4CJKA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 53
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjkA00
4PUOA 4NYNA 3L2QA 4B9SA 1IKVA 2X6NA 1WSJA 1VSMA 4CF8A 4EP5A 1JLCA 4FLZA 3AVKA 3ULDA 3KK2A 4HVJA 1IKYA 3DLKA 1RTDA 4IKFA 1EKEA 3LP3A 4F2SA 3K58A 3PX4A 3NCIA 3AO4A 5CY4A 3DLGA 4M42A 3P1GA 5J2MA 4CGFA 4CIGA 4CJ3A 1WSFA 3IS9A 1RILA 3OYKA 3EZ5A 1HNIA 4FK4A 3I8DA 3I0SA 1S9GA 2HHTA 3CYMA 4Y1CA 4CJQA 1TK5A 1L3UA 3QNOA 5E41A 3L3VA 4W5QA 4JRPA 2Z1IA 1VSFA 5KGXA 2WOMA 5HP1A 4DTRA 4OLBA 1XHXA 2E4LA 1U45A 3T1AA 3V81A 4CJPA 3L2RA 4Z4HA 1T7PA 4E89A 4BACA 3ZSVA 4CIFA 1B92A 3SV3A 3MEGA 2PYLA 4XIUA 3O4NA 5SWMA 3K59A 3L8BA 2OYQA 4F8RA 1ZBHA 3KKRA 5D3GA 4DTNA 4CK2A 3VQDA 2HHWA 1RDBA 4Z4CA 4E7HA 5HRPA 1FKPA 2W42A 2WONA 3RTVA 3SJJA 3RRHA 4LSNA 1B9FA 1EETA 2X78A 3HL8A 1BISA 2RF2A 3QINA 1N5YA 1W0HA 4H4OA 4CEBA 1RT7A 4FW1A 4O4GA 4CF2A 3K5OA 3AA4A 2KFZA 3NF9A 3ZT4A 4JS5A 3JSMA 1S1UA 1KLMA 2XY8A 1X9SA 1JLBA 4N56A 5KI6A 3VQEA 1QE1A 3OYBA 2NUBA 1UA1A 4BWJA 3TAQA 1FKOA 5J2PA 4E19A 4CJLA 3KLHA 3RMCA 4BDPA 2DFEA 5KGWA 1ASUA 2HNYA 1ASVA 2AJQA 1L3SA 4FLVA 2X6SA 4M3RA 3QESA 4KB1A 1VSJA 2YNFA 3AVHA 1RBSA 4H4MA 4WE1A 2OZSA 4DLGA 4IDKA 4H8KA 2PY5A 4AHTA 3KD5E 2FBTA 2QKKA 3HPGA 4KI4A 3QEPA 4JS4A 1C1BA 3NF8A 4OPKA 3CFPA 4KPYA 4YFUA 4OJRA 1IO2A 3IG1A 4CE9A 3H08A 3LAKA 3ZT1A 4CECA 3NH0A 4KHQA 1VK0A 4PQUA 1BL3A 1WN7A 3A2FA 3AO5A 3LWLA 3QNNA 2B5JA 3SI6A 3WNHA 4FK0A 2D0CA 2HHQA 2RPIA 1HPZA 3IRXA 3DI6A 3LDSA 1BCOA 4HCBA 4B9UA 3DLRA 5HBMA 3OVNA 1UOCA 3G0ZA 4CK1A 4CF9A 4CIEA 4N5SA 1ITGA 4CJVA 1SKSA 3NFAA 4IBNA 3S3MA 4OKEA 1W9HA 3OS2A 4J2EA 3SYZA 3HSTB 4IFVA 4FJIA 4KHWA 1J54A 4Q0BA 3KKSA 1CLQA 1QS4A 3LP1A 2KW4A 2GBZA 2DTUA 3LANA 4CFCA 4CJEA 3OYNA 1TAQA 3NDKA 3U6FA 5FRMA 2QXFA 4E7IA 1QSSA 3L2WA 3NHGA 1UA0A 3OY9A 1RT5A 4FVMA 3K57A 3OJSA 1RTIA 5C24A 5K14A 4DSIA 3MXIA 4FJXA 3AA5X 4DFJA 2XY5A 4AH9A 4OPJA 3MXJA 3QEWA 2BE2A 2G8VA 2HVIA 1CZ9A 4IFYA 1REVA 3O3FA 1JL2A 3KLGA 1RT2A 4CGGA 2ITGA 1KRPA 3RR7A 1JLGA 2ATQA 3ZT0A 4FJKA 3LALA 1NJXA 4FJ8A 2OA8A 1VSKA 3OYHA 4Z0UA 3D0PA 4KHUA 3VQ4A 4FJHA 3CM5A 1BIUA 5FDLA 4CHQA 3KLEA 3NBPA 3OYJA 4LH4A 1HMVA 4EP4A 1DTTA 4DTOA 4MQ3A 4O0JA 3NGYA 1YTAA 4DU1A 3UIQA 2QK9A 3CM6A 1S1VA 4ICLA 3ZSRA 1L5UA 1SL0A 1LWCA 4O55A 4C8LA 1SL1A 1BQMA 4PWDA 4FJJA 4HHTA 3PV8A 2Q3SA 3VN5A 2A1SA 2GV9A 1TKDA 2KZZA 3TABA 3TR8A 4AHUA 1QHTA 3C6UA 1XWLA 2VWKA 4DSJA 1VSEA 4M3WA 3HXMA 3S3NA 4J2AA 3NF6A 1ZBFA 5J2NA 2QKBA 2RKIA 2ZE2A 2HW3A 1LAVA 2A1RA 5CZ1A 4C8NA 3DOLA 4ZHRA 1GOCA 3VA3A 4OKKA 3V9WA 3QO9A 3C6TA 1TKXA 4CGIA 4HUFA 5J1EA 4OGEA 4CEAA 3ASMA 1BQNA 3AA2A 4CEQA 2D5RA 2F96A 4Z4GA 1LV5A 2G8UA 4CHNA 1WSGA 1HYZA 1RT4A 1C6VA 3AVJA 2HB5A 3BDPA 4Q5VA 1WLJA 4DQPA 3LZJA 1IKXA 1I39A 1S5JA 1IKWA 3QEVA 1KLNA 2YNIA 4DQSA 3HVRA 2YHAA 1NOYA 4E1MA 2G8HA 4NCBA 1HQEA 4ID5A 2DFFA 4CERA 1CXUA 1LWEA 4KREA 3VQQA 3MXMA 4J2DA 3RMBA 3QIPA 2R7YA 4N76A 3TWHA 3SQ0A 4CJUA 3AA3A 4QCLA 1YVUA 2Z1GA 3AVLA 1EP4A 4KTWA 4CJWA 4AILC 3THVA 2I5JA 3OYMA 2D0BA 3HYFA 3NH1A 5J2QA 2XY6A 1U47A 2PZSA 3HM9A 4AHCA 1BGXT 3QIOA 3DOKA 1S1WA 4AHSA 3RWUA 4KI6A 4M3XA 1BI4B 4DF8A 4HUEA 3FFIA 3TAGA 1J5OA 4FJ9A 2HVHA 2OZMA 4N47A 1TAUA 1C0MA 2YV0X 2HNDA 3VQBA 2X74A 4BE2A 1RTHA 4E3SA 3V9XA 2BGGA 1GOAA 2VG6A 4I9LA 1RT3A 3QLHA 4BDZA 4C8MA 2Y1JA 2HHSA 4LD0A 3P5JA 4KTZA 1QTMA 1UAXA 2F8SA 1VSDA 4FXDA 5FROA 3TAEA 5I42A 3RRGA 3NGIA 1Q9XA 4N41A 3OYFA 3KIOA 3NAEA 1RDAA 4B3OA 3QERA 1MU2A 3AVCA 1RBRA 4FZZA 4Z4EA 3OS1A 1GOBA 2BANA 3SPZA 3PO5A 1LAWA 4CEOA 4DTPA 5KRSA 5I3UA 3OYLA 3VQ5A 4CJFA 4CHPA 4DLEA 2YKMA 2P1JA 4M41A 1HRHA 3VQ8A 4FLUA 1NK8A 1ZBIA 4CGJA 4FJMA 3AVMA 1TVRA 4RW4A 3DLHA 4Z4IA 5CYQA 3SUOA 1KTQA 4DS5A 4CK3A 1C0UA 1TL1A 4DTMA 1X9MA 2P5OA 4B9VA 3IAYA 5JS2A 3AVGA 3CFRA 2KQ2A 4FM1A 1JKHA 1VRTA 2P51A 1NJYA 4KAZA 2IDOA 3EYZA 3WNGA 3ISNC 3DLBA 4F2RA 4FJLA 3LP0A 1HYSA 3K2PA 3LAMA 4RW9A 1Z25A 1TV6A 4FLXA 1NK9A 2E6MA 4FK2A 4Z4FA 4RG8A 2VG5A 2VWJA 4M3UA 2ETJA 1NKCA 3ZT2A 3KLIA 2O4GA 3KK3A 4BE0A 5FRNA 1C1CA 3SUQA 5DK5A 1Q9YA 1K6YA 2G8FA 4W5NA 1FK9A 3T19A 4FLTA 4ZTJA 4C8OA 2LSNA 3AO3A 3LP2A 4RW8A 5CZ2A 4CEDA 4HUGA 1WSIA 4CGHA 4M3TA 5EU7A 4FCYA 1TKTA 3DLEA 1A5WA 1NK0A 1IH7A 2HHUA 4FJ5A 1RDDA 1TL3A 3T3FA 1FXXA 1KSPA 1LW2A 1X1PA 5HRNA 1TK0A 1D5AA 5SZTA 3TAFA 1QSYA 4O0IA 3HT3A 4DTJA 1KFSA 3S3OA 2YNHA 1WSEA 1RBTA 2FC0A 4CJ4A 3SQ1A 3MECA 4CF1A 3U3YA 5KTQA 1T8EA 4KHSA 2E6LA 3E01A 3LPTA 1TKZA 4M45A 1KVCA 3HP9A 1S6PA 4QOZB 1NK5A 4KB0A 1T03A 1WSHA 4PY5A 1HNVA 3VQ6A 4DG1A 1S9EA 3NGZA 4KFBA 4W5RA 4DFMA 4CFDA 3TI0A 2G8KA 4OLAA 3C94A 1HQUA 2Z1HA 4W5OA 2Z1JA 3BGRA 4CJTA 4KHNA 1UWBA 4B8CA 2YHBA 3VQCA 3AVAA 4CCHA 3I0RA 1RT1A 2DFHA 2XO7A 1D8YA 4FJGA 4NCGA 4DS4A 1RCHA 3F9KA 4JRQA 4Y1DA 2IOCA 4I7FA 4IG3A 1JL1A 1LW0A 1QQCA 3AO1A 3OS0A 4BDYA 4FM2A 3RMAA 4GMJB 3B6PA 3LPUA 5JS1A 3PX6A 4M3YA 1HJRA 1EXQA 3HPHA 4LH5A 1WAJA 3ALYA 1XI1A 4DSEA 2VG7A 1RNHA 1BCMA 3KLFA 2XY7A 3QETA 1WNSA 3MEEA 2IAJA 4DWIA 2KFNA 1BI4A 3ZSOA 4FW2A 1J53A 4KTQA 3V9ZA 3KK1A 1JLFA 3VQ7A 4EZ6A 3M8PA 2ZD1A 1G15A 1I3AA 1JXBA 3DRRA 3AV9A 3DRPA 3WNFA 4CHOA 3K5NA 3SUNA 2IC3A 3O3GA 3WNEA 2JGUA 4KV8A 1D9DA 4FLWA 3DRSA 3AO2A 3OYDA 1Z26A 2EHGA 2OPQA 3V9UA 4DF4A 2P5GA 1BIZA 2PYJA 2F8TA 3NE6A 4GW6A 4AHVA 1B9DA 1KCFA 4RW7A 3JYTA 3KD1E 2HHXA 3ZT3A 1KVBA 4E0DA 1VSLA 1VSHA 4I2PA 4BE1A 3ZCMA 1KFDA 3M8QA 3HP6A 5HROA 4R5PA 3TANA 3ZSYA 2EX3A 1T05A 3NF7A 4KHYA 3M8RA 3DYAA 4NCAA 4CHZA 3V4IA 2O4IA 5T7BA 3HPOA 4DQRA 4FLYA 3KJVA 1QSLA 3MAQA 4DSLA 3OJUA 4G1QA 1C1AA 2D0AA 3LZIA 3CQ8A 1RBUA 5HRRA 3KTQA 3SQ2A 3V6DA 3VA0A 3CFOA 1SKRA 1ZYQA 1U4BA 3EY1A 3TARA 3HK2A 3ZSZA 4CJSA 2RN2A 2JLEA 1A5XA 3ZSWA 4DU4A 4RW6A 1KVAA 4E7KA 4FZYA 4LY7A 4MFBA 4OKJA 1NKBA 3V1RA 2G8IA 2GUIA 3B6OA 4E1NA 3V1QA 1VSIA 3U3GA 3L2VA 1L3TA 5HLFA 4OGCA 1S6QA 2BDPA 4B8AB 2B6AA 4QAGA 3LWMA 1U48A 4E7JA 3L3UA 1C0TA 3TAMA 1YTUA 4B9NA 4ID1A 4C8KA 3SQ4A 2XRIA 3O4QA 3CG7A 1NK7A 4CEFA 1XC9A 1TK8A 2HHVA 4CEZA 4DTXA 4M3ZA 4YNQA 4CFAA 2FBVA 5DMRA 1JLQA 3VQ9A 3OYIA 3QEIA 3QEXA 4FJNA 1L3VA 3HO1A 3G10A 1DLOA 1ZBUA 3D45A 3TAPA 5KRTA 3MEDA 1DTQA 4DSKA 4DMNA 3RR8A 1XHZA 4HTUA 4PA1A 2YNGA 1EX4A 1U04A 3DMJA 2DY4A 3ZSQA 4DFKA 3OYGA 1WAFA 4I9QA 3L2UA 1Q8IA 4O5BA 4B9TA 4CJRA 3SV4A 4LSLA 3K5LA 4TSXA 4F3OA 2XHBA 1RTJA 3K5MA 4CJ5A 5HRSA 4OVLA 4B08A 4FM0A 2HNZA 1S1TA 4ELUA 3PX0A 4J2BA 4KO0A 4I2QA 4DQQA 4DQIA 4CESA 4B9LA 2OPSA 3C95A 1JXEA 4NYFA 4W5TA 1JLAA 2ZQBA 3P83D 4KKOA 2Y1IA 2IS3A 3AVNA 3SZ2A 3V9SA 4FJ7A 3SUPA 4EZ9A 4DU3A 1NJWA 4K8ZA 4DTSA 4CGDA 2OPRA 3NH2A 3SNNA 4CFBA 4DFPA 1SKWA 2FBYA 3M8SA 3OYEA 1SL2A 1NOZA 3DM2A 4BWMA 4CJKA 4B9MA 3HJFA 4UQGA 1CXQA 1SUQA 4F3TA 3O3HA 1N6QA 1YT3A 1X9WA 4FYDA 4ZTFA 1U49A 1RBVA 5C42A 3S9HA 3SPYA 1R0AA 4O44A 1F21A 4L8RB 4DSFA 3VQAA 3F73A 2G8WA 4DTUA 4IG0A 3AVBA 3VQPA 4ELTA 1JLEA 3AVIA 3ITHA 1NK6A 2B4JA 4CEEA 4CHYA 1TGOA 1RT6A 1SV5A 1Y97A 1D9FA 5C25A 1CZBA 3PUFA 4JLHA 1RDCA 3HVTA 3ZSXA 1NKEA 2KTQA 4GVMA 1A5VA 2OPPA 1NK4A 1BHLA 1ZBLA 4FZXC 4K8XA 4ELVA 4F4KA 3PY8A 3PO4A 2YKNA 1VRUA 3V1OA 3RMDA 1IG9A 3SCXA 2IGIA 2FBXA 5CYMA 2KZMA 1NJZA 1ASWA 3OYCA 4E7LA 4CF0A 2HMIA 1J9AA 1HYVA 1LWFA 1O1WA 1S1XA 4KRFA 4AHRA 3AVFA 4HCCA 3OYAA
chains in the Genus database with same CATH superfamily
3L2QA 4B9SA 2X6NA 1WSJA 3KWIA 3CJ9A 4F2SA 3JXUA 3QFUA 5CY4A 4IDHA 4M42A 4RTFD 4H5TA 4CGFA 4CJ3A 3OYKA 3EZ5A 1HNIA 2PFUA 4CJQA 1TK5A 3QNOA 5E41A 4WFBL 3L3VA 2WOMA 3VPZA 5HP1A 4DTRA 1XHXA 1P8ZA 1U45A 3CCLN 1N33K 2RHKA 5AZJA 1IBMK 4YDUC 4CIFA 3MEGA 2PYLA 4BG9A 4F8RA 2RE2A 3ENOA 4YOYA 1RDBA 1WBDA 3RSEA 4QS8A 2WONA 4FOEA 4BY9C 3A0IX 1BG3A 1B9FA 3N4PA 4H4OA 1RT7A 4FW1A 4O4GA 3VTIA 4YDUA 4JKAA 4BRPA 4JS5A 1S1UA 4DR5K 5KI6A 3VQEA 1QE1A 4MLHA 3O80A 4BDPA 2DFEA 3I55N 1ASUA 1BO5O 2AJQA 1L3SA 5HOOA 3QESA 2HF3A 4DLGA 4JS4A 2GUPA 2IVOA 4OJRA 5JVGL 4CECA 3AO5A 3A2FA 3LWLA 2VGMA 2D0CA 2RPIA 1HPZA 1BCOA 1O13A 1UOCA 2ASMA 2Q1NA 4N5SA 3CF5L 3THXA 3UKRB 1KC8O 3MMVA 3OS2A 4J2EA 1ZC6A 3HSTB 4Q0BA 1QS4A 4XH5A 2GBZA 4CFCA 1NGAA 5FRMA 4NXMK 2P9PA 5EX5A 4E7IA 1QSSA 3L2WA 4FVMA 4QS7A 3MXIA 4A59A 4AH9A 1KRPA 1JLGA 2ATQA 3ZT0A 4FJKA 3FLCO 1NJXA 1VQ7N 4C1NI 4FJ8A 3OYHA 4Z0UA 4BR9A 1BIUA 4CHQA 3EN9A 3KLEA 1HMVA 2V7ZA 1Z05A 2QWLA 4YOTA 4JKGB 4DU1A 3HBTA 3CM6A 1OH6A 1SL0A 1BQMA 4HHTA 2Q3SA 2KZZA 1XMOK 3TABA 4JI8K 2VWKA 1VQ6N 3HXMA 3L6QA 3NF6A 1ZBFA 4H5VA 5J2NA 2ZE2A 2HW3A 4ZHRA 3VA3A 1GOCA 4BRMA 3PIPL 3V9WA 1GLBG 4CGIA 4HUFA 3BY5A 3E9PA 3ASMA 4LFBK 2D5RA 2F96A 2G8UA 4Z94A 3AVJA 4H5NA 4LFAK 4JKFA 4XEIA 4B1VA 4DQSA 2YHAA 1ZXOA 4E1MA 1NOYA 3VF4A 3H1QA 2DFFA 4ID5A 1CXUA 2IVPA 2GX9A 3HSCA 3QIPA 4B1WB 3SQ0A 1YVUA 4CI6A 3U9DA 1WOQA 4FL9A 4KI6A 3TAGA 1NGIA 3MN9A 1J5OA 2OZMA 1KQSM 1RTHA 1KXPA 2E5LK 1Q82O 4K41A 4I9LA 4A5AA 4BDZA 2UXBK 4MO4A 1JJ2M 1T44A 2QWPA 2F7TA 3EKUA 4LF6K 4FXDA 5FROA 3RRGA 4N41A 3KIOA 1MU2A 3AVCA 4JN4A 3OS1A 2O8BB 5KRSA 4CVNE 5I3UA 3OYLA 4CJFA 5AZJB 1ZBIA 4A2AA 1HRHA 4WQ4C 4CGJA 3WQUA 3P38A 1DT9A 3CHWA 3THYB 4DS5A 4DTMA 2P5OA 3IAYA 1TL1A 2KQ2A 3OTOK 1JKHA 2P51A 2IDOA 4FJLA 4F2RA 3LP0A 3K2PA 3LAMA 4FLXA 2E6MA 2VG5A 5JLFA 1NGEA 5FPNA 3ZT2A 3KLIA 2E88A 3VEZA 1Q9YA 4W5NA 4WQ4A 1N32K 3D2FB 3DXMB 5CZ2A 3AAQA 1TKTA 4FJ5A 3S41A 1KSPA 1LW2A 5HRNA 1QSYA 3CC2N 1WSEA 2FC0A 4KH5A 2E8AA 4BC5A 2E6LA 5BPLA 3HP9A 2QA4N 1NK5A 4MO5A 3VMFB 4DG1A 4BVOA 4W5RA 1HQUA 4W5OA 1UWBA 4MDAA 3SAFA 3VQCA 3AVAA 1RT1A 2KKZA 4NCGA 4BGBA 1RDUA 4JRQA 3ULEB 3AO1A 1E4GT 1LW0A 1QQCA 2NRXA 4YY3K 2P9SA 4BDYA 4FM2A 3RMAA 3B6PA 5JS1A 3PX6A 1Z6RA 3MK6A 4M7XA 1WAJA 1BCMA 3D2EA 2XY7A 2ZF5O 3ZSOA 1JCEA 1HX1A 3THWA 3VQ7A 4JI4K 5AQSA 1G15A 1I3AA 5BPMA 1JXBA 3AV9A 3DRPA 4PKGA 3Q7CA 5AQPA 3WXIA 4FLWA 1KD1O 3V9UA 3L4QA 2GELA 2F8TA 2YCHA 4ISEA 1B9DA 5KQ8A 4LFCK 4E0DA 1VSLA 1VQ5N 4BE1A 3M8QA 4CZIA 3HP6A 4M7YA 3VGMA 1T05A 4KHYA 3DYAA 3HPOA 3TSUA 3MAQA 3ZETA 4JI2K 3L0QA 1RBUA 4CZLA 5HRRA 3SQ2A 3J7AP 3LDLA 3CJAA 3VA0A 1SKRA 4PL7A 1U4BA 3GDQA 3EY1A 3TARA 3HK2A 3OHRA 3ZSWA 4DU4A 4RW6A 1Q18A 4FZYA 4GVEA 3V1RA 2G8IA 3ZEUB 5ADXA 3G4SN 1LOTB 3U3GA 2I7PA 4B8AB 4QAGA 4U7BA 3LWMA 1U48A 1I94K 4DV5K 3T7ZA 3WXKA 1C0TA 1TK8A 3CG7A 1NK7A 2HHVA 5AZIA 4ISGA 5CR4A 5DMRA 3OYIA 4GNIA 1IV0A 1QZ6A 4CBUA 3D45A 3TAPA 3JS6A 4K0KK 1BWFO 4O8UA 1BUPA 3LM9A 5FPDA 2WC9A 2FSNA 3EZWA 1ESVA 4FWKA 4I6MA 4B9TA 2P9LA 4LSLA 3K5MA 4B08A 3J81O 4ELUA 2HBJA 3HOTA 2VCPA 4FWMA 4J2BA 4I2QA 3MX2A 4CESA 5I9EB 4LF4K 3O1WA 3C95A 4CZHA 3AVNA 3SZ2A 3FE1A 4EZ9A 5AQYA 4DU3A 4DTSA 3SNNA 5H1SQ 5DM7L 2O8CA 1FW6A 4B9MA 4CJKA 4BRGA 1SUQA 5C42A 4O44A 3C6HA 2G8WA 2BH1A 3ZX2A 4CEEA 1Y97A 1D9FA 5C25A 3ZSXA 1RDCA 4GVMA 1A5VA 2OPPA 2NRHA 5LL6Z 1IG9A 4LF8K 2A40A 4FWRA 1NJZA 2CH5A 2HMIA 1N8RO 4RWTA 1J9AA 1HYVA 1S1XA 4BRKA 4GKKK 2JWLA 2O8DA 1V4TA 1IKVA 1VSMA 4FLZA 4B3MK 4HVJA 1IKYA 1RFQA 3TTFA 1RTDA 4IKFA 3LP3A 1MDUB 3PX4A 3P1GA 2WTUA 5J2MA 4H03B 3I8DA 3I0SA 1VQPN 1Q81O 3Q7BA 3D7EO 1L3UA 4W5QA 1VQLN 4BREA 4OLBA 5LY3A 4FWLA 3ID6A 2V51B 4E89A 5M1FA 3ZSVA 4DR4K 1B92A 3KZBA 3O4NA 5SWMA 3L8BA 4DTNA 4YOWA 4Z4CA 1XQSC 4E7HA 2JWKA 5HRPA 2W6LA 3CCEN 3SJJA 2Q97A 2IVNA 1EETA 2X78A 3HL8A 1BISA 2DPNA 4FWPA 2AP1A 5ADXH 4IFEA 5LJVA 4JI7K 4FWQA 3K5OA 3N4QA 3AA4A 2KFZA 2BUPA 1GLFO 3O6WA 3JSMA 3J7ZO 2XY8A 1JLBA 3OYBA 1J5EK 2NUBA 2O8EA 3TTDA 4CW7B 1IG8A 3KLHA 1BU6O 4JKHA 5KGWA 3ENBA 4X66K 2HNYA 4JHDA 3ZX3A 4BQLA 4BVPA 5IWAK 2X6SA 5AQHA 2F9TA 4KB1A 2UUBK 1VSJA 1RBSA 4H4MA 2OZSA 4IDKA 2PY5A 4AHTA 1OH7A 3KD5E 2FBTA 2IIRA 1C1BA 1HKGA 4OPKA 2WUSA 4KPYA 4CJ7A 3T1YK 3BZKA 1IO2A 3IG1A 4CE9A 1W2BM 3MN7A 2PAVA 4EAHD 4KHQA 1BL3A 1WN7A 2B5JA 3WNHA 3FZMA 4FK0A 1NWKA 4BRIA 3DLRA 5HBMA 4H0XB 5IT9O 2QM1A 1ITGA 4CJVA 3NFAA 4JI5K 3S3MA 1W9HA 1IBKK 4B1ZA 3SYZA 4IFVA 4KHWA 1J54A 4ILGB 1E4FT 3TSQA 1CLQA 1G99A 2KW4A 3KHYA 3MCAB 3NVMA 2DTUA 4CJEA 3OYNA 3WT0A 5F2RA 2QWMA 3NHGA 1RT5A 3K57A 2E2PA 3OJSA 1RTIA 5C24A 3CMEN 4DSIA 2QWRA 4FJXA 4OPJA 3MXJA 2BE2A 4IFYA 3DLLL 1NLVA 3NMUA 5AQKA 3RR7A 2ITGA 3D0PA 4DUYK 4GKJK 3CM5A 4H0OA 4BQZA 2ASPA 1S1VA 1LWCA 4O55A 5AQRA 3CCJN 2GV9A 3A8YA 4G9ZA 4CZEA 4AHUA 3C6UA 1QVFM 1K73O 4M3WA 3B8AX 3S3NA 2QKBA 2QEXN 2RKIA 3P39A 3AARA 2ZJPL 3HM8A 3IKMA 2A1RA 4CD3A 1OH5A 4IO9L 4OKKA 5J1EA 4OGEA 1KAXA 4WF9L 3AA2A 4CEQA 4Z4GA 1LV5A 2O8CB 1XC3A 3BDPA 4C23A 4Q5VA 1YUWA 1I39A 1S5JA 1IKWA 3MN5A 3VENA 1YI2N 2G8HA 4NCBA 3HJFA 1HQEA 1LWEA 3WUHA 3MXMA 4J2DA 4V19S 3RMBA 1E3MA 1K8KB 4N76A 3TWHA 4CJUA 4PKIA 2Z1GA 1EP4A 2UYTA 3OYMA 1NGCA 2D0BA 3H3NO 3T1HK 4AHCA 3QIOA 4BRDA 3RWUA 4AHSA 4M3XA 5MLCQ 3FFIA 4C1NK 2HVHA 2O8DB 4N47A 1TAUA 2YV0X 5GIOA 4BE2A 1BA0A 4EFHA 2Y1JA 4C8MA 4GV6A 5AQTA 5TKWA 4KTZA 1UAXA 3CMAN 2VYPA 5I42A 3NGIA 3NAEA 1RDAA 1MWMA 3QERA 1XNQK 1RBRA 1C0FA 3SPZA 1VQ8N 3OBWA 5AQIA 1LAWA 2NRZA 2UXDK 4DTPA 3LL3A 4CHPA 1XMQK 4FLUA 1NK8A 4AM6A 5BREA 4FJMA 5AQGA 3DLHA 3UE5A 1KTQA 5GAEP 1C0UA 3CFRA 3FZKA 4DR1K 1VRTA 4KAZA 3ATVA 4BRHA 3EYZA 3WNGA 3DLBA 4BC2A 2VWJA 2ETJA 1NKCA 1GLEG 3KK3A 4BE0A 2E1YA 4DB3A 5FRNA 2G8FA 1K6YA 3T19A 1YIJN 2LSNA 3C7NB 4HUGA 4LF7K 1EWRA 1WSIA 2CGKA 1NNEA 1A5WA 1IH7A 4JHDB 1D5AA 4K43A 3TAFA 2UUCK 4O0IA 4DTJA 3S3OA 1RBTA 3PSFA 3ZX0A 3CCMN 4CF1A 3U3YA 5KTQA 3M3ZA 3E01A 2HF4A 1KVCA 1RDWX 4KB0A 2HOEA 1WSHA 1YJWN 3ATUA 4PY5A 3KK7A 3NGZA 4KFBA 4DFMA 4IEEA 1H1VA 5EOYA 2YHBA 3I33A 2HBMA 2DFHA 4FJGA 1ILYA 3F9KA 2IOCA 4IG3A 1OVQA 1S3XA 5AQVA 3OS0A 3CJ1A 4L3QA 4LH5A 4A61A 3EEQA 3PSIA 4DSEA 5AQUA 1RNHA 3QETA 3MEEA 1TYQA 2IAJA 4DWIA 2KFNA 1BI4A 4JI6K 4FW2A 2QTDA 3V9ZA 2A3ZA 2ZD1A 2P9IB 3DRRA 5LJWA 4CBXA 3K5NA 3SUNA 3DRSA 3AO2A 3IFRA 1NGGA 2A5XA 1MA9B 5AFUH 2YJFA 3CPEA 3KD1E 4RW7A 5TKYA 3JYTA 2HHXA 1EWQA 4JI3K 4DKWA 3WEEA 4FWOA 4JKBA 4RCHA 1VQ4N 2EX3A 3GBTA 4CHZA 3VERA 5KPTA 3V4IA 3CCUN 2CGJA 3KJVA 1HJOA 3LZIA 4BRFA 5M1QA 4K25A 4NB4A 3CFOA 4YOUA 1HLUA 4JD2A 1IBLK 1DGKN 2RN2A 2JLEA 1KVAA 3LM2A 3C0BA 4LY7A 4KH4A 4B1UB 4OKJA 4J8FA 3HZ6A 4CZFA 1SAZA 1K9MO 3L2VA 5HLFA 1EO1A 4JK7A 2FF6A 2B6AA 3FZHA 5AQQA 5AQXA 5GADP 3L3UA 3H46O 1YTUA 4B9NA 3RSEB 2Q2RA 4C8KA 3SQ4A 2HHWA 4M3ZA 4DTXA 3WXLA 1K8AO 2E20A 3QEXA 1X9JA 4JEPA 4IOCL 1L3VA 3G10A 5KPZA 1DLOA 2P9NA 5GINA 3SBGA 3MEDA 1DTQA 3DXKA 4A5BA 2YNGA 3HI0A 3DMJA 2OTJN 4B3RK 1WAFA 3O8MA 4O5BA 2Q0UA 4OVLA 1WBBA 2HNZA 1S1TA 1VAZA 4KO0A 3GE1A 5C15A 1JXEA 2Y1IA 2HSTA 2IS3A 3K9KA 3V9SA 4BGAA 3SUPA 4FJ7A 4DV0K 4K8ZA 3LDPA 2OPRA 3NH2A 1YAGA 4EHTA 4EIAA 3P31A 3R6MA 4MDBA 3M8SA 3DM2A 4FYDA 4BR4A 3S9HA 1SZ2A 4DSFA 3A5MC 3VQAA 3F73A 4NXNK 3VQPA 3AVIA 4BR5A 5EVZA 1RGIA 4CHYA 1TGOA 4WQ5C 1SV5A 3THXB 3CQXA 3CQYA 2KTQA 4K8XA 1BHLA 3H3OB 3LDQA 3H6EA 4F9OA 3SCXA 2IGIA 2FBXA 2P9PB 1GLJO 2KZMA 4CF0A 5BR8K 5A2QO 3AVKA 3KK2A 3DLKA 1EKEA 4WQ5A 3AO4A 1BOTO 2QI2A 3DLGA 2BTFA 3CCSN 1WSFA 1RILA 3VF2A 2E2QA 1S9GA 4DV3K 4Y1CA 5AQNA 1QHAA 3F5TA 4BR2A 2E4LA 3T1AA 4CJPA 2Q36A 1QVGM 1GLCG 3QBXA 4XIUA 1VQNN 1ZBHA 3KKRA 5D3GA 3MN6A 4CK2A 3O08A 3UKUA 1U2VA 2PBDA 1CZAN 5AQZA 3IDHA 1VQMN 4B3SK 3RRHA 3QB0A 4LSNA 3CETA 4IJNA 2RF2A 1N5YA 1W0HA 3H1VX 1OKJA 3ZT4A 1X9SA 4DV6K 3VGKA 2E2OA 4BWJA 3TAQA 1FKOA 5J2PA 3SMPA 3T69A 4E19A 4DQ8A 5C2DA 2V52B 4PKHA 1W97L 4M3RA 1NMNA 3AVHA 3WEEB 4IOAL 4H8KA 4BR0A 4LF5K 2QKKA 3HPGA 5BRDA 3IUCA 3NF8A 5LMNK 4CZMA 2OCEA 4NLCA 3H08A 3LAKA 3NH0A 4DR6K 2W6KA 3QNNA 3SI6A 4QS9A 3IRXA 3DI6A 3LDSA 3H45C 3G0ZA 3U4LA 5FPMA 4CIEA 2NRWA 3PLAA 3BEXA 1ATRA 4IBNA 4OKEA 3L4IA 3SAGA 5JLHA 3VEOA 5M1KA 3O9RA 3KKSA 5AQMA 3NDKA 4DV2K 3U6FA 1YITN 2QXFA 2VGNA 1UA0A 5K14A 4DFJA 3A5LC 4IWVA 1REVA 3O3FA 1JL2A 4HWIA 4DHYA 4GV3A 1T6DA 3LALA 5FLXO 2OA8A 3E9LA 3O9SA 3VQ4A 4FJHA 4JKEA 5M1PA 5DM6L 3TTCA 4EP4A 1DTTA 3QICA 4MQ3A 4DTOA 3NGYA 1YTAA 1EQYA 4FPBA 1SL1A 4PWDA 4FJJA 2HMPA 2A1SA 3E1YA 3TSPA 3TR8A 4DSJA 1QHTA 4A62A 1XWLA 4WFNL 4J2AA 4XH4A 5CZ1A 5EY4A 3DOLA 1VQON 3C6TA 1TKXA 1Q7YO 3A5NC 2NRRA 3VEYA 2O8FA 4KH6A 1WSGA 5AQOA 4DQPA 3LZJA 4IJAA 1KLNA 2YNIA 4CERA 2ITMA 3D6RA 2P9SB 2R7YA 5CE3A 4BR7A 3AA3A 3UB5A 3AVLA 4QCLA 3THVA 4AILC 4CJWA 4YOVA 5M1OA 3HYFA 2XY6A 5BPNA 1U47A 3D2EB 1D4XA 2PZSA 3DOKA 1S1WA 4DF8A 3THWB 1XNRK 1C0MA 2D0PA 3VQBA 2X74A 1R59O 4YHHK 1RT3A 3QLHA 2HHSA 5C2FA 5C12A 1T3VA 3QBWA 3TAEA 2AA4A 1Q9XA 1QZ5A 3OYFA 3IMXA 4FZZA 4Z4EA 1GOBA 3U9ZA 3PO5A 3C6AA 4CEOA 4M63C 3UKRA 3GOIA 3AGRA 3VQ5A 2FSKA 2YKMA 2P1JA 2HHHK 3ZETB 4RW4A 3EE9A 3UKUB 1X9MA 1IJJA 1U2VB 2KHOA 2HBLA 4H0PA 4H0TB 3AVGA 1JCGA 3CCVN 4FM1A 4GV9A 2QXLA 3ISNC 4RW9A 1Z25A 1TV6A 1NK9A 4RG8A 4M3UA 2ZM6K 1N36K 2YHWA 2O4GA 4CBWA 3SUQA 1KAZA 4FLTA 3AO3A 4RW8A 4CEDA 4A2BA 4M3TA 3BF1A 4FOIA 4FCYA 4PL8A 4A57A 3DLEA 3NVKA 1TL3A 2NRTA 1TK0A 1BDGA 5SZTA 3HT3A 3J80O 4CJ4A 5AZIB 5FPEA 3MECA 4ILJA 5GAGP 4KHSA 3LPTA 1TKZA 4M45A 1FJGK 4IOXA 1S9EA 3EKSA 5KQDA 4CFDA 3TI0A 2G8KA 4U67L 3C94A 2Z1HA 5BRFA 3J7YP 2W41A 4B8CA 4BRCA 4CCHA 3I0RA 4I6MB 2P9LB 1YJNN 1D8YA 5AQWA 5HL7L 4Y1DA 1NM1A 2GTDA 3EO3A 4I7FA 3VEXA 4OO1J 4K42A 2D0OA 3E66A 4BRQA 1EXQA 1BA1A 3ALYA 5GIPA 2VG7A 3BUZB 3KLFA 1WNSA 1OVYA 1HKCA 1SQKA 1J53A 1ATNA 3KK1A 1JLFA 3M8PA 3WNFA 3FFKB 4FWSA 3CC7N 2IC3A 1NGHA 3SBTA 1Z26A 2EHGA 2OPQA 2QWOA 3VF6A 1BIZA 3VOVA 3FGUA 3NE6A 2YX6A 4GW6A 3F2KA 2I7NA 5AFUA 3ZT3A 1NG9A 2NZTA 1VSHA 4I2PA 4CZJA 3ZCMA 1KFDA 2O8BA 2A41A 4IEIA 4R5PA 3NF7A 4NO7A 3M8RA 4NCAA 4NLBA 2CGLA 5T7BA 4DQRA 4DV1K 1QSLA 3OJUA 4G1QA 1C1AA 2D0AA 5AQFA 3THYA 4JAXA 4OX9K 2UXCK 3ZSZA 4CJSA 4JV5K 1A5XA 4E7KA 2O8FB 3VEWA 1C0GA 5F0XA 3V1QA 4FO0A 1QQMA 4H0YB 3D2FA 3DXMA 3BZCA 4OGCA 4E7JA 3C65A 2E1ZA 4ID1A 3SMSA 3O4QA 1XC9A 3MX5A 3CD6N 2FBVA 3PIOL 1JLQA 1VHXA 3QEIA 5B8HA 4FJNA 3HO1A 1T6CA 1ZBUA 4AQYK 5EXWA 1ATSA 3M5RA 1SS6A 4DSKA 4DMNA 1XHZA 4PA1A 4FWNA 1EX4A 1U04A 3OYGA 2O8EB 4I9QA 3L2UA 1Q8IA 4CJRA 3SV4A 3K5LA 1RTJA 4CJ5A 2FLOA 5HRSA 3CJCA 3ULEA 4DR7K 1TUYA 4DQQA 4DQIA 2ZWHA 4BROA 4B9LA 2OPSA 2P9UA 4NYFA 4W5TA 1JLAA 1OH8A 4KKOA 3FZFA 3EE8A 2QWNA 1NJWA 1VQ9N 1WB9A 4CFBA 1SKWA 2FBYA 3U8XA 1SL2A 4BWMA 3K9JA 1N6QA 1YT3A 1U49A 1RBVA 4L8RB 4DTUA 4IG0A 3AVBA 4ELTA 3ITHA 1NK6A 3A5OC 1CZBA 1WUAA 3PUFA 4JLHA 3HVTA 4FZXC 1ZBLA 4ELVA 4F4KA 3PO4A 1HPMA 3RMDA 5F1XA 5CYMA 3OYCA 4E7LA 5BN8A 1DEJA 1LWFA 4AHRA 4HCCA 3OYAA 4PUOA 4NYNA 1HR0K 4CF8A 4EP5A 1JLCA 3ULDA 3ZLJA 4H5RA 3K58A 3OW2M 3NCIA 3WXJA 3R8EA 4CIGA 3IS9A 4FK4A 2HHTA 4FSVA 4R79A 1JCFA 3CYMA 4JRPA 2Z1IA 1VSFA 5KGXA 3ZEUA 2E2NA 3V81A 4AM7A 3L2RA 4Z4HA 1T7PA 4BACA 4E1JA 3SV3A 2OYQA 2CH6A 1TUUA 3K59A 3SK3A 2NRVA 5BR9A 2EWSA 3VQDA 2H3GX 5KPRA 1HNZK 4OPAA 5C0YA 1FKPA 2W42A 3HRGA 3CCQN 3RTVA 2OTLN 3QINA 1YF5L 3WXMB 4CEBA 4JK8A 4CF2A 2ZGYA 3NF9A 2D1KA 3K0SA 4X62K 3AGKA 4YORA 3HTVA 3GL1A 1DKGD 5E26A 1KLMA 4N56A 4FVUA 1UA1A 4CJLA 3RMCA 5GAHP 1ASVA 5AQJA 2FSJA 1YJ9N 4FLVA 2ZJRL 2YNFA 3CI5A 1VQKN 4WE1A 4KI4A 3QEPA 2V7YA 4WCEL 3I56N 3CFPA 4YFUA 4JYAK 3EL2A 3ZT1A 3SJHA 1X3NA 4LC9B 4BRNA 1VK0A 4PQUA 2P9KA 2HHQA 4HCBA 1QQOA 3HOSA 4JI1K 4B9UA 1S22A 3CC4N 3OVNA 4CK1A 4CF9A 1SKSA 4DR2K 4FJIA 1XUPO 4X64K 3LP1A 3LANA 1TAQA 3OY9A 3TPQA 3M1FA 1S72N 3VEVA 3AA5X 2G8VA 2XY5A 3QEWA 2HVIA 1YVNA 1CZ9A 2QW9A 3KLGA 4UY8O 1RT2A 4CGGA 1HNXK 1LCUA 1VSKA 4KHUA 5BRHA 5FDLA 3NBPA 3OYJA 4LH4A 1X9WA 3I8BA 4O0JA 3UIQA 2QK9A 1HUXA 4ICLA 3ZSRA 1L5UA 4C8LA 4BC4A 3PV8A 3VN5A 4OPHA 2WBNA 1TKDA 4ISFA 5JICA 3CCRN 1VSEA 4H0VB 1LAVA 2P9UB 4C8NA 3QO9A 4WYBA 4CEAA 1BQNA 3O9QA 4CD1A 2VWBA 4CHNA 4BRLA 1HYZA 1RT4A 1C6VA 2F9WA 2HB5A 2NLXA 3BP8A 2VQFK 1WLJA 1IKXA 3QEVA 3HVRA 4KREA 3VQQA 4IO8A 1NU0A 4YOXA 3CERA 1J6ZA 4JI0K 4KTWA 2I5JA 2Q31A 3QDKA 2ZJQL 3NH1A 5J2QA 2WFBA 4LF9K 1KAYA 3HM9A 1BGXT 3KVGA 1TYQB 1BI4B 3ID8A 4HUEA 4WFAL 4FJ9A 3R1XA 2HNDA 4E3SA 1NGFA 3V9XA 2BGGA 1GOAA 2VG6A 3VTHA 4CZKA 4B1YB 2KLAA 1NGBA 4LD0A 3MWPA 5E84A 1GLAG 3LDNA 3P5JA 1QTMA 2F8SA 1VSDA 2A42A 1Q86O 4B3OA 1GLDG 3VGLA 2ASOA 2BANA 3MWTA 2ZGZA 5AQLA 4DLEA 3VQ8A 3AAPA 4M41A 4O8KA 3AVMA 1TVRA 4Z4IA 5CYQA 3SUOA 4CK3A 4B9VA 1U6ZA 3FZLA 5JS2A 3ENHA 1N34K 1NJYA 1P90A 4JD2B 1HYSA 4O5FA 5JVHL 1MWKA 4FK2A 4Z4FA 2YHXA 3E9OA 1HKBA 5LMUK 1C1CA 5DK5A 1FK9A 3M6GA 4DUZK 4ZTJA 2FF3B 4C8OA 3LP2A 3FR0A 5M1NA 4CGHA 5EU7A 3LDOA 1NK0A 2HHUA 1RDDA 3T3FA 1FXXA 1X1PA 1KFSA 2GWKA 3G25A 2YNHA 3SQ1A 3ZYYX 1T8EA 4GY2B 4BG8A 3G6EN 1S6PA 2P9NB 4QOZB 3MCPA 2YJEA 3P4IA 1T03A 1HNVA 3SAHA 3MDQA 2D4WA 1NMDA 3DXKB 3VQ6A 4OLAA 2Z1JA 3BGRA 4CJTA 4KHNA 5CHIA 2XO7A 2P9KB 4CZGA 4DS4A 1RCHA 3O4WA 5ELZA 1JL1A 1NJIO 1K8KA 4GMJB 3O1BA 3LPUA 4M3YA 1HJRA 3HPHA 4DR3K 1XI1A 2YI1A 3CXCM 1Y64A 4HTLA 4KTQA 2GEMA 4ILHA 4EZ6A 4FPAA 4CHOA 1YHQN 3O3GA 1D9DA 3WNEA 2JGUA 4KV8A 3AY9A 3OYDA 3KWGA 2P5GA 4DF4A 1V4SA 4DV7K 3R3LA 2PYJA 3DWLA 4XH1A 4AHVA 1KCFA 4JKDA 1KVBA 3GG4A 3BF3A 1X3MA 4DV4K 5HROA 3TANA 3ZSYA 4KHPK 2O4IA 3W0LA 5AR0A 4FLYA 4DSLA 3CQ8A 4JKCA 3KTQA 3V6DA 1W7AA 4JK9A 1ZYQA 1M1KO 3TU5A 1GLLO 4KBOA 4B1XB 3JAMO 3F9MA 4MFBA 1NKBA 1QQNA 4EHUA 2GUIA 2HBKA 3B6OA 4E1NA 1VSIA 2QWQA 2NNWA 4B9QA 1L3TA 1HNWK 3O5BA 1S6QA 3C7NA 2BDPA 2W40A 3G71N 1YXQA 3TAMA 2VQEK 5JMVA 2XRIA 4CEFA 3CIPA 4CEZA 4YNQA 4CFAA 2OANA 3VQ9A 1ZBSA 2FXUA 3VESA 5KRTA 4KRFA 4BC3A 3RR8A 4HTUA 3OA9A 3R9PA 2DY4A 3ZSQA 2F4VK 4JKGA 1NBWA 4DFKA 2GWJA 2A6AA 3CJ7A 4PHTX 3O9UA 4IXCA 4Y0WA 5AJ3K 1M90O 2YHYA 4F3OA 4TSXA 2XHBA 4FM0A 3O9TA 3PX0A 1NGDA 3J8AA 2ZQBA 3VETA 3P83D 3SLCA 4X65K 4JNEA 3DAWA 4CGDA 4IZ9A 5BN9A 4DFPA 4H5WA 4MLEA 3OYEA 1NOZA 4UQGA 1CXQA 2P9IA 3O3HA 4F3TA 4ZTFA 3SPYA 1R0AA 1F21A 3CPWM 2UU9K 1JLEA 4BRAA 1NGJA 2J4RA 2B4JA 2UUAK 1RT6A 2Q0RA 3CJBA 1NKEA 1NK4A 3PY8A 2YKNA 1VRUA 3OBYA 3V1OA 4DCHA 3DJCA 4AF1A 1ASWA 5C10A 3RVCA 3QFPA 1O1WA 4B3TK 3W3DA 3QMLA 3AVFA 3WQTA
chains in the Genus database with same CATH topology
4PUOA 4NYNA 3L2QA 4B9SA 1IKVA 2X6NA 1WSJA 1VSMA 4CF8A 4EP5A 1JLCA 4FLZA 3AVKA 3ULDA 3KK2A 4HVJA 1IKYA 3DLKA 1RTDA 4IKFA 1EKEA 3LP3A 4F2SA 3K58A 3PX4A 3NCIA 3AO4A 5CY4A 3DLGA 4M42A 3P1GA 5J2MA 4CGFA 4CIGA 4CJ3A 1WSFA 3IS9A 1RILA 3OYKA 3EZ5A 1HNIA 4FK4A 3I8DA 3I0SA 1S9GA 2HHTA 3CYMA 4Y1CA 4CJQA 1TK5A 1L3UA 3QNOA 5E41A 3L3VA 4W5QA 4JRPA 2Z1IA 1VSFA 5KGXA 2WOMA 5HP1A 4DTRA 4OLBA 1XHXA 2E4LA 1U45A 3T1AA 3V81A 4CJPA 3L2RA 4Z4HA 1T7PA 4E89A 4BACA 3ZSVA 4CIFA 1B92A 3SV3A 3MEGA 2PYLA 4XIUA 3O4NA 5SWMA 3K59A 3L8BA 2OYQA 4F8RA 1ZBHA 3KKRA 5D3GA 4DTNA 4CK2A 3VQDA 2HHWA 1RDBA 4Z4CA 4E7HA 5HRPA 1FKPA 2W42A 2WONA 3RTVA 3SJJA 3RRHA 4LSNA 1B9FA 1EETA 2X78A 3HL8A 1BISA 2RF2A 3QINA 1N5YA 1W0HA 4H4OA 4CEBA 1RT7A 4FW1A 4O4GA 4CF2A 3K5OA 3AA4A 2KFZA 3NF9A 3ZT4A 4JS5A 3JSMA 1S1UA 1KLMA 2XY8A 1X9SA 1JLBA 4N56A 5KI6A 3VQEA 1QE1A 3OYBA 2NUBA 1UA1A 4BWJA 3TAQA 1FKOA 5J2PA 4E19A 4CJLA 3KLHA 3RMCA 4BDPA 2DFEA 5KGWA 1ASUA 2HNYA 1ASVA 2AJQA 1L3SA 4FLVA 2X6SA 4M3RA 3QESA 4KB1A 1VSJA 2YNFA 3AVHA 1RBSA 4H4MA 4WE1A 2OZSA 4DLGA 4IDKA 4H8KA 2PY5A 4AHTA 3KD5E 2FBTA 2QKKA 3HPGA 4KI4A 3QEPA 4JS4A 1C1BA 3NF8A 4OPKA 3CFPA 4KPYA 4YFUA 4OJRA 1IO2A 3IG1A 4CE9A 3H08A 3LAKA 3ZT1A 4CECA 3NH0A 4KHQA 1VK0A 4PQUA 1BL3A 1WN7A 3A2FA 3AO5A 3LWLA 3QNNA 2B5JA 3SI6A 3WNHA 4FK0A 2D0CA 2HHQA 2RPIA 1HPZA 3IRXA 3DI6A 3LDSA 1BCOA 4HCBA 4B9UA 3DLRA 5HBMA 3OVNA 1UOCA 3G0ZA 4CK1A 4CF9A 4CIEA 4N5SA 1ITGA 4CJVA 1SKSA 3NFAA 4IBNA 3S3MA 4OKEA 1W9HA 3OS2A 4J2EA 3SYZA 3HSTB 4IFVA 4FJIA 4KHWA 1J54A 4Q0BA 3KKSA 1CLQA 1QS4A 3LP1A 2KW4A 2GBZA 2DTUA 3LANA 4CFCA 4CJEA 3OYNA 1TAQA 3NDKA 3U6FA 5FRMA 2QXFA 4E7IA 1QSSA 3L2WA 3NHGA 1UA0A 3OY9A 1RT5A 4FVMA 3K57A 3OJSA 1RTIA 5C24A 5K14A 4DSIA 3MXIA 4FJXA 3AA5X 4DFJA 2XY5A 4AH9A 4OPJA 3MXJA 3QEWA 2BE2A 2G8VA 2HVIA 1CZ9A 4IFYA 1REVA 3O3FA 1JL2A 3KLGA 1RT2A 4CGGA 2ITGA 1KRPA 3RR7A 1JLGA 2ATQA 3ZT0A 4FJKA 3LALA 1NJXA 4FJ8A 2OA8A 1VSKA 3OYHA 4Z0UA 3D0PA 4KHUA 3VQ4A 4FJHA 3CM5A 1BIUA 5FDLA 4CHQA 3KLEA 3NBPA 3OYJA 4LH4A 1HMVA 4EP4A 1DTTA 4DTOA 4MQ3A 4O0JA 3NGYA 1YTAA 4DU1A 3UIQA 2QK9A 3CM6A 1S1VA 4ICLA 3ZSRA 1L5UA 1SL0A 1LWCA 4O55A 4C8LA 1SL1A 1BQMA 4PWDA 4FJJA 4HHTA 3PV8A 2Q3SA 3VN5A 2A1SA 2GV9A 1TKDA 2KZZA 3TABA 3TR8A 4AHUA 1QHTA 3C6UA 1XWLA 2VWKA 4DSJA 1VSEA 4M3WA 3HXMA 3S3NA 4J2AA 3NF6A 1ZBFA 5J2NA 2QKBA 2RKIA 2ZE2A 2HW3A 1LAVA 2A1RA 5CZ1A 4C8NA 3DOLA 4ZHRA 1GOCA 3VA3A 4OKKA 3V9WA 3QO9A 3C6TA 1TKXA 4CGIA 4HUFA 5J1EA 4OGEA 4CEAA 3ASMA 1BQNA 3AA2A 4CEQA 2D5RA 2F96A 4Z4GA 1LV5A 2G8UA 4CHNA 1WSGA 1HYZA 1RT4A 1C6VA 3AVJA 2HB5A 3BDPA 4Q5VA 1WLJA 4DQPA 3LZJA 1IKXA 1I39A 1S5JA 1IKWA 3QEVA 1KLNA 2YNIA 4DQSA 3HVRA 2YHAA 1NOYA 4E1MA 2G8HA 4NCBA 1HQEA 4ID5A 2DFFA 4CERA 1CXUA 1LWEA 4KREA 3VQQA 3MXMA 4J2DA 3RMBA 3QIPA 2R7YA 4N76A 3TWHA 3SQ0A 4CJUA 3AA3A 4QCLA 1YVUA 2Z1GA 3AVLA 1EP4A 4KTWA 4CJWA 4AILC 3THVA 2I5JA 3OYMA 2D0BA 3HYFA 3NH1A 5J2QA 2XY6A 1U47A 2PZSA 3HM9A 4AHCA 1BGXT 3QIOA 3DOKA 1S1WA 4AHSA 3RWUA 4KI6A 4M3XA 1BI4B 4DF8A 4HUEA 3FFIA 3TAGA 1J5OA 4FJ9A 2HVHA 2OZMA 4N47A 1TAUA 1C0MA 2YV0X 2HNDA 3VQBA 2X74A 4BE2A 1RTHA 4E3SA 3V9XA 2BGGA 1GOAA 2VG6A 4I9LA 1RT3A 3QLHA 4BDZA 4C8MA 2Y1JA 2HHSA 4LD0A 3P5JA 4KTZA 1QTMA 1UAXA 2F8SA 1VSDA 4FXDA 5FROA 3TAEA 5I42A 3RRGA 3NGIA 1Q9XA 4N41A 3OYFA 3KIOA 3NAEA 1RDAA 4B3OA 3QERA 1MU2A 3AVCA 1RBRA 4FZZA 4Z4EA 3OS1A 1GOBA 2BANA 3SPZA 3PO5A 1LAWA 4CEOA 4DTPA 5KRSA 5I3UA 3OYLA 3VQ5A 4CJFA 4CHPA 4DLEA 2YKMA 2P1JA 4M41A 1HRHA 3VQ8A 4FLUA 1NK8A 1ZBIA 4CGJA 4FJMA 3AVMA 1TVRA 4RW4A 3DLHA 4Z4IA 5CYQA 3SUOA 1KTQA 4DS5A 4CK3A 1C0UA 1TL1A 4DTMA 1X9MA 2P5OA 4B9VA 3IAYA 5JS2A 3AVGA 3CFRA 2KQ2A 4FM1A 1JKHA 1VRTA 2P51A 1NJYA 4KAZA 2IDOA 3EYZA 3WNGA 3ISNC 3DLBA 4F2RA 4FJLA 3LP0A 1HYSA 3K2PA 3LAMA 4RW9A 1Z25A 1TV6A 4FLXA 1NK9A 2E6MA 4FK2A 4Z4FA 4RG8A 2VG5A 2VWJA 4M3UA 2ETJA 1NKCA 3ZT2A 3KLIA 2O4GA 3KK3A 4BE0A 5FRNA 1C1CA 3SUQA 5DK5A 1Q9YA 1K6YA 2G8FA 4W5NA 1FK9A 3T19A 4FLTA 4ZTJA 4C8OA 2LSNA 3AO3A 3LP2A 4RW8A 5CZ2A 4CEDA 4HUGA 1WSIA 4CGHA 4M3TA 5EU7A 4FCYA 1TKTA 3DLEA 1A5WA 1NK0A 1IH7A 2HHUA 4FJ5A 1RDDA 1TL3A 3T3FA 1FXXA 1KSPA 1LW2A 1X1PA 5HRNA 1TK0A 1D5AA 5SZTA 3TAFA 1QSYA 4O0IA 3HT3A 4DTJA 1KFSA 3S3OA 2YNHA 1WSEA 1RBTA 2FC0A 4CJ4A 3SQ1A 3MECA 4CF1A 3U3YA 5KTQA 1T8EA 4KHSA 2E6LA 3E01A 3LPTA 1TKZA 4M45A 1KVCA 3HP9A 1S6PA 4QOZB 1NK5A 4KB0A 1T03A 1WSHA 4PY5A 1HNVA 3VQ6A 4DG1A 1S9EA 3NGZA 4KFBA 4W5RA 4DFMA 4CFDA 3TI0A 2G8KA 4OLAA 3C94A 1HQUA 2Z1HA 4W5OA 2Z1JA 3BGRA 4CJTA 4KHNA 1UWBA 4B8CA 2YHBA 3VQCA 3AVAA 4CCHA 3I0RA 1RT1A 2DFHA 2XO7A 1D8YA 4FJGA 4NCGA 4DS4A 1RCHA 3F9KA 4JRQA 4Y1DA 2IOCA 4I7FA 4IG3A 1JL1A 1LW0A 1QQCA 3AO1A 3OS0A 4BDYA 4FM2A 3RMAA 4GMJB 3B6PA 3LPUA 5JS1A 3PX6A 4M3YA 1HJRA 1EXQA 3HPHA 4LH5A 1WAJA 3ALYA 1XI1A 4DSEA 2VG7A 1RNHA 1BCMA 3KLFA 2XY7A 3QETA 1WNSA 3MEEA 2IAJA 4DWIA 2KFNA 1BI4A 3ZSOA 4FW2A 1J53A 4KTQA 3V9ZA 3KK1A 1JLFA 3VQ7A 4EZ6A 3M8PA 2ZD1A 1G15A 1I3AA 1JXBA 3DRRA 3AV9A 3DRPA 3WNFA 4CHOA 3K5NA 3SUNA 2IC3A 3O3GA 3WNEA 2JGUA 4KV8A 1D9DA 4FLWA 3DRSA 3AO2A 3OYDA 1Z26A 2EHGA 2OPQA 3V9UA 4DF4A 2P5GA 1BIZA 2PYJA 2F8TA 3NE6A 4GW6A 4AHVA 1B9DA 1KCFA 4RW7A 3JYTA 3KD1E 2HHXA 3ZT3A 1KVBA 4E0DA 1VSLA 1VSHA 4I2PA 4BE1A 3ZCMA 1KFDA 3M8QA 3HP6A 5HROA 4R5PA 3TANA 3ZSYA 2EX3A 1T05A 3NF7A 4KHYA 3M8RA 3DYAA 4NCAA 4CHZA 3V4IA 2O4IA 5T7BA 3HPOA 4DQRA 4FLYA 3KJVA 1QSLA 3MAQA 4DSLA 3OJUA 4G1QA 1C1AA 2D0AA 3LZIA 3CQ8A 1RBUA 5HRRA 3KTQA 3SQ2A 3V6DA 3VA0A 3CFOA 1SKRA 1ZYQA 1U4BA 3EY1A 3TARA 3HK2A 3ZSZA 4CJSA 2RN2A 2JLEA 1A5XA 3ZSWA 4DU4A 4RW6A 1KVAA 4E7KA 4FZYA 4LY7A 4MFBA 4OKJA 1NKBA 3V1RA 2G8IA 2GUIA 3B6OA 4E1NA 3V1QA 1VSIA 3U3GA 3L2VA 1L3TA 5HLFA 4OGCA 1S6QA 2BDPA 4B8AB 2B6AA 4QAGA 3LWMA 1U48A 4E7JA 3L3UA 1C0TA 3TAMA 1YTUA 4B9NA 4ID1A 4C8KA 3SQ4A 2XRIA 3O4QA 3CG7A 1NK7A 4CEFA 1XC9A 1TK8A 2HHVA 4CEZA 4DTXA 4M3ZA 4YNQA 4CFAA 2FBVA 5DMRA 1JLQA 3VQ9A 3OYIA 3QEIA 3QEXA 4FJNA 1L3VA 3HO1A 3G10A 1DLOA 1ZBUA 3D45A 3TAPA 5KRTA 3MEDA 1DTQA 4DSKA 4DMNA 3RR8A 1XHZA 4HTUA 4PA1A 2YNGA 1EX4A 1U04A 3DMJA 2DY4A 3ZSQA 4DFKA 3OYGA 1WAFA 4I9QA 3L2UA 1Q8IA 4O5BA 4B9TA 4CJRA 3SV4A 4LSLA 3K5LA 4TSXA 4F3OA 2XHBA 1RTJA 3K5MA 4CJ5A 5HRSA 4OVLA 4B08A 4FM0A 2HNZA 1S1TA 4ELUA 3PX0A 4J2BA 4KO0A 4I2QA 4DQQA 4DQIA 4CESA 4B9LA 2OPSA 3C95A 1JXEA 4NYFA 4W5TA 1JLAA 2ZQBA 3P83D 4KKOA 2Y1IA 2IS3A 3AVNA 3SZ2A 3V9SA 4FJ7A 3SUPA 4EZ9A 4DU3A 1NJWA 4K8ZA 4DTSA 4CGDA 2OPRA 3NH2A 3SNNA 4CFBA 4DFPA 1SKWA 2FBYA 3M8SA 3OYEA 1SL2A 1NOZA 3DM2A 4BWMA 4CJKA 4B9MA 3HJFA 4UQGA 1CXQA 1SUQA 4F3TA 3O3HA 1N6QA 1YT3A 1X9WA 4FYDA 4ZTFA 1U49A 1RBVA 5C42A 3S9HA 3SPYA 1R0AA 4O44A 1F21A 4L8RB 4DSFA 3VQAA 3F73A 2G8WA 4DTUA 4IG0A 3AVBA 3VQPA 4ELTA 1JLEA 3AVIA 3ITHA 1NK6A 2B4JA 4CEEA 4CHYA 1TGOA 1RT6A 1SV5A 1Y97A 1D9FA 5C25A 1CZBA 3PUFA 4JLHA 1RDCA 3HVTA 3ZSXA 1NKEA 2KTQA 4GVMA 1A5VA 2OPPA 1NK4A 1BHLA 1ZBLA 4FZXC 4K8XA 4ELVA 4F4KA 3PY8A 3PO4A 2YKNA 1VRUA 3V1OA 3RMDA 1IG9A 3SCXA 2IGIA 2FBXA 5CYMA 2KZMA 1NJZA 1ASWA 3OYCA 4E7LA 4CF0A 2HMIA 1J9AA 1HYVA 1LWFA 1O1WA 1S1XA 4KRFA 4AHRA 3AVFA 4HCCA 3OYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUO A;  4NYN A;  3L2Q A;  4B9S A;  1IKV A;  2X6N A;  1WSJ A;  1VSM A;  4CF8 A;  4EP5 A;  1JLC A;  4FLZ A;  3AVK A;  3ULD A;  3KK2 A;  4HVJ A;  1IKY A;  3DLK A;  1RTD A;  4IKF A;  1EKE A;  3LP3 A;  4F2S A;  3K58 A;  3PX4 A;  3NCI A;  3AO4 A;  5CY4 A;  3DLG A;  4M42 A;  3P1G A;  5J2M A;  4CGF A;  4CIG A;  4CJ3 A;  1WSF A;  3IS9 A;  1RIL A;  3OYK A;  3EZ5 A;  1HNI A;  4FK4 A;  3I8D A;  3I0S A;  1S9G A;  2HHT A;  3CYM A;  4Y1C A;  4CJQ A;  1TK5 A;  1L3U A;  3QNO A;  5E41 A;  3L3V A;  4W5Q A;  4JRP A;  2Z1I A;  1VSF A;  5KGX A;  2WOM A;  5HP1 A;  4DTR A;  4OLB A;  1XHX A;  2E4L A;  1U45 A;  3T1A A;  3V81 A;  4CJP A;  3L2R A;  4Z4H A;  1T7P A;  4E89 A;  4BAC A;  3ZSV A;  4CIF A;  1B92 A;  3SV3 A;  3MEG A;  2PYL A;  4XIU A;  3O4N A;  5SWM A;  3K59 A;  3L8B A;  2OYQ A;  4F8R A;  1ZBH A;  3KKR A;  5D3G A;  4DTN A;  4CK2 A;  3VQD A;  2HHW A;  1RDB A;  4Z4C A;  4E7H A;  5HRP A;  1FKP A;  2W42 A;  2WON A;  3RTV A;  3SJJ A;  3RRH A;  4LSN A;  1B9F A;  1EET A;  2X78 A;  3HL8 A;  1BIS A;  2RF2 A;  3QIN A;  1N5Y A;  1W0H A;  4H4O A;  4CEB A;  1RT7 A;  4FW1 A;  4O4G A;  4CF2 A;  3K5O A;  3AA4 A;  2KFZ A;  3NF9 A;  3ZT4 A;  4JS5 A;  3JSM A;  1S1U A;  1KLM A;  2XY8 A;  1X9S A;  1JLB A;  4N56 A;  5KI6 A;  3VQE A;  1QE1 A;  3OYB A;  2NUB A;  1UA1 A;  4BWJ A;  3TAQ A;  1FKO A;  5J2P A;  4E19 A;  4CJL A;  3KLH A;  3RMC A;  4BDP A;  2DFE A;  5KGW A;  1ASU A;  2HNY A;  1ASV A;  2AJQ A;  1L3S A;  4FLV A;  2X6S A;  4M3R A;  3QES A;  4KB1 A;  1VSJ A;  2YNF A;  3AVH A;  1RBS A;  4H4M A;  4WE1 A;  2OZS A;  4DLG A;  4IDK A;  4H8K A;  2PY5 A;  4AHT A;  3KD5 E;  2FBT A;  2QKK A;  3HPG A;  4KI4 A;  3QEP A;  4JS4 A;  1C1B A;  3NF8 A;  4OPK A;  3CFP A;  4KPY A;  4YFU A;  4OJR A;  1IO2 A;  3IG1 A;  4CE9 A;  3H08 A;  3LAK A;  3ZT1 A;  4CEC A;  3NH0 A;  4KHQ A;  1VK0 A;  4PQU A;  1BL3 A;  1WN7 A;  3A2F A;  3AO5 A;  3LWL A;  3QNN A;  2B5J A;  3SI6 A;  3WNH A;  4FK0 A;  2D0C A;  2HHQ A;  2RPI A;  1HPZ A;  3IRX A;  3DI6 A;  3LDS A;  1BCO A;  4HCB A;  4B9U A;  3DLR A;  5HBM A;  3OVN A;  1UOC A;  3G0Z A;  4CK1 A;  4CF9 A;  4CIE A;  4N5S A;  1ITG A;  4CJV A;  1SKS A;  3NFA A;  4IBN A;  3S3M A;  4OKE A;  1W9H A;  3OS2 A;  4J2E A;  3SYZ A;  3HST B;  4IFV A;  4FJI A;  4KHW A;  1J54 A;  4Q0B A;  3KKS A;  1CLQ A;  1QS4 A;  3LP1 A;  2KW4 A;  2GBZ A;  2DTU A;  3LAN A;  4CFC A;  4CJE A;  3OYN A;  1TAQ A;  3NDK A;  3U6F A;  5FRM A;  2QXF A;  4E7I A;  1QSS A;  3L2W A;  3NHG A;  1UA0 A;  3OY9 A;  1RT5 A;  4FVM A;  3K57 A;  3OJS A;  1RTI A;  5C24 A;  5K14 A;  4DSI A;  3MXI A;  4FJX A;  3AA5 X;  4DFJ A;  2XY5 A;  4AH9 A;  4OPJ A;  3MXJ A;  3QEW A;  2BE2 A;  2G8V A;  2HVI A;  1CZ9 A;  4IFY A;  1REV A;  3O3F A;  1JL2 A;  3KLG A;  1RT2 A;  4CGG A;  2ITG A;  1KRP A;  3RR7 A;  1JLG A;  2ATQ A;  3ZT0 A;  4FJK A;  3LAL A;  1NJX A;  4FJ8 A;  2OA8 A;  1VSK A;  3OYH A;  4Z0U A;  3D0P A;  4KHU A;  3VQ4 A;  4FJH A;  3CM5 A;  1BIU A;  5FDL A;  4CHQ A;  3KLE A;  3NBP A;  3OYJ A;  4LH4 A;  1HMV A;  4EP4 A;  1DTT A;  4DTO A;  4MQ3 A;  4O0J A;  3NGY A;  1YTA A;  4DU1 A;  3UIQ A;  2QK9 A;  3CM6 A;  1S1V A;  4ICL A;  3ZSR A;  1L5U A;  1SL0 A;  1LWC A;  4O55 A;  4C8L A;  1SL1 A;  1BQM A;  4PWD A;  4FJJ A;  4HHT A;  3PV8 A;  2Q3S A;  3VN5 A;  2A1S A;  2GV9 A;  1TKD A;  2KZZ A;  3TAB A;  3TR8 A;  4AHU A;  1QHT A;  3C6U A;  1XWL A;  2VWK A;  4DSJ A;  1VSE A;  4M3W A;  3HXM A;  3S3N A;  4J2A A;  3NF6 A;  1ZBF A;  5J2N A;  2QKB A;  2RKI A;  2ZE2 A;  2HW3 A;  1LAV A;  2A1R A;  5CZ1 A;  4C8N A;  3DOL A;  4ZHR A;  1GOC A;  3VA3 A;  4OKK A;  3V9W A;  3QO9 A;  3C6T A;  1TKX A;  4CGI A;  4HUF A;  5J1E A;  4OGE A;  4CEA A;  3ASM A;  1BQN A;  3AA2 A;  4CEQ A;  2D5R A;  2F96 A;  4Z4G A;  1LV5 A;  2G8U A;  4CHN A;  1WSG A;  1HYZ A;  1RT4 A;  1C6V A;  3AVJ A;  2HB5 A;  3BDP A;  4Q5V A;  1WLJ A;  4DQP A;  3LZJ A;  1IKX A;  1I39 A;  1S5J A;  1IKW A;  3QEV A;  1KLN A;  2YNI A;  4DQS A;  3HVR A;  2YHA A;  1NOY A;  4E1M A;  2G8H A;  4NCB A;  1HQE A;  4ID5 A;  2DFF A;  4CER A;  1CXU A;  1LWE A;  4KRE A;  3VQQ A;  3MXM A;  4J2D A;  3RMB A;  3QIP A;  2R7Y A;  4N76 A;  3TWH A;  3SQ0 A;  4CJU A;  3AA3 A;  4QCL A;  1YVU A;  2Z1G A;  3AVL A;  1EP4 A;  4KTW A;  4CJW A;  4AIL C;  3THV A;  2I5J A;  3OYM A;  2D0B A;  3HYF A;  3NH1 A;  5J2Q A;  2XY6 A;  1U47 A;  2PZS A;  3HM9 A;  4AHC A;  1BGX T;  3QIO A;  3DOK A;  1S1W A;  4AHS A;  3RWU A;  4KI6 A;  4M3X A;  1BI4 B;  4DF8 A;  4HUE A;  3FFI A;  3TAG A;  1J5O A;  4FJ9 A;  2HVH A;  2OZM A;  4N47 A;  1TAU A;  1C0M A;  2YV0 X;  2HND A;  3VQB A;  2X74 A;  4BE2 A;  1RTH A;  4E3S A;  3V9X A;  2BGG A;  1GOA A;  2VG6 A;  4I9L A;  1RT3 A;  3QLH A;  4BDZ A;  4C8M A;  2Y1J A;  2HHS A;  4LD0 A;  3P5J A;  4KTZ A;  1QTM A;  1UAX A;  2F8S A;  1VSD A;  4FXD A;  5FRO A;  3TAE A;  5I42 A;  3RRG A;  3NGI A;  1Q9X A;  4N41 A;  3OYF A;  3KIO A;  3NAE A;  1RDA A;  4B3O A;  3QER A;  1MU2 A;  3AVC A;  1RBR A;  4FZZ A;  4Z4E A;  3OS1 A;  1GOB A;  2BAN A;  3SPZ A;  3PO5 A;  1LAW A;  4CEO A;  4DTP A;  5KRS A;  5I3U A;  3OYL A;  3VQ5 A;  4CJF A;  4CHP A;  4DLE A;  2YKM A;  2P1J A;  4M41 A;  1HRH A;  3VQ8 A;  4FLU A;  1NK8 A;  1ZBI A;  4CGJ A;  4FJM A;  3AVM A;  1TVR A;  4RW4 A;  3DLH A;  4Z4I A;  5CYQ A;  3SUO A;  1KTQ A;  4DS5 A;  4CK3 A;  1C0U A;  1TL1 A;  4DTM A;  1X9M A;  2P5O A;  4B9V A;  3IAY A;  5JS2 A;  3AVG A;  3CFR A;  2KQ2 A;  4FM1 A;  1JKH A;  1VRT A;  2P51 A;  1NJY A;  4KAZ A;  2IDO A;  3EYZ A;  3WNG A;  3ISN C;  3DLB A;  4F2R A;  4FJL A;  3LP0 A;  1HYS A;  3K2P A;  3LAM A;  4RW9 A;  1Z25 A;  1TV6 A;  4FLX A;  1NK9 A;  2E6M A;  4FK2 A;  4Z4F A;  4RG8 A;  2VG5 A;  2VWJ A;  4M3U A;  2ETJ A;  1NKC A;  3ZT2 A;  3KLI A;  2O4G A;  3KK3 A;  4BE0 A;  5FRN A;  1C1C A;  3SUQ A;  5DK5 A;  1Q9Y A;  1K6Y A;  2G8F A;  4W5N A;  1FK9 A;  3T19 A;  4FLT A;  4ZTJ A;  4C8O A;  2LSN A;  3AO3 A;  3LP2 A;  4RW8 A;  5CZ2 A;  4CED A;  4HUG A;  1WSI A;  4CGH A;  4M3T A;  5EU7 A;  4FCY A;  1TKT A;  3DLE A;  1A5W A;  1NK0 A;  1IH7 A;  2HHU A;  4FJ5 A;  1RDD A;  1TL3 A;  3T3F A;  1FXX A;  1KSP A;  1LW2 A;  1X1P A;  5HRN A;  1TK0 A;  1D5A A;  5SZT A;  3TAF A;  1QSY A;  4O0I A;  3HT3 A;  4DTJ A;  1KFS A;  3S3O A;  2YNH A;  1WSE A;  1RBT A;  2FC0 A;  4CJ4 A;  3SQ1 A;  3MEC A;  4CF1 A;  3U3Y A;  5KTQ A;  1T8E A;  4KHS A;  2E6L A;  3E01 A;  3LPT A;  1TKZ A;  4M45 A;  1KVC A;  3HP9 A;  1S6P A;  4QOZ B;  1NK5 A;  4KB0 A;  1T03 A;  1WSH A;  4PY5 A;  1HNV A;  3VQ6 A;  4DG1 A;  1S9E A;  3NGZ A;  4KFB A;  4W5R A;  4DFM A;  4CFD A;  3TI0 A;  2G8K A;  4OLA A;  3C94 A;  1HQU A;  2Z1H A;  4W5O A;  2Z1J A;  3BGR A;  4CJT A;  4KHN A;  1UWB A;  4B8C A;  2YHB A;  3VQC A;  3AVA A;  4CCH A;  3I0R A;  1RT1 A;  2DFH A;  2XO7 A;  1D8Y A;  4FJG A;  4NCG A;  4DS4 A;  1RCH A;  3F9K A;  4JRQ A;  4Y1D A;  2IOC A;  4I7F A;  4IG3 A;  1JL1 A;  1LW0 A;  1QQC A;  3AO1 A;  3OS0 A;  4BDY A;  4FM2 A;  3RMA A;  4GMJ B;  3B6P A;  3LPU A;  5JS1 A;  3PX6 A;  4M3Y A;  1HJR A;  1EXQ A;  3HPH A;  4LH5 A;  1WAJ A;  3ALY A;  1XI1 A;  4DSE A;  2VG7 A;  1RNH A;  1BCM A;  3KLF A;  2XY7 A;  3QET A;  1WNS A;  3MEE A;  2IAJ A;  4DWI A;  2KFN A;  1BI4 A;  3ZSO A;  4FW2 A;  1J53 A;  4KTQ A;  3V9Z A;  3KK1 A;  1JLF A;  3VQ7 A;  4EZ6 A;  3M8P A;  2ZD1 A;  1G15 A;  1I3A A;  1JXB A;  3DRR A;  3AV9 A;  3DRP A;  3WNF A;  4CHO A;  3K5N A;  3SUN A;  2IC3 A;  3O3G A;  3WNE A;  2JGU A;  4KV8 A;  1D9D A;  4FLW A;  3DRS A;  3AO2 A;  3OYD A;  1Z26 A;  2EHG A;  2OPQ A;  3V9U A;  4DF4 A;  2P5G A;  1BIZ A;  2PYJ A;  2F8T A;  3NE6 A;  4GW6 A;  4AHV A;  1B9D A;  1KCF A;  4RW7 A;  3JYT A;  3KD1 E;  2HHX A;  3ZT3 A;  1KVB A;  4E0D A;  1VSL A;  1VSH A;  4I2P A;  4BE1 A;  3ZCM A;  1KFD A;  3M8Q A;  3HP6 A;  5HRO A;  4R5P A;  3TAN A;  3ZSY A;  2EX3 A;  1T05 A;  3NF7 A;  4KHY A;  3M8R A;  3DYA A;  4NCA A;  4CHZ A;  3V4I A;  2O4I A;  5T7B A;  3HPO A;  4DQR A;  4FLY A;  3KJV A;  1QSL A;  3MAQ A;  4DSL A;  3OJU A;  4G1Q A;  1C1A A;  2D0A A;  3LZI A;  3CQ8 A;  1RBU A;  5HRR A;  3KTQ A;  3SQ2 A;  3V6D A;  3VA0 A;  3CFO A;  1SKR A;  1ZYQ A;  1U4B A;  3EY1 A;  3TAR A;  3HK2 A;  3ZSZ A;  4CJS A;  2RN2 A;  2JLE A;  1A5X A;  3ZSW A;  4DU4 A;  4RW6 A;  1KVA A;  4E7K A;  4FZY A;  4LY7 A;  4MFB A;  4OKJ A;  1NKB A;  3V1R A;  2G8I A;  2GUI A;  3B6O A;  4E1N A;  3V1Q A;  1VSI A;  3U3G A;  3L2V A;  1L3T A;  5HLF A;  4OGC A;  1S6Q A;  2BDP A;  4B8A B;  2B6A A;  4QAG A;  3LWM A;  1U48 A;  4E7J A;  3L3U A;  1C0T A;  3TAM A;  1YTU A;  4B9N A;  4ID1 A;  4C8K A;  3SQ4 A;  2XRI A;  3O4Q A;  3CG7 A;  1NK7 A;  4CEF A;  1XC9 A;  1TK8 A;  2HHV A;  4CEZ A;  4DTX A;  4M3Z A;  4YNQ A;  4CFA A;  2FBV A;  5DMR A;  1JLQ A;  3VQ9 A;  3OYI A;  3QEI A;  3QEX A;  4FJN A;  1L3V A;  3HO1 A;  3G10 A;  1DLO A;  1ZBU A;  3D45 A;  3TAP A;  5KRT A;  3MED A;  1DTQ A;  4DSK A;  4DMN A;  3RR8 A;  1XHZ A;  4HTU A;  4PA1 A;  2YNG A;  1EX4 A;  1U04 A;  3DMJ A;  2DY4 A;  3ZSQ A;  4DFK A;  3OYG A;  1WAF A;  4I9Q A;  3L2U A;  1Q8I A;  4O5B A;  4B9T A;  4CJR A;  3SV4 A;  4LSL A;  3K5L A;  4TSX A;  4F3O A;  2XHB A;  1RTJ A;  3K5M A;  4CJ5 A;  5HRS A;  4OVL A;  4B08 A;  4FM0 A;  2HNZ A;  1S1T A;  4ELU A;  3PX0 A;  4J2B A;  4KO0 A;  4I2Q A;  4DQQ A;  4DQI A;  4CES A;  4B9L A;  2OPS A;  3C95 A;  1JXE A;  4NYF A;  4W5T A;  1JLA A;  2ZQB A;  3P83 D;  4KKO A;  2Y1I A;  2IS3 A;  3AVN A;  3SZ2 A;  3V9S A;  4FJ7 A;  3SUP A;  4EZ9 A;  4DU3 A;  1NJW A;  4K8Z A;  4DTS A;  4CGD A;  2OPR A;  3NH2 A;  3SNN A;  4CFB A;  4DFP A;  1SKW A;  2FBY A;  3M8S A;  3OYE A;  1SL2 A;  1NOZ A;  3DM2 A;  4BWM A;  4CJK A;  4B9M A;  3HJF A;  4UQG A;  1CXQ A;  1SUQ A;  4F3T A;  3O3H A;  1N6Q A;  1YT3 A;  1X9W A;  4FYD A;  4ZTF A;  1U49 A;  1RBV A;  5C42 A;  3S9H A;  3SPY A;  1R0A A;  4O44 A;  1F21 A;  4L8R B;  4DSF A;  3VQA A;  3F73 A;  2G8W A;  4DTU A;  4IG0 A;  3AVB A;  3VQP A;  4ELT A;  1JLE A;  3AVI A;  3ITH A;  1NK6 A;  2B4J A;  4CEE A;  4CHY A;  1TGO A;  1RT6 A;  1SV5 A;  1Y97 A;  1D9F A;  5C25 A;  1CZB A;  3PUF A;  4JLH A;  1RDC A;  3HVT A;  3ZSX A;  1NKE A;  2KTQ A;  4GVM A;  1A5V A;  2OPP A;  1NK4 A;  1BHL A;  1ZBL A;  4FZX C;  4K8X A;  4ELV A;  4F4K A;  3PY8 A;  3PO4 A;  2YKN A;  1VRU A;  3V1O A;  3RMD A;  1IG9 A;  3SCX A;  2IGI A;  2FBX A;  5CYM A;  2KZM A;  1NJZ A;  1ASW A;  3OYC A;  4E7L A;  4CF0 A;  2HMI A;  1J9A A;  1HYV A;  1LWF A;  1O1W A;  1S1X A;  4KRF A;  4AHR A;  3AVF A;  4HCC A;  3OYA A; 
#chains in the Genus database with same CATH topology
 3L2Q A;  4B9S A;  2X6N A;  1WSJ A;  3KWI A;  3CJ9 A;  4F2S A;  3JXU A;  3QFU A;  5CY4 A;  4IDH A;  4M42 A;  4RTF D;  4H5T A;  4CGF A;  4CJ3 A;  3OYK A;  3EZ5 A;  1HNI A;  2PFU A;  4CJQ A;  1TK5 A;  3QNO A;  5E41 A;  4WFB L;  3L3V A;  2WOM A;  3VPZ A;  5HP1 A;  4DTR A;  1XHX A;  1P8Z A;  1U45 A;  3CCL N;  1N33 K;  2RHK A;  5AZJ A;  1IBM K;  4YDU C;  4CIF A;  3MEG A;  2PYL A;  4BG9 A;  4F8R A;  2RE2 A;  3ENO A;  4YOY A;  1RDB A;  1WBD A;  3RSE A;  4QS8 A;  2WON A;  4FOE A;  4BY9 C;  3A0I X;  1BG3 A;  1B9F A;  3N4P A;  4H4O A;  1RT7 A;  4FW1 A;  4O4G A;  3VTI A;  4YDU A;  4JKA A;  4BRP A;  4JS5 A;  1S1U A;  4DR5 K;  5KI6 A;  3VQE A;  1QE1 A;  4MLH A;  3O80 A;  4BDP A;  2DFE A;  3I55 N;  1ASU A;  1BO5 O;  2AJQ A;  1L3S A;  5HOO A;  3QES A;  2HF3 A;  4DLG A;  4JS4 A;  2GUP A;  2IVO A;  4OJR A;  5JVG L;  4CEC A;  3AO5 A;  3A2F A;  3LWL A;  2VGM A;  2D0C A;  2RPI A;  1HPZ A;  1BCO A;  1O13 A;  1UOC A;  2ASM A;  2Q1N A;  4N5S A;  3CF5 L;  3THX A;  3UKR B;  1KC8 O;  3MMV A;  3OS2 A;  4J2E A;  1ZC6 A;  3HST B;  4Q0B A;  1QS4 A;  4XH5 A;  2GBZ A;  4CFC A;  1NGA A;  5FRM A;  4NXM K;  2P9P A;  5EX5 A;  4E7I A;  1QSS A;  3L2W A;  4FVM A;  4QS7 A;  3MXI A;  4A59 A;  4AH9 A;  1KRP A;  1JLG A;  2ATQ A;  3ZT0 A;  4FJK A;  3FLC O;  1NJX A;  1VQ7 N;  4C1N I;  4FJ8 A;  3OYH A;  4Z0U A;  4BR9 A;  1BIU A;  4CHQ A;  3EN9 A;  3KLE A;  1HMV A;  2V7Z A;  1Z05 A;  2QWL A;  4YOT A;  4JKG B;  4DU1 A;  3HBT A;  3CM6 A;  1OH6 A;  1SL0 A;  1BQM A;  4HHT A;  2Q3S A;  2KZZ A;  1XMO K;  3TAB A;  4JI8 K;  2VWK A;  1VQ6 N;  3HXM A;  3L6Q A;  3NF6 A;  1ZBF A;  4H5V A;  5J2N A;  2ZE2 A;  2HW3 A;  4ZHR A;  3VA3 A;  1GOC A;  4BRM A;  3PIP L;  3V9W A;  1GLB G;  4CGI A;  4HUF A;  3BY5 A;  3E9P A;  3ASM A;  4LFB K;  2D5R A;  2F96 A;  2G8U A;  4Z94 A;  3AVJ A;  4H5N A;  4LFA K;  4JKF A;  4XEI A;  4B1V A;  4DQS A;  2YHA A;  1ZXO A;  4E1M A;  1NOY A;  3VF4 A;  3H1Q A;  2DFF A;  4ID5 A;  1CXU A;  2IVP A;  2GX9 A;  3HSC A;  3QIP A;  4B1W B;  3SQ0 A;  1YVU A;  4CI6 A;  3U9D A;  1WOQ A;  4FL9 A;  4KI6 A;  3TAG A;  1NGI A;  3MN9 A;  1J5O A;  2OZM A;  1KQS M;  1RTH A;  1KXP A;  2E5L K;  1Q82 O;  4K41 A;  4I9L A;  4A5A A;  4BDZ A;  2UXB K;  4MO4 A;  1JJ2 M;  1T44 A;  2QWP A;  2F7T A;  3EKU A;  4LF6 K;  4FXD A;  5FRO A;  3RRG A;  4N41 A;  3KIO A;  1MU2 A;  3AVC A;  4JN4 A;  3OS1 A;  2O8B B;  5KRS A;  4CVN E;  5I3U A;  3OYL A;  4CJF A;  5AZJ B;  1ZBI A;  4A2A A;  1HRH A;  4WQ4 C;  4CGJ A;  3WQU A;  3P38 A;  1DT9 A;  3CHW A;  3THY B;  4DS5 A;  4DTM A;  2P5O A;  3IAY A;  1TL1 A;  2KQ2 A;  3OTO K;  1JKH A;  2P51 A;  2IDO A;  4FJL A;  4F2R A;  3LP0 A;  3K2P A;  3LAM A;  4FLX A;  2E6M A;  2VG5 A;  5JLF A;  1NGE A;  5FPN A;  3ZT2 A;  3KLI A;  2E88 A;  3VEZ A;  1Q9Y A;  4W5N A;  4WQ4 A;  1N32 K;  3D2F B;  3DXM B;  5CZ2 A;  3AAQ A;  1TKT A;  4FJ5 A;  3S41 A;  1KSP A;  1LW2 A;  5HRN A;  1QSY A;  3CC2 N;  1WSE A;  2FC0 A;  4KH5 A;  2E8A A;  4BC5 A;  2E6L A;  5BPL A;  3HP9 A;  2QA4 N;  1NK5 A;  4MO5 A;  3VMF B;  4DG1 A;  4BVO A;  4W5R A;  1HQU A;  4W5O A;  1UWB A;  4MDA A;  3SAF A;  3VQC A;  3AVA A;  1RT1 A;  2KKZ A;  4NCG A;  4BGB A;  1RDU A;  4JRQ A;  3ULE B;  3AO1 A;  1E4G T;  1LW0 A;  1QQC A;  2NRX A;  4YY3 K;  2P9S A;  4BDY A;  4FM2 A;  3RMA A;  3B6P A;  5JS1 A;  3PX6 A;  1Z6R A;  3MK6 A;  4M7X A;  1WAJ A;  1BCM A;  3D2E A;  2XY7 A;  2ZF5 O;  3ZSO A;  1JCE A;  1HX1 A;  3THW A;  3VQ7 A;  4JI4 K;  5AQS A;  1G15 A;  1I3A A;  5BPM A;  1JXB A;  3AV9 A;  3DRP A;  4PKG A;  3Q7C A;  5AQP A;  3WXI A;  4FLW A;  1KD1 O;  3V9U A;  3L4Q A;  2GEL A;  2F8T A;  2YCH A;  4ISE A;  1B9D A;  5KQ8 A;  4LFC K;  4E0D A;  1VSL A;  1VQ5 N;  4BE1 A;  3M8Q A;  4CZI A;  3HP6 A;  4M7Y A;  3VGM A;  1T05 A;  4KHY A;  3DYA A;  3HPO A;  3TSU A;  3MAQ A;  3ZET A;  4JI2 K;  3L0Q A;  1RBU A;  4CZL A;  5HRR A;  3SQ2 A;  3J7A P;  3LDL A;  3CJA A;  3VA0 A;  1SKR A;  4PL7 A;  1U4B A;  3GDQ A;  3EY1 A;  3TAR A;  3HK2 A;  3OHR A;  3ZSW A;  4DU4 A;  4RW6 A;  1Q18 A;  4FZY A;  4GVE A;  3V1R A;  2G8I A;  3ZEU B;  5ADX A;  3G4S N;  1LOT B;  3U3G A;  2I7P A;  4B8A B;  4QAG A;  4U7B A;  3LWM A;  1U48 A;  1I94 K;  4DV5 K;  3T7Z A;  3WXK A;  1C0T A;  1TK8 A;  3CG7 A;  1NK7 A;  2HHV A;  5AZI A;  4ISG A;  5CR4 A;  5DMR A;  3OYI A;  4GNI A;  1IV0 A;  1QZ6 A;  4CBU A;  3D45 A;  3TAP A;  3JS6 A;  4K0K K;  1BWF O;  4O8U A;  1BUP A;  3LM9 A;  5FPD A;  2WC9 A;  2FSN A;  3EZW A;  1ESV A;  4FWK A;  4I6M A;  4B9T A;  2P9L A;  4LSL A;  3K5M A;  4B08 A;  3J81 O;  4ELU A;  2HBJ A;  3HOT A;  2VCP A;  4FWM A;  4J2B A;  4I2Q A;  3MX2 A;  4CES A;  5I9E B;  4LF4 K;  3O1W A;  3C95 A;  4CZH A;  3AVN A;  3SZ2 A;  3FE1 A;  4EZ9 A;  5AQY A;  4DU3 A;  4DTS A;  3SNN A;  5H1S Q;  5DM7 L;  2O8C A;  1FW6 A;  4B9M A;  4CJK A;  4BRG A;  1SUQ A;  5C42 A;  4O44 A;  3C6H A;  2G8W A;  2BH1 A;  3ZX2 A;  4CEE A;  1Y97 A;  1D9F A;  5C25 A;  3ZSX A;  1RDC A;  4GVM A;  1A5V A;  2OPP A;  2NRH A;  5LL6 Z;  1IG9 A;  4LF8 K;  2A40 A;  4FWR A;  1NJZ A;  2CH5 A;  2HMI A;  1N8R O;  4RWT A;  1J9A A;  1HYV A;  1S1X A;  4BRK A;  4GKK K;  2JWL A;  2O8D A;  1V4T A;  1IKV A;  1VSM A;  4FLZ A;  4B3M K;  4HVJ A;  1IKY A;  1RFQ A;  3TTF A;  1RTD A;  4IKF A;  3LP3 A;  1MDU B;  3PX4 A;  3P1G A;  2WTU A;  5J2M A;  4H03 B;  3I8D A;  3I0S A;  1VQP N;  1Q81 O;  3Q7B A;  3D7E O;  1L3U A;  4W5Q A;  1VQL N;  4BRE A;  4OLB A;  5LY3 A;  4FWL A;  3ID6 A;  2V51 B;  4E89 A;  5M1F A;  3ZSV A;  4DR4 K;  1B92 A;  3KZB A;  3O4N A;  5SWM A;  3L8B A;  4DTN A;  4YOW A;  4Z4C A;  1XQS C;  4E7H A;  2JWK A;  5HRP A;  2W6L A;  3CCE N;  3SJJ A;  2Q97 A;  2IVN A;  1EET A;  2X78 A;  3HL8 A;  1BIS A;  2DPN A;  4FWP A;  2AP1 A;  5ADX H;  4IFE A;  5LJV A;  4JI7 K;  4FWQ A;  3K5O A;  3N4Q A;  3AA4 A;  2KFZ A;  2BUP A;  1GLF O;  3O6W A;  3JSM A;  3J7Z O;  2XY8 A;  1JLB A;  3OYB A;  1J5E K;  2NUB A;  2O8E A;  3TTD A;  4CW7 B;  1IG8 A;  3KLH A;  1BU6 O;  4JKH A;  5KGW A;  3ENB A;  4X66 K;  2HNY A;  4JHD A;  3ZX3 A;  4BQL A;  4BVP A;  5IWA K;  2X6S A;  5AQH A;  2F9T A;  4KB1 A;  2UUB K;  1VSJ A;  1RBS A;  4H4M A;  2OZS A;  4IDK A;  2PY5 A;  4AHT A;  1OH7 A;  3KD5 E;  2FBT A;  2IIR A;  1C1B A;  1HKG A;  4OPK A;  2WUS A;  4KPY A;  4CJ7 A;  3T1Y K;  3BZK A;  1IO2 A;  3IG1 A;  4CE9 A;  1W2B M;  3MN7 A;  2PAV A;  4EAH D;  4KHQ A;  1BL3 A;  1WN7 A;  2B5J A;  3WNH A;  3FZM A;  4FK0 A;  1NWK A;  4BRI A;  3DLR A;  5HBM A;  4H0X B;  5IT9 O;  2QM1 A;  1ITG A;  4CJV A;  3NFA A;  4JI5 K;  3S3M A;  1W9H A;  1IBK K;  4B1Z A;  3SYZ A;  4IFV A;  4KHW A;  1J54 A;  4ILG B;  1E4F T;  3TSQ A;  1CLQ A;  1G99 A;  2KW4 A;  3KHY A;  3MCA B;  3NVM A;  2DTU A;  4CJE A;  3OYN A;  3WT0 A;  5F2R A;  2QWM A;  3NHG A;  1RT5 A;  3K57 A;  2E2P A;  3OJS A;  1RTI A;  5C24 A;  3CME N;  4DSI A;  2QWR A;  4FJX A;  4OPJ A;  3MXJ A;  2BE2 A;  4IFY A;  3DLL L;  1NLV A;  3NMU A;  5AQK A;  3RR7 A;  2ITG A;  3D0P A;  4DUY K;  4GKJ K;  3CM5 A;  4H0O A;  4BQZ A;  2ASP A;  1S1V A;  1LWC A;  4O55 A;  5AQR A;  3CCJ N;  2GV9 A;  3A8Y A;  4G9Z A;  4CZE A;  4AHU A;  3C6U A;  1QVF M;  1K73 O;  4M3W A;  3B8A X;  3S3N A;  2QKB A;  2QEX N;  2RKI A;  3P39 A;  3AAR A;  2ZJP L;  3HM8 A;  3IKM A;  2A1R A;  4CD3 A;  1OH5 A;  4IO9 L;  4OKK A;  5J1E A;  4OGE A;  1KAX A;  4WF9 L;  3AA2 A;  4CEQ A;  4Z4G A;  1LV5 A;  2O8C B;  1XC3 A;  3BDP A;  4C23 A;  4Q5V A;  1YUW A;  1I39 A;  1S5J A;  1IKW A;  3MN5 A;  3VEN A;  1YI2 N;  2G8H A;  4NCB A;  3HJF A;  1HQE A;  1LWE A;  3WUH A;  3MXM A;  4J2D A;  4V19 S;  3RMB A;  1E3M A;  1K8K B;  4N76 A;  3TWH A;  4CJU A;  4PKI A;  2Z1G A;  1EP4 A;  2UYT A;  3OYM A;  1NGC A;  2D0B A;  3H3N O;  3T1H K;  4AHC A;  3QIO A;  4BRD A;  3RWU A;  4AHS A;  4M3X A;  5MLC Q;  3FFI A;  4C1N K;  2HVH A;  2O8D B;  4N47 A;  1TAU A;  2YV0 X;  5GIO A;  4BE2 A;  1BA0 A;  4EFH A;  2Y1J A;  4C8M A;  4GV6 A;  5AQT A;  5TKW A;  4KTZ A;  1UAX A;  3CMA N;  2VYP A;  5I42 A;  3NGI A;  3NAE A;  1RDA A;  1MWM A;  3QER A;  1XNQ K;  1RBR A;  1C0F A;  3SPZ A;  1VQ8 N;  3OBW A;  5AQI A;  1LAW A;  2NRZ A;  2UXD K;  4DTP A;  3LL3 A;  4CHP A;  1XMQ K;  4FLU A;  1NK8 A;  4AM6 A;  5BRE A;  4FJM A;  5AQG A;  3DLH A;  3UE5 A;  1KTQ A;  5GAE P;  1C0U A;  3CFR A;  3FZK A;  4DR1 K;  1VRT A;  4KAZ A;  3ATV A;  4BRH A;  3EYZ A;  3WNG A;  3DLB A;  4BC2 A;  2VWJ A;  2ETJ A;  1NKC A;  1GLE G;  3KK3 A;  4BE0 A;  2E1Y A;  4DB3 A;  5FRN A;  2G8F A;  1K6Y A;  3T19 A;  1YIJ N;  2LSN A;  3C7N B;  4HUG A;  4LF7 K;  1EWR A;  1WSI A;  2CGK A;  1NNE A;  1A5W A;  1IH7 A;  4JHD B;  1D5A A;  4K43 A;  3TAF A;  2UUC K;  4O0I A;  4DTJ A;  3S3O A;  1RBT A;  3PSF A;  3ZX0 A;  3CCM N;  4CF1 A;  3U3Y A;  5KTQ A;  3M3Z A;  3E01 A;  2HF4 A;  1KVC A;  1RDW X;  4KB0 A;  2HOE A;  1WSH A;  1YJW N;  3ATU A;  4PY5 A;  3KK7 A;  3NGZ A;  4KFB A;  4DFM A;  4IEE A;  1H1V A;  5EOY A;  2YHB A;  3I33 A;  2HBM A;  2DFH A;  4FJG A;  1ILY A;  3F9K A;  2IOC A;  4IG3 A;  1OVQ A;  1S3X A;  5AQV A;  3OS0 A;  3CJ1 A;  4L3Q A;  4LH5 A;  4A61 A;  3EEQ A;  3PSI A;  4DSE A;  5AQU A;  1RNH A;  3QET A;  3MEE A;  1TYQ A;  2IAJ A;  4DWI A;  2KFN A;  1BI4 A;  4JI6 K;  4FW2 A;  2QTD A;  3V9Z A;  2A3Z A;  2ZD1 A;  2P9I B;  3DRR A;  5LJW A;  4CBX A;  3K5N A;  3SUN A;  3DRS A;  3AO2 A;  3IFR A;  1NGG A;  2A5X A;  1MA9 B;  5AFU H;  2YJF A;  3CPE A;  3KD1 E;  4RW7 A;  5TKY A;  3JYT A;  2HHX A;  1EWQ A;  4JI3 K;  4DKW A;  3WEE A;  4FWO A;  4JKB A;  4RCH A;  1VQ4 N;  2EX3 A;  3GBT A;  4CHZ A;  3VER A;  5KPT A;  3V4I A;  3CCU N;  2CGJ A;  3KJV A;  1HJO A;  3LZI A;  4BRF A;  5M1Q A;  4K25 A;  4NB4 A;  3CFO A;  4YOU A;  1HLU A;  4JD2 A;  1IBL K;  1DGK N;  2RN2 A;  2JLE A;  1KVA A;  3LM2 A;  3C0B A;  4LY7 A;  4KH4 A;  4B1U B;  4OKJ A;  4J8F A;  3HZ6 A;  4CZF A;  1SAZ A;  1K9M O;  3L2V A;  5HLF A;  1EO1 A;  4JK7 A;  2FF6 A;  2B6A A;  3FZH A;  5AQQ A;  5AQX A;  5GAD P;  3L3U A;  3H46 O;  1YTU A;  4B9N A;  3RSE B;  2Q2R A;  4C8K A;  3SQ4 A;  2HHW A;  4M3Z A;  4DTX A;  3WXL A;  1K8A O;  2E20 A;  3QEX A;  1X9J A;  4JEP A;  4IOC L;  1L3V A;  3G10 A;  5KPZ A;  1DLO A;  2P9N A;  5GIN A;  3SBG A;  3MED A;  1DTQ A;  3DXK A;  4A5B A;  2YNG A;  3HI0 A;  3DMJ A;  2OTJ N;  4B3R K;  1WAF A;  3O8M A;  4O5B A;  2Q0U A;  4OVL A;  1WBB A;  2HNZ A;  1S1T A;  1VAZ A;  4KO0 A;  3GE1 A;  5C15 A;  1JXE A;  2Y1I A;  2HST A;  2IS3 A;  3K9K A;  3V9S A;  4BGA A;  3SUP A;  4FJ7 A;  4DV0 K;  4K8Z A;  3LDP A;  2OPR A;  3NH2 A;  1YAG A;  4EHT A;  4EIA A;  3P31 A;  3R6M A;  4MDB A;  3M8S A;  3DM2 A;  4FYD A;  4BR4 A;  3S9H A;  1SZ2 A;  4DSF A;  3A5M C;  3VQA A;  3F73 A;  4NXN K;  3VQP A;  3AVI A;  4BR5 A;  5EVZ A;  1RGI A;  4CHY A;  1TGO A;  4WQ5 C;  1SV5 A;  3THX B;  3CQX A;  3CQY A;  2KTQ A;  4K8X A;  1BHL A;  3H3O B;  3LDQ A;  3H6E A;  4F9O A;  3SCX A;  2IGI A;  2FBX A;  2P9P B;  1GLJ O;  2KZM A;  4CF0 A;  5BR8 K;  5A2Q O;  3AVK A;  3KK2 A;  3DLK A;  1EKE A;  4WQ5 A;  3AO4 A;  1BOT O;  2QI2 A;  3DLG A;  2BTF A;  3CCS N;  1WSF A;  1RIL A;  3VF2 A;  2E2Q A;  1S9G A;  4DV3 K;  4Y1C A;  5AQN A;  1QHA A;  3F5T A;  4BR2 A;  2E4L A;  3T1A A;  4CJP A;  2Q36 A;  1QVG M;  1GLC G;  3QBX A;  4XIU A;  1VQN N;  1ZBH A;  3KKR A;  5D3G A;  3MN6 A;  4CK2 A;  3O08 A;  3UKU A;  1U2V A;  2PBD A;  1CZA N;  5AQZ A;  3IDH A;  1VQM N;  4B3S K;  3RRH A;  3QB0 A;  4LSN A;  3CET A;  4IJN A;  2RF2 A;  1N5Y A;  1W0H A;  3H1V X;  1OKJ A;  3ZT4 A;  1X9S A;  4DV6 K;  3VGK A;  2E2O A;  4BWJ A;  3TAQ A;  1FKO A;  5J2P A;  3SMP A;  3T69 A;  4E19 A;  4DQ8 A;  5C2D A;  2V52 B;  4PKH A;  1W97 L;  4M3R A;  1NMN A;  3AVH A;  3WEE B;  4IOA L;  4H8K A;  4BR0 A;  4LF5 K;  2QKK A;  3HPG A;  5BRD A;  3IUC A;  3NF8 A;  5LMN K;  4CZM A;  2OCE A;  4NLC A;  3H08 A;  3LAK A;  3NH0 A;  4DR6 K;  2W6K A;  3QNN A;  3SI6 A;  4QS9 A;  3IRX A;  3DI6 A;  3LDS A;  3H45 C;  3G0Z A;  3U4L A;  5FPM A;  4CIE A;  2NRW A;  3PLA A;  3BEX A;  1ATR A;  4IBN A;  4OKE A;  3L4I A;  3SAG A;  5JLH A;  3VEO A;  5M1K A;  3O9R A;  3KKS A;  5AQM A;  3NDK A;  4DV2 K;  3U6F A;  1YIT N;  2QXF A;  2VGN A;  1UA0 A;  5K14 A;  4DFJ A;  3A5L C;  4IWV A;  1REV A;  3O3F A;  1JL2 A;  4HWI A;  4DHY A;  4GV3 A;  1T6D A;  3LAL A;  5FLX O;  2OA8 A;  3E9L A;  3O9S A;  3VQ4 A;  4FJH A;  4JKE A;  5M1P A;  5DM6 L;  3TTC A;  4EP4 A;  1DTT A;  3QIC A;  4MQ3 A;  4DTO A;  3NGY A;  1YTA A;  1EQY A;  4FPB A;  1SL1 A;  4PWD A;  4FJJ A;  2HMP A;  2A1S A;  3E1Y A;  3TSP A;  3TR8 A;  4DSJ A;  1QHT A;  4A62 A;  1XWL A;  4WFN L;  4J2A A;  4XH4 A;  5CZ1 A;  5EY4 A;  3DOL A;  1VQO N;  3C6T A;  1TKX A;  1Q7Y O;  3A5N C;  2NRR A;  3VEY A;  2O8F A;  4KH6 A;  1WSG A;  5AQO A;  4DQP A;  3LZJ A;  4IJA A;  1KLN A;  2YNI A;  4CER A;  2ITM A;  3D6R A;  2P9S B;  2R7Y A;  5CE3 A;  4BR7 A;  3AA3 A;  3UB5 A;  3AVL A;  4QCL A;  3THV A;  4AIL C;  4CJW A;  4YOV A;  5M1O A;  3HYF A;  2XY6 A;  5BPN A;  1U47 A;  3D2E B;  1D4X A;  2PZS A;  3DOK A;  1S1W A;  4DF8 A;  3THW B;  1XNR K;  1C0M A;  2D0P A;  3VQB A;  2X74 A;  1R59 O;  4YHH K;  1RT3 A;  3QLH A;  2HHS A;  5C2F A;  5C12 A;  1T3V A;  3QBW A;  3TAE A;  2AA4 A;  1Q9X A;  1QZ5 A;  3OYF A;  3IMX A;  4FZZ A;  4Z4E A;  1GOB A;  3U9Z A;  3PO5 A;  3C6A A;  4CEO A;  4M63 C;  3UKR A;  3GOI A;  3AGR A;  3VQ5 A;  2FSK A;  2YKM A;  2P1J A;  2HHH K;  3ZET B;  4RW4 A;  3EE9 A;  3UKU B;  1X9M A;  1IJJ A;  1U2V B;  2KHO A;  2HBL A;  4H0P A;  4H0T B;  3AVG A;  1JCG A;  3CCV N;  4FM1 A;  4GV9 A;  2QXL A;  3ISN C;  4RW9 A;  1Z25 A;  1TV6 A;  1NK9 A;  4RG8 A;  4M3U A;  2ZM6 K;  1N36 K;  2YHW A;  2O4G A;  4CBW A;  3SUQ A;  1KAZ A;  4FLT A;  3AO3 A;  4RW8 A;  4CED A;  4A2B A;  4M3T A;  3BF1 A;  4FOI A;  4FCY A;  4PL8 A;  4A57 A;  3DLE A;  3NVK A;  1TL3 A;  2NRT A;  1TK0 A;  1BDG A;  5SZT A;  3HT3 A;  3J80 O;  4CJ4 A;  5AZI B;  5FPE A;  3MEC A;  4ILJ A;  5GAG P;  4KHS A;  3LPT A;  1TKZ A;  4M45 A;  1FJG K;  4IOX A;  1S9E A;  3EKS A;  5KQD A;  4CFD A;  3TI0 A;  2G8K A;  4U67 L;  3C94 A;  2Z1H A;  5BRF A;  3J7Y P;  2W41 A;  4B8C A;  4BRC A;  4CCH A;  3I0R A;  4I6M B;  2P9L B;  1YJN N;  1D8Y A;  5AQW A;  5HL7 L;  4Y1D A;  1NM1 A;  2GTD A;  3EO3 A;  4I7F A;  3VEX A;  4OO1 J;  4K42 A;  2D0O A;  3E66 A;  4BRQ A;  1EXQ A;  1BA1 A;  3ALY A;  5GIP A;  2VG7 A;  3BUZ B;  3KLF A;  1WNS A;  1OVY A;  1HKC A;  1SQK A;  1J53 A;  1ATN A;  3KK1 A;  1JLF A;  3M8P A;  3WNF A;  3FFK B;  4FWS A;  3CC7 N;  2IC3 A;  1NGH A;  3SBT A;  1Z26 A;  2EHG A;  2OPQ A;  2QWO A;  3VF6 A;  1BIZ A;  3VOV A;  3FGU A;  3NE6 A;  2YX6 A;  4GW6 A;  3F2K A;  2I7N A;  5AFU A;  3ZT3 A;  1NG9 A;  2NZT A;  1VSH A;  4I2P A;  4CZJ A;  3ZCM A;  1KFD A;  2O8B A;  2A41 A;  4IEI A;  4R5P A;  3NF7 A;  4NO7 A;  3M8R A;  4NCA A;  4NLB A;  2CGL A;  5T7B A;  4DQR A;  4DV1 K;  1QSL A;  3OJU A;  4G1Q A;  1C1A A;  2D0A A;  5AQF A;  3THY A;  4JAX A;  4OX9 K;  2UXC K;  3ZSZ A;  4CJS A;  4JV5 K;  1A5X A;  4E7K A;  2O8F B;  3VEW A;  1C0G A;  5F0X A;  3V1Q A;  4FO0 A;  1QQM A;  4H0Y B;  3D2F A;  3DXM A;  3BZC A;  4OGC A;  4E7J A;  3C65 A;  2E1Z A;  4ID1 A;  3SMS A;  3O4Q A;  1XC9 A;  3MX5 A;  3CD6 N;  2FBV A;  3PIO L;  1JLQ A;  1VHX A;  3QEI A;  5B8H A;  4FJN A;  3HO1 A;  1T6C A;  1ZBU A;  4AQY K;  5EXW A;  1ATS A;  3M5R A;  1SS6 A;  4DSK A;  4DMN A;  1XHZ A;  4PA1 A;  4FWN A;  1EX4 A;  1U04 A;  3OYG A;  2O8E B;  4I9Q A;  3L2U A;  1Q8I A;  4CJR A;  3SV4 A;  3K5L A;  1RTJ A;  4CJ5 A;  2FLO A;  5HRS A;  3CJC A;  3ULE A;  4DR7 K;  1TUY A;  4DQQ A;  4DQI A;  2ZWH A;  4BRO A;  4B9L A;  2OPS A;  2P9U A;  4NYF A;  4W5T A;  1JLA A;  1OH8 A;  4KKO A;  3FZF A;  3EE8 A;  2QWN A;  1NJW A;  1VQ9 N;  1WB9 A;  4CFB A;  1SKW A;  2FBY A;  3U8X A;  1SL2 A;  4BWM A;  3K9J A;  1N6Q A;  1YT3 A;  1U49 A;  1RBV A;  4L8R B;  4DTU A;  4IG0 A;  3AVB A;  4ELT A;  3ITH A;  1NK6 A;  3A5O C;  1CZB A;  1WUA A;  3PUF A;  4JLH A;  3HVT A;  4FZX C;  1ZBL A;  4ELV A;  4F4K A;  3PO4 A;  1HPM A;  3RMD A;  5F1X A;  5CYM A;  3OYC A;  4E7L A;  5BN8 A;  1DEJ A;  1LWF A;  4AHR A;  4HCC A;  3OYA A;  4PUO A;  4NYN A;  1HR0 K;  4CF8 A;  4EP5 A;  1JLC A;  3ULD A;  3ZLJ A;  4H5R A;  3K58 A;  3OW2 M;  3NCI A;  3WXJ A;  3R8E A;  4CIG A;  3IS9 A;  4FK4 A;  2HHT A;  4FSV A;  4R79 A;  1JCF A;  3CYM A;  4JRP A;  2Z1I A;  1VSF A;  5KGX A;  3ZEU A;  2E2N A;  3V81 A;  4AM7 A;  3L2R A;  4Z4H A;  1T7P A;  4BAC A;  4E1J A;  3SV3 A;  2OYQ A;  2CH6 A;  1TUU A;  3K59 A;  3SK3 A;  2NRV A;  5BR9 A;  2EWS A;  3VQD A;  2H3G X;  5KPR A;  1HNZ K;  4OPA A;  5C0Y A;  1FKP A;  2W42 A;  3HRG A;  3CCQ N;  3RTV A;  2OTL N;  3QIN A;  1YF5 L;  3WXM B;  4CEB A;  4JK8 A;  4CF2 A;  2ZGY A;  3NF9 A;  2D1K A;  3K0S A;  4X62 K;  3AGK A;  4YOR A;  3HTV A;  3GL1 A;  1DKG D;  5E26 A;  1KLM A;  4N56 A;  4FVU A;  1UA1 A;  4CJL A;  3RMC A;  5GAH P;  1ASV A;  5AQJ A;  2FSJ A;  1YJ9 N;  4FLV A;  2ZJR L;  2YNF A;  3CI5 A;  1VQK N;  4WE1 A;  4KI4 A;  3QEP A;  2V7Y A;  4WCE L;  3I56 N;  3CFP A;  4YFU A;  4JYA K;  3EL2 A;  3ZT1 A;  3SJH A;  1X3N A;  4LC9 B;  4BRN A;  1VK0 A;  4PQU A;  2P9K A;  2HHQ A;  4HCB A;  1QQO A;  3HOS A;  4JI1 K;  4B9U A;  1S22 A;  3CC4 N;  3OVN A;  4CK1 A;  4CF9 A;  1SKS A;  4DR2 K;  4FJI A;  1XUP O;  4X64 K;  3LP1 A;  3LAN A;  1TAQ A;  3OY9 A;  3TPQ A;  3M1F A;  1S72 N;  3VEV A;  3AA5 X;  2G8V A;  2XY5 A;  3QEW A;  2HVI A;  1YVN A;  1CZ9 A;  2QW9 A;  3KLG A;  4UY8 O;  1RT2 A;  4CGG A;  1HNX K;  1LCU A;  1VSK A;  4KHU A;  5BRH A;  5FDL A;  3NBP A;  3OYJ A;  4LH4 A;  1X9W A;  3I8B A;  4O0J A;  3UIQ A;  2QK9 A;  1HUX A;  4ICL A;  3ZSR A;  1L5U A;  4C8L A;  4BC4 A;  3PV8 A;  3VN5 A;  4OPH A;  2WBN A;  1TKD A;  4ISF A;  5JIC A;  3CCR N;  1VSE A;  4H0V B;  1LAV A;  2P9U B;  4C8N A;  3QO9 A;  4WYB A;  4CEA A;  1BQN A;  3O9Q A;  4CD1 A;  2VWB A;  4CHN A;  4BRL A;  1HYZ A;  1RT4 A;  1C6V A;  2F9W A;  2HB5 A;  2NLX A;  3BP8 A;  2VQF K;  1WLJ A;  1IKX A;  3QEV A;  3HVR A;  4KRE A;  3VQQ A;  4IO8 A;  1NU0 A;  4YOX A;  3CER A;  1J6Z A;  4JI0 K;  4KTW A;  2I5J A;  2Q31 A;  3QDK A;  2ZJQ L;  3NH1 A;  5J2Q A;  2WFB A;  4LF9 K;  1KAY A;  3HM9 A;  1BGX T;  3KVG A;  1TYQ B;  1BI4 B;  3ID8 A;  4HUE A;  4WFA L;  4FJ9 A;  3R1X A;  2HND A;  4E3S A;  1NGF A;  3V9X A;  2BGG A;  1GOA A;  2VG6 A;  3VTH A;  4CZK A;  4B1Y B;  2KLA A;  1NGB A;  4LD0 A;  3MWP A;  5E84 A;  1GLA G;  3LDN A;  3P5J A;  1QTM A;  2F8S A;  1VSD A;  2A42 A;  1Q86 O;  4B3O A;  1GLD G;  3VGL A;  2ASO A;  2BAN A;  3MWT A;  2ZGZ A;  5AQL A;  4DLE A;  3VQ8 A;  3AAP A;  4M41 A;  4O8K A;  3AVM A;  1TVR A;  4Z4I A;  5CYQ A;  3SUO A;  4CK3 A;  4B9V A;  1U6Z A;  3FZL A;  5JS2 A;  3ENH A;  1N34 K;  1NJY A;  1P90 A;  4JD2 B;  1HYS A;  4O5F A;  5JVH L;  1MWK A;  4FK2 A;  4Z4F A;  2YHX A;  3E9O A;  1HKB A;  5LMU K;  1C1C A;  5DK5 A;  1FK9 A;  3M6G A;  4DUZ K;  4ZTJ A;  2FF3 B;  4C8O A;  3LP2 A;  3FR0 A;  5M1N A;  4CGH A;  5EU7 A;  3LDO A;  1NK0 A;  2HHU A;  1RDD A;  3T3F A;  1FXX A;  1X1P A;  1KFS A;  2GWK A;  3G25 A;  2YNH A;  3SQ1 A;  3ZYY X;  1T8E A;  4GY2 B;  4BG8 A;  3G6E N;  1S6P A;  2P9N B;  4QOZ B;  3MCP A;  2YJE A;  3P4I A;  1T03 A;  1HNV A;  3SAH A;  3MDQ A;  2D4W A;  1NMD A;  3DXK B;  3VQ6 A;  4OLA A;  2Z1J A;  3BGR A;  4CJT A;  4KHN A;  5CHI A;  2XO7 A;  2P9K B;  4CZG A;  4DS4 A;  1RCH A;  3O4W A;  5ELZ A;  1JL1 A;  1NJI O;  1K8K A;  4GMJ B;  3O1B A;  3LPU A;  4M3Y A;  1HJR A;  3HPH A;  4DR3 K;  1XI1 A;  2YI1 A;  3CXC M;  1Y64 A;  4HTL A;  4KTQ A;  2GEM A;  4ILH A;  4EZ6 A;  4FPA A;  4CHO A;  1YHQ N;  3O3G A;  1D9D A;  3WNE A;  2JGU A;  4KV8 A;  3AY9 A;  3OYD A;  3KWG A;  2P5G A;  4DF4 A;  1V4S A;  4DV7 K;  3R3L A;  2PYJ A;  3DWL A;  4XH1 A;  4AHV A;  1KCF A;  4JKD A;  1KVB A;  3GG4 A;  3BF3 A;  1X3M A;  4DV4 K;  5HRO A;  3TAN A;  3ZSY A;  4KHP K;  2O4I A;  3W0L A;  5AR0 A;  4FLY A;  4DSL A;  3CQ8 A;  4JKC A;  3KTQ A;  3V6D A;  1W7A A;  4JK9 A;  1ZYQ A;  1M1K O;  3TU5 A;  1GLL O;  4KBO A;  4B1X B;  3JAM O;  3F9M A;  4MFB A;  1NKB A;  1QQN A;  4EHU A;  2GUI A;  2HBK A;  3B6O A;  4E1N A;  1VSI A;  2QWQ A;  2NNW A;  4B9Q A;  1L3T A;  1HNW K;  3O5B A;  1S6Q A;  3C7N A;  2BDP A;  2W40 A;  3G71 N;  1YXQ A;  3TAM A;  2VQE K;  5JMV A;  2XRI A;  4CEF A;  3CIP A;  4CEZ A;  4YNQ A;  4CFA A;  2OAN A;  3VQ9 A;  1ZBS A;  2FXU A;  3VES A;  5KRT A;  4KRF A;  4BC3 A;  3RR8 A;  4HTU A;  3OA9 A;  3R9P A;  2DY4 A;  3ZSQ A;  2F4V K;  4JKG A;  1NBW A;  4DFK A;  2GWJ A;  2A6A A;  3CJ7 A;  4PHT X;  3O9U A;  4IXC A;  4Y0W A;  5AJ3 K;  1M90 O;  2YHY A;  4F3O A;  4TSX A;  2XHB A;  4FM0 A;  3O9T A;  3PX0 A;  1NGD A;  3J8A A;  2ZQB A;  3VET A;  3P83 D;  3SLC A;  4X65 K;  4JNE A;  3DAW A;  4CGD A;  4IZ9 A;  5BN9 A;  4DFP A;  4H5W A;  4MLE A;  3OYE A;  1NOZ A;  4UQG A;  1CXQ A;  2P9I A;  3O3H A;  4F3T A;  4ZTF A;  3SPY A;  1R0A A;  1F21 A;  3CPW M;  2UU9 K;  1JLE A;  4BRA A;  1NGJ A;  2J4R A;  2B4J A;  2UUA K;  1RT6 A;  2Q0R A;  3CJB A;  1NKE A;  1NK4 A;  3PY8 A;  2YKN A;  1VRU A;  3OBY A;  3V1O A;  4DCH A;  3DJC A;  4AF1 A;  1ASW A;  5C10 A;  3RVC A;  3QFP A;  1O1W A;  4B3T K;  3W3D A;  3QML A;  3AVF A;  3WQT A; 
#chains in the Genus database with same CATH homology
 4PUO A;  4NYN A;  3L2Q A;  4B9S A;  1IKV A;  2X6N A;  1WSJ A;  1VSM A;  4CF8 A;  4EP5 A;  1JLC A;  4FLZ A;  3AVK A;  3ULD A;  3KK2 A;  4HVJ A;  1IKY A;  3DLK A;  1RTD A;  4IKF A;  1EKE A;  3LP3 A;  4F2S A;  3K58 A;  3PX4 A;  3NCI A;  3AO4 A;  5CY4 A;  3DLG A;  4M42 A;  3P1G A;  5J2M A;  4CGF A;  4CIG A;  4CJ3 A;  1WSF A;  3IS9 A;  1RIL A;  3OYK A;  3EZ5 A;  1HNI A;  4FK4 A;  3I8D A;  3I0S A;  1S9G A;  2HHT A;  3CYM A;  4Y1C A;  4CJQ A;  1TK5 A;  1L3U A;  3QNO A;  5E41 A;  3L3V A;  4W5Q A;  4JRP A;  2Z1I A;  1VSF A;  5KGX A;  2WOM A;  5HP1 A;  4DTR A;  4OLB A;  1XHX A;  2E4L A;  1U45 A;  3T1A A;  3V81 A;  4CJP A;  3L2R A;  4Z4H A;  1T7P A;  4E89 A;  4BAC A;  3ZSV A;  4CIF A;  1B92 A;  3SV3 A;  3MEG A;  2PYL A;  4XIU A;  3O4N A;  5SWM A;  3K59 A;  3L8B A;  2OYQ A;  4F8R A;  1ZBH A;  3KKR A;  5D3G A;  4DTN A;  4CK2 A;  3VQD A;  2HHW A;  1RDB A;  4Z4C A;  4E7H A;  5HRP A;  1FKP A;  2W42 A;  2WON A;  3RTV A;  3SJJ A;  3RRH A;  4LSN A;  1B9F A;  1EET A;  2X78 A;  3HL8 A;  1BIS A;  2RF2 A;  3QIN A;  1N5Y A;  1W0H A;  4H4O A;  4CEB A;  1RT7 A;  4FW1 A;  4O4G A;  4CF2 A;  3K5O A;  3AA4 A;  2KFZ A;  3NF9 A;  3ZT4 A;  4JS5 A;  3JSM A;  1S1U A;  1KLM A;  2XY8 A;  1X9S A;  1JLB A;  4N56 A;  5KI6 A;  3VQE A;  1QE1 A;  3OYB A;  2NUB A;  1UA1 A;  4BWJ A;  3TAQ A;  1FKO A;  5J2P A;  4E19 A;  4CJL A;  3KLH A;  3RMC A;  4BDP A;  2DFE A;  5KGW A;  1ASU A;  2HNY A;  1ASV A;  2AJQ A;  1L3S A;  4FLV A;  2X6S A;  4M3R A;  3QES A;  4KB1 A;  1VSJ A;  2YNF A;  3AVH A;  1RBS A;  4H4M A;  4WE1 A;  2OZS A;  4DLG A;  4IDK A;  4H8K A;  2PY5 A;  4AHT A;  3KD5 E;  2FBT A;  2QKK A;  3HPG A;  4KI4 A;  3QEP A;  4JS4 A;  1C1B A;  3NF8 A;  4OPK A;  3CFP A;  4KPY A;  4YFU A;  4OJR A;  1IO2 A;  3IG1 A;  4CE9 A;  3H08 A;  3LAK A;  3ZT1 A;  4CEC A;  3NH0 A;  4KHQ A;  1VK0 A;  4PQU A;  1BL3 A;  1WN7 A;  3A2F A;  3AO5 A;  3LWL A;  3QNN A;  2B5J A;  3SI6 A;  3WNH A;  4FK0 A;  2D0C A;  2HHQ A;  2RPI A;  1HPZ A;  3IRX A;  3DI6 A;  3LDS A;  1BCO A;  4HCB A;  4B9U A;  3DLR A;  5HBM A;  3OVN A;  1UOC A;  3G0Z A;  4CK1 A;  4CF9 A;  4CIE A;  4N5S A;  1ITG A;  4CJV A;  1SKS A;  3NFA A;  4IBN A;  3S3M A;  4OKE A;  1W9H A;  3OS2 A;  4J2E A;  3SYZ A;  3HST B;  4IFV A;  4FJI A;  4KHW A;  1J54 A;  4Q0B A;  3KKS A;  1CLQ A;  1QS4 A;  3LP1 A;  2KW4 A;  2GBZ A;  2DTU A;  3LAN A;  4CFC A;  4CJE A;  3OYN A;  1TAQ A;  3NDK A;  3U6F A;  5FRM A;  2QXF A;  4E7I A;  1QSS A;  3L2W A;  3NHG A;  1UA0 A;  3OY9 A;  1RT5 A;  4FVM A;  3K57 A;  3OJS A;  1RTI A;  5C24 A;  5K14 A;  4DSI A;  3MXI A;  4FJX A;  3AA5 X;  4DFJ A;  2XY5 A;  4AH9 A;  4OPJ A;  3MXJ A;  3QEW A;  2BE2 A;  2G8V A;  2HVI A;  1CZ9 A;  4IFY A;  1REV A;  3O3F A;  1JL2 A;  3KLG A;  1RT2 A;  4CGG A;  2ITG A;  1KRP A;  3RR7 A;  1JLG A;  2ATQ A;  3ZT0 A;  4FJK A;  3LAL A;  1NJX A;  4FJ8 A;  2OA8 A;  1VSK A;  3OYH A;  4Z0U A;  3D0P A;  4KHU A;  3VQ4 A;  4FJH A;  3CM5 A;  1BIU A;  5FDL A;  4CHQ A;  3KLE A;  3NBP A;  3OYJ A;  4LH4 A;  1HMV A;  4EP4 A;  1DTT A;  4DTO A;  4MQ3 A;  4O0J A;  3NGY A;  1YTA A;  4DU1 A;  3UIQ A;  2QK9 A;  3CM6 A;  1S1V A;  4ICL A;  3ZSR A;  1L5U A;  1SL0 A;  1LWC A;  4O55 A;  4C8L A;  1SL1 A;  1BQM A;  4PWD A;  4FJJ A;  4HHT A;  3PV8 A;  2Q3S A;  3VN5 A;  2A1S A;  2GV9 A;  1TKD A;  2KZZ A;  3TAB A;  3TR8 A;  4AHU A;  1QHT A;  3C6U A;  1XWL A;  2VWK A;  4DSJ A;  1VSE A;  4M3W A;  3HXM A;  3S3N A;  4J2A A;  3NF6 A;  1ZBF A;  5J2N A;  2QKB A;  2RKI A;  2ZE2 A;  2HW3 A;  1LAV A;  2A1R A;  5CZ1 A;  4C8N A;  3DOL A;  4ZHR A;  1GOC A;  3VA3 A;  4OKK A;  3V9W A;  3QO9 A;  3C6T A;  1TKX A;  4CGI A;  4HUF A;  5J1E A;  4OGE A;  4CEA A;  3ASM A;  1BQN A;  3AA2 A;  4CEQ A;  2D5R A;  2F96 A;  4Z4G A;  1LV5 A;  2G8U A;  4CHN A;  1WSG A;  1HYZ A;  1RT4 A;  1C6V A;  3AVJ A;  2HB5 A;  3BDP A;  4Q5V A;  1WLJ A;  4DQP A;  3LZJ A;  1IKX A;  1I39 A;  1S5J A;  1IKW A;  3QEV A;  1KLN A;  2YNI A;  4DQS A;  3HVR A;  2YHA A;  1NOY A;  4E1M A;  2G8H A;  4NCB A;  1HQE A;  4ID5 A;  2DFF A;  4CER A;  1CXU A;  1LWE A;  4KRE A;  3VQQ A;  3MXM A;  4J2D A;  3RMB A;  3QIP A;  2R7Y A;  4N76 A;  3TWH A;  3SQ0 A;  4CJU A;  3AA3 A;  4QCL A;  1YVU A;  2Z1G A;  3AVL A;  1EP4 A;  4KTW A;  4CJW A;  4AIL C;  3THV A;  2I5J A;  3OYM A;  2D0B A;  3HYF A;  3NH1 A;  5J2Q A;  2XY6 A;  1U47 A;  2PZS A;  3HM9 A;  4AHC A;  1BGX T;  3QIO A;  3DOK A;  1S1W A;  4AHS A;  3RWU A;  4KI6 A;  4M3X A;  1BI4 B;  4DF8 A;  4HUE A;  3FFI A;  3TAG A;  1J5O A;  4FJ9 A;  2HVH A;  2OZM A;  4N47 A;  1TAU A;  1C0M A;  2YV0 X;  2HND A;  3VQB A;  2X74 A;  4BE2 A;  1RTH A;  4E3S A;  3V9X A;  2BGG A;  1GOA A;  2VG6 A;  4I9L A;  1RT3 A;  3QLH A;  4BDZ A;  4C8M A;  2Y1J A;  2HHS A;  4LD0 A;  3P5J A;  4KTZ A;  1QTM A;  1UAX A;  2F8S A;  1VSD A;  4FXD A;  5FRO A;  3TAE A;  5I42 A;  3RRG A;  3NGI A;  1Q9X A;  4N41 A;  3OYF A;  3KIO A;  3NAE A;  1RDA A;  4B3O A;  3QER A;  1MU2 A;  3AVC A;  1RBR A;  4FZZ A;  4Z4E A;  3OS1 A;  1GOB A;  2BAN A;  3SPZ A;  3PO5 A;  1LAW A;  4CEO A;  4DTP A;  5KRS A;  5I3U A;  3OYL A;  3VQ5 A;  4CJF A;  4CHP A;  4DLE A;  2YKM A;  2P1J A;  4M41 A;  1HRH A;  3VQ8 A;  4FLU A;  1NK8 A;  1ZBI A;  4CGJ A;  4FJM A;  3AVM A;  1TVR A;  4RW4 A;  3DLH A;  4Z4I A;  5CYQ A;  3SUO A;  1KTQ A;  4DS5 A;  4CK3 A;  1C0U A;  1TL1 A;  4DTM A;  1X9M A;  2P5O A;  4B9V A;  3IAY A;  5JS2 A;  3AVG A;  3CFR A;  2KQ2 A;  4FM1 A;  1JKH A;  1VRT A;  2P51 A;  1NJY A;  4KAZ A;  2IDO A;  3EYZ A;  3WNG A;  3ISN C;  3DLB A;  4F2R A;  4FJL A;  3LP0 A;  1HYS A;  3K2P A;  3LAM A;  4RW9 A;  1Z25 A;  1TV6 A;  4FLX A;  1NK9 A;  2E6M A;  4FK2 A;  4Z4F A;  4RG8 A;  2VG5 A;  2VWJ A;  4M3U A;  2ETJ A;  1NKC A;  3ZT2 A;  3KLI A;  2O4G A;  3KK3 A;  4BE0 A;  5FRN A;  1C1C A;  3SUQ A;  5DK5 A;  1Q9Y A;  1K6Y A;  2G8F A;  4W5N A;  1FK9 A;  3T19 A;  4FLT A;  4ZTJ A;  4C8O A;  2LSN A;  3AO3 A;  3LP2 A;  4RW8 A;  5CZ2 A;  4CED A;  4HUG A;  1WSI A;  4CGH A;  4M3T A;  5EU7 A;  4FCY A;  1TKT A;  3DLE A;  1A5W A;  1NK0 A;  1IH7 A;  2HHU A;  4FJ5 A;  1RDD A;  1TL3 A;  3T3F A;  1FXX A;  1KSP A;  1LW2 A;  1X1P A;  5HRN A;  1TK0 A;  1D5A A;  5SZT A;  3TAF A;  1QSY A;  4O0I A;  3HT3 A;  4DTJ A;  1KFS A;  3S3O A;  2YNH A;  1WSE A;  1RBT A;  2FC0 A;  4CJ4 A;  3SQ1 A;  3MEC A;  4CF1 A;  3U3Y A;  5KTQ A;  1T8E A;  4KHS A;  2E6L A;  3E01 A;  3LPT A;  1TKZ A;  4M45 A;  1KVC A;  3HP9 A;  1S6P A;  4QOZ B;  1NK5 A;  4KB0 A;  1T03 A;  1WSH A;  4PY5 A;  1HNV A;  3VQ6 A;  4DG1 A;  1S9E A;  3NGZ A;  4KFB A;  4W5R A;  4DFM A;  4CFD A;  3TI0 A;  2G8K A;  4OLA A;  3C94 A;  1HQU A;  2Z1H A;  4W5O A;  2Z1J A;  3BGR A;  4CJT A;  4KHN A;  1UWB A;  4B8C A;  2YHB A;  3VQC A;  3AVA A;  4CCH A;  3I0R A;  1RT1 A;  2DFH A;  2XO7 A;  1D8Y A;  4FJG A;  4NCG A;  4DS4 A;  1RCH A;  3F9K A;  4JRQ A;  4Y1D A;  2IOC A;  4I7F A;  4IG3 A;  1JL1 A;  1LW0 A;  1QQC A;  3AO1 A;  3OS0 A;  4BDY A;  4FM2 A;  3RMA A;  4GMJ B;  3B6P A;  3LPU A;  5JS1 A;  3PX6 A;  4M3Y A;  1HJR A;  1EXQ A;  3HPH A;  4LH5 A;  1WAJ A;  3ALY A;  1XI1 A;  4DSE A;  2VG7 A;  1RNH A;  1BCM A;  3KLF A;  2XY7 A;  3QET A;  1WNS A;  3MEE A;  2IAJ A;  4DWI A;  2KFN A;  1BI4 A;  3ZSO A;  4FW2 A;  1J53 A;  4KTQ A;  3V9Z A;  3KK1 A;  1JLF A;  3VQ7 A;  4EZ6 A;  3M8P A;  2ZD1 A;  1G15 A;  1I3A A;  1JXB A;  3DRR A;  3AV9 A;  3DRP A;  3WNF A;  4CHO A;  3K5N A;  3SUN A;  2IC3 A;  3O3G A;  3WNE A;  2JGU A;  4KV8 A;  1D9D A;  4FLW A;  3DRS A;  3AO2 A;  3OYD A;  1Z26 A;  2EHG A;  2OPQ A;  3V9U A;  4DF4 A;  2P5G A;  1BIZ A;  2PYJ A;  2F8T A;  3NE6 A;  4GW6 A;  4AHV A;  1B9D A;  1KCF A;  4RW7 A;  3JYT A;  3KD1 E;  2HHX A;  3ZT3 A;  1KVB A;  4E0D A;  1VSL A;  1VSH A;  4I2P A;  4BE1 A;  3ZCM A;  1KFD A;  3M8Q A;  3HP6 A;  5HRO A;  4R5P A;  3TAN A;  3ZSY A;  2EX3 A;  1T05 A;  3NF7 A;  4KHY A;  3M8R A;  3DYA A;  4NCA A;  4CHZ A;  3V4I A;  2O4I A;  5T7B A;  3HPO A;  4DQR A;  4FLY A;  3KJV A;  1QSL A;  3MAQ A;  4DSL A;  3OJU A;  4G1Q A;  1C1A A;  2D0A A;  3LZI A;  3CQ8 A;  1RBU A;  5HRR A;  3KTQ A;  3SQ2 A;  3V6D A;  3VA0 A;  3CFO A;  1SKR A;  1ZYQ A;  1U4B A;  3EY1 A;  3TAR A;  3HK2 A;  3ZSZ A;  4CJS A;  2RN2 A;  2JLE A;  1A5X A;  3ZSW A;  4DU4 A;  4RW6 A;  1KVA A;  4E7K A;  4FZY A;  4LY7 A;  4MFB A;  4OKJ A;  1NKB A;  3V1R A;  2G8I A;  2GUI A;  3B6O A;  4E1N A;  3V1Q A;  1VSI A;  3U3G A;  3L2V A;  1L3T A;  5HLF A;  4OGC A;  1S6Q A;  2BDP A;  4B8A B;  2B6A A;  4QAG A;  3LWM A;  1U48 A;  4E7J A;  3L3U A;  1C0T A;  3TAM A;  1YTU A;  4B9N A;  4ID1 A;  4C8K A;  3SQ4 A;  2XRI A;  3O4Q A;  3CG7 A;  1NK7 A;  4CEF A;  1XC9 A;  1TK8 A;  2HHV A;  4CEZ A;  4DTX A;  4M3Z A;  4YNQ A;  4CFA A;  2FBV A;  5DMR A;  1JLQ A;  3VQ9 A;  3OYI A;  3QEI A;  3QEX A;  4FJN A;  1L3V A;  3HO1 A;  3G10 A;  1DLO A;  1ZBU A;  3D45 A;  3TAP A;  5KRT A;  3MED A;  1DTQ A;  4DSK A;  4DMN A;  3RR8 A;  1XHZ A;  4HTU A;  4PA1 A;  2YNG A;  1EX4 A;  1U04 A;  3DMJ A;  2DY4 A;  3ZSQ A;  4DFK A;  3OYG A;  1WAF A;  4I9Q A;  3L2U A;  1Q8I A;  4O5B A;  4B9T A;  4CJR A;  3SV4 A;  4LSL A;  3K5L A;  4TSX A;  4F3O A;  2XHB A;  1RTJ A;  3K5M A;  4CJ5 A;  5HRS A;  4OVL A;  4B08 A;  4FM0 A;  2HNZ A;  1S1T A;  4ELU A;  3PX0 A;  4J2B A;  4KO0 A;  4I2Q A;  4DQQ A;  4DQI A;  4CES A;  4B9L A;  2OPS A;  3C95 A;  1JXE A;  4NYF A;  4W5T A;  1JLA A;  2ZQB A;  3P83 D;  4KKO A;  2Y1I A;  2IS3 A;  3AVN A;  3SZ2 A;  3V9S A;  4FJ7 A;  3SUP A;  4EZ9 A;  4DU3 A;  1NJW A;  4K8Z A;  4DTS A;  4CGD A;  2OPR A;  3NH2 A;  3SNN A;  4CFB A;  4DFP A;  1SKW A;  2FBY A;  3M8S A;  3OYE A;  1SL2 A;  1NOZ A;  3DM2 A;  4BWM A;  4CJK A;  4B9M A;  3HJF A;  4UQG A;  1CXQ A;  1SUQ A;  4F3T A;  3O3H A;  1N6Q A;  1YT3 A;  1X9W A;  4FYD A;  4ZTF A;  1U49 A;  1RBV A;  5C42 A;  3S9H A;  3SPY A;  1R0A A;  4O44 A;  1F21 A;  4L8R B;  4DSF A;  3VQA A;  3F73 A;  2G8W A;  4DTU A;  4IG0 A;  3AVB A;  3VQP A;  4ELT A;  1JLE A;  3AVI A;  3ITH A;  1NK6 A;  2B4J A;  4CEE A;  4CHY A;  1TGO A;  1RT6 A;  1SV5 A;  1Y97 A;  1D9F A;  5C25 A;  1CZB A;  3PUF A;  4JLH A;  1RDC A;  3HVT A;  3ZSX A;  1NKE A;  2KTQ A;  4GVM A;  1A5V A;  2OPP A;  1NK4 A;  1BHL A;  1ZBL A;  4FZX C;  4K8X A;  4ELV A;  4F4K A;  3PY8 A;  3PO4 A;  2YKN A;  1VRU A;  3V1O A;  3RMD A;  1IG9 A;  3SCX A;  2IGI A;  2FBX A;  5CYM A;  2KZM A;  1NJZ A;  1ASW A;  3OYC A;  4E7L A;  4CF0 A;  2HMI A;  1J9A A;  1HYV A;  1LWF A;  1O1W A;  1S1X A;  4KRF A;  4AHR A;  3AVF A;  4HCC A;  3OYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...