1KVBA

E. coli ribonuclease hi d134h mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCHELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
total genus 54
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvbA00
4FJ5A 3P83D 1XHZA 5SZTA 1TK0A 3JYTA 1BQMA 4WE1A 5D3GA 1A5VA 1EP4A 1B92A 1IKYA 4FLVA 4KRFA 3ZT4A 4DQPA 3C94A 2DFFA 4CERA 1KSPA 4L8RB 1CZBA 1U47A 1RTHA 1KCFA 4KAZA 4E1MA 3QEWA 1BCOA 3NF6A 2QK9A 4FW2A 4CJRA 4W5NA 3CFOA 4CF2A 3TAQA 4DFKA 4KHSA 3ZCMA 4GW6A 1ZYQA 4DS4A 4CFDA 1TL3A 3B6OA 2QKKA 3ZT3A 4KI6A 1X9SA 2YNGA 4JS4A 3AVFA 1RBRA 4XIUA 3OS0A 2GBZA 3ZT0A 3LAMA 3AVGA 3MEEA 4FJGA 2E6LA 3G0ZA 2A1SA 1HRHA 4AHCA 3KD1E 4N76A 1CXUA 4IBNA 1J53A 1Q8IA 1C1AA 3DRRA 5DMRA 5C24A 2VWJA 4CJ3A 4DU3A 4FK2A 3OYBA 1YTUA 3MXMA 4DTRA 4FJ9A 3TAFA 1HQUA 3VQEA 1QS4A 3DRSA 3QLHA 4Z4GA 4CFAA 1CXQA 1RBVA 1VSFA 1D9FA 3OVNA 2DFHA 3LPTA 1RNHA 5HRRA 1RBTA 3SQ1A 1WSHA 1S5JA 1DTQA 3KLIA 4CJVA 4OPKA 2G8WA 1KTQA 4H4MA 1D8YA 2KTQA 1LWFA 5J2PA 4Z0UA 2YNHA 3V9SA 4FYDA 1UWBA 2DTUA 1RTJA 4J2EA 1RCHA 4AHRA 3K5LA 1Q9YA 3LDSA 1J54A 4N56A 3V9ZA 4NCAA 1RDAA 1EKEA 3OS1A 3IRXA 1TAUA 1XC9A 3SUNA 1HYZA 3V81A 4E3SA 3T1AA 1WSIA 4B3OA 4CK1A 4BACA 3L8BA 3SPYA 3AVNA 4IG0A 4E7LA 4CF8A 4CGGA 3TANA 4J2BA 3AVMA 2X78A 3KK1A 4FZXC 3O4NA 3HPOA 3DLGA 4MFBA 3V1OA 2HHUA 3SYZA 1J9AA 4E0DA 2F8TA 2B5JA 3K5NA 2OPPA 4DSEA 3QEVA 1JLEA 2RN2A 4DSIA 2GV9A 1SV5A 3QIPA 4CGDA 4JRPA 3SQ2A 3VQ7A 1T8EA 3NFAA 1T03A 4FZZA 4C8NA 3V4IA 3DM2A 1DTTA 3SJJA 4E7HA 3G10A 5KRSA 1TL1A 1JKHA 3SZ2A 3S3OA 3OS2A 4HUGA 1VSHA 3MEDA 4OKEA 5CZ2A 3VQBA 4HVJA 4PY5A 4CJWA 3CFRA 1U48A 4RW8A 3LP2A 3QESA 1S1XA 4CJEA 4EZ9A 3ASMA 4BDYA 1C1BA 1KFDA 3ZSOA 3SV4A 3RR7A 1IKVA 1ASUA 3WNFA 3S3NA 2EHGA 4I9LA 3MXIA 4Z4HA 3L2QA 4JS5A 4PWDA 1Z26A 3VQPA 1C0UA 3NBPA 2IDOA 1GOCA 4BWJA 3OYEA 3QO9A 1SKRA 4LH4A 4CEZA 3AA3A 1U49A 4Y1DA 1X9WA 1SL1A 4GVMA 4FJKA 1QTMA 2FC0A 4AH9A 3NF9A 4AHUA 4FZYA 4CEAA 3HL8A 2R7YA 4CEFA 5J2NA 1QSLA 5HLFA 1ZBIA 4FXDA 1LAVA 5HRNA 3OJSA 2X74A 3RRHA 4CEBA 3LANA 1NKEA 4DTPA 3VQ4A 4DFPA 4OGCA 3O4QA 4LSLA 1CLQA 4PA1A 1REVA 3KKRA 3OYAA 4FLXA 4M42A 3RMDA 1LV5A 1HMVA 2BE2A 4N5SA 1Z25A 1BIZA 1LAWA 2HHXA 4DWIA 1KLMA 3QEIA 3MAQA 5K14A 3A2FA 2GUIA 5I42A 2XY6A 3V9XA 4R5PA 3TI0A 3SPZA 1HYSA 4CF0A 5CYMA 4CF1A 1BL3A 1WAJA 2OPRA 3UIQA 4BWMA 4I9QA 4BDZA 3KKSA 1JLGA 3ZT1A 3KK2A 3SI6A 3HJFA 3LP0A 4IG3A 4HCBA 3WNHA 3U6FA 1D5AA 4IFYA 1T05A 2B4JA 4CECA 1NJZA 4ELVA 2HHTA 1RBUA 2E4LA 4OKJA 3DMJA 3VQ8A 1YVUA 2XY8A 4Z4FA 1TK8A 3SUPA 4M3ZA 3THVA 5T7BA 1GOBA 1S1VA 3AO4A 3C6TA 2IS3A 4J2DA 3AA2A 4CJSA 3O3HA 3LZIA 4FCYA 1WSGA 4M3RA 4OLAA 3LWMA 4M3WA 1HPZA 1JLFA 4O44A 5I3UA 2QKBA 4B8CA 1L3TA 1U4BA 4Z4EA 2HB5A 3NGIA 1EX4A 1SL2A 4FVMA 4CK2A 4FJ7A 3D45A 4DS5A 4QAGA 3S3MA 4RW9A 4KHYA 4AILC 4KB1A 1RT2A 4CJFA 5FDLA 4ELTA 3IAYA 3L3UA 2KFZA 3AO3A 2E6MA 2BDPA 1IH7A 1UA0A 3AO1A 2D0BA 2VWKA 1JL2A 1RBSA 2YKNA 2VG6A 3SQ0A 2IOCA 3VQDA 3SV3A 4ID5A 4M45A 2DY4A 4DTNA 1RT4A 2I5JA 3K59A 1LW0A 3TWHA 1L3SA 4EP5A 4CJ4A 3EZ5A 3AVKA 1J5OA 2G8IA 4NYNA 4AHVA 4DQIA 4N41A 3PUFA 3PX6A 3MXJA 4LSNA 4M41A 4CJQA 1RDCA 3DOLA 5HROA 1TKZA 4DFJA 1A5WA 4B08A 4CEEA 3CG7A 4CJPA 3HP6A 4JLHA 3NE6A 4JRQA 1HQEA 2Z1IA 3BGRA 3KLFA 4E7IA 4CFBA 1ZBLA 1K6YA 3K5OA 1YT3A 3QERA 2G8KA 4K8XA 2DFEA 3HK2A 3DOKA 3RWUA 5JS2A 4UQGA 5HP1A 4DMNA 1HNIA 4B9UA 4B9NA 4OVLA 4OGEA 4DQSA 4CGJA 4DU1A 3QEXA 4ZTFA 3PO5A 3RR8A 2PZSA 1HYVA 3TABA 4E7KA 3DLKA 4EP4A 1GOAA 1CZ9A 1EETA 2YHBA 4O55A 3NH2A 3PX0A 1ITGA 4DSLA 3V6DA 3O3FA 1NKCA 3LAKA 3DLBA 4KB0A 1S1WA 1NOZA 3M8RA 2YV0X 3AVHA 4DTMA 4FK0A 1VSIA 3FFIA 4DG1A 1KVAA 1TK5A 1RT7A 5SWMA 3OYDA 2VG5A 2YKMA 4QCLA 3RMBA 3ITHA 2HW3A 3RMAA 4DQQA 3CQ8A 2G8HA 3SCXA 4CHNA 4E19A 3KK3A 4F2SA 1VSMA 3D0PA 1A5XA 3SNNA 4C8LA 2ETJA 2P1JA 2ATQA 4IDKA 1S1UA 3KTQA 3DI6A 5CZ1A 4E7JA 2OYQA 4B9LA 1JXBA 5FRNA 3NH1A 2HHSA 4B9VA 4CCHA 1IKWA 3VQQA 1RT5A 1T7PA 4J2AA 1Y97A 1S6PA 1SL0A 1VSJA 1WSJA 1TKXA 3IS9A 3PX4A 1NJWA 3NHGA 2Q3SA 4C8MA 2RPIA 5C25A 3ALYA 2IAJA 1BCMA 2KW4A 3NGYA 3K58A 1TV6A 3LWLA 3ZSYA 3CYMA 3OY9A 4W5RA 4FW1A 3LZJA 4DTXA 2WOMA 3NDKA 4KTZA 4CK3A 3RRGA 1FK9A 1LWEA 1RT6A 3B6PA 3O3GA 2OA8A 1QHTA 2HHVA 3JSMA 4CHYA 2WONA 3M8SA 3ZSXA 3F73A 3I0RA 1UA1A 3HVRA 1LW2A 3CM5A 4LY7A 4FLZA 2PYJA 1C1CA 2HNYA 3BDPA 3QNNA 4ID1A 2B6AA 3NF7A 1KFSA 1N5YA 5J1EA 4DQRA 3OYHA 3OYGA 5CY4A 3ZSRA 1XWLA 4CIFA 2NUBA 3KLGA 1L3UA 3OYFA 3V1RA 1S1TA 4IFVA 4CJ5A 2Y1IA 4FJMA 4KPYA 2EX3A 2RKIA 3M8PA 4EZ6A 4KO0A 5HBMA 2FBTA 1L5UA 4CIGA 4N47A 3VQAA 5EU7A 4BDPA 4CEQA 4FJIA 4I7FA 1S9GA 1QSSA 5KGXA 1L3VA 3HVTA 3KJVA 1IO2A 3LPUA 4FM1A 2XY7A 3SUOA 5E41A 3PY8A 1U45A 2YHAA 3DLHA 2Z1GA 3ZT2A 4CE9A 4FLWA 5KGWA 4DTUA 4CF9A 2D5RA 1BI4A 1ASWA 3ZSQA 1BI4B 2HNZA 3QETA 2F8SA 4FJXA 1VSKA 2IGIA 1I3AA 4CHQA 4RW6A 3K57A 4Z4CA 4HHTA 1C6VA 1VSDA 1WN7A 5C42A 4ICLA 1B9DA 3AO2A 4KTWA 3AA4A 5KRTA 2O4IA 2D0AA 2ZQBA 2ZD1A 5HRSA 3HT3A 2HVIA 4FJ8A 2P51A 1ZBHA 4K8ZA 3C6UA 4DF4A 1QE1A 2Z1JA 3WNEA 3VQ6A 3OYJA 4OLBA 3VA3A 4CJLA 1MU2A 5FRMA 3L3VA 3VQCA 4I2QA 4W5OA 3TAGA 4ELUA 1VK0A 2BGGA 1FKPA 3MECA 2IC3A 3HPHA 4HUEA 2AJQA 3OYIA 1NK9A 3MEGA 3HYFA 2HNDA 3E01A 1WAFA 4KFBA 3TAPA 3KD5E 4M3YA 3U3YA 2P5OA 4DU4A 1KVCA 4DTJA 1NK8A 4Q0BA 2FBYA 1R0AA 1NJXA 4PQUA 4BE1A 1NJYA 4B9SA 4KHNA 4CIEA 4DLEA 3V9WA 4GMJB 4O4GA 4FJHA 5DK5A 5JS1A 1VRUA 4NYFA 2XRIA 3S9HA 4F8RA 3NF8A 3ZSWA 1IKXA 3NH0A 3DLRA 4E1NA 4DLGA 4IKFA 4DSFA 2YNIA 1NK4A 3QNOA 1TVRA 3VA0A 3HPGA 1RTIA 3AVBA 1RT3A 3LALA 3KLHA 1O1WA 2FBVA 4HTUA 4B9MA 2RF2A 1QQCA 1HNVA 4CJTA 4CJKA 4DTOA 3U3GA 4ZHRA 1X9MA 1XHXA 4QOZB 4Q5VA 2P5GA 4KI4A 4O5BA 1VRTA 1RT1A 1S6QA 1I39A 1W0HA 3DYAA 4Y1CA 5KI6A 2W42A 1NK0A 4KKOA 2HHQA 3OYCA 2KFNA 2D0CA 3WNGA 3OYMA 4ZTJA 2KQ2A 3ISNC 3EYZA 2KZMA 2Y1JA 2OZSA 3ZSZA 4AHTA 5CYQA 1BIUA 1F21A 2G8FA 2YNFA 2XO7A 4E89A 3KLEA 3ZSVA 2ZE2A 4LH5A 4PUOA 3QIOA 3M8QA 3T3FA 4FM0A 2BANA 5KTQA 3TAEA 1KLNA 3HXMA 1BHLA 1ZBUA 3I0SA 4YNQA 1U04A 3HSTB 2F96A 4CJUA 4CHPA 1Q9XA 5J2MA 3P1GA 3OYKA 4BE2A 3L2UA 4I2PA 4FJLA 5HRPA 3DLEA 4NCGA 1FKOA 3EY1A 1RILA 1W9HA 1NKBA 4M3TA 4OPJA 1EXQA 3VQ9A 5FROA 1SUQA 2FBXA 3C95A 2OPSA 3AVIA 4CGHA 3QEPA 4F4KA 4FJNA 1NOYA 3VQ5A 4DSKA 1S9EA 4CEDA 1UOCA 4CESA 1TKDA 4O0JA 4DF8A 4W5QA 3LP1A 4CGIA 4KHQA 2KZZA 1JXEA 1WLJA 2A1RA 4FJJA 1UAXA 3LP3A 2O4GA 4RG8A 1YTAA 3F9KA 4DSJA 3I8DA 3L2RA 1X1PA 1XI1A 3H08A 4RW4A 4C8KA 1C0TA 1NK7A 4RW7A 4DFMA 1QSYA 2HVHA 1JLAA 4OJRA 1JLQA 3AVCA 3IG1A 1ZBFA 2ITGA 3NGZA 3AVAA 2PY5A 4KHWA 5J2QA 3RTVA 4F3OA 2HHWA 4FLTA 3OYNA 3T19A 4Z4IA 1DLOA 3PV8A 4B9TA 1KVBA 3ULDA 2XY5A 4HCCA 3DRPA 4G1QA 4CGFA 1FXXA 1WSEA 1B9FA 4DTSA 4F3TA 4B8AB 4MQ3A 2OPQA 4FLUA 2G8VA 2LSNA 4W5TA 3KIOA 1JL1A 3TAMA 4KHUA 1RTDA 1C0MA 4KV8A 3NCIA 2VG7A 3NAEA 1ASVA 3QINA 1SKWA 1TKTA 1IG9A 1VSLA 4C8OA 1KRPA 4FK4A 1JLBA 3CFPA 3K5MA 1LWCA 1RDDA 2JLEA 3AVJA 2HMIA 4BE0A 2QXFA 1RDBA 4M3XA 4KREA 3TR8A 2JGUA 4AHSA 3TARA 2G8UA 3HM9A 4CHOA 4KTQA 1BQNA 1VSEA 3L2VA 3AO5A 4FLYA 1WNSA 4M3UA 4O0IA 2OZMA 2PYLA 4HUFA 2X6NA 2Z1HA 4H8KA 1HJRA 1TGOA 3V9UA 1BGXT 3AVLA 3CM6A 1BISA 3SQ4A 1JLCA 1G15A 4YFUA 1NK5A 3K2PA 4H4OA 4TSXA 3RMCA 4CEOA 3L2WA 4NCBA 3HO1A 2XHBA 3SUQA 1N6QA 3V1QA 3P5JA 1SKSA 4CFCA 4OKKA 1WSFA 1D9DA 3HP9A 3OYLA 3AA5X 1NK6A 1TAQA 4LD0A 3VN5A 3PO4A 4F2RA 2X6SA 3AV9A 3OJUA 4FM2A 4CHZA
chains in the Genus database with same CATH superfamily
5KPTA 1XHZA 4XH5A 4BRDA 3T69A 2AA4A 3EL2A 2QEXN 4HTLA 5AQYA 2DFFA 1SAZA 1BCOA 4FW2A 3CFOA 4CF2A 4JI2K 3ZCMA 2E1YA 4DS4A 4CFDA 2QKKA 3ZT3A 4XIUA 1RBRA 1ZXOA 3HI0A 3SMSA 2PFUA 3A5NC 2E6LA 2A1SA 4DQ8A 1CXUA 5DMRA 4DU3A 1C1AA 3MCPA 4IZ9A 4CJ3A 5ADXA 3OYBA 5M1QA 1TYQB 4BGBA 1CXQA 1VSFA 5HRRA 3PSFA 1WSHA 4OPKA 4GVEA 1D8YA 4BG8A 3ZEUA 5C2DA 4A62A 3V9SA 3PLAA 1BG3A 1UWBA 4IJAA 1RTJA 2ASOA 2ZJRL 1VQ6N 4M63C 1J54A 3D2EA 3D2EB 1CZAN 1EKEA 3VESA 1T3VA 4BRIA 4XEIA 3AVNA 3TANA 4J2BA 3CQXA 2CGJA 3AVMA 3KK1A 1Y64A 1ATRA 3DLGA 2HHUA 4LF5K 3HOSA 4E0DA 2B5JA 4O8UA 4PKGA 3WT0A 1SV5A 4CGDA 3NFAA 4CI6A 1E4FT 1DTTA 1YF5L 3LDPA 2IIRA 3SZ2A 5KRSA 3QMLA 1JKHA 3OS2A 4DB3A 1VSHA 5CZ2A 3VQBA 4PY5A 4CJEA 3SV4A 2Q97A 3WNFA 3S3NA 3O8MA 5AQKA 1ZC6A 3F2KA 4BRKA 4CEZA 4GV9A 1X9WA 1SL1A 2WBNA 2FC0A 1GLLO 1QSLA 1NG9A 5BREA 1NMNA 4OO1J 3RRHA 3LANA 2IVOA 5FLXO 4YDUA 4FLXA 4M42A 3MN6A 4JI4K 3TSQA 4N5SA 1BIZA 1Z25A 4DR2K 1LAWA 3JXUA 1W2BM 2HHXA 4BR9A 2FXUA 3CJ9A 5I42A 4R5PA 3SPZA 3VEOA 5CYMA 1DKGD 3UIQA 1QQNA 4BWMA 4KHPK 2QWMA 3HJFA 4IG3A 1QQOA 2H3GX 2O8DB 3H3NO 2ZGYA 1NJZA 2HHTA 3DMJA 1TK8A 3C6TA 2O8EA 4A59A 4FCYA 3LZIA 2O8EB 3R8EA 3O9QA 2WFBA 1JLFA 4O44A 3WEEA 3WEEB 1YVNA 4WQ5A 1L3TA 2HB5A 5BN8A 1EX4A 5LMUK 4BVPA 4FWPA 4DUZK 4RW9A 4AILC 4KB1A 4ELTA 3BZCA 3VOVA 2J4RA 2QWRA 3MK6A 5LL6Z 2RE2A 4BQZA 4CJ7A 2BDPA 1IH7A 5LJVA 4ISEA 4PL7A 3EEQA 1RBSA 3VQDA 3KK7A 4M45A 1E4GT 1RT4A 5C12A 1LW0A 1BUPA 3GE1A 4EP5A 4CBXA 2A5XA 5LJWA 1RDCA 3O1WA 4FL9A 4B08A 4H0OA 2Z1IA 4OLAA 3KLFA 3E1YA 4K8XA 2G8KA 2DFEA 3HK2A 3DOKA 3RWUA 1S72N 4GV3A 4ZTFA 3RR8A 3BUZB 4JK8A 4NB4A 5FPEA 3TABA 4EP4A 1GOAA 4JI0K 3A0IX 3LAKA 4B1XB 3DLBA 1K73O 1NOZA 1NGFA 3FFIA 4JK7A 1ZBSA 5AQLA 4B1UB 4F2SA 1VSMA 1A5XA 2OYQA 1JCGA 5CZ1A 1LOTB 2YJEA 3SAGA 5FRNA 3SAHA 3M5RA 1IKWA 1S6PA 5C15A 1VSJA 3IS9A 1TKXA 1WUAA 2ZF5O 2Q3SA 1LCUA 3ALYA 4FPAA 1BCMA 3NGYA 3CI5A 1TV6A 3ZSYA 3OY9A 2WOMA 3NDKA 4KTZA 4NXMK 4CK3A 3C6AA 3RRGA 1QHTA 3JSMA 1UA1A 4DV0K 3CM5A 1C1CA 2HNYA 3BDPA 3QNNA 1VQNN 1VQ7N 4WYBA 1KFSA 4BR7A 4QS7A 3OTOK 4DR4K 1SZ2A 2Y1IA 3DXMA 1ATSA 3DXMB 4EZ6A 4KO0A 3MN5A 2CH6A 4JKAA 3VQAA 3A5MC 5EU7A 2BH1A 4I7FA 3R1XA 2W6KA 2XY7A 3CJAA 5E41A 4DR5K 2W40A 3DLHA 3ZT2A 4CE9A 2NZTA 3P4IA 3ZSQA 4J8FA 3W3DA 2P9NA 2P9NB 3QFUA 3K57A 4Z4CA 4E7IA 1VSDA 1WN7A 2O4IA 3AA4A 2D0AA 3HT3A 1ZBHA 3A5OC 4IO9L 3VA3A 4I2QA 4LFBK 1NLVA 1FKPA 3FZMA 1VQKN 3HYFA 3E01A 1WAFA 3O9SA 5M1KA 4M3YA 3U3YA 2P5OA 3QB0A 4DTJA 5AQJA 4IFEA 4CIEA 1GLBG 4GMJB 1VQ8N 1VRUA 4F8RA 3NF8A 5EVZA 4AQYK 4BRCA 5AQUA 3ULEA 3ULEB 2P9SA 3U9ZA 2P9SB 4FWNA 1TVRA 3HPGA 3AVBA 1RT3A 1HNVA 2OTLN 4DTOA 3LL3A 3O08A 3U3GA 3JS6A 5GAGP 1X9MA 1XHXA 5AQHA 2P5GA 4O5BA 1VRTA 4BRFA 1I39A 3DYAA 3ATUA 1JCEA 3SJHA 3WNGA 3ISNC 2FSJA 2KZMA 4U7BA 4AHTA 2XO7A 2E2NA 3QIOA 1N34K 2WC9A 2NLXA 1OH5A 3LDQA 1KLNA 5JLFA 1KAZA 3CMEN 1U04A 1I94K 1J6ZA 1FJGK 5F2RA 3P1GA 4YOVA 5M1FA 3VQ9A 3HOTA 2FBXA 3C95A 4CGHA 2OPSA 3J80O 3K0SA 1VQ5N 3L4IA 4YOWA 3VGKA 4B1VA 4DSKA 1S9EA 4LF7K 4KHQA 4CGIA 1WLJA 2A1RA 1VQPN 1T44A 3I8DA 1X1PA 5CHIA 1JLAA 1JLQA 3IG1A 2ITGA 3RTVA 3A8YA 3AGRA 1KVBA 5E26A 1VQ9N 1NGCA 4HCCA 4WF9L 4DTSA 4F3TA 4FLUA 2LSNA 1JL1A 1C0MA 4EFHA 4KV8A 4B1YB 4C8OA 1IG9A 1KRPA 1MWMA 2KHOA 3DWLA 3AVJA 3H1QA 3BZKA 2G8UA 3O4WA 2FF6A 3HM9A 3RSEA 4CHOA 1BQNA 3RSEB 4KTQA 3WXIA 4H8KA 1BGXT 3AVLA 3U8XA 1BISA 1BWFO 1JLCA 1G15A 1NM1A 1N33K 3K9KA 3FZKA 3L2WA 4YOTA 3CJ1A 3V1QA 4OKKA 1D9DA 3FE1A 4OPHA 1NK6A 3L0QA 3BP8A 3VN5A 2X6SA 3AV9A 4FM2A 5BR8K 1TK0A 4WE1A 5D3GA 1EP4A 3VEZA 1B92A 3C94A 3NVMA 1KSPA 4L8RB 1RTHA 3QEWA 3LDNA 2QK9A 3TAQA 4KHSA 5GAEP 3AVFA 4K43A 4F9OA 1DT9A 4X66K 3J7ZO 4FJGA 3AVGA 1TUUA 1HRHA 4IBNA 1Q8IA 1VQLN 3SBTA 1YTUA 3MXMA 4FJ9A 4FOIA 1E3MA 1HQUA 2E2OA 3DRSA 2F9WA 1RBVA 5E84A 2DFHA 5BRFA 1NU0A 5J2PA 2FSKA 4J2EA 1RCHA 1Q9YA 3LDSA 4N56A 3V9ZA 3IRXA 5AQWA 2EWSA 4BACA 1OH7A 3L8BA 3LM2A 5BPMA 4FZXC 4A2BA 3W0LA 3O4NA 4MFBA 3V1OA 3CQYA 3RVCA 3SYZA 1NGDA 3K5NA 4IEIA 1JLEA 4DSIA 5MLCQ 4JRPA 3SQ2A 1T8EA 1VAZA 3VQ7A 2A6AA 4C8NA 3DM2A 1U6ZA 2GWKA 4LC9B 1TL1A 5GIOA 4OKEA 3CFRA 1U48A 3D6RA 3LP2A 4IO8A 5AQOA 3ASMA 3BF1A 1C1BA 4JKBA 1HX1A 1ASUA 2EHGA 4Z4HA 3L2QA 4O5FA 4JS5A 4PWDA 2O8CA 5FPDA 2O8CB 1SKRA 4LH4A 1HR0K 4GVMA 4AH9A 3NF9A 4CEAA 2R7YA 3R3LA 2UXDK 1LAVA 1NKEA 1QZ5A 4DTPA 3VQ4A 4DFPA 1REVA 4JI6K 1LV5A 5KQ8A 3VF2A 1BU6O 2YCHA 3QEIA 3VETA 3O9UA 3GL1A 1Q18A 4I9QA 2VCPA 2ZM6K 4BDZA 3KKSA 3ZT1A 1RFQA 3ID8A 5BN9A 2UXBK 1HLUA 1KC8O 4CD1A 1EQYA 3U6FA 1D5AA 2VYPA 4CECA 3KWIA 2E4LA 2VWBA 3MMVA 1GOBA 3AO4A 2IS3A 4MDBA 2P9KA 2P9KB 1RDUA 1U4BA 4FWMA 3PIPL 1SL2A 4FVMA 1OH6A 4DS5A 3CC4N 4B1WB 3S3MA 3VEVA 4KHYA 3TTCA 4CJFA 3L3UA 2KFZA 2OCEA 2WTUA 4H5NA 3ZX3A 1UA0A 4BROA 4LF9K 3SQ0A 1NGIA 5TKYA 4ID5A 3TWHA 1L3SA 4JKFA 4CJ4A 2G8IA 4GNIA 4AHVA 3PUFA 3PX6A 4JI7K 4LSNA 3OBYA 4EIAA 4CEEA 3CG7A 1Q7YO 3NE6A 2JWKA 3P38A 1HQEA 3BGRA 2GX9A 4CFBA 1K6YA 3QERA 4YOXA 4BVOA 3ZEUB 3MWTA 4UQGA 4CZIA 2E8AA 1OKJA 5C10A 1GLCG 1NGEA 3ZYYX 4DQSA 4BR0A 2QWQA 2PZSA 4LFAK 4E7KA 1CZ9A 3J7AP 1ITGA 3V6DA 3K9JA 1S1WA 4KB0A 4KBOA 4DV4K 4DG1A 1KVAA 3M6GA 4FSVA 3RMBA 4CZFA 5GADP 5AQQA 2HBLA 4CHNA 3KK3A 2OTJN 3SNNA 2ETJA 1S1UA 3IFRA 3DI6A 1NGGA 5LMNK 4B9LA 1JXBA 5JLHA 3NH1A 2HHSA 4B9VA 4IWVA 5F0XA 3VQQA 1RT5A 4J2AA 1NJWA 3PX4A 5AQTA 5C25A 2IAJA 2KW4A 3CYMA 4W5RA 3LZJA 3H1VX 2UXCK 4BQLA 1C0GA 3TTFA 4H5WA 4B3TK 4BRGA 4A57A 4QS8A 1FK9A 1LWEA 1RT6A 1DGKN 3M8SA 3ZSXA 3KWGA 4LY7A 2PYJA 1KQSM 1VHXA 2PBDA 1HUXA 1SS6A 2B6AA 3NF7A 4OX9K 1XQSC 4KH4A 3IUCA 1XWLA 3OYFA 1S1TA 1YUWA 2JWLA 4M7YA 4PHTX 1XNQK 2GUPA 5HBMA 4CIGA 4JN4A 4N47A 3BF3A 4BDPA 5HOOA 4JKHA 1J5EK 1QSSA 5KGXA 3D2FA 3D2FB 4BRMA 4BR5A 3SUOA 3QFPA 1U45A 5IWAK 2Z1GA 2W6LA 3HTVA 4JHDA 1BO5O 4JHDB 1BI4A 1ASWA 1W97L 1BI4B 2HNZA 3CHWA 3FFKB 3WQTA 2UUCK 2F8SA 1VSKA 4BC3A 1I3AA 1N36K 2ZD1A 4DV5K 2P51A 5AQSA 4K8ZA 3C6UA 2QWLA 4OLBA 2VQFK 3GG4A 1MU2A 4ELUA 3SBGA 3MECA 2IC3A 3HPHA 4EAHD 3CCUN 3OYIA 3F5TA 3MWPA 1NBWA 2OANA 5ELZA 3FR0A 1V4SA 2UU9K 3HRGA 1IV0A 4DU4A 1NJIO 1KVCA 3CCJN 1YHQN 3ZETA 3ZETB 4C1NK 3CCEN 5C2FA 4B9SA 4DLEA 3FZFA 3O9TA 3NMUA 5JS1A 4NYFA 2XRIA 3NH0A 3C65A 4BRNA 4DLGA 2YNIA 4I6MA 1NK4A 4I6MB 3VA0A 1RTIA 1XNRK 1QQMA 3CPEA 4H0PA 5BPNA 3VGLA 2RHKA 5BRDA 4HTUA 4CJKA 3AY9A 4ZHRA 4KI4A 4K0KK 1ILYA 2HHQA 2D0CA 4DR7K 2D0OA 4ZTJA 4OPAA 2OZSA 1NGHA 1F21A 2G8FA 3P39A 2V51B 4LH5A 4PUOA 4V19S 3DAWA 3OHRA 2NRVA 4FM0A 1XMQK 1M90O 4KH6A 3HXMA 3CPWM 4CJUA 4CHPA 1Q9XA 5J2MA 4BE2A 5GIPA 4I2PA 5HRPA 3CC2N 3ATVA 1OH8A 1EXQA 4FPBA 5FROA 5H1SQ 2GEMA 4NLBA 3VQ5A 4FOEA 4CESA 3VERA 4DF8A 2KZZA 3WQUA 4W5QA 2Q0UA 2O4GA 4DSJA 1P90A 3HBTA 3L2RA 3H08A 4RW4A 1QSYA 2HVHA 3AVAA 4YORA 4A61A 4KHWA 3JAMO 4NXNK 3T19A 1NGAA 4B9TA 1WSEA 4CZGA 4MLEA 3KIOA 4JI5K 3I33A 4KHUA 1RTDA 4ISGA 3NAEA 3VTHA 1TKTA 1GLEG 3CC7N 1JLBA 1HKBA 3K5MA 1LWCA 4M3XA 2QXFA 2ITMA 1G99A 4KREA 3TR8A 3TARA 1VSEA 4FLYA 4O0IA 3E9PA 2X6NA 2Z1HA 3IMXA 4U67L 4TSXA 1NMDA 4CEOA 4BR4A 4IEEA 3OBWA 4JI8K 3HP9A 3OYLA 3AA5X 1EO1A 4WQ4C 2HSTA 4YOYA 4LD0A 2ZWHA 4DV6K 4MO5A 2VGNA 2UUBK 2ZJQL 5SZTA 3JYTA 1BQMA 2Q31A 2YHWA 1IKYA 1WBBA 4CERA 2HMPA 1BOTO 1KCFA 4KAZA 5AQZA 3NF6A 1C0FA 3CETA 4DFKA 4JNEA 1ZYQA 1TL3A 3B6OA 2YNGA 3SK3A 4FWRA 3OS0A 3ZT0A 2QWPA 3KD1E 4AHCA 2QW9A 5C24A 1D4XA 3THYA 3THYB 3AAQA 2KKZA 4IJNA 4DTRA 4FWQA 3CCMN 3TAFA 3VQEA 1QS4A 3QLHA 4CFAA 1KXPA 5FPNA 1RBTA 3KLIA 1DTQA 3WXKA 4CJVA 2G8WA 1KTQA 3G6EN 1N32K 2KTQA 4RTFD 3EN9A 4Z0UA 1R59O 2DTUA 2IVNA 4AHRA 3K5LA 1HNZK 3U4LA 1RDAA 3OS1A 4NCAA 1XC9A 1HYZA 3V81A 5HL7L 3O9RA 4H5RA 4E3SA 1YJNN 1WSIA 4CK1A 1MDUB 4CF8A 2GELA 2HBJA 3HPOA 1QVFM 3M3ZA 2YX6A 2OPPA 5AQFA 2GV9A 4E7HA 3HM8A 3S3OA 1JJ2M 3UB5A 1HPMA 4HVJA 4CJWA 1S1XA 4EZ9A 1H1VA 4H0YB 3ZSOA 1IKVA 4I9LA 3MXIA 1QHAA 3WXMB 2VGMA 1Z26A 4BRPA 3VQPA 2IVPA 3NBPA 2IDOA 1GOCA 3QO9A 1Z05A 2YJFA 3AA3A 4FJKA 4Y1DA 1QTMA 4FZYA 4AHUA 1ZBIA 4FXDA 3HL8A 4CEFA 1IG8A 3AAPA 5J2NA 5HLFA 5HRNA 4CEBA 1JCFA 5AFUH 2O8BA 2O8BB 4OGCA 3O4QA 4PA1A 3OYAA 2D1KA 3RMDA 2BE2A 4JD2A 4JD2B 1IBMK 3MAQA 5K14A 3V9XA 3TI0A 3MX2A 2A41A 1HYSA 1WAJA 5GINA 1K8AO 3A5LC 1JLGA 4DV7K 1X3MA 1K9MO 4HCBA 3WNHA 1T05A 4ELVA 1RBUA 3N4PA 3CCLN 4OKJA 3VQ8A 1YVUA 3WXLA 3SUPA 5T7BA 2P9PA 4J2DA 2P9PB 5AQXA 2ASPA 2QM1A 2O8FA 4CJSA 3O3HA 2O8FB 4CVNE 3LWMA 4M3WA 1HPZA 4H03B 5I3UA 2QKBA 4CZEA 4K42A 4Z4EA 3T1HK 3EKSA 4CK2A 3D45A 2W41A 3L6QA 4FWSA 4QAGA 4NO7A 1SQKA 5FDLA 5BR9A 3IAYA 3AO3A 3KHYA 2E6MA 3Q7BA 4B3RK 5M1OA 2YKNA 4E1JA 2IOCA 3K59A 1GLDG 2QA4N 3H6EA 3AVKA 1P8ZA 4DQIA 4N41A 2GWJA 4ILHA 3CXCM 4M41A 2I7NA 4CJQA 5HROA 5CR4A 1TKZA 4DFJA 1A5WA 2GTDA 4YDUC 4CJPA 3HP6A 4B3OA 2HHHK 5HP1A 4DMNA 1BA0A 4B9UA 4CZJA 2YHYA 4OVLA 4OGEA 4GKJK 3QEXA 4WFNL 4QS9A 2PAVA 2YHBA 4ILJA 3NH2A 4DSLA 3O3FA 2NRXA 5TKWA 4DTMA 2YV0X 3AVHA 4FK0A 3J7YP 3C6HA 1TK5A 3OYDA 3VGMA 3KVGA 2BUPA 4QCLA 5BPLA 1VQMN 3ITHA 2HW3A 3DXKA 3RMAA 3DXKB 4IOCL 1YJWN 2G8HA 5LY3A 3SCXA 1KAYA 3CERA 1X3NA 2P1JA 4IDKA 3KTQA 4WQ5C 4E7JA 1T7PA 1Y97A 3IKMA 4JK9A 2RPIA 5JICA 4WCEL 3CJCA 2QWOA 3K58A 5KPRA 5EX5A 3C0BA 4DTXA 4FW1A 1YI2N 3AARA 4X62K 3DLLL 1X9JA 4AM6A 5AJ3K 3B6PA 3O3GA 3I8BA 4BRQA 2OA8A 3CIPA 2AP1A 3WXJA 4CHYA 3F73A 3I0RA 1NWKA 4FLZA 1GLJO 4JKEA 4ID1A 1N5YA 3AGKA 4JKCA 4AF1A 5J1EA 4DQRA 1U2VA 1U2VB 4EHTA 5CY4A 4CZKA 3KLGA 1TAUA 1GLFO 2NUBA 2HF3A 1CLQA 3V1RA 4IFVA 4KPYA 3M8PA 2NRZA 2FBTA 1L5UA 1WBDA 3FGUA 4IOAL 1NNEA 4FJIA 1L3VA 1BDGA 4LF4K 3PY8A 3G71N 2YHAA 4UY8O 4DTUA 4CF9A 1IJJA 4FJXA 3ZX0A 2VQEK 4JKGA 4JKGB 5C42A 4ICLA 1GLAG 2A3ZA 3AO2A 5KRTA 2HVIA 4FJ8A 3CCRN 4DF4A 2Z1JA 3VQ6A 4CJLA 3L3VA 3VQCA 3TAGA 4W5OA 1VK0A 5AQPA 4BC2A 3E9OA 3VEXA 1NK9A 3MEGA 1K8KA 2HNDA 1K8KB 4KFBA 1YITN 4JEPA 1NK8A 2FBYA 1R0AA 1NJXA 4PQUA 2ASMA 3V9WA 5AZJA 4FJHA 2DPNA 5DK5A 5AZJB 1YJ9N 1IKXA 3BY5A 3DLRA 5KPZA 4E1NA 4IKFA 4DSFA 1ATNA 5AZIA 5AZIB 4YHHK 3KLHA 1O1WA 2FBVA 2RF2A 1QQCA 4CZMA 5AQNA 1TYQA 3S41A 1W0HA 4ILGB 5KI6A 2W42A 3THXA 3THXB 1NK0A 2KFNA 3OYCA 5F1XA 3ZSZA 2WUSA 5CYQA 4MDAA 2YNFA 3HZ6A 4E89A 3KLEA 3ZSVA 3M8QA 1DEJA 3I0SA 4YNQA 1KAXA 4CZHA 3QBWA 5AQIA 4FJLA 3OW2M 3EY1A 1RILA 4OPJA 3I56N 1MA9B 1SUQA 3AVIA 4F4KA 3QEPA 4FJNA 2UYTA 2CGKA 2A40A 3TU5A 2QXLA 4B3MK 1UOCA 5I9EB 4H0TB 3BEXA 3D7EO 2F7TA 4FJJA 1UAXA 3LP3A 3F9KA 5IT9O 1XI1A 4C8KA 1C0TA 1NK7A 4RW7A 4DFMA 5BRHA 4OJRA 1ZBFA 3SMPA 3T1YK 4F3OA 5DM6L 1IBKK 4FLTA 3OYNA 4PL8A 4Z4IA 1DLOA 5AQVA 3ULDA 4CGFA 4H0XB 1VQON 1FXXA 1B9FA 4K41A 4PKIA 4W5TA 3TAMA 5JVHL 4WFBL 3NCIA 2VG7A 3VEYA 3QINA 1SKWA 4FWLA 4AM7A 2CH5A 4FK4A 4CD3A 2JLEA 2HMIA 1RDBA 2FSNA 2JGUA 4AHSA 4H5VA 3O1BA 2PYLA 3V9UA 3CM6A 3GDQA 3SQ4A 1HKCA 4O8KA 4NCBA 2O8DA 4B9QA 3HO1A 3SUQA 3P5JA 1SKSA 4CFCA 4DHYA 3UE5A 4XH1A 5ADXH 1YXQA 3G25A 4CHZA 4Z4GA 3O6WA 4FJ5A 5EY4A 3P83D 4IOXA 1A5VA 1S22A 1V4TA 1XUPO 4FLVA 4KRFA 3ZT4A 4DQPA 2V7YA 2Q0RA 1CZBA 1U47A 4E1MA 5JVGL 4CJRA 4W5NA 3ZLJA 4GW6A 2HF4A 4KI6A 1X9SA 4JS4A 2D0PA 5EXWA 2GBZA 3LAMA 3MEEA 3G0ZA 4N76A 4ISFA 1J53A 3DRRA 4JI1K 2VWJA 4FK2A 3O5BA 5KQDA 3CCVN 4BC4A 3OVNA 1D9FA 4EHUA 3LPTA 1RNHA 3M1FA 3SQ1A 2D4WA 4DR6K 1S5JA 4H4MA 1LWFA 2YNHA 4FYDA 4JI3K 3MDQA 2E5LK 3CCSN 5AR0A 4HWIA 4RWTA 3NVKA 3SUNA 4PKHA 3T1AA 4C1NI 3SPYA 4GKKK 3OA9A 4IG0A 3TSPA 3ZX2A 4CGGA 3H3OB 4E7LA 1M1KO 2X78A 1Q81O 4BREA 1J9AA 2F8TA 3PSIA 3WUHA 1YIJN 4IDHA 3CMAN 4DSEA 1HNXK 3QEVA 2RN2A 3QIPA 1T03A 4FZZA 3V4IA 3VPZA 3SJJA 3G10A 3MN7A 4HUGA 3MEDA 1TUYA 2A42A 2E20A 3VEWA 4RW8A 1EWQA 3QESA 2FLOA 5M1PA 4BDYA 1KFDA 3RR7A 3TSUA 1BA1A 1C0UA 4IXCA 4BWJA 4YY3K 3OYEA 2E2QA 1ESVA 1U49A 3VMFB 3LDOA 3OJSA 2HBMA 2X74A 3C7NA 3C7NB 4LSLA 3SLCA 3KKRA 4FWOA 1HMVA 1QZ6A 4DWIA 1KLMA 3TTDA 3A2FA 2GUIA 2XY6A 3MCAB 4K25A 4CF0A 4CF1A 1BL3A 1NGBA 2OPRA 3H46O 3J8AA 3KK2A 3SI6A 3LP0A 3UKUA 3UKUB 4R79A 4JKDA 2QTDA 4IFYA 2B4JA 5JMVA 4X65K 2XY8A 4Z4FA 4M3ZA 3THVA 1S1VA 3QBXA 4YOUA 5AFUA 3AA2A 1WSGA 4M3RA 1T6DA 4CBWA 4MLHA 4B8CA 2F9TA 4CW7B 2NRTA 3NGIA 4XH4A 4FJ7A 4LF8K 2NRRA 3GOIA 4Y0WA 4WFAL 3E9LA 2ZGZA 1RT2A 3AO1A 2D0BA 4CZLA 2VWKA 1JL2A 2VG6A 2BTFA 3P31A 3SV3A 4DR1K 2DY4A 4M7XA 4DTNA 2I5JA 3LDLA 4BG9A 4X64K 3EZ5A 1J5OA 4NYNA 1WB9A 3MXJA 1XMOK 1NGJA 4MO4A 3DOLA 1Z6RA 1W7AA 4JLHA 4JRQA 5B8HA 3ENBA 1ZBLA 4BY9C 2CGLA 3K5OA 1YT3A 1N8RO 5JS2A 1HNIA 4B9NA 3EZWA 2P9IA 2P9IB 4CGJA 4DU1A 3PO5A 3DJCA 1HYVA 1T6CA 3DLKA 3ENHA 1EETA 4O55A 3PX0A 5EOYA 1NKCA 2HBKA 4BGAA 3M8RA 1VSIA 3CF5L 1RT7A 5SWMA 1KD1O 2VG5A 2YKMA 2E2PA 4JAXA 3MX5A 2V52B 2YI1A 3CQ8A 4DQQA 3CJBA 4E19A 4BRHA 3D0PA 4C8LA 2ATQA 4CCHA 3B8AX 5AQRA 3EKUA 1SL0A 1WSJA 3NHGA 1OVQA 2QWNA 4C8MA 3SAFA 2Q2RA 2NRWA 3R6MA 3VF4A 3LWLA 2KLAA 2HHVA 5A2QO 2WONA 4DV2K 2E88A 3HVRA 1LW2A 1RDWX 4BRLA 2ZJPL 3OYHA 1MWKA 1XC3A 3OYGA 3ZSRA 2F4VK 4JYAK 4CIFA 1L3UA 4FJMA 4CJ5A 2NRHA 4DR3K 2EX3A 2RKIA 4FO0A 4CEQA 4BRAA 3ENOA 1S9GA 4H0VB 3HSCA 3HVTA 3KJVA 1IO2A 3LPUA 4FM1A 3VENA 3IDHA 4A5BA 2Q36A 4G9ZA 1HNWK 4FLWA 3CJ7A 5KGWA 4B3SK 2D5RA 3QETA 3EO3A 2IGIA 4CHQA 3I55N 1HKGA 4RW6A 4HHTA 1C6VA 1B9DA 4KTWA 3QICA 3UKRA 2ZQBA 3UKRB 5HRSA 1QE1A 3WNEA 4H5TA 2Q1NA 3OYJA 5FRMA 2E1ZA 4NLCA 3THWA 3THWB 2BGGA 4HUEA 4FVUA 2AJQA 4A5AA 3TAPA 3KD5E 4Q0BA 4BE1A 5FPMA 5M1NA 1NJYA 1OVYA 4KHNA 3Q7CA 4O4GA 1Q82O 3S9HA 3ZSWA 3GBTA 4DV3K 2UUAK 3QNOA 1O13A 4CBUA 3LALA 4B9MA 4CJTA 4B1ZA 5CE3A 4QOZB 1VQ4N 4Q5VA 1RT1A 1S6QA 4Y1CA 3LM9A 4DCHA 1RGIA 2NNWA 4KKOA 4Z94A 3OYMA 5GAHP 2KQ2A 3EYZA 2Y1JA 1BIUA 3VTIA 3QDKA 4BR2A 3FZHA 1S3XA 2P9UA 2P9UB 2ZE2A 3EE8A 3T3FA 2BANA 5KTQA 3TAEA 1BHLA 1ZBUA 3CD6N 2HOEA 3HSTB 2F96A 1QVGM 1Q86O 3J81O 3O80A 3OYKA 3L4QA 3L2UA 3DLEA 4NCGA 1FKOA 1NKBA 1W9HA 4M3TA 3R9PA 5DM7L 3TPQA 4WQ4A 1YAGA 1IBLK 3EE9A 4RCHA 3VF6A 1NOYA 4DKWA 4CEDA 1TKDA 4O0JA 3ID6A 3F9MA 3LP1A 3PIOL 4LF6K 1JXEA 1EWRA 4RG8A 1YTAA 3MN9A 3AVCA 2PY5A 3NGZA 5J2QA 5AQGA 2HHWA 4GV6A 3PV8A 2XY5A 3DRPA 4G1QA 5AQMA 1FW6A 4GY2B 4B8AB 4MQ3A 2OPQA 3FZLA 2G8VA 3T7ZA 4C23A 1ASVA 1WOQA 3E66A 3N4QA 1VSLA 2I7PA 3CFPA 1RDDA 1HJOA 4L3QA 4BE0A 4JV5K 4DUYK 2YHXA 2V7ZA 4A2AA 4LFCK 4FWKA 5C0YA 3L2VA 3AO5A 1WNSA 4M3UA 2OZMA 4HUFA 3U9DA 1HJRA 1TGOA 3KZBA 4YFUA 2P9LA 3H45C 2P9LB 3K2PA 1NK5A 4H4OA 3RMCA 4DV1K 2XHBA 3FLCO 1N6QA 1WSFA 3G4SN 3CCQN 1TAQA 4BC5A 4KH5A 3PO4A 4F2RA 2FF3B 2QI2A 3OJUA
chains in the Genus database with same CATH topology
4FJ5A 3P83D 1XHZA 5SZTA 1TK0A 3JYTA 1BQMA 4WE1A 5D3GA 1A5VA 1EP4A 1B92A 1IKYA 4FLVA 4KRFA 3ZT4A 4DQPA 3C94A 2DFFA 4CERA 1KSPA 4L8RB 1CZBA 1U47A 1RTHA 1KCFA 4KAZA 4E1MA 3QEWA 1BCOA 3NF6A 2QK9A 4FW2A 4CJRA 4W5NA 3CFOA 4CF2A 3TAQA 4DFKA 4KHSA 3ZCMA 4GW6A 1ZYQA 4DS4A 4CFDA 1TL3A 3B6OA 2QKKA 3ZT3A 4KI6A 1X9SA 2YNGA 4JS4A 3AVFA 1RBRA 4XIUA 3OS0A 2GBZA 3ZT0A 3LAMA 3AVGA 3MEEA 4FJGA 2E6LA 3G0ZA 2A1SA 1HRHA 4AHCA 3KD1E 4N76A 1CXUA 4IBNA 1J53A 1Q8IA 1C1AA 3DRRA 5DMRA 5C24A 2VWJA 4CJ3A 4DU3A 4FK2A 3OYBA 1YTUA 3MXMA 4DTRA 4FJ9A 3TAFA 1HQUA 3VQEA 1QS4A 3DRSA 3QLHA 4Z4GA 4CFAA 1CXQA 1RBVA 1VSFA 1D9FA 3OVNA 2DFHA 3LPTA 1RNHA 5HRRA 1RBTA 3SQ1A 1WSHA 1S5JA 1DTQA 3KLIA 4CJVA 4OPKA 2G8WA 1KTQA 4H4MA 1D8YA 2KTQA 1LWFA 5J2PA 4Z0UA 2YNHA 3V9SA 4FYDA 1UWBA 2DTUA 1RTJA 4J2EA 1RCHA 4AHRA 3K5LA 1Q9YA 3LDSA 1J54A 4N56A 3V9ZA 4NCAA 1RDAA 1EKEA 3OS1A 3IRXA 1TAUA 1XC9A 3SUNA 1HYZA 3V81A 4E3SA 3T1AA 1WSIA 4B3OA 4CK1A 4BACA 3L8BA 3SPYA 3AVNA 4IG0A 4E7LA 4CF8A 4CGGA 3TANA 4J2BA 3AVMA 2X78A 3KK1A 4FZXC 3O4NA 3HPOA 3DLGA 4MFBA 3V1OA 2HHUA 3SYZA 1J9AA 4E0DA 2F8TA 2B5JA 3K5NA 2OPPA 4DSEA 3QEVA 1JLEA 2RN2A 4DSIA 2GV9A 1SV5A 3QIPA 4CGDA 4JRPA 3SQ2A 3VQ7A 1T8EA 3NFAA 1T03A 4FZZA 4C8NA 3V4IA 3DM2A 1DTTA 3SJJA 4E7HA 3G10A 5KRSA 1TL1A 1JKHA 3SZ2A 3S3OA 3OS2A 4HUGA 1VSHA 3MEDA 4OKEA 5CZ2A 3VQBA 4HVJA 4PY5A 4CJWA 3CFRA 1U48A 4RW8A 3LP2A 3QESA 1S1XA 4CJEA 4EZ9A 3ASMA 4BDYA 1C1BA 1KFDA 3ZSOA 3SV4A 3RR7A 1IKVA 1ASUA 3WNFA 3S3NA 2EHGA 4I9LA 3MXIA 4Z4HA 3L2QA 4JS5A 4PWDA 1Z26A 3VQPA 1C0UA 3NBPA 2IDOA 1GOCA 4BWJA 3OYEA 3QO9A 1SKRA 4LH4A 4CEZA 3AA3A 1U49A 4Y1DA 1X9WA 1SL1A 4GVMA 4FJKA 1QTMA 2FC0A 4AH9A 3NF9A 4AHUA 4FZYA 4CEAA 3HL8A 2R7YA 4CEFA 5J2NA 1QSLA 5HLFA 1ZBIA 4FXDA 1LAVA 5HRNA 3OJSA 2X74A 3RRHA 4CEBA 3LANA 1NKEA 4DTPA 3VQ4A 4DFPA 4OGCA 3O4QA 4LSLA 1CLQA 4PA1A 1REVA 3KKRA 3OYAA 4FLXA 4M42A 3RMDA 1LV5A 1HMVA 2BE2A 4N5SA 1Z25A 1BIZA 1LAWA 2HHXA 4DWIA 1KLMA 3QEIA 3MAQA 5K14A 3A2FA 2GUIA 5I42A 2XY6A 3V9XA 4R5PA 3TI0A 3SPZA 1HYSA 4CF0A 5CYMA 4CF1A 1BL3A 1WAJA 2OPRA 3UIQA 4BWMA 4I9QA 4BDZA 3KKSA 1JLGA 3ZT1A 3KK2A 3SI6A 3HJFA 3LP0A 4IG3A 4HCBA 3WNHA 3U6FA 1D5AA 4IFYA 1T05A 2B4JA 4CECA 1NJZA 4ELVA 2HHTA 1RBUA 2E4LA 4OKJA 3DMJA 3VQ8A 1YVUA 2XY8A 4Z4FA 1TK8A 3SUPA 4M3ZA 3THVA 5T7BA 1GOBA 1S1VA 3AO4A 3C6TA 2IS3A 4J2DA 3AA2A 4CJSA 3O3HA 3LZIA 4FCYA 1WSGA 4M3RA 4OLAA 3LWMA 4M3WA 1HPZA 1JLFA 4O44A 5I3UA 2QKBA 4B8CA 1L3TA 1U4BA 4Z4EA 2HB5A 3NGIA 1EX4A 1SL2A 4FVMA 4CK2A 4FJ7A 3D45A 4DS5A 4QAGA 3S3MA 4RW9A 4KHYA 4AILC 4KB1A 1RT2A 4CJFA 5FDLA 4ELTA 3IAYA 3L3UA 2KFZA 3AO3A 2E6MA 2BDPA 1IH7A 1UA0A 3AO1A 2D0BA 2VWKA 1JL2A 1RBSA 2YKNA 2VG6A 3SQ0A 2IOCA 3VQDA 3SV3A 4ID5A 4M45A 2DY4A 4DTNA 1RT4A 2I5JA 3K59A 1LW0A 3TWHA 1L3SA 4EP5A 4CJ4A 3EZ5A 3AVKA 1J5OA 2G8IA 4NYNA 4AHVA 4DQIA 4N41A 3PUFA 3PX6A 3MXJA 4LSNA 4M41A 4CJQA 1RDCA 3DOLA 5HROA 1TKZA 4DFJA 1A5WA 4B08A 4CEEA 3CG7A 4CJPA 3HP6A 4JLHA 3NE6A 4JRQA 1HQEA 2Z1IA 3BGRA 3KLFA 4E7IA 4CFBA 1ZBLA 1K6YA 3K5OA 1YT3A 3QERA 2G8KA 4K8XA 2DFEA 3HK2A 3DOKA 3RWUA 5JS2A 4UQGA 5HP1A 4DMNA 1HNIA 4B9UA 4B9NA 4OVLA 4OGEA 4DQSA 4CGJA 4DU1A 3QEXA 4ZTFA 3PO5A 3RR8A 2PZSA 1HYVA 3TABA 4E7KA 3DLKA 4EP4A 1GOAA 1CZ9A 1EETA 2YHBA 4O55A 3NH2A 3PX0A 1ITGA 4DSLA 3V6DA 3O3FA 1NKCA 3LAKA 3DLBA 4KB0A 1S1WA 1NOZA 3M8RA 2YV0X 3AVHA 4DTMA 4FK0A 1VSIA 3FFIA 4DG1A 1KVAA 1TK5A 1RT7A 5SWMA 3OYDA 2VG5A 2YKMA 4QCLA 3RMBA 3ITHA 2HW3A 3RMAA 4DQQA 3CQ8A 2G8HA 3SCXA 4CHNA 4E19A 3KK3A 4F2SA 1VSMA 3D0PA 1A5XA 3SNNA 4C8LA 2ETJA 2P1JA 2ATQA 4IDKA 1S1UA 3KTQA 3DI6A 5CZ1A 4E7JA 2OYQA 4B9LA 1JXBA 5FRNA 3NH1A 2HHSA 4B9VA 4CCHA 1IKWA 3VQQA 1RT5A 1T7PA 4J2AA 1Y97A 1S6PA 1SL0A 1VSJA 1WSJA 1TKXA 3IS9A 3PX4A 1NJWA 3NHGA 2Q3SA 4C8MA 2RPIA 5C25A 3ALYA 2IAJA 1BCMA 2KW4A 3NGYA 3K58A 1TV6A 3LWLA 3ZSYA 3CYMA 3OY9A 4W5RA 4FW1A 3LZJA 4DTXA 2WOMA 3NDKA 4KTZA 4CK3A 3RRGA 1FK9A 1LWEA 1RT6A 3B6PA 3O3GA 2OA8A 1QHTA 2HHVA 3JSMA 4CHYA 2WONA 3M8SA 3ZSXA 3F73A 3I0RA 1UA1A 3HVRA 1LW2A 3CM5A 4LY7A 4FLZA 2PYJA 1C1CA 2HNYA 3BDPA 3QNNA 4ID1A 2B6AA 3NF7A 1KFSA 1N5YA 5J1EA 4DQRA 3OYHA 3OYGA 5CY4A 3ZSRA 1XWLA 4CIFA 2NUBA 3KLGA 1L3UA 3OYFA 3V1RA 1S1TA 4IFVA 4CJ5A 2Y1IA 4FJMA 4KPYA 2EX3A 2RKIA 3M8PA 4EZ6A 4KO0A 5HBMA 2FBTA 1L5UA 4CIGA 4N47A 3VQAA 5EU7A 4BDPA 4CEQA 4FJIA 4I7FA 1S9GA 1QSSA 5KGXA 1L3VA 3HVTA 3KJVA 1IO2A 3LPUA 4FM1A 2XY7A 3SUOA 5E41A 3PY8A 1U45A 2YHAA 3DLHA 2Z1GA 3ZT2A 4CE9A 4FLWA 5KGWA 4DTUA 4CF9A 2D5RA 1BI4A 1ASWA 3ZSQA 1BI4B 2HNZA 3QETA 2F8SA 4FJXA 1VSKA 2IGIA 1I3AA 4CHQA 4RW6A 3K57A 4Z4CA 4HHTA 1C6VA 1VSDA 1WN7A 5C42A 4ICLA 1B9DA 3AO2A 4KTWA 3AA4A 5KRTA 2O4IA 2D0AA 2ZQBA 2ZD1A 5HRSA 3HT3A 2HVIA 4FJ8A 2P51A 1ZBHA 4K8ZA 3C6UA 4DF4A 1QE1A 2Z1JA 3WNEA 3VQ6A 3OYJA 4OLBA 3VA3A 4CJLA 1MU2A 5FRMA 3L3VA 3VQCA 4I2QA 4W5OA 3TAGA 4ELUA 1VK0A 2BGGA 1FKPA 3MECA 2IC3A 3HPHA 4HUEA 2AJQA 3OYIA 1NK9A 3MEGA 3HYFA 2HNDA 3E01A 1WAFA 4KFBA 3TAPA 3KD5E 4M3YA 3U3YA 2P5OA 4DU4A 1KVCA 4DTJA 1NK8A 4Q0BA 2FBYA 1R0AA 1NJXA 4PQUA 4BE1A 1NJYA 4B9SA 4KHNA 4CIEA 4DLEA 3V9WA 4GMJB 4O4GA 4FJHA 5DK5A 5JS1A 1VRUA 4NYFA 2XRIA 3S9HA 4F8RA 3NF8A 3ZSWA 1IKXA 3NH0A 3DLRA 4E1NA 4DLGA 4IKFA 4DSFA 2YNIA 1NK4A 3QNOA 1TVRA 3VA0A 3HPGA 1RTIA 3AVBA 1RT3A 3LALA 3KLHA 1O1WA 2FBVA 4HTUA 4B9MA 2RF2A 1QQCA 1HNVA 4CJTA 4CJKA 4DTOA 3U3GA 4ZHRA 1X9MA 1XHXA 4QOZB 4Q5VA 2P5GA 4KI4A 4O5BA 1VRTA 1RT1A 1S6QA 1I39A 1W0HA 3DYAA 4Y1CA 5KI6A 2W42A 1NK0A 4KKOA 2HHQA 3OYCA 2KFNA 2D0CA 3WNGA 3OYMA 4ZTJA 2KQ2A 3ISNC 3EYZA 2KZMA 2Y1JA 2OZSA 3ZSZA 4AHTA 5CYQA 1BIUA 1F21A 2G8FA 2YNFA 2XO7A 4E89A 3KLEA 3ZSVA 2ZE2A 4LH5A 4PUOA 3QIOA 3M8QA 3T3FA 4FM0A 2BANA 5KTQA 3TAEA 1KLNA 3HXMA 1BHLA 1ZBUA 3I0SA 4YNQA 1U04A 3HSTB 2F96A 4CJUA 4CHPA 1Q9XA 5J2MA 3P1GA 3OYKA 4BE2A 3L2UA 4I2PA 4FJLA 5HRPA 3DLEA 4NCGA 1FKOA 3EY1A 1RILA 1W9HA 1NKBA 4M3TA 4OPJA 1EXQA 3VQ9A 5FROA 1SUQA 2FBXA 3C95A 2OPSA 3AVIA 4CGHA 3QEPA 4F4KA 4FJNA 1NOYA 3VQ5A 4DSKA 1S9EA 4CEDA 1UOCA 4CESA 1TKDA 4O0JA 4DF8A 4W5QA 3LP1A 4CGIA 4KHQA 2KZZA 1JXEA 1WLJA 2A1RA 4FJJA 1UAXA 3LP3A 2O4GA 4RG8A 1YTAA 3F9KA 4DSJA 3I8DA 3L2RA 1X1PA 1XI1A 3H08A 4RW4A 4C8KA 1C0TA 1NK7A 4RW7A 4DFMA 1QSYA 2HVHA 1JLAA 4OJRA 1JLQA 3AVCA 3IG1A 1ZBFA 2ITGA 3NGZA 3AVAA 2PY5A 4KHWA 5J2QA 3RTVA 4F3OA 2HHWA 4FLTA 3OYNA 3T19A 4Z4IA 1DLOA 3PV8A 4B9TA 1KVBA 3ULDA 2XY5A 4HCCA 3DRPA 4G1QA 4CGFA 1FXXA 1WSEA 1B9FA 4DTSA 4F3TA 4B8AB 4MQ3A 2OPQA 4FLUA 2G8VA 2LSNA 4W5TA 3KIOA 1JL1A 3TAMA 4KHUA 1RTDA 1C0MA 4KV8A 3NCIA 2VG7A 3NAEA 1ASVA 3QINA 1SKWA 1TKTA 1IG9A 1VSLA 4C8OA 1KRPA 4FK4A 1JLBA 3CFPA 3K5MA 1LWCA 1RDDA 2JLEA 3AVJA 2HMIA 4BE0A 2QXFA 1RDBA 4M3XA 4KREA 3TR8A 2JGUA 4AHSA 3TARA 2G8UA 3HM9A 4CHOA 4KTQA 1BQNA 1VSEA 3L2VA 3AO5A 4FLYA 1WNSA 4M3UA 4O0IA 2OZMA 2PYLA 4HUFA 2X6NA 2Z1HA 4H8KA 1HJRA 1TGOA 3V9UA 1BGXT 3AVLA 3CM6A 1BISA 3SQ4A 1JLCA 1G15A 4YFUA 1NK5A 3K2PA 4H4OA 4TSXA 3RMCA 4CEOA 3L2WA 4NCBA 3HO1A 2XHBA 3SUQA 1N6QA 3V1QA 3P5JA 1SKSA 4CFCA 4OKKA 1WSFA 1D9DA 3HP9A 3OYLA 3AA5X 1NK6A 1TAQA 4LD0A 3VN5A 3PO4A 4F2RA 2X6SA 3AV9A 3OJUA 4FM2A 4CHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJ5 A;  3P83 D;  1XHZ A;  5SZT A;  1TK0 A;  3JYT A;  1BQM A;  4WE1 A;  5D3G A;  1A5V A;  1EP4 A;  1B92 A;  1IKY A;  4FLV A;  4KRF A;  3ZT4 A;  4DQP A;  3C94 A;  2DFF A;  4CER A;  1KSP A;  4L8R B;  1CZB A;  1U47 A;  1RTH A;  1KCF A;  4KAZ A;  4E1M A;  3QEW A;  1BCO A;  3NF6 A;  2QK9 A;  4FW2 A;  4CJR A;  4W5N A;  3CFO A;  4CF2 A;  3TAQ A;  4DFK A;  4KHS A;  3ZCM A;  4GW6 A;  1ZYQ A;  4DS4 A;  4CFD A;  1TL3 A;  3B6O A;  2QKK A;  3ZT3 A;  4KI6 A;  1X9S A;  2YNG A;  4JS4 A;  3AVF A;  1RBR A;  4XIU A;  3OS0 A;  2GBZ A;  3ZT0 A;  3LAM A;  3AVG A;  3MEE A;  4FJG A;  2E6L A;  3G0Z A;  2A1S A;  1HRH A;  4AHC A;  3KD1 E;  4N76 A;  1CXU A;  4IBN A;  1J53 A;  1Q8I A;  1C1A A;  3DRR A;  5DMR A;  5C24 A;  2VWJ A;  4CJ3 A;  4DU3 A;  4FK2 A;  3OYB A;  1YTU A;  3MXM A;  4DTR A;  4FJ9 A;  3TAF A;  1HQU A;  3VQE A;  1QS4 A;  3DRS A;  3QLH A;  4Z4G A;  4CFA A;  1CXQ A;  1RBV A;  1VSF A;  1D9F A;  3OVN A;  2DFH A;  3LPT A;  1RNH A;  5HRR A;  1RBT A;  3SQ1 A;  1WSH A;  1S5J A;  1DTQ A;  3KLI A;  4CJV A;  4OPK A;  2G8W A;  1KTQ A;  4H4M A;  1D8Y A;  2KTQ A;  1LWF A;  5J2P A;  4Z0U A;  2YNH A;  3V9S A;  4FYD A;  1UWB A;  2DTU A;  1RTJ A;  4J2E A;  1RCH A;  4AHR A;  3K5L A;  1Q9Y A;  3LDS A;  1J54 A;  4N56 A;  3V9Z A;  4NCA A;  1RDA A;  1EKE A;  3OS1 A;  3IRX A;  1TAU A;  1XC9 A;  3SUN A;  1HYZ A;  3V81 A;  4E3S A;  3T1A A;  1WSI A;  4B3O A;  4CK1 A;  4BAC A;  3L8B A;  3SPY A;  3AVN A;  4IG0 A;  4E7L A;  4CF8 A;  4CGG A;  3TAN A;  4J2B A;  3AVM A;  2X78 A;  3KK1 A;  4FZX C;  3O4N A;  3HPO A;  3DLG A;  4MFB A;  3V1O A;  2HHU A;  3SYZ A;  1J9A A;  4E0D A;  2F8T A;  2B5J A;  3K5N A;  2OPP A;  4DSE A;  3QEV A;  1JLE A;  2RN2 A;  4DSI A;  2GV9 A;  1SV5 A;  3QIP A;  4CGD A;  4JRP A;  3SQ2 A;  3VQ7 A;  1T8E A;  3NFA A;  1T03 A;  4FZZ A;  4C8N A;  3V4I A;  3DM2 A;  1DTT A;  3SJJ A;  4E7H A;  3G10 A;  5KRS A;  1TL1 A;  1JKH A;  3SZ2 A;  3S3O A;  3OS2 A;  4HUG A;  1VSH A;  3MED A;  4OKE A;  5CZ2 A;  3VQB A;  4HVJ A;  4PY5 A;  4CJW A;  3CFR A;  1U48 A;  4RW8 A;  3LP2 A;  3QES A;  1S1X A;  4CJE A;  4EZ9 A;  3ASM A;  4BDY A;  1C1B A;  1KFD A;  3ZSO A;  3SV4 A;  3RR7 A;  1IKV A;  1ASU A;  3WNF A;  3S3N A;  2EHG A;  4I9L A;  3MXI A;  4Z4H A;  3L2Q A;  4JS5 A;  4PWD A;  1Z26 A;  3VQP A;  1C0U A;  3NBP A;  2IDO A;  1GOC A;  4BWJ A;  3OYE A;  3QO9 A;  1SKR A;  4LH4 A;  4CEZ A;  3AA3 A;  1U49 A;  4Y1D A;  1X9W A;  1SL1 A;  4GVM A;  4FJK A;  1QTM A;  2FC0 A;  4AH9 A;  3NF9 A;  4AHU A;  4FZY A;  4CEA A;  3HL8 A;  2R7Y A;  4CEF A;  5J2N A;  1QSL A;  5HLF A;  1ZBI A;  4FXD A;  1LAV A;  5HRN A;  3OJS A;  2X74 A;  3RRH A;  4CEB A;  3LAN A;  1NKE A;  4DTP A;  3VQ4 A;  4DFP A;  4OGC A;  3O4Q A;  4LSL A;  1CLQ A;  4PA1 A;  1REV A;  3KKR A;  3OYA A;  4FLX A;  4M42 A;  3RMD A;  1LV5 A;  1HMV A;  2BE2 A;  4N5S A;  1Z25 A;  1BIZ A;  1LAW A;  2HHX A;  4DWI A;  1KLM A;  3QEI A;  3MAQ A;  5K14 A;  3A2F A;  2GUI A;  5I42 A;  2XY6 A;  3V9X A;  4R5P A;  3TI0 A;  3SPZ A;  1HYS A;  4CF0 A;  5CYM A;  4CF1 A;  1BL3 A;  1WAJ A;  2OPR A;  3UIQ A;  4BWM A;  4I9Q A;  4BDZ A;  3KKS A;  1JLG A;  3ZT1 A;  3KK2 A;  3SI6 A;  3HJF A;  3LP0 A;  4IG3 A;  4HCB A;  3WNH A;  3U6F A;  1D5A A;  4IFY A;  1T05 A;  2B4J A;  4CEC A;  1NJZ A;  4ELV A;  2HHT A;  1RBU A;  2E4L A;  4OKJ A;  3DMJ A;  3VQ8 A;  1YVU A;  2XY8 A;  4Z4F A;  1TK8 A;  3SUP A;  4M3Z A;  3THV A;  5T7B A;  1GOB A;  1S1V A;  3AO4 A;  3C6T A;  2IS3 A;  4J2D A;  3AA2 A;  4CJS A;  3O3H A;  3LZI A;  4FCY A;  1WSG A;  4M3R A;  4OLA A;  3LWM A;  4M3W A;  1HPZ A;  1JLF A;  4O44 A;  5I3U A;  2QKB A;  4B8C A;  1L3T A;  1U4B A;  4Z4E A;  2HB5 A;  3NGI A;  1EX4 A;  1SL2 A;  4FVM A;  4CK2 A;  4FJ7 A;  3D45 A;  4DS5 A;  4QAG A;  3S3M A;  4RW9 A;  4KHY A;  4AIL C;  4KB1 A;  1RT2 A;  4CJF A;  5FDL A;  4ELT A;  3IAY A;  3L3U A;  2KFZ A;  3AO3 A;  2E6M A;  2BDP A;  1IH7 A;  1UA0 A;  3AO1 A;  2D0B A;  2VWK A;  1JL2 A;  1RBS A;  2YKN A;  2VG6 A;  3SQ0 A;  2IOC A;  3VQD A;  3SV3 A;  4ID5 A;  4M45 A;  2DY4 A;  4DTN A;  1RT4 A;  2I5J A;  3K59 A;  1LW0 A;  3TWH A;  1L3S A;  4EP5 A;  4CJ4 A;  3EZ5 A;  3AVK A;  1J5O A;  2G8I A;  4NYN A;  4AHV A;  4DQI A;  4N41 A;  3PUF A;  3PX6 A;  3MXJ A;  4LSN A;  4M41 A;  4CJQ A;  1RDC A;  3DOL A;  5HRO A;  1TKZ A;  4DFJ A;  1A5W A;  4B08 A;  4CEE A;  3CG7 A;  4CJP A;  3HP6 A;  4JLH A;  3NE6 A;  4JRQ A;  1HQE A;  2Z1I A;  3BGR A;  3KLF A;  4E7I A;  4CFB A;  1ZBL A;  1K6Y A;  3K5O A;  1YT3 A;  3QER A;  2G8K A;  4K8X A;  2DFE A;  3HK2 A;  3DOK A;  3RWU A;  5JS2 A;  4UQG A;  5HP1 A;  4DMN A;  1HNI A;  4B9U A;  4B9N A;  4OVL A;  4OGE A;  4DQS A;  4CGJ A;  4DU1 A;  3QEX A;  4ZTF A;  3PO5 A;  3RR8 A;  2PZS A;  1HYV A;  3TAB A;  4E7K A;  3DLK A;  4EP4 A;  1GOA A;  1CZ9 A;  1EET A;  2YHB A;  4O55 A;  3NH2 A;  3PX0 A;  1ITG A;  4DSL A;  3V6D A;  3O3F A;  1NKC A;  3LAK A;  3DLB A;  4KB0 A;  1S1W A;  1NOZ A;  3M8R A;  2YV0 X;  3AVH A;  4DTM A;  4FK0 A;  1VSI A;  3FFI A;  4DG1 A;  1KVA A;  1TK5 A;  1RT7 A;  5SWM A;  3OYD A;  2VG5 A;  2YKM A;  4QCL A;  3RMB A;  3ITH A;  2HW3 A;  3RMA A;  4DQQ A;  3CQ8 A;  2G8H A;  3SCX A;  4CHN A;  4E19 A;  3KK3 A;  4F2S A;  1VSM A;  3D0P A;  1A5X A;  3SNN A;  4C8L A;  2ETJ A;  2P1J A;  2ATQ A;  4IDK A;  1S1U A;  3KTQ A;  3DI6 A;  5CZ1 A;  4E7J A;  2OYQ A;  4B9L A;  1JXB A;  5FRN A;  3NH1 A;  2HHS A;  4B9V A;  4CCH A;  1IKW A;  3VQQ A;  1RT5 A;  1T7P A;  4J2A A;  1Y97 A;  1S6P A;  1SL0 A;  1VSJ A;  1WSJ A;  1TKX A;  3IS9 A;  3PX4 A;  1NJW A;  3NHG A;  2Q3S A;  4C8M A;  2RPI A;  5C25 A;  3ALY A;  2IAJ A;  1BCM A;  2KW4 A;  3NGY A;  3K58 A;  1TV6 A;  3LWL A;  3ZSY A;  3CYM A;  3OY9 A;  4W5R A;  4FW1 A;  3LZJ A;  4DTX A;  2WOM A;  3NDK A;  4KTZ A;  4CK3 A;  3RRG A;  1FK9 A;  1LWE A;  1RT6 A;  3B6P A;  3O3G A;  2OA8 A;  1QHT A;  2HHV A;  3JSM A;  4CHY A;  2WON A;  3M8S A;  3ZSX A;  3F73 A;  3I0R A;  1UA1 A;  3HVR A;  1LW2 A;  3CM5 A;  4LY7 A;  4FLZ A;  2PYJ A;  1C1C A;  2HNY A;  3BDP A;  3QNN A;  4ID1 A;  2B6A A;  3NF7 A;  1KFS A;  1N5Y A;  5J1E A;  4DQR A;  3OYH A;  3OYG A;  5CY4 A;  3ZSR A;  1XWL A;  4CIF A;  2NUB A;  3KLG A;  1L3U A;  3OYF A;  3V1R A;  1S1T A;  4IFV A;  4CJ5 A;  2Y1I A;  4FJM A;  4KPY A;  2EX3 A;  2RKI A;  3M8P A;  4EZ6 A;  4KO0 A;  5HBM A;  2FBT A;  1L5U A;  4CIG A;  4N47 A;  3VQA A;  5EU7 A;  4BDP A;  4CEQ A;  4FJI A;  4I7F A;  1S9G A;  1QSS A;  5KGX A;  1L3V A;  3HVT A;  3KJV A;  1IO2 A;  3LPU A;  4FM1 A;  2XY7 A;  3SUO A;  5E41 A;  3PY8 A;  1U45 A;  2YHA A;  3DLH A;  2Z1G A;  3ZT2 A;  4CE9 A;  4FLW A;  5KGW A;  4DTU A;  4CF9 A;  2D5R A;  1BI4 A;  1ASW A;  3ZSQ A;  1BI4 B;  2HNZ A;  3QET A;  2F8S A;  4FJX A;  1VSK A;  2IGI A;  1I3A A;  4CHQ A;  4RW6 A;  3K57 A;  4Z4C A;  4HHT A;  1C6V A;  1VSD A;  1WN7 A;  5C42 A;  4ICL A;  1B9D A;  3AO2 A;  4KTW A;  3AA4 A;  5KRT A;  2O4I A;  2D0A A;  2ZQB A;  2ZD1 A;  5HRS A;  3HT3 A;  2HVI A;  4FJ8 A;  2P51 A;  1ZBH A;  4K8Z A;  3C6U A;  4DF4 A;  1QE1 A;  2Z1J A;  3WNE A;  3VQ6 A;  3OYJ A;  4OLB A;  3VA3 A;  4CJL A;  1MU2 A;  5FRM A;  3L3V A;  3VQC A;  4I2Q A;  4W5O A;  3TAG A;  4ELU A;  1VK0 A;  2BGG A;  1FKP A;  3MEC A;  2IC3 A;  3HPH A;  4HUE A;  2AJQ A;  3OYI A;  1NK9 A;  3MEG A;  3HYF A;  2HND A;  3E01 A;  1WAF A;  4KFB A;  3TAP A;  3KD5 E;  4M3Y A;  3U3Y A;  2P5O A;  4DU4 A;  1KVC A;  4DTJ A;  1NK8 A;  4Q0B A;  2FBY A;  1R0A A;  1NJX A;  4PQU A;  4BE1 A;  1NJY A;  4B9S A;  4KHN A;  4CIE A;  4DLE A;  3V9W A;  4GMJ B;  4O4G A;  4FJH A;  5DK5 A;  5JS1 A;  1VRU A;  4NYF A;  2XRI A;  3S9H A;  4F8R A;  3NF8 A;  3ZSW A;  1IKX A;  3NH0 A;  3DLR A;  4E1N A;  4DLG A;  4IKF A;  4DSF A;  2YNI A;  1NK4 A;  3QNO A;  1TVR A;  3VA0 A;  3HPG A;  1RTI A;  3AVB A;  1RT3 A;  3LAL A;  3KLH A;  1O1W A;  2FBV A;  4HTU A;  4B9M A;  2RF2 A;  1QQC A;  1HNV A;  4CJT A;  4CJK A;  4DTO A;  3U3G A;  4ZHR A;  1X9M A;  1XHX A;  4QOZ B;  4Q5V A;  2P5G A;  4KI4 A;  4O5B A;  1VRT A;  1RT1 A;  1S6Q A;  1I39 A;  1W0H A;  3DYA A;  4Y1C A;  5KI6 A;  2W42 A;  1NK0 A;  4KKO A;  2HHQ A;  3OYC A;  2KFN A;  2D0C A;  3WNG A;  3OYM A;  4ZTJ A;  2KQ2 A;  3ISN C;  3EYZ A;  2KZM A;  2Y1J A;  2OZS A;  3ZSZ A;  4AHT A;  5CYQ A;  1BIU A;  1F21 A;  2G8F A;  2YNF A;  2XO7 A;  4E89 A;  3KLE A;  3ZSV A;  2ZE2 A;  4LH5 A;  4PUO A;  3QIO A;  3M8Q A;  3T3F A;  4FM0 A;  2BAN A;  5KTQ A;  3TAE A;  1KLN A;  3HXM A;  1BHL A;  1ZBU A;  3I0S A;  4YNQ A;  1U04 A;  3HST B;  2F96 A;  4CJU A;  4CHP A;  1Q9X A;  5J2M A;  3P1G A;  3OYK A;  4BE2 A;  3L2U A;  4I2P A;  4FJL A;  5HRP A;  3DLE A;  4NCG A;  1FKO A;  3EY1 A;  1RIL A;  1W9H A;  1NKB A;  4M3T A;  4OPJ A;  1EXQ A;  3VQ9 A;  5FRO A;  1SUQ A;  2FBX A;  3C95 A;  2OPS A;  3AVI A;  4CGH A;  3QEP A;  4F4K A;  4FJN A;  1NOY A;  3VQ5 A;  4DSK A;  1S9E A;  4CED A;  1UOC A;  4CES A;  1TKD A;  4O0J A;  4DF8 A;  4W5Q A;  3LP1 A;  4CGI A;  4KHQ A;  2KZZ A;  1JXE A;  1WLJ A;  2A1R A;  4FJJ A;  1UAX A;  3LP3 A;  2O4G A;  4RG8 A;  1YTA A;  3F9K A;  4DSJ A;  3I8D A;  3L2R A;  1X1P A;  1XI1 A;  3H08 A;  4RW4 A;  4C8K A;  1C0T A;  1NK7 A;  4RW7 A;  4DFM A;  1QSY A;  2HVH A;  1JLA A;  4OJR A;  1JLQ A;  3AVC A;  3IG1 A;  1ZBF A;  2ITG A;  3NGZ A;  3AVA A;  2PY5 A;  4KHW A;  5J2Q A;  3RTV A;  4F3O A;  2HHW A;  4FLT A;  3OYN A;  3T19 A;  4Z4I A;  1DLO A;  3PV8 A;  4B9T A;  1KVB A;  3ULD A;  2XY5 A;  4HCC A;  3DRP A;  4G1Q A;  4CGF A;  1FXX A;  1WSE A;  1B9F A;  4DTS A;  4F3T A;  4B8A B;  4MQ3 A;  2OPQ A;  4FLU A;  2G8V A;  2LSN A;  4W5T A;  3KIO A;  1JL1 A;  3TAM A;  4KHU A;  1RTD A;  1C0M A;  4KV8 A;  3NCI A;  2VG7 A;  3NAE A;  1ASV A;  3QIN A;  1SKW A;  1TKT A;  1IG9 A;  1VSL A;  4C8O A;  1KRP A;  4FK4 A;  1JLB A;  3CFP A;  3K5M A;  1LWC A;  1RDD A;  2JLE A;  3AVJ A;  2HMI A;  4BE0 A;  2QXF A;  1RDB A;  4M3X A;  4KRE A;  3TR8 A;  2JGU A;  4AHS A;  3TAR A;  2G8U A;  3HM9 A;  4CHO A;  4KTQ A;  1BQN A;  1VSE A;  3L2V A;  3AO5 A;  4FLY A;  1WNS A;  4M3U A;  4O0I A;  2OZM A;  2PYL A;  4HUF A;  2X6N A;  2Z1H A;  4H8K A;  1HJR A;  1TGO A;  3V9U A;  1BGX T;  3AVL A;  3CM6 A;  1BIS A;  3SQ4 A;  1JLC A;  1G15 A;  4YFU A;  1NK5 A;  3K2P A;  4H4O A;  4TSX A;  3RMC A;  4CEO A;  3L2W A;  4NCB A;  3HO1 A;  2XHB A;  3SUQ A;  1N6Q A;  3V1Q A;  3P5J A;  1SKS A;  4CFC A;  4OKK A;  1WSF A;  1D9D A;  3HP9 A;  3OYL A;  3AA5 X;  1NK6 A;  1TAQ A;  4LD0 A;  3VN5 A;  3PO4 A;  4F2R A;  2X6S A;  3AV9 A;  3OJU A;  4FM2 A;  4CHZ A; 
#chains in the Genus database with same CATH topology
 5KPT A;  1XHZ A;  4XH5 A;  4BRD A;  3T69 A;  2AA4 A;  3EL2 A;  2QEX N;  4HTL A;  5AQY A;  2DFF A;  1SAZ A;  1BCO A;  4FW2 A;  3CFO A;  4CF2 A;  4JI2 K;  3ZCM A;  2E1Y A;  4DS4 A;  4CFD A;  2QKK A;  3ZT3 A;  4XIU A;  1RBR A;  1ZXO A;  3HI0 A;  3SMS A;  2PFU A;  3A5N C;  2E6L A;  2A1S A;  4DQ8 A;  1CXU A;  5DMR A;  4DU3 A;  1C1A A;  3MCP A;  4IZ9 A;  4CJ3 A;  5ADX A;  3OYB A;  5M1Q A;  1TYQ B;  4BGB A;  1CXQ A;  1VSF A;  5HRR A;  3PSF A;  1WSH A;  4OPK A;  4GVE A;  1D8Y A;  4BG8 A;  3ZEU A;  5C2D A;  4A62 A;  3V9S A;  3PLA A;  1BG3 A;  1UWB A;  4IJA A;  1RTJ A;  2ASO A;  2ZJR L;  1VQ6 N;  4M63 C;  1J54 A;  3D2E A;  3D2E B;  1CZA N;  1EKE A;  3VES A;  1T3V A;  4BRI A;  4XEI A;  3AVN A;  3TAN A;  4J2B A;  3CQX A;  2CGJ A;  3AVM A;  3KK1 A;  1Y64 A;  1ATR A;  3DLG A;  2HHU A;  4LF5 K;  3HOS A;  4E0D A;  2B5J A;  4O8U A;  4PKG A;  3WT0 A;  1SV5 A;  4CGD A;  3NFA A;  4CI6 A;  1E4F T;  1DTT A;  1YF5 L;  3LDP A;  2IIR A;  3SZ2 A;  5KRS A;  3QML A;  1JKH A;  3OS2 A;  4DB3 A;  1VSH A;  5CZ2 A;  3VQB A;  4PY5 A;  4CJE A;  3SV4 A;  2Q97 A;  3WNF A;  3S3N A;  3O8M A;  5AQK A;  1ZC6 A;  3F2K A;  4BRK A;  4CEZ A;  4GV9 A;  1X9W A;  1SL1 A;  2WBN A;  2FC0 A;  1GLL O;  1QSL A;  1NG9 A;  5BRE A;  1NMN A;  4OO1 J;  3RRH A;  3LAN A;  2IVO A;  5FLX O;  4YDU A;  4FLX A;  4M42 A;  3MN6 A;  4JI4 K;  3TSQ A;  4N5S A;  1BIZ A;  1Z25 A;  4DR2 K;  1LAW A;  3JXU A;  1W2B M;  2HHX A;  4BR9 A;  2FXU A;  3CJ9 A;  5I42 A;  4R5P A;  3SPZ A;  3VEO A;  5CYM A;  1DKG D;  3UIQ A;  1QQN A;  4BWM A;  4KHP K;  2QWM A;  3HJF A;  4IG3 A;  1QQO A;  2H3G X;  2O8D B;  3H3N O;  2ZGY A;  1NJZ A;  2HHT A;  3DMJ A;  1TK8 A;  3C6T A;  2O8E A;  4A59 A;  4FCY A;  3LZI A;  2O8E B;  3R8E A;  3O9Q A;  2WFB A;  1JLF A;  4O44 A;  3WEE A;  3WEE B;  1YVN A;  4WQ5 A;  1L3T A;  2HB5 A;  5BN8 A;  1EX4 A;  5LMU K;  4BVP A;  4FWP A;  4DUZ K;  4RW9 A;  4AIL C;  4KB1 A;  4ELT A;  3BZC A;  3VOV A;  2J4R A;  2QWR A;  3MK6 A;  5LL6 Z;  2RE2 A;  4BQZ A;  4CJ7 A;  2BDP A;  1IH7 A;  5LJV A;  4ISE A;  4PL7 A;  3EEQ A;  1RBS A;  3VQD A;  3KK7 A;  4M45 A;  1E4G T;  1RT4 A;  5C12 A;  1LW0 A;  1BUP A;  3GE1 A;  4EP5 A;  4CBX A;  2A5X A;  5LJW A;  1RDC A;  3O1W A;  4FL9 A;  4B08 A;  4H0O A;  2Z1I A;  4OLA A;  3KLF A;  3E1Y A;  4K8X A;  2G8K A;  2DFE A;  3HK2 A;  3DOK A;  3RWU A;  1S72 N;  4GV3 A;  4ZTF A;  3RR8 A;  3BUZ B;  4JK8 A;  4NB4 A;  5FPE A;  3TAB A;  4EP4 A;  1GOA A;  4JI0 K;  3A0I X;  3LAK A;  4B1X B;  3DLB A;  1K73 O;  1NOZ A;  1NGF A;  3FFI A;  4JK7 A;  1ZBS A;  5AQL A;  4B1U B;  4F2S A;  1VSM A;  1A5X A;  2OYQ A;  1JCG A;  5CZ1 A;  1LOT B;  2YJE A;  3SAG A;  5FRN A;  3SAH A;  3M5R A;  1IKW A;  1S6P A;  5C15 A;  1VSJ A;  3IS9 A;  1TKX A;  1WUA A;  2ZF5 O;  2Q3S A;  1LCU A;  3ALY A;  4FPA A;  1BCM A;  3NGY A;  3CI5 A;  1TV6 A;  3ZSY A;  3OY9 A;  2WOM A;  3NDK A;  4KTZ A;  4NXM K;  4CK3 A;  3C6A A;  3RRG A;  1QHT A;  3JSM A;  1UA1 A;  4DV0 K;  3CM5 A;  1C1C A;  2HNY A;  3BDP A;  3QNN A;  1VQN N;  1VQ7 N;  4WYB A;  1KFS A;  4BR7 A;  4QS7 A;  3OTO K;  4DR4 K;  1SZ2 A;  2Y1I A;  3DXM A;  1ATS A;  3DXM B;  4EZ6 A;  4KO0 A;  3MN5 A;  2CH6 A;  4JKA A;  3VQA A;  3A5M C;  5EU7 A;  2BH1 A;  4I7F A;  3R1X A;  2W6K A;  2XY7 A;  3CJA A;  5E41 A;  4DR5 K;  2W40 A;  3DLH A;  3ZT2 A;  4CE9 A;  2NZT A;  3P4I A;  3ZSQ A;  4J8F A;  3W3D A;  2P9N A;  2P9N B;  3QFU A;  3K57 A;  4Z4C A;  4E7I A;  1VSD A;  1WN7 A;  2O4I A;  3AA4 A;  2D0A A;  3HT3 A;  1ZBH A;  3A5O C;  4IO9 L;  3VA3 A;  4I2Q A;  4LFB K;  1NLV A;  1FKP A;  3FZM A;  1VQK N;  3HYF A;  3E01 A;  1WAF A;  3O9S A;  5M1K A;  4M3Y A;  3U3Y A;  2P5O A;  3QB0 A;  4DTJ A;  5AQJ A;  4IFE A;  4CIE A;  1GLB G;  4GMJ B;  1VQ8 N;  1VRU A;  4F8R A;  3NF8 A;  5EVZ A;  4AQY K;  4BRC A;  5AQU A;  3ULE A;  3ULE B;  2P9S A;  3U9Z A;  2P9S B;  4FWN A;  1TVR A;  3HPG A;  3AVB A;  1RT3 A;  1HNV A;  2OTL N;  4DTO A;  3LL3 A;  3O08 A;  3U3G A;  3JS6 A;  5GAG P;  1X9M A;  1XHX A;  5AQH A;  2P5G A;  4O5B A;  1VRT A;  4BRF A;  1I39 A;  3DYA A;  3ATU A;  1JCE A;  3SJH A;  3WNG A;  3ISN C;  2FSJ A;  2KZM A;  4U7B A;  4AHT A;  2XO7 A;  2E2N A;  3QIO A;  1N34 K;  2WC9 A;  2NLX A;  1OH5 A;  3LDQ A;  1KLN A;  5JLF A;  1KAZ A;  3CME N;  1U04 A;  1I94 K;  1J6Z A;  1FJG K;  5F2R A;  3P1G A;  4YOV A;  5M1F A;  3VQ9 A;  3HOT A;  2FBX A;  3C95 A;  4CGH A;  2OPS A;  3J80 O;  3K0S A;  1VQ5 N;  3L4I A;  4YOW A;  3VGK A;  4B1V A;  4DSK A;  1S9E A;  4LF7 K;  4KHQ A;  4CGI A;  1WLJ A;  2A1R A;  1VQP N;  1T44 A;  3I8D A;  1X1P A;  5CHI A;  1JLA A;  1JLQ A;  3IG1 A;  2ITG A;  3RTV A;  3A8Y A;  3AGR A;  1KVB A;  5E26 A;  1VQ9 N;  1NGC A;  4HCC A;  4WF9 L;  4DTS A;  4F3T A;  4FLU A;  2LSN A;  1JL1 A;  1C0M A;  4EFH A;  4KV8 A;  4B1Y B;  4C8O A;  1IG9 A;  1KRP A;  1MWM A;  2KHO A;  3DWL A;  3AVJ A;  3H1Q A;  3BZK A;  2G8U A;  3O4W A;  2FF6 A;  3HM9 A;  3RSE A;  4CHO A;  1BQN A;  3RSE B;  4KTQ A;  3WXI A;  4H8K A;  1BGX T;  3AVL A;  3U8X A;  1BIS A;  1BWF O;  1JLC A;  1G15 A;  1NM1 A;  1N33 K;  3K9K A;  3FZK A;  3L2W A;  4YOT A;  3CJ1 A;  3V1Q A;  4OKK A;  1D9D A;  3FE1 A;  4OPH A;  1NK6 A;  3L0Q A;  3BP8 A;  3VN5 A;  2X6S A;  3AV9 A;  4FM2 A;  5BR8 K;  1TK0 A;  4WE1 A;  5D3G A;  1EP4 A;  3VEZ A;  1B92 A;  3C94 A;  3NVM A;  1KSP A;  4L8R B;  1RTH A;  3QEW A;  3LDN A;  2QK9 A;  3TAQ A;  4KHS A;  5GAE P;  3AVF A;  4K43 A;  4F9O A;  1DT9 A;  4X66 K;  3J7Z O;  4FJG A;  3AVG A;  1TUU A;  1HRH A;  4IBN A;  1Q8I A;  1VQL N;  3SBT A;  1YTU A;  3MXM A;  4FJ9 A;  4FOI A;  1E3M A;  1HQU A;  2E2O A;  3DRS A;  2F9W A;  1RBV A;  5E84 A;  2DFH A;  5BRF A;  1NU0 A;  5J2P A;  2FSK A;  4J2E A;  1RCH A;  1Q9Y A;  3LDS A;  4N56 A;  3V9Z A;  3IRX A;  5AQW A;  2EWS A;  4BAC A;  1OH7 A;  3L8B A;  3LM2 A;  5BPM A;  4FZX C;  4A2B A;  3W0L A;  3O4N A;  4MFB A;  3V1O A;  3CQY A;  3RVC A;  3SYZ A;  1NGD A;  3K5N A;  4IEI A;  1JLE A;  4DSI A;  5MLC Q;  4JRP A;  3SQ2 A;  1T8E A;  1VAZ A;  3VQ7 A;  2A6A A;  4C8N A;  3DM2 A;  1U6Z A;  2GWK A;  4LC9 B;  1TL1 A;  5GIO A;  4OKE A;  3CFR A;  1U48 A;  3D6R A;  3LP2 A;  4IO8 A;  5AQO A;  3ASM A;  3BF1 A;  1C1B A;  4JKB A;  1HX1 A;  1ASU A;  2EHG A;  4Z4H A;  3L2Q A;  4O5F A;  4JS5 A;  4PWD A;  2O8C A;  5FPD A;  2O8C B;  1SKR A;  4LH4 A;  1HR0 K;  4GVM A;  4AH9 A;  3NF9 A;  4CEA A;  2R7Y A;  3R3L A;  2UXD K;  1LAV A;  1NKE A;  1QZ5 A;  4DTP A;  3VQ4 A;  4DFP A;  1REV A;  4JI6 K;  1LV5 A;  5KQ8 A;  3VF2 A;  1BU6 O;  2YCH A;  3QEI A;  3VET A;  3O9U A;  3GL1 A;  1Q18 A;  4I9Q A;  2VCP A;  2ZM6 K;  4BDZ A;  3KKS A;  3ZT1 A;  1RFQ A;  3ID8 A;  5BN9 A;  2UXB K;  1HLU A;  1KC8 O;  4CD1 A;  1EQY A;  3U6F A;  1D5A A;  2VYP A;  4CEC A;  3KWI A;  2E4L A;  2VWB A;  3MMV A;  1GOB A;  3AO4 A;  2IS3 A;  4MDB A;  2P9K A;  2P9K B;  1RDU A;  1U4B A;  4FWM A;  3PIP L;  1SL2 A;  4FVM A;  1OH6 A;  4DS5 A;  3CC4 N;  4B1W B;  3S3M A;  3VEV A;  4KHY A;  3TTC A;  4CJF A;  3L3U A;  2KFZ A;  2OCE A;  2WTU A;  4H5N A;  3ZX3 A;  1UA0 A;  4BRO A;  4LF9 K;  3SQ0 A;  1NGI A;  5TKY A;  4ID5 A;  3TWH A;  1L3S A;  4JKF A;  4CJ4 A;  2G8I A;  4GNI A;  4AHV A;  3PUF A;  3PX6 A;  4JI7 K;  4LSN A;  3OBY A;  4EIA A;  4CEE A;  3CG7 A;  1Q7Y O;  3NE6 A;  2JWK A;  3P38 A;  1HQE A;  3BGR A;  2GX9 A;  4CFB A;  1K6Y A;  3QER A;  4YOX A;  4BVO A;  3ZEU B;  3MWT A;  4UQG A;  4CZI A;  2E8A A;  1OKJ A;  5C10 A;  1GLC G;  1NGE A;  3ZYY X;  4DQS A;  4BR0 A;  2QWQ A;  2PZS A;  4LFA K;  4E7K A;  1CZ9 A;  3J7A P;  1ITG A;  3V6D A;  3K9J A;  1S1W A;  4KB0 A;  4KBO A;  4DV4 K;  4DG1 A;  1KVA A;  3M6G A;  4FSV A;  3RMB A;  4CZF A;  5GAD P;  5AQQ A;  2HBL A;  4CHN A;  3KK3 A;  2OTJ N;  3SNN A;  2ETJ A;  1S1U A;  3IFR A;  3DI6 A;  1NGG A;  5LMN K;  4B9L A;  1JXB A;  5JLH A;  3NH1 A;  2HHS A;  4B9V A;  4IWV A;  5F0X A;  3VQQ A;  1RT5 A;  4J2A A;  1NJW A;  3PX4 A;  5AQT A;  5C25 A;  2IAJ A;  2KW4 A;  3CYM A;  4W5R A;  3LZJ A;  3H1V X;  2UXC K;  4BQL A;  1C0G A;  3TTF A;  4H5W A;  4B3T K;  4BRG A;  4A57 A;  4QS8 A;  1FK9 A;  1LWE A;  1RT6 A;  1DGK N;  3M8S A;  3ZSX A;  3KWG A;  4LY7 A;  2PYJ A;  1KQS M;  1VHX A;  2PBD A;  1HUX A;  1SS6 A;  2B6A A;  3NF7 A;  4OX9 K;  1XQS C;  4KH4 A;  3IUC A;  1XWL A;  3OYF A;  1S1T A;  1YUW A;  2JWL A;  4M7Y A;  4PHT X;  1XNQ K;  2GUP A;  5HBM A;  4CIG A;  4JN4 A;  4N47 A;  3BF3 A;  4BDP A;  5HOO A;  4JKH A;  1J5E K;  1QSS A;  5KGX A;  3D2F A;  3D2F B;  4BRM A;  4BR5 A;  3SUO A;  3QFP A;  1U45 A;  5IWA K;  2Z1G A;  2W6L A;  3HTV A;  4JHD A;  1BO5 O;  4JHD B;  1BI4 A;  1ASW A;  1W97 L;  1BI4 B;  2HNZ A;  3CHW A;  3FFK B;  3WQT A;  2UUC K;  2F8S A;  1VSK A;  4BC3 A;  1I3A A;  1N36 K;  2ZD1 A;  4DV5 K;  2P51 A;  5AQS A;  4K8Z A;  3C6U A;  2QWL A;  4OLB A;  2VQF K;  3GG4 A;  1MU2 A;  4ELU A;  3SBG A;  3MEC A;  2IC3 A;  3HPH A;  4EAH D;  3CCU N;  3OYI A;  3F5T A;  3MWP A;  1NBW A;  2OAN A;  5ELZ A;  3FR0 A;  1V4S A;  2UU9 K;  3HRG A;  1IV0 A;  4DU4 A;  1NJI O;  1KVC A;  3CCJ N;  1YHQ N;  3ZET A;  3ZET B;  4C1N K;  3CCE N;  5C2F A;  4B9S A;  4DLE A;  3FZF A;  3O9T A;  3NMU A;  5JS1 A;  4NYF A;  2XRI A;  3NH0 A;  3C65 A;  4BRN A;  4DLG A;  2YNI A;  4I6M A;  1NK4 A;  4I6M B;  3VA0 A;  1RTI A;  1XNR K;  1QQM A;  3CPE A;  4H0P A;  5BPN A;  3VGL A;  2RHK A;  5BRD A;  4HTU A;  4CJK A;  3AY9 A;  4ZHR A;  4KI4 A;  4K0K K;  1ILY A;  2HHQ A;  2D0C A;  4DR7 K;  2D0O A;  4ZTJ A;  4OPA A;  2OZS A;  1NGH A;  1F21 A;  2G8F A;  3P39 A;  2V51 B;  4LH5 A;  4PUO A;  4V19 S;  3DAW A;  3OHR A;  2NRV A;  4FM0 A;  1XMQ K;  1M90 O;  4KH6 A;  3HXM A;  3CPW M;  4CJU A;  4CHP A;  1Q9X A;  5J2M A;  4BE2 A;  5GIP A;  4I2P A;  5HRP A;  3CC2 N;  3ATV A;  1OH8 A;  1EXQ A;  4FPB A;  5FRO A;  5H1S Q;  2GEM A;  4NLB A;  3VQ5 A;  4FOE A;  4CES A;  3VER A;  4DF8 A;  2KZZ A;  3WQU A;  4W5Q A;  2Q0U A;  2O4G A;  4DSJ A;  1P90 A;  3HBT A;  3L2R A;  3H08 A;  4RW4 A;  1QSY A;  2HVH A;  3AVA A;  4YOR A;  4A61 A;  4KHW A;  3JAM O;  4NXN K;  3T19 A;  1NGA A;  4B9T A;  1WSE A;  4CZG A;  4MLE A;  3KIO A;  4JI5 K;  3I33 A;  4KHU A;  1RTD A;  4ISG A;  3NAE A;  3VTH A;  1TKT A;  1GLE G;  3CC7 N;  1JLB A;  1HKB A;  3K5M A;  1LWC A;  4M3X A;  2QXF A;  2ITM A;  1G99 A;  4KRE A;  3TR8 A;  3TAR A;  1VSE A;  4FLY A;  4O0I A;  3E9P A;  2X6N A;  2Z1H A;  3IMX A;  4U67 L;  4TSX A;  1NMD A;  4CEO A;  4BR4 A;  4IEE A;  3OBW A;  4JI8 K;  3HP9 A;  3OYL A;  3AA5 X;  1EO1 A;  4WQ4 C;  2HST A;  4YOY A;  4LD0 A;  2ZWH A;  4DV6 K;  4MO5 A;  2VGN A;  2UUB K;  2ZJQ L;  5SZT A;  3JYT A;  1BQM A;  2Q31 A;  2YHW A;  1IKY A;  1WBB A;  4CER A;  2HMP A;  1BOT O;  1KCF A;  4KAZ A;  5AQZ A;  3NF6 A;  1C0F A;  3CET A;  4DFK A;  4JNE A;  1ZYQ A;  1TL3 A;  3B6O A;  2YNG A;  3SK3 A;  4FWR A;  3OS0 A;  3ZT0 A;  2QWP A;  3KD1 E;  4AHC A;  2QW9 A;  5C24 A;  1D4X A;  3THY A;  3THY B;  3AAQ A;  2KKZ A;  4IJN A;  4DTR A;  4FWQ A;  3CCM N;  3TAF A;  3VQE A;  1QS4 A;  3QLH A;  4CFA A;  1KXP A;  5FPN A;  1RBT A;  3KLI A;  1DTQ A;  3WXK A;  4CJV A;  2G8W A;  1KTQ A;  3G6E N;  1N32 K;  2KTQ A;  4RTF D;  3EN9 A;  4Z0U A;  1R59 O;  2DTU A;  2IVN A;  4AHR A;  3K5L A;  1HNZ K;  3U4L A;  1RDA A;  3OS1 A;  4NCA A;  1XC9 A;  1HYZ A;  3V81 A;  5HL7 L;  3O9R A;  4H5R A;  4E3S A;  1YJN N;  1WSI A;  4CK1 A;  1MDU B;  4CF8 A;  2GEL A;  2HBJ A;  3HPO A;  1QVF M;  3M3Z A;  2YX6 A;  2OPP A;  5AQF A;  2GV9 A;  4E7H A;  3HM8 A;  3S3O A;  1JJ2 M;  3UB5 A;  1HPM A;  4HVJ A;  4CJW A;  1S1X A;  4EZ9 A;  1H1V A;  4H0Y B;  3ZSO A;  1IKV A;  4I9L A;  3MXI A;  1QHA A;  3WXM B;  2VGM A;  1Z26 A;  4BRP A;  3VQP A;  2IVP A;  3NBP A;  2IDO A;  1GOC A;  3QO9 A;  1Z05 A;  2YJF A;  3AA3 A;  4FJK A;  4Y1D A;  1QTM A;  4FZY A;  4AHU A;  1ZBI A;  4FXD A;  3HL8 A;  4CEF A;  1IG8 A;  3AAP A;  5J2N A;  5HLF A;  5HRN A;  4CEB A;  1JCF A;  5AFU H;  2O8B A;  2O8B B;  4OGC A;  3O4Q A;  4PA1 A;  3OYA A;  2D1K A;  3RMD A;  2BE2 A;  4JD2 A;  4JD2 B;  1IBM K;  3MAQ A;  5K14 A;  3V9X A;  3TI0 A;  3MX2 A;  2A41 A;  1HYS A;  1WAJ A;  5GIN A;  1K8A O;  3A5L C;  1JLG A;  4DV7 K;  1X3M A;  1K9M O;  4HCB A;  3WNH A;  1T05 A;  4ELV A;  1RBU A;  3N4P A;  3CCL N;  4OKJ A;  3VQ8 A;  1YVU A;  3WXL A;  3SUP A;  5T7B A;  2P9P A;  4J2D A;  2P9P B;  5AQX A;  2ASP A;  2QM1 A;  2O8F A;  4CJS A;  3O3H A;  2O8F B;  4CVN E;  3LWM A;  4M3W A;  1HPZ A;  4H03 B;  5I3U A;  2QKB A;  4CZE A;  4K42 A;  4Z4E A;  3T1H K;  3EKS A;  4CK2 A;  3D45 A;  2W41 A;  3L6Q A;  4FWS A;  4QAG A;  4NO7 A;  1SQK A;  5FDL A;  5BR9 A;  3IAY A;  3AO3 A;  3KHY A;  2E6M A;  3Q7B A;  4B3R K;  5M1O A;  2YKN A;  4E1J A;  2IOC A;  3K59 A;  1GLD G;  2QA4 N;  3H6E A;  3AVK A;  1P8Z A;  4DQI A;  4N41 A;  2GWJ A;  4ILH A;  3CXC M;  4M41 A;  2I7N A;  4CJQ A;  5HRO A;  5CR4 A;  1TKZ A;  4DFJ A;  1A5W A;  2GTD A;  4YDU C;  4CJP A;  3HP6 A;  4B3O A;  2HHH K;  5HP1 A;  4DMN A;  1BA0 A;  4B9U A;  4CZJ A;  2YHY A;  4OVL A;  4OGE A;  4GKJ K;  3QEX A;  4WFN L;  4QS9 A;  2PAV A;  2YHB A;  4ILJ A;  3NH2 A;  4DSL A;  3O3F A;  2NRX A;  5TKW A;  4DTM A;  2YV0 X;  3AVH A;  4FK0 A;  3J7Y P;  3C6H A;  1TK5 A;  3OYD A;  3VGM A;  3KVG A;  2BUP A;  4QCL A;  5BPL A;  1VQM N;  3ITH A;  2HW3 A;  3DXK A;  3RMA A;  3DXK B;  4IOC L;  1YJW N;  2G8H A;  5LY3 A;  3SCX A;  1KAY A;  3CER A;  1X3N A;  2P1J A;  4IDK A;  3KTQ A;  4WQ5 C;  4E7J A;  1T7P A;  1Y97 A;  3IKM A;  4JK9 A;  2RPI A;  5JIC A;  4WCE L;  3CJC A;  2QWO A;  3K58 A;  5KPR A;  5EX5 A;  3C0B A;  4DTX A;  4FW1 A;  1YI2 N;  3AAR A;  4X62 K;  3DLL L;  1X9J A;  4AM6 A;  5AJ3 K;  3B6P A;  3O3G A;  3I8B A;  4BRQ A;  2OA8 A;  3CIP A;  2AP1 A;  3WXJ A;  4CHY A;  3F73 A;  3I0R A;  1NWK A;  4FLZ A;  1GLJ O;  4JKE A;  4ID1 A;  1N5Y A;  3AGK A;  4JKC A;  4AF1 A;  5J1E A;  4DQR A;  1U2V A;  1U2V B;  4EHT A;  5CY4 A;  4CZK A;  3KLG A;  1TAU A;  1GLF O;  2NUB A;  2HF3 A;  1CLQ A;  3V1R A;  4IFV A;  4KPY A;  3M8P A;  2NRZ A;  2FBT A;  1L5U A;  1WBD A;  3FGU A;  4IOA L;  1NNE A;  4FJI A;  1L3V A;  1BDG A;  4LF4 K;  3PY8 A;  3G71 N;  2YHA A;  4UY8 O;  4DTU A;  4CF9 A;  1IJJ A;  4FJX A;  3ZX0 A;  2VQE K;  4JKG A;  4JKG B;  5C42 A;  4ICL A;  1GLA G;  2A3Z A;  3AO2 A;  5KRT A;  2HVI A;  4FJ8 A;  3CCR N;  4DF4 A;  2Z1J A;  3VQ6 A;  4CJL A;  3L3V A;  3VQC A;  3TAG A;  4W5O A;  1VK0 A;  5AQP A;  4BC2 A;  3E9O A;  3VEX A;  1NK9 A;  3MEG A;  1K8K A;  2HND A;  1K8K B;  4KFB A;  1YIT N;  4JEP A;  1NK8 A;  2FBY A;  1R0A A;  1NJX A;  4PQU A;  2ASM A;  3V9W A;  5AZJ A;  4FJH A;  2DPN A;  5DK5 A;  5AZJ B;  1YJ9 N;  1IKX A;  3BY5 A;  3DLR A;  5KPZ A;  4E1N A;  4IKF A;  4DSF A;  1ATN A;  5AZI A;  5AZI B;  4YHH K;  3KLH A;  1O1W A;  2FBV A;  2RF2 A;  1QQC A;  4CZM A;  5AQN A;  1TYQ A;  3S41 A;  1W0H A;  4ILG B;  5KI6 A;  2W42 A;  3THX A;  3THX B;  1NK0 A;  2KFN A;  3OYC A;  5F1X A;  3ZSZ A;  2WUS A;  5CYQ A;  4MDA A;  2YNF A;  3HZ6 A;  4E89 A;  3KLE A;  3ZSV A;  3M8Q A;  1DEJ A;  3I0S A;  4YNQ A;  1KAX A;  4CZH A;  3QBW A;  5AQI A;  4FJL A;  3OW2 M;  3EY1 A;  1RIL A;  4OPJ A;  3I56 N;  1MA9 B;  1SUQ A;  3AVI A;  4F4K A;  3QEP A;  4FJN A;  2UYT A;  2CGK A;  2A40 A;  3TU5 A;  2QXL A;  4B3M K;  1UOC A;  5I9E B;  4H0T B;  3BEX A;  3D7E O;  2F7T A;  4FJJ A;  1UAX A;  3LP3 A;  3F9K A;  5IT9 O;  1XI1 A;  4C8K A;  1C0T A;  1NK7 A;  4RW7 A;  4DFM A;  5BRH A;  4OJR A;  1ZBF A;  3SMP A;  3T1Y K;  4F3O A;  5DM6 L;  1IBK K;  4FLT A;  3OYN A;  4PL8 A;  4Z4I A;  1DLO A;  5AQV A;  3ULD A;  4CGF A;  4H0X B;  1VQO N;  1FXX A;  1B9F A;  4K41 A;  4PKI A;  4W5T A;  3TAM A;  5JVH L;  4WFB L;  3NCI A;  2VG7 A;  3VEY A;  3QIN A;  1SKW A;  4FWL A;  4AM7 A;  2CH5 A;  4FK4 A;  4CD3 A;  2JLE A;  2HMI A;  1RDB A;  2FSN A;  2JGU A;  4AHS A;  4H5V A;  3O1B A;  2PYL A;  3V9U A;  3CM6 A;  3GDQ A;  3SQ4 A;  1HKC A;  4O8K A;  4NCB A;  2O8D A;  4B9Q A;  3HO1 A;  3SUQ A;  3P5J A;  1SKS A;  4CFC A;  4DHY A;  3UE5 A;  4XH1 A;  5ADX H;  1YXQ A;  3G25 A;  4CHZ A;  4Z4G A;  3O6W A;  4FJ5 A;  5EY4 A;  3P83 D;  4IOX A;  1A5V A;  1S22 A;  1V4T A;  1XUP O;  4FLV A;  4KRF A;  3ZT4 A;  4DQP A;  2V7Y A;  2Q0R A;  1CZB A;  1U47 A;  4E1M A;  5JVG L;  4CJR A;  4W5N A;  3ZLJ A;  4GW6 A;  2HF4 A;  4KI6 A;  1X9S A;  4JS4 A;  2D0P A;  5EXW A;  2GBZ A;  3LAM A;  3MEE A;  3G0Z A;  4N76 A;  4ISF A;  1J53 A;  3DRR A;  4JI1 K;  2VWJ A;  4FK2 A;  3O5B A;  5KQD A;  3CCV N;  4BC4 A;  3OVN A;  1D9F A;  4EHU A;  3LPT A;  1RNH A;  3M1F A;  3SQ1 A;  2D4W A;  4DR6 K;  1S5J A;  4H4M A;  1LWF A;  2YNH A;  4FYD A;  4JI3 K;  3MDQ A;  2E5L K;  3CCS N;  5AR0 A;  4HWI A;  4RWT A;  3NVK A;  3SUN A;  4PKH A;  3T1A A;  4C1N I;  3SPY A;  4GKK K;  3OA9 A;  4IG0 A;  3TSP A;  3ZX2 A;  4CGG A;  3H3O B;  4E7L A;  1M1K O;  2X78 A;  1Q81 O;  4BRE A;  1J9A A;  2F8T A;  3PSI A;  3WUH A;  1YIJ N;  4IDH A;  3CMA N;  4DSE A;  1HNX K;  3QEV A;  2RN2 A;  3QIP A;  1T03 A;  4FZZ A;  3V4I A;  3VPZ A;  3SJJ A;  3G10 A;  3MN7 A;  4HUG A;  3MED A;  1TUY A;  2A42 A;  2E20 A;  3VEW A;  4RW8 A;  1EWQ A;  3QES A;  2FLO A;  5M1P A;  4BDY A;  1KFD A;  3RR7 A;  3TSU A;  1BA1 A;  1C0U A;  4IXC A;  4BWJ A;  4YY3 K;  3OYE A;  2E2Q A;  1ESV A;  1U49 A;  3VMF B;  3LDO A;  3OJS A;  2HBM A;  2X74 A;  3C7N A;  3C7N B;  4LSL A;  3SLC A;  3KKR A;  4FWO A;  1HMV A;  1QZ6 A;  4DWI A;  1KLM A;  3TTD A;  3A2F A;  2GUI A;  2XY6 A;  3MCA B;  4K25 A;  4CF0 A;  4CF1 A;  1BL3 A;  1NGB A;  2OPR A;  3H46 O;  3J8A A;  3KK2 A;  3SI6 A;  3LP0 A;  3UKU A;  3UKU B;  4R79 A;  4JKD A;  2QTD A;  4IFY A;  2B4J A;  5JMV A;  4X65 K;  2XY8 A;  4Z4F A;  4M3Z A;  3THV A;  1S1V A;  3QBX A;  4YOU A;  5AFU A;  3AA2 A;  1WSG A;  4M3R A;  1T6D A;  4CBW A;  4MLH A;  4B8C A;  2F9T A;  4CW7 B;  2NRT A;  3NGI A;  4XH4 A;  4FJ7 A;  4LF8 K;  2NRR A;  3GOI A;  4Y0W A;  4WFA L;  3E9L A;  2ZGZ A;  1RT2 A;  3AO1 A;  2D0B A;  4CZL A;  2VWK A;  1JL2 A;  2VG6 A;  2BTF A;  3P31 A;  3SV3 A;  4DR1 K;  2DY4 A;  4M7X A;  4DTN A;  2I5J A;  3LDL A;  4BG9 A;  4X64 K;  3EZ5 A;  1J5O A;  4NYN A;  1WB9 A;  3MXJ A;  1XMO K;  1NGJ A;  4MO4 A;  3DOL A;  1Z6R A;  1W7A A;  4JLH A;  4JRQ A;  5B8H A;  3ENB A;  1ZBL A;  4BY9 C;  2CGL A;  3K5O A;  1YT3 A;  1N8R O;  5JS2 A;  1HNI A;  4B9N A;  3EZW A;  2P9I A;  2P9I B;  4CGJ A;  4DU1 A;  3PO5 A;  3DJC A;  1HYV A;  1T6C A;  3DLK A;  3ENH A;  1EET A;  4O55 A;  3PX0 A;  5EOY A;  1NKC A;  2HBK A;  4BGA A;  3M8R A;  1VSI A;  3CF5 L;  1RT7 A;  5SWM A;  1KD1 O;  2VG5 A;  2YKM A;  2E2P A;  4JAX A;  3MX5 A;  2V52 B;  2YI1 A;  3CQ8 A;  4DQQ A;  3CJB A;  4E19 A;  4BRH A;  3D0P A;  4C8L A;  2ATQ A;  4CCH A;  3B8A X;  5AQR A;  3EKU A;  1SL0 A;  1WSJ A;  3NHG A;  1OVQ A;  2QWN A;  4C8M A;  3SAF A;  2Q2R A;  2NRW A;  3R6M A;  3VF4 A;  3LWL A;  2KLA A;  2HHV A;  5A2Q O;  2WON A;  4DV2 K;  2E88 A;  3HVR A;  1LW2 A;  1RDW X;  4BRL A;  2ZJP L;  3OYH A;  1MWK A;  1XC3 A;  3OYG A;  3ZSR A;  2F4V K;  4JYA K;  4CIF A;  1L3U A;  4FJM A;  4CJ5 A;  2NRH A;  4DR3 K;  2EX3 A;  2RKI A;  4FO0 A;  4CEQ A;  4BRA A;  3ENO A;  1S9G A;  4H0V B;  3HSC A;  3HVT A;  3KJV A;  1IO2 A;  3LPU A;  4FM1 A;  3VEN A;  3IDH A;  4A5B A;  2Q36 A;  4G9Z A;  1HNW K;  4FLW A;  3CJ7 A;  5KGW A;  4B3S K;  2D5R A;  3QET A;  3EO3 A;  2IGI A;  4CHQ A;  3I55 N;  1HKG A;  4RW6 A;  4HHT A;  1C6V A;  1B9D A;  4KTW A;  3QIC A;  3UKR A;  2ZQB A;  3UKR B;  5HRS A;  1QE1 A;  3WNE A;  4H5T A;  2Q1N A;  3OYJ A;  5FRM A;  2E1Z A;  4NLC A;  3THW A;  3THW B;  2BGG A;  4HUE A;  4FVU A;  2AJQ A;  4A5A A;  3TAP A;  3KD5 E;  4Q0B A;  4BE1 A;  5FPM A;  5M1N A;  1NJY A;  1OVY A;  4KHN A;  3Q7C A;  4O4G A;  1Q82 O;  3S9H A;  3ZSW A;  3GBT A;  4DV3 K;  2UUA K;  3QNO A;  1O13 A;  4CBU A;  3LAL A;  4B9M A;  4CJT A;  4B1Z A;  5CE3 A;  4QOZ B;  1VQ4 N;  4Q5V A;  1RT1 A;  1S6Q A;  4Y1C A;  3LM9 A;  4DCH A;  1RGI A;  2NNW A;  4KKO A;  4Z94 A;  3OYM A;  5GAH P;  2KQ2 A;  3EYZ A;  2Y1J A;  1BIU A;  3VTI A;  3QDK A;  4BR2 A;  3FZH A;  1S3X A;  2P9U A;  2P9U B;  2ZE2 A;  3EE8 A;  3T3F A;  2BAN A;  5KTQ A;  3TAE A;  1BHL A;  1ZBU A;  3CD6 N;  2HOE A;  3HST B;  2F96 A;  1QVG M;  1Q86 O;  3J81 O;  3O80 A;  3OYK A;  3L4Q A;  3L2U A;  3DLE A;  4NCG A;  1FKO A;  1NKB A;  1W9H A;  4M3T A;  3R9P A;  5DM7 L;  3TPQ A;  4WQ4 A;  1YAG A;  1IBL K;  3EE9 A;  4RCH A;  3VF6 A;  1NOY A;  4DKW A;  4CED A;  1TKD A;  4O0J A;  3ID6 A;  3F9M A;  3LP1 A;  3PIO L;  4LF6 K;  1JXE A;  1EWR A;  4RG8 A;  1YTA A;  3MN9 A;  3AVC A;  2PY5 A;  3NGZ A;  5J2Q A;  5AQG A;  2HHW A;  4GV6 A;  3PV8 A;  2XY5 A;  3DRP A;  4G1Q A;  5AQM A;  1FW6 A;  4GY2 B;  4B8A B;  4MQ3 A;  2OPQ A;  3FZL A;  2G8V A;  3T7Z A;  4C23 A;  1ASV A;  1WOQ A;  3E66 A;  3N4Q A;  1VSL A;  2I7P A;  3CFP A;  1RDD A;  1HJO A;  4L3Q A;  4BE0 A;  4JV5 K;  4DUY K;  2YHX A;  2V7Z A;  4A2A A;  4LFC K;  4FWK A;  5C0Y A;  3L2V A;  3AO5 A;  1WNS A;  4M3U A;  2OZM A;  4HUF A;  3U9D A;  1HJR A;  1TGO A;  3KZB A;  4YFU A;  2P9L A;  3H45 C;  2P9L B;  3K2P A;  1NK5 A;  4H4O A;  3RMC A;  4DV1 K;  2XHB A;  3FLC O;  1N6Q A;  1WSF A;  3G4S N;  3CCQ N;  1TAQ A;  4BC5 A;  4KH5 A;  3PO4 A;  4F2R A;  2FF3 B;  2QI2 A;  3OJU A; 
#chains in the Genus database with same CATH homology
 4FJ5 A;  3P83 D;  1XHZ A;  5SZT A;  1TK0 A;  3JYT A;  1BQM A;  4WE1 A;  5D3G A;  1A5V A;  1EP4 A;  1B92 A;  1IKY A;  4FLV A;  4KRF A;  3ZT4 A;  4DQP A;  3C94 A;  2DFF A;  4CER A;  1KSP A;  4L8R B;  1CZB A;  1U47 A;  1RTH A;  1KCF A;  4KAZ A;  4E1M A;  3QEW A;  1BCO A;  3NF6 A;  2QK9 A;  4FW2 A;  4CJR A;  4W5N A;  3CFO A;  4CF2 A;  3TAQ A;  4DFK A;  4KHS A;  3ZCM A;  4GW6 A;  1ZYQ A;  4DS4 A;  4CFD A;  1TL3 A;  3B6O A;  2QKK A;  3ZT3 A;  4KI6 A;  1X9S A;  2YNG A;  4JS4 A;  3AVF A;  1RBR A;  4XIU A;  3OS0 A;  2GBZ A;  3ZT0 A;  3LAM A;  3AVG A;  3MEE A;  4FJG A;  2E6L A;  3G0Z A;  2A1S A;  1HRH A;  4AHC A;  3KD1 E;  4N76 A;  1CXU A;  4IBN A;  1J53 A;  1Q8I A;  1C1A A;  3DRR A;  5DMR A;  5C24 A;  2VWJ A;  4CJ3 A;  4DU3 A;  4FK2 A;  3OYB A;  1YTU A;  3MXM A;  4DTR A;  4FJ9 A;  3TAF A;  1HQU A;  3VQE A;  1QS4 A;  3DRS A;  3QLH A;  4Z4G A;  4CFA A;  1CXQ A;  1RBV A;  1VSF A;  1D9F A;  3OVN A;  2DFH A;  3LPT A;  1RNH A;  5HRR A;  1RBT A;  3SQ1 A;  1WSH A;  1S5J A;  1DTQ A;  3KLI A;  4CJV A;  4OPK A;  2G8W A;  1KTQ A;  4H4M A;  1D8Y A;  2KTQ A;  1LWF A;  5J2P A;  4Z0U A;  2YNH A;  3V9S A;  4FYD A;  1UWB A;  2DTU A;  1RTJ A;  4J2E A;  1RCH A;  4AHR A;  3K5L A;  1Q9Y A;  3LDS A;  1J54 A;  4N56 A;  3V9Z A;  4NCA A;  1RDA A;  1EKE A;  3OS1 A;  3IRX A;  1TAU A;  1XC9 A;  3SUN A;  1HYZ A;  3V81 A;  4E3S A;  3T1A A;  1WSI A;  4B3O A;  4CK1 A;  4BAC A;  3L8B A;  3SPY A;  3AVN A;  4IG0 A;  4E7L A;  4CF8 A;  4CGG A;  3TAN A;  4J2B A;  3AVM A;  2X78 A;  3KK1 A;  4FZX C;  3O4N A;  3HPO A;  3DLG A;  4MFB A;  3V1O A;  2HHU A;  3SYZ A;  1J9A A;  4E0D A;  2F8T A;  2B5J A;  3K5N A;  2OPP A;  4DSE A;  3QEV A;  1JLE A;  2RN2 A;  4DSI A;  2GV9 A;  1SV5 A;  3QIP A;  4CGD A;  4JRP A;  3SQ2 A;  3VQ7 A;  1T8E A;  3NFA A;  1T03 A;  4FZZ A;  4C8N A;  3V4I A;  3DM2 A;  1DTT A;  3SJJ A;  4E7H A;  3G10 A;  5KRS A;  1TL1 A;  1JKH A;  3SZ2 A;  3S3O A;  3OS2 A;  4HUG A;  1VSH A;  3MED A;  4OKE A;  5CZ2 A;  3VQB A;  4HVJ A;  4PY5 A;  4CJW A;  3CFR A;  1U48 A;  4RW8 A;  3LP2 A;  3QES A;  1S1X A;  4CJE A;  4EZ9 A;  3ASM A;  4BDY A;  1C1B A;  1KFD A;  3ZSO A;  3SV4 A;  3RR7 A;  1IKV A;  1ASU A;  3WNF A;  3S3N A;  2EHG A;  4I9L A;  3MXI A;  4Z4H A;  3L2Q A;  4JS5 A;  4PWD A;  1Z26 A;  3VQP A;  1C0U A;  3NBP A;  2IDO A;  1GOC A;  4BWJ A;  3OYE A;  3QO9 A;  1SKR A;  4LH4 A;  4CEZ A;  3AA3 A;  1U49 A;  4Y1D A;  1X9W A;  1SL1 A;  4GVM A;  4FJK A;  1QTM A;  2FC0 A;  4AH9 A;  3NF9 A;  4AHU A;  4FZY A;  4CEA A;  3HL8 A;  2R7Y A;  4CEF A;  5J2N A;  1QSL A;  5HLF A;  1ZBI A;  4FXD A;  1LAV A;  5HRN A;  3OJS A;  2X74 A;  3RRH A;  4CEB A;  3LAN A;  1NKE A;  4DTP A;  3VQ4 A;  4DFP A;  4OGC A;  3O4Q A;  4LSL A;  1CLQ A;  4PA1 A;  1REV A;  3KKR A;  3OYA A;  4FLX A;  4M42 A;  3RMD A;  1LV5 A;  1HMV A;  2BE2 A;  4N5S A;  1Z25 A;  1BIZ A;  1LAW A;  2HHX A;  4DWI A;  1KLM A;  3QEI A;  3MAQ A;  5K14 A;  3A2F A;  2GUI A;  5I42 A;  2XY6 A;  3V9X A;  4R5P A;  3TI0 A;  3SPZ A;  1HYS A;  4CF0 A;  5CYM A;  4CF1 A;  1BL3 A;  1WAJ A;  2OPR A;  3UIQ A;  4BWM A;  4I9Q A;  4BDZ A;  3KKS A;  1JLG A;  3ZT1 A;  3KK2 A;  3SI6 A;  3HJF A;  3LP0 A;  4IG3 A;  4HCB A;  3WNH A;  3U6F A;  1D5A A;  4IFY A;  1T05 A;  2B4J A;  4CEC A;  1NJZ A;  4ELV A;  2HHT A;  1RBU A;  2E4L A;  4OKJ A;  3DMJ A;  3VQ8 A;  1YVU A;  2XY8 A;  4Z4F A;  1TK8 A;  3SUP A;  4M3Z A;  3THV A;  5T7B A;  1GOB A;  1S1V A;  3AO4 A;  3C6T A;  2IS3 A;  4J2D A;  3AA2 A;  4CJS A;  3O3H A;  3LZI A;  4FCY A;  1WSG A;  4M3R A;  4OLA A;  3LWM A;  4M3W A;  1HPZ A;  1JLF A;  4O44 A;  5I3U A;  2QKB A;  4B8C A;  1L3T A;  1U4B A;  4Z4E A;  2HB5 A;  3NGI A;  1EX4 A;  1SL2 A;  4FVM A;  4CK2 A;  4FJ7 A;  3D45 A;  4DS5 A;  4QAG A;  3S3M A;  4RW9 A;  4KHY A;  4AIL C;  4KB1 A;  1RT2 A;  4CJF A;  5FDL A;  4ELT A;  3IAY A;  3L3U A;  2KFZ A;  3AO3 A;  2E6M A;  2BDP A;  1IH7 A;  1UA0 A;  3AO1 A;  2D0B A;  2VWK A;  1JL2 A;  1RBS A;  2YKN A;  2VG6 A;  3SQ0 A;  2IOC A;  3VQD A;  3SV3 A;  4ID5 A;  4M45 A;  2DY4 A;  4DTN A;  1RT4 A;  2I5J A;  3K59 A;  1LW0 A;  3TWH A;  1L3S A;  4EP5 A;  4CJ4 A;  3EZ5 A;  3AVK A;  1J5O A;  2G8I A;  4NYN A;  4AHV A;  4DQI A;  4N41 A;  3PUF A;  3PX6 A;  3MXJ A;  4LSN A;  4M41 A;  4CJQ A;  1RDC A;  3DOL A;  5HRO A;  1TKZ A;  4DFJ A;  1A5W A;  4B08 A;  4CEE A;  3CG7 A;  4CJP A;  3HP6 A;  4JLH A;  3NE6 A;  4JRQ A;  1HQE A;  2Z1I A;  3BGR A;  3KLF A;  4E7I A;  4CFB A;  1ZBL A;  1K6Y A;  3K5O A;  1YT3 A;  3QER A;  2G8K A;  4K8X A;  2DFE A;  3HK2 A;  3DOK A;  3RWU A;  5JS2 A;  4UQG A;  5HP1 A;  4DMN A;  1HNI A;  4B9U A;  4B9N A;  4OVL A;  4OGE A;  4DQS A;  4CGJ A;  4DU1 A;  3QEX A;  4ZTF A;  3PO5 A;  3RR8 A;  2PZS A;  1HYV A;  3TAB A;  4E7K A;  3DLK A;  4EP4 A;  1GOA A;  1CZ9 A;  1EET A;  2YHB A;  4O55 A;  3NH2 A;  3PX0 A;  1ITG A;  4DSL A;  3V6D A;  3O3F A;  1NKC A;  3LAK A;  3DLB A;  4KB0 A;  1S1W A;  1NOZ A;  3M8R A;  2YV0 X;  3AVH A;  4DTM A;  4FK0 A;  1VSI A;  3FFI A;  4DG1 A;  1KVA A;  1TK5 A;  1RT7 A;  5SWM A;  3OYD A;  2VG5 A;  2YKM A;  4QCL A;  3RMB A;  3ITH A;  2HW3 A;  3RMA A;  4DQQ A;  3CQ8 A;  2G8H A;  3SCX A;  4CHN A;  4E19 A;  3KK3 A;  4F2S A;  1VSM A;  3D0P A;  1A5X A;  3SNN A;  4C8L A;  2ETJ A;  2P1J A;  2ATQ A;  4IDK A;  1S1U A;  3KTQ A;  3DI6 A;  5CZ1 A;  4E7J A;  2OYQ A;  4B9L A;  1JXB A;  5FRN A;  3NH1 A;  2HHS A;  4B9V A;  4CCH A;  1IKW A;  3VQQ A;  1RT5 A;  1T7P A;  4J2A A;  1Y97 A;  1S6P A;  1SL0 A;  1VSJ A;  1WSJ A;  1TKX A;  3IS9 A;  3PX4 A;  1NJW A;  3NHG A;  2Q3S A;  4C8M A;  2RPI A;  5C25 A;  3ALY A;  2IAJ A;  1BCM A;  2KW4 A;  3NGY A;  3K58 A;  1TV6 A;  3LWL A;  3ZSY A;  3CYM A;  3OY9 A;  4W5R A;  4FW1 A;  3LZJ A;  4DTX A;  2WOM A;  3NDK A;  4KTZ A;  4CK3 A;  3RRG A;  1FK9 A;  1LWE A;  1RT6 A;  3B6P A;  3O3G A;  2OA8 A;  1QHT A;  2HHV A;  3JSM A;  4CHY A;  2WON A;  3M8S A;  3ZSX A;  3F73 A;  3I0R A;  1UA1 A;  3HVR A;  1LW2 A;  3CM5 A;  4LY7 A;  4FLZ A;  2PYJ A;  1C1C A;  2HNY A;  3BDP A;  3QNN A;  4ID1 A;  2B6A A;  3NF7 A;  1KFS A;  1N5Y A;  5J1E A;  4DQR A;  3OYH A;  3OYG A;  5CY4 A;  3ZSR A;  1XWL A;  4CIF A;  2NUB A;  3KLG A;  1L3U A;  3OYF A;  3V1R A;  1S1T A;  4IFV A;  4CJ5 A;  2Y1I A;  4FJM A;  4KPY A;  2EX3 A;  2RKI A;  3M8P A;  4EZ6 A;  4KO0 A;  5HBM A;  2FBT A;  1L5U A;  4CIG A;  4N47 A;  3VQA A;  5EU7 A;  4BDP A;  4CEQ A;  4FJI A;  4I7F A;  1S9G A;  1QSS A;  5KGX A;  1L3V A;  3HVT A;  3KJV A;  1IO2 A;  3LPU A;  4FM1 A;  2XY7 A;  3SUO A;  5E41 A;  3PY8 A;  1U45 A;  2YHA A;  3DLH A;  2Z1G A;  3ZT2 A;  4CE9 A;  4FLW A;  5KGW A;  4DTU A;  4CF9 A;  2D5R A;  1BI4 A;  1ASW A;  3ZSQ A;  1BI4 B;  2HNZ A;  3QET A;  2F8S A;  4FJX A;  1VSK A;  2IGI A;  1I3A A;  4CHQ A;  4RW6 A;  3K57 A;  4Z4C A;  4HHT A;  1C6V A;  1VSD A;  1WN7 A;  5C42 A;  4ICL A;  1B9D A;  3AO2 A;  4KTW A;  3AA4 A;  5KRT A;  2O4I A;  2D0A A;  2ZQB A;  2ZD1 A;  5HRS A;  3HT3 A;  2HVI A;  4FJ8 A;  2P51 A;  1ZBH A;  4K8Z A;  3C6U A;  4DF4 A;  1QE1 A;  2Z1J A;  3WNE A;  3VQ6 A;  3OYJ A;  4OLB A;  3VA3 A;  4CJL A;  1MU2 A;  5FRM A;  3L3V A;  3VQC A;  4I2Q A;  4W5O A;  3TAG A;  4ELU A;  1VK0 A;  2BGG A;  1FKP A;  3MEC A;  2IC3 A;  3HPH A;  4HUE A;  2AJQ A;  3OYI A;  1NK9 A;  3MEG A;  3HYF A;  2HND A;  3E01 A;  1WAF A;  4KFB A;  3TAP A;  3KD5 E;  4M3Y A;  3U3Y A;  2P5O A;  4DU4 A;  1KVC A;  4DTJ A;  1NK8 A;  4Q0B A;  2FBY A;  1R0A A;  1NJX A;  4PQU A;  4BE1 A;  1NJY A;  4B9S A;  4KHN A;  4CIE A;  4DLE A;  3V9W A;  4GMJ B;  4O4G A;  4FJH A;  5DK5 A;  5JS1 A;  1VRU A;  4NYF A;  2XRI A;  3S9H A;  4F8R A;  3NF8 A;  3ZSW A;  1IKX A;  3NH0 A;  3DLR A;  4E1N A;  4DLG A;  4IKF A;  4DSF A;  2YNI A;  1NK4 A;  3QNO A;  1TVR A;  3VA0 A;  3HPG A;  1RTI A;  3AVB A;  1RT3 A;  3LAL A;  3KLH A;  1O1W A;  2FBV A;  4HTU A;  4B9M A;  2RF2 A;  1QQC A;  1HNV A;  4CJT A;  4CJK A;  4DTO A;  3U3G A;  4ZHR A;  1X9M A;  1XHX A;  4QOZ B;  4Q5V A;  2P5G A;  4KI4 A;  4O5B A;  1VRT A;  1RT1 A;  1S6Q A;  1I39 A;  1W0H A;  3DYA A;  4Y1C A;  5KI6 A;  2W42 A;  1NK0 A;  4KKO A;  2HHQ A;  3OYC A;  2KFN A;  2D0C A;  3WNG A;  3OYM A;  4ZTJ A;  2KQ2 A;  3ISN C;  3EYZ A;  2KZM A;  2Y1J A;  2OZS A;  3ZSZ A;  4AHT A;  5CYQ A;  1BIU A;  1F21 A;  2G8F A;  2YNF A;  2XO7 A;  4E89 A;  3KLE A;  3ZSV A;  2ZE2 A;  4LH5 A;  4PUO A;  3QIO A;  3M8Q A;  3T3F A;  4FM0 A;  2BAN A;  5KTQ A;  3TAE A;  1KLN A;  3HXM A;  1BHL A;  1ZBU A;  3I0S A;  4YNQ A;  1U04 A;  3HST B;  2F96 A;  4CJU A;  4CHP A;  1Q9X A;  5J2M A;  3P1G A;  3OYK A;  4BE2 A;  3L2U A;  4I2P A;  4FJL A;  5HRP A;  3DLE A;  4NCG A;  1FKO A;  3EY1 A;  1RIL A;  1W9H A;  1NKB A;  4M3T A;  4OPJ A;  1EXQ A;  3VQ9 A;  5FRO A;  1SUQ A;  2FBX A;  3C95 A;  2OPS A;  3AVI A;  4CGH A;  3QEP A;  4F4K A;  4FJN A;  1NOY A;  3VQ5 A;  4DSK A;  1S9E A;  4CED A;  1UOC A;  4CES A;  1TKD A;  4O0J A;  4DF8 A;  4W5Q A;  3LP1 A;  4CGI A;  4KHQ A;  2KZZ A;  1JXE A;  1WLJ A;  2A1R A;  4FJJ A;  1UAX A;  3LP3 A;  2O4G A;  4RG8 A;  1YTA A;  3F9K A;  4DSJ A;  3I8D A;  3L2R A;  1X1P A;  1XI1 A;  3H08 A;  4RW4 A;  4C8K A;  1C0T A;  1NK7 A;  4RW7 A;  4DFM A;  1QSY A;  2HVH A;  1JLA A;  4OJR A;  1JLQ A;  3AVC A;  3IG1 A;  1ZBF A;  2ITG A;  3NGZ A;  3AVA A;  2PY5 A;  4KHW A;  5J2Q A;  3RTV A;  4F3O A;  2HHW A;  4FLT A;  3OYN A;  3T19 A;  4Z4I A;  1DLO A;  3PV8 A;  4B9T A;  1KVB A;  3ULD A;  2XY5 A;  4HCC A;  3DRP A;  4G1Q A;  4CGF A;  1FXX A;  1WSE A;  1B9F A;  4DTS A;  4F3T A;  4B8A B;  4MQ3 A;  2OPQ A;  4FLU A;  2G8V A;  2LSN A;  4W5T A;  3KIO A;  1JL1 A;  3TAM A;  4KHU A;  1RTD A;  1C0M A;  4KV8 A;  3NCI A;  2VG7 A;  3NAE A;  1ASV A;  3QIN A;  1SKW A;  1TKT A;  1IG9 A;  1VSL A;  4C8O A;  1KRP A;  4FK4 A;  1JLB A;  3CFP A;  3K5M A;  1LWC A;  1RDD A;  2JLE A;  3AVJ A;  2HMI A;  4BE0 A;  2QXF A;  1RDB A;  4M3X A;  4KRE A;  3TR8 A;  2JGU A;  4AHS A;  3TAR A;  2G8U A;  3HM9 A;  4CHO A;  4KTQ A;  1BQN A;  1VSE A;  3L2V A;  3AO5 A;  4FLY A;  1WNS A;  4M3U A;  4O0I A;  2OZM A;  2PYL A;  4HUF A;  2X6N A;  2Z1H A;  4H8K A;  1HJR A;  1TGO A;  3V9U A;  1BGX T;  3AVL A;  3CM6 A;  1BIS A;  3SQ4 A;  1JLC A;  1G15 A;  4YFU A;  1NK5 A;  3K2P A;  4H4O A;  4TSX A;  3RMC A;  4CEO A;  3L2W A;  4NCB A;  3HO1 A;  2XHB A;  3SUQ A;  1N6Q A;  3V1Q A;  3P5J A;  1SKS A;  4CFC A;  4OKK A;  1WSF A;  1D9D A;  3HP9 A;  3OYL A;  3AA5 X;  1NK6 A;  1TAQ A;  4LD0 A;  3VN5 A;  3PO4 A;  4F2R A;  2X6S A;  3AV9 A;  3OJU A;  4FM2 A;  4CHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...