1JLBA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
554
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 148
structure length 549
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlbA05
3DRRA 1S0NA 5KRSA 3F9KA 3Q8RB 1WSHA 2ALZA 2KZZA 1Q9YA 4AH9A 3RB3A 3ZT3A 4CJVA 5E41A 2KQ2A 5J1EA 3MXJA 4PUOB 2JC1A 4MKAA 1S1XA 2A1SA 2YNIB 3T1AA 2RPIA 4ZP9A 2HHTA 3H2LA 4J9KA 3CVKA 4B9NA 1S1WA 3S3MA 2IM0A 3DOKA 4TYBA 1EP4B 3OYLA 3G6YA 1TP7A 1TGOA 2R8IA 4RW6B 3M8RA 2OPSA 3V6JA 3SQ4A 4M41A 5FRNA 3GIJA 4ELVA 3ICLA 1J9AA 3HL8A 5F8LA 2X6SA 4ID5B 5KFBA 4NYZA 3V1QA 3FQLA 3JYTB 3SQ0A 1HNVB 1LWFA 1BHLA 3LALA 1LV5A 4ED7A 4EBEA 3TAMA 3V6DB 4JS4A 3GIMA 1ASVA 3CJ3A 4OVLA 3QGHA 4JV2A 4DSKA 4ZTJA 2I5JB 2AX0A 4XO0A 4IH5A 2OPQB 1IM4A 4Y3CA 1TK8A 2R2TA 4DL5A 5KFLA 2IDOA 3HT3A 1D9DA 3I5AA 2E6LA 3MR5A 4CJUA 4DU1A 4KI4A 4WFZA 2HMIA 4M45A 2B43A 3MEDA 1LW0A 3OYEA 4UQGA 3NF6A 1LW0B 2B6AA 3DRSA 5KG7A 4KREA 3Q8SB 2EHGA 4ZPAA 1CSJA 2HMIB 2W42A 3RMBA 4J2BA 2FVPA 2D3ZA 3LWMA 5DG7A 4DTRA 5KG6A 2C2RA 2KTQA 4NCGB 4IG3A 5EWEA 4FLXA 2OA8A 2W7OA 2I5JA 5DLGA 3TAMB 3V6DA 1BQMB 1K1SA 1UA0A 1HNVA 4KKOA 1ZYQA 3SNNA 3I8DA 3BR9A 3PUFA 3KHLA 2W9AA 5C24B 4FK0A 4ECTA 4Y2AA 4NLTA 5KFJA 3AVGA 3ASMA 2OPSB 4HUFA 4DL6A 4CF9A 1IKYB 3B6PA 3CM6A 3KMQA 3PX0A 1JLEA 3DOKB 4W5RA 4KTWA 4CF1A 2BE2B 5KFSA 3QZ7A 4HKQA 3VQAA 4LQ9A 4JV1A 1B9FA 3OL9A 1JLAB 1IKXB 4PUOA 5J1EB 3H4DA 2FVRA 2FBTA 1WSFA 2FBYA 4KI6A 3LPTA 4XIUA 4OKEA 1T3NA 3TAQA 4EEYA 4NZ0A 4Z4IA 2UVRA 3QNOA 3VQ4A 1HQEB 5J2PB 2C2EA 2YNGB 3G10A 2XI3A 4KPYA 2OPRB 3MFHA 1F21A 4CJKA 2WB4A 2O5DA 2X78A 3CFPA 3KK3A 3GIKA 2OPPB 4CHZA 5FROA 1JLAA 3HPOA 2HHVA 5KG1A 4BWMA 3RB6A 2BE2A 5HRNA 5K14A 3JSMB 3QEIA 5L1IA 2UVWA 4ELTA 1JLEB 4YNQA 3GYNA 3KTQA 1X9SA 1VRUA 3TAEA 3DLBA 3HVAA 4NLSA 4DMNA 3U3YA 5HLFA 4TSXA 5C24A 4Z4EA 4H4OA 4Q45A 3VQEA 1BI4B 3MXMA 3O3GA 1JKHB 4R5PB 4KKOB 4E89A 5HROB 1BQMA 4DF4A 3NKYA 4AHUA 1T8EA 1SV5B 4F2RA 3DLRA 4HCCA 4J9MA 4ED0A 4EZ9A 2IJFA 3HYFA 3V9SA 3PW7A 1SKRA 2W8LA 2QKBA 2XWYA 1C0TB 1RDDA 2FJXA 1TVRB 3UDLA 1QAIA 2C2DA 3BQ1A 3QIPB 1VSMA 3THVA 3PVXA 2XC9A 2W9CB 3IG1B 3LP1A 3K5LA 4X2BA 5F9NA 1FKPB 3FSIA 4NYFA 3MEDB 4DTNA 3KLIA 4CJ5A 1S9GA 1GX5A 1NNDA 1D1UA 3MXIA 3QEWA 2ASLA 2ZE2B 1LAWA 1YVUA 3OL6A 1N48A 1DTQA 3OHBA 2UVUA 1KFDA 2W9BA 4C8KA 4AHTA 2G8VA 4ZHRA 5I42A 4FBUA 1W0HA 4FJXA 3OYHA 4K4XA 3PW2A 1EX4A 2NUBA 1Q9XA 3MEGA 3BSCA 4I2PB 4ED2A 3U6FA 4I2QA 4RW9B 4DU3A 3HO1A 4GC7A 4NLYA 3PJWA 3OLBA 3BGRB 3CDEA 3VQBA 3D28A 1N56A 3MECA 3DRPB 4RW6A 2VG7B 2O4IA 3ALYA 3HP9A 1EP4A 2GV9A 4TN2A 3BQ0A 3AA4A 2HNZA 3QIDA 4R8UA 2HB5A 1LWCB 1VSLA 2YKNA 5KFNA 3OYMA 3OYNA 5CYMB 1S1XB 1TL1B 4HVJA 1TKZA 3PY8A 5CZ2A 4Q44A 4Q43A 3AVLA 2VG5A 3PO4A 3S9HA 4IH7A 5HP1A 2FVSA 4B9SA 5KFCA 3GV5B 3KLEB 1RDBA 2JGUA 4KFBB 3K58A 3SJJA 3OSNA 4EBDA 2VG6A 3DRRB 3DI6A 5KFFA 1D9FA 1T7PA 4E1NA 4AHVA 3AVMA 2E9RX 4KAZA 1KVBA 3OYFA 5KFWA 2HHSA 1XR6A 3HVTA 1UWBB 4DTUA 3MF5A 3O4QA 4F2SA 4WZQA 3L2UA 1MMLA 2EX3A 3O3HA 4DFKA 3I5BA 2JC0A 1JXBA 4ID1A 2HVHA 1YVFA 3OJSA 1YT3A 1S48A 3DM2B 3SV4A 1GOAA 3H5XA 2HHWA 1KHWA 4FJGA 5DK5A 2ASJA 3VQ6A 1HNIB 4M42A 3I0RB 2OH2A 2F8SA 2B5JA 5F8HA 1NKEA 3LAKA 2R8JA 2DPIA 1CZBA 2LSNA 1MU2B 4ECVA 3C6TB 1S1VA 4PY5A 4FJLA 3KLFB 1KCFA 3DLEA 1HMVA 1RT6A 2RF2A 1SL1A 1FXXA 4OPKA 5KFQA 4DQRA 2DFHA 2PZSA 1HRHA 4FW1A 4YFUA 4F8RA 4ICLB 2AGPA 4N76A 1RA7A 4DG1A 3ZT4A 5JS1A 3OS1A 1NK8A 2XGQA 5C42B 3DMJA 3KK1A 2YKMA 1TKTA 1VRTB 2FLLA 4DTSA 5KT6A 3V6KA 2F8EX 4CJEA 3EPGA 1IH7A 3AA2A 3MEEB 1RT5A 3RB4A 3L2QA 3LP2B 4J9NA 2AGQA 5D3GB 3H4BA 1S1TA 2B4JA 2OZMA 4CECA 3PV8A 4EP5A 4ECWA 2XY7A 1XR7A 5KFRA 1FK9B 1JLCA 5KG5A 3RRHA 1QQCA 1RT3A 1R0AB 4MK7A 3H40A 4TQSA 3OYDA 4K50A 3NAEA 4CFDA 1RTHB 1CZ9A 1RTJA 4DQIA 1RDAA 3VQ7A 1RBUA 2RDIA 1R0AA 3SPZA 4CGFA 3K59A 1FKOA 2D0CA 4EYIB 5DG9A 3UR0A 4E3SA 4IRKA 4EO8A 4IFYB 4RNFA 4M3YA 5J2MA 2OZSA 3KLHA 5D3GA 4ED3A 4ECSA 4FZXC 4WFXA 3K57A 3V9ZA 3QYYA 5EUHA 2G8UA 4QW9A 3ZSOA 3KHGA 2W8KA 4WYLA 1JXLA 4DL4A 4O5BA 3NDKA 4URQU 4MKBA 3ISND 4ZMMA 3RR8A 4MFBB 1S0MA 1RAJA 2X6NA 1IG9A 4F4ZA 4FJ7A 2BANA 4XPEA 3G6XA 4M3UA 1S6QB 4QPXA 5HBMA 4Q8FA 4ZPCA 4QW8A 4CJ4A 3AO4A 4CERA 1U09A 3MAQA 3QNNA 3K5MA 4O44A 2RF2B 4KHRA 4BWJA 5DGAA 5C25B 5JXSA 3ZSZA 4CEBA 4BDZA 3SUNA 4KTQA 3C6TA 3H5UA 4Y2CA 3NBPB 5HRRA 1B9DA 4CEFA 2C22A 4E7KA 2FJWA 1NK4A 1X1PA 3L8BA 3I0RA 4W5NA 1RT2A 4E7JA 3M8PA 3SCXA 1TV6B 2IMWP 1Z25A 2KW4A 1JLQB 4J9QA 3HP6A 3PO5A 5EU7A 2VWJA 3GV8B 4LQ3A 2FVCA 1TK5A 3M8SA 4WXOA 5KRTA 4LY7A 1JLFB 1JLBB 4CHNA 3C95A 4ED8A 1NJZA 2YHAA 3TAFA 4OGCA 1C2PA 3HVTB 3PX6A 3QZ8A 5KI6A 3CDWA 4OLBA 3OJUA 2P5OA 1S4FA 1NJWA 3LZIA 3DI6B 5KFVA 3T5LA 2VG6B 2R8GA 1W9HA 4KO0B 4KFBA 4J2DA 4QWBA 3CWJA 4KHQA 1RT7A 2GBZA 1U45A 1L5UA 4DFMA 2HNYB 5HP1B 4K4TA 4KTZA 3CIZA 1RTDB 2VG5B 4IFVB 3AVNA 4TXSA 3T5JA 1XHZA 3PW0A 4KSEB 2F8TA 4IOBA 5CYMA 1TKXA 1S0OA 4N56A 3AO1A 4J9OA 1EETA 3RB0A 1EKEA 2ITGA 4M3RA 2R7YA 5KFMA 2FBVA 4FLWA 1LWCA 2W7PA 3NL0A 2J6UA 3AVBA 5J2MB 4HUGA 1JXEA 4RNOA 1D0EA 5F8JA 4TY8A 3PX4A 1JL1A 3BGRA 4RW8A 4FJHA 1SH2A 2IJNA 3LP3A 4I9QA 4CIEA 3C6UB 4IQXA 1A5VA 3MEGB 1RBSA 3VQCA 1N6QA 5T14A 3NHGA 1SUQA 3RAXA 4QWAA 4KHYA 2Y1JA 2J6TA 4B9MA 4CFBA 2OYQA 2W9BB 4MH8A 1JLGA 3VN5A 1WLJA 4FM0A 2RN2A 4ZVGA 5DGBA 3V9WA 1S1TB 4RW7B 2ZE2A 2Z1GA 1WSJA 5KFOA 4FZYA 3LP2A 4YMEA 3H08A 5KT7A 1RT5B 3NFAA 3OYJA 1S9GB 4Y1DA 4E7IA 1ZTWA 4PWDB 4B3OB 1NK0A 4F4WA 1FKPA 4ECRA 2P5GA 3TQ1A 1VRTA 3NH2A 4GW6A 1TKTB 5KT4A 4U6PA 2EC0A 4K4VA 2IC3A 3QESA 5C42A 3KK1B 5F8MA 1NJXA 3QIPA 2HWHA 3QERA 1RYRA 4ICLA 3BSOA 3RMAA 4C8LA 4FJNA 4I7FB 1SKWA 1C1BA 4CEZA 4CJLA 1C0TA 3I0SA 4EBCA 1KHVA 4F4KA 4CFAA 1HARA 3O4NA 2BGGA 4E1MA 3NE6A 4OKKA 4PQUB 1UA1A 1SV5A 2DFEA 1HMVB 2D5RA 4AHSA 2E9TA 5HROA 1J5OA 5CZ1A 3TAGA 1TL3A 4YR0A 4R5PA 2IAJB 4NLVA 4BACA 4FJMA 2BQRA 3TANA 4FZZA 3L2VA 3PJXA 1HNIA 2R8HA 4DSLA 3HVRA 3VA0A 3EY1A 1VRUB 3SV3A 4N41A 3AVAA 4ED1A 2ATLA 4C8NA 1T05A 3QGIA 1QUVA 2PYJA 5KFKA 4O3OA 4DFPA 4CJ3A 2V0NA 4O55A 1Q8IA 2P1JA 2D41A 3SZ2A 4RW4B 1DTTB 4DTOA 1BL3A 1C1CA 2V4QA 1S10A 4O3SA 3HHKA 2AJQA 1SH0A 2BR0A 3PZPA 4KB1A 1UWBA 3DOLB 4YP3A 1CXUA 4Y1CA 3G0ZA 3S3NA 3NGZA 2QV6A 1ZBLA 1KTQA 3CO9A 4IG0B 2X74A 4F3OA 3RAQA 2Z1JA 3FRZA 4W5QA 4LD0A 3IN5A 3FDSA 3HPHA 5KFEA 4M3ZA 4DQPA 4Z4CA 4CK1A 4JRQA 4NLXA 1QHTA 4FJ9A 4IH6A 3KLEA 3OLAA 3PR4A 4CJFA 2CJQA 3QEVA 2WOMA 3RBDA 1A5WA 4CF0A 2IBKA 5SWMA 4IRDA 1IKXA 4IR1A 2XY6A 4J9SA 1S5JA 1KVCA 1ASWA 2YNHA 4J9LA 4CHOA 1VSDA 4LH4A 2YKNB 5KFHA 4EYHB 3ZT0A 1U47A 2HNZB 3D0PA 4Y34A 4FCYA 3AO5A 3MTKA 3L3UA 3ITHA 2FVQA 2R2UA 2D3UA 3DRPA 1NK7A 3MECB 2DTUA 4DEZA 2ZD1A 1U4BA 1W25A 1QAJA 2ILYA 3WNGA 1QSSA 1LW2B 4I2QB 4RW9A 4NLRA 4DQQA 4I2PA 4YR3A 2Z1IA 1G15A 1A5XA 3NF8A 3AA3A 4FK4A 4OKJA 4DU4A 2GC8A 4QWEA 3F73A 4ZHRB 5I42B 3VQ8A 1HYVA 1NK9A 4NLPA 3MFIA 1S49A 1T94A 1L3TA 3P1GA 1KLNA 2XGPA 1J54A 1DTQB 3I5CA 3CYMA 5KGWA 3VQ9A 5F8GA 3RMDA 3CJ5A 4IG3B 3MR6A 2D0AA 3LP0A 3TABA 3CFRA 3VQSA 4LH5A 3V1RA 1XR5A 2PYLA 4NYNA 3DRSB 3D5MA 2B6AB 1RT1A 4N5SA 1VSEA 3IG1A 1IKVA 2KFZA 3HJFA 1UOCA 2DY4A 1N5YA 2IM2A 4DLEA 2HHXA 3FQKA 3ZSWA 1TVRA 3SYZA 2FBXA 3P5JA 3QINA 3LP0B 1BCOA 2HHUA 4C8MA 3SUOA 1HYZA 2OPQA 1K1QA 4E7LA 4GMJB 5HRSA 3SPYA 3HVWA 2VA2A 3IAYA 1IO2A 4CJTA 3JYTA 1JKHA 3EZ5A 3RWUA 4RZRA 3FFIA 3ISNC 5KG2A 3SUQA 4CF8A 4ID5A 3CJ0A 4IRCA 1XWLA 1U04A 4MQ3A 1BI4A 5KT5A 4H4OB 1LW2A 1BISA 3VA3A 1YTAA 1BQNB 3UQSA 4AHRA 3LAMA 4NLUA 4DTJA 1KFSA 4NCBA 5DLFA 2QXFA 4CGGA 3NH0A 3ZT2A 3H98A 3PW4A 3AVJA 3NMAA 3T5HA 4BE0A 1GX6A 3VQ5A 4Q0BB 1RYSA 1WSGA 3NGDA 4CHPA 2YNIA 3DYAA 2YNHB 2Z1HA 1Y97A 4CFCA 4JLHA 4BDYA 5L1LA 1Z4UA 4FLZA 4RG8A 3OS2A 1QSYA 3BSNA 5I3UB 4ZPDA 4RNNA 2OPRA 3V1OA 4C8OA 2ASDA 1REVA 4RNHA 2YNGA 3OYCA 1D5AA 5KFUA 4NCAA 4O3QA 4IG0A 4J9RA 1REVB 5KFTA 3SQ1A 5I3UA 3B6OA 3NH1A 3E01B 4URSA 3HM9A 2R8KA 4CGDA 4M95A 2XCPA 4QWDA 2BRLA 5KFDA 5DG8A 4CJRA 4RW4A 2WRMA 3DYAB 1NK5A 3BJYA 4QCLA 4NLGA 4FS1A 4M3TA 2GUIA 4Q0BA 4O3PA 1ZBFA 4B9UA 4ZP8A 4WZMA 2R2RA 2JEIA 1IKYA 1KLMB 1NKCA 2VA3A 3AV9A 3M8QA 2YHBA 4HHTA 1BQNA 4FJIA 2PY5A 5JS2A 4KHWA 3FFIB 2IAJA 4QWCA 1TL3B 3WNEA 3KNAA 3DLGA 1XI1A 3KOAA 3ZT1A 4ZP7A 2WCXA 4KV8A 1X9MA 3AVCA 3V9UA 1DLOA 4BDPA 3E51A 2P51A 4NCGA 3OS0A 2IM3A 3G6VA 4L8RB 3TARA 3K2PA 4O0IA 5KFXA 1ASUA 1K6YA 1C1BB 4I7FA 1TAUA 4HTUA 4LSNB 3V9XA 1N5YB 4Z0UA 2IC3B 1IKVB 4DTPA 4KHSA 4KAIA 1RT1B 2WHOA 3AVIA 4K4WA 5KFIA 4CCHA 3NCIA 4M3XA 4B3OA 1XHXA 4PWDA 1BGXT 3IGNA 2ETJA 1QTMA 5L1KA 3K5OA 1TK0A 3NGIA 2XCAA 3ZSQA 2G8WA 4O0JA 2G8IA 2Q3SA 4FM2A 4G3IA 3QGGA 3OYKA 4MK8A 4CESA 1JLGB 3MR3A 3GIIA 1S9FA 2BDPA 5KG3A 4MIAA 4E0DA 4DL3A 1LWFB 2R2SA 1SUQB 4IKFA 3TVKA 4ELUA 3AVHA 1N6QB 2JEJA 1WAFA 4CGHA 3LPUA 1N4LA 5FRMA 2ZD1B 2UUTA 4RUCA 4ECZA 3SI6A 4TQRA 3S3OA 5FDLB 1RILA 1KSPA 3UIQA 3ITHB 3QLHA 4DTMA 3DLKB 1S1WB 4O4GB 2FC0A 4AHCA 2IGIA 5CYQA 1EETB 3CG7A 4DLGA 3IS9B 3KIOA 4IFVA 4FLTA 4H4MB 2WOMB 2JLEA 2HNYA 3M9OB 1RT7B 3ZSYA 4GVMA 4CGJA 2YNFA 4LSLB 1BIUA 1RBRA 1B92A 4KO0A 5L1JA 1U49A 4XPCA 4KBIA 3SFGA 3KJVB 1UAXA 1LAVA 3QO9B 2JEFA 4ECUA 4DS5A 4EO6A 4URGA 3NF9A 4DL2A 4CIGA 4CJWA 4CEQA 1VSFA 2XO7A 3DOLA 3VQQA 4WXWA 2QKKA 4NLWA 4WE1B 3KKRA 4Q8EA 1WSIA 4K4SA 3KHHA 2VWKA 3AO3A 1C1CB 2UUWA 2FJVA 2A1RA 2HNDA 1DTTA 3RBEA 4FLVA 3OSPA 4W5OA 1C0UA 1HPZB 4ECQA 2WONA 3VQPA 3AVKA 5KG4A 2DPJA 2ZKUA 5KFYA 2XY5A 2CKWA 4CJSA 1JLQA 1T05B 5F8NA 4N47A 2BQUA 3OHAA 4FLUA 3CFOA 3V81B 3BSAA 3L3VA 4F4YA 3KLGB 3M9NB 4ED6A 5C5JA 1HQUA 1S1UB 1JIHA 3V6HA 2E9ZA 5T7BA 2AWZA 4CEEA 1J5OB 4AILC 4FJ8A 5C25A 3KK2B 3OL8A 1XC9A 4Z4GA 4ZPBA 4O44B 1QE1A 4PQUA 4FJJA 1RTIA 2ILZA 4TY9A 3NAIA 2GIRA 4MIBA 4OLAA 1TAQA 5HBMB 4FBTA 1JX4A 2DFFA 1S6QA 4QOZB 3I0SB 1LWEB 4JS5A 2UVVA 5EWGA 4EP4A 4IDKA 4J2AA 1RT4B 3PR5B 1NHVA 2XI2A 1ZETA 1WN7A 2D7SA 2HVIA 1RBVA 4MFBA 3SUPA 3H5YA 1ZBHA 4NRUA 5KFZA 2D0BA 2HWIA 2AX1A 1U48A 1KRPA 1IKWA 1TQLA 4ZTFA 2IA6A 3V4IA 4JUZA 1GOBA 3NF7A 3H5SA 1WNEA 4RW7A 3IRXB 3KHRA 2RKIB 3QIOA 4IFYA 4MK9A 4DSIA 4K4YA 2AQ4A 2I1RA 1D8YA 4B9VA 1FKOB 5J2NB 4NLQA 1X9WA 1S9EB 4OGEA 4G1QA 1T03B 1RTJB 4RU9A 5J2QB 4O3NA 4NLDA 4ZP6A 4WYWA 3GQCA 1BCMA 4CGIA 3OY9A 1QS4A 2QK9A 4CJPA 4G1QB 1T03A 3C6UA 1RA6A 4CK3A 3GV7B 4OPJA 4KB7A 4FJ5A 3OYBA 4RW8B 4O3RA 1NOZA 1WNSA 4NRTA 3P83D 4TY8B 1VSKA 5KT2A 1I39A 3TAPA 2E6MA 3PHEA 4DWIA 4YQWA 4H54A 2FLNA 4FS2A 4OJRA 1SL0A 3Q8PB 1RDCA 3WNHA 5DQHA 3SQ2A 4KHUA 4KHMA 3KLVA 1NKBA 1IKWB 1ZTTA 2F96A 3D45A 1RNHA 1TKXB 1WSEA 3VQDA 1S6PB 5KT3A 1KVAA 2HHQA 4BE1A 3HXMA 4U7CA 5CY4A 1HJRA 2AU0A 2WK4A 1RTDA 4Z4HA 1NOYA 3CJ2A 3DMJB 4DL7A 2XRIA 5EDWA 3L2WA 3HK2A 5DMRA 3LZJA 1RT4A 2AGOA 5JUMA 5KGXA 1VSJA 4CK2A 2V9WA 4FXDA 1Z26A 3QEPA 2HAIA 3TR8A 2C28A 3LDSA 4KRFA 3PW5A 1QE1B 3N6LA 3ZSVA 1L3UA 3KK2A 4GC6A 3KLFA 3N6MA 4Q5VA 3GILA 4HYKA 1MU2A 1JLBA 1S1UA 1JLFA 3M9MB 1O1WA 3QETA 1HYSB 1J53A 3AVFA 5KFPA 5HRPA 3KLGA 2B5JB 2J6SA 1TKDA 1NJYA 3RTVA 3CJ4A 1TV6A 3M8PB 1RT2B 3LANA 3L2RA 4FM1A 4B9TA 2WONB 4W5TA 3Q8QB 4B8AB 1C0UB 2JEGA 4JRPA 3KD1E 2IM1A 1HYSA 3SFUA 4DFJA 2KFNA 2HNDB 1C6VA 3NBPA 4CF2A 1ZBIA 4FJKA 4HCBA 3RRGA 4B08A 4WE1A 1VSHA 4FVMA 1ZBUA 2BRKA 4EZ6A 2FLPA 2ATQA 3T5KA 3UPFA 4TLRA 4DQSA 1NHUA 3KJVA 5F8IA 1CLQA 2HW3A 4KB0A 4ZVFA 2BANB 2YNFB 4LSLA 4TYAA 4DS4A 1YTUA 4KE5A 2RDJA 1L3SA 4H4MA 2XY8A 4CEOA 4IBNA 3HSTB 3IS9A 4R0EA 1TKZB 4ZVHA 3HPGA 1TL1A 1S6PA 4IR9A 4RNMA 3ZCMA 4FW2A 4DSJA 5CYQB 3N6NA 1C1AA 4R8UB 4HUEA 1OS5A 4O4GA 1I6JA 3DLKA 3KLHB 4DSFA 3OYAA 4M3WA 1I3AA 3SI8A 3H59A 3QLHB 2VG7A 5FDLA 5DQIA 3U3GA 3MR2A 4CEDA 2XHBA 2Y1IA 3TI0A 3NAHA 4QAGA 1RDRA 2G8HA 3KKSA 1RTHA 3BQ2A 2G8FA 5J2QA 3T3FA 3ULDA 4IKAA 1S9EA 1RT3B 5J2NA 4FK2A 2IOCA 1JLCB 1FK9A 3ZSXA 4CHYA 1S97A 4H8KA 2RKIA 4DTXA 3OVNA 3IRXA 4K4ZA 5KG0A 4ECXA 2G8KA 4J9PA 3V4IB 3O3FA 3A2FA 3MEEA 4CEAA 3EPIA 1ITGA 2BQ3A 1SL2A 4O4RA 4DSEA 3CM5A 4BE2A 3EZUA 3RR7A 3KLIB 2E4LA 3CDUA 1CXQA 1VSIA 5KFAA 3RMCA 5EWFA 3G86A 3LP1B 4I9LA 2YKMB 2W9CA 5L9XA 4DG1B 3C94A 1BIZA 4E19A 1SKSA 2GIQA 4ECYA 4LSNA 2KZMA 5DQGA 4IDKB 1LWEA 4WFYA 3AA5X 4F3TA 3CQ8A 1RBTA 3BREA 3EYZA 1DLOB 4KV8B 1RTIB 4CJQA 4E7HA 3QEXA 3DDKA 1GOCA 4PA1A 4CHQA 4FLYA 1RT6B 3DLEB 4Z4FA 3DLGB 2WTFA 3ZSRA 1S1VB 4OL8A 3LWLA 4JV0A 1WAJA 3TWHA 1SH3A 1EXQA 4DF8A 1HQUB 2ZQBA 5HLFB 4B8CA 4B9LA 2O4GA 5KTQA 5KFGA 3T19A 3M8QB 2IS3A 4CIFA 3BDPA 3V81A 1KLMA 4KHNA 3DLHA 3IGVA 3OL7A 2YV0X 5SZTA 3HKWA 5F9LA 3DM2A 3WNFA 5K14B 3JSMA 4K8XA 4K8ZA 4YR2A 1HPZA 4RUAA 1QSLA 1L3VA 2QE5A 3NGYA 4ZVEA 1NK6A 2OPPA 3KD5E 3KK3B 4FYDA 3KMSA 2V4RA 3E01A 4F4XA 4F50A 4J2EA 3OYGA 1C0MA 3OYIA 1RCHA 4K4UA 1JL2A 3AO2A 3QO9A 1HQEA 5J2PA 3K5NA 1VK0A 4CE9A 4NLOA 4M94A
chains in the Genus database with same CATH superfamily
1S0NA 2W6KA 1BUPA 3F9KA 1APSA 1WSHA 1HQ2A 1T3OA 1D4XA 2GX9A 1Q9YA 3FCHA 3WQPA 1YHQS 4EFAC 2R7WA 4IO1A 4JKHA 1P1LA 3BKFA 2WFBA 2J7KA 2JC1A 1XMOK 2A1SA 2CQBA 1KDNA 2YNIB 2RPIA 4EHTA 3H2LA 1QUPA 3CVKA 1HFEL 4B9NA 3TSPA 4TYBA 1EP4B 3OYLA 1WKLA 3DHWC 2CJYB 2ASYA 2OPSA 3OTCA 3PDNA 3SAGA 4M41A 2YWGA 2HQCA 1UVKA 5GAGU 2FTRA 1X3MA 3V6DB 4JS4A 2V5HG 3GIMA 2WVBA 3CJ3A 2Y3YA 2VFUA 3QGHA 3C19A 3O44A 3GE1A 4ZPVR 3TX0A 4XO0A 3WC2A 1IM4A 4BRFA 4YN3B 4Y3CA 2R2TA 3PFOA 1PJ6A 4F7VA 1WORA 4JNEA 4WKRA 1RLDA 3MR5A 5A8KB 3W62A 4DU1A 3N0VA 4WFZA 2HMIA 2DNNA 2JH3A 4AYBD 1GLFO 4CBXA 1HBNB 1KQSM 1S6UA 2CNNB 3OYEA 2EKYA 3W3SA 5AXKA 3MZIA 1P1TA 3AJ2A 2D3ZA 4EAHD 5KPZA 2K1RB 4XH1A 1I5OB 3LDLA 1OVYA 2I5JA 3MUTP 1CBKA 2RRBA 3GWCA 1VMBA 5CAAA 3TAMB 2ZJQL 4U96A 3IWLA 5M1OA 1BDGA 2WSCC 5A2QY 3IBWA 4J8FA 3WUHA 1G6BA 3OW2M 1RKIA 4NPOA 4JKFA 3RBZA 1GXTA 3KHLA 3VGUA 4ECTA 4Y2AA 5HMWA 3AQPA 4OLOA 2E1YA 3ASMA 3TVZA 3EVWA 4RL1A 1X5OA 4HUFA 1NXIA 2VONA 1H38A 1Z1ZA 3LGMA 1JLEA 3UCZP 3UO0A 3FVYA 4KTWA 2BE2B 5KFSA 3SEOA 1U8SA 1GLAG 1FXDA 4NXMF 3IA0A 3PIOQ 4DR7K 1IKXB 1VQ5S 5J1EB 3H4DA 1IBKJ 4WPAA 5M2PA 2RQKA 2VBXA 4BLGA 3LPTA 2UU9J 2IY5B 2OAUA 3TAQA 3RBXA 3B78A 2NS1B 2V9KA 2UXBK 3KKFA 4X65F 4XH5A 5HOOA 4Y6IA 2YNGB 2Y0SD 3O3LA 3TQEA 3G10A 2XI3A 4A8QA 1BXNA 3G87A 4KHPK 3MFHA 3TNVA 3H1VX 2QSWA 2WTUA 2XM3A 2GVDB 1WC3A 4Z37A 4CHZA 1JLAA 1RWOB 2UUCJ 1FJGF 2RRNA 2BE2A 5HRNA 5L1IA 2RB7A 4DX8H 4ELTA 4YNQA 2V8PA 5AQQA 3KTQA 4HI1A 1EB0A 1VRUA 2CDQA 1X9SA 3P5BP 4EIAA 5CE3A 5A0YA 3THTA 1S57A 4CZJA 2N7YA 4DR3F 2DNHA 5C24A 3PFEA 1BI4B 4A8FA 4G6VB 2VL1A 5IS2A 1FRLA 1JKHB 1SC6A 5HROB 3TA2A 1RADB 3NKYA 1T8EA 3D6TB 3QRQA 4AHUA 5GADI 4F2RA 4DR2K 4DV3J 1TUUA 3MWPA 3R5BA 4DPXA 2IJFA 3PSFA 3V9SA 3PW7A 2K1RA 2O8DB 4OIXA 3QIPB 2MY8A 1X4BA 5BR8F 3IG1B 2J0QD 4DCOB 1HBNA 1U6FA 2N4CA 2BM0A 3KLIA 1J27A 2QLWA 1S9GA 4NA1A 2ZHOA 2ASLA 2RH3A 1LAWA 1M5KC 1Q7LB 4MLHA 4P73A 3OL6A 1DTQA 3OHBA 1KFDA 3PRVA 3NOGA 4PEOA 4DR3K 1NDKA 4FBUA 4AL5A 4WKYA 4JN4A 1SQEA 2BBEA 3PW2A 4NXNJ 2AF6A 4WQ5C 4OZNA 4I2QA 4RW9B 3JAMY 3PJWA 1SIZA 3D28A 1IV0A 3WXKA 3MECA 3B4DA 2Z4PA 1YITS 2NRZA 1YDLA 2C2ZB 3AA4A 4I69A 1VQLN 3WX8A 2NCKL 4DUYK 5KFNA 2YX7A 3OYMA 4HVJA 4PL7A 1C4CA 1HBOA 1WSRA 4ANCA 5B0DA 1FWLA 3NS7B 2Q6BA 5DRKA 3CTRA 4B9SA 4QJVA 2IVOA 3HJVA 1ZAXA 4WJBA 3K58A 3ZX3A 2Y0BB 3DN9A 1J5EJ 4EBDA 3VVTA 1T7PA 2CQIA 2HKEA 1B3TA 2FY8A 2PDAA 3IFEA 4KAZA 3SQGA 4ILJA 5E0OA 1S76D 1UWBB 3KJNB 2Y9HA 2F1FA 5AQIA 3MF5A 2P9SA 4F2SA 1MMLA 5DM6L 4OI2A 3POTA 5HMXA 3CCUS 4YB6A 5BN8A 3M6XA 4IOCL 4PRFA 3T1YF 3HMJG 4HHUA 3TJAA 4ID1A 4U67Q 3OFEA 3D66A 1CPZA 4N7TA 1NLKL 4A8KA 1YT3A 3DM2B 3T41A 3D2FA 3GJSB 2KG0A 3SV4A 1LWXA 2CQPA 2RUGA 2HHWA 2R3VA 3MN5A 3M6UA 3RSEA 4DUZF 3I0RB 2OH2A 2B5JA 5F8HA 4JI3K 1PJ5A 2HVZA 1IM6A 3UKUA 5TKYA 3PIPQ 3HDSA 1CZBA 2LSNA 3TP2A 4ECVA 4N8NA 4Z7YA 1S1VA 4PY5A 1TU0B 3M30B 2DNMA 1VQKS 2DFHA 4YY3J 1JXVA 4U9RA 5A8RB 2XB2D 2WVCA 2XSJB 1T3VA 3W64A 2G0IA 3ZT4A 5JS1A 1SJ1A 1IBLK 2DVIA 3I33A 4CI0B 4YUDA 3MMBA 5KT6A 3V6KA 2XS2A 3AA2A 1IH7A 1TYQA 1I1GA 1VQ9N 3L7UA 3T1HJ 4LFCK 3EXYA 3R7BB 3LP2B 2VB6A 4WBFA 3H4BA 1XIQA 2FUG9 2OZMA 1YJTA 3PYFA 3MM8A 3HOTA 1QQCA 1R0AB 2PD1A 3H40A 3DU6A 2F9JA 4JYAJ 1JK9B 1EO1A 2IDEA 3QRPA 1H2VZ 3CJ9A 1DBDA 4DUZJ 2RDIA 2P9IB 2P9LB 1AT1B 3K59A 5D0HA 2D0CA 5DG9A 4E3SA 2ZNZA 4EO8A 1FTCA 4RNFA 1MN7A 4I6MA 1GLCG 5D3GA 2H51B 4CTAA 4KJIA 2QWMA 1AUDA 3GMGA 4BQZA 3PXGa 3UN3A 3TZZA 3V9ZA 3QYYA 4QW9A 1DQ8A 1HA1A 3QB0A 4DL4A 3LW5C 3ISND 3X1LB 3HZGA 4DUYJ 1Q1KA 3M05A 4LF7J 2BANA 3AH6A 4K0KF 4I56A 4YDXA 4XPEA 4DQ8A 2E1PA 2F4VF 1S6QB 4QPXA 2B56A 3L9ZA 4A59A 4EK2A 1YZ6A 3HLUA 2NUHA 5I9EB 1SJFA 2V2ZA 1BWFO 3J8AA 4FYVB 2B4OA 1Y64A 4USIA 3LO3A 4WP9A 1SC1B 1HWIA 2XEXA 3N5BA 1WHXA 4O44A 3PM9A 4WQ5A 2E5JA 4C0BA 4HVZA 4KTQA 3SUNA 4Y2CA 3VGTA 1RJJA 2DNPA 3SMSA 2Z2YB 4E7KA 1BY9A 1VQ7S 3L8BA 5H9EK 4E7JA 4FWNA 3K0JA 5D77A 1Z25A 1LFPA 3NRBA 2QEXN 1TR0A 3MCSA 3LM9A 3HP6A 2CWKA 2F4VK 5ETTA 4LQ3A 4XDDA 3KXDA 2AV5A 1NEEA 4LY7A 4CHNA 2QGFB 4HH0A 1J5EF 4R0JA 4CIOA 1GXLA 2YHAA 3O9QA 2CZVC 2MKHA 1TUWA 1C2PA 3HVTB 3QQCD 4BG8A 3QZ8A 4OLBA 1UEVA 2D0PA 3AOBA 4LRDA 3LZIA 3DI6B 3T5LA 2VG6B 2JX2A 5ADXA 3MPUB 3MM7A 2WC9A 3E9LA 3D3BJ 2I7PA 1L5UA 2GBZA 2FHOB 1W26A 1CJKA 1YXQA 3C7NA 3WIUA 3O1WA 4H5TA 4AE5A 2V8HA 2ITGA 4M3RA 5ETOA 3VALA 1LWCA 5F3ZA 4RUHA 3NL0A 3L4IA 1TUVA 2CPEA 4M7XA 2V51B 4HUGA 1JXEA 5F8JA 1SH2A 2P9NB 3B82A 4IQXA 1A5VA 1RBSA 2R7UA 1SUQA 3A5MC 3ILLA 2Y1JA 3IFRA 4Z2XA 2VFRA 2KKHA 2E2PA 2GZOA 4ZPWR 5IXUA 2OYQA 4MH8A 3FEZA 3I87A 2Z1GA 1WSJA 4QYZJ 5ETSA 2J9CA 4Q2LA 4V1Ak 4DPYA 2HFNA 1RT5B 4LIRA 5KT7A 3NFAA 1NM1A 3ZX2A 3OYJA 5CD4A 3VAMA 4FF3A 2W2PP 2UUBJ 1ITPA 3CIPA 1JCEA 3NH2A 4GW6A 4U6PA 4K4VA 3NP5A 3QESA 5C42A 1AZSA 1BWVA 1EHWA 1RYRA 3A5OC 4YB1P 4ICLA 3D0HE 3JS6A 4C8LA 1F3FA 2IPOB 1SKWA 3DGVA 2VDIA 3G9CA 2BJ9A 1U2VA 3O4NA 3ZZYA 3QGPA 2BGGA 1OYEA 2XS5A 1VQ4N 1HBMB 5C7PA 1UA1A 1SV5A 4XAKA 4UY8T 2ZH2A 4YR0A 2C2OB 4PXEA 5EXWA 4BACA 4FJMA 3KWGA 1FJGJ 2CQ1A 2XQCA 4FZVA 3PHTA 2BKNA 2NXCA 4C11B 2LLZA 3PJXA 4ZJLA 5IT9Y 1U1LA 2YBVA 3HVRA 1NGJA 3EY1A 4N41A 3SV3A 5EOYA 4JI5J 4YDUC 4NB4A 5ETQA 4OYAA 5E3CA 5J1PA 4O3OA 4ZVRB 4O55A 2D41A 5JMNA 4USKA 3RZAA 4DTOA 1TZ0A 1YBAA 2ASPA 2HRUA 4O3SA 1JCFA 1GEHA 3SXLA 3HHKA 1W2BR 2B4VA 2CNKB 4ETXA 2DRBA 3EO3A 1BA1A 2QV6A 4FL9A 2X74A 3FGUA 2KKZA 3RAQA 1WDDA 4HACB 3HSCA 2Z1JA 2DR6A 1R8BA 3FFKB 4LD0A 3R8EA 2QC3A 1F60B 4KGZB 5KFEA 4M3ZA 3LOUA 3UI3A 4Z4CA 4JRQA 4NLXA 4RX6A 3IMQJ 4IH6A 4MKVA 1F9HA 2R7RA 3H45C 2A40A 1LEOA 2FDNA 4JI2F 5SWMA 1NLVA 2XY6A 4J9SA 2KL8A 1YIJS 3CCQN 1N5TA 4GVLA 1Q18A 1YBUA 4EYHB 2J9DE 3ZT0A 4LF7F 3AO5A 5ETNA 3L3UA 2FVQA 4B3MK 1S3XA 1NK7A 3DRPA 1P9YA 5H9FJ 2ZVIA 2ZD1A 2OKQA 2CYYA 4I2PA 1ZZNA 1G15A 4FK4A 2M2BA 4OZ2A 3BPDA 2H54B 2LQJA 4X66F 2WVFA 1UCNA 4QWEA 3KJFB 1NK9A 5I42B 3C16A 1HYVA 4LBPA 1DARA 1T94A 3J7A1 4O8UA 3G25A 3OTOK 2YJFA 4L75A 3BB5A 3CYMA 2FJBB 3R6GB 1FESA 4Y0FA 1MN9A 1O13A 1PAUB 3V1RA 3B8HA 4Z7CA 2FF6A 3ENWA 1CZAN 2AMCB 3DRSB 1KONA 4C3KA 5JVGL 1RT1A 2VFVA 1UOCA 1N5YA 1HKCA 4DLEA 2IIHA 5E84A 3FQKA 3ZSWA 3P49B 2FBXA 3LGHA 1KAXA 4BR9A 4C8MA 3OR2B 4I6WA 1VQPS 2OPQA 2HS0A 4DV0K 2HAFA 3NGTA 3H7HB 1FEEA 4OX6A 3N9UC 2BM1A 5FIIA 3IAYA 4CJTA 3EZ5A 2HS4A 3R9PA 4NASA 3PSIA 3CJ0A 1V4TA 4CO2A 4H4OB 1MWZA 1YTAA 4NLUA 1XMQF 3C66A 4U7BA 4BR2A 3G82A 3T5HA 4X65K 1N33K 3VPZA 5B0GA 4CZFA 3S8SA 2ASOA 3UE5A 2DISA 4JLHA 4ETZA 2CUYA 3GFXA 3BSNA 2V2KA 5LM7E 1PSDA 4DR4J 3WDOA 5AQWA 3WQTA 4FWQA 1REVA 4MYUA 3J7YP 1FEHA 1D5AA 4B3RJ 1GK8A 5KFUA 4O3QA 2OO4A 1WC0A 4QS8A 2NZ4A 1U0SA 4CT9A 5I3UA 4OYIA 4B3TK 2K06A 3PKYA 4HDGA 4RBUA 2QT7A 2G4BA 4NXNF 2DHAA 4BRPA 2VV5A 2WRMA 1E6VB 5AQNA 4QZVB 2GCFA 2IVMA 2GUIA 4WFAL 3VEWA 1FDDA 4JV5K 3CJ7A 4ZP8A 1JJ2R 1BWEA 1KLMB 4JI0J 1NKCA 4IOCQ 3S7RA 1PBUA 1E3MA 2PY5A 2ZH3A 3GCXP 1WHYA 4U67L 2IAJA 3HD1A 3B54A 4YOVA 1EQYA 3KNAA 3W1YC 3QT6A 3KOAA 2PO4A 2HWTA 1HBMA 3ZT1A 5L8RC 2VCPA 1Q5VA 2PA8D 3J81U 1F5AA 3V9UA 4M5LA 4NCGA 3OS0A 2IM3A 3MD1A 1ZAWA 3K2PA 2F65A 5KFXA 1VQ8N 4I7FA 4P2MA 4LSNB 2HBQB 3V9XA 3OR1B 4Z0UA 2N4DA 1UWAA 4CCHA 4DV2F 2DHGA 4LF9F 1JNRB 1XHXA 5AE2A 3CCQS 4ZJQA 2ETJA 1FNXH 2AKWB 3NGIA 3ZSQA 2G8WA 4JV5F 4G3IA 4WFNL 1U1PA 4YORA 3QGGA 4AD6A 1RU2A 1RTZA 4MK8A 3RW6A 4BRIA 2ZDOA 3GIIA 1S9FA 5KG3A 3ZO7A 2OI2A 2UUCF 4E0DA 4DL3A 2ZC4A 4DR6K 2QO3A 4NXNK 1SUQB 4ELUA 4L76A 1Z2ZA 2HFZA 4QIVA 2F63A 4XH4A 5BR8J 1VC5A 4H4KC 2ZH6A 4RUCA 2LQ8A 4MDBA 1P8GA 1RILA 3UIQA 5AZJB 3ITHB 2BMBA 3G2XA 3MOZA 2Y8YA 3OW2R 3HOSA 4DTMA 3DLKB 1S1WB 2X1AA 5CYQA 3OTDA 3D1QA 3IBCB 4IFVA 2BYCA 1MROA 2WVDA 4WWSA 4DR6F 1K8KB 2JLEA 2HNYA 2D9OA 1RT7B 3ZSYA 2YNFA 2CPXA 2J4RA 1B92A 4KO0A 4XPCA 1AROP 3SFGA 3NWGA 1EZZB 3FZKA 4GKJF 4ECUA 1FDBA 2NYIA 3QSYB 4DS5A 3NF9A 4DL2A 4CIGA 2VQFJ 4B9QA 2XO7A 3SBGA 3HI9A 4NLWA 4WE1B 3KKRA 4Q8EA 1QVGR 2YH0A 4YHHF 2JZ5A 2FJVA 5DM7L 2A1RA 2MB0B 1DTTA 3M2UB 2M8DB 2PMHA 2V69A 3DNCA 1U1NA 5KG4A 2DPJA 2ZKUA 2XY5A 2J9DA 5F8NA 4N47A 3OHAA 2MY7A 4DV4F 1VQ6S 4F4YA 3BGFA 3M9NB 2A1BA 5BREA 1OH7A 1TELA 2OTLS 1KAYA 1UVJA 2E9ZA 3MWBA 4CZIA 4OYPA 3E9PA 1J5OB 2DRDA 4FWOA 3OL8A 2BOAA 3ZFVA 2UUAF 1QY7A 1RTIA 3MX5A 4A61A 3E2EA 1TAQA 3Q24A 4QOZB 3US5A 3I0SB 3Q89A 1DJ0A 3FSXA 3CJCA 2UVVA 4EP4A 3VAFA 1ESVA 1LXJA 2XI2A 1X0FA 1WN7A 1RBVA 2J8AA 1N54B 1U0HB 1PO6A 3SUPA 2ZWOA 1QQOA 4WYBA 1FE0A 2MTLA 4ZLPA 2GHWA 1OY6A 2OMOA 2J0XA 5GADU 2EFOA 5MLCV 4DR2F 1S7IA 2J5AA 2C3OA 2AYMA 3V4IA 1W7WA 1B99A 4RW7A 5B0CA 1RGIA 2MQPA 4CJ7A 4WF9L 3C14B 4DSIA 3WXLA 2UXDK 4K4YA 2XNRA 2IMOA 1S12A 5LJVA 4WF9Q 1SQGA 4UF4A 4ILLA 1HWUA 4P2FA 1X9WA 1RAEB 2ZOFA 4RU9A 3R9LA 1REGX 3W5YA 4WYWA 3GQCA 4MKYA 3OY9A 1S79A 1HNZJ 4CJPA 4G1QB 2VGNA 3VQTA 4OPJA 3FBCA 3MM8B 4RW8B 3SSRA 4O3RA 1WNSA 2QWRA 3CQXA 1PC4A 5HANA 2NLWA 3CCES 3TAPA 1N33F 2KXNB 2RE2A 1N8RO 3X3UA 4H54A 4FS2A 3WNHA 2BE9B 1T9YA 2E5GA 5DQHA 3KLVA 1ZTTA 2F96A 1TKXB 1ZA1B 1WSEA 5KT3A 3B8AX 4A2BA 1HBUB 1KVAA 5GAEU 4CM2A 4AXIA 2JLFA 5CY4A 1HJRA 2AU0A 2ZHBA 1NPKA 4LVOP 4DL7A 1Y3JA 3HHEA 2V2VA 3HK2A 3I82A 2AYGA 3KYLA 1X5SA 1W2BM 2Z58B 4DV0F 4CDIA 4BRHA 2K2PA 4ZPTR 1VSJA 2V9WA 4H5NA 3LDSA 3LPYA 3KLFA 2DKOB 3N6MA 2V7ZA 1JLBA 4CZEA 4RWWA 3D6RA 3CC4S 1HYSB 2LA6A 5BJRA 4X4NA 2YI1A 4DV6F 1LK5A 4GNIA 2B5JB 2GWJA 3ATUA 2HF4A 1K44A 4X65J 1Q7YO 4I6AA 2IJRA 3AARA 2C2MB 3E9OA 3Q8QB 3GYGA 2YJEA 7FDRA 1HYSA 4DFJA 1CS4B 1C6VA 3KUGA 4FJKA 1FVSA 2JHEA 3CC7S 4NE9C 4WE1A 3R5JB 2IVFB 4NMXA 4TLRA 4DQSA 4FWKA 4J90A 5F8IA 4KB0A 5E3QA 4O8KA 1OJ4A 4BHQA 2YNFB 4BCAA 2PGCA 2O8BB 2NRHA 5GMEA 2RRAA 3M1VB 3ZZUA 3IS9A 4R0EA 4JI2K 1HBOB 2O8FA 4ZVHA 1IUJA 3HPGA 1S6PA 1QAXA 2ZWHA 3HT0A 4FW2A 2OGUA 5EGYA 2ZJRL 1MWQA 4FWLA 4O4GA 3GR0A 4JV5J 4FPBA 3KLHB 4JI0K 2FC8A 4M3WA 4CWBA 4Z94A 5AZJA 1QM9A 3PRDA 4CEDA 5HAOA 4CZLA 2ZBCA 4LF9J 2V34A 2GUPA 1NH8A 5M1FA 3BKUA 2G8HA 2Z2MA 1BG3A 3KKSA 3BQ2A 1NDCA 2AEMA 2G8FA 5J2QA 3T3FA 4PWUA 3ULDA 4IO8A 3MPDA 3M3ZA 1FK9A 1M5SA 4K2JA 3CJSA 1NRKA 2ZF5O 4H8KA 4DTXA 3FMBA 4GVBA 5KG0A 4J9UE 4ECXA 3V4IB 2BJ8A 5CHCB 3A2FA 1TUGB 4DSEA 3NG8A 4B1YB 2UUBK 3RR7A 4NMLA 3KLIB 2C1EB 1CXQA 5KFAA 5EX5A 2YKMB 4PYDA 1CJVB 2XLIA 4C6AA 1T6DA 4E19A 1T95A 4LSNA 1UW9A 1NPPA 2GQ2A 2DH9A 1WF0A 1GNKA 4JI3J 1DLOB 4BC4A 2F3JA 3UDVA 3GP9A 4PA1A 4Z4FA 3LWLA 2F8MA 2ZH5A 2QLXA 5H1SV 2DO0A 2J9EA 3ZZOA 1UTAA 1HQUB 4OHXA 1N34K 9ATCB 1KLMA 4LMZA 3AD8C 1WEZA 4KHNA 4Y2IA 1T9UA 4BRDA 3OL7A 2YV0X 3HKWA 2MHEA 5AJ3F 1VK8A 4ZVQB 4IZ9A 4TVAB 3TO8A 1U1OA 4K7QA 1XC3A 2RHQB 3M2UA 4K41A 2QE5A 5ITHA 6AT1B 2R7TA 4UY8O 3KK3B 2L9NA 4FYDA 2VZ9A 7FD1A 1VQLS 2CJBA 2B8QA 4A57A 1V5VA 2BXJA 3OYGA 2DO4A 5B0BA 1PJ7A 3K9KA 4ZCMA 2LEPA 1K73O 4NZ7A 2YH1A 4CE9A 2GQQA 2QWQA 3RYLA 3U02A 1KQKA 4B02A 2A10A 2ALZA 3ZT3A 3M6WA 1K8KA 3CO0P 3HD2A 5J1EA 4UT4A 3MXJA 1Q0NA 1VCTA 4LT6A 3T1AA 3CJRA 4ILRA 1TL7B 1URNA 4ERDA 4HTJA 1S1WA 2QLJB 3D0GE 3DOKA 3UVJB 4OI6A 3H20A 2R8IA 1Q7YT 3V6JA 4JAXA 3DRXA 1RHJB 4BVPA 5FRNA 2HRYA 4ELVA 2HLUA 1J9AA 3GR1A 2GMLA 2X6SA 3SCKE 2OCEA 2G2OA 2NYHA 1BHLA 4A47A 1MG7A 2WW4A 4LR7A 4NXMJ 3G71N 4JV2A 3C65A 4DSKA 2I5JB 2AX0A 4IH5A 2OPQB 2AT1B 5AJ3K 2VIHA 4HT5A 5FD1A 3HT3A 1XQIA 2XZDB 5ADZA 3FZFA 2E6LA 5HVHA 4KI4A 4M45A 1M90T 3ENBA 3GL1A 1J6ZA 4UQGA 3NF6A 2FGCA 3S01A 1T6CA 3N28A 4ZPAA 3RMBA 2HG4A 2FVPA 4J2BA 2EFGA 1Y7PA 3LWMA 4DTRA 5KG6A 4ED5A 3Q8UA 5M1KA 2W6LA 2OMLA 4DDFA 3V6DA 1VQMN 1BQMB 4JI6J 4TLQA 3PACA 1HNVA 1UA0A 3SNNA 3BR9A 1Q81T 4NOHA 2FJDB 3HZ6A 2W9AA 2H65B 4NLTA 5KFJA 2OPSB 1HPMA 4DL6A 3IUCA 4CF9A 2AA4A 3B6PA 3AFGA 1JWWA 4MLEA 1KN6A 4YOYA 3PX0A 2XWXA 3ENQA 2EW9A 1HW8A 3AB2B 2Z57B 4W5RA 3QZ7A 3WZ0A 4CI6A 3VQAA 4LQ9A 4WIQA 5D4OA 3OXFA 4FKYA 1B9FA 4PUOA 2OTJS 4DR5J 2G0CA 2GQCA 1ZPWX 2OD4A 2FVRA 1HD0A 4QIFA 4KI6A 4C0OC 2ATCB 4Z4IA 3CIMA 5FLXU 1HQEB 5J2PB 2DCLA 3HHLB 2K3KA 2KYZA 2EWSA 3BKTA 1ZA2B 1ZBTA 3AAQA 3MUVP 3AGRA 2X78A 4UW2A 2OPPB 3VF2A 2PAVA 3QFHA 4CP5A 2CH5A 1VBYA 2HHVA 1FE4A 3M8ZA 5A76A 4JD2A 3JSMB 3QEIA 4GKJJ 1NCLA 5L46A 3CUNA 1WOQA 3GYNA 2B9XA 1BC6A 1DEJA 2DGUA 2YXLA 3TAEA 3T1HF 4C11A 4ZITA 2UUAJ 5A6PA 5HLFA 1HNWK 3CCLN 2VASA 4Z4EA 4H4OA 3VQEA 3I9ZA 1LQ9A 1ATNA 4OYMA 4JI8J 4X4SA 4YB7A 4WFBQ 2HS3A 2D1KA 5AQVA 4E89A 3CXCM 2E7VA 4DF4A 1SV5B 5C12A 2M4MA 2IHR1 3HCXA 3U9ZA 5ETVA 2QKBA 1N88A 4ISFA 1RDDA 2IIRA 1QAIA 5C2DA 1FW6A 3UNGC 1U2CA 3HHLD 1AFJA 2XC9A 3SBMA 3ONQA 4R79A 2ZJQQ 4DTNA 1IBKK 1NNDA 3LDQA 4CLUA 3DCAA 2ZE2B 5D8HB 2RE1A 1DT9A 4CLLA 5K9FA 2W2QP 3UE2A 4WK1A 1LNQA 4USHA 4USUA 2W9BA 2ZJRQ 1W0HA 2H4YB 1H98A 1DRZA 3TTFA 1CULB 4A46A 3CD7A 4K4XA 1NUEA 2NUBA 1Q9XA 4I2PB 4DCJB 1XMQK 3W5XA 4KT0C 4NLYA 3MX2A 4WFBL 3CDEA 3O9SA 3VQBA 2FZCB 2AYEA 3DRPB 3GZ7A 3CMEN 2XMKA 4XTTA 1FDAA 3ALYA 4TN2A 3PYDA 3QIDA 2V63A 1VQ7N 2HB5A 1LWCB 3D1OA 4JYAF 3OYNA 2DPNA 4BROA 4V19J 1TL1B 3EICA 5C0YA 1PG5B 1TKZA 3I56N 1Q82O 3KG4A 3VF6A 3AVLA 5CD4H 2VG5A 4X66J 3PO4A 1HR0K 3S9HA 4IH7A 4LFAF 5KFCA 3CJKA 1SS6A 2RQ4A 2BUNA 1PYOB 2OANA 3SJJA 3O8WA 2VG6A 2UXDF 4E1NA 3QT5A 2MXYA 2E9RX 1U1KA 4OI1A 4M5IA 1RQ0A 1RZMA 4X4OA 3N01A 2DNKA 2XLKA 1XR6A 5E3RA 1IVZA 1IBMK 3HVTA 2N82B 4PG6A 1RP5A 3HHNB 2EKNA 3L2UA 1WG5A 2EX3A 3O3HA 2KVQE 2JFKA 3I5BA 1JXBA 4USTA 2VU5A 2MHNA 1PC5A 3R5DA 4LRCA 1N5VA 1PIEA 1GOAA 3H5XA 4FJGA 5DK5A 2DXEA 1GFWB 4LRFA 5HL7L 3VQ6A 1HNIB 4M42A 4DV7K 3H0PA 3CCWA 1NKEA 1HNWF 4FPAA 3O9TA 2R8JA 4GMKA 4JI1J 2DPIA 1WBDA 2FJEB 3WXIA 3EVOA 2DGSA 2J0SD 3GSDA 3UDEA 1FT8A 2H5IB 3KUHA 3TR5A 1NMEB 1HMVA 1D09B 1RT6A 4LFCF 3OUYA 2E2QA 1FXXA 4AT1B 4OPKA 3TEHB 3MHYA 3CCSS 1VQMS 2PZSA 4H5WA 1HX1A 3LDNA 1XMQJ 5GADP 3L95X 2Y1RI 2QG9B 5T41A 3TWZA 5IT9O 5LSRA 2FB0A 3CCJN 1R0CB 2FC9A 1NK8A 5C42B 2DH7A 2YKMA 4DXLA 1HL6A 4C3LA 3N4WA 4DTSA 2F8EX 2WBRA 1K0TA 3QT7A 3PIOL 2BUPA 3G4SN 3BO2A 2DGTA 3MEEB 1RT5A 3B4MA 1S1TA 5CZXA 4X64F 2B4JA 2Q0RA 4EP5A 2E20A 1Y9OA 5KFRA 3RRHA 2ZBPA 3QDKA 1N36J 3NAEA 4CFDA 2KN4A 4IYQA 1RTHB 1SZ2A 2CIMA 4CLTA 1OYDA 1RDAA 3JTPA 3ENVA 3IDHA 1R0AA 1VHIA 4Q7AA 3SPZA 2E1RA 3JSYA 4EYIB 3QMQA 4UZCA 3NLCA 2ZH1A 1NM2A 4USWA 4M5GA 4IFYB 5J2MA 4IDHA 2EFVA 3KLHA 2C3PA 2ZH9A 4ED3A 2EXUA 2CPFA 3QBWA 5JVHL 3K57A 1PGZA 2CADA 2QTWA 3IR5B 1YLXA 3NDKA 3C7NB 2Q66A 3GFHA 4ZMMA 1SQKA 4FVCA 1S0MA 1RAJA 1NAQA 1NDLA 5LMNJ 4P7VA 2WSEC 4PL8A 1UVNA 3G6XA 1GMUA 5M2UA 5A8RA 4X64K 2FF3B 4IOAL 1Q53A 3AO4A 5BXIA 3T7ZA 3GJQB 1CVJA 3K5MA 1M1KT 1G2EA 4BWJA 4L3KA 4CEBA 3JQJA 1NB2A 2BE7D 3H5UA 1A9NB 1U1MA 2EFQA 1FWKA 2C22A 3UKUB 1NK4A 4KGXB 1RWPB 2QZ8A 4W4MA 1WF2A 1N32F 1A6LA 4IJNA 4W5NA 5AQUA 5CH7B 4DCHA 3SCXA 1TV6B 4LR8A 1JLQB 4KH6A 1NU0A 5EU7A 2VWJA 2HGNA 1WG4A 2FVCA 1VGYA 1S22A 4WXOA 5KRTA 1NGAA 4C23A 1JLBB 3MOJB 2QMUB 3C95A 5K8MA 4ED8A 3IM8A 3G8SA 1NJZA 5F3TA 2P9SB 3TAFA 4DU7A 3TUJC 4OGCA 5CYJA 3Q0AA 2A2DA 2W7AA 5C2FA 4DV7F 2DR7A 5HSPA 4UOCA 3OJUA 2P5OA 1NJWA 1UFWA 2CJKA 1K9MT 3Q23A 3THWB 4F0KA 3K8VA 1RCOB 2NRXA 2VH7A 1AUSL 2BW7A 1XK8A 3Q22A 3AVNA 4TXSA 3T5JA 1XHZA 4KSEB 1CJUB 4J9OA 1EKEA 2FBVA 2O8EB 2CDRB 2W7PA 4CO3A 5HQLA 3C15B 3ZZTA 3CXCR 2J6UA 3AVBA 4DV1K 3V5RA 5G0RB 1D0EA 3BGRA 4RW8A 3ET6A 2IJNA 2Z2ZA 2P9IA 4CIEA 1D8ZA 4JI8K 1UPMB 1HR0F 4CO4A 1R6VA 1FNMA 1RWWB 4QWAA 2OLWA 4B9MA 2KLAA 4YHHJ 1OPIA 2ZBQA 2OJ3A 3IAM9 3N79A 4RW7B 4YOUA 5FLXY 2HHHK 4S0MA 4YMEA 4U95A 1QQNA 3IAS9 1KP6A 1TYQB 4E7IA 1ZTWA 4PWDB 4BGAA 2GAHC 1ZOTA 3MMBB 4ECRA 1WBBA 1VRTA 5KT4A 3WC0A 2V94A 2E5LK 1U0HA 1KXPA 2FYXA 3AXMA 3O08A 1C1BA 1FHTA 4CJLA 1C0TA 3I0SA 1VLOA 2P9CA 4F4KA 4CFAA 1HARA 1XNRJ 1YJ7A 3NE6A 4OKKA 1QLNA 3M4XA 4ZOSA 2DFEA 4AHSA 1J5OA 7AT1B 3TJ8A 2CRLA 4NLVA 2SXLA 1MMNA 4LF6K 3TANA 2BQRA 4FZZA 3L2VA 4DX6A 2M0GB 2GMHA 5A0YB 1VRUB 2Q2RA 2ATLA 3A4TA 2XMWA 2IFXA 3QGIA 2HURA 3A3NB 1MWYA 5E3AA 2FD2A 3OTOF 3FKBA 4C2MA 2YVSA 2QA2A 2CWXA 3ZNJ1 2P1JA 3RW7A 4RW4B 3M2VB 2W2MP 2E7WA 4X66K 4JI0F 3H2VE 4DKWA 4P6QA 2H9ZA 2HBKA 2AJQA 2BR0A 1OQ3A 4KB1A 1CJTA 3BP8A 4ZKAA 4Y1CA 3MMAB 3EGZA 3MN7A 2LKZA 1DGKN 4W5QA 4CZKA 2YWEA 2WBMA 1Q95G 1IBMJ 4DQPA 3NCQA 1QHTA 4FJ9A 2X7IA 3OLAA 4CJFA 2CJQA 2H5EA 1IR2A 1UL3A 2IBKA 3PYGA 3QFPA 1P8ZA 1IKXA 3EXCX 4IR1A 2L41A 1S5JA 1KVCA 2YNHA 2MKJA 4CHOA 5LOQA 2YKNB 4FPIA 3R5AA 3EDRB 4LRAA 2HNZB 2UXCJ 1T9TA 4Y34A 4PQAA 5JLFA 1Y5NB 3CCVN 2B4UA 1S77D 3K2YA 4RO0A 2QX0A 6FDRA 2DTUA 3P31A 3PEJA 2WZ1A 1Q86O 1LW2B 3W65A 4DQQA 4YR3A 4DUZK 2Z1IA 1A5XA 1KQFB 3PKMA 4UOFA 1PKUA 4OKJA 2VPWB 1P27B 1Y11A 2N3LA 3P1GA 2XGPA 1J54A 3CCRS 1DTQB 5AQKA 5F8GA 2MZRA 3MM9A 2FPHX 1H0HB 3CFRA 3VQSA 2VJVA 1Y5IB 4LH5A 2X1BA 2DGQA 1OY9A 1HHTP 4GV9A 4OYZA 2EBEA 2YHWA 2OSRA 1F6TA 3IG1A 4RKUC 3VTHA 2KFZA 3HJFA 2IM2A 3FSYA 4IWVA 2HHXA 2B51A 2W4PA 3QINA 1XNQJ 3GFYA 2HHUA 3H6EA 3J7Z5 1HYZA 1K1QA 4PYAA 2GGPB 2YCHA 4GMJB 3U1LA 5HRSA 1YI2S 4MO5A 4A4JA 3V2UC 1EARA 5FJ4A 3ISNC 5KG2A 3SUQA 4IRCA 2B4PA 4QS7A 1OKJA 1U04A 2EI5A 3PTWA 1BISA 4OX9J 4NCBA 2VJUA 2CXEA 3CNQP 3U7JA 5DLFA 3NH0A 2E1AA 1F3VA 2PEHA 2BV3A 2QRRA 1GX6A 3VQ5A 1WSGA 2X1GA 3RGIA 5RUBA 3HX9A 5E26A 3D7SB 2YNHB 1KQGB 2Z1HA 1YSJA 4CFCA 4BDYA 5L1LA 3CD0A 3CPWR 5H9FK 2GVDA 2XZTB 3WQUA 1BOTO 5GAEP 2FSNA 3BM7A 4ZPDA 3O9UA 4I4BA 2OPRA 3HKZD 3KK7A 3V1OA 4C8OA 4LFBF 4DR3J 1ILYA 4Y65A 3OYCA 3IR7B 1Q4RA 3W2WB 3LDOA 1KTVA 4IG0A 4KQZA 4J9RA 1REVB 2XYHB 1YJ9S 4YS2A 5KFTA 5D4LA 4JOUA 2W1BA 4URSA 2W2OP 2L9DA 2A5XA 2R8KA 4CGDA 3A8IA 5KFDA 4CJRA 4RW4A 1YIJN 1HI8A 4RLEA 1V3SA 3RAMA 2Q6CA 2KM8C 4NLGA 4L73A 1HNXJ 5EY4A 1OMSA 4FS1A 3NNCA 4O23A 4Q0BA 3GE9A 1JCGA 4JI4J 2JEIA 1IKYA 3AV9A 3M8QA 1BQNA 4FWRA 5JS2A 2NRTA 4KHWA 2UV8A 4JEPA 3VWSA 4W98A 2FHKA 3VCDA 3WNEA 4WU3A 3OVAA 3VGVA 3CF5L 2IVPA 4P9SA 3AVCA 2UV8G 2VFTA 3BEGB 1X4FA 2P51A 3G6VA 4L8RB 1FKAF 3TARA 1ASUA 1K6YA 1C1BB 3Q2SC 1N34F 1XMBA 2W4CA 1VQNS 3LH2S 1N5YB 2GIFA 1XJWB 3VETA 4UZBA 1IKVB 4DTPA 3AAWB 4KHSA 1HR0J 5KFIA 5CQGA 2CQGA 4B3OA 4HI2A 2KI2A 1BGXT 2GHPA 3IGNA 1QTMA 3QJLA 3K5OA 3OBWA 4DV1J 3G71S 2KJWA 2G8IA 3UKRB 1VQ8S 2BH1A 2B9YA 1IN0A 2JSXA 1QZ6A 4CESA 2BZ2A 1ZBSA 3MR3A 1R3NA 4MIAA 3C16B 1HWJA 2FLOA 2OEMA 1LWFB 4BC9A 1JJ2M 5B09A 3TVKA 4PABA 5LT5A 3MUMP 2DY9A 3OVBA 4CGHA 3LPUA 1N4LA 1XBWA 3OBIA 5FRMA 2ZD1B 2M52A 4KBOA 2X3DA 3VAGA 4JI6F 1KSPA 5G0RA 3QLHA 3CCEN 4B3SF 4AHCA 4ATNA 2JNJA 2IGIA 2O8EA 2ITMA 1EETB 4OZ5A 2QSFA 1NSKL 1VS3A 3R5CA 3RJMB 1VLYA 3EEQA 4FLTA 4H4MB 2V4JB 1UAWA 2WOMB 3AGKA 2ZHAA 1OH6A 3LM2A 3D54A 3M9OB 1R27B 4G65A 4JB8B 4LSLB 2RMLA 2HBRB 2KXHA 2GTDA 4FDFA 1YI2N 1FVQA 5IM0B 3GG1A 2V8DA 3J81O 4EO6A 4URGA 3IXQA 4CJWA 1QAYA 1HHSA 4WXWA 1G7CB 4BRNA 5LSLA 3G8QA 1R31A 3KHHA 2VWKA 2CAJA 4OFZA 1T0TV 2HNDA 4FLVA 1Q8BA 3J7YI 2H3GX 4JI4K 1C0UA 1F9EB 2WONA 3FZHA 2QI2A 5A2QO 2PE8A 4CJSA 1JLQA 3VEVA 4L3NA 3N4QA 2R42A 3CFOA 2ALYB 4AQYJ 3VEOA 3I6PA 1S1UB 3NVMA 1JIHA 3V6HA 5B0EA 3TPQA 5T7BA 4FJ8A 1S4EA 5GMKa 1XC9A 2B0GA 5AQLA 5AQYA 2C3YA 2BJ3A 2GIRA 4MIBA 1RK8A 4K59A 4FBTA 4KHPJ 2DTJA 4GY2B 4FVUA 3CE8A 3HFKA 2MQNA 2A41A 1SC4B 1NHVA 1ZETA 2HVIA 2VFSA 3EUNA 3THXA 2YQ0A 4MFBA 3H5YA 4H4KA 2FSJA 4X4TA 2GEMA 4NEYA 1ROFA 1FRJA 2D0BA 1TQLA 2BJ7A 1NMNA 3UR3C 1R6YA 3SDEB 4ZLLA 2RKIB 1K73T 3QIOA 2ACMA 1KBRA 2AQ4A 4U7UK 1WOSA 4F67A 3BH6B 1MNEA 4NI2A 3L4BC 5J2NB 4CM0A 3K9JA 4O3NA 4NLDA 4ZP6A 1BCMA 1QS4A 2AW0A 1T03A 4KYZA 5ETRA 1FXLA 1RA6A 4CK3A 4KB7A 4NI2B 4FJ5A 2XMJA 1NOZA 1JMTA 3P83D 1X9JA 3LUYA 4TY8B 1I94K 1VQON 3PHEA 4DWIA 4JP8A 2FLNA 1SL0A 1XMOJ 1RDCA 2O67A 4FYWB 1ZM3A 5LL6Z 2GHVC 3SQ2A 2HVDA 4KHUA 1NKBA 1RNHA 3VQDA 1R59O 1X4DA 2PC6A 2HHQA 1UETA 5IV3A 1CJKB 4Z4HA 1NOYA 1J2VA 5M1NA 5EDWA 4HT7A 3D9BA 3EGNA 3P45B 2BACA 5GAHP 1DHMA 4CK2A 1HNWJ 4JBCA 3TR8A 2AJ4A 1ZAVA 3GLJA 2JFDA 4FO0A 3OUYB 1L3UA 3ZSVA 3KK2A 1YHQN 1X3NA 3M9MB 1O1WA 1J53A 3NY0A 5KFPA 2RQCA 4NEZA 5HRPA 2QXLA 3KLGA 1XNRF 3EDQB 5EHHA 3RTVA 3FEYB 3HBTA 1WC6A 3M8PB 3LANA 1DFDA 4K0KJ 3U8XA 2DGVA 5KOWA 2WONB 2M5YA 1RCXB 1NMDA 2JEGA 4JRPA 3O6WA 3SFUA 2HNDB 2GJFA 4CF2A 1ZBIA 2P2CB 2R4FA 1AFIA 1OIAA 2VC0A 1VQOS 1HKGA 3QMLA 3ZTSA 4AQYK 4C3MA 2HFOA 2GV1A 5AQPA 2ATQA 2WVEA 2GFFA 4FPRA 4TNOA 5IM0A 2VBYA 3TZYA 4AM7A 3ETOA 2HW3A 1JNZB 4ZVFA 2Q0UA 3AT1B 2MLZA 4QU6A 5F0UA 2OSQA 3F44A 4LSLA 1YTUA 4YY3F 1L3SA 4H4MA 2V4JA 4YOXA 5I3QA 2XY8A 4CEOA 2LYVA 3HSTB 1OSCA 1TKZB 1TL1A 3F0NA 3CD6S 4EGLA 2YKAA 1FDNA 4RNMA 1YVNA 4KHPF 3N6NA 4BR0A 4R8UB 4HUEA 3HSGA 2OTJN 3J81Y 3OYAA 5F0XA 3M6GA 3WIVA 1I3AA 3H59A 3QLHB 2VG7A 2RUSA 5DQIA 2AP1A 4PKHA 3U3GA 2XHBA 1H74A 2PA3A 4DPTA 1X4EA 2RHSB 4QAGA 1RDRA 1GT8A 4ZIWA 3RRKA 4B3SK 4IKAA 1HW9A 2GW8A 2GA7A 3GCWP 2RKIA 3FR0A 4LF2A 4HHHA 3OVNA 4E1JA 2HRTA 4HR2A 2IVYA 2G8KA 3ZNUA 4J9VA 5C10A 2ZJPL 2VICA 1ITGA 3EPIA 5EN1A 1AB8A 4BR5A 4BE2A 3EZUA 3C8YA 3NGSA 4GKKF 3EJMA 5AE3A 4KGVB 4X62K 1WSVA 4IDKB 1RXOB 2XYPB 4Q2MA 2BOPA 5DZ6A 3J7ZO 4PXCA 3BREA 2JRSA 3EYZA 5E5NA 2LP4A 3R7NB 4QIGA 4KV8B 4WK3A 3QEXA 3DDKA 1VQSA 4FF1A 4CHQA 4FLYA 4B1WB 1VQ9S 1S1VB 3JSRA 5B08A 2X3GA 4UUWA 4ISGA 3DU5A 1X4HA 2VPYB 3TX8A 1ELOA 4DF8A 4PXDA 1EKRA 5HLFB 3NGRA 1UKUA 3T19A 1F2GA 3M8QB 2IS3A 1F0XA 3V81A 2PIIA 5LXYA 3DLHA 5K14B 5BN9A 4K8XA 4U8VA 4LC9B 2L3MA 1SQFA 4L72B 5EX3A 4N8OA 3HULA 2F9DA 4CH0S 4I6YA 1NK6A 2BA9A 4USJC 2IRXA 2CZ4A 3JAMU 3E01A 5GMDA 4F50A 2HMPA 3Q7BA 2NUUG 4RR5A 4K4UA 1UFKA 2CPYA 3OD2A 3K5NA 3FZ2A 3W2WA 1VK0A 4J5OA 4M94A 1FCAA 3DRRA 1SCJB 4OHVA 5KRSA 3EMTA 1KOHA 2KZZA 2HQIA 1BHNA 5DJBA 3VEYA 5LMUK 4O0NA 4PUOB 3H1QA 1WF1A 2LMIA 1U2RA 5GIOA 3DXSX 4ZP9A 2HHTA 2NXJA 3R1XA 2AJ1A 2NZTA 1TP7A 3NS6A 1TGOA 3M8RA 2LDYA 3I4PA 3SQ4A 2M9KA 1U02A 1SXLA 1WACA 5CABA 3GIJA 3ICLA 4YOWA 1YRTA 1HNZK 4KH1B 4WP8A 1HNVB 1LWFA 1WI6A 2MZ1A 3W7BA 2MEWA 1AW0A 2HK2A 3LALA 4WTYA 4EBEA 1ASVA 2IVNA 4OVLA 3O6QA 2WW8A 2D69A 4A8OA 2GGPA 4ZTJA 5D4NA 1SJRA 1VQ5N 5E7OB 1C0GA 5IV4A 2X51A 1TK8A 5LJ3Y 3UKRA 4A8SA 1RSCA 3I5AA 2DHSA 3VGSA 2B43A 5AFUH 4LF4J 3MEDA 1UW4A 1QJHA 1LW0A 1H73A 1FTRA 2PBDA 3GSIA 2B6AA 2OFHX 2NXUA 3Q8SB 1CSJA 3MM5A 2W42A 2XMMA 3H3OB 3AJDA 2I9SA 2L08A 3WX4A 2XMVA 5DG7A 4A8XA 2KTQA 4IG3A 2OA8A 2W7OA 2M8HA 1ZM4A 4HDHA 4PR6A 4ANDA 4FOIA 1XNQF 1NGIA 1QQMA 1K1SA 2YX4A 4KKOA 1ZYQA 3VESA 1NGFA 3VV2B 3PUFA 1YGYA 5C24B 4FK0A 1FRHA 3AVGA 4ZCKA 1IKYB 3CM6A 4P72A 3KMQA 2A6AA 4K5RA 4OI3A 1ZC6A 1FWPA 3DOKB 3JQKA 4CF1A 4M5MA 3QT8A 4HL9A 4JV1A 3BH7B 1IBLJ 1T9VA 3ELHA 3CW2C 5DETA 1JLAB 3NGKA 1HNXK 3DDNA 1NHKL 2FBTA 5BR9A 1WSFA 1H2TZ 1MMDA 2QIFA 3BGUA 2FBYA 1EJ7L 1WD6A 2UXCF 3OBYA 4H5VA 1T3NA 4OKEA 3HRGA 1V3ZA 4NZ0A 2C3MA 1FFSB 3QNOA 3VQ4A 3IM9A 2C2EA 2NRRA 2H5JB 3IBFB 4OX9F 1SI9A 4K25A 4KPYA 2OPRB 4NYPA 5BRFA 2D4WA 3BF1A 2IYGA 2VBZA 2DIVA 2NZCA 3E66A 3CFPA 4R25A 3KK3A 5THWA 4L3QA 5FROA 1WEXA 4BWMA 4Y2KA 3OTBA 2UVWA 5ETMA 1JLEB 1WI8A 2OEKA 1ZZFA 5B7WA 3DLBA 1HKBA 1U24A 3HVAA 4NLSA 3R6LB 4DMNA 4LRBA 4FYYB 4WQ4C 1TUYA 4CD1A 1E4GT 5D4PA 2CQCA 3BR8A 1SVDA 3O3GA 4CYUA 4KKOB 4F04B 3MDQA 2PEBA 5HATA 2VKZG 2HPUA 3DLRA 4HCCA 3DKDA 2GX8A 4J9MA 3EKUA 2XULA 2W8LA 3QSIA 1HWKA 2F9WA 3CPEA 3FZBA 1C0TB 2DNRA 1B0PA 3MN6A 2FJXA 3Q8VA 2VHGA 1WKKA 2C2DA 4F3MA 3BQ1A 1M5VC 4GV6A 3TYTA 2MKCA 1CJVA 2H1YA 5K8OA 3THVA 1YWXA 6FD1A 5L39A 3K5LA 3CJ8A 4EI2A 1FKPB 3I32A 4NYFA 3MEDB 3CC2S 4OYXA 2MQOA 4CJ5A 2YWWA 3ULHA 4K42A 4ZVOB 1GX5A 3ENOA 4OJGA 2RJZA 4OJ3A 2KFYA 2KO1A 3MXIA 3I55S 3QEWA 3H46O 3MM9B 5IFMA 4RWXA 3OTEA 1YVUA 1VBZA 4H0XB 2J0WA 1PCAA 4C8KA 1NSAA 4AHTA 5CCMA 2G8VA 2BKPA 4ZHRA 4FJXA 4WFAQ 2DB1A 5U47A 3OYHA 5CCLA 3OTOJ 1EX4A 1YJNS 2MQMA 3KG1A 4GC7A 4QQBA 3OLBA 3BGRB 2DRAA 3KNGA 1N56A 3JTOA 4I0WA 3HP9A 1EP4A 2QL7B 4CLYA 2OIHA 5ETLA 2HNZA 3C15A 4B1ZA 2YKNA 4LF8J 3L6QA 5A2QU 5DDOC 2FHJD 2DEIA 1CJUA 5CYMB 4ER8A 4Q44A 4Q43A 1UJ6A 2NREA 3OFFA 2ZITA 2FVSA 2XTJP 2UXCK 4KFBB 3OHRA 1W2IA 1LCUA 3DGPA 3DRRB 1D9FA 4KH4A 3CPWM 3Q7CA 5B8HA 1RI7A 4F0HA 1IG8A 3UD4P 1RB0A 5AQRA 3OYFA 1KEKA 5KFWA 1OPZA 3MMAA 1RHUB 3MCMA 4DTUA 1XEZA 2YKQA 3K7RA 4CT8A 1Y3KA 4DJBA 4WZQA 4DFKA 4IOAQ 5LL6d 1WKJA 2JC0A 2HFSA 2MPUA 1YVFA 1URRA 3W3DA 4B3TJ 1S48A 2KG1A 4HHJA 3FRYA 1KHWA 1CQNA 1Q82T 5K8PA 4JI7K 1YK9A 4M5NA 2UU9F 4FWSA 2P9UB 2ADBA 3ID6A 4WIIA 5HQ8A 4V19X 3LDPA 2FXUA 2W41A 2KHCA 3KLFB 3HHLC 1RE1B 1SL1A 1FJGK 5KFQA 4A5BA 1JJHA 4V19S 2FY1A 1HRHA 2NNWA 4FW1A 4YHHK 3VMFB 3NGUA 2CFXA 4YFUA 4F8RA 2AGPA 1RA7A 3D67A 4DG1A 3DXMA 5JICA 3OS1A 3ZTPA 3DMJA 1TKTA 4ED4A 3CEDA 1VRTB 3THPA 1RISA 4DV3F 2UZAA 3R2CJ 3T6JA 2LU2A 2LDIA 1HBUA 4CJEA 1UJ4A 4GRSA 2Y8WA 3RB4A 2F7TA 1E6YA 2MKYA 1RAOA 4RCHA 4QR2A 1FJCA 2AGQA 2UXBJ 5AZIA 2I2YA 4C97A 1E4FT 3WEEB 4CECA 4ECWA 2DK2A 1XR7A 5KG5A 3MCNA 3R3TA 4TQSA 2CPJA 2ZZNA 3U27A 1N32J 4OYBA 1GQEA 1FNOA 2HBYB 3BF3A 1GLBG 2NSCA 1CZ9A 3DLJA 1RTJA 5IWAJ 1VAZA 1R8AA 3QRRA 2AZ1A 2DIUA 1FKOA 3UR0A 2DNZA 4IRKA 1SJQA 3C14A 5DS7A 4MDAA 2OZSA 3CQYA 3IRWP 2UUCK 2CG4A 4ECSA 4WFXA 2O8CB 3ULEB 5EUHA 1H3DA 3KWIA 1JXLA 4O5BA 4URQU 4I68A 5IQQA 3RR8A 1QDUB 3CMAS 2HYIB 3LQVA 2X6NA 4PXBA 1IG9A 4FJ7A 2QMXA 3UN2A 2VQFK 4M5HA 4M3UA 4LF9K 1SAZA 5HBMA 4Q8FA 3F5TA 3ILOA 1HWLA 4CJ4A 2Q1NA 2B9WA 1NJIT 4BRGA 1U09A 1R43A 2ASMA 2P9KB 1CEZA 2RF2B 3M8YA 4KHRA 4JI4F 4C1NI 3K89A 3Q2TC 5C25B 5JXSA 2AJ0A 4BDZA 1EX8A 3C6TA 3NBPB 1B9DA 1S99A 2BJDA 3D1HA 2FJWA 5FPMA 1CG2A 1X0PA 1O6XA 3AY0A 1X1PA 1AXQA 1RT2A 1AYEA 3M8PA 2KW4A 4FP9A 5LMNK 5BPMA 4FN5A 4QU7A 4DZDA 3MWTA 3GV8B 2RNEA 1TK5A 3D2EA 3BEXA 2QMWA 2GAGC 1SIWB 5HVFA 4D3GA 2G9OA 2DHXA 4M5JA 4NX9A 5H1SQ 3PX6A 2Q31A 4X62F 4JI1F 5KI6A 2G1HA 2JJ4D 3THYA 2ZBRA 1XMOF 1VC0A 3CT9A 1WEYA 4AL7A 5CA5A 5M1PA 1IJEB 1SJ3P 4KO0B 3RU0A 1OSDA 2DJWA 4J2DA 4QWBA 1RT7A 4H0TB 3BPSP 2HNYB 1YRUA 5HP1B 4DFMA 3UW1A 4KTZA 3CIZA 1RTDB 2VG5B 4IFVB 2CQ0A 1K8AO 4IOBA 5A8WB 5HL7Q 3G4SS 2RILA 4MIWA 5KFMA 2LA4A 4FLWA 3NS5A 2LEAA 1RWXB 4ILMA 5J2MB 4RNOA 1SC3B 4YB5A 4TY8A 2ZNYA 4FJHA 4EWTA 2CPIA 3GFZA 2QM1A 4I9QA 3C6UB 4ZDNA 1RUSA 2KHDA 3MEGB 1N6QA 5T14A 1LKZA 4H0OA 3NHGA 3EE3A 4KHYA 4C48A 2X1FA 4L74A 1U6ZA 5KAKA 2J6TA 2QWPA 4CFBA 3MXHP 3CULA 2W9BB 3P39A 1JLGA 3PIPL 3VN5A 4FM0A 4LJMA 4FF2A 3I56S 3V9WA 4FXWA 1S1TB 2ZE2A 2QW9A 3HF5A 2E5IA 3M5RA 1GAOA 1NK0A 4F4WA 2P5GA 2DXFA 3TJ9A 3TQ1A 3KK1B 2HIQA 5F8MA 1NJXA 1M1KO 3ETMA 3ZZ0A 1YJ9N 2HWHA 3BSOA 4I7FB 2IRYA 4CEZA 3DFEA 4I67A 2MKKA 4EBCA 5HK4A 2RVJA 2LVWA 3OFGA 4DR4F 1UPPA 4E1MA 1JQGA 3ZLJA 4PQUB 2HZVA 2QYGA 3AODA 1HMVB 2VDHA 4JKBA 4AF1A 4RBTA 1TL3A 4R5PA 2IAJB 2JOQA 3W5ZA 4BC5A 1NO8A 3CB4A 3QATA 1N0VC 1H2UX 3C6AA 2CJXB 1P90A 5AXMA 1RAGB 3FK4A 1HNIA 1TFYA 3G6ES 2Q36A 1BUXA 2HZCA 1QUVA 4NYOA 3VENA 2NRVA 3R97A 4DFPA 4LFCJ 1ATSA 3T1HK 2MGZB 4ZN1A 3CCSN 4W92B 1BL3A 2V4QA 3CMES 5ADXH 1S10A 1WUUA 4E98A 1SH0A 5HMZA 2EG1A 3DOLB 3HHDA 4YP3A 2P9PB 3G0ZA 3BYRA 3ZTQA 3CO9A 3HSJA 4LFAK 4F3OA 4IXCA 3FRZA 8RUCA 3FDSA 5AQJA 4CK1A 1D9AA 1YAGA 4YDUA 1AA1B 3KLEA 4M5KA 3PR4A 1NJIO 3QEVA 2WOMA 3RBDA 1N5SA 4CF0A 2R7VA 2Q79A 2Q1LA 4IRDA 3QAEA 2ERRA 1I3OB 4DR1F 1ASWA 2DNYA 4DOZA 1KR4A 4LF6J 1VSDA 4H0VB 4LH4A 4CLPA 4M8LA 4YOTA 3GYXB 4OPAA 5KFHA 1U47A 3D0PA 4FCYA 2YTCA 5AQTA 1O8BA 3TA0A 2FIUA 4UY85 2VPXB 3R3LA 2CGKA 2PFDA 1U4BA 1W25A 4P7TA 3SJHA 1QAJA 2MZQA 2E5HA 1QSSA 1HKAA 4NLRA 3MK6A 2C3UA 2J7WA 4EU0A 3NF8A 1XQSC 1UZHA 1Y10A 4DPWA 1CULA 1IWAA 4X84A 4DU4A 1U2FA 3F73A 3VQ8A 4NLPA 3MFIA 4LF5F 2ZM6J 1RHKB 3O9RA 4I1TA 2LXUA 3CI5A 5KGWA 2HQGA 2Z30B 3RMDA 1OH5A 1BO5O 3MR6A 3LP0A 1HUXA 3CCLS 4DX5A 2ZFHA 1HI0P 4NYNA 4DV6J 4K5SA 1Q79A 4LF4K 4DHYA 5JLHA 3HM8A 4N5SA 9RUBA 1IKVA 2U1AA 1M5PC 3OPKA 3R1LA 3R5GA 5DO2A 4ZS6A 5T7LA 1NGBA 1ULRA 1TVRA 1FRXA 3SYZA 2LEBA 3LP0B 1BCOA 1T11A 3A3OB 2D1CA 2I8EA 3SUOA 3F2KA 5BPNA 2D3O1 4CH7A 2QA4N 3SPYA 3MAAA 1IO2A 3JYTA 4B1XB 4CF8A 4ID5A 4MQ3A 5KT5A 3CJBA 3DDIA 1FO1A 4AHRA 1BQNB 3LAMA 4M63A 1KFSA 4DTJA 4UQTA 2QXFA 4CGGA 3ZT2A 3H98A 1FX2A 3AVJA 3NMAA 3H42A 3DHXA 3DLLL 4BE0A 1N33J 4Q0BB 2LCWA 1GMWA 3NGDA 2ROEA 4BS2A 5BRHA 4QBUA 3GJRB 3ZTOA 1Y97A 3QPIA 4JK7A 2YWKA 3KDOA 4RG8A 3G96A 3OS2A 4IO9Q 1QSYA 1C0FA 1UP1A 1Q16B 4RNNA 4OX8A 2AEFA 2O66A 2ASDA 4RNHA 3ENHA 1O0PA 1WHVA 1B4SA 2LFVA 4LR9A 4CLWA 3NXZA 3IWNC 2D9PA 4X4VA 1VIXA 3I96A 4HACA 2E66A 3M6VA 4CW7B 1IR0A 2PI5A 3SQ1A 3B6OA<