1KVBA

E. coli ribonuclease hi d134h mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCHELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE H
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvbA00
2WONA 4CHPA 4CJLA 3KD1E 2HNYA 1TL1A 2YKNA 1BI4A 3MXJA 4CEDA 4CJKA 4Y1CA 2O4IA 3AVNA 4O5BA 4FJGA 1HPZA 4GW6A 5DK5A 1NK7A 1GOCA 4LH5A 1TK8A 3AVGA 3ZSZA 4M3TA 3L2RA 3NGIA 4ELUA 4M45A 3PUFA 5C42A 5HROA 3SQ0A 1X1PA 2ATQA 4DTXA 2YV0X 3PX6A 3K2PA 4TSXA 1IG9A 3LPTA 3OYCA 3AVAA 4KV8A 2EHGA 4NCBA 4RW8A 1C0MA 1TL3A 4FLZA 3SUPA 2YNFA 4KPYA 2IAJA 3RR8A 4I9QA 3RMDA 3SV4A 1EP4A 2HHXA 4IBNA 2X6NA 2YNHA 4LSLA 1HJRA 3NFAA 5CYQA 3M8SA 4IFVA 4EP4A 3LZIA 2VG7A 3ULDA 2HHSA 4CECA 4CEAA 1NK4A 4FK4A 4HTUA 1IKWA 2HW3A 4FJLA 4UQGA 3OYEA 2Z1IA 4Q5VA 2B4JA 4DTPA 3DRRA 2G8WA 5J2NA 1XHXA 1Z26A 2YHBA 3C6TA 4GMJB 1D5AA 1LWEA 4CFDA 1GOAA 3O3HA 4B9SA 4DTJA 1QSLA 1NJYA 3ISNC 1RBUA 3VQBA 4E7KA 3ZT3A 4KI4A 3LWMA 1JL1A 2EX3A 3SNNA 1ASWA 3CFRA 4E1MA 1YTUA 4O55A 4FJMA 1TKZA 3VQPA 4CJ5A 4CJWA 4IFYA 3EY1A 4IG0A 4DLGA 2A1RA 2XY8A 1C0TA 2X74A 1WAFA 3O3FA 2G8UA 3V9ZA 2P5GA 3L2WA 2BDPA 1QSYA 1B9FA 4N76A 1BCOA 3TAMA 3CG7A 3OYJA 1R0AA 4DLEA 3RR7A 1K6YA 3SYZA 4DTSA 2OZSA 4M3XA 1TKXA 1B9DA 4CJSA 4E7JA 5KGXA 1L3VA 4FLUA 4QOZB 4CJQA 1T03A 3KK2A 3LP2A 4FJJA 1J54A 4FZXC 1SL1A 1IKXA 4CFBA 4CHYA 1S1XA 1W9HA 5CY4A 4FLVA 3NF8A 1LWFA 4F3TA 1EXQA 3LPUA 1LW2A 3ZCMA 5CYMA 4CFCA 3K59A 3SPYA 3DM2A 4O4GA 4J2EA 1VSKA 3IAYA 3G10A 2D5RA 4W5QA 2HHUA 5SZTA 4Z4EA 1WSEA 5HLFA 2PYLA 2FBTA 2QK9A 4KAZA 2DY4A 2LSNA 2FBXA 3HPGA 2KW4A 4DG1A 3OS1A 1Q9XA 1RTHA 5FROA 1TKDA 4CHZA 4AHSA 4Z4IA 2E4LA 1KLMA 1RT2A 4CEEA 3TAGA 4AHCA 4DMNA 1RTDA 3VQAA 4M42A 2YHAA 2Y1IA 1VK0A 4ELTA 1ITGA 3MXMA 4OGEA 2P1JA 2P51A 2PY5A 3VQEA 1HYZA 3DYAA 1UA0A 4FVMA 3VQ8A 4FJIA 1C1AA 5HBMA 1CLQA 2PZSA 1WNSA 5KRSA 1S1WA 4W5TA 1HQEA 3CFOA 1L3SA 4OJRA 4ZHRA 1S1UA 1Z25A 1S9GA 2ITGA 1J5OA 1BQNA 4KTZA 3VQ5A 2X78A 1Q8IA 4FW2A 4H8KA 3PX0A 3VQCA 5HP1A 1NK9A 4CGIA 1KVCA 3LAMA 4JS5A 4CGJA 3B6PA 2XY7A 1TKTA 1JKHA 2HVHA 1EX4A 1CZBA 3V1OA 2GBZA 3QIOA 3TARA 1BL3A 4CEZA 3L8BA 2XY5A 3AVIA 3THVA 1HYVA 4CE9A 3NCIA 1REVA 4DQSA 3DOKA 4AHRA 1WSHA 2VG5A 4RW4A 1ZBUA 4O0JA 3V6DA 1T7PA 1RT5A 3PY8A 1J53A 1ZBIA 4DU1A 1RBRA 4ID5A 4C8OA 5SWMA 2HMIA 4Q0BA 1EKEA 5I42A 1ASVA 1D8YA 3OYMA 1L3UA 3C95A 4AHUA 1S9EA 4I9LA 1ZBLA 4DTMA 2ETJA 3ALYA 1NK6A 3IRXA 3RMAA 5J1EA 3KJVA 4LSNA 4CF0A 4CK2A 1HMVA 4PUOA 3LP1A 4FM2A 1I39A 4CCHA 3OYFA 1NJXA 3AA4A 2G8VA 3HP9A 4CK1A 4N5SA 5FRNA 4CFAA 4FZYA 5FRMA 3C6UA 3HVTA 1RBTA 4F2RA 1ASUA 1VRUA 4KHNA 4G1QA 4KREA 2OPQA 3KTQA 1WN7A 1YTAA 3PO5A 4CJRA 4DQRA 4DTUA 3ZT4A 1VRTA 3V1QA 3TAQA 1UA1A 4KHSA 4KI6A 2RKIA 1YT3A 1JLGA 4LD0A 3OYGA 4OLBA 1UOCA 4ID1A 3LAKA 2JGUA 4DWIA 4QCLA 5T7BA 1S1TA 4B08A 1ZBHA 4DF4A 2VG6A 4KB1A 4M3WA 1N5YA 3AVHA 2OYQA 4Z4CA 3LZJA 4OPKA 3LALA 4FJ5A 2QKKA 1CXQA 1S1VA 4HVJA 3D0PA 4GVMA 3RWUA 2IS3A 1NK0A 4PWDA 3KLIA 3QEWA 2VWKA 3OS2A 3AVFA 3ZT1A 1TVRA 3JSMA 1NK5A 5EU7A 4CGGA 3SUOA 4CHQA 2OPSA 3WNFA 3G0ZA 4B9UA 3F73A 3WNEA 3QEXA 3TAEA 3VN5A 3AVLA 4KTWA 2GV9A 3T19A 5KRTA 3OYDA 3U3GA 4OGCA 1NOZA 3OVNA 3V9UA 1WLJA 2KZZA 2DTUA 4FM0A 3HYFA 4E0DA 2BANA 4DU3A 1I3AA 2ZD1A 1IH7A 1C0UA 3DLGA 3L3VA 3DLBA 4FJ9A 1HQUA 1GOBA 3L2UA 3NGZA 3AO4A 5E41A 3LP3A 1XC9A 4I2PA 5CZ1A 2KFZA 3KK1A 2E6LA 1SKWA 2XO7A 3U3YA 3PO4A 2BGGA 1U4BA 3AO2A 3ZSRA 4J2DA 4FJHA 3FFIA 4CJ3A 4JS4A 5JS1A 4FLYA 4CEFA 2A1SA 2RPIA 1EETA 3RMCA 4PQUA 2BE2A 4OLAA 3OJUA 4KHQA 3DLEA 3SZ2A 3LDSA 5I3UA 5HRSA 1RBVA 4I7FA 3V9WA 4MFBA 3OYKA 4M41A 3V9SA 4AHTA 4K8XA 3KLHA 4BWMA 1BGXT 1NK8A 4FXDA 4W5NA 1ZBFA 3ASMA 4E7HA 4Z4HA 1VSMA 4FM1A 2HHQA 3SJJA 1C1BA 3K5NA 1C1CA 4Z4GA 1QHTA 4C8KA 1B92A 5KGWA 1NKBA 4DF8A 2HHWA 1QS4A 1TK0A 3KLEA 1JLQA 1NOYA 4B9MA 3O4QA 1BISA 3KIOA 3DOLA 1A5WA 3MEEA 4WE1A 4BE1A 3NF9A 4LY7A 2GUIA 1G15A 2E6MA 1FKPA 4H4OA 3T1AA 3NAEA 3MAQA 1BIUA 4CF9A 5DMRA 1KSPA 2KQ2A 4F2SA 4OVLA 4CF8A 3IG1A 4Z0UA 4CHNA 4B9TA 3AVBA 1U49A 1T05A 1W0HA 3HVRA 2W42A 4E1NA 1JLBA 4NCGA 3QEIA 2P5OA 3K5LA 4W5RA 3HO1A 4JRPA 4CESA 4YFUA 1KLNA 1NJWA 3KLFA 1C6VA 1RT3A 2Z1HA 1QTMA 4B3OA 3AO1A 2HNZA 1RT4A 3QNNA 4FYDA 4JRQA 1BHLA 3AVKA 3OYAA 1RDAA 3OYNA 3TAPA 1L3TA 3HM9A 2X6SA 4DQIA 2G8KA 3KKSA 4F4KA 4O44A 4HCBA 4C8NA 3L3UA 4NCAA 4RG8A 2D0CA 3T3FA 3SUQA 1IKYA 1ZYQA 1DTTA 3V4IA 1HNVA 1IKVA 2IC3A 1JLFA 4XIUA 3VA0A 1RNHA 1Y97A 1KFDA 5HRPA 3HPOA 3QNOA 4ELVA 4DTNA 4BDZA 4E7IA 1LV5A 1DTQA 4DS4A 2FC0A 1O1WA 4CJPA 4CJTA 2ZQBA 3RRHA 4CJEA 1TAUA 3BGRA 4FJNA 4OKKA 4CK3A 4FW1A 3OYHA 3SQ1A 4IDKA 1JL2A 1KVBA 2IDOA 5KTQA 3PX4A 3L2VA 3SV3A 4EP5A 3VA3A 3NH0A 5FDLA 1BI4B 1DLOA 3VQQA 3ZSOA 4CEBA 4BE2A 1U47A 3ZT0A 1JLCA 2F96A 3AVMA 1U48A 4M3YA 3P83D 1FK9A 2OPPA 1WSFA 3H08A 3NBPA 4CF1A 2G8FA 4OKJA 3LWLA 1RTIA 2Z1GA 3NHGA 2R7YA 2KTQA 4O0IA 4C8LA 4HUFA 1D9DA 1FKOA 3KLGA 1IO2A 5HRNA 3OY9A 3EZ5A 4MQ3A 1JLEA 3NE6A 2DFFA 4OPJA 4CHOA 4FCYA 5CZ2A 3O3GA 1TK5A 3KD5E 3HXMA 3AA5X 4KRFA 4CIGA 2G8HA 1X9MA 3NH1A 4E7LA 2QXFA 3S3OA 1VSJA 3D45A 2NUBA 3CQ8A 4HUGA 2D0AA 4JLHA 3DLKA 4IG3A 1LWCA 4RW6A 3PV8A 4M3RA 2FBYA 3ZSVA 3P1GA 3OYBA 4DS5A 1S6QA 3HSTB 4FJKA 3BDPA 1S6PA 3M8QA 4KFBA 3AA2A 5J2PA 3V81A 2B5JA 1T8EA 3WNGA 3HPHA 3TAFA 3QESA 5K14A 1SV5A 1WAJA 4ICLA 2ZE2A 4DSIA 1BCMA 3QO9A 1NKCA 4FJ7A 5J2MA 1JXEA 1VSFA 4RW7A 3LANA 3O4NA 1U45A 4DSLA 3HK2A 3TANA 3VQ7A 4F3OA 3VQ6A 3NH2A 1QQCA 1QE1A 4CEQA 2YNIA 1JXBA 2YNGA 4NYFA 4DTOA 3K58A 1RILA 3QEVA 5JS2A 2AJQA 3DRSA 4I2QA 1VSIA 4C8MA 1WSGA 3A2FA 4CGDA 3DLRA 4CIEA 4B8CA 3I0SA 4DTRA 4CJ4A 3SCXA 1QSSA 3MXIA 1JLAA 3SPZA 2VWJA 3TR8A 4BE0A 5KI6A 4CIFA 1RDDA 2F8SA 1HNIA 4DQPA 2FBVA 4H4MA 4KKOA 4J2BA 1VSHA 4CERA 1SL0A 3F9KA 2XRIA 4M3UA 3HJFA 3DRPA 1SKSA 1LAWA 4LH4A 1LAVA 5C25A 2O4GA 3SQ2A 4CJUA 4FJ8A 4FZZA 4HHTA 3V1RA 1TV6A 1U04A 3RRGA 2F8TA 1BQMA 4R5PA 1KRPA 4DFPA 3AA3A 4BWJA 2WOMA 2D0BA 3AV9A 3ITHA 4CEOA 4B9NA 3QLHA 3K5OA 2XHBA 4ZTFA 3HL8A 3NDKA 4FK2A 3SQ4A 2RN2A 4FLTA 3TI0A 1XHZA 2DFEA 3I0RA 2DFHA 4AHVA 1SKRA 4CJFA 4K8ZA 3DI6A 4KHUA 3ZSYA 4KTQA 3QERA 2KZMA 1KVAA 2OA8A 1S5JA 3S9HA 3QINA 1KTQA 3QIPA 3NF6A 3L2QA 4EZ9A 3IS9A 4DSFA 1CZ9A 3S3MA 3CYMA 1RDBA 4Z4FA 1KCFA 3M8PA 1RTJA 1XI1A 2Q3SA 4DFJA 4N41A 1N6QA 3EYZA 5HRRA 2IGIA 2QKBA 3ZT2A 4FLWA 3ZSWA 1XWLA 3DMJA 4OKEA 3QETA 4F8RA 3QEPA 3LP0A 1FXXA 2HNDA 4HUEA 1TAQA 2XY6A 4E89A 1CXUA 1RT7A 4B8AB 3WNHA 3HP6A 1SUQA 3CM6A 3KKRA 4W5OA 4DQQA 3U6FA 4HCCA 4EZ6A 3VQDA 3DLHA 3UIQA 1TGOA 3ZSXA 5C24A 4YNQA 3AVCA 1LW0A 3OS0A 4DFMA 4KHWA 1X9WA 4DU4A 4DSKA 3MEDA 3SUNA 3OJSA 3AVJA 4CGHA 3CFPA 3JYTA 4E19A 3RMBA 1J9AA 3HT3A 3M8RA 4BDPA 4B9LA 1YVUA 2OPRA 1HRHA 4DFKA 2Z1JA 4PA1A 1RBSA 4CGFA 3I8DA 5D3GA 4L8RB 1RDCA 1MU2A 3E01A 4BACA 4AH9A 4M3ZA 4KO0A 4CF2A 4N56A 1RT6A 1F21A 2HB5A 4E3SA 3VQ9A 4FK0A 1L5UA 3K5MA 2Y1JA 1A5XA 3OYIA 4DSJA 3CM5A 3K57A 4J2AA 2RF2A 2HVIA 1WSJA 4AILC 1WSIA 3OYLA 4FJXA 2OZMA 2B6AA 4PY5A 2YKMA 2PYJA 4KB0A 3MECA 3MEGA 1D9FA 2HHTA 2JLEA 4Y1DA 1X9SA 2G8IA 1HYSA 3AO3A 1VSDA 3B6OA 3C94A 3KK3A 1RCHA 4DSEA 2IOCA 1Q9YA 2HHVA 3P5JA 1NJZA 2I5JA 1UWBA 3ZSQA 1NKEA 1SL2A 3NF7A 3RTVA 1VSEA 1RT1A 4ZTJA 1KFSA 3VQ4A 3AO5A 4RW9A 4KHYA 2KFNA 4QAGA 3TABA 1A5VA 4FLXA 5J2QA 3S3NA 4NYNA 3NGYA 3SI6A 3V9XA 4N47A 4IKFA 4BDYA 1BIZA 4CJVA 1UAXA 1VSLA 4B9VA 3TWHA
chains in the Genus database with same CATH superfamily
4CHPA 2UYTA 4BY9C 4IEEA 4Y1CA 4LF6K 3JS6A 4JAXA 4U67L 5DK5A 3MX5A 1NK7A 4M3TA 3L2RA 3QBXA 1X1PA 4BR2A 3K2PA 1N34K 3OYCA 4IJNA 4KV8A 1C0MA 3UB5A 2IAJA 3RR8A 1EP4A 4GNIA 3R8EA 2YNHA 5CYQA 3NFAA 3ULDA 2VG7A 1OH8A 3CCUN 3CJAA 4Q5VA 2B4JA 3DRRA 5J2NA 3AAPA 1D5AA 3O3HA 3ID8A 3VQBA 2HF3A 3FZLA 3GOIA 3LWMA 1JL1A 5DM7L 1ASWA 3CFRA 4O55A 3EY1A 1VQKN 4ISFA 1X3NA 2XY8A 1C0TA 4OX9K 2QWLA 3ULEA 3ZETA 3L2WA 2BDPA 1BCOA 1R0AA 3CG7A 3A8YA 5AQFA 1K6YA 3CJCA 2PFUA 3VOVA 5EY4A 3ZX2A 4FLUA 4QOZB 2GTDA 3A5OC 4CJQA 1T03A 3KK2A 3O6WA 2ASMA 4CHYA 2FSJA 3VERA 4YHHK 4JK7A 3ZCMA 3K59A 4J2EA 5CYMA 4CFCA 1W2BM 4W5QA 1GLJO 2PYLA 2WC9A 2QK9A 2E8AA 3W3DA 3OS1A 1GLAG 3WXIA 4KH6A 3O1WA 2E4LA 3A5NC 4AHCA 5AFUA 2JWLA 4M42A 3MXMA 4Y0WA 3CPEA 3DYAA 4FJIA 3QFUA 5KRSA 3CFOA 4ZHRA 3UKUA 1BQNA 4FW2A 1P90A 2GEMA 1JKHA 1CZBA 4BRMA 3THVA 3O9UA 3L8BA 2XY5A 3AVIA 4CE9A 3NCIA 1REVA 3D2EA 4O0JA 4MO5A 3PY8A 1J53A 1BO5O 4DUZK 2YJFA 4Q0BA 2O8EA 2YX6A 1ASVA 3WQUA 5LJWA 3C95A 1YI2N 3VF4A 4DTMA 3IRXA 3DXKB 4CK2A 4PUOA 4CCHA 3AA4A 4CK1A 4N5SA 4LF5K 4FWSA 2WFBA 5FRMA 2GX9A 4F2RA 1VRUA 2ZM6K 4KHNA 1NGFA 2E1YA 1Q82O 1KAZA 4BRCA 2RKIA 3ZX3A 1HX1A 1UOCA 3LAKA 2JGUA 4GKKK 2E2QA 4J8FA 1S1TA 5AQSA 5F2RA 4DF4A 2VG6A 4KB1A 3CCQN 4DR1K 3SAHA 3AVHA 2QKKA 3BY5A 4GVMA 2NRZA 2IS3A 4PWDA 2VWKA 4DV1K 4PHTX 1TVRA 1NK5A 1KQSM 4WFBL 3MN7A 4FWMA 5AQIA 4EHUA 2VCPA 4BRPA 1TYQA 4IWVA 5ADXA 1NGCA 3T19A 4FM0A 2BANA 1VQ8N 1C0UA 4FJ9A 3L3VA 5GADP 3AO4A 3CERA 4WFNL 3J81O 3TU5A 4LFBK 1QVGM 3C7NA 5F1XA 2YHXA 2BGGA 3CIPA 3AO2A 4FJHA 3VEYA 5JS1A 4CEFA 4JI8K 2RPIA 3RMCA 1Z05A 3CCSN 3D7EO 4XEIA 4PQUA 1N33K 3THYB 3E9OA 4MFBA 4M41A 5HL7L 3V9SA 3KLHA 4PKHA 4BWMA 4FXDA 4XH5A 3H3OB 4E7HA 4OPAA 1VSMA 4FM1A 1YXQA 1QS4A 3DOLA 4LY7A 2GUIA 1ATNA 3T1AA 2E6MA 3C6HA 1VQ9N 3MAQA 1BIUA 4F2SA 2KHOA 4CF8A 3IG1A 1GLFO 4B1UB 1DT9A 1SZ2A 4BGAA 1W0HA 3HVRA 2W42A 4NCGA 5GAGP 3MN9A 1C6VA 2Z1HA 4I6MA 4B3MK 4NXMK 2HNZA 1HNWK 3AVKA 1L3TA 1RDAA 1ESVA 3TAPA 3M1FA 2X6SA 3KKSA 4O44A 4GKJK 4CBWA 4NCAA 5KPZA 2D0CA 4KBOA 2E88A 4YOWA 4O8KA 2W40A 1HNVA 2IC3A 1JLFA 4XIUA 3CJ9A 2E2NA 5M1PA 4IOXA 4X66K 1ATSA 1O1WA 3VESA 3WEEA 4CJTA 2P9NB 4CJEA 1TAUA 4YOXA 4OKKA 5LJVA 4FW1A 3OYHA 1JL2A 1VQ5N 5KTQA 3L2VA 3SV3A 2HHHK 4BQZA 4CEBA 1DLOA 3BF1A 4BE2A 1U47A 3UKRB 3D2FA 2F96A 2Q31A 4B1YB 1U48A 1HPMA 4CF1A 3FGUA 2G8FA 2P9UA 2P9KA 4O0IA 4K42A 2ZJQL 1BDGA 3KLGA 1IO2A 5AR0A 5HOOA 5HRNA 3OY9A 5JICA 3NE6A 2DFFA 3KD5E 1X9MA 4E7LA 2QXFA 1NLVA 4JLHA 5BN9A 4JKDA 3TTDA 1GLEG 4A61A 2WBNA 2YCHA 2F7TA 4FJKA 3THXB 3AA2A 4JI5K 2B5JA 1T8EA 3SLCA 4A59A 3QESA 2NRXA 3I8BA 1WAJA 3CPWM 4ILHA 3CJBA 3C7NB 2D4WA 1YHQN 1VSFA 2D0PA 3HK2A 4F3OA 4H5NA 3VQ6A 1QQCA 1QE1A 4CEQA 3OA9A 1JXBA 4DTOA 3W0LA 1RILA 4X65K 5LMNK 1HKBA 5KPTA 4JI0K 4DV6K 4JD2A 1N8RO 1VSIA 4CIEA 3DLRA 2HBLA 3TR8A 4PKIA 1HNIA 4H4MA 4KKOA 4FWPA 4V19S 5BR9A 1T44A 3HJFA 2W6KA 1LAWA 4JYAK 4Z94A 4BG9A 3CD6N 1QQNA 4HHTA 3ZX0A 3LDLA 2E2OA 1KRPA 4DFPA 5AQGA 1Q7YO 1WBBA 4B9NA 5BRHA 4DV2K 3NDKA 4FK2A 3TI0A 3O1BA 4NLBA 5TKWA 3DI6A 3ZSYA 5M1QA 3CCEN 2NRVA 2E1ZA 4CZMA 4CJ7A 1S5JA 4M7XA 3QINA 3L2QA 4BC4A 3IS9A 3S3MA 3M8PA 3VEZA 1RTJA 1HR0K 4H5TA 3NMUA 1QVFM 1ATRA 4FLWA 4OKEA 3FZFA 1VQON 4WQ5A 1FXXA 5JLFA 2ZGZA 3DWLA 1TAQA 2H3GX 3KKRA 4W5OA 4C1NI 1ILYA 4YNQA 3AVCA 2V51B 2WUSA 3HOSA 3OJSA 2E2PA 3VETA 4CZGA 3Q7CA 5I9EB 5D3GA 4L8RB 4IZ9A 4CF2A 2HB5A 3K5MA 2Y1JA 1A5XA 2Q0RA 4FO0A 3OYIA 4J2AA 2HVIA 4K41A 4FJXA 3E9LA 1D9FA 2JLEA 2V7ZA 3AO3A 3C94A 4DSEA 1YF5L 2I5JA 1UWBA 3RTVA 4KHYA 3CJ7A 3ZEUA 4AF1A 1BA1A 3FZKA 4N47A 4O5FA 4BDYA 1UAXA 1VSLA 3L4QA 4B9VA 3KWIA 1NWKA 1S72N 4DV7K 5AQHA 2WONA 4CJLA 1BI4A 3AGRA 3MXJA 4CEDA 5AQYA 4FJGA 5BN8A 2W6LA 2O8CA 1GOCA 5E84A 4LH5A 3ZSZA 3MDQA 4ELUA 3PUFA 4JHDB 5C42A 1OVYA 2ATQA 1IG9A 3LPTA 3T69A 4C1NK 3WXMB 3AVAA 3O08A 1TL3A 3SUPA 1JCFA 3VMFB 4BRLA 3SV4A 3RSEA 3OTOK 3EZWA 1HJRA 2HHSA 4EP4A 3WQTA 4CEAA 4FK4A 4HTUA 1IKWA 4UQGA 4DR7K 3O9QA 4GMJB 4B9SA 4E7KA 4DV5K 4WF9L 2HOEA 4DV4K 4E1MA 2UUAK 4FJMA 5IWAK 3VQPA 4CJWA 4IFYA 3CJ1A 4DLGA 2Q1NA 4LF8K 2BH1A 3V9ZA 3AARA 3HM8A 3TAMA 2UUCK 3SYZA 2QWOA 1HNZK 2OZSA 4M3XA 4CJSA 2NRRA 5AQNA 3LDPA 3VTHA 4WYBA 4FZXC 4FWRA 2OTLN 1S1XA 1LW2A 3SPYA 2O8BB 3IAYA 3I33A 2D5RA 1RDUA 3MMVA 1WSEA 5SZTA 2DY4A 2LSNA 2FBXA 2NLXA 4DG1A 3OBYA 2W41A 5C12A 1SAZA 1RT2A 4UY8O 2Y1IA 1VQNN 4JKFA 2P1JA 3VQEA 1HYZA 3CETA 1UA0A 3VQ8A 4GVEA 2PZSA 4W5TA 4DB3A 5IT9O 1BUPA 4BRFA 2ITMA 1Q8IA 4BR5A 5HP1A 1HKCA 1MDUB 4CGIA 1KVCA 3LAMA 2XY7A 3V1OA 3K9KA 2GBZA 3TARA 4CEZA 2CH6A 3OHRA 4XH4A 4DR3K 4E1JA 2VG5A 4RW4A 1T7PA 5C15A 3U9DA 1EKEA 5I42A 5FPDA 3K0SA 4AHUA 1S9EA 4I9LA 3WXJA 2D1KA 4QS9A 1HMVA 4FM2A 2G8VA 3HP9A 3H45C 3E9PA 4H03B 5FRNA 3C6UA 5AZIA 2O8CB 1E4GT 4G1QA 3BEXA 4DTUA 4DQRA 1Q86O 2P9SA 5AQXA 2KLAA 1NJIO 3UE5A 5M1NA 3TSPA 4B08A 1GLCG 4IJAA 4M3WA 3EL2A 2P9IB 4CD3A 4IO9L 4FJ5A 3LALA 3RWUA 3CCLN 3QEWA 3OS2A 3AVFA 3ZT1A 4OPHA 4IEIA 1LOTB 3JSMA 2NZTA 2OPSA 3WNFA 3HSCA 4ILGB 3WNEA 3TAEA 3AVLA 2GV9A 5KRTA 2QWQA 4OGCA 3V9UA 2DTUA 2CGJA 4DU3A 2ZJRL 1I3AA 1IH7A 3DLGA 3GBTA 1HQUA 1GOBA 3NGZA 5E41A 1MWKA 3LP3A 3KWGA 4ISGA 1SKWA 3D6RA 3U3YA 1XC3A 2QI2A 3ZSRA 3FFIA 4XH1A 3A5MC 4JKGA 1EETA 2BE2A 3OJUA 3DLEA 3LDSA 1C0GA 4I7FA 5HRSA 5M1KA 3MN5A 5AZJB 4AHTA 4K8XA 3R9PA 1NK8A 5FLXO 2E20A 3ASMA 1FJGK 4Z4HA 3SJJA 1C1BA 3K5NA 1C1CA 1QHTA 4C8KA 5KGWA 5AQJA 1TK0A 4MLEA 3KLEA 1XMOK 1NOYA 4BE1A 3NF9A 2HHTA 1G15A 3CCRN 1GLLO 1YTUA 5DMRA 4OVLA 4CHNA 3AVBA 1U49A 4LFAK 3VTIA 3AY9A 3QEIA 1HUXA 3K5LA 4W5RA 2P5OA 1OH6A 1KLNA 2I7PA 4A62A 4H0VB 1RT3A 4BC5A 2Q97A 1QTMA 4GV3A 4B3OA 4NB4A 3AO1A 3AGKA 3DXMA 4DCHA 4JRQA 1NG9A 1U2VB 5AQKA 1XMQK 3E66A 2P9LB 2NNWA 3SUQA 1IKYA 2IVOA 1DTTA 3V4IA 2OANA 3VA0A 1RNHA 4H5VA 3HPOA 4ELVA 4B1XB 1DTQA 4K43A 3G71N 2FC0A 2ZQBA 4K25A 5AZIB 4B3SK 1K8KA 4FJNA 3WXLA 4IDKA 1VAZA 2IDOA 3ZYYX 3PX4A 4EP5A 3VA3A 3F2KA 3VQQA 3ZSOA 3ZT0A 1YITN 3HRGA 2OPPA 1WSFA 3H08A 5BR8K 3CHWA 1RTIA 5GAEP 4MLHA 3LWLA 3VPZA 4HUFA 2UXDK 1XUPO 1Y64A 3VEVA 4OPJA 4CHOA 4IOAL 4RTFD 3AA5X 4K0KK 4YDUC 2NUBA 2D0AA 1W7AA 4IG3A 2FBYA 3ZSVA 3PSFA 1S6QA 3HSTB 3S41A 5J2PA 4ISEA 3WNGA 2NRHA 3TAFA 1HNXK 2O8DA 5CR4A 3THWA 4QS7A 1BCMA 1NKCA 1IJJA 4RW7A 3O4NA 2JWKA 3TANA 2YNIA 3O8MA 2P9PA 4H5WA 4CZIA 3ULEB 3ZETB 1T6DA 5M1FA 4CGDA 3A2FA 3SCXA 3O4WA 4EFHA 3MK6A 1QSSA 4CJ4A 3SPZA 1KC8O 1OH7A 2F8SA 2FBVA 1SL0A 2XRIA 4M3UA 2I7NA 2A40A 1SKSA 3ZLJA 4LH4A 5C25A 4CJUA 4FJ8A 1TV6A 1BQMA 3AA3A 2WOMA 5CE3A 4ZTFA 2RN2A 3U9ZA 4BREA 4FLTA 1XHZA 2DFEA 4AHVA 1K8AO 4KHUA 2HBMA 4PKGA 4KTQA 3CC4N 1S3XA 3QERA 4FPAA 2KZMA 1KVAA 1C0FA 2A5XA 4B1VA 3S9HA 3UKUB 3QIPA 3NF6A 4B9QA 3GDQA 1RDBA 5AQLA 4KHPK 4H0OA 1VQ4N 4N41A 3PIPL 2IGIA 4BRDA 4BGBA 2BUPA 3DMJA 3QETA 2RE2A 3D2EB 2HNDA 4E89A 1RT7A 1YUWA 3HP6A 1SUQA 2O8EB 2O8FA 3FZMA 4EZ6A 5C24A 1LW0A 1WBDA 1K8KB 1X9WA 4DSKA 3SUNA 2VGMA 3AVJA 3CFPA 1J9AA 4B9LA 4DFKA 2Z1JA 3I8DA 4BQLA 2OTJN 2UXBK 4BACA 2QWPA 4M3ZA 4BROA 1F21A 4E3SA 1L5UA 3CM5A 3K57A 4IO8A 1WSJA 3MWTA 3HOTA 1WSIA 4LF4K 2GELA 4YOTA 2UUBK 2PYJA 3MEGA 3HTVA 4LF9K 1X9SA 4WCEL 1VSDA 3B6OA 3DLLL 2HHVA 3P5JA 3ZSQA 1J6ZA 1SL2A 1DKGD 4ZTJA 1RT1A 1KFSA 1TYQB 3AO5A 2KFNA 3J8AA 3TABA 3H46O 5TKYA 3THWB 3IUCA 4X64K 4IKFA 4BR7A 4EIAA 2A42A 1VQ6N 2HNYA 1TL1A 2YKNA 3AVNA 4O5BA 4DR5K 4GW6A 1NGIA 1NNEA 4YOYA 4DV3K 3AVGA 2CGLA 3J7AP 2ASPA 1MA9B 4B1WB 5HROA 4DTXA 3PX6A 4WFAL 3EN9A 4NCBA 4RW8A 4AM6A 4KPYA 1NGAA 4O8UA 3RMDA 2HHXA 4IBNA 1XQSC 4LSLA 4CECA 1NK4A 2HW3A 3G25A 1X9JA 3OYEA 4DTPA 1KD1O 2G8WA 1XHXA 1LWEA 5BREA 1NJYA 4OO1J 3FR0A 1RBUA 4FVUA 3MWPA 4JI4K 3ZT3A 4KI4A 4GV9A 3SNNA 4QS8A 1TKZA 2VYPA 4IG0A 2X74A 1WAFA 3O3FA 2G8UA 2P5GA 3CCVN 4N76A 3RR7A 3OYJA 4DLEA 4I6MB 4DTSA 1GLBG 1TKXA 4E7JA 1L3VA 1J54A 1SL1A 4CFBA 4C23A 1W9HA 3SMSA 4FLVA 3NF8A 1LWFA 2IVPA 1EXQA 3F9MA 3DM2A 4DR2K 1VSKA 2BTFA 5JLHA 3G10A 5AQWA 4Z4EA 5HLFA 3EE8A 3HPGA 4WQ4C 1TKDA 4AHSA 1IG8A 3TAGA 4BR4A 4CEEA 3WEEB 3TTFA 1GLDG 1VK0A 5KQ8A 4OGEA 2VGNA 4FOIA 1IBLK 2P51A 2PY5A 4FVMA 5AQRA 1C1AA 1CLQA 4H0TB 1S1UA 1S9GA 2ITGA 2YHYA 3D2FB 4KTZA 3VQ5A 2X78A 3VQCA 1QQOA 1NK9A 1IBKK 4CGJA 2P9UB 2P9KB 3R6MA 1EX4A 3M3ZA 1BL3A 3P31A 3P39A 2FF3B 1HYVA 2F9TA 1NBWA 4CZEA 4DQSA 3DOKA 5BPNA 1JCGA 4R79A 1ZBIA 4LF7K 1RBRA 3KVGA 4H0YB 3QICA 2HMIA 1D8YA 3OYMA 1L3UA 2GWJA 2QM1A 1NK6A 1ZBLA 3CCMN 4FWOA 3KJVA 4CF0A 2VWBA 5C2FA 3A0IX 3OYFA 1NJXA 1T3VA 4MDAA 4CFAA 1DEJA 2PBDA 3HVTA 5CHIA 4IFEA 3H3NO 2OPQA 3KTQA 1YTAA 3M6GA 5EOYA 3ATUA 3V1QA 4YOVA 1UA1A 3F5TA 3QB0A 1YT3A 4LD0A 1MWMA 3OYGA 4OLBA 4ID1A 4JD2B 1P8ZA 5T7BA 1ZBHA 4DHYA 3BZCA 1N5YA 4Z4CA 3LZJA 1CXQA 3D0PA 3MX2A 1NK0A 1YJNN 5FPEA 4CHQA 3G0ZA 2Q0UA 4B9UA 1V4TA 3QEXA 4KTWA 3OYDA 1NOZA 3VF6A 4U7BA 1WLJA 3HYFA 1VHXA 1QHAA 3DLBA 3BUZB 2QA4N 3L2UA 4DQ8A 3T1YK 4JV5K 4I2PA 1RGIA 3KK1A 2E6LA 1YIJN 5AFUH 1U6ZA 4CJ3A 2A1SA 4KHQA 1RBVA 3V9WA 4CBUA 2QWNA 4BR9A 1BGXT 1WOQA 2ASOA 4W5NA 1ZBFA 3CCJN 3PLAA 2OCEA 3VENA 2HHQA 3FE1A 2ZWHA 1NKBA 1BG3A 4DF8A 3N4PA 1JLQA 4CZJA 4WE1A 1BISA 3KIOA 3MEEA 1VQMN 1FKPA 3NAEA 3SJHA 1Q81O 1KSPA 3BP8A 3MN6A 1JLBA 3ID6A 3CMAN 4DUYK 4WQ4A 1NJWA 5AQZA 4B3TK 1Z6RA 1IV0A 3VEOA 3QNNA 4FYDA 1Q18A 4DR4K 3OYNA 4DQIA 4F4KA 4BVPA 3GL1A 1NU0A 2HBJA 3EO3A 3T3FA 2V52B 1ZYQA 1K73O 1JCEA 1Y97A 1KAYA 5HRPA 4DTNA 4BDZA 4E7IA 3ZEUB 4DS4A 3HZ6A 4M7YA 4DKWA 4EAHD 2HBKA 3SQ1A 5ADXH 5FDLA 1BI4B 3H6EA 4M63C 1JLCA 3AVMA 3P83D 1FK9A 2R7YA 3KZBA 4H0PA 2KTQA 3CC2N 1FKOA 1VQLN 4MQ3A 3JAMO 5JVHL 4FCYA 3O3GA 4KRFA 3HXMA 5EXWA 3NH1A 4F8RA 3D45A 4HUGA 3RSEB 4JK9A 3P1GA 5EX5A 3OYBA 4DS5A 1SQKA 5AQUA 3M8QA 2F9WA 4JNEA 1KXPA 1YJWN 2D0OA 3HPHA 4H0XB 5EVZA 5K14A 1SV5A 3J7ZO 2ZE2A 4DSIA 1FW6A 3QO9A 4EHTA 1JXEA 3LANA 2KKZA 3SAGA 3VQ7A 3L6QA 4NYFA 3L0QA 2AJQA 3M5RA 4I2QA 1WSGA 4DTRA 3BF3A 3I0SA 3MXIA 1JLAA 4BE0A 5KI6A 4CIFA 4J2BA 4HWIA 2FLOA 3LDNA 3R1XA 3ENBA 4CERA 3F9KA 3C6AA 4MO4A 5AQVA 1EO1A 5C10A 4CZLA 4DR6K 1LAVA 4BRKA 3LL3A 3SQ2A 4PL8A 2F8TA 1U04A 3K9JA 1M90O 4CZHA 4BWJA 3I56N 2D0BA 3AV9A 3ITHA 4CEOA 3TSQA 3K5OA 2XHBA 1K9MO 3SQ4A 4JKEA 3I0RA 3SBTA 1BA0A 1EQYA 1G99A 2A41A 2OA8A 4A5AA 4ILJA 1KTQA 4FWNA 4EZ9A 1S22A 3THYA 1XI1A 4FSVA 3ZT2A 3CXCM 3P38A 3QEPA 3SBGA 2XY6A 4JKBA 1CXUA 4B8AB 3WNHA 5LY3A 4DQQA 3CM6A 3CI5A 3U6FA 3VQDA 3DLHA 3UIQA 1TGOA 2AP1A 3OS0A 1DGKN 3MEDA 2YHWA 3T7ZA 1NGHA 4E19A 3M8RA 3QFPA 1NGGA 3QMLA 2AA4A 4CGFA 4CVNE 1RDCA 1MU2A 5GIOA 2VQEK 3I55N 4RCHA 4AH9A 3Q7BA 4KO0A 2E5LK 2P9SB 2FSKA 4FK0A 3VQ9A 5BPMA 3AAQA 5KPRA 4DSJA 3OYLA 2B6AA 2WTUA 2YKMA 3IMXA 4PY5A 3MECA 2G8IA 4PL7A 2CGKA 3KK3A 1RCHA 2IOCA 1NJZA 2GUPA 3NF7A 1VSEA 2CH5A 3VQ4A 4RW9A 4QAGA 4DV0K 4JKCA 3A5LC 4FLXA 3FZHA 4NYNA 2A3ZA 3PIOL 3NGYA 5JVGL 3U8XA 3SI6A 2P9NA 1M1KO 1BIZA 2ZGYA 3CC7N 3KD1E 4CJKA 2O4IA 3UKRA 1HPZA 5F0XA 1TK8A 2EWSA 3DJCA 4IDHA 1HLUA 3NGIA 3LDOA 4M45A 3N4QA 4A5BA 3SQ0A 4JKGB 5H1SQ 2YV0X 4TSXA 4F9OA 3OBWA 3O9RA 2EHGA 4FLZA 2YNFA 4I9QA 4MDBA 2X6NA 3M8SA 4IFVA 3LZIA 3THXA 4FJLA 3EKUA 2Z1IA 4GV6A 1Z26A 1OKJA 2YHBA 3C6TA 4CFDA 1GOAA 4DTJA 1QSLA 3ISNC 1IBMK 2NRTA 4GY2B 2EX3A 2J4RA 2QWMA 4BR0A 4CJ5A 3LM9A 2A1RA 2NRWA 3O9SA 2VQFK 1QSYA 1B9FA 3JXUA 1NGJA 3DXMB 1B9DA 5KGXA 5DM6L 2HSTA 3LP2A 4FJJA 1YVNA 1IKXA 3J80O 2QXLA 5CY4A 4F3TA 2GWKA 3LPUA 5LL6Z 1BU6O 3SAFA 4O4GA 2HHUA 4KH4A 2FBTA 4KAZA 1W97L 2KW4A 1Q9XA 1RTHA 3KHYA 3EE9A 5FROA 4CHZA 5AQOA 4Z4IA 1KLMA 3FLCO 2A6AA 3EKSA 4DMNA 1RTDA 3VQAA 2YHAA 2HMPA 4ELTA 1ITGA 1T6CA 5AQQA 4HTLA 3C65A 1TUUA 4WQ5C 3G6EN 5HBMA 1WNSA 1QZ5A 1S1WA 1OH5A 1HQEA 1L3SA 4OJRA 1Z25A 5B8HA 1O13A 1J5OA 3PX0A 4H8KA 4JS5A 3B6PA 5E26A 4JKAA 1TKTA 2HVHA 3NVKA 4FOEA 3QIOA 2IIRA 3CF5L 1NGEA 4AHRA 1WSHA 3V6DA 1ZBUA 1RT5A 4DU1A 4ID5A 3VF2A 4C8OA 5C0YA 5SWMA 3QBWA 5FPMA 1HJOA 1NMNA 2ETJA 3ALYA 3E1YA 3RMAA 5J1EA 4IOCL 4LSNA 3MCAB 4A2AA 2ZJPL 1I94K 3LP1A 4CI6A 2O8DB 3R3LA 1I39A 1ZC6A 4FZYA 3IKMA 1RBTA 5LMUK 1ASUA 4KREA 1WN7A 3L4IA 3PO5A 4CJRA 4YDUA 3TAQA 3ZT4A 1VRTA 2YJEA 1N36K 2P9PB 4KHSA 4KI6A 1JLGA 1VQ7N 2RHKA 1XNQK 5AQTA 4DWIA 4CZKA 4QCLA 2OYQA 4OPKA 1S1VA 4HVJA 3KLIA 5EU7A 1RDWX 1ZBSA 4FWQA 4CGGA 3SUOA 3T1HK 4A57A 2UU9K 3F73A 3VN5A 4BRAA 3U3GA 3OVNA 4NLCA 2KZZA 4E0DA 2ZD1A 4JI3K 1XC9A 5CZ1A 4FPBA 3HI0A 4NXNK 2XO7A 3PO4A 4IXCA 1U4BA 3VGLA 4J2DA 4BG8A 1ZXOA 4JS4A 3ATVA 3KK7A 4FLYA 4JHDA 3O5BA 3PSIA 3ENHA 3SK3A 4OLAA 5I3UA 3SZ2A 3OYKA 1OVQA 3VEWA 4Z4GA 4A2BA 3NVMA 3O80A 1HKGA 1B92A 2HHWA 4FL9A 3TSUA 2O8FB 1J5EK 4B9MA 3O4QA 5A2QO 4L3QA 1A5WA 3QDKA 4H4OA 2KFZA 4CF9A 4CW7B 2KQ2A 3WXKA 5KQDA 4Z0UA 4CZFA 4B9TA 1RFQA 1QZ6A 1T05A 4E1NA 3HO1A 1EWRA 4JRPA 4CESA 4YFUA 1LCUA 3KLFA 4RWTA 3GE1A 2V7YA 4AQYK 3MCPA 5FPNA 4B1ZA 1RT4A 4H5RA 3ENOA 3O9TA 1NGDA 1BHLA 1N32K 3OYAA 3CQXA 1TUYA 3HM9A 2G8KA 4HCBA 4C8NA 3L3UA 2YI1A 1BWFO 4FWKA 4RG8A 2O8BA 4LFCK 1IKVA 4NO7A 3H1QA 3CQYA 1KFDA 4YORA 3QNOA 3VEXA 1LV5A 4BRGA 1R59O 4BVOA 4JN4A 4CJPA 3OW2M 4BC2A 3RRHA 3RVCA 3BGRA 4B3RK 4CK3A 2ZF5O 4JI2K 1KVBA 1KAXA 3NH0A 1EWQA 5BRFA 1YJ9N 4CD1A 4JI1K 3G4SN 4AM7A 1SS6A 4M3YA 5BRDA 3NBPA 1H1VA 3TPQA 4OKJA 2Z1GA 3NHGA 4C8LA 3J7YP 1NM1A 4JKHA 4BRHA 4CBXA 5C2DA 1D9DA 5BPLA 3WT0A 5M1OA 3C0BA 3EZ5A 3H1VX 1JLEA 1TK5A 5CZ2A 4CIGA 2G8HA 3S3OA 1VSJA 3CQ8A 3WUHA 3DLKA 1LWCA 1NMDA 4RW6A 1D4XA 3PV8A 4M3RA 1QQMA 3BDPA 1S6PA 2FF6A 2HF4A 4KFBA 3V81A 4ICLA 3CMEN 4JI7K 3VGKA 4FJ7A 5AQMA 5J2MA 3IDHA 1U45A 4DSLA 1E3MA 3GG4A 3NH2A 1WB9A 2YNGA 3K58A 3QEVA 5JS2A 3DRSA 4C8MA 1VQPN 4B8CA 3B8AX 1WUAA 2QWRA 2FXUA 2VWJA 2P9IA 1RDDA 4DQPA 2FSNA 2UXCK 1VSHA 4JI6K 3DRPA 5AQPA 4BRQA 3BZKA 2O4GA 1X3MA 4FZZA 3V1RA 3RRGA 2PAVA 4G9ZA 4R5PA 3IFRA 4X62K 4BRIA 3QLHA 5ELZA 3HL8A 1E4FT 2DFHA 1SKRA 4CJFA 4K8ZA 4LC9B 1V4SA 1NGBA 3EEQA 4DSFA 1YAGA 1CZ9A 3CYMA 4Z4FA 1KCFA 3U4LA 2F4VK 1CZAN 2Q3SA 4JEPA 4DFJA 3TTCA 1N6QA 5AZJA 3EYZA 5HRRA 4YY3K 2QKBA 3ZSWA 1XWLA 3LP0A 4YOUA 4HUEA 3FFKB 1BOTO 4HCCA 3ZSXA 4FWLA 4DFMA 4KHWA 4DU4A 5MLCQ 4CGHA 3JYTA 3RMBA 2QEXN 4BDPA 3HT3A 1XNRK 1YVUA 2OPRA 1HRHA 4PA1A 1RBSA 3E01A 3LDQA 2IVNA 5JMVA 3VGMA 4N56A 1RT6A 2QTDA 3SMPA 5AJ3K 5GIPA 4BRNA 2RF2A 5GAHP 2QW9A 4AILC 4JK8A 4BC3A 2OZMA 3HBTA 1U2VA 5GINA 4KB0A 4KH5A 2P9LA 4Y1DA 1HYSA 1Q9YA 1NKEA 1JJ2M 2Q2RA 3DAWA 1A5VA 3S3NA 5J2QA 2DPNA 3P4IA 3V9XA 4CJVA 3LM2A 3TWHA 3DXKA 2Q36A
chains in the Genus database with same CATH topology
2WONA 4CHPA 4CJLA 3KD1E 2HNYA 1TL1A 2YKNA 1BI4A 3MXJA 4CEDA 4CJKA 4Y1CA 2O4IA 3AVNA 4O5BA 4FJGA 1HPZA 4GW6A 5DK5A 1NK7A 1GOCA 4LH5A 1TK8A 3AVGA 3ZSZA 4M3TA 3L2RA 3NGIA 4ELUA 4M45A 3PUFA 5C42A 5HROA 3SQ0A 1X1PA 2ATQA 4DTXA 2YV0X 3PX6A 3K2PA 4TSXA 1IG9A 3LPTA 3OYCA 3AVAA 4KV8A 2EHGA 4NCBA 4RW8A 1C0MA 1TL3A 4FLZA 3SUPA 2YNFA 4KPYA 2IAJA 3RR8A 4I9QA 3RMDA 3SV4A 1EP4A 2HHXA 4IBNA 2X6NA 2YNHA 4LSLA 1HJRA 3NFAA 5CYQA 3M8SA 4IFVA 4EP4A 3LZIA 2VG7A 3ULDA 2HHSA 4CECA 4CEAA 1NK4A 4FK4A 4HTUA 1IKWA 2HW3A 4FJLA 4UQGA 3OYEA 2Z1IA 4Q5VA 2B4JA 4DTPA 3DRRA 2G8WA 5J2NA 1XHXA 1Z26A 2YHBA 3C6TA 4GMJB 1D5AA 1LWEA 4CFDA 1GOAA 3O3HA 4B9SA 4DTJA 1QSLA 1NJYA 3ISNC 1RBUA 3VQBA 4E7KA 3ZT3A 4KI4A 3LWMA 1JL1A 2EX3A 3SNNA 1ASWA 3CFRA 4E1MA 1YTUA 4O55A 4FJMA 1TKZA 3VQPA 4CJ5A 4CJWA 4IFYA 3EY1A 4IG0A 4DLGA 2A1RA 2XY8A 1C0TA 2X74A 1WAFA 3O3FA 2G8UA 3V9ZA 2P5GA 3L2WA 2BDPA 1QSYA 1B9FA 4N76A 1BCOA 3TAMA 3CG7A 3OYJA 1R0AA 4DLEA 3RR7A 1K6YA 3SYZA 4DTSA 2OZSA 4M3XA 1TKXA 1B9DA 4CJSA 4E7JA 5KGXA 1L3VA 4FLUA 4QOZB 4CJQA 1T03A 3KK2A 3LP2A 4FJJA 1J54A 4FZXC 1SL1A 1IKXA 4CFBA 4CHYA 1S1XA 1W9HA 5CY4A 4FLVA 3NF8A 1LWFA 4F3TA 1EXQA 3LPUA 1LW2A 3ZCMA 5CYMA 4CFCA 3K59A 3SPYA 3DM2A 4O4GA 4J2EA 1VSKA 3IAYA 3G10A 2D5RA 4W5QA 2HHUA 5SZTA 4Z4EA 1WSEA 5HLFA 2PYLA 2FBTA 2QK9A 4KAZA 2DY4A 2LSNA 2FBXA 3HPGA 2KW4A 4DG1A 3OS1A 1Q9XA 1RTHA 5FROA 1TKDA 4CHZA 4AHSA 4Z4IA 2E4LA 1KLMA 1RT2A 4CEEA 3TAGA 4AHCA 4DMNA 1RTDA 3VQAA 4M42A 2YHAA 2Y1IA 1VK0A 4ELTA 1ITGA 3MXMA 4OGEA 2P1JA 2P51A 2PY5A 3VQEA 1HYZA 3DYAA 1UA0A 4FVMA 3VQ8A 4FJIA 1C1AA 5HBMA 1CLQA 2PZSA 1WNSA 5KRSA 1S1WA 4W5TA 1HQEA 3CFOA 1L3SA 4OJRA 4ZHRA 1S1UA 1Z25A 1S9GA 2ITGA 1J5OA 1BQNA 4KTZA 3VQ5A 2X78A 1Q8IA 4FW2A 4H8KA 3PX0A 3VQCA 5HP1A 1NK9A 4CGIA 1KVCA 3LAMA 4JS5A 4CGJA 3B6PA 2XY7A 1TKTA 1JKHA 2HVHA 1EX4A 1CZBA 3V1OA 2GBZA 3QIOA 3TARA 1BL3A 4CEZA 3L8BA 2XY5A 3AVIA 3THVA 1HYVA 4CE9A 3NCIA 1REVA 4DQSA 3DOKA 4AHRA 1WSHA 2VG5A 4RW4A 1ZBUA 4O0JA 3V6DA 1T7PA 1RT5A 3PY8A 1J53A 1ZBIA 4DU1A 1RBRA 4ID5A 4C8OA 5SWMA 2HMIA 4Q0BA 1EKEA 5I42A 1ASVA 1D8YA 3OYMA 1L3UA 3C95A 4AHUA 1S9EA 4I9LA 1ZBLA 4DTMA 2ETJA 3ALYA 1NK6A 3IRXA 3RMAA 5J1EA 3KJVA 4LSNA 4CF0A 4CK2A 1HMVA 4PUOA 3LP1A 4FM2A 1I39A 4CCHA 3OYFA 1NJXA 3AA4A 2G8VA 3HP9A 4CK1A 4N5SA 5FRNA 4CFAA 4FZYA 5FRMA 3C6UA 3HVTA 1RBTA 4F2RA 1ASUA 1VRUA 4KHNA 4G1QA 4KREA 2OPQA 3KTQA 1WN7A 1YTAA 3PO5A 4CJRA 4DQRA 4DTUA 3ZT4A 1VRTA 3V1QA 3TAQA 1UA1A 4KHSA 4KI6A 2RKIA 1YT3A 1JLGA 4LD0A 3OYGA 4OLBA 1UOCA 4ID1A 3LAKA 2JGUA 4DWIA 4QCLA 5T7BA 1S1TA 4B08A 1ZBHA 4DF4A 2VG6A 4KB1A 4M3WA 1N5YA 3AVHA 2OYQA 4Z4CA 3LZJA 4OPKA 3LALA 4FJ5A 2QKKA 1CXQA 1S1VA 4HVJA 3D0PA 4GVMA 3RWUA 2IS3A 1NK0A 4PWDA 3KLIA 3QEWA 2VWKA 3OS2A 3AVFA 3ZT1A 1TVRA 3JSMA 1NK5A 5EU7A 4CGGA 3SUOA 4CHQA 2OPSA 3WNFA 3G0ZA 4B9UA 3F73A 3WNEA 3QEXA 3TAEA 3VN5A 3AVLA 4KTWA 2GV9A 3T19A 5KRTA 3OYDA 3U3GA 4OGCA 1NOZA 3OVNA 3V9UA 1WLJA 2KZZA 2DTUA 4FM0A 3HYFA 4E0DA 2BANA 4DU3A 1I3AA 2ZD1A 1IH7A 1C0UA 3DLGA 3L3VA 3DLBA 4FJ9A 1HQUA 1GOBA 3L2UA 3NGZA 3AO4A 5E41A 3LP3A 1XC9A 4I2PA 5CZ1A 2KFZA 3KK1A 2E6LA 1SKWA 2XO7A 3U3YA 3PO4A 2BGGA 1U4BA 3AO2A 3ZSRA 4J2DA 4FJHA 3FFIA 4CJ3A 4JS4A 5JS1A 4FLYA 4CEFA 2A1SA 2RPIA 1EETA 3RMCA 4PQUA 2BE2A 4OLAA 3OJUA 4KHQA 3DLEA 3SZ2A 3LDSA 5I3UA 5HRSA 1RBVA 4I7FA 3V9WA 4MFBA 3OYKA 4M41A 3V9SA 4AHTA 4K8XA 3KLHA 4BWMA 1BGXT 1NK8A 4FXDA 4W5NA 1ZBFA 3ASMA 4E7HA 4Z4HA 1VSMA 4FM1A 2HHQA 3SJJA 1C1BA 3K5NA 1C1CA 4Z4GA 1QHTA 4C8KA 1B92A 5KGWA 1NKBA 4DF8A 2HHWA 1QS4A 1TK0A 3KLEA 1JLQA 1NOYA 4B9MA 3O4QA 1BISA 3KIOA 3DOLA 1A5WA 3MEEA 4WE1A 4BE1A 3NF9A 4LY7A 2GUIA 1G15A 2E6MA 1FKPA 4H4OA 3T1AA 3NAEA 3MAQA 1BIUA 4CF9A 5DMRA 1KSPA 2KQ2A 4F2SA 4OVLA 4CF8A 3IG1A 4Z0UA 4CHNA 4B9TA 3AVBA 1U49A 1T05A 1W0HA 3HVRA 2W42A 4E1NA 1JLBA 4NCGA 3QEIA 2P5OA 3K5LA 4W5RA 3HO1A 4JRPA 4CESA 4YFUA 1KLNA 1NJWA 3KLFA 1C6VA 1RT3A 2Z1HA 1QTMA 4B3OA 3AO1A 2HNZA 1RT4A 3QNNA 4FYDA 4JRQA 1BHLA 3AVKA 3OYAA 1RDAA 3OYNA 3TAPA 1L3TA 3HM9A 2X6SA 4DQIA 2G8KA 3KKSA 4F4KA 4O44A 4HCBA 4C8NA 3L3UA 4NCAA 4RG8A 2D0CA 3T3FA 3SUQA 1IKYA 1ZYQA 1DTTA 3V4IA 1HNVA 1IKVA 2IC3A 1JLFA 4XIUA 3VA0A 1RNHA 1Y97A 1KFDA 5HRPA 3HPOA 3QNOA 4ELVA 4DTNA 4BDZA 4E7IA 1LV5A 1DTQA 4DS4A 2FC0A 1O1WA 4CJPA 4CJTA 2ZQBA 3RRHA 4CJEA 1TAUA 3BGRA 4FJNA 4OKKA 4CK3A 4FW1A 3OYHA 3SQ1A 4IDKA 1JL2A 1KVBA 2IDOA 5KTQA 3PX4A 3L2VA 3SV3A 4EP5A 3VA3A 3NH0A 5FDLA 1BI4B 1DLOA 3VQQA 3ZSOA 4CEBA 4BE2A 1U47A 3ZT0A 1JLCA 2F96A 3AVMA 1U48A 4M3YA 3P83D 1FK9A 2OPPA 1WSFA 3H08A 3NBPA 4CF1A 2G8FA 4OKJA 3LWLA 1RTIA 2Z1GA 3NHGA 2R7YA 2KTQA 4O0IA 4C8LA 4HUFA 1D9DA 1FKOA 3KLGA 1IO2A 5HRNA 3OY9A 3EZ5A 4MQ3A 1JLEA 3NE6A 2DFFA 4OPJA 4CHOA 4FCYA 5CZ2A 3O3GA 1TK5A 3KD5E 3HXMA 3AA5X 4KRFA 4CIGA 2G8HA 1X9MA 3NH1A 4E7LA 2QXFA 3S3OA 1VSJA 3D45A 2NUBA 3CQ8A 4HUGA 2D0AA 4JLHA 3DLKA 4IG3A 1LWCA 4RW6A 3PV8A 4M3RA 2FBYA 3ZSVA 3P1GA 3OYBA 4DS5A 1S6QA 3HSTB 4FJKA 3BDPA 1S6PA 3M8QA 4KFBA 3AA2A 5J2PA 3V81A 2B5JA 1T8EA 3WNGA 3HPHA 3TAFA 3QESA 5K14A 1SV5A 1WAJA 4ICLA 2ZE2A 4DSIA 1BCMA 3QO9A 1NKCA 4FJ7A 5J2MA 1JXEA 1VSFA 4RW7A 3LANA 3O4NA 1U45A 4DSLA 3HK2A 3TANA 3VQ7A 4F3OA 3VQ6A 3NH2A 1QQCA 1QE1A 4CEQA 2YNIA 1JXBA 2YNGA 4NYFA 4DTOA 3K58A 1RILA 3QEVA 5JS2A 2AJQA 3DRSA 4I2QA 1VSIA 4C8MA 1WSGA 3A2FA 4CGDA 3DLRA 4CIEA 4B8CA 3I0SA 4DTRA 4CJ4A 3SCXA 1QSSA 3MXIA 1JLAA 3SPZA 2VWJA 3TR8A 4BE0A 5KI6A 4CIFA 1RDDA 2F8SA 1HNIA 4DQPA 2FBVA 4H4MA 4KKOA 4J2BA 1VSHA 4CERA 1SL0A 3F9KA 2XRIA 4M3UA 3HJFA 3DRPA 1SKSA 1LAWA 4LH4A 1LAVA 5C25A 2O4GA 3SQ2A 4CJUA 4FJ8A 4FZZA 4HHTA 3V1RA 1TV6A 1U04A 3RRGA 2F8TA 1BQMA 4R5PA 1KRPA 4DFPA 3AA3A 4BWJA 2WOMA 2D0BA 3AV9A 3ITHA 4CEOA 4B9NA 3QLHA 3K5OA 2XHBA 4ZTFA 3HL8A 3NDKA 4FK2A 3SQ4A 2RN2A 4FLTA 3TI0A 1XHZA 2DFEA 3I0RA 2DFHA 4AHVA 1SKRA 4CJFA 4K8ZA 3DI6A 4KHUA 3ZSYA 4KTQA 3QERA 2KZMA 1KVAA 2OA8A 1S5JA 3S9HA 3QINA 1KTQA 3QIPA 3NF6A 3L2QA 4EZ9A 3IS9A 4DSFA 1CZ9A 3S3MA 3CYMA 1RDBA 4Z4FA 1KCFA 3M8PA 1RTJA 1XI1A 2Q3SA 4DFJA 4N41A 1N6QA 3EYZA 5HRRA 2IGIA 2QKBA 3ZT2A 4FLWA 3ZSWA 1XWLA 3DMJA 4OKEA 3QETA 4F8RA 3QEPA 3LP0A 1FXXA 2HNDA 4HUEA 1TAQA 2XY6A 4E89A 1CXUA 1RT7A 4B8AB 3WNHA 3HP6A 1SUQA 3CM6A 3KKRA 4W5OA 4DQQA 3U6FA 4HCCA 4EZ6A 3VQDA 3DLHA 3UIQA 1TGOA 3ZSXA 5C24A 4YNQA 3AVCA 1LW0A 3OS0A 4DFMA 4KHWA 1X9WA 4DU4A 4DSKA 3MEDA 3SUNA 3OJSA 3AVJA 4CGHA 3CFPA 3JYTA 4E19A 3RMBA 1J9AA 3HT3A 3M8RA 4BDPA 4B9LA 1YVUA 2OPRA 1HRHA 4DFKA 2Z1JA 4PA1A 1RBSA 4CGFA 3I8DA 5D3GA 4L8RB 1RDCA 1MU2A 3E01A 4BACA 4AH9A 4M3ZA 4KO0A 4CF2A 4N56A 1RT6A 1F21A 2HB5A 4E3SA 3VQ9A 4FK0A 1L5UA 3K5MA 2Y1JA 1A5XA 3OYIA 4DSJA 3CM5A 3K57A 4J2AA 2RF2A 2HVIA 1WSJA 4AILC 1WSIA 3OYLA 4FJXA 2OZMA 2B6AA 4PY5A 2YKMA 2PYJA 4KB0A 3MECA 3MEGA 1D9FA 2HHTA 2JLEA 4Y1DA 1X9SA 2G8IA 1HYSA 3AO3A 1VSDA 3B6OA 3C94A 3KK3A 1RCHA 4DSEA 2IOCA 1Q9YA 2HHVA 3P5JA 1NJZA 2I5JA 1UWBA 3ZSQA 1NKEA 1SL2A 3NF7A 3RTVA 1VSEA 1RT1A 4ZTJA 1KFSA 3VQ4A 3AO5A 4RW9A 4KHYA 2KFNA 4QAGA 3TABA 1A5VA 4FLXA 5J2QA 3S3NA 4NYNA 3NGYA 3SI6A 3V9XA 4N47A 4IKFA 4BDYA 1BIZA 4CJVA 1UAXA 1VSLA 4B9VA 3TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WON A;  4CHP A;  4CJL A;  3KD1 E;  2HNY A;  1TL1 A;  2YKN A;  1BI4 A;  3MXJ A;  4CED A;  4CJK A;  4Y1C A;  2O4I A;  3AVN A;  4O5B A;  4FJG A;  1HPZ A;  4GW6 A;  5DK5 A;  1NK7 A;  1GOC A;  4LH5 A;  1TK8 A;  3AVG A;  3ZSZ A;  4M3T A;  3L2R A;  3NGI A;  4ELU A;  4M45 A;  3PUF A;  5C42 A;  5HRO A;  3SQ0 A;  1X1P A;  2ATQ A;  4DTX A;  2YV0 X;  3PX6 A;  3K2P A;  4TSX A;  1IG9 A;  3LPT A;  3OYC A;  3AVA A;  4KV8 A;  2EHG A;  4NCB A;  4RW8 A;  1C0M A;  1TL3 A;  4FLZ A;  3SUP A;  2YNF A;  4KPY A;  2IAJ A;  3RR8 A;  4I9Q A;  3RMD A;  3SV4 A;  1EP4 A;  2HHX A;  4IBN A;  2X6N A;  2YNH A;  4LSL A;  1HJR A;  3NFA A;  5CYQ A;  3M8S A;  4IFV A;  4EP4 A;  3LZI A;  2VG7 A;  3ULD A;  2HHS A;  4CEC A;  4CEA A;  1NK4 A;  4FK4 A;  4HTU A;  1IKW A;  2HW3 A;  4FJL A;  4UQG A;  3OYE A;  2Z1I A;  4Q5V A;  2B4J A;  4DTP A;  3DRR A;  2G8W A;  5J2N A;  1XHX A;  1Z26 A;  2YHB A;  3C6T A;  4GMJ B;  1D5A A;  1LWE A;  4CFD A;  1GOA A;  3O3H A;  4B9S A;  4DTJ A;  1QSL A;  1NJY A;  3ISN C;  1RBU A;  3VQB A;  4E7K A;  3ZT3 A;  4KI4 A;  3LWM A;  1JL1 A;  2EX3 A;  3SNN A;  1ASW A;  3CFR A;  4E1M A;  1YTU A;  4O55 A;  4FJM A;  1TKZ A;  3VQP A;  4CJ5 A;  4CJW A;  4IFY A;  3EY1 A;  4IG0 A;  4DLG A;  2A1R A;  2XY8 A;  1C0T A;  2X74 A;  1WAF A;  3O3F A;  2G8U A;  3V9Z A;  2P5G A;  3L2W A;  2BDP A;  1QSY A;  1B9F A;  4N76 A;  1BCO A;  3TAM A;  3CG7 A;  3OYJ A;  1R0A A;  4DLE A;  3RR7 A;  1K6Y A;  3SYZ A;  4DTS A;  2OZS A;  4M3X A;  1TKX A;  1B9D A;  4CJS A;  4E7J A;  5KGX A;  1L3V A;  4FLU A;  4QOZ B;  4CJQ A;  1T03 A;  3KK2 A;  3LP2 A;  4FJJ A;  1J54 A;  4FZX C;  1SL1 A;  1IKX A;  4CFB A;  4CHY A;  1S1X A;  1W9H A;  5CY4 A;  4FLV A;  3NF8 A;  1LWF A;  4F3T A;  1EXQ A;  3LPU A;  1LW2 A;  3ZCM A;  5CYM A;  4CFC A;  3K59 A;  3SPY A;  3DM2 A;  4O4G A;  4J2E A;  1VSK A;  3IAY A;  3G10 A;  2D5R A;  4W5Q A;  2HHU A;  5SZT A;  4Z4E A;  1WSE A;  5HLF A;  2PYL A;  2FBT A;  2QK9 A;  4KAZ A;  2DY4 A;  2LSN A;  2FBX A;  3HPG A;  2KW4 A;  4DG1 A;  3OS1 A;  1Q9X A;  1RTH A;  5FRO A;  1TKD A;  4CHZ A;  4AHS A;  4Z4I A;  2E4L A;  1KLM A;  1RT2 A;  4CEE A;  3TAG A;  4AHC A;  4DMN A;  1RTD A;  3VQA A;  4M42 A;  2YHA A;  2Y1I A;  1VK0 A;  4ELT A;  1ITG A;  3MXM A;  4OGE A;  2P1J A;  2P51 A;  2PY5 A;  3VQE A;  1HYZ A;  3DYA A;  1UA0 A;  4FVM A;  3VQ8 A;  4FJI A;  1C1A A;  5HBM A;  1CLQ A;  2PZS A;  1WNS A;  5KRS A;  1S1W A;  4W5T A;  1HQE A;  3CFO A;  1L3S A;  4OJR A;  4ZHR A;  1S1U A;  1Z25 A;  1S9G A;  2ITG A;  1J5O A;  1BQN A;  4KTZ A;  3VQ5 A;  2X78 A;  1Q8I A;  4FW2 A;  4H8K A;  3PX0 A;  3VQC A;  5HP1 A;  1NK9 A;  4CGI A;  1KVC A;  3LAM A;  4JS5 A;  4CGJ A;  3B6P A;  2XY7 A;  1TKT A;  1JKH A;  2HVH A;  1EX4 A;  1CZB A;  3V1O A;  2GBZ A;  3QIO A;  3TAR A;  1BL3 A;  4CEZ A;  3L8B A;  2XY5 A;  3AVI A;  3THV A;  1HYV A;  4CE9 A;  3NCI A;  1REV A;  4DQS A;  3DOK A;  4AHR A;  1WSH A;  2VG5 A;  4RW4 A;  1ZBU A;  4O0J A;  3V6D A;  1T7P A;  1RT5 A;  3PY8 A;  1J53 A;  1ZBI A;  4DU1 A;  1RBR A;  4ID5 A;  4C8O A;  5SWM A;  2HMI A;  4Q0B A;  1EKE A;  5I42 A;  1ASV A;  1D8Y A;  3OYM A;  1L3U A;  3C95 A;  4AHU A;  1S9E A;  4I9L A;  1ZBL A;  4DTM A;  2ETJ A;  3ALY A;  1NK6 A;  3IRX A;  3RMA A;  5J1E A;  3KJV A;  4LSN A;  4CF0 A;  4CK2 A;  1HMV A;  4PUO A;  3LP1 A;  4FM2 A;  1I39 A;  4CCH A;  3OYF A;  1NJX A;  3AA4 A;  2G8V A;  3HP9 A;  4CK1 A;  4N5S A;  5FRN A;  4CFA A;  4FZY A;  5FRM A;  3C6U A;  3HVT A;  1RBT A;  4F2R A;  1ASU A;  1VRU A;  4KHN A;  4G1Q A;  4KRE A;  2OPQ A;  3KTQ A;  1WN7 A;  1YTA A;  3PO5 A;  4CJR A;  4DQR A;  4DTU A;  3ZT4 A;  1VRT A;  3V1Q A;  3TAQ A;  1UA1 A;  4KHS A;  4KI6 A;  2RKI A;  1YT3 A;  1JLG A;  4LD0 A;  3OYG A;  4OLB A;  1UOC A;  4ID1 A;  3LAK A;  2JGU A;  4DWI A;  4QCL A;  5T7B A;  1S1T A;  4B08 A;  1ZBH A;  4DF4 A;  2VG6 A;  4KB1 A;  4M3W A;  1N5Y A;  3AVH A;  2OYQ A;  4Z4C A;  3LZJ A;  4OPK A;  3LAL A;  4FJ5 A;  2QKK A;  1CXQ A;  1S1V A;  4HVJ A;  3D0P A;  4GVM A;  3RWU A;  2IS3 A;  1NK0 A;  4PWD A;  3KLI A;  3QEW A;  2VWK A;  3OS2 A;  3AVF A;  3ZT1 A;  1TVR A;  3JSM A;  1NK5 A;  5EU7 A;  4CGG A;  3SUO A;  4CHQ A;  2OPS A;  3WNF A;  3G0Z A;  4B9U A;  3F73 A;  3WNE A;  3QEX A;  3TAE A;  3VN5 A;  3AVL A;  4KTW A;  2GV9 A;  3T19 A;  5KRT A;  3OYD A;  3U3G A;  4OGC A;  1NOZ A;  3OVN A;  3V9U A;  1WLJ A;  2KZZ A;  2DTU A;  4FM0 A;  3HYF A;  4E0D A;  2BAN A;  4DU3 A;  1I3A A;  2ZD1 A;  1IH7 A;  1C0U A;  3DLG A;  3L3V A;  3DLB A;  4FJ9 A;  1HQU A;  1GOB A;  3L2U A;  3NGZ A;  3AO4 A;  5E41 A;  3LP3 A;  1XC9 A;  4I2P A;  5CZ1 A;  2KFZ A;  3KK1 A;  2E6L A;  1SKW A;  2XO7 A;  3U3Y A;  3PO4 A;  2BGG A;  1U4B A;  3AO2 A;  3ZSR A;  4J2D A;  4FJH A;  3FFI A;  4CJ3 A;  4JS4 A;  5JS1 A;  4FLY A;  4CEF A;  2A1S A;  2RPI A;  1EET A;  3RMC A;  4PQU A;  2BE2 A;  4OLA A;  3OJU A;  4KHQ A;  3DLE A;  3SZ2 A;  3LDS A;  5I3U A;  5HRS A;  1RBV A;  4I7F A;  3V9W A;  4MFB A;  3OYK A;  4M41 A;  3V9S A;  4AHT A;  4K8X A;  3KLH A;  4BWM A;  1BGX T;  1NK8 A;  4FXD A;  4W5N A;  1ZBF A;  3ASM A;  4E7H A;  4Z4H A;  1VSM A;  4FM1 A;  2HHQ A;  3SJJ A;  1C1B A;  3K5N A;  1C1C A;  4Z4G A;  1QHT A;  4C8K A;  1B92 A;  5KGW A;  1NKB A;  4DF8 A;  2HHW A;  1QS4 A;  1TK0 A;  3KLE A;  1JLQ A;  1NOY A;  4B9M A;  3O4Q A;  1BIS A;  3KIO A;  3DOL A;  1A5W A;  3MEE A;  4WE1 A;  4BE1 A;  3NF9 A;  4LY7 A;  2GUI A;  1G15 A;  2E6M A;  1FKP A;  4H4O A;  3T1A A;  3NAE A;  3MAQ A;  1BIU A;  4CF9 A;  5DMR A;  1KSP A;  2KQ2 A;  4F2S A;  4OVL A;  4CF8 A;  3IG1 A;  4Z0U A;  4CHN A;  4B9T A;  3AVB A;  1U49 A;  1T05 A;  1W0H A;  3HVR A;  2W42 A;  4E1N A;  1JLB A;  4NCG A;  3QEI A;  2P5O A;  3K5L A;  4W5R A;  3HO1 A;  4JRP A;  4CES A;  4YFU A;  1KLN A;  1NJW A;  3KLF A;  1C6V A;  1RT3 A;  2Z1H A;  1QTM A;  4B3O A;  3AO1 A;  2HNZ A;  1RT4 A;  3QNN A;  4FYD A;  4JRQ A;  1BHL A;  3AVK A;  3OYA A;  1RDA A;  3OYN A;  3TAP A;  1L3T A;  3HM9 A;  2X6S A;  4DQI A;  2G8K A;  3KKS A;  4F4K A;  4O44 A;  4HCB A;  4C8N A;  3L3U A;  4NCA A;  4RG8 A;  2D0C A;  3T3F A;  3SUQ A;  1IKY A;  1ZYQ A;  1DTT A;  3V4I A;  1HNV A;  1IKV A;  2IC3 A;  1JLF A;  4XIU A;  3VA0 A;  1RNH A;  1Y97 A;  1KFD A;  5HRP A;  3HPO A;  3QNO A;  4ELV A;  4DTN A;  4BDZ A;  4E7I A;  1LV5 A;  1DTQ A;  4DS4 A;  2FC0 A;  1O1W A;  4CJP A;  4CJT A;  2ZQB A;  3RRH A;  4CJE A;  1TAU A;  3BGR A;  4FJN A;  4OKK A;  4CK3 A;  4FW1 A;  3OYH A;  3SQ1 A;  4IDK A;  1JL2 A;  1KVB A;  2IDO A;  5KTQ A;  3PX4 A;  3L2V A;  3SV3 A;  4EP5 A;  3VA3 A;  3NH0 A;  5FDL A;  1BI4 B;  1DLO A;  3VQQ A;  3ZSO A;  4CEB A;  4BE2 A;  1U47 A;  3ZT0 A;  1JLC A;  2F96 A;  3AVM A;  1U48 A;  4M3Y A;  3P83 D;  1FK9 A;  2OPP A;  1WSF A;  3H08 A;  3NBP A;  4CF1 A;  2G8F A;  4OKJ A;  3LWL A;  1RTI A;  2Z1G A;  3NHG A;  2R7Y A;  2KTQ A;  4O0I A;  4C8L A;  4HUF A;  1D9D A;  1FKO A;  3KLG A;  1IO2 A;  5HRN A;  3OY9 A;  3EZ5 A;  4MQ3 A;  1JLE A;  3NE6 A;  2DFF A;  4OPJ A;  4CHO A;  4FCY A;  5CZ2 A;  3O3G A;  1TK5 A;  3KD5 E;  3HXM A;  3AA5 X;  4KRF A;  4CIG A;  2G8H A;  1X9M A;  3NH1 A;  4E7L A;  2QXF A;  3S3O A;  1VSJ A;  3D45 A;  2NUB A;  3CQ8 A;  4HUG A;  2D0A A;  4JLH A;  3DLK A;  4IG3 A;  1LWC A;  4RW6 A;  3PV8 A;  4M3R A;  2FBY A;  3ZSV A;  3P1G A;  3OYB A;  4DS5 A;  1S6Q A;  3HST B;  4FJK A;  3BDP A;  1S6P A;  3M8Q A;  4KFB A;  3AA2 A;  5J2P A;  3V81 A;  2B5J A;  1T8E A;  3WNG A;  3HPH A;  3TAF A;  3QES A;  5K14 A;  1SV5 A;  1WAJ A;  4ICL A;  2ZE2 A;  4DSI A;  1BCM A;  3QO9 A;  1NKC A;  4FJ7 A;  5J2M A;  1JXE A;  1VSF A;  4RW7 A;  3LAN A;  3O4N A;  1U45 A;  4DSL A;  3HK2 A;  3TAN A;  3VQ7 A;  4F3O A;  3VQ6 A;  3NH2 A;  1QQC A;  1QE1 A;  4CEQ A;  2YNI A;  1JXB A;  2YNG A;  4NYF A;  4DTO A;  3K58 A;  1RIL A;  3QEV A;  5JS2 A;  2AJQ A;  3DRS A;  4I2Q A;  1VSI A;  4C8M A;  1WSG A;  3A2F A;  4CGD A;  3DLR A;  4CIE A;  4B8C A;  3I0S A;  4DTR A;  4CJ4 A;  3SCX A;  1QSS A;  3MXI A;  1JLA A;  3SPZ A;  2VWJ A;  3TR8 A;  4BE0 A;  5KI6 A;  4CIF A;  1RDD A;  2F8S A;  1HNI A;  4DQP A;  2FBV A;  4H4M A;  4KKO A;  4J2B A;  1VSH A;  4CER A;  1SL0 A;  3F9K A;  2XRI A;  4M3U A;  3HJF A;  3DRP A;  1SKS A;  1LAW A;  4LH4 A;  1LAV A;  5C25 A;  2O4G A;  3SQ2 A;  4CJU A;  4FJ8 A;  4FZZ A;  4HHT A;  3V1R A;  1TV6 A;  1U04 A;  3RRG A;  2F8T A;  1BQM A;  4R5P A;  1KRP A;  4DFP A;  3AA3 A;  4BWJ A;  2WOM A;  2D0B A;  3AV9 A;  3ITH A;  4CEO A;  4B9N A;  3QLH A;  3K5O A;  2XHB A;  4ZTF A;  3HL8 A;  3NDK A;  4FK2 A;  3SQ4 A;  2RN2 A;  4FLT A;  3TI0 A;  1XHZ A;  2DFE A;  3I0R A;  2DFH A;  4AHV A;  1SKR A;  4CJF A;  4K8Z A;  3DI6 A;  4KHU A;  3ZSY A;  4KTQ A;  3QER A;  2KZM A;  1KVA A;  2OA8 A;  1S5J A;  3S9H A;  3QIN A;  1KTQ A;  3QIP A;  3NF6 A;  3L2Q A;  4EZ9 A;  3IS9 A;  4DSF A;  1CZ9 A;  3S3M A;  3CYM A;  1RDB A;  4Z4F A;  1KCF A;  3M8P A;  1RTJ A;  1XI1 A;  2Q3S A;  4DFJ A;  4N41 A;  1N6Q A;  3EYZ A;  5HRR A;  2IGI A;  2QKB A;  3ZT2 A;  4FLW A;  3ZSW A;  1XWL A;  3DMJ A;  4OKE A;  3QET A;  4F8R A;  3QEP A;  3LP0 A;  1FXX A;  2HND A;  4HUE A;  1TAQ A;  2XY6 A;  4E89 A;  1CXU A;  1RT7 A;  4B8A B;  3WNH A;  3HP6 A;  1SUQ A;  3CM6 A;  3KKR A;  4W5O A;  4DQQ A;  3U6F A;  4HCC A;  4EZ6 A;  3VQD A;  3DLH A;  3UIQ A;  1TGO A;  3ZSX A;  5C24 A;  4YNQ A;  3AVC A;  1LW0 A;  3OS0 A;  4DFM A;  4KHW A;  1X9W A;  4DU4 A;  4DSK A;  3MED A;  3SUN A;  3OJS A;  3AVJ A;  4CGH A;  3CFP A;  3JYT A;  4E19 A;  3RMB A;  1J9A A;  3HT3 A;  3M8R A;  4BDP A;  4B9L A;  1YVU A;  2OPR A;  1HRH A;  4DFK A;  2Z1J A;  4PA1 A;  1RBS A;  4CGF A;  3I8D A;  5D3G A;  4L8R B;  1RDC A;  1MU2 A;  3E01 A;  4BAC A;  4AH9 A;  4M3Z A;  4KO0 A;  4CF2 A;  4N56 A;  1RT6 A;  1F21 A;  2HB5 A;  4E3S A;  3VQ9 A;  4FK0 A;  1L5U A;  3K5M A;  2Y1J A;  1A5X A;  3OYI A;  4DSJ A;  3CM5 A;  3K57 A;  4J2A A;  2RF2 A;  2HVI A;  1WSJ A;  4AIL C;  1WSI A;  3OYL A;  4FJX A;  2OZM A;  2B6A A;  4PY5 A;  2YKM A;  2PYJ A;  4KB0 A;  3MEC A;  3MEG A;  1D9F A;  2HHT A;  2JLE A;  4Y1D A;  1X9S A;  2G8I A;  1HYS A;  3AO3 A;  1VSD A;  3B6O A;  3C94 A;  3KK3 A;  1RCH A;  4DSE A;  2IOC A;  1Q9Y A;  2HHV A;  3P5J A;  1NJZ A;  2I5J A;  1UWB A;  3ZSQ A;  1NKE A;  1SL2 A;  3NF7 A;  3RTV A;  1VSE A;  1RT1 A;  4ZTJ A;  1KFS A;  3VQ4 A;  3AO5 A;  4RW9 A;  4KHY A;  2KFN A;  4QAG A;  3TAB A;  1A5V A;  4FLX A;  5J2Q A;  3S3N A;  4NYN A;  3NGY A;  3SI6 A;  3V9X A;  4N47 A;  4IKF A;  4BDY A;  1BIZ A;  4CJV A;  1UAX A;  1VSL A;  4B9V A;  3TWH A; 
#chains in the Genus database with same CATH topology
 4CHP A;  2UYT A;  4BY9 C;  4IEE A;  4Y1C A;  4LF6 K;  3JS6 A;  4JAX A;  4U67 L;  5DK5 A;  3MX5 A;  1NK7 A;  4M3T A;  3L2R A;  3QBX A;  1X1P A;  4BR2 A;  3K2P A;  1N34 K;  3OYC A;  4IJN A;  4KV8 A;  1C0M A;  3UB5 A;  2IAJ A;  3RR8 A;  1EP4 A;  4GNI A;  3R8E A;  2YNH A;  5CYQ A;  3NFA A;  3ULD A;  2VG7 A;  1OH8 A;  3CCU N;  3CJA A;  4Q5V A;  2B4J A;  3DRR A;  5J2N A;  3AAP A;  1D5A A;  3O3H A;  3ID8 A;  3VQB A;  2HF3 A;  3FZL A;  3GOI A;  3LWM A;  1JL1 A;  5DM7 L;  1ASW A;  3CFR A;  4O55 A;  3EY1 A;  1VQK N;  4ISF A;  1X3N A;  2XY8 A;  1C0T A;  4OX9 K;  2QWL A;  3ULE A;  3ZET A;  3L2W A;  2BDP A;  1BCO A;  1R0A A;  3CG7 A;  3A8Y A;  5AQF A;  1K6Y A;  3CJC A;  2PFU A;  3VOV A;  5EY4 A;  3ZX2 A;  4FLU A;  4QOZ B;  2GTD A;  3A5O C;  4CJQ A;  1T03 A;  3KK2 A;  3O6W A;  2ASM A;  4CHY A;  2FSJ A;  3VER A;  4YHH K;  4JK7 A;  3ZCM A;  3K59 A;  4J2E A;  5CYM A;  4CFC A;  1W2B M;  4W5Q A;  1GLJ O;  2PYL A;  2WC9 A;  2QK9 A;  2E8A A;  3W3D A;  3OS1 A;  1GLA G;  3WXI A;  4KH6 A;  3O1W A;  2E4L A;  3A5N C;  4AHC A;  5AFU A;  2JWL A;  4M42 A;  3MXM A;  4Y0W A;  3CPE A;  3DYA A;  4FJI A;  3QFU A;  5KRS A;  3CFO A;  4ZHR A;  3UKU A;  1BQN A;  4FW2 A;  1P90 A;  2GEM A;  1JKH A;  1CZB A;  4BRM A;  3THV A;  3O9U A;  3L8B A;  2XY5 A;  3AVI A;  4CE9 A;  3NCI A;  1REV A;  3D2E A;  4O0J A;  4MO5 A;  3PY8 A;  1J53 A;  1BO5 O;  4DUZ K;  2YJF A;  4Q0B A;  2O8E A;  2YX6 A;  1ASV A;  3WQU A;  5LJW A;  3C95 A;  1YI2 N;  3VF4 A;  4DTM A;  3IRX A;  3DXK B;  4CK2 A;  4PUO A;  4CCH A;  3AA4 A;  4CK1 A;  4N5S A;  4LF5 K;  4FWS A;  2WFB A;  5FRM A;  2GX9 A;  4F2R A;  1VRU A;  2ZM6 K;  4KHN A;  1NGF A;  2E1Y A;  1Q82 O;  1KAZ A;  4BRC A;  2RKI A;  3ZX3 A;  1HX1 A;  1UOC A;  3LAK A;  2JGU A;  4GKK K;  2E2Q A;  4J8F A;  1S1T A;  5AQS A;  5F2R A;  4DF4 A;  2VG6 A;  4KB1 A;  3CCQ N;  4DR1 K;  3SAH A;  3AVH A;  2QKK A;  3BY5 A;  4GVM A;  2NRZ A;  2IS3 A;  4PWD A;  2VWK A;  4DV1 K;  4PHT X;  1TVR A;  1NK5 A;  1KQS M;  4WFB L;  3MN7 A;  4FWM A;  5AQI A;  4EHU A;  2VCP A;  4BRP A;  1TYQ A;  4IWV A;  5ADX A;  1NGC A;  3T19 A;  4FM0 A;  2BAN A;  1VQ8 N;  1C0U A;  4FJ9 A;  3L3V A;  5GAD P;  3AO4 A;  3CER A;  4WFN L;  3J81 O;  3TU5 A;  4LFB K;  1QVG M;  3C7N A;  5F1X A;  2YHX A;  2BGG A;  3CIP A;  3AO2 A;  4FJH A;  3VEY A;  5JS1 A;  4CEF A;  4JI8 K;  2RPI A;  3RMC A;  1Z05 A;  3CCS N;  3D7E O;  4XEI A;  4PQU A;  1N33 K;  3THY B;  3E9O A;  4MFB A;  4M41 A;  5HL7 L;  3V9S A;  3KLH A;  4PKH A;  4BWM A;  4FXD A;  4XH5 A;  3H3O B;  4E7H A;  4OPA A;  1VSM A;  4FM1 A;  1YXQ A;  1QS4 A;  3DOL A;  4LY7 A;  2GUI A;  1ATN A;  3T1A A;  2E6M A;  3C6H A;  1VQ9 N;  3MAQ A;  1BIU A;  4F2S A;  2KHO A;  4CF8 A;  3IG1 A;  1GLF O;  4B1U B;  1DT9 A;  1SZ2 A;  4BGA A;  1W0H A;  3HVR A;  2W42 A;  4NCG A;  5GAG P;  3MN9 A;  1C6V A;  2Z1H A;  4I6M A;  4B3M K;  4NXM K;  2HNZ A;  1HNW K;  3AVK A;  1L3T A;  1RDA A;  1ESV A;  3TAP A;  3M1F A;  2X6S A;  3KKS A;  4O44 A;  4GKJ K;  4CBW A;  4NCA A;  5KPZ A;  2D0C A;  4KBO A;  2E88 A;  4YOW A;  4O8K A;  2W40 A;  1HNV A;  2IC3 A;  1JLF A;  4XIU A;  3CJ9 A;  2E2N A;  5M1P A;  4IOX A;  4X66 K;  1ATS A;  1O1W A;  3VES A;  3WEE A;  4CJT A;  2P9N B;  4CJE A;  1TAU A;  4YOX A;  4OKK A;  5LJV A;  4FW1 A;  3OYH A;  1JL2 A;  1VQ5 N;  5KTQ A;  3L2V A;  3SV3 A;  2HHH K;  4BQZ A;  4CEB A;  1DLO A;  3BF1 A;  4BE2 A;  1U47 A;  3UKR B;  3D2F A;  2F96 A;  2Q31 A;  4B1Y B;  1U48 A;  1HPM A;  4CF1 A;  3FGU A;  2G8F A;  2P9U A;  2P9K A;  4O0I A;  4K42 A;  2ZJQ L;  1BDG A;  3KLG A;  1IO2 A;  5AR0 A;  5HOO A;  5HRN A;  3OY9 A;  5JIC A;  3NE6 A;  2DFF A;  3KD5 E;  1X9M A;  4E7L A;  2QXF A;  1NLV A;  4JLH A;  5BN9 A;  4JKD A;  3TTD A;  1GLE G;  4A61 A;  2WBN A;  2YCH A;  2F7T A;  4FJK A;  3THX B;  3AA2 A;  4JI5 K;  2B5J A;  1T8E A;  3SLC A;  4A59 A;  3QES A;  2NRX A;  3I8B A;  1WAJ A;  3CPW M;  4ILH A;  3CJB A;  3C7N B;  2D4W A;  1YHQ N;  1VSF A;  2D0P A;  3HK2 A;  4F3O A;  4H5N A;  3VQ6 A;  1QQC A;  1QE1 A;  4CEQ A;  3OA9 A;  1JXB A;  4DTO A;  3W0L A;  1RIL A;  4X65 K;  5LMN K;  1HKB A;  5KPT A;  4JI0 K;  4DV6 K;  4JD2 A;  1N8R O;  1VSI A;  4CIE A;  3DLR A;  2HBL A;  3TR8 A;  4PKI A;  1HNI A;  4H4M A;  4KKO A;  4FWP A;  4V19 S;  5BR9 A;  1T44 A;  3HJF A;  2W6K A;  1LAW A;  4JYA K;  4Z94 A;  4BG9 A;  3CD6 N;  1QQN A;  4HHT A;  3ZX0 A;  3LDL A;  2E2O A;  1KRP A;  4DFP A;  5AQG A;  1Q7Y O;  1WBB A;  4B9N A;  5BRH A;  4DV2 K;  3NDK A;  4FK2 A;  3TI0 A;  3O1B A;  4NLB A;  5TKW A;  3DI6 A;  3ZSY A;  5M1Q A;  3CCE N;  2NRV A;  2E1Z A;  4CZM A;  4CJ7 A;  1S5J A;  4M7X A;  3QIN A;  3L2Q A;  4BC4 A;  3IS9 A;  3S3M A;  3M8P A;  3VEZ A;  1RTJ A;  1HR0 K;  4H5T A;  3NMU A;  1QVF M;  1ATR A;  4FLW A;  4OKE A;  3FZF A;  1VQO N;  4WQ5 A;  1FXX A;  5JLF A;  2ZGZ A;  3DWL A;  1TAQ A;  2H3G X;  3KKR A;  4W5O A;  4C1N I;  1ILY A;  4YNQ A;  3AVC A;  2V51 B;  2WUS A;  3HOS A;  3OJS A;  2E2P A;  3VET A;  4CZG A;  3Q7C A;  5I9E B;  5D3G A;  4L8R B;  4IZ9 A;  4CF2 A;  2HB5 A;  3K5M A;  2Y1J A;  1A5X A;  2Q0R A;  4FO0 A;  3OYI A;  4J2A A;  2HVI A;  4K41 A;  4FJX A;  3E9L A;  1D9F A;  2JLE A;  2V7Z A;  3AO3 A;  3C94 A;  4DSE A;  1YF5 L;  2I5J A;  1UWB A;  3RTV A;  4KHY A;  3CJ7 A;  3ZEU A;  4AF1 A;  1BA1 A;  3FZK A;  4N47 A;  4O5F A;  4BDY A;  1UAX A;  1VSL A;  3L4Q A;  4B9V A;  3KWI A;  1NWK A;  1S72 N;  4DV7 K;  5AQH A;  2WON A;  4CJL A;  1BI4 A;  3AGR A;  3MXJ A;  4CED A;  5AQY A;  4FJG A;  5BN8 A;  2W6L A;  2O8C A;  1GOC A;  5E84 A;  4LH5 A;  3ZSZ A;  3MDQ A;  4ELU A;  3PUF A;  4JHD B;  5C42 A;  1OVY A;  2ATQ A;  1IG9 A;  3LPT A;  3T69 A;  4C1N K;  3WXM B;  3AVA A;  3O08 A;  1TL3 A;  3SUP A;  1JCF A;  3VMF B;  4BRL A;  3SV4 A;  3RSE A;  3OTO K;  3EZW A;  1HJR A;  2HHS A;  4EP4 A;  3WQT A;  4CEA A;  4FK4 A;  4HTU A;  1IKW A;  4UQG A;  4DR7 K;  3O9Q A;  4GMJ B;  4B9S A;  4E7K A;  4DV5 K;  4WF9 L;  2HOE A;  4DV4 K;  4E1M A;  2UUA K;  4FJM A;  5IWA K;  3VQP A;  4CJW A;  4IFY A;  3CJ1 A;  4DLG A;  2Q1N A;  4LF8 K;  2BH1 A;  3V9Z A;  3AAR A;  3HM8 A;  3TAM A;  2UUC K;  3SYZ A;  2QWO A;  1HNZ K;  2OZS A;  4M3X A;  4CJS A;  2NRR A;  5AQN A;  3LDP A;  3VTH A;  4WYB A;  4FZX C;  4FWR A;  2OTL N;  1S1X A;  1LW2 A;  3SPY A;  2O8B B;  3IAY A;  3I33 A;  2D5R A;  1RDU A;  3MMV A;  1WSE A;  5SZT A;  2DY4 A;  2LSN A;  2FBX A;  2NLX A;  4DG1 A;  3OBY A;  2W41 A;  5C12 A;  1SAZ A;  1RT2 A;  4UY8 O;  2Y1I A;  1VQN N;  4JKF A;  2P1J A;  3VQE A;  1HYZ A;  3CET A;  1UA0 A;  3VQ8 A;  4GVE A;  2PZS A;  4W5T A;  4DB3 A;  5IT9 O;  1BUP A;  4BRF A;  2ITM A;  1Q8I A;  4BR5 A;  5HP1 A;  1HKC A;  1MDU B;  4CGI A;  1KVC A;  3LAM A;  2XY7 A;  3V1O A;  3K9K A;  2GBZ A;  3TAR A;  4CEZ A;  2CH6 A;  3OHR A;  4XH4 A;  4DR3 K;  4E1J A;  2VG5 A;  4RW4 A;  1T7P A;  5C15 A;  3U9D A;  1EKE A;  5I42 A;  5FPD A;  3K0S A;  4AHU A;  1S9E A;  4I9L A;  3WXJ A;  2D1K A;  4QS9 A;  1HMV A;  4FM2 A;  2G8V A;  3HP9 A;  3H45 C;  3E9P A;  4H03 B;  5FRN A;  3C6U A;  5AZI A;  2O8C B;  1E4G T;  4G1Q A;  3BEX A;  4DTU A;  4DQR A;  1Q86 O;  2P9S A;  5AQX A;  2KLA A;  1NJI O;  3UE5 A;  5M1N A;  3TSP A;  4B08 A;  1GLC G;  4IJA A;  4M3W A;  3EL2 A;  2P9I B;  4CD3 A;  4IO9 L;  4FJ5 A;  3LAL A;  3RWU A;  3CCL N;  3QEW A;  3OS2 A;  3AVF A;  3ZT1 A;  4OPH A;  4IEI A;  1LOT B;  3JSM A;  2NZT A;  2OPS A;  3WNF A;  3HSC A;  4ILG B;  3WNE A;  3TAE A;  3AVL A;  2GV9 A;  5KRT A;  2QWQ A;  4OGC A;  3V9U A;  2DTU A;  2CGJ A;  4DU3 A;  2ZJR L;  1I3A A;  1IH7 A;  3DLG A;  3GBT A;  1HQU A;  1GOB A;  3NGZ A;  5E41 A;  1MWK A;  3LP3 A;  3KWG A;  4ISG A;  1SKW A;  3D6R A;  3U3Y A;  1XC3 A;  2QI2 A;  3ZSR A;  3FFI A;  4XH1 A;  3A5M C;  4JKG A;  1EET A;  2BE2 A;  3OJU A;  3DLE A;  3LDS A;  1C0G A;  4I7F A;  5HRS A;  5M1K A;  3MN5 A;  5AZJ B;  4AHT A;  4K8X A;  3R9P A;  1NK8 A;  5FLX O;  2E20 A;  3ASM A;  1FJG K;  4Z4H A;  3SJJ A;  1C1B A;  3K5N A;  1C1C A;  1QHT A;  4C8K A;  5KGW A;  5AQJ A;  1TK0 A;  4MLE A;  3KLE A;  1XMO K;  1NOY A;  4BE1 A;  3NF9 A;  2HHT A;  1G15 A;  3CCR N;  1GLL O;  1YTU A;  5DMR A;  4OVL A;  4CHN A;  3AVB A;  1U49 A;  4LFA K;  3VTI A;  3AY9 A;  3QEI A;  1HUX A;  3K5L A;  4W5R A;  2P5O A;  1OH6 A;  1KLN A;  2I7P A;  4A62 A;  4H0V B;  1RT3 A;  4BC5 A;  2Q97 A;  1QTM A;  4GV3 A;  4B3O A;  4NB4 A;  3AO1 A;  3AGK A;  3DXM A;  4DCH A;  4JRQ A;  1NG9 A;  1U2V B;  5AQK A;  1XMQ K;  3E66 A;  2P9L B;  2NNW A;  3SUQ A;  1IKY A;  2IVO A;  1DTT A;  3V4I A;  2OAN A;  3VA0 A;  1RNH A;  4H5V A;  3HPO A;  4ELV A;  4B1X B;  1DTQ A;  4K43 A;  3G71 N;  2FC0 A;  2ZQB A;  4K25 A;  5AZI B;  4B3S K;  1K8K A;  4FJN A;  3WXL A;  4IDK A;  1VAZ A;  2IDO A;  3ZYY X;  3PX4 A;  4EP5 A;  3VA3 A;  3F2K A;  3VQQ A;  3ZSO A;  3ZT0 A;  1YIT N;  3HRG A;  2OPP A;  1WSF A;  3H08 A;  5BR8 K;  3CHW A;  1RTI A;  5GAE P;  4MLH A;  3LWL A;  3VPZ A;  4HUF A;  2UXD K;  1XUP O;  1Y64 A;  3VEV A;  4OPJ A;  4CHO A;  4IOA L;  4RTF D;  3AA5 X;  4K0K K;  4YDU C;  2NUB A;  2D0A A;  1W7A A;  4IG3 A;  2FBY A;  3ZSV A;  3PSF A;  1S6Q A;  3HST B;  3S41 A;  5J2P A;  4ISE A;  3WNG A;  2NRH A;  3TAF A;  1HNX K;  2O8D A;  5CR4 A;  3THW A;  4QS7 A;  1BCM A;  1NKC A;  1IJJ A;  4RW7 A;  3O4N A;  2JWK A;  3TAN A;  2YNI A;  3O8M A;  2P9P A;  4H5W A;  4CZI A;  3ULE B;  3ZET B;  1T6D A;  5M1F A;  4CGD A;  3A2F A;  3SCX A;  3O4W A;  4EFH A;  3MK6 A;  1QSS A;  4CJ4 A;  3SPZ A;  1KC8 O;  1OH7 A;  2F8S A;  2FBV A;  1SL0 A;  2XRI A;  4M3U A;  2I7N A;  2A40 A;  1SKS A;  3ZLJ A;  4LH4 A;  5C25 A;  4CJU A;  4FJ8 A;  1TV6 A;  1BQM A;  3AA3 A;  2WOM A;  5CE3 A;  4ZTF A;  2RN2 A;  3U9Z A;  4BRE A;  4FLT A;  1XHZ A;  2DFE A;  4AHV A;  1K8A O;  4KHU A;  2HBM A;  4PKG A;  4KTQ A;  3CC4 N;  1S3X A;  3QER A;  4FPA A;  2KZM A;  1KVA A;  1C0F A;  2A5X A;  4B1V A;  3S9H A;  3UKU B;  3QIP A;  3NF6 A;  4B9Q A;  3GDQ A;  1RDB A;  5AQL A;  4KHP K;  4H0O A;  1VQ4 N;  4N41 A;  3PIP L;  2IGI A;  4BRD A;  4BGB A;  2BUP A;  3DMJ A;  3QET A;  2RE2 A;  3D2E B;  2HND A;  4E89 A;  1RT7 A;  1YUW A;  3HP6 A;  1SUQ A;  2O8E B;  2O8F A;  3FZM A;  4EZ6 A;  5C24 A;  1LW0 A;  1WBD A;  1K8K B;  1X9W A;  4DSK A;  3SUN A;  2VGM A;  3AVJ A;  3CFP A;  1J9A A;  4B9L A;  4DFK A;  2Z1J A;  3I8D A;  4BQL A;  2OTJ N;  2UXB K;  4BAC A;  2QWP A;  4M3Z A;  4BRO A;  1F21 A;  4E3S A;  1L5U A;  3CM5 A;  3K57 A;  4IO8 A;  1WSJ A;  3MWT A;  3HOT A;  1WSI A;  4LF4 K;  2GEL A;  4YOT A;  2UUB K;  2PYJ A;  3MEG A;  3HTV A;  4LF9 K;  1X9S A;  4WCE L;  1VSD A;  3B6O A;  3DLL L;  2HHV A;  3P5J A;  3ZSQ A;  1J6Z A;  1SL2 A;  1DKG D;  4ZTJ A;  1RT1 A;  1KFS A;  1TYQ B;  3AO5 A;  2KFN A;  3J8A A;  3TAB A;  3H46 O;  5TKY A;  3THW B;  3IUC A;  4X64 K;  4IKF A;  4BR7 A;  4EIA A;  2A42 A;  1VQ6 N;  2HNY A;  1TL1 A;  2YKN A;  3AVN A;  4O5B A;  4DR5 K;  4GW6 A;  1NGI A;  1NNE A;  4YOY A;  4DV3 K;  3AVG A;  2CGL A;  3J7A P;  2ASP A;  1MA9 B;  4B1W B;  5HRO A;  4DTX A;  3PX6 A;  4WFA L;  3EN9 A;  4NCB A;  4RW8 A;  4AM6 A;  4KPY A;  1NGA A;  4O8U A;  3RMD A;  2HHX A;  4IBN A;  1XQS C;  4LSL A;  4CEC A;  1NK4 A;  2HW3 A;  3G25 A;  1X9J A;  3OYE A;  4DTP A;  1KD1 O;  2G8W A;  1XHX A;  1LWE A;  5BRE A;  1NJY A;  4OO1 J;  3FR0 A;  1RBU A;  4FVU A;  3MWP A;  4JI4 K;  3ZT3 A;  4KI4 A;  4GV9 A;  3SNN A;  4QS8 A;  1TKZ A;  2VYP A;  4IG0 A;  2X74 A;  1WAF A;  3O3F A;  2G8U A;  2P5G A;  3CCV N;  4N76 A;  3RR7 A;  3OYJ A;  4DLE A;  4I6M B;  4DTS A;  1GLB G;  1TKX A;  4E7J A;  1L3V A;  1J54 A;  1SL1 A;  4CFB A;  4C23 A;  1W9H A;  3SMS A;  4FLV A;  3NF8 A;  1LWF A;  2IVP A;  1EXQ A;  3F9M A;  3DM2 A;  4DR2 K;  1VSK A;  2BTF A;  5JLH A;  3G10 A;  5AQW A;  4Z4E A;  5HLF A;  3EE8 A;  3HPG A;  4WQ4 C;  1TKD A;  4AHS A;  1IG8 A;  3TAG A;  4BR4 A;  4CEE A;  3WEE B;  3TTF A;  1GLD G;  1VK0 A;  5KQ8 A;  4OGE A;  2VGN A;  4FOI A;  1IBL K;  2P51 A;  2PY5 A;  4FVM A;  5AQR A;  1C1A A;  1CLQ A;  4H0T B;  1S1U A;  1S9G A;  2ITG A;  2YHY A;  3D2F B;  4KTZ A;  3VQ5 A;  2X78 A;  3VQC A;  1QQO A;  1NK9 A;  1IBK K;  4CGJ A;  2P9U B;  2P9K B;  3R6M A;  1EX4 A;  3M3Z A;  1BL3 A;  3P31 A;  3P39 A;  2FF3 B;  1HYV A;  2F9T A;  1NBW A;  4CZE A;  4DQS A;  3DOK A;  5BPN A;  1JCG A;  4R79 A;  1ZBI A;  4LF7 K;  1RBR A;  3KVG A;  4H0Y B;  3QIC A;  2HMI A;  1D8Y A;  3OYM A;  1L3U A;  2GWJ A;  2QM1 A;  1NK6 A;  1ZBL A;  3CCM N;  4FWO A;  3KJV A;  4CF0 A;  2VWB A;  5C2F A;  3A0I X;  3OYF A;  1NJX A;  1T3V A;  4MDA A;  4CFA A;  1DEJ A;  2PBD A;  3HVT A;  5CHI A;  4IFE A;  3H3N O;  2OPQ A;  3KTQ A;  1YTA A;  3M6G A;  5EOY A;  3ATU A;  3V1Q A;  4YOV A;  1UA1 A;  3F5T A;  3QB0 A;  1YT3 A;  4LD0 A;  1MWM A;  3OYG A;  4OLB A;  4ID1 A;  4JD2 B;  1P8Z A;  5T7B A;  1ZBH A;  4DHY A;  3BZC A;  1N5Y A;  4Z4C A;  3LZJ A;  1CXQ A;  3D0P A;  3MX2 A;  1NK0 A;  1YJN N;  5FPE A;  4CHQ A;  3G0Z A;  2Q0U A;  4B9U A;  1V4T A;  3QEX A;  4KTW A;  3OYD A;  1NOZ A;  3VF6 A;  4U7B A;  1WLJ A;  3HYF A;  1VHX A;  1QHA A;  3DLB A;  3BUZ B;  2QA4 N;  3L2U A;  4DQ8 A;  3T1Y K;  4JV5 K;  4I2P A;  1RGI A;  3KK1 A;  2E6L A;  1YIJ N;  5AFU H;  1U6Z A;  4CJ3 A;  2A1S A;  4KHQ A;  1RBV A;  3V9W A;  4CBU A;  2QWN A;  4BR9 A;  1BGX T;  1WOQ A;  2ASO A;  4W5N A;  1ZBF A;  3CCJ N;  3PLA A;  2OCE A;  3VEN A;  2HHQ A;  3FE1 A;  2ZWH A;  1NKB A;  1BG3 A;  4DF8 A;  3N4P A;  1JLQ A;  4CZJ A;  4WE1 A;  1BIS A;  3KIO A;  3MEE A;  1VQM N;  1FKP A;  3NAE A;  3SJH A;  1Q81 O;  1KSP A;  3BP8 A;  3MN6 A;  1JLB A;  3ID6 A;  3CMA N;  4DUY K;  4WQ4 A;  1NJW A;  5AQZ A;  4B3T K;  1Z6R A;  1IV0 A;  3VEO A;  3QNN A;  4FYD A;  1Q18 A;  4DR4 K;  3OYN A;  4DQI A;  4F4K A;  4BVP A;  3GL1 A;  1NU0 A;  2HBJ A;  3EO3 A;  3T3F A;  2V52 B;  1ZYQ A;  1K73 O;  1JCE A;  1Y97 A;  1KAY A;  5HRP A;  4DTN A;  4BDZ A;  4E7I A;  3ZEU B;  4DS4 A;  3HZ6 A;  4M7Y A;  4DKW A;  4EAH D;  2HBK A;  3SQ1 A;  5ADX H;  5FDL A;  1BI4 B;  3H6E A;  4M63 C;  1JLC A;  3AVM A;  3P83 D;  1FK9 A;  2R7Y A;  3KZB A;  4H0P A;  2KTQ A;  3CC2 N;  1FKO A;  1VQL N;  4MQ3 A;  3JAM O;  5JVH L;  4FCY A;  3O3G A;  4KRF A;  3HXM A;  5EXW A;  3NH1 A;  4F8R A;  3D45 A;  4HUG A;  3RSE B;  4JK9 A;  3P1G A;  5EX5 A;  3OYB A;  4DS5 A;  1SQK A;  5AQU A;  3M8Q A;  2F9W A;  4JNE A;  1KXP A;  1YJW N;  2D0O A;  3HPH A;  4H0X B;  5EVZ A;  5K14 A;  1SV5 A;  3J7Z O;  2ZE2 A;  4DSI A;  1FW6 A;  3QO9 A;  4EHT A;  1JXE A;  3LAN A;  2KKZ A;  3SAG A;  3VQ7 A;  3L6Q A;  4NYF A;  3L0Q A;  2AJQ A;  3M5R A;  4I2Q A;  1WSG A;  4DTR A;  3BF3 A;  3I0S A;  3MXI A;  1JLA A;  4BE0 A;  5KI6 A;  4CIF A;  4J2B A;  4HWI A;  2FLO A;  3LDN A;  3R1X A;  3ENB A;  4CER A;  3F9K A;  3C6A A;  4MO4 A;  5AQV A;  1EO1 A;  5C10 A;  4CZL A;  4DR6 K;  1LAV A;  4BRK A;  3LL3 A;  3SQ2 A;  4PL8 A;  2F8T A;  1U04 A;  3K9J A;  1M90 O;  4CZH A;  4BWJ A;  3I56 N;  2D0B A;  3AV9 A;  3ITH A;  4CEO A;  3TSQ A;  3K5O A;  2XHB A;  1K9M O;  3SQ4 A;  4JKE A;  3I0R A;  3SBT A;  1BA0 A;  1EQY A;  1G99 A;  2A41 A;  2OA8 A;  4A5A A;  4ILJ A;  1KTQ A;  4FWN A;  4EZ9 A;  1S22 A;  3THY A;  1XI1 A;  4FSV A;  3ZT2 A;  3CXC M;  3P38 A;  3QEP A;  3SBG A;  2XY6 A;  4JKB A;  1CXU A;  4B8A B;  3WNH A;  5LY3 A;  4DQQ A;  3CM6 A;  3CI5 A;  3U6F A;  3VQD A;  3DLH A;  3UIQ A;  1TGO A;  2AP1 A;  3OS0 A;  1DGK N;  3MED A;  2YHW A;  3T7Z A;  1NGH A;  4E19 A;  3M8R A;  3QFP A;  1NGG A;  3QML A;  2AA4 A;  4CGF A;  4CVN E;  1RDC A;  1MU2 A;  5GIO A;  2VQE K;  3I55 N;  4RCH A;  4AH9 A;  3Q7B A;  4KO0 A;  2E5L K;  2P9S B;  2FSK A;  4FK0 A;  3VQ9 A;  5BPM A;  3AAQ A;  5KPR A;  4DSJ A;  3OYL A;  2B6A A;  2WTU A;  2YKM A;  3IMX A;  4PY5 A;  3MEC A;  2G8I A;  4PL7 A;  2CGK A;  3KK3 A;  1RCH A;  2IOC A;  1NJZ A;  2GUP A;  3NF7 A;  1VSE A;  2CH5 A;  3VQ4 A;  4RW9 A;  4QAG A;  4DV0 K;  4JKC A;  3A5L C;  4FLX A;  3FZH A;  4NYN A;  2A3Z A;  3PIO L;  3NGY A;  5JVG L;  3U8X A;  3SI6 A;  2P9N A;  1M1K O;  1BIZ A;  2ZGY A;  3CC7 N;  3KD1 E;  4CJK A;  2O4I A;  3UKR A;  1HPZ A;  5F0X A;  1TK8 A;  2EWS A;  3DJC A;  4IDH A;  1HLU A;  3NGI A;  3LDO A;  4M45 A;  3N4Q A;  4A5B A;  3SQ0 A;  4JKG B;  5H1S Q;  2YV0 X;  4TSX A;  4F9O A;  3OBW A;  3O9R A;  2EHG A;  4FLZ A;  2YNF A;  4I9Q A;  4MDB A;  2X6N A;  3M8S A;  4IFV A;  3LZI A;  3THX A;  4FJL A;  3EKU A;  2Z1I A;  4GV6 A;  1Z26 A;  1OKJ A;  2YHB A;  3C6T A;  4CFD A;  1GOA A;  4DTJ A;  1QSL A;  3ISN C;  1IBM K;  2NRT A;  4GY2 B;  2EX3 A;  2J4R A;  2QWM A;  4BR0 A;  4CJ5 A;  3LM9 A;  2A1R A;  2NRW A;  3O9S A;  2VQF K;  1QSY A;  1B9F A;  3JXU A;  1NGJ A;  3DXM B;  1B9D A;  5KGX A;  5DM6 L;  2HST A;  3LP2 A;  4FJJ A;  1YVN A;  1IKX A;  3J80 O;  2QXL A;  5CY4 A;  4F3T A;  2GWK A;  3LPU A;  5LL6 Z;  1BU6 O;  3SAF A;  4O4G A;  2HHU A;  4KH4 A;  2FBT A;  4KAZ A;  1W97 L;  2KW4 A;  1Q9X A;  1RTH A;  3KHY A;  3EE9 A;  5FRO A;  4CHZ A;  5AQO A;  4Z4I A;  1KLM A;  3FLC O;  2A6A A;  3EKS A;  4DMN A;  1RTD A;  3VQA A;  2YHA A;  2HMP A;  4ELT A;  1ITG A;  1T6C A;  5AQQ A;  4HTL A;  3C65 A;  1TUU A;  4WQ5 C;  3G6E N;  5HBM A;  1WNS A;  1QZ5 A;  1S1W A;  1OH5 A;  1HQE A;  1L3S A;  4OJR A;  1Z25 A;  5B8H A;  1O13 A;  1J5O A;  3PX0 A;  4H8K A;  4JS5 A;  3B6P A;  5E26 A;  4JKA A;  1TKT A;  2HVH A;  3NVK A;  4FOE A;  3QIO A;  2IIR A;  3CF5 L;  1NGE A;  4AHR A;  1WSH A;  3V6D A;  1ZBU A;  1RT5 A;  4DU1 A;  4ID5 A;  3VF2 A;  4C8O A;  5C0Y A;  5SWM A;  3QBW A;  5FPM A;  1HJO A;  1NMN A;  2ETJ A;  3ALY A;  3E1Y A;  3RMA A;  5J1E A;  4IOC L;  4LSN A;  3MCA B;  4A2A A;  2ZJP L;  1I94 K;  3LP1 A;  4CI6 A;  2O8D B;  3R3L A;  1I39 A;  1ZC6 A;  4FZY A;  3IKM A;  1RBT A;  5LMU K;  1ASU A;  4KRE A;  1WN7 A;  3L4I A;  3PO5 A;  4CJR A;  4YDU A;  3TAQ A;  3ZT4 A;  1VRT A;  2YJE A;  1N36 K;  2P9P B;  4KHS A;  4KI6 A;  1JLG A;  1VQ7 N;  2RHK A;  1XNQ K;  5AQT A;  4DWI A;  4CZK A;  4QCL A;  2OYQ A;  4OPK A;  1S1V A;  4HVJ A;  3KLI A;  5EU7 A;  1RDW X;  1ZBS A;  4FWQ A;  4CGG A;  3SUO A;  3T1H K;  4A57 A;  2UU9 K;  3F73 A;  3VN5 A;  4BRA A;  3U3G A;  3OVN A;  4NLC A;  2KZZ A;  4E0D A;  2ZD1 A;  4JI3 K;  1XC9 A;  5CZ1 A;  4FPB A;  3HI0 A;  4NXN K;  2XO7 A;  3PO4 A;  4IXC A;  1U4B A;  3VGL A;  4J2D A;  4BG8 A;  1ZXO A;  4JS4 A;  3ATV A;  3KK7 A;  4FLY A;  4JHD A;  3O5B A;  3PSI A;  3ENH A;  3SK3 A;  4OLA A;  5I3U A;  3SZ2 A;  3OYK A;  1OVQ A;  3VEW A;  4Z4G A;  4A2B A;  3NVM A;  3O80 A;  1HKG A;  1B92 A;  2HHW A;  4FL9 A;  3TSU A;  2O8F B;  1J5E K;  4B9M A;  3O4Q A;  5A2Q O;  4L3Q A;  1A5W A;  3QDK A;  4H4O A;  2KFZ A;  4CF9 A;  4CW7 B;  2KQ2 A;  3WXK A;  5KQD A;  4Z0U A;  4CZF A;  4B9T A;  1RFQ A;  1QZ6 A;  1T05 A;  4E1N A;  3HO1 A;  1EWR A;  4JRP A;  4CES A;  4YFU A;  1LCU A;  3KLF A;  4RWT A;  3GE1 A;  2V7Y A;  4AQY K;  3MCP A;  5FPN A;  4B1Z A;  1RT4 A;  4H5R A;  3ENO A;  3O9T A;  1NGD A;  1BHL A;  1N32 K;  3OYA A;  3CQX A;  1TUY A;  3HM9 A;  2G8K A;  4HCB A;  4C8N A;  3L3U A;  2YI1 A;  1BWF O;  4FWK A;  4RG8 A;  2O8B A;  4LFC K;  1IKV A;  4NO7 A;  3H1Q A;  3CQY A;  1KFD A;  4YOR A;  3QNO A;  3VEX A;  1LV5 A;  4BRG A;  1R59 O;  4BVO A;  4JN4 A;  4CJP A;  3OW2 M;  4BC2 A;  3RRH A;  3RVC A;  3BGR A;  4B3R K;  4CK3 A;  2ZF5 O;  4JI2 K;  1KVB A;  1KAX A;  3NH0 A;  1EWQ A;  5BRF A;  1YJ9 N;  4CD1 A;  4JI1 K;  3G4S N;  4AM7 A;  1SS6 A;  4M3Y A;  5BRD A;  3NBP A;  1H1V A;  3TPQ A;  4OKJ A;  2Z1G A;  3NHG A;  4C8L A;  3J7Y P;  1NM1 A;  4JKH A;  4BRH A;  4CBX A;  5C2D A;  1D9D A;  5BPL A;  3WT0 A;  5M1O A;  3C0B A;  3EZ5 A;  3H1V X;  1JLE A;  1TK5 A;  5CZ2 A;  4CIG A;  2G8H A;  3S3O A;  1VSJ A;  3CQ8 A;  3WUH A;  3DLK A;  1LWC A;  1NMD A;  4RW6 A;  1D4X A;  3PV8 A;  4M3R A;  1QQM A;  3BDP A;  1S6P A;  2FF6 A;  2HF4 A;  4KFB A;  3V81 A;  4ICL A;  3CME N;  4JI7 K;  3VGK A;  4FJ7 A;  5AQM A;  5J2M A;  3IDH A;  1U45 A;  4DSL A;  1E3M A;  3GG4 A;  3NH2 A;  1WB9 A;  2YNG A;  3K58 A;  3QEV A;  5JS2 A;  3DRS A;  4C8M A;  1VQP N;  4B8C A;  3B8A X;  1WUA A;  2QWR A;  2FXU A;  2VWJ A;  2P9I A;  1RDD A;  4DQP A;  2FSN A;  2UXC K;  1VSH A;  4JI6 K;  3DRP A;  5AQP A;  4BRQ A;  3BZK A;  2O4G A;  1X3M A;  4FZZ A;  3V1R A;  3RRG A;  2PAV A;  4G9Z A;  4R5P A;  3IFR A;  4X62 K;  4BRI A;  3QLH A;  5ELZ A;  3HL8 A;  1E4F T;  2DFH A;  1SKR A;  4CJF A;  4K8Z A;  4LC9 B;  1V4S A;  1NGB A;  3EEQ A;  4DSF A;  1YAG A;  1CZ9 A;  3CYM A;  4Z4F A;  1KCF A;  3U4L A;  2F4V K;  1CZA N;  2Q3S A;  4JEP A;  4DFJ A;  3TTC A;  1N6Q A;  5AZJ A;  3EYZ A;  5HRR A;  4YY3 K;  2QKB A;  3ZSW A;  1XWL A;  3LP0 A;  4YOU A;  4HUE A;  3FFK B;  1BOT O;  4HCC A;  3ZSX A;  4FWL A;  4DFM A;  4KHW A;  4DU4 A;  5MLC Q;  4CGH A;  3JYT A;  3RMB A;  2QEX N;  4BDP A;  3HT3 A;  1XNR K;  1YVU A;  2OPR A;  1HRH A;  4PA1 A;  1RBS A;  3E01 A;  3LDQ A;  2IVN A;  5JMV A;  3VGM A;  4N56 A;  1RT6 A;  2QTD A;  3SMP A;  5AJ3 K;  5GIP A;  4BRN A;  2RF2 A;  5GAH P;  2QW9 A;  4AIL C;  4JK8 A;  4BC3 A;  2OZM A;  3HBT A;  1U2V A;  5GIN A;  4KB0 A;  4KH5 A;  2P9L A;  4Y1D A;  1HYS A;  1Q9Y A;  1NKE A;  1JJ2 M;  2Q2R A;  3DAW A;  1A5V A;  3S3N A;  5J2Q A;  2DPN A;  3P4I A;  3V9X A;  4CJV A;  3LM2 A;  3TWH A;  3DXK A;  2Q36 A; 
#chains in the Genus database with same CATH homology
 2WON A;  4CHP A;  4CJL A;  3KD1 E;  2HNY A;  1TL1 A;  2YKN A;  1BI4 A;  3MXJ A;  4CED A;  4CJK A;  4Y1C A;  2O4I A;  3AVN A;  4O5B A;  4FJG A;  1HPZ A;  4GW6 A;  5DK5 A;  1NK7 A;  1GOC A;  4LH5 A;  1TK8 A;  3AVG A;  3ZSZ A;  4M3T A;  3L2R A;  3NGI A;  4ELU A;  4M45 A;  3PUF A;  5C42 A;  5HRO A;  3SQ0 A;  1X1P A;  2ATQ A;  4DTX A;  2YV0 X;  3PX6 A;  3K2P A;  4TSX A;  1IG9 A;  3LPT A;  3OYC A;  3AVA A;  4KV8 A;  2EHG A;  4NCB A;  4RW8 A;  1C0M A;  1TL3 A;  4FLZ A;  3SUP A;  2YNF A;  4KPY A;  2IAJ A;  3RR8 A;  4I9Q A;  3RMD A;  3SV4 A;  1EP4 A;  2HHX A;  4IBN A;  2X6N A;  2YNH A;  4LSL A;  1HJR A;  3NFA A;  5CYQ A;  3M8S A;  4IFV A;  4EP4 A;  3LZI A;  2VG7 A;  3ULD A;  2HHS A;  4CEC A;  4CEA A;  1NK4 A;  4FK4 A;  4HTU A;  1IKW A;  2HW3 A;  4FJL A;  4UQG A;  3OYE A;  2Z1I A;  4Q5V A;  2B4J A;  4DTP A;  3DRR A;  2G8W A;  5J2N A;  1XHX A;  1Z26 A;  2YHB A;  3C6T A;  4GMJ B;  1D5A A;  1LWE A;  4CFD A;  1GOA A;  3O3H A;  4B9S A;  4DTJ A;  1QSL A;  1NJY A;  3ISN C;  1RBU A;  3VQB A;  4E7K A;  3ZT3 A;  4KI4 A;  3LWM A;  1JL1 A;  2EX3 A;  3SNN A;  1ASW A;  3CFR A;  4E1M A;  1YTU A;  4O55 A;  4FJM A;  1TKZ A;  3VQP A;  4CJ5 A;  4CJW A;  4IFY A;  3EY1 A;  4IG0 A;  4DLG A;  2A1R A;  2XY8 A;  1C0T A;  2X74 A;  1WAF A;  3O3F A;  2G8U A;  3V9Z A;  2P5G A;  3L2W A;  2BDP A;  1QSY A;  1B9F A;  4N76 A;  1BCO A;  3TAM A;  3CG7 A;  3OYJ A;  1R0A A;  4DLE A;  3RR7 A;  1K6Y A;  3SYZ A;  4DTS A;  2OZS A;  4M3X A;  1TKX A;  1B9D A;  4CJS A;  4E7J A;  5KGX A;  1L3V A;  4FLU A;  4QOZ B;  4CJQ A;  1T03 A;  3KK2 A;  3LP2 A;  4FJJ A;  1J54 A;  4FZX C;  1SL1 A;  1IKX A;  4CFB A;  4CHY A;  1S1X A;  1W9H A;  5CY4 A;  4FLV A;  3NF8 A;  1LWF A;  4F3T A;  1EXQ A;  3LPU A;  1LW2 A;  3ZCM A;  5CYM A;  4CFC A;  3K59 A;  3SPY A;  3DM2 A;  4O4G A;  4J2E A;  1VSK A;  3IAY A;  3G10 A;  2D5R A;  4W5Q A;  2HHU A;  5SZT A;  4Z4E A;  1WSE A;  5HLF A;  2PYL A;  2FBT A;  2QK9 A;  4KAZ A;  2DY4 A;  2LSN A;  2FBX A;  3HPG A;  2KW4 A;  4DG1 A;  3OS1 A;  1Q9X A;  1RTH A;  5FRO A;  1TKD A;  4CHZ A;  4AHS A;  4Z4I A;  2E4L A;  1KLM A;  1RT2 A;  4CEE A;  3TAG A;  4AHC A;  4DMN A;  1RTD A;  3VQA A;  4M42 A;  2YHA A;  2Y1I A;  1VK0 A;  4ELT A;  1ITG A;  3MXM A;  4OGE A;  2P1J A;  2P51 A;  2PY5 A;  3VQE A;  1HYZ A;  3DYA A;  1UA0 A;  4FVM A;  3VQ8 A;  4FJI A;  1C1A A;  5HBM A;  1CLQ A;  2PZS A;  1WNS A;  5KRS A;  1S1W A;  4W5T A;  1HQE A;  3CFO A;  1L3S A;  4OJR A;  4ZHR A;  1S1U A;  1Z25 A;  1S9G A;  2ITG A;  1J5O A;  1BQN A;  4KTZ A;  3VQ5 A;  2X78 A;  1Q8I A;  4FW2 A;  4H8K A;  3PX0 A;  3VQC A;  5HP1 A;  1NK9 A;  4CGI A;  1KVC A;  3LAM A;  4JS5 A;  4CGJ A;  3B6P A;  2XY7 A;  1TKT A;  1JKH A;  2HVH A;  1EX4 A;  1CZB A;  3V1O A;  2GBZ A;  3QIO A;  3TAR A;  1BL3 A;  4CEZ A;  3L8B A;  2XY5 A;  3AVI A;  3THV A;  1HYV A;  4CE9 A;  3NCI A;  1REV A;  4DQS A;  3DOK A;  4AHR A;  1WSH A;  2VG5 A;  4RW4 A;  1ZBU A;  4O0J A;  3V6D A;  1T7P A;  1RT5 A;  3PY8 A;  1J53 A;  1ZBI A;  4DU1 A;  1RBR A;  4ID5 A;  4C8O A;  5SWM A;  2HMI A;  4Q0B A;  1EKE A;  5I42 A;  1ASV A;  1D8Y A;  3OYM A;  1L3U A;  3C95 A;  4AHU A;  1S9E A;  4I9L A;  1ZBL A;  4DTM A;  2ETJ A;  3ALY A;  1NK6 A;  3IRX A;  3RMA A;  5J1E A;  3KJV A;  4LSN A;  4CF0 A;  4CK2 A;  1HMV A;  4PUO A;  3LP1 A;  4FM2 A;  1I39 A;  4CCH A;  3OYF A;  1NJX A;  3AA4 A;  2G8V A;  3HP9 A;  4CK1 A;  4N5S A;  5FRN A;  4CFA A;  4FZY A;  5FRM A;  3C6U A;  3HVT A;  1RBT A;  4F2R A;  1ASU A;  1VRU A;  4KHN A;  4G1Q A;  4KRE A;  2OPQ A;  3KTQ A;  1WN7 A;  1YTA A;  3PO5 A;  4CJR A;  4DQR A;  4DTU A;  3ZT4 A;  1VRT A;  3V1Q A;  3TAQ A;  1UA1 A;  4KHS A;  4KI6 A;  2RKI A;  1YT3 A;  1JLG A;  4LD0 A;  3OYG A;  4OLB A;  1UOC A;  4ID1 A;  3LAK A;  2JGU A;  4DWI A;  4QCL A;  5T7B A;  1S1T A;  4B08 A;  1ZBH A;  4DF4 A;  2VG6 A;  4KB1 A;  4M3W A;  1N5Y A;  3AVH A;  2OYQ A;  4Z4C A;  3LZJ A;  4OPK A;  3LAL A;  4FJ5 A;  2QKK A;  1CXQ A;  1S1V A;  4HVJ A;  3D0P A;  4GVM A;  3RWU A;  2IS3 A;  1NK0 A;  4PWD A;  3KLI A;  3QEW A;  2VWK A;  3OS2 A;  3AVF A;  3ZT1 A;  1TVR A;  3JSM A;  1NK5 A;  5EU7 A;  4CGG A;  3SUO A;  4CHQ A;  2OPS A;  3WNF A;  3G0Z A;  4B9U A;  3F73 A;  3WNE A;  3QEX A;  3TAE A;  3VN5 A;  3AVL A;  4KTW A;  2GV9 A;  3T19 A;  5KRT A;  3OYD A;  3U3G A;  4OGC A;  1NOZ A;  3OVN A;  3V9U A;  1WLJ A;  2KZZ A;  2DTU A;  4FM0 A;  3HYF A;  4E0D A;  2BAN A;  4DU3 A;  1I3A A;  2ZD1 A;  1IH7 A;  1C0U A;  3DLG A;  3L3V A;  3DLB A;  4FJ9 A;  1HQU A;  1GOB A;  3L2U A;  3NGZ A;  3AO4 A;  5E41 A;  3LP3 A;  1XC9 A;  4I2P A;  5CZ1 A;  2KFZ A;  3KK1 A;  2E6L A;  1SKW A;  2XO7 A;  3U3Y A;  3PO4 A;  2BGG A;  1U4B A;  3AO2 A;  3ZSR A;  4J2D A;  4FJH A;  3FFI A;  4CJ3 A;  4JS4 A;  5JS1 A;  4FLY A;  4CEF A;  2A1S A;  2RPI A;  1EET A;  3RMC A;  4PQU A;  2BE2 A;  4OLA A;  3OJU A;  4KHQ A;  3DLE A;  3SZ2 A;  3LDS A;  5I3U A;  5HRS A;  1RBV A;  4I7F A;  3V9W A;  4MFB A;  3OYK A;  4M41 A;  3V9S A;  4AHT A;  4K8X A;  3KLH A;  4BWM A;  1BGX T;  1NK8 A;  4FXD A;  4W5N A;  1ZBF A;  3ASM A;  4E7H A;  4Z4H A;  1VSM A;  4FM1 A;  2HHQ A;  3SJJ A;  1C1B A;  3K5N A;  1C1C A;  4Z4G A;  1QHT A;  4C8K A;  1B92 A;  5KGW A;  1NKB A;  4DF8 A;  2HHW A;  1QS4 A;  1TK0 A;  3KLE A;  1JLQ A;  1NOY A;  4B9M A;  3O4Q A;  1BIS A;  3KIO A;  3DOL A;  1A5W A;  3MEE A;  4WE1 A;  4BE1 A;  3NF9 A;  4LY7 A;  2GUI A;  1G15 A;  2E6M A;  1FKP A;  4H4O A;  3T1A A;  3NAE A;  3MAQ A;  1BIU A;  4CF9 A;  5DMR A;  1KSP A;  2KQ2 A;  4F2S A;  4OVL A;  4CF8 A;  3IG1 A;  4Z0U A;  4CHN A;  4B9T A;  3AVB A;  1U49 A;  1T05 A;  1W0H A;  3HVR A;  2W42 A;  4E1N A;  1JLB A;  4NCG A;  3QEI A;  2P5O A;  3K5L A;  4W5R A;  3HO1 A;  4JRP A;  4CES A;  4YFU A;  1KLN A;  1NJW A;  3KLF A;  1C6V A;  1RT3 A;  2Z1H A;  1QTM A;  4B3O A;  3AO1 A;  2HNZ A;  1RT4 A;  3QNN A;  4FYD A;  4JRQ A;  1BHL A;  3AVK A;  3OYA A;  1RDA A;  3OYN A;  3TAP A;  1L3T A;  3HM9 A;  2X6S A;  4DQI A;  2G8K A;  3KKS A;  4F4K A;  4O44 A;  4HCB A;  4C8N A;  3L3U A;  4NCA A;  4RG8 A;  2D0C A;  3T3F A;  3SUQ A;  1IKY A;  1ZYQ A;  1DTT A;  3V4I A;  1HNV A;  1IKV A;  2IC3 A;  1JLF A;  4XIU A;  3VA0 A;  1RNH A;  1Y97 A;  1KFD A;  5HRP A;  3HPO A;  3QNO A;  4ELV A;  4DTN A;  4BDZ A;  4E7I A;  1LV5 A;  1DTQ A;  4DS4 A;  2FC0 A;  1O1W A;  4CJP A;  4CJT A;  2ZQB A;  3RRH A;  4CJE A;  1TAU A;  3BGR A;  4FJN A;  4OKK A;  4CK3 A;  4FW1 A;  3OYH A;  3SQ1 A;  4IDK A;  1JL2 A;  1KVB A;  2IDO A;  5KTQ A;  3PX4 A;  3L2V A;  3SV3 A;  4EP5 A;  3VA3 A;  3NH0 A;  5FDL A;  1BI4 B;  1DLO A;  3VQQ A;  3ZSO A;  4CEB A;  4BE2 A;  1U47 A;  3ZT0 A;  1JLC A;  2F96 A;  3AVM A;  1U48 A;  4M3Y A;  3P83 D;  1FK9 A;  2OPP A;  1WSF A;  3H08 A;  3NBP A;  4CF1 A;  2G8F A;  4OKJ A;  3LWL A;  1RTI A;  2Z1G A;  3NHG A;  2R7Y A;  2KTQ A;  4O0I A;  4C8L A;  4HUF A;  1D9D A;  1FKO A;  3KLG A;  1IO2 A;  5HRN A;  3OY9 A;  3EZ5 A;  4MQ3 A;  1JLE A;  3NE6 A;  2DFF A;  4OPJ A;  4CHO A;  4FCY A;  5CZ2 A;  3O3G A;  1TK5 A;  3KD5 E;  3HXM A;  3AA5 X;  4KRF A;  4CIG A;  2G8H A;  1X9M A;  3NH1 A;  4E7L A;  2QXF A;  3S3O A;  1VSJ A;  3D45 A;  2NUB A;  3CQ8 A;  4HUG A;  2D0A A;  4JLH A;  3DLK A;  4IG3 A;  1LWC A;  4RW6 A;  3PV8 A;  4M3R A;  2FBY A;  3ZSV A;  3P1G A;  3OYB A;  4DS5 A;  1S6Q A;  3HST B;  4FJK A;  3BDP A;  1S6P A;  3M8Q A;  4KFB A;  3AA2 A;  5J2P A;  3V81 A;  2B5J A;  1T8E A;  3WNG A;  3HPH A;  3TAF A;  3QES A;  5K14 A;  1SV5 A;  1WAJ A;  4ICL A;  2ZE2 A;  4DSI A;  1BCM A;  3QO9 A;  1NKC A;  4FJ7 A;  5J2M A;  1JXE A;  1VSF A;  4RW7 A;  3LAN A;  3O4N A;  1U45 A;  4DSL A;  3HK2 A;  3TAN A;  3VQ7 A;  4F3O A;  3VQ6 A;  3NH2 A;  1QQC A;  1QE1 A;  4CEQ A;  2YNI A;  1JXB A;  2YNG A;  4NYF A;  4DTO A;  3K58 A;  1RIL A;  3QEV A;  5JS2 A;  2AJQ A;  3DRS A;  4I2Q A;  1VSI A;  4C8M A;  1WSG A;  3A2F A;  4CGD A;  3DLR A;  4CIE A;  4B8C A;  3I0S A;  4DTR A;  4CJ4 A;  3SCX A;  1QSS A;  3MXI A;  1JLA A;  3SPZ A;  2VWJ A;  3TR8 A;  4BE0 A;  5KI6 A;  4CIF A;  1RDD A;  2F8S A;  1HNI A;  4DQP A;  2FBV A;  4H4M A;  4KKO A;  4J2B A;  1VSH A;  4CER A;  1SL0 A;  3F9K A;  2XRI A;  4M3U A;  3HJF A;  3DRP A;  1SKS A;  1LAW A;  4LH4 A;  1LAV A;  5C25 A;  2O4G A;  3SQ2 A;  4CJU A;  4FJ8 A;  4FZZ A;  4HHT A;  3V1R A;  1TV6 A;  1U04 A;  3RRG A;  2F8T A;  1BQM A;  4R5P A;  1KRP A;  4DFP A;  3AA3 A;  4BWJ A;  2WOM A;  2D0B A;  3AV9 A;  3ITH A;  4CEO A;  4B9N A;  3QLH A;  3K5O A;  2XHB A;  4ZTF A;  3HL8 A;  3NDK A;  4FK2 A;  3SQ4 A;  2RN2 A;  4FLT A;  3TI0 A;  1XHZ A;  2DFE A;  3I0R A;  2DFH A;  4AHV A;  1SKR A;  4CJF A;  4K8Z A;  3DI6 A;  4KHU A;  3ZSY A;  4KTQ A;  3QER A;  2KZM A;  1KVA A;  2OA8 A;  1S5J A;  3S9H A;  3QIN A;  1KTQ A;  3QIP A;  3NF6 A;  3L2Q A;  4EZ9 A;  3IS9 A;  4DSF A;  1CZ9 A;  3S3M A;  3CYM A;  1RDB A;  4Z4F A;  1KCF A;  3M8P A;  1RTJ A;  1XI1 A;  2Q3S A;  4DFJ A;  4N41 A;  1N6Q A;  3EYZ A;  5HRR A;  2IGI A;  2QKB A;  3ZT2 A;  4FLW A;  3ZSW A;  1XWL A;  3DMJ A;  4OKE A;  3QET A;  4F8R A;  3QEP A;  3LP0 A;  1FXX A;  2HND A;  4HUE A;  1TAQ A;  2XY6 A;  4E89 A;  1CXU A;  1RT7 A;  4B8A B;  3WNH A;  3HP6 A;  1SUQ A;  3CM6 A;  3KKR A;  4W5O A;  4DQQ A;  3U6F A;  4HCC A;  4EZ6 A;  3VQD A;  3DLH A;  3UIQ A;  1TGO A;  3ZSX A;  5C24 A;  4YNQ A;  3AVC A;  1LW0 A;  3OS0 A;  4DFM A;  4KHW A;  1X9W A;  4DU4 A;  4DSK A;  3MED A;  3SUN A;  3OJS A;  3AVJ A;  4CGH A;  3CFP A;  3JYT A;  4E19 A;  3RMB A;  1J9A A;  3HT3 A;  3M8R A;  4BDP A;  4B9L A;  1YVU A;  2OPR A;  1HRH A;  4DFK A;  2Z1J A;  4PA1 A;  1RBS A;  4CGF A;  3I8D A;  5D3G A;  4L8R B;  1RDC A;  1MU2 A;  3E01 A;  4BAC A;  4AH9 A;  4M3Z A;  4KO0 A;  4CF2 A;  4N56 A;  1RT6 A;  1F21 A;  2HB5 A;  4E3S A;  3VQ9 A;  4FK0 A;  1L5U A;  3K5M A;  2Y1J A;  1A5X A;  3OYI A;  4DSJ A;  3CM5 A;  3K57 A;  4J2A A;  2RF2 A;  2HVI A;  1WSJ A;  4AIL C;  1WSI A;  3OYL A;  4FJX A;  2OZM A;  2B6A A;  4PY5 A;  2YKM A;  2PYJ A;  4KB0 A;  3MEC A;  3MEG A;  1D9F A;  2HHT A;  2JLE A;  4Y1D A;  1X9S A;  2G8I A;  1HYS A;  3AO3 A;  1VSD A;  3B6O A;  3C94 A;  3KK3 A;  1RCH A;  4DSE A;  2IOC A;  1Q9Y A;  2HHV A;  3P5J A;  1NJZ A;  2I5J A;  1UWB A;  3ZSQ A;  1NKE A;  1SL2 A;  3NF7 A;  3RTV A;  1VSE A;  1RT1 A;  4ZTJ A;  1KFS A;  3VQ4 A;  3AO5 A;  4RW9 A;  4KHY A;  2KFN A;  4QAG A;  3TAB A;  1A5V A;  4FLX A;  5J2Q A;  3S3N A;  4NYN A;  3NGY A;  3SI6 A;  3V9X A;  4N47 A;  4IKF A;  4BDY A;  1BIZ A;  4CJV A;  1UAX A;  1VSL A;  4B9V A;  3TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...