4LF9K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf9K00
2VQFK 4NXMK 4X65K 4JI3K 1IBKK 1HNZK 5LMNK 1IBMK 5FLXO 5A2QO 1XNQK 4DR7K 4DV7K 2UXCK 5BR8K 1HR0K 4AQYK 4KHPK 4JI8K 4DV3K 2UXBK 3T1HK 4K0KK 4DV0K 2UXDK 4X64K 4DR3K 4LF4K 4JI7K 3JAMO 4B3TK 4JV5K 5IT9O 4LF5K 2UU9K 4YY3K 4LFBK 4LF6K 4JI6K 1HNXK 2HHHK 4DUYK 2UUBK 5IWAK 4DR2K 2UUAK 3J7AP 3J81O 3T1YK 4LF9K 4B3SK 3J80O 4X66K 4CVNE 1I94K 4X62K 1XNRK 4GKKK 2UUCK 4DV6K 4JI4K 4JI5K 4B3RK 1N34K 4DR4K 2E5LK 4JI1K 5AJ3K 4JI2K 1N36K 4DUZK 4JI0K 4LFCK 1N33K 4B3MK 1XMOK 1XMQK 2F4VK 4DR6K 4V19S 4DR1K 4NXNK 1IBLK 4LFAK 1N32K 4YHHK 4GKJK 4LF7K 4OX9K 4LF8K 4DV1K 1HNWK 4DR5K 5LMUK 4DV2K 2ZM6K 4DV5K 4DV4K 4CW7B 1J5EK 5LL6Z 3J7YP 2VQEK 3OTOK 1FJGK 4JYAK
chains in the Genus database with same CATH superfamily
1HKGA 5AQOA 3U4LA 3KWGA 1KAYA 4CJRA 4NLCA 3AVBA 4JKAA 3OYEA 2D0CA 3AO1A 4YORA 1CZ9A 4CJQA 5BRHA 1QZ5A 1Q7YO 1EX4A 1LOTB 3ZYYX 2OANA 3I0RA 4CGDA 3CJCA 3R6MA 2UXCK 4CK1A 4BRDA 3ZX0A 4ELTA 4YOVA 4EZ9A 2O8FB 3LZJA 1VQLN 1HPMA 1K73O 1Q8IA 5BREA 2QXFA 1TYQB 4DTPA 2QW9A 4CEZA 3MEDA 1TK8A 4JKGB 1K8KB 2NNWA 3MXMA 3JXUA 1OVQA 4CD3A 3H1VX 1CZBA 3C6UA 3OS0A 3PO5A 4PUOA 3ALYA 1IJJA 1XNRK 5J1EA 5EXWA 3OYFA 3L3VA 3HRGA 4GKKK 4CF0A 1XC3A 3O8MA 3KLHA 3MWTA 3C7NA 3SPYA 3LALA 2F8TA 2KLAA 1FK9A 2ZQBA 4JI2K 4B8AB 3SMSA 3TAPA 1N36K 3E01A 1GLEG 3L0QA 3TTDA 2KFZA 3QFUA 4CJUA 4E1MA 4AHCA 4RWTA 3LPTA 1RBUA 4XH1A 3KLFA 3SUPA 4HUGA 2E2NA 2DY4A 1NKEA 1LW2A 4BDPA 1LWEA 3U8XA 3PIOL 1L3UA 3K9JA 1ASUA 2BE2A 3EEQA 5C24A 3P31A 1NGEA 2VWJA 3VQ8A 2HMPA 3O6WA 4DTRA 3NH1A 3R8EA 2O8CA 1B9FA 1RDUA 1VSKA 3WXIA 1XHZA 3THYB 4QS8A 4B9TA 4RG8A 3TSQA 2DFFA 1UA0A 1KAZA 2P9IA 4E7KA 3P5JA 5FDLA 3ULEA 1ATSA 5BR8K 1HR0K 3WXKA 2HF3A 2GBZA 3QEWA 1RDAA 2FF3B 4HTLA 2BDPA 3VQ4A 3C65A 3KK2A 1ATRA 1NJWA 4HUEA 1BG3A 4DR3K 3CERA 1IH7A 2RN2A 4BRGA 4NCBA 2YNIA 1VQ9N 5AQWA 3VEVA 4O4GA 1D9DA 4DFKA 2JWKA 2RE2A 3C6AA 1HKCA 1XWLA 3HXMA 3SAGA 4BRHA 3WNFA 5LY3A 1JL2A 2ZJRL 1YAGA 4FOEA 3ZX2A 3WEEA 3ZETA 1WOQA 3BP8A 3SYZA 4M3XA 4K8XA 4CZJA 1N34K 4KH6A 4O5FA 3RSEA 1CXQA 4PQUA 1VSDA 2E5LK 4IDHA 3A5OC 4FWMA 2WTUA 2CH6A 4Z4CA 1BIUA 2E2OA 4OPHA 2OA8A 1XI1A 2O8DA 4B1WB 3VTIA 2QM1A 1HYSA 4FL9A 4CJ3A 5AQIA 1WBDA 1SQKA 4FJXA 2CH5A 2XY8A 3ZSOA 1OH6A 3CJ1A 3CCLN 1ATNA 4CECA 2NRVA 2D0AA 4LSLA 3SUQA 4LF7K 4OLAA 2HBJA 3LP1A 2YHXA 4CFBA 4ILJA 3V9UA 5CR4A 3LWMA 5ADXH 2ASMA 2HHXA 5LMUK 4CJSA 3ID6A 1YXQA 3OYAA 1RDDA 5J2MA 4OO1J 2VG6A 4CJPA 1WAJA 4H0OA 4YOWA 1U4BA 4MDBA 1DGKN 1JLCA 3VQCA 4BG8A 3VEXA 3VQBA 1F21A 4WCEL 2IGIA 1XC9A 5LMNK 2D0OA 5I42A 1WN7A 5AFUA 5KGWA 4JD2B 1YJWN 1JLBA 1HKBA 4CHPA 5FRMA 1X9MA 2JGUA 4DFPA 3RMBA 4B1UB 2VGMA 3EZWA 3NBPA 3S3NA 3KD1E 3HM8A 4L3QA 2YNHA 3QB0A 4W5RA 2HHVA 4U67L 2D5RA 4B9VA 5TKYA 4DU4A 5AQSA 1RBTA 2XHBA 2HHQA 3O9QA 1KRPA 1TUYA 4DCHA 2HHUA 4RW7A 4MO4A 1TKXA 4CEQA 3THXA 1W9HA 1KCFA 5AQNA 5KRSA 4U7BA 3ZLJA 4H8KA 5BPMA 1RDCA 1J9AA 3CMAN 3KTQA 1QHTA 4M3ZA 2OTLN 3T3FA 1G15A 5GADP 1ILYA 1L5UA 4M3TA 3DAWA 4CFCA 4IFYA 3KKSA 3BDPA 3H1QA 5E41A 4Q0BA 3B8AX 3OHRA 4OJRA 5FPMA 4PL7A 3P38A 3SQ0A 4IZ9A 4DR6K 2QEXN 3LAKA 3MN7A 2FSJA 2O4IA 2E8AA 2ITMA 4M3WA 4FJHA 3LPUA 4DV1K 1LAVA 4CBUA 4UY8O 5KPTA 2P51A 3V1RA 1FXXA 4DV5K 1RTHA 2VYPA 3MDQA 1D8YA 2JLEA 3R9PA 3WNGA 4E3SA 4H5RA 3C6HA 1O13A 4BRIA 3OYLA 4NYFA 4CHOA 1FJGK 1YITN 1VSEA 3F2KA 3RMCA 5JVGL 4NXMK 4QAGA 4CEDA 4Y0WA 2EHGA 3V4IA 4MLEA 3C7NB 4KBOA 3M5RA 3K5NA 1HNZK 1BI4A 3AVJA 1DKGD 1QVFM 4JKEA 2YHAA 4A2AA 3D2EA 5FLXO 3W3DA 2D4WA 4PKGA 2YHYA 3ZT1A 2ASOA 2FSNA 3VA3A 3CCUN 3TARA 1P8ZA 2P9PA 4CF2A 3HP6A 1I39A 3O5BA 4GV6A 2Q1NA 3FE1A 4JI8K 1JL1A 4H4MA 4FJLA 4FWOA 4CEFA 4K0KK 5AQZA 2QWMA 4KB1A 3AVGA 3SPZA 2VGNA 2UU9K 1LWFA 3SCXA 4JI6K 4C8LA 3VA0A 3IAYA 4BE2A 3CQXA 3VOVA 3QNOA 4YNQA 2HNZA 4PY5A 4PL8A 3DM2A 5H1SQ 5C12A 2YX6A 2HHTA 3KKRA 2O8CB 4WFNL 3TAEA 2OCEA 2UUCK 4DV6K 3U9ZA 4N5SA 2HBKA 2GWKA 3K5LA 3P83D 4B3OA 1C0MA 1G99A 5KQDA 4W5TA 2B4JA 3ULEB 1YF5L 1VK0A 3H3OB 5KGXA 4CJVA 3CQ8A 3MX5A 1YT3A 4BRKA 5AQRA 1RT4A 4FK2A 1NGAA 3N4QA 2PY5A 3DLGA 4DTOA 5F0XA 4CK2A 4B1XB 2IS3A 3HPGA 1SKRA 4BC5A 2LSNA 3HI0A 1QTMA 3QIPA 1NGDA 4N41A 4BWMA 1C0TA 4FLZA 4FLYA 1RGIA 2P9KB 3TI0A 3RWUA 4H0VB 2KFNA 1Y97A 2GEMA 4FPAA 3I55N 3J7YP 1TAUA 4H4OA 2RPIA 4CJTA 3AO4A 2I7PA 1T6DA 3OTOK 4DTJA 3AA4A 4IJAA 3O4QA 2VQFK 2KHOA 3ITHA 3WNEA 4MDAA 3QDKA 3NGYA 5HL7L 2O8DB 1HYVA 3VPZA 2A6AA 3ZCMA 3TR8A 1S5JA 2FSKA 3KLIA 4AQYK 2ZGYA 2G8WA 4W5QA 3M6GA 1T44A 3VGLA 4BREA 1D9FA 4JI7K 4HWIA 2W6KA 3M1FA 3OYDA 4OGEA 4BE1A 4N47A 2O4GA 3PIPL 5AQVA 1P90A 3CPWM 2P9NA 2Q2RA 4AM6A 3BF3A 2GELA 3AVAA 4CGIA 3CC7N 1IG8A 4FSVA 1VSMA 3HPHA 1JXEA 5SWMA 4ISGA 2O8EA 3GG4A 1VRTA 1KLMA 3EKUA 4QCLA 4WQ4C 2FBXA 4M7XA 2A3ZA 2OPRA 3QIOA 2JWLA 5M1PA 3U3GA 4ELVA 5DM7L 2VG7A 1RDBA 4AH9A 3PV8A 4IOAL 3VF2A 5M1QA 4FWPA 4TSXA 4IEIA 4DB3A 3VERA 4CF9A 2NRWA 4DTXA 1RT7A 1SS6A 3NAEA 4FCYA 3AV9A 2ITGA 2PYJA 4DSKA 4OX9K 3BF1A 4WQ4A 1JLGA 1HJRA 1RT1A 4LF8K 1K6YA 4BR5A 3HJFA 3FZLA 3NVMA 3KJVA 3PY8A 1Z05A 3TPQA 5CE3A 4FK0A 4WYBA 3PSFA 2QWLA 3DLKA 3CC2N 1U2VB 3V9WA 3AGRA 1R59O 4JRQA 4BRFA 1QS4A 2HBMA 1RT5A 4JNEA 4GV9A 4IG0A 3V9SA 2E4LA 1L3SA 1HYZA 1A5VA 4CZIA 5GIPA 3SJJA 5K14A 2VWBA 4CZLA 3CM6A 5KPZA 4DR7K 4Z4GA 4H0PA 3SZ2A 1HLUA 3FZHA 2XY7A 2Q97A 3ULDA 1Z26A 5JMVA 5CYMA 4KHQA 4FJ7A 5AQXA 1YI2N 2YKMA 4BRQA 4FOIA 3EKSA 1JLFA 3DRRA 4B3TK 4IEEA 1JKHA 1BA1A 2J4RA 3AAQA 3F9KA 1SAZA 4K42A 4CZFA 4E1JA 3THWB 4J2DA 3QLHA 1HUXA 1S22A 4YY3K 1JCGA 2QWNA 4JKBA 1BISA 4B9NA 3C6TA 4H5WA 4MO5A 3U3YA 3C95A 2CGLA 1BL3A 4IOXA 3UE5A 4ID5A 1U48A 4RW8A 3HPOA 1NG9A 3QO9A 4ICLA 4JKDA 3U9DA 4C23A 1K8AO 4FWNA 1BIZA 1GLDG 3M8PA 4J8FA 5AQPA 3T69A 1X3NA 2WBNA 3DOLA 1BI4B 1ESVA 4WQ5C 3PUFA 3QINA 3D2EB 3GDQA 3LDNA 4Z4EA 1RT3A 5AJ3K 1T7PA 1DEJA 2QWRA 4RW6A 4BGBA 3VQ6A 2P9PB 3AVMA 4KH4A 4B3MK 3UKRA 1BHLA 4N76A 1KFDA 4M45A 3IFRA 4WQ5A 4BVOA 4O8UA 3LDLA 1GLFO 4CJKA 2E6MA 4J2BA 1WUAA 3M8SA 2XY6A 4CJLA 2QA4N 1KSPA 3P1GA 1VSLA 1HNWK 3KIOA 2E2QA 2W42A 2QWQA 3LZIA 3O9SA 3G0ZA 4K43A 3VN5A 4OPJA 3CCEN 1HRHA 3W0LA 3HBTA 3CCQN 1VAZA 2Y1JA 4NCGA 4ZTJA 2DFHA 5EOYA 4DTSA 4FW2A 3C0BA 4KHNA 1H1VA 2G8KA 4KHWA 3OS2A 3AARA 3QBWA 2P5GA 1NWKA 3N4PA 3D7EO 4Y1CA 3LDPA 2B5JA 1BQNA 1RFQA 1Y64A 4PKHA 5HOOA 1HNVA 5DMRA 3KK3A 1ZYQA 3RVCA 1S1TA 1XUPO 1TKDA 4MQ3A 3O1WA 2CGKA 5AQMA 3H3NO 3K5MA 2IVOA 4A5AA 4NLBA 3ZX3A 2OPSA 4IWVA 1SKWA 3OYIA 4H0YB 4K41A 4CIGA 5IT9O 3TTCA 4DFJA 5E84A 3UKUA 2OPQA 1VQ6N 4C8OA 4LFBK 2AJQA 4Z4IA 3O08A 4FWRA 3SAFA 1J54A 3ZSZA 2PFUA 2UUAK 4C8NA 4BQLA 2PYLA 3TU5A 1S6QA 3L2RA 4DQIA 3E66A 1L3VA 3PSIA 4FLVA 4FO0A 4B1ZA 2XO7A 4JI4K 4JI5K 3AVHA 5TKWA 1KC8O 4FYDA 4BDZA 3BGRA 4JLHA 4AM7A 2UYTA 4FJ8A 2QWOA 2P9KA 4CFDA 1N8RO 1XMOK 3IUCA 2FBYA 4E1NA 5AFUH 4F2RA 2KZMA 3VMFB 3MXIA 1FKOA 1ASWA 4M3UA 1YUWA 3FFKB 4FVMA 3SQ1A 1U49A 3OJSA 3DLLL 3RTVA 3V1QA 3A5LC 3CCSN 3H08A 1C0UA 1QQCA 2P9NB 3LANA 5KQ8A 4PWDA 3G25A 3QBXA 3WUHA 3EE8A 3T19A 1KLNA 5CZ2A 3SQ2A 1WNSA 4FLUA 4JYAK 4AHRA 4DS4A 3VQ9A 2O8EB 4KKOA 4DQQA 1E4FT 4JKCA 3DWLA 3OW2M 1IBKK 2YJFA 4GNIA 4DQ8A 1MDUB 3HYFA 4A59A 3AVNA 4CGGA 3PX0A 2DPNA 1NK6A 1DTTA 5JVHL 4H0TB 4DFMA 3AO2A 4IKFA 5FRNA 4W5NA 2ZD1A 1TKZA 4JKHA 3SI6A 3O9TA 4EFHA 1RDWX 3HOSA 3ZSVA 3AVKA 2ASPA 1WSEA 4PA1A 4DV0K 3V6DA 2UXDK 4E0DA 2IC3A 3JAMO 4OKJA 2I5JA 1LWCA 3O4NA 4ELUA 3ASMA 4HCCA 3NCIA 1Z25A 3WXJA 1IKWA 4OPKA 4IJNA 4C1NI 1IV0A 3S9HA 4DF8A 3F9MA 1YJ9N 3O3HA 1M90O 3MCPA 3PX4A 3HSCA 4KTZA 3J81O 4O44A 1TVRA 1ZBFA 3CM5A 2G8UA 1T8EA 3JSMA 3K0SA 4H03B 3HTVA 1M1KO 3V9XA 4RW4A 2GWJA 2WFBA 3I8BA 1S9GA 5MLCQ 3TAGA 1NJZA 5GAGP 5E26A 3FZKA 1VSHA 4AHVA 2F9WA 1SV5A 2PAVA 1U2VA 4DR1K 2Z1HA 4F8RA 4KHSA 4FM0A 2NRXA 1NKBA 4FM2A 4BRMA 1U04A 5KRTA 1BQMA 1WBBA 3SJHA 1U6ZA 3NF6A 2IIRA 4YOYA 5HP1A 3MK6A 1X9JA 2CGJA 5LJVA 4H0XB 5LL6Z 4FM1A 1O1WA 5ADXA 3FFIA 1KQSM 3SUNA 2KQ2A 4BRPA 3F5TA 1OH7A 2PZSA 4BC2A 3GBTA 2HOEA 5ELZA 3RRGA 4XH5A 3VQEA 1KVBA 2FBVA 3OYKA 3ZSQA 1TAQA 3NMUA 4DHYA 1WAFA 1WB9A 5C25A 4JK8A 3ZT2A 1TK0A 4HCBA 3VF4A 3THWA 4FWLA 3UKRB 4WFBL 3OBWA 2V52B 1S1UA 4OVLA 4CEOA 3WT0A 3LDOA 4YOXA 3K58A 1Q82O 1Q9XA 4C1NK 2P9LA 2ZF5O 3DMJA 4LF4K 2WUSA 3CJAA 5HRRA 3CMEN 4F3OA 2KZZA 3CETA 3LP2A 1NGJA 4FWSA 1SL0A 4DSEA 3A5NC 1IKXA 2P5OA 4BC4A 3QESA 4GVEA 3ZSRA 3L6QA 1NGHA 3UB5A 1YHQN 1TUUA 3B6OA 4KI6A 2XRIA 1WSGA 4DSIA 4K8ZA 2E1ZA 5T7BA 1YVUA 1QHAA 2W41A 3S3OA 4B9QA 3SV3A 3RR8A 3LP0A 3HZ6A 3CD6N 4B3RK 4YDUC 1VHXA 2QKBA 1LCUA 1IO2A 4E7HA 4H5VA 2RKIA 1TK5A 3L8BA 4JS5A 1N33K 1J53A 1V4SA 3TAFA 1K9MO 1RBVA 4BR4A 5J2NA 3EYZA 1HQEA 2DTUA 3DLRA 3DXMA 1NKCA 1KXPA 1NK5A 2KTQA 4NXNK 4E7LA 3H6EA 4FPBA 4LY7A 1VQ5N 2P9SA 2HF4A 4YDUA 4KREA 3SQ4A 3AVCA 2HSTA 4PHTX 3UKUB 1UOCA 1B9DA 1BOTO 5F2RA 1SZ2A 3OYCA 3CHWA 4LH5A 4DQRA 3MEEA 2V51B 3A2FA 2YV0X 1ZBIA 1SL1A 1ZBUA 3VGKA 1RTIA 3GE1A 3SUOA 3LM9A 2BUPA 3O9RA 3PX6A 3RMAA 1Q9YA 1EQYA 1BWFO 1Q18A 4JKFA 2QK9A 1OKJA 2A1SA 4N56A 1RTJA 4DKWA 3CPEA 4FWQA 4CJFA 2FBTA 4QOZB 3U6FA 3S3MA 4CE9A 3VGMA 5GAHP 1GLLO 1ITGA 5JS2A 4X64K 4B1YB 3QEXA 1B92A 1A5XA 3M3ZA 3IG1A 2OPPA 4I9QA 4KTWA 5C0YA 4E7JA 3KWIA 2BH1A 4HHTA 1HPZA 4IOCL 1MWMA 4Y1DA 3TWHA 5KI6A 4XIUA 2Z1IA 3OYHA 4O0IA 1NGBA 3VQQA 4CK3A 5M1NA 1W7AA 5GAEP 1QE1A 3CCJN 3HL8A 5AQLA 3V1OA 1YVNA 3VQ7A 2FLOA 5KTQA 2P9UA 3MEGA 3R1XA 2X78A 4IO8A 2V7YA 3SV4A 1MU2A 3LWLA 2HB5A 3MX2A 3OVNA 3VQDA 1SL2A 3JS6A 3UIQA 1DLOA 2F4VK 1CLQA 4CESA 1QVGM 4KAZA 4FK4A 3BY5A 1NK0A 4DS5A 3FZFA 4RCHA 4A57A 1JLAA 5BPLA 1J5OA 2E88A 3A8YA 1NK4A 5AQTA 4JAXA 1NOYA 4OKKA 5EU7A 1BCMA 4M3RA 4YOUA 4CERA 4CIFA 3LAMA 4JRPA 4R79A 4CHZA 5AQGA 5BR9A 3QEPA 2YJEA 3VTHA 2YNGA 4E89A 3O3FA 3A5MC 4O5BA 2W40A 3HP9A 1IBMK 3AO5A 2NZTA 2Q0UA 1NGIA 5HROA 5AQQA 4BE0A 4YFUA 4O0JA 4A5BA 2FXUA 3PLAA 1KAXA 4DV7K 3OY9A 3ATVA 1KVAA 4AHUA 3QMLA 4CJ5A 2AA4A 2E1YA 4KI4A 1S6PA 2F8SA 1SUQA 3NF7A 3ATUA 4CF8A 4DMNA 4LF5K 3E9LA 4LD0A 1Q86O 2NRRA 5CYQA 2YHBA 1N5YA 4LF9K 3CFPA 1E3MA 3HVTA 4DQPA 2WOMA 4X62K 5I9EB 1RILA 1TL3A 1X9SA 5JLFA 2A1RA 1I3AA 1QQNA 3NE6A 3QFPA 4ILHA 3EL2A 4A61A 3QERA 3MN5A 4DU3A 3OYMA 1QZ6A 3E1YA 4BG9A 3C94A 4CZEA 4JHDA 4QS7A 2P9LB 4JEPA 5BPNA 4AHSA 4ILGB 4LFAK 5C2DA 4YHHK 4JN4A 2Z1JA 1C1CA 3WXMB 2Q31A 3L3UA 1HX1A 3SAHA 4M41A 3P39A 2ZM6K 1X1PA 4XH4A 4B8CA 4ISFA 2NLXA 1NMDA 1QSSA 5JLHA 2HVIA 3TTFA 3D45A 1NM1A 3FLCO 4H5NA 4H5TA 4GKJK 4FWKA 3TSUA 1NK7A 1YJNN 3KHYA 1CXUA 3K57A 3CFOA 3MWPA 2EWSA 5FPEA 4WF9L 1EKEA 1C1AA 1XQSC 4E7IA 4X65K 3RR7A 4FJ9A 4NB4A 4Z0UA 5AQUA 1NBWA 3LDQA 4CD1A 1UWBA 4KRFA 4EAHD 3VEWA 4BRAA 3L2WA 1XNQK 4AF1A 5GINA 4DTMA 4FJMA 3DXMB 3VQ5A 4B9LA 3KLGA 4CFAA 1S3XA 2A40A 2P9SB 3MXJA 2DFEA 2YNFA 3EO3A 4Z4FA 3GOIA 2X6NA 1ZBLA 4JV5K 5AQKA 1KTQA 4DG1A 3DXKB 2AP1A 4NO7A 3G4SN 4B08A 4DSJA 4LF6K 1HNXK 4DUYK 5AQHA 5CHIA 3LDSA 3DI6A 3DRPA 2GX9A 5J2QA 4GY2B 3K9KA 3VESA 3MN6A 4ISEA 3J80O 1I94K 2Z1GA 2ATQA 1NMNA 3CF5L 1JJ2M 3G71N 2Q0RA 3I33A 2ZJPL 1ZXOA 2NUBA 3NH2A 3QEIA 1SKSA 1QSLA 3IDHA 3OYNA 3S41A 5AZIA 2P1JA 5F1XA 4JI1K 1TKTA 5HRSA 2E6LA 3V9ZA 2D0BA 3O1BA 3ENBA 3HM9A 4BRCA 2HNDA 5HRPA 2QKKA 4BROA 5J2PA 3VQPA 4LFCK 1VQNN 4FXDA 3NF9A 3M8RA 5AQYA 1NU0A 1XMQK 5M1KA 4FLTA 3WQUA 3OJUA 1NNEA 2D0PA 1S1VA 3NHGA 1OH5A 1J6ZA 3DLBA 1UAXA 3J8AA 3KD5E 5BN8A 1QSYA 4HVJA 3TANA 2G8VA 3ZT0A 3SLCA 4CI6A 3VQAA 4DV4K 3D2FA 4E19A 3O3GA 3CIPA 4Z94A 3I56N 1TGOA 5BRDA 1EP4A 2V7ZA 3AVIA 4CF1A 4CGJA 4CZMA 2O8BA 3KK7A 2KKZA 4I6MB 5JICA 3L2VA 5CY4A 1NGCA 5DM6L 4DTUA 4JI3K 3T1AA 3CC4N 2P9UB 3CJBA 1Q81O 5B8HA 4KO0A 3R3LA 1VQ7N 1CZAN 1LW0A 2QTDA 2I7NA 4C8MA 3J7ZO 2XY5A 3VEZA 3O9UA 4BACA 4LH4A 4FJ5A 2BGGA 2IAJA 3FR0A 3QNNA 3AGKA 1OH8A 3CCMN 2QXLA 2W6LA 1S1WA 4UQGA 4EP5A 5M1OA 3QEVA 3OA9A 2HVHA 3A0IX 2R7YA 5BRFA 4O8KA 3OYBA 1R0AA 2B6AA 3F73A 2NRHA 2G8IA 2RF2A 4BR0A 2F9TA 3LL3A 1T03A 5M1FA 1X3MA 3IMXA 4IO9L 1C6VA 3CXCM 1EWQA 1GOCA 2E2PA 1RTDA 3CG7A 3VETA 2FF6A 1T3VA 3ZEUA 4B9UA 2F96A 3T1YK 1RT2A 1GOAA 2HW3A 2OTJN 1LAWA 2GUPA 1NJYA 3ZT3A 4C8KA 1GLBG 3K59A 1OVYA 4I2PA 2WONA 4CEBA 4CZGA 2Q36A 4JK7A 1X9WA 3NH0A 3AVLA 1NGGA 1C1BA 3B6PA 4JI0K 4F3TA 2FC0A 3MMVA 1REVA 4YOTA 5CZ1A 4MLHA 1KD1O 1EO1A 1N32K 4RTFD 1GLAG 3Q7BA 4BWJA 1W0HA 4KHYA 2KW4A 2GTDA 3CCVN 1JLQA 2IOCA 3TABA 5DK5A 1RT6A 4GV3A 4DV2K 3MAQA 2YCHA 5C42A 4CGFA 2ZWHA 4R5PA 5I3UA 4FJKA 2BANA 1HJOA 2QI2A 4CJ4A 3HO1A 1RCHA 1NJXA 3VEOA 1NGFA 1T05A 4DWIA 1VSFA 4BRNA 3AA3A 4O55A 3L4QA 1YTAA 4DLEA 4F2SA 1JXBA 2IVPA 3LM2A 3THVA 2G8FA 4JHDB 3RRHA 4DTNA 2VWKA 4EZ6A 5AZJB 1HQUA 3BUZB 1VQ4N 3TAQA 1S9EA 4M42A 4DV3K 3H46O 4DU1A 4BY9C 4IFVA 3KLEA 2ZE2A 1IKVA 4F9OA 2IDOA 1ZBHA 2EX3A 1JCFA 3HVRA 1TV6A 4IG3A 4BDYA 1GLCG 4HUFA 3DJCA 5FPNA 4FVUA 2H3GX 4DQSA 3HK2A 4J2EA 2ZGZA 3WNHA 3NGIA 4B3SK 4CVNE 4F4KA 1C0GA 2RHKA 4CZKA 1S72N 1E4GT 1ZBSA 4DR4K 1YIJN 1VQON 2GUIA 3ENHA 1HNIA 4WFAL 4CGHA 3L4IA 2YKNA 4FJJA 3VENA 4AHTA 2Q3SA 4RW9A 4CJWA 5C10A 3NGZA 4FJGA 3BZKA 3MCAB 2A42A 5GIOA 4NYNA 4FZZA 2A5XA 4OPAA 2O8FA 4KTQA 3CQYA 4XEIA 3AVFA 1TYQA 3EY1A 4J2AA 3NF8A 4G1QA 4CCHA 1KVCA 2Y1IA 2YI1A 4JKGA 1K8KA 2E20A 4OKEA 3VF6A 3KK1A 3HT3A 4BGAA 4DF4A 1IKYA 1TL1A 2HBLA 4FLWA 4CJ7A 3JYTA 3V81A 4ZHRA 3Q7CA 3EN9A 1RNHA 5JS1A 3ISNC 3AA2A 3D0PA 2NRTA 5AZIB 1LV5A 5C15A 3DXKA 3G6EN 3EZ5A 5A2QO 2GV9A 3L2UA 1FKPA 1D4XA 4AILC 4CIEA 3PO4A 3NVKA 3E9OA 1QQOA 3VEYA 4B1VA 3IRXA 1DT9A 4KHPK 4IBNA 4K25A 5EVZA 3SBTA 2UXBK 3OBYA 3CCRN 4FLXA 1MWKA 4LC9B 1NLVA 3KZBA 4QS9A 3HSTB 2P9IB 4I7FA 1BUPA 2D1KA 5C2FA 3D2FB 1UA1A 1NJIO 1KFSA 3M8QA 1NOZA 5IWAK 4BR9A 1S1XA 3AAPA 4BR2A 1NK8A 4M3YA 1T6CA 1Z6RA 4ZTFA 1BO5O 2O8BB 2OYQA 1BGXT 3CYMA 3O80A 1BA0A 4JK9A 5EY4A 4EIAA 3E9PA 4M7YA 4A2BA 4M63C 4OLBA 3CI5A 4BR7A 1HMVA 1VQPN 4FJIA 2ZJQL 3ZSXA 3H45C 5D3GA 3P4IA 1ZC6A 4GMJB 3DOKA 2HMIA 5KPRA 4L8RB 3THYA 3ID8A 4IFEA 2ETJA 3MECA 4EP4A 3IS9A 3KVGA 1EXQA 4I9LA 4Z4HA 3D6RA 2OZSA 4FW1A 4DSLA 3MN9A 1JCEA 2PBDA 4BRLA 4IXCA 1YTUA 3ZSYA 3WEEB 1L3TA 1BU6O 3ZETB 3NFAA 4CHQA 3QETA 5EX5A 1IBLK 4CBXA 3DYAA 1W2BM 2X6SA 4I6MA 2NRZA 3RSEB 2F7TA 2VCPA 1NK9A 4FZXC 3TSPA 2BTFA 4CW7B 3DRSA 5FROA 1J5EK 3ZEUB 3AA5X 1XHXA 4GVMA 3O4WA 1GLJO 5LJWA 2QWPA 4Q5VA 4KB0A 2VQEK 1WLJA 3OS1A 4FZYA 3AO3A 1C0FA 1WSJA 2HNYA 3ZSWA 1EWRA 1VSJA 4CJEA 4BVPA 1FW6A 4CEAA 5HLFA 4LSNA 5AQFA 1W97L 4CZHA 3SK3A 5SZTA 3GL1A 4B9SA 3K5OA 2G8HA 2HHSA 3ENOA 4GW6A 1VQMN 3FZMA 3CJ9A 1QQMA 3I0SA 2YHWA 4B9MA 1WSFA 1DTQA 1WSHA 4BQZA 3T1HK 1ASVA 4JS4A 4EHTA 1VQKN 4NCAA 1EETA 3CFRA 4G9ZA 4ID1A 4OGCA 3BEXA 1A5WA 3LP3A 4MFBA 3OYJA 4CHYA 4KFBA 4WE1A 1U45A 2HHHK 2UUBK 1BDGA 4DR2K 3J7AP 3QICA 3L2QA 3T7ZA 2IVNA 3FGUA 4X66K 3AY9A 5HRNA 3DLHA 3I8DA 2VG5A 3IKMA 4CBWA 4W5OA 3K2PA 4CHNA 3SMPA 2A41A 4DSFA 1N6QA 5HBMA 1U47A 1JLEA 3G10A 3NDKA 1RBSA 4JD2A 5AQJA 4KHUA 1WSIA 4KV8A 4DUZK 3HOTA 3THXB 4HTUA 1BCOA 4EHUA 3CJ7A 1IG9A 2HHWA 1GOBA 3WQTA 2WC9A 4V19S 4A62A 1MA9B 4PKIA 3DLEA 3EE9A 4FJNA 4KPYA 4DLGA 5AR0A 4I2QA 4KH5A 4DR5K 3SNNA 3SBGA 5BN9A 3TAMA 3ZT4A 3BZCA 2X74A 4BC3A 2OZMA 4IDKA 4CEEA 1RBRA 5FPDA 3OYGA 1VRUA 3WXLA 1D5AA 1VSIA 3RMDA 1VQ8N 1V4TA 5AZJA
chains in the Genus database with same CATH topology
2VQFK 4NXMK 4X65K 4JI3K 1IBKK 1HNZK 5LMNK 1IBMK 5FLXO 5A2QO 1XNQK 4DR7K 4DV7K 2UXCK 5BR8K 1HR0K 4AQYK 4KHPK 4JI8K 4DV3K 2UXBK 3T1HK 4K0KK 4DV0K 2UXDK 4X64K 4DR3K 4LF4K 4JI7K 3JAMO 4B3TK 4JV5K 5IT9O 4LF5K 2UU9K 4YY3K 4LFBK 4LF6K 4JI6K 1HNXK 2HHHK 4DUYK 2UUBK 5IWAK 4DR2K 2UUAK 3J7AP 3J81O 3T1YK 4LF9K 4B3SK 3J80O 4X66K 4CVNE 1I94K 4X62K 1XNRK 4GKKK 2UUCK 4DV6K 4JI4K 4JI5K 4B3RK 1N34K 4DR4K 2E5LK 4JI1K 5AJ3K 4JI2K 1N36K 4DUZK 4JI0K 4LFCK 1N33K 4B3MK 1XMOK 1XMQK 2F4VK 4DR6K 4V19S 4DR1K 4NXNK 1IBLK 4LFAK 1N32K 4YHHK 4GKJK 4LF7K 4OX9K 4LF8K 4DV1K 1HNWK 4DR5K 5LMUK 4DV2K 2ZM6K 4DV5K 4DV4K 4CW7B 1J5EK 5LL6Z 3J7YP 2VQEK 3OTOK 1FJGK 4JYAK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF K;  4NXM K;  4X65 K;  4JI3 K;  1IBK K;  1HNZ K;  5LMN K;  1IBM K;  5FLX O;  5A2Q O;  1XNQ K;  4DR7 K;  4DV7 K;  2UXC K;  5BR8 K;  1HR0 K;  4AQY K;  4KHP K;  4JI8 K;  4DV3 K;  2UXB K;  3T1H K;  4K0K K;  4DV0 K;  2UXD K;  4X64 K;  4DR3 K;  4LF4 K;  4JI7 K;  3JAM O;  4B3T K;  4JV5 K;  5IT9 O;  4LF5 K;  2UU9 K;  4YY3 K;  4LFB K;  4LF6 K;  4JI6 K;  1HNX K;  2HHH K;  4DUY K;  2UUB K;  5IWA K;  4DR2 K;  2UUA K;  3J7A P;  3J81 O;  3T1Y K;  4LF9 K;  4B3S K;  3J80 O;  4X66 K;  4CVN E;  1I94 K;  4X62 K;  1XNR K;  4GKK K;  2UUC K;  4DV6 K;  4JI4 K;  4JI5 K;  4B3R K;  1N34 K;  4DR4 K;  2E5L K;  4JI1 K;  5AJ3 K;  4JI2 K;  1N36 K;  4DUZ K;  4JI0 K;  4LFC K;  1N33 K;  4B3M K;  1XMO K;  1XMQ K;  2F4V K;  4DR6 K;  4V19 S;  4DR1 K;  4NXN K;  1IBL K;  4LFA K;  1N32 K;  4YHH K;  4GKJ K;  4LF7 K;  4OX9 K;  4LF8 K;  4DV1 K;  1HNW K;  4DR5 K;  5LMU K;  4DV2 K;  2ZM6 K;  4DV5 K;  4DV4 K;  4CW7 B;  1J5E K;  5LL6 Z;  3J7Y P;  2VQE K;  3OTO K;  1FJG K;  4JYA K; 
#chains in the Genus database with same CATH topology
 1HKG A;  5AQO A;  3U4L A;  3KWG A;  1KAY A;  4CJR A;  4NLC A;  3AVB A;  4JKA A;  3OYE A;  2D0C A;  3AO1 A;  4YOR A;  1CZ9 A;  4CJQ A;  5BRH A;  1QZ5 A;  1Q7Y O;  1EX4 A;  1LOT B;  3ZYY X;  2OAN A;  3I0R A;  4CGD A;  3CJC A;  3R6M A;  2UXC K;  4CK1 A;  4BRD A;  3ZX0 A;  4ELT A;  4YOV A;  4EZ9 A;  2O8F B;  3LZJ A;  1VQL N;  1HPM A;  1K73 O;  1Q8I A;  5BRE A;  2QXF A;  1TYQ B;  4DTP A;  2QW9 A;  4CEZ A;  3MED A;  1TK8 A;  4JKG B;  1K8K B;  2NNW A;  3MXM A;  3JXU A;  1OVQ A;  4CD3 A;  3H1V X;  1CZB A;  3C6U A;  3OS0 A;  3PO5 A;  4PUO A;  3ALY A;  1IJJ A;  1XNR K;  5J1E A;  5EXW A;  3OYF A;  3L3V A;  3HRG A;  4GKK K;  4CF0 A;  1XC3 A;  3O8M A;  3KLH A;  3MWT A;  3C7N A;  3SPY A;  3LAL A;  2F8T A;  2KLA A;  1FK9 A;  2ZQB A;  4JI2 K;  4B8A B;  3SMS A;  3TAP A;  1N36 K;  3E01 A;  1GLE G;  3L0Q A;  3TTD A;  2KFZ A;  3QFU A;  4CJU A;  4E1M A;  4AHC A;  4RWT A;  3LPT A;  1RBU A;  4XH1 A;  3KLF A;  3SUP A;  4HUG A;  2E2N A;  2DY4 A;  1NKE A;  1LW2 A;  4BDP A;  1LWE A;  3U8X A;  3PIO L;  1L3U A;  3K9J A;  1ASU A;  2BE2 A;  3EEQ A;  5C24 A;  3P31 A;  1NGE A;  2VWJ A;  3VQ8 A;  2HMP A;  3O6W A;  4DTR A;  3NH1 A;  3R8E A;  2O8C A;  1B9F A;  1RDU A;  1VSK A;  3WXI A;  1XHZ A;  3THY B;  4QS8 A;  4B9T A;  4RG8 A;  3TSQ A;  2DFF A;  1UA0 A;  1KAZ A;  2P9I A;  4E7K A;  3P5J A;  5FDL A;  3ULE A;  1ATS A;  5BR8 K;  1HR0 K;  3WXK A;  2HF3 A;  2GBZ A;  3QEW A;  1RDA A;  2FF3 B;  4HTL A;  2BDP A;  3VQ4 A;  3C65 A;  3KK2 A;  1ATR A;  1NJW A;  4HUE A;  1BG3 A;  4DR3 K;  3CER A;  1IH7 A;  2RN2 A;  4BRG A;  4NCB A;  2YNI A;  1VQ9 N;  5AQW A;  3VEV A;  4O4G A;  1D9D A;  4DFK A;  2JWK A;  2RE2 A;  3C6A A;  1HKC A;  1XWL A;  3HXM A;  3SAG A;  4BRH A;  3WNF A;  5LY3 A;  1JL2 A;  2ZJR L;  1YAG A;  4FOE A;  3ZX2 A;  3WEE A;  3ZET A;  1WOQ A;  3BP8 A;  3SYZ A;  4M3X A;  4K8X A;  4CZJ A;  1N34 K;  4KH6 A;  4O5F A;  3RSE A;  1CXQ A;  4PQU A;  1VSD A;  2E5L K;  4IDH A;  3A5O C;  4FWM A;  2WTU A;  2CH6 A;  4Z4C A;  1BIU A;  2E2O A;  4OPH A;  2OA8 A;  1XI1 A;  2O8D A;  4B1W B;  3VTI A;  2QM1 A;  1HYS A;  4FL9 A;  4CJ3 A;  5AQI A;  1WBD A;  1SQK A;  4FJX A;  2CH5 A;  2XY8 A;  3ZSO A;  1OH6 A;  3CJ1 A;  3CCL N;  1ATN A;  4CEC A;  2NRV A;  2D0A A;  4LSL A;  3SUQ A;  4LF7 K;  4OLA A;  2HBJ A;  3LP1 A;  2YHX A;  4CFB A;  4ILJ A;  3V9U A;  5CR4 A;  3LWM A;  5ADX H;  2ASM A;  2HHX A;  5LMU K;  4CJS A;  3ID6 A;  1YXQ A;  3OYA A;  1RDD A;  5J2M A;  4OO1 J;  2VG6 A;  4CJP A;  1WAJ A;  4H0O A;  4YOW A;  1U4B A;  4MDB A;  1DGK N;  1JLC A;  3VQC A;  4BG8 A;  3VEX A;  3VQB A;  1F21 A;  4WCE L;  2IGI A;  1XC9 A;  5LMN K;  2D0O A;  5I42 A;  1WN7 A;  5AFU A;  5KGW A;  4JD2 B;  1YJW N;  1JLB A;  1HKB A;  4CHP A;  5FRM A;  1X9M A;  2JGU A;  4DFP A;  3RMB A;  4B1U B;  2VGM A;  3EZW A;  3NBP A;  3S3N A;  3KD1 E;  3HM8 A;  4L3Q A;  2YNH A;  3QB0 A;  4W5R A;  2HHV A;  4U67 L;  2D5R A;  4B9V A;  5TKY A;  4DU4 A;  5AQS A;  1RBT A;  2XHB A;  2HHQ A;  3O9Q A;  1KRP A;  1TUY A;  4DCH A;  2HHU A;  4RW7 A;  4MO4 A;  1TKX A;  4CEQ A;  3THX A;  1W9H A;  1KCF A;  5AQN A;  5KRS A;  4U7B A;  3ZLJ A;  4H8K A;  5BPM A;  1RDC A;  1J9A A;  3CMA N;  3KTQ A;  1QHT A;  4M3Z A;  2OTL N;  3T3F A;  1G15 A;  5GAD P;  1ILY A;  1L5U A;  4M3T A;  3DAW A;  4CFC A;  4IFY A;  3KKS A;  3BDP A;  3H1Q A;  5E41 A;  4Q0B A;  3B8A X;  3OHR A;  4OJR A;  5FPM A;  4PL7 A;  3P38 A;  3SQ0 A;  4IZ9 A;  4DR6 K;  2QEX N;  3LAK A;  3MN7 A;  2FSJ A;  2O4I A;  2E8A A;  2ITM A;  4M3W A;  4FJH A;  3LPU A;  4DV1 K;  1LAV A;  4CBU A;  4UY8 O;  5KPT A;  2P51 A;  3V1R A;  1FXX A;  4DV5 K;  1RTH A;  2VYP A;  3MDQ A;  1D8Y A;  2JLE A;  3R9P A;  3WNG A;  4E3S A;  4H5R A;  3C6H A;  1O13 A;  4BRI A;  3OYL A;  4NYF A;  4CHO A;  1FJG K;  1YIT N;  1VSE A;  3F2K A;  3RMC A;  5JVG L;  4NXM K;  4QAG A;  4CED A;  4Y0W A;  2EHG A;  3V4I A;  4MLE A;  3C7N B;  4KBO A;  3M5R A;  3K5N A;  1HNZ K;  1BI4 A;  3AVJ A;  1DKG D;  1QVF M;  4JKE A;  2YHA A;  4A2A A;  3D2E A;  5FLX O;  3W3D A;  2D4W A;  4PKG A;  2YHY A;  3ZT1 A;  2ASO A;  2FSN A;  3VA3 A;  3CCU N;  3TAR A;  1P8Z A;  2P9P A;  4CF2 A;  3HP6 A;  1I39 A;  3O5B A;  4GV6 A;  2Q1N A;  3FE1 A;  4JI8 K;  1JL1 A;  4H4M A;  4FJL A;  4FWO A;  4CEF A;  4K0K K;  5AQZ A;  2QWM A;  4KB1 A;  3AVG A;  3SPZ A;  2VGN A;  2UU9 K;  1LWF A;  3SCX A;  4JI6 K;  4C8L A;  3VA0 A;  3IAY A;  4BE2 A;  3CQX A;  3VOV A;  3QNO A;  4YNQ A;  2HNZ A;  4PY5 A;  4PL8 A;  3DM2 A;  5H1S Q;  5C12 A;  2YX6 A;  2HHT A;  3KKR A;  2O8C B;  4WFN L;  3TAE A;  2OCE A;  2UUC K;  4DV6 K;  3U9Z A;  4N5S A;  2HBK A;  2GWK A;  3K5L A;  3P83 D;  4B3O A;  1C0M A;  1G99 A;  5KQD A;  4W5T A;  2B4J A;  3ULE B;  1YF5 L;  1VK0 A;  3H3O B;  5KGX A;  4CJV A;  3CQ8 A;  3MX5 A;  1YT3 A;  4BRK A;  5AQR A;  1RT4 A;  4FK2 A;  1NGA A;  3N4Q A;  2PY5 A;  3DLG A;  4DTO A;  5F0X A;  4CK2 A;  4B1X B;  2IS3 A;  3HPG A;  1SKR A;  4BC5 A;  2LSN A;  3HI0 A;  1QTM A;  3QIP A;  1NGD A;  4N41 A;  4BWM A;  1C0T A;  4FLZ A;  4FLY A;  1RGI A;  2P9K B;  3TI0 A;  3RWU A;  4H0V B;  2KFN A;  1Y97 A;  2GEM A;  4FPA A;  3I55 N;  3J7Y P;  1TAU A;  4H4O A;  2RPI A;  4CJT A;  3AO4 A;  2I7P A;  1T6D A;  3OTO K;  4DTJ A;  3AA4 A;  4IJA A;  3O4Q A;  2VQF K;  2KHO A;  3ITH A;  3WNE A;  4MDA A;  3QDK A;  3NGY A;  5HL7 L;  2O8D B;  1HYV A;  3VPZ A;  2A6A A;  3ZCM A;  3TR8 A;  1S5J A;  2FSK A;  3KLI A;  4AQY K;  2ZGY A;  2G8W A;  4W5Q A;  3M6G A;  1T44 A;  3VGL A;  4BRE A;  1D9F A;  4JI7 K;  4HWI A;  2W6K A;  3M1F A;  3OYD A;  4OGE A;  4BE1 A;  4N47 A;  2O4G A;  3PIP L;  5AQV A;  1P90 A;  3CPW M;  2P9N A;  2Q2R A;  4AM6 A;  3BF3 A;  2GEL A;  3AVA A;  4CGI A;  3CC7 N;  1IG8 A;  4FSV A;  1VSM A;  3HPH A;  1JXE A;  5SWM A;  4ISG A;  2O8E A;  3GG4 A;  1VRT A;  1KLM A;  3EKU A;  4QCL A;  4WQ4 C;  2FBX A;  4M7X A;  2A3Z A;  2OPR A;  3QIO A;  2JWL A;  5M1P A;  3U3G A;  4ELV A;  5DM7 L;  2VG7 A;  1RDB A;  4AH9 A;  3PV8 A;  4IOA L;  3VF2 A;  5M1Q A;  4FWP A;  4TSX A;  4IEI A;  4DB3 A;  3VER A;  4CF9 A;  2NRW A;  4DTX A;  1RT7 A;  1SS6 A;  3NAE A;  4FCY A;  3AV9 A;  2ITG A;  2PYJ A;  4DSK A;  4OX9 K;  3BF1 A;  4WQ4 A;  1JLG A;  1HJR A;  1RT1 A;  4LF8 K;  1K6Y A;  4BR5 A;  3HJF A;  3FZL A;  3NVM A;  3KJV A;  3PY8 A;  1Z05 A;  3TPQ A;  5CE3 A;  4FK0 A;  4WYB A;  3PSF A;  2QWL A;  3DLK A;  3CC2 N;  1U2V B;  3V9W A;  3AGR A;  1R59 O;  4JRQ A;  4BRF A;  1QS4 A;  2HBM A;  1RT5 A;  4JNE A;  4GV9 A;  4IG0 A;  3V9S A;  2E4L A;  1L3S A;  1HYZ A;  1A5V A;  4CZI A;  5GIP A;  3SJJ A;  5K14 A;  2VWB A;  4CZL A;  3CM6 A;  5KPZ A;  4DR7 K;  4Z4G A;  4H0P A;  3SZ2 A;  1HLU A;  3FZH A;  2XY7 A;  2Q97 A;  3ULD A;  1Z26 A;  5JMV A;  5CYM A;  4KHQ A;  4FJ7 A;  5AQX A;  1YI2 N;  2YKM A;  4BRQ A;  4FOI A;  3EKS A;  1JLF A;  3DRR A;  4B3T K;  4IEE A;  1JKH A;  1BA1 A;  2J4R A;  3AAQ A;  3F9K A;  1SAZ A;  4K42 A;  4CZF A;  4E1J A;  3THW B;  4J2D A;  3QLH A;  1HUX A;  1S22 A;  4YY3 K;  1JCG A;  2QWN A;  4JKB A;  1BIS A;  4B9N A;  3C6T A;  4H5W A;  4MO5 A;  3U3Y A;  3C95 A;  2CGL A;  1BL3 A;  4IOX A;  3UE5 A;  4ID5 A;  1U48 A;  4RW8 A;  3HPO A;  1NG9 A;  3QO9 A;  4ICL A;  4JKD A;  3U9D A;  4C23 A;  1K8A O;  4FWN A;  1BIZ A;  1GLD G;  3M8P A;  4J8F A;  5AQP A;  3T69 A;  1X3N A;  2WBN A;  3DOL A;  1BI4 B;  1ESV A;  4WQ5 C;  3PUF A;  3QIN A;  3D2E B;  3GDQ A;  3LDN A;  4Z4E A;  1RT3 A;  5AJ3 K;  1T7P A;  1DEJ A;  2QWR A;  4RW6 A;  4BGB A;  3VQ6 A;  2P9P B;  3AVM A;  4KH4 A;  4B3M K;  3UKR A;  1BHL A;  4N76 A;  1KFD A;  4M45 A;  3IFR A;  4WQ5 A;  4BVO A;  4O8U A;  3LDL A;  1GLF O;  4CJK A;  2E6M A;  4J2B A;  1WUA A;  3M8S A;  2XY6 A;  4CJL A;  2QA4 N;  1KSP A;  3P1G A;  1VSL A;  1HNW K;  3KIO A;  2E2Q A;  2W42 A;  2QWQ A;  3LZI A;  3O9S A;  3G0Z A;  4K43 A;  3VN5 A;  4OPJ A;  3CCE N;  1HRH A;  3W0L A;  3HBT A;  3CCQ N;  1VAZ A;  2Y1J A;  4NCG A;  4ZTJ A;  2DFH A;  5EOY A;  4DTS A;  4FW2 A;  3C0B A;  4KHN A;  1H1V A;  2G8K A;  4KHW A;  3OS2 A;  3AAR A;  3QBW A;  2P5G A;  1NWK A;  3N4P A;  3D7E O;  4Y1C A;  3LDP A;  2B5J A;  1BQN A;  1RFQ A;  1Y64 A;  4PKH A;  5HOO A;  1HNV A;  5DMR A;  3KK3 A;  1ZYQ A;  3RVC A;  1S1T A;  1XUP O;  1TKD A;  4MQ3 A;  3O1W A;  2CGK A;  5AQM A;  3H3N O;  3K5M A;  2IVO A;  4A5A A;  4NLB A;  3ZX3 A;  2OPS A;  4IWV A;  1SKW A;  3OYI A;  4H0Y B;  4K41 A;  4CIG A;  5IT9 O;  3TTC A;  4DFJ A;  5E84 A;  3UKU A;  2OPQ A;  1VQ6 N;  4C8O A;  4LFB K;  2AJQ A;  4Z4I A;  3O08 A;  4FWR A;  3SAF A;  1J54 A;  3ZSZ A;  2PFU A;  2UUA K;  4C8N A;  4BQL A;  2PYL A;  3TU5 A;  1S6Q A;  3L2R A;  4DQI A;  3E66 A;  1L3V A;  3PSI A;  4FLV A;  4FO0 A;  4B1Z A;  2XO7 A;  4JI4 K;  4JI5 K;  3AVH A;  5TKW A;  1KC8 O;  4FYD A;  4BDZ A;  3BGR A;  4JLH A;  4AM7 A;  2UYT A;  4FJ8 A;  2QWO A;  2P9K A;  4CFD A;  1N8R O;  1XMO K;  3IUC A;  2FBY A;  4E1N A;  5AFU H;  4F2R A;  2KZM A;  3VMF B;  3MXI A;  1FKO A;  1ASW A;  4M3U A;  1YUW A;  3FFK B;  4FVM A;  3SQ1 A;  1U49 A;  3OJS A;  3DLL L;  3RTV A;  3V1Q A;  3A5L C;  3CCS N;  3H08 A;  1C0U A;  1QQC A;  2P9N B;  3LAN A;  5KQ8 A;  4PWD A;  3G25 A;  3QBX A;  3WUH A;  3EE8 A;  3T19 A;  1KLN A;  5CZ2 A;  3SQ2 A;  1WNS A;  4FLU A;  4JYA K;  4AHR A;  4DS4 A;  3VQ9 A;  2O8E B;  4KKO A;  4DQQ A;  1E4F T;  4JKC A;  3DWL A;  3OW2 M;  1IBK K;  2YJF A;  4GNI A;  4DQ8 A;  1MDU B;  3HYF A;  4A59 A;  3AVN A;  4CGG A;  3PX0 A;  2DPN A;  1NK6 A;  1DTT A;  5JVH L;  4H0T B;  4DFM A;  3AO2 A;  4IKF A;  5FRN A;  4W5N A;  2ZD1 A;  1TKZ A;  4JKH A;  3SI6 A;  3O9T A;  4EFH A;  1RDW X;  3HOS A;  3ZSV A;  3AVK A;  2ASP A;  1WSE A;  4PA1 A;  4DV0 K;  3V6D A;  2UXD K;  4E0D A;  2IC3 A;  3JAM O;  4OKJ A;  2I5J A;  1LWC A;  3O4N A;  4ELU A;  3ASM A;  4HCC A;  3NCI A;  1Z25 A;  3WXJ A;  1IKW A;  4OPK A;  4IJN A;  4C1N I;  1IV0 A;  3S9H A;  4DF8 A;  3F9M A;  1YJ9 N;  3O3H A;  1M90 O;  3MCP A;  3PX4 A;  3HSC A;  4KTZ A;  3J81 O;  4O44 A;  1TVR A;  1ZBF A;  3CM5 A;  2G8U A;  1T8E A;  3JSM A;  3K0S A;  4H03 B;  3HTV A;  1M1K O;  3V9X A;  4RW4 A;  2GWJ A;  2WFB A;  3I8B A;  1S9G A;  5MLC Q;  3TAG A;  1NJZ A;  5GAG P;  5E26 A;  3FZK A;  1VSH A;  4AHV A;  2F9W A;  1SV5 A;  2PAV A;  1U2V A;  4DR1 K;  2Z1H A;  4F8R A;  4KHS A;  4FM0 A;  2NRX A;  1NKB A;  4FM2 A;  4BRM A;  1U04 A;  5KRT A;  1BQM A;  1WBB A;  3SJH A;  1U6Z A;  3NF6 A;  2IIR A;  4YOY A;  5HP1 A;  3MK6 A;  1X9J A;  2CGJ A;  5LJV A;  4H0X B;  5LL6 Z;  4FM1 A;  1O1W A;  5ADX A;  3FFI A;  1KQS M;  3SUN A;  2KQ2 A;  4BRP A;  3F5T A;  1OH7 A;  2PZS A;  4BC2 A;  3GBT A;  2HOE A;  5ELZ A;  3RRG A;  4XH5 A;  3VQE A;  1KVB A;  2FBV A;  3OYK A;  3ZSQ A;  1TAQ A;  3NMU A;  4DHY A;  1WAF A;  1WB9 A;  5C25 A;  4JK8 A;  3ZT2 A;  1TK0 A;  4HCB A;  3VF4 A;  3THW A;  4FWL A;  3UKR B;  4WFB L;  3OBW A;  2V52 B;  1S1U A;  4OVL A;  4CEO A;  3WT0 A;  3LDO A;  4YOX A;  3K58 A;  1Q82 O;  1Q9X A;  4C1N K;  2P9L A;  2ZF5 O;  3DMJ A;  4LF4 K;  2WUS A;  3CJA A;  5HRR A;  3CME N;  4F3O A;  2KZZ A;  3CET A;  3LP2 A;  1NGJ A;  4FWS A;  1SL0 A;  4DSE A;  3A5N C;  1IKX A;  2P5O A;  4BC4 A;  3QES A;  4GVE A;  3ZSR A;  3L6Q A;  1NGH A;  3UB5 A;  1YHQ N;  1TUU A;  3B6O A;  4KI6 A;  2XRI A;  1WSG A;  4DSI A;  4K8Z A;  2E1Z A;  5T7B A;  1YVU A;  1QHA A;  2W41 A;  3S3O A;  4B9Q A;  3SV3 A;  3RR8 A;  3LP0 A;  3HZ6 A;  3CD6 N;  4B3R K;  4YDU C;  1VHX A;  2QKB A;  1LCU A;  1IO2 A;  4E7H A;  4H5V A;  2RKI A;  1TK5 A;  3L8B A;  4JS5 A;  1N33 K;  1J53 A;  1V4S A;  3TAF A;  1K9M O;  1RBV A;  4BR4 A;  5J2N A;  3EYZ A;  1HQE A;  2DTU A;  3DLR A;  3DXM A;  1NKC A;  1KXP A;  1NK5 A;  2KTQ A;  4NXN K;  4E7L A;  3H6E A;  4FPB A;  4LY7 A;  1VQ5 N;  2P9S A;  2HF4 A;  4YDU A;  4KRE A;  3SQ4 A;  3AVC A;  2HST A;  4PHT X;  3UKU B;  1UOC A;  1B9D A;  1BOT O;  5F2R A;  1SZ2 A;  3OYC A;  3CHW A;  4LH5 A;  4DQR A;  3MEE A;  2V51 B;  3A2F A;  2YV0 X;  1ZBI A;  1SL1 A;  1ZBU A;  3VGK A;  1RTI A;  3GE1 A;  3SUO A;  3LM9 A;  2BUP A;  3O9R A;  3PX6 A;  3RMA A;  1Q9Y A;  1EQY A;  1BWF O;  1Q18 A;  4JKF A;  2QK9 A;  1OKJ A;  2A1S A;  4N56 A;  1RTJ A;  4DKW A;  3CPE A;  4FWQ A;  4CJF A;  2FBT A;  4QOZ B;  3U6F A;  3S3M A;  4CE9 A;  3VGM A;  5GAH P;  1GLL O;  1ITG A;  5JS2 A;  4X64 K;  4B1Y B;  3QEX A;  1B92 A;  1A5X A;  3M3Z A;  3IG1 A;  2OPP A;  4I9Q A;  4KTW A;  5C0Y A;  4E7J A;  3KWI A;  2BH1 A;  4HHT A;  1HPZ A;  4IOC L;  1MWM A;  4Y1D A;  3TWH A;  5KI6 A;  4XIU A;  2Z1I A;  3OYH A;  4O0I A;  1NGB A;  3VQQ A;  4CK3 A;  5M1N A;  1W7A A;  5GAE P;  1QE1 A;  3CCJ N;  3HL8 A;  5AQL A;  3V1O A;  1YVN A;  3VQ7 A;  2FLO A;  5KTQ A;  2P9U A;  3MEG A;  3R1X A;  2X78 A;  4IO8 A;  2V7Y A;  3SV4 A;  1MU2 A;  3LWL A;  2HB5 A;  3MX2 A;  3OVN A;  3VQD A;  1SL2 A;  3JS6 A;  3UIQ A;  1DLO A;  2F4V K;  1CLQ A;  4CES A;  1QVG M;  4KAZ A;  4FK4 A;  3BY5 A;  1NK0 A;  4DS5 A;  3FZF A;  4RCH A;  4A57 A;  1JLA A;  5BPL A;  1J5O A;  2E88 A;  3A8Y A;  1NK4 A;  5AQT A;  4JAX A;  1NOY A;  4OKK A;  5EU7 A;  1BCM A;  4M3R A;  4YOU A;  4CER A;  4CIF A;  3LAM A;  4JRP A;  4R79 A;  4CHZ A;  5AQG A;  5BR9 A;  3QEP A;  2YJE A;  3VTH A;  2YNG A;  4E89 A;  3O3F A;  3A5M C;  4O5B A;  2W40 A;  3HP9 A;  1IBM K;  3AO5 A;  2NZT A;  2Q0U A;  1NGI A;  5HRO A;  5AQQ A;  4BE0 A;  4YFU A;  4O0J A;  4A5B A;  2FXU A;  3PLA A;  1KAX A;  4DV7 K;  3OY9 A;  3ATV A;  1KVA A;  4AHU A;  3QML A;  4CJ5 A;  2AA4 A;  2E1Y A;  4KI4 A;  1S6P A;  2F8S A;  1SUQ A;  3NF7 A;  3ATU A;  4CF8 A;  4DMN A;  4LF5 K;  3E9L A;  4LD0 A;  1Q86 O;  2NRR A;  5CYQ A;  2YHB A;  1N5Y A;  4LF9 K;  3CFP A;  1E3M A;  3HVT A;  4DQP A;  2WOM A;  4X62 K;  5I9E B;  1RIL A;  1TL3 A;  1X9S A;  5JLF A;  2A1R A;  1I3A A;  1QQN A;  3NE6 A;  3QFP A;  4ILH A;  3EL2 A;  4A61 A;  3QER A;  3MN5 A;  4DU3 A;  3OYM A;  1QZ6 A;  3E1Y A;  4BG9 A;  3C94 A;  4CZE A;  4JHD A;  4QS7 A;  2P9L B;  4JEP A;  5BPN A;  4AHS A;  4ILG B;  4LFA K;  5C2D A;  4YHH K;  4JN4 A;  2Z1J A;  1C1C A;  3WXM B;  2Q31 A;  3L3U A;  1HX1 A;  3SAH A;  4M41 A;  3P39 A;  2ZM6 K;  1X1P A;  4XH4 A;  4B8C A;  4ISF A;  2NLX A;  1NMD A;  1QSS A;  5JLH A;  2HVI A;  3TTF A;  3D45 A;  1NM1 A;  3FLC O;  4H5N A;  4H5T A;  4GKJ K;  4FWK A;  3TSU A;  1NK7 A;  1YJN N;  3KHY A;  1CXU A;  3K57 A;  3CFO A;  3MWP A;  2EWS A;  5FPE A;  4WF9 L;  1EKE A;  1C1A A;  1XQS C;  4E7I A;  4X65 K;  3RR7 A;  4FJ9 A;  4NB4 A;  4Z0U A;  5AQU A;  1NBW A;  3LDQ A;  4CD1 A;  1UWB A;  4KRF A;  4EAH D;  3VEW A;  4BRA A;  3L2W A;  1XNQ K;  4AF1 A;  5GIN A;  4DTM A;  4FJM A;  3DXM B;  3VQ5 A;  4B9L A;  3KLG A;  4CFA A;  1S3X A;  2A40 A;  2P9S B;  3MXJ A;  2DFE A;  2YNF A;  3EO3 A;  4Z4F A;  3GOI A;  2X6N A;  1ZBL A;  4JV5 K;  5AQK A;  1KTQ A;  4DG1 A;  3DXK B;  2AP1 A;  4NO7 A;  3G4S N;  4B08 A;  4DSJ A;  4LF6 K;  1HNX K;  4DUY K;  5AQH A;  5CHI A;  3LDS A;  3DI6 A;  3DRP A;  2GX9 A;  5J2Q A;  4GY2 B;  3K9K A;  3VES A;  3MN6 A;  4ISE A;  3J80 O;  1I94 K;  2Z1G A;  2ATQ A;  1NMN A;  3CF5 L;  1JJ2 M;  3G71 N;  2Q0R A;  3I33 A;  2ZJP L;  1ZXO A;  2NUB A;  3NH2 A;  3QEI A;  1SKS A;  1QSL A;  3IDH A;  3OYN A;  3S41 A;  5AZI A;  2P1J A;  5F1X A;  4JI1 K;  1TKT A;  5HRS A;  2E6L A;  3V9Z A;  2D0B A;  3O1B A;  3ENB A;  3HM9 A;  4BRC A;  2HND A;  5HRP A;  2QKK A;  4BRO A;  5J2P A;  3VQP A;  4LFC K;  1VQN N;  4FXD A;  3NF9 A;  3M8R A;  5AQY A;  1NU0 A;  1XMQ K;  5M1K A;  4FLT A;  3WQU A;  3OJU A;  1NNE A;  2D0P A;  1S1V A;  3NHG A;  1OH5 A;  1J6Z A;  3DLB A;  1UAX A;  3J8A A;  3KD5 E;  5BN8 A;  1QSY A;  4HVJ A;  3TAN A;  2G8V A;  3ZT0 A;  3SLC A;  4CI6 A;  3VQA A;  4DV4 K;  3D2F A;  4E19 A;  3O3G A;  3CIP A;  4Z94 A;  3I56 N;  1TGO A;  5BRD A;  1EP4 A;  2V7Z A;  3AVI A;  4CF1 A;  4CGJ A;  4CZM A;  2O8B A;  3KK7 A;  2KKZ A;  4I6M B;  5JIC A;  3L2V A;  5CY4 A;  1NGC A;  5DM6 L;  4DTU A;  4JI3 K;  3T1A A;  3CC4 N;  2P9U B;  3CJB A;  1Q81 O;  5B8H A;  4KO0 A;  3R3L A;  1VQ7 N;  1CZA N;  1LW0 A;  2QTD A;  2I7N A;  4C8M A;  3J7Z O;  2XY5 A;  3VEZ A;  3O9U A;  4BAC A;  4LH4 A;  4FJ5 A;  2BGG A;  2IAJ A;  3FR0 A;  3QNN A;  3AGK A;  1OH8 A;  3CCM N;  2QXL A;  2W6L A;  1S1W A;  4UQG A;  4EP5 A;  5M1O A;  3QEV A;  3OA9 A;  2HVH A;  3A0I X;  2R7Y A;  5BRF A;  4O8K A;  3OYB A;  1R0A A;  2B6A A;  3F73 A;  2NRH A;  2G8I A;  2RF2 A;  4BR0 A;  2F9T A;  3LL3 A;  1T03 A;  5M1F A;  1X3M A;  3IMX A;  4IO9 L;  1C6V A;  3CXC M;  1EWQ A;  1GOC A;  2E2P A;  1RTD A;  3CG7 A;  3VET A;  2FF6 A;  1T3V A;  3ZEU A;  4B9U A;  2F96 A;  3T1Y K;  1RT2 A;  1GOA A;  2HW3 A;  2OTJ N;  1LAW A;  2GUP A;  1NJY A;  3ZT3 A;  4C8K A;  1GLB G;  3K59 A;  1OVY A;  4I2P A;  2WON A;  4CEB A;  4CZG A;  2Q36 A;  4JK7 A;  1X9W A;  3NH0 A;  3AVL A;  1NGG A;  1C1B A;  3B6P A;  4JI0 K;  4F3T A;  2FC0 A;  3MMV A;  1REV A;  4YOT A;  5CZ1 A;  4MLH A;  1KD1 O;  1EO1 A;  1N32 K;  4RTF D;  1GLA G;  3Q7B A;  4BWJ A;  1W0H A;  4KHY A;  2KW4 A;  2GTD A;  3CCV N;  1JLQ A;  2IOC A;  3TAB A;  5DK5 A;  1RT6 A;  4GV3 A;  4DV2 K;  3MAQ A;  2YCH A;  5C42 A;  4CGF A;  2ZWH A;  4R5P A;  5I3U A;  4FJK A;  2BAN A;  1HJO A;  2QI2 A;  4CJ4 A;  3HO1 A;  1RCH A;  1NJX A;  3VEO A;  1NGF A;  1T05 A;  4DWI A;  1VSF A;  4BRN A;  3AA3 A;  4O55 A;  3L4Q A;  1YTA A;  4DLE A;  4F2S A;  1JXB A;  2IVP A;  3LM2 A;  3THV A;  2G8F A;  4JHD B;  3RRH A;  4DTN A;  2VWK A;  4EZ6 A;  5AZJ B;  1HQU A;  3BUZ B;  1VQ4 N;  3TAQ A;  1S9E A;  4M42 A;  4DV3 K;  3H46 O;  4DU1 A;  4BY9 C;  4IFV A;  3KLE A;  2ZE2 A;  1IKV A;  4F9O A;  2IDO A;  1ZBH A;  2EX3 A;  1JCF A;  3HVR A;  1TV6 A;  4IG3 A;  4BDY A;  1GLC G;  4HUF A;  3DJC A;  5FPN A;  4FVU A;  2H3G X;  4DQS A;  3HK2 A;  4J2E A;  2ZGZ A;  3WNH A;  3NGI A;  4B3S K;  4CVN E;  4F4K A;  1C0G A;  2RHK A;  4CZK A;  1S72 N;  1E4G T;  1ZBS A;  4DR4 K;  1YIJ N;  1VQO N;  2GUI A;  3ENH A;  1HNI A;  4WFA L;  4CGH A;  3L4I A;  2YKN A;  4FJJ A;  3VEN A;  4AHT A;  2Q3S A;  4RW9 A;  4CJW A;  5C10 A;  3NGZ A;  4FJG A;  3BZK A;  3MCA B;  2A42 A;  5GIO A;  4NYN A;  4FZZ A;  2A5X A;  4OPA A;  2O8F A;  4KTQ A;  3CQY A;  4XEI A;  3AVF A;  1TYQ A;  3EY1 A;  4J2A A;  3NF8 A;  4G1Q A;  4CCH A;  1KVC A;  2Y1I A;  2YI1 A;  4JKG A;  1K8K A;  2E20 A;  4OKE A;  3VF6 A;  3KK1 A;  3HT3 A;  4BGA A;  4DF4 A;  1IKY A;  1TL1 A;  2HBL A;  4FLW A;  4CJ7 A;  3JYT A;  3V81 A;  4ZHR A;  3Q7C A;  3EN9 A;  1RNH A;  5JS1 A;  3ISN C;  3AA2 A;  3D0P A;  2NRT A;  5AZI B;  1LV5 A;  5C15 A;  3DXK A;  3G6E N;  3EZ5 A;  5A2Q O;  2GV9 A;  3L2U A;  1FKP A;  1D4X A;  4AIL C;  4CIE A;  3PO4 A;  3NVK A;  3E9O A;  1QQO A;  3VEY A;  4B1V A;  3IRX A;  1DT9 A;  4KHP K;  4IBN A;  4K25 A;  5EVZ A;  3SBT A;  2UXB K;  3OBY A;  3CCR N;  4FLX A;  1MWK A;  4LC9 B;  1NLV A;  3KZB A;  4QS9 A;  3HST B;  2P9I B;  4I7F A;  1BUP A;  2D1K A;  5C2F A;  3D2F B;  1UA1 A;  1NJI O;  1KFS A;  3M8Q A;  1NOZ A;  5IWA K;  4BR9 A;  1S1X A;  3AAP A;  4BR2 A;  1NK8 A;  4M3Y A;  1T6C A;  1Z6R A;  4ZTF A;  1BO5 O;  2O8B B;  2OYQ A;  1BGX T;  3CYM A;  3O80 A;  1BA0 A;  4JK9 A;  5EY4 A;  4EIA A;  3E9P A;  4M7Y A;  4A2B A;  4M63 C;  4OLB A;  3CI5 A;  4BR7 A;  1HMV A;  1VQP N;  4FJI A;  2ZJQ L;  3ZSX A;  3H45 C;  5D3G A;  3P4I A;  1ZC6 A;  4GMJ B;  3DOK A;  2HMI A;  5KPR A;  4L8R B;  3THY A;  3ID8 A;  4IFE A;  2ETJ A;  3MEC A;  4EP4 A;  3IS9 A;  3KVG A;  1EXQ A;  4I9L A;  4Z4H A;  3D6R A;  2OZS A;  4FW1 A;  4DSL A;  3MN9 A;  1JCE A;  2PBD A;  4BRL A;  4IXC A;  1YTU A;  3ZSY A;  3WEE B;  1L3T A;  1BU6 O;  3ZET B;  3NFA A;  4CHQ A;  3QET A;  5EX5 A;  1IBL K;  4CBX A;  3DYA A;  1W2B M;  2X6S A;  4I6M A;  2NRZ A;  3RSE B;  2F7T A;  2VCP A;  1NK9 A;  4FZX C;  3TSP A;  2BTF A;  4CW7 B;  3DRS A;  5FRO A;  1J5E K;  3ZEU B;  3AA5 X;  1XHX A;  4GVM A;  3O4W A;  1GLJ O;  5LJW A;  2QWP A;  4Q5V A;  4KB0 A;  2VQE K;  1WLJ A;  3OS1 A;  4FZY A;  3AO3 A;  1C0F A;  1WSJ A;  2HNY A;  3ZSW A;  1EWR A;  1VSJ A;  4CJE A;  4BVP A;  1FW6 A;  4CEA A;  5HLF A;  4LSN A;  5AQF A;  1W97 L;  4CZH A;  3SK3 A;  5SZT A;  3GL1 A;  4B9S A;  3K5O A;  2G8H A;  2HHS A;  3ENO A;  4GW6 A;  1VQM N;  3FZM A;  3CJ9 A;  1QQM A;  3I0S A;  2YHW A;  4B9M A;  1WSF A;  1DTQ A;  1WSH A;  4BQZ A;  3T1H K;  1ASV A;  4JS4 A;  4EHT A;  1VQK N;  4NCA A;  1EET A;  3CFR A;  4G9Z A;  4ID1 A;  4OGC A;  3BEX A;  1A5W A;  3LP3 A;  4MFB A;  3OYJ A;  4CHY A;  4KFB A;  4WE1 A;  1U45 A;  2HHH K;  2UUB K;  1BDG A;  4DR2 K;  3J7A P;  3QIC A;  3L2Q A;  3T7Z A;  2IVN A;  3FGU A;  4X66 K;  3AY9 A;  5HRN A;  3DLH A;  3I8D A;  2VG5 A;  3IKM A;  4CBW A;  4W5O A;  3K2P A;  4CHN A;  3SMP A;  2A41 A;  4DSF A;  1N6Q A;  5HBM A;  1U47 A;  1JLE A;  3G10 A;  3NDK A;  1RBS A;  4JD2 A;  5AQJ A;  4KHU A;  1WSI A;  4KV8 A;  4DUZ K;  3HOT A;  3THX B;  4HTU A;  1BCO A;  4EHU A;  3CJ7 A;  1IG9 A;  2HHW A;  1GOB A;  3WQT A;  2WC9 A;  4V19 S;  4A62 A;  1MA9 B;  4PKI A;  3DLE A;  3EE9 A;  4FJN A;  4KPY A;  4DLG A;  5AR0 A;  4I2Q A;  4KH5 A;  4DR5 K;  3SNN A;  3SBG A;  5BN9 A;  3TAM A;  3ZT4 A;  3BZC A;  2X74 A;  4BC3 A;  2OZM A;  4IDK A;  4CEE A;  1RBR A;  5FPD A;  3OYG A;  1VRU A;  3WXL A;  1D5A A;  1VSI A;  3RMD A;  1VQ8 N;  1V4T A;  5AZJ A; 
#chains in the Genus database with same CATH homology
 2VQF K;  4NXM K;  4X65 K;  4JI3 K;  1IBK K;  1HNZ K;  5LMN K;  1IBM K;  5FLX O;  5A2Q O;  1XNQ K;  4DR7 K;  4DV7 K;  2UXC K;  5BR8 K;  1HR0 K;  4AQY K;  4KHP K;  4JI8 K;  4DV3 K;  2UXB K;  3T1H K;  4K0K K;  4DV0 K;  2UXD K;  4X64 K;  4DR3 K;  4LF4 K;  4JI7 K;  3JAM O;  4B3T K;  4JV5 K;  5IT9 O;  4LF5 K;  2UU9 K;  4YY3 K;  4LFB K;  4LF6 K;  4JI6 K;  1HNX K;  2HHH K;  4DUY K;  2UUB K;  5IWA K;  4DR2 K;  2UUA K;  3J7A P;  3J81 O;  3T1Y K;  4LF9 K;  4B3S K;  3J80 O;  4X66 K;  4CVN E;  1I94 K;  4X62 K;  1XNR K;  4GKK K;  2UUC K;  4DV6 K;  4JI4 K;  4JI5 K;  4B3R K;  1N34 K;  4DR4 K;  2E5L K;  4JI1 K;  5AJ3 K;  4JI2 K;  1N36 K;  4DUZ K;  4JI0 K;  4LFC K;  1N33 K;  4B3M K;  1XMO K;  1XMQ K;  2F4V K;  4DR6 K;  4V19 S;  4DR1 K;  4NXN K;  1IBL K;  4LFA K;  1N32 K;  4YHH K;  4GKJ K;  4LF7 K;  4OX9 K;  4LF8 K;  4DV1 K;  1HNW K;  4DR5 K;  5LMU K;  4DV2 K;  2ZM6 K;  4DV5 K;  4DV4 K;  4CW7 B;  1J5E K;  5LL6 Z;  3J7Y P;  2VQE K;  3OTO K;  1FJG K;  4JYA K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...