4CJKA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjkA00
1RT1A 4AHCA 1SKRA 4CGHA 3SI6A 2BE2A 2YV0X 3MAQA 3CFPA 4O55A 3RR8A 3VQQA 2Z1JA 1L3SA 3KIOA 4AH9A 1KCFA 5KGXA 2YNHA 3ZSOA 2X6NA 1S1TA 1S6PA 1VSIA 1L3TA 1EX4A 4FK2A 4YFUA 2Q3SA 4DU1A 3HYFA 2DTUA 5C25A 4W5TA 3AV9A 3AA5X 4Y1CA 4HUFA 3ZT2A 4DS4A 1X1PA 4IG0A 4FJHA 3THVA 3OYIA 3F9KA 4LSLA 3PX6A 4B9NA 4DSKA 1UA0A 2HHXA 3B6OA 1JLCA 3V9SA 3HT3A 3SQ1A 2OZMA 4HUEA 1NK5A 4M45A 5I42A 2G8IA 4HVJA 1ZBHA 4CFDA 4OKKA 4FCYA 4KHQA 3K59A 1SUQA 2XHBA 1S9GA 1T03A 3TAQA 4DFMA 3VQ5A 3O4QA 4CFBA 3SNNA 4DSJA 4CIEA 2YKNA 1QTMA 1D9DA 3KLGA 3MXIA 2OPQA 1UOCA 2P5GA 1FK9A 3L3UA 1XHZA 2O4GA 1W0HA 4BE1A 3LPTA 3LZJA 2ITGA 3RMCA 1T05A 4I2PA 3M8RA 3QESA 4AHRA 1ZYQA 4UQGA 4R5PA 3NF9A 1TKXA 3HVTA 1NJYA 3UIQA 2YHAA 1SKSA 4OGCA 4IDKA 3L2QA 1KRPA 1LWEA 3NAEA 3AVIA 1TL3A 4CIGA 3DOLA 1NK8A 2YNFA 1CXUA 1ZBFA 3CM5A 3B6PA 4ZTJA 3NF7A 2XO7A 1WSFA 1QSYA 2OPRA 2VG6A 3QO9A 3HM9A 1VRUA 3V9ZA 4DTNA 5C42A 3LDSA 4AILC 2D0CA 1TKZA 3JSMA 4E7JA 5SZTA 1HQUA 3NF6A 4CECA 4B9LA 3G0ZA 3DM2A 4DLEA 1JLEA 3T3FA 4KHUA 3LPUA 3QIPA 4IG3A 3HJFA 2HNZA 2G8FA 1JKHA 4FXDA 4Z4EA 1X9WA 2VG5A 3ZCMA 4CEAA 4HHTA 1U45A 3ZSVA 1WAJA 1HNVA 1HYZA 4OLAA 2E6LA 3M8PA 2EX3A 4M3YA 2I5JA 2YNGA 4ELUA 4FZXC 3PUFA 3L2UA 3C94A 3G10A 3MEGA 1S9EA 1BGXT 1RBVA 3KD1E 2AJQA 2P1JA 4CJUA 1S1UA 4DTRA 5HLFA 3LP1A 4KB1A 4CERA 3DYAA 4FLXA 1NK9A 2B6AA 1TGOA 3PO5A 4KHSA 2NUBA 3DLRA 1LV5A 3ZSQA 4E0DA 1EETA 4DTOA 1NOZA 3RMAA 1BQNA 3V1QA 2DFEA 3OYAA 4CJLA 3LANA 3VQ9A 4DSLA 4HUGA 3HK2A 3QIOA 1VSKA 3LAKA 3I0SA 4EP5A 5HRPA 2R7YA 4DF4A 2HHVA 1WSJA 4N76A 3VQCA 3AO3A 4CEZA 3CFOA 3D45A 4FLZA 4KI6A 3AVBA 4YNQA 4Z4IA 1VRTA 2HHQA 4NYNA 1RBSA 1JLGA 1KVCA 2QKBA 4RW6A 4F3OA 3ZSZA 3O4NA 2YNIA 3HP6A 4DQRA 2GUIA 3KK1A 4CIFA 3DLHA 4KHYA 5KGWA 3NHGA 2VG7A 5J1EA 4Y1DA 3SPZA 1BCOA 1EP4A 3VQBA 1ITGA 4CGIA 4CJSA 3AVGA 4RG8A 3QEPA 3NGIA 2A1SA 1Q9YA 4B9SA 3CYMA 3VQ7A 1HJRA 4CHOA 4B9UA 4CJWA 4DTPA 2HNYA 1C6VA 1JLAA 3NGYA 1SL0A 2A1RA 3KKRA 3HXMA 2OPPA 4GMJB 4B3OA 4CJTA 2D0AA 3SZ2A 2GV9A 4B9VA 2OA8A 1RT5A 3C6TA 3EZ5A 4B8AB 4QAGA 4CF1A 3DRPA 3TAPA 3VQ8A 1W9HA 3WNEA 1S1VA 3MXMA 1JL2A 4KKOA 1NKBA 3V4IA 4RW7A 2XY8A 2ZQBA 3TWHA 3SJJA 3LP2A 4FVMA 1BCMA 1U49A 1Q9XA 4LSNA 4HCBA 1C1CA 1EXQA 4LH5A 4W5NA 3QLHA 4M41A 4NCGA 4IFYA 1X9MA 1QE1A 3SQ0A 3DLKA 1YT3A 3ALYA 4K8ZA 1BIZA 2G8UA 5I3UA 5KRTA 1IKYA 4KV8A 3WNHA 1A5VA 3CQ8A 2F8SA 1LAVA 2IC3A 1HMVA 5CYMA 1BQMA 4CK2A 3NGZA 3NH1A 1TK0A 1HQEA 3LZIA 4AHVA 4C8LA 4H8KA 2D0BA 2YHBA 4ID5A 2BGGA 3OYGA 1UAXA 3DLEA 4I9LA 4GVMA 3AO2A 1MU2A 5CZ2A 3SCXA 3BGRA 1RT3A 1IKXA 4C8MA 4DQSA 1A5XA 3KLFA 3DLGA 4BWJA 1RTDA 4QCLA 3AA3A 3VQ4A 3OY9A 4B9MA 4DFKA 4DTXA 4CEDA 1FKPA 1RDAA 1SKWA 4CJRA 3K2PA 3CG7A 3L2WA 1IH7A 5HRRA 3ZSXA 3PO4A 4H4MA 5CY4A 4N47A 1BI4A 3KLHA 3NCIA 3SPYA 2LSNA 1VK0A 3VA0A 4OJRA 4FK0A 4KRFA 3DRSA 3LALA 1J5OA 4CJ4A 1DTTA 3ZSRA 1TAQA 3SV4A 4DQQA 4CGJA 2D5RA 4OKEA 4CFCA 4CESA 4AHTA 1D9FA 4O5BA 2G8HA 4M3RA 2QXFA 1XWLA 1NK7A 1IG9A 2OYQA 3M8QA 4FJJA 3ZT0A 4FW1A 4O0IA 2Z1IA 4Q5VA 5HRNA 3M8SA 4CHQA 3DMJA 4RW4A 4FJ7A 4BACA 4DTSA 4CHNA 2ZE2A 4BWMA 4LH4A 5HP1A 4KHWA 3P83D 1TAUA 2Z1GA 1B92A 4EZ6A 1UA1A 1VSDA 1KLNA 4JLHA 3PY8A 3K58A 4ID1A 3AVKA 4E89A 3O3GA 2RF2A 1B9DA 3RRGA 1VSMA 4CEEA 1GOBA 2Y1JA 4DQPA 3VQPA 2F96A 4OKJA 1F21A 4AHUA 3RMDA 1BI4B 4CF8A 1KFSA 2HHWA 3U3GA 3MXJA 4KTZA 2G8VA 5EU7A 2QKKA 3ZT4A 3DOKA 4DWIA 3QNOA 3KK2A 4F8RA 1NOYA 3HP9A 1KFDA 5FRMA 2O4IA 1NJWA 3NH2A 1RT6A 3HPGA 3KTQA 3OJUA 2IAJA 1T8EA 4XIUA 1NK6A 4G1QA 2HB5A 1JLFA 3TAEA 3QNNA 1U47A 1JXEA 4GW6A 4W5OA 4DU3A 3OYHA 4M3WA 4N41A 1RT2A 2XRIA 3QINA 1QSSA 3NE6A 3OS2A 4FJMA 3HO1A 4OPJA 3QETA 2IOCA 1HRHA 4PUOA 4BE0A 3ITHA 2BANA 1QHTA 3C95A 3PX4A 1J53A 3E01A 4CHZA 3F73A 3V9XA 4NCBA 3AVCA 3AO5A 2KZZA 2P5OA 4FJ5A 3LP3A 3VQEA 1TV6A 1KVAA 1C0UA 5DMRA 3TAFA 3HPOA 4PY5A 1IO2A 1RDBA 3SUPA 1NKEA 1RCHA 5J2NA 4KI4A 1C1AA 3P5JA 4J2AA 3AVJA 1DLOA 4E1MA 1TK5A 3SQ2A 4CGGA 1RILA 4H4OA 4FK4A 1ZBUA 1REVA 3JYTA 2HMIA 3TAMA 4IKFA 4FW2A 4EZ9A 3H08A 2ZD1A 3ISNC 1SL2A 4CJ5A 2FBXA 3PX0A 3RWUA 4JRQA 4ICLA 5KI6A 4FM1A 4OLBA 1WSEA 1ASWA 3V9WA 4DU4A 3RMBA 3OYEA 4M3UA 4CE9A 2YKMA 4CK3A 3OS1A 5D3GA 2FBTA 3OYKA 4DG1A 4FLYA 5J2MA 4OPKA 1N5YA 3AVMA 4CCHA 2HVIA 1WSHA 1QSLA 4BDPA 4M42A 4LD0A 2WOMA 3TAGA 1WSGA 4J2BA 1Z25A 3FFIA 4QOZB 2HVHA 4CEOA 5CZ1A 1RNHA 5T7BA 3L2RA 2F8TA 3V81A 4CF9A 1WN7A 2WONA 2JGUA 2OPSA 4J2DA 1B9FA 1HYVA 4BE2A 1HNIA 1X9SA 2IDOA 3DI6A 3OYBA 3ZT3A 2G8KA 3HL8A 1SL1A 1L5UA 3K5OA 4KREA 3LAMA 3OYJA 4CJKA 4O0JA 4E7IA 4DTMA 3SUNA 2HNDA 1DTQA 1VSHA 1D8YA 2X78A 1JXBA 3ASMA 3O3HA 3QERA 4F2RA 4F4KA 4I7FA 3TABA 2HW3A 3VQAA 1NK4A 1RBRA 2G8WA 2KFNA 4CJQA 3V1OA 4J2EA 3IG1A 1S5JA 4DTUA 4MFBA 4DQIA 2KFZA 3QEXA 4K8XA 4N5SA 3TARA 1GOCA 4AHSA 3ULDA 4BDYA 4F2SA 2KZMA 1J9AA 1UWBA 2E4LA 2XY6A 1NKCA 3OYMA 4I9QA 1NJZA 4HTUA 3OYCA 4C8KA 2VWJA 4Q0BA 4FJGA 3AA4A 1ASVA 5C24A 3U3YA 3SUOA 4W5QA 3KLIA 1JLBA 3DRRA 4I2QA 5J2QA 4FJIA 1N6QA 1VSJA 3AO1A 2DFFA 3MEEA 4E1NA 4CJPA 2PZSA 4CGFA 1U4BA 1FKOA 3MEDA 3OYFA 3V6DA 4C8OA 4FZZA 4FYDA 1KTQA 2X6SA 3MECA 1CZ9A 1I3AA 1LW0A 3ZSWA 1EKEA 3K5NA 4ELVA 2VWKA 3OYDA 4E7LA 1IKWA 4Z4CA 4JS5A 1IKVA 1TL1A 3TR8A 1XC9A 1TKDA 2DFHA 3S9HA 4FM2A 4DTJA 1RDCA 3P1GA 1XI1A 2FBYA 2KW4A 3KK3A 1T7PA 4B9TA 1ZBIA 3QEIA 1G15A 4ZTFA 1TK8A 2BDPA 1BHLA 1CLQA 2EHGA 5DK5A 1BIUA 4CHYA 2E6MA 2FBVA 3V9UA 3AVFA 1WAFA 1A5WA 3ZT1A 4PWDA 2IS3A 5E41A 2W42A 4KO0A 1WLJA 3IS9A 3AA2A 3OS0A 1J54A 3AVAA 4MQ3A 3C6UA 1QQCA 4DSIA 4DFJA 4DFPA 2KTQA 3CFRA 4OGEA 4CEBA 2QK9A 3OYNA 1Y97A 1XHXA 3LWLA 1RTIA 3NBPA 5CYQA 5SWMA 3K5LA 4JRPA 3OVNA 3L8BA 4ZHRA 3K57A 1KVBA 4L8RB 1O1WA 3AVHA 3RR7A 4KTWA 3ZSYA 4LY7A 4FJKA 4CJFA 3VA3A 1S1XA 1TVRA 4E19A 1R0AA 2Y1IA 3AVNA 4KHNA 5JS1A 4CJVA 5KTQA 1RBUA 3HSTB 3T19A 4DS5A 3EY1A 2HHTA 1C0TA 2KQ2A 5JS2A 4IFVA 4CEQA 2IGIA 4FLUA 3PV8A 4FLWA 4FLTA 3AVLA 4PA1A 2XY7A 4B8CA 4KPYA 2DY4A 2PYLA 4M3ZA 3VQDA 3CM6A 3OJSA 1RTHA 1VSFA 1RTJA 1WSIA 3L2VA 2P51A 4C8NA 4IBNA 5HBMA 4KAZA 4KTQA 1U04A 3TI0A 4RW8A 3U6FA 1RT4A 4FZYA 1LW2A 4O4GA 4DSFA 3DLBA 2OZSA 5HRSA 4O44A 5J2PA 4E7KA 4Z4FA 2JLEA 3LP0A 1LAWA 2RPIA 4M3XA 3EYZA 3KJVA 4FJLA 4FJNA 4PQUA 1YVUA 3SQ4A 4WE1A 1CXQA 1L3UA 4CJ3A 3TANA 2HHUA 1RT7A 4RW9A 5K14A 1BL3A 3HVRA 2RKIA 4FJXA 4FJ8A 4F3TA 5FROA 3QEVA 4JS4A 3S3NA 4CF0A 3HPHA 4CFAA 4CK1A 1S1WA 4KB0A 2FC0A 4E7HA 1LWFA 3KD5E 2ATQA 1GOAA 5FDLA 1I39A 2Z1HA 1FXXA 4NYFA 3VQ6A 1QS4A 4CJEA 3S3MA 1BISA 4DLGA 1C1BA 4OVLA 4FM0A 2X74A 3AO4A 1C0MA 3RRHA 5FRNA 1RDDA 3OYLA 3L3VA 1LWCA 4W5RA 4FLVA 1NJXA 1CZBA 2B5JA 1YTAA 4Z0UA 5HROA 4FJ9A 3K5MA 2PYJA 1D5AA 1JL1A 1JLQA 3KKSA 4NCAA 1RBTA 3IRXA 2RN2A 2HHSA 3NH0A 3QEWA 3A2FA 1VSLA 3NFAA 3V1RA 4Z4HA 4TSXA 1NK0A 3BDPA 3S3OA 3T1AA 1VSEA 1KLMA 4CHPA 1HYSA 3LWMA 1S6QA 3O3FA 3RTVA 2XY5A 3KLEA 1YTUA 4Z4GA 4HCCA 4DMNA 4KFBA 4DSEA 4N56A 4E3SA 1U48A 4M3TA 2PY5A 1WNSA 3SV3A 3VN5A 4B08A 1TKTA 1KSPA 1HPZA 1Q8IA 3I8DA 3SUQA 4CGDA 1Z26A 3NF8A 3WNFA 3IAYA 4CF2A 3NDKA 3SYZA 1ASUA 4EP4A 4DF8A 3WNGA 1ZBLA 1L3VA 2GBZA 1SV5A 3I0RA 5KRSA 2B4JA 4CEFA 4BDZA 4ELTA 1K6YA 3D0PA 2ETJA
chains in the Genus database with same CATH superfamily
1RT1A 4AHCA 2YV0X 4CZKA 3T69A 3CFPA 3U9ZA 3RR8A 3A5OC 3VTIA 5JMVA 3KIOA 4JKEA 1DEJA 4ILJA 1S6PA 2D0PA 1VSIA 4CZIA 4UY8O 4W5TA 4FJHA 4IJNA 4DS4A 3N4PA 4JN4A 3F9KA 4V19S 4B9NA 1JLCA 3HRGA 4L3QA 5AQFA 3V9SA 4AQYK 2OZMA 4HUEA 2A41A 1NK5A 4HVJA 4H0PA 1VQ5N 4JI7K 4OKKA 3EE9A 1YI2N 3K59A 1SUQA 2XHBA 4DFMA 4AF1A 4DSJA 2YKNA 1QTMA 1RGIA 3THXB 2O4GA 1W0HA 5AQLA 1QZ6A 3QESA 1ZYQA 2HBMA 3CQYA 2YHAA 3AVIA 4CIGA 1HNZK 4BRDA 2O8EB 1CXUA 3H6EA 5M1PA 2Q0UA 4DB3A 4FWOA 2XO7A 4JKGA 2VG6A 3R9PA 2ZF5O 4YOXA 3JSMA 5AZJB 4E1JA 4BR9A 2VGNA 3HBTA 3MDQA 3QB0A 2WBNA 3T3FA 3O08A 2G8FA 4YHHK 1X9WA 4Z4EA 4HHTA 1WAJA 4OLAA 2QTDA 2EX3A 4ELUA 3PUFA 3G10A 3MEGA 1S9EA 2AJQA 4CJUA 5AQXA 4CERA 3ENBA 4KHSA 1OVYA 2DPNA 3WEEB 3EKUA 1LV5A 1J5EK 1HNXK 2DFEA 3TTDA 3OYAA 1S3XA 3D2FB 4DSLA 1VSKA 3LAKA 3I0SA 3VGKA 4DF4A 1WSJA 1O13A 4MO5A 4OPHA 2HHQA 1VRTA 1EWQA 4IJAA 4NYNA 3GOIA 4F3OA 2YNIA 1GLCG 1MWMA 3DLHA 3SPZA 2ZJQL 3VQBA 4BRPA 4CGIA 3QEPA 4B9SA 1U2VA 1Q9YA 3E9LA 3CCUN 1C6VA 3NGYA 1YIJN 5JICA 2OPPA 4YOWA 4B3OA 4B9VA 3OTOK 2OA8A 1RT5A 3C6TA 2HF4A 4B8AB 4QAGA 4CZFA 3DRPA 3VQ8A 3AGKA 1S1VA 3MXMA 4RW7A 4IEEA 2KKZA 3PIPL 3VEVA 2V7YA 3QLHA 1QE1A 3SQ0A 3ALYA 4F9OA 1W7AA 5I3UA 3VMFB 1IKYA 1A5VA 2F8SA 5AZJA 3NGZA 1HX1A 3LZIA 3CCLN 4C8LA 5BRHA 3I33A 4ID5A 3ZETA 3OYGA 4I9LA 2CGLA 3MMVA 3MCPA 3SCXA 4H0VB 3DLGA 1XUPO 4CEDA 1RDAA 2OTLN 2A42A 3K2PA 3CG7A 1IH7A 3MN6A 4GVEA 5CY4A 4JI5K 2P9PA 3NCIA 1MA9B 4FWQA 3LALA 4JNEA 4OKEA 3UKRA 3CJ1A 1D9FA 4DUYK 4M3RA 2QXFA 4U7BA 1NK7A 3ZT0A 5FPNA 3DMJA 4DTSA 3GL1A 5HP1A 1Q82O 2Z1GA 1UA1A 1P8ZA 5AQHA 1BU6O 1LOTB 3AVKA 1GLDG 2RF2A 3TPQA 4M63C 1GOBA 3VQPA 2W6LA 2F9WA 3RSEA 1YAGA 3ZX0A 4CF8A 1KFSA 3U3GA 2QKKA 4O8UA 3ZT4A 3QNOA 3VEWA 1NOYA 5FRMA 3PIOL 3C6HA 4XIUA 4G1QA 3PLAA 1Q7YO 1JLFA 1U47A 1JXEA 5AQQA 3LM9A 1QZ5A 4M3WA 4N41A 4JI2K 1RT2A 2XRIA 1M1KO 1QSSA 3HO1A 3W0LA 1X3NA 2IOCA 1HRHA 4DCHA 1QVFM 3ITHA 3AARA 2EWSA 1J53A 4CHZA 4DV4K 3I55N 2PBDA 4WFAL 5LJVA 1QQNA 4FVUA 5AFUH 2E2QA 4E1MA 2AA4A 4ISEA 3KWGA 4FK4A 5JVGL 1REVA 2F7TA 2HMIA 3DXMB 4GKJK 4FW2A 4EZ9A 4QS7A 3PX0A 3RWUA 4JRQA 4OLBA 3V9WA 2O8BB 3A5NC 5EXWA 4M3UA 3TU5A 4CK3A 2O8DA 3OYKA 5BR9A 4DG1A 1IJJA 5A2QO 1X3MA 1YUWA 1Z25A 3HOTA 5CZ1A 4JHDA 3L2RA 3E66A 1B9FA 4BE2A 1X9SA 2Q31A 3ZT3A 1MDUB 3K5OA 4KREA 4CJKA 3ZEUB 4DTMA 3M3ZA 3THXA 2QM1A 2X78A 4NXMK 4FWNA 3WXMB 1D4XA 2KHOA 3CF5L 1NK4A 1KAZA 1Z6RA 1OH5A 4DTUA 4MFBA 3TARA 1GOCA 4AHSA 1J9AA 4FPAA 3VESA 3OYCA 4C8KA 2VWJA 3SMPA 5C24A 3TSPA 3G71N 1JLBA 4I2QA 4FJIA 4LF7K 3JXUA 4H5RA 1N6QA 3AO1A 2DFFA 4ILHA 4E1NA 4CGFA 3OYFA 4BC2A 5B8HA 2X6SA 1P90A 3FR0A 1EKEA 3K9JA 1IKVA 1TL1A 3O1WA 3TR8A 2RE2A 3T1HK 3S9HA 5M1OA 1TK8A 2BDPA 1HPMA 5DK5A 3AVFA 4PWDA 1YVNA 4KO0A 1U6ZA 1M90O 1BO5O 1J54A 3VTHA 4FOEA 1QQCA 4DFJA 2UU9K 3CCMN 3C7NB 3WQTA 1Y97A 2Q1NA 3OYNA 3LWLA 3O9RA 3VEYA 5AQSA 4ILGB 3UKUB 2P9KB 2JWKA 4KTWA 1OH7A 3J7ZO 2BTFA 4JKCA 3A0IX 3HSTB 4DS5A 3EY1A 4FLUA 4PA1A 3QDKA 3CM6A 4CJ7A 3L2VA 2P9IB 2P51A 4HWIA 4IBNA 3CJCA 4KTQA 3C6AA 4RW8A 3PSFA 3TI0A 1RT4A 4FZYA 5HRSA 3L6QA 5J2PA 4E7KA 4IO8A 1LAWA 3EYZA 3SMSA 4J8FA 4JD2B 3HVRA 3G4SN 4EAHD 3AAPA 3QEVA 3EO3A 3S3NA 5I9EB 3HPHA 1KXPA 2E2OA 4CK1A 2FC0A 4E7HA 2O8CA 3KD5E 5FDLA 2Z1HA 1FXXA 3CCRN 2E5LK 3WXIA 4FWMA 1ZXOA 2NZTA 1C1BA 2X74A 3AO4A 3O9TA 5M1FA 5LMNK 4B1YB 3L3VA 5C12A 5FPDA 1NJXA 1CZBA 2HMPA 5HROA 1D5AA 1JLQA 1IV0A 2V51B 3IRXA 1VQMN 1VQ9N 1VSLA 4TSXA 4BRAA 1KLMA 4YDUC 4WQ4C 1E3MA 3E9OA 4NO7A 2P9KA 3RTVA 2XY5A 4Z4GA 4KFBA 1HLUA 4B08A 3CMEN 1G99A 1KSPA 1HPZA 3VPZA 4DF8A 1ASUA 3CJAA 5CE3A 4BDZA 3IKMA 1K6YA 2ETJA 3H1VX 1XQSC 3DXKB 3JS6A 3SI6A 3MAQA 2V7ZA 3VQQA 2Z1JA 3QMLA 4KBOA 2W40A 3RSEB 5DM7L 2O8BA 1ZC6A 1L3TA 4FK2A 4YFUA 2DTUA 4Y1CA 1X1PA 3THVA 3PX6A 1NGGA 3HT3A 2E8AA 3SQ1A 5AJ3K 4CD3A 1GLBG 1VQON 1GLFO 3VF6A 3SNNA 4CIEA 2OPQA 1UOCA 2P5GA 1FK9A 3L3UA 4BREA 4BE1A 1JCFA 2ITGA 5E26A 2P9NA 3T7ZA 3NF9A 1TKXA 2QXLA 4BR7A 3UIQA 4OGCA 5BPNA 3L2QA 4CBUA 1TUYA 1ZBFA 3BP8A 1NBWA 1WSFA 1QSYA 4YOTA 4BVOA 1VRUA 1X9JA 4LF4K 5C42A 2D0CA 5SZTA 4YY3K 4CECA 4H0YB 2UXCK 3DM2A 1WOQA 3ULEA 4IG3A 3HJFA 4YORA 1HKCA 2VG5A 3ZCMA 4CEAA 1U45A 3ZSVA 1OKJA 2Q97A 3J7YP 5ELZA 1BGXT 3IDHA 3O4WA 4DTRA 3LP1A 1NU0A 3IFRA 3DYAA 4FLXA 1NK9A 2W41A 3EZWA 3VGLA 1EETA 3RMAA 1DGKN 1BQNA 4CZJA 4DR5K 5TKYA 4LFAK 3I56N 3ID6A 5HRPA 4GV6A 2HHVA 2VWBA 4CEZA 4KI6A 3D45A 3VF2A 1NGIA 3CC4N 4PHTX 4FLZA 2VQFK 4B3TK 1KVCA 4RW6A 2J4RA 3ZSZA 2GUIA 3KK1A 2RHKA 2VG7A 5J1EA 1VQ8N 3CCJN 3F9MA 3NGIA 4RTFD 3CYMA 1HJRA 4DTPA 2HNYA 5AQJA 5KPZA 1SL0A 4H5WA 3KK7A 3ZEUA 4MLEA 5CHIA 1NGDA 2D0AA 3SZ2A 3D2EA 3HZ6A 3EZ5A 4KH4A 2FLOA 1VAZA 3TAPA 4BC3A 3C0BA 2E2PA 2XY8A 3SJJA 4FVMA 1BCMA 4JI6K 4LSNA 5ADXA 4HCBA 3G25A 1T3VA 1EXQA 4AM7A 1XNRK 4BG9A 1YT3A 2I7NA 4FWKA 1BIZA 2NLXA 2HOEA 3CQ8A 3SJHA 1LAVA 1HMVA 3NH1A 1VQPN 1TK0A 4B1XB 4IZ9A 1HQEA 4DV6K 4H8KA 2D0BA 2YHBA 1HJOA 4JV5K 4GVMA 2WUSA 3GG4A 4YDUA 1MU2A 4BRQA 4B3SK 4DQSA 1YF5L 4CW7B 5F0XA 1RTDA 4QCLA 3WUHA 1FKPA 5JLFA 4B9QA 5FPMA 3L2WA 3BZKA 3CCSN 4CZLA 2O8EA 1OH8A 1WBDA 3G6EN 1TAQA 3SV4A 4CFCA 2JWLA 2UUAK 1KAYA 2A5XA 4FW1A 2Z1IA 3AY9A 3DJCA 4PKGA 1Z05A 4JKAA 4RW4A 2ZE2A 1B92A 4GNIA 4EZ6A 3DXMA 3ZYYX 4JLHA 3PY8A 3O3GA 1VSMA 4CEEA 4IOCL 2F96A 4OKJA 3RMDA 1BI4B 4KTZA 4DWIA 4MDAA 2ITMA 4F8RA 3HP9A 4O5FA 3P31A 4WQ5A 4MLHA 1T8EA 1NK6A 1ATRA 3TAEA 3QNNA 4GW6A 4W5OA 4DU3A 3OYHA 4FJMA 5JVHL 3NE6A 1NMNA 1YHQN 3VF4A 5IWAK 3WXLA 2BANA 3ENHA 3EEQA 5GAEP 3V9XA 5C10A 2QA4N 3AVCA 2O8CB 4FJ5A 3LP3A 2D4WA 3D2EB 3VQEA 1TV6A 4GY2B 1C0UA 5DMRA 4CVNE 3HPOA 4KH5A 2F4VK 4KI4A 1C1AA 3AVJA 1TK5A 3T1YK 4CGGA 4H4OA 3WEEA 3ZETB 3M5RA 5KQ8A 3VEOA 2GUPA 3H08A 5AQMA 4ICLA 4JKFA 1ASWA 3THWB 3OS1A 2NNWA 5AQYA 1N5YA 4OPKA 1WSHA 4M42A 4BDPA 5AQUA 3NVKA 2WOMA 1NLVA 1HR0K 3FFIA 4QOZB 1H1VA 3CERA 3SLCA 1RNHA 5T7BA 1RFQA 1WN7A 4RWTA 2OPSA 1HNIA 1NMDA 3OYBA 5GIPA 2G8KA 1SL1A 2UUCK 1DKGD 3QBWA 3C7NA 5BRFA 3VEZA 2HNDA 3O3HA 3ATVA 1N8RO 4BRGA 2KFNA 4CJQA 3V1OA 4WFBL 1YJWN 2NRVA 4IOAL 4BDYA 1ZBSA 4F2SA 2KZMA 2E4LA 3J81O 3OYMA 1NJZA 3O8MA 3W3DA 4GV9A 3AA4A 1ASVA 3SUOA 4W5QA 3KLIA 4FPBA 3DRRA 1RDWX 5HOOA 1MWKA 3CJBA 4CJPA 1U4BA 3V6DA 1ESVA 2VYPA 2KLAA 4XEIA 3L4QA 3K5NA 2IVNA 2Q2RA 4Z4CA 2ASPA 3A5LC 1BWFO 1RDCA 1ZBIA 4B9TA 4ZTFA 1NNEA 2QI2A 1CLQA 1T6DA 3BEXA 4CHYA 2E6MA 3ZT1A 2GWJA 2IS3A 1HNWK 2HF3A 2W42A 1WLJA 2WFBA 4WYBA 3AVAA 3ULEB 3C6UA 3IMXA 2YHYA 4DSIA 2KTQA 2QWNA 5EVZA 3CFRA 3FLCO 3K5LA 3SK3A 4JRPA 1KQSM 4KH6A 3K57A 4L8RB 3QFPA 3ZSYA 4BC5A 4JHDB 4CJFA 3VA3A 1TVRA 1R0AA 1Q81O 2Y1IA 3CCVN 4KHNA 5JS1A 5KTQA 4C1NK 3T19A 2GEMA 5AQIA 4CEQA 3GBTA 4B8CA 4KPYA 2PYLA 4M3ZA 3VQDA 3OJSA 1NGBA 1RTHA 1WSIA 2BUPA 4C8NA 3EN9A 3MN5A 4H5TA 3U6FA 4BR5A 1N33K 2CH6A 3FE1A 4O4GA 4JK9A 4FWSA 3DLBA 1K9MO 3BF1A 4A5AA 4FJNA 4PQUA 1YVUA 5AFUA 4G9ZA 3TANA 2ZJPL 1NGFA 1RT7A 3BY5A 4RW9A 2RKIA 4BG8A 4BRLA 1BUPA 2P9SA 1S1WA 1YITN 4U67L 3ZLJA 2ATQA 4CJEA 3J7AP 1BISA 4K0KK 4DLGA 3DXKA 4FM0A 2QEXN 3EE8A 3RRHA 1VQ4N 1VQLN 5FRNA 3DLLL 1RDDA 1LWCA 1YTAA 1XNQK 4CZEA 4X66K 2PYJA 3KKSA 4NCAA 2HHSA 3NFAA 1NK0A 3MX2A 3K9KA 3S3OA 5KPRA 1VSEA 2FXUA 3KWIA 3MCAB 3O3FA 4E3SA 4N56A 5AQZA 3MWTA 3SV3A 1TKTA 3NF8A 4CF2A 3SYZA 4EP4A 1ZBLA 3WNGA 1L3VA 5KRSA 3K0SA 4H0XB 3EKSA 1SKRA 2YJEA 1NG9A 5KGXA 3ZSOA 3R8EA 2IIRA 1EX4A 4DU1A 5C25A 2VCPA 3AV9A 4PL7A 4HUFA 3ZT2A 4LSLA 4DSKA 2HHXA 5HL7L 4M45A 2G8IA 4DR2K 1ZBHA 3CCQN 4CFDA 2FF6A 4LC9B 3LDOA 3JAMO 1S9GA 3TAQA 4MO4A 3KLGA 4IOXA 3MXIA 5AQNA 2P9IA 5C2FA 1XHZA 2V52B 4WCEL 3AAQA 4I2PA 3HI0A 4DR1K 3UKRB 4AHRA 3O9SA 4R5PA 3D7EO 5F1XA 1KRPA 1NK8A 2YNFA 1BG3A 4NB4A 3CM5A 3B6PA 4XH5A 2QWPA 4A2BA 3BZCA 2OPRA 5GADP 4HTLA 4DTNA 1YJ9N 1GLEG 4AILC 3D6RA 3NF6A 3G0ZA 4H0TB 3THWA 2HSTA 1JLEA 4BRFA 3LPUA 3QIPA 3S41A 4BRMA 3I8BA 3HSCA 4M3YA 2GWKA 4FZXC 3L2UA 4JYAK 1RBVA 5GAGP 4ISFA 1S1UA 4A62A 4IXCA 3MWPA 3PO5A 1IBMK 3DLRA 4DTOA 3V1QA 4DV0K 1GLAG 4CJLA 4JKDA 3VQ9A 3QIOA 4BR4A 2IVOA 1K73O 4Z4IA 3CFOA 4FL9A 1JLGA 1R59O 1FW6A 4CIFA 4Y1DA 3HOSA 1EP4A 1ITGA 3ZX3A 3VETA 3AVGA 4RG8A 2A1SA 3VENA 5GAHP 4PL8A 3C65A 3VQ7A 4DKWA 4CJWA 4K43A 1JLAA 2A1RA 3HXMA 4CJTA 4CF1A 2ZJRL 3HM8A 4JKGB 2FSJA 3WNEA 5KPTA 4KKOA 4QS8A 2ZQBA 1EWRA 3FZHA 1K8KA 2BH1A 3LP2A 1U49A 1Q9XA 2D1KA 4BQLA 1U2VB 4BRCA 1C1CA 4DV7K 4M41A 3UE5A 1X9MA 4IFYA 3QFUA 3DLKA 4DV1K 5AQRA 5KRTA 3WNHA 4CZHA 4CK2A 3O6WA 4H03B 2BGGA 5M1QA 3DLEA 3O1BA 3BGRA 1IKXA 4C8MA 1Q18A 3SAHA 1VQ6N 3AA3A 3VQ4A 4B9MA 4DTXA 1SKWA 5HRRA 1BI4A 3LDQA 3SPYA 2CH5A 1J5OA 4OPAA 4CJ4A 1DTTA 4PKIA 3TSQA 4CGJA 2D5RA 3CPWM 4CESA 1HKGA 4AHTA 4O5BA 1IG9A 3J8AA 3TTFA 3M8QA 4O0IA 4Q5VA 4B1UB 4BR2A 4CHQA 3BF3A 1TAUA 4KHWA 4BWMA 4LH4A 5TKWA 1VSDA 1KLNA 3O80A 3A5MC 4E89A 3RRGA 4DQPA 5EX5A 4AHUA 1F21A 4XH4A 3MN9A 2HHWA 3MXJA 2G8VA 3DOKA 3P4IA 4JEPA 2H3GX 4FO0A 3KK2A 3SBTA 4LF6K 1RT6A 3HPGA 2IAJA 4H0OA 2HB5A 3ZX2A 5EOYA 1WBBA 4CBXA 3QINA 3OS2A 4FOIA 1DT9A 4PUOA 4AM6A 4BE0A 3WQUA 1ATSA 3R6MA 1QHTA 2ASMA 3FGUA 3F73A 4NCBA 2P5OA 3CD6N 4CBWA 3TAFA 2A3ZA 3SUPA 1RCHA 1IG8A 5J2NA 4J2AA 4XH1A 1DLOA 3SQ2A 4X64K 4M7YA 1RILA 4IKFA 4JI1K 1SL2A 3N4QA 3FZLA 3M6GA 3UB5A 3CMAN 3OYEA 4CE9A 2YKMA 4O8KA 2FBTA 4FLYA 2HVIA 1QSLA 3B8AX 2YCHA 3IUCA 1CZAN 1XC3A 3TAGA 1WSGA 5CR4A 5BPLA 3CXCM 2QWQA 2F8TA 4CF9A 1ATNA 4H5NA 3GE1A 1WB9A 4BC4A 4J2DA 1HYVA 2NRWA 3HL8A 1S22A 4E7IA 4LF5K 1DTQA 3QERA 3HTVA 3O5BA 4I7FA 3WT0A 2HW3A 2G8WA 4CZGA 2OANA 1S5JA 4DQIA 3ENOA 2KFZA 4JAXA 4CZMA 4K8XA 3ULDA 1SS6A 2WTUA 1UWBA 2XY6A 4I9QA 2UXDK 2D0OA 5EY4A 4HTUA 3H46O 4Q0BA 2ZM6K 4FJGA 4DQ8A 5J2QA 3MEEA 1QQMA 2PZSA 4BGBA 1FKOA 3MEDA 4C8OA 4FZZA 4JD2A 4PKHA 1FJGK 1SZ2A 1I3AA 3OBYA 1LW0A 2VWKA 3OYDA 2VQEK 5E84A 5H1SQ 1TKDA 1XI1A 2FBYA 1T7PA 1JJ2M 3QEIA 1G15A 1BHLA 1GLJO 4DR7K 4I6MA 2EHGA 3DAWA 1BIUA 2FBVA 1A5WA 3M1FA 5E41A 4YOVA 3AA2A 3U8XA 5FLXO 5BRDA 4JI3K 4OGEA 4CEBA 4X62K 5C2DA 1XHXA 3NBPA 1J6ZA 2OTJN 4WFNL 3J80O 4DR4K 2FSNA 3AVHA 4EHUA 4LY7A 2NRZA 4WQ4A 4E19A 3AVNA 4CJVA 2GELA 4WF9L 2HHTA 1C0TA 3VERA 4IFVA 2IGIA 4FLTA 3AVLA 2DY4A 2XY7A 4A2AA 3H1QA 3TTCA 1RTJA 1QQOA 4KAZA 1C0FA 1U04A 1LW2A 2OZSA 1IBKK 2QWRA 2JLEA 3LP0A 2RPIA 3KJVA 2IVPA 4B1VA 3CETA 4NXNK 4WE1A 1CXQA 1L3UA 3OHRA 3VOVA 5K14A 4FJXA 3KZBA 2P9UB 3MX5A 3U4LA 4CFAA 3E9PA 4KB0A 2NRHA 1K8AO 1GOAA 1N34K 4FWLA 4NYFA 3VQ6A 3S3MA 1C0MA 2A40A 4FLVA 4W5RA 2B5JA 3ID8A 4Z0UA 4FJ9A 4BQZA 1VQNN 1RBTA 3LDLA 2QWLA 3O9QA 3A2FA 3V1RA 4Z4HA 4BRNA 3BDPA 3T1AA 4CD1A 1HYSA 1SQKA 3LWMA 4B1ZA 1S6QA 2E1ZA 2YI1A 4HCCA 1YJNN 1WNSA 1Q8IA 3I8DA 4CGDA 1Z26A 4ELTA 4IWVA 3NDKA 4K25A 1EO1A 4FWPA 1SV5A 2B4JA 3D0PA 4OX9K 5AZIB 3TSUA 4CGHA 2BE2A 3U9DA 2PFUA 4O55A 5KQDA 1L3SA 1E4FT 4A57A 4AH9A 1KCFA 2YNHA 5M1NA 2X6NA 1S1TA 2HBKA 2Q3SA 3FZKA 3HYFA 3AA5X 4IG0A 3OYIA 2P9LB 1UA0A 3B6OA 3AGRA 3THYB 2ZWHA 5LY3A 5I42A 4FCYA 1Y64A 1S72N 2YX6A 4KHQA 1ILYA 3SAGA 1T44A 3LDPA 1T03A 3VQ5A 3O4QA 1YXQA 4CFBA 4A5BA 1D9DA 2HBJA 3H45C 3F2KA 4IFEA 3LPTA 2F9TA 3LZJA 3RMCA 1T05A 3M8RA 5ADXH 3OBWA 4UQGA 3HVTA 1SKSA 4IDKA 1I94K 1LWEA 3NAEA 1TL3A 3DOLA 4ZTJA 1VHXA 3NF7A 3QO9A 3HM9A 3V9ZA 3CPEA 3LDSA 1TKZA 5M1KA 4E7JA 1VQ7N 1HQUA 4B9LA 3CI5A 1LCUA 4DLEA 4KHUA 1TYQB 2HNZA 1JKHA 3QBXA 4FXDA 1HNVA 1HYZA 5AQTA 1K8KB 3VEXA 2E6LA 3M8PA 5JLHA 2I5JA 2YNGA 3GDQA 3F5TA 3C94A 4I6MB 1XMQK 2HHHK 3KD1E 2P1JA 5HLFA 3RVCA 4KB1A 4FWRA 2B6AA 1TGOA 4Z94A 2NUBA 4E0DA 3ZSQA 1NOZA 1BDGA 2UXBK 2GX9A 3LANA 1WUAA 4B3MK 3HK2A 4B1WB 4HUGA 4RCHA 2R7YA 4EP5A 4LFCK 5BREA 2HBLA 3VQCA 3AO3A 4N76A 4JK7A 2O8DB 3AVBA 4YNQA 4EFHA 3KHYA 1RBSA 2QKBA 1N36K 2NRTA 3O4NA 3HP6A 4DQRA 4KHYA 5KGWA 3NHGA 2O8FB 1BCOA 1HKBA 4CJSA 1SAZA 2I7PA 4B9UA 4CHOA 1C0GA 2P9PB 3KKRA 4GMJB 2A6AA 4M7XA 4BRIA 2GV9A 1QHAA 3FZMA 1V4SA 1W9HA 1KC8O 1JL2A 1NKBA 3V4IA 3TWHA 4B3RK 1JCGA 4MDBA 1NGEA 4LH5A 1V4TA 4W5NA 4NCGA 5DM6L 4K8ZA 2G8UA 1GLLO 5GIOA 4KV8A 4LF8K 2IC3A 5CYMA 1BQMA 1TUUA 4BRHA 4DUZK 4AHVA 3L0QA 1BOTO 1KAXA 1UAXA 1VQKN 3AO2A 5CZ2A 1RT3A 4X65K 3THYA 1RDUA 4BR0A 1A5XA 3KLFA 4BWJA 3OY9A 3FFKB 4DFKA 4CJRA 3PO4A 3ZSXA 4H4MA 4N47A 3KLHA 3L4IA 1NGCA 1NJIO 5AQKA 4FK0A 2LSNA 1VK0A 3VA0A 4OJRA 4KRFA 4LF9K 3DRSA 3EL2A 3ZSRA 4DQQA 4BROA 3OA9A 1IBLK 3Q7CA 4GKKK 1NGHA 3O9UA 1N32K 2G8HA 1XWLA 2OYQA 4FJJA 5HRNA 3M8SA 2YHWA 4FJ7A 5GINA 4BACA 4CHNA 3P83D 2CGJA 2OCEA 3K58A 4ID1A 3D2FA 1B9DA 4NLCA 2Y1JA 4ISGA 1EQYA 5EU7A 3VGMA 1KFDA 1NGAA 2O4IA 1NJWA 1JCEA 3NH2A 3KTQA 3OJUA 2WC9A 4JI0K 4C1NI 3P39A 4KHPK 4OPJA 5AQVA 3LL3A 3QETA 4DV2K 4JK8A 3C95A 3PX4A 3E01A 3AO5A 2KZZA 3NVMA 1OH6A 1KVAA 4PY5A 1IO2A 1RDBA 4OO1J 1NKEA 1W97L 3P5JA 3CJ9A 3MK6A 4CI6A 1ZBUA 3JYTA 4QS9A 3TAMA 2O8FA 2ZD1A 3ISNC 4CJ5A 2FBXA 4FM1A 5KI6A 1WSEA 2VGMA 4DU4A 3RMBA 4JI4K 4WQ5C 5D3GA 5J2MA 3AVMA 4CCHA 4C23A 4LD0A 4J2BA 1NGJA 2HVHA 4CEOA 4JI8K 3H3NO 3Q7BA 4JKBA 5FPEA 5LMUK 4DV5K 3V81A 2WONA 2JGUA 4BGAA 2IDOA 3DI6A 4K42A 3FZFA 1L5UA 3LAMA 3OYJA 1XMOK 4O0JA 1QVGM 1HUXA 2QWMA 1VSHA 3SUNA 5AQOA 1D8YA 4F2RA 1JXBA 3ASMA 4GV3A 4F4KA 3TABA 3VQAA 4BRKA 1RBRA 3LM2A 4J2EA 3IG1A 1TYQA 2ZGZA 3QEXA 4N5SA 3CIPA 1E4GT 1NKCA 2FSKA 4R79A 3BUZB 3LDNA 1KD1O 3SBGA 5BN8A 5IT9O 3U3YA 2UYTA 2ZGYA 1VSJA 2NRRA 2W6KA 2GTDA 3E1YA 5F2RA 4FYDA 1KTQA 2NRXA 3MECA 1CZ9A 3ZSWA 3CQXA 4ELVA 4E7LA 4IO9L 1IKWA 2P9LA 3PSIA 4JS5A 2E2NA 1XC9A 2DFHA 4IDHA 4FM2A 4DTJA 3P1GA 3KK3A 2KW4A 3WXJA 3NMUA 4BVPA 5AQGA 5BPMA 3V9UA 4LFBK 2E88A 4YOUA 1WAFA 5BR8K 5C0YA 5MLCQ 2PAVA 3IS9A 3OS0A 4MQ3A 1BA0A 2YHXA 4DV3K 4DFPA 2QK9A 5BN9A 2ASOA 4H5VA 1RTIA 5CYQA 2P9SB 5SWMA 3OVNA 3L8BA 2P9UA 4ZHRA 1KVBA 1O1WA 3CC7N 3RR7A 4FJKA 1S1XA 2CGKA 3H3OB 4JKHA 1RBUA 3UKUA 2KQ2A 2E1YA 5JS2A 3PV8A 5AZIA 4FLWA 4NLBA 3CJ7A 1VSFA 1NM1A 1NWKA 3CC2N 4FSVA 5HBMA 4DSFA 5LL6Z 4O44A 4Z4FA 4M3XA 3QICA 4K41A 4FJLA 2QW9A 3A8YA 3CCEN 3SQ4A 4EHTA 4CJ3A 2HHUA 2FF3B 1BL3A 4FJ8A 4F3TA 4A61A 5FROA 4JS4A 4CF0A 5LJWA 2QWOA 5AR0A 1W2BM 4DR3K 1BA1A 2E20A 1LWFA 2AP1A 1Q86O 3P38A 1I39A 4DHYA 3ATUA 2YJFA 1QS4A 4OVLA 2P9NB 3R3LA 2Q0RA 3R1XA 3DWLA 3OYLA 5C15A 4EIAA 3K5MA 1JL1A 1T6CA 3MN7A 2RN2A 4DR6K 3NH0A 3QEWA 1OVQA 5AQPA 3CHWA 4CHPA 3WXKA 5AQWA 3KVGA 3OW2M 3KLEA 4BY9C 1YTUA 2Q36A 4DMNA 3SAFA 4IEIA 4DSEA 1U48A 4M3TA 2PY5A 3VN5A 3SUQA 3IAYA 3WNFA 4YOYA 2GBZA 3I0RA 4Y0WA 4A59A 4CEFA 1NJYA 2UUBK
chains in the Genus database with same CATH topology
1RT1A 4AHCA 1SKRA 4CGHA 3SI6A 2BE2A 2YV0X 3MAQA 3CFPA 4O55A 3RR8A 3VQQA 2Z1JA 1L3SA 3KIOA 4AH9A 1KCFA 5KGXA 2YNHA 3ZSOA 2X6NA 1S1TA 1S6PA 1VSIA 1L3TA 1EX4A 4FK2A 4YFUA 2Q3SA 4DU1A 3HYFA 2DTUA 5C25A 4W5TA 3AV9A 3AA5X 4Y1CA 4HUFA 3ZT2A 4DS4A 1X1PA 4IG0A 4FJHA 3THVA 3OYIA 3F9KA 4LSLA 3PX6A 4B9NA 4DSKA 1UA0A 2HHXA 3B6OA 1JLCA 3V9SA 3HT3A 3SQ1A 2OZMA 4HUEA 1NK5A 4M45A 5I42A 2G8IA 4HVJA 1ZBHA 4CFDA 4OKKA 4FCYA 4KHQA 3K59A 1SUQA 2XHBA 1S9GA 1T03A 3TAQA 4DFMA 3VQ5A 3O4QA 4CFBA 3SNNA 4DSJA 4CIEA 2YKNA 1QTMA 1D9DA 3KLGA 3MXIA 2OPQA 1UOCA 2P5GA 1FK9A 3L3UA 1XHZA 2O4GA 1W0HA 4BE1A 3LPTA 3LZJA 2ITGA 3RMCA 1T05A 4I2PA 3M8RA 3QESA 4AHRA 1ZYQA 4UQGA 4R5PA 3NF9A 1TKXA 3HVTA 1NJYA 3UIQA 2YHAA 1SKSA 4OGCA 4IDKA 3L2QA 1KRPA 1LWEA 3NAEA 3AVIA 1TL3A 4CIGA 3DOLA 1NK8A 2YNFA 1CXUA 1ZBFA 3CM5A 3B6PA 4ZTJA 3NF7A 2XO7A 1WSFA 1QSYA 2OPRA 2VG6A 3QO9A 3HM9A 1VRUA 3V9ZA 4DTNA 5C42A 3LDSA 4AILC 2D0CA 1TKZA 3JSMA 4E7JA 5SZTA 1HQUA 3NF6A 4CECA 4B9LA 3G0ZA 3DM2A 4DLEA 1JLEA 3T3FA 4KHUA 3LPUA 3QIPA 4IG3A 3HJFA 2HNZA 2G8FA 1JKHA 4FXDA 4Z4EA 1X9WA 2VG5A 3ZCMA 4CEAA 4HHTA 1U45A 3ZSVA 1WAJA 1HNVA 1HYZA 4OLAA 2E6LA 3M8PA 2EX3A 4M3YA 2I5JA 2YNGA 4ELUA 4FZXC 3PUFA 3L2UA 3C94A 3G10A 3MEGA 1S9EA 1BGXT 1RBVA 3KD1E 2AJQA 2P1JA 4CJUA 1S1UA 4DTRA 5HLFA 3LP1A 4KB1A 4CERA 3DYAA 4FLXA 1NK9A 2B6AA 1TGOA 3PO5A 4KHSA 2NUBA 3DLRA 1LV5A 3ZSQA 4E0DA 1EETA 4DTOA 1NOZA 3RMAA 1BQNA 3V1QA 2DFEA 3OYAA 4CJLA 3LANA 3VQ9A 4DSLA 4HUGA 3HK2A 3QIOA 1VSKA 3LAKA 3I0SA 4EP5A 5HRPA 2R7YA 4DF4A 2HHVA 1WSJA 4N76A 3VQCA 3AO3A 4CEZA 3CFOA 3D45A 4FLZA 4KI6A 3AVBA 4YNQA 4Z4IA 1VRTA 2HHQA 4NYNA 1RBSA 1JLGA 1KVCA 2QKBA 4RW6A 4F3OA 3ZSZA 3O4NA 2YNIA 3HP6A 4DQRA 2GUIA 3KK1A 4CIFA 3DLHA 4KHYA 5KGWA 3NHGA 2VG7A 5J1EA 4Y1DA 3SPZA 1BCOA 1EP4A 3VQBA 1ITGA 4CGIA 4CJSA 3AVGA 4RG8A 3QEPA 3NGIA 2A1SA 1Q9YA 4B9SA 3CYMA 3VQ7A 1HJRA 4CHOA 4B9UA 4CJWA 4DTPA 2HNYA 1C6VA 1JLAA 3NGYA 1SL0A 2A1RA 3KKRA 3HXMA 2OPPA 4GMJB 4B3OA 4CJTA 2D0AA 3SZ2A 2GV9A 4B9VA 2OA8A 1RT5A 3C6TA 3EZ5A 4B8AB 4QAGA 4CF1A 3DRPA 3TAPA 3VQ8A 1W9HA 3WNEA 1S1VA 3MXMA 1JL2A 4KKOA 1NKBA 3V4IA 4RW7A 2XY8A 2ZQBA 3TWHA 3SJJA 3LP2A 4FVMA 1BCMA 1U49A 1Q9XA 4LSNA 4HCBA 1C1CA 1EXQA 4LH5A 4W5NA 3QLHA 4M41A 4NCGA 4IFYA 1X9MA 1QE1A 3SQ0A 3DLKA 1YT3A 3ALYA 4K8ZA 1BIZA 2G8UA 5I3UA 5KRTA 1IKYA 4KV8A 3WNHA 1A5VA 3CQ8A 2F8SA 1LAVA 2IC3A 1HMVA 5CYMA 1BQMA 4CK2A 3NGZA 3NH1A 1TK0A 1HQEA 3LZIA 4AHVA 4C8LA 4H8KA 2D0BA 2YHBA 4ID5A 2BGGA 3OYGA 1UAXA 3DLEA 4I9LA 4GVMA 3AO2A 1MU2A 5CZ2A 3SCXA 3BGRA 1RT3A 1IKXA 4C8MA 4DQSA 1A5XA 3KLFA 3DLGA 4BWJA 1RTDA 4QCLA 3AA3A 3VQ4A 3OY9A 4B9MA 4DFKA 4DTXA 4CEDA 1FKPA 1RDAA 1SKWA 4CJRA 3K2PA 3CG7A 3L2WA 1IH7A 5HRRA 3ZSXA 3PO4A 4H4MA 5CY4A 4N47A 1BI4A 3KLHA 3NCIA 3SPYA 2LSNA 1VK0A 3VA0A 4OJRA 4FK0A 4KRFA 3DRSA 3LALA 1J5OA 4CJ4A 1DTTA 3ZSRA 1TAQA 3SV4A 4DQQA 4CGJA 2D5RA 4OKEA 4CFCA 4CESA 4AHTA 1D9FA 4O5BA 2G8HA 4M3RA 2QXFA 1XWLA 1NK7A 1IG9A 2OYQA 3M8QA 4FJJA 3ZT0A 4FW1A 4O0IA 2Z1IA 4Q5VA 5HRNA 3M8SA 4CHQA 3DMJA 4RW4A 4FJ7A 4BACA 4DTSA 4CHNA 2ZE2A 4BWMA 4LH4A 5HP1A 4KHWA 3P83D 1TAUA 2Z1GA 1B92A 4EZ6A 1UA1A 1VSDA 1KLNA 4JLHA 3PY8A 3K58A 4ID1A 3AVKA 4E89A 3O3GA 2RF2A 1B9DA 3RRGA 1VSMA 4CEEA 1GOBA 2Y1JA 4DQPA 3VQPA 2F96A 4OKJA 1F21A 4AHUA 3RMDA 1BI4B 4CF8A 1KFSA 2HHWA 3U3GA 3MXJA 4KTZA 2G8VA 5EU7A 2QKKA 3ZT4A 3DOKA 4DWIA 3QNOA 3KK2A 4F8RA 1NOYA 3HP9A 1KFDA 5FRMA 2O4IA 1NJWA 3NH2A 1RT6A 3HPGA 3KTQA 3OJUA 2IAJA 1T8EA 4XIUA 1NK6A 4G1QA 2HB5A 1JLFA 3TAEA 3QNNA 1U47A 1JXEA 4GW6A 4W5OA 4DU3A 3OYHA 4M3WA 4N41A 1RT2A 2XRIA 3QINA 1QSSA 3NE6A 3OS2A 4FJMA 3HO1A 4OPJA 3QETA 2IOCA 1HRHA 4PUOA 4BE0A 3ITHA 2BANA 1QHTA 3C95A 3PX4A 1J53A 3E01A 4CHZA 3F73A 3V9XA 4NCBA 3AVCA 3AO5A 2KZZA 2P5OA 4FJ5A 3LP3A 3VQEA 1TV6A 1KVAA 1C0UA 5DMRA 3TAFA 3HPOA 4PY5A 1IO2A 1RDBA 3SUPA 1NKEA 1RCHA 5J2NA 4KI4A 1C1AA 3P5JA 4J2AA 3AVJA 1DLOA 4E1MA 1TK5A 3SQ2A 4CGGA 1RILA 4H4OA 4FK4A 1ZBUA 1REVA 3JYTA 2HMIA 3TAMA 4IKFA 4FW2A 4EZ9A 3H08A 2ZD1A 3ISNC 1SL2A 4CJ5A 2FBXA 3PX0A 3RWUA 4JRQA 4ICLA 5KI6A 4FM1A 4OLBA 1WSEA 1ASWA 3V9WA 4DU4A 3RMBA 3OYEA 4M3UA 4CE9A 2YKMA 4CK3A 3OS1A 5D3GA 2FBTA 3OYKA 4DG1A 4FLYA 5J2MA 4OPKA 1N5YA 3AVMA 4CCHA 2HVIA 1WSHA 1QSLA 4BDPA 4M42A 4LD0A 2WOMA 3TAGA 1WSGA 4J2BA 1Z25A 3FFIA 4QOZB 2HVHA 4CEOA 5CZ1A 1RNHA 5T7BA 3L2RA 2F8TA 3V81A 4CF9A 1WN7A 2WONA 2JGUA 2OPSA 4J2DA 1B9FA 1HYVA 4BE2A 1HNIA 1X9SA 2IDOA 3DI6A 3OYBA 3ZT3A 2G8KA 3HL8A 1SL1A 1L5UA 3K5OA 4KREA 3LAMA 3OYJA 4CJKA 4O0JA 4E7IA 4DTMA 3SUNA 2HNDA 1DTQA 1VSHA 1D8YA 2X78A 1JXBA 3ASMA 3O3HA 3QERA 4F2RA 4F4KA 4I7FA 3TABA 2HW3A 3VQAA 1NK4A 1RBRA 2G8WA 2KFNA 4CJQA 3V1OA 4J2EA 3IG1A 1S5JA 4DTUA 4MFBA 4DQIA 2KFZA 3QEXA 4K8XA 4N5SA 3TARA 1GOCA 4AHSA 3ULDA 4BDYA 4F2SA 2KZMA 1J9AA 1UWBA 2E4LA 2XY6A 1NKCA 3OYMA 4I9QA 1NJZA 4HTUA 3OYCA 4C8KA 2VWJA 4Q0BA 4FJGA 3AA4A 1ASVA 5C24A 3U3YA 3SUOA 4W5QA 3KLIA 1JLBA 3DRRA 4I2QA 5J2QA 4FJIA 1N6QA 1VSJA 3AO1A 2DFFA 3MEEA 4E1NA 4CJPA 2PZSA 4CGFA 1U4BA 1FKOA 3MEDA 3OYFA 3V6DA 4C8OA 4FZZA 4FYDA 1KTQA 2X6SA 3MECA 1CZ9A 1I3AA 1LW0A 3ZSWA 1EKEA 3K5NA 4ELVA 2VWKA 3OYDA 4E7LA 1IKWA 4Z4CA 4JS5A 1IKVA 1TL1A 3TR8A 1XC9A 1TKDA 2DFHA 3S9HA 4FM2A 4DTJA 1RDCA 3P1GA 1XI1A 2FBYA 2KW4A 3KK3A 1T7PA 4B9TA 1ZBIA 3QEIA 1G15A 4ZTFA 1TK8A 2BDPA 1BHLA 1CLQA 2EHGA 5DK5A 1BIUA 4CHYA 2E6MA 2FBVA 3V9UA 3AVFA 1WAFA 1A5WA 3ZT1A 4PWDA 2IS3A 5E41A 2W42A 4KO0A 1WLJA 3IS9A 3AA2A 3OS0A 1J54A 3AVAA 4MQ3A 3C6UA 1QQCA 4DSIA 4DFJA 4DFPA 2KTQA 3CFRA 4OGEA 4CEBA 2QK9A 3OYNA 1Y97A 1XHXA 3LWLA 1RTIA 3NBPA 5CYQA 5SWMA 3K5LA 4JRPA 3OVNA 3L8BA 4ZHRA 3K57A 1KVBA 4L8RB 1O1WA 3AVHA 3RR7A 4KTWA 3ZSYA 4LY7A 4FJKA 4CJFA 3VA3A 1S1XA 1TVRA 4E19A 1R0AA 2Y1IA 3AVNA 4KHNA 5JS1A 4CJVA 5KTQA 1RBUA 3HSTB 3T19A 4DS5A 3EY1A 2HHTA 1C0TA 2KQ2A 5JS2A 4IFVA 4CEQA 2IGIA 4FLUA 3PV8A 4FLWA 4FLTA 3AVLA 4PA1A 2XY7A 4B8CA 4KPYA 2DY4A 2PYLA 4M3ZA 3VQDA 3CM6A 3OJSA 1RTHA 1VSFA 1RTJA 1WSIA 3L2VA 2P51A 4C8NA 4IBNA 5HBMA 4KAZA 4KTQA 1U04A 3TI0A 4RW8A 3U6FA 1RT4A 4FZYA 1LW2A 4O4GA 4DSFA 3DLBA 2OZSA 5HRSA 4O44A 5J2PA 4E7KA 4Z4FA 2JLEA 3LP0A 1LAWA 2RPIA 4M3XA 3EYZA 3KJVA 4FJLA 4FJNA 4PQUA 1YVUA 3SQ4A 4WE1A 1CXQA 1L3UA 4CJ3A 3TANA 2HHUA 1RT7A 4RW9A 5K14A 1BL3A 3HVRA 2RKIA 4FJXA 4FJ8A 4F3TA 5FROA 3QEVA 4JS4A 3S3NA 4CF0A 3HPHA 4CFAA 4CK1A 1S1WA 4KB0A 2FC0A 4E7HA 1LWFA 3KD5E 2ATQA 1GOAA 5FDLA 1I39A 2Z1HA 1FXXA 4NYFA 3VQ6A 1QS4A 4CJEA 3S3MA 1BISA 4DLGA 1C1BA 4OVLA 4FM0A 2X74A 3AO4A 1C0MA 3RRHA 5FRNA 1RDDA 3OYLA 3L3VA 1LWCA 4W5RA 4FLVA 1NJXA 1CZBA 2B5JA 1YTAA 4Z0UA 5HROA 4FJ9A 3K5MA 2PYJA 1D5AA 1JL1A 1JLQA 3KKSA 4NCAA 1RBTA 3IRXA 2RN2A 2HHSA 3NH0A 3QEWA 3A2FA 1VSLA 3NFAA 3V1RA 4Z4HA 4TSXA 1NK0A 3BDPA 3S3OA 3T1AA 1VSEA 1KLMA 4CHPA 1HYSA 3LWMA 1S6QA 3O3FA 3RTVA 2XY5A 3KLEA 1YTUA 4Z4GA 4HCCA 4DMNA 4KFBA 4DSEA 4N56A 4E3SA 1U48A 4M3TA 2PY5A 1WNSA 3SV3A 3VN5A 4B08A 1TKTA 1KSPA 1HPZA 1Q8IA 3I8DA 3SUQA 4CGDA 1Z26A 3NF8A 3WNFA 3IAYA 4CF2A 3NDKA 3SYZA 1ASUA 4EP4A 4DF8A 3WNGA 1ZBLA 1L3VA 2GBZA 1SV5A 3I0RA 5KRSA 2B4JA 4CEFA 4BDZA 4ELTA 1K6YA 3D0PA 2ETJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RT1 A;  4AHC A;  1SKR A;  4CGH A;  3SI6 A;  2BE2 A;  2YV0 X;  3MAQ A;  3CFP A;  4O55 A;  3RR8 A;  3VQQ A;  2Z1J A;  1L3S A;  3KIO A;  4AH9 A;  1KCF A;  5KGX A;  2YNH A;  3ZSO A;  2X6N A;  1S1T A;  1S6P A;  1VSI A;  1L3T A;  1EX4 A;  4FK2 A;  4YFU A;  2Q3S A;  4DU1 A;  3HYF A;  2DTU A;  5C25 A;  4W5T A;  3AV9 A;  3AA5 X;  4Y1C A;  4HUF A;  3ZT2 A;  4DS4 A;  1X1P A;  4IG0 A;  4FJH A;  3THV A;  3OYI A;  3F9K A;  4LSL A;  3PX6 A;  4B9N A;  4DSK A;  1UA0 A;  2HHX A;  3B6O A;  1JLC A;  3V9S A;  3HT3 A;  3SQ1 A;  2OZM A;  4HUE A;  1NK5 A;  4M45 A;  5I42 A;  2G8I A;  4HVJ A;  1ZBH A;  4CFD A;  4OKK A;  4FCY A;  4KHQ A;  3K59 A;  1SUQ A;  2XHB A;  1S9G A;  1T03 A;  3TAQ A;  4DFM A;  3VQ5 A;  3O4Q A;  4CFB A;  3SNN A;  4DSJ A;  4CIE A;  2YKN A;  1QTM A;  1D9D A;  3KLG A;  3MXI A;  2OPQ A;  1UOC A;  2P5G A;  1FK9 A;  3L3U A;  1XHZ A;  2O4G A;  1W0H A;  4BE1 A;  3LPT A;  3LZJ A;  2ITG A;  3RMC A;  1T05 A;  4I2P A;  3M8R A;  3QES A;  4AHR A;  1ZYQ A;  4UQG A;  4R5P A;  3NF9 A;  1TKX A;  3HVT A;  1NJY A;  3UIQ A;  2YHA A;  1SKS A;  4OGC A;  4IDK A;  3L2Q A;  1KRP A;  1LWE A;  3NAE A;  3AVI A;  1TL3 A;  4CIG A;  3DOL A;  1NK8 A;  2YNF A;  1CXU A;  1ZBF A;  3CM5 A;  3B6P A;  4ZTJ A;  3NF7 A;  2XO7 A;  1WSF A;  1QSY A;  2OPR A;  2VG6 A;  3QO9 A;  3HM9 A;  1VRU A;  3V9Z A;  4DTN A;  5C42 A;  3LDS A;  4AIL C;  2D0C A;  1TKZ A;  3JSM A;  4E7J A;  5SZT A;  1HQU A;  3NF6 A;  4CEC A;  4B9L A;  3G0Z A;  3DM2 A;  4DLE A;  1JLE A;  3T3F A;  4KHU A;  3LPU A;  3QIP A;  4IG3 A;  3HJF A;  2HNZ A;  2G8F A;  1JKH A;  4FXD A;  4Z4E A;  1X9W A;  2VG5 A;  3ZCM A;  4CEA A;  4HHT A;  1U45 A;  3ZSV A;  1WAJ A;  1HNV A;  1HYZ A;  4OLA A;  2E6L A;  3M8P A;  2EX3 A;  4M3Y A;  2I5J A;  2YNG A;  4ELU A;  4FZX C;  3PUF A;  3L2U A;  3C94 A;  3G10 A;  3MEG A;  1S9E A;  1BGX T;  1RBV A;  3KD1 E;  2AJQ A;  2P1J A;  4CJU A;  1S1U A;  4DTR A;  5HLF A;  3LP1 A;  4KB1 A;  4CER A;  3DYA A;  4FLX A;  1NK9 A;  2B6A A;  1TGO A;  3PO5 A;  4KHS A;  2NUB A;  3DLR A;  1LV5 A;  3ZSQ A;  4E0D A;  1EET A;  4DTO A;  1NOZ A;  3RMA A;  1BQN A;  3V1Q A;  2DFE A;  3OYA A;  4CJL A;  3LAN A;  3VQ9 A;  4DSL A;  4HUG A;  3HK2 A;  3QIO A;  1VSK A;  3LAK A;  3I0S A;  4EP5 A;  5HRP A;  2R7Y A;  4DF4 A;  2HHV A;  1WSJ A;  4N76 A;  3VQC A;  3AO3 A;  4CEZ A;  3CFO A;  3D45 A;  4FLZ A;  4KI6 A;  3AVB A;  4YNQ A;  4Z4I A;  1VRT A;  2HHQ A;  4NYN A;  1RBS A;  1JLG A;  1KVC A;  2QKB A;  4RW6 A;  4F3O A;  3ZSZ A;  3O4N A;  2YNI A;  3HP6 A;  4DQR A;  2GUI A;  3KK1 A;  4CIF A;  3DLH A;  4KHY A;  5KGW A;  3NHG A;  2VG7 A;  5J1E A;  4Y1D A;  3SPZ A;  1BCO A;  1EP4 A;  3VQB A;  1ITG A;  4CGI A;  4CJS A;  3AVG A;  4RG8 A;  3QEP A;  3NGI A;  2A1S A;  1Q9Y A;  4B9S A;  3CYM A;  3VQ7 A;  1HJR A;  4CHO A;  4B9U A;  4CJW A;  4DTP A;  2HNY A;  1C6V A;  1JLA A;  3NGY A;  1SL0 A;  2A1R A;  3KKR A;  3HXM A;  2OPP A;  4GMJ B;  4B3O A;  4CJT A;  2D0A A;  3SZ2 A;  2GV9 A;  4B9V A;  2OA8 A;  1RT5 A;  3C6T A;  3EZ5 A;  4B8A B;  4QAG A;  4CF1 A;  3DRP A;  3TAP A;  3VQ8 A;  1W9H A;  3WNE A;  1S1V A;  3MXM A;  1JL2 A;  4KKO A;  1NKB A;  3V4I A;  4RW7 A;  2XY8 A;  2ZQB A;  3TWH A;  3SJJ A;  3LP2 A;  4FVM A;  1BCM A;  1U49 A;  1Q9X A;  4LSN A;  4HCB A;  1C1C A;  1EXQ A;  4LH5 A;  4W5N A;  3QLH A;  4M41 A;  4NCG A;  4IFY A;  1X9M A;  1QE1 A;  3SQ0 A;  3DLK A;  1YT3 A;  3ALY A;  4K8Z A;  1BIZ A;  2G8U A;  5I3U A;  5KRT A;  1IKY A;  4KV8 A;  3WNH A;  1A5V A;  3CQ8 A;  2F8S A;  1LAV A;  2IC3 A;  1HMV A;  5CYM A;  1BQM A;  4CK2 A;  3NGZ A;  3NH1 A;  1TK0 A;  1HQE A;  3LZI A;  4AHV A;  4C8L A;  4H8K A;  2D0B A;  2YHB A;  4ID5 A;  2BGG A;  3OYG A;  1UAX A;  3DLE A;  4I9L A;  4GVM A;  3AO2 A;  1MU2 A;  5CZ2 A;  3SCX A;  3BGR A;  1RT3 A;  1IKX A;  4C8M A;  4DQS A;  1A5X A;  3KLF A;  3DLG A;  4BWJ A;  1RTD A;  4QCL A;  3AA3 A;  3VQ4 A;  3OY9 A;  4B9M A;  4DFK A;  4DTX A;  4CED A;  1FKP A;  1RDA A;  1SKW A;  4CJR A;  3K2P A;  3CG7 A;  3L2W A;  1IH7 A;  5HRR A;  3ZSX A;  3PO4 A;  4H4M A;  5CY4 A;  4N47 A;  1BI4 A;  3KLH A;  3NCI A;  3SPY A;  2LSN A;  1VK0 A;  3VA0 A;  4OJR A;  4FK0 A;  4KRF A;  3DRS A;  3LAL A;  1J5O A;  4CJ4 A;  1DTT A;  3ZSR A;  1TAQ A;  3SV4 A;  4DQQ A;  4CGJ A;  2D5R A;  4OKE A;  4CFC A;  4CES A;  4AHT A;  1D9F A;  4O5B A;  2G8H A;  4M3R A;  2QXF A;  1XWL A;  1NK7 A;  1IG9 A;  2OYQ A;  3M8Q A;  4FJJ A;  3ZT0 A;  4FW1 A;  4O0I A;  2Z1I A;  4Q5V A;  5HRN A;  3M8S A;  4CHQ A;  3DMJ A;  4RW4 A;  4FJ7 A;  4BAC A;  4DTS A;  4CHN A;  2ZE2 A;  4BWM A;  4LH4 A;  5HP1 A;  4KHW A;  3P83 D;  1TAU A;  2Z1G A;  1B92 A;  4EZ6 A;  1UA1 A;  1VSD A;  1KLN A;  4JLH A;  3PY8 A;  3K58 A;  4ID1 A;  3AVK A;  4E89 A;  3O3G A;  2RF2 A;  1B9D A;  3RRG A;  1VSM A;  4CEE A;  1GOB A;  2Y1J A;  4DQP A;  3VQP A;  2F96 A;  4OKJ A;  1F21 A;  4AHU A;  3RMD A;  1BI4 B;  4CF8 A;  1KFS A;  2HHW A;  3U3G A;  3MXJ A;  4KTZ A;  2G8V A;  5EU7 A;  2QKK A;  3ZT4 A;  3DOK A;  4DWI A;  3QNO A;  3KK2 A;  4F8R A;  1NOY A;  3HP9 A;  1KFD A;  5FRM A;  2O4I A;  1NJW A;  3NH2 A;  1RT6 A;  3HPG A;  3KTQ A;  3OJU A;  2IAJ A;  1T8E A;  4XIU A;  1NK6 A;  4G1Q A;  2HB5 A;  1JLF A;  3TAE A;  3QNN A;  1U47 A;  1JXE A;  4GW6 A;  4W5O A;  4DU3 A;  3OYH A;  4M3W A;  4N41 A;  1RT2 A;  2XRI A;  3QIN A;  1QSS A;  3NE6 A;  3OS2 A;  4FJM A;  3HO1 A;  4OPJ A;  3QET A;  2IOC A;  1HRH A;  4PUO A;  4BE0 A;  3ITH A;  2BAN A;  1QHT A;  3C95 A;  3PX4 A;  1J53 A;  3E01 A;  4CHZ A;  3F73 A;  3V9X A;  4NCB A;  3AVC A;  3AO5 A;  2KZZ A;  2P5O A;  4FJ5 A;  3LP3 A;  3VQE A;  1TV6 A;  1KVA A;  1C0U A;  5DMR A;  3TAF A;  3HPO A;  4PY5 A;  1IO2 A;  1RDB A;  3SUP A;  1NKE A;  1RCH A;  5J2N A;  4KI4 A;  1C1A A;  3P5J A;  4J2A A;  3AVJ A;  1DLO A;  4E1M A;  1TK5 A;  3SQ2 A;  4CGG A;  1RIL A;  4H4O A;  4FK4 A;  1ZBU A;  1REV A;  3JYT A;  2HMI A;  3TAM A;  4IKF A;  4FW2 A;  4EZ9 A;  3H08 A;  2ZD1 A;  3ISN C;  1SL2 A;  4CJ5 A;  2FBX A;  3PX0 A;  3RWU A;  4JRQ A;  4ICL A;  5KI6 A;  4FM1 A;  4OLB A;  1WSE A;  1ASW A;  3V9W A;  4DU4 A;  3RMB A;  3OYE A;  4M3U A;  4CE9 A;  2YKM A;  4CK3 A;  3OS1 A;  5D3G A;  2FBT A;  3OYK A;  4DG1 A;  4FLY A;  5J2M A;  4OPK A;  1N5Y A;  3AVM A;  4CCH A;  2HVI A;  1WSH A;  1QSL A;  4BDP A;  4M42 A;  4LD0 A;  2WOM A;  3TAG A;  1WSG A;  4J2B A;  1Z25 A;  3FFI A;  4QOZ B;  2HVH A;  4CEO A;  5CZ1 A;  1RNH A;  5T7B A;  3L2R A;  2F8T A;  3V81 A;  4CF9 A;  1WN7 A;  2WON A;  2JGU A;  2OPS A;  4J2D A;  1B9F A;  1HYV A;  4BE2 A;  1HNI A;  1X9S A;  2IDO A;  3DI6 A;  3OYB A;  3ZT3 A;  2G8K A;  3HL8 A;  1SL1 A;  1L5U A;  3K5O A;  4KRE A;  3LAM A;  3OYJ A;  4CJK A;  4O0J A;  4E7I A;  4DTM A;  3SUN A;  2HND A;  1DTQ A;  1VSH A;  1D8Y A;  2X78 A;  1JXB A;  3ASM A;  3O3H A;  3QER A;  4F2R A;  4F4K A;  4I7F A;  3TAB A;  2HW3 A;  3VQA A;  1NK4 A;  1RBR A;  2G8W A;  2KFN A;  4CJQ A;  3V1O A;  4J2E A;  3IG1 A;  1S5J A;  4DTU A;  4MFB A;  4DQI A;  2KFZ A;  3QEX A;  4K8X A;  4N5S A;  3TAR A;  1GOC A;  4AHS A;  3ULD A;  4BDY A;  4F2S A;  2KZM A;  1J9A A;  1UWB A;  2E4L A;  2XY6 A;  1NKC A;  3OYM A;  4I9Q A;  1NJZ A;  4HTU A;  3OYC A;  4C8K A;  2VWJ A;  4Q0B A;  4FJG A;  3AA4 A;  1ASV A;  5C24 A;  3U3Y A;  3SUO A;  4W5Q A;  3KLI A;  1JLB A;  3DRR A;  4I2Q A;  5J2Q A;  4FJI A;  1N6Q A;  1VSJ A;  3AO1 A;  2DFF A;  3MEE A;  4E1N A;  4CJP A;  2PZS A;  4CGF A;  1U4B A;  1FKO A;  3MED A;  3OYF A;  3V6D A;  4C8O A;  4FZZ A;  4FYD A;  1KTQ A;  2X6S A;  3MEC A;  1CZ9 A;  1I3A A;  1LW0 A;  3ZSW A;  1EKE A;  3K5N A;  4ELV A;  2VWK A;  3OYD A;  4E7L A;  1IKW A;  4Z4C A;  4JS5 A;  1IKV A;  1TL1 A;  3TR8 A;  1XC9 A;  1TKD A;  2DFH A;  3S9H A;  4FM2 A;  4DTJ A;  1RDC A;  3P1G A;  1XI1 A;  2FBY A;  2KW4 A;  3KK3 A;  1T7P A;  4B9T A;  1ZBI A;  3QEI A;  1G15 A;  4ZTF A;  1TK8 A;  2BDP A;  1BHL A;  1CLQ A;  2EHG A;  5DK5 A;  1BIU A;  4CHY A;  2E6M A;  2FBV A;  3V9U A;  3AVF A;  1WAF A;  1A5W A;  3ZT1 A;  4PWD A;  2IS3 A;  5E41 A;  2W42 A;  4KO0 A;  1WLJ A;  3IS9 A;  3AA2 A;  3OS0 A;  1J54 A;  3AVA A;  4MQ3 A;  3C6U A;  1QQC A;  4DSI A;  4DFJ A;  4DFP A;  2KTQ A;  3CFR A;  4OGE A;  4CEB A;  2QK9 A;  3OYN A;  1Y97 A;  1XHX A;  3LWL A;  1RTI A;  3NBP A;  5CYQ A;  5SWM A;  3K5L A;  4JRP A;  3OVN A;  3L8B A;  4ZHR A;  3K57 A;  1KVB A;  4L8R B;  1O1W A;  3AVH A;  3RR7 A;  4KTW A;  3ZSY A;  4LY7 A;  4FJK A;  4CJF A;  3VA3 A;  1S1X A;  1TVR A;  4E19 A;  1R0A A;  2Y1I A;  3AVN A;  4KHN A;  5JS1 A;  4CJV A;  5KTQ A;  1RBU A;  3HST B;  3T19 A;  4DS5 A;  3EY1 A;  2HHT A;  1C0T A;  2KQ2 A;  5JS2 A;  4IFV A;  4CEQ A;  2IGI A;  4FLU A;  3PV8 A;  4FLW A;  4FLT A;  3AVL A;  4PA1 A;  2XY7 A;  4B8C A;  4KPY A;  2DY4 A;  2PYL A;  4M3Z A;  3VQD A;  3CM6 A;  3OJS A;  1RTH A;  1VSF A;  1RTJ A;  1WSI A;  3L2V A;  2P51 A;  4C8N A;  4IBN A;  5HBM A;  4KAZ A;  4KTQ A;  1U04 A;  3TI0 A;  4RW8 A;  3U6F A;  1RT4 A;  4FZY A;  1LW2 A;  4O4G A;  4DSF A;  3DLB A;  2OZS A;  5HRS A;  4O44 A;  5J2P A;  4E7K A;  4Z4F A;  2JLE A;  3LP0 A;  1LAW A;  2RPI A;  4M3X A;  3EYZ A;  3KJV A;  4FJL A;  4FJN A;  4PQU A;  1YVU A;  3SQ4 A;  4WE1 A;  1CXQ A;  1L3U A;  4CJ3 A;  3TAN A;  2HHU A;  1RT7 A;  4RW9 A;  5K14 A;  1BL3 A;  3HVR A;  2RKI A;  4FJX A;  4FJ8 A;  4F3T A;  5FRO A;  3QEV A;  4JS4 A;  3S3N A;  4CF0 A;  3HPH A;  4CFA A;  4CK1 A;  1S1W A;  4KB0 A;  2FC0 A;  4E7H A;  1LWF A;  3KD5 E;  2ATQ A;  1GOA A;  5FDL A;  1I39 A;  2Z1H A;  1FXX A;  4NYF A;  3VQ6 A;  1QS4 A;  4CJE A;  3S3M A;  1BIS A;  4DLG A;  1C1B A;  4OVL A;  4FM0 A;  2X74 A;  3AO4 A;  1C0M A;  3RRH A;  5FRN A;  1RDD A;  3OYL A;  3L3V A;  1LWC A;  4W5R A;  4FLV A;  1NJX A;  1CZB A;  2B5J A;  1YTA A;  4Z0U A;  5HRO A;  4FJ9 A;  3K5M A;  2PYJ A;  1D5A A;  1JL1 A;  1JLQ A;  3KKS A;  4NCA A;  1RBT A;  3IRX A;  2RN2 A;  2HHS A;  3NH0 A;  3QEW A;  3A2F A;  1VSL A;  3NFA A;  3V1R A;  4Z4H A;  4TSX A;  1NK0 A;  3BDP A;  3S3O A;  3T1A A;  1VSE A;  1KLM A;  4CHP A;  1HYS A;  3LWM A;  1S6Q A;  3O3F A;  3RTV A;  2XY5 A;  3KLE A;  1YTU A;  4Z4G A;  4HCC A;  4DMN A;  4KFB A;  4DSE A;  4N56 A;  4E3S A;  1U48 A;  4M3T A;  2PY5 A;  1WNS A;  3SV3 A;  3VN5 A;  4B08 A;  1TKT A;  1KSP A;  1HPZ A;  1Q8I A;  3I8D A;  3SUQ A;  4CGD A;  1Z26 A;  3NF8 A;  3WNF A;  3IAY A;  4CF2 A;  3NDK A;  3SYZ A;  1ASU A;  4EP4 A;  4DF8 A;  3WNG A;  1ZBL A;  1L3V A;  2GBZ A;  1SV5 A;  3I0R A;  5KRS A;  2B4J A;  4CEF A;  4BDZ A;  4ELT A;  1K6Y A;  3D0P A;  2ETJ A; 
#chains in the Genus database with same CATH topology
 1RT1 A;  4AHC A;  2YV0 X;  4CZK A;  3T69 A;  3CFP A;  3U9Z A;  3RR8 A;  3A5O C;  3VTI A;  5JMV A;  3KIO A;  4JKE A;  1DEJ A;  4ILJ A;  1S6P A;  2D0P A;  1VSI A;  4CZI A;  4UY8 O;  4W5T A;  4FJH A;  4IJN A;  4DS4 A;  3N4P A;  4JN4 A;  3F9K A;  4V19 S;  4B9N A;  1JLC A;  3HRG A;  4L3Q A;  5AQF A;  3V9S A;  4AQY K;  2OZM A;  4HUE A;  2A41 A;  1NK5 A;  4HVJ A;  4H0P A;  1VQ5 N;  4JI7 K;  4OKK A;  3EE9 A;  1YI2 N;  3K59 A;  1SUQ A;  2XHB A;  4DFM A;  4AF1 A;  4DSJ A;  2YKN A;  1QTM A;  1RGI A;  3THX B;  2O4G A;  1W0H A;  5AQL A;  1QZ6 A;  3QES A;  1ZYQ A;  2HBM A;  3CQY A;  2YHA A;  3AVI A;  4CIG A;  1HNZ K;  4BRD A;  2O8E B;  1CXU A;  3H6E A;  5M1P A;  2Q0U A;  4DB3 A;  4FWO A;  2XO7 A;  4JKG A;  2VG6 A;  3R9P A;  2ZF5 O;  4YOX A;  3JSM A;  5AZJ B;  4E1J A;  4BR9 A;  2VGN A;  3HBT A;  3MDQ A;  3QB0 A;  2WBN A;  3T3F A;  3O08 A;  2G8F A;  4YHH K;  1X9W A;  4Z4E A;  4HHT A;  1WAJ A;  4OLA A;  2QTD A;  2EX3 A;  4ELU A;  3PUF A;  3G10 A;  3MEG A;  1S9E A;  2AJQ A;  4CJU A;  5AQX A;  4CER A;  3ENB A;  4KHS A;  1OVY A;  2DPN A;  3WEE B;  3EKU A;  1LV5 A;  1J5E K;  1HNX K;  2DFE A;  3TTD A;  3OYA A;  1S3X A;  3D2F B;  4DSL A;  1VSK A;  3LAK A;  3I0S A;  3VGK A;  4DF4 A;  1WSJ A;  1O13 A;  4MO5 A;  4OPH A;  2HHQ A;  1VRT A;  1EWQ A;  4IJA A;  4NYN A;  3GOI A;  4F3O A;  2YNI A;  1GLC G;  1MWM A;  3DLH A;  3SPZ A;  2ZJQ L;  3VQB A;  4BRP A;  4CGI A;  3QEP A;  4B9S A;  1U2V A;  1Q9Y A;  3E9L A;  3CCU N;  1C6V A;  3NGY A;  1YIJ N;  5JIC A;  2OPP A;  4YOW A;  4B3O A;  4B9V A;  3OTO K;  2OA8 A;  1RT5 A;  3C6T A;  2HF4 A;  4B8A B;  4QAG A;  4CZF A;  3DRP A;  3VQ8 A;  3AGK A;  1S1V A;  3MXM A;  4RW7 A;  4IEE A;  2KKZ A;  3PIP L;  3VEV A;  2V7Y A;  3QLH A;  1QE1 A;  3SQ0 A;  3ALY A;  4F9O A;  1W7A A;  5I3U A;  3VMF B;  1IKY A;  1A5V A;  2F8S A;  5AZJ A;  3NGZ A;  1HX1 A;  3LZI A;  3CCL N;  4C8L A;  5BRH A;  3I33 A;  4ID5 A;  3ZET A;  3OYG A;  4I9L A;  2CGL A;  3MMV A;  3MCP A;  3SCX A;  4H0V B;  3DLG A;  1XUP O;  4CED A;  1RDA A;  2OTL N;  2A42 A;  3K2P A;  3CG7 A;  1IH7 A;  3MN6 A;  4GVE A;  5CY4 A;  4JI5 K;  2P9P A;  3NCI A;  1MA9 B;  4FWQ A;  3LAL A;  4JNE A;  4OKE A;  3UKR A;  3CJ1 A;  1D9F A;  4DUY K;  4M3R A;  2QXF A;  4U7B A;  1NK7 A;  3ZT0 A;  5FPN A;  3DMJ A;  4DTS A;  3GL1 A;  5HP1 A;  1Q82 O;  2Z1G A;  1UA1 A;  1P8Z A;  5AQH A;  1BU6 O;  1LOT B;  3AVK A;  1GLD G;  2RF2 A;  3TPQ A;  4M63 C;  1GOB A;  3VQP A;  2W6L A;  2F9W A;  3RSE A;  1YAG A;  3ZX0 A;  4CF8 A;  1KFS A;  3U3G A;  2QKK A;  4O8U A;  3ZT4 A;  3QNO A;  3VEW A;  1NOY A;  5FRM A;  3PIO L;  3C6H A;  4XIU A;  4G1Q A;  3PLA A;  1Q7Y O;  1JLF A;  1U47 A;  1JXE A;  5AQQ A;  3LM9 A;  1QZ5 A;  4M3W A;  4N41 A;  4JI2 K;  1RT2 A;  2XRI A;  1M1K O;  1QSS A;  3HO1 A;  3W0L A;  1X3N A;  2IOC A;  1HRH A;  4DCH A;  1QVF M;  3ITH A;  3AAR A;  2EWS A;  1J53 A;  4CHZ A;  4DV4 K;  3I55 N;  2PBD A;  4WFA L;  5LJV A;  1QQN A;  4FVU A;  5AFU H;  2E2Q A;  4E1M A;  2AA4 A;  4ISE A;  3KWG A;  4FK4 A;  5JVG L;  1REV A;  2F7T A;  2HMI A;  3DXM B;  4GKJ K;  4FW2 A;  4EZ9 A;  4QS7 A;  3PX0 A;  3RWU A;  4JRQ A;  4OLB A;  3V9W A;  2O8B B;  3A5N C;  5EXW A;  4M3U A;  3TU5 A;  4CK3 A;  2O8D A;  3OYK A;  5BR9 A;  4DG1 A;  1IJJ A;  5A2Q O;  1X3M A;  1YUW A;  1Z25 A;  3HOT A;  5CZ1 A;  4JHD A;  3L2R A;  3E66 A;  1B9F A;  4BE2 A;  1X9S A;  2Q31 A;  3ZT3 A;  1MDU B;  3K5O A;  4KRE A;  4CJK A;  3ZEU B;  4DTM A;  3M3Z A;  3THX A;  2QM1 A;  2X78 A;  4NXM K;  4FWN A;  3WXM B;  1D4X A;  2KHO A;  3CF5 L;  1NK4 A;  1KAZ A;  1Z6R A;  1OH5 A;  4DTU A;  4MFB A;  3TAR A;  1GOC A;  4AHS A;  1J9A A;  4FPA A;  3VES A;  3OYC A;  4C8K A;  2VWJ A;  3SMP A;  5C24 A;  3TSP A;  3G71 N;  1JLB A;  4I2Q A;  4FJI A;  4LF7 K;  3JXU A;  4H5R A;  1N6Q A;  3AO1 A;  2DFF A;  4ILH A;  4E1N A;  4CGF A;  3OYF A;  4BC2 A;  5B8H A;  2X6S A;  1P90 A;  3FR0 A;  1EKE A;  3K9J A;  1IKV A;  1TL1 A;  3O1W A;  3TR8 A;  2RE2 A;  3T1H K;  3S9H A;  5M1O A;  1TK8 A;  2BDP A;  1HPM A;  5DK5 A;  3AVF A;  4PWD A;  1YVN A;  4KO0 A;  1U6Z A;  1M90 O;  1BO5 O;  1J54 A;  3VTH A;  4FOE A;  1QQC A;  4DFJ A;  2UU9 K;  3CCM N;  3C7N B;  3WQT A;  1Y97 A;  2Q1N A;  3OYN A;  3LWL A;  3O9R A;  3VEY A;  5AQS A;  4ILG B;  3UKU B;  2P9K B;  2JWK A;  4KTW A;  1OH7 A;  3J7Z O;  2BTF A;  4JKC A;  3A0I X;  3HST B;  4DS5 A;  3EY1 A;  4FLU A;  4PA1 A;  3QDK A;  3CM6 A;  4CJ7 A;  3L2V A;  2P9I B;  2P51 A;  4HWI A;  4IBN A;  3CJC A;  4KTQ A;  3C6A A;  4RW8 A;  3PSF A;  3TI0 A;  1RT4 A;  4FZY A;  5HRS A;  3L6Q A;  5J2P A;  4E7K A;  4IO8 A;  1LAW A;  3EYZ A;  3SMS A;  4J8F A;  4JD2 B;  3HVR A;  3G4S N;  4EAH D;  3AAP A;  3QEV A;  3EO3 A;  3S3N A;  5I9E B;  3HPH A;  1KXP A;  2E2O A;  4CK1 A;  2FC0 A;  4E7H A;  2O8C A;  3KD5 E;  5FDL A;  2Z1H A;  1FXX A;  3CCR N;  2E5L K;  3WXI A;  4FWM A;  1ZXO A;  2NZT A;  1C1B A;  2X74 A;  3AO4 A;  3O9T A;  5M1F A;  5LMN K;  4B1Y B;  3L3V A;  5C12 A;  5FPD A;  1NJX A;  1CZB A;  2HMP A;  5HRO A;  1D5A A;  1JLQ A;  1IV0 A;  2V51 B;  3IRX A;  1VQM N;  1VQ9 N;  1VSL A;  4TSX A;  4BRA A;  1KLM A;  4YDU C;  4WQ4 C;  1E3M A;  3E9O A;  4NO7 A;  2P9K A;  3RTV A;  2XY5 A;  4Z4G A;  4KFB A;  1HLU A;  4B08 A;  3CME N;  1G99 A;  1KSP A;  1HPZ A;  3VPZ A;  4DF8 A;  1ASU A;  3CJA A;  5CE3 A;  4BDZ A;  3IKM A;  1K6Y A;  2ETJ A;  3H1V X;  1XQS C;  3DXK B;  3JS6 A;  3SI6 A;  3MAQ A;  2V7Z A;  3VQQ A;  2Z1J A;  3QML A;  4KBO A;  2W40 A;  3RSE B;  5DM7 L;  2O8B A;  1ZC6 A;  1L3T A;  4FK2 A;  4YFU A;  2DTU A;  4Y1C A;  1X1P A;  3THV A;  3PX6 A;  1NGG A;  3HT3 A;  2E8A A;  3SQ1 A;  5AJ3 K;  4CD3 A;  1GLB G;  1VQO N;  1GLF O;  3VF6 A;  3SNN A;  4CIE A;  2OPQ A;  1UOC A;  2P5G A;  1FK9 A;  3L3U A;  4BRE A;  4BE1 A;  1JCF A;  2ITG A;  5E26 A;  2P9N A;  3T7Z A;  3NF9 A;  1TKX A;  2QXL A;  4BR7 A;  3UIQ A;  4OGC A;  5BPN A;  3L2Q A;  4CBU A;  1TUY A;  1ZBF A;  3BP8 A;  1NBW A;  1WSF A;  1QSY A;  4YOT A;  4BVO A;  1VRU A;  1X9J A;  4LF4 K;  5C42 A;  2D0C A;  5SZT A;  4YY3 K;  4CEC A;  4H0Y B;  2UXC K;  3DM2 A;  1WOQ A;  3ULE A;  4IG3 A;  3HJF A;  4YOR A;  1HKC A;  2VG5 A;  3ZCM A;  4CEA A;  1U45 A;  3ZSV A;  1OKJ A;  2Q97 A;  3J7Y P;  5ELZ A;  1BGX T;  3IDH A;  3O4W A;  4DTR A;  3LP1 A;  1NU0 A;  3IFR A;  3DYA A;  4FLX A;  1NK9 A;  2W41 A;  3EZW A;  3VGL A;  1EET A;  3RMA A;  1DGK N;  1BQN A;  4CZJ A;  4DR5 K;  5TKY A;  4LFA K;  3I56 N;  3ID6 A;  5HRP A;  4GV6 A;  2HHV A;  2VWB A;  4CEZ A;  4KI6 A;  3D45 A;  3VF2 A;  1NGI A;  3CC4 N;  4PHT X;  4FLZ A;  2VQF K;  4B3T K;  1KVC A;  4RW6 A;  2J4R A;  3ZSZ A;  2GUI A;  3KK1 A;  2RHK A;  2VG7 A;  5J1E A;  1VQ8 N;  3CCJ N;  3F9M A;  3NGI A;  4RTF D;  3CYM A;  1HJR A;  4DTP A;  2HNY A;  5AQJ A;  5KPZ A;  1SL0 A;  4H5W A;  3KK7 A;  3ZEU A;  4MLE A;  5CHI A;  1NGD A;  2D0A A;  3SZ2 A;  3D2E A;  3HZ6 A;  3EZ5 A;  4KH4 A;  2FLO A;  1VAZ A;  3TAP A;  4BC3 A;  3C0B A;  2E2P A;  2XY8 A;  3SJJ A;  4FVM A;  1BCM A;  4JI6 K;  4LSN A;  5ADX A;  4HCB A;  3G25 A;  1T3V A;  1EXQ A;  4AM7 A;  1XNR K;  4BG9 A;  1YT3 A;  2I7N A;  4FWK A;  1BIZ A;  2NLX A;  2HOE A;  3CQ8 A;  3SJH A;  1LAV A;  1HMV A;  3NH1 A;  1VQP N;  1TK0 A;  4B1X B;  4IZ9 A;  1HQE A;  4DV6 K;  4H8K A;  2D0B A;  2YHB A;  1HJO A;  4JV5 K;  4GVM A;  2WUS A;  3GG4 A;  4YDU A;  1MU2 A;  4BRQ A;  4B3S K;  4DQS A;  1YF5 L;  4CW7 B;  5F0X A;  1RTD A;  4QCL A;  3WUH A;  1FKP A;  5JLF A;  4B9Q A;  5FPM A;  3L2W A;  3BZK A;  3CCS N;  4CZL A;  2O8E A;  1OH8 A;  1WBD A;  3G6E N;  1TAQ A;  3SV4 A;  4CFC A;  2JWL A;  2UUA K;  1KAY A;  2A5X A;  4FW1 A;  2Z1I A;  3AY9 A;  3DJC A;  4PKG A;  1Z05 A;  4JKA A;  4RW4 A;  2ZE2 A;  1B92 A;  4GNI A;  4EZ6 A;  3DXM A;  3ZYY X;  4JLH A;  3PY8 A;  3O3G A;  1VSM A;  4CEE A;  4IOC L;  2F96 A;  4OKJ A;  3RMD A;  1BI4 B;  4KTZ A;  4DWI A;  4MDA A;  2ITM A;  4F8R A;  3HP9 A;  4O5F A;  3P31 A;  4WQ5 A;  4MLH A;  1T8E A;  1NK6 A;  1ATR A;  3TAE A;  3QNN A;  4GW6 A;  4W5O A;  4DU3 A;  3OYH A;  4FJM A;  5JVH L;  3NE6 A;  1NMN A;  1YHQ N;  3VF4 A;  5IWA K;  3WXL A;  2BAN A;  3ENH A;  3EEQ A;  5GAE P;  3V9X A;  5C10 A;  2QA4 N;  3AVC A;  2O8C B;  4FJ5 A;  3LP3 A;  2D4W A;  3D2E B;  3VQE A;  1TV6 A;  4GY2 B;  1C0U A;  5DMR A;  4CVN E;  3HPO A;  4KH5 A;  2F4V K;  4KI4 A;  1C1A A;  3AVJ A;  1TK5 A;  3T1Y K;  4CGG A;  4H4O A;  3WEE A;  3ZET B;  3M5R A;  5KQ8 A;  3VEO A;  2GUP A;  3H08 A;  5AQM A;  4ICL A;  4JKF A;  1ASW A;  3THW B;  3OS1 A;  2NNW A;  5AQY A;  1N5Y A;  4OPK A;  1WSH A;  4M42 A;  4BDP A;  5AQU A;  3NVK A;  2WOM A;  1NLV A;  1HR0 K;  3FFI A;  4QOZ B;  1H1V A;  3CER A;  3SLC A;  1RNH A;  5T7B A;  1RFQ A;  1WN7 A;  4RWT A;  2OPS A;  1HNI A;  1NMD A;  3OYB A;  5GIP A;  2G8K A;  1SL1 A;  2UUC K;  1DKG D;  3QBW A;  3C7N A;  5BRF A;  3VEZ A;  2HND A;  3O3H A;  3ATV A;  1N8R O;  4BRG A;  2KFN A;  4CJQ A;  3V1O A;  4WFB L;  1YJW N;  2NRV A;  4IOA L;  4BDY A;  1ZBS A;  4F2S A;  2KZM A;  2E4L A;  3J81 O;  3OYM A;  1NJZ A;  3O8M A;  3W3D A;  4GV9 A;  3AA4 A;  1ASV A;  3SUO A;  4W5Q A;  3KLI A;  4FPB A;  3DRR A;  1RDW X;  5HOO A;  1MWK A;  3CJB A;  4CJP A;  1U4B A;  3V6D A;  1ESV A;  2VYP A;  2KLA A;  4XEI A;  3L4Q A;  3K5N A;  2IVN A;  2Q2R A;  4Z4C A;  2ASP A;  3A5L C;  1BWF O;  1RDC A;  1ZBI A;  4B9T A;  4ZTF A;  1NNE A;  2QI2 A;  1CLQ A;  1T6D A;  3BEX A;  4CHY A;  2E6M A;  3ZT1 A;  2GWJ A;  2IS3 A;  1HNW K;  2HF3 A;  2W42 A;  1WLJ A;  2WFB A;  4WYB A;  3AVA A;  3ULE B;  3C6U A;  3IMX A;  2YHY A;  4DSI A;  2KTQ A;  2QWN A;  5EVZ A;  3CFR A;  3FLC O;  3K5L A;  3SK3 A;  4JRP A;  1KQS M;  4KH6 A;  3K57 A;  4L8R B;  3QFP A;  3ZSY A;  4BC5 A;  4JHD B;  4CJF A;  3VA3 A;  1TVR A;  1R0A A;  1Q81 O;  2Y1I A;  3CCV N;  4KHN A;  5JS1 A;  5KTQ A;  4C1N K;  3T19 A;  2GEM A;  5AQI A;  4CEQ A;  3GBT A;  4B8C A;  4KPY A;  2PYL A;  4M3Z A;  3VQD A;  3OJS A;  1NGB A;  1RTH A;  1WSI A;  2BUP A;  4C8N A;  3EN9 A;  3MN5 A;  4H5T A;  3U6F A;  4BR5 A;  1N33 K;  2CH6 A;  3FE1 A;  4O4G A;  4JK9 A;  4FWS A;  3DLB A;  1K9M O;  3BF1 A;  4A5A A;  4FJN A;  4PQU A;  1YVU A;  5AFU A;  4G9Z A;  3TAN A;  2ZJP L;  1NGF A;  1RT7 A;  3BY5 A;  4RW9 A;  2RKI A;  4BG8 A;  4BRL A;  1BUP A;  2P9S A;  1S1W A;  1YIT N;  4U67 L;  3ZLJ A;  2ATQ A;  4CJE A;  3J7A P;  1BIS A;  4K0K K;  4DLG A;  3DXK A;  4FM0 A;  2QEX N;  3EE8 A;  3RRH A;  1VQ4 N;  1VQL N;  5FRN A;  3DLL L;  1RDD A;  1LWC A;  1YTA A;  1XNQ K;  4CZE A;  4X66 K;  2PYJ A;  3KKS A;  4NCA A;  2HHS A;  3NFA A;  1NK0 A;  3MX2 A;  3K9K A;  3S3O A;  5KPR A;  1VSE A;  2FXU A;  3KWI A;  3MCA B;  3O3F A;  4E3S A;  4N56 A;  5AQZ A;  3MWT A;  3SV3 A;  1TKT A;  3NF8 A;  4CF2 A;  3SYZ A;  4EP4 A;  1ZBL A;  3WNG A;  1L3V A;  5KRS A;  3K0S A;  4H0X B;  3EKS A;  1SKR A;  2YJE A;  1NG9 A;  5KGX A;  3ZSO A;  3R8E A;  2IIR A;  1EX4 A;  4DU1 A;  5C25 A;  2VCP A;  3AV9 A;  4PL7 A;  4HUF A;  3ZT2 A;  4LSL A;  4DSK A;  2HHX A;  5HL7 L;  4M45 A;  2G8I A;  4DR2 K;  1ZBH A;  3CCQ N;  4CFD A;  2FF6 A;  4LC9 B;  3LDO A;  3JAM O;  1S9G A;  3TAQ A;  4MO4 A;  3KLG A;  4IOX A;  3MXI A;  5AQN A;  2P9I A;  5C2F A;  1XHZ A;  2V52 B;  4WCE L;  3AAQ A;  4I2P A;  3HI0 A;  4DR1 K;  3UKR B;  4AHR A;  3O9S A;  4R5P A;  3D7E O;  5F1X A;  1KRP A;  1NK8 A;  2YNF A;  1BG3 A;  4NB4 A;  3CM5 A;  3B6P A;  4XH5 A;  2QWP A;  4A2B A;  3BZC A;  2OPR A;  5GAD P;  4HTL A;  4DTN A;  1YJ9 N;  1GLE G;  4AIL C;  3D6R A;  3NF6 A;  3G0Z A;  4H0T B;  3THW A;  2HST A;  1JLE A;  4BRF A;  3LPU A;  3QIP A;  3S41 A;  4BRM A;  3I8B A;  3HSC A;  4M3Y A;  2GWK A;  4FZX C;  3L2U A;  4JYA K;  1RBV A;  5GAG P;  4ISF A;  1S1U A;  4A62 A;  4IXC A;  3MWP A;  3PO5 A;  1IBM K;  3DLR A;  4DTO A;  3V1Q A;  4DV0 K;  1GLA G;  4CJL A;  4JKD A;  3VQ9 A;  3QIO A;  4BR4 A;  2IVO A;  1K73 O;  4Z4I A;  3CFO A;  4FL9 A;  1JLG A;  1R59 O;  1FW6 A;  4CIF A;  4Y1D A;  3HOS A;  1EP4 A;  1ITG A;  3ZX3 A;  3VET A;  3AVG A;  4RG8 A;  2A1S A;  3VEN A;  5GAH P;  4PL8 A;  3C65 A;  3VQ7 A;  4DKW A;  4CJW A;  4K43 A;  1JLA A;  2A1R A;  3HXM A;  4CJT A;  4CF1 A;  2ZJR L;  3HM8 A;  4JKG B;  2FSJ A;  3WNE A;  5KPT A;  4KKO A;  4QS8 A;  2ZQB A;  1EWR A;  3FZH A;  1K8K A;  2BH1 A;  3LP2 A;  1U49 A;  1Q9X A;  2D1K A;  4BQL A;  1U2V B;  4BRC A;  1C1C A;  4DV7 K;  4M41 A;  3UE5 A;  1X9M A;  4IFY A;  3QFU A;  3DLK A;  4DV1 K;  5AQR A;  5KRT A;  3WNH A;  4CZH A;  4CK2 A;  3O6W A;  4H03 B;  2BGG A;  5M1Q A;  3DLE A;  3O1B A;  3BGR A;  1IKX A;  4C8M A;  1Q18 A;  3SAH A;  1VQ6 N;  3AA3 A;  3VQ4 A;  4B9M A;  4DTX A;  1SKW A;  5HRR A;  1BI4 A;  3LDQ A;  3SPY A;  2CH5 A;  1J5O A;  4OPA A;  4CJ4 A;  1DTT A;  4PKI A;  3TSQ A;  4CGJ A;  2D5R A;  3CPW M;  4CES A;  1HKG A;  4AHT A;  4O5B A;  1IG9 A;  3J8A A;  3TTF A;  3M8Q A;  4O0I A;  4Q5V A;  4B1U B;  4BR2 A;  4CHQ A;  3BF3 A;  1TAU A;  4KHW A;  4BWM A;  4LH4 A;  5TKW A;  1VSD A;  1KLN A;  3O80 A;  3A5M C;  4E89 A;  3RRG A;  4DQP A;  5EX5 A;  4AHU A;  1F21 A;  4XH4 A;  3MN9 A;  2HHW A;  3MXJ A;  2G8V A;  3DOK A;  3P4I A;  4JEP A;  2H3G X;  4FO0 A;  3KK2 A;  3SBT A;  4LF6 K;  1RT6 A;  3HPG A;  2IAJ A;  4H0O A;  2HB5 A;  3ZX2 A;  5EOY A;  1WBB A;  4CBX A;  3QIN A;  3OS2 A;  4FOI A;  1DT9 A;  4PUO A;  4AM6 A;  4BE0 A;  3WQU A;  1ATS A;  3R6M A;  1QHT A;  2ASM A;  3FGU A;  3F73 A;  4NCB A;  2P5O A;  3CD6 N;  4CBW A;  3TAF A;  2A3Z A;  3SUP A;  1RCH A;  1IG8 A;  5J2N A;  4J2A A;  4XH1 A;  1DLO A;  3SQ2 A;  4X64 K;  4M7Y A;  1RIL A;  4IKF A;  4JI1 K;  1SL2 A;  3N4Q A;  3FZL A;  3M6G A;  3UB5 A;  3CMA N;  3OYE A;  4CE9 A;  2YKM A;  4O8K A;  2FBT A;  4FLY A;  2HVI A;  1QSL A;  3B8A X;  2YCH A;  3IUC A;  1CZA N;  1XC3 A;  3TAG A;  1WSG A;  5CR4 A;  5BPL A;  3CXC M;  2QWQ A;  2F8T A;  4CF9 A;  1ATN A;  4H5N A;  3GE1 A;  1WB9 A;  4BC4 A;  4J2D A;  1HYV A;  2NRW A;  3HL8 A;  1S22 A;  4E7I A;  4LF5 K;  1DTQ A;  3QER A;  3HTV A;  3O5B A;  4I7F A;  3WT0 A;  2HW3 A;  2G8W A;  4CZG A;  2OAN A;  1S5J A;  4DQI A;  3ENO A;  2KFZ A;  4JAX A;  4CZM A;  4K8X A;  3ULD A;  1SS6 A;  2WTU A;  1UWB A;  2XY6 A;  4I9Q A;  2UXD K;  2D0O A;  5EY4 A;  4HTU A;  3H46 O;  4Q0B A;  2ZM6 K;  4FJG A;  4DQ8 A;  5J2Q A;  3MEE A;  1QQM A;  2PZS A;  4BGB A;  1FKO A;  3MED A;  4C8O A;  4FZZ A;  4JD2 A;  4PKH A;  1FJG K;  1SZ2 A;  1I3A A;  3OBY A;  1LW0 A;  2VWK A;  3OYD A;  2VQE K;  5E84 A;  5H1S Q;  1TKD A;  1XI1 A;  2FBY A;  1T7P A;  1JJ2 M;  3QEI A;  1G15 A;  1BHL A;  1GLJ O;  4DR7 K;  4I6M A;  2EHG A;  3DAW A;  1BIU A;  2FBV A;  1A5W A;  3M1F A;  5E41 A;  4YOV A;  3AA2 A;  3U8X A;  5FLX O;  5BRD A;  4JI3 K;  4OGE A;  4CEB A;  4X62 K;  5C2D A;  1XHX A;  3NBP A;  1J6Z A;  2OTJ N;  4WFN L;  3J80 O;  4DR4 K;  2FSN A;  3AVH A;  4EHU A;  4LY7 A;  2NRZ A;  4WQ4 A;  4E19 A;  3AVN A;  4CJV A;  2GEL A;  4WF9 L;  2HHT A;  1C0T A;  3VER A;  4IFV A;  2IGI A;  4FLT A;  3AVL A;  2DY4 A;  2XY7 A;  4A2A A;  3H1Q A;  3TTC A;  1RTJ A;  1QQO A;  4KAZ A;  1C0F A;  1U04 A;  1LW2 A;  2OZS A;  1IBK K;  2QWR A;  2JLE A;  3LP0 A;  2RPI A;  3KJV A;  2IVP A;  4B1V A;  3CET A;  4NXN K;  4WE1 A;  1CXQ A;  1L3U A;  3OHR A;  3VOV A;  5K14 A;  4FJX A;  3KZB A;  2P9U B;  3MX5 A;  3U4L A;  4CFA A;  3E9P A;  4KB0 A;  2NRH A;  1K8A O;  1GOA A;  1N34 K;  4FWL A;  4NYF A;  3VQ6 A;  3S3M A;  1C0M A;  2A40 A;  4FLV A;  4W5R A;  2B5J A;  3ID8 A;  4Z0U A;  4FJ9 A;  4BQZ A;  1VQN N;  1RBT A;  3LDL A;  2QWL A;  3O9Q A;  3A2F A;  3V1R A;  4Z4H A;  4BRN A;  3BDP A;  3T1A A;  4CD1 A;  1HYS A;  1SQK A;  3LWM A;  4B1Z A;  1S6Q A;  2E1Z A;  2YI1 A;  4HCC A;  1YJN N;  1WNS A;  1Q8I A;  3I8D A;  4CGD A;  1Z26 A;  4ELT A;  4IWV A;  3NDK A;  4K25 A;  1EO1 A;  4FWP A;  1SV5 A;  2B4J A;  3D0P A;  4OX9 K;  5AZI B;  3TSU A;  4CGH A;  2BE2 A;  3U9D A;  2PFU A;  4O55 A;  5KQD A;  1L3S A;  1E4F T;  4A57 A;  4AH9 A;  1KCF A;  2YNH A;  5M1N A;  2X6N A;  1S1T A;  2HBK A;  2Q3S A;  3FZK A;  3HYF A;  3AA5 X;  4IG0 A;  3OYI A;  2P9L B;  1UA0 A;  3B6O A;  3AGR A;  3THY B;  2ZWH A;  5LY3 A;  5I42 A;  4FCY A;  1Y64 A;  1S72 N;  2YX6 A;  4KHQ A;  1ILY A;  3SAG A;  1T44 A;  3LDP A;  1T03 A;  3VQ5 A;  3O4Q A;  1YXQ A;  4CFB A;  4A5B A;  1D9D A;  2HBJ A;  3H45 C;  3F2K A;  4IFE A;  3LPT A;  2F9T A;  3LZJ A;  3RMC A;  1T05 A;  3M8R A;  5ADX H;  3OBW A;  4UQG A;  3HVT A;  1SKS A;  4IDK A;  1I94 K;  1LWE A;  3NAE A;  1TL3 A;  3DOL A;  4ZTJ A;  1VHX A;  3NF7 A;  3QO9 A;  3HM9 A;  3V9Z A;  3CPE A;  3LDS A;  1TKZ A;  5M1K A;  4E7J A;  1VQ7 N;  1HQU A;  4B9L A;  3CI5 A;  1LCU A;  4DLE A;  4KHU A;  1TYQ B;  2HNZ A;  1JKH A;  3QBX A;  4FXD A;  1HNV A;  1HYZ A;  5AQT A;  1K8K B;  3VEX A;  2E6L A;  3M8P A;  5JLH A;  2I5J A;  2YNG A;  3GDQ A;  3F5T A;  3C94 A;  4I6M B;  1XMQ K;  2HHH K;  3KD1 E;  2P1J A;  5HLF A;  3RVC A;  4KB1 A;  4FWR A;  2B6A A;  1TGO A;  4Z94 A;  2NUB A;  4E0D A;  3ZSQ A;  1NOZ A;  1BDG A;  2UXB K;  2GX9 A;  3LAN A;  1WUA A;  4B3M K;  3HK2 A;  4B1W B;  4HUG A;  4RCH A;  2R7Y A;  4EP5 A;  4LFC K;  5BRE A;  2HBL A;  3VQC A;  3AO3 A;  4N76 A;  4JK7 A;  2O8D B;  3AVB A;  4YNQ A;  4EFH A;  3KHY A;  1RBS A;  2QKB A;  1N36 K;  2NRT A;  3O4N A;  3HP6 A;  4DQR A;  4KHY A;  5KGW A;  3NHG A;  2O8F B;  1BCO A;  1HKB A;  4CJS A;  1SAZ A;  2I7P A;  4B9U A;  4CHO A;  1C0G A;  2P9P B;  3KKR A;  4GMJ B;  2A6A A;  4M7X A;  4BRI A;  2GV9 A;  1QHA A;  3FZM A;  1V4S A;  1W9H A;  1KC8 O;  1JL2 A;  1NKB A;  3V4I A;  3TWH A;  4B3R K;  1JCG A;  4MDB A;  1NGE A;  4LH5 A;  1V4T A;  4W5N A;  4NCG A;  5DM6 L;  4K8Z A;  2G8U A;  1GLL O;  5GIO A;  4KV8 A;  4LF8 K;  2IC3 A;  5CYM A;  1BQM A;  1TUU A;  4BRH A;  4DUZ K;  4AHV A;  3L0Q A;  1BOT O;  1KAX A;  1UAX A;  1VQK N;  3AO2 A;  5CZ2 A;  1RT3 A;  4X65 K;  3THY A;  1RDU A;  4BR0 A;  1A5X A;  3KLF A;  4BWJ A;  3OY9 A;  3FFK B;  4DFK A;  4CJR A;  3PO4 A;  3ZSX A;  4H4M A;  4N47 A;  3KLH A;  3L4I A;  1NGC A;  1NJI O;  5AQK A;  4FK0 A;  2LSN A;  1VK0 A;  3VA0 A;  4OJR A;  4KRF A;  4LF9 K;  3DRS A;  3EL2 A;  3ZSR A;  4DQQ A;  4BRO A;  3OA9 A;  1IBL K;  3Q7C A;  4GKK K;  1NGH A;  3O9U A;  1N32 K;  2G8H A;  1XWL A;  2OYQ A;  4FJJ A;  5HRN A;  3M8S A;  2YHW A;  4FJ7 A;  5GIN A;  4BAC A;  4CHN A;  3P83 D;  2CGJ A;  2OCE A;  3K58 A;  4ID1 A;  3D2F A;  1B9D A;  4NLC A;  2Y1J A;  4ISG A;  1EQY A;  5EU7 A;  3VGM A;  1KFD A;  1NGA A;  2O4I A;  1NJW A;  1JCE A;  3NH2 A;  3KTQ A;  3OJU A;  2WC9 A;  4JI0 K;  4C1N I;  3P39 A;  4KHP K;  4OPJ A;  5AQV A;  3LL3 A;  3QET A;  4DV2 K;  4JK8 A;  3C95 A;  3PX4 A;  3E01 A;  3AO5 A;  2KZZ A;  3NVM A;  1OH6 A;  1KVA A;  4PY5 A;  1IO2 A;  1RDB A;  4OO1 J;  1NKE A;  1W97 L;  3P5J A;  3CJ9 A;  3MK6 A;  4CI6 A;  1ZBU A;  3JYT A;  4QS9 A;  3TAM A;  2O8F A;  2ZD1 A;  3ISN C;  4CJ5 A;  2FBX A;  4FM1 A;  5KI6 A;  1WSE A;  2VGM A;  4DU4 A;  3RMB A;  4JI4 K;  4WQ5 C;  5D3G A;  5J2M A;  3AVM A;  4CCH A;  4C23 A;  4LD0 A;  4J2B A;  1NGJ A;  2HVH A;  4CEO A;  4JI8 K;  3H3N O;  3Q7B A;  4JKB A;  5FPE A;  5LMU K;  4DV5 K;  3V81 A;  2WON A;  2JGU A;  4BGA A;  2IDO A;  3DI6 A;  4K42 A;  3FZF A;  1L5U A;  3LAM A;  3OYJ A;  1XMO K;  4O0J A;  1QVG M;  1HUX A;  2QWM A;  1VSH A;  3SUN A;  5AQO A;  1D8Y A;  4F2R A;  1JXB A;  3ASM A;  4GV3 A;  4F4K A;  3TAB A;  3VQA A;  4BRK A;  1RBR A;  3LM2 A;  4J2E A;  3IG1 A;  1TYQ A;  2ZGZ A;  3QEX A;  4N5S A;  3CIP A;  1E4G T;  1NKC A;  2FSK A;  4R79 A;  3BUZ B;  3LDN A;  1KD1 O;  3SBG A;  5BN8 A;  5IT9 O;  3U3Y A;  2UYT A;  2ZGY A;  1VSJ A;  2NRR A;  2W6K A;  2GTD A;  3E1Y A;  5F2R A;  4FYD A;  1KTQ A;  2NRX A;  3MEC A;  1CZ9 A;  3ZSW A;  3CQX A;  4ELV A;  4E7L A;  4IO9 L;  1IKW A;  2P9L A;  3PSI A;  4JS5 A;  2E2N A;  1XC9 A;  2DFH A;  4IDH A;  4FM2 A;  4DTJ A;  3P1G A;  3KK3 A;  2KW4 A;  3WXJ A;  3NMU A;  4BVP A;  5AQG A;  5BPM A;  3V9U A;  4LFB K;  2E88 A;  4YOU A;  1WAF A;  5BR8 K;  5C0Y A;  5MLC Q;  2PAV A;  3IS9 A;  3OS0 A;  4MQ3 A;  1BA0 A;  2YHX A;  4DV3 K;  4DFP A;  2QK9 A;  5BN9 A;  2ASO A;  4H5V A;  1RTI A;  5CYQ A;  2P9S B;  5SWM A;  3OVN A;  3L8B A;  2P9U A;  4ZHR A;  1KVB A;  1O1W A;  3CC7 N;  3RR7 A;  4FJK A;  1S1X A;  2CGK A;  3H3O B;  4JKH A;  1RBU A;  3UKU A;  2KQ2 A;  2E1Y A;  5JS2 A;  3PV8 A;  5AZI A;  4FLW A;  4NLB A;  3CJ7 A;  1VSF A;  1NM1 A;  1NWK A;  3CC2 N;  4FSV A;  5HBM A;  4DSF A;  5LL6 Z;  4O44 A;  4Z4F A;  4M3X A;  3QIC A;  4K41 A;  4FJL A;  2QW9 A;  3A8Y A;  3CCE N;  3SQ4 A;  4EHT A;  4CJ3 A;  2HHU A;  2FF3 B;  1BL3 A;  4FJ8 A;  4F3T A;  4A61 A;  5FRO A;  4JS4 A;  4CF0 A;  5LJW A;  2QWO A;  5AR0 A;  1W2B M;  4DR3 K;  1BA1 A;  2E20 A;  1LWF A;  2AP1 A;  1Q86 O;  3P38 A;  1I39 A;  4DHY A;  3ATU A;  2YJF A;  1QS4 A;  4OVL A;  2P9N B;  3R3L A;  2Q0R A;  3R1X A;  3DWL A;  3OYL A;  5C15 A;  4EIA A;  3K5M A;  1JL1 A;  1T6C A;  3MN7 A;  2RN2 A;  4DR6 K;  3NH0 A;  3QEW A;  1OVQ A;  5AQP A;  3CHW A;  4CHP A;  3WXK A;  5AQW A;  3KVG A;  3OW2 M;  3KLE A;  4BY9 C;  1YTU A;  2Q36 A;  4DMN A;  3SAF A;  4IEI A;  4DSE A;  1U48 A;  4M3T A;  2PY5 A;  3VN5 A;  3SUQ A;  3IAY A;  3WNF A;  4YOY A;  2GBZ A;  3I0R A;  4Y0W A;  4A59 A;  4CEF A;  1NJY A;  2UUB K; 
#chains in the Genus database with same CATH homology
 1RT1 A;  4AHC A;  1SKR A;  4CGH A;  3SI6 A;  2BE2 A;  2YV0 X;  3MAQ A;  3CFP A;  4O55 A;  3RR8 A;  3VQQ A;  2Z1J A;  1L3S A;  3KIO A;  4AH9 A;  1KCF A;  5KGX A;  2YNH A;  3ZSO A;  2X6N A;  1S1T A;  1S6P A;  1VSI A;  1L3T A;  1EX4 A;  4FK2 A;  4YFU A;  2Q3S A;  4DU1 A;  3HYF A;  2DTU A;  5C25 A;  4W5T A;  3AV9 A;  3AA5 X;  4Y1C A;  4HUF A;  3ZT2 A;  4DS4 A;  1X1P A;  4IG0 A;  4FJH A;  3THV A;  3OYI A;  3F9K A;  4LSL A;  3PX6 A;  4B9N A;  4DSK A;  1UA0 A;  2HHX A;  3B6O A;  1JLC A;  3V9S A;  3HT3 A;  3SQ1 A;  2OZM A;  4HUE A;  1NK5 A;  4M45 A;  5I42 A;  2G8I A;  4HVJ A;  1ZBH A;  4CFD A;  4OKK A;  4FCY A;  4KHQ A;  3K59 A;  1SUQ A;  2XHB A;  1S9G A;  1T03 A;  3TAQ A;  4DFM A;  3VQ5 A;  3O4Q A;  4CFB A;  3SNN A;  4DSJ A;  4CIE A;  2YKN A;  1QTM A;  1D9D A;  3KLG A;  3MXI A;  2OPQ A;  1UOC A;  2P5G A;  1FK9 A;  3L3U A;  1XHZ A;  2O4G A;  1W0H A;  4BE1 A;  3LPT A;  3LZJ A;  2ITG A;  3RMC A;  1T05 A;  4I2P A;  3M8R A;  3QES A;  4AHR A;  1ZYQ A;  4UQG A;  4R5P A;  3NF9 A;  1TKX A;  3HVT A;  1NJY A;  3UIQ A;  2YHA A;  1SKS A;  4OGC A;  4IDK A;  3L2Q A;  1KRP A;  1LWE A;  3NAE A;  3AVI A;  1TL3 A;  4CIG A;  3DOL A;  1NK8 A;  2YNF A;  1CXU A;  1ZBF A;  3CM5 A;  3B6P A;  4ZTJ A;  3NF7 A;  2XO7 A;  1WSF A;  1QSY A;  2OPR A;  2VG6 A;  3QO9 A;  3HM9 A;  1VRU A;  3V9Z A;  4DTN A;  5C42 A;  3LDS A;  4AIL C;  2D0C A;  1TKZ A;  3JSM A;  4E7J A;  5SZT A;  1HQU A;  3NF6 A;  4CEC A;  4B9L A;  3G0Z A;  3DM2 A;  4DLE A;  1JLE A;  3T3F A;  4KHU A;  3LPU A;  3QIP A;  4IG3 A;  3HJF A;  2HNZ A;  2G8F A;  1JKH A;  4FXD A;  4Z4E A;  1X9W A;  2VG5 A;  3ZCM A;  4CEA A;  4HHT A;  1U45 A;  3ZSV A;  1WAJ A;  1HNV A;  1HYZ A;  4OLA A;  2E6L A;  3M8P A;  2EX3 A;  4M3Y A;  2I5J A;  2YNG A;  4ELU A;  4FZX C;  3PUF A;  3L2U A;  3C94 A;  3G10 A;  3MEG A;  1S9E A;  1BGX T;  1RBV A;  3KD1 E;  2AJQ A;  2P1J A;  4CJU A;  1S1U A;  4DTR A;  5HLF A;  3LP1 A;  4KB1 A;  4CER A;  3DYA A;  4FLX A;  1NK9 A;  2B6A A;  1TGO A;  3PO5 A;  4KHS A;  2NUB A;  3DLR A;  1LV5 A;  3ZSQ A;  4E0D A;  1EET A;  4DTO A;  1NOZ A;  3RMA A;  1BQN A;  3V1Q A;  2DFE A;  3OYA A;  4CJL A;  3LAN A;  3VQ9 A;  4DSL A;  4HUG A;  3HK2 A;  3QIO A;  1VSK A;  3LAK A;  3I0S A;  4EP5 A;  5HRP A;  2R7Y A;  4DF4 A;  2HHV A;  1WSJ A;  4N76 A;  3VQC A;  3AO3 A;  4CEZ A;  3CFO A;  3D45 A;  4FLZ A;  4KI6 A;  3AVB A;  4YNQ A;  4Z4I A;  1VRT A;  2HHQ A;  4NYN A;  1RBS A;  1JLG A;  1KVC A;  2QKB A;  4RW6 A;  4F3O A;  3ZSZ A;  3O4N A;  2YNI A;  3HP6 A;  4DQR A;  2GUI A;  3KK1 A;  4CIF A;  3DLH A;  4KHY A;  5KGW A;  3NHG A;  2VG7 A;  5J1E A;  4Y1D A;  3SPZ A;  1BCO A;  1EP4 A;  3VQB A;  1ITG A;  4CGI A;  4CJS A;  3AVG A;  4RG8 A;  3QEP A;  3NGI A;  2A1S A;  1Q9Y A;  4B9S A;  3CYM A;  3VQ7 A;  1HJR A;  4CHO A;  4B9U A;  4CJW A;  4DTP A;  2HNY A;  1C6V A;  1JLA A;  3NGY A;  1SL0 A;  2A1R A;  3KKR A;  3HXM A;  2OPP A;  4GMJ B;  4B3O A;  4CJT A;  2D0A A;  3SZ2 A;  2GV9 A;  4B9V A;  2OA8 A;  1RT5 A;  3C6T A;  3EZ5 A;  4B8A B;  4QAG A;  4CF1 A;  3DRP A;  3TAP A;  3VQ8 A;  1W9H A;  3WNE A;  1S1V A;  3MXM A;  1JL2 A;  4KKO A;  1NKB A;  3V4I A;  4RW7 A;  2XY8 A;  2ZQB A;  3TWH A;  3SJJ A;  3LP2 A;  4FVM A;  1BCM A;  1U49 A;  1Q9X A;  4LSN A;  4HCB A;  1C1C A;  1EXQ A;  4LH5 A;  4W5N A;  3QLH A;  4M41 A;  4NCG A;  4IFY A;  1X9M A;  1QE1 A;  3SQ0 A;  3DLK A;  1YT3 A;  3ALY A;  4K8Z A;  1BIZ A;  2G8U A;  5I3U A;  5KRT A;  1IKY A;  4KV8 A;  3WNH A;  1A5V A;  3CQ8 A;  2F8S A;  1LAV A;  2IC3 A;  1HMV A;  5CYM A;  1BQM A;  4CK2 A;  3NGZ A;  3NH1 A;  1TK0 A;  1HQE A;  3LZI A;  4AHV A;  4C8L A;  4H8K A;  2D0B A;  2YHB A;  4ID5 A;  2BGG A;  3OYG A;  1UAX A;  3DLE A;  4I9L A;  4GVM A;  3AO2 A;  1MU2 A;  5CZ2 A;  3SCX A;  3BGR A;  1RT3 A;  1IKX A;  4C8M A;  4DQS A;  1A5X A;  3KLF A;  3DLG A;  4BWJ A;  1RTD A;  4QCL A;  3AA3 A;  3VQ4 A;  3OY9 A;  4B9M A;  4DFK A;  4DTX A;  4CED A;  1FKP A;  1RDA A;  1SKW A;  4CJR A;  3K2P A;  3CG7 A;  3L2W A;  1IH7 A;  5HRR A;  3ZSX A;  3PO4 A;  4H4M A;  5CY4 A;  4N47 A;  1BI4 A;  3KLH A;  3NCI A;  3SPY A;  2LSN A;  1VK0 A;  3VA0 A;  4OJR A;  4FK0 A;  4KRF A;  3DRS A;  3LAL A;  1J5O A;  4CJ4 A;  1DTT A;  3ZSR A;  1TAQ A;  3SV4 A;  4DQQ A;  4CGJ A;  2D5R A;  4OKE A;  4CFC A;  4CES A;  4AHT A;  1D9F A;  4O5B A;  2G8H A;  4M3R A;  2QXF A;  1XWL A;  1NK7 A;  1IG9 A;  2OYQ A;  3M8Q A;  4FJJ A;  3ZT0 A;  4FW1 A;  4O0I A;  2Z1I A;  4Q5V A;  5HRN A;  3M8S A;  4CHQ A;  3DMJ A;  4RW4 A;  4FJ7 A;  4BAC A;  4DTS A;  4CHN A;  2ZE2 A;  4BWM A;  4LH4 A;  5HP1 A;  4KHW A;  3P83 D;  1TAU A;  2Z1G A;  1B92 A;  4EZ6 A;  1UA1 A;  1VSD A;  1KLN A;  4JLH A;  3PY8 A;  3K58 A;  4ID1 A;  3AVK A;  4E89 A;  3O3G A;  2RF2 A;  1B9D A;  3RRG A;  1VSM A;  4CEE A;  1GOB A;  2Y1J A;  4DQP A;  3VQP A;  2F96 A;  4OKJ A;  1F21 A;  4AHU A;  3RMD A;  1BI4 B;  4CF8 A;  1KFS A;  2HHW A;  3U3G A;  3MXJ A;  4KTZ A;  2G8V A;  5EU7 A;  2QKK A;  3ZT4 A;  3DOK A;  4DWI A;  3QNO A;  3KK2 A;  4F8R A;  1NOY A;  3HP9 A;  1KFD A;  5FRM A;  2O4I A;  1NJW A;  3NH2 A;  1RT6 A;  3HPG A;  3KTQ A;  3OJU A;  2IAJ A;  1T8E A;  4XIU A;  1NK6 A;  4G1Q A;  2HB5 A;  1JLF A;  3TAE A;  3QNN A;  1U47 A;  1JXE A;  4GW6 A;  4W5O A;  4DU3 A;  3OYH A;  4M3W A;  4N41 A;  1RT2 A;  2XRI A;  3QIN A;  1QSS A;  3NE6 A;  3OS2 A;  4FJM A;  3HO1 A;  4OPJ A;  3QET A;  2IOC A;  1HRH A;  4PUO A;  4BE0 A;  3ITH A;  2BAN A;  1QHT A;  3C95 A;  3PX4 A;  1J53 A;  3E01 A;  4CHZ A;  3F73 A;  3V9X A;  4NCB A;  3AVC A;  3AO5 A;  2KZZ A;  2P5O A;  4FJ5 A;  3LP3 A;  3VQE A;  1TV6 A;  1KVA A;  1C0U A;  5DMR A;  3TAF A;  3HPO A;  4PY5 A;  1IO2 A;  1RDB A;  3SUP A;  1NKE A;  1RCH A;  5J2N A;  4KI4 A;  1C1A A;  3P5J A;  4J2A A;  3AVJ A;  1DLO A;  4E1M A;  1TK5 A;  3SQ2 A;  4CGG A;  1RIL A;  4H4O A;  4FK4 A;  1ZBU A;  1REV A;  3JYT A;  2HMI A;  3TAM A;  4IKF A;  4FW2 A;  4EZ9 A;  3H08 A;  2ZD1 A;  3ISN C;  1SL2 A;  4CJ5 A;  2FBX A;  3PX0 A;  3RWU A;  4JRQ A;  4ICL A;  5KI6 A;  4FM1 A;  4OLB A;  1WSE A;  1ASW A;  3V9W A;  4DU4 A;  3RMB A;  3OYE A;  4M3U A;  4CE9 A;  2YKM A;  4CK3 A;  3OS1 A;  5D3G A;  2FBT A;  3OYK A;  4DG1 A;  4FLY A;  5J2M A;  4OPK A;  1N5Y A;  3AVM A;  4CCH A;  2HVI A;  1WSH A;  1QSL A;  4BDP A;  4M42 A;  4LD0 A;  2WOM A;  3TAG A;  1WSG A;  4J2B A;  1Z25 A;  3FFI A;  4QOZ B;  2HVH A;  4CEO A;  5CZ1 A;  1RNH A;  5T7B A;  3L2R A;  2F8T A;  3V81 A;  4CF9 A;  1WN7 A;  2WON A;  2JGU A;  2OPS A;  4J2D A;  1B9F A;  1HYV A;  4BE2 A;  1HNI A;  1X9S A;  2IDO A;  3DI6 A;  3OYB A;  3ZT3 A;  2G8K A;  3HL8 A;  1SL1 A;  1L5U A;  3K5O A;  4KRE A;  3LAM A;  3OYJ A;  4CJK A;  4O0J A;  4E7I A;  4DTM A;  3SUN A;  2HND A;  1DTQ A;  1VSH A;  1D8Y A;  2X78 A;  1JXB A;  3ASM A;  3O3H A;  3QER A;  4F2R A;  4F4K A;  4I7F A;  3TAB A;  2HW3 A;  3VQA A;  1NK4 A;  1RBR A;  2G8W A;  2KFN A;  4CJQ A;  3V1O A;  4J2E A;  3IG1 A;  1S5J A;  4DTU A;  4MFB A;  4DQI A;  2KFZ A;  3QEX A;  4K8X A;  4N5S A;  3TAR A;  1GOC A;  4AHS A;  3ULD A;  4BDY A;  4F2S A;  2KZM A;  1J9A A;  1UWB A;  2E4L A;  2XY6 A;  1NKC A;  3OYM A;  4I9Q A;  1NJZ A;  4HTU A;  3OYC A;  4C8K A;  2VWJ A;  4Q0B A;  4FJG A;  3AA4 A;  1ASV A;  5C24 A;  3U3Y A;  3SUO A;  4W5Q A;  3KLI A;  1JLB A;  3DRR A;  4I2Q A;  5J2Q A;  4FJI A;  1N6Q A;  1VSJ A;  3AO1 A;  2DFF A;  3MEE A;  4E1N A;  4CJP A;  2PZS A;  4CGF A;  1U4B A;  1FKO A;  3MED A;  3OYF A;  3V6D A;  4C8O A;  4FZZ A;  4FYD A;  1KTQ A;  2X6S A;  3MEC A;  1CZ9 A;  1I3A A;  1LW0 A;  3ZSW A;  1EKE A;  3K5N A;  4ELV A;  2VWK A;  3OYD A;  4E7L A;  1IKW A;  4Z4C A;  4JS5 A;  1IKV A;  1TL1 A;  3TR8 A;  1XC9 A;  1TKD A;  2DFH A;  3S9H A;  4FM2 A;  4DTJ A;  1RDC A;  3P1G A;  1XI1 A;  2FBY A;  2KW4 A;  3KK3 A;  1T7P A;  4B9T A;  1ZBI A;  3QEI A;  1G15 A;  4ZTF A;  1TK8 A;  2BDP A;  1BHL A;  1CLQ A;  2EHG A;  5DK5 A;  1BIU A;  4CHY A;  2E6M A;  2FBV A;  3V9U A;  3AVF A;  1WAF A;  1A5W A;  3ZT1 A;  4PWD A;  2IS3 A;  5E41 A;  2W42 A;  4KO0 A;  1WLJ A;  3IS9 A;  3AA2 A;  3OS0 A;  1J54 A;  3AVA A;  4MQ3 A;  3C6U A;  1QQC A;  4DSI A;  4DFJ A;  4DFP A;  2KTQ A;  3CFR A;  4OGE A;  4CEB A;  2QK9 A;  3OYN A;  1Y97 A;  1XHX A;  3LWL A;  1RTI A;  3NBP A;  5CYQ A;  5SWM A;  3K5L A;  4JRP A;  3OVN A;  3L8B A;  4ZHR A;  3K57 A;  1KVB A;  4L8R B;  1O1W A;  3AVH A;  3RR7 A;  4KTW A;  3ZSY A;  4LY7 A;  4FJK A;  4CJF A;  3VA3 A;  1S1X A;  1TVR A;  4E19 A;  1R0A A;  2Y1I A;  3AVN A;  4KHN A;  5JS1 A;  4CJV A;  5KTQ A;  1RBU A;  3HST B;  3T19 A;  4DS5 A;  3EY1 A;  2HHT A;  1C0T A;  2KQ2 A;  5JS2 A;  4IFV A;  4CEQ A;  2IGI A;  4FLU A;  3PV8 A;  4FLW A;  4FLT A;  3AVL A;  4PA1 A;  2XY7 A;  4B8C A;  4KPY A;  2DY4 A;  2PYL A;  4M3Z A;  3VQD A;  3CM6 A;  3OJS A;  1RTH A;  1VSF A;  1RTJ A;  1WSI A;  3L2V A;  2P51 A;  4C8N A;  4IBN A;  5HBM A;  4KAZ A;  4KTQ A;  1U04 A;  3TI0 A;  4RW8 A;  3U6F A;  1RT4 A;  4FZY A;  1LW2 A;  4O4G A;  4DSF A;  3DLB A;  2OZS A;  5HRS A;  4O44 A;  5J2P A;  4E7K A;  4Z4F A;  2JLE A;  3LP0 A;  1LAW A;  2RPI A;  4M3X A;  3EYZ A;  3KJV A;  4FJL A;  4FJN A;  4PQU A;  1YVU A;  3SQ4 A;  4WE1 A;  1CXQ A;  1L3U A;  4CJ3 A;  3TAN A;  2HHU A;  1RT7 A;  4RW9 A;  5K14 A;  1BL3 A;  3HVR A;  2RKI A;  4FJX A;  4FJ8 A;  4F3T A;  5FRO A;  3QEV A;  4JS4 A;  3S3N A;  4CF0 A;  3HPH A;  4CFA A;  4CK1 A;  1S1W A;  4KB0 A;  2FC0 A;  4E7H A;  1LWF A;  3KD5 E;  2ATQ A;  1GOA A;  5FDL A;  1I39 A;  2Z1H A;  1FXX A;  4NYF A;  3VQ6 A;  1QS4 A;  4CJE A;  3S3M A;  1BIS A;  4DLG A;  1C1B A;  4OVL A;  4FM0 A;  2X74 A;  3AO4 A;  1C0M A;  3RRH A;  5FRN A;  1RDD A;  3OYL A;  3L3V A;  1LWC A;  4W5R A;  4FLV A;  1NJX A;  1CZB A;  2B5J A;  1YTA A;  4Z0U A;  5HRO A;  4FJ9 A;  3K5M A;  2PYJ A;  1D5A A;  1JL1 A;  1JLQ A;  3KKS A;  4NCA A;  1RBT A;  3IRX A;  2RN2 A;  2HHS A;  3NH0 A;  3QEW A;  3A2F A;  1VSL A;  3NFA A;  3V1R A;  4Z4H A;  4TSX A;  1NK0 A;  3BDP A;  3S3O A;  3T1A A;  1VSE A;  1KLM A;  4CHP A;  1HYS A;  3LWM A;  1S6Q A;  3O3F A;  3RTV A;  2XY5 A;  3KLE A;  1YTU A;  4Z4G A;  4HCC A;  4DMN A;  4KFB A;  4DSE A;  4N56 A;  4E3S A;  1U48 A;  4M3T A;  2PY5 A;  1WNS A;  3SV3 A;  3VN5 A;  4B08 A;  1TKT A;  1KSP A;  1HPZ A;  1Q8I A;  3I8D A;  3SUQ A;  4CGD A;  1Z26 A;  3NF8 A;  3WNF A;  3IAY A;  4CF2 A;  3NDK A;  3SYZ A;  1ASU A;  4EP4 A;  4DF8 A;  3WNG A;  1ZBL A;  1L3V A;  2GBZ A;  1SV5 A;  3I0R A;  5KRS A;  2B4J A;  4CEF A;  4BDZ A;  4ELT A;  1K6Y A;  3D0P A;  2ETJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...