1RT7A

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
536
structure length
535
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 139
structure length 535
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt7A05
3P83D 1IKWA 2HWHA 4DSKA 2QXFA 3NL0A 3JSMA 3CO9A 1FXXA 1VSJA 3ZSQA 2R2SA 3KLVA 4CJRA 1YVUA 2FVRA 3NF9A 3E01B 5HRRA 1QAIA 2OPRA 3AVLA 4M3RA 4W5QA 4FM1A 1S9EB 4NCGA 2HMIA 3UIQA 4FZZA 2KFNA 1R0AA 3QEPA 4U6PA 1VRUA 3AA5X 3QGHA 2UUTA 3T5HA 3MXIA 4CEDA 1KHWA 1KVBA 3KLFA 3DRPB 2QV6A 4O0IA 4Z4HA 2R2UA 5HLFB 5C25B 4KV8B 1S1VA 3OL6A 4E7KA 3MR2A 1JLBB 1J53A 3QEXA 4J9SA 2F8TA 4FLUA 4KHQA 3M9OB 4FK4A 4I7FB 2WONA 3AVIA 4MIBA 1S1TB 1RTHA 4FXDA 3M8SA 3NAHA 4CCHA 2JEJA 3LAKA 4GW6A 4HYKA 2HHQA 1QSSA 4MH8A 1REVB 2ALZA 3RMAA 2BE2A 4G1QA 2VG5B 4H8KA 1FKPA 3DLKA 5KFXA 2BRLA 5F8NA 1S6PB 1T03B 5F8MA 4FJMA 2JC1A 4Z4FA 4YR0A 1QHTA 3OJSA 4OLAA 2FJXA 3C6UB 3IG1B 4ZVFA 5KFNA 1FKOB 3NFAA 4ECTA 1RTHB 1S1TA 3NGIA 2ASDA 5J2MA 1SL2A 4URSA 2D3UA 5EUHA 1C2PA 4CEZA 4HHTA 1S1VB 4Q0BA 4RU9A 4F3OA 3NCIA 3NDKA 3HT3A 1VRTA 4QOZB 2VG7B 3SYZA 4LY7A 3B6PA 3O3HA 1R0AB 3T3FA 4IRDA 3OYJA 1SH2A 4H4MB 3L3UA 4M94A 4KPYA 1SKSA 4XPCA 5HROB 1NJZA 3F73A 3HVWA 3IGNA 4O55A 4AHUA 3QNNA 3KLEB 4IRKA 3KK3B 3KLHA 4NLUA 3AO4A 4KHMA 4DL5A 2C22A 4LSNB 1RTDB 1RBUA 3H5XA 1TKZB 4LQ3A 4RNMA 3DYAB 4JUZA 3OJUA 1IKYA 2W9CB 1Q9YA 1S5JA 3QLHA 2XY8A 2G8FA 3IS9A 1EETB 3H4DA 3HYFA 1HNVA 2D0AA 5KFHA 3Q8PB 4Y1CA 1RYRA 4ED0A 4Q5VA 1NHVA 4ED1A 3TABA 3PO5A 1ZBIA 4G3IA 5J2QA 4DTNA 4ID5A 4DTJA 3V9SA 4CJUA 1ZTTA 4KBIA 4H54A 3T1AA 1VSEA 2GBZA 1RT6B 4CEFA 3NF7A 1KLMA 2KW4A 3ZSZA 4NYZA 4O44B 1WSJA 3FQKA 3MR3A 2DFEA 1TKDA 2B6AB 4NYNA 2G8WA 1U04A 3PV8A 2JEIA 1KCFA 1T8EA 3AVNA 1RT5B 3TAQA 5KT2A 2HVHA 4OGCA 4M3WA 2KTQA 4DTPA 4NRUA 1QQCA 2QK9A 1WSEA 5KFSA 2CKWA 2X6SA 4NLPA 1C0UB 2AJQA 4CHQA 2YNFB 1RT2B 1C1CA 5T7BA 3G6YA 1KRPA 3AVMA 4QWDA 3MFHA 1RBVA 2XY7A 4R0EA 2BRKA 4KFBB 2R2TA 4N5SA 3UDLA 3HPOA 2KZZA 4BDZA 1GOBA 2FLLA 3V9UA 1ASWA 1TAUA 4IFYB 1S48A 4EBCA 3CJ4A 1NK9A 3VN5A 2G8KA 2IA6A 2RPIA 5L9XA 1C0TA 1XR7A 2ATQA 1RT6A 5KFPA 3DI6B 4CF0A 4E7LA 3BDPA 4TQSA 3OYEA 4ID5B 4CJ3A 1EXQA 5HRSA 1NJWA 4B9TA 4J9OA 1KSPA 5CYMB 2JGUA 2R8JA 2DPIA 2RF2A 2R8GA 3TAFA 5KGWA 1QUVA 2OPPB 3GILA 1KHVA 1JLFA 4ED6A 1WSGA 1MU2B 3HPGA 1ASUA 3CFRA 3IS9B 1ZBLA 3QLHB 1IKXA 3I0RA 3RAQA 3SV3A 2PY5A 3SFUA 3OVNA 4FJ9A 1TV6B 3AO1A 2WCXA 3DYAA 3PR4A 4ZHRB 2XRIA 2FVPA 5DLGA 3I0SA 2HVIA 1BQNA 3OYFA 3BSOA 3OYLA 4K8ZA 1BQMB 4AH9A 3KK3A 3OS2A 5HP1B 4MK9A 4NLRA 4ZPDA 4ECZA 4CK3A 4DQQA 4CEAA 4ELTA 2LSNA 1KFDA 4CGFA 1RT4B 5D3GB 3EPIA 1RBRA 4ZVHA 4JS5A 4FLTA 4DL3A 3DDKA 3QINA 4N41A 4IKAA 2JEFA 3V9XA 3A2FA 4NLOA 3AVJA 3WNGA 3NH2A 3Q8SB 1RCHA 3KKSA 1TGOA 4I2QA 3TAGA 4ED8A 3BJYA 3KK1B 3TVKA 3DM2B 2BANB 3KJVB 5CY4A 2IDOA 1MU2A 3RTVA 2E9TA 3ZT3A 1VSDA 2OPPA 4N56A 4CESA 4MKBA 2R7YA 3TI0A 4OKKA 4FM0A 1KVAA 1B92A 4QCLA 2RF2B 3K5MA 4B9NA 5CYMA 2Z1HA 1EP4B 1JX4A 2VG5A 2BE2B 2IJFA 3PW7A 3V9ZA 2AQ4A 3QETA 4RNFA 1TL3A 3GIKA 1NK8A 5DGBA 1DLOB 1NOZA 2Q3SA 4IR1A 4IRCA 3LP0B 3MXJA 2FC0A 3SPZA 4I7FA 1VSIA 4DQIA 4OKEA 3CJ5A 3V1QA 4RUCA 2IJNA 1RT7A 3HK2A 1RBSA 2BQRA 5KG2A 4CERA 1TAQA 4OJRA 1DTQB 1WLJA 2G8VA 1ASVA 3V4IB 4CF9A 1J5OA 1NKCA 3GIJA 2IC3A 3PW5A 1RTJA 4PUOA 3H4BA 2W8KA 2RN2A 1S9EA 3CYMA 4C8MA 3NH0A 3LPUA 1C1CB 2E9RX 5K14B 1VSMA 1JXLA 1S1UB 2YNFA 2Z1JA 3DRRB 3OL9A 2AX0A 3CJ2A 1JLGB 1S1XB 3PY8A 4F2SA 4NLDA 4IH5A 3H5YA 4RW9B 1U47A 2WB4A 1S4FA 1HMVB 4K4XA 3ZT0A 4DTRA 2XCPA 4DL7A 1KFSA 4U7CA 1C1AA 3LPTA 2B6AA 2VA2A 1BQMA 1L3TA 2EX3A 1BQNB 4RW8B 2YV0X 3H40A 4NLQA 1JLEB 3U3YA 3I0SB 2HNZB 2BR0A 3OY9A 1HNIA 4YP3A 1J9AA 2C2DA 1HYVA 5KG5A 3TARA 4F4ZA 2W42A 4EEYA 1O1WA 4PQUB 4EP5A 1HYZA 2HB5A 3PO4A 1TK5A 5KFBA 3M8RA 3HL8A 5KG4A 4DL4A 4ID1A 2HNYA 5KFAA 4DF8A 4N47A 1RDAA 1S97A 3MXMA 1S6QA 4KKOA 2YNIA 2HWIA 5L1IA 1C0MA 4B9VA 2XWYA 4PQUA 3KHGA 3SQ2A 3LWLA 4K4TA 2IBKA 4ZPCA 4FJNA 4RW4B 3UQSA 3DOKA 1UA0A 4DF4A 1Y97A 1GOAA 4DLEA 4PWDA 1XR6A 4QW8A 2AGQA 4IG3B 1RDRA 4DS5A 1LWCA 5DQGA 4CJWA 4CFBA 2V4QA 5J2NA 3OYDA 1ITGA 4OLBA 4IR9A 4FM2A 3U6FA 3OYMA 2JEGA 3FDSA 4RW9A 3L3VA 4DU3A 1YVFA 4KHNA 4TXSA 4BWMA 1YT3A 3DOLB 4YNQA 2OPQB 2R2RA 3LWMA 3HPHA 5SWMA 2BQ3A 4TN2A 5JUMA 5F8LA 1JLCB 4J9RA 4BE0A 4F4KA 1RT5A 1RTJB 4PUOB 4CF8A 4URQU 4DMNA 3DRSB 4O3QA 4FLXA 4H4OB 1S49A 3OYHA 4ELVA 3SCXA 5C42A 2W9AA 1GX5A 4JS4A 4TSXA 4FW1A 2HHTA 3V1OA 1S6PA 2JLEA 1KLMB 5F9LA 3LAMA 5F8HA 3DLKB 3LZIA 3N6MA 3KHRA 3FRZA 3C94A 4G1QB 2PZSA 1NK0A 1SH3A 4HKQA 4K4WA 3JYTB 5KG1A 2RKIA 2IM0A 3CDEA 3V6KA 4KHWA 3VQQA 4I9QA 4FLVA 4MQ3A 3ALYA 4QWCA 3PUFA 4O3SA 4FZXC 3WNHA 3IRXB 4E3SA 3PX4A 5SZTA 3SJJA 3B6OA 3MR6A 3KMSA 1HNVB 2A1RA 4CHZA 3SZ2A 3ASMA 1K1QA 5C25A 5KFJA 1EETA 3MEEA 5C24A 3O3GA 2D3ZA 5KT6A 4CEEA 1TK8A 3T19A 3EYZA 3MEDA 1N6QA 1XI1A 1RT1B 5DQHA 3GV8B 3QIPA 2HHSA 5FDLA 3AA4A 4WE1B 3BQ0A 1RTDA 4FZYA 3G10A 5L1LA 1QS4A 1U09A 3E01A 3AV9A 3KLHB 3BQ1A 2O5DA 2W9BB 4CGIA 1NK5A 3V6JA 4ZP9A 1IKWB 3RR8A 3CIZA 1C6VA 4TY9A 3QEWA 4JRPA 2ASLA 3CM6A 4FBTA 4DFMA 3QIPB 5KFMA 4WFZA 4CHOA 5I3UB 4CF1A 1RT1A 1S9FA 2IS3A 5HP1A 5FRNA 2FVCA 4FCYA 4KHUA 1BHLA 1JIHA 2HNDA 3P5JA 4CFCA 3HVRA 4DWIA 2ZKUA 5KFFA 3HVAA 2IOCA 1J54A 1X9MA 2B43A 3RMDA 4O4GB 1C1BA 5J2MB 3IRXA 1SL1A 3FFIA 2IM1A 3AVGA 3OYCA 4K4YA 4OGEA 1IKXB 3ZSWA 4JRQA 4FYDA 4CFDA 4ECWA 4R5PA 1QTMA 4MKAA 2FJWA 1DTTA 5HBMB 2AWZA 3QZ7A 1BISA 4B08A 1NNDA 2OPSB 4IG0B 1REVA 3AO5A 4KI4A 1TKTB 3OL7A 4KB0A 1I3AA 4BDYA 1IH7A 1NOYA 3DI6A 3S9HA 4ZVGA 3QGIA 1C0TB 3HHKA 4CFAA 2OYQA 4CK2A 2C2RA 4W5NA 2XHBA 1XR5A 3H5UA 3VQEA 3HVTB 4XPEA 1L3UA 3ZT4A 4F4YA 2ILZA 1VSHA 1NHUA 4ED7A 3MFIA 3SQ0A 1K1SA 4ELUA 5J1EA 3AO2A 1CSJA 4B9LA 4IFVA 4KFBA 1HARA 3CVKA 4ED2A 3C95A 1RT3A 1EKEA 1NKEA 1UWBA 2B5JA 4RZRA 1X9SA 3JSMB 5J2NB 3M9MB 1X1PA 4FJXA 3AA2A 3QERA 5DG9A 4IG3A 3TR8A 3HVTA 4BE1A 1L5UA 3AVAA 2ITGA 4W5OA 3ITHA 3OHBA 2R8KA 2V0NA 3L2WA 4J2AA 4CIEA 2F8SA 5CZ2A 2JC0A 4KSEB 1CXUA 3LP2B 4AHTA 1I39A 2VG6A 3LP1A 2ASJA 4KTQA 4WXWA 2YKNB 1FK9A 4EO8A 1WSFA 4O3NA 1KVCA 4HCCA 5JXSA 4CHYA 4IG0A 3G86A 3GIMA 4ECRA 1SUQA 2XO7A 3MR5A 5L1KA 3O3FA 1BIZA 2X74A 2ZD1A 1LWFA 4KTZA 4WFXA 2P1JA 2VWKA 3GV7B 1VSKA 3KLGA 3DMJB 1D1UA 4RNNA 3M8PA 4DTMA 2ZE2A 1C1BB 3ISND 1SUQB 4YMEA 3WNEA 3SFGA 3OHAA 4YFUA 4IOBA 4NLWA 2G8IA 1JXBA 2D0BA 5F8GA 1FK9B 4Q8FA 4AHVA 4UQGA 2W9CA 4F4XA 1QSYA 4EBDA 1T94A 2DFFA 4M45A 4J9LA 1U49A 1LW2B 4ZP8A 3ZSYA 4YQWA 1TK0A 1HQEA 4E1MA 3CQ8A 4LSNA 2YNGB 1QE1A 2HAIA 4ECSA 1TQLA 3NAEA 1GX6A 4WYWA 2W9BA 4Z4EA 1UA1A 1S1UA 5HROA 3VQ5A 2ETJA 3HO1A 4DEZA 3OYAA 4DTUA 3RBDA 4IFVB 4WE1A 2FBXA 4CJQA 2IC3B 3NH1A 2ZQBA 1SKRA 2RDIA 3DLRA 3VQ7A 1J5OB 3BREA 1YTUA 1D9FA 2OZSA 2RDJA 3MEGA 1WAFA 2Y1JA 1RT7B 3NBPA 4Y2AA 3G0ZA 1IG9A 3L8BA 4CJ4A 1TL1B 5KFRA 2QKBA 4EYIB 4O3RA 4W5RA 3SI6A 4J9KA 5KFLA 4QWEA 3PJWA 4NLVA 2WHOA 3K59A 4HUGA 3C6UA 3CDUA 3QYYA 1TL3B 4NLXA 2RKIB 4FS1A 4KB1A 1T03A 1EP4A 3KHLA 3V6DB 1D8YA 3PZPA 4CK1A 5HRPA 4CGDA 3RMBA 2D0CA 4DSJA 3KD1E 1BCOA 3AA3A 4B3OA 4CJPA 3KKRA 4FBUA 2XI3A 1D0EA 3D45A 4AHSA 1WSHA 2XGPA 4MK7A 1XC9A 1NK6A 2D5RA 4CEOA 1KLNA 5EWFA 4IKFA 3FFIB 1JKHA 2IMWP 4CIGA 4DU1A 1EX4A 1BCMA 4I2QB 4WZMA 4ED3A 4M3YA 1WNSA 4CF2A 5F9NA 4E0DA 1T3NA 4LH5A 4NLGA 4BWJA 5KFKA 2FLNA 1YTAA 5I42B 4TY8B 1TVRB 3AVHA 4OL8A 3DRPA 1VK0A 4Y1DA 1RYSA 1G15A 5E41A 4DG1A 3GQCA 3VQAA 4CJTA 4I9LA 3NGYA 3L2QA 4NCGB 1RT4A 5D3GA 1LW0A 1JLAA 1L3VA 4CGJA 2OPRB 5KT5A 3Q8RB 1TKXA 4F4WA 4OPJA 3DLGA 3K57A 2UVWA 3AVBA 4NCAA 5KTQA 1QE1B 2YNGA 2GV9A 1T7PA 3SI8A 4L8RB 3VQDA 4TYBA 1HQEB 3SUQA 1LAVA 5FDLB 4XIUA 1RAJA 2GC8A 2J6UA 4B8AB 4PY5A 3V6HA 3F9KA 2HHVA 4DTOA 1W0HA 4FJIA 2GIRA 2G8UA 3OYGA 3OLBA 3BR9A 4MIAA 4IBNA 1RA7A 1S10A 4Q45A 1JL2A 4M3XA 2CJQA 2FBTA 5EWGA 3S3OA 4FLYA 2ZE2B 5KFCA 4FVMA 2EHGA 2XCAA 3QESA 4ZVEA 2HHUA 3H08A 1VSLA 2F96A 3V81A 1Q9XA 4KHRA 3EY1A 3SPYA 4EBEA 2Z1IA 3CFPA 3I5AA 4ZPAA 3RMCA 2IM2A 3HP6A 1LAWA 2IAJA 4F8RA 1N48A 4LD0A 3HSTB 4LH4A 5KFWA 3I5CA 5C42B 2V9WA 1A5XA 4FW2A 1HRHA 4CJVA 2W7PA 1S9GB 2YNHB 4Y34A 4IFYA 3NHGA 4H4OA 4Q44A 4I2PA 1NK4A 3DRSA 3EZUA 4KO0B 2HHXA 4MK8A 4O5BA 3T5KA 1HMVA 1SV5A 5J2PB 4B8CA 1HPZB 3ULDA 1RDDA 1Q8IA 3PW4A 4FJLA 2OPQA 4K4VA 3DOLA 4ICLB 1C0UA 3LDSA 3DLEB 3KNAA 5KFGA 2W8LA 3TWHA 4KAIA 4KHSA 4FJKA 4FJ7A 3N6LA 1VSFA 4EO6A 3VQPA 3MECA 3RR7A 3OSPA 3SUPA 1S0MA 1WNEA 4QWBA 3PX6A 3OS1A 4PWDB 3IN5A 4Z4IA 4C8OA 3O4QA 2V4RA 4FJJA 4C8NA 4K4UA 2X78A 2XGQA 3EPGA 4IH7A 4RW4A 4DSEA 3LZJA 4IDKB 1RTIB 2NUBA 3CJ3A 1JLQB 3HM9A 4JV1A 4MFBA 4NLSA 1TKTA 5L1JA 2EC0A 3PW0A 1I6JA 4KKOB 1U4BA 3SQ1A 3HKWA 4E7JA 3PJXA 3ZT2A 5HBMA 2IGIA 2O4IA 4J9PA 3NKYA 4M41A 5DQIA 1T05B 3NMAA 4R5PB 4B9UA 3MF5A 5KG0A 4AILC 3VQCA 4DLGA 3KOAA 3DM2A 3NE6A 3KK1A 3L2RA 1CZBA 1A5VA 1X9WA 4ZMMA 3KK2B 1UOCA 4CHNA 5KT3A 3BGRB 3D0PA 2A1SA 2WOMA 3DLGB 4K4SA 3SQ4A 2KFZA 5KT4A 5I3UA 3HXMA 3M8QB 4O3PA 1JLAB 3QNOA 4C8LA 1Z25A 2XI2A 4DFKA 1SL0A 1GOCA 3P1GA 1S1XA 2UVRA 3M8QA 3PX0A 2VG7A 3RAXA 1RA6A 2WOMB 4O4RA 5T14A 4TY8A 1ZBUA 4Y3CA 2BQUA 1NK7A 3KLIB 3K5NA 3BGRA 3IGVA 3VQSA 3TQ1A 3KK2A 2AGOA 4DFPA 2C2EA 4HUEA 4HCBA 3MEDB 1N6QB 3I0RB 4RW7B 3MEEB 5C24B 1JL1A 4FJ5A 3IG1A 4K50A 4K8XA 3KTQA 4CJ5A 2ATLA 2FLPA 5KRSA 2UVVA 4DQPA 5CYQB 4B3OB 5KFQA 2I5JA 4DU4A 4FJHA 1SH0A 3V6DA 4R8UA 5KT7A 1FKPB 4J2BA 3LP0A 3H59A 3RWUA 3MTKA 1DLOA 4ZP7A 2C28A 5KRTA 1D9DA 1OS5A 4F50A 4MFBB 1LWEA 3JYTA 1JLQA 2WK4A 4FJGA 3RB3A 2E4LA 4R8UB 3GIIA 1NJXA 4NCBA 2PYJA 4DTXA 5KFZA 2FBVA 1U45A 3G6XA 3L2UA 3VQ4A 3MAQA 1JLBA 2OH2A 4KV8A 1CZ9A 3MEGB 2YHBA 5HLFA 1WSIA 3V1RA 3H5SA 2BANA 3KJVA 2VWJA 2DTUA 3ZSXA 1VRUB 2IM3A 1JXEA 3D28A 2P51A 2WTFA 5DLFA 2DPJA 2XY6A 3TANA 3OYKA 4CEQA 3DLHA 3PR5B 3CDWA 4N76A 1RT2A 4ZPBA 3DLEA 4XO0A 3SUOA 3RRHA 3AVCA 5KG3A 3DLBA 4B9MA 3QIDA 2I1RA 4AHRA 1S0OA 4CEBA 1S0NA 1SV5B 4KE5A 3RRGA 3CG7A 4DSFA 1LW2A 1HQUB 5FRMA 4I2PB 2KQ2A 5KFOA 5EDWA 4ZTFA 1S9GA 2YNHA 4BACA 3VQ9A 1LWCB 4CGGA 4FS2A 4TYAA 2QKKA 2HW3A 4FJ8A 3WNFA 4ECYA 4BDPA 5KG6A 3S3MA 3FQLA 5KG7A 1TV6A 4ECXA 4TQRA 3QO9B 4J9QA 4NLYA 4EP4A 2OA8A 4FK0A 1K6YA 4LQ9A 3GV5B 4X2BA 1N5YB 1LWFB 3BQ2A 3ZSVA 2YNIB 3H2LA 1RILA 4DQSA 3ICLA 3ZT1A 4K4ZA 4CE9A 2F8EX 2W7OA 3AO3A 3K5OA 1N5YA 2PYLA 3UPFA 3CWJA 3PVXA 3NF8A 4URGA 1RTIA 4IDKA 2VG6B 3QO9A 4BE2A 2G8HA 5JS1A 1HNIB 4HVJA 4M3UA 3S3NA 1TKZA 3K5LA 2HNZA 4FLZA 4E1NA 3OSNA 1JLEA 4RW8A 3OYNA 1B9DA 4JV0A 3KLEA 3VQBA 2DY4A 3MECB 5CZ1A 1HQUA 4RG8A 1UWBB 2B5JB 2UVUA 1UAXA 4OVLA 4KREA 4E7HA 3QZ8A 1RT3B 3ZSRA 3CJ0A 1BGXT 1LW0B 3FSIA 4H4MA 4DS4A 1RDBA 4M42A 2UUWA 1JLGA 5DMRA 2WRMA 1ZBFA 3OL8A 4RW6A 4NZ0A 4W5TA 3K58A 1VRTB 4ICLA 4PA1A 3DRRA 4C8KA 3ZSOA 1ZETA 3CM5A 5K14A 5I42A 3K2PA 3HJFA 4B9SA 3ZCMA 4KI6A 4Q43A 3C6TA 3HP9A 2AGPA 5J2PA 2AX1A 1KTQA 4J9NA 3RBEA 3NAIA 5KFVA 3NGZA 2YHAA 3OYIA 4HUFA 4FK2A 3V4IA 4KRFA 1DTQA 3RB0A 1U48A 4F2RA 3LP3A 1NJYA 2E6MA 4O44A 2HHWA 2OPSA 4NLTA 4F3TA 1XHXA 4E89A 1ZTWA 2Y1IA 5KGXA 4Q8EA 1DTTB 1LWEB 3OLAA 1B9FA 5J2QB 3TAEA 3ISNC 4E7IA 1TL1A 2WONB 4CJFA 4YR2A 2J6TA 3VA0A 4O4GA 5DGAA 2I5JB 4KHYA 5CYQA 4M95A 3THVA 3NBPB 1W25A 2R8IA 4WZQA 2D7SA 1N56A 4OKJA 4CGHA 4J2DA 4RW7A 3KLFB 1IKYB 1RBTA 3KHHA 1IKVA 3E51A 2AU0A 3GYNA 5C5JA 3I8DA 5KFYA 4ECUA 2YKMB 3KLIA 1RDCA 3RB4A 2XC9A 2FVQA 5DG7A 1MMLA 4KAZA 4NRTA 1TKXB 4Z4GA 1QSLA 5KFEA 3VQ6A 4DL2A 3SNNA 2YKMA 2B4JA 4IH6A 4KB7A 1A5WA 1Z4UA 1IM4A 1IKVB 1ZYQA 4DG1B 1W9HA 3QEVA 3V9WA 1TVRA 4QAGA 4EZ6A 1RNHA 4Q0BB 5DK5A 3EZ5A 2VA3A 3T5LA 4O3OA 2FBYA 2D41A 2P5OA 4ZHRA 1CLQA 1S1WB 1TP7A 2BGGA 3KMQA 1BI4B 1WAJA 1JKHB 4NYFA 3KD5E 4AHCA 3OYBA 3O4NA 4QWAA 3DMJA 4WXOA 4GMJB 4WYLA 1FKOA 1JLFB 1T05A 2ZD1B 1XHZA 4CJEA 4LSLA 4E19A 2E6LA 3T5JA 3BSAA 3M9NB 4GVMA 1HYSA 2FJVA 3RB6A 4M3ZA 4HTUA 1Z26A 4JLHA 4YR3A 3LP2A 4Z0UA 2ILYA 5KI6A 3U3GA 2X6NA 3ITHB 1JLCA 1NKBA 3BSNA 3C6TB 1XWLA 5EU7A 4TLRA 3Q8QB 3NF6A 2O4GA 5KFIA 3UR0A 4DTSA 4CJSA 4RW6B 5EWEA 2FVSA 4KTWA 5KFTA 1WN7A 1HJRA 2Z1GA 4ZTJA 4O0JA 2HMIB 2R8HA 3AVFA 4CJKA 2KZMA 3L2VA 3BSCA 2GUIA 3D5MA 4FLWA 4QPXA 3N6NA 3TAPA 4RNHA 5J1EB 3LANA 5F8IA 3H98A 3I5BA 1N4LA 1LV5A 2XY5A 5JS2A 1HPZA 5HRNA 3KIOA 2OZMA 3TAMB 4CHPA 4KO0A 4WFYA 1D5AA 3DOKB 4GC6A 4EYHB 5FROA 4DQRA 3QEIA 3QGGA 3PHEA 4Z4CA 4DSLA 3CFOA 5F8JA 3VA3A 2IAJB 4EZ9A 1ZBHA 1HYSB 3OS0A 4GC7A 4QW9A 1S6QB 3AVKA 4DFJA 2J6SA 3M8PB 4LSLB 1BIUA 2P5GA 5KFDA 4J2EA 2HNYB 4RNOA 4DL6A 3KLGB 4ECQA 3LALA 4CJLA 3SUNA 4CECA 3V81B 4CIFA 4RUAA 4Y2CA 1L3SA 4ZP6A 5KFUA 2GIQA 2BDPA 1F21A 4J9MA 5DG8A 4IQXA 1BI4A 4ECVA 1IO2A 1S1WA 3VQ8A 3QIOA 2DFHA 2QE5A 1BL3A 2HNDB 3PW2A 2YKNA 3NGDA 4OPKA 1SKWA 2E9ZA 3LP1B 4M3TA 3SV4A 4DSIA 1QAJA 3IAYA 3TAMA 3G6VA 1CXQA 4JV2A
chains in the Genus database with same CATH superfamily
2HWHA 2QXFA 2DR8A 3GFZA 1VSJA 3ZSQA 1UVNA 3VV2B 3E01B 4M3RA 4FM1A 1S9EB 4AL5A 3HHLB 4GV9A 1R0AA 3QEPA 2RE1A 4U6PA 1VRUA 1KOHA 1NNEA 4CLLA 4Z4HA 2R2UA 5HLFB 5C25B 4PCQA 3VETA 3Q8VA 4JHDB 3MR2A 2ZFHA 1GQEA 2E1YA 2XMJA 2HK2A 4KHQA 2LCWA 1RBLA 2ZHBA 3NWRA 4FXDA 4CCHA 2JEJA 4RX6A 1BOTO 4FO0A 1QSSA 3CE8A 3KJQB 3Q7CA 3FSYA 2MJNA 3L6QA 2VG5B 2P9LB 5KFXA 3SEOA 1S6PB 3QAUA 3TO8A 4PABA 5F8MA 5BR8K 4FJMA 2W4DA 2BVZA 3MPDA 2FJXA 3IG1B 2NRRA 1FKOB 4ECTA 1PYOB 1ESVA 3AOBA 3L9ZA 4URSA 3PRDA 3IAM9 2H9ZA 1YJ9N 1WOQA 1RFQA 2D3UA 5EUHA 4WBFA 3CD7A 5M2UA 1JK9B 3N01A 5BR8J 4NZ7A 3CQYA 4HHTA 4Q0BA 4H0PA 4A8KA 2NSCA 3NDKA 3HT3A 3D2EB 1W7AA 3EXCX 4BR4A 1TL7B 2NXNA 3SYZA 4CWBA 4IRDA 3L3UA 3N28A 1SKSA 4KY3A 5BPMA 5HROB 3F73A 5LSRA 2RHQB 2PMWA 3KK3B 3KLHA 4JYAJ 2PT0A 4LSNB 2DBBA 4YOYA 3T9ZA 4OZ5A 1TKZB 1HHSA 1U1PA 3K0SA 1BY9A 1O6XA 3WXMB 2O8DA 3NOGA 1FWPA 3OTOK 1EETB 1LFPA 2JNJA 3H4DA 4OI6A 3HYFA 2MSTA 2J5AA 5IQQA 3AB2B 4DR6F 5CABA 1U02A 3TABA 2A5XA 2OKQA 1HKGA 1U1RA 2H5EA 3V9SA 4F04B 2DGTA 4H54A 4A4JA 3LPYA 4DI6A 4CEFA 2NLXA 4DN0A 3WC2A 4U95A 2XO6A 3BDEA 1H2UX 2E5LK 2BKPA 2DFEA 1YBTA 2J8AA 2DISA 3CHWA 3T6BA 3VR1A 3VAKA 3Q24A 3PNIA 4WP3A 4LF7J 3JS6A 1ZA1B 1RB0A 3R5CA 1O51A 3AY0A 3JQJA 4YDDB 3F9MA 4OGCA 5BYSA 1RAIB 2KHOA 1ZM3A 2KTQA 2OTLS 1QQCA 3O6QA 2F40A 2JVRA 3JS9A 5KFSA 2X6SA 4B1ZA 1P6TA 3MXHP 1RT2B 3R5JB 5T7BA 3AVMA 5F1XA 1YJRA 4QWDA 1RBVA 3O8MA 4ILJA 2MB0B 3FZKA 3KJNB 4BDZA 1GOBA 1SPBP 1V4TA 3V9UA 3P49B 1TAUA 3GU0A 3TUJC 3IM8A 1A0OB 2YWGA 2VGMA 4ISFA 3VN5A 2V51B 1H6KX 1T9TA 2IA6A 4BRDA 5F2RA 4OIXA 4D3HA 5KFPA 1U8WA 2GCFA 1VHXA 4BRAA 3DI6B 3BUZB 1J5EK 3DGVA 4P75A 3OV7A 3HJVA 2QA4N 4CJ3A 1EXQA 5HMYA 1VC5A 1HW9A 1R8HA 1H72C 2OIHA 1NU4A 5GINA 2VBYA 2R8JA 2RF2A 4Y0FA 3TAFA 1NZAA 4M8LA 4JI4K 2A10A 2OPPB 1X60A 3OVSA 3GILA 1KHVA 5KPTA 4LFBJ 3HPGA 4R25A 5GMDA 1ASUA 3IWLA 4WFBQ 1BXNA 4CO2A 2AW0A 4FJ9A 2AJ1A 3AO1A 1V3SA 3DYAA 4LF8K 3ZEUB 1S72S 2XRIA 3I0SA 2HVIA 4V19S 1BQNA 4M1KA 1BQMB 2ASPA 4MK9A 4DPXA 1RISA 1B4SA 4ILGB 2KN4A 1RBRA 4ZVHA 4NI2B 5DDPC 3ZO7A 3L95X 4OV6A 4LFAJ 1VQ7S 2ZBRA 2DR7A 4NLOA 2UXDK 4RKUC 2W01A 4P7TA 4CZEA 3Q8SB 1TGOA 4I2QA 3TTCA 2DHGA 1SVDA 2Q79A 3CSKA 3F2KA 4ES1A 3GYXB 1ZZFA 1KVAA 4OO1J 5IC4B 1ZPWX 1B92A 1C4AA 2B9EA 1JX4A 2VG5A 2IJFA 4KR0B 4LT6A 2AQ4A 2Q31A 2HZAA 1B3TA 1TL3A 1YJNS 3GIKA 1NU0A 5F0UA 5DGBA 1DLOB 1NOZA 3QMQA 2Q3SA 4IR1A 4IRCA 4BR9A 3SPZA 2EVZA 4OKEA 3CJ5A 5DS7A 3V1QA 2MKJA 2IJNA 1VJQA 1MA9B 1TUYA 3CCWA 2NR0A 3QJLA 2G8VA 4B3SK 1V3ZA 3V4IB 3MD1A 5H9EJ 2N7YA 4UTGA 1NKCA 2IC3A 4ER8A 3SSRA 1FTCA 3N79A 2QM1A 4C8MA 1VSMA 4A5BA 3FMWA 1U26A 2AYBA 1SQKA 2VQEJ 3Q23A 1JLGB 3VALA 3H5YA 4RW9B 1F5AA 1HMVB 2CPFA 1CJTB 4K4XA 3ULHA 4I6WA 4DTRA 2FHJA 1DJ0A 3ZETB 2V7ZA 5IT0A 4C23A 1BQMA 1Q5YA 2CPHA 1ITPA 1MW7A 1U24A 2BR0A 4M5DA 2GHVC 4OLOA 4OYMA 1VR6A 1J9AA 2C2DA 3HHLD 5KG5A 3VVTA 1FX2A 5I3QA 3TARA 3B82A 5AQWA 1FNOA 1NGEA 5KFBA 3FEZA 5B0DA 4OZJA 1UFLA 1RDAA 5GIOA 3M2UA 2OTJS 3MXMA 3MPWA 2J0QD 1S76D 1S6QA 3IR6B 1C0MA 1IJFB 2KU7A 2YJEA 1RUSA 2HZVA 4U8VA 2MQMA 3LWLA 4ZPCA 2OFHX 4FJNA 1P1LA 1DQAA 3DOKA 4RL1A 2GVZB 3THXB 3RAMA 5AQTA 4PWDA 4OJHA 4DS5A 3R5GA 2UXCF 1CS4A 3TEHB 4CFBA 2KG1A 4JKGA 2V4QA 4BRPA 2R7VA 3OYDA 3ZETA 1FXDA 3H2VE 3T7ZA 3G71S 2QIFA 5A2QY 5LJ5Y 3OYMA 3I96A 3SCLE 2WBRA 3T41A 2V50A 4CBWA 1VQKN 4DU3A 2DNMA 1FXLA 1YXQA 2KHCA 3DOLB 3VEYA 3LWMA 3GJQB 4CH1A 2Z2MA 3H20A 1JLCB 4J9RA 5DDRC 4KHPK 1S6UA 4F4KA 1WKJA 3HX9A 4CZJA 1RTJB 4DMNA 3DRSB 4O23A 4O3QA 2AF6A 3AAQA 2EFVA 3OD2A 4DV1K 1WC6A 4X84A 2HHTA 3GWCA 4YB7A 1KLMB 3S41A 3KHRA 5KG1A 2RS8A 3CDEA 4OYZA 1YIJS 1T3OA 1TU0B 4QWCA 4A57A 3PUFA 4CW7B 4O3SA 1NMEB 4QYZJ 1S6OA 1R7IA 3KMSA 1HNVB 2A1RA 4QS8A 1N32J 1K1QA 1CQMA 3KWGA 2D3ZA 2ZBQA 5KT6A 1HBUB 4IWVA 3T19A 1XI1A 3MEDA 1N6QA 2YHWA 1RT1B 1W26A 3GV8B 1KD1T 3WHIA 1R6YA 2IVYA 4YEAA 1U09A 3E01A 3PACA 3BQ1A 1NLKL 5LMNK 4ZLJA 2HBQB 2L3MA 1WKKA 1OY8A 3VEZA 1AFIA 1HNXK 4JRPA 1S9FA 5FRNA 3M8WA 3D2EA 2BABA 2FVCA 1RDUA 1T0TV 1U8SA 1JIHA 3VGTA 3HD2A 3RSEA 2ZKUA 2APOA 2MY7A 1J54A 1X9MA 2FHOB 2E1ZA 5LJVA 4MT1A 2CWXA 5D6GA 2IM1A 3OYCA 1TELA 1IKXB 5IWAJ 4FYDA 3ZSWA 4JRQA 5C2FA 3ZZZA 1QTMA 2FJWA 2MKKA 2DPNA 1DTTA 1QAXA 1K47A 3B54A 2N4DA 1KQSM 1EHWA 2AIRB 2WW8A 1BISA 4B08A 2YWEA 1NNDA 2ZITA 2FIUA 2OPSB 4NXMJ 3S01A 2WVDA 1U6FA 1Z2LA 4KB0A 4LF5K 4BDYA 2AEFA 1GXUA 3MM6A 2I6WA 4L75A 1RDWX 1C0TB 2C2NA 3OTOF 2YTCA 4C11B 2C2RA 4W5NA 4P72A 1XR5A 3JAMU 3H5UA 2VU5A 5FPMA 8RUCA 1VSHA 4ED7A 4JI0K 4BQLA 4ELUA 1RKJA 4WF9L 4NA2A 1LQ9A 3AO2A 1UETA 4MO5A 3JTOA 4KFBA 1HARA 4PR6A 3C95A 1HD0A 4M5GA 3LA0A 5HVGA 4E98A 3JSMB 5J2NB 1K73T 4GKJJ 3TA0A 2BH1A 2N3LA 2D9PA 3KUGA 3ILJA 1J27A 3OHBA 3L2WA 3LH2S 2EKYA 2JC0A 3QBXA 1WBBA 2BZ2A 2VG6A 3LP1A 2EI5A 2YKNB 2QZ8A 1OO0B 1YZ7A 1WSFA 1TZ0A 4HCCA 5AXNA 3EVOA 2RILA 2W2QP 2RQCA 4IG0A 3GIMA 5HK4A 1YSJA 2BM0A 3NEKA 2XO7A 2ERRA 4CZGA 4YHHF 3O3FA 1BIZA 3CCQN 2ZD1A 1CULB 3LOUA 2P9SA 4LFCF 3DGPB 1AFJA 1SB6A 3WQPA 3CCEN 1VGYA 3TA2A 4WFXA 1QZ6A 3AOCA 2DNZA 2D1KA 1VSKA 4CZCA 3KLGA 1D1UA 4HI2A 3TUIC 3B4DA 2CVIA 1C1BB 2YHYA 3O1BA 3BPSP 4YMEA 2DNYA 3WEEA 4OHVA 4YY3F 2RUGA 2RIJA 5HATA 1FK9B 3I6PA 4AHVA 2P5VA 1FE0A 3R3TA 1S72N 3ZTPA 3W5ZA 2W9CA 2X3GA 1QSYA 1U49A 3BGOP 1H0HB 1RHQB 3BYPA 1TK0A 1SQGA 1S79A 2V8GA 5EX5A 3CCVN 3CQ8A 4LFAF 2ACYA 1NH8A 1QE1A 4H0VB 2OMOA 3ADAC 1HR0F 2QLWA 1VQ8S 1ROFA 4IQMA 2RSQA 2CDQA 2VBWA 3V5RA 2VPYB 3OYAA 4DTUA 3TEGA 1Y3JA 2OTJN 2HQFA 5CQGA 5IC6B 1D9FA 1H38A 3M1VA 3LDQA 3BZKA 3TJ9A 3H0PA 4C1NI 4JYAF 2DNQA 4Y2AA 1IG9A 2HBLA 1YIJN 1TL1B 3O5BA 5FPNA 4J9KA 4IO1A 3PJWA 2ZM6J 2XULA 4NLVA 3K59A 5ETLA 1ZA2B 3FEXB 4WFNL 3TJ8A 4NLXA 2W7AA 4KB1A 2ZVSA 4CK1A 5HRPA 3RMBA 4DSJA 3KD1E 4KGXB 3G71N 4B02A 3AA3A 4B3OA 3KKRA 3D45A 1D0EA 1WSHA 3JSRA 4DV7F 2AP1A 3EMTA 1FD8A 1XC9A 1URRA 3W1YC 3AODA 2PFUA 1X5SA 1KLNA 3FFIB 4GNIA 4FDFA 4M3YA 5GAGU 4LH5A 2DHHA 1UZHA 3CPEA 4TY8B 1WC0A 3AVHA 1KD1O 3GDQA 1HPMA 2XZTB 3GQCA 1NG9A 4I9LA 4J91A 2A6OA 1MN7A 4JP8A 2DNLA 3NGYA 4WPAA 2CJYB 5D3GA 2VIHA 1IQTA 2DGXA 1L3VA 4OQJA 2OPRB 1EWRA 2P9PB 3GG0A 4HL9A 3Q8RB 2J9CA 3D3CJ 4GVLA 4CJ7A 1JJ2M 3AVBA 2YKAA 2YNGA 2GV9A 2Z56B 3N5BA 3VGLA 3AH6A 5FDLB 4B8AB 1I94K 5K8OA 1WHWA 4B3SF 2W40A 3VZHA 3MDFA 1Q81T 2C2MB 1W0HA 3H3OB 4A8XA 2GIRA 2G8UA 2BX6A 2OD4A 2BYCA 3FUYA 4MIAA 3KDNA 4B1VA 4Q45A 1OIAA 4A61A 3GLJA 2CJQA 3MOZA 2EEYA 3AY9A 1X0FA 4LRDA 1SJFA 3QT5A 2P9KA 3SPYA 2Z1IA 3SK3A 3CFPA 4ZPAA 4FPAA 1AT1B 1N88A 1LAWA 4F8RA 1N48A 1X5OA 3MR7A 3HSTB 4FYWB 2PAVA 1A5XA 3VGVA 4FW2A 4EFAC 2C1EB 4H4OA 1NK4A 2UU9K 3ULEB 4MK8A 3ID8A 1HMVA 2K7JA 1SV5A 4B8CA 1RDDA 1Q8IA 4FJLA 2OPQA 4K4VA 2NLWA 1GH8A 4ICLB 1C0UA 1WHVA 1E4FT 2BXJA 4AM7A 3TTFA 3SSSA 3EGVA 3TWHA 5LMUK 4A8OA 2B51A 2HFUA 3N6LA 4E1JA 3CMES 5DM7L 3VQPA 1H74A 3D4JA 3MECA 2UUAF 4CD3A 1YVNA 3OSPA 3SUPA 3HSJA 3S6EA 4QWBA 1SQFA 1JXVA 3PX6A 1JCFA 3OS1A 3IN5A 2OEKA 2XMMA 3O4QA 1FNMA 2Y8YA 2V4RA 4LIWA 3A5LC 4FJJA 4K4UA 4JI1F 3EPGA 4IH7A 2CZ9A 4LF6F 4W92B 4ILLA 4IDKB 5CD4A 4A5AA 3ENVA 1NGHA 4A46A 1N5SA 3UD3P 2EC0A 1A9NB 4JI2K 1I6JA 3A3NB 5E26A 3HKWA 3WC0A 3O5TB 3ZT2A 4UZBA 2O4IA 3MZIA 4M41A 5DQIA 4R5PB 1N34K 4IO9Q 1V9OA 4U8YA 1IG8A 3MF5A 5KG0A 2ZOGA 3DM2A 3WIUA 3RUBL 4FPIA 2KL8A 3L2RA 1QAYA 2HEKA 5LMUJ 1UCNA 4M5DB 5KT3A 3BGRB 4FVCA 2UUAK 2WOMA 3DLGB 4K4SA 3PSFA 3SQ4A 1NDPA 2M8HA 4RTFD 3M5RA 5I3UA 1VRQC 1HWKA 4NI2A 5E3CA 2VKRA 4C8LA 4P6QA 2XI2A 1GOCA 3P1GA 2JVOA 4L3KA 1Q18A 2VG7A 1RA6A 1RADB 3D7EO 4CZHA 2M2BA 4V1Ak 4TY8A 2FB0A 3OUYB 3ZX2A 3HFZB 2VL1A 3KK2A 2A18A 5BXIA 3M32B 2HRTA 1MWMA 2E5HA 5C24B 2XB2D 1JB0C 4FJ5A 3JXUA 3QQCD 4EU0A 4CJ5A 5KRSA 4B3RK 2XWXA 2UVVA 4DQPA 4B3OB 5KFQA 1SH0A 5KT7A 3LP0A 3CJKB 1HI8A 2G2OA 3OR2A 3CXCR 1D9DA 1BU6O 4DR6K 3JYTA 2Q43A 1JLQA 2WK4A 1B7YB 3RB3A 4R0JA 2PYJA 4N7TA 5JLFA 1U45A 1R0CB 3UVJB 2JLGA 3CD6N 4DQ8A 1WSIA 3ZSXA 3D2FA 4WIIA 1QJHA 1JXEA 2DITA 3D28A 4OI2A 5E33A 5DLFA 1VQMS 3AARA 4FWPA 1NBWA 1SIWB 2WC9A 4KJIA 3DLHA 3PR5B 1MN9A 1RT2A 2WVBA 5KG3A 3U02A 1ATNA 3DLBA 4B9MA 1HBMB 3R5BA 1WG1A 4JD2B 4WWSA 5LY3A 3EM1A 2BJ7A 1LW2A 5DO2A 4DSFA 4U7UK 3V4MA 5F3TA 2CJKA 3CCZA 4JI7F 1FJ7A 2BJDA 4FS2A 2ZGYA 1F6TA 2PEBA 4PKGA 4FJ8A 3WNFA 4ECYA 5E3QA 5KG6A 4CQ1A 3QSIA 2YWKA 2POKA 5AJ3K 4EP4A 1Z6RA 1ZM2A 3DXKA 4I6MB 3J7YP 2WB1D 4X2BA 2YKQA 2W41A 1HA1A 4TU7A 3FGVA 4DL0C 3ZSVA 3M6GA 3WZ0A 3ICLA 2KM8B 3ZT1A 4DX7A 4K4ZA 2X1BA 1VHIA 2F8EX 2W7OA 2VOPA 1QVGR 3CWJA 1S57A 4IDKA 2JRSA 3CD6S 2VICA 2O8DB 2G8HA 2CYYA 4CI0B 4LF4F 4E1NA 2C3PA 4RW8A 2YX7A 3VHQA 1JNZB 3KLEA 3MECB 4P9SA 3M6WA 3K9JA 3P39A 2FDNA 1MROB 5FJ4A 4DMZA 1KP6A 5EX0A 2MGZB 3QDKA 2JWKA 4M42A 1NGJA 2WRMA 3OL8A 4RW6A 2RS2A 4B3TF 3E9LA 3ZSOA 4Y2MA 3GONA 3NMRA 1VMBA 5I42A 1A7GE 3HJFA 1RK8A 3ZCMA 4KI6A 5GMKa 3RU0A 3C6TA 2J7UA 3HP9A 2AGPA 4BC9A 1QY7A 3JAMY 3HHDA 2VC1A 3ULEA 3KUEA 3OYIA 3NG8A 4HUFA 2H1YA 2ZZTA 4I68A 1B99A 4JV5K 2ZNYA 2QLJB 3LP3A 3GB0A 4O44A 2D3O1 4NLTA 1XHXA 1AYEA 4Y6IA 4HTLA 5KGXA 4Q8EA 3ENBA 1DTTB 4GKKK 2LVWA 4DJBA 1Z1ZA 2QMWA 4A2BA 4I56A 4YN3B 4A47A 1KQFB 1ZZNA 3ISNC 1JJ2R 2C42A 1XK8A 1TL1A 1C4CA 4YDXA 1QQOA 3EVWA 3TUPA 1T6CA 2J6TA 4DR4K 1UJ4A 1VQLN 2QMXA 3CUNA 4PG5A 1FVQA 3QFUA 5IV3A 4ANEA 4OKJA 1HBOB 4CGHA 2OSQA 1FDDA 1IKYB 3KG4A 3J81j 1U2CA 1IKVA 3E51A 3R27A 4A48A 4ECUA 1S99A 3MD3A 4RCHA 1CC7A 4CLWA 2XC9A 1MMLA 2V2QA 3LPEA 3NS6A 1TKXB 3KG0A 2HQGA 1QSLA 5KFEA 3SNNA 2YKMA 3GSDA 1VBYA 2HGNA 1VQ7N 4ZIWA 1A5WA 3HRGA 4JI0F 2VUGA 1HX1A 4PKHA 2E1CA 1W9HA 3DRYA 2HHHJ 3V9WA 1FA0A 1TVRA 5FLXU 4EZ6A 1RNHA 1X31C 1VBZA 3ZYYX 4ITSA 2DJWA 1BG3A 2HMPA 1JKHB 2JJ4D 4ETXA 3VGSA 4NX9A 1UVKA 3A12A 1JLFB 1Q79A 2MQNA 3NLCA 2XBPA 1XHZA 1WOSA 3MOJB 4E19A 2LEPA 3KJFB 5HVFA 4ZN1A 1KXPA 1IBLJ 5U47A 2FJVA 3RB6A 3GE1A 5CAAA 1NZ8A 4OYOA 4HTUA 2EPIA 4FF3A 1S3XA 4ZVOB 2ILYA 4PL7A 4CYUB 3EDQB 5KI6A 3U3GA 2X6NA 3Q8QB 1H7WA 2WVCA 2Z30B 2M9KA 2O4GA 2HS4A 4DV2K 5KFIA 1URNA 4JI7J 4CJSA 3G6ES 2LP4A 5EWEA 3UI3A 3SMZA 1OWXA 2YWHA 4O0JA 2HMIB 2IHR1 2R8HA 3BF1A 1E6VA 1ULRA 3AVFA 4CJKA 3UNYA 3THYA 1U1NA 2HBZB 1VQSA 1RAGB 3O44A 5F8IA 3PHTA 1HQ2A 1WC5A 1N4LA 2XY5A 5JS2A 2UXBK 3NS5A 2P9IB 3KIOA 2OZMA 4HTIA 4XAKA 4WFYA 3DKDA 2E2OA 1ATRA 4GC6A 4LFBF 5EX3A 3QMLA 3QEIA 1DGKN 4PXEA 5AZIB 2Y1RI 5A8WB 4MKYA 2EXUA 4X4PA 4USJC 4ZVTB 1HYSB 3LF0A 3NNAA 3OS0A 1S6QB 1HKBA 2NRTA 3M8PB 4LSLB 4DL6A 4RNOA 3N4PA 3D7SB 4EIAA 4ZDNA 3TJAA 2CQ4A 4CJLA 2ADBA 2Q36A 3V81B 4BC7A 4GV3A 1FJGF 3MAAA 2CH6A 3I56S 5DG8A 3PIPL 4IQXA 2UXBF 4C3KA 1S1WA 1TUGB 3W0LA 4CO4A 1MMDA 3VQ8A 1OH8A 1HKAA 1L3KA 2QE5A 1BL3A 2HNDB 2YKNA 3NGDA 2LDIA 2LLZA 3MN6A 3UW1A 2XYGB 2ZHOA 4KHPF 3QRPA 3SV4A 3TZZA 2KI2A 4C2MA 4DR7J 2X1FA 3G6VA 5AXLA 4FSVA 4ILHA 1WEZA 2IYIA 4QR0A 4AD6A 1RGIA 2IVMA 5ELZA 3SCJE 4CJRA 4JI8J 3NF9A 2EG1A 3AVLA 4BROA 1S59A 2HMIA 2P9GA 4FZZA 2LQJA 4NLCA 4E8UA 4YOXA 4F3MA 3O9UA 3T5HA 4X66K 1KVBA 1ZOTA 2RAQA 3DRPB 2QV6A 1OVQA 1WF1A 2DGUA 3US5A 5GAEP 1DEJA 1BO5O 4E7KA 1S1VA 1REGX 5D8HB 2F8TA 4FLUA 4EK2A 3SAGA 3J8AA 1V4SA 1XBWA 2OCEA 5JVHQ 4FK4A 1CZAN 4H5RA 4LFCJ 4I7FB 4WF9Q 4M5MA 1U1KA 4OZ1A 3NAHA 4NXNK 2HHQA 3I82A 2W25A 4DUYK 4MH8A 1REVB 2ALZA 3FLCO 3RMAA 2BE2A 1YX2A 3C46A 4H8KA 3DLKA 4YY3J 1VBXA 2WSFC 5F8NA 2XSJB 3FKBA 2DO4A 4Z4FA 3OJSA 4OLAA 2Q0UA 3CJ1A 4ZVFA 3NFAA 5A6WA 3EX7B 1JWWA 2CJAA 1S1TA 3NGIA 2ASDA 2OELA 3R6GB 1SL2A 4CH0S 3CETA 1FRKA 2WVFA 2L9WA 4RBUA 1S1VB 4RU9A 3RSEB 2OI2A 1Y7PA 5GADP 3M30A 2DHXA 4IOCQ 5E2QA 3DC2A 3C6AA 4UY8T 2VG7B 2B7BB 3QWUA 1X9JA 2COLA 4CI6A 1R0AB 2VFSA 5A8KB 4JK9A 2IFXA 4K25A 2ZOMA 4DR7F 4X62J 4XPCA 3B8AX 1NJZA 2BJ3A 3H1QA 4C0OC 1Q8BA 3IGNA 4DDFA 4O55A 3H45C 4AHUA 3OFHA 4BRKA 3QNNA 3W64A 5H9EK 4NLUA 1B64A 1O13A 2KKHA 3OR1B 4DL5A 1AZSA 1RTDB 3MM9A 3CQXA 3H5XA 3MN5A 4LQ3A 5GAHI 3LDPA 1FDBA 1IKYA 1FRJA 4A8WA 1S5JA 1ZM9A 2G8FA 1EWQA 2JX2A 4GKKF 4P2FA 2GWJA 3C15A 2D0AA 3Q8PB 3EO3A 4Y1CA 1GXTA 4CDIA 4Q5VA 1E6YB 4LF4K 3PO5A 4PG4A 5J2QA 4DTJA 1H2TZ 1HHQA 1ZTTA 2RT3A 4KBIA 1UVLA 3T1AA 3VGUA 1RT6B 3NF7A 3ZZOA 2UYTA 3ZSZA 4ED5A 4NYZA 4H0XB 4LF6J 2HQ3A 1ZPVA 2E1MC 4FKYA 1KONA 1JMTA 4DV0F 3F41A 5D15A 1WG4A 2UUCF 4P7VA 2JEIA 2QN6B 1DAXA 3GP9A 3AVNA 3MWBA 1T8EA 5I3PA 2D0PA 3NP5A 5AJ3F 4WU3A 3QICA 2E7XA 2W6KA 4DTPA 4NRUA 4A8MP 1GLBG 3NS7B 4JI7K 3D54A 1C0UB 4CHQA 1SC6A 1C1CA 1TL4A 1X4CA 3CMAS 1NDCA 3OXFA 4R0EA 2BRKA 1YITN 3FEYB 1F2HA 2MYFA 2ZBIA 1XERA 4L3QA 2HOEA 5LL6Z 4DR2K 2FD2A 1HI1A 5B7WA 3P5TL 3EE3A 1ASWA 2AV5A 2XZWA 4EBCA 1CLFA 2F4FA 2FQQB 1UFWA 2KXNB 2VGNA 4FYYB 4X64J 2G8KA 1ZM4A 2V2KA 3UWTA 2ZNZA 3D1QA 2KRRA 2UUBF 5L9XA 4X62F 1XR7A 2ATQA 1MWYA 1RT6A 4CF0A 2RD5C 3BDPA 4DX5A 4ID5B 4OZLA 1NJWA 4B9TA 2HFOA 1N33J 3W3SA 4PYDA 4CM0A 4DCPB 3ZC4A 1RZMA 5ETTA 3DFEA 3W2VB 1Q1KA 4ZVQB 1QUVA 4ED6A 1X3NA 3PYDA 1TFWA 3CFRA 3IS9B 2BUNA 5AQZA 3I0RA 3RAQA 1S0VA 3SFUA 1QVFR 3BGFA 5C2DA 2GJFA 3M32A 3PR4A 4QZVB 4ZHRB 4K0KK 1U1QA 3VEWA 1Q8KA 1LKZA 1XIQA 2UUAJ 3OYFA 3BSOA 1FHTA 4A62A 2A3JA 3KK3A 4EWTA 4WK1A 4NLRA 5A0YA 3CCVS 5A8RA 2P9UB 4CK3A 4DQQA 4CEAA 4H5WA 4QS7A 4L74A 2GO8A 5D3GB 4LR8A 5BN9A 1KN6A 1UWAA 3DDKA 3QINA 1RU2A 2QWOA 5M1KA 3CJSA 1LOTB 4BR5A 2UXDF 3AD9C 3U8XA 1M1GA 3K0JA 4H0YB 4KRWA 3Q2SC 1R59O 5L38A 3CCMN 1KQGB 3H1VX 3BH7B 1KQSR 2W24A 1RCHA 3DM2B 1YQHA 3MPYA 3RTVA 1VSDA 4N56A 2EC2A 4MKBA 3S7RA 3VGMA 3NXZA 4QCLA 2RF2B 3O8WA 3K5MA 5IT9Y 3ILLA 5CYMA 1DHMA 4USUA 3WT0A 2M0GB 1JCEA 3HFKA 4LRAA 1TMJA 1N34F 3W62A 5DM7Q 4RJVA 2HFVA 1VSIA 3DHXA 3C3LA 4KH1B 2ZC3A 3LM9A 4JHDA 1YI2S 4K2XA 4Q2LA 2DIVA 4OJRA 1DTQB 1OMSA 1FFWB 2FY8A 5GAGP 2XLIA 4CF9A 3SDEB 3ZZPA 4TNOA 1EAYC 1RTJA 4ZVSB 1VQKS 1PC4A 4I4BA 1S12A 3OXGA 2W8KA 2AEJA 3PXGa 5E3AA 5HAOA 4BS2A 3FK4A 2F4VJ 1U2VB 1JXLA 3DRRB 1OYEA 3OL9A 1NB2A 1KBRA 3CJ2A 3PEJA 3ONQA 3IP0A 4F2SA 1WBDA 4IH5A 4CZIA 4UZCA 2WB4A 2CPJA 2GGPA 1YRUA 3ZT0A 2QLBB 4JOUA 3K9KA 1C1AA 5A0YB 5LMNJ 3LPTA 3BS9A 2O3DA 5BPLA 2VA2A 1M5KC 4FXVA 2EX3A 4OX9J 4RW8B 5AQLA 2YV0X 3H40A 1JLEB 4YUDA 1YJWN 2HYIB 4BC5A 4YP3A 3MCOA 2ZKTA 1HYVA 1LCUA 3CC4S 3SIPB 1CC8A 3QRQA 3A5MC 2RQMA 4EEYA 1WTFA 4PQUB 4EP5A 3PO4A 2HB5A 2DYAA 1TYQB 4PG7A 5KFAA 4N47A 3G4SS 1S97A 5AQOA 2VASA 2DRBA 4NYOA 2GMLA 2HF4A 4WFBL 3SCIE 4DV3K 3EVMA 4B9VA 4DUTA 2XWYA 4PQUA 5BRHA 3SQ2A 3P4IA 2XS5A 3N4QA 4RW4B 2HBRB 1UA0A 2MSSA 4DF4A 2ZF5O 3SQOP 5K8MA 1Y97A 4ZLPA 4DLEA 4BR0A 5AQNA 4QW8A 2AGQA 2DK2A 2ZH2A 3JTPA 5M2RA 5J2NA 2VZ9A 4DHVA 4FWQA 4IR9A 4FM2A 5B0GA 3C16A 2LECA 2KXHA 5L9NA 1FJCA 1IJJA 2YBVA 1S22A 1YVFA 4KH4A 5AFUA 4TXSA 1TL7A 5IT9U 3J7A1 5AR0A 3QJJA 3QPIA 5F8LA 4BE0A 4V19X 2ZBPA 4XK8C 4PUOB 4CYUA 4FLXA 2CPEA 4GO7X 2DNRA 4ELVA 4ATNA 3SCXA 1PC5A 2ZH8A 1BC6A 1DBDA 2F9DA 1GX5A 1N5TA 4HR2A 4DZDA 1VC0A 4OX9K 5JVHL 1FEHA 3LAMA 3LZIA 4JB8B 3FRZA 3C94A 4G1QB 2K7KA 5LT5A 3OW2R 1SH3A 4HKQA 3JYTB 3V6KA 2IRXA 4BHQA 4MQ3A 3BF3A 4HHJA 5B08A 2YQ3A 3SAHA 3RGIA 1MSWD 1AW0A 3IRXB 3W63A 5BR8F 2XHWA 3SJJA 3R1LA 3MR6A 5H1SQ 1RSCA 1R8BA 2X1AA 4CHZA 3GSIA 3ASMA 2PFDA 2BOAA 5KFJA 1CJUB 5C24A 4CEEA 1TK8A 3EYZA 1J6ZA 5DQHA 2HLTA 1N0VC 3CJ9A 5FDLA 3MHYA 4PPZA 4WE1B 3ETMA 3G10A 5L1LA 3H2UB 3AA9A 5LMUF 1RWNB 3GZ7A 3KLHB 2W9BB 4DR1F 4CGIA 5T41A 1IKWB 3RR8A 3CIZA 5I4MA 4ZPWR 1C6VA 4TY9A 1YI2N 1ELOA 3QEWA 3QIPB 2HFNA 3KWMA 4WFZA 3PIPQ 4CF1A 5HP1A 4X4OA 4CFCA 3HVRA 4DWIA 3TZYA 3BBBA 4DXLA 5KFFA 5G0RB 3E2EA 3NNHA 1O0PA 3THWB 2DD8S 3IA0A 3M2RB 2M8DB 2BM1A 2U2FA 2UZAA 1R8PA 2XZDB 2VF3A 1X4EA 1R0BG 4ECWA 4MKAA 1KAZA 2O8CB 1U2FA 2MHNA 2CG4A 2AWZA 3A5OC 1AB8A 1WORA 4G65A 3VOVA 1IBCB 2W2NP 5T7LA 2IA0A 4MKVA 4IG0B 4FZVA 1NGAA 2V8VA 5AQRA 1I3AA 2BJ1A 1XMOK 1M0SA 1IH7A 2AJ2A 3ENQA 2OYQA 2R7QA 4CK2A 1SJ1A 3CTRA 4AL6A 2XHBA 2P9IA 2OEJA 1YWXA 4XPEA 1I94F 1Q16B 3SQ0A 1AROP 2Q3PA 1N33K 4Z94A 3I9ZA 1VK8A 2J9DE 1YJVA 2IDLA 1QLNA 1FERA 3MWTA 4ZA1A 3SCKE 3UKUA 1RT3A 1VS3A 3TP2A 5L46A 2QJ3A 2FSKA 2HBKA 3G8QA 4XH5A 4YY3K 2FC9A 4U67Q 3AA2A 3QERA 4IG3A 1DY3A 3TR8A 3HVTA 4BE1A 2V0NA 4KSEB 1CXUA 4LJMA 3GJSB 4ZLLA 3LP2B 4AHTA 3RZAA 4QU7A 3JSYA 4LFCK 3CCLN 5JJBA 1FK9A 4EO8A 1WG5A 1OKJA 1NM1A 1Y5IB 2FJEB 3G86A 4ECRA 1DARA 4O8UA 2QI2A 4DV7K 1FE4A 2X1GA 1R43A 2ZH5A 2P9KB 4KTZA 4OI1A 2KM8C 1HNXJ 1YJ7A 4LF5F 4RNNA 4OX9F 3RYLA 2AYGA 2VQFF 3M8PA 5CD4H 2ZE2A 5EY4A 1SUQB 4XH1A 2CFXA 2VDHA 5J1PA 3D6FB 3TVYA 3FZMA 5C2GA 3HBTA 4UQGA 4F4XA 2ZWOA 1T94A 4M45A 1LW2B 4YQWA 3NY0A 2DNHA 1Q7LB 1VOMA 4NXMF 2HAIA 2RJZA 4ECSA 1YJWS 3D3BJ 3J80Y 1GX6A 2D69A 2E66A 2BUPA 2D74B 4PXDA 1FD2A 5HROA 2G0IA 2ETJA 1E6VB 3RBDA 4WE1A 1AUDA 2MKYA 3K5PA 3WXIA 2LQ5A 2IC3B 1BD6A 1SKRA 2RDIA 1APSA 3DLRA 5D4NA 4CD1A 3MX2A 2RDJA 1GLCG 1WAFA 2Y1JA 2KT2A 1T11A 5GAEU 3NBPA 3UVJA 3G0ZA 3L8BA 2HK3A 4W5RA 1SCJB 2V63A 4QWEA 2K3IA 4DV3F 4HUGA 3C6UA 4C3MA 4O0NA 1K73O 2BOPA 1T03A 2F8HA 1GXLA 5LJ3Y 3VQTA 3ZZ0A 3MUVP 2K3KA 1YZ6A 4NE9C 4CEOA 4TKTA 1JKHA 3M2RA 1EX4A 4I2QB 3H3NO 5F9NA 4P10A 3PTWA 1T3NA 4BWJA 5KFKA 1QUPA 1YTAA 3CO0P 2EFNA 5I42B 2UV8A 2VQEF 2NRWA 2KG0A 3UE5A 4OL8A 3DRPA 1VK0A 5HANA 1Q7YT 5HQMA 1IBKK 1G15A 1N36K 3WXLA 1EO1A 1X4AA 1YJUA 3KDOA 3L2QA 4NCGB 1RT4A 2Z4PA 3T69A 1JLAA 3LO3A 1NPRA 1UL3A 1XNRF 4HLBA 3O9QA 2CADA 2DNKA 2KKZA 1HNZJ 4PYAA 3DLGA 3K57A 2UVWA 4HACA 4DU8A 5KTQA 1QE1B 4CT9A 3M8ZA 1K9MT 3SQGB 4L8RB 4TYBA 4NL5A 2D9OA 1NGFA 5K8PA 3ZEUA 2GC8A 3GJTB 5DETA 3V6HA 2P9NA 1PYTA 2HHVA 4DTOA 4FJIA 1YHQS 3A8YA 1X3MA 1HBOA 1X4BA 1RA7A 2KFYA 3PCOB 2FBTA 2ZE2B 5KFCA 4LF4J 2CJBA 2V52B 3DAWA 2HSEB 1JQGA 3O9TA 3ZTRA 4PRFA 5TKYA 4HEA9 4KHRA 4PG8A 3QT6A 2NXJA 4EBEA 2QSWA 4AQYJ 4JI8K 3RMCA 2ZH1A 2GZOA 5AE1A 4X4VA 3I5CA 5C42B 3GPAA 2G0JA 2W7PA 1S9GB 2YNHB 1PSDA 3CMEN 3NHGA 3BN4A 3VF2A 3EZUA 2X51A 4KO0B 4KC5A 2I9SA 4O5BA 5GAGI 2GGPB 1VBKA 3THTA 3VCDA 1HPZB 2CQ3A 1FEEA 2CNNB 2J0XA 5THWA 1WF2A 2H5JB 1H73A 3PKYA 3DLEB 2HPUA 2CA9A 1VQYA 5KFGA 3K2YA 3OBWA 3THYB 2JDJA 2MZJA 2K1RB 2AYEA 4FJKA 4FJ7A 4EMDA 5BN8A 2HSTA 3F44A 4JKGB 1IV0A 4K0KF 3AJ2A 2UXDJ 3OQ2A 1CJVB 4C8NA 2GAGC 2YJFA 4K8RA 2XGQA 1PKUA 4RW4A 4BC4A 1HL6A 1UTAA 4OFZA 1JLQB 4JV1A 4OJ3A 3ZNJ1 3KVGA 1QHAA 1HNZF 3S1TA 1GLFO 4EAHD 2QWNA 4AF1A 3ETOA 1LNQA 2MQ8A 3MUMP 3SQ1A 2Y1LB 2NS1B 3EGZA 3PJXA 2YCHA 3ISZA 3O4WA 4UOFA 4XDDA 3NMAA 5ETNA 4B9UA 1FX4A 4I6MA 4QU6A 5KPZA 3FMBA 4USIA 1OQ6A 1CZBA 3D6TB 2R7RA 4YOEA 4WTYA 1X9WA 4ZMMA 4CHNA 5IM0A 3O80A 4OLPA 3D0PA 4DR1J 2NRHA 2C3YA 2A1SA 4KH0B 2WUSA 2RU9A 4IUFA 4AFFA 4OYIA 2F65A 2VOOA 2MZRA 5KT4A 3HXMA 1PIEA 4CLYA 3CCES 3QNOA 3TRGA 2O8EB 1K8KA 2JL9A 3NGKA 3PX0A 3MMCA 3MCMA 1U0HB 1IN0A 5T14A 3TX8A 2BQUA 3LW5C 2L41A 3VQSA 4DV5K 3TQ1A 2F5GA 3CGIA 2ACMA 4DFPA 3KNGA 1NGCA 3K89A 4HCBA 2ASYA 3FBCA 3I0RB 1FWLA 4RW7B 1D4XA 2NXCA 3BM7A 3MEEB 2I0XA 4IJAA 1SAZA 3IG1A 4K50A 4K8XA 3T1YF 2FLPA 3AT1B 2M5YA 2I5JA 4FPBA 3MK6A 2CJXB 3J81U 4DR5F 3T1YK 4R8UA 4J2BA 5BPNA 3H59A 1I3OB 3RWUA 3DU5A 2HZCA 1HNWJ 1W2BR 3GTYX 2E4LA 2CGJA 2GO9A 5DDOC 4DTXA 1BUXA 2E5LJ 2AMCB 3G6XA 3SMPA 5GADU 1M90O 1CG2A 3MAQA 1Y5LB 4IO8A 4LR7A 2HLUA 2YHBA 3AOAA 3V1RA 2BANA 2VWJA 1HI0P 2DTUA 2LQ8A 5AQPA 2IM3A 4OI4A 2WTFA 2XY6A 2DPJA 3TANA 5C10A 4N76A 4ZPBA 1ZAXA 2GFFA 2IYGA 5A76A 1RE1B 4Q2MA 2MGZA 4AHRA 1S0OA 2XMAA 1S0NA 4KE5A 3RRGA 3CG7A 3Q83A 5FRMA 1VLOA 1XTZA 4C8ZA 2HIQA 3LUYA 4ZTFA 2V69A 2P2CB 3IKMA 2DH9A 2QKKA 2HW3A 3QT7A 3EUNA 3S3MA 2GVZA 4I6AA 3C65A 1GMVA 1FXRA 1XN9A 3D66A 1DT9A 1IVZA 2CNKB 3GV5B 5K20B 2D1CA 1LWFB 2CVEA 2RU3A 3MUTP 4QQBA 2ITMA 4DU7A 1NMDA 4F67A 5HVHA 3K5OA 2PYLA 2W6LA 4K59A 3CJAA 1WC4A 3FCWA 3QO9A 5GADI 3OSNA 3LQVA 4NA1A 4C3LA 4ENOA 1B9DA 4X66F 2V8HA 4JV0A 1NSAA 1FRXA 2DT9A 3Q8YA 3CC2N 2NZ4A 1HQUA 4B17A 1UWBB 2B5JB 4RR5A 4KREA 1WKLA 1NB7A 3CJ0A 3UKUB 2PIIA 3T9NA 2QWLA 4DS4A 1RDBA 1JLGA 1I51B 3BB5A 2Q66A 1YAGA 5D0RA 1F5CA 3WQTA 4DPYA 3CMAN 4PA1A 3CF5Q 2VB6A 1ZETA 3EJMA 3G9CA 1U2VA 1VISA 1NXIA 3DOMB 5GAHP 1KKHA 2ADCA 4B9SA 4JI5F 3I33A 5ETQA 2N7CA 1KTQA 2AX1A 3GMGA 4GRSA 3R7BB 3NAIA 4JI6F 5KFVA 1YTYA 5IWAK 2NNWA 3NGZA 2NZTA 2CQGA 4F26A 1ATSA 3V4IA 4PHTX 4F36A 4KRFA 5DM6L 4NOHA 1NWKA 4F2RA 4DN9A 4J8FA 1EB0A 2CQ0A 1NJYA 4E89A 3OTCA 3UFCX 1RKIA 2C2OB 1LWEB 1D9AA 1QZ5A 3OLAA 4LF9K 1X5TA 2GJIA 4XEIA 5CYJA 4E7IA 1IJEB 2IVNA 5D4PA 1VI7A 3WXJA 4X65F 4CJFA 4O4GA 4KHYA 4M95A 2DCLA 1HLWA 2I7PA 2R8IA 5G0RA 1MMNA 4WZQA 4UOCA 2KJWA 2OJ3A 5IFMA 2LYVA 1N56A 3UR3C 4AT1B 4J2DA 3CJCA 1XNRK 3KLFB 3LGNA 1V5VA 2H4YB 3LM2A 4LRBA 4ANDA 3KHHA 4ZKAA 3AJ1A 1UFKA 1RAFB 3GYNA 2CQ1A 5CHIA 1SC3B 2ZJQQ 3KLIA 1PBAA 5CH7B 2HS3A 1T9WA 3QAEA 4NRTA 1WF0A 1HWUA 3VZIA 4IH6A 4KB7A 5A8KA 5KOXA 1IM4A 3G4SN 4DV2F 4DV6J 2RDDA 4QAGA 4OYAA 3VMFB 3PYEA 2FBYA 2NUUG 4JI4J 2JH3A 1YBUA 4PXCA 5AE2A 3KD5E 4AHCA 4WXOA 2R7SA 1Y4ZB 4ZPTR 3HDSA 4TVAB 1VQ5S 5HMXA 1N5QA 3VEOA 4LSLA 2E6LA 3T5JA 3H46O 3M9NB 4M5HA 3P31A 2OGUA 3NGRA 2VQFK 1M1HA 3HSDA 2VWBA 1M90T 4X4TA 4NMLA 4JLHA 3WXKA 3LP2A 2ZH6A 5C2CA 3ITHB 4YHHJ 3K8VA 2FSNA 2DNOA 4K5RA 2ZWPA 5EU7A 4XDCA 3MWPA 4JV5J 2KH9A 1T9YA 1KC8O 3BKUA 5KFTA 4QS9A 4OI3A 4LRFA 4K7QA 4NWBA 3BSCA 4LF7F 1XJWB 4UY85 4X4UA 3LANA 4CZKA 1XNQK 3GJRB 3H98A 3UD4P 3UKRA 1LV5A 1PILA 4KO0A 1PBUA 1BE4A 1KAXA 2ZM6K 5D0EA 3DOKB 2MY8A 1HR0J 4DSLA 1S5ZA 4ISEA 4ZCIA 2W4PA 1D8ZA 2DHSA 1Y9OA 3JAMO 3MM8B 3AA8A 3TNVA 2IMOA 1KR4A 1ZBHA 5H9FK 3CC4N 4QW9A 4JI3F 2CQCA 4DFJA 1CPZA 1S7HA 2HNYB 4ISGA 4ECQA 1P8ZA 1XMOJ 3SUNA 1OPZA 4CIFA 1MWKA 4Y2CA 2OUGA 2V2VA 3DGPA 2ZM6F 2PGCA 4DZ6A 2GIQA 2BDPA 1F21A 3GL1A 4BRFA 1TUUA 2E88A 1BI4A 2EK6A 4BRMA 1IO2A 3AGKA 3R7NB 1OH6A 3IO1A 4DPUA 4JYAK 3PW2A 5GMEA 1W7WA 3ZZTA 1SKWA 2E9ZA 3NOCA 4M3TA 1QAJA 4B1UB 3IAYA 4LC9B 4QOTA 1F5BA 4WP9A 2NXEA 4ZVUB 1SIZA 3P83D 5F3ZA 1IBLF 4DSKA 3JXOA 3NL0A 3CO9A 2R2SA 3KLVA 3DLLL 2QFJA 2MTLA 2YI1A 1QAIA 3IDHA 2OPRA 9RUBA 4ETZA 3PM9A 2HRYA 1CBKA 4IYQA 2KFNA 4IEEA 1N8RO 2V4JB 3AA5X 4FWRA 3MXIA 2UUTA 4IOAQ 1KHWA 4CEDA 3GOIA 2VC0A 4O0IA 3FZBA 3BGLA 3OL6A 1J53A 3CMQA 1VQPS 2K8GA 2VONA 3OFGA 4LVOP 4QIVA 1NJIT 2CDRB 2GVDA 2GEMA 3HOSA 3M8SA 3C8YA 1EARA 3LAKA 4GW6A 3L4BC 3CJ8A 4G1IA 4C4WA 3KZBA 3EXYA 4G1QA 4QYZK 4L73A 2BRLA 2OANA 3HULA 4BGAA 3HSGA 5AFUH 2JWLA 2JC1A 1H1VA 4YHHK 1Q95G 4FXWA 1RTHB 4Y2KA 1NGBA 2E5IA 1RWWB 4JEPA 1YHQN 2E7WA 4X4NA 1GFWB 1FW6A 4JI0J 4CEZA 1WEXA 4F3OA 5HO4A 3CJBA 3L4QA 3M1VB 4F9OA 3NCIA 2C3UA 3W60A 4H5NA 4USVA 1HWJA 1YITS 5CCLA 3CCLS 1SH2A 4H4MB 2UXBJ 4LBPA 2C2ZB 2N4CA 4ZOSA 3BBFA 2V67A 3HVWA 4QYRA 3IM9A 3DDIA 4QIGA 1YGYA 3NCRA 2C22A 1DQ9A 1WB9A 1K9MO 1Q5VA 2IDEA 3VAJA 3DYAB 1U1LA 1EQMA 2QEXS 2Z2LA 2XQCA 1Q9YA 3QLHA 2XY8A 3RBZA 3IC1A 2QWPA 2GHWA 2H51B 3IMXA 2FZKB 2W2PP 1HNVA 4DKWA 1RYRA 4ED0A 5AXKA 1NHVA 1NAQA 4DV7J 4ED1A 2YWFA 4DPOA 4G3IA 5ADZA 2B9YA 1VQNS 2B8QA 2DY9A 4CJUA 3D67A 5IWAF 3Q8UA 3QT8A 3FBFA 4WQ4A 5LL6d 3ILOA 2KW4A 2PI5A 1RHJB 2ZDPA 3MR3A 1IUJA 1N0UA 3KFWX 2BE9B 2FZCB 2B6AB 5DZ7A 2GX8A 1U04A 4QBUA 3PV8A 1KCFA 3GIRA 2ZDOA 3OTBA 3PYFA 4M5JA 2I8EA 2HVHA 2OLWA 3IWXA 3RRKA 1HBMA 2KLAA 3W65A 1WSEA 2CKWA 1CJKA 3CCRN 2LDYA 2YNFB 1FDNA 4EI2A 1VQ4N 4AQYK 3G6YA 1KRPA 1BWFO 4QR1A 3MFHA 4CIOA 4KFBB 5ITHA 2RVJA 2FLLA 3SDEA 2VD3A 4IFYB 2Q0RA 4ZS6A 4ID8A 4OHWA 2FHKA 3CJ4A 1F60B 2QLXA 2QEXN 4RWTA 1MWQA 4YOWA 4FP9A 2BV3A 4C11A 2X7IA 2DGQA 2XNQA 1C0TA 1JCGA 3VAHA 1PGZA 1WC3A 4HVZA 4E7LA 1PJ5A 3R7SB 4LF9F 3OVAA 4J9OA 1VQLS 2DEJA 1KSPA 5CYMB 1VQNN 2JGUA 3I4HX 3EZWA 4BR7A 2VPZB 4YOVA 1NM2A 1Y5NB 4DR5J 1JLFA 1GTHA 2AJFE 4L3NA 1WSGA 1MU2B 3A4TA 1ZBLA 3FCVA 3DDNA 2J4RA 1IKXA 2PY5A 3SBMA 3T1YJ 3OVNA 2JSXA 3M3ZA 1TV6B 2R4FA 2WCXA 2BMBA 2NYIA 1F1BB 2FF6A 2Y9HA 4WCEQ 1W2BM 2FVPA 5DLGA 4JI6K 3C14A 3B4MA 3OYLA 1UW4A 4JI5K 5HP1B 3FZLA 5HMZA 3MMAA 3MMCB 4ECZA 3F5TA 1RTZA 4ELTA 2HKEA 2LSNA 2G1DA 2XLKA 4CGFA 1RT4B 3EPIA 2KYZA 4JS5A 1R8AA 4FLTA 2EFQA 1N32F 4WKYA 4IKAA 4PQAA 5D78A 3J81O 3WIVA 2JEFA 3V2UC 3A2FA 1VQPN 1WI8A 1RXOB 4DR3F 4L6V3 4K5SA 2OFGX 3WNGA 3BV8A 2AEMA 3NH2A 1R27B 2ZJRL 3TAGA 2GHPA 4ZLNA 1U1OA 4ED8A 3KK1B 2BANB 2H3GX 5CY4A 5KQ8A 1MU2A 4CBUA 5GAEI 3AAWB 2OPPA 4CESA 3TI0A 2R7YA 8ATCB 3A3PB 2QG9B 2OP5A 4B9NA 3Q0AA 2EBEA 1N8RT 2BE2B 1FO1A 4LBHA 2AA4A 3U4LA 5ETRA 2ZUAA 1TUWA 3LP0B 2FC0A 1HWIA 4DV5F 2F7TA 4B9QA 3GG1A 3MM7A 1WTBA 5KG2A 4CERA 3ZTSA 1ASVA 1XNQJ 1HNZK 4GMKA 2YVSA 4J37A 4OHZA 3UN5A 5EHHA 4Z2XA 4PUOA 1U25A 3A1YG 3TSUA 1YG0A 3AJDA 2GS8A 3PKMA 3BY5A 2RN2A 3NH0A 3LPUA 3L7PA 1C1CB 4MDAA 2B4UA 2YNFA 3LL3A 3GFHA 2G0CA 4QR2A 1K8KB 4BRHA 4CNYA 4DCOB 1U47A 1S4FA 3HSZA 3C66A 1TL5A 2J0SD 2YQ1A 4JKAA 3O6WA 4AM6A 4U7CA 4ZIVA 4DV4J 1BQNB 1RHMB 3MM5A 3J7AP 1EQYA 3I0SB 4B3MF 4KIAA 1HNIA 2Y0SD 3D2WA 5AE3A 2NCKL 4P71A 3M6VA 2E5JA 1O1WA 3I56N 2UUCK 1DKGD 1PJ6A 4NZ6A 1P1TA 1HD1A 4GVBA 1OYDA 3HL8A 2HNYA 1SQEA 3MCNA 4ID1A 2BACA 4M5NA 4KKOA 3HMJG 3O9SA 2HWIA 1WI6A 3M8YA 4WQ4C 3KHGA 1ZAVA 4F25A 1T3VA 2E2NA 3PLAA 3CCJN 2IBKA 1VHFA 2DGSA 1EKSA 3UQSA 3D6HB 2P9NB 3TYTA 2RQ4A 1GOAA 1WOOA 1XR6A 1SJRA 4IG3B 3G2XA 1LWCA 3P96A 2QGFB 1NSPA 3R5DA 2DY1A 4CLPA 3FNNA 1ITGA 4OLBA 2PA8D 4USTA 1CJTA 4HH0A 1JJ4A 5ADXA 2KXFA 3CDBA 2JEGA 4QIEA 3L3VA 4X4SA 3DXMA 4USMA 2CPXA 2ROPA 4KHNA 1VIXA 1VQOS 4BWMA 3CPWM 4X64F 1YT3A 4YNQA 5BJRA 5SWMA 3P38A 3FCHA 2H48B 5JMNA 1WWHA 2MPUA 2GTDA 1RT5A 4CF8A 1J5EJ 2DXFA 4H4OB 1S49A 3OYHA 4A2AA 2QMUB 5C42A 2E1PA 3E3XA 2W9AA 4MJKA 4JS4A 3QFPA 2VQEK 1KVKA 3V1OA 1S6PA 5B0AA 2QYGA 3JSBA 2ALYB 3N6MA 1U2RA 4X66J 2GELA 4GV6A 2K06A 2O8CA 2IM0A 5AQSA 2O8BA 3ALYA 2QRRA 1UMJA 3M1FA 4E3SA 3PX4A 4U9RA 4F4AA 3IXQA 3SZ2A 2D0OA 1SC1B 2F4VK 5LXYA 3DLLQ 2QLFB 1EETA 3HZ6A 3MEEA 4LIRA 1B7FA 1Q7YO 3UN3A 4DR7K 2V4JA 1QQNA 1G4CA 2VYPA 3QIPA 2HHSA 2UU9J 1HNWK 1VJWA 4BRQA 4FWMA 3A3OB 3BQ0A 1RTDA 3MM9B 4FZYA 3EICA 1QS4A 3OR1A 3AV9A 3X1LB 3DXBA 4YB6A 1ZXOA 4FN5A 4Y0WA 1NK5A 4V19J 4ZP9A 4MLHA 3G96A 4IXCA 3KXDA 2KVQE 1NCLA 4OX8A 4IEIA 2ASLA 2BJ9A 2CQPA 3LGMA 3CM6A 4DFMA 1F9FA 3ZZYA 5F41A 4M7YA 2P9EA 4CH7A 2R42A 2IS3A 1GLJO 4FCYA 4YDUA 1WDDA 3PDNA 3DCAA 2OEMA 1N34J 2IOCA 1RU1A 3RMDA 3CULA 4O4GB 2MJUA 4ILRA 5J2MB 3IRXA 3AVGA 4OGEA 3H7HB 4Y00A 2XLJA 4XTTA 4CFDA 4NMXA 3D68A 4L72B 1HFEL 2MZSA 3QBWA 5BR9A 2P9LA 3D0GE 5A2QU 3PYGA 2XG8A 3I55N 4KI4A 1TKTB 4C0BA 3ATUA 1X0PA 2EFOA 1NOYA 1WJ9A 4ZVPB 3DI6A 2F9JA 3QGIA 3HHKA 1SJ4P 1A6LA 4CFAA 5E3RA 2KB2A 1OPIA 3SXLA 3DU6A 2GQ2A 3HVTB 3VQEA 2Y8WA 3ZT4A 1NHKL 4WFNQ 4F4YA 2ILZA 1NHUA 3ENOA 2HQCA 1FJEB 1OY6A 4K0KJ 3EEQA 5J1EA 5ETKA 3ET6A 3BH6B 1CSJA 3O1LA 3X3UA 4IFVA 3Q7BA 3CVKA 4ED2A 4CTAB 3OFEA 4IZ9A 5AQUA 3JQKA 3CCRS 1YF5L 1QVFM 1BQXA 4CLFA 5LMNF 3B78A 3H8YA 4RZRA 2E20A 4KBOA 4JN4A 3BGUA 4OYBA 4KQZA 1X9SA 3IWNC 3OHRA 2E1AA 1DURA 3M9MB 1X1PA 5HQ8A 1S4EA 5DG9A 3B8HA 1L5UA 5M1QA 3W7BA 2ITGA 4M63A 2NRZA 2Z2ZA 1N52B 4J2AA 2F8SA 1YJTA 5TKWA 2F4VF 3H6EA 1M1KT 1GAOA 3M7VA 1N33F 4O3NA 2ABYA 5JXSA 1B0VA 1W2IA 2LU2A 3O08A 5L1KA 2L08A 1VQON 1GMUA 4E2FB 3ILIA 2GA7A 1UVJA 2X74A 1LWFA 2QA2A 1K44A 2P1JA 2VWKA 3GV7B 3TVZA 3N9UC 1BWVA 4ZPVR 3J7AN 1RBOB 2M88A 4QJVA 3L7UA 3THWA 1HHTP 4JV5F 3WNEA 4KH5A 3P8BB 3OHAA 4NLWA 2G8IA 4CZLA 4FOEA 1JXBA 5F8GA 4Q8FA 5D77A 2FJBB 4Z7YA 4P2SA 4DCHA 4J9LA 3C0BA 3VEVA 2E8AA 2ZJQL 1HQEA 4MYTA 1O5JA 2AT1B 3IUCA 3RJMB 3L4IA 3UKRB 4B3TK 4EUVA 3MCPA 4HACB 2DR9A 1TQLA 1P90A 3NAEA 1PYSB 2MLYA 3GFYA 4FWSA 1UA1A 3HO1A 4DEZA 3HSCA 4G6VB 1NO8A 3QGPA 1FTRA 5RUBA 4IFVB 4BLGA 2VKZG 2YH0A 5IXUA 1M5PC 1I1GA 3NH1A 1XMOF 3VQ7A 1J5OB 3BREA 7AT1B 1YTUA 2UP1A 5C12A 4DPWA 2VPWB 5F0WA 5IOLA 3MEGA 1UAWA 1MLAA 1OH7A 2QKBA 1PAEX 3SI6A 5KFLA 3N0VA 5HMWA 4JI2J 3CDUA 3L7OA 3QYYA 1TL3B 5DM6Q 5HJYA 1VC6A 1IBKJ 3MGJA 1C0FA 3KHLA 1EP4A 1D8YA 3PZPA 2EBGA 4CGDA 1F2GA 3AAPA 1JJHA 4FBUA 1G7CB 2PC6A 1VK3A 4MK7A 2J9EA 3CC7S 1NK6A 2GJ2A 1LK7A 2D5RA 4OZ0A 5EWFA 1WACA 3FZHA 4DU1A 1BCMA 2QTDA 4WZMA 4ED3A 2ZC4A 4E0DA 4NLGA 4MIWA 1XMQK 2FLNA 4JKBA 2AZ3A 4EGLA 1TVRB 4BG9A 3OW2M 1KQKA 4Y1DA 4OPAA 4LREA 3VQAA 2HBMA 4CJTA 2MKIA 2O8EA 2VH7A 1X4FA 5H1SV 3I55S 2J0WA 5E0OA 4CGJA 2F8MA 4OZNA 4ZITA 1EQ0A 3R3LA 2Z0GA 4CLSA 1TKXA 4B1XB 4F4WA 3M05A 2MLXA 2MZ1A 1UEVA 3CIPA 4BG8A 4HWIA 4NCAA 1T7PA 5IM0B 1T95A 2Q1NA 4YDUC 4XIUA 1RAJA 2J6UA 4UUWA 3F9KA 3GBTA 1RHRB 4DV2J 4DV6F