4PA1A

Crystal structure of catalytic core domain of fiv integrase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
151
structure length
151
Chain Sequence
HMGIWQMDCTHFDGKIILVGIHVESGYIWAQIISQETADCTVKAVLQLLSAHNVTELQTDNGPNFKNQKMEGVLNYMGVKHKFGIPGNPQSQALVENVNHTLKVWIQKFLPETTSLDNALSLAVHSLNFKRRGRIGGMAPYELLAQQESLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Identification of phe187 as a crucial dimerization determinant facilitates crystallization of a monomeric retroviral integrase core domain.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
total genus 50
structure length 151
sequence length 151
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pa1A00
4CK1A 2HHUA 3QEIA 1RT1A 2XO7A 4CEZA 4B9NA 4I9QA 1LWCA 3D0PA 4KHWA 5D3GA 3VQPA 1S1VA 4DWIA 4CK2A 4DTXA 4B3OA 1VSEA 4FJ5A 2KFNA 4IG3A 3OS1A 2RPIA 1DTQA 4E7JA 1U4BA 4DSLA 1UAXA 4OLBA 1EP4A 4KTQA 3EZ5A 1WLJA 4FK0A 4DU4A 1U47A 4CHNA 2EHGA 3LZJA 1VSHA 2B5JA 4KO0A 1KLNA 2D0AA 3L2RA 4C8NA 1REVA 3AVJA 3OS2A 2Q3SA 2HHQA 4DFJA 3AVFA 4M3ZA 2ZE2A 4FJJA 3NF7A 3ZT1A 3NGIA 4ID5A 3K57A 3LP2A 2E6MA 2RKIA 3OYKA 1NK0A 3O4QA 4IFYA 1HRHA 3ZT4A 1FK9A 2YKNA 3LAMA 3ZSXA 4FZZA 1Z25A 4O44A 4W5RA 1J53A 1J5OA 1C1BA 2A1RA 2G8UA 3M8RA 4DF8A 1U49A 2G8VA 3DLRA 1RT4A 4JRQA 5J2NA 2FBVA 4DTOA 4ZTFA 3QINA 1IO2A 1S1WA 2GUIA 1DTTA 4ZTJA 4KI4A 4NCGA 3WNEA 2HHXA 2KFZA 1WSGA 3NE6A 1BIUA 3ZSZA 2KZMA 4EZ9A 3PO4A 1BQNA 3SPYA 2GV9A 4CF2A 1HYVA 3L3UA 2HHSA 3VN5A 1I39A 3EYZA 1NJYA 1NKEA 3KJVA 4DQIA 1J54A 1KVAA 2JLEA 4O5BA 4CEFA 3SQ4A 2G8WA 4DG1A 4FJ7A 2G8KA 4HUEA 3I8DA 3K5NA 1NOZA 1L3UA 3OYGA 2BGGA 2E6LA 2XY8A 4FJXA 3MEGA 3A2FA 4FJ9A 2VWKA 4N5SA 4M41A 4LH4A 3CM5A 1D9FA 1C0TA 3QLHA 3T3FA 3QERA 4J2BA 5KTQA 3RRHA 1VRTA 3MXJA 4HUFA 3OYHA 1S9EA 3DM2A 3L2QA 3KIOA 1SL1A 1C0MA 4DU3A 1C1CA 3U3YA 4G1QA 1RTHA 1NK5A 1WSIA 3OYIA 4AHTA 3KLHA 4KHNA 4DTSA 1RT7A 3RR8A 3RMCA 3NBPA 4FW1A 5SZTA 3LDSA 1WAJA 3SQ2A 1QTMA 4JS5A 4FJLA 1C1AA 4DFMA 1CZ9A 1TK0A 4DTUA 2OPQA 4PA1A 2KZZA 1CLQA 2PY5A 4DTNA 3B6OA 1NJWA 4DQRA 2OA8A 4FJNA 5K14A 1RNHA 1LAVA 1DLOA 3QNOA 2KTQA 2NUBA 1NK4A 3AVKA 3AVAA 1HYSA 1J9AA 1TKXA 4IBNA 3L2VA 2DFEA 3LP1A 1BHLA 1TL3A 1VSDA 3ZSQA 3SUOA 1NOYA 1JL1A 4KHQA 3AO4A 4FVMA 4Q0BA 3QEWA 4FJHA 2HB5A 2QXFA 3O3FA 1VSIA 4CHYA 2HHWA 2LSNA 3ZSRA 2GBZA 4OPKA 3DLHA 2X74A 4W5OA 1WAFA 2OPPA 3KD5E 4KAZA 1X9MA 4F3TA 1S1XA 1JLBA 3ZSYA 1W0HA 4CJLA 4FJKA 2DFFA 3OYDA 4Z4FA 4KV8A 4I2PA 1B9FA 3AO3A 4O55A 4Z4IA 4EP5A 4CJRA 5J2MA 3QESA 2FBTA 4B9LA 4LH5A 1VSKA 2HNYA 4CEAA 5C42A 3HP6A 1RBUA 5CZ2A 5E41A 3SZ2A 4CEBA 5JS1A 1R0AA 2YHBA 3BGRA 4OKJA 4CGJA 3V9UA 4DSKA 3SYZA 4AHRA 3HVTA 3TAPA 1LW0A 4E7IA 1ASUA 4FW2A 3NAEA 1CXQA 1SKSA 3LANA 5HRSA 4GW6A 2FBYA 3ZT2A 1IH7A 4PQUA 4M3UA 5HROA 4UQGA 1QS4A 1TV6A 4DTRA 3IS9A 4M3RA 3PX6A 4CEEA 1ASWA 1EETA 2D5RA 3KKRA 1EX4A 4Y1DA 3ZSVA 3AVHA 1IKVA 3CFOA 3OYMA 4FLVA 1MU2A 3ISNC 1SL2A 4DQPA 2BE2A 5J1EA 2HNZA 5HP1A 2YV0X 1JL2A 3LPTA 4E7KA 4Z0UA 3TARA 2HHVA 4W5QA 1JLAA 3VA3A 4AHCA 2HNDA 2HMIA 3V6DA 1Q8IA 3HK2A 1JLGA 3NH0A 1NK9A 1ZBHA 1HQUA 2RF2A 4ELVA 4F2SA 4KHSA 1A5XA 2A1SA 5KGWA 4AILC 1T05A 4NCAA 3V1RA 1YT3A 3K5OA 3WNGA 1Y97A 4CIGA 4BE0A 2BANA 3ULDA 2OZSA 3HP9A 1QHTA 4E0DA 3D45A 3AVIA 1C6VA 4BDPA 2Y1JA 2PZSA 4W5TA 1RBVA 1SKRA 2PYLA 3K58A 4F2RA 4CECA 4HUGA 2ZD1A 3C6TA 1U45A 2P1JA 2X78A 4DFPA 3BDPA 3RR7A 1Q9YA 1HYZA 3L3VA 1KFSA 1NKCA 3ASMA 3QEVA 3V9XA 3NH1A 1RDAA 3OS0A 3SUQA 3S3MA 3SJJA 4B9SA 3KKSA 5HRRA 3AVNA 4CJ5A 1SUQA 1RDCA 2X6SA 4B9MA 2HVHA 3V1QA 4CGDA 1QQCA 4RW6A 4KHYA 4CESA 3ALYA 1T7PA 1UA0A 1LWFA 2Z1GA 1RILA 3CFRA 3QEXA 2F96A 1SL0A 3VQ8A 4DLGA 4KHUA 1L3VA 4IDKA 4DQQA 1FKPA 1KCFA 4FK4A 2Z1HA 4AHVA 1WN7A 4N56A 3VQ6A 1S6PA 4FJMA 1NKBA 4C8LA 1KLMA 2VWJA 3TABA 1LW2A 3LPUA 3M8PA 1S9GA 3U3GA 1TGOA 1D9DA 2F8TA 3F9KA 3DYAA 4KRFA 3SUPA 1WSFA 5FRMA 4FCYA 1ASVA 4DSIA 3P83D 2XY7A 1S1UA 1JLQA 4FLTA 3NHGA 5CYQA 2F8SA 5FDLA 4HCCA 1TL1A 1KSPA 3KTQA 4DTPA 3DMJA 2WONA 3KLIA 4DSFA 3VQCA 1ZBLA 4E1NA 2VG6A 1U04A 4I7FA 5KI6A 3OYEA 4CFCA 3AA2A 4H8KA 3TANA 4L8RB 4KKOA 2E4LA 3NGYA 4KPYA 3NDKA 4CGHA 3HO1A 4DS5A 4RW4A 4RW7A 3MXMA 1TKTA 3S9HA 1BI4B 4Q5VA 3KK1A 2BDPA 3TI0A 3V1OA 1RT6A 3AVMA 1YVUA 2XY6A 2P5OA 3K2PA 4NYNA 4FLUA 1T8EA 1UOCA 3ZSOA 1QSSA 5HRNA 4ELTA 4IKFA 3AO1A 4E7LA 1XC9A 4CJVA 4GVMA 5T7BA 4CF8A 4DU1A 1KTQA 3LAKA 3VA0A 1XWLA 2B4JA 3AA3A 3VQDA 2YNGA 4OGCA 3L8BA 3TAEA 4IFVA 3THVA 2PYJA 3OVNA 2QKKA 3O3GA 3PUFA 1YTUA 2IOCA 1TK8A 2DTUA 1A5WA 5C24A 1JKHA 5I3UA 3SI6A 1I3AA 4KREA 3RRGA 1WSJA 3IAYA 1XHZA 3OYNA 3DLBA 1WSEA 5DMRA 4DFKA 4C8OA 4FK2A 4PY5A 4CFBA 2D0BA 4HVJA 2DY4A 1S5JA 5EU7A 2DFHA 1ITGA 4E89A 3OYBA 3TWHA 3E01A 1Q9XA 1KVCA 3AVGA 3NF9A 1BIZA 4FM0A 4OGEA 4KTZA 3MXIA 4ICLA 4CJQA 4B08A 4Z4HA 1WSHA 1BISA 1RT2A 3RTVA 4EZ6A 4FZXC 3PY8A 2G8FA 4DSJA 1TK5A 3AVBA 2ATQA 3DRPA 3VQ7A 1S6QA 1RBSA 5KRTA 3OY9A 3CQ8A 4O0JA 4BDZA 4BE1A 3V9ZA 4B9VA 3K5LA 1GOAA 2OPSA 3SCXA 1X1PA 1A5VA 3JSMA 1B9DA 4CF0A 4DLEA 4NYFA 1C0UA 2P5GA 3TAGA 4RG8A 4MFBA 4OPJA 3VQBA 4JRPA 1RCHA 4KB1A 3IRXA 3ZT3A 1TAQA 4F3OA 4J2AA 1GOCA 1LAWA 1X9SA 3VQEA 4CHPA 1KVBA 1NK8A 3DRSA 4FXDA 1SV5A 1X9WA 2G8HA 4IG0A 2Z1IA 3F73A 3T19A 4Z4GA 3M8SA 4H4MA 2QKBA 3HVRA 4E19A 5FROA 1RTJA 3TR8A 1VRUA 3HXMA 1S1TA 1O1WA 4QAGA 4E1MA 3KLGA 2HW3A 4CJTA 4FM2A 1EKEA 1K6YA 1RDBA 3C6UA 3G10A 3B6PA 1BCMA 2P51A 3CYMA 1LWEA 1CXUA 3V9SA 3ZCMA 3FFIA 4CJPA 1JLCA 4CEOA 4CJEA 4CF1A 4CCHA 4XIUA 1L5UA 2W42A 3ZSWA 2YKMA 3C95A 3CM6A 4DSEA 3DLEA 3HT3A 3NF6A 3OYJA 4FJGA 3C94A 3HYFA 1VSFA 4YFUA 1NK6A 4LSLA 3V4IA 1KRPA 2O4IA 4O0IA 4FLZA 2Z1JA 3PX4A 4E7HA 3ITHA 1ZBIA 3DLGA 5KGXA 2OZMA 1RT5A 3I0RA 1SKWA 3CFPA 4W5NA 3HL8A 3QIPA 2ITGA 4AHSA 4CF9A 3OJSA 3PX0A 4HHTA 2EX3A 3P1GA 4CGIA 5CY4A 4ELUA 4QCLA 1TKDA 3VQ4A 2IDOA 4BDYA 4M3XA 2IAJA 2XY5A 2ETJA 1NK7A 3RWUA 5HBMA 1HQEA 1ZBFA 3TAQA 4DQSA 4CJSA 3QETA 1RBTA 1QSLA 2AJQA 3L2WA 4CEDA 3T1AA 4DTMA 1T03A 2G8IA 3MECA 4AHUA 3AO2A 3OJUA 4BACA 4CHQA 3MAQA 3EY1A 4NCBA 4FYDA 1BI4A 4BWJA 3K5MA 3DRRA 4F4KA 1KFDA 3AA5X 4LY7A 4PWDA 1RTIA 1UA1A 4CJ3A 1NJZA 1GOBA 3K59A 5CYMA 3AVLA 4ZHRA 1IG9A 4KTWA 3M8QA 3RMAA 2X6NA 3VQ5A 3TAMA 1TKZA 3LWMA 4Z4CA 2IS3A 4OJRA 3RMBA 1RBRA 2YNIA 3KLFA 1HNIA 2FBXA 3HSTB 3LZIA 3DOKA 3OYCA 3V9WA 3OYLA 3SV3A 4BWMA 2VG7A 1LV5A 3KK2A 3LP0A 4N76A 3QO9A 3SQ1A 3RMDA 3HPHA 2FC0A 1ZBUA 1N5YA 3KD1E 4OLAA 3O4NA 3SPZA 4OVLA 1IKXA 2XRIA 3HPGA 4J2EA 1VSLA 3U6FA 1HJRA 1FXXA 1QE1A 4CJWA 4LD0A 3WNHA 5KRSA 1RDDA 4R5PA 2OYQA 2D0CA 3G0ZA 1BGXT 2IGIA 1JLEA 4FZYA 4N41A 4Y1CA 3WNFA 4DMNA 3MEEA 3P5JA 4K8ZA 4RW8A 4M45A 1F21A 4RW9A 4CGFA 2XHBA 2R7YA 4JS4A 1L3TA 5JS2A 3I0SA 4CJ4A 1JLFA 3SV4A 4WE1A 1G15A 4B9TA 3NFAA 3UIQA 4LSNA 4DS4A 4MQ3A 5SWMA 3KLEA 3L2UA 3QIOA 5J2QA 1JXBA 2O4GA 2OPRA 4CE9A 4FJIA 3SQ0A 4KI6A 1ZYQA 1HPZA 3HJFA 2HHTA 2KW4A 3AA4A 4HTUA 3LWLA 4FLYA 2I5JA 3VQQA 1TAUA 4HCBA 1HMVA 4M3YA 2ZQBA 4B8AB 1TVRA 4KB0A 4CFDA 1UWBA 3NF8A 4E3SA 4CJFA 4FLXA 3JYTA 4BE2A 1VSMA 1W9HA 1Z26A 1D8YA 1YTAA 3LALA 1EXQA 4TSXA 3CG7A 5C25A 4H4OA 3NCIA 3DOLA 2JGUA 1VSJA 1CZBA 3NH2A 3KK3A 4FLWA 1NJXA 1RTDA 5J2PA 4J2DA 1XHXA 4CHOA 2IC3A 1XI1A 1BCOA 2YNFA 4JLHA 4CIEA 2Y1IA 5I42A 4M3TA 2VG5A 3AO5A 5DK5A 4CJKA 5HRPA 3S3NA 4C8MA 1HNVA 2YHAA 3HM9A 3DLKA 3QEPA 4C8KA 2QK9A 4I2QA 4CEQA 4FM1A 4I9LA 3PO5A 4M3WA 5HLFA 4M42A 2HVIA 4ID1A 3VQ9A 1FKOA 5FRNA 3SNNA 3OYFA 1D5AA 2B6AA 4CK3A 4N47A 2YNHA 1WNSA 3S3OA 3SUNA 4PUOA 4F8RA 3VQAA 3IG1A 3QNNA 4CHZA 1BL3A 4DTJA 1JXEA 4CJUA 4YNQA 3PV8A 4CFAA 1QSYA 4B9UA 1VK0A 4CERA 3LP3A 4KFBA 1BQMA 3TAFA 1B92A 4AH9A 3ZT0A 4CIFA 4DF4A 4QOZB 4GMJB 4OKEA 3DI6A 3NGZA 3AV9A 4OKKA 3HPOA 1IKWA 4CGGA 4Z4EA 2WOMA 3H08A 4O4GA 3AVCA 1RT3A 2KQ2A 5CZ1A 1L3SA 2RN2A 4FJ8A 1U48A 4B8CA 3V81A 3OYAA 3MEDA 4EP4A 3O3HA 1IKYA 4K8XA 1N6QA
chains in the Genus database with same CATH superfamily
4CZJA 2HHUA 3H1VX 3ZETA 1RT1A 3C6HA 4KH4A 1VQ4N 3D0PA 2ZWHA 3NVKA 3A5LC 1S1VA 2BTFA 4CK2A 4K43A 4DTXA 4B3OA 1U4BA 2FSKA 3SK3A 4B1VA 4E7JA 1UAXA 2Q31A 4KTQA 1HJOA 4ISGA 4KH6A 2QWPA 3IFRA 5GAGP 4YOVA 2IIRA 3AVJA 3OS2A 4M3ZA 1SAZA 1Q86O 2P9UA 2NRRA 3ZT1A 3NGIA 2NNWA 3N4PA 2E6MA 2CH5A 3E9OA 3OYKA 3O4QA 5EVZA 1FK9A 1KD1O 1J53A 1J5OA 5BRFA 4NB4A 4JI8K 4JN4A 1DTTA 4EHTA 4ZTJA 3NE6A 1BIUA 3ZSZA 1BQNA 3QBWA 2GV9A 4CF2A 1HYVA 3FZKA 3GE1A 3L3UA 1I39A 5AQZA 1J54A 4JI2K 2G8WA 1KAXA 1DT9A 3HI0A 3I8DA 3K5NA 1GLEG 4WQ5C 3MEGA 4K42A 4YDUA 3ATVA 2VWKA 1YJNN 4DV3K 1C0TA 3MXJA 5CE3A 5ADXH 5IWAK 1MDUB 1C0MA 5AZJA 1C1CA 3U3YA 4G1QA 1RTHA 3CD6N 1NK5A 1HR0K 1WSIA 4KHNA 3RR8A 5FPEA 3SQ2A 4GKJK 4BG8A 4DFMA 1NWKA 4PA1A 1NGFA 2PY5A 4DTNA 4H5VA 4B3MK 5K14A 3O4WA 3S41A 4DV6K 3LP1A 3CJAA 1X3NA 1VQON 1NOYA 2CGLA 1I94K 4JI7K 1K73O 3AO4A 4FVMA 4Q0BA 3QEWA 3ENBA 4FJHA 1J5EK 1VSIA 4JKCA 3C7NA 2E5LK 2GBZA 4OPKA 3IMXA 3OTOK 2YHYA 3LDQA 2OPPA 3BF3A 3VERA 5LJVA 3CJCA 1VQ7N 1W0HA 2HBLA 3OYDA 4KV8A 4B9QA 3VESA 4EP5A 4DR2K 3O5BA 2FF6A 4LH5A 1VSKA 5C42A 4CZMA 3ZEUA 5AQSA 4H03B 4JEPA 4BQLA 3AY9A 1Q7YO 4RCHA 3TAPA 4MLHA 3CPEA 1LW0A 3DXMB 5FLXO 1SKSA 4IO8A 2FBYA 5HROA 1OH8A 4UQGA 4X62K 3JXUA 3PX6A 4CEEA 3LL3A 3KKRA 1EETA 2D5RA 3ZSVA 3R8EA 4KRFA 4DQPA 5AR0A 3G6EN 2HNZA 3TTCA 2YV0X 1JL2A 5AQGA 2GX9A 4Z0UA 5LY3A 1RDWX 3PSFA 3ZYYX 2HMIA 3V6DA 2V52B 1JLGA 5IT9O 3SBGA 1NK9A 3P4IA 4WQ4C 3K5OA 1GLLO 1Y97A 3ULDA 2OZSA 1C6VA 4BDPA 2Y1JA 1RBVA 2PYLA 3C6TA 4DFPA 1BG3A 1HYZA 4BRQA 1KFSA 4A5BA 2Q97A 3BY5A 3V9XA 4B9SA 5HRRA 3D7EO 1EO1A 3O6WA 4X66K 3MDQA 3ALYA 1LWFA 4IWVA 1MWKA 1V4TA 2A6AA 3RSEA 1KCFA 1L3VA 2QM1A 3MMVA 2Z1HA 4AHVA 1JCFA 3TABA 4FSVA 1LW2A 1TGOA 3SUPA 3E66A 1CZAN 4FCYA 3CCJN 3ULEB 5F1XA 1S1UA 1HX1A 1VQMN 3NHGA 3UKRB 3UE5A 2I7NA 4B1YB 3VOVA 3DMJA 1ZBLA 2HBKA 4YOUA 2QK9A 2VG6A 5KI6A 3CCVN 4CFCA 3TANA 5KQ8A 4PHTX 5AFUH 3HM8A 2GEMA 3HO1A 4RW7A 3MXMA 4MDAA 3V1OA 4B1WB 3AVMA 2NLXA 5F0XA 4DR5K 4ELTA 1XC9A 4CJVA 5BPMA 1WBDA 4CF8A 4EIAA 1KTQA 2KKZA 2OA8A 3VEYA 4OGCA 3AARA 2HSTA 3THVA 3KWIA 2QKKA 2F9TA 1ILYA 4JI0K 1TK8A 1O13A 2DTUA 1NGJA 3DXMA 4FO0A 1WSJA 1XHZA 5BREA 4FK2A 4CFBA 4CD1A 3H1QA 4E89A 3OYBA 4CBUA 3SAHA 2D1KA 5AQXA 1VQ5N 4ICLA 3PY8A 3VQ7A 1S6QA 3OY9A 2OPSA 3JSMA 3O9SA 4NYFA 1C0UA 2P5GA 4RG8A 4MFBA 4Z94A 4JRPA 3IRXA 3JAMO 1TAQA 3J7AP 5GADP 1IBKK 4IG0A 2Z1IA 4H4MA 3HVRA 3AAPA 4CZEA 3TR8A 1NGBA 1VRUA 3HXMA 1S1TA 1O1WA 4QAGA 4CJTA 3FR0A 4BREA 3B6PA 1BCMA 3CYMA 3CCLN 1CXUA 3ZCMA 2VCPA 3CJ7A 4CJEA 3ID8A 2W42A 3AGRA 3C95A 4DSEA 1VSFA 4YFUA 5I9EB 4LSLA 2E20A 5GAHP 4FLZA 3O9UA 3T7ZA 4B3TK 3PX4A 3DLGA 4WQ5A 1BA1A 1RT5A 3I0RA 1LCUA 2Q0RA 4CF9A 4QCLA 2EX3A 2YX6A 3P1GA 4CGIA 4ELUA 4BDYA 2IAJA 3UKRA 3WXLA 4HTLA 5CHIA 2AJQA 1QSLA 1SZ2A 3TTDA 4CEDA 3W3DA 3MECA 3A8YA 4A5AA 3MAQA 4NCBA 3EY1A 4X65K 2QWQA 3AA5X 4LY7A 1RTIA 4A61A 3K59A 5CYMA 1DKGD 1EWRA 1TKZA 1IBLK 3RMBA 2FBXA 1M1KO 2EWSA 4CJ7A 3V9WA 3OYLA 4EAHD 1LV5A 4QS8A 1GLJO 3SQ1A 3WT0A 4IOXA 3LM9A 5KRSA 1XNQK 4R5PA 2IGIA 1NMNA 3P5JA 4RW8A 2R7YA 1L3TA 4LFCK 4B9TA 4MQ3A 5SWMA 3L2UA 3QIOA 4CE9A 3SQ0A 4L3QA 3KWGA 3KVGA 3AA4A 4B3RK 3LWLA 4FLYA 2I5JA 3K0SA 4M3YA 4B8AB 4JHDA 1YIJN 3NF8A 4CJFA 4FLXA 3JYTA 2UUAK 4H5WA 1Z26A 1YTAA 3CG7A 3H46O 3NCIA 3NH2A 1NJXA 4J2DA 4CHOA 4OO1J 4CJKA 5HRPA 3S3NA 4NLBA 3PO5A 4M3WA 1FKOA 4JK9A 5FPMA 1D5AA 3T1HK 4CK3A 2UXDK 5BR9A 2YNHA 4PUOA 4F8RA 4FWPA 4BGBA 3CI5A 1VK0A 4CERA 1BQMA 4K41A 2Q36A 3GG4A 4AH9A 3I33A 3TTFA 4IO9L 3CCQN 1YAGA 2WOMA 3AVCA 3DXKB 5M1OA 5AQJA 4GV6A 2RN2A 2PBDA 3O3HA 1U45A 1HUXA 1NGIA 3WXJA 2E2NA 1BDGA 1ATNA 3QEIA 1LWCA 4JI1K 5AQPA 2KFNA 4FJ5A 4CBXA 4IG3A 4FWLA 1EP4A 3EZ5A 1WLJA 4CZFA 1U47A 2EHGA 4BC3A 4CZLA 3LZJA 2B5JA 4KO0A 1KLNA 4C8NA 1REVA 2HHQA 4DFJA 3D2EA 1Q82O 3F2KA 1LOTB 4ID5A 3LM2A 3HSCA 4WFNL 2VWBA 3ZT4A 4BR9A 4FZZA 1Z25A 2A1RA 1U49A 1RT4A 5AQVA 1N8RO 2FBVA 1YHQN 4V19S 2ZGZA 2UXCK 2GUIA 3WNEA 1RGIA 1WSGA 2KZMA 4EZ9A 4A2BA 4YY3K 5EX5A 5DM6L 4DQIA 3I8BA 1KVAA 2JLEA 3SQ4A 1Q81O 4HUEA 1HKCA 3OYGA 3A2FA 2V51B 4N5SA 1D9FA 2A40A 1VRTA 4BRMA 4HUFA 1S9EA 4BR4A 1IJJA 4FWOA 3EZWA 2OTLN 4XH1A 4AHTA 3KLHA 3EE9A 1RT7A 5AQHA 3RMCA 3NBPA 1W97L 4FJLA 1C1AA 5JVHL 3J81O 1TK0A 1CLQA 3M5RA 1VQLN 2YJFA 5GAEP 4B3SK 3EKUA 4MO5A 5KPRA 4K25A 2E8AA 5C2FA 4FJNA 2V7YA 1LAVA 3QNOA 5AQKA 2KTQA 2NUBA 1NK4A 1X9JA 3ENOA 1J9AA 3SUOA 2QW9A 4K0KK 3VTIA 1BO5O 1XQSC 4JKEA 3SMSA 5KPTA 1WAFA 1YXQA 4F3TA 4FJKA 4DR7K 2DFFA 4I2PA 3AO3A 5J2MA 3QESA 2FBTA 5MLCQ 5FPNA 5E41A 5CZ2A 1R0AA 4OKJA 4AM6A 4IOAL 2WFBA 1CXQA 2WTUA 2ZGYA 4GW6A 1IH7A 4PQUA 5AQIA 4M3RA 2NRXA 4XEIA 1EX4A 1T44A 3OYMA 4FLVA 1IKVA 3CFOA 1SL2A 1MU2A 1V4SA 5J1EA 4DR3K 3R1XA 5HP1A 2D0OA 3LPTA 4O8UA 4JI6K 1JLAA 3VA3A 2O8FB 2HNDA 3NH0A 4ILGB 4DR4K 1A5XA 2A1SA 4AILC 1J6ZA 3EKSA 4CIGA 1HKBA 4G9ZA 3AVIA 4W5TA 1SKRA 3G25A 4C1NI 3VTHA 4F2RA 4CECA 2ZD1A 3R3LA 4A2AA 3RR7A 3J80O 3L3VA 3OS0A 3S3MA 4YORA 3KKSA 3AVNA 3THYB 1SUQA 1RDCA 4RW6A 2Z1GA 4BRDA 2F96A 1SL0A 2BH1A 1FKPA 1U2VB 4IDHA 3VQ6A 3RVCA 2ZJPL 3BZKA 3VEVA 3QB0A 1NKBA 3WQTA 5BRDA 5BPNA 3LPUA 3U3GA 3MWPA 3F9KA 3DYAA 4C23A 5HL7L 2ASOA 4JAXA 2VQFK 3KTQA 1KSPA 3P38A 4DTPA 3MX2A 3GDQA 3KLIA 4I7FA 4KKOA 4BRIA 2QTDA 3HBTA 4ILHA 2W6LA 4DS5A 1BI4B 1RT6A 4F9OA 2XY6A 2A41A 3K2PA 5AQWA 4FLUA 1Q18A 2P5OA 1T8EA 4E7LA 1P8ZA 5LMNK 4DU1A 3VA0A 3VF2A 2B4JA 3VQDA 2YNGA 5H1SQ 3L8BA 2PYJA 3OVNA 1YTUA 3VENA 3J8AA 1I3AA 3RRGA 4NO7A 3DLBA 2GUPA 3OYNA 5DMRA 4HVJA 4JKFA 2DY4A 4LF8K 2E2PA 2DFHA 3QICA 3NF9A 3LDNA 4OGEA 4EHUA 1T3VA 3EN9A 4Z4HA 4FZXC 1RT2A 4U7BA 2G8FA 1TK5A 3AVBA 4DV5K 1RBSA 3CQ8A 4O0JA 3SCXA 4IEIA 1X1PA 3CCSN 2O8FA 1NM1A 4BRLA 3VQBA 4J2AA 1ZXOA 1GOCA 3EO3A 3FZMA 2W6KA 4JKAA 1KVBA 3F73A 3G4SN 4E19A 5FROA 1RTJA 4DV0K 3KLGA 1VQ8N 3C6UA 4H0VB 2P51A 3THYA 1LWEA 4CEOA 1K8KB 2VGNA 1L5UA 3HT3A 3OYJA 5BPLA 1U2VA 1ZBIA 2ASMA 3ITHA 3L6QA 5KGXA 2OZMA 1NJIO 2VGMA 3CJBA 4DUYK 3VEOA 4W5NA 4AHSA 4BR7A 3KK7A 4I6MB 3VGMA 1NGHA 2ETJA 5LMUK 1HQEA 1ZBFA 4BG9A 1KC8O 3T1YK 3T1AA 4DTMA 4AHUA 4H0XB 4BACA 1NG9A 4FYDA 3W0LA 1BI4A 5E84A 3DRRA 3VMFB 1KFDA 4PWDA 3M3ZA 1NJZA 1IG9A 3AVLA 2X6NA 1EQYA 3TAMA 1TUYA 3LWMA 2IS3A 4A62A 2YNIA 5ELZA 2YHWA 2VG7A 2HBJA 5AQYA 3RMDA 3HPHA 2FC0A 3C0BA 4OLAA 3SPZA 3C6AA 4J2EA 1IKXA 1HJRA 3TSUA 3WNHA 1RDDA 2D0CA 3G0ZA 1VQKN 1JLEA 4N41A 5LL6Z 4Y1CA 3WNFA 3MN5A 5FPDA 2E2QA 3MEEA 2HHVA 4M45A 4CD3A 1F21A 5JS2A 3SV4A 3OBYA 4LSNA 3KLEA 1VAZA 3OBWA 4B1ZA 3SAFA 3A5OC 3BUZB 2ZQBA 1TVRA 4KB0A 4YHHK 4MDBA 4BGAA 4BE2A 3MCPA 4AQYK 3ENHA 3LALA 4TSXA 5C25A 3DOLA 2YI1A 1BA0A 4ISEA 4JK7A 1XHXA 3UKUB 2YNFA 2Q1NA 2V7ZA 2VYPA 3O80A 2VG5A 3AO5A 1K9MO 4JK8A 4C8MA 3DLKA 4NXNK 1P90A 4I2QA 4CEQA 4JD2B 4BR5A 1K8KA 4FM1A 3MN7A 3R9PA 4ID1A 5FRNA 3CJ9A 3SNNA 2QA4N 2B6AA 2FSJA 1WNSA 3SUNA 4IZ9A 3VQAA 3QNNA 4CHZA 4DTJA 3K9JA 2F4VK 4CJUA 4XH4A 4YNQA 3EEQA 3TAFA 1B92A 1GLCG 2KHOA 4OKEA 3U9DA 3TU5A 3NGZA 1ESVA 3AV9A 4I6MA 1IKWA 4CGGA 4Z4EA 3WEEB 2P9LB 4CBWA 4FJ8A 1ATRA 5AQMA 1N6QA 3CF5L 4CK1A 3N4QA 5GINA 3D6RA 2WUSA 2XO7A 4I9QA 4CZKA 1JCEA 3VQPA 4DWIA 1DTQA 4DSLA 3OW2M 4OLBA 4U67L 4FPAA 4BY9C 3ULEA 5AQFA 4LFAK 1VSHA 5KQDA 2NRTA 2UUCK 2YHXA 3QDKA 4IFYA 4WFAL 1HRHA 4ILJA 1VQPN 3E1YA 5M1FA 3L4QA 3QFPA 4BC2A 5BN8A 2G8VA 3DLRA 4JKDA 2O8DB 3QINA 1S1WA 2HHXA 2KFZA 4KI4A 3PO4A 4DCHA 4LF4K 3EYZA 1NJYA 1NKEA 3EL2A 3PIOL 4O5BA 4IFEA 4FJ7A 3MN9A 2G8KA 1U6ZA 1QVGM 4O5FA 1L3UA 4FJXA 1NBWA 5GIOA 2GTDA 1DEJA 3CM5A 3QLHA 3T3FA 3PLAA 5KTQA 3RRHA 3UKUA 3OYHA 3LDLA 3L2QA 3GL1A 4DTSA 1WOQA 2F7TA 3JS6A 4FW1A 1YVNA 5SZTA 3LDSA 1WAJA 2OCEA 1N34K 4LF5K 4FVUA 2E88A 1GLFO 3B6OA 2P9NB 2NZTA 5BR8K 5BRHA 1DLOA 3AVKA 3AVAA 1HYSA 1TKXA 4IBNA 2DFEA 1OH6A 1VSDA 4B1UB 4KHQA 3O9TA 3WEEA 2HB5A 2P9LA 4CHYA 2HHWA 2LSNA 3ZSRA 3DLHA 2X74A 5B8HA 4YDUC 3KD5E 4KAZA 4WQ4A 1X9MA 1S1XA 3ZSYA 3A5NC 4CZIA 3HRGA 4Z4FA 1DGKN 1B9FA 4O55A 3AGKA 4Z4IA 1QVFM 2ZM6K 5TKWA 4B9LA 4CEAA 2QWOA 1HNZK 1RBUA 4NLCA 3SZ2A 2UUBK 3BGRA 3P31A 3HVTA 3HTVA 5C12A 3DLLL 3H45C 4E7IA 1ASUA 3CQYA 3VF6A 3H3OB 3ZT2A 3ZLJA 1MA9B 3SJHA 3IS9A 2GWJA 1ASWA 4Y1DA 2QWMA 4WFBL 3MK6A 4GV9A 1KXPA 2BE2A 2O8DA 4DQ8A 4AHCA 3O08A 2A5XA 1Q8IA 3O1WA 1C0GA 3I55N 3HK2A 1ZBHA 1HQUA 2RF2A 4ELVA 4F2SA 4KHSA 3F5TA 1QQMA 3FLCO 1YT3A 3WNGA 4IJAA 2BANA 3HP9A 1QHTA 2F9WA 3G71N 5AQQA 2P1JA 3BDPA 3KZBA 5JICA 3ASMA 3QEVA 4NXMK 2NRHA 5JVGL 2FF3B 3NH1A 2CH6A 4GV3A 3SJJA 1NGGA 3SLCA 3TSQA 4H5RA 4B9MA 2HVHA 1QQCA 1T7PA 3QEXA 3CFRA 4DLGA 4KHUA 3I56N 4IDKA 4DQQA 2ZF5O 2UXBK 4JI3K 1W7AA 4N56A 1S6PA 4FJMA 4BC5A 2P9NA 4C8LA 1NNEA 1KLMA 2VWJA 3KHYA 1D9DA 1S9GA 4DUZK 1WSFA 4OPHA 3HOSA 5FRMA 2QI2A 2ZJQL 1ASVA 3T69A 4DSIA 3P83D 3K9KA 1JLQA 4FLTA 1KQSM 5CYQA 5FDLA 4GKKK 1TL1A 3HOTA 1C0FA 4QS9A 3VQCA 4L8RB 2UYTA 5EY4A 4BRPA 4CGHA 3S9HA 4Q5VA 5AQTA 3TI0A 1QZ6A 4JNEA 1G99A 3NMUA 1QSSA 3P39A 5HRNA 5JMVA 4IKFA 3AO1A 1BOTO 3VGLA 1JCGA 2OTJN 4GVMA 3CCMN 3VF4A 5AZIB 4OPAA 3LAKA 1XWLA 3AA3A 3IDHA 4IFVA 3PUFA 3DXKA 3E9LA 4LC9B 2ASPA 4PKIA 4FWRA 3M6GA 4KREA 4WF9L 1WSEA 4DFKA 2D0BA 3DWLA 4M7YA 5EU7A 1ITGA 3E01A 1M90O 5AQRA 3AVGA 2GELA 1BIZA 4KTZA 3MXIA 3RTVA 4B08A 4EFHA 2QWLA 3CJ1A 2ATQA 4MO4A 5AZJB 3B8AX 2Q0UA 5KRTA 4BDZA 4BE1A 3V9ZA 3FGUA 2AA4A 4B9VA 1GOAA 3CCUN 1A5VA 2HF4A 1B9DA 3TAGA 4KB1A 4B1XB 4FWMA 3PSIA 2ZJRL 1NK8A 3DRSA 1X9WA 4PKHA 3T19A 3M8SA 3CC4N 4E1MA 3ZX3A 3CC2N 4FM2A 3C65A 1EKEA 1ZC6A 2ITMA 1RDBA 5TKYA 3G10A 3V9SA 5HOOA 4CJPA 2QXLA 3FFIA 4CCHA 4CF1A 3C7NB 4XIUA 1YITN 3CM6A 3O8MA 4KBOA 3DLEA 5M1QA 1S3XA 3NF6A 3C94A 1NK6A 5JLHA 1XUPO 4O0IA 2Z1JA 3ZX2A 5C0YA 2UU9K 5CR4A 4H0OA 1N32K 1SKWA 3CFPA 1S22A 3HL8A 1NKCA 4MLEA 3PX0A 3ZEUB 4H0YB 2FLOA 2XY5A 1NK7A 3RWUA 1ZBSA 3TAQA 4DV1K 1RBTA 5M1PA 1QQOA 3QETA 3THWB 1T03A 3AO2A 4BR0A 5AQLA 2IVPA 4F4KA 2RHKA 1YJWN 4FWQA 1UA1A 4CJ3A 3IUCA 4KTWA 3M8QA 3RMAA 4FOEA 4Z4CA 4OJRA 1EWQA 5AZIA 1RBRA 2HOEA 3KLFA 3HSTB 3LZIA 3DOKA 1RDUA 4IXCA 4BWMA 3LP0A 1X3MA 1ZBUA 3O4NA 3HPGA 3U6FA 4CJWA 1FXXA 5C2DA 3FZLA 4FJJA 1BGXT 4K8ZA 4RW9A 2VQEK 2E1ZA 1BUPA 3I0SA 1JLFA 4WE1A 3NFAA 3UIQA 4DS4A 3VPZA 4IOCL 1JXBA 2O4GA 1W2BM 4FJIA 4KI6A 1ZYQA 3HJFA 2KW4A 4HTUA 1TAUA 3RSEB 4X64K 1OH7A 1HNXK 3AAQA 3BEXA 5A2QO 4E3SA 3FFKB 1VSMA 3U4LA 2Q2RA 4DV4K 5BN9A 1VSJA 1BU6O 1CZBA 3KK3A 4FLWA 1RTDA 2IC3A 1XI1A 1BCOA 1BWFO 5I42A 3CMAN 2QWRA 1HNVA 2YHAA 2NRVA 5M1NA 3O1BA 3QEPA 4C8KA 5HLFA 4M42A 3O9QA 3FZFA 4N47A 4H5NA 3SAGA 3IG1A 4LFBK 4HWIA 3BP8A 3MN6A 1QSYA 1OKJA 3H6EA 4KFBA 2D0PA 3ZT0A 5ADXA 1NLVA 3DI6A 4DKWA 4OKKA 3HPOA 5C10A 1GLDG 1R59O 4O4GA 4AF1A 3E9PA 1RT3A 1U48A 4B8CA 3V81A 3DJCA 3THWA 3MEDA 1Q9XA 5DM7L 4K8XA 2CGJA 4AM7A 1YJ9N 2A3ZA 1E4FT 1YI2N 1YUWA 4CEZA 4B9NA 4KHWA 5D3GA 3WQUA 1N36K 1VSEA 4E1JA 3OS1A 1NGEA 2RPIA 2W40A 4FWNA 1XMQK 4BRHA 4PL7A 4FK0A 4DU4A 4CHNA 5LJWA 3GBTA 1WB9A 4UY8O 2D0AA 3VETA 3L2RA 2Q3SA 3AVFA 2ZE2A 5F2RA 3NF7A 3K57A 3LP2A 1Z05A 2RKIA 1NK0A 3BF1A 4DV7K 3LAMA 2YKNA 3ZSXA 4O44A 4W5RA 1C1BA 2P9PB 2QEXN 2G8UA 3M8RA 4DF8A 1XC3A 4JRQA 1QQNA 5J2NA 4DTOA 4ZTFA 1IO2A 4NCGA 3SPYA 3L4IA 2HHSA 3VN5A 4RWTA 4PL8A 1H1VA 3KJVA 1KAYA 3CMEN 3EE8A 4DR1K 4CEFA 4DG1A 1OH5A 1NOZA 2FXUA 2BGGA 4BVOA 2E6LA 2XY8A 4FJ9A 4M41A 4LH4A 4RTFD 1SS6A 3CETA 4BROA 3QERA 4J2BA 1FJGK 3VEZA 3DM2A 3KIOA 1SL1A 1IV0A 1HNWK 5KPZA 4DU3A 2H3GX 2CGKA 3OYIA 4CVNE 1GLAG 1QTMA 4JS5A 1CZ9A 4DTUA 2OPQA 2KZZA 1NJWA 4H5TA 4DQRA 1XNRK 1RNHA 2AP1A 1HLUA 2P9IB 3UB5A 1ATSA 3L2VA 1BHLA 1T6CA 1TL3A 2P9SB 3ZSQA 1JL1A 4A57A 2QXFA 3O3FA 4DHYA 3A5MC 1IBMK 4W5OA 4DB3A 4LF6K 2O8CB 4FPBA 2O8EB 4ISFA 1JLBA 4CJLA 1KAZA 3LDOA 3VGKA 3U9ZA 4BRCA 4CJRA 2HNYA 3HP6A 3WUHA 4CEBA 5JS1A 2A42A 2YHBA 5AFUA 4CGJA 3V9UA 4DSKA 3SYZA 4AHRA 2YJEA 2DPNA 1JJ2M 4GVEA 3BZCA 4JHDB 3NAEA 4FW2A 1NGAA 3LANA 5HRSA 3Q7CA 4M3UA 4GY2B 4M63C 1QS4A 2E1YA 1TV6A 4JI4K 4DTRA 2JWLA 3Q7BA 4JI5K 3F9MA 2P9PA 3AVHA 3M1FA 3ISNC 3GOIA 3ID6A 4E7KA 3TARA 1VHXA 1GLBG 3WXKA 4KHPK 2HMPA 4W5QA 3H3NO 2E2OA 1HPMA 4O8KA 4BQZA 5KGWA 4NCAA 1T05A 4FL9A 3V1RA 4BE0A 4E0DA 3D45A 4OX9K 2PZSA 3L0QA 5E26A 3K58A 4HUGA 2X78A 3CIPA 1Q9YA 4JKGB 1Y64A 1RDAA 3SUQA 3J7ZO 4CJ5A 4C1NK 2X6SA 4WCEL 3V1QA 4CGDA 1NU0A 5AQNA 4CESA 4KHYA 1UA0A 1RILA 3VQ8A 3J7YP 1VQ9N 2BUPA 4FK4A 3QFUA 1WN7A 1VQNN 3CPWM 1SQKA 3M8PA 2F8TA 2P9IA 1WBBA 5C15A 2NRZA 2XY7A 2P9SA 3THXB 2F8SA 4HCCA 2WONA 4M7XA 4DSFA 4E1NA 1U04A 3OYEA 3D2EB 3AA2A 4H8KA 3MWTA 4JD2A 1XMOK 2E4LA 3NGYA 4KPYA 3SBTA 3NDKA 3CC7N 4RW4A 1TKTA 1E3MA 3KK1A 2BDPA 2O8CA 2I7PA 1HKGA 2O8EA 3HZ6A 1YVUA 4NYNA 1UOCA 3ZSOA 3DAWA 4JYAK 2P9KB 5T7BA 3CERA 4BC4A 4BRGA 3TAEA 3D2FB 3O3GA 2IOCA 4WYBA 4FOIA 1A5WA 5C24A 1JKHA 1RFQA 5I3UA 3SI6A 3CQXA 3IAYA 4C8OA 3ZX0A 4PY5A 4FWKA 1S5JA 3TWHA 1KVCA 4FM0A 4H0TB 4YOTA 1E4GT 4EZ6A 4CJQA 1WSHA 1BISA 2D4WA 4DSJA 3DRPA 3VEWA 4XH5A 4BRKA 1QHAA 4BVPA 3O9RA 3K5LA 1Z6RA 4CF0A 4DLEA 4LF9K 4J8FA 4OPJA 4BRFA 1RCHA 4F3OA 3ZT3A 4BR2A 1LAWA 1X9SA 3VQEA 4CHPA 3OHRA 4FXDA 1SV5A 2G8HA 4Z4GA 2RE2A 2QKBA 4A59A 1YF5L 2HW3A 4JKGA 1OVYA 3MCAB 3VEXA 1MWMA 3SMPA 1K6YA 4LF7K 4CZHA 1JLCA 1N33K 1NMDA 4DV2K 3ZSWA 2YKMA 4FJGA 4PKGA 3HYFA 4BRAA 3V4IA 1KRPA 2O4IA 5GIPA 2YCHA 2O8BB 4E7HA 3TSPA 3WXIA 1T6DA 2OANA 1D4XA 1S72N 3QIPA 2ITGA 3OJSA 4HHTA 1TYQB 5CY4A 3THXA 1TKDA 3VQ4A 2IDOA 4M3XA 3IKMA 2JWKA 5HBMA 2PAVA 4DQSA 4CJSA 3FZHA 2GWKA 3L2WA 4DR6K 4QS7A 2G8IA 3OJUA 2PFUA 4CHQA 2QWNA 4BWJA 3K5MA 3ZETB 4IJNA 4H0PA 1GOBA 4ZHRA 5JLFA 2P9KA 3A0IX 3VQ5A 2HHHK 1K8AO 3U8XA 1HNIA 1IG8A 4JKHA 3OYCA 4JV5K 3D2FA 4JKBA 3SV3A 5AQOA 3KK2A 4N76A 3QO9A 3KD1E 1N5YA 2P9UB 1QZ5A 3QMLA 2XRIA 4OVLA 2NRWA 5EOYA 1VQ6N 1VSLA 1QE1A 3CCRN 4LD0A 2OYQA 4FZYA 4DMNA 1WUAA 4CGFA 2XHBA 4JS4A 2FSNA 4GNIA 4YOYA 5AQUA 2KLAA 4CJ4A 1G15A 3FE1A 5J2QA 4CZGA 2OPRA 1OVQA 2W41A 3OA9A 1HPZA 2HHTA 1NGDA 3VQQA 2J4RA 5AJ3K 4HCBA 1HMVA 4CFDA 1UWBA 3LDPA 2IVNA 2IVOA 3R6MA 2HBMA 1W9HA 1D8YA 1EXQA 4H4OA 3CCEN 2JGUA 3MX5A 4IEEA 3CHWA 5J2PA 3WXMB 4CIEA 4JLHA 2Y1IA 4M3TA 5DK5A 3CXCM 3QBXA 3HM9A 3PIPL 3NVMA 4I9LA 4CW7B 4YOWA 2HVIA 3VQ9A 1FW6A 3OYFA 4BRNA 3S3OA 3ATUA 4Y0WA 2O8BA 1BL3A 2WBNA 1JXEA 1NGCA 3PV8A 2HF3A 4CFAA 4B9UA 2WC9A 1TUUA 3LP3A 4CIFA 4DF4A 4QOZB 4GMJB 4R79A 3TPQA 5M1KA 1TYQA 4KH5A 4FWSA 3H08A 5EXWA 2KQ2A 5CZ1A 1L3SA 4YOXA 3OYAA 4CI6A 4EP4A 1IKYA
chains in the Genus database with same CATH topology
4CK1A 2HHUA 3QEIA 1RT1A 2XO7A 4CEZA 4B9NA 4I9QA 1LWCA 3D0PA 4KHWA 5D3GA 3VQPA 1S1VA 4DWIA 4CK2A 4DTXA 4B3OA 1VSEA 4FJ5A 2KFNA 4IG3A 3OS1A 2RPIA 1DTQA 4E7JA 1U4BA 4DSLA 1UAXA 4OLBA 1EP4A 4KTQA 3EZ5A 1WLJA 4FK0A 4DU4A 1U47A 4CHNA 2EHGA 3LZJA 1VSHA 2B5JA 4KO0A 1KLNA 2D0AA 3L2RA 4C8NA 1REVA 3AVJA 3OS2A 2Q3SA 2HHQA 4DFJA 3AVFA 4M3ZA 2ZE2A 4FJJA 3NF7A 3ZT1A 3NGIA 4ID5A 3K57A 3LP2A 2E6MA 2RKIA 3OYKA 1NK0A 3O4QA 4IFYA 1HRHA 3ZT4A 1FK9A 2YKNA 3LAMA 3ZSXA 4FZZA 1Z25A 4O44A 4W5RA 1J53A 1J5OA 1C1BA 2A1RA 2G8UA 3M8RA 4DF8A 1U49A 2G8VA 3DLRA 1RT4A 4JRQA 5J2NA 2FBVA 4DTOA 4ZTFA 3QINA 1IO2A 1S1WA 2GUIA 1DTTA 4ZTJA 4KI4A 4NCGA 3WNEA 2HHXA 2KFZA 1WSGA 3NE6A 1BIUA 3ZSZA 2KZMA 4EZ9A 3PO4A 1BQNA 3SPYA 2GV9A 4CF2A 1HYVA 3L3UA 2HHSA 3VN5A 1I39A 3EYZA 1NJYA 1NKEA 3KJVA 4DQIA 1J54A 1KVAA 2JLEA 4O5BA 4CEFA 3SQ4A 2G8WA 4DG1A 4FJ7A 2G8KA 4HUEA 3I8DA 3K5NA 1NOZA 1L3UA 3OYGA 2BGGA 2E6LA 2XY8A 4FJXA 3MEGA 3A2FA 4FJ9A 2VWKA 4N5SA 4M41A 4LH4A 3CM5A 1D9FA 1C0TA 3QLHA 3T3FA 3QERA 4J2BA 5KTQA 3RRHA 1VRTA 3MXJA 4HUFA 3OYHA 1S9EA 3DM2A 3L2QA 3KIOA 1SL1A 1C0MA 4DU3A 1C1CA 3U3YA 4G1QA 1RTHA 1NK5A 1WSIA 3OYIA 4AHTA 3KLHA 4KHNA 4DTSA 1RT7A 3RR8A 3RMCA 3NBPA 4FW1A 5SZTA 3LDSA 1WAJA 3SQ2A 1QTMA 4JS5A 4FJLA 1C1AA 4DFMA 1CZ9A 1TK0A 4DTUA 2OPQA 4PA1A 2KZZA 1CLQA 2PY5A 4DTNA 3B6OA 1NJWA 4DQRA 2OA8A 4FJNA 5K14A 1RNHA 1LAVA 1DLOA 3QNOA 2KTQA 2NUBA 1NK4A 3AVKA 3AVAA 1HYSA 1J9AA 1TKXA 4IBNA 3L2VA 2DFEA 3LP1A 1BHLA 1TL3A 1VSDA 3ZSQA 3SUOA 1NOYA 1JL1A 4KHQA 3AO4A 4FVMA 4Q0BA 3QEWA 4FJHA 2HB5A 2QXFA 3O3FA 1VSIA 4CHYA 2HHWA 2LSNA 3ZSRA 2GBZA 4OPKA 3DLHA 2X74A 4W5OA 1WAFA 2OPPA 3KD5E 4KAZA 1X9MA 4F3TA 1S1XA 1JLBA 3ZSYA 1W0HA 4CJLA 4FJKA 2DFFA 3OYDA 4Z4FA 4KV8A 4I2PA 1B9FA 3AO3A 4O55A 4Z4IA 4EP5A 4CJRA 5J2MA 3QESA 2FBTA 4B9LA 4LH5A 1VSKA 2HNYA 4CEAA 5C42A 3HP6A 1RBUA 5CZ2A 5E41A 3SZ2A 4CEBA 5JS1A 1R0AA 2YHBA 3BGRA 4OKJA 4CGJA 3V9UA 4DSKA 3SYZA 4AHRA 3HVTA 3TAPA 1LW0A 4E7IA 1ASUA 4FW2A 3NAEA 1CXQA 1SKSA 3LANA 5HRSA 4GW6A 2FBYA 3ZT2A 1IH7A 4PQUA 4M3UA 5HROA 4UQGA 1QS4A 1TV6A 4DTRA 3IS9A 4M3RA 3PX6A 4CEEA 1ASWA 1EETA 2D5RA 3KKRA 1EX4A 4Y1DA 3ZSVA 3AVHA 1IKVA 3CFOA 3OYMA 4FLVA 1MU2A 3ISNC 1SL2A 4DQPA 2BE2A 5J1EA 2HNZA 5HP1A 2YV0X 1JL2A 3LPTA 4E7KA 4Z0UA 3TARA 2HHVA 4W5QA 1JLAA 3VA3A 4AHCA 2HNDA 2HMIA 3V6DA 1Q8IA 3HK2A 1JLGA 3NH0A 1NK9A 1ZBHA 1HQUA 2RF2A 4ELVA 4F2SA 4KHSA 1A5XA 2A1SA 5KGWA 4AILC 1T05A 4NCAA 3V1RA 1YT3A 3K5OA 3WNGA 1Y97A 4CIGA 4BE0A 2BANA 3ULDA 2OZSA 3HP9A 1QHTA 4E0DA 3D45A 3AVIA 1C6VA 4BDPA 2Y1JA 2PZSA 4W5TA 1RBVA 1SKRA 2PYLA 3K58A 4F2RA 4CECA 4HUGA 2ZD1A 3C6TA 1U45A 2P1JA 2X78A 4DFPA 3BDPA 3RR7A 1Q9YA 1HYZA 3L3VA 1KFSA 1NKCA 3ASMA 3QEVA 3V9XA 3NH1A 1RDAA 3OS0A 3SUQA 3S3MA 3SJJA 4B9SA 3KKSA 5HRRA 3AVNA 4CJ5A 1SUQA 1RDCA 2X6SA 4B9MA 2HVHA 3V1QA 4CGDA 1QQCA 4RW6A 4KHYA 4CESA 3ALYA 1T7PA 1UA0A 1LWFA 2Z1GA 1RILA 3CFRA 3QEXA 2F96A 1SL0A 3VQ8A 4DLGA 4KHUA 1L3VA 4IDKA 4DQQA 1FKPA 1KCFA 4FK4A 2Z1HA 4AHVA 1WN7A 4N56A 3VQ6A 1S6PA 4FJMA 1NKBA 4C8LA 1KLMA 2VWJA 3TABA 1LW2A 3LPUA 3M8PA 1S9GA 3U3GA 1TGOA 1D9DA 2F8TA 3F9KA 3DYAA 4KRFA 3SUPA 1WSFA 5FRMA 4FCYA 1ASVA 4DSIA 3P83D 2XY7A 1S1UA 1JLQA 4FLTA 3NHGA 5CYQA 2F8SA 5FDLA 4HCCA 1TL1A 1KSPA 3KTQA 4DTPA 3DMJA 2WONA 3KLIA 4DSFA 3VQCA 1ZBLA 4E1NA 2VG6A 1U04A 4I7FA 5KI6A 3OYEA 4CFCA 3AA2A 4H8KA 3TANA 4L8RB 4KKOA 2E4LA 3NGYA 4KPYA 3NDKA 4CGHA 3HO1A 4DS5A 4RW4A 4RW7A 3MXMA 1TKTA 3S9HA 1BI4B 4Q5VA 3KK1A 2BDPA 3TI0A 3V1OA 1RT6A 3AVMA 1YVUA 2XY6A 2P5OA 3K2PA 4NYNA 4FLUA 1T8EA 1UOCA 3ZSOA 1QSSA 5HRNA 4ELTA 4IKFA 3AO1A 4E7LA 1XC9A 4CJVA 4GVMA 5T7BA 4CF8A 4DU1A 1KTQA 3LAKA 3VA0A 1XWLA 2B4JA 3AA3A 3VQDA 2YNGA 4OGCA 3L8BA 3TAEA 4IFVA 3THVA 2PYJA 3OVNA 2QKKA 3O3GA 3PUFA 1YTUA 2IOCA 1TK8A 2DTUA 1A5WA 5C24A 1JKHA 5I3UA 3SI6A 1I3AA 4KREA 3RRGA 1WSJA 3IAYA 1XHZA 3OYNA 3DLBA 1WSEA 5DMRA 4DFKA 4C8OA 4FK2A 4PY5A 4CFBA 2D0BA 4HVJA 2DY4A 1S5JA 5EU7A 2DFHA 1ITGA 4E89A 3OYBA 3TWHA 3E01A 1Q9XA 1KVCA 3AVGA 3NF9A 1BIZA 4FM0A 4OGEA 4KTZA 3MXIA 4ICLA 4CJQA 4B08A 4Z4HA 1WSHA 1BISA 1RT2A 3RTVA 4EZ6A 4FZXC 3PY8A 2G8FA 4DSJA 1TK5A 3AVBA 2ATQA 3DRPA 3VQ7A 1S6QA 1RBSA 5KRTA 3OY9A 3CQ8A 4O0JA 4BDZA 4BE1A 3V9ZA 4B9VA 3K5LA 1GOAA 2OPSA 3SCXA 1X1PA 1A5VA 3JSMA 1B9DA 4CF0A 4DLEA 4NYFA 1C0UA 2P5GA 3TAGA 4RG8A 4MFBA 4OPJA 3VQBA 4JRPA 1RCHA 4KB1A 3IRXA 3ZT3A 1TAQA 4F3OA 4J2AA 1GOCA 1LAWA 1X9SA 3VQEA 4CHPA 1KVBA 1NK8A 3DRSA 4FXDA 1SV5A 1X9WA 2G8HA 4IG0A 2Z1IA 3F73A 3T19A 4Z4GA 3M8SA 4H4MA 2QKBA 3HVRA 4E19A 5FROA 1RTJA 3TR8A 1VRUA 3HXMA 1S1TA 1O1WA 4QAGA 4E1MA 3KLGA 2HW3A 4CJTA 4FM2A 1EKEA 1K6YA 1RDBA 3C6UA 3G10A 3B6PA 1BCMA 2P51A 3CYMA 1LWEA 1CXUA 3V9SA 3ZCMA 3FFIA 4CJPA 1JLCA 4CEOA 4CJEA 4CF1A 4CCHA 4XIUA 1L5UA 2W42A 3ZSWA 2YKMA 3C95A 3CM6A 4DSEA 3DLEA 3HT3A 3NF6A 3OYJA 4FJGA 3C94A 3HYFA 1VSFA 4YFUA 1NK6A 4LSLA 3V4IA 1KRPA 2O4IA 4O0IA 4FLZA 2Z1JA 3PX4A 4E7HA 3ITHA 1ZBIA 3DLGA 5KGXA 2OZMA 1RT5A 3I0RA 1SKWA 3CFPA 4W5NA 3HL8A 3QIPA 2ITGA 4AHSA 4CF9A 3OJSA 3PX0A 4HHTA 2EX3A 3P1GA 4CGIA 5CY4A 4ELUA 4QCLA 1TKDA 3VQ4A 2IDOA 4BDYA 4M3XA 2IAJA 2XY5A 2ETJA 1NK7A 3RWUA 5HBMA 1HQEA 1ZBFA 3TAQA 4DQSA 4CJSA 3QETA 1RBTA 1QSLA 2AJQA 3L2WA 4CEDA 3T1AA 4DTMA 1T03A 2G8IA 3MECA 4AHUA 3AO2A 3OJUA 4BACA 4CHQA 3MAQA 3EY1A 4NCBA 4FYDA 1BI4A 4BWJA 3K5MA 3DRRA 4F4KA 1KFDA 3AA5X 4LY7A 4PWDA 1RTIA 1UA1A 4CJ3A 1NJZA 1GOBA 3K59A 5CYMA 3AVLA 4ZHRA 1IG9A 4KTWA 3M8QA 3RMAA 2X6NA 3VQ5A 3TAMA 1TKZA 3LWMA 4Z4CA 2IS3A 4OJRA 3RMBA 1RBRA 2YNIA 3KLFA 1HNIA 2FBXA 3HSTB 3LZIA 3DOKA 3OYCA 3V9WA 3OYLA 3SV3A 4BWMA 2VG7A 1LV5A 3KK2A 3LP0A 4N76A 3QO9A 3SQ1A 3RMDA 3HPHA 2FC0A 1ZBUA 1N5YA 3KD1E 4OLAA 3O4NA 3SPZA 4OVLA 1IKXA 2XRIA 3HPGA 4J2EA 1VSLA 3U6FA 1HJRA 1FXXA 1QE1A 4CJWA 4LD0A 3WNHA 5KRSA 1RDDA 4R5PA 2OYQA 2D0CA 3G0ZA 1BGXT 2IGIA 1JLEA 4FZYA 4N41A 4Y1CA 3WNFA 4DMNA 3MEEA 3P5JA 4K8ZA 4RW8A 4M45A 1F21A 4RW9A 4CGFA 2XHBA 2R7YA 4JS4A 1L3TA 5JS2A 3I0SA 4CJ4A 1JLFA 3SV4A 4WE1A 1G15A 4B9TA 3NFAA 3UIQA 4LSNA 4DS4A 4MQ3A 5SWMA 3KLEA 3L2UA 3QIOA 5J2QA 1JXBA 2O4GA 2OPRA 4CE9A 4FJIA 3SQ0A 4KI6A 1ZYQA 1HPZA 3HJFA 2HHTA 2KW4A 3AA4A 4HTUA 3LWLA 4FLYA 2I5JA 3VQQA 1TAUA 4HCBA 1HMVA 4M3YA 2ZQBA 4B8AB 1TVRA 4KB0A 4CFDA 1UWBA 3NF8A 4E3SA 4CJFA 4FLXA 3JYTA 4BE2A 1VSMA 1W9HA 1Z26A 1D8YA 1YTAA 3LALA 1EXQA 4TSXA 3CG7A 5C25A 4H4OA 3NCIA 3DOLA 2JGUA 1VSJA 1CZBA 3NH2A 3KK3A 4FLWA 1NJXA 1RTDA 5J2PA 4J2DA 1XHXA 4CHOA 2IC3A 1XI1A 1BCOA 2YNFA 4JLHA 4CIEA 2Y1IA 5I42A 4M3TA 2VG5A 3AO5A 5DK5A 4CJKA 5HRPA 3S3NA 4C8MA 1HNVA 2YHAA 3HM9A 3DLKA 3QEPA 4C8KA 2QK9A 4I2QA 4CEQA 4FM1A 4I9LA 3PO5A 4M3WA 5HLFA 4M42A 2HVIA 4ID1A 3VQ9A 1FKOA 5FRNA 3SNNA 3OYFA 1D5AA 2B6AA 4CK3A 4N47A 2YNHA 1WNSA 3S3OA 3SUNA 4PUOA 4F8RA 3VQAA 3IG1A 3QNNA 4CHZA 1BL3A 4DTJA 1JXEA 4CJUA 4YNQA 3PV8A 4CFAA 1QSYA 4B9UA 1VK0A 4CERA 3LP3A 4KFBA 1BQMA 3TAFA 1B92A 4AH9A 3ZT0A 4CIFA 4DF4A 4QOZB 4GMJB 4OKEA 3DI6A 3NGZA 3AV9A 4OKKA 3HPOA 1IKWA 4CGGA 4Z4EA 2WOMA 3H08A 4O4GA 3AVCA 1RT3A 2KQ2A 5CZ1A 1L3SA 2RN2A 4FJ8A 1U48A 4B8CA 3V81A 3OYAA 3MEDA 4EP4A 3O3HA 1IKYA 4K8XA 1N6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CK1 A;  2HHU A;  3QEI A;  1RT1 A;  2XO7 A;  4CEZ A;  4B9N A;  4I9Q A;  1LWC A;  3D0P A;  4KHW A;  5D3G A;  3VQP A;  1S1V A;  4DWI A;  4CK2 A;  4DTX A;  4B3O A;  1VSE A;  4FJ5 A;  2KFN A;  4IG3 A;  3OS1 A;  2RPI A;  1DTQ A;  4E7J A;  1U4B A;  4DSL A;  1UAX A;  4OLB A;  1EP4 A;  4KTQ A;  3EZ5 A;  1WLJ A;  4FK0 A;  4DU4 A;  1U47 A;  4CHN A;  2EHG A;  3LZJ A;  1VSH A;  2B5J A;  4KO0 A;  1KLN A;  2D0A A;  3L2R A;  4C8N A;  1REV A;  3AVJ A;  3OS2 A;  2Q3S A;  2HHQ A;  4DFJ A;  3AVF A;  4M3Z A;  2ZE2 A;  4FJJ A;  3NF7 A;  3ZT1 A;  3NGI A;  4ID5 A;  3K57 A;  3LP2 A;  2E6M A;  2RKI A;  3OYK A;  1NK0 A;  3O4Q A;  4IFY A;  1HRH A;  3ZT4 A;  1FK9 A;  2YKN A;  3LAM A;  3ZSX A;  4FZZ A;  1Z25 A;  4O44 A;  4W5R A;  1J53 A;  1J5O A;  1C1B A;  2A1R A;  2G8U A;  3M8R A;  4DF8 A;  1U49 A;  2G8V A;  3DLR A;  1RT4 A;  4JRQ A;  5J2N A;  2FBV A;  4DTO A;  4ZTF A;  3QIN A;  1IO2 A;  1S1W A;  2GUI A;  1DTT A;  4ZTJ A;  4KI4 A;  4NCG A;  3WNE A;  2HHX A;  2KFZ A;  1WSG A;  3NE6 A;  1BIU A;  3ZSZ A;  2KZM A;  4EZ9 A;  3PO4 A;  1BQN A;  3SPY A;  2GV9 A;  4CF2 A;  1HYV A;  3L3U A;  2HHS A;  3VN5 A;  1I39 A;  3EYZ A;  1NJY A;  1NKE A;  3KJV A;  4DQI A;  1J54 A;  1KVA A;  2JLE A;  4O5B A;  4CEF A;  3SQ4 A;  2G8W A;  4DG1 A;  4FJ7 A;  2G8K A;  4HUE A;  3I8D A;  3K5N A;  1NOZ A;  1L3U A;  3OYG A;  2BGG A;  2E6L A;  2XY8 A;  4FJX A;  3MEG A;  3A2F A;  4FJ9 A;  2VWK A;  4N5S A;  4M41 A;  4LH4 A;  3CM5 A;  1D9F A;  1C0T A;  3QLH A;  3T3F A;  3QER A;  4J2B A;  5KTQ A;  3RRH A;  1VRT A;  3MXJ A;  4HUF A;  3OYH A;  1S9E A;  3DM2 A;  3L2Q A;  3KIO A;  1SL1 A;  1C0M A;  4DU3 A;  1C1C A;  3U3Y A;  4G1Q A;  1RTH A;  1NK5 A;  1WSI A;  3OYI A;  4AHT A;  3KLH A;  4KHN A;  4DTS A;  1RT7 A;  3RR8 A;  3RMC A;  3NBP A;  4FW1 A;  5SZT A;  3LDS A;  1WAJ A;  3SQ2 A;  1QTM A;  4JS5 A;  4FJL A;  1C1A A;  4DFM A;  1CZ9 A;  1TK0 A;  4DTU A;  2OPQ A;  4PA1 A;  2KZZ A;  1CLQ A;  2PY5 A;  4DTN A;  3B6O A;  1NJW A;  4DQR A;  2OA8 A;  4FJN A;  5K14 A;  1RNH A;  1LAV A;  1DLO A;  3QNO A;  2KTQ A;  2NUB A;  1NK4 A;  3AVK A;  3AVA A;  1HYS A;  1J9A A;  1TKX A;  4IBN A;  3L2V A;  2DFE A;  3LP1 A;  1BHL A;  1TL3 A;  1VSD A;  3ZSQ A;  3SUO A;  1NOY A;  1JL1 A;  4KHQ A;  3AO4 A;  4FVM A;  4Q0B A;  3QEW A;  4FJH A;  2HB5 A;  2QXF A;  3O3F A;  1VSI A;  4CHY A;  2HHW A;  2LSN A;  3ZSR A;  2GBZ A;  4OPK A;  3DLH A;  2X74 A;  4W5O A;  1WAF A;  2OPP A;  3KD5 E;  4KAZ A;  1X9M A;  4F3T A;  1S1X A;  1JLB A;  3ZSY A;  1W0H A;  4CJL A;  4FJK A;  2DFF A;  3OYD A;  4Z4F A;  4KV8 A;  4I2P A;  1B9F A;  3AO3 A;  4O55 A;  4Z4I A;  4EP5 A;  4CJR A;  5J2M A;  3QES A;  2FBT A;  4B9L A;  4LH5 A;  1VSK A;  2HNY A;  4CEA A;  5C42 A;  3HP6 A;  1RBU A;  5CZ2 A;  5E41 A;  3SZ2 A;  4CEB A;  5JS1 A;  1R0A A;  2YHB A;  3BGR A;  4OKJ A;  4CGJ A;  3V9U A;  4DSK A;  3SYZ A;  4AHR A;  3HVT A;  3TAP A;  1LW0 A;  4E7I A;  1ASU A;  4FW2 A;  3NAE A;  1CXQ A;  1SKS A;  3LAN A;  5HRS A;  4GW6 A;  2FBY A;  3ZT2 A;  1IH7 A;  4PQU A;  4M3U A;  5HRO A;  4UQG A;  1QS4 A;  1TV6 A;  4DTR A;  3IS9 A;  4M3R A;  3PX6 A;  4CEE A;  1ASW A;  1EET A;  2D5R A;  3KKR A;  1EX4 A;  4Y1D A;  3ZSV A;  3AVH A;  1IKV A;  3CFO A;  3OYM A;  4FLV A;  1MU2 A;  3ISN C;  1SL2 A;  4DQP A;  2BE2 A;  5J1E A;  2HNZ A;  5HP1 A;  2YV0 X;  1JL2 A;  3LPT A;  4E7K A;  4Z0U A;  3TAR A;  2HHV A;  4W5Q A;  1JLA A;  3VA3 A;  4AHC A;  2HND A;  2HMI A;  3V6D A;  1Q8I A;  3HK2 A;  1JLG A;  3NH0 A;  1NK9 A;  1ZBH A;  1HQU A;  2RF2 A;  4ELV A;  4F2S A;  4KHS A;  1A5X A;  2A1S A;  5KGW A;  4AIL C;  1T05 A;  4NCA A;  3V1R A;  1YT3 A;  3K5O A;  3WNG A;  1Y97 A;  4CIG A;  4BE0 A;  2BAN A;  3ULD A;  2OZS A;  3HP9 A;  1QHT A;  4E0D A;  3D45 A;  3AVI A;  1C6V A;  4BDP A;  2Y1J A;  2PZS A;  4W5T A;  1RBV A;  1SKR A;  2PYL A;  3K58 A;  4F2R A;  4CEC A;  4HUG A;  2ZD1 A;  3C6T A;  1U45 A;  2P1J A;  2X78 A;  4DFP A;  3BDP A;  3RR7 A;  1Q9Y A;  1HYZ A;  3L3V A;  1KFS A;  1NKC A;  3ASM A;  3QEV A;  3V9X A;  3NH1 A;  1RDA A;  3OS0 A;  3SUQ A;  3S3M A;  3SJJ A;  4B9S A;  3KKS A;  5HRR A;  3AVN A;  4CJ5 A;  1SUQ A;  1RDC A;  2X6S A;  4B9M A;  2HVH A;  3V1Q A;  4CGD A;  1QQC A;  4RW6 A;  4KHY A;  4CES A;  3ALY A;  1T7P A;  1UA0 A;  1LWF A;  2Z1G A;  1RIL A;  3CFR A;  3QEX A;  2F96 A;  1SL0 A;  3VQ8 A;  4DLG A;  4KHU A;  1L3V A;  4IDK A;  4DQQ A;  1FKP A;  1KCF A;  4FK4 A;  2Z1H A;  4AHV A;  1WN7 A;  4N56 A;  3VQ6 A;  1S6P A;  4FJM A;  1NKB A;  4C8L A;  1KLM A;  2VWJ A;  3TAB A;  1LW2 A;  3LPU A;  3M8P A;  1S9G A;  3U3G A;  1TGO A;  1D9D A;  2F8T A;  3F9K A;  3DYA A;  4KRF A;  3SUP A;  1WSF A;  5FRM A;  4FCY A;  1ASV A;  4DSI A;  3P83 D;  2XY7 A;  1S1U A;  1JLQ A;  4FLT A;  3NHG A;  5CYQ A;  2F8S A;  5FDL A;  4HCC A;  1TL1 A;  1KSP A;  3KTQ A;  4DTP A;  3DMJ A;  2WON A;  3KLI A;  4DSF A;  3VQC A;  1ZBL A;  4E1N A;  2VG6 A;  1U04 A;  4I7F A;  5KI6 A;  3OYE A;  4CFC A;  3AA2 A;  4H8K A;  3TAN A;  4L8R B;  4KKO A;  2E4L A;  3NGY A;  4KPY A;  3NDK A;  4CGH A;  3HO1 A;  4DS5 A;  4RW4 A;  4RW7 A;  3MXM A;  1TKT A;  3S9H A;  1BI4 B;  4Q5V A;  3KK1 A;  2BDP A;  3TI0 A;  3V1O A;  1RT6 A;  3AVM A;  1YVU A;  2XY6 A;  2P5O A;  3K2P A;  4NYN A;  4FLU A;  1T8E A;  1UOC A;  3ZSO A;  1QSS A;  5HRN A;  4ELT A;  4IKF A;  3AO1 A;  4E7L A;  1XC9 A;  4CJV A;  4GVM A;  5T7B A;  4CF8 A;  4DU1 A;  1KTQ A;  3LAK A;  3VA0 A;  1XWL A;  2B4J A;  3AA3 A;  3VQD A;  2YNG A;  4OGC A;  3L8B A;  3TAE A;  4IFV A;  3THV A;  2PYJ A;  3OVN A;  2QKK A;  3O3G A;  3PUF A;  1YTU A;  2IOC A;  1TK8 A;  2DTU A;  1A5W A;  5C24 A;  1JKH A;  5I3U A;  3SI6 A;  1I3A A;  4KRE A;  3RRG A;  1WSJ A;  3IAY A;  1XHZ A;  3OYN A;  3DLB A;  1WSE A;  5DMR A;  4DFK A;  4C8O A;  4FK2 A;  4PY5 A;  4CFB A;  2D0B A;  4HVJ A;  2DY4 A;  1S5J A;  5EU7 A;  2DFH A;  1ITG A;  4E89 A;  3OYB A;  3TWH A;  3E01 A;  1Q9X A;  1KVC A;  3AVG A;  3NF9 A;  1BIZ A;  4FM0 A;  4OGE A;  4KTZ A;  3MXI A;  4ICL A;  4CJQ A;  4B08 A;  4Z4H A;  1WSH A;  1BIS A;  1RT2 A;  3RTV A;  4EZ6 A;  4FZX C;  3PY8 A;  2G8F A;  4DSJ A;  1TK5 A;  3AVB A;  2ATQ A;  3DRP A;  3VQ7 A;  1S6Q A;  1RBS A;  5KRT A;  3OY9 A;  3CQ8 A;  4O0J A;  4BDZ A;  4BE1 A;  3V9Z A;  4B9V A;  3K5L A;  1GOA A;  2OPS A;  3SCX A;  1X1P A;  1A5V A;  3JSM A;  1B9D A;  4CF0 A;  4DLE A;  4NYF A;  1C0U A;  2P5G A;  3TAG A;  4RG8 A;  4MFB A;  4OPJ A;  3VQB A;  4JRP A;  1RCH A;  4KB1 A;  3IRX A;  3ZT3 A;  1TAQ A;  4F3O A;  4J2A A;  1GOC A;  1LAW A;  1X9S A;  3VQE A;  4CHP A;  1KVB A;  1NK8 A;  3DRS A;  4FXD A;  1SV5 A;  1X9W A;  2G8H A;  4IG0 A;  2Z1I A;  3F73 A;  3T19 A;  4Z4G A;  3M8S A;  4H4M A;  2QKB A;  3HVR A;  4E19 A;  5FRO A;  1RTJ A;  3TR8 A;  1VRU A;  3HXM A;  1S1T A;  1O1W A;  4QAG A;  4E1M A;  3KLG A;  2HW3 A;  4CJT A;  4FM2 A;  1EKE A;  1K6Y A;  1RDB A;  3C6U A;  3G10 A;  3B6P A;  1BCM A;  2P51 A;  3CYM A;  1LWE A;  1CXU A;  3V9S A;  3ZCM A;  3FFI A;  4CJP A;  1JLC A;  4CEO A;  4CJE A;  4CF1 A;  4CCH A;  4XIU A;  1L5U A;  2W42 A;  3ZSW A;  2YKM A;  3C95 A;  3CM6 A;  4DSE A;  3DLE A;  3HT3 A;  3NF6 A;  3OYJ A;  4FJG A;  3C94 A;  3HYF A;  1VSF A;  4YFU A;  1NK6 A;  4LSL A;  3V4I A;  1KRP A;  2O4I A;  4O0I A;  4FLZ A;  2Z1J A;  3PX4 A;  4E7H A;  3ITH A;  1ZBI A;  3DLG A;  5KGX A;  2OZM A;  1RT5 A;  3I0R A;  1SKW A;  3CFP A;  4W5N A;  3HL8 A;  3QIP A;  2ITG A;  4AHS A;  4CF9 A;  3OJS A;  3PX0 A;  4HHT A;  2EX3 A;  3P1G A;  4CGI A;  5CY4 A;  4ELU A;  4QCL A;  1TKD A;  3VQ4 A;  2IDO A;  4BDY A;  4M3X A;  2IAJ A;  2XY5 A;  2ETJ A;  1NK7 A;  3RWU A;  5HBM A;  1HQE A;  1ZBF A;  3TAQ A;  4DQS A;  4CJS A;  3QET A;  1RBT A;  1QSL A;  2AJQ A;  3L2W A;  4CED A;  3T1A A;  4DTM A;  1T03 A;  2G8I A;  3MEC A;  4AHU A;  3AO2 A;  3OJU A;  4BAC A;  4CHQ A;  3MAQ A;  3EY1 A;  4NCB A;  4FYD A;  1BI4 A;  4BWJ A;  3K5M A;  3DRR A;  4F4K A;  1KFD A;  3AA5 X;  4LY7 A;  4PWD A;  1RTI A;  1UA1 A;  4CJ3 A;  1NJZ A;  1GOB A;  3K59 A;  5CYM A;  3AVL A;  4ZHR A;  1IG9 A;  4KTW A;  3M8Q A;  3RMA A;  2X6N A;  3VQ5 A;  3TAM A;  1TKZ A;  3LWM A;  4Z4C A;  2IS3 A;  4OJR A;  3RMB A;  1RBR A;  2YNI A;  3KLF A;  1HNI A;  2FBX A;  3HST B;  3LZI A;  3DOK A;  3OYC A;  3V9W A;  3OYL A;  3SV3 A;  4BWM A;  2VG7 A;  1LV5 A;  3KK2 A;  3LP0 A;  4N76 A;  3QO9 A;  3SQ1 A;  3RMD A;  3HPH A;  2FC0 A;  1ZBU A;  1N5Y A;  3KD1 E;  4OLA A;  3O4N A;  3SPZ A;  4OVL A;  1IKX A;  2XRI A;  3HPG A;  4J2E A;  1VSL A;  3U6F A;  1HJR A;  1FXX A;  1QE1 A;  4CJW A;  4LD0 A;  3WNH A;  5KRS A;  1RDD A;  4R5P A;  2OYQ A;  2D0C A;  3G0Z A;  1BGX T;  2IGI A;  1JLE A;  4FZY A;  4N41 A;  4Y1C A;  3WNF A;  4DMN A;  3MEE A;  3P5J A;  4K8Z A;  4RW8 A;  4M45 A;  1F21 A;  4RW9 A;  4CGF A;  2XHB A;  2R7Y A;  4JS4 A;  1L3T A;  5JS2 A;  3I0S A;  4CJ4 A;  1JLF A;  3SV4 A;  4WE1 A;  1G15 A;  4B9T A;  3NFA A;  3UIQ A;  4LSN A;  4DS4 A;  4MQ3 A;  5SWM A;  3KLE A;  3L2U A;  3QIO A;  5J2Q A;  1JXB A;  2O4G A;  2OPR A;  4CE9 A;  4FJI A;  3SQ0 A;  4KI6 A;  1ZYQ A;  1HPZ A;  3HJF A;  2HHT A;  2KW4 A;  3AA4 A;  4HTU A;  3LWL A;  4FLY A;  2I5J A;  3VQQ A;  1TAU A;  4HCB A;  1HMV A;  4M3Y A;  2ZQB A;  4B8A B;  1TVR A;  4KB0 A;  4CFD A;  1UWB A;  3NF8 A;  4E3S A;  4CJF A;  4FLX A;  3JYT A;  4BE2 A;  1VSM A;  1W9H A;  1Z26 A;  1D8Y A;  1YTA A;  3LAL A;  1EXQ A;  4TSX A;  3CG7 A;  5C25 A;  4H4O A;  3NCI A;  3DOL A;  2JGU A;  1VSJ A;  1CZB A;  3NH2 A;  3KK3 A;  4FLW A;  1NJX A;  1RTD A;  5J2P A;  4J2D A;  1XHX A;  4CHO A;  2IC3 A;  1XI1 A;  1BCO A;  2YNF A;  4JLH A;  4CIE A;  2Y1I A;  5I42 A;  4M3T A;  2VG5 A;  3AO5 A;  5DK5 A;  4CJK A;  5HRP A;  3S3N A;  4C8M A;  1HNV A;  2YHA A;  3HM9 A;  3DLK A;  3QEP A;  4C8K A;  2QK9 A;  4I2Q A;  4CEQ A;  4FM1 A;  4I9L A;  3PO5 A;  4M3W A;  5HLF A;  4M42 A;  2HVI A;  4ID1 A;  3VQ9 A;  1FKO A;  5FRN A;  3SNN A;  3OYF A;  1D5A A;  2B6A A;  4CK3 A;  4N47 A;  2YNH A;  1WNS A;  3S3O A;  3SUN A;  4PUO A;  4F8R A;  3VQA A;  3IG1 A;  3QNN A;  4CHZ A;  1BL3 A;  4DTJ A;  1JXE A;  4CJU A;  4YNQ A;  3PV8 A;  4CFA A;  1QSY A;  4B9U A;  1VK0 A;  4CER A;  3LP3 A;  4KFB A;  1BQM A;  3TAF A;  1B92 A;  4AH9 A;  3ZT0 A;  4CIF A;  4DF4 A;  4QOZ B;  4GMJ B;  4OKE A;  3DI6 A;  3NGZ A;  3AV9 A;  4OKK A;  3HPO A;  1IKW A;  4CGG A;  4Z4E A;  2WOM A;  3H08 A;  4O4G A;  3AVC A;  1RT3 A;  2KQ2 A;  5CZ1 A;  1L3S A;  2RN2 A;  4FJ8 A;  1U48 A;  4B8C A;  3V81 A;  3OYA A;  3MED A;  4EP4 A;  3O3H A;  1IKY A;  4K8X A;  1N6Q A; 
#chains in the Genus database with same CATH topology
 4CZJ A;  2HHU A;  3H1V X;  3ZET A;  1RT1 A;  3C6H A;  4KH4 A;  1VQ4 N;  3D0P A;  2ZWH A;  3NVK A;  3A5L C;  1S1V A;  2BTF A;  4CK2 A;  4K43 A;  4DTX A;  4B3O A;  1U4B A;  2FSK A;  3SK3 A;  4B1V A;  4E7J A;  1UAX A;  2Q31 A;  4KTQ A;  1HJO A;  4ISG A;  4KH6 A;  2QWP A;  3IFR A;  5GAG P;  4YOV A;  2IIR A;  3AVJ A;  3OS2 A;  4M3Z A;  1SAZ A;  1Q86 O;  2P9U A;  2NRR A;  3ZT1 A;  3NGI A;  2NNW A;  3N4P A;  2E6M A;  2CH5 A;  3E9O A;  3OYK A;  3O4Q A;  5EVZ A;  1FK9 A;  1KD1 O;  1J53 A;  1J5O A;  5BRF A;  4NB4 A;  4JI8 K;  4JN4 A;  1DTT A;  4EHT A;  4ZTJ A;  3NE6 A;  1BIU A;  3ZSZ A;  1BQN A;  3QBW A;  2GV9 A;  4CF2 A;  1HYV A;  3FZK A;  3GE1 A;  3L3U A;  1I39 A;  5AQZ A;  1J54 A;  4JI2 K;  2G8W A;  1KAX A;  1DT9 A;  3HI0 A;  3I8D A;  3K5N A;  1GLE G;  4WQ5 C;  3MEG A;  4K42 A;  4YDU A;  3ATV A;  2VWK A;  1YJN N;  4DV3 K;  1C0T A;  3MXJ A;  5CE3 A;  5ADX H;  5IWA K;  1MDU B;  1C0M A;  5AZJ A;  1C1C A;  3U3Y A;  4G1Q A;  1RTH A;  3CD6 N;  1NK5 A;  1HR0 K;  1WSI A;  4KHN A;  3RR8 A;  5FPE A;  3SQ2 A;  4GKJ K;  4BG8 A;  4DFM A;  1NWK A;  4PA1 A;  1NGF A;  2PY5 A;  4DTN A;  4H5V A;  4B3M K;  5K14 A;  3O4W A;  3S41 A;  4DV6 K;  3LP1 A;  3CJA A;  1X3N A;  1VQO N;  1NOY A;  2CGL A;  1I94 K;  4JI7 K;  1K73 O;  3AO4 A;  4FVM A;  4Q0B A;  3QEW A;  3ENB A;  4FJH A;  1J5E K;  1VSI A;  4JKC A;  3C7N A;  2E5L K;  2GBZ A;  4OPK A;  3IMX A;  3OTO K;  2YHY A;  3LDQ A;  2OPP A;  3BF3 A;  3VER A;  5LJV A;  3CJC A;  1VQ7 N;  1W0H A;  2HBL A;  3OYD A;  4KV8 A;  4B9Q A;  3VES A;  4EP5 A;  4DR2 K;  3O5B A;  2FF6 A;  4LH5 A;  1VSK A;  5C42 A;  4CZM A;  3ZEU A;  5AQS A;  4H03 B;  4JEP A;  4BQL A;  3AY9 A;  1Q7Y O;  4RCH A;  3TAP A;  4MLH A;  3CPE A;  1LW0 A;  3DXM B;  5FLX O;  1SKS A;  4IO8 A;  2FBY A;  5HRO A;  1OH8 A;  4UQG A;  4X62 K;  3JXU A;  3PX6 A;  4CEE A;  3LL3 A;  3KKR A;  1EET A;  2D5R A;  3ZSV A;  3R8E A;  4KRF A;  4DQP A;  5AR0 A;  3G6E N;  2HNZ A;  3TTC A;  2YV0 X;  1JL2 A;  5AQG A;  2GX9 A;  4Z0U A;  5LY3 A;  1RDW X;  3PSF A;  3ZYY X;  2HMI A;  3V6D A;  2V52 B;  1JLG A;  5IT9 O;  3SBG A;  1NK9 A;  3P4I A;  4WQ4 C;  3K5O A;  1GLL O;  1Y97 A;  3ULD A;  2OZS A;  1C6V A;  4BDP A;  2Y1J A;  1RBV A;  2PYL A;  3C6T A;  4DFP A;  1BG3 A;  1HYZ A;  4BRQ A;  1KFS A;  4A5B A;  2Q97 A;  3BY5 A;  3V9X A;  4B9S A;  5HRR A;  3D7E O;  1EO1 A;  3O6W A;  4X66 K;  3MDQ A;  3ALY A;  1LWF A;  4IWV A;  1MWK A;  1V4T A;  2A6A A;  3RSE A;  1KCF A;  1L3V A;  2QM1 A;  3MMV A;  2Z1H A;  4AHV A;  1JCF A;  3TAB A;  4FSV A;  1LW2 A;  1TGO A;  3SUP A;  3E66 A;  1CZA N;  4FCY A;  3CCJ N;  3ULE B;  5F1X A;  1S1U A;  1HX1 A;  1VQM N;  3NHG A;  3UKR B;  3UE5 A;  2I7N A;  4B1Y B;  3VOV A;  3DMJ A;  1ZBL A;  2HBK A;  4YOU A;  2QK9 A;  2VG6 A;  5KI6 A;  3CCV N;  4CFC A;  3TAN A;  5KQ8 A;  4PHT X;  5AFU H;  3HM8 A;  2GEM A;  3HO1 A;  4RW7 A;  3MXM A;  4MDA A;  3V1O A;  4B1W B;  3AVM A;  2NLX A;  5F0X A;  4DR5 K;  4ELT A;  1XC9 A;  4CJV A;  5BPM A;  1WBD A;  4CF8 A;  4EIA A;  1KTQ A;  2KKZ A;  2OA8 A;  3VEY A;  4OGC A;  3AAR A;  2HST A;  3THV A;  3KWI A;  2QKK A;  2F9T A;  1ILY A;  4JI0 K;  1TK8 A;  1O13 A;  2DTU A;  1NGJ A;  3DXM A;  4FO0 A;  1WSJ A;  1XHZ A;  5BRE A;  4FK2 A;  4CFB A;  4CD1 A;  3H1Q A;  4E89 A;  3OYB A;  4CBU A;  3SAH A;  2D1K A;  5AQX A;  1VQ5 N;  4ICL A;  3PY8 A;  3VQ7 A;  1S6Q A;  3OY9 A;  2OPS A;  3JSM A;  3O9S A;  4NYF A;  1C0U A;  2P5G A;  4RG8 A;  4MFB A;  4Z94 A;  4JRP A;  3IRX A;  3JAM O;  1TAQ A;  3J7A P;  5GAD P;  1IBK K;  4IG0 A;  2Z1I A;  4H4M A;  3HVR A;  3AAP A;  4CZE A;  3TR8 A;  1NGB A;  1VRU A;  3HXM A;  1S1T A;  1O1W A;  4QAG A;  4CJT A;  3FR0 A;  4BRE A;  3B6P A;  1BCM A;  3CYM A;  3CCL N;  1CXU A;  3ZCM A;  2VCP A;  3CJ7 A;  4CJE A;  3ID8 A;  2W42 A;  3AGR A;  3C95 A;  4DSE A;  1VSF A;  4YFU A;  5I9E B;  4LSL A;  2E20 A;  5GAH P;  4FLZ A;  3O9U A;  3T7Z A;  4B3T K;  3PX4 A;  3DLG A;  4WQ5 A;  1BA1 A;  1RT5 A;  3I0R A;  1LCU A;  2Q0R A;  4CF9 A;  4QCL A;  2EX3 A;  2YX6 A;  3P1G A;  4CGI A;  4ELU A;  4BDY A;  2IAJ A;  3UKR A;  3WXL A;  4HTL A;  5CHI A;  2AJQ A;  1QSL A;  1SZ2 A;  3TTD A;  4CED A;  3W3D A;  3MEC A;  3A8Y A;  4A5A A;  3MAQ A;  4NCB A;  3EY1 A;  4X65 K;  2QWQ A;  3AA5 X;  4LY7 A;  1RTI A;  4A61 A;  3K59 A;  5CYM A;  1DKG D;  1EWR A;  1TKZ A;  1IBL K;  3RMB A;  2FBX A;  1M1K O;  2EWS A;  4CJ7 A;  3V9W A;  3OYL A;  4EAH D;  1LV5 A;  4QS8 A;  1GLJ O;  3SQ1 A;  3WT0 A;  4IOX A;  3LM9 A;  5KRS A;  1XNQ K;  4R5P A;  2IGI A;  1NMN A;  3P5J A;  4RW8 A;  2R7Y A;  1L3T A;  4LFC K;  4B9T A;  4MQ3 A;  5SWM A;  3L2U A;  3QIO A;  4CE9 A;  3SQ0 A;  4L3Q A;  3KWG A;  3KVG A;  3AA4 A;  4B3R K;  3LWL A;  4FLY A;  2I5J A;  3K0S A;  4M3Y A;  4B8A B;  4JHD A;  1YIJ N;  3NF8 A;  4CJF A;  4FLX A;  3JYT A;  2UUA K;  4H5W A;  1Z26 A;  1YTA A;  3CG7 A;  3H46 O;  3NCI A;  3NH2 A;  1NJX A;  4J2D A;  4CHO A;  4OO1 J;  4CJK A;  5HRP A;  3S3N A;  4NLB A;  3PO5 A;  4M3W A;  1FKO A;  4JK9 A;  5FPM A;  1D5A A;  3T1H K;  4CK3 A;  2UXD K;  5BR9 A;  2YNH A;  4PUO A;  4F8R A;  4FWP A;  4BGB A;  3CI5 A;  1VK0 A;  4CER A;  1BQM A;  4K41 A;  2Q36 A;  3GG4 A;  4AH9 A;  3I33 A;  3TTF A;  4IO9 L;  3CCQ N;  1YAG A;  2WOM A;  3AVC A;  3DXK B;  5M1O A;  5AQJ A;  4GV6 A;  2RN2 A;  2PBD A;  3O3H A;  1U45 A;  1HUX A;  1NGI A;  3WXJ A;  2E2N A;  1BDG A;  1ATN A;  3QEI A;  1LWC A;  4JI1 K;  5AQP A;  2KFN A;  4FJ5 A;  4CBX A;  4IG3 A;  4FWL A;  1EP4 A;  3EZ5 A;  1WLJ A;  4CZF A;  1U47 A;  2EHG A;  4BC3 A;  4CZL A;  3LZJ A;  2B5J A;  4KO0 A;  1KLN A;  4C8N A;  1REV A;  2HHQ A;  4DFJ A;  3D2E A;  1Q82 O;  3F2K A;  1LOT B;  4ID5 A;  3LM2 A;  3HSC A;  4WFN L;  2VWB A;  3ZT4 A;  4BR9 A;  4FZZ A;  1Z25 A;  2A1R A;  1U49 A;  1RT4 A;  5AQV A;  1N8R O;  2FBV A;  1YHQ N;  4V19 S;  2ZGZ A;  2UXC K;  2GUI A;  3WNE A;  1RGI A;  1WSG A;  2KZM A;  4EZ9 A;  4A2B A;  4YY3 K;  5EX5 A;  5DM6 L;  4DQI A;  3I8B A;  1KVA A;  2JLE A;  3SQ4 A;  1Q81 O;  4HUE A;  1HKC A;  3OYG A;  3A2F A;  2V51 B;  4N5S A;  1D9F A;  2A40 A;  1VRT A;  4BRM A;  4HUF A;  1S9E A;  4BR4 A;  1IJJ A;  4FWO A;  3EZW A;  2OTL N;  4XH1 A;  4AHT A;  3KLH A;  3EE9 A;  1RT7 A;  5AQH A;  3RMC A;  3NBP A;  1W97 L;  4FJL A;  1C1A A;  5JVH L;  3J81 O;  1TK0 A;  1CLQ A;  3M5R A;  1VQL N;  2YJF A;  5GAE P;  4B3S K;  3EKU A;  4MO5 A;  5KPR A;  4K25 A;  2E8A A;  5C2F A;  4FJN A;  2V7Y A;  1LAV A;  3QNO A;  5AQK A;  2KTQ A;  2NUB A;  1NK4 A;  1X9J A;  3ENO A;  1J9A A;  3SUO A;  2QW9 A;  4K0K K;  3VTI A;  1BO5 O;  1XQS C;  4JKE A;  3SMS A;  5KPT A;  1WAF A;  1YXQ A;  4F3T A;  4FJK A;  4DR7 K;  2DFF A;  4I2P A;  3AO3 A;  5J2M A;  3QES A;  2FBT A;  5MLC Q;  5FPN A;  5E41 A;  5CZ2 A;  1R0A A;  4OKJ A;  4AM6 A;  4IOA L;  2WFB A;  1CXQ A;  2WTU A;  2ZGY A;  4GW6 A;  1IH7 A;  4PQU A;  5AQI A;  4M3R A;  2NRX A;  4XEI A;  1EX4 A;  1T44 A;  3OYM A;  4FLV A;  1IKV A;  3CFO A;  1SL2 A;  1MU2 A;  1V4S A;  5J1E A;  4DR3 K;  3R1X A;  5HP1 A;  2D0O A;  3LPT A;  4O8U A;  4JI6 K;  1JLA A;  3VA3 A;  2O8F B;  2HND A;  3NH0 A;  4ILG B;  4DR4 K;  1A5X A;  2A1S A;  4AIL C;  1J6Z A;  3EKS A;  4CIG A;  1HKB A;  4G9Z A;  3AVI A;  4W5T A;  1SKR A;  3G25 A;  4C1N I;  3VTH A;  4F2R A;  4CEC A;  2ZD1 A;  3R3L A;  4A2A A;  3RR7 A;  3J80 O;  3L3V A;  3OS0 A;  3S3M A;  4YOR A;  3KKS A;  3AVN A;  3THY B;  1SUQ A;  1RDC A;  4RW6 A;  2Z1G A;  4BRD A;  2F96 A;  1SL0 A;  2BH1 A;  1FKP A;  1U2V B;  4IDH A;  3VQ6 A;  3RVC A;  2ZJP L;  3BZK A;  3VEV A;  3QB0 A;  1NKB A;  3WQT A;  5BRD A;  5BPN A;  3LPU A;  3U3G A;  3MWP A;  3F9K A;  3DYA A;  4C23 A;  5HL7 L;  2ASO A;  4JAX A;  2VQF K;  3KTQ A;  1KSP A;  3P38 A;  4DTP A;  3MX2 A;  3GDQ A;  3KLI A;  4I7F A;  4KKO A;  4BRI A;  2QTD A;  3HBT A;  4ILH A;  2W6L A;  4DS5 A;  1BI4 B;  1RT6 A;  4F9O A;  2XY6 A;  2A41 A;  3K2P A;  5AQW A;  4FLU A;  1Q18 A;  2P5O A;  1T8E A;  4E7L A;  1P8Z A;  5LMN K;  4DU1 A;  3VA0 A;  3VF2 A;  2B4J A;  3VQD A;  2YNG A;  5H1S Q;  3L8B A;  2PYJ A;  3OVN A;  1YTU A;  3VEN A;  3J8A A;  1I3A A;  3RRG A;  4NO7 A;  3DLB A;  2GUP A;  3OYN A;  5DMR A;  4HVJ A;  4JKF A;  2DY4 A;  4LF8 K;  2E2P A;  2DFH A;  3QIC A;  3NF9 A;  3LDN A;  4OGE A;  4EHU A;  1T3V A;  3EN9 A;  4Z4H A;  4FZX C;  1RT2 A;  4U7B A;  2G8F A;  1TK5 A;  3AVB A;  4DV5 K;  1RBS A;  3CQ8 A;  4O0J A;  3SCX A;  4IEI A;  1X1P A;  3CCS N;  2O8F A;  1NM1 A;  4BRL A;  3VQB A;  4J2A A;  1ZXO A;  1GOC A;  3EO3 A;  3FZM A;  2W6K A;  4JKA A;  1KVB A;  3F73 A;  3G4S N;  4E19 A;  5FRO A;  1RTJ A;  4DV0 K;  3KLG A;  1VQ8 N;  3C6U A;  4H0V B;  2P51 A;  3THY A;  1LWE A;  4CEO A;  1K8K B;  2VGN A;  1L5U A;  3HT3 A;  3OYJ A;  5BPL A;  1U2V A;  1ZBI A;  2ASM A;  3ITH A;  3L6Q A;  5KGX A;  2OZM A;  1NJI O;  2VGM A;  3CJB A;  4DUY K;  3VEO A;  4W5N A;  4AHS A;  4BR7 A;  3KK7 A;  4I6M B;  3VGM A;  1NGH A;  2ETJ A;  5LMU K;  1HQE A;  1ZBF A;  4BG9 A;  1KC8 O;  3T1Y K;  3T1A A;  4DTM A;  4AHU A;  4H0X B;  4BAC A;  1NG9 A;  4FYD A;  3W0L A;  1BI4 A;  5E84 A;  3DRR A;  3VMF B;  1KFD A;  4PWD A;  3M3Z A;  1NJZ A;  1IG9 A;  3AVL A;  2X6N A;  1EQY A;  3TAM A;  1TUY A;  3LWM A;  2IS3 A;  4A62 A;  2YNI A;  5ELZ A;  2YHW A;  2VG7 A;  2HBJ A;  5AQY A;  3RMD A;  3HPH A;  2FC0 A;  3C0B A;  4OLA A;  3SPZ A;  3C6A A;  4J2E A;  1IKX A;  1HJR A;  3TSU A;  3WNH A;  1RDD A;  2D0C A;  3G0Z A;  1VQK N;  1JLE A;  4N41 A;  5LL6 Z;  4Y1C A;  3WNF A;  3MN5 A;  5FPD A;  2E2Q A;  3MEE A;  2HHV A;  4M45 A;  4CD3 A;  1F21 A;  5JS2 A;  3SV4 A;  3OBY A;  4LSN A;  3KLE A;  1VAZ A;  3OBW A;  4B1Z A;  3SAF A;  3A5O C;  3BUZ B;  2ZQB A;  1TVR A;  4KB0 A;  4YHH K;  4MDB A;  4BGA A;  4BE2 A;  3MCP A;  4AQY K;  3ENH A;  3LAL A;  4TSX A;  5C25 A;  3DOL A;  2YI1 A;  1BA0 A;  4ISE A;  4JK7 A;  1XHX A;  3UKU B;  2YNF A;  2Q1N A;  2V7Z A;  2VYP A;  3O80 A;  2VG5 A;  3AO5 A;  1K9M O;  4JK8 A;  4C8M A;  3DLK A;  4NXN K;  1P90 A;  4I2Q A;  4CEQ A;  4JD2 B;  4BR5 A;  1K8K A;  4FM1 A;  3MN7 A;  3R9P A;  4ID1 A;  5FRN A;  3CJ9 A;  3SNN A;  2QA4 N;  2B6A A;  2FSJ A;  1WNS A;  3SUN A;  4IZ9 A;  3VQA A;  3QNN A;  4CHZ A;  4DTJ A;  3K9J A;  2F4V K;  4CJU A;  4XH4 A;  4YNQ A;  3EEQ A;  3TAF A;  1B92 A;  1GLC G;  2KHO A;  4OKE A;  3U9D A;  3TU5 A;  3NGZ A;  1ESV A;  3AV9 A;  4I6M A;  1IKW A;  4CGG A;  4Z4E A;  3WEE B;  2P9L B;  4CBW A;  4FJ8 A;  1ATR A;  5AQM A;  1N6Q A;  3CF5 L;  4CK1 A;  3N4Q A;  5GIN A;  3D6R A;  2WUS A;  2XO7 A;  4I9Q A;  4CZK A;  1JCE A;  3VQP A;  4DWI A;  1DTQ A;  4DSL A;  3OW2 M;  4OLB A;  4U67 L;  4FPA A;  4BY9 C;  3ULE A;  5AQF A;  4LFA K;  1VSH A;  5KQD A;  2NRT A;  2UUC K;  2YHX A;  3QDK A;  4IFY A;  4WFA L;  1HRH A;  4ILJ A;  1VQP N;  3E1Y A;  5M1F A;  3L4Q A;  3QFP A;  4BC2 A;  5BN8 A;  2G8V A;  3DLR A;  4JKD A;  2O8D B;  3QIN A;  1S1W A;  2HHX A;  2KFZ A;  4KI4 A;  3PO4 A;  4DCH A;  4LF4 K;  3EYZ A;  1NJY A;  1NKE A;  3EL2 A;  3PIO L;  4O5B A;  4IFE A;  4FJ7 A;  3MN9 A;  2G8K A;  1U6Z A;  1QVG M;  4O5F A;  1L3U A;  4FJX A;  1NBW A;  5GIO A;  2GTD A;  1DEJ A;  3CM5 A;  3QLH A;  3T3F A;  3PLA A;  5KTQ A;  3RRH A;  3UKU A;  3OYH A;  3LDL A;  3L2Q A;  3GL1 A;  4DTS A;  1WOQ A;  2F7T A;  3JS6 A;  4FW1 A;  1YVN A;  5SZT A;  3LDS A;  1WAJ A;  2OCE A;  1N34 K;  4LF5 K;  4FVU A;  2E88 A;  1GLF O;  3B6O A;  2P9N B;  2NZT A;  5BR8 K;  5BRH A;  1DLO A;  3AVK A;  3AVA A;  1HYS A;  1TKX A;  4IBN A;  2DFE A;  1OH6 A;  1VSD A;  4B1U B;  4KHQ A;  3O9T A;  3WEE A;  2HB5 A;  2P9L A;  4CHY A;  2HHW A;  2LSN A;  3ZSR A;  3DLH A;  2X74 A;  5B8H A;  4YDU C;  3KD5 E;  4KAZ A;  4WQ4 A;  1X9M A;  1S1X A;  3ZSY A;  3A5N C;  4CZI A;  3HRG A;  4Z4F A;  1DGK N;  1B9F A;  4O55 A;  3AGK A;  4Z4I A;  1QVF M;  2ZM6 K;  5TKW A;  4B9L A;  4CEA A;  2QWO A;  1HNZ K;  1RBU A;  4NLC A;  3SZ2 A;  2UUB K;  3BGR A;  3P31 A;  3HVT A;  3HTV A;  5C12 A;  3DLL L;  3H45 C;  4E7I A;  1ASU A;  3CQY A;  3VF6 A;  3H3O B;  3ZT2 A;  3ZLJ A;  1MA9 B;  3SJH A;  3IS9 A;  2GWJ A;  1ASW A;  4Y1D A;  2QWM A;  4WFB L;  3MK6 A;  4GV9 A;  1KXP A;  2BE2 A;  2O8D A;  4DQ8 A;  4AHC A;  3O08 A;  2A5X A;  1Q8I A;  3O1W A;  1C0G A;  3I55 N;  3HK2 A;  1ZBH A;  1HQU A;  2RF2 A;  4ELV A;  4F2S A;  4KHS A;  3F5T A;  1QQM A;  3FLC O;  1YT3 A;  3WNG A;  4IJA A;  2BAN A;  3HP9 A;  1QHT A;  2F9W A;  3G71 N;  5AQQ A;  2P1J A;  3BDP A;  3KZB A;  5JIC A;  3ASM A;  3QEV A;  4NXM K;  2NRH A;  5JVG L;  2FF3 B;  3NH1 A;  2CH6 A;  4GV3 A;  3SJJ A;  1NGG A;  3SLC A;  3TSQ A;  4H5R A;  4B9M A;  2HVH A;  1QQC A;  1T7P A;  3QEX A;  3CFR A;  4DLG A;  4KHU A;  3I56 N;  4IDK A;  4DQQ A;  2ZF5 O;  2UXB K;  4JI3 K;  1W7A A;  4N56 A;  1S6P A;  4FJM A;  4BC5 A;  2P9N A;  4C8L A;  1NNE A;  1KLM A;  2VWJ A;  3KHY A;  1D9D A;  1S9G A;  4DUZ K;  1WSF A;  4OPH A;  3HOS A;  5FRM A;  2QI2 A;  2ZJQ L;  1ASV A;  3T69 A;  4DSI A;  3P83 D;  3K9K A;  1JLQ A;  4FLT A;  1KQS M;  5CYQ A;  5FDL A;  4GKK K;  1TL1 A;  3HOT A;  1C0F A;  4QS9 A;  3VQC A;  4L8R B;  2UYT A;  5EY4 A;  4BRP A;  4CGH A;  3S9H A;  4Q5V A;  5AQT A;  3TI0 A;  1QZ6 A;  4JNE A;  1G99 A;  3NMU A;  1QSS A;  3P39 A;  5HRN A;  5JMV A;  4IKF A;  3AO1 A;  1BOT O;  3VGL A;  1JCG A;  2OTJ N;  4GVM A;  3CCM N;  3VF4 A;  5AZI B;  4OPA A;  3LAK A;  1XWL A;  3AA3 A;  3IDH A;  4IFV A;  3PUF A;  3DXK A;  3E9L A;  4LC9 B;  2ASP A;  4PKI A;  4FWR A;  3M6G A;  4KRE A;  4WF9 L;  1WSE A;  4DFK A;  2D0B A;  3DWL A;  4M7Y A;  5EU7 A;  1ITG A;  3E01 A;  1M90 O;  5AQR A;  3AVG A;  2GEL A;  1BIZ A;  4KTZ A;  3MXI A;  3RTV A;  4B08 A;  4EFH A;  2QWL A;  3CJ1 A;  2ATQ A;  4MO4 A;  5AZJ B;  3B8A X;  2Q0U A;  5KRT A;  4BDZ A;  4BE1 A;  3V9Z A;  3FGU A;  2AA4 A;  4B9V A;  1GOA A;  3CCU N;  1A5V A;  2HF4 A;  1B9D A;  3TAG A;  4KB1 A;  4B1X B;  4FWM A;  3PSI A;  2ZJR L;  1NK8 A;  3DRS A;  1X9W A;  4PKH A;  3T19 A;  3M8S A;  3CC4 N;  4E1M A;  3ZX3 A;  3CC2 N;  4FM2 A;  3C65 A;  1EKE A;  1ZC6 A;  2ITM A;  1RDB A;  5TKY A;  3G10 A;  3V9S A;  5HOO A;  4CJP A;  2QXL A;  3FFI A;  4CCH A;  4CF1 A;  3C7N B;  4XIU A;  1YIT N;  3CM6 A;  3O8M A;  4KBO A;  3DLE A;  5M1Q A;  1S3X A;  3NF6 A;  3C94 A;  1NK6 A;  5JLH A;  1XUP O;  4O0I A;  2Z1J A;  3ZX2 A;  5C0Y A;  2UU9 K;  5CR4 A;  4H0O A;  1N32 K;  1SKW A;  3CFP A;  1S22 A;  3HL8 A;  1NKC A;  4MLE A;  3PX0 A;  3ZEU B;  4H0Y B;  2FLO A;  2XY5 A;  1NK7 A;  3RWU A;  1ZBS A;  3TAQ A;  4DV1 K;  1RBT A;  5M1P A;  1QQO A;  3QET A;  3THW B;  1T03 A;  3AO2 A;  4BR0 A;  5AQL A;  2IVP A;  4F4K A;  2RHK A;  1YJW N;  4FWQ A;  1UA1 A;  4CJ3 A;  3IUC A;  4KTW A;  3M8Q A;  3RMA A;  4FOE A;  4Z4C A;  4OJR A;  1EWQ A;  5AZI A;  1RBR A;  2HOE A;  3KLF A;  3HST B;  3LZI A;  3DOK A;  1RDU A;  4IXC A;  4BWM A;  3LP0 A;  1X3M A;  1ZBU A;  3O4N A;  3HPG A;  3U6F A;  4CJW A;  1FXX A;  5C2D A;  3FZL A;  4FJJ A;  1BGX T;  4K8Z A;  4RW9 A;  2VQE K;  2E1Z A;  1BUP A;  3I0S A;  1JLF A;  4WE1 A;  3NFA A;  3UIQ A;  4DS4 A;  3VPZ A;  4IOC L;  1JXB A;  2O4G A;  1W2B M;  4FJI A;  4KI6 A;  1ZYQ A;  3HJF A;  2KW4 A;  4HTU A;  1TAU A;  3RSE B;  4X64 K;  1OH7 A;  1HNX K;  3AAQ A;  3BEX A;  5A2Q O;  4E3S A;  3FFK B;  1VSM A;  3U4L A;  2Q2R A;  4DV4 K;  5BN9 A;  1VSJ A;  1BU6 O;  1CZB A;  3KK3 A;  4FLW A;  1RTD A;  2IC3 A;  1XI1 A;  1BCO A;  1BWF O;  5I42 A;  3CMA N;  2QWR A;  1HNV A;  2YHA A;  2NRV A;  5M1N A;  3O1B A;  3QEP A;  4C8K A;  5HLF A;  4M42 A;  3O9Q A;  3FZF A;  4N47 A;  4H5N A;  3SAG A;  3IG1 A;  4LFB K;  4HWI A;  3BP8 A;  3MN6 A;  1QSY A;  1OKJ A;  3H6E A;  4KFB A;  2D0P A;  3ZT0 A;  5ADX A;  1NLV A;  3DI6 A;  4DKW A;  4OKK A;  3HPO A;  5C10 A;  1GLD G;  1R59 O;  4O4G A;  4AF1 A;  3E9P A;  1RT3 A;  1U48 A;  4B8C A;  3V81 A;  3DJC A;  3THW A;  3MED A;  1Q9X A;  5DM7 L;  4K8X A;  2CGJ A;  4AM7 A;  1YJ9 N;  2A3Z A;  1E4F T;  1YI2 N;  1YUW A;  4CEZ A;  4B9N A;  4KHW A;  5D3G A;  3WQU A;  1N36 K;  1VSE A;  4E1J A;  3OS1 A;  1NGE A;  2RPI A;  2W40 A;  4FWN A;  1XMQ K;  4BRH A;  4PL7 A;  4FK0 A;  4DU4 A;  4CHN A;  5LJW A;  3GBT A;  1WB9 A;  4UY8 O;  2D0A A;  3VET A;  3L2R A;  2Q3S A;  3AVF A;  2ZE2 A;  5F2R A;  3NF7 A;  3K57 A;  3LP2 A;  1Z05 A;  2RKI A;  1NK0 A;  3BF1 A;  4DV7 K;  3LAM A;  2YKN A;  3ZSX A;  4O44 A;  4W5R A;  1C1B A;  2P9P B;  2QEX N;  2G8U A;  3M8R A;  4DF8 A;  1XC3 A;  4JRQ A;  1QQN A;  5J2N A;  4DTO A;  4ZTF A;  1IO2 A;  4NCG A;  3SPY A;  3L4I A;  2HHS A;  3VN5 A;  4RWT A;  4PL8 A;  1H1V A;  3KJV A;  1KAY A;  3CME N;  3EE8 A;  4DR1 K;  4CEF A;  4DG1 A;  1OH5 A;  1NOZ A;  2FXU A;  2BGG A;  4BVO A;  2E6L A;  2XY8 A;  4FJ9 A;  4M41 A;  4LH4 A;  4RTF D;  1SS6 A;  3CET A;  4BRO A;  3QER A;  4J2B A;  1FJG K;  3VEZ A;  3DM2 A;  3KIO A;  1SL1 A;  1IV0 A;  1HNW K;  5KPZ A;  4DU3 A;  2H3G X;  2CGK A;  3OYI A;  4CVN E;  1GLA G;  1QTM A;  4JS5 A;  1CZ9 A;  4DTU A;  2OPQ A;  2KZZ A;  1NJW A;  4H5T A;  4DQR A;  1XNR K;  1RNH A;  2AP1 A;  1HLU A;  2P9I B;  3UB5 A;  1ATS A;  3L2V A;  1BHL A;  1T6C A;  1TL3 A;  2P9S B;  3ZSQ A;  1JL1 A;  4A57 A;  2QXF A;  3O3F A;  4DHY A;  3A5M C;  1IBM K;  4W5O A;  4DB3 A;  4LF6 K;  2O8C B;  4FPB A;  2O8E B;  4ISF A;  1JLB A;  4CJL A;  1KAZ A;  3LDO A;  3VGK A;  3U9Z A;  4BRC A;  4CJR A;  2HNY A;  3HP6 A;  3WUH A;  4CEB A;  5JS1 A;  2A42 A;  2YHB A;  5AFU A;  4CGJ A;  3V9U A;  4DSK A;  3SYZ A;  4AHR A;  2YJE A;  2DPN A;  1JJ2 M;  4GVE A;  3BZC A;  4JHD B;  3NAE A;  4FW2 A;  1NGA A;  3LAN A;  5HRS A;  3Q7C A;  4M3U A;  4GY2 B;  4M63 C;  1QS4 A;  2E1Y A;  1TV6 A;  4JI4 K;  4DTR A;  2JWL A;  3Q7B A;  4JI5 K;  3F9M A;  2P9P A;  3AVH A;  3M1F A;  3ISN C;  3GOI A;  3ID6 A;  4E7K A;  3TAR A;  1VHX A;  1GLB G;  3WXK A;  4KHP K;  2HMP A;  4W5Q A;  3H3N O;  2E2O A;  1HPM A;  4O8K A;  4BQZ A;  5KGW A;  4NCA A;  1T05 A;  4FL9 A;  3V1R A;  4BE0 A;  4E0D A;  3D45 A;  4OX9 K;  2PZS A;  3L0Q A;  5E26 A;  3K58 A;  4HUG A;  2X78 A;  3CIP A;  1Q9Y A;  4JKG B;  1Y64 A;  1RDA A;  3SUQ A;  3J7Z O;  4CJ5 A;  4C1N K;  2X6S A;  4WCE L;  3V1Q A;  4CGD A;  1NU0 A;  5AQN A;  4CES A;  4KHY A;  1UA0 A;  1RIL A;  3VQ8 A;  3J7Y P;  1VQ9 N;  2BUP A;  4FK4 A;  3QFU A;  1WN7 A;  1VQN N;  3CPW M;  1SQK A;  3M8P A;  2F8T A;  2P9I A;  1WBB A;  5C15 A;  2NRZ A;  2XY7 A;  2P9S A;  3THX B;  2F8S A;  4HCC A;  2WON A;  4M7X A;  4DSF A;  4E1N A;  1U04 A;  3OYE A;  3D2E B;  3AA2 A;  4H8K A;  3MWT A;  4JD2 A;  1XMO K;  2E4L A;  3NGY A;  4KPY A;  3SBT A;  3NDK A;  3CC7 N;  4RW4 A;  1TKT A;  1E3M A;  3KK1 A;  2BDP A;  2O8C A;  2I7P A;  1HKG A;  2O8E A;  3HZ6 A;  1YVU A;  4NYN A;  1UOC A;  3ZSO A;  3DAW A;  4JYA K;  2P9K B;  5T7B A;  3CER A;  4BC4 A;  4BRG A;  3TAE A;  3D2F B;  3O3G A;  2IOC A;  4WYB A;  4FOI A;  1A5W A;  5C24 A;  1JKH A;  1RFQ A;  5I3U A;  3SI6 A;  3CQX A;  3IAY A;  4C8O A;  3ZX0 A;  4PY5 A;  4FWK A;  1S5J A;  3TWH A;  1KVC A;  4FM0 A;  4H0T B;  4YOT A;  1E4G T;  4EZ6 A;  4CJQ A;  1WSH A;  1BIS A;  2D4W A;  4DSJ A;  3DRP A;  3VEW A;  4XH5 A;  4BRK A;  1QHA A;  4BVP A;  3O9R A;  3K5L A;  1Z6R A;  4CF0 A;  4DLE A;  4LF9 K;  4J8F A;  4OPJ A;  4BRF A;  1RCH A;  4F3O A;  3ZT3 A;  4BR2 A;  1LAW A;  1X9S A;  3VQE A;  4CHP A;  3OHR A;  4FXD A;  1SV5 A;  2G8H A;  4Z4G A;  2RE2 A;  2QKB A;  4A59 A;  1YF5 L;  2HW3 A;  4JKG A;  1OVY A;  3MCA B;  3VEX A;  1MWM A;  3SMP A;  1K6Y A;  4LF7 K;  4CZH A;  1JLC A;  1N33 K;  1NMD A;  4DV2 K;  3ZSW A;  2YKM A;  4FJG A;  4PKG A;  3HYF A;  4BRA A;  3V4I A;  1KRP A;  2O4I A;  5GIP A;  2YCH A;  2O8B B;  4E7H A;  3TSP A;  3WXI A;  1T6D A;  2OAN A;  1D4X A;  1S72 N;  3QIP A;  2ITG A;  3OJS A;  4HHT A;  1TYQ B;  5CY4 A;  3THX A;  1TKD A;  3VQ4 A;  2IDO A;  4M3X A;  3IKM A;  2JWK A;  5HBM A;  2PAV A;  4DQS A;  4CJS A;  3FZH A;  2GWK A;  3L2W A;  4DR6 K;  4QS7 A;  2G8I A;  3OJU A;  2PFU A;  4CHQ A;  2QWN A;  4BWJ A;  3K5M A;  3ZET B;  4IJN A;  4H0P A;  1GOB A;  4ZHR A;  5JLF A;  2P9K A;  3A0I X;  3VQ5 A;  2HHH K;  1K8A O;  3U8X A;  1HNI A;  1IG8 A;  4JKH A;  3OYC A;  4JV5 K;  3D2F A;  4JKB A;  3SV3 A;  5AQO A;  3KK2 A;  4N76 A;  3QO9 A;  3KD1 E;  1N5Y A;  2P9U B;  1QZ5 A;  3QML A;  2XRI A;  4OVL A;  2NRW A;  5EOY A;  1VQ6 N;  1VSL A;  1QE1 A;  3CCR N;  4LD0 A;  2OYQ A;  4FZY A;  4DMN A;  1WUA A;  4CGF A;  2XHB A;  4JS4 A;  2FSN A;  4GNI A;  4YOY A;  5AQU A;  2KLA A;  4CJ4 A;  1G15 A;  3FE1 A;  5J2Q A;  4CZG A;  2OPR A;  1OVQ A;  2W41 A;  3OA9 A;  1HPZ A;  2HHT A;  1NGD A;  3VQQ A;  2J4R A;  5AJ3 K;  4HCB A;  1HMV A;  4CFD A;  1UWB A;  3LDP A;  2IVN A;  2IVO A;  3R6M A;  2HBM A;  1W9H A;  1D8Y A;  1EXQ A;  4H4O A;  3CCE N;  2JGU A;  3MX5 A;  4IEE A;  3CHW A;  5J2P A;  3WXM B;  4CIE A;  4JLH A;  2Y1I A;  4M3T A;  5DK5 A;  3CXC M;  3QBX A;  3HM9 A;  3PIP L;  3NVM A;  4I9L A;  4CW7 B;  4YOW A;  2HVI A;  3VQ9 A;  1FW6 A;  3OYF A;  4BRN A;  3S3O A;  3ATU A;  4Y0W A;  2O8B A;  1BL3 A;  2WBN A;  1JXE A;  1NGC A;  3PV8 A;  2HF3 A;  4CFA A;  4B9U A;  2WC9 A;  1TUU A;  3LP3 A;  4CIF A;  4DF4 A;  4QOZ B;  4GMJ B;  4R79 A;  3TPQ A;  5M1K A;  1TYQ A;  4KH5 A;  4FWS A;  3H08 A;  5EXW A;  2KQ2 A;  5CZ1 A;  1L3S A;  4YOX A;  3OYA A;  4CI6 A;  4EP4 A;  1IKY A; 
#chains in the Genus database with same CATH homology
 4CK1 A;  2HHU A;  3QEI A;  1RT1 A;  2XO7 A;  4CEZ A;  4B9N A;  4I9Q A;  1LWC A;  3D0P A;  4KHW A;  5D3G A;  3VQP A;  1S1V A;  4DWI A;  4CK2 A;  4DTX A;  4B3O A;  1VSE A;  4FJ5 A;  2KFN A;  4IG3 A;  3OS1 A;  2RPI A;  1DTQ A;  4E7J A;  1U4B A;  4DSL A;  1UAX A;  4OLB A;  1EP4 A;  4KTQ A;  3EZ5 A;  1WLJ A;  4FK0 A;  4DU4 A;  1U47 A;  4CHN A;  2EHG A;  3LZJ A;  1VSH A;  2B5J A;  4KO0 A;  1KLN A;  2D0A A;  3L2R A;  4C8N A;  1REV A;  3AVJ A;  3OS2 A;  2Q3S A;  2HHQ A;  4DFJ A;  3AVF A;  4M3Z A;  2ZE2 A;  4FJJ A;  3NF7 A;  3ZT1 A;  3NGI A;  4ID5 A;  3K57 A;  3LP2 A;  2E6M A;  2RKI A;  3OYK A;  1NK0 A;  3O4Q A;  4IFY A;  1HRH A;  3ZT4 A;  1FK9 A;  2YKN A;  3LAM A;  3ZSX A;  4FZZ A;  1Z25 A;  4O44 A;  4W5R A;  1J53 A;  1J5O A;  1C1B A;  2A1R A;  2G8U A;  3M8R A;  4DF8 A;  1U49 A;  2G8V A;  3DLR A;  1RT4 A;  4JRQ A;  5J2N A;  2FBV A;  4DTO A;  4ZTF A;  3QIN A;  1IO2 A;  1S1W A;  2GUI A;  1DTT A;  4ZTJ A;  4KI4 A;  4NCG A;  3WNE A;  2HHX A;  2KFZ A;  1WSG A;  3NE6 A;  1BIU A;  3ZSZ A;  2KZM A;  4EZ9 A;  3PO4 A;  1BQN A;  3SPY A;  2GV9 A;  4CF2 A;  1HYV A;  3L3U A;  2HHS A;  3VN5 A;  1I39 A;  3EYZ A;  1NJY A;  1NKE A;  3KJV A;  4DQI A;  1J54 A;  1KVA A;  2JLE A;  4O5B A;  4CEF A;  3SQ4 A;  2G8W A;  4DG1 A;  4FJ7 A;  2G8K A;  4HUE A;  3I8D A;  3K5N A;  1NOZ A;  1L3U A;  3OYG A;  2BGG A;  2E6L A;  2XY8 A;  4FJX A;  3MEG A;  3A2F A;  4FJ9 A;  2VWK A;  4N5S A;  4M41 A;  4LH4 A;  3CM5 A;  1D9F A;  1C0T A;  3QLH A;  3T3F A;  3QER A;  4J2B A;  5KTQ A;  3RRH A;  1VRT A;  3MXJ A;  4HUF A;  3OYH A;  1S9E A;  3DM2 A;  3L2Q A;  3KIO A;  1SL1 A;  1C0M A;  4DU3 A;  1C1C A;  3U3Y A;  4G1Q A;  1RTH A;  1NK5 A;  1WSI A;  3OYI A;  4AHT A;  3KLH A;  4KHN A;  4DTS A;  1RT7 A;  3RR8 A;  3RMC A;  3NBP A;  4FW1 A;  5SZT A;  3LDS A;  1WAJ A;  3SQ2 A;  1QTM A;  4JS5 A;  4FJL A;  1C1A A;  4DFM A;  1CZ9 A;  1TK0 A;  4DTU A;  2OPQ A;  4PA1 A;  2KZZ A;  1CLQ A;  2PY5 A;  4DTN A;  3B6O A;  1NJW A;  4DQR A;  2OA8 A;  4FJN A;  5K14 A;  1RNH A;  1LAV A;  1DLO A;  3QNO A;  2KTQ A;  2NUB A;  1NK4 A;  3AVK A;  3AVA A;  1HYS A;  1J9A A;  1TKX A;  4IBN A;  3L2V A;  2DFE A;  3LP1 A;  1BHL A;  1TL3 A;  1VSD A;  3ZSQ A;  3SUO A;  1NOY A;  1JL1 A;  4KHQ A;  3AO4 A;  4FVM A;  4Q0B A;  3QEW A;  4FJH A;  2HB5 A;  2QXF A;  3O3F A;  1VSI A;  4CHY A;  2HHW A;  2LSN A;  3ZSR A;  2GBZ A;  4OPK A;  3DLH A;  2X74 A;  4W5O A;  1WAF A;  2OPP A;  3KD5 E;  4KAZ A;  1X9M A;  4F3T A;  1S1X A;  1JLB A;  3ZSY A;  1W0H A;  4CJL A;  4FJK A;  2DFF A;  3OYD A;  4Z4F A;  4KV8 A;  4I2P A;  1B9F A;  3AO3 A;  4O55 A;  4Z4I A;  4EP5 A;  4CJR A;  5J2M A;  3QES A;  2FBT A;  4B9L A;  4LH5 A;  1VSK A;  2HNY A;  4CEA A;  5C42 A;  3HP6 A;  1RBU A;  5CZ2 A;  5E41 A;  3SZ2 A;  4CEB A;  5JS1 A;  1R0A A;  2YHB A;  3BGR A;  4OKJ A;  4CGJ A;  3V9U A;  4DSK A;  3SYZ A;  4AHR A;  3HVT A;  3TAP A;  1LW0 A;  4E7I A;  1ASU A;  4FW2 A;  3NAE A;  1CXQ A;  1SKS A;  3LAN A;  5HRS A;  4GW6 A;  2FBY A;  3ZT2 A;  1IH7 A;  4PQU A;  4M3U A;  5HRO A;  4UQG A;  1QS4 A;  1TV6 A;  4DTR A;  3IS9 A;  4M3R A;  3PX6 A;  4CEE A;  1ASW A;  1EET A;  2D5R A;  3KKR A;  1EX4 A;  4Y1D A;  3ZSV A;  3AVH A;  1IKV A;  3CFO A;  3OYM A;  4FLV A;  1MU2 A;  3ISN C;  1SL2 A;  4DQP A;  2BE2 A;  5J1E A;  2HNZ A;  5HP1 A;  2YV0 X;  1JL2 A;  3LPT A;  4E7K A;  4Z0U A;  3TAR A;  2HHV A;  4W5Q A;  1JLA A;  3VA3 A;  4AHC A;  2HND A;  2HMI A;  3V6D A;  1Q8I A;  3HK2 A;  1JLG A;  3NH0 A;  1NK9 A;  1ZBH A;  1HQU A;  2RF2 A;  4ELV A;  4F2S A;  4KHS A;  1A5X A;  2A1S A;  5KGW A;  4AIL C;  1T05 A;  4NCA A;  3V1R A;  1YT3 A;  3K5O A;  3WNG A;  1Y97 A;  4CIG A;  4BE0 A;  2BAN A;  3ULD A;  2OZS A;  3HP9 A;  1QHT A;  4E0D A;  3D45 A;  3AVI A;  1C6V A;  4BDP A;  2Y1J A;  2PZS A;  4W5T A;  1RBV A;  1SKR A;  2PYL A;  3K58 A;  4F2R A;  4CEC A;  4HUG A;  2ZD1 A;  3C6T A;  1U45 A;  2P1J A;  2X78 A;  4DFP A;  3BDP A;  3RR7 A;  1Q9Y A;  1HYZ A;  3L3V A;  1KFS A;  1NKC A;  3ASM A;  3QEV A;  3V9X A;  3NH1 A;  1RDA A;  3OS0 A;  3SUQ A;  3S3M A;  3SJJ A;  4B9S A;  3KKS A;  5HRR A;  3AVN A;  4CJ5 A;  1SUQ A;  1RDC A;  2X6S A;  4B9M A;  2HVH A;  3V1Q A;  4CGD A;  1QQC A;  4RW6 A;  4KHY A;  4CES A;  3ALY A;  1T7P A;  1UA0 A;  1LWF A;  2Z1G A;  1RIL A;  3CFR A;  3QEX A;  2F96 A;  1SL0 A;  3VQ8 A;  4DLG A;  4KHU A;  1L3V A;  4IDK A;  4DQQ A;  1FKP A;  1KCF A;  4FK4 A;  2Z1H A;  4AHV A;  1WN7 A;  4N56 A;  3VQ6 A;  1S6P A;  4FJM A;  1NKB A;  4C8L A;  1KLM A;  2VWJ A;  3TAB A;  1LW2 A;  3LPU A;  3M8P A;  1S9G A;  3U3G A;  1TGO A;  1D9D A;  2F8T A;  3F9K A;  3DYA A;  4KRF A;  3SUP A;  1WSF A;  5FRM A;  4FCY A;  1ASV A;  4DSI A;  3P83 D;  2XY7 A;  1S1U A;  1JLQ A;  4FLT A;  3NHG A;  5CYQ A;  2F8S A;  5FDL A;  4HCC A;  1TL1 A;  1KSP A;  3KTQ A;  4DTP A;  3DMJ A;  2WON A;  3KLI A;  4DSF A;  3VQC A;  1ZBL A;  4E1N A;  2VG6 A;  1U04 A;  4I7F A;  5KI6 A;  3OYE A;  4CFC A;  3AA2 A;  4H8K A;  3TAN A;  4L8R B;  4KKO A;  2E4L A;  3NGY A;  4KPY A;  3NDK A;  4CGH A;  3HO1 A;  4DS5 A;  4RW4 A;  4RW7 A;  3MXM A;  1TKT A;  3S9H A;  1BI4 B;  4Q5V A;  3KK1 A;  2BDP A;  3TI0 A;  3V1O A;  1RT6 A;  3AVM A;  1YVU A;  2XY6 A;  2P5O A;  3K2P A;  4NYN A;  4FLU A;  1T8E A;  1UOC A;  3ZSO A;  1QSS A;  5HRN A;  4ELT A;  4IKF A;  3AO1 A;  4E7L A;  1XC9 A;  4CJV A;  4GVM A;  5T7B A;  4CF8 A;  4DU1 A;  1KTQ A;  3LAK A;  3VA0 A;  1XWL A;  2B4J A;  3AA3 A;  3VQD A;  2YNG A;  4OGC A;  3L8B A;  3TAE A;  4IFV A;  3THV A;  2PYJ A;  3OVN A;  2QKK A;  3O3G A;  3PUF A;  1YTU A;  2IOC A;  1TK8 A;  2DTU A;  1A5W A;  5C24 A;  1JKH A;  5I3U A;  3SI6 A;  1I3A A;  4KRE A;  3RRG A;  1WSJ A;  3IAY A;  1XHZ A;  3OYN A;  3DLB A;  1WSE A;  5DMR A;  4DFK A;  4C8O A;  4FK2 A;  4PY5 A;  4CFB A;  2D0B A;  4HVJ A;  2DY4 A;  1S5J A;  5EU7 A;  2DFH A;  1ITG A;  4E89 A;  3OYB A;  3TWH A;  3E01 A;  1Q9X A;  1KVC A;  3AVG A;  3NF9 A;  1BIZ A;  4FM0 A;  4OGE A;  4KTZ A;  3MXI A;  4ICL A;  4CJQ A;  4B08 A;  4Z4H A;  1WSH A;  1BIS A;  1RT2 A;  3RTV A;  4EZ6 A;  4FZX C;  3PY8 A;  2G8F A;  4DSJ A;  1TK5 A;  3AVB A;  2ATQ A;  3DRP A;  3VQ7 A;  1S6Q A;  1RBS A;  5KRT A;  3OY9 A;  3CQ8 A;  4O0J A;  4BDZ A;  4BE1 A;  3V9Z A;  4B9V A;  3K5L A;  1GOA A;  2OPS A;  3SCX A;  1X1P A;  1A5V A;  3JSM A;  1B9D A;  4CF0 A;  4DLE A;  4NYF A;  1C0U A;  2P5G A;  3TAG A;  4RG8 A;  4MFB A;  4OPJ A;  3VQB A;  4JRP A;  1RCH A;  4KB1 A;  3IRX A;  3ZT3 A;  1TAQ A;  4F3O A;  4J2A A;  1GOC A;  1LAW A;  1X9S A;  3VQE A;  4CHP A;  1KVB A;  1NK8 A;  3DRS A;  4FXD A;  1SV5 A;  1X9W A;  2G8H A;  4IG0 A;  2Z1I A;  3F73 A;  3T19 A;  4Z4G A;  3M8S A;  4H4M A;  2QKB A;  3HVR A;  4E19 A;  5FRO A;  1RTJ A;  3TR8 A;  1VRU A;  3HXM A;  1S1T A;  1O1W A;  4QAG A;  4E1M A;  3KLG A;  2HW3 A;  4CJT A;  4FM2 A;  1EKE A;  1K6Y A;  1RDB A;  3C6U A;  3G10 A;  3B6P A;  1BCM A;  2P51 A;  3CYM A;  1LWE A;  1CXU A;  3V9S A;  3ZCM A;  3FFI A;  4CJP A;  1JLC A;  4CEO A;  4CJE A;  4CF1 A;  4CCH A;  4XIU A;  1L5U A;  2W42 A;  3ZSW A;  2YKM A;  3C95 A;  3CM6 A;  4DSE A;  3DLE A;  3HT3 A;  3NF6 A;  3OYJ A;  4FJG A;  3C94 A;  3HYF A;  1VSF A;  4YFU A;  1NK6 A;  4LSL A;  3V4I A;  1KRP A;  2O4I A;  4O0I A;  4FLZ A;  2Z1J A;  3PX4 A;  4E7H A;  3ITH A;  1ZBI A;  3DLG A;  5KGX A;  2OZM A;  1RT5 A;  3I0R A;  1SKW A;  3CFP A;  4W5N A;  3HL8 A;  3QIP A;  2ITG A;  4AHS A;  4CF9 A;  3OJS A;  3PX0 A;  4HHT A;  2EX3 A;  3P1G A;  4CGI A;  5CY4 A;  4ELU A;  4QCL A;  1TKD A;  3VQ4 A;  2IDO A;  4BDY A;  4M3X A;  2IAJ A;  2XY5 A;  2ETJ A;  1NK7 A;  3RWU A;  5HBM A;  1HQE A;  1ZBF A;  3TAQ A;  4DQS A;  4CJS A;  3QET A;  1RBT A;  1QSL A;  2AJQ A;  3L2W A;  4CED A;  3T1A A;  4DTM A;  1T03 A;  2G8I A;  3MEC A;  4AHU A;  3AO2 A;  3OJU A;  4BAC A;  4CHQ A;  3MAQ A;  3EY1 A;  4NCB A;  4FYD A;  1BI4 A;  4BWJ A;  3K5M A;  3DRR A;  4F4K A;  1KFD A;  3AA5 X;  4LY7 A;  4PWD A;  1RTI A;  1UA1 A;  4CJ3 A;  1NJZ A;  1GOB A;  3K59 A;  5CYM A;  3AVL A;  4ZHR A;  1IG9 A;  4KTW A;  3M8Q A;  3RMA A;  2X6N A;  3VQ5 A;  3TAM A;  1TKZ A;  3LWM A;  4Z4C A;  2IS3 A;  4OJR A;  3RMB A;  1RBR A;  2YNI A;  3KLF A;  1HNI A;  2FBX A;  3HST B;  3LZI A;  3DOK A;  3OYC A;  3V9W A;  3OYL A;  3SV3 A;  4BWM A;  2VG7 A;  1LV5 A;  3KK2 A;  3LP0 A;  4N76 A;  3QO9 A;  3SQ1 A;  3RMD A;  3HPH A;  2FC0 A;  1ZBU A;  1N5Y A;  3KD1 E;  4OLA A;  3O4N A;  3SPZ A;  4OVL A;  1IKX A;  2XRI A;  3HPG A;  4J2E A;  1VSL A;  3U6F A;  1HJR A;  1FXX A;  1QE1 A;  4CJW A;  4LD0 A;  3WNH A;  5KRS A;  1RDD A;  4R5P A;  2OYQ A;  2D0C A;  3G0Z A;  1BGX T;  2IGI A;  1JLE A;  4FZY A;  4N41 A;  4Y1C A;  3WNF A;  4DMN A;  3MEE A;  3P5J A;  4K8Z A;  4RW8 A;  4M45 A;  1F21 A;  4RW9 A;  4CGF A;  2XHB A;  2R7Y A;  4JS4 A;  1L3T A;  5JS2 A;  3I0S A;  4CJ4 A;  1JLF A;  3SV4 A;  4WE1 A;  1G15 A;  4B9T A;  3NFA A;  3UIQ A;  4LSN A;  4DS4 A;  4MQ3 A;  5SWM A;  3KLE A;  3L2U A;  3QIO A;  5J2Q A;  1JXB A;  2O4G A;  2OPR A;  4CE9 A;  4FJI A;  3SQ0 A;  4KI6 A;  1ZYQ A;  1HPZ A;  3HJF A;  2HHT A;  2KW4 A;  3AA4 A;  4HTU A;  3LWL A;  4FLY A;  2I5J A;  3VQQ A;  1TAU A;  4HCB A;  1HMV A;  4M3Y A;  2ZQB A;  4B8A B;  1TVR A;  4KB0 A;  4CFD A;  1UWB A;  3NF8 A;  4E3S A;  4CJF A;  4FLX A;  3JYT A;  4BE2 A;  1VSM A;  1W9H A;  1Z26 A;  1D8Y A;  1YTA A;  3LAL A;  1EXQ A;  4TSX A;  3CG7 A;  5C25 A;  4H4O A;  3NCI A;  3DOL A;  2JGU A;  1VSJ A;  1CZB A;  3NH2 A;  3KK3 A;  4FLW A;  1NJX A;  1RTD A;  5J2P A;  4J2D A;  1XHX A;  4CHO A;  2IC3 A;  1XI1 A;  1BCO A;  2YNF A;  4JLH A;  4CIE A;  2Y1I A;  5I42 A;  4M3T A;  2VG5 A;  3AO5 A;  5DK5 A;  4CJK A;  5HRP A;  3S3N A;  4C8M A;  1HNV A;  2YHA A;  3HM9 A;  3DLK A;  3QEP A;  4C8K A;  2QK9 A;  4I2Q A;  4CEQ A;  4FM1 A;  4I9L A;  3PO5 A;  4M3W A;  5HLF A;  4M42 A;  2HVI A;  4ID1 A;  3VQ9 A;  1FKO A;  5FRN A;  3SNN A;  3OYF A;  1D5A A;  2B6A A;  4CK3 A;  4N47 A;  2YNH A;  1WNS A;  3S3O A;  3SUN A;  4PUO A;  4F8R A;  3VQA A;  3IG1 A;  3QNN A;  4CHZ A;  1BL3 A;  4DTJ A;  1JXE A;  4CJU A;  4YNQ A;  3PV8 A;  4CFA A;  1QSY A;  4B9U A;  1VK0 A;  4CER A;  3LP3 A;  4KFB A;  1BQM A;  3TAF A;  1B92 A;  4AH9 A;  3ZT0 A;  4CIF A;  4DF4 A;  4QOZ B;  4GMJ B;  4OKE A;  3DI6 A;  3NGZ A;  3AV9 A;  4OKK A;  3HPO A;  1IKW A;  4CGG A;  4Z4E A;  2WOM A;  3H08 A;  4O4G A;  3AVC A;  1RT3 A;  2KQ2 A;  5CZ1 A;  1L3S A;  2RN2 A;  4FJ8 A;  1U48 A;  4B8C A;  3V81 A;  3OYA A;  3MED A;  4EP4 A;  3O3H A;  1IKY A;  4K8X A;  1N6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...