1FKPA

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
542
structure length
541
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 147
structure length 541
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fkpA05
3PJXA 3NAIA 2FJXA 3EY1A 4OKKA 3MXMA 4C8KA 3QIPB 3LPUA 3MAQA 1CLQA 3QO9B 3N6MA 1LW2A 3H4BA 4Z4CA 1C1CA 4DG1A 4DL5A 3IN5A 2KFNA 5KT2A 4DFPA 3LDSA 1QUVA 3VA0A 3TANA 3D28A 5HP1A 3N6LA 2FVRA 4NZ0A 1XI1A 3HPGA 2YNHA 3D45A 2UUWA 3KTQA 3H40A 3MEEB 4U7CA 3QETA 1G15A 4OGEA 4DTSA 4NLWA 4PA1A 1CSJA 1XWLA 4FLTA 3SUNA 1QSYA 3WNHA 4NLXA 4KTQA 2D41A 4NCAA 4YNQA 1RT3A 1FXXA 4DS5A 4I2PA 3DLRA 4BDYA 4K4YA 4B08A 1SUQA 5KFIA 4FBTA 3MR6A 3PW4A 2JC1A 2V4RA 1NJYA 4M42A 3SUOA 5EWFA 2UUTA 3K2PA 1JLGA 4UQGA 5HLFA 3NGYA 3QEVA 1FK9B 4B9NA 1JXEA 3L2VA 2Z1JA 2HWIA 3BJYA 1GOBA 4O4GB 4KB0A 2RKIB 1XR6A 4ECUA 3OHBA 3RAQA 5KG0A 1VSIA 2G8VA 4Y2AA 5EWEA 1NOZA 1VSDA 1ZBLA 3KHHA 3PUFA 3KNAA 1QE1A 3ZSQA 3K5OA 4ZHRA 3LPTA 2XI2A 5KFRA 5C42B 3OY9A 3BSCA 3KK3A 4E3SA 2FJVA 4BE1A 3OYLA 2WK4A 4XO0A 1EXQA 4ZPBA 5EU7A 1D9FA 3KIOA 3FQLA 4Y34A 1NHUA 4RW9B 4TQSA 3DLKB 4CGGA 3G86A 3PX4A 3L8BA 2C28A 3Q8QB 4ZVFA 2YKNB 5KFTA 4HCBA 1SL0A 5KFAA 2R7YA 2JEIA 1L3VA 4KPYA 1N48A 4CERA 3QESA 2I5JB 2BQUA 1JLBB 3MR2A 1ZBFA 1RT7B 4HKQA 4ZPCA 4FK2A 5EWGA 4W5NA 3HSTB 3GIMA 4FJ8A 4Z4IA 4JS4A 3KJVA 3TAMB 2YV0X 1ZBHA 4DTXA 1Q8IA 5J2NA 1KVBA 1TP7A 5F8HA 3ZT2A 2OPRB 5KFZA 5I3UB 1A5XA 2C22A 1VRTB 3VQ4A 3CJ4A 3VQDA 2CJQA 2I5JA 2D5RA 4ZTJA 4IH6A 4MIAA 1R0AB 2W9BA 1UWBA 4K4XA 3KD1E 5KFLA 3DLGA 4BDZA 4KHQA 4EYHB 2RKIA 4GC7A 1RBVA 4FYDA 4I2QA 2E9TA 5KFJA 3QNOA 4DF4A 1NK0A 3MXIA 5DLFA 2ATLA 4IH5A 2WB4A 1SKSA 3RBDA 4FJ5A 2F96A 1JXLA 5C42A 1T7PA 4DQPA 1TKXA 1VK0A 2IAJA 3RB6A 2IA6A 1K1QA 5L1IA 1ZTWA 1QE1B 4OPKA 4E1MA 2IM2A 1WSGA 4CIEA 1ITGA 4YR3A 3QZ8A 4ECSA 3RB3A 4FZXC 1XR5A 2DFHA 3K59A 5L1KA 4FW2A 1JX4A 1I39A 1SV5B 2X74A 2BGGA 2YNHB 1BIUA 4ZP7A 1XHZA 5HP1B 1SKRA 2FBTA 1RDAA 3DLGB 4MQ3A 1U45A 2BE2B 1UWBB 1R0AA 4NCBA 2DTUA 3O4QA 4H8KA 3QO9A 3OLAA 1JXBA 1KCFA 3PW0A 4ED0A 3LP0B 2UVWA 4M41A 4AHTA 3NH0A 3WNFA 4XPEA 1RA6A 4C8MA 4AH9A 2QKKA 4Q44A 3BQ2A 1DTTB 2VWKA 1QS4A 4O3QA 3MEEA 5J2MA 1EETB 2AX0A 3OJSA 3DOLA 3T19A 2X78A 1RT7A 1L3TA 1TV6A 1KVCA 4AHVA 3C95A 3ZSZA 1LWFB 1WSEA 3PZPA 4DFKA 1C2PA 4RUCA 1C1CB 4DG1B 2JC0A 3OS1A 5KFKA 4ED7A 3NFAA 4R5PB 5F8IA 5T7BA 4B3OA 4J2EA 4E1NA 3RTVA 4J9QA 5FRNA 3CJ0A 2OPQA 1Z26A 2IJFA 1VSFA 4KHWA 3NF8A 4TYBA 5KT5A 1KLNA 3IG1A 3QGGA 4TSXA 4NCGA 4FW1A 4GMJB 3QLHB 4O44B 1QQCA 1X9WA 1D9DA 3UDLA 4EO6A 4IRKA 1HJRA 3E51A 4IDKB 3FFIA 3UIQA 2ZKUA 4N56A 1IKXA 2YNGB 4CJRA 3BDPA 1EKEA 3PR5B 2NUBA 4YR2A 4JLHA 2HW3A 3PW5A 5KG5A 2C2EA 2WOMA 2XCAA 5KFSA 1MU2A 1RT2B 1JL1A 2QKBA 1Q9YA 3LP3A 5KI6A 3RB4A 3DRPB 1KVAA 2AWZA 3Q8SB 1NKEA 1C0MA 2IM1A 5I42B 2GIRA 3T5JA 3DRRA 4CJLA 5DLGA 3V81A 4I2PB 3MFIA 4CFDA 3NBPB 5K14B 1SH3A 5DGAA 2CKWA 4RNNA 4PUOA 2W9CB 1S5JA 4TQRA 4CEEA 4RW4B 1WN7A 3RRHA 2XY5A 3AVMA 4IG3B 1N56A 1TL3B 1HNIB 3TQ1A 4RW4A 2ZQBA 2W9CA 4I9LA 1FKPA 2VG7A 3G6VA 3E01A 1RT4B 5KFYA 1TL1B 2HMIB 4K4SA 1JLEB 3HVTA 3KK2A 4J9RA 3AVFA 3QERA 3QIPA 3LWLA 2YNIB 1HRHA 3MEGA 4FZYA 4KREA 4KE5A 2W9AA 3PO4A 5I42A 1S1TA 1HMVB 1UAXA 2ZD1B 4ED8A 3DRPA 3PVXA 3NAHA 1T05A 1RBTA 3P1GA 1S9GB 1BCMA 4KHUA 4FLVA 2ASJA 1BISA 5CYQB 2VG5A 3TAPA 3FFIB 4NLYA 5F9LA 4LH5A 1RA7A 4ELTA 1JLQB 1S1WA 4AILC 1WSJA 2HNZA 2FVQA 4NYZA 4O3OA 4OVLA 4ZP8A 3V1QA 4Q0BA 4ED2A 3KLFA 1Y97A 4C8NA 4CEAA 2D7SA 4EO8A 1BQMA 1D0EA 4QWBA 3JSMA 1S6PA 3FQKA 4C8LA 2OPQB 2IMWP 4F4ZA 1NOYA 1S0OA 2KFZA 4B3OB 3TR8A 5DK5A 4O3PA 1RTHB 3QEPA 2YKMB 2QK9A 3V4IB 5C24A 4NLGA 5C25A 5DQHA 3GV5B 4DL4A 4KHRA 4J2AA 1S9GA 1C0TB 2AGPA 3SQ4A 3ZSOA 3AVNA 1RBUA 1S1UB 1WSHA 4E7KA 4E7IA 3KK1A 4AHRA 3QGHA 5D3GB 2LSNA 3TARA 1SH0A 5DGBA 1HMVA 5KG6A 1TK5A 4ZMMA 3DM2B 5FDLA 3LP0A 2R8HA 3NCIA 5KFVA 4F4XA 4DTNA 1UA0A 3BSNA 3LP2A 4CGHA 4ECQA 1TL1A 1S49A 5KFEA 4KO0B 4G1QB 4J9OA 2RF2B 2R2SA 4FJGA 2BE2A 3E01B 2R8KA 3OYCA 4DFJA 2VA2A 3VQQA 1S10A 4TN2A 1XHXA 2VG6B 1WNEA 3KLHB 1T03A 1VSKA 4PQUB 4NLSA 3U3GA 2DY4A 4JRPA 4FM0A 4DQSA 4KB1A 1UOCA 2PY5A 2ALZA 3KKRA 2OPSA 1VSJA 1NK4A 4DQQA 4NYFA 4TYAA 2O4IA 4ED6A 5J1EB 3ZSVA 1HYZA 1NKBA 4CK3A 3PV8A 1EX4A 1RTDA 3KLIB 4JV0A 5EUHA 4WZQA 2IAJB 3DYAA 1B9DA 1B9FA 3VQ8A 1RT5A 5KFOA 3IGVA 4LSNA 4EZ6A 3MFHA 3H98A 3HPOA 4ZVEA 3SFUA 2X6NA 3VQEA 4WZMA 2BQRA 4ECYA 2F8EX 4TY8A 3TABA 4CJ3A 3MECA 1C0UB 4OKJA 4DQIA 4LQ9A 1REVA 4FZZA 1BIZA 1NKCA 2UVUA 3ZT4A 4YQWA 3PHEA 3CM5A 4L8RB 3I0RA 1WAFA 3MEDB 3A2FA 2XGQA 1VSHA 1LWCB 2ILZA 1GX5A 2XY6A 1S1XA 4DQRA 2WCXA 2E4LA 4FJ7A 4WFXA 2E6LA 1XR7A 4YR0A 4M3UA 4CK1A 2OPRA 4CHNA 1IH7A 3DI6A 2D0CA 2W7PA 1JKHB 2XY7A 3M8SA 4IOBA 1DLOB 3RB0A 3DMJA 5SWMA 3MR3A 4MKAA 4R8UA 1YVUA 4DF8A 3HVRA 4FLZA 2VA3A 3PJWA 3QEIA 1JLBA 4R5PA 1JLCB 1S6QA 5EDWA 2BR0A 4DTJA 1WNSA 4IFYA 1TQLA 4MK8A 3OL9A 1ZYQA 1LWFA 3IS9B 3SPZA 4ICLB 4BDPA 2KTQA 3SUQA 4RNHA 4CJPA 3DOLB 1EETA 1N6QB 2AU0A 3F73A 3C6TA 3T5LA 3QEWA 3RRGA 1S1VB 2O5DA 3OL8A 3LANA 3L2RA 1JLCA 4RZRA 4NLDA 4NLUA 4ID5A 3CIZA 3RMDA 1ZBUA 3HHKA 4FM1A 2E6MA 4HCCA 2QV6A 1TKZA 1TAQA 1JKHA 1L3UA 4CJWA 3QINA 3ISNC 4CF2A 2PYLA 5KG3A 3NAEA 3AVIA 4ZPDA 3SQ2A 1XC9A 2HHVA 4K4WA 1IG9A 5KFGA 2P5GA 2A1SA 1SV5A 5KT4A 3GIKA 5KGWA 3OYNA 5HLFB 2V9WA 4N41A 2P1JA 4CCHA 1EP4A 1KFDA 3KHLA 3O3GA 2KZZA 4Z4HA 3KLGA 4FLWA 2W8LA 2YHBA 2WRMA 2HHQA 3OYDA 4IQXA 2X6SA 4TY8B 3ALYA 4CJVA 4XIUA 2XC9A 3I5CA 3O4NA 1C1AA 3BQ1A 2HHWA 1IKVA 4ZTFA 4B9TA 4OGCA 1RT5B 3NGZA 4ED1A 2F8TA 4EEYA 1RCHA 1RT6A 4WYWA 4QAGA 1RTDB 3KLVA 3MTKA 1NK9A 4CE9A 4ECRA 5KFNA 4H54A 2OPSB 4J9KA 2OA8A 2ETJA 3LP1B 1X9MA 2XY8A 4DSKA 2OZSA 2FJWA 3UPFA 4F4WA 3ASMA 5KFPA 3D5MA 1RT1B 5KG4A 2JGUA 4FXDA 4FJJA 3M8PA 1IM4A 2VG6A 1IKWA 3RR7A 3HVAA 3SV3A 1QTMA 4FJNA 2RF2A 1KHVA 4RU9A 4B9MA 4F3TA 4K4VA 3HVWA 4GC6A 1UA1A 1VSMA 4B9VA 4IRDA 3O3HA 1TVRB 1RTIA 5L9XA 3LALA 4FJKA 3Q8RB 3CJ5A 5HBMA 4CEFA 2YKNA 5F8JA 4WXOA 3GQCA 4PY5A 3DLBA 3VQBA 3S3NA 1HYSA 4GW6A 3DLEA 4IH7A 4F50A 3HPHA 5KFUA 4CESA 3BSOA 1RYSA 3DRSB 3U6FA 1U04A 4DSJA 4YP3A 1RTHA 3KK3B 3SI8A 3EPIA 1TK8A 3OYBA 3NF7A 1D8YA 2HNYB 4QCLA 4CFCA 4I7FA 3ZSYA 4O3NA 4CJ4A 5KRSA 5KFDA 3NF9A 1DLOA 4Q43A 4OLBA 1C6VA 2HVIA 4KHYA 2V4QA 1RDBA 3L3UA 4O4GA 3ZCMA 3H59A 2O4GA 3SZ2A 3NE6A 4M3RA 1RNHA 4EYIB 2HNZB 3OSNA 4J9LA 2IBKA 3ULDA 1YTAA 4EBEA 1KSPA 4R0EA 4DSLA 4TY9A 2B5JB 1HARA 4EBDA 4WFZA 5FRMA 4CGJA 5KFCA 2J6TA 3QIOA 4E7LA 4E89A 1N5YA 1T05B 4MFBB 5CYMB 3QNNA 1GX6A 2HNDA 2IC3A 4IRCA 1VRUB 4RW6A 1RT3B 3M8QB 4FLUA 2B6AA 4KTWA 3OYMA 3KD5E 2ZE2A 1ASWA 1S1TB 1I3AA 1RDCA 1U4BA 3GV8B 2OPPA 4E19A 3RMCA 1HNVA 2DPJA 3HYFA 2G8FA 2C2DA 4Y2CA 4CEBA 1LW0A 4ZP6A 5JS2A 4DL7A 3NL0A 2VG7B 3F9KA 1FKPB 2WONB 2D0BA 3V1OA 3PX0A 3C6UB 4B8CA 1TL3A 4FS1A 4CEOA 3V6DB 4DTMA 3V9XA 2R2RA 4AHSA 3NGDA 3SJJA 4DL6A 4W5OA 4PUOB 1HPZB 2RDIA 3SUPA 4NYNA 1B92A 3VQSA 3Q8PB 3VQ9A 4JUZA 3SV4A 1YT3A 4G1QA 2B6AB 4RW8B 2IOCA 3QIDA 3M8QA 3OJUA 3LP2B 4GVMA 4JRQA 5KFHA 3PR4A 4O0JA 3V81B 3AA2A 3DOKB 1DTQA 4KKOB 1OS5A 5FDLB 3DM2A 4KI4A 3AO4A 1NK8A 3VA3A 4F8RA 3HL8A 5HRSA 4PWDB 1J54A 1QAIA 5J2PA 3KK1B 3DLHA 1YVFA 2EHGA 4ZPAA 2JEFA 1Q9XA 3BGRB 3D0PA 4ZP9A 4QWAA 3ZSRA 1IO2A 3H2LA 2IM0A 3AVGA 4E7HA 1KTQA 1BL3A 4B9SA 2YNFA 5CZ1A 4NLQA 2YNGA 3K57A 1IKXB 4O55A 5C25B 1TAUA 1IKYA 5C24B 1TK0A 4DL2A 1ASVA 4W5TA 3V1RA 1J5OA 1W9HA 3TAQA 4RNFA 4PWDA 3MXJA 1O1WA 3TAGA 4IR1A 1GOCA 1J9AA 4F2RA 4O44A 4Y3CA 3ZT0A 2R8JA 1RTJB 1HYVA 3AVAA 4I9QA 3ITHA 1RDRA 1A5WA 2B43A 1BCOA 3K5LA 4N47A 3NH1A 3AA4A 2HVHA 3QYYA 1HPZA 2YNFB 5F8NA 4IBNA 4IFVB 2G8KA 3HXMA 1NK6A 2BRLA 4WE1B 1L3SA 4QW8A 1A5VA 1JLFB 1NHVA 4QOZB 3PY8A 2QE5A 3RWUA 4M3YA 3NH2A 3S3MA 4DTRA 3C6UA 5HBMB 4FS2A 4DFMA 2WONA 1Z4UA 4H4MA 4CJEA 4M45A 4RNMA 4URSA 2KW4A 4K4TA 1S48A 4FLXA 4MH8A 3I0SA 3OLBA 1LW0B 4CHPA 2J6UA 4BACA 3PO5A 1BQNB 4BE2A 1TKTA 4QWDA 4RUAA 4Y1DA 4NLRA 4URQU 3VQCA 2Z1GA 3M8PB 2YNIA 4Y1CA 4DU1A 1VRUA 3G0ZA 4M95A 2HNDB 1BGXT 4DLGA 3L2UA 3V9UA 2RPIA 5KFXA 2OH2A 1CZ9A 2R8IA 2Z1HA 3EZUA 2UVVA 4LD0A 4QWEA 3KMSA 2Y1JA 4NLTA 3CWJA 3PW7A 4J9SA 3O3FA 1HQUB 4ECTA 4HUGA 1RYRA 4DSFA 3L2QA 3AVJA 4OJRA 2EC0A 2HHTA 3HKWA 3SPYA 4RW6B 4ECVA 3H08A 1S9EA 2IC3B 1RTJA 3DRRB 3WNGA 3OYEA 2JLEA 3V9ZA 3AVHA 1TKXB 1SKWA 5KGXA 4DL3A 2ASDA 4CF8A 4CEZA 3U3YA 2B5JA 1IKYB 4G3IA 4NLPA 2R2TA 3CJ3A 2FVPA 3N6NA 2HB5A 2HWHA 4Q8FA 3VQ7A 3HM9A 4ED3A 1MU2B 1RT2A 4K50A 2WOMB 4CGDA 3CQ8A 1WAJA 3M8RA 5HROB 1HYSB 1F21A 4LQ3A 4ECXA 2W9BB 1U49A 4F4KA 5J2PB 2D0AA 4FLYA 3MF5A 1TKDA 4LSLB 1BI4B 3NGIA 3HP6A 2WHOA 5I3UA 3QLHA 4KV8A 5J2QA 4TLRA 4JS5A 1DTQB 4KKOA 4NCGB 4HUEA 4M3TA 3NHGA 3LWMA 4E7JA 3THVA 2V0NA 3K5MA 1S1VA 5L1JA 5FROA 3CDUA 4HUFA 1QSSA 1BHLA 4M3ZA 1KHWA 3DRSA 4HHTA 4RNOA 4F4YA 1NJXA 1QSLA 4J2BA 2P5OA 1FKOB 3DLEB 4CEQA 3TWHA 5SZTA 1RT1A 4DTPA 3SQ0A 4IFYB 4Z0UA 3I5BA 3CYMA 4ELVA 1TV6B 4KSEB 3OSPA 3T5HA 5HRRA 4KHNA 2BANA 4R8UB 3OVNA 1HNVB 1DTTA 2OPPB 2XI3A 4BE0A 3KMQA 3GIJA 1KLMB 3IRXA 4OLAA 2ZE2B 1IKVB 3VQ5A 3DI6B 3H5SA 3H5UA 2R8GA 1IKWB 3FDSA 1SL2A 3G6XA 2FVSA 3FSIA 4QPXA 4JV2A 5KT3A 2ITGA 1LWCA 1N5YB 3MEDA 4M3WA 4CFAA 3SYZA 5JS1A 3MR5A 3LP1A 5KFMA 3AVBA 1T8EA 4CHZA 5CY4A 3SI6A 1J53A 2E9ZA 3CFRA 3V9WA 1REVB 4W5QA 1FK9A 2D3UA 4FJHA 3AO1A 3AO2A 2G8WA 3PX6A 1RT6B 1CXQA 2KQ2A 4CJUA 1RILA 4WYLA 2DFEA 3CJ2A 4E0DA 2XRIA 3QGIA 4URGA 4Z4GA 4B9UA 1KLMA 3IRXB 4IG0A 1SUQB 1TKZB 2IJNA 2BDPA 3G6YA 1HQEB 3IAYA 4ECZA 4RG8A 4CHOA 4I7FB 2HNYA 5J1EA 3V6JA 3TAEA 4DSEA 3OYKA 3GILA 3CDWA 4KB7A 3OYIA 1U09A 1EP4B 1NK7A 3OS0A 4TXSA 1SH2A 3VQAA 2AJQA 5T14A 5KG7A 2W42A 1FKOA 5E41A 4EBCA 1JIHA 4WFYA 4CJSA 1RDDA 3IS9A 3V6KA 1W0HA 2PZSA 2HHSA 1QAJA 2IS3A 4CJ5A 4FJIA 1S6QB 4CGIA 3RR8A 3TI0A 2RN2A 5HRNA 1TVRA 3AO5A 4KV8B 5J2QB 2FC0A 3KOAA 2B4JA 1S4FA 3ZSWA 4FM2A 4LSLA 3KLEA 5F8GA 4CJFA 3CFOA 3KJVB 4KBIA 3VQ6A 4M3XA 3C6TB 4DTUA 3CFPA 4NLVA 3NDKA 1N6QA 4Q8EA 2A1RA 4U6PA 3H4DA 2P51A 5HROA 3RBEA 2PYJA 4CJQA 1C0TA 1QHTA 4MKBA 4ICLA 2FVCA 2FLPA 1NJWA 3BR9A 3AVLA 1GOAA 3B6PA 4H4OB 4DTOA 4LH4A 4CECA 5F9NA 2G8HA 4BWJA 3DLKA 4ZVHA 4EP4A 2EX3A 4RW9A 1S9EB 4IR9A 4Q5VA 1HQEA 1ZTTA 2DFFA 1C1BA 3DMJB 5F8LA 1BQMB 5L1LA 5CZ2A 4J2DA 3IGNA 1ZETA 3KKSA 4IG0B 4O0IA 4ZVGA 1MMLA 1NJZA 3HP9A 1U48A 5DG8A 4CHQA 5JXSA 4ZHRB 4M94A 1S1XB 1N4LA 1S0MA 4FK4A 4XPCA 1LV5A 2F8SA 3KLGB 1KFSA 2VG5B 3ICLA 4F3OA 3CG7A 4HTUA 3JYTA 5F8MA 4CFBA 4IKFA 1S0NA 4EZ9A 3GV7B 4K8ZA 3I5AA 1D5AA 2GC8A 4KHSA 3MECB 4CF9A 3SFGA 3K5NA 3PW2A 2XCPA 3HK2A 1JLGB 2ZD1A 4QWCA 2RDJA 1KRPA 2XHBA 3L3VA 4KFBB 4CF0A 3T1AA 1TKTB 3OL7A 2XO7A 2I1RA 3S3OA 2FBXA 4HYKA 3MEGB 4OL8A 3OYFA 3OL6A 3OYGA 4DEZA 3LAMA 4QW9A 3KLIA 2Q3SA 2BANB 4FJXA 3I0SB 4ID5B 2BRKA 1NK5A 1LAWA 2ATQA 3M9MB 1RT4A 1U47A 3NMAA 3CDEA 4F2SA 3DDKA 4EP5A 5KTQA 3CVKA 3L2WA 2BQ3A 5D3GA 4NRTA 4KI6A 2ILYA 2G8UA 2C2RA 1S1UA 2AX1A 4FK0A 4KAIA 1JLFA 2HHXA 5KFQA 4WE1A 4ELUA 1T94A 1WSIA 5KFWA 1NNDA 3M9NB 5DG9A 3WNEA 3EZ5A 3CO9A 5HRPA 3QZ7A 3NBPA 5K14A 3LZIA 3ITHB 1I6JA 1LW2B 3UQSA 3KHRA 4FVMA 4LY7A 4NRUA 2Y1IA 5DQGA 2Z1IA 2AQ4A 2GV9A 4DU3A 3OHAA 3EPGA 1BI4A 4C8OA 4RW7A 3JSMB 4DLEA 5KFFA 2FLNA 1J5OB 3K58A 1CXUA 5DG7A 4CEDA 4KRFA 4Q0BB 4N5SA 1WSFA 4YMEA 3HO1A 2DPIA 2W7OA 1LWEA 1S1WB 4Q45A 1Z25A 3GIIA 1CZBA 4J9MA 5CYQA 3I0RB 4DMNA 4DWIA 4BWMA 2FLLA 1LWEB 3OYJA 4CJTA 3P83D 3V6HA 1C0UA 2JEJA 1S6PB 4FJMA 2IGIA 1RBRA 4FJLA 4O4RA 4RW8A 3S9HA 4CIGA 4W5RA 1HQUA 4RW7B 3ZSXA 4LSNB 2R2UA 3KLFB 4AHUA 4N76A 4KAZA 3DYAB 3QEXA 4AHCA 1VSLA 1K6YA 3ISND 4HVJA 3V6DA 3TAFA 4IKAA 3M9OB 3BQ0A 3HVTB 1RAJA 2HMIA 3H5XA 1WLJA 3OYAA 4JV1A 4J9PA 3NKYA 2D3ZA 2XGPA 4FCYA 4DS4A 3HJFA 2QXFA 4O3SA 4IG3A 3AV9A 3T3FA 3ZT3A 3P5JA 2XWYA 3HT3A 2OYQA 4PQUA 2ASLA 3VQPA 3KLHA 1T03B 3SCXA 4FJ9A 2E9RX 1L5UA 4ID1A 4O3RA 4DSIA 3I8DA 1S97A 1RBSA 4CGFA 4KO0A 3CM6A 1BQNA 1JLAB 5KT6A 3AA3A 2AGOA 2JEGA 4B8AB 3KK2B 1JLEA 4X2BA 1JLAA 5KG1A 1T3NA 5CYMA 4MFBA 3T5KA 4KFBA 4CIFA 5KRTA 4H4MB 2GUIA 4Z4EA 3OYHA 5JUMA 2VWJA 1HNIA 2GIQA 4YFUA 4KHMA 3H5YA 1VSEA 2YHAA 4KTZA 5KT7A 4O5BA 4CJKA 4OPJA 1X9SA 2HHUA 1JL2A 4K8XA 2HAIA 3VN5A 4WXWA 4IFVA 3LZJA 3KHGA 1ZBIA 3JYTB 1W25A 1YTUA 4ECWA 3FRZA 2J6SA 3G10A 5C5JA 1SL1A 3NF6A 3ZT1A 3SNNA 3V4IA 3C94A 3SQ1A 2YKMA 4K4ZA 3GYNA 1X1PA 4MIBA 4K4UA 5KG2A 2GBZA 4DU4A 4CF1A 4B9LA 4OKEA 3OS2A 4NLOA 5KFBA 3EYZA 3AA5X 2IDOA 2W8KA 1C1BB 3LAKA 3B6OA 3RMAA 2IM3A 4CK2A 3V9SA 4I2QB 1JLQA 3AVCA 3BGRA 5DMRA 4Z4FA 4H4OA 3RAXA 2FBYA 5DQIA 3AO3A 3BREA 3UR0A 1S9FA 4FBUA 2FBVA 2G8IA 4IDKA 4CHYA 3BSAA 3TVKA 1VRTA 1TGOA 1D1UA 2KZMA 1K1SA 1RTIB 3DOKA 1LAVA 5J2NB 5J2MB 2WTFA 3IG1B 2AGQA 3AVKA 3TAMA 4MK9A 2OZMA 3KLEB 4MK7A 3RMBA 4J9NA 1ASUA 2UVRA
chains in the Genus database with same CATH superfamily
3UR3C 2NRTA 4YY3K 4JI4F 1K8AO 3MAQA 4C8ZA 3MOJB 3QO9B 3BB5A 1C1CA 4DG1A 3W61A 3TANA 5CA5A 3JS9A 1AA1B 2W4CA 3R5DA 4B1UB 2FGCA 4NZ0A 4JHDA 1Y00A 3D45A 3H40A 2B9XA 4U7CA 4CD3A 4HT5A 4FVUA 1W2BR 2KVQE 4FXWA 1Q8BA 3NNCA 1NGIA 4FSVA 1CSJA 1XWLA 2LQBA 4NLXA 4LFCF 4NCAA 4Y00A 2PMHA 3IC1A 4YNQA 1NLKL 4DR5J 4I2PA 3DLRA 3MD3A 4BDYA 3QGPA 1JK9B 3TR5A 4DV2K 2V4RA 4FWMA 4GKJJ 1TUGB 4OZ0A 4B3SK 4RL1A 4LF6K 3THYA 4USIA 5HLFA 3FSYA 1X4GA 5C0YA 4B3RK 3A1YG 3NS6A 5HVFA 4K25A 4M63C 1GOBA 4BROA 4Z7CA 3OHBA 3RAQA 5KG0A 2LEBA 3GPAA 3CXCM 2KHDA 3KHHA 5B0GA 1UETA 4H5VA 1VQ9S 4ZHRA 1FRXA 1ZBTA 1UPPA 2ZITA 3OY9A 2ZJRQ 2FJVA 5FD1A 2N3LA 1D9FA 4ZPBA 5EU7A 5DZ6A 1IBMF 2RU9A 3KIOA 4P6QA 2OLWA 4CGGA 1YG0A 3NLCA 5B09A 2C28A 2VODA 2QYGA 4ZVFA 2YKNB 4C0HA 1NO8A 2K06A 2R7YA 4IDHA 2I5JB 2MY7A 1VQ4N 1VQSA 1JLBB 3H1VX 2Z56B 1ZBFA 5I3PA 3M32B 1QD1A 5EWGA 3AHPA 4LRFA 1XMBA 3HSTB 2JWNA 3GIMA 4FJ8A 3GL1A 2VH7A 4LC9B 2BUPA 2ZJQL 5IM0A 1DGKN 2YV0X 1ZBHA 1Q8IA 4DU7A 4LFCJ 3J7ZT 1VRTB 3VQ4A 1IBMK 4L3KA 2YQ3A 2CFXA 2XSJB 5CCMA 4K4XA 5AQLA 4BDZA 2U2FA 4GC7A 1RBVA 4FYDA 5HMYA 3C14B 3R5CA 3QNOA 3RVCA 2DHSA 1NK0A 3MXIA 3OT9A 4IO8A 2WB4A 1SKSA 2ZNYA 2F96A 5C42A 4YB7A 2UV8A 1VK0A 4C97A 1FD2A 2UXBF 3GBTA 2KB2A 1QE1B 3L09A 3MM8B 1WSGA 1N33F 1NNEA 1NMNA 4FZXC 3RB3A 4I68A 4JV5K 1XR5A 5DDPC 1JX4A 1HBUA 2BGGA 2YNHB 1M5PC 3D9BA 4V19S 4CTAA 2XMUA 2FB0A 3QJLA 2F40A 3K2YA 1U45A 2EFNA 2YWWA 1SJ4P 1RLCL 1SXLA 1J5EJ 2LXIA 4K5RA 3C7NB 5E0OA 3QO9A 3CC2S 1D8ZA 1F0XA 3PW0A 3K8VA 1HKGA 2ZJPQ 2RHSB 4M5IA 1BLUA 4KH6A 3NH0A 3DXMB 4LRAA 2QKKA 4LFBF 2ZOFA 4JI0K 2VWKA 2QL9B 3S8SA 3MEEA 5J2MA 1NSAA 1EETB 1QDUB 2AX0A 4A8OA 3OJSA 1VK8A 2M9KA 2AMCB 2MKSA 1LWFB 1X4AA 1WSEA 4DFKA 3TO8A 1C2PA 1I3OB 3BBBA 1N88A 2JC0A 2GQCA 3UW1A 3OS1A 4R5PB 4WFAQ 5T7BA 4B3OA 3CCRN 4HHUA 4E1NA 2V7ZA 2Z0GA 1Z26A 3OBYA 3A0IX 3E1YA 1FVQA 3FFKB 1NCLA 2RUSA 4X4QA 1WUUA 3OVBA 2L9DA 3QLHB 4O44B 1QQCA 3UDLA 1N54B 4JKFA 4UQTA 3W66A 3R5BA 1MWZA 1NU0A 2GWJA 2EK1A 3IBCB 2ZKUA 4N56A 1IKXA 2ZM6K 1PJ6A 4CT9A 1FX2A 1OH8A 1YRXA 4CJRA 5G4DA 3BDPA 2NUBA 3CJAA 1TU0B 4WFBL 2HW3A 1RXOB 4JI3K 2C2EA 1MU2A 1RT2B 1LEOA 2QKBA 2KVIA 2QL5B 4OHVA 5AXNA 3PHTA 3FNNA 1JJCB 3ILIA 4OZLA 4Y0WA 3RB4A 2E29A 1NGGA 1C0MA 1N0UA 1UEVA 3T5JA 1O5JA 1BWEA 4EI2A 2KHOA 3MFIA 1P90A 5K14B 2V4JB 2VC1A 5DGAA 3AXKA 1B0VA 7AT1B 4IO1A 4CNYA 3DXSX 4CLZA 4RNNA 4PZVA 3WXKA 3P3DA 1VJQA 4RW4B 3VAHA 3CD5A 3J8AA 1VQNN 5HMWA 1ICEB 2XY5A 2QWQA 4IG3B 4WQ5A 2B4PA 1HNIB 1XMQJ 4RW4A 4JI0F 1FJCA 2W9CA 1GXTA 4BG8A 1FKPA 4G1IA 1NJIT 4ZPWR 1SJ3P 3K8WA 2E5GA 3HVTA 4ISEA 1HUXA 2NXJA 1MW7A 3ZYYX 4FZYA 3BKFA 4KREA 1X8DA 4KE5A 5JJBA 2W9AA 1KR4A 3LM9A 1S1TA 1F5BA 2MKCA 1UAXA 3UWTA 3A8EA 2ZD1B 4K59A 3D6HB 1FDNA 3ZZUA 4B3TF 4DCHA 1T05A 2GO8A 4KHUA 4RPFA 3R3TA 4N8OA 2VG5A 3IXQA 5B0EA 4YB6A 4DR2K 5LJ3Y 4AF1A 2RRAA 3OD2A 4PXEA 1S1WA 4AILC 1WEYA 5AE1A 2NZTA 4JYAF 3MEKA 4OVLA 3V1QA 4PKHA 2V8DA 3CJRA 4QS9A 1Y97A 2IRXA 4CEAA 1BQMA 2N4CA 1RHKB 1QM9A 4NO7A 4C8LA 2OPQB 2IMWP 3MN5A 3GOIA 3ZZZA 2UXDK 3WDOA 2SXLA 4O3PA 4YUDA 2UXCK 4W90B 2QK9A 3V4IB 4FF1A 2H4WB 5C25A 2RQCA 3GV5B 1E4FT 4DL4A 1H2UX 1S9GA 2CPYA 1C0TB 4LF7J 2VL1A 3SQ4A 3AVNA 5ADZA 1YZ6A 3KK1A 4X62J 5AQRA 5D3GB 3TARA 4C2MA 1SVDA 5DGBA 1HMVA 2B4UA 5KG6A 3DM2B 2W01A 2VB6A 5FDLA 1YX2A 4FXVA 3EUNA 1PAUB 3UCZP 3KDOA 2ZJRL 2VQFK 4ED5A 1E6YB 1BDGA 5GAHI 1ROFA 3QMQA 3ZTRA 2RF2B 1VQMS 4PYAA 2VA2A 3VQQA 1S10A 4TN2A 3UNGC 1XHXA 2PFUA 3CJ9A 5M1NA 3KLHB 1E3MA 3OFGA 4PQUB 2NQPA 3WC0A 5CHIA 2MKHA 2CZ4A 1M1KO 4KB1A 2AW0A 3TZWA 4DV6F 2AT1B 1ZM3A 2PY5A 1WTFA 1NK4A 2I6WA 4JOUA 3ZZTA 5C2FA 5J1EB 3A5LC 1MMDA 4CK3A 5GAEP 3JXUA 2V2KA 5EUHA 1U02A 2HKEA 4CZHA 2IAJB 1RWKB 4EIAA 3VQ8A 1RT5A 5KFOA 3IGVA 4YDDB 3MFHA 3HPOA 2MJUA 2Z2MA 3D0GE 1FVSA 4ZVEA 5A8KA 4ECYA 2BM0A 1VIXA 4CLYA 4TY8A 1Z05A 1WI6A 4GKJK 4DQIA 5IXUA 2X3GA 3EDQB 2WSFC 1VQLN 5AQWA 1CQMA 3MCNA 3ZT4A 4YQWA 1WF2A 3NEKA 3VHQA 2Y0BB 1IJJA 3I0RA 3MEDB 2V63A 2XGQA 3PDNA 1X5SA 1M90T 2OMLA 2E4LA 4ZVPB 4YR0A 4CK1A 4HLBA 4FNIA 1HBMB 5FPDA 4IOBA 2KU7A 3DMJA 4OHZA 2XYPB 3R5JB 1FEEA 4R8UA 2DH7A 4M5KA 1YVUA 2DR5A 3G8SA 3PJWA 5E5NA 1JLBA 1RAOA 1GLEG 4BR7A 4KGXB 5BR8F 2CQIA 1WNSA 4IFYA 2DYAA 5IQQA 4USTA 3KKFA 2XMJA 4HHHA 4RNHA 4CJPA 3DOLB 4H5TA 1N6QB 4NX9A 3QEWA 3T5LA 3S6EA 3LANA 3L2RA 3C6AA 2WBNA 4ID5A 3CIZA 3CCSN 4O23A 2OMOA 5IT9O 5D6GA 2KT3A 2KDOA 2W2QP 3QINA 3ISNC 4OX9K 2PYLA 4ZPDA 4F26A 2DGVA 1XC9A 4K4WA 2H54B 2A1SA 3I87A 4P2FA 5HLFB 2V9WA 4YHHK 4R0JA 4USKA 3Q22A 4KHPF 1KFDA 2KZZA 3CQYA 1Y10A 3KLGA 2LFVA 2QX0A 3M6VA 4O8UA 1C0FA 2EFGA 4CJVA 3I96A 2XC9A 3JTNA 1ZAXA 2MTLA 4PG5A 1YTYA 2NXNA 2HHWA 1E6VB 3WXLA 3M6GA 4ANCA 4PABA 4ED1A 1NDPA 1ZBSA 3P45B 1RTDB 5H9FK 5BJRA 3QAUA 1T9XA 5KFNA 4DHYA 2OPSB 3P39A 2OA8A 3IWNC 2XY8A 3BZKA 2FJWA 5KFPA 4CLFA 5KG4A 2RQ4A 3VZIA 1ACMB 2JGUA 2V2QA 2G4BA 1Y5IB 5BR8K 3P4UB 1Q8KA 1FJGF 1F3VA 3UKUA 1Y9OA 2VG6A 1UFLA 1KQFB 4OHWA 1R27B 1QTMA 4FJNA 3D6TB 2GQQA 4F3TA 4K4VA 1EKRA 1Y5LB 3HVWA 2A6OA 3QRRA 3N4PA 4IRDA 3KUHA 3O3HA 2ZEJA 1RTIA 1QHAA 1RP5A 4DN9A 4DR7K 2FGOA 2XMMA 3TRGA 3P8BB 3K9JA 4LF5J 2BABA 2VPXB 3ZZOA 4WXOA 4JI5F 1U2VA 2EG2A 4BVPA 1E4GT 2J7WA 1FT8A 2JVOA 1KD1O 3DRSB 1XNRK 3IMQJ 2YWGA 5D15A 4DSJA 2WW4A 1H2VZ 4QR1A 1FXRA 2D9PA 1TK8A 3TJ8A 4OZJA 1KVIA 2HNYB 4CFCA 3FE1A 4LSZB 1SJRA 1S12A 3DFEA 3AD8C 2XNRA 4KC5A 2V94A 1K8KA 1RDBA 3L3UA 4O4GA 4W4MA 2GNKA 3H59A 3SZ2A 2XMVA 4EYIB 3R1LA 3OSNA 1KC8T 3SEOA 3R8EA 1VQ7S 1YI2N 4R0EA 4DSLA 2FQQB 2MLYA 3TTFA 5FRMA 3OTOK 2N7CA 3QIOA 4FWSA 4ZVUB 3JTOA 3WC2A 4TU9A 4ZJLA 4A48A 5E2QA 5FPMA 1HBNB 1GX6A 4IRCA 2YX7A 4A8XA 3D2EB 5D0HA 3M8QB 2JNJA 4FLUA 2F7VA 2BYCA 2UXBK 1VQ9N 4BRMA 4J9UE 5CZXA 4KHPK 1S77D 4DR7J 5C15A 3U7JA 4DV7J 1OH6A 2R7VA 2DPJA 4DV5F 3HYFA 5HI7A 2A0FB 3V2UC 4Y2CA 4JI6F 2M5YA 1XC3A 3MMBB 4JEPA 5C2GA 1OPIA 3NL0A 4DUYK 2D0BA 3ZFVA 5BRFA 2O8BB 1TL3A 2JWLA 4FS1A 3C65A 2QA4N 1SJQA 3V6DB 2P9IB 2R2RA 4AHSA 3SJJA 2HFOA 2Y8WA 4F04B 4OV6A 1TYQA 5GAGU 3SUPA 3VQ9A 4G1QA 1FFSB 2QMXA 1CBKA 2QC3A 4AL7A 1GXUA 3OJUA 4PKIA 3KZBA 3DLLL 3D3BJ 2HPUA 3DM2A 1NK8A 3VA3A 3C8YA 2AHOB 5HRSA 4USHA 4ILGB 5IS2A 1B0PA 3KK1B 5D0RA 5B0AA 2EHGA 2JEFA 4DR3K 3BGRB 3ETOA 4HTJA 4QWAA 5AQIA 1IO2A 3MM5A 3L4BC 1PILA 2YNFA 3JAMY 2QLFB 5AQTA 2YNGA 3K57A 4O55A 5C25B 1TAUA 2NZ4A 2J7KA 5LT5A 1NGAA 4UOGA 3V1RA 1J5OA 4Y2KA 3TAQA 1U0HA 1O1WA 3TAGA 4LF9F 1GOCA 3QRPA 4ZVRB 4GKKF 5KPRA 3R1HA 2OTJN 2QFJA 3OUYA 1VAZA 3AOCA 1W26A 2D0OA 1U1MA 4WTYA 2QMUB 1RDRA 2B43A 3K5LA 1BCOA 4LF4K 3NH1A 2ZBRA 4DV0F 2HVHA 1EHWA 3TX0A 2YNFB 1HNZJ 2FJEB 4Y0FA 3LDOA 1YBUA 4ZIWA 4WE1B 3Q2SC 2O8EA 1JLFB 2YY3A 4QOZB 2KFYA 2QE5A 2POKA 1YVNA 3NH2A 1XN9A 2H9ZA 2WONA 4H4MA 4DX8H 4CJEA 2HVEA 4URSA 4K4TA 2DGQA 2HS0A 2ZNZA 1LW0B 5BXIA 3ZTPA 1R59O 2I2YA 5D8HB 4OI3A 4QWDA 2R3VA 3L6QA 2VQEJ 4URQU 3VQCA 2Z1GA 4OX9J 5HQMA 4Y1CA 4DU1A 3RGIA 3G0ZA 4AM6A 2HNDB 3AAWB 2CQCA 1BA1A 5AXMA 3H2VE 2KN4A 1RHQB 5KPTA 4XH1A 1U26A 3TVZA 2VV5A 3C19A 3EZUA 3MM6B 1YIJS 3DGPA 1EQMA 1N32J 4NA2A 2DXFA 1J5EK 1K8AT 4PL7A 2X3DA 3MM7B 4DSFA 3CCJS 3AVJA 3MMCB 2HHTA 3HKWA 3SPYA 1WG5A 5TKYA 3AH6A 3DRRB 3OYEA 3V9ZA 1KOHA 1TKXB 5KGXA 4I6YA 2RMLA 1T6CA 2RS8A 2ASDA 5GAEU 3U3YA 3CPWM 4M5GA 1UFKA 4NLPA 2R2TA 3CJ3A 1WOPA 1HKCA 2HB5A 1YBAA 2HWHA 1Q86O 1HBOB 1S59A 4K41A 4ZVSB 4CGDA 5BRDA 2XBPA 3PCOB 3GMGA 5HROB 2P9CA 3TEGA 3FMBA 1U49A 3EVWA 4F4KA 2D0AA 5IT0A 4FLYA 4DXLA 1TKDA 4LSLB 3WIUA 2ZH1A 3N5BA 3KVGA 3HP6A 3MD1A 4KV8A 3UN2A 1DTQB 3UN3A 4M3TA 3MR7A 3LWMA 4E7JA 1N5TA 3CNQP 3CEDA 4AQYJ 3L4QA 3WEEB 2Q6CA 4HUFA 1QSSA 1OYEA 2MGZB 3NY0A 2WTUA 4BCAA 2CG4A 5C10A 4CEQA 4Y2MA 2MEWA 2VFRA 4GVEA 1RT1A 3ZNJ1 3L9ZA 1VQNS 4F3QA 1C4CA 4ELVA 1ZH5A 4KSEB 5AQKA 1HWLA 1GEHA 1NB7A 2BANA 2W4DA 4X4TA 3GSIA 1UCNA 1ZC6A 3P38A 2XI3A 4BC9A 1JQGA 1T9TA 3VQ5A 2R8GA 3SAHA 3FDSA 3UKUB 2L9WA 1HWIA 1A6LA 2W4PA 4NL5A 1LWCA 3CW2C 4DR1F 3Q7CA 1T8EA 3AVBA 3VZHA 1VQ8N 1J53A 3CC4N 1X4EA 4JI2K 3CFRA 3V9WA 3A8YA 1REVB 4B3MF 2KRBA 3FEZA 3MURP 2P9EA 3SDEB 2PE8A 2K1RA 5J1NA 2ITMA 2IPOB 5JLFA 2XO6A 3CJ2A 4E0DA 2XRIA 2PT0A 4URGA 1E6VA 3QGIA 1FD8A 3SIPB 3N28A 4B9UA 4IG0A 1CG2A 5D4PA 1D09B 3J81Y 2OAUA 3SMZA 4ECZA 4RG8A 4CHOA 4I7FB 2WVEA 1N36F 2HNYA 4K2JA 3VEVA 3OYKA 1YJNN 4UOFA 2A2DA 4KB7A 3HD1A 3M6WA 3H1QA 3NCPA 3T6JA 1U09A 3BY5A 1GMVA 4TXSA 1VHXA 4ZPVR 6FD1A 2AJQA 5I9EB 5IT4A 5T14A 4KGKA 1FKOA 1R43A 1TMMA 1UFWA 2BUNA 2HBMA 1I1GA 1RDDA 3IS9A 1IQZA 2DGOA 3KDNA 2HHSA 5LSOA 1GLJO 2IS3A 2QWMA 1ZZFA 5BPMA 2BE7D 5ETMA 4CGIA 3T1YF 3CCMS 3MPWA 2YWHA 2RQKA 1UZDA 3ET6A 1HNXJ 4P10A 3KOAA 5L9NA 1S4FA 2W25A 4DHVA 3D6RA 5FLXU 5CHCB 4KBIA 4AUKA 3VQ6A 4DTUA 1T3OA 4CJQA 1N5VA 1QHTA 4EU0A 4MKBA 4MMOA 2FLPA 4PAAA 3HSCA 4X66K 2YKAA 4LH4A 3PSFA 1XNRJ 1VR6A 1DQ8A 3A8IA 2GO9A 2YWFA 2ROGA 2UP1A 5GAHP 3SCIE 2ZZNA 1I94F 3HI0A 2VZ9A 2CIMA 4CZFA 1WDTA 1C1BA 4CNZA 3DMJB 4J2DA 4IG0B 4YOTA 2OP5A 3EJMA 2CGKA 1O6XA 3SDEA 2ZHOA 4M94A 1UTAA 3EZWA 2ACMA 4KIAA 3KWMA 1LV5A 4F3OA 3QDKA 4USJC 2ZH7A 4WJBA 4G9ZA 1MN7A 4L6V3 2J9DE 1D5AA 4FYXB 4M5JA 5IQ6A 2DGUA 3MECB 3RUBL 1HWJA 3K5NA 2E7VA 2E5IA 3PW2A 3A5NC 2C2ZB 3THYB 2LEPA 3AY0A 4X65F 2XHBA 4CF0A 3TA1A 5B0FA 2XO7A 3S3OA 3HTVA 5LMUK 2PGCA 3L4IA 3MEGB 3OL6A 3OYGA 4A59A 3KLIA 3IRWP 2ACYA 2BANB 3HX9A 4ID5B 3ZZYA 2Z58B 1RT4A 2GAGC 3ATVA 3CDEA 3FBFA 2BQ3A 4I1TA 4ZVTB 2HLTA 1JJ4A 4W92B 1B99A 1S1UA 3VAIA 4FK0A 2HHXA 4ZKAA 4ELUA 1T94A 4B3MK 1GK8A 5KFWA 2HURA 3D67A 2RT3A 3NVKA 2R7SA 1NXIA 3WNEA 2Q0RA 4FWPA 3IM8A 5HRPA 3NBPA 3KHRA 1S99A 2EFQA 4FVMA 1VQOS 5LOQA 4IWVA 2HZAA 4C8OA 3IWLA 3GYGA 4DLEA 5KFFA 1Q1KA 1SCJB 3K58A 3R3LA 4LRCA 2A2CA 4Q0BB 1GT8A 1WSRA 4N5SA 4F0HA 1TFYA 5BREA 3HO1A 2DPIA 2FPHX 3EM1A 4Q45A 5IWAJ 3T69A 1R31A 4J9MA 1OPZA 3BPDA 4DMNA 4DWIA 3QSYB 4BC5A 1NM1A 3ID8A 3M8WA 3V6HA 4MO4A 1S6PB 3HSZA 2IGIA 3CERA 4OZ5A 5A8KB 1VS3A 4O4RA 4KH5A 4FJLA 2D0PA 4JKGB 3J81j 3MM7A 4RW7B 1WOOA 4CO5A 4N76A 3IFEA 1VSLA 2HQ3A 3ISND 4HVJA 3R97A 3BQ0A 4B3TK 9ATCB 1CPZA 3DXBA 4PXCA 4NZ6A 3A5MC 4QU6A 4YB5A 1VQON 5E3CA 4JV1A 3NKYA 2YQ1A 4DS4A 4L73A 5HN0A 4O3SA 2YXLA 4MLHA 3P5JA 5I3QA 2XWYA 3CIPA 4PQUA 3KLHA 4K0KF 2ZJQQ 4ID1A 4H0TB 1S97A 3W62A 1RBSA 3MPYA 3CM6A 3N9UC 3M5RA 1JLAB 2DXDA 4B3MJ 4BRCA 1ATSA 1SBRA 1XNQF 2CQ3A 1JLEA 5KG1A 4BG9A 2YKPA 2NLXA 4CIFA 2W2NP 3AY9A 4DR7F 4H4MB 1TFWA 2D69A 3ISZA 5JUMA 2VWJA 1J5EF 1VHFA 5HK4A 3ADAC 3O1BA 2YHAA 4O5BA 2I7NA 2O8EB 1SC6A 2XYGB 3VN5A 2XS7A 3LZJA 3KHGA 2J6SA 5C5JA 1SL1A 3ZT1A 1KWMA 3V4IA 4K4UA 1XUPO 2GBZA 4B9LA 1V5IB 4J90A 4ETXA 3EYZA 5LJVA 5LSLA 3T7ZA 3M3ZA 1C1BB 3B6OA 3RMAA 3PJ9A 2P9SA 2W41A 4IOCL 4M5DA 1P1LA 2HK3A 4Z4FA 3R1XA 4FPBA 2VQFF 3IAS9 2G8IA 2M2BA 1XNRF 1WKLA 3SLCA 2KZMA 2WC9A 4G6VB 4FWNA 4ZN3A 4JI3J 2MZTA 2WTFA 2E1MC 2IMOA 4ED4A 1T9VA 4B1XB 4OQJA 1HNWJ 3KLEB 1FRKA 4MK7A 2DGSA 4Z2XA 1ASUA 3PJXA 2GAHC 2ZHAA 1K73O 2FJXA 3GJQB 3QIPB 3AJ1A 3LPUA 2B8QA 3PIPQ 1CLQA 5K8NA 4OZ1A 3TEHB 1LW2A 3H4BA 1RISA 3SAFA 4IXCA 2V67A 4X4OA 4EAHD 2CG8A 4JKHA 3HPGA 2UUWA 3KTQA 1WACA 2MKIA 1G15A 1BA0A 3SUNA 3DXMA 2ZBIA 2NRZA 2P6SA 4QIVA 2W6LA 3OXFA 1GMUA 1KNZA 1RBLA 2N3OA 2NLWA 4JBCA 1U25A 4CBUA 3GJRB 4B08A 4FBTA 3CCQS 1HHTP 4NWBA 1RAFB 2P9KB 1NJYA 4M42A 1WI8A 4CTAB 5EWFA 3K2PA 5DM7Q 1LK5A 2X7IA 4B9NA 1TZ0A 3CCES 2Z1JA 2GMJA 4K7QA 3MOZA 4DPYA 2G9OA 2HWIA 1XMQF 3K9KA 2RKIB 2Q0UA 4ECUA 5BPNA 1WHYA 1QZ6A 1HW8A 1NOZA 1JJHA 2VPZB 1S3XA 3MMAA 2O8FA 3TU5A 3ZSQA 1F60B 2NSBA 3JXOA 2XI2A 1YK9A 4DUYF 2ALYB 5KOWA 1APSA 3KK3A 1PO6A 3OYLA 2PFFB 2OEMA 1EXQA 1U1KA 3F56A 4RW9B 3FBEA 4DV0J 2CPDA 3ZXWA 3CPWR 3PX4A 3EGWB 1BY9A 3NRBA 4EK2A 3CCUN 3HZEA 3TSQA 2RJZA 2JEIA 1L3VA 4KPYA 3SJHA 3MR2A 3VV2B 1WF1A 4DR6F 4HKQA 2QMWA 2FSKA 1UP1A 2AP6A 4JI4J 4Z4IA 4FF2A 2HFVA 5AQOA 2E2QA 4A8MP 3HJVA 1FDBA 3TVYA 3PYEA 2A3JA 3VQDA 1ZM2A 2D5RA 1VC0A 4ZTJA 4CZJA 1VQKS 1NHKL 1RHMB 2K7JA 2R7WA 1NGEA 2FHMA 4A62A 2MDAA 2JL9A 3QT6A 4H4KC 1UW9A 1YJNS 5KFJA 1HBOA 2OD4A 3CD6N 2HSEB 1LQ9A 4IH5A 5DLFA 5K20B 2E5LJ 4FYYB 3GONA 1V4SA 2CQHA 4DQPA 2QSWA 4P72A 2HBJA 2IA6A 5HMXA 1K1QA 4YDUA 5L1IA 4MT1A 2QA2A 2V5HG 4E1MA 2IM2A 1RHRB 2QRRA 4CIEA 4K0KJ 5JMNA 3M30A 2AEMA 1N34K 2QTDA 4JKDA 2DXEA 4AXJA 3K59A 2JOQA 3A3NB 3MM6A 1Q7YT 4FF3A 1LFPA 1XHZA 3GZ7A 3IDHA 1SKRA 4CT8A 3LGMA 3QPIA 2FBTA 3ULHA 2O8DA 2FZGB 1UWBB 1R0AA 2G13A 3O4WA 3B82A 3MDFA 3OLAA 1KCFA 2X1GA 3CJCA 2HVDA 3LP0B 4ITSA 4UOHA 4OYZA 2VFTA 4OI6A 4IZ9A 1RA6A 4EGLA 4Q44A 3ZTQA 1QS4A 5DDQC 5F41A 3T19A 3HHLA 2HFZA 1Z2LA 5AQYA 3A3OB 2QLXA 4ANEA 1EAYC 3CPEA 3L7OA 3PZPA 5DDRC 2W40A 5KFKA 1Q82O 4ZLNA 2QA1A 4B1ZA 3P5BP 4J9QA 2AJ2A 1WTBA 3IFRA 3CJ0A 3THWB 3FGUA 2GELA 2GTDA 1WDDA 2IJFA 4DMZA 1VSFA 4RO0A 3NF8A 2HHHJ 2HF3A 3B78A 3CJKB 1M1GA 4NCGA 4FW1A 2EBGA 2HQDA 1X9WA 4P74A 3HF5A 3EO3A 4F25A 4IRKA 1HJRA 1X4BA 1UJ4A 4L74A 3LPYA 5EX5A 5JMVA 5AQSA 1EKEA 1S72S 2WOMA 3ILOA 4KGMA 1VC5A 4CH0S 1Q9YA 2DB1A 4OIXA 4A2BA 4JYAJ 4OV1A 1R7IA 2C1EB 2FD2A 1S22A 4F7VA 2CPJA 3I9ZA 3GSDA 2IM1A 2GIRA 4CJLA 4F4AA 4DU8A 4I2PB 3O6QA 2JFDA 5F0UA 4CFDA 4OZNA 2CKWA 1MSWD 1SKUB 5LMNK 2QWPA 4CEEA 1VOMA 2WBMA 2UU9F 3RRHA 1RU1A 2XMAA 1RTZA 1LXNA 1N56A 1TL3B 1W2IA 1MWMA 3F2KA 5HO4A 3JQMA 3G6VA 2F9JA 1RT4B 4OJGA 5KFYA 4DCOB 1FE0A 4K4SA 2DRBA 2QO3A 3KK2A 1Q7YO 3HLUA 4J9RA 5M1QA 4B3RJ 1HRHA 3QT8A 1U8WA 2BJEA 5ETLA 2J4RA 3GTYX 4JKBA 2ZH9A 3ZX2A 1AXQA 4JI3F 3C16A 3MWPA 3BV8A 3QB0A 2HBZB 2MQ8A 3HZGA 2LQ5A 3Q24A 4JD2B 3NAHA 4PG7A 1S9GB 4CM2A 3OTEA 3EX7B 4LFAK 3LL3A 1TUVA 3FFIB 4DZ6A 1HKAA 4NLYA 3T1YJ 4LH5A 4ELTA 3UB5A 2HNZA 4NYZA 1YJWS 3UCUP 3CE8A 4ED2A 4U8YA 2CAJA 2OEKA 3QSIA 3VF4A 4RWTA 1MDUB 5CD4A 5BYRA 2W2PP 3FQKA 2UUAJ 1JWWA 2J0WA 2KFZA 3TR8A 2D3O1 5DK5A 2HIYA 2ZWOA 3QEPA 2YKMB 4NLGA 3OBWA 3NXZA 2FSJA 4PXDA 2KHCA 1KD1T 1RU2A 3GG1A 2PAVA 3EL2A 3F44A 1BUXA 1S1UB 4IUFA 1FA0A 2IYIA 2HRTA 1NGDA 3O9UA 4OYIA 3PIOQ 1F1BB 2LSNA 3CJ8A 4C8YA 4JI7F 2VASA 1TK5A 3CJ1A 3ZNUA 2VQEF 3NCIA 3ET6B 5KFVA 3AAPA 1SS6A 1UA0A 2BJ9A 4EUVA 2L41A 4J9OA 2LDIA 2BE2A 3E01B 3OYCA 4NA3A 1BO5O 3UKRA 2YJEA 2VG6B 2HSTA 4C3KA 1VSKA 1U2RA 3IM9A 5LJWA 4MLEA 1KVKA 1S0VA 1MROA 5A8WA 1UOCA 3F41A 2OPSA 1QTNB 4DQQA 1KVJA 4C4WA 1RTDA 3TTDA 3DLLQ 1RWMB 4WZQA 2E8AA 2GV1A 1B9DA 2NXEA 4U96A 1L3KA 1DZ5A 3LOUA 3VQEA 4YB1P 5AQXA 3FCWA 3SQGB 4R79A 5K9FA 1HD1A 4C23A 4ATNA 4OKJA 2Y0SD 4X65K 1NKCA 2UVUA 1EX8A 2V6AA 3CM5A 3A13A 2BJ8A 1LWCB 1JCEA 2XY6A 2FZCB 1S1XA 3PEHA 4WFAL 1F3FA 1DT9A 4UW2A 2VOPA 2GWKA 4CHNA 3FGVA 1IH7A 2D0CA 2Q1NA 2W7PA 3MCOA 2XY7A 3RB0A 3CJSA 1CULA 4FN5A 3J80Y 1XMOJ 1NM2A 5AJ3K 2DKOB 3HVRA 1IG8A 3D2FB 1BUPA 1HI1A 2DCLA 4O5FA 1S6QA 2BR0A 1B7FA 4DTJA 2LA6A 3CCWA 4GV3A 1ZYQA 1WBDA 1LWFA 3IS9B 3IP0A 2K8GA 4XH5A 2KTQA 1TR0A 5H1SV 5GIOA 1S7HA 2MQPA 1RI7A 2J0XA 2E20A 2AU0A 3PRVA 3RRGA 1S1VB 3OPKA 1WC4A 4OO1J 1JLCA 3G71S 4LVOP 3TUJC 3R9LA 2LKZA 2CQGA 3DWLA 1ZAVA 1IBLJ 4HCCA 2XHWA 2F4VJ 4U95A 4ILMA 3PFOA 1JKHA 2QTWA 2YH0A 2QI2A 5ETQA 4FDFA 3NAEA 1WG1A 2XZTB 3SQ2A 2R4FA 2HHVA 3DOMB 5KFGA 2BJ7A 5KT4A 3GIKA 2IVOA 2QIFA 5KGWA 2B3TB 3TA0A 4N41A 1JCFA 1RHUB 3BGOP 1AUDA 1U7LA 3W5ZA 1EP4A 4KR0B 4DV3J 3AOBA 5E7OB 2GX9A 1YJWN 1H3DA 1D3WA 1FFWB 4P7TA 3OYDA 4I6MB 1WC0A 4TY8B 3X3UA 2DBBA 4WU3A 1C1AA 2RRBA 4AL5A 3NOCA 2JZ5A 4B9TA 1RT5B 3LTOA 3NGZA 2DO4A 4D3GA 4EEYA 2O67A 1OSDA 3OFHA 4WYWA 4BC2A 2JLGA 2C2NA 3LDLA 4ECRA 4QQBA 4J9KA 2XLIA 1PIEA 1PJ7A 1GLDG 1D9AA 1Y0HA 4F4WA 3BP8A 4WK1A 1CS4A 3DHWC 1S5ZA 5AFUA 1HR0J 4DBQA 4FXDA 3M8PA 1IM4A 4N8NA 5HANA 3ZO7A 2KLAA 4BRAA 1U1QA 1QQMA 1FJGK 1AROP 3NS7B 5KAKA 3S7RA 3HVAA 3SV3A 4MDBA 1Y11A 2RF2A 3GDQA 1T95A 4RU9A 4B9MA 2HQCA 4OLOA 1VSMA 1TVRB 2J9CA 5L9XA 2J0SD 3HFZB 1VLYA 3Q8RB 2VD3A 3A8KA 1A7GE 1ULRA 4QYRA 3EDRB 2YKNA 5F8JA 3S3NA 3C15B 2MKJA 1WHVA 4GW6A 1IBLK 4M7XA 2AJ4A 2KYZA 5KFUA 1NSPA 1NPRA 1CJTB 1FXLA 3CC7N 2H51B 5AQHA 2VUGA 4BRKA 1U04A 5HAOA 2I0XA 4EHUA 1HPMA 1RADB 3TQEA 1HWKA 4CJ4A 2WVBA 1XK8A 2MB0B 1YITN 3NF9A 4WIIA 2HVIA 3TPQA 2AYBA 1FNOA 2O4GA 4ENOA 3TW0A 4M3RA 3MM5B 3R2DJ 2ZZTA 3VGTA 5LSRA 4DCPB 1W97L 3RYLA 2B5JB 3CF5L 1HARA 3MMJA 4EBDA 2IVPA 4WFZA 2J6TA 1KQSM 2E44A 1T05B 3VAMA 5CYMB 4AE5A 2HNDA 1TL7A 4RW6A 2P2CB 2B6AA 1K9MT 4WCEQ 3VF6A 2ZE2A 4JK7A 4UY8O 1I3AA 4NMLA 2OPPA 2HBLA 2P9IA 2QWRA 5E3RA 1HNVA 3UFCX 2ZM6J 2C2DA 4CEBA 1LW0A 4L75A 2VDIA 2HGNA 2IDEA 4DL7A 2VG7B 5M1FA 2M8DB 4B9QA 3PX0A 1GLLO 4MKVA 2ZC3A 1V5VA 3UVJA 5RUBA 3ZTOA 1C0GA 3HSDA 3NGDA 1J2VA 2R7XA 4KGZB 5BYSA 1B92A 3VQSA 1QQOA 3SV4A 2AYMA 2ABYA 3GFXA 1CJUB 3M8QA 4GVMA 4OYMA 2H3GX 4NXNF 3FSXA 4DPWA 2B4OA 3CJBA 1RQ0A 3MUMP 4KI4A 3I8BA 3AO4A 3J7AP 1DARA 4YORA 4DUZJ 4YOXA 3DLHA 1YVFA 3CCLS 4ZPAA 1EQYA 1Q9XA 3D0PA 3W0LA 2F7TA 1WJ9A 2A1BA 3AVGA 3ENWA 1KTQA 3MWBA 3Q8YA 3AGRA 2MQLA 1FWKA 2OELA 4DV1F 4OPAA 1IKYA 2LEAA 1ASVA 4W5TA 4BR0A 1DRZA 4RNFA 3G4SN 1N8RT 1RFQA 1ZA2B 4JI8F 4F2RA 4BRDA 2W1BA 4Y3CA 3ZT0A 5A6WA 1X0PA 2Z4PA 1HYVA 4FOIA 3VAJA 2ZBCA 2A6AA 3T6BA 3BO4A 2DEJA 4N47A 1TMJA 2L3MA 1HPZA 2XMTA 4C9DA 3MAHA 3HXMA 4J5OA 4QW8A 1NHVA 4NYPA 2BTFA 4DTRA 2XB2D 5HBMB 2QYCA 3ZX3A 4FS2A 4QIFA 1Z4UA 3U1NA 4DFMA 4M45A 1CJKB 1IQTA 3FMWA 1S48A 2NREA 2VF3A 4MH8A 3MPDA 3I0SA 3OLBA 4Y2IA 1U6BA 2MZ1A 2R7TA 2HWTA 2J6UA 2N7YA 3EICA 3CCMN 4UZBA 2FIUA 4JI6J 2ZVIA 4DR3J 4Y1DA 3W5XA 5AQQA 3UVJB 2MSTA 1VRUA 4M95A 4LR9A 1BGXT 2HEKA 4DLGA 1ZA1B 5K8MA 5KFXA 1FRLA 2Z1HA 2UVVA 4RUHA 3KMSA 3FZKA 4JI5J 1HBUB 3M4XA 1K73T 2YCHA 4NLTA 4J9SA 4ECTA 4HUGA 4WWSA 1NSQA 3L2QA 4OJRA 4RW6B 1HD0A 1TL7B 2IC3B 4ZK7M 2Y1LB 4OYWA 1X4CA 2Q1LA 1BOTO 2AJ0A 3K0SA 2MJNA 3OW2R 2B5JA 1B64A 4G3IA 3WT0A 1FXDA 2HLUA 5LMUJ 2DHXA 3HM9A 4PHTX 2CYYA 4A46A 3AB2B 3CQ8A 1WAJA 1UVIA 1UJ5A 1F21A 4ECXA 3D66A 5J2PB 3PEJA 3FZMA 1B0TA 2IFXA 3ULEA 1DJ0A 1X5PA 3RZAA 4JS5A 4GVLA 4KKOA 3NHGA 5IM0B 1OSCA 4DV4K 4C11B 4H4KA 3FK4A 3CDUA 1BHLA 4LF6F 3TZYA 4F02A 3SBGA 3THWA 4P71A 3DLEB 2QJ3A 2V8HA 3C15A 1KP6A 3U27A 5SZTA 1MLAA 4OI0A 4H0OA 3CCSS 3JTPA 3SQ0A 3HSJA 1MWKA 1HNXK 3MI7X 3I5BA 4JB8B 1X0FA 3OSPA 2QN6B 3CCQN 4KHNA 3D1HA 3BZCA 4BC7A 3VR1A 2MZRA 2BVZA 3NNAA 1U8SA 1RAEB 2OPPB 2CQ2A 2HFUA 2PBDA 3ILLA 2E5JA 2ZWPA 3H5SA 3AARA 3ENAA 2RU3A 1Q53A 3G6XA 2FVSA 2K1RB 2ROEA 1FFGB 3IR5B 4B1VA 4QPXA 2WW8A 1Z2ZA 5AJ3J 2ITGA 1FWLA 2VICA 1GLAG 2BXJA 1HWUA 1WD6A 3WZ0A 3MEDA 3BDEA 2C2KB 2LLZA 3NMRA 1R0CB 5JS1A 3MR5A 2E7XA 5KFMA 4J8FA 5CY4A 3N0VA 2FC8A 2E9ZA 5L39A 1Q81T 4PRFA 4DR4K 3HHNB 3VEYA 1KKHA 4K42A 3PX6A 2KQ2A 4I69A 4GY2B 2E2NA 1KXPA 5LY3A 3AFGA 1IN0A 3JS6A 4HL9A 2VKZG 2CZ9A 4P7VA 3C66A 1VISA 2BDPA 2CPHA 2A5XA 3R6MA 2ZFHA 1UVLA 3AGKA 3FKBA 2BV3A 1HQEB 3DKDA 1R8AA 2EFVA 5J1EA 2D1KA 3VF2A 5H9EK 1U1NA 2LQ8A 1RK8A 1XIQA 3OYIA 3CO0P 2VFVA 1UVKA 2UXDJ 2X51A 1NK7A 4JV5J 3VQAA 1NDKA 7FD1A 2PI4A 3VEWA 3DOMA 4JI2F 2H4YB 2F3JA 2V2ZA 5KG7A 2CQ4A 4JHDB 4WFNL 4DV4F 5AXLA 3SBTA 1JIHA 1FX4A 2J5AA 2QEXS 2NRWA 4WFYA 5FIIA 3MN7A 3EN9A 2RS2A 3SQOP 1AZSB 4CJ5A 2BA9A 4RWXA 1E6YA 1MN9A 5E33A 3CHWA 1R8BA 4DUTA 1NLVA 1PSDA 1FEHA 4PWUA 2G0JA 1TVRA 3AO5A 4KV8B 2XMWA 2FC0A 2OTLN 1VGYA 1GQEA 3ZSWA 1KOOA 2LQJA 3CCTA 4LSLA 5F8GA 3CFOA 3KJVB 4MTPA 4OYPA 2P9NB 1UW4A 3CFPA 2A1RA 4U6PA 4IEIA 3H4DA 2J9EA 3ZC4A 2OJ3A 2MQOA 3VAGA 2YKOA 5AQNA 1KQSR 1C0TA 4U67Q 3I55S 1NJWA 5GMDA 3AVLA 2UU9J 1GOAA 1NJIO 2RH3A 1WKJA 3VAKA 3B6PA 3I31A 4H4OB 1Z6RA 3MCPA 3DJCA 2GGPB 1RWOB 2G8HA 4BR4A 1Q82T 5E3QA 2F4VF 3O2IA 3BM7A 1HQEA 4G1PA 2MY8A 2VIHA 2DFFA 1CULB 5F8LA 3LQVA 3VESA 5CZ2A 3IGNA 3KKSA 4LF8K 4O0IA 1NJZA 3HP9A 2OTJS 4CHQA 2K7KA 1NU4A 5GAGI 2DGXA 1Q7LB 2MZQA 1SIWB 4J91A 4FK4A 2QWLA 1YDLA 3ICLA 4UUXA 3U9DA 2UUBK 4F67A 5ITHA 4IKFA 1S0NA 3JSBA 3GV7B 2BW2A 2OTLS 3UI3A 3I5AA 5LXRA 4CF9A 4KY3A 3W2VB 3HFKA 3OR1B 4IJAA 3M1FA 3VGLA 4NXNJ 2O1PA 4OL8A 4NI2A 3N79A 1HI0P 3A3PB 4KBOA 2ATQA 3M9MB 4QOTA 4GMKA 3NMAA 1RWXB 1PCAA 3DDKA 4EP5A 2BJ1A 4NRTA 1B3TA 3W2WA 1R6YA 2C2RA 4RBTA 2CPIA 1NAQA 4KAIA 1YITS 3O9QA 4FYWB 4WE1A 3CTRA 4DR4F 2DNKA 3TZXA 3N5FA 2B51A 5K14A 2V4JA 3LZIA 1I6JA 4J37A 4LY7A 2Y1IA 3WXMB 1OY9A 4RTFD 3GCWP 4ZVQB 1YJ7A 3OUYB 3VMFB 4MKYA 2GV9A 3MWTA 1V3ZA 1VQPS 1BI4A 4PEOA 1LCUA 3QT7A 3JSMB 2P9LA 4JI1K 1WEXA 5HJYA 5DG7A 4HI2A 2RAQA 4CEDA 1BQXA 3QT5A 1N0VC 1Q8LA 3G9CA 1U24A 1GMWD 1YF5L 4X4PA 4OYOA 3DN9A 1YJ9S 2N4DA 3CJTA 1YJUA 4JYAK 1V9OA 3OYJA 4M5DB 5C2CA 4ES3A 2JEJA 4QZVB 1ILYA 5IWAK 2RILA 3FVYA 4WFBQ 2PMZD 1RWUA 4A8WA 4W5RA 2YHXA 4YOEA 3DRXA 4LSNB 2R2UA 4AHUA 4L72B 3OTBA 4NEZA 3QEXA 1IBMJ 4AHCA 4K5SA 1K6YA 1QVFR 3M9OB 3HVTB 5E3AA 2HMIA 3W9HA 1IBCB 4QYZJ 1WLJA 1FTRA 4CLSA 3G82A 3IMXA 2D3ZA 3N4WA 2CWXA 1XMOF 1VBXA 2Z2ZA 3HJFA 1M1HA 2VQFJ 5A8WB 2QXFA 1WF0A 3G96A 4IG3A 3AV9A 3T3FA 2ASLA 5AQGA 1WHXA 3NS5A 3SCXA 4DV3K 4FJ9A 2E9RX 2NYIA 4O3RA 3C16B 5DDOC 4ILLA 5GADU 2DHGA 4CGFA 2JH3A 3KWIA 3WQTA 4Q2LA 2ZZMA 3KK2B 4LFAJ 4X64F 5B0BA 4I56A 4FL9A 1JLAA 4ZJOA 4NEYA 1H74A 4KFBA 4HDHA 4U8VA 1AUSL 5HVGA 1HL6A 2KKHA 2GIQA 4M1KA 3H5YA 5KT7A 1WBBA 1FNMA 4LF5F 1OH7A 1X9SA 2DY9A 1IBLF 3JAMU 3CCRS 4ECWA 3FRZA 4MYTA 4RJVA 4JP8A 3M1VB 3CD6S 3NCQA 3C94A 3SQ1A 2QXLA 2YKMA 3MN6A 4K4ZA 3GYNA 2C2MB 2VBYA 4CD1A 4DU4A 3S01A 1X4FA 3ILJA 4KT0C 4H03B 1SIZA 4NYOA 4JKGA 1LFWA 2ZH3A 3LAKA 3FZ2A 1K0VA 1VYAA 3SCJE 3I56N 4IOCQ 3F0NA 2YI1A 4I2QB 5A2QY 4CO1A 2FBVA 3R6LB 3HI9A 2VYPA 2DNGA 2BH1A 1JNRB 1VRTA 2IVNA 1TGOA 1D1UA 4WP8A 1XTZA 5J2MB 5L46A 2BEFA 4CLPA 3TAMA 1KN6A 1CJUA 2OZMA 3RMBA 1IR1A 5EVZA 1KS2A 3NAIA 3EY1A 2V68A 4NXMF 1RACB 5AQJA 4DV7K 2KJWA 4Z4CA 4DL5A 3O9SA 3IN5A 3E8OA 2XM3A 5KT2A 4A8YA 1T3VA 1QUVA 4NZ7A 3AJ2A 2I7PA 5AZJA 1NWKA 3D28A 5KQ8A 4NXNK 5HP1A 1FTCA 3N6LA 2YNHA 1KTVA 2DEIA 3QETA 4HH0A 3KHYA 4OGEA 3MPVA 4DTSA 4NLWA 4LBPA 5C7PA 4FLTA 1RAAB 1QSYA 3WNHA 5K5MA 1CVJA 2KG0A 4OI2A 4KTQA 2Q2RA 1U2CA 3QFUA 1RT3A 4N7TA 3IBWA 2A40A 3SK3A 3G8QA 1EO1A 2KKZA 1SUQA 5KFIA 2JC1A 2DISA 1YJRA 3SUOA 1U6FA 2GVZB 2UUTA 4UQGA 2UUCF 1OJ4A 3NGYA 1X5TA 4RBVA 1JXEA 3L2VA 2GVZA 3O1LA 4KB0A 2CNKB 6AT1B 1VSIA 3AB4B 2A3ZA 1FRHA 5EWEA 4DV2F 1ZBLA 2VGMA 3PUFA 4BBYA 3LF0A 3Q0AA 3K5OA 2UU9K 4HH1A 1QZ5A 2Q97A 4P2SA 3BSCA 3MCAB 1NUEA 4E3SA 2CQPA 3Q7BA 4WQ5C 4BE1A 2CH5A 3PRBA 5AQZA 2PDAA 1VMBA 4IYQA 1NHUA 2NRVA 1YQHA 4TQSA 4DUZK 4X84A 2G2YA 5HL7L 4JI0J 3BF4A 5KFTA 3BKUA 1SL0A 3QFWA 3G6ES 4CERA 3QESA 4JI8J 2BQUA 4DV7F 3HHLB 3TP2A 4W5NA 2G2OA 3DC2A 2B7BB 4NLCA 1JCGA 3TAMB 3BBCA 1IJFB 5J2NA 1KVBA 1TP7A 1ATNA 3ZT2A 5IFMA 5GIPA 1AB8A 2OPRB 5KFZA 3GFYA 3R6GB 5I3UB 1A5XA 4H5NA 1O51A 2C22A 5EY4A 2R7RA 2BM1A 3JQJA 2OCEA 2CJQA 4DJBA 3J7YP 4Y28C 4IH6A 4MIAA 1R0AB 1OQ6A 2W9BA 1UWBA 5KFLA 1HKBA 3IKMA 4KHQA 3CMEN 4EYHB 3EWGA 5FJ4A 1D4XA 1QQNA 2KJVA 4I2QA 3D6FB 2HIQA 2HHHK 5ADXA 1F9HA 3BH6B 1BWFO 2ATLA 2HOEA 2DR7A 3PFEA 2HRYA 4BRQA 3RBDA 4FJ5A 1KC8O 1RE1B 1JXLA 1R8PA 2DTJA 1T7PA 1Y5NB 2AKWB 3TWZA 4I64A 2PMWA 2IAJA 3RB6A 5A8RB 1ZTWA 2VONA 1WC6A 4OPKA 2V69A 4QR0A 1ITGA 3QZ8A 5A0YB 3M2RB 3AQOA 3H8YA 3P6YC 3EEQA 1RAHB 4XEIA 1SQGA 2EFPA 2PC6A 2DFHA 5M2PA 5L1KA 4FW2A 2X74A 4QIEA 4LF4J 4YY3J 2F9TA 2Y3YA 1ZPWX 5HP1B 4L76A 2A42A 1RDAA 4ZLPA 1HNWK 3DLGB 1BMQB 4MQ3A 4USMA 4NCBA 3HHDA 4X4NA 5AE3A 1S57A 3O4QA 1QVGM 4H8KA 4AD6A 3L3CA 4DUYJ 3O9TA 1EB0A 3GR0A 4M41A 2GHWA 4BRGA 2CADA 3RW7A 8RUCA 3B4MA 4IQMA 3NGUA 1DTTB 3BQ2A 5LXYA 4O3QA 4JI6K 2X78A 1RT7A 1V4TA 1T11A 1AYEA 1KVCA 1RDWX 2HRUA 3AD7C 4BR5A 2OD6A 2RE1A 4AHVA 2UYTA 2DH9A 1JXVA 4ZCIA 2X1BA 4ED7A 3NFAA 1SQFA 4CZEA 2DGTA 1OH5A 4RX6A 2OPQA 2I8EA 3L0QA 3UO0A 4KHWA 2RIJA 1A9NB 1NDCA 5KT5A 1KLNA 1RAGB 3IG1A 3QGGA 4HACA 4TSXA 3MM9B 2GA7A 3C6HA 3IR7B 4M7YA 2Q66A 1D9DA 3LW5C 4BRFA 2XZDB 3EVOA 4GV9A 3E51A 5E84A 4IDKB 3UIQA 4PWWA 2PD1A 2ZM6F 4YR2A 1EARA 5KG5A 1Q5YA 2XCAA 4AT1B 1JL1A 4JI4K 5KI6A 3OV7A 3SQGA 2AWZA 2P9KA 4A47A 3MZIA 3Q8SB 1VDHA 1NKEA 3VEZA 5D78A 1GAOA 2O3DA 4M63A 1SAZA 1R3NA 3DRRA 5DLGA 2VPYB 4V19J 3HRGA 3VGKA 4NOHA 4WYBA 3M2UA 3W65A 4DV0K 2HVZA 3KJQB 5C12A 1H38A 3TUPA 2W9CB 1EZZB 1S5JA 5LM7E 1Q95G 2NRXA 1WN7A 3B4DA 3LUYA 4ZS6A 2EPIA 4F36A 4ER8A 3RAMA 3TQ1A 1MG7A 2ZQBA 4I9LA 3UKRB 2VG7A 2D1CA 3E01A 1KQGB 4JI7J 4HWIA 2HMIB 5F3ZA 1JLEB 4P52A 5GVQA 1AFIA 3HD2A 3AVFA 3QIPA 2YNIB 4PG4A 3R5GA 2M0GB 1O8BA 2MZSA 4DR2F 4LBHA 3UE2A 3TUIC 3SBMA 3PVXA 3C3LA 2C42A 4BRHA 1VQKN 2ZGZA 1M5HA 2M8HA 1RBTA 3P1GA 1S76D 1YUWA 2HZCA 1R6VA 3BR8A 2U1AA 4X4UA 5B7WA 1BISA 3TAPA 4Y6IA 1YHQS 3FZFA 1PC5A 1GH8A 4DV1J 4K2XA 4PXBA 4O3OA 4YOUA 4ZP8A 4CZCA 2JLFA 2NRHA 1K9MO 4C8NA 1HR0F 2D7SA 5HL7Q 2IIRA 1D0EA 3HM8A 5M1PA 3JSMA 5B08A 3GG0A 3BUZB 1S6PA 2MZJA 2Z57B 2CXEA 5F0XA 2CRLA 2F4VK 4B3OB 1QAYA 1R8CA 2LMIA 1RTHB 3T9ZA 3U9ZA 3CD7A 4J2AA 1X5OA 3W7BA 2CWKA 2J8AA 3ZSOA 1RBUA 4CVNE 1WSHA 1IUJA 2HFNA 3LGNA 2MSSA 4JKEA 4E7IA 3M6XA 2P9NA 4AHRA 3QGHA 2OFHX 4IFEA 2B56A 4U7BA 2HGLA 1SH0A 1ESVA 4ZMMA 3GYXB 2QT7A 4OJ1A 4DQ8A 2XEXA 2AYGA 1VCTA 2LQ9A 3O8WA 4DTNA 1NBEB 1TL1A 5KFEA 2VFUA 4G1QB 1ITPA 2R2SA 2R8KA 4EFHA 5M1OA 2DIVA 4NPOA 3A4TA 4NLSA 2FZKB 2APOA 5IWAF 1RWVB 3VPZA 4JRPA 5TKWA 4FM0A 3LH2S 2GHPA 3N4QA 4PPZA 2H3EB 3ZX0A 3MHYA 3P96A 4F0KA 4JI1F 3KKRA 3M2RA 1M5KC 4UT4A 1OY8A 3QFHA 4NYFA 3EXYA 3MMBA 4TYAA 4ED6A 2KO1A 3ZSVA 1HYZA 1NKBA 1EX4A 3KLIB 1DHMA 4JV0A 1ZS6A 1VQ8S 2VPWB 1YBTA 3DYAA 2W7AA 3K0JA 4CZGA 5H9FJ 3SFUA 4WZMA 2BQRA 2RB7A 2ASOA 2F8EX 4C1NI 4I6MA 3MECA 2YVSA 1ZPVA 1JJ2M 4AQYK 4FZZA 3O5BA 5D4LA 4HTIA 2ERRA 3CB4A 4RR5A 4LF8F 3PHEA 3A2FA 2ILZA 2QGFB 3BBFA 1GX5A 2A6MA 4DQRA 4IJNA 2WCXA 4WFXA 1XR7A 4M3UA 4LIWA 2WSCC 2OPRA 3QFPA 4OFZA 1Q78A 5DM6Q 3DI6A 4UY85 3CJKA 3ENBA 1JKHB 2EFOA 4DR2J 1WC5A 3M8SA 3KXDA 3BEXA 3AT1B 2P9PB 3D7EO 4PCQA 1SQKA 4LF5K 3D1QA 5JVHQ 2I38A 4FLZA 5C2DA 3QEIA 3EKSA 4ILHA 3GIRA 4FZVA 1JLCB 2QLWA 2Z2YB 2ROPA 4OYXA 1TQLA 2PEBA 4MK8A 3GU0A 4KH1B 3FR0A 2UUAF 4BDPA 2FY8A 5CR4A 3SUQA 2MPUA 3BGFA 3Q2TC 3JB9k 1UVNA 3OXGA 3GG4A 3F73A 1A0OB 3SMSA 2DGWA 4CDIA 3NMUA 4LF7K 4RZRA 4DR1K 2VJVA 3QICA 4A61A 1S6OA 4TU8A 2NUUG 1UMJA 1ZBUA 4X64K 4FM1A 3FEYB 1GXLA 3DDIA 3QWUA 3VETA 1L3UA 5A6PA 4CF2A 2C3UA 1FJEB 3AVIA 3VERA 1ZM9A 3QJJA 1NMDA 1NGBA 3VOVA 4CM0A 3O6WA 1SV5A 4B1WB 2MQMA 3D0IE 2P1JA 2CH6A 4FF4A 3R8YA 1H2TZ 4Z4HA 2HHQA 2YHBA 2B9YA 2X6SA 3ALYA 1CJVB 4DCJB 2GW8A 2DPNA 3I5CA 3VAFA 3O4NA 4A8SA 3BQ1A 1IKVA 4ZTFA 1WOSA 4OGCA 3RU0A 2J9DA 1X3NA 1NH7A 2VCPA 1RT6A 4QAGA 3VGVA 3KLVA 2JX2A 1NK9A 3MXHP 1I51B 5BN9A 4FKYA 2ETJA 1X9MA 4X66F 4DSKA 5CE3A 2OZSA 3UPFA 1RUSA 3D5MA 2H5IB 2YPZA 3NGRA 4NA1A 2ADBA 1I94K 2FLOA 4LF2A 2CJYB 1NGHA 1KHVA 2CGLA 2Y1RI 1FF2A 4GC6A 4B9VA 1KEKA 3S41A 3NOGA 3DXKA 2L48A 2FYXA 4B17A 4FJKA 5HQLA 2OSRA 2DNLA 3CJ5A 5HBMA 4CEFA 4I0WA 2CJXB 3DLBA 1PKUA 3B8AX 4IH7A 3T1HJ 2CNLB 2J76E 2VGNA 1WORA 4CESA 3BSOA 1RYSA 4YP3A 3E9PA 3M2VA 1DQ9A 4X62K 3KK3B 3EPIA 3V4MA 2H65B 3OYBA 1P6TA 1M5SA 1EKSA 1D8YA 4QCLA 4I7FA 5JLHA 3JSRA 3QBWA 3B8HA 2MQNA 1HNXF 1C6VA 2V4QA 3NNHA 4OJHA 2DNMA 3ZCMA 2Z30B 3MAAB 2V9KA 2ZH4A 3NE6A 2CNNB 1RNHA 2HNZB 1NPKA 1DAXA 2NRRA 1YTAA 2DNNA 1XNQK 4Y65A 1U1PA 3PSIA 2AZ3A 4FWOA 3WQUA 5CXTA 4CO0A 4E89A 4GO7X 2CNOB 1VRUB 4YHHJ 2ZH8A 3GJSB 2FJDB 1KAXA 1YJTA 1N36J 1DEJA 4UOCA 3OYMA 3KD5E 1ASWA 1FESA 2NXUA 1X3MA 2YWKA 1U4BA 1RDCA 3PG9A 4E19A 3M7VA 2WSEC 2G8FA 3ZZRA 4ZP6A 5JS2A 4LF9K 2G0CA 4QJVA 3W3DA 2GS8A 3G82B 3ENHA 2KXHA 3EZOA 3H0PA 3V1OA 3C6UB 4A5BA 3D1OA 3IO1A 3TSUA 4KH4A 3DU5A 2MKKA 4DPXA 2LA4A 3AOAA 3P4IA 4DTMA 3V9XA 4CP5A 4JV5F 1H98A 4JI7K 1LXJA 3L95X 4PUOB 1HPZB 1H0HB 4RU2A 3Q8PB 4S0MA 2YX1A 3CMAN 1YT3A 2B6AB 2IOCA 3QIDA 3VTHA 3DCAA 3W8GA 1WC1A 2HQIA 2QLBB 5IOLA 4O0JA 3V81B 3DOKB 4ZIVA 1DTQA 2DHHA 2UXCJ 5FDLB 1GMWA 4PWDB 1WSVA 5E3PA 1J27A 2ZBPA 4M5LA 1ZM4A 3CC2N 4ZP9A 4CBXA 3ZSRA 2R7UA 1VHIA 1QY7A 2M3DA 4NLQA 1YRUA 4DV1K 4DL2A 3MXJA 4KGVB 3J7Z5 1J9AA 2R8JA 3D3CJ 1B4SA 3J7ZO 1QAXA 3IWXA 5DM6L 4I9QA 3ITHA 1A5WA 1R0BG 2FHOB 2BKNA 3AA4A 2CGJA 3MPUB 3K7RA 4IBNA 3CSKA 2GEMA 1NK6A 4B3SJ 1A5VA 1XEZA 2CDRB 3PY8A 4LFCK 3RWUA 3TYTA 3GWCA 4M3YA 1URNA 3CCZA 3S3MA 3CDAA 1IWAA 3W2WB 3MUVP 5GMEA 3E66A 4RNMA 1R89A 2DNPA 2KW4A 4FLXA 2X1AA 4USVA 4CHPA 2M70A 4JI8K 1RWPB 1Q79A 4BACA 4WP9A 2MQQA 1BQNB 3ENOA 4DPOA 4MJKA 2B0GA 4OZ2A 4RUAA