  4Q0B A;  4HVJ A;  3V9X A;  4E7L A;  4HUE A;  1KVA A;  3BDP A;  4CF0 A;  1NKE A;  2HB5 A;  4CEE A;  4Z4F A;  3L3V A;  4AHC A;  4CJK A;  2VWK A;  3NDK A;  3S9H A;  4W5T A;  1RT5 A;  2DY4 A;  4CF8 A;  3HPO A;  4BDZ A;  1KVB A;  1O1W A;  2HMI A;  2B6A A;  3VQP A;  4CEF A;  2NUB A;  1VSE A;  2ZE2 A;  3QO9 A;  4O0J A;  4BWM A;  4B8A B;  1BHL A;  2Z1J A;  4OKK A;  3LAN A;  3P1G A;  1GOB A;  5KI6 A;  5KRS A;  5E41 A;  3TWH A;  3PV8 A;  3OYB A;  1QSS A;  4O0I A;  1KFS A;  5CZ2 A;  1FK9 A;  4PY5 A;  4CGH A;  4B9M A;  4KB0 A;  2Q3S A;  2XRI A;  3A2F A;  4CK1 A;  3VQQ A;  4CIE A;  5KGX A;  3AVJ A;  4CK3 A;  1TK8 A;  1KSP A;  3VA0 A;  2G8H A;  4FLU A;  4M3Z A;  1TVR A;  3B6O A;  3P83 D;  4YNQ A;  1S1U A;  5SZT A;  4F2R A;  4KRE A;  3E01 A;  5DMR A;  1BI4 A;  4CHN A;  4CJL A;  3IS9 A;  1XC9 A;  4FM1 A;  4ELU A;  4F2S A;  4DFP A;  4CEC A;  4N5S A;  2QXF A;  3CFR A;  4NCA A;  4M42 A;  4QOZ B;  2HHT A;  1IKX A;  3OYF A;  3NAE A;  3F9K A;  2XHB A;  4BE0 A;  3C94 A;  3VQE A;  4FLT A;  4DTM A;  3QEI A;  3SQ1 A;  3ITH A;  3V9S A;  1SKW A;  3RR8 A;  2OA8 A;  1WSJ A;  4CIF A;  3WNH A;  3IG1 A;  1RT6 A;  4I7F A;  3KLE A;  4JRQ A;  4OKE A;  5HLF A;  4M3T A;  1X9S A;  5J1E A;  4OJR A;  1RDD A;  1U04 A;  3LZI A;  3ULD A;  1T05 A;  4CJR A;  4C8L A;  3HP9 A;  1L3U A;  3SUQ A;  4W5N A;  4CFC A;  1EX4 A;  1S6P A;  1HQE A;  2RN2 A;  3DOL A;  3V1Q A;  1ZBU A;  4L8R B;  3S3M A;  4FLW A;  3OYD A;  4FLX A;  3U3Y A;  1Z26 A;  2GV9 A;  3AO3 A;  5EU7 A;  3LZJ A;  4EZ9 A;  1A5X A;  2F8T A;  1X9M A;  1QS4 A;  2DTU A;  3DMJ A;  2LSN A;  3S3N A;  4E7H A;  1LW2 A;  2ZD1 A;  2OPQ A; 
#chains in the Genus database with same CATH topology
 4DF4 A;  3THX A;  4A5A A;  1S1W A;  3ZSV A;  1B9F A;  2ZJP L;  3OYA A;  3GG4 A;  4E19 A;  4YFU A;  3AO5 A;  4TSX A;  3BGR A;  3G10 A;  3F73 A;  4IOA L;  4PL8 A;  4OPH A;  4K25 A;  3C6A A;  4M3U A;  3CCM N;  2W40 A;  1QQM A;  3AVF A;  3FLC O;  5ADX H;  3HVR A;  2YNH A;  1ZYQ A;  1RT1 A;  3NFA A;  4IG3 A;  4A2B A;  1MDU B;  2O8B B;  4CZH A;  4BC5 A;  2NRR A;  4CJW A;  2BTF A;  4BWJ A;  1NK0 A;  3K9J A;  4M3Y A;  2PBD A;  1MU2 A;  3MXI A;  3VES A;  2D0B A;  2WC9 A;  4MFB A;  4H8K A;  2KZM A;  1B92 A;  3NF8 A;  4BC3 A;  4CEQ A;  2QWR A;  1UA1 A;  2YHY A;  2A1S A;  1NK8 A;  1NMN A;  1C0T A;  4JKD A;  4KHW A;  3E1Y A;  1L5U A;  3KD5 E;  3U9Z A;  1ZBI A;  4CJ3 A;  4BG8 A;  1CZ9 A;  1QQO A;  2R7Y A;  3FZM A;  2DFE A;  1S22 A;  1OH6 A;  1M1K O;  3HM8 A;  4LFA K;  1FKO A;  1HYZ A;  1S9G A;  1IV0 A;  2OAN A;  2I5J A;  5F0X A;  1NLV A;  4ILJ A;  4C8K A;  3TR8 A;  3IDH A;  2ZM6 K;  1Q8I A;  4B9U A;  3BF1 A;  4H4O A;  1VSL A;  1ITG A;  1BI4 B;  5BR8 K;  4FCY A;  4E1J A;  3LAK A;  3RWU A;  2ZJQ L;  3DLG A;  3HP6 A;  3RVC A;  4B3T K;  3CQ8 A;  1XWL A;  4HHT A;  3CM6 A;  2IC3 A;  3O4Q A;  1JLC A;  3CPW M;  3G71 N;  4O44 A;  2QWL A;  4KAZ A;  1QSL A;  4OPA A;  1NOZ A;  4WQ5 C;  3NGI A;  4ISE A;  4FLV A;  1K9M O;  2QKB A;  3CC7 N;  4R79 A;  1K8K B;  1U48 A;  4MDA A;  3DWL A;  5AQG A;  3ZEU A;  4FWQ A;  4IKF A;  4DQR A;  4U7B A;  4LFC K;  1RDC A;  3LDS A;  4EIA A;  5FRN A;  2B4J A;  3OBY A;  1N32 K;  3O3G A;  4BRK A;  4Y1C A;  3DXK B;  5BPN A;  3ALY A;  4I6M B;  3VF2 A;  4ID5 A;  4KKO A;  4EP5 A;  5C0Y A;  3TI0 A;  4FJM A;  3PUF A;  4JV5 K;  2YNG A;  3O6W A;  2Y1J A;  5KPT A;  1KAY A;  3DLL L;  4OO1 J;  1UWB A;  3DI6 A;  4NXM K;  4WYB A;  2QK9 A;  1RNH A;  1WNS A;  3CC2 N;  1BIZ A;  3C65 A;  3PX4 A;  1D4X A;  4JRP A;  4X65 K;  3G4S N;  1IO2 A;  3AVL A;  1FXX A;  4ELV A;  1ZC6 A;  3DYA A;  4JHD A;  4E0D A;  2OTL N;  3TTC A;  3KLF A;  1KLM A;  4M3R A;  4B1U B;  2WOM A;  3VQ9 A;  3OS2 A;  3CM5 A;  2I7N A;  3OYH A;  5AZJ A;  3U3G A;  4E1N A;  3JYT A;  2Z1H A;  2VG5 A;  3CJ7 A;  3IFR A;  2UUB K;  1F21 A;  3KD1 E;  2HND A;  2QTD A;  3DAW A;  4JN4 A;  1T3V A;  4YHH K;  4PHT X;  2ASM A;  5C2D A;  2HHS A;  2OPR A;  1Q82 O;  1T6D A;  2X74 A;  3AY9 A;  3NCI A;  3OYC A;  3D45 A;  3T69 A;  2NRX A;  3ULE B;  2IOC A;  3R1X A;  5HL7 L;  1WBB A;  2NRV A;  2G8F A;  1SL1 A;  4IJA A;  4IO9 L;  1T03 A;  2Z1G A;  1NK6 A;  4EP4 A;  4RG8 A;  3RMA A;  1RTH A;  4IFE A;  1X3M A;  4BRL A;  2Q97 A;  1N6Q A;  3O8M A;  3KWG A;  4A57 A;  3OJS A;  5AQV A;  4DTN A;  3WNE A;  5BR9 A;  3SQ0 A;  4KI4 A;  4MQ3 A;  2P9L B;  4E1M A;  2HHH K;  4FW1 A;  4KBO A;  2EHG A;  4FYD A;  3H1Q A;  1HPZ A;  4M7X A;  2JLE A;  1D5A A;  2UYT A;  3IAY A;  3BUZ B;  3I0R A;  4DHY A;  4KHU A;  3L2Q A;  2P9N A;  3AO2 A;  1QQN A;  4U67 L;  1S5J A;  3EL2 A;  1LAW A;  3VQ7 A;  3LWL A;  2D0O A;  2Q2R A;  1I3A A;  2D0P A;  1YAG A;  1NKB A;  4CJF A;  1EP4 A;  2UXC K;  1SKR A;  4FJ5 A;  3TSP A;  2HOE A;  1TYQ B;  3BEX A;  2P51 A;  1ASW A;  5EVZ A;  4CGG A;  1Q18 A;  5AJ3 K;  3QML A;  2CGK A;  4DTO A;  2G8K A;  3DRS A;  3HRG A;  1S1X A;  5BRE A;  3SZ2 A;  5I3U A;  3O9U A;  4QS9 A;  1WBD A;  2IDO A;  4F4K A;  4LF9 K;  4BR0 A;  3DLH A;  4JS4 A;  5AQH A;  3T1Y K;  1U47 A;  3M8Q A;  1LV5 A;  4K43 A;  3HPG A;  3M5R A;  2UU9 K;  3DXM B;  4B1X B;  4F3T A;  4BC4 A;  3P5J A;  5C42 A;  3H6E A;  2V52 B;  1H1V A;  4CEZ A;  5AQK A;  3U9D A;  1Z25 A;  2BDP A;  1SV5 A;  3VEN A;  1REV A;  4DMN A;  3DRR A;  5H1S Q;  1G99 A;  4H0X B;  1HRH A;  1WOQ A;  1VSK A;  4CEA A;  1DT9 A;  3KVG A;  3CJA A;  3LL3 A;  3LWM A;  3SUP A;  1JCG A;  3NVK A;  2ITG A;  4J2A A;  1WUA A;  3WQU A;  1JLA A;  3W3D A;  3CCJ N;  4AM6 A;  2HHV A;  4LF5 K;  1NK7 A;  4BE1 A;  4M7Y A;  2ZQB A;  4CZJ A;  3KZB A;  5EOY A;  3E9O A;  2G8U A;  4DS5 A;  4B9T A;  1QHA A;  1NJX A;  4GVM A;  3O9S A;  3HBT A;  1QZ5 A;  3WXI A;  1VSM A;  4OKJ A;  1W9H A;  4E7J A;  1CXQ A;  3AAR A;  5IT9 O;  4KO0 A;  2QWO A;  4BVO A;  4FJ8 A;  1DEJ A;  4CHO A;  4BRP A;  2FSJ A;  4OPJ A;  4ZHR A;  1HNZ K;  4CJ7 A;  4KPY A;  1GLF O;  1NGD A;  4CZL A;  3WXL A;  2NRW A;  3DLR A;  3DM2 A;  4HUF A;  4DU1 A;  1WAJ A;  1DKG D;  1IH7 A;  3O9T A;  3V1O A;  4B8C A;  1IKW A;  1GLD G;  3ENB A;  4DG1 A;  4J2E A;  4H5T A;  3D2F A;  4FJJ A;  2P5O A;  3AVB A;  4RW9 A;  3UKR A;  3A8Y A;  1YHQ N;  3SUN A;  1ASU A;  3EZ5 A;  3WEE B;  4JI5 K;  4CIG A;  3VGK A;  5C12 A;  2VGN A;  1YJ9 N;  2GUP A;  4GNI A;  4AHC A;  3S9H A;  4CF8 A;  2CH6 A;  1O1W A;  1S72 N;  2B6A A;  3VQP A;  5AQI A;  3FZH A;  2ZE2 A;  4IOC L;  4O0J A;  4OKK A;  3PV8 A;  3LAN A;  2HF3 A;  1NBW A;  4PY5 A;  3UKU B;  3O1W A;  5JMV A;  1KSP A;  4DSJ A;  3AVJ A;  1TK8 A;  5EXW A;  5IWA K;  1YXQ A;  2E1Z A;  5DMR A;  2QXL A;  3IS9 A;  5AR0 A;  4NB4 A;  4DFP A;  3CFR A;  4QOZ B;  2QXF A;  1U2V B;  4BE0 A;  3NAE A;  3QEI A;  4DQI A;  1BO5 O;  3SQ1 A;  1HNW K;  3ITH A;  3V9S A;  2UXD K;  1WSJ A;  4CIF A;  1NJI O;  3WNH A;  4DR5 K;  4OKE A;  2YCH A;  1X9S A;  3O5B A;  2A41 A;  4X66 K;  3MWP A;  3HP9 A;  5CE3 A;  4C8L A;  4W5N A;  4BC2 A;  2RN2 A;  3V1Q A;  3SAH A;  1TUY A;  3LZJ A;  5DM7 L;  3S3N A;  2KKZ A;  2ZD1 A;  3A0I X;  4A61 A;  4DV2 K;  4YY3 K;  2RE2 A;  4FJK A;  4BQL A;  2IAJ A;  1P8Z A;  3U6F A;  5LMU K;  2YNF A;  4RW7 A;  1OH5 A;  1YVN A;  4Z0U A;  1QSY A;  4K8X A;  3C6T A;  3MDQ A;  2ATQ A;  4Z4C A;  4JI6 K;  3O3F A;  3VEO A;  4KV8 A;  3ZT3 A;  5C15 A;  3CCR N;  2IVN A;  1XI1 A;  2B5J A;  3SV3 A;  5J2Q A;  4BY9 C;  3IKM A;  3QLH A;  4B1Y B;  5JVG L;  1RDB A;  4DV7 K;  4FZY A;  1SZ2 A;  4DTU A;  1IG8 A;  3M1F A;  1NGG A;  4JD2 A;  1XMO K;  2VWB A;  3W0L A;  2E6M A;  2KQ2 A;  4FK0 A;  4FXD A;  4WQ5 A;  2O8D B;  1KXP A;  5CR4 A;  3L0Q A;  1JKH A;  3VOV A;  2ZF5 O;  3GBT A;  1Y64 A;  1U4B A;  1NM1 A;  3D2E A;  1DGK N;  3LDQ A;  5C10 A;  2PZS A;  3V9Z A;  3G0Z A;  1J54 A;  1VSF A;  4NO7 A;  3C7N B;  3VEX A;  3QFU A;  2A1R A;  4FWR A;  3V81 A;  1GLA G;  3LM9 A;  3ZSZ A;  2XO7 A;  1JXB A;  4FK4 A;  2OCE A;  3V9W A;  4AHT A;  1BCO A;  3TAG A;  4DWI A;  2Z1I A;  3VGM A;  4OLA A;  4W5R A;  3AO1 A;  4CBW A;  2ASO A;  2CH5 A;  3FFK B;  3CME N;  5C2F A;  3AVG A;  3EO3 A;  4DV4 K;  3NF9 A;  4J8F A;  4FOI A;  1C1C A;  1YF5 L;  1SQK A;  4FVU A;  3ATU A;  1HR0 K;  5BRD A;  3QNO A;  4C1N K;  4YOX A;  3L8B A;  1HYS A;  4AHR A;  3K9K A;  5M1N A;  3OYI A;  4OGC A;  3TAM A;  1C6V A;  1YIJ N;  5DM6 L;  1Q7Y O;  4YDU C;  5BN8 A;  4J2B A;  2YX6 A;  2O8C A;  2AJQ A;  1RCH A;  4CGJ A;  3TAP A;  3AA2 A;  2F7T A;  1OH7 A;  3KKR A;  3THX B;  3HPH A;  3SBT A;  1X1P A;  4BRH A;  2BGG A;  1ZBS A;  3SMP A;  1JLQ A;  2A6A A;  2QM1 A;  4A59 A;  1OKJ A;  2IVO A;  4OGE A;  2YHA A;  4M45 A;  1BL3 A;  5LL6 Z;  3I55 N;  3PO5 A;  3WNF A;  1RT3 A;  4LY7 A;  3TAB A;  1NJW A;  4FLY A;  1LW0 A;  3UE5 A;  2E2N A;  3VQ5 A;  3CD6 N;  3ISN C;  1BIS A;  2OPP A;  1K73 O;  3TAN A;  4CJE A;  3MN6 A;  4IFV A;  2P9U A;  3HOS A;  4CZF A;  3THW A;  3A5N C;  1ATR A;  2ITM A;  5JS1 A;  1RDW X;  3EYZ A;  1EWQ A;  3M8R A;  4B3O A;  5M1Q A;  4LSL A;  3VTI A;  3QNN A;  1EKE A;  2QKK A;  2HF4 A;  3AVA A;  1BQM A;  5I42 A;  5D3G A;  4WQ4 C;  1VK0 A;  3TAE A;  5EX5 A;  3CPE A;  2P9I A;  3PO4 A;  4HCB A;  3CJC A;  4CJ5 A;  3HOT A;  4DUY K;  1M90 O;  2HNZ A;  3J7A P;  1XQS C;  2ETJ A;  1XNR K;  2KW4 A;  1CXU A;  4YOU A;  2Q0R A;  3SAF A;  4CGF A;  4QCL A;  4JKB A;  3MN7 A;  3SV4 A;  3ZX3 A;  1KAX A;  3QBW A;  1J53 A;  4IEE A;  5CYQ A;  5GAE P;  4KB1 A;  5AQU A;  3VN5 A;  4DR3 K;  3RMB A;  1QE1 A;  1WSE A;  3TAR A;  1VQK N;  4KHN A;  4E7K A;  3FR0 A;  3O3H A;  1NGI A;  1VSD A;  1JCF A;  1GOA A;  3J81 O;  1A5V A;  4CFA A;  3TAQ A;  5FRO A;  4DU4 A;  1YJN N;  4FOE A;  1TK0 A;  1IG9 A;  3BP8 A;  4NYF A;  3NH1 A;  3OJU A;  2FC0 A;  1JLB A;  4KRF A;  3MXM A;  1VQ4 N;  3H3N O;  4KHP K;  4JI8 K;  2FBT A;  3NF6 A;  5AQY A;  3AAP A;  1RBV A;  3D0P A;  4ZTJ A;  1C0M A;  3WQT A;  4NYN A;  3V1R A;  1W97 L;  3SLC A;  1SUQ A;  3ZEU B;  4DR1 K;  2E88 A;  4FWK A;  4PQU A;  4B9V A;  1SKS A;  4DQP A;  4CJP A;  3CJ1 A;  4CJT A;  3MXJ A;  2YJF A;  3VEV A;  4IFY A;  3K5O A;  1NGC A;  4IDH A;  5GAG P;  3LDL A;  2NRH A;  3VA3 A;  2JWL A;  1WN7 A;  3A5L C;  4CE9 A;  3MWT A;  1S9E A;  3VMF B;  3ZCM A;  4CZM A;  1YI2 N;  4Y1D A;  1K6Y A;  1SAZ A;  4JK8 A;  2W6L A;  4AHU A;  4PA1 A;  3SI6 A;  5HOO A;  4LC9 B;  4GY2 B;  2YHB A;  3F2K A;  3SUO A;  1GLB G;  1U45 A;  3J8A A;  5AFU A;  3F5T A;  4YOR A;  3QFP A;  3L2R A;  3K57 A;  3A5M C;  3HI0 A;  4AHV A;  4IEI A;  4CF2 A;  4JKF A;  2ZJR L;  3IRX A;  3SBG A;  4JHD B;  3RSE B;  1XHZ A;  1SL2 A;  4OX9 K;  3I0S A;  4JI7 K;  5F2R A;  3KIO A;  3RMD A;  3KK7 A;  3ZT0 A;  1K8K A;  1YT3 A;  4N47 A;  1JLE A;  5AZJ B;  3B6P A;  1Q81 O;  2G8I A;  2X78 A;  3NGY A;  4N41 A;  2IS3 A;  4FZX C;  3EE8 A;  4DU3 A;  1L3V A;  3SNN A;  3MEG A;  3JAM O;  5GIO A;  4FWS A;  1NGB A;  3T3F A;  2XY6 A;  5F1X A;  1S6Q A;  4CJV A;  5M1K A;  4AM7 A;  4DTJ A;  3MCP A;  4BR9 A;  4NXN K;  4B3R K;  5M1F A;  1FKP A;  4XH4 A;  1P90 A;  3SPY A;  3ZSO A;  4AIL C;  3TAF A;  4CEB A;  3I8D A;  1VQN N;  3EKS A;  4B1Z A;  4CGI A;  3NE6 A;  2HVI A;  3MED A;  4EHT A;  4DSF A;  1MA9 B;  4AH9 A;  1KRP A;  3ENO A;  4FJ9 A;  5CHI A;  5AQJ A;  1HYV A;  2IIR A;  3CET A;  1VSJ A;  4MLH A;  2O4I A;  3CMA N;  2VQF K;  1YJW N;  4RCH A;  1R59 O;  3OYM A;  5C25 A;  3OHR A;  4WE1 A;  3G25 A;  3WUH A;  3HYF A;  3L3U A;  1C0U A;  3PSF A;  4IZ9 A;  3TU5 A;  1IBK K;  4DSL A;  1NGH A;  3O1B A;  4H5V A;  2OZM A;  1IJJ A;  1TKD A;  4BGA A;  1RBT A;  1BQN A;  4DR4 K;  4DKW A;  1BCM A;  4XH5 A;  2D0C A;  3ULE A;  4KH6 A;  1KD1 O;  1JLF A;  1VQL N;  3V9X A;  4E7L A;  4HUE A;  3OBW A;  3TSU A;  2DY4 A;  1MWK A;  1KVB A;  3CXC M;  2Z1J A;  5KRS A;  3ZYY X;  4B9M A;  4KB0 A;  4YOT A;  3VEY A;  4CIE A;  1VQP N;  3VA0 A;  4FLU A;  1TVR A;  5AZI A;  4F2R A;  3I56 N;  1S1U A;  2P9L A;  3PIP L;  4CHN A;  4FM1 A;  4ELU A;  4F2S A;  4M42 A;  3PLA A;  2HHT A;  2VGM A;  3F9K A;  2GWK A;  3RR8 A;  3HTV A;  4X64 K;  2OA8 A;  3IUC A;  1IBM K;  5AQQ A;  3MCA B;  3KLE A;  4JRQ A;  4YOW A;  4BRD A;  5HLF A;  4OJR A;  1L3U A;  4BVP A;  1EX4 A;  3DOL A;  4L8R B;  3S3M A;  3AO3 A;  3VEW A;  1NGA A;  2Q31 A;  2DTU A;  2LSN A;  2P9K B;  3CCE N;  2OPQ A;  4GVE A;  5M1P A;  1ZBL A;  3KK3 A;  4PKI A;  1Q86 O;  1NOY A;  1IKV A;  2PFU A;  4CCH A;  2FLO A;  3THV A;  4CJQ A;  1HNI A;  1CZB A;  2KTQ A;  1DLO A;  1XUP O;  1WSH A;  4Z4H A;  4O8K A;  4M63 C;  4GKK K;  5A2Q O;  2O8E A;  1VQ9 N;  3C0B A;  4KTZ A;  2E2Q A;  5AQO A;  1VHX A;  3AA5 X;  3HXM A;  3WXJ A;  4YOY A;  4CBX A;  2E2P A;  5CZ1 A;  3OS1 A;  1J9A A;  3VF6 A;  4AF1 A;  1HUX A;  3J80 O;  3P4I A;  3ZLJ A;  3QEV A;  3CI5 A;  1C1B A;  1NU0 A;  3J7Y P;  2XY8 A;  2DFH A;  4RWT A;  3P38 A;  3D2F B;  4E7I A;  3ZSQ A;  2F96 A;  4FK2 A;  3UKR B;  1WSG A;  4ICL A;  2PYJ A;  4MO4 A;  1ATN A;  3L6Q A;  4YDU A;  5FRM A;  4FZZ A;  4BGB A;  2P1J A;  2E2O A;  3CYM A;  3MN5 A;  4ISG A;  3KLG A;  2XY7 A;  1N36 K;  3ZET B;  1N8R O;  1ASV A;  2P9S A;  5CY4 A;  1Y97 A;  3ATV A;  3QER A;  3QEX A;  4K0K K;  4WCE L;  4CFD A;  2PY5 A;  3LDN A;  3OA9 A;  2E5L K;  3O9Q A;  4BRM A;  2UUA K;  2YKM A;  5HRN A;  1JCE A;  1RGI A;  4BQZ A;  4CJ4 A;  3KHY A;  4E89 A;  2D1K A;  4K8Z A;  1KC8 O;  1V4T A;  3SMS A;  1WSI A;  1N33 K;  1TL3 A;  4M3W A;  2YKN A;  3QDK A;  3D6R A;  3V6D A;  3ZSY A;  4ID1 A;  1KFD A;  3OYL A;  4PWD A;  4IWV A;  4DF8 A;  4H0P A;  3CCQ N;  2YV0 X;  5KQD A;  4FJH A;  3P31 A;  4CVN E;  4XIU A;  3JS6 A;  1WSF A;  1L3S A;  4WQ4 A;  3ZX0 A;  4JKE A;  4J2D A;  1J5E K;  4FM0 A;  1IBL K;  1GLL O;  4GV9 A;  3RR7 A;  2OYQ A;  3QIC A;  2VG7 A;  1ESV A;  1NWK A;  1HLU A;  4H4M A;  3CCU N;  2W42 A;  4RW6 A;  1ILY A;  4JK9 A;  4OPK A;  3OYG A;  3WXM B;  2HBL A;  3K59 A;  2O8F B;  1W7A A;  1BU6 O;  3R6M A;  5SWM A;  4H0T B;  1C0F A;  2WBN A;  4C8M A;  5C24 A;  1E4F T;  5AQN A;  4DFK A;  3SJH A;  4R5P A;  3QET A;  1JJ2 M;  4LFB K;  4FWL A;  3OYJ A;  3C6H A;  3VQC A;  5J2P A;  1OH8 A;  3ASM A;  2A5X A;  4PL7 A;  3NMU A;  4FPA A;  3ZSR A;  4GW6 A;  3FGU A;  1U2V A;  2XY5 A;  2P9P A;  1I94 K;  4XEI A;  2BH1 A;  1RBU A;  3WNG A;  4HTL A;  5FPN A;  5KQ8 A;  2NLX A;  1KTQ A;  3TTD A;  1VQ7 N;  3VF4 A;  4EFH A;  5LY3 A;  5GIP A;  2D4W A;  4JK7 A;  2AP1 A;  2VCP A;  5FPD A;  3EKU A;  3KLH A;  3BF3 A;  5TKY A;  3R8E A;  3JXU A;  3PX6 A;  3D2E B;  4H0Y B;  3QIO A;  4OVL A;  1JLG A;  4BRE A;  1DTT A;  4DV1 K;  4DTX A;  3S3O A;  5AQZ A;  3CJ9 A;  3KTQ A;  3FE1 A;  5AQM A;  3CJB A;  4KH4 A;  3OYK A;  4CF1 A;  1RBR A;  2BAN A;  4LF6 K;  4JKG B;  4CD3 A;  5AQP A;  2FBX A;  3CIP A;  1VQ5 N;  3EEQ A;  3AVC A;  1BIU A;  3M8S A;  3HL8 A;  4WFB L;  3THY A;  2VYP A;  1N34 K;  4WFA L;  5ADX A;  4BG9 A;  1HMV A;  3SPZ A;  1T7P A;  4X62 K;  2OTJ N;  4NLC A;  1GLC G;  4B08 A;  1TKX A;  1W2B M;  1LCU A;  4Q5V A;  3AAQ A;  2YHW A;  1QQC A;  4CEO A;  2A3Z A;  2HHQ A;  3QBX A;  4ILG B;  1EXQ A;  4NCG A;  3J7Z O;  1EQY A;  2CGJ A;  2HHW A;  2QEX N;  1QVF M;  1RFQ A;  3MX2 A;  3ZT4 A;  4W5Q A;  2GUI A;  5T7B A;  3HVT A;  2KFZ A;  4E3S A;  2O8C B;  3RRG A;  4NCB A;  3DJC A;  3ZSW A;  1C1A A;  4FWM A;  2X6S A;  1YTU A;  2A40 A;  1TGO A;  3CQY A;  5E26 A;  1EO1 A;  5BPM A;  2KFN A;  3WXK A;  3LP3 A;  3EN9 A;  1RTJ A;  3K58 A;  3GE1 A;  5KTQ A;  5GIN A;  1TAQ A;  4FM2 A;  4L3Q A;  3NH2 A;  4H0V B;  4PUO A;  3VPZ A;  1TUU A;  3LP1 A;  3MEC A;  4Z4E A;  2P9U B;  2HMP A;  3LDP A;  4JKA A;  3THW B;  3AV9 A;  3G6E N;  2JGU A;  3QES A;  2BE2 A;  4CER A;  4NLB A;  3NF7 A;  5B8H A;  2D5R A;  3LAL A;  3M3Z A;  3HK2 A;  4I2P A;  5HRO A;  3HZ6 A;  4Z94 A;  4CF9 A;  1E4G T;  3CER A;  3T7Z A;  4QS8 A;  4HUG A;  1SL0 A;  3I33 A;  1RT4 A;  4N56 A;  1QTM A;  4JKC A;  2P9I B;  4IJN A;  3L2V A;  1RTI A;  4DLG A;  2YHX A;  4KTQ A;  4C8O A;  3KKS A;  3HM9 A;  2E4L A;  2H3G X;  1VSH A;  3F9M A;  4BRI A;  2VQE K;  1QVG M;  4YOV A;  4F3O A;  1DTQ A;  4F8R A;  4JKH A;  4KFB A;  3FZF A;  3U8X A;  4DFM A;  1GLE G;  2DFF A;  2GX9 A;  5LMN K;  3V4I A;  1D9D A;  2V7Z A;  4ISF A;  3FZL A;  2VG6 A;  4I9Q A;  4B9Q A;  3NGZ A;  4DSI A;  2GTD A;  1E3M A;  5BPL A;  1VRU A;  4CK2 A;  5J2N A;  5LJW A;  3RMC A;  4K41 A;  1S3X A;  3SQ2 A;  4MLE A;  4EAH D;  3O80 A;  2X6N A;  4BDY A;  5AQL A;  5M1O A;  2HBM A;  5MLC Q;  1NJY A;  1NK5 A;  4DV6 K;  1NK4 A;  1J6Z A;  3ZSX A;  3MK6 A;  4IDK A;  4HTU A;  3AVK A;  3GDQ A;  3CCL N;  2E1Y A;  3E66 A;  4FW2 A;  5HRR A;  3HO1 A;  1Z05 A;  3VEZ A;  4JLH A;  2GEM A;  4FJ7 A;  3AO4 A;  5ELZ A;  3LPT A;  2CGL A;  2O8B A;  4RTF D;  3CHW A;  4LH5 A;  2A42 A;  4CGD A;  3VGL A;  4KI6 A;  4M41 A;  4CZE A;  3CG7 A;  2QA4 N;  1WLJ A;  3DRP A;  3QEP A;  2QWP A;  4HVJ A;  3CF5 L;  1NKE A;  3HSC A;  3L3V A;  4CI6 A;  1OVY A;  2VWK A;  3NDK A;  3MN9 A;  4GV6 A;  4BRG A;  1FJG K;  4FWP A;  4BDZ A;  2HMI A;  4CEF A;  2PAV A;  4JI1 K;  3ID6 A;  3M6G A;  3QO9 A;  3A5O C;  4BWM A;  5I9E B;  4B8A B;  5KI6 A;  3P1G A;  5E41 A;  3B8A X;  3TWH A;  1GLJ O;  3OYB A;  1QSS A;  4O0I A;  1KFS A;  5CZ2 A;  1FK9 A;  3MX5 A;  3A2F A;  3VQQ A;  4YNQ A;  4DQ8 A;  5SZT A;  3H1V X;  5JVH L;  1BI4 A;  4CJL A;  1ATS A;  1IKX A;  4FPB A;  1X3N A;  4H5W A;  3C94 A;  3VQE A;  3U4L A;  1CLQ A;  1VQO N;  1XMQ K;  3IG1 A;  2FSN A;  1YUW A;  4BR2 A;  4PKH A;  1BG3 A;  3VET A;  1RDD A;  3AGK A;  3LZI A;  3ULD A;  4IOX A;  1S6P A;  5AQW A;  1Z6R A;  4FLW A;  2FXU A;  3ZX2 A;  3I8B A;  2QI2 A;  2GV9 A;  5EU7 A;  3L4Q A;  4HWI A;  1X9M A;  1QS4 A;  4DR7 K;  2F9T A;  2GEL A;  1LW2 A;  1I39 A;  1T8E A;  3WT0 A;  3L2W A;  3VQA A;  3DXK A;  2QWN A;  4LF4 K;  2WTU A;  1HKC A;  4FJL A;  3CFP A;  5EY4 A;  4IG0 A;  4BAC A;  4I6M A;  2YNI A;  4N76 A;  1NGJ A;  2BUP A;  4CFB A;  3ENH A;  3NHG A;  4A2A A;  1RBS A;  1D8Y A;  3LP2 A;  4BDP A;  2OZS A;  3OW2 M;  3BZK A;  1VSI A;  4CD1 A;  3RSE A;  4DV5 K;  1VRT A;  4DFJ A;  4BRN A;  1LOT B;  3ZT1 A;  4CHQ A;  5KPR A;  5BRH A;  3DLK A;  4WFN L;  4DTS A;  4O5B A;  3EZW A;  4BR4 A;  3HST B;  4OLB A;  1L3T A;  4KHQ A;  4WF9 L;  4CED A;  5GAD P;  3PY8 A;  3E9L A;  4CJS A;  3VQ4 A;  1MWM A;  1BGX T;  3NVM A;  4JI3 K;  1V4S A;  1LWC A;  3IMX A;  5HP1 A;  2P9N B;  5HRS A;  3DLE A;  4CHP A;  3PIO L;  4FJG A;  4KHY A;  1BDG A;  4CHZ A;  3OTO K;  1HQU A;  1FW6 A;  1IKY A;  2GBZ A;  4HCC A;  1XHX A;  4JI0 K;  3QEW A;  2F8S A;  5JLH A;  3BZC A;  4W5O A;  3O4W A;  4GKJ K;  4CBU A;  4FWO A;  2EX3 A;  1NKC A;  4DTR A;  5GAH P;  4KTW A;  1Q9X A;  4FJI A;  3VQD A;  1TKZ A;  4CZK A;  5AZI B;  3ID8 A;  2I7P A;  4BRQ A;  1D9F A;  3S41 A;  1RT2 A;  5AFU H;  2KLA A;  4DTP A;  4I9L A;  1RIL A;  4C8N A;  4B3M K;  3JSM A;  1HX1 A;  1YTA A;  4DR2 K;  1HNX K;  1UAX A;  1X9W A;  4RW8 A;  3M8P A;  3TPQ A;  4LH4 A;  2QW9 A;  2DPN A;  3LPU A;  1NMD A;  1XNQ K;  4BRF A;  3KK1 A;  4B9S A;  3L4I A;  4QAG A;  2KHO A;  3K5M A;  4DSK A;  4B1W B;  3LDO A;  4O5F A;  3T19 A;  4IXC A;  3VQB A;  2VWJ A;  1A5W A;  2HBJ A;  4MDB A;  2FBY A;  3KJV A;  3KWI A;  4FLZ A;  4C23 A;  1RT7 A;  1JL2 A;  4E7H A;  1LAV A;  1WB9 A;  1JL1 A;  4LD0 A;  1TYQ A;  2PYL A;  4FJN A;  2NRZ A;  1EET A;  5CYM A;  2O8E B;  5KGW A;  1BUP A;  2Q1N A;  2G8V A;  1KVC A;  1UOC A;  3E9P A;  4H0O A;  2FF6 A;  3Q7B A;  3HT3 A;  4CZG A;  3DOK A;  3DXM A;  2EWS A;  1QZ6 A;  2WFB A;  3EE9 A;  1HNV A;  3QIN A;  5FDL A;  3N4Q A;  1T6C A;  4RW4 A;  4FVM A;  2W6K A;  4O55 A;  1TL1 A;  1VQ8 N;  4QS7 A;  2P9K A;  5E84 A;  2O4G A;  3CFO A;  4V19 S;  3L2U A;  1B9D A;  1BWF O;  1GOC A;  1Q9Y A;  2V7Y A;  3GL1 A;  4DS4 A;  4F9O A;  2P9S B;  4BR5 A;  3VQ6 A;  1RDA A;  4LF8 K;  2HHX A;  1HJR A;  5AQR A;  2NZT A;  3BY5 A;  3OS0 A;  4XH1 A;  2HNY A;  4IBN A;  3EY1 A;  3V9U A;  4LF7 K;  2ZGZ A;  3CCS N;  2IGI A;  1VQM N;  3Q7C A;  4JAX A;  1U6Z A;  1VAZ A;  4O8U A;  2HHU A;  3CQX A;  4BRA A;  1NJZ A;  4BE2 A;  3H08 A;  1TK5 A;  2HVH A;  5AQT A;  2YI1 A;  4UQG A;  3RRH A;  4DLE A;  2RHK A;  1RTD A;  4Z4G A;  4Y0W A;  4JEP A;  5BN9 A;  4AHS A;  4A5B A;  4CW7 B;  2NRT A;  2P5G A;  3SJJ A;  3AVH A;  5KRT A;  2KZZ A;  1T44 A;  1LWE A;  2YJE A;  4CES A;  3OYN A;  2F9W A;  1NGF A;  3AA3 A;  1CZA N;  1XC3 A;  3KK2 A;  1KAZ A;  3O08 A;  3ZT2 A;  1NK9 A;  3UIQ A;  2Q36 A;  2UXB K;  4GMJ B;  3CC4 N;  2AA4 A;  2G8W A;  3VQ8 A;  3ZET A;  5KPZ A;  2QWM A;  3DLB A;  1JXE A;  1TAU A;  3MEE A;  1QHT A;  1K8A O;  2RKI A;  3LM2 A;  3WEE A;  4B9N A;  4B1V A;  1TV6 A;  3NBP A;  4JS5 A;  5JS2 A;  4JYA K;  1KLN A;  4Z4I A;  4BRC A;  2ZWH A;  4ELT A;  2HBK A;  4DQQ A;  3AVI A;  3P39 A;  2WON A;  5BRF A;  3OY9 A;  4DR6 K;  3H3O B;  4I2Q A;  3LP0 A;  1TKT A;  1S1V A;  1G15 A;  1S1T A;  2P9P B;  5K14 A;  3TTF A;  3UKU A;  3HJF A;  5DK5 A;  3N4P A;  1BA0 A;  4B9L A;  4LSN A;  4DQS A;  1R0A A;  4O4G A;  3SAG A;  1KQS M;  1LWF A;  4JI2 K;  2D0A A;  2FBV A;  5HBM A;  4CHY A;  2HW3 A;  2GWJ A;  4BR7 A;  1YIT N;  1J5O A;  2V51 B;  1HJO A;  2ZGY A;  3MAQ A;  2QWQ A;  2HST A;  4KH5 A;  4M3X A;  3NH0 A;  3SYZ A;  4JD2 B;  4C1N I;  2F4V K;  4DCH A;  2JWK A;  3C95 A;  2ASP A;  3KLI A;  5JLF A;  3R3L A;  1WAF A;  3AA4 A;  3K2P A;  2O8F A;  3H45 C;  3D7E O;  3SQ4 A;  4FWN A;  1W0H A;  5FPM A;  1NNE A;  3PX0 A;  2RF2 A;  3OVN A;  5FPE A;  1N5Y A;  1RDU A;  1KCF A;  3CCV N;  3THY B;  4H5R A;  1YVU A;  4IO8 A;  4MO5 A;  4FJX A;  2OPS A;  4ZTF A;  4KHS A;  3K0S A;  3AVN A;  4FO0 A;  3LAM A;  4CZI A;  5TKW A;  5LJV A;  1NG9 A;  2Y1I A;  2J4R A;  4DB3 A;  1BA1 A;  4DV3 K;  4BRO A;  3FFI A;  1UA0 A;  3C6U A;  3PSI A;  5AQF A;  2E6L A;  3VTH A;  4UY8 O;  3FZK A;  4DV0 K;  4CJU A;  3SCX A;  4EZ6 A;  4DUZ K;  4G1Q A;  3UB5 A;  4PKG A;  3TSQ A;  3T1A A;  1ZBH A;  4JNE A;  3O4N A;  3RTV A;  3K5L A;  3OYE A;  4JI4 K;  1ZBF A;  2Q0U A;  2RPI A;  3QIP A;  2O8D A;  5HRP A;  1X9J A;  4FSV A;  1SS6 A;  4FL9 A;  4AQY K;  2FF3 B;  3AVM A;  4DSE A;  3MMV A;  3K5N A;  4H5N A;  1U49 A;  5J2M A;  1NGE A;  4JKG A;  4Q0B A;  1VQ6 N;  1KVA A;  3BDP A;  4CF0 A;  2HB5 A;  4CEE A;  4Z4F A;  4H03 B;  5FLX O;  4K42 A;  4CJK A;  4ILH A;  3T1H K;  4W5T A;  1RT5 A;  1HKG A;  3HPO A;  3H46 O;  5AQS A;  2NUB A;  1VSE A;  1HKB A;  3C7N A;  1BOT O;  4A62 A;  1BHL A;  1GOB A;  4GV3 A;  1C0G A;  1EWR A;  4CGH A;  2Q3S A;  2XRI A;  1ZXO A;  4CK1 A;  5KGX A;  4CK3 A;  2G8H A;  4M3Z A;  3B6O A;  3P83 D;  2NNW A;  1OVQ A;  3E01 A;  4KRE A;  1XC9 A;  3SK3 A;  3AGR A;  2FSK A;  4CEC A;  4N5S A;  4NCA A;  3VER A;  3OYF A;  4FLT A;  4DTM A;  2XHB A;  1SKW A;  4B3S K;  2UUC K;  4I7F A;  1RT6 A;  2E20 A;  2W41 A;  3R9P A;  4M3T A;  1HPM A;  5J1E A;  3QB0 A;  1U04 A;  1T05 A;  3O9R A;  4CJR A;  3SUQ A;  5JIC A;  4CFC A;  1HQE A;  2E8A A;  4G9Z A;  1ZBU A;  2WUS A;  1O13 A;  2IVP A;  3OYD A;  5AQX A;  4FLX A;  3U3Y A;  1Z26 A;  2F8T A;  4EZ9 A;  1A5X A;  3GOI A;  3DMJ A;  4EHU A; 
#chains in the Genus database with same CATH homology
 4DF4 A;  1T8E A;  3L2W A;  3VQA A;  1ZBL A;  1S1W A;  3KK3 A;  4FJK A;  1NOY A;  3ZSV A;  1IKV A;  4FJL A;  3CFP A;  4CCH A;  2IAJ A;  4IG0 A;  4BAC A;  1B9F A;  2YNI A;  3U6F A;  4CJQ A;  4CFB A;  3THV A;  4N76 A;  3OYA A;  1HNI A;  1CZB A;  4E19 A;  2KTQ A;  1DLO A;  2YNF A;  3AO5 A;  4YFU A;  4RW7 A;  4TSX A;  1WSH A;  3BGR A;  4Z4H A;  3NHG A;  1D8Y A;  1RBS A;  4BDP A;  3LP2 A;  3G10 A;  4Z0U A;  3F73 A;  2OZS A;  1QSY A;  1VSI A;  4K8X A;  1VRT A;  3C6T A;  4DFJ A;  4M3U A;  4KTZ A;  2ATQ A;  4Z4C A;  3AA5 X;  3ZT1 A;  3HXM A;  3O3F A;  4KV8 A;  3ZT3 A;  4CHQ A;  3AVF A;  3HVR A;  3DLK A;  4DTS A;  1XI1 A;  2B5J A;  2YNH A;  4O5B A;  1ZYQ A;  5CZ1 A;  3SV3 A;  5J2Q A;  3OS1 A;  1J9A A;  3HST B;  3QLH A;  1RT1 A;  1RDB A;  3NFA A;  4IG3 A;  4FZY A;  4OLB A;  1L3T A;  4DTU A;  3QEV A;  4KHQ A;  4CJW A;  1NK0 A;  4BWJ A;  1C1B A;  4CED A;  3PY8 A;  4M3Y A;  1MU2 A;  2E6M A;  2KQ2 A;  3VQ4 A;  4CJS A;  3MXI A;  4FK0 A;  4FXD A;  1BGX T;  2XY8 A;  2D0B A;  2DFH A;  4MFB A;  1JKH A;  4H8K A;  4E7I A;  3ZSQ A;  2KZM A;  1B92 A;  2F96 A;  3NF8 A;  4FK2 A;  4CEQ A;  1WSG A;  1LWC A;  4ICL A;  2PYJ A;  5HP1 A;  5HRS A;  1UA1 A;  5FRM A;  1U4B A;  4FZZ A;  2A1S A;  3DLE A;  2P1J A;  4CHP A;  1NK8 A;  1C0T A;  4FJG A;  4KHW A;  4KHY A;  3CYM A;  4CHZ A;  1L5U A;  3KD5 E;  3KLG A;  1HQU A;  1ZBI A;  4CJ3 A;  2XY7 A;  3V9Z A;  2PZS A;  3G0Z A;  1CZ9 A;  1J54 A;  1IKY A;  2GBZ A;  2R7Y A;  1ASV A;  1VSF A;  2DFE A;  4HCC A;  1XHX A;  1CLQ A;  3QEW A;  2F8S A;  5CY4 A;  1FKO A;  1HYZ A;  1S9G A;  1Y97 A;  3QER A;  3QEX A;  2A1R A;  3V81 A;  4W5O A;  4CFD A;  2I5J A;  2PY5 A;  3ZSZ A;  4C8K A;  3TR8 A;  2XO7 A;  2EX3 A;  2YKM A;  1JXB A;  5HRN A;  1NKC A;  4FK4 A;  4DTR A;  4KTW A;  1Q9X A;  4FJI A;  3VQD A;  1Q8I A;  3V9W A;  4B9U A;  4H4O A;  1TKZ A;  4AHT A;  1VSL A;  1BCO A;  4CJ4 A;  1ITG A;  4E89 A;  3TAG A;  1BI4 B;  4DWI A;  2Z1I A;  4K8Z A;  4OLA A;  4W5R A;  4FCY A;  3AO1 A;  1WSI A;  3LAK A;  1D9F A;  3RWU A;  1RT2 A;  1TL3 A;  3DLG A;  3HP6 A;  3CQ8 A;  1XWL A;  3AVG A;  4DTP A;  3NF9 A;  4I9L A;  4HHT A;  3CM6 A;  2IC3 A;  3O4Q A;  1JLC A;  1RIL A;  4M3W A;  4C8N A;  2YKN A;  1C1C A;  3JSM A;  3V6D A;  1YTA A;  3ZSY A;  4O44 A;  4KAZ A;  4ID1 A;  1QSL A;  1KFD A;  1NOZ A;  1UAX A;  3OYL A;  4PWD A;  3QNO A;  1X9W A;  4RW8 A;  4DF8 A;  3M8P A;  4LH4 A;  3L8B A;  1HYS A;  4FJH A;  4AHR A;  2YV0 X;  3OYI A;  3NGI A;  3LPU A;  4XIU A;  4FLV A;  4OGC A;  3TAM A;  2QKB A;  1WSF A;  1L3S A;  1C6V A;  3KK1 A;  1U48 A;  4B9S A;  4J2D A;  4J2B A;  4FM0 A;  4QAG A;  4IKF A;  3K5M A;  4DSK A;  4DQR A;  3RR7 A;  2OYQ A;  2AJQ A;  2VG7 A;  1RCH A;  4CGJ A;  3TAP A;  1RDC A;  3AA2 A;  3LDS A;  3KKR A;  4H4M A;  3T19 A;  2W42 A;  4RW6 A;  2B4J A;  3VQB A;  5FRN A;  2VWJ A;  3HPH A;  1A5W A;  1X1P A;  2BGG A;  3O3G A;  2FBY A;  4OPK A;  1JLQ A;  4Y1C A;  3OYG A;  3KJV A;  4Z4E A;  4FLZ A;  3ALY A;  3K59 A;  5SWM A;  1RT7 A;  4OGE A;  1JL2 A;  4ID5 A;  4C8M A;  2YHA A;  4KKO A;  1LAV A;  5C24 A;  1BL3 A;  1JL1 A;  4M45 A;  4EP5 A;  4LD0 A;  3TI0 A;  3PO5 A;  3WNF A;  1RT3 A;  4LY7 A;  3TAB A;  1NJW A;  3PUF A;  4FLY A;  4DFK A;  1LW0 A;  2PYL A;  4FJM A;  4FJN A;  1EET A;  3VQ5 A;  2YNG A;  5CYM A;  4R5P A;  3QET A;  5KGW A;  2Y1J A;  3OYJ A;  3ISN C;  3VQC A;  5J2P A;  1BIS A;  1UWB A;  2OPP A;  3ASM A;  3DI6 A;  3TAN A;  2QK9 A;  1RNH A;  1WNS A;  2G8V A;  3ZSR A;  4GW6 A;  1BIZ A;  3PX4 A;  1KVC A;  4CJE A;  4IFV A;  4JRP A;  1UOC A;  2XY5 A;  1IO2 A;  3AVL A;  5JS1 A;  1FXX A;  3HT3 A;  1RBU A;  3WNG A;  4ELV A;  3DYA A;  3EYZ A;  1KTQ A;  3DOK A;  3M8R A;  4B3O A;  4E0D A;  4LSL A;  3QNN A;  1EKE A;  3KLF A;  2QKK A;  1KLM A;  1HNV A;  3AVA A;  4M3R A;  1BQM A;  2WOM A;  3QIN A;  3VQ9 A;  3CM5 A;  5FDL A;  3OS2 A;  5I42 A;  5D3G A;  1VK0 A;  3TAE A;  4RW4 A;  4FVM A;  3OYH A;  3PO4 A;  4HCB A;  4CJ5 A;  4O55 A;  1TL1 A;  3U3G A;  4E1N A;  3JYT A;  2Z1H A;  2HNZ A;  2VG5 A;  3KLH A;  1F21 A;  3KD1 E;  2HND A;  3PX6 A;  2ETJ A;  2O4G A;  3CFO A;  3QIO A;  1JLG A;  4OVL A;  1DTT A;  2KW4 A;  1CXU A;  3L2U A;  1B9D A;  4DTX A;  3S3O A;  1GOC A;  1Q9Y A;  3KTQ A;  4CGF A;  4QCL A;  2HHS A;  3SV4 A;  2OPR A;  4DS4 A;  3VQ6 A;  2X74 A;  1J53 A;  3NCI A;  1RDA A;  3D45 A;  3OYC A;  3OYK A;  4CF1 A;  5CYQ A;  2HHX A;  1RBR A;  2IOC A;  1HJR A;  2BAN A;  4KB1 A;  2G8F A;  3VN5 A;  3RMB A;  2FBX A;  3OS0 A;  1SL1 A;  2Z1G A;  1T03 A;  1NK6 A;  1QE1 A;  1WSE A;  2HNY A;  4EP4 A;  3AVC A;  4RG8 A;  3TAR A;  1BIU A;  4IBN A;  3M8S A;  3EY1 A;  3HL8 A;  3V9U A;  4KHN A;  2IGI A;  3RMA A;  4E7K A;  3O3H A;  1VSD A;  1GOA A;  1A5V A;  2HHU A;  4CFA A;  3TAQ A;  5FRO A;  1RTH A;  1NJZ A;  4DU4 A;  4BE2 A;  3H08 A;  1TK5 A;  1N6Q A;  1HMV A;  3RRH A;  2HVH A;  4UQG A;  4DLE A;  3SPZ A;  1T7P A;  1RTD A;  1TK0 A;  1IG9 A;  4Z4G A;  4NYF A;  4AHS A;  3NH1 A;  3OJU A;  2FC0 A;  4B08 A;  3OJS A;  1JLB A;  1TKX A;  4KRF A;  4DTN A;  3WNE A;  3MXM A;  2P5G A;  3SQ0 A;  4KI4 A;  4Q5V A;  3SJJ A;  3AVH A;  4MQ3 A;  5KRT A;  2FBT A;  4E1M A;  3NF6 A;  1QQC A;  4CEO A;  2HHQ A;  4FW1 A;  2KZZ A;  2EHG A;  4FYD A;  1HPZ A;  1RBV A;  3D0P A;  1LWE A;  2JLE A;  1D5A A;  4CES A;  4ZTJ A;  3OYN A;  3IAY A;  1C0M A;  1EXQ A;  3I0R A;  4NCG A;  4NYN A;  3V1R A;  4KHU A;  1SUQ A;  3AA3 A;  2HHW A;  3KK2 A;  3L2Q A;  3AO2 A;  3ZT4 A;  3ZT2 A;  1NK9 A;  4W5Q A;  2GUI A;  3UIQ A;  5T7B A;  4PQU A;  4B9V A;  3HVT A;  2KFZ A;  1SKS A;  4E3S A;  4CJP A;  3RRG A;  4DQP A;  4NCB A;  4GMJ B;  1S5J A;  4CJT A;  3MXJ A;  1LAW A;  3VQ7 A;  3ZSW A;  1C1A A;  3LWL A;  4IFY A;  3K5O A;  2G8W A;  3VQ8 A;  2X6S A;  1YTU A;  1I3A A;  3VA3 A;  4DSJ A;  1TGO A;  3DLB A;  1JXE A;  1TAU A;  3MEE A;  1QHT A;  2KFN A;  2RKI A;  1WN7 A;  4CE9 A;  1NKB A;  4CJF A;  3LP3 A;  1EP4 A;  4B9N A;  1TV6 A;  3NBP A;  1S9E A;  3ZCM A;  4JS5 A;  1RTJ A;  5JS2 A;  3K58 A;  1SKR A;  4Y1D A;  1K6Y A;  4FJ5 A;  5KTQ A;  4DQI A;  1KLN A;  4AHU A;  4Z4I A;  4PA1 A;  2P51 A;  1ASW A;  1TAQ A;  4CGG A;  3SI6 A;  4FM2 A;  2YHB A;  4ELT A;  3NH2 A;  4DQQ A;  3AVI A;  4DTO A;  2WON A;  3SUO A;  4PUO A;  1U45 A;  2G8K A;  3DRS A;  3OY9 A;  1S1X A;  3SZ2 A;  4I2Q A;  5I3U A;  3LP0 A;  3LP1 A;  3MEC A;  3L2R A;  1TKT A;  3K57 A;  1S1V A;  1G15 A;  2IDO A;  4AHV A;  4F4K A;  1S1T A;  3DLH A;  5K14 A;  4CF2 A;  3HJF A;  3AV9 A;  4JS4 A;  2JGU A;  5DK5 A;  3QES A;  2BE2 A;  3IRX A;  3M8Q A;  3NF7 A;  4CER A;  1U47 A;  1LV5 A;  4B9L A;  4LSN A;  3HPG A;  4DQS A;  1R0A A;  4O4G A;  2D5R A;  1XHZ A;  3LAL A;  4F3T A;  3P5J A;  4I2P A;  5C42 A;  5HRO A;  3HK2 A;  1SL2 A;  3I0S A;  1LWF A;  4CEZ A;  2D0A A;  2FBV A;  4CF9 A;  5HBM A;  4HUG A;  1Z25 A;  4CHY A;  1SL0 A;  2BDP A;  2HW3 A;  1RT4 A;  1SV5 A;  3KIO A;  4N56 A;  3RMD A;  1J5O A;  1QTM A;  3MAQ A;  3ZT0 A;  1REV A;  4DMN A;  1YT3 A;  3DRR A;  4N47 A;  1JLE A;  3NH0 A;  3B6P A;  4M3X A;  1HRH A;  2G8I A;  1VSK A;  3L2V A;  2X78 A;  4CEA A;  3SYZ A;  3NGY A;  1RTI A;  4N41 A;  4DLG A;  2IS3 A;  4FZX C;  4C8O A;  3KKS A;  4KTQ A;  3LWM A;  2E4L A;  3C95 A;  1VSH A;  3HM9 A;  4DU3 A;  3SUP A;  1L3V A;  3SNN A;  3MEG A;  3KLI A;  2ITG A;  4F3O A;  1DTQ A;  4F8R A;  4J2A A;  1WAF A;  4KFB A;  3AA4 A;  3K2P A;  4DFM A;  2DFF A;  3SQ4 A;  3V4I A;  1JLA A;  1D9D A;  1W0H A;  3T3F A;  2XY6 A;  4I9Q A;  2VG6 A;  1I39 A;  1S6Q A;  3PX0 A;  4CJV A;  3NGZ A;  2HHV A;  2RF2 A;  3OVN A;  4DSI A;  1NK7 A;  1N5Y A;  1KCF A;  4BE1 A;  4DTJ A;  1VRU A;  1FKP A;  1YVU A;  4CK2 A;  5J2N A;  3SPY A;  3ZSO A;  2ZQB A;  3RMC A;  4FJX A;  2OPS A;  4AIL C;  3TAF A;  4CEB A;  3I8D A;  4ZTF A;  4KHS A;  3AVN A;  3SQ2 A;  2X6N A;  3LAM A;  4CGI A;  2G8U A;  3NE6 A;  4BDY A;  4DS5 A;  4B9T A;  2Y1I A;  2HVI A;  3MED A;  4DSF A;  1NJX A;  4AH9 A;  1NJY A;  4GVM A;  1NK5 A;  1KRP A;  4FJ9 A;  1NK4 A;  3ZSX A;  1HYV A;  1VSM A;  3FFI A;  4OKJ A;  3C6U A;  1UA0 A;  1W9H A;  4E7J A;  1CXQ A;  1VSJ A;  4KO0 A;  4IDK A;  2O4I A;  2E6L A;  4FJ8 A;  4HTU A;  3AVK A;  4CHO A;  4OPJ A;  4ZHR A;  4CJU A;  3SCX A;  4FW2 A;  5HRR A;  4EZ6 A;  3HO1 A;  3OYM A;  4G1Q A;  4KPY A;  4JLH A;  5C25 A;  4FJ7 A;  3AO4 A;  3LPT A;  3DLR A;  4WE1 A;  3T1A A;  3DM2 A;  3HYF A;  1ZBH A;  3L3U A;  4HUF A;  4DU1 A;  1C0U A;  3O4N A;  1WAJ A;  3RTV A;  1IH7 A;  3V1O A;  3K5L A;  4LH5 A;  4B8C A;  1IKW A;  3OYE A;  4DSL A;  4CGD A;  1ZBF A;  4KI6 A;  2RPI A;  4M41 A;  3QIP A;  2OZM A;  1TKD A;  4J2E A;  1RBT A;  1BQN A;  4DG1 A;  5HRP A;  3CG7 A;  4FJJ A;  3AVM A;  4DSE A;  3AVB A;  1BCM A;  2P5O A;  3K5N A;  4RW9 A;  1U49 A;  2D0C A;  5J2M A;  1WLJ A;  3DRP A;  3SUN A;  1ASU A;  3EZ5 A;  3QEP A;  1JLF A;  4CIG A;  4Q0B A;  4HVJ A;  3V9X A;  4E7L A;  4HUE A;  1KVA A;  3BDP A;  4CF0 A;  1NKE A;  2HB5 A;  4CEE A;  4Z4F A;  3L3V A;  4AHC A;  4CJK A;  2VWK A;  3NDK A;  3S9H A;  4W5T A;  1RT5 A;  2DY4 A;  4CF8 A;  3HPO A;  4BDZ A;  1KVB A;  1O1W A;  2HMI A;  2B6A A;  3VQP A;  4CEF A;  2NUB A;  1VSE A;  2ZE2 A;  3QO9 A;  4O0J A;  4BWM A;  4B8A B;  1BHL A;  2Z1J A;  4OKK A;  3LAN A;  3P1G A;  1GOB A;  5KI6 A;  5KRS A;  5E41 A;  3TWH A;  3PV8 A;  3OYB A;  1QSS A;  4O0I A;  1KFS A;  5CZ2 A;  1FK9 A;  4PY5 A;  4CGH A;  4B9M A;  4KB0 A;  2Q3S A;  2XRI A;  3A2F A;  4CK1 A;  3VQQ A;  4CIE A;  5KGX A;  3AVJ A;  4CK3 A;  1TK8 A;  1KSP A;  3VA0 A;  2G8H A;  4FLU A;  4M3Z A;  1TVR A;  3B6O A;  3P83 D;  4YNQ A;  1S1U A;  5SZT A;  4F2R A;  4KRE A;  3E01 A;  5DMR A;  1BI4 A;  4CHN A;  4CJL A;  3IS9 A;  1XC9 A;  4FM1 A;  4ELU A;  4F2S A;  4DFP A;  4CEC A;  4N5S A;  2QXF A;  3CFR A;  4NCA A;  4M42 A;  4QOZ B;  2HHT A;  1IKX A;  3OYF A;  3NAE A;  3F9K A;  2XHB A;  4BE0 A;  3C94 A;  3VQE A;  4FLT A;  4DTM A;  3QEI A;  3SQ1 A;  3ITH A;  3V9S A;  1SKW A;  3RR8 A;  2OA8 A;  1WSJ A;  4CIF A;  3WNH A;  3IG1 A;  1RT6 A;  4I7F A;  3KLE A;  4JRQ A;  4OKE A;  5HLF A;  4M3T A;  1X9S A;  5J1E A;  4OJR A;  1RDD A;  1U04 A;  3LZI A;  3ULD A;  1T05 A;  4CJR A;  4C8L A;  3HP9 A;  1L3U A;  3SUQ A;  4W5N A;  4CFC A;  1EX4 A;  1S6P A;  1HQE A;  2RN2 A;  3DOL A;  3V1Q A;  1ZBU A;  4L8R B;  3S3M A;  4FLW A;  3OYD A;  4FLX A;  3U3Y A;  1Z26 A;  2GV9 A;  3AO3 A;  5EU7 A;  3LZJ A;  4EZ9 A;  1A5X A;  2F8T A;  1X9M A;  1QS4 A;  2DTU A;  3DMJ A;  2LSN A;  3S3N A;  4E7H A;  1LW2 A;  2ZD1 A;  2OPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...