1JLBA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
554
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 148
structure length 549
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlbA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlbA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlbA05
5DQHA 1IKYA 4EP5A 5KGXA 3ISNC 4CGIA 2D3UA 1C6VA 2W9CB 3LWMA 1U47A 4AHRA 3LP1A 2W9AA 1N5YB 3GILA 2FLLA 1I6JA 1RT7B 5EU7A 2AGOA 1RILA 1HNVA 1NJYA 4R5PB 1JLQB 2Y1IA 5D3GA 2VG7A 2YKNA 4IH5A 3ZSQA 4NLTA 4O3RA 4IFYA 4CEOA 4K4ZA 3AO3A 2W8LA 2XY7A 2QK9A 3PO4A 4LQ9A 4OKKA 3HJFA 4QW9A 4KHQA 5C42A 4ZMMA 3KLEB 2VWJA 3VQ5A 3V1RA 2FC0A 4RW7A 3EZ5A 5KFVA 3M9OB 4PUOB 3V6DA 1HPZB 4ZP9A 1FKPB 2BANB 3ITHB 4IBNA 5KFRA 3SQ0A 3G10A 1KFSA 4J9NA 4DFMA 1VSDA 4TY8A 2YNIA 1G15A 3MR2A 3CDEA 3DLKB 3HKWA 5L9XA 2F8SA 4MFBA 1RTJB 3QEPA 3K5LA 4FJIA 5CYQA 5J2PA 4HVJA 4KTQA 4WZQA 3KLIA 4O55A 2G8KA 5KFIA 3BQ0A 2OH2A 1S9GA 1JIHA 4QWDA 1K6YA 4RZRA 4CFBA 1IH7A 3H40A 3OS1A 1Z25A 2R8KA 3H59A 3G6YA 1X9MA 2VWKA 4B3OB 1RYRA 2GIQA 3L3UA 4HTUA 3MF5A 4KV8A 1NK0A 4O44B 3BDPA 4ZP8A 4CF9A 3NKYA 1EETB 2FBTA 3GV5B 1RAJA 2ASLA 1W9HA 2WRMA 3H5XA 1U45A 4RNHA 3OVNA 3V9UA 4O0JA 4Q43A 3I5AA 5KFBA 4MK9A 1NKCA 4PWDB 2CJQA 1JL2A 1BCMA 4PY5A 4DFPA 1S1VA 4DQPA 2GV9A 4BWJA 1SKSA 3AVGA 3DI6A 1JLGB 3BREA 5J2NA 1RT5B 4QW8A 3K57A 1I3AA 4ECVA 3L2VA 3P5JA 4Z0UA 4B9VA 5EUHA 3LP2A 3ZT1A 1C1BB 1NOYA 5DG8A 4FJ7A 3VQDA 1JLAA 3P83D 4NLSA 3BSAA 3NL0A 1ZTWA 4KI6A 4OGCA 4XIUA 3JYTA 3V9SA 4K4VA 3LDSA 3RB0A 2R8IA 2G8UA 1UWBA 4YMEA 3ZSXA 4FJGA 3HPOA 5C25B 2C2EA 4M3RA 2QE5A 3JSMB 3DRSA 3TAFA 4ZP6A 3LAMA 1BI4A 4ID5B 2R8GA 4BE2A 2WOMA 2B5JA 1IKWA 1F21A 2HHUA 3B6OA 3TQ1A 4W5RA 3OLAA 2C28A 2FLNA 3LP0B 3TAEA 3PJXA 1ASWA 4G1QB 2KQ2A 3OYNA 4M95A 3SUQA 3QO9A 5DQIA 4F3OA 1HMVA 4QWAA 4MK8A 2ZE2A 2UVVA 4M3XA 1VK0A 1BQMA 1C0UB 3RBEA 4IRKA 1VRTB 4NLXA 2B43A 4CF0A 4EZ6A 3VA3A 4ELUA 1S6PB 4ZHRB 4J9KA 1KLMA 3I0RB 4DLGA 4KAZA 5L1KA 1TKZB 3FFIB 2E9RX 2IM3A 1YVUA 1MU2A 3H4DA 5KTQA 4EBCA 4OKJA 4J2DA 4DL3A 1TAQA 3AO5A 4WYWA 1JLCB 1GOCA 3HVRA 4ECUA 1HARA 3PX0A 1FK9A 4DTUA 2XGPA 1JKHA 4Y1DA 4IH7A 4O4GB 4DFJA 1QHTA 1S9FA 3O4NA 3QGHA 3SUNA 2IC3B 1Q9XA 3CJ5A 3AA2A 4W5QA 1UA0A 1A5WA 3OSNA 3KLHA 4TXSA 2VG5B 1TK0A 3PW4A 1HYVA 3MXMA 3HVWA 3NBPA 3RB4A 3AVJA 4NLYA 2OPQA 3DOLA 3AVCA 1KCFA 4M3ZA 4TQRA 1B9DA 4DQSA 5KT2A 4B9UA 3NF6A 3SNNA 1VSLA 4KB0A 4B8AB 4ZVHA 2PZSA 4M3WA 1L3UA 4Q44A 3LANA 5HROB 1N5YA 3DYAB 3RB6A 3OYMA 3SV3A 1RT7A 4DU1A 4O3OA 1S9EB 1TVRA 3TANA 3MEEB 1Z26A 4R5PA 3FQKA 4OKEA 4CHQA 3CG7A 1JLQA 3OLBA 4K4TA 4I2PB 2JC1A 3MXIA 2YNFB 4B9SA 4E19A 3CVKA 3H2LA 1D8YA 3BQ1A 1T03B 4ZVFA 3KLEA 5KFJA 1NK7A 4FJMA 3OL9A 4CFDA 5KT4A 1Z4UA 4PUOA 3GIMA 4J2BA 1HPZA 1IO2A 5HRSA 4JV0A 4ZPDA 4CEAA 2BANA 3ITHA 4DSJA 4CJPA 4E7KA 2IAJB 3PX4A 1TK8A 3F9KA 2FVSA 4FK0A 1OS5A 4K50A 1EKEA 1TV6B 4Z4HA 1S6QA 3DLKA 2XHBA 3RMBA 4ECZA 5KFWA 3EPIA 1CZBA 1NK6A 3UPFA 4L8RB 2XC9A 4CHYA 4TYBA 1L5UA 2A1RA 3SCXA 2UUWA 4DTRA 3QGIA 3VQ9A 5DK5A 5FDLB 4B3OA 2AX0A 3OYCA 5KI6A 3MFIA 4O44A 3T5LA 2DFEA 5F8MA 3A2FA 4CJRA 4DL5A 2B4JA 5JS2A 4W5NA 3PUFA 5KFMA 1EETA 1BGXT 3EYZA 4DTOA 5KFQA 2OPRB 1IM4A 3S3NA 3G6VA 1LW0B 5KFTA 4M41A 4NYZA 2RF2B 1TL3B 1QSLA 5KRTA 3KTQA 4N5SA 1KVBA 3KOAA 4I9QA 3H08A 3AA4A 2AWZA 4CEDA 3QZ8A 1WSFA 3MEDB 4FLXA 3KK1B 4DTNA 4F4ZA 1RDCA 2UVRA 2C2DA 2J6TA 2RDJA 2J6SA 1KTQA 1JLGA 4PQUB 3H4BA 1RT5A 4Z4IA 4ZPCA 1BIZA 4ELVA 1D9DA 5DLGA 1LAVA 4C8NA 4IG3B 1L3VA 4AHUA 3V9XA 1C1BA 3L2WA 4KB7A 3KK2A 5HLFB 2QKKA 1VSMA 1HJRA 1EP4B 1WSEA 1S0OA 3GYNA 1RT1A 3HSTB 1O1WA 3RAQA 5KFOA 3MECB 4DL4A 4I7FB 3RBDA 3KNAA 2VA3A 3OHAA 2G8VA 4LH5A 4RW6B 5C25A 1C1CB 1QQCA 1CSJA 1LW2B 3JSMA 3CJ0A 2HAIA 4O3PA 1VSEA 4FW2A 4DSIA 4KTWA 4FM1A 4ID5A 3ZSVA 3MAQA 4OLAA 3OYAA 4OPJA 3LP0A 1WSJA 4CJ5A 4ECWA 3TABA 4ED3A 2G8FA 4G1QA 1K1SA 2E6MA 2QV6A 4CIFA 4R8UB 4U7CA 3KJVB 2EC0A 4H4OA 5KG6A 4O0IA 4EZ9A 3LZJA 3OYKA 1HQUB 2KW4A 3EY1A 2DPIA 4B9NA 3KD1E 4E7IA 4CGHA 3I8DA 3PJWA 3QETA 3OYEA 1C0UA 4DSFA 1C2PA 1VRTA 1RA7A 1SKWA 2VG6A 1QAIA 2YNHA 2ASJA 4E7LA 1S6PA 3IRXB 4ZHRA 3I0RA 3Q8RB 2Z1GA 5KG7A 1TKZA 3KLVA 3HYFA 3VQ7A 3RMDA 1YT3A 1C1AA 4QOZB 4DG1B 4EO6A 3ASMA 3FFIA 1S0MA 4N76A 3KK3A 3HPGA 3K59A 3ZSZA 2YV0X 3BR9A 4AH9A 1ZETA 3QNOA 4QWCA 2JEJA 4NLQA 4ID1A 5I42B 2JLEA 3T19A 3ZSYA 3C94A 3GQCA 4DMNA 3QIOA 3VQBA 4O4GA 1ZYQA 4CHOA 3QINA 1VSKA 5CZ1A 4IKFA 4CJWA 2IC3A 2IM0A 1RT4B 3OS2A 4KAIA 3D45A 2JC0A 1S1XB 5KG3A 5DGAA 2HWIA 5KFFA 3VQQA 1ZTTA 1J9AA 1XHXA 2BR0A 4FW1A 3LZIA 2VG5A 2GIRA 4DFKA 2W9BB 2W42A 3PO5A 4HUGA 2HNYB 4FLZA 4EYHB 1IKXB 2PYJA 3PY8A 3PW7A 4Z4GA 3UDLA 3PHEA 2UVUA 1RTHB 4X2BA 4W5TA 3DM2A 4ZPBA 3F73A 5EWEA 1QUVA 1FXXA 4AHTA 2E4LA 4FJXA 5FRMA 4KPYA 5HRPA 5HROA 1TKTB 1ZBFA 3DYAA 4CHPA 4AHCA 3N6NA 4CE9A 4CK3A 4CJFA 3SI6A 1S9EA 3MEEA 3RRGA 1VSIA 4I2PA 1LAWA 2D0AA 4LSNB 2ASDA 1S1TB 4KREA 3HP9A 3AVMA 3I5BA 3BGRB 1U49A 4J2AA 3PW0A 4GMJB 1XR6A 1T03A 3V81B 3UQSA 3SJJA 4IDKB 4DS5A 4JRPA 4MKBA 1JLEB 4K8XA 4IRCA 1ZBUA 4RUAA 2F8EX 1NNDA 2IAJA 3LPTA 4KHWA 4WFYA 5KG1A 2AJQA 4F8RA 1TV6A 2AX1A 3OYHA 3KHRA 1RBUA 1T05B 3QEIA 2OYQA 3GV7B 4F4KA 2IMWP 2AGQA 3QIPB 3ZT2A 3DMJA 5DQGA 4DSLA 4RUCA 3AVLA 3T5JA 3CFPA 4AILC 4CJ4A 4FJ5A 5FDLA 5JXSA 2R8JA 4NRTA 4IRDA 3AVNA 2FVQA 4CECA 4NLWA 3E51A 4DTMA 1X1PA 3T5HA 3TWHA 1REVB 3Q8PB 4ZTJA 4CJLA 4F4WA 4RW9B 3CQ8A 2OPRA 1LW0A 5KFUA 3L2RA 2JEIA 2RF2A 1TL3A 4CGFA 1RTDB 2XY6A 4RNNA 4FJNA 1SKRA 4B08A 4NLPA 3OYDA 4H8KA 1RTIB 1D0EA 4E7HA 3DLEA 4B9MA 5C24A 2XO7A 4FLTA 4ECXA 2FLPA 4NLVA 4RNFA 4ZPAA 4F4XA 3KLGB 5KFGA 3QEXA 5F8JA 1TL1B 4IG3A 1ZBLA 3U3YA 3QESA 2HHQA 2B6AB 4IR9A 3VQEA 1TKDA 3HVTB 3PVXA 5HLFA 1JX4A 3M8PB 4QWEA 3AVFA 1HQEB 1EP4A 4IG0B 4CERA 4MIBA 4W5OA 2E9TA 1A5VA 4LSLB 3O3FA 2IGIA 4TLRA 3MECA 4F4YA 2I5JB 4I7FA 4YR2A 3NE6A 4BE1A 4K8ZA 5E41A 4DTSA 1KLNA 3MR5A 1RNHA 4LH4A 2BRKA 4CJVA 2XI2A 1SV5B 1S48A 5KT6A 4CJ3A 1L3TA 4IH6A 3WNHA 4RW6A 1HYSB 1C1CA 3NF9A 3TAMA 3NFAA 4JS5A 1LW2A 3OYJA 3K5OA 2E9ZA 3TAGA 4NCGB 4FK4A 1FKOB 1NJWA 1Q9YA 2X78A 2FJXA 2CKWA 1DLOB 4CGDA 2ILYA 1A5XA 1IKVB 3EZUA 4ED8A 1R0AB 4NRUA 3NGDA 4N41A 3OYLA 4HUEA 1WLJA 1D9FA 4JUZA 1NKEA 2JEFA 1TQLA 3RMCA 2Z1IA 2WHOA 3MEGB 4ED6A 4WXOA 3RR7A 3OL8A 1KVCA 1L3SA 3QIDA 3IG1B 1S10A 3P1GA 1HQUA 1LWCB 3QLHB 4J9SA 3OYIA 1EXQA 1NJXA 4RW4B 5HRNA 4DTXA 4E89A 4DL6A 3DLHA 3IRXA 2XY8A 1TP7A 4NZ0A 3KD5E 2HVIA 3KMQA 1J5OA 4BWMA 3HM9A 3SI8A 4DSEA 4DTJA 3AVHA 4DG1A 4CFAA 3QNNA 1J53A 1ASVA 3HT3A 3KLFB 3L2QA 2YKMB 2G8WA 4YFUA 3QYYA 4I2QB 3OSPA 4DLEA 3IS9B 1U04A 2BDPA 5I42A 5L1LA 3NDKA 1RDDA 1U48A 4J9OA 2ILZA 4QAGA 1WNEA 4FJ9A 4M3UA 3UIQA 2OPPB 3Q8SB 2O4IA 4Q0BB 4BDZA 3S3OA 5HP1B 2FVRA 1RT4A 4KHYA 2P5OA 2W9CA 1S1XA 2Q3SA 1T8EA 3S9HA 4DU4A 1QS4A 3CFRA 2ETJA 2ATQA 4M94A 2KTQA 1JLBB 1GOBA 3Q8QB 5I3UB 3SUPA 1IKXA 2RN2A 3MR3A 1N6QB 2X6SA 4MKAA 4URSA 3SV4A 1RBSA 4OJRA 1CLQA 1RT2B 4JS4A 1N56A 4TSXA 4EYIB 4NLOA 4FS2A 1XWLA 1TKTA 4H4MB 1T3NA 4RW7B 2D0CA 2XWYA 2HNDB 4CHNA 3VQAA 3IGNA 2R2TA 3H98A 3M9NB 4LSNA 1CZ9A 3NAEA 1FKPA 1S1TA 4TY8B 3BGRA 4MIAA 4Q8FA 2XI3A 4NLDA 4KSEB 3OY9A 3V81A 2IJFA 4IDKA 1RTJA 3KLIB 4E7JA 3HL8A 2RDIA 1JLEA 3ZCMA 5T7BA 4NCBA 3U3GA 3L2UA 4DF8A 4NLGA 2D41A 4IR1A 5KFCA 4XPCA 2AQ4A 4ELTA 2C2RA 3CFOA 4CEQA 2W7PA 5KFXA 2R8HA 4WE1B 3DRRB 3VQSA 3OYBA 3CM5A 2DFFA 1B92A 3QIPA 1UOCA 4C8MA 5DGBA 4PA1A 4FLWA 1BCOA 4FM0A 2IM1A 2YNGB 5JS1A 3ZSWA 3SPZA 2KFZA 3V6KA 1BQNB 1S1WB 3OJSA 4HUFA 1S1UB 4RW8B 4PWDA 1WNSA 2P51A 4CEFA 3AA5X 2AGPA 2XY5A 4TY9A 5CY4A 4DSKA 4KRFA 3EPGA 1XC9A 1REVA 1XHZA 3HP6A 4KHRA 4RW9A 3K5MA 3AO1A 1NK8A 3SFGA 1B9FA 3LP2B 2Y1JA 1YTUA 4KI4A 3KKSA 1RTDA 3GV8B 3ZSOA 2V0NA 4O3SA 3DLBA 3N6MA 3BSNA 1JXBA 5F8GA 1BL3A 1RTIA 3K5NA 4CCHA 2HMIB 4CIEA 1VSHA 1VSJA 3O3GA 4N56A 3WNFA 3O4QA 3K2PA 3LPUA 3KLGA 1IG9A 1WSGA 4J9MA 3VQCA 3DRSB 2B6AA 2EX3A 5F9NA 5HBMB 3M8PA 1HQEA 4OLBA 2WOMB 4IG0A 1SH3A 4QWBA 1ZBIA 3T3FA 4LSLA 3D5MA 2OZMA 1JLFB 1X9SA 1LWEB 4OVLA 4WFXA 1XR5A 4E1MA 1DTTB 4YR0A 3S3MA 1HYSA 4K4UA 1NOZA 4KHSA 4CEZA 1W25A 4CF8A 4NCGA 1FKOA 4ED2A 4ED1A 2FBXA 3E01B 4DU3A 2W8KA 2HWHA 3VA0A 4GVMA 1DLOA 1D5AA 4FLYA 3ZT0A 2DPJA 1R0AA 1UAXA 3BSOA 1RCHA 2P5GA 3C6TB 1HYZA 4C8KA 4FBTA 4KHUA 2XRIA 3MTKA 3MEGA 5DMRA 4BDYA 3ZT4A 3I0SB 3KHHA 3PR5B 4F3TA 2BRLA 3IG1A 1MU2B 3KMSA 3M8QB 5J2MB 4HCCA 1LWCA 1RT3B 3QLHA 1NK5A 3ULDA 4ZVEA 3SFUA 3G6XA 3U6FA 2DY4A 4RW4A 5KT5A 4J9PA 3ICLA 1RT6B 4IKAA 1QTMA 1JLCA 3DRPB 1Q8IA 1JKHB 2BQUA 1U09A 3ZT3A 4OPKA 3QZ7A 3VQPA 5KFSA 5EWGA 4CJUA 1S5JA 1JXEA 1TKXB 3KLFA 4ZTFA 1S4FA 4KE5A 2YKMA 2WCXA 3GIJA 1KRPA 2W7OA 4FJ8A 1VRUB 4I2QA 3IS9A 2BGGA 2ATLA 4TYAA 1LWFB 1CXQA 2KZZA 1C0TB 5KFDA 2OPPA 4MH8A 2OPQB 3DOLB 3DLRA 4Q0BA 4K4YA 3SQ1A 3CM6A 5HP1A 4CHZA 1RBRA 4FJLA 2XCAA 1MMLA 1QE1B 1TK5A 4RU9A 1D1UA 4KFBB 3PZPA 3AO4A 1TVRB 5DLFA 1RA6A 1JLBA 2HHVA 5I3UA 2D7SA 5HRRA 2IJNA 5L1IA 1N6QA 3SYZA 4Q8EA 2YNFA 3TAPA 4C8LA 5SWMA 1RT2A 4K4WA 4IFVB 3SZ2A 3PR4A 1X9WA 4NLUA 4J9QA 1T7PA 1HNIB 4Z4FA 3D0PA 1SUQB 4H4MA 4FZXC 4O5BA 2IS3A 3T1AA 3LAKA 4UQGA 5F8NA 4Y2CA 4BE0A 3SQ2A 2HNDA 4ZVGA 4GC7A 2FVCA 4KO0B 2C22A 3CJ4A 4CK2A 4CJTA 4EP4A 1NK9A 1W0HA 4FXDA 3BJYA 2EHGA 3QERA 1S6QB 1LV5A 2X6NA 4F2RA 4HYKA 3SPYA 1SH0A 2E6LA 4O3NA 1WSIA 1XR7A 1WN7A 5J1EB 3SQ4A 3C6UB 5CYMB 2R2RA 2HHTA 3CJ2A 3B6PA 1SL0A 4FJHA 4CESA 3RTVA 5KFNA 4WE1A 3DRRA 4ED7A 4ECYA 3WNEA 3AO2A 5CZ2A 4FZZA 5K14B 1WSHA 3NAHA 4KKOB 2D5RA 3ISND 5EWFA 2YNGA 2ZQBA 2GC8A 3NH2A 1NHUA 1BQNA 1BIUA 1S1WA 3NGZA 1S1UA 4RW8A 4ECSA 3M9MB 1SL1A 3V4IB 2HHSA 2R2SA 3FSIA 2PYLA 4Y3CA 3H5YA 3MEDA 4XO0A 5DG7A 2OPSB 3KK1A 2HNZB 2XGQA 2RKIB 4GW6A 2V4RA 4QPXA 4HHTA 4PQUA 4O4RA 4DF4A 2ZD1B 4BDPA 2QKBA 4FK2A 3KK2B 1S97A 2JGUA 2ALZA 5KFHA 4EEYA 3LP3A 4G3IA 1RT1B 5FRNA 5KG2A 3HVAA 4JV2A 2HMIA 3MXJA 2OZSA 2FVPA 4EO8A 3V9WA 4J9LA 4H54A 4DWIA 4IOBA 3KHLA 4ICLB 2BQRA 3NGIA 3DLGB 3NH1A 2G8IA 3HO1A 5F8IA 2R7YA 3GIKA 1BHLA 3QEWA 4FYDA 5FROA 4YNQA 5HBMA 4TN2A 4Z4CA 3NF8A 3OL7A 3QEVA 1BISA 1KVAA 4E1NA 4B9LA 2OA8A 4KTZA 3TR8A 1JLFA 1LWEA 3RAXA 2WK4A 2HW3A 4DL2A 2WB4A 1UA1A 4ZP7A 2IBKA 1DTTA 3PV8A 4ECQA 3CYMA 3M8SA 5KGWA 4M42A 4FCYA 4FVMA 3N6LA 4O3QA 3VQ8A 4H4OB 1RBVA 1WAJA 4RG8A 4R8UA 2G8HA 2A1SA 3RMAA 3KJVA 4R0EA 3PW2A 4DL7A 4DS4A 3D28A 1NJZA 1ASUA 3E01A 5KT7A 5J2QB 3ALYA 2IM2A 2BE2B 2X74A 2D3ZA 3V1OA 3K58A 2VG6B 3HXMA 2YNHB 3PW5A 5KFLA 4Y1CA 1DTQB 3C6TA 3V9ZA 1JXLA 4YQWA 2DFHA 2FBVA 3V6JA 1KHWA 3ZSRA 3MFHA 3I0SA 4URGA 1WAFA 3RRHA 3KK3B 3DOKB 3V1QA 5KG4A 3M8QA 5J2MA 1RT3A 4Y34A 4RNMA 2WONB 4HCBA 1S49A 4JLHA 4KBIA 2UVWA 3FRZA 1RT6A 4OGEA 1N4LA 3LWLA 3T5KA 5KT3A 4TQSA 2Z1JA 2UUTA 3DRPA 2HVHA 1I39A 2V9WA 1SH2A 1TGOA 3L8BA 1HRHA 1IKYB 4WZMA 4I9LA 2LSNA 2BQ3A 1TKXA 4FM2A 4CIGA 4FZYA 3VN5A 1VRUA 3LP1B 3KKRA 2IDOA 2W9BA 1LWFA 3HPHA 4CEBA 1HNVB 1C0TA 2JEGA 4XPEA 2HNYA 5D3GB 3C95A 2VG7B 2YKNB 3DM2B 4IFYB 1RTHA 5KFKA 4CJSA 4MK7A 1ZBHA 3G0ZA 3DDKA 1QE1A 4M45A 3RB3A 1YTAA 4KFBA 5C42B 3H5UA 1KHVA 2YHBA 2RPIA 3LALA 4GC6A 1K1QA 3V6DB 4CJQA 3CO9A 3G86A 4FLUA 4URQU 4DEZA 3OJUA 3NH0A 3O3HA 1U4BA 2YNIB 4ECTA 4IFVA 4RNOA 4MFBB 3RR8A 1HNIA 5CYQB 5J2PB 1SUQA 3BSCA 4WFZA 3FQLA 3HHKA 1Y97A 1S9GB 4J2EA 4NCAA 1CXUA 4DQQA 4ED0A 4KO0A 3VQ6A 1QSSA 5T14A 3OYGA 3THVA 2XCPA 3NCIA 4U6PA 3AVKA 4FBUA 4E3SA 3KHGA 4KV8B 4DQIA 1JL1A 1T05A 4KHNA 3CIZA 3DMJB 4WXWA 5KG5A 4NYFA 2PY5A 1J54A 5J1EA 4CJKA 1EX4A 5KFAA 2I1RA 2AU0A 3C6UA 5CYMA 3MR6A 2QXFA 3I5CA 3IAYA 4N47A 2GUIA 3CDWA 4OL8A 1GOAA 3IGVA 4CEEA 2NUBA 1S1VB 5KFYA 2DTUA 3OS0A 1S0NA 4FJKA 5K14A 3DI6B 5KFZA 1QSYA 5J2NB 4NLRA 3RWUA 4KKOA 4K4XA 4KHMA 1RDRA 4QCLA 3TARA 4FS1A 3KIOA 4JRQA 1NK4A 1JLAB 4FLVA 4K4SA 3V4IA 2WTFA 4DTPA 2FJVA 4B9TA 3DLEB 1RDBA 4JV1A 3JYTB 2F96A 5C24B 2KZMA 2OPSA 2HHXA 3IN5A 2HNZA 1UWBB 3AA3A 2D0BA 2RKIA 3SUOA 1KFDA 3UR0A 2ZD1A 3CWJA 4IQXA 1TL1A 4EBEA 5L1JA 5JUMA 3AVBA 3HVTA 2IA6A 2FBYA 4C8OA 2HHWA 1BI4B 4Q5VA 2B5JB 4CF2A 4ECRA 1IKWB 4DQRA 4LD0A 4FJJA 2I5JA 4YP3A 2V4QA 2IOCA 3TVKA 4ICLA 3DLGA 1ITGA 3AV9A 1SV5A 4CGJA 2J6UA 5C5JA 3OL6A 3TAMB 3AVAA 1SL2A 5F8LA 3V6HA 4Y2AA 3QO9B 3H5SA 5SZTA 3NF7A 4HKQA 3BQ2A 4F50A 2Z1HA 1XI1A 1HMVB 5KFEA 4CGGA 2ZE2B 3OYFA 1BQMB 2O4GA 3NHGA 1IKVA 3OHBA 5KRSA 3NGYA 3TAQA 3GIIA 4J9RA 1VSFA 2HB5A 1KLMB 2FJWA 3WNGA 3M8RA 4CFCA 4LQ3A 1TAUA 3QGGA 4M3YA 4WYLA 5KG0A 3PX6A 2GBZA 4CF1A 4CK1A 3AVIA 1GX5A 4NYNA 2KFNA 1N48A 2ITGA 1RYSA 1C0MA 5J2QA 1RBTA 2BE2A 5DG9A 1NHVA 3VQ4A 1DTQA 4B8CA 2YHAA 4F2SA 2P1JA 4YR3A 4EBDA 1FK9B 4E0DA 2F8TA 1J5OB 4Z4EA 4LY7A 4AHVA 5KFPA 2R2UA 3NMAA 1KSPA 3TI0A 1GX6A 3DOKA 1RDAA 5F9LA 4Q45A 2O5DA 4KB1A 3NAIA 5F8HA 2WONA 3CJ3A 4AHSA 2VA2A 3CDUA 4M3TA 4MQ3A 1NKBA 4CJEA 3KLHB 5EDWA 3HK2A 2ZKUA 3FDSA 1YVFA 1T94A 3NBPB 1QAJA 4BACA 3L3VA
chains in the Genus database with same CATH superfamily
5EHHA 2WTUA 3IO1A 4EP5A 5KGXA 5A2QU 1ULRA 5LMUJ 1HHSA 3U7JA 2G0IA 2W9CB 3TO8A 3Q7CA 2I38A 2FGOA 3HF5A 2VJVA 4HDHA 5AQRA 1V4SA 1N8RT 3E1YA 1N5YB 1G2EA 3KWGA 2FLLA 1NJYA 4DR4F 3CJ7A 5D3GA 4IH5A 1Q5YA 3ZSQA 4NLTA 1IG8A 4O3RA 4IFYA 2P9PA 4A47A 1D3WA 4QYZJ 2O8EB 4DPOA 3VQTA 2QK9A 4QW9A 4KHQA 2DH9A 2EPIA 2E5LK 3UD4P 1HPZB 1YJVA 1FKPB 2BANB 4IBNA 2DRBA 3SQ0A 1FT8A 3BZQA 2UV8G 2YNIA 3CDEA 4MDAA 3DLKB 2B4UA 5L9XA 4MFBA 1RB0A 4A59A 1WC3A 2CVIA 4KTQA 3LQVA 1M5KC 4O55A 3C14A 3BQ0A 1S9GA 1ZPWX 3ZTOA 1RJJA 1WHXA 1Q81T 2QTDA 3QFUA 2E20A 1Z25A 3H59A 1X9MA 2GIQA 3H1QA 2LA4A 5GADU 3UN5A 3A8KA 2DITA 2FSNA 4ZP8A 3SBMA 2QSFA 1J6ZA 2CJYB 1EETB 4EU0A 5LJ3Y 4USMA 1T9XA 1YJ9N 3T7ZA 1UJ4A 1K9MO 4MO5A 4O0JA 1NKCA 2CJQA 5LJWA 3QSIA 3D1HA 3F41A 2MGZA 2FJAB 1NSPA 4DR7F 4DQPA 2B0GA 3O5TB 2GV9A 4BWJA 1SKSA 3QRRA 4LF5F 1MMDA 3D2FA 4F02A 3BREA 5J2NA 1P8GA 4A8OA 5HQ8A 2UU9K 2CQ4A 4LBHA 3MMCB 4BRKA 2HRUA 1N33F 4MTPA 3M2VB 3ZT1A 5IZHA 2DNHA 4KYZA 1MMNA 1FVSA 1H73A 1JLAA 2K1RB 2JRSA 3BSAA 2EFVA 1ZTWA 2GQQA 3V9SA 2G8UA 3WZ0A 3D3BJ 2HK2A 2KDOA 3ZSXA 2OEJA 5C25B 2ZUGA 1TL7B 2U2FA 2C2EA 4M3RA 2QE5A 1X3MA 3P96A 2PN6A 4DBQA 2MZSA 4O0NA 1LNQA 4BE2A 4DPUA 5GADI 2B5JA 2IJRA 4H0VB 5AQUA 3JSYA 4OX7A 5AQSA 3S1TA 2YWFA 1X5OA 2HLTA 2IPOB 2N7CA 3VZHA 3M4XA 1ASWA 1RWOB 3WXJA 2KQ2A 4M95A 4O23A 2IVFB 4AL7A 3SUQA 1OVYA 3QO9A 1B70B 3KJFB 3C7NB 5DQIA 5AQGA 1WHYA 1YUWA 1XJWB 2ZE2A 1V3SA 1BQMA 5ITHA 4JYAK 4KHPK 4KT0C 1VRTB 2FF3B 3BN4A 2W01A 2VKRA 3CCQN 2VGMA 1BUPA 1E6VA 4J9KA 1KLMA 3O08A 4KAZA 2D1KA 3EEQA 1RP5A 1TFWA 5AZJA 2V5HG 2E9RX 1IJJA 1YVUA 2P9LA 3OTBA 5KTQA 2PFUA 2RRAA 1GXUA 4RLEA 4HL9A 4DL3A 3G82B 4A48A 1Z6RA 2GUPA 3J7Z5 3R2DJ 1M1HA 1JLCB 2XS2A 1GOCA 1Q79A 3PX0A 5DZ7A 2HBYB 1W97L 1UVLA 4PXDA 1JKHA 4CM2A 3CCZA 4YOWA 1S9FA 4CWBA 7FD1A 3CJ5A 4W5QA 1UA0A 5L46A 3UCGA 3R5AA 4K2JA 1AZSA 3CPWM 4CO5A 4FSVA 2V67A 5JMVA 2JWNA 3D2EA 3W63A 4P7VA 3MXMA 1S57A 2QWNA 3RB4A 3EJMA 5A2QY 3AVCA 2DEIA 3QJLA 2ASOA 4J7CA 4XDDA 4TQRA 1PG5B 1NNEA 3ZNUA 3FZBA 4B9UA 1VSLA 1P6TA 2V63A 4M3WA 4RU2A 2R42A 1N5YA 3RB6A 1FXLA 3VTHA 3OYMA 3EGZA 4S0MA 3TANA 4Y0WA 1JJCB 2YNFB 1X4CA 3JS9A 2Q66A 2O8EA 1UVMA 2QM1A 1SC1B 3H42A 1T03B 3D9BA 4CLWA 4K7QA 3G8TA 4KGXB 2Q0RA 3OL9A 1NMEB 1FRHA 5DM6Q 4J2BA 1HPZA 1WF0A 2RB7A 2BANA 4CJPA 4DV3K 4B1WB 4E7KA 2AYMA 1TK8A 2FDNA 4C3MA 1TV6B 5A76A 3DLKA 2CAJA 4AXIA 3UPFA 5GMDA 5H1SV 3J7A1 2JVOA 4CHYA 4F67A 3KDNA 1HNWF 1RHJB 2A1RA 3QGIA 3VQ9A 4LR7A 2AX0A 1FRJA 4LF6K 3W8PA 3T5LA 2PMWA 2GX8A 4EHUA 1EETA 3EYZA 2OPRB 1IM4A 5KOWA 1GLEG 1LW0B 4IOXA 3SXLA 1VQLS 3LPYA 1TL3B 1QSLA 4MJKA 3KTQA 2X3GA 2DXFA 5ETVA 1UEVA 3KOAA 1HWIA 1Z2LA 3MXHP 3DXKB 3U9DA 3KK1B 3CPWR 4DTNA 4GKJK 2JWKA 1RDCA 2C2DA 2AYBA 5ETLA 3CC4S 2I0XA 1BWEA 4BC3A 2CWKA 1E3MA 4PQUB 4ZCKA 3PFEA 1HBUB 5LXYA 3MMCA 3M2VA 3RSEB 3L2WA 4OZ3A 2AW0A 5E3QA 1VSMA 2K1RA 1HJRA 1S0OA 3GYNA 5ETSA 1RT1A 1WSVA 4M5MA 4X84A 3RAQA 5KFOA 1MA9B 4I7FB 4TVAB 3SIPB 4LF7K 1H7WA 3O6WA 2G8VA 2N7YA 5C25A 2LYVA 1TL7A 1CG2A 1CSJA 4JI2K 1VSEA 2YWKA 5FLXO 1C4CA 2VKZG 5A2QO 4GVEA 2FD2A 3B4DA 4OPJA 4IJNA 1MROB 3ID8A 1GNKA 2M3DA 4LF8K 4NB4A 4CJ5A 4ECWA 3HSCA 3DLJA 3MCNA 4R8UB 5DO2A 4ZVPB 1U1RA 5KG6A 4O0IA 3DXSX 3HI0A 1T9TA 3G2XA 4PXBA 1HQUB 3CJKB 5A6PA 1SVDA 1FNOA 2OI2A 3FZMA 1VRTA 2VG6A 4YHHF 5AQQA 2YNHA 4E7LA 3ZC4A 2QG9B 1VISA 1B64A 1IQTA 2CXEA 1LWXA 3M8WA 4PZVA 1YT3A 4GV3A 4BC2A 4EO6A 1T9WA 2C3PA 3FKBA 5AT1B 5D0RA 4H03B 3KK3A 3K59A 2HIQA 4DV0J 3ZSZA 2YV0X 2DY9A 1VGYA 4WFNL 1ZETA 3G82A 1BWFO 1VQOS 4NLQA 2A2CA 2JLEA 3ZSYA 2DB1A 3ILOA 1FX4A 3N9UC 3C94A 4L3QA 2VJUA 1JCGA 3QIOA 2KXNB 2NXNA 3ZZPA 4CW7B 2OFHX 1OY9A 3O8WA 3SCJE 2AP1A 3KUEA 1NPKA 4IOCQ 4EWTA 4M8LA 5KFFA 5T41A 1U26A 3OXLA 1XHXA 1Y00A 3LZIA 3CO0P 4RPFA 2CZVC 2W42A 3BZKA 3PO5A 2XEXA 2EKYA 3MMAB 3PY8A 3BN7A 1QD1A 2MMYA 3RW6A 4ZPBA 1UFLA 4U95A 3H25A 3VF0B 5ETQA 1N36K 1CJVB 1RUSA 2E4LA 1S76D 2Q31A 3J81j 2IVOA 4KPYA 4OX8A 1BMQB 1ZBFA 2QEXS 4AHCA 2VC0A 5GMKa 3HFKA 4CD1A 4CJFA 5F0UA 4JI3K 1GLBG 4WK3A 4LC9B 4LSNB 2FJBB 3ZTQA 3BGRB 4JI6F 2UXBK 5HSPA 1XR6A 1T03A 4IDKB 2Y1LB 4DS5A 3W2VA 3ZZUA 4MKBA 3SQGA 4OQJA 1U8WA 4GO5X 4KHWA 5E33A 3OV7A 1TV6A 3OYHA 2YQ0A 1CZAN 1GFWB 2OSQA 2Z2ZA 1GMUA 4F4KA 3ZT2A 3Q8VA 1K73O 2ALYB 4DR7J 1FJ7A 1X7VA 2M8HA 1EB0A 3Q22A 1FKAF 2MKCA 1ELOA 1Q86T 2CPHA 1N33J 1X1PA 5CD4H 3T5HA 3DOMB 4CJLA 3CMES 4AE5A 5EGYA 2OPRA 2Q1NA 1LW0A 4N8OA 1X5TA 2VH7A 3L2RA 2JEIA 1TL3A 3CXCM 5HJYA 1BUXA 4B08A 3P6YC 4H8KA 2LMIA 1RTIB 3DXKA 4OI4A 3M6UA 1D9AA 2XO7A 3O1WA 4NLVA 3W9HA 3CD0A 4F4XA 1HBUA 5DDRC 2ZZTA 3RSEA 3QESA 4MKVA 4DQ8A 3S01A 4DB3A 2MQOA 3AVFA 1HQEB 1WACA 1MN7A 4MIBA 2DNOA 2ROPA 2Z58B 2J0QD 1VI7A 4I7FA 4YR2A 3OBYA 3NE6A 4BE1A 3GJRB 1OPZA 1SV5B 4CJ3A 1L3TA 3DLLL 2L41A 3PSFA 2XMUA 3TAMA 4YOYA 4CZHA 1VBKA 4NCGB 4FVCA 3D1OA 1U0HB 1NXIA 2X78A 1C0GA 1FX2A 3QICA 2ILYA 2DNQA 1KC8T 1R0AB 2ZC4A 2VBZA 1D9FA 2AF6A 1NKEA 5D4OA 1TQLA 2GELA 4OV1A 2WHOA 2ACMA 4PG8A 2P2CB 3RR7A 2AJ4A 4ZVSB 1L3SA 1BA1A 5LMNK 1S10A 2BW2A 2EXUA 1DZ5A 3N4PA 3MMJA 1HQUA 2DISA 3CJKA 2DY1A 1LWCB 1YJWS 3OYIA 2JH3A 3L3CA 4LR8A 2IYGA 4RW4B 3WXKA 3UVJB 3RBXA 5L9NA 4CDIA 4UY8T 4QIWD 1O51A 2F7VA 1J5OA 1UTAA 4BWMA 2CH5A 3SI8A 1AXQA 4H5RA 4CFAA 3TJAA 1ASVA 1M1KO 3TJ8A 2W4DA 4LFBF 2YKMB 1DURA 3QYYA 4I2QB 3OSPA 5HVHA 2BDPA 3CMQA 4BR9A 4J9OA 2ILZA 3CXCR 5IV3A 2OPPB 3Q8SB 2WBNA 5CD4A 1HBOB 1N34K 2ZBIA 3B54A 1S77D 3VEYA 1VQKS 4KHYA 3BYPA 1W7AA 1FRMA 1O13A 2PIIA 5AQHA 2G2OA 4JI0F 3FZHA 2DHAA 4C0OC 3N5BA 3CJBA 3ZX0A 2UUAK 5I3UB 1S6UA 3MR3A 1N6QB 4P74A 2X6SA 2KJWA 1KOOA 3NS7B 1WB9A 2BJ3A 4PKIA 2KKHA 4CYUB 1XWLA 3GCXP 2KHCA 1PCAA 1T3NA 1VQ9S 2CVEA 4LFAJ 1WG5A 2NYHA 3TRGA 4LSNA 2IMOA 3NAEA 1R43A 1N36J 1H72C 2NR0A 2AJFE 3BGRA 4Q8FA 5AQYA 4RX6A 2IVYA 1SI9A 5GAGP 2IJFA 4IDKA 2O8DB 3EKUA 1HNWJ 3FCVA 4W98A 4IQMA 2EK6A 3ZCMA 5T7BA 4YDUA 3U3GA 3L2UA 3BEGB 4WYBA 4IR1A 3FZKA 4X64K 2C2RA 1I5OB 2W7PA 2V2ZA 2R8HA 3VAFA 1NJIO 3P45B 2DO0A 3VQSA 2FZGB 2RILA 3L7OA 5CHCB 5BN8A 3CCRN 1LQ9A 2F4FA 4LT6A 1BCOA 1U02A 2RUGA 3MWTA 5JS1A 3FZ2A 4USKA 2DGUA 1B0VA 1IBLF 4WP3A 4AL6A 3M7VA 4HUFA 1EKSA 4RW8B 1KQFB 4JI4F 1WNSA 4JKCA 3UD5A 4DSKA 1XC9A 2UV8A 2E1MC 4H0XB 3DOMA 2CQ2A 1A7GE 3E8OA 1I94F 1NGGA 2YTCA 2E29A 3IM9A 3LP2B 3CJ1A 4KI4A 2IRXA 2FIUA 2QL9B 3ZSOA 3DLBA 3TZYA 2UXDF 1RTIA 4C8ZA 3K5NA 1PAUB 1VSJA 3P5TL 4N56A 2B4OA 4I6AA 5GMEA 3O4QA 2HEKA 2YCHA 1XNRJ 2KM8C 2VBXA 3OBWA 3CQYA 3QJJA 2GJIA 4H5TA 4ZCLA 4OYAA 2D4WA 1HQEA 1C4AA 4OLBA 3VGVA 4FNIA 4E8UA 4QWBA 4BC9A 1KAZA 2AP6A 3S8SA 3T3FA 5FPMA 5BR8J 4WFXA 1CVJA 4ZITA 3U27A 4LF4F 1HI1A 2G2YA 1GLLO 2VBWA 1SIWB 1JNRB 1OO0B 3K7RA 3R97A 1W25A 3PYEA 4PKDB 4NCGA 4A8XA 5L8RC 4DU3A 1XIQA 3VA0A 3T1HF 3HX9A 3QT7A 3KG1A 2DPJA 1R0AA 3M1VA 3RUBL 2OMLA 2BJ9A 4LF9K 4C8KA 2QWLA 1YJ9S 2MHEA 2YKAA 2R3VA 2Z8QA 3VGKA 3NMRA 3PR5B 4NXMK 3JQKA 2OIHA 5J2MB 1LWCA 2J9DE 4OYPA 4ZVEA 1MWYA 4YUDA 4FPAA 4RW4A 1XMQF 1RT6B 4OZNA 3ID6A 2HQ3A 2Q36A 3I55S 1NGJA 2CNKB 3ZT3A 2JHEA 3UR3C 3QZ7A 4ISEA 3VQPA 1HWJA 5KFSA 1H6KX 3SSSA 4C2MA 3KWIA 4KH4A 2IHR1 1Q1KA 4IXCA 1S4FA 3V2UC 3IM8A 4KE5A 2YKMA 1FJGK 2B9WA 1VRUB 3EGNA 1DFDA 4I2QA 1GEHA 2DNZA 1FDAA 2OPPA 2ZJQL 3DOLB 3MM5B 7AT1B 1HBOA 2MZJA 1Y10A 3DCAA 2R7WA 2XCAA 3BEXA 2GMJA 2BOPA 3AO4A 1RWUA 1TVRB 5DLFA 4JI6J 4HWIA 3PACA 2HHVA 2R7SA 1N34J 3UW1A 1HR0F 5I3UA 2D7SA 3DJCA 2CG8A 1N6QA 2LDYA 4Q8EA 5LSLA 3TAPA 3UDEA 4DR1K 4K4WA 1JWWA 4IFVB 4LR9A 1UVKA 4CYUA 4X4PA 4HI2A 4FZXC 4O5BA 2N82B 3CCQS 3CUNA 3LAKA 4UQGA 1FCAA 4P2MA 3SQ2A 4ZVOB 4FOIA 3CJ4A 4EP4A 1XC3A 4BC5A 2MHNA 3MUTP 3T1YK 3BJYA 3GG0A 2EHGA 1S6QB 2HPUA 1KDNA 1FA0A 3SPYA 2O8DA 2E6LA 3LDNA 1YGYA 3O8MA 1WSIA 3F56A 2R7XA 3SQ4A 2HS0A 2YH1A 3QT5A 4FJHA 4RO0A 1WC0A 2P9NB 1RBLA 4ECYA 2LEAA 5CZ2A 4FZZA 2J8AA 1NDLA 5HAOA 1F9FA 3D4JA 4DCOB 3ISND 4FL9A 3NH2A 1SQFA 3QAUA 1BIUA 4RW8A 3M9MB 2YBVA 2PYLA 2DNLA 4Y3CA 1O5JA 1RWWB 3MURP 3H5YA 1XTZA 5AQOA 2OPSB 4DV7K 3IDHA 3K8WA 3QFPA 3GG1A 4FYXB 1DY3A 2EWHA 4HHTA 3I87A 3WC0A 5H9EK 3J8AA 3MMBB 5F0XA 2BJEA 2ALZA 3I33A 2LEBA 4DV5J 1ZA1B 3HVAA 4WU3A 1FHTA 2OZSA 4EO8A 3V9WA 1VC6A 1OH7A 4CBXA 4L73A 4A5AA 1HI0P 4ERDA 4IOBA 4ICLB 5F0WA 2BQRA 3QRQA 3UO0A 2E2PA 3HO1A 4X65K 3O6QA 2M0GB 2Z2MA 1DRZA 1X4AA 4F4AA 3NF8A 2WVDA 3NCRA 3OL7A 1BISA 3PCOB 3D0GE 1ZZNA 5M1KA 1NDKA 1NCLA 4M5JA 1RLCL 1VJQA 2DHGA 5C2CA 1G6BA 2WK4A 4C0HA 4BR7A 4DL2A 2IBKA 3LTOA 1SJRA 3PV8A 2D3OR 3JXUA 3HOSA 4O3QA 4ANCA 3ZO7A 3QGPA 4DS4A 1NJZA 5EOYA 3WXMB 2VFVA 3ALYA 2X74A 3A3OB 5AQWA 2VU5A 4NLCA 4Y1CA 1U2RA 3F2KA 4DR4K 1EJ7L 3N5FA 3ZSRA 4CVNE 2HZVA 5A0YB 4URGA 3DOKB 5CABA 5J2MA 4RNMA 1FFWB 1AA1B 4KBIA 1TZ0A 3FRZA 1HLUA 1RT6A 1WKJA 4WWSA 1YTYA 3LWLA 5KT3A 4TQSA 4X66J 4LFCF 2E1RA 3EDRB 4AUKA 1S7HA 2FSKA 1KTVA 2F4VF 3MDFA 3G71N 1EWQA 2VASA 2E1PA 5HVGA 4FZYA 1HHQA 2MPUA 3O3LA 1VRUA 3LP1B 2GEMA 3ZETB 2XLKA 4H0TB 4CEBA 2FJEB 1HNVB 3DDIA 2JEGA 3CGIA 5BRHA 4FWRA 4DV2J 2NRRA 4IOCL 1ZBHA 4OI3A 2FLOA 4M45A 1YRUA 4K42A 4C1NK 1B0PA 1ZH5A 3ILLA 3H5UA 1KHVA 1Y4ZB 1ATRA 1YVNA 2A42A 4O8KA 2CJAA 3LALA 1K1QA 2GFFA 3W2WB 1CC8A 2UUCJ 3NG8A 3G86A 3QFWA 3QT6A 3OJUA 3NH0A 1BOTO 3O3HA 2FY8A 1FESA 1TMJA 4ECTA 4IFVA 4RNOA 4JKDA 3RR8A 4LF5K 1Y9OA 2HBLA 2DIUA 1MDUB 2XHWA 3OTOJ 4NCAA 3CULA 4DQQA 2P9SB 3VQ6A 3ADAC 3CTRA 2E1CA 4E3SA 1T05A 4OJGA 4DV1J 1IBMK 4WXWA 5KG5A 3W9IA 4JD2B 5KFAA 2I1RA 2AU0A 1WHVA 3IAYA 4N47A 1XN9A 2QWMA 1K73T 5BREA 4HHHA 1FDDA 4HT5A 2P9NA 1VQ4N 3UKRB 4PL7A 1S1VB 1EAYC 5IV4A 1S0NA 4FJKA 9ATCB 1SJ1A 1QSYA 3CCEN 1XQSC 3RWUA 3SAHA 3LM9A 3AAWB 1EQMA 4OI1A 1RDRA 2QL7B 3TARA 3KIOA 1NK4A 4BQLA 2WTFA 2FJVA 2V69A 1RDBA 4JV1A 3QJPA 2OPSA 4RKUC 2Y0BB 5GVQA 2HQDA 1LFWA 3LW5C 4HI1A 4CO1A 3A5LC 3SUOA 1BDGA 5F3TA 1VAZA 4B3SF 1TL1A 3M3ZA 1B0TA 3MMBA 1AUSL 3NVKA 3C2PA 2ITMA 2P9KB 2B9XA 1KQKA 1UW9A 2YPZA 1BI4B 4MT1A 3IFEA 2JDJA 4LD0A 2DHSA 2M7SA 4C6AA 4NMXA 4YP3A 1W26A 4ICLA 3BBCA 3OVAA 4ZVTB 4A8YA 2NZTA 4X4VA 2RMLA 1WJ9A 3HLUA 2W7AA 2E88A 3NF7A 1KQGB 2LP4A 4GVLA 1HMVB 5KFEA 4CGGA 2O4GA 4OFZA 2OHDA 4JV5F 3FBFA 3NGYA 4J9RA 2W24A 4WQ5C 3NMUA 1TAUA 2DR5A 2B51A 4LQ3A 3I32A 5IC4B 1XMQJ 3PX6A 2SXLA 3ZZOA 4NYNA 1S72N 1N48A 2ITGA 1RYSA 3PDNA 3B78A 5DG9A 3O9TA 5IT9U 3R5CA 1BA0A 4B8CA 3EE8A 4X62J 1KN6A 4Z4EA 4DR3K 5KFPA 5A0YA 1KSPA 3EL2A 3DOKA 1RDAA 3FZLA 5F9LA 4KB1A 1MWKA 1M1KT 2A0FB 4CLTA 3CDUA 4MQ3A 2XYGB 3D1QA 4CJEA 2CNOB 4R25A 3HK2A 1B7FA 2ZKUA 2GCFA 3VGSA 2DPNA 1T94A 2IYIA 2HGNA 4J9UE 2C2KB 4PHTX 2E66A 3ISNC 4OZLA 1BY9A 3SAFA 4PPZA 1C6VA 3CNQP 4JI7F 1U47A 4B1YB 3GBTA 2NUUG 3LP1A 4HACB 3A8YA 3UKUB 2RRNA 4DX5A 4JAXA 1I6JA 3Q2SC 1F60B 5EU7A 2AGOA 1SJFA 1HNVA 1JLQB 4OZ2A 4IOAQ 2WW8A 5C2FA 2DGOA 1EKRA 2ZBCA 5IM0A 2FXUA 2G2ZA 2XY7A 3PFOA 2QT7A 4LQ9A 1HD0A 3HJFA 4M63C 3O4WA 3GONA 3UN2A 3VQ5A 4Z2XA 1RWNB 4RW7A 4KH6A 2MKYA 2KHDA 1WC5A 4D3HA 2J76E 4RWTA 1P9QC 2VQFK 3G10A 5H9FK 5A8KB 1KFSA 3OTCA 3FEYB 4OX9F 4TY8A 1G15A 3MR2A 3FLCO 4DR2F 1YSJA 2RHQB 1KD1T 1IR2A 3QEPA 3K5LA 4FJIA 3NXZA 4WZQA 4BRPA 1XNQK 3OR1B 5KFIA 1M5OC 5BYQA 1K0VA 3LM2A 2EFNA 1JIHA 2A40A 3PM9A 2P9SA 4TU8A 2AYEA 5ADXH 4EHTA 1JMTA 2K2PA 4CFBA 3OS1A 2R8KA 3G6YA 4B3OB 1RYRA 5AE1A 2Y1RI 4HTUA 3MF5A 4C7QA 1NJIT 2YWEA 4CF9A 3HHLD 1BD6A 5GADP 2QYGA 4A8QA 2ASLA 2WRMA 3H5XA 4IEEA 5GIOA 2P6SA 3M6VA 4Q43A 2XMJA 1RAGB 5KFBA 4MK9A 1BCMA 3K2YA 1S22A 3UKRA 1S1VA 1IBMJ 4B3TJ 1Y64A 2ZGYA 1JLGB 2I9SA 2XWXA 4JI1K 3MCOA 2ADBA 1S79A 3JS6A 2CUYA 4PYDA 2QIFA 2NRHA 3P5JA 3VETA 1OH5A 2PEHA 3JB9k 1Q8LA 4FJ7A 3B8AX 2GTDA 3VQDA 3R5DA 3HHEA 3WQTA 3P83D 3CCJN 2ZHAA 4FVUA 4OGCA 3C6AA 4DUZK 5LJVA 4I68A 2EBEA 4YHHK 3GSDA 4NL5A 1UFKA 3HPOA 4FWPA 3H1VX 5D0GA 2MKIA 2P9KA 4OHXA 1YJNS 3V5RA 1BI4A 2WOMA 2CNNB 1Z2ZA 4KPCA 3ZXWA 1F21A 4ZLNA 4W5RA 4Q2MA 2IDLA 4JEPA 3TAEA 4CTAB 1VQNS 3PJXA 3EICA 1IXKA 4G1QB 1RAAB 4OYMA 3OYNA 1H0HB 1X4FA 3J7ZT 1FERA 4OIXA 1H74A 4F3OA 1XEZA 3QBXA 1HMVA 2UVVA 1VK0A 3M8YA 3RBEA 3D68A 4ZVQB 2DYAA 4FPRA 4C3LA 2QWRA 3CCRS 2J7WA 5AXNA 4C48A 3I0RB 2JVRA 1TKZB 3KG4A 3VENA 2VCPA 2KU7A 2E1ZA 1S12A 1MU2A 3H4DA 2ZOFA 4HH0A 3QATA 2W6KA 1GT8A 5IT9Y 4ZCIA 1ZXOA 3J80U 5ADXA 4WYWA 3M05A 2PAVA 2F4VJ 5AQMA 3U8XA 3S41A 4Y1DA 2NRXA 2CPIA 2R7OA 2HQFA 4O4GB 4DFJA 1QHTA 3UNGC 4BREA 3M2RB 4FYYB 1RTZA 2K06A 2IC3B 2NCKL 1U1KA 3AA2A 1B4SA 3MTJA 4KJIA 3A3PB 2WC9A 2VG5B 2VOOA 1HYVA 4NLYA 2OPQA 4M5LA 5TKWA 1WOQA 1KCFA 4X4TA 4WP8A 4DQSA 5KT2A 3NF6A 3NCQA 4NZ6A 4ZVHA 3BYRA 3OVSA 5EX0A 1L3UA 4Q44A 4HACA 3UKUA 4NO7A 2ZDOA 1BG3A 1NG9A 3SCKE 1RACB 3H2VE 4O3OA 2V8DA 2D9PA 5C10A 4CHQA 1JLQA 3OLBA 4K4TA 4I2PB 2JC1A 2HIYA 2WBRA 3MXIA 2AT1B 2ZJPQ 4AYBD 3VAIA 4WF9L 3CVKA 3P4UB 3BQ1A 2B7CB 1KP6A 2CJXB 4E1JA 3UNYA 1G1XA 3K9KA 1NK7A 1RSCA 4CFDA 2V7ZA 4A62A 4ZPDA 2NNWA 4CEAA 4C3KA 2IAJB 3QBWA 3A8EA 2B9YA 5A8KA 2BKNA 4K50A 4KR0B 1VQ6N 2XHBA 3SMZA 3A5NC 4ECZA 5JVHL 3L09A 5LSOA 5KFWA 1CZBA 1KKHA 3OR1A 4UUWA 1R6YA 3B4MA 1ILYA 2M4MA 4L8RB 4DN9A 2KL8A 3EMTA 3KUGA 3PKYA 3KJQB 2XC9A 1K8AO 4F3QA 2YKOA 4V1Ak 1L5UA 2BV3A 3CCTA 3W3DA 3AFGA 5DK5A 1T3VA 4B3OA 3ILIA 5KI6A 2E5GA 4JKEA 2DR9A 2DFEA 4DR6F 4A4JA 3ENAA 5F8MA 4CJRA 4DL5A 1IBKF 1FD2A 3PUFA 1BGXT 4DTOA 5KFQA 3CD7A 2G1DA 5KFTA 2RF2B 4ETXA 4WFAQ 1KVBA 3AY0A 1V5VA 2MDAA 1U6ZA 3BGUA 1NZAA 1VLOA 4F4ZA 2UVRA 3AGKA 2RDJA 1JLGA 5IT4A 1ICEB 4EK2A 3A4TA 1BIZA 4ELVA 5IT9O 1OQ3A 3WQUA 1RAHB 2P6TA 3V9XA 2G9OA 2NPFA 5HLFB 2QKKA 3HULA 2AZ1A 4U9RA 1EP4B 1ACMB 4OI0A 4YOVA 4JI5J 4BRHA 1OYDA 1X4DA 1Y7PA 4JI1J 4DPWA 5D8HB 1RGIA 4DL4A 2VA3A 3OHAA 5C2GA 1OPIA 4LH5A 2CGLA 3FCHA 1LW2B 3NOGA 4O3PA 1IJEB 2VQEK 4LFBK 4JV5J 4Z94A 3ZSVA 3CHWA 4C23A 2WAQD 4C4WA 3FUYA 4CTAA 2JOQA 2AZ3A 2FHKA 4G1QA 1CQNA 1S0VA 1KAYA 2J9CA 2EC0A 4NEYA 4H4OA 2VFTA 4DV6F 1FNMA 3OYKA 4USIA 3LZJA 3FGVA 5AE2A 2KW4A 2DNMA 5D6GA 3EY1A 5JLHA 4AQYF 1QVFM 3I8DA 3QETA 2PA3A 1SKWA 2W41A 4JI0K 4B3RK 1JNZB 1UETA 2YH0A 4K43A 3I0RA 3LF0A 2EKNA 1TKZA 5IFMA 5IXUA 3WQPA 3RMDA 4DG1B 3AAQA 5L38A 2W2MP 3L7PA 3JQMA 3TOQA 3CCMN 2DNYA 3HPGA 1U8SA 1WD6A 1KVJA 1T3OA 3J80Y 2DR6A 4GY2B 3N4QA 3T19A 2LQJA 4BQZA 2XMVA 2OD4A 4JI7J 3THXA 3VQBA 4Y0FA 4O4GA 4HHUA 4JI8F 1ZYQA 4CHOA 3M2RA 1VSKA 5CZ1A 2IC3A 2CQHA 2W6LA 4I56A 2K3IA 4ES2A 1WKKA 3OS2A 4KAIA 3D45A 4NXNK 5DGAA 1X4HA 5KOXA 4K25A 1ITPA 2BR0A 1HI8A 2VG5A 3TZXA 4K0KK 4DFKA 4F0MA 4L72B 3PYGA 4FKYA 4JB8B 2PYJA 3UDLA 2D9OA 4X2BA 3DM2A 2GHWA 5B0BA 5EWEA 2UXCF 2WSFC 4OYBA 2WUSA 4AHTA 2HVZA 5FRMA 3GJQB 4PYAA 3CC4N 1UEUA 5HRPA 1DQ8A 4CHPA 4IUFA 1LK5A 4DR2J 5LM7E 1IBLK 4I2PA 1F2HA 2D0AA 3BKTA 4JI4K 1S1TB 4KREA 3HP9A 3AVMA 4PR6A 4J2AA 1DEJA 1QHAA 4OHWA 3V81B 4UOHA 1I94K 4BRMA 2DO4A 4PG6A 2BJDA 1WOSA 4RUAA 1NNDA 3TZZA 2HBRB 3VGLA 2IAJA 2GGPA 2IRYA 2N4CA 3LPTA 3TW0A 2UXDK 4DR5J 4F8RA 2A41A 2GHPA 4GV9A 1QVFR 1VHXA 3KHRA 1RBUA 3BF3A 8RUCA 1FD8A 3SAGA 2F7TA 3QEIA 2OYQA 3MAHA 2NLWA 2YWGA 2RVJA 5F41A 1VMBA 2NXJA 2DGTA 3CFPA 4AILC 4DUYF 3G71S 2R8JA 3AVNA 3HHLB 1EX8A 4NLWA 4DTMA 4G6VB 1XK8A 2Q43A 3Q8PB 4LF4K 4RW9B 3NGRA 3ZZRA 1QUPA 5KFUA 2RF2A 3TU5A 4CGFA 4IDHA 2GIFA 2VZ9A 1SKRA 3HBTA 4NLPA 4A8FA 3OYDA 5KQ8A 1C0FA 3T1HK 4J9VA 4FLTA 4DN0A 3DGPB 2FLPA 2R7TA 3P4IA 3J80O 2VUGA 5KFGA 1FTRA 1V4TA 3U3YA 4U67L 1HKGA 3L9ZA 3FRYA 4IR9A 1U2VB 3HVTB 3PVXA 5HLFA 3D7EO 1EP4A 4PEOA 1M5VC 1VBXA 1X31C 5HI7A 1A5VA 4OZJA 4LSLB 3O3FA 4F4YA 2KKZA 2FC9A 1RNHA 2XI2A 3WNHA 3CMAN 1HYSB 1YITN 1VIOA 3NFAA 1LW2A 3MPUB 3G6ES 3K5OA 3I9V9 2E9ZA 4CH0S 1FKOB 5HJXA 2HK3A 1LOUA 2FJXA 1HNZJ 3ZX3A 2RT3A 3TQEA 3M6GA 4CGDA 4FP9A 1IKVB 4ED8A 1FDBA 4HUEA 3BS9A 1GXLA 4H5WA 3RMCA 3DRYA 3TSQA 3OL8A 2AJ0A 2WBMA 4BRDA 4ES3A 1VQ4S 1NPPA 2XTJP 2BYCA 1R27B 2QO3A 4WIQA 1NJXA 1SJ3P 4NA1A 4BRLA 2C1EB 4FN5A 3GTYX 3C19A 3LOUA 4OLPA 3CCES 4DL6A 4Z37A 1IWAA 2RIJA 3RJMB 4DV4F 2VONA 2PGCA 1HR0K 3KMQA 3DGVA 2IRUA 4AM7A 4DG1A 1WUUA 3POTB 1J53A 2QYCA 3HT3A 3KLFB 3C46A 3L2QA 2HURA 3QQCD 5EY4A 3THWB 3HZ6A 2HHPA 5JMNA 1HW9A 3I6PA 4DLEA 3GE9A 4Q2LA 3X3UA 1RDDA 4FJ9A 2RQKA 1YXQA 4HTIA 3GCWP 4BDZA 3BR8A 8ATCB 1W7WA 2CQGA 5HP1B 5I3QA 2FVRA 1LXNA 3TUJC 4J5OA 2Q3SA 5EN1A 4BR0A 1DT9A 2ATQA 2K7KA 1URRA 1GOBA 3BGOP 3OVBA 2RN2A 1A0OB 5C12A 4JNEA 3TA2A 4JKGB 4MKAA 4ZPTR 1RHQB 1RBSA 4OJRA 1QQNA 4FS2A 4NLBA 3UCZP 2RQ4A 5BRFA 4H4MB 1PYTA 3VCDA 4USTA 4NA2A 4M5HA 3VQAA 4CT8A 2VWBA 1CZ9A 5E26A 2KT3A 1S1TA 2X1FA 3DHWC 1S72S 1VHIA 2AKWB 3OTEA 2XI3A 2J9DA 3KG0A 2CFXA 2GVZB 3TX8A 1IQZA 1KNZA 1YHQN 3V81A 3IR6B 3K0SA 3QSYB 1RTJA 1JJ2M 2J5AA 3FMWA 3HL8A 4E7JA 1ROFA 1OJ4A 4H5VA 3BM7A 4ELTA 5DETA 5KFXA 4WE1B 3DRRB 1HX1A 3OYBA 3CM5A 1GMVA 4PA1A 3RAMA 4C97A 1N32K 4NEZA 4KRWA 2IM1A 3AOAA 2CWXA 1NGBA 2W2NP 3V6KA 1S1WB 2E5LF 2QLJB 3TP2A 1KONA 3OJSA 3ZX2A 4P75A 4FKXA 2JX2A 4PWDA 4CEFA 1TU0B 3AA5X 1YJWN 5LL6Z 4PG4A 3HHLA 5AQXA 4KRFA 2LDIA 3NRBA 1HNXJ 3ENOA 3VALA 5F1XA 4KHRA 4RW9A 3K5MA 3AO1A 3AQPA 2NREA 2Y1JA 3JSRA 2AHOB 1SKUB 1IUJA 2D0OA 3N6MA 2F8HA 3CETA 4CLLA 2GHVC 1SAZA 1GQEA 2HMIB 2I2YA 4CIEA 1VSHA 3DGPA 3K2PA 2HRTA 1BE4A 4P2XA 1RDWX 1IG9A 3K5PA 1WSGA 2C2NA 2PFFB 3VQCA 3J7YU 5E3PA 5F9NA 1U2VA 3VWSA 5CQGA 1A6LA 2HAFA 2ZM6K 1RBAA 4LSLA 3NP5A 1LWEB 4OVLA 4D3GA 2V6AA 2C2OB 1XR5A 2ZWHA 4YR0A 1W2IA 2RRBA 2DKOB 3S3MA 4LFCK 1HYSA 1NOZA 4AQYJ 2V2VA 4IO8A 4CEZA 4CF8A 5RUBA 1FKOA 4ED2A 4ED1A 5A6WA 3UFCX 4M5DA 5D15A 2R9LA 4YY3K 3IP0A 3NOCA 1D5AA 2QGFB 3UE2A 1UAXA 1VK8A 1RCHA 5AJ3J 4GVBB 4RBUA 2P5GA 1E6VB 1GLJO 1APSA 5JICA 2BXJA 5LL6d 5JVGQ 2VL1A 4BDYA 4IZ9A 2BRLA 3KJNB 3M32B 5IQ6A 4OZ1A 1CULA 4BR4A 3M8QB 4HCCA 2RHSB 1RT3B 3U6FA 3SFUA 3A8JA 3NGUA 2CDRB 2DNNA 4JI8J 3VZIA 3VHQA 5E84A 2CADA 1Q8IA 1JKHB 1YJ7A 3J7YI 2BQUA 5AZIB 1NGDA 3MUVP 3HDSA 3POTA 5EWGA 4CJUA 3C8YA 3BV8A 1NSKL 3CCJS 3KLFA 3D2WA 2MKJA 2FUG9 2YKPA 1RWKB 4I69A 3THWA 1AZSB 3GIJA 3C66A 4FJ8A 3EUNA 2GA7A 2BGGA 4FF1A 2UXCJ 3OFEA 1LWFB 1CXQA 5FLXU 1C0TB 5HL7Q 3DLRA 5E7OB 5HP1A 1S5ZA 2A1BA 3CJ9A 3MAAB 1RCXB 4QS7A 3M2UB 1TK5A 2GVDB 4RU9A 4KFBB 5EX3A 2CG4A 1SZ2A 1TELA 4FF3A 1DQAA 1RA6A 1RXOB 5HRRA 2IJNA 5L1IA 1SJ4P 4DPYA 3GWCA 2BMBA 1MG7A 3SYZA 4JKGA 4C8LA 2EG2A 1RISA 3CPEA 4C9DA 4J9QA 4YDXA 5B8HA 3D0PA 2H51B 4H4MA 3H8YA 2QA4G 4Y2CA 4GC7A 3GJTB 2ZJPL 1NK9A 1H98A 3FEXB 4JOUA 2RS8A 3QERA 1MWQA 4K8RA 2AEMA 2GS8A 4J8FA 2GVZA 4FOEA 3ULHA 3NLCA 1UAWA 2A10A 2ROEA 4DUYJ 4ID8A 3WXIA 1OYEA 5J1EB 3P31A 4B3SK 2R2RA 2HHTA 3ZZ0A 1DHMA 3CJ2A 3B6PA 1XMOJ 3RTVA 4WE1A 3DRRA 3AOBA 1MWZA 1GLFO 1HW8A 4WPAA 1DQ9A 3P8BB 1WSHA 3NAHA 3DN9A 2YX7A 3J7AN 2D5RA 3VF6A 4CLYA 2ZQBA 2RAQA 1NHUA 2RDDA 1S1WA 3WIUA 2JLGA 1OSDA 4ECSA 2CPEA 1SL1A 2HHSA 2XSJA 3FSIA 4LREA 2MQ8A 2X51A 2ASYA 3MEDA 4XO0A 1QZ5A 3I55N 4QPXA 4O4RA 2PT0A 3QAEA 2CJBA 4WFAL 2HGMA 1M5PC 4CD3A 2XMAA 1FRIA 1Q53A 4BC4A 5KFHA 3THTA 1RT1B 3EVMA 2F9TA 5FRNA 4YB6A 2HMIA 2LA6A 3C15B 2FVPA 4UQTA 2YWHA 2ZUAA 4H0PA 3R8YA 2H9ZA 4H54A 1AFIA 3A5OC 3E9LA 4FYWB 2KXFA 3NGIA 2G8IA 5K8MA 2AEJA 5ADZA 4WCEQ 2W25A 5HQLA 5FROA 4YNQA 3MOZA 2COLA 1J5EJ 1PYSB 3W1YC 4JBCA 4L74A 1VQ6S 3TR8A 4QU7A 1LWEA 5U47A 1YJUA 4BR5A 4LF2A 4ZKAA 4ZP7A 2O8FA 3UCUP 3FBBA 2Q79A 3CYMA 3M8SA 4M42A 3WEEB 5HMZA 4FCYA 3N6LA 2DIVA 2HG4A 2HS4A 3RMAA 3KJVA 4R0EA 4XH4A 4DL7A 1NM1A 1RI7A 2V7YA 4DV4J 1VK3A 5K8OA 2CQIA 4ZJOA 3DHXA 3UD3P 2VG6B 5DM7Q 3HXMA 2YNHB 4GVBA 1VRQC 3V9ZA 1FNXH 6FD1A 4YQWA 2DFHA 3ZYYX 3V6JA 1KHWA 3EXCX 2ZNYA 4U8VA 1WAFA 3KK3B 3M32A 4JI2F 5L39A 3V1QA 2RE2A 2F65A 5KG4A 3M8QA 1RT3A 4OZ0A 1WSRA 4JLHA 1LOTB 2HKEA 3MM8B 1N4LA 1Q0NA 3T5KA 2Z1JA 2UUTA 4QIFA 2P8IA 2D1CA 1SH2A 1TGOA 2RQCA 1QM9A 3MM7B 5AZIA 3L8BA 4L76A 1WEXA 2BJ1A 2XLIA 1IKYB 2LSNA 4OX9K 2JL9A 2VFUA 4UZCA 2A2DA 2AD9A 5M2PA 5D0EA 3THYA 4X4UA 3VESA 5FLXY 2HFVA 2W9BA 1LWFA 3HPHA 1C0TA 2HNYA 3C95A 1NDPA 1RTHA 1NBEB 3MAAA 3G0ZA 3M2UA 2MB0B 1OH8A 2DGXA 3DDKA 2BE7D 4B1VA 2RJZA 4DX8H 5SUHA 2GVDA 4KFBA 1SPBP 4A8SA 1AW0A 4CI6A 2EK1A 2CPZA 5F3ZA 5LXRA 3GMGA 4CJQA 3CO9A 5ELZA 4DEZA 3O2IA 4WQ5A 1FWKA 1BC6A 2CIMA 5CYQB 5J2PB 4NYPA 2PFDA 3W2VB 5CE3A 3FQLA 1RHMB 3SQGB 3N0VA 3QWPA 1VQ8N 1Y97A 2NRWA 3E66A 1CXUA 3JAMO 2ZGZA 1IBCB 3CCMS 3THVA 4LFAF 1U24A 4U6PA 4KV8B 1N36F 4HEA9 2E5LJ 2CQCA 4A8MP 5J1EA 1PJ5A 1GTHA 4CJKA 3PIOQ 2VF3A 4WK1A 4IWVA 3E2EA 2C42A 3AY9A 1KOHA 2GUIA 5B0EA 2ZOMA 2KFYA 4OL8A 4CEEA 2NUBA 2GMHA 1NMNA 3FNNA 5MLCQ 3OS0A 2UXBF 3Q2TC 3DI6B 3T41A 2DNKA 2WB1D 2R7VA 4NLRA 2XB2D 2FQQB 5K5MA 2ZC3A 2RNEA 2ZH1A 3CIMA 4FWLA 1BWVA 4FS1A 3EDQB 3FSYA 2MZ1A 4B9TA 3AA3A 2D0BA 4OI2A 1KFDA 2QRRA 3UR0A 2O66A 3DKDA 1F5BA 2B8QA 5KQDA 1Q8BA 1IM6A 5JUMA 4EFHA 4BC7A 5AE3A 2V34A 3R5JB 3OT9A 2IA6A 2FBYA 4Q5VA 4WU2A 3C15A 2UU9J 1HUXA 4Y65A 1VJWA 4FJJA 2I5JA 3TVKA 5LT5A 3HFVA 1ITGA 1T0TV 3TAMB 1GAOA 4USVA 3O5BA 4PXEA 3AXMA 1WOOA 4U7BA 1XNRF 3V6HA 5IC6B 2UUBK 5SZTA 4HKQA 4F50A 1N88A 1XI1A 1VS3A 5DRKA 2XO6A 3NEKA 2NXEA 2NSCA 2BH1A 3TAQA 1FXDA 3ZEUB 2VIHA 3WEEA 2ASMA 5BR8F 3M8RA 2N3LA 4CFCA 3QGGA 4JKBA 4WYLA 4PWWA 3KK7A 4CK1A 4YDUC 2LEPA 4CO3A 1YBAA 1RBTA 1WBDA 2ZF5O 3R1XA 1S99A 2UP1A 4V19X 2A3ZA 2YHAA 4F2SA 4YR3A 1FK9B 2EC2A 2V8HA 3TNVA 2F8TA 1J5OB 4LY7A 2JSXA 4OJ1A 1U1OA 3TI0A 5I3PA 4JYAJ 4KHPJ 4MIWA 3B6BA 2QZ8A 2O5DA 3NAIA 2CRLA 4NA3A 4AHSA 2VA2A 2ZBRA 3CB4A 2VFRA 3W65A 4BRQA 3MM8A 3KLHB 1YX2A 3Q0AA 5EDWA 1DGKN 3MM7A 3PRBA 1T11A 2QI2A 4BACA 3L3VA 1YKWA 4OV6A 1IKYA 4CGIA 2ZZNA 3MPWA 2D3UA 3MGJA 5LMNF 1RHRB 4MYTA 3IWNC 2QLXA 3GILA 2LQ5A 3CMAS 4RWWA 1RILA 3DC2A 1YITS 3B82A 4R5PB 3FC9A 4I6MB 2Y1IA 1FWLA 3G8QA 1O6XA 4KGVB 3AO3A 2W8LA 2NRVA 2E7WA 2I6WA 1YI2N 1IBKK 3ZFVA 3KLEB 4DZDA 4B3MK 3V1RA 3D6HB 3EZ5A 4HTJA 4ZP9A 1DARA 3FSXA 3ITHB 2CGKA 2YWWA 3W5YA 4J9NA 1VSDA 1N34F 3HKWA 1U1LA 2F8SA 3T9ZA 3G25A 5IWAK 1TL5A 5CYQA 1B99A 5J2PA 3KLIA 4OO1J 1N5SA 2OH2A 1K6YA 4RZRA 1YAGA 4ED5A 2UUAF 1TMMA 3MN9A 3MUMP 3FFKB 3D6MB 1FEEA 3IWXA 4KV8A 4O44B 1NMDA 3CC2S 1AROP 4UOGA 3NKYA 4MO4A 4DV3J 2KH9A 3GV5B 2H4WB 2VYPA 2VDHA 1W9HA 3AJ2A 3Q8YA 4RNHA 1YJTA 1NLVA 1UJ5A 2YKQA 4DFPA 4M5GA 1OY6A 1NGEA 3EVOA 3RBZA 2E7VA 3AVGA 3DI6A 2HHHK 3PKMA 3UWTA 1RT5B 1X3NA 4QW8A 3K57A 1I3AA 4CLUA 4NI2B 4Z0UA 4B9VA 1C1BB 1NOYA 1UPMB 4LF6J 4DV6K 1J2VA 4PQAA 2ZEJA 2HSEB 2KT2A 1GMWA 4NLSA 1RDUA 3NL0A 2HVDA 4KI6A 4XIUA 4K4VA 3BF4A 5FPNA 3IBWA 4ZOSA 3RB0A 2H4YB 2BM0A 2Z57B 4YMEA 4QR0A 4FJGA 2XMKA 3HSDA 1LKZA 2V2QA 3EVWA 3DRSA 4ITSA 4GKJJ 3TAFA 4ZP6A 4ID5B 2R8GA 2HHUA 3MM9B 1YHQS 2QWOA 4ES1A 3B6OA 4DU8A 5ETPA 4DV5F 8AT1B 3MN5A 2C28A 3I82A 2FLNA 4ETZA 4CIOA 1HL6A 4OYWA 3KXDA 3U4LA 1D4XA 1QAXA 3IXQA 1HHTP 5D4LA 4MK8A 4LF7J 2MLZA 4M3XA 4CM0A 3M1VB 4IRKA 4C11B 4NLXA 2CH6A 4CF0A 4EZ6A 4JI2J 4NX9A 1S6PB 3ZEUA 3HD2A 1NGFA 3I56N 2QW9A 1HWKA 2UUBJ 2JFKA 5KAKA 5ETRA 2IM3A 1NGHA 4U8YA 4GKKK 3W7BA 3LDPA 4OKJA 1G3OA 2UYTA 4LF8J 4J2DA 2V68A 3H3OB 5LMUK 3W5ZA 1SIZA 3HVRA 1CBKA 1FK9A 1BQXA 2HFOA 2E1YA 1OSCA 3GFYA 4DU7A 3QGHA 4A46A 1AFJA 1Q9XA 4J91A 5HATA 3NWGA 2OSRA 1A5WA 2R7QA 3OSNA 4QYZK 2OELA 2Q97A 4ILHA 3KLHA 3I8BA 1X4GA 2LQBA 2J7UA 1TK0A 2Y8WA 3RZAA 3VPZA 1X0FA 4LRBA 4QR2A 2HVEA 3R27A 4QYRA 1Q82O 1HBNB 1B9DA 4X66F 5CA5A 4DOZA 1VYAA 3M1FA 1R8AA 4OI6A 1PYOB 2FZKB 3SV3A 1HBMB 2NS1B 2QA4N 4DCJB 5HL7L 1H3DA 1VC0A 3MEEB 4OKEA 4R5PA 3FQKA 4I6MA 3CG7A 3GPAA 2P9GA 3ETMA 1RLDA 4ZDNA 4B9SA 4JN4A 4EGLA 1QQOA 1NAQA 4PG5A 4NOHA 3JQJA 1EHWA 4DV2F 1RWVB 4ZVFA 4PPDA 3BP8A 3KLEA 1RWXB 2H5EA 4FJMA 2KVQE 1WDTA 4J90A 5KT4A 1Z4UA 1VQ7N 3VAGA 1IO2A 5HRSA 1PC4A 1YG0A 3ITHA 4DSJA 4H0YB 1YJNN 2X3DA 3BPSP 4FK0A 4DDFA 4M5KA 4Z4HA 5G4DA 2UUCF 3RMBA 4JI3J 4A5BA 3OR2B 3EPIA 3Q7BA 1NK6A 2E8AA 1VQNN 2J0XA 4U96A 3MWBA 4TYBA 2UXBJ 2M2BA 4CZIA 3SCXA 3OTOF 1Q86O 5FDLB 3R3TA 3OYCA 3IA0A 3MFIA 3CCLN 5E3AA 4O44A 1DJ0A 4DR1F 3NGKA 1YK9A 2O8BB 2B4JA 1BXNA 2Y0SD 2Y9HA 2MSTA 3S3NA 4WTOB 4M41A 4BVPA 4NYZA 4DV1F 5KRTA 1K9MT 3CERA 3D54A 4I9QA 3H08A 3AA4A 4CEDA 2NYIA 3R9LA 5B08A 3QZ8A 4TU7A 3T1YF 4QU6A 2H65B 3TUIC 1PSDA 4FLXA 1VR6A 3VEXA 4V19S 2J6TA 3IBFB 4WBFA 2J6SA 2CNLB 1RT5A 2VHGA 4M5NA 4NI2A 5DLGA 1U1MA 4IG3B 4HLBA 2M8DB 1S3XA 1C1BA 4KB7A 1T9UA 3KK2A 5FD1A 2PI4A 1U1QA 1F0XA 3HSTB 5F2RA 1P8ZA 4KQZA 2EW9A 4ZLLA 5GINA 1PJ7A 4R0JA 1FJCA 1WKLA 3RBDA 3KNAA 1SBRA 2ZH4A 5BR9A 1F5CA 3R6LB 4RW6B 5LJ5Y 1C1CB 1QQCA 5EXWA 1RAIB 1ZBTA 4FW2A 1U2CA 4DSIA 4FM1A 4EI2A 4ID5A 4BRGA 2FHJA 1WEYA 1KC8O 2G0JA 4OLAA 3MM9A 3OTDA 2KLAA 2CPFA 1GLDG 3MD3A 1FXRA 4ED3A 1ZOTA 3Q23A 1K1SA 4U7CA 2ZJRQ 3OA9A 3N28A 3AGRA 5CHIA 2DPIA 2QA1A 2V4JA 2HOEA 4FZVA 2KXHA 3OYEA 2BACA 4DSFA 1C2PA 4UY8O 4C11A 2NRZA 1RA7A 4DHYA 2ASJA 1S6PA 1NB2A 2DD8S 1WORA 3CC7S 4GNIA 1YRXA 1JQGA 3VQ7A 1IN0A 1NH7A 1C1AA 4QOZB 4X65F 2XBPA 3EN9A 1S0MA 3VEWA 4N76A 3FZFA 3IAS9 4GV6A 3BR9A 4AH9A 5DM7L 3QNOA 3CJAA 2JEJA 3ZLJA 1H2UX 2NZ4A 4ID1A 2NRTA 3QMLA 5I42B 5LMNJ 2ZHOA 3LH2S 3GQCA 4DMNA 4GO7X 4OYOA 3ENBA 3TZWA 4WFBQ 3T69A 5AQIA 4IKFA 3P38A 4X62F 4OYXA 3EGVA 1V6HA 1RT4B 3AH6A 3GJSB 2HWIA 3J81U 4IJAA 2M9KA 3VQQA 1ZTTA 1XBWA 2GIRA 2K8GA 4B1XB 4OHVA 2WSEC 4EYHB 1IKXB 3EM1A 3PW7A 3PHEA 4W5TA 3MN7A 1HBNA 1FVQA 4BR2A 3JSBA 1QUVA 2L08A 3H45C 4FJXA 4XDCA 1RABB 4OMFG 2CQPA 3AXKA 3BUZB 1RHUB 3N6NA 4MKYA 1CC7A 1HBMA 3SI6A 2IY5B 3MEEA 3RRGA 1VSIA 1LAWA 2VPXB 3JTPA 4DCPB 2OCEA 3MHYA 1D8ZA 1LK7A 1D09B 3AA9A 2HFUA 3PW0A 4GMJB 2LKZA 5BYRA 3UQSA 1UJ6A 2UUAJ 1LEOA 1NUEA 4JRPA 4K8XA 5GAHU 1U2FA 2ACYA 2F8EX 4LRDA 4WFYA 2GO8A 3ISZA 2AX1A 5C2DA 2ASPA 1T05B 2YQ3A 3AODA 2IMWP 3OR2A 2H3GX 3NWRA 2AGQA 3DMJA 2HRYA 5DM6L 3GZ7A 4WQ4C 5DQGA 4KC5A 3H7HB 4IO1A 2V9KA 4U7UK 4PKGA 3AVLA 4LF1A 3T5JA 2A6AA 4LRFA 1FF2A 1BO5O 1VLYA 1RAFB 5FDLA 4IRDA 1XERA 3EXYA 2OLWA 3MEKA 1JJHA 4CECA 4ZVRB 2O8BA 2VFSA 2CPJA 1REVB 4OJ3A 1WG1A 4F3MA 3CIPA 1R6VA 3CQ8A 1SJQA 3PIOL 2W40A 4X64J 4F04B 4BROA 1ZA2B 2LXIA 5D78A 3BF1A 2XY6A 4RNNA 1NO8A 4ILGB 3ULEB 3WHIA 1D0EA 3A8IA 3DLEA 1T95A 4B9MA 5C24A 2QMUB 4A8WA 3HHNB 5GAHI 3O9SA 1H2VZ 1IBMF 4RNFA 4B3TF 3KLGB 3QEXA 5F8JA 1TL1B 4IG3A 2KJVA 1ZBLA 2MQMA 2B6AB 3VQEA 1TKDA 4H5NA 3VGTA 3M8PB 3L6QA 4G9ZA 2OFGX 4IO9Q 1Q16B 2W4PA 4IG0B 2A3JA 1UZHA 2E9TA 3ATVA 4AL5A 4I6WA 4TLRA 3R1LA 2DK2A 3AB4B 1KLNA 3MR5A 4LH4A 5KT6A 2H48B 1RFQA 1VQ8S 3O80A 4ZLPA 4RW6A 2QN6B 1C1CA 3VR1A 3NF9A 3LPEA 5GAEU 3OYJA 3DXMB 4CQ1A 3U1LA 4FF4A 3NVMA 1UP1A 4FK4A 2ZH2A 1WUAA 1Q9YA 1GLCG 1VFJA 2CKWA 4DXLA 2HFNA 1FDNA 1A5XA 4DV0K 3EZUA 3NGDA 3OYLA 1H2TZ 1ZZFA 1WLJA 3HSGA 1FI4A 3BO4A 2ROGA 2JEFA 3D3CJ 5BYSA 3PJ9A 1UL3A 4ED6A 4WXOA 4FDFA 2MQNA 4LBIA 3QIDA 3IG1B 3VAKA 3C16B 2O8CB 3ATUA 1MN9A 3QLHB 4J9SA 3IMQJ 3A12A 5HRNA 4DTXA 4E89A 2A18A 4PWUA 3BH6B 2XY8A 4ALZA 4LRAA 1TP7A 4FWMA 3BB5A 3KD5E 3GB0A 2HVIA 4DSEA 4DTJA 2KG1A 3KWMA 2YHYA 3QNNA 3CI5A 2ZJQQ 5CXTA 2I7NA 3IAM9 3X1LB 3M6XA 3UB5A 1R8CA 4LF9J 3CCVN 1SQKA 5T7LB 5J1NA 4U7UD 2O01C 1Y11A 5I9EB 2MSSA 5I42A 3NDKA 4NXMJ 3VAHA 5GAEI 4QAGA 1WNEA 3OXFA 1ZM2A 2O4IA 1YZ7A 2JLFA 2BA9A 1WF2A 2MQPA 1DAXA 1XMBA 1ZAVA 4JHDB 3HSJA 1RT4A 3PSIA 2P5OA 3TUZC 2W9CA 5CCMA 3N79A 3J81Y 5K20B 3D7SB 3WDOA 3FMBA 1T8EA 3S9HA 1BU6O 2E5JA 4DU4A 1QS4A 1Q8KA 1S59A 3CFRA 2ETJA 1HWUA 4M94A 2KTQA 1JLBB 4LIWA 3Q8QB 1IKXA 3HMJG 3OD2A 2PO4A 4DR3F 2H54B 5IM0B 3N4WA 1FJGJ 1CLQA 1F3FA 3CD6N 1V3RA 1N56A 3BH7B 2NXCA 2CPYA 4NLOA 5FPEA 3RG6A 1PBUA 2GV1A 3SBGA 4RW7B 1N5TA 2HNDB 5HN0A 4ZIWA 3WBZA 3BDEA 3IGNA 2R2TA 3H98A 4LIRA 3M9NB 3WC2A 1FKPA 4TY8B 4MIAA 4DR7K 1ZC6A 3OY9A 3LDOA 4CNZA 4B02A 3BKFA 1YZ6A 2XMTA 1N33K 2RDIA 1G99A 3ZNJ1 4NCBA 3ILJA 4OLOA 3G6EN 1QQMA 4DF8A 4DR1J 1N5QA 4RUHA 4H4KA 2FYXA 3CFOA 4CEQA 2GMLA 3TTDA 5AQTA 1N52B 3H0PA 3IMXA 1E4FT 2IBOA 3CJSA 4DCHA 3I4PA 2XG8A 1UOCA 4XTTA 5B09A 1WWHA 3T1YJ 4FM0A 3SPZA 4ILJA 4C0BA 3IUCA 2PSZA 2P51A 2VQFF 1OIAA 2AGPA 1NBWA 2XY5A 4Y2MA 5M1QA 1SB6A 5CY4A 3CF5Q 1REVA 3HP6A 1H7XA 4B1UB 1KBRA 1NK8A 1XNQF 1A9NB 4HR2A 1NM2A 3GV8B 4JK8A 2V0NA 4O3SA 3QMQA 1JXBA 3KZBA 1BL3A 2ZH6A 3ULEA 2IA0A 1YWXA 2DT9A 3O3GA 1YI2S 2LVWA 5LOQA 2VC1A 5AXKA 5BPLA 4ZPVR 3RYLA 4Q7AA 3LPUA 4ANEA 3KLGA 4A2BA 1Y0HA 4J9MA 2XZTB 4DX7A 2YX1A 4Y2KA 1M0SA 5CAAA 1X60A 2B6AA 1TL4A 5HBMB 1I1GA 3M8PA 4DV7J 2WOMB 4IG0A 3J7YP 4HDGA 1PO6A 4N8NA 1ZBIA 1X9SA 3H6EA 3KNGA 5H9EJ 4JI5F 4E1MA 1DTTB 3FCWA