1JLBA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
554
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 148
structure length 549
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlbA05
3QGGA 3IAYA 3DRRB 4O0JA 4H4MB 2QKKA 1S1TB 4RW8B 4WZQA 1BIUA 5DLFA 2VG5A 1RT2A 3H2LA 2VG6A 2D0BA 4CEDA 1GX5A 3TABA 4Y1DA 1KHVA 1HPZB 4GVMA 3SFUA 2BE2A 2WHOA 2ZQBA 4GC6A 1DTTB 3S3NA 3SQ1A 2OPRA 1KVBA 2WONB 3HT3A 4ECVA 3CVKA 3G10A 3LZIA 2FVCA 4OKJA 3ZSRA 5I42B 3M8QA 1N4LA 4Z4CA 2GBZA 4NLVA 3NDKA 2AGPA 3QLHA 4N56A 1VK0A 3HKWA 3V6JA 3CJ0A 5KT4A 1S6PB 2RDJA 4K4TA 4DL5A 4NLTA 4O4RA 2G8KA 2PYJA 1JXBA 4FJXA 1L3UA 4I2QB 1BL3A 3JSMA 1SUQA 3DRPB 3OYMA 4QW9A 1KVAA 4PQUA 3ZSQA 3GV8B 4Q8EA 1X9WA 4ECXA 2ZD1B 1Q8IA 4TN2A 2HNDB 4M45A 4QPXA 2XI3A 1UAXA 4RU9A 3Q8PB 2ASJA 4I9QA 4ED8A 4NRTA 2AQ4A 1XHXA 4DWIA 5KFZA 3ZT4A 5HROB 3KK1B 1NK0A 4BE0A 3KLIA 4K4XA 3E01A 2GC8A 3O3FA 4CHZA 2E9ZA 3L2QA 2B6AA 3V81A 4NLPA 5C42B 4F4WA 1S9GA 2E6LA 4O5BA 1HQEB 3OYBA 3AVNA 1EP4A 2OPPB 4CIFA 1JLEA 4IQXA 3AVHA 4I9LA 4ZVGA 3OL7A 3NF6A 3JYTA 4Z4EA 4KV8A 1S9EB 1IM4A 4CK1A 3IGNA 2UVWA 2IM0A 1RBUA 5KFTA 3ZT1A 4CHNA 4C8NA 5KT7A 4KHUA 3N6NA 3C95A 5J2NA 3KHLA 1D5AA 4WZMA 5FRNA 1S49A 5C25B 1KLMA 4NLGA 2HW3A 4LD0A 3RRGA 4ZPCA 4E1MA 1RDBA 2FLLA 4M3RA 4ECZA 2ASLA 4R0EA 2HNYA 4DTPA 5E41A 1TV6B 4ZPBA 4ZP7A 4ZPAA 4K4WA 4K4SA 4RNOA 4FLXA 2LSNA 4B8CA 1Q9YA 4M3TA 4E7IA 1IKVA 3WNGA 3QEVA 2OYQA 2ATQA 3OLAA 4QWDA 1W9HA 1JKHA 4EO8A 2D3ZA 5EU7A 3CO9A 3K5MA 5HBMA 4EO6A 1S1WA 1JLFB 2HHXA 3OYHA 1UWBA 3G6YA 2E9RX 1TKXB 4E0DA 5HRPA 2C28A 3NMAA 2FBTA 2HMIB 2PZSA 3FFIB 1X1PA 3VQ5A 3KK2B 1MMLA 4ZVFA 1HNIA 1KFDA 1IKYB 2KZMA 4ECSA 2P5OA 3H08A 4F4XA 1RA7A 5I3UA 3KLFB 4Z4GA 3HL8A 4KSEB 3OYAA 4CJTA 1UA0A 4FZZA 4Q43A 4C8OA 4PUOB 4R5PB 4CEAA 1BCOA 4O0IA 5J2PA 3CDWA 3ALYA 3LPTA 2AGQA 3HVTB 5KG3A 1LWCA 3WNFA 4WXOA 2B4JA 1NJYA 2YKMA 5K14B 2UVRA 4OJRA 3MEDA 4NCBA 4E1NA 2I5JB 4CJ3A 3PY8A 2OPSB 3VA3A 1FKOA 4DFJA 3NL0A 3OS2A 3DLGA 3PVXA 1BISA 3DLRA 4IDKA 4B9UA 4DQIA 4FK0A 4IG3B 4NLRA 4ID5A 5KFLA 5FRMA 3WNHA 5DK5A 3SUNA 3DOKA 4DLEA 4M3YA 1WSFA 5FDLB 4QWEA 1TL3B 1SKSA 2YNFA 2ZKUA 2XWYA 2G8WA 3T5HA 4IFYB 2HNZB 1RTIA 2VA2A 2VWKA 4TXSA 2WOMA 5EWFA 3KLEA 2KTQA 3VQPA 4CEBA 3UR0A 1LW0A 1WSHA 2IM2A 5HP1A 2GIQA 3QERA 3VQ8A 3QEXA 3RMBA 4ECUA 1RBVA 3OHAA 4O3NA 4Q8FA 4J2BA 4DU3A 3MR2A 4MKAA 1VRTA 4DSJA 3DLEA 3RR8A 1WSIA 4PA1A 3EPGA 1VSIA 1RILA 4H54A 1QE1B 4KAZA 4YR2A 3PW5A 1TAUA 4IKFA 4B9TA 4KHRA 3RRHA 4KKOA 4CJVA 3QO9B 3FDSA 4N47A 5L9XA 4E7JA 4CK3A 1SL1A 1TVRB 4FJLA 3NGYA 4I7FB 4CF2A 2ZE2B 2Z1IA 3PW7A 1REVA 2QK9A 3AVMA 3QIPB 4KTQA 3I0SA 1HNVA 2AJQA 4JV0A 4RNMA 3ULDA 5DQGA 1KFSA 4X2BA 4JLHA 1NJWA 1N5YA 1S1XB 4YQWA 2AX1A 3M8PA 3PW4A 3BGRA 3SUQA 3ICLA 4ICLB 3QYYA 4IG0B 4DLGA 4PY5A 2XI2A 1GOCA 4HUEA 2E6MA 3U3YA 3AA2A 2HHTA 3TAMB 2W9BA 3NGIA 3PZPA 3MEGA 1ITGA 4RZRA 3MXMA 3GIKA 2JLEA 1G15A 4FBUA 4DSLA 3G6XA 2XY8A 5EWEA 5KRTA 1ZBIA 5DG8A 3M9OB 1WAJA 2RF2B 1TKZB 5J2QB 2IAJB 3TAPA 3ZSOA 1JLGA 2IJFA 4CJRA 1L3SA 4ZVHA 4ED2A 1IH7A 1SKWA 3L8BA 1IKWA 1U49A 4DG1A 1W25A 4UQGA 4RUAA 4F3TA 5KFHA 4DFKA 1S1UB 4FJGA 1T05B 3DOLB 2QKBA 4RW6B 2PYLA 1RTHA 4MK8A 4WYWA 3AO5A 5F9NA 2IMWP 1KCFA 2IJNA 5KFVA 1RDRA 4C8LA 2Y1JA 3S3OA 1RNHA 4DL2A 4KTWA 4B9VA 4QCLA 1WSJA 4RW7A 5F8LA 3TQ1A 1ZTTA 3GIIA 1KVCA 2IA6A 3KLGB 2FJWA 1XI1A 2OPRB 3H59A 3M9NB 3I0RA 1JX4A 2BRLA 4R8UA 2R8HA 1B92A 3D28A 1RBTA 3M8QB 4Y34A 1WSEA 3LP2B 4HHTA 4FJKA 2F8EX 1XHZA 2R8GA 3O3HA 3LP1A 2QXFA 1ZBUA 5C24A 4FLUA 2AWZA 3ZSXA 3DMJA 3OSNA 3D5MA 3RBEA 4ELVA 1T7PA 3HPOA 2R2UA 5KFBA 3AVLA 4OGCA 3T3FA 3UPFA 5KGWA 3JSMB 3K59A 3O3GA 4E19A 3SI6A 2FVQA 2WRMA 4M3UA 1S0MA 3SUOA 2ATLA 2KQ2A 2VA3A 5CYQB 1X9MA 2P51A 1RT4B 4DS5A 4RW9A 3KK3A 5KFOA 1KLNA 3MTKA 2C2RA 3KHGA 1S48A 1DLOA 4KREA 1Y97A 1Q9XA 4F4YA 3H5SA 1FKPB 5SWMA 4WE1B 4JS4A 3PX0A 1RT7A 3V81B 4Q45A 4LQ3A 2IS3A 4B9SA 4HTUA 3GIMA 4CF0A 3MR5A 2EC0A 3OYGA 4WFYA 4DTMA 3EPIA 3RB0A 3VQ9A 3OYJA 3KNAA 3JYTB 3FQLA 1N56A 3LZJA 4FM0A 4NCGA 2Q3SA 4KV8B 3VQQA 4Y2AA 3PV8A 4OGEA 3GV5B 5KG6A 4W5QA 3LWMA 3PJXA 2BR0A 3KJVB 1TK5A 5KT2A 3AVGA 1C2PA 4MK9A 1C1BB 3H4DA 1HYSA 5KFAA 4ZTJA 4W5RA 4ED7A 4FJJA 3T5JA 2O5DA 2HNYB 4YR3A 4QAGA 5F8HA 3AVCA 3OSPA 4RW4B 1RT6A 4QW8A 2Z1HA 1WSGA 2QV6A 4DU1A 4KBIA 3LP3A 4Y3CA 1TL1A 5KI6A 1LWFA 4AHUA 2W42A 5KFIA 1IKVB 4HUGA 2EX3A 4KB7A 3KIOA 4XPCA 4CFAA 1GOBA 4O4GA 3AVJA 3SNNA 4J9NA 4KFBA 1JKHB 4Q0BB 1U48A 2BQ3A 1WNEA 3P83D 1BQNA 4W5TA 2GV9A 3KKSA 3MFIA 5HBMB 3RTVA 3VQCA 1S1WB 4FJNA 4WXWA 1UWBB 3NF7A 2V9WA 2D7SA 1J54A 5HRNA 4DF8A 4BWJA 3E51A 4LSNA 4CGIA 1W0HA 4TY8A 3B6PA 3RAQA 4N41A 1GX6A 3KLHA 1RT3A 3PR4A 1XR5A 3VQAA 2HB5A 4J9PA 2IC3B 4MFBA 1RDAA 1LW2A 1HQUB 1S5JA 2GIRA 1LAVA 3DRSA 4JS5A 4F3OA 4JUZA 5J2PB 3C6TA 4GC7A 3AA5X 1QAIA 4ZP6A 4FM2A 4O3SA 2G8HA 4DTNA 2JC1A 1LWCB 3PUFA 2G8IA 4FS1A 4ECYA 2FVPA 3MEDB 2V0NA 1T03A 2IM1A 1TK0A 4Z4FA 3T5LA 3CYMA 1FKOB 5KT6A 3CFOA 1EKEA 4B3OB 1RTDA 4FLVA 4IDKB 3MR6A 4IFVB 4NLOA 2C22A 4ID5B 5KFYA 4DTRA 3BSOA 4NLWA 2YKNA 5T7BA 3CJ5A 2CJQA 2BANA 3MECA 2YNIA 4DSIA 1BGXT 3KTQA 2YNFB 4Y2CA 1TK8A 3RAXA 3C6UA 3IG1A 5KFUA 4GW6A 1NKBA 2PY5A 5J1EA 3V1OA 2W8KA 3KLEB 1A5XA 4FW2A 5DG9A 3DM2B 4J9RA 1JIHA 3BQ0A 1LWEB 3OYEA 3TWHA 4ED1A 1HMVA 4IH5A 1T3NA 1DTQA 3IS9A 4ELUA 2UUTA 1U04A 3IRXA 3V6DA 3ISND 3TAGA 4H4OB 5KT5A 3DLEB 4FJ9A 2YV0X 4MQ3A 2KFZA 2C2DA 1R0AA 4FBTA 1CSJA 1BI4A 1JXLA 4F4KA 1BQMB 3AV9A 2YHBA 4H4MA 4NRUA 4KKOB 3SUPA 3V9ZA 4G3IA 3NGZA 4DSFA 2IDOA 4Q44A 5D3GB 2XY7A 1EETA 1VSDA 4J9LA 1X9SA 2C2EA 5C5JA 1TKDA 2X6NA 1DTTA 2G8UA 4MH8A 2WONA 3MEEB 3PW2A 4ZPDA 1JXEA 3HVWA 4CHYA 1XC9A 3QGIA 3CDUA 5I42A 1C0TB 4CJ5A 4HCBA 3ITHB 1F21A 3HYFA 1FK9A 5J2MB 4E7LA 4QWAA 4KRFA 4EBDA 5L1KA 1S6PA 4FW1A 3F73A 3O4QA 3I8DA 1NK8A 4TQRA 3G86A 3U3GA 2W9BB 1JLQB 2DPIA 2X6SA 4I2QA 4M95A 1JL2A 3MEGB 3AO1A 3DRPA 1T94A 1S6QA 3NGDA 2HHQA 3FQKA 1QQCA 4DQSA 4PWDA 4JRPA 3H5UA 2OZSA 1RBSA 2DY4A 1QSYA 3DLBA 3RBDA 3QESA 1CXUA 2HNDA 1C0UB 1IKWB 4EZ6A 3BSNA 4Z4IA 3LP0B 3V9UA 4KHYA 4CGJA 2FBYA 3SV4A 2XRIA 1L3VA 3OL9A 3HVAA 5HROA 1MU2B 2R8JA 3TAFA 4KI6A 4FJIA 1SH2A 1RT5A 1QS4A 4DSKA 3AO2A 3NKYA 4CFBA 1CXQA 2RKIA 3LALA 3VQ7A 1HQEA 1RT1B 2XGPA 4J9KA 4DS4A 2FBXA 2HWHA 3OJSA 4RW7B 4NLUA 5CYMA 5KFWA 1GOAA 4CJUA 1U09A 3HJFA 3KMQA 2D3UA 5JS2A 3HK2A 5DLGA 4QWCA 4DEZA 2F96A 3RMCA 3SPZA 2JC0A 1NJZA 4LSLB 4CGDA 1RTJA 2O4GA 1J5OA 2A1SA 4CEFA 2IM3A 3LP1B 3K5LA 4O44A 2FLPA 1RYRA 3S3MA 2G8VA 1T8EA 5EDWA 1D9FA 3RB3A 4EZ9A 2W9AA 2BRKA 4DTUA 3QEWA 3DYAA 3OYDA 4FK4A 4Y1CA 2XY6A 3AVAA 3QINA 4XIUA 2BGGA 4H8KA 2B5JB 3CQ8A 2Y1IA 4ECQA 3CJ4A 4I2PA 1U4BA 1WN7A 1L3TA 4FLWA 4KO0A 2RDIA 2W8LA 4NLQA 4CEOA 1DLOB 4DL6A 2YNGB 3NBPB 4M3XA 4BACA 1VSEA 2A1RA 1U45A 1VSLA 1SKRA 1RT7B 5KG7A 4AHRA 4E89A 4FJ5A 4DF4A 4ID1A 5KFGA 4FM1A 4CF1A 4CE9A 5DG7A 3HSTB 5L1JA 4LQ9A 4QOZB 4CJWA 2HMIA 3FFIA 5F8IA 1RDCA 2V4QA 3EZ5A 1VRUB 4K4YA 1S9FA 3KLFA 4NCGB 3BJYA 2HAIA 4IKAA 2ITGA 2HHWA 3ASMA 1ASVA 4OLAA 1NK4A 3L3VA 4YFUA 4FVMA 3VQEA 1LV5A 3OJUA 5CY4A 4CEQA 4CEZA 1N6QA 4ZHRB 2XCPA 4FJ7A 4KE5A 1Z25A 3AVIA 3M8RA 2YNHA 2I5JA 4DQPA 3KKRA 2VG5B 1RT2B 2VG6B 1IKXA 2J6TA 4CGHA 2BE2B 1TL1B 4J9SA 2IOCA 4IG3A 1XR6A 5DQHA 3OY9A 2I1RA 1ZETA 2D41A 4C8MA 1BHLA 1A5WA 1J9AA 1HYZA 3OYNA 5HRSA 3QGHA 4KFBB 2HNZA 1SV5A 1B9DA 4Q5VA 4N76A 4TSXA 1BQNB 1QUVA 3QLHB 1YVUA 3CFRA 4FS2A 1S97A 4CIEA 4IRCA 4IRDA 4U7CA 3RMDA 1SUQB 2RPIA 3I5AA 3ZSVA 3MR3A 4PQUB 3N6MA 3KLHB 4F8RA 4L8RB 3UDLA 3DLKA 4AH9A 2GUIA 3O4NA 4KB0A 2IGIA 1JLBA 2UVVA 3QO9A 2DTUA 3C6TB 4NCAA 1Z26A 2FJVA 3RR7A 3VQBA 1TVRA 1C1CA 1NK6A 1D1UA 4I7FA 2ZE2A 3AO4A 3OLBA 2X74A 3UIQA 3K57A 3KLIB 3E01B 4YNQA 3A2FA 3VQSA 3AVFA 2B6AB 2HVHA 5KT3A 2HVIA 3TAQA 3ISNC 1S9GB 1RDDA 1ZBFA 2VG7A 1UA1A 3QIOA 1S1XA 1EP4B 4ZMMA 3G6VA 4CK2A 4ICLA 1JLEB 2W9CA 4F50A 1RTDB 5FROA 4F4ZA 4DMNA 4O3PA 4OL8A 3LWLA 4KHWA 1D0EA 2Z1JA 3L2RA 4OPJA 3CJ2A 1KHWA 2BANB 2OPQA 2YNIB 4AHTA 1SH0A 1NHUA 3SJJA 3TAMA 3C6UB 1K1SA 4CF8A 3PX6A 4EYHB 4DQRA 4AHCA 3V9XA 4RG8A 2KW4A 3S9HA 5HLFA 2FVSA 4O55A 5J2NB 4TLRA 2OZMA 4ZTFA 3HHKA 1KLMB 2ILZA 4FJHA 4IH7A 5J2QA 2XHBA 3BR9A 4J2DA 2JEIA 4CJSA 1L5UA 2KZZA 1TKTA 3MF5A 2ASDA 1BCMA 2XCAA 3ZSZA 4FLYA 3CG7A 4K4VA 3HPHA 3VA0A 3UQSA 3M8SA 3OS0A 1S1UA 1JLCA 4J9QA 4AHVA 1I6JA 2FLNA 3NF8A 3HM9A 3L2UA 3U6FA 4G1QA 3DOLA 1R0AB 4OKKA 5L1IA 4RW6A 1JLAA 5KFQA 4JRQA 4E3SA 3OYFA 3BDPA 3PJWA 1VSJA 1A5VA 4DL4A 4CJQA 4K4UA 1VSKA 3V4IA 4M94A 3HVRA 1NHVA 3H98A 3SYZA 1BIZA 1EETB 3AVBA 2G8FA 3SPYA 3BQ2A 2IBKA 3VQ4A 3KLGA 3VN5A 3PO5A 4YR0A 1S1VA 5KFKA 3RMAA 1NK9A 5KFCA 3OS1A 4CESA 3TAEA 3T1AA 3QNNA 2KFNA 1S4FA 3I5BA 3LP2A 5F8NA 1I3AA 1JL1A 4CHPA 3IGVA 5DGAA 1HNIB 3ZCMA 1FK9B 3C94A 5SZTA 2P1JA 2O4IA 5I3UB 4BE1A 4NYNA 3RWUA 2R8KA 5DGBA 4K8ZA 3H5YA 5F9LA 4TQSA 3OYKA 3HXMA 3FRZA 3Q8SB 1S6QB 4AILC 5KFJA 4PWDB 3MFHA 4ED6A 1Z4UA 2YKMB 5CYQA 3QETA 4IRKA 3V9WA 3NH2A 2XGQA 1RT4A 1NKCA 2UVUA 4BDPA 4FK2A 1RYSA 2D0AA 4ZP9A 3DLGB 3DI6A 1RA6A 4KHMA 2OH2A 4IOBA 1FKPA 4TY9A 1J53A 4WE1A 4O3QA 4KI4A 2UUWA 1RT5B 3BSAA 4M42A 3NAHA 3DOKB 2RKIB 3RB4A 5KG1A 1QSSA 4OPKA 3SI8A 4O3RA 1RTIB 3P1GA 5KFDA 3KOAA 4K8XA 1NOYA 1RAJA 2WOMB 1EX4A 5CYMB 3KD1E 5KFPA 4NZ0A 4NLSA 1LW0B 4NLDA 5HP1B 4WYLA 4BDYA 1VSMA 3PX4A 3LPUA 3H4BA 1VRTB 4M41A 3QNOA 1RTJB 3LANA 4CECA 1J5OB 3KJVA 2V4RA 4KHQA 1HJRA 1K6YA 1C1BA 2HHVA 4O44B 2RN2A 4WFZA 3DRRA 4KHNA 1S1TA 4CJKA 4RW8A 2R7YA 4KAIA 3AVKA 1D9DA 1RBRA 3DYAB 3ZSYA 3TI0A 4KHSA 4DFPA 3K5OA 2VWJA 4GMJB 1D8YA 3NH1A 4FLTA 2FJXA 4RW4A 1HPZA 1REVB 3HP9A 3KLVA 1HARA 4I2PB 1S0OA 3V9SA 2J6SA 2YHAA 2OA8A 4HCCA 1ASUA 3I0SB 1HNVB 3GILA 4KO0B 4ELTA 3OHBA 3NF9A 3TVKA 4FJ8A 1N5YB 3M8PB 3L2WA 4EBEA 3BGRB 3NE6A 3IN5A 3MXJA 3AO3A 4Q0BA 2AU0A 3VQDA 4URQU 2P5GA 4B9NA 1N48A 4M3ZA 3VQ6A 4CCHA 1YTAA 3T19A 4CERA 2WB4A 3PW0A 1NK5A 4MIAA 4CHQA 3GQCA 3V6KA 1SL2A 5KFXA 1QTMA 4CJLA 2ZD1A 4FZYA 2WK4A 2IC3A 4BE2A 1HQUA 3MXIA 1JLGB 3NFAA 3CJ3A 2BDPA 3TARA 4B08A 3KD5E 5KG5A 4DG1B 1B9FA 3OYCA 2XY5A 2QE5A 2B43A 2R2RA 1N6QB 1VSFA 3KK1A 3QZ8A 4MKBA 4ECWA 4N5SA 1RTHB 4W5OA 4HKQA 1NK7A 5C42A 2W7PA 3SFGA 1NOZA 2YNHB 2BQRA 4IH6A 1IKXB 3OYIA 2OPPA 1NNDA 4CIGA 1WAFA 3L3UA 3THVA 4RUCA 4F2RA 4B3OA 1XR7A 2W7OA 2FBVA 5F8MA 3OYLA 4IFVA 4LY7A 4HUFA 4CJFA 1O1WA 3ZT3A 4IBNA 3DLHA 5KRSA 3I0RB 1S9EA 4FZXC 3BQ1A 4R8UB 1QAJA 4CF9A 3GV7B 4ZP8A 4DL3A 1SV5B 4LH4A 5JXSA 3PR5B 1QSLA 4E7KA 3DM2A 2E9TA 3WNEA 5C25A 1TP7A 5CZ2A 3QEPA 4FLZA 5C24B 3EY1A 5T14A 3DMJB 1LWEA 3LAKA 3HP6A 4RNNA 3H5XA 1C6VA 3SQ0A 3K58A 3LAMA 4NYFA 5L1LA 3CDEA 4ED3A 2HHUA 1TV6A 3SZ2A 4CGFA 2E4LA 4H4OA 2HHSA 4RNFA 4W5NA 2XO7A 3CM6A 3L2VA 3KMSA 1ZBHA 3DLKB 3QEIA 4QWBA 5F8JA 1LAWA 1IO2A 3D0PA 3K5NA 1BQMA 3AA3A 4CJEA 4RNHA 4RW9B 3KK3B 4OVLA 1NJXA 1JLBB 4M3WA 4B8AB 1SH3A 3AA4A 4URGA 1QHTA 1C1CB 5D3GA 3NAEA 4IR9A 2JGUA 2J6UA 4MIBA 3B6OA 4FCYA 4DSEA 2FVRA 3GIJA 4FJMA 1CZ9A 5JUMA 1JLFA 1VSHA 1TKXA 3MEEA 4ED0A 2VG7B 2ALZA 1YT3A 5KFEA 1IG9A 2JEJA 1C0TA 3G0ZA 3CM5A 3ITHA 4C8KA 3KK2A 1S10A 2W9CB 1C0MA 1IKYA 4URSA 2NUBA 5J2MA 3SV3A 5KFMA 2D5RA 3NAIA 4KPYA 4E7HA 2OPQB 4JV2A 2FC0A 5DMRA 4Z4HA 1UOCA 5JS1A 1JLQA 4PUOA 4R5PA 4NLXA 4MK7A 4HVJA 4AHSA 2F8SA 5HLFB 3HVTA 3Q8RB 1SL0A 4FXDA 1HYSB 3M9MB 3RB6A 5K14A 4Z0UA 3V6HA 3HPGA 1TGOA 1TKTB 1C0UA 4YP3A 1HRHA 2WTFA 4JV1A 3N6LA 1FXXA 4DFMA 4IR1A 2OPSA 3QIDA 2D0CA 3NH0A 3LP0A 1JLCB 2EHGA 1RT6B 4G1QB 3Q8QB 3K2PA 1ZTWA 1WNSA 5EWGA 1MU2A 3SQ2A 1LWFB 3KHHA 4HYKA 1KRPA 1JLAB 5F8GA 5KFNA 5EUHA 5KGXA 1TQLA 3SQ4A 5FDLA 1TL3A 1ZBLA 1ZYQA 1RT1A 4O4GB 2DFHA 5KTQA 3V4IB 4IFYA 1WLJA 1YVFA 2HWIA 3ZT0A 3TR8A 4CJ4A 4OLBA 2DFEA 4BDZA 4CEEA 4NLYA 3HO1A 1S1VB 2R8IA 3ZT2A 2CKWA 1I39A 1OS5A 4TYAA 4NYZA 5CZ1A 3H40A 4LSNB 1K1QA 2Z1GA 4TY8B 2F8TA 4J2EA 4J2AA 4LH5A 4LSLA 3I5CA 3OL6A 1RT3B 4O3OA 5DQIA 2DFFA 5KFRA 4MFBB 1QE1A 1RCHA 1LW2B 4OKEA 3NHGA 3KHRA 1CZBA 3DRSB 5KG4A 2JEGA 3DDKA 3CIZA 2R2TA 1YTUA 3ZSWA 3CFPA 3NCIA 2DPJA 4F2SA 4ECTA 2B5JA 3EYZA 2WCXA 3QIPA 1U47A 3PO4A 1TAQA 1XWLA 3D45A 4B9MA 3LDSA 4KB1A 1T03B 4XPEA 3MAQA 4FYDA 4XO0A 3T5KA 2YNGA 3DI6B 4B9LA 3BSCA 3NBPA 2BQUA 4DL7A 4KTZA 4DTJA 4IG0A 4K4ZA 2X78A 3SCXA 5KG2A 4CHOA 4DQQA 2YKNB 4CFDA 3CWJA 4TYBA 3MECB 2XC9A 4ECRA 5HRRA 3IG1B 4EYIB 3OL8A 4K50A 4CGGA 1KSPA 4EP4A 5J1EB 2ETJA 2AGOA 3OVNA 4CFCA 2R2SA 3F9KA 4ZVEA 4U6PA 1VRUA 1S0NA 4DTSA 4EBCA 4CJPA 2RF2A 1TKZA 3P5JA 2IAJA 3BREA 5KFFA 2JEFA 1HMVB 4YMEA 1ASWA 1CLQA 1DTQB 3IS9B 3V1RA 1KTQA 4EP5A 4J9OA 3V1QA 3IRXB 3FSIA 1C1AA 3V6DB 5KFSA 4EEYA 4J9MA 4DU4A 4BWMA 2AX0A 3PHEA 1T05A 5KG0A 3QZ7A 1HYVA 3EZUA 4WFXA 3TANA 4ZHRA 1BI4B 2ILYA 4DTXA 1EXQA 4DTOA 3GYNA 1NKEA
chains in the Genus database with same CATH superfamily
4H4MB 5M1FA 2QKKA 1WC6A 4QQBA 4USUA 2V51B 3TZZA 1BIUA 5DLFA 1RT2A 3H2LA 2LQJA 4CEDA 1GX5A 3K17A 1GAOA 3W66A 3SFUA 1LOUA 2UXBJ 5B8HA 3CCLN 1QUPA 3UNGC 2F7TA 2H3EB 2DXDA 4FPIA 4JD2A 4DR6J 3VCDA 1VIOA 4OKJA 5I42B 3OW2R 3O2IA 3VAFA 3M8QA 2BW2A 1S22A 3CHWA 3C6HA 3SAHA 3HULA 2L9NA 3NDKA 3GZ7A 3GPAA 1D9AA 4LF4F 2CQGA 1OQ6A 1VK0A 2P9IB 3HKWA 4I0WA 4O4RA 1KD1O 2G8KA 5KPTA 1GLFO 1JXBA 3SDEA 1QLNA 4I2QB 1Y0HA 3DRPB 1B3TA 4QW9A 3DXMA 3ET6B 1MROA 3PYGA 3ETMA 3CD7A 3JQJA 2L08A 1IWGA 4J5OA 4PG8A 2XS5A 3ZEUB 2HNDB 2JLGA 2G0CA 2CJYB 3MM5B 5FPDA 4ED8A 1EIYB 5AZJA 3OTOK 1XHXA 5D77A 1U6ZA 2BJ1A 1NK0A 2VC0A 2GC8A 4CHZA 4CP5A 3N79A 2B6AA 1CQMA 4C3KA 2W25A 1S9GA 1Y5IB 1HQEB 3OYBA 1EP4A 2EBEA 2OPPB 2GIFA 1YJNS 2X1GA 1JLEA 4LR8A 1XQIA 3J7A1 3S8SA 4Z4EA 4LRDA 4LF4J 1UJ6A 1PC5A 4UY8O 1RBUA 3MMBB 3IFRA 2PFDA 4Y6IA 2APOA 3SQOP 3BO4A 4C8NA 4CHNA 2GELA 5KT7A 5KPZA 2ADCA 3KHLA 5FRNA 4K2XA 1KLMA 4JNEA 3EGNA 3FZBA 3KK7A 4E1MA 2E2NA 4A61A 3W65A 3J7Z5 4M3RA 2ASLA 3CC4N 2HNYA 5E41A 3VEXA 4ZPBA 4P71A 4ZP7A 3ENOA 3CW2C 4Z7YA 4WFBQ 3FBBA 4ILGB 2LSNA 1RWNB 4DZDA 2A0FB 4M3TA 1IKVA 4OYBA 2E1CA 4YOUA 1SS6A 4RJVA 2VPYB 2VQEK 4QIWD 1QQMA 4HH1A 4C1NI 3L09A 1OMSA 3K5MA 5HBMA 4EO6A 2HHXA 3W9IA 6FDRA 3A1YG 1FEEA 3TUJC 4RL1A 3OT9A 2PZSA 3FFIB 1CJKA 4DV6K 2VONA 1MMLA 3OFFA 2EK1A 5AJ3K 4PYDA 3A13A 2P5OA 3H08A 3FZLA 3O8MA 4K41A 1EAYC 3KLFB 3AJDA 4YN3B 3HL8A 1NAQA 4ES1A 2BEFA 3C19A 4OHXA 3TEHB 2DKOB 2QA4S 4Q43A 1S3XA 3UN2A 2DR5A 4R5PB 2ASYA 4CEAA 3ENAA 2ZNZA 4O0IA 3CDWA 2K7KA 2ALYB 5KG3A 1N54B 2YKMA 5K14B 4OJRA 4A2AA 2DNOA 4LSZB 4OLPA 2I9SA 3PY8A 2F9JA 2W2PP 2OPSB 2XZWA 4NLBA 3DLGA 3PVXA 5HOOA 2DO0A 4DQIA 4IDKA 4B9UA 2KLAA 3ZNUA 4ID5A 2DITA 3T1YF 5KFLA 2ZKTA 3WNHA 4TU7A 5DK5A 1TL3B 2LFVA 4F7VA 3ZX0A 3N4WA 2G8WA 3HHLD 2HNZB 4CNZA 1RTIA 2A6AA 2VWKA 1P9YA 4TXSA 1JMTA 2KTQA 2O67A 4WP3A 1LW0A 4P75A 2GIQA 1HWLA 3VQ8A 3RMBA 4ECUA 2DR7A 3OHAA 4Q8FA 4DR5F 4KH6A 2H48B 2XSJB 4H4KA 4BRMA 1VSIA 1RILA 4NO7A 1QE1B 5L39A 5AQLA 3PW5A 1TAUA 4IKFA 1IBMK 3FDSA 4N47A 4M7XA 3RBZA 2ZDPA 4E7JA 4CK3A 3CULA 1RKIA 2Q36A 1WF1A 1LXJA 2FB0A 2Z1IA 1REVA 1V6HA 2QK9A 2GJIA 5HVHA 2O8DA 3I0SA 2H65B 4RNMA 4M5MA 4E2FB 2XG8A 5JVGL 1N5YA 2AX1A 3M8PA 3AA8A 2K7JA 1VQMN 1RAGB 1R31A 1RB0A 3H2UB 4D3HA 2YWFA 3WXJA 2XQCA 5IS2A 4HUEA 1RCOB 1U26A 2NPIA 3BH7B 3TA1A 3AGRA 1HBOB 3AAWB 3CXCM 2ZZMA 3BS9A 1F0XA 4M5HA 2W9BA 1VQLS 4RZRA 3MXMA 3VEVA 4DR5J 3G6XA 2KU7A 3DU5A 1P1LA 2CG4A 1VQPS 3P3DA 4LF6K 4AFFA 5J2QB 2IAJB 3ZSOA 2DTJA 4ZVHA 4ED2A 1IH7A 3CMAN 3HCXA 3L8BA 4YY3F 1U49A 2DNZA 1N8RO 4F9OA 4PL7A 2ZWHA 3G4SN 3MAAB 1QJHA 3ADAC 3T7ZA 3UFCX 4R25A 5CD4A 1K0TA 2ZHOA 2Z2ZA 2I7PA 3NCPA 5IQQA 4ETZA 1HFEL 1V5VA 2IMWP 4EHTA 1WBDA 1TL7A 1KCFA 1RDRA 3S3OA 3CGIA 2IA6A 2FJWA 2XNRA 2UUCF 2OPRB 1VQ6N 3I0RA 2OO4A 2AEMA 1B92A 4MYUA 5B08A 4Y34A 1WSEA 3VF0B 1NGIA 4BR9A 4HHTA 5DM7Q 4JI1K 3CQXA 2P9UB 1I94K 2QXFA 2X3DA 5C24A 3ZSXA 4BQZA 2RILA 3RG6A 3RBEA 1T7PA 4X4QA 5HL7L 3K59A 2J5AA 3O3GA 4A62A 1RZMA 2FVQA 4YY3J 3ZXWA 2YJEA 3U9ZA 5FPEA 4AUKA 2ATLA 3BY5A 2UUBK 2GNKA 5LY3A 3LL3A 2HK2A 3WC2A 3MTKA 4YB7A 1Q86O 1K8AO 1Y97A 3K9KA 2PFUA 3E66A 2VDIA 3WX8A 3V81B 4ZLNA 3VEWA 4HHJA 2WSFC 1IJFB 3A4TA 1GLDG 3OYGA 3KJFB 3VF6A 3VQ9A 3W63A 4X66F 4JAXA 3JYTB 2B4VA 1N56A 2O8BA 2Q3SA 1XNRF 2E5IA 1WJ9A 1FF2A 1NMNA 2CPDA 4GO7X 3ZETA 1XBWA 3LWMA 3VZIA 3AJ1A 2FHJA 3JQMA 4P6QA 1IBCB 2IVMA 3IUCA 5TKYA 3RUBL 1TK5A 4M5DB 2A3JA 1C2PA 1C1BB 4KBOA 2E5HA 5KFAA 1NJIO 1VQ9S 1MSWD 4ILHA 4W5RA 3EN9A 4FJJA 3AHPA 1GLAG 4X64K 2FQQB 2HRTA 1REGX 4EU0A 2BUPA 3OSPA 3IDHA 1WSGA 2QV6A 5AE2A 2W42A 4L6V3 4DV7K 2VKRA 2OCEA 2X3GA 3KIOA 4EHUA 5CHIA 1RGIA 4O4GA 3R27A 4J9NA 2FZGB 4Q0BB 3P83D 1WNEA 1XNQF 4PG7A 2HIYA 2GA7A 3VQCA 1ROFA 3Q22A 1UWBB 3ZZ0A 4QIFA 4O8UA 3BGLA 1XNRJ 1NPKA 4U67L 1BXNA 2WB1D 4DF8A 3H20A 5D4OA 3B6PA 2CYYA 4QZVB 3KLHA 3VQAA 5BRHA 4J9PA 2AJFE 3HHLC 2GIRA 3IWNC 2KT3A 4JS5A 2JRSA 4F3OA 5JVHL 3AA5X 2D69A 4ZP6A 5I3QA 3WQUA 4YORA 1LWCB 3PYEA 2ZEJA 1HNZJ 5D0EA 2B9XA 2VICA 2FVPA 1YJ9S 5AQIA 1BWEA 4WK3A 3UDEA 1T03A 1TK0A 1OYDA 2M5YA 5KT6A 3CFOA 4WU2A 1RTDA 3EMTA 3W3DA 3VAKA 1WDDA 2C22A 3AQOA 4DTRA 1YHQS 2YKNA 5D4PA 3EGWB 1TU0B 1BGXT 3IO1A 3RAXA 3RSEA 5EY4A 2G1DA 3IG1A 4TKTA 1NNEA 2IFXA 2R3VA 1NGGA 3DLJA 2ZOMA 3DM2B 1RBLA 5A6PA 1DQAA 5T7LB 3BQ0A 1LWEB 4ZVTB 1KQFB 3IC1A 3TWHA 4OI4A 4AYBD 1N5VA 3IRXA 4FWQA 2PMHA 5EOYA 4UUXA 4H4OB 3DLEB 4H5TA 2A6OA 2C42A 5IT0A 1BI4A 4UTGA 1MN9A 4F4KA 5E5NA 1HD1A 4X4VA 1DBDA 2AV5A 2C3OA 2OSQA 3WQTA 2CADA 3PM9A 1Q79A 1RFQA 5A0YB 4JKEA 1EETA 1VSDA 2ZJQQ 1X9SA 2C2EA 2J0SD 2G8UA 1OJ4A 2XULA 3ZZOA 1QVGR 2LDIA 2HAFA 3GFZA 3PW2A 1RAOA 4CHYA 1XC9A 3OW2M 1E6YA 4DR1F 1WUUA 3CC4S 3GYXB 3CDUA 1C0TB 2RUSA 5C15A 4F67A 2KKZA 1H98A 2G2ZA 3MPWA 1VC0A 2GQCA 4KRFA 2BKNA 4OO1J 1TR0A 1S6PA 4FW1A 2M9KA 2AZ1A 2P6TA 1NK8A 4TQRA 1FRLA 3U3GA 1JLQB 2VYPA 2DNHA 2DPIA 2X6SA 1SI9A 2D1CA 1S6QA 2HHQA 5BN8A 4OZJA 2OMLA 5CH7B 4LF7K 2OZSA 1F6TA 3P5BP 2PC6A 1QSYA 1HIYA 2JFKA 1GLJO 3RBDA 3QESA 2MKKA 1FJGK 1M0SA 2MYFA 4LMZA 1WDTA 4Z4IA 3JSBA 1WOQA 2PD1A 2QN6B 3SV4A 1HBNB 3OL9A 1X0FA 2R8JA 3TAFA 5D6GA 1GEHA 3M5RA 2QMUB 4C8YA 3CCTA 1I1GA 1R6VA 4JI4F 3BZKA 2RKIA 2XGPA 4J9KA 4PKIA 4DS4A 3OJSA 4RW7B 2V52B 2HKEA 2KVQE 1NLVA 2J7KA 2D3UA 3PEHA 3KNGA 5EN1A 4WKYA 4B1UB 4QWCA 2F96A 1Q8LA 2CAJA 3UCUP 2E5LK 5ETTA 1O5JA 2N3OA 1VLOA 4LC9B 1CULA 5J1NA 4LSLB 2NXNA 1NJZA 1RTJA 4Y65A 3C46A 2A1SA 3GCWP 2HQDA 2IVYA 2AJ0A 1T8EA 1D9FA 3RB3A 2W4DA 4EZ9A 2DIUA 2W9AA 1QAXA 2Z2YB 1TUVA 4OYXA 3SBGA 3OYDA 3IFEA 1YVNA 4FK4A 3AVAA 3D0IE 1R8HA 2BGGA 1M5KC 1QTNB 4LF5F 3TQEA 4FKXA 4I2PA 2OSRA 2M52A 3ISZA 2FIUA 3NGKA 1U4BA 2B9EA 2FTRA 4DX7A 2DXEA 1ZZFA 1T6CA 4JI4J 1DLOB 4DR2K 1S5ZA 2J76E 1UWAA 4M3XA 3MM6A 2D3O1 1FERA 3MM7B 1EHWA 1F60B 5KG7A 2MQ8A 2NCKL 4DF4A 4FOEA 4ID1A 5KFGA 2XMTA 4CF1A 4CE9A 4A2BA 2A2CA 4FOIA 4DR3F 2HMIA 2VC1A 3CCVN 1ATNA 1HWJA 3MD1A 1WHWA 1VRUB 1S9FA 4NCGB 1U2VB 3BJYA 4IKAA 4OHWA 2HHWA 5E3AA 3B54A 3I9V9 3HSJA 3P8BB 1RWOB 1BLUA 3M32A 1UEKA 4M5NA 1T95A 3HT0A 1YITN 3OBWA 3OJUA 4CEQA 4DR4K 4CEZA 2YWGA 3C16B 4LF5J 2BX6A 4DUYF 4M5JA 3M8RA 2IDEA 2LU1A 3KKRA 4ETXA 1IKXA 5L46A 1FKAF 3MPVA 1TL1B 4J9SA 2IOCA 1X8DA 3I32A 4JI3F 5DQHA 1KVKA 5GIOA 5ELZA 2I1RA 4C8MA 2LDYA 3H6EA 3PXGa 3W5YA 5HRSA 3GSIA 5A8WB 5H1SQ 1RWMB 1KOHA 3AXMA 3SLCA 5ITHA 1VYAA 1U0SA 1LK5A 2PGCA 4FO0A 1X3NA 2MDAA 2X1FA 3X3UA 1FE4A 1PJ5A 1IBKK 2H9ZA 3MR3A 2CJAA 4YOTA 3WEEB 3DLKA 2DGVA 1URNA 2GUIA 3O4NA 2IRYA 4P2XA 1VQ6S 4KB0A 2IGIA 3E9PA 1KXPA 5ETSA 2UVVA 3R7BB 3QO9A 3CJKA 1U2CA 3C6TB 2EFPA 4NXMK 2FJVA 3RR7A 2ZE2A 2YI1A 2NUUG 2X74A 1SJFA 3KLIB 1NDCA 4X65K 3AVFA 3VQSA 2HFOA 2HVIA 3A8YA 3POTB 4CTAA 4JI3J 2VG7A 8ATCB 2V67A 3R9LA 2VB6A 3S6EA 2OTJS 3UKRA 2Z30B 4ICLA 2DNYA 2W9CA 4MLHA 5FROA 5A2QO 3H3NO 1G3OA 3A12A 2CWXA 3L2RA 3ZZZA 3CJ2A 2BANB 2OPQA 2YNIB 1N34F 1K1SA 3M6VA 4DQRA 4JKDA 3TU5A 1EB0A 5HLFA 1XMOJ 2MPUA 1XTZA 1HNXJ 4O55A 4Y0FA 1S72N 2ILZA 4J2DA 2JEIA 2PSZA 3E9LA 3ZSZA 5H9FJ 1IUJA 1UVMA 3I6PA 2ACMA 3OS0A 1S1UA 1JLCA 4AHVA 1I6JA 1FO1A 2FLNA 3U6FA 4G1QA 3A8IA 1B7FA 3DOLA 2LQBA 1RP5A 1FRJA 3THPA 3PYDA 1HD0A 4JB8B 1RAFB 5HANA 1NMDA 3BDPA 2MZQA 3PJWA 2GVZB 4DL4A 2E2QA 3V4IA 4LFCF 5ETVA 3AVBA 1WF2A 2XNQA 5AQRA 2FSJA 2IBKA 3VQ4A 3KLGA 1NEEA 3SBTA 3VN5A 4NMXA 3PO5A 2QIFA 4YR0A 3J7YU 1DT9A 5GADU 5KFCA 3OS1A 2W4CA 4KJIA 4FL9A 2JX2A 3GJQB 1N34J 1U7LA 3IM8A 3JS9A 2V2ZA 2HOEA 3LDOA 4I6MB 2DGWA 3LP2A 1JL1A 5DGAA 2MEWA 3MPDA 5SZTA 3ZCMA 2QL9B 2O4IA 5I3UB 3RWUA 2R4FA 3FRZA 3AT1B 3C15B 1WEZA 5BR8F 1UW9A 2AIRB 4CZKA 5D0RA 3KDNA 1W2IA 3GDQA 1N5TA 2UXDJ 3QETA 4B3TF 3V9WA 3NH2A 2XGQA 3DN9A 2UVUA 1P27B 4QIEA 3O5TB 2D0AA 2HVDA 4U95A 3MAHA 4ZP9A 4IO9Q 4FF2A 3O44A 2XM3A 3BF1A 4LFCJ 4JK9A 3M2RB 4IOBA 1FKPA 4KI4A 2GGPB 4CO5A 4C1NK 2UUWA 4KR0B 3BSAA 2NRRA 5GADI 3DOKB 3F9MA 2G9OA 1QSSA 2NRWA 3AXKA 1Y11A 2DT9A 1U8WA 2BMBA 1RAJA 5CYMB 2ZH6A 3NNCA 4NZ0A 3FBEA 5G0RA 5HP1B 3M2UA 2GX8A 1GNKA 1DURA 4M41A 1YBTA 3QNOA 3LANA 3P45B 5BR8J 3O1WA 3SSQA 1K6YA 1UEVA 5U47A 3G6EN 2BJ8A 2VPWB 4WFZA 1HBMA 3HHNB 3DYAB 3ZSYA 5AXMA 2V2VA 3NH1A 1ZBSA 3W2WB 3NNHA 3KLVA 5HVGA 2F3JA 3D7SB 4KHPF 1WC4A 4HCCA 4BRPA 2RQKA 3ZTRA 3GILA 3AOBA 4Y2KA 2HHHJ 4I1TA 1VRQC 4GRSA 4EBEA 4RR5A 2VD3A 4DL0C 5GAGU 1RISA 2P9IA 3HOTA 1K73O 4M3ZA 8RUCA 1OH5A 4DU7A 4ZOSA 2WB4A 3PW0A 4CHQA 3GQCA 3V6KA 1VJQA 3ET6A 2EG2A 1H2VZ 2EBGA 2WK4A 1AFIA 1HQUA 4HI2A 2BDPA 3HSZA 3KD5E 2FC9A 3CNQP 4WF9Q 3T9ZA 2R2RA 5F0WA 1RCXB 1E6VB 5LJ5Y 1N6QB 1RHJB 2EC2A 4FP9A 3VHQA 3QZ8A 3C66A 4LR7A 3ZFVA 2VFVA 1RTHB 4UZCA 2W7PA 4ZJQA 5GMEA 2YNHB 1X5TA 2K1RB 1NGHA 1RBOB 3MCAB 2OPPA 1NNDA 3WC0A 3JTNA 3SMZA 3E2EA 1JCEA 2R42A 4B3OA 2ZJPL 4XK8C 1XR7A 5GAGI 1NGEA 2W7OA 2CPIA 2FBVA 5RUBA 3MURP 4IFVA 4WCEL 3OYLA 1GTEA 2ZM6F 4BCAA 1BDGA 1O1WA 2IRUA 2ZWOA 5LSLA 2RS8A 4WJBA 4USTA 5D0GA 1SV5B 4LH4A 2GMHA 3KWGA 2Q31A 3PG9A 3WNEA 2QM1A 3JTOA 5CZ2A 3W60A 3BYPA 3DMJB 3I31A 3HP6A 1C6VA 1YBUA 3SQ0A 2WAQD 2BE7D 3Q8VA 4NYFA 5L1LA 2ZBCA 1YX2A 3KUGA 3IM9A 2B8QA 4HHUA 4XEIA 1PC4A 2DRDA 4W5NA 3L2VA 5AQGA 2VQFK 1S7HA 4QWBA 3D0PA 1BQMA 3T1YK 2IDLA 2W2NP 4M3WA 1KN6A 4BC5A 3SSRA 5LT5A 4URGA 2DH7A 1C1CB 5D3GA 2P9EA 4IR9A 3N4PA 4MIBA 2FVRA 4FJMA 4M8LA 1CZ9A 3GJRB 2V8PA 3G82B 5JUMA 2JJ4D 3TJ8A 4P2SA 5HAOA 3OVAA 2ZM6J 4RWWA 7AT1B 5GAEP 3N0VA 4JI7J 5KFEA 1Y7PA 4YHHF 2JEJA 1T9WA 3ITHA 4J9VA 4C8KA 1OH6A 1CS4B 1S10A 3MCSA 1F1BB 2NUBA 5J2MA 3MXHP 3J7ZT 2ZBIA 4KPYA 5EX5A 4F3MA 4OX6A 4DCOB 5DMRA 2HQ3A 2CZVC 3GU0A 1SAZA 2DGQA 4R5PA 4HVJA 1RK8A 4BRFA 3HTVA 3O08A 4O5FA 2JH3A 3Q86A 5K14A 4Z0UA 3HPGA 1C0UA 1KAXA 2AHOB 4YP3A 2WTFA 2QLFB 4EI2A 3MUVP 3O9SA 3N6LA 1FXXA 4DFMA 1BA1A 1ZA1B 4TU8A 2OPSA 4IR1A 4UW2A 1PKUA 2CZ4A 3OVSA 3KJQB 1JJCB 2EHGA 1RT6B 5ETKA 3Q8QB 4ISEA 1WNSA 3GP9A 1MU2A 2CPXA 1LWFB 1KRPA 5F8GA 5KFNA 1H72C 1O8BA 5EUHA 5KGXA 1FDDA 3FZKA 4L3NA 2KM8C 2E1PA 1TL3A 5F2RA 4WP8A 2BV3A 4YHHJ 4I6YA 4QR1A 3C65A 4B1YB 4CJ4A 4U7UD 1SXLA 3QBWA 5BYSA 4IZ9A 4CEEA 1UVJA 4NI2B 2CKWA 1I39A 4ANEA 1UETA 4LSNB 2Z1GA 4Y2MA 4J2AA 2V9KA 2XSJA 5C2GA 3OL6A 4WFBL 5CHCB 5DDOC 1QE1A 3CCJN 2DHAA 3KHRA 1OQ3A 5AQOA 3ZSWA 3OBYA 2DPJA 4F2SA 1Z2ZA 4ECTA 1B0TA 3KUEA 3EYZA 2WCXA 2UUCK 1XWLA 5CXTA 3SQGA 2HFUA 2HGLA 3D54A 3RBXA 1K8KA 3OTEA 4XPEA 2VIHA 4BRKA 3DI6B 2BQUA 2WFBA 2X78A 4UY85 1ZPWX 2GHVC 1HBOA 4DQQA 4CFDA 3BN4A 4B17A 3MECB 2LKZA 4ECRA 4FNIA 3I87A 5HRRA 2NZ4A 2DEJA 2ZH1A 1KSPA 2BZ2A 4H03B 2ETJA 2P9LA 4DV3F 1DRZA 1CJVB 4EK2A 4L73A 1R8PA 4BRQA 4U6PA 1S0NA 3EVWA 3D2WA 2BXJA 2IAJA 3ZZYA 4FWMA 1TUWA 4GVLA 1CLQA 1DTQB 5DM6Q 1JCFA 2IY5B 3MCMA 1IM6A 2MLZA 2HGMA 1TZ0A 4A8WA 4DU4A 4DDFA 4DV4K 1YJ7A 3GFYA 3NEKA 1VHFA 2WVBA 4NXNF 3M2VB 2VFSA 3C7NB 1NB2A 3Q2SC 3IAYA 4O0JA 1GXUA 1S1TB 1HLWA 1N33F 1NCLA 1OKJA 4WZQA 1WG5A 2VG5A 3KYLA 3TABA 3NP5A 1ZM9A 4Y1DA 2DGXA 1HPZB 2MKYA 2CJBA 3OPKA 4GVMA 5EHHA 2WHOA 2ZQBA 4X66K 4GC6A 3NS7B 1DTTB 3SQ1A 1FNOA 2OPRA 3JQKA 2WONB 1XNRK 3HT3A 2EKNA 2KXFA 2VV5A 3ZSRA 1N4LA 2DGUA 1V9OA 3O6QA 4BR2A 3GFHA 5LOQA 1NGFA 3PRBA 2AGPA 4N56A 2MXYA 4PG6A 5LSOA 3OBIA 3V6JA 3T1HF 2RDJA 1TELA 4NLTA 1H1VA 1TUYA 4L74A 1FDAA 1BL3A 1SUQA 3OYMA 4JP8A 2EI5A 1KVAA 3ZSQA 3GV8B 5A8KB 5D4LA 2CNOB 4DXLA 1S12A 3S41A 2HLUA 2G13A 3PLAA 4NXNJ 3M1VB 5E3RA 2YWKA 2QFIA 4M45A 4QPXA 3UCGA 1UAXA 3CD0A 1SB6A 1N33J 3Q8PB 2ASJA 4I9QA 3VTHA 4NRTA 4DV5J 1M5PC 5DZ6A 1X60A 4BQLA 3ZT4A 5HROB 2E2PA 5AZIB 5AFUA 1S6OA 1XNQK 4BE0A 3L2QA 4CD3A 3V81A 4NLPA 5ADXA 1XUPO 2E6LA 4RCHA 4JK8A 2BJDA 3O8WA 1X3MA 4DUZJ 4BRHA 1MWYA 3V2UC 3QWPA 2JL9A 4CIFA 5LMUF 1RACB 1V3ZA 3AVHA 4I9LA 3OL7A 1NSQA 3NF6A 1Z1ZA 3JYTA 2CQ0A 4U8YA 4TNOA 1S9EB 2KYZA 3T1HJ 2UVWA 2ZC3A 2Q0RA 2I0XA 3GMGA 2UXCK 4B9QA 3FZMA 3ZT1A 4H5WA 3MK6A 1JJ4A 1G7CB 4ILRA 3EX7B 1D5AA 5C25B 5GMDA 3NS6A 4BRCA 2AP1A 1CBKA 2VASA 2DPNA 5HO4A 1T3OA 4OI1A 2OTLS 2P9GA 4R0EA 2W1BA 4P7VA 4B1ZA 4HDGA 1GFWB 2Q79A 4K4WA 4K4SA 4CLUA 2F9DA 3D1HA 4FVCA 4B8CA 4BGBA 2HBQB 4E7IA 2HZCA 4AM6A 4BR4A 2ATQA 4DX8H 5AQJA 4BC4A 4QWDA 2GVDA 2HWTA 2A10A 1DZ5A 5DM7L 5EU7A 2EW9A 1H73A 1D4XA 5LMUJ 1UWBA 2Y8YA 3D6HB 2OP5A 2MKCA 4ZK7M 3IBCB 2C28A 3CF5Q 2CNKB 2FBTA 2OUGA 1KQGB 2HVEA 1RA7A 1XC3A 4LF8J 4DPTA 1YUWA 2IVOA 4M5IA 4H0VB 4KSEB 3L3CA 2YBVA 4CJTA 1UA0A 4DHYA 1FXLA 4FWPA 2PMWA 1BCOA 3QJLA 3ALYA 1LWCA 4ZCIA 3WNFA 2B4JA 2UVRA 4NCBA 4IUFA 1RAEB 3VETA 2I5JB 1UVIA 4DR1K 3MM8B 3CEDA 5AQMA 3OS2A 1WKKA 4BR5A 4FPAA 1IJJA 4A8YA 4HI1A 2U2FA 3DLRA 4FK0A 4IG3B 3G87A 1S79A 3AOCA 4DQ8A 5FRMA 4QWEA 2L9WA 2ZKUA 2FSKA 2F40A 3T5HA 2NRTA 3MCNA 3CCES 2WOMA 1AB8A 4DN9A 3VQPA 3T6JA 1PGZA 3U27A 4OYPA 5C7PA 3QEXA 1RHUB 4DUTA 4DU3A 3MR2A 1HLUA 3E8OA 4IJNA 2PDAA 2FJDB 3DLEA 2HFZA 1WSIA 3LGNA 5I3PA 2L9DA 4NX9A 3TTFA 4H54A 4YR2A 2A3ZA 1HNWJ 2UUAF 2HS0A 5L9XA 2QTDA 2I7NA 1TVRB 3IAS9 3R6GB 5A0YA 1DGKN 5BPMA 2R7QA 5C2DA 1B0PA 1HNVA 3ULDA 1BUPA 1T02A 1KFSA 4X2BA 4LVOP 4RWTA 4MLEA 1NJWA 3FEXB 4NYOA 5A6WA 5EX3A 3BGRA 4A8QA 1TTHB 3FR0A 4DLGA 1K47A 1GOCA 3UN3A 5IT9O 3L7PA 2RVJA 4USWA 3U3YA 4RKUC 3TA0A 1KP6A 1PG5B 3PZPA 1ITGA 1LCUA 1N0VC 3I9ZA 4FBUA 1G15A 1Q8KA 2XY8A 3M9OB 3OUYB 2MGZA 2KFYA 2QLJB 1VQSA 1JLGA 1L3SA 2N3LA 4CJRA 4ZLLA 4DV2J 1SKWA 3K0JA 1RUSA 4JV5F 2YHWA 3M30B 4UQGA 4F3TA 4CD1A 2GMLA 2RQMA 3PJ9A 4FJGA 1T05B 3AD9C 3W64A 3NY0A 1E4FT 3ILIA 3L4IA 3T6BA 3VPZA 4BRNA 1HR0K 4RU2A 1YXQA 1YZ6A 4WYWA 5F9NA 4U8VA 5LMNK 2V7ZA 1SC4B 3AA9A 2EVZA 2V63A 2IJNA 4C8LA 2D3OR 2V8HA 4ZN3A 4DR3K 4JN4A 4KTWA 4B9VA 4RW7A 5F8LA 3TQ1A 4JYAK 5DDRC 3MM9B 2JVRA 3RVCA 1XI1A 1YTYA 1TMJA 3B8AX 1K44A 2BRLA 2IMOA 5JMNA 3D28A 5B7WA 1MG7A 4JI5J 1QVFM 4JI6J 2CQ2A 3Q7CA 1KDNA 1ZBUA 2AWZA 4DUYK 2KG0A 4P2MA 3D5MA 3LDNA 5HMXA 3AB4B 2J0QD 2DCUB 1RHKB 2KH9A 3T3FA 4OGCA 5KGWA 3PIOQ 3JSMB 5JLFA 3PDNA 3SI6A 4ED5A 3OXFA 3SUOA 1HKCA 2V4JB 3N28A 4DPWA 1X4AA 2ZJQL 2LEBA 4H5RA 1RT4B 4DS5A 3U1MA 3KK3A 4DCHA 4A8SA 4I56A 3KHGA 3SJHA 4KGVB 1DLOA 4C98A 2FHKA 2BTFA 5E33A 3LOUA 3ULEB 3K8WA 3DAWA 2QWMA 4OX7A 2MHNA 3VAMA 4B3SF 4JKFA 1T0TV 4B9SA 4LQ3A 4HTUA 1GLEG 1ZPVA 3D2EB 2BM1A 2JLFA 4CLZA 2EEYA 3RB0A 3OYJA 3OTBA 4FM0A 3US5A 1J2VA 4NCGA 1U2VA 4OV1A 2LYVA 2ZF5O 4CRJA 4OGEA 3GV5B 1Q95G 1BA0A 4FF1A 2DHSA 2LP4A 2LEAA 4IOAQ 1Q78A 1RKJA 5M2UA 5KT2A 2ZOGA 4FWRA 1HYSA 4PABA 2YXLA 4ED7A 2M4MA 2O5DA 2YPYA 2BACA 5F3TA 4YR3A 4QAGA 3OR1A 1KC8T 4FWSA 4YB5A 4Y3CA 1TL1A 1J6ZA 4AHUA 1Y3KA 5KFIA 5BR9A 2O8EA 3SAFA 4XPCA 3UKUA 4CFAA 3NXZA 1HW9A 2XMKA 2W4PA 2VOPA 3AVJA 3F56A 1OSCA 1U48A 4LVNP 3HFKA 3QJPA 3MFIA 2PFFB 1S1WB 4WBFA 3GCXP 5K8PA 1Y9OA 2D7SA 3FJ2A 3DGPB 3QFHA 2HURA 4BWJA 2I6WA 4CO1A 4CGIA 1W0HA 4TY8A 2QSWA 2ZBQA 4PKDB 1GX6A 3RW7A 3PR4A 1R43A 2Z58B 1Q7LB 2Y8WA 2RS2A 1YJTA 3WEEA 4MFBA 1RDAA 1QY7A 2AJ2A 4D3GA 3LUYA 1N36F 5BRFA 2NXUA 1JCGA 1LAVA 3GOIA 2OD6A 1YG0A 4GKJK 5HATA 3C6TA 1QAYA 4GC7A 5LJ3Y 1QAIA 3RRKA 2RE1A 3P4UB 2GW8A 3TVYA 2V0NA 2FD2A 2IM1A 3POTA 4Z4FA 1XEZA 3T5LA 3ZLJA 4C8ZA 5AQHA 2ASPA 3VQTA 2C3MA 2B8PA 3OV7A 4NLWA 1YI2N 3GB0A 5T7BA 3L7UA 5IXUA 2BANA 2YNIA 1YF5L 1TK8A 1XMBA 3THTA 1PYTA 5KFUA 1M90T 1NKBA 4CLKA 2LECA 5J1EA 2CQ1A 1RDUA 5CD4H 3V1OA 3KLEB 2LEPA 1TL5A 2P9NA 3GIRA 4HT7A 1APSA 4OYMA 5IFMA 3CCMN 5IV4A 4B3TK 4NEZA 2L48A 4ISGA 3R3TA 2VCPA 2J9DE 1WKJA 1HMVA 1T3NA 1HQ2A 4DI6A 3IS9A 2UUTA 4H0YB 2KDOA 1VQNS 4RPFA 5MLCQ 4FJ9A 3GYGA 3PRVA 2YV0X 4MQ3A 4C3LA 1HJOA 3THXB 2ACYA 3AV9A 2YHBA 4KKOB 2QSFA 2E7XA 4P9SA 3V9ZA 4CM0A 3TUPA 1J5EF 1SJ3P 1B99A 4PXBA 4J9LA 4LIWA 1FWPA 1JXVA 3HHLB 3BZCA 1TKDA 3QT7A 5I9EB 4PXEA 2QZ8A 5AXNA 1YKWA 4WFAQ 1A9NB 2Q66A 2WW8A 4QR0A 3F41A 3MEEB 4ZPDA 1RAIB 2HQCA 3EGZA 3JSYA 2YQ3A 2DD8S 1F21A 3MUMP 1HBUB 2CVIA 4E7LA 4LUBA 2RD5C 1R59O 4QWAA 1OH8A 2OIHA 3TZXA 3M6XA 2PEHA 3FZ2A 3O4QA 4CH1A 5K8MA 1DEJA 1IBLJ 3IBWA 1LOTB 4M95A 3MEGB 1K9MT 3C15A 3VMFB 2BBEA 4EUVA 1FT8A 2NYHA 3JTPA 2DY4A 2F4VF 4KHPK 4UF4A 1CXUA 2R7OA 4K0KF 1IKWB 2EFVA 4MAKA 2CZ9A 4PHTX 1J5EJ 4I6AA 2C2NA 1O51A 2CNLB 1BOTO 3M2RA 1CQNA 1CC8A 2CQPA 1SH2A 3H3OB 5HQ8A 4NZ7A 3AO2A 5F0XA 4CFBA 1FXDA 4G1IA 1YAGA 2J0XA 3VQ7A 5JICA 1RT1B 1EQ0A 2P9KB 2VGNA 1N5QA 4NLUA 4AXIA 4CLTA 5CYMA 3UVJA 1WC0A 1GOAA 5KAKA 1ZS6A 3UO0A 2HF4A 3DXSX 2ZH8A 5DLGA 4DEZA 5DJBA 2Y9HA 1VQ5N 3QFPA 1VISA 1HPMA 4B3MK 3DOMB 1U1KA 3GG1A 3LP1B 1FVQA 2QLXA 2F4VJ 2F8MA 1WEYA 5EDWA 4LF9F 4WFNQ 4N7TA 2E7WA 3HSGA 3DYAA 2XY6A 1W97L 2VF3A 4XIUA 4FXVA 1FRIA 2FXUA 4NLCA 4ECQA 3W2WA 4FKYA 4ZVRB 3VEOA 1EQMA 3NMUA 2RDIA 2MTLA 1GMWD 2D9PA 1IV0A 3CCUN 3PCOB 4DL6A 4FWOA 4F3QA 3J81Y 3NBPB 4PKHA 4X62J 1HHTP 1SKRA 2VFUA 5IM0B 3WT0A 4YOEA 4MKVA 3A3OB 4QIVA 1EKRA 4FJ5A 3BGUA 4FM1A 4OYAA 5DG7A 2ERRA 4OJHA 3HSTB 5L1JA 2O66A 4CJWA 3QT6A 2EFQA 3TX8A 3BKTA 2J7WA 2DJWA 4XDDA 1Y4ZB 2HAIA 1UW4A 3HD1A 3R5GA 4OZ2A 2QT7A 3UI3A 5B0CA 3ASMA 1U6BA 4LF9J 2XMUA 1NK4A 3L3VA 4AXJA 4MT1A 3D67A 4WQ4C 4I64A 2D1KA 4KIAA 4H0PA 3VQEA 4IO9L 1OY8A 3E3XA 1HKGA 2HRYA 5CY4A 1E3MA 1E6VA 1N6QA 4ZHRB 4FJ7A 5E3CA 5E0OA 3P39A 4YDUC 2YNHA 2K1RA 1RT2B 1W26A 5A76A 1ESVA 2Y1LB 5BJRA 2RHKA 3PACA 2GAHC 4YB6A 2B3TB 4JD2B 2NSBA 1ZETA 1BHLA 4HTIA 2EWSA 3OYNA 1TFWA 4KFBB 1FXRA 1SV5A 2IYGA 1B9DA 1BQNB 4K25A 1WF0A 1H2TZ 2MY7A 1QUVA 4M7YA 3FCVA 1YVUA 5AE3A 4WK1A 4F26A 2P8IA 3SDEB 1VBKA 3RMDA 2CQIA 1SJRA 2E2OA 2ZH9A 5M1NA 2HQFA 3D66A 3N6MA 5A2QY 4L8RB 5IOLA 4PPDA 3WXKA 5GMKa 3HFVA 2DTUA 2C3UA 5AQFA 1C1CA 1D1UA 5CAAA 4I7FA 3P31A 1FJEB 3AO4A 3OLBA 2CPEA 2B6AB 5KT3A 3KHYA 1S9GB 1RDDA 1ZBFA 2POKA 1UA1A 1S1XA 1EP4B 2QA4G 5DO2A 4L76A 4CK2A 3VAJA 1JLEB 2UXBF 4F50A 4WIIA 4F4ZA 3CC7S 4DMNA 4ZPTR 1S59A 4DR6F 2Z1JA 1NBWA 3EWGA 4OPJA 5E2QA 2IA0A 1SH0A 2QWPA 3SJJA 3WUHA 3TAMA 1IR1A 3C6UB 4LFAK 3PX6A 4WF9L 4AHCA 3V9XA 4F25A 1B0VA 2OELA 2FVSA 3MZIA 2OZMA 1KLMB 3UR3C 3FEYB 5LM7E 1T9UA 3BF4A 2Q2RA 1L5UA 2KZZA 3MF5A 2ASDA 4M5GA 2XCAA 2NXJA 4FLYA 2LXIA 2FJAB 3CG7A 3U1NA 2YJFA 3M8SA 2XS7A 3V4MA 2F4FA 1VQ8N 3NF8A 3HM9A 1Q7YT 3L2UA 4KGZB 1R27B 4RW6A 3LF0A 3TJ9A 3K9JA 5KFQA 2FZCB 3OYFA 1WG1A 1VIXA 1D8ZA 4CJQA 4K4UA 4ZJLA 2YVSA 2V69A 4M94A 4Z2XA 4NYPA 3SYZA 2AEFA 1BIZA 4DV3K 1Q0NA 2V68A 2G8FA 1U02A 5HJXA 2ZHBA 1QM9A 2QMWA 3RMAA 1O6XA 1RWXB 4A48A 4NI2A 3S7RA 3SCLE 3TAEA 5IWAK 1WTFA 3I5BA 2VGMA 2X7IA 1I3AA 4CHPA 1HW8A 3IGVA 2ASMA 3DRXA 4NYNA 1U1LA 1WG4A 5F9LA 1N33K 4TQSA 1RHMB 1VQ7N 4CO0A 2IYIA 2NRXA 3IMQJ 4AILC 5KFJA 3L0QA 4PWDB 3MFHA 2HBMA 1DQ9A 3GBTA 3IBFB 3QMLA 3AAPA 4E1JA 2YKMB 5CYQA 4G6VB 5FLXY 2QYGA 1X7VA 2WSCC 1NKCA 3FCHA 2YHXA 2P6SA 4WQ4A 1NWKA 1M5OC 3DLGB 3DI6A 3DHXA 3UD4P 3OTOJ 1J53A 4WE1A 1RT5B 2CQBA 3NAHA 4ANCA 1CJTB 3RB4A 2YPZA 1HI0P 4JI2K 3AAQA 2RMLA 3G8QA 5K20B 2VQEF 1RTIB 3F44A 8AT1B 4GVEA 4H5NA 1H7XA 1VQKS 1NOYA 3KD1E 1X4GA 6AT1B 3TW0A 2V8VA 1LW0B 1HKAA 1NPPA 3QMQA 4WYLA 1XMQK 2VKZG 5M1QA 1PAUB 3CCSN 4GNIA 4F36A 3FBCA 2GWKA 4DV6F 3U1LA 1HKBA 4BR7A 4CECA 3KJVA 2PEBA 1U1MA 1HJRA 3M2VA 2RN2A 1YI2S 3C7NA 3W2VB 1S1TA 4YDDB 3AVKA 1RBRA 3TI0A 2EK6A 2VWJA 1D8YA 1IR2A 4FLTA 2FJXA 3O3LA 4RW4A 1HPZA 3EO3A 1OY6A 1REVB 4EFHA 2J6SA 1CVJA 2OA8A 2DNKA 1RE1B 3EVOA 3I0SB 2EKYA 4KO0B 2VWBA 2ZJRL 3N5BA 3TVKA 1N5YB 9ATCB 4OX9K 3M8PB 1U1NA 1BUXA 5F1XA 3AO3A 2DYAA 1NMEB 2VQEJ 3VQDA 1TMMA 3R7NB 1C0FA 3ENVA 4OIXA 4XH5A 2P5GA 4B9NA 3EM1A 3VQ6A 4CCHA 4JHDB 2J9DA 1YRUA 1P9QC 1SL2A 4MMOA 4DV6J 2HBJA 2IVNA 1QTMA 3KWIA 5AJ3J 4HHHA 2ZHAA 5KQ8A 2IC3A 2CVEA 2XHWA 2D0OA 3L9ZA 2KO1A 2YQ0A 1XQSC 2Q97A 4BE2A 2XZTB 3CDBA 4USVA 1CLFA 2GTDA 2QWOA 4ZJOA 3FGUA 4MKBA 2NXEA 5HVFA 4N5SA 1NK7A 4GKKK 1NOZA 1Y64A 1IBMF 1VQ4S 3P4IA 3BH6B 3OYIA 2QWLA 2UU9F 3L3UA 1PSDA 4CH7A 5HJYA 2V5HG 4A57A 5CZXA 4CJFA 4IBNA 5KRSA 3I0RB 1S9EA 4FZXC 3BQ1A 4CT8A 3H8YA 3KKFA 1ACMB 1FW6A 5DM6L 2MZSA 4R0JA 4HEA9 3CETA 4F4AA 3GG4A 5BRDA 3D3BJ 4OZNA 4Z37A 1RU2A 1UVNA 1PJ7A 4UQTA 2MSTA 5AQWA 3CIMA 5C25A 2HBLA 3NWGA 3UWTA 5C24B 4FLZA 5T14A 4RNNA 5FIIA 4BLGA 2IBOA 3IWLA 3GR0A 1Y3JA 5EX0A 2HHUA 2HHSA 2QC3A 4HACB 1FTRA 2XO7A 3CM6A 1YIJN 4NA3A 1ZBHA 3D1QA 4LF6F 4USMA 4PYAA 2MZJA 4RNHA 1JLBB 4B8AB 1WBBA 5B0DA 5AQTA 1VQ5S 2QEXS 2R7RA 1BY9A 1IBMJ 5H1SV 5JVHQ 2UU9J 4AL6A 3B6OA 4FCYA 3LQVA 3GIJA 2FZKB 4XH4A 3PKYA 4P52A 3DJCA 3TYTA 1RXOB 3J7YP 1RU1A 5LL6Z 5GADP 4K43A 2ALZA 4UT4A 1YT3A 1IG9A 4C0OC 1QZ5A 2DHHA 1C0MA 1EKSA 3TTCA 4URSA 4AD6A 4DMZA 3NGUA 5KFMA 2D5RA 1X31C 2O8BB 2PAVA 4Z7CA 3RYLA 3WZ0A 3ZZUA 2UUAK 2QWRA 1T44A 1BQXA 1T9VA 1KQSR 2AZ3A 3MN7A 4NZ6A 1I94F 4FXDA 2CPHA 1HA1A 2E29A 4C9DA 4LF6J 4PL8A 4TU9A 2QTWA 5HQMA 1HRHA 2W40A 1ZH5A 1U1RA 3QIDA 3MM8A 3NH0A 3LP0A 5ADZA 2HEKA 3HMJG 1CPZA 1C0GA 3K2PA 1ZTWA 2CGLA 2UUBF 3KHHA 2W2MP 1JLAB 2C3YA 3JAMY 2PIIA 2V50A 1S6UA 4WU3A 1ZBLA 4O4GB 2DFHA 1Z2LA 2MQPA 4FYWB 2KHCA 1YVFA 3MR7A 4DR7K 3TR8A 1H38A 3NOCA 1SVDA 4OZ3A 4NLYA 2NZCA 3UE2A 1OS5A 2LLZA 3ENBA 4JV5K 4I68A 1OYEA 3FFKB 2YX1A 3NG8A 2AW0A 2ZBPA 1YRXA 2GFFA 3I5CA 4JI1J 4O3OA 5K5MA 1FFGB 1I94J 2DFFA 1RCHA 4OKEA 3DHWC 4ZN1A 1CZBA 1SJQA 1AZSA 3DDKA 3CIZA 2R2TA 3TA2A 1I5OB 3CFPA 2C2OB 2B5JA 3PYFA 4BRIA 3M6UA 1NH8A 1OPZA 1TAQA 2UUBJ 2HFSA 1S76D 3D45A 4B9MA 3I4HX 2PE8A 3HF5A 3R5BA 3QGPA 3Q83A 1T03B 4XDCA 4X64F 1R8BA 5H9EK 3T5KA 2YNGA 2QX0A 3BSCA 3BBBA 3CMEN 4DL7A 2VDHA 1R6YA 3KG1A 3OTDA 5GAGP 2H4WB 1EARA 3SCXA 2N82B 3TNVA 4AL7A 1RWVB 1NDPA 2YKNB 1Q4RA 4M63C 3M8ZA 2XC9A 2W2QP 5THWA 3QICA 3RSEB 2PA3A 3IG1B 2KJWA 4EYIB 3OL8A 2O8FB 2MKJA 3WX4A 1GTHA 1G99A 4EP4A 3OVNA 4YUDA 2R2SA 2X1BA 3MD3A 3H45C 3S01A 2MLXA 3OUYA 1LQ9A 4EBCA 2KM8B 3P5JA 4WPAA 3BREA 3PHTA 5KFFA 1KTQA 4EP5A 4LJMA 3D0HE 4J9OA 3IRXB 3V1QA 3M30A 1C1AA 3FSXA 3PHEA 1T05A 3OHRA 1BHNA 4CO3A 4WFXA 3TANA 1BI4B 2ILYA 4DTXA 4U9RA 4B3SK 4DTOA 1NKEA 3QGGA 3CCRS 3DCAA 1IN0A 2V8GA 1G4CA 2D0BA 1Q82T 2VG6A 4X64J 1GLLO 2HFVA 1HNZF 3DXKB 2RUGA 5LSRA 3MM9A 2Z57B 2BE2A 3R8EA 1JJHA 5DDQC 5GAEU 3G10A 2W01A 2FVCA 1NJIT 1KONA 4JI8K 5L9NA 3MWBA 4Z4CA 2BKPA 3DLLL 1HI1A 1CEZA 1KBRA 3QLHA 2F8HA 1NGCA 4GY2B 2K2PA 2QFJA 3J81U 1N32K 3NCRA 1S6PB 4K4TA 3V5RA 3MTJA 4FJXA 2DISA 1L3UA 2Q6CA 2M88A 2C3PA 3JSMA 2ABYA 3MMCA 1YJNN 1F5CA 4PQUA 4ECXA 4I69A 1NZAA 4N77A 3A0IX 3CCLS 1D3WA 1Q8IA 1M90O 3VENA 2LXFA 4TN2A 2YKPA 4I6WA 2XEXA 4IEEA 2XI3A 2MY8A 2FDNA 2N4CA 1DY3A 2AQ4A 4AQYK 2M7SA 4DWIA 4RBVA 5KFZA 2PBDA 3K89A 3ULEA 3KK1B 2YH1A 4JKCA 2DNPA 3OFGA 3E01A 3O3FA 4MO4A 4QU7A 2G2YA 2JWLA 4A5AA 4O5BA 5GAEI 4DV0K 2IIRA 4V19S 4CYUA 3D2EA 3MHYA 3M3ZA 3MEKA 4IQXA 1NDKA 3RU0A 1AFJA 1UZHA 4B1WB 3KWMA 1X9JA 1LNQA 3C14B 1N36K 3HD2A 3EZWA 2QG9B 3VAGA 2OD4A 5DZ7A 2Y1RI 1CULB 3MMAB 3PIPQ 4KHUA 1WSVA 5J2NA 4LRCA 3H1QA 2GX9A 3ZTQA 4ER8A 2V7YA 5E3QA 4NLGA 3VR1A 1UMJA 4NPOA 3RRGA 2P9SA 1RDBA 2FLLA 1UFKA 3EUNA 4OYZA 3HI9A 1IQTA 2L41A 4IJAA 2MZRA 1P90A 4DOZA 2HVZA 3RAMA 1B4SA 4DJBA 5K9FA 1V4TA 1U0HA 1DJ0A 3A5LC 1FJGF 3D6FB 4CLFA 3QEVA 1ICEB 2LA6A 5A2QU 2UZAA 2OYQA 2GMJA 2MB0B 3OLAA 2AF6A 1X4FA 3MDQA 1EWRA 2LQ5A 2D3ZA 2FHOB 4MJKA 3CO9A 1S57A 3VGMA 1S1WA 1V3SA 5M1PA 4ANDA 3PIOL 2HMIB 2IJRA 3VQ5A 2VBYA 1T11A 1HNIA 1KFDA 1FWLA 4ECSA 3WBZA 4F4XA 3R1HA 1VDHA 4Z4GA 2DY1A 4IWVA 4LBHA 4C8OA 3M32B 1F5BA 3HVTB 2EFOA 5AXLA 4LF7J 2C2KB 1NJYA 3FKBA 3BYRA 2P9PA 4GV6A 4CBWA 4AF1A 3BEGB 4E1NA 1DAXA 1YBAA 1FJGJ 4DFJA 2MKHA 1VBXA 2MJUA 4ZIWA 4NLRA 3QFUA 3SMSA 3SUNA 1SQFA 1YSJA 1SKSA 1S7IA 2XWYA 4DR2F 4JKBA 4P74A 1RBAA 3KLEA 3R6LB 4UOHA 3HZEA 4QOTA 4CEBA 3UR0A 1WSHA 5CQGA 1XERA 2QLWA 4K0KK 3M4XA 1RBVA 1R8AA 3CPWR 2CDQA 1R0CB 3AQPA 4J2BA 4MKAA 5DDPC 3R97A 1VRTA 3R2DJ 4IDHA 1WEXA 4JKGA 2WUSA 4PA1A 4HTJA 3NGRA 1CZAN 1FJCA 5IT9Y 2VPZB 2E1YA 4K42A 4B9TA 3THXA 2E1RA 2C1EB 2O3DA 2AMCB 4KKOA 3O80A 5A8RA 3NCQA 4CJVA 3QO9B 3EL2A 1RTZA 1WD6A 3ETOA 3CJKB 3OR2A 2HBRB 1SL1A 4FF3A 4FJLA 2SXLA 2ZE2B 1JWWA 4KH4A 3PW7A 3D68A 4O23A 3AVMA 3HHLA 3BF3A 4KTQA 3TPQA 3EEQA 2V94A 4JV0A 3D2FA 4CTAB 4JLHA 3JS6A 4YQWA 4ED4A 1GQEA 5FLXU 4J8FA 3UKRB 2Q1NA 4DR2J 3ICLA 2VHGA 4V19X 4WKRA 2VPXB 4ICLB 3PFEA 1HBUA 3QT5A 4YB1P 1O0PA 1P1TA 3VGUA 4QU6A 4OYWA 4OHVA 4CI6A 2HHTA 2VFTA 3G9CA 1VCTA 5LXYA 3MEGA 5IZHA 4PRFA 5AFUH 4DSLA 1VHXA 5ADXH 4F0KA 3O4WA 1TYQA 2IJFA 2KN4A 1IKWA 4DG1A 1VQMS 1W25A 4RUAA 1IBKF 4PEOA 5KFHA 3J81O 1S1UB 1WI8A 3DOLB 3RZAA 4DR4J 1UL3A 2MQQA 4MK8A 3AO5A 1TL4A 3BO3A 4U7UK 4M1KA 4JI0K 2Y1JA 2P9KA 1NBEB 1AYEA 1RNHA 4QCLA 2CIMA 4BG9A 4KH5A 3GIIA 4FDFA 3KLGB 4X65F 2Z2LA 1JX4A 3CMAS 4R8UA 3GFXA 1V3RA 3G4SS 3LP2B 4G1PA 4FJKA 3DOMA 1XHZA 2YX4A 4BG8A 3O3HA 3LP1A 4FLUA 4F0MA 5IQ6A 3F2KA 5AQVA 3THYA 4ELVA 2B9YA 3HPOA 3AVLA 4X4NA 3UPFA 3EE3A 1PILA 2OAUA 1XMOF 1X4BA 1HNXF 1IBKJ 1UCNA 2B4PA 4AL5A 2VA3A 2BW7A 2X51A 2NRZA 2P51A 4WFAL 4RW9A 1KS2A 2E1AA 2FHJD 3SSSA 5KFOA 1KLNA 1RLCL 4FXWA 3CUNA 1S48A 2J9CA 2ZUAA 4E8UA 4EWTA 4KREA 1H74A 4NXMJ 1Q9XA 3TRGA 3DC2A 3M8WA 1FKPB 5IM0A 3PX0A 4JS4A 1CC7A 4X65J 4Q45A 2IS3A 4J37A 1VQ9N 3TWZA 3VGTA 1Q7YO 3C0BA 4X4OA 2BUNA 2EC0A 4WFYA 4DTMA 1Y5NB 3UN5A 2AEJA 2ZJPQ 3HDSA 1BO5O 4PG5A 1FTCA 3FEZA 3FQLA 3CERA 2NR0A 3MN5A 5G0RB 4KV8B 2RHSB 4Y2AA 3PV8A 1PYSB 4W5QA 3M2UB 3K7RA 3QAEA 1KKHA 1MMDA 2DBBA 3W61A 3PJXA 5KQDA 2FJEB 3H4DA 1KVJA 4USKA 3AODA 1Q8BA 4ZTJA 4NOHA 1HBMB 3J80Y 4PPZA 1T6DA 2ZC4A 3DU6A 5F8HA 1XIQA 3AVCA 1VQYA 1UFLA 1FVSA 2UXBK 4DU1A 2UXDF 4FYVB 5KI6A 1HWKA 3O9UA 2YH0A 3EGVA 4DR6K 3UD3P 1NM1A 2PA8D 4KB7A 3TX0A 2VODA 2CWKA 2DNNA 1RHQB 4KFBA 1JKHB 2GZOA 2A6MA 3JSRA 2BQ3A 1BQNA 1I51B 3LA0A 2GV9A 4W5TA 3CT9A 3RTVA 4QS8A 4FJNA 4H4KC 1YJ9N 2O8CA 2V9WA 2XLKA 2ADBA 3NS5A 1J54A 5HRNA 4WFNL 3DDIA 2A18A 3E51A 3RAQA 5BYQA 4N41A 3R3LA 3QWUA 1VOMA 1RT3A 2G2OA 4LREA 4A8OA 1LW2A 1VQON 4M5LA 1HQUB 3O1BA 1YHQN 1M1HA 3DRSA 4ILJA 4JUZA 5J2PB 1PJ6A 2OANA 4FM2A 4O3SA 2G8HA 1Y10A 2CPZA 2Q1LA 4FS1A 2DXFA 4RUHA 2HQGA 3MEDB 2QW9A 2M70A 2DO4A 4NEYA 3CJ9A 4PR6A 1FKOB 4JOUA 3H7HB 1EKEA 4FF4A 4B3OB 4RWXA 1KQKA 1OVYA 3D3CJ 3MR6A 4LF4K 1FCAA 2QXLA 4IFVB 4NLOA 3TOQA 2HHHF 2XO6A 5LXRA 1BWFO 4OJ1A 2AP6A 3CJ5A 2CJQA 3ZZRA 3I8BA 4CJ7A 2QMXA 3KTQA 2YNFB 4Y2CA 3C6UA 4GW6A 2PY5A 3QFWA 2DH9A 2YQ1A 1SJ4P 3JAMU 1A5XA 4FW2A 4EMDA 3ENQA 2L3MA 5DG9A 1KEKA 3TVZA 5FLXO 1SPBP 3FC9A 2E5GA 5IT4A 4ED1A 3MMVA 2WBNA 4IH5A 2AYEA 3CJSA 3BPSP 3G96A 4ELUA 3VALA 3VERA 1U04A 2NS1B 2QJ3A 3V6DA 1QDUB 3ISND 3QSYB 5KT5A 1W2BR 3CJQA 2HS4A 3FGVA 2C2DA 2KFZA 1GT8A 2GQ2A 4FBTA 1CSJA 1EZZB 1BQMB 4H4MA 4NRUA 3G71N 2DCLA 3EDRB 4G3IA 3PKMA 3H46O 2DHGA 4DSFA 5D3GB 2YCHA 7FD1A 3NWRA 2RJZA 2X6NA 2KXHA 3LM9A 4WWSA 4ERDA 3LH2S 4FYXB 3IR7B 1NU0A 5GAHU 5I42A 4NA1A 3ITHB 3HYFA 3GJSB 2VBXA 1HX1A 5J2MB 1XK8A 2G4BA 1NRKA 4I4BA 5L1KA 3VAIA 2HFNA 3F73A 2ROPA 1V4SA 4NB4A 3OXLA 3R5CA 2HMPA 4I2QA 2XMVA 3AO1A 3DRPA 5HQLA 2B51A 3FQKA 1ZAWA 4X4TA 2JDJA 2LCWA 4PWDA 2XYGB 4DQSA 2WC9A 3SEOA 3H5UA 4JRPA 4LFBF 1RBSA 4YOYA 4LBPA 1NPRA 2QGFB 2OEMA 4B1VA 3ZEUA 4IOCQ 2HNDA 1C0UB 1JB0C 4CLPA 4NASA 4FPRA 1U24A 1K73T 4EZ6A 3MM5A 3BSNA 2CJKA 2P5VA 4K2JA 3V9UA 4KHYA 4CGJA 2FBYA 2XRIA 1L3VA 3HVAA 2DNQA 1MU2B 2VQFF 4KI6A 2ZWPA 4FJIA 4P7TA 1RT5A 2BA9A 4DSKA 4LBIA 1QS4A 3NKYA 2NYIA 1CJTA 3KZBA 1VBYA 2RU9A 1HQEA 2FUG9 5GAHI 2XLJA 2ZZNA 2FBXA 4BC2A 3J7AP 3C3LA 3R1LA 3H25A 3HJFA 2W6KA 3J8AA 1ILYA 5JS2A 3HK2A 2DK2A 4JI7F 4UOCA 3MMBA 1MA9B 1UJ5A 3FMWA 3SPZA 2JC0A 1RWUA 3IA0A 4WTYA 1MDUB 3TSPA 2XMJA 4CEFA 4LFBJ 2FLPA 3Q8YA 2G8VA 3DWLA 3W2VA 3M1FA 2BRKA 2LA4A 4Y1CA 4CZHA 3VF2A 2UU9K 3A8EA 3CO0P 4K5RA 3CQ8A 2B4UA 2Y1IA 1UEUA 2W7AA 1WN7A 2VQFJ 3SQGB 4C7QA 4KO0A 2EXUA 1LK7A 2W8LA 4NLQA 1K8KB 3T1YJ 4CEOA 3G2XA 1FDNA 1AW0A 4BACA 2A1RA 5C10A 3Q2TC 4ZIVA 1VSLA 3ATVA 1QVGM 1RT7B 4CZFA 2GEMA 4E89A 2HIQA 5F3ZA 2E5JA 4JHDA 1H0HB 3HI0A 3C2PA 2CQ4A 4C0HA 3K5PA 2O1PA 4LQ9A 4DR5K 3UDVA 1RLDA 3FFIA 2V2KA 2P9LB 4I67A 1RDCA 4YDXA 2V4QA 3EZ5A 2VU5A 5K8NA 4K4YA 4L3QA 3KLFA 2ITGA 4PWUA 3TUIC 4X4SA 2WVEA 1ASVA 5AQYA 1Q1KA 4YFUA 2KYXA 2R9LA 1F9HA 1O13A 2CPFA 2N4DA 4RBTA 2XCPA 5AQUA 1HWIA 2E88A 1GXLA 5CYJA 3D7EO 3AVIA 3BO2A 2UV8A 1WC1A 4DPXA 2WVDA 4DQPA 2VG5B 4ES2A 3CCVS 4LT6A 4ZKAA 3PTWA 2J6TA 3X1LB 1FRXA 2FGOA 2YTCA 3OY9A 4RO0A 2D41A 2GV1A 2A42A 4KY3A 5C2FA 1J9AA 3QGHA 1YITS 2HNZA 4CZCA 4Q5VA 2AYGA 4PZVA 3U4LA 2HSEB 2NZTA 4FS2A