1RT7A

Hiv-1 reverse transcriptase complexed with uc84
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
536
structure length
535
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptase in complex with carboxanilide derivatives.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 139
structure length 535
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt7A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt7A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt7A05
4CGFA 3SUQA 3VQDA 4DQIA 1GOAA 1HQEB 3C6UA 2ITGA 3VQ5A 4TXSA 4NRUA 3JYTA 3OHAA 1F21A 2W42A 3T3FA 2ZQBA 4WFYA 4PA1A 2FVRA 1N6QB 5DQIA 4CIEA 3G6VA 3D28A 1KSPA 3QINA 4IH5A 4K4TA 2ILZA 4CERA 4DL7A 4DLEA 5FROA 1J5OA 1S10A 2BDPA 1IKVA 4KREA 5DMRA 3KD5E 4Z4FA 1JLQA 3T1AA 4G1QA 2GUIA 4KHRA 4RNNA 3LAMA 4Y2AA 4IDKA 2YKMB 3M9OB 1RTHB 4NYZA 4O0IA 4J2DA 2ASDA 2R8JA 3GV8B 3QEWA 5KG7A 5FDLB 3BQ1A 2HHTA 4W5NA 1NK5A 2E9TA 1FKPB 3VA0A 1KLNA 3AVMA 1C0MA 3AA4A 4O3NA 4FW1A 1JL2A 4WE1A 5HBMB 2P5OA 2IAJB 1KLMA 1D0EA 4CJLA 4Z4IA 1RTDB 4FJ7A 4CJTA 4IG0A 4MFBB 1VSFA 4M3TA 3HYFA 1RT3A 3PJWA 2HW3A 4F50A 4AHVA 4CEFA 1VRUA 1T05A 1WSJA 4JRQA 5CZ1A 3NGIA 3MF5A 3N6LA 3HVAA 4IR1A 3CVKA 2VG6A 3QZ7A 4M3WA 3U3GA 1NKCA 1S1UA 3RAQA 1HPZA 2FVCA 4FJ9A 4N5SA 1RA6A 3AVFA 1UWBA 4MKAA 3UPFA 3CFRA 4K4SA 3GYNA 3DRRB 2HHSA 3CJ3A 1TP7A 1WSFA 4B8CA 4F4WA 3KK1B 3H4DA 4HHTA 4B08A 1LW2A 3N6NA 3MEGA 3D0PA 3V9XA 4DSJA 3CDUA 4EBEA 3C6UB 4ZTJA 4IFVA 3OVNA 3H4BA 2XO7A 4K8XA 4GMJB 3PJXA 3TARA 3PV8A 3M8QB 2AGPA 4OKEA 3OLBA 1KFSA 4NLQA 5C24B 1N5YB 2QXFA 3SV4A 1HARA 3CO9A 4N41A 4OPJA 3KMSA 5J2NB 4Q8EA 5KRTA 4NLXA 1WSGA 4NCAA 1HYSB 3D45A 3K5MA 2JEIA 3TANA 3DLGA 3KLGB 4K4XA 1QUVA 3PO5A 1FK9A 3DRPA 2XRIA 3DRSA 3AVIA 3NL0A 3G86A 5KG0A 5KFSA 1S1VB 5CYMB 3F9KA 4ZP6A 1NHUA 1XHZA 2XHBA 5C25A 2BGGA 1TVRB 4CJ4A 2FBVA 1RTDA 4NLDA 3LWMA 4R8UA 1BCOA 2VG7B 3TAEA 1JLQB 5E41A 3DMJB 5I42B 3V1RA 1EETB 3I0RB 2OPQA 2D3ZA 4BE1A 1SUQA 4J9OA 1JLFA 4RUCA 3RBEA 4PWDA 4O4GB 4URQU 1RNHA 1N6QA 2HNDA 3BSAA 1TKZB 4DG1A 4ECZA 1GX6A 4CJKA 1C1AA 3HP6A 1HQEA 1SH0A 4IOBA 5EWEA 3ZT4A 1ZYQA 4ECTA 3LPTA 3G0ZA 3QEPA 1RT1B 4KHYA 3HJFA 2UVWA 1RTHA 3KLEA 4XPCA 4IR9A 2I5JB 3VQ8A 3N6MA 4ICLB 2J6TA 1RILA 3MEDB 1T05B 4DU4A 3SUOA 3CFOA 4EO6A 4OL8A 2UVUA 4BDZA 3VQAA 4CESA 2YNHA 4TYAA 1KRPA 4TQSA 5KGWA 1Q9YA 4DF4A 4JUZA 4JRPA 4ECUA 3RBDA 1R0AA 3NDKA 2KZMA 2R2SA 4FM1A 3K5LA 2V0NA 3SQ2A 1TKTA 1ZTTA 2WB4A 2YKNA 3MECA 3V1QA 3NE6A 4NLGA 3ICLA 1RBSA 4AILC 1IKXB 1S1UB 1NOZA 3E01B 1ZBFA 1FK9B 4K50A 2BANB 3O3FA 2CKWA 3GIMA 4MKBA 1ZBHA 4PUOA 3MR5A 2BQRA 1S4FA 4WXWA 3QZ8A 1U47A 5KFFA 3VQSA 3QIPA 1UA0A 1JIHA 3O3HA 3SYZA 3PW7A 3BDPA 2FVPA 3AVKA 3PO4A 5F8GA 1RDAA 1T3NA 1XHXA 2BQ3A 1ASUA 4QOZB 3WNHA 2OPPB 3QYYA 4CJEA 1L3UA 3GIJA 5C24A 1N5YA 2IMWP 5KFVA 5KG3A 2OPSA 2HNYA 5KFJA 4MK8A 3ZSZA 4GC7A 3S9HA 2D0AA 2AJQA 4ECWA 1L3SA 3SI8A 1CZ9A 2RF2B 4DL4A 3HT3A 3V6HA 3AVHA 5KT3A 3OS0A 4OLAA 3TAQA 3UDLA 5CY4A 3FQKA 3PR4A 2F96A 1SL0A 1GOBA 3GILA 3L3VA 3HVRA 2D3UA 4B9NA 4CJ5A 2BR0A 4K4UA 4KB7A 3TAMB 3DLHA 5KFRA 5EWFA 4DSKA 3SFGA 4KHMA 4O3OA 2JEJA 4KTWA 2WONB 1HYZA 3S3MA 2D7SA 4MIAA 1WSEA 1C1BA 2XCAA 1A5XA 4H4OB 4FK4A 3GQCA 1S6PA 1RTJB 1ZBLA 4RG8A 3OL7A 1D8YA 3B6OA 4FJLA 3DRPB 3RR7A 4R8UB 3P83D 2IJFA 2UVVA 3SPZA 4Y1DA 4RW9B 3SUNA 3KLGA 4ZP8A 1HJRA 1RYSA 5L1KA 5J2PA 5T7BA 3LWLA 4MQ3A 4UQGA 3EZUA 4DTJA 3OJUA 3KD1E 3HL8A 4IFYA 4ELVA 2ASJA 1SUQB 4DS5A 1NK0A 1I3AA 4X2BA 1C0UA 5HROB 1YTUA 3I0SB 1K1QA 5KFQA 3VQ6A 3NF7A 4CIFA 1ASWA 5JS2A 5CYQA 3DM2A 4TQRA 1KVAA 3PX4A 5DG7A 1JLCB 4XPEA 3TR8A 2HNDB 4FS1A 5HRPA 3NAEA 3K57A 2I1RA 3MEEB 3V6DB 1W25A 4B9MA 4FLYA 4DEZA 3QIDA 4EZ9A 3KHHA 4JLHA 4FM2A 2Q3SA 3EYZA 2V9WA 1TKTB 3ZSQA 2W9CB 3OYLA 4KHNA 3KOAA 1WSIA 1JLBA 1TK5A 1S97A 4QW8A 4AH9A 2GC8A 5JUMA 2W9BA 2YHAA 2YNHB 1YVFA 2Z1GA 4J9KA 4ECYA 3OYDA 1QSSA 5KFEA 3LP1A 5KFBA 3OJSA 5KFPA 4WE1B 2JC1A 3OY9A 3E01A 1SKSA 2JEFA 3ISNC 3M8RA 3KHLA 2OH2A 3DMJA 1NJYA 3ITHA 4PUOB 4NZ0A 4CECA 3RMCA 4F8RA 3ZSXA 2YKNB 2HB5A 2VG5A 3M8PA 3RMDA 2X74A 2R8HA 3SQ0A 1L3TA 4FJKA 4YFUA 3QNOA 3U3YA 2DTUA 3MR6A 3OS1A 5C5JA 1JXLA 4QWCA 2E4LA 4Y2CA 1WAJA 2E6MA 4CGIA 2HNZB 2FC0A 2GIRA 3NH0A 4DF8A 1QS4A 4CFCA 2G8FA 1RDBA 4K4VA 1HNVA 4KHWA 2OZSA 3I5AA 4YNQA 4ID1A 3OL6A 1SKRA 1NK4A 3MEDA 4CF1A 1LW2B 1NK8A 4Z4GA 3ZT3A 2ZE2A 4ED7A 4DTMA 2XY6A 4CCHA 4NLYA 3KKRA 1U48A 1HMVA 3AA3A 1JLGA 4JV0A 1TL3A 1QAJA 1QE1A 2CJQA 1DTTA 2OPSB 4DU1A 3MECB 3PW5A 2WONA 4FW2A 3T5LA 5HLFA 1IKXA 1BI4B 4EBDA 4LSLB 1X1PA 4FM0A 3V4IA 2B5JA 3NKYA 4DWIA 2AWZA 4M41A 4C8OA 2PZSA 4RUAA 1C6VA 1TK8A 2JGUA 5KFKA 1S1VA 2HVHA 1S48A 4CK3A 5KT4A 5JS1A 3LP2B 2EX3A 3RR8A 4KHSA 1U4BA 4NCGA 1S49A 1NKEA 4R5PA 3TAPA 3KJVA 4NRTA 1U09A 1LWEA 2ATQA 2HHWA 3IG1A 1CXQA 4N76A 3NAHA 4FBUA 4BWJA 1LW0B 5J1EB 1C0UB 4Q8FA 3K59A 2DPJA 1NOYA 3L2QA 1RBVA 4FK2A 3NBPA 5KFXA 1FKPA 2J6UA 4L8RB 4W5OA 4I9QA 1IKVB 4KV8A 3KK2A 1S6QB 1L3VA 3OL8A 3V6JA 3EPIA 4ED8A 1LWFB 4Q5VA 3CJ4A 3PW4A 1EP4B 1SV5B 4DTOA 4C8MA 3TAMA 4J9MA 3RB0A 3Q8PB 4E0DA 2ALZA 1W9HA 3L2RA 1HNIB 2WRMA 2EC0A 1U49A 1ITGA 4CHPA 5DG8A 4FCYA 3PY8A 2IM3A 4DFKA 1JLCA 1I39A 1HMVB 4NYFA 2JLEA 4B9LA 4QWBA 3AO5A 3VQ9A 3IN5A 2RDJA 3RAXA 4IBNA 2R8KA 5K14B 4RW8A 1S1TB 4F4XA 1TL1A 2IJNA 4IRCA 1DTQB 4I2QB 2FLLA 5KI6A 1BQMB 4FJ8A 1UOCA 3P1GA 1VRTA 1Q8IA 4IH7A 3DRRA 1RYRA 5KGXA 3H2LA 5HRNA 4FJ5A 1FKOB 4CGHA 3SZ2A 2AQ4A 4KFBB 1EKEA 5DK5A 3BQ0A 2JEGA 4CK1A 3SUPA 5HP1B 1S9EA 1VSLA 1D9FA 3RRGA 4J9LA 1NJWA 3PX6A 2O4IA 3QERA 4DTSA 3WNGA 5FRNA 1LAWA 2FVSA 4WYWA 5HRSA 3AVBA 4DSFA 4O55A 3IG1B 4DTUA 4OJRA 5F8MA 4MK9A 3D5MA 4G3IA 3MR3A 3LP3A 5JXSA 1XR6A 4JV1A 1VSKA 4H4MA 2WOMB 3KIOA 4PQUA 2A1SA 3OYGA 5C25B 4I9LA 1XC9A 1T94A 3V9ZA 2Z1JA 2WHOA 4CJRA 3O3GA 4KI6A 3MTKA 3L2UA 3KLFA 4ZVEA 3CFPA 2D0BA 3SPYA 2YV0X 4O3SA 4ZP7A 2I5JA 2ETJA 3V9SA 4E7JA 3PHEA 1S9GA 4LQ9A 5KFOA 4JS5A 2HVIA 3C6TB 5DLFA 2AX0A 3QLHB 3EPGA 4KSEB 5I3UA 2ZD1A 4Q0BB 3OHBA 1RTIB 3TAFA 3DLGB 4ZMMA 5KFWA 3ZCMA 2W8LA 4CGGA 4ELUA 3OYIA 3LZJA 2VWJA 1J9AA 3K5OA 3CQ8A 4DTRA 5HLFB 4KB0A 3KLEB 4KTZA 3NAIA 2ILYA 1VSIA 3ZT2A 2FBTA 4CEOA 2KFNA 3Q8RB 3K58A 3NH2A 5C42B 2G8IA 3CJ2A 2D0CA 1RT6B 4CJWA 3OYBA 4FLZA 1TK0A 2FLNA 1D1UA 1SV5A 4CEZA 3KJVB 3KK3A 4JS4A 4ECXA 2R8GA 3DI6B 1EETA 1D9DA 5KFNA 4FVMA 3THVA 5D3GB 2OPPA 3SJJA 3KLIB 1DTTB 4NLUA 2NUBA 3G6XA 2GBZA 5KFGA 4CEBA 3BSNA 2ASLA 4TY8B 4DL3A 3HK2A 1JLAA 3HPHA 2HNYB 1VSEA 5L1JA 1BL3A 3FQLA 3Q8QB 1TV6B 2YNFA 2IC3B 4J2EA 2WOMA 3K5NA 3MXMA 3T5HA 3V9WA 1TAUA 2WK4A 3DDKA 3S3OA 3L2VA 1VSHA 4FJHA 3DLEB 1BIUA 2FVQA 2F8SA 1ZBIA 4O44B 1WN7A 1S9GB 1BQNA 1D5AA 1HQUB 1S1WA 1VRTB 3MFIA 4CJSA 3C95A 4CHOA 3L3UA 4MH8A 1RDDA 2HMIA 4HYKA 1JLEA 4NLSA 4DQRA 2IS3A 2G8HA 4B8AB 1VSJA 4FZYA 1RBRA 4M45A 4FJIA 3VQ4A 3AO3A 4KE5A 4ZVFA 1T8EA 4HVJA 4B3OA 2IM2A 5F9LA 1GOCA 3NMAA 4IRDA 3IGNA 2FJXA 4R0EA 4HKQA 4DTNA 3C6TA 4ED1A 3P5JA 4RNMA 1BGXT 4BDYA 2V4RA 1RDRA 2ZD1B 2RKIA 3T19A 3M8SA 2ZKUA 3RRHA 1TKXB 4GW6A 4RW7B 4CE9A 4IKFA 2P51A 4F3OA 4PWDB 3I0SA 1HPZB 4H4MB 3MXIA 3NF9A 4RW6A 4OLBA 4DG1B 3I5CA 5KFHA 2AGQA 1RTJA 1VSDA 1QTMA 3OSNA 4CHZA 3I8DA 3AVLA 4CJQA 2QE5A 3NGDA 2E9RX 5KFMA 3T5KA 4CGDA 4URSA 4OGCA 1NK9A 4RW9A 3DOLA 4E7LA 1IO2A 1RT5B 3BR9A 3ISND 5EDWA 3MFHA 5CYMA 4FJNA 4FLWA 4M3YA 4IG3A 4Y1CA 4CEEA 3DOKB 1SH3A 4CEQA 1NKBA 4LH5A 4M3UA 4NLWA 4I2PA 2IBKA 4IQXA 4DLGA 3HP9A 1RTIA 3VQPA 5KT2A 3TI0A 4FJMA 3AV9A 3KLHB 2IA6A 5J2PB 4DMNA 5F9NA 1C0TB 4O4GA 1S0NA 1RT4A 4ED6A 3DI6A 3O4QA 3CJ0A 3LDSA 3KLIA 1NJXA 3Q8SB 4QAGA 5J2MA 4RNHA 1JX4A 3QESA 4LSNA 2VA2A 5HROA 2GIQA 4BACA 2OPRA 1REVA 1T03B 4CEAA 5KFUA 4E7IA 2XC9A 5CZ2A 2BRLA 4CFAA 3JYTB 1C1CA 1LWCB 4KO0A 1X9WA 1A5WA 3VQEA 3BJYA 2R2TA 5I3UB 4Q0BA 4IFVB 2BE2B 4O4RA 4TY9A 3RMBA 4FYDA 4EYHB 2IC3A 4DS4A 5EWGA 3IS9B 3VQBA 5DQHA 4BE2A 1GX5A 4HUEA 2OA8A 4ZPDA 1WAFA 2Y1IA 4CHQA 1YT3A 4EEYA 4C8LA 2O4GA 2D41A 1RT2A 1VK0A 1NK6A 1TV6A 2YNFB 1JXBA 4DSEA 4EBCA 1RCHA 3LP1B 4RZRA 2WCXA 3OYNA 3QEIA 4CF0A 1JLBB 4ICLA 2W9BB 2E6LA 4LD0A 3BSCA 4DSIA 3DOLB 4NLOA 3PW0A 5KG5A 2AX1A 2X6SA 4O44A 4FLTA 3NCIA 4RNOA 1JLGB 4ECRA 4H4OA 1XR7A 4E7HA 4M3XA 4YR0A 1RT3B 4ID5B 3AA2A 3QETA 4W5QA 1QSLA 4KB1A 4F3TA 1FXXA 4CJUA 3TAGA 4EP5A 2B43A 5KFIA 3HO1A 4XIUA 5KRSA 2IDOA 3KHRA 4BE0A 1DLOB 3DLKA 4TYBA 1RBTA 2IGIA 3JSMA 4HUFA 4ZVGA 3GIKA 2Y1JA 2HNZA 4TLRA 2XWYA 1KFDA 4BDPA 1TQLA 2R8IA 2FJVA 3CDEA 2C2RA 3ULDA 2E9ZA 5FRMA 5KFLA 2PY5A 2XGQA 3HXMA 2HWIA 2YNGB 4NLPA 4U6PA 3BGRA 4GC6A 2UUTA 3ZSRA 3ZSVA 4DQSA 1OS5A 4Y34A 4Z4HA 3M9NB 3KLFB 3IRXA 4IG3B 3SQ4A 4HCCA 1NJZA 2G8WA 4RW6B 3UR0A 4O3QA 4DL5A 2G8KA 4QWDA 4ED2A 1UAXA 4LY7A 3TABA 4DQPA 3V1OA 4E89A 4CJ3A 1S9FA 1Y97A 4KRFA 2W7OA 4WYLA 3BSOA 2ATLA 1S6PB 1O1WA 3MEEA 3V6DA 4NCGB 1YVUA 3QEVA 4J2AA 1YTAA 4KV8B 3KK2B 1LWEB 1RT4B 4NCBA 3FFIA 2UUWA 5KG6A 4DFMA 4FZXC 2DY4A 3TQ1A 2W9CA 1RBUA 4KHUA 1S1TA 4FS2A 3DRSB 1N48A 3FSIA 2P5GA 3OS2A 4WZMA 2KTQA 5L1IA 4AHUA 1HNIA 4KTQA 3TWHA 3NH1A 3QNNA 1IKWA 1IKYB 2IM1A 4YR3A 1TAQA 3H08A 4GVMA 3FDSA 3H40A 4CJFA 1I6JA 2DFHA 2BQUA 1ZETA 4F2RA 1A5VA 3AO2A 1K6YA 5KG2A 2QKBA 5KFCA 4PY5A 5J1EA 4QWAA 4KBIA 3ZSOA 3G10A 1QSYA 1TKZA 2IOCA 1TL1B 3CDWA 1EP4A 3DLKB 1RT2B 1ZBUA 4Q45A 4K8ZA 1S6QA 4EYIB 2J6SA 2KQ2A 4H8KA 3ZT1A 3NF6A 2C22A 3PZPA 5KT6A 5FDLA 3ZT0A 4O3PA 3LP0B 2P1JA 3H5XA 4FJGA 4RW8B 2UVRA 2X6NA 3OYJA 2A1RA 4AHCA 4RNFA 3H5YA 3CG7A 1KVCA 2XGPA 4W5TA 1NHVA 3H98A 2WTFA 3OL9A 5J2QB 4QW9A 4N56A 3WNFA 1BQNB 1HQUA 3SI6A 2AGOA 5EUHA 2FLPA 3VQ7A 3JSMB 3E51A 5SWMA 3PX0A 4KFBA 4NLVA 1JKHB 3RMAA 3OLAA 4WZQA 3QO9B 2XY7A 3B6PA 4J2BA 1N4LA 5DGAA 1RT7B 3WNEA 2G8VA 5J2MB 5EU7A 1K1SA 4QPXA 3AVAA 3FRZA 1DTQA 4I2QA 1KLMB 3NF8A 3HM9A 3V81B 3KTQA 4RU9A 4Q44A 5KFDA 4ED0A 1MU2A 1LV5A 1CZBA 3AA5X 4EO8A 1C1BB 4E7KA 1RT6A 3HVTA 5I42A 3CIZA 2RKIB 4QCLA 1WNEA 2FBXA 1L5UA 4B9UA 1N56A 1HYVA 1LW0A 1RA7A 2HWHA 2Z1HA 4Y3CA 4QWEA 1X9MA 1SL2A 3FFIB 3H59A 5KFYA 4FJXA 4URGA 4CFDA 1J54A 2B6AA 3KNAA 3I0RA 4B9SA 2VWKA 4ZTFA 3NHGA 2DFFA 4RW4B 1UA1A 4FZZA 2YHBA 1HNVB 5KT7A 4MIBA 4DL2A 2RF2A 4E3SA 3O4NA 2AU0A 3LAKA 4FK0A 4H54A 1IKYA 3AO1A 4TN2A 4HTUA 2LSNA 3CYMA 3HSTB 2F8TA 3IAYA 2XY8A 2RPIA 3LZIA 4DFJA 4ZPAA 4IKAA 5CYQB 2FBYA 2YNIB 1CXUA 1J53A 1QE1B 1IKWB 3RB4A 3AVJA 1Z4UA 4DTPA 2OPQB 3S3NA 2HHXA 2HMIB 2R2UA 1JKHA 1S1XA 4M3ZA 3GV7B 1HRHA 2B5JB 4AHSA 3HPGA 5K14A 1R0AB 2C2EA 4J9RA 4ZVHA 4FXDA 4LQ3A 4B9TA 4ZP9A 4CHYA 3HPOA 3DYAA 1BQMA 3VA3A 2XI3A 2W7PA 3HKWA 4OKJA 2KFZA 2X78A 4ECQA 3C94A 3T5JA 1QHTA 4LSNB 1WNSA 2F8EX 5C42A 4M3RA 5T14A 3GV5B 5HP1A 5J2QA 1KVBA 3IGVA 4CGJA 1KTQA 3UIQA 2QK9A 4J9NA 4TY8A 1XI1A 1JLFB 5KT5A 1CSJA 1IG9A 4KKOB 1C1CB 1LWCA 4KO0B 4BWMA 5KFTA 5DG9A 1IH7A 4K4WA 1TKDA 3CM6A 1KCFA 4CIGA 2RDIA 1EXQA 3KMQA 3GIIA 2G8UA 4C8NA 1JXEA 4CEDA 3SFUA 1JLEB 1BI4A 4E1MA 1QAIA 4DTXA 3H5SA 2HHUA 4J9QA 3V81A 3I5BA 4NYNA 3ZSYA 1S1WB 2BANA 4B9VA 3LP0A 3KHGA 1NK7A 4OVLA 2KW4A 4KPYA 3F73A 1X9SA 4EP4A 3DLRA 3QIPB 2Z1IA 3MAQA 2KZZA 1SL1A 5HRRA 4FBTA 3QO9A 4NLTA 3NGYA 2VA3A 4ZHRA 3G6YA 4HUGA 1ZTWA 3HVWA 4RW4A 1XWLA 3L8BA 4K4ZA 1RT7A 4G1QB 3RWUA 5F8JA 3V4IB 4RW7A 3OYAA 3SQ1A 1WLJA 4I7FA 3LANA 3PW2A 1B9DA 4KAIA 4LH4A 3QGIA 2XY5A 4F4KA 1RT5A 2OYQA 4ECSA 1XR5A 4W5RA 3OYMA 4M95A 4FLVA 1BISA 1TKXA 4R5PB 2IAJA 5KG4A 3TVKA 3PVXA 3A2FA 1MU2B 4YR2A 2QKKA 1MMLA 4AHRA 2DPIA 4CF8A 3KK3B 4E1NA 2DFEA 3MXJA 2YNIA 3LPUA 4DL6A 3CWJA 3MR2A 3K2PA 5F8IA 3EZ5A 1Q9XA 1S1XB 3QLHA 3NFAA 4FLXA 4KKOA 1KHVA 2GV9A 3V9UA 3H5UA 1W0HA 5DQGA 4IDKB 3DOKA 4U7CA 4O5BA 4PQUB 1SKWA 2C28A 4JV2A 4ZPCA 4TSXA 1IM4A 4IFYB 2QV6A 1B92A 3UQSA 1CLQA 5KFAA 2PYLA 4YP3A 4CF9A 4DFPA 3M9MB 2YKMA 1RDCA 1S5JA 4O3RA 4WFXA 5SZTA 1VSMA 4M42A 1U04A 3OYFA 4KI4A 1JL1A 4YQWA 4CJVA 4OPKA 3OYHA 3ALYA 3ASMA 4I2PB 3VN5A 4KHQA 3RB3A 4IG0B 4MFBA 3LP2A 1Z25A 4F4YA 3QEXA 3HVTB 1NNDA 3SCXA 3AVCA 1TGOA 1S0OA 4WXOA 2EHGA 4IH6A 3QIOA 4CFBA 2FJWA 2VG6B 3VQQA 2B6AB 3OSPA 3ITHB 4ZHRB 2IM0A 3KLHA 3HHKA 3DM2B 2HHVA 1VRUB 4EZ6A 4F2SA 1Z26A 2R2RA 5HBMA 3AO4A 1JLAB 4B3OB 1ASVA 5F8LA 2OPRB 4IRKA 3U6FA 2OZMA 3DYAB 5DGBA 4WFZA 1LWFA 4CF2A 4O0JA 1QQCA 3OYEA 2BRKA 4MK7A 4K4YA 4KAZA 1S9EB 2RN2A 1REVB 1T03A 4M94A 1G15A 3VQCA 3OYCA 2HHQA 5L1LA 3PUFA 1B9FA 2C2DA 1WSHA 3IS9A 4J9SA 4OKKA 5KTQA 1J5OB 4XO0A 4FLUA 1SH2A 2BE2A 4E19A 1DLOA 1EX4A 5KFZA 3RTVA 3SV3A 2B4JA 2XCPA 4DQQA 3ZSWA 5L9XA 1T7PA 1BHLA 1C2PA 2JC0A 3KKSA 5F8HA 2W9AA 3CM5A 4ID5A 4LSLA 1TL3B 2D5RA 3MEGB 2W8KA 4Z4CA 2O5DA 3AVNA 5KG1A 3KK1A 4NLRA 4ELTA 2ZE2B 3DLEA 1KHWA 4Q43A 4CK2A 1BCMA 3IRXB 4I7FB 3BQ2A 3CJ5A 4FJJA 5F8NA 2HAIA 4ED3A 2R7YA 3OYKA 4F4ZA 2VG7A 1FKOA 2VG5B 4CJPA 4HCBA 3M8PB 2YNGA 4ECVA 3L2WA 4YMEA 3BREA 2XI2A 4ZPBA 3KLVA 1LAVA 1TVRA 4Z0UA 3LALA 4N47A 4Z4EA 2PYJA 4J9PA 4DSLA 3PR5B 1C0TA 3EY1A 3M8QA 1UWBB 5D3GA 4CHNA 3AVGA 3NGZA 3NBPB 2V4QA 1U45A 3QGGA 3DLBA 5J2NA 4C8KA 1RAJA 3QGHA 4AHTA 4OGEA 4DU3A 1S0MA 3BGRB 3SNNA 3V6KA 3RB6A 1HYSA 1RT1A 1BIZA 5DLGA
chains in the Genus database with same CATH superfamily
4CGFA 3SUQA 2NRVA 1D8ZA 4OZ5A 1HQEB 1FXRA 3VQ5A 4OYIA 3D54A 2DB1A 1WOQA 4LUBA 3OHAA 4QYZK 4WFYA 4WP8A 1N6QB 2GJ2A 3G6VA 3D28A 3U9DA 4K4TA 1PKUA 1WF0A 2DNHA 1IBKF 3MTJA 4DL7A 1CPZA 3JAMO 1IKVA 1QVFM 1M5SA 2P2CB 5ADXH 3PRDA 1JLQA 1F5CA 4OYAA 3LAMA 2IRXA 4CZLA 1RTHB 3VWSA 3QBCA 2F9TA 3NNHA 2V6AA 4ES3A 1NHKL 4O23A 5F3TA 2M88A 2VBYA 3J81U 2V8HA 2K2PA 2DGVA 1W2BM 4NMXA 1UFWA 4O3NA 1HKBA 3ZEUA 2WVEA 3DGVA 4O5FA 4JI0J 3G6ES 2GQ2A 4CJLA 1NU4A 3TJAA 4FJ7A 3W3DA 4PYAA 4CJTA 4JEPA 4IG0A 5BR8F 1VSFA 4M3TA 3PJWA 3EXCX 1EQ0A 2FZCB 4M3WA 2H9ZA 3U3GA 4B1VA 5FIIA 3RAQA 1HPZA 2BM0A 2GMHA 4N5SA 2MKIA 3AVFA 1UWBA 2ROEA 3VAFA 2QW9A 5GAEP 4OZJA 4YDUA 3TPQA 3GYNA 5DO2A 1UJ4A 2QA4S 3CD0A 1YVNA 1O8BA 3H4DA 1EO1A 5E3RA 2H5JB 1LW2A 4MT1A 3PACA 3V9XA 4B1ZA 3C6UB 3Q7CA 3L7PA 4IFVA 3OVNA 1TU0B 1HR0J 3QQCD 4YY3J 3TARA 1R31A 3THWA 2F65A 3M8QB 2AGPA 1Q82T 4DR4K 5C24B 1N5YB 1FNOA 1HARA 3ETMA 2FHJA 3CO9A 4OPJA 4CH7A 4QR0A 4USVA 1NPKA 1HYSB 5IWAJ 4H0YB 1QUVA 2OFGX 3WXIA 3I33A 4MDAA 4QIFA 2RRNA 3DRSA 3AVIA 4DR2F 5D4NA 3SIPB 1W26A 3U27A 2O8BB 5CYMB 4ZP6A 1JK9B 1NHUA 2ASMA 2XHBA 2B4VA 2QMXA 3TUIC 2BW2A 3CCMS 4ZVUB 3NP5A 2HK2A 1RTDA 1MNEA 4NLDA 3LWMA 4R8UA 2VG7B 2WVBA 3TAEA 3CNQP 3I0RB 4UUXA 5KQ8A 3RBEA 1E6YA 4X4OA 5E84A 4DR7K 4ECZA 5M2UA 1GQEA 3SMSA 1PILA 4H0PA 4K0KF 5I3QA 4IOBA 3ZX2A 3JS6A 1NSQA 3QEPA 1T95A 2E88A 2OAUA 4JI5J 1H1VA 3OXFA 3HHLD 4DDFA 5M1QA 3VQ8A 1ZZNA 4MLEA 2XMAA 1RILA 2P9SB 1HBNA 1T05B 2G1HA 4I6WA 3MN9A 4ITSA 3B8HA 2UVUA 3TP2A 4ZLJA 4CESA 2YNHA 3MMCB 4TYAA 4AQYK 1K8KB 3CTRA 3QT5A 3UKUB 2R2SA 4FM1A 2HZCA 3CJCA 1TKTA 2GFFA 4DPYA 2ZVIA 3ZZ0A 4NLGA 3H90A 3MM9A 3M2VB 3FBEA 4AILC 1VQ7S 4ILHA 1RB0A 5AT1B 1F0XA 3E01B 4K43A 4K50A 9ATCB 1F9HA 2CKWA 3VF0B 3GIMA 4MKBA 4WFBQ 4CBXA 4PUOA 1UL3A 3MR5A 3FZMA 2BQRA 4WXWA 3QIPA 1ZAVA 2BKNA 4FVCA 2V52B 5A8WB 4K59A 3O3HA 3BDPA 1RDAA 2E5JA 3DJCA 2ZWPA 1HNWJ 4FWKA 2OPPB 1IQZA 1FXLA 4ZKAA 5IWAK 3GIJA 2IMWP 3CJ7A 3UKRB 4KH6A 1CJKB 2CQ4A 5IQ6A 2HHHJ 4MK8A 2RH3A 3S9HA 2ACYA 5GAGU 3VESA 2CJ9A 4IYQA 4TVAB 5JMNA 1CZ9A 4F36A 1NM1A 1ZPVA 3UN5A 3LTOA 4N8OA 4DR1K 4P9SA 4OFZA 3PR4A 1GOBA 1YHQN 4CJ5A 4LF5F 5DDPC 2B7CB 2DCLA 4KB7A 3UNGC 2MGZA 3DLHA 1CQNA 5KFRA 4DSKA 1GMVA 2OHDA 4KTWA 4BRHA 2LP4A 2D7SA 3THPA 3C8YA 3BB5A 1WSEA 1C1BA 2XCAA 1KAXA 5AQOA 3N9UC 2LQ8A 4RPFA 3DC2A 5IT9U 2VDIA 5K8PA 1D8YA 2OFHX 4FJLA 4R8UB 3BYRA 3PEJA 3C16B 2K7KA 2JL9A 1JJ2R 2VFUA 1IR1A 4GO5X 1Y7PA 2FHKA 5GVQA 3CMEN 4ZP8A 1HJRA 2P5VA 1RYSA 5J2PA 1D09B 1TUGB 4MQ3A 3I8BA 4DTJA 1OJ4A 4A8YA 2GAGC 4C1NI 4C0BA 1IBCB 1SUQB 1NK0A 3T9ZA 4ETXA 4X2BA 1Y11A 5CCLA 3EKSA 5KFQA 3UN2A 1RCOB 4CIFA 2QLBB 3SBGA 3S8SA 2IJRA 3PX4A 1SQEA 3QGPA 4OQJA 1N5VA 1RAGB 4FS1A 2M8HA 5HRPA 3NAEA 2I1RA 1W25A 2HBQB 4EZ9A 3QIDA 4DEZA 4FLYA 3J81Y 4A5AA 2OMLA 2Q3SA 3EYZA 4FYWB 1FD8A 3VHQA 4Z37A 3H1QA 4LRCA 3ZSQA 3VAHA 3I96A 4KHNA 3KOAA 1TK5A 4QW8A 1RBLA 2AP1A 4GKKF 3EGWB 4ECYA 5KFEA 3OJSA 5KFPA 4RJVA 2ZZMA 1YWXA 2BW7A 2OH2A 2PMZD 4ANEA 4OX7A 3VGLA 1YRUA 4F8RA 2YKNB 3ZYYX 4EMDA 3RMDA 2B9EA 2X74A 5ETQA 3HKZD 4I6AA 3EICA 1LKZA 3KWMA 3U3YA 4N7TA 1IBMJ 4QWCA 2E4LA 2DO4A 2E6MA 3DGPA 2W2NP 2HNZB 3AD9C 1FT8A 3DHXA 3OR2B 1NU0A 1RDBA 2O8FB 2E2PA 2DRAA 4M5NA 4BY9C 1RZMA 3OL6A 1SKRA 4A8XA 3MEDA 4CF1A 2CDRB 2K7JA 2J0WA 2PBDA 1FO1A 1X4HA 4FPBA 3JS9A 3MMBA 1H74A 1NBWA 4DR4J 3FE1A 2AP6A 2ZJPL 2V4JB 1WI6A 3JSRA 3HF5A 2LXUA 4JV0A 3PSIA 1RWXB 1IJJA 2CJQA 2V7ZA 3J7YP 2V34A 2C3MA 3PW5A 2A6MA 5HLFA 1BI4B 4LF9F 4B3SJ 1GAOA 4LSLB 3G87A 3NKYA 3HLUA 4RUAA 2CIMA 3LL3A 1Q18A 4NEYA 1NLVA 1TK8A 3MGJA 2JGUA 1IBKK 1OSCA 5KT4A 3LP2B 2HBLA 1AB8A 4MO5A 3CF5L 1S49A 4R5PA 4B02A 4U7UK 4N76A 4FBUA 4GY2B 4CW7B 5AZIA 2R42A 2JWNA 3ZTOA 4Q8FA 3IWNC 3C16A 4QR1A 3R97A 4OYMA 2D9OA 3UE2A 3L2QA 2VQEK 4FK2A 4LREA 5KFXA 2J6UA 1M1HA 4R25A 4PG4A 3MCOA 2B3TB 2Z2LA 1U6FA 2EFGA 5H1SQ 3THXA 3WIUA 3V6JA 4Y00A 4AYBD 3M3ZA 3JB9k 3K0JA 1SI9A 2MGZB 4BRQA 3Q22A 1G6BA 4NXNF 3R6GB 2ALZA 1YTYA 2G0IA 1URNA 2OJ3A 4A8MP 2E1YA 4B3MJ 3PY8A 1WUAA 2DXDA 3ZETB 1WEYA 1GH8A 2C42A 4X4PA 2JLEA 3UCUP 4Z94A 1K73T 2Z30B 3PEHA 2RDJA 3OBIA 4JK7A 1HR0K 1SIZA 2BKOA 4F4XA 1VQYA 3MM6B 3IO1A 3W8GA 3VETA 1BQMB 2ZHBA 2QFIA 3GPAA 3MCSA 2Y8WA 4FJ8A 1VRTA 1Q8IA 1SVDA 4H5VA 3MM7A 4MAKA 4PCQA 3KJFB 2Y3YA 2CA9A 3FJ2A 3ZZRA 1OKJA 5GADP 3D6RA 1EWRA 3R5JB 4FJ5A 1NPRA 2AQ4A 5DK5A 4CK1A 5HP1B 4OV1A 4J9LA 3WNGA 5FRNA 1O51A 1LAWA 2FVSA 4WYWA 2ZZNA 5FLXO 3AVBA 4DSFA 1RBOB 1HWJA 4DTUA 1Q5VA 5F8MA 3W2WB 5G4DA 4NI2B 2VL1A 1KVJA 3FKBA 3MMBB 4USHA 2CNOB 2YJFA 1NWKA 2YY3A 3TRGA 2VQFK 1SJFA 4ZA1A 2EFVA 3KIOA 2BABA 5CYJA 2WBNA 2FGCA 2RD5C 1V3RA 3CMAN 2J9DE 1KR4A 1T94A 2PFFB 2O8FA 4CJRA 2XMUA 3FR0A 4KI6A 1U2FA 3C14A 4ZVEA 3OW2M 3CFPA 2IIRA 5AQVA 3AB4B 2PGCA 5C2GA 1VQOS 5KFOA 2NZ4A 3VENA 4JS5A 5LM7E 2AX0A 3THTA 4AM7A 5IT9Y 3QLHB 1J6ZA 3EPGA 4X62F 1KEKA 4KSEB 3WHIA 2LU1A 3DLGB 4OJ3A 4QZVB 2E1AA 1HNXK 2XS5A 4ZMMA 4CGGA 4YHHJ 2F4VF 2P9GA 1RWMB 4ELUA 3OYIA 4K42A 3N01A 3BY5A 2VPWB 4HTIA 4ZJOA 1Q82O 3VALA 1KDNA 2ZBQA 4DHVA 4DTRA 5HLFB 2W2PP 4KB0A 4I0WA 2ILYA 1UMJA 3OQ2A 3LDPA 4LFAF 3EE9A 4QYZJ 4JOUA 4CEOA 4PZVA 2DH8A 3R6MA 1ATNA 2G8IA 4WK3A 4JN4A 3MN5A 3T1HJ 2BEFA 4LF2A 1YJNS 3CCES 1D1UA 4A8KA 2GJFA 2AZ1A 1SV5A 4WCEQ 3L6QA 2CJBA 3KJVB 4LF7F 3KK3A 4BREA 2R8GA 3J7AP 2DTJA 2ZJQQ 4GVBA 2VC1A 1D9DA 4FVMA 1CJTA 3MPYA 3CCMN 2OPPA 3SJJA 3GFXA 3WT0A 4CEBA 3MX2A 4H5WA 4TY8B 5KAKA 3Q2SC 2CQBA 3HK2A 1JLAA 2HPUA 2HNYB 2YKOA 3K5PA 3FQLA 2XS7A 2IC3B 2RS8A 2AYBA 3K5NA 1S57A 2P8IA 4I64A 3DDKA 5BR8J 3AJ1A 4EFHA 2XNRA 1FJGJ 2FVQA 1EARA 5B8HA 3TSUA 4O44B 4GVLA 1J27A 4CJSA 1NSPA 2IYIA 4DV4J 4NA2A 4PG8A 4LF6J 3OA9A 3T1YK 4JKAA 4OYBA 3TZXA 1JLEA 4DR3F 2IS3A 4B8AB 3D1OA 5HMWA 4DV1F 3CCSN 3OUYB 3MOZA 1O6XA 4ZVFA 3H45C 4HVJA 1LQ9A 2IM2A 3AJDA 4WPAA 4Y0WA 2DH9A 3N4PA 3C66A 2QMWA 3C6TA 2ZDPA 3P5JA 1T11A 3CC2N 4BDYA 2V4RA 3G82B 2ZD1B 3MPUB 2ZH8A 2MTLA 3M8SA 4PYDA 2L9NA 2V9KA 1F9EB 4IXCA 1TKXB 5KQDA 4RW7B 4Y2KA 2DRDA 4WFNQ 3IWLA 5JMVA 3TYTA 2CQ0A 1YITS 2CH6A 1Z05A 3ZZOA 4AE5A 3M2UA 4WF9L 4ANCA 1WJ9A 3GTYX 1F9FA 4CHZA 2QWNA 4C3LA 2HFVA 4CJQA 3OFHA 3NGDA 3DXBA 1NK9A 1VK8A 2BOAA 3ISND 1UW4A 5HMXA 4ZS6A 4CLZA 4OX9J 4DR2J 2FJEB 4IG3A 3KFWX 3MD1A 4Y1CA 5B7WA 1WC4A 2ZVSA 5ETRA 4IQXA 3LDLA 3RYLA 1UZDA 1BWEA 2ZWHA 5M2PA 2K1RA 4DN0A 1ZM9A 4H4KC 3HOTA 1MSWD 3DI6A 4BG9A 3KLIA 3CCQS 2AIRB 3ZTSA 3O9TA 3EE3A 4RNHA 4LSNA 2GHPA 4FXWA 5HROA 1T03B 3THYB 1Z2ZA 2F1FA 1TL7B 4WKRA 4IWVA 2CGJA 5A6PA 3JYTB 3J7ZT 3BJYA 2R2TA 4Q0BA 1VQLN 2BE2B 3E9LA 2KVIA 5T7LB 3RMBA 4FYDA 4EYHB 2OELA 3I55N 4H0VB 2IC3A 2RDDA 4BE2A 3IP0A 1YT3A 2D0OA 3TQEA 2QZ8A 4X65J 2AW0A 1ESVA 1NGIA 4DSEA 3ADAC 2QL5B 3LP1B 3BPSP 4CF0A 5GAGP 1JLBB 1MWYA 2P9SA 4OZLA 5CZVA 4ZCKA 1ZA1B 4LF8K 4DSIA 4NLOA 4JI3J 1QDUB 3GSDA 2DGQA 2MZSA 4FLTA 4X4SA 4CO4A 4J37A 2NRWA 4M3XA 1XR7A 2FY1A 2A0FB 4W5QA 3MMVA 4KB1A 4F3TA 1FXXA 2PFUA 4EP5A 5A8KA 4UY8O 3KHRA 2K8GA 4P2MA 3DLKA 1RBTA 3D4JA 3JSMA 4HUFA 4ZVGA 3TTCA 1KFDA 3VTIA 1CJUB 3ULDA 2IMOA 5EY4A 4JI4K 3D7SB 3HXMA 2HWIA 3AY9A 3MCAB 2YNGB 1H73A 1X4DA 4CYUB 4GC6A 2HOEA 3DNCA 4DQSA 2F3JA 4BRNA 3IRXA 4HCCA 1PC4A 1OYEA 2G8WA 1KKHA 2R7WA 2CZ9A 1HI0P 1NJIO 2QMUB 3TABA 1UAXA 2RMLA 2X3DA 3V1OA 1C4AA 1Y97A 1WEZA 3MEEA 3V6DA 4FWNA 1AW0A 3LPYA 3WUHA 3FFIA 5KG6A 1DHMA 1BG3A 1DQAA 1IJFB 2GELA 2O8EB 4FS2A 2GVZA 3VAIA 1N33J 3F44A 3CJKA 5L1IA 5H1SV 4KTQA 2AT1B 4DV6K 2YVSA 3O9RA 2FDNA 4HTJA 1IKYB 3AQOA 2V68A 1TAQA 2Y1RI 1HNZJ 4C8YA 1ZM3A 3H08A 5D0EA 3TUZC 4K5RA 1I6JA 2DFHA 1FJCA 2Y0BB 4YS2A 2WVFA 2QKBA 4A5BA 2A3JA 5J1EA 4AL6A 1UVJA 3ZSOA 3G10A 3MM6A 1TKZA 1RT2B 3HSJA 2YQ1A 2Z2MA 4DR3K 2KQ2A 1LCUA 4H8KA 1FNXH 2KDOA 4U8YA 3KYLA 5FDLA 3ZT0A 2UUAK 2UVRA 2DGUA 2X6NA 4KHPJ 3OYJA 5FJ4A 4C9DA 4P73A 3CG7A 1KVCA 2A6AA 3M1FA 3MHYA 4DI6A 4R0JA 4P52A 3SSQA 5J2QB 1F6TA 3D2FA 3WNFA 4UOFA 3SI6A 3S7RA 3E51A 2ZH1A 5SWMA 3L3CA 3CCEN 2YWKA 2VFSA 3QO9B 3B6PA 3K2YA 5DGAA 2G8VA 5EU7A 4QPXA 2GTDA 2PA3A 5KOXA 2ZBPA 1KLMB 4OZ3A 4C0HA 1DRZA 1MU2A 3DXKA 1IUJA 1GTHA 1LNQA 3CCWA 1RFQA 5FPEA 4I69A 2BJEA 1AFIA 1XMOJ 4EO8A 1HBMB 3EGZA 1RHUB 4E7KA 5I42A 3CIZA 5A6WA 4B9UA 1YAGA 1RA7A 3R1XA 5M1FA 2XZWA 3B54A 4KQZA 3O5TB 1X9MA 3FFIB 4RTFD 5HATA 4G1PA 4CFDA 1YKWA 3KNAA 5D77A 5AQQA 1Q8LA 5IT0A 1VQNN 2EFPA 1CJVB 2DFFA 3K9JA 4FZZA 4Y65A 1HNVB 4NOHA 2UP1A 4ER8A 2NRRA 2BOPA 4HL9A 4H54A 4LF1A 3ZNJ1 4FNHA 3DHWC 4JI5F 1OVYA 4ILMA 3IAYA 1MN9A 2RPIA 5AJ3J 4DUYF 4DFJA 1RU1A 1N8RT 1EIYB 3CF5Q 4CZKA 2FBYA 2E1CA 1X5SA 3ULHA 1BQXA 2CGLA 3FFKB 2N4CA 4NXMK 1Z4UA 4DTPA 2OPQB 5HL7Q 3CPWR 3S3NA 4CBWA 3HSCA 2BJ9A 1WHVA 2R2UA 1HKAA 1VQ4S 1JKHA 1S1XA 4GV6A 1HRHA 4AHSA 4J9RA 2WUSA 1E3MA 2P9NA 3DGPB 2VKZG 3TZZA 3FNNA 1XBWA 3VA3A 2NRHA 2C3YA 2HIYA 4OKJA 3R3TA 3C6AA 1PYTA 3TSQA 4PG6A 3M32B 5AQHA 5LJWA 5C42A 2DR9A 3CO0P 5T14A 3GV5B 4JI6K 1MDUB 1VQMS 5J2QA 1FJGF 1RWOB 3D2FB 2OMOA 3KZBA 3FSYA 1HI1A 4J9NA 5ETLA 4TY8A 5KT5A 1VISA 5A0YB 1CSJA 1C1CB 1LWCA 4BWMA 4DV2F 1AUDA 4C1NK 1IH7A 3LM9A 3K0SA 3SSSA 2MQ8A 4KRWA 4ANDA 4LVOP 1IWAA 2CQHA 2DCUB 1EXQA 3KMQA 3GIIA 4PKHA 2D3O1 2GCFA 3CCJN 3SFUA 2GIFA 1QHAA 2V63A 2GQQA 3H5SA 2MQQA 1MLAA 2JSXA 2E44A 4J9QA 4J5OA 3I5BA 4NYNA 2GHWA 1S1WB 3LP0A 3F56A 1LK5A 3KNGA 3Q8UA 4IEIA 5B0DA 1FX4A 3FZFA 4BRGA 4WWSA 3M4XA 3MWTA 1M5PC 1HLUA 5CA5A 3NGYA 3TX8A 4ZHRA 3G6YA 3VAJA 2QJ3A 1UTAA 1RADB 4K4ZA 1JCEA 3UNYA 1RT7A 4G1QB 3RWUA 5F8JA 1CBKA 3FUYA 1X7VA 4USKA 3J80O 3LANA 5L39A 2KYXA 2BUPA 1XR5A 3W7BA 4W5RA 3NG8A 2IRUA 4OYXA 3KG1A 4X62J 3TVKA 4LF6K 4HDGA 1YG0A 1WSRA 2J5AA 1FJEB 2DPIA 4CF8A 3KK3B 3I9V9 2B4PA 1N5SA 1TL7A 4DL6A 3MR2A 3SAHA 1SC1B 3NFAA 4BHQA 4RWTA 3V9UA 1AUSL 3H5UA 1W0HA 5DQGA 1FD2A 4IDKB 2MQNA 2C28A 4JV2A 3R7NB 1PYOB 4DV5F 2W24A 3ZX3A 2CNLB 4CLPA 2PYLA 3L4IA 1S5JA 2EVZA 2LU2A 1OIAA 3W5ZA 3ALYA 4I2PB 3AGKA 3FVYA 3WQTA 1GMWD 3MMJA 1NNDA 2N7YA 2HLTA 3SCXA 1TGOA 2EG1A 6FD1A 1S0OA 2BMBA 4CO5A 2EHGA 3RW7A 3H3OB 3L4QA 4YOYA 4YORA 2F9JA 2ADCA 2YH0A 3D9BA 3OSPA 3GB0A 2IM0A 5HQMA 4KH1B 3DM2B 1FJ7A 1U0HA 3CC7S 2HHVA 4RR5A 5HBMA 1SS6A 4K5SA 3AO4A 1UVKA 1FESA 3R27A 3RG6A 2CXEA 3DYAB 3HHEA 1JJCB 2OI2A 1DARA 5DGBA 3QB0A 2D74B 1PCAA 4O0JA 2V2VA 1S9EB 2FQQB 1RHQB 4M94A 3VQCA 3PUFA 2JLGA 2QL7B 2XYPB 1WSHA 2OIHA 4J9SA 4FL9A 4HACA 4FLUA 1K9MT 1EX4A 3BEGB 4J8FA 3SV3A 3TEHB 4OZ0A 1T44A 3KKSA 5F8HA 1Y9OA 1V3ZA 2V67A 3CM5A 2FJBB 3ZC4A 2OKQA 2H4WB 4AL5A 1NGBA 1B7FA 4E1JA 2CQ1A 2QEXS 4Z4CA 1KQKA 3F41A 2LEBA 3KK1A 4NLRA 3MPDA 2HFNA 3LOUA 4DMZA 3IRXB 3MM7B 2DGTA 5F8NA 2HAIA 2QGFB 3VF4A 4F4ZA 2VODA 2VG7A 1D9AA 1XMBA 4CJPA 2BXJA 3CJQA 2CPXA 3K89A 3L2WA 4YMEA 1LAVA 2XI2A 4ZPBA 1E6YB 1OYDA 4NZ6A 3Q7BA 5L46A 2IVNA 3PR5B 2VGMA 2WSCC 1KONA 3NGZA 1U45A 3QGGA 1APSA 5DETA 3NRBA 3KVGA 4C8KA 3E8OA 4AHTA 1H72C 4F4AA 4HHUA 4B3TJ 3BGRB 2NZCA 2MHEA 3RB6A 5AFUA 1HYSA 5CHIA 1BIZA 1N34K 4FYVB 4CLKA 1KWMA 2O8BA 3R1HA 2VPYB 2OTLS 3AOCA 2WBMA 3FBFA 3C6UA 2BVZA 3NNCA 2W42A 3FLCO 2ZQBA 2GX8A 1FDNA 4PA1A 5DQIA 3RZAA 5AQYA 3H7HB 4JNEA 3QINA 3D67A 4BC2A 5FROA 4HACB 1WI8A 3BO2A 5DMRA 5BREA 2KHOA 4Y2AA 4IDKA 2YKMB 2B9XA 1ZC6A 3I56S 1T9XA 4LC9B 4O0IA 2VJUA 2VCPA 4JV5F 3GV8B 3QEWA 5FDLB 4W5NA 4O8UA 2EBGA 4BC4A 4M7YA 3AVMA 2OUGA 4FW1A 1JL2A 4ZPWR 3JQMA 2KG0A 3T1YF 5HBMB 5DM6L 2J8AA 1VHIA 4YOVA 4MFBB 3W9IA 5H9FJ 3IA0A 2KT2A 1SIWB 4HR2A 3WXJA 2XMWA 3HYFA 2HW3A 2QWQA 1AZSA 1E6VA 1VRUA 1T05A 2LMIA 2KM8B 2I7PA 4JD2B 4JRQA 4M5JA 5JVGQ 4A8SA 4DPOA 2UUAJ 5B0GA 2A40A 2FVCA 4JB8B 4FJ9A 3UPFA 5ETVA 2NUUG 1MG7A 4A47A 2ITMA 3ETOA 1TP7A 2H65B 2RU3A 5E3AA 3UWTA 4XH4A 4LF9J 3N6NA 2HG4A 3LGMA 4GO7X 3J80U 3MEGA 3D0PA 1I94J 4DSJA 3CDUA 5B0EA 4LIWA 2G2YA 2FIUA 6AT1B 2DR5A 3QRPA 3HHLA 3BGUA 2XO7A 2V4JA 2Z2ZA 4GMJB 1QAXA 2HEKA 3VCDA 1KQFB 5JJBA 3M2RA 2IVMA 3H25A 3PV8A 2DITA 3U7JA 3GFYA 4LFAJ 3SV4A 5J2NB 4Q8EA 2HVZA 3EGNA 2DGXA 2L9WA 4NCAA 4DXLA 4YUDA 3D45A 2PMHA 3K5MA 1V9OA 3GWCA 1OY6A 1VLOA 4BRDA 1N0UA 3TANA 5AE2A 3KLGB 3IAM9 1F2GA 1R59O 1FK9A 1MN7A 2XRIA 3HOSA 3G86A 4U67Q 2FC9A 1WBBA 4CZJA 4HH0A 3CCVS 3OVAA 3BF1A 1VOMA 2YX6A 2YHXA 1H3DA 5C25A 2OD6A 3FCWA 4BGBA 1Q78A 1DZ5A 2BGGA 1YI2N 1V3SA 4M63C 1Q16B 3M32A 4AL7A 1OSDA 1BCOA 3P45B 1JLQB 5E41A 4ZVPB 2N7CA 5I42B 1EETB 1C0FA 3PG9A 1SUQA 4ZLNA 4J9OA 1JLFA 4PWDA 3D68A 4O4GB 5E5NA 1RNHA 1N6QA 2HNDA 2VFVA 3K17A 4DG1A 1FTCA 1NH7A 4CJKA 3DRYA 1HQEA 3ENHA 4LFCJ 5EWEA 3ZT4A 1ZYQA 4ECTA 3LPTA 3HJFA 4H0TB 1BWFO 1HFEL 2UUBJ 2VJVA 4KBOA 1GLEG 4XPCA 5IT4A 4YY3F 1FCAA 3N6MA 3MEDB 4DU4A 1X0PA 2B51A 1UVIA 1HHSA 4BDZA 4GV3A 3WEEA 4TQSA 4DF4A 3SBMA 3W64A 4ECUA 4HEA9 4HHHA 3FBBA 2KZMA 2AEMA 4JKBA 3SQ2A 3CHWA 1ZTTA 2LXFA 1UVLA 2YKNA 4HHJA 5K8OA 1XNQJ 1FWLA 4I6YA 1RBSA 3DRXA 1WBDA 1IKXB 5GAHU 3EVMA 1NOZA 1NJIT 2LQBA 1FK9B 3SAGA 3O3FA 4BVPA 3CSKA 3IBFB 1BUPA 1S4FA 4JI1K 3ELHA 3UD5A 2GWJA 5JVGL 3SYZA 1EJ7L 3MDQA 1AT1B 4X64J 5F8GA 1T3NA 1XHXA 2BQ3A 2R3VA 1ASUA 4I6MA 3WNHA 1U2VB 2PN6A 1R8HA 2NXCA 5DM7L 1D4XA 2OPSA 1WWHA 5KFJA 3NLCA 4DKWA 3UDCA 2AJQA 3FZBA 5DM6Q 3SI8A 2HFUA 1N32K 2AD9A 2Q0UA 2CJYB 5KT3A 4OLAA 4YHHF 5I9EB 2HFSA 1GMWA 2IDEA 2F96A 4QYRA 4B9NA 2AJ2A 3CW2C 4K4UA 4JV5K 2GV1A 1XNRF 1CS4B 4I67A 3VEYA 3TUPA 1WACA 4O3OA 3Q89A 1N33K 1S12A 1N0VC 2WTUA 1GTEA 4DR5K 1AZSB 3S3MA 4MIAA 3C0BA 4JYAK 1S6PA 1RTJB 3WBZA 1QTNB 2CZVC 1Y3KA 3OL7A 2P9KB 2M0GB 3DRPB 3RR7A 2IJFA 1P9YA 4DPWA 4JKGA 4FXVA 1RHRB 3E2EA 1VQ8S 4W4MA 4JI7K 4DV3K 2KJWA 3LWLA 3CJKB 2CG8A 3EZUA 2RHSB 2Q43A 3HL8A 2OEJA 2YHWA 4DS5A 3NOCA 1S7IA 1VI7A 4NEZA 1K1QA 2YBVA 2DEJA 3NF7A 3UW1A 2HF3A 1ASWA 5JS2A 5KOWA 4IO9L 1GLLO 5CYQA 1HBNB 2LA6A 2X7IA 1KVAA 4X4TA 5DG7A 4KHPK 4MYTA 4W98A 1IBKJ 3U4LA 2CWXA 4OI2A 1R0CB 3MEEB 3V6DB 4FM2A 4AT1B 3MM5B 4H0OA 4DV7J 3OYLA 1RJJA 5ETTA 3CMES 2W1BA 1FHTA 2VOOA 3K9KA 4AH9A 2MQMA 3KG0A 2Z1GA 1YVFA 3AAQA 1ZOTA 3BBBA 5KFBA 4WE1B 1VQLS 2QLFB 3E01A 4PXBA 3QJJA 3KJNB 4A62A 3ISNC 4DR1J 3GE1A 3WZ0A 4CECA 1WSVA 3RMCA 3ZSXA 3R5DA 2VG5A 4WQ5A 5HJXA 2JJ4D 3SQ0A 3CCLN 4FJKA 3QNOA 2HWTA 2DTUA 3OS1A 3M30B 2O8CA 2N4DA 1E4GT 1VLYA 1YHQS 1R43A 2CFXA 2FC0A 2G8FA 3KUEA 5BR9A 1SJRA 1YBAA 3CQYA 3KWGA 2HRUA 2CGKA 5THWA 2KH9A 1HKCA 2WSFC 4ID1A 1NK4A 2UU9F 3WXMB 5BRFA 2Z0GA 3VEZA 3NCQA 4AF1A 1T02A 4OO1J 4YB1P 4Z4GA 1X3MA 4NXMF 3ZT3A 1KQSM 2ZE2A 3WEEB 2VBXA 3KKRA 3JTPA 2X51A 1HMVA 3HD1A 1DQ8A 4YDDB 1QAJA 1QE1A 3O8WA 4DU1A 2WONA 2XNQA 3T5LA 3Q83A 2BE9B 4DCOB 1M90T 5IM0A 4DV1K 1X1PA 4FM0A 3V4IA 2B5JA 1VHXA 5CE3A 2AWZA 2GS8A 4FWLA 3EVWA 4C8OA 4M41A 2YI1A 1JNZB 4OX9F 5KFKA 2KLAA 2MJUA 1S48A 1RTZA 4C3KA 3DLLL 3DDIA 1S6OA 3UB5A 3FGVA 2KL8A 3FEZA 2J4RA 3KJVA 1U09A 1LWEA 4PAAA 2HHWA 1CXQA 3NAHA 1WG4A 4LF4J 4DV5J 1RISA 2MKKA 4BWJA 1TMMA 4CNYA 3VMFB 1VC0A 4LFBK 2C2ZB 2LEPA 4ZIWA 5BRDA 1M0SA 1IKVB 4KV8A 1S6QB 1GXUA 1RWKB 3OL8A 3CJAA 4Q5VA 3F5TA 1NRKA 1QQMA 2Q2RA 3IFEA 4DTOA 1B70B 3TAMA 3RB0A 4E0DA 3A8KA 3FZKA 1T9WA 4O0NA 4P72A 5A76A 3IFRA 3KUGA 3HBTA 4LRFA 4JKCA 3EGVA 1ITGA 1FW6A 4CHPA 1UEVA 5DG8A 4FCYA 1SQFA 4C11A 2HSTA 5I4MA 3W2VA 3MM5A 4U95A 4QWBA 3VQ9A 3IN5A 2R8KA 2QN6B 1VQNS 3WC2A 1N34J 1DTQB 4I2QB 4BC7A 4L3QA 2FLLA 1FDDA 1QUPA 4B3TK 1U8WA 3P1GA 3ZEUB 4DX5A 1HW8A 4IH7A 2ZHAA 5F3ZA 4USJC 5KGXA 3H2LA 1WTFA 3U02A 4CGHA 2KRBA 4KFBB 3I4PA 2JEGA 3SUPA 1YJNN 1S9EA 3RRGA 4X64K 3T1HF 5T41A 4ERDA 2AJFE 1G1XA 5AE3A 1R6VA 3VGTA 4MK9A 5IFMA 3LP3A 2POKA 2DNYA 1OH7A 4GRSA 3CCRN 4JV1A 4OYPA 1VSKA 2WOMB 4PQUA 2A1SA 2DVIA 3O4WA 4DUZK 3H42A 1E4FT 1XC9A 3M6GA 5H9FK 1VQ6S 4ZVSB 3V9ZA 3ILIA 2VQEJ 1WF2A 2WHOA 3MTKA 5CR4A 3GG1A 4WTOB 4JI4J 4CNZA 4ISEA 2ETJA 3V9SA 4E7JA 3PHEA 4YOWA 4LQ9A 2Q1LA 4M5GA 3DLJA 4ZVQB 3OTOJ 1BA0A 3R1LA 5I3UA 2ZD1A 1KNZA 5KFWA 1M5OC 4CIOA 2VWJA 2QO3A 3K5OA 2P9EA 1BO5O 2HRYA 3MPWA 3PLAA 3NAIA 3DCAA 2P9IB 4L74A 1VSIA 4BRMA 3ZT2A 4JKFA 3CJ1A 2H1YA 3GYGA 3Q8RB 4H5NA 2NLXA 2XWXA 2D0CA 1UCNA 4ZVOB 3OYBA 4FLZA 1TK0A 2FLNA 1P9QC 4CEZA 2F63A 3LUYA 1BMQB 2HS0A 3D1QA 1EETA 1RABB 3J81O 3DLLQ 1RWPB 3KLIB 1DTTB 4NLUA 2O8DA 2ZUGA 3EX7B 2L3MA 2D3OR 5L1JA 2NS1B 2YNFA 4QR2A 2QWPA 4J2EA 3MXMA 2QTDA 3T5HA 1QLNA 3CD6N 3SBTA 4DR6F 4WFAQ 2BE7D 8AT1B 3SAFA 5IV3A 5AJ3K 1VSHA 1NSAA 2F9DA 1K47A 3DLEB 1BIUA 4A2AA 4OYZA 1S9GB 1BQNA 1D5AA 1S1WA 1VRTB 3C95A 2HBZB 4MH8A 4HYKA 4NLSA 2G8HA 1RWNB 1VSJA 4FZYA 4B3MK 5IXUA 2WFBA 2Z2YB 3PTWA 4M45A 4FWQA 2KXNB 4ALZA 5L38A 1Q8KA 4CLWA 1HNXJ 4ZDNA 4IRDA 2HQCA 2UUBK 5GMDA 4WKYA 2W41A 3QAEA 2WB1D 2DNMA 2DEIA 1R7IA 4FPAA 4MYUA 2FF3B 1QVGM 3M7VA 4CJ7A 1TUUA 2ZKUA 3RRHA 1XC3A 4GW6A 3AA9A 5LSLA 2P51A 1H98A 4H4MB 2M70A 2ZC4A 4QJVA 4UY85 1CVJA 4BC3A 2H48B 3DDNA 2A2DA 2MZQA 4RW6A 5E3QA 4D3GA 3R5CA 1VQ8N 5A2QO 3C15B 1RTJA 1V4SA 1QTMA 3ENAA 5EN1A 1K0TA 4CI0B 3C19A 2QE5A 2XB2D 3A0IX 3MURP 5KFMA 3T5KA 4CGDA 1B99A 4URSA 4OGCA 4B3RK 1NGAA 1RT5B 5EDWA 1Q81T 3MFHA 3UE5A 2MY7A 1MA9B 3CDBA 4QIWD 5A2QU 3MAHA 3J7ZO 4ID8A 4FLWA 2VFTA 2P9KA 4HT7A 4CEEA 1QM9A 1NKBA 4LH5A 4B3SF 4NLWA 1NGCA 1ATSA 2IBKA 4KR0B 1RTIA 3RBXA 4L76A 3KLHB 2IA6A 5ADXA 3Q8YA 2Q3PA 1X4CA 5F9NA 3TNVA 2EKYA 3SJHA 4M5LA 2UUBF 4M5DA 3W66A 1HHQA 4I68A 2AKWB 3VVTA 1NJXA 5J2MA 3AT1B 2D69A 4OI1A 2VA2A 4BACA 2O8EA 1H38A 4E7IA 2IY5B 4OX6A 2BRLA 4IFVB 2KKZA 2JZ5A 2ZNZA 4RLEA 4UY8T 3O9UA 4TY9A 2O8CB 3GR1A 3EM1A 4OHWA 1FDAA 5EWGA 3VQBA 1X31C 4HUEA 1LXJA 1SXLA 2ZC3A 3EDQB 4CHQA 1HL6A 4YDXA 1LFWA 1JMTA 4BQZA 4P2XA 4BR0A 1TV6A 4A8WA 4EBCA 4RZRA 3OYNA 3R2DJ 3D2EA 3R2CJ 2KXFA 1LOUA 2XYHB 4LF4K 2X3GA 1A6LA 4DV0J 1IN0A 3DOLB 4BG8A 4J91A 3NCIA 3G8SA 1JLGB 4ECRA 4H4OA 1HWLA 4E7HA 1VK3A 4H03B 4ID5B 4TNOA 1KOHA 3QETA 3TAGA 1IBMF 1QVFR 3A5NC 2JDJA 4NMLA 4XIUA 2IDOA 4BE0A 1DLOB 1WC5A 4TYBA 3OVBA 2IGIA 1RWVB 3RUBL 2UU9J 5AQMA 2BBEA 4BLGA 5B08A 4TLRA 2XWYA 4Z7YA 4BDPA 2R8IA 2FJVA 1YX2A 5GAHP 2DXEA 5IWAF 5FRMA 1PJ6A 2NYIA 4RKUC 3BH7B 1ULRA 2PMWA 4RWXA 2F7TA 3ZSRA 3QT7A 2RUGA 1VQMN 3VPZA 2VHGA 1V4TA 4RBTA 4DL5A 4M5HA 4QWDA 4ED2A 4LY7A 5E0OA 4KRFA 2FY8A 3BSOA 1S6PB 2PC6A 5CAAA 4TU9A 1BOTO 3QEVA 4NCGB 3ENVA 4DU7A 3LA0A 2Z56B 4KV8B 4K8RA 5AR0A 1FKAF 2UXBK 3O44A 3SCJE 2F4VJ 3CJRA 4R79A 4DFMA 5SUHA 3VV2B 3R8EA 2DY4A 4GNIA 2W9CA 3RSEB 4KHUA 3PKMA 3MMAB 2CJAA 2KTQA 4JI8K 1HWKA 3D1HA 2HLUA 4B1XB 3QNNA 4ES2A 2RUSA 3HFVA 4DL0C 1U1KA 2IM1A 2PDAA 4A8FA 3GFZA 3FDSA 3VGSA 3H40A 2VYPA 1FNMA 2BQUA 2E7XA 1ZETA 1FA0A 1ZPWX 3AO2A 1HX1A 3O3LA 4UOCA 1B0TA 5KG2A 1U2VA 3A1YG 2YX4A 2IVFB 2K3KA 1X0FA 1QSYA 1FJGK 2I38A 2OEKA 4DV7F 3DLKB 2W6LA 3GJRB 3HCXA 1H2VZ 4QQBA 2HGNA 4EYIB 3UFCX 5MLCV 3NF6A 3PZPA 2OGUA 2B56A 3M6XA 1CQMA 1JB0C 4OJGA 3ZTQA 1X4EA 4RW8B 2LA4A 4W92B 3TEGA 3Q0AA 4RNFA 2P9CA 4OLPA 1F5AA 1HQUA 5EUHA 2B8PA 3VQ7A 4KFBA 1JKHB 4F9OA 3HTVA 1HR0F 2CQDA 3S41A 1UEKA 2V7YA 2A3ZA 3SXLA 4UOGA 2P9LB 3WNEA 4FN5A 4RX6A 1ITPA 3OR1A 3H46O 4JI8F 1U25A 2RQKA 2U2FA 4BRPA 4LR8A 3HM9A 3V81B 3SDEB 4BRKA 3CCTA 4ED0A 1X5OA 1HNZF 1LV5A 1AA1B 3AA5X 1CZBA 1C1BB 1RT6A 3T41A 2ZJQL 1WNEA 4F7VA 1N56A 1HYVA 1FTRA 3LM2A 2HWHA 4LF8J 4Y3CA 4FJXA 2B6AA 5LOQA 4B9SA 4XDCA 1HBUA 2GO8A 4QS9A 3Q86A 4A4JA 5L8RC 4RW4B 4DV4K 3MZIA 3NXZA 5KT7A 4MIBA 4DL2A 5C15A 4E3SA 2AU0A 4FK0A 1TYQA 3AODA 4ZCMA 1VQ9N 4MDBA 2W6KA 4TN2A 2EK6A 5A2QY 4X66K 2LSNA 3BZKA 5I3PA 4XH1A 2YKPA 1RKJA 3LZIA 1U24A 2E1PA 1I5OB 2Z4PA 4ZPAA 4U96A 4IKAA 1EQYA 2PT0A 4OHXA 5HANA 2QLWA 1CXUA 1J53A 1JJHA 2K06A 1URRA 4WIQA 3ET6A 3ZTPA 4BVOA 4A57A 4E2FB 1M90O 4X66J 3I6PA 4ZOSA 4HT5A 1YRXA 3L0QA 2HMIB 2B5JB 1XIQA 3HPGA 5K14A 1R0AB 4ZVHA 4OI4A 2B8QA 1DQ9A 4OZ2A 1PAEX 1IXKA 3F9MA 2LCWA 3HKWA 3MAAB 3E9PA 2HQFA 3T5JA 1IQTA 3SMPA 4P2FA 4KC5A 1WNSA 2RS2A 3SDEA 3TZWA 4FP9A 3R5AA 3OXLA 1KVBA 2NYHA 1WOOA 4JD2A 2UXDJ 3J8AA 3W62A 2EG2A 2LQJA 4KKOB 1UJ6A 4G9ZA 4DR6J 4AFFA 3QFHA 2A41A 2YWEA 3FSXA 3TVZA 1WELA 2J0SD 3AFGA 3CIPA 4K41A 2MMYA 2G8UA 4C8NA 1EWQA 4CEDA 5B09A 1JLEB 4CVNE 1BI4A 4YN3B 1RGVA 4DTXA 2IVPA 2PIIA 5CZXA 1U6BA 2FJAB 3PIPL 3ZSYA 2BANA 3KHGA 3PRVA 3RAMA 4DUYJ 3GG4A 2J9EA 2QA4G 1I3OB 2R7OA 3F73A 3MAQA 4TLQA 5HRRA 4FBTA 2VA3A 1NGGA 2VGNA 2KKHA 2FLOA 3LDQA 1OY8A 1VBZA 1XWLA 1P8GA 4M1KA 1ZXOA 3H6EA 3MUTP 1YIJN 3IMQJ 1CJKA 4JI3F 1SJ1A 2HBJA 1HLWA 1WLJA 2W4CA 4I7FA 3PW2A 3MM8A 1B9DA 4KAIA 2GVDA 2I2YA 2XMVA 4GKKK 4ECSA 3OYMA 4M95A 4FLVA 4R5PB 2E5LJ 3ILLA 2HBKA 1MU2B 3DXKB 2QKKA 2KT5A 1Y5NB 4XDDA 1RAIB 2DFEA 2M3DA 3MXJA 2MZRA 3CWJA 2XLKA 1B7YB 2BM1A 3GIRA 1XJWB 2QG9B 3H20A 1QVGR 1OWXA 1T3OA 3QFPA 4U7CA 1SKWA 4O5BA 4PQUB 1UJ5A 4UUWA 4LF8F 4IFYB 4ETZA 3UQSA 2E2QA 4ZVTB 5GAEI 4DFPA 1RDCA 1OMSA 2NREA 3S1TA 5SZTA 1VSMA 3SEOA 4HDHA 1JL1A 1RWUA 4OYOA 4YQWA 4CJVA 4OPKA 4EHUA 3P49B 5L9NA 3VN5A 2WZ1A 4MFBA 1Z25A 3QEXA 1NEEA 3MN6A 3TA2A 3PRBA 3BBCA 2APOA 3AVCA 4EK2A 4H5TA 4IH6A 4JYAF 3PHTA 2FJWA 2E1ZA 2B6AB 3ITHB 4ZHRB 2PI4A 3KLHA 4ZLPA 5HVFA 1N33F 1CJVA 2ZOMA 2OSQA 2DGOA 2ZM6K 1JXVA 5T7LA 4LF5K 4CO3A 4ZPTR 2IPOB 1ASVA 5F8LA 2OPRB 4IRKA 2ATCB 2Q31A 4JAXA 5D15A 3BYPA 3J7Z5 4WFZA 1LWFA 2W40A 1JCFA 5GADI 2BRKA 4AM6A 4MK7A 4KAZA 2RN2A 1T03A 2IFXA 1XUPO 3OYCA 3HHLB 4PXDA 3H0PA 3D2EB 1MMDA 1VRQC 1B9FA 3IS9A 3AARA 3O9QA 5KTQA 2CNNB 3DXMA 2MKJA 1SQKA 4U9RA 1BXNA 4NWBA 4E19A 1P8ZA 3ZZYA 3NGUA 4IO1A 5KFZA 1MWKA 1KP6A 3M05A 5L9XA 1T7PA 3EO3A 2JC0A 4N77A 2NRTA 1K0VA 4LRDA 3BF3A 1TL3B 5LY3A 3WX8A 2W8KA 5FLXU 2VWBA 1HW9A 5KG1A 1VQ4N 3GOIA 5AQWA 2KHCA 3CERA 4JK8A 5LL6Z 4CK2A 3RBZA 4IQMA 4DPTA 1Q79A 4FJJA 3AA8A 4WU3A 4F0MA 1DEJA 2R7YA 2G1DA 2ZH4A 1Q86T 1RAOA 1FKOA 3P39A 2WC9A 1PJ5A 2YNGA 4CM0A 1KD1T 3BREA 4XTTA 1NM2A 5BXIA 2EFOA 4Z0UA 3LALA 2PYJA 4DSLA 2UYTA 3FGUA 1C0TA 4K0KK 1OPZA 3EY1A 2AJ1A 1UWBB 9RUBA 3MCNA 5D3GA 1T6CA 3BGFA 4H5RA 2H3EB 2RJZA 2V4QA 2HZAA 2ROPA 3NVMA 3DLBA 3M5RA 1XNQK 3QGHA 4OGEA 2DBBA 1S0MA 3SNNA 2E5GA 1R8BA 4WF9Q 3DN9A 4DQIA 1GOAA 2MKCA 1N88A 2NZTA 2ITGA 3FZLA 2VZ9A 4NRUA 3EDRB 1MW7A 2Q97A 3O6QA 4I56A 4CIEA 4DX6A 4IH5A 1MROB 2ILZA 3VQTA 2ZOGA 2DIUA 3OVSA 1J5OA 4OX9K 4Z4FA 2CZ4A 4G1QA 2GUIA 1DKGD 4LF7J 1NGFA 4KHRA 4RNNA 3M9OB 1BY9A 4Y2MA 5LSRA 4A8QA 1YXQA 3OUYA 4J2DA 3GL1A 2X1GA 4PPZA 2MYFA 1Q95G 2R8JA 2HHTA 5KG7A 2EPIA 4F3MA 1CLFA 2EXUA 3DOMB 2IVOA 1KLNA 1C0MA 2EI5A 3AB2B 3SQOP 1RAAB 2P5OA 4IFEA 1D0EA 4Z4IA 3P5TL 2YKAA 1CS4A 2E2NA 1I1GA 2AJ0A 1FRIA 2BJ3A 1WSJA 3NGIA 3W5YA 3TU5A 3MF5A 2V51B 3PIPQ 1PC5A 2VG6A 5AE1A 3FMBA 2Q6CA 1NKCA 2A42A 1Q5YA 4YB7A 1U1PA 2L48A 4MKAA 1SCJB 4LJMA 2HHSA 2YTCA 1M5VC 3KG4A 5D4LA 5JLHA 2UZAA 3SQGB 3NWRA 4LFCF 4QS7A 1IJEB 2DRBA 4B8CA 4HHTA 2COLA 4B3SK 2DK2A 2I7NA 1NSKL 4FYXB 1NGHA 2C2KB 3L09A 3V4MA 4ZTJA 3SCIE 4EUVA 2O67A 3H4BA 3LGHA 3MWBA 3C14B 5J1PA 1R8CA 4FF3A 4WQ4C 2G2ZA 1WORA 4Y0FA 4NLQA 3A5LC 3KMSA 3FCVA 4LVNP 5KRTA 1WSGA 2ZFHA 1PGZA 1XQIA 2CQGA 3DLGA 1TL4A 2KFYA 2PEBA 3DRPA 2VDHA 3PKYA 2CUYA 3NL0A 1NH8A 2PAVA 1YJTA 1S1VB 2D4WA 1GK8A 2ZUAA 4C4WA 1SC6A 3F9KA 1XHZA 3OTEA 1HD1A 4TU8A 2YKQA 1XNRK 1TVRB 4CJ4A 2FBVA 3OFGA 5C7PA 3VGUA 1H7WA 3O1WA 1RAFB 3QRRA 3DMJB 5AQKA 1VQSA 2D3ZA 4BE1A 3MK6A 5C0YA 4RUCA 4URQU 3A8JA 3P8BB 1TKZB 8RUCA 3ZZUA 1GX6A 1WEXA 1ZBSA 2GHVC 1C1AA 1B3TA 1SH0A 2ZJRQ 2AHOB 2XTJP 5CQGA 4GKJJ 3GU0A 4KHYA 1RTHA 4DR6K 2NXEA 5DJBA 2Q1NA 1ICEB 2DYAA 2I5JB 4JKHA 4L72B 2HBRB 3HULA 1GT8A 5EX5A 2WSEC 2LQ5A 3OHRA 5K8MA 4W90B 5AQJA 1KXPA 3I32A 3B8AX 4EO6A 4OL8A 3VQAA 4G1IA 4LFCK 1KRPA 1RI7A 2HMPA 4WIIA 8ATCB 1R0AA 3K5LA 2FXUA 4NA3A 3QFWA 2WB4A 3U1NA 2ZNYA 3MECA 3V1QA 4WQ4A 3ICLA 2JLFA 4ATNA 4U67L 3H2UB 2OLWA 2G4BA 5DDQC 4LF6F 1FE0A 3ONQA 2XYGB 3ID8A 4K0KJ 3D3BJ 3BPDA 3DOMA 5CHCB 3HZEA 4OPAA 1ZBHA 2GGPA 4NLCA 2PO4A 4FWSA 3QZ8A 5KFFA 3VQSA 3PIOQ 1RHKB 5LSOA 1JIHA 2FZGB 4UW2A 3PW7A 4X4VA 3PO4A 3B4MA 4JI0F 2DNPA 1YQHA 4BROA 4QOZB 1YJWS 2EEYA 1QQNA 2XULA 3BP8A 2DO0A 3O1LA 1L3UA 4CJEA 5C24A 1N5YA 5KFVA 2N82B 2HS3A 1RUSA 4USUA 4ECWA 1VQ9S 1S77D 3UO0A 5MAOA 2RF2B 1F1BB 3NWGA 1R8AA 3HT3A 3V6HA 3CD6S 4CLYA 4ED5A 4ISFA 2RU9A 3I4HX 3AVHA 2GZOA 2M52A 3W8PA 2VB6A 3UDLA 2LLZA 3TAQA 2E20A 1C4CA 1CC8A 3L3VA 3HVRA 2GVZB 1RLDA 1RU2A 1ZAWA 2GW8A 3SFGA 2JEJA 3M8WA 3ZTRA 2NR0A 2HAFA 2BH1A 2HQDA 1A5XA 3GQCA 1FVSA 4RG8A 1R89A 2ZITA 2W2MP 3WQUA 3OR2A 3SUNA 3KLGA 2DD8S 1FFSB 3UVJA 2F7VA 5L1KA 3QPIA 5K5MA 5T7BA 5GINA 3IC1A 3ZO7A 2YWGA 4UQGA 1UFLA 3OJUA 1Y10A 1S79A 3T1HK 3HSGA 2V8VA 2ASJA 3O08A 3G71N 3L7OA 4EWTA 2VFRA 2HQ3A 4X64F 1I3AA 4AQYJ 3VZIA 1FFGB 5HROB 4X66F 1YTUA 4LR7A 4CZHA 3DM2A 1G4CA 5E2QA 4TQRA 1JLCB 3A3OB 2M5YA 4PEOA 3TR8A 2HNDB 4RUBA 2UXBF 3K57A 4GVEA 4B9MA 3I87A 3KHHA 3ZZTA 4JLHA 1QD1A 2A10A 3BUZB 2K3IA 1EZZB 2V9WA 3QJPA 2W9CB 3RSEA 2ZF5O 4ZN3A 1WSIA 1JLBA 1XERA 1UPMB 4V1Ak 4DR7J 5JUMA 2R7SA 2YNHB 1QSSA 3MMCA 1RDUA 3VEWA 1UETA 3KHYA 3LP1A 4MTPA 1C0GA 1SKSA 1WDTA 2JEFA 3N5FA 4DV0F 1HNXF 3M8ZA 1NJYA 3ITHA 3RW6A 2RVJA 2EK1A 1BHNA 2HB5A 3PM9A 2ZGYA 2R8HA 2VKRA 3K8WA 3JSBA 3MX5A 1L3TA 2D1CA 3MR6A 4FOIA 4GKJF 4HVZA 4O8KA 1JXLA 5KPRA 4Y2CA 4C11B 2RQ4A 3KKFA 5HVGA 2UUAF 4CGIA 2SXLA 3NH0A 4DF8A 4CFCA 3G8QA 5LT5A 2CADA 5AQFA 4TU7A 1IBLK 2MLZA 4K4VA 3U1LA 1HNVA 1IR2A 3IWXA 2NPIA 3DAWA 2OZSA 2HRTA 3EVOA 3M1VB 4B9QA 3I5AA 3GJQB 4YNQA 1FX2A 4JKEA 2MZ1A 2QM1A 4LFAK 2DISA 3BR8A 1TELA 3N5BA 1TTHB 4DTMA 2Q79A 2I6WA 2RIJA 1IBLF 5DRKA 2GQCA 1U48A 5LMNJ 1WC0A 1TL3A 5E33A 4C7QA 3EMTA 2XMTA 1DTTA 2OPSB 2XMJA 3MECB 1U02A 3TO8A 2UU9K 2H5IB 2ROGA 2ZGZA 3HT0A 1T0TV 3AD7C 5HL7L 2O3DA 2VV5A 3LPEA 4NXNJ 1B0VA 1EKRA 3CEDA 5HK4A 2QYGA 1SPBP 3NS7B 2HVHA 4CK3A 2HBYB 1RCXB 5A8WA 4IO9Q 1NBEB 2BTFA 1VIOA 4B17A 2JOQA 1PJ7A 4FWMA 4F25A 1U4BA 1VQON 4NRTA 3QWUA 3IG1A 5EX3A 1LW0B 5J1EB 1Q53A 4NYPA 1S72S 4LFBJ 2DPJA 1NOYA 1RBVA 4YB6A 3NBPA 5CH7B 2EW9A 1FKPA 1M5HA 4ZLLA 4L8RB 5BRHA 4W5OA 2EFQA 4I9QA 3MEKA 5FPDA 2DNLA 3VVUA 1J5EK 2KM8C 4ED8A 3VZHA 2ASOA 4OJ1A 5IC4B 1SV5B 4C8MA 1TFYA 2YX7A 1NO8A 1VGYA 1XEZA 2VQEF 3L2RA 1OH5A 1WUUA 2WVDA 3R6LB 2EC0A 2L41A 3ATUA 4FF2A 4A48A 1W2IA 1FRMA 4DFKA 2HS4A 1I39A 1HMVB 2O8DB 4PL8A 4NYFA 1S5ZA 3HM8A 3AO5A 5AQZA 3RAXA 4RW8A 1NGEA 5IS2A 2JRSA 1TL1A 2IJNA 1UOCA 4J90A 3CCLS 4OI3A 2FB0A 4JI8J 3B6BA 3DRRA 1RYRA 1HUXA 5HRNA 1A9NB 3SZ2A 1VSLA 2H5EA 4A8OA 3PX6A 1OQ6A 3QERA 2F4VK 4EFAC 4QOTA 1FRKA 5HRSA 2OP5A 1VAZA 3D5MA 4G6VB 4G3IA 3A4TA 3MR3A 4C3MA 3A13A 4LSZB 1XQSC 4DV3F 3AJ2A 4H4MA 3OD2A 5LXRA 2JHEA 2LFVA 3J7AN 3HHDA 1YZ6A 5C2FA 3EZOA 3UDEA 4I9LA 3TTFA 5A8RB 1GFWB 4JI0K 4G65A 1W2BR 2Z1JA 2HFOA 3JQJA 1ZAXA 3L2UA 5RUBA 1N32F 4DCHA 3KLFA 1B4SA 2R7UA 2D0BA 2YV0X 2FHOB 4O3SA 4ZP7A 2I5JA 2IBOA 2VBWA 1S9GA 1NGDA 2HVIA 3C6TB 5DLFA 4ED4A 4BCAA 2VPZB 3OHBA 2IA0A 1H2TZ 1VBYA 1XN9A 1R3NA 1F5BA 3KDOA 4CO0A 5AQTA 4NXNK 3OTBA 1R27B 3CQ8A 2ZKTA 3GZ7A 2CVEA 2J9CA 3QMLA 4KTZA 2ZOFA 2K1RB 3N4QA 3HFZB 2YQ3A 4YOEA 1IR0A 2KFNA 5ADZA 5HJYA 3MCPA 3A8EA 3ZFVA 3K58A 2Q66A 3O6WA 3CJ2A 3VGVA 4N8NA 4OJHA 1M1KT 1RT6B 1N32J 1Q0NA 1HNZK 2QC3A 4WFNL 2CPIA 3A12A 3MCMA 4JS4A 1IV0A 4ECXA 1Y00A 4FF1A 3DI6B 1BU6O 2F9WA 3IAS9 5D3GB 4BR9A 2NUBA 4PHTX 2XM3A 3G6XA 5M1PA 2LXIA 2ASLA 4DL3A 4DQ8A 4JHDA 5HAOA 1VSEA 2ZZTA 5DDOC 4FSVA 2EC2A 2JNJA 4F04B 1Y5IB 2YPZA 5AXLA 1TAUA 4CBUA 3S3OA 2ZH3A 3L2VA 5G0RB 4V19S 4CH1A 4C2MA 4PKIA 5LL6d 2PD1A 1AXQA 2CRLA 3G96A 5D6GA 2F8SA 2GNKA 3ZETA 2BJ8A 2IVYA 1WN7A 3MFIA 1HQUB 1FERA 2EKNA 1Y64A 4OPHA 1PG5B 1I94K 1MMNA 2HMIA 2QTWA 4BR7A 1XMQK 4DQRA 2AYEA 2FJDB 2DR7A 4B3MF 1RBRA 4RBUA 5K20B 3AO3A 3MOJB 1T8EA 3MAAA 4B3OA 3HMJG 2NCKL 3FC9A 3OPKA 5FD1A 5F9LA 1GOCA 4DR1F 3NMAA 3C46A 4OHYA 1FXDA 3PYEA 1YITN 3DFEA 4ED1A 4RNMA 1TMJA 2MPUA 2XO6A 1BGXT 2VASA 1RDRA 4FWRA 2ZM6J 4NX9A 1F2HA 3IRWP 3IMXA 4KGKA 4RBVA 4CE9A 2VUGA 5EX0A 5AXKA 1HPZB 2BKPA 4DV4F 3MXIA 4OLBA 4DG1B 3KXDA 2KHDA 4Y6IA 3I5CA 2DY1A 3D0HE 4FVUA 3J80Y 3UI3A 2AGQA 4JI1F 1EHWA 1JWWA 3OSNA 4M7XA 4DUZJ 3I8DA 2CNKB 1VQ5S 1U8SA 3QT8A 2QSFA 1U0SA 3DOLA 1IO2A 2GMLA 3BR9A 4KJIA 4C48A 2N3OA 2NRZA 1GLFO 4FJNA 4OZNA 4M3YA 2CPHA 2AEFA 5AXMA 3RVCA 3DOKB 1SH3A 2HHPA 5ETPA 1RLCL 4M3UA 5J1NA 2DHGA 2QLXA 4DLGA 5TKWA 5KT2A 4IJAA 1ELOA 3UCGA 4FJMA 1WC6A 5J2PB 1X4AA 2B7BB 4DMNA 4RU2A 1ZS6A 1C0TB 4O4GA 2A18A 1S0NA 1UVNA 4ED6A 3UDVA 2CPYA 4GVBB 3CI5A 3O4QA 3CJ0A 3NGTA 1G7CB 3Q8SB 2OTJS 4QAGA 3BN4A 3QESA 1FI4A 2P9PB