1KVBA

E. coli ribonuclease hi d134h mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCHELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
total genus 54
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvbA00
1NK8A 4Z4EA 2YNIA 3ZSXA 2PYJA 3DLKA 3M8RA 1TK5A 1DLOA 1TV6A 4KHNA 1TKZA 3VQPA 1TL1A 1LW0A 1JLBA 4DTUA 3ALYA 2A1RA 1I39A 4OGCA 1KVCA 1RT2A 3V1QA 1VSJA 3OYAA 1TK0A 4CF2A 3EYZA 4E7IA 3LAKA 4FXDA 1KSPA 1VSFA 3C6UA 4EP4A 3VQ9A 3V9WA 2F8SA 2QKBA 1C1AA 4QAGA 3HSTB 4R5PA 3NH2A 4H4MA 3TWHA 3LWMA 1TKTA 1K6YA 1ITGA 1X9WA 4NCBA 4LY7A 3KKRA 3NAEA 3AVLA 2FBXA 2IOCA 1RT5A 2X6NA 1S1TA 2YKMA 3M8SA 2OZMA 4OKJA 4M3ZA 4N76A 2BANA 5CZ1A 1QE1A 1C0UA 3OY9A 4C8KA 2G8UA 1X9SA 4FZZA 4ZHRA 2VG6A 3LDSA 3ULDA 2JGUA 1JLFA 1WAFA 1S6QA 5HROA 4CEAA 1HYSA 1BI4B 4I9LA 4DS5A 4B9LA 4BE0A 3VQQA 3MXMA 3K59A 4CHYA 3HL8A 1C1BA 3L2QA 1U47A 4DTRA 4CFBA 1LW2A 3SUPA 3TAQA 3V9UA 2XY6A 5FRNA 3ASMA 3L8BA 3OS0A 3OYJA 2VG7A 3L2WA 3HVRA 4M3YA 4AHRA 3OYKA 4E7HA 3PY8A 4FW1A 4B9SA 4KB0A 4CERA 3SQ4A 4FZYA 4CEEA 4DTSA 1S1VA 3AVJA 3WNHA 1T05A 1EP4A 2RN2A 2RF2A 3VQDA 1L5UA 3A2FA 3TARA 3QESA 1S6PA 4N56A 4PQUA 1RDDA 4JRPA 3SYZA 4M3TA 3TABA 2RPIA 3HPOA 3IAYA 4OKEA 4KRFA 4HCCA 4BE1A 1S5JA 2OPRA 3AVKA 3O4NA 1RBVA 3L2RA 4JRQA 1O1WA 3NHGA 4CEZA 3AA5X 4CF8A 4E89A 2Y1IA 2VWKA 3I0RA 4OJRA 4NYNA 4DS4A 3V81A 3HK2A 4CJKA 2O4IA 4E19A 4CCHA 5FRMA 3MECA 4KTWA 2EX3A 4FLUA 1XHXA 1KFSA 1NK6A 4OKKA 4O0IA 2D0AA 4H8KA 3T19A 3PO4A 4DQIA 3L3UA 4CFAA 4M3WA 2B4JA 3KLIA 1HNVA 5CYMA 4ZTFA 4Z0UA 2G8VA 3AVAA 3AA2A 3JSMA 3KK2A 1Z25A 1ZBIA 4B3OA 4CJVA 4ZTJA 1BGXT 3NGYA 3PUFA 3TAGA 3BDPA 1X1PA 2IGIA 2YNHA 4AH9A 4LSNA 1NJXA 2YHAA 1NK0A 2HHXA 1RT3A 3THVA 1FKPA 3ZCMA 4FYDA 3OJUA 4GW6A 2RKIA 1JLQA 3TANA 4FJKA 4W5NA 4RG8A 4DU1A 3ZSZA 4FK2A 3T3FA 4DF8A 1NJZA 1LAWA 2GUIA 2E6MA 2HNDA 4IDKA 4B9VA 4AHCA 4DTXA 3RMAA 1LWFA 3VA0A 5C25A 4O4GA 3K5LA 1QSSA 5HRSA 3V1RA 3M8QA 4FLTA 4DFJA 3S3OA 4FJHA 4DTJA 4Z4GA 3P83D 4OPKA 2F96A 3HP9A 5J2MA 4Z4IA 3DRPA 1HQUA 3PX6A 4YFUA 2R7YA 4ID1A 3QEWA 1IG9A 3HO1A 3CQ8A 3DLRA 4M3RA 4LH5A 3LP2A 2FBTA 3QIPA 3VQBA 1DTQA 1I3AA 1RT7A 3BGRA 3SNNA 4HTUA 3OYMA 1HJRA 3DRSA 4B8CA 4FM0A 1W9HA 4KHWA 4JLHA 3VQ5A 3IS9A 4FJNA 3ISNC 1SV5A 2KW4A 3NF6A 3S3MA 4OLBA 4Z4HA 2P5OA 2XO7A 2B5JA 3HVTA 4DFMA 4NYFA 3TAMA 4EP5A 3SQ1A 1J54A 1J5OA 1TKDA 3TAPA 1CXQA 4FLZA 2W42A 3NGZA 2D5RA 3KLEA 3MEDA 4BWJA 2HMIA 3RR7A 3SV4A 5HBMA 4FJ5A 1S9GA 3C6TA 3D45A 1UA0A 3L2VA 1WLJA 4BWMA 1Q9YA 3O4QA 4QCLA 4RW7A 4YNQA 1YT3A 4CFDA 3HM9A 2P51A 1EKEA 2Z1GA 4DSLA 1XHZA 1HMVA 4NCAA 1JXBA 4KHSA 1NKBA 3AO5A 4CJLA 3G0ZA 2FC0A 2Q3SA 3V1OA 1FK9A 1VSKA 3QEPA 4FK0A 4OLAA 3MEGA 1Z26A 4ICLA 1SKSA 1EX4A 5KRSA 3TR8A 3SQ0A 1WAJA 2FBYA 1T8EA 1TAQA 3DOKA 1C6VA 1SUQA 5SZTA 3OS2A 3ZSYA 3T1AA 3LPTA 1LAVA 4W5OA 3U3YA 4F3OA 1C0TA 4RW8A 5KGWA 1HPZA 4J2EA 2OA8A 4KHYA 4IFYA 2ETJA 4GMJB 1J53A 4LSLA 3S3NA 4PWDA 1Q9XA 4KFBA 3E01A 2Z1HA 3RTVA 3MEEA 4DU3A 1D8YA 3K5NA 1U48A 1U4BA 1TGOA 2DTUA 1IKVA 3P5JA 2G8KA 2PY5A 1YVUA 3SI6A 2YHBA 4J2BA 4CGGA 1W0HA 3OS1A 2ZD1A 2DFHA 4KREA 2XY5A 3VQ8A 2IS3A 3ZT2A 1HNIA 4CJ5A 3MXIA 4B9NA 4Q0BA 1NOZA 3H08A 2LSNA 1L3VA 5KTQA 3KLFA 3SV3A 2HHWA 1A5VA 1GOBA 1TVRA 2ITGA 1VRUA 1VSMA 3TI0A 3VQ7A 4DWIA 4CJRA 1VSEA 1L3SA 1BQMA 1SL0A 5DMRA 4FLYA 4DSFA 2IAJA 3ZSQA 4KAZA 1RTIA 3CFOA 2WONA 3RR8A 2YV0X 1L3UA 1L3TA 1VSHA 3VQ4A 4J2DA 1JL1A 1WNSA 4O0JA 3KD1E 1BIUA 1XI1A 3S9HA 3LP0A 3LZIA 1RBTA 1IKWA 1J9AA 1KTQA 2DFEA 4Y1CA 5J1EA 4JS4A 4FW2A 4B08A 1EXQA 3OYIA 3ZT3A 2D0CA 3CFRA 2XHBA 3NH0A 4FLVA 1G15A 1N5YA 3QO9A 1D5AA 3O3HA 2Z1IA 3VQCA 1D9FA 4W5QA 3OYDA 2G8HA 4CJFA 4FLWA 4CJWA 4C8LA 3QEXA 3HJFA 3OYHA 5FDLA 5K14A 4M45A 1RDCA 2BE2A 3DLEA 2QK9A 4ELVA 3SPZA 5FROA 1JL2A 1D9DA 3KK3A 3OJSA 4L8RB 3U3GA 4Q5VA 4CK1A 3EZ5A 5CZ2A 4FJXA 2OPQA 4AHUA 4FJ7A 2X78A 1VRTA 4CGHA 1SKWA 1RTDA 1R0AA 1S9EA 1ZBUA 1XWLA 4EZ6A 3TAFA 2E6LA 3K57A 2ZQBA 1BHLA 1VSIA 1QHTA 5KGXA 3OYNA 1NJYA 2O4GA 3AVIA 3DYAA 4H4OA 3PO5A 2F8TA 2QKKA 1C0MA 1RT6A 1N6QA 3AO4A 2PYLA 2X6SA 4DU4A 4HVJA 3NE6A 3SUQA 3K5MA 1RDBA 3AV9A 2YKNA 3C94A 4CHOA 3AO1A 3AA4A 2P5GA 1FXXA 3ZSVA 2IDOA 1FKOA 3CG7A 4BDZA 1JLAA 4KHUA 3L3VA 4M42A 3KIOA 2QXFA 3VQ6A 3SJJA 1CZ9A 2G8FA 2EHGA 4IFVA 5HRNA 1RT4A 3OVNA 4KO0A 1BQNA 3NH1A 4CK3A 2KZZA 4W5RA 1RBSA 1YTAA 2DFFA 5KI6A 3NCIA 4HUGA 4WE1A 1RBUA 1ASWA 4NCGA 4LH4A 1ZBLA 4CEDA 1LWEA 2I5JA 2OPSA 3WNFA 3HXMA 1IKYA 1MU2A 1WSIA 3DLGA 3RWUA 4AHSA 1BI4A 1WSEA 4CJEA 5HP1A 1SL1A 4DQPA 4IKFA 3KJVA 4C8NA 4CHPA 3OYLA 4BACA 1IH7A 4DQQA 3KK1A 2KTQA 3AO2A 1NKEA 1S1WA 3QERA 3HPGA 4DTMA 1BIZA 4FJLA 1Y97A 2HNYA 1X9MA 4FJIA 4CJUA 4FZXC 4CJ3A 4KB1A 3SUNA 1U04A 3ZSOA 1BISA 4QOZB 1F21A 4CEQA 4DLGA 1KFDA 4DSIA 4HHTA 4Y1DA 4CESA 1DTTA 3LPUA 1U49A 4F2SA 3RMBA 4FK4A 4E0DA 1B9FA 4M3UA 3PX0A 1RNHA 5HLFA 3LWLA 5E41A 4KHQA 4DMNA 1NK5A 5C24A 4DF4A 3NGIA 2G8WA 1RILA 2HB5A 1A5WA 1HYZA 4GVMA 4AILC 1IKXA 4F2RA 1WSFA 1T7PA 1GOAA 3NF8A 3QLHA 3JYTA 1QSYA 3AVHA 4BDYA 1ASUA 5SWMA 3LALA 3AVFA 3SCXA 1EETA 2ZE2A 4DTNA 4DFKA 3M8PA 1NKCA 3CYMA 2BGGA 2YNFA 3LANA 1A5XA 4OVLA 1TL3A 5EU7A 1CXUA 3QNNA 5J2QA 1QTMA 4M3XA 4DG1A 3LZJA 3VN5A 2HHTA 4F8RA 3ZT4A 4JS5A 4I2QA 3AA3A 3SZ2A 4FVMA 3AVNA 4E1MA 2NUBA 3DM2A 3ZSWA 1RBRA 3VQEA 3QIOA 4DQRA 2KQ2A 1QS4A 2Z1JA 2OZSA 4FJ9A 4E1NA 4I9QA 3O3FA 4KI6A 1LWCA 5HRRA 4N47A 3QNOA 2G8IA 2XY8A 3K58A 4CJQA 4C8OA 3SQ2A 1HQEA 1NK9A 3NF7A 5J2NA 4CJ4A 3F73A 2KZMA 4PA1A 4CJPA 2XRIA 3RRGA 5DK5A 3VQAA 4RW6A 4CF9A 3LAMA 3CM5A 3RMDA 1LV5A 1Q8IA 1RTJA 2P1JA 1RCHA 4CIFA 4CEBA 4I2PA 5T7BA 3OYBA 3OYCA 3TAEA 4MFBA 2KFZA 3D0PA 3NDKA 4CJTA 3CM6A 4DTOA 3U6FA 3AVMA 5JS2A 1WSJA 3CFPA 4CGFA 3EY1A 4OPJA 1JLGA 4HUFA 5JS1A 1BCMA 4CHZA 3HP6A 3K5OA 3PV8A 2HHVA 4RW4A 2GV9A 5CY4A 1U45A 2PZSA 4BE2A 1SKRA 4B9UA 2HHUA 3SPYA 4FJMA 4PUOA 2HVHA 3PX4A 1ASVA 3KLGA 2YNGA 1VSDA 1KVAA 5C42A 4AHVA 1XC9A 1QSLA 1KVBA 1QQCA 3MAQA 4XIUA 2D0BA 4F4KA 1WSHA 4CE9A 3QINA 1UA1A 3UIQA 3V9XA 4EZ9A 2JLEA 4CIGA 4O55A 4CFCA 1RT1A 3G10A 1JLEA 4FJGA 4F3TA 4KI4A 4ID5A 4MQ3A 4CGDA 2E4LA 2WOMA 4FCYA 4E7LA 4KV8A 1JLCA 1TKXA 1IO2A 4KTQA 4CEFA 2KFNA 1TAUA 4Z4CA 3DI6A 4UQGA 3KD5E 1S1XA 1NK7A 4B9MA 4FJJA 4CF1A 4KPYA 1C1CA 1KLMA 3OYFA 5J2PA 4E7JA 1YTUA 3IG1A 2ATQA 3O3GA 1KRPA 1CZBA 2HNZA 3WNGA 1B92A 3I8DA 1VK0A 3HPHA 4J2AA 4HUEA 4M41A 4OGEA 3I0SA 3HT3A 1T03A 1VSLA 4IG0A 3P1GA 1BL3A 4DTPA 3DLHA 3F9KA 1ZBHA 5CYQA 3RRHA 1REVA 4FJ8A 4B8AB 2HHSA 1HYVA 2X74A 4CK2A 5D3GA 1KCFA 2VWJA 3V6DA 1TK8A 1B9DA 1UAXA 4HCBA 3DMJA 4RW9A 3AO3A 3DOLA 3V4IA 2HVIA 1JXEA 1WSGA 4I7FA 3WNEA 4CEOA 3AVGA 1S1UA 4B9TA 3KLHA 4K8ZA 4PY5A 5KRTA 3LP3A 4CHNA 4W5TA 4DSEA 1WN7A 4E3SA 3DRRA 3MXJA 2OYQA 4BDPA 3ZT1A 1BCOA 2A1SA 2OPPA 3B6OA 1HRHA 3B6PA 3ZT0A 4FM1A 3VA3A 3ITHA 3OYGA 2DY4A 4CHQA 4DSJA 1RDAA 3QEIA 3FFIA 3V9ZA 3QEVA 3OYEA 2XY7A 1UOCA 3ZSRA 4DFPA 2VG5A 1JKHA 1SL2A 4LD0A 4DSKA 4E7KA 5I3UA 4IG3A 4N5SA 4ELUA 3RMCA 2B6AA 4G1QA 4C8MA 5HRPA 2Y1JA 4K8XA 1CLQA 4IBNA 4FLXA 1ZYQA 3L2UA 4N41A 4CGJA 1ZBFA 3DLBA 4CGIA 4DQSA 1GOCA 4ELTA 4KKOA 4CECA 4CJSA 1NK4A 3HYFA 4AHTA 2GBZA 4O5BA 1KLNA 1NJWA 4Z4FA 4FM2A 4DLEA 2HHQA 3KKSA 3V9SA 3C95A 1RTHA 3IRXA 3SUOA 1UWBA 3K2PA 4KTZA 4O44A 1NOYA 4TSXA 3NFAA 4CF0A 2FBVA 2HW3A 2AJQA 3AVCA 3LP1A 3NBPA 2BDPA 5I42A 4CIEA 2IC3A 3AVBA 3QETA 3NF9A 3KTQA
chains in the Genus database with same CATH superfamily
1K8AO 4Z4EA 2ZJRL 3ZSXA 4JKHA 3ZETB 1TK5A 4QS9A 1TL1A 4JD2A 1TK0A 1WB9A 3V1QA 1RT2A 1VSJA 1YVNA 3LAKA 2F8SA 1KXPA 5EXWA 4R5PA 1HUXA 3MCPA 4A2AA 3LWMA 1X9WA 3UKUA 3NAEA 2YKMA 3DAWA 2OCEA 4OKJA 2CH5A 4FWLA 4JKGB 3SK3A 3J7AP 3ULEA 2G8UA 1X9SA 2FXUA 4WQ5C 1WAFA 2CH6A 1BI4B 4DS5A 3G25A 3I55N 3K59A 5ADXA 3HL8A 3L2QA 3D7EO 3TAQA 5FRNA 3ASMA 3OYJA 2E2PA 5AQLA 2W40A 3ATVA 4A61A 4DTSA 2IVNA 3AGKA 3AVJA 2RN2A 4CVNE 3CJCA 3W3DA 3A2FA 5KQDA 1ATRA 3QESA 1S6PA 4JRPA 3SYZA 2QA4N 4OKEA 3WXKA 5BN8A 4JI1K 3HK2A 3I0RA 4DS4A 2GX9A 2GTDA 4KTWA 2EX3A 4FLUA 3KK7A 1KFSA 4OKKA 4H8KA 2O8EA 3T19A 4O8UA 4AM6A 2E5LK 3E9OA 1HNVA 3G4SN 4ZTFA 1Z25A 4A57A 4B3OA 3TAGA 2P9NB 1YXQA 3BDPA 3GG4A 2IVOA 1FKPA 3ZCMA 4FYDA 2RKIA 3ZEUA 5JVGL 4RG8A 4DU1A 3ZSZA 3T3FA 4DR7K 1LAWA 4BQLA 4AHCA 3W0LA 4DTXA 4UY8O 4O4GA 5HRSA 3V1RA 4FJHA 1VQPN 3UE5A 1N8RO 2E2NA 4DCHA 5C12A 3DRPA 1NM1A 1XQSC 1HQUA 1HKCA 3PX6A 4ID1A 3DLRA 3DLLL 1I3AA 1BOTO 3DRSA 3EKSA 3SMSA 3VQ5A 4JK9A 5F2RA 3S3MA 2HSTA 2P5OA 2B5JA 3HVTA 2RHKA 4DV2K 1HNZK 4DFMA 1HNXK 1CXQA 3NGZA 3F9MA 1ZXOA 2HMIA 3O6WA 3LL3A 3O4QA 4YNQA 4H0PA 5LJVA 1EKEA 2Z1GA 3TPQA 1JXBA 2ZGZA 4KHSA 1XC3A 4CJLA 2FC0A 4A62A 2Q3SA 4NXMK 1FK9A 2HBLA 1VSKA 4ICLA 4BC3A 1WAJA 2FBYA 3CCRN 1SUQA 4YOVA 1GLFO 1FW6A 3BY5A 1C0TA 3HOSA 4RW8A 5KGWA 3CHWA 2OA8A 1E3MA 2GWJA 1J6ZA 4FWNA 4PWDA 1NGAA 3D2FA 4K43A 1TGOA 5EY4A 1W7AA 5C2FA 3OS1A 2ZD1A 4KREA 1GLDG 2XY5A 2IS3A 4MDBA 1HNIA 3ZT2A 2OTJN 2LSNA 1L3VA 3KLFA 4H5RA 4RWTA 3K9KA 3JAMO 3VQ7A 4CJRA 3TSPA 4FWQA 2O8FB 1Q18A 4KAZA 2WONA 4M7YA 1NNEA 3L4IA 1L3TA 3VQ4A 1WNSA 2BUPA 3S9HA 4CZMA 1RBTA 1KTQA 2DFEA 5J1EA 4H5TA 4FW2A 1T6DA 4B08A 1YITN 4QS8A 4ISFA 1U2VB 1TUUA 4GNIA 4PL7A 4MO4A 2Z1IA 1W2BM 3VETA 1Y64A 4C8LA 4FWMA 3OYHA 5K14A 5FROA 3AAPA 3KK3A 2P9SA 2D4WA 4Q5VA 5CZ2A 4FJ7A 2X78A 4B1WB 1R0AA 3CCSN 1N34K 2ZQBA 3OYNA 1QHTA 3PO5A 2O4GA 4JK7A 3QFUA 1RT6A 3OA9A 3AO4A 4DU4A 4DUZK 2YKNA 4KBOA 1FKOA 3CG7A 2RE2A 1JLAA 4KHUA 4M42A 2ZWHA 3PSIA 3DJCA 5A2QO 1BQNA 1VAZA 1RBSA 2DFFA 4LF9K 2E8AA 4FWSA 4JKGA 4BRHA 3VGMA 4B1UB 5BR8K 4CEDA 1LWEA 3HXMA 1IKYA 1ZBSA 4KH5A 4FO0A 3DLGA 3RWUA 3FGUA 1BI4A 4CJEA 1SL1A 2HOEA 3CJ9A 1NGGA 4CHPA 1YI2N 3MCAB 3SAHA 3QERA 3HPGA 4DTMA 3H6EA 2YJEA 5F1XA 1Y97A 1X9MA 4CJUA 4CJ3A 4KB1A 1U04A 1QZ5A 3LDOA 1BISA 2IVPA 1F21A 4CEQA 1KFDA 5CR4A 3RMBA 3U8XA 3PX0A 2A40A 3LWLA 4DMNA 3H1QA 3M6GA 4CJ7A 2HB5A 4JN4A 2VCPA 3JYTA 3AVHA 1IV0A 1ASUA 3LALA 3SCXA 2ZE2A 3M8PA 2BGGA 1ESVA 3HTVA 1CXUA 3QNNA 4M3XA 3LZJA 4FOEA 1XNRK 4ILJA 3VF2A 4YOYA 4E1MA 3MX5A 1RBRA 2PAVA 4BRGA 1QS4A 4I9QA 3O3FA 2P9IA 2G8IA 3CC4N 3SQ2A 1I94K 4CJ4A 4PA1A 2XRIA 5DK5A 3RMDA 4CF9A 3LAMA 3R9PA 1Q8IA 1V4SA 3OYCA 1DT9A 4CEBA 2E20A 5M1FA 3NDKA 4CJTA 3U6FA 3AVMA 1WSJA 3CFPA 4OPJA 1N32K 3OBYA 2P9LB 2V52B 4CHZA 4H03B 3PV8A 3S41A 2HHUA 2PZSA 4B9UA 4WFBL 3SPYA 1VQNN 4YHHK 1BU6O 1VSDA 2KKZA 4OO1J 3MAQA 2D0BA 4DV5K 1UA1A 3V9XA 2JLEA 1RT1A 3CMEN 4ID5A 4FCYA 3P31A 4BR2A 2QI2A 5KPZA 1NK7A 3DWLA 1KLMA 3IG1A 3WNGA 1B92A 4M41A 1VSLA 4IG0A 3P1GA 2D0OA 1BL3A 1ZBHA 2QEXN 3ENHA 1TK8A 1UAXA 1QVGM 1WSGA 3WNEA 1JCEA 3MDQA 4CEOA 3AVGA 5KRTA 4W5TA 4QS7A 3MN6A 2OYQA 3MXJA 1LOTB 3WXMB 1HRHA 3B6PA 3ZT0A 4FM1A 1P90A 3FFIA 5ELZA 1UOCA 3H3NO 3ZSRA 4EFHA 4DSKA 4E7KA 2WTUA 4ELUA 4C8MA 2Y1JA 3CJAA 4IBNA 4CGJA 2Q0UA 1P8ZA 1GOCA 4KKOA 2FSNA 1NK4A 2CGJA 4JAXA 1T3VA 4Z4FA 3KKSA 3KZBA 3CMAN 2O8FA 3Q7CA 3TSQA 4KTZA 5LY3A 4O44A 4TSXA 4CF0A 4E1JA 2BDPA 4DQ8A 3AVBA 1NK8A 1XUPO 4WYBA 1SQKA 1U2VA 1DLOA 1TV6A 3VQPA 4GV9A 1IJJA 4DTUA 3ALYA 2A1RA 1KVCA 4ILHA 2BH1A 3BUZB 3ZX2A 4E7IA 3C6UA 2P9KB 1QZ6A 2E2QA 1C1AA 3P4IA 1WUAA 4WQ5A 4LF6K 4BRQA 4H4MA 4CZGA 3BZCA 1K6YA 1ITGA 1NMNA 3A5NC 4MLHA 3KKRA 1M90O 4NCBA 2X6NA 3BEXA 1WBBA 1K9MO 3L4QA 4DR6K 4C8KA 2VQEK 4FZZA 2E1YA 4ZHRA 5BRDA 3ULDA 2JGUA 5HROA 4CEAA 4CI6A 4B9LA 1C1BA 4DTRA 2DPNA 1C0GA 2ASMA 3C7NA 4K42A 3ATUA 5AJ3K 3L8BA 2YX6A 3L2WA 3EO3A 1WOQA 4E7HA 3LM2A 3SJHA 4FW1A 3VEYA 3SQ4A 4CEEA 1S1VA 1EP4A 5M1QA 3VQDA 3QB0A 4JI7K 1L5UA 3ID6A 3TARA 4PQUA 1RDDA 4WFNL 2YJFA 5HOOA 2RPIA 4JYAK 3HPOA 3IAYA 4HCCA 2QXLA 2OPRA 3AVKA 2AA4A 3O4NA 1RBVA 3CCQN 3CPEA 1O1WA 2NRVA 5BR9A 4E89A 2Y1IA 1GLEG 3ZX3A 1IBMK 3THXB 3B8AX 1NK6A 4O0IA 5AQZA 4M3WA 2QWMA 5LL6Z 3E1YA 3JSMA 1NGBA 4ZTJA 3PUFA 3NGYA 1X1PA 2HHXA 2I7PA 4LSNA 3ZYYX 5AZJB 3L0QA 4KH6A 3TANA 4W5NA 1QHAA 1NJZA 4Z94A 1JJ2M 4IO9L 1LWFA 3K5LA 1QSSA 4FLTA 4DTJA 3WT0A 4Z4GA 4OPKA 2F96A 3C6AA 3HO1A 2R7YA 5AQYA 4JI4K 4M3RA 3SNNA 1DTQA 1RT7A 2W6KA 3O1WA 5AQVA 4FM0A 2WFBA 4JLHA 5AQXA 4G9ZA 3ISNC 3H1VX 1HPMA 3ZLJA 3TAMA 3G71N 2ZM6K 1J5OA 4O8KA 2H3GX 3M3ZA 3MEDA 4BWJA 3U9ZA 1Q82O 4BC4A 3C6TA 2P9LA 4B1ZA 3L2VA 1UA0A 4BROA 1Q9YA 4CZEA 4QCLA 2W6LA 1YT3A 4CFDA 3CCMN 4BQZA 4NCAA 1K73O 1NKBA 5BRFA 5C2DA 3QFPA 4JV5K 3MEGA 1SKSA 4MLEA 5CHIA 3TR8A 3SQ0A 3DOKA 3ZSYA 3T1AA 4W5OA 3U3YA 4F3OA 1HPZA 4J2EA 2KLAA 4KHYA 2ETJA 4LSLA 2HBMA 3KWIA 2ASOA 2Z1HA 3RTVA 5BREA 2G8KA 3SI6A 4J2BA 4CGGA 2ZJPL 1W0HA 3C65A 4Q0BA 1NOZA 1JCFA 4CZJA 5KTQA 4KH4A 2HHWA 1TVRA 3T1HK 1VRUA 1VSMA 1KQSM 3TI0A 4FPAA 4DWIA 2FLOA 1L3SA 1JCGA 4IJAA 1SL0A 1KC8O 5DMRA 4CBXA 4DSFA 4J8FA 2IAJA 4JKCA 3CFOA 4BRNA 2YV0X 1L3UA 1JL1A 4O0JA 1XI1A 2E1ZA 4H5VA 3LZIA 1J9AA 2KHOA 4Y1CA 2D0CA 4DV3K 4FLVA 4GVEA 1N5YA 3O3HA 2A5XA 1D9FA 2G8HA 2O8BB 4FLWA 3O9QA 3QEXA 5FDLA 3M1FA 1DKGD 3I8BA 1RDCA 2BE2A 1E4GT 1XNQK 4ELVA 4L8RB 4CK1A 4FJXA 3CF5L 4CGHA 2HHHK 1S9EA 3TAFA 5BRHA 3HZ6A 4BRIA 3DYAA 4H4OA 3QMLA 4IFEA 2QKKA 1N6QA 2PYLA 4FOIA 2VGMA 2F9TA 3WXIA 2D0PA 3SUQA 3AV9A 1OVQA 4JEPA 3AA4A 1VQLN 3VEVA 3PIOL 2KZZA 3NH1A 3CIPA 2HMPA 1FJGK 5GAHP 1YTAA 3NCIA 4JNEA 2YHYA 1Q86O 3O9RA 4HUGA 2HF4A 3HI0A 1RBUA 2Q1NA 4NCGA 2O8DB 4LH4A 3UB5A 5EOYA 1ZBLA 2I5JA 2OPSA 1QQOA 3WNFA 1O13A 1MU2A 4IKFA 4AHSA 4YORA 4DQPA 2QM1A 1VQON 2KTQA 4DQQA 3KK1A 2HBKA 4C23A 4CZIA 4FJLA 3VEOA 3SAFA 5AR0A 4C1NI 4JI5K 4DSIA 3IMXA 4DLGA 4FK4A 2Q36A 4NB4A 1HJOA 4JHDB 4JI3K 1RNHA 5HLFA 1GLJO 5E41A 1NK5A 3MX2A 5C24A 5IT9O 4O5FA 4L3QA 4AILC 1IKXA 4F2RA 4M63C 1QSYA 4BDYA 3EE9A 3PSFA 5SWMA 5AQMA 3THXA 1EETA 4DTNA 4NO7A 4DFKA 3K0SA 5AQOA 1NKCA 3LANA 4IWVA 4DG1A 3AA3A 1Q81O 2QWLA 1YIJN 4NXNK 1QVFM 2WC9A 3DM2A 3ZSWA 3HOTA 3TU5A 5HRRA 3QNOA 5AZJA 4K41A 4C8OA 4PKHA 2J4RA 1BDGA 1NK9A 5J2NA 3F73A 4DB3A 2KZMA 4CJPA 1TUYA 2PFUA 3DXMB 2VQFK 3GOIA 3VQAA 1LV5A 3FR0A 5T7BA 1BO5O 3TAEA 4I2PA 3LM9A 4MFBA 3VTIA 3D0PA 3O4WA 4DTOA 4BG8A 4BVPA 3FFKB 4CGFA 4CZKA 5JS1A 1H1VA 4IZ9A 1HNWK 1S22A 2GV9A 4RW4A 5CY4A 4FJMA 4PUOA 2HVHA 3PX4A 2F7TA 4AHVA 3HSCA 3THYA 4XIUA 2Q2RA 3QINA 3G10A 4JKDA 4BG9A 1G99A 4KI4A 2P9UB 4JI0K 3O8MA 2E4LA 3FZHA 4CEFA 4Z4CA 4B9MA 4FJJA 4KPYA 3ZETA 1NGJA 3OYFA 2HNZA 1VK0A 3HT3A 4OGEA 1KAXA 3OBWA 3DLHA 3RRHA 2NRWA 1HYVA 1KCFA 3V6DA 1B9DA 4HCBA 3V4IA 2HVIA 4I7FA 1OKJA 4K8ZA 1S1UA 3KLHA 1X9JA 1WN7A 3F5TA 3ZT1A 4BREA 3B6OA 1K8KB 3VA3A 3ITHA 4CHQA 4I6MB 2GEMA 3V9ZA 1SAZA 3N4QA 1SL2A 4LD0A 3T7ZA 5I3UA 1X3NA 4IG3A 3DXKB 3O80A 4IOAL 5HRPA 3C0BA 1IG8A 2ITMA 4FLXA 1ZYQA 3L2UA 4N41A 3BZKA 3PIPL 4BRFA 3DLBA 4CECA 4AHTA 1YJ9N 2ZF5O 2HHQA 4DLEA 1NU0A 3IRXA 3V9SA 1UWBA 3A5OC 5JICA 4LF4K 1NOYA 4OX9K 3NFAA 3WEEB 2HW3A 3H3OB 2AJQA 3VTHA 1NWKA 5I42A 4CIEA 5JMVA 2NRHA 3QETA 1BA1A 3KTQA 3DLKA 3M8RA 4KHNA 1LW0A 2CGKA 4EAHD 4BRPA 2O8BA 1T6CA 1VSFA 4EP4A 3V9WA 2QKBA 3NH2A 2HF3A 3TWHA 4HWIA 2FF3B 4MO5A 2P9NA 4YOWA 2Q97A 3AVLA 2IOCA 1RT5A 2OZMA 1S1TA 3M8SA 4N76A 2BANA 5CZ1A 1QE1A 5BPLA 4H0VB 3D2EB 2VG6A 1RDWX 3R6MA 3LDSA 1JLFA 5FPMA 1HYSA 4I9LA 4BE0A 3VQQA 3MXMA 4CHYA 5GAEP 1MA9B 3HRGA 4CFBA 1LW2A 3EEQA 3O1BA 2XY6A 3SUPA 3OS0A 3HVRA 2UYTA 4AHRA 3PY8A 4KB0A 4FZYA 4IDHA 4RTFD 4N56A 3AY9A 3MN5A 4JKFA 1NGDA 2P9PB 1YJNN 1NGIA 4BE1A 3VF4A 4CEZA 4DV1K 4NYNA 4CJKA 3I33A 4E19A 5FRMA 3MECA 3HM8A 1XHXA 1DEJA 3WXJA 2D0AA 4YDUC 3PO4A 4CW7B 4CFAA 1NGEA 4Z0UA 4AF1A 3AA2A 3O9UA 1ZBIA 4DV6K 3J7ZO 1BGXT 4JHDA 3MMVA 2IGIA 2YNHA 3IUCA 3O9SA 5M1KA 1NK0A 2GELA 3O5BA 1JLQA 3EE8A 2A6AA 5LJWA 2VYPA 2HNDA 4IDKA 3RMAA 2W41A 5C25A 4DFJA 3S3OA 4H0OA 3P83D 3HP9A 3J81O 4Z4IA 1SS6A 4YFUA 3QEWA 4LFAK 3CC7N 3LP2A 3VQBA 3QIPA 4JK8A 3BGRA 3RSEB 1HJRA 4KHWA 4B8CA 1W9HA 4BRKA 1DGKN 4X65K 4FJNA 4OLBA 2KW4A 2XO7A 3DXMA 4X66K 2O8CB 4RCHA 2OTLN 4EP5A 1J54A 1XMQK 4FLZA 3Q7BA 2W42A 3KLEA 3RR7A 3SV4A 4FJ5A 2QW9A 3D45A 4BWMA 1Z6RA 3HM9A 2P51A 4KHPK 4Y0WA 4DSLA 1XHZA 4DR5K 3AO5A 4DR4K 3QEPA 3KHYA 3P39A 1Z26A 1EX4A 5KRSA 1S72N 1T8EA 3BP8A 1TAQA 5C15A 3OS2A 2A41A 5SZTA 2F4VK 2P9UA 3EL2A 1LAVA 2VWBA 4YOTA 5AFUH 3ZX0A 4YOXA 5AQJA 3BF1A 5KPTA 4IFYA 4GKKK 1D4XA 5AQNA 1Q9XA 4KFBA 5CE3A 3E01A 1D8YA 4FWPA 3K5NA 1MWKA 4FWKA 1U4BA 3A5LC 5AQUA 3P5JA 2PY5A 1YVUA 4GV6A 3T1YK 3CC2N 3R1XA 3H46O 3TSUA 3SV3A 1GOBA 2ITGA 4PKIA 4BRCA 3VGLA 4BRLA 3QICA 3FZLA 1K8KA 4J2DA 4LC9B 3KD1E 3TTDA 3VERA 1BIUA 1VQMN 3LP0A 4A5AA 2HBJA 1IKWA 1J5EK 4H0YB 4BR7A 3DXKA 3OYIA 3ZT3A 4HTLA 2E2OA 3CFRA 2UUBK 2YI1A 1D5AA 2GUPA 1YAGA 1S3XA 1MDUB 4W5QA 3OYDA 5AQKA 4CJWA 3ID8A 3HJFA 4M45A 3DLEA 5AZIB 3SPZA 1D9DA 3OJSA 5EVZA 3WEEA 3EZ5A 5AQFA 4FPBA 1RTDA 1SKWA 2F9WA 5AQIA 1BHLA 1VSIA 5E84A 3J8AA 3AVIA 2UU9K 3O9TA 4HVJA 3NE6A 4BC2A 3K5MA 3C94A 4XH1A 3KWGA 5MLCQ 4H0TB 2P5GA 3ZSVA 2IDOA 4YY3K 2QXFA 3N4PA 1CZ9A 2EHGA 3OVNA 4KO0A 4CK3A 4W5RA 5KI6A 4BGBA 5AQSA 4WE1A 2UXDK 4LF8K 4IJNA 1Z05A 3CQYA 1WSEA 5HP1A 5KQ8A 4C8NA 3A0IX 4BACA 1IH7A 1NKEA 1S1WA 1BIZA 4FZXC 2E88A 3SUNA 3ZSOA 4Y1DA 4CESA 1DTTA 3MN9A 4FVUA 3PLAA 1ZC6A 4KHQA 2P9PA 4X62K 2G8WA 1A5WA 3CCEN 1HYZA 3E9PA 4GVMA 4X64K 1WSFA 5IWAK 4B1XB 4F9OA 4U7BA 4WQ4C 1X3MA 3AVFA 2UUAK 4FWRA 5TKWA 3CYMA 2Q31A 4CD1A 1MWMA 5ADXH 3QBWA 2NZTA 4EIAA 3VN5A 2HHTA 4F8RA 3ZT4A 3SZ2A 4I2QA 3CERA 3AVNA 3E9LA 2NUBA 4DQRA 3VQEA 2OZSA 2Z1JA 4FJ9A 4E1NA 4KI6A 3LDQA 2XY8A 3MN7A 2QWOA 4IOCL 3CXCM 3RRGA 3FZFA 4RW6A 3CM5A 4PKGA 2NRZA 4BR9A 2NRRA 4CIFA 3CM6A 4H5NA 3EY1A 1JLGA 4HUFA 1BCMA 3K5OA 2HHVA 2I7NA 1U45A 4BE2A 2Q0RA 3RSEA 3KLGA 1KVAA 1KVBA 3FLCO 4F4KA 4CE9A 3J80O 3UIQA 2O8CA 3LDLA 1GLCG 4FJGA 4F3TA 4MQ3A 2WOMA 4ISEA 1OVYA 1TAUA 1KAYA 3DI6A 4UQGA 3KD5E 3QBXA 2YHWA 4CF1A 1VQ7N 5AQQA 4E7JA 2FSKA 1KRPA 1EO1A 1HLUA 5AQWA 3HPHA 4J2AA 1T03A 3I0SA 3FE1A 2CGLA 1EQYA 2P9KA 3A8YA 3THWB 1T44A 4B8AB 2HHSA 2P9IB 5D3GA 2VWJA 3DMJA 4RW9A 3DOLA 5BPNA 1JXEA 1IBKK 4B9TA 4PY5A 3MWPA 4E3SA 3LP3A 2UXCK 3CCLN 1GLLO 2NRTA 5GIOA 2DY4A 3OYGA 5BN9A 4DSJA 1RDAA 3NVKA 3M5RA 3QEIA 1KAZA 3AAQA 2D1KA 4DFPA 1R59O 2VG5A 5GINA 2WUSA 4CZLA 3NVMA 3RMCA 4G1QA 2QWQA 3GDQA 3C6HA 5FPNA 4JKBA 3JXUA 4CGIA 4DQSA 4ELTA 4FL9A 4CJSA 3H45C 2GBZA 5M1NA 1KLNA 5C10A 4WFAL 1C0FA 4DR3K 1RTHA 1VQ5N 3SUOA 4BY9C 3K2PA 1N33K 3VF6A 3J7YP 3AVCA 3NBPA 1EWQA 4PHTX 2YNIA 2PYJA 1TKZA 1JLBA 1YUWA 1I39A 4OGCA 5I9EB 3OYAA 3AARA 4CF2A 3EYZA 4FXDA 1KSPA 3VQ9A 4QAGA 3HSTB 3LDPA 1HKGA 4LF7K 5AZIA 1TKTA 4PL8A 4LY7A 5JLFA 2FBXA 3EN9A 3FZMA 4DR1K 3WUHA 4M3ZA 4LFBK 3MWTA 3O08A 1C0UA 1VQ6N 3OY9A 4NLBA 2GWKA 1S6QA 3GBTA 4CZFA 1U47A 3CETA 1EWRA 3V9UA 3ENOA 4XH4A 3SLCA 3VESA 3BF3A 1ATSA 2VG7A 4M3YA 1CZAN 3OYKA 4K0KK 4B9SA 4CERA 3TTFA 3JS6A 1T05A 3WNHA 1NG9A 2RF2A 3IKMA 4YDUA 4M3TA 2NLXA 1BA0A 3TABA 1YJWN 4KRFA 3VEWA 1S5JA 4BR4A 3L2RA 4JRQA 3NHGA 3AA5X 2V7ZA 4BVOA 4CF8A 2VWKA 4OJRA 2O4IA 3V81A 4CCHA 4BC5A 4DQIA 3QDKA 3L3UA 4BRAA 5FPDA 2B4JA 3KLIA 5CYMA 2G8VA 3AVAA 3VEZA 3KK2A 3AGRA 4CJVA 2A3ZA 4OPAA 4AH9A 1NJXA 2YHAA 1RT3A 3THVA 3OJUA 3CCUN 4GW6A 3UKRB 4FJKA 1BUPA 2IIRA 3FZKA 4DF8A 4FK2A 4V19S 2GUIA 2E6MA 4B9VA 4JKAA 4BGAA 4AM7A 5EX5A 5DM6L 3VA0A 5AQPA 3M8QA 2VGNA 4CZHA 1VQKN 5J2MA 3G6EN 3A5MC 3C7NB 3MK6A 1IG9A 3CQ8A 1GLAG 4LH5A 1BWFO 2FBTA 5AQTA 4HTUA 3OYMA 4B3SK 3IS9A 1SV5A 3NF6A 1HX1A 4Z4HA 3EKUA 3VOVA 3RVCA 4NYFA 3SQ1A 1U6ZA 1TKDA 3TAPA 2D5RA 4EHUA 3D6RA 5HBMA 1VHXA 1S9GA 3OTOK 1NGFA 1WLJA 5B8HA 4RW7A 4XH5A 4MDAA 1HMVA 3U4LA 2YHXA 3G0ZA 1TYQB 3V1OA 4DV0K 4FK0A 4OLAA 4GKJK 1RFQA 3T69A 3VGKA 3VMFB 3CD6N 1C6VA 3LPTA 1M1KO 3CCJN 3LDNA 4GMJB 5E26A 1J53A 3S3NA 3R8EA 3OHRA 3MEEA 4DU3A 1U48A 2DTUA 3R3LA 1IKVA 1NJIO 2YHBA 4B3MK 2DFHA 4BR5A 4ILGB 3VQ8A 3MXIA 4B9NA 4CJ5A 3THWA 3H08A 1A5VA 1ILYA 3VENA 5TKYA 3CCVN 1VSEA 1BQMA 2QWPA 4FLYA 3ZSQA 2JWKA 1RTIA 3SBTA 2ZJQL 3RR8A 1VSHA 2O8DA 1NGHA 4WCEL 3CQXA 4IEIA 4CBWA 1NGCA 4JS4A 5C0YA 1QQNA 1EXQA 3VPZA 4LFCK 5H1SQ 2XHBA 3NH0A 1G15A 4NLCA 3QO9A 4JD2B 2QWNA 3VQCA 3TTCA 4CJFA 3F2KA 1KD1O 4B3RK 5M1OA 2QK9A 3I56N 1JL2A 4IO8A 1BG3A 3U3GA 3UKUB 5LMNK 2OPQA 4AHUA 1VRTA 1QQMA 4ISGA 5FPEA 3OW2M 1NMDA 1XWLA 1ZBUA 4EZ6A 2E6LA 3K57A 4B9QA 5HL7L 3ULEB 5KGXA 1NJYA 1HR0K 2F8TA 3GE1A 1C0MA 4CBUA 3IFRA 2X6SA 4DHYA 5M1PA 1RDBA 4CHOA 3AO1A 3P38A 5GADP 1FXXA 4BDZA 1XMOK 3L3VA 3KIOA 4H5WA 3IDHA 3VQ6A 2ZGYA 1OH5A 3SJJA 2G8FA 1NBWA 2JWLA 4IFVA 5HRNA 1NLVA 1RT4A 2PBDA 2AP1A 3SAGA 1ASWA 1GLBG 2UXBK 1WSIA 1N36K 1V4TA 3KJVA 2V51B 5LMUK 3OYLA 2FF6A 3CJ7A 4BR0A 3AO2A 5KPRA 4DKWA 2O8EB 3CPWM 2HNYA 1YHQN 4FJIA 4WQ4A 5GAGP 4QOZB 4HHTA 2QTDA 4F2SA 3LPUA 1U49A 4E0DA 1B9FA 4M3UA 1E4FT 1OH8A 5JVHL 3CJ1A 4DF4A 3ZEUB 3NGIA 5F0XA 1RILA 4BRMA 5AQHA 1T7PA 1GOAA 3NF8A 3QLHA 4B3TK 2OANA 4C1NK 5GIPA 4YOUA 2YNFA 3WQUA 4DV7K 1A5XA 4OVLA 1TL3A 5EU7A 1LCUA 5J2QA 1QTMA 4JI8K 4JS5A 4R79A 4JI6K 4FVMA 4CD3A 1IBLK 5AQGA 3QIOA 5AQRA 2KQ2A 1LWCA 3ENBA 4N47A 4DUYK 3K58A 4CJQA 2BTFA 3UKRA 1HQEA 3CJBA 3NF7A 1RGIA 4IXCA 5AFUA 1ATNA 1RTJA 2P1JA 1RCHA 4EHTA 2KFZA 3OYBA 3E66A 1Q7YO 4I6MA 5FLXO 5JS2A 1VQ4N 5JLHA 5BPMA 4B1VA 4U67L 3HP6A 2FSJA 1SKRA 1ASVA 1SZ2A 2YNGA 5C42A 1XC9A 1QSLA 1QQCA 1WSHA 4EZ9A 4CIGA 4O55A 1YF5L 3SMPA 4CFCA 1JLEA 4FWOA 4BRDA 4CGDA 4E7LA 4H0XB 4KV8A 1JLCA 1TKXA 3K9JA 1IO2A 4IEEA 1OH6A 4KTQA 2KFNA 3U9DA 4DV4K 3SBGA 4OPHA 1VQ8N 1S1XA 1C1CA 5J2PA 3D2FB 3GL1A 1W97L 1YTUA 2ATQA 3O3GA 1CZBA 2QWRA 3I8DA 4HUEA 2EWSA 1TYQA 3VEXA 4DTPA 3F9KA 2A42A 5CYQA 4FJ8A 1REVA 3WXLA 4AQYK 4LF5K 2V7YA 1RDUA 2X74A 4CK2A 4GY2B 3HBTA 4WF9L 3AO3A 4A59A 4FSVA 2NRXA 4CHNA 4DSEA 4M7XA 3DRRA 4BDPA 1BCOA 2A1SA 2OPPA 3WQTA 3L6QA 4XEIA 3EZWA 3KVGA 4DR2K 5DM7L 4JKEA 3D2EA 4A5BA 3QEVA 3OYEA 2XY7A 1JKHA 4N5SA 1OH7A 2B6AA 4K25A 4GV3A 4A2BA 4K8XA 1CLQA 1ZBFA 2UUCK 4JI2K 3THYB 3HYFA 2WBNA 4O5BA 1NJWA 2ASPA 4FM2A 3NMUA 4IOXA 3C95A 3CI5A 2NNWA 2P9SB 2YCHA 4B1YB 2FBVA 1HKBA 3LP1A 1WBDA 2IC3A 1VQ9N 3NF9A
chains in the Genus database with same CATH topology
1NK8A 4Z4EA 2YNIA 3ZSXA 2PYJA 3DLKA 3M8RA 1TK5A 1DLOA 1TV6A 4KHNA 1TKZA 3VQPA 1TL1A 1LW0A 1JLBA 4DTUA 3ALYA 2A1RA 1I39A 4OGCA 1KVCA 1RT2A 3V1QA 1VSJA 3OYAA 1TK0A 4CF2A 3EYZA 4E7IA 3LAKA 4FXDA 1KSPA 1VSFA 3C6UA 4EP4A 3VQ9A 3V9WA 2F8SA 2QKBA 1C1AA 4QAGA 3HSTB 4R5PA 3NH2A 4H4MA 3TWHA 3LWMA 1TKTA 1K6YA 1ITGA 1X9WA 4NCBA 4LY7A 3KKRA 3NAEA 3AVLA 2FBXA 2IOCA 1RT5A 2X6NA 1S1TA 2YKMA 3M8SA 2OZMA 4OKJA 4M3ZA 4N76A 2BANA 5CZ1A 1QE1A 1C0UA 3OY9A 4C8KA 2G8UA 1X9SA 4FZZA 4ZHRA 2VG6A 3LDSA 3ULDA 2JGUA 1JLFA 1WAFA 1S6QA 5HROA 4CEAA 1HYSA 1BI4B 4I9LA 4DS5A 4B9LA 4BE0A 3VQQA 3MXMA 3K59A 4CHYA 3HL8A 1C1BA 3L2QA 1U47A 4DTRA 4CFBA 1LW2A 3SUPA 3TAQA 3V9UA 2XY6A 5FRNA 3ASMA 3L8BA 3OS0A 3OYJA 2VG7A 3L2WA 3HVRA 4M3YA 4AHRA 3OYKA 4E7HA 3PY8A 4FW1A 4B9SA 4KB0A 4CERA 3SQ4A 4FZYA 4CEEA 4DTSA 1S1VA 3AVJA 3WNHA 1T05A 1EP4A 2RN2A 2RF2A 3VQDA 1L5UA 3A2FA 3TARA 3QESA 1S6PA 4N56A 4PQUA 1RDDA 4JRPA 3SYZA 4M3TA 3TABA 2RPIA 3HPOA 3IAYA 4OKEA 4KRFA 4HCCA 4BE1A 1S5JA 2OPRA 3AVKA 3O4NA 1RBVA 3L2RA 4JRQA 1O1WA 3NHGA 4CEZA 3AA5X 4CF8A 4E89A 2Y1IA 2VWKA 3I0RA 4OJRA 4NYNA 4DS4A 3V81A 3HK2A 4CJKA 2O4IA 4E19A 4CCHA 5FRMA 3MECA 4KTWA 2EX3A 4FLUA 1XHXA 1KFSA 1NK6A 4OKKA 4O0IA 2D0AA 4H8KA 3T19A 3PO4A 4DQIA 3L3UA 4CFAA 4M3WA 2B4JA 3KLIA 1HNVA 5CYMA 4ZTFA 4Z0UA 2G8VA 3AVAA 3AA2A 3JSMA 3KK2A 1Z25A 1ZBIA 4B3OA 4CJVA 4ZTJA 1BGXT 3NGYA 3PUFA 3TAGA 3BDPA 1X1PA 2IGIA 2YNHA 4AH9A 4LSNA 1NJXA 2YHAA 1NK0A 2HHXA 1RT3A 3THVA 1FKPA 3ZCMA 4FYDA 3OJUA 4GW6A 2RKIA 1JLQA 3TANA 4FJKA 4W5NA 4RG8A 4DU1A 3ZSZA 4FK2A 3T3FA 4DF8A 1NJZA 1LAWA 2GUIA 2E6MA 2HNDA 4IDKA 4B9VA 4AHCA 4DTXA 3RMAA 1LWFA 3VA0A 5C25A 4O4GA 3K5LA 1QSSA 5HRSA 3V1RA 3M8QA 4FLTA 4DFJA 3S3OA 4FJHA 4DTJA 4Z4GA 3P83D 4OPKA 2F96A 3HP9A 5J2MA 4Z4IA 3DRPA 1HQUA 3PX6A 4YFUA 2R7YA 4ID1A 3QEWA 1IG9A 3HO1A 3CQ8A 3DLRA 4M3RA 4LH5A 3LP2A 2FBTA 3QIPA 3VQBA 1DTQA 1I3AA 1RT7A 3BGRA 3SNNA 4HTUA 3OYMA 1HJRA 3DRSA 4B8CA 4FM0A 1W9HA 4KHWA 4JLHA 3VQ5A 3IS9A 4FJNA 3ISNC 1SV5A 2KW4A 3NF6A 3S3MA 4OLBA 4Z4HA 2P5OA 2XO7A 2B5JA 3HVTA 4DFMA 4NYFA 3TAMA 4EP5A 3SQ1A 1J54A 1J5OA 1TKDA 3TAPA 1CXQA 4FLZA 2W42A 3NGZA 2D5RA 3KLEA 3MEDA 4BWJA 2HMIA 3RR7A 3SV4A 5HBMA 4FJ5A 1S9GA 3C6TA 3D45A 1UA0A 3L2VA 1WLJA 4BWMA 1Q9YA 3O4QA 4QCLA 4RW7A 4YNQA 1YT3A 4CFDA 3HM9A 2P51A 1EKEA 2Z1GA 4DSLA 1XHZA 1HMVA 4NCAA 1JXBA 4KHSA 1NKBA 3AO5A 4CJLA 3G0ZA 2FC0A 2Q3SA 3V1OA 1FK9A 1VSKA 3QEPA 4FK0A 4OLAA 3MEGA 1Z26A 4ICLA 1SKSA 1EX4A 5KRSA 3TR8A 3SQ0A 1WAJA 2FBYA 1T8EA 1TAQA 3DOKA 1C6VA 1SUQA 5SZTA 3OS2A 3ZSYA 3T1AA 3LPTA 1LAVA 4W5OA 3U3YA 4F3OA 1C0TA 4RW8A 5KGWA 1HPZA 4J2EA 2OA8A 4KHYA 4IFYA 2ETJA 4GMJB 1J53A 4LSLA 3S3NA 4PWDA 1Q9XA 4KFBA 3E01A 2Z1HA 3RTVA 3MEEA 4DU3A 1D8YA 3K5NA 1U48A 1U4BA 1TGOA 2DTUA 1IKVA 3P5JA 2G8KA 2PY5A 1YVUA 3SI6A 2YHBA 4J2BA 4CGGA 1W0HA 3OS1A 2ZD1A 2DFHA 4KREA 2XY5A 3VQ8A 2IS3A 3ZT2A 1HNIA 4CJ5A 3MXIA 4B9NA 4Q0BA 1NOZA 3H08A 2LSNA 1L3VA 5KTQA 3KLFA 3SV3A 2HHWA 1A5VA 1GOBA 1TVRA 2ITGA 1VRUA 1VSMA 3TI0A 3VQ7A 4DWIA 4CJRA 1VSEA 1L3SA 1BQMA 1SL0A 5DMRA 4FLYA 4DSFA 2IAJA 3ZSQA 4KAZA 1RTIA 3CFOA 2WONA 3RR8A 2YV0X 1L3UA 1L3TA 1VSHA 3VQ4A 4J2DA 1JL1A 1WNSA 4O0JA 3KD1E 1BIUA 1XI1A 3S9HA 3LP0A 3LZIA 1RBTA 1IKWA 1J9AA 1KTQA 2DFEA 4Y1CA 5J1EA 4JS4A 4FW2A 4B08A 1EXQA 3OYIA 3ZT3A 2D0CA 3CFRA 2XHBA 3NH0A 4FLVA 1G15A 1N5YA 3QO9A 1D5AA 3O3HA 2Z1IA 3VQCA 1D9FA 4W5QA 3OYDA 2G8HA 4CJFA 4FLWA 4CJWA 4C8LA 3QEXA 3HJFA 3OYHA 5FDLA 5K14A 4M45A 1RDCA 2BE2A 3DLEA 2QK9A 4ELVA 3SPZA 5FROA 1JL2A 1D9DA 3KK3A 3OJSA 4L8RB 3U3GA 4Q5VA 4CK1A 3EZ5A 5CZ2A 4FJXA 2OPQA 4AHUA 4FJ7A 2X78A 1VRTA 4CGHA 1SKWA 1RTDA 1R0AA 1S9EA 1ZBUA 1XWLA 4EZ6A 3TAFA 2E6LA 3K57A 2ZQBA 1BHLA 1VSIA 1QHTA 5KGXA 3OYNA 1NJYA 2O4GA 3AVIA 3DYAA 4H4OA 3PO5A 2F8TA 2QKKA 1C0MA 1RT6A 1N6QA 3AO4A 2PYLA 2X6SA 4DU4A 4HVJA 3NE6A 3SUQA 3K5MA 1RDBA 3AV9A 2YKNA 3C94A 4CHOA 3AO1A 3AA4A 2P5GA 1FXXA 3ZSVA 2IDOA 1FKOA 3CG7A 4BDZA 1JLAA 4KHUA 3L3VA 4M42A 3KIOA 2QXFA 3VQ6A 3SJJA 1CZ9A 2G8FA 2EHGA 4IFVA 5HRNA 1RT4A 3OVNA 4KO0A 1BQNA 3NH1A 4CK3A 2KZZA 4W5RA 1RBSA 1YTAA 2DFFA 5KI6A 3NCIA 4HUGA 4WE1A 1RBUA 1ASWA 4NCGA 4LH4A 1ZBLA 4CEDA 1LWEA 2I5JA 2OPSA 3WNFA 3HXMA 1IKYA 1MU2A 1WSIA 3DLGA 3RWUA 4AHSA 1BI4A 1WSEA 4CJEA 5HP1A 1SL1A 4DQPA 4IKFA 3KJVA 4C8NA 4CHPA 3OYLA 4BACA 1IH7A 4DQQA 3KK1A 2KTQA 3AO2A 1NKEA 1S1WA 3QERA 3HPGA 4DTMA 1BIZA 4FJLA 1Y97A 2HNYA 1X9MA 4FJIA 4CJUA 4FZXC 4CJ3A 4KB1A 3SUNA 1U04A 3ZSOA 1BISA 4QOZB 1F21A 4CEQA 4DLGA 1KFDA 4DSIA 4HHTA 4Y1DA 4CESA 1DTTA 3LPUA 1U49A 4F2SA 3RMBA 4FK4A 4E0DA 1B9FA 4M3UA 3PX0A 1RNHA 5HLFA 3LWLA 5E41A 4KHQA 4DMNA 1NK5A 5C24A 4DF4A 3NGIA 2G8WA 1RILA 2HB5A 1A5WA 1HYZA 4GVMA 4AILC 1IKXA 4F2RA 1WSFA 1T7PA 1GOAA 3NF8A 3QLHA 3JYTA 1QSYA 3AVHA 4BDYA 1ASUA 5SWMA 3LALA 3AVFA 3SCXA 1EETA 2ZE2A 4DTNA 4DFKA 3M8PA 1NKCA 3CYMA 2BGGA 2YNFA 3LANA 1A5XA 4OVLA 1TL3A 5EU7A 1CXUA 3QNNA 5J2QA 1QTMA 4M3XA 4DG1A 3LZJA 3VN5A 2HHTA 4F8RA 3ZT4A 4JS5A 4I2QA 3AA3A 3SZ2A 4FVMA 3AVNA 4E1MA 2NUBA 3DM2A 3ZSWA 1RBRA 3VQEA 3QIOA 4DQRA 2KQ2A 1QS4A 2Z1JA 2OZSA 4FJ9A 4E1NA 4I9QA 3O3FA 4KI6A 1LWCA 5HRRA 4N47A 3QNOA 2G8IA 2XY8A 3K58A 4CJQA 4C8OA 3SQ2A 1HQEA 1NK9A 3NF7A 5J2NA 4CJ4A 3F73A 2KZMA 4PA1A 4CJPA 2XRIA 3RRGA 5DK5A 3VQAA 4RW6A 4CF9A 3LAMA 3CM5A 3RMDA 1LV5A 1Q8IA 1RTJA 2P1JA 1RCHA 4CIFA 4CEBA 4I2PA 5T7BA 3OYBA 3OYCA 3TAEA 4MFBA 2KFZA 3D0PA 3NDKA 4CJTA 3CM6A 4DTOA 3U6FA 3AVMA 5JS2A 1WSJA 3CFPA 4CGFA 3EY1A 4OPJA 1JLGA 4HUFA 5JS1A 1BCMA 4CHZA 3HP6A 3K5OA 3PV8A 2HHVA 4RW4A 2GV9A 5CY4A 1U45A 2PZSA 4BE2A 1SKRA 4B9UA 2HHUA 3SPYA 4FJMA 4PUOA 2HVHA 3PX4A 1ASVA 3KLGA 2YNGA 1VSDA 1KVAA 5C42A 4AHVA 1XC9A 1QSLA 1KVBA 1QQCA 3MAQA 4XIUA 2D0BA 4F4KA 1WSHA 4CE9A 3QINA 1UA1A 3UIQA 3V9XA 4EZ9A 2JLEA 4CIGA 4O55A 4CFCA 1RT1A 3G10A 1JLEA 4FJGA 4F3TA 4KI4A 4ID5A 4MQ3A 4CGDA 2E4LA 2WOMA 4FCYA 4E7LA 4KV8A 1JLCA 1TKXA 1IO2A 4KTQA 4CEFA 2KFNA 1TAUA 4Z4CA 3DI6A 4UQGA 3KD5E 1S1XA 1NK7A 4B9MA 4FJJA 4CF1A 4KPYA 1C1CA 1KLMA 3OYFA 5J2PA 4E7JA 1YTUA 3IG1A 2ATQA 3O3GA 1KRPA 1CZBA 2HNZA 3WNGA 1B92A 3I8DA 1VK0A 3HPHA 4J2AA 4HUEA 4M41A 4OGEA 3I0SA 3HT3A 1T03A 1VSLA 4IG0A 3P1GA 1BL3A 4DTPA 3DLHA 3F9KA 1ZBHA 5CYQA 3RRHA 1REVA 4FJ8A 4B8AB 2HHSA 1HYVA 2X74A 4CK2A 5D3GA 1KCFA 2VWJA 3V6DA 1TK8A 1B9DA 1UAXA 4HCBA 3DMJA 4RW9A 3AO3A 3DOLA 3V4IA 2HVIA 1JXEA 1WSGA 4I7FA 3WNEA 4CEOA 3AVGA 1S1UA 4B9TA 3KLHA 4K8ZA 4PY5A 5KRTA 3LP3A 4CHNA 4W5TA 4DSEA 1WN7A 4E3SA 3DRRA 3MXJA 2OYQA 4BDPA 3ZT1A 1BCOA 2A1SA 2OPPA 3B6OA 1HRHA 3B6PA 3ZT0A 4FM1A 3VA3A 3ITHA 3OYGA 2DY4A 4CHQA 4DSJA 1RDAA 3QEIA 3FFIA 3V9ZA 3QEVA 3OYEA 2XY7A 1UOCA 3ZSRA 4DFPA 2VG5A 1JKHA 1SL2A 4LD0A 4DSKA 4E7KA 5I3UA 4IG3A 4N5SA 4ELUA 3RMCA 2B6AA 4G1QA 4C8MA 5HRPA 2Y1JA 4K8XA 1CLQA 4IBNA 4FLXA 1ZYQA 3L2UA 4N41A 4CGJA 1ZBFA 3DLBA 4CGIA 4DQSA 1GOCA 4ELTA 4KKOA 4CECA 4CJSA 1NK4A 3HYFA 4AHTA 2GBZA 4O5BA 1KLNA 1NJWA 4Z4FA 4FM2A 4DLEA 2HHQA 3KKSA 3V9SA 3C95A 1RTHA 3IRXA 3SUOA 1UWBA 3K2PA 4KTZA 4O44A 1NOYA 4TSXA 3NFAA 4CF0A 2FBVA 2HW3A 2AJQA 3AVCA 3LP1A 3NBPA 2BDPA 5I42A 4CIEA 2IC3A 3AVBA 3QETA 3NF9A 3KTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK8 A;  4Z4E A;  2YNI A;  3ZSX A;  2PYJ A;  3DLK A;  3M8R A;  1TK5 A;  1DLO A;  1TV6 A;  4KHN A;  1TKZ A;  3VQP A;  1TL1 A;  1LW0 A;  1JLB A;  4DTU A;  3ALY A;  2A1R A;  1I39 A;  4OGC A;  1KVC A;  1RT2 A;  3V1Q A;  1VSJ A;  3OYA A;  1TK0 A;  4CF2 A;  3EYZ A;  4E7I A;  3LAK A;  4FXD A;  1KSP A;  1VSF A;  3C6U A;  4EP4 A;  3VQ9 A;  3V9W A;  2F8S A;  2QKB A;  1C1A A;  4QAG A;  3HST B;  4R5P A;  3NH2 A;  4H4M A;  3TWH A;  3LWM A;  1TKT A;  1K6Y A;  1ITG A;  1X9W A;  4NCB A;  4LY7 A;  3KKR A;  3NAE A;  3AVL A;  2FBX A;  2IOC A;  1RT5 A;  2X6N A;  1S1T A;  2YKM A;  3M8S A;  2OZM A;  4OKJ A;  4M3Z A;  4N76 A;  2BAN A;  5CZ1 A;  1QE1 A;  1C0U A;  3OY9 A;  4C8K A;  2G8U A;  1X9S A;  4FZZ A;  4ZHR A;  2VG6 A;  3LDS A;  3ULD A;  2JGU A;  1JLF A;  1WAF A;  1S6Q A;  5HRO A;  4CEA A;  1HYS A;  1BI4 B;  4I9L A;  4DS5 A;  4B9L A;  4BE0 A;  3VQQ A;  3MXM A;  3K59 A;  4CHY A;  3HL8 A;  1C1B A;  3L2Q A;  1U47 A;  4DTR A;  4CFB A;  1LW2 A;  3SUP A;  3TAQ A;  3V9U A;  2XY6 A;  5FRN A;  3ASM A;  3L8B A;  3OS0 A;  3OYJ A;  2VG7 A;  3L2W A;  3HVR A;  4M3Y A;  4AHR A;  3OYK A;  4E7H A;  3PY8 A;  4FW1 A;  4B9S A;  4KB0 A;  4CER A;  3SQ4 A;  4FZY A;  4CEE A;  4DTS A;  1S1V A;  3AVJ A;  3WNH A;  1T05 A;  1EP4 A;  2RN2 A;  2RF2 A;  3VQD A;  1L5U A;  3A2F A;  3TAR A;  3QES A;  1S6P A;  4N56 A;  4PQU A;  1RDD A;  4JRP A;  3SYZ A;  4M3T A;  3TAB A;  2RPI A;  3HPO A;  3IAY A;  4OKE A;  4KRF A;  4HCC A;  4BE1 A;  1S5J A;  2OPR A;  3AVK A;  3O4N A;  1RBV A;  3L2R A;  4JRQ A;  1O1W A;  3NHG A;  4CEZ A;  3AA5 X;  4CF8 A;  4E89 A;  2Y1I A;  2VWK A;  3I0R A;  4OJR A;  4NYN A;  4DS4 A;  3V81 A;  3HK2 A;  4CJK A;  2O4I A;  4E19 A;  4CCH A;  5FRM A;  3MEC A;  4KTW A;  2EX3 A;  4FLU A;  1XHX A;  1KFS A;  1NK6 A;  4OKK A;  4O0I A;  2D0A A;  4H8K A;  3T19 A;  3PO4 A;  4DQI A;  3L3U A;  4CFA A;  4M3W A;  2B4J A;  3KLI A;  1HNV A;  5CYM A;  4ZTF A;  4Z0U A;  2G8V A;  3AVA A;  3AA2 A;  3JSM A;  3KK2 A;  1Z25 A;  1ZBI A;  4B3O A;  4CJV A;  4ZTJ A;  1BGX T;  3NGY A;  3PUF A;  3TAG A;  3BDP A;  1X1P A;  2IGI A;  2YNH A;  4AH9 A;  4LSN A;  1NJX A;  2YHA A;  1NK0 A;  2HHX A;  1RT3 A;  3THV A;  1FKP A;  3ZCM A;  4FYD A;  3OJU A;  4GW6 A;  2RKI A;  1JLQ A;  3TAN A;  4FJK A;  4W5N A;  4RG8 A;  4DU1 A;  3ZSZ A;  4FK2 A;  3T3F A;  4DF8 A;  1NJZ A;  1LAW A;  2GUI A;  2E6M A;  2HND A;  4IDK A;  4B9V A;  4AHC A;  4DTX A;  3RMA A;  1LWF A;  3VA0 A;  5C25 A;  4O4G A;  3K5L A;  1QSS A;  5HRS A;  3V1R A;  3M8Q A;  4FLT A;  4DFJ A;  3S3O A;  4FJH A;  4DTJ A;  4Z4G A;  3P83 D;  4OPK A;  2F96 A;  3HP9 A;  5J2M A;  4Z4I A;  3DRP A;  1HQU A;  3PX6 A;  4YFU A;  2R7Y A;  4ID1 A;  3QEW A;  1IG9 A;  3HO1 A;  3CQ8 A;  3DLR A;  4M3R A;  4LH5 A;  3LP2 A;  2FBT A;  3QIP A;  3VQB A;  1DTQ A;  1I3A A;  1RT7 A;  3BGR A;  3SNN A;  4HTU A;  3OYM A;  1HJR A;  3DRS A;  4B8C A;  4FM0 A;  1W9H A;  4KHW A;  4JLH A;  3VQ5 A;  3IS9 A;  4FJN A;  3ISN C;  1SV5 A;  2KW4 A;  3NF6 A;  3S3M A;  4OLB A;  4Z4H A;  2P5O A;  2XO7 A;  2B5J A;  3HVT A;  4DFM A;  4NYF A;  3TAM A;  4EP5 A;  3SQ1 A;  1J54 A;  1J5O A;  1TKD A;  3TAP A;  1CXQ A;  4FLZ A;  2W42 A;  3NGZ A;  2D5R A;  3KLE A;  3MED A;  4BWJ A;  2HMI A;  3RR7 A;  3SV4 A;  5HBM A;  4FJ5 A;  1S9G A;  3C6T A;  3D45 A;  1UA0 A;  3L2V A;  1WLJ A;  4BWM A;  1Q9Y A;  3O4Q A;  4QCL A;  4RW7 A;  4YNQ A;  1YT3 A;  4CFD A;  3HM9 A;  2P51 A;  1EKE A;  2Z1G A;  4DSL A;  1XHZ A;  1HMV A;  4NCA A;  1JXB A;  4KHS A;  1NKB A;  3AO5 A;  4CJL A;  3G0Z A;  2FC0 A;  2Q3S A;  3V1O A;  1FK9 A;  1VSK A;  3QEP A;  4FK0 A;  4OLA A;  3MEG A;  1Z26 A;  4ICL A;  1SKS A;  1EX4 A;  5KRS A;  3TR8 A;  3SQ0 A;  1WAJ A;  2FBY A;  1T8E A;  1TAQ A;  3DOK A;  1C6V A;  1SUQ A;  5SZT A;  3OS2 A;  3ZSY A;  3T1A A;  3LPT A;  1LAV A;  4W5O A;  3U3Y A;  4F3O A;  1C0T A;  4RW8 A;  5KGW A;  1HPZ A;  4J2E A;  2OA8 A;  4KHY A;  4IFY A;  2ETJ A;  4GMJ B;  1J53 A;  4LSL A;  3S3N A;  4PWD A;  1Q9X A;  4KFB A;  3E01 A;  2Z1H A;  3RTV A;  3MEE A;  4DU3 A;  1D8Y A;  3K5N A;  1U48 A;  1U4B A;  1TGO A;  2DTU A;  1IKV A;  3P5J A;  2G8K A;  2PY5 A;  1YVU A;  3SI6 A;  2YHB A;  4J2B A;  4CGG A;  1W0H A;  3OS1 A;  2ZD1 A;  2DFH A;  4KRE A;  2XY5 A;  3VQ8 A;  2IS3 A;  3ZT2 A;  1HNI A;  4CJ5 A;  3MXI A;  4B9N A;  4Q0B A;  1NOZ A;  3H08 A;  2LSN A;  1L3V A;  5KTQ A;  3KLF A;  3SV3 A;  2HHW A;  1A5V A;  1GOB A;  1TVR A;  2ITG A;  1VRU A;  1VSM A;  3TI0 A;  3VQ7 A;  4DWI A;  4CJR A;  1VSE A;  1L3S A;  1BQM A;  1SL0 A;  5DMR A;  4FLY A;  4DSF A;  2IAJ A;  3ZSQ A;  4KAZ A;  1RTI A;  3CFO A;  2WON A;  3RR8 A;  2YV0 X;  1L3U A;  1L3T A;  1VSH A;  3VQ4 A;  4J2D A;  1JL1 A;  1WNS A;  4O0J A;  3KD1 E;  1BIU A;  1XI1 A;  3S9H A;  3LP0 A;  3LZI A;  1RBT A;  1IKW A;  1J9A A;  1KTQ A;  2DFE A;  4Y1C A;  5J1E A;  4JS4 A;  4FW2 A;  4B08 A;  1EXQ A;  3OYI A;  3ZT3 A;  2D0C A;  3CFR A;  2XHB A;  3NH0 A;  4FLV A;  1G15 A;  1N5Y A;  3QO9 A;  1D5A A;  3O3H A;  2Z1I A;  3VQC A;  1D9F A;  4W5Q A;  3OYD A;  2G8H A;  4CJF A;  4FLW A;  4CJW A;  4C8L A;  3QEX A;  3HJF A;  3OYH A;  5FDL A;  5K14 A;  4M45 A;  1RDC A;  2BE2 A;  3DLE A;  2QK9 A;  4ELV A;  3SPZ A;  5FRO A;  1JL2 A;  1D9D A;  3KK3 A;  3OJS A;  4L8R B;  3U3G A;  4Q5V A;  4CK1 A;  3EZ5 A;  5CZ2 A;  4FJX A;  2OPQ A;  4AHU A;  4FJ7 A;  2X78 A;  1VRT A;  4CGH A;  1SKW A;  1RTD A;  1R0A A;  1S9E A;  1ZBU A;  1XWL A;  4EZ6 A;  3TAF A;  2E6L A;  3K57 A;  2ZQB A;  1BHL A;  1VSI A;  1QHT A;  5KGX A;  3OYN A;  1NJY A;  2O4G A;  3AVI A;  3DYA A;  4H4O A;  3PO5 A;  2F8T A;  2QKK A;  1C0M A;  1RT6 A;  1N6Q A;  3AO4 A;  2PYL A;  2X6S A;  4DU4 A;  4HVJ A;  3NE6 A;  3SUQ A;  3K5M A;  1RDB A;  3AV9 A;  2YKN A;  3C94 A;  4CHO A;  3AO1 A;  3AA4 A;  2P5G A;  1FXX A;  3ZSV A;  2IDO A;  1FKO A;  3CG7 A;  4BDZ A;  1JLA A;  4KHU A;  3L3V A;  4M42 A;  3KIO A;  2QXF A;  3VQ6 A;  3SJJ A;  1CZ9 A;  2G8F A;  2EHG A;  4IFV A;  5HRN A;  1RT4 A;  3OVN A;  4KO0 A;  1BQN A;  3NH1 A;  4CK3 A;  2KZZ A;  4W5R A;  1RBS A;  1YTA A;  2DFF A;  5KI6 A;  3NCI A;  4HUG A;  4WE1 A;  1RBU A;  1ASW A;  4NCG A;  4LH4 A;  1ZBL A;  4CED A;  1LWE A;  2I5J A;  2OPS A;  3WNF A;  3HXM A;  1IKY A;  1MU2 A;  1WSI A;  3DLG A;  3RWU A;  4AHS A;  1BI4 A;  1WSE A;  4CJE A;  5HP1 A;  1SL1 A;  4DQP A;  4IKF A;  3KJV A;  4C8N A;  4CHP A;  3OYL A;  4BAC A;  1IH7 A;  4DQQ A;  3KK1 A;  2KTQ A;  3AO2 A;  1NKE A;  1S1W A;  3QER A;  3HPG A;  4DTM A;  1BIZ A;  4FJL A;  1Y97 A;  2HNY A;  1X9M A;  4FJI A;  4CJU A;  4FZX C;  4CJ3 A;  4KB1 A;  3SUN A;  1U04 A;  3ZSO A;  1BIS A;  4QOZ B;  1F21 A;  4CEQ A;  4DLG A;  1KFD A;  4DSI A;  4HHT A;  4Y1D A;  4CES A;  1DTT A;  3LPU A;  1U49 A;  4F2S A;  3RMB A;  4FK4 A;  4E0D A;  1B9F A;  4M3U A;  3PX0 A;  1RNH A;  5HLF A;  3LWL A;  5E41 A;  4KHQ A;  4DMN A;  1NK5 A;  5C24 A;  4DF4 A;  3NGI A;  2G8W A;  1RIL A;  2HB5 A;  1A5W A;  1HYZ A;  4GVM A;  4AIL C;  1IKX A;  4F2R A;  1WSF A;  1T7P A;  1GOA A;  3NF8 A;  3QLH A;  3JYT A;  1QSY A;  3AVH A;  4BDY A;  1ASU A;  5SWM A;  3LAL A;  3AVF A;  3SCX A;  1EET A;  2ZE2 A;  4DTN A;  4DFK A;  3M8P A;  1NKC A;  3CYM A;  2BGG A;  2YNF A;  3LAN A;  1A5X A;  4OVL A;  1TL3 A;  5EU7 A;  1CXU A;  3QNN A;  5J2Q A;  1QTM A;  4M3X A;  4DG1 A;  3LZJ A;  3VN5 A;  2HHT A;  4F8R A;  3ZT4 A;  4JS5 A;  4I2Q A;  3AA3 A;  3SZ2 A;  4FVM A;  3AVN A;  4E1M A;  2NUB A;  3DM2 A;  3ZSW A;  1RBR A;  3VQE A;  3QIO A;  4DQR A;  2KQ2 A;  1QS4 A;  2Z1J A;  2OZS A;  4FJ9 A;  4E1N A;  4I9Q A;  3O3F A;  4KI6 A;  1LWC A;  5HRR A;  4N47 A;  3QNO A;  2G8I A;  2XY8 A;  3K58 A;  4CJQ A;  4C8O A;  3SQ2 A;  1HQE A;  1NK9 A;  3NF7 A;  5J2N A;  4CJ4 A;  3F73 A;  2KZM A;  4PA1 A;  4CJP A;  2XRI A;  3RRG A;  5DK5 A;  3VQA A;  4RW6 A;  4CF9 A;  3LAM A;  3CM5 A;  3RMD A;  1LV5 A;  1Q8I A;  1RTJ A;  2P1J A;  1RCH A;  4CIF A;  4CEB A;  4I2P A;  5T7B A;  3OYB A;  3OYC A;  3TAE A;  4MFB A;  2KFZ A;  3D0P A;  3NDK A;  4CJT A;  3CM6 A;  4DTO A;  3U6F A;  3AVM A;  5JS2 A;  1WSJ A;  3CFP A;  4CGF A;  3EY1 A;  4OPJ A;  1JLG A;  4HUF A;  5JS1 A;  1BCM A;  4CHZ A;  3HP6 A;  3K5O A;  3PV8 A;  2HHV A;  4RW4 A;  2GV9 A;  5CY4 A;  1U45 A;  2PZS A;  4BE2 A;  1SKR A;  4B9U A;  2HHU A;  3SPY A;  4FJM A;  4PUO A;  2HVH A;  3PX4 A;  1ASV A;  3KLG A;  2YNG A;  1VSD A;  1KVA A;  5C42 A;  4AHV A;  1XC9 A;  1QSL A;  1KVB A;  1QQC A;  3MAQ A;  4XIU A;  2D0B A;  4F4K A;  1WSH A;  4CE9 A;  3QIN A;  1UA1 A;  3UIQ A;  3V9X A;  4EZ9 A;  2JLE A;  4CIG A;  4O55 A;  4CFC A;  1RT1 A;  3G10 A;  1JLE A;  4FJG A;  4F3T A;  4KI4 A;  4ID5 A;  4MQ3 A;  4CGD A;  2E4L A;  2WOM A;  4FCY A;  4E7L A;  4KV8 A;  1JLC A;  1TKX A;  1IO2 A;  4KTQ A;  4CEF A;  2KFN A;  1TAU A;  4Z4C A;  3DI6 A;  4UQG A;  3KD5 E;  1S1X A;  1NK7 A;  4B9M A;  4FJJ A;  4CF1 A;  4KPY A;  1C1C A;  1KLM A;  3OYF A;  5J2P A;  4E7J A;  1YTU A;  3IG1 A;  2ATQ A;  3O3G A;  1KRP A;  1CZB A;  2HNZ A;  3WNG A;  1B92 A;  3I8D A;  1VK0 A;  3HPH A;  4J2A A;  4HUE A;  4M41 A;  4OGE A;  3I0S A;  3HT3 A;  1T03 A;  1VSL A;  4IG0 A;  3P1G A;  1BL3 A;  4DTP A;  3DLH A;  3F9K A;  1ZBH A;  5CYQ A;  3RRH A;  1REV A;  4FJ8 A;  4B8A B;  2HHS A;  1HYV A;  2X74 A;  4CK2 A;  5D3G A;  1KCF A;  2VWJ A;  3V6D A;  1TK8 A;  1B9D A;  1UAX A;  4HCB A;  3DMJ A;  4RW9 A;  3AO3 A;  3DOL A;  3V4I A;  2HVI A;  1JXE A;  1WSG A;  4I7F A;  3WNE A;  4CEO A;  3AVG A;  1S1U A;  4B9T A;  3KLH A;  4K8Z A;  4PY5 A;  5KRT A;  3LP3 A;  4CHN A;  4W5T A;  4DSE A;  1WN7 A;  4E3S A;  3DRR A;  3MXJ A;  2OYQ A;  4BDP A;  3ZT1 A;  1BCO A;  2A1S A;  2OPP A;  3B6O A;  1HRH A;  3B6P A;  3ZT0 A;  4FM1 A;  3VA3 A;  3ITH A;  3OYG A;  2DY4 A;  4CHQ A;  4DSJ A;  1RDA A;  3QEI A;  3FFI A;  3V9Z A;  3QEV A;  3OYE A;  2XY7 A;  1UOC A;  3ZSR A;  4DFP A;  2VG5 A;  1JKH A;  1SL2 A;  4LD0 A;  4DSK A;  4E7K A;  5I3U A;  4IG3 A;  4N5S A;  4ELU A;  3RMC A;  2B6A A;  4G1Q A;  4C8M A;  5HRP A;  2Y1J A;  4K8X A;  1CLQ A;  4IBN A;  4FLX A;  1ZYQ A;  3L2U A;  4N41 A;  4CGJ A;  1ZBF A;  3DLB A;  4CGI A;  4DQS A;  1GOC A;  4ELT A;  4KKO A;  4CEC A;  4CJS A;  1NK4 A;  3HYF A;  4AHT A;  2GBZ A;  4O5B A;  1KLN A;  1NJW A;  4Z4F A;  4FM2 A;  4DLE A;  2HHQ A;  3KKS A;  3V9S A;  3C95 A;  1RTH A;  3IRX A;  3SUO A;  1UWB A;  3K2P A;  4KTZ A;  4O44 A;  1NOY A;  4TSX A;  3NFA A;  4CF0 A;  2FBV A;  2HW3 A;  2AJQ A;  3AVC A;  3LP1 A;  3NBP A;  2BDP A;  5I42 A;  4CIE A;  2IC3 A;  3AVB A;  3QET A;  3NF9 A;  3KTQ A; 
#chains in the Genus database with same CATH topology
 1K8A O;  4Z4E A;  2ZJR L;  3ZSX A;  4JKH A;  3ZET B;  1TK5 A;  4QS9 A;  1TL1 A;  4JD2 A;  1TK0 A;  1WB9 A;  3V1Q A;  1RT2 A;  1VSJ A;  1YVN A;  3LAK A;  2F8S A;  1KXP A;  5EXW A;  4R5P A;  1HUX A;  3MCP A;  4A2A A;  3LWM A;  1X9W A;  3UKU A;  3NAE A;  2YKM A;  3DAW A;  2OCE A;  4OKJ A;  2CH5 A;  4FWL A;  4JKG B;  3SK3 A;  3J7A P;  3ULE A;  2G8U A;  1X9S A;  2FXU A;  4WQ5 C;  1WAF A;  2CH6 A;  1BI4 B;  4DS5 A;  3G25 A;  3I55 N;  3K59 A;  5ADX A;  3HL8 A;  3L2Q A;  3D7E O;  3TAQ A;  5FRN A;  3ASM A;  3OYJ A;  2E2P A;  5AQL A;  2W40 A;  3ATV A;  4A61 A;  4DTS A;  2IVN A;  3AGK A;  3AVJ A;  2RN2 A;  4CVN E;  3CJC A;  3W3D A;  3A2F A;  5KQD A;  1ATR A;  3QES A;  1S6P A;  4JRP A;  3SYZ A;  2QA4 N;  4OKE A;  3WXK A;  5BN8 A;  4JI1 K;  3HK2 A;  3I0R A;  4DS4 A;  2GX9 A;  2GTD A;  4KTW A;  2EX3 A;  4FLU A;  3KK7 A;  1KFS A;  4OKK A;  4H8K A;  2O8E A;  3T19 A;  4O8U A;  4AM6 A;  2E5L K;  3E9O A;  1HNV A;  3G4S N;  4ZTF A;  1Z25 A;  4A57 A;  4B3O A;  3TAG A;  2P9N B;  1YXQ A;  3BDP A;  3GG4 A;  2IVO A;  1FKP A;  3ZCM A;  4FYD A;  2RKI A;  3ZEU A;  5JVG L;  4RG8 A;  4DU1 A;  3ZSZ A;  3T3F A;  4DR7 K;  1LAW A;  4BQL A;  4AHC A;  3W0L A;  4DTX A;  4UY8 O;  4O4G A;  5HRS A;  3V1R A;  4FJH A;  1VQP N;  3UE5 A;  1N8R O;  2E2N A;  4DCH A;  5C12 A;  3DRP A;  1NM1 A;  1XQS C;  1HQU A;  1HKC A;  3PX6 A;  4ID1 A;  3DLR A;  3DLL L;  1I3A A;  1BOT O;  3DRS A;  3EKS A;  3SMS A;  3VQ5 A;  4JK9 A;  5F2R A;  3S3M A;  2HST A;  2P5O A;  2B5J A;  3HVT A;  2RHK A;  4DV2 K;  1HNZ K;  4DFM A;  1HNX K;  1CXQ A;  3NGZ A;  3F9M A;  1ZXO A;  2HMI A;  3O6W A;  3LL3 A;  3O4Q A;  4YNQ A;  4H0P A;  5LJV A;  1EKE A;  2Z1G A;  3TPQ A;  1JXB A;  2ZGZ A;  4KHS A;  1XC3 A;  4CJL A;  2FC0 A;  4A62 A;  2Q3S A;  4NXM K;  1FK9 A;  2HBL A;  1VSK A;  4ICL A;  4BC3 A;  1WAJ A;  2FBY A;  3CCR N;  1SUQ A;  4YOV A;  1GLF O;  1FW6 A;  3BY5 A;  1C0T A;  3HOS A;  4RW8 A;  5KGW A;  3CHW A;  2OA8 A;  1E3M A;  2GWJ A;  1J6Z A;  4FWN A;  4PWD A;  1NGA A;  3D2F A;  4K43 A;  1TGO A;  5EY4 A;  1W7A A;  5C2F A;  3OS1 A;  2ZD1 A;  4KRE A;  1GLD G;  2XY5 A;  2IS3 A;  4MDB A;  1HNI A;  3ZT2 A;  2OTJ N;  2LSN A;  1L3V A;  3KLF A;  4H5R A;  4RWT A;  3K9K A;  3JAM O;  3VQ7 A;  4CJR A;  3TSP A;  4FWQ A;  2O8F B;  1Q18 A;  4KAZ A;  2WON A;  4M7Y A;  1NNE A;  3L4I A;  1L3T A;  3VQ4 A;  1WNS A;  2BUP A;  3S9H A;  4CZM A;  1RBT A;  1KTQ A;  2DFE A;  5J1E A;  4H5T A;  4FW2 A;  1T6D A;  4B08 A;  1YIT N;  4QS8 A;  4ISF A;  1U2V B;  1TUU A;  4GNI A;  4PL7 A;  4MO4 A;  2Z1I A;  1W2B M;  3VET A;  1Y64 A;  4C8L A;  4FWM A;  3OYH A;  5K14 A;  5FRO A;  3AAP A;  3KK3 A;  2P9S A;  2D4W A;  4Q5V A;  5CZ2 A;  4FJ7 A;  2X78 A;  4B1W B;  1R0A A;  3CCS N;  1N34 K;  2ZQB A;  3OYN A;  1QHT A;  3PO5 A;  2O4G A;  4JK7 A;  3QFU A;  1RT6 A;  3OA9 A;  3AO4 A;  4DU4 A;  4DUZ K;  2YKN A;  4KBO A;  1FKO A;  3CG7 A;  2RE2 A;  1JLA A;  4KHU A;  4M42 A;  2ZWH A;  3PSI A;  3DJC A;  5A2Q O;  1BQN A;  1VAZ A;  1RBS A;  2DFF A;  4LF9 K;  2E8A A;  4FWS A;  4JKG A;  4BRH A;  3VGM A;  4B1U B;  5BR8 K;  4CED A;  1LWE A;  3HXM A;  1IKY A;  1ZBS A;  4KH5 A;  4FO0 A;  3DLG A;  3RWU A;  3FGU A;  1BI4 A;  4CJE A;  1SL1 A;  2HOE A;  3CJ9 A;  1NGG A;  4CHP A;  1YI2 N;  3MCA B;  3SAH A;  3QER A;  3HPG A;  4DTM A;  3H6E A;  2YJE A;  5F1X A;  1Y97 A;  1X9M A;  4CJU A;  4CJ3 A;  4KB1 A;  1U04 A;  1QZ5 A;  3LDO A;  1BIS A;  2IVP A;  1F21 A;  4CEQ A;  1KFD A;  5CR4 A;  3RMB A;  3U8X A;  3PX0 A;  2A40 A;  3LWL A;  4DMN A;  3H1Q A;  3M6G A;  4CJ7 A;  2HB5 A;  4JN4 A;  2VCP A;  3JYT A;  3AVH A;  1IV0 A;  1ASU A;  3LAL A;  3SCX A;  2ZE2 A;  3M8P A;  2BGG A;  1ESV A;  3HTV A;  1CXU A;  3QNN A;  4M3X A;  3LZJ A;  4FOE A;  1XNR K;  4ILJ A;  3VF2 A;  4YOY A;  4E1M A;  3MX5 A;  1RBR A;  2PAV A;  4BRG A;  1QS4 A;  4I9Q A;  3O3F A;  2P9I A;  2G8I A;  3CC4 N;  3SQ2 A;  1I94 K;  4CJ4 A;  4PA1 A;  2XRI A;  5DK5 A;  3RMD A;  4CF9 A;  3LAM A;  3R9P A;  1Q8I A;  1V4S A;  3OYC A;  1DT9 A;  4CEB A;  2E20 A;  5M1F A;  3NDK A;  4CJT A;  3U6F A;  3AVM A;  1WSJ A;  3CFP A;  4OPJ A;  1N32 K;  3OBY A;  2P9L B;  2V52 B;  4CHZ A;  4H03 B;  3PV8 A;  3S41 A;  2HHU A;  2PZS A;  4B9U A;  4WFB L;  3SPY A;  1VQN N;  4YHH K;  1BU6 O;  1VSD A;  2KKZ A;  4OO1 J;  3MAQ A;  2D0B A;  4DV5 K;  1UA1 A;  3V9X A;  2JLE A;  1RT1 A;  3CME N;  4ID5 A;  4FCY A;  3P31 A;  4BR2 A;  2QI2 A;  5KPZ A;  1NK7 A;  3DWL A;  1KLM A;  3IG1 A;  3WNG A;  1B92 A;  4M41 A;  1VSL A;  4IG0 A;  3P1G A;  2D0O A;  1BL3 A;  1ZBH A;  2QEX N;  3ENH A;  1TK8 A;  1UAX A;  1QVG M;  1WSG A;  3WNE A;  1JCE A;  3MDQ A;  4CEO A;  3AVG A;  5KRT A;  4W5T A;  4QS7 A;  3MN6 A;  2OYQ A;  3MXJ A;  1LOT B;  3WXM B;  1HRH A;  3B6P A;  3ZT0 A;  4FM1 A;  1P90 A;  3FFI A;  5ELZ A;  1UOC A;  3H3N O;  3ZSR A;  4EFH A;  4DSK A;  4E7K A;  2WTU A;  4ELU A;  4C8M A;  2Y1J A;  3CJA A;  4IBN A;  4CGJ A;  2Q0U A;  1P8Z A;  1GOC A;  4KKO A;  2FSN A;  1NK4 A;  2CGJ A;  4JAX A;  1T3V A;  4Z4F A;  3KKS A;  3KZB A;  3CMA N;  2O8F A;  3Q7C A;  3TSQ A;  4KTZ A;  5LY3 A;  4O44 A;  4TSX A;  4CF0 A;  4E1J A;  2BDP A;  4DQ8 A;  3AVB A;  1NK8 A;  1XUP O;  4WYB A;  1SQK A;  1U2V A;  1DLO A;  1TV6 A;  3VQP A;  4GV9 A;  1IJJ A;  4DTU A;  3ALY A;  2A1R A;  1KVC A;  4ILH A;  2BH1 A;  3BUZ B;  3ZX2 A;  4E7I A;  3C6U A;  2P9K B;  1QZ6 A;  2E2Q A;  1C1A A;  3P4I A;  1WUA A;  4WQ5 A;  4LF6 K;  4BRQ A;  4H4M A;  4CZG A;  3BZC A;  1K6Y A;  1ITG A;  1NMN A;  3A5N C;  4MLH A;  3KKR A;  1M90 O;  4NCB A;  2X6N A;  3BEX A;  1WBB A;  1K9M O;  3L4Q A;  4DR6 K;  4C8K A;  2VQE K;  4FZZ A;  2E1Y A;  4ZHR A;  5BRD A;  3ULD A;  2JGU A;  5HRO A;  4CEA A;  4CI6 A;  4B9L A;  1C1B A;  4DTR A;  2DPN A;  1C0G A;  2ASM A;  3C7N A;  4K42 A;  3ATU A;  5AJ3 K;  3L8B A;  2YX6 A;  3L2W A;  3EO3 A;  1WOQ A;  4E7H A;  3LM2 A;  3SJH A;  4FW1 A;  3VEY A;  3SQ4 A;  4CEE A;  1S1V A;  1EP4 A;  5M1Q A;  3VQD A;  3QB0 A;  4JI7 K;  1L5U A;  3ID6 A;  3TAR A;  4PQU A;  1RDD A;  4WFN L;  2YJF A;  5HOO A;  2RPI A;  4JYA K;  3HPO A;  3IAY A;  4HCC A;  2QXL A;  2OPR A;  3AVK A;  2AA4 A;  3O4N A;  1RBV A;  3CCQ N;  3CPE A;  1O1W A;  2NRV A;  5BR9 A;  4E89 A;  2Y1I A;  1GLE G;  3ZX3 A;  1IBM K;  3THX B;  3B8A X;  1NK6 A;  4O0I A;  5AQZ A;  4M3W A;  2QWM A;  5LL6 Z;  3E1Y A;  3JSM A;  1NGB A;  4ZTJ A;  3PUF A;  3NGY A;  1X1P A;  2HHX A;  2I7P A;  4LSN A;  3ZYY X;  5AZJ B;  3L0Q A;  4KH6 A;  3TAN A;  4W5N A;  1QHA A;  1NJZ A;  4Z94 A;  1JJ2 M;  4IO9 L;  1LWF A;  3K5L A;  1QSS A;  4FLT A;  4DTJ A;  3WT0 A;  4Z4G A;  4OPK A;  2F96 A;  3C6A A;  3HO1 A;  2R7Y A;  5AQY A;  4JI4 K;  4M3R A;  3SNN A;  1DTQ A;  1RT7 A;  2W6K A;  3O1W A;  5AQV A;  4FM0 A;  2WFB A;  4JLH A;  5AQX A;  4G9Z A;  3ISN C;  3H1V X;  1HPM A;  3ZLJ A;  3TAM A;  3G71 N;  2ZM6 K;  1J5O A;  4O8K A;  2H3G X;  3M3Z A;  3MED A;  4BWJ A;  3U9Z A;  1Q82 O;  4BC4 A;  3C6T A;  2P9L A;  4B1Z A;  3L2V A;  1UA0 A;  4BRO A;  1Q9Y A;  4CZE A;  4QCL A;  2W6L A;  1YT3 A;  4CFD A;  3CCM N;  4BQZ A;  4NCA A;  1K73 O;  1NKB A;  5BRF A;  5C2D A;  3QFP A;  4JV5 K;  3MEG A;  1SKS A;  4MLE A;  5CHI A;  3TR8 A;  3SQ0 A;  3DOK A;  3ZSY A;  3T1A A;  4W5O A;  3U3Y A;  4F3O A;  1HPZ A;  4J2E A;  2KLA A;  4KHY A;  2ETJ A;  4LSL A;  2HBM A;  3KWI A;  2ASO A;  2Z1H A;  3RTV A;  5BRE A;  2G8K A;  3SI6 A;  4J2B A;  4CGG A;  2ZJP L;  1W0H A;  3C65 A;  4Q0B A;  1NOZ A;  1JCF A;  4CZJ A;  5KTQ A;  4KH4 A;  2HHW A;  1TVR A;  3T1H K;  1VRU A;  1VSM A;  1KQS M;  3TI0 A;  4FPA A;  4DWI A;  2FLO A;  1L3S A;  1JCG A;  4IJA A;  1SL0 A;  1KC8 O;  5DMR A;  4CBX A;  4DSF A;  4J8F A;  2IAJ A;  4JKC A;  3CFO A;  4BRN A;  2YV0 X;  1L3U A;  1JL1 A;  4O0J A;  1XI1 A;  2E1Z A;  4H5V A;  3LZI A;  1J9A A;  2KHO A;  4Y1C A;  2D0C A;  4DV3 K;  4FLV A;  4GVE A;  1N5Y A;  3O3H A;  2A5X A;  1D9F A;  2G8H A;  2O8B B;  4FLW A;  3O9Q A;  3QEX A;  5FDL A;  3M1F A;  1DKG D;  3I8B A;  1RDC A;  2BE2 A;  1E4G T;  1XNQ K;  4ELV A;  4L8R B;  4CK1 A;  4FJX A;  3CF5 L;  4CGH A;  2HHH K;  1S9E A;  3TAF A;  5BRH A;  3HZ6 A;  4BRI A;  3DYA A;  4H4O A;  3QML A;  4IFE A;  2QKK A;  1N6Q A;  2PYL A;  4FOI A;  2VGM A;  2F9T A;  3WXI A;  2D0P A;  3SUQ A;  3AV9 A;  1OVQ A;  4JEP A;  3AA4 A;  1VQL N;  3VEV A;  3PIO L;  2KZZ A;  3NH1 A;  3CIP A;  2HMP A;  1FJG K;  5GAH P;  1YTA A;  3NCI A;  4JNE A;  2YHY A;  1Q86 O;  3O9R A;  4HUG A;  2HF4 A;  3HI0 A;  1RBU A;  2Q1N A;  4NCG A;  2O8D B;  4LH4 A;  3UB5 A;  5EOY A;  1ZBL A;  2I5J A;  2OPS A;  1QQO A;  3WNF A;  1O13 A;  1MU2 A;  4IKF A;  4AHS A;  4YOR A;  4DQP A;  2QM1 A;  1VQO N;  2KTQ A;  4DQQ A;  3KK1 A;  2HBK A;  4C23 A;  4CZI A;  4FJL A;  3VEO A;  3SAF A;  5AR0 A;  4C1N I;  4JI5 K;  4DSI A;  3IMX A;  4DLG A;  4FK4 A;  2Q36 A;  4NB4 A;  1HJO A;  4JHD B;  4JI3 K;  1RNH A;  5HLF A;  1GLJ O;  5E41 A;  1NK5 A;  3MX2 A;  5C24 A;  5IT9 O;  4O5F A;  4L3Q A;  4AIL C;  1IKX A;  4F2R A;  4M63 C;  1QSY A;  4BDY A;  3EE9 A;  3PSF A;  5SWM A;  5AQM A;  3THX A;  1EET A;  4DTN A;  4NO7 A;  4DFK A;  3K0S A;  5AQO A;  1NKC A;  3LAN A;  4IWV A;  4DG1 A;  3AA3 A;  1Q81 O;  2QWL A;  1YIJ N;  4NXN K;  1QVF M;  2WC9 A;  3DM2 A;  3ZSW A;  3HOT A;  3TU5 A;  5HRR A;  3QNO A;  5AZJ A;  4K41 A;  4C8O A;  4PKH A;  2J4R A;  1BDG A;  1NK9 A;  5J2N A;  3F73 A;  4DB3 A;  2KZM A;  4CJP A;  1TUY A;  2PFU A;  3DXM B;  2VQF K;  3GOI A;  3VQA A;  1LV5 A;  3FR0 A;  5T7B A;  1BO5 O;  3TAE A;  4I2P A;  3LM9 A;  4MFB A;  3VTI A;  3D0P A;  3O4W A;  4DTO A;  4BG8 A;  4BVP A;  3FFK B;  4CGF A;  4CZK A;  5JS1 A;  1H1V A;  4IZ9 A;  1HNW K;  1S22 A;  2GV9 A;  4RW4 A;  5CY4 A;  4FJM A;  4PUO A;  2HVH A;  3PX4 A;  2F7T A;  4AHV A;  3HSC A;  3THY A;  4XIU A;  2Q2R A;  3QIN A;  3G10 A;  4JKD A;  4BG9 A;  1G99 A;  4KI4 A;  2P9U B;  4JI0 K;  3O8M A;  2E4L A;  3FZH A;  4CEF A;  4Z4C A;  4B9M A;  4FJJ A;  4KPY A;  3ZET A;  1NGJ A;  3OYF A;  2HNZ A;  1VK0 A;  3HT3 A;  4OGE A;  1KAX A;  3OBW A;  3DLH A;  3RRH A;  2NRW A;  1HYV A;  1KCF A;  3V6D A;  1B9D A;  4HCB A;  3V4I A;  2HVI A;  4I7F A;  1OKJ A;  4K8Z A;  1S1U A;  3KLH A;  1X9J A;  1WN7 A;  3F5T A;  3ZT1 A;  4BRE A;  3B6O A;  1K8K B;  3VA3 A;  3ITH A;  4CHQ A;  4I6M B;  2GEM A;  3V9Z A;  1SAZ A;  3N4Q A;  1SL2 A;  4LD0 A;  3T7Z A;  5I3U A;  1X3N A;  4IG3 A;  3DXK B;  3O80 A;  4IOA L;  5HRP A;  3C0B A;  1IG8 A;  2ITM A;  4FLX A;  1ZYQ A;  3L2U A;  4N41 A;  3BZK A;  3PIP L;  4BRF A;  3DLB A;  4CEC A;  4AHT A;  1YJ9 N;  2ZF5 O;  2HHQ A;  4DLE A;  1NU0 A;  3IRX A;  3V9S A;  1UWB A;  3A5O C;  5JIC A;  4LF4 K;  1NOY A;  4OX9 K;  3NFA A;  3WEE B;  2HW3 A;  3H3O B;  2AJQ A;  3VTH A;  1NWK A;  5I42 A;  4CIE A;  5JMV A;  2NRH A;  3QET A;  1BA1 A;  3KTQ A;  3DLK A;  3M8R A;  4KHN A;  1LW0 A;  2CGK A;  4EAH D;  4BRP A;  2O8B A;  1T6C A;  1VSF A;  4EP4 A;  3V9W A;  2QKB A;  3NH2 A;  2HF3 A;  3TWH A;  4HWI A;  2FF3 B;  4MO5 A;  2P9N A;  4YOW A;  2Q97 A;  3AVL A;  2IOC A;  1RT5 A;  2OZM A;  1S1T A;  3M8S A;  4N76 A;  2BAN A;  5CZ1 A;  1QE1 A;  5BPL A;  4H0V B;  3D2E B;  2VG6 A;  1RDW X;  3R6M A;  3LDS A;  1JLF A;  5FPM A;  1HYS A;  4I9L A;  4BE0 A;  3VQQ A;  3MXM A;  4CHY A;  5GAE P;  1MA9 B;  3HRG A;  4CFB A;  1LW2 A;  3EEQ A;  3O1B A;  2XY6 A;  3SUP A;  3OS0 A;  3HVR A;  2UYT A;  4AHR A;  3PY8 A;  4KB0 A;  4FZY A;  4IDH A;  4RTF D;  4N56 A;  3AY9 A;  3MN5 A;  4JKF A;  1NGD A;  2P9P B;  1YJN N;  1NGI A;  4BE1 A;  3VF4 A;  4CEZ A;  4DV1 K;  4NYN A;  4CJK A;  3I33 A;  4E19 A;  5FRM A;  3MEC A;  3HM8 A;  1XHX A;  1DEJ A;  3WXJ A;  2D0A A;  4YDU C;  3PO4 A;  4CW7 B;  4CFA A;  1NGE A;  4Z0U A;  4AF1 A;  3AA2 A;  3O9U A;  1ZBI A;  4DV6 K;  3J7Z O;  1BGX T;  4JHD A;  3MMV A;  2IGI A;  2YNH A;  3IUC A;  3O9S A;  5M1K A;  1NK0 A;  2GEL A;  3O5B A;  1JLQ A;  3EE8 A;  2A6A A;  5LJW A;  2VYP A;  2HND A;  4IDK A;  3RMA A;  2W41 A;  5C25 A;  4DFJ A;  3S3O A;  4H0O A;  3P83 D;  3HP9 A;  3J81 O;  4Z4I A;  1SS6 A;  4YFU A;  3QEW A;  4LFA K;  3CC7 N;  3LP2 A;  3VQB A;  3QIP A;  4JK8 A;  3BGR A;  3RSE B;  1HJR A;  4KHW A;  4B8C A;  1W9H A;  4BRK A;  1DGK N;  4X65 K;  4FJN A;  4OLB A;  2KW4 A;  2XO7 A;  3DXM A;  4X66 K;  2O8C B;  4RCH A;  2OTL N;  4EP5 A;  1J54 A;  1XMQ K;  4FLZ A;  3Q7B A;  2W42 A;  3KLE A;  3RR7 A;  3SV4 A;  4FJ5 A;  2QW9 A;  3D45 A;  4BWM A;  1Z6R A;  3HM9 A;  2P51 A;  4KHP K;  4Y0W A;  4DSL A;  1XHZ A;  4DR5 K;  3AO5 A;  4DR4 K;  3QEP A;  3KHY A;  3P39 A;  1Z26 A;  1EX4 A;  5KRS A;  1S72 N;  1T8E A;  3BP8 A;  1TAQ A;  5C15 A;  3OS2 A;  2A41 A;  5SZT A;  2F4V K;  2P9U A;  3EL2 A;  1LAV A;  2VWB A;  4YOT A;  5AFU H;  3ZX0 A;  4YOX A;  5AQJ A;  3BF1 A;  5KPT A;  4IFY A;  4GKK K;  1D4X A;  5AQN A;  1Q9X A;  4KFB A;  5CE3 A;  3E01 A;  1D8Y A;  4FWP A;  3K5N A;  1MWK A;  4FWK A;  1U4B A;  3A5L C;  5AQU A;  3P5J A;  2PY5 A;  1YVU A;  4GV6 A;  3T1Y K;  3CC2 N;  3R1X A;  3H46 O;  3TSU A;  3SV3 A;  1GOB A;  2ITG A;  4PKI A;  4BRC A;  3VGL A;  4BRL A;  3QIC A;  3FZL A;  1K8K A;  4J2D A;  4LC9 B;  3KD1 E;  3TTD A;  3VER A;  1BIU A;  1VQM N;  3LP0 A;  4A5A A;  2HBJ A;  1IKW A;  1J5E K;  4H0Y B;  4BR7 A;  3DXK A;  3OYI A;  3ZT3 A;  4HTL A;  2E2O A;  3CFR A;  2UUB K;  2YI1 A;  1D5A A;  2GUP A;  1YAG A;  1S3X A;  1MDU B;  4W5Q A;  3OYD A;  5AQK A;  4CJW A;  3ID8 A;  3HJF A;  4M45 A;  3DLE A;  5AZI B;  3SPZ A;  1D9D A;  3OJS A;  5EVZ A;  3WEE A;  3EZ5 A;  5AQF A;  4FPB A;  1RTD A;  1SKW A;  2F9W A;  5AQI A;  1BHL A;  1VSI A;  5E84 A;  3J8A A;  3AVI A;  2UU9 K;  3O9T A;  4HVJ A;  3NE6 A;  4BC2 A;  3K5M A;  3C94 A;  4XH1 A;  3KWG A;  5MLC Q;  4H0T B;  2P5G A;  3ZSV A;  2IDO A;  4YY3 K;  2QXF A;  3N4P A;  1CZ9 A;  2EHG A;  3OVN A;  4KO0 A;  4CK3 A;  4W5R A;  5KI6 A;  4BGB A;  5AQS A;  4WE1 A;  2UXD K;  4LF8 K;  4IJN A;  1Z05 A;  3CQY A;  1WSE A;  5HP1 A;  5KQ8 A;  4C8N A;  3A0I X;  4BAC A;  1IH7 A;  1NKE A;  1S1W A;  1BIZ A;  4FZX C;  2E88 A;  3SUN A;  3ZSO A;  4Y1D A;  4CES A;  1DTT A;  3MN9 A;  4FVU A;  3PLA A;  1ZC6 A;  4KHQ A;  2P9P A;  4X62 K;  2G8W A;  1A5W A;  3CCE N;  1HYZ A;  3E9P A;  4GVM A;  4X64 K;  1WSF A;  5IWA K;  4B1X B;  4F9O A;  4U7B A;  4WQ4 C;  1X3M A;  3AVF A;  2UUA K;  4FWR A;  5TKW A;  3CYM A;  2Q31 A;  4CD1 A;  1MWM A;  5ADX H;  3QBW A;  2NZT A;  4EIA A;  3VN5 A;  2HHT A;  4F8R A;  3ZT4 A;  3SZ2 A;  4I2Q A;  3CER A;  3AVN A;  3E9L A;  2NUB A;  4DQR A;  3VQE A;  2OZS A;  2Z1J A;  4FJ9 A;  4E1N A;  4KI6 A;  3LDQ A;  2XY8 A;  3MN7 A;  2QWO A;  4IOC L;  3CXC M;  3RRG A;  3FZF A;  4RW6 A;  3CM5 A;  4PKG A;  2NRZ A;  4BR9 A;  2NRR A;  4CIF A;  3CM6 A;  4H5N A;  3EY1 A;  1JLG A;  4HUF A;  1BCM A;  3K5O A;  2HHV A;  2I7N A;  1U45 A;  4BE2 A;  2Q0R A;  3RSE A;  3KLG A;  1KVA A;  1KVB A;  3FLC O;  4F4K A;  4CE9 A;  3J80 O;  3UIQ A;  2O8C A;  3LDL A;  1GLC G;  4FJG A;  4F3T A;  4MQ3 A;  2WOM A;  4ISE A;  1OVY A;  1TAU A;  1KAY A;  3DI6 A;  4UQG A;  3KD5 E;  3QBX A;  2YHW A;  4CF1 A;  1VQ7 N;  5AQQ A;  4E7J A;  2FSK A;  1KRP A;  1EO1 A;  1HLU A;  5AQW A;  3HPH A;  4J2A A;  1T03 A;  3I0S A;  3FE1 A;  2CGL A;  1EQY A;  2P9K A;  3A8Y A;  3THW B;  1T44 A;  4B8A B;  2HHS A;  2P9I B;  5D3G A;  2VWJ A;  3DMJ A;  4RW9 A;  3DOL A;  5BPN A;  1JXE A;  1IBK K;  4B9T A;  4PY5 A;  3MWP A;  4E3S A;  3LP3 A;  2UXC K;  3CCL N;  1GLL O;  2NRT A;  5GIO A;  2DY4 A;  3OYG A;  5BN9 A;  4DSJ A;  1RDA A;  3NVK A;  3M5R A;  3QEI A;  1KAZ A;  3AAQ A;  2D1K A;  4DFP A;  1R59 O;  2VG5 A;  5GIN A;  2WUS A;  4CZL A;  3NVM A;  3RMC A;  4G1Q A;  2QWQ A;  3GDQ A;  3C6H A;  5FPN A;  4JKB A;  3JXU A;  4CGI A;  4DQS A;  4ELT A;  4FL9 A;  4CJS A;  3H45 C;  2GBZ A;  5M1N A;  1KLN A;  5C10 A;  4WFA L;  1C0F A;  4DR3 K;  1RTH A;  1VQ5 N;  3SUO A;  4BY9 C;  3K2P A;  1N33 K;  3VF6 A;  3J7Y P;  3AVC A;  3NBP A;  1EWQ A;  4PHT X;  2YNI A;  2PYJ A;  1TKZ A;  1JLB A;  1YUW A;  1I39 A;  4OGC A;  5I9E B;  3OYA A;  3AAR A;  4CF2 A;  3EYZ A;  4FXD A;  1KSP A;  3VQ9 A;  4QAG A;  3HST B;  3LDP A;  1HKG A;  4LF7 K;  5AZI A;  1TKT A;  4PL8 A;  4LY7 A;  5JLF A;  2FBX A;  3EN9 A;  3FZM A;  4DR1 K;  3WUH A;  4M3Z A;  4LFB K;  3MWT A;  3O08 A;  1C0U A;  1VQ6 N;  3OY9 A;  4NLB A;  2GWK A;  1S6Q A;  3GBT A;  4CZF A;  1U47 A;  3CET A;  1EWR A;  3V9U A;  3ENO A;  4XH4 A;  3SLC A;  3VES A;  3BF3 A;  1ATS A;  2VG7 A;  4M3Y A;  1CZA N;  3OYK A;  4K0K K;  4B9S A;  4CER A;  3TTF A;  3JS6 A;  1T05 A;  3WNH A;  1NG9 A;  2RF2 A;  3IKM A;  4YDU A;  4M3T A;  2NLX A;  1BA0 A;  3TAB A;  1YJW N;  4KRF A;  3VEW A;  1S5J A;  4BR4 A;  3L2R A;  4JRQ A;  3NHG A;  3AA5 X;  2V7Z A;  4BVO A;  4CF8 A;  2VWK A;  4OJR A;  2O4I A;  3V81 A;  4CCH A;  4BC5 A;  4DQI A;  3QDK A;  3L3U A;  4BRA A;  5FPD A;  2B4J A;  3KLI A;  5CYM A;  2G8V A;  3AVA A;  3VEZ A;  3KK2 A;  3AGR A;  4CJV A;  2A3Z A;  4OPA A;  4AH9 A;  1NJX A;  2YHA A;  1RT3 A;  3THV A;  3OJU A;  3CCU N;  4GW6 A;  3UKR B;  4FJK A;  1BUP A;  2IIR A;  3FZK A;  4DF8 A;  4FK2 A;  4V19 S;  2GUI A;  2E6M A;  4B9V A;  4JKA A;  4BGA A;  4AM7 A;  5EX5 A;  5DM6 L;  3VA0 A;  5AQP A;  3M8Q A;  2VGN A;  4CZH A;  1VQK N;  5J2M A;  3G6E N;  3A5M C;  3C7N B;  3MK6 A;  1IG9 A;  3CQ8 A;  1GLA G;  4LH5 A;  1BWF O;  2FBT A;  5AQT A;  4HTU A;  3OYM A;  4B3S K;  3IS9 A;  1SV5 A;  3NF6 A;  1HX1 A;  4Z4H A;  3EKU A;  3VOV A;  3RVC A;  4NYF A;  3SQ1 A;  1U6Z A;  1TKD A;  3TAP A;  2D5R A;  4EHU A;  3D6R A;  5HBM A;  1VHX A;  1S9G A;  3OTO K;  1NGF A;  1WLJ A;  5B8H A;  4RW7 A;  4XH5 A;  4MDA A;  1HMV A;  3U4L A;  2YHX A;  3G0Z A;  1TYQ B;  3V1O A;  4DV0 K;  4FK0 A;  4OLA A;  4GKJ K;  1RFQ A;  3T69 A;  3VGK A;  3VMF B;  3CD6 N;  1C6V A;  3LPT A;  1M1K O;  3CCJ N;  3LDN A;  4GMJ B;  5E26 A;  1J53 A;  3S3N A;  3R8E A;  3OHR A;  3MEE A;  4DU3 A;  1U48 A;  2DTU A;  3R3L A;  1IKV A;  1NJI O;  2YHB A;  4B3M K;  2DFH A;  4BR5 A;  4ILG B;  3VQ8 A;  3MXI A;  4B9N A;  4CJ5 A;  3THW A;  3H08 A;  1A5V A;  1ILY A;  3VEN A;  5TKY A;  3CCV N;  1VSE A;  1BQM A;  2QWP A;  4FLY A;  3ZSQ A;  2JWK A;  1RTI A;  3SBT A;  2ZJQ L;  3RR8 A;  1VSH A;  2O8D A;  1NGH A;  4WCE L;  3CQX A;  4IEI A;  4CBW A;  1NGC A;  4JS4 A;  5C0Y A;  1QQN A;  1EXQ A;  3VPZ A;  4LFC K;  5H1S Q;  2XHB A;  3NH0 A;  1G15 A;  4NLC A;  3QO9 A;  4JD2 B;  2QWN A;  3VQC A;  3TTC A;  4CJF A;  3F2K A;  1KD1 O;  4B3R K;  5M1O A;  2QK9 A;  3I56 N;  1JL2 A;  4IO8 A;  1BG3 A;  3U3G A;  3UKU B;  5LMN K;  2OPQ A;  4AHU A;  1VRT A;  1QQM A;  4ISG A;  5FPE A;  3OW2 M;  1NMD A;  1XWL A;  1ZBU A;  4EZ6 A;  2E6L A;  3K57 A;  4B9Q A;  5HL7 L;  3ULE B;  5KGX A;  1NJY A;  1HR0 K;  2F8T A;  3GE1 A;  1C0M A;  4CBU A;  3IFR A;  2X6S A;  4DHY A;  5M1P A;  1RDB A;  4CHO A;  3AO1 A;  3P38 A;  5GAD P;  1FXX A;  4BDZ A;  1XMO K;  3L3V A;  3KIO A;  4H5W A;  3IDH A;  3VQ6 A;  2ZGY A;  1OH5 A;  3SJJ A;  2G8F A;  1NBW A;  2JWL A;  4IFV A;  5HRN A;  1NLV A;  1RT4 A;  2PBD A;  2AP1 A;  3SAG A;  1ASW A;  1GLB G;  2UXB K;  1WSI A;  1N36 K;  1V4T A;  3KJV A;  2V51 B;  5LMU K;  3OYL A;  2FF6 A;  3CJ7 A;  4BR0 A;  3AO2 A;  5KPR A;  4DKW A;  2O8E B;  3CPW M;  2HNY A;  1YHQ N;  4FJI A;  4WQ4 A;  5GAG P;  4QOZ B;  4HHT A;  2QTD A;  4F2S A;  3LPU A;  1U49 A;  4E0D A;  1B9F A;  4M3U A;  1E4F T;  1OH8 A;  5JVH L;  3CJ1 A;  4DF4 A;  3ZEU B;  3NGI A;  5F0X A;  1RIL A;  4BRM A;  5AQH A;  1T7P A;  1GOA A;  3NF8 A;  3QLH A;  4B3T K;  2OAN A;  4C1N K;  5GIP A;  4YOU A;  2YNF A;  3WQU A;  4DV7 K;  1A5X A;  4OVL A;  1TL3 A;  5EU7 A;  1LCU A;  5J2Q A;  1QTM A;  4JI8 K;  4JS5 A;  4R79 A;  4JI6 K;  4FVM A;  4CD3 A;  1IBL K;  5AQG A;  3QIO A;  5AQR A;  2KQ2 A;  1LWC A;  3ENB A;  4N47 A;  4DUY K;  3K58 A;  4CJQ A;  2BTF A;  3UKR A;  1HQE A;  3CJB A;  3NF7 A;  1RGI A;  4IXC A;  5AFU A;  1ATN A;  1RTJ A;  2P1J A;  1RCH A;  4EHT A;  2KFZ A;  3OYB A;  3E66 A;  1Q7Y O;  4I6M A;  5FLX O;  5JS2 A;  1VQ4 N;  5JLH A;  5BPM A;  4B1V A;  4U67 L;  3HP6 A;  2FSJ A;  1SKR A;  1ASV A;  1SZ2 A;  2YNG A;  5C42 A;  1XC9 A;  1QSL A;  1QQC A;  1WSH A;  4EZ9 A;  4CIG A;  4O55 A;  1YF5 L;  3SMP A;  4CFC A;  1JLE A;  4FWO A;  4BRD A;  4CGD A;  4E7L A;  4H0X B;  4KV8 A;  1JLC A;  1TKX A;  3K9J A;  1IO2 A;  4IEE A;  1OH6 A;  4KTQ A;  2KFN A;  3U9D A;  4DV4 K;  3SBG A;  4OPH A;  1VQ8 N;  1S1X A;  1C1C A;  5J2P A;  3D2F B;  3GL1 A;  1W97 L;  1YTU A;  2ATQ A;  3O3G A;  1CZB A;  2QWR A;  3I8D A;  4HUE A;  2EWS A;  1TYQ A;  3VEX A;  4DTP A;  3F9K A;  2A42 A;  5CYQ A;  4FJ8 A;  1REV A;  3WXL A;  4AQY K;  4LF5 K;  2V7Y A;  1RDU A;  2X74 A;  4CK2 A;  4GY2 B;  3HBT A;  4WF9 L;  3AO3 A;  4A59 A;  4FSV A;  2NRX A;  4CHN A;  4DSE A;  4M7X A;  3DRR A;  4BDP A;  1BCO A;  2A1S A;  2OPP A;  3WQT A;  3L6Q A;  4XEI A;  3EZW A;  3KVG A;  4DR2 K;  5DM7 L;  4JKE A;  3D2E A;  4A5B A;  3QEV A;  3OYE A;  2XY7 A;  1JKH A;  4N5S A;  1OH7 A;  2B6A A;  4K25 A;  4GV3 A;  4A2B A;  4K8X A;  1CLQ A;  1ZBF A;  2UUC K;  4JI2 K;  3THY B;  3HYF A;  2WBN A;  4O5B A;  1NJW A;  2ASP A;  4FM2 A;  3NMU A;  4IOX A;  3C95 A;  3CI5 A;  2NNW A;  2P9S B;  2YCH A;  4B1Y B;  2FBV A;  1HKB A;  3LP1 A;  1WBD A;  2IC3 A;  1VQ9 N;  3NF9 A; 
#chains in the Genus database with same CATH homology
 1NK8 A;  4Z4E A;  2YNI A;  3ZSX A;  2PYJ A;  3DLK A;  3M8R A;  1TK5 A;  1DLO A;  1TV6 A;  4KHN A;  1TKZ A;  3VQP A;  1TL1 A;  1LW0 A;  1JLB A;  4DTU A;  3ALY A;  2A1R A;  1I39 A;  4OGC A;  1KVC A;  1RT2 A;  3V1Q A;  1VSJ A;  3OYA A;  1TK0 A;  4CF2 A;  3EYZ A;  4E7I A;  3LAK A;  4FXD A;  1KSP A;  1VSF A;  3C6U A;  4EP4 A;  3VQ9 A;  3V9W A;  2F8S A;  2QKB A;  1C1A A;  4QAG A;  3HST B;  4R5P A;  3NH2 A;  4H4M A;  3TWH A;  3LWM A;  1TKT A;  1K6Y A;  1ITG A;  1X9W A;  4NCB A;  4LY7 A;  3KKR A;  3NAE A;  3AVL A;  2FBX A;  2IOC A;  1RT5 A;  2X6N A;  1S1T A;  2YKM A;  3M8S A;  2OZM A;  4OKJ A;  4M3Z A;  4N76 A;  2BAN A;  5CZ1 A;  1QE1 A;  1C0U A;  3OY9 A;  4C8K A;  2G8U A;  1X9S A;  4FZZ A;  4ZHR A;  2VG6 A;  3LDS A;  3ULD A;  2JGU A;  1JLF A;  1WAF A;  1S6Q A;  5HRO A;  4CEA A;  1HYS A;  1BI4 B;  4I9L A;  4DS5 A;  4B9L A;  4BE0 A;  3VQQ A;  3MXM A;  3K59 A;  4CHY A;  3HL8 A;  1C1B A;  3L2Q A;  1U47 A;  4DTR A;  4CFB A;  1LW2 A;  3SUP A;  3TAQ A;  3V9U A;  2XY6 A;  5FRN A;  3ASM A;  3L8B A;  3OS0 A;  3OYJ A;  2VG7 A;  3L2W A;  3HVR A;  4M3Y A;  4AHR A;  3OYK A;  4E7H A;  3PY8 A;  4FW1 A;  4B9S A;  4KB0 A;  4CER A;  3SQ4 A;  4FZY A;  4CEE A;  4DTS A;  1S1V A;  3AVJ A;  3WNH A;  1T05 A;  1EP4 A;  2RN2 A;  2RF2 A;  3VQD A;  1L5U A;  3A2F A;  3TAR A;  3QES A;  1S6P A;  4N56 A;  4PQU A;  1RDD A;  4JRP A;  3SYZ A;  4M3T A;  3TAB A;  2RPI A;  3HPO A;  3IAY A;  4OKE A;  4KRF A;  4HCC A;  4BE1 A;  1S5J A;  2OPR A;  3AVK A;  3O4N A;  1RBV A;  3L2R A;  4JRQ A;  1O1W A;  3NHG A;  4CEZ A;  3AA5 X;  4CF8 A;  4E89 A;  2Y1I A;  2VWK A;  3I0R A;  4OJR A;  4NYN A;  4DS4 A;  3V81 A;  3HK2 A;  4CJK A;  2O4I A;  4E19 A;  4CCH A;  5FRM A;  3MEC A;  4KTW A;  2EX3 A;  4FLU A;  1XHX A;  1KFS A;  1NK6 A;  4OKK A;  4O0I A;  2D0A A;  4H8K A;  3T19 A;  3PO4 A;  4DQI A;  3L3U A;  4CFA A;  4M3W A;  2B4J A;  3KLI A;  1HNV A;  5CYM A;  4ZTF A;  4Z0U A;  2G8V A;  3AVA A;  3AA2 A;  3JSM A;  3KK2 A;  1Z25 A;  1ZBI A;  4B3O A;  4CJV A;  4ZTJ A;  1BGX T;  3NGY A;  3PUF A;  3TAG A;  3BDP A;  1X1P A;  2IGI A;  2YNH A;  4AH9 A;  4LSN A;  1NJX A;  2YHA A;  1NK0 A;  2HHX A;  1RT3 A;  3THV A;  1FKP A;  3ZCM A;  4FYD A;  3OJU A;  4GW6 A;  2RKI A;  1JLQ A;  3TAN A;  4FJK A;  4W5N A;  4RG8 A;  4DU1 A;  3ZSZ A;  4FK2 A;  3T3F A;  4DF8 A;  1NJZ A;  1LAW A;  2GUI A;  2E6M A;  2HND A;  4IDK A;  4B9V A;  4AHC A;  4DTX A;  3RMA A;  1LWF A;  3VA0 A;  5C25 A;  4O4G A;  3K5L A;  1QSS A;  5HRS A;  3V1R A;  3M8Q A;  4FLT A;  4DFJ A;  3S3O A;  4FJH A;  4DTJ A;  4Z4G A;  3P83 D;  4OPK A;  2F96 A;  3HP9 A;  5J2M A;  4Z4I A;  3DRP A;  1HQU A;  3PX6 A;  4YFU A;  2R7Y A;  4ID1 A;  3QEW A;  1IG9 A;  3HO1 A;  3CQ8 A;  3DLR A;  4M3R A;  4LH5 A;  3LP2 A;  2FBT A;  3QIP A;  3VQB A;  1DTQ A;  1I3A A;  1RT7 A;  3BGR A;  3SNN A;  4HTU A;  3OYM A;  1HJR A;  3DRS A;  4B8C A;  4FM0 A;  1W9H A;  4KHW A;  4JLH A;  3VQ5 A;  3IS9 A;  4FJN A;  3ISN C;  1SV5 A;  2KW4 A;  3NF6 A;  3S3M A;  4OLB A;  4Z4H A;  2P5O A;  2XO7 A;  2B5J A;  3HVT A;  4DFM A;  4NYF A;  3TAM A;  4EP5 A;  3SQ1 A;  1J54 A;  1J5O A;  1TKD A;  3TAP A;  1CXQ A;  4FLZ A;  2W42 A;  3NGZ A;  2D5R A;  3KLE A;  3MED A;  4BWJ A;  2HMI A;  3RR7 A;  3SV4 A;  5HBM A;  4FJ5 A;  1S9G A;  3C6T A;  3D45 A;  1UA0 A;  3L2V A;  1WLJ A;  4BWM A;  1Q9Y A;  3O4Q A;  4QCL A;  4RW7 A;  4YNQ A;  1YT3 A;  4CFD A;  3HM9 A;  2P51 A;  1EKE A;  2Z1G A;  4DSL A;  1XHZ A;  1HMV A;  4NCA A;  1JXB A;  4KHS A;  1NKB A;  3AO5 A;  4CJL A;  3G0Z A;  2FC0 A;  2Q3S A;  3V1O A;  1FK9 A;  1VSK A;  3QEP A;  4FK0 A;  4OLA A;  3MEG A;  1Z26 A;  4ICL A;  1SKS A;  1EX4 A;  5KRS A;  3TR8 A;  3SQ0 A;  1WAJ A;  2FBY A;  1T8E A;  1TAQ A;  3DOK A;  1C6V A;  1SUQ A;  5SZT A;  3OS2 A;  3ZSY A;  3T1A A;  3LPT A;  1LAV A;  4W5O A;  3U3Y A;  4F3O A;  1C0T A;  4RW8 A;  5KGW A;  1HPZ A;  4J2E A;  2OA8 A;  4KHY A;  4IFY A;  2ETJ A;  4GMJ B;  1J53 A;  4LSL A;  3S3N A;  4PWD A;  1Q9X A;  4KFB A;  3E01 A;  2Z1H A;  3RTV A;  3MEE A;  4DU3 A;  1D8Y A;  3K5N A;  1U48 A;  1U4B A;  1TGO A;  2DTU A;  1IKV A;  3P5J A;  2G8K A;  2PY5 A;  1YVU A;  3SI6 A;  2YHB A;  4J2B A;  4CGG A;  1W0H A;  3OS1 A;  2ZD1 A;  2DFH A;  4KRE A;  2XY5 A;  3VQ8 A;  2IS3 A;  3ZT2 A;  1HNI A;  4CJ5 A;  3MXI A;  4B9N A;  4Q0B A;  1NOZ A;  3H08 A;  2LSN A;  1L3V A;  5KTQ A;  3KLF A;  3SV3 A;  2HHW A;  1A5V A;  1GOB A;  1TVR A;  2ITG A;  1VRU A;  1VSM A;  3TI0 A;  3VQ7 A;  4DWI A;  4CJR A;  1VSE A;  1L3S A;  1BQM A;  1SL0 A;  5DMR A;  4FLY A;  4DSF A;  2IAJ A;  3ZSQ A;  4KAZ A;  1RTI A;  3CFO A;  2WON A;  3RR8 A;  2YV0 X;  1L3U A;  1L3T A;  1VSH A;  3VQ4 A;  4J2D A;  1JL1 A;  1WNS A;  4O0J A;  3KD1 E;  1BIU A;  1XI1 A;  3S9H A;  3LP0 A;  3LZI A;  1RBT A;  1IKW A;  1J9A A;  1KTQ A;  2DFE A;  4Y1C A;  5J1E A;  4JS4 A;  4FW2 A;  4B08 A;  1EXQ A;  3OYI A;  3ZT3 A;  2D0C A;  3CFR A;  2XHB A;  3NH0 A;  4FLV A;  1G15 A;  1N5Y A;  3QO9 A;  1D5A A;  3O3H A;  2Z1I A;  3VQC A;  1D9F A;  4W5Q A;  3OYD A;  2G8H A;  4CJF A;  4FLW A;  4CJW A;  4C8L A;  3QEX A;  3HJF A;  3OYH A;  5FDL A;  5K14 A;  4M45 A;  1RDC A;  2BE2 A;  3DLE A;  2QK9 A;  4ELV A;  3SPZ A;  5FRO A;  1JL2 A;  1D9D A;  3KK3 A;  3OJS A;  4L8R B;  3U3G A;  4Q5V A;  4CK1 A;  3EZ5 A;  5CZ2 A;  4FJX A;  2OPQ A;  4AHU A;  4FJ7 A;  2X78 A;  1VRT A;  4CGH A;  1SKW A;  1RTD A;  1R0A A;  1S9E A;  1ZBU A;  1XWL A;  4EZ6 A;  3TAF A;  2E6L A;  3K57 A;  2ZQB A;  1BHL A;  1VSI A;  1QHT A;  5KGX A;  3OYN A;  1NJY A;  2O4G A;  3AVI A;  3DYA A;  4H4O A;  3PO5 A;  2F8T A;  2QKK A;  1C0M A;  1RT6 A;  1N6Q A;  3AO4 A;  2PYL A;  2X6S A;  4DU4 A;  4HVJ A;  3NE6 A;  3SUQ A;  3K5M A;  1RDB A;  3AV9 A;  2YKN A;  3C94 A;  4CHO A;  3AO1 A;  3AA4 A;  2P5G A;  1FXX A;  3ZSV A;  2IDO A;  1FKO A;  3CG7 A;  4BDZ A;  1JLA A;  4KHU A;  3L3V A;  4M42 A;  3KIO A;  2QXF A;  3VQ6 A;  3SJJ A;  1CZ9 A;  2G8F A;  2EHG A;  4IFV A;  5HRN A;  1RT4 A;  3OVN A;  4KO0 A;  1BQN A;  3NH1 A;  4CK3 A;  2KZZ A;  4W5R A;  1RBS A;  1YTA A;  2DFF A;  5KI6 A;  3NCI A;  4HUG A;  4WE1 A;  1RBU A;  1ASW A;  4NCG A;  4LH4 A;  1ZBL A;  4CED A;  1LWE A;  2I5J A;  2OPS A;  3WNF A;  3HXM A;  1IKY A;  1MU2 A;  1WSI A;  3DLG A;  3RWU A;  4AHS A;  1BI4 A;  1WSE A;  4CJE A;  5HP1 A;  1SL1 A;  4DQP A;  4IKF A;  3KJV A;  4C8N A;  4CHP A;  3OYL A;  4BAC A;  1IH7 A;  4DQQ A;  3KK1 A;  2KTQ A;  3AO2 A;  1NKE A;  1S1W A;  3QER A;  3HPG A;  4DTM A;  1BIZ A;  4FJL A;  1Y97 A;  2HNY A;  1X9M A;  4FJI A;  4CJU A;  4FZX C;  4CJ3 A;  4KB1 A;  3SUN A;  1U04 A;  3ZSO A;  1BIS A;  4QOZ B;  1F21 A;  4CEQ A;  4DLG A;  1KFD A;  4DSI A;  4HHT A;  4Y1D A;  4CES A;  1DTT A;  3LPU A;  1U49 A;  4F2S A;  3RMB A;  4FK4 A;  4E0D A;  1B9F A;  4M3U A;  3PX0 A;  1RNH A;  5HLF A;  3LWL A;  5E41 A;  4KHQ A;  4DMN A;  1NK5 A;  5C24 A;  4DF4 A;  3NGI A;  2G8W A;  1RIL A;  2HB5 A;  1A5W A;  1HYZ A;  4GVM A;  4AIL C;  1IKX A;  4F2R A;  1WSF A;  1T7P A;  1GOA A;  3NF8 A;  3QLH A;  3JYT A;  1QSY A;  3AVH A;  4BDY A;  1ASU A;  5SWM A;  3LAL A;  3AVF A;  3SCX A;  1EET A;  2ZE2 A;  4DTN A;  4DFK A;  3M8P A;  1NKC A;  3CYM A;  2BGG A;  2YNF A;  3LAN A;  1A5X A;  4OVL A;  1TL3 A;  5EU7 A;  1CXU A;  3QNN A;  5J2Q A;  1QTM A;  4M3X A;  4DG1 A;  3LZJ A;  3VN5 A;  2HHT A;  4F8R A;  3ZT4 A;  4JS5 A;  4I2Q A;  3AA3 A;  3SZ2 A;  4FVM A;  3AVN A;  4E1M A;  2NUB A;  3DM2 A;  3ZSW A;  1RBR A;  3VQE A;  3QIO A;  4DQR A;  2KQ2 A;  1QS4 A;  2Z1J A;  2OZS A;  4FJ9 A;  4E1N A;  4I9Q A;  3O3F A;  4KI6 A;  1LWC A;  5HRR A;  4N47 A;  3QNO A;  2G8I A;  2XY8 A;  3K58 A;  4CJQ A;  4C8O A;  3SQ2 A;  1HQE A;  1NK9 A;  3NF7 A;  5J2N A;  4CJ4 A;  3F73 A;  2KZM A;  4PA1 A;  4CJP A;  2XRI A;  3RRG A;  5DK5 A;  3VQA A;  4RW6 A;  4CF9 A;  3LAM A;  3CM5 A;  3RMD A;  1LV5 A;  1Q8I A;  1RTJ A;  2P1J A;  1RCH A;  4CIF A;  4CEB A;  4I2P A;  5T7B A;  3OYB A;  3OYC A;  3TAE A;  4MFB A;  2KFZ A;  3D0P A;  3NDK A;  4CJT A;  3CM6 A;  4DTO A;  3U6F A;  3AVM A;  5JS2 A;  1WSJ A;  3CFP A;  4CGF A;  3EY1 A;  4OPJ A;  1JLG A;  4HUF A;  5JS1 A;  1BCM A;  4CHZ A;  3HP6 A;  3K5O A;  3PV8 A;  2HHV A;  4RW4 A;  2GV9 A;  5CY4 A;  1U45 A;  2PZS A;  4BE2 A;  1SKR A;  4B9U A;  2HHU A;  3SPY A;  4FJM A;  4PUO A;  2HVH A;  3PX4 A;  1ASV A;  3KLG A;  2YNG A;  1VSD A;  1KVA A;  5C42 A;  4AHV A;  1XC9 A;  1QSL A;  1KVB A;  1QQC A;  3MAQ A;  4XIU A;  2D0B A;  4F4K A;  1WSH A;  4CE9 A;  3QIN A;  1UA1 A;  3UIQ A;  3V9X A;  4EZ9 A;  2JLE A;  4CIG A;  4O55 A;  4CFC A;  1RT1 A;  3G10 A;  1JLE A;  4FJG A;  4F3T A;  4KI4 A;  4ID5 A;  4MQ3 A;  4CGD A;  2E4L A;  2WOM A;  4FCY A;  4E7L A;  4KV8 A;  1JLC A;  1TKX A;  1IO2 A;  4KTQ A;  4CEF A;  2KFN A;  1TAU A;  4Z4C A;  3DI6 A;  4UQG A;  3KD5 E;  1S1X A;  1NK7 A;  4B9M A;  4FJJ A;  4CF1 A;  4KPY A;  1C1C A;  1KLM A;  3OYF A;  5J2P A;  4E7J A;  1YTU A;  3IG1 A;  2ATQ A;  3O3G A;  1KRP A;  1CZB A;  2HNZ A;  3WNG A;  1B92 A;  3I8D A;  1VK0 A;  3HPH A;  4J2A A;  4HUE A;  4M41 A;  4OGE A;  3I0S A;  3HT3 A;  1T03 A;  1VSL A;  4IG0 A;  3P1G A;  1BL3 A;  4DTP A;  3DLH A;  3F9K A;  1ZBH A;  5CYQ A;  3RRH A;  1REV A;  4FJ8 A;  4B8A B;  2HHS A;  1HYV A;  2X74 A;  4CK2 A;  5D3G A;  1KCF A;  2VWJ A;  3V6D A;  1TK8 A;  1B9D A;  1UAX A;  4HCB A;  3DMJ A;  4RW9 A;  3AO3 A;  3DOL A;  3V4I A;  2HVI A;  1JXE A;  1WSG A;  4I7F A;  3WNE A;  4CEO A;  3AVG A;  1S1U A;  4B9T A;  3KLH A;  4K8Z A;  4PY5 A;  5KRT A;  3LP3 A;  4CHN A;  4W5T A;  4DSE A;  1WN7 A;  4E3S A;  3DRR A;  3MXJ A;  2OYQ A;  4BDP A;  3ZT1 A;  1BCO A;  2A1S A;  2OPP A;  3B6O A;  1HRH A;  3B6P A;  3ZT0 A;  4FM1 A;  3VA3 A;  3ITH A;  3OYG A;  2DY4 A;  4CHQ A;  4DSJ A;  1RDA A;  3QEI A;  3FFI A;  3V9Z A;  3QEV A;  3OYE A;  2XY7 A;  1UOC A;  3ZSR A;  4DFP A;  2VG5 A;  1JKH A;  1SL2 A;  4LD0 A;  4DSK A;  4E7K A;  5I3U A;  4IG3 A;  4N5S A;  4ELU A;  3RMC A;  2B6A A;  4G1Q A;  4C8M A;  5HRP A;  2Y1J A;  4K8X A;  1CLQ A;  4IBN A;  4FLX A;  1ZYQ A;  3L2U A;  4N41 A;  4CGJ A;  1ZBF A;  3DLB A;  4CGI A;  4DQS A;  1GOC A;  4ELT A;  4KKO A;  4CEC A;  4CJS A;  1NK4 A;  3HYF A;  4AHT A;  2GBZ A;  4O5B A;  1KLN A;  1NJW A;  4Z4F A;  4FM2 A;  4DLE A;  2HHQ A;  3KKS A;  3V9S A;  3C95 A;  1RTH A;  3IRX A;  3SUO A;  1UWB A;  3K2P A;  4KTZ A;  4O44 A;  1NOY A;  4TSX A;  3NFA A;  4CF0 A;  2FBV A;  2HW3 A;  2AJQ A;  3AVC A;  3LP1 A;  3NBP A;  2BDP A;  5I42 A;  4CIE A;  2IC3 A;  3AVB A;  3QET A;  3NF9 A;  3KTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...