4CJKA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 53
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjkA00
3K59A 1QHTA 5EU7A 3OYGA 1KLNA 4I9LA 5C24A 4CF1A 4CEQA 3LAKA 3TAMA 4CHZA 4DMNA 4ZHRA 3RTVA 3KLGA 1BQNA 4B08A 4HUGA 4DTOA 3SQ4A 1FXXA 1GOCA 3NF8A 3ISNC 4YNQA 2OPQA 1YT3A 1WSJA 3S3NA 3RR8A 1CZ9A 1C1BA 4HVJA 3V1QA 1NJZA 1RTHA 4OKJA 3OYKA 3RMAA 1TK5A 3NFAA 3SQ0A 3PY8A 2EX3A 3LDSA 2YNFA 4JRPA 2KFZA 1HNIA 3NBPA 1CXQA 4BWJA 5KRSA 3KIOA 4CJQA 2GUIA 4CCHA 1BI4A 3LP3A 4CEOA 2IC3A 4E7HA 1D8YA 1JLAA 4E7LA 3EYZA 1N6QA 3AO5A 1TK0A 3TANA 4B9MA 1U45A 2YNHA 3F73A 4NCBA 1RDBA 4CFBA 4RW6A 3WNGA 3OYHA 3VQDA 3TARA 4CIFA 3TAGA 4CHQA 3NCIA 5HLFA 1NK9A 4FLUA 3ZSQA 2G8WA 1BQMA 3HL8A 1TKZA 1KVBA 1JLCA 3SJJA 2G8VA 3SCXA 2DFFA 2HHUA 4DFKA 1X9WA 1SUQA 4Z4HA 4KPYA 1HPZA 3RMCA 1ZYQA 4IFVA 1TKTA 3B6OA 3IRXA 3V81A 4BDPA 4AHVA 4C8LA 3AVBA 1ZBHA 1BISA 4AILC 4M45A 4DQQA 4FJJA 4LSNA 4CK2A 1SL1A 4E19A 4CEZA 1T8EA 1ZBLA 1FKOA 4F8RA 2ITGA 1QTMA 3B6PA 3TAPA 2FBXA 4Z4FA 1I3AA 1RTJA 3NHGA 4KV8A 4CJ4A 3NH1A 2R7YA 4FJ9A 3QEVA 1KVAA 2P5GA 3I8DA 4AHUA 4K8ZA 4CGDA 1G15A 1Z26A 3D45A 1C1CA 2FBVA 4UQGA 1REVA 3DLBA 3PX6A 3HSTB 1I39A 1O1WA 4DTMA 3CFRA 2ATQA 2HVHA 3OYEA 4FJIA 1UOCA 4CF9A 4FW1A 2YV0X 4B9UA 4DLEA 3AVHA 5CZ1A 4EZ9A 2XY8A 3QIOA 4GW6A 4LH4A 1IKWA 4AHSA 3MEDA 1U04A 1WSIA 1D9FA 4DWIA 4IKFA 4B9TA 1HQEA 3VQ8A 4KKOA 2DFEA 4F4KA 4NCAA 1RTIA 3SUOA 3VQ5A 3HT3A 4FJNA 1WSHA 1CXUA 1RT2A 2VWKA 4GMJB 4H4MA 3VQAA 4CF8A 3ZT0A 3SYZA 1YTUA 2BDPA 4FJHA 3WNFA 1TAQA 4J2AA 3LP0A 1NK8A 1RT3A 2Z1GA 3DYAA 3MAQA 1SL2A 3AVNA 1S9GA 3CM6A 3AA5X 4TSXA 3PO4A 1RDDA 4I7FA 5CYMA 3MXMA 1XWLA 2ZD1A 4IFYA 4DG1A 3LALA 4W5QA 2HMIA 2YKMA 3NGYA 1L3VA 4FJLA 1EP4A 2RKIA 1UAXA 4KI4A 4BACA 3LPUA 3NF6A 3DI6A 3C6UA 1C1AA 3AO3A 3PX0A 1JKHA 4LH5A 3M8PA 4DTPA 3QEWA 3KD5E 3HYFA 4EP4A 4M3RA 3M8SA 1BCOA 1IKXA 2YHBA 1BCMA 3CYMA 3TI0A 3NH2A 2RN2A 4CGGA 1NK0A 5FRMA 1IG9A 1NOYA 3CQ8A 3OYLA 1TKDA 4DTSA 4CJLA 4B9LA 3NGIA 3LPTA 2KQ2A 3QLHA 3O3HA 1VSIA 3T1AA 3LAMA 3P5JA 4O4GA 3KK1A 3L2VA 3T3FA 4E0DA 4OGEA 4LSLA 3I0SA 4BE2A 4OKEA 1U4BA 4HUFA 1IKYA 2X6SA 1RBVA 2IS3A 1J9AA 3DMJA 5J2MA 3ALYA 4H4OA 3RMBA 4ZTJA 3VQBA 1UA0A 4F3OA 1TL3A 3QINA 3KK2A 3M8QA 3V9XA 4FLTA 3TAQA 4KHSA 1WSEA 4Q0BA 1ASWA 4FZYA 4JS5A 2G8IA 4DQRA 1HRHA 3SV3A 4M3XA 3QEPA 1WN7A 4ZTFA 4CHPA 3V4IA 1BI4B 4RG8A 3T19A 3CM5A 5E41A 1IKVA 3RMDA 2G8HA 3V9UA 2HW3A 2E6LA 4RW9A 1S1VA 2YHAA 3DOKA 5FDLA 2GV9A 3AVMA 3OS2A 3OYCA 3LP2A 4R5PA 1KTQA 1TKXA 3I0RA 3HK2A 4CFDA 4OPKA 1CZBA 4N56A 4E3SA 1KLMA 4W5NA 1VRUA 1QQCA 1LW0A 4KHNA 3TABA 1BHLA 2AJQA 1F21A 1GOAA 4CGFA 3SV4A 1DTTA 1KSPA 2OZMA 4M3YA 4CJSA 4CJUA 3HPOA 3V1OA 1DTQA 1T03A 4AHTA 4CHOA 4DQPA 4KFBA 4CJTA 4RW8A 3PX4A 1IH7A 1SL0A 5SWMA 2DTUA 3VA3A 3ZT4A 4QCLA 3QO9A 1D9DA 1A5WA 1LW2A 3WNEA 1X1PA 3DLKA 3QEIA 2PYJA 4FJ5A 4O5BA 5KTQA 4QOZB 1WSFA 2P1JA 2D0AA 1WSGA 1MU2A 3SI6A 3PO5A 1C6VA 3S9HA 3DRSA 3EY1A 3NF9A 3NDKA 4CJ5A 5HRNA 2QKKA 3P83D 4G1QA 4W5TA 4Z4GA 3OYFA 2Y1IA 1LV5A 3K5OA 4DS4A 2IOCA 1JLQA 4CEEA 2YNIA 3HJFA 4RW7A 4C8MA 4CF0A 1KCFA 2VG5A 5CZ2A 1QSYA 4JLHA 1ZBIA 3QERA 1UA1A 3JSMA 2PY5A 1VSDA 3V9ZA 1QS4A 3VQEA 4F2RA 1RBSA 4BDYA 3RRHA 4FJGA 2HHVA 1SKRA 1HMVA 1EKEA 2O4GA 2FC0A 1R0AA 1LWCA 3SQ2A 1W0HA 3WNHA 1JLFA 3KTQA 3IAYA 3QIPA 1YVUA 4DTNA 1QE1A 3SPYA 2IDOA 5J1EA 4KHWA 4ELVA 1VSKA 1RT6A 3IS9A 1WLJA 4CEDA 3IG1A 4C8KA 1L5UA 4OKKA 3V9SA 3U6FA 1Q8IA 3G10A 4E7KA 5FRNA 3OY9A 1RILA 3PV8A 1NK5A 5HRPA 3L2UA 4AH9A 4CJRA 3L2WA 3NE6A 1X9MA 1NKBA 2HVIA 4FM2A 4LY7A 4Q5VA 5J2PA 3SPZA 3K57A 4I2PA 2A1RA 1XHZA 1L3TA 1TK8A 3SQ1A 3ZSZA 4OLBA 2F96A 3KLEA 1N5YA 4FJ7A 5D3GA 1NK7A 3DRPA 2WOMA 4RW4A 4Z4EA 3QNOA 4Z4IA 4DSFA 5FROA 2HHWA 5K14A 1C0UA 5HBMA 1S1UA 4K8XA 4CIEA 4CF2A 3AVJA 1VSMA 3OVNA 2P51A 1ZBUA 1C0MA 4FXDA 1K6YA 2KZZA 4HCCA 4E89A 3FFIA 4FK0A 1A5VA 4DSKA 3K2PA 4FVMA 2BGGA 5JS2A 4HHTA 3TAEA 3KJVA 2XRIA 4E7IA 3U3GA 2OA8A 4FJ8A 3RWUA 1Z25A 3NAEA 3ZSXA 3MEEA 3SNNA 3VN5A 5CYQA 1BIUA 1RT1A 4CJWA 3HP6A 4KAZA 4XIUA 2OPRA 3M8RA 4CJVA 3SUQA 1VSEA 4CE9A 3MEGA 2B5JA 4EZ6A 5JS1A 2OPPA 4DU3A 4CEAA 2HHSA 3AVGA 3DLRA 4DSJA 4F3TA 3MECA 5HROA 1S6PA 3MXJA 4N47A 3VQQA 1J53A 1L3UA 3OS0A 1TVRA 2FBYA 1RT5A 5C42A 3CFOA 4FW2A 4E1NA 5KGXA 3NH0A 3OYJA 3K5NA 1B9DA 4DLGA 3MXIA 3CFPA 2G8FA 4N76A 4O0JA 1KFDA 1RBTA 4KO0A 1S5JA 1NK4A 4M3UA 5I42A 2HNYA 3THVA 3K5MA 4DU4A 2HB5A 3K5LA 1U47A 1BGXT 3ZSOA 4HUEA 3S3MA 4KTQA 3AO2A 5KI6A 4FYDA 1X9SA 1VSLA 4ICLA 1NJWA 3AV9A 3ZSYA 1S1XA 1SKWA 2XHBA 4KREA 1S6QA 4CGIA 2RF2A 1HQUA 1C0TA 3KLHA 3LP1A 2F8SA 1A5XA 1BL3A 3AVFA 4IG0A 4L8RB 1D5AA 3ZCMA 4PQUA 1KFSA 3QEXA 4NYFA 1FK9A 2NUBA 4OVLA 1ASVA 1RNHA 3AO1A 3AA4A 3NGZA 4FCYA 3LWLA 4HCBA 3LZIA 1HYZA 3AVCA 2QK9A 4E7JA 2KZMA 3DRRA 1RBRA 4N5SA 5DMRA 3OS1A 2E6MA 1RT7A 3KLIA 2OZSA 2ZE2A 4QAGA 4M3WA 1VSHA 3OYAA 4PWDA 1J54A 2A1SA 3DOLA 3HVTA 3DLGA 3OJSA 5C25A 4KB0A 1IO2A 4AHCA 1NJXA 1YTAA 2D0BA 3O3GA 3C6TA 3LZJA 4M3TA 1JXBA 5J2NA 4PY5A 4O55A 4FLWA 1RCHA 1DLOA 3KKSA 3ZSRA 3ZSVA 4CJEA 3QETA 1WNSA 3HO1A 2OYQA 2IGIA 2E4LA 3KK3A 2G8KA 4FK2A 3ZT2A 2O4IA 4BE0A 1NKEA 3OYNA 4DTRA 2I5JA 4PUOA 4M42A 2HNDA 1Y97A 5KGWA 1XHXA 3V1RA 4EP5A 4M3ZA 3OYDA 3HXMA 1S1TA 1RT4A 3RR7A 1LAWA 2XY6A 2GBZA 4Y1DA 2KFNA 3SZ2A 3VQ9A 4FZZA 2X74A 4ELTA 1BIZA 2QXFA 2W42A 1NK6A 2ETJA 2YKNA 1ZBFA 3L3UA 4I9QA 2HHQA 4DQSA 4KTWA 4OPJA 4DFJA 3AA2A 1LWEA 4CGJA 5HRRA 3DM2A 4IG3A 3TAFA 2HHTA 1NJYA 4FJMA 1RDCA 1EETA 2DFHA 4KB1A 3KLFA 3HM9A 3JYTA 2Z1IA 2PZSA 4Y1CA 4KHUA 1J5OA 4CK3A 3F9KA 4CJKA 4FM1A 1T05A 1JLGA 3K58A 4F2SA 2YNGA 4AHRA 3OJUA 3L2QA 3BDPA 3RRGA 3C95A 4DTUA 3CG7A 3VQ7A 4Z4CA 3QESA 1XC9A 3VQ6A 3V6DA 4MQ3A 2RPIA 4CJFA 1EXQA 4PA1A 5SZTA 4YFUA 3E01A 1KVCA 2Z1JA 3VQ4A 4CJPA 4FM0A 4DSEA 1LWFA 4OLAA 2OPSA 4KTZA 1QSSA 2IAJA 1JXEA 2BE2A 4MFBA 4CECA 4NYNA 3O3FA 1S1WA 1WAJA 2D0CA 1T7PA 3EZ5A 1NOZA 5HP1A 1HNVA 4BDZA 1RTDA 1GOBA 3BGRA 2HNZA 1U49A 4DQIA 4Z0UA 4BE1A 4CESA 1B9FA 2Y1JA 5CY4A 4DF4A 3TR8A 2P5OA 4B9VA 2KW4A 1HYSA 3LANA 4CERA 1SKSA 4FZXC 4J2DA 2ZQBA 5KRTA 2QKBA 2LSNA 1ASUA 1HJRA 4ID5A 4ID1A 4CEFA 4CJ3A 4CHYA 4DTJA 4B9SA 4W5OA 1JLEA 4NCGA 2VG7A 3KKRA 1TAUA 2HHXA 5J2QA 3OYBA 5DK5A 3NF7A 3O4NA 4DSIA 3KD1E 4W5RA 3ULDA 3DLHA 4FLVA 3LWMA 1NKCA 4DF8A 3HPGA 3AVKA 4CEBA 4FJXA 4OJRA 3QNNA 1LAVA 3TWHA 3PUFA 2FBTA 4JS4A 3U3YA 4B3OA 1VRTA 1KRPA 4CGHA 3HP9A 4M41A 1XI1A 2JLEA 4N41A 2Q3SA 4DSLA 1ITGA 1JLBA 4OGCA 4E1MA 3SUPA 2EHGA 1RDAA 1JL1A 1EX4A 2XY5A 3ZT3A 2BANA 3G0ZA 4CIGA 3L2RA 1RBUA 4HTUA 1B92A 4B9NA 4KHQA 4DFMA 1S9EA 2B4JA 3L3VA 2G8UA 3A2FA 1CLQA 4CFCA 2X78A 4DTXA 2XY7A 4DFPA 4FK4A 3AVIA 1L3SA 4KRFA 4C8NA 4O0IA 2JGUA 2VWJA 1W9HA 2B6AA 4J2BA 4KI6A 3VA0A 2WONA 2KTQA 1TL1A 3ZSWA 3H08A 2XO7A 4FLXA 3VQPA 3S3OA 4C8OA 4CHNA 3HPHA 2VG6A 3AVAA 1VSJA 4FJKA 3AA3A 3P1GA 3OYMA 4JRQA 5I3UA 1QSLA 2PYLA 3V9WA 3C94A 2D5RA 3ASMA 3UIQA 3ZT1A 4J2EA 1FKPA 4GVMA 1Q9YA 1WAFA 3O4QA 4O44A 4H8KA 4BWMA 4WE1A 4IBNA 4B8AB 3L8BA 1HYVA 1TGOA 2Z1HA 3D0PA 4FLYA 3SUNA 1Q9XA 2X6NA 4LD0A 4B8CA 4DU1A 3HVRA 5T7BA 4FLZA 1JL2A 4DS5A 4I2QA 3DLEA 1SV5A 5HRSA 4KHYA 1VK0A 1U48A 3OYIA 4ELUA 2DY4A 1TV6A 4CFAA 1UWBA 3AO4A 3AVLA 2F8TA 1VSFA 3ITHA 4IDKA 4CK1A 3VQCA
chains in the Genus database with same CATH superfamily
5ELZA 5C24A 4ZHRA 3LAKA 3RTVA 1BQNA 4DTOA 3SQ4A 1KQSM 3NF8A 2OPQA 1YT3A 3S3NA 3RR8A 3C0BA 3V1QA 4DUZK 1RTHA 3O9SA 4OKJA 4LF6K 2YHWA 4JRPA 2QWMA 1FJGK 4CCHA 1BI4A 3LP3A 1W97L 3CPEA 4FL9A 4E7HA 1IBMK 4FWLA 3EYZA 3O1WA 1TK0A 4NCBA 4CFBA 3ATVA 4B3RK 3LDOA 1MDUB 3C6HA 4CHQA 4CIFA 3FE1A 4FLUA 3ZSQA 5GINA 1TKZA 1JLCA 3SJJA 1X9WA 4Z4HA 1ZYQA 4IFEA 2RHKA 2PFUA 3PIPL 5CR4A 3IUCA 4YOUA 2P9LB 1SL1A 1E4FT 3I55N 1ZBLA 1FKOA 5C15A 3B6PA 3RSEB 1KAYA 1RTJA 4CJ4A 4BY9C 3QEVA 3CCUN 1NGDA 4H0TB 4BROA 4V19S 3PX6A 3HSTB 4BRFA 2Q31A 3KVGA 1OH8A 4B9UA 2FSJA 1NGGA 1HQEA 3VEVA 2KHOA 1RT2A 3ZT0A 1NGBA 2NRRA 2BDPA 4FJHA 3W0LA 3DXMB 2HBMA 2E2OA 2Z1GA 4JHDA 3AVNA 4LF4K 3CM6A 4TSXA 4CZHA 3PO4A 1RDDA 4I7FA 3MXMA 4DQ8A 2ZD1A 4IFYA 4DG1A 2YKMA 3NGYA 2IVOA 5AQSA 4JI1K 1C1AA 4NB4A 3PX0A 3EL2A 4BR9A 3O1BA 3M8PA 2ASPA 3VF6A 4DV1K 4L3QA 4EP4A 1BCOA 5AZIB 1KC8O 3VTIA 4JKFA 1JCFA 1NK0A 1NOYA 3A5LC 3EEQA 2O8DA 3LPTA 2KQ2A 3LAMA 1RDWX 4OKEA 4HUFA 1IKYA 2IS3A 4LF9K 4UY8O 3RMBA 4F3OA 4BVPA 3QINA 4JKGB 3M8QA 3V9XA 3AGRA 3TAQA 3HBTA 1WSEA 3TSPA 3CERA 4M3XA 5KPRA 3CM5A 5M1NA 3DOKA 4GNIA 5AZJB 1VRUA 2HF4A 3R9PA 4LC9B 2D1KA 2AJQA 5AQRA 1GOAA 2OZMA 1KSPA 1U2VB 4OPHA 4CZJA 1DTQA 4CHOA 3AAQA 1D9DA 1A5WA 1LW2A 4EHTA 3I56N 3DLKA 3QEIA 4CW7B 1WSFA 1C0GA 2D0AA 4BR5A 4C1NK 2YJEA 1C6VA 2J4RA 3GE1A 3DRSA 4RCHA 3EY1A 5AFUH 3CJCA 2ZWHA 5AQFA 2IOCA 2YNIA 3HJFA 1TUYA 3JS6A 1QSYA 3JSMA 4EAHD 3WEEA 3VQEA 4BRCA 1ATNA 4RWTA 4CZKA 1R0AA 1LWCA 2KKZA 1JCGA 3KTQA 3IAYA 2P9IA 4ELVA 4O8UA 1VSKA 3VGKA 4C8KA 4BR4A 4OKKA 3V9SA 3G10A 5FRNA 1NG9A 5GAEP 4CJRA 1M1KO 4LY7A 3K57A 1XHZA 1L3TA 1KD1O 1SZ2A 4DKWA 1N5YA 4Z4EA 2WOMA 1C0UA 4K8XA 1S1UA 3AVJA 3CCMN 2P9SA 2E2NA 3GG4A 1ZBUA 4YY3K 1K6YA 1Z05A 3EKSA 4FK0A 5JS2A 4HHTA 2NNWA 2GEMA 2P9LA 5LMNK 2P9KB 3ZSXA 5BRFA 1BIUA 1RT1A 2UUAK 1MWMA 3SUQA 4CE9A 4JKCA 4EZ6A 4DSJA 4C23A 4CZEA 1S6PA 4N47A 3AGKA 3VQQA 1L3UA 4YDUC 1TVRA 3OYJA 5F1XA 4LF8K 3NH0A 1QQNA 1B9DA 3CFPA 4BGBA 5AR0A 1M90O 4KO0A 1S5JA 2HB5A 3K5LA 1U47A 3U4LA 4HUEA 1BDGA 4FO0A 1S1XA 1YF5L 3MX5A 4KREA 2UYTA 4CGIA 2RF2A 1HQUA 3IFRA 3E66A 4H0PA 1FK9A 4OVLA 1HX1A 4FCYA 3AVCA 3EO3A 3DRRA 4N5SA 3SK3A 2E6MA 1RT7A 3KLIA 4PWDA 5AQQA 2A1SA 3DLGA 4KB0A 1IO2A 5C2DA 3O3GA 5BRHA 3L4IA 1JXBA 4PY5A 4O55A 1T44A 3KKSA 1DLOA 3VESA 4CJEA 5JLHA 1OH7A 2PAVA 3O9TA 4JNEA 4DTRA 1Y97A 4A5AA 3KHYA 3OYDA 1S1TA 1YIJN 4FOIA 3U9DA 2GBZA 4Y1DA 3VTHA 3VEOA 1VQNN 4ELTA 2W42A 1GLAG 3AA2A 4JAXA 4IG3A 2HHTA 1E4GT 4BC3A 2UUCK 3JYTA 2Z1IA 2PZSA 2KLAA 1U2VA 4F2SA 3BDPA 1BO5O 1S22A 1FW6A 4DTUA 1HNWK 4Z4CA 3AARA 3V6DA 2Z1JA 1NGJA 4CJPA 4FM0A 4K0KK 3EKUA 2Q97A 1S1WA 2QI2A 1HNVA 1GOBA 3BGRA 2HNZA 1U49A 1IBLK 4Z0UA 3H3NO 1YI2N 5CY4A 2WFBA 3LANA 4CERA 5KRTA 2QKBA 2LSNA 1ASUA 1HJRA 4CJ3A 4KH4A 4BRNA 4BGAA 3MK6A 3O4NA 3ULDA 1VQ9N 4GY2B 5FPEA 4FLVA 4NXNK 1N8RO 4HTLA 2FBTA 4DR3K 3FZLA 1XI1A 4IZ9A 4DSLA 4NLBA 2QM1A 4CIGA 1RBUA 1B92A 4LFCK 1S9EA 3L3VA 1CLQA 4DFPA 5BREA 2P9PA 1Q81O 2JGUA 4KI6A 2WONA 3ZSWA 5IT9O 4FLXA 3A0IX 2VG6A 4YOVA 1VSJA 4FJKA 1QSLA 4JRQA 4BG9A 3V9WA 3SBTA 2P9KA 3VEWA 3CMEN 4O44A 2ZJRL 3L8BA 1HYVA 4FLYA 4I6MA 4B8CA 3CCVN 1JL2A 4K41A 3VF2A 5HRSA 3KZBA 3S41A 1TV6A 1UWBA 2F8TA 4CK1A 3CFRA 5JVHL 3QBWA 2BUPA 4DMNA 4HUGA 2A40A 1FXXA 2F9WA 2CH5A 4YNQA 1WSJA 4BRDA 4B1WB 3HI0A 1NJZA 3PY8A 3OYKA 3NFAA 3LDSA 2YNFA 2KFZA 2PBDA 5M1OA 4BWJA 4CJQA 2P9UB 2GUIA 4CEOA 2IC3A 1D8YA 1JLAA 3QB0A 4E7LA 3N4PA 3TANA 3ENOA 3F73A 2OCEA 4J8FA 4RW6A 3WNGA 2HMPA 3CJBA 3GOIA 4A2BA 1YXQA 3OYHA 1NK9A 4FWRA 1BQMA 3HL8A 1KVBA 5IWAK 2DFFA 4DFKA 1SUQA 4KPYA 1VQ6N 3RMCA 4OX9K 3UE5A 4JV5K 4IFVA 1TKTA 3B6OA 3V81A 4BDPA 4AHVA 4LF7K 1BISA 3VEXA 4M45A 3DXKA 3MN6A 3CCJN 4FJJA 5JICA 4CEZA 4F8RA 2ITGA 3TAPA 1S3XA 4YOTA 3NH1A 4BR0A 3I8DA 3P31A 4K8ZA 4CGDA 3D45A 1REVA 2D4WA 1O1WA 4IOXA 3A8YA 3CMAN 1UOCA 4CD3A 4DLEA 5CZ1A 4EZ9A 2XY8A 4LH4A 4AHSA 1IKWA 4PKGA 1WSIA 5LY3A 1D9FA 2DFEA 1RTIA 1CXUA 2VWKA 4NXMK 4H4MA 4CF8A 1YTUA 1LOTB 1WOQA 1I94K 4M7XA 1NK8A 1RT3A 2VQEK 2UXBK 1BOTO 4BG8A 2OTLN 1XWLA 3OBWA 5AQGA 3H6EA 3ZETA 5B8HA 1YVNA 4JKEA 3LPUA 3C6UA 5AQKA 4A59A 3AO3A 1GLFO 2O8FB 4Z94A 3QEWA 3KD5E 4IXCA 4A2AA 2FSKA 1IKXA 5AJ3K 2RN2A 4MLHA 2F9TA 5FRMA 4BR2A 3CQ8A 3FZHA 4DTSA 2NRHA 3VGLA 3NGIA 1LV5A 1VSIA 3T1AA 4YOXA 2O8EB 4E0DA 1W2BM 4ZTJA 1J9AA 5J2MA 4H4OA 1G99A 3L0QA 1OKJA 4CI6A 4FLTA 1ASWA 4FZYA 3MWTA 4A61A 2G8IA 1HRHA 3SV3A 3QBXA 4ZTFA 2NRWA 3V4IA 3T19A 4PKIA 4RW9A 4BRPA 4DR1K 1KAXA 2GV9A 3AVMA 3H45C 3R6MA 4R5PA 3EE9A 2CH6A 3HK2A 1CZBA 4W5NA 5F0XA 1LW0A 3TABA 1F21A 4M3YA 4CJSA 2F4VK 2QWPA 4IEEA 3V1OA 1DT9A 3ZX2A 4KFBA 5GAGP 5SWMA 2HBLA 4LFBK 4FPBA 3VOVA 4B1ZA 3R3LA 4FJ5A 4BRQA 2QWRA 3CHWA 1NBWA 5EX5A 2CGJA 1WSGA 1MU2A 3HTVA 3SI6A 2W6KA 2GUPA 2V7YA 4JI2K 4CJ5A 4BREA 3CCLN 1XNQK 3OYFA 4MDAA 3T7ZA 3O9QA 4RW7A 4CF0A 1NU0A 1KCFA 5CZ2A 4FWQA 1ZBIA 1NWKA 3BZKA 1Q86O 3TPQA 5BR8K 1VSDA 4F9OA 3V9ZA 1QS4A 1RBSA 4FJGA 2HHVA 1SKRA 1HR0K 3SQ2A 3WNHA 2ZGYA 1JLFA 1NMNA 2NRXA 3E1YA 4DTNA 3ULEA 4KHWA 4YOYA 1RT6A 2GELA 3U6FA 3CI5A 1BUPA 1N34K 1X9MA 1NKBA 2NLXA 2H3GX 4AH9A 3IKMA 5HRPA 3L2WA 1TUUA 1W7AA 4I2PA 4DV5K 1X9JA 5LJWA 4OLBA 2F96A 3KLEA 5D3GA 5AQVA 2ASOA 2P9NB 4ISFA 3QNOA 3MWPA 4DSFA 4Z4IA 2HHWA 4QS9A 5K14A 4IOCL 2GWJA 1VSMA 3OVNA 2P51A 1C0MA 4FXDA 2KZZA 4E89A 3FFIA 3K2PA 2BGGA 3D2FA 4E7IA 4FJ8A 3C6AA 4H5TA 3MEEA 4DV0K 3SNNA 5FPNA 4CJWA 3HP6A 4IJAA 4XIUA 5CHIA 2HOEA 4CJVA 4KH6A 3MEGA 5AQZA 2B5JA 1N33K 5JS1A 1BWFO 4QS8A 4DHYA 4EFHA 2HHSA 4F3TA 4H0YB 3RVCA 1J53A 2E1ZA 3PIOL 3OS0A 2FBYA 5C42A 5KGXA 4DUYK 3M3ZA 4H03B 2QA4N 5ADXH 2WUSA 3CETA 4N76A 4O0JA 1KFDA 4IO9L 3K0SA 1IJJA 2YCHA 3THVA 2HNYA 4M3UA 1QVGM 1BGXT 3S3MA 5KQDA 3FZKA 4ICLA 1X9SA 1NJWA 1EO1A 3JXUA 4WFAL 1S6QA 3KLHA 1C0TA 3LP1A 2F8SA 3LDQA 3DWLA 4L8RB 1D5AA 3THWB 5C10A 4PQUA 2BTFA 4YORA 1KFSA 3QEXA 2NUBA 1ASVA 1SS6A 2W40A 3FLCO 1XUPO 2QK9A 3OHRA 2KZMA 1RBRA 3OS1A 1ATRA 2ZE2A 3OYAA 4GV3A 3L6QA 1J54A 3HVTA 2D0PA 4IOAL 4AHCA 1YAGA 1KXPA 3CJ7A 2E5LK 3QETA 2OYQA 4FK2A 2O4IA 4BE0A 5AQMA 1NKEA 3OYNA 2I5JA 1QZ6A 3V1RA 3D2EB 3G25A 1RT4A 1K8KA 2ASMA 3CJAA 2O8FA 4I9QA 3SMPA 1EQYA 2YKNA 1NK6A 1ZBFA 4DQSA 4KTWA 1LWEA 4YOWA 1U6ZA 5AQOA 1RDCA 2DFHA 4KB1A 1Q7YO 3M5RA 4KHUA 1WBDA 2E2QA 3K58A 3RRGA 1YHQN 3QESA 1XC9A 3VQ6A 2RPIA 5SZTA 4H5NA 2E2PA 1XC3A 2BE2A 4MFBA 4CJ7A 1WAJA 1T7PA 4BDZA 4DQIA 1K9MO 2V52B 2BH1A 3SAFA 3VEZA 4DF4A 3TR8A 2P5OA 4E1JA 2KW4A 3P39A 3QICA 4ID1A 5EXWA 4DTJA 4B9SA 2VG7A 3O80A 1KAZA 3OYBA 4DV4K 5DK5A 3NF7A 4GKKK 3RSEA 1ZXOA 3ZEUB 3HPGA 4FJXA 1HNZK 1VQON 5BR9A 3U3YA 3PSIA 4JKDA 3WT0A 4B3OA 3VPZA 2O8CB 2AA4A 3OBYA 5H1SQ 3CQYA 4CGHA 3HP9A 2ITMA 4M41A 3QDKA 5AQWA 2Q3SA 1EWRA 1QHAA 2EWSA 1JL1A 1EX4A 4M63C 3VMFB 2XY5A 3G0ZA 2ZGZA 4HTUA 4DV3K 4B9NA 1P8ZA 2GTDA 3A2FA 4DTXA 5BRDA 4FK4A 1VQKN 1L3SA 2WBNA 4C8NA 3TSUA 3F2KA 4R79A 2VWJA 1Y64A 4FWMA 4DCHA 2XO7A 4C8OA 1HUXA 4CZGA 1V4TA 3DXMA 4AM6A 3AVAA 3GBTA 3TSQA 2UXCK 1NGEA 3AA3A 3OYMA 5I3UA 4EIAA 4AQYK 3C94A 3CCQN 3ZT1A 1FKPA 4GVMA 1WAFA 4WE1A 5DM6L 3HVRA 5T7BA 4FLZA 4DS5A 3VERA 1SV5A 3MCPA 1VK0A 1U48A 2VGMA 4PKHA 5AZIA 3AVLA 3ITHA 4J2BA 2YHXA 3MN9A 3AAPA 1HJOA 5AQJA 5GADP 4I9LA 1KLNA 5M1QA 5HL7L 4CEQA 4CHZA 3FFKB 1GOCA 4WQ5A 5C2FA 1CZ9A 2NRTA 1BG3A 1C1BA 1J5EK 1GLDG 4HVJA 3RMAA 4JKGA 3O4WA 3SQ0A 5AQTA 2EX3A 3NBPA 4MO5A 5KRSA 3KIOA 1HLUA 3ID6A 3AO5A 4CBUA 4B9MA 1U45A 4KHPK 3HZ6A 2E20A 3TARA 3TAGA 1NNEA 2OZSA 2G8WA 3IDHA 4JK8A 5AZJA 3TU5A 1IBKK 3HSCA 4FWPA 2G8VA 3SCXA 3UKUB 4ILJA 1HPZA 3WUHA 3TTDA 3IRXA 5BPNA 4DV6K 5EY4A 4WFBL 3QFUA 4E19A 1T8EA 4H5RA 3THXB 4Z4FA 1I3AA 5GIOA 3NHGA 1QQMA 3E9OA 4JD2B 2W6LA 2R7YA 4FJ9A 4XEIA 2HBKA 1KVAA 3KWIA 4AHUA 3CJ9A 1Z26A 1C1CA 2FBVA 4DTMA 1K8AO 3OYEA 2FSNA 4FW1A 2YV0X 3M1FA 3QIOA 3N4QA 1MWKA 1U04A 1HKGA 4DWIA 1H1VA 4IKFA 4KKOA 4BRMA 1E3MA 4F4KA 3SUOA 2GWKA 3KWGA 4FJNA 4GMJB 3VQAA 3FR0A 3PLAA 4BQLA 3WNFA 1TAQA 3KK7A 3MAQA 1SL2A 3IMXA 4IO8A 4KBOA 3SLCA 2ZJQL 4X65K 4BC4A 4CBXA 3LALA 4W5QA 1L3VA 2RKIA 1UAXA 4NO7A 4BACA 3CC4N 2D0OA 3DI6A 3NF6A 4AF1A 4LH5A 3I8BA 2QWQA 1GLCG 3CCEN 2VWBA 1NJIO 2YHBA 3CYMA 3UKRB 3NH2A 3F5TA 4CGGA 4BRLA 1IG9A 4BC2A 4M7YA 1TKDA 4CJLA 4B9LA 1YJNN 2NRZA 3QLHA 3O3HA 5BPLA 3G71N 3P5JA 3KK1A 3D6RA 4LSLA 4LFAK 2UXDK 2E8AA 2X6SA 3DMJA 1YJ9N 1NGHA 3L4QA 1UA0A 1TL3A 3KK2A 2GX9A 4KHSA 2VYPA 3QEPA 1WN7A 5DM7L 1BI4B 4RG8A 3RMDA 3I33A 1BA1A 1NM1A 2E6LA 4ISEA 1QVFM 2FLOA 4DR2K 3OS2A 1KTQA 1TKXA 3AY9A 3I0RA 4CFDA 4G9ZA 4B3SK 1KLMA 5JMVA 1QQCA 3U8XA 1BHLA 4B1VA 4WF9L 4CGFA 3SV4A 1DTTA 2QW9A 4CJUA 3HPOA 3BY5A 4DQPA 4AHTA 4RW8A 5MLCQ 3MX2A 3VA3A 1X1PA 3E9PA 4QOZB 2P1JA 4GV9A 3S9HA 1Q82O 3NF9A 4BRAA 5HRNA 4G1QA 3K5OA 2ZM6K 3WQUA 4C8MA 2VG5A 4DR4K 4BR7A 1ESVA 4F2RA 3EE8A 3RRHA 1EKEA 2FC0A 4ILHA 3QIPA 4K43A 4WQ5C 1WB9A 1YVUA 1QE1A 3O5BA 1WLJA 4CVNE 3Q7BA 2Q36A 5KPTA 3D7EO 1NLVA 2F7TA 3IG1A 1L5UA 4JHDB 4JN4A 4X64K 3PV8A 3NE6A 3L2UA 2CGLA 1XNRK 4FM2A 2A1RA 4Q5VA 4DR7K 1N32K 1TK8A 3SQ1A 3ZSZA 3T1YK 3BP8A 1NK7A 3DRPA 3WXJA 5HBMA 3ENBA 4JI3K 4B9QA 1OH5A 3TTCA 4FVMA 3CD6N 3TAEA 3KJVA 3U3GA 2O8DB 3LM2A 1NGAA 5AQIA 3RWUA 1Z25A 2JWKA 4JK7A 3BF3A 3EN9A 3VN5A 1CZAN 4KAZA 2O8BB 1JJ2M 5AFUA 3M8RA 1OH6A 4IJNA 1TYQB 4BVOA 4DU3A 4CEAA 3DLRA 3MECA 5HROA 3MXJA 1T3VA 2Q0RA 1T6DA 2YI1A 4E1NA 3K5NA 3FZFA 2RE2A 4U67L 4DU4A 4RTFD 4KTQA 2A3ZA 5KI6A 1VSLA 3AV9A 4FWNA 3LDPA 2HBJA 1BL3A 3AVFA 1K73O 2DPNA 3ZCMA 4LF5K 2A6AA 4MDBA 4JI5K 3NGZA 3F9MA 5TKYA 2UUBK 4HCBA 3LZIA 3A5NC 4E7JA 5DMRA 4H0VB 4O8KA 4IWVA 5F2RA 4QAGA 4M3WA 4K42A 2A5XA 3WEEB 1BA0A 1NJXA 2D0BA 1SQKA 3LZJA 4M3TA 2NZTA 3JAMO 5J2NA 2OANA 3NVKA 3ZSRA 3ZSVA 3HO1A 1WNSA 2P9IB 2E4LA 3KK3A 4WQ4A 3ZT2A 1GLEG 5KGWA 1XHXA 4M3ZA 3RR7A 2XY6A 2FF3B 2KFNA 3C65A 2ETJA 4H0OA 5FPMA 4OPJA 5HRRA 3DM2A 4A57A 3TAFA 1NJYA 3KLFA 3HM9A 4FPAA 4CK3A 1ATSA 5M1PA 4FM1A 2P9SB 4FWSA 4Y0WA 3H3OB 5C12A 1VQMN 1T05A 4FVUA 4JI0K 3L2QA 2A41A 3OJUA 4H0XB 1XMOK 3VQ7A 1QZ5A 4MQ3A 1EXQA 2P9UA 4PA1A 4YFUA 3E01A 3CF5L 2YHYA 5AQNA 4OLAA 2OPSA 4GV6A 2IAJA 4CECA 3ENHA 2W41A 4DR5K 4GKJK 1O13A 1NGCA 5HOOA 4CESA 1B9FA 4BRHA 3B8AX 4B9VA 5E26A 1HYSA 4FZXC 1SKSA 3O6WA 4YDUA 3U9ZA 4CHYA 4ID5A 3QMLA 3P4IA 4W5OA 1JLEA 1ZC6A 3VGMA 4DSIA 4W5RA 5AQPA 3DLHA 3LWMA 1NGIA 4MO4A 1Q18A 3VETA 4OJRA 3QNNA 4JKHA 1QQOA 5BN8A 1YJWN 5JLFA 3PUFA 4JS4A 3TWHA 2I7PA 3J81O 3J7YP 2JLEA 2V51B 1ITGA 1JLBA 3SUPA 1XMQK 2EHGA 3ZT3A 3J80O 3L2RA 3MCAB 2B4JA 2XY7A 2JWLA 3H1VX 3O9UA 4KRFA 3C7NB 4O0IA 1TL1A 3H08A 1VQ4N 4CHNA 3MN7A 3OW2M 3P1GA 2D5RA 3ASMA 3UIQA 1Q9YA 3DLLL 1YITN 4H8KA 4IBNA 2O8BA 1TGOA 2Z1HA 3CIPA 3D0PA 2X6NA 4LD0A 1TYQA 4DU1A 2ZJPL 4I2QA 3DLEA 4KHYA 3WXLA 1GLJO 2V7ZA 1VSFA 4IDKA 3VQCA 3K59A 3ZX0A 1QHTA 5AQXA 3FGUA 5EU7A 3SMSA 3FZMA 3R1XA 3OYGA 4CF1A 3TAMA 3KLGA 2O8EA 4B08A 3CJ1A 2Q1NA 3ISNC 3THYB 1HKBA 1BU6O 4JI6K 4JKAA 1TK5A 2A42A 1HNIA 1CXQA 5EVZA 3DAWA 1N6QA 4A5BA 2YNHA 1RDBA 3VQDA 3CXCM 3NCIA 5HLFA 2QWLA 3A5MC 2QWOA 4MLEA 1OVQA 3SAHA 3T69A 2HHUA 1IV0A 3CQXA 4OO1J 2IIRA 3HRGA 4C8LA 4JI8K 3HOTA 3AVBA 1ZBHA 4AILC 3MN5A 4DQQA 5M1KA 4LSNA 4CK2A 3NVMA 1HNXK 1QTMA 2FBXA 4IDHA 4KV8A 4WQ4C 1T6CA 2P5GA 4JKBA 1G15A 1SAZA 4UQGA 4CZLA 3DLBA 1I39A 4BRKA 2ATQA 2HVHA 4FJIA 5LL6Z 1GLLO 4CF9A 1EWQA 3AVHA 4GW6A 3MEDA 2WC9A 4CD1A 5C0YA 4B9TA 3VQ8A 1WBBA 4NCAA 2P9PB 3VQ5A 3HT3A 1WSHA 3MDQA 5BN9A 2VQFK 3SYZA 4FWKA 1IG8A 1OVYA 4J2AA 3LP0A 1VQLN 3J7ZO 3DYAA 1S9GA 3AA5X 4IEIA 5CYMA 4JK9A 3G4SN 2HMIA 4FJLA 1EP4A 4KI4A 4CZIA 2P9NA 4I6MB 3GL1A 1J6ZA 1JKHA 2OTJN 4DTPA 4QS7A 2WTUA 2IVPA 3HYFA 1NMDA 4M3RA 3M8SA 1BCMA 3TI0A 4PL7A 3E9LA 3GDQA 5LMUK 3OYLA 1N36K 5KPZA 3T3FA 3L2VA 4O4GA 4OGEA 4JEPA 3I0SA 4BE2A 1U4BA 3BZCA 1RBVA 3ALYA 4X66K 3VQBA 1DEJA 3LM9A 2QEXN 4Q0BA 3ZX3A 4JS5A 4DQRA 4CHPA 2HW3A 5E41A 2NRVA 1IKVA 2G8HA 3V9UA 4A62A 1S1VA 5FPDA 2YHAA 5FDLA 2VCPA 3OYCA 3LP2A 4OPKA 4N56A 3SJHA 4E3SA 4KHNA 5A2QO 1VQPN 1Z6RA 5AQYA 3ATUA 3UB5A 3C7NA 1T03A 4CJTA 3PX4A 1IH7A 1SL0A 3CC7N 3DXKB 2DTUA 1ZBSA 3ZT4A 4QCLA 3QO9A 4H5VA 3WNEA 2PYJA 4O5BA 1VAZA 5KTQA 3BUZB 3PO5A 3THWA 2QTDA 4PL8A 3NDKA 3PSFA 2QKKA 3P83D 4W5TA 4Z4GA 4WFNL 2Y1IA 4DS4A 1JLQA 4CEEA 3SAGA 3BF1A 4JLHA 3QERA 1UA1A 2PY5A 3LL3A 4GVEA 4BDYA 4ISGA 3G6EN 1HMVA 2O4GA 1X3MA 4CBWA 1W0HA 2E88A 3THYA 3SPYA 2IDOA 5J1EA 2YJFA 3IS9A 1XQSC 4CEDA 3OA9A 3D2EA 3K9KA 1Q8IA 4E7KA 1DGKN 3OY9A 1RILA 1NK5A 2HVIA 4JI4K 3ZETB 5J2PA 3SPZA 4B1YB 2E1YA 4WYBA 4FJ7A 2ZF5O 4RW4A 1X3NA 5FROA 1R59O 4FWOA 3TTFA 4CIEA 4CF2A 2FXUA 3J7AP 4X62K 5I9EB 3OTOK 2I7NA 4HCCA 3K9JA 4DB3A 1A5VA 4DSKA 3WXIA 2XRIA 2OA8A 1DKGD 4XH5A 3NAEA 3H1QA 3O08A 5CYQA 5BPMA 1RDUA 2OPRA 1VSEA 2OPPA 3LDLA 3AVGA 5AQUA 3VENA 4DR6K 5TKWA 5GIPA 3O8MA 4BQZA 3P38A 3WXKA 3MMVA 3NMUA 3BEXA 1RT5A 3CFOA 4FW2A 4DLGA 1YUWA 3MXIA 3ZYYX 2G8FA 3ID8A 4XH4A 1RBTA 4NLCA 1NK4A 3SBGA 5I42A 3K5MA 4KH5A 1RGIA 3ZSOA 5M1FA 5LJVA 3ZEUA 3AO2A 4FYDA 3ZSYA 2O8CA 1SKWA 3M6GA 4C1NI 2XHBA 1A5XA 4OPAA 2YX6A 4IG0A 4NYFA 1RNHA 3AO1A 3AA4A 3LWLA 4B3MK 4B1XB 2UU9K 1HYZA 1NGFA 4XH1A 1VSHA 3DOLA 3OJSA 2FF6A 5C25A 4DV7K 3R8EA 1YTAA 3C6TA 1VQ7N 3EZWA 4FLWA 1RCHA 2CGKA 2IGIA 2G8KA 3ULEB 1WUAA 3QFPA 4PUOA 4M42A 2HNDA 4EP5A 3HXMA 3W3DA 1LAWA 2AP1A 3SZ2A 3VQ9A 1MA9B 4FZZA 2X74A 1BIZA 2QXFA 3L3UA 4B3TK 2HHQA 5AQLA 4DFJA 4CGJA 5ADXA 1P90A 3DJCA 4FJMA 1EETA 3T1HK 4Y1CA 1J5OA 3F9KA 4CJKA 1JLGA 2YNGA 1VHXA 4AHRA 1VQ8N 3C95A 4U7BA 4PHTX 3CG7A 1S72N 3D2FB 3J8AA 4CJFA 3VQ4A 1KVCA 4DSEA 1LWFA 5EOYA 2Q2RA 4KTZA 1QSSA 1JXEA 3O3FA 4NYNA 3CCSN 4B1UB 2D0CA 3EZ5A 1NOZA 5HP1A 1RTDA 1D4XA 3VEYA 4BE1A 3UKUA 2Y1JA 2Q0UA 3CPWM 4J2DA 3WXMB 2ZQBA 2IVNA 5KQ8A 4CEFA 4FSVA 5CE3A 5GAHP 3CCRN 4NCGA 3KKRA 1TAUA 1V4SA 3A5OC 3HOSA 5J2QA 2HHXA 2HF3A 3THXA 4JI7K 2HSTA 3KD1E 1NKCA 4JD2A 3H46O 4DF8A 3AVKA 4CEBA 4BRIA 2VGNA 1LAVA 4CZMA 4JYAK 5AQHA 3O9RA 3VF4A 1JCEA 1VRTA 1KRPA 4N41A 3ZLJA 4OGCA 4BRGA 4E1MA 1ILYA 1RDAA 1VQ5N 4YHHK 2BANA 1LCUA 4KHQA 4DFMA 4DV2K 2G8UA 4O5FA 4CFCA 2X78A 4WCEL 3AVIA 1RFQA 1W9HA 2B6AA 3VA0A 2KTQA 4BC5A 3VQPA 3S3OA 3HPHA 2QXLA 1HPMA 1GLBG 5E84A 2PYLA 3Q7CA 5JVGL 4K25A 4J2EA 3O4QA 2QWNA 3CC2N 5FLXO 4BWMA 4FOEA 4B8AB 3WQTA 1Q9XA 4H5WA 3SUNA 4ILGB 1C0FA 4HWIA 4EHUA 4AM7A 3LDNA 3HM8A 1HKCA 3OYIA 4ELUA 2DY4A 1K8KB 4CFAA 4CZFA 3AO4A 2HHHK 3UKRA
chains in the Genus database with same CATH topology
3K59A 1QHTA 5EU7A 3OYGA 1KLNA 4I9LA 5C24A 4CF1A 4CEQA 3LAKA 3TAMA 4CHZA 4DMNA 4ZHRA 3RTVA 3KLGA 1BQNA 4B08A 4HUGA 4DTOA 3SQ4A 1FXXA 1GOCA 3NF8A 3ISNC 4YNQA 2OPQA 1YT3A 1WSJA 3S3NA 3RR8A 1CZ9A 1C1BA 4HVJA 3V1QA 1NJZA 1RTHA 4OKJA 3OYKA 3RMAA 1TK5A 3NFAA 3SQ0A 3PY8A 2EX3A 3LDSA 2YNFA 4JRPA 2KFZA 1HNIA 3NBPA 1CXQA 4BWJA 5KRSA 3KIOA 4CJQA 2GUIA 4CCHA 1BI4A 3LP3A 4CEOA 2IC3A 4E7HA 1D8YA 1JLAA 4E7LA 3EYZA 1N6QA 3AO5A 1TK0A 3TANA 4B9MA 1U45A 2YNHA 3F73A 4NCBA 1RDBA 4CFBA 4RW6A 3WNGA 3OYHA 3VQDA 3TARA 4CIFA 3TAGA 4CHQA 3NCIA 5HLFA 1NK9A 4FLUA 3ZSQA 2G8WA 1BQMA 3HL8A 1TKZA 1KVBA 1JLCA 3SJJA 2G8VA 3SCXA 2DFFA 2HHUA 4DFKA 1X9WA 1SUQA 4Z4HA 4KPYA 1HPZA 3RMCA 1ZYQA 4IFVA 1TKTA 3B6OA 3IRXA 3V81A 4BDPA 4AHVA 4C8LA 3AVBA 1ZBHA 1BISA 4AILC 4M45A 4DQQA 4FJJA 4LSNA 4CK2A 1SL1A 4E19A 4CEZA 1T8EA 1ZBLA 1FKOA 4F8RA 2ITGA 1QTMA 3B6PA 3TAPA 2FBXA 4Z4FA 1I3AA 1RTJA 3NHGA 4KV8A 4CJ4A 3NH1A 2R7YA 4FJ9A 3QEVA 1KVAA 2P5GA 3I8DA 4AHUA 4K8ZA 4CGDA 1G15A 1Z26A 3D45A 1C1CA 2FBVA 4UQGA 1REVA 3DLBA 3PX6A 3HSTB 1I39A 1O1WA 4DTMA 3CFRA 2ATQA 2HVHA 3OYEA 4FJIA 1UOCA 4CF9A 4FW1A 2YV0X 4B9UA 4DLEA 3AVHA 5CZ1A 4EZ9A 2XY8A 3QIOA 4GW6A 4LH4A 1IKWA 4AHSA 3MEDA 1U04A 1WSIA 1D9FA 4DWIA 4IKFA 4B9TA 1HQEA 3VQ8A 4KKOA 2DFEA 4F4KA 4NCAA 1RTIA 3SUOA 3VQ5A 3HT3A 4FJNA 1WSHA 1CXUA 1RT2A 2VWKA 4GMJB 4H4MA 3VQAA 4CF8A 3ZT0A 3SYZA 1YTUA 2BDPA 4FJHA 3WNFA 1TAQA 4J2AA 3LP0A 1NK8A 1RT3A 2Z1GA 3DYAA 3MAQA 1SL2A 3AVNA 1S9GA 3CM6A 3AA5X 4TSXA 3PO4A 1RDDA 4I7FA 5CYMA 3MXMA 1XWLA 2ZD1A 4IFYA 4DG1A 3LALA 4W5QA 2HMIA 2YKMA 3NGYA 1L3VA 4FJLA 1EP4A 2RKIA 1UAXA 4KI4A 4BACA 3LPUA 3NF6A 3DI6A 3C6UA 1C1AA 3AO3A 3PX0A 1JKHA 4LH5A 3M8PA 4DTPA 3QEWA 3KD5E 3HYFA 4EP4A 4M3RA 3M8SA 1BCOA 1IKXA 2YHBA 1BCMA 3CYMA 3TI0A 3NH2A 2RN2A 4CGGA 1NK0A 5FRMA 1IG9A 1NOYA 3CQ8A 3OYLA 1TKDA 4DTSA 4CJLA 4B9LA 3NGIA 3LPTA 2KQ2A 3QLHA 3O3HA 1VSIA 3T1AA 3LAMA 3P5JA 4O4GA 3KK1A 3L2VA 3T3FA 4E0DA 4OGEA 4LSLA 3I0SA 4BE2A 4OKEA 1U4BA 4HUFA 1IKYA 2X6SA 1RBVA 2IS3A 1J9AA 3DMJA 5J2MA 3ALYA 4H4OA 3RMBA 4ZTJA 3VQBA 1UA0A 4F3OA 1TL3A 3QINA 3KK2A 3M8QA 3V9XA 4FLTA 3TAQA 4KHSA 1WSEA 4Q0BA 1ASWA 4FZYA 4JS5A 2G8IA 4DQRA 1HRHA 3SV3A 4M3XA 3QEPA 1WN7A 4ZTFA 4CHPA 3V4IA 1BI4B 4RG8A 3T19A 3CM5A 5E41A 1IKVA 3RMDA 2G8HA 3V9UA 2HW3A 2E6LA 4RW9A 1S1VA 2YHAA 3DOKA 5FDLA 2GV9A 3AVMA 3OS2A 3OYCA 3LP2A 4R5PA 1KTQA 1TKXA 3I0RA 3HK2A 4CFDA 4OPKA 1CZBA 4N56A 4E3SA 1KLMA 4W5NA 1VRUA 1QQCA 1LW0A 4KHNA 3TABA 1BHLA 2AJQA 1F21A 1GOAA 4CGFA 3SV4A 1DTTA 1KSPA 2OZMA 4M3YA 4CJSA 4CJUA 3HPOA 3V1OA 1DTQA 1T03A 4AHTA 4CHOA 4DQPA 4KFBA 4CJTA 4RW8A 3PX4A 1IH7A 1SL0A 5SWMA 2DTUA 3VA3A 3ZT4A 4QCLA 3QO9A 1D9DA 1A5WA 1LW2A 3WNEA 1X1PA 3DLKA 3QEIA 2PYJA 4FJ5A 4O5BA 5KTQA 4QOZB 1WSFA 2P1JA 2D0AA 1WSGA 1MU2A 3SI6A 3PO5A 1C6VA 3S9HA 3DRSA 3EY1A 3NF9A 3NDKA 4CJ5A 5HRNA 2QKKA 3P83D 4G1QA 4W5TA 4Z4GA 3OYFA 2Y1IA 1LV5A 3K5OA 4DS4A 2IOCA 1JLQA 4CEEA 2YNIA 3HJFA 4RW7A 4C8MA 4CF0A 1KCFA 2VG5A 5CZ2A 1QSYA 4JLHA 1ZBIA 3QERA 1UA1A 3JSMA 2PY5A 1VSDA 3V9ZA 1QS4A 3VQEA 4F2RA 1RBSA 4BDYA 3RRHA 4FJGA 2HHVA 1SKRA 1HMVA 1EKEA 2O4GA 2FC0A 1R0AA 1LWCA 3SQ2A 1W0HA 3WNHA 1JLFA 3KTQA 3IAYA 3QIPA 1YVUA 4DTNA 1QE1A 3SPYA 2IDOA 5J1EA 4KHWA 4ELVA 1VSKA 1RT6A 3IS9A 1WLJA 4CEDA 3IG1A 4C8KA 1L5UA 4OKKA 3V9SA 3U6FA 1Q8IA 3G10A 4E7KA 5FRNA 3OY9A 1RILA 3PV8A 1NK5A 5HRPA 3L2UA 4AH9A 4CJRA 3L2WA 3NE6A 1X9MA 1NKBA 2HVIA 4FM2A 4LY7A 4Q5VA 5J2PA 3SPZA 3K57A 4I2PA 2A1RA 1XHZA 1L3TA 1TK8A 3SQ1A 3ZSZA 4OLBA 2F96A 3KLEA 1N5YA 4FJ7A 5D3GA 1NK7A 3DRPA 2WOMA 4RW4A 4Z4EA 3QNOA 4Z4IA 4DSFA 5FROA 2HHWA 5K14A 1C0UA 5HBMA 1S1UA 4K8XA 4CIEA 4CF2A 3AVJA 1VSMA 3OVNA 2P51A 1ZBUA 1C0MA 4FXDA 1K6YA 2KZZA 4HCCA 4E89A 3FFIA 4FK0A 1A5VA 4DSKA 3K2PA 4FVMA 2BGGA 5JS2A 4HHTA 3TAEA 3KJVA 2XRIA 4E7IA 3U3GA 2OA8A 4FJ8A 3RWUA 1Z25A 3NAEA 3ZSXA 3MEEA 3SNNA 3VN5A 5CYQA 1BIUA 1RT1A 4CJWA 3HP6A 4KAZA 4XIUA 2OPRA 3M8RA 4CJVA 3SUQA 1VSEA 4CE9A 3MEGA 2B5JA 4EZ6A 5JS1A 2OPPA 4DU3A 4CEAA 2HHSA 3AVGA 3DLRA 4DSJA 4F3TA 3MECA 5HROA 1S6PA 3MXJA 4N47A 3VQQA 1J53A 1L3UA 3OS0A 1TVRA 2FBYA 1RT5A 5C42A 3CFOA 4FW2A 4E1NA 5KGXA 3NH0A 3OYJA 3K5NA 1B9DA 4DLGA 3MXIA 3CFPA 2G8FA 4N76A 4O0JA 1KFDA 1RBTA 4KO0A 1S5JA 1NK4A 4M3UA 5I42A 2HNYA 3THVA 3K5MA 4DU4A 2HB5A 3K5LA 1U47A 1BGXT 3ZSOA 4HUEA 3S3MA 4KTQA 3AO2A 5KI6A 4FYDA 1X9SA 1VSLA 4ICLA 1NJWA 3AV9A 3ZSYA 1S1XA 1SKWA 2XHBA 4KREA 1S6QA 4CGIA 2RF2A 1HQUA 1C0TA 3KLHA 3LP1A 2F8SA 1A5XA 1BL3A 3AVFA 4IG0A 4L8RB 1D5AA 3ZCMA 4PQUA 1KFSA 3QEXA 4NYFA 1FK9A 2NUBA 4OVLA 1ASVA 1RNHA 3AO1A 3AA4A 3NGZA 4FCYA 3LWLA 4HCBA 3LZIA 1HYZA 3AVCA 2QK9A 4E7JA 2KZMA 3DRRA 1RBRA 4N5SA 5DMRA 3OS1A 2E6MA 1RT7A 3KLIA 2OZSA 2ZE2A 4QAGA 4M3WA 1VSHA 3OYAA 4PWDA 1J54A 2A1SA 3DOLA 3HVTA 3DLGA 3OJSA 5C25A 4KB0A 1IO2A 4AHCA 1NJXA 1YTAA 2D0BA 3O3GA 3C6TA 3LZJA 4M3TA 1JXBA 5J2NA 4PY5A 4O55A 4FLWA 1RCHA 1DLOA 3KKSA 3ZSRA 3ZSVA 4CJEA 3QETA 1WNSA 3HO1A 2OYQA 2IGIA 2E4LA 3KK3A 2G8KA 4FK2A 3ZT2A 2O4IA 4BE0A 1NKEA 3OYNA 4DTRA 2I5JA 4PUOA 4M42A 2HNDA 1Y97A 5KGWA 1XHXA 3V1RA 4EP5A 4M3ZA 3OYDA 3HXMA 1S1TA 1RT4A 3RR7A 1LAWA 2XY6A 2GBZA 4Y1DA 2KFNA 3SZ2A 3VQ9A 4FZZA 2X74A 4ELTA 1BIZA 2QXFA 2W42A 1NK6A 2ETJA 2YKNA 1ZBFA 3L3UA 4I9QA 2HHQA 4DQSA 4KTWA 4OPJA 4DFJA 3AA2A 1LWEA 4CGJA 5HRRA 3DM2A 4IG3A 3TAFA 2HHTA 1NJYA 4FJMA 1RDCA 1EETA 2DFHA 4KB1A 3KLFA 3HM9A 3JYTA 2Z1IA 2PZSA 4Y1CA 4KHUA 1J5OA 4CK3A 3F9KA 4CJKA 4FM1A 1T05A 1JLGA 3K58A 4F2SA 2YNGA 4AHRA 3OJUA 3L2QA 3BDPA 3RRGA 3C95A 4DTUA 3CG7A 3VQ7A 4Z4CA 3QESA 1XC9A 3VQ6A 3V6DA 4MQ3A 2RPIA 4CJFA 1EXQA 4PA1A 5SZTA 4YFUA 3E01A 1KVCA 2Z1JA 3VQ4A 4CJPA 4FM0A 4DSEA 1LWFA 4OLAA 2OPSA 4KTZA 1QSSA 2IAJA 1JXEA 2BE2A 4MFBA 4CECA 4NYNA 3O3FA 1S1WA 1WAJA 2D0CA 1T7PA 3EZ5A 1NOZA 5HP1A 1HNVA 4BDZA 1RTDA 1GOBA 3BGRA 2HNZA 1U49A 4DQIA 4Z0UA 4BE1A 4CESA 1B9FA 2Y1JA 5CY4A 4DF4A 3TR8A 2P5OA 4B9VA 2KW4A 1HYSA 3LANA 4CERA 1SKSA 4FZXC 4J2DA 2ZQBA 5KRTA 2QKBA 2LSNA 1ASUA 1HJRA 4ID5A 4ID1A 4CEFA 4CJ3A 4CHYA 4DTJA 4B9SA 4W5OA 1JLEA 4NCGA 2VG7A 3KKRA 1TAUA 2HHXA 5J2QA 3OYBA 5DK5A 3NF7A 3O4NA 4DSIA 3KD1E 4W5RA 3ULDA 3DLHA 4FLVA 3LWMA 1NKCA 4DF8A 3HPGA 3AVKA 4CEBA 4FJXA 4OJRA 3QNNA 1LAVA 3TWHA 3PUFA 2FBTA 4JS4A 3U3YA 4B3OA 1VRTA 1KRPA 4CGHA 3HP9A 4M41A 1XI1A 2JLEA 4N41A 2Q3SA 4DSLA 1ITGA 1JLBA 4OGCA 4E1MA 3SUPA 2EHGA 1RDAA 1JL1A 1EX4A 2XY5A 3ZT3A 2BANA 3G0ZA 4CIGA 3L2RA 1RBUA 4HTUA 1B92A 4B9NA 4KHQA 4DFMA 1S9EA 2B4JA 3L3VA 2G8UA 3A2FA 1CLQA 4CFCA 2X78A 4DTXA 2XY7A 4DFPA 4FK4A 3AVIA 1L3SA 4KRFA 4C8NA 4O0IA 2JGUA 2VWJA 1W9HA 2B6AA 4J2BA 4KI6A 3VA0A 2WONA 2KTQA 1TL1A 3ZSWA 3H08A 2XO7A 4FLXA 3VQPA 3S3OA 4C8OA 4CHNA 3HPHA 2VG6A 3AVAA 1VSJA 4FJKA 3AA3A 3P1GA 3OYMA 4JRQA 5I3UA 1QSLA 2PYLA 3V9WA 3C94A 2D5RA 3ASMA 3UIQA 3ZT1A 4J2EA 1FKPA 4GVMA 1Q9YA 1WAFA 3O4QA 4O44A 4H8KA 4BWMA 4WE1A 4IBNA 4B8AB 3L8BA 1HYVA 1TGOA 2Z1HA 3D0PA 4FLYA 3SUNA 1Q9XA 2X6NA 4LD0A 4B8CA 4DU1A 3HVRA 5T7BA 4FLZA 1JL2A 4DS5A 4I2QA 3DLEA 1SV5A 5HRSA 4KHYA 1VK0A 1U48A 3OYIA 4ELUA 2DY4A 1TV6A 4CFAA 1UWBA 3AO4A 3AVLA 2F8TA 1VSFA 3ITHA 4IDKA 4CK1A 3VQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K59 A;  1QHT A;  5EU7 A;  3OYG A;  1KLN A;  4I9L A;  5C24 A;  4CF1 A;  4CEQ A;  3LAK A;  3TAM A;  4CHZ A;  4DMN A;  4ZHR A;  3RTV A;  3KLG A;  1BQN A;  4B08 A;  4HUG A;  4DTO A;  3SQ4 A;  1FXX A;  1GOC A;  3NF8 A;  3ISN C;  4YNQ A;  2OPQ A;  1YT3 A;  1WSJ A;  3S3N A;  3RR8 A;  1CZ9 A;  1C1B A;  4HVJ A;  3V1Q A;  1NJZ A;  1RTH A;  4OKJ A;  3OYK A;  3RMA A;  1TK5 A;  3NFA A;  3SQ0 A;  3PY8 A;  2EX3 A;  3LDS A;  2YNF A;  4JRP A;  2KFZ A;  1HNI A;  3NBP A;  1CXQ A;  4BWJ A;  5KRS A;  3KIO A;  4CJQ A;  2GUI A;  4CCH A;  1BI4 A;  3LP3 A;  4CEO A;  2IC3 A;  4E7H A;  1D8Y A;  1JLA A;  4E7L A;  3EYZ A;  1N6Q A;  3AO5 A;  1TK0 A;  3TAN A;  4B9M A;  1U45 A;  2YNH A;  3F73 A;  4NCB A;  1RDB A;  4CFB A;  4RW6 A;  3WNG A;  3OYH A;  3VQD A;  3TAR A;  4CIF A;  3TAG A;  4CHQ A;  3NCI A;  5HLF A;  1NK9 A;  4FLU A;  3ZSQ A;  2G8W A;  1BQM A;  3HL8 A;  1TKZ A;  1KVB A;  1JLC A;  3SJJ A;  2G8V A;  3SCX A;  2DFF A;  2HHU A;  4DFK A;  1X9W A;  1SUQ A;  4Z4H A;  4KPY A;  1HPZ A;  3RMC A;  1ZYQ A;  4IFV A;  1TKT A;  3B6O A;  3IRX A;  3V81 A;  4BDP A;  4AHV A;  4C8L A;  3AVB A;  1ZBH A;  1BIS A;  4AIL C;  4M45 A;  4DQQ A;  4FJJ A;  4LSN A;  4CK2 A;  1SL1 A;  4E19 A;  4CEZ A;  1T8E A;  1ZBL A;  1FKO A;  4F8R A;  2ITG A;  1QTM A;  3B6P A;  3TAP A;  2FBX A;  4Z4F A;  1I3A A;  1RTJ A;  3NHG A;  4KV8 A;  4CJ4 A;  3NH1 A;  2R7Y A;  4FJ9 A;  3QEV A;  1KVA A;  2P5G A;  3I8D A;  4AHU A;  4K8Z A;  4CGD A;  1G15 A;  1Z26 A;  3D45 A;  1C1C A;  2FBV A;  4UQG A;  1REV A;  3DLB A;  3PX6 A;  3HST B;  1I39 A;  1O1W A;  4DTM A;  3CFR A;  2ATQ A;  2HVH A;  3OYE A;  4FJI A;  1UOC A;  4CF9 A;  4FW1 A;  2YV0 X;  4B9U A;  4DLE A;  3AVH A;  5CZ1 A;  4EZ9 A;  2XY8 A;  3QIO A;  4GW6 A;  4LH4 A;  1IKW A;  4AHS A;  3MED A;  1U04 A;  1WSI A;  1D9F A;  4DWI A;  4IKF A;  4B9T A;  1HQE A;  3VQ8 A;  4KKO A;  2DFE A;  4F4K A;  4NCA A;  1RTI A;  3SUO A;  3VQ5 A;  3HT3 A;  4FJN A;  1WSH A;  1CXU A;  1RT2 A;  2VWK A;  4GMJ B;  4H4M A;  3VQA A;  4CF8 A;  3ZT0 A;  3SYZ A;  1YTU A;  2BDP A;  4FJH A;  3WNF A;  1TAQ A;  4J2A A;  3LP0 A;  1NK8 A;  1RT3 A;  2Z1G A;  3DYA A;  3MAQ A;  1SL2 A;  3AVN A;  1S9G A;  3CM6 A;  3AA5 X;  4TSX A;  3PO4 A;  1RDD A;  4I7F A;  5CYM A;  3MXM A;  1XWL A;  2ZD1 A;  4IFY A;  4DG1 A;  3LAL A;  4W5Q A;  2HMI A;  2YKM A;  3NGY A;  1L3V A;  4FJL A;  1EP4 A;  2RKI A;  1UAX A;  4KI4 A;  4BAC A;  3LPU A;  3NF6 A;  3DI6 A;  3C6U A;  1C1A A;  3AO3 A;  3PX0 A;  1JKH A;  4LH5 A;  3M8P A;  4DTP A;  3QEW A;  3KD5 E;  3HYF A;  4EP4 A;  4M3R A;  3M8S A;  1BCO A;  1IKX A;  2YHB A;  1BCM A;  3CYM A;  3TI0 A;  3NH2 A;  2RN2 A;  4CGG A;  1NK0 A;  5FRM A;  1IG9 A;  1NOY A;  3CQ8 A;  3OYL A;  1TKD A;  4DTS A;  4CJL A;  4B9L A;  3NGI A;  3LPT A;  2KQ2 A;  3QLH A;  3O3H A;  1VSI A;  3T1A A;  3LAM A;  3P5J A;  4O4G A;  3KK1 A;  3L2V A;  3T3F A;  4E0D A;  4OGE A;  4LSL A;  3I0S A;  4BE2 A;  4OKE A;  1U4B A;  4HUF A;  1IKY A;  2X6S A;  1RBV A;  2IS3 A;  1J9A A;  3DMJ A;  5J2M A;  3ALY A;  4H4O A;  3RMB A;  4ZTJ A;  3VQB A;  1UA0 A;  4F3O A;  1TL3 A;  3QIN A;  3KK2 A;  3M8Q A;  3V9X A;  4FLT A;  3TAQ A;  4KHS A;  1WSE A;  4Q0B A;  1ASW A;  4FZY A;  4JS5 A;  2G8I A;  4DQR A;  1HRH A;  3SV3 A;  4M3X A;  3QEP A;  1WN7 A;  4ZTF A;  4CHP A;  3V4I A;  1BI4 B;  4RG8 A;  3T19 A;  3CM5 A;  5E41 A;  1IKV A;  3RMD A;  2G8H A;  3V9U A;  2HW3 A;  2E6L A;  4RW9 A;  1S1V A;  2YHA A;  3DOK A;  5FDL A;  2GV9 A;  3AVM A;  3OS2 A;  3OYC A;  3LP2 A;  4R5P A;  1KTQ A;  1TKX A;  3I0R A;  3HK2 A;  4CFD A;  4OPK A;  1CZB A;  4N56 A;  4E3S A;  1KLM A;  4W5N A;  1VRU A;  1QQC A;  1LW0 A;  4KHN A;  3TAB A;  1BHL A;  2AJQ A;  1F21 A;  1GOA A;  4CGF A;  3SV4 A;  1DTT A;  1KSP A;  2OZM A;  4M3Y A;  4CJS A;  4CJU A;  3HPO A;  3V1O A;  1DTQ A;  1T03 A;  4AHT A;  4CHO A;  4DQP A;  4KFB A;  4CJT A;  4RW8 A;  3PX4 A;  1IH7 A;  1SL0 A;  5SWM A;  2DTU A;  3VA3 A;  3ZT4 A;  4QCL A;  3QO9 A;  1D9D A;  1A5W A;  1LW2 A;  3WNE A;  1X1P A;  3DLK A;  3QEI A;  2PYJ A;  4FJ5 A;  4O5B A;  5KTQ A;  4QOZ B;  1WSF A;  2P1J A;  2D0A A;  1WSG A;  1MU2 A;  3SI6 A;  3PO5 A;  1C6V A;  3S9H A;  3DRS A;  3EY1 A;  3NF9 A;  3NDK A;  4CJ5 A;  5HRN A;  2QKK A;  3P83 D;  4G1Q A;  4W5T A;  4Z4G A;  3OYF A;  2Y1I A;  1LV5 A;  3K5O A;  4DS4 A;  2IOC A;  1JLQ A;  4CEE A;  2YNI A;  3HJF A;  4RW7 A;  4C8M A;  4CF0 A;  1KCF A;  2VG5 A;  5CZ2 A;  1QSY A;  4JLH A;  1ZBI A;  3QER A;  1UA1 A;  3JSM A;  2PY5 A;  1VSD A;  3V9Z A;  1QS4 A;  3VQE A;  4F2R A;  1RBS A;  4BDY A;  3RRH A;  4FJG A;  2HHV A;  1SKR A;  1HMV A;  1EKE A;  2O4G A;  2FC0 A;  1R0A A;  1LWC A;  3SQ2 A;  1W0H A;  3WNH A;  1JLF A;  3KTQ A;  3IAY A;  3QIP A;  1YVU A;  4DTN A;  1QE1 A;  3SPY A;  2IDO A;  5J1E A;  4KHW A;  4ELV A;  1VSK A;  1RT6 A;  3IS9 A;  1WLJ A;  4CED A;  3IG1 A;  4C8K A;  1L5U A;  4OKK A;  3V9S A;  3U6F A;  1Q8I A;  3G10 A;  4E7K A;  5FRN A;  3OY9 A;  1RIL A;  3PV8 A;  1NK5 A;  5HRP A;  3L2U A;  4AH9 A;  4CJR A;  3L2W A;  3NE6 A;  1X9M A;  1NKB A;  2HVI A;  4FM2 A;  4LY7 A;  4Q5V A;  5J2P A;  3SPZ A;  3K57 A;  4I2P A;  2A1R A;  1XHZ A;  1L3T A;  1TK8 A;  3SQ1 A;  3ZSZ A;  4OLB A;  2F96 A;  3KLE A;  1N5Y A;  4FJ7 A;  5D3G A;  1NK7 A;  3DRP A;  2WOM A;  4RW4 A;  4Z4E A;  3QNO A;  4Z4I A;  4DSF A;  5FRO A;  2HHW A;  5K14 A;  1C0U A;  5HBM A;  1S1U A;  4K8X A;  4CIE A;  4CF2 A;  3AVJ A;  1VSM A;  3OVN A;  2P51 A;  1ZBU A;  1C0M A;  4FXD A;  1K6Y A;  2KZZ A;  4HCC A;  4E89 A;  3FFI A;  4FK0 A;  1A5V A;  4DSK A;  3K2P A;  4FVM A;  2BGG A;  5JS2 A;  4HHT A;  3TAE A;  3KJV A;  2XRI A;  4E7I A;  3U3G A;  2OA8 A;  4FJ8 A;  3RWU A;  1Z25 A;  3NAE A;  3ZSX A;  3MEE A;  3SNN A;  3VN5 A;  5CYQ A;  1BIU A;  1RT1 A;  4CJW A;  3HP6 A;  4KAZ A;  4XIU A;  2OPR A;  3M8R A;  4CJV A;  3SUQ A;  1VSE A;  4CE9 A;  3MEG A;  2B5J A;  4EZ6 A;  5JS1 A;  2OPP A;  4DU3 A;  4CEA A;  2HHS A;  3AVG A;  3DLR A;  4DSJ A;  4F3T A;  3MEC A;  5HRO A;  1S6P A;  3MXJ A;  4N47 A;  3VQQ A;  1J53 A;  1L3U A;  3OS0 A;  1TVR A;  2FBY A;  1RT5 A;  5C42 A;  3CFO A;  4FW2 A;  4E1N A;  5KGX A;  3NH0 A;  3OYJ A;  3K5N A;  1B9D A;  4DLG A;  3MXI A;  3CFP A;  2G8F A;  4N76 A;  4O0J A;  1KFD A;  1RBT A;  4KO0 A;  1S5J A;  1NK4 A;  4M3U A;  5I42 A;  2HNY A;  3THV A;  3K5M A;  4DU4 A;  2HB5 A;  3K5L A;  1U47 A;  1BGX T;  3ZSO A;  4HUE A;  3S3M A;  4KTQ A;  3AO2 A;  5KI6 A;  4FYD A;  1X9S A;  1VSL A;  4ICL A;  1NJW A;  3AV9 A;  3ZSY A;  1S1X A;  1SKW A;  2XHB A;  4KRE A;  1S6Q A;  4CGI A;  2RF2 A;  1HQU A;  1C0T A;  3KLH A;  3LP1 A;  2F8S A;  1A5X A;  1BL3 A;  3AVF A;  4IG0 A;  4L8R B;  1D5A A;  3ZCM A;  4PQU A;  1KFS A;  3QEX A;  4NYF A;  1FK9 A;  2NUB A;  4OVL A;  1ASV A;  1RNH A;  3AO1 A;  3AA4 A;  3NGZ A;  4FCY A;  3LWL A;  4HCB A;  3LZI A;  1HYZ A;  3AVC A;  2QK9 A;  4E7J A;  2KZM A;  3DRR A;  1RBR A;  4N5S A;  5DMR A;  3OS1 A;  2E6M A;  1RT7 A;  3KLI A;  2OZS A;  2ZE2 A;  4QAG A;  4M3W A;  1VSH A;  3OYA A;  4PWD A;  1J54 A;  2A1S A;  3DOL A;  3HVT A;  3DLG A;  3OJS A;  5C25 A;  4KB0 A;  1IO2 A;  4AHC A;  1NJX A;  1YTA A;  2D0B A;  3O3G A;  3C6T A;  3LZJ A;  4M3T A;  1JXB A;  5J2N A;  4PY5 A;  4O55 A;  4FLW A;  1RCH A;  1DLO A;  3KKS A;  3ZSR A;  3ZSV A;  4CJE A;  3QET A;  1WNS A;  3HO1 A;  2OYQ A;  2IGI A;  2E4L A;  3KK3 A;  2G8K A;  4FK2 A;  3ZT2 A;  2O4I A;  4BE0 A;  1NKE A;  3OYN A;  4DTR A;  2I5J A;  4PUO A;  4M42 A;  2HND A;  1Y97 A;  5KGW A;  1XHX A;  3V1R A;  4EP5 A;  4M3Z A;  3OYD A;  3HXM A;  1S1T A;  1RT4 A;  3RR7 A;  1LAW A;  2XY6 A;  2GBZ A;  4Y1D A;  2KFN A;  3SZ2 A;  3VQ9 A;  4FZZ A;  2X74 A;  4ELT A;  1BIZ A;  2QXF A;  2W42 A;  1NK6 A;  2ETJ A;  2YKN A;  1ZBF A;  3L3U A;  4I9Q A;  2HHQ A;  4DQS A;  4KTW A;  4OPJ A;  4DFJ A;  3AA2 A;  1LWE A;  4CGJ A;  5HRR A;  3DM2 A;  4IG3 A;  3TAF A;  2HHT A;  1NJY A;  4FJM A;  1RDC A;  1EET A;  2DFH A;  4KB1 A;  3KLF A;  3HM9 A;  3JYT A;  2Z1I A;  2PZS A;  4Y1C A;  4KHU A;  1J5O A;  4CK3 A;  3F9K A;  4CJK A;  4FM1 A;  1T05 A;  1JLG A;  3K58 A;  4F2S A;  2YNG A;  4AHR A;  3OJU A;  3L2Q A;  3BDP A;  3RRG A;  3C95 A;  4DTU A;  3CG7 A;  3VQ7 A;  4Z4C A;  3QES A;  1XC9 A;  3VQ6 A;  3V6D A;  4MQ3 A;  2RPI A;  4CJF A;  1EXQ A;  4PA1 A;  5SZT A;  4YFU A;  3E01 A;  1KVC A;  2Z1J A;  3VQ4 A;  4CJP A;  4FM0 A;  4DSE A;  1LWF A;  4OLA A;  2OPS A;  4KTZ A;  1QSS A;  2IAJ A;  1JXE A;  2BE2 A;  4MFB A;  4CEC A;  4NYN A;  3O3F A;  1S1W A;  1WAJ A;  2D0C A;  1T7P A;  3EZ5 A;  1NOZ A;  5HP1 A;  1HNV A;  4BDZ A;  1RTD A;  1GOB A;  3BGR A;  2HNZ A;  1U49 A;  4DQI A;  4Z0U A;  4BE1 A;  4CES A;  1B9F A;  2Y1J A;  5CY4 A;  4DF4 A;  3TR8 A;  2P5O A;  4B9V A;  2KW4 A;  1HYS A;  3LAN A;  4CER A;  1SKS A;  4FZX C;  4J2D A;  2ZQB A;  5KRT A;  2QKB A;  2LSN A;  1ASU A;  1HJR A;  4ID5 A;  4ID1 A;  4CEF A;  4CJ3 A;  4CHY A;  4DTJ A;  4B9S A;  4W5O A;  1JLE A;  4NCG A;  2VG7 A;  3KKR A;  1TAU A;  2HHX A;  5J2Q A;  3OYB A;  5DK5 A;  3NF7 A;  3O4N A;  4DSI A;  3KD1 E;  4W5R A;  3ULD A;  3DLH A;  4FLV A;  3LWM A;  1NKC A;  4DF8 A;  3HPG A;  3AVK A;  4CEB A;  4FJX A;  4OJR A;  3QNN A;  1LAV A;  3TWH A;  3PUF A;  2FBT A;  4JS4 A;  3U3Y A;  4B3O A;  1VRT A;  1KRP A;  4CGH A;  3HP9 A;  4M41 A;  1XI1 A;  2JLE A;  4N41 A;  2Q3S A;  4DSL A;  1ITG A;  1JLB A;  4OGC A;  4E1M A;  3SUP A;  2EHG A;  1RDA A;  1JL1 A;  1EX4 A;  2XY5 A;  3ZT3 A;  2BAN A;  3G0Z A;  4CIG A;  3L2R A;  1RBU A;  4HTU A;  1B92 A;  4B9N A;  4KHQ A;  4DFM A;  1S9E A;  2B4J A;  3L3V A;  2G8U A;  3A2F A;  1CLQ A;  4CFC A;  2X78 A;  4DTX A;  2XY7 A;  4DFP A;  4FK4 A;  3AVI A;  1L3S A;  4KRF A;  4C8N A;  4O0I A;  2JGU A;  2VWJ A;  1W9H A;  2B6A A;  4J2B A;  4KI6 A;  3VA0 A;  2WON A;  2KTQ A;  1TL1 A;  3ZSW A;  3H08 A;  2XO7 A;  4FLX A;  3VQP A;  3S3O A;  4C8O A;  4CHN A;  3HPH A;  2VG6 A;  3AVA A;  1VSJ A;  4FJK A;  3AA3 A;  3P1G A;  3OYM A;  4JRQ A;  5I3U A;  1QSL A;  2PYL A;  3V9W A;  3C94 A;  2D5R A;  3ASM A;  3UIQ A;  3ZT1 A;  4J2E A;  1FKP A;  4GVM A;  1Q9Y A;  1WAF A;  3O4Q A;  4O44 A;  4H8K A;  4BWM A;  4WE1 A;  4IBN A;  4B8A B;  3L8B A;  1HYV A;  1TGO A;  2Z1H A;  3D0P A;  4FLY A;  3SUN A;  1Q9X A;  2X6N A;  4LD0 A;  4B8C A;  4DU1 A;  3HVR A;  5T7B A;  4FLZ A;  1JL2 A;  4DS5 A;  4I2Q A;  3DLE A;  1SV5 A;  5HRS A;  4KHY A;  1VK0 A;  1U48 A;  3OYI A;  4ELU A;  2DY4 A;  1TV6 A;  4CFA A;  1UWB A;  3AO4 A;  3AVL A;  2F8T A;  1VSF A;  3ITH A;  4IDK A;  4CK1 A;  3VQC A; 
#chains in the Genus database with same CATH topology
 5ELZ A;  5C24 A;  4ZHR A;  3LAK A;  3RTV A;  1BQN A;  4DTO A;  3SQ4 A;  1KQS M;  3NF8 A;  2OPQ A;  1YT3 A;  3S3N A;  3RR8 A;  3C0B A;  3V1Q A;  4DUZ K;  1RTH A;  3O9S A;  4OKJ A;  4LF6 K;  2YHW A;  4JRP A;  2QWM A;  1FJG K;  4CCH A;  1BI4 A;  3LP3 A;  1W97 L;  3CPE A;  4FL9 A;  4E7H A;  1IBM K;  4FWL A;  3EYZ A;  3O1W A;  1TK0 A;  4NCB A;  4CFB A;  3ATV A;  4B3R K;  3LDO A;  1MDU B;  3C6H A;  4CHQ A;  4CIF A;  3FE1 A;  4FLU A;  3ZSQ A;  5GIN A;  1TKZ A;  1JLC A;  3SJJ A;  1X9W A;  4Z4H A;  1ZYQ A;  4IFE A;  2RHK A;  2PFU A;  3PIP L;  5CR4 A;  3IUC A;  4YOU A;  2P9L B;  1SL1 A;  1E4F T;  3I55 N;  1ZBL A;  1FKO A;  5C15 A;  3B6P A;  3RSE B;  1KAY A;  1RTJ A;  4CJ4 A;  4BY9 C;  3QEV A;  3CCU N;  1NGD A;  4H0T B;  4BRO A;  4V19 S;  3PX6 A;  3HST B;  4BRF A;  2Q31 A;  3KVG A;  1OH8 A;  4B9U A;  2FSJ A;  1NGG A;  1HQE A;  3VEV A;  2KHO A;  1RT2 A;  3ZT0 A;  1NGB A;  2NRR A;  2BDP A;  4FJH A;  3W0L A;  3DXM B;  2HBM A;  2E2O A;  2Z1G A;  4JHD A;  3AVN A;  4LF4 K;  3CM6 A;  4TSX A;  4CZH A;  3PO4 A;  1RDD A;  4I7F A;  3MXM A;  4DQ8 A;  2ZD1 A;  4IFY A;  4DG1 A;  2YKM A;  3NGY A;  2IVO A;  5AQS A;  4JI1 K;  1C1A A;  4NB4 A;  3PX0 A;  3EL2 A;  4BR9 A;  3O1B A;  3M8P A;  2ASP A;  3VF6 A;  4DV1 K;  4L3Q A;  4EP4 A;  1BCO A;  5AZI B;  1KC8 O;  3VTI A;  4JKF A;  1JCF A;  1NK0 A;  1NOY A;  3A5L C;  3EEQ A;  2O8D A;  3LPT A;  2KQ2 A;  3LAM A;  1RDW X;  4OKE A;  4HUF A;  1IKY A;  2IS3 A;  4LF9 K;  4UY8 O;  3RMB A;  4F3O A;  4BVP A;  3QIN A;  4JKG B;  3M8Q A;  3V9X A;  3AGR A;  3TAQ A;  3HBT A;  1WSE A;  3TSP A;  3CER A;  4M3X A;  5KPR A;  3CM5 A;  5M1N A;  3DOK A;  4GNI A;  5AZJ B;  1VRU A;  2HF4 A;  3R9P A;  4LC9 B;  2D1K A;  2AJQ A;  5AQR A;  1GOA A;  2OZM A;  1KSP A;  1U2V B;  4OPH A;  4CZJ A;  1DTQ A;  4CHO A;  3AAQ A;  1D9D A;  1A5W A;  1LW2 A;  4EHT A;  3I56 N;  3DLK A;  3QEI A;  4CW7 B;  1WSF A;  1C0G A;  2D0A A;  4BR5 A;  4C1N K;  2YJE A;  1C6V A;  2J4R A;  3GE1 A;  3DRS A;  4RCH A;  3EY1 A;  5AFU H;  3CJC A;  2ZWH A;  5AQF A;  2IOC A;  2YNI A;  3HJF A;  1TUY A;  3JS6 A;  1QSY A;  3JSM A;  4EAH D;  3WEE A;  3VQE A;  4BRC A;  1ATN A;  4RWT A;  4CZK A;  1R0A A;  1LWC A;  2KKZ A;  1JCG A;  3KTQ A;  3IAY A;  2P9I A;  4ELV A;  4O8U A;  1VSK A;  3VGK A;  4C8K A;  4BR4 A;  4OKK A;  3V9S A;  3G10 A;  5FRN A;  1NG9 A;  5GAE P;  4CJR A;  1M1K O;  4LY7 A;  3K57 A;  1XHZ A;  1L3T A;  1KD1 O;  1SZ2 A;  4DKW A;  1N5Y A;  4Z4E A;  2WOM A;  1C0U A;  4K8X A;  1S1U A;  3AVJ A;  3CCM N;  2P9S A;  2E2N A;  3GG4 A;  1ZBU A;  4YY3 K;  1K6Y A;  1Z05 A;  3EKS A;  4FK0 A;  5JS2 A;  4HHT A;  2NNW A;  2GEM A;  2P9L A;  5LMN K;  2P9K B;  3ZSX A;  5BRF A;  1BIU A;  1RT1 A;  2UUA K;  1MWM A;  3SUQ A;  4CE9 A;  4JKC A;  4EZ6 A;  4DSJ A;  4C23 A;  4CZE A;  1S6P A;  4N47 A;  3AGK A;  3VQQ A;  1L3U A;  4YDU C;  1TVR A;  3OYJ A;  5F1X A;  4LF8 K;  3NH0 A;  1QQN A;  1B9D A;  3CFP A;  4BGB A;  5AR0 A;  1M90 O;  4KO0 A;  1S5J A;  2HB5 A;  3K5L A;  1U47 A;  3U4L A;  4HUE A;  1BDG A;  4FO0 A;  1S1X A;  1YF5 L;  3MX5 A;  4KRE A;  2UYT A;  4CGI A;  2RF2 A;  1HQU A;  3IFR A;  3E66 A;  4H0P A;  1FK9 A;  4OVL A;  1HX1 A;  4FCY A;  3AVC A;  3EO3 A;  3DRR A;  4N5S A;  3SK3 A;  2E6M A;  1RT7 A;  3KLI A;  4PWD A;  5AQQ A;  2A1S A;  3DLG A;  4KB0 A;  1IO2 A;  5C2D A;  3O3G A;  5BRH A;  3L4I A;  1JXB A;  4PY5 A;  4O55 A;  1T44 A;  3KKS A;  1DLO A;  3VES A;  4CJE A;  5JLH A;  1OH7 A;  2PAV A;  3O9T A;  4JNE A;  4DTR A;  1Y97 A;  4A5A A;  3KHY A;  3OYD A;  1S1T A;  1YIJ N;  4FOI A;  3U9D A;  2GBZ A;  4Y1D A;  3VTH A;  3VEO A;  1VQN N;  4ELT A;  2W42 A;  1GLA G;  3AA2 A;  4JAX A;  4IG3 A;  2HHT A;  1E4G T;  4BC3 A;  2UUC K;  3JYT A;  2Z1I A;  2PZS A;  2KLA A;  1U2V A;  4F2S A;  3BDP A;  1BO5 O;  1S22 A;  1FW6 A;  4DTU A;  1HNW K;  4Z4C A;  3AAR A;  3V6D A;  2Z1J A;  1NGJ A;  4CJP A;  4FM0 A;  4K0K K;  3EKU A;  2Q97 A;  1S1W A;  2QI2 A;  1HNV A;  1GOB A;  3BGR A;  2HNZ A;  1U49 A;  1IBL K;  4Z0U A;  3H3N O;  1YI2 N;  5CY4 A;  2WFB A;  3LAN A;  4CER A;  5KRT A;  2QKB A;  2LSN A;  1ASU A;  1HJR A;  4CJ3 A;  4KH4 A;  4BRN A;  4BGA A;  3MK6 A;  3O4N A;  3ULD A;  1VQ9 N;  4GY2 B;  5FPE A;  4FLV A;  4NXN K;  1N8R O;  4HTL A;  2FBT A;  4DR3 K;  3FZL A;  1XI1 A;  4IZ9 A;  4DSL A;  4NLB A;  2QM1 A;  4CIG A;  1RBU A;  1B92 A;  4LFC K;  1S9E A;  3L3V A;  1CLQ A;  4DFP A;  5BRE A;  2P9P A;  1Q81 O;  2JGU A;  4KI6 A;  2WON A;  3ZSW A;  5IT9 O;  4FLX A;  3A0I X;  2VG6 A;  4YOV A;  1VSJ A;  4FJK A;  1QSL A;  4JRQ A;  4BG9 A;  3V9W A;  3SBT A;  2P9K A;  3VEW A;  3CME N;  4O44 A;  2ZJR L;  3L8B A;  1HYV A;  4FLY A;  4I6M A;  4B8C A;  3CCV N;  1JL2 A;  4K41 A;  3VF2 A;  5HRS A;  3KZB A;  3S41 A;  1TV6 A;  1UWB A;  2F8T A;  4CK1 A;  3CFR A;  5JVH L;  3QBW A;  2BUP A;  4DMN A;  4HUG A;  2A40 A;  1FXX A;  2F9W A;  2CH5 A;  4YNQ A;  1WSJ A;  4BRD A;  4B1W B;  3HI0 A;  1NJZ A;  3PY8 A;  3OYK A;  3NFA A;  3LDS A;  2YNF A;  2KFZ A;  2PBD A;  5M1O A;  4BWJ A;  4CJQ A;  2P9U B;  2GUI A;  4CEO A;  2IC3 A;  1D8Y A;  1JLA A;  3QB0 A;  4E7L A;  3N4P A;  3TAN A;  3ENO A;  3F73 A;  2OCE A;  4J8F A;  4RW6 A;  3WNG A;  2HMP A;  3CJB A;  3GOI A;  4A2B A;  1YXQ A;  3OYH A;  1NK9 A;  4FWR A;  1BQM A;  3HL8 A;  1KVB A;  5IWA K;  2DFF A;  4DFK A;  1SUQ A;  4KPY A;  1VQ6 N;  3RMC A;  4OX9 K;  3UE5 A;  4JV5 K;  4IFV A;  1TKT A;  3B6O A;  3V81 A;  4BDP A;  4AHV A;  4LF7 K;  1BIS A;  3VEX A;  4M45 A;  3DXK A;  3MN6 A;  3CCJ N;  4FJJ A;  5JIC A;  4CEZ A;  4F8R A;  2ITG A;  3TAP A;  1S3X A;  4YOT A;  3NH1 A;  4BR0 A;  3I8D A;  3P31 A;  4K8Z A;  4CGD A;  3D45 A;  1REV A;  2D4W A;  1O1W A;  4IOX A;  3A8Y A;  3CMA N;  1UOC A;  4CD3 A;  4DLE A;  5CZ1 A;  4EZ9 A;  2XY8 A;  4LH4 A;  4AHS A;  1IKW A;  4PKG A;  1WSI A;  5LY3 A;  1D9F A;  2DFE A;  1RTI A;  1CXU A;  2VWK A;  4NXM K;  4H4M A;  4CF8 A;  1YTU A;  1LOT B;  1WOQ A;  1I94 K;  4M7X A;  1NK8 A;  1RT3 A;  2VQE K;  2UXB K;  1BOT O;  4BG8 A;  2OTL N;  1XWL A;  3OBW A;  5AQG A;  3H6E A;  3ZET A;  5B8H A;  1YVN A;  4JKE A;  3LPU A;  3C6U A;  5AQK A;  4A59 A;  3AO3 A;  1GLF O;  2O8F B;  4Z94 A;  3QEW A;  3KD5 E;  4IXC A;  4A2A A;  2FSK A;  1IKX A;  5AJ3 K;  2RN2 A;  4MLH A;  2F9T A;  5FRM A;  4BR2 A;  3CQ8 A;  3FZH A;  4DTS A;  2NRH A;  3VGL A;  3NGI A;  1LV5 A;  1VSI A;  3T1A A;  4YOX A;  2O8E B;  4E0D A;  1W2B M;  4ZTJ A;  1J9A A;  5J2M A;  4H4O A;  1G99 A;  3L0Q A;  1OKJ A;  4CI6 A;  4FLT A;  1ASW A;  4FZY A;  3MWT A;  4A61 A;  2G8I A;  1HRH A;  3SV3 A;  3QBX A;  4ZTF A;  2NRW A;  3V4I A;  3T19 A;  4PKI A;  4RW9 A;  4BRP A;  4DR1 K;  1KAX A;  2GV9 A;  3AVM A;  3H45 C;  3R6M A;  4R5P A;  3EE9 A;  2CH6 A;  3HK2 A;  1CZB A;  4W5N A;  5F0X A;  1LW0 A;  3TAB A;  1F21 A;  4M3Y A;  4CJS A;  2F4V K;  2QWP A;  4IEE A;  3V1O A;  1DT9 A;  3ZX2 A;  4KFB A;  5GAG P;  5SWM A;  2HBL A;  4LFB K;  4FPB A;  3VOV A;  4B1Z A;  3R3L A;  4FJ5 A;  4BRQ A;  2QWR A;  3CHW A;  1NBW A;  5EX5 A;  2CGJ A;  1WSG A;  1MU2 A;  3HTV A;  3SI6 A;  2W6K A;  2GUP A;  2V7Y A;  4JI2 K;  4CJ5 A;  4BRE A;  3CCL N;  1XNQ K;  3OYF A;  4MDA A;  3T7Z A;  3O9Q A;  4RW7 A;  4CF0 A;  1NU0 A;  1KCF A;  5CZ2 A;  4FWQ A;  1ZBI A;  1NWK A;  3BZK A;  1Q86 O;  3TPQ A;  5BR8 K;  1VSD A;  4F9O A;  3V9Z A;  1QS4 A;  1RBS A;  4FJG A;  2HHV A;  1SKR A;  1HR0 K;  3SQ2 A;  3WNH A;  2ZGY A;  1JLF A;  1NMN A;  2NRX A;  3E1Y A;  4DTN A;  3ULE A;  4KHW A;  4YOY A;  1RT6 A;  2GEL A;  3U6F A;  3CI5 A;  1BUP A;  1N34 K;  1X9M A;  1NKB A;  2NLX A;  2H3G X;  4AH9 A;  3IKM A;  5HRP A;  3L2W A;  1TUU A;  1W7A A;  4I2P A;  4DV5 K;  1X9J A;  5LJW A;  4OLB A;  2F96 A;  3KLE A;  5D3G A;  5AQV A;  2ASO A;  2P9N B;  4ISF A;  3QNO A;  3MWP A;  4DSF A;  4Z4I A;  2HHW A;  4QS9 A;  5K14 A;  4IOC L;  2GWJ A;  1VSM A;  3OVN A;  2P51 A;  1C0M A;  4FXD A;  2KZZ A;  4E89 A;  3FFI A;  3K2P A;  2BGG A;  3D2F A;  4E7I A;  4FJ8 A;  3C6A A;  4H5T A;  3MEE A;  4DV0 K;  3SNN A;  5FPN A;  4CJW A;  3HP6 A;  4IJA A;  4XIU A;  5CHI A;  2HOE A;  4CJV A;  4KH6 A;  3MEG A;  5AQZ A;  2B5J A;  1N33 K;  5JS1 A;  1BWF O;  4QS8 A;  4DHY A;  4EFH A;  2HHS A;  4F3T A;  4H0Y B;  3RVC A;  1J53 A;  2E1Z A;  3PIO L;  3OS0 A;  2FBY A;  5C42 A;  5KGX A;  4DUY K;  3M3Z A;  4H03 B;  2QA4 N;  5ADX H;  2WUS A;  3CET A;  4N76 A;  4O0J A;  1KFD A;  4IO9 L;  3K0S A;  1IJJ A;  2YCH A;  3THV A;  2HNY A;  4M3U A;  1QVG M;  1BGX T;  3S3M A;  5KQD A;  3FZK A;  4ICL A;  1X9S A;  1NJW A;  1EO1 A;  3JXU A;  4WFA L;  1S6Q A;  3KLH A;  1C0T A;  3LP1 A;  2F8S A;  3LDQ A;  3DWL A;  4L8R B;  1D5A A;  3THW B;  5C10 A;  4PQU A;  2BTF A;  4YOR A;  1KFS A;  3QEX A;  2NUB A;  1ASV A;  1SS6 A;  2W40 A;  3FLC O;  1XUP O;  2QK9 A;  3OHR A;  2KZM A;  1RBR A;  3OS1 A;  1ATR A;  2ZE2 A;  3OYA A;  4GV3 A;  3L6Q A;  1J54 A;  3HVT A;  2D0P A;  4IOA L;  4AHC A;  1YAG A;  1KXP A;  3CJ7 A;  2E5L K;  3QET A;  2OYQ A;  4FK2 A;  2O4I A;  4BE0 A;  5AQM A;  1NKE A;  3OYN A;  2I5J A;  1QZ6 A;  3V1R A;  3D2E B;  3G25 A;  1RT4 A;  1K8K A;  2ASM A;  3CJA A;  2O8F A;  4I9Q A;  3SMP A;  1EQY A;  2YKN A;  1NK6 A;  1ZBF A;  4DQS A;  4KTW A;  1LWE A;  4YOW A;  1U6Z A;  5AQO A;  1RDC A;  2DFH A;  4KB1 A;  1Q7Y O;  3M5R A;  4KHU A;  1WBD A;  2E2Q A;  3K58 A;  3RRG A;  1YHQ N;  3QES A;  1XC9 A;  3VQ6 A;  2RPI A;  5SZT A;  4H5N A;  2E2P A;  1XC3 A;  2BE2 A;  4MFB A;  4CJ7 A;  1WAJ A;  1T7P A;  4BDZ A;  4DQI A;  1K9M O;  2V52 B;  2BH1 A;  3SAF A;  3VEZ A;  4DF4 A;  3TR8 A;  2P5O A;  4E1J A;  2KW4 A;  3P39 A;  3QIC A;  4ID1 A;  5EXW A;  4DTJ A;  4B9S A;  2VG7 A;  3O80 A;  1KAZ A;  3OYB A;  4DV4 K;  5DK5 A;  3NF7 A;  4GKK K;  3RSE A;  1ZXO A;  3ZEU B;  3HPG A;  4FJX A;  1HNZ K;  1VQO N;  5BR9 A;  3U3Y A;  3PSI A;  4JKD A;  3WT0 A;  4B3O A;  3VPZ A;  2O8C B;  2AA4 A;  3OBY A;  5H1S Q;  3CQY A;  4CGH A;  3HP9 A;  2ITM A;  4M41 A;  3QDK A;  5AQW A;  2Q3S A;  1EWR A;  1QHA A;  2EWS A;  1JL1 A;  1EX4 A;  4M63 C;  3VMF B;  2XY5 A;  3G0Z A;  2ZGZ A;  4HTU A;  4DV3 K;  4B9N A;  1P8Z A;  2GTD A;  3A2F A;  4DTX A;  5BRD A;  4FK4 A;  1VQK N;  1L3S A;  2WBN A;  4C8N A;  3TSU A;  3F2K A;  4R79 A;  2VWJ A;  1Y64 A;  4FWM A;  4DCH A;  2XO7 A;  4C8O A;  1HUX A;  4CZG A;  1V4T A;  3DXM A;  4AM6 A;  3AVA A;  3GBT A;  3TSQ A;  2UXC K;  1NGE A;  3AA3 A;  3OYM A;  5I3U A;  4EIA A;  4AQY K;  3C94 A;  3CCQ N;  3ZT1 A;  1FKP A;  4GVM A;  1WAF A;  4WE1 A;  5DM6 L;  3HVR A;  5T7B A;  4FLZ A;  4DS5 A;  3VER A;  1SV5 A;  3MCP A;  1VK0 A;  1U48 A;  2VGM A;  4PKH A;  5AZI A;  3AVL A;  3ITH A;  4J2B A;  2YHX A;  3MN9 A;  3AAP A;  1HJO A;  5AQJ A;  5GAD P;  4I9L A;  1KLN A;  5M1Q A;  5HL7 L;  4CEQ A;  4CHZ A;  3FFK B;  1GOC A;  4WQ5 A;  5C2F A;  1CZ9 A;  2NRT A;  1BG3 A;  1C1B A;  1J5E K;  1GLD G;  4HVJ A;  3RMA A;  4JKG A;  3O4W A;  3SQ0 A;  5AQT A;  2EX3 A;  3NBP A;  4MO5 A;  5KRS A;  3KIO A;  1HLU A;  3ID6 A;  3AO5 A;  4CBU A;  4B9M A;  1U45 A;  4KHP K;  3HZ6 A;  2E20 A;  3TAR A;  3TAG A;  1NNE A;  2OZS A;  2G8W A;  3IDH A;  4JK8 A;  5AZJ A;  3TU5 A;  1IBK K;  3HSC A;  4FWP A;  2G8V A;  3SCX A;  3UKU B;  4ILJ A;  1HPZ A;  3WUH A;  3TTD A;  3IRX A;  5BPN A;  4DV6 K;  5EY4 A;  4WFB L;  3QFU A;  4E19 A;  1T8E A;  4H5R A;  3THX B;  4Z4F A;  1I3A A;  5GIO A;  3NHG A;  1QQM A;  3E9O A;  4JD2 B;  2W6L A;  2R7Y A;  4FJ9 A;  4XEI A;  2HBK A;  1KVA A;  3KWI A;  4AHU A;  3CJ9 A;  1Z26 A;  1C1C A;  2FBV A;  4DTM A;  1K8A O;  3OYE A;  2FSN A;  4FW1 A;  2YV0 X;  3M1F A;  3QIO A;  3N4Q A;  1MWK A;  1U04 A;  1HKG A;  4DWI A;  1H1V A;  4IKF A;  4KKO A;  4BRM A;  1E3M A;  4F4K A;  3SUO A;  2GWK A;  3KWG A;  4FJN A;  4GMJ B;  3VQA A;  3FR0 A;  3PLA A;  4BQL A;  3WNF A;  1TAQ A;  3KK7 A;  3MAQ A;  1SL2 A;  3IMX A;  4IO8 A;  4KBO A;  3SLC A;  2ZJQ L;  4X65 K;  4BC4 A;  4CBX A;  3LAL A;  4W5Q A;  1L3V A;  2RKI A;  1UAX A;  4NO7 A;  4BAC A;  3CC4 N;  2D0O A;  3DI6 A;  3NF6 A;  4AF1 A;  4LH5 A;  3I8B A;  2QWQ A;  1GLC G;  3CCE N;  2VWB A;  1NJI O;  2YHB A;  3CYM A;  3UKR B;  3NH2 A;  3F5T A;  4CGG A;  4BRL A;  1IG9 A;  4BC2 A;  4M7Y A;  1TKD A;  4CJL A;  4B9L A;  1YJN N;  2NRZ A;  3QLH A;  3O3H A;  5BPL A;  3G71 N;  3P5J A;  3KK1 A;  3D6R A;  4LSL A;  4LFA K;  2UXD K;  2E8A A;  2X6S A;  3DMJ A;  1YJ9 N;  1NGH A;  3L4Q A;  1UA0 A;  1TL3 A;  3KK2 A;  2GX9 A;  4KHS A;  2VYP A;  3QEP A;  1WN7 A;  5DM7 L;  1BI4 B;  4RG8 A;  3RMD A;  3I33 A;  1BA1 A;  1NM1 A;  2E6L A;  4ISE A;  1QVF M;  2FLO A;  4DR2 K;  3OS2 A;  1KTQ A;  1TKX A;  3AY9 A;  3I0R A;  4CFD A;  4G9Z A;  4B3S K;  1KLM A;  5JMV A;  1QQC A;  3U8X A;  1BHL A;  4B1V A;  4WF9 L;  4CGF A;  3SV4 A;  1DTT A;  2QW9 A;  4CJU A;  3HPO A;  3BY5 A;  4DQP A;  4AHT A;  4RW8 A;  5MLC Q;  3MX2 A;  3VA3 A;  1X1P A;  3E9P A;  4QOZ B;  2P1J A;  4GV9 A;  3S9H A;  1Q82 O;  3NF9 A;  4BRA A;  5HRN A;  4G1Q A;  3K5O A;  2ZM6 K;  3WQU A;  4C8M A;  2VG5 A;  4DR4 K;  4BR7 A;  1ESV A;  4F2R A;  3EE8 A;  3RRH A;  1EKE A;  2FC0 A;  4ILH A;  3QIP A;  4K43 A;  4WQ5 C;  1WB9 A;  1YVU A;  1QE1 A;  3O5B A;  1WLJ A;  4CVN E;  3Q7B A;  2Q36 A;  5KPT A;  3D7E O;  1NLV A;  2F7T A;  3IG1 A;  1L5U A;  4JHD B;  4JN4 A;  4X64 K;  3PV8 A;  3NE6 A;  3L2U A;  2CGL A;  1XNR K;  4FM2 A;  2A1R A;  4Q5V A;  4DR7 K;  1N32 K;  1TK8 A;  3SQ1 A;  3ZSZ A;  3T1Y K;  3BP8 A;  1NK7 A;  3DRP A;  3WXJ A;  5HBM A;  3ENB A;  4JI3 K;  4B9Q A;  1OH5 A;  3TTC A;  4FVM A;  3CD6 N;  3TAE A;  3KJV A;  3U3G A;  2O8D B;  3LM2 A;  1NGA A;  5AQI A;  3RWU A;  1Z25 A;  2JWK A;  4JK7 A;  3BF3 A;  3EN9 A;  3VN5 A;  1CZA N;  4KAZ A;  2O8B B;  1JJ2 M;  5AFU A;  3M8R A;  1OH6 A;  4IJN A;  1TYQ B;  4BVO A;  4DU3 A;  4CEA A;  3DLR A;  3MEC A;  5HRO A;  3MXJ A;  1T3V A;  2Q0R A;  1T6D A;  2YI1 A;  4E1N A;  3K5N A;  3FZF A;  2RE2 A;  4U67 L;  4DU4 A;  4RTF D;  4KTQ A;  2A3Z A;  5KI6 A;  1VSL A;  3AV9 A;  4FWN A;  3LDP A;  2HBJ A;  1BL3 A;  3AVF A;  1K73 O;  2DPN A;  3ZCM A;  4LF5 K;  2A6A A;  4MDB A;  4JI5 K;  3NGZ A;  3F9M A;  5TKY A;  2UUB K;  4HCB A;  3LZI A;  3A5N C;  4E7J A;  5DMR A;  4H0V B;  4O8K A;  4IWV A;  5F2R A;  4QAG A;  4M3W A;  4K42 A;  2A5X A;  3WEE B;  1BA0 A;  1NJX A;  2D0B A;  1SQK A;  3LZJ A;  4M3T A;  2NZT A;  3JAM O;  5J2N A;  2OAN A;  3NVK A;  3ZSR A;  3ZSV A;  3HO1 A;  1WNS A;  2P9I B;  2E4L A;  3KK3 A;  4WQ4 A;  3ZT2 A;  1GLE G;  5KGW A;  1XHX A;  4M3Z A;  3RR7 A;  2XY6 A;  2FF3 B;  2KFN A;  3C65 A;  2ETJ A;  4H0O A;  5FPM A;  4OPJ A;  5HRR A;  3DM2 A;  4A57 A;  3TAF A;  1NJY A;  3KLF A;  3HM9 A;  4FPA A;  4CK3 A;  1ATS A;  5M1P A;  4FM1 A;  2P9S B;  4FWS A;  4Y0W A;  3H3O B;  5C12 A;  1VQM N;  1T05 A;  4FVU A;  4JI0 K;  3L2Q A;  2A41 A;  3OJU A;  4H0X B;  1XMO K;  3VQ7 A;  1QZ5 A;  4MQ3 A;  1EXQ A;  2P9U A;  4PA1 A;  4YFU A;  3E01 A;  3CF5 L;  2YHY A;  5AQN A;  4OLA A;  2OPS A;  4GV6 A;  2IAJ A;  4CEC A;  3ENH A;  2W41 A;  4DR5 K;  4GKJ K;  1O13 A;  1NGC A;  5HOO A;  4CES A;  1B9F A;  4BRH A;  3B8A X;  4B9V A;  5E26 A;  1HYS A;  4FZX C;  1SKS A;  3O6W A;  4YDU A;  3U9Z A;  4CHY A;  4ID5 A;  3QML A;  3P4I A;  4W5O A;  1JLE A;  1ZC6 A;  3VGM A;  4DSI A;  4W5R A;  5AQP A;  3DLH A;  3LWM A;  1NGI A;  4MO4 A;  1Q18 A;  3VET A;  4OJR A;  3QNN A;  4JKH A;  1QQO A;  5BN8 A;  1YJW N;  5JLF A;  3PUF A;  4JS4 A;  3TWH A;  2I7P A;  3J81 O;  3J7Y P;  2JLE A;  2V51 B;  1ITG A;  1JLB A;  3SUP A;  1XMQ K;  2EHG A;  3ZT3 A;  3J80 O;  3L2R A;  3MCA B;  2B4J A;  2XY7 A;  2JWL A;  3H1V X;  3O9U A;  4KRF A;  3C7N B;  4O0I A;  1TL1 A;  3H08 A;  1VQ4 N;  4CHN A;  3MN7 A;  3OW2 M;  3P1G A;  2D5R A;  3ASM A;  3UIQ A;  1Q9Y A;  3DLL L;  1YIT N;  4H8K A;  4IBN A;  2O8B A;  1TGO A;  2Z1H A;  3CIP A;  3D0P A;  2X6N A;  4LD0 A;  1TYQ A;  4DU1 A;  2ZJP L;  4I2Q A;  3DLE A;  4KHY A;  3WXL A;  1GLJ O;  2V7Z A;  1VSF A;  4IDK A;  3VQC A;  3K59 A;  3ZX0 A;  1QHT A;  5AQX A;  3FGU A;  5EU7 A;  3SMS A;  3FZM A;  3R1X A;  3OYG A;  4CF1 A;  3TAM A;  3KLG A;  2O8E A;  4B08 A;  3CJ1 A;  2Q1N A;  3ISN C;  3THY B;  1HKB A;  1BU6 O;  4JI6 K;  4JKA A;  1TK5 A;  2A42 A;  1HNI A;  1CXQ A;  5EVZ A;  3DAW A;  1N6Q A;  4A5B A;  2YNH A;  1RDB A;  3VQD A;  3CXC M;  3NCI A;  5HLF A;  2QWL A;  3A5M C;  2QWO A;  4MLE A;  1OVQ A;  3SAH A;  3T69 A;  2HHU A;  1IV0 A;  3CQX A;  4OO1 J;  2IIR A;  3HRG A;  4C8L A;  4JI8 K;  3HOT A;  3AVB A;  1ZBH A;  4AIL C;  3MN5 A;  4DQQ A;  5M1K A;  4LSN A;  4CK2 A;  3NVM A;  1HNX K;  1QTM A;  2FBX A;  4IDH A;  4KV8 A;  4WQ4 C;  1T6C A;  2P5G A;  4JKB A;  1G15 A;  1SAZ A;  4UQG A;  4CZL A;  3DLB A;  1I39 A;  4BRK A;  2ATQ A;  2HVH A;  4FJI A;  5LL6 Z;  1GLL O;  4CF9 A;  1EWQ A;  3AVH A;  4GW6 A;  3MED A;  2WC9 A;  4CD1 A;  5C0Y A;  4B9T A;  3VQ8 A;  1WBB A;  4NCA A;  2P9P B;  3VQ5 A;  3HT3 A;  1WSH A;  3MDQ A;  5BN9 A;  2VQF K;  3SYZ A;  4FWK A;  1IG8 A;  1OVY A;  4J2A A;  3LP0 A;  1VQL N;  3J7Z O;  3DYA A;  1S9G A;  3AA5 X;  4IEI A;  5CYM A;  4JK9 A;  3G4S N;  2HMI A;  4FJL A;  1EP4 A;  4KI4 A;  4CZI A;  2P9N A;  4I6M B;  3GL1 A;  1J6Z A;  1JKH A;  2OTJ N;  4DTP A;  4QS7 A;  2WTU A;  2IVP A;  3HYF A;  1NMD A;  4M3R A;  3M8S A;  1BCM A;  3TI0 A;  4PL7 A;  3E9L A;  3GDQ A;  5LMU K;  3OYL A;  1N36 K;  5KPZ A;  3T3F A;  3L2V A;  4O4G A;  4OGE A;  4JEP A;  3I0S A;  4BE2 A;  1U4B A;  3BZC A;  1RBV A;  3ALY A;  4X66 K;  3VQB A;  1DEJ A;  3LM9 A;  2QEX N;  4Q0B A;  3ZX3 A;  4JS5 A;  4DQR A;  4CHP A;  2HW3 A;  5E41 A;  2NRV A;  1IKV A;  2G8H A;  3V9U A;  4A62 A;  1S1V A;  5FPD A;  2YHA A;  5FDL A;  2VCP A;  3OYC A;  3LP2 A;  4OPK A;  4N56 A;  3SJH A;  4E3S A;  4KHN A;  5A2Q O;  1VQP N;  1Z6R A;  5AQY A;  3ATU A;  3UB5 A;  3C7N A;  1T03 A;  4CJT A;  3PX4 A;  1IH7 A;  1SL0 A;  3CC7 N;  3DXK B;  2DTU A;  1ZBS A;  3ZT4 A;  4QCL A;  3QO9 A;  4H5V A;  3WNE A;  2PYJ A;  4O5B A;  1VAZ A;  5KTQ A;  3BUZ B;  3PO5 A;  3THW A;  2QTD A;  4PL8 A;  3NDK A;  3PSF A;  2QKK A;  3P83 D;  4W5T A;  4Z4G A;  4WFN L;  2Y1I A;  4DS4 A;  1JLQ A;  4CEE A;  3SAG A;  3BF1 A;  4JLH A;  3QER A;  1UA1 A;  2PY5 A;  3LL3 A;  4GVE A;  4BDY A;  4ISG A;  3G6E N;  1HMV A;  2O4G A;  1X3M A;  4CBW A;  1W0H A;  2E88 A;  3THY A;  3SPY A;  2IDO A;  5J1E A;  2YJF A;  3IS9 A;  1XQS C;  4CED A;  3OA9 A;  3D2E A;  3K9K A;  1Q8I A;  4E7K A;  1DGK N;  3OY9 A;  1RIL A;  1NK5 A;  2HVI A;  4JI4 K;  3ZET B;  5J2P A;  3SPZ A;  4B1Y B;  2E1Y A;  4WYB A;  4FJ7 A;  2ZF5 O;  4RW4 A;  1X3N A;  5FRO A;  1R59 O;  4FWO A;  3TTF A;  4CIE A;  4CF2 A;  2FXU A;  3J7A P;  4X62 K;  5I9E B;  3OTO K;  2I7N A;  4HCC A;  3K9J A;  4DB3 A;  1A5V A;  4DSK A;  3WXI A;  2XRI A;  2OA8 A;  1DKG D;  4XH5 A;  3NAE A;  3H1Q A;  3O08 A;  5CYQ A;  5BPM A;  1RDU A;  2OPR A;  1VSE A;  2OPP A;  3LDL A;  3AVG A;  5AQU A;  3VEN A;  4DR6 K;  5TKW A;  5GIP A;  3O8M A;  4BQZ A;  3P38 A;  3WXK A;  3MMV A;  3NMU A;  3BEX A;  1RT5 A;  3CFO A;  4FW2 A;  4DLG A;  1YUW A;  3MXI A;  3ZYY X;  2G8F A;  3ID8 A;  4XH4 A;  1RBT A;  4NLC A;  1NK4 A;  3SBG A;  5I42 A;  3K5M A;  4KH5 A;  1RGI A;  3ZSO A;  5M1F A;  5LJV A;  3ZEU A;  3AO2 A;  4FYD A;  3ZSY A;  2O8C A;  1SKW A;  3M6G A;  4C1N I;  2XHB A;  1A5X A;  4OPA A;  2YX6 A;  4IG0 A;  4NYF A;  1RNH A;  3AO1 A;  3AA4 A;  3LWL A;  4B3M K;  4B1X B;  2UU9 K;  1HYZ A;  1NGF A;  4XH1 A;  1VSH A;  3DOL A;  3OJS A;  2FF6 A;  5C25 A;  4DV7 K;  3R8E A;  1YTA A;  3C6T A;  1VQ7 N;  3EZW A;  4FLW A;  1RCH A;  2CGK A;  2IGI A;  2G8K A;  3ULE B;  1WUA A;  3QFP A;  4PUO A;  4M42 A;  2HND A;  4EP5 A;  3HXM A;  3W3D A;  1LAW A;  2AP1 A;  3SZ2 A;  3VQ9 A;  1MA9 B;  4FZZ A;  2X74 A;  1BIZ A;  2QXF A;  3L3U A;  4B3T K;  2HHQ A;  5AQL A;  4DFJ A;  4CGJ A;  5ADX A;  1P90 A;  3DJC A;  4FJM A;  1EET A;  3T1H K;  4Y1C A;  1J5O A;  3F9K A;  4CJK A;  1JLG A;  2YNG A;  1VHX A;  4AHR A;  1VQ8 N;  3C95 A;  4U7B A;  4PHT X;  3CG7 A;  1S72 N;  3D2F B;  3J8A A;  4CJF A;  3VQ4 A;  1KVC A;  4DSE A;  1LWF A;  5EOY A;  2Q2R A;  4KTZ A;  1QSS A;  1JXE A;  3O3F A;  4NYN A;  3CCS N;  4B1U B;  2D0C A;  3EZ5 A;  1NOZ A;  5HP1 A;  1RTD A;  1D4X A;  3VEY A;  4BE1 A;  3UKU A;  2Y1J A;  2Q0U A;  3CPW M;  4J2D A;  3WXM B;  2ZQB A;  2IVN A;  5KQ8 A;  4CEF A;  4FSV A;  5CE3 A;  5GAH P;  3CCR N;  4NCG A;  3KKR A;  1TAU A;  1V4S A;  3A5O C;  3HOS A;  5J2Q A;  2HHX A;  2HF3 A;  3THX A;  4JI7 K;  2HST A;  3KD1 E;  1NKC A;  4JD2 A;  3H46 O;  4DF8 A;  3AVK A;  4CEB A;  4BRI A;  2VGN A;  1LAV A;  4CZM A;  4JYA K;  5AQH A;  3O9R A;  3VF4 A;  1JCE A;  1VRT A;  1KRP A;  4N41 A;  3ZLJ A;  4OGC A;  4BRG A;  4E1M A;  1ILY A;  1RDA A;  1VQ5 N;  4YHH K;  2BAN A;  1LCU A;  4KHQ A;  4DFM A;  4DV2 K;  2G8U A;  4O5F A;  4CFC A;  2X78 A;  4WCE L;  3AVI A;  1RFQ A;  1W9H A;  2B6A A;  3VA0 A;  2KTQ A;  4BC5 A;  3VQP A;  3S3O A;  3HPH A;  2QXL A;  1HPM A;  1GLB G;  5E84 A;  2PYL A;  3Q7C A;  5JVG L;  4K25 A;  4J2E A;  3O4Q A;  2QWN A;  3CC2 N;  5FLX O;  4BWM A;  4FOE A;  4B8A B;  3WQT A;  1Q9X A;  4H5W A;  3SUN A;  4ILG B;  1C0F A;  4HWI A;  4EHU A;  4AM7 A;  3LDN A;  3HM8 A;  1HKC A;  3OYI A;  4ELU A;  2DY4 A;  1K8K B;  4CFA A;  4CZF A;  3AO4 A;  2HHH K;  3UKR A; 
#chains in the Genus database with same CATH homology
 3K59 A;  1QHT A;  5EU7 A;  3OYG A;  1KLN A;  4I9L A;  5C24 A;  4CF1 A;  4CEQ A;  3LAK A;  3TAM A;  4CHZ A;  4DMN A;  4ZHR A;  3RTV A;  3KLG A;  1BQN A;  4B08 A;  4HUG A;  4DTO A;  3SQ4 A;  1FXX A;  1GOC A;  3NF8 A;  3ISN C;  4YNQ A;  2OPQ A;  1YT3 A;  1WSJ A;  3S3N A;  3RR8 A;  1CZ9 A;  1C1B A;  4HVJ A;  3V1Q A;  1NJZ A;  1RTH A;  4OKJ A;  3OYK A;  3RMA A;  1TK5 A;  3NFA A;  3SQ0 A;  3PY8 A;  2EX3 A;  3LDS A;  2YNF A;  4JRP A;  2KFZ A;  1HNI A;  3NBP A;  1CXQ A;  4BWJ A;  5KRS A;  3KIO A;  4CJQ A;  2GUI A;  4CCH A;  1BI4 A;  3LP3 A;  4CEO A;  2IC3 A;  4E7H A;  1D8Y A;  1JLA A;  4E7L A;  3EYZ A;  1N6Q A;  3AO5 A;  1TK0 A;  3TAN A;  4B9M A;  1U45 A;  2YNH A;  3F73 A;  4NCB A;  1RDB A;  4CFB A;  4RW6 A;  3WNG A;  3OYH A;  3VQD A;  3TAR A;  4CIF A;  3TAG A;  4CHQ A;  3NCI A;  5HLF A;  1NK9 A;  4FLU A;  3ZSQ A;  2G8W A;  1BQM A;  3HL8 A;  1TKZ A;  1KVB A;  1JLC A;  3SJJ A;  2G8V A;  3SCX A;  2DFF A;  2HHU A;  4DFK A;  1X9W A;  1SUQ A;  4Z4H A;  4KPY A;  1HPZ A;  3RMC A;  1ZYQ A;  4IFV A;  1TKT A;  3B6O A;  3IRX A;  3V81 A;  4BDP A;  4AHV A;  4C8L A;  3AVB A;  1ZBH A;  1BIS A;  4AIL C;  4M45 A;  4DQQ A;  4FJJ A;  4LSN A;  4CK2 A;  1SL1 A;  4E19 A;  4CEZ A;  1T8E A;  1ZBL A;  1FKO A;  4F8R A;  2ITG A;  1QTM A;  3B6P A;  3TAP A;  2FBX A;  4Z4F A;  1I3A A;  1RTJ A;  3NHG A;  4KV8 A;  4CJ4 A;  3NH1 A;  2R7Y A;  4FJ9 A;  3QEV A;  1KVA A;  2P5G A;  3I8D A;  4AHU A;  4K8Z A;  4CGD A;  1G15 A;  1Z26 A;  3D45 A;  1C1C A;  2FBV A;  4UQG A;  1REV A;  3DLB A;  3PX6 A;  3HST B;  1I39 A;  1O1W A;  4DTM A;  3CFR A;  2ATQ A;  2HVH A;  3OYE A;  4FJI A;  1UOC A;  4CF9 A;  4FW1 A;  2YV0 X;  4B9U A;  4DLE A;  3AVH A;  5CZ1 A;  4EZ9 A;  2XY8 A;  3QIO A;  4GW6 A;  4LH4 A;  1IKW A;  4AHS A;  3MED A;  1U04 A;  1WSI A;  1D9F A;  4DWI A;  4IKF A;  4B9T A;  1HQE A;  3VQ8 A;  4KKO A;  2DFE A;  4F4K A;  4NCA A;  1RTI A;  3SUO A;  3VQ5 A;  3HT3 A;  4FJN A;  1WSH A;  1CXU A;  1RT2 A;  2VWK A;  4GMJ B;  4H4M A;  3VQA A;  4CF8 A;  3ZT0 A;  3SYZ A;  1YTU A;  2BDP A;  4FJH A;  3WNF A;  1TAQ A;  4J2A A;  3LP0 A;  1NK8 A;  1RT3 A;  2Z1G A;  3DYA A;  3MAQ A;  1SL2 A;  3AVN A;  1S9G A;  3CM6 A;  3AA5 X;  4TSX A;  3PO4 A;  1RDD A;  4I7F A;  5CYM A;  3MXM A;  1XWL A;  2ZD1 A;  4IFY A;  4DG1 A;  3LAL A;  4W5Q A;  2HMI A;  2YKM A;  3NGY A;  1L3V A;  4FJL A;  1EP4 A;  2RKI A;  1UAX A;  4KI4 A;  4BAC A;  3LPU A;  3NF6 A;  3DI6 A;  3C6U A;  1C1A A;  3AO3 A;  3PX0 A;  1JKH A;  4LH5 A;  3M8P A;  4DTP A;  3QEW A;  3KD5 E;  3HYF A;  4EP4 A;  4M3R A;  3M8S A;  1BCO A;  1IKX A;  2YHB A;  1BCM A;  3CYM A;  3TI0 A;  3NH2 A;  2RN2 A;  4CGG A;  1NK0 A;  5FRM A;  1IG9 A;  1NOY A;  3CQ8 A;  3OYL A;  1TKD A;  4DTS A;  4CJL A;  4B9L A;  3NGI A;  3LPT A;  2KQ2 A;  3QLH A;  3O3H A;  1VSI A;  3T1A A;  3LAM A;  3P5J A;  4O4G A;  3KK1 A;  3L2V A;  3T3F A;  4E0D A;  4OGE A;  4LSL A;  3I0S A;  4BE2 A;  4OKE A;  1U4B A;  4HUF A;  1IKY A;  2X6S A;  1RBV A;  2IS3 A;  1J9A A;  3DMJ A;  5J2M A;  3ALY A;  4H4O A;  3RMB A;  4ZTJ A;  3VQB A;  1UA0 A;  4F3O A;  1TL3 A;  3QIN A;  3KK2 A;  3M8Q A;  3V9X A;  4FLT A;  3TAQ A;  4KHS A;  1WSE A;  4Q0B A;  1ASW A;  4FZY A;  4JS5 A;  2G8I A;  4DQR A;  1HRH A;  3SV3 A;  4M3X A;  3QEP A;  1WN7 A;  4ZTF A;  4CHP A;  3V4I A;  1BI4 B;  4RG8 A;  3T19 A;  3CM5 A;  5E41 A;  1IKV A;  3RMD A;  2G8H A;  3V9U A;  2HW3 A;  2E6L A;  4RW9 A;  1S1V A;  2YHA A;  3DOK A;  5FDL A;  2GV9 A;  3AVM A;  3OS2 A;  3OYC A;  3LP2 A;  4R5P A;  1KTQ A;  1TKX A;  3I0R A;  3HK2 A;  4CFD A;  4OPK A;  1CZB A;  4N56 A;  4E3S A;  1KLM A;  4W5N A;  1VRU A;  1QQC A;  1LW0 A;  4KHN A;  3TAB A;  1BHL A;  2AJQ A;  1F21 A;  1GOA A;  4CGF A;  3SV4 A;  1DTT A;  1KSP A;  2OZM A;  4M3Y A;  4CJS A;  4CJU A;  3HPO A;  3V1O A;  1DTQ A;  1T03 A;  4AHT A;  4CHO A;  4DQP A;  4KFB A;  4CJT A;  4RW8 A;  3PX4 A;  1IH7 A;  1SL0 A;  5SWM A;  2DTU A;  3VA3 A;  3ZT4 A;  4QCL A;  3QO9 A;  1D9D A;  1A5W A;  1LW2 A;  3WNE A;  1X1P A;  3DLK A;  3QEI A;  2PYJ A;  4FJ5 A;  4O5B A;  5KTQ A;  4QOZ B;  1WSF A;  2P1J A;  2D0A A;  1WSG A;  1MU2 A;  3SI6 A;  3PO5 A;  1C6V A;  3S9H A;  3DRS A;  3EY1 A;  3NF9 A;  3NDK A;  4CJ5 A;  5HRN A;  2QKK A;  3P83 D;  4G1Q A;  4W5T A;  4Z4G A;  3OYF A;  2Y1I A;  1LV5 A;  3K5O A;  4DS4 A;  2IOC A;  1JLQ A;  4CEE A;  2YNI A;  3HJF A;  4RW7 A;  4C8M A;  4CF0 A;  1KCF A;  2VG5 A;  5CZ2 A;  1QSY A;  4JLH A;  1ZBI A;  3QER A;  1UA1 A;  3JSM A;  2PY5 A;  1VSD A;  3V9Z A;  1QS4 A;  3VQE A;  4F2R A;  1RBS A;  4BDY A;  3RRH A;  4FJG A;  2HHV A;  1SKR A;  1HMV A;  1EKE A;  2O4G A;  2FC0 A;  1R0A A;  1LWC A;  3SQ2 A;  1W0H A;  3WNH A;  1JLF A;  3KTQ A;  3IAY A;  3QIP A;  1YVU A;  4DTN A;  1QE1 A;  3SPY A;  2IDO A;  5J1E A;  4KHW A;  4ELV A;  1VSK A;  1RT6 A;  3IS9 A;  1WLJ A;  4CED A;  3IG1 A;  4C8K A;  1L5U A;  4OKK A;  3V9S A;  3U6F A;  1Q8I A;  3G10 A;  4E7K A;  5FRN A;  3OY9 A;  1RIL A;  3PV8 A;  1NK5 A;  5HRP A;  3L2U A;  4AH9 A;  4CJR A;  3L2W A;  3NE6 A;  1X9M A;  1NKB A;  2HVI A;  4FM2 A;  4LY7 A;  4Q5V A;  5J2P A;  3SPZ A;  3K57 A;  4I2P A;  2A1R A;  1XHZ A;  1L3T A;  1TK8 A;  3SQ1 A;  3ZSZ A;  4OLB A;  2F96 A;  3KLE A;  1N5Y A;  4FJ7 A;  5D3G A;  1NK7 A;  3DRP A;  2WOM A;  4RW4 A;  4Z4E A;  3QNO A;  4Z4I A;  4DSF A;  5FRO A;  2HHW A;  5K14 A;  1C0U A;  5HBM A;  1S1U A;  4K8X A;  4CIE A;  4CF2 A;  3AVJ A;  1VSM A;  3OVN A;  2P51 A;  1ZBU A;  1C0M A;  4FXD A;  1K6Y A;  2KZZ A;  4HCC A;  4E89 A;  3FFI A;  4FK0 A;  1A5V A;  4DSK A;  3K2P A;  4FVM A;  2BGG A;  5JS2 A;  4HHT A;  3TAE A;  3KJV A;  2XRI A;  4E7I A;  3U3G A;  2OA8 A;  4FJ8 A;  3RWU A;  1Z25 A;  3NAE A;  3ZSX A;  3MEE A;  3SNN A;  3VN5 A;  5CYQ A;  1BIU A;  1RT1 A;  4CJW A;  3HP6 A;  4KAZ A;  4XIU A;  2OPR A;  3M8R A;  4CJV A;  3SUQ A;  1VSE A;  4CE9 A;  3MEG A;  2B5J A;  4EZ6 A;  5JS1 A;  2OPP A;  4DU3 A;  4CEA A;  2HHS A;  3AVG A;  3DLR A;  4DSJ A;  4F3T A;  3MEC A;  5HRO A;  1S6P A;  3MXJ A;  4N47 A;  3VQQ A;  1J53 A;  1L3U A;  3OS0 A;  1TVR A;  2FBY A;  1RT5 A;  5C42 A;  3CFO A;  4FW2 A;  4E1N A;  5KGX A;  3NH0 A;  3OYJ A;  3K5N A;  1B9D A;  4DLG A;  3MXI A;  3CFP A;  2G8F A;  4N76 A;  4O0J A;  1KFD A;  1RBT A;  4KO0 A;  1S5J A;  1NK4 A;  4M3U A;  5I42 A;  2HNY A;  3THV A;  3K5M A;  4DU4 A;  2HB5 A;  3K5L A;  1U47 A;  1BGX T;  3ZSO A;  4HUE A;  3S3M A;  4KTQ A;  3AO2 A;  5KI6 A;  4FYD A;  1X9S A;  1VSL A;  4ICL A;  1NJW A;  3AV9 A;  3ZSY A;  1S1X A;  1SKW A;  2XHB A;  4KRE A;  1S6Q A;  4CGI A;  2RF2 A;  1HQU A;  1C0T A;  3KLH A;  3LP1 A;  2F8S A;  1A5X A;  1BL3 A;  3AVF A;  4IG0 A;  4L8R B;  1D5A A;  3ZCM A;  4PQU A;  1KFS A;  3QEX A;  4NYF A;  1FK9 A;  2NUB A;  4OVL A;  1ASV A;  1RNH A;  3AO1 A;  3AA4 A;  3NGZ A;  4FCY A;  3LWL A;  4HCB A;  3LZI A;  1HYZ A;  3AVC A;  2QK9 A;  4E7J A;  2KZM A;  3DRR A;  1RBR A;  4N5S A;  5DMR A;  3OS1 A;  2E6M A;  1RT7 A;  3KLI A;  2OZS A;  2ZE2 A;  4QAG A;  4M3W A;  1VSH A;  3OYA A;  4PWD A;  1J54 A;  2A1S A;  3DOL A;  3HVT A;  3DLG A;  3OJS A;  5C25 A;  4KB0 A;  1IO2 A;  4AHC A;  1NJX A;  1YTA A;  2D0B A;  3O3G A;  3C6T A;  3LZJ A;  4M3T A;  1JXB A;  5J2N A;  4PY5 A;  4O55 A;  4FLW A;  1RCH A;  1DLO A;  3KKS A;  3ZSR A;  3ZSV A;  4CJE A;  3QET A;  1WNS A;  3HO1 A;  2OYQ A;  2IGI A;  2E4L A;  3KK3 A;  2G8K A;  4FK2 A;  3ZT2 A;  2O4I A;  4BE0 A;  1NKE A;  3OYN A;  4DTR A;  2I5J A;  4PUO A;  4M42 A;  2HND A;  1Y97 A;  5KGW A;  1XHX A;  3V1R A;  4EP5 A;  4M3Z A;  3OYD A;  3HXM A;  1S1T A;  1RT4 A;  3RR7 A;  1LAW A;  2XY6 A;  2GBZ A;  4Y1D A;  2KFN A;  3SZ2 A;  3VQ9 A;  4FZZ A;  2X74 A;  4ELT A;  1BIZ A;  2QXF A;  2W42 A;  1NK6 A;  2ETJ A;  2YKN A;  1ZBF A;  3L3U A;  4I9Q A;  2HHQ A;  4DQS A;  4KTW A;  4OPJ A;  4DFJ A;  3AA2 A;  1LWE A;  4CGJ A;  5HRR A;  3DM2 A;  4IG3 A;  3TAF A;  2HHT A;  1NJY A;  4FJM A;  1RDC A;  1EET A;  2DFH A;  4KB1 A;  3KLF A;  3HM9 A;  3JYT A;  2Z1I A;  2PZS A;  4Y1C A;  4KHU A;  1J5O A;  4CK3 A;  3F9K A;  4CJK A;  4FM1 A;  1T05 A;  1JLG A;  3K58 A;  4F2S A;  2YNG A;  4AHR A;  3OJU A;  3L2Q A;  3BDP A;  3RRG A;  3C95 A;  4DTU A;  3CG7 A;  3VQ7 A;  4Z4C A;  3QES A;  1XC9 A;  3VQ6 A;  3V6D A;  4MQ3 A;  2RPI A;  4CJF A;  1EXQ A;  4PA1 A;  5SZT A;  4YFU A;  3E01 A;  1KVC A;  2Z1J A;  3VQ4 A;  4CJP A;  4FM0 A;  4DSE A;  1LWF A;  4OLA A;  2OPS A;  4KTZ A;  1QSS A;  2IAJ A;  1JXE A;  2BE2 A;  4MFB A;  4CEC A;  4NYN A;  3O3F A;  1S1W A;  1WAJ A;  2D0C A;  1T7P A;  3EZ5 A;  1NOZ A;  5HP1 A;  1HNV A;  4BDZ A;  1RTD A;  1GOB A;  3BGR A;  2HNZ A;  1U49 A;  4DQI A;  4Z0U A;  4BE1 A;  4CES A;  1B9F A;  2Y1J A;  5CY4 A;  4DF4 A;  3TR8 A;  2P5O A;  4B9V A;  2KW4 A;  1HYS A;  3LAN A;  4CER A;  1SKS A;  4FZX C;  4J2D A;  2ZQB A;  5KRT A;  2QKB A;  2LSN A;  1ASU A;  1HJR A;  4ID5 A;  4ID1 A;  4CEF A;  4CJ3 A;  4CHY A;  4DTJ A;  4B9S A;  4W5O A;  1JLE A;  4NCG A;  2VG7 A;  3KKR A;  1TAU A;  2HHX A;  5J2Q A;  3OYB A;  5DK5 A;  3NF7 A;  3O4N A;  4DSI A;  3KD1 E;  4W5R A;  3ULD A;  3DLH A;  4FLV A;  3LWM A;  1NKC A;  4DF8 A;  3HPG A;  3AVK A;  4CEB A;  4FJX A;  4OJR A;  3QNN A;  1LAV A;  3TWH A;  3PUF A;  2FBT A;  4JS4 A;  3U3Y A;  4B3O A;  1VRT A;  1KRP A;  4CGH A;  3HP9 A;  4M41 A;  1XI1 A;  2JLE A;  4N41 A;  2Q3S A;  4DSL A;  1ITG A;  1JLB A;  4OGC A;  4E1M A;  3SUP A;  2EHG A;  1RDA A;  1JL1 A;  1EX4 A;  2XY5 A;  3ZT3 A;  2BAN A;  3G0Z A;  4CIG A;  3L2R A;  1RBU A;  4HTU A;  1B92 A;  4B9N A;  4KHQ A;  4DFM A;  1S9E A;  2B4J A;  3L3V A;  2G8U A;  3A2F A;  1CLQ A;  4CFC A;  2X78 A;  4DTX A;  2XY7 A;  4DFP A;  4FK4 A;  3AVI A;  1L3S A;  4KRF A;  4C8N A;  4O0I A;  2JGU A;  2VWJ A;  1W9H A;  2B6A A;  4J2B A;  4KI6 A;  3VA0 A;  2WON A;  2KTQ A;  1TL1 A;  3ZSW A;  3H08 A;  2XO7 A;  4FLX A;  3VQP A;  3S3O A;  4C8O A;  4CHN A;  3HPH A;  2VG6 A;  3AVA A;  1VSJ A;  4FJK A;  3AA3 A;  3P1G A;  3OYM A;  4JRQ A;  5I3U A;  1QSL A;  2PYL A;  3V9W A;  3C94 A;  2D5R A;  3ASM A;  3UIQ A;  3ZT1 A;  4J2E A;  1FKP A;  4GVM A;  1Q9Y A;  1WAF A;  3O4Q A;  4O44 A;  4H8K A;  4BWM A;  4WE1 A;  4IBN A;  4B8A B;  3L8B A;  1HYV A;  1TGO A;  2Z1H A;  3D0P A;  4FLY A;  3SUN A;  1Q9X A;  2X6N A;  4LD0 A;  4B8C A;  4DU1 A;  3HVR A;  5T7B A;  4FLZ A;  1JL2 A;  4DS5 A;  4I2Q A;  3DLE A;  1SV5 A;  5HRS A;  4KHY A;  1VK0 A;  1U48 A;  3OYI A;  4ELU A;  2DY4 A;  1TV6 A;  4CFA A;  1UWB A;  3AO4 A;  3AVL A;  2F8T A;  1VSF A;  3ITH A;  4IDK A;  4CK1 A;  3VQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...