1JLBA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
554
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 148
structure length 549
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlbA05
2GUIA 1U4BA 2D7SA 2AQ4A 1IKWA 1Q8IA 1D8YA 3HVWA 4CECA 3DM2A 3T5JA 1D5AA 1KCFA 4FLXA 4IFYA 1LWFA 4NZ0A 2R7YA 5L1KA 5C42A 3P5JA 1DTTB 1NNDA 4E1NA 1QSSA 1TVRB 2R2UA 3L2QA 2XI2A 3OYEA 2JEJA 4M3RA 5KFIA 1VSJA 1FKOB 1ZTWA 5C24B 3KLEB 4WZQA 4C8KA 5K14A 2PZSA 3NH1A 2HNDB 3RB4A 4GVMA 3I5CA 1D9FA 4J9PA 4O3PA 4DF8A 2AX1A 4U7CA 3TANA 4DSEA 4KRFA 4NLRA 5KG1A 1NJYA 3T19A 3LP0B 3K59A 2IM2A 3BR9A 1IG9A 4FW1A 4DTJA 3GYNA 3QNOA 3Q8PB 4J2BA 2QV6A 4KV8A 3OYHA 1TKXB 1ZBUA 4I2QA 2V4QA 3KHRA 3LANA 1RT6B 4MIAA 4CHOA 3L2UA 4CGIA 4FYDA 3M9OB 1IM4A 3AVHA 4Y2CA 4CFAA 1JLQA 2X74A 1DTTA 4I9QA 4X2BA 3G86A 2PYLA 1L3SA 1TVRA 5KGWA 1WSHA 4KFBB 2HMIB 3ZSRA 3CDWA 2D41A 3OJSA 1KSPA 4R5PB 3ASMA 4M3ZA 3QGIA 1FKOA 3KLEA 3PW7A 4CJKA 5KG7A 1BI4B 2HNDA 4DEZA 3BSCA 5SZTA 4DSFA 4N41A 1LWEA 2AGPA 4CFCA 4ZPAA 1HNVA 5KFXA 4IG3A 1GOCA 4DSLA 2HHVA 4QWCA 3VQ4A 1XHZA 3DDKA 3PW5A 3MXJA 4IOBA 4YFUA 4EBDA 3AVGA 3RR7A 4CHPA 3U6FA 2AX0A 4ECQA 1TKXA 4RW8B 1HMVB 4FLUA 4FK0A 3MAQA 1RT6A 4EZ9A 3PW2A 1J53A 4F2RA 3OHAA 4R8UB 3M8SA 4I2PA 4F8RA 4QWEA 4WE1B 2PYJA 3QEVA 1N6QB 4ZVGA 4KPYA 2QK9A 4CFBA 4O3OA 2JEIA 1LWCB 3IGNA 5F8NA 4KFBA 3PR5B 2R8JA 4R5PA 1RNHA 1VSFA 3V81B 4IR9A 4F3TA 4TY9A 2YHAA 2IJFA 3KLFA 3NL0A 3PW4A 3KKSA 4RW9B 1ZTTA 1S1XB 4Q0BB 4DF4A 3WNHA 2WCXA 4QCLA 4K4YA 4W5RA 3AVLA 4NYZA 4K50A 4DL6A 2O4IA 3P83D 4TY8B 3H4DA 4KB0A 1IKXA 4JS4A 4FLTA 4HKQA 4DL2A 1HMVA 1FKPA 1BL3A 4DU4A 5DQGA 1U09A 1SKRA 4QOZB 2BQUA 3NAHA 5HRRA 4HVJA 3KLGB 3TAGA 4FK4A 4O44A 4KO0B 4JRQA 4CJ4A 4OLAA 3OS2A 1SH0A 2LSNA 3SCXA 3HPHA 4Z4CA 2F8TA 2VG6A 3G6YA 2KZZA 4LQ9A 3LAMA 4CF8A 3G10A 4TYBA 2XCAA 1NJWA 3U3GA 3V1QA 1NOZA 4TSXA 4HUEA 3HVTA 3JSMA 4FZYA 3AA2A 4E0DA 3VQ8A 2ATQA 1S6PB 2YKNB 2DY4A 4GC6A 5KFYA 4CHZA 4OJRA 4RW6B 1S1XA 4Q0BA 4RNFA 1MMLA 2BQRA 4ZP8A 3QIPA 1Y97A 2YNIA 3RB6A 4J9RA 3AVKA 2GIQA 4TY8A 2EHGA 3ZSXA 3NF6A 4E7JA 4ZPBA 1X1PA 5DK5A 4KHMA 3ZSZA 5F8IA 1DLOB 3O3GA 4DQRA 2FBYA 2E9TA 1TL1A 1FK9B 3RMBA 5KFTA 3VQ9A 3KLGA 2C2RA 4J9SA 4KO0A 5FRMA 2E4LA 2BANB 2D5RA 2E9RX 4TN2A 5KFBA 1WNEA 1JX4A 2HAIA 4KB1A 1NK9A 1RDRA 1BIUA 1CLQA 2AU0A 3CO9A 1T05B 1BCMA 4N56A 1LW0A 1TV6B 4KHUA 5EWFA 2VWKA 1RT3B 3PHEA 2FBXA 3T1AA 2FC0A 4HCBA 4BDYA 1X9WA 4IRDA 4E7LA 3EYZA 1S6PA 5KFDA 4AHTA 3OVNA 2YKNA 3VQ6A 3HPGA 1SH3A 4J9MA 3D45A 5KT2A 5KG0A 3BQ0A 4RW6A 4XO0A 3QEPA 3BGRB 4O0IA 3LDSA 3I0SA 1IKVB 1W25A 4IR1A 1HRHA 4RNOA 4M41A 2J6SA 3DLGB 1WNSA 1VSLA 3OLAA 1S9GB 1SV5B 3OYNA 5CY4A 1DLOA 2I5JB 2GC8A 4PA1A 5F9LA 1FK9A 3KK1B 1ASWA 3ICLA 4CJTA 2ITGA 2BANA 2FJVA 3AO4A 3PJXA 4G1QB 3CDEA 2FVPA 4ZP6A 3E51A 1NK5A 3L3UA 4CGFA 1T05A 1LAVA 3TAMB 3MEGB 1QTMA 2QKKA 4AHUA 5HRPA 4WFYA 4ECYA 2D0AA 2E6MA 1U04A 4KBIA 4M3YA 3BSAA 4AH9A 4FJLA 5DG7A 1UAXA 4URGA 5KT6A 1S1WB 2KFZA 3TAEA 2AJQA 4LQ3A 3LPUA 3CYMA 4K4XA 1IKVA 4DL3A 3DLGA 3KHHA 5L1LA 1VK0A 3VQQA 3ITHB 3RAXA 4Y1CA 3PV8A 4FJKA 3LP1B 3IS9A 1RT4B 4YQWA 1SL2A 4OPJA 2I5JA 5J2NB 3GV8B 1C1CB 3KK1A 2HNZA 1REVB 3U3YA 3B6OA 2IAJA 1G15A 5I42A 3NH2A 4L8RB 4FJ7A 4KHYA 1S4FA 3OYFA 3I0RB 2GBZA 5DLFA 2OZMA 3LPTA 4NYNA 4G1QA 3UR0A 4FS2A 3OS1A 4K8ZA 3HP6A 4N47A 4CIGA 4CJPA 5KGXA 3F73A 3TAMA 4CGGA 1QE1A 3ULDA 1SUQB 4FJ8A 4QW9A 3GIJA 1JXLA 3DLBA 4DSIA 3MR2A 3KTQA 1JKHB 3DRSB 4B9SA 1S1WA 3BQ2A 4NLUA 1LW2B 4IDKB 1CXUA 2VA2A 4CEQA 1RDBA 4CF0A 2ATLA 3L2WA 1S1VB 4FM0A 2UUTA 3ITHA 4CE9A 2BQ3A 3LP1A 4ICLB 4EEYA 1TKZB 5J2NA 2OA8A 1S6QB 1C1CA 1REVA 4KREA 3G0ZA 3OYDA 4BDPA 1TP7A 4DU3A 3BREA 4EP4A 3TVKA 1U47A 3AVMA 2E6LA 5KFZA 1JLEA 1LWFB 1KVCA 1JL1A 2A1SA 4ED3A 1KVAA 4CK2A 4FJXA 5CYQA 4ECWA 1SUQA 2I1RA 3K57A 2B6AA 3OYIA 3UIQA 1WAJA 4FLZA 1QS4A 5F8HA 3OYCA 3TAQA 1JKHA 2R8IA 2IJNA 2AWZA 3JYTB 3OSNA 4PQUB 1EETB 2HHQA 5KFFA 1LW2A 4IDKA 4CGDA 1JXBA 5KFCA 4NCAA 3S9HA 1KFSA 3SUNA 1S1VA 4DU1A 4ZPCA 2ETJA 1I6JA 3NF7A 3I5BA 5DMRA 4BDZA 4ZTFA 1UOCA 4FJIA 4DQIA 5KT4A 3SQ0A 5KFOA 4QWAA 1S6QA 1KFDA 2XWYA 1NOYA 3KD1E 4KV8B 4KHSA 5FDLB 1S1UA 4JV0A 4I2QB 5C25A 4OVLA 2ZD1A 4IQXA 2PY5A 3K5MA 4CHNA 1KHVA 4F2SA 1J9AA 1NJZA 4FJJA 3HK2A 3UDLA 3C95A 1JLQB 4H54A 3LAKA 1NK0A 3DOLA 3RB0A 2O5DA 2G8IA 1RT5B 2G8UA 2Y1JA 3TABA 3MR6A 3HT3A 3VQCA 3OYJA 5DQIA 4IKFA 3O3HA 4CEOA 1HJRA 3L8BA 3JYTA 4IH6A 4PQUA 1EETA 4IH5A 4NLDA 5KG2A 4CJ3A 4DS5A 3PVXA 4Y3CA 3LWLA 4CGHA 1LWEB 5EWGA 2JC0A 3SUOA 1JLFB 1HNVB 4J9OA 2BR0A 4IG3B 4CJEA 2GV9A 5HRNA 4MKBA 4E1MA 1UA1A 3MEDB 3IRXA 3OHBA 1T94A 2XC9A 4FM1A 3EY1A 5FDLA 3AVJA 2YNHB 4B9UA 1TKDA 3KLHA 2JLEA 3PW0A 1NHVA 4O3SA 4I2PB 1KHWA 2RDJA 4DLEA 3VQEA 3HPOA 2WK4A 1RBVA 2NUBA 1RDDA 4JS5A 3M8PB 3HKWA 4Q43A 2JEFA 3D5MA 3HM9A 1YTAA 3SFUA 4CEBA 1YTUA 1RT5A 2HB5A 4K4ZA 1I39A 4ECVA 5SWMA 3OJUA 4F4YA 4CESA 3PX0A 1WLJA 4BE2A 2RDIA 2IBKA 4HUGA 4Q44A 1HQUB 5KRSA 4M95A 1VSKA 4FLVA 4M3TA 2F96A 2B43A 4DQPA 3KLFB 2WOMB 1SKWA 4Q5VA 4F4XA 1K6YA 4F3OA 4CEFA 4JUZA 1JLFA 3H5UA 4IH7A 3HL8A 3PUFA 3V6JA 1ASVA 3ISNC 4HCCA 1TAQA 3I5AA 3PJWA 1RYSA 3PO5A 3NKYA 4BE1A 4KSEB 3H59A 3SV4A 3MEDA 1RT2A 3Q8RB 4E19A 1IKXB 3QO9A 4XIUA 3M9MB 2HHWA 1EKEA 4H4OB 4DTMA 2YNHA 1FKPB 3HO1A 4HHTA 3F9KA 4KE5A 4CJWA 3V1RA 4NLQA 3CJ5A 3H5YA 4EYIB 4M45A 3VQ7A 4W5TA 5KT3A 3HXMA 4O44B 5JXSA 3M8PA 2R2TA 4FLYA 4NLTA 3OYGA 1BQNB 2EX3A 4FM2A 2ASJA 3QGHA 4DLGA 3HVAA 3RWUA 2VG6B 4NLXA 5JS1A 1SL1A 1UA0A 4K4SA 3OYMA 5JUMA 2IA6A 2OH2A 1JL2A 1HYVA 3HVTB 4WYLA 4Y2AA 3JSMB 3HP9A 4FJMA 4LD0A 1HQUA 4O3QA 1RA7A 3RMAA 4KB7A 4I7FB 2WOMA 1NK8A 3EPGA 3QLHA 1FXXA 3C94A 3QIPB 1CXQA 2YNIB 3CM5A 4DMNA 4JV1A 3PX6A 2IOCA 4Y34A 4M94A 3SQ2A 4DS4A 1KRPA 4URQU 4M3UA 3SUPA 5L9XA 2D3ZA 2OPRB 3GILA 4O3NA 4NCGB 2XY6A 4H4OA 4J9NA 3SJJA 4OKKA 4CERA 4ZVFA 4I9LA 1KLMB 1YT3A 1TL1B 3FFIB 4IRCA 4QWDA 1SKSA 2C22A 4TYAA 1KTQA 2XY5A 3ZSOA 1WSIA 1QQCA 4O55A 5D3GA 4BACA 4ELVA 4TXSA 2X78A 3WNGA 3V6KA 1HYSB 3PR4A 1BQNA 1MU2B 3ZSWA 3ISND 3QINA 1ZBFA 2C2EA 3PY8A 3LALA 1JIHA 3WNEA 1LW0B 2DFHA 1IKYA 3OYLA 4FCYA 4U6PA 4B3OB 1EX4A 3LZJA 5KFLA 1BGXT 1O1WA 3CJ4A 4I7FA 3RB3A 3QZ8A 4EYHB 5J2MA 2E9ZA 1EP4B 1VRTA 4CK3A 4WXWA 5KFJA 3OS0A 3I0SB 2JEGA 1XWLA 2VG7B 4DL4A 4EBCA 3OLBA 3V6DA 5KFKA 2OPRA 4CJUA 2RKIA 4NCGA 1S97A 4RU9A 2QKBA 4TQRA 2V4RA 3CDUA 1KLMA 5KG5A 3CWJA 3FFIA 3M9NB 3K5NA 4M3XA 4MH8A 4N5SA 4NCBA 3SYZA 4ED0A 1S10A 1C0TB 2ZE2B 4MK7A 1HYSA 3HJFA 4Q8EA 4HYKA 1MU2A 5CYMB 1JLGB 5T7BA 3DRPB 4FJNA 4GC7A 1Z26A 2WHOA 4KAZA 1HARA 3KLVA 3MFHA 4OKEA 3EPIA 4WZMA 3QGGA 3ALYA 1SH2A 1CZBA 2FLNA 4TQSA 4B3OA 3AVBA 4XPCA 3ZT0A 4PWDA 4BWMA 3O4NA 5HRSA 1HNIA 4J2EA 1T03B 1EP4A 4BWJA 1RTIB 2WRMA 1Z25A 2HVHA 1K1QA 1T7PA 2VG7A 3OYAA 2R2SA 3EZ5A 4NLYA 4J9LA 5HBMB 4IBNA 3IS9B 3V9SA 5EUHA 3GIIA 2B5JB 1TL3B 4B9VA 4DWIA 1WSGA 4PUOB 1WSJA 1XC9A 3H5SA 2HNZB 2KFNA 4CIFA 2IAJB 5I42B 1S49A 2V9WA 3OL7A 1C0TA 4CFDA 2XY7A 2ZE2A 4OLBA 4CEDA 2DTUA 3KK2B 5CYMA 2W7PA 1JLGA 3Q8SB 3DRPA 2KQ2A 4CJ5A 1GOBA 4NLSA 1NK7A 3OL8A 3IG1B 2JC1A 2ILYA 4ED7A 3DRRB 3GIMA 1QE1B 2C2DA 4RNMA 4M42A 4ID1A 1QUVA 3IN5A 3SPYA 4CEAA 1QAIA 4J2AA 2YNGA 4CF1A 2W9BB 5KI6A 4N76A 3TAFA 3T5LA 1RTDA 1T03A 1RAJA 1RTIA 4RW7B 3H98A 2WTFA 2QE5A 4CJRA 1L5UA 4IG0A 4UQGA 4JV2A 5E41A 1RA6A 5HBMA 4E7KA 4ZVHA 4KKOB 3NGIA 2VG5B 3E01A 1YVUA 2P51A 2ZQBA 2B5JA 1TL3A 4PUOA 1I3AA 3NHGA 4NRTA 1ZBLA 5DGAA 4AHSA 1HQEB 2HVIA 1BQMB 4ZHRA 4ELUA 4EP5A 4ECUA 3DI6B 1S9FA 3RRHA 3DMJB 3KK2A 3QEWA 1JLEB 5HP1B 3IG1A 1D1UA 2XCPA 1RYRA 4KI4A 3FQKA 4ZVEA 2FJWA 4FVMA 2HWIA 3DRRA 4RW4A 2A1RA 4J9QA 1C2PA 5CYQB 1WN7A 4YP3A 2B6AB 4Q45A 3K5LA 3OL6A 2DFEA 4Z4IA 1RILA 2J6UA 2W9BA 4DL7A 1D0EA 4DFJA 4CJFA 2ALZA 4LSNA 4H4MB 5DQHA 3AVNA 4XPEA 2X6NA 3DOKB 3D28A 4AHVA 4DTPA 1DTQA 4AHCA 4ID5B 3FSIA 3SQ1A 2G8HA 4RW7A 2P5OA 1Z4UA 5F9NA 1NK4A 2IC3B 2IS3A 1JLCB 4YMEA 3MXMA 2W9AA 1WSFA 2WB4A 3TAPA 4KKOA 4FBUA 2VG5A 3OY9A 3GV7B 4H8KA 2XGQA 3NCIA 3H40A 4QW8A 2W8KA 1HQEA 3ZT2A 4CJSA 5KT5A 1BQMA 4QAGA 1S1UB 3V9WA 2YNFA 3DI6A 5C25B 4IFVB 2ZD1B 3DMJA 5KFSA 3BSNA 3OSPA 3RMCA 5J1EA 5HP1A 3LWMA 1EXQA 2UVRA 3DOLB 4C8MA 4FLWA 4KI6A 3AVCA 3NMAA 2QXFA 1QAJA 4DFMA 4F4KA 1S9EA 3MEEB 3ZT3A 1NKEA 3SV3A 4H4MA 1T8EA 1RTJA 4TLRA 2VWJA 3CJ0A 4FZZA 4Z4HA 3CQ8A 3DOKA 5DG8A 4DTRA 4ID5A 3TR8A 2W9CB 1N4LA 3AVIA 1U49A 3QYYA 1C6VA 2IC3A 1JLCA 5EDWA 4CEZA 4MKAA 3QERA 2FJXA 4RUCA 3RMDA 3KLIA 1ASUA 2WONA 4OGEA 3IRXB 3AA4A 4FJHA 4DG1A 4LH5A 3LP3A 4O0JA 2HNYB 3KLHB 5HLFB 1S0NA 4IFVA 5F8LA 1A5VA 1J54A 4C8NA 4W5NA 2OPPA 4GW6A 3VQPA 2RF2A 3MXIA 3AVFA 4CF9A 3IAYA 5I3UA 5T14A 2R8HA 4K4TA 2Z1HA 3NFAA 3KK3A 4ECRA 4EO6A 3DLKA 5DLGA 2OPQB 2KW4A 3GQCA 5F8GA 4DTSA 4YR2A 4ED8A 4ED1A 4K4WA 1CSJA 4NLVA 4KAIA 4O4GB 5C5JA 3MEEA 1QSYA 3Q8QB 1HPZB 5KFEA 2BDPA 4E7IA 3THVA 5EWEA 2UVWA 3VA3A 2XRIA 2W9CA 3NH0A 1RTHA 1GX6A 4FJ5A 1TAUA 2XY8A 4CJLA 1CZ9A 3B6PA 3FRZA 1RBRA 1R0AA 1N48A 2BGGA 3NF9A 4ZMMA 1RT2B 4KTZA 3RRGA 4K8XA 5F8JA 4Z0UA 3QO9B 3V6HA 2UVVA 2ZKUA 2HNYA 2RN2A 3ZSQA 3V9XA 5HLFA 4FS1A 2AGOA 3HHKA 2UUWA 3H2LA 4QPXA 2Y1IA 4MQ3A 1RCHA 4M3WA 5DGBA 3ZSYA 3HYFA 3MFIA 2OPQA 1C1AA 4NRUA 3H5XA 4RUAA 1K1SA 4ED2A 1ZETA 4MFBB 3I8DA 3K58A 4F4WA 4O4GA 3CM6A 3AV9A 1HPZA 1VRUB 2J6TA 3CVKA 5KG6A 1JLBB 2HHUA 2ASLA 1B9FA 2OPSB 2YHBA 1L3VA 3SZ2A 2F8EX 1VSMA 3HVRA 3QLHB 2DPJA 3T5HA 4K4VA 1RBUA 4WFZA 2DPIA 4CIEA 5C24A 4R0EA 3L2RA 4IKAA 5KT7A 2FBVA 4CK1A 1Q9XA 3NE6A 3CJ2A 2G8VA 4RNHA 1BISA 5KFRA 4DSJA 5J2PB 3H4BA 2FVRA 2FBTA 2XI3A 3UPFA 1WAFA 5L1IA 3LP0A 5D3GB 3SNNA 1XHXA 4J2DA 4FXDA 2KTQA 2X6SA 4WFXA 1RDCA 4MFBA 3DLEB 4CJVA 4DTNA 3VQBA 4MK9A 1IKYB 1XI1A 1C0UB 1X9SA 3T3FA 1XR7A 1VRUA 5KG3A 3FDSA 1JLBA 2O4GA 4E89A 2B4JA 2OPSA 5KFWA 5J2MB 1XR6A 1JLAB 2BRKA 3OYBA 2P1JA 3V9UA 5KFNA 4K4UA 1VRTB 1HYZA 2HMIA 1U45A 4KHQA 5KFUA 4YR0A 1TK5A 3CG7A 3G6VA 1S0MA 2G8WA 4WYWA 4EO8A 1NJXA 1IH7A 2C28A 3V6DB 1BI4A 2RKIB 3QEIA 4RZRA 1J5OB 3CFPA 4PY5A 4RG8A 5J2PA 3OL9A 1W0HA 3LZIA 3NDKA 3KD5E 5FROA 1W9HA 2JGUA 1VSDA 3NAIA 5KFMA 2RPIA 2HHXA 3EZUA 1N5YB 4ZPDA 1L3TA 3N6MA 1QHTA 4RW8A 3KIOA 2W8LA 3C6TB 4AHRA 1S1TB 5HROB 3IGVA 3KNAA 3QZ7A 3BJYA 3O4QA 4R8UA 3DLEA 3C6UB 2HWHA 2P5GA 5L1JA 4DFPA 1C0UA 2IMWP 3AO1A 4WE1A 2YKMB 4Z4FA 3DLRA 3N6NA 2VA3A 1SL0A 3A2FA 1L3UA 1N6QA 5KRTA 3AA5X 2G8KA 4PWDB 3TWHA 3ZSVA 1JLAA 1HNIB 3M8QB 1LWCA 4B9NA 1KLNA 1U48A 4CF2A 3PX4A 4KTWA 3MECB 4DL5A 4ECSA 2OZSA 4KHWA 3V81A 2V0NA 4J9KA 1X9MA 5CZ1A 4LSLB 2D0BA 2FVQA 4NLPA 1LV5A 1ZBIA 4YNQA 1J5OA 4RW9A 3N6LA 3GIKA 3SUQA 1VSHA 3MF5A 4E3SA 2XHBA 4HUFA 1S48A 1T3NA 3ZCMA 5KTQA 5KFHA 3LP2B 4NLOA 4KTQA 3DYAB 4ZP7A 1N5YA 4O5BA 4CCHA 3VA0A 3KHLA 2D3UA 2FVCA 3AO2A 1RDAA 3RAQA 4BE0A 3C6TA 1S1TA 5HROA 4ED6A 3SI6A 1RT1B 3FQLA 4ECTA 3TARA 4F50A 3C6UA 4E7HA 4DTUA 4ECZA 4NLWA 3O3FA 2YKMA 3SQ4A 2YNGB 5KFPA 3PZPA 4F4ZA 3MR3A 1IO2A 3H08A 1RTDB 3M8QA 1A5WA 1RBTA 2HHSA 4CHYA 4HTUA 3MECA 4B08A 4IG0B 4G3IA 4QWBA 4CJQA 4B8AB 2Q3SA 1JXEA 4B9LA 4LSLA 3SFGA 1TKTB 3D0PA 3CIZA 3E01B 1Q9YA 3VN5A 3ZT4A 1NK6A 3L3VA 4WXOA 4AILC 4CHQA 2AGQA 4ZHRB 3NGZA 4ELTA 4Q8FA 2FLLA 4OKJA 2XGPA 1N56A 3KKRA 1NKBA 3LP2A 2Z1IA 3DYAA 3MTKA 3NF8A 3VQSA 1ITGA 3NAEA 4RW4B 4O4RA 1RT1A 5DG9A 1TK8A 2BE2B 1C1BB 2YV0X 4KHNA 5KFGA 5CZ2A 1QSLA 3QEXA 4LSNB 1ZYQA 5KG4A 1DTQB 1TV6A 1C0MA 1RT3A 1TK0A 5KFVA 4ZP9A 2UVUA 3HSTB 4DQQA 1LAWA 2Z1GA 1TKTA 3S3MA 4LY7A 2IM1A 2XO7A 3VQAA 5J2QB 3WNFA 4DFKA 4EBEA 3K2PA 1TGOA 4MK8A 3BGRA 3BSOA 3T5KA 3CFRA 1B92A 3BQ1A 2YNFB 3K5OA 4MIBA 1S9GA 1SV5A 2W7OA 5EU7A 5J1EB 3RTVA 4C8LA 3CFOA 3GV5B 1GX5A 3AA3A 2BE2A 1C1BA 4ECXA 3V1OA 2BRLA 3S3OA 3PO4A 1UWBB 3KJVB 2CKWA 2HW3A 4IRKA 1S9EB 4Y1DA 2IGIA 4Z4EA 2G8FA 1RTJB 3QIOA 1RT7B 3QESA 3KOAA 3MEGA 3RBEA 1S0OA 1GOAA 4JLHA 4OGCA 4OPKA 4Z4GA 1VSIA 3CJ3A 4EZ6A 1D9DA 3DLHA 3BDPA 4ZTJA 1F21A 4NLGA 4URSA 3KHGA 3KLIB 5J2QA 2WONB 1NKCA 3QIDA 4DG1B 4KHRA 2R2RA 3V4IB 3MR5A 2OYQA 4YR3A 4RNNA 1KVBA 3ZT1A 3NBPB 4B8CA 4CEEA 3OYKA 5F8MA 2DFFA 2OPPB 2KZMA 2RF2B 1RT4A 2EC0A 3L2VA 5I3UB 1YVFA 1A5XA 3AVAA 3M8RA 2FLPA 3AO5A 4GMJB 3KK3B 3G6XA 3TI0A 3RR8A 3DLKB 4B9MA 2Z1JA 2ILZA 1VSEA 1IKWB 1UWBA 3DM2B 3KJVA 3NGYA 3I0RA 1WSEA 2FVSA 3V9ZA 5FRNA 3SPZA 1XR5A 3VQ5A 4IFYB 4DSKA 3QETA 1RT7A 5C42B 4W5OA 2R8GA 4DQSA 2IM3A 3KMSA 2IDOA 2R8KA 4W5QA 1B9DA 4CGJA 5JS2A 1RTHB 2F8SA 1OS5A 3S3NA 3KMQA 3QNNA 1TQLA 4FJGA 3P1GA 2GIRA 2ASDA 4FK2A 1R0AB 2IM0A 2HHTA 5KFAA 2W42A 3DRSA 4LH4A 4FZXC 5K14B 3TQ1A 1BHLA 1NHUA 3V4IA 4DTOA 4NYFA 3NBPA 3UQSA 1BCOA 5KFQA 4FJ9A 3VQDA 2D0CA 4DTXA 1RBSA 4ICLA 2CJQA 1BIZA 1S5JA 3NGDA 4JRPA 1ZBHA 1TKZA 4B9TA 3SI8A 4O3RA 4FW2A 4OL8A 3RBDA 4C8OA 4FBTA 3AO3A
chains in the Genus database with same CATH superfamily
1CLFA 4WK1A 5AJ3K 2NRHA 1IKWA 1Q8IA 2G2OA 1D8YA 3NCPA 4WFBQ 5CD4H 1PCAA 2XMVA 3HULA 3T5JA 1D5AA 1GLCG 1O13A 3FMWA 4GO5X 3Q8YA 3P5JA 2QM1A 1DTTB 1NNDA 2L48A 1X60A 4WIIA 3W63A 1U1NA 2R2UA 3OYEA 2DY9A 2NYHA 1YJ9N 4C8ZA 4M3RA 2ZJPL 3SSQA 5KFIA 1ZTWA 3KLEB 2IVFB 4C8KA 2PZSA 3RB4A 1JCEA 4GVMA 3PRVA 3I5CA 2L3MA 4HTJA 4J9PA 1Q4RA 2AX1A 4DF8A 4DSEA 1DAXA 1HWJA 4K8RA 3MGJA 3DDIA 4JI2K 3CCQN 1KOOA 3F9MA 3QNOA 3Q8PB 1HPMA 2V2KA 4X62J 1NWKA 2G0JA 3W9JA 1XMBA 1RT6B 3SLCA 1NU4A 7FD1A 4CGIA 3IC1A 3BN7A 3C7NA 1CS4A 3JTOA 3JTPA 2PYLA 5DJBA 2CQPA 4QR2A 1WSHA 5ETLA 1XJWB 2B3TB 4V19S 3ZSRA 2AEMA 3MWTA 1SJ4P 2EBGA 3NGRA 1H3DA 1FKOA 2AHOB 1RZMA 3PW7A 3Q22A 4CJKA 4DEZA 3BSCA 3R5CA 3IM9A 4FYYB 2AGPA 1CC8A 4DSLA 4FF2A 3ENHA 1RWMB 3CCJN 1AA1B 4FF3A 1BD6A 4BRCA 3I9ZA 5IV3A 3MMAB 4ILRA 4YFUA 4CHPA 2OGUA 1TKXA 2I7NA 2Z30B 2GJFA 4FLUA 3CDBA 2KT2A 3KUEA 2BW2A 2VIHA 1IR0A 3MAQA 1S7IA 3M2RA 1JXVA 4I6YA 3K2YA 4QWEA 4DPWA 4Q2MA 1NB7A 4MO5A 1N33F 3MPYA 1VIXA 4YORA 1QAXA 3B4MA 4CFBA 3IGNA 4DU8A 3CCSN 2EFGA 1VSFA 1QY7A 5E3AA 2YHAA 2UXBJ 4GKKK 1S4EA 1VQ9N 3KKSA 3G82B 4KYZA 2FJAB 2J4RA 1T9YA 4QCLA 3HHLA 1SC1B 2MKSA 3FMBA 2MQMA 4K50A 2O4IA 3P83D 2E5IA 4GMKA 4NMXA 5A76A 2ZKTA 4Y65A 1BQXA 1XQSC 4DU4A 1SKRA 4QOZB 1RGIA 2BQUA 3NAHA 3WBZA 5HRRA 1M5OC 3KLGB 3OTOJ 3P4IA 4FK4A 2F3JA 3CMAN 1U7LA 1SH0A 2LSNA 1E6VA 3SCXA 1T44A 4YDUC 3QT6A 1K9MO 2KZZA 4LQ9A 1F9EB 2VDIA 4TYBA 1D09B 4YY3F 2XCAA 2CADA 3EKSA 1NJWA 4G9ZA 4TSXA 3RBZA 3KXDA 3HVTA 2FHKA 5RUBA 4FZYA 1HR0K 1H7WA 1WKJA 2M3DA 2CYYA 3JXUA 1E6YB 3G71N 1AYEA 2YKNB 4BR0A 2F9TA 5FPDA 4BC9A 4OJRA 1Y97A 2YNIA 3MPDA 1HKGA 4X65F 1HD1A 3TVZA 3HFKA 2EWSA 2EHGA 4TY8A 1MG7A 1X1PA 5DK5A 3ZSZA 5F8IA 1DLOB 4QR1A 1D8ZA 3J80O 4DQRA 3O3GA 4OYBA 1VQ8S 2FBYA 4TU8A 1TL1A 1RHKB 1FK9B 2H9ZA 5JJBA 4CQ1A 1V9OA 3TWZA 5AQLA 2P2CB 4FVCA 3MXHP 4KO0A 3HHLD 2MJUA 4H0TB 1EKRA 2BANB 1YLXA 2E4LA 1Z2ZA 4TN2A 3VVTA 1NK9A 2V8VA 3CO9A 3I4PA 2GGPA 3J7ZT 3DAWA 2IA0A 2RUSA 2G0IA 3GDQA 1X9WA 1BY9A 2OI2A 1TYQB 1FFGB 2V68A 3EXYA 3TSPA 3VQ6A 2Z57B 4J9MA 1R8BA 2XSJA 4ED4A 2ZOGA 4CZIA 3GTYX 1HW8A 3VGLA 2ZM6F 2J6SA 3DLGB 2VD3A 1WNSA 1U2RA 3OLAA 4FXWA 5AQGA 2OEJA 3JAMY 3A5NC 2R7VA 2EXUA 1RWNB 3AOCA 2Q6BA 2DH8A 3DGPB 1BOTO 5J1NA 3VHQA 4USJC 2PA3A 3MCNA 4ZP6A 4ZVRB 4KH1B 2J9CA 4AHUA 5L9NA 2J0QD 2VV5A 3S41A 2D3O1 1U04A 4KBIA 5EX5A 4M3YA 3BSAA 4AH9A 4FJLA 5DG7A 1ZAVA 1UAXA 4URGA 1X4DA 3NNCA 4LF4F 4OHWA 1G6BA 4K4XA 4IZ9A 3WHIA 2OP5A 1RWPB 1EWRA 4CZMA 3IS9A 4B3RJ 1SL2A 1IM6A 3CCRS 2X7IA 2P9LB 3AT1B 4JK9A 3AD9C 4L8RB 3CPWM 4FJ7A 4KHYA 1GXLA 3OYFA 3OBWA 2CQHA 3LPTA 4G1QA 3FZHA 1YJWN 1I94J 1T3OA 3ZZUA 3A3NB 2K3IA 4ILMA 2I38A 4OLPA 2UU9J 3TAMA 3ULDA 1QE1A 2VODA 4FYVB 1N33K 4FJ8A 3GIJA 1EARA 4PL7A 4QPTA 2JFDA 3MD3A 2P6TA 2DNZA 2KYZA 1S1WA 3CXCR 3BQ2A 1GMUA 1OH5A 1YRUA 5ETVA 2MY7A 1HA1A 4OYWA 4M5KA 4JI6J 2BQ3A 1UJ4A 4ICLB 1EQYA 5HQLA 3LH2S 1M5KC 2GNKA 5J2NA 3OUYA 3OYDA 4BDPA 1TP7A 3TVKA 1VCTA 1WACA 2YWKA 1X4BA 4WKRA 4KHPK 5KFZA 3CT9A 2A1SA 2YQ1A 4FOIA 2BEFA 3WZ0A 3MOZA 4C11B 2B6AA 4DHVA 2QX0A 2V4JA 1TU0B 2FQQB 3UIQA 3O2IA 4LR9A 5F8HA 1JKHA 3AAWB 2GVZB 4UOHA 2UXCF 2H65B 2NREA 2NLXA 4PQUB 4PG7A 2ZZTA 1ZH5A 4FPRA 5KFFA 1Q5YA 4IDKA 4CGDA 3I32A 1Y4ZB 4J8FA 4LUBA 1DQ8A 3SUNA 1S1VA 4DU1A 1Q81O 2ETJA 1I6JA 4ZTFA 2BUNA 4X65K 3ZX2A 5KFOA 4XH1A 1KFDA 2XWYA 2GHPA 2CJXB 1ITPA 4LVNP 3SSSA 4MT1A 4CHNA 4FJJA 3WXKA 5L39A 2UYTA 3C95A 3C7NB 2G8IA 4K42A 2Y1JA 2DGTA 3TABA 3MR6A 2HS4A 3OYJA 5H9FK 4IKFA 2R7WA 4CEOA 2PFDA 3JYTA 2AEFA 3K7RA 4IH6A 4LMZA 4B3SF 2CQ1A 2F8HA 3F2KA 4IH5A 1HBUB 4CJ3A 3PVXA 3M6WA 4Y3CA 1V4TA 4CGHA 1DZ5A 5EWGA 1YXQA 2JC0A 3M2UA 1MSWD 4QIGA 4NEZA 5A8WA 5GMKa 3R5JB 4E1MA 2ZM6K 3MEDB 2JNJA 4A62A 4FM1A 1R8CA 3H42A 3GL1A 2E66A 3O1WA 3O1BA 2QLJB 3V5RA 5B08A 3C16A 2M7SA 3QB0A 4Q43A 3AXMA 2GV1A 3UDCA 1YTAA 1S3XA 2HB5A 4A8OA 1RBOB 1MNEA 1I39A 3NNAA 3CGIA 5ETQA 4OZJA 4CESA 3FFKB 3GSIA 4PKGA 4X4VA 3EEQA 1YRTA 3ID6A 3QRQA 4Q44A 4M95A 1VSKA 2BXJA 4FLVA 5ETMA 1SKWA 4C6AA 4Q5VA 4CEFA 2ZUAA 2UV8A 2CGLA 4W4MA 4LF4K 4JOUA 4HCCA 3MN9A 3NKYA 1S72N 4KSEB 4DZ6A 2J5AA 3H59A 3MX2A 4IO8A 2C3UA 3E8OA 2M8DB 3POTA 1WOQA 3M9MB 1Q82T 1EKEA 2YNHA 3THWA 2KN4A 3HO1A 4HHTA 3F9KA 4KE5A 3V1RA 3CJ5A 4H5VA 4F0KA 1ZAXA 3FSXA 3ZYYX 3SQGB 1NSPA 4NLTA 3IAS9 1FD8A 1R7IA 1BQNB 2F7TA 3GMGA 3QGHA 2R7OA 5ELZA 3H46O 4BC3A 3P4UB 5T41A 4LR8A 4X4NA 3E9PA 1FRKA 4M5HA 4CO5A 4OZLA 1UA0A 1YDLA 2OH2A 1JL2A 1HYVA 3HVTB 4WYLA 2PI4A 3VTHA 1YIJN 2E7WA 3MMCA 3N5BA 4HWIA 2VONA 1D9AA 4I7FB 2FF6A 5D78A 1SQKA 1NK8A 3EPGA 1SKUB 2G2ZA 2BM1A 4JK8A 1HKBA 2YNIB 3CM5A 2IOCA 4Y34A 2CPIA 3W60A 1ZM4A 1KRPA 4URQU 5L9XA 2PE8A 2EK1A 4J9NA 1SIZA 3EKUA 4ZVFA 3ZZYA 2UUAF 1YT3A 4I9LA 1TL1B 4IRCA 2RB7A 4PXCA 3HT0A 4MDAA 1WSIA 5LJWA 3HLUA 3H90A 2X78A 4NE9C 2ZJRL 3ZSWA 2ADCA 5HMWA 4LF9F 2V67A 4WKYA 1B0TA 2RJZA 1VHFA 4BS2A 2K1RA 4P52A 3J81U 4B3OB 3LZJA 1U26A 1O1WA 1NSAA 1VQ6N 1RP5A 4BLGA 1WC5A 4UOGA 3QZ8A 2UXCK 4G1PA 4DPTA 1N32F 3TEGA 3PCOB 2XSJB 3C46A 4OI3A 5KFJA 4FVUA 5D77A 4DL4A 1Q78A 2XZTB 4JD2A 2RQCA 2O8BA 1TUWA 1RHUB 5L38A 4NCGA 1BMQB 4DUZK 2P8IA 5TKWA 1X4AA 1IJJA 2CIMA 3CDUA 1KLMA 5KG5A 3CWJA 3FFIA 3F44A 4LFBJ 2DT9A 3PEHA 2XMUA 4NCBA 4QIWD 1T6DA 4ED0A 2LECA 3R1XA 4MK7A 2BJ1A 1HYSA 2YH0A 4Q8EA 4HYKA 1MU2A 5FLXU 1FXRA 2CQIA 3DRPB 5C12A 4GC7A 2WHOA 5AE2A 1AZSB 3EZOA 5AJ3J 1QLNA 3J7AP 3T7ZA 3KLVA 4OKEA 4AXJA 4WZMA 3QGGA 4NASA 3CJ9A 1S59A 1X4EA 3IFRA 3OTCA 4B3SK 1HNIA 4J2EA 1T03B 5A0YA 4CZJA 1HL6A 4YOVA 4C0BA 2R7RA 1T7PA 3W3DA 4F02A 3EE3A 5DZ7A 3J7Z5 1WDDA 3H25A 4IBNA 3IS9B 2A2DA 4PG8A 4IO9L 4TKTA 2B5JB 3UKRA 3CJAA 3H0PA 1P8GA 3CJTA 1WSGA 2V5HG 3WUHA 2KFNA 2ZJQL 1K73O 1S49A 3EICA 4JI2J 3RUBL 1FCAA 5CYMA 1ACMB 1NK7A 1HWUA 3OL8A 3IG1B 1F5BA 2A6MA 4CNZA 5CHCB 3FE1A 4XH4A 1QE1B 4QS8A 1QUVA 2GIFA 2KKZA 3SPYA 2OTJN 4KGMA 3J7YP 1BXNA 2B4OA 2Q36A 3B6BA 3L4QA 3AA9A 1AUDA 5HJXA 2VBYA 3TAFA 1HW9A 3IMXA 2ZBRA 1BA1A 4USMA 2CVIA 1RTIA 2AD9A 4RW7B 2QE5A 1L5UA 3P96A 2KFYA 2J8SA 5E41A 3IRWP 3T1YF 4KKOB 4AL7A 2DB1A 2DGUA 2ZQBA 1TL3A 3MR7A 3BF4A 1A9NB 1I3AA 3NHGA 4NRTA 1NSQA 5DGAA 1KDNA 1HQEB 3R8EA 1LFPA 4ZHRA 2R4FA 2LDYA 2VHGA 3DI6B 1IBMF 2E88A 1U1OA 1IV0A 3LDNA 1HI0P 1RYRA 4KI4A 1FESA 3PIPL 4DZDA 2CQBA 3LGMA 4J9QA 1C0FA 4ZLJA 2ZEJA 1WN7A 1BUXA 2B6AB 4Q45A 2V4JB 4HVZA 2GMJA 2QFIA 2W9BA 3MZIA 2CWXA 1W97L 3HDSA 5LL6Z 5DQHA 1U8WA 4XPEA 2QYGA 3D3CJ 1OPIA 1UW4A 2FHJA 3CC4S 3FSIA 1IBLJ 2RS2A 1RABB 1Q18A 3PNIA 1NK4A 1X4GA 4P6QA 4DJBA 3LDQA 4F4AA 1JJCB 1Y0HA 2G1DA 1WSFA 3I55N 2GO8A 4NI2A 2VG5A 3OY9A 4GKKJ 4WFAQ 2A3ZA 4R79A 3GV7B 1R43A 1S6OA 5HOOA 3TOQA 4TU7A 1RDUA 1IBKF 2H4WB 4ZK7M 3V9WA 2UUAK 1VQSA 1NM1A 2LXIA 3AJDA 3BV8A 2Q0RA 5KFSA 4LF2A 3RMCA 1VQMS 5D0HA 5J1EA 3M3ZA 3CUNA 4F7VA 4DCPB 2UVRA 2HSTA 3SJHA 3G8TA 3NMAA 5DDPC 1W2IA 5SUHA 4PAAA 2FZKB 4F4KA 4OV6A 4X84A 3LDOA 4H4MA 2J9EA 3P45B 1RTJA 4TLRA 1T8EA 2HSEB 3CJ0A 4Z4HA 3DOKA 5D4OA 3EX7B 4IOAL 1DQ9A 3KJNB 3B54A 3TR8A 2IRXA 1JLCA 4JV5J 3O9TA 1HR0J 4RUCA 4CLLA 3BGLA 4CI0B 3Q8VA 3W0LA 4FJHA 1HNWF 3LP3A 4O0JA 4A8WA 5HLFB 5F8LA 1S79A 2HBYB 1WSVA 3C16B 2Z1HA 1L3KA 3DKDA 1CG2A 4OQJA 2KW4A 3AB2B 5F8GA 4YR2A 4LBPA 5KFEA 4E7IA 3R6MA 1X3MA 3VA3A 3RVCA 2QA4N 2XHWA 1RTHA 1GX6A 3NH0A 2XY8A 4CJLA 4FXVA 3FRZA 1RBRA 5ETPA 5A8KB 1N48A 2BGGA 1RE1B 3NF9A 1NLKL 5AQNA 4OV1A 3RRGA 2YX6A 3POTB 4LFCF 3V6HA 4Z0UA 1RAOA 3J81j 2ZKUA 2RN2A 1SI9A 3V9XA 3FEYB 3J81O 2AGOA 1KP6A 1GXTA 2Y1IA 1RCHA 4M3WA 4U9RA 2ZC3A 1V3ZA 3C0BA 1U1PA 3PYDA 4K43A 3MFIA 5AXMA 1FW6A 1M90T 3GR1A 4RUAA 1ZETA 3QMQA 3K58A 2VH7A 4F0MA 1VRUB 1YGYA 2J6TA 3UWTA 1JLBB 2HHUA 5HN0A 1CEZA 3VAKA 3TX0A 3M8WA 3GFZA 2DPIA 5FLXO 3MWPA 4I1TA 4R0EA 3WXLA 2GWKA 2Z0GA 2FBVA 5BREA 1GT8A 3T1YK 3CJ2A 4U96A 2OANA 2C2MB 1BISA 5D4LA 1Y11A 5GAHI 3WIVA 2FBTA 2HQCA 3ONQA 3UPFA 3SNNA 3GCWP 2YX1A 4W98A 1C4AA 1D3WA 3TUZC 4ZITA 2YKAA 1GMWA 1IBMK 4QJVA 3UD5A 4FPBA 5AE3A 2ZDOA 3AXKA 2MKKA 2RQ4A 5LXRA 5AQRA 2FY8A 4CJVA 3VQBA 1X9SA 2P9IB 3FDSA 2E1RA 2B4JA 4UY8T 5KFWA 2ZH2A 1N33J 4BVOA 4PWWA 3OYBA 5LSRA 3SAHA 1NGEA 3PKMA 5G0RA 4JD2B 1IH7A 2C28A 3D54A 4I69A 2O8BB 1BI4A 3BKFA 5AQVA 2M88A 2LFVA 3VGVA 1Q79A 4U67Q 3KD5E 1IBKK 2DR8A 4HTLA 4PKIA 3MM7A 3NAIA 3M1FA 3W9HA 4ZPDA 5AQIA 3N6MA 1QHTA 4WBFA 2YX7A 5IWAF 1K8KB 3VF6A 2KI2A 3QZ7A 3DLEA 1WEZA 3DFEA 3WT0A 1C0UA 4KHPJ 4WE1A 2IHR1 2YKMB 4Z4FA 3DLRA 2VA3A 1T9XA 1L3UA 4NYPA 1GMWD 3HZGA 1YSJA 5KRTA 4UUWA 3TWHA 3ZSVA 1JLAA 2DIVA 1HNIB 3BS9A 4B9NA 1U48A 2DGQA 4BR9A 3PX4A 3MECB 4JEPA 4DL5A 4ZIWA 2E1YA 3ZNUA 1KN6A 3V81A 1N0UA 2NUUG 5HVHA 4J9KA 2F63A 4JBCA 1P8ZA 4LBHA 4JKEA 1FRJA 1RI7A 1ZBIA 4YNQA 5CA5A 3SDEA 1J5OA 4RW9A 3W62A 3UKRB 3GIKA 1AXQA 4A8QA 1HNWK 3M05A 2FSJA 2ZC4A 4X65J 4OJ3A 3PACA 3NEKA 2KXHA 1N5YA 3IM8A 4CCHA 3VA0A 1VMBA 1S1TA 5HROA 4ED6A 3SI6A 1YI2N 3Q23A 5FPEA 1X31C 4EI2A 4DV2F 3N4QA 5KFPA 3CHWA 3UVJA 3ZX3A 2WB1D 3PZPA 1YJTA 3MR3A 3TJAA 5ETTA 3M8QA 1A5WA 3OBIA 3THXB 3A5MC 5H9FJ 4B08A 4ZVSB 4B8AB 1JXEA 1UPPA 3MMBA 3RG6A 4IFEA 1QTNB 1Q9YA 3ZT4A 4WFNQ 4WXOA 4H0XB 4LFCK 3ZETB 4ZHRB 3M2VA 3NGZA 3MM6A 2VWBA 4IEEA 2FLLA 4OKJA 4OYXA 2OLWA 3LP2A 3S7RA 2ZM6J 3DYAA 2QA2A 4EGLA 3W8PA 1FFSB 4IEIA 2NSCA 2CQGA 3BUZB 3AA8A 3LA0A 2CZ9A 3QFHA 4X4PA 3MDFA 4Y0FA 2NPIA 2HFSA 2LXFA 2MTLA 1VISA 4WPAA 4IDHA 3W66A 5CZ2A 3QEXA 1ZYQA 3A8EA 3ZXWA 2ASYA 3WEEA 1C0MA 3FZKA 1TK0A 5ADXH 2JRSA 1VHXA 4OZ0A 4DQQA 3AFGA 1TKTA 3PXGa 1FTRA 4LY7A 5HATA 5LSLA 3K0SA 1S76D 2PIIA 4PABA 4NZ7A 5M1PA 3TR5A 4P7VA 2D69A 3VF4A 4LF4J 1LXJA 2QLWA 5KPTA 2IRUA 3BQ1A 3CB4A 3BEXA 2W4CA 5J1EB 5AQZA 4AD6A 2CWKA 4A8YA 4WQ5C 2WSCC 2VFSA 3A5LC 2KXNB 3PO4A 1UWBB 2GQ2A 4BR4A 2CKWA 1ZM3A 4IRKA 2K2PA 3CCEN 1SC3B 3D7SB 4A61A 4Z4EA 4BR2A 1RTJB 2GQQA 4ZPWR 2DIUA 1S0OA 3SEOA 1OSCA 4FL9A 4PKHA 3R3LA 4EZ6A 4ZTJA 3E9LA 2C2OB 2J9DA 3NS5A 3VEOA 4ZOSA 3RSEA 1T6CA 4URSA 3MX5A 2VFRA 4M5IA 4JNEA 1NKCA 1G99A 3MR5A 4BG9A 4YR3A 4QIVA 2IDEA 3ZT1A 3NBPB 2DRDA 4CEEA 4XTTA 3CC7S 4AE5A 5F8MA 4H0VB 1RU2A 3FLCO 2V2ZA 1RT4A 3L2VA 1A5XA 1YVFA 2IVMA 2W7AA 4GMJB 1OY9A 3TI0A 3RR8A 4USIA 3G6ES 4B9MA 3TSQA 4M63A 5IWAK 4OYZA 1IR1A 3I0RA 1WSEA 1T9TA 3V9ZA 5FRNA 4IFYB 4UOCA 4QS9A 1JJ2M 1GNKA 3D2EB 4W5OA 4DCOB 2IM3A 2RE2A 2IFXA 3O5TB 2R8KA 5JS2A 1RTHB 2YJEA 3MUMP 1N8RT 4FJGA 3OTEA 2ASDA 2H1YA 2UXCJ 4DPUA 2JDJA 4NEYA 4ZVTB 1NHUA 2YWFA 1BHLA 1RFQA 3BF3A 4IUFA 2VU5A 5D0EA 5KFQA 3GJSB 1BO5O 1TMMA 2D0CA 1FDAA 3UNYA 4OI4A 4DTXA 2WAQD 3O4WA 4ENOA 9ATCB 4BRKA 1S5JA 8AT1B 1ZBHA 2EFOA 4PG4A 4B9TA 4O3RA 1HLUA 3LTOA 3Q7CA 2D7SA 1OH7A 3GG0A 4ID8A 2HFZA 4USWA 3DM2A 1OO0B 1VQNN 3EL2A 1U25A 2QTDA 1XQIA 2HYIB 5DM7L 4DV2K 5C42A 3JSBA 4XDCA 1SJQA 5M2RA 4RLEA 4HACA 1QSSA 1RWOB 2MZRA 2QG9B 3R97A 2Z2LA 3LDPA 3HD1A 3ETOA 4K0KF 2HGLA 1QVFR 3R7BB 3VZHA 1OIAA 1ULRA 2DK2A 1V4SA 4B3SJ 2BMBA 2MZQA 3TANA 5AQJA 3MN5A 3PDNA 2WVFA 4ZCKA 1NJYA 2PC6A 3T19A 3K59A 4JI5K 3UDVA 2GX8A 1P27B 4J2BA 4LRDA 2QV6A 5HANA 4P72A 2XQCA 5LXYA 5ETRA 1RACB 4I2QA 2QMXA 3M6XA 1A0OB 1GH8A 3U1MA 1NGJA 1Q0NA 3QWPA 1IM4A 3AVHA 2E44A 2NZCA 2X74A 4I9QA 2FY1A 4X2BA 2YX4A 1HBNA 1TVRA 5KGWA 1C0GA 2P9KB 4QU6A 3C14A 3J7YU 2NRWA 5G0RB 2D41A 1KSPA 4N8NA 1WHVA 2P9UA 4RCHA 4M3ZA 3QGIA 3PIOQ 1OWXA 5KG7A 3HMJG 1BI4B 2HNDA 3PG9A 5SZTA 4DSFA 4PG5A 1FTCA 4IG3A 1GOCA 4FKXA 4QWCA 2JLGA 3M1VB 1XHZA 2VASA 2ZWPA 2EFVA 2YTCA 3VGTA 2MLXA 4NZ6A 4CJ7A 4BREA 1HMVB 4FK0A 2F9DA 2D1KA 2F4VF 3M8SA 4WE1B 4WFBL 2PYJA 2RRAA 2PN6A 4MLEA 3QEVA 4ZVGA 5JMVA 5KAKA 3FBCA 2QK9A 2HZAA 4O3OA 4KFBA 1WG4A 3PR5B 2I9SA 4C48A 2ZZNA 4R5PA 1RNHA 3V81B 1SB6A 1X7VA 2OUGA 4TY9A 3SCJE 5GAEU 1IJEB 3THPA 2WVDA 3VAMA 5F3ZA 3NL0A 4RW9B 1S1XB 4DF4A 3C8YA 2CXEA 5DDRC 1R0CB 1C4CA 1N52B 3VAHA 4K4YA 1Z6RA 4UY85 4OO1J 4OHVA 1HBMA 1BLUA 4BRQA 1RU1A 1R0BG 2V52B 4JS4A 1SJFA 1K8AT 3CCLS 1BL3A 1FKPA 2BKPA 4RR5A 3M5RA 2UUAJ 2DR9A 3J81Y 4CJ4A 3LGNA 1Y3JA 5E2QA 2NYIA 4OLAA 1MA9B 2MZTA 3HPHA 3S01A 3TO8A 4LT6A 3FCVA 4Z4CA 4JKCA 1CULA 3S1TA 2YY3A 3U1NA 4DV0F 1LNQA 1RDWX 1VQMN 4WP3A 4HUEA 3IR6B 2KRRA 3OVSA 1NGHA 2B9XA 1S6PB 3MMBB 5C0YA 2WSFC 3DNCA 4GC6A 1NJIO 2B8PA 4Q0BA 1MMLA 4DBQA 4ZP8A 1SC4B 1N32J 2H5EA 3EGNA 2ZHAA 2CPJA 4J9RA 2MXYA 2L9NA 3MM6B 3WIUA 4CD1A 3ZSXA 1YITS 3K17A 5FLXY 4ZPBA 4QR0A 1O51A 3HFZB 2L41A 2HS0A 2V50A 3VZIA 4ZLLA 1JWWA 2C2RA 4JI8F 2V63A 2YWWA 4B1YB 1VQ7N 2D5RA 3W5XA 4ANEA 3HZ6A 3P31A 2E9RX 1WNEA 1J5EF 3UO0A 1GFWB 1T05B 3GLJA 2DRAA 3WEEB 4WP8A 3M7VA 2LQ9A 2FBXA 2AYEA 4HCBA 4ZVQB 4IRDA 3VPZA 4OYIA 3NRBA 2WFBA 3OVNA 3PFEA 4WQ4C 4K0KK 3NGKA 2K3KA 5KT2A 4RW6A 4XO0A 3T6JA 1MWMA 2OD6A 4O0IA 2RMLA 3O08A 1IKVB 4M41A 1HRHA 4A4JA 3OFGA 2FJEB 2A3JA 5CY4A 1YVNA 3A3PB 1Q1KA 1NDKA 2I5JB 2GC8A 2F9WA 1VOMA 3SSRA 5F9LA 2HHHF 3KK1B 1EHWA 4TU9A 2MZSA 5G4DA 3WXJA 1TUUA 2C1EB 3M6UA 3JSRA 3NOCA 3AO4A 3I96A 3I8BA 3CDEA 2XYGB 3E51A 3MWBA 1TR0A 2RUGA 4YOYA 3A3OB 4HT5A 1TL7A 4CD3A 1F6TA 5B0CA 2E8AA 3DJCA 4FYXB 1PJ7A 3FZFA 1MWKA 3UD4P 5KT6A 2AJQA 3RW6A 3C3LA 3CYMA 1IQZA 2XULA 4Y0WA 4AT1B 3KHHA 4ZIVA 3VQQA 2ZUGA 5LSOA 3PV8A 3N28A 2APOA 4Y1CA 1RT4B 3R6LB 2VOOA 3T1YJ 3LDLA 4OPJA 4P7TA 1C1CB 3UN3A 3KZBA 5B0EA 3U4LA 2XYPB 2LKZA 5M1FA 2IAJA 1G15A 3T1HF 3R8YA 3I0RB 4Z7YA 3H6EA 4DR7F 2OZMA 2F4VK 1IBMJ 1Y7PA 4N47A 4CJPA 3IUCA 4LC9B 2LU1A 2BABA 3ID8A 3GFHA 1RAEB 5GADI 3DLBA 1NH8A 4DSIA 3CIMA 3MI7X 3U7JA 2DNRA 3QT7A 2ATCB 3KTQA 2ZBPA 2M2BA 1NZ8A 4B1XB 1MN9A 1YJNS 4NL5A 1RCOB 4NLUA 3THYA 2VA2A 4LVOP 3L2WA 3EE9A 3A12A 2E2OA 4AM7A 4FM0A 2XB2D 3ITHA 4OX9F 3LP1A 1ZA2B 2QZ8A 1K44A 2OA8A 1S6QB 1REVA 1VJWA 3ZO7A 3BREA 4EP4A 1IBKJ 4NX9A 1U47A 2E6LA 2GCFA 4ATNA 3BZCA 3PRDA 2QGFB 5B7WA 1SUQA 4HACB 3G96A 3K57A 3FR0A 1QS4A 4FLZA 2B56A 4DV0K 4E8UA 2R8IA 1AT1B 1H1VA 2IJNA 3OSNA 1VJQA 4ZA1A 2Q66A 1SZ2A 1LW2A 5FJ4A 1JXBA 2XLJA 3SMSA 2FPHX 3CJSA 3MOJB 4DV6F 1WHYA 1VHIA 4FJIA 9RUBA 2LDIA 4DX8H 2DNGA 1X4HA 5KT4A 2LQJA 3NGTA 2E5HA 2XO6A 1NOYA 3V4MA 1WDTA 1HNWJ 1KXPA 1S1UA 4JV0A 4I2QB 4I67A 1QVGM 5C25A 3R9LA 1ROFA 3M32A 4GKJF 2ZD1A 2MQOA 2F4FA 1QJHA 2EFQA 5IT4A 4AL6A 4F2SA 4JI8K 4ZN3A 2L08A 2E1ZA 2MQPA 4H54A 3QRRA 3DOLA 2O5DA 2VYPA 1GAOA 2AV5A 1HBNB 1J5EK 2HKEA 3HT3A 3KUGA 1N8RO 4DOZA 4RBUA 3MN6A 1DY3A 2CJBA 2YXLA 8ATCB 1BE4A 1HJRA 2P9UB 1EETA 4MLHA 3CPWR 5AZIA 1K47A 4DS5A 5THWA 2LVWA 2Y9HA 3ULEB 1FRIA 2N3LA 1SJ1A 3DLJA 4J9OA 4IG3B 2GV9A 1RWXB 3BM7A 3LPEA 3VESA 3O6QA 1FHTA 2WZ1A 3W3SA 1T94A 2XC9A 3EY1A 1WKKA 1R3NA 2DTJA 5FDLA 3CCVS 4B9UA 2V7YA 3PYFA 1HUXA 3PKYA 4LFCJ 3ADAC 4ITSA 3DWLA 3KWMA 1NHVA 1KHWA 4CTAA 3HPOA 3H2UB 1EIYB 4JS5A 3M8PB 3HKWA 2BBEA 1I3OB 3CJ8A 1RT5A 4X66F 4MTPA 4OZ5A 3OJUA 2Q79A 4UOFA 4F4YA 4F3QA 3K5PA 1T95A 3VAJA 1RAGB 1UWAA 4MIWA 5EN1A 4M3TA 3IR5B 2F96A 2B43A 2WOMB 2A5XA 2EPIA 4I68A 4WCEQ 1HWKA 1TL4A 5HO4A 4F3OA 5I9EB 5F41A 3HL8A 1JLFA 3PUFA 4YHHF 3V6JA 5AXLA 1ASVA 2FB0A 4HHUA 4BY9C 2OKQA 3I5AA 3L4BC 1RYSA 3PO5A 4BE1A 3L4IA 2EW9A 3LOUA 3TUIC 1RT2A 4E19A 1KTVA 4XIUA 4H4OB 4DTMA 1FKPB 3CD0A 2Z2MA 1VQ4N 5LY3A 4Z7CA 3H5YA 4M45A 3DOMA 4LRCA 4X4OA 5KT3A 3HXMA 5JXSA 5IM0B 2HBQB 2AMCB 1NMNA 4C3KA 3T1HK 3OYGA 1FJ7A 4FM2A 1I94K 5EY4A 2G2YA 4DR7K 4DV7F 2F8MA 1TZ0A 1SL1A 3OYMA 2V6AA 1S5ZA 5T7LB 3HP9A 3HHNB 1HQUA 4O3QA 3M6VA 3FCWA 4KB7A 5IT9O 1K9MT 2IVNA 3HHLC 4B9QA 4AM6A 3NLCA 1FXXA 1UFWA 3SQOP 4NA3A 5D0RA 4BR7A 3AY9A 4DMNA 3SQ2A 1XNQF 4DS4A 2QWOA 3JQKA 4M3UA 2CQ3A 4AF1A 4BROA 2D3ZA 3LL3A 2OPRB 3JXOA 3GILA 2KT5A 4OX9K 2OEMA 2E29A 5CD4A 4CERA 3IWLA 4DPXA 4QWDA 2C22A 3HM8A 2WBRA 2XY5A 3H45C 4O55A 2O8EA 4BACA 4TXSA 2KL8A 3ZFVA 3PR4A 2ZFHA 5B0AA 2DNOA 2JH3A 2LCWA 3QINA 1XBWA 2KHDA 1ZBFA 2IMOA 2C2EA 3EN9A 3LALA 4Y2MA 5IWAJ 1JIHA 3WNEA 1M1GA 3UCGA 3MAAB 1IKYA 1BUPA 3N0VA 3VEXA 1MROA 1EX4A 2VGNA 5KFLA 4BRNA 3A1YG 1BGXT 3CJ4A 3G6EN 5DETA 3RB3A 5J2MA 4E1JA 3JQJA 2E9ZA 1EP4B 4WXWA 2LA6A 3OS0A 2G1HA 3R2CJ 2VC0A 1RGVA 3PSFA 1XWLA 1I1GA 3L3CA 1VDHA 2VG7B 3NGSA 4EBCA 2CJKA 3OLBA 1OVYA 3KJQB 4DV6K 4CJUA 2RKIA 3PEJA 4RU9A 3TTCA 4TQRA 4M3XA 3D2WA 4MH8A 1GLLO 1HQ2A 2Q31A 1URNA 4OYAA 4GV9A 2EG1A 1OPZA 5KQDA 2ZE2B 3HJFA 3MD1A 4QS7A 3TJ8A 4GKJK 1Z2LA 3R5GA 1JLGB 2W40A 1PO6A 1HARA 2HF4A 1TL7B 4FWPA 3ALYA 2OELA 2B0GA 2V34A 2M0GB 3R3TA 4FP9A 1PYTA 4XAKA 4DV2J 2DNPA 4XPCA 5IOLA 4PRFA 1XIQA 4BQZA 3ZT0A 2OJ3A 1BA0A 5E33A 3HRGA 2A2CA 2YCHA 4BWJA 1CJKA 2AKWB 1Z25A 2KT3A 2N3OA 4RJVA 2MGZA 1BC6A 4I0WA 4J9LA 5HBMB 3UFCX 3ET6A 3V9SA 3VGKA 3BDEA 4DWIA 1V5IB 4CM2A 4ZN1A 4B9VA 1FX4A 1RHJB 3CCZA 5DO2A 4WQ4A 2IAJB 2V9WA 3OL7A 1C0TA 1FT8A 2XY7A 1UVNA 3EM1A 3VGUA 4CEDA 5GAHP 4A5AA 2K8GA 3ILLA 4FF1A 2GAGC 4CJ5A 1SPBP 1V3SA 4ED7A 2XSFA 4P74A 4RNMA 4M42A 2W6LA 2W25A 4ID1A 4X66K 2YNGA 4CF1A 3QBCA 2DGWA 2HZCA 4DR3F 4QOTA 4ALZA 1NCLA 1URRA 2FYXA 4F26A 2UP1A 1X5PA 4UQGA 4JK7A 3H8YA 2CVEA 4YHHK 4E7KA 1YVUA 3N79A 2P51A 5LJ5Y 2DGSA 5M2PA 3QNWB 4PUOA 3EXCX 1OH6A 1X3NA 1ZBLA 2O8DA 2H3EB 2JZ5A 1BQMB 1FJCA 4M5DA 1XTZA 1S9FA 3FBEA 3KK2A 3QEWA 1SS6A 2CPDA 2HK3A 3NY0A 4A57A 3GYGA 5K5MA 3MCSA 1HHTP 2NXNA 2HWIA 3DRRA 4DUYF 4F67A 1X0PA 4EU0A 4DV7K 2G13A 3UR3C 2DRBA 3K5LA 3OL6A 2C42A 2W2NP 5ETNA 2LMIA 4M5JA 1RILA 4OPAA 2GZOA 4RWWA 4DTPA 1VYAA 2Y0BB 4ID5B 3J80U 1WOPA 1JCGA 5F9NA 2NXUA 2ZH8A 3MXMA 1VC6A 1LQ9A 2GW8A 3PSIA 1KVKA 1XNQK 1CJVA 2X1GA 4H8KA 3IKMA 3Q2TC 3K9KA 4CJSA 3RJMB 1S1UB 4C8YA 2YNFA 2NCKL 1Q81T 5C25B 1YTYA 3M32B 3D66A 3T69A 2E20A 2ZD1B 3DMJA 5HP1A 3L95X 5EX0A 3LF0A 5IFMA 3DOLB 4KI6A 3AGRA 2MQQA 4L3QA 2PMZD 2MZ1A 3UB5A 3VF2A 4USTA 5A8RB 3QGPA 1S9EA 3CMES 3MEEB 4RX6A 3SV3A 1QUPA 4KJIA 5DG8A 2X1AA 3C2PA 4DTRA 4JI4F 1S0VA 1N4LA 3AVIA 1K0VA 1C6VA 2IC3A 5EDWA 4CEZA 3QPIA 3GSDA 4MKAA 1TTHB 3D6RA 5DDQC 2MB0B 4HDHA 2PGCA 2CPXA 3OTBA 3AA4A 2KG1A 4LFBK 2NRVA 4IFVA 4ZLNA 3L09A 2EI5A 3IP0A 4W5NA 2Q43A 2OPPA 3CCUN 1UFKA 3OXFA 2RF2A 3MXIA 1IWGA 2NNWA 3AVFA 3IAYA 3DXKA 5T14A 1GXUA 4JKDA 3NFAA 3KK3A 2A42A 4NXMF 3FZ2A 1AB8A 4ED8A 3VVUA 4KPCA 4AL5A 4KAIA 2YHYA 2WUSA 2HOEA 3FNNA 2BDPA 3B8AX 2DHSA 3LPYA 5EWEA 5GIPA 2YBVA 2PMWA 4FNIA 2W9CA 2HFOA 2Q0UA 3QAUA 3QFPA 2IY5B 4J90A 4ZMMA 5I3PA 4K0KJ 1RT2B 4OI6A 4FPIA 4H0PA 4L74A 2HNYA 4DX7A 4WFAL 4JI0F 4FS1A 5AQOA 2JJ4D 4KGZB 2U1AA 4EMDA 3HHKA 3H2LA 2HEKA 3HSCA 2CPZA 2UUBF 3ZSYA 1FVSA 2OPQA 4NRUA 3WXIA 1K1SA 4ED2A 1FWPA 4MFBB 2BM0A 4O4GA 4EWTA 1ILYA 1FERA 1HPZA 4YS2A 1PBAA 3D2FA 1P9QC 1NM2A 1R89A 3HVRA 4DR3K 2XMJA 4K4VA 3JS6A 4IWVA 3JQMA 1MLAA 4FYWB 5C24A 2DY1A 3MN7A 2HIYA 4CK1A 5AQYA 5KFRA 3H4BA 5J2PB 2XI3A 4ILJA 1WAFA 2HS3A 5L1IA 3LP0A 2O8EB 2MSTA 1QQOA 4OYOA 5L46A 3CETA 3UKUB 4DI6A 1VRQC 1UVMA 4L75A 4DV5F 4DUYK 3BEGB 1XI1A 4MK9A 1IKYB 1HFEL 3T3FA 2F4VJ 1FO1A 1XR7A 2FHOB 5KG3A 3R27A 3KYLA 4E89A 3TSUA 4TLQA 4CYUA 2OPSA 2HG4A 5J2MB 1XR6A 2IIHA 2P1JA 1IBLK 5C7PA 2BJDA 2HMIA 1RUSA 2DEIA 4QBUA 3OTDA 3CQXA 1S0MA 2G8WA 4EO8A 3M8ZA 2LEPA 2RKIB 1S12A 4DCJB 3I82A 4L6V3 4RZRA 3CFPA 3OL9A 3QJLA 3JSYA 2G4BA 5FROA 1J2VA 1W9HA 2C3OA 3FCHA 4JKAA 3LW5C 4ERDA 2BJ9A 2VQEF 1L3TA 2WSEC 2JVRA 4RW8A 4DR6F 1FVQA 4AHRA 1H0HB 3UE2A 4JI3F 3IGVA 3CJ1A 3KNAA 3BJYA 4R8UA 3ZZZA 5GIOA 4UQTA 2BUPA 1SL0A 1N6QA 4OLOA 4QIEA 2O8CB 1VQPN 1LWCA 3OFHA 2BA9A 1KLNA 4KQZA 4G65A 2A1BA 3HI9A 4KTWA 2MGZB 4DV0J 4JI4K 2KDOA 3ZTRA 4KHWA 2HHPA 4JV5K 2E5LF 1F3FA 2GS8A 2ZDPA 4FWOA 2RQMA 2D0BA 1FJEB 4BQLA 1KD1O 2ALYB 5EVZA 3MM8B 1GLDG 3X3UA 2EBEA 4X4TA 1ZM2A 3ZZ0A 1VAZA 4HUFA 1S48A 3MCPA 2NPFA 4KTQA 1B99A 1HKCA 1YJ9S 1H2TZ 2D3UA 2FVCA 1EZZB 3C6TA 2RHKA 3BO3A 2RRNA 4P75A 4DQ8A 4OX7A 1K73T 3TARA 5C2FA 3C6UA 4E7HA 3D6TB 5GMEA 4NXMK 3NCQA 4NLWA 1UVLA 4JI8J 1OMSA 2YNGB 3HF5A 2DGXA 4OHYA 3QBWA 1IO2A 4MAKA 2J8AA 3CCQS 1J5EJ 1RBTA 1Q86O 4HTUA 4K41A 5K8MA 3TTFA 1CQMA 5IC4B 4CJQA 2XHCA 1NSKL 4RWXA 4LSLA 4DCHA 4ZJLA 3CEDA 5E3RA 1ZS6A 2V8PA 3AOAA 2VKRA 2AGQA 1R6YA 4WU3A 4JI0K 1N56A 3KKRA 1RAFB 1KQFB 2UUBK 3D6MB 3IR7B 2MHEA 1RT1A 4YEAA 2HQDA 4ANDA 5BJRA 1S99A 2HHHJ 2QA4G 2YV0X 5JVHQ 4KHNA 5KFGA 3CERA 2BOAA 4IOAQ 2VJVA 3S6EA 2CGKA 4C0OC 1F3VA 3CCJS 4GNIA 3OVAA 2D1CA 2QWMA 1M1KT 5KG4A 2VQFF 1U2VB 2DO4A 3BBCA 1KR4A 2HBMA 3UNGC 2AA4A 3MDQA 1S6UA 1LAWA 1V5VA 2PEHA 1CJUA 2ZH9A 4UZCA 3HSZA 3G8QA 3VQAA 2F65A 2PSZA 1CJVB 2EC2A 2QIFA 4DFKA 3WNFA 2DNLA 4EBEA 3G4SN 3BGRA 2U2FA 2HFVA 3DHWC 3R1HA 3CFRA 4GVLA 4PR6A 3ZLJA 2YNFB 3K5OA 4Z94A 1SV5A 3CCSS 5EU7A 3O80A 1KQSM 2BZ2A 3NCRA 4C8LA 3CFOA 1LFWA 1YRXA 1VQ9S 2HVZA 2BE2A 1C1BA 1O6XA 1U0SA 5KQ8A 2BRLA 3KJVB 3IBFB 3OXLA 2HW3A 1P1TA 2O8FB 2ZH5A 4DV5K 2KU7A 3T1HJ 2AIRB 2A6AA 1S9EB 5FPMA 3VAFA 4DR7J 3QIOA 1RT7B 3P5TL 1HHSA 1WOSA 3BGUA 2VKZG 2ZZMA 3PTWA 4JLHA 4OGCA 4Z4GA 2RDDA 3ENAA 1VSIA 4YOWA 2HQFA 4FZVA 1D9DA 1Q8LA 4HTIA 4LF5F 1OYEA 2D74B 3KG4A 5AFUA 2PFFB 5CABA 1F21A 5DZ6A 3KHGA 2W2PP 5J2QA 1UKUA 3TP2A 4JKBA 3AHPA 1UMJA 1TMJA 4RNNA 4B8CA 1V3RA 3MPWA 2ZNYA 3ENVA 2ZNZA 2DXDA 1B70B 2DFFA 3EVMA 2OPPB 2KZMA 2RF2B 2EC0A 3PRBA 3KHYA 4OX9J 3M8RA 2FLPA 5D15A 3IDHA 3KK3B 1FF2A 3G71S 2Z1JA 1IKWB 4DR6K 3NGYA 1UTAA 2FVSA 3TJ9A 1XR5A 3VQ5A 4OZ3A 1NEEA 2XLIA 2R8GA 5AQMA 4DQSA 3KMSA 2E1AA 3M6GA 4W5QA 3NXZA 4CGJA 2F8SA 4CP5A 4WU2A 3S3NA 3KMQA 4J91A 1TQLA 3Q0AA 4YY3K 3AD7C 4KC5A 4FK2A 3K8WA 2HHTA 3ENWA 2AYGA 4XEIA 3DRSA 4LH4A 3H1VX 1HKAA 2V8DA 4YUDA 2E5LK 1KONA 3V4IA 1FA0A 4J7CA 1UW9A 3CNQP 1BCOA 4P10A 2JSXA 1D4XA 3ZZOA 5GVQA 5LJVA 3D6HB 5AQWA 1R6VA 4DV6J 3TZYA 4BG8A 1BIZA 3O6WA 4ZVPB 3SI8A 4OL8A 4O8KA 1Q8BA 1TFYA 3MPUB 3EO3A 2E5JA 2AQ4A 5EX3A 4CWBA 4PYAA 2H48B 2FC8A 3A4TA 1N36F 2J0WA 5BPNA 4GKJJ 5BYSA 1LWFA 4NZ0A 4CO1A 5L1KA 1G1XA 4Q2LA 4DR4F 1FI4A 3U27A 4CLWA 3NNHA 1CS4B 2I0XA 1BWFO 2BJ8A 2J7WA 4AYBD 1YHQS 3L2QA 1NMDA 2XI2A 2JEJA 3RGIA 5CE3A 5C15A 2VPWB 1WF0A 1FKOB 5C24B 4WZQA 3O5BA 1QHAA 5K14A 3I33A 1O8BA 4HI2A 3NH1A 1XMQF 2ROGA 4U95A 1KAZA 4O3PA 3GYXB 4U7CA 5KG1A 3NVMA 5BN9A 1UZDA 3LP0B 2IM2A 1FD2A 3BR9A 4FW1A 4DTJA 4V19X 1QM9A 1F2GA 3OYHA 1TKXB 4DR1F 1RCXB 4H0OA 3KHRA 5BN8A 5GAHU 1SQEA 3M2RB 1Y5LB 4CHOA 1N34F 3LM9A 1PSDA 4FYDA 1NDPA 1LK5A 2BJ3A 3M9OB 1BDGA 3HTVA 4M5LA 1NRKA 4Y2CA 5LMNF 1JK9B 2HLUA 1DTTA 4A8XA 1AFIA 5E0OA 2MSSA 4I6WA 2NQPA 4X66J 4OI0A 2VQFK 2HMIB 3LM2A 2KB2A 2QSWA 5GADP 2CJYB 3CDWA 1DKGD 3OJSA 2XEXA 2A0FB 3KLEA 4BHQA 2BE9B 4CH7A 3OQ2A 3VGMA 1YJWS 4U8VA 3KG1A 2ZGZA 3OVBA 4ED5A 1F60B 3ETMA 1JJ2R 3TA0A 2HHVA 1N0VC 3HHLB 3VQ4A 4YHHJ 4HLBA 2W24A 4OFZA 3PW5A 1HX1A 3MXJA 4IJAA 2P9GA 1QDUB 2VPZB 3AVGA 3RR7A 4RPFA 3U6FA 2AX0A 4DR2F 4ECQA 4RW8B 8RUCA 5IQ6A 1RT6A 4EZ9A 3PW2A 1J53A 4R8UB 2FUG9 4I2PA 4BGBA 1VK8A 2PT0A 2FXUA 2HRYA 3A8KA 2YKOA 5JICA 1N6QB 1E6VB 2E2NA 1U6BA 5HSPA 2GTDA 4DU7A 4DV7J 1NO8A 1LWCB 5F8NA 1IVZA 2LEAA 2CQ2A 2BJ7A 4PZVA 2OEKA 1W7WA 3JAMO 2DNHA 3CPEA 2HFNA 2XZWA 4LF5K 3KLFA 1OH8A 5IQQA 1SJRA 3PW4A 3T9ZA 1LWXA 3WNHA 2HBZB 2ZH4A 4W5RA 3MUVP 5JMNA 4NYZA 4DL6A 5HJYA 3MMAA 1FXLA 4TY8B 1XNQJ 1WI8A 4KB0A 1IKXA 4FLTA 4HKQA 4DL2A 5B8HA 3BP8A 1U09A 4HVJA 1YJUA 2W4DA 2JWKA 2Y8YA 4KO0B 4JRQA 2QEXN 4F04B 4ZDNA 3AY0A 2EFPA 1KC8O 2VG6A 3TZWA 3FC9A 2FGCA 2GGPB 2CQCA 1WI6A 2HBJA 1NOZA 1RADB 2GJ2A 3FBBA 1IXKA 3JSMA 3AA2A 4E0DA 4EAHD 3VQ8A 4C9DA 2ATQA 2UXDF 2OTLN 3B82A 4BGAA 1FEHA 3G25A 2DY4A 3G82A 5KFYA 4CHZA 4LF6F 1LOUA 2QSFA 4RNFA 2LXUA 2BQRA 5K9FA 3CMEN 2ERRA 2GIQA 3NF6A 4G1IA 4P2SA 2Y1LB 5AFUH 2E9TA 4JHDA 2ZGYA 3EVOA 3CCTA 2Z56B 5KFTA 3VQ9A 3KLGA 4J9SA 2DVIA 3NWGA 5FRMA 2OSQA 1WJ9A 2Q2RA 2YHXA 1N36K 1JX4A 5BRDA 2W41A 2HRUA 2HAIA 4KB1A 3MHYA 2DXFA 1RDRA 1CLQA 2AU0A 1BCMA 4DR4K 3EVWA 4CLUA 5CQGA 1LW0A 4KHUA 2R42A 2J7KA 2VWKA 4OJGA 1IJFB 3FEXB 3T1AA 2FC0A 3GJRB 4RKUC 1RAIB 1Y10A 4E7LA 4NPOA 4AHTA 2M5YA 1BG3A 2YKNA 3HPGA 1SH3A 1HIYA 3D45A 5EOYA 3BQ0A 1N5VA 3QEPA 2D0PA 3BGRB 1XMQK 3I0SA 1CQNA 1W25A 1WC6A 1SV5B 1VBKA 2GA7A 1DLOA 5CZXA 4PA1A 4M1KA 1FK9A 2XYHB 1RLCL 3ICLA 4DR1K 3U02A 2BANA 3IWNC 3VERA 3FVYA 4LF1A 1MMNA 4P9SA 4G1QB 1N34K 2HF3A 2FVPA 3F0NA 1NK5A 3W5YA 4WF9L 2FZCB 3EUNA 4CGFA 3TAMB 3G87A 5LMNK 4Y00A 1QTMA 3O9QA 5HRPA 3N5FA 1KAYA 1IQTA 4WFYA 2RU3A 4ECYA 2W01A 4WIQA 5E3CA 1CPZA 3ILIA 2E6MA 5GAGI 2QWLA 4C4WA 5HAOA 3QQCD 3DGVA 1S1WB 2CPEA 4DR3J 4LQ3A 2QC3A 2FTRA 4BRGA 1RHRB 1RJJA 2K7JA 3DLGA 1VK0A 3RAXA 4YQWA 1YIJS 3GWCA 1OY6A 1MMDA 5J2NB 2WTUA 4B3TF 3DLLQ 1Q7YO 3DGPA 2HNZA 3Q89A 3OUYB 4DR2K 5IXUA 3UDEA 3ISZA 3EGWB 2GBZA 4NYNA 4K8ZA 4FS2A 1B3TA 2P9SA 4CIGA 1FEEA 3THTA 5KGXA 4CI6A 3E66A 1M1KO 2XG8A 3UW1A 1FXDA 2MKHA 3J80Y 2CNKB 4C1NK 4DUYJ 4QW9A 3VETA 5B0GA 3O44A 5DS7A 3MR2A 1Q7LB 1JKHB 3GG4A 1WELA 4CO3A 3DRSB 2V8HA 5GAEP 2H4YB 2GFFA 4IDKB 3EZWA 2EEYA 3VAIA 1ZM9A 4CEQA 3OD2A 2ATLA 5CZVA 4LFAF 2H5JB 1S1VB 2BW7A 4Y2KA 2Q1NA 1FDNA 4LF7F 1J6ZA 1MW7A 4M63C 2P9LA 4KREA 2DEJA 5H9EK 4DU3A 2CPHA 3AVMA 4MKYA 1JLEA 1LWFB 3CCWA 1ZXOA 2AW0A 3KG0A 4ED3A 4CK2A 4FJXA 5CYQA 2CZVC 1UP1A 2D3OR 4IOCQ 3OYIA 4LF9K 2JHEA 3TAQA 3IXQA 1YAGA 2PO4A 3OYCA 1WSRA 2AWZA 3JYTB 4K25A 3QAEA 1CJTA 3MTJA 2AJ2A 2UXDK 3QSYB 4DB3A 5KFCA 2VUGA 2GX9A 4L3NA 3M2UB 3S9HA 1N32K 4JI4J 1FE0A 5A8WB 2KXFA 2UZAA 3FBFA 3NF7A 3I5BA 4BDZA 1UOCA 1N5TA 1DBDA 2VBZA 2CA9A 2IPOB 2RH3A 1S57A 3DU5A 1W2BM 1GLAG 4KHSA 2B51A 1OY8A 1N88A 1VC5A 5AR0A 2DNMA 2ITMA 1OKJA 3T9NA 4OVLA 4IQXA 1J9AA 2W2OP 4DPOA 3UDLA 3NMUA 2FC9A 3RB0A 2AJ4A 2LYVA 4C11A 3BR8A 3RW7A 2KVQE 1J27A 5ADXA 1WBDA 4BCAA 4NXMJ 3VQCA 3D0IE 4ZCIA 5DQIA 3O3HA 2GVZA 3L8BA 3NOGA 1VQ8N 4PQUA 1WTFA 2QLXA 4I64A 5KG2A 2QN6B 5DRKA 1PAEX 3BY5A 3LWLA 3VWSA 4V1Ak 3SUOA 3TX8A 5HMZA 5HRNA 1IR2A 2CFXA 4MKBA 4GVEA 2OTJS 1UA1A 3IRXA 3AVJA 2JL9A 2YNHB 3SAGA 3THWB 1T11A 5TKYA 3OV7A 1IN0A 4O3SA 3T6BA 4JI0J 4BRIA 4I2PB 2Q97A 2X3GA 4DLEA 4WTYA 3VQEA 2WK4A 1RBVA 3HHEA 3ATVA 2MMYA 2JEFA 2A41A 4LREA 1P90A 1YTUA 2UUBJ 4K4ZA 4ISEA 1TL5A 3H7HB 3PX0A 1ICEB 4BE2A 2RDIA 2B8QA 4N77A 4L3KA 2IBKA 4HUGA 3MMCB 2F7VA 1HBUA 5KRSA 2YHWA 5K8PA 3CD5A 4DQPA 3KLFB 4TNOA 2JFKA 2A18A 2C2NA 1X9JA 1WF2A 2VF3A 4JUZA 4IH7A 3H5UA 5AE1A 4NB4A 4CZKA 3ISNC 1UJ6A 3PJWA 4CLSA 2E1PA 3MEDA 4P73A 3Q8RB 2KM8C 1T3VA 1IKXB 3QO9A 3D7EO 2ZVSA 4NLQA 4B3TK 1PILA 4W5TA 4PXDA 4RBTA 5U47A 4Z2XA 2R2TA 4FLYA 5M1OA 3MCAB 4BRHA 4FO0A 4CLPA 2EX3A 5D6GA 1W7AA 4DLGA 3I55S 1JB0C 1PJ5A 2VG6B 4NLXA 2QWRA 3HX9A 3TNVA 5JS1A 1MWYA 4QYZK 3MCMA 2K1RB 2IA6A 4DV5J 3JSMB 3V2UC 3CCRN 3GZ7A 1T0TV 3RMAA 1NZAA 1QVGR 1FDBA 2DHAA 3P8BB 3R5BA 4OIXA 1CXQA 1RQ0A 2XTJP 4M94A 4FOEA 4H5NA 5F0UA 4YOTA 4LFAK 4YOXA 2IVPA 1FJGF 4UZBA 4O3NA 4NCGB 4FN5A 2YKQA 3SJJA 1NJIT 4OKKA 4JHDB 1KLMB 4LF7K 2MY8A 3FFIB 1SKSA 1KTQA 4CM0A 4B1UB 4KHPF 1XN9A 1QQCA 5D3GA 4ELVA 1WHWA 3WNGA 3SQGA 1HYSB 2ADBA 4ILLA 1BQNA 1MU2B 4J37A 2VQEJ 3PY8A 4DR6J 3WX8A 1P9YA 2RHSB 1LW0B 3I87A 2DFHA 1NPKA 2B4PA 4JI3J 3OYLA 3DHXA 4U6PA 1WHXA 4L76A 4DPYA 1VQLS 4I7FA 2KH9A 2Y0SD 4EYHB 4B3MF 2ASOA 1VQKS 1WUAA 2RU9A 5A0YB 4RTFD 3FK4A 4EFHA 4CK3A 2IJRA 3W2WA 4YY3J 5B0BA 3I0SB 3MUTP 3BGOP 4WCEL 4H5TA 4AQYF 2RQKA 2E5LJ 2QKBA 4H5RA 2V4RA 4PXEA 3K5NA 1FRLA 2ZBCA 3SYZA 2QA4S 3KDOA 1G7CB 1F2HA 3DRYA 5CYMB 5LL6d 1Z26A 1SVDA 4ZVUB 1QQNA 4TQSA 4B3OA 4HH0A 4X4SA 3OR1A 4BRAA 1LCUA 1DJ0A 3TTDA 4PWDA 4K59A 2V9KA 3TQEA 1E4GT 2W4PA 1RTIB 5F3TA 2IYGA 2CGJA 2PA8D 4ZKAA 3EZ5A 4NLYA 1JNZB 3OA9A 4PPZA 5HMXA 3GIIA 1TL3B 1YHQN 3PHTA 1XC9A 2HNZB 2KHCA 2AP1A 3O9RA 5D8HB 4LRFA 4Y6IA 1WKLA 4A8KA 4PKDB 2DTUA 2AF6A 1X0FA 3Q8SB 3DRPA 2PI5A 2KQ2A 1GOBA 2CG8A 4NLSA 2P9SB 2JC1A 1I5OB 1VBXA 4ES1A 1AZSA 4DV1F 3GIMA 2QL7B 3SMPA 4K2JA 3E3XA 3QFWA 4WK3A 1BWVA 2YPYA 2HAFA 2W9BB 5KI6A 3EE8A 3HSJA 4N76A 1X8DA 3T5LA 2E7VA 3FZBA 1RTDA 1T03A 4L72B 2LA4A 1RLDA 4OYMA 2XWXA 2WTFA 3L0QA 4CJRA 2BVZA 2VQFJ 5GADU 5AQKA 1H72C 4IG0A 1UCNA 2HWTA 4JV2A 2WVCA 5CYJA 1RA6A 2B4VA 2HQ3A 4NI2B 3NGIA 2VG5B 3E01A 1XMOF 5FPNA 1EO1A 3Q8UA 2B5JA 3IBWA 1ATSA 1KVJA 2VZ9A 1FDDA 4AFFA 2HIQA 4ECUA 4EP5A 2DR7A 5CAAA 3W65A 3RRHA 1ZZFA 4EK2A 1JLEB 3IG1A 1YZ6A 3CO0P 4ZVEA 2FJWA 4FVMA 1WORA 4YB1P 5CYQB 3D9BA 2QWPA 1NGGA 2DFEA 4GV3A 4O8UA 2J6UA 3LGHA 4DL7A 4Y2IA 1D0EA 4A8SA 4CJFA 2ALZA 4H4MB 1CJTB 4BRDA 1U2FA 3DOKB 2QT7A 3D28A 3FZLA 4G6VB 1DTQA 4AHCA 3SQ1A 2G8HA 4RW7A 2XBPA 4E98A 1Z4UA 2M70A 1JLCB 1IBCB 1FWKA 2W9AA 3TAPA 2WB4A 5KOXA 3R9PA 4KKOA 4LF5J