1RT7A

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
536
structure length
535
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 139
structure length 535
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt7A05
1EP4A 1VSLA 4PWDA 4C8MA 3KK1B 3BQ2A 1J54A 2V4RA 1C0MA 3TAQA 4OGCA 3QESA 4O3RA 1C1AA 4E1NA 3GV5B 4M3RA 2IA6A 3HVAA 4AHUA 2YKMA 1U47A 3CIZA 2Z1JA 4NLGA 3I0RB 1DTTB 1MU2B 4XIUA 4K4TA 1VSJA 1JLEB 1SUQB 3PW7A 4IRCA 5F8IA 4CCHA 5KT2A 1KVAA 3BSOA 3AVMA 4NCGA 1S0MA 4YR2A 2AX1A 2B5JB 2DY4A 3GIKA 2IBKA 2KZMA 3BSAA 2I5JA 1RA6A 4JUZA 3I5CA 4WYLA 2HW3A 4ECZA 5J2PA 2DFHA 3MXJA 3SJJA 2P5OA 1YTUA 2IM1A 3BJYA 4QWCA 2DFFA 3CO9A 2WOMB 3HVTB 3VQ8A 3QGGA 2AGQA 2ASLA 3L3UA 4DG1A 4EEYA 3H4BA 4FJGA 3AA4A 4DSLA 3V4IB 3CVKA 2C2EA 3OS2A 4NLYA 2YNHB 4WFZA 2ASDA 3KLHA 3DYAA 3PUFA 4KAZA 4M3XA 3E01B 4J9PA 3T5KA 3DRSA 1BI4B 1SKSA 5JS1A 4PQUA 4JV1A 1T7PA 2GC8A 4O4RA 4ZTJA 3NF9A 3VQ4A 4H4OA 1BCOA 4RNMA 5CYMB 2ATQA 4ECSA 3T19A 5EWGA 2ASJA 4YFUA 1TK0A 3K5OA 1BQMB 1HQEA 2YNIB 3HO1A 4NYNA 3S3MA 3TAFA 4N76A 3K5LA 4M3ZA 3NBPB 2G8UA 4K4XA 2WONB 4IKFA 3AVFA 1ZTWA 1W25A 4C8LA 1SL0A 2V0NA 5I3UB 3ZSRA 2VG7A 3E51A 3QIDA 3AO5A 3OJUA 1NOZA 4NZ0A 1TKTB 4RZRA 2QKKA 4KB1A 3QLHA 1VK0A 3VQBA 1RDDA 1YTAA 5HRSA 1IKVA 1GOBA 4Q0BB 3TANA 4CGDA 4KI4A 1KLNA 1C1BB 3PZPA 3PJXA 4CFBA 3AVAA 3FQLA 2XC9A 3DRRB 3FSIA 4AHRA 3CG7A 1HRHA 1WSJA 4Y1DA 1LW0B 1NK6A 4CE9A 4J2BA 3Q8RB 1RT6A 5EWEA 4TSXA 3HVWA 3HT3A 5KFOA 3SV4A 5J2NB 4XO0A 4IRKA 4ELVA 4CJPA 4KKOB 5DK5A 3KHLA 3TAPA 3VN5A 3KLGA 1XHXA 4ED3A 1SH2A 1NJWA 4B9VA 5JS2A 5KFFA 1KCFA 3GIIA 2BANB 3HXMA 3OYDA 4CFAA 1LAWA 1JXBA 3IG1A 3O3HA 4FJIA 4I9QA 3O4QA 4DTPA 1S6PB 4BDYA 1HYVA 3OL7A 4DFPA 1D1UA 1IKXA 3V6JA 3LZJA 1RBTA 1YVFA 2B6AB 4DTSA 3D45A 3TQ1A 4O4GA 4CF9A 4LSLB 1G15A 4DSIA 3KLFA 4E0DA 4MFBA 3UR0A 4KHSA 1I6JA 4Z4CA 3H59A 3TWHA 1U04A 3F73A 3I8DA 4YNQA 4CEFA 1QE1B 1WNEA 3KLIA 3U3YA 2IS3A 2IDOA 2X74A 3I5BA 3PVXA 5KFZA 1HQUA 4MKAA 3SQ1A 4IG3B 3DLHA 3LZIA 5EUHA 2C22A 3UIQA 4WE1A 4CEZA 3V6DA 4DQQA 4Y2CA 1A5VA 3CYMA 3AO1A 3CDUA 3ISNC 1JLBB 3SFGA 3MAQA 3AVBA 3QETA 3CFOA 5K14B 3BQ1A 3D28A 4FJJA 3L3VA 4RW7A 3DRPA 4EO6A 1KTQA 3QEXA 1VRUA 1TAQA 1TVRA 5HROA 4ID5A 5KT5A 4U7CA 1C1CA 4NCAA 3OLBA 4Z4EA 4RW6A 3VQQA 4IBNA 2VWJA 3CJ2A 4N41A 1ZBFA 2ZD1B 4CFDA 5EDWA 3PX4A 1WNSA 1NJYA 4RNHA 5L1LA 3QEIA 2FLNA 3GYNA 2Q3SA 4CEOA 2HAIA 4ECUA 1S5JA 4KB7A 2Z1GA 2HHWA 4RW4A 4PWDB 5HLFA 3KNAA 3KK2A 1NK8A 1ZBUA 4C8OA 3OHAA 3GIMA 4DLGA 3V9XA 5KG4A 5J2QB 1S4FA 4QWDA 5C25B 4CHQA 4IR1A 3QERA 2WCXA 2HVIA 1RTDA 3L2WA 4DL6A 4CJKA 1T05B 2WK4A 4NCGB 2XHBA 4JV0A 2HNYA 4KPYA 3DLGB 2I5JB 3LWMA 1I3AA 2F8SA 4TXSA 5KFUA 4K4VA 3TI0A 2E4LA 4E3SA 1BCMA 3V1OA 3ZT3A 3DDKA 3GV7B 4NLSA 4YMEA 2X6NA 4MK8A 3MFIA 3LP1B 3NGYA 2OPSA 3OS0A 3HK2A 1TQLA 4NLWA 1B9FA 1GX5A 1HJRA 2D0AA 1O1WA 4B9TA 3LP0B 4CF1A 4K50A 2D3ZA 4K4SA 3B6OA 2W9CB 1HNIA 3K58A 5HRPA 3RRHA 5KFTA 3OYHA 4HVJA 1QS4A 3KLHB 3DYAB 4CGHA 2DFEA 3DRSB 2F96A 4PQUB 3FQKA 4CJTA 4O3NA 1RA7A 4ZTFA 1DLOA 3DOLB 4H4OB 4ECYA 2J6UA 1REVA 4FCYA 4HTUA 1VSFA 4KSEB 3N6NA 1RT4B 3PR5B 1D0EA 3KIOA 2IAJB 3PY8A 3H2LA 4BE1A 4IH6A 2D3UA 1L3SA 4KO0B 1RILA 4WFYA 2R7YA 4O5BA 2G8IA 4YQWA 1RT3B 2W9BA 1JIHA 1JLAA 4B3OA 2YV0X 5CYQA 4CHNA 1L5UA 2R2RA 3KLVA 2BRLA 3DOKA 1CSJA 1S10A 4EZ9A 2D0CA 4W5QA 2C28A 3CJ4A 3BR9A 3RAXA 3PX6A 4CERA 4XPCA 3NFAA 4FM2A 1IKVB 2BE2B 3L8BA 1NKCA 5KRSA 4F2SA 1YT3A 4DU1A 3SUNA 2IJFA 4CJLA 5KG2A 4QOZB 4Q45A 1RCHA 2P1JA 3I0SA 3HHKA 3PW2A 3SUQA 4BE0A 3OVNA 3NF6A 4J9NA 5KRTA 4KHQA 3QEVA 4K4YA 3FRZA 3CWJA 3TAEA 4QWEA 1JX4A 3KJVA 4DSEA 3IRXA 2XWYA 3OYJA 3MXIA 1T3NA 3CFRA 3KLGB 2D41A 4RUCA 4Y1CA 2B4JA 3EZ5A 4OJRA 1HPZA 5D3GA 4MK7A 1Q9XA 4CJFA 1RDAA 4KV8A 4Q8EA 3KLEA 4E1MA 1UWBA 1CXQA 3RWUA 5KG7A 2IM2A 3IG1B 4DWIA 3KK3A 2RDIA 5C42A 4FLYA 3OYAA 1IKXB 1DTQA 1NHUA 1JLGB 1L3UA 4ED0A 3DLBA 4AHVA 4AH9A 4O4GB 2HHSA 4TY8A 4FLVA 4K8XA 2FLPA 4DSFA 4TN2A 5L1IA 3KLFB 4MFBB 4KFBA 1OS5A 4DL4A 4FJMA 4RG8A 3M9NB 2FBXA 4W5RA 4FW1A 1RTJA 2AQ4A 4GMJB 4RNNA 3KLIB 4IFYA 1QSSA 4G1QA 4MH8A 4GVMA 1HQUB 5KGWA 4CHYA 1FKPB 2KW4A 3HVRA 3CJ5A 1EX4A 4ZVEA 2EX3A 4FZXC 2V4QA 1U4BA 2J6TA 3V6DB 4FM0A 5KFSA 4PUOA 1X9WA 3G86A 4FJ7A 4CESA 4OPJA 3K5MA 3MR3A 3U3GA 4KHRA 4O3OA 3DRPB 3NCIA 1JLFA 3T5JA 1BIZA 1LW2A 5J1EA 1C1CB 2IC3A 3L2QA 2G8FA 4RW6B 4EZ6A 2UVVA 3K57A 4CEBA 1IKYB 3AA2A 5KG5A 2R2SA 2BDPA 4ZPAA 3BDPA 2QXFA 4NRTA 2IMWP 1S1WA 3LAKA 2FVRA 5KFPA 1NK7A 4BDPA 5F8HA 3PV8A 1TV6A 5T14A 5F8MA 4FS2A 5HLFB 1MMLA 3U6FA 3KK2B 1X9MA 4H4MA 1FK9B 2HNZA 2GIQA 5KFXA 3V1QA 4ZVFA 2UVRA 1LV5A 3N6LA 4I2QA 4KTQA 2G8WA 4B8AB 3LP2A 1WSHA 3RR7A 4B9SA 2JEJA 2I1RA 4DQIA 2LSNA 3HM9A 3QNOA 4H8KA 1U45A 3OYEA 4CGIA 3VQ6A 3V81B 1VSKA 3HPOA 2VG5B 3HPGA 2OPPA 1S6QA 1VSEA 1RTHA 3OSPA 3NGDA 3ZSYA 3H5XA 3OYKA 4LSNA 4JS5A 3GQCA 4ED1A 2ETJA 3V6HA 2YKNB 4RW9A 1EETA 3ICLA 3NGZA 2GUIA 4NLUA 4L8RB 1VSDA 2E9ZA 1UOCA 1WSGA 3G0ZA 3ZSVA 4Q43A 3L2UA 3V6KA 5DG7A 4RNFA 4HUEA 3OJSA 1XWLA 2QK9A 5DQGA 3AVGA 3WNFA 1VSMA 4OPKA 2X6SA 5CZ2A 4CJ4A 1HNIB 4CK1A 4HKQA 4RW8A 5I42A 1BQNA 2XCPA 1LAVA 1RBSA 3CFPA 2OPQA 3HJFA 4K4UA 3LPTA 2IM0A 4NLPA 1X1PA 2ILYA 4I2PA 2GBZA 5J2MA 5DQIA 5KFCA 4O0IA 1DLOB 4Y2AA 4LQ3A 4N56A 4TQSA 1UA1A 3KHGA 2OZSA 1ZETA 2R8IA 4HHTA 5HRNA 3SUOA 2VG6A 1S9GA 3MF5A 3QEPA 4JV2A 1JL1A 5SZTA 4IRDA 1W9HA 4CEQA 3M8QB 1HNVA 4R5PB 3V9ZA 2HNDA 2XI2A 5DGBA 5HBMB 3SCXA 2C2RA 2CJQA 2G8VA 4F3OA 4F4KA 2D0BA 2W9BB 3RMDA 1JLAB 4O3SA 5CYQB 1TL1B 2O4IA 1C0UA 1S1VA 3DOKB 4FLZA 3KD1E 3KMQA 1NHVA 2QKBA 1TKZA 2FC0A 1XC9A 3JYTA 4EBDA 2BGGA 4KI6A 1NK9A 4R8UB 1ZBIA 4ECTA 4FM1A 4ZP9A 3SFUA 3AVLA 3OSNA 3CJ0A 5KFVA 3MFHA 4FS1A 2FVSA 1WLJA 1I39A 5C5JA 2FVCA 3HL8A 3QZ8A 2P51A 3D0PA 4CIEA 3CQ8A 3V9WA 4B8CA 4ECRA 2ZKUA 3QZ7A 3KMSA 2O5DA 3QIOA 4CK3A 1JLQA 2ZE2A 4M3TA 3KJVB 3IRXB 4O44A 4IQXA 4F50A 3VA3A 4AHSA 3LAMA 4URQU 4FJXA 1HPZB 1WAJA 3FFIA 5D3GB 4F4XA 2XI3A 4MK9A 3F9KA 4HYKA 3CDWA 4ED6A 3KLEB 4AILC 1LWEB 4ICLB 4BWJA 1CZBA 2XGPA 4DTMA 1S1XA 3C6TB 2QE5A 2Y1IA 3OYIA 3KK3B 3M9MB 3ZSQA 3DLRA 3BSNA 1CLQA 5C42B 5KFMA 5KFNA 2V9WA 1SL2A 2AX0A 4KHYA 3MEDA 4RNOA 1RAJA 4TY8B 1ZYQA 4K4ZA 4I9LA 4KTZA 5KFQA 4KFBB 2JLEA 2FBTA 4WXOA 1RDBA 1SKWA 4ZHRB 3BGRB 4K8ZA 1B92A 3VQ5A 2YHAA 4DL7A 3M8RA 1RTJB 3VQ9A 3ALYA 2BQRA 5KGXA 3BQ0A 4U6PA 3QYYA 3QO9B 3AVKA 3SUPA 3DLKA 4M3UA 3HKWA 3NF7A 1A5XA 2XCAA 4ED2A 1RT7A 4DQRA 3K5NA 3QINA 5F8LA 1NJXA 4N5SA 1LWCB 4GC7A 4F3TA 1HYSA 4BDZA 4N47A 4LH5A 3DM2A 3AO3A 1K6YA 2RN2A 2XY5A 1S9EA 1JLFB 3MR5A 4KHMA 3K2PA 5L1KA 1N5YA 3VQDA 1LW2B 1TKXA 1EP4B 3NAEA 4CJVA 4RUAA 4K4WA 4Z4HA 4ECWA 3V9UA 3AVNA 3P5JA 2YKMB 3H5SA 4FK2A 4DU3A 1TV6B 4QWBA 2W8LA 1FKOA 4B08A 3I0RA 1MU2A 4H4MB 3QEWA 3ZT4A 1SUQA 2KQ2A 2PZSA 4FJKA 5F8GA 3VQEA 3M8PA 1JKHA 4H54A 2HHQA 1LWFA 1T03A 3IAYA 1XHZA 3O3GA 4ZPDA 3MEEA 2PYJA 4HUGA 3Q8QB 1QSYA 1NKBA 5J2PB 3H5YA 4EP5A 1RTIA 2OPPB 1S6QB 4E89A 2EC0A 1RTHB 1XR7A 4DF4A 3PW5A 1N48A 4LSNB 3IGVA 4KTWA 2CKWA 4RW9B 2A1SA 1EETB 5F8JA 4BACA 1SV5A 5KG6A 5EU7A 4DG1B 2BR0A 3AV9A 2VA2A 4CGJA 3L2VA 4B9NA 3ZT2A 1SH3A 3V4IA 2BRKA 1ZBLA 5KFYA 2R2UA 1S1UA 4FZYA 3LDSA 3AO2A 3E01A 4NLXA 1YVUA 4DL3A 2R8GA 3C6UA 5CZ1A 4CF2A 1KVBA 4DTNA 2QV6A 4CJ3A 5I42B 5C24A 2IGIA 4O3QA 4J9LA 4CJ5A 4M3YA 3AA3A 2OA8A 2OPQB 4FJ8A 1S97A 2OZMA 1QTMA 1XI1A 2W7PA 4KAIA 1HQEB 5J2MB 4OKKA 2XGQA 2IOCA 3OL6A 2YNIA 3VQ7A 2ATLA 4CIGA 5KFJA 4J9OA 2W42A 1S9GB 3NBPA 3LANA 2FBVA 3TARA 1EKEA 2WONA 3BREA 2AJQA 4WYWA 1HNVB 1RNHA 3QGIA 1SL1A 2HNDB 1WSEA 4E7IA 4ELTA 4Z0UA 2VG7B 4HCBA 3AO4A 4FLTA 3NHGA 1KLMA 3OYLA 3UDLA 5KT3A 2E6MA 3RB6A 3QLHB 4HUFA 3EY1A 5FDLA 4J9QA 1S1VB 1J5OA 1SKRA 1TKZB 3JSMA 4FBUA 1J53A 4FZZA 2HHUA 3G6YA 3JYTB 1S0NA 4WFXA 4DS4A 1C1BA 3MTKA 1JLCA 5FRNA 4ECQA 4I7FA 2NUBA 1RT6B 2DPIA 3OYBA 4QW8A 1N4LA 4OKEA 1NKEA 1B9DA 3HSTB 4E7LA 5J2NA 4KKOA 1NK5A 4OLBA 3H4DA 1D9FA 3OLAA 3D5MA 2KFNA 1GX6A 2KTQA 4OKJA 4EP4A 3OHBA 2PYLA 2ZE2B 2W9AA 5KFWA 1Z25A 1VRTA 2YNFA 4TYAA 3RMAA 2WRMA 4JLHA 1QQCA 1XR6A 3AVIA 1Z4UA 3ZSXA 3H08A 4DF8A 3HP6A 1HARA 3V1RA 2B6AA 1T94A 4AHCA 4ZMMA 4F4YA 1C0TA 3GV8B 1RBRA 5KFAA 1HMVA 3EZUA 3CJ3A 2FBYA 2AWZA 4ZVHA 1FXXA 2W8KA 1CZ9A 3MEDB 4NRUA 1K1SA 4KB0A 1TKDA 1QE1A 5DLFA 5F8NA 3IS9A 2KFZA 3CM5A 4EYHB 1ITGA 4CIFA 1RDRA 2HHTA 4IG0A 4WE1B 4Z4IA 4IG3A 3G6XA 4MIAA 3RB3A 3AA5X 2HWHA 5HP1A 4DFJA 3OL8A 3DLKB 1JLBA 1KFDA 4KBIA 1BHLA 1KHWA 1QAJA 1QSLA 4IFVA 2HHXA 4RW7B 1KHVA 5DG8A 5FROA 1GOCA 1RT7B 1VRUB 5KFEA 4ID1A 1TVRB 5HROB 4ID5B 4NYFA 5T7BA 4HCCA 3DM2B 2RPIA 1C2PA 3MECA 3SI8A 4FLXA 1GOAA 4CJSA 1N5YB 3ITHA 3RTVA 1D5AA 4ZP6A 4RW4B 3ZSZA 3MR6A 4CJEA 5KT7A 3LPUA 3SQ0A 2G8KA 3Q8PB 1RDCA 4FYDA 3KD5E 3EPGA 4C8KA 5KFRA 1N56A 4IH5A 2RKIA 4E7HA 5J2QA 1RTDB 1J9AA 1FKOB 5C25A 5KTQA 3TAMA 4URSA 2YHBA 2KZZA 1T05A 1RT5A 2Y1JA 2JEGA 4Z4FA 4URGA 2HNYB 3M8PB 1JKHB 4IKAA 2WTFA 3PO5A 1SH0A 3KOAA 1LWFB 1T03B 2E9TA 3K59A 3UQSA 3MEEB 3DLGA 4TYBA 3Q8SB 1C6VA 5KFBA 4ECXA 3S9HA 4W5NA 4QWAA 4NLDA 3QIPA 4DQPA 1RTIB 3WNEA 4DFMA 2F8TA 3G6VA 4YP3A 2OPSB 3LP1A 4MQ3A 1BGXT 2O4GA 1T8EA 1TAUA 1SV5B 5KFIA 1S9FA 4CJQA 4ZPBA 3PW0A 4CJUA 4CK2A 3NH1A 1KFSA 3LP0A 4LQ9A 2W9CA 2AGPA 3CDEA 3O4NA 2ALZA 1S1UB 1NK0A 1ASUA 4B9MA 1JXLA 2JEFA 1S1TA 3C6UB 3N6MA 1N6QA 1REVB 5C24B 4IH7A 2IM3A 3DOLA 4J9SA 4PA1A 2E9RX 4DL5A 3OYCA 3KHHA 4CHZA 3PJWA 4JS4A 3V9SA 5F9NA 1RT4A 4OGEA 2IAJA 3PR4A 3GIJA 4J2DA 2PY5A 3TVKA 3OYMA 4KO0A 4CEAA 4KHNA 5JUMA 4F4WA 4B3OB 1RT3A 3DLEA 3HPHA 3OYFA 4EYIB 3SV3A 2ITGA 5KI6A 1KRPA 2B43A 4CFCA 4ED8A 4B9UA 3GILA 1XR5A 4DTOA 5SWMA 1KLMB 3MEGA 3KHRA 1KSPA 3TR8A 3H98A 1TL3A 4GW6A 4Q5VA 4WZMA 2ILZA 1RBVA 5FDLB 1RYSA 4KRFA 4M3WA 4NYZA 4LY7A 1J5OB 4Q44A 3EYZA 2BE2A 3SPZA 3JSMB 1X9SA 1R0AA 3NMAA 4DU4A 3H5UA 5KFKA 4FJLA 4KE5A 4FLWA 3VQAA 2D5RA 1JLCB 3I0SB 4FJ9A 4I7FB 4OVLA 1IM4A 1L3TA 4IOBA 4CHOA 1IG9A 3SNNA 4AHTA 3KKRA 3P1GA 1HYZA 1UAXA 1RT2A 2FJXA 2FVQA 3T5HA 4KV8B 2HMIA 3VQPA 2JGUA 3MXMA 3ISND 2OPRA 4ECVA 1VRTB 2YNFB 1UWBB 4FJ5A 4WZQA 3AVJA 3RR8A 3VQSA 2OYQA 3ZT1A 1EXQA 1DTQB 4PY5A 3PX0A 3ZSOA 5KFLA 3PHEA 1JLGA 4KHUA 3RAQA 4IDKA 1K1QA 3BSCA 1C0TB 2X78A 4FJHA 4R0EA 2UVUA 4CECA 4YR3A 1HMVB 2UUTA 4CJWA 3WNHA 4KHWA 1IKWA 4J9MA 4FW2A 4F2RA 2RF2A 2A1RA 4IFYB 4G1QB 5KT4A 1QHTA 4ZPCA 4JRQA 3NDKA 5KG0A 3IS9B 2FJVA 4M42A 4Y3CA 2R8JA 1QUVA 3DI6A 4W5OA 2R8KA 4FK0A 1FKPA 4IG0B 3SQ2A 2YNGA 5KFDA 2XRIA 4J9RA 4PUOB 5KG3A 3NGIA 2JC1A 2E6LA 5HP1B 1RYRA 3DMJA 1RT1A 1ASWA 4CHPA 4E19A 4IFVB 3I5AA 4FJNA 1IO2A 3S3OA 2Z1IA 5J1EB 3S3NA 2IC3B 1VSHA 2HVHA 2AU0A 4B9LA 3RMCA 3MECB 2UUWA 4DMNA 3KK1A 1IKYA 3ZSWA 3RBDA 5E41A 3L2RA 5DG9A 1S1WB 3ASMA 5FRMA 3AVCA 3ITHB 2JC0A 1TGOA 3LP3A 2WHOA 3IGNA 1F21A 4JRPA 3KKSA 5KFHA 4EBEA 1DTTA 1U48A 1BIUA 3WNGA 3P83D 5EWFA 1JLEA 2HNZB 2R8HA 3NL0A 1FK9A 4QPXA 4I2QB 3AVHA 2RKIB 4KREA 4DTJA 2B5JA 3LP2B 4O3PA 5CY4A 2GIRA 3SPYA 4M41A 2P5GA 3M8SA 3TAMB 1BISA 4NLVA 4O55A 4NLQA 2W7OA 3OYGA 2VA3A 4DSKA 1Q8IA 4E7KA 4J2AA 1RT5B 3HYFA 3FDSA 3V81A 3RB0A 2BQUA 2HHVA 2VG5A 1TK8A 4M94A 3PW4A 2G8HA 4CGGA 3KTQA 5DGAA 2WOMA 2YKNA 3HVTA 1Y97A 4UQGA 3QIPB 1WAFA 4XPEA 4RU9A 4DL2A 4QW9A 1D8YA 3VA0A 4YR0A 2XY8A 2YNHA 3RRGA 3ULDA 1S0OA 1BI4A 4M95A 4X2BA 4MKBA 3NE6A 4RW8B 4ZP8A 1WSFA 1BQNB 1NJZA 3NAHA 5CYMA 2UVWA 3LALA 3T3FA 1IH7A 3G10A 4I2PB 1S1TB 3EPIA 4NLRA 4C8NA 1QAIA 1BQMA 1N6QB 4TY9A 4DQSA 4F4ZA 2VG6B 4NLOA 5DQHA 3NF8A 1A5WA 2WB4A 4EO8A 1ZTTA 3OL9A 3QNNA 4QCLA 3SQ4A 3M8QA 4OL8A 4DEZA 2HWIA 4WXWA 5I3UA 4R5PA 2DPJA 2VWKA 1KVCA 4W5TA 4OLAA 5HBMA 4ELUA 1TKTA 2C2DA 2OH2A 3DLEB 4J9KA 2D7SA 1C0UB 3LWLA 1TL1A 5JXSA 3T5LA 2F8EX 4TLRA 2R2TA 4Q0BA 3SYZA 3MEGB 3UPFA 1TL3B 1JL2A 4GC6A 3SI6A 3NH2A 4R8UA 3DRRA 2XY6A 4FK4A 2XO7A 4DLEA 3HP9A 4CF8A 1LW0A 1R0AB 5DMRA 3VQCA 4DTUA 4LD0A 1CXUA 1WN7A 4O0JA 5KG1A 1Z26A 1D9DA 4DTXA 4ZVGA 4TQRA 1L3VA 2FVPA 1JLQB 4FXDA 2BANA 1S49A 1NNDA 3A2FA 4O44B 2BQ3A 3RBEA 2IJNA 2FJWA 2FLLA 3TAGA 1RT2B 3C95A 2DTUA 3B6PA 3THVA 3QGHA 3FFIB 3O3FA 2HB5A 1W0HA 2RDJA 1S6PA 4CEDA 2HMIB 1TK5A 2OPRB 4MIBA 4G3IA 4E7JA 1NK4A 4FVMA 1LWEA 1S1XB 4ICLA 3NH0A 1ZBHA 2EHGA 3C94A 5KFGA 3RMBA 1NOYA 1ASVA 3C6TA 1BL3A 1JXEA 4BE2A 4LSLA 5KT6A 4QAGA 3ZCMA 4ED7A 1WSIA 4IR9A 4LH4A 3OYNA 4DSJA 4DFKA 2GV9A 3SZ2A 4IDKB 3NKYA 3H40A 4NLTA 1TP7A 4ZP7A 3NAIA 2Z1HA 3OS1A 1IKWB 3T1AA 2JEIA 5HRRA 4ZHRA 4Y34A 3BGRA 2RF2B 2ZQBA 3OY9A 4NCBA 3PO4A 3RB4A 2XY7A 3ZT0A 4CF0A 4Q8FA 3QO9A 3MR2A 3DI6B 3M9OB 3CM6A 5K14A 3IN5A 1RBUA 4BWMA 4EBCA 2YNGB 2J6SA 4CEEA 1S48A 4FLUA 1HYSB 5DLGA 1VSIA 3DMJB 1UA0A 1LWCA 5L1JA 3TABA 4Z4GA 1RT1B 4CGFA 4FBTA 4CJRA 1U09A 1U49A 5F9LA 4DS5A 4M45A 2ZD1A 1S9EB 2AGOA 4DTRA 1TKXB 5L9XA 4F8RA 4J2EA 1Q9YA
chains in the Genus database with same CATH superfamily
3MCAB 4B3MJ 2HEKA 2V4RA 5EX3A 2FHOB 1C0MA 4O3RA 1C1AA 2MZ1A 1YJ9N 3GV5B 3HVAA 1U47A 1NZ8A 2CPIA 1MU2B 4K4TA 4IOAQ 3KK7A 3P5BP 5KT2A 1KVAA 1QJHA 1S0MA 3G9CA 5A0YA 4OZJA 1VRQC 4CO2A 3GIKA 4JKGB 2VQEK 1IWGA 4P72A 4BLGA 2ZZTA 4C3LA 1WI6A 2XMMA 1XMOK 4WK3A 4WYLA 3L9ZA 5LXRA 5J2PA 4K25A 1RBAA 4QWCA 4NI2A 1W7AA 1GLCG 2DFFA 5LOQA 2WOMB 1UEKA 1NSAA 4WFBL 3QGGA 1EJ7L 2HRYA 4IEIA 1VBZA 2ZH1A 3H4BA 4FJGA 3M8ZA 1S3XA 4DSLA 3C15A 4WK1A 4DR4F 2YNHB 2F63A 3KDNA 5M1QA 3KLHA 4GNIA 3RJMB 4J9PA 3S1TA 4ILRA 3T5KA 2EK6A 4GKKK 1T6CA 4B1XB 1WG1A 4JV1A 2GC8A 2RUGA 1YJRA 4ZTJA 3CIPA 4H4OA 5CYMB 2ATQA 2Q79A 3KG1A 1SAZA 4JI7J 2G2ZA 3K5OA 2XO6A 3MX5A 4NYNA 3ZZ0A 4FKYA 3ENOA 3VERA 2ZHAA 3TAFA 4DI6A 3S3MA 1XJWB 4M3ZA 3KJFB 3NBPB 1VR6A 2D4WA 2WONB 4IKFA 2AT1B 3K89A 3UW1A 1W25A 3SSRA 5DS7A 2P9KB 4DV1J 4FF3A 1UVKA 4KGZB 2UUCK 3W2WA 1TKTB 3ISZA 4RZRA 2P9UA 2J5AA 4CBUA 4KB1A 1VK0A 5CABA 4PCQA 2I9SA 2OI2A 3TANA 2FXUA 1QHAA 3OVSA 3ZC4A 1NPRA 3FQLA 3W0LA 3FC9A 1HRHA 3VPZA 1LW0B 1NK6A 4GKJK 1H73A 3DOMA 1G7CB 3OR1A 3TUZC 1VBYA 4TSXA 3HT3A 1HLWA 5J2NB 5DK5A 1KKHA 2K06A 4OZ0A 3TAPA 3IUCA 1XHXA 1NJWA 1VCTA 1KCFA 2UV8G 1M5PC 3CB4A 2MLYA 1O8BA 1WC4A 3NCQA 3TTCA 4M5NA 4CFAA 1LAWA 3DFEA 1F1BB 4I9QA 3O4QA 2ZM6F 4BDYA 3D45A 2E1PA 5C10A 4QOTA 3MAAA 1P27B 3JTOA 2YBVA 4Q2LA 2RQKA 4LSLB 4DSIA 4MFBA 3OTOJ 4GVBB 1I6JA 4P2MA 3C8YA 1FD8A 1FW6A 1CQNA 3K9KA 3CC4S 1U04A 3I8DA 4YNQA 3CMEN 1SKUB 2Q97A 5HQ8A 3U3YA 2IS3A 1NDPA 3I5BA 1Q0NA 1QQMA 3PVXA 3S01A 3D2FB 3NRBA 3T9ZA 2B9XA 1FI4A 3THWA 3DLHA 2DNMA 4WE1A 1N32J 4A46A 3CDUA 1GK8A 1VQ7S 1N5VA 3IKMA 2P9CA 2WVBA 2NRRA 4KH1B 2KXNB 4BS2A 3VTIA 2N7YA 4JI1K 4QR0A 4NLCA 2V9KA 3DRPA 1TAQA 3MCMA 5KT5A 4WF9L 2M7SA 4Z4EA 1RLCL 1UP1A 1ZBFA 2QO3A 2ZD1B 4D3GA 3MN7A 2V52B 1HBMB 2IRYA 4RNHA 1M5HA 2VBYA 2FLNA 3M3ZA 3GYNA 4CEOA 1MMNA 1KTVA 4ECUA 2HHWA 3TR5A 3KK2A 4JYAF 1J27A 3R97A 2HYIB 2LA4A 3V9XA 4PWUA 5KG4A 4L3NA 4IR1A 3PYFA 3L2WA 7FDRA 4M5DB 3MM8A 3T6JA 2UUBF 2N7CA 1U26A 1XUPO 3A4TA 2HNYA 2OEMA 2XYGB 4TXSA 2EWSA 4K4VA 3TI0A 1DARA 3KWIA 4RO0A 3ZT3A 4BR4A 4YMEA 2X6NA 2GTDA 2JRSA 3MFIA 3LP1B 2Z30B 3HK2A 1VAZA 5I3PA 1B9FA 4B9TA 4CF1A 3B6OA 2D3ZA 3JSRA 3FLCO 1WHYA 5IQQA 1RWNB 3IXQA 3CCES 1RAIB 3G87A 4WYBA 1QS4A 1D3WA 3PTWA 3W5XA 3BY5A 4DV2J 2DFEA 3H46O 3BYPA 2F96A 4PQUB 3FQKA 4CJTA 4ZJOA 4NXMK 4ZTFA 1DLOA 3QAUA 1TYQA 4BRLA 4ECYA 1REVA 2FJBB 4KGXB 2MTLA 2NR0A 2HBQB 5E3PA 1J5EJ 1RT4B 3PR5B 4DV4J 4KQZA 3K0JA 1UW4A 2DCLA 1Q7LB 1T44A 1WBDA 3BH6B 2DEIA 4AQYF 4KO0B 2L3MA 1RILA 4FPBA 3DAWA 2R7YA 1ELOA 4YEAA 1M5OC 1VQ8N 1JIHA 4RKUC 4B3OA 4K59A 5AQVA 2R2RA 4L76A 1NGHA 3DOKA 3HD1A 4EZ9A 2QFIA 4CBXA 5IT9U 3GG0A 1FFSB 1Q18A 3FSYA 5C12A 3A8IA 2MQ8A 4K2JA 4FYXB 2GMHA 3PX6A 1S6OA 2BE2B 5IWAF 2YY3A 4Y2MA 1WELA 8ATCB 3BO4A 1YT3A 1KC8O 1RK8A 2IJFA 3I4PA 3KXDA 4ILJA 5KG2A 4C1NK 5IS2A 5C15A 4B3MF 1N88A 2DYAA 4ZIVA 2Z8QA 3SK3A 3WIUA 3SUQA 1CC8A 4F4AA 3PIPL 4BCAA 3CWJA 5AQQA 2NZ4A 3OR2B 3IC1A 4JI4J 2BJ8A 2BTFA 5A6WA 2PMHA 3AT1B 4CZFA 2RQCA 3KLGB 2D41A 4RUCA 2DGSA 2JH3A 2B4JA 1YI2N 1YJ9S 1TL4A 1IBMK 4KV8A 5AQMA 4CJ7A 2ADCA 4Q8EA 4E1MA 1QTNB 3EGVA 5KG7A 3IG1B 4CLFA 4FLYA 3HHLC 1Q5VA 1NHUA 2MGZA 1L3UA 4ED0A 1OJ4A 1JK9B 1WC6A 2HHSA 2PA3A 2D1KA 4FLVA 2YWEA 4DSFA 3KLFB 4PL7A 4DL4A 3EKSA 3D3BJ 2KHOA 4W5RA 1UJ6A 3TZZA 2AQ4A 2A6AA 4YY3J 4X64K 4IFYA 3OTEA 4MH8A 1S12A 1DAXA 5A8KA 2Q1LA 2M9KA 1HQUB 2EFNA 1FKPB 2KW4A 4FZXC 2NPIA 1EWRA 4W92B 4QIVA 3P45B 1MG7A 3G86A 4FJ7A 4CESA 1M5SA 4JI7F 5D4LA 3MR3A 4ZKAA 3POTB 2B9WA 4YN3B 1YSJA 2O8EB 2VDIA 3ZZYA 3PDNA 1C1CB 3U27A 1KD1T 2G8FA 1HNWK 3K57A 2UVVA 4KC5A 1ACMB 4TVAB 2R2SA 1CJKA 1VHFA 1EB0A 2GJFA 1XMBA 2UXDK 1NK7A 3PV8A 2JVOA 2QSWA 4Y2IA 2AF6A 4EGLA 4CTAB 1FK9B 4DZ6A 5JLHA 2HOEA 3E8OA 5AQRA 2UVRA 5IV4A 1LV5A 4KTQA 3HSGA 4H5NA 3AAQA 3EXYA 3TEHB 3A8YA 3M2UB 1W7WA 1PAEX 2BZ2A 4HWIA 1JCFA 1BHNA 3VQ6A 3H7HB 1BWFO 5IT9O 1VSEA 2XS5A 1RTHA 2QLBB 3G25A 3C46A 3OYKA 4JS5A 1MWYA 4ED1A 3NGSA 3V6HA 5E5NA 4I6WA 2O67A 5GMDA 2IHR1 1ILYA 3ICLA 1WB9A 1YX2A 2VPZB 1VSDA 2E9ZA 1UOCA 1KQSR 3F56A 4PYDA 3R5AA 4N8OA 4Z37A 3AGKA 4AD6A 2QK9A 5DQGA 5GMKa 3AVGA 3BM7A 1HNIB 2GVDB 3C14A 2LEBA 1FVQA 3VAFA 1LAVA 2GQQA 2QA4G 3HJFA 2HZCA 2CZVC 2BX6A 2PAVA 3LPTA 4A48A 2VONA 3KDOA 3OTOF 4X4RA 2UXBF 2ATCB 2NZCA 4LQ3A 4WU2A 1QZ6A 2P9SA 2BJEA 4HHTA 5HRNA 4P75A 1S9GA 2VQEJ 3MF5A 3QEPA 4IRDA 2H3GX 4CEQA 3M8QB 2F40A 1WKLA 2J8AA 3V9ZA 5E0OA 3CMES 5HBMB 4F3OA 1OO0B 1N32F 3TX8A 2D0BA 4MDBA 3L4BC 3MDFA 5EXWA 1XNQK 3RMDA 2PO4A 4LSZB 1JLAB 4K8RA 4ZIWA 3M7VA 4ERDA 4WBFA 4DPOA 1TL1B 3UD3P 4OI0A 2EBGA 5THWA 3QT8A 1NHVA 2MJUA 1KQSM 4ZVRB 1NK9A 5ETVA 4R8UB 1Y0HA 4ECTA 3D6MB 2O8BB 4WCEQ 4FM1A 4ZP9A 3SFUA 3AVLA 3MFHA 3JB9k 1GNKA 3K8WA 5C5JA 5IT9Y 2PIIA 3VHQA 1IVZA 1F2HA 2LXIA 3CE8A 2ZKUA 2QWQA 1WJ9A 3KMSA 2JX2A 3QIOA 2RDDA 3QRRA 2E5HA 1TR0A 4M3TA 3O9RA 2VKRA 4O44A 2CVIA 3VA3A 4AHSA 2VGMA 1RI7A 3R9LA 5IFMA 3IFRA 3FFIA 2ZJPQ 4ETXA 2PA8D 3JQKA 2F9DA 3PFEA 1MWQA 3BDEA 3SQOP 3KLEB 2N4DA 3J7A1 1S1XA 2C42A 3C6TB 3M5RA 3L4IA 2DH8A 3KK3B 2FC8A 3BSNA 2UUCJ 2NSCA 3R1XA 2E7WA 4DR1F 2DVIA 1FFGB 3LOUA 2X1FA 5C7PA 4KHYA 1MDUB 3RRKA 1RAJA 3BB5A 3M2RA 1ZYQA 4I9LA 3W5ZA 2AIRB 2OTJN 1SKWA 3JSYA 1GLFO 3ID6A 3M8RA 3QB0A 1RTJB 4NASA 2APOA 4GKJJ 2KI2A 2BJ3A 2IRUA 1FNXH 2RE2A 2HWTA 1NRKA 2MQPA 3QO9B 2OSQA 1GMWD 1PJ6A 4BRPA 1G3OA 1A5XA 4ED2A 2VWBA 2PGCA 3IWNC 1B4SA 4DQRA 2YPZA 3WIVA 2CWXA 5BN9A 4OYAA 4LH5A 3DM2A 1MWZA 4YOTA 2F8MA 4RCHA 1K6YA 4C3MA 1BO5O 1S9EA 5B0DA 3N28A 1N0UA 3G6EN 2VL1A 1TKXA 2EG1A 2DXFA 2GCFA 4CJVA 2F9TA 3MUTP 1UCNA 4C0BA 4LF6F 4OYIA 1HFEL 2YKQA 4CD1A 1VQ8S 3BBCA 2W8LA 4FVUA 1FKOA 4B08A 3D2EA 1CG2A 4H4MB 3QEWA 3ZT4A 1SUQA 2PZSA 5F8GA 2MKHA 3PKYA 1S99A 1JKHA 3MMCA 1T9WA 2RS2A 1V4TA 1XHZA 5B09A 4IUFA 4EHTA 3MEEA 2PYJA 1PO6A 1KP6A 1QSYA 3FZKA 3C2PA 1NKBA 5J2PB 3H5YA 3UB5A 3RBXA 4EP5A 1FDAA 3HFKA 4JI1J 1ZC6A 4NI2B 1N48A 1TUYA 2NRVA 1YRXA 4RW9B 1SV5A 5KG6A 5EU7A 3AV9A 4DU7A 1WTBA 2DJWA 4B9NA 4K41A 2ZKTA 2BJ9A 3AQOA 2BRKA 1CQMA 3N4WA 2R2UA 3W9HA 4JB8B 4DX7A 3LDSA 1YVUA 1YI2S 3SAHA 2ZWHA 1PKUA 4WFBQ 4ZJQA 4YS2A 4DTNA 2QV6A 2B4PA 2AD9A 5AQLA 5I42B 3KWGA 2IGIA 2KM8C 3RG6A 4BC9A 1XI1A 2HBMA 1YAGA 2GUPA 2IOCA 2DNNA 1RHMB 3VQ7A 2J4RA 1X4CA 1HKGA 3QBXA 5KFJA 2Q1NA 1QVGR 2H54B 1KS2A 4B3RJ 1AFIA 4KGKA 2ZF5O 3VEYA 2XM3A 1EKEA 1VLOA 3BREA 1RNHA 3TOQA 4LR7A 4ZOSA 2HNDB 4PRFA 1WSEA 4ELTA 1DQ8A 4JHDA 3AO4A 4YOUA 2D9OA 2POKA 2P9UB 3M1VB 1FCAA 2Z2ZA 3QJLA 3ZTRA 5FDLA 4AT1B 4RUBA 1TKZB 2HHUA 2QTDA 3JYTB 1R7IA 1RACB 2KVIA 1FNOA 4WP9A 1RWMB 3HOTA 2QL5B 3OYBA 3MCSA 4M63A 2VZ9A 4NXMJ 1UVNA 4P2XA 4BRMA 2H4YB 3GDQA 4OLBA 1GQEA 5LM7E 1Z2ZA 4QS8A 3D5MA 3CSKA 2ZE2B 3D0IE 4X65F 1QVGM 2PMZD 1HL6A 4LF8J 2CPDA 4JLHA 4U7UD 1QQCA 1KQKA 3GB0A 3AVIA 4LFAJ 1D4XA 4HL9A 2Z2MA 1U02A 4BVPA 1T94A 3MMBB 3NVMA 4AHCA 4CZKA 4WQ5C 1C0TA 3CJ3A 3FGVA 3TWZA 3D7SB 1GFWB 1VOMA 4FN5A 4QIGA 1NCLA 5DRKA 1GMVA 3EEQA 3R3TA 3BN4A 2I7NA 1AROP 5AQWA 5F8NA 2KFZA 4BY9C 4I1TA 4ANEA 3SDEA 3THWB 2ZH5A 4JI5K 4IG0A 4WE1B 3I31A 2CQIA 2HWHA 3LGNA 1NGFA 4XK8C 2ASOA 2K8GA 1BHLA 1KHWA 4IFVA 3HCXA 2IPOB 5E7OB 3KYLA 1KHVA 4FKXA 1GOCA 5ETMA 5KFEA 1MROA 3R2DJ 1I94F 3CO0P 1IBMJ 4A8MP 4ZVSB 2K3IA 3FKBA 2J7WA 1GOAA 4CJSA 1LCUA 2JWLA 4YHHJ 4ZP6A 3ZSZA 2F4FA 4WF9Q 3C3LA 4ZLLA 2X1AA 4AXIA 3Q8PB 5E3QA 5AT1B 3KD5E 1HR0K 3Q8YA 5AR0A 4X4OA 4IH5A 2RKIA 2E7VA 1ZM4A 4BR0A 2HHHK 3B78A 3PRDA 3ZETA 5F2RA 4X64J 4LT6A 4BGBA 4Z4FA 4URGA 2HNYB 3M8PB 4IKAA 3ULHA 2XHCA 3KOAA 2E9TA 1F9HA 2C3OA 4WQ4A 2A40A 3DLGA 3Q8SB 3RW6A 4HACA 4C6AA 4G1PA 2GHWA 4N77A 1GLJO 4DQPA 4S0MA 2F8TA 4YORA 3FMWA 2GX9A 2CVEA 4KYZA 2J7UA 4CO0A 1HNWJ 5F1XA 4ZPBA 4ZN3A 3PW0A 3L4QA 4CK2A 3VAGA 3PSIA 2W9CA 4MO4A 2QWMA 1YLXA 2UXDJ 2F9JA 2ALZA 1NK0A 4KPCA 4NMLA 4I69A 3FK4A 2JEFA 4EFHA 3C6UB 3DWLA 3TTDA 1FRMA 5GADU 2CFXA 1REVB 5C24B 2IM3A 3DOLA 2B4OA 4J9SA 2DR7A 4CHZA 1JJ2R 5D0HA 3PJWA 4JS4A 3V9SA 4JKCA 3UKRA 3PR4A 3GIJA 1C0GA 4J2DA 4B3SF 2C2NA 4OO1J 2CQ2A 4USWA 3BGLA 2V34A 3GJRB 4B3OB 3HPHA 2OTJS 4GVEA 4EYIB 2G4BA 3SV3A 4NWBA 5KI6A 5D4PA 5AJ3F 3EL2A 2J7KA 4B9UA 5M1NA 4FF2A 3ZX0A 3TR8A 4N8NA 3S8SA 4Q5VA 3EKUA 4PKIA 5D78A 2LEPA 4JKEA 1J5OB 4FXWA 1KONA 3SPZA 2O8FA 3NMAA 3O4WA 4PXCA 4OYXA 4FLWA 1R6YA 2D0OA 2D5RA 4U7BA 5CZVA 4I7FB 1NBEB 4OVLA 4FJ9A 5BYSA 1FT8A 2W2OP 4KY3A 1RAOA 4ILGB 3J81U 3G6ES 2XMTA 3RSEB 4CYUA 5H1SV 3MCPA 4CHOA 1JJ2M 3CJAA 3GMGA 3AY0A 1XQSC 3P1GA 1UAXA 2F7TA 4RWXA 1TUUA 3ENVA 4C8YA 4KV8B 5HQMA 3CULA 2JGUA 3LH2S 1VRTB 2YNFB 3PIPQ 1FRJA 4YDUA 3D0GE 3L09A 1XNQJ 5CD4A 2MGZB 3ZSOA 1CPZA 3EVWA 3PHEA 4KHUA 3AA8A 1K1QA 2IBOA 4HTIA 2RU3A 2UVUA 4YR3A 1HMVB 4ZVTB 4CJWA 3R5GA 2OD4A 4I56A 5BR8K 2A1RA 1NDKA 4IFYB 1Q81T 1QHTA 3FMBA 3CD0A 4ZPCA 2CNOB 5A8KB 4QIFA 2FJVA 4M42A 4Y3CA 3CCMN 1QUVA 4W5OA 2DNRA 4LUBA 3SMZA 2XRIA 2BEFA 3NGIA 2JC1A 1RYRA 4CWBA 4CH1A 1RT1A 2NQPA 4E19A 2E1CA 3VAIA 2E5LK 3T1HK 1IO2A 4P2FA 3D6FB 4B3RF 2UUWA 1JJ4A 3L2RA 5DG9A 1ZS6A 4DR3K 1FRHA 1KVIA 3ENQA 4BRHA 4EBEA 1DTTA 4JAXA 1JLEA 1Q8KA 2R8HA 4QU7A 1FJGJ 3NL0A 3MN9A 2Z57B 2BA9A 4KREA 2B5JA 3GG4A 5CY4A 2GIRA 3PEJA 4M41A 3M8SA 4ES1A 3TAMB 1BISA 3OYGA 1P1LA 4AL7A 5DM6L 2VA3A 2M70A 4U9RA 4ZVOB 4E7KA 2P9IA 3FDSA 1RBLA 1FVSA 3BF4A 3C7NA 1E6VA 4FOEA 3PW4A 4FO0A 2G8HA 4CGGA 1VHXA 3AD7C 5CZXA 2YKNA 3HVTA 2VCPA 4UQGA 1Y97A 2JFKA 1WAFA 3OHRA 3TPQA 1PC4A 3GFXA 4PPDA 2MZJA 5H9EJ 4YR0A 3MGJA 2XY8A 4LF8F 5GMEA 3J81O 4DX6A 2ZBIA 4M95A 4LFAF 1SVDA 2QYGA 2UUAK 1RHQB 1ATRA 2VV5A 1TL7A 2H4WB 3HHDA 3T3FA 4C8NA 1VQ4N 5LMUK 1BQMA 3A8EA 2E2NA 5A2QU 4TY9A 4L3KA 5SUHA 2D1CA 2AJ2A 3NF8A 3VEVA 2WB4A 2B7BB 3ILLA 3SQ4A 1LEOA 4M5LA 5I3UA 4R5PA 5A76A 1KVCA 4W5TA 1EIYB 1VGYA 2CJBA 3CD7A 2CADA 2OH2A 2YHXA 2D7SA 1GXTA 2DNGA 2MQLA 4MMOA 3LWLA 3QPIA 4OX9K 5IXUA 2KHDA 3QFPA 4ZITA 4GC6A 2O3DA 4BREA 4H5WA 4C2MA 2DISA 3CCJN 2XY6A 1HWLA 4ZLNA 3HBTA 2XO7A 1NMEB 4DLEA 3PXGa 2ZVSA 1R0AB 1N33K 2P5VA 3GPAA 1CLFA 1RE1B 1CXUA 1M5VC 4YHHF 3GG1A 3MX2A 3QNWB 2RHQB 1YGYA 2V7ZA 3DGPA 3FGUA 4TQRA 2QGFB 2YH1A 2NXJA 3JXOA 4GV3A 2BANA 3OTDA 4O44B 2NYHA 2IJNA 3DCAA 1BY9A 3C6AA 4USHA 3EE9A 2GW8A 3FEZA 3QGHA 3O44A 3ATUA 3FFIB 2VQFK 2HB5A 1S6PA 1TK5A 3QWPA 3J81Y 1NGGA 4O0NA 4E7JA 2QMXA 2P9PB 4FVMA 5G4DA 1LWEA 1S1XB 2IRXA 2E1RA 1VQNN 1FTRA 2R7QA 2VB6A 4C48A 1JXEA 3QRQA 2XMJA 5KT6A 4FL9A 1WSRA 3ZCMA 2PFUA 2HFNA 4PXDA 3W2VA 3SZ2A 2FHJA 4DUYK 1IQTA 2NXNA 3NKYA 4XDCA 2NZTA 3NAIA 1G1XA 4BC4A 3OS1A 2ZOGA 3T1AA 3ET6B 2E44A 5B0FA 2EFOA 3CDBA 3BGRA 4DUZK 2RF2B 2ZQBA 1SJ1A 1HWUA 4Q8FA 4GMKA 1WC3A 3MCOA 3K8VA 2R7SA 3MR2A 5K14A 3EWGA 3IN5A 4KHPK 2ZH2A 2WSFC 2P6SA 1Q7YO 4FLUA 5DLGA 3OVAA 1VSIA 3DMJB 3U1NA 1LWCA 3TABA 4Z4GA 3CCVN 2NREA 3BPSP 3DLLL 1K73O 3FCHA 1U49A 4TU8A 3AFGA 4DV6F 1S9EB 1K8KA 2CG4A 1TKXB 1NGIA 4PG5A 1RHRB 1SXLA 2UYTA 5AQXA 1DQ9A 4MO5A 4DR2F 5A2QO 4CLYA 1NJIO 2D3OR 2UZAA 4FWNA 4F67A 2DCUB 1E6YA 3D2EB 1RSCA 4HTLA 4GVLA 1SUQB 4OPHA 5F8IA 4CCHA 1WD6A 3U4LA 3MMCB 3VEZA 1AZSA 3W3DA 5CD4H 1Y10A 4CRJA 3P96A 2CPJA 2WBMA 5D15A 2HW3A 1YK9A 2DFHA 3SAGA 3BJYA 3IO1A 3J7ZO 4HR2A 3D68A 1MN7A 4UF4A 4M8LA 1HBUA 2CNKB 1T95A 3AA4A 4DJBA 1U8WA 3DYAA 3EZWA 3PUFA 4KAZA 4M3XA 4CD3A 2LQ9A 2N82B 3Q89A 3DRSA 1XNQF 2NUHA 2B0GA 4A4JA 3JS9A 1HR0J 3A5LC 4ZCLA 1NU0A 2Z2LA 5G0RA 2FSJA 1K73T 1ZAWA 2LEAA 3N4PA 2HHHJ 1U2FA 3T19A 3P3DA 2ASJA 1TK0A 4OX6A 1RXOB 1S57A 4P71A 4UOHA 5B7WA 3UN2A 4FWPA 2G8UA 4K4XA 4JBCA 3TSUA 4BC7A 3UD4P 1HHTP 1H6KX 4C8LA 2V0NA 1WF2A 4DR4K 4OJ1A 2KJVA 2O8CB 1W97L 3AO5A 3LDLA 4NZ0A 2B9EA 4R25A 3CCMS 2ZUGA 5H1SQ 4BC5A 3QMLA 1YTAA 1QVFR 4L75A 1IKVA 2BE7D 5HVFA 2C3PA 1NUEA 2VC1A 4Q0BB 3UCUP 3WT0A 1RU2A 2JZ5A 1U1PA 1KLNA 2F4VF 1PGZA 3DRRB 3FSIA 4AHRA 1VQLS 4UY8T 1FRIA 4J2BA 3Q8RB 1FXLA 3ZZOA 5K5MA 4J5OA 3JQMA 4M5MA 3VN5A 2HBLA 3DLJA 5KFFA 3GIIA 1FJGF 4DQ8A 3E1YA 4X4VA 2I0XA 3SCKE 1YJNN 4RLEA 2RE1A 3HXMA 3OYDA 3HULA 1JXBA 4A5BA 3ENWA 3O3HA 2P9EA 4FJIA 2XEXA 3OL7A 1SS6A 2R3VA 1RBTA 1SC1B 3CJCA 3NCPA 3N9UC 4AM7A 4Y6IA 3TQ1A 4O4GA 5E3RA 1BC6A 3M8YA 1QVFM 3Q86A 1G15A 4E0DA 3UR0A 1HBNA 3TJ9A 1ZAXA 3A5NC 4ETZA 2KG0A 2XZDB 4CZEA 5GVQA 2IDOA 5RUBA 3RU0A 4ZA1A 5KOXA 1I51B 4MKAA 3M32A 1V4SA 3BEXA 2Y3YA 3QFHA 4Y2CA 3IM8A 2GJ2A 3MAQA 3LDPA 2Q0UA 2ZM6K 3AXMA 3ZLJA 3KG4A 1QM9A 3QETA 4FNHA 4NA2A 2JHEA 2O8DA 4C3KA 2C2OB 1SI9A 4EO6A 2O01C 3QEXA 1VRUA 3KVGA 1TVRA 1VK3A 3O1LA 5BYRA 4U7CA 3OLBA 2YHYA 4ZVPB 4RW6A 2A6MA 1YJWN 3CJ2A 1VQ4S 4LRDA 2KT3A 1GAOA 7AT1B 5EDWA 3PX4A 2V6AA 3VMFB 4G6VB 2CJYB 2MDAA 4M5JA 4M5IA 5T7LA 2ZH6A 2HAIA 1S5JA 2W4DA 4PWDB 5HLFA 5GAGU 4JI2J 3SBGA 1NK8A 4FPIA 4C8OA 3MM7B 3MPUB 3GIMA 4LC9B 1YBTA 2WVEA 1CZAN 5BR8J 1X4HA 3F41A 4Z94A 4V19J 3V4MA 4KIAA 3J80Y 4NCGB 3CJ8A 2XHBA 5EOYA 4JV0A 4F0KA 3O80A 3OA9A 4DV3J 1CJTB 1IBLK 1R27B 3DLGB 4FYYB 2I5JB 3J7Z5 1I3AA 4JNEA 2QW9A 4DCOB 4E3SA 2Y0BB 3AJDA 4F26A 3BZKA 2E5LJ 1YVNA 3T1HJ 3NGYA 1X7VA 1KVJA 3OS0A 2JL9A 4JYAK 1SJ3P 1ZA1B 2A42A 4P9SA 1HJRA 5D77A 1O1WA 4USUA 2W9CB 3ZX3A 4WKRA 1HWKA 1UJ5A 3K58A 5HRPA 4DR3J 5KFTA 3OYHA 4C11B 4CGHA 1FJCA 4I6MA 2UUBK 3T6BA 3MK6A 1RKJA 4C98A 3KZBA 2AHOB 1RDUA 1P8GA 4P6QA 2W24A 3DOLB 1VQNS 2AZ3A 4FCYA 5CA5A 3UVJA 1H2VZ 4KSEB 4LFBF 2HFZA 3KG0A 3UKUA 1D0EA 3KIOA 3UKRB 4C8ZA 2RAQA 3IWXA 1UEVA 1T11A 2DGVA 3QBCA 2NSBA 1L3SA 1KAXA 2RJZA 2HZAA 2YX1A 3R1HA 4WFYA 4YQWA 2W9BA 4J9VA 5CYQA 1URRA 1L5UA 4CHNA 5GAEU 3ONQA 3KLVA 1S10A 3G71N 1WWHA 3IBFB 4K5RA 1WHXA 5FJ4A 1XTZA 2HZVA 1NGAA 3IFEA 3RAXA 1HNXJ 3MM6B 2O8FB 3L8BA 2QN6B 4CO1A 1U1OA 1TZ0A 2PEHA 5HMYA 1NDLA 5I9EB 3CCVS 2FSNA 2HQCA 2GWKA 3THYA 1HI0P 2UUAJ 2KT2A 2P1JA 3IWLA 3L0QA 4AQYK 1KR4A 3TO8A 3NF6A 5KRTA 4KHQA 4QWEA 4JKBA 3KJVA 5LMUJ 3OBWA 3IRXA 2V69A 3J7AP 2XWYA 4OYMA 3OYJA 2HFSA 5IT0A 4XTTA 3ULEB 1X5OA 2RS8A 1HPZA 2FJEB 4A47A 5D3GA 4MK7A 3RW7A 4DBQA 4CJFA 3I9V9 2AW0A 3M6UA 4HT7A 1YG0A 1OH6A 2IM2A 1RCXB 3N79A 5AQNA 1NWKA 5IWAK 3D67A 3VZIA 3OYAA 5LXYA 4OLPA 1IKXB 1DTQA 3MEKA 2PE8A 4ALZA 4OX9J 3DLBA 4B3MK 2ACYA 2HK2A 4X4SA 5L1IA 4RG8A 3BZQA 1O13A 4ZCMA 2IVYA 1BLUA 5D0EA 3I82A 3KLIB 2UXCK 1QSSA 2G0IA 1EQYA 3W3SA 3HVRA 3CJ5A 2EX3A 3W64A 3QJJA 2CQPA 2J6TA 3V6DB 4FM0A 3UNYA 1HR0F 2A3JA 3CD6S 1X9WA 1UWAA 2HSTA 3U1MA 1HKAA 2UU9F 4BBYA 1N5SA 3HT0A 2EK1A 2HGLA 4F25A 2F65A 3CQYA 2VQFJ 1DRZA 1JLFA 3T5JA 3WQTA 1RAEB 1LW2A 5J1EA 4NL5A 3D1HA 3L2QA 2QT7A 2NLWA 4EZ6A 5KG5A 1LOUA 2BDPA 4ZPAA 2M88A 2QXFA 3CJTA 2MXYA 3LAKA 2H51B 5KFPA 1VYAA 2XZWA 5T14A 2WVFA 2MEWA 5FLXU 4DUYJ 3ZXWA 1X9MA 2E1MC 1OKJA 2XG8A 1VQ5N 1P1TA 4EU0A 3N6LA 1VQPN 3OUYA 1F9FA 3DXMA 4DUZJ 1WSHA 3R2CJ 1EX8A 4A62A 1U6ZA 1Q8BA 5AQFA 3LF0A 2JEJA 2LSNA 2L41A 1U45A 2P9IB 4LJMA 3UNGC 5CYJA 3HPOA 3EMTA 2BKNA 3HPGA 2R7WA 3UN5A 3OSPA 3GQCA 4FDFA 2ETJA 2EFGA 2YKNB 2KKHA 5DM6Q 5BYQA 3LPEA 1T6DA 2XWXA 3BGOP 3U02A 2P9LB 3ZSVA 4Q43A 2BJ1A 4L3QA 2Z2YB 4HUEA 1XWLA 2E66A 1YJNS 2X6SA 2VPWB 4CJ4A 4CK1A 2J8SA 1NDCA 1BQNA 1RADB 2QWLA 3CFPA 1N0VC 4NE9C 4CH0S 2HRTA 3EJMA 1FESA 4CVNE 2WC9A 5DQIA 5KFCA 2AV5A 2DGXA 4JKFA 2YHWA 4N56A 3UFCX 1NG9A 2C2ZB 3KHGA 1EKSA 2R8IA 3SUOA 1YITN 1FF2A 2LFVA 1X3NA 4R5PB 1APSA 2CPZA 3FVYA 2V94A 2CJQA 2G8VA 4F4KA 2BACA 4PG8A 1SQEA 2GAHC 1RCOB 3TVYA 3ZTOA 4O3SA 2BKPA 3C66A 2O4IA 2QXLA 3AOCA 3SSSA 1S1VA 1DFDA 2XLIA 2QKBA 3ETMA 1VC6A 1XC9A 4U95A 4LBHA 3NGRA 3D0HE 1UVJA 2UXBK 3OSNA 3CJ0A 1Y3JA 3H2VE 3PEHA 2QLXA 3THXA 4ZLPA 1I39A 2KYXA 2ZEJA 1YJWS 2FVCA 3QZ8A 2P51A 3EO3A 1Z1ZA 3DGPB 5F0UA 4ECRA 4JI2F 3MWBA 1N32K 3NMUA 4E8UA 1R43A 4J90A 5C2GA 4F50A 3TW0A 3RGIA 2VBXA 1NMNA 1U0HA 4BRCA 3NWGA 4MK9A 1K9MT 2QWPA 1LWEB 3VETA 5FLXO 2DITA 4DV3F 4BWJA 2QE5A 3OYIA 1OPZA 5C42B 1N8RO 4FZVA 5KFNA 4LIWA 1FWLA 3HI0A 3KUEA 2YI1A 2IFXA 3MEDA 2E5LF 4TY8B 1CJVA 4K4ZA 5EX0A 2XYPB 1SQKA 1UPPA 5I4MA 5LT5A 1UVIA 5KFQA 3ZEUB 4KFBB 2DR9A 4WXOA 3I33A 3BGRB 3VQ5A 4IO9L 1AB8A 2OKQA 2BQRA 4DR3F 3BQ0A 3SUPA 2XMUA 5A8WA 4GY2B 3OT9A 3MMVA 2PD1A 2DD8S 3EM1A 2A0FB 3CNQP 1WDDA 2JDJA 5F8LA 1NJXA 1LWCB 4DR5F 4F3TA 4OZ3A 3QRPA 4DR1K 4J7CA 4N47A 3A5OC 2DT9A 4ZJLA 3AO3A 2AJ1A 1K8KB 1WUAA 2XY5A 2RN2A 3NOGA 4M5GA 3MR5A 2FJDB 2MPUA 4KHMA 3K2PA 5L1KA 3IBCB 1N5YA 3NMRA 1Y7PA 3W61A 1K0VA 3GYGA 4U8VA 1H2TZ 3M30A 4LF2A 3MR7A 3PRVA 3DLLQ 5E3CA 2K1RA 3CJQA 4ECWA 4B3TF 3P5JA 1RWOB 4BRAA 1J6ZA 1E6YB 2NRHA 4DU3A 1TV6B 2BV3A 4ANDA 1NXIA 2XLJA 2RIJA 1HI1A 3G71S 2KQ2A 3QSYB 1HNXF 2MQQA 4WPAA 3VALA 4H54A 2HHQA 4DPUA 1LWFA 5HATA 1RHJB 2HS0A 3O3GA 1E3MA 4F9OA 2GZOA 4C0OC 5FLXY 4I0WA 2G9OA 2ZM6J 1TELA 1RTIA 2OPPB 4NA1A 2VOOA 1S6QB 4E89A 3BBBA 3BGUA 2P6TA 4LSNB 1ZOTA 3IGVA 1PYSB 4E98A 1EETB 2HLTA 5F8JA 4LF6K 4USKA 1YQHA 1G6BA 1QAXA 4TLQA 3L2VA 2CH6A 3X3UA 3R8YA 2RRAA 3E01A 5B08A 2CQGA 1HI8A 2DNYA 4F3QA 4DL3A 2R8GA 2XMAA 4AL6A 4CF2A 2M8DB 4OX9F 4O3QA 4J9LA 1IN0A 4CJ5A 3AA3A 2OPQB 4IYQA 2R7OA 1CVJA 2W7PA 1UKUA 5J2MB 1WC5A 4JI6F 3VAKA 4P52A 3NEKA 2YNIA 4YOXA 3LW5C 2MHEA 2V8GA 3PIOL 3LM2A 4OI1A 3R9PA 3CCRN 1IBLJ 3TARA 1YIJN 1VK8A 1HNVB 1SL1A 3BO3A 4Z0UA 3DC2A 2RRNA 4HCBA 3MDQA 4H5RA 3NCRA 3NHGA 1NLVA 3A8JA 4CLZA 3ETOA 3FE1A 2E6MA 2IDLA 3RB6A 3EY1A 1V3RA 4JYAJ 4J9QA 5F3TA 3Q23A 1QY7A 3EDRB 4BGAA 1J53A 4FZZA 1Y5NB 4PR6A 5HVGA 1S0NA 4ES3A 4R0JA 1SPBP 2QA4S 4ECQA 2IIHA 1WC0A 4DN0A 4LREA 2UUBJ 4OMFG 4M63C 1RWXB 1GLEG 1B9DA 3QFUA 4X62F 4F0MA 1BMQB 3UN3A 3SQGA 3CCSN 1NPPA 1GX6A 4OJHA 4OKJA 4EP4A 5JICA 3M2VA 2W9AA 5KFWA 2DH9A 3PCOB 4HDGA 3GWCA 1KBRA 3M4XA 1ZM9A 1XR6A 1RGVA 1SC6A 1JNZB 1VQPS 3HP6A 4PG4A 1HARA 3V1RA 3C6HA 3FR0A 2B6AA 3K17A 3BN7A 1SCJB 1UPMB 1VQSA 2AWZA 4RWTA 4NZ7A 2W8KA 1OSCA 4ILLA 3MM5B 2HVEA 3R5CA 4NRUA 1K1SA 5M2PA 1Q4RA 3N01A 2DNKA 3CTRA 5K8NA 4LVNP 4EIAA 1HX1A 2EBEA 3CM5A 3R8EA 1M1HA 3VWSA 4X65K 1DQAA 4K42A 4EYHB 3ZTSA 4AQYJ 1RDRA 2HHTA 2JJ4D 3MM9A 3IR5B 4A2BA 1YBUA 4NOHA 4MIAA 2ZBCA 4QR1A 5HP1A 3OL8A 3DLKB 1B70B 5TKYA 4EK2A 2L9NA 2FY1A 1QSLA 2PDAA 2ZJQQ 1RT7B 5FROA 1VRUB 4ID1A 1TVRB 3I55N 3DXKA 3RZAA 1QQOA 3ZFVA 3MECA 3E9LA 3CCWA 3SCLE 4DV5F 4CZCA 3R6LB 5IM0B 3GR0A 5IWAJ 3QICA 4DX5A 4FLXA 1PILA 3M6GA 3ZNJ1 5T7LB 2JSXA 2OCEA 3VAMA 1Q86O 4YOVA 4CBWA 4CJEA 5KT7A 4UW2A 3ILOA 3QFWA 1R8PA 1RDCA 4U67L 3EPGA 4C8KA 3FBBA 4J91A 4FYVB 2GNKA 2HKEA 3ADAC 4M7YA 3WXIA 3QATA 5A8RA 5J2QA 2G0JA 5KTQA 2UXCJ 3J7YU 1PG5B 1NGBA 5M2RA 1T05A 2A18A 2ZH3A 1I94K 3D1QA 2JEGA 1JQGA 2MMYA 1IM6A 5HMZA 2B8PA 2WTFA 2O66A 1T03B 3UQSA 1R3NA 1XERA 4TYBA 2NS1B 3CPEA 1H74A 5KFBA 3S9HA 1OYDA 4W5NA 5LMNF 2N4CA 2HBRB 2ZBPA 1YZ6A 1X31C 3ENBA 3I96A 4UOGA 2FIUA 2GS8A 4MQ3A 1OY8A 2O4GA 2CNLB 4UOCA 4RX6A 5HSPA 4L74A 3LP0A 3P31A 4IJNA 2KHCA 2AYBA 2AGPA 3WEEB 3CDEA 4QYRA 3O4NA 1N34F 4KH6A 1S1UB 2IMOA 5AXLA 4I6MB 4ISFA 5HMXA 2DHAA 3GP9A 1LNQA 4BR5A 1JXLA 5CXTA 4BRQA 3ZZUA 1UJ4A 4H0TB 3P8BB 3DU5A 4IH7A 2Z4PA 4ZCKA 4PA1A 2LECA 2KM8B 3KHHA 4A2AA 4OGEA 2LKZA 1K8AO 2E2OA 1NEEA 5TKWA 4CEAA 3UD5A 1UETA 2HIQA 4V19S 5JMNA 4ER8A 1RWWB 4F4WA 5J1PA 3DLEA 1KRPA 1R6VA 2CA9A 4NPOA 4DR6K 3GILA 2YJEA 1XR5A 4R79A 5SWMA 1KLMB 1KSPA 2AJ4A 1TL3A 4GW6A 4QS7A 1S5ZA 4M3WA 2CRLA 3EYZA 4B9QA 1U0SA 1U2VB 3JSMB 1X9SA 4CLTA 1XMQF 5KFKA 3EGNA 3VQAA 4CZLA 2JVRA 3HF5A 2JWNA 4NXNK 1JLCB 4B3SK 1L3TA 4JI3F 5BREA 4IOBA 4WP8A 2XMKA 2B56A 3D2WA 4OZLA 3AARA 1IG9A 4AHTA 3KKRA 3A1YG 1HYZA 5AJ3K 5LSOA 4YOEA 5AE2A 2HIYA 1DEJA 2FJXA 3T5HA 2RD5C 2HMIA 3JQJA 3ISND 3FFKB 3FEYB 4YDUC 4AM6A 1KNZA 1HA1A 2CJXB 2DHGA 3CJBA 3P6YC 5JMVA 1DTQB 3FNNA 4KJIA 4CZGA 2MKJA 3TA0A 3RAQA 3WXJA 5MLCV 3BSCA 2X78A 3WNHA 1NB2A 4NMXA 2QYCA 2OFGX 2UXBJ 3V5RA 4DR7F 2W4PA 1DGKN 3BZCA 1EQ0A 3UI3A 3O6WA 4JRQA 5KG0A 3IS9B 2R8JA 3DI6A 1DBDA 2R8KA 2Y8WA 2KKZA 2GFFA 2E20A 3AHPA 2E6LA 5CQGA 2HBKA 5AZJA 4CHPA 4Q2MA 3P5TL 1FO1A 5CH7B 3ELHA 2ZBQA 2HQDA 3CW2C 1KQGB 2Z1IA 5J1EB 3S3NA 1OY9A 2KFYA 2HVHA 3UO0A 3MWPA 1SJFA 1IBLF 4FWKA 4DMNA 1IKYA 3ZSWA 3RBDA 4C0HA 3Q8UA 3B6BA 3ITHB 3HZGA 2ZUAA 3VEWA 3IGNA 2V2QA 1Q5YA 1F21A 1DJ0A 3CCRS 3KKSA 1RZMA 5B0BA 3FEXB 3H90A 1YIJS 2A6OA 1U48A 3Q83A 3WNGA 3P83D 2FLOA 3MUMP 1RUSA 3J81j 3TA2A 4DTJA 1C4CA 2RILA 1EWQA 5L8RC 4CZIA 6FD1A 2ZH9A 3H42A 1Q8IA 2GMLA 1RT5B 3U8XA 2HHVA 2HBYB 1TK8A 1KOHA 2BM0A 2MQMA 4ES2A 4B3RK 2WOMA 1RAHB 4DR1J 4J9UE 3SJHA 3QIPB 3G8QA 1NH8A 3CCQN 4PPZA 4DL2A 5K8MA 4QR2A 3VA0A 1Q16B 2YNHA 5AQIA 1OH8A 3CCSS 1S0OA 2ZFHA 3GE9A 1U6BA 4MLHA 2CQDA 1N54B 3CXCR 3TP2A 3NNCA 4X2BA 2DNOA 1WSFA 1BQNB 2YJFA 5CYMA 1RBOB 3LALA 3KJNB 4BC2A 1S1TB 3EPIA 1PYOB 1N6QB 3AQPA 4X84A 2HSEB 4DQSA 4PG7A 8RUCA 5DQHA 1A5WA 3WHIA 5HJYA 1H1VA 3QNNA 4DEZA 2E88A 2P9KA 1ITPA 3IDHA 4FXVA 4LF8K 3HSJA 3GL1A 1TKTA 2ROPA 4J9KA 3OXFA 4LFAK 4B1YB 2YH0A 2DNHA 4LF6J 1F5BA 2F8EX 1B0TA 4M5KA 2GGPB 1P9YA 3MEGB 1T9YA 1W26A 5E2QA 3QBWA 3NGTA 2HK3A 5CCMA 3SI6A 2COLA 5AQHA 1QUPA 3MCNA 4I67A 3LGMA 2Z0GA 3CXCM 4KT0C 3G4SN 4CF8A 3B4DA 2PN6A 3W65A 1LW0A 3TZWA 3G8SA 3NS6A 4PXEA 1NGJA 4DTUA 3BBFA 4O0JA 2NPFA 4DTXA 2VBWA 4CLUA 4ZPWR 2CGJA 2VODA 1K47A 3A2FA 4BRIA 1P6TA 3N5FA 2Q66A 5JVHL 1YBAA 7FD1A 3EE8A 2WSEC 1RT2B 3NS5A 3C95A 4WTYA 3THVA 2UXCF 3I4HX 3O3FA 2RDJA 1XEZA 1RHUB 2OPRB 4MIBA 3OBYA 2G1HA 1PBUA 4ICLA 4ZLJA 3C94A 3AJ2A 1BL3A 2GHPA 4BE2A 4LSLA 4WWSA 4ED7A 1WSIA 3V2UC 4IR9A 4DSJA 4IOXA 4ILHA 4DFKA 1IR0A 2GV9A 4YHHK 1KN6A 1V3SA 1CJVB 5ETRA 5BPLA 2OP5A 4IDKB 4NLTA 1DURA 1TP7A 5LSRA 3D2FA 4WIIA 2B7CB 1IKWB 4F36A 5IV3A 2VD3A 2RQ4A 5HRRA 4CLWA 3NLCA 4ZHRA 3OY9A 4NCBA 4OYOA 2XY7A 3MMAB 3GJTB 4CF0A 4LF5J 2KYZA 3RUBL 1Y5IB 3M6VA 3E66A 2FJAB 3GYXB 4BWMA 4JD2A 4LR8A 2YNGB 1VIOA 4CEEA 2Y0SD 4IO9Q 1REGX 3CQXA 3GOIA 2HFVA 2Q2RA 5F9LA 2ZD1A 3TJAA 2AGOA 4DTRA 2QLWA 2PC6A 1KC8T 4LFCJ 1HBMA 3A3OB 1KEKA 1CJUA 4CDIA 4CIOA 4FWMA 1EP4A 3KK1B 3EE3A 1J54A 3TAQA 4OGCA 4F3MA 3QESA 4E1NA 5D0GA 3GR1A 3H3OB 4AHUA 2YKMA 3NY0A 1F2GA 3CIZA 2ZZNA 3I6PA 4XIUA 3FZLA 1MWMA 1T3OA 4IRCA 4M5DA 3CJKB 1TL5A 3BSOA 1X8DA 2ASYA 2ALYB 3TUIC 3AVMA 3DXSX 4X65J 4YR2A 2XHWA 4NLBA 2DY4A 3R7NB 2KZMA 4FNIA 3BSAA 5AQZA 4NZ6A 3K9JA 4DV6K 1WF1A 1RA6A 1S7IA 4JUZA 3L6QA 3I5CA 1RDWX 4Q7AA 3DGVA 2P5OA 1IJEB 4DR2K 2N3LA 2AGQA 2ASLA 2QA1A 3L3UA 4DG1A 4P10A 3CVKA 2C2EA 2AEMA 4WFZA 2ASDA 1SC4B 3E01B 1XQIA 2V63A 2MKCA 5DJBA 1BI4B 1SKSA 5JS1A 4PQUA 3R1LA 5L39A 2JOQA 1T7PA 4O4RA 1LKZA 3NF9A 1M1KO 1BCOA 2WUSA 4RNMA 1BE4A 1NO8A 2LP4A 1RQ0A 4ECSA 3F5TA 1B99A 2YNIB 3DN9A 3G96A 1I94J 3ZZZA 1HHQA 3K5LA 4RBUA 4X4NA 3VGMA 1ZTWA 1VFJA 3GCWP 1SL0A 1GXUA 3ZSRA 4LF4F 2VG7A 3QIDA 5DZ7A 2W2QP 5KPTA 2ZGZA 1OWXA 5LL6d 2QKKA 3PIOQ 2P9NA 3VQBA 1RDDA 3WZ0A 1LXJA 5HRSA 5GADI 3T1YF 1NH7A 5AXMA 4CGDA 1VS3A 2CQBA 4DDFA 2W2NP 3CG7A 2DKOB 4Y1DA 2FTRA 4DV0F 2YWGA 4DN9A 4CE9A 4AUKA 2W1BA 1WOSA 5KFOA 1NSKL 1HWJA 4IRKA 5B0GA 3KLGA 2JFDA 1HWIA 1Q78A 4B9VA 3JAMU 5JS2A 1C4AA 5KAKA 4BRKA 3GTYX 3QWUA 3ZTPA 3M2VB 3E2EA 2J0SD 1U1RA 3IM9A 1Y00A 4BHQA 3NGKA 5LJ5Y 5DDQC 4A61A 3IG1A 1R8CA 4Z7YA 2MQOA 3K7RA 4CQ1A 4DTPA 1NSQA 1HYVA 4CW7B 2J9CA 2P8IA 2MZQA 2FZGB 3LZJA 4DCJB 2F4VK 1YVFA 2B6AB 3HI9A 2E1AA 3RVCA 1X5SA 1NZAA 5ETLA 4DR6J 4CF9A 2BYCA 3KLFA 2E2PA 4Z4CA 2E29A 2MHNA 3SCIE 3CCUN 1ATNA 2OELA 3F73A 2IVMA 3L95X 1E4GT 2AKWB 2CXEA 3DJCA 5U47A 5HQLA 2ZOMA 2X74A 1FJGK 3LDOA 1BG3A 1R59O 3CCQS 4NXNJ 5KFZA 1HQUA 4N7TA 4B3SJ 3P38A 5A6PA 3VAJA 1ESVA 3SQ1A 2KXFA 3LZIA 2C22A 1SQFA 4X4UA 4CEZA 4DQQA 1A5VA 2MKKA 3ISNC 3SFGA 2IVPA 2JLFA 3VF6A 3CC7N 3CFOA 2VPYB 5AJ3J 2IVNA 2HG4A 3D28A 4FJJA 1H7XA 4HI1A 4FWLA 3L3VA 4RW7A 3TJ8A 2WB1D 2I6WA 2O8EA 3DXKB 4ID5A 5ETPA 1EZZB 1C1CA 4CNZA 4NCAA 3QMQA 1YUWA 2FY8A 2V51B 1M5KC 3CJ1A 2BOPA 5H9EK 4LF1A 2Z1GA 4AF1A 3KNAA 2Q43A 2LCWA 4IJAA 4PEOA 3UCGA 1XNRF 3Q2TC 3OHAA 1OIAA 2Y1LB 4DLGA 1IR2A 1PC5A 5A8RB 5J2QB 4QWDA 1XIQA 4CHQA 2WCXA 3M2UA 5B0EA 2NRZA 4DL6A 4CJKA 2NRWA 1T05B 4A8SA 1SIWB 5A0YB 4OV6A 1HUXA 2LQBA 1U1NA 4U67Q 2GQ2A 1B0PA 4JKAA 1T3VA 1H72C 4KPYA 2QIFA 3T9NA 2F8SA 5DM7L 5C2FA 1WSVA 3G4SS 5KFUA 4DPTA 3OBIA 3W8PA 4CM0A 3PYEA 2LU1A 1BCMA 2BUPA 1P90A 3GV7B 1KAYA 4NLSA 4MK8A 4Y2KA 5FPNA 3HSDA 1HD0A 4LRBA 3W5YA 1TQLA 2FUG9 4NLWA 4O23A 2B9YA 1VQ7N 4FSVA 5HJXA 1Y3KA 3LP0B 4FYWB 4QZVB 3C15B 4X66F 1HNIA 5EHHA 3RRHA 2GVDA 5CAAA 1H98A 1VQ9N 3KLHB 1RP5A 2EEYA 3O8MA 4QS9A 3IAM9 2PFDA 4O3NA 2HQFA 1S4EA 1RA7A 3CEDA 4H4OB 2LDIA 2J6UA 2Y9HA 4HTUA 1RWKB 5FPEA 2FZCB 4BQZA 3N6NA 1IV0A 2ASPA 2E1ZA 1JMTA 1ZM3A 4M7XA 4JI8F 3O9TA 4QQBA 9ATCB 2QWNA 1GLAG 4O5BA 2G8IA 2OJ3A 2VGNA 5JVGL 4LF5F 1JLAA 2HQ3A 2CUYA 3M6XA 4ED5A 4IO8A 3EUNA 2HGNA 2D0CA 4W5QA 2C28A 3W2WB 3S41A 4AYBD 3EZOA 3TA1A 2A41A 2ZDOA 2HHPA 4CERA 2O8BA 4XPCA 3NFAA 4LF7F 4FM2A 1UFLA 5D0RA 5HN0A 1IBCB 5KRSA 3W9IA 4MAKA 4LFBK 2DGWA 3GU0A 4LF9F 1AYEA 4LFCF 1M90O 3B4MA 1KQFB 3FSXA 2W6LA 4Q45A 1RCHA 3I0SA 3PW2A 4BE0A 3OVNA 2V4JA 4RUHA 3DOMB 3OR1B 3QEVA 4K4YA 3TAEA 2KLAA 1TU0B 4DSEA 1OY6A 3HOSA 2XNQA 5ADXA 3KKFA 3MXIA 4NEZA 4DHYA 3CFRA 1UVLA 5E84A 2DGUA 1RDAA 2BBEA 5ETTA 3KLEA 4RTFD 5E33A 3KK3A 2IA0A 1G99A 3JAMY 1WKJA 4PL8A 3VESA 3CD5A 3MAAB 1U25A 2FLPA 4TN2A 1AFJA 1WEXA 4MFBB 1OS5A 1S6UA 4FJMA 3M9NB 2BXJA 3AD8C 1HLUA 2Q6BA 5CHCB 4DU8A 1GT8A 4FW1A 1RTJA 4OJGA 4GMJB 3PACA 4OV1A 4KR0B 5LJWA 4UT4A 5DDRC 4CHYA 1Y4ZB 1IG8A 4CO3A 1EX4A 2XLKA 1OPIA 5KFSA 4PUOA 5AZJB 3BPDA 4FF4A 4OPJA 1H2UX 3K5MA 2C3YA 3U3GA 4KHRA 3DRPB 4OQJA 1M90T 1BIZA 2GA7A 4B02A 2A2CA 3CHWA 4CEBA 1IKYB 1RAAB 1SC3B 1S76D 1URNA 4NRTA 4IO1A 2FVRA 4TNOA 4O5FA 5F8HA 3H25A 3J8AA 5ELZA 5F8MA 3KK2B 4QIEA 4OI4A 4H4MA 2ACMA 2HNZA 2GIQA 5KFXA 4P73A 2MSTA 2WBNA 3OFGA 3MD1A 4I2QA 1Y64A 4B8AB 1BOTO 2FHMA 2LMIA 4EFAC 2UU9K 3RR7A 4B9SA 3BV8A 5C0YA 3MM8B 3QNOA 1Z2LA 3OV7A 4MLEA 4CGIA 2V50A 2CQHA 3NGDA 2CQ1A 3VF2A 1N36F 2GO8A 4RW9A 2NNWA 2MYFA 2AJ0A 1T0TV 2PFFB 2FB0A 2QA2A 3OFFA 3FRYA 3NGZA 4NLUA 2FF6A 4L6V3 5AFUA 2EXUA 1WSGA 2QFJA 1VQ6N 2OD6A 1VQKN 5DG7A 4RNFA 3ENHA 2VBZA 3OJSA 2DBBA 1VSMA 5CZ2A 5ETOA 3BKFA 3ZX2A 4C7QA 5I42A 5LY3A 5HMWA 4DR6F 1NPKA 1RBSA 5B0CA 4CO5A 2AYEA 2AYGA 2IM0A 4KH0B 4I2PA 4D3HA 4KH5A 2GBZA 5E26A 4O0IA 1DLOB 1TYQB 4TQSA 1UA1A 3SLCA 1ZETA 2OZSA 1FX2A 1C0FA 2VG6A 2FGCA 1UAWA 1U6FA 4LR9A 4RR5A 1JL1A 1W9HA 4PHTX 1T9UA 5FD1A 1LWXA 3UR3C 4DV6J 2VF3A 4NXNF 3CCUS 2HNDA 3F0NA 3MHYA 2VFRA 5DGBA 3SCXA 2C2RA 5HAOA 4ZK7M 2IDEA 3M1VA 1Q53A 1FHTA 1FWPA 3CCZA 5AQYA 4DR2J 3OFEA 1C0UA 4G9ZA 3DOKB 3KD1E 3Q22A 1TKZA 2EC2A 1PSDA 3JYTA 1R8BA 3OTCA 3CC7S 4EBDA 2OLWA 1YTYA 2BGGA 1WOOA 1ZBIA 1A7GE 4OHZA 2OEJA 2VIHA 4L72B 5LJ3Y 2FVSA 1WLJA 2CH5A 3CERA 1UEUA 3C19A 2QM1A 4CIEA 3CQ8A 3V9WA 4B8CA 3H6EA 4BRFA 3R5DA 3QZ7A 3E3XA 2O5DA 4U8YA 3UE2A 1OVQA 2MZRA 4OLOA 5M2UA 3GIRA 2ZE2A 2MKIA 2FSKA 4IQXA 5K8PA 5L46A 4URQU 2NRXA 3CC2N 3DXBA 2EWHA 1WAJA 1BA0A 4F4XA 2XI3A 3F9KA 3CDWA 1HPMA 4ED6A 4AILC 4ICLB 4LRCA 2QC3A 3MMBA 1CZBA 1K0TA 4EAHD 2QMWA 2ZBRA 5JVHQ 3M9MB 2XS7A 3DLRA 1RLDA 1AUDA 3WDOA 2J76E 2YKOA 2V9WA 1VDHA 3FUYA 4RNOA 3NG8A 1D8ZA 2VHGA 4JI2K 1GH8A 4IWVA 3QQCD 2FBTA 2CNNB 2DXDA 2F8HA 3A5MC 2ZVIA 1RDBA 3VGKA 4ZHRB 4K8ZA 2OMLA 2V8PA 5B0AA 2YHAA 2K2PA 3R6MA 3U9DA 3MPYA 3VQ9A 3FCVA 5KGXA 3P4IA 4U6PA 3QYYA 4E1JA 1OH5A 2HVDA 3JXUA 5F0WA 4A8YA 2W25A 4K0KF 4JD2B 3NF7A 2XCAA 4DV3K 3K5NA 1VQ9S 3QINA 2DK2A 1HYSA 3CI5A 2ZH7A 2OO4A 2RH3A 1BU6O 1HBOA 2G1DA 1T9XA 3TRGA 4ED4A 1ZBSA 5HI7A 3C16A 2ZH8A 2JLGA 3VQDA 1CJUB 4IOCL 2F4VJ 1EP4B 3NAEA 4RUAA 4UQTA 2H5EA 1CJKB 4RWWA 4Z4HA 5ADZA 1WKKA 3AVNA 5ADXH 2YKMB 3WC2A 3H45C 3I0RA 3WC0A 1O5JA 4I6AA 2IVOA 2ZJRL 1UL3A 2MKYA 1GLDG 1PIEA 4DR5K 2EW9A 4DOZA 4FF1A 3M8PA 2PI4A 3IAYA 1U2RA 4ZPDA 4JK8A 2EKYA 3R7BB 3AODA 2EC0A 1RTHB 1XR7A 5GAGI 4FP9A 3PW5A 2CKWA 1X5PA 2DPNA 4CI6A 3BKUA 4BACA 2PMWA 4B3TK 1ULRA 2DNPA 4DG1B 4CGJA 1WDTA 1UTAA 5DETA 2FYXA 1SH3A 3V4IA 1ZBLA 2DO0A 4DV7J 5KFYA 3J7YP 3W63A 1HNXK 1RWUA 3AO2A 4NLXA 3R7SB 5FPDA 2MZSA 3C6UA 2MZTA 1S22A 5CZ1A 3C14B 4CJ3A 2B4VA 5C24A 4M3YA 4JOUA 3D4JA 2OA8A 1S97A 2OZMA 4DPYA 1EHWA 4KAIA 2LLZA 2BM1A 5T41A 2HGMA 4X4TA 4JI0K 2P9SB 2ATLA 4Y65A 2BJDA 1TFYA 2W42A 1S9GB 4W4MA 4DHVA 2RUSA 3QGIA 4E7IA 5DZ6A 2XTJP 2CQ4A 5KPRA 2VG7B 4CZHA 1WG5A 2YKPA 3OYLA 4PAAA 3UDLA 5KT3A 5AQSA 2P9NB 4HUFA 2F3JA 1FJ7A 3H1QA 5ETSA 5EX5A 1YJTA 2KRBA 2DR6A 3QT5A