1RT7A

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
536
structure length
535
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 139
structure length 535
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt7A05
1A5VA 1JLEA 4DG1A 3LDSA 2IJNA 4EBCA 4I9LA 3HHKA 3UQSA 1RTIA 1J5OA 5KTQA 3NGIA 4CJTA 3OYDA 1HNIA 5KT5A 2EC0A 1BISA 2BGGA 4JUZA 3VQ7A 5FRNA 1TVRB 3SUNA 1I39A 2VG6A 3I0SA 4EP4A 1VSFA 4GVMA 1RTDA 1S9GA 3PHEA 3Q8SB 2OPPA 3V4IB 4FW1A 3D0PA 5C42A 4B3OB 3CM6A 5DG9A 5J2QB 3CFRA 1Z25A 4FS1A 3H5XA 4DLEA 1NNDA 4O3PA 4Q44A 4E0DA 2XGQA 4M3UA 4CJWA 4K50A 4EBDA 3QEXA 3CVKA 4HUGA 4H54A 4CEBA 1JL1A 2D41A 4O3QA 4DSJA 2X6SA 3EPGA 1T05B 4B9LA 4FVMA 3EZUA 2J6SA 4DQPA 1JKHB 1NOYA 3BQ2A 4KHQA 4JRQA 3KHLA 1VSDA 4F8RA 1TVRA 4NRTA 5DK5A 4ZTFA 4J9PA 5DG7A 3OHBA 2D0BA 1YVUA 1QSSA 4Z0UA 4B3OA 5D3GA 3CFPA 4C8KA 5J2QA 4KB1A 5DQIA 5DLGA 1LW0A 2A1SA 4WFZA 4IRDA 4CECA 3U6FA 5KFAA 4CE9A 1IKVB 4J9SA 4J2AA 4AH9A 4J2BA 2ASJA 2VA2A 1SL2A 3G6VA 3KLHB 3DOKB 3G6YA 3TANA 3OLAA 1N6QB 1SV5B 5J1EB 2XHBA 3P83D 4FJXA 4DL7A 4K8ZA 4O44B 1T05A 4WYWA 4FW2A 4CGJA 5KG0A 1JKHA 2V4QA 3HPOA 1D9FA 4Y1DA 4J9NA 4IRKA 3RBDA 4FLWA 4C8LA 4DTUA 4C8MA 1C0UB 1N5YA 1S1UB 5EWFA 1RCHA 4CJVA 2IOCA 1I3AA 1S10A 3NH2A 4H8KA 4RUAA 5KFXA 1D0EA 3RB3A 4WZQA 1B9DA 3TAFA 3MXMA 3DRSB 3HXMA 4M3WA 1IKVA 4MH8A 2W7OA 2AGQA 3AVFA 2P5OA 2FVRA 2R8JA 3KLHA 3DOKA 5T14A 1HQEB 5KGWA 5I3UB 5J1EA 3I0RB 4IH5A 4FK4A 3DRPB 3QGGA 4CJRA 4NLXA 4ZP8A 4LD0A 4IR1A 1YTUA 3EYZA 4O44A 2GV9A 1NKCA 4CJEA 3ITHA 1T94A 4ZVFA 3NE6A 4O3SA 1KFSA 3VA0A 1C0UA 3PJWA 3QEIA 3C6TA 1S1UA 3LP1B 4NLRA 1MU2B 5KFIA 3OYJA 2QKBA 4FBUA 1T7PA 4DEZA 4RG8A 4Y3CA 5F8GA 2XC9A 2W8LA 1UAXA 3VQPA 4IBNA 4KBIA 2W9AA 4FJ7A 3DRSA 4Q0BB 5E41A 1S9FA 3D5MA 3OS1A 4F4ZA 4M3YA 4NLTA 4MK9A 2AX0A 5HLFA 2C2EA 1HQEA 5JS1A 1KTQA 5I3UA 3FRZA 4U6PA 3CJ0A 3PW5A 2UVRA 3NF8A 4E1MA 3DRPA 2D0AA 3GV5B 1Z26A 1KLMB 4M3XA 3LANA 4NLSA 1RBRA 3FDSA 4IH6A 2YNHB 3KNAA 4EO8A 4ZP6A 2HB5A 3LZIA 4JRPA 3LP1A 1MU2A 3B6OA 1KCFA 3CJ3A 2R2SA 5J2MA 5L1KA 4KE5A 3B6PA 1O1WA 3L2VA 3AVKA 1QSLA 2OA8A 3NAIA 2HHSA 1JIHA 4W5QA 4GW6A 5HRSA 2Z1HA 4KB0A 4ZVEA 2HNYB 3A2FA 1XHZA 3H5UA 3ZSWA 4M3ZA 3SCXA 1RT4B 5KT2A 4K4UA 4RUCA 3CIZA 4YR0A 1KLMA 4QWCA 4PWDB 3NDKA 2R2TA 2YNHA 4B08A 4I2PB 1CSJA 1RDCA 1RT2B 5JS2A 3L2QA 4MFBA 2P5GA 4J9QA 3HL8A 4CIEA 5KRSA 3OYNA 3AVHA 3U3YA 4B9NA 3LWLA 5FRMA 3AVIA 3NGYA 2J6UA 1C1BB 4HUFA 1S4FA 1IKXB 1TAQA 2FVCA 2DPJA 4M95A 1D1UA 4DL3A 1EXQA 2HNYA 4CF8A 3D45A 3I5CA 1RBUA 1NJXA 3VN5A 2IC3A 2V0NA 2WHOA 4K4VA 3L8BA 4KSEB 3HT3A 3BREA 5KFEA 3AO2A 3TVKA 3RWUA 1S1VB 3IGVA 3SI8A 5L1LA 3CJ2A 3UDLA 3MFHA 5KFMA 1X9MA 2YKMB 4NLOA 5HRPA 4L8RB 3L2RA 1NK9A 4PWDA 4WFYA 4RU9A 5CZ2A 2FLNA 4MKAA 4I2PA 3OYMA 1RT2A 1NKBA 1HYZA 3AVGA 4OKEA 1YVFA 5KFCA 3M8PB 1N4LA 4B8AB 1GX6A 2HVIA 4FCYA 3ZT0A 1RT1B 1C1BA 3RB6A 2W42A 1IKXA 3AVAA 4R5PB 3CDUA 4F4XA 4CEDA 2WCXA 4DTPA 1TL1B 3M8QB 3GIKA 4E89A 4RZRA 2IA6A 5EWGA 4CHPA 1QAIA 1ZBFA 3ZT2A 4K4ZA 2ILYA 4K4TA 1SL0A 3K59A 1S1VA 1EP4B 4I2QB 1HYVA 3VQ5A 3K58A 2YKMA 4DF8A 4QWDA 1U4BA 3AA2A 4R8UB 3QO9B 3D28A 3NAEA 1J54A 2AQ4A 2WK4A 4HYKA 2Z1GA 4BE1A 5KG4A 1BIZA 3M8PA 2Z1IA 3AVLA 3WNHA 2DFHA 1JL2A 3TARA 1RT1A 3TI0A 3OYIA 1WSFA 3SYZA 3V9UA 4BDYA 2HHTA 4FJLA 4R5PA 1C0TB 4O55A 4MK7A 3RB4A 1TL1A 3M8QA 4FLUA 3OYAA 4LSLB 3NMAA 5DG8A 3MFIA 3G10A 3AA5X 1NK0A 4YR3A 4ECQA 2D3ZA 4EO6A 2ITGA 1TKZB 3PJXA 5DMRA 3RMAA 1TKXB 3UR0A 2GBZA 4RW7B 3OL6A 1EP4A 4I2QA 3CJ5A 1D5AA 1UA0A 1F21A 2ZQBA 4R8UA 3QO9A 1SH2A 5KFTA 3BSOA 4FLVA 2JEFA 2R8KA 4ID5A 1VSLA 3I8DA 3DOLB 1XR6A 3T3FA 4LQ9A 1RDDA 4IKAA 3K5NA 3DLEB 4FLZA 3Q8PB 2P1JA 4WXOA 1HRHA 5KFUA 2WRMA 2ASLA 3CQ8A 3NH1A 3JSMA 4URSA 1HQUB 3AO4A 1C0TA 1UOCA 2VG7B 1KFDA 4M3RA 4YP3A 3KOAA 1C1AA 1NOZA 4LSLA 2FBXA 3DLKB 3LAKA 1U09A 1ZETA 3OSPA 2AU0A 4CHOA 2HAIA 3NF9A 2XCPA 4XPEA 3KK1B 1TKZA 4ZVHA 1J9AA 1SKRA 2R7YA 1TKXA 1TKTB 4CJ5A 3AVBA 4RW7A 3QYYA 1JLEB 3F9KA 2DY4A 4MIAA 4CEAA 1JLBB 2DTUA 3OY9A 1U45A 4ED3A 4NLYA 1XR7A 3K2PA 1NK6A 4B9VA 4CEFA 4IOBA 3DOLA 4Y2CA 2DPIA 4J9RA 4J9OA 1XI1A 4EBEA 4CHNA 5J2PB 3CYMA 3DLEA 3IS9A 1JXEA 3O4QA 1X9WA 4G1QA 4H4MB 2OH2A 1ASVA 4XPCA 4Q5VA 4KHYA 2VG7A 3DLKA 1A5XA 4ECTA 1BQNB 3DM2B 2IBKA 4NLVA 5KG2A 3KK1A 4KAZA 3RTVA 2C28A 4F3TA 1TKTA 3OYCA 3HPGA 1TK0A 1QTMA 4JV2A 2XY8A 3ASMA 1JLBA 4YQWA 4NLPA 2UVUA 3NGDA 1L3TA 3NKYA 2HW3A 3OL9A 2HWIA 4ZPCA 4HCCA 1VSMA 1VRTA 5CYMB 5KFLA 2HHUA 3KKSA 4HCBA 1JLQB 3H2LA 5J2PA 3VA3A 2X74A 3IG1B 4LH4A 4H4MA 2BQUA 4CJUA 2Y1IA 3SUOA 2XY7A 3MEEB 4CJ3A 3HP6A 4CF9A 3GIIA 4DTMA 1S6QB 4RNNA 3H4DA 2YV0X 1U47A 5D3GB 1QQCA 1BQNA 1IO2A 2VWKA 3DM2A 2WONB 5KFSA 1LW0B 3QERA 1JLFA 1C1CB 4QAGA 3M9OB 5KFHA 4M42A 3RAQA 2KFNA 1KHWA 3PO5A 2D5RA 3TR8A 4CHZA 4BDZA 3KLFB 3KLIB 2RPIA 4CK1A 2A1RA 4CFCA 1XR5A 3T5KA 5CYMA 3T19A 1RT6B 4IRCA 2IAJB 1MMLA 4KTZA 4DWIA 1JLQA 1SKWA 3ZT1A 2VA3A 4DSLA 3IG1A 5KFQA 1C0MA 5KGXA 3QEVA 1N5YB 3DI6B 3MEEA 4IR9A 4B8CA 2FBTA 1WAFA 3MF5A 4O3RA 1S6QA 3PW4A 1S97A 3QEWA 3MR2A 4EZ6A 1RYRA 2JC0A 3MTKA 2WONA 1S6PB 1LAVA 3LWMA 3SQ1A 5KT6A 5KFGA 3AA3A 2QE5A 4TLRA 2X6NA 3F73A 1C1CA 2HNDB 3SPYA 1DTQB 4CGFA 2WTFA 5JUMA 4ICLB 3KLFA 4KHSA 3KMSA 3KLIA 3ULDA 3FFIB 2WB4A 5HBMB 4OPJA 4OLAA 4JS5A 3M8RA 4GC7A 1RT6A 4Z4CA 2IAJA 1QHTA 3ITHB 4RW4B 4OKKA 1W0HA 4PY5A 4TQRA 3FSIA 3BSAA 2BQRA 2DFFA 2JGUA 3NFAA 1QAJA 3LP3A 5F8MA 2JEJA 3C6TB 3DI6A 2KFZA 2ASDA 1VK0A 2FLLA 3V1RA 5KFYA 3SJJA 4DLGA 4WFXA 1SUQA 1S6PA 1ZTTA 4PQUB 4LY7A 5CZ1A 1ZYQA 4FJJA 4DFPA 3DLGB 2HNDA 1DTQA 2ZKUA 3C95A 4CF2A 3V6KA 3L2WA 1UA1A 3PO4A 4ICLA 5HLFB 4DTNA 4F50A 4WYLA 4DL6A 3NF7A 4YMEA 3FQLA 3TAMB 4LQ3A 4B9UA 3FFIA 3MAQA 5HBMA 4KB7A 1CZBA 3KLVA 4YFUA 3RR7A 2FJXA 3KTQA 1TK8A 1LV5A 4EYIB 4RW4A 4DL5A 2FBYA 4DMNA 4TQSA 2WOMB 4DQIA 4FJGA 1Y97A 4AILC 1RAJA 3L3UA 4KHWA 4ED2A 4EEYA 3NHGA 5DQHA 4BACA 5J2MB 4ED0A 4CGGA 3OYHA 1WAJA 3NL0A 4PQUA 4H4OB 3U3GA 3SQ4A 4AHTA 2ILZA 2D3UA 4O0JA 5F8NA 3DLGA 2PYLA 1QUVA 4DS5A 1BHLA 3OHAA 1BGXT 4FJ5A 1RDBA 3TAMA 4FXDA 3EY1A 3CWJA 3AO1A 3TAPA 2CKWA 4CGIA 3H5SA 2HNZB 2OZSA 5DQGA 3OYLA 4I9QA 4TSXA 4M45A 4ECSA 1ASUA 1NK5A 3VQBA 1NJYA 3V9SA 4KPYA 2WOMA 3O3FA 4F4KA 3QLHB 1BQMB 4MFBB 5SZTA 3OLBA 3C94A 1RNHA 3PX0A 3GV7B 4H4OA 3MR6A 3SNNA 1XHXA 1VRUB 4W5TA 3N6LA 3HYFA 3CDEA 4DTJA 1SH0A 2FVSA 2D0CA 2IC3B 1Q9YA 4ECWA 3VQ9A 4M3TA 4MK8A 2AJQA 4PUOB 1FK9B 2QK9A 2HHVA 5CY4A 2HNZA 4ED8A 3RRHA 3K5LA 3V9WA 4KKOB 2GUIA 4FJKA 4NLQA 3RMBA 5KT4A 1KLNA 2EX3A 1WNEA 4Y34A 1YTAA 1NK8A 3QLHA 1LAWA 2E9RX 1BQMA 1D8YA 5KG3A 2OPQB 4R0EA 3RMCA 1TAUA 5HROB 2C2RA 1RA6A 1WSHA 5KFRA 1VRUA 1K1SA 5KT3A 1XC9A 2RN2A 5KFPA 4FLTA 4MKBA 3G86A 4TYAA 2ETJA 3V6DA 2ZE2B 3SFUA 3OS2A 4CJPA 2I1RA 4KHUA 2HVHA 4PUOA 1FK9A 2ZD1B 3DDKA 5FROA 3E01B 3AV9A 3KJVB 2HHWA 3SFGA 4KKOA 3MR3A 1NJWA 4OPKA 3OYGA 1BIUA 2F8TA 5F8IA 2UVWA 3RMDA 3BSCA 3VQ8A 3N6MA 4FLYA 3G6XA 2OPQA 3BR9A 4E7LA 4KO0B 5HROA 3RRGA 3P5JA 3AVMA 4IFYB 2XRIA 3PUFA 2E6LA 2RDJA 4I7FB 3THVA 1KRPA 5KG5A 4E7IA 4AHCA 3DYAB 1N56A 2F8SA 3IGNA 4K4SA 3M9NB 3ZSRA 1BI4B 3SPZA 2RDIA 3OL8A 3P1GA 1VSKA 4Q43A 2ZE2A 2XWYA 4ZHRB 4O4RA 2IS3A 3N6NA 3TAQA 3KK2B 2ZD1A 2BRLA 3CO9A 3PZPA 2R2UA 2I5JB 4FM1A 3VQCA 2PY5A 3E01A 3KJVA 1LWFB 3DMJB 4KFBB 3AVCA 2C2DA 3S3MA 1IM4A 1X9SA 3C6UB 2BR0A 1TV6B 3H40A 1U48A 5L1JA 4ID5B 3T5LA 4ID1A 3BGRB 4WE1B 3MEDB 3NBPA 3OL7A 4ECXA 4KO0A 5KFZA 4YR2A 3LP0B 2BQ3A 4ECUA 3H98A 3JSMB 3HVWA 4IFYA 2J6TA 4TY8B 3KHGA 1EKEA 4CJ4A 4N76A 5K14B 4I7FA 4DSIA 2BE2B 1NK7A 3LPUA 3EZ5A 3DYAA 3KMQA 2G8IA 1BI4A 1S1WB 4FM0A 4DQQA 4ZHRA 4FM2A 1W9HA 4O0IA 2ATLA 1FKPB 1R0AB 3KK2A 1YT3A 4KHNA 3QZ8A 1B9FA 1QS4A 1VSHA 2I5JA 3H5YA 1LWFA 3DMJA 4KFBA 1K1QA 1OS5A 4FS2A 4EYHB 3C6UA 1TV6A 3HK2A 5F8JA 2C22A 3BGRA 1TK5A 2IM2A 2G8KA 4CEQA 4K8XA 3SV3A 4WE1A 3MEDA 5KFKA 3G0ZA 1L3SA 2F8EX 4IKFA 3IS9B 3LP0A 4G1QB 4ZPDA 2QV6A 3BDPA 4TY8A 4DSKA 4OGCA 4E19A 5K14A 4ED7A 2BE2A 3AA4A 1QSYA 5HRRA 1JLCB 1NHVA 4ZPAA 1S1WA 4URQU 2HMIB 1RBTA 4QOZB 2G8HA 4QWBA 1SKSA 2KQ2A 1FKPA 4BDPA 1R0AA 3V1QA 2UVVA 4EP5A 4CCHA 4OJRA 4JLHA 3AO3A 4FBTA 4CEOA 1GOAA 2IM0A 2ALZA 2B5JA 1NK4A 2Z1JA 3HM9A 4FK0A 4AHRA 4F2RA 1GOBA 4Z4GA 3ALYA 4DQRA 3CDWA 1VRTB 2Q3SA 4PA1A 4NCAA 4F2SA 1CLQA 4CEZA 1RT3B 4E7KA 3LPTA 4DSEA 4FZZA 3KIOA 4E7JA 4CJLA 3DRRB 2Y1JA 2XY6A 3K5OA 1TL3B 3HVAA 4Y1CA 4CK3A 1JLCA 3NGZA 1W25A 4RNFA 4HVJA 4C8OA 2W9CB 4DTRA 1SL1A 2HMIA 1S5JA 3RR8A 4C8NA 4NCGB 3RBEA 1JLFB 3KD1E 4N47A 1S48A 2YKNB 4CJFA 3V81B 3MECB 4CERA 4CGDA 4CIFA 4ELUA 3HPHA 1WLJA 3QETA 2NUBA 4BWJA 5KRTA 3SUPA 4QPXA 2X78A 2R8HA 4CGHA 2AX1A 2XGPA 3OS0A 1JLAB 4IG0A 4RNOA 3QGIA 3NAHA 1RBSA 1RT3A 4LH5A 3QIDA 4GC6A 1REVB 3HJFA 4BE2A 4ZTJA 1LWEB 1RILA 3BJYA 4CJQA 3DRRA 1TL3A 3M8SA 4FLXA 4IDKB 3OSNA 4K4XA 1L5UA 3OJUA 2W9CA 3BQ1A 1S0NA 3VQ6A 3DLRA 4NCGA 5KFWA 3OYBA 1QE1B 3QIPB 4FZYA 2O4GA 4CF1A 4KV8B 2YKNA 4N56A 3V81A 2BRKA 1IKWB 3RB0A 2YNFB 3MECA 1S0MA 2GIRA 4ZP7A 4WXWA 4BE0A 3MXIA 1S49A 2V9WA 4W5OA 4TN2A 1U49A 3CG7A 1JLAA 1RYSA 3TAEA 3VQDA 2W8KA 1EETB 5KG6A 3VQQA 1KVAA 2RF2B 3LAMA 4J2EA 4Q45A 4OGEA 3RAXA 1REVA 1HYSB 3T5JA 2XO7A 3O4NA 1LWEA 2V4RA 1KVBA 1U04A 3KLGB 4IDKA 3AVNA 1RA7A 3VQEA 3LZJA 4FJMA 3O3GA 4KI6A 3KK3B 2B4JA 1SUQB 1BCMA 4OLBA 3DLBA 3CM5A 4B9MA 4TXSA 4W5NA 1QE1A 4NZ0A 3QIPA 3V6HA 3GILA 4KV8A 3ICLA 4NLGA 1IKWA 2YNFA 2IDOA 3V4IA 1JXLA 4K4WA 1WNSA 4MQ3A 2VWJA 3KKRA 3FQKA 1Z4UA 1ZBHA 4KHMA 3L2UA 2DFEA 1NKEA 4QWAA 4IH7A 1EETA 3ZSQA 1DTTB 3NH0A 4DL2A 1WSJA 2RF2A 4O3OA 3PX6A 1RTHB 4RW8B 4ED6A 2GIQA 1HYSA 4XO0A 4DF4A 1RDRA 3LP2B 3PR5B 3KHHA 2XI3A 3KLGA 3KK3A 3SV4A 4IQXA 1WSGA 2B6AB 2IM3A 3V9ZA 5CYQB 4DFMA 1ITGA 4NLDA 5DGAA 1LW2B 1RBVA 4UQGA 5L1IA 2LSNA 1CXQA 5EWEA 1FXXA 4AHVA 2AWZA 3IN5A 1JLGB 4NYZA 1DTTA 4EZ9A 3TWHA 1RTHA 4NYNA 1TKDA 4TY9A 4RW8A 4NYFA 4FJ8A 4GMJB 1N6QA 1SV5A 4NRUA 4J9MA 4RNHA 3LP2A 1WSEA 3HSTB 3ZT3A 5EU7A 3GIJA 1CXUA 4KAIA 1LWCB 3AO5A 2G8WA 4RW9B 1CZ9A 3QIOA 4Z4FA 2B6AA 1FKOA 2OYQA 1A5WA 2KTQA 1DLOB 1SH3A 4HUEA 5EUHA 5CYQA 4AHSA 1IKYB 1WSIA 5KG1A 4E7HA 2KW4A 1HMVB 1S1XB 1LW2A 3K57A 5F9LA 4HTUA 4U7CA 2XY5A 3HVTB 1G15A 2IJFA 3VQ4A 4IG3B 2FVQA 1T3NA 3MEGB 2UUWA 4ZP9A 3H4BA 5DLFA 1JLGA 4OL8A 4W5RA 3PR4A 4HHTA 4DTOA 4CHQA 3QESA 3T1AA 3KLEB 1JX4A 4CIGA 1KHVA 4KTQA 2E9TA 2HHXA 1BL3A 4E3SA 3OYKA 4NCBA 4DU4A 3I0RA 1Q9XA 3CJ4A 1J53A 1S0OA 3T5HA 5KI6A 1LWCA 4RW6B 3GYNA 4RW9A 4Z4IA 2YNIB 2RKIB 4HKQA 3E51A 2KZZA 1DLOA 1HJRA 3TQ1A 4CJKA 1C6VA 4XIUA 1IKYA 3V6DB 1HMVA 1S1XA 3QNOA 1HPZB 4CHYA 4O3NA 3KD5E 1ZTWA 5HRNA 4ZPBA 1ASWA 2IM1A 3HVTA 4ECYA 4ELVA 4DU1A 4FJHA 4IG3A 3SI6A 4JV1A 3MEGA 4Q0BA 1ZBIA 3UIQA 2KZMA 4E1NA 5C25B 2B43A 2G8UA 4CFDA 5F8LA 3KLEA 1TGOA 4F4WA 4WZMA 1UWBB 3ZSYA 4CFBA 5JXSA 3IAYA 2QXFA 4F4YA 3WNEA 1D9DA 2PZSA 4N5SA 3UPFA 3ISND 4Q8EA 2E6MA 3I5AA 2W9BB 4RW6A 1JXBA 4YNQA 3Q8RB 2YNIA 2RKIA 1RT7B 1S1TB 4CEEA 5KG7A 4IFVB 1N48A 2AGOA 5F9NA 3OYEA 1IG9A 5KFJA 4ECZA 2CJQA 3SQ2A 4B9TA 1HPZA 3TAGA 2IMWP 2XI2A 3IRXB 2YHBA 4NLUA 4CK2A 4NLWA 1WN7A 4ELTA 5KFDA 2O5DA 5C25A 5I42B 1XWLA 4J2DA 4FZXC 4KTWA 5C5JA 4DFKA 2W7PA 1UWBA 4F3OA 3QGHA 3NCIA 5KFFA 1RT4A 2JEIA 4N41A 5DGBA 3HKWA 3ZCMA 4O5BA 3NBPB 4KRFA 1X1PA 2YHAA 1TP7A 3TABA 2W9BA 3LALA 1RT7A 5HP1B 4G3IA 1S1TA 2JEGA 3EPIA 1IH7A 4IFVA 4QCLA 1L3VA 3OYFA 2P51A 2HHQA 4Q8FA 3S9HA 3IRXA 1L3UA 5KFVA 3CFOA 1RTJB 5I42A 3ZT4A 2IGIA 2XCAA 4ECRA 5KT7A 1K6YA 1HNVB 2R2RA 3ZSVA 2UUTA 4AHUA 1B92A 4RNMA 2OPSB 4CJSA 4Z4EA 3NF6A 4Y2AA 2FJVA 3BQ0A 2G8VA 4QWEA 4OKJA 4OVLA 2JC1A 1BCOA 3WNGA 4ZVGA 4CFAA 5FDLB 2FBVA 4QW9A 4BWMA 2VG5B 1HARA 1S9EB 2G8FA 5HP1A 4ED1A 3MXJA 3WNFA 3PV8A 3S3NA 3GV8B 3VQAA 1I6JA 4URGA 4CF0A 3GQCA 3K5MA 3Q8QB 3DLHA 2D7SA 4FJ9A 4J9LA 4TYBA 4FYDA 2BANB 1RTJA 4ZMMA 2B5JB 2AGPA 4M94A 2O4IA 2R8GA 1GX5A 1HNVA 1Q8IA 4M41A 1RT5B 5F8HA 2OPSA 3MR5A 3SQ0A 4MIBA 1VSEA 2F96A 3GIMA 4O4GB 5KFOA 3ZSZA 4DSFA 2E9ZA 1T8EA 1VSJA 4X2BA 5FDLA 2ATQA 2VG5A 1S9EA 4DTSA 2YNGB 3HVRA 3HP9A 2OPRB 3V1OA 4CESA 5L9XA 2EHGA 2FVPA 3PY8A 5KFBA 4DFJA 3M9MB 3KHRA 4FJIA 4LSNB 3SUQA 4JS4A 5J2NB 3PX4A 3JYTB 3PVXA 4JV0A 2BANA 2OZMA 2E4LA 3OJSA 3ZSOA 1GOCA 3BSNA 3PW0A 5C24B 3AVJA 3H08A 4J9KA 3I5BA 1RT5A 3PW2A 2QKKA 1T03B 1NJZA 2HWHA 4Z4HA 3V6JA 4FK2A 4O4GA 4IG0B 3QZ7A 1RDAA 1FKOB 3HO1A 3VQSA 4ECVA 4KHRA 1ZBUA 3S3OA 1NHUA 2YNGA 4DG1B 3PW7A 2BDPA 4K4YA 4KREA 1RTIB 3OVNA 1J5OB 4QW8A 2FJWA 1ZBLA 2OPRA 2FLPA 4DS4A 3SZ2A 1HNIB 1TQLA 3ZSXA 4B9SA 3QINA 4LSNA 1KSPA 5J2NA 3L3VA 4DU3A 2GC8A 1C2PA 3JYTA 2VG6B 3QNNA 2PYJA 5EDWA 3I0SB 1RTDB 1HQUA 1S9GB 1VSIA 3ISNC 2OPPB 2R8IA 5C24A 1EX4A 4DQSA 5C42B 3V9XA 5KFNA 4DTXA 3H59A 1T03A 5SWMA 5T7BA 4FJNA 4KI4A 1KVCA 4DL4A 3QEPA 2JLEA 3O3HA 2FC0A
chains in the Genus database with same CATH superfamily
1JLEA 5ETQA 4DG1A 3LDSA 4DUYK 4I9LA 1RTIA 5IFMA 1SQFA 1OY8A 1NM2A 5LSRA 5A0YB 1YI2N 4B3SK 1Q86T 5D4LA 1U1MA 1CQNA 5KT5A 1BISA 4UT4A 3W5XA 4JUZA 2HRTA 1T44A 3A8YA 3CC2N 1RP5A 4ES3A 2PFUA 1XTZA 2KXFA 5THWA 4YDUC 3V4IB 3TZXA 5C42A 1GLLO 1WJ9A 2H65B 3R27A 2N7YA 4D3GA 3H5XA 1EJ7L 3E9PA 4Q44A 2O8FA 4PKDB 5HL7Q 3H6EA 1PILA 3VF0B 1HBUA 3AAQA 1W2IA 2X1AA 3QEXA 3CVKA 3VVUA 3MMVA 4Q2MA 2D41A 5A0YA 4O3QA 4CRJA 2X6SA 4A62A 1RAAB 1JKHB 1F2GA 2PMHA 4AT1B 4JRQA 1VSDA 3RJMB 4NRTA 5DK5A 2DGVA 4DR1K 4J9PA 3K89A 1GMVA 5DG7A 3OHBA 1H1VA 3VOVA 5D3GA 4C8KA 2IBOA 3ZZ0A 3UDCA 2DD8S 1LW0A 2A1SA 4CECA 2DH7A 4CE9A 4AH9A 4J2BA 2ASJA 2MQNA 3WZ0A 3D3CJ 4BLGA 3CIMA 3G6YA 1ROFA 4IWVA 5BR8K 1YK9A 3DWLA 4DL7A 1LCUA 3HHDA 4FW2A 3MAHA 1QAXA 3A13A 1JKHA 2XM3A 1FF2A 4Y1DA 3TZWA 1VBXA 4FLWA 4DTUA 3QB0A 2FJAB 1S57A 1RCHA 1CZAN 3OPKA 4AQYF 4H8KA 2RAQA 1N33J 4WZQA 3QWPA 2XMAA 3C46A 3WQTA 2W7OA 4UQTA 3QBXA 3UDEA 3N4PA 2PEHA 2EWHA 2YBVA 5T14A 1FI4A 3ILIA 2H4YB 3I56N 3NOCA 3I0RB 4FK4A 3DRPB 3BH6B 5F1XA 3OTBA 4IR1A 2BKPA 3DNCA 3EYZA 4CJEA 1KNZA 4ZVFA 2PEBA 2OSQA 3GR0A 4O3SA 1HI0P 3W2VA 4NB4A 4PG6A 2V51B 4LF6J 1VQ5S 2QL7B 3J7AP 1N8RT 1FXDA 4DUTA 3M1VB 4BRIA 4IBNA 2Z58B 4KBIA 2HHHF 2GUPA 2R42A 4DV5F 4JKHA 4ZLPA 1AYEA 3OS1A 2DIVA 4M3YA 3H8YA 2NUHA 4LBPA 3UE2A 3PRVA 2C2EA 3DN9A 4RLEA 4ZOSA 1KTQA 1VBKA 3PW5A 3I82A 1P9YA 3DRPA 2H4WB 1KLMB 3MDQA 3LANA 2XLKA 3QRRA 4IH6A 4CW7B 1K47A 3FGUA 3ZTQA 2KLAA 3BYPA 3GPAA 4B1WB 2R2SA 1FJGF 2Y3YA 1X9JA 3M1VA 1YTYA 1CC7A 4KE5A 3B6PA 1WG1A 1O1WA 3L2VA 2X3GA 2IYGA 1QSLA 2OA8A 2ADBA 4BRCA 3CJCA 2KVQE 4GW6A 4IO1A 3A2FA 3A5OC 2HLTA 3M6VA 2FHMA 2VD3A 2AT1B 4K4UA 4RUCA 1KLMA 4O5FA 5F2RA 3MD1A 4FPIA 4DR3J 3NDKA 5LMNF 4B08A 1FRHA 1OH6A 2J5AA 1WORA 2P5GA 1F5AA 1D8ZA 4B3RJ 2RNEA 2J6UA 3ZTPA 1IKXB 1TAQA 5F3ZA 2JOQA 1B3TA 1D1UA 1RWXB 3FEZA 5GAGI 1PJ6A 3NY0A 4XH1A 3J81Y 4CF8A 3T69A 4CO0A 1RBUA 2IC3A 2V0NA 2WHOA 4JI1F 1UP1A 4OJ1A 3TVKA 2UUAK 4USWA 3T1HF 3PLAA 5L1LA 1S77D 1OQ6A 3UDLA 3MFHA 3DOMB 5KFMA 2YKMB 5KPZA 4NLOA 3D6RA 4L8RB 3MN6A 4C8ZA 4RU9A 4LFBJ 2FLNA 4ILHA 1P1LA 3O4WA 3OYMA 2DISA 1HYZA 3AVGA 1NBEB 5KFCA 3B4DA 5I3PA 5KQ8A 2HVIA 3ENBA 4DV5J 4P74A 4JI0F 2ADCA 1UW4A 2HQ3A 1IKXA 4IOCL 1U1NA 2UXDK 3L7UA 2A6AA 3CDUA 1U1RA 1FRKA 4E89A 1Y9OA 1QAIA 1BWVA 2J0WA 1ZBFA 2R7SA 2DNLA 4H4KC 1SL0A 3Q8YA 3MCOA 3DOMA 4I2QB 1HYVA 3K58A 3BBFA 2YKMA 2B3TB 4DF8A 1WHXA 1N0UA 3WQUA 1H98A 3J7Z5 3RSEB 2WK4A 2CQCA 5KG4A 3B8AX 2Z1IA 3WNHA 3AFGA 1JL2A 3O1BA 3J7ZO 4ILJA 4ZITA 4U67L 2CGLA 3WX8A 1NSKL 4CZKA 2B9WA 3I9V9 3J81U 5B0AA 1Z2LA 2PSZA 3DDNA 1NK0A 4AD6A 2ZH3A 1NGCA 3MHYA 2ITGA 3RMAA 3IA0A 4ISFA 2QLBB 5HI7A 3J8AA 2GBZA 3GCWP 4I2QA 1UA0A 4P2SA 4CO3A 5KFTA 1YBUA 3RSEA 3P4UB 1YJWN 2R8KA 4ID5A 2MKHA 3AXMA 2C2OB 5E2QA 4FLZA 4CZIA 3MI7X 4WXOA 5A6WA 1YG0A 3IM9A 1YDLA 3GE1A 3TTDA 1SC4B 1C4CA 2UXCK 2EBGA 3AO4A 1KFDA 2XTJP 4JI1J 4OYZA 2FHOB 4U7UD 2FBXA 3H46O 3DLKB 1U09A 2AU0A 3T1HJ 5H9FK 3NNAA 3NF9A 2XCPA 1J9AA 4DV3K 1TKTB 4CJ5A 1CJKB 4A46A 3RGIA 5I3QA 4DPWA 1O6XA 3F9KA 1VISA 4X65K 3N5FA 2J0SD 2DY4A 4MIAA 1JLBB 4WU3A 1ZM9A 4NA3A 4DR1F 1XR7A 4B9VA 2RDDA 1HR0J 5B0GA 4JI0J 3QWUA 3S8SA 4J9RA 4J9OA 1XI1A 4CHNA 3CYMA 1VQ9S 3IS9A 3IP0A 4LVOP 3THTA 2RE2A 2OH2A 3D4JA 2JLGA 2XLJA 2K3KA 1LXNA 4KHYA 4PL7A 2Y1LB 3DLKA 1FRLA 1BQNB 2RUSA 2Q66A 5AE2A 2MQ8A 2HFVA 5KG2A 2OSRA 2E66A 2L3MA 1TKTA 1CJKA 4U8YA 5A8KB 2O1PA 4XK8C 2YX7A 4BRMA 3PRBA 2A1BA 2DRDA 4CLLA 5A6PA 3THWB 2XY8A 2P9UB 2V63A 5JVGL 1JLBA 2UVUA 3NGDA 2EFVA 2HWIA 4ZPCA 1B4SA 1M1HA 2F9DA 1VRTA 4I6YA 4KRWA 4G65A 4Y65A 4HCBA 2ZF5O 1ICEB 2X74A 3IG1B 3BPDA 1FJEB 2EW9A 4DUYJ 3GTYX 4GY2B 4CJ3A 4CZGA 4CF9A 3M6WA 1S6QB 4RNNA 2DR6A 2FYXA 4B3SJ 4EGLA 1UVMA 2YKPA 1BQNA 3TVYA 1QQCA 3ZNJ1 1FESA 1IG8A 4Y0WA 1JLFA 3BV8A 4UOCA 3NNHA 5A8KA 4M42A 4OI3A 1HWJA 3THWA 2D5RA 2E1PA 3HULA 2P9UA 2MHEA 2OIHA 4J8FA 2XMTA 3Q8UA 2RPIA 5BR9A 2A1RA 1GMWA 1MWYA 1XR5A 3T5KA 1O51A 3HI0A 3ZT1A 2W01A 4DSLA 3IG1A 4LFCF 5KGXA 1N5YB 3ID6A 1R6VA 2JRSA 3W1YC 3Q7BA 4IR9A 4OO1J 4YDUA 3D7SB 1S6QA 2ZKTA 3QEWA 4EZ6A 4OJHA 1UWAA 2G2OA 1S6PB 4I64A 5B0CA 1XNRF 3LWMA 3SQ1A 5KT6A 2J9EA 2QE5A 1B0VA 4TLRA 4KH6A 4A8QA 4AM6A 5GAEP 1S5ZA 4DR1J 4CGFA 3K5PA 4NWBA 4BVOA 2BUNA 3KJQB 1MA9B 1YUWA 3MDFA 4KHSA 4A47A 2YQ0A 4OPJA 3CJ9A 4AM7A 4GC7A 4Z4CA 3ITHB 2V69A 4RW4B 2YH1A 4OKKA 3N5BA 5MLCQ 4TQRA 2BQRA 3I8BA 2SXLA 2D1KA 3LP3A 5F8MA 1JJ2R 3C6TB 4UOHA 3OFFA 1H0HB 1A6LA 2ASDA 2L08A 2AYGA 3V1RA 5KFYA 2GGPB 1EKRA 1CVJA 1S6PA 2YWGA 2VQEF 1Q5VA 3U4LA 1RAGB 4FJJA 3DLGB 5EOYA 1YWXA 1T9UA 1CLFA 5HLFB 5E84A 3NF7A 4YMEA 1VQ8S 1V3ZA 4PCQA 1FX4A 4KY3A 5DETA 4Y2MA 4ZPWR 2HVEA 1QLNA 4EYIB 4RW4A 3W9JA 4U96A 3AY9A 1U24A 2FBYA 4DMNA 6FDRA 4TQSA 3K9KA 2CQ0A 4NI2B 1VQ4S 2COLA 5J2MB 1OYEA 1RADB 3CTRA 2WVDA 2UUAF 2GGPA 3G71N 5EX5A 5F3TA 2BW7A 2BVZA 2ILZA 4M1KA 1NUEA 3DLGA 5F8NA 3OT9A 3J7YI 1I51B 4KGMA 2BH1A 1U26A 3UCUP 2DXEA 1BGXT 3Q23A 3LM2A 4FXDA 3MPUB 3CWJA 4CM2A 1SC6A 4H03B 4HI2A 3TAPA 2CKWA 2JDJA 4Y2KA 4CGIA 3H5SA 5DQGA 3OYLA 2QXLA 2GX9A 1NK5A 2P9KB 3MM9B 2G0IA 3G96A 2RQCA 4BRHA 1I94F 3BKUA 3QLHB 4NI2A 4DR2F 3I4HX 3OTDA 5SZTA 1XNRJ 1M5HA 1FDBA 2QO3A 2F40A 2AJ0A 2VFSA 3R2DJ 1F5CA 3NP5A 1RNHA 3GJSB 1VQ6N 2NS1B 4EUVA 4LF4F 4BR4A 1SH0A 2VUGA 3CCRN 1WWHA 3SAFA 1Q9YA 3VPZA 4CLWA 3VQ9A 4M3TA 3GDQA 1T9TA 3MMCB 2HHVA 2QK9A 2ZH6A 2WB1D 4JYAK 5IWAK 4KKOB 4FJKA 3EJMA 4NLQA 3MM9A 2P9KA 1KLNA 4NPOA 3QGPA 3P3DA 1NK8A 3QLHA 2CZVC 4FKYA 4XEIA 4LSZB 3HSCA 4R0EA 3M3ZA 5HROB 2AF6A 2C2RA 1WSHA 1BWFO 3C6HA 1K1SA 1XBWA 4QR2A 5FPDA 5KFPA 1OKJA 4TU9A 2P6SA 2AYMA 2FSJA 1PC5A 5CH7B 3V6DA 3AJ1A 1HKBA 2ZE2B 4CJPA 5CCLA 2HVHA 2ZGZA 3MMCA 2VPZB 5K8OA 4WKYA 3CJAA 4JI2F 2CNLB 3KJVB 2YKQA 3CC4S 4QZVB 1WSRA 4KKOA 3MR3A 4DR5F 2I7NA 1Y3KA 5GAHI 2UXCF 4OPKA 4DHYA 2ZJRQ 4CH7A 2UUAJ 4BR2A 4FLYA 3BZQA 2HS4A 5HROA 4FWNA 3P5JA 3AVMA 4IFYB 1JNZB 1FJCA 2E6LA 2FSNA 4CZLA 1KRPA 4X65F 5D8HB 3DYAB 2VGMA 2G0CA 2M52A 1IBLK 5C2CA 3M9NB 2XS7A 2RDIA 2BX6A 3P1GA 1R59O 5D77A 2ZE2A 2XWYA 2IS3A 1U8SA 4A8OA 3QATA 3CCVN 2ZEJA 3CO9A 2UXDJ 3IBCB 3VQCA 3KJVA 1LWFB 4U7BA 1I94J 2VFRA 3C14B 3AVCA 1WB9A 1IM4A 1TL5A 4DR2J 3C6UB 4FO0A 1U48A 4UUWA 3T5LA 3W8PA 4ID1A 2C3MA 3NGTA 3PM9A 1PYOB 4WE1B 4DCHA 5DJBA 1I5OB 1WC1A 2I38A 5JLHA 3AJ2A 2BQ3A 4LF4J 4ECUA 3G25A 3ID8A 5AQHA 4IFYA 4ILLA 4XDDA 2XMVA 3DYAA 3UN3A 1N34F 4JN4A 3TRGA 5T41A 4E2FB 4H4KA 4B17A 2H3EB 3QZ8A 2BYCA 1QQOA 2Y1RI 4JI6K 1LWFA 2DR7A 3C14A 2KXNB 4FS2A 4EYHB 3C6UA 5MLCV 1P8GA 3O9UA 5F8JA 1TK5A 1W97L 1XMQK 4CZEA 4WE1A 4TU8A 3G0ZA 4IKFA 4E8UA 2YKAA 3KYLA 3BEGB 1J6ZA 4ZPDA 1YHQS 1GXLA 1BC6A 2YX1A 1RLCL 1REGX 4DSKA 2HBQB 1GLBG 2KDOA 3AA4A 3MN5A 1ELOA 4URQU 3MMBB 2HMIB 1RBTA 2CFXA 1CJUB 4QWBA 2ASOA 2UVVA 3N79A 4LFAK 4DR5J 3ZZPA 4CCHA 3TX8A 2UXCJ 4OLPA 2A6MA 1TUGB 5HQMA 4IJNA 2NXUA 3L0QA 2EFGA 5A2QY 6FD1A 4JKEA 5H9FJ 2XYGB 1DKGD 1PJ5A 4BRNA 2MJUA 5B8HA 4PA1A 4FF3A 4F2SA 4CEZA 2KRBA 2P9NB 2DHXA 3LPTA 4DX5A 4X65J 3CI5A 1U1KA 1T9WA 3J7ZT 3KDOA 4HH0A 2OANA 1RKIA 3ENVA 2ZOMA 4C8OA 2W9CB 2HMIA 3SQOP 1S5JA 2EWSA 1CJUA 4OYOA 4P52A 2YPZA 1U1QA 1QVGM 2YKNB 2RJZA 3MECB 2GZOA 4CERA 2ZHBA 2I8EA 5M1OA 1WLJA 1GXTA 1IQZA 1V4TA 3A5NC 4QPXA 3FMBA 2JH3A 3IC1A 2CJXB 2AX1A 1JLAB 3AXKA 4BRGA 4AL7A 3NAHA 2P9NA 3QIDA 2K7KA 4JI5F 4HWIA 4WFNL 2Q31A 3M6GA 1LWEB 3MCSA 4CJQA 5EX3A 3SQGB 4HLBA 4M5MA 2BUPA 3OJUA 2W9CA 3GG1A 5KAKA 1QE1B 1XQIA 3O9QA 3R8YA 4FZYA 2O4GA 3G82B 2YKNA 1B99A 4N56A 3Q0AA 2BRKA 5CR4A 3MECA 1PSDA 3ZEUB 5JVHL 3CJSA 3HHLB 4M5KA 5F41A 3MXIA 4Z37A 2HVZA 2P9IB 2YPYA 1U49A 4ZJQA 1JLAA 3TAEA 1HQ2A 3N28A 1IWGA 4JNEA 3NGKA 5AQJA 3VQQA 3JAMY 4BY9C 4IFEA 3GIRA 2OTJS 3S01A 3RAXA 1HYSB 4GV3A 2Y8YA 3CCMS 1LWEA 2CGKA 3KKFA 3SQGA 3AVNA 3VQEA 4ZVRB 3KK3B 2CQHA 1SUQB 1BCMA 1KBRA 1KAXA 1VQ9N 4CLZA 4B9MA 4TXSA 1T95A 4OHZA 1QE1A 4NZ0A 3ZC4A 3DXKB 3ICLA 1WC5A 3D0IE 3ZEUA 4NMLA 1JXLA 2HF4A 4RWXA 1F2HA 3HHLA 3RG6A 2CJBA 1CJTB 4YDXA 5H9EJ 3D2EB 4YB5A 2P9IA 1NKEA 4IH7A 4K8RA 3P39A 2B0GA 1DTTB 3RUBL 3VGKA 4FPAA 4DR4F 4O3OA 2HFNA 3AA8A 2O8BB 4W92B 1HYSA 4DF4A 3SMPA 3Q2TC 3KHHA 3GSDA 3CC7S 2O01C 2HYIB 1WG5A 2HFUA 3KK3A 2Z2LA 1XUPO 1KR4A 3WBZA 5AQKA 1JJ4A 2DCUB 2IM3A 3IFEA 4CDIA 2P9GA 4ERDA 3DXKA 3L95X 2R7XA 4A57A 2CYYA 2VPYB 7FD1A 2LSNA 2HQFA 3M6XA 3ADAC 4MLEA 1CJTA 3D2EA 3NMUA 3ET6B 4AHVA 5GADI 3VGUA 2AV5A 2NRXA 1CBKA 3JAMU 1CQMA 1YJ9N 1DTTA 2XO6A 3I4PA 2XS2A 1UKUA 4RBVA 4IDHA 2A10A 2O8BA 4NYFA 2QEXN 1NXIA 4FJ8A 1SV5A 2BM1A 2K8GA 4RNHA 1WSEA 2JLFA 3CXCR 1CXUA 1A7GE 4Z4FA 1A5WA 3LH2S 1PAEX 2VIHA 3UDVA 4HUEA 1X4BA 1WHYA 1IKYB 4OPAA 1WSIA 3ZZUA 2KW4A 1S1XB 3GOIA 2POKA 4F02A 2BKNA 1KONA 4U7CA 3PACA 2XY5A 2V94A 1G15A 1N5SA 2DJWA 3ET6A 2IMOA 2A40A 5DLFA 4OL8A 4W5RA 4P73A 3PR4A 4HHTA 5IM0A 3N4QA 3T1AA 4QQBA 4KTQA 2E9TA 2L48A 2GIFA 4NCBA 4DU4A 1IBLF 1Q9XA 3CJ4A 3HDSA 1JXVA 1VQSA 3BS9A 5GMKa 5KI6A 3BO2A 2CNOB 4HKQA 5C7PA 1AROP 2H3GX 1IKYA 1S1XA 2DXDA 3LOUA 3QJJA 1HPZB 2GJFA 3MWBA 2OTLS 3S6EA 5HQLA 3JTPA 2MGZB 5E7OB 5D78A 2CQ1A 1TGOA 4WZMA 5LT5A 2L41A 2F8MA 3FR0A 2XLIA 2CPZA 4N5SA 3ISND 3HM8A 3CPWR 4ZVQB 2E6MA 5ETKA 4JKAA 4DV7K 1S1TB 4CEEA 4JI6F 3TP2A 1VI7A 3VAIA 2ZC4A 3OYEA 1VQ4N 1NDLA 1BA1A 1TUWA 3SQ2A 4A5BA 1HPZA 3TAGA 3MZIA 1FRJA 3EDQB 3IRXB 2VQFK 5LL6Z 4NLUA 1XMQF 2OEJA 3OR2B 4PXEA 2NXJA 2MGZA 4ELTA 3A3NB 5KFDA 1GLCG 2O5DA 1XWLA 2OFHX 1AUDA 5C5JA 2GJ2A 1FD2A 5GINA 3GWCA 2ERRA 3NCIA 2XZWA 3CD7A 3TEGA 4W98A 4ANEA 2JEIA 3CNQP 4C1NI 2PBDA 1RABB 5CAAA 2W6LA 3PIPL 3AODA 3TABA 3C7NB 3ZFVA 4DV4F 4LFAF 3OFHA 2QTWA 2JEGA 1S1TA 5ETSA 2ZFHA 1EWQA 3QPIA 2QWMA 1H7XA 4ER8A 1BU6O 4F9OA 3HFZB 2DRAA 5HMWA 3HD1A 4F26A 1HKGA 2C2KB 3IRXA 1YQHA 2MJNA 2HBJA 2QX0A 3FNNA 3OR2A 5E3AA 2VONA 2LA4A 4PQAA 4UUXA 4ZDNA 1RTJB 5G4DA 1F9EB 4IZ9A 4CLSA 4CM0A 3AT1B 1K6YA 2KYZA 3ZSVA 1IBLJ 1IBMF 1VHIA 2VDIA 4AHUA 5C2DA 1B92A 4RNMA 3I33A 1ZM3A 3BQ0A 2VBYA 3J81j 4OKJA 4I67A 4ZVGA 4CFAA 2Q3PA 1NGFA 5FDLB 3LL3A 3T1YK 2G13A 2EVZA 3C7NA 2E7XA 2G8FA 3K8VA 1Y00A 2A3JA 3HI9A 1DZ5A 2CZ9A 3IWXA 4PYDA 4URGA 2V2ZA 3GQCA 2EG1A 3O1LA 3Q8QB 3WXKA 4TYBA 4FYDA 1RTJA 3A8EA 3KG1A 3QSIA 1ZBSA 2RSQA 8ATCB 2AGPA 2RU3A 4M41A 2C2ZB 3HFVA 1EX8A 4X4PA 1OY6A 3SQ0A 1AB8A 2MY7A 3GIMA 4O4GB 5KFOA 2BA9A 3SJHA 3O5BA 4JI6J 5FDLA 2FD2A 2ATQA 3CC4N 1X4FA 2NPFA 3A8IA 3HP9A 4HHJA 1XIQA 3CETA 2EHGA 1XMQJ 4AFFA 4OYMA 1QD1A 4JK9A 4DFJA 3M9MB 3KHRA 4WCEL 1S4EA 3SUQA 1VQMS 1U7LA 3PX4A 2G9OA 4FF4A 3PW0A 1NMDA 3TNVA 1XERA 4J9KA 2U1AA 4JI3K 2VFUA 4TKTA 3EXCX 1EARA 4Z4HA 3V6JA 4O4GA 2LXIA 2YH0A 4LFAJ 1RDAA 1FKOB 4C6AA 2ZH5A 3VQSA 1NZAA 1NWKA 3CCJS 4WKRA 3RBXA 4QW8A 2ALYB 2ZWOA 2E1YA 5JICA 3ZX2A 3SZ2A 2EFOA 1HNIB 2Q2RA 3WDOA 1KSPA 3BY5A 4DU3A 1FWKA 2VG6B 5AFUA 3QNNA 5EDWA 4LF8K 1IBMJ 3I0SB 2RIJA 1RTDB 1HQUA 1Q79A 4KH5A 4DQSA 2FLOA 1X0PA 3V9XA 1S7IA 5AQNA 2E5LK 3W8GA 1NJIO 2MDAA 3BR8A 1K73T 5IT9U 4OHYA 1K8AT 3O3HA 3KHYA 1FKOA 2FC0A 3IR7B 2ZH7A 1SIZA 1MW7A 3QJPA 4EBCA 3UQSA 2EXUA 5KTQA 3NGIA 2CWXA 1UPPA 1HNIA 2FF6A 2RQ4A 4KC5A 3PXGa 5CZVA 3VQ7A 1NPRA 1R7IA 3MGJA 1NGBA 3QDKA 1HX1A 2VG6A 4OZ3A 4LC9B 3I0SA 3Q2SC 3F41A 1RTDA 3PHEA 3Q8SB 1FDDA 1KAYA 4QIFA 5GAHU 3CM6A 1YZ6A 5DG9A 2HIYA 5J2QB 3CFRA 1X0FA 3O8WA 4DLEA 1LEOA 4O3PA 4E0DA 4FPRA 2D9PA 4RJVA 3F44A 4DPOA 4EBDA 3MTJA 3PYGA 4HUGA 4H54A 4NZ6A 1RB0A 1X4CA 1LOUA 5LSLA 1P9QC 4USMA 3CSKA 1T05B 1FW6A 2L9DA 1NOYA 2RD5C 2P9CA 3KHLA 2E5IA 3NVMA 2FXUA 2OEKA 4JKDA 5G0RB 2KO1A 3FLCO 4Z0UA 1P6TA 3CFPA 4QR1A 2X1FA 5J2QA 5DLGA 3VMFB 2CNKB 1K9MO 1IN0A 4J9SA 1H2UX 1PYTA 1UEUA 4WP3A 3G6VA 3DCAA 4JOUA 2OAUA 3OLAA 4YOYA 2F4VK 1F6TA 1T05A 3JB9k 2CJKA 5KG0A 2NZCA 3HPOA 3RBDA 3BP8A 1WD6A 1FWLA 3K7RA 1RE1B 1JCFA 5G0RA 3CDAA 4CZCA 2IOCA 2MB0B 1X5SA 2KKZA 1ZA2B 3TAFA 1HWIA 3DRSB 3HXMA 3JSYA 2QWNA 4M3WA 5HJYA 4MKVA 2AGQA 3AVFA 5K8MA 1VQLN 2R8JA 2FQQB 3OW2R 2P8IA 2F5GA 2MQLA 4ATNA 4DV7F 4USUA 2AA4A 1JQGA 2QLWA 1G4CA 3LDQA 5M1QA 4IH5A 4A59A 2DNKA 3BZKA 3QGGA 1YTUA 2W2MP 1JJ2M 1NKCA 2A6OA 2Z2MA 1E4GT 5A2QO 4L72B 4DDFA 2OTJN 1FE4A 5JVGQ 4V19S 5A76A 3CO0P 4U8VA 3SMZA 5AQPA 2CIMA 3CCMN 3W60A 4DEZA 1Q78A 3CJTA 1U8WA 3NOGA 3MUTP 3VQPA 2MLYA 3GJQB 3PJ9A 4U7UK 2E2PA 4RUBA 2W9AA 1MSWD 3DRSA 4Q0BB 1RXOB 1S9FA 3R1LA 2H48B 3N01A 4NLTA 4CO5A 3FBCA 2N82B 4LR7A 2H1YA 2JFDA 2DNPA 5JS1A 2OI2A 3FRZA 3TJAA 1V3SA 4E1MA 3DXSX 4M5GA 3GV5B 4NLSA 2VOPA 3PYFA 2W2PP 4PPDA 3QRQA 3F5TA 3FDSA 3LTOA 4ZP6A 1HHQA 3UVJA 2HB5A 3LZIA 2QWRA 5AXMA 5BJRA 1KCFA 4WQ4C 1PKUA 3AVKA 3VVTA 3NAIA 1NLKL 1JIHA 3T1YF 2DT9A 1XHZA 4PPZA 3ZNUA 3EE9A 5D0RA 2DH9A 1NH7A 1FA0A 5D4PA 5E3CA 1GMUA 1KDNA 4HI1A 3CE8A 1T3OA 4CNZA 4QWCA 3TUJC 4NMXA 1WC6A 3ATUA 5AE1A 1K0TA 4K42A 1RDCA 5JS2A 5FLXU 2DNNA 4OQJA 4J9QA 3JAMO 3HL8A 4CIEA 3OYNA 3ULEB 3LWLA 2KM8B 4WFAQ 2E20A 4HUFA 1WBDA 1GQEA 2DPJA 4DV7J 2WAQD 2JVRA 3HLUA 4DL3A 3ILLA 3I5CA 1RHKB 5D6GA 3BGOP 3HT3A 4RR5A 3OFGA 4EHTA 4ZN1A 1CULA 3CJ2A 4RWWA 4DOZA 4CD1A 1O13A 5HRPA 3VR1A 3L2RA 4WFYA 4OX9F 7AT1B 2M0GB 4ZVSB 2HQIA 4EK2A 3CEDA 3PEJA 4OKEA 1M1KO 2LKZA 1N4LA 4KPCA 4DUZK 3EUNA 3ULEA 4GNIA 3DU6A 1ESVA 1RWPB 2LQ5A 1VGYA 2W42A 2DY9A 3AVAA 4CEDA 2WCXA 1TL1B 3M8QB 3GIKA 3OXLA 4RZRA 5L46A 2KT2A 1ZZNA 4CHPA 3R2CJ 5C12A 2DO4A 2P9PB 4A8YA 2N3OA 3MM8B 4CT8A 2ILYA 3K59A 4RL1A 3SCLE 1EP4B 4R8UB 2J0QD 3FBFA 4LF8F 5GMEA 5U47A 2D1CA 4HYKA 1BG3A 3F56A 2DFHA 1M90T 3TARA 2V5HG 3T1YJ 3NS6A 1Q8BA 3J80Y 1VC0A 3OVAA 3SYZA 1WSFA 4K7QA 4BDYA 5GADU 3C16B 2HHTA 1Q7LB 5FPEA 1VQ7N 3RB4A 1TL1A 3M8QA 4BRLA 4FLUA 3OYAA 4LSLB 1SAZA 5DG8A 4FNIA 3AA5X 4F7VA 4ECQA 1RDWX 2D3ZA 2P9PA 1ZH5A 3PJXA 3B78A 1TKXB 5ADXA 2XYPB 4WIQA 1EP4A 1LWXA 1D5AA 4MT1A 5AQWA 1F21A 2WUSA 2ZQBA 1SJRA 4R8UA 2VC0A 1SH2A 1RWMB 3BSOA 1MMNA 3I8DA 1IXKA 4LQ9A 2CPJA 2KB2A 3Q8PB 2P1JA 2MZQA 1HRHA 4A5AA 2D3O1 4H0VB 3UD3P 1HD1A 1UOCA 2BABA 4YP3A 3HOSA 1WDTA 1NOZA 4LSLA 3RRKA 5AQTA 4EAHD 3KWGA 2HAIA 1RBAA 3KK1B 4MYUA 2HVDA 1SKRA 2R7YA 1TKXA 4CLPA 3TTFA 3US5A 3CQXA 3F0NA 3AVBA 4YOUA 4DPYA 4FXVA 1RWUA 3E9OA 4C3KA 1X5PA 3KJFB 2J9CA 2KL8A 2NRZA 4FYWB 2WBNA 3OY9A 4JI3J 4K2XA 4IOBA 2CGJA 2K1RB 1U0SA 2Z56B 1ZM4A 3O6WA 2ZJPQ 5J2PB 3O4QA 5D15A 1Y11A 2B9YA 4F0HA 3VTHA 1UMJA 3B8HA 1IVZA 3UKRB 1RWVB 1KQKA 3UCZP 4CLTA 4ECTA 1KVKA 1WF2A 2IBKA 3KK1A 2Y8WA 1I3OB 3HFKA 3K8WA 4LF8J 4HT5A 2IIHA 1NU0A 1HD0A 1QTMA 3ASMA 2LLZA 3T6BA 2HW3A 2AJFE 4HCCA 3D9BA 2K1RA 3UKUB 5CYMB 3KZBA 3KNGA 3U7JA 3H2LA 5J2PA 3VA3A 5AZJA 4CJUA 3SUOA 4ES1A 3IMQJ 3HP6A 1N52B 3GIIA 4WTOB 3UKRA 3H4DA 3P5TL 2AHOB 3CDBA 2VWKA 2BEFA 4DQ8A 2WONB 2JL9A 3A12A 4X4SA 3CMEN 1VQMN 1OJ4A 4B02A 4G6VB 1DJ0A 2KFNA 1WC4A 1Y5IB 4BDZA 3M7VA 5BPNA 3O1WA 1YJUA 3HF5A 4FWLA 3UKUA 5CYMA 2IAJB 4DWIA 4KTZA 1R0BG 4TNOA 5CYJA 1Y10A 5KFQA 1C0MA 2VWBA 3QEVA 2K06A 3DI6B 1MWMA 2GX8A 3UO0A 5AJ3K 2ZBRA 1Y3JA 4AXIA 3MTKA 2WONA 2IIRA 4ZVTB 1LAVA 5KFGA 3AA3A 4YHHF 2AP1A 3SPYA 2F63A 4I68A 2BJEA 2DHGA 3VEYA 2WTFA 1VIOA 1NJIT 3TSPA 2V67A 1Y0HA 2C2MB 1VAZA 5GAEI 4X62K 2WBRA 3CULA 2Q1LA 4OLAA 3BKFA 3KUEA 4JBCA 2IAJA 1QHTA 3D67A 2R7UA 4DV1K 3BSAA 3GE9A 2FJBB 5RUBA 4YOVA 3IMXA 2JEJA 4JEPA 3DI6A 1VK0A 4WFXA 1RACB 1GNKA 1ZTTA 2RS8A 4A2BA 2XSFA 1VC5A 3TUZC 2J76E 3NGSA 2ZKUA 4PXCA 1JB0C 3C95A 5HMXA 1UA1A 4ISEA 1S0VA 4F50A 2ZJRL 3PDNA 3I32A 4BR5A 4LQ3A 2XNRA 3R97A 1NMNA 2KVIA 2BZ2A 4YFUA 2FC9A 3KTQA 2FJXA 2LP4A 3O3LA 3NGUA 1CG2A 1E3MA 3BF4A 1Y97A 4AILC 2AEJA 4XDCA 4KHWA 4ED2A 4EEYA 2PC6A 4BACA 1NEEA 2HQDA 1WAJA 1GT8A 1RKJA 2IY5B 4AHTA 2EPIA 5BYQA 4O0JA 2QSWA 2DIUA 3D1QA 2MKJA 3OHAA 1FEEA 1RDBA 3HHEA 2AMCB 3O5TB 4RBTA 3THYB 2HNZB 2MMYA 1T0TV 2LECA 4YUDA 2B56A 4J7CA 4X64F 2GQQA 4OYIA 3VENA 1XMOK 1K0VA 2OHDA 4TVAB 2OEMA 3O3FA 4F4KA 1V4SA 3NS5A 4MFBB 3K0SA 3OLBA 4XAKA 1XNQK 3FKBA 2HF3A 4YS2A 4KHPK 3SNNA 1MNEA 1XHXA 3TX0A 4PAAA 4W5TA 2XWXA 4X4OA 3HYFA 3G8TA 3JXOA 2NRHA 5D4OA 3MWTA 4HDHA 4ECWA 2M4MA 1RHUB 3GYGA 2G0JA 4UY85 1HNZF 5CY4A 3THYA 2R7OA 2HNZA 3H2UB 4ED8A 1ZBTA 3MM5B 3V9WA 4UY8O 2GUIA 4CO4A 2CPXA 2EX3A 3SSRA 1NNEA 5HOOA 3Q86A 1LAWA 3MCNA 1FWPA 3W2WB 4WQ4A 5IQQA 2HKEA 5KG3A 1GLFO 5C2GA 3B6BA 2VODA 3R3LA 5GVQA 4U95A 1RA6A 1FVSA 1XC9A 3BUZB 1KQGB 4FLTA 4KBOA 4TYAA 1BQXA 3PYDA 3HMJG 3VERA 3OS2A 4P6QA 3LDLA 2ZD1B 4QYRA 3TZZA 4JI4K 1HW9A 3OA9A 3DDKA 3MM5A 3SFGA 3WT0A 3CPWM 1RU1A 1ZAVA 4ZCIA 1YJWS 5F8IA 1CJVB 3W2WA 2BV3A 3RW6A 5CD4A 4CNYA 3ZTRA 3AQPA 3PUFA 2WSFC 3NCQA 5KG5A 4DX7A 3IGNA 1ATRA 2E5JA 4Q43A 4DUZJ 5AQUA 4ZHRB 1M5SA 2NPIA 3NGRA 3KK2B 2ZD1A 2BRLA 4GO7X 2R2UA 3V2UC 4DV6F 3VEWA 4HR2A 4KFBB 2C2DA 3S3MA 4B1ZA 2JFKA 2VZ9A 1TV6B 2ZZTA 1UEKA 2RRBA 4FL9A 4OI4A 1OPIA 4TLQA 4A8SA 1CJVA 1NLVA 4PKHA 3OL7A 2DTJA 2OMLA 1HNWF 3GZ7A 3JSMB 3HVWA 4QIVA 3CHWA 3UB5A 3KHGA 1EKEA 3VESA 4DSIA 1TMMA 3MMAA 4CH0S 4BC3A 1TYQB 1UCNA 3P31A 4XH4A 4JV5K 3BN7A 2G1HA 4ZHRA 5GMDA 2WFBA 4FM2A 3SEOA 4O0IA 1S6UA 3KK2A 5E0OA 2QC3A 3IAM9 2O8DB 4KFBA 3MPDA 2NYHA 1TV6A 1SJ4P 2KFYA 3QT7A 3VTIA 4R79A 3CUNA 2CVEA 2LXUA 4ID8A 4K8XA 3SV3A 1ZC6A 1UFWA 5MAOA 1RCXB 4G1QB 3K2YA 4WQ5A 1M1KT 1GXUA 3BDPA 3W66A 1YBTA 4E19A 1SC1B 3R7SB 1TYQA 3W5ZA 2CA9A 1NHVA 3R3TA 2G8HA 1SPBP 2BJ3A 5AQGA 2CPEA 4EP5A 3GR1A 3GFYA 4OJRA 2KT3A 2O8DA 4BRQA 2DNGA 4CEOA 2HQCA 2IM0A 2KT5A 2YQ1A 2Z1JA 2DGUA 4AHRA 1SQKA 3KVGA 2CQ4A 5HATA 1JJCB 4E7KA 1KC8O 2IVYA 1RFQA 1TUUA 3QFHA 2ZH8A 4DL0C 3IWNC 1YJNS 2F4FA 4E7JA 1E4FT 3D7EO 4CJLA 2C2NA 1UJ6A 1GLDG 4A48A 2XY6A 3K5OA 1TL3B 3HVAA 3MMJA 4DCPB 1M1GA 3Q24A 3NGZA 1FNMA 4RNFA 2HS3A 2HOEA 4HVJA 4DTRA 4X62F 2H5EA 3QJLA 1ZM2A 2NR0A 4AUKA 3RBEA 4RUHA 4NCGB 2IJRA 4DV6J 1NGDA 2UU9K 3NNCA 1S48A 1HPMA 4DV1F 3V81B 1EHWA 4CGDA 3KFWX 1BMQB 4CJ7A 2U2FA 3HPHA 2LYVA 3U9DA 4BWJA 3A3OB 1MROB 4LRDA 4DV0K 1NB7A 4RNOA 1HNWJ 1HJOA 1RBSA 4LH5A 2G1DA 4FXWA 3SBMA 3VGLA 4OHVA 1REVB 5E3PA 3CPEA 4ZTJA 1S12A 4A8XA 3ENHA 2YJEA 1TUYA 1WOPA 1DAXA 1TL3A 3H3NO 4IDKB 1HL6A 1S76D 5EVZA 4PR6A 4K4XA 2HAFA 4OJGA 4NO7A 1XJWB 3BQ1A 1SS6A 3VQ6A 4NCGA 4CF1A 3V81A 3RB0A 2YNFB 1S0MA 2YWEA 4QU6A 2AZ3A 4H0PA 3CCLS 3UN2A 3OXFA 4LF6F 1MROA 4GKKK 2ZH4A 4W5OA 1RAOA 1VR6A 4USJC 1Q81T 1O5JA 3VQDA 1U6FA 3D1HA 1Z6RA 1JMTA 1REVA 4ZIWA 3T5JA 3EL2A 3NLCA 5AQOA 2ROPA 3HBTA 2F1FA 3O4NA 4IDKA 4FJMA 1RA7A 5M1PA 3FSYA 1ATNA 1DY3A 4OLBA 3CM5A 3G71S 1RLDA 3GILA 4YY3K 2YNFA 4WF9L 5E3QA 2UUBK 3V4IA 1QJHA 1WNSA 1XMOF 5AJ3J 3KKRA 2IRYA 3CJQA 3J80O 7FDRA 1Z4UA 4WCEQ 4KHMA 4CBUA 2I2YA 3ZSQA 3GFHA 4DL2A 4KHPF 9RUBA 1F5BA 4ED6A 3I55N 1VS3A 4X62J 1RDRA 2YWWA 3LP2B 2MKYA 4BQLA 2OFGX 3P45B 4BC4A 2RB7A 3OUYB 4IQXA 3UFCX 1WSGA 4DV1J 4CLYA 1VQ6S 2B6AB 4UOGA 4P7VA 3OTOK 4DR3F 2AIRB 4CBXA 3CCRS 1Z1ZA 5LMUK 1LW2B 3TA1A 4UQGA 1CXQA 1QTNB 2X7IA 4B3RF 2V6AA 4ZN3A 3MCMA 3TA2A 1JLGB 4FYYB 5F0XA 2DR9A 2C1EB 3UR3C 1TKDA 2Y0BB 4NYNA 3BF1A 2VKZG 2WW4A 2E8AA 4OYAA 4J9MA 3LP2A 3HSTB 4WP8A 1AFIA 5EU7A 3OUYA 4KAIA 4RW9B 2B6AA 2VPXB 4JI4F 4MYTA 4C3MA 4WK3A 2KTQA 1AUSL 4C1NK 5D0HA 1SH3A 1F3VA 4AHSA 4LFBF 2BJ7A 5KG1A 4QU7A 4E7HA 1LW2A 1J2VA 3K57A 5F9LA 3T9ZA 4HTUA 3V5RA 4N8OA 2IJFA 3OW2M 4IG3B 4LBIA 2UUWA 4ZP9A 3T41A 2NYIA 3H4BA 1JLGA 4GV6A 2UZAA 3O44A 3C0BA 1KHVA 1R89A 1L3KA 4OX6A 2I7PA 2E2NA 3GFZA 3I0RA 1OH8A 1DQ9A 4A8FA 1WKKA 4BR7A 1S0OA 2HHPA 3T5HA 1GH8A 1V5VA 1T6DA 3MOZA 1FJ7A 4RW9A 4Z4IA 2ZVSA 3WIUA 2RKIB 3QAEA 1XMOJ 1HJRA 1YGYA 2ASPA 1UW9A 4BRFA 1C6VA 4XIUA 2QW9A 5CHCB 4CHYA 3KD5E 1ZTWA 5HRNA 3WIVA 1ASWA 2F3JA 2R7RA 4ECYA 4IG3A 3CCVS 1BUXA 1IR1A 3SI6A 1KD1T 2DEJA 4JV1A 4KHPJ 5C25B 2B43A 2BACA 2E7WA 4ILMA 5B0DA 1G7CB 3ZSYA 3IAYA 2QXFA 4F4YA 1VBYA 1D9DA 2XHWA 2QWQA 1ILYA 4JV5F 4CZJA 3M30B 3H45C 3I5AA 3Q8RB 2RKIA 1RT7B 4CTAB 4DN0A 2WSCC 1N48A 3X3UA 3GG0A 2AGOA 5F9NA 3QBCA 4ECZA 4OHWA 2CJQA 4RWTA 2IMWP 2XI2A 3SCIE 3LW5C 2Q6CA 5C25A 3PRDA 5TKWA 4J2DA 2IDEA 3N9UC 2W7PA 4XH5A 5IV3A 2EFQA 4N41A 2DHAA 4KGXB 4O5BA 3NBPB 4JI4J 3HCXA 4BBYA 3M30A 3R9LA 4GKJK 2GEMA 2J7UA 3AB2B 1NB2A 3IXQA 1RT7A 4CTAA 5BRDA 5CCMA 1YJVA 4QCLA 1L3VA 3G6EN 2DGSA 4P75A 2HHQA 5GAEU 1HR0F 3DLJA 4JD2B 3R8EA 3EVMA 2WW8A 2HS0A 3Q83A 2VICA 4ILGB 2RS2A 3ZT4A 1FRIA 3AARA 2OGUA 2R2RA 2UUTA 1Q7YT 2OPSB 4FWRA 2VB6A 3SBTA 5AQVA 4UY8T 3WNGA 1BCOA 4HTIA 4QW9A 3VALA 4BC2A 2LXFA 5JMVA 2VG5B 1HARA 4J9VA 1TUVA 4IXCA 3SCKE 3CCWA 2LQJA 2V68A 3PV8A 4EHUA 2ROGA 4DPTA 2ZZNA 5DZ6A 2DRBA 2QYGA 3K5MA 2E1MC 1R8CA 3DLHA 3EVWA 3IFRA 5LY3A 4J9LA 1NDPA 4P71A 3VGSA 4ZMMA 2B5JB 4HVZA 5B0FA 2O4IA 1GX5A 1Q8IA 1GLEG 4DUYF 4JV5J 2OPSA 2CPFA 3MR5A 1JK9B 1VSEA 4DSFA 4B3SF 4FWPA 3ZSZA 4LVNP 4X2BA 2NRVA 3PKMA 3ENAA 1VC6A 2VG5A 1Q86O 2E44A 4IUFA 2WC9A 3X1LB 3FC9A 5L9XA 5AQLA 2VASA 4JI8K 4KGZB 4GKKF 2ZITA 2NUUG 2KI2A 3FBBA 1S59A 2FZKB 3PVXA 4H0TB 3ZSOA 1GOCA 3BSNA 3ZYYX 3MK6A 1X60A 2DGTA 3AVJA 2L9NA 3I5BA 1R6YA 2CADA 4X66K 1YAGA 1Q5YA 2OLWA 2FC8A 3QSYB 4FK2A 4IG0B 5FJ4A 4EFHA 2R4FA 5EXWA 3HSDA 4FF2A 3S3OA 1S72S 1FRMA 3PW7A 3TQEA 4YY3F 3VHQA 5M2RA 2MQOA 2UUBF 3OVNA 1J5OB 4FWSA 2Q43A 4DS4A 3I96A 1X4AA 1VMBA 1TQLA 3CW2C 1OO0B 2W2NP 4B9SA 3ZSXA 1IBKK 4USIA 1HLUA 3L3VA 3JQMA 3WHIA 1S9GB 3M32B 4JK7A 2OPPB 1BA0A 1EX4A 4N8NA 4H0OA 4X4QA 1H7WA 4DTXA 1DEJA 5BR8F 1LK5A 5SWMA 1HA1A 1X31C 4KQZA 4MTPA 2N3LA 2QRRA 4OI2A 2UU9J 4GO5X 3QEPA 3HHNB 4EIAA 3CF5L 1B7YB 3OTOF 3N0VA 1Q53A 2IJNA 3VAFA 2F9JA 4DV0J 1J5OA 1WDDA 2KKHA 4FSVA 3CERA 4F3QA 3EICA 2EC0A 1JJHA 2IVPA 2BGGA 1IBCB 5FRNA 1TVRB 3IR5B 2QWLA 2XEXA 3G4SN 3MAAB 1S9GA 3M32A 2OPPA 4FW1A 2HGMA 3RBZA 3ZZZA 3OFEA 2FTRA 1Z25A 4QR0A 4I0WA 4QIWD 5AR0A 4LF5K 2XGQA 1YJ9S 4M3UA 4AL5A 4CJWA 4K50A 3W61A 3HHLC 3JQJA 2QEXS 1GK8A 3KWMA 4EFAC 4GKKJ 2HGNA 1KC8T 4B9LA 4RPFA 4AYBD 4L3QA 1VQPS 1IJJA 4M5HA 1TVRA 4WJBA 1YJNN 4ZCKA 3MAAA 1F9FA 3BBCA 2D0BA 4PZVA 1YVUA 2PT0A 2MLXA 2LQ8A 4KB1A 4WFZA 1GTHA 2C3PA 3U6FA 4KGKA 4O23A 3TSUA 4DU7A 1SL2A 1ZAWA 4YY3J 3KLHB 2UUBJ 3DOKB 3FFKB 3L3CA 1MWZA 2CXEA 1N6QB 1Q1KA 1SVDA 2BJ8A 2QGFB 4FJXA 1EAYC 4ZKAA 5K5MA 4O44B 4MDAA 4WYWA 3U27A 4WFAL 1N33K 2CWKA 5BXIA 3E66A 2ZWHA 1X5TA 1X7VA 4IRKA 4C8LA 1N5YA 5B0EA 3KUHA 5BR8J 3VV2B 4OZ2A 2QIFA 5EWFA 1I3AA 1S10A 4R25A 1TTHB 2QSFA 4RUAA 3RB3A 2HK3A 3MXMA 4A8KA 2QT7A 3MOJB 1DT9A 1YRUA 4MH8A 1UVLA 3OTOJ 2KHOA 2P5OA 2MHNA 2FVRA 2JNJA 3KLHA 3DOKA 3CCLN 5LMUJ 2CH6A 3W3DA 4OI6A 2W40A 5I3UB 3M4XA 1Y7PA 3ZO7A 2D3OR 2LU1A 5ADZA 4ZP8A 4F04B 1OPZA 4O44A 3ITHA 2YI1A 5DM7L 3ULHA 2NRTA 3QEIA 1FEHA 3OVBA 2YX6A 3C6TA 3LP1B 4NLRA 1MU2B 2QKBA 4BC9A 1T7PA 4FBUA 1G99A 4Y3CA 5I4MA 1UZDA 2W8LA 1LK7A 1P1TA 5B0BA 2PI4A 5E41A 2YXLA 2VYPA 2Q6BA 4KJIA 2EC2A 3D5MA 2AKWB 4F4ZA 1VQOS 4MK9A 5HLFA 4PKGA 1OH7A 3AD8C 4L74A 4F3MA 1GAOA 5I3UA 4U6PA 3CJ0A 2D69A 3FCWA 2CQ3A 3D6FB 2D0AA 1KP6A 4M3XA 2DY1A 3W65A 4HDGA 3GMGA 1RBRA 2UXDF 2C3OA 2GS8A 5CQGA 2OELA 5B09A 4DR7K 3NS7B 3LP1A 4H5RA 1MU2A 2BXJA 3RVCA 2DCLA 4ETZA 5J2MA 4YB6A 1OY9A 4GRSA 4OI0A 2JSXA 2HHSA 2NZTA 4M63C 4W5QA 3AHPA 4OI1A 5HRSA 2Z1HA 2BE7D 4ZVEA 1QDUB 2HNYB 3B82A 3H5UA 4I6MB 3EKUA 3ZSWA 3SCXA 4BVPA 1RT4B 4CQ1A 3TUPA 4AQYK 5KT2A 2MKKA 4ZJLA 5AXKA 1RAFB 2B8PA 2E5GA 3CIZA 3CMQA 1ACMB 2EBEA 2B4VA 5DDPC 2PFDA 1HUXA 2JZ5A 3ZTSA 2HBMA 2EG2A 2CZ4A 2WVBA 1VJWA 1RT2B 1UVKA 4DN9A 3L2QA 3PTWA 4YOEA 2D74B 5ETLA 1VQKN 3U3YA 3AVHA 4Z7CA 5AQXA 4O8UA 1C1BB 4ANCA 2YWFA 3CCUS 2FVCA 4M95A 2NXEA 4CT9A 1EXQA 2HNYA 1LKZA 3D45A 2OJ3A 2KHDA 4EMDA 4K4VA 4PKIA 1ZPWX 3EMTA 3BREA 2AYBA 3AO2A 3E8OA 2YWKA 2HHHK 3RWUA 1VQNN 1NPKA 3IGVA 3SI8A 4JI8F 3FZMA 3HSJA 3MURP 2ZJPL 1X9MA 5L8RC 1SIWB 2W25A 1RHRB 1NK9A 5CZ2A 2R7QA 1RT2A 1NHKL 1V3RA 5B7WA 4YN3B 2R9LA 2ASYA 3M8PB 2PMZD 1GX6A 2Z2ZA 1RUSA 4ZVUB 3ZT0A 1RT1B 1C1BA 1R8BA 3QFWA 2M5YA 4DV3F 1RZMA 2VHGA 2EEYA 5EWGA 2VFTA 3O9SA 1FJGK 5HN0A 2PA8D 3ZT2A 1FE0A 3BEXA 4K4ZA 2NQPA 4DXLA 1IBKF 2HG4A 3VQ5A 2H51B 3Q89A 1U4BA 2J0XA 3QO9B 1RGVA 1J54A 2AQ4A 2CPIA 2GWJA 2Z1GA 2WTUA 3EE3A 1BIZA 5H1SQ 3M8PA 5AQIA 5HVGA 3UWTA 4OZJA 2QLJB 4K5RA 4WTYA 1UPMB 3I87A 1U2RA 4ZK7M 1RT1A 3TI0A 3V9UA 2V7ZA 5LMNK 3TPQA 4DX8H 1C0TB 1VIXA 4LF9K 3MFIA 3G10A 4MO5A 2Y9HA 1EQYA 4YR3A 3UCGA 3PSIA 4EO6A 5DMRA 3CJ1A 2QMUB 3LDPA 3VF6A 4RW7B 2CJ9A 4YB1P 3CCSN 2J7KA 1AT1B 3QO9A 4FLVA 2P9SB 3FUYA 5HVHA 1VSLA 4C48A 3DOLB 1XR6A 1FDAA 3T1HK 2I6WA 4USTA 4IKAA 3VAMA 3DLEB 5KFUA 1PCAA 2WRMA 4YDDB 2ASLA 3AJDA 3CQ8A 2DGQA 2A2CA 1C0TA 4IJAA 3ISZA 3LAKA 3EGNA 1BY9A 4JI8J 1I1GA 2CAJA 1DBDA 3C8YA 4LRBA 5EGYA 3OD2A 4RW7A 3QYYA 1JLEB 5L9NA 2GAHC 3K17A 4CEAA 1DQAA 1RI7A 2DTUA 1U45A 4ED3A 1NK6A 2P9SA 2DGXA 4X66J 3P4IA 2E2QA 3DOLA 2CG4A 4Y2CA 1HI8A 5HJXA 2VCPA 4DV3J 2DPIA 3W63A 3A5MC 2MQPA 3CQYA 1F60B 3DLEA 1ATSA 4NXMK 1NGIA 2A3ZA 1OQ3A 1PJ7A 4XPCA 3PFEA 1DQ8A 3BO4A 1VLYA 3DM2B 3MMBA 1ZAXA 4HT7A 2I9SA 1IBKJ 2KU7A 5M2PA 1DARA 1D9AA 4H0XB 4F3TA 5M1FA 4BRAA 4IOAL 1HHTP 2P6TA 3OYCA 1HBUB 3HPGA 1TK0A 4GV9A 3OTCA 4JV2A 3PG9A 3DGPB 1L3TA 3NKYA 4LF7K 1T9VA 1UL3A 1VSMA 5LJVA 4DMZA 2FZCB 5KFLA 2HHUA 3J81O 4P7TA 1FFGB 3TW0A 5L38A 3KKSA 1JLQB 3JQKA 5A8RB 2FY1A 2XMJA 4P2FA 2BOPA 4LH4A 2Y1IA 2FUG9 1YJ7A 5BREA 4IOXA 2W41A 4X84A 4DTMA 1Q16B 4OV6A 4YOXA 2LA6A 3LA0A 1W2BR 1U47A 2YV0X 1PAUB 5D3GB 1IO2A 1KXPA 3DM2A 1UJ4A 5KFSA 1QVFR 1LW0B 1NPPA 5CHIA 2V4JB 1C1CB 4QAGA 3M9OB 1VQLS 5KFHA 1BLUA 1KHWA 2QFIA 3TR8A 4CHZA 3DGPA 3FEYB 3KLIB 4CK1A 1DRZA 4OPHA 3T19A 2OD6A 1BUPA 4LF5J 1JLQA 2XZDB 5A8RA 5CABA 4LUBA 2VA3A 2XG8A 4CBWA 2RE1A 1S72N 2CPYA 2E2OA 1T6CA 2MZTA 4B8CA 4O3RA 3PW4A 3OV7A 5ITHA 1S97A 2Q1NA 1V9OA 3WQPA 2FZGB 2FSKA 2UV8G 1TR0A 5DDQC 2V4JA 1IUJA 3F73A 1C1CA 1DTQB 3G82A 4JKFA 2F7VA 1YX2A 5JUMA 4ICLB 4BREA 4CYUB 1NO8A 3CD6N 4DR7F 3KMSA 3KLIA 3FFIB 3UI3A 5HBMB 4DZDA 1J5EK 3M8RA 2A5XA 1Q8LA 5CA5A 3CIPA 4PY5A 2DFFA 2JGUA 3NFAA 3W2VB 1DURA 2FB0A 4LRFA 1WI8A 3H0PA 2RVJA 5CZXA 2V2KA 3O08A 4FDFA 4E98A 1ITPA 2FLLA 4DLGA 4L75A 1SUQA 4LY7A 1HFEL 5C10A 1WG4A 1RGIA 2CVIA 4UW2A 2CUYA 1MN9A 4JYAF 3U1LA 5IWAF 1DTQA 5JJBA 1NCLA 2CDQA 3V6KA 3PO4A 4ICLA 4CYUA 1NGEA 4DL6A 1HW8A 1W7AA 5HMZA 1BOTO 5D4NA 3FFIA 1Y5LB 3OHRA 5HBMA 4KB7A 3QFUA 4ZIVA 1KTVA 4QIGA 3RR7A 1TK8A 5H1SV 3CJKB 3UNGC 4AXJA 3HZ6A 4DL5A 2ZBIA 8RUCA 1KQFB 4FJGA 2MZSA 1RAJA 2DGWA 2A42A 2CNNB 1JWWA 4G1PA 5DQHA 3NHGA 4CGGA 3OYHA 3P38A 1VQPN 3NL0A 3HZEA 4H5NA 3AGRA 2DR8A 4CLKA 4LFCK 2D3UA 3SCJE 2PYLA 4FWKA 1QUVA 3AY0A 2R7VA 5ETRA 1UJ5A 1TMJA 4PEOA 2DPNA 3AD7C 3KG0A 2LCWA 3EY1A 3AB4B 1XNRK 2QMXA 3LDNA 1HWLA 4LRCA 3VEXA 2OZSA 5DDOC 3CJKA 4I9QA 2DH8A 4M45A 4ECSA 1ASUA 3VQBA 1NJYA 3HOTA 4Z2XA 2ZDPA 3WX4A 2E1ZA 2F65A 1BQMB 4L6V3 3W62A 4CD3A 3D1OA 1MN7A 4IEIA 3GV7B 3N6LA 2HURA 4JKBA 3HRGA 3CDEA 4DR7J 2MEWA 1V5IB 3ZXWA 2FVSA 3RYLA 2IC3B 4DJBA 1LNQA 5JMNA 2AJQA 4ZLLA 3U9ZA 2N4DA 3CMAN 2W2QP 4X4NA 2VQEK 1SC3B 1U2VB 2YX4A 3H90A 3D6TB 4WP9A 3VGTA 4WF9Q 2NREA 2ITMA 1SBRA 3RMBA 4LF9F 1YTAA 4AQYJ 1BQMA 1BE4A 3A8JA 3HKZD 3LF0A 4JYAJ 5E5NA 5IWAJ 3RMCA 2DK2A 5KFRA 2EKNA 1VQ7S 4G9ZA 4M63A 1OVQA 3G86A 2ETJA 1M5VC 2ZWPA 1UAWA 2A41A 3KG4A 4KYZA 2KM8C 3ENWA 5ETNA 1X4GA 2I1RA 5DRKA 3OBWA 4FVUA 2M9KA 3GLJA 1U2VA 4ZVPB 3E01B 3GYXB 3AV9A 2HHWA 1VQON 5IC6B 4B9QA 3TU5A 3EZWA 1H73A 3OYGA 1KAZA 1BIUA 2GA7A 2HSEB 2F8TA 1BD6A 4CLUA 3BSCA 2HHHJ 4GVBB 3N6MA 1N5VA 3G6XA 3QBWA 4E7LA 4KO0B 3A4TA 2MXYA 3BPSP 3M6UA 3BO3A 1YF5L 4F0MA 4YOWA 2YHWA 2KHCA 2XRIA 4M5JA 2YHYA 3ZX0A 2KG0A 2RDJA 1O0PA 1K44A 4E7IA 1I94K 4PABA 4K4SA 3ZSRA 4DR2K 3PHTA 1VSKA 4F36A 4C9DA 1RWNB 3TAQA 2E1RA 1WKLA 5IQ6A 4FM1A 2V50A 2LMIA 2ZUAA 2PY5A 3E01A 4LF4K 1U1LA 3VAJA 4NXMF 4RTFD 1VQYA 1WEYA 1X9SA 3K0JA 1FJGJ 1ZZFA 3H40A 4ID5B 2OO4A 1LQ9A 2V8DA 1UVIA 4ANDA 4ED4A 2V2VA 4GVBA 3MEDB 1U2FA 3JS6A 1YKWA 4KO0A 4YR2A 1CEZA 2BKOA 3BH7B 4B1YB 3DJCA 3W0LA 2J6TA 1KN6A 3PIOL 2ZGYA 4TY8B 2B7BB 4IYQA 3SIPB 4CJ4A 3L4BC 5KOWA 4N76A 1JCEA 2BE2B 1U1OA 3EZ5A 3KMQA 2G8IA 2J8AA 1S1WB 2GCFA 4FM0A 4DQQA 4LF7F 1YBAA 4CLFA 2ATLA 1FKPB 3CCUN 3NWGA 5LMNJ 3OBIA 4KHNA 1B9FA 2XMWA 1VSHA 3H5YA 4LF9J 3IWLA 3VZIA 3L7PA 1K1QA 1OS5A 2Z0GA 2ZNYA 3CB4A 5AZIB 2GO8A 4G1IA 3FGVA 1TZ0A 2IM2A 1KQSR 3HTVA 2G8KA 2FHJD 4CEQA 4NYPA 1S7HA 1YZ7A 3MEDA 5HANA 4JI2K 3IS9B 4BROA 2HFSA 5IT9Y 4DR5K 2QV6A 1IJEB 4TY8A 4LIRA 4ED7A 2BE2A 1QSYA 5HRRA 1JLCB 3ZLJA 3QNWB 1S1WA 4QOZB 2DB1A