4PA1A

Crystal structure of catalytic core domain of fiv integrase
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
151
structure length
151
Chain Sequence
HMGIWQMDCTHFDGKIILVGIHVESGYIWAQIISQETADCTVKAVLQLLSAHNVTELQTDNGPNFKNQKMEGVLNYMGVKHKFGIPGNPQSQALVENVNHTLKVWIQKFLPETTSLDNALSLAVHSLNFKRRGRIGGMAPYELLAQQESLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Integrase
publication title Identification of phe187 as a crucial dimerization determinant facilitates crystallization of a monomeric retroviral integrase core domain.
pubmed doi rcsb
source organism Feline immunodeficiency virus
total genus 50
structure length 151
sequence length 151
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pa1A00
4O44A 1KLNA 1VSFA 2HB5A 4XIUA 3DRSA 4CERA 1HYVA 3T1AA 4CEQA 2FC0A 3WNHA 4CJPA 4CF9A 4YNQA 3K2PA 3KKRA 4CF0A 4B9TA 1JKHA 1J53A 2OPPA 1SKWA 4CJLA 3WNEA 2KW4A 4YFUA 1XWLA 4E7HA 3PX4A 4OLAA 1C1CA 4KREA 5J2NA 3NF6A 3AVJA 2KFZA 1MU2A 1CLQA 1T05A 5EU7A 2D5RA 3TR8A 4CHYA 4FJIA 4CEOA 4CESA 3V6DA 1ZBUA 5HRPA 4C8MA 4H8KA 4ZHRA 4W5RA 4IFVA 3HM9A 3E01A 1S1TA 3K57A 4KHUA 4F3TA 4DQPA 1IKVA 4KHWA 3V9ZA 3DLKA 2G8VA 1RT5A 2BGGA 2OPRA 3ZSOA 4E0DA 3TWHA 3AA3A 4FJHA 1TV6A 2YHAA 3CFPA 3ZT0A 2XY6A 4KAZA 3ZSWA 5J2MA 3DYAA 3EYZA 3KLEA 1BCOA 1VSEA 1VSHA 3AVIA 5KGWA 4NCGA 3ZT4A 4B08A 4OGEA 1RBVA 4CEZA 3V9WA 1L3SA 5K14A 2HVIA 3LP0A 1TVRA 3KD5E 3VQ5A 4M3YA 3CG7A 4B9UA 4N41A 2ZE2A 3HYFA 3SPYA 1TKZA 4KTWA 4CJEA 1IKWA 2IC3A 4KHNA 3OYMA 3OYBA 1HMVA 3D0PA 4FLVA 3U6FA 2BDPA 4JS5A 2E6MA 3SZ2A 1TGOA 3DLBA 4JLHA 2VG5A 1JLQA 4DLEA 1S1XA 1QS4A 2O4GA 4M3RA 3U3YA 1RT2A 3PV8A 1X1PA 5DK5A 3O3HA 3I8DA 2JLEA 5J1EA 3PO5A 3L2WA 4F2SA 1JLAA 1KSPA 3TABA 3AVAA 3AO1A 1VSMA 2JGUA 4E89A 3SI6A 4LSNA 2NUBA 3MEEA 4LSLA 3QIPA 3NGYA 2X78A 1GOCA 3S3NA 3AO3A 4CGFA 1T7PA 3AVLA 4FJMA 1JXEA 2QKBA 5C42A 1HJRA 3K5LA 4FZYA 4H4MA 3VQAA 3NFAA 3QINA 1NK0A 1N6QA 3TAMA 3HO1A 4OKKA 1RTJA 3LP3A 1IKXA 2OZMA 4DSKA 1R0AA 4C8KA 1NJYA 4ICLA 1WNSA 4RW4A 4M3WA 1NKBA 3M8RA 4Z0UA 4J2EA 1HYSA 4DQSA 2G8IA 2DFHA 4FJ5A 4DSEA 3D45A 3LPUA 1LWCA 4JRPA 4ZTJA 1U48A 3M8PA 5I42A 2G8HA 1KCFA 4FJ8A 1NOZA 3L8BA 3G0ZA 2ATQA 1S9EA 3NBPA 4FXDA 2BANA 3DLEA 4DWIA 3AA2A 3AV9A 4CFDA 4CFCA 4BE2A 3VQ9A 4E19A 4CHNA 4CCHA 4DS5A 4FJ7A 3LDSA 1RTIA 3VQ8A 3OYNA 1B9DA 3DOLA 1WLJA 4FVMA 2F96A 1VRTA 4DFPA 2YKNA 3LPTA 5HBMA 4FCYA 4E7KA 4OGCA 3OYEA 4ZTFA 5CZ2A 1LAVA 1QQCA 2B5JA 3DRRA 1CXUA 4FLZA 4WE1A 2VG7A 1Q8IA 2P1JA 4CJ5A 4QAGA 3L2QA 4PQUA 3NH1A 1CXQA 3TAPA 2OPQA 4B8CA 3IAYA 5J2PA 4FLYA 1G15A 1WSEA 3AO2A 3K5OA 1BISA 4DTNA 1LWFA 3SV4A 2O4IA 2KZZA 2LSNA 3NHGA 2EX3A 5J2QA 2ZD1A 1DTTA 4RW7A 1KFSA 3OYIA 5JS2A 1HYZA 5KRTA 1FKOA 4DSLA 1Q9XA 1NK8A 4HTUA 3SYZA 2QKKA 4NYNA 3S3MA 3SQ1A 4B9LA 4KHSA 1VSJA 2FBVA 4FW2A 1YT3A 5CY4A 4HUFA 1HRHA 3DM2A 1RTDA 3PO4A 3AVKA 3AVCA 3ZSXA 2Y1IA 3NH2A 1ITGA 1KTQA 4LY7A 3NF9A 1RDAA 1VRUA 5CYQA 3CFRA 4DU3A 2KFNA 4F2RA 1WSJA 3ASMA 4FM2A 4Z4FA 4RW6A 3QO9A 3THVA 1NJWA 4OPKA 1EXQA 1UWBA 3DOKA 3L2VA 2XY7A 4K8XA 4L8RB 5CZ1A 3RMDA 3RRHA 3PX0A 4HVJA 1SV5A 4CJ3A 3OY9A 4JRQA 1HNIA 1NJXA 4KPYA 4LD0A 1NK9A 5JS1A 1U45A 3TAEA 2D0AA 3NF8A 1NKCA 4Q0BA 1L3TA 3AVBA 3OS1A 4CK2A 1CZBA 1D8YA 4GVMA 5I3UA 3OS2A 3ZSRA 1ASVA 3LAKA 1UA0A 1A5VA 4FLTA 3L3VA 1RILA 3MXJA 1ZBFA 1TKTA 3I0SA 3AVGA 4Z4GA 1JLFA 2VWKA 4HCCA 3OYDA 3LWLA 3AA5X 1VSIA 3DLRA 4OKEA 2HVHA 2HHTA 2FBXA 4B9VA 4DSIA 1BHLA 3CM5A 1Z26A 2DFEA 3V1OA 4CJRA 1KVCA 3OYKA 2G8FA 4OJRA 3O3GA 2VG6A 1K6YA 2YNHA 4AH9A 3L2UA 3TANA 3BGRA 4N56A 3O3FA 2FBYA 4DTPA 3K58A 3UIQA 3RMAA 2P5OA 1C0TA 4CEDA 1VK0A 1UAXA 3L3UA 5FROA 5HLFA 5HRSA 2B6AA 1W0HA 4M3TA 2HHVA 4PWDA 1C6VA 1TKDA 4J2BA 1W9HA 2KZMA 1KFDA 1I39A 4BACA 1RT6A 1RBTA 1RDDA 1A5XA 4DTSA 1YTAA 3NH0A 3RR7A 1L3UA 1BGXT 1BI4A 2E4LA 4CJWA 5C25A 3DLHA 4B9NA 1QSYA 3DLGA 2PYLA 1WN7A 2HHUA 1ASUA 4CEFA 2YNIA 1VSDA 3VA3A 4M41A 4DQQA 4F4KA 3OJUA 3LWMA 3LZJA 2R7YA 1TKXA 5DMRA 4N76A 1EP4A 4W5NA 3HXMA 4CF2A 3QEXA 1B92A 3CYMA 3P1GA 3AVNA 1ZYQA 1RCHA 1UA1A 4HCBA 4F8RA 3MECA 1YVUA 3HSTB 5T7BA 2W42A 4HHTA 4DFMA 1IH7A 3V9SA 5KI6A 3ALYA 3ZSQA 4PA1A 1EX4A 4Y1CA 1DLOA 3KLIA 4DMNA 4R5PA 3NE6A 4E7LA 4CK1A 4J2AA 4CFAA 2PY5A 1X9SA 1JLBA 1S1UA 1NOYA 4BDYA 3P5JA 3WNFA 1YTUA 1RDCA 3ZCMA 2RKIA 4BWMA 3LP2A 1J5OA 4OLBA 4M45A 5HROA 3QETA 4JS4A 2IAJA 4FLXA 2KTQA 1Y97A 2Q3SA 3SQ2A 4DSJA 2F8SA 2XO7A 3VN5A 3TI0A 4B3OA 3V81A 1U4BA 4KI4A 2HNZA 2IDOA 4RW9A 4RW8A 1VSKA 4FLUA 4M3UA 3HJFA 3T3FA 4FJJA 1O1WA 4FJ9A 2KQ2A 4BDZA 3OYFA 2YKMA 3LAMA 1NK7A 2A1RA 4CFBA 4CIFA 4N5SA 3QEVA 3KD1E 4CJFA 3FFIA 3OYAA 3QEWA 3MEGA 4BE1A 3RMBA 1BIUA 4E1NA 4DF8A 1S6QA 2HMIA 4Z4EA 4N47A 1REVA 2YV0X 3G10A 4KFBA 3VQPA 2XY5A 4FZXC 4M42A 3B6PA 5D3GA 3NF7A 2HHXA 3OVNA 4FK2A 4EZ6A 3HPOA 4KB1A 3SQ0A 1HNVA 1ZBIA 4DQIA 4C8NA 5HP1A 1ZBLA 2OA8A 5FRMA 2BE2A 3I0RA 4CF1A 4F3OA 3F73A 4FZZA 4CF8A 1TL3A 3B6OA 4DQRA 4IG0A 1TAQA 4E7JA 3HP6A 4CJ4A 1U47A 2QXFA 1U49A 1WAFA 4FJKA 4I2PA 4BWJA 4EP5A 2GBZA 1BIZA 4FJXA 2IGIA 4AHTA 1SUQA 3VQ4A 1HQUA 3KKSA 3M8QA 1IG9A 4IBNA 3CFOA 4CHPA 5KTQA 1XC9A 3PUFA 4DTOA 2ITGA 3SUQA 2X74A 5SWMA 1KVBA 3K5MA 3IG1A 4OKJA 2G8UA 4CIEA 4DU1A 3P83D 2ZQBA 3QNOA 1S9GA 2HNDA 4DF4A 3KLFA 2FBTA 5E41A 4DTRA 1Q9YA 4CJQA 3HPGA 5C24A 4HUGA 3RR8A 4FK4A 4IFYA 3VQCA 3PY8A 1JXBA 1LWEA 2AJQA 1B9FA 4IG3A 4DTUA 1LW0A 1XHZA 1X9WA 3KTQA 4C8LA 2WOMA 3O4QA 3OYGA 4EP4A 2HW3A 1BL3A 3LZIA 1D9FA 4FJLA 3JSMA 4FM1A 4C8OA 1C1AA 4CGGA 4CGJA 1S1WA 4OPJA 4I7FA 3VA0A 4O0IA 4LH5A 4KKOA 3NGIA 4IKFA 3KK1A 3F9KA 4CHZA 1BCMA 3QLHA 4GMJB 5KRSA 3KLGA 1JLCA 2RF2A 3AVMA 1T8EA 1NK4A 1TAUA 3K5NA 3QIOA 2B4JA 3H08A 1TK8A 2DTUA 3S9HA 2A1SA 3S3OA 1Z25A 3IRXA 4Y1DA 4CHOA 1XHXA 4DU4A 4B9MA 4I9QA 4KRFA 1D5AA 1F21A 1KVAA 2EHGA 1QSSA 1JLGA 1RT3A 3QNNA 4CGHA 3QEIA 4CHQA 4DLGA 4PUOA 4CEBA 4FM0A 1I3AA 4J2DA 4NCBA 1BI4B 4FW1A 1S1VA 1U04A 3TAGA 1IO2A 3VQQA 3DI6A 4BDPA 1JL2A 3HL8A 3SV3A 3DRPA 1UOCA 2E6LA 4O4GA 4GW6A 1RT4A 1NKEA 4MFBA 3TAQA 1CZ9A 1WAJA 2Z1GA 3NCIA 5FRNA 4DG1A 1SKRA 3VQ6A 4Q5VA 2HHSA 4QCLA 2Z1HA 3JYTA 1GOBA 4E7IA 1D9DA 2OZSA 4Z4HA 4CGIA 1FKPA 1WSFA 2RPIA 4ID5A 3T19A 3V1RA 3SQ4A 1NJZA 4O55A 3AVFA 4KB0A 1C1BA 2DFFA 3HPHA 4DSFA 3MEDA 2PYJA 3CM6A 4KTZA 4K8ZA 3SJJA 4FJNA 4Z4IA 2OYQA 3LANA 3NDKA 2D0BA 3PX6A 1QSLA 5SZTA 3KK3A 4W5TA 2XHBA 3V9XA 1S6PA 1SL1A 2IOCA 3IS9A 4EZ9A 3RWUA 4AHSA 3NAEA 2G8KA 1LW2A 4M3ZA 3MXIA 3ZT1A 1JL1A 4H4OA 1RBSA 2GUIA 2YNFA 1WSGA 4E1MA 4AHVA 1JLEA 3KLHA 4ELTA 3WNGA 3RTVA 2XY8A 4AHRA 3SPZA 3TAFA 3V1QA 2P5GA 2OPSA 4Z4CA 3SNNA 1SL0A 1DTQA 1J9AA 4M3XA 4DFJA 4AILC 3K59A 4ELVA 1BQNA 1TK5A 3BDPA 4KV8A 3SUNA 4FK0A 2Z1JA 3V4IA 4DS4A 1ASWA 3VQDA 1FXXA 1KRPA 4CE9A 2X6NA 3SUPA 1WSIA 4NYFA 4O5BA 1WSHA 3QERA 2HHWA 4B8AB 1RNHA 3AO5A 2I5JA 1RTHA 4FLWA 1L5UA 2Y1JA 1ZBHA 1VSLA 1HQEA 3ZT3A 3VQEA 2WONA 3L2RA 1C0MA 1S5JA 1NK5A 4CJVA 4E3SA 3SCXA 3VQ7A 3M8SA 2YHBA 3TARA 3C6TA 4DTJA 4RG8A 1A5WA 3LP1A 4I2QA 3ZSVA 4B9SA 4FYDA 1J54A 3C6UA 3NGZA 4DFKA 1SKSA 4PY5A 4OVLA 5HRRA 1EETA 1LAWA 3AA4A 4AHUA 2PZSA 3SUOA 1GOAA 2HHQA 3ULDA 4CECA 3EY1A 3KIOA 3U3GA 4CJKA 3OYJA 4HUEA 1XI1A 1L3VA 1TL1A 3ZT2A 3HT3A 1RDBA 1EKEA 3EZ5A 1QTMA 2YNGA 3CQ8A 4KO0A 1FK9A 1RBRA 3HP9A 1HPZA 4DTMA 4FJGA 2D0CA 3A2FA 4KHQA 4DTXA 1IKYA 4TSXA 5FDLA 3KK2A 4IDKA 3OYHA 1RBUA 2X6SA 3VQBA 3KJVA 3MAQA 3QEPA 1KLMA 3OS0A 2QK9A 3RMCA 4UQGA 3LALA 4W5QA 4QOZB 1C0UA 4LH4A 4ID1A 4CK3A 3C95A 3ZSZA 4CJSA 4CEAA 4MQ3A 4BE0A 5HRNA 3QESA 4AHCA 3V9UA 3HVRA 1T03A 1SL2A 3ISNC 1N5YA 4CJUA 1RT1A 4I9LA 3O4NA 3ZSYA 4ELUA 1QE1A 1BQMA 2RN2A 3HK2A 4W5OA 3DMJA 1QHTA 5CYMA 1TK0A 4O0JA 2Z1IA 4CJTA 2F8TA 4CEEA 2DY4A 4CGDA 2XRIA 4NCAA 3RRGA 5KGXA 2ETJA 2GV9A 3AO4A 2IS3A 4G1QA 1X9MA 2G8WA 2VWJA 3OJSA 4KI6A 3ITHA 3OYCA 1LV5A 1NK6A 4CIGA 1RT7A 3AVHA 3HVTA 3C94A 2P51A 3MXMA 4KHYA 4KTQA 3OYLA 2HNYA
chains in the Genus database with same CATH superfamily
5FPDA 3DRSA 2QTDA 3WNHA 2P9UB 4ISEA 4CF9A 3K2PA 4RWTA 4I6MB 1SKWA 1NGBA 2HBLA 4KH6A 5J2NA 2KFZA 3M1FA 5AQOA 4ILHA 3TR8A 4CHYA 5HRPA 5GAHP 4H8KA 4ZHRA 4W5RA 1NNEA 3HBTA 5BR8K 3UKRB 2KHOA 4KHWA 4JI1K 1K73O 1RT5A 3TWHA 3AA3A 4FJHA 2YHYA 3A8YA 2XY6A 4JI5K 5LJWA 1VQ7N 5J2MA 3AVIA 4H5VA 4OGEA 1L3SA 1KAXA 2A3ZA 4IJNA 1RFQA 3VF4A 4FSVA 4DR1K 1TKZA 2P9NA 4CJEA 4H0PA 5FPMA 4KHNA 4FLVA 3U6FA 2BDPA 2E6MA 3SZ2A 3LM9A 4HTLA 4JLHA 5MLCQ 1JLQA 3SLCA 4M3RA 5M1QA 4BREA 1RT2A 3PV8A 3O3HA 2V7YA 2JLEA 3L2WA 1Q18A 4H0OA 4E89A 3SI6A 4YOYA 2O8DB 2NUBA 4HWIA 4DV6K 3QIPA 4GVEA 1GOCA 3K0SA 3S3NA 3F9MA 4CGFA 3AVLA 5C42A 2VYPA 4JNEA 3GG4A 1FJGK 1RDUA 1RTJA 3O5BA 4C8KA 3CQYA 3S41A 1TUUA 3SAGA 4DSEA 4GV9A 5I42A 4JKGB 3JXUA 2P9KB 4FXDA 5AQKA 5GIOA 4DWIA 3D2EA 3AV9A 4CFDA 2HF4A 4JKAA 3VQ9A 3KZBA 3UB5A 3DOLA 2F96A 4DFPA 4B3SK 4FCYA 4AQYK 3CETA 2B5JA 5CZ2A 4FLZA 4CD3A 4WE1A 2FF6A 2P1JA 4CJ5A 1YJ9N 3NH1A 4BQLA 1CXQA 4X66K 3MK6A 2ZF5O 2V51B 5J2PA 1G15A 1WSEA 3K5OA 4DTNA 3IUCA 3A5MC 3VPZA 2WBNA 1KFSA 4RW7A 5JS2A 4DSLA 5KRTA 1FKOA 2W6LA 2Q36A 3G6EN 3SYZA 3ENOA 4NYNA 2CGKA 1RTDA 3DM2A 3PO4A 3CJ1A 1GLLO 2Q2RA 1KTQA 3CFRA 5F0XA 1WSJA 5EOYA 4FM2A 4CZMA 5BPLA 3THVA 4DR3K 1NJWA 1EXQA 2A6AA 1VQNN 1HKGA 3RRHA 4XH1A 5AQJA 4NXNK 2QWQA 4CJ3A 3OY9A 1HNIA 3CJ9A 4FOIA 2OTJN 2VCPA 4JD2A 4JI6K 1CZBA 3CERA 3ENHA 1HNWK 3OS2A 3LAKA 1UA0A 1A5VA 3NVMA 4BRGA 3I0SA 1DKGD 2P9NB 3AA5X 2HVHA 1OH7A 4H0XB 4DSIA 4B9VA 1BHLA 3V1OA 4CJRA 1C0GA 3KVGA 4OJRA 3L2UA 2YNHA 4AH9A 3TANA 3BGRA 3PSIA 4LC9B 1M90O 2FBYA 2D0OA 3UIQA 2P5OA 4LFCK 3M3ZA 4MO5A 3FZMA 5FROA 2OANA 3M5RA 3R9PA 4WF9L 5HLFA 3EO3A 3CC2N 1N32K 4M3TA 2QWNA 2ZGYA 1BOTO 3Q7CA 1RT6A 1RBTA 1S22A 1A5XA 4DHYA 1BGXT 1LOTB 4CJWA 5C25A 1NLVA 4CEFA 3VA3A 1NGEA 5ELZA 1KAYA 4AM7A 4HCBA 4QS9A 1NU0A 3MECA 4F8RA 4DFMA 3L4IA 1IH7A 5KI6A 4JHDB 5AQUA 2ASMA 4JKDA 3SJHA 4E7LA 4CK1A 3C0BA 2VGNA 3P5JA 1YTUA 3D2EB 3LP2A 4QS8A 4M45A 5HROA 1NBWA 4FLXA 1KC8O 1Y97A 3EKUA 2Q3SA 3SQ2A 3TI0A 3ENBA 3TTDA 1U4BA 4B3OA 3CCRN 4M3UA 4RW9A 3SBTA 1XMQK 1NWKA 4FJJA 5GAEP 4CFBA 4CIFA 3CCVN 3KD1E 3CJBA 3RMBA 4DF8A 4Z4EA 2HMIA 2F8TA 1REVA 3G10A 3O9UA 4CZFA 3B6PA 3HPOA 4KB1A 2Q31A 4DQIA 3ATVA 2OA8A 3PIOL 4DQRA 1V4TA 4IG0A 1ILYA 5GADP 2A5XA 4PKGA 4BVPA 2O8EB 4BWJA 4FJXA 1SUQA 4GV6A 5HL7L 4DTOA 4OO1J 3K9KA 4CD1A 3IG1A 4OKJA 3QNOA 1X3MA 2HNDA 1RDWX 4A61A 1D4XA 3LDLA 4FK4A 3K9JA 1ZBSA 1LW0A 4C8LA 2WOMA 3VEYA 1VQ5N 2NRVA 1D9FA 4FJLA 3FFKB 4C8OA 1GLCG 1K8AO 2UYTA 3VEXA 4I7FA 5AQFA 4O0IA 4DR2K 4LH5A 4KKOA 3NGIA 3KK1A 2RF2A 3DJCA 1NK4A 3K5NA 3H08A 2VQEK 1Z25A 3IRXA 4B9MA 5M1OA 3ATUA 1QSSA 1BDGA 5BRDA 4FWQA 3QEIA 4CHQA 4DLGA 1DGKN 4A57A 4CEBA 5KPZA 4JK8A 1S1VA 2WUSA 3VQQA 5AQYA 3MDQA 5TKWA 3HL8A 4EHTA 3SV3A 4GW6A 3I8BA 1YVNA 5FRNA 2Z1HA 1YITN 1GOBA 2QWPA 4CGIA 1FKPA 4ID5A 2DFFA 2PYJA 3CM6A 4JK7A 4KTZA 3CPWM 4FJNA 3NDKA 3PX6A 1QSLA 4W5TA 3CXCM 4O8UA 3L4QA 3RMCA 1JL1A 2YNFA 2GUIA 4E1MA 1WSGA 3U4LA 1JLEA 3WNGA 5AFUH 3THXB 2XY8A 3JS6A 3TAFA 2E88A 2P5GA 2P9LA 2H3GX 1DTQA 3K59A 4ELVA 4JK9A 1TK5A 3BDPA 4FK0A 3MWPA 3VQDA 4NYFA 1WSHA 2HHWA 3B8AX 4PL8A 4B8AB 1L5UA 1RTHA 5DM6L 3O80A 1W7AA 3VESA 2WONA 4BR5A 3SAFA 3ZLJA 1JJ2M 4E3SA 4A2AA 3VQ7A 4C1NK 3C6TA 3ZSVA 4IDHA 3C6UA 4PY5A 4OVLA 1EETA 2P9IA 2NRRA 2V52B 5AZIB 4CECA 3QFUA 1ESVA 3OYJA 1L3VA 1XI1A 3ZT2A 3EZ5A 1ZC6A 2PBDA 4KHPK 3U9DA 4KHQA 3A2FA 4DUZK 1IKYA 2W6KA 2GEMA 3OYHA 2X6SA 3MAQA 3QEPA 5AQVA 2QK9A 5IT9O 4LH4A 1K9MO 4MQ3A 4BE0A 5HRNA 1SL2A 2O8FB 3E66A 4CJUA 2WFBA 5AQNA 2GWKA 5CYMA 1TK0A 2Z1IA 3R6MA 1KXPA 3H3NO 4CGDA 4O5FA 4CJ7A 2ETJA 4CW7B 2VWJA 3J7YP 4BRNA 2JWKA 5KQ8A 1N33K 3OYLA 2UU9K 1GLAG 4CZGA 3SAHA 4CZKA 1NJIO 4YNQA 5EXWA 4CF0A 3N4QA 1J53A 3WNEA 4E7HA 1XWLA 4KREA 4BC4A 2E8AA 1QQNA 1R59O 1G99A 2D5RA 2P9UA 5E26A 4CESA 4I6MA 3HM9A 3E01A 2VQFK 1S1TA 3FZHA 4DCHA 3K57A 2O8CA 4F3TA 4DQPA 1BU6O 1U2VA 3V9ZA 4JKHA 3RSEB 2OPRA 3DYAA 3KLEA 1BCOA 1VSEA 4NCGA 1RBVA 3QDKA 2HOEA 3VQ5A 4J8FA 2ZE2A 3AARA 1JCEA 3OYMA 3LDPA 4JS5A 1EQYA 2VG5A 3C7NA 3U3YA 4FWOA 4F2SA 3C6AA 1YAGA 2WC9A 3G25A 3TABA 4BC5A 2JGUA 4LSNA 4LSLA 2X78A 3LL3A 1HPMA 4K41A 3WXIA 2QKBA 4H4MA 2P9IB 1NK0A 5BRHA 3IMXA 1QVFM 2OZMA 1IKXA 4K42A 1R0AA 2VWBA 4ICLA 1WNSA 4PL7A 3VENA 1HYSA 2DFHA 1LWCA 4CZIA 2F7TA 3H6EA 1KCFA 1NOZA 3L8BA 4YDUC 3DLEA 4ISFA 4CFCA 4DR4K 4DS5A 3LDQA 4FJ7A 4LF6K 3VQ8A 3OYNA 4JKGA 1B9DA 1WLJA 2P9KA 1VQ8N 2YKNA 5HBMA 3OYEA 4ZTFA 1LAVA 2QXLA 4NXMK 1Q8IA 3L2QA 4PQUA 4QAGA 2OPQA 2QI2A 3IAYA 4FLYA 5A2QO 4Y0WA 2HSTA 3NHGA 5J2QA 4BGAA 2Q0UA 1QQOA 3DWLA 2QKKA 3H3OB 4B9LA 1VSJA 4FW2A 4KPYA 4DV5K 4HUFA 1HRHA 4V19S 3WXMB 3ZSXA 2Y1IA 3SBGA 1RDAA 4F2RA 1EO1A 4Z4FA 4RW6A 1IJJA 2XY7A 4K8XA 1UWBA 3DOKA 2Q97A 1OH6A 1SV5A 2O8CB 4BRHA 4DB3A 3MX5A 1U2VB 5JS1A 1U45A 4R79A 3TAEA 3NF8A 3AVBA 1D8YA 2UUBK 4B3MK 4IEIA 1RILA 5F1XA 1ZBFA 1E3MA 4HCCA 4OKEA 2HHTA 2FBXA 1JCGA 1KVCA 2G8FA 2VG6A 1K6YA 3VTHA 4N56A 2GELA 3K58A 3HM8A 1C0TA 1YUWA 3C7NB 1VK0A 3L3UA 4JKBA 3CJAA 4XEIA 4DV2K 2NZTA 2HBMA 2IVOA 4PWDA 4J2BA 4EHUA 1W9HA 3C6HA 1I39A 4BACA 5BREA 2E1YA 4DTSA 3NH0A 1L3UA 4B9NA 2VGMA 2PYLA 4H0TB 2HHUA 1V4SA 4DQQA 3OJUA 3LZJA 5DMRA 1EP4A 3HXMA 4EAHD 4CF2A 1B92A 3CMAN 2NRZA 3AVNA 1ZYQA 3R1XA 1RCHA 1WUAA 1OKJA 2W42A 4HHTA 4IOCL 4OPAA 4OPHA 1DLOA 3KLIA 3NE6A 3A0IX 2P9PA 5M1NA 4CFAA 5C2FA 4J2AA 2CH5A 2PY5A 1S1UA 2QW9A 3H1QA 3ZCMA 5B8HA 1J5OA 4JHDA 1VQ9N 4OLBA 4PHTX 4JS4A 2KTQA 3SK3A 3NVKA 4U7BA 2F8SA 4DSJA 4A62A 2F9WA 2HNZA 2RHKA 4FLUA 4JI3K 1VSKA 4KI4A 3HJFA 4JN4A 2D1KA 1O1WA 4FJ9A 1NK7A 2A1RA 2BH1A 3OYAA 3MEGA 4JKCA 1BIUA 4E1NA 4WFAL 4N47A 4KFBA 4X64K 2XY5A 4M42A 1YHQN 2E2PA 1Q82O 4FK2A 5GAGP 4EZ6A 3OA9A 1HNVA 3SQ0A 4OX9K 1ZBIA 3ZX0A 1H1VA 4WYBA 5HP1A 4B1YB 3I0RA 4F3OA 4FZZA 4BRQA 3P38A 2F9TA 1TL3A 3EL2A 3HP6A 4CJ4A 4IO9L 4E7JA 2QXFA 1WAFA 4DKWA 3FLCO 3OBWA 3CFOA 4CHPA 3QMLA 5C2DA 2ITGA 5SWMA 3K5MA 2O8EA 2ZWHA 1NMNA 2I7PA 3DAWA 5AQIA 4CJQA 4DR7K 1JCFA 3PLAA 5C24A 3A5LC 2QWRA 1B9FA 1XHZA 4B1ZA 3BY5A 3CHWA 3OYGA 2HW3A 1QQMA 3TPQA 1C1AA 5JVHL 4FPBA 4CZJA 5C15A 4DV3K 5AQPA 4IZ9A 3F9KA 4CHZA 1BCMA 4GMJB 2HF3A 1T6CA 3Q7BA 3QIOA 2DTUA 4Y1DA 2OTLN 2EHGA 3WEEB 1JLGA 3QFPA 3QNNA 4IOXA 4CGHA 3E1YA 3CPEA 1I3AA 5ADXH 3OHRA 2A40A 1JL2A 3DRPA 1UOCA 4O4GA 2GWJA 4MFBA 3TAQA 3NCIA 2HHSA 4DG1A 3IFRA 3VQ6A 4Q5VA 4QCLA 3T7ZA 1D9DA 3BZCA 4Z4HA 4DQ8A 3V1RA 3SQ4A 4B1WB 1NJZA 4O55A 3AVFA 3O9QA 4DSFA 3MEDA 1GLDG 3SJJA 4K8ZA 2P9PB 5GIPA 2D0BA 5SZTA 1Y64A 3VEZA 1SL1A 2IOCA 4EZ9A 4AHSA 5EVZA 3D2FB 4M3ZA 4H4OA 1RBSA 4AHVA 3RTVA 3V1QA 4Z4CA 3A5OC 1SL0A 1J9AA 4M3XA 4AILC 3MWTA 3QICA 5ADXA 4B1UB 3V4IA 3KK7A 1FXXA 4BVOA 3THXA 3SUPA 2A42A 5LY3A 2I5JA 4XH5A 4U67L 1ZBHA 3L2RA 5CHIA 1SS6A 3CMEN 3VTIA 4CJVA 1NK5A 1IBKK 3M8SA 2ZM6K 1A5WA 4RTFD 1S3XA 4I2QA 2YCHA 3TSQA 4DFKA 3SMPA 1ATSA 2UUAK 3EEQA 2PZSA 3T1HK 5C0YA 2QWOA 1GOAA 2ASPA 5BN9A 2UXCK 4CJKA 3J81O 2YNGA 4LFBK 4KO0A 1FK9A 2QEXN 3HP9A 1HPZA 4FJGA 2D0CA 5AZIA 4TSXA 5FDLA 3KK2A 3P39A 3KJVA 3VQBA 3BP8A 3QB0A 3QBXA 4IFEA 3DXKB 4W5QA 1P90A 1C0UA 2UXBK 4CK3A 4CJSA 4NB4A 2FLOA 3HVRA 3O4NA 2E1ZA 1YJNN 4ELUA 4BRCA 2KLAA 2P9SA 3DMJA 1QHTA 4O0JA 4CEEA 2DY4A 3MN9A 5AQZA 5KGXA 2GV9A 3AO4A 2GUPA 2O8FA 4WQ4A 4Z94A 3O08A 1NK6A 3HVTA 4AM6A 2P51A 2D0PA 2HNYA 1TUYA 4O44A 2HB5A 1HYVA 3T1AA 4CEQA 2FSJA 4CJPA 4WFBL 1HUXA 4B9TA 3RVCA 2IIRA 1JKHA 3FZKA 4WQ5C 4YOVA 4CBWA 4YFUA 3PX4A 4OLAA 3NF6A 1MU2A 4LF8K 1CLQA 4YOUA 1T05A 5EU7A 1ZBUA 3O8MA 4C8MA 5AR0A 1X3NA 3GL1A 4KHUA 3U8XA 2PAVA 2GTDA 2G8VA 2BGGA 1TV6A 2YHAA 3CFPA 4KAZA 3EYZA 3H1VX 1VSHA 3ZETA 4B08A 1VQKN 4CEZA 2HVIA 1TVRA 1KQSM 3RSEA 3KD5E 4M3YA 4N41A 2IVPA 3SPYA 5KQDA 1IKWA 2IC3A 3OYBA 3O1BA 3DLBA 3VGLA 3WXJA 4DLEA 1QS4A 2O4GA 5DK5A 3I8DA 3PO5A 4YORA 4GV3A 1JLAA 2Q1NA 3AVAA 4BC3A 3AO1A 1VSMA 3MEEA 2NNWA 3AO3A 3N4PA 5AZJB 3CIPA 3VF2A 1HJRA 4CI6A 3K5LA 4FZYA 3VQAA 3QINA 5FPEA 5DM7L 4IEEA 3O1WA 3VMFB 3LP3A 4IXCA 1NM1A 1NJYA 4RW4A 3HSCA 3WXLA 1NKBA 3M8RA 4J2EA 3LM2A 4JRPA 4ZTJA 3EZWA 2G8HA 3G0ZA 2ATQA 1S9EA 5AFUA 4BE2A 4AF1A 4E19A 5AQMA 4LF4K 3U9ZA 2CH6A 1W2BM 1RTIA 4A5BA 4FVMA 1VRTA 1QVGM 2P9SB 4OGCA 4O8KA 1CXUA 3CF5L 5AQSA 5JLHA 1OVYA 4H5TA 2QWMA 3WT0A 1LWFA 3SV4A 1ATRA 3E9LA 2O4IA 2LSNA 2KZZA 3G71N 2ZD1A 1DTTA 3GOIA 3JAMO 4H0VB 4ILJA 3D7EO 4HTUA 3P4IA 3SQ1A 2FBVA 1YT3A 3VGKA 3AVCA 3J8AA 3NH2A 1ITGA 2NRWA 4LY7A 5CYQA 4DU3A 1VRUA 2KFNA 1IBMK 1NGGA 3DXMB 3UKUB 3QO9A 4OPKA 5JVGL 3L2VA 4BY9C 4JI0K 3PX0A 1NJXA 1O13A 5EY4A 3CCQN 2D0AA 1NKCA 4Q0BA 1L3TA 2ZJQL 4UY8O 3OS1A 3I55N 4CK2A 4GVMA 1DEJA 1ASVA 4JEPA 3ZETB 3L0QA 2VWKA 3AAPA 3OYDA 3LWLA 1VSIA 3WQTA 1MWKA 4BR4A 3OYKA 3O3GA 4IOAL 4DTPA 3CJ7A 3RMAA 2BTFA 3QBWA 5H1SQ 4CEDA 4WCEL 5HRSA 1VQ6N 3CC4N 2HHVA 1C6VA 5BN8A 4BR7A 3MCAB 1RDDA 1BG3A 1YTAA 1HX1A 1BI4A 2E4LA 3DLHA 2G8IA 2CGLA 1M1KO 3DLGA 5C12A 1N34K 2YNIA 1QZ6A 1IG8A 3LWMA 4ISGA 2R7YA 4W5NA 4A59A 2FSKA 1UA1A 1YVUA 3HSTB 1BWFO 2JWLA 4RCHA 5M1KA 3ALYA 4DMNA 1OH8A 1EX4A 4Y1CA 1XQSC 3R8EA 4B1XB 1X9SA 1JLBA 1NOYA 2RKIA 3R3LA 2IAJA 3HOSA 4MLHA 3V81A 3IKMA 2IDOA 4BDZA 2O8BB 2YKMA 3LAMA 3GBTA 4N5SA 2E2NA 3QEVA 3FFIA 3QEWA 4BE1A 2YV0X 4CZLA 2HHXA 3OVNA 4C8NA 4BQZA 1Q81O 3F73A 4CF8A 1KAZA 1TAQA 1U49A 4FJKA 2GBZA 1XUPO 4JI8K 3BF1A 3VQ4A 1HQUA 3KKSA 4MO4A 4IBNA 5KTQA 2OCEA 1XC9A 2HBJA 2X74A 4QS7A 5KPTA 4L3QA 2G8UA 5LJVA 1S9GA 2HBKA 4DF4A 2FBTA 5LMUK 3HPGA 3EE9A 1JXBA 1LWEA 2AJQA 3KTQA 1X9WA 4BC2A 3AGRA 4EP4A 4JI4K 3LZIA 2ZJPL 5HOOA 3MCPA 4CGGA 1S1WA 4OPJA 1N36K 3O6WA 3VA0A 1NGIA 1VQON 4IKFA 3ULEA 5KRSA 3CCLN 3E9OA 3ZX3A 1TAUA 2B4JA 2ITMA 2A1SA 4I9QA 2J4RA 3MN6A 4CHOA 4WFNL 1D5AA 1F21A 4H5WA 3F2KA 4PUOA 4FM0A 4J2DA 1BI4B 1XNRK 1IO2A 4MDBA 3ID6A 4BDPA 4BGBA 2E20A 1YF5L 3WEEA 3CCSN 1NKEA 5FLXO 3OBYA 2Z1GA 1SKRA 4E7IA 1WSFA 2RPIA 3T19A 4KB0A 1C1BA 3HPHA 1KD1O 4Z4IA 1MA9B 3LANA 4ILGB 3V9XA 1GLEG 3IS9A 3RWUA 4DV0K 3NAEA 2G8KA 3VF6A 3MXIA 3O9SA 3HRGA 3KLHA 4ELTA 3E9PA 4YHHK 4CBUA 2OPSA 1HNZK 3SNNA 3ZEUA 3EKSA 5FPNA 4DFJA 3TTCA 3NMUA 3D2FA 1X9JA 2Z1JA 1YJWN 2QWLA 2X6NA 1WSIA 2YJFA 3AO5A 4BR9A 3ZT3A 1C0MA 3ZX2A 4B9QA 3TU5A 4DTJA 4RG8A 3LP1A 1P8ZA 3ID8A 4B9SA 4FYDA 3NGZA 1YXQA 5HRRA 3AA4A 3UE5A 4AHUA 3SUOA 2HHQA 3CD6N 5EX5A 3EY1A 3U3GA 5M1FA 3L6QA 2NRTA 1TL1A 2GX9A 5TKYA 1RDBA 1EKEA 3IDHA 5BRFA 1BUPA 1HR0K 1RBRA 4FO0A 4DTMA 5M1PA 3J7AP 4NO7A 4H5NA 4IO8A 2BUPA 2E2QA 1HNXK 4UQGA 3CCJN 4WQ4C 5AQXA 4YDUA 1NMDA 3QESA 4KH4A 4AHCA 3V9UA 1YIJN 1N5YA 1RT1A 1BQMA 2RN2A 3HK2A 4W5OA 3DXKA 1TYQB 4GNIA 4CJTA 4FWRA 4NCAA 1NGCA 1RGIA 4JKFA 3AAQA 3OJSA 4A5AA 1LV5A 4IWVA 4CIGA 1E4FT 3MN7A 3AVHA 3ULEB 3MXMA 4KHYA 4KTQA 1KLNA 1VSFA 4XIUA 4CERA 1VQPN 2FC0A 3FE1A 3KKRA 4FWMA 1IBLK 2OPPA 1OH5A 4XH4A 1LCUA 4CJLA 4LF7K 2KW4A 4GKKK 1C1CA 3FR0A 3AVJA 3PSFA 4FJIA 4CEOA 2KKZA 3V6DA 1EWQA 4IFVA 1C0FA 3VEVA 4BRDA 3THWA 3ZYYX 1IKVA 2ZJRL 3DLKA 3EN9A 4BG8A 2QM1A 3GDQA 3ZSOA 5AQLA 3VETA 5IWAK 3O9RA 4FWLA 4BRLA 4E0DA 3ZT0A 1N8RO 3ZSWA 2V7ZA 5E41A 3ZT4A 5KGWA 4CZEA 3V9WA 5K14A 3LP0A 3FGUA 1J6ZA 5AQHA 3HZ6A 3AGKA 3CG7A 4B9UA 3HYFA 4PKHA 4KTWA 3ZEUB 3D0PA 1HMVA 2PFUA 3W3DA 1TGOA 5BR9A 1S1XA 1ZXOA 4B3RK 2WTUA 1X1PA 5J1EA 1KSPA 4BRAA 5CR4A 5AQTA 3NGYA 3CC7N 5KPRA 1SAZA 1T7PA 5AJ3K 4FJMA 1JXEA 4EFHA 3AY9A 3NFAA 1N6QA 3TAMA 3HO1A 4OKKA 2E5LK 4DSKA 5AZJA 4M3WA 4H03B 4Z0UA 4DQSA 3P31A 4FJ5A 1VHXA 3D45A 3LPUA 3WQUA 4CZHA 1U48A 3M8PA 4FJ8A 3NBPA 2BANA 2YHXA 3AA2A 3T1YK 3CCUN 4JAXA 1NGHA 2NRHA 4CHNA 4CCHA 1T44A 3LDSA 4H0YB 3LPTA 3A5NC 4E7KA 3VERA 1QQCA 3DRRA 2VG7A 3EE8A 3O9TA 5LL6Z 4BR0A 5BPNA 3TAPA 4B8CA 3CCEN 3AO2A 1BISA 4JV5K 5C10A 1I94K 3C65A 2EX3A 4FVUA 3OYIA 3KWGA 1HYZA 2D4WA 1Q9XA 3J7ZO 1NK8A 3S3MA 4KHSA 5CY4A 1NGAA 3AVKA 2YX6A 2A41A 4A2BA 3G4SN 3NF9A 3W0LA 3SMSA 3ASMA 4FOEA 4JD2B 1VQMN 1XNQK 2UXDK 4L8RB 3HOTA 5CZ1A 3RMDA 1K8KA 2EWSA 4BRFA 4HVJA 1HJOA 3THWB 4JRQA 4LD0A 5JLFA 1NK9A 3OTOK 3WXKA 3DXMA 3UKUA 5I3UA 3VEWA 3ZSRA 3H46O 4FLTA 3L3VA 3MXJA 4X65K 1TKTA 3AVGA 4Z4GA 1JLFA 4C1NI 2W41A 5CE3A 5I9EB 4K43A 3DLRA 3CM5A 1Z26A 2DFEA 1Z05A 4BG9A 4BROA 3DLLL 4JYAK 3O3FA 4DR5K 1IV0A 3HTVA 1WB9A 1UAXA 4CBXA 3MMVA 2B6AA 1W0HA 5GINA 1TKDA 2KZMA 1KFDA 4B3TK 3RR7A 4FWNA 1QSYA 1WN7A 1ASUA 1VSDA 3VEOA 4M41A 4F4KA 1TKXA 4N76A 4KH5A 3QEXA 1BO5O 3CYMA 2YJEA 3P1GA 1CZAN 3CJCA 2DPNA 5T7BA 4LFAK 3V9SA 3H45C 5E84A 3ZSQA 4PA1A 4R5PA 1HKBA 4H5RA 2YI1A 3I56N 4FWSA 4BDYA 3BZKA 3WNFA 1RDCA 5AQGA 4BWMA 2RE2A 3TTFA 3QETA 4DV1K 1T6DA 2XO7A 3VN5A 4RW8A 1NGJA 3T3FA 2FSNA 2KQ2A 4NLBA 3OYFA 4EIAA 3MX2A 3HI0A 4CJFA 3I33A 1S6QA 4M7XA 3VQPA 5D3GA 4FZXC 4MDAA 3NF7A 2UUCK 4DR6K 1Q86O 2O8BA 5JICA 1T3VA 4DV4K 4KBOA 1Q7YO 2FF3B 1ZBLA 5FRMA 4IJAA 2BE2A 4CF1A 4G9ZA 1Z6RA 3B6OA 3CI5A 3F5TA 1U47A 3PIPL 4LF5K 4I2PA 4EP5A 4BRIA 1BIZA 1E4GT 2IGIA 4AHTA 3M8QA 1VQ4N 1IG9A 2W40A 3PUFA 3SUQA 1NGFA 1U6ZA 3BEXA 1K8KB 3LDOA 1KVBA 4CIEA 4DU1A 3P83D 2ZQBA 1XMOK 4BR2A 3THYA 3KLFA 4K0KK 4E1JA 4M7YA 4DTRA 1Q9YA 1S72N 4F9OA 4HUGA 3RR8A 4IFYA 3VQCA 3PY8A 3FZFA 1YI2N 4IG3A 4DTUA 3O4QA 5AQQA 2FXUA 3M6GA 1BL3A 3KHYA 3MN5A 3JSMA 4FM1A 4CGJA 5AQRA 3OW2M 1J5EK 1OVQA 4BRKA 3VOVA 3QLHA 1SZ2A 3D6RA 4M63C 3KLGA 4PKIA 5F2RA 1JLCA 4FL9A 1T8EA 3AVMA 1WBDA 3FZLA 1TK8A 4B1VA 3S9HA 3S3OA 4DU4A 1XHXA 4KRFA 1KVAA 4DV7K 1RT3A 1HKCA 4NCBA 4MLEA 4FW1A 4FWPA 3TSUA 1U04A 3TAGA 4WQ5A 4K25A 3DI6A 3CCMN 3BF3A 4GKJK 1WOQA 2E6LA 1RT4A 1MWMA 1QHAA 4NLCA 2CGJA 1BA0A 1CZ9A 1WAJA 4CVNE 1SQKA 3JYTA 2OZSA 3UKRA 4DUYK 2QA4N 2OYQA 1WBBA 3KK3A 2I7NA 2XHBA 1S6PA 2P9LB 2Q0RA 1LW2A 3ZT1A 4AHRA 3SPZA 3LDNA 2ASOA 1BQNA 4JI7K 4KV8A 3SUNA 4DS4A 1ASWA 1KRPA 4CE9A 4O5BA 3QERA 4FLWA 1RNHA 1EWRA 2Y1JA 3KWIA 1VSLA 1HQEA 3VQEA 2E2OA 4YOWA 1S5JA 2O8DA 3SCXA 3TARA 2YHBA 3TSPA 1NGDA 1J54A 2ZGZA 4X62K 1NG9A 1FW6A 1SKSA 1LAWA 1BA1A 3ULDA 2AA4A 3O4WA 3KIOA 4HUEA 2IVNA 3VGMA 3HT3A 4LF9K 1QTMA 2NLXA 1GLJO 2AP1A 3CQ8A 3CQXA 2HHHK 1W97L 3GE1A 3J80O 5LMNK 5JMVA 4JI2K 4DTXA 4IDKA 1RBUA 4BRPA 1KLMA 4FPAA 3OS0A 4FWKA 3THYB 3LALA 4QOZB 2YHWA 1GLBG 4ID1A 1HLUA 3C95A 3ZSZA 4CEAA 1T03A 1VAZA 3ISNC 3WUHA 4I9LA 3ZSYA 1QE1A 5AQWA 3T69A 1ATNA 4YY3K 4JKEA 2XRIA 4GY2B 2F4VK 3RRGA 1XC3A 1GLFO 2G8WA 1X9MA 1QZ5A 2IS3A 4G1QA 4YOTA 5BPMA 4KI6A 3ITHA 3OYCA 2HMPA 1MDUB 1RT7A 1VQLN 1DT9A 3C94A 4BRMA 4YOXA 3BUZB 4C23A 1TYQA 2NRXA
chains in the Genus database with same CATH topology
4O44A 1KLNA 1VSFA 2HB5A 4XIUA 3DRSA 4CERA 1HYVA 3T1AA 4CEQA 2FC0A 3WNHA 4CJPA 4CF9A 4YNQA 3K2PA 3KKRA 4CF0A 4B9TA 1JKHA 1J53A 2OPPA 1SKWA 4CJLA 3WNEA 2KW4A 4YFUA 1XWLA 4E7HA 3PX4A 4OLAA 1C1CA 4KREA 5J2NA 3NF6A 3AVJA 2KFZA 1MU2A 1CLQA 1T05A 5EU7A 2D5RA 3TR8A 4CHYA 4FJIA 4CEOA 4CESA 3V6DA 1ZBUA 5HRPA 4C8MA 4H8KA 4ZHRA 4W5RA 4IFVA 3HM9A 3E01A 1S1TA 3K57A 4KHUA 4F3TA 4DQPA 1IKVA 4KHWA 3V9ZA 3DLKA 2G8VA 1RT5A 2BGGA 2OPRA 3ZSOA 4E0DA 3TWHA 3AA3A 4FJHA 1TV6A 2YHAA 3CFPA 3ZT0A 2XY6A 4KAZA 3ZSWA 5J2MA 3DYAA 3EYZA 3KLEA 1BCOA 1VSEA 1VSHA 3AVIA 5KGWA 4NCGA 3ZT4A 4B08A 4OGEA 1RBVA 4CEZA 3V9WA 1L3SA 5K14A 2HVIA 3LP0A 1TVRA 3KD5E 3VQ5A 4M3YA 3CG7A 4B9UA 4N41A 2ZE2A 3HYFA 3SPYA 1TKZA 4KTWA 4CJEA 1IKWA 2IC3A 4KHNA 3OYMA 3OYBA 1HMVA 3D0PA 4FLVA 3U6FA 2BDPA 4JS5A 2E6MA 3SZ2A 1TGOA 3DLBA 4JLHA 2VG5A 1JLQA 4DLEA 1S1XA 1QS4A 2O4GA 4M3RA 3U3YA 1RT2A 3PV8A 1X1PA 5DK5A 3O3HA 3I8DA 2JLEA 5J1EA 3PO5A 3L2WA 4F2SA 1JLAA 1KSPA 3TABA 3AVAA 3AO1A 1VSMA 2JGUA 4E89A 3SI6A 4LSNA 2NUBA 3MEEA 4LSLA 3QIPA 3NGYA 2X78A 1GOCA 3S3NA 3AO3A 4CGFA 1T7PA 3AVLA 4FJMA 1JXEA 2QKBA 5C42A 1HJRA 3K5LA 4FZYA 4H4MA 3VQAA 3NFAA 3QINA 1NK0A 1N6QA 3TAMA 3HO1A 4OKKA 1RTJA 3LP3A 1IKXA 2OZMA 4DSKA 1R0AA 4C8KA 1NJYA 4ICLA 1WNSA 4RW4A 4M3WA 1NKBA 3M8RA 4Z0UA 4J2EA 1HYSA 4DQSA 2G8IA 2DFHA 4FJ5A 4DSEA 3D45A 3LPUA 1LWCA 4JRPA 4ZTJA 1U48A 3M8PA 5I42A 2G8HA 1KCFA 4FJ8A 1NOZA 3L8BA 3G0ZA 2ATQA 1S9EA 3NBPA 4FXDA 2BANA 3DLEA 4DWIA 3AA2A 3AV9A 4CFDA 4CFCA 4BE2A 3VQ9A 4E19A 4CHNA 4CCHA 4DS5A 4FJ7A 3LDSA 1RTIA 3VQ8A 3OYNA 1B9DA 3DOLA 1WLJA 4FVMA 2F96A 1VRTA 4DFPA 2YKNA 3LPTA 5HBMA 4FCYA 4E7KA 4OGCA 3OYEA 4ZTFA 5CZ2A 1LAVA 1QQCA 2B5JA 3DRRA 1CXUA 4FLZA 4WE1A 2VG7A 1Q8IA 2P1JA 4CJ5A 4QAGA 3L2QA 4PQUA 3NH1A 1CXQA 3TAPA 2OPQA 4B8CA 3IAYA 5J2PA 4FLYA 1G15A 1WSEA 3AO2A 3K5OA 1BISA 4DTNA 1LWFA 3SV4A 2O4IA 2KZZA 2LSNA 3NHGA 2EX3A 5J2QA 2ZD1A 1DTTA 4RW7A 1KFSA 3OYIA 5JS2A 1HYZA 5KRTA 1FKOA 4DSLA 1Q9XA 1NK8A 4HTUA 3SYZA 2QKKA 4NYNA 3S3MA 3SQ1A 4B9LA 4KHSA 1VSJA 2FBVA 4FW2A 1YT3A 5CY4A 4HUFA 1HRHA 3DM2A 1RTDA 3PO4A 3AVKA 3AVCA 3ZSXA 2Y1IA 3NH2A 1ITGA 1KTQA 4LY7A 3NF9A 1RDAA 1VRUA 5CYQA 3CFRA 4DU3A 2KFNA 4F2RA 1WSJA 3ASMA 4FM2A 4Z4FA 4RW6A 3QO9A 3THVA 1NJWA 4OPKA 1EXQA 1UWBA 3DOKA 3L2VA 2XY7A 4K8XA 4L8RB 5CZ1A 3RMDA 3RRHA 3PX0A 4HVJA 1SV5A 4CJ3A 3OY9A 4JRQA 1HNIA 1NJXA 4KPYA 4LD0A 1NK9A 5JS1A 1U45A 3TAEA 2D0AA 3NF8A 1NKCA 4Q0BA 1L3TA 3AVBA 3OS1A 4CK2A 1CZBA 1D8YA 4GVMA 5I3UA 3OS2A 3ZSRA 1ASVA 3LAKA 1UA0A 1A5VA 4FLTA 3L3VA 1RILA 3MXJA 1ZBFA 1TKTA 3I0SA 3AVGA 4Z4GA 1JLFA 2VWKA 4HCCA 3OYDA 3LWLA 3AA5X 1VSIA 3DLRA 4OKEA 2HVHA 2HHTA 2FBXA 4B9VA 4DSIA 1BHLA 3CM5A 1Z26A 2DFEA 3V1OA 4CJRA 1KVCA 3OYKA 2G8FA 4OJRA 3O3GA 2VG6A 1K6YA 2YNHA 4AH9A 3L2UA 3TANA 3BGRA 4N56A 3O3FA 2FBYA 4DTPA 3K58A 3UIQA 3RMAA 2P5OA 1C0TA 4CEDA 1VK0A 1UAXA 3L3UA 5FROA 5HLFA 5HRSA 2B6AA 1W0HA 4M3TA 2HHVA 4PWDA 1C6VA 1TKDA 4J2BA 1W9HA 2KZMA 1KFDA 1I39A 4BACA 1RT6A 1RBTA 1RDDA 1A5XA 4DTSA 1YTAA 3NH0A 3RR7A 1L3UA 1BGXT 1BI4A 2E4LA 4CJWA 5C25A 3DLHA 4B9NA 1QSYA 3DLGA 2PYLA 1WN7A 2HHUA 1ASUA 4CEFA 2YNIA 1VSDA 3VA3A 4M41A 4DQQA 4F4KA 3OJUA 3LWMA 3LZJA 2R7YA 1TKXA 5DMRA 4N76A 1EP4A 4W5NA 3HXMA 4CF2A 3QEXA 1B92A 3CYMA 3P1GA 3AVNA 1ZYQA 1RCHA 1UA1A 4HCBA 4F8RA 3MECA 1YVUA 3HSTB 5T7BA 2W42A 4HHTA 4DFMA 1IH7A 3V9SA 5KI6A 3ALYA 3ZSQA 4PA1A 1EX4A 4Y1CA 1DLOA 3KLIA 4DMNA 4R5PA 3NE6A 4E7LA 4CK1A 4J2AA 4CFAA 2PY5A 1X9SA 1JLBA 1S1UA 1NOYA 4BDYA 3P5JA 3WNFA 1YTUA 1RDCA 3ZCMA 2RKIA 4BWMA 3LP2A 1J5OA 4OLBA 4M45A 5HROA 3QETA 4JS4A 2IAJA 4FLXA 2KTQA 1Y97A 2Q3SA 3SQ2A 4DSJA 2F8SA 2XO7A 3VN5A 3TI0A 4B3OA 3V81A 1U4BA 4KI4A 2HNZA 2IDOA 4RW9A 4RW8A 1VSKA 4FLUA 4M3UA 3HJFA 3T3FA 4FJJA 1O1WA 4FJ9A 2KQ2A 4BDZA 3OYFA 2YKMA 3LAMA 1NK7A 2A1RA 4CFBA 4CIFA 4N5SA 3QEVA 3KD1E 4CJFA 3FFIA 3OYAA 3QEWA 3MEGA 4BE1A 3RMBA 1BIUA 4E1NA 4DF8A 1S6QA 2HMIA 4Z4EA 4N47A 1REVA 2YV0X 3G10A 4KFBA 3VQPA 2XY5A 4FZXC 4M42A 3B6PA 5D3GA 3NF7A 2HHXA 3OVNA 4FK2A 4EZ6A 3HPOA 4KB1A 3SQ0A 1HNVA 1ZBIA 4DQIA 4C8NA 5HP1A 1ZBLA 2OA8A 5FRMA 2BE2A 3I0RA 4CF1A 4F3OA 3F73A 4FZZA 4CF8A 1TL3A 3B6OA 4DQRA 4IG0A 1TAQA 4E7JA 3HP6A 4CJ4A 1U47A 2QXFA 1U49A 1WAFA 4FJKA 4I2PA 4BWJA 4EP5A 2GBZA 1BIZA 4FJXA 2IGIA 4AHTA 1SUQA 3VQ4A 1HQUA 3KKSA 3M8QA 1IG9A 4IBNA 3CFOA 4CHPA 5KTQA 1XC9A 3PUFA 4DTOA 2ITGA 3SUQA 2X74A 5SWMA 1KVBA 3K5MA 3IG1A 4OKJA 2G8UA 4CIEA 4DU1A 3P83D 2ZQBA 3QNOA 1S9GA 2HNDA 4DF4A 3KLFA 2FBTA 5E41A 4DTRA 1Q9YA 4CJQA 3HPGA 5C24A 4HUGA 3RR8A 4FK4A 4IFYA 3VQCA 3PY8A 1JXBA 1LWEA 2AJQA 1B9FA 4IG3A 4DTUA 1LW0A 1XHZA 1X9WA 3KTQA 4C8LA 2WOMA 3O4QA 3OYGA 4EP4A 2HW3A 1BL3A 3LZIA 1D9FA 4FJLA 3JSMA 4FM1A 4C8OA 1C1AA 4CGGA 4CGJA 1S1WA 4OPJA 4I7FA 3VA0A 4O0IA 4LH5A 4KKOA 3NGIA 4IKFA 3KK1A 3F9KA 4CHZA 1BCMA 3QLHA 4GMJB 5KRSA 3KLGA 1JLCA 2RF2A 3AVMA 1T8EA 1NK4A 1TAUA 3K5NA 3QIOA 2B4JA 3H08A 1TK8A 2DTUA 3S9HA 2A1SA 3S3OA 1Z25A 3IRXA 4Y1DA 4CHOA 1XHXA 4DU4A 4B9MA 4I9QA 4KRFA 1D5AA 1F21A 1KVAA 2EHGA 1QSSA 1JLGA 1RT3A 3QNNA 4CGHA 3QEIA 4CHQA 4DLGA 4PUOA 4CEBA 4FM0A 1I3AA 4J2DA 4NCBA 1BI4B 4FW1A 1S1VA 1U04A 3TAGA 1IO2A 3VQQA 3DI6A 4BDPA 1JL2A 3HL8A 3SV3A 3DRPA 1UOCA 2E6LA 4O4GA 4GW6A 1RT4A 1NKEA 4MFBA 3TAQA 1CZ9A 1WAJA 2Z1GA 3NCIA 5FRNA 4DG1A 1SKRA 3VQ6A 4Q5VA 2HHSA 4QCLA 2Z1HA 3JYTA 1GOBA 4E7IA 1D9DA 2OZSA 4Z4HA 4CGIA 1FKPA 1WSFA 2RPIA 4ID5A 3T19A 3V1RA 3SQ4A 1NJZA 4O55A 3AVFA 4KB0A 1C1BA 2DFFA 3HPHA 4DSFA 3MEDA 2PYJA 3CM6A 4KTZA 4K8ZA 3SJJA 4FJNA 4Z4IA 2OYQA 3LANA 3NDKA 2D0BA 3PX6A 1QSLA 5SZTA 3KK3A 4W5TA 2XHBA 3V9XA 1S6PA 1SL1A 2IOCA 3IS9A 4EZ9A 3RWUA 4AHSA 3NAEA 2G8KA 1LW2A 4M3ZA 3MXIA 3ZT1A 1JL1A 4H4OA 1RBSA 2GUIA 2YNFA 1WSGA 4E1MA 4AHVA 1JLEA 3KLHA 4ELTA 3WNGA 3RTVA 2XY8A 4AHRA 3SPZA 3TAFA 3V1QA 2P5GA 2OPSA 4Z4CA 3SNNA 1SL0A 1DTQA 1J9AA 4M3XA 4DFJA 4AILC 3K59A 4ELVA 1BQNA 1TK5A 3BDPA 4KV8A 3SUNA 4FK0A 2Z1JA 3V4IA 4DS4A 1ASWA 3VQDA 1FXXA 1KRPA 4CE9A 2X6NA 3SUPA 1WSIA 4NYFA 4O5BA 1WSHA 3QERA 2HHWA 4B8AB 1RNHA 3AO5A 2I5JA 1RTHA 4FLWA 1L5UA 2Y1JA 1ZBHA 1VSLA 1HQEA 3ZT3A 3VQEA 2WONA 3L2RA 1C0MA 1S5JA 1NK5A 4CJVA 4E3SA 3SCXA 3VQ7A 3M8SA 2YHBA 3TARA 3C6TA 4DTJA 4RG8A 1A5WA 3LP1A 4I2QA 3ZSVA 4B9SA 4FYDA 1J54A 3C6UA 3NGZA 4DFKA 1SKSA 4PY5A 4OVLA 5HRRA 1EETA 1LAWA 3AA4A 4AHUA 2PZSA 3SUOA 1GOAA 2HHQA 3ULDA 4CECA 3EY1A 3KIOA 3U3GA 4CJKA 3OYJA 4HUEA 1XI1A 1L3VA 1TL1A 3ZT2A 3HT3A 1RDBA 1EKEA 3EZ5A 1QTMA 2YNGA 3CQ8A 4KO0A 1FK9A 1RBRA 3HP9A 1HPZA 4DTMA 4FJGA 2D0CA 3A2FA 4KHQA 4DTXA 1IKYA 4TSXA 5FDLA 3KK2A 4IDKA 3OYHA 1RBUA 2X6SA 3VQBA 3KJVA 3MAQA 3QEPA 1KLMA 3OS0A 2QK9A 3RMCA 4UQGA 3LALA 4W5QA 4QOZB 1C0UA 4LH4A 4ID1A 4CK3A 3C95A 3ZSZA 4CJSA 4CEAA 4MQ3A 4BE0A 5HRNA 3QESA 4AHCA 3V9UA 3HVRA 1T03A 1SL2A 3ISNC 1N5YA 4CJUA 1RT1A 4I9LA 3O4NA 3ZSYA 4ELUA 1QE1A 1BQMA 2RN2A 3HK2A 4W5OA 3DMJA 1QHTA 5CYMA 1TK0A 4O0JA 2Z1IA 4CJTA 2F8TA 4CEEA 2DY4A 4CGDA 2XRIA 4NCAA 3RRGA 5KGXA 2ETJA 2GV9A 3AO4A 2IS3A 4G1QA 1X9MA 2G8WA 2VWJA 3OJSA 4KI6A 3ITHA 3OYCA 1LV5A 1NK6A 4CIGA 1RT7A 3AVHA 3HVTA 3C94A 2P51A 3MXMA 4KHYA 4KTQA 3OYLA 2HNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O44 A;  1KLN A;  1VSF A;  2HB5 A;  4XIU A;  3DRS A;  4CER A;  1HYV A;  3T1A A;  4CEQ A;  2FC0 A;  3WNH A;  4CJP A;  4CF9 A;  4YNQ A;  3K2P A;  3KKR A;  4CF0 A;  4B9T A;  1JKH A;  1J53 A;  2OPP A;  1SKW A;  4CJL A;  3WNE A;  2KW4 A;  4YFU A;  1XWL A;  4E7H A;  3PX4 A;  4OLA A;  1C1C A;  4KRE A;  5J2N A;  3NF6 A;  3AVJ A;  2KFZ A;  1MU2 A;  1CLQ A;  1T05 A;  5EU7 A;  2D5R A;  3TR8 A;  4CHY A;  4FJI A;  4CEO A;  4CES A;  3V6D A;  1ZBU A;  5HRP A;  4C8M A;  4H8K A;  4ZHR A;  4W5R A;  4IFV A;  3HM9 A;  3E01 A;  1S1T A;  3K57 A;  4KHU A;  4F3T A;  4DQP A;  1IKV A;  4KHW A;  3V9Z A;  3DLK A;  2G8V A;  1RT5 A;  2BGG A;  2OPR A;  3ZSO A;  4E0D A;  3TWH A;  3AA3 A;  4FJH A;  1TV6 A;  2YHA A;  3CFP A;  3ZT0 A;  2XY6 A;  4KAZ A;  3ZSW A;  5J2M A;  3DYA A;  3EYZ A;  3KLE A;  1BCO A;  1VSE A;  1VSH A;  3AVI A;  5KGW A;  4NCG A;  3ZT4 A;  4B08 A;  4OGE A;  1RBV A;  4CEZ A;  3V9W A;  1L3S A;  5K14 A;  2HVI A;  3LP0 A;  1TVR A;  3KD5 E;  3VQ5 A;  4M3Y A;  3CG7 A;  4B9U A;  4N41 A;  2ZE2 A;  3HYF A;  3SPY A;  1TKZ A;  4KTW A;  4CJE A;  1IKW A;  2IC3 A;  4KHN A;  3OYM A;  3OYB A;  1HMV A;  3D0P A;  4FLV A;  3U6F A;  2BDP A;  4JS5 A;  2E6M A;  3SZ2 A;  1TGO A;  3DLB A;  4JLH A;  2VG5 A;  1JLQ A;  4DLE A;  1S1X A;  1QS4 A;  2O4G A;  4M3R A;  3U3Y A;  1RT2 A;  3PV8 A;  1X1P A;  5DK5 A;  3O3H A;  3I8D A;  2JLE A;  5J1E A;  3PO5 A;  3L2W A;  4F2S A;  1JLA A;  1KSP A;  3TAB A;  3AVA A;  3AO1 A;  1VSM A;  2JGU A;  4E89 A;  3SI6 A;  4LSN A;  2NUB A;  3MEE A;  4LSL A;  3QIP A;  3NGY A;  2X78 A;  1GOC A;  3S3N A;  3AO3 A;  4CGF A;  1T7P A;  3AVL A;  4FJM A;  1JXE A;  2QKB A;  5C42 A;  1HJR A;  3K5L A;  4FZY A;  4H4M A;  3VQA A;  3NFA A;  3QIN A;  1NK0 A;  1N6Q A;  3TAM A;  3HO1 A;  4OKK A;  1RTJ A;  3LP3 A;  1IKX A;  2OZM A;  4DSK A;  1R0A A;  4C8K A;  1NJY A;  4ICL A;  1WNS A;  4RW4 A;  4M3W A;  1NKB A;  3M8R A;  4Z0U A;  4J2E A;  1HYS A;  4DQS A;  2G8I A;  2DFH A;  4FJ5 A;  4DSE A;  3D45 A;  3LPU A;  1LWC A;  4JRP A;  4ZTJ A;  1U48 A;  3M8P A;  5I42 A;  2G8H A;  1KCF A;  4FJ8 A;  1NOZ A;  3L8B A;  3G0Z A;  2ATQ A;  1S9E A;  3NBP A;  4FXD A;  2BAN A;  3DLE A;  4DWI A;  3AA2 A;  3AV9 A;  4CFD A;  4CFC A;  4BE2 A;  3VQ9 A;  4E19 A;  4CHN A;  4CCH A;  4DS5 A;  4FJ7 A;  3LDS A;  1RTI A;  3VQ8 A;  3OYN A;  1B9D A;  3DOL A;  1WLJ A;  4FVM A;  2F96 A;  1VRT A;  4DFP A;  2YKN A;  3LPT A;  5HBM A;  4FCY A;  4E7K A;  4OGC A;  3OYE A;  4ZTF A;  5CZ2 A;  1LAV A;  1QQC A;  2B5J A;  3DRR A;  1CXU A;  4FLZ A;  4WE1 A;  2VG7 A;  1Q8I A;  2P1J A;  4CJ5 A;  4QAG A;  3L2Q A;  4PQU A;  3NH1 A;  1CXQ A;  3TAP A;  2OPQ A;  4B8C A;  3IAY A;  5J2P A;  4FLY A;  1G15 A;  1WSE A;  3AO2 A;  3K5O A;  1BIS A;  4DTN A;  1LWF A;  3SV4 A;  2O4I A;  2KZZ A;  2LSN A;  3NHG A;  2EX3 A;  5J2Q A;  2ZD1 A;  1DTT A;  4RW7 A;  1KFS A;  3OYI A;  5JS2 A;  1HYZ A;  5KRT A;  1FKO A;  4DSL A;  1Q9X A;  1NK8 A;  4HTU A;  3SYZ A;  2QKK A;  4NYN A;  3S3M A;  3SQ1 A;  4B9L A;  4KHS A;  1VSJ A;  2FBV A;  4FW2 A;  1YT3 A;  5CY4 A;  4HUF A;  1HRH A;  3DM2 A;  1RTD A;  3PO4 A;  3AVK A;  3AVC A;  3ZSX A;  2Y1I A;  3NH2 A;  1ITG A;  1KTQ A;  4LY7 A;  3NF9 A;  1RDA A;  1VRU A;  5CYQ A;  3CFR A;  4DU3 A;  2KFN A;  4F2R A;  1WSJ A;  3ASM A;  4FM2 A;  4Z4F A;  4RW6 A;  3QO9 A;  3THV A;  1NJW A;  4OPK A;  1EXQ A;  1UWB A;  3DOK A;  3L2V A;  2XY7 A;  4K8X A;  4L8R B;  5CZ1 A;  3RMD A;  3RRH A;  3PX0 A;  4HVJ A;  1SV5 A;  4CJ3 A;  3OY9 A;  4JRQ A;  1HNI A;  1NJX A;  4KPY A;  4LD0 A;  1NK9 A;  5JS1 A;  1U45 A;  3TAE A;  2D0A A;  3NF8 A;  1NKC A;  4Q0B A;  1L3T A;  3AVB A;  3OS1 A;  4CK2 A;  1CZB A;  1D8Y A;  4GVM A;  5I3U A;  3OS2 A;  3ZSR A;  1ASV A;  3LAK A;  1UA0 A;  1A5V A;  4FLT A;  3L3V A;  1RIL A;  3MXJ A;  1ZBF A;  1TKT A;  3I0S A;  3AVG A;  4Z4G A;  1JLF A;  2VWK A;  4HCC A;  3OYD A;  3LWL A;  3AA5 X;  1VSI A;  3DLR A;  4OKE A;  2HVH A;  2HHT A;  2FBX A;  4B9V A;  4DSI A;  1BHL A;  3CM5 A;  1Z26 A;  2DFE A;  3V1O A;  4CJR A;  1KVC A;  3OYK A;  2G8F A;  4OJR A;  3O3G A;  2VG6 A;  1K6Y A;  2YNH A;  4AH9 A;  3L2U A;  3TAN A;  3BGR A;  4N56 A;  3O3F A;  2FBY A;  4DTP A;  3K58 A;  3UIQ A;  3RMA A;  2P5O A;  1C0T A;  4CED A;  1VK0 A;  1UAX A;  3L3U A;  5FRO A;  5HLF A;  5HRS A;  2B6A A;  1W0H A;  4M3T A;  2HHV A;  4PWD A;  1C6V A;  1TKD A;  4J2B A;  1W9H A;  2KZM A;  1KFD A;  1I39 A;  4BAC A;  1RT6 A;  1RBT A;  1RDD A;  1A5X A;  4DTS A;  1YTA A;  3NH0 A;  3RR7 A;  1L3U A;  1BGX T;  1BI4 A;  2E4L A;  4CJW A;  5C25 A;  3DLH A;  4B9N A;  1QSY A;  3DLG A;  2PYL A;  1WN7 A;  2HHU A;  1ASU A;  4CEF A;  2YNI A;  1VSD A;  3VA3 A;  4M41 A;  4DQQ A;  4F4K A;  3OJU A;  3LWM A;  3LZJ A;  2R7Y A;  1TKX A;  5DMR A;  4N76 A;  1EP4 A;  4W5N A;  3HXM A;  4CF2 A;  3QEX A;  1B92 A;  3CYM A;  3P1G A;  3AVN A;  1ZYQ A;  1RCH A;  1UA1 A;  4HCB A;  4F8R A;  3MEC A;  1YVU A;  3HST B;  5T7B A;  2W42 A;  4HHT A;  4DFM A;  1IH7 A;  3V9S A;  5KI6 A;  3ALY A;  3ZSQ A;  4PA1 A;  1EX4 A;  4Y1C A;  1DLO A;  3KLI A;  4DMN A;  4R5P A;  3NE6 A;  4E7L A;  4CK1 A;  4J2A A;  4CFA A;  2PY5 A;  1X9S A;  1JLB A;  1S1U A;  1NOY A;  4BDY A;  3P5J A;  3WNF A;  1YTU A;  1RDC A;  3ZCM A;  2RKI A;  4BWM A;  3LP2 A;  1J5O A;  4OLB A;  4M45 A;  5HRO A;  3QET A;  4JS4 A;  2IAJ A;  4FLX A;  2KTQ A;  1Y97 A;  2Q3S A;  3SQ2 A;  4DSJ A;  2F8S A;  2XO7 A;  3VN5 A;  3TI0 A;  4B3O A;  3V81 A;  1U4B A;  4KI4 A;  2HNZ A;  2IDO A;  4RW9 A;  4RW8 A;  1VSK A;  4FLU A;  4M3U A;  3HJF A;  3T3F A;  4FJJ A;  1O1W A;  4FJ9 A;  2KQ2 A;  4BDZ A;  3OYF A;  2YKM A;  3LAM A;  1NK7 A;  2A1R A;  4CFB A;  4CIF A;  4N5S A;  3QEV A;  3KD1 E;  4CJF A;  3FFI A;  3OYA A;  3QEW A;  3MEG A;  4BE1 A;  3RMB A;  1BIU A;  4E1N A;  4DF8 A;  1S6Q A;  2HMI A;  4Z4E A;  4N47 A;  1REV A;  2YV0 X;  3G10 A;  4KFB A;  3VQP A;  2XY5 A;  4FZX C;  4M42 A;  3B6P A;  5D3G A;  3NF7 A;  2HHX A;  3OVN A;  4FK2 A;  4EZ6 A;  3HPO A;  4KB1 A;  3SQ0 A;  1HNV A;  1ZBI A;  4DQI A;  4C8N A;  5HP1 A;  1ZBL A;  2OA8 A;  5FRM A;  2BE2 A;  3I0R A;  4CF1 A;  4F3O A;  3F73 A;  4FZZ A;  4CF8 A;  1TL3 A;  3B6O A;  4DQR A;  4IG0 A;  1TAQ A;  4E7J A;  3HP6 A;  4CJ4 A;  1U47 A;  2QXF A;  1U49 A;  1WAF A;  4FJK A;  4I2P A;  4BWJ A;  4EP5 A;  2GBZ A;  1BIZ A;  4FJX A;  2IGI A;  4AHT A;  1SUQ A;  3VQ4 A;  1HQU A;  3KKS A;  3M8Q A;  1IG9 A;  4IBN A;  3CFO A;  4CHP A;  5KTQ A;  1XC9 A;  3PUF A;  4DTO A;  2ITG A;  3SUQ A;  2X74 A;  5SWM A;  1KVB A;  3K5M A;  3IG1 A;  4OKJ A;  2G8U A;  4CIE A;  4DU1 A;  3P83 D;  2ZQB A;  3QNO A;  1S9G A;  2HND A;  4DF4 A;  3KLF A;  2FBT A;  5E41 A;  4DTR A;  1Q9Y A;  4CJQ A;  3HPG A;  5C24 A;  4HUG A;  3RR8 A;  4FK4 A;  4IFY A;  3VQC A;  3PY8 A;  1JXB A;  1LWE A;  2AJQ A;  1B9F A;  4IG3 A;  4DTU A;  1LW0 A;  1XHZ A;  1X9W A;  3KTQ A;  4C8L A;  2WOM A;  3O4Q A;  3OYG A;  4EP4 A;  2HW3 A;  1BL3 A;  3LZI A;  1D9F A;  4FJL A;  3JSM A;  4FM1 A;  4C8O A;  1C1A A;  4CGG A;  4CGJ A;  1S1W A;  4OPJ A;  4I7F A;  3VA0 A;  4O0I A;  4LH5 A;  4KKO A;  3NGI A;  4IKF A;  3KK1 A;  3F9K A;  4CHZ A;  1BCM A;  3QLH A;  4GMJ B;  5KRS A;  3KLG A;  1JLC A;  2RF2 A;  3AVM A;  1T8E A;  1NK4 A;  1TAU A;  3K5N A;  3QIO A;  2B4J A;  3H08 A;  1TK8 A;  2DTU A;  3S9H A;  2A1S A;  3S3O A;  1Z25 A;  3IRX A;  4Y1D A;  4CHO A;  1XHX A;  4DU4 A;  4B9M A;  4I9Q A;  4KRF A;  1D5A A;  1F21 A;  1KVA A;  2EHG A;  1QSS A;  1JLG A;  1RT3 A;  3QNN A;  4CGH A;  3QEI A;  4CHQ A;  4DLG A;  4PUO A;  4CEB A;  4FM0 A;  1I3A A;  4J2D A;  4NCB A;  1BI4 B;  4FW1 A;  1S1V A;  1U04 A;  3TAG A;  1IO2 A;  3VQQ A;  3DI6 A;  4BDP A;  1JL2 A;  3HL8 A;  3SV3 A;  3DRP A;  1UOC A;  2E6L A;  4O4G A;  4GW6 A;  1RT4 A;  1NKE A;  4MFB A;  3TAQ A;  1CZ9 A;  1WAJ A;  2Z1G A;  3NCI A;  5FRN A;  4DG1 A;  1SKR A;  3VQ6 A;  4Q5V A;  2HHS A;  4QCL A;  2Z1H A;  3JYT A;  1GOB A;  4E7I A;  1D9D A;  2OZS A;  4Z4H A;  4CGI A;  1FKP A;  1WSF A;  2RPI A;  4ID5 A;  3T19 A;  3V1R A;  3SQ4 A;  1NJZ A;  4O55 A;  3AVF A;  4KB0 A;  1C1B A;  2DFF A;  3HPH A;  4DSF A;  3MED A;  2PYJ A;  3CM6 A;  4KTZ A;  4K8Z A;  3SJJ A;  4FJN A;  4Z4I A;  2OYQ A;  3LAN A;  3NDK A;  2D0B A;  3PX6 A;  1QSL A;  5SZT A;  3KK3 A;  4W5T A;  2XHB A;  3V9X A;  1S6P A;  1SL1 A;  2IOC A;  3IS9 A;  4EZ9 A;  3RWU A;  4AHS A;  3NAE A;  2G8K A;  1LW2 A;  4M3Z A;  3MXI A;  3ZT1 A;  1JL1 A;  4H4O A;  1RBS A;  2GUI A;  2YNF A;  1WSG A;  4E1M A;  4AHV A;  1JLE A;  3KLH A;  4ELT A;  3WNG A;  3RTV A;  2XY8 A;  4AHR A;  3SPZ A;  3TAF A;  3V1Q A;  2P5G A;  2OPS A;  4Z4C A;  3SNN A;  1SL0 A;  1DTQ A;  1J9A A;  4M3X A;  4DFJ A;  4AIL C;  3K59 A;  4ELV A;  1BQN A;  1TK5 A;  3BDP A;  4KV8 A;  3SUN A;  4FK0 A;  2Z1J A;  3V4I A;  4DS4 A;  1ASW A;  3VQD A;  1FXX A;  1KRP A;  4CE9 A;  2X6N A;  3SUP A;  1WSI A;  4NYF A;  4O5B A;  1WSH A;  3QER A;  2HHW A;  4B8A B;  1RNH A;  3AO5 A;  2I5J A;  1RTH A;  4FLW A;  1L5U A;  2Y1J A;  1ZBH A;  1VSL A;  1HQE A;  3ZT3 A;  3VQE A;  2WON A;  3L2R A;  1C0M A;  1S5J A;  1NK5 A;  4CJV A;  4E3S A;  3SCX A;  3VQ7 A;  3M8S A;  2YHB A;  3TAR A;  3C6T A;  4DTJ A;  4RG8 A;  1A5W A;  3LP1 A;  4I2Q A;  3ZSV A;  4B9S A;  4FYD A;  1J54 A;  3C6U A;  3NGZ A;  4DFK A;  1SKS A;  4PY5 A;  4OVL A;  5HRR A;  1EET A;  1LAW A;  3AA4 A;  4AHU A;  2PZS A;  3SUO A;  1GOA A;  2HHQ A;  3ULD A;  4CEC A;  3EY1 A;  3KIO A;  3U3G A;  4CJK A;  3OYJ A;  4HUE A;  1XI1 A;  1L3V A;  1TL1 A;  3ZT2 A;  3HT3 A;  1RDB A;  1EKE A;  3EZ5 A;  1QTM A;  2YNG A;  3CQ8 A;  4KO0 A;  1FK9 A;  1RBR A;  3HP9 A;  1HPZ A;  4DTM A;  4FJG A;  2D0C A;  3A2F A;  4KHQ A;  4DTX A;  1IKY A;  4TSX A;  5FDL A;  3KK2 A;  4IDK A;  3OYH A;  1RBU A;  2X6S A;  3VQB A;  3KJV A;  3MAQ A;  3QEP A;  1KLM A;  3OS0 A;  2QK9 A;  3RMC A;  4UQG A;  3LAL A;  4W5Q A;  4QOZ B;  1C0U A;  4LH4 A;  4ID1 A;  4CK3 A;  3C95 A;  3ZSZ A;  4CJS A;  4CEA A;  4MQ3 A;  4BE0 A;  5HRN A;  3QES A;  4AHC A;  3V9U A;  3HVR A;  1T03 A;  1SL2 A;  3ISN C;  1N5Y A;  4CJU A;  1RT1 A;  4I9L A;  3O4N A;  3ZSY A;  4ELU A;  1QE1 A;  1BQM A;  2RN2 A;  3HK2 A;  4W5O A;  3DMJ A;  1QHT A;  5CYM A;  1TK0 A;  4O0J A;  2Z1I A;  4CJT A;  2F8T A;  4CEE A;  2DY4 A;  4CGD A;  2XRI A;  4NCA A;  3RRG A;  5KGX A;  2ETJ A;  2GV9 A;  3AO4 A;  2IS3 A;  4G1Q A;  1X9M A;  2G8W A;  2VWJ A;  3OJS A;  4KI6 A;  3ITH A;  3OYC A;  1LV5 A;  1NK6 A;  4CIG A;  1RT7 A;  3AVH A;  3HVT A;  3C94 A;  2P51 A;  3MXM A;  4KHY A;  4KTQ A;  3OYL A;  2HNY A; 
#chains in the Genus database with same CATH topology
 5FPD A;  3DRS A;  2QTD A;  3WNH A;  2P9U B;  4ISE A;  4CF9 A;  3K2P A;  4RWT A;  4I6M B;  1SKW A;  1NGB A;  2HBL A;  4KH6 A;  5J2N A;  2KFZ A;  3M1F A;  5AQO A;  4ILH A;  3TR8 A;  4CHY A;  5HRP A;  5GAH P;  4H8K A;  4ZHR A;  4W5R A;  1NNE A;  3HBT A;  5BR8 K;  3UKR B;  2KHO A;  4KHW A;  4JI1 K;  1K73 O;  1RT5 A;  3TWH A;  3AA3 A;  4FJH A;  2YHY A;  3A8Y A;  2XY6 A;  4JI5 K;  5LJW A;  1VQ7 N;  5J2M A;  3AVI A;  4H5V A;  4OGE A;  1L3S A;  1KAX A;  2A3Z A;  4IJN A;  1RFQ A;  3VF4 A;  4FSV A;  4DR1 K;  1TKZ A;  2P9N A;  4CJE A;  4H0P A;  5FPM A;  4KHN A;  4FLV A;  3U6F A;  2BDP A;  2E6M A;  3SZ2 A;  3LM9 A;  4HTL A;  4JLH A;  5MLC Q;  1JLQ A;  3SLC A;  4M3R A;  5M1Q A;  4BRE A;  1RT2 A;  3PV8 A;  3O3H A;  2V7Y A;  2JLE A;  3L2W A;  1Q18 A;  4H0O A;  4E89 A;  3SI6 A;  4YOY A;  2O8D B;  2NUB A;  4HWI A;  4DV6 K;  3QIP A;  4GVE A;  1GOC A;  3K0S A;  3S3N A;  3F9M A;  4CGF A;  3AVL A;  5C42 A;  2VYP A;  4JNE A;  3GG4 A;  1FJG K;  1RDU A;  1RTJ A;  3O5B A;  4C8K A;  3CQY A;  3S41 A;  1TUU A;  3SAG A;  4DSE A;  4GV9 A;  5I42 A;  4JKG B;  3JXU A;  2P9K B;  4FXD A;  5AQK A;  5GIO A;  4DWI A;  3D2E A;  3AV9 A;  4CFD A;  2HF4 A;  4JKA A;  3VQ9 A;  3KZB A;  3UB5 A;  3DOL A;  2F96 A;  4DFP A;  4B3S K;  4FCY A;  4AQY K;  3CET A;  2B5J A;  5CZ2 A;  4FLZ A;  4CD3 A;  4WE1 A;  2FF6 A;  2P1J A;  4CJ5 A;  1YJ9 N;  3NH1 A;  4BQL A;  1CXQ A;  4X66 K;  3MK6 A;  2ZF5 O;  2V51 B;  5J2P A;  1G15 A;  1WSE A;  3K5O A;  4DTN A;  3IUC A;  3A5M C;  3VPZ A;  2WBN A;  1KFS A;  4RW7 A;  5JS2 A;  4DSL A;  5KRT A;  1FKO A;  2W6L A;  2Q36 A;  3G6E N;  3SYZ A;  3ENO A;  4NYN A;  2CGK A;  1RTD A;  3DM2 A;  3PO4 A;  3CJ1 A;  1GLL O;  2Q2R A;  1KTQ A;  3CFR A;  5F0X A;  1WSJ A;  5EOY A;  4FM2 A;  4CZM A;  5BPL A;  3THV A;  4DR3 K;  1NJW A;  1EXQ A;  2A6A A;  1VQN N;  1HKG A;  3RRH A;  4XH1 A;  5AQJ A;  4NXN K;  2QWQ A;  4CJ3 A;  3OY9 A;  1HNI A;  3CJ9 A;  4FOI A;  2OTJ N;  2VCP A;  4JD2 A;  4JI6 K;  1CZB A;  3CER A;  3ENH A;  1HNW K;  3OS2 A;  3LAK A;  1UA0 A;  1A5V A;  3NVM A;  4BRG A;  3I0S A;  1DKG D;  2P9N B;  3AA5 X;  2HVH A;  1OH7 A;  4H0X B;  4DSI A;  4B9V A;  1BHL A;  3V1O A;  4CJR A;  1C0G A;  3KVG A;  4OJR A;  3L2U A;  2YNH A;  4AH9 A;  3TAN A;  3BGR A;  3PSI A;  4LC9 B;  1M90 O;  2FBY A;  2D0O A;  3UIQ A;  2P5O A;  4LFC K;  3M3Z A;  4MO5 A;  3FZM A;  5FRO A;  2OAN A;  3M5R A;  3R9P A;  4WF9 L;  5HLF A;  3EO3 A;  3CC2 N;  1N32 K;  4M3T A;  2QWN A;  2ZGY A;  1BOT O;  3Q7C A;  1RT6 A;  1RBT A;  1S22 A;  1A5X A;  4DHY A;  1BGX T;  1LOT B;  4CJW A;  5C25 A;  1NLV A;  4CEF A;  3VA3 A;  1NGE A;  5ELZ A;  1KAY A;  4AM7 A;  4HCB A;  4QS9 A;  1NU0 A;  3MEC A;  4F8R A;  4DFM A;  3L4I A;  1IH7 A;  5KI6 A;  4JHD B;  5AQU A;  2ASM A;  4JKD A;  3SJH A;  4E7L A;  4CK1 A;  3C0B A;  2VGN A;  3P5J A;  1YTU A;  3D2E B;  3LP2 A;  4QS8 A;  4M45 A;  5HRO A;  1NBW A;  4FLX A;  1KC8 O;  1Y97 A;  3EKU A;  2Q3S A;  3SQ2 A;  3TI0 A;  3ENB A;  3TTD A;  1U4B A;  4B3O A;  3CCR N;  4M3U A;  4RW9 A;  3SBT A;  1XMQ K;  1NWK A;  4FJJ A;  5GAE P;  4CFB A;  4CIF A;  3CCV N;  3KD1 E;  3CJB A;  3RMB A;  4DF8 A;  4Z4E A;  2HMI A;  2F8T A;  1REV A;  3G10 A;  3O9U A;  4CZF A;  3B6P A;  3HPO A;  4KB1 A;  2Q31 A;  4DQI A;  3ATV A;  2OA8 A;  3PIO L;  4DQR A;  1V4T A;  4IG0 A;  1ILY A;  5GAD P;  2A5X A;  4PKG A;  4BVP A;  2O8E B;  4BWJ A;  4FJX A;  1SUQ A;  4GV6 A;  5HL7 L;  4DTO A;  4OO1 J;  3K9K A;  4CD1 A;  3IG1 A;  4OKJ A;  3QNO A;  1X3M A;  2HND A;  1RDW X;  4A61 A;  1D4X A;  3LDL A;  4FK4 A;  3K9J A;  1ZBS A;  1LW0 A;  4C8L A;  2WOM A;  3VEY A;  1VQ5 N;  2NRV A;  1D9F A;  4FJL A;  3FFK B;  4C8O A;  1GLC G;  1K8A O;  2UYT A;  3VEX A;  4I7F A;  5AQF A;  4O0I A;  4DR2 K;  4LH5 A;  4KKO A;  3NGI A;  3KK1 A;  2RF2 A;  3DJC A;  1NK4 A;  3K5N A;  3H08 A;  2VQE K;  1Z25 A;  3IRX A;  4B9M A;  5M1O A;  3ATU A;  1QSS A;  1BDG A;  5BRD A;  4FWQ A;  3QEI A;  4CHQ A;  4DLG A;  1DGK N;  4A57 A;  4CEB A;  5KPZ A;  4JK8 A;  1S1V A;  2WUS A;  3VQQ A;  5AQY A;  3MDQ A;  5TKW A;  3HL8 A;  4EHT A;  3SV3 A;  4GW6 A;  3I8B A;  1YVN A;  5FRN A;  2Z1H A;  1YIT N;  1GOB A;  2QWP A;  4CGI A;  1FKP A;  4ID5 A;  2DFF A;  2PYJ A;  3CM6 A;  4JK7 A;  4KTZ A;  3CPW M;  4FJN A;  3NDK A;  3PX6 A;  1QSL A;  4W5T A;  3CXC M;  4O8U A;  3L4Q A;  3RMC A;  1JL1 A;  2YNF A;  2GUI A;  4E1M A;  1WSG A;  3U4L A;  1JLE A;  3WNG A;  5AFU H;  3THX B;  2XY8 A;  3JS6 A;  3TAF A;  2E88 A;  2P5G A;  2P9L A;  2H3G X;  1DTQ A;  3K59 A;  4ELV A;  4JK9 A;  1TK5 A;  3BDP A;  4FK0 A;  3MWP A;  3VQD A;  4NYF A;  1WSH A;  2HHW A;  3B8A X;  4PL8 A;  4B8A B;  1L5U A;  1RTH A;  5DM6 L;  3O80 A;  1W7A A;  3VES A;  2WON A;  4BR5 A;  3SAF A;  3ZLJ A;  1JJ2 M;  4E3S A;  4A2A A;  3VQ7 A;  4C1N K;  3C6T A;  3ZSV A;  4IDH A;  3C6U A;  4PY5 A;  4OVL A;  1EET A;  2P9I A;  2NRR A;  2V52 B;  5AZI B;  4CEC A;  3QFU A;  1ESV A;  3OYJ A;  1L3V A;  1XI1 A;  3ZT2 A;  3EZ5 A;  1ZC6 A;  2PBD A;  4KHP K;  3U9D A;  4KHQ A;  3A2F A;  4DUZ K;  1IKY A;  2W6K A;  2GEM A;  3OYH A;  2X6S A;  3MAQ A;  3QEP A;  5AQV A;  2QK9 A;  5IT9 O;  4LH4 A;  1K9M O;  4MQ3 A;  4BE0 A;  5HRN A;  1SL2 A;  2O8F B;  3E66 A;  4CJU A;  2WFB A;  5AQN A;  2GWK A;  5CYM A;  1TK0 A;  2Z1I A;  3R6M A;  1KXP A;  3H3N O;  4CGD A;  4O5F A;  4CJ7 A;  2ETJ A;  4CW7 B;  2VWJ A;  3J7Y P;  4BRN A;  2JWK A;  5KQ8 A;  1N33 K;  3OYL A;  2UU9 K;  1GLA G;  4CZG A;  3SAH A;  4CZK A;  1NJI O;  4YNQ A;  5EXW A;  4CF0 A;  3N4Q A;  1J53 A;  3WNE A;  4E7H A;  1XWL A;  4KRE A;  4BC4 A;  2E8A A;  1QQN A;  1R59 O;  1G99 A;  2D5R A;  2P9U A;  5E26 A;  4CES A;  4I6M A;  3HM9 A;  3E01 A;  2VQF K;  1S1T A;  3FZH A;  4DCH A;  3K57 A;  2O8C A;  4F3T A;  4DQP A;  1BU6 O;  1U2V A;  3V9Z A;  4JKH A;  3RSE B;  2OPR A;  3DYA A;  3KLE A;  1BCO A;  1VSE A;  4NCG A;  1RBV A;  3QDK A;  2HOE A;  3VQ5 A;  4J8F A;  2ZE2 A;  3AAR A;  1JCE A;  3OYM A;  3LDP A;  4JS5 A;  1EQY A;  2VG5 A;  3C7N A;  3U3Y A;  4FWO A;  4F2S A;  3C6A A;  1YAG A;  2WC9 A;  3G25 A;  3TAB A;  4BC5 A;  2JGU A;  4LSN A;  4LSL A;  2X78 A;  3LL3 A;  1HPM A;  4K41 A;  3WXI A;  2QKB A;  4H4M A;  2P9I B;  1NK0 A;  5BRH A;  3IMX A;  1QVF M;  2OZM A;  1IKX A;  4K42 A;  1R0A A;  2VWB A;  4ICL A;  1WNS A;  4PL7 A;  3VEN A;  1HYS A;  2DFH A;  1LWC A;  4CZI A;  2F7T A;  3H6E A;  1KCF A;  1NOZ A;  3L8B A;  4YDU C;  3DLE A;  4ISF A;  4CFC A;  4DR4 K;  4DS5 A;  3LDQ A;  4FJ7 A;  4LF6 K;  3VQ8 A;  3OYN A;  4JKG A;  1B9D A;  1WLJ A;  2P9K A;  1VQ8 N;  2YKN A;  5HBM A;  3OYE A;  4ZTF A;  1LAV A;  2QXL A;  4NXM K;  1Q8I A;  3L2Q A;  4PQU A;  4QAG A;  2OPQ A;  2QI2 A;  3IAY A;  4FLY A;  5A2Q O;  4Y0W A;  2HST A;  3NHG A;  5J2Q A;  4BGA A;  2Q0U A;  1QQO A;  3DWL A;  2QKK A;  3H3O B;  4B9L A;  1VSJ A;  4FW2 A;  4KPY A;  4DV5 K;  4HUF A;  1HRH A;  4V19 S;  3WXM B;  3ZSX A;  2Y1I A;  3SBG A;  1RDA A;  4F2R A;  1EO1 A;  4Z4F A;  4RW6 A;  1IJJ A;  2XY7 A;  4K8X A;  1UWB A;  3DOK A;  2Q97 A;  1OH6 A;  1SV5 A;  2O8C B;  4BRH A;  4DB3 A;  3MX5 A;  1U2V B;  5JS1 A;  1U45 A;  4R79 A;  3TAE A;  3NF8 A;  3AVB A;  1D8Y A;  2UUB K;  4B3M K;  4IEI A;  1RIL A;  5F1X A;  1ZBF A;  1E3M A;  4HCC A;  4OKE A;  2HHT A;  2FBX A;  1JCG A;  1KVC A;  2G8F A;  2VG6 A;  1K6Y A;  3VTH A;  4N56 A;  2GEL A;  3K58 A;  3HM8 A;  1C0T A;  1YUW A;  3C7N B;  1VK0 A;  3L3U A;  4JKB A;  3CJA A;  4XEI A;  4DV2 K;  2NZT A;  2HBM A;  2IVO A;  4PWD A;  4J2B A;  4EHU A;  1W9H A;  3C6H A;  1I39 A;  4BAC A;  5BRE A;  2E1Y A;  4DTS A;  3NH0 A;  1L3U A;  4B9N A;  2VGM A;  2PYL A;  4H0T B;  2HHU A;  1V4S A;  4DQQ A;  3OJU A;  3LZJ A;  5DMR A;  1EP4 A;  3HXM A;  4EAH D;  4CF2 A;  1B92 A;  3CMA N;  2NRZ A;  3AVN A;  1ZYQ A;  3R1X A;  1RCH A;  1WUA A;  1OKJ A;  2W42 A;  4HHT A;  4IOC L;  4OPA A;  4OPH A;  1DLO A;  3KLI A;  3NE6 A;  3A0I X;  2P9P A;  5M1N A;  4CFA A;  5C2F A;  4J2A A;  2CH5 A;  2PY5 A;  1S1U A;  2QW9 A;  3H1Q A;  3ZCM A;  5B8H A;  1J5O A;  4JHD A;  1VQ9 N;  4OLB A;  4PHT X;  4JS4 A;  2KTQ A;  3SK3 A;  3NVK A;  4U7B A;  2F8S A;  4DSJ A;  4A62 A;  2F9W A;  2HNZ A;  2RHK A;  4FLU A;  4JI3 K;  1VSK A;  4KI4 A;  3HJF A;  4JN4 A;  2D1K A;  1O1W A;  4FJ9 A;  1NK7 A;  2A1R A;  2BH1 A;  3OYA A;  3MEG A;  4JKC A;  1BIU A;  4E1N A;  4WFA L;  4N47 A;  4KFB A;  4X64 K;  2XY5 A;  4M42 A;  1YHQ N;  2E2P A;  1Q82 O;  4FK2 A;  5GAG P;  4EZ6 A;  3OA9 A;  1HNV A;  3SQ0 A;  4OX9 K;  1ZBI A;  3ZX0 A;  1H1V A;  4WYB A;  5HP1 A;  4B1Y B;  3I0R A;  4F3O A;  4FZZ A;  4BRQ A;  3P38 A;  2F9T A;  1TL3 A;  3EL2 A;  3HP6 A;  4CJ4 A;  4IO9 L;  4E7J A;  2QXF A;  1WAF A;  4DKW A;  3FLC O;  3OBW A;  3CFO A;  4CHP A;  3QML A;  5C2D A;  2ITG A;  5SWM A;  3K5M A;  2O8E A;  2ZWH A;  1NMN A;  2I7P A;  3DAW A;  5AQI A;  4CJQ A;  4DR7 K;  1JCF A;  3PLA A;  5C24 A;  3A5L C;  2QWR A;  1B9F A;  1XHZ A;  4B1Z A;  3BY5 A;  3CHW A;  3OYG A;  2HW3 A;  1QQM A;  3TPQ A;  1C1A A;  5JVH L;  4FPB A;  4CZJ A;  5C15 A;  4DV3 K;  5AQP A;  4IZ9 A;  3F9K A;  4CHZ A;  1BCM A;  4GMJ B;  2HF3 A;  1T6C A;  3Q7B A;  3QIO A;  2DTU A;  4Y1D A;  2OTL N;  2EHG A;  3WEE B;  1JLG A;  3QFP A;  3QNN A;  4IOX A;  4CGH A;  3E1Y A;  3CPE A;  1I3A A;  5ADX H;  3OHR A;  2A40 A;  1JL2 A;  3DRP A;  1UOC A;  4O4G A;  2GWJ A;  4MFB A;  3TAQ A;  3NCI A;  2HHS A;  4DG1 A;  3IFR A;  3VQ6 A;  4Q5V A;  4QCL A;  3T7Z A;  1D9D A;  3BZC A;  4Z4H A;  4DQ8 A;  3V1R A;  3SQ4 A;  4B1W B;  1NJZ A;  4O55 A;  3AVF A;  3O9Q A;  4DSF A;  3MED A;  1GLD G;  3SJJ A;  4K8Z A;  2P9P B;  5GIP A;  2D0B A;  5SZT A;  1Y64 A;  3VEZ A;  1SL1 A;  2IOC A;  4EZ9 A;  4AHS A;  5EVZ A;  3D2F B;  4M3Z A;  4H4O A;  1RBS A;  4AHV A;  3RTV A;  3V1Q A;  4Z4C A;  3A5O C;  1SL0 A;  1J9A A;  4M3X A;  4AIL C;  3MWT A;  3QIC A;  5ADX A;  4B1U B;  3V4I A;  3KK7 A;  1FXX A;  4BVO A;  3THX A;  3SUP A;  2A42 A;  5LY3 A;  2I5J A;  4XH5 A;  4U67 L;  1ZBH A;  3L2R A;  5CHI A;  1SS6 A;  3CME N;  3VTI A;  4CJV A;  1NK5 A;  1IBK K;  3M8S A;  2ZM6 K;  1A5W A;  4RTF D;  1S3X A;  4I2Q A;  2YCH A;  3TSQ A;  4DFK A;  3SMP A;  1ATS A;  2UUA K;  3EEQ A;  2PZS A;  3T1H K;  5C0Y A;  2QWO A;  1GOA A;  2ASP A;  5BN9 A;  2UXC K;  4CJK A;  3J81 O;  2YNG A;  4LFB K;  4KO0 A;  1FK9 A;  2QEX N;  3HP9 A;  1HPZ A;  4FJG A;  2D0C A;  5AZI A;  4TSX A;  5FDL A;  3KK2 A;  3P39 A;  3KJV A;  3VQB A;  3BP8 A;  3QB0 A;  3QBX A;  4IFE A;  3DXK B;  4W5Q A;  1P90 A;  1C0U A;  2UXB K;  4CK3 A;  4CJS A;  4NB4 A;  2FLO A;  3HVR A;  3O4N A;  2E1Z A;  1YJN N;  4ELU A;  4BRC A;  2KLA A;  2P9S A;  3DMJ A;  1QHT A;  4O0J A;  4CEE A;  2DY4 A;  3MN9 A;  5AQZ A;  5KGX A;  2GV9 A;  3AO4 A;  2GUP A;  2O8F A;  4WQ4 A;  4Z94 A;  3O08 A;  1NK6 A;  3HVT A;  4AM6 A;  2P51 A;  2D0P A;  2HNY A;  1TUY A;  4O44 A;  2HB5 A;  1HYV A;  3T1A A;  4CEQ A;  2FSJ A;  4CJP A;  4WFB L;  1HUX A;  4B9T A;  3RVC A;  2IIR A;  1JKH A;  3FZK A;  4WQ5 C;  4YOV A;  4CBW A;  4YFU A;  3PX4 A;  4OLA A;  3NF6 A;  1MU2 A;  4LF8 K;  1CLQ A;  4YOU A;  1T05 A;  5EU7 A;  1ZBU A;  3O8M A;  4C8M A;  5AR0 A;  1X3N A;  3GL1 A;  4KHU A;  3U8X A;  2PAV A;  2GTD A;  2G8V A;  2BGG A;  1TV6 A;  2YHA A;  3CFP A;  4KAZ A;  3EYZ A;  3H1V X;  1VSH A;  3ZET A;  4B08 A;  1VQK N;  4CEZ A;  2HVI A;  1TVR A;  1KQS M;  3RSE A;  3KD5 E;  4M3Y A;  4N41 A;  2IVP A;  3SPY A;  5KQD A;  1IKW A;  2IC3 A;  3OYB A;  3O1B A;  3DLB A;  3VGL A;  3WXJ A;  4DLE A;  1QS4 A;  2O4G A;  5DK5 A;  3I8D A;  3PO5 A;  4YOR A;  4GV3 A;  1JLA A;  2Q1N A;  3AVA A;  4BC3 A;  3AO1 A;  1VSM A;  3MEE A;  2NNW A;  3AO3 A;  3N4P A;  5AZJ B;  3CIP A;  3VF2 A;  1HJR A;  4CI6 A;  3K5L A;  4FZY A;  3VQA A;  3QIN A;  5FPE A;  5DM7 L;  4IEE A;  3O1W A;  3VMF B;  3LP3 A;  4IXC A;  1NM1 A;  1NJY A;  4RW4 A;  3HSC A;  3WXL A;  1NKB A;  3M8R A;  4J2E A;  3LM2 A;  4JRP A;  4ZTJ A;  3EZW A;  2G8H A;  3G0Z A;  2ATQ A;  1S9E A;  5AFU A;  4BE2 A;  4AF1 A;  4E19 A;  5AQM A;  4LF4 K;  3U9Z A;  2CH6 A;  1W2B M;  1RTI A;  4A5B A;  4FVM A;  1VRT A;  1QVG M;  2P9S B;  4OGC A;  4O8K A;  1CXU A;  3CF5 L;  5AQS A;  5JLH A;  1OVY A;  4H5T A;  2QWM A;  3WT0 A;  1LWF A;  3SV4 A;  1ATR A;  3E9L A;  2O4I A;  2LSN A;  2KZZ A;  3G71 N;  2ZD1 A;  1DTT A;  3GOI A;  3JAM O;  4H0V B;  4ILJ A;  3D7E O;  4HTU A;  3P4I A;  3SQ1 A;  2FBV A;  1YT3 A;  3VGK A;  3AVC A;  3J8A A;  3NH2 A;  1ITG A;  2NRW A;  4LY7 A;  5CYQ A;  4DU3 A;  1VRU A;  2KFN A;  1IBM K;  1NGG A;  3DXM B;  3UKU B;  3QO9 A;  4OPK A;  5JVG L;  3L2V A;  4BY9 C;  4JI0 K;  3PX0 A;  1NJX A;  1O13 A;  5EY4 A;  3CCQ N;  2D0A A;  1NKC A;  4Q0B A;  1L3T A;  2ZJQ L;  4UY8 O;  3OS1 A;  3I55 N;  4CK2 A;  4GVM A;  1DEJ A;  1ASV A;  4JEP A;  3ZET B;  3L0Q A;  2VWK A;  3AAP A;  3OYD A;  3LWL A;  1VSI A;  3WQT A;  1MWK A;  4BR4 A;  3OYK A;  3O3G A;  4IOA L;  4DTP A;  3CJ7 A;  3RMA A;  2BTF A;  3QBW A;  5H1S Q;  4CED A;  4WCE L;  5HRS A;  1VQ6 N;  3CC4 N;  2HHV A;  1C6V A;  5BN8 A;  4BR7 A;  3MCA B;  1RDD A;  1BG3 A;  1YTA A;  1HX1 A;  1BI4 A;  2E4L A;  3DLH A;  2G8I A;  2CGL A;  1M1K O;  3DLG A;  5C12 A;  1N34 K;  2YNI A;  1QZ6 A;  1IG8 A;  3LWM A;  4ISG A;  2R7Y A;  4W5N A;  4A59 A;  2FSK A;  1UA1 A;  1YVU A;  3HST B;  1BWF O;  2JWL A;  4RCH A;  5M1K A;  3ALY A;  4DMN A;  1OH8 A;  1EX4 A;  4Y1C A;  1XQS C;  3R8E A;  4B1X B;  1X9S A;  1JLB A;  1NOY A;  2RKI A;  3R3L A;  2IAJ A;  3HOS A;  4MLH A;  3V81 A;  3IKM A;  2IDO A;  4BDZ A;  2O8B B;  2YKM A;  3LAM A;  3GBT A;  4N5S A;  2E2N A;  3QEV A;  3FFI A;  3QEW A;  4BE1 A;  2YV0 X;  4CZL A;  2HHX A;  3OVN A;  4C8N A;  4BQZ A;  1Q81 O;  3F73 A;  4CF8 A;  1KAZ A;  1TAQ A;  1U49 A;  4FJK A;  2GBZ A;  1XUP O;  4JI8 K;  3BF1 A;  3VQ4 A;  1HQU A;  3KKS A;  4MO4 A;  4IBN A;  5KTQ A;  2OCE A;  1XC9 A;  2HBJ A;  2X74 A;  4QS7 A;  5KPT A;  4L3Q A;  2G8U A;  5LJV A;  1S9G A;  2HBK A;  4DF4 A;  2FBT A;  5LMU K;  3HPG A;  3EE9 A;  1JXB A;  1LWE A;  2AJQ A;  3KTQ A;  1X9W A;  4BC2 A;  3AGR A;  4EP4 A;  4JI4 K;  3LZI A;  2ZJP L;  5HOO A;  3MCP A;  4CGG A;  1S1W A;  4OPJ A;  1N36 K;  3O6W A;  3VA0 A;  1NGI A;  1VQO N;  4IKF A;  3ULE A;  5KRS A;  3CCL N;  3E9O A;  3ZX3 A;  1TAU A;  2B4J A;  2ITM A;  2A1S A;  4I9Q A;  2J4R A;  3MN6 A;  4CHO A;  4WFN L;  1D5A A;  1F21 A;  4H5W A;  3F2K A;  4PUO A;  4FM0 A;  4J2D A;  1BI4 B;  1XNR K;  1IO2 A;  4MDB A;  3ID6 A;  4BDP A;  4BGB A;  2E20 A;  1YF5 L;  3WEE A;  3CCS N;  1NKE A;  5FLX O;  3OBY A;  2Z1G A;  1SKR A;  4E7I A;  1WSF A;  2RPI A;  3T19 A;  4KB0 A;  1C1B A;  3HPH A;  1KD1 O;  4Z4I A;  1MA9 B;  3LAN A;  4ILG B;  3V9X A;  1GLE G;  3IS9 A;  3RWU A;  4DV0 K;  3NAE A;  2G8K A;  3VF6 A;  3MXI A;  3O9S A;  3HRG A;  3KLH A;  4ELT A;  3E9P A;  4YHH K;  4CBU A;  2OPS A;  1HNZ K;  3SNN A;  3ZEU A;  3EKS A;  5FPN A;  4DFJ A;  3TTC A;  3NMU A;  3D2F A;  1X9J A;  2Z1J A;  1YJW N;  2QWL A;  2X6N A;  1WSI A;  2YJF A;  3AO5 A;  4BR9 A;  3ZT3 A;  1C0M A;  3ZX2 A;  4B9Q A;  3TU5 A;  4DTJ A;  4RG8 A;  3LP1 A;  1P8Z A;  3ID8 A;  4B9S A;  4FYD A;  3NGZ A;  1YXQ A;  5HRR A;  3AA4 A;  3UE5 A;  4AHU A;  3SUO A;  2HHQ A;  3CD6 N;  5EX5 A;  3EY1 A;  3U3G A;  5M1F A;  3L6Q A;  2NRT A;  1TL1 A;  2GX9 A;  5TKY A;  1RDB A;  1EKE A;  3IDH A;  5BRF A;  1BUP A;  1HR0 K;  1RBR A;  4FO0 A;  4DTM A;  5M1P A;  3J7A P;  4NO7 A;  4H5N A;  4IO8 A;  2BUP A;  2E2Q A;  1HNX K;  4UQG A;  3CCJ N;  4WQ4 C;  5AQX A;  4YDU A;  1NMD A;  3QES A;  4KH4 A;  4AHC A;  3V9U A;  1YIJ N;  1N5Y A;  1RT1 A;  1BQM A;  2RN2 A;  3HK2 A;  4W5O A;  3DXK A;  1TYQ B;  4GNI A;  4CJT A;  4FWR A;  4NCA A;  1NGC A;  1RGI A;  4JKF A;  3AAQ A;  3OJS A;  4A5A A;  1LV5 A;  4IWV A;  4CIG A;  1E4F T;  3MN7 A;  3AVH A;  3ULE B;  3MXM A;  4KHY A;  4KTQ A;  1KLN A;  1VSF A;  4XIU A;  4CER A;  1VQP N;  2FC0 A;  3FE1 A;  3KKR A;  4FWM A;  1IBL K;  2OPP A;  1OH5 A;  4XH4 A;  1LCU A;  4CJL A;  4LF7 K;  2KW4 A;  4GKK K;  1C1C A;  3FR0 A;  3AVJ A;  3PSF A;  4FJI A;  4CEO A;  2KKZ A;  3V6D A;  1EWQ A;  4IFV A;  1C0F A;  3VEV A;  4BRD A;  3THW A;  3ZYY X;  1IKV A;  2ZJR L;  3DLK A;  3EN9 A;  4BG8 A;  2QM1 A;  3GDQ A;  3ZSO A;  5AQL A;  3VET A;  5IWA K;  3O9R A;  4FWL A;  4BRL A;  4E0D A;  3ZT0 A;  1N8R O;  3ZSW A;  2V7Z A;  5E41 A;  3ZT4 A;  5KGW A;  4CZE A;  3V9W A;  5K14 A;  3LP0 A;  3FGU A;  1J6Z A;  5AQH A;  3HZ6 A;  3AGK A;  3CG7 A;  4B9U A;  3HYF A;  4PKH A;  4KTW A;  3ZEU B;  3D0P A;  1HMV A;  2PFU A;  3W3D A;  1TGO A;  5BR9 A;  1S1X A;  1ZXO A;  4B3R K;  2WTU A;  1X1P A;  5J1E A;  1KSP A;  4BRA A;  5CR4 A;  5AQT A;  3NGY A;  3CC7 N;  5KPR A;  1SAZ A;  1T7P A;  5AJ3 K;  4FJM A;  1JXE A;  4EFH A;  3AY9 A;  3NFA A;  1N6Q A;  3TAM A;  3HO1 A;  4OKK A;  2E5L K;  4DSK A;  5AZJ A;  4M3W A;  4H03 B;  4Z0U A;  4DQS A;  3P31 A;  4FJ5 A;  1VHX A;  3D45 A;  3LPU A;  3WQU A;  4CZH A;  1U48 A;  3M8P A;  4FJ8 A;  3NBP A;  2BAN A;  2YHX A;  3AA2 A;  3T1Y K;  3CCU N;  4JAX A;  1NGH A;  2NRH A;  4CHN A;  4CCH A;  1T44 A;  3LDS A;  4H0Y B;  3LPT A;  3A5N C;  4E7K A;  3VER A;  1QQC A;  3DRR A;  2VG7 A;  3EE8 A;  3O9T A;  5LL6 Z;  4BR0 A;  5BPN A;  3TAP A;  4B8C A;  3CCE N;  3AO2 A;  1BIS A;  4JV5 K;  5C10 A;  1I94 K;  3C65 A;  2EX3 A;  4FVU A;  3OYI A;  3KWG A;  1HYZ A;  2D4W A;  1Q9X A;  3J7Z O;  1NK8 A;  3S3M A;  4KHS A;  5CY4 A;  1NGA A;  3AVK A;  2YX6 A;  2A41 A;  4A2B A;  3G4S N;  3NF9 A;  3W0L A;  3SMS A;  3ASM A;  4FOE A;  4JD2 B;  1VQM N;  1XNQ K;  2UXD K;  4L8R B;  3HOT A;  5CZ1 A;  3RMD A;  1K8K A;  2EWS A;  4BRF A;  4HVJ A;  1HJO A;  3THW B;  4JRQ A;  4LD0 A;  5JLF A;  1NK9 A;  3OTO K;  3WXK A;  3DXM A;  3UKU A;  5I3U A;  3VEW A;  3ZSR A;  3H46 O;  4FLT A;  3L3V A;  3MXJ A;  4X65 K;  1TKT A;  3AVG A;  4Z4G A;  1JLF A;  4C1N I;  2W41 A;  5CE3 A;  5I9E B;  4K43 A;  3DLR A;  3CM5 A;  1Z26 A;  2DFE A;  1Z05 A;  4BG9 A;  4BRO A;  3DLL L;  4JYA K;  3O3F A;  4DR5 K;  1IV0 A;  3HTV A;  1WB9 A;  1UAX A;  4CBX A;  3MMV A;  2B6A A;  1W0H A;  5GIN A;  1TKD A;  2KZM A;  1KFD A;  4B3T K;  3RR7 A;  4FWN A;  1QSY A;  1WN7 A;  1ASU A;  1VSD A;  3VEO A;  4M41 A;  4F4K A;  1TKX A;  4N76 A;  4KH5 A;  3QEX A;  1BO5 O;  3CYM A;  2YJE A;  3P1G A;  1CZA N;  3CJC A;  2DPN A;  5T7B A;  4LFA K;  3V9S A;  3H45 C;  5E84 A;  3ZSQ A;  4PA1 A;  4R5P A;  1HKB A;  4H5R A;  2YI1 A;  3I56 N;  4FWS A;  4BDY A;  3BZK A;  3WNF A;  1RDC A;  5AQG A;  4BWM A;  2RE2 A;  3TTF A;  3QET A;  4DV1 K;  1T6D A;  2XO7 A;  3VN5 A;  4RW8 A;  1NGJ A;  3T3F A;  2FSN A;  2KQ2 A;  4NLB A;  3OYF A;  4EIA A;  3MX2 A;  3HI0 A;  4CJF A;  3I33 A;  1S6Q A;  4M7X A;  3VQP A;  5D3G A;  4FZX C;  4MDA A;  3NF7 A;  2UUC K;  4DR6 K;  1Q86 O;  2O8B A;  5JIC A;  1T3V A;  4DV4 K;  4KBO A;  1Q7Y O;  2FF3 B;  1ZBL A;  5FRM A;  4IJA A;  2BE2 A;  4CF1 A;  4G9Z A;  1Z6R A;  3B6O A;  3CI5 A;  3F5T A;  1U47 A;  3PIP L;  4LF5 K;  4I2P A;  4EP5 A;  4BRI A;  1BIZ A;  1E4G T;  2IGI A;  4AHT A;  3M8Q A;  1VQ4 N;  1IG9 A;  2W40 A;  3PUF A;  3SUQ A;  1NGF A;  1U6Z A;  3BEX A;  1K8K B;  3LDO A;  1KVB A;  4CIE A;  4DU1 A;  3P83 D;  2ZQB A;  1XMO K;  4BR2 A;  3THY A;  3KLF A;  4K0K K;  4E1J A;  4M7Y A;  4DTR A;  1Q9Y A;  1S72 N;  4F9O A;  4HUG A;  3RR8 A;  4IFY A;  3VQC A;  3PY8 A;  3FZF A;  1YI2 N;  4IG3 A;  4DTU A;  3O4Q A;  5AQQ A;  2FXU A;  3M6G A;  1BL3 A;  3KHY A;  3MN5 A;  3JSM A;  4FM1 A;  4CGJ A;  5AQR A;  3OW2 M;  1J5E K;  1OVQ A;  4BRK A;  3VOV A;  3QLH A;  1SZ2 A;  3D6R A;  4M63 C;  3KLG A;  4PKI A;  5F2R A;  1JLC A;  4FL9 A;  1T8E A;  3AVM A;  1WBD A;  3FZL A;  1TK8 A;  4B1V A;  3S9H A;  3S3O A;  4DU4 A;  1XHX A;  4KRF A;  1KVA A;  4DV7 K;  1RT3 A;  1HKC A;  4NCB A;  4MLE A;  4FW1 A;  4FWP A;  3TSU A;  1U04 A;  3TAG A;  4WQ5 A;  4K25 A;  3DI6 A;  3CCM N;  3BF3 A;  4GKJ K;  1WOQ A;  2E6L A;  1RT4 A;  1MWM A;  1QHA A;  4NLC A;  2CGJ A;  1BA0 A;  1CZ9 A;  1WAJ A;  4CVN E;  1SQK A;  3JYT A;  2OZS A;  3UKR A;  4DUY K;  2QA4 N;  2OYQ A;  1WBB A;  3KK3 A;  2I7N A;  2XHB A;  1S6P A;  2P9L B;  2Q0R A;  1LW2 A;  3ZT1 A;  4AHR A;  3SPZ A;  3LDN A;  2ASO A;  1BQN A;  4JI7 K;  4KV8 A;  3SUN A;  4DS4 A;  1ASW A;  1KRP A;  4CE9 A;  4O5B A;  3QER A;  4FLW A;  1RNH A;  1EWR A;  2Y1J A;  3KWI A;  1VSL A;  1HQE A;  3VQE A;  2E2O A;  4YOW A;  1S5J A;  2O8D A;  3SCX A;  3TAR A;  2YHB A;  3TSP A;  1NGD A;  1J54 A;  2ZGZ A;  4X62 K;  1NG9 A;  1FW6 A;  1SKS A;  1LAW A;  1BA1 A;  3ULD A;  2AA4 A;  3O4W A;  3KIO A;  4HUE A;  2IVN A;  3VGM A;  3HT3 A;  4LF9 K;  1QTM A;  2NLX A;  1GLJ O;  2AP1 A;  3CQ8 A;  3CQX A;  2HHH K;  1W97 L;  3GE1 A;  3J80 O;  5LMN K;  5JMV A;  4JI2 K;  4DTX A;  4IDK A;  1RBU A;  4BRP A;  1KLM A;  4FPA A;  3OS0 A;  4FWK A;  3THY B;  3LAL A;  4QOZ B;  2YHW A;  1GLB G;  4ID1 A;  1HLU A;  3C95 A;  3ZSZ A;  4CEA A;  1T03 A;  1VAZ A;  3ISN C;  3WUH A;  4I9L A;  3ZSY A;  1QE1 A;  5AQW A;  3T69 A;  1ATN A;  4YY3 K;  4JKE A;  2XRI A;  4GY2 B;  2F4V K;  3RRG A;  1XC3 A;  1GLF O;  2G8W A;  1X9M A;  1QZ5 A;  2IS3 A;  4G1Q A;  4YOT A;  5BPM A;  4KI6 A;  3ITH A;  3OYC A;  2HMP A;  1MDU B;  1RT7 A;  1VQL N;  1DT9 A;  3C94 A;  4BRM A;  4YOX A;  3BUZ B;  4C23 A;  1TYQ A;  2NRX A; 
#chains in the Genus database with same CATH homology
 4O44 A;  1KLN A;  1VSF A;  2HB5 A;  4XIU A;  3DRS A;  4CER A;  1HYV A;  3T1A A;  4CEQ A;  2FC0 A;  3WNH A;  4CJP A;  4CF9 A;  4YNQ A;  3K2P A;  3KKR A;  4CF0 A;  4B9T A;  1JKH A;  1J53 A;  2OPP A;  1SKW A;  4CJL A;  3WNE A;  2KW4 A;  4YFU A;  1XWL A;  4E7H A;  3PX4 A;  4OLA A;  1C1C A;  4KRE A;  5J2N A;  3NF6 A;  3AVJ A;  2KFZ A;  1MU2 A;  1CLQ A;  1T05 A;  5EU7 A;  2D5R A;  3TR8 A;  4CHY A;  4FJI A;  4CEO A;  4CES A;  3V6D A;  1ZBU A;  5HRP A;  4C8M A;  4H8K A;  4ZHR A;  4W5R A;  4IFV A;  3HM9 A;  3E01 A;  1S1T A;  3K57 A;  4KHU A;  4F3T A;  4DQP A;  1IKV A;  4KHW A;  3V9Z A;  3DLK A;  2G8V A;  1RT5 A;  2BGG A;  2OPR A;  3ZSO A;  4E0D A;  3TWH A;  3AA3 A;  4FJH A;  1TV6 A;  2YHA A;  3CFP A;  3ZT0 A;  2XY6 A;  4KAZ A;  3ZSW A;  5J2M A;  3DYA A;  3EYZ A;  3KLE A;  1BCO A;  1VSE A;  1VSH A;  3AVI A;  5KGW A;  4NCG A;  3ZT4 A;  4B08 A;  4OGE A;  1RBV A;  4CEZ A;  3V9W A;  1L3S A;  5K14 A;  2HVI A;  3LP0 A;  1TVR A;  3KD5 E;  3VQ5 A;  4M3Y A;  3CG7 A;  4B9U A;  4N41 A;  2ZE2 A;  3HYF A;  3SPY A;  1TKZ A;  4KTW A;  4CJE A;  1IKW A;  2IC3 A;  4KHN A;  3OYM A;  3OYB A;  1HMV A;  3D0P A;  4FLV A;  3U6F A;  2BDP A;  4JS5 A;  2E6M A;  3SZ2 A;  1TGO A;  3DLB A;  4JLH A;  2VG5 A;  1JLQ A;  4DLE A;  1S1X A;  1QS4 A;  2O4G A;  4M3R A;  3U3Y A;  1RT2 A;  3PV8 A;  1X1P A;  5DK5 A;  3O3H A;  3I8D A;  2JLE A;  5J1E A;  3PO5 A;  3L2W A;  4F2S A;  1JLA A;  1KSP A;  3TAB A;  3AVA A;  3AO1 A;  1VSM A;  2JGU A;  4E89 A;  3SI6 A;  4LSN A;  2NUB A;  3MEE A;  4LSL A;  3QIP A;  3NGY A;  2X78 A;  1GOC A;  3S3N A;  3AO3 A;  4CGF A;  1T7P A;  3AVL A;  4FJM A;  1JXE A;  2QKB A;  5C42 A;  1HJR A;  3K5L A;  4FZY A;  4H4M A;  3VQA A;  3NFA A;  3QIN A;  1NK0 A;  1N6Q A;  3TAM A;  3HO1 A;  4OKK A;  1RTJ A;  3LP3 A;  1IKX A;  2OZM A;  4DSK A;  1R0A A;  4C8K A;  1NJY A;  4ICL A;  1WNS A;  4RW4 A;  4M3W A;  1NKB A;  3M8R A;  4Z0U A;  4J2E A;  1HYS A;  4DQS A;  2G8I A;  2DFH A;  4FJ5 A;  4DSE A;  3D45 A;  3LPU A;  1LWC A;  4JRP A;  4ZTJ A;  1U48 A;  3M8P A;  5I42 A;  2G8H A;  1KCF A;  4FJ8 A;  1NOZ A;  3L8B A;  3G0Z A;  2ATQ A;  1S9E A;  3NBP A;  4FXD A;  2BAN A;  3DLE A;  4DWI A;  3AA2 A;  3AV9 A;  4CFD A;  4CFC A;  4BE2 A;  3VQ9 A;  4E19 A;  4CHN A;  4CCH A;  4DS5 A;  4FJ7 A;  3LDS A;  1RTI A;  3VQ8 A;  3OYN A;  1B9D A;  3DOL A;  1WLJ A;  4FVM A;  2F96 A;  1VRT A;  4DFP A;  2YKN A;  3LPT A;  5HBM A;  4FCY A;  4E7K A;  4OGC A;  3OYE A;  4ZTF A;  5CZ2 A;  1LAV A;  1QQC A;  2B5J A;  3DRR A;  1CXU A;  4FLZ A;  4WE1 A;  2VG7 A;  1Q8I A;  2P1J A;  4CJ5 A;  4QAG A;  3L2Q A;  4PQU A;  3NH1 A;  1CXQ A;  3TAP A;  2OPQ A;  4B8C A;  3IAY A;  5J2P A;  4FLY A;  1G15 A;  1WSE A;  3AO2 A;  3K5O A;  1BIS A;  4DTN A;  1LWF A;  3SV4 A;  2O4I A;  2KZZ A;  2LSN A;  3NHG A;  2EX3 A;  5J2Q A;  2ZD1 A;  1DTT A;  4RW7 A;  1KFS A;  3OYI A;  5JS2 A;  1HYZ A;  5KRT A;  1FKO A;  4DSL A;  1Q9X A;  1NK8 A;  4HTU A;  3SYZ A;  2QKK A;  4NYN A;  3S3M A;  3SQ1 A;  4B9L A;  4KHS A;  1VSJ A;  2FBV A;  4FW2 A;  1YT3 A;  5CY4 A;  4HUF A;  1HRH A;  3DM2 A;  1RTD A;  3PO4 A;  3AVK A;  3AVC A;  3ZSX A;  2Y1I A;  3NH2 A;  1ITG A;  1KTQ A;  4LY7 A;  3NF9 A;  1RDA A;  1VRU A;  5CYQ A;  3CFR A;  4DU3 A;  2KFN A;  4F2R A;  1WSJ A;  3ASM A;  4FM2 A;  4Z4F A;  4RW6 A;  3QO9 A;  3THV A;  1NJW A;  4OPK A;  1EXQ A;  1UWB A;  3DOK A;  3L2V A;  2XY7 A;  4K8X A;  4L8R B;  5CZ1 A;  3RMD A;  3RRH A;  3PX0 A;  4HVJ A;  1SV5 A;  4CJ3 A;  3OY9 A;  4JRQ A;  1HNI A;  1NJX A;  4KPY A;  4LD0 A;  1NK9 A;  5JS1 A;  1U45 A;  3TAE A;  2D0A A;  3NF8 A;  1NKC A;  4Q0B A;  1L3T A;  3AVB A;  3OS1 A;  4CK2 A;  1CZB A;  1D8Y A;  4GVM A;  5I3U A;  3OS2 A;  3ZSR A;  1ASV A;  3LAK A;  1UA0 A;  1A5V A;  4FLT A;  3L3V A;  1RIL A;  3MXJ A;  1ZBF A;  1TKT A;  3I0S A;  3AVG A;  4Z4G A;  1JLF A;  2VWK A;  4HCC A;  3OYD A;  3LWL A;  3AA5 X;  1VSI A;  3DLR A;  4OKE A;  2HVH A;  2HHT A;  2FBX A;  4B9V A;  4DSI A;  1BHL A;  3CM5 A;  1Z26 A;  2DFE A;  3V1O A;  4CJR A;  1KVC A;  3OYK A;  2G8F A;  4OJR A;  3O3G A;  2VG6 A;  1K6Y A;  2YNH A;  4AH9 A;  3L2U A;  3TAN A;  3BGR A;  4N56 A;  3O3F A;  2FBY A;  4DTP A;  3K58 A;  3UIQ A;  3RMA A;  2P5O A;  1C0T A;  4CED A;  1VK0 A;  1UAX A;  3L3U A;  5FRO A;  5HLF A;  5HRS A;  2B6A A;  1W0H A;  4M3T A;  2HHV A;  4PWD A;  1C6V A;  1TKD A;  4J2B A;  1W9H A;  2KZM A;  1KFD A;  1I39 A;  4BAC A;  1RT6 A;  1RBT A;  1RDD A;  1A5X A;  4DTS A;  1YTA A;  3NH0 A;  3RR7 A;  1L3U A;  1BGX T;  1BI4 A;  2E4L A;  4CJW A;  5C25 A;  3DLH A;  4B9N A;  1QSY A;  3DLG A;  2PYL A;  1WN7 A;  2HHU A;  1ASU A;  4CEF A;  2YNI A;  1VSD A;  3VA3 A;  4M41 A;  4DQQ A;  4F4K A;  3OJU A;  3LWM A;  3LZJ A;  2R7Y A;  1TKX A;  5DMR A;  4N76 A;  1EP4 A;  4W5N A;  3HXM A;  4CF2 A;  3QEX A;  1B92 A;  3CYM A;  3P1G A;  3AVN A;  1ZYQ A;  1RCH A;  1UA1 A;  4HCB A;  4F8R A;  3MEC A;  1YVU A;  3HST B;  5T7B A;  2W42 A;  4HHT A;  4DFM A;  1IH7 A;  3V9S A;  5KI6 A;  3ALY A;  3ZSQ A;  4PA1 A;  1EX4 A;  4Y1C A;  1DLO A;  3KLI A;  4DMN A;  4R5P A;  3NE6 A;  4E7L A;  4CK1 A;  4J2A A;  4CFA A;  2PY5 A;  1X9S A;  1JLB A;  1S1U A;  1NOY A;  4BDY A;  3P5J A;  3WNF A;  1YTU A;  1RDC A;  3ZCM A;  2RKI A;  4BWM A;  3LP2 A;  1J5O A;  4OLB A;  4M45 A;  5HRO A;  3QET A;  4JS4 A;  2IAJ A;  4FLX A;  2KTQ A;  1Y97 A;  2Q3S A;  3SQ2 A;  4DSJ A;  2F8S A;  2XO7 A;  3VN5 A;  3TI0 A;  4B3O A;  3V81 A;  1U4B A;  4KI4 A;  2HNZ A;  2IDO A;  4RW9 A;  4RW8 A;  1VSK A;  4FLU A;  4M3U A;  3HJF A;  3T3F A;  4FJJ A;  1O1W A;  4FJ9 A;  2KQ2 A;  4BDZ A;  3OYF A;  2YKM A;  3LAM A;  1NK7 A;  2A1R A;  4CFB A;  4CIF A;  4N5S A;  3QEV A;  3KD1 E;  4CJF A;  3FFI A;  3OYA A;  3QEW A;  3MEG A;  4BE1 A;  3RMB A;  1BIU A;  4E1N A;  4DF8 A;  1S6Q A;  2HMI A;  4Z4E A;  4N47 A;  1REV A;  2YV0 X;  3G10 A;  4KFB A;  3VQP A;  2XY5 A;  4FZX C;  4M42 A;  3B6P A;  5D3G A;  3NF7 A;  2HHX A;  3OVN A;  4FK2 A;  4EZ6 A;  3HPO A;  4KB1 A;  3SQ0 A;  1HNV A;  1ZBI A;  4DQI A;  4C8N A;  5HP1 A;  1ZBL A;  2OA8 A;  5FRM A;  2BE2 A;  3I0R A;  4CF1 A;  4F3O A;  3F73 A;  4FZZ A;  4CF8 A;  1TL3 A;  3B6O A;  4DQR A;  4IG0 A;  1TAQ A;  4E7J A;  3HP6 A;  4CJ4 A;  1U47 A;  2QXF A;  1U49 A;  1WAF A;  4FJK A;  4I2P A;  4BWJ A;  4EP5 A;  2GBZ A;  1BIZ A;  4FJX A;  2IGI A;  4AHT A;  1SUQ A;  3VQ4 A;  1HQU A;  3KKS A;  3M8Q A;  1IG9 A;  4IBN A;  3CFO A;  4CHP A;  5KTQ A;  1XC9 A;  3PUF A;  4DTO A;  2ITG A;  3SUQ A;  2X74 A;  5SWM A;  1KVB A;  3K5M A;  3IG1 A;  4OKJ A;  2G8U A;  4CIE A;  4DU1 A;  3P83 D;  2ZQB A;  3QNO A;  1S9G A;  2HND A;  4DF4 A;  3KLF A;  2FBT A;  5E41 A;  4DTR A;  1Q9Y A;  4CJQ A;  3HPG A;  5C24 A;  4HUG A;  3RR8 A;  4FK4 A;  4IFY A;  3VQC A;  3PY8 A;  1JXB A;  1LWE A;  2AJQ A;  1B9F A;  4IG3 A;  4DTU A;  1LW0 A;  1XHZ A;  1X9W A;  3KTQ A;  4C8L A;  2WOM A;  3O4Q A;  3OYG A;  4EP4 A;  2HW3 A;  1BL3 A;  3LZI A;  1D9F A;  4FJL A;  3JSM A;  4FM1 A;  4C8O A;  1C1A A;  4CGG A;  4CGJ A;  1S1W A;  4OPJ A;  4I7F A;  3VA0 A;  4O0I A;  4LH5 A;  4KKO A;  3NGI A;  4IKF A;  3KK1 A;  3F9K A;  4CHZ A;  1BCM A;  3QLH A;  4GMJ B;  5KRS A;  3KLG A;  1JLC A;  2RF2 A;  3AVM A;  1T8E A;  1NK4 A;  1TAU A;  3K5N A;  3QIO A;  2B4J A;  3H08 A;  1TK8 A;  2DTU A;  3S9H A;  2A1S A;  3S3O A;  1Z25 A;  3IRX A;  4Y1D A;  4CHO A;  1XHX A;  4DU4 A;  4B9M A;  4I9Q A;  4KRF A;  1D5A A;  1F21 A;  1KVA A;  2EHG A;  1QSS A;  1JLG A;  1RT3 A;  3QNN A;  4CGH A;  3QEI A;  4CHQ A;  4DLG A;  4PUO A;  4CEB A;  4FM0 A;  1I3A A;  4J2D A;  4NCB A;  1BI4 B;  4FW1 A;  1S1V A;  1U04 A;  3TAG A;  1IO2 A;  3VQQ A;  3DI6 A;  4BDP A;  1JL2 A;  3HL8 A;  3SV3 A;  3DRP A;  1UOC A;  2E6L A;  4O4G A;  4GW6 A;  1RT4 A;  1NKE A;  4MFB A;  3TAQ A;  1CZ9 A;  1WAJ A;  2Z1G A;  3NCI A;  5FRN A;  4DG1 A;  1SKR A;  3VQ6 A;  4Q5V A;  2HHS A;  4QCL A;  2Z1H A;  3JYT A;  1GOB A;  4E7I A;  1D9D A;  2OZS A;  4Z4H A;  4CGI A;  1FKP A;  1WSF A;  2RPI A;  4ID5 A;  3T19 A;  3V1R A;  3SQ4 A;  1NJZ A;  4O55 A;  3AVF A;  4KB0 A;  1C1B A;  2DFF A;  3HPH A;  4DSF A;  3MED A;  2PYJ A;  3CM6 A;  4KTZ A;  4K8Z A;  3SJJ A;  4FJN A;  4Z4I A;  2OYQ A;  3LAN A;  3NDK A;  2D0B A;  3PX6 A;  1QSL A;  5SZT A;  3KK3 A;  4W5T A;  2XHB A;  3V9X A;  1S6P A;  1SL1 A;  2IOC A;  3IS9 A;  4EZ9 A;  3RWU A;  4AHS A;  3NAE A;  2G8K A;  1LW2 A;  4M3Z A;  3MXI A;  3ZT1 A;  1JL1 A;  4H4O A;  1RBS A;  2GUI A;  2YNF A;  1WSG A;  4E1M A;  4AHV A;  1JLE A;  3KLH A;  4ELT A;  3WNG A;  3RTV A;  2XY8 A;  4AHR A;  3SPZ A;  3TAF A;  3V1Q A;  2P5G A;  2OPS A;  4Z4C A;  3SNN A;  1SL0 A;  1DTQ A;  1J9A A;  4M3X A;  4DFJ A;  4AIL C;  3K59 A;  4ELV A;  1BQN A;  1TK5 A;  3BDP A;  4KV8 A;  3SUN A;  4FK0 A;  2Z1J A;  3V4I A;  4DS4 A;  1ASW A;  3VQD A;  1FXX A;  1KRP A;  4CE9 A;  2X6N A;  3SUP A;  1WSI A;  4NYF A;  4O5B A;  1WSH A;  3QER A;  2HHW A;  4B8A B;  1RNH A;  3AO5 A;  2I5J A;  1RTH A;  4FLW A;  1L5U A;  2Y1J A;  1ZBH A;  1VSL A;  1HQE A;  3ZT3 A;  3VQE A;  2WON A;  3L2R A;  1C0M A;  1S5J A;  1NK5 A;  4CJV A;  4E3S A;  3SCX A;  3VQ7 A;  3M8S A;  2YHB A;  3TAR A;  3C6T A;  4DTJ A;  4RG8 A;  1A5W A;  3LP1 A;  4I2Q A;  3ZSV A;  4B9S A;  4FYD A;  1J54 A;  3C6U A;  3NGZ A;  4DFK A;  1SKS A;  4PY5 A;  4OVL A;  5HRR A;  1EET A;  1LAW A;  3AA4 A;  4AHU A;  2PZS A;  3SUO A;  1GOA A;  2HHQ A;  3ULD A;  4CEC A;  3EY1 A;  3KIO A;  3U3G A;  4CJK A;  3OYJ A;  4HUE A;  1XI1 A;  1L3V A;  1TL1 A;  3ZT2 A;  3HT3 A;  1RDB A;  1EKE A;  3EZ5 A;  1QTM A;  2YNG A;  3CQ8 A;  4KO0 A;  1FK9 A;  1RBR A;  3HP9 A;  1HPZ A;  4DTM A;  4FJG A;  2D0C A;  3A2F A;  4KHQ A;  4DTX A;  1IKY A;  4TSX A;  5FDL A;  3KK2 A;  4IDK A;  3OYH A;  1RBU A;  2X6S A;  3VQB A;  3KJV A;  3MAQ A;  3QEP A;  1KLM A;  3OS0 A;  2QK9 A;  3RMC A;  4UQG A;  3LAL A;  4W5Q A;  4QOZ B;  1C0U A;  4LH4 A;  4ID1 A;  4CK3 A;  3C95 A;  3ZSZ A;  4CJS A;  4CEA A;  4MQ3 A;  4BE0 A;  5HRN A;  3QES A;  4AHC A;  3V9U A;  3HVR A;  1T03 A;  1SL2 A;  3ISN C;  1N5Y A;  4CJU A;  1RT1 A;  4I9L A;  3O4N A;  3ZSY A;  4ELU A;  1QE1 A;  1BQM A;  2RN2 A;  3HK2 A;  4W5O A;  3DMJ A;  1QHT A;  5CYM A;  1TK0 A;  4O0J A;  2Z1I A;  4CJT A;  2F8T A;  4CEE A;  2DY4 A;  4CGD A;  2XRI A;  4NCA A;  3RRG A;  5KGX A;  2ETJ A;  2GV9 A;  3AO4 A;  2IS3 A;  4G1Q A;  1X9M A;  2G8W A;  2VWJ A;  3OJS A;  4KI6 A;  3ITH A;  3OYC A;  1LV5 A;  1NK6 A;  4CIG A;  1RT7 A;  3AVH A;  3HVT A;  3C94 A;  2P51 A;  3MXM A;  4KHY A;  4KTQ A;  3OYL A;  2HNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...