1JLBA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
554
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 148
structure length 549
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlbA05
3H5XA 2X6SA 1RT1A 4FZZA 1TL3A 1C0UB 2NUBA 2R8GA 3GYNA 4KTQA 1VK0A 3MEEA 3DLGB 4DSKA 4CJSA 4H4OB 5FROA 3LP0B 5DQHA 2BE2A 2RN2A 3EPIA 3PW0A 3IGNA 3TAFA 5FRMA 1BQMA 3QLHA 3V1QA 3OYDA 3OY9A 3AVNA 1BI4B 5T14A 3QESA 1JLQB 3V81A 3UDLA 3HP9A 3G6XA 4UQGA 4KFBB 4NLDA 2HHUA 3S9HA 3M8PB 4RW7B 3QYYA 4X2BA 2XHBA 3NF7A 1C1BA 4YFUA 1BISA 1FKPA 5FDLB 1HQEB 1VSJA 4CJ5A 4RW6B 3MAQA 1QS4A 4PA1A 5HROB 1JXBA 3VA0A 4YR3A 1RBSA 1JLAA 1RTIB 2HNYA 4K4SA 3FQLA 3RMBA 4OLAA 2XCAA 3RB6A 3L3VA 2FBTA 3KLFA 2HMIB 2B4JA 3I5CA 2E6LA 1RTJB 2I5JA 2YNFB 1QUVA 4HUEA 3HK2A 3NDKA 1DTTA 4F4XA 3PZPA 4TYAA 2BANA 3IG1A 5KG1A 3HL8A 3LPTA 4HVJA 4FVMA 4CJLA 4FLUA 1TKXA 3DRSB 1TV6A 2ASJA 3VQ5A 5KFDA 1FKOA 5KRTA 4BWMA 4DEZA 2ALZA 1B9DA 4ZTFA 4G1QB 1KLMB 3PX6A 3C6UA 4URGA 1D1UA 4JV2A 3TAMA 1FXXA 4B9LA 3V4IA 4FK2A 2AQ4A 1HRHA 2KZMA 1ITGA 3MEGB 4NYZA 1XR6A 4LH5A 2W7PA 1C0MA 3KHLA 3NF9A 2V4QA 4I9QA 1BQMB 3GIIA 4IG3B 4FM1A 3UIQA 3TANA 1XR5A 4ZPBA 2VWKA 2IGIA 3U3YA 5KFHA 1J5OA 1S0NA 4WE1B 3OHAA 2VG7A 2YNGA 4DQPA 4XPCA 1L3UA 1T05A 3SV4A 1RNHA 1VRUA 1IKYA 1D0EA 1JX4A 3HVRA 3OYBA 2XC9A 2BRKA 5FRNA 3GIKA 3ZSZA 4CIGA 5CZ2A 3DYAB 4RNOA 4HUFA 4J9PA 4DG1B 3EYZA 3KHHA 1FKPB 1S1TB 4JLHA 1TKZB 3S3OA 1TKDA 4TY9A 1B9FA 2ASDA 1JLEB 2IA6A 3IN5A 4J9NA 4QWBA 3L2UA 1WSFA 3AO1A 5F8NA 1IKVB 1U04A 4N41A 3GQCA 4ECZA 3QETA 3MEDA 3T5KA 5J2NA 2P51A 3I8DA 5C5JA 4LSLA 4IR1A 4EYHB 1NJYA 3NGIA 3TWHA 1CXUA 1YT3A 5HLFA 1ZBUA 3SPYA 2ATQA 3O3FA 2WRMA 2BANB 4KTWA 3KLHA 3SNNA 3MFHA 3QIPB 2DFFA 4ED3A 4NLQA 4DTOA 4FLXA 1RA6A 4MFBB 4M3TA 3V6JA 1UWBB 4F50A 3QINA 1HMVB 4F2RA 3V6DA 4CGFA 4FK4A 5JS1A 2R2UA 3U3GA 5DLGA 4KKOB 1TL1A 3ZT4A 3HM9A 3G86A 2HVHA 4Q0BB 4J2DA 1TVRA 3CJ3A 4B9UA 5EUHA 1N5YA 3QEVA 4FM0A 2B6AA 1N56A 4CHOA 5DG9A 4FJMA 2IC3A 3RB4A 1KRPA 2YHBA 4AHUA 1KSPA 4LD0A 5KFEA 4KHQA 2OYQA 2OPQA 1RT6B 4OLBA 2C2DA 3H5YA 1SV5B 4I2QA 3DM2B 3BQ0A 2E4LA 4OVLA 3DMJB 2Z1JA 2W9AA 2YNGB 1NOZA 1HPZA 2O5DA 2V9WA 2BQRA 2G8IA 5F8MA 4FLTA 4WFYA 3OHBA 1NK9A 4KI4A 4FJNA 3SZ2A 3NH2A 2JEJA 4JRPA 3ASMA 1RBTA 2HW3A 4CEFA 2X78A 3LWMA 4HTUA 1VRTB 3RB0A 2EC0A 1SH2A 3LP2B 2E9ZA 4Y34A 1C1CA 2D3UA 2B5JA 2FVRA 4ED7A 3FDSA 1NK4A 1QHTA 4CGHA 4HYKA 4CEDA 3BJYA 3KLGA 2JC0A 3L2WA 2WB4A 4LH4A 4TYBA 4M95A 4O4RA 4Y1DA 4B8AB 4RW9B 3KHGA 3HVTB 1XHXA 3QNNA 4Z4EA 1LW0A 3CDWA 4YR0A 5I3UB 5HRRA 3FFIA 3QGHA 1UA1A 3SQ4A 2A1RA 5I42B 3GV8B 1Q9XA 4QAGA 1W0HA 4KHYA 4RW8A 1N6QA 3O4NA 3TABA 3V6DB 2O4IA 2KFNA 3H5UA 4NLYA 5EDWA 4CJKA 4DF4A 4W5TA 4AHCA 1TVRB 2IOCA 1RYRA 2IAJB 5K14A 1LAWA 4IDKB 3NH0A 1D8YA 4FLVA 1KFDA 2R7YA 4K4XA 4WXWA 3AA2A 1J54A 2G8KA 4DS4A 4H8KA 4ICLA 4IKAA 2GBZA 3AVCA 3NKYA 3GV7B 1R0AA 1QE1A 1RTDB 3AA5X 4N5SA 1D9DA 2W9CA 2RDJA 3T5JA 3NMAA 4H4OA 1RDRA 3ITHB 3QGGA 5KFUA 4B08A 2ZD1A 3CG7A 3P83D 4CJFA 1Z25A 3NGDA 1XC9A 5C42B 4DL4A 3JSMA 2G8FA 2E9RX 4ZP6A 2B5JB 4B3OB 4B9VA 2QK9A 3KLIA 2F8EX 4CFDA 2IDOA 4ECRA 4NLGA 1JLCA 1QAJA 1NHVA 3OYKA 4K4ZA 2Z1GA 2R2RA 4RW7A 2VG5A 3KKSA 3RMDA 1S6QA 2G8WA 1JL2A 4WXOA 3KLEB 4RW6A 1EP4A 2V4RA 2D0CA 3PR4A 5KT6A 5KFAA 2HVIA 4ZP9A 3PJXA 4MK9A 5KG6A 2UVVA 4MIAA 1SUQB 4EO8A 3MR3A 4TQRA 1KCFA 3DOKA 1WAJA 3QO9B 3WNHA 4URSA 4ID5B 4ECXA 4DTNA 4RG8A 3OJUA 1S1WA 4NLWA 5KFVA 1DLOB 4QWAA 5KFWA 1RTJA 4JS5A 3VQ6A 1YVFA 5JS2A 5KT5A 4CEBA 4KBIA 2DPJA 1IM4A 4EBCA 2DPIA 4OJRA 4M94A 5C24A 3PUFA 1TK5A 3I0SB 2OPPA 1SH0A 3L2QA 5DGBA 4BE1A 4IFVA 1FKOB 3PW4A 4OKEA 2EX3A 1S4FA 1JLBA 1EXQA 1S9GA 4FW1A 4G1QA 1JLFA 2XRIA 3ZSOA 4GC7A 2UVWA 5CY4A 1RCHA 1EETB 3K57A 4ZPCA 4KTZA 4ZP8A 3MEGA 4IG0B 1B92A 1MU2B 5HP1A 4ED0A 2KQ2A 2ZD1B 3SQ2A 4CGDA 2YV0X 2O4GA 1JLGA 2XCPA 2F8TA 1WNSA 3AVGA 4ZVGA 1BGXT 1I6JA 3KK1A 2FLPA 2W9BB 3V9XA 4WE1A 3G6VA 3VA3A 4CJ3A 2X74A 4CF8A 4WYLA 2IM3A 4E7JA 3E01A 3AVIA 3DI6B 4DQQA 3KK3A 3RR8A 1S1VA 1VSDA 4RNMA 2VG5B 3HVWA 5EWGA 1S6QB 4NCGB 3NE6A 5DQGA 4KV8A 5J2QA 1XI1A 4DSJA 2R2SA 4B9MA 4DFPA 4HCCA 4RNNA 3P5JA 2D0BA 4DS5A 4NCBA 2OZMA 2YNHB 5EWEA 4KO0A 1T03A 1VSEA 3OYGA 2YKNB 5KFMA 4EBEA 3G0ZA 2OZSA 1A5WA 2AGOA 4CK1A 3DOKB 4KHNA 2RKIA 4NLOA 3HO1A 1RT5B 5KRSA 4LSLB 3DLEA 3CJ2A 4CF9A 4DL2A 4U6PA 1QQCA 3TI0A 2C28A 5DG8A 5F9LA 1FK9A 3OYLA 4NLXA 4YNQA 3RMCA 5C24B 1LW2B 1I39A 3ZSRA 4KPYA 3AVAA 3T3FA 4YQWA 4EYIB 4OGCA 4KB1A 2FJWA 3IAYA 5KGXA 2Y1JA 4CK2A 4O3QA 5KG2A 2ETJA 3BQ1A 2JC1A 4KAZA 4FYDA 3O3HA 1RILA 2C22A 2J6SA 3MR2A 1KVCA 3MEEB 1HYZA 2J6UA 1IKWA 4CJ4A 1SL1A 3OVNA 2IC3B 3DOLA 1QSLA 1J53A 3QLHB 3TARA 3VQEA 3QZ7A 1KTQA 5J2MB 3LAMA 1RT3A 4DTMA 3KK1B 4DU4A 3QEPA 3DM2A 2HNDA 3DMJA 1WSHA 2ATLA 3BREA 4CEEA 3BGRB 4ZHRB 2W7OA 1S5JA 2WOMA 3I0RB 2FBXA 3S3MA 4ZVFA 1S9EA 2P5GA 5DK5A 4JV0A 2ZKUA 3KK3B 1RT7A 4I9LA 3ZT3A 5KFGA 3EPGA 4NYFA 4C8OA 2RDIA 4GW6A 2E9TA 1HQEA 4MH8A 4E7IA 5D3GB 4OKJA 4O3PA 3JYTB 2YNIB 4E1NA 2YNHA 4Z4HA 4CJWA 4TLRA 5KFJA 3SUQA 2YKNA 3AVMA 3RRGA 1JLAB 3N6MA 4W5NA 5KFTA 1ZBHA 3SYZA 4FS1A 4KHUA 4CIFA 5DMRA 3T19A 3ALYA 5KFOA 3DRPB 1XHZA 4IKFA 3QZ8A 3DRRA 2OPSB 1JXLA 1CLQA 3Q8PB 2BQ3A 2Z1IA 1NJWA 5I3UA 1DTTB 3TAGA 3C6TB 4PQUB 1FK9B 1KFSA 3IRXB 3V9WA 4DQIA 5HBMB 3B6OA 1VSIA 2F96A 5HRPA 1HYSA 4QWEA 3U6FA 3PVXA 3GIMA 1RA7A 4AHVA 1QAIA 4CJQA 1N6QB 1QSYA 1S6PA 4BDPA 2F8SA 2IBKA 1ASVA 4QW8A 4J9SA 5KG3A 3EZ5A 2IS3A 1RBVA 3V6HA 4Q8EA 3RWUA 4IQXA 5K14B 1KHWA 3Q8QB 1S48A 4CGJA 1J9AA 4DU1A 3HJFA 1HQUB 3DOLB 1KHVA 3OSNA 4CESA 4ICLB 4IG3A 4Z0UA 5CYMB 3OYCA 4AH9A 1RT3B 4FJKA 3KD1E 3PX0A 2B43A 4DSEA 4ECSA 4CJPA 3AVHA 3AO2A 2UUWA 5KT4A 3BGRA 4ZHRA 5KG5A 4IBNA 4FJJA 2JEFA 1OS5A 3OL7A 4M3WA 3CIZA 3K5LA 3KKRA 3KMQA 3QEXA 3DYAA 1WN7A 3KK2B 4URQU 5KFFA 4CECA 3OL9A 2AX1A 3KJVB 4TY8A 3NL0A 4CF1A 3O3GA 1IO2A 1VSKA 3ULDA 1HNIA 1UOCA 3HKWA 4DTJA 4F8RA 3PR5B 4DTXA 2VWJA 4J9RA 3O4QA 3ZT0A 2CJQA 1C2PA 2R2TA 2UVUA 2FVSA 3AO5A 3LDSA 3H5SA 5L1LA 2BR0A 3DRPA 1U49A 3MEDB 4HCBA 2WK4A 4K50A 2G8VA 2LSNA 4B9SA 3OYNA 5CYQB 1RT2B 3M9NB 3F73A 4FJLA 1TKTB 3KLEA 4I7FB 4ID1A 4J9QA 1Q8IA 5C25A 3IRXA 3KLHB 4QW9A 1DTQB 4DSFA 4MFBA 1LV5A 1HYSB 3AA4A 4JUZA 2HNZB 1HMVA 1S6PB 1Z4UA 5J1EB 5SWMA 2VA2A 3N6LA 3M8QB 4Q5VA 2FC0A 5KG7A 3OYFA 3MECA 4IH5A 2OPRA 5KFIA 4Z4GA 3BSCA 4MK7A 4U7CA 3Q8SB 4DFJA 4IFYA 2FJVA 2WONB 4DMNA 3K2PA 3MXJA 2B6AB 1RBUA 4DWIA 1IG9A 4XPEA 3TR8A 3GIJA 2OH2A 4E7HA 5F9NA 3V1OA 4IFVB 1EKEA 2XI2A 2OPQB 3SFGA 1O1WA 3QIOA 5HRSA 2YKMA 3HYFA 1NK7A 4I2QB 2R8IA 4LSNB 2IJNA 3MF5A 3M8SA 1C0UA 2HAIA 3OS0A 1GOCA 5EWFA 3CM5A 1HPZB 3DLGA 4KFBA 4FK0A 4MKBA 3SI8A 4AHTA 3MR5A 5KG0A 1MU2A 5F8HA 1SKSA 4FJ8A 3MXIA 4W5RA 3MXMA 1VSLA 2HHQA 1D5AA 3VQDA 1VRTA 4E7LA 4J9OA 5KFPA 5HROA 4NCAA 3CQ8A 4RNFA 1N48A 2Z1HA 2HNYB 3LP3A 4ED1A 2UUTA 3OJSA 2UVRA 3M8PA 5KFQA 2FVCA 3BDPA 3HVTA 1GOBA 1U47A 4TN2A 3DLKA 4Y2AA 1WSJA 4EBDA 1WNEA 3L2RA 4GMJB 1C1BB 4NLVA 2YNFA 3WNFA 4BDYA 5J2QB 3V9SA 1L3TA 1S49A 3ZSVA 1ZTTA 5C25B 4F2SA 1RT4B 4RW8B 2FBYA 2FLLA 3CJ0A 3EZUA 4RU9A 3PW7A 2HNZA 2RKIB 1TV6B 3LP1B 4FLWA 2WHOA 2V0NA 4CJEA 3T5LA 3V6KA 3ZT1A 2GC8A 4FZXC 3VQ4A 3P1GA 1ZBLA 1LWEB 2P5OA 3C6UB 1X9SA 4ZVHA 3MECB 4ELUA 3TAMB 4O3OA 4FJXA 3VN5A 3LAKA 4IFYB 3CVKA 1CSJA 3OL8A 3IS9A 3CM6A 2XY8A 4O44A 1VSFA 4DLEA 1ASUA 3NAIA 1TKXB 5KI6A 3DRSA 4RZRA 5L1KA 1BCOA 3LALA 3RAQA 4F4ZA 3T5HA 3HPHA 3LANA 1ASWA 4M42A 4LQ3A 1S0MA 3L2VA 2HHTA 4FCYA 4O5BA 1LWCA 2XWYA 1GX6A 4W5OA 4FJ7A 3RB3A 5KFKA 3NGZA 2A1SA 5JUMA 4CJTA 4E89A 4Q43A 4DG1A 5KT3A 2G8HA 3CDUA 3OLAA 3KMSA 1JKHA 1TKZA 4O4GA 1LWFB 4E19A 2AJQA 1HNVA 1JLEA 1RDCA 1S1UA 4BACA 2HNDB 2PYLA 1RTHB 4K4VA 2VG7B 1ZBFA 3SUPA 3TAEA 1JLCB 4ELTA 4O3RA 3AA3A 4CJVA 1NKCA 1IKVA 1IKYB 4M3ZA 4BDZA 2J6TA 3HXMA 3NAHA 3DLKB 3ZT2A 3K58A 3OSPA 1JL1A 1S1TA 5D3GA 3CO9A 3NF6A 5HLFB 2P1JA 2FVPA 2HHVA 3VQ7A 1BIUA 5KTQA 3LWLA 3CJ5A 4ED2A 1REVA 2ZE2B 4K8XA 1UWBA 1KVBA 1S1XA 3KTQA 4B8CA 3ZSWA 2E6MA 4IH6A 3LP1A 4ID5A 2QKKA 2C2RA 3QERA 2OPSA 1W9HA 3SCXA 1Y97A 3PO5A 4KKOA 3KOAA 3VQSA 1NK0A 4BE0A 1L3VA 4PUOA 4NLRA 3IS9B 4WZMA 4FJHA 4Q44A 4M3YA 5KT7A 4O44B 3HPOA 4CFCA 4CGIA 3UR0A 2AWZA 4RW4B 1NK8A 2OPPB 1NK5A 4DL7A 3SV3A 2IM0A 5F8LA 4B9NA 3NFAA 3LZJA 1SH3A 2KTQA 3E51A 1BIZA 1JLBB 1RT6A 4NLPA 3SUNA 1SV5A 4CF0A 3THVA 4CEAA 4B9TA 4TSXA 1TL1B 1TL3B 2HHSA 1TP7A 2XGPA 3ZCMA 4L8RB 3KNAA 3QGIA 4QCLA 1EETA 1GX5A 5F8GA 1RDAA 1N5YB 3IGVA 4ECUA 3K5MA 5KFZA 4NZ0A 4DSLA 3A2FA 4FLYA 4ED8A 3SFUA 4O4GB 3S3NA 1ZBIA 5CYMA 4EP4A 4FBUA 1WAFA 4F3TA 1BI4A 4J9KA 2W9BA 4M45A 3OYJA 5KT2A 1RTHA 3HHKA 4C8LA 4F4KA 1RAJA 4E1MA 4W5QA 4CK3A 4FM2A 2JLEA 3DI6A 2VA3A 5F8JA 3H4DA 2YHAA 3VQ8A 4K4WA 2BRLA 3KJVA 4KV8B 4TY8B 3GILA 2JGUA 1HNIB 4WFXA 3FSIA 1BCMA 1RDBA 2GIRA 4DSIA 1REVB 2ZE2A 3KLGB 2ILYA 1RTIA 1CXQA 3VQCA 3QNOA 3PV8A 3FQKA 2KZZA 2VG6B 1U48A 2KFZA 3VQAA 3ISND 4KHMA 1LW0B 4N76A 3NBPB 1RT2A 3PO4A 1S10A 3TQ1A 2RPIA 3SUOA 3FFIB 3K5OA 4M3UA 3SQ0A 4MK8A 2IAJA 4WZQA 5I42A 3TAQA 4ECVA 1LW2A 3CWJA 3RR7A 4RNHA 3SJJA 4QWCA 3HT3A 4ELVA 3D5MA 4ZPDA 1ZTWA 4FBTA 1NK6A 4DQRA 2PYJA 3HVAA 4KB0A 2FJXA 5J1EA 1N4LA 4OGEA 1A5VA 3AV9A 1YTAA 2XY7A 2D7SA 2BDPA 2HB5A 4DTRA 3RTVA 1MMLA 2QV6A 4Y2CA 3V4IB 3VQQA 4QOZB 3ITHA 4IDKA 4FXDA 1X9MA 4M3XA 1IKWB 4I2PA 3WNGA 4FJGA 3NHGA 1HYVA 3ZSXA 4Q8FA 3G6YA 4JRQA 4DU3A 3OL6A 1BL3A 4B3OA 1R0AB 1J5OB 4LSNA 4K4YA 3VQBA 5L1IA 4FLZA 1RDDA 4OPKA 4M41A 2CKWA 2WOMB 5E41A 4CIEA 1VRUB 3AVFA 3V1RA 4Q45A 3BQ2A 3TAPA 4CEZA 1SKWA 3DDKA 4EZ6A 2R8KA 4TQSA 5KFYA 2QE5A 1ZYQA 5C42A 4MQ3A 3DLRA 4FW2A 2YNIA 2DFHA 2D41A 3OLBA 1C0TB 3KHRA 2QXFA 4J2BA 4KHWA 4Y3CA 3N6NA 3H40A 1WSIA 2DFEA 3VQPA 1T94A 3QO9A 4ECYA 2AGQA 3DLBA 1NNDA 1NJXA 5T7BA 3DRRB 1S97A 5CZ1A 1T3NA 3DLHA 1Q9YA 3AVJA 3NGYA 5J2NB 4NLUA 5KG4A 1S1WB 3EY1A 2I1RA 4YR2A 1DLOA 4IOBA 4CGGA 1L3SA 4AHRA 1Z26A 3PX4A 4Z4CA 5F8IA 4Y1CA 1BQNB 3BSOA 2AX0A 2HWIA 3SQ1A 3UQSA 4F4WA 4G3IA 3PY8A 3SPZA 1SUQA 3QIPA 4TXSA 4EZ9A 1TGOA 2GIQA 2IM2A 4DTUA 3QEIA 1K1QA 1KVAA 1U45A 2RF2B 4WYWA 4KB7A 3RMAA 4E0DA 4IH7A 3AVKA 4MIBA 1IKXA 4FJ9A 3RAXA 4ZMMA 4LQ9A 1NOYA 4PWDA 4Q0BA 1SL2A 3LP0A 4Z4FA 2BE2B 4YP3A 4DQSA 5HP1B 1TAQA 3PJWA 3HP6A 4CFAA 2GUIA 3AO4A 3QEWA 1JLGB 4H4MA 4R8UB 3MFIA 1S9GB 2X6NA 4ZPAA 2IMWP 5EU7A 3CJ4A 1JLQA 1L5UA 4CJUA 4O3SA 4F3OA 4C8MA 1JIHA 5KGWA 2HHWA 1EX4A 4CHPA 3KK2A 1T7PA 4CEQA 4HHTA 1JKHB 4N47A 1LWFA 3LP2A 5KFBA 4R5PB 3LPUA 1CZ9A 5HRNA 3RBDA 3CFOA 1C0TA 3K59A 2PZSA 4KO0B 1T03B 5DLFA 4F4YA 3ZSYA 3QIDA 4NRUA 1T8EA 2W8LA 3SI6A 2ILZA 5JXSA 3KLVA 4OL8A 4PY5A 1A5XA 3TVKA 1D9FA 1WSEA 1RT5A 5CYQA 2HHXA 3NAEA 4H54A 3DLEB 4E3SA 3D28A 1TKTA 1LAVA 1BQNA 4O55A 1RBRA 1RYSA 1JXEA 4KE5A 5KFXA 3OYHA 1YVUA 4FZYA 3OYIA 4Z4IA 2XI3A 4OKKA 5DG7A 4NLTA 3M8QA 3ISNC 1KLMA 3H4BA 3CDEA 5DGAA 3H98A 4PUOB 4PWDB 3H2LA 4CHNA 1HARA 1ZETA 2JEGA 4XIUA 2GV9A 2BGGA 4BE2A 4RW4A 3H08A 4JS4A 4HUGA 5L9XA 4H4MB 4R8UA 4QWDA 4IR9A 1YTUA 1F21A 4E7KA 3ICLA 5KFCA 1QE1B 1RTDA 4GVMA 1C1AA 2W9CB 4EP5A 3OS1A 4FJ5A 1T05B 1VSMA 1GOAA 2FVQA 4R0EA 3BR9A 1RT7B 4ED6A 4XO0A 4KAIA 4DFKA 3AO3A 2R8JA 3JSMB 4KREA 5J2MA 4CERA 4DFMA 1WSGA 4R5PA 3JYTA 4GC6A 3KLIB 3CYMA 3B6PA 5KFSA 4O3NA 1NKBA 4EO6A 1HJRA 3RRHA 4HKQA 3OYMA 3I0RA 4CJRA 4OPJA 4QPXA 1S9EB 3M9OB 2JEIA 4ECWA 5L1JA 2W8KA 4ZTJA 1EP4B 5KFNA 2XY5A 4NRTA 2XGQA 3WNEA 3I5AA 3CFPA 4ECQA 4ZP7A 1SL0A 3AVLA 3PW5A 4EEYA 2G8UA 1RT4A 4ECTA 4K4UA 3UPFA 3PHEA 2VG6A 4KHSA 2Y1IA 4FS2A 3L3UA 4O0JA 4J2AA 3NBPA 2FBVA 4CHZA 3NH1A 1LWEA 3K5NA 1TAUA 3M9MB 2R8HA 4DLGA 2ASLA 2D5RA 3C6TA 4PQUA 1NHUA 1CZBA 1IH7A 2EHGA 3OYAA 3G10A 3OYEA 5HBMA 3FRZA 2Q3SA 5J2PA 4KHRA 3I0SA 1KLNA 1HQUA 3M8RA 3RBEA 4DL6A 4CFBA 4N56A 4CF2A 2C2EA 3VQ9A 3MR6A 3HSTB 4WFZA 1JLFB 1NJZA 4C8NA 3D0PA 1VSHA 1RT1B 4IRCA 4J9MA 4BWJA 4CEOA 3KIOA 3F9KA 4CE9A 3V9ZA 1LWCB 3MTKA 4IG0A 5DQIA 3AVBA 1S9FA 4DTPA 1WLJA 4I2PB 4DL5A 4J2EA 4C8KA 4YMEA 2OA8A 4NLSA 5KFRA 1HNVB 1K1SA 1C1CB 4RUAA 2KW4A 4CCHA 2PY5A 1S0OA 3C94A 3V81B 1S1UB 2ZQBA 4DF8A 4LY7A 3NCIA 2D0AA 2QKBA 3L8BA 1K6YA 2XY6A 3E01B 1NKEA 4RW9A 3HPGA 4KI6A 1QSSA 3BSAA 3OS2A 1S1VB 2IM1A 3D45A 2BQUA 3KD5E 4K4TA 4K8ZA 2AU0A 2ITGA 4NCGA 5KFLA 4KRFA 5FDLA 1TK0A 1U4BA 3Q8RB 4NYNA 4FJIA 1XR7A 2HWHA 5SZTA 2DTUA 1DTQA 1C6VA 1G15A 1UA0A 2WTFA 1S1XB 3GV5B 3T1AA 1BHLA 2XO7A 3NF8A 1W25A 4JV1A 4AHSA 2AGPA 4AILC 3KLFB 2HMIA 3H59A 4DL3A 4CHYA 4CHQA 4RUCA 1XWLA 1X1PA 2W42A 2I5JB 2WCXA 2OPRB 4I7FA 1UAXA 3PW2A 2IJFA 3ZSQA 4KSEB 1QTMA 2WONA 1TQLA 3IG1B 4J9LA 3I5BA 2DY4A 5J2PB 3V9UA 4IRKA 2FLNA 4O0IA 2RF2A 1SKRA 4MKAA 1TK8A 4M3RA 1IKXB 1U09A 4IRDA 1I3AA 1X9WA 3C95A 3CFRA 4DTSA 2YKMB 2D3ZA 4ZVEA 3BSNA 3LZIA
chains in the Genus database with same CATH superfamily
1T0TV 1BY9A 2BE7D 1RT1A 4FZZA 4UUXA 1V4TA 1OH7A 3KJFB 2B9XA 4OLPA 1TFWA 5FROA 3LP0B 2ZDPA 4PXDA 2QGFB 3PW0A 1REGX 2HBLA 3O4WA 4CO2A 3QLHA 2W2QP 3P5TL 2V9KA 4JB8B 3AVNA 1UVJA 4P10A 2MJNA 2O67A 1JLQB 2AJFE 4LBHA 3HP9A 5LSLA 2PMZD 4DUZF 2H4WB 3FEZA 4NLDA 1X4FA 1NMNA 3S9HA 5B08A 2X1BA 4RW7B 3R6LB 5A8RA 3MAAA 3BZQA 3OR1A 2R7WA 3I33A 5IV3A 1O8BA 1BISA 1VSJA 4JYAJ 4PA1A 3WC0A 1WI6A 2FZKB 4RKUC 3QJJA 1BWEA 2L9NA 3VA0A 4YR3A 1N5TA 1JLAA 3GL1A 2CG8A 3D54A 2NXCA 2RQ4A 5HVFA 2HYIB 1NSPA 2PSZA 5AFUH 3CCJS 4OZNA 2YNFB 1QUVA 3HK2A 2BJ3A 3SDEB 1UWAA 4CJLA 2JJ4D 1OYDA 2VOPA 1WF0A 4BRHA 2FB0A 4I6AA 3R5DA 2ASJA 1FX2A 2ASYA 5KFDA 5KRTA 4BWMA 2HLUA 4ZTFA 4G1QB 3PX6A 1XC3A 3OTOF 1BOTO 4Y65A 4JV2A 3V4IA 3ZC4A 1WKLA 4DX6A 1FE4A 1EKSA 2MKYA 1N88A 1C0MA 2BM1A 2NSBA 1HW8A 1RHJB 1Q8KA 3FCHA 3TANA 4ZPBA 1B3TA 3CF5Q 3U3YA 2R7OA 3FZMA 1S0NA 2JVOA 3GR0A 2VG7A 1SC1B 1RBOB 2JHEA 1WOSA 1D0EA 4YB7A 2BRKA 5FRNA 3ZSZA 3DYAB 4RNOA 3CCSS 4CTAB 2E2QA 2Q43A 4J9PA 4DG1B 1KD1T 2MY8A 4TY9A 2IA6A 1NO8A 3WXIA 2DR7A 2O8EB 3AO1A 5A8KB 1VLOA 2UUCF 4F25A 2ZBIA 3GQCA 3QETA 3MEDA 3DRXA 1G3OA 5BPNA 3KK7A 2P51A 5C5JA 3FBFA 1S22A 4IR1A 2XEXA 3MR7A 3TWHA 2ZWPA 1CXUA 5HLFA 2IA0A 1ZBUA 3EVOA 2DNYA 2ATQA 4DR6F 3NMRA 2WRMA 1LK7A 3SNNA 4NLQA 4FLXA 4OHZA 2EK1A 4CO0A 3CGIA 1VQ5N 3E9LA 3CCEN 4V19X 2GZOA 1BD6A 3P4UB 2BOAA 4CGFA 4QS7A 5DLGA 1UPMB 3HHLC 4JD2A 2HBYB 3ZEUA 3ZT4A 2NZCA 3G86A 2M2BA 4J2DA 3SCLE 3QEVA 2YTCA 3JXUA 1N56A 4NXNF 3PFEA 5GAGI 3VEWA 3ZXWA 5DG9A 2IC3A 5BJRA 4BR4A 3BF1A 3J81O 2UU9K 2K8GA 3AOCA 1KSPA 4M5LA 5DETA 1XNQK 4MIWA 4OVLA 3DMJB 4DV1F 2EG2A 2H5JB 4L3QA 5KQDA 1FFWB 1XK8A 3OHBA 4PXBA 4GKKJ 4KI4A 3SZ2A 1WHVA 4JRPA 2CDRB 3QT7A 4CIOA 4IEEA 1NGIA 4EFAC 4BBYA 2VBYA 2D3UA 2FVRA 4DL0C 4ED7A 1LCUA 3FDSA 2W2NP 2CPHA 4KH6A 4CEDA 3KLGA 2JC0A 4Y2MA 3L2WA 2CJAA 4TYBA 3CCQN 2VJUA 4O4RA 4Y1DA 1VQPS 1RGIA 3QNNA 1ZC6A 2DRBA 1WC6A 1YLXA 5I3UB 3PIOL 2DH9A 5HRRA 3V5RA 1TL7B 4CLFA 3R27A 3DN9A 2A1RA 5B8HA 4DPYA 2YXLA 4KHYA 2AYEA 3MMCB 3W3DA 4LR9A 1N6QA 3D0HE 3V6DB 1N54B 4ZJLA 5AT1B 3G82A 4AD6A 1Q7YO 2E20A 5FPMA 3SXLA 4ITSA 4ANCA 3T7ZA 1UFKA 1RWNB 2G0IA 2J9CA 4LF8K 3FBCA 1KQGB 4RPFA 4H8KA 4B3TK 4IKAA 2GBZA 5CCLA 4A8XA 4DR6K 1QE1A 3AA5X 3Q7BA 1YDLA 3VTIA 1D9DA 2W9CA 3QQCD 2YKQA 3GONA 3LDLA 3W9IA 4LMZA 4B08A 2ZKTA 3AJ2A 5M1FA 1P9QC 2DY1A 1XC9A 5AZIB 3PEHA 5C42B 3E9OA 4IO1A 2RU9A 3H2VE 4ZP6A 2G2ZA 4B9VA 4LFAF 3PKMA 1SAZA 1LQ9A 3OTOJ 5DDPC 1NHVA 4P52A 1YI2N 2NPFA 4U7BA 4RW7A 2V6AA 2VG5A 1S6QA 4WXOA 3KLEB 1EP4A 2PA3A 2HQIA 1X4DA 2AEJA 4BGAA 3PR4A 2XWXA 5KFAA 3BN4A 4U96A 4MK9A 2DGTA 2UVVA 1SUQB 3UNGC 2F4VK 3HD1A 4X4PA 4TQRA 5DM7L 3K89A 4JOUA 1APSA 2M70A 1KCFA 1M5KC 3WNHA 1SQKA 2CG4A 3KG4A 3OJUA 4U67L 2WB1D 1Q82O 5ADZA 1S1WA 4HR2A 1R6YA 5KFVA 2ZH6A 3W2VA 3LL3A 2O8FB 1I94J 3SQOP 5KT5A 4CEBA 4EBCA 4CZEA 3SDEA 2DPIA 4M94A 3PUFA 3T1YK 3I55S 5GAEU 3PFOA 3U27A 1FKOB 4OKEA 1VFJA 2A10A 2DNHA 4LF7J 2V8VA 1Q1KA 4HL9A 1FJGF 3HF5A 1OJ4A 4ZPCA 4ZP8A 4ED0A 2ZD1B 1B70B 3E3XA 2OI2A 2ZBQA 1ZZNA 1JLGA 2P5VA 1A7GE 5FIIA 2GS8A 3AVGA 1X0FA 4KGZB 4LJMA 4K2JA 4A8FA 1NWKA 2NUUG 2W9BB 3D2FA 3D9BA 4JI2K 4CJ3A 3B4DA 3PTWA 3E01A 3F9MA 1XERA 3I55N 3QNWB 2XM3A 3GJRB 3TA2A 1NU4A 3RR8A 4DV2K 1H7XA 2VG5B 2PIIA 3HVWA 5EWGA 4NCGB 3NE6A 4X65F 1S77D 4BGBA 4NCBA 3RG6A 2HRUA 2YNHB 2UV8A 5EWEA 2HF4A 3OYGA 4OZ0A 1HUXA 2OZSA 1A5WA 3DOKB 3MWBA 1BA1A 2L9WA 3DLEA 4CF9A 3T1HK 4LVNP 2BW2A 3K8WA 3LF0A 1NGGA 1AT1B 3OYLA 4NA2A 1NZAA 3RUBL 3RBZA 1WTFA 2WSFC 3EWGA 2KT3A 1I39A 3GCXP 5HQ8A 1SJ3P 4EYIB 4OGCA 1KEKA 3HSCA 2A5XA 2FJWA 5JVHL 2DGSA 5KGXA 4K5RA 1PSDA 1NJIT 2J4RA 3OFHA 4IFEA 2XMTA 2ZNYA 2PMHA 3O3HA 3B78A 4DR3J 3FZKA 3MEEB 3JTNA 4YB1P 3RU0A 4OZ2A 1T9UA 1IN0A 5BREA 4PG8A 3BGOP 3M05A 4ISGA 3TNVA 2HMPA 2UUAK 3CPEA 5AJ3F 2LQ9A 5D8HB 4O8UA 3VQEA 1U6ZA 3ZZOA 3THYA 3KK1B 3DM2A 4X4OA 2ATLA 4ZHRB 1S5JA 2HHHF 2PI4A 1TUUA 3MMBB 4KJIA 2GX9A 1VRQC 1X3MA 3U4LA 4JV0A 3WXJA 3KK3B 4NYFA 3EPGA 1NH8A 2KXHA 3MAAB 1U26A 3BEXA 2B8QA 2LXIA 4BRQA 3OVSA 4E7IA 3CETA 5AQWA 1Y64A 1M90O 3CNQP 4CJWA 4OX9F 3W9JA 4TLRA 2YKNA 3AVMA 3RRGA 3B4MA 4W5NA 4DZ6A 2KU7A 1IWGA 1ZBHA 3TUJC 4KHUA 4JI7F 5DMRA 3T19A 3DRPB 3OBYA 1XHZA 4IKFA 3M6UA 3ENOA 1NDKA 1FEEA 2UZAA 4AXJA 3MAHA 4JI0K 3BP8A 4C3KA 1OPIA 3V9WA 3IC1A 4EGLA 1VSIA 4QWEA 4C1NI 3GIMA 3VZIA 4AHVA 1N6QB 4BDPA 4JI6K 2ZH7A 3HJVA 3D4JA 2VODA 2IBKA 2DCLA 4QR1A 3VZHA 1ASVA 4K43A 4CH7A 1AFIA 4B1WB 3M8WA 1QHAA 3MN6A 1EO1A 1N0VC 1JJ2R 4YEAA 1RBVA 5GAEP 4AF1A 2NRRA 3RWUA 5K14B 2DVIA 1KHWA 3G2XA 3GYXB 2VWBA 5FLXU 5IXUA 4USIA 2O01C 2J7KA 2XMJA 3GIRA 1IR1A 3O9UA 3JQKA 3MX2A 2YJEA 3OYCA 1RT3B 4OYIA 4FJKA 5IT0A 1QZ5A 3U9DA 4ECSA 4CJPA 5KT4A 1GQEA 4OFZA 3U02A 4LBPA 1VQMN 3L0QA 1HA1A 1XBWA 2JEFA 3IR6B 3NMUA 5D0EA 2MLXA 3RGIA 3K5LA 3KKRA 3M30A 3KMQA 3TZWA 3TU5A 2PT0A 4IO8A 3KK2B 2E2OA 4URQU 3NP5A 3KJVB 3UD4P 4CF1A 3FK4A 1VSKA 1UOCA 3GCWP 1VHIA 3C16A 5BYSA 4F8RA 3PR5B 3RRKA 5FLXO 4J9RA 4HTIA 4W98A 3H1QA 5GAGU 3H5SA 4FYXB 5L1LA 4PAAA 2BR0A 1U49A 4K5SA 1K73O 4K50A 2LSNA 1S6UA 5CYQB 1Z05A 2HFUA 5CAAA 4FJLA 2OCEA 4RU2A 2Q2RA 4ID1A 4J9QA 1UMJA 5C25A 4LF5F 1NGDA 1TUYA 3OFFA 4MFBA 1LV5A 1T9VA 3AA4A 3N6LA 4PL8A 5KPZA 5AQMA 2OD6A 3SAFA 5IV4A 5HATA 4MKVA 4IH5A 2OPRA 4MK7A 4U7CA 1UTAA 3Q8SB 3K2PA 3MXJA 3VCDA 2OH2A 5GMKa 1RWUA 5F9NA 4L6V3 2P9LA 3DJCA 2F4VF 1U1MA 4B3RF 2OPQB 1UEVA 1NK7A 3HYFA 5HRSA 2R8IA 2QWMA 1NBWA 1C0UA 4DPXA 1GOCA 3NEKA 3DLGA 2DITA 4KFBA 2VQEJ 1YZ7A 2ASPA 3NNHA 5F8HA 1SKSA 3QRRA 2QL9B 1U24A 2BE9B 4FJ8A 1KKHA 1AYEA 1Q4RA 1WELA 2BJ1A 1VI7A 3M32B 5D0GA 3Q23A 3LGNA 1IM6A 4J9OA 1MWQA 5A0YB 4CM2A 1HBUA 1FA0A 3QBCA 3EEQA 3BBCA 4RNFA 1ZPWX 1N48A 2Z1HA 2HNYB 4H5RA 2UUTA 1LXNA 3OJSA 2YX6A 1E6YA 1OPZA 2UVRA 2FVCA 3ELHA 1U47A 1RAAB 3DLKA 4Y2AA 1HJOA 4GMJB 3CEDA 3AOAA 1C1BB 3D6RA 2B3TB 1L3TA 1FRIA 4ZK7M 1S49A 5C25B 1RHQB 2JLFA 3CCRN 1RT4B 5C12A 4WPAA 3EZUA 3PW7A 2MGZA 4FLWA 1ESVA 3T5LA 4P72A 4B3MK 2GC8A 4FZXC 3P1GA 2M4MA 3ZZTA 1LWEB 1X9SA 4X62F 4DV6J 3POTB 2XBPA 3R6MA 4O3OA 1VQ8N 3JSBA 2IFXA 3LAKA 4IFYB 1U25A 1CSJA 4GV6A 2VONA 4O44A 2HEKA 1KS2A 3SAHA 2CUYA 3NXZA 5KI6A 4RZRA 3RAQA 2CRLA 3T5HA 4A8SA 1XUPO 4K42A 1GXLA 1XJWB 4LQ3A 3P39A 2VKZG 2D1KA 5HK4A 4FCYA 4A8OA 2XWYA 5AXLA 4FJ7A 2UUBK 2V8HA 5JUMA 2C3MA 1U0HA 1N5QA 3I6PA 1GLJO 3I4HX 2PGCA 4ZIWA 3CDUA 5B0AA 3M4XA 1TKZA 4O4GA 1LWFB 4IQMA 1JLEA 3N5BA 3DU6A 3SUPA 3CJKB 2HG4A 4O3RA 1IKVA 3CJ8A 2W40A 3ID8A 4M3ZA 2OTJS 3L4BC 2J6TA 3NAHA 3H90A 4DPWA 2AJ4A 4WCEQ 3F2KA 2K7KA 5ETVA 1VIOA 3DXKB 5A6PA 2LDIA 4BRKA 2P9SB 1BIUA 5KTQA 2LFVA 3G4SN 3SAGA 1REVA 2E7XA 5A8WA 1YJ9S 3D2WA 4CBXA 2O8CB 2V8PA 3H3OB 1S1XA 1OWXA 2ZC3A 3ZSWA 2FHMA 4NYPA 4ID5A 1OY6A 4FXWA 3QERA 2OPSA 2HZAA 2Y0BB 1HX1A 3S7RA 3SSRA 1Y97A 3KOAA 1L3VA 3ZTPA 4PUOA 3BGUA 4M8LA 4WZMA 1KAZA 4O44B 4WKRA 3D6HB 4CGIA 1OH6A 3UR0A 3TUZC 2A42A 1NK8A 4DL7A 1GLFO 1PBUA 2IM0A 3NFAA 3LZJA 1SH3A 2F63A 3KWIA 1JLBB 2FHJA 1RT6A 1H1VA 4B9TA 1TL1B 1TL3B 2DPNA 1TP7A 4L8RB 4LF5K 1EETA 1GX5A 1RDAA 4WFNL 1N5YB 3IGVA 3K5MA 2A2CA 1ACMB 2HK2A 2DB1A 2ZUGA 2W4DA 4HHJA 1G99A 3A2FA 1JCFA 4FYVB 4ED8A 3RBXA 2ACMA 1JWWA 1YBTA 4I0WA 1ZBIA 1FXDA 1B7FA 4DR3K 3B54A 4MT1A 5HJYA 2W9BA 4GMKA 2IDLA 3CJKA 4MJKA 4YB5A 1WUAA 4F4KA 4W5QA 5DZ6A 4FM2A 2VFSA 2JLEA 3DI6A 3MM9A 3JS9A 2VA3A 3BO2A 5F8JA 3I9ZA 4Z37A 3SIPB 1WORA 1MWKA 2H3EB 3CPWR 1XMOF 4TY8B 4NX9A 4WQ4C 4AT1B 2XULA 1RDBA 2GQQA 4OX6A 2ILYA 2COLA 2M8HA 3VQCA 3PV8A 2QLBB 4LR7A 2KZZA 2VG6B 2HBQB 3MXHP 3ISND 4KHMA 1Q81O 1IBMJ 1KQSR 4GKKK 1FERA 2CPXA 3TQ1A 2XMMA 3CCUN 5FPDA 1R8HA 3FFIB 3M2UA 4YOTA 3GJQB 3SQ0A 4ECVA 4USMA 1X5TA 4RNHA 3RR7A 1C0FA 3SJJA 4ZPDA 1VS3A 3UKRA 1HHTP 3HVAA 2DGQA 1K9MO 4L74A 2FJXA 1N4LA 4ER8A 1B64A 3VAIA 2OEJA 1YTAA 1RI7A 2D7SA 5K8PA 3LM2A 2DNNA 1W7AA 4I6YA 4WFBL 2DNMA 4FPIA 3G6ES 3ITHA 4IDKA 4FXDA 4YOVA 2AA4A 5AJ3K 3LPEA 4PG7A 3NHGA 2P9LB 2GMHA 1R8AA 5U47A 1CJTB 2W4PA 1R0AB 2ZGYA 3VQBA 1WKKA 2MQOA 3VF4A 1VQ9S 4LFAJ 4M5KA 5E41A 4CI0B 1VHXA 3UKUB 3AY0A 1SXLA 2K7JA 4CEZA 3L09A 2Q0UA 5KFYA 2R8KA 3L4IA 4O8KA 3W60A 4LFCK 1E6VA 2WVBA 3OLBA 2E66A 4KHWA 2DXEA 2F8MA 2HIYA 3N6NA 3H40A 2H51B 1Q81T 1VCTA 3IWXA 2Y1RI 2CPIA 3M5RA 3NGKA 4NZ6A 1RBLA 4BC4A 4DX5A 5T7BA 3GLJA 5KG4A 1S1WB 2DHSA 1XMQJ 3PYFA 3EY1A 1J5EK 4PZVA 1ZS6A 3PX4A 4Y1CA 4K0KJ 3BSOA 2AX0A 1FTRA 3U1LA 1IBKJ 2BVZA 1SUQA 4TXSA 2GIQA 1RKIA 5IS2A 1KVAA 2DH8A 2XLJA 2DRAA 4IH7A 3BPSP 3LGHA 1WD6A 2OIHA 1WOQA 4ZMMA 5LJVA 5AQZA 4LQ9A 1F5BA 4JD2B 1NOYA 3G96A 3CPWM 3KZBA 3QAUA 2R4FA 3MM7B 2W25A 1NNEA 4RX6A 4CI6A 4Z4FA 2BE2B 3Q89A 4Q7AA 2KHDA 1FDBA 3IBCB 2B4PA 3D1HA 4OI0A 2OLWA 2E44A 2X3GA 4FPBA 1NAQA 3HHNB 3EICA 2GUPA 4R8UB 4ZPAA 4CJ7A 3A5LC 5EU7A 3VAMA 3OR2A 3QJPA 4D3GA 3QSIA 4WTYA 1BQXA 2CWXA 1RSCA 4FWMA 3GE1A 3AQPA 3PSFA 5I3PA 1VQKN 1SB6A 2J9DE 4CEQA 1MSWD 3UDVA 1QTNB 3H20A 4CZCA 3LP2A 2CWKA 3IM9A 3QAEA 3RBDA 4DUZJ 1H74A 3IAM9 3K59A 2PZSA 1T03B 1FJEB 1CULB 3QIDA 4HLBA 4RL1A 2W8LA 4Q2MA 5JMVA 2VGNA 2FD2A 4OL8A 2YVSA 3UO0A 4EHUA 3TVKA 4RTFD 4GV3A 1WSEA 4CD1A 4B17A 3K8VA 3NAEA 3T1YF 2BKOA 1TKTA 3PHTA 1TFYA 1XQIA 1YKWA 1JXEA 4KE5A 4LREA 4B3TF 1W97L 4P7TA 3N79A 4P71A 4MAKA 5DRKA 1FJGK 4Z4IA 3ADAC 4KH5A 4ZCIA 4XK8C 3CDEA 1FE0A 2WBNA 1QY7A 1XNQJ 3UN3A 5DGAA 3H2LA 4KYZA 1B4SA 5EVZA 1ZAVA 3MM7A 4QBUA 3O8MA 4PKIA 5AQSA 1PAEX 3EE3A 4TLQA 2QG9B 2OEKA 4QWDA 1FX4A 4X4VA 2G9OA 1VBZA 2G4BA 4ZLPA 3BB5A 3CJTA 4LFCJ 5DM6Q 2P9KA 2D9OA 4ANEA 4EP5A 5IWAJ 1S0VA 3H45C 1N52B 3TJ8A 4JHDA 5EN1A 4JNEA 1T05B 2P6TA 4R0EA 4YB6A 1RZMA 1HBMB 3BBBA 4XO0A 4KAIA 3ATVA 3ZX3A 2GMJA 3IO1A 5LM7E 2HRTA 4CERA 2Z2YB 2YHYA 2W2OP 4NO7A 3ZTOA 5A0YA 3MURP 4GC6A 4O3NA 2DGOA 4AFFA 4BRGA 5MLCV 3RRHA 3NLCA 4I6MA 4OPJA 3D3CJ 2V34A 1S9EB 3M9OB 3S6EA 1K44A 2JEIA 3MN5A 2J7WA 1NB2A 5LJ3Y 4ECWA 2NQPA 3M8ZA 2BX6A 3UN2A 2KKHA 5KFNA 3WNEA 1MROB 3CFPA 4ECQA 4YY3K 3PW5A 3JAMY 2VBZA 3VALA 4XH5A 2G8UA 2AEFA 1WC0A 2X1GA 5DM6L 2ZBRA 1KN6A 4FS2A 4X64K 4J2AA 3NBPA 2ZJPL 4DUTA 3K5NA 1TAUA 4M63C 4DLGA 3MGJA 4RBVA 1R7IA 4PQUA 1NHUA 3OV7A 3OYAA 3G10A 3ZFVA 3RSEA 4MLEA 3FRZA 4AE5A 2Q3SA 3I0SA 5EHHA 3M8RA 4Z94A 4CFBA 2OSRA 3VQ9A 4X64F 1Y11A 1TMJA 3EL2A 1NJZA 4C8NA 3D0PA 2CPYA 1RT1B 4IRCA 4AL5A 4J9MA 4BWJA 1RBAA 3IBFB 4CE9A 2QXLA 4CQ1A 4OX7A 3MTKA 2UXCJ 3WQUA 4IG0A 3J7YI 5DQIA 4ZVOB 4RWWA 4I2PB 2VASA 4FF1A 4RCHA 2D74B 4BRNA 1QZ6A 2GCFA 4NLSA 3VF0B 1C1CB 2DNRA 3C94A 3V81B 4HT5A 4CM0A 2QMWA 3CJQA 1Y7PA 2JWNA 2FY1A 3DRYA 1GLAG 3NCQA 3BY5A 2XY6A 1NPRA 4I1TA 2MSTA 2RUSA 1L3KA 4KGVB 2QN6B 4KI6A 2Z2ZA 4IYQA 3D45A 4K4TA 2DHAA 4Q2LA 4NCGA 1Q79A 5BPLA 4FVUA 3FJ2A 4FJIA 2PFFB 4P74A 2BKPA 5IM0A 2K2PA 2MDAA 3AGKA 1FI4A 2MYFA 2YPYA 3NF8A 4JV1A 4AHSA 2C42A 2FY8A 3CIMA 1ZPVA 2AGPA 4CHQA 2W42A 4V1Ak 1CJKB 1F1BB 1KP6A 2WCXA 2LP4A 4I7FA 4HTLA 2H48B 3J7YU 1VQPN 3PSIA 2DR5A 2WONA 4ERDA 2CJ9A 4J9LA 2ZC4A 3HHDA 4K41A 2SXLA 3MWTA 3S41A 4NA1A 2KG1A 1U09A 3J7YP 5JLFA 3C95A 3CFRA 3GU0A 3BSNA 3H5XA 2X6SA 1CC7A 3THWA 1C0UB 4KTQA 2VQFF 4DSKA 4JI4F 3C14B 3PLAA 4H4OB 2A6AA 5DQHA 3HSDA 2BE2A 3ZZYA 4AM7A 1H98A 4O0NA 3ZYYX 2YKAA 1B0VA 2XMVA 5FRMA 1BQMA 3V1QA 1R31A 2MTLA 4Y2KA 3GTYX 4FL9A 5IZHA 1BI4B 5T14A 3R97A 1W2IA 3V81A 2YY3A 3UDLA 3LQVA 3G6XA 1MWYA 4UQGA 2H4YB 1S3XA 1Y3KA 4X65J 4JBCA 3MZIA 2HLTA 3NF7A 3AJ1A 1Q16B 2ROGA 1FKPA 1N36K 4CJ5A 4PL7A 3MAQA 4AL7A 4KR0B 1OY9A 3CCUS 2B56A 2CQHA 4B3SJ 5HROB 2WBRA 5HL7L 5L38A 5CXTA 2UXBK 4ILMA 4OX9J 2QA1A 3RMBA 1IWAA 3CD6N 2RE1A 5AXKA 3G4SS 2FBTA 3KLFA 3I5CA 2E6LA 3TWZA 2NRHA 4HUEA 3POTA 3NDKA 1DTTA 3PZPA 2HFZA 5M1OA 4J9UE 1BLUA 3LPTA 4FVMA 1BWFO 3J7ZO 3OA9A 1NH7A 4DR7K 2VKRA 1TKXA 2QLXA 2V5HG 2VPYB 1V3ZA 1U6FA 3PNIA 4H4KA 1FKOA 2RHSB 1NEEA 3AJDA 1B9DA 4J8FA 1H6KX 3C6UA 2J9DA 2FPHX 1DRZA 4JI8F 1HRHA 2KZMA 1ITGA 5LXYA 2NCKL 2UU9F 4UOFA 2DR6A 2W7PA 5L46A 3M2VA 2BJ7A 2ZJRL 3ENQA 1VK3A 2KRRA 2V4QA 2EXUA 2XZTB 3DXBA 3UB5A 3UIQA 1XR5A 3EDQB 1GXTA 3IWLA 1CJTA 2BOPA 5KFHA 1J5OA 2JFDA 1YTYA 2PEHA 3K9KA 3S01A 4XPCA 1L3UA 4CZGA 4HACB 1T05A 1RNHA 5IWAF 2XC9A 4LUBA 1RWVB 5CZ2A 2E1RA 3MOZA 3R8EA 3OR1B 2W2MP 4C23A 3N01A 4FNIA 3TJ9A 4YOUA 3TEGA 1S1TB 3DOMA 1TKDA 5IFMA 1JLEB 2K3IA 2QWOA 2G0CA 3UCUP 3L2UA 1WSFA 2ZNZA 5A8WB 1IQTA 5F8NA 4FWPA 2N3OA 1U04A 4ECZA 3T5KA 3CD5A 4XEIA 1BDGA 3G8QA 3I8DA 1N33K 5LOQA 5H9FJ 4A8KA 1U7LA 2BANB 3MFHA 4ED3A 2HBKA 4B3RK 1UWBB 2H65B 2DR9A 4DHVA 3QINA 1HMVB 3PRVA 3V6DA 5LJWA 3PDNA 4EI2A 5D4OA 2R2UA 4ILHA 3DWLA 2WSEC 4KKOB 2PO4A 4KT0C 3G71N 4XTTA 2J5AA 1NSAA 1M5PC 4WQ5A 2KVIA 4KRWA 3TX0A 2CPDA 4A59A 5T41A 2YHBA 2E1MC 4A8WA 2OPQA 1FESA 1RT6B 3H5YA 1SV5B 4I2QA 2D69A 5M1NA 2KFYA 3HULA 5BN9A 1HPZA 2G8IA 4QIEA 5F8MA 2G2OA 4WFYA 3K7RA 5ETRA 4PR6A 2BBEA 2YX1A 2ZM6F 3MUTP 2E2PA 2HW3A 3J7AP 2A6OA 5B0FA 1ZOTA 2B5JA 1AUSL 4CLSA 2YI1A 2QTWA 2QA4S 3AB4B 2FHOB 2ZVIA 3VV2B 1HD1A 2WB4A 2E1AA 2LQJA 4LH4A 4LF4K 3TYTA 4M95A 4F36A 4BC9A 4RW9B 1XHXA 1GTHA 2W4CA 4WIIA 1SJRA 3FCWA 2H1YA 4LF6F 2FC8A 2D0OA 5AQNA 1CQMA 3A12A 4PG4A 3NGUA 4YY3F 4NPOA 2QEXS 2NSCA 5I42B 1O6XA 2XMKA 1GEHA 1OY8A 2VDIA 1X5OA 3M6WA 3O4NA 1AXQA 2O4IA 1U1KA 4ILJA 1U6BA 3W2VB 3KUHA 1RTZA 3KVGA 1KXPA 1YBAA 2IOCA 4EWTA 2IAJB 5K14A 2XSJA 3UN5A 4Y0WA 3NS7B 2EWSA 2AMCB 3HX9A 3AA2A 4JKCA 2G8KA 3DC2A 4ICLA 3LDOA 4DV6K 2LCWA 1IBKF 4FF2A 4DV3J 3SBTA 1R0AA 3NMAA 3EMTA 1V3RA 1RDRA 3ET6B 1MA9B 1YZ6A 4CLPA 4L76A 5KFUA 1QUPA 3CG7A 3P83D 3NGDA 1J5EF 4Y28C 3J81j 4DV7J 1N33J 2G8FA 3VAHA 2B5JB 4B3OB 1SJFA 1SZ2A 2F8EX 4YOXA 2EFGA 4NLGA 5AZJB 1QAJA 4KY3A 3OYKA 1UEKA 2VQEK 3EVMA 4KH4A 2Z1GA 5LL6d 4OI3A 2E5LJ 2X1AA 1P9YA 1OH5A 2X3DA 5EY4A 5DJBA 3GJTB 2QWNA 3KKSA 3RMDA 4NMLA 4LSZB 1JL2A 4CZMA 2KVQE 2I7PA 4RW6A 2V4RA 3O9QA 5KT6A 2MY7A 3KXDA 3CTRA 5KG6A 4MIAA 3MR3A 1RUSA 1ZA2B 2O8CA 3ENWA 1JQGA 2OEMA 2UU9J 3DOKA 3QO9B 3T9ZA 4XDDA 4URSA 3RW6A 4ECXA 4F4AA 3T6JA 2V2ZA 5E3PA 2KJWA 4QWAA 4CLLA 3WXMB 2C3UA 2BJDA 3GSIA 2C3YA 1F9HA 1IM4A 4JI7J 3UR3C 3THXA 2CQDA 4BC3A 3LO3A 1FWLA 1UVMA 3L2QA 2OTLS 4QU7A 2HHHJ 4IFVA 4ATNA 1N8RO 2V7YA 1S4FA 4FW1A 4USKA 1JLFA 4YDDB 2XRIA 2FSKA 1WC3A 4GC7A 5CY4A 1RCHA 1KWMA 2ASMA 1HPMA 4QOTA 1DURA 3MEGA 4IG0B 2M9KA 3ILLA 2YV0X 3R3LA 5D4LA 5DDQC 2XCPA 3EXYA 2CH6A 4XH4A 1BGXT 3G25A 2KT2A 2YJFA 3V9XA 4PPZA 1YJ9N 3VA3A 4CF8A 2OSQA 2VC0A 1T44A 5I9EB 3F56A 3RZAA 2JZ5A 4ZVUB 1ICEB 3MCAB 1S1VA 1VSDA 3CJAA 1MN7A 2E5LK 3EZOA 4CZJA 1VQ5S 4PPDA 1N32F 1XI1A 5F3ZA 2X51A 1P1LA 4HCCA 3P5JA 1FDNA 3I87A 2OZMA 3U1NA 1WC5A 1T03A 3G0ZA 4PABA 1C4AA 3VGVA 3B8AX 1HNWF 1PJ5A 1Q8BA 1OO0B 4OYBA 3HO1A 3K0SA 1Q0NA 2MHNA 4WF9Q 4QYZJ 3GZ7A 3CJ2A 2O8FA 2CIMA 5DG8A 3TTFA 2DGWA 4NLXA 4YNQA 1LW2B 1NM2A 4CNYA 5EXWA 3CCWA 1T9WA 2HGMA 2VFRA 4KB1A 4F3MA 2F1FA 1X4AA 3C15A 2XHWA 4PWWA 2Y1JA 4CK2A 1E3MA 5KG2A 3EO3A 4D3HA 2JC1A 1RILA 3UE2A 3OW2M 2J6SA 3CXCM 2ZOFA 3K17A 1XNRF 4QYRA 1IKWA 4CJ4A 5GMEA 5AE2A 1M5OC 1U1NA 2IC3B 2QMXA 3DOLA 1J53A 3QLHB 3CCQS 4CLKA 1YJUA 1FJGJ 3LAMA 1RT3A 1SJQA 4DTMA 4DU4A 4C11B 5LXRA 3QEPA 3DMJA 1WSHA 4CEEA 5HQLA 3L7OA 2WOMA 1BG3A 2A0FB 2FBXA 4ZVFA 1S9EA 3GFYA 2RJZA 2P5GA 4A4JA 2ZKUA 4I9LA 5KFGA 4X4SA 1N36F 2B9EA 4GW6A 4MH8A 3R5BA 4O3PA 3VPZA 2YNIB 2UUBF 2P8IA 1KQSM 2ZJQQ 2DJWA 5GAHU 2ZDOA 3N6MA 5KFTA 1T02A 2M0GB 5C15A 1NZ8A 4DKWA 1SJ4P 3DRRA 2OPSB 1JXLA 2VD3A 2ZWHA 4CO5A 3Q8PB 1K0TA 4EAHD 3WIVA 2Z1IA 1NJWA 5I3UA 3TAGA 3MTJA 2BJ9A 4ZKAA 4PQUB 2DCUB 1QQMA 4BRCA 3IRXB 1HLUA 2ZFHA 5IT4A 1T11A 1VJWA 2I9SA 4DQIA 5JMNA 2F96A 1JXVA 3U6FA 3A3OB 1RE1B 1S6PA 4GV9A 1KD1O 4I4BA 3BUZB 2A3JA 3ZX0A 3NWRA 3DGVA 4DU8A 2YH0A 3I56S 4PQAA 4QW8A 2HIQA 5KG3A 1W7WA 3NGTA 9RUBA 4X62J 1JJCB 4OI2A 1K8AT 4IQXA 2CQ4A 1S48A 1PC4A 3HFKA 1HQUB 3DOLB 1KHVA 3OSNA 4CESA 2RU3A 2F9DA 5C2CA 3QRPA 2Z58B 5CYMB 4AH9A 1HNXJ 2MKKA 3ZZZA 4B1VA 2V67A 2B4OA 3AVHA 1J27A 2W6KA 2UUWA 3AO2A 1CVJA 4ZHRA 5DDOC 4FF4A 1OS5A 1P90A 1BE4A 4M3WA 5ADXH 3DYAA 1WN7A 5KFFA 3OL9A 4TY8A 3NL0A 1HNIA 2LXUA 4AXIA 2QA4G 4DTJA 4DUYJ 2WZ1A 3ZT0A 2WW8A 3C19A 2CJQA 1KAXA 5AQGA 4JK8A 1A9NB 2R2TA 2UVUA 3AO5A 1IBKK 5GAHI 4OZLA 1ZAXA 4HCBA 3NGSA 1P8ZA 1X4HA 2XZWA 3IBWA 3M9NB 3F73A 1LK5A 3MM5A 5E33A 3NNAA 4YHHF 1IUJA 3PCOB 4QW9A 1DTQB 4DSFA 1VQ4N 2BABA 3QATA 2HNZB 5HL7Q 3HI0A 4B1YB 1S6PB 5J1EB 4DI6A 2FC0A 2IRYA 1N5SA 2OKQA 2R9LA 3MEKA 1SIWB 5KG7A 4DR5K 4ENOA 5HVHA 2GO9A 4GO7X 3MECA 2DO0A 4CLUA 4Z4GA 2V4JA 2GJFA 1HIYA 2WONB 3CCMN 5AQLA 5AFUA 2FIUA 2YHWA 2CQ3A 4H0OA 1FRKA 5BR8F 2AT1B 3CW2C 4UOGA 2XI2A 1VQLS 3WHIA 4B02A 2YKMA 3THTA 2Z56B 3W2WA 5GAEI 3GBTA 4M7XA 5LMNK 4LSNB 1HR0K 4X4QA 3LH2S 3OVAA 3FZHA 1U2VA 3ZNUA 3CM5A 2KHCA 3TZXA 4IEIA 4AHTA 4DR2F 2ZBCA 4MLHA 5KG0A 4OYWA 3H42A 5SUHA 2H5EA 3GR1A 2CGJA 4W5RA 2QTDA 2I38A 3VAJA 1HNXK 2IIRA 1VRTA 2QRRA 2DXFA 1LOUA 2HQFA 4E7LA 5HROA 4NCAA 2WFBA 1IBLF 5C7PA 3SQGB 3HBTA 1KQFB 1VQ7S 5E7OB 3I31A 3M8PA 5LMUF 4X4NA 3Q8VA 1VQSA 2O8BB 1GOBA 2OTJN 1JJHA 1OSCA 4TN2A 5B09A 1X31C 2D3OR 3WEEA 4EBDA 3L2RA 1HLWA 3BBFA 4NLVA 5J2QB 4RUHA 3FKBA 1HWKA 2RQKA 2WVDA 1EARA 4DUZK 5JVGL 3L4QA 3FLCO 4RW8B 3SEOA 2FLLA 3CJ0A 1HNZK 1E4FT 1H7WA 2RKIB 3LP1B 2V0NA 2UUCJ 1T3OA 3EE8A 3ZT1A 3LTOA 3HI9A 4FZVA 3VQ4A 4MDAA 5A2QY 1ZBLA 2P5OA 3FSXA 4M63A 4G65A 4NL5A 2CXEA 4ELUA 2ZBPA 3NS6A 4FJXA 4LRCA 4WQ4A 3VN5A 2QLJB 3IS9A 3CM6A 3FBBA 5K20B 2CJXB 3KG0A 3NAIA 1TKXB 3GG0A 4FP9A 4ZN1A 4CVNE 2VUGA 4QZVB 3LALA 5IT9Y 4F4ZA 4PEOA 4JKEA 3BH6B 4ZVQB 1ASWA 1T6CA 2CQ2A 5KOXA 2A1SA 3R1LA 2IPOB 3CDAA 3NG8A 2J0QD 4CJTA 3GFHA 4DG1A 5KT3A 2G8HA 2E5IA 1DQAA 4W90B 2AJQA 1HNVA 1S1UA 2V2VA 3J7A1 1ZBFA 2VG7B 2MQ8A 3TAEA 2GGPB 1NDCA 3TJAA 4ELTA 1NPPA 1NKCA 2AP1A 3T1HF 3AA3A 4CJVA 2OFGX 1E6YB 1EQYA 1XMOK 4BDZA 3HXMA 3DLKB 1VIXA 2QWQA 4GVEA 3M1FA 4ZVRB 3OSPA 1X0PA 3CC7S 3BKTA 1LKZA 3MMVA 5D3GA 1OQ6A 5HLFB 2N3LA 4FWLA 2HBMA 4F3QA 3CJ5A 3CCVS 2O8EA 2AYMA 2AJ2A 1KVBA 2MGZB 4IH6A 3SCJE 4XAKA 3QB0A 1YG0A 4CO3A 1W9HA 1B99A 3MWPA 2UUAF 1CJKA 3P31A 1NK0A 2E1CA 4BE0A 4FWKA 4N77A 4USHA 3IS9B 3PIOQ 1FWPA 5KT7A 4RWXA 3HRGA 4CFCA 4LF9F 3A8KA 2AWZA 3HTVA 5F41A 2OPPB 3KDOA 4JV5F 5F8LA 5E5NA 3AD8C 3ENHA 2W6LA 2W2PP 2KJVA 2CQBA 3P4IA 3D1QA 5J1PA 4CF0A 2B9WA 2JVRA 2BUPA 1I5OB 2CQCA 4QCLA 9ATCB 4Z7YA 3R7BB 3O9SA 2EBEA 3M6XA 4L3KA 3MMAB 2KN4A 2A3ZA 4ZLLA 2IYIA 5D4NA 4NZ0A 2VBWA 3N4WA 2A2DA 4DSLA 1IBLJ 4DV2F 5BRDA 3QWUA 3GFXA 4FLYA 1ILYA 1UL3A 4JKGA 1K8KB 3S3NA 2GFFA 5MAOA 4FBUA 4V19J 3FR0A 4J9KA 3OYJA 2RNEA 3VAGA 3CCRS 4WFAQ 3PIPL 3J7AN 3CMAN 1DT9A 1HKAA 1IR0A 4K4WA 3E9PA 4QU6A 1IXKA 3KJVA 3BYPA 2NUHA 3UCZP 1PCAA 1F2HA 2F9WA 4J7CA 4YHHJ 1REVB 1XMOJ 1QVFR 3OFGA 1VQ7N 3VQAA 1SC6A 4B9QA 3A5MC 3O5BA 1LW0B 3NBPB 2DTJA 3UD3P 1UFLA 1RKJA 5IC6B 4M5HA 2FC9A 1YSJA 4WZQA 3TAQA 4ELVA 2A18A 3Q8YA 1FFSB 2FJEB 2PBDA 4FBTA 5ETOA 1RAGB 3JQJA 2PI5A 5FD1A 2DY9A 4WYBA 4GVLA 2IBOA 1A5VA 2EPIA 2IVMA 2WW4A 2DKOB 1MMLA 2NZ4A 4Y2CA 3V4IB 4NLCA 1XEZA 1HWIA 1UZHA 2VFVA 2FHJD 1X9MA 4DR7F 4I2PA 4FJGA 2QO3A 3TUIC 1HL6A 4IDHA 4Q8FA 2CVIA 4NEYA 2O3DA 1K8KA 4DU3A 2MKJA 1MMDA 4B3OA 1NUEA 4C11A 4LSNA 1GLEG 2VICA 4FLZA 1UW9A 2DHGA 3OHRA 3VHQA 5AZJA 4M41A 2GAHC 2CKWA 3LA0A 2WOMB 5A2QO 4CIEA 4ZPWR 1VRUB 3AVFA 5A2QU 3DDKA 4C97A 4RWTA 1KDNA 4TQSA 4ISEA 3MUMP 3IM8A 5C42A 4MQ3A 4C8YA 2RIJA 1BUPA 3MK6A 1NSQA 2EFQA 3PXGa 3O1LA 4JI5F 4J2BA 1NLKL 1HBUB 4ZITA 3D2EB 4DV3K 2EK6A 5A8KA 1LNQA 1Z1ZA 2OP5A 3DLLL 1FNOA 2AGQA 1NNDA 3MM8A 1NJXA 3DRRB 3QFUA 5CZ1A 3DLHA 3TR5A 1Q9YA 3AVJA 5J2NB 4NLUA 3QT6A 1V4SA 1DLOA 4FN5A 5CH7B 5F8IA 1QDUB 3TTCA 4DX8H 5FLXY 1R89A 2X1FA 2QYCA 3SPZA 3CJCA 4EZ9A 3QEIA 3M6VA 1U45A 2E5HA 1FDAA 4WYWA 2ADCA 4OX9K 3RMAA 2VHGA 3MI7X 3AVKA 4MIBA 1IKXA 2P9PB 4FJ9A 2DGVA 2WVEA 1WC4A 3MCNA 3EX7B 4OHVA 4FSVA 2DNLA 5CABA 5IQQA 1VQNN 1WSRA 4PWDA 1YUWA 4BR7A 1X5SA 4LF1A 4KPCA 3D67A 4YP3A 4DQSA 5HP1B 4IUFA 3DXSX 5F1XA 4CFAA 1VLYA 4DV5K 3D0GE 1FF2A 5GAGP 5LMNF 3MFIA 1S9GB 3EKSA 2IMWP 3CJ4A 1JLQA 1VQ6N 2UV8G 3SSQA 3UNYA 4K59A 2LQ8A 5CCMA 2AD9A 5GADU 8ATCB 5KGWA 1K47A 3H1VX 3VEOA 2KT5A 3D3BJ 4ZPVR 1NU0A 2YPZA 4N47A 5KFBA 3LPUA 1CZ9A 1X5PA 4F4YA 3ZSYA 2B7BB 4DU7A 3DXMB 3VGTA 3W1YC 2NRVA 3MM8B 1D9FA 4LIWA 4E3SA 3MCSA 1LAVA 3NY0A 1BQNA 3OTDA 2AYBA 4JEPA 2DEJA 1RYSA 2MZQA 1GT8A 1V6HA 3QMLA 2VF3A 2QWLA 4DR1J 4F9OA 2NXNA 2CGLA 3JSYA 4NLTA 3ISNC 3VWSA 1C0GA 2RS8A 5KAKA 3H4BA 1D4XA 2PFUA 3H98A 3TSQA 3D0IE 4O23A 4PWDB 4CHNA 3H0PA 1ZETA 2WVFA 2JEGA 4XIUA 2BGGA 4BE2A 4RW4A 2G13A 2X7IA 3ILIA 3HOTA 1U1PA 4R8UA 3PG9A 3THYB 1RAOA 2BMBA 1G6BA 1YTUA 3DDIA 4C0HA 3JQMA 1QE1B 3LDQA 3MHYA 4DV4K 3GWCA 1C1AA 4FJ5A 2E7WA 2RQMA 2BM0A 2Y8WA 1RT7B 1HBNB 4ED6A 2G1HA 4CO4A 3VR1A 4OI4A 1DBDA 2BH1A 4R5PA 3CYMA 2B4UA 3QFHA 3CC2N 2HOEA 1WKJA 4HKQA 3OYMA 3I0RA 1YJNS 4CJRA 4E98A 1JMTA 2HHPA 3J81Y 4FWNA 1NDPA 3I96A 2MQPA 1A0OB 3W62A 2W8KA 2CQGA 3MUVP 3QGPA 1EP4B 1PC5A 1WSVA 1Q8LA 1M1KO 1SL0A 4ZP7A 3C65A 5IWAK 2OTLN 3AVLA 1MLAA 2PAVA 3C2PA 1RT4A 3C7NA 5ETQA 3PHEA 4KHSA 2OFHX 3I32A 2HBRB 3CJRA 3L3UA 4O0JA 2J0SD 3SK3A 4DV5J 4CHZA 4USJC 3NH1A 2Q31A 4GKJF 3QSYB 5CQGA 3VESA 2ASLA 2D5RA 4QIWD 1FNXH 5G4DA 2Z0GA 2ZJRQ 3SBMA 1BC6A 1HQUA 2ZJQL 2ZH5A 4DL6A 3VMFB 2FJBB 2HVEA 1PILA 2C2EA 4BCAA 4HEA9 3HSTB 4H0XB 1FNMA 1U1LA 4TU7A 3O8WA 1TZ0A 1N34J 3OVBA 8RUCA 2YCHA 3V9ZA 1VC5A 2VU5A 2GMLA 1S9FA 4L72B 2ZVSA 1WLJA 2DNZA 2D4WA 2AJ1A 4E8UA 1O0PA 4DL5A 3F0NA 4C8KA 2XYPB 1NGAA 1K1SA 2AHOB 1MG7A 4RUAA 5F0UA 3W63A 1VQOS 2D0PA 4LY7A 4UT4A 3LOUA 3NCIA 2D0AA 2QKBA 1K6YA 2RUGA 4EIAA 1VQ6S 4YDUC 3HPGA 1YJRA 3GP9A 3FRYA 2QLWA 4EFHA 1QSSA 3BSAA 3OS2A 1S1VB 2IM1A 2IRXA 4NYOA 2AU0A 5KFLA 2RB7A 4KRFA 4DUYK 3PRDA 3Q8RB 3O5TB 1MROA 1XR7A 4ZCMA 4RBTA 2HWHA 5LY3A 1DTQA 1G15A 3VVUA 1S1XB 4LFBJ 2AYGA 3GV5B 3T1AA 2XMUA 1BHLA 1W25A 2GW8A 5HAOA 3NWGA 2WSCC 2UXDF 2RDDA 1Z6RA 3H59A 5BR8J 4FPAA 3HFVA 4DL3A 4RUCA 1XWLA 2Q1NA 3M1VB 4TVAB 1ELOA 4CZFA 2IJFA 4KSEB 4HH0A 4YS2A 5J2PB 4WFAL 2FLNA 4MKAA 1X7VA 4YOYA 4IRDA 1I3AA 1X9WA 4YDUA 3W2WB 2YKMB 4DTSA 3OBIA 1TL3A 2NUBA 1UCNA 2R8GA 3GYNA 4DX7A 1VK0A 3MEEA 3DLGB 3ID6A 3ET6A 2LYVA 4ETXA 3GE9A 3D6TB 3IGNA 4DV7F 3TAFA 3I82A 3P5BP 5AE1A 1WEZA 5G0RB 1UFWA 4Z2XA 3QESA 2G0JA 4ZN3A 4EMDA 5JJBA 2XLIA 3MOJB 4DCJB 3SQGA 4HACA 1H3DA 4KFBB 1KTVA 4OHYA 2HHHK 1RHKB 2HHUA 2D1CA 1KOHA 4Z7CA 1T6DA 4BVPA 4X2BA 2XHBA 3CF5L 1RWMB 3CERA 3U1MA 4YFUA 4JI1F 5FDLB 1HQEB 4FF3A 4RW6B 2KL8A 4DV4F 1Y4ZB 2APOA 3D7EO 2M3DA 1VOMA 1RTIB 2HNYA 2QWPA 4H5NA 4OLAA 1M1HA 4BHQA 3BKFA 3RB6A 4WCEL 5KPRA 3L3VA 4CYUB 4KHPF 2D9PA 2HMIB 1UJ6A 2B4JA 1RTJB 5M2RA 2YX7A 4JI0F 1ULRA 4F4XA 4TYAA 3VGKA 2QIFA 1EWQA 2BANA 5KG1A 4Y00A 4HVJA 4DV2J 4H5TA 4FKXA 3DRSB 1TV6A 4DEZA 5BYQA 2NXJA 4URGA 4QIGA 7AT1B 1D1UA 3TAMA 1QAYA 1JNRB 4K0KK 4PKHA 5AE3A 2NLWA 2POKA 3MEGB 4NYZA 1XR6A 5F0XA 4LH5A 3SSSA 4RR5A 3RJMB 4I6WA 2BEFA 4QIVA 1TL4A 1HNZJ 4I9QA 3GIIA 3A8IA 2BV3A 4A8MP 1M5VC 2VWKA 3A8EA 5ITHA 4WE1B 4JYAF 3AD7C 4BREA 3OHAA 2JOQA 1M1GA 2OD4A 3OBWA 2J0XA 3FZLA 2DK2A 3SV4A 1VRUA 3HVRA 3OYBA 1HFEL 3GIKA 4GVBA 3M30B 4CIGA 2Q6BA 4X4RA 4HUFA 3L3CA 1RWKB 3EYZA 3BM7A 3KHHA 5J1NA 1FKPB 4JI5J 4JLHA 1TKZB 3P49B 1SQFA 4MO4A 1J6ZA 3E8OA 1R59O 4J9NA 4QWBA 2O1PA 3PYEA 4DCHA 2IYGA 1IKVB 2EW9A 2KO1A 1YBUA 4F0KA 4FKYA 5J2NA 2F8HA 4WWSA 3I56N 1IBCB 1IR2A 3PYDA 3TEHB 3SPYA 2UXBJ 2C2NA 7FD1A 1YRUA 2AF6A 3K2YA 3MM6B 1YRXA 4DTOA 5CA5A 2DFFA 1RA6A 3WQPA 4PRFA 4M3TA 3V6JA 1PJ7A 4F50A 4KHPJ 3VTHA 4F2RA 3QBWA 5AR0A 3HHEA 2RQCA 2FDNA 1RK8A 3ULHA 4DN0A 2CYYA 2YWGA 3R5JB 3GMGA 4GRSA 2Q0RA 2HVHA 4BG8A 3FUYA 3CJ3A 4B9UA 2H5IB 4A47A 4FVCA 4FM0A 2P9EA 4U9RA 2E2NA 4IOAL 2PEBA 4J90A 3BGLA 4AHUA 4DR4F 3L95X 4KHQA 2OYQA 2C2DA 3GYGA 1N34F 1GFWB 3DM2B 3BQ0A 4JI7K 2E4LA 3M2RB 2W9AA 1NOZA 3CXCR 1PO6A 2O5DA 1MDUB 3MMBA 4FLTA 5CE3A 3TVZA 1NK9A 5L8RC 4FJNA 3T6BA 1GAOA 2JEJA 3ASMA 1NBEB 4CEFA 2X78A 3NCPA 4HTUA 3AXKA 1VRTB 3MMJA 1SH2A 2MQNA 4NMXA 2RE2A 2KG0A 4JKGB 2E9ZA 4Y34A 5M1PA 2DNPA 1NK4A 1QHTA 4CGHA 5JVGQ 4IJNA 4J9VA 3QT5A 4ZDNA 1NMEB 4B8AB 3HVTB 4JI4J 4Z4EA 3O9RA 1DJ0A 3BKUA 1RAIB 3CDWA 4YR0A 4A46A 1BU6O 3FFIA 1UA1A 3SQ4A 4OO1J 2XMWA 2LKZA 1W0HA 4DOZA 5E3AA 4BRIA 4KGXB 2BZ2A 1NGJA 1C4CA 2HWTA 5BXIA 2KFNA 1WEXA 2P9GA 4NLYA 5EDWA 1RWXB 2QC3A 4CJKA 3OFEA 1RADB 4DF4A 4W5TA 2HBZB 3A8YA 4WU2A 3VQTA 1HR0J 1TVRB 1LFPA 1LAWA 3NH0A 4FLVA 4YY3J 1RWPB 1KFDA 2R7YA 1GMUA 2LQ5A 2ITMA 3CCZA 2FF6A 3CCMS 2YKOA 4Y6IA 4C0BA 2VDHA 4UZBA 1RTDB 2VPZB 3THWB 3M2RA 1KC8O 2OMOA 4N5SA 4I56A 2AKWB 1QM9A 3K0JA 1VQMS 4H4OA 3QGGA 3M7VA 1WACA 3HSJA 3J80U 1FXRA 3MCMA 2ZD1A 1EKRA 1GLLO 4CJFA 4OPAA 3JB9k 1Z25A 3L9ZA 3HFZB 4DL4A 3CJSA 1PJ6A 3JSMA 2ZM6J 1SC3B 2QK9A 4OHXA 2IDOA 4ECRA 2FTRA 2ZWOA 3W8GA 2EI5A 2M7SA 4K4ZA 2K06A 5AQTA 3AARA 2QSWA 1AA1B 4ID8A 1XNQF 1Y00A 2G8WA 2JWKA 1WEYA 4LR8A 1E6VB 1KVJA 3MCOA 3N5FA 3PJXA 3D2EA 3MMCA 3PYGA 3C7NB 4BC5A 2ZZNA 4ID5B 3AHPA 4DTNA 4RG8A 1Y10A 4CYUA 1DLOB 2D3O1 1XQSC 3CDBA 4FO0A 5JS2A 3FZ2A 4KBIA 4NASA 2DPJA 1MN9A 3SMPA 2YKPA 3OTOK 4OJRA 5C24A 3CUNA 4HDHA 1FCAA 3C66A 5HOOA 4B3RJ 3I0SB 2OPPA 3FMWA 1SH0A 2Z2LA 4BE1A 1S72S 2R7QA 3PW4A 2EX3A 1XNRK 3EUNA 3IRWP 1EXQA 4NWBA 4G1QA 1M5SA 2KXNB 3E2EA 2YHXA 1EETB 2VIHA 3N9UC 5GMDA 1GMWA 1FJCA 1B92A 1CJVA 3MMAA 1MU2B 2VJVA 3WC2A 5HP1A 4BRMA 2KQ2A 2CGKA 3C6HA 2QT7A 1YXQA 2MKHA 4BC2A 4OV1A 2O4GA 3SBGA 2F8TA 3R5AA 4ZVGA 2NXEA 4LF5J 1Y3JA 3OR2B 2FLPA 4WE1A 4V19S 4B3MF 3WUHA 3GFZA 1UETA 4NXNK 1WHXA 2VPXB 2B51A 4E7JA 3MPVA 1JK9B 2DBBA 2HVZA 4DQQA 3FE1A 3P8BB 3WEEB 3HSZA 4RNMA 1I51B 5GADP 2DGUA 5M2UA 3CIPA 5DQGA 4KV8A 5J2QA 4B9MA 1HI8A 1RACB 2EFOA 2QM1A 2D0BA 4OI6A 4UOCA 1IVZA 5IM0B 2YKNB 1FO1A 5KFMA 4P7VA 5B0EA 5CD4A 1NGCA 3Q2TC 2K3KA 4ZOSA 2AGOA 2UXDJ 2RKIA 4NLOA 2ERRA 2IJRA 1NSKL 1CBKA 1FWKA 2Z57B 1Q7LB 2EVZA 3RVCA 1QQCA 3TI0A 3Q83A 5F9LA 4WTOB 4BROA 1FK9A 2IDEA 1ZM2A 3RMCA 1WF2A 3ZSRA 3AVAA 1NM1A 2JH3A 4C1NK 3TW0A 1GH8A 2FSJA 4O3QA 2ETJA 2F7TA 3BQ1A 3VETA 4KAZA 2C22A 1NB7A 3KUGA 4K8RA 4NA3A 2ZGZA 2FGCA 5GIPA 3WX8A 1SL1A 2MEWA 3BH7B 5DDRC 3EGWB 1B0TA 1XN9A 4ZJQA 2QA4N 2LMIA 1HBMA 1ZM4A 3FCVA 2MKSA 4UOHA 5J2MB 3R1XA 1WBDA 2HNDA 3BREA 3BGRB 2W7OA 2GWKA 1S5ZA 3I0RB 5AQVA 3K5PA 4HWIA 5DK5A 1RT7A 1ZH5A 3R9PA 2Q36A 3J8AA 5IC4B 2GVDB 1I94K 4OKJA 3JYTB 3M3ZA 4E1NA 3EVWA 3J7Z5 1RWOB 5KFJA 3SUQA 3ILOA 4DR1F 1JLAB 1R43A 3SLCA 3IR7B 4FS1A 4A8QA 3QZ8A 4DR2K 1XMQF 3J81U 1CLQA 2V8DA 2ZOMA 2DHXA 2BQ3A 2F65A 3C6TB 1CPZA 4DCOB 3UE5A 4IO9L 5A6WA 4BRDA 3VGUA 1W26A 3EZWA 5HBMB 3B6OA 5AQQA 5HRPA 3G9CA 3ZLJA 3QPIA 3OTEA 1QAIA 2ZH8A 1QSYA 5HQMA 1PYTA 3HZGA 3NRBA 3O44A 4W92B 1AZSB 1P8GA 5HO4A 2W24A 2YX4A 4WP8A 4J9SA 3IFEA 2P9UA 3EZ5A 2IS3A 4U8YA 3V6HA 3Q8QB 1J9AA 3FZBA 3AA9A 5FJ4A 3ZTQA 3Q0AA 4ICLB 4IG3A 2XQCA 2GTDA 4QR2A 2QL5B 4Z0UA 1N34K 2ZH3A 3KD1E 3PX0A 3CCSN 4M5MA 2CA9A 1GMWD 4RJVA 3C46A 3BS9A 1XTZA 3AH6A 4IBNA 4FJJA 5L9NA 2YBVA 2VPWB 4EK2A 3CIZA 3VGLA 2HKEA 1ZM3A 5LL6Z 2BACA 3QEXA 4DR3F 2BJEA 3CD7A 4CECA 4B1ZA 2AX1A 5K5MA 3O3GA 1IO2A 3ULDA 2GV1A 2HS3A 2V69A 3O4QA 1FRMA 1C2PA 3BEGB 3LDSA 5GADI 4PYDA 2LEAA 2RHKA 3BN7A 1DFDA 1K0VA 3DRPA 2NRWA 4IXCA 2WK4A 1TMMA 4CP5A 2G8VA 4B9SA 4FWRA 3OYNA 1RT2B 3DKDA 2M52A 3EE9A 3R8YA 4DN9A 4CH1A 4L73A 5C2DA 3ZZRA 1TKTB 3KLEA 2J8SA 4OQJA 5DZ7A 1VR6A 1R8CA 4BR0A 3IRXA 4KH0B 4AQYK 3ZZPA 3KLHB 1HYSB 2RT3A 4FYWB 3WXKA 1CS4B 4Q5VA 1YITS 2ZITA 4CZLA 1FKAF 4RO0A 3ZEUB 4OMFG 5KFIA 5LJ5Y 4IFYA 2H54B 2B6AB 4DWIA 4XPEA 1XMQK 3GIJA 4IZ9A 2FZGB 3V1OA 2E29A 4KBOA 3SFGA 1E4GT 3QIOA 2YQ3A 4I2QB 3AOBA 1FD8A 2IJNA 1DHMA 1U8WA 2HAIA 5B0CA 3OS0A 5HMYA 1YK9A 2NLXA 4F26A 1VC0A 3IR5B 4FK0A 4MKBA 3SI8A 2C2KB 1M5HA 4DR7J 3EGZA 1T9TA 3JTOA 3MXIA 4LRDA 4ZS6A 3FBEA 3UD5A 5AXMA 5GIOA 1U2FA 2FJAB 2YQ1A 4DPOA 3VQDA 4BRPA 4IOXA 5G0RA 3R7NB 2VFTA 2CPEA 5KFPA 3MD1A 1MWZA 2DNKA 2F7VA 3ISZA 3QFWA 3LP3A 4ED1A 4K7QA 4B1UB 5KFQA 4J5OA 3HVTA 1GXUA 3W5XA 5A8RB 4IOAQ 1WSJA 3H8YA 1YF5L 2YNFA 3V9SA 3U9ZA 1UJ5A 1UVKA 2Z2MA 4ZPTR 3HKZD 2MQLA 4F2SA 2XYGB 4MYUA 2FBYA 1F9FA 2BA9A 1TV6B 1UKUA 2WHOA 2KXFA 1RAFB 2PDAA 3V6KA 3FZFA 3R5CA 1AFJA 4LF2A 3U8XA 4JI5K 2EWHA 3C6UB 4J91A 3GJSB 3G6EN 1RCXB 4ZVHA 2DIUA 2V51B 3CVKA 2QMUB 1X4BA 3IWNC 1VSFA 4WBFA<