1RT7A

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
536
structure length
535
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 139
structure length 535
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt7A05
4N47A 4H4MA 4TY9A 4NLQA 4Y34A 4DEZA 1XHXA 1HPZB 4FZXC 5DLGA 4ZHRB 1U09A 4FJ5A 4QCLA 4NYFA 2CJQA 4MQ3A 4Z4FA 3V81A 3OLAA 1IKXA 2BGGA 3PX6A 2W7OA 1VSLA 4DF8A 5F8HA 3HM9A 4FJLA 1T8EA 4DL4A 3BGRA 3F73A 5F9LA 1Q9YA 3CO9A 4FJKA 5KT3A 3DOLB 2XGQA 2J6TA 3DRPB 3KHRA 1RTJA 1S49A 3I5BA 3OS1A 3TQ1A 3KK2B 4NLVA 2HB5A 5DGAA 2WONB 2R2TA 1QTMA 1ITGA 1FK9B 3FFIB 1ZBLA 3VQ4A 3PO5A 3PR4A 4NCGA 3NE6A 3RAQA 3V9SA 2FBYA 2VG5B 1ZBUA 4TLRA 3BR9A 2JEFA 3ZSWA 1T03A 1RAJA 3KNAA 3OYLA 5KFJA 4CJSA 3MR5A 1X9MA 2IM2A 4K4VA 4E7JA 1C1BA 1NK7A 2IOCA 4DSKA 5CYQA 1SKRA 3DLKA 4IRCA 3T1AA 4RNHA 3RBEA 5EUHA 3OL7A 3MAQA 3NGZA 4KE5A 1S1UB 4M3XA 3AVBA 3C6UA 1F21A 5J1EA 3G86A 1HNIA 5F8LA 2R2UA 4C8NA 2G8UA 3O4QA 4FXDA 5FDLB 4FLWA 1JXLA 2BQRA 5FDLA 4J2BA 5HROA 4HYKA 4JV0A 5KFWA 3CDEA 2ILZA 1G15A 2OYQA 4B9TA 4ED0A 3OYMA 3LAKA 3KLEB 4BE0A 3NAIA 1LWEA 4B8AB 1HNVA 1TKTB 3AVLA 2FLLA 3ZSXA 3HT3A 4U6PA 2VG7B 1KCFA 4CF1A 3IG1A 1LW0B 3L2WA 3CVKA 4M3TA 1WNSA 1HYSA 4E1MA 3RR7A 2PYJA 1EP4A 1RNHA 2WRMA 3H5XA 4Q45A 2FVSA 2KFNA 4KB1A 1T05B 4FJGA 1JX4A 1VK0A 4IDKB 1FKOA 1S6QB 4O4GA 4MFBB 3MR2A 4LH5A 5KT7A 4CJ5A 1VRUB 2ETJA 4ZP7A 5DGBA 4FCYA 3M8PB 1RTJB 1SH3A 3ZSOA 4B9SA 3DOLA 4K4XA 3CM6A 1L5UA 3TANA 3BGRB 4DS4A 4WE1B 4PY5A 3NCIA 1VSHA 4CJQA 1W25A 1BQNA 3OS0A 3L3VA 1RT7B 3BJYA 4G1QA 1TV6B 4TQRA 5C5JA 2UUWA 4ZPBA 1S9GB 3HPHA 4RZRA 3LP0A 3AO1A 1D0EA 2P1JA 2I1RA 2HNYB 1U4BA 3T19A 3CG7A 3VQPA 3RMAA 1JLBB 2Q3SA 3SYZA 4Q43A 1FKPA 4BACA 3IG1B 4DQSA 3HVWA 4G3IA 3AV9A 3NF7A 3NAEA 3RR8A 2G8HA 4BE2A 1C0MA 3QZ8A 1JLQA 2ITGA 4CHZA 3MEDB 4HVJA 4CJFA 4ECQA 1QUVA 4NRTA 4CJ3A 3EZUA 3AVIA 4KBIA 1R0AA 1BIUA 1I6JA 3NDKA 4E0DA 1S1TA 3H5YA 4ICLB 1S1XA 3GV7B 3GIKA 3E51A 5DLFA 4O55A 1GX5A 3BDPA 4CEOA 2HHQA 2DFHA 2ATLA 1S1WA 1HMVA 3VQ9A 3VQBA 4M3YA 4EZ9A 1S4FA 4CE9A 1MMLA 3UIQA 3AVMA 4LH4A 1U47A 2R2SA 3U6FA 2OZMA 4F2RA 2D3ZA 4RW7B 4F4KA 5KTQA 1RT3B 1VRUA 5JUMA 2R8HA 4FJHA 2NUBA 3JSMA 3QEIA 1S6QA 4O4GB 2WK4A 1VSEA 5DK5A 2Z1HA 1J5OB 5CYQB 3PW7A 1XR5A 3KLFA 1WLJA 3KOAA 4DFJA 5I42A 1RT4A 4FS2A 5KT4A 3LP2B 3S3OA 4LY7A 5KG0A 3PW2A 1T03B 4B9VA 1KVAA 2CKWA 5KFRA 3V1QA 2X74A 2IA6A 1RBRA 4IBNA 3GV5B 4TQSA 2YNFB 4CGIA 4E7IA 4FK0A 3DMJB 3MEGA 4FM0A 2OZSA 1QHTA 3GIJA 4M42A 4EBEA 1TKTA 2QE5A 3PO4A 2BE2B 3T5HA 3V6DB 1KVCA 4NYNA 2GV9A 2FJXA 4M41A 2ZE2A 1BL3A 3MFIA 1TVRB 1LV5A 2HHWA 1NJZA 3M8RA 3KMSA 1QQCA 1YVUA 3SV3A 1EETA 2VA3A 2ZKUA 1UOCA 4ED6A 2D0AA 4UQGA 3H4DA 3L2UA 4H4OB 3KHHA 1GOCA 4DTRA 1KSPA 4ED1A 4RNFA 3VA3A 3OYDA 4ZHRA 3ZT3A 2OPPB 4Z0UA 3RB6A 4RW9A 5JS2A 4LQ3A 4CGGA 1N5YA 3KHLA 1BGXT 4DQRA 1RT3A 4DTOA 3NFAA 4I2QB 4DL7A 4FW2A 1C1AA 2ILYA 4H8KA 4DSLA 3TAEA 5KG4A 1TAQA 4WE1A 2BDPA 3PZPA 3TAMB 3I5CA 1S1WB 5K14A 4RNNA 4MKAA 2G8IA 5KT5A 3QIDA 1U04A 3DI6B 4NLGA 4EEYA 2EX3A 4PWDB 4IDKA 4ECUA 3ICLA 3PW4A 4QWEA 4M95A 4DL3A 4FJJA 3H40A 1HQUB 3WNFA 1R0AB 5KFKA 1S6PB 1BIZA 4ZTFA 1KVBA 4TY8B 4FW1A 3C95A 3D28A 3DRSB 1IKWA 4M45A 4NRUA 4W5RA 3EY1A 5KG5A 1JLBA 1HQEA 3GYNA 4DG1A 4C8LA 1HNVB 3T5JA 3NH1A 4MIBA 2WOMB 1ZTTA 3MECA 3AO3A 2KZZA 3SPYA 2WOMA 2IJNA 4E1NA 1RA7A 3SI6A 2I5JB 2C28A 3HO1A 5KFUA 2QKKA 4I7FB 1KFSA 4Y2AA 4CGFA 2QKBA 4RNOA 3IRXA 4FK4A 1T3NA 5KFSA 1D5AA 4YNQA 4EO8A 5HRPA 3NMAA 4ED7A 4CJUA 3CFOA 4AHUA 2FBXA 3OYHA 3C6UB 3TI0A 1C0TB 1HQUA 1I3AA 1X1PA 4DQPA 4NCBA 1NNDA 4DFKA 1MU2A 3AO4A 4OKEA 2IAJA 1C1BB 4ID5A 1RT2A 3BSOA 2JEIA 1JLEA 3EPGA 4HKQA 2W9CA 1QS4A 4OGEA 4R8UB 5FRNA 1TKXA 1LW0A 1VSMA 3TAMA 4R8UA 4DLEA 3LP2A 1KHVA 1JLEB 4AHRA 4IG3A 1BQMB 3ZT4A 4ECTA 3V6HA 1TL3A 1FK9A 4NLPA 3I8DA 3WNEA 4FLYA 4KSEB 4KPYA 2XI3A 3QIPA 4YR3A 3NBPB 4WXOA 4J2DA 3TARA 1TL1B 4URGA 5HROB 3AA2A 4K4YA 1JL1A 2GIRA 5CYMA 2YNHB 3KHGA 3MXMA 3MXJA 3HSTB 2G8WA 1JLFA 1TKZB 4QAGA 4FJ7A 3QERA 4KO0B 4E7HA 3K5OA 4PA1A 4ZPCA 5KFIA 5KFYA 3ZSVA 4CFDA 2P5GA 2DPJA 4FJNA 3V6DA 3S3NA 5L1LA 4NLOA 4OKKA 2B6AA 4C8KA 3D0PA 1IKVB 1SL2A 1J53A 4JV2A 2VG6B 1K1SA 2R2RA 2YNFA 5J2NA 3IS9A 4OVLA 1CLQA 3WNGA 4O3OA 4RUAA 3G6YA 3ZT2A 4EZ6A 3SQ2A 2PY5A 5KG6A 3O3GA 3HP9A 2OPQA 4O44B 2HNYA 3TAQA 1J5OA 4O3NA 2LSNA 1K1QA 4CERA 3DI6A 2D7SA 3NGDA 3ZT0A 4J9QA 3H5UA 2YKNB 5EWFA 4KV8A 5CY4A 5HLFA 1RTIA 3U3YA 1D1UA 3OYEA 1LW2A 3OYFA 4OKJA 2DY4A 4DTSA 3ITHA 3KLGA 2VA2A 1BI4A 3DM2A 4C8OA 4DQQA 4CFAA 3M8PA 3SFGA 2QK9A 3ZSQA 5KFXA 3OYAA 4OGCA 3LDSA 4CIGA 2ASLA 2AGOA 4CF8A 1VSKA 3G6VA 1NJXA 3PVXA 4H4MB 3NL0A 2J6UA 3TABA 2XWYA 4FLVA 1SUQA 5KT2A 1NK8A 4FJMA 4QWCA 2DPIA 2HMIB 3RMBA 1JLQB 3FRZA 4CFBA 5KG2A 4U7CA 4O3SA 1S1VA 1QSLA 4IQXA 2G8VA 3AVNA 3OL8A 3KLIB 1JLAB 4M3RA 4TY8A 4F4WA 3RRGA 2AGPA 2WTFA 3ALYA 3M8QB 1K6YA 2Z1JA 3PW5A 2D0BA 3DLEB 4PWDA 1RT1B 4DU1A 3NF9A 2OPSB 1RDDA 4NLYA 1L3UA 3VQCA 3QO9B 1S9FA 1S9GA 3SUPA 1UA1A 1ZYQA 3Q8PB 4MK8A 2ZQBA 1RT7A 2W42A 3OLBA 3EYZA 3H08A 5DG7A 5CYMB 3VQQA 4ELUA 5L9XA 3AA3A 4IRKA 1VSFA 3P83D 3V9UA 1S10A 5KFTA 2E9TA 3QINA 5J1EB 5HP1A 1CZ9A 2DTUA 2HVIA 4EBDA 4FJ8A 1TAUA 3MXIA 5HRSA 4N5SA 2BR0A 4IFYB 3FDSA 4M3WA 4YMEA 1BCMA 1TL3B 2E4LA 1BHLA 2RKIA 5CZ2A 4DTMA 4K50A 1O1WA 3OVNA 4QPXA 3GQCA 4WFYA 1WN7A 5KFQA 3D45A 4E3SA 3HHKA 4CJLA 4EYHB 2JEJA 2EC0A 4CJRA 4J9PA 3N6NA 1UWBA 3HXMA 5KFZA 4BWMA 4TXSA 1XC9A 4KHNA 4CGDA 2QXFA 1RTHB 4ICLA 3K57A 1KFDA 3OHBA 4CHPA 4DTJA 1OS5A 1VSJA 3TAFA 4FJ9A 4Z4IA 3DLGA 3EZ5A 4B8CA 3VQ8A 1UWBB 4CF9A 4ZVEA 3OHAA 4FZYA 4O3RA 5C42B 1DTQB 1HYVA 2GBZA 5KFBA 3V4IA 1YVFA 3BSAA 2R8KA 4DSJA 3KTQA 4Y1DA 2E6LA 3MECB 2EHGA 1S48A 2C2DA 2RN2A 2KZMA 3OYGA 1LWCB 3BQ2A 3OYIA 4E19A 2IDOA 2HHUA 3MTKA 3K5NA 1RBSA 4IG3B 5F8JA 1HYZA 3QGHA 2IM0A 3N6LA 4Z4GA 1JLGB 4PUOB 4J9SA 2C2EA 3HPGA 3QESA 3OYBA 1D9DA 4F3TA 4FM2A 2FJWA 4NZ0A 5DMRA 4AHCA 3I0SA 4IH5A 2VWJA 4EBCA 3K5MA 2GC8A 3KK1A 1TKDA 2V9WA 3QO9A 4ECWA 2YV0X 4TYBA 4M3UA 1U49A 2XCPA 5KG7A 3AVFA 3TAPA 4CHYA 4Z4EA 1RBTA 2W9BA 4QW8A 4ZP6A 3AO5A 1N48A 3OY9A 3K58A 4CF2A 2FJVA 1IG9A 4KHRA 3SPZA 3IRXB 4ECSA 5J2QB 1RILA 1ASUA 4LSLB 4E7KA 5E41A 4FS1A 1IKVA 2Y1IA 4B9LA 4MIAA 1LWFA 4J9LA 3UR0A 1HJRA 4OJRA 1DTTB 2E9ZA 4CEZA 4JLHA 4YQWA 2F8EX 4I2PA 1DTTA 2FVPA 2AX0A 4EO6A 4R0EA 3EPIA 1JXEA 2AGQA 4HCCA 3OJUA 4QWAA 3QYYA 4NLSA 4HCBA 4LSLA 2YNGA 1NK5A 5J2PB 1XWLA 4FBUA 1YTAA 1DLOB 5KRTA 1TL1A 2X6NA 4HUEA 2G8KA 4MK7A 4IG0A 1S0NA 3E01A 2XHBA 4ELVA 1SH2A 1SL1A 3G6XA 4NLDA 1KRPA 4F4XA 1QE1B 2FBTA 3CM5A 1RDRA 4CESA 5J2MA 1FKOB 3JYTB 4IOBA 1L3VA 2ZD1B 1EX4A 3LWLA 2X78A 3QEPA 1C0UA 1REVB 4CJKA 1ZTWA 1ASVA 4CJWA 2RF2A 1HYSB 1TK5A 5KFEA 3KK3B 3B6PA 1NKEA 2IS3A 1L3TA 4KFBB 3CFPA 3H4BA 4IH7A 1SKWA 3SQ1A 1KLNA 2VG6A 1W0HA 4ID5B 4NLXA 4MK9A 1WSEA 1WSIA 4N56A 3S9HA 1UAXA 2WHOA 4KI6A 2PZSA 2XC9A 3KLEA 3BQ1A 2HHXA 3RRHA 3ISNC 1FXXA 3I0RB 4DS5A 4B3OB 3T5LA 3SCXA 2KTQA 1EETB 5CZ1A 4JS5A 1J54A 4K4SA 3NF6A 2GIQA 3AVHA 4E89A 4WYLA 4CJEA 1NHVA 1NK6A 3GV8B 4I7FA 3ASMA 4Y3CA 3DLGB 3MR3A 4I2PB 1RT1A 4CEEA 5F8NA 4IR9A 1S1TB 3RB0A 4AH9A 3Q8SB 2UVWA 4ZP8A 2JEGA 4DLGA 1BQMA 1IKWB 4ZP9A 4Y1CA 1BCOA 1ASWA 3SQ0A 3NH2A 4CFCA 4DL6A 1C1CA 4ZPDA 3OL9A 4LSNA 1RDCA 5KFOA 1X9WA 2F96A 5F8GA 2VG5A 4CECA 2W9CB 4WFXA 2D0CA 4OLAA 3IGVA 4FJXA 4NCGB 1QAJA 3ISND 3NHGA 3IGNA 5C25B 4Q8EA 4CHNA 1ZBHA 3JYTA 2OPRA 4XPCA 3V1OA 4K4TA 3UQSA 3MEEA 4FM1A 3V9ZA 3V6JA 1TP7A 3OJSA 2HHSA 1CXUA 3RB4A 1S9EA 5EU7A 4RW8A 2D5RA 4RW7A 4URQU 4F50A 3O4NA 2HHTA 3ITHB 3KLGB 3PUFA 4PUOA 1DLOA 4GC6A 2B5JA 1C6VA 5KGWA 4WXWA 4NLRA 4KTQA 3SI8A 3SUQA 2YNIA 3CDUA 1S9EB 2IMWP 4R5PA 3V81B 4IR1A 1ZETA 2IJFA 4Q5VA 2AU0A 4RG8A 4J9OA 3BREA 3KLVA 4K4WA 4WZQA 2WB4A 4X2BA 3NH0A 2BRKA 2OPRB 4O3QA 4OL8A 5C25A 4JRQA 4M94A 2BRLA 3DLRA 3OL6A 1N6QA 4DG1B 4H4OA 2FC0A 3VQDA 1LAVA 1JLCB 3BSCA 4CGJA 4HHTA 3QGGA 1DTQA 1RT5B 1JKHA 2DFFA 2E6MA 3KKSA 2HAIA 2HNDA 1RDBA 1RA6A 1HRHA 2HWIA 1YT3A 5KFHA 1TK8A 1S6PA 5T14A 2A1RA 1N6QB 4K8ZA 4ZVHA 1S97A 1TGOA 3T3FA 3MR6A 3KJVA 1SV5B 3M9MB 1Z4UA 4HTUA 3LZIA 2FBVA 4K4ZA 1KHWA 1NK9A 3DMJA 2O4GA 3QLHA 3KLHB 4FBTA 3IAYA 1BQNB 2XGPA 3H98A 1BISA 3H2LA 2ALZA 3ZSZA 2C22A 1RT6B 2GUIA 1QSYA 4YR2A 3I0RA 3CJ0A 5I42B 1RTIB 2J6SA 3KLFB 4KV8B 3OYCA 4CJVA 4L8RB 3SUNA 3RBDA 3SNNA 3CQ8A 4KKOB 3BSNA 3QZ7A 4KAIA 3JSMB 1UA0A 3SJJA 4MH8A 3MEEB 4KKOA 4WYWA 5DG8A 2HNZB 1NJYA 2W8LA 3SQ4A 2FVRA 5HBMA 1D9FA 4ECRA 1EP4B 4KAZA 4FLZA 3QETA 2XY5A 3PR5B 4J9RA 4CK3A 1IKYA 4RW6A 4LSNB 1TKXB 3PJWA 1Y97A 4FLXA 5D3GB 2B43A 3OYJA 2HWHA 3IS9B 2RF2B 3A2FA 3FSIA 4EYIB 4TYAA 1TVRA 1ZBIA 4CEAA 1GX6A 2V4RA 4DTXA 3M9NB 2RDJA 2R8GA 2P51A 3NGYA 3C6TB 3LANA 3AVGA 4ZTJA 3KKRA 4KO0A 5F8MA 2XCAA 2R8IA 3GILA 3HVTA 3Q8RB 4TSXA 3RAXA 2V4QA 1L3SA 1JLFB 3RWUA 2KQ2A 2Y1JA 2UVRA 3DRRB 4AHTA 1RYSA 5L1JA 4JUZA 3ULDA 2Z1IA 3G10A 4URSA 1RT5A 1NK4A 1IKYB 4RW6B 2HMIA 1A5XA 3HK2A 4CGHA 1WSJA 1U45A 1W9HA 3LP3A 4B3OA 1D8YA 4NLTA 2JC0A 1NJWA 2IC3A 1WAJA 2HHVA 3HPOA 2HNZA 4DTUA 4MKBA 3PJXA 3SUOA 4I9QA 1I39A 5KFDA 1VRTB 1LWFB 4O0IA 1TV6A 5HP1B 3CJ5A 3LPTA 3VQAA 2HVHA 3TAGA 3DM2B 4BDPA 1BI4B 4N41A 4KI4A 2B5JB 4QW9A 1JL2A 4ECYA 1S5JA 2HW3A 4KTZA 3LPUA 3KIOA 4I9LA 4CEFA 5FROA 4BDZA 4DL5A 1KTQA 4DTPA 4C8MA 4F8RA 2R8JA 2O5DA 1RTDB 4Q44A 4MFBA 3QGIA 3KJVB 3FFIA 1JIHA 3DLEA 3M8QA 2KFZA 2JGUA 3D5MA 5KFMA 3UDLA 4WZMA 3I0SB 5T7BA 4DSEA 2IM1A 3KLIA 1KLMB 4KREA 5DQGA 2YKMA 1C1CB 4DTNA 3DOKB 3HKWA 1IM4A 4DQIA 3IN5A 4IKAA 1IH7A 2UVVA 3PV8A 4CEQA 1VRTA 5KG3A 2W9AA 2ASJA 4B9UA 3CWJA 4ID1A 2OH2A 1HQEB 5KFAA 4G1QB 3GIMA 2YNIB 3AA4A 2AX1A 5C42A 4OPKA 5KT6A 3H59A 4ECZA 3LP1A 3VN5A 1KLMA 3MFHA 4YP3A 3VQ6A 1HNIB 3HVTB 1EXQA 5HLFB 5KFFA 3QIPB 2W9BB 1VSDA 2ZE2B 1NHUA 4NCAA 4ECVA 4K8XA 1ZBFA 4BWJA 5EWGA 2BE2A 3DLKB 4ECXA 3PW0A 5KI6A 1T05A 1LAWA 1T94A 3RB3A 1RBVA 3I5AA 1XR7A 4QWDA 3P5JA 4OLBA 3QEVA 3M9OB 5KG1A 4H54A 4W5TA 4CF0A 3VQSA 5K14B 2W8KA 4KFBA 3V1RA 3FQKA 4ZPAA 4CIFA 2A1SA 4RUCA 3DLBA 1REVA 1C0UB 5HBMB 2C2RA 4JRPA 4N76A 4I2QA 2ZD1A 1N5YB 5J2MB 1NKCA 3K5LA 4OPJA 4DFPA 3V9WA 1X9SA 2IC3B 4Y2CA 4Z4HA 1NKBA 2AQ4A 3V4IB 2F8SA 4KHUA 3AVJA 3SFUA 4DMNA 3PHEA 2YNHA 3OYNA 5HRNA 2YNGB 3CYMA 1IKXB 1Z25A 3SZ2A 3VQEA 4KHYA 2I5JA 2V0NA 1S1XB 4CK2A 1SV5A 1B9FA 3NKYA 3C6TA 2IM3A 1CXQA 3QEWA 2WCXA 1HPZA 5KRSA 3CIZA 3HVAA 3MF5A 4RW4B 3PY8A 2XY8A 1N56A 3U3GA 2D3UA 1TQLA 5C24B 1Z26A 1JLAA 4IH6A 2XRIA 5KFVA 1NK0A 4O0JA 4JV1A 3TVKA 2FLNA 4B9NA 5D3GA 4FLUA 5KFCA 3PX4A 3L2VA 4Q0BA 1JLCA 1XHZA 5I3UB 4DSIA 3BQ0A 5DQIA 3UPFA 3WNHA 2BANB 3N6MA 1RDAA 3KMQA 3OS2A 1U48A 4ED2A 4XIUA 1MU2B 3QNOA 2WONA 1WSHA 1RTDA 3KK2A 1C0TA 3T5KA 1NOZA 3HVRA 3C94A 4AILC 3AVCA 2R7YA 3DYAB 4IKFA 4IG0B 3CFRA 1A5VA 2Z1GA 3QEXA 3CJ3A 5SWMA 1RT6A 3O3HA 2QV6A 4CK1A 3LALA 4ZVFA 4IFVB 2XY7A 3DYAA 3KLHA 2YKNA 2ASDA 3NAHA 4RW9B 1WNEA 3CJ4A 4XO0A 2OPPA 4TN2A 4J9KA 3RMCA 4GC7A 5EWEA 2W7PA 4CEDA 3TWHA 4FJIA 2B4JA 4FVMA 3KD5E 3DRSA 3AVAA 5KFPA 1QSSA 4DL2A 2RPIA 2VG7A 3DRRA 5J2NB 4Z4CA 1JKHB 5F8IA 2ATQA 1SL0A 3KD1E 3OSNA 1JXBA 1N4LA 3SV4A 1SUQB 1Q9XA 2B6AB 4B08A 4W5QA 3O3FA 4RW4A 4DU3A 2PYLA 4CJ4A 3VQ5A 5HRRA 4CCHA 4KHWA 2IGIA 3HL8A 3RTVA 3AA5X 2BQUA 2RDIA 1T7PA 4FLTA 4FYDA 5JS1A 4PQUB 4F3OA 4YR0A 3AO2A 4NLUA 4R5PB 4CHOA 1SKSA 4LD0A 4IFVA 3GIIA 4Q8FA 4J2AA 1WAFA 2XI2A 3LAMA 1JLGA 2DFEA 4DSFA 2XO7A 1RT4B 1S0MA 4AHSA 3M8SA 3OSPA 3H5SA 5L1KA 4AHVA 2RKIB 4KTWA 2BQ3A 1CZBA 4O3PA 1LWCA 4ED8A 4IRDA 2KW4A 2AJQA 3VA0A 1CSJA 3L2RA 5KFNA 5KFGA 3V9XA 1J9AA 2BANA 4JS4A 3P1GA 2G8FA 3LWMA 1RBUA 1EKEA 1SH0A 1IO2A 5I3UA 3KK3A 2IBKA 3F9KA 1HMVB 4O5BA 3QLHB 5KFLA 1QAIA 4B9MA 4EP5A 4F2SA 1WSGA 4CIEA 5JXSA 3PX0A 2YHAA 4PQUA 3CDWA 3DLHA 3V6KA 4GMJB 2OPSA 5KGXA 3S3MA 4RNMA 3OYKA 5FRMA 4ELTA 3G0ZA 4KB7A 4W5NA 1LWEB 4O4RA 5L1IA 2UUTA 2UVUA 1VSIA 1S0OA 4XPEA 1B92A 3AVKA 1RTHA 4NYZA 4QOZB 3MEGB 3DRPA 5DG9A 1WSFA 1TKZA 1GOBA 1XI1A 3K2PA 4RU9A 3HJFA 4KHMA 3LP1B 5F9NA 1RYRA 1S1VB 3QNNA 4LQ9A 5J2PA 5SZTA 4YFUA 4HUFA 4NLWA 3QIOA 2D41A 1GOAA 4CEBA 3HP6A 2P5OA 3THVA 1TK0A 2F8TA 4ZMMA 4F4ZA 3B6OA 3NBPA 3NGIA 3RMDA 2JC1A 3VQ7A 2O4IA 1S1UA 4HUGA 4ZVGA 4E7LA 1HARA 2AWZA 3LP0B 4W5OA 2OA8A 4IFYA 4M3ZA 2YHBA 1YTUA 4CJTA 3HYFA 4KRFA 4BDYA 3ZCMA 5J2QA 3DOKA 3K59A 4F4YA 3ZSYA 1LW2B 3DDKA 4EP4A 2YKMB 4KHSA 3L8BA 3CJ2A 4GVMA 4RW8B 4DF4A 4GW6A 1XR6A 1RT2B 2JLEA 1C2PA 4CHQA 4K4UA 4QWBA 2IAJB 4BE1A 2FVCA 4DU4A 4J2EA 4DFMA 4FZZA 2OPQB 1QE1A 4O44A 3ZT1A 4ED3A 5DQHA 3KK1B 4WFZA 4KHQA 2E9RX 3NF8A 1NOYA 3E01B 2FVQA 2FLPA 4Q0BB 3MEDA 3LZJA 4FK2A 2VWKA 2HNDB 4J9MA 2XY6A 2X6SA 4J9NA 5EDWA 4KB0A 3ZSRA 1B9DA 1Q8IA 1RCHA 3L2QA 1FKPB 5C24A 3FQLA 3TR8A 4DWIA 3Q8QB 1A5WA 3L3UA 4CJPA
chains in the Genus database with same CATH superfamily
4NLQA 5A8RB 4DR4J 1HPZB 1X5OA 4FZXC 4Z2XA 1EJ7L 3JTNA 4ZHRB 2VYPA 3TRGA 2FGCA 4FJ5A 4GKJF 2E1YA 4BROA 3NCPA 4KBOA 3GOIA 4QCLA 4NYFA 2CJQA 4DV0J 3G4SS 3UKUB 3MD3A 3UVJB 3V81A 2ZUAA 2ROGA 3C8YA 3HM9A 5F9LA 3CO9A 4FJKA 3T6JA 3TSPA 4KR0B 3M6WA 5ETKA 2J6TA 3LDLA 1HD0A 1FD2A 1RTJA 4A2AA 3KK2B 2WONB 4JV5K 4LFBJ 1FK9B 1ITGA 4NLCA 4IZ9A 1MWYA 3ENWA 5H1SV 3WX8A 4NCGA 2RQMA 4TLRA 1N8RO 5BR8J 1V4SA 3ZSWA 2QA4N 5F0WA 2VZ9A 3OYLA 4CJSA 4P52A 2ZZNA 4E7JA 1Q53A 1C1BA 5CYQA 1SKRA 4RUHA 3T1AA 3T7ZA 3OL7A 5CA5A 4FKXA 4A61A 1FFWB 3IUCA 4KE5A 4BRPA 5AE1A 3F9MA 9ATCB 2G8UA 5F0UA 3P8BB 1BG3A 2K06A 5JVGL 2BQRA 5FPEA 2AP6A 3SQGA 1PJ7A 3ZZZA 3CB4A 1M5OC 5AE3A 3ILJA 1Y64A 2DHGA 4EU0A 1UVJA 3OYMA 3R1HA 3HHLB 4PABA 4F0MA 3HM8A 4WU3A 4K42A 1TKTB 1B3TA 1HNWF 1HWKA 3VAHA 2FLLA 3HT3A 2VASA 4CF1A 3NGTA 5IC6B 4M3TA 1HYSA 3M2UB 3UNGC 1EP4A 3H5XA 4H5VA 1O0PA 2FVSA 3G6EN 2E2QA 3VEYA 4IDKB 4QR2A 5D78A 3ZO7A 4JI0K 4PKIA 2ETJA 2RMLA 4ZP7A 5DGBA 2ASPA 3M8PB 1VQYA 2CPZA 4XH1A 1SH3A 1E6YB 4WTYA 1E3MA 3C65A 4DS4A 4WE1B 4PY5A 1U1PA 1VSHA 4Q7AA 2UXDF 4WCEL 3D6FB 1J27A 1FI4A 1NSPA 1TV6B 3LDNA 1S9GB 3GR0A 2AHOB 3HPHA 2I0XA 3LP0A 2HS4A 2P1JA 5BN8A 4DV7F 4FF4A 2HNYB 3TA2A 3L4IA 3T19A 2FF6A 3CG7A 1RB0A 1IQZA 3RMAA 3SYZA 1WELA 4HHUA 3C6HA 3N28A 1WF1A 1ZM2A 4DQSA 2V6AA 3M6VA 3HFKA 3NAEA 1LFWA 2WSEC 4BE2A 5HVHA 1ZM3A 3MEDB 1B4SA 1QUVA 4NRTA 1WWHA 2UU9F 3EZUA 4B17A 1R0AA 5BR9A 3OW2M 1I6JA 1N5QA 4E0DA 4RX6A 2RVJA 3E51A 3SCKE 5LMUK 3OQ2A 2ATLA 2RAQA 3VQ9A 3VQBA 4M3YA 1RWNB 2F9DA 3BY5A 1BXNA 2R2SA 1FRKA 5AQJA 3PYDA 3A8KA 4WPAA 5JUMA 3KUEA 3JSMA 3GFZA 4NI2A 3IP0A 1XR5A 4LF8J 4ZIWA 1HIYA 5KT4A 3QRRA 3PW2A 3DXKA 2ZJPQ 3V1QA 3TNVA 4CT8A 2VQEF 3TUZC 4M5GA 2RDDA 1RBRA 4IBNA 3GV5B 4TQSA 4A8YA 2VOOA 1QAXA 3GIJA 4O8UA 3J8AA 2R4FA 2QE5A 3PO4A 1ATSA 2VGMA 4FWQA 3V6DB 2CJBA 3QAEA 3MI7X 3H3NO 3MFIA 5IM0A 3UD3P 4PG8A 1KVIA 2HHWA 1UZDA 4LF5J 2BE9B 2DNQA 2G2YA 2BJ8A 1YVUA 3SV3A 1N36J 3AFGA 2ZBRA 1UOCA 4OJGA 4ED6A 2CGLA 2F3JA 4JD2B 3IBFB 2DR9A 1NCLA 4RNFA 4ZHRA 3WIUA 3RB6A 4RW9A 4GV6A 1BGXT 1SCJB 1Y11A 3VF2A 3TAEA 1Q81O 3CCLS 1TAQA 2E1RA 3PZPA 1WOSA 4WIIA 1R27B 4G65A 3W9IA 4UTGA 5GAEI 3U9DA 2ASYA 4FWOA 2D74B 2ERRA 4RNNA 3D3BJ 1CLFA 1SVDA 1P8ZA 2YX6A 3O9TA 1KAZA 1U04A 4NLGA 4PKGA 1XJWB 3PW4A 1HQUB 5KFKA 1XQIA 1SJFA 3I82A 3J80U 4ZTFA 3R5JB 3B6BA 2AV5A 2AIRB 3WDOA 2VBWA 3D28A 1P90A 3R6GB 1IKWA 2R7TA 2VB6A 6AT1B 3EY1A 1V9OA 4DG1A 1K8AT 4QIGA 2WOMB 1ZTTA 2KZZA 3P5BP 1HX1A 2WOMA 2FJBB 4E1NA 4QOTA 3U1NA 2I5JB 4JD2A 4BRAA 2FXUA 2LVWA 5KFUA 2EXUA 1OMSA 4I7FB 3VHQA 1IV0A 5EXWA 3MM8B 3PIPL 1UFLA 2QKBA 2E1PA 3JXUA 4FK4A 4FN5A 4PG6A 1D5AA 3AD7C 5HRPA 4ED7A 2P9PA 4AHUA 2GV1A 4DUYK 5A2QO 1D09B 3C6UB 2FSJA 4F25A 1U0HB 2QI2A 4PRFA 1NNDA 3AAQA 4OI4A 3LH2S 4J37A 1BLUA 3R1LA 5DM6Q 2JEIA 3EPGA 4HKQA 3TUJC 4I56A 1TTHB 4NEZA 4HACA 3C16B 1VSMA 3CF5L 3TAMA 2D0PA 4R8UA 4DLEA 3LP2A 3TQEA 1KHVA 1JLEB 3GYXB 3ZT4A 2O8BA 2OFGX 1ZH5A 1VQ9S 2JSXA 3P96A 3V6HA 4FPRA 2OIHA 1AT1B 4BG9A 3CIMA 4FLYA 3GG1A 3KYLA 2XM3A 4B3RF 5AXNA 2XI3A 3QIPA 3H6EA 1UJ5A 4URGA 4QBUA 4YB1P 1PCAA 4B3TF 3VF0B 1JL1A 4CZFA 2GIRA 5CYMA 4HDHA 3HHEA 4AFFA 3O80A 3OXGA 2CQGA 1VQ4S 1TKZB 4DQ8A 4IO9Q 1Z1ZA 4UZCA 2DD8S 4E7HA 2FHMA 4PA1A 5KFYA 3RRKA 2DGOA 5AQXA 3DXBA 3S3NA 3MAAB 1AXQA 2E2OA 4NA1A 4OKKA 4C8KA 1IKVB 1J53A 2R2RA 2NPIA 2BE7D 2YNFA 5J2NA 3IS9A 4OVLA 4FVUA 1W2BM 4JKAA 2M2BA 3H90A 1YJVA 4O3OA 5JICA 4RUAA 4YB5A 5IZHA 2QRRA 2PY5A 2AYEA 1G4CA 1MMNA 4C98A 1J5OA 3TA0A 3FZKA 1K1QA 3R7BB 4CERA 3ZT0A 1PJ6A 3EGVA 2VDHA 3F5TA 3A3OB 2XYPB 2E8AA 4QU6A 5LSLA 1LW2A 3OYFA 3MXHP 1YRUA 2YJFA 4JI2F 3LPYA 1NWKA 4CFAA 3N9UC 3KHYA 3O6WA 3OYAA 4CIGA 3EE3A 1VSKA 2HBLA 2A0FB 1FJGK 3R7SB 4H4MB 3WIVA 1T6CA 3TABA 3BH7B 2D9PA 2DPIA 3C2PA 1FF2A 4CFBA 5KG2A 1WI8A 5HL7Q 2IVNA 4ISGA 4C1NK 1PC5A 1QSLA 4IQXA 4LRFA 1PC4A 2P9KB 2HIQA 5AQGA 3RRGA 2AGPA 4ZPVR 3NY0A 1RHQB 2NQPA 2CDRB 1LK5A 2OPSB 2O3DA 3QO9B 2BMBA 3SUPA 4ZPWR 5G0RB 2W42A 2J9DE 3EYZA 5GAHP 3H08A 3SMZA 5DG7A 5CYMB 2Q43A 4ELUA 2XMMA 3AA3A 4EI2A 1VSFA 4ZVPB 5KFTA 4H5WA 3QINA 1SKUB 4P2FA 3IWNC 3IWLA 2DIVA 1EKSA 4EBDA 4NI2B 5AFUH 3MXIA 1YI2N 3CNQP 1VIOA 1QTNB 4YMEA 2CG8A 1BCMA 4PWUA 2HHHF 2E4LA 4B3MF 2V2ZA 4DTMA 2M8HA 5M2UA 2H4YB 1OH5A 2QEXN 4H0OA 4WFYA 1ZXOA 1R6VA 3FLCO 3PLAA 4DUTA 2OEMA 2JEJA 4LVNP 2A2DA 4J9PA 4H0VB 2CQBA 1UWBA 2E5HA 4BWMA 2OI2A 1U1OA 3LDPA 4CLTA 4DTJA 4FJ9A 2IPOB 1DGKN 3CF5Q 4FZYA 2J7UA 4MIWA 2OP5A 1VHXA 3QWUA 1UMJA 1HYVA 3NVKA 4X64K 1URRA 1YVFA 5JVGQ 4DSJA 1RKIA 3KTQA 4G1IA 1X4AA 1KQKA 4FNIA 3L6QA 2E6LA 1EO1A 2VIHA 5BREA 1NUEA 2EHGA 3AD9C 5I3PA 3FRYA 5A8RA 5CZXA 4B1WB 3GU0A 3VV2B 2IM0A 5CABA 2VODA 2ZJRQ 2F9JA 1JLGB 3OYBA 3D2FA 3OVBA 3OXLA 2B7CB 2GMJA 3K5MA 4G9ZA 1TKDA 1N33J 5FPMA 2LQ9A 3QO9A 4BC7A 1FJGF 3H2UB 4DV6K 1UVIA 3AVFA 3GCXP 1MWMA 3TAPA 1GXUA 5C7PA 1HUXA 3DOMA 1VQ7S 4Z4EA 5AQMA 1KDNA 1WOOA 3OY9A 4WKRA 5B0AA 4KHRA 2D3OR 4PXEA 4ECSA 1SQKA 4LSLB 4L3NA 4K0KF 3HFVA 1CS4A 3QJLA 3ZFVA 2Y1IA 3VR1A 1YZ7A 3R6LB 4KC5A 5DDQC 3AQPA 5ETTA 5K8NA 4DR1J 2JLFA 2HGLA 4CEZA 2E9ZA 3ZEUB 1GMWA 4YQWA 3MPUB 2XLJA 2EKNA 2GHVC 4R0EA 3EPIA 2AGQA 1FXLA 3OJUA 4NPOA 4HTJA 3DNCA 4NLSA 2LMIA 4BRCA 1KVJA 2GVZB 5HN0A 2HZAA 4LUBA 3PRBA 4OI3A 3CPWR 2YX4A 5KRTA 1TL1A 4HUEA 2LEBA 1S0NA 5H9FK 4LF9F 2V67A 3Q2TC 1SH2A 3G6XA 1KRPA 4F4XA 2PMZD 1QE1B 1UW4A 1H1VA 4F26A 3LWLA 3US5A 2X78A 5HVFA 4ES2A 1ASVA 4H5TA 4CJWA 2QSWA 2RU3A 3EX7B 3BO4A 5KPTA 4KFBB 3H4BA 4X64J 4IH7A 1SKWA 1WC5A 3SQ1A 1KLNA 4RBVA 1R8HA 1RCOB 1W0HA 2VJUA 5B7WA 4Y6IA 2RT3A 1T3OA 1WSEA 1WI6A 2BJEA 3UW1A 3M8ZA 3KLEA 3RRHA 2LEAA 3M6GA 4B3OB 3T5LA 1WUUA 2FHKA 4OZLA 4OYBA 1NG9A 2GIQA 4M5LA 3QT6A 3AVHA 1PBAA 2CQCA 4E89A 1M5KC 1BMQB 1NHVA 3M4XA 1NK6A 4DV2K 3GV8B 3EN9A 2V2KA 3ASMA 1Q78A 1KVKA 3DAWA 2YQ3A 3NGKA 1OH7A 3Q7BA 3CCES 2O8DA 5F8NA 5GADI 1S1TB 2DGQA 3B4DA 3NEKA 1X4CA 3MD1A 3BKUA 2QWPA 3PRDA 5IT0A 1BQMA 2HQGA 1IKWB 3WXMB 1F9EB 1NXIA 4DMZA 4LSNA 5KFOA 4Y00A 1I5OB 4CQ1A 4CECA 2W9CB 2E66A 2D0CA 4OYXA 1S59A 1DJ0A 3VAFA 4YDXA 4K4TA 3UQSA 1PILA 3MEEA 5IXUA 4LF5F 1TP7A 3OJSA 4CZGA 2OEJA 2OO4A 3KUGA 2GUPA 1OY6A 1CXUA 2PO4A 3QQCD 5EU7A 4BR9A 4RW8A 1G7CB 3QT8A 3CD6S 2VF3A 2L08A 4URQU 3KLGB 2XULA 4WKYA 1C6VA 4BR4A 5KGWA 4J8FA 3SUQA 4JNEA 2F63A 1TUWA 4RG8A 4WK1A 2PD1A 1J5EJ 3N5BA 4KY3A 3VAJA 4NLBA 1XMQJ 2V7YA 4JRQA 4JI1K 2C2OB 3OL6A 4HR2A 1A6LA 4BS2A 3VQDA 3BF3A 4DX7A 3BO3A 4ZK7M 5CH7B 4NMXA 1NGBA 4DV6F 1VBXA 5ETLA 4CZCA 2DFFA 2OTLN 3M05A 5I4MA 4JV5F 2OD6A 1GLDG 2H5JB 2HQCA 2Y8WA 4OI2A 2YQ0A 4DUYJ 1ZA2B 4RPFA 5LJVA 2XLKA 3LQVA 4Z94A 1TGOA 5MLCV 1OSCA 3T3FA 3CJCA 2HSTA 3PFOA 1BDGA 3LZIA 3OBIA 3J7ZO 3DMJA 4E2FB 3KLHB 4PR6A 2CA9A 2HQ3A 1EQ0A 1YJTA 1IR2A 1WG5A 3IM8A 4YR2A 2ZJQQ 4JI3J 4FXWA 4W90B 3OYCA 3N5FA 4CW7B 3SUNA 2PA3A 4JI7J 3P4UB 3CQ8A 4KAIA 4GV3A 4W92B 2ZH2A 5DG8A 2E5LF 1OYDA 2CVEA 2XSJB 4ZVSB 2KYXA 1GLAG 4ECRA 1F60B 4FLZA 3QETA 3A8YA 2ZDOA 1W2IA 4LSNB 2QLXA 2G13A 3PJWA 4FLXA 2MGZA 4DV7J 2W2MP 2RF2B 3A2FA 3ILIA 1IWGA 4EYIB 4WJBA 1TVRA 3J81j 5IM0B 3MCMA 4LRBA 2V4RA 3TUIC 2RDJA 2R8GA 4HWIA 3C6TB 1N54B 4DDFA 5F8MA 2XCAA 2RS2A 1X4HA 2V4QA 4PWWA 3RBZA 1L3SA 3HT0A 1RYSA 5HJXA 1NDPA 1VC5A 2Z1IA 4XDDA 4DUZJ 4RW6B 2K2PA 1A5XA 2FHJA 4CGHA 1KOOA 4AT1B 3IDHA 3R7NB 1D8YA 3UKUA 4JI7K 1WC6A 3ZYYX 2JC0A 1NJWA 1HBMA 1RK8A 3HPOA 3CETA 3PYFA 3VVUA 2CIMA 1VRTB 2P8IA 1OSDA 2E7WA 3VQAA 2HVHA 3CERA 2E5GA 2BKNA 1VQMS 2B5JB 4CM0A 4V19S 4KTZA 5FROA 3A3NB 4CO5A 1N34K 5AQWA 4DL5A 1KTQA 2KFYA 3J81Y 4F8RA 4B3SJ 4X4QA 1JIHA 3W9HA 2XS7A 1U7LA 2RHKA 1GXLA 4DR5J 1MW7A 2VOPA 3A5LC 2HZVA 4IUFA 4UW2A 5FJ4A 2F7TA 3UDLA 3VEZA 3JAMY 4KREA 3HZGA 5DQGA 1RCXB 1MG7A 4NXMF 5HO4A 3DOKB 3HKWA 4ZVQB 1U6ZA 2GHWA 3FJ2A 1IM4A 2JZ5A 1U1LA 4PG4A 3SSRA 1UVMA 2R7SA 2CPFA 2MQLA 4KPCA 2PI4A 3TA1A 1OQ3A 3CWJA 4ID1A 3TZXA 3JSYA 5E33A 2V63A 2GMHA 1V3ZA 1VLOA 3AY9A 4X65F 5HAOA 5B0DA 4ECZA 3VN5A 1IQTA 2GJ2A 3MFHA 1EXQA 2W9BB 3ULEB 3V5RA 2L9DA 2IRUA 2GWKA 1LOTB 4LF6K 4F3QA 4ECVA 1ZBFA 1X5SA 2BE2A 3DLKB 2GJIA 2M9KA 5GAHI 4ECXA 4G6VB 5GADP 1T05A 1RBVA 1KQFB 3WX4A 2J7WA 4PPDA 2HPUA 2OMLA 1NM1A 4H54A 4GVBB 4GO7X 4CO3A 1Z2ZA 1YJRA 4LT6A 1KR4A 2XTJP 3MDFA 1TL5A 2D1KA 3H1QA 4CIFA 2D3O1 1OVQA 2QTWA 3DLBA 1K47A 3VEWA 1REVA 3T41A 4IEEA 4N76A 5B0EA 4NXMJ 4CD3A 2DHXA 2RHSB 3ZZYA 5LXYA 2LQ5A 2NNWA 2J0WA 1T0TV 4Y2CA 4CBXA 4FPBA 4Z4HA 3V4IB 2F8SA 4KHUA 5DRKA 4JEPA 2ZJQL 2KLAA 1WSRA 2F4FA 2V7ZA 1IKXB 1EHWA 4Y2MA 1N32J 2MY8A 2PDAA 3OD2A 4KHYA 5GIOA 1SJQA 2RSQA 2V0NA 4QIVA 1S1XB 4CLUA 1SV5A 1PAUB 2K3KA 3NKYA 4ZVOB 2E1CA 2WCXA 3LGHA 1HPZA 1V5VA 3ID8A 3PY8A 3U3GA 2D3UA 2JWNA 5KFVA 4DV4J 1NK0A 5LY3A 3ILLA 4F4AA 2BV3A 2OJ3A 4JV1A 4B9NA 1RWOB 1RSCA 5HMWA 2MLYA 5KFCA 2AKWB 3AJ1A 4AF1A 3WNHA 4CD1A 2HBYB 3ZTRA 5GAGI 2MJNA 2M5YA 2WONA 1RTDA 4O5FA 4LF8F 4KHPF 3T5KA 3HVRA 2B9YA 3P49B 2GFFA 3Q83A 3AVCA 2R7YA 5MLCQ 2BJ9A 3CFRA 2P9PB 3QEXA 1RT6A 3VGTA 3O3HA 2QV6A 3KLHA 2BUPA 3D1OA 5FLXY 3OR1A 4DR4K 2Y1RI 2QSFA 3D54A 3R3TA 3MX5A 2OPPA 5A0YA 3QFPA 4H4KC 3CDBA 4TNOA 2ZGYA 2LA4A 1YHQS 2DCUB 4WQ5C 1W2BR 2ZUGA 2RIJA 4X62F 3MDQA 3DRRA 1IR0A 2ATQA 3GONA 1M5SA 1Q9XA 2C3YA 2LDIA 1S0VA 5IWAK 4RW4A 5AR0A 4CJ4A 3VQ5A 5HRRA 1VQ8S 2I9SA 3I56N 3RTVA 3AA5X 2RE1A 1T7PA 3K8WA 3P3DA 4F3OA 2J9EA 1Q82O 3LPEA 3AO2A 4NLUA 4U96A 1YZ6A 1S4EA 1IBMJ 1CJKA 2VFVA 3TTDA 4DSFA 2DFEA 2UUAF 2FZCB 2R42A 3FZLA 2C2NA 3CCMN 4YORA 1GLBG 2ZDPA 4B1YB 4XTTA 2NXCA 4X65K 4IRDA 1WBDA 4BC3A 2R7QA 3VA0A 3W8PA 2CYYA 2HSEB 1J9AA 2PT0A 3P1GA 2G8FA 1WJ9A 2XS2A 1IO2A 2UUBK 2DY9A 1NB7A 3O1LA 3KWMA 2U1AA 1Q7YO 4B1VA 2EC2A 1JWWA 4BR7A 5KFLA 1QAIA 4B9MA 2YJEA 1QVFR 2YHAA 1FE0A 3CDWA 3ZXWA 2AJ2A 3S3MA 2J8SA 4BC2A 4RNMA 3OYKA 4W5NA 5LJWA 5L1IA 2UUTA 2CG4A 3KK7A 4LBIA 1RTHA 2HBMA 2IJRA 3DRPA 5DG9A 3CIPA 5J1NA 3K2PA 3HJFA 3LP1B 1S1VB 1RAIB 3W5XA 2GZOA 5J2PA 4NLWA 1VQNS 1NGAA 1NO8A 3FMBA 3B6OA 3NBPA 2VPZB 4X4NA 2JC1A 1RWKB 3I4HX 4HUGA 3AOAA 4DOZA 2C2KB 1VQNN 5EX3A 4JI5K 3M30A 2YHBA 2UUBJ 3HYFA 3WT0A 1Y3JA 2ZWOA 3CCMS 1HQ2A 1Q79A 3BR8A 1HKBA 3PJ9A 2YKMB 3GFYA 3L8BA 3CJ2A 4PHTX 3KVGA 4JI6F 4X4VA 4DF4A 4RO0A 4GW6A 3MR7A 1KQSM 1JB0C 2VC1A 1R89A 4K4UA 4QWBA 3U4LA 4BE1A 4J2EA 3S01A 2B4PA 2FY1A 3N4WA 3SDEA 4FZZA 4O44A 1Q95G 4ED3A 5DQHA 1O51A 4KHQA 4X62K 2FVQA 4Q0BB 4DR7K 4B1ZA 3LZJA 2HNDB 3I31A 1XMOK 1SC4B 4J9MA 3D7EO 4J9NA 3HBTA 5KPRA 2IIRA 4KB0A 3ZSRA 3L2QA 4KGMA 2KO1A 1F1BB 4OX6A 4QU7A 1RAAB 2NRXA 5DDRC 1A5WA 3KZBA 1UTAA 4H4MA 4Y34A 2HOEA 2O67A 4LFAJ 2SXLA 1NMEB 2Q66A 4WYBA 4GKKK 2HHPA 1YQHA 3O3LA 3QBCA 4PG7A 4EHUA 3ZX0A 3K8VA 1Z05A 2RHQB 4USHA 2QLWA 2WFBA 1NRKA 4DV1F 2ZWHA 3OLAA 1IKXA 3PX6A 2Z58B 3C14B 3W3SA 5ITHA 1H2TZ 4DR7F 4FJLA 1Q9YA 3CMEN 3R8EA 4UY8T 4HHJA 2YBVA 4JAXA 2R2TA 1QLNA 2F9TA 2WVBA 2CPHA 3PO5A 1X4BA 1YKWA 3PR4A 4R0JA 5AXKA 3PKYA 3J7A1 3V9SA 2W2NP 2R7WA 1I94K 1ZBUA 1XMOJ 3BR9A 3WUHA 5LSRA 2QYCA 3OR2A 4DV1K 4OZ5A 1RAJA 3W8GA 2MLXA 2FJEB 4F0KA 4DPWA 3MR5A 3DU6A 2JWLA 1RAOA 2JFDA 1RI7A 1E6VA 4RNHA 3TR5A 3RBEA 2LU2A 2HLTA 4S0MA 4LJMA 1SBRA 4MT1A 2R2UA 1BD6A 3VGKA 1I1GA 4NB4A 3ULHA 4B1XB 1X31C 4EFHA 3TJ9A 1ACMB 4WK3A 5B0GA 2JX2A 3OPKA 2OYQA 4ED0A 4KQZA 1V5IB 3L3CA 3CDAA 3BKTA 3IRWP 2MQOA 2V69A 4FYXB 4OJ3A 2K1RA 3JQKA 3LF0A 3OTCA 4DPUA 3IG1A 4C8YA 3QGPA 1T9TA 3L2WA 3CVKA 4UY8O 3JTPA 4E1MA 5CHIA 5BR8K 4KH6A 1WEXA 2H48B 4Q2LA 3ZTPA 1ATRA 4KB1A 2NRWA 1FKOA 1S6QB 4DUZF 4OYMA 1UPPA 4C9DA 1VRUB 3OFGA 3MMCB 2UXCJ 4B9QA 4FCYA 3J7YU 4HDGA 1RTJB 4LF7K 4B9SA 3MUTP 4KIAA 1NB2A 5AQRA 2K7KA 1L5UA 2HFZA 4I6WA 3TVYA 5E2QA 1B99A 1YF5L 2G0CA 4G1QA 4JKFA 3A5OC 4ZPBA 2MKYA 4RZRA 3FSYA 1D0EA 5E3RA 4DB3A 3I56S 3GBTA 1IJJA 3MCPA 2J9DA 3M2RB 2E1ZA 1JLBB 2Q3SA 4Q43A 1CS4B 1XNQJ 4BACA 5DM6L 3IG1B 3AV9A 4LF7F 3NF7A 4GVLA 1S22A 5AT1B 3EWGA 1OPZA 3QZ8A 2ITGA 2YWWA 4CHZA 4HVJA 1N8RT 4CJ3A 4K59A 3AVIA 3VF4A 1TU0B 1Q5VA 4DPXA 2QXLA 5E26A 1S1XA 2B7BB 3ZZRA 3UFCX 1I94F 1DFDA 4O55A 4CEOA 3CE8A 4N8NA 1XMBA 2HQFA 1YVNA 3O08A 2KT2A 4B3SF 2Y9HA 2ROEA 4JYAF 3AGKA 2D3ZA 3UDCA 4F4KA 3VZIA 5LM7E 1N0VC 1RT3B 4K5SA 1HNZJ 4JV5J 1VSEA 1OH8A 5DK5A 2Z1HA 1J5OB 5CYQB 2O8BB 2CPEA 4DFJA 3KOAA 5I42A 1HWJA 2UUCK 3I9ZA 4FS2A 3S3OA 4C0BA 1QD1A 4DHVA 4CO1A 1T03B 2M88A 4B9VA 3CCQN 4DPOA 5KFRA 1Q1KA 4OHVA 2A6AA 2CQ0A 1HI1A 2H4WB 5G0RA 3I8BA 3DMJB 4C11B 3MEGA 2VC0A 1QZ6A 2DISA 3VAGA 2DTJA 1TKTA 1NGHA 2P6SA 1WSVA 2GV9A 4JK7A 5AXLA 2YHXA 4WP9A 3TJ8A 2NLXA 1F6TA 2K7JA 4ILGB 1K0VA 2VONA 2A10A 3M8RA 4JI3K 3MWBA 2VA3A 2ZKUA 2JHEA 2MJUA 3KHHA 1GOCA 2MKJA 1YBAA 3ETMA 3KG4A 2OPPB 1HKGA 2EEYA 1E6VB 4CGGA 4DQRA 1RT3A 2BW7A 3R97A 4DTOA 1BOTO 1DY3A 2B8PA 3U02A 1TMJA 4FW2A 1C1AA 2ILYA 1QVFM 4OHZA 2ZHBA 1AYEA 3KWIA 2HF3A 4C48A 2W2QP 2E1MC 2BA9A 1HHQA 2UXBK 3ZETB 3I5CA 1K73O 5K14A 4MKAA 4JI3F 3FZ2A 5KQ8A 5KT5A 1H72C 3OTEA 3DI6B 2DRDA 1GMWD 3CMQA 2G2ZA 4ECUA 3ICLA 3CD0A 4DL3A 1DRZA 1UZHA 4FJJA 3WNFA 3IMXA 4OLOA 1BIZA 1NDCA 2Z4PA 3MM5B 4TY8B 1V3RA 2PSZA 3FCWA 4DUZK 1ZPWX 5KOXA 2EKYA 3WXIA 2ZH8A 1T9UA 1WEYA 4YN3B 2NRZA 1BY9A 4JI8F 1NSKL 1G99A 3VAKA 3UN5A 1JLBA 1HQEA 3GYNA 4C8LA 4CO4A 1HNVB 2CWKA 3T5JA 2YKOA 2CZ9A 4UOGA 4ZLPA 1RA7A 3SI6A 3E9OA 3O5BA 4WP3A 2BX6A 2UUCJ 4IOAQ 3CXCR 2ZH5A 1RWPB 1LOUA 3IRXA 3WHIA 1M5PC 3WZ0A 1VR6A 3NMAA 4CJUA 2ZVIA 3F0NA 4ZVUB 1ULRA 3GE1A 4EWTA 4BCAA 3ET6A 1C0TB 4WTOB 2POKA 2EK1A 1I3AA 3F44A 4NCBA 2E7VA 4DFKA 1MU2A 3AO4A 3GYGA 2DNYA 2UUCF 1C1BB 2W6KA 1JLEA 1FX4A 2W4PA 3D2EA 4R8UB 1WTBA 5FRNA 3Q7CA 4DHYA 1R7IA 1TKXA 5K9FA 2AP1A 4FWSA 2IIHA 1JQGA 4AHRA 4A5BA 3OBWA 1FK9A 5IT9Y 2QA1A 4NA2A 2HS3A 1U0HA 2FHOB 2WC9A 3SSSA 1VBYA 4MAKA 2CGJA 4P2SA 3RG6A 2NRVA 4WXOA 3HHDA 2D4WA 3QICA 3TARA 1TL1B 3VERA 4K4YA 3SMPA 4AQYK 4PL7A 1IBCB 4A4JA 2IBOA 1NMDA 3BBCA 3A8EA 2G8WA 5GAHU 4QAGA 1N33F 2A1BA 1XEZA 3QERA 1WORA 4ZPCA 5KFIA 3G2XA 2BXJA 3ZSVA 4CFDA 2DPJA 1O5JA 4FJNA 2EK6A 3IAM9 3CI5A 2DGUA 2NRHA 4QIEA 3MCAB 2KU7A 3P6YC 5L1LA 1H2VZ 2B6AA 2X7IA 4UT4A 2I6WA 1M90T 4DL0C 1CLQA 2CQ1A 5AZJB 3G6YA 3ZT2A 4M5DB 3BEGB 3D2EB 2XZWA 5KG6A 1HW8A 3TAQA 3OTOJ 4CZJA 5D8HB 2QL9B 3D67A 3MHYA 1KS2A 4NXMK 2B9XA 3ET6B 5IS2A 5EWFA 3MN6A 1HKCA 3J7AP 4BVPA 3HRGA 3MPWA 3U3YA 4I4BA 3OYEA 4OKJA 3OW2R 3ITHA 1BI4A 2V34A 1HL6A 4DQQA 3BPDA 3SFGA 2B4OA 4OGCA 2ASLA 2AGOA 2CH6A 3G6VA 3PACA 5H9EK 7FD1A 2UUAK 4LF4K 5C10A 4FLVA 2W7AA 4KRWA 3WQPA 5KT2A 3RMBA 4ZN1A 3FRZA 4OYIA 4U7CA 3NOGA 1YBTA 4CTAB 1DQ9A 5ETRA 3AVNA 3OL8A 3KLIB 4H5RA 1JLAB 4XH4A 3VF6A 1L3KA 4QR0A 2AYMA 1NGDA 3NF9A 1RDDA 3VQCA 2XMUA 1S9GA 1FA0A 4CDIA 1UA1A 1I94J 4WFAQ 1SAZA 2QTDA 3OLBA 2V8PA 2EI5A 3OXFA 3TSUA 5A2QU 4FNHA 2GO9A 5L9XA 4ILMA 2PC6A 3V9UA 1S10A 1J2VA 2DHHA 3RAMA 1CZ9A 2DTUA 2L3MA 3RYLA 5HRSA 2BR0A 2XZTB 3FDSA 2GQQA 3QNWB 4PXCA 2UUAJ 3FK4A 2XYHB 4DU7A 1U1RA 2RKIA 2RE2A 2P9GA 2VHGA 1O1WA 2PAVA 2ZGZA 3GQCA 3DRYA 3AODA 3IA0A 1HW9A 1RP5A 4E3SA 4EYHB 1N33K 1X4EA 4CJRA 2E1AA 2NYIA 4AYBD 5IFMA 5KFZA 3WQUA 2QXFA 2WSCC 4Y65A 2FGOA 2NZ4A 3SJHA 1OS5A 4DV3J 3TAFA 3C6AA 4BRDA 4Z4IA 3EZ5A 1N5SA 3AQOA 2FYXA 3J7AN 1MWKA 2A41A 4BG8A 4ZVEA 1EWQA 2MKCA 5A6WA 1RTZA 5KQDA 5BXIA 3CJ9A 1KWMA 1R8BA 1N0UA 1Y0HA 2LLZA 1QDUB 4QYRA 2C2DA 2KZMA 1Y4ZB 4OZJA 3R5CA 1UJ6A 3VZHA 3BQ2A 2QWLA 4E19A 3OUYB 2HHUA 3U1MA 3MTKA 2DNOA 1VQ6S 3I96A 4J9SA 4PUOB 2C2EA 1JCFA 3HPGA 3QESA 3FGUA 4F3TA 4FM2A 3KXDA 2A18A 5IC4B 2NYHA 3LGNA 3HI9A 2YH1A 2VBZA 3FCVA 1AFIA 2YV0X 1ESVA 1U49A 2XCPA 2YPYA 3UCGA 4ENOA 2P9UA 5JVHQ 2FQQB 3IR5B 3C15A 3KJFB 5MAOA 2ZC4A 3GP9A 1C4CA 5T7LA 2CNLB 3FBEA 4CF2A 1WOQA 3WBZA 3SBGA 3SPZA 3K5PA 4E7KA 2HFOA 2BM1A 4FS1A 4DV0F 1WHXA 2UXBJ 4B9LA 1WHYA 3K89A 1N5TA 2PGCA 3R5GA 1N32F 2F8EX 2C3MA 4DR4F 3L4BC 4I2PA 2FVPA 3FE1A 3ENBA 2QFJA 2AX0A 4EO6A 4UUXA 5CAAA 2BJDA 3NP5A 3THYB 4HCBA 3HSZA 4FBUA 2F40A 1DAXA 2X6NA 1WDTA 4IG0A 1MWQA 2ZVSA 1F9HA 2ZJPL 3E01A 2FBTA 2ACMA 2F4VJ 1YJ9N 4LMZA 5J1PA 3MPVA 2Q3PA 2LCWA 2E2NA 1REVB 5A6PA 4HTIA 3THWB 2AYGA 4CZHA 1HYSB 3M2UA 1TK5A 4UOFA 5KFEA 2PI5A 1RAEB 4LR8A 1FJCA 3CFPA 4BRGA 2QA4S 3VGSA 3UCZP 3EM1A 2P6TA 2GX9A 4LFAK 1WSIA 2QLFB 4N56A 2Q0UA 2Q97A 3PHTA 4Y28C 3H2VE 3S9HA 4ZITA 1UAXA 3ISZA 2WHOA 2QZ8A 2XC9A 2HHXA 4GKJK 2NZCA 1YJNS 4CJ7A 1Q7LB 2VBXA 4DS5A 3DHWC 1H73A 2KTQA 1EETB 5CZ1A 4JS5A 3CUNA 4IOAL 2GIFA 4A8QA 4ZCKA 1GTEA 2G4BA 2A42A 4Y3CA 3DLGB 2PFDA 3MR3A 3G25A 1RT1A 5ADXH 3TUPA 1F5BA 1RJJA 4ZP8A 1SPBP 3PIPQ 4DLGA 4C97A 2HZCA 3EE9A 2NRRA 1BCOA 1YXQA 3AY0A 1YWXA 3CMES 1ZM9A 1WC0A 1RDCA 1LNQA 1SQEA 1UKUA 2AW0A 4OLAA 1MDUB 2O8EA 4NCGB 2RQ4A 5C25B 1S12A 1FFSB 2V4JA 3CD7A 4CHNA 2OPRA 3V1OA 1IN0A 4FM1A 3V9ZA 4FZVA 3VALA 3MWPA 3EUNA 3OR1B 1FCAA 3MCNA 2CJAA 2Q2RA 2D5RA 4F50A 3EVOA 4AL5A 4C4WA 1X4DA 2KH9A 2HHTA 1HBNB 3EDQB 2J9CA 4GC6A 2DR8A 4EK2A 3L7OA 3VETA 4KTQA 2WBMA 2IMWP 2N4DA 2MQPA 5K8PA 3R2DJ 2BACA 2AU0A 4J9OA 3UD4P 2ADBA 2NLWA 4X2BA 4O3QA 1WG1A 3SAHA 3U7JA 3DLRA 3O44A 1N6QA 3VGVA 1R8PA 2FC0A 3W2VA 5CZVA 4H0PA 3M5RA 1JLCB 4RWXA 4CGJA 5LL6d 2QW9A 1RT5B 2E6MA 5LMNK 1S7IA 1XTZA 1HRHA 2Y1LB 4B3MK 1N5VA 2HWIA 2DNRA 3KJNB 1ZPVA 1EZZB 2ZH3A 1S6PA 1HI0P 2C3UA 5T14A 2CNOB 2XLIA 1S97A 2VFRA 2ZKTA 3MR6A 3KJVA 1SV5B 4H4KA 3MN9A 2UUBF 2FBVA 1VBKA 1KHWA 4KGVB 4MJKA 4FBTA 3IAYA 1Q8BA 1BQNB 3H98A 4X4OA 4F9OA 1BISA 2ALZA 1MSWD 4OFZA 2GUIA 2A2CA 2B3TB 1GLCG 4OX9F 3I0RA 4CLPA 3M32A 3GSIA 5I42B 1RTIB 4QIWD 4JOUA 4KV8B 5M1KA 4ILHA 2LKZA 3SNNA 5M1PA 4KKOB 5LSOA 1KNZA 1NGJA 1CJUA 3MEEB 4KKOA 3SJJA 4WYWA 4AL6A 2V51B 1NJYA 4BRKA 2W8LA 2YX1A 3SQ4A 3DLLQ 1UVLA 1D9FA 1M1KO 1RWMB 2J7KA 3ENQA 3HZ6A 4JYAJ 1Y97A 2B43A 2HWHA 3CCSN 2ZM6J 1T6DA 3K9JA 4USIA 1WDDA 3CJ1A 1R8CA 1ZBIA 2KM8B 1QVGR 1GX6A 3PKMA 4FDFA 1IBLJ 1FJGJ 4MYUA 3AVGA 4KO0A 3W61A 2ASMA 5D4NA 1NJIT 2HF4A 3HVTA 4TSXA 4HT5A 3RAXA 3NOCA 2Y1JA 1LXNA 2UVRA 1GXTA 1S6OA 4AHTA 3IBWA 4JUZA 3G10A 4URSA 1UW9A 1IKYB 2YPZA 5AQHA 3THPA 1BWFO 1NGGA 3W5YA 3LP3A 2FB0A 2VFUA 1N36K 3RW6A 4EIAA 1WD6A 3MK6A 2IC3A 1AFJA 1WAJA 2HHVA 3EZOA 2MZQA 2XEXA 3PJXA 1R59O 1CJTB 1TFWA 1TV6A 3MM9A 5HP1B 3FZBA 3CJ5A 1R43A 4ANCA 1PO6A 3TAGA 1U24A 2CAJA 4GO5X 5GVQA 3C3LA 1JL2A 1ZM4A 1S5JA 2HW3A 3LPUA 2DO0A 1CJKB 3KIOA 4I9LA 2P9EA 2ZH7A 5IT4A 1RDWX 5DDOC 2LECA 2HVEA 3UDEA 4BQLA 1IBLK 2O5DA 4Q44A 4MFBA 1UEVA 3KJVB 4B02A 5EY4A 4BC9A 3RU0A 3M8QA 2J4RA 3W3DA 2KFZA 3D5MA 5CD4A 5KFMA 2W2PP 4DSEA 5T7BA 4M5DA 5ETSA 1KLMB 3D0IE 5AFUA 2CPJA 3QWPA 1APSA 4DQIA 1WEZA 4JI4F 4EGLA 3W2VB 3N79A 3PV8A 3M2RA 2L41A 2AZ1A 5KG3A 2W9AA 3RVCA 4C3KA 3D4JA 2BABA 3D66A 2HBZB 3GL1A 2ZBQA 2OH2A 2LP4A 1RGVA 3FBCA 2YNIB 2AX1A 4YB7A 3H59A 3N4QA 3LP1A 1JJ2M 3BGLA 4C8ZA 5K8MA 4P2MA 4YP3A 3VQ6A 1HNIB 4M5HA 5KFFA 2KXFA 5BPNA 4NL5A 3UNYA 5EWGA 2R9LA 2HURA 4HL9A 5KI6A 2FJAB 1T94A 3RB3A 1XR7A 3CCEN 1S7HA 1H98A 3IC1A 1RISA 5KG1A 3A5NC 3VQSA 2ROPA 8RUCA 3NCRA 4KFBA 3JB9k 4DCPB 1M1GA 1C0UB 2ZD1A 3OUYA 2QG9B 4LF9J 3M1VB 4XAKA 4CZIA 1NU0A 1HNWK 5J2MB 4NXNF 3HHLA 4DFPA 4JB8B 3BUZB 4OZ0A 4Z7YA 1VQPN 5JMVA 1GLFO 3GB0A 5B0FA 2YNHA 2V2VA 5HRNA 1S77D 2A5XA 3CJQA 3MGJA 2QWMA 1DEJA 4YOWA 4JI0F 4CH7A 4QZVB 4DR1F 3ZNJ1 1B9FA 2OFHX 2IM3A 3AGRA 3QEWA 5HI7A 1JCGA 1SXLA 4BRQA 2PA8D 4RW4B 2XY8A 1HNXK 1TQLA 3CEDA 1JLAA 4IH6A 3G71S 4QPTA 4BR2A 3TZYA 3ZNUA 3QAUA 4DR6J 4FLUA 4TLQA 3P5TL 2KG0A 1R0CB 5U47A 2G2OA 1OH6A 4A59A 3POTA 3L2VA 1JLCA 1XHZA 4DR3K 5HJYA 4DSIA 4JKDA 3UPFA 2Q6CA 2GGPB 2HBQB 3HLUA 4KH5A 3KMQA 4CZKA 4ED2A 5C0YA 2FF3B 3O1BA 4ED5A 1WSHA 2EFVA 3KK2A 1C0TA 5SUHA 1IBMK 1BWVA 2Z30B 4PYAA 4IG0B 1MA9B 3FBBA 1LWXA 2YKQA 2AF6A 3CCSS 1GLEG 1A9NB 1X0PA 2GEMA 4JI4K 3AB4B 3D0HE 3DYAA 3LDOA 5CE3A 2YKNA 4PCQA 5HK4A 3NAHA 4DV4F 2DHSA 1FWPA 1TL4A 3AAWB 3SBTA 4RW9B 1KD1O 1P9YA 1VQ7N 1NU4A 5LMUF 4XO0A 1RBOB 3D1QA 3WQTA 3HULA 3NNCA 5BRDA 2RS8A 5JVHL 2AA4A 1R0BG 5GAEU 3TWHA 2ZZTA 4FJIA 1H6KX 3KD5E 4RJVA 5KFPA 1QSSA 2RPIA 4Z4CA 3KJQB 4FSVA 4M5IA 3KD1E 1SUQB 4W5QA 4DU3A 6FDRA 2MKKA 1AZSA 4ZCLA 2YWGA 3H8YA 2VJVA 2R7UA 3CJBA 4FF2A 3HL8A 1HPMA 2K3IA 1Q16B 2MSSA 4D3GA 4YR0A 1U2VA 5EOYA 3E8OA 1HBOB 2AEJA 3WXLA 4V19X 4LD0A 1S79A 4Q8FA 4J2AA 3EXCX 2XI2A 2MKSA 3ZX3A 1FRIA 3S8SA 4OJ1A 4I6YA 1S0MA 5LMNJ 3M8SA 2ZM6K 5IOLA 4AHVA 2ZBCA 2OTJN 2DH8A 2RKIB 4KTWA 2NXNA 4BQZA 3ENVA 4H03B 1CC7A 4BBYA 4FWPA 5KFGA 2YX7A 2G9OA 1EKEA 4XDCA 4L75A 2QMUB 1CJVA 3MM7B 3L95X 3KK3A 2IBKA 2ZF5O 2XBPA 4F2SA 1WSGA 4CIEA 1B64A 5JXSA 1U2VB 4GNIA 1TYQB 4JKGA 4JKHA 1NGEA 2VWBA 1UEUA 2J0QD 2ITMA 4ELTA 1VQ5S 3G0ZA 4O4RA 1S0OA 4LF8K 4X4PA 2OUGA 3D0GE 4ZVTB 5DM7Q 3PEJA 4IQMA 3LA0A 5AQTA 4QOZB 4DKWA 1XI1A 2CH5A 4KHMA 3W7BA 4DX8H 1V3SA 2RJZA 4HUFA 1WKLA 3QIOA 3HP6A 1Y7PA 3THVA 4BRNA 4LFCK 3Q8VA 1M1HA 3UVJA 1Y3KA 1DKGD 3HX9A 1HARA 3L7UA 1RAFB 1KEKA 1JNZB 4IFYA 4W5OA 2OA8A 3AH6A 2O1PA 4M3ZA 2HHHK 2A40A 1OIAA 4PKHA 3QJJA 5J2QA 2OTJS 3K59A 1LW2B 4JI8K 4KHSA 2B9EA 4ZLNA 4GVMA 4DUYF 1QM9A 3HKZD 1XR6A 4LF4F 5L46A 1QQOA 4KH4A 4DU4A 4CM2A 4DFMA 4LRDA 5E3QA 3EZWA 1NH7A 3RUBL 3KK1B 1FNOA 4WFZA 1NOYA 2O8CA 3MEDA 5C12A 2AJ1A 2PE8A 2VWKA 2XY6A 1B9DA 1Q8IA 1P8GA 1RCHA 3DJCA 2NSCA 1FKPB 3Q8QB 4CJPA 5M1QA 4FPAA 4ZJLA 4N47A 4TY9A 1XHXA 3GJTB 3CCUS 3CW2C 5DLGA 1U09A 3GJSB 2AYBA 5GAGU 4JI6J 4A8FA 4USKA 4U7UK 1VSLA 4DF8A 3PM9A 1ZZFA 1T8EA 2ZM6F 4FVCA 4BC4A 2XGQA 3DOLB 1KP6A 3GWCA 4ERDA 3DRPB 2XMKA 1RBLA 2F4VK 3OS1A 4NLVA 5DGAA 4RL1A 2P9UB 3GSDA 3LOUA 3FFIB 3RJMB 1ZBLA 2YWKA 3VQ4A 2PEBA 2XMAA 3CC2N 3NE6A 3RAQA 1JJHA 3BB5A 4C23A 5C15A 2JEFA 1RWWB 3CJKB 1G2EA 1X9MA 1U02A 1NK7A 4YUDA 2E5IA 2ZZMA 4DSKA 2P9LB 3FUYA 3DLKA 4IRCA 5AE2A 3MAQA 3NGZA 3BN7A 2HEKA 1S1UB 2MSTA 1X9JA 2MHNA 3AVBA 5H9EJ 3C6UA 1F21A 4ZKAA 4ETXA 5J1EA 4CH1A 4I67A 3G86A 1HNIA 3AARA 4OHXA 3W66A 4AM7A 3CT9A 2QO3A 1HNXJ 3P4IA 3O4QA 2DNGA 4FLWA 2QMXA 2EWHA 1JXLA 1M5HA 2VKZG 2IYGA 3L9ZA 4HYKA 4MLHA 3F41A 5KFWA 1VBZA 1Q82T 2ILZA 4DV2J 4B9TA 1CZAN 1BU6O 3LAKA 4BE0A 3PSIA 3NAIA 4JK9A 2WSFC 3PCOB 4B8AB 2UV8A 4DN9A 3ZSXA 4IYQA 2WVDA 4U6PA 3E9LA 4CZLA 4H5NA 2RRNA 4BREA 4X66J 3MM7A 4J9VA 1WNSA 1FRHA 3VESA 5BPLA 1RNHA 4CBUA 2WRMA 4PKDB 4Q45A 3BZCA 2KFNA 5C2CA 1UP1A 1VK0A 4K8RA 2KVQE 4O4GA 4LH5A 1TFYA 3AT1B 5LJ3Y 2DJWA 2GVDA 3G8SA 4UY85 3ZSOA 2VQFJ 3ADAC 3DOLA 2FJDB 4Y2KA 4K4XA 4Z37A 2CZ4A 2DHAA 3TANA 2W24A 3DKDA 2LU1A 3NCIA 1HD1A 4CJQA 4WF9Q 1W25A 1BQNA 3MM8A 3OS0A 4CLZA 3L3VA 4FWMA 5H9FJ 4TQRA 1W26A 3M30B 2UUWA 5EVZA 2V68A 1RHUB 1G6BA 2ZH4A 1HR0F 1RWXB 2I1RA 1RWVB 4OI0A 1NBEB 1U4BA 2YI1A 4YS2A 2O8EB 4N7TA 1UFKA 3VPZA 5M1NA 1FKPA 2OGUA 2KL8A 3G71N 4BC5A 2KRBA 3CTRA 3RR8A 2G8HA 5D77A 1JLQA 1YRTA 3UB5A 4KBIA 3NDKA 1Z2LA 1S1TA 2YXLA 4YOVA 1O6XA 1H2UX 3F56A 1GLLO 3D68A 1S72N 2C2ZB 1RZMA 1GX5A 3BDPA 3W65A 3NNAA 4DBQA 2DFHA 1S1WA 4B3TK 1HMVA 1H7WA 3R27A 4EZ9A 4CWBA 4ZVRB 1SIZA 1S4FA 3DN9A 4CE9A 1MMLA 3FMWA 3UE5A 1X4GA 4X64F 1VMBA 3UIQA 2OZMA 4RW7B 1SJ4P 5KTQA 1HNZF 2XSJA 2BW2A 1VRUA 4RBTA 4FJHA 2GELA 2NUBA 3QEIA 1S6QA 2WK4A 5JJBA 1IXKA 2Z2LA 2H51B 2Y0SD 3KLFA 1WLJA 2WAQD 1RLCL 2M4MA 1RT4A 3CJKA 4AE5A 4IO8A 5E3PA 4LY7A 4PEOA 3NGUA 1OY8A 3NS6A 2CKWA 1KVAA 1RFQA 5T41A 2X74A 2YNFB 4E7IA 4QS8A 2OZSA 2KXHA 5BJRA 2QWQA 2QIFA 4NXNJ 1QHTA 1CBKA 3ZZPA 2MXYA 4EBEA 4NEYA 2BE2B 1FVSA 4FF3A 1T11A 1U1KA 2FJXA 3HTVA 4M41A 3BN4A 2ZE2A 1BL3A 3DDIA 2WW4A 3HSJA 1VQLS 4MYTA 2KT3A 2AJ0A 1SI9A 5AQIA 1D4XA 2HLUA 3KMSA 1SC1B 3G8TA 1K8AO 2QL7B 4DV6J 3H4DA 4ED1A 3VA3A 3ZT3A 4Z0UA 2IHR1 5D0HA 1IUJA 3KHLA 3NFAA 2DCLA 4DL7A 4IO1A 4K0KK 2Q36A 4H8KA 4DSLA 3CQXA 1SC6A 3ZC4A 1IM6A 4NWBA 4WE1A 2BDPA 2BJ1A 4NMLA 2IRXA 3IKMA 2OELA 1VFJA 4H0TB 1S1WB 4ATNA 5HL7L 2WVEA 2GVDB 2G8IA 5B09A 4EEYA 3SDEB 2BKPA 3CCUN 4RTFD 4PWDB 3CPWM 2FPHX 4QWEA 1R6YA 3H40A 1HR0J 1F5CA 1R0AB 4BR5A 3GG0A 1VI7A 1YBUA 2JLGA 4F3MA 5GAEP 1AUDA 4FW1A 1D8ZA 1U2FA 3DRSB 4M45A 2QC3A 1YITN 4DR3J 2C3OA 2DH7A 1BUPA 2B8QA 4OQJA 3NH1A 4MIBA 2IMOA 2J76E 2Q31A 3MECA 3GG4A 4TKTA 3SPYA 3B82A 2IJNA 2C28A 4E8UA 1EAYC 1D9AA 4C2MA 1KFSA 3PNIA 4Y2AA 3HJVA 2M70A 2DNMA 3FBFA 2RUSA 1KBRA 1X5PA 4R25A 3VGMA 1T3NA 4YNQA 1VRQC 4JI4J 1RABB 3AB2B 2R7XA 4BLGA 4Y0WA 4P6QA 4DV5F 2FBXA 2E7XA 3OYHA 2X3DA 2K8GA 3TI0A 3T1HF 3DHXA 4QS9A 1X1PA 3J7Z5 3DU5A 1UL3A 3VTIA 4OKEA 2NZTA 4A8OA 2IAJA 1RT2A 2MDAA 1EIYB 2W9CA 4IO9L 2IDEA 3IFRA 4JKCA 4LFBF 2LXFA 2QLJB 1HNXF 4YY3F 4OX9K 4P71A 3MM9B 4ZPTR 1TL3A 2P9SB 2ASOA 3MAAA 4NLPA 3I8DA 3WNEA 1DARA 4KSEB 3NLCA 4YR3A 3NBPB 1BA1A 4X4RA 1PYOB 4J2DA 2BVZA 4DV1J 4IOCL 3FZFA 2ACYA 2YNHB 3FGVA 3MXMA 2MQQA 4AQYJ 1K73T 3MPYA 2M7SA 1OVYA 2HFSA 4KO0B 1FW6A 3K5OA 1VQ5N 1TMMA 3EO3A 3QB0A 4DR5K 3WC2A 2YTCA 1ZAVA 3OTBA 5D0RA 3UN2A 5ETOA 3Q23A 1VQKS 2BBEA 2WB1D 1SL2A 1NPPA 2VG6B 4K2JA 3BF1A 3CGIA 1IBLF 2E5LK 2H65B 3M8WA 2NUHA 4FOIA 1KONA 2J5AA 2KI2A 1YX2A 3CC4S 2Z57B 1Q86T 4TVAB 2RH3A 4ZJQA 4EZ6A 3SQ2A 3O3GA 3MM6A 2DNZA 1XMQK 3HP9A 3TO8A 2OPQA 3GE9A 3EGWB 1OKJA 2RB7A 5CCLA 2CJYB 2E44A 4USTA 3DI6A 2D7SA 3NGDA 3WXJA 2DEIA 3H5UA 2OEKA 2YKNB 4LR7A 4KV8A 2PMWA 5HLFA 2NREA 4CLWA 3L0QA 4MKYA 1D1UA 2RU9A 4WBFA 1XN9A 2DY4A 2CJKA 2VA2A 3ZLJA 2F8HA 3DM2A 2W4CA 3UD5A 5DJBA 4M8LA 3M8PA 1U6BA 5KFXA 3I55S 4CF8A 1NJXA 3CCVS 3ZEUA 2CZVC 2DRAA 3LM9A 2J6UA 2XWYA 3THXB 2FZGB 1NK8A 4H0YB 4QWCA 2HMIB 4LF4J 1JLQB 5ETNA 1K9MO 3ZZTA 2G8VA 1RLDA 2P9NB 4M3RA 2VH7A 3AAPA 3T1HK 4A5AA 1B7YB 4NYOA 1YHQN 3SK3A 3DCAA 3GFHA 2WTFA 3AD8C 2DGTA 2Z1JA 3PW5A 1IBKK 2W6LA 3DLEB 1RT1B 4DU1A 1EQMA 3ZZOA 4KHPK 4CYUA 1ZYQA 3Q8PB 3NMRA 2ZQBA 1REGX 2V52B 1W7WA 4IJAA 4DV7K 2KHOA 3OHRA 3D2FB 1U6FA 4ANDA 3VQQA 4M7XA 3U9ZA 2V8VA 1QAYA 4IRKA 3P83D 1KOHA 3EDRB 3ETOA 5CYJA 1ZAXA 5HP1A 1QQNA 2E88A 1EB0A 4N5SA 4IFYB 1CJUB 2NCKL 4M3WA 5JLFA 1TL3B 2D9OA 3EXYA 5F3ZA 1GK8A 3UR3C 4K50A 5A8WA 3OVNA 3W60A 5KFQA 3D45A 4WQ4C 2C3PA 5M2RA 1FRXA 1T3VA 2FC9A 2EC0A 1WHWA 3KUHA 3N6NA 2ZBIA 1BO5O 3BKFA 2G0JA 3JXOA 4TXSA 2DGWA 2EBGA 1XC3A 1F2GA 1RTHB 4HH0A 4ICLA 4FWLA 1KFDA 4CHPA 1Q8LA 1VSJA 1WB9A 1R3NA 2IVFB 2BM0A 2IA0A 3DLGA 1S6UA 2N3LA 5FLXU 4B8CA 1VQ4N 2F7VA 5AZIB 1UWBB 4U7BA 4OO1J 2F65A 4PQAA 5EGYA 3W1YC 4O3RA 3DXKB 5C42B 4YOXA 2AEFA 5KFBA 3V4IA 3PTWA 2R8KA 4ZOSA 3CMAS 4U9RA 1IBMF 2ZBPA 4PPZA 4DCHA 4P73A 3BZKA 3MECB 4DR1K 1S48A 2LYVA 2RN2A 3QSIA 5AQVA 1LWCB 2BEFA 4LVOP 4IEIA 5A8KA 1FXRA 3MMBB 2GJFA 4DV4K 3N6LA 1VQLN 2QWRA 2FHJD 2V94A 4NZ7A 1D9DA 1TUUA 2FJWA 4NZ0A 1Y5NB 3PEHA 4USMA 4IH5A 2LFVA 4I6MA 2VWJA 1P6TA 2VQEK 5C2GA 2G1DA 3KK1A 4EUVA 3Q2SC 3KG0A 3LUYA 4DR3F 3JS6A 4ECWA 4TYBA 2A6OA 4C1NI 4M3UA 3OFEA 3FFKB 4P7TA 5KG7A 1TR0A 3TZZA 3HZEA 1DURA 1U0SA 4RKUC 4CHYA 1DQ8A 1ZBSA 3SCJE 1SJRA 4QW8A 3AO5A 2F4VF 1UETA 3EKUA 2YQ1A 2KG1A 2HQDA 4O23A 1ZA1B 3IRXB 5L8RC 1ASUA 3C14A 4UUWA 4WCEQ 3R8YA 5E41A 3CHWA 2BKOA 4M1KA 1HJOA 4J91A 4DI6A 4MDBA 2HVDA 3DGVA 3TYTA 1HJRA 1DTTB 3QMLA 4JLHA 2GS8A 1DTTA 3G6ES 1RADB 2OKQA 2ZJRL 2DXFA 4QWAA 5E5NA 4W98A 2V8HA 3D2WA 1ATNA 1NK5A 5J2PB 5L38A 1YTAA 1DLOB 2VQEJ 3QFUA 3W2WB 3R1XA 3C7NA 2HFNA 1HA1A 2X1AA 2LQ8A 3BGUA 1IJFB 1XNRF 2R7RA 4DV5J 4CESA 4OHWA 2JH3A 2GMLA 3JYTB 2GTDA 2ZD1B 4ZCIA 1NGFA 1C0UA 2Q0RA 1ZTWA 2RF2A 4KT0C 3ZETA 2YCHA 3SMSA 3B6PA 1NKEA 2IS3A 3KDOA 1R8AA 3BDEA 1VQMN 2CQ2A 2VG6A 4ILJA 5IT9O 4ID5B 4NLXA 4JHDB 3IWXA 4KI6A 2PZSA 1NGIA 3BQ1A 3R5AA 2XMVA 3H46O 2JDJA 4L74A 3ULEA 2F5GA 2Y0BB 1FXXA 1GNKA 1QUPA 3SCXA 4P72A 4CNZA 1U26A 2BOAA 1J54A 1WF2A 3FC9A 2UXDK 1UPMB 4RR5A 4ZLJA 4WYLA 3N4PA 1XNQF 2PFUA 5HMZA 4I2PB 1MWZA 2DNLA 2L9NA 4ETZA 3N0VA 2WTUA 2YKPA 3Q8SB 4XK8C 4ANEA 3TP2A 3TJAA 2JEGA 4YHHF 1FRJA 1TZ0A 4PYDA 3W64A 1RU2A 5AQOA 1ASWA 3NH2A 3JQJA 1VAZA 1C1CA 3OL9A 4I68A 1X9WA 1CQNA 2F96A 4OPAA 2VG5A 2OD4A 1VIXA 2UU9K 2ZOGA 1S76D 1VLYA 3IGVA 4FJXA 1QJHA 5B08A 3O4WA 1QAJA 2VICA 3NHGA 4Q8EA 3T6BA 1ZBHA 2KKHA 2HIYA 2NXEA 3J7ZT 2ZOMA 1VS3A 4KH0B 3HD1A 2J8AA 3QPIA 5GAGP 4WFBQ 2VQFK 5LMNF 2G0IA 2VV5A 3NVMA 3SQOP 4RW7A 3S1TA 5CXTA 3UE2A 3C7NB 3B54A 3ITHB 1Q18A 3PUFA 4YHHK 1DLOA 1N52B 2B5JA 1X3NA 2AT1B 4WXWA 2BZ2A 5CQGA 1S9EB 4R5PA 2EPIA 3V81B 4IR1A 4Q5VA 1HNWJ 3MCOA 1HWUA 4K4WA 4WZQA 2BRKA 5C25A 2V4JB 1X4FA 2RUGA 2J0XA 2GCFA 1FWLA 2Z8QA 4DR7J 1DTQA 4NYPA 2GQ2A 4JI5F 3O9UA 4USWA 1WUAA 3KKSA 4HI1A 2HAIA 3CCJS 2HNDA 1HKAA 2ZOFA