1RT7A

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
536
structure length
535
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
total genus 139
structure length 535
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt7A05
1RYSA 4CEBA 1RT3A 3AVNA 3VQ9A 3SQ2A 3Q8SB 2IM2A 3DLHA 4JS5A 5KT7A 3OYNA 4WYLA 2KW4A 4OLAA 4TN2A 2W9CA 4KSEB 4EBCA 5DLGA 3AV9A 3OS2A 1DTQB 4W5OA 3GV5B 2IA6A 1I39A 3RB0A 3OHAA 3PW0A 3L3UA 1B9FA 3C95A 3I5AA 3O3GA 3QGGA 4FZYA 3NGDA 3H2LA 3VQ8A 4CEQA 2FBXA 4NLUA 4HTUA 3HJFA 3DOKA 4B9MA 4FLZA 1BGXT 1S1VB 3KK1B 1ZBIA 1BCOA 4ICLB 2XI2A 4FZZA 1REVB 4LY7A 1RT5A 1LV5A 2B5JA 2HNZA 3D45A 3LP0B 1UAXA 3AVJA 3SV3A 1SV5B 3H40A 1WNSA 2OPPB 4ECZA 3BSNA 5F8HA 4C8LA 4KBIA 2IBKA 1S6QA 5KG3A 3DLKA 2D41A 2QKBA 3L3VA 4MK9A 1HNIB 1OS5A 3C6TB 5KFZA 1RILA 1FKPA 3VQBA 3MEEA 4B3OB 3QO9B 1TKZA 2AX1A 4QWEA 3DYAA 4KPYA 3BSAA 4KFBB 1GOAA 4CJRA 2ZKUA 3G86A 1VRUB 4J9RA 3MTKA 2E4LA 3M8PB 3TANA 4U7CA 2BANA 3QGHA 2CJQA 4OL8A 1TAQA 4F50A 1S0MA 3KKSA 4FW2A 4FXDA 1LW2B 4M45A 1U49A 4TYBA 4FS2A 4RG8A 3G6XA 4W5TA 4DG1B 3FQLA 5KG1A 5DGBA 1S9GA 4XO0A 3NMAA 4EYIB 1LAWA 4M3TA 1DTQA 1TKXB 3G6VA 2V0NA 1BL3A 4UQGA 1SL1A 1VSLA 3EPGA 3K5LA 3KD5E 3OYMA 2W8LA 3I8DA 3HPGA 1D0EA 4IFYB 2IMWP 2XCPA 1QSLA 4KAIA 1S9FA 4FLTA 4YMEA 3KK1A 4TSXA 4ICLA 2R2RA 2VG5B 2DTUA 3LP0A 5CYQB 4O3QA 4FJJA 2XGPA 2OPPA 3GYNA 1UA0A 3I0SA 2JEGA 3HXMA 1GX5A 4B9TA 1D5AA 2FC0A 4CJWA 3NBPB 3OHBA 1CLQA 3VQ5A 3S3NA 1L3TA 4MH8A 4E7JA 3PHEA 2VA2A 1A5WA 3U3YA 1HNIA 1HYVA 4LH5A 4ECQA 5CY4A 3C6TA 2UVUA 4Z4HA 2Q3SA 2OZSA 4OPJA 5KFMA 4CECA 4NLDA 3PO4A 3RB4A 4B3OA 3CDWA 4HVJA 4DU1A 1S1UB 1N56A 3QO9A 3MFHA 5J2MA 3TAMA 1NK5A 2F8TA 3O4QA 1VRUA 3M8PA 5DG8A 2C28A 1RBVA 3KK3B 1S6PB 4B9SA 3GV7B 5DLFA 1S49A 4O3PA 4LSNB 2J6SA 3H5UA 2XC9A 3V9WA 3LP2A 1HQUB 3LAMA 2YHAA 2FVCA 1A5VA 1HYSB 1C0TA 3T3FA 3V6KA 2ITGA 1TKXA 3KLIB 4FBUA 1EKEA 3QEIA 3RB6A 3VQ7A 1SH3A 4W5NA 2R2SA 1RDCA 3M9MB 4CF2A 1TVRB 4IFYA 4OGEA 4GW6A 4BDYA 4NLQA 4YQWA 1D9FA 5C5JA 4RW7B 2ILYA 3RMBA 3NH1A 4E7HA 1XR7A 4MFBA 3L2VA 2VG5A 5L1KA 2KZMA 3QERA 5CYQA 1S0OA 3D5MA 4J2AA 2D0AA 3AVHA 3OL6A 4K50A 4OVLA 4HCBA 3SUQA 5HROA 4ZMMA 2AGQA 3NBPA 3LPTA 1DLOA 3D28A 1S1XB 3OYEA 4I7FB 4FJIA 4WFZA 1ZETA 1IM4A 4O44B 1FK9B 3S9HA 5KFGA 2P5OA 2E6MA 3VN5A 2R8HA 2HHQA 4ED1A 2J6UA 4CIFA 4CJUA 1RT1A 2RKIB 4GMJB 3PW2A 3PUFA 2LSNA 3NH0A 1XHZA 4DFPA 4LSLB 3CG7A 4ZP8A 1S6PA 3DOLB 2G8WA 3ZT3A 3CJ2A 3Q8QB 1IKVB 4LSNA 1JLBB 3MECB 5EWGA 3RRHA 2YV0X 2P1JA 1HQUA 4DS4A 4DTJA 5KFYA 1HYSA 4K8ZA 1JLAB 3HKWA 3S3MA 3E51A 2IAJB 4J9QA 3V1OA 4CGGA 3KLIA 4FJNA 4K4YA 3PW7A 2DPJA 1IKYB 3LWMA 3PJWA 3LALA 3I5CA 1JXEA 3L2QA 1U04A 3C94A 1TVRA 1D1UA 4H8KA 3H5SA 4MK8A 2W9AA 3DLBA 1HMVB 3TARA 1RBRA 1SUQB 1BIUA 4EO6A 4RW7A 2DY4A 5HP1B 3GIIA 1F21A 2C2RA 2V9WA 2VA3A 3OVNA 4CEZA 3T5HA 3QEWA 3KK2B 5J2QB 4GVMA 4KO0B 1N6QB 3WNEA 3HVAA 1WAFA 3H5XA 4CHPA 2DFHA 3AA4A 4DU3A 1C0UA 4RW6A 1WAJA 1I6JA 1JL1A 1NNDA 3LZJA 1J54A 1ZBHA 2Y1IA 4NLPA 4O0IA 1Q9XA 4TQSA 4CHYA 1FK9A 3HVTB 3DLRA 1S9EB 1HPZB 4AHUA 1ASWA 2ILZA 3AO5A 5F9NA 4CJFA 4IR1A 3FFIB 4RW8B 2JEFA 5CZ1A 5EWFA 2RKIA 5HLFA 4ZPDA 4CCHA 3V4IB 1TL1B 5D3GB 4JUZA 3CJ4A 4FCYA 3RMCA 4DTXA 2YKNA 4N47A 3QIOA 4LSLA 4WXWA 1LWFB 4G3IA 1T8EA 2HHUA 3HM9A 2G8HA 2G8VA 5C24B 1IKVA 4ED2A 3DRSB 4IG3B 2CKWA 3GIKA 1X9MA 3OJSA 3MEGB 3MECA 1RBSA 1DTTB 1K6YA 4FLVA 5FROA 3CFPA 2AX0A 5KFPA 1C0MA 4O4GB 4DTPA 1XC9A 2IAJA 4KHWA 4IKFA 3DDKA 3V6DB 5KFUA 1CSJA 1IKYA 4AHRA 2XHBA 1NOYA 1RDAA 5J2NB 1N48A 1J9AA 2A1RA 1JLCB 2X6NA 1HMVA 3LP1B 3PW5A 1SUQA 1VSIA 3P1GA 3PY8A 3SFUA 1VK0A 4EBEA 2JGUA 2ZD1A 4FS1A 5KRSA 3KK2A 5J2QA 2Z1IA 5HRRA 3CJ3A 4K4UA 1RT3B 4KO0A 1NK7A 2R2TA 1KRPA 4ECVA 4DTRA 2ZQBA 3K58A 2HNDB 3PW4A 2Z1JA 3VQAA 4F3OA 1FKOA 4CEOA 1S9EA 3RAXA 2J6TA 4KKOA 2YNHB 4BWMA 4NCBA 2BQRA 4KI6A 3CFOA 4CFBA 1X9WA 3AO1A 1RBUA 2VG6B 4YFUA 4KTWA 5F8GA 1TK0A 1TL1A 5D3GA 4DQQA 3BREA 3OY9A 2B5JB 5KFXA 5DK5A 4IG0B 3T5JA 3OYBA 3OS0A 1LWFA 5SWMA 3VQSA 4RNHA 4KTQA 1S6QB 5DQIA 1NKEA 5C24A 3DLKB 4IG3A 4M95A 3MXIA 4ECWA 4BWJA 4CJ5A 4CHZA 3MEGA 1DTTA 4FK0A 5KT5A 3DLGB 4Z4EA 4ED0A 4B9UA 2D5RA 4DWIA 3K5MA 1Q9YA 1JL2A 3PZPA 3MXMA 4O4GA 2BRKA 3E01B 1U09A 1VRTB 5T14A 4TYAA 4KREA 2IDOA 3OSPA 3MEEB 1NK0A 5KFJA 3ZT0A 4Y2AA 4CGHA 1T7PA 2PY5A 1KVAA 2IJNA 3TR8A 1NHUA 2GC8A 1QAIA 4RZRA 5J2NA 4DU4A 5KFLA 2BANB 3Q8PB 4DL7A 1KFSA 3LP1A 3ULDA 1KTQA 4E19A 1VSFA 5JS2A 2HHTA 1YTUA 1LAVA 3PX4A 4JRQA 4ECRA 4CERA 3RBEA 4J9NA 4Y2CA 4DTOA 4CGJA 3G10A 1KLNA 3ZT4A 4FM0A 4RNNA 2KQ2A 2XI3A 4O3RA 1S9GB 3SFGA 2C2EA 4FLUA 5KFOA 1IKWA 2HNDA 4CHQA 4FK2A 3HO1A 5C42B 3ICLA 4ELVA 4FLWA 5JUMA 5EU7A 1IKXA 3AA3A 4CF0A 2IM3A 2UVVA 2YNHA 1RT2B 3RBDA 4N76A 4FJMA 2XGQA 4RUAA 4DQRA 2VG6A 2X74A 1ITGA 2FLPA 4DL3A 3KHHA 3Q8RB 2UVRA 4FZXC 4IG0A 1D8YA 4RNMA 2EX3A 2B6AA 2YNGA 5FRNA 3I0SB 2HWIA 3K59A 1NOZA 4NRUA 5KFDA 1YTAA 4CK3A 4I9LA 3ZSZA 2YNIB 3DLGA 2E9TA 3O3FA 5KFVA 4K4SA 2D0BA 1KLMA 5DGAA 3E01A 1VRTA 2Z1GA 3QYYA 4DFKA 4DSFA 3LP3A 4QWAA 5J2MB 4URQU 3TAMB 3VQ6A 4R5PA 4KE5A 4FJ9A 3HSTB 2VWKA 4YP3A 4Q44A 2VG7B 3NFAA 2UUWA 4FJ8A 2XY7A 3LP2B 5KFAA 2V4QA 4F4ZA 5KFSA 1C0TB 4JV0A 4HUEA 5HRSA 1C1AA 3OLAA 4KV8A 2KFNA 3PR5B 2FBYA 2WONA 2XO7A 3NGZA 3AVFA 5C42A 1VSEA 3DRPA 3SPZA 2HHVA 4YNQA 2A1SA 4E7KA 2OPRA 4DSLA 2WOMB 1RT7B 1BHLA 1RT2A 2D3UA 3BJYA 4DL5A 2W9BB 1HNVB 4KHQA 3DLEB 4AHCA 4QPXA 4MFBB 3CDUA 4NLVA 3T5KA 1XHXA 4KHMA 1QQCA 4IH5A 4Q8FA 3V9XA 3TI0A 4B8AB 4E7LA 2X78A 3P5JA 1RNHA 5HROB 2P51A 2UUTA 4K8XA 1DLOB 4NZ0A 1X9SA 3PX0A 1B92A 4OPKA 3HK2A 3MXJA 4Q45A 2OA8A 4BACA 3QINA 4YR3A 2YNIA 3MF5A 4CF8A 3KLFA 3AA2A 3SUPA 2KZZA 4DSEA 4KHRA 3UDLA 4CJKA 4MKAA 4AHVA 3KHRA 1RT1B 1D9DA 5F8NA 5L1LA 3IG1A 1QSSA 4NCGB 1KHVA 4DL4A 3GIJA 3HYFA 3G6YA 3CQ8A 3AVMA 4RNFA 1JKHB 4C8NA 3VQQA 5KFHA 4FJKA 1RTHA 2JC0A 3P83D 1CXQA 2VG7A 1RT6B 3SYZA 5KFNA 2C2DA 3UIQA 3H59A 4KB7A 2WRMA 2FJVA 4CF9A 3F9KA 2I5JA 1JXBA 2BQUA 2OPQB 3ASMA 3VQDA 4ECUA 4NLXA 1QS4A 2NUBA 4B9LA 2OZMA 3LWLA 1HARA 4BE1A 3NGIA 4M3RA 3RAQA 3QIDA 4YR2A 2WOMA 4TY8A 1RT7A 1JLEA 1L3UA 2KTQA 5KFBA 2OH2A 1LWCB 1RT4B 3CYMA 1ZBFA 2W9BA 3NAIA 1HNVA 2AGPA 3VA0A 5KG7A 3NDKA 1ASUA 4CEFA 2HHXA 3DLEA 1K1QA 5J2PA 4WFXA 4HYKA 2Y1JA 4ECYA 1BQNB 1U4BA 4I2PB 4E1MA 3OYHA 3H98A 1C6VA 2ATQA 3RMDA 1EXQA 2OPSA 4Q8EA 1KSPA 1TQLA 4LQ3A 4H4OB 1VSKA 4F4XA 3L2UA 4YR0A 1FXXA 1C0UB 4JRPA 4RW6B 1JIHA 1IH7A 3SNNA 4MIAA 3QLHB 1TK8A 4ED6A 1NKBA 4PWDA 4GC6A 4HUGA 3ITHB 4ZP9A 3UQSA 4KB1A 1B9DA 3SI8A 4NLWA 4ID5A 1GOCA 2F96A 3ZSQA 5KFTA 4EEYA 2HVHA 3NF6A 3MR6A 5HLFB 4FJLA 3MFIA 4Q0BB 3AVBA 1RDDA 5F8JA 1MU2A 4NCGA 1WSHA 2X6SA 2YKNB 1TGOA 4URSA 2HHWA 4K4XA 1JKHA 3KMSA 4MKBA 4F2SA 1ZBUA 5KT3A 4OGCA 2IC3B 1NJYA 3WNHA 1SH2A 3FQKA 5CZ2A 4FM2A 2FJWA 2GIRA 3NF8A 4CIGA 1RT6A 4CK1A 1A5XA 3HVRA 2D7SA 5T7BA 2GIQA 3FSIA 2IM1A 2OPQA 4L8RB 1TAUA 4KTZA 3EZUA 4TY9A 3NAHA 1CZBA 3EZ5A 3BGRA 3LDSA 5KG4A 4NLSA 2XY5A 4C8MA 1EETB 3H08A 2AJQA 4DTSA 3QNNA 3MEDB 1LWCA 1RT4A 4ELTA 4B9NA 1QUVA 4B08A 3HHKA 1IG9A 4EP4A 3TAFA 3KNAA 3TWHA 1BQNA 3SJJA 2ZD1B 4CF1A 1LW0B 4I2PA 2E9RX 2FVQA 3HVWA 1NJWA 4RW4B 3SUNA 2GUIA 3KIOA 1VSDA 3RR7A 4LQ9A 3IRXB 4H4OA 3V9UA 3CDEA 3S3OA 2GBZA 5J1EB 4IBNA 3IS9B 3QLHA 2YKMB 2ASJA 3QGIA 1FKOB 3ITHA 4E0DA 4WE1B 4KKOB 3TVKA 4ECTA 2R2UA 4QWDA 5KFRA 2XCAA 1L5UA 5HBMA 4R8UA 5HRNA 4M94A 4Q0BA 1UWBA 3WNFA 1WLJA 2XY8A 3MR3A 3NHGA 4QWBA 3OJUA 4DS5A 2PYJA 2IC3A 3TABA 3OYAA 5K14B 1C1BB 3THVA 4HCCA 3CJ0A 1ASVA 1RBTA 1EX4A 5HRPA 1CZ9A 4NLGA 2BE2A 3QIPB 4FJ7A 2G8UA 3B6PA 4KHSA 1U48A 1Z25A 2HAIA 3VQCA 3SQ4A 1WSIA 4NYZA 4OKKA 4C8KA 4F2RA 4Y1DA 3M8RA 4IRKA 1EETA 3I0RB 4FJHA 4ZHRB 3PX6A 1HQEA 3VA3A 3MEDA 2AQ4A 4G1QB 4HKQA 5KG6A 4IKAA 5DQGA 2R8JA 4CJEA 1T03B 1YVUA 3HP9A 2ZE2B 5KFIA 3O4NA 1LW0A 2QE5A 4OLBA 4OKEA 1LWEB 4RW4A 4J9PA 1NKCA 4M3XA 1UOCA 5I42B 3IRXA 2AU0A 4CJQA 1WNEA 1S1WB 4FLYA 1R0AB 4BDZA 2HMIA 3BQ2A 1Z4UA 4CE9A 5J1EA 1ZTTA 1IKWB 4E7IA 4Z4FA 3KLGA 3N6LA 4CGIA 3IS9A 1RDRA 1U45A 2YKMA 4OJRA 2YHBA 3OYDA 4J2EA 4WE1A 1I3AA 1IKXB 4W5RA 5DMRA 1JLQA 2D3ZA 4H54A 4Z4IA 2RPIA 3FRZA 3KJVB 4J2BA 1SH0A 4DFJA 1UA1A 3RRGA 5KTQA 3SQ0A 4N41A 3T19A 3SUOA 2B6AB 4NYFA 2YNGB 3LANA 4FLXA 2DFEA 4TLRA 3DI6A 3RR8A 5L1IA 3DRRB 5K14A 3EY1A 1C1BA 2O4GA 1WSGA 1EP4A 4FW1A 1NK9A 3DM2B 4TXSA 3CO9A 4DLEA 2JEJA 1MMLA 3FDSA 4AHSA 3QIPA 3KTQA 4WZMA 1KLMB 5JS1A 4CFAA 4ZVEA 1SL0A 3MAQA 3L2WA 2UVWA 4BDPA 1SKWA 4CJLA 3HPOA 1QE1A 5JXSA 1BQMA 2WCXA 3CJ5A 4JV1A 4FJ5A 2RDIA 3I0RA 5KG5A 4AH9A 4F8RA 4FJXA 4ZHRA 4R5PB 2I1RA 3ZSRA 4G1QA 4NLOA 3OL8A 4RNOA 5C25A 2EHGA 1JX4A 1JLFB 4ECSA 3H4BA 1T03A 2ZE2A 3JSMB 1LWEA 3UR0A 4PQUB 1O1WA 5I42A 1S1WA 1R0AA 4RW9A 2ETJA 3L2RA 4KV8B 3I5BA 2WONB 3PR4A 1N5YB 2EC0A 3AO2A 5SZTA 3DRPB 5KRTA 3HP6A 4LD0A 2OPRB 4PUOB 1T3NA 4FYDA 2YNFA 2JEIA 2KFZA 1VSHA 2HNYA 3KJVA 3KLHB 2Z1HA 5FRMA 1N4LA 4AILC 3PJXA 3NL0A 4LH4A 2QXFA 2RDJA 1WSFA 1TL3B 5FDLA 2XRIA 3QNOA 4OKJA 3V6JA 4XPCA 3VQPA 3OL9A 5DG9A 4DSJA 2BQ3A 1ZBLA 3C6UA 4IFVB 5KT2A 1KCFA 3D0PA 4M3UA 3DRRA 4CJSA 3H4DA 3MR5A 3DM2A 5L1JA 1S1TB 3V9ZA 4Q5VA 1T94A 4O3OA 1S10A 3OYJA 1ZYQA 4E3SA 3V81B 3KLFB 1QHTA 4ZTFA 3NH2A 1C1CB 2IGIA 4FK4A 3V6HA 3KMQA 2FVRA 2WB4A 5KT4A 3ZSYA 3IG1B 4NLYA 3ZSXA 4C8OA 3SZ2A 3IGNA 2VWJA 1TKTA 1KHWA 5E41A 5KFQA 3V1RA 3N6MA 4WXOA 4MK7A 1L3VA 5KGXA 3ZSOA 1BIZA 3OLBA 3DMJA 3CWJA 3PV8A 3RMAA 3SCXA 1JLFA 3KHGA 3K57A 1RTHB 5F9LA 3JSMA 3NAEA 3KLEB 4ZPBA 3LZIA 4PQUA 2OYQA 1RTJB 1QSYA 1SKRA 3ZT2A 3OSNA 1C2PA 3OYIA 4MIBA 4EO8A 2I5JB 2RN2A 4NLRA 4O3SA 3K5OA 2WTFA 4QOZB 4CJPA 4F4WA 1N5YA 4IR9A 2W42A 1NJZA 4IDKB 3GILA 1BI4B 2E6LA 3QEPA 3M8SA 4ZP6A 4Z4GA 3G0ZA 4CFCA 4BE2A 4PUOA 4TY8B 1Z26A 1JLEB 2QK9A 5KG2A 4N5SA 2JLEA 4J9MA 3QEVA 3TQ1A 3AVAA 3L8BA 3KLHA 4X2BA 2QV6A 5DQHA 5J2PB 4IRDA 4N56A 1RA7A 4NCAA 3GQCA 1TL3A 4FJGA 2OPSB 2BRLA 4JS4A 2FVSA 1QAJA 3UPFA 4IFVA 5I3UB 3BR9A 2FJXA 3QESA 2ASLA 1S1VA 2IOCA 4O55A 2HB5A 1REVA 1S1TA 2BGGA 3T5LA 4PWDB 3EPIA 4RUCA 3NF7A 5F8LA 1SV5A 3V81A 3V9SA 1C1CA 4ID5B 3RB3A 4Y1CA 3QZ8A 4ZVHA 3CVKA 4KRFA 1MU2B 3BQ0A 4ZPAA 4Z4CA 3U6FA 4HHTA 1HJRA 3EYZA 3IAYA 1S48A 2R7YA 2XY6A 5EWEA 4CESA 3IN5A 4FM1A 4I2QB 1XR6A 3N6NA 3KLEA 4XIUA 2O4IA 4KFBA 4IOBA 4M3WA 3H5YA 3NE6A 1RTJA 2IM0A 2B43A 4CEAA 4ZTJA 3RWUA 4CJ3A 3CFRA 4IDKA 4QW8A 1BI4A 3BGRB 1S5JA 3O3HA 2W7OA 1LW2A 1JLGB 4NYNA 4KB0A 1HYZA 3LPUA 3SQ1A 1RDBA 1CXUA 5KFEA 4DG1A 3K5NA 4E1NA 4DEZA 4CEEA 5EDWA 1XWLA 2ALZA 2XWYA 3M9NB 4QAGA 4F4YA 4DTNA 4DF4A 3OL7A 2RF2B 1KVBA 3QZ7A 1KVCA 2F8EX 3SPYA 3GV8B 4PA1A 5DG7A 5I3UA 1K1SA 4URGA 3MR2A 2QKKA 2G8KA 3AA5X 4M42A 4CK2A 4CIEA 3AVKA 3K2PA 1KFDA 1WSEA 1T05B 2GV9A 5KT6A 3CM5A 3TAPA 3BQ1A 1SL2A 4DFMA 1GX6A 2BDPA 5HBMB 4R8UB 4J2DA 3KKRA 4JLHA 3AVCA 4ZP7A 1UWBB 3QEXA 1RYRA 5KFWA 1S4FA 1W0HA 4ELUA 1TK5A 4U6PA 4ED8A 4KHNA 1NJXA 1QTMA 4ZPCA 4XPEA 1S1UA 4J9SA 4WFYA 3ZSVA 4I2QA 1XI1A 4O4RA 3AVLA 4DQPA 4HUFA 2ATLA 1BCMA 2HW3A 2BE2B 2G8IA 1IO2A 4CJ4A 3KK3A 2W8KA 4O5BA 1S97A 4ECXA 4H4MB 3ZSWA 1SKSA 3ALYA 1JLGA 2R8KA 2HWHA 1HQEB 1VSMA 1BISA 1RTIB 4WYWA 2HVIA 4K4ZA 2FLNA 4GC7A 4R0EA 4O0JA 3OYKA 5CYMB 2RF2A 1Q8IA 1J53A 3QETA 2FLLA 3OYGA 3AO4A 3F73A 1Y97A 3A2FA 2DPIA 1RTDB 4ED3A 1J5OB 2HMIB 3PVXA 2HHSA 1NK4A 1TV6B 1NK6A 3KLGB 3HPHA 2F8SA 4Y3CA 3ZCMA 4DL6A 4DLGA 2IJFA 4ID1A 1S0NA 5F8IA 1JLQB 5KG0A 1T05A 2R8GA 3U3GA 1W9HA 3BSOA 2E9ZA 3V1QA 1GOBA 4IH6A 3TAEA 1L3SA 1S1XA 1G15A 4I7FA 4KI4A 2PZSA 4O44A 2JC1A 4NLTA 4F4KA 4ZVGA 2AWZA 4ED7A 4DF8A 4WZQA 4KAZA 3DI6B 3BDPA 3HL8A 1YT3A 2BR0A 4Q43A 3HT3A 2PYLA 3PO5A 4BE0A 5EUHA 2G8FA 1EP4B 2ASDA 4DSIA 1WN7A 4EYHB 3M9OB 3NCIA 4M3YA 4KHUA 1X1PA 3OYFA 4CGDA 3NGYA 3DOLA 1W25A 3GIMA 4H4MA 4JV2A 1TP7A 1QE1B 1BQMB 2FBTA 1JLBA 2V4RA 3ISNC 2IS3A 4F3TA 4O3NA 1NK8A 4QWCA 2C22A 3CM6A 4I9QA 1JLAA 1RCHA 1RTIA 4CFDA 5C25B 4K4WA 4CGFA 4K4VA 4ZVFA 4DTUA 3JYTB 2FVPA 3TAGA 5CYMA 1WSJA 3B6OA 3NF9A 4QW9A 1VSJA 4Z0UA 3SI6A 4AHTA 4CJVA 1RAJA 1RTDA 4J9LA 4CJTA 3M8QB 4IQXA 3IGVA 1J5OA 1JXLA 3VQ4A 4RW9B 5KGWA 1TV6A 5HP1A 2FBVA 4CHOA 4W5QA 4IRCA 3KLVA 5L9XA 4EZ6A 4NRTA 4TQRA 1N6QA 4DMNA 2YNFB 2O5DA 3T1AA 3KHLA 4MQ3A 2HNYB 3TAQA 1NHVA 3AVGA 3OYLA 4IH7A 1XR5A 2W9CB 4K4TA 2W7PA 5KI6A 3KD1E 4DL2A 4DSKA 3AVIA 3HVTA 5FDLB 3BSCA 1HPZA 3OS1A 3C6UB 3FFIA 4RW8A 3DOKB 4FBTA 4EP5A 2DFFA 3V4IA 4EZ9A 3SV4A 4J9KA 4M41A 4DQSA 4M3ZA 1RT5B 2HNZB 1U47A 3ZT1A 4DQIA 5F8MA 2WHOA 3OYCA 4DTMA 3KOAA 3CIZA 5KFFA 1ZTWA 2AGOA 3WNGA 4CEDA 3RTVA 3DRSA 4B9VA 2R8IA 4E89A 1RA6A 1TKTB 5KFCA 4B8CA 4Y34A 2WK4A 4QCLA 3DMJB 4PY5A 3VQEA 1FKPB 3AO3A 3JYTA 3ISND 4KHYA 3V6DA 5KFKA 3LAKA 4RU9A 1TKZB 1YVFA 2B4JA 3NKYA 3DYAB 4CHNA 4EBDA 1HRHA 1JLCA 2D0CA 4FVMA 2P5GA 1TKDA 3M8QA 4J9OA
chains in the Genus database with same CATH superfamily
5A8WB 3T1YJ 3UCUP 4X65K 4F25A 4CEBA 1TR0A 5ELZA 4JAXA 3D6RA 3P8BB 1KR4A 3Q8SB 3HHDA 4B3SF 4OX8A 5B8HA 4KSEB 4EBCA 5DLGA 3AV9A 3OS2A 4KR0B 3S1TA 4CBXA 4W5OA 3GV5B 2XHCA 2VBXA 3DGPB 1X0FA 3C95A 2DPNA 2OJ3A 5GAEI 3I5AA 3WDOA 5HO4A 5LJVA 3HJFA 4B9MA 3LOUA 2VBYA 1S1VB 3KK1B 1ZBIA 1I1GA 1REVB 4XDCA 2HNZA 1UAXA 4BBYA 1JNZB 2OPPB 2PFFB 1HFEL 1RE1B 3VHQA 2P9IB 5KAKA 1UVKA 1JNRB 3S8SA 3FLCO 1D09B 1XEZA 3CD0A 1BD6A 1HNIB 5KFZA 3MXHP 2ACYA 4BC9A 1LNQA 1QJHA 3MAAA 3E9PA 2VPYB 1QLNA 3DYAA 1X3MA 3I87A 3M5RA 4KFBB 1NNEA 2MDAA 2ZKUA 3G86A 4J9RA 4QR2A 3CC7S 4EU0A 1FF2A 1VISA 2CJQA 4OYIA 5IOLA 4F50A 1S0MA 1NWKA 4FW2A 4CT8A 1RBOB 5CD4H 1NGIA 1BWEA 4M45A 1U49A 3CB4A 4TYBA 2NRRA 5AQHA 3G6XA 4UW2A 2UXBK 5DGBA 2QWLA 1XK8A 4LF5J 2V4JB 4LVNP 1S7HA 4IOCQ 3G6VA 3ZTOA 5IT9O 4OQJA 4IFYB 3GOIA 2IMWP 3P3DA 3QBCA 3VEWA 3W5YA 5M1OA 5BRDA 1QSLA 4AM6A 4XH4A 5HSPA 3ZETB 2ZFHA 1R8AA 4ICLA 2R2RA 2ZVIA 4BG9A 4YHHK 3T1HJ 2GJFA 5CYQB 2RHQB 3D0GE 3GYNA 1RWOB 4PCQA 1UA0A 1VLYA 2N4CA 3HXMA 4DV7K 3WEEA 1KC8O 4CJWA 3NBPB 3H42A 1W2BR 4E7JA 4Q7AA 1P6TA 2HSEB 1A5WA 3U3YA 1HYVA 5KFMA 4CECA 4NLDA 2CZVC 2D1CA 3MHYA 3V4MA 1UMJA 4HVJA 2GV1A 3CDAA 1XUPO 1WG5A 4EIAA 1NK5A 4CW7B 5CQGA 1VRUA 3GJRB 2OKQA 3KK3B 3SSRA 3M2VA 2HLTA 2ZH9A 3ZLJA 2ZUAA 2X1FA 1SI9A 1UEVA 2AMCB 1FRIA 3ZTRA 4PKGA 5D0EA 2XC9A 2CQCA 1H98A 4JYAJ 4ZVOB 3KUHA 2ASYA 1HYSB 1Y10A 3OQ2A 5EVZA 3T3FA 1TKXA 3KLIB 1VCTA 5AQZA 4W5NA 2FGCA 2R2SA 2NSBA 5L38A 2AJ4A 2FSNA 2HK3A 2E1AA 2JLFA 4GW6A 1YQHA 2P6TA 2E5LK 1RACB 4OYMA 4BR7A 3GL1A 1RAGB 4LF4K 3MCSA 5C5JA 4NI2B 2ILYA 1PO6A 3VEVA 4U9RA 3MN7A 3WC0A 1BG3A 3J81Y 2MHNA 4P2SA 1F60B 1S0OA 4FZVA 3D5MA 2ZWOA 3OFHA 4AFFA 4J2AA 2ZUGA 4K50A 4OVLA 3CJTA 1IBKF 3UFCX 2ZBIA 2WUSA 4GKJJ 1S1XB 1YX2A 3P4IA 2XMVA 2CWKA 4K2XA 3LUYA 4N8NA 2QXLA 5KFGA 4LFBK 1B99A 1XQSC 1HNZF 3SXLA 3VN5A 4FPAA 5DDQC 1U7LA 3CCVN 4CIFA 2RKIB 2K3KA 3PW2A 1JJ2R 5G0RB 3PDNA 2UUBF 3NH0A 1XHZA 3ET6B 1H1VA 1VR6A 3ZTSA 1X5SA 4ILRA 4DR6J 1OMSA 3WX4A 3ZT3A 3UWTA 5ADZA 1NH7A 4CO0A 2C42A 1Q79A 5IWAJ 1MWKA 3W1YC 2EBGA 3RRHA 1YITN 2P1JA 4AL5A 4BC4A 3RSEA 5KFYA 4R0JA 3RBXA 3DLLQ 4DV1F 2VWBA 3S3MA 5EY4A 1K9MO 4J9QA 2U2FA 2W4CA 1VQ9S 4FJNA 3LWMA 3I5CA 3FBFA 3L2QA 3OUYB 3QFUA 3VF0B 2NZ4A 4H8KA 2W2NP 5BRFA 1RBRA 4NA3A 4EO6A 4RW7A 5AQYA 4B3SK 2G13A 4K0KJ 1Y0HA 1CJUB 3O9UA 4CEZA 2MY7A 1HR0J 3QEWA 4NA2A 3I4HX 5J2QB 2XYGB 4DCHA 2J7WA 1N6QB 1X4EA 2DGSA 4CO4A 3OPKA 3J80U 4F4AA 3SMPA 1HBNA 2DFHA 3AA4A 4DU3A 2Q1NA 1I6JA 3A8EA 4D3HA 4EAHD 3F9MA 1NNDA 3HZGA 4O0IA 4LRCA 2W4DA 1BO5O 3FFIB 4RW8B 2JEFA 5HLFA 4ZPDA 5CH7B 3BO3A 5F0UA 2AV5A 3A3OB 3MD1A 3W0LA 5C2CA 4DTXA 3OXFA 4LMZA 4LSLA 1P9QC 3CEDA 4OI4A 1T8EA 1MWZA 2ADBA 3O4WA 3OW2M 4B02A 4IG3B 3MECA 3N5BA 2NXJA 4DZ6A 2MSSA 1K6YA 2ZJRL 2P9KB 3W2VA 5KFPA 2MKSA 4O4GB 4H0TB 1WOSA 2LVWA 2HQFA 4AHRA 5HVFA 2YWWA 1H74A 3IBWA 1BWFO 1RDAA 3S01A 1RDWX 1JLCB 3MOJB 3ZZRA 3NOGA 3LP1B 3PW5A 1SUQA 1VSIA 5D15A 2XYHB 4CZKA 2OUGA 4FS1A 4ANDA 1Q16B 3KK2A 2Z1IA 3TNVA 2R2TA 4FKYA 1KRPA 2F3JA 1HWUA 1Q82T 4QS7A 3ZX3A 1VC5A 2W2OP 1R59O 5ETTA 4LSZB 1Q7YT 1J27A 4QYRA 2EVZA 2WAQD 2DR8A 2Y1LB 4ILJA 4KKOA 2DHAA 1EARA 2XNRA 4YB7A 3PJ9A 3AAQA 1IR1A 3FCWA 4JV5J 4PG6A 3CJ9A 2IY5B 2HURA 1BA0A 2VG6B 2FQQB 2BM1A 5F8GA 1TL1A 1ULRA 3AODA 3BREA 3T5JA 4PHTX 3OS0A 3J7ZO 3GJSB 5B0FA 1NSQA 3HJVA 5DQIA 1NKEA 5C24A 1UP1A 4ECWA 1F5AA 3VEZA 4CJ5A 4DZDA 4CHZA 1N32F 4TLQA 1QVGR 4MYUA 2RRNA 3VESA 4FK0A 2CJBA 1RDUA 2PDAA 5BPMA 1JL2A 3MXMA 1JQGA 3E01B 4TYAA 2KYZA 1KQSM 3THTA 3MAAB 1NK0A 4ZPVR 4Y2AA 3BZCA 2M70A 3TR8A 3NGSA 1ITPA 3D2EB 4RZRA 1P8GA 1RKIA 2CQIA 2UV8G 5KFLA 4DL7A 1KFSA 2EI5A 4E19A 1VSFA 4BR5A 2MKYA 3W63A 4GNIA 1YTUA 1EAYC 1LAVA 3RBEA 2RH3A 4J9NA 3VEOA 1WKLA 1JWWA 1F1BB 2ROPA 3M1VA 3OA9A 1TYQA 5AR0A 3ZT4A 4X66J 2DHGA 4DKWA 3NVMA 4FLUA 4CHQA 3NNHA 2HF3A 3ICLA 4Y28C 4ELVA 5C12A 5EU7A 4O0NA 3GG0A 3AA3A 3J7Z5 2YNHA 4WQ4A 4OX9F 3RBDA 3F0NA 5KPRA 3IR7B 4RUAA 4Z2XA 2ZH8A 2X74A 1ITGA 2R7SA 1GLAG 1IBKK 3MM7A 5B0BA 3KHHA 5GMDA 4IG0A 2EX3A 3I82A 1XMOF 2P9PB 5D4PA 3MK6A 2ZWHA 3WEEB 3KG1A 4NRUA 4X62J 2J0QD 3CCJN 1HNZK 1FJGF 4I9LA 3FVYA 2OLWA 1E6YB 1SJ3P 1VBXA 4Y2MA 3O3FA 2GELA 3VAKA 3O80A 2UUBK 1R8HA 1HNWJ 3UN2A 3ID8A 2DD8S 4DFKA 3QT5A 2HVZA 2QW9A 3MX5A 3QWPA 4FJ9A 5AQLA 2CNKB 2DNPA 3CMAS 4DV1K 2DH8A 2VG7B 4WIQA 3VAGA 2VOOA 3MWPA 4P7TA 2QG9B 5AQPA 3QBXA 1S3XA 5KFSA 2GHPA 5I9EB 5B0DA 5HRSA 4DR2J 2KFNA 4QBUA 5C42A 3DRPA 4NO7A 2K7KA 3SPZA 3WC2A 1C0FA 2OPRA 2ZM6F 1YTYA 4DSLA 2WOMB 1R8PA 2F7TA 2D3UA 5FPMA 2W9BB 4AF1A 1UVMA 3U4LA 1V5VA 3DLEB 4QPXA 4NLVA 3V9XA 4YOTA 4FPIA 3KWGA 3JB9k 3D0HE 2X78A 3P5JA 1VIOA 2RIJA 2DIVA 3LTOA 2O8DA 4A8WA 4L76A 4M5GA 2R7QA 4A8OA 2IBOA 4Q45A 4UUWA 1R0CB 2O8FB 3H46O 4MKAA 5E3AA 2CNOB 4OFZA 2IVPA 4C48A 1IJEB 4FF2A 1FJ7A 1QVFM 1N52B 2RQKA 4NCGB 4RTFD 4YN3B 3ZTPA 3M3ZA 2HRUA 2P9CA 4E98A 4LFCF 3D66A 4C8NA 1Z05A 1R0BG 3MDQA 2DHHA 2JC0A 2LEAA 1RUSA 3SYZA 2Q0UA 5KFNA 5C2FA 2W6KA 2FTRA 4KB7A 4A47A 3E9OA 1RAFB 3MCOA 3ASMA 1QQMA 2HMPA 3GDQA 4B9LA 2LLZA 2W7AA 3UDVA 1PC4A 5E3CA 4M3RA 3RAQA 3D6MB 4OX6A 1RT7A 1L3UA 5H9FJ 1LWCB 1RT4B 2AGPA 1LK7A 2E1RA 2J7UA 4PABA 2XMMA 4WFXA 4B3TJ 2Y1JA 1CULB 1C6VA 2HS4A 4TKTA 2CZ9A 2OPSA 3BGUA 2QWQA 5CABA 1CVJA 2QYGA 4YR0A 1I5OB 1N88A 1RTZA 2NUUG 2NRWA 3QLHB 1TK8A 4ZP9A 3UQSA 2LP4A 1B9DA 3SI8A 2QA1A 4DV4F 1GOCA 2PAVA 5KFTA 4OHXA 5HLFB 2P9NA 5ADXA 4BVPA 2BTFA 4PG8A 1NXIA 1N32K 3MEKA 1RHJB 3IA0A 4UF4A 3KNGA 2DY9A 4OGCA 4M5DB 3WNHA 4DPOA 2FJWA 4ZS6A 3FZMA 2GIRA 4CK1A 3O5BA 3JQMA 1UW9A 4KH1B 3HVRA 1MSWD 5IQ6A 2D7SA 1DFDA 3W2VB 3HFKA 1T0TV 5AZJA 2AEJA 3G8TA 3TR5A 1HA1A 2KXFA 3OTBA 4C3MA 5D4NA 4KTZA 2JX2A 1KQGB 1VQON 1CZBA 2XY5A 3FJ2A 3E3XA 4LR8A 1EETB 3QFPA 4DTSA 2KH9A 2DNNA 1LXJA 1Q8LA 3A8IA 3EN9A 4Y6IA 2PA8D 3RW7A 3HSDA 2AJFE 1RAEB 4M5MA 3TWHA 3K0SA 3SJJA 4CF1A 4I67A 4I2PA 2E9RX 3HVWA 3ENVA 4RW4B 4P6QA 3C8YA 2ACMA 4LQ9A 4H4OA 3UR3C 5DRKA 4PWWA 3D4JA 2CFXA 3MCAB 3Q83A 2GBZA 3I55N 3HHLB 2B8QA 4OX9K 4BRIA 4UOFA 2ASJA 3GJTB 2KVQE 4IWVA 4BRFA 3ITHA 4RL1A 4KKOB 4C0BA 2MKIA 1A7GE 1XMOK 3NNCA 3B4MA 4M63C 1L5UA 4M94A 3TZZA 2VDHA 1UWBA 1FJGK 4JN4A 3SCJE 2F65A 3WNFA 4B1YB 3A3PB 2RNEA 2XY8A 3MR3A 2R4FA 1REGX 1RAOA 4ZCLA 4QWBA 2CYYA 3FEYB 3PFOA 1FRXA 4HDGA 3B8AX 2HS0A 5K14B 2OEKA 3DDIA 1GMWD 3THVA 1ZZFA 4DV3J 1U0HA 2BOPA 1ASVA 3N4PA 2QTDA 1KS2A 2EKYA 2D3O1 4FJ7A 3B6PA 1U48A 1BQXA 2HAIA 3SQ4A 4MJKA 4KC5A 3TVZA 4NYZA 1FXDA 3CD5A 3CCQN 1NMEB 1NZAA 4ZHRB 3L09A 1FRHA 2QWMA 4G1QB 4OYOA 1NB7A 3OTOJ 4M7YA 5GADI 2OTLN 4RBUA 2R8JA 4QIEA 3TQEA 3J7YI 1YVUA 3HP9A 2ZE2B 3ULEA 5KFIA 4OLBA 1X5PA 2CQ3A 2HF4A 4JP8A 4EFHA 1K8AT 3P96A 4JKGA 2K2PA 3M1VB 2ZM6K 3VEYA 3BQ2A 4ZN1A 2E8AA 4CE9A 4CNZA 1PILA 1ZTTA 4Z4FA 3N6LA 3FMWA 7FD1A 1VQKS 1U0SA 4OJRA 2BW2A 2KFYA 3OYDA 4PR6A 2J8SA 4W5RA 2FY1A 2DNHA 4JB8B 2BKPA 1SIWB 3HDSA 1J2VA 1GLFO 3RRGA 5KTQA 4N41A 3W9JA 1ZM2A 1VK3A 4DR1J 1M5PC 1GTHA 2DFEA 2K7JA 1BC6A 1UFKA 2FJDB 3SQOP 3RR8A 4YOVA 1TFYA 1DT9A 2AA4A 3K5PA 5JJBA 3DRRB 1TMMA 2O4GA 2ZOMA 2JL9A 2HQGA 2JEJA 4A2BA 4AHSA 2XBPA 3O1WA 5JS1A 3OV7A 1ZZNA 5IXUA 4BC3A 4BDPA 1SKWA 2C2ZB 4CJLA 4LFCK 2WCXA 3CJ5A 3NXZA 2RDIA 2YX1A 3I0RA 5KG5A 3GLJA 4B3MJ 3ZSRA 2E5HA 4K59A 1GMWA 1BY9A 2EHGA 1JLFB 1T03A 2M8HA 3CCWA 3UR0A 4PQUB 2B3TB 3O1LA 1HKBA 1S1WA 2MKCA 1Y9OA 3BBFA 3VZHA 4DMZA 3FE1A 4C97A 1HBOA 3DRPB 1WC1A 3W2WA 2OPRB 3M2RB 2WB1D 3T9NA 1SQFA 3A13A 1T3NA 3RAMA 4JHDA 3D0IE 3JS9A 3Q7CA 2RILA 4C0OC 3KJVA 3G2XA 2DK2A 3P49B 1VQPS 3DOMB 2QXFA 5FDLA 2XRIA 3QNOA 4OKJA 1NB2A 1FFSB 2O8DB 2BQ3A 1ZBLA 4PXCA 4CI6A 4DV4K 1BLUA 3R8YA 4CZHA 5L1JA 4CD3A 3V9ZA 3RG6A 1PG5B 2LKZA 3V81B 1XNQF 4FK4A 3KMQA 4FPBA 4DV2J 2PI5A 1EQ0A 2FVRA 5KT4A 1MG7A 4NLYA 1KHWA 3D1QA 5T41A 1L3VA 2R42A 2WVFA 3LQVA 4YUDA 4P73A 3OLBA 3VR1A 3DMJA 1SVDA 1P1LA 1X5OA 1GNKA 3M32A 3THPA 3EL2A 1WBBA 3ETOA 1HI8A 3A4TA 1Y4ZB 1S72N 9ATCB 4OZNA 3ZEUB 4A8KA 3OYIA 4EO8A 2YWFA 1ZH5A 5FLXY 2WTFA 1F5BA 4CJPA 4RO0A 2LQ8A 1N5YA 4IR9A 2W42A 4IDKB 3GILA 2EFNA 3QEPA 4ZP6A 4I69A 4BE2A 4CTAA 4PUOA 5HATA 2QK9A 4V19X 3QEVA 3AVAA 2AHOB 2E1MC 1HI1A 4YOWA 2QV6A 3GFZA 4DHVA 4WKYA 2HQDA 3TTDA 4N56A 2HFNA 1RA7A 3MM8B 1FRKA 4FJGA 3JTPA 2OPSB 1WJ9A 2A10A 3N5FA 2UXDJ 2FDNA 2KT2A 4BVOA 5I3UB 3AAWB 3H6EA 2ASLA 2IOCA 1S76D 4NYOA 3EPIA 3NF7A 1C1CA 1NGHA 2QN6B 4PXBA 1WF2A 4RUHA 4Y1CA 1V3ZA 4ZVHA 2P9NB 4G1PA 3HOTA 4ZPAA 3A3NB 5BR9A 1HJRA 3HRGA 2GMJA 1WBDA 4BC5A 1T02A 4GY2B 2HEKA 1NMDA 2QIFA 3CD6S 3O1BA 2CDQA 3OBWA 4CESA 2U1AA 2HGMA 2B8PA 1F2GA 1RTJA 4FPRA 1HHQA 2MQNA 1MROA 1FHTA 2AEFA 4X4PA 4C98A 1C0GA 2QLXA 4JI2J 4QW8A 1BI4A 3UKRB 3NMUA 5A0YB 1JLGB 4KB0A 2PC6A 1HYZA 2EK6A 3HTVA 3H3NO 5GAEP 4E1NA 1FD2A 3L4BC 1XWLA 5AZIB 2XWYA 3GP9A 4F4YA 1T9XA 1ZM3A 4ETZA 1I94F 1KVBA 4FWNA 5K5MA 3SPYA 2P9UA 3GV8B 4IEEA 3EE9A 1CJTB 1RGVA 2X7IA 3R1XA 2OSQA 2QKKA 4A5AA 4M42A 5HQLA 3MUMP 1WSEA 1OJ4A 3RU0A 5KT6A 3Q7BA 2GW8A 5AQOA 4DFMA 4AM7A 4J2DA 1P1TA 2Q97A 2ZJPQ 5BR8J 1UWBB 5KFWA 3Q22A 4ELUA 4NXMJ 1TK5A 3B82A 2NYIA 1NJXA 1QTMA 3DJCA 4Y2KA 3TX0A 1K9MT 4ZPCA 1X4HA 4WFYA 3WIUA 4I2QA 4KIAA 1AZSA 4O4RA 2XWXA 3ZX2A 1YBTA 4L6V3 4K8RA 4HUFA 4CLFA 4N7TA 4NXNF 1IO2A 4CJ4A 4HTJA 2W8KA 5A8KA 4O5BA 1Y7PA 4H4MB 2LU1A 3ZSWA 5ETQA 5B0GA 4J9VA 3ALYA 5HN0A 2FIUA 3O9SA 3L9ZA 1HNXF 4WYWA 3ILIA 3MPWA 3K9KA 3DHXA 3MMJA 4K4ZA 4BROA 2ZWPA 1URNA 4MKVA 1JCGA 4O0JA 2VQFJ 2ZBQA 2RQMA 2RF2A 3ZO7A 4AQYJ 2FLLA 4WTYA 3CC7N 1RTDB 4ED3A 1NDLA 3CCLN 1J5OB 2F4VF 4LF7F 1TV6B 1DQ9A 2J9DA 3O5TB 4ZLJA 4DLGA 2IJFA 4KHPF 3U3GA 4ZK7M 3PRVA 2YKPA 3TAEA 5A6PA 1G15A 1OSDA 4O44A 4NLTA 4F4KA 3SQGA 4IO9L 2XS2A 2AWZA 2CG4A 2A2DA 3M6VA 3PYEA 1NLKL 1XNQK 2V8PA 3PO5A 1GK8A 2ASDA 3FC9A 4X64K 4V1Ak 3OYFA 2QA4G 1Q86O 3W62A 5GAHI 2D3OR 2V4RA 3U9DA 4FYWB 3SBMA 1NK8A 1JLAA 1RTIA 1FX4A 3NF9A 1VSJA 1TELA 4AHTA 1RAJA 2F9DA 4JI7J 3M8QB 3BO2A 1JXLA 5EX5A 3A8JA 1HBOB 1TUWA 4V19J 3Q2TC 1HBUA 2EFGA 3ZZUA 4RBVA 1X9JA 1D9AA 3J7ZT 1NH8A 3MAHA 4IH7A 1H73A 5LJWA 1FDDA 4P2MA 1SBRA 2YXLA 2RT3A 2P8IA 5FDLB 4EGLA 3BB5A 4HHHA 2HVDA 4W98A 5LT5A 4GO7X 3UKUA 3DOKB 2ASPA 2XYPB 3IXQA 4EZ9A 4M41A 4JI4F 1N5VA 3ZT1A 2UUAF 3OYCA 3HFZB 3CIZA 1IN0A 4F7VA 4X4QA 3M1FA 3C7NA 1SPBP 2NSCA 4JI0F 4R25A 2WC9A 5FJ4A 4OMFG 3FKBA 4GRSA 1DGKN 1WUUA 1IWAA 2DVIA 3DMJB 3C0BA 4YEAA 1DHMA 3ISND 3M32B 1IJFB 1TKZB 1M0SA 2XMUA 2B4JA 1M1KO 3UDCA 2J7KA 5HMYA 5KPTA 4ES1A 4GKKJ 1RT3A 4HH0A 2Z2YB 3DLHA 2DNOA 2CPIA 2OO4A 1FFGB 1U2RA 5KT7A 1I94K 2E1YA 2YQ3A 2B7CB 3O6WA 2W9CA 1VQ9N 3EGZA 1DTQB 2VFRA 5DDOC 2IA6A 1M5HA 3L3UA 1LOUA 3UN5A 3GYGA 3O3GA 2HQCA 3EGNA 3H2LA 3QFWA 3VQ8A 3AQOA 4CEQA 2JHEA 4NLUA 1HLWA 4NWBA 1OVQA 3CCVS 1B70B 4ILMA 1O5JA 2H5IB 5K8NA 1NGBA 1LV5A 4ISGA 3H40A 3BSNA 4L74A 2B9YA 3FZHA 5KG3A 4U8YA 2RRAA 3RBZA 2D41A 2L41A 4DUZF 3I6PA 1QD1A 2DHXA 2C3YA 4I6AA 1N5TA 1OS5A 1HWIA 3L95X 4CWBA 1PGZA 1YRUA 1FDNA 3VQBA 4NXNK 3ONQA 3QO9B 3ENBA 4IFEA 1EO1A 5AQXA 1FWKA 3BSAA 4KPYA 1HD1A 1GOAA 3BS9A 2VPZB 4JI3F 3M8PB 4BY9C 4U7CA 2XZTB 3VTIA 4BC7A 4PG5A 1NG9A 3R6MA 4X4RA 4ZA1A 2VQEJ 2W41A 4RLEA 1LCUA 2M8DB 2QM1A 4BQZA 3I9ZA 3VEXA 3EDQB 4W5TA 4ZCIA 3FGUA 3FQLA 1EKSA 1R27B 2YTCA 1GH8A 1S9GA 2ZGYA 3LDLA 1KOHA 2F4VK 4LF7K 1BL3A 1SL1A 4CLLA 1VSLA 1GXUA 5DM7L 3K5LA 1RWVB 2W8LA 3EE8A 3HPGA 1D0EA 3QB0A 4LF6J 2UYTA 4BRHA 2A40A 4KHPK 1B0VA 5LMNF 4JI1J 1NGCA 5IFMA 2EWHA 2DTUA 3LP0A 3PIPQ 2IYGA 3VQTA 3I0SA 3CCRN 3D68A 2JEGA 1GX5A 4B9TA 5LMUJ 2FC0A 3A8YA 3C65A 1WHWA 4NEYA 3S3NA 2E5GA 4QR0A 5MAOA 3PLAA 2QLJB 4I6MB 3FBCA 4OHYA 3C6TA 5AJ3J 4Z4HA 2Q3SA 1G3OA 4KH4A 4DPWA 3HHEA 4B3OA 2CUYA 3CDWA 4KYZA 4ZVRB 3DXKB 5FPDA 4DU1A 1N56A 4P74A 3QT6A 3O8MA 3MFHA 1AZSB 5LM7E 3TAMA 2F8TA 3O4QA 2NPIA 3UCGA 1Y5LB 3S6EA 2C28A 4A57A 3PSFA 2V69A 3R5CA 2UU9J 4I56A 2VV5A 1S6PB 2G0JA 2YKOA 3CIMA 1S49A 3CCEN 2RQ4A 4LSNB 2J6SA 1Y11A 1YI2N 4FF3A 5JVHQ 3IBCB 2DEIA 2V8HA 1HQUB 1PBUA 2FVCA 1A5VA 3BF4A 3GCXP 3MPYA 1EKEA 3D3CJ 3U7JA 3VQ7A 3R3LA 3W65A 3M9MB 6FD1A 3T1YF 1TVRB 5CCLA 4OGEA 2JFDA 4BDYA 1WD6A 3DFEA 4TU8A 1PJ5A 3NH1A 4XDDA 2BJ7A 4RR5A 4MFBA 3L2VA 2CQGA 2VG5A 3H90A 1HW9A 1S59A 3M8YA 3QSYB 2KZMA 2WFBA 3MDFA 4RKUC 1ZBSA 3AVHA 3S41A 3SUQA 3G6ES 3VGSA 1NBWA 4FJIA 1IM4A 4O44B 1AT1B 1UPMB 2E5JA 1NLVA 2P5OA 2GAHC 3QT7A 2GAGC 3Q23A 4JI4K 1MDUB 2O8BA 4OYZA 1T6CA 1WDTA 4CJUA 3O08A 4GO5X 3G9CA 2GO8A 3OT9A 1WG1A 2Q66A 4JI0K 2ZC3A 1XNRK 1AB8A 2OP5A 1U1RA 4DFPA 2MQMA 3IMXA 2DNKA 2PN6A 2QSFA 1UVJA 3GWCA 2EFOA 3TOQA 5T7LB 3GFHA 3MMCB 1AFIA 1IV0A 1PJ7A 2XO6A 5EWGA 2YV0X 4J37A 2CPDA 3LH2S 4FWKA 5BPLA 4K8ZA 5E3RA 4WKRA 1JLAB 2IMOA 3HKWA 4X4NA 8RUCA 5D0RA 2IAJB 5THWA 4KGMA 4CGGA 1AXQA 4K4YA 2ZHOA 4CI0B 1IKYB 2FXUA 3LALA 5B0AA 1NGAA 2I7PA 1NRKA 1D1UA 3H5SA 4MK8A 3G4SS 4K2JA 1HMVB 3N28A 2H5JB 2DY4A 4LF5F 2PFUA 4GVMA 3TJAA 1QUPA 1IJJA 3B8HA 1FDAA 4ZKAA 1MNEA 4F9OA 4F04B 3J80O 1DBDA 4DV6J 5GVQA 4BG8A 4CHPA 1C0UA 4RW6A 2MJUA 4HT5A 3UNGC 3LZJA 1J54A 3VVTA 1FK9A 3DLRA 4HACB 1S9EB 1V6HA 1C4AA 4M7XA 3T1HF 5F9NA 3CETA 2DY1A 3H20A 3CF5Q 3BGOP 4ZIWA 5CZ1A 1KXPA 1AYEA 4H5NA 3SAGA 5D3GB 4JUZA 4DUZK 4F02A 1YAGA 4GVBA 4NMXA 3U1NA 4WXWA 5K20B 4G3IA 2PT0A 4OJGA 3HM9A 2G8HA 1NHKL 2G8VA 3POTB 1IKVA 4ED2A 3C7NB 4JEPA 3NEKA 5HL7Q 1X9MA 2JDJA 3OJSA 2GVDB 4CYUA 4JI6J 2ZOGA 1RBSA 2RHKA 1DTTB 4Y0WA 2AIRB 2QL9B 1YGYA 4CQ1A 1WEYA 3BGLA 5EN1A 1DARA 1QAYA 4H0YB 3I32A 4JI3K 4NOHA 4IKFA 4I68A 2KO1A 4ERDA 4UZCA 5KFUA 1CSJA 2FZKB 3A12A 2DGXA 2Q6BA 1U1PA 1EWRA 4A2AA 5J2NB 1J9AA 3DDNA 4KGXB 2A1RA 4IJAA 3D2FA 4GMKA 1EWQA 4JYAF 3PY8A 2EC2A 4ZDNA 1VK0A 4EBEA 2DH7A 1M1HA 2JGUA 2P5VA 1CJKB 4RUBA 5D6GA 5HRRA 3CJ3A 1YJWN 4K4UA 1RT3B 4KO0A 1NK7A 1RWNB 2GJIA 3H1VX 2ZQBA 4CO2A 4JKAA 3C3LA 4IYQA 2I0XA 1G99A 3PW4A 2Z1JA 2QWOA 1SB6A 5LMNK 1CC8A 2Z56B 4ISFA 4IOXA 2VH7A 4H0OA 1X9WA 3AO1A 2R7TA 4YFUA 2HWTA 3QRQA 5DK5A 2A5XA 2YHWA 4GKJF 5DZ6A 1LWFA 2HGNA 2CVIA 2YQ0A 1VFJA 3MEGA 2RU3A 4WBFA 2FF6A 5M1NA 3DLGB 4B9UA 2QC3A 3PZPA 5T14A 4KREA 1VRTB 4IOCL 2EBEA 4DR6F 3ZT0A 1UL3A 2AP1A 1T7PA 2PY5A 2IJNA 3TRGA 2H4YB 1UEUA 4A8YA 1YIJS 3VGUA 5DETA 3MMBA 5IWAF 3SMSA 4DU4A 1Z1ZA 2CH5A 4IO9Q 3ULDA 1KTQA 3DKDA 4LF1A 4DPTA 2HHTA 3KWIA 4PZVA 1AW0A 5M1FA 4H5VA 2KT5A 3PX4A 3FZ2A 4USHA 1VQMS 1AFJA 2BUPA 3UVJA 2CQ2A 4DV0J 1Q1KA 2JWKA 4FM0A 3CD7A 2KQ2A 1FRLA 3T1YK 3C66A 1S9GB 3SFGA 3RVCA 2HNDA 3HO1A 3UNYA 3WQPA 3SAFA 3R7SB 4K0KF 5DS7A 4CF0A 2Y8YA 2UVVA 5D77A 1HR0F 1XN9A 1RT2B 2XZWA 1GXTA 3CJRA 3Q8VA 4DQRA 4Y65A 2FLPA 1QAXA 2M5YA 2ROEA 4DL3A 3WXMB 4RNMA 2B6AA 1ROFA 2YNGA 3G82B 4FDFA 3I0SB 2HWIA 3K59A 4CBWA 3NOCA 1K8KA 5KFDA 4ANEA 5ETKA 4WYBA 2N7CA 3TA2A 2VHGA 3DN9A 5M1KA 1CZAN 2YNIB 3MN6A 3KVGA 3G96A 1F3VA 1NEEA 3CGIA 1RHKB 3U02A 2D0BA 1KLMA 4C9DA 2JJ4D 2YH1A 3E2EA 4FOEA 2I38A 4M63A 2V8DA 1FX2A 3L3CA 3SSQA 1OPZA 1VQOS 3BEGB 3MI7X 3J7YP 3LF0A 3TAMB 2QFIA 2VFVA 5U47A 3BBBA 2CXEA 2F63A 2VWKA 1FTRA 2GUPA 1VBZA 1X4GA 1CPZA 5KQDA 2OFGX 2ROGA 4LR9A 2P9LA 2VDIA 2UUWA 1X4AA 4FXWA 3AAPA 1Z2LA 4F3MA 2HGLA 2V4QA 4F4ZA 2HBQB 3WXJA 3MD3A 4HUEA 3CJ8A 2W24A 1C1AA 3OLAA 4KV8A 3FK4A 2WONA 3I55S 3AVFA 4BRCA 4LBHA 1FNOA 2HHVA 4E7KA 5DDPC 4LF5K 2ADCA 3I33A 3R1HA 3M30B 3BJYA 1TUUA 4CZCA 2CA9A 3VGLA 2BE7D 1UAWA 2Q79A 1OH8A 4CZIA 4AHCA 4MFBB 3CDUA 4JBCA 3CW2C 2BBEA 3TI0A 2PMWA 4E7LA 4BRPA 1LWXA 2YPZA 1RNHA 3PM9A 1HLUA 2W2MP 1WELA 3T1HK 2B9WA 1X9SA 1HL6A 1ZXOA 3PX0A 2CZ4A 2OA8A 3LM9A 3QINA 2Q0RA 1ZM9A 3MF5A 4CF8A 2DNLA 3AA2A 3DLLL 4KHRA 5E5NA 3FBEA 4USIA 5F8NA 5L1LA 1CC7A 2HBZB 2H51B 1VJWA 5C2GA 3TJ8A 1KHVA 3CC4S 3CQ8A 3HBTA 1B4SA 1T3OA 3A5NC 2OTLS 1WF0A 3VQQA 1VYAA 2FHKA 2DR7A 1CXQA 3J7AN 2HSTA 1RT6B 5ETVA 3DXSX 4CF9A 1VGYA 1DZ5A 4BR0A 3F9KA 2HBJA 4CDIA 2OPQB 1IBMJ 5FIIA 3MUTP 2XULA 1RKJA 2OZMA 1HARA 2VPWB 2VCPA 2QLBB 1HIYA 1W2IA 3NAIA 1HNVA 2O8EA 3VA0A 4AXJA 4OLOA 3RGIA 1ASUA 2R3VA 3ULHA 4HYKA 4FWMA 2KN4A 4X66F 4ECYA 2L08A 3ZZPA 2CJYB 1GLBG 5CXTA 3RMDA 2AJ2A 2BKOA 4OX7A 5A76A 1Q81T 4OHWA 3L2UA 2M7SA 2FC9A 4QYZJ 3TUJC 3S7RA 2MKKA 3CPWM 1C0UB 4JRPA 4RW6B 3V2UC 3J80Y 1RFQA 1WC3A 3TUPA 2Q1LA 4HUGA 3D3BJ 1RBLA 3TSUA 2J76E 3ZSQA 1IWGA 3MOZA 4EEYA 2HVHA 4GKJK 2HHHJ 3O9QA 3SCKE 3NF6A 1VQPN 4FJLA 4Q0BB 4XH5A 3R5DA 4ZITA 1WC5A 3PYFA 4X62F 3QICA 1K0VA 3PYGA 3UI3A 1EQMA 4OJ1A 4URSA 1R8BA 4K4XA 3VAHA 1F2HA 1JKHA 3LDQA 3KMSA 2H5EA 5CE3A 1EHWA 1TZ0A 2IJRA 3GE9A 3FQKA 4FM2A 3QATA 1VHIA 4CYUB 1HNWF 2X51A 1E4GT 1A5XA 1MW7A 4DR6K 2GIQA 3VERA 4CT9A 2FYXA 2E20A 4S0MA 2CJ9A 3Q86A 1TAUA 3UE5A 1SCJB 1HUXA 5IWAK 3AD9C 3EZUA 4TY9A 3NAHA 3EZ5A 3BGRA 3I31A 5KG4A 2MZTA 4C8MA 4FWOA 4ES2A 2AJQA 1U2VB 5EGYA 4ELTA 4B9NA 1QUVA 3HHKA 2DISA 1IG9A 3TAFA 3KNAA 1BQNA 1OYDA 4CLZA 1LW0B 4DR2F 1NJWA 3OHRA 2NQPA 1IR2A 3KIOA 1N36J 3IRXB 1WSVA 3V9UA 4K0KK 1XMQJ 3S3OA 2NRZA 1GLLO 1HR0K 5J1EB 1T95A 3THWA 2AYBA 1XMOJ 2YKMB 3MPVA 4WE1B 1U8SA 1WKJA 1FJGJ 4PKDB 4ECTA 2R2UA 4B1VA 1F9EB 5HBMA 4R8UA 1Q86T 2HFUA 4MIWA 4GV9A 2G2OA 1YBAA 3ZYYX 1OY8A 4BRGA 1WLJA 4ZCKA 3W5ZA 4DR4J 1BHNA 2O8CA 1TTHB 3NHGA 1VQ7N 2XMAA 3OJUA 1TU0B 3R1LA 3BV8A 2IC3A 3TABA 1VQ8S 3LW5C 3HZEA 2GTDA 1EX4A 1S72S 4TU7A 4OHZA 3QIPB 2B4UA 2NXNA 1NGDA 1AROP 3A8KA 3PIOQ 4Y1DA 1ZAWA 1RHQB 4IRKA 4RPFA 1HQEA 3TSQA 2P9EA 3MEDA 4HKQA 2HHPA 5DQGA 4K7QA 3H3OB 3CD6N 1NGEA 3R2DJ 2PBDA 3R97A 1S22A 3R7BB 1NGGA 4J9PA 4J7CA 1R8CA 4BDZA 1CJVB 2HMIA 4PPZA 3R5JB 2CQDA 1M5OC 2NLXA 4YOUA 4CGIA 3IS9A 1RDRA 1OQ6A 4NASA 4K25A 3L7OA 2K3IA 5M1PA 4B3TF 2HPUA 2GVZA 5DMRA 4H54A 4Z4IA 4JK7A 1RSCA 2RPIA 3QNWB 3WIVA 2JFKA 4DFJA 5GIPA 2MYFA 1UA1A 1X8DA 4P52A 4KGKA 2AYEA 3T19A 3SUOA 2B6AB 4LRFA 1WOPA 4CH0S 4OI0A 2YNGB 3LANA 1UEKA 5GMKa 3GG4A 2E1PA 1VLOA 3DI6A 3OR1A 1C1BA 4K41A 3QMQA 1WSGA 4FW1A 1NK9A 3PHTA 3FMBA 3CO9A 1M1KT 3CXCR 1OSCA 4I0WA 4J5OA 4YDUA 3KTQA 2WBMA 1KLMB 4CFAA 1SL0A 3MAQA 2UVWA 2Y8WA 2ZNZA 3ZZTA 1OH6A 1BQMA 4JV1A 3D67A 5AQKA 4F8RA 4AH9A 4XH1A 1S4EA 1VQ4N 3JQKA 4LUBA 3OR2B 3SCLE 2VJUA 4DQ8A 3BYPA 2CPXA 4NLOA 4E8UA 3C15A 4DPUA 4LF9J 2CIMA 4OYPA 3LPEA 4IO1A 2P9LB 2QMUB 1LWEA 3KHYA 1O1WA 5I42A 1M5SA 1YWXA 1R0AA 5HMXA 4ITSA 4RW9A 2JWNA 3L2RA 4KV8B 4ZOSA 3I5BA 2WONB 1E6VA 3PR4A 2PO4A 2ATCB 3J8AA 3KZBA 5KRTA 4PYAA 3B6BA 4EHTA 4X66K 2YNFA 1WUAA 1H72C 2F7VA 3OD2A 2HNYA 2AZ3A 3KLHB 2KT3A 2LU2A 5FRMA 1N4LA 3P5TL 4QIWD 2BZ2A 3PJXA 3NL0A 4LH4A 3IDHA 3FGVA 1CLFA 4AYBD 1ATNA 2HZCA 3V6JA 3DLJA 3EUNA 4ZVQB 3OL9A 4DSJA 4ETXA 3GR0A 4Z7CA 2UXCJ 4CJSA 3DM2A 1S1TB 5GAHP 4Q5VA 2KL8A 5DM6Q 1T94A 2NYHA 4O3OA 3OYJA 4E3SA 4ZTFA 4X62K 2IGIA 3AARA 3T9ZA 2KJWA 2GA7A 3T6JA 4JK8A 3ZSXA 1TKTA 3UE2A 5KFQA 2VONA 3HI9A 1G7CB 1S99A 4MK7A 3ZSOA 2VZ9A 4C2MA 1HNWK 1BIZA 3EE3A 4DV3F 3CWJA 3PV8A 3NY0A 4BR4A 3RMAA 4C8YA 1OO0B 3VETA 3M2UA 3C19A 1V3SA 3JSMA 3KLEB 1H2VZ 3OBYA 2HBYB 2MPUA 4U7UK 4MDAA 1QSYA 4MTPA 3ZT2A 3CJKA 3OSNA 1C2PA 1HKGA 1MWQA 4MIBA 3CI5A 5H1SV 3CCLS 2H4WB 3OTOF 3C2PA 4Z4GA 3G0ZA 1GLEG 3MGJA 1Z26A 4DR2K 4QIVA 4N5SA 2N7YA 4DX7A 4P72A 3THXB 5E26A 4X2BA 3W3SA 4XK8C 4IRDA 1D3WA 2D9OA 1TL3A 4HI1A 4FN5A 4MKYA 2DO0A 5GAGI 1R43A 3DCAA 4IFVA 1GT8A 1BXNA 4O55A 2BXJA 1M90O 3N4WA 3WXIA 2CJAA 5SUHA 4YS2A 5GADU 4DR1F 4DCJB 3CVKA 4KRFA 5LSLA 3J7YU 3BQ0A 3W3DA 3TZYA 4Z4CA 3U6FA 3BKUA 3MR7A 1S48A 3AGRA 3ILLA 2HBMA 4W90B 5CZXA 3TJ9A 1ZA1B 1ACMB 3IN5A 2N3LA 4XIUA 2MQLA 3VV2B 2O4IA 4IOBA 4M3WA 4KH5A 4WK1A 4IDHA 1FO1A 4CRJA 5KOXA 4ZTJA 2IFXA 4B3MF 2HFSA 4OYBA 2OGUA 2CPJA 1YJ9N 3BGRB 1S5JA 3O3HA 2W7OA 4IZ9A 1LW2A 1FXRA 4NYNA 4CLPA 3MM9A 3AA9A 3EWGA 2FC8A 3LPUA 1CXUA 4DG1A 3ATVA 2GZOA 4JKDA 4DEZA 2Y9HA 4FYYB 4QAGA 5BYRA 4DTNA 5EXWA 4DF4A 2HAFA 5AQRA 5H9FK 3OL7A 1ATRA 2F8EX 2CRLA 4B3TK 3B78A 5CR4A 5DG7A 2YWHA 3THWB 2UUCJ 2R7WA 2D0OA 1RK8A 2RUSA 2G8KA 2Z4PA 4CK2A 4B9QA 5CD4A 2B7BB 2VPXB 3K2PA 4ATNA 2A1BA 3D1OA 3QMLA 3BQ1A 3SJHA 4WFBQ 3PNIA 5HBMB 4R8UB 1HBMA 4UUXA 3MWTA 4CLTA 1KN6A 3JSRA 2OMOA 3AVCA 1S4FA 1W0HA 4OO1J 2AJ1A 3E1YA 2MGZA 4U6PA 2G2ZA 4KHNA 2O8CB 1KAXA 2RS8A 2NRTA 4XPEA 4QR1A 4IOAL 2G9OA 3AVLA 4DV2F 1G1XA 5M2UA 1BCMA 3CHWA 2YPYA 4MO5A 4Z37A 2CQ0A 2E44A 4UT4A 4JI8J 4QPTA 1CQNA 2K8GA 4ECXA 4XAKA 5BN9A 2VIHA 3N79A 4RCHA 3CCMN 5ETPA 1HQEB 4CLSA 4DR3K 1SJRA 2HIYA 2HVIA 2DBBA 3WZ0A 4GC7A 4UOHA 2ASOA 2Z30B 3OYKA 4USVA 4G65A 1Q8IA 1J53A 4B17A 3QETA 3OYGA 4L75A 3F73A 3AO4A 1VK8A 4ZPWR 2HMIB 1HI0P 1RLCL 1TUYA 1Y00A 3GYXB 2BJ8A 3OXLA 4DR5J 5F8IA 1T05A 2R8GA 1W9HA 3KXDA 3V1QA 1ELOA 1WACA 2FJAB 4BCAA 1PYTA 2UXDF 2AF6A 3LA0A 4I7FA 3TTFA 2PZSA 5HQ8A 1NGFA 3WUHA 3I8BA 4H5WA 3LDNA 3AXMA 4DF8A 3DI6B 3HL8A 4X64J 3MPDA 1UFWA 3PYDA 1SC6A 2G8FA 2GJ2A 4DSIA 4C3LA 1U6BA 2NZCA 4Z94A 2E5IA 2ZDPA 3TEGA 2DGTA 5ETNA 3M9OB 1M5KC 3MPUB 3NGYA 3DOLA 4HR2A 3HM8A 2P9GA 3GIMA 4JV2A 4DV3K 1BQMB 3HLUA 2FBTA 4WF9Q 1WI8A 3ISNC 4O3NA 1SKUB 4K43A 4QWCA 3QT8A 4I9QA 4HTIA 4K4WA 1FE0A 2W4PA 2RVJA 4ZIVA 3JYTB 3KDNA 2XQCA 5CYMA 3B6OA 3SI6A 4Z0UA 4JI2F 3OTOK 2P9SA 4J9LA 3K2YA 5G4DA 4RW9B 1HPMA 4FNIA 4P2FA 2FBVA 3TVYA 1FJEB 2FPHX 1VHFA 5L9XA 2JRSA 2BMBA 4NRTA 4TQRA 2YNFB 3KHLA 4MQ3A 2HNYB 4IJNA 1NHVA 1YZ6A 3CCRS 2EW9A 1X31C 3R6LB 3UO0A 1WG4A 4U67Q 3KJNB 3TZWA 4DL2A 3AVIA 1HPZA 1KWMA 5L39A 2BH1A 3HSCA 2PI4A 1QTNB 3HSJA 1Q7YO 2DFFA 3OBIA 1UKUA 3JAMO 3V4IA 1PCAA 2VB6A 4J9KA 1OH5A 4DR1K 3QRRA 1R6VA 1W2BM 2HNZB 5BR8F 2E2OA 2HQ3A 4DJBA 3G6EN 3GFXA 3EGWB 1NDKA 3RTVA 4NXMF 1YK9A 1ZAVA 3CCES 1XJWB 2R8IA 4C11A 5ETLA 1TKTB 3RUBL 4Y34A 1YI2S 2WK4A 5A2QO 1G4CA 2H48B 3VQEA 3D7EO 5CA5A 3EM1A 3TYTA 1U6ZA 2HK2A 3M2UB 3V6DA 1SS6A 5KFKA 4B3MK 3NKYA 3DYAB 2ZGZA 3QJLA 4CHNA 3J7A1 2RE2A 2D0CA 3CJKB 1V4SA 4FVMA 2P5GA 1TKDA 1E3MA 2QI2A 3BF1A 1WEXA 3GSDA 1RYSA 2RMLA 3IR5B 2DHSA 4HEA9 3AVNA 3THYA 3VQ9A 2IM2A 4JS5A 2VQFF 4OLAA 2C3MA 4TN2A 4AQYF 2J5AA 4X4TA 2V8VA 1BU6O 3H25A 2P6SA 1OH7A 1S12A 3CCSN 5HAOA 2J9EA 3D9BA 5F1XA 2CH6A 2OTJN 1VHXA 1B9FA 3G4SN 2J0XA 4OZ5A 1YLXA 3QGGA 4FZYA 3NGDA 2HOEA 1QHAA 5IT9Y 4MYTA 2FBXA 1BGXT 2Q31A 1VQYA 1LQ9A 4YB1P 1BCOA 4ICLB 2HZAA 2XI2A 3W5XA 1NM1A 2QWRA 1RT5A 2B5JA 3BDEA 3AVJA 4J8FA 5F8HA 4C8LA 2IBKA 1S6QA 2DB1A 1WC6A 3D6FB 3L3VA 1U8WA 2O01C 4MK9A 3QJJA 1L3KA 1JJ2M 2E1ZA 4DV2K 1RILA 2XSFA 4PWUA 4FWRA 2ZBPA 1FKPA 3IP0A 4CJRA 1YG0A 3GZ7A 3MCNA 1VRUB 3SSSA 2E4LA 3WQTA 1J5EJ 1ZBTA 4DV5J 1S7IA 4OL8A 3M2VB 2OI2A 1TAQA 2I6WA 3KKSA 2G0CA 4FXDA 2Z2MA 4LF8J 1LW2B 4JI5J 1A9NB 2J8AA 2ZNYA 2IDLA 3MM5A 4A8FA 1VBKA 1PBAA 4DG1B 5LXYA 2RU9A 4XO0A 3AD8C 4YOYA 2ZJPL 4JI7F 3NLCA 4M3TA 1TKXB 1VJQA 2KDOA 1HQ2A 2V2VA 3DGPA 1ATSA 3OYMA 2R7VA 4ZJQA 4KAIA 1S9FA 4FLTA 3ZZZA 3KK1A 4PEOA 4WFNQ 5GAHU 2UXDK 4FJJA 3F2KA 2XGPA 2HFOA 2OPPA 2FJBB 3BN4A 3O44A 1FDBA 2B9XA 3TZXA 3OTEA 1HBMB 4ZLPA 3OHBA 5HMWA 1CLQA 2J9DE 1Y3JA 4OI1A 1HNIA 4WWSA 1H7XA 5CY4A 2UVUA 3K8VA 1RADB 3R5GA 4OPJA 3RJMB 3NCRA 2DNZA 4FYVB 3VPZA 3W64A 1R6YA 4ER8A 3MX2A 2YCHA 5J2MA 2VKZG 3AJ2A 1CBKA 3GR1A 1UTAA 4DX6A 4B9SA 2WW4A 1FD8A 3NWRA 2F1FA 1XBWA 1V4TA 3H5UA 2B4VA 3V9WA 4D3GA 1YJWS 2YHAA 3RSEB 4JI2K 1C0TA 2A0FB 3V6KA 4DR7J 2ITGA 3EZOA 3X3UA 1TL5A 4FBUA 2PEBA 3QEIA 3RB6A 4M5NA 2OD4A 1YIJN 3BZKA 1M5VC 4YY3J 4IFYA 4NLQA 3PXGa 1T6DA 4GKKF 3VMFB 3HMJG 4CZEA 4RW7B 3ZETA 3RMBA 4Y0FA 4E7HA 3CJAA 1RHMB 1U1OA 1VQMN 3QERA 5CYQA 1A0OB 2CPHA 2BKNA 4B1ZA 1VI7A 1F3FA 2LQ5A 2L3MA 5HROA 1JCFA 3GMGA 4ZMMA 1HBNB 3HZ6A 2AGQA 3NBPA 1DLOA 2MLZA 3OYEA 4I7FB 2XLJA 2IVNA 1ZETA 1PJ6A 4TU9A 1MA9B 3FZKA 1HKAA 2V50A 1XNRJ 3KKFA 4KH0B 1RQ0A 2R8HA 5BR8K 3R27A 3VCDA 4DUYJ 3VZIA 3OFEA 3TU5A 4GMJB 4NXMK 3PUFA 2LSNA 3AOBA 2P2CB 2LXIA 7AT1B 1ZOTA 3N9UC 4LSLB 2BVZA 4ZP8A 2IA0A 3DOLB 2AYGA 2G8WA 2CQBA 3Q8QB 4FVUA 4CO5A 1OIAA 5AQIA 2NCKL 3MECB 3CCTA 4CZMA 3VAMA 2CQPA 3FZFA 4NPOA 2LA6A 4DTJA 3N4QA 1HYSA 3KLIA 3CUNA 4EWTA 5JMVA 3CJCA 2YWKA 1FI4A 2APOA 2VQEF 2BJ3A 2DH9A 2XMKA 2W9AA 1VQLN 3TARA 3ZXWA 3J81O 1SUQB 4NI2A 2VQFK 5HANA 3GIIA 2DT9A 4NZ7A 2V9WA 5CZVA 4AQYK 2NZTA 3T5HA 3BY5A 3P4UB 3DXBA 3KK2B 4PG4A 1QQOA 3WNEA 5AQWA 1WAFA 3EGVA 2ZBRA 4P75A 1WAJA 4LF6F 2QX0A 4C4WA 4FF4A 2KXHA 1IBLJ 1JJHA 4CHYA 3QFHA 1HPZB 4JI1F 2EK1A 2ILZA 1QY7A 4CJFA 3BYRA 5D0HA 2PFDA 5EWFA 3C16A 2RKIA 4CCHA 3V4IB 1TL1B 1MWYA 5LMUF 5G0RA 3CJ4A 2CDRB 3VALA 3ET6A 2YKNA 4N47A 3MMVA 4HT7A 2HHUA 5AJ3F 4U7UD 2CQ4A 5C24B 2QLFB 4PQAA 5AQNA 2CKWA 2BJDA 2YWEA 5FROA 1URRA 2AX0A 1C0MA 2HVEA 4C1NI 4KHWA 5IT0A 2PGCA 3DDKA 3V6DB 2UU9F 2V2KA 2YJEA 3CC4N 1NOYA 3OUYA 1ICEB 2Z2ZA 1N48A 3L0QA 1JCEA 2YVSA 4H4KC 5F41A 3SFUA 2KM8C 2XLIA 1KVJA 1CJUA 2X3DA 5AE2A 3FEXB 5J2QA 4JI7K 4IOAQ 2FSJA 4DTRA 5C15A 4HHUA 3VF6A 1TYQB 3B54A 2CJKA 4F36A 3K58A 4C7QA 4BREA 1T9YA 1IR0A 2O66A 4F3OA 1WF1A 3RAXA 1K8AO 5MLCV 4KT0C 3NMRA 2YNHB 2BQRA 4KI6A 3FBBA 2QMWA 2EWSA 1GFWB 4NLCA 1TK0A 1TL4A 3MM7B 2DGOA 2KHOA 2B5JB 5KFXA 4IG0B 2EXUA 4ENOA 3IUCA 3OYBA 4KTQA 3H45C 1S6QB 4FWLA 4IG3A 3EKSA 4BWJA 2LQBA 5C2DA 4DUTA 3CMEN 4BS2A 2MTLA 4Z4EA 4ED0A 2D5RA 3K5MA 1OY9A 4DCPB 5A8RA 2OSRA 5AQJA 4O4GA 2BRKA 1U09A 3OSPA 4MDBA 3ELHA 5KFJA 2NRHA 1BUPA 1RB0A 5LY3A 2V7YA 1UZHA 2XMJA 2ERRA 4RU2A 1KVAA 2HKEA 1PIEA 3NS6A 1NHUA 1NSKL 1QAIA 3Q8PB 3LP1A 4LFAJ 2MKHA 3ETMA 3R7NB 5JS2A 3LL3A 1RGIA 4EFAC 1B3TA 4ECRA 3PIPL 2MLYA 3MM5B 1KLNA 4RNNA 1H3DA 2M4MA 2NNWA 2C2EA 2EPIA 4PAAA 5KFOA 4GKKK 1ZPWX 5C42B 2MXYA 4DXLA 5K8OA 3L7UA 4WIIA 1IKXA 3IM9A 3DXMA 2CNNB 3ZZ0A 2AEMA 4X4OA 5RUBA 2IPOB 3D6HB 4FJMA 3VTHA 2XGQA 2VG6A 1QM9A 3CQXA 4DV6F 3LM2A 3TW0A 4X4VA 3VENA 1LFPA 3Q8RB 4FZXC 1D8YA 5BYQA 4IO8A 2KYXA 3WHIA 5FRNA 1OVYA 2XNQA 3EXYA 5KOWA 3IWXA 2DGWA 3K9JA 5L46A 1JMTA 1ZAXA 4CK3A 5AQUA 6FDRA 5JVHL 3H8YA 3BR8A 3OW2R 2M2BA 5KFVA 4K4SA 2KI2A 4LF2A 1SXLA 5DGAA 2AD9A 3E01A 1HX1A 2Z1GA 1JXVA 2BW7A 5J1NA 3QYYA 3ILOA 4DSFA 3LP3A 4U96A 3L4QA 3OVSA 5J2MB 2V9KA 1RBAA 2IDEA 3BZQA 2PSZA 2DNMA 3D2EA 4R5PA 4KE5A 4L3KA 3HSTB 2X1BA 1B0TA 4JI6F 3CPEA 3NGRA 1VQ8N 2ZJQQ 4Q44A 1DURA 1NSPA 5DDRC 5AFUA 3D6TB 3NFAA 2XY7A 2V5HG 2H1YA 1SJQA 2DTJA 2WSCC 1C0TB 4JV0A 1YVNA 2VQEK 4WP9A 3PR5B 2FBYA 2XO7A 1X4FA 2BJ1A 2UZAA 3SDEA 1N33J 2DNQA 1M90T 3CJQA 1GLJO 2A1SA 1SJFA 1RT7B 1WOQA 3PKMA 1DQAA 3ENWA 1KQKA 1KC8T 2I8EA 2RDDA 4KHMA 3CMQA 4IH5A 4JD2A 4LF6K 4Q8FA 4X4UA 2P9PA 3W9HA 2GGPA 1KQFB 4JI1K 5HROB 2BYCA 2W40A 1VQ7S 4NLBA 4L73A 4K8XA 1DLOB 4NZ0A 4NE9C 1B92A 3X1LB 1E6YA 8AT1B 2I2YA 4IQMA 4YR3A 3TX8A 3DGVA 3LDPA 1CS4A 4C3KA 5LMUK 1RWKB 1S77D 3GG1A 2KZZA 2HYIB 2FY8A 2NREA 5AQFA 4C23A 2M9KA 5F0XA 4AHVA 5AE3A 5C10A 1D9DA 2F8HA 5E33A 1UJ4A 5AJ3K 1QSSA 4O8KA 2MB0B 3WXKA 1NZ8A 3G6YA 2RS2A 1KKHA 2BJEA 3AVMA 1KQSR 1EKRA 2ZKTA 4WFAQ 1M1GA 1HHSA 2QMXA 5KFHA 3SAHA 4DX8H 1RTHA 1KD1O 4FJKA 1FW6A 2O3DA 2VG7A 1U2CA 3T41A 3UIQA 1PC5A 4WU2A 2UU9K 2WRMA 2FJVA 5AZJB 4YDDB 3EVWA 2I5JA 1JXBA 2BQUA 4FWPA 2CPYA 3VQDA 4NLXA 2NUBA 2UV8A 3LWLA 4BE1A 5D8HB 3NGIA 4MAKA 3QIDA 1MMNA 2JVRA 4JKEA 5L8RC 2WOMA 4YDXA 1JLEA 2KTQA 5KFBA 2OH2A 4FL9A 1EZZB 3CYMA 3AB4B 3CF5L 2W9BA 2BUNA 3NDKA 2ZF5O 2MMYA 3DLEA 1K1QA 3L6QA 5DZ7A 4DV0F 4WPAA 1IM6A 1U4BA 2H3EB 2MJNA 4I2PB 3OYHA 4DU7A 1TL7A 2VASA 2ATQA 1T9TA 1EXQA 1KSPA 2WTUA 4H4OB 1VSKA 4Y2IA 1JJCB 2ZC4A 5HL7L 3U1LA 5H9EJ 1W26A 2V8GA 2ABYA 2QA2A 3D1HA 4ED6A 3ITHB 2RD5C 2O8FA 1D8ZA 8ATCB 4KB1A 4YDUC 4NLWA 4ID5A 2F96A 2CQ1A 5IZHA 3SBGA 1WSRA 2VU5A 2HIQA 2B56A 3O6QA 3BO4A 3KK7A 3C16B 4I4BA 3I56S 4A59A 3MFIA 1UVLA 3AVBA 2R9LA 1Y5IB 5F8JA 2HG4A 4NCGA 1Q53A 2NRXA 3A1YG 1WSHA 2YKNB 2CPEA 1VQ4S 3MMAA 5E0OA 4AXIA 3R3TA 4L72B 4MKBA 1ZBUA 3KG4A 2OD6A 2NRVA 1ZS6A 1NJYA 1SH2A 5CZ2A 1RWPB 2DR9A 1U0HB 5T7BA 2EG2A 2ZH4A 2IM1A 3EDRB 2VF3A 5AXNA 4L8RB 3TEHB 4UOGA 1NUEA 4NLSA 1N34J 2CGLA 3NS5A 5E3PA 2KKZA 4B1XB 3QNNA 3MN9A 4USMA 3TTCA 3HHLD 2L48A 1WB9A 1LWCA 1RT4A 5HK4A 4FVCA 3N0VA 5GAGP 2Q36A 3U9ZA 2Q6CA 4WCEQ 3ULEB 1FE4A 1CULA 4JOUA 2FVQA 2GUIA 4JKGB 4PKIA 4WK3A 1P27B 5BXIA 3PRBA 1YBUA 2MZJA 1O13A 3WX8A 1W7AA 1FVSA 1F5CA 4IEIA 1OQ3A 3HOSA 3QLHA 2C2NA 2AT1B 4DV6K 3TVKA 3AQPA 5JLHA 1JJ4A 4DI6A 1A6LA 3OVAA 2XCAA 2M3DA 5HRNA 4AE5A 3HD2A 4MO4A 3O9RA 1VQ5S 3TA0A 4H5TA 1B7YB 1S79A 2CVEA 4DS5A 4M5DA 1QVFR 4H0PA 1WKKA 3OYAA 3PTWA 4OI2A 1X7VA 3CJ0A 5JLFA 1RBTA 4HCCA 1CZ9A 1EB0A 5A8RB 4KHSA 1WHXA 3VQCA 2PIIA 1Q5VA 1WSIA