1KVBA

E. coli ribonuclease hi d134h mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
155
structure length
155
Chain Sequence
b'MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCHELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
total genus 54
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvbA00
2RPIA 4CGHA 3VQAA 1VSFA 3MECA 4AH9A 4KAZA 4FK0A 2A1SA 4DTSA 4QAGA 1JLFA 4AHVA 5HRRA 2VG5A 3LPTA 3TR8A 2VG7A 4GMJB 4RW8A 4AHTA 1XHZA 3WNGA 1FKPA 1HRHA 2XY5A 1S1TA 4I2QA 1RCHA 4DWIA 1KCFA 2G8KA 3U3GA 2DTUA 2RN2A 3VQQA 2HHQA 4GVMA 4FYDA 1IO2A 3S9HA 4ZTFA 1LWFA 4CGJA 4DTPA 3RMBA 1N6QA 5HLFA 4DQIA 2NUBA 4CJKA 3O4QA 1TL3A 4CF2A 3ZT4A 1C0MA 3K59A 3THVA 2G8WA 3RR7A 1WSHA 2ZE2A 3KLIA 3L2QA 4CHQA 2BGGA 4H8KA 4DTUA 4AILC 2F96A 2XRIA 2PZSA 3NGIA 3C95A 1U4BA 4DU4A 4B9SA 2IS3A 4PY5A 3LP3A 3HK2A 4E7HA 3LP2A 3NAEA 3ZSOA 3SQ0A 3P1GA 5KTQA 1ASVA 1D8YA 4M3ZA 4HHTA 1NKBA 2OZSA 4N47A 2HVHA 3CM6A 3O3HA 1RT3A 2EHGA 3KLFA 3F9KA 1CLQA 4HCCA 4NCAA 1S1WA 3DOKA 4IG0A 4BACA 3AA3A 4Q0BA 3QO9A 2G8UA 2QK9A 3ZSRA 4KHUA 2HB5A 4DQPA 2YNIA 3AO3A 4CJ4A 1U49A 4CK1A 3JYTA 3AVFA 3VQCA 1ZYQA 1IH7A 1U47A 4IDKA 3NHGA 5KGWA 4CFAA 4YNQA 5HROA 3SV3A 3ISNC 4FJ7A 1YTUA 1WLJA 4OVLA 4ID1A 4M3RA 1RT5A 4IG3A 5DMRA 4CFDA 3L2RA 4DS4A 1JXBA 3EY1A 3V1RA 5CYQA 4CJ5A 3O3GA 1L3SA 3AVAA 4AHCA 3SUQA 4BE2A 3LP0A 4B8AB 3AO1A 3PO5A 1HYSA 5K14A 1RDBA 4H4MA 1IKVA 5CYMA 4CGFA 4CF9A 5C25A 4DF8A 1Z25A 4K8XA 3TAEA 5HP1A 4HUGA 4M3YA 3V1OA 3LAMA 3NF8A 3MXJA 3ZT2A 4DSKA 3ITHA 4O0JA 4BDPA 4ELUA 4LH5A 4LY7A 2HNYA 4KFBA 3VQ6A 1QS4A 4KPYA 4DTMA 4OLBA 4YFUA 3ZT3A 2Z1JA 2Q3SA 4FLWA 4J2AA 3A2FA 4KHSA 4B9LA 3HYFA 1X9SA 2ZD1A 3L8BA 2OPSA 3K5NA 5D3GA 1RT6A 2E6LA 2WONA 1XC9A 4FJHA 3IRXA 1C1AA 4KHNA 3PY8A 1S1VA 3AA2A 3AVNA 3P83D 4JLHA 1LW0A 3WNEA 3QEVA 1HYZA 3M8SA 5FDLA 2XY7A 3KTQA 3KD5E 1WSFA 3NH0A 4PA1A 1S5JA 4DFKA 4FXDA 4QCLA 4RG8A 3S3NA 4M42A 4C8KA 4CJPA 4FJLA 1S1UA 2DFHA 3T19A 1U04A 1CZBA 4EZ6A 2KQ2A 4BE1A 4EP5A 3V1QA 4FLYA 3QEPA 4FK2A 4GW6A 1UA1A 4PQUA 4AHRA 4ID5A 2O4GA 1RTHA 3ZSWA 1ZBFA 2KZZA 1BI4A 3AVKA 4CJWA 3TANA 3HPHA 3OYDA 1HPZA 4Y1DA 3ALYA 4LH4A 4JS5A 4E89A 3SQ1A 3LWMA 3O4NA 3TI0A 3HPOA 3TWHA 3QINA 5KI6A 3OS2A 2YNFA 3QERA 4FZXC 3MAQA 3P5JA 4J2BA 2E4LA 4OKEA 2D0CA 1TKXA 3NDKA 4CJUA 3HVRA 3LDSA 4F4KA 1K6YA 3NBPA 2FBXA 4O55A 1KFSA 1CXUA 3AVJA 4CJFA 4M3TA 3DLRA 2OYQA 1W0HA 4Z4CA 3M8RA 1KVBA 1NJYA 3VQBA 4BDZA 4DTJA 1B9DA 1Z26A 2A1RA 3TAMA 5J2NA 1VSLA 4CHOA 4DG1A 3TAGA 2Y1JA 2KFNA 3OS1A 1X9MA 4QOZB 5JS1A 1L3TA 3SQ2A 1QHTA 3AVGA 4DMNA 4BE0A 1KLNA 3IAYA 4DFJA 3KK3A 1T05A 1YTAA 1HQUA 1J53A 3DLHA 4KTZA 4KV8A 4H4OA 3RR8A 3OYGA 4KI6A 3NFAA 1KRPA 3I0RA 4WE1A 3K58A 3QEIA 1NK0A 1SUQA 1J5OA 3DLEA 1SV5A 1S1XA 1WSGA 3CYMA 4DLGA 2FBYA 4O44A 1U48A 1BGXT 1EETA 4L8RB 4CGDA 4O0IA 3PX4A 1A5XA 1T03A 1L5UA 4B9NA 2GV9A 4EP4A 3VQ4A 1DTQA 4W5OA 2OPRA 4N41A 1Q8IA 1RT7A 3ZSYA 2ITGA 4RW7A 3AO2A 3AVIA 1RT4A 3ZT0A 3HT3A 1RBSA 3L2UA 3V9ZA 4ZHRA 1QSYA 1JKHA 1NK9A 1LV5A 1XHXA 1BCOA 1HJRA 1RBUA 3D45A 3TARA 1L3UA 1IKXA 2WOMA 3SNNA 3T1AA 3VN5A 3QEWA 3CFOA 1ZBLA 1N5YA 1RTJA 1B9FA 1JL2A 4KB0A 4ELVA 3SJJA 2X6SA 4E1NA 4E7JA 2KW4A 4N5SA 1NJWA 1C0TA 1QQCA 3C6TA 4CJEA 2HNDA 4W5RA 4CF8A 3AA5X 3PUFA 4B9VA 1BIZA 5KRSA 3OYJA 3KLEA 2VWKA 3SUPA 1ASWA 1ZBIA 4FW1A 1TAQA 5HRNA 1D9FA 4PWDA 5J2QA 2LSNA 1BISA 2P1JA 3K5OA 4LSNA 5C24A 4JRPA 3HVTA 3OYIA 3V9UA 3MXMA 2QKKA 5C42A 3HSTB 1I3AA 4FJNA 4Z4EA 1SKWA 4E7KA 4TSXA 3SV4A 1RTIA 1W9HA 4NYNA 5FROA 1C1BA 3JSMA 3QIPA 1LW2A 4FJ8A 2HHUA 4DSFA 4CE9A 3CM5A 1C6VA 1Q9XA 3AVMA 4F3OA 3ZSXA 3K5LA 1NJZA 4OGEA 2W42A 1O1WA 4DSEA 5FRNA 2G8IA 1TAUA 3QEXA 2I5JA 2VG6A 1NK7A 3HM9A 1T7PA 2GBZA 2ZQBA 3CQ8A 1JLGA 1TGOA 4FJXA 4J2EA 1DTTA 4R5PA 3QESA 3G0ZA 2B5JA 4I7FA 4IBNA 4M41A 3AO4A 1NOZA 1NKCA 4FJGA 1KVCA 3WNHA 4E3SA 3KK2A 4BDYA 1SKRA 4OKKA 2DFFA 2IGIA 4FJIA 1Y97A 5JS2A 3CFRA 3VQ7A 4CESA 3OVNA 2IOCA 1VSMA 4NCGA 4CFBA 4PUOA 1CXQA 2DFEA 4O5BA 1RBTA 3OYNA 3ZCMA 1C0UA 1GOAA 3DI6A 4FLUA 1JXEA 4OGCA 4DQSA 1D9DA 2G8FA 2QKBA 1HYVA 4CF0A 2XHBA 4I9LA 3IS9A 3RWUA 1WAFA 2R7YA 1RTDA 4B9UA 3WNFA 4RW4A 3DYAA 4KHWA 2HHSA 3HXMA 3LANA 3L2VA 2YKMA 1T8EA 1RNHA 1VSKA 1WN7A 3VQDA 3SUNA 3C6UA 3DOLA 5E41A 1L3VA 3ZSVA 3HO1A 1S6PA 3VQ9A 2OZMA 1TKZA 3S3MA 3OYLA 2ATQA 2JGUA 4E7LA 2JLEA 4BWJA 3KK1A 3SUOA 2RF2A 3L3VA 1IG9A 1TK0A 4FK4A 2HHXA 4CF1A 3OJSA 1NK4A 4NYFA 2YNHA 1NKEA 1VSJA 4Q5VA 2P5GA 4FLXA 3KD1E 4HVJA 2HHTA 4CEOA 1RDAA 4OLAA 4G1QA 1LWCA 3PO4A 3IG1A 1BCMA 1C1CA 4K8ZA 5I42A 3QLHA 5I3UA 4CFCA 1TL1A 3K57A 4OJRA 2BDPA 2HNZA 4FJ5A 2OPPA 4NCBA 3B6PA 4KTWA 4W5NA 4DF4A 1UA0A 4OKJA 4E7IA 3F73A 5DK5A 5SZTA 2YKNA 4C8NA 2D0BA 4DTRA 3TABA 3D0PA 4DFPA 4B9TA 3ULDA 4FM2A 4C8LA 1NJXA 4CJVA 3AO5A 4CK3A 2OA8A 4MQ3A 4O4GA 3DLBA 1BQNA 3TAQA 5CZ2A 3HJFA 1NOYA 3UIQA 1ZBHA 3KLHA 3ZSQA 2G8VA 4HTUA 2YNGA 3BDPA 4FM0A 1VSIA 3OYKA 1LAVA 3DRRA 1RBVA 5J2MA 1KVAA 3OYFA 1S9EA 3G10A 3V9XA 2X74A 4CHNA 4W5TA 3QETA 3NH1A 4CEZA 5HBMA 4CECA 4CIFA 4FM1A 3QNNA 3EZ5A 1EKEA 3AVLA 4F2RA 4EZ9A 3HP6A 3AVBA 3OYCA 2F8SA 3OYEA 3NCIA 3M8PA 4N76A 1S6QA 4M3UA 1NK5A 1FKOA 4IFVA 4M3WA 2KFZA 4DTNA 4KREA 3VQ5A 1TKTA 3B6OA 3DRSA 1RILA 3HP9A 3EYZA 2RKIA 5HRSA 3DMJA 3QNOA 2HHVA 4ZTJA 3CG7A 5CY4A 2YHAA 2IDOA 4RW9A 3VQ8A 3ZT1A 4CEQA 4CK2A 3SYZA 3OJUA 3V4IA 1JLBA 3NGYA 3KLGA 4KKOA 2DY4A 1HQEA 2VWJA 4IKFA 3VQEA 4HUEA 4Z0UA 3BGRA 4F2SA 4FZZA 5FRMA 1SL1A 1J9AA 2D5RA 2XY8A 3VQPA 1JLEA 3LALA 1XI1A 1TVRA 2IAJA 3NE6A 1VRTA 4I9QA 3E01A 2GUIA 4I2PA 4ELTA 4J2DA 1REVA 2Y1IA 2X6NA 3TAFA 5KGXA 1NK8A 1RDDA 4F8RA 4CIGA 5T7BA 3MXIA 2B4JA 4MFBA 4CJRA 4JS4A 4FLVA 4DSJA 3C94A 1BQMA 2BANA 4OPJA 1KFDA 1LAWA 2G8HA 3SCXA 3LZIA 2KTQA 4FCYA 1KLMA 4IFYA 1BL3A 3RTVA 1TV6A 3RMDA 1VSDA 3CFPA 4HUFA 4DTOA 2HVIA 1TKDA 3LP1A 3OY9A 2YV0X 4CEDA 1KTQA 2BE2A 2QXFA 4CJSA 3I8DA 4FLTA 3DLKA 4FJ9A 2X78A 1QE1A 1VRUA 4DSLA 4AHSA 3V6DA 3AVHA 3O3FA 5KRTA 1EXQA 2P5OA 1TK8A 4F3TA 1X9WA 4CCHA 3ASMA 4JRQA 4DSIA 1DLOA 4CJTA 1GOBA 4HCBA 2IC3A 2O4IA 1KSPA 1VSHA 3RRHA 1UAXA 3M8QA 1BI4B 4DTXA 4Z4FA 5J2PA 3OYBA 1U45A 1WSJA 2XY6A 1QSSA 4FJKA 4DU1A 2OPQA 3LWLA 3LZJA 1WSEA 4KB1A 2KZMA 1RT2A 3AA4A 2PYLA 1UOCA 2E6MA 1X1PA 1I39A 3OYAA 2HMIA 3DM2A 4B8CA 3RMAA 2YHBA 3AVCA 1QSLA 1A5VA 4B9MA 2Z1IA 3MEGA 3PX0A 1RT1A 3ZSZA 1ITGA 3FFIA 2HW3A 4FZYA 1UWBA 3LAKA 2Z1GA 4XIUA 3SPYA 1WNSA 4Y1CA 3U6FA 1XWLA 4RW6A 4C8OA 4CERA 1CZ9A 1HNVA 4N56A 4DQQA 4CJ3A 3V81A 1ZBUA 4FJJA 4OPKA 3I0SA 1TK5A 4AHUA 4KI4A 1QTMA 4CHYA 2PYJA 2AJQA 4FW2A 4B3OA 3KKRA 4M45A 1BHLA 4Z4IA 4CJLA 4KRFA 3DLGA 5CZ1A 3V9SA 3QIOA 4DFMA 3RMCA 1SKSA 4KO0A 3U3YA 4BWMA 2F8TA 1JL1A 1RDCA 4DQRA 2P51A 4W5QA 4CEEA 1NK6A 2B6AA 2Z1HA 2FBVA 5SWMA 3PV8A 1RBRA 1D5AA 2D0AA 1HNIA 1ASUA 2ETJA 1VSEA 4E19A 1EX4A 5J1EA 4DU3A 4UQGA 4FLZA 1YVUA 3OYMA 1S9GA 3H08A 3MEDA 4CEAA 1SL2A 3SZ2A 1R0AA 1J54A 3LPUA 4KHQA 1JLAA 3OYHA 3L2WA 4FJMA 3MEEA 3HL8A 3V9WA 3SPZA 3KIOA 1JLQA 4CJQA 5EU7A 3T3FA 2XO7A 1SL0A 3HPGA 1WAJA 4CGGA 4CHZA 1B92A 3PX6A 2EX3A 3K5MA 3VA0A 4CEBA 4B08A 1BIUA 4Z4GA 1FXXA 2FC0A 4ICLA 4E1MA 1MU2A 3L3UA 1FK9A 4C8MA 1Q9YA 4KTQA 1YT3A 4CHPA 1JLCA 3DRPA 4Z4HA 3VA3A 4KHYA 3K2PA 4LSLA 1GOCA 1IKYA 4E0DA 3RRGA 5HRPA 1EP4A 3SI6A 1WSIA 3SQ4A 3OS0A 2FBTA 2HHWA 1IKWA 4CGIA 4LD0A 1LWEA 4CIEA 3TAPA 3NF6A 1G15A 1A5WA 4CEFA 3NGZA 4DLEA 4DS5A 2PY5A 3NH2A 1HMVA 3KJVA 3NF7A 3KKSA 3S3OA 1F21A 3AV9A 1VK0A 4FVMA 3NF9A 4M3XA
chains in the Genus database with same CATH superfamily
4KAZA 2NRZA 1Z6RA 4QAGA 5HRRA 3TR8A 4JV5K 3AGKA 4RW8A 3WNGA 2XY5A 3A5LC 4DWIA 2G8KA 3U3GA 2HBJA 3MK6A 1IO2A 3S9HA 3C6AA 3FE1A 4YOWA 1LWFA 4CGJA 3EZWA 4FZXC 2NUBA 4CJKA 3O4QA 3ENHA 3GBTA 4AILC 2XRIA 1VQPN 3C95A 4JK8A 1U4BA 3LP3A 4B3SK 3P1GA 1QVGM 1ASVA 1K8KA 1D8YA 1NKBA 2OZSA 1NMDA 3QMLA 4EHUA 4N47A 3VERA 3TSQA 3O3HA 4DR7K 1RT3A 3LM2A 1NGEA 3KLFA 3F9KA 1VQ8N 1S1WA 4LF9K 4DV1K 4IXCA 4LF4K 2QK9A 4DQPA 4CJ4A 3J81O 4CK1A 2E8AA 3JYTA 1W2BM 4AF1A 1ZYQA 1U47A 5KGWA 4YNQA 4I6MB 1J6ZA 3SV3A 5HROA 4FWRA 4M3RA 2GTDA 2P9KB 5DMRA 4JI6K 4CFDA 5CYQA 3AGRA 4CJ5A 1L3SA 1SQKA 4AHCA 4BE2A 3AO1A 5DM7L 3PO5A 1HYSA 1RDBA 4ISGA 4CF9A 4JKGA 2YJEA 3MWPA 3AAPA 1Q86O 2I7PA 3V1OA 3MXJA 4O0JA 4BDPA 1JCGA 4EFHA 4OLBA 3F2KA 2Z1JA 1T44A 4FLWA 4J2AA 4FOEA 3IUCA 2OPSA 1OH7A 3H1VX 3K5NA 5LY3A 3PY8A 3AA2A 1HYZA 5FDLA 2XY7A 4IOAL 3A5OC 4PA1A 3IFRA 3KK7A 1S1UA 1U04A 4BE1A 4GVEA 1YI2N 5KPRA 4AHRA 1VQ6N 4BRHA 2P9LB 1ZBFA 3M3ZA 1GLEG 4XEIA 4BRDA 4CJWA 1HPZA 3ULEA 4LH4A 3IDHA 3LWMA 3C65A 3TI0A 2WC9A 4DV5K 3KWGA 5FRMA 3MMVA 5KI6A 1IV0A 3P5JA 3NVMA 3NDKA 3TTCA 3HVRA 1K6YA 4O55A 1CXUA 3PLAA 4CJFA 4M3TA 3DLRA 4BY9C 4OO1J 4BRFA 4FPBA 1KVBA 4WQ4C 4DV0K 3HI0A 3I56N 3VQBA 1Z26A 2A41A 4XH1A 4DG1A 1YITN 4EIAA 4QOZB 2E88A 1L3TA 1QHTA 2GUPA 2AA4A 4BE0A 1KLNA 3IAYA 2OTJN 1Y64A 5EX5A 1HNWK 3DLHA 4KTZA 3G71N 4IO8A 3RR8A 1KRPA 2CH5A 3B8AX 1LCUA 3K58A 5BPMA 1SUQA 3QB0A 1SV5A 1S1XA 1WSGA 3CYMA 4BRNA 4O0IA 1A5XA 3VQ4A 1RDWX 2OPRA 1Q8IA 3ZSYA 4RW7A 1R59O 3AO2A 3AVIA 1RT4A 3U8XA 3ZT0A 3L2UA 3EL2A 1NK9A 1LV5A 1BCOA 1HJRA 1IKXA 2WOMA 3VN5A 4YDUC 3CFOA 1ZBLA 4ELVA 3SJJA 5BR8K 4H5WA 1C0TA 4DR5K 2HNDA 5JICA 4W5RA 3OTOK 5KRSA 2VWKA 1TAQA 2YHXA 4JRPA 3QFUA 4X62K 3UE5A 3SV4A 4OPHA 4BG8A 3ZEUA 5FROA 1C1BA 2CH6A 4DHYA 3CM5A 5GAEP 4IOCL 3E66A 4BGBA 5FRNA 2G8IA 2D4WA 1T7PA 3WXKA 2ZQBA 1JLGA 1TGOA 4J2EA 1DTTA 5AQIA 2P9NA 3G0ZA 2B5JA 3SAGA 4JI4K 4H0OA 3O08A 5AZJA 1GLCG 2DFFA 2IGIA 3CFRA 4PUOA 4NCGA 4JI7K 1XNRK 2ASPA 3ZCMA 3DI6A 4FLUA 1JXEA 4OGCA 1HYVA 3RWUA 2R7YA 1E4GT 4B9UA 3RSEB 3DYAA 3EN9A 1KXPA 3LANA 2VGNA 4WQ5C 3C6UA 2FSJA 5E41A 4JK7A 1L3VA 3ZSVA 3HO1A 3VQ9A 4BC5A 3R9PA 3S3MA 4E7LA 1IG9A 4FK4A 5AQRA 1HKBA 3CCRN 4BR4A 1SAZA 1VSJA 3T69A 2P5GA 4HVJA 4OLAA 1RDAA 1LWCA 1BCMA 2HSTA 4I6MA 4CZEA 5I3UA 3J80O 4MDAA 1EWRA 1TL1A 4BC4A 5AQPA 3K57A 4OJRA 2BDPA 3T1HK 4FVUA 5LMNK 3C0BA 4JI8K 4DF4A 4OKJA 1XC3A 3VETA 3VEVA 4FJXA 3FR0A 3AO5A 3VTHA 5BPNA 4O4GA 5CZ2A 1NOYA 3E9LA 4YHHK 3DAWA 2J4RA 5J2MA 3OYFA 1S9EA 3V9XA 4CHNA 1HNXK 4CECA 3E9PA 4F2RA 2QA4N 3AVBA 4C1NI 3J7YP 1S6QA 5F0XA 4IFVA 4IDHA 3OW2M 3VQ5A 1TKTA 3B6OA 3VGMA 1IBKK 4K43A 3O9TA 2RKIA 5HRSA 2ASOA 3DMJA 3ZT1A 1YUWA 2UXBK 4CEQA 1JLBA 2A5XA 3NGYA 1QQOA 4IKFA 4YY3K 2YCHA 3E9OA 3BGRA 3UKRB 1VQLN 4F2SA 2O8DB 2Q36A 3CCVN 3TSPA 4QS8A 3VQPA 2V7YA 1TVRA 1VRTA 3CJ1A 1REVA 3SMSA 1NGCA 1BQMA 2G8HA 4KH4A 3RMDA 2RE2A 1ATNA 1VSDA 4NLBA 4BR5A 4YOVA 3LP1A 4YOTA 3R1XA 1TYQB 5I9EB 1NGBA 2JWLA 4AHSA 4H0TB 1BDGA 2WBNA 1X9WA 4AM7A 3O9SA 2BUPA 2IC3A 1VSHA 1UAXA 4DTXA 1BI4B 1K9MO 4Z4FA 5J2PA 1U45A 1BOTO 4DU1A 2OPQA 3LZJA 1WSEA 4MO4A 3AA4A 1LOTB 1X1PA 3OYAA 4KH6A 2YHBA 5A2QO 3AVCA 2Z1IA 5EVZA 1ITGA 4BR0A 3D2EB 2KKZA 3LAKA 2Z1GA 1K8AO 4XIUA 1X9JA 3SK3A 3ENOA 4N56A 3V81A 1ZBUA 4FJJA 1NGHA 2NLXA 3ATUA 4PHTX 2E1ZA 2V7ZA 5EXWA 2HBLA 4CJLA 2QW9A 3DLGA 5CZ1A 3CCMN 4DFMA 3U3YA 4BWMA 2QWRA 4DQRA 4CEEA 4BQZA 5AQFA 2FBVA 2ETJA 5J1EA 4FLZA 4M7XA 1RDUA 3O5BA 1D4XA 3H08A 4IEEA 4E1JA 1FJGK 1SL2A 3U9ZA 4LFAK 1J54A 4KHQA 4BR9A 4LC9B 5EU7A 4BQLA 1SL0A 4CHZA 3EKSA 4FWPA 4CEBA 2FC0A 4E1MA 1Q9YA 4C8MA 4CHPA 3DRPA 4Z4HA 3VA3A 3ID8A 3RSEA 2E2NA 1IKWA 4RWTA 4CGIA 4LD0A 3TAPA 2NRTA 3NF6A 2QWMA 4DLEA 1Z05A 4H03B 1ZC6A 2RPIA 4CGHA 1VSFA 4AH9A 1YJWN 3ZETA 1WBDA 5AQUA 5FPDA 5JLFA 5GADP 1XHZA 3THXB 4JKGB 1FKPA 3PSFA 3K9KA 4A61A 3UKUB 3H6EA 2AP1A 4DV6K 4FYDA 2PAVA 2ZM6K 4B9QA 2ZJQL 5CR4A 2F9WA 4CF2A 3P4IA 4IEIA 3RR7A 1WSHA 3KLIA 2BGGA 3WEEB 4H8KA 4DTUA 4IWVA 4PY5A 2EWSA 3LP2A 3G4SN 1MWMA 5KTQA 4HHTA 3MN6A 1Q18A 2HVHA 2EHGA 1CLQA 3JAMO 3DOKA 4IG0A 4Q0BA 3AA3A 2P9SA 3QO9A 3AO3A 3VQCA 1IH7A 2D0PA 5GINA 1E4FT 1YTUA 1FW6A 5KPZA 2WFBA 4ID1A 1VQKN 3CHWA 3L6QA 1RT5A 4JKAA 2QWQA 1GLLO 3V1RA 3FZHA 3SUQA 4B8AB 4R79A 4K8XA 4BRIA 4H0YB 3TAEA 2HBMA 5GAGP 5HP1A 4HUGA 4M3YA 3NF8A 3UKRA 1Q82O 3ITHA 1U6ZA 4BRCA 5M1NA 4KPYA 3FZMA 1XUPO 4YFUA 5BN8A 3A2FA 4BRAA 2UXDK 2NZTA 3WXLA 4CBXA 4JYAK 1C1AA 5FPNA 4CD1A 4JLHA 3KTQA 1LW0A 3QEVA 2UXCK 1BG3A 3KZBA 3KD5E 5AZIB 1ATRA 3CCUN 1WSFA 4DFKA 1VQ9N 3N4PA 4M42A 4C8KA 3P31A 4CJPA 4B1YB 1KD1O 2KQ2A 3V1QA 3QEPA 4PQUA 4ID5A 2O4GA 1RTHA 2KZZA 1BI4A 4DV3K 3AVKA 4BR2A 1HR0K 3SAHA 4JS5A 3MN5A 3O6WA 3WUHA 2E4LA 4JI5K 1VQ5N 4AQYK 3OA9A 3LDSA 5MLCQ 3NBPA 4DV2K 5EY4A 1W0HA 3A5MC 4DTJA 3ZEUB 5E26A 1VSLA 4CHOA 5AFUH 3TAGA 2KFNA 3HBTA 4B1ZA 1X9MA 3AVGA 1OVYA 4DMNA 1KQSM 1YTAA 1J53A 4KV8A 2NNWA 3HRGA 3OYGA 3I0RA 3CF5L 2Q97A 3QEIA 2P9NB 1S22A 4O44A 1U48A 1WB9A 2CGKA 2VWBA 5AZJB 5LJWA 4B9NA 2GV9A 1DTQA 4N41A 4LF6K 1KC8O 3IKMA 1RT7A 1OVQA 1RBSA 3JS6A 4ZHRA 5M1KA 3WQUA 3CCSN 5AQNA 1JKHA 2Q2RA 1RBUA 4CZJA 3SNNA 5GAHP 4KB0A 2X6SA 4E1NA 5AR0A 4E7JA 2KW4A 1NJWA 4CF8A 3AA5X 3O80A 3KLEA 2Q0UA 5BPLA 1ASWA 4FW1A 1D9FA 4PWDA 2E5LK 4LSNA 2QKKA 1J5EK 3MXMA 3T1YK 4Z4EA 1SKWA 4H0VB 1W9HA 4NYNA 4A62A 3GG4A 4DSFA 4CE9A 3AVMA 4F3OA 1RFQA 5AQTA 5AQSA 4OGEA 3QICA 1YVNA 3QEXA 3WXMB 4JKCA 3O9RA 3TU5A 4CW7B 4R5PA 3THXA 2NRWA 4I7FA 1NKCA 3AO4A 1KVCA 4JEPA 3KK2A 5C0YA 3UKUA 4FJIA 3VQ7A 1NLVA 3PSIA 1HPMA 2IOCA 1IG8A 1RBTA 1Q81O 2PBDA 1D9DA 2XHBA 3WEEA 2O8CB 4RW4A 1ZBSA 2YHYA 4DR4K 4KHWA 2CGJA 2UUCK 4CZKA 5KQDA 1T6CA 3HXMA 3L2VA 2YKMA 4HWIA 5M1QA 3P38A 1TUYA 4DR2K 3DOLA 4O8UA 5JMVA 4GKJK 5M1PA 1TK0A 2HHXA 3OJSA 4NYFA 4CEOA 1N33K 4G1QA 3PO4A 3IG1A 1C1CA 4K8ZA 4MO5A 4FWSA 4DCHA 2HNZA 3Q7BA 5LMUK 5AJ3K 4NCBA 1GLDG 4U7BA 4FL9A 3A8YA 4XH5A 2YKNA 4C8NA 2D0BA 4OPAA 3UB5A 2UUBK 3DLBA 4JKDA 1ZBHA 3NVKA 3KLHA 3ZSQA 2G8VA 3BDPA 2VCPA 1EQYA 1HKCA 1VSIA 2E2PA 3DRRA 1RBVA 4BRPA 1KVAA 4W5TA 3BY5A 5AZIA 4CIFA 5JVHL 1EKEA 4PL8A 4EZ9A 3OYCA 3OYEA 3M8PA 3THYA 1NK5A 1FKOA 4JKEA 3DRSA 4BRMA 4QS9A 3VF2A 1HNZK 3CG7A 5CY4A 1M90O 1VQ7N 5AQHA 3CPEA 3KLGA 2OCEA 4ISEA 4Z0UA 4GV6A 3MCPA 2GWJA 4MDBA 1XI1A 1WBBA 1K73O 3NE6A 3DXKB 4H0PA 5FLXO 3ZX2A 3N4QA 2Y1IA 2X6NA 3ATVA 3GOIA 3TAFA 3MXIA 4JS4A 4FLVA 2BANA 1KFDA 1DKGD 4FCYA 4IFYA 4DTOA 4HUFA 3SLCA 1TKDA 3OY9A 2YV0X 3I8DA 2X78A 1QE1A 1VRUA 4A5BA 4BRKA 2P5OA 3BUZB 4YOUA 4WF9L 2FSNA 1GOBA 2IVPA 3MN9A 2HF3A 3LM9A 2P9IB 1WSJA 2XY6A 1QSSA 4FJKA 1GLFO 3VEWA 3I55N 3LWLA 3CCEN 4KB1A 3CI5A 2KZMA 1RT2A 4JI2K 4BRLA 2HMIA 4FPAA 4C23A 1A5VA 3PX0A 1RT1A 3ZSZA 4FZYA 3C7NB 1P8ZA 4RW6A 4CERA 4OX9K 3GE1A 4DQQA 5BRHA 3CJ7A 4LFCK 2QWOA 5KQ8A 4KI4A 1QTMA 4CHYA 2AJQA 4FW2A 4A2AA 3KKRA 1HUXA 2IVOA 3PIOL 1BHLA 4Z4IA 3V9SA 3QIOA 1ILYA 3ZETB 2F8TA 1EWQA 2P51A 4W5QA 2B6AA 1Q7YO 1WUAA 4UQGA 3NMUA 3OYMA 2KLAA 3SZ2A 3OYHA 4PKHA 3HL8A 3V9WA 3SPZA 1JLQA 1YHQN 4CGGA 1U2VB 3VA0A 5AQOA 4B08A 1FXXA 4ICLA 4UY8O 5CE3A 4F3TA 4KTQA 1YT3A 4LSLA 3WXJA 3SAFA 3RRGA 2O8CA 5HRPA 4NLCA 4NXMK 4YOXA 2HHWA 4ILJA 3KHYA 2P9SB 5IT9O 3WXIA 1G15A 3IMXA 4JNEA 1HMVA 3KJVA 3I33A 3CCJN 3KWIA 5BRFA 2UUAK 3NF9A 2GWKA 4WCEL 3AY9A 3MECA 2P9PA 4FK0A 2A1SA 4AHVA 1JLFA 1QZ6A 3LDLA 2VG5A 3LPTA 1VQMN 4AHTA 3HOSA 1XMQK 1S1TA 4I2QA 3VQQA 4ZTFA 3BEXA 4EAHD 3RMBA 1N6QA 5DM6L 3EO3A 4F9OA 1C0MA 3K59A 2G8WA 1W97L 4BG9A 2PZSA 3NGIA 4B9SA 2IS3A 3H3NO 4M3ZA 2JWKA 3FFKB 3CM6A 1OH8A 4CZFA 1N36K 1KAZA 4BACA 4G9ZA 2G8UA 2QTDA 3ZSRA 2Q1NA 4CZLA 3CMAN 2YNIA 3AVFA 4FWMA 3HM8A 4IDKA 3NHGA 2ZGYA 5M1OA 5B8HA 1KAXA 3E1YA 4OVLA 5C10A 1YF5L 3D7EO 3L2RA 3EY1A 1GLJO 3AARA 3THWB 4M7YA 5K14A 1IKVA 2NRRA 5CYMA 4CGFA 4DF8A 2H3GX 4JD2A 3ZT2A 4DSKA 1HKGA 1CZAN 4ELUA 4LH5A 4LY7A 2HNYA 3VQ6A 1QS4A 2YJFA 3TTFA 3LDNA 4H5NA 3DXKA 4KHSA 2HBKA 3H3OB 1XNQK 1X9SA 2ITMA 3R8EA 5D3GA 4X66K 1RT6A 2WONA 1VQ4N 2DPNA 3P83D 4WQ5A 3BF1A 1RGIA 1S5JA 4RG8A 3S3NA 2DFHA 1YAGA 4CJ7A 4DR1K 4FLYA 3H46O 4FK2A 4GW6A 2NRHA 3VF6A 3ZSWA 3EE9A 4H5TA 2P9IA 3ALYA 4E89A 3SQ1A 3HPOA 3TWHA 1NM1A 4GV9A 3QERA 4J2BA 4CJUA 1NG9A 2FBXA 3CQYA 3GDQA 3C7NA 3M8RA 2A1RA 3TAMA 3VGKA 5C2FA 1H1VA 3F5TA 5JS1A 3DWLA 1T05A 4GNIA 1N32K 5JVGL 2YX6A 3NFAA 4WE1A 1O13A 3DLEA 2FBYA 3BZKA 1EETA 4CGDA 1T03A 3PX4A 4EP4A 3O1WA 2ITGA 3HT3A 4A57A 3V9ZA 1S3XA 1QSYA 2ZJPL 4DUZK 4LFBK 3TARA 1L3UA 2OANA 3T1AA 3QEWA 3O1BA 4FSVA 1U2VA 3C6TA 2QM1A 4CJEA 3HSCA 3PUFA 2HOEA 3OYJA 4Y0WA 3SUPA 1ZBIA 2P1JA 3HVTA 4JI3K 1I3AA 4FJNA 2QWPA 5FPEA 1RTIA 1BA0A 4ILHA 3QIPA 1LW2A 2GEMA 1C6VA 1Q9XA 3FZKA 5GIPA 3ZSXA 2HMPA 1GLAG 1NJZA 1G99A 4DSEA 2W42A 1O1WA 5GIOA 2VG6A 3HM9A 1VQON 5BR9A 5E84A 2GBZA 1BA1A 3CQ8A 2A42A 5AQXA 4M41A 4FWQA 4A59A 1NGDA 1SKRA 4BDYA 4DR3K 1Y97A 4CESA 2O8EA 4CFBA 1QHAA 3O9UA 2DFEA 3OYNA 4FJHA 1C0UA 4DQSA 2VQFK 4CF0A 4I9LA 3IS9A 1WAFA 4PKGA 1RTDA 4B3TK 1YXQA 1T8EA 3VQDA 1VSKA 4WYBA 3SUNA 4B3RK 2OZMA 3KVGA 3K0SA 3OYLA 2JGUA 4BWJA 3P39A 3KK1A 2RF2A 3L3VA 4AM6A 3THYB 3ENBA 3VF4A 4CF1A 5HL7L 1NKEA 4FLXA 2HHTA 5I42A 3QLHA 4CFCA 4V19S 4K41A 4GV3A 3LDOA 3VPZA 3MX5A 3DXMB 3CERA 3MWTA 3THWA 4FJ5A 4KTWA 4W5NA 3CC2N 4E7IA 3G6EN 3TPQA 5DK5A 3D0PA 4B9TA 1WOQA 3ULDA 4FM2A 4CJVA 4HTUA 4JI0K 4FM0A 3EE8A 3ID6A 1T6DA 4DKWA 2X74A 4J8FA 3L4IA 3QETA 4CEZA 4FM1A 3QNNA 3U9DA 4LF5K 3EZ5A 4U67L 3J7AP 3HP6A 2ZWHA 3NCIA 4N76A 5BRDA 4M3WA 2WTUA 2FF6A 4DTNA 1RILA 3HP9A 3EYZA 4B1VA 3D2FA 1VHXA 2HHVA 4ZTJA 3SYZA 3SQ4A 3VQ8A 2IDOA 4CK2A 3V4IA 3BP8A 4KKOA 2DY4A 1HQEA 4WFBL 5H1SQ 4FZZA 1SL1A 1JLEA 1E3MA 2A3ZA 4I9QA 4I2PA 4J2DA 2QXLA 5KGXA 1RDDA 2P9UA 4F8RA 5T7BA 2B4JA 4MFBA 4H5VA 4CJRA 4DSJA 4CZIA 4CZGA 1IBMK 3SCXA 2HVIA 1BL3A 3QDKA 1JCFA 1S72N 3CFPA 3O8MA 3FGUA 1KTQA 2QXFA 4CVNE 4FLTA 4FJ9A 3DLKA 4C1NK 4MLEA 3AVHA 2O8BA 1EXQA 1ESVA 4A5AA 1TK8A 1JCEA 4JKBA 4JRQA 4DV7K 4CZMA 4DSIA 3M5RA 3RRHA 4DB3A 1BUPA 3CJAA 2RHKA 1OH5A 4BRGA 2E6MA 5AQJA 1I39A 4ISFA 3DM2A 3RMAA 2PFUA 5AQMA 4B9MA 1N8RO 3VOVA 3FFIA 3S41A 2HW3A 1UWBA 3ZLJA 4Y1CA 3U6FA 4C8OA 1XWLA 1SZ2A 2UU9K 4CJ3A 1JJ2M 3PIPL 4OPKA 2PYJA 4JAXA 4DV4K 2P9PB 4KRFA 4GY2B 1JL1A 1RDCA 2IIRA 5BN9A 4IFEA 3K9JA 2Z1HA 5SWMA 3PV8A 1RBRA 4JHDA 1IJJA 4BREA 2QWLA 1YVUA 2OTLN 4IJNA 1R0AA 1VQNN 3LPUA 1JLAA 3ZX0A 4BROA 1QQMA 3OBYA 4DR6K 3K5MA 1BIUA 4Z4GA 1MU2A 1FK9A 2V51B 1DGKN 3K2PA 1GOCA 1IKYA 1EP4A 3SI6A 2F7TA 3OS0A 4LF8K 3SMPA 2I7NA 2D1KA 3R6MA 4CEFA 1X3NA 4DS5A 3NH2A 2A6AA 3VEXA 3OBWA 3NF7A 3KKSA 5ADXH 1ZXOA 2V52B 3AV9A 1MA9B 5BREA 3VQAA 3LL3A 4DTSA 5AQVA 3BF3A 4JK9A 2BTFA 2VG7A 2WUSA 5EOYA 4GMJB 4B1XB 4BVOA 5AFUA 1OH6A 1HRHA 1RCHA 4JD2B 1KCFA 2DTUA 3DXMA 4BRQA 2RN2A 2HHQA 4GVMA 4CBUA 3CCLN 1XQSC 4XH4A 1VAZA 4DTPA 4NO7A 2QI2A 3SBGA 1QZ5A 5HLFA 4DQIA 1ATSA 1TL3A 2KHOA 3ZT4A 3THVA 2ZE2A 3L2QA 4CHQA 3SJHA 5KPTA 2F96A 1P90A 3DLLL 4DU4A 4A2BA 3HK2A 4E7HA 3NAEA 3SQ0A 3ZSOA 4MLHA 2GX9A 2ZJRL 3CJ9A 2E2QA 4WFNL 3ZYYX 3HOTA 1NNEA 3LDQA 3H1QA 5AQKA 4HCCA 4NCAA 1EO1A 3VEOA 4KHUA 2HB5A 1U49A 3EKUA 4CFAA 3ISNC 4FJ7A 1WLJA 3RVCA 4IG3A 4DS4A 2FSKA 1JXBA 3O3GA 3QFPA 3AVAA 3LP0A 3ZX3A 3VESA 4H4MA 5C25A 1Z25A 2ASMA 3LAMA 1GLBG 4KFBA 2FLOA 4DTMA 2O8FB 3ZT3A 2Q3SA 4DUYK 4B9LA 1DEJA 3HYFA 2W40A 2ZD1A 4QS7A 3L8BA 4CBWA 2W6LA 2E6LA 1XC9A 3AAQA 3IRXA 4KHNA 4O5FA 1S1VA 3AVNA 3WNEA 3M1FA 1NJIO 3M8SA 3CQXA 5M1FA 3NH0A 4FXDA 4QCLA 3QBXA 3A0IX 5C12A 3GL1A 4FJLA 4CI6A 3T19A 1CZBA 4EZ6A 4EP5A 4DQ8A 5CHIA 1UA1A 1NMNA 1YJ9N 2ZGZA 3TANA 3C6HA 3HPHA 4FWLA 3VMFB 4Y1DA 3OYDA 4L3QA 2P9KA 3O4NA 4GKKK 3QINA 1HLUA 3OS2A 2YNFA 3MAQA 4OKEA 2D0CA 1TKXA 4F4KA 1KFSA 4IJAA 3AVJA 4PKIA 4JKFA 2Q0RA 2OYQA 4Z4CA 4PL7A 4WQ4A 1IBLK 1NJYA 3R3LA 4BDZA 1YJNN 1B9DA 2QWNA 2E20A 4M63C 5J2NA 2Y1JA 3OS1A 3BZCA 1BO5O 3SQ2A 1NGAA 4DFJA 3KK3A 4NXNK 5AQGA 1HQUA 4H4OA 4KI6A 5F2RA 1C0GA 1NK0A 1J5OA 5C2DA 4DLGA 4L8RB 1BGXT 5AQYA 4X64K 1L5UA 3VGLA 4JKHA 4W5OA 3TSUA 2Q31A 2O8EB 1YIJN 4KBOA 1M1KO 1XHXA 1NGFA 3CPWM 4FOIA 3D45A 2P9LA 4YDUA 1N5YA 1RTJA 1B9FA 1JL2A 5ADXA 3J8AA 4N5SA 1QQCA 3WT0A 4B9VA 1BIZA 4O8KA 4RTFD 5HRNA 5J2QA 2LSNA 1BISA 3K5OA 5C24A 3D6RA 5LJVA 3V9UA 4BR7A 3OYIA 4NB4A 5C42A 3HSTB 3CCQN 4E7KA 4TSXA 1MDUB 3L4QA 4YOYA 3JSMA 1SS6A 4FJ8A 2HHUA 3I8BA 2HF4A 1NGIA 3G25A 3K5LA 3VENA 1BWFO 3DJCA 1TAUA 2I5JA 1C0FA 1NK7A 1HJOA 3QESA 4IBNA 4FJGA 1NOZA 4Z94A 3WNHA 4E3SA 1MWKA 4OKKA 4CZHA 3WQTA 5JS2A 2UYTA 3OVNA 1VSMA 4CD3A 2E1YA 1CXQA 4O5BA 3QBWA 1N34K 1GOAA 1NU0A 3T7ZA 1NWKA 5TKYA 2G8FA 2QKBA 4BVPA 1NGGA 4HTLA 3JXUA 3WNFA 1BU6O 3HTVA 2VGMA 2HHSA 1HX1A 1RNHA 1WN7A 3CJBA 2NRXA 1NGJA 1S6PA 1TKZA 5ELZA 3CC7N 2ATQA 2JLEA 3CETA 3SUOA 4JI1K 3W0LA 2VQEK 1NK4A 2YNHA 4Q5VA 5AQZA 3KD1E 3D2FB 3U4LA 3VEZA 3MX2A 3H45C 1NBWA 1I94K 1V4SA 2OPPA 2W6KA 3VEYA 5C15A 3J7ZO 3B6PA 1UA0A 3L0QA 4FWNA 3F73A 5IWAK 5SZTA 4DTRA 3TABA 4DFPA 4C8LA 1KAYA 2P9UB 1NJXA 2OA8A 3OHRA 4CK3A 3HJFA 4MQ3A 1BQNA 3TAQA 3CJCA 3UIQA 2O8FA 1TUUA 2YNGA 1K8KB 4B3MK 4BGAA 3FLCO 3OYKA 1LAVA 3TTDA 3Q7CA 3LDPA 2HHHK 3G10A 2O8BB 2NRVA 4EHTA 3NH1A 5HBMA 3AVLA 3EEQA 2F8SA 4M3UA 2KFZA 4KREA 1QVFM 5AQLA 3QNOA 4KH5A 2YHAA 4RW9A 4BC2A 3OJUA 3CMEN 3W3DA 5HOOA 2VWJA 3CC4N 4IZ9A 3VQEA 4BC3A 4HUEA 4B1UB 1J9AA 2D5RA 2XY8A 3M6GA 5F1XA 3LALA 2IAJA 3MN7A 4FWOA 2D0OA 2GUIA 3E01A 3FZLA 4ELTA 1NK8A 3FZFA 4CIGA 2VYPA 4K25A 3C94A 4OPJA 4ILGB 1LAWA 3LZIA 2KTQA 1KLMA 3RTVA 1TV6A 3CXCM 4RCHA 3CIPA 4CEDA 2BE2A 4CJSA 4JHDB 4DSLA 3V6DA 3O3FA 1X3MA 5KRTA 4HCBA 4CCHA 3ASMA 4K42A 1DLOA 5LL6Z 3SBTA 1QQNA 1T3VA 2IVNA 4IOXA 4CJTA 2F4VK 2O4IA 1KSPA 5AQQA 3M8QA 3OYBA 4KHPK 3ULEB 2YHWA 3VTIA 2PYLA 1UOCA 4B8CA 4H5RA 1QSLA 3MDQA 4YORA 3MEGA 3O9QA 3SPYA 2FXUA 1WNSA 2BH1A 2CGLA 4IO9L 1XMOK 1CZ9A 1DT9A 1HNVA 2O8DA 4X65K 3I0SA 1TK5A 4AHUA 2W41A 4B3OA 4LF7K 4M45A 4FO0A 3A5NC 3MCAB 4WFAL 3RMCA 1SKSA 2FF3B 4KO0A 2YI1A 1NK6A 5JLHA 1W7AA 1D5AA 1TYQA 1OKJA 2D0AA 1HNIA 1ASUA 4E19A 1VSEA 1EX4A 4JN4A 5FPMA 4DU3A 3CD6N 1S9GA 3MEDA 4CEAA 2F9TA 1V4TA 3L2WA 4FJMA 3MEEA 4K0KK 3KIOA 4CJQA 3T3FA 3F9MA 2XO7A 3HPGA 1WAJA 2E2OA 1B92A 3PX6A 2EX3A 3L3UA 4H0XB 1JLCA 4KHYA 3HZ6A 4E0DA 1WSIA 2A40A 2FBTA 3D2EA 5AQWA 3O4WA 2GELA 1LWEA 4CIEA 4FWKA 1A5WA 3NGZA 2PY5A 4B1WB 5TKWA 2ZF5O 3S3OA 1F21A 2QEXN 4FVMA 1VK0A 4M3XA
chains in the Genus database with same CATH topology
2RPIA 4CGHA 3VQAA 1VSFA 3MECA 4AH9A 4KAZA 4FK0A 2A1SA 4DTSA 4QAGA 1JLFA 4AHVA 5HRRA 2VG5A 3LPTA 3TR8A 2VG7A 4GMJB 4RW8A 4AHTA 1XHZA 3WNGA 1FKPA 1HRHA 2XY5A 1S1TA 4I2QA 1RCHA 4DWIA 1KCFA 2G8KA 3U3GA 2DTUA 2RN2A 3VQQA 2HHQA 4GVMA 4FYDA 1IO2A 3S9HA 4ZTFA 1LWFA 4CGJA 4DTPA 3RMBA 1N6QA 5HLFA 4DQIA 2NUBA 4CJKA 3O4QA 1TL3A 4CF2A 3ZT4A 1C0MA 3K59A 3THVA 2G8WA 3RR7A 1WSHA 2ZE2A 3KLIA 3L2QA 4CHQA 2BGGA 4H8KA 4DTUA 4AILC 2F96A 2XRIA 2PZSA 3NGIA 3C95A 1U4BA 4DU4A 4B9SA 2IS3A 4PY5A 3LP3A 3HK2A 4E7HA 3LP2A 3NAEA 3ZSOA 3SQ0A 3P1GA 5KTQA 1ASVA 1D8YA 4M3ZA 4HHTA 1NKBA 2OZSA 4N47A 2HVHA 3CM6A 3O3HA 1RT3A 2EHGA 3KLFA 3F9KA 1CLQA 4HCCA 4NCAA 1S1WA 3DOKA 4IG0A 4BACA 3AA3A 4Q0BA 3QO9A 2G8UA 2QK9A 3ZSRA 4KHUA 2HB5A 4DQPA 2YNIA 3AO3A 4CJ4A 1U49A 4CK1A 3JYTA 3AVFA 3VQCA 1ZYQA 1IH7A 1U47A 4IDKA 3NHGA 5KGWA 4CFAA 4YNQA 5HROA 3SV3A 3ISNC 4FJ7A 1YTUA 1WLJA 4OVLA 4ID1A 4M3RA 1RT5A 4IG3A 5DMRA 4CFDA 3L2RA 4DS4A 1JXBA 3EY1A 3V1RA 5CYQA 4CJ5A 3O3GA 1L3SA 3AVAA 4AHCA 3SUQA 4BE2A 3LP0A 4B8AB 3AO1A 3PO5A 1HYSA 5K14A 1RDBA 4H4MA 1IKVA 5CYMA 4CGFA 4CF9A 5C25A 4DF8A 1Z25A 4K8XA 3TAEA 5HP1A 4HUGA 4M3YA 3V1OA 3LAMA 3NF8A 3MXJA 3ZT2A 4DSKA 3ITHA 4O0JA 4BDPA 4ELUA 4LH5A 4LY7A 2HNYA 4KFBA 3VQ6A 1QS4A 4KPYA 4DTMA 4OLBA 4YFUA 3ZT3A 2Z1JA 2Q3SA 4FLWA 4J2AA 3A2FA 4KHSA 4B9LA 3HYFA 1X9SA 2ZD1A 3L8BA 2OPSA 3K5NA 5D3GA 1RT6A 2E6LA 2WONA 1XC9A 4FJHA 3IRXA 1C1AA 4KHNA 3PY8A 1S1VA 3AA2A 3AVNA 3P83D 4JLHA 1LW0A 3WNEA 3QEVA 1HYZA 3M8SA 5FDLA 2XY7A 3KTQA 3KD5E 1WSFA 3NH0A 4PA1A 1S5JA 4DFKA 4FXDA 4QCLA 4RG8A 3S3NA 4M42A 4C8KA 4CJPA 4FJLA 1S1UA 2DFHA 3T19A 1U04A 1CZBA 4EZ6A 2KQ2A 4BE1A 4EP5A 3V1QA 4FLYA 3QEPA 4FK2A 4GW6A 1UA1A 4PQUA 4AHRA 4ID5A 2O4GA 1RTHA 3ZSWA 1ZBFA 2KZZA 1BI4A 3AVKA 4CJWA 3TANA 3HPHA 3OYDA 1HPZA 4Y1DA 3ALYA 4LH4A 4JS5A 4E89A 3SQ1A 3LWMA 3O4NA 3TI0A 3HPOA 3TWHA 3QINA 5KI6A 3OS2A 2YNFA 3QERA 4FZXC 3MAQA 3P5JA 4J2BA 2E4LA 4OKEA 2D0CA 1TKXA 3NDKA 4CJUA 3HVRA 3LDSA 4F4KA 1K6YA 3NBPA 2FBXA 4O55A 1KFSA 1CXUA 3AVJA 4CJFA 4M3TA 3DLRA 2OYQA 1W0HA 4Z4CA 3M8RA 1KVBA 1NJYA 3VQBA 4BDZA 4DTJA 1B9DA 1Z26A 2A1RA 3TAMA 5J2NA 1VSLA 4CHOA 4DG1A 3TAGA 2Y1JA 2KFNA 3OS1A 1X9MA 4QOZB 5JS1A 1L3TA 3SQ2A 1QHTA 3AVGA 4DMNA 4BE0A 1KLNA 3IAYA 4DFJA 3KK3A 1T05A 1YTAA 1HQUA 1J53A 3DLHA 4KTZA 4KV8A 4H4OA 3RR8A 3OYGA 4KI6A 3NFAA 1KRPA 3I0RA 4WE1A 3K58A 3QEIA 1NK0A 1SUQA 1J5OA 3DLEA 1SV5A 1S1XA 1WSGA 3CYMA 4DLGA 2FBYA 4O44A 1U48A 1BGXT 1EETA 4L8RB 4CGDA 4O0IA 3PX4A 1A5XA 1T03A 1L5UA 4B9NA 2GV9A 4EP4A 3VQ4A 1DTQA 4W5OA 2OPRA 4N41A 1Q8IA 1RT7A 3ZSYA 2ITGA 4RW7A 3AO2A 3AVIA 1RT4A 3ZT0A 3HT3A 1RBSA 3L2UA 3V9ZA 4ZHRA 1QSYA 1JKHA 1NK9A 1LV5A 1XHXA 1BCOA 1HJRA 1RBUA 3D45A 3TARA 1L3UA 1IKXA 2WOMA 3SNNA 3T1AA 3VN5A 3QEWA 3CFOA 1ZBLA 1N5YA 1RTJA 1B9FA 1JL2A 4KB0A 4ELVA 3SJJA 2X6SA 4E1NA 4E7JA 2KW4A 4N5SA 1NJWA 1C0TA 1QQCA 3C6TA 4CJEA 2HNDA 4W5RA 4CF8A 3AA5X 3PUFA 4B9VA 1BIZA 5KRSA 3OYJA 3KLEA 2VWKA 3SUPA 1ASWA 1ZBIA 4FW1A 1TAQA 5HRNA 1D9FA 4PWDA 5J2QA 2LSNA 1BISA 2P1JA 3K5OA 4LSNA 5C24A 4JRPA 3HVTA 3OYIA 3V9UA 3MXMA 2QKKA 5C42A 3HSTB 1I3AA 4FJNA 4Z4EA 1SKWA 4E7KA 4TSXA 3SV4A 1RTIA 1W9HA 4NYNA 5FROA 1C1BA 3JSMA 3QIPA 1LW2A 4FJ8A 2HHUA 4DSFA 4CE9A 3CM5A 1C6VA 1Q9XA 3AVMA 4F3OA 3ZSXA 3K5LA 1NJZA 4OGEA 2W42A 1O1WA 4DSEA 5FRNA 2G8IA 1TAUA 3QEXA 2I5JA 2VG6A 1NK7A 3HM9A 1T7PA 2GBZA 2ZQBA 3CQ8A 1JLGA 1TGOA 4FJXA 4J2EA 1DTTA 4R5PA 3QESA 3G0ZA 2B5JA 4I7FA 4IBNA 4M41A 3AO4A 1NOZA 1NKCA 4FJGA 1KVCA 3WNHA 4E3SA 3KK2A 4BDYA 1SKRA 4OKKA 2DFFA 2IGIA 4FJIA 1Y97A 5JS2A 3CFRA 3VQ7A 4CESA 3OVNA 2IOCA 1VSMA 4NCGA 4CFBA 4PUOA 1CXQA 2DFEA 4O5BA 1RBTA 3OYNA 3ZCMA 1C0UA 1GOAA 3DI6A 4FLUA 1JXEA 4OGCA 4DQSA 1D9DA 2G8FA 2QKBA 1HYVA 4CF0A 2XHBA 4I9LA 3IS9A 3RWUA 1WAFA 2R7YA 1RTDA 4B9UA 3WNFA 4RW4A 3DYAA 4KHWA 2HHSA 3HXMA 3LANA 3L2VA 2YKMA 1T8EA 1RNHA 1VSKA 1WN7A 3VQDA 3SUNA 3C6UA 3DOLA 5E41A 1L3VA 3ZSVA 3HO1A 1S6PA 3VQ9A 2OZMA 1TKZA 3S3MA 3OYLA 2ATQA 2JGUA 4E7LA 2JLEA 4BWJA 3KK1A 3SUOA 2RF2A 3L3VA 1IG9A 1TK0A 4FK4A 2HHXA 4CF1A 3OJSA 1NK4A 4NYFA 2YNHA 1NKEA 1VSJA 4Q5VA 2P5GA 4FLXA 3KD1E 4HVJA 2HHTA 4CEOA 1RDAA 4OLAA 4G1QA 1LWCA 3PO4A 3IG1A 1BCMA 1C1CA 4K8ZA 5I42A 3QLHA 5I3UA 4CFCA 1TL1A 3K57A 4OJRA 2BDPA 2HNZA 4FJ5A 2OPPA 4NCBA 3B6PA 4KTWA 4W5NA 4DF4A 1UA0A 4OKJA 4E7IA 3F73A 5DK5A 5SZTA 2YKNA 4C8NA 2D0BA 4DTRA 3TABA 3D0PA 4DFPA 4B9TA 3ULDA 4FM2A 4C8LA 1NJXA 4CJVA 3AO5A 4CK3A 2OA8A 4MQ3A 4O4GA 3DLBA 1BQNA 3TAQA 5CZ2A 3HJFA 1NOYA 3UIQA 1ZBHA 3KLHA 3ZSQA 2G8VA 4HTUA 2YNGA 3BDPA 4FM0A 1VSIA 3OYKA 1LAVA 3DRRA 1RBVA 5J2MA 1KVAA 3OYFA 1S9EA 3G10A 3V9XA 2X74A 4CHNA 4W5TA 3QETA 3NH1A 4CEZA 5HBMA 4CECA 4CIFA 4FM1A 3QNNA 3EZ5A 1EKEA 3AVLA 4F2RA 4EZ9A 3HP6A 3AVBA 3OYCA 2F8SA 3OYEA 3NCIA 3M8PA 4N76A 1S6QA 4M3UA 1NK5A 1FKOA 4IFVA 4M3WA 2KFZA 4DTNA 4KREA 3VQ5A 1TKTA 3B6OA 3DRSA 1RILA 3HP9A 3EYZA 2RKIA 5HRSA 3DMJA 3QNOA 2HHVA 4ZTJA 3CG7A 5CY4A 2YHAA 2IDOA 4RW9A 3VQ8A 3ZT1A 4CEQA 4CK2A 3SYZA 3OJUA 3V4IA 1JLBA 3NGYA 3KLGA 4KKOA 2DY4A 1HQEA 2VWJA 4IKFA 3VQEA 4HUEA 4Z0UA 3BGRA 4F2SA 4FZZA 5FRMA 1SL1A 1J9AA 2D5RA 2XY8A 3VQPA 1JLEA 3LALA 1XI1A 1TVRA 2IAJA 3NE6A 1VRTA 4I9QA 3E01A 2GUIA 4I2PA 4ELTA 4J2DA 1REVA 2Y1IA 2X6NA 3TAFA 5KGXA 1NK8A 1RDDA 4F8RA 4CIGA 5T7BA 3MXIA 2B4JA 4MFBA 4CJRA 4JS4A 4FLVA 4DSJA 3C94A 1BQMA 2BANA 4OPJA 1KFDA 1LAWA 2G8HA 3SCXA 3LZIA 2KTQA 4FCYA 1KLMA 4IFYA 1BL3A 3RTVA 1TV6A 3RMDA 1VSDA 3CFPA 4HUFA 4DTOA 2HVIA 1TKDA 3LP1A 3OY9A 2YV0X 4CEDA 1KTQA 2BE2A 2QXFA 4CJSA 3I8DA 4FLTA 3DLKA 4FJ9A 2X78A 1QE1A 1VRUA 4DSLA 4AHSA 3V6DA 3AVHA 3O3FA 5KRTA 1EXQA 2P5OA 1TK8A 4F3TA 1X9WA 4CCHA 3ASMA 4JRQA 4DSIA 1DLOA 4CJTA 1GOBA 4HCBA 2IC3A 2O4IA 1KSPA 1VSHA 3RRHA 1UAXA 3M8QA 1BI4B 4DTXA 4Z4FA 5J2PA 3OYBA 1U45A 1WSJA 2XY6A 1QSSA 4FJKA 4DU1A 2OPQA 3LWLA 3LZJA 1WSEA 4KB1A 2KZMA 1RT2A 3AA4A 2PYLA 1UOCA 2E6MA 1X1PA 1I39A 3OYAA 2HMIA 3DM2A 4B8CA 3RMAA 2YHBA 3AVCA 1QSLA 1A5VA 4B9MA 2Z1IA 3MEGA 3PX0A 1RT1A 3ZSZA 1ITGA 3FFIA 2HW3A 4FZYA 1UWBA 3LAKA 2Z1GA 4XIUA 3SPYA 1WNSA 4Y1CA 3U6FA 1XWLA 4RW6A 4C8OA 4CERA 1CZ9A 1HNVA 4N56A 4DQQA 4CJ3A 3V81A 1ZBUA 4FJJA 4OPKA 3I0SA 1TK5A 4AHUA 4KI4A 1QTMA 4CHYA 2PYJA 2AJQA 4FW2A 4B3OA 3KKRA 4M45A 1BHLA 4Z4IA 4CJLA 4KRFA 3DLGA 5CZ1A 3V9SA 3QIOA 4DFMA 3RMCA 1SKSA 4KO0A 3U3YA 4BWMA 2F8TA 1JL1A 1RDCA 4DQRA 2P51A 4W5QA 4CEEA 1NK6A 2B6AA 2Z1HA 2FBVA 5SWMA 3PV8A 1RBRA 1D5AA 2D0AA 1HNIA 1ASUA 2ETJA 1VSEA 4E19A 1EX4A 5J1EA 4DU3A 4UQGA 4FLZA 1YVUA 3OYMA 1S9GA 3H08A 3MEDA 4CEAA 1SL2A 3SZ2A 1R0AA 1J54A 3LPUA 4KHQA 1JLAA 3OYHA 3L2WA 4FJMA 3MEEA 3HL8A 3V9WA 3SPZA 3KIOA 1JLQA 4CJQA 5EU7A 3T3FA 2XO7A 1SL0A 3HPGA 1WAJA 4CGGA 4CHZA 1B92A 3PX6A 2EX3A 3K5MA 3VA0A 4CEBA 4B08A 1BIUA 4Z4GA 1FXXA 2FC0A 4ICLA 4E1MA 1MU2A 3L3UA 1FK9A 4C8MA 1Q9YA 4KTQA 1YT3A 4CHPA 1JLCA 3DRPA 4Z4HA 3VA3A 4KHYA 3K2PA 4LSLA 1GOCA 1IKYA 4E0DA 3RRGA 5HRPA 1EP4A 3SI6A 1WSIA 3SQ4A 3OS0A 2FBTA 2HHWA 1IKWA 4CGIA 4LD0A 1LWEA 4CIEA 3TAPA 3NF6A 1G15A 1A5WA 4CEFA 3NGZA 4DLEA 4DS5A 2PY5A 3NH2A 1HMVA 3KJVA 3NF7A 3KKSA 3S3OA 1F21A 3AV9A 1VK0A 4FVMA 3NF9A 4M3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPI A;  4CGH A;  3VQA A;  1VSF A;  3MEC A;  4AH9 A;  4KAZ A;  4FK0 A;  2A1S A;  4DTS A;  4QAG A;  1JLF A;  4AHV A;  5HRR A;  2VG5 A;  3LPT A;  3TR8 A;  2VG7 A;  4GMJ B;  4RW8 A;  4AHT A;  1XHZ A;  3WNG A;  1FKP A;  1HRH A;  2XY5 A;  1S1T A;  4I2Q A;  1RCH A;  4DWI A;  1KCF A;  2G8K A;  3U3G A;  2DTU A;  2RN2 A;  3VQQ A;  2HHQ A;  4GVM A;  4FYD A;  1IO2 A;  3S9H A;  4ZTF A;  1LWF A;  4CGJ A;  4DTP A;  3RMB A;  1N6Q A;  5HLF A;  4DQI A;  2NUB A;  4CJK A;  3O4Q A;  1TL3 A;  4CF2 A;  3ZT4 A;  1C0M A;  3K59 A;  3THV A;  2G8W A;  3RR7 A;  1WSH A;  2ZE2 A;  3KLI A;  3L2Q A;  4CHQ A;  2BGG A;  4H8K A;  4DTU A;  4AIL C;  2F96 A;  2XRI A;  2PZS A;  3NGI A;  3C95 A;  1U4B A;  4DU4 A;  4B9S A;  2IS3 A;  4PY5 A;  3LP3 A;  3HK2 A;  4E7H A;  3LP2 A;  3NAE A;  3ZSO A;  3SQ0 A;  3P1G A;  5KTQ A;  1ASV A;  1D8Y A;  4M3Z A;  4HHT A;  1NKB A;  2OZS A;  4N47 A;  2HVH A;  3CM6 A;  3O3H A;  1RT3 A;  2EHG A;  3KLF A;  3F9K A;  1CLQ A;  4HCC A;  4NCA A;  1S1W A;  3DOK A;  4IG0 A;  4BAC A;  3AA3 A;  4Q0B A;  3QO9 A;  2G8U A;  2QK9 A;  3ZSR A;  4KHU A;  2HB5 A;  4DQP A;  2YNI A;  3AO3 A;  4CJ4 A;  1U49 A;  4CK1 A;  3JYT A;  3AVF A;  3VQC A;  1ZYQ A;  1IH7 A;  1U47 A;  4IDK A;  3NHG A;  5KGW A;  4CFA A;  4YNQ A;  5HRO A;  3SV3 A;  3ISN C;  4FJ7 A;  1YTU A;  1WLJ A;  4OVL A;  4ID1 A;  4M3R A;  1RT5 A;  4IG3 A;  5DMR A;  4CFD A;  3L2R A;  4DS4 A;  1JXB A;  3EY1 A;  3V1R A;  5CYQ A;  4CJ5 A;  3O3G A;  1L3S A;  3AVA A;  4AHC A;  3SUQ A;  4BE2 A;  3LP0 A;  4B8A B;  3AO1 A;  3PO5 A;  1HYS A;  5K14 A;  1RDB A;  4H4M A;  1IKV A;  5CYM A;  4CGF A;  4CF9 A;  5C25 A;  4DF8 A;  1Z25 A;  4K8X A;  3TAE A;  5HP1 A;  4HUG A;  4M3Y A;  3V1O A;  3LAM A;  3NF8 A;  3MXJ A;  3ZT2 A;  4DSK A;  3ITH A;  4O0J A;  4BDP A;  4ELU A;  4LH5 A;  4LY7 A;  2HNY A;  4KFB A;  3VQ6 A;  1QS4 A;  4KPY A;  4DTM A;  4OLB A;  4YFU A;  3ZT3 A;  2Z1J A;  2Q3S A;  4FLW A;  4J2A A;  3A2F A;  4KHS A;  4B9L A;  3HYF A;  1X9S A;  2ZD1 A;  3L8B A;  2OPS A;  3K5N A;  5D3G A;  1RT6 A;  2E6L A;  2WON A;  1XC9 A;  4FJH A;  3IRX A;  1C1A A;  4KHN A;  3PY8 A;  1S1V A;  3AA2 A;  3AVN A;  3P83 D;  4JLH A;  1LW0 A;  3WNE A;  3QEV A;  1HYZ A;  3M8S A;  5FDL A;  2XY7 A;  3KTQ A;  3KD5 E;  1WSF A;  3NH0 A;  4PA1 A;  1S5J A;  4DFK A;  4FXD A;  4QCL A;  4RG8 A;  3S3N A;  4M42 A;  4C8K A;  4CJP A;  4FJL A;  1S1U A;  2DFH A;  3T19 A;  1U04 A;  1CZB A;  4EZ6 A;  2KQ2 A;  4BE1 A;  4EP5 A;  3V1Q A;  4FLY A;  3QEP A;  4FK2 A;  4GW6 A;  1UA1 A;  4PQU A;  4AHR A;  4ID5 A;  2O4G A;  1RTH A;  3ZSW A;  1ZBF A;  2KZZ A;  1BI4 A;  3AVK A;  4CJW A;  3TAN A;  3HPH A;  3OYD A;  1HPZ A;  4Y1D A;  3ALY A;  4LH4 A;  4JS5 A;  4E89 A;  3SQ1 A;  3LWM A;  3O4N A;  3TI0 A;  3HPO A;  3TWH A;  3QIN A;  5KI6 A;  3OS2 A;  2YNF A;  3QER A;  4FZX C;  3MAQ A;  3P5J A;  4J2B A;  2E4L A;  4OKE A;  2D0C A;  1TKX A;  3NDK A;  4CJU A;  3HVR A;  3LDS A;  4F4K A;  1K6Y A;  3NBP A;  2FBX A;  4O55 A;  1KFS A;  1CXU A;  3AVJ A;  4CJF A;  4M3T A;  3DLR A;  2OYQ A;  1W0H A;  4Z4C A;  3M8R A;  1KVB A;  1NJY A;  3VQB A;  4BDZ A;  4DTJ A;  1B9D A;  1Z26 A;  2A1R A;  3TAM A;  5J2N A;  1VSL A;  4CHO A;  4DG1 A;  3TAG A;  2Y1J A;  2KFN A;  3OS1 A;  1X9M A;  4QOZ B;  5JS1 A;  1L3T A;  3SQ2 A;  1QHT A;  3AVG A;  4DMN A;  4BE0 A;  1KLN A;  3IAY A;  4DFJ A;  3KK3 A;  1T05 A;  1YTA A;  1HQU A;  1J53 A;  3DLH A;  4KTZ A;  4KV8 A;  4H4O A;  3RR8 A;  3OYG A;  4KI6 A;  3NFA A;  1KRP A;  3I0R A;  4WE1 A;  3K58 A;  3QEI A;  1NK0 A;  1SUQ A;  1J5O A;  3DLE A;  1SV5 A;  1S1X A;  1WSG A;  3CYM A;  4DLG A;  2FBY A;  4O44 A;  1U48 A;  1BGX T;  1EET A;  4L8R B;  4CGD A;  4O0I A;  3PX4 A;  1A5X A;  1T03 A;  1L5U A;  4B9N A;  2GV9 A;  4EP4 A;  3VQ4 A;  1DTQ A;  4W5O A;  2OPR A;  4N41 A;  1Q8I A;  1RT7 A;  3ZSY A;  2ITG A;  4RW7 A;  3AO2 A;  3AVI A;  1RT4 A;  3ZT0 A;  3HT3 A;  1RBS A;  3L2U A;  3V9Z A;  4ZHR A;  1QSY A;  1JKH A;  1NK9 A;  1LV5 A;  1XHX A;  1BCO A;  1HJR A;  1RBU A;  3D45 A;  3TAR A;  1L3U A;  1IKX A;  2WOM A;  3SNN A;  3T1A A;  3VN5 A;  3QEW A;  3CFO A;  1ZBL A;  1N5Y A;  1RTJ A;  1B9F A;  1JL2 A;  4KB0 A;  4ELV A;  3SJJ A;  2X6S A;  4E1N A;  4E7J A;  2KW4 A;  4N5S A;  1NJW A;  1C0T A;  1QQC A;  3C6T A;  4CJE A;  2HND A;  4W5R A;  4CF8 A;  3AA5 X;  3PUF A;  4B9V A;  1BIZ A;  5KRS A;  3OYJ A;  3KLE A;  2VWK A;  3SUP A;  1ASW A;  1ZBI A;  4FW1 A;  1TAQ A;  5HRN A;  1D9F A;  4PWD A;  5J2Q A;  2LSN A;  1BIS A;  2P1J A;  3K5O A;  4LSN A;  5C24 A;  4JRP A;  3HVT A;  3OYI A;  3V9U A;  3MXM A;  2QKK A;  5C42 A;  3HST B;  1I3A A;  4FJN A;  4Z4E A;  1SKW A;  4E7K A;  4TSX A;  3SV4 A;  1RTI A;  1W9H A;  4NYN A;  5FRO A;  1C1B A;  3JSM A;  3QIP A;  1LW2 A;  4FJ8 A;  2HHU A;  4DSF A;  4CE9 A;  3CM5 A;  1C6V A;  1Q9X A;  3AVM A;  4F3O A;  3ZSX A;  3K5L A;  1NJZ A;  4OGE A;  2W42 A;  1O1W A;  4DSE A;  5FRN A;  2G8I A;  1TAU A;  3QEX A;  2I5J A;  2VG6 A;  1NK7 A;  3HM9 A;  1T7P A;  2GBZ A;  2ZQB A;  3CQ8 A;  1JLG A;  1TGO A;  4FJX A;  4J2E A;  1DTT A;  4R5P A;  3QES A;  3G0Z A;  2B5J A;  4I7F A;  4IBN A;  4M41 A;  3AO4 A;  1NOZ A;  1NKC A;  4FJG A;  1KVC A;  3WNH A;  4E3S A;  3KK2 A;  4BDY A;  1SKR A;  4OKK A;  2DFF A;  2IGI A;  4FJI A;  1Y97 A;  5JS2 A;  3CFR A;  3VQ7 A;  4CES A;  3OVN A;  2IOC A;  1VSM A;  4NCG A;  4CFB A;  4PUO A;  1CXQ A;  2DFE A;  4O5B A;  1RBT A;  3OYN A;  3ZCM A;  1C0U A;  1GOA A;  3DI6 A;  4FLU A;  1JXE A;  4OGC A;  4DQS A;  1D9D A;  2G8F A;  2QKB A;  1HYV A;  4CF0 A;  2XHB A;  4I9L A;  3IS9 A;  3RWU A;  1WAF A;  2R7Y A;  1RTD A;  4B9U A;  3WNF A;  4RW4 A;  3DYA A;  4KHW A;  2HHS A;  3HXM A;  3LAN A;  3L2V A;  2YKM A;  1T8E A;  1RNH A;  1VSK A;  1WN7 A;  3VQD A;  3SUN A;  3C6U A;  3DOL A;  5E41 A;  1L3V A;  3ZSV A;  3HO1 A;  1S6P A;  3VQ9 A;  2OZM A;  1TKZ A;  3S3M A;  3OYL A;  2ATQ A;  2JGU A;  4E7L A;  2JLE A;  4BWJ A;  3KK1 A;  3SUO A;  2RF2 A;  3L3V A;  1IG9 A;  1TK0 A;  4FK4 A;  2HHX A;  4CF1 A;  3OJS A;  1NK4 A;  4NYF A;  2YNH A;  1NKE A;  1VSJ A;  4Q5V A;  2P5G A;  4FLX A;  3KD1 E;  4HVJ A;  2HHT A;  4CEO A;  1RDA A;  4OLA A;  4G1Q A;  1LWC A;  3PO4 A;  3IG1 A;  1BCM A;  1C1C A;  4K8Z A;  5I42 A;  3QLH A;  5I3U A;  4CFC A;  1TL1 A;  3K57 A;  4OJR A;  2BDP A;  2HNZ A;  4FJ5 A;  2OPP A;  4NCB A;  3B6P A;  4KTW A;  4W5N A;  4DF4 A;  1UA0 A;  4OKJ A;  4E7I A;  3F73 A;  5DK5 A;  5SZT A;  2YKN A;  4C8N A;  2D0B A;  4DTR A;  3TAB A;  3D0P A;  4DFP A;  4B9T A;  3ULD A;  4FM2 A;  4C8L A;  1NJX A;  4CJV A;  3AO5 A;  4CK3 A;  2OA8 A;  4MQ3 A;  4O4G A;  3DLB A;  1BQN A;  3TAQ A;  5CZ2 A;  3HJF A;  1NOY A;  3UIQ A;  1ZBH A;  3KLH A;  3ZSQ A;  2G8V A;  4HTU A;  2YNG A;  3BDP A;  4FM0 A;  1VSI A;  3OYK A;  1LAV A;  3DRR A;  1RBV A;  5J2M A;  1KVA A;  3OYF A;  1S9E A;  3G10 A;  3V9X A;  2X74 A;  4CHN A;  4W5T A;  3QET A;  3NH1 A;  4CEZ A;  5HBM A;  4CEC A;  4CIF A;  4FM1 A;  3QNN A;  3EZ5 A;  1EKE A;  3AVL A;  4F2R A;  4EZ9 A;  3HP6 A;  3AVB A;  3OYC A;  2F8S A;  3OYE A;  3NCI A;  3M8P A;  4N76 A;  1S6Q A;  4M3U A;  1NK5 A;  1FKO A;  4IFV A;  4M3W A;  2KFZ A;  4DTN A;  4KRE A;  3VQ5 A;  1TKT A;  3B6O A;  3DRS A;  1RIL A;  3HP9 A;  3EYZ A;  2RKI A;  5HRS A;  3DMJ A;  3QNO A;  2HHV A;  4ZTJ A;  3CG7 A;  5CY4 A;  2YHA A;  2IDO A;  4RW9 A;  3VQ8 A;  3ZT1 A;  4CEQ A;  4CK2 A;  3SYZ A;  3OJU A;  3V4I A;  1JLB A;  3NGY A;  3KLG A;  4KKO A;  2DY4 A;  1HQE A;  2VWJ A;  4IKF A;  3VQE A;  4HUE A;  4Z0U A;  3BGR A;  4F2S A;  4FZZ A;  5FRM A;  1SL1 A;  1J9A A;  2D5R A;  2XY8 A;  3VQP A;  1JLE A;  3LAL A;  1XI1 A;  1TVR A;  2IAJ A;  3NE6 A;  1VRT A;  4I9Q A;  3E01 A;  2GUI A;  4I2P A;  4ELT A;  4J2D A;  1REV A;  2Y1I A;  2X6N A;  3TAF A;  5KGX A;  1NK8 A;  1RDD A;  4F8R A;  4CIG A;  5T7B A;  3MXI A;  2B4J A;  4MFB A;  4CJR A;  4JS4 A;  4FLV A;  4DSJ A;  3C94 A;  1BQM A;  2BAN A;  4OPJ A;  1KFD A;  1LAW A;  2G8H A;  3SCX A;  3LZI A;  2KTQ A;  4FCY A;  1KLM A;  4IFY A;  1BL3 A;  3RTV A;  1TV6 A;  3RMD A;  1VSD A;  3CFP A;  4HUF A;  4DTO A;  2HVI A;  1TKD A;  3LP1 A;  3OY9 A;  2YV0 X;  4CED A;  1KTQ A;  2BE2 A;  2QXF A;  4CJS A;  3I8D A;  4FLT A;  3DLK A;  4FJ9 A;  2X78 A;  1QE1 A;  1VRU A;  4DSL A;  4AHS A;  3V6D A;  3AVH A;  3O3F A;  5KRT A;  1EXQ A;  2P5O A;  1TK8 A;  4F3T A;  1X9W A;  4CCH A;  3ASM A;  4JRQ A;  4DSI A;  1DLO A;  4CJT A;  1GOB A;  4HCB A;  2IC3 A;  2O4I A;  1KSP A;  1VSH A;  3RRH A;  1UAX A;  3M8Q A;  1BI4 B;  4DTX A;  4Z4F A;  5J2P A;  3OYB A;  1U45 A;  1WSJ A;  2XY6 A;  1QSS A;  4FJK A;  4DU1 A;  2OPQ A;  3LWL A;  3LZJ A;  1WSE A;  4KB1 A;  2KZM A;  1RT2 A;  3AA4 A;  2PYL A;  1UOC A;  2E6M A;  1X1P A;  1I39 A;  3OYA A;  2HMI A;  3DM2 A;  4B8C A;  3RMA A;  2YHB A;  3AVC A;  1QSL A;  1A5V A;  4B9M A;  2Z1I A;  3MEG A;  3PX0 A;  1RT1 A;  3ZSZ A;  1ITG A;  3FFI A;  2HW3 A;  4FZY A;  1UWB A;  3LAK A;  2Z1G A;  4XIU A;  3SPY A;  1WNS A;  4Y1C A;  3U6F A;  1XWL A;  4RW6 A;  4C8O A;  4CER A;  1CZ9 A;  1HNV A;  4N56 A;  4DQQ A;  4CJ3 A;  3V81 A;  1ZBU A;  4FJJ A;  4OPK A;  3I0S A;  1TK5 A;  4AHU A;  4KI4 A;  1QTM A;  4CHY A;  2PYJ A;  2AJQ A;  4FW2 A;  4B3O A;  3KKR A;  4M45 A;  1BHL A;  4Z4I A;  4CJL A;  4KRF A;  3DLG A;  5CZ1 A;  3V9S A;  3QIO A;  4DFM A;  3RMC A;  1SKS A;  4KO0 A;  3U3Y A;  4BWM A;  2F8T A;  1JL1 A;  1RDC A;  4DQR A;  2P51 A;  4W5Q A;  4CEE A;  1NK6 A;  2B6A A;  2Z1H A;  2FBV A;  5SWM A;  3PV8 A;  1RBR A;  1D5A A;  2D0A A;  1HNI A;  1ASU A;  2ETJ A;  1VSE A;  4E19 A;  1EX4 A;  5J1E A;  4DU3 A;  4UQG A;  4FLZ A;  1YVU A;  3OYM A;  1S9G A;  3H08 A;  3MED A;  4CEA A;  1SL2 A;  3SZ2 A;  1R0A A;  1J54 A;  3LPU A;  4KHQ A;  1JLA A;  3OYH A;  3L2W A;  4FJM A;  3MEE A;  3HL8 A;  3V9W A;  3SPZ A;  3KIO A;  1JLQ A;  4CJQ A;  5EU7 A;  3T3F A;  2XO7 A;  1SL0 A;  3HPG A;  1WAJ A;  4CGG A;  4CHZ A;  1B92 A;  3PX6 A;  2EX3 A;  3K5M A;  3VA0 A;  4CEB A;  4B08 A;  1BIU A;  4Z4G A;  1FXX A;  2FC0 A;  4ICL A;  4E1M A;  1MU2 A;  3L3U A;  1FK9 A;  4C8M A;  1Q9Y A;  4KTQ A;  1YT3 A;  4CHP A;  1JLC A;  3DRP A;  4Z4H A;  3VA3 A;  4KHY A;  3K2P A;  4LSL A;  1GOC A;  1IKY A;  4E0D A;  3RRG A;  5HRP A;  1EP4 A;  3SI6 A;  1WSI A;  3SQ4 A;  3OS0 A;  2FBT A;  2HHW A;  1IKW A;  4CGI A;  4LD0 A;  1LWE A;  4CIE A;  3TAP A;  3NF6 A;  1G15 A;  1A5W A;  4CEF A;  3NGZ A;  4DLE A;  4DS5 A;  2PY5 A;  3NH2 A;  1HMV A;  3KJV A;  3NF7 A;  3KKS A;  3S3O A;  1F21 A;  3AV9 A;  1VK0 A;  4FVM A;  3NF9 A;  4M3X A; 
#chains in the Genus database with same CATH topology
 4KAZ A;  2NRZ A;  1Z6R A;  4QAG A;  5HRR A;  3TR8 A;  4JV5 K;  3AGK A;  4RW8 A;  3WNG A;  2XY5 A;  3A5L C;  4DWI A;  2G8K A;  3U3G A;  2HBJ A;  3MK6 A;  1IO2 A;  3S9H A;  3C6A A;  3FE1 A;  4YOW A;  1LWF A;  4CGJ A;  3EZW A;  4FZX C;  2NUB A;  4CJK A;  3O4Q A;  3ENH A;  3GBT A;  4AIL C;  2XRI A;  1VQP N;  3C95 A;  4JK8 A;  1U4B A;  3LP3 A;  4B3S K;  3P1G A;  1QVG M;  1ASV A;  1K8K A;  1D8Y A;  1NKB A;  2OZS A;  1NMD A;  3QML A;  4EHU A;  4N47 A;  3VER A;  3TSQ A;  3O3H A;  4DR7 K;  1RT3 A;  3LM2 A;  1NGE A;  3KLF A;  3F9K A;  1VQ8 N;  1S1W A;  4LF9 K;  4DV1 K;  4IXC A;  4LF4 K;  2QK9 A;  4DQP A;  4CJ4 A;  3J81 O;  4CK1 A;  2E8A A;  3JYT A;  1W2B M;  4AF1 A;  1ZYQ A;  1U47 A;  5KGW A;  4YNQ A;  4I6M B;  1J6Z A;  3SV3 A;  5HRO A;  4FWR A;  4M3R A;  2GTD A;  2P9K B;  5DMR A;  4JI6 K;  4CFD A;  5CYQ A;  3AGR A;  4CJ5 A;  1L3S A;  1SQK A;  4AHC A;  4BE2 A;  3AO1 A;  5DM7 L;  3PO5 A;  1HYS A;  1RDB A;  4ISG A;  4CF9 A;  4JKG A;  2YJE A;  3MWP A;  3AAP A;  1Q86 O;  2I7P A;  3V1O A;  3MXJ A;  4O0J A;  4BDP A;  1JCG A;  4EFH A;  4OLB A;  3F2K A;  2Z1J A;  1T44 A;  4FLW A;  4J2A A;  4FOE A;  3IUC A;  2OPS A;  1OH7 A;  3H1V X;  3K5N A;  5LY3 A;  3PY8 A;  3AA2 A;  1HYZ A;  5FDL A;  2XY7 A;  4IOA L;  3A5O C;  4PA1 A;  3IFR A;  3KK7 A;  1S1U A;  1U04 A;  4BE1 A;  4GVE A;  1YI2 N;  5KPR A;  4AHR A;  1VQ6 N;  4BRH A;  2P9L B;  1ZBF A;  3M3Z A;  1GLE G;  4XEI A;  4BRD A;  4CJW A;  1HPZ A;  3ULE A;  4LH4 A;  3IDH A;  3LWM A;  3C65 A;  3TI0 A;  2WC9 A;  4DV5 K;  3KWG A;  5FRM A;  3MMV A;  5KI6 A;  1IV0 A;  3P5J A;  3NVM A;  3NDK A;  3TTC A;  3HVR A;  1K6Y A;  4O55 A;  1CXU A;  3PLA A;  4CJF A;  4M3T A;  3DLR A;  4BY9 C;  4OO1 J;  4BRF A;  4FPB A;  1KVB A;  4WQ4 C;  4DV0 K;  3HI0 A;  3I56 N;  3VQB A;  1Z26 A;  2A41 A;  4XH1 A;  4DG1 A;  1YIT N;  4EIA A;  4QOZ B;  2E88 A;  1L3T A;  1QHT A;  2GUP A;  2AA4 A;  4BE0 A;  1KLN A;  3IAY A;  2OTJ N;  1Y64 A;  5EX5 A;  1HNW K;  3DLH A;  4KTZ A;  3G71 N;  4IO8 A;  3RR8 A;  1KRP A;  2CH5 A;  3B8A X;  1LCU A;  3K58 A;  5BPM A;  1SUQ A;  3QB0 A;  1SV5 A;  1S1X A;  1WSG A;  3CYM A;  4BRN A;  4O0I A;  1A5X A;  3VQ4 A;  1RDW X;  2OPR A;  1Q8I A;  3ZSY A;  4RW7 A;  1R59 O;  3AO2 A;  3AVI A;  1RT4 A;  3U8X A;  3ZT0 A;  3L2U A;  3EL2 A;  1NK9 A;  1LV5 A;  1BCO A;  1HJR A;  1IKX A;  2WOM A;  3VN5 A;  4YDU C;  3CFO A;  1ZBL A;  4ELV A;  3SJJ A;  5BR8 K;  4H5W A;  1C0T A;  4DR5 K;  2HND A;  5JIC A;  4W5R A;  3OTO K;  5KRS A;  2VWK A;  1TAQ A;  2YHX A;  4JRP A;  3QFU A;  4X62 K;  3UE5 A;  3SV4 A;  4OPH A;  4BG8 A;  3ZEU A;  5FRO A;  1C1B A;  2CH6 A;  4DHY A;  3CM5 A;  5GAE P;  4IOC L;  3E66 A;  4BGB A;  5FRN A;  2G8I A;  2D4W A;  1T7P A;  3WXK A;  2ZQB A;  1JLG A;  1TGO A;  4J2E A;  1DTT A;  5AQI A;  2P9N A;  3G0Z A;  2B5J A;  3SAG A;  4JI4 K;  4H0O A;  3O08 A;  5AZJ A;  1GLC G;  2DFF A;  2IGI A;  3CFR A;  4PUO A;  4NCG A;  4JI7 K;  1XNR K;  2ASP A;  3ZCM A;  3DI6 A;  4FLU A;  1JXE A;  4OGC A;  1HYV A;  3RWU A;  2R7Y A;  1E4G T;  4B9U A;  3RSE B;  3DYA A;  3EN9 A;  1KXP A;  3LAN A;  2VGN A;  4WQ5 C;  3C6U A;  2FSJ A;  5E41 A;  4JK7 A;  1L3V A;  3ZSV A;  3HO1 A;  3VQ9 A;  4BC5 A;  3R9P A;  3S3M A;  4E7L A;  1IG9 A;  4FK4 A;  5AQR A;  1HKB A;  3CCR N;  4BR4 A;  1SAZ A;  1VSJ A;  3T69 A;  2P5G A;  4HVJ A;  4OLA A;  1RDA A;  1LWC A;  1BCM A;  2HST A;  4I6M A;  4CZE A;  5I3U A;  3J80 O;  4MDA A;  1EWR A;  1TL1 A;  4BC4 A;  5AQP A;  3K57 A;  4OJR A;  2BDP A;  3T1H K;  4FVU A;  5LMN K;  3C0B A;  4JI8 K;  4DF4 A;  4OKJ A;  1XC3 A;  3VET A;  3VEV A;  4FJX A;  3FR0 A;  3AO5 A;  3VTH A;  5BPN A;  4O4G A;  5CZ2 A;  1NOY A;  3E9L A;  4YHH K;  3DAW A;  2J4R A;  5J2M A;  3OYF A;  1S9E A;  3V9X A;  4CHN A;  1HNX K;  4CEC A;  3E9P A;  4F2R A;  2QA4 N;  3AVB A;  4C1N I;  3J7Y P;  1S6Q A;  5F0X A;  4IFV A;  4IDH A;  3OW2 M;  3VQ5 A;  1TKT A;  3B6O A;  3VGM A;  1IBK K;  4K43 A;  3O9T A;  2RKI A;  5HRS A;  2ASO A;  3DMJ A;  3ZT1 A;  1YUW A;  2UXB K;  4CEQ A;  1JLB A;  2A5X A;  3NGY A;  1QQO A;  4IKF A;  4YY3 K;  2YCH A;  3E9O A;  3BGR A;  3UKR B;  1VQL N;  4F2S A;  2O8D B;  2Q36 A;  3CCV N;  3TSP A;  4QS8 A;  3VQP A;  2V7Y A;  1TVR A;  1VRT A;  3CJ1 A;  1REV A;  3SMS A;  1NGC A;  1BQM A;  2G8H A;  4KH4 A;  3RMD A;  2RE2 A;  1ATN A;  1VSD A;  4NLB A;  4BR5 A;  4YOV A;  3LP1 A;  4YOT A;  3R1X A;  1TYQ B;  5I9E B;  1NGB A;  2JWL A;  4AHS A;  4H0T B;  1BDG A;  2WBN A;  1X9W A;  4AM7 A;  3O9S A;  2BUP A;  2IC3 A;  1VSH A;  1UAX A;  4DTX A;  1BI4 B;  1K9M O;  4Z4F A;  5J2P A;  1U45 A;  1BOT O;  4DU1 A;  2OPQ A;  3LZJ A;  1WSE A;  4MO4 A;  3AA4 A;  1LOT B;  1X1P A;  3OYA A;  4KH6 A;  2YHB A;  5A2Q O;  3AVC A;  2Z1I A;  5EVZ A;  1ITG A;  4BR0 A;  3D2E B;  2KKZ A;  3LAK A;  2Z1G A;  1K8A O;  4XIU A;  1X9J A;  3SK3 A;  3ENO A;  4N56 A;  3V81 A;  1ZBU A;  4FJJ A;  1NGH A;  2NLX A;  3ATU A;  4PHT X;  2E1Z A;  2V7Z A;  5EXW A;  2HBL A;  4CJL A;  2QW9 A;  3DLG A;  5CZ1 A;  3CCM N;  4DFM A;  3U3Y A;  4BWM A;  2QWR A;  4DQR A;  4CEE A;  4BQZ A;  5AQF A;  2FBV A;  2ETJ A;  5J1E A;  4FLZ A;  4M7X A;  1RDU A;  3O5B A;  1D4X A;  3H08 A;  4IEE A;  4E1J A;  1FJG K;  1SL2 A;  3U9Z A;  4LFA K;  1J54 A;  4KHQ A;  4BR9 A;  4LC9 B;  5EU7 A;  4BQL A;  1SL0 A;  4CHZ A;  3EKS A;  4FWP A;  4CEB A;  2FC0 A;  4E1M A;  1Q9Y A;  4C8M A;  4CHP A;  3DRP A;  4Z4H A;  3VA3 A;  3ID8 A;  3RSE A;  2E2N A;  1IKW A;  4RWT A;  4CGI A;  4LD0 A;  3TAP A;  2NRT A;  3NF6 A;  2QWM A;  4DLE A;  1Z05 A;  4H03 B;  1ZC6 A;  2RPI A;  4CGH A;  1VSF A;  4AH9 A;  1YJW N;  3ZET A;  1WBD A;  5AQU A;  5FPD A;  5JLF A;  5GAD P;  1XHZ A;  3THX B;  4JKG B;  1FKP A;  3PSF A;  3K9K A;  4A61 A;  3UKU B;  3H6E A;  2AP1 A;  4DV6 K;  4FYD A;  2PAV A;  2ZM6 K;  4B9Q A;  2ZJQ L;  5CR4 A;  2F9W A;  4CF2 A;  3P4I A;  4IEI A;  3RR7 A;  1WSH A;  3KLI A;  2BGG A;  3WEE B;  4H8K A;  4DTU A;  4IWV A;  4PY5 A;  2EWS A;  3LP2 A;  3G4S N;  1MWM A;  5KTQ A;  4HHT A;  3MN6 A;  1Q18 A;  2HVH A;  2EHG A;  1CLQ A;  3JAM O;  3DOK A;  4IG0 A;  4Q0B A;  3AA3 A;  2P9S A;  3QO9 A;  3AO3 A;  3VQC A;  1IH7 A;  2D0P A;  5GIN A;  1E4F T;  1YTU A;  1FW6 A;  5KPZ A;  2WFB A;  4ID1 A;  1VQK N;  3CHW A;  3L6Q A;  1RT5 A;  4JKA A;  2QWQ A;  1GLL O;  3V1R A;  3FZH A;  3SUQ A;  4B8A B;  4R79 A;  4K8X A;  4BRI A;  4H0Y B;  3TAE A;  2HBM A;  5GAG P;  5HP1 A;  4HUG A;  4M3Y A;  3NF8 A;  3UKR A;  1Q82 O;  3ITH A;  1U6Z A;  4BRC A;  5M1N A;  4KPY A;  3FZM A;  1XUP O;  4YFU A;  5BN8 A;  3A2F A;  4BRA A;  2UXD K;  2NZT A;  3WXL A;  4CBX A;  4JYA K;  1C1A A;  5FPN A;  4CD1 A;  4JLH A;  3KTQ A;  1LW0 A;  3QEV A;  2UXC K;  1BG3 A;  3KZB A;  3KD5 E;  5AZI B;  1ATR A;  3CCU N;  1WSF A;  4DFK A;  1VQ9 N;  3N4P A;  4M42 A;  4C8K A;  3P31 A;  4CJP A;  4B1Y B;  1KD1 O;  2KQ2 A;  3V1Q A;  3QEP A;  4PQU A;  4ID5 A;  2O4G A;  1RTH A;  2KZZ A;  1BI4 A;  4DV3 K;  3AVK A;  4BR2 A;  1HR0 K;  3SAH A;  4JS5 A;  3MN5 A;  3O6W A;  3WUH A;  2E4L A;  4JI5 K;  1VQ5 N;  4AQY K;  3OA9 A;  3LDS A;  5MLC Q;  3NBP A;  4DV2 K;  5EY4 A;  1W0H A;  3A5M C;  4DTJ A;  3ZEU B;  5E26 A;  1VSL A;  4CHO A;  5AFU H;  3TAG A;  2KFN A;  3HBT A;  4B1Z A;  1X9M A;  3AVG A;  1OVY A;  4DMN A;  1KQS M;  1YTA A;  1J53 A;  4KV8 A;  2NNW A;  3HRG A;  3OYG A;  3I0R A;  3CF5 L;  2Q97 A;  3QEI A;  2P9N B;  1S22 A;  4O44 A;  1U48 A;  1WB9 A;  2CGK A;  2VWB A;  5AZJ B;  5LJW A;  4B9N A;  2GV9 A;  1DTQ A;  4N41 A;  4LF6 K;  1KC8 O;  3IKM A;  1RT7 A;  1OVQ A;  1RBS A;  3JS6 A;  4ZHR A;  5M1K A;  3WQU A;  3CCS N;  5AQN A;  1JKH A;  2Q2R A;  1RBU A;  4CZJ A;  3SNN A;  5GAH P;  4KB0 A;  2X6S A;  4E1N A;  5AR0 A;  4E7J A;  2KW4 A;  1NJW A;  4CF8 A;  3AA5 X;  3O80 A;  3KLE A;  2Q0U A;  5BPL A;  1ASW A;  4FW1 A;  1D9F A;  4PWD A;  2E5L K;  4LSN A;  2QKK A;  1J5E K;  3MXM A;  3T1Y K;  4Z4E A;  1SKW A;  4H0V B;  1W9H A;  4NYN A;  4A62 A;  3GG4 A;  4DSF A;  4CE9 A;  3AVM A;  4F3O A;  1RFQ A;  5AQT A;  5AQS A;  4OGE A;  3QIC A;  1YVN A;  3QEX A;  3WXM B;  4JKC A;  3O9R A;  3TU5 A;  4CW7 B;  4R5P A;  3THX A;  2NRW A;  4I7F A;  1NKC A;  3AO4 A;  1KVC A;  4JEP A;  3KK2 A;  5C0Y A;  3UKU A;  4FJI A;  3VQ7 A;  1NLV A;  3PSI A;  1HPM A;  2IOC A;  1IG8 A;  1RBT A;  1Q81 O;  2PBD A;  1D9D A;  2XHB A;  3WEE A;  2O8C B;  4RW4 A;  1ZBS A;  2YHY A;  4DR4 K;  4KHW A;  2CGJ A;  2UUC K;  4CZK A;  5KQD A;  1T6C A;  3HXM A;  3L2V A;  2YKM A;  4HWI A;  5M1Q A;  3P38 A;  1TUY A;  4DR2 K;  3DOL A;  4O8U A;  5JMV A;  4GKJ K;  5M1P A;  1TK0 A;  2HHX A;  3OJS A;  4NYF A;  4CEO A;  1N33 K;  4G1Q A;  3PO4 A;  3IG1 A;  1C1C A;  4K8Z A;  4MO5 A;  4FWS A;  4DCH A;  2HNZ A;  3Q7B A;  5LMU K;  5AJ3 K;  4NCB A;  1GLD G;  4U7B A;  4FL9 A;  3A8Y A;  4XH5 A;  2YKN A;  4C8N A;  2D0B A;  4OPA A;  3UB5 A;  2UUB K;  3DLB A;  4JKD A;  1ZBH A;  3NVK A;  3KLH A;  3ZSQ A;  2G8V A;  3BDP A;  2VCP A;  1EQY A;  1HKC A;  1VSI A;  2E2P A;  3DRR A;  1RBV A;  4BRP A;  1KVA A;  4W5T A;  3BY5 A;  5AZI A;  4CIF A;  5JVH L;  1EKE A;  4PL8 A;  4EZ9 A;  3OYC A;  3OYE A;  3M8P A;  3THY A;  1NK5 A;  1FKO A;  4JKE A;  3DRS A;  4BRM A;  4QS9 A;  3VF2 A;  1HNZ K;  3CG7 A;  5CY4 A;  1M90 O;  1VQ7 N;  5AQH A;  3CPE A;  3KLG A;  2OCE A;  4ISE A;  4Z0U A;  4GV6 A;  3MCP A;  2GWJ A;  4MDB A;  1XI1 A;  1WBB A;  1K73 O;  3NE6 A;  3DXK B;  4H0P A;  5FLX O;  3ZX2 A;  3N4Q A;  2Y1I A;  2X6N A;  3ATV A;  3GOI A;  3TAF A;  3MXI A;  4JS4 A;  4FLV A;  2BAN A;  1KFD A;  1DKG D;  4FCY A;  4IFY A;  4DTO A;  4HUF A;  3SLC A;  1TKD A;  3OY9 A;  2YV0 X;  3I8D A;  2X78 A;  1QE1 A;  1VRU A;  4A5B A;  4BRK A;  2P5O A;  3BUZ B;  4YOU A;  4WF9 L;  2FSN A;  1GOB A;  2IVP A;  3MN9 A;  2HF3 A;  3LM9 A;  2P9I B;  1WSJ A;  2XY6 A;  1QSS A;  4FJK A;  1GLF O;  3VEW A;  3I55 N;  3LWL A;  3CCE N;  4KB1 A;  3CI5 A;  2KZM A;  1RT2 A;  4JI2 K;  4BRL A;  2HMI A;  4FPA A;  4C23 A;  1A5V A;  3PX0 A;  1RT1 A;  3ZSZ A;  4FZY A;  3C7N B;  1P8Z A;  4RW6 A;  4CER A;  4OX9 K;  3GE1 A;  4DQQ A;  5BRH A;  3CJ7 A;  4LFC K;  2QWO A;  5KQ8 A;  4KI4 A;  1QTM A;  4CHY A;  2AJQ A;  4FW2 A;  4A2A A;  3KKR A;  1HUX A;  2IVO A;  3PIO L;  1BHL A;  4Z4I A;  3V9S A;  3QIO A;  1ILY A;  3ZET B;  2F8T A;  1EWQ A;  2P51 A;  4W5Q A;  2B6A A;  1Q7Y O;  1WUA A;  4UQG A;  3NMU A;  3OYM A;  2KLA A;  3SZ2 A;  3OYH A;  4PKH A;  3HL8 A;  3V9W A;  3SPZ A;  1JLQ A;  1YHQ N;  4CGG A;  1U2V B;  3VA0 A;  5AQO A;  4B08 A;  1FXX A;  4ICL A;  4UY8 O;  5CE3 A;  4F3T A;  4KTQ A;  1YT3 A;  4LSL A;  3WXJ A;  3SAF A;  3RRG A;  2O8C A;  5HRP A;  4NLC A;  4NXM K;  4YOX A;  2HHW A;  4ILJ A;  3KHY A;  2P9S B;  5IT9 O;  3WXI A;  1G15 A;  3IMX A;  4JNE A;  1HMV A;  3KJV A;  3I33 A;  3CCJ N;  3KWI A;  5BRF A;  2UUA K;  3NF9 A;  2GWK A;  4WCE L;  3AY9 A;  3MEC A;  2P9P A;  4FK0 A;  2A1S A;  4AHV A;  1JLF A;  1QZ6 A;  3LDL A;  2VG5 A;  3LPT A;  1VQM N;  4AHT A;  3HOS A;  1XMQ K;  1S1T A;  4I2Q A;  3VQQ A;  4ZTF A;  3BEX A;  4EAH D;  3RMB A;  1N6Q A;  5DM6 L;  3EO3 A;  4F9O A;  1C0M A;  3K59 A;  2G8W A;  1W97 L;  4BG9 A;  2PZS A;  3NGI A;  4B9S A;  2IS3 A;  3H3N O;  4M3Z A;  2JWK A;  3FFK B;  3CM6 A;  1OH8 A;  4CZF A;  1N36 K;  1KAZ A;  4BAC A;  4G9Z A;  2G8U A;  2QTD A;  3ZSR A;  2Q1N A;  4CZL A;  3CMA N;  2YNI A;  3AVF A;  4FWM A;  3HM8 A;  4IDK A;  3NHG A;  2ZGY A;  5M1O A;  5B8H A;  1KAX A;  3E1Y A;  4OVL A;  5C10 A;  1YF5 L;  3D7E O;  3L2R A;  3EY1 A;  1GLJ O;  3AAR A;  3THW B;  4M7Y A;  5K14 A;  1IKV A;  2NRR A;  5CYM A;  4CGF A;  4DF8 A;  2H3G X;  4JD2 A;  3ZT2 A;  4DSK A;  1HKG A;  1CZA N;  4ELU A;  4LH5 A;  4LY7 A;  2HNY A;  3VQ6 A;  1QS4 A;  2YJF A;  3TTF A;  3LDN A;  4H5N A;  3DXK A;  4KHS A;  2HBK A;  3H3O B;  1XNQ K;  1X9S A;  2ITM A;  3R8E A;  5D3G A;  4X66 K;  1RT6 A;  2WON A;  1VQ4 N;  2DPN A;  3P83 D;  4WQ5 A;  3BF1 A;  1RGI A;  1S5J A;  4RG8 A;  3S3N A;  2DFH A;  1YAG A;  4CJ7 A;  4DR1 K;  4FLY A;  3H46 O;  4FK2 A;  4GW6 A;  2NRH A;  3VF6 A;  3ZSW A;  3EE9 A;  4H5T A;  2P9I A;  3ALY A;  4E89 A;  3SQ1 A;  3HPO A;  3TWH A;  1NM1 A;  4GV9 A;  3QER A;  4J2B A;  4CJU A;  1NG9 A;  2FBX A;  3CQY A;  3GDQ A;  3C7N A;  3M8R A;  2A1R A;  3TAM A;  3VGK A;  5C2F A;  1H1V A;  3F5T A;  5JS1 A;  3DWL A;  1T05 A;  4GNI A;  1N32 K;  5JVG L;  2YX6 A;  3NFA A;  4WE1 A;  1O13 A;  3DLE A;  2FBY A;  3BZK A;  1EET A;  4CGD A;  1T03 A;  3PX4 A;  4EP4 A;  3O1W A;  2ITG A;  3HT3 A;  4A57 A;  3V9Z A;  1S3X A;  1QSY A;  2ZJP L;  4DUZ K;  4LFB K;  3TAR A;  1L3U A;  2OAN A;  3T1A A;  3QEW A;  3O1B A;  4FSV A;  1U2V A;  3C6T A;  2QM1 A;  4CJE A;  3HSC A;  3PUF A;  2HOE A;  3OYJ A;  4Y0W A;  3SUP A;  1ZBI A;  2P1J A;  3HVT A;  4JI3 K;  1I3A A;  4FJN A;  2QWP A;  5FPE A;  1RTI A;  1BA0 A;  4ILH A;  3QIP A;  1LW2 A;  2GEM A;  1C6V A;  1Q9X A;  3FZK A;  5GIP A;  3ZSX A;  2HMP A;  1GLA G;  1NJZ A;  1G99 A;  4DSE A;  2W42 A;  1O1W A;  5GIO A;  2VG6 A;  3HM9 A;  1VQO N;  5BR9 A;  5E84 A;  2GBZ A;  1BA1 A;  3CQ8 A;  2A42 A;  5AQX A;  4M41 A;  4FWQ A;  4A59 A;  1NGD A;  1SKR A;  4BDY A;  4DR3 K;  1Y97 A;  4CES A;  2O8E A;  4CFB A;  1QHA A;  3O9U A;  2DFE A;  3OYN A;  4FJH A;  1C0U A;  4DQS A;  2VQF K;  4CF0 A;  4I9L A;  3IS9 A;  1WAF A;  4PKG A;  1RTD A;  4B3T K;  1YXQ A;  1T8E A;  3VQD A;  1VSK A;  4WYB A;  3SUN A;  4B3R K;  2OZM A;  3KVG A;  3K0S A;  3OYL A;  2JGU A;  4BWJ A;  3P39 A;  3KK1 A;  2RF2 A;  3L3V A;  4AM6 A;  3THY B;  3ENB A;  3VF4 A;  4CF1 A;  5HL7 L;  1NKE A;  4FLX A;  2HHT A;  5I42 A;  3QLH A;  4CFC A;  4V19 S;  4K41 A;  4GV3 A;  3LDO A;  3VPZ A;  3MX5 A;  3DXM B;  3CER A;  3MWT A;  3THW A;  4FJ5 A;  4KTW A;  4W5N A;  3CC2 N;  4E7I A;  3G6E N;  3TPQ A;  5DK5 A;  3D0P A;  4B9T A;  1WOQ A;  3ULD A;  4FM2 A;  4CJV A;  4HTU A;  4JI0 K;  4FM0 A;  3EE8 A;  3ID6 A;  1T6D A;  4DKW A;  2X74 A;  4J8F A;  3L4I A;  3QET A;  4CEZ A;  4FM1 A;  3QNN A;  3U9D A;  4LF5 K;  3EZ5 A;  4U67 L;  3J7A P;  3HP6 A;  2ZWH A;  3NCI A;  4N76 A;  5BRD A;  4M3W A;  2WTU A;  2FF6 A;  4DTN A;  1RIL A;  3HP9 A;  3EYZ A;  4B1V A;  3D2F A;  1VHX A;  2HHV A;  4ZTJ A;  3SYZ A;  3SQ4 A;  3VQ8 A;  2IDO A;  4CK2 A;  3V4I A;  3BP8 A;  4KKO A;  2DY4 A;  1HQE A;  4WFB L;  5H1S Q;  4FZZ A;  1SL1 A;  1JLE A;  1E3M A;  2A3Z A;  4I9Q A;  4I2P A;  4J2D A;  2QXL A;  5KGX A;  1RDD A;  2P9U A;  4F8R A;  5T7B A;  2B4J A;  4MFB A;  4H5V A;  4CJR A;  4DSJ A;  4CZI A;  4CZG A;  1IBM K;  3SCX A;  2HVI A;  1BL3 A;  3QDK A;  1JCF A;  1S72 N;  3CFP A;  3O8M A;  3FGU A;  1KTQ A;  2QXF A;  4CVN E;  4FLT A;  4FJ9 A;  3DLK A;  4C1N K;  4MLE A;  3AVH A;  2O8B A;  1EXQ A;  1ESV A;  4A5A A;  1TK8 A;  1JCE A;  4JKB A;  4JRQ A;  4DV7 K;  4CZM A;  4DSI A;  3M5R A;  3RRH A;  4DB3 A;  1BUP A;  3CJA A;  2RHK A;  1OH5 A;  4BRG A;  2E6M A;  5AQJ A;  1I39 A;  4ISF A;  3DM2 A;  3RMA A;  2PFU A;  5AQM A;  4B9M A;  1N8R O;  3VOV A;  3FFI A;  3S41 A;  2HW3 A;  1UWB A;  3ZLJ A;  4Y1C A;  3U6F A;  4C8O A;  1XWL A;  1SZ2 A;  2UU9 K;  4CJ3 A;  1JJ2 M;  3PIP L;  4OPK A;  2PYJ A;  4JAX A;  4DV4 K;  2P9P B;  4KRF A;  4GY2 B;  1JL1 A;  1RDC A;  2IIR A;  5BN9 A;  4IFE A;  3K9J A;  2Z1H A;  5SWM A;  3PV8 A;  1RBR A;  4JHD A;  1IJJ A;  4BRE A;  2QWL A;  1YVU A;  2OTL N;  4IJN A;  1R0A A;  1VQN N;  3LPU A;  1JLA A;  3ZX0 A;  4BRO A;  1QQM A;  3OBY A;  4DR6 K;  3K5M A;  1BIU A;  4Z4G A;  1MU2 A;  1FK9 A;  2V51 B;  1DGK N;  3K2P A;  1GOC A;  1IKY A;  1EP4 A;  3SI6 A;  2F7T A;  3OS0 A;  4LF8 K;  3SMP A;  2I7N A;  2D1K A;  3R6M A;  4CEF A;  1X3N A;  4DS5 A;  3NH2 A;  2A6A A;  3VEX A;  3OBW A;  3NF7 A;  3KKS A;  5ADX H;  1ZXO A;  2V52 B;  3AV9 A;  1MA9 B;  5BRE A;  3VQA A;  3LL3 A;  4DTS A;  5AQV A;  3BF3 A;  4JK9 A;  2BTF A;  2VG7 A;  2WUS A;  5EOY A;  4GMJ B;  4B1X B;  4BVO A;  5AFU A;  1OH6 A;  1HRH A;  1RCH A;  4JD2 B;  1KCF A;  2DTU A;  3DXM A;  4BRQ A;  2RN2 A;  2HHQ A;  4GVM A;  4CBU A;  3CCL N;  1XQS C;  4XH4 A;  1VAZ A;  4DTP A;  4NO7 A;  2QI2 A;  3SBG A;  1QZ5 A;  5HLF A;  4DQI A;  1ATS A;  1TL3 A;  2KHO A;  3ZT4 A;  3THV A;  2ZE2 A;  3L2Q A;  4CHQ A;  3SJH A;  5KPT A;  2F96 A;  1P90 A;  3DLL L;  4DU4 A;  4A2B A;  3HK2 A;  4E7H A;  3NAE A;  3SQ0 A;  3ZSO A;  4MLH A;  2GX9 A;  2ZJR L;  3CJ9 A;  2E2Q A;  4WFN L;  3ZYY X;  3HOT A;  1NNE A;  3LDQ A;  3H1Q A;  5AQK A;  4HCC A;  4NCA A;  1EO1 A;  3VEO A;  4KHU A;  2HB5 A;  1U49 A;  3EKU A;  4CFA A;  3ISN C;  4FJ7 A;  1WLJ A;  3RVC A;  4IG3 A;  4DS4 A;  2FSK A;  1JXB A;  3O3G A;  3QFP A;  3AVA A;  3LP0 A;  3ZX3 A;  3VES A;  4H4M A;  5C25 A;  1Z25 A;  2ASM A;  3LAM A;  1GLB G;  4KFB A;  2FLO A;  4DTM A;  2O8F B;  3ZT3 A;  2Q3S A;  4DUY K;  4B9L A;  1DEJ A;  3HYF A;  2W40 A;  2ZD1 A;  4QS7 A;  3L8B A;  4CBW A;  2W6L A;  2E6L A;  1XC9 A;  3AAQ A;  3IRX A;  4KHN A;  4O5F A;  1S1V A;  3AVN A;  3WNE A;  3M1F A;  1NJI O;  3M8S A;  3CQX A;  5M1F A;  3NH0 A;  4FXD A;  4QCL A;  3QBX A;  3A0I X;  5C12 A;  3GL1 A;  4FJL A;  4CI6 A;  3T19 A;  1CZB A;  4EZ6 A;  4EP5 A;  4DQ8 A;  5CHI A;  1UA1 A;  1NMN A;  1YJ9 N;  2ZGZ A;  3TAN A;  3C6H A;  3HPH A;  4FWL A;  3VMF B;  4Y1D A;  3OYD A;  4L3Q A;  2P9K A;  3O4N A;  4GKK K;  3QIN A;  1HLU A;  3OS2 A;  2YNF A;  3MAQ A;  4OKE A;  2D0C A;  1TKX A;  4F4K A;  1KFS A;  4IJA A;  3AVJ A;  4PKI A;  4JKF A;  2Q0R A;  2OYQ A;  4Z4C A;  4PL7 A;  4WQ4 A;  1IBL K;  1NJY A;  3R3L A;  4BDZ A;  1YJN N;  1B9D A;  2QWN A;  2E20 A;  4M63 C;  5J2N A;  2Y1J A;  3OS1 A;  3BZC A;  1BO5 O;  3SQ2 A;  1NGA A;  4DFJ A;  3KK3 A;  4NXN K;  5AQG A;  1HQU A;  4H4O A;  4KI6 A;  5F2R A;  1C0G A;  1NK0 A;  1J5O A;  5C2D A;  4DLG A;  4L8R B;  1BGX T;  5AQY A;  4X64 K;  1L5U A;  3VGL A;  4JKH A;  4W5O A;  3TSU A;  2Q31 A;  2O8E B;  1YIJ N;  4KBO A;  1M1K O;  1XHX A;  1NGF A;  3CPW M;  4FOI A;  3D45 A;  2P9L A;  4YDU A;  1N5Y A;  1RTJ A;  1B9F A;  1JL2 A;  5ADX A;  3J8A A;  4N5S A;  1QQC A;  3WT0 A;  4B9V A;  1BIZ A;  4O8K A;  4RTF D;  5HRN A;  5J2Q A;  2LSN A;  1BIS A;  3K5O A;  5C24 A;  3D6R A;  5LJV A;  3V9U A;  4BR7 A;  3OYI A;  4NB4 A;  5C42 A;  3HST B;  3CCQ N;  4E7K A;  4TSX A;  1MDU B;  3L4Q A;  4YOY A;  3JSM A;  1SS6 A;  4FJ8 A;  2HHU A;  3I8B A;  2HF4 A;  1NGI A;  3G25 A;  3K5L A;  3VEN A;  1BWF O;  3DJC A;  1TAU A;  2I5J A;  1C0F A;  1NK7 A;  1HJO A;  3QES A;  4IBN A;  4FJG A;  1NOZ A;  4Z94 A;  3WNH A;  4E3S A;  1MWK A;  4OKK A;  4CZH A;  3WQT A;  5JS2 A;  2UYT A;  3OVN A;  1VSM A;  4CD3 A;  2E1Y A;  1CXQ A;  4O5B A;  3QBW A;  1N34 K;  1GOA A;  1NU0 A;  3T7Z A;  1NWK A;  5TKY A;  2G8F A;  2QKB A;  4BVP A;  1NGG A;  4HTL A;  3JXU A;  3WNF A;  1BU6 O;  3HTV A;  2VGM A;  2HHS A;  1HX1 A;  1RNH A;  1WN7 A;  3CJB A;  2NRX A;  1NGJ A;  1S6P A;  1TKZ A;  5ELZ A;  3CC7 N;  2ATQ A;  2JLE A;  3CET A;  3SUO A;  4JI1 K;  3W0L A;  2VQE K;  1NK4 A;  2YNH A;  4Q5V A;  5AQZ A;  3KD1 E;  3D2F B;  3U4L A;  3VEZ A;  3MX2 A;  3H45 C;  1NBW A;  1I94 K;  1V4S A;  2OPP A;  2W6K A;  3VEY A;  5C15 A;  3J7Z O;  3B6P A;  1UA0 A;  3L0Q A;  4FWN A;  3F73 A;  5IWA K;  5SZT A;  4DTR A;  3TAB A;  4DFP A;  4C8L A;  1KAY A;  2P9U B;  1NJX A;  2OA8 A;  3OHR A;  4CK3 A;  3HJF A;  4MQ3 A;  1BQN A;  3TAQ A;  3CJC A;  3UIQ A;  2O8F A;  1TUU A;  2YNG A;  1K8K B;  4B3M K;  4BGA A;  3FLC O;  3OYK A;  1LAV A;  3TTD A;  3Q7C A;  3LDP A;  2HHH K;  3G10 A;  2O8B B;  2NRV A;  4EHT A;  3NH1 A;  5HBM A;  3AVL A;  3EEQ A;  2F8S A;  4M3U A;  2KFZ A;  4KRE A;  1QVF M;  5AQL A;  3QNO A;  4KH5 A;  2YHA A;  4RW9 A;  4BC2 A;  3OJU A;  3CME N;  3W3D A;  5HOO A;  2VWJ A;  3CC4 N;  4IZ9 A;  3VQE A;  4BC3 A;  4HUE A;  4B1U B;  1J9A A;  2D5R A;  2XY8 A;  3M6G A;  5F1X A;  3LAL A;  2IAJ A;  3MN7 A;  4FWO A;  2D0O A;  2GUI A;  3E01 A;  3FZL A;  4ELT A;  1NK8 A;  3FZF A;  4CIG A;  2VYP A;  4K25 A;  3C94 A;  4OPJ A;  4ILG B;  1LAW A;  3LZI A;  2KTQ A;  1KLM A;  3RTV A;  1TV6 A;  3CXC M;  4RCH A;  3CIP A;  4CED A;  2BE2 A;  4CJS A;  4JHD B;  4DSL A;  3V6D A;  3O3F A;  1X3M A;  5KRT A;  4HCB A;  4CCH A;  3ASM A;  4K42 A;  1DLO A;  5LL6 Z;  3SBT A;  1QQN A;  1T3V A;  2IVN A;  4IOX A;  4CJT A;  2F4V K;  2O4I A;  1KSP A;  5AQQ A;  3M8Q A;  3OYB A;  4KHP K;  3ULE B;  2YHW A;  3VTI A;  2PYL A;  1UOC A;  4B8C A;  4H5R A;  1QSL A;  3MDQ A;  4YOR A;  3MEG A;  3O9Q A;  3SPY A;  2FXU A;  1WNS A;  2BH1 A;  2CGL A;  4IO9 L;  1XMO K;  1CZ9 A;  1DT9 A;  1HNV A;  2O8D A;  4X65 K;  3I0S A;  1TK5 A;  4AHU A;  2W41 A;  4B3O A;  4LF7 K;  4M45 A;  4FO0 A;  3A5N C;  3MCA B;  4WFA L;  3RMC A;  1SKS A;  2FF3 B;  4KO0 A;  2YI1 A;  1NK6 A;  5JLH A;  1W7A A;  1D5A A;  1TYQ A;  1OKJ A;  2D0A A;  1HNI A;  1ASU A;  4E19 A;  1VSE A;  1EX4 A;  4JN4 A;  5FPM A;  4DU3 A;  3CD6 N;  1S9G A;  3MED A;  4CEA A;  2F9T A;  1V4T A;  3L2W A;  4FJM A;  3MEE A;  4K0K K;  3KIO A;  4CJQ A;  3T3F A;  3F9M A;  2XO7 A;  3HPG A;  1WAJ A;  2E2O A;  1B92 A;  3PX6 A;  2EX3 A;  3L3U A;  4H0X B;  1JLC A;  4KHY A;  3HZ6 A;  4E0D A;  1WSI A;  2A40 A;  2FBT A;  3D2E A;  5AQW A;  3O4W A;  2GEL A;  1LWE A;  4CIE A;  4FWK A;  1A5W A;  3NGZ A;  2PY5 A;  4B1W B;  5TKW A;  2ZF5 O;  3S3O A;  1F21 A;  2QEX N;  4FVM A;  1VK0 A;  4M3X A; 
#chains in the Genus database with same CATH homology
 2RPI A;  4CGH A;  3VQA A;  1VSF A;  3MEC A;  4AH9 A;  4KAZ A;  4FK0 A;  2A1S A;  4DTS A;  4QAG A;  1JLF A;  4AHV A;  5HRR A;  2VG5 A;  3LPT A;  3TR8 A;  2VG7 A;  4GMJ B;  4RW8 A;  4AHT A;  1XHZ A;  3WNG A;  1FKP A;  1HRH A;  2XY5 A;  1S1T A;  4I2Q A;  1RCH A;  4DWI A;  1KCF A;  2G8K A;  3U3G A;  2DTU A;  2RN2 A;  3VQQ A;  2HHQ A;  4GVM A;  4FYD A;  1IO2 A;  3S9H A;  4ZTF A;  1LWF A;  4CGJ A;  4DTP A;  3RMB A;  1N6Q A;  5HLF A;  4DQI A;  2NUB A;  4CJK A;  3O4Q A;  1TL3 A;  4CF2 A;  3ZT4 A;  1C0M A;  3K59 A;  3THV A;  2G8W A;  3RR7 A;  1WSH A;  2ZE2 A;  3KLI A;  3L2Q A;  4CHQ A;  2BGG A;  4H8K A;  4DTU A;  4AIL C;  2F96 A;  2XRI A;  2PZS A;  3NGI A;  3C95 A;  1U4B A;  4DU4 A;  4B9S A;  2IS3 A;  4PY5 A;  3LP3 A;  3HK2 A;  4E7H A;  3LP2 A;  3NAE A;  3ZSO A;  3SQ0 A;  3P1G A;  5KTQ A;  1ASV A;  1D8Y A;  4M3Z A;  4HHT A;  1NKB A;  2OZS A;  4N47 A;  2HVH A;  3CM6 A;  3O3H A;  1RT3 A;  2EHG A;  3KLF A;  3F9K A;  1CLQ A;  4HCC A;  4NCA A;  1S1W A;  3DOK A;  4IG0 A;  4BAC A;  3AA3 A;  4Q0B A;  3QO9 A;  2G8U A;  2QK9 A;  3ZSR A;  4KHU A;  2HB5 A;  4DQP A;  2YNI A;  3AO3 A;  4CJ4 A;  1U49 A;  4CK1 A;  3JYT A;  3AVF A;  3VQC A;  1ZYQ A;  1IH7 A;  1U47 A;  4IDK A;  3NHG A;  5KGW A;  4CFA A;  4YNQ A;  5HRO A;  3SV3 A;  3ISN C;  4FJ7 A;  1YTU A;  1WLJ A;  4OVL A;  4ID1 A;  4M3R A;  1RT5 A;  4IG3 A;  5DMR A;  4CFD A;  3L2R A;  4DS4 A;  1JXB A;  3EY1 A;  3V1R A;  5CYQ A;  4CJ5 A;  3O3G A;  1L3S A;  3AVA A;  4AHC A;  3SUQ A;  4BE2 A;  3LP0 A;  4B8A B;  3AO1 A;  3PO5 A;  1HYS A;  5K14 A;  1RDB A;  4H4M A;  1IKV A;  5CYM A;  4CGF A;  4CF9 A;  5C25 A;  4DF8 A;  1Z25 A;  4K8X A;  3TAE A;  5HP1 A;  4HUG A;  4M3Y A;  3V1O A;  3LAM A;  3NF8 A;  3MXJ A;  3ZT2 A;  4DSK A;  3ITH A;  4O0J A;  4BDP A;  4ELU A;  4LH5 A;  4LY7 A;  2HNY A;  4KFB A;  3VQ6 A;  1QS4 A;  4KPY A;  4DTM A;  4OLB A;  4YFU A;  3ZT3 A;  2Z1J A;  2Q3S A;  4FLW A;  4J2A A;  3A2F A;  4KHS A;  4B9L A;  3HYF A;  1X9S A;  2ZD1 A;  3L8B A;  2OPS A;  3K5N A;  5D3G A;  1RT6 A;  2E6L A;  2WON A;  1XC9 A;  4FJH A;  3IRX A;  1C1A A;  4KHN A;  3PY8 A;  1S1V A;  3AA2 A;  3AVN A;  3P83 D;  4JLH A;  1LW0 A;  3WNE A;  3QEV A;  1HYZ A;  3M8S A;  5FDL A;  2XY7 A;  3KTQ A;  3KD5 E;  1WSF A;  3NH0 A;  4PA1 A;  1S5J A;  4DFK A;  4FXD A;  4QCL A;  4RG8 A;  3S3N A;  4M42 A;  4C8K A;  4CJP A;  4FJL A;  1S1U A;  2DFH A;  3T19 A;  1U04 A;  1CZB A;  4EZ6 A;  2KQ2 A;  4BE1 A;  4EP5 A;  3V1Q A;  4FLY A;  3QEP A;  4FK2 A;  4GW6 A;  1UA1 A;  4PQU A;  4AHR A;  4ID5 A;  2O4G A;  1RTH A;  3ZSW A;  1ZBF A;  2KZZ A;  1BI4 A;  3AVK A;  4CJW A;  3TAN A;  3HPH A;  3OYD A;  1HPZ A;  4Y1D A;  3ALY A;  4LH4 A;  4JS5 A;  4E89 A;  3SQ1 A;  3LWM A;  3O4N A;  3TI0 A;  3HPO A;  3TWH A;  3QIN A;  5KI6 A;  3OS2 A;  2YNF A;  3QER A;  4FZX C;  3MAQ A;  3P5J A;  4J2B A;  2E4L A;  4OKE A;  2D0C A;  1TKX A;  3NDK A;  4CJU A;  3HVR A;  3LDS A;  4F4K A;  1K6Y A;  3NBP A;  2FBX A;  4O55 A;  1KFS A;  1CXU A;  3AVJ A;  4CJF A;  4M3T A;  3DLR A;  2OYQ A;  1W0H A;  4Z4C A;  3M8R A;  1KVB A;  1NJY A;  3VQB A;  4BDZ A;  4DTJ A;  1B9D A;  1Z26 A;  2A1R A;  3TAM A;  5J2N A;  1VSL A;  4CHO A;  4DG1 A;  3TAG A;  2Y1J A;  2KFN A;  3OS1 A;  1X9M A;  4QOZ B;  5JS1 A;  1L3T A;  3SQ2 A;  1QHT A;  3AVG A;  4DMN A;  4BE0 A;  1KLN A;  3IAY A;  4DFJ A;  3KK3 A;  1T05 A;  1YTA A;  1HQU A;  1J53 A;  3DLH A;  4KTZ A;  4KV8 A;  4H4O A;  3RR8 A;  3OYG A;  4KI6 A;  3NFA A;  1KRP A;  3I0R A;  4WE1 A;  3K58 A;  3QEI A;  1NK0 A;  1SUQ A;  1J5O A;  3DLE A;  1SV5 A;  1S1X A;  1WSG A;  3CYM A;  4DLG A;  2FBY A;  4O44 A;  1U48 A;  1BGX T;  1EET A;  4L8R B;  4CGD A;  4O0I A;  3PX4 A;  1A5X A;  1T03 A;  1L5U A;  4B9N A;  2GV9 A;  4EP4 A;  3VQ4 A;  1DTQ A;  4W5O A;  2OPR A;  4N41 A;  1Q8I A;  1RT7 A;  3ZSY A;  2ITG A;  4RW7 A;  3AO2 A;  3AVI A;  1RT4 A;  3ZT0 A;  3HT3 A;  1RBS A;  3L2U A;  3V9Z A;  4ZHR A;  1QSY A;  1JKH A;  1NK9 A;  1LV5 A;  1XHX A;  1BCO A;  1HJR A;  1RBU A;  3D45 A;  3TAR A;  1L3U A;  1IKX A;  2WOM A;  3SNN A;  3T1A A;  3VN5 A;  3QEW A;  3CFO A;  1ZBL A;  1N5Y A;  1RTJ A;  1B9F A;  1JL2 A;  4KB0 A;  4ELV A;  3SJJ A;  2X6S A;  4E1N A;  4E7J A;  2KW4 A;  4N5S A;  1NJW A;  1C0T A;  1QQC A;  3C6T A;  4CJE A;  2HND A;  4W5R A;  4CF8 A;  3AA5 X;  3PUF A;  4B9V A;  1BIZ A;  5KRS A;  3OYJ A;  3KLE A;  2VWK A;  3SUP A;  1ASW A;  1ZBI A;  4FW1 A;  1TAQ A;  5HRN A;  1D9F A;  4PWD A;  5J2Q A;  2LSN A;  1BIS A;  2P1J A;  3K5O A;  4LSN A;  5C24 A;  4JRP A;  3HVT A;  3OYI A;  3V9U A;  3MXM A;  2QKK A;  5C42 A;  3HST B;  1I3A A;  4FJN A;  4Z4E A;  1SKW A;  4E7K A;  4TSX A;  3SV4 A;  1RTI A;  1W9H A;  4NYN A;  5FRO A;  1C1B A;  3JSM A;  3QIP A;  1LW2 A;  4FJ8 A;  2HHU A;  4DSF A;  4CE9 A;  3CM5 A;  1C6V A;  1Q9X A;  3AVM A;  4F3O A;  3ZSX A;  3K5L A;  1NJZ A;  4OGE A;  2W42 A;  1O1W A;  4DSE A;  5FRN A;  2G8I A;  1TAU A;  3QEX A;  2I5J A;  2VG6 A;  1NK7 A;  3HM9 A;  1T7P A;  2GBZ A;  2ZQB A;  3CQ8 A;  1JLG A;  1TGO A;  4FJX A;  4J2E A;  1DTT A;  4R5P A;  3QES A;  3G0Z A;  2B5J A;  4I7F A;  4IBN A;  4M41 A;  3AO4 A;  1NOZ A;  1NKC A;  4FJG A;  1KVC A;  3WNH A;  4E3S A;  3KK2 A;  4BDY A;  1SKR A;  4OKK A;  2DFF A;  2IGI A;  4FJI A;  1Y97 A;  5JS2 A;  3CFR A;  3VQ7 A;  4CES A;  3OVN A;  2IOC A;  1VSM A;  4NCG A;  4CFB A;  4PUO A;  1CXQ A;  2DFE A;  4O5B A;  1RBT A;  3OYN A;  3ZCM A;  1C0U A;  1GOA A;  3DI6 A;  4FLU A;  1JXE A;  4OGC A;  4DQS A;  1D9D A;  2G8F A;  2QKB A;  1HYV A;  4CF0 A;  2XHB A;  4I9L A;  3IS9 A;  3RWU A;  1WAF A;  2R7Y A;  1RTD A;  4B9U A;  3WNF A;  4RW4 A;  3DYA A;  4KHW A;  2HHS A;  3HXM A;  3LAN A;  3L2V A;  2YKM A;  1T8E A;  1RNH A;  1VSK A;  1WN7 A;  3VQD A;  3SUN A;  3C6U A;  3DOL A;  5E41 A;  1L3V A;  3ZSV A;  3HO1 A;  1S6P A;  3VQ9 A;  2OZM A;  1TKZ A;  3S3M A;  3OYL A;  2ATQ A;  2JGU A;  4E7L A;  2JLE A;  4BWJ A;  3KK1 A;  3SUO A;  2RF2 A;  3L3V A;  1IG9 A;  1TK0 A;  4FK4 A;  2HHX A;  4CF1 A;  3OJS A;  1NK4 A;  4NYF A;  2YNH A;  1NKE A;  1VSJ A;  4Q5V A;  2P5G A;  4FLX A;  3KD1 E;  4HVJ A;  2HHT A;  4CEO A;  1RDA A;  4OLA A;  4G1Q A;  1LWC A;  3PO4 A;  3IG1 A;  1BCM A;  1C1C A;  4K8Z A;  5I42 A;  3QLH A;  5I3U A;  4CFC A;  1TL1 A;  3K57 A;  4OJR A;  2BDP A;  2HNZ A;  4FJ5 A;  2OPP A;  4NCB A;  3B6P A;  4KTW A;  4W5N A;  4DF4 A;  1UA0 A;  4OKJ A;  4E7I A;  3F73 A;  5DK5 A;  5SZT A;  2YKN A;  4C8N A;  2D0B A;  4DTR A;  3TAB A;  3D0P A;  4DFP A;  4B9T A;  3ULD A;  4FM2 A;  4C8L A;  1NJX A;  4CJV A;  3AO5 A;  4CK3 A;  2OA8 A;  4MQ3 A;  4O4G A;  3DLB A;  1BQN A;  3TAQ A;  5CZ2 A;  3HJF A;  1NOY A;  3UIQ A;  1ZBH A;  3KLH A;  3ZSQ A;  2G8V A;  4HTU A;  2YNG A;  3BDP A;  4FM0 A;  1VSI A;  3OYK A;  1LAV A;  3DRR A;  1RBV A;  5J2M A;  1KVA A;  3OYF A;  1S9E A;  3G10 A;  3V9X A;  2X74 A;  4CHN A;  4W5T A;  3QET A;  3NH1 A;  4CEZ A;  5HBM A;  4CEC A;  4CIF A;  4FM1 A;  3QNN A;  3EZ5 A;  1EKE A;  3AVL A;  4F2R A;  4EZ9 A;  3HP6 A;  3AVB A;  3OYC A;  2F8S A;  3OYE A;  3NCI A;  3M8P A;  4N76 A;  1S6Q A;  4M3U A;  1NK5 A;  1FKO A;  4IFV A;  4M3W A;  2KFZ A;  4DTN A;  4KRE A;  3VQ5 A;  1TKT A;  3B6O A;  3DRS A;  1RIL A;  3HP9 A;  3EYZ A;  2RKI A;  5HRS A;  3DMJ A;  3QNO A;  2HHV A;  4ZTJ A;  3CG7 A;  5CY4 A;  2YHA A;  2IDO A;  4RW9 A;  3VQ8 A;  3ZT1 A;  4CEQ A;  4CK2 A;  3SYZ A;  3OJU A;  3V4I A;  1JLB A;  3NGY A;  3KLG A;  4KKO A;  2DY4 A;  1HQE A;  2VWJ A;  4IKF A;  3VQE A;  4HUE A;  4Z0U A;  3BGR A;  4F2S A;  4FZZ A;  5FRM A;  1SL1 A;  1J9A A;  2D5R A;  2XY8 A;  3VQP A;  1JLE A;  3LAL A;  1XI1 A;  1TVR A;  2IAJ A;  3NE6 A;  1VRT A;  4I9Q A;  3E01 A;  2GUI A;  4I2P A;  4ELT A;  4J2D A;  1REV A;  2Y1I A;  2X6N A;  3TAF A;  5KGX A;  1NK8 A;  1RDD A;  4F8R A;  4CIG A;  5T7B A;  3MXI A;  2B4J A;  4MFB A;  4CJR A;  4JS4 A;  4FLV A;  4DSJ A;  3C94 A;  1BQM A;  2BAN A;  4OPJ A;  1KFD A;  1LAW A;  2G8H A;  3SCX A;  3LZI A;  2KTQ A;  4FCY A;  1KLM A;  4IFY A;  1BL3 A;  3RTV A;  1TV6 A;  3RMD A;  1VSD A;  3CFP A;  4HUF A;  4DTO A;  2HVI A;  1TKD A;  3LP1 A;  3OY9 A;  2YV0 X;  4CED A;  1KTQ A;  2BE2 A;  2QXF A;  4CJS A;  3I8D A;  4FLT A;  3DLK A;  4FJ9 A;  2X78 A;  1QE1 A;  1VRU A;  4DSL A;  4AHS A;  3V6D A;  3AVH A;  3O3F A;  5KRT A;  1EXQ A;  2P5O A;  1TK8 A;  4F3T A;  1X9W A;  4CCH A;  3ASM A;  4JRQ A;  4DSI A;  1DLO A;  4CJT A;  1GOB A;  4HCB A;  2IC3 A;  2O4I A;  1KSP A;  1VSH A;  3RRH A;  1UAX A;  3M8Q A;  1BI4 B;  4DTX A;  4Z4F A;  5J2P A;  3OYB A;  1U45 A;  1WSJ A;  2XY6 A;  1QSS A;  4FJK A;  4DU1 A;  2OPQ A;  3LWL A;  3LZJ A;  1WSE A;  4KB1 A;  2KZM A;  1RT2 A;  3AA4 A;  2PYL A;  1UOC A;  2E6M A;  1X1P A;  1I39 A;  3OYA A;  2HMI A;  3DM2 A;  4B8C A;  3RMA A;  2YHB A;  3AVC A;  1QSL A;  1A5V A;  4B9M A;  2Z1I A;  3MEG A;  3PX0 A;  1RT1 A;  3ZSZ A;  1ITG A;  3FFI A;  2HW3 A;  4FZY A;  1UWB A;  3LAK A;  2Z1G A;  4XIU A;  3SPY A;  1WNS A;  4Y1C A;  3U6F A;  1XWL A;  4RW6 A;  4C8O A;  4CER A;  1CZ9 A;  1HNV A;  4N56 A;  4DQQ A;  4CJ3 A;  3V81 A;  1ZBU A;  4FJJ A;  4OPK A;  3I0S A;  1TK5 A;  4AHU A;  4KI4 A;  1QTM A;  4CHY A;  2PYJ A;  2AJQ A;  4FW2 A;  4B3O A;  3KKR A;  4M45 A;  1BHL A;  4Z4I A;  4CJL A;  4KRF A;  3DLG A;  5CZ1 A;  3V9S A;  3QIO A;  4DFM A;  3RMC A;  1SKS A;  4KO0 A;  3U3Y A;  4BWM A;  2F8T A;  1JL1 A;  1RDC A;  4DQR A;  2P51 A;  4W5Q A;  4CEE A;  1NK6 A;  2B6A A;  2Z1H A;  2FBV A;  5SWM A;  3PV8 A;  1RBR A;  1D5A A;  2D0A A;  1HNI A;  1ASU A;  2ETJ A;  1VSE A;  4E19 A;  1EX4 A;  5J1E A;  4DU3 A;  4UQG A;  4FLZ A;  1YVU A;  3OYM A;  1S9G A;  3H08 A;  3MED A;  4CEA A;  1SL2 A;  3SZ2 A;  1R0A A;  1J54 A;  3LPU A;  4KHQ A;  1JLA A;  3OYH A;  3L2W A;  4FJM A;  3MEE A;  3HL8 A;  3V9W A;  3SPZ A;  3KIO A;  1JLQ A;  4CJQ A;  5EU7 A;  3T3F A;  2XO7 A;  1SL0 A;  3HPG A;  1WAJ A;  4CGG A;  4CHZ A;  1B92 A;  3PX6 A;  2EX3 A;  3K5M A;  3VA0 A;  4CEB A;  4B08 A;  1BIU A;  4Z4G A;  1FXX A;  2FC0 A;  4ICL A;  4E1M A;  1MU2 A;  3L3U A;  1FK9 A;  4C8M A;  1Q9Y A;  4KTQ A;  1YT3 A;  4CHP A;  1JLC A;  3DRP A;  4Z4H A;  3VA3 A;  4KHY A;  3K2P A;  4LSL A;  1GOC A;  1IKY A;  4E0D A;  3RRG A;  5HRP A;  1EP4 A;  3SI6 A;  1WSI A;  3SQ4 A;  3OS0 A;  2FBT A;  2HHW A;  1IKW A;  4CGI A;  4LD0 A;  1LWE A;  4CIE A;  3TAP A;  3NF6 A;  1G15 A;  1A5W A;  4CEF A;  3NGZ A;  4DLE A;  4DS5 A;  2PY5 A;  3NH2 A;  1HMV A;  3KJV A;  3NF7 A;  3KKS A;  3S3O A;  1F21 A;  3AV9 A;  1VK0 A;  4FVM A;  3NF9 A;  4M3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...