1FKPA

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
542
structure length
541
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 147
structure length 541
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fkpA05
3M9MB 1S9FA 4I2PA 2GV9A 4YR0A 2B5JB 5KFXA 4BE0A 1NK5A 4OKJA 2QK9A 5KFUA 1MMLA 4WZMA 2I5JB 1NK7A 4KFBA 4CGIA 4FLXA 4W5QA 5KG3A 4LH5A 3PZPA 2D0CA 3IG1B 4CHYA 2A1RA 1HJRA 2IAJB 1LW0B 4MKAA 4F3OA 4IH7A 2XWYA 5HRSA 5DG9A 4URSA 3P5JA 3JSMB 4DFJA 2XCAA 5KFJA 1RT1B 3E01B 4ZPBA 4M95A 1T3NA 3K58A 4FJ8A 4JLHA 4DL4A 4Z4IA 2AQ4A 3OYGA 1KTQA 2WOMB 2RDJA 1C1BA 4FJKA 1NOZA 4DL3A 4FM0A 1WAJA 2B43A 1BQMA 2OPPB 2HNDB 3NKYA 1RTDB 4CEAA 1X9SA 5KFSA 2OPQB 3KLEB 1U47A 2JGUA 1WSEA 2D0BA 5SWMA 5CY4A 1VSKA 1QAIA 2DFFA 4WFXA 2YKNA 5KFFA 3RR8A 4DTPA 3KHRA 1OS5A 2W7PA 5I3UB 4KTWA 2IM2A 2QXFA 3M9NB 4ED6A 2RF2B 1VK0A 2EC0A 4ED7A 5HRNA 4J2DA 2E9TA 3CM6A 3KLIB 1S1WA 3VN5A 3LPUA 3H5SA 3K2PA 4JRPA 4CEOA 1JLBA 4Q44A 5DG7A 1KRPA 3PJWA 1K1QA 3DLRA 4YFUA 3NF8A 3QNOA 2WONA 2Q3SA 3PW2A 3PX6A 4DF8A 3SUPA 3LALA 1ZBFA 3DYAB 1C0MA 2WHOA 3M8QA 4DL6A 4CK3A 5HBMA 3PW4A 2R8JA 5HP1B 5EWFA 3QYYA 1TKTA 4I9QA 4DTXA 3MEGB 1DTTB 4QWDA 4ZTJA 5F9NA 2ZE2A 4M3WA 3KMSA 4NLXA 2YNFA 4ZVEA 3TANA 1IKVA 4ECVA 3LAKA 3EPGA 1RILA 3DM2A 2CKWA 3PX0A 4N76A 4M3TA 1L3TA 5C42A 1TKDA 3NF7A 3LWMA 1KHVA 5KG4A 1BIZA 3LP2A 3ZT2A 4KHUA 3MEDB 3KLHB 4RNOA 3NE6A 4ID1A 4RW6A 1YVUA 4FVMA 4FW2A 1YTAA 4CGFA 2ASLA 4M3RA 4CHOA 3ZT3A 5I42A 2EX3A 4DLEA 3NF6A 4RNNA 3TAMB 2W9BB 3D28A 1TVRB 2B5JA 5KFNA 3VQ5A 4ZP7A 1NHVA 1RDRA 1KFDA 3HJFA 5T14A 3KOAA 1RA6A 3VQDA 1KVCA 5T7BA 1WAFA 4E0DA 4B08A 2I5JA 3H98A 4Q43A 3GV5B 3ZSWA 3CO9A 3BDPA 2WCXA 3N6LA 3IG1A 4DL7A 2YHBA 5DG8A 4E7IA 4DTJA 3CFPA 4QWAA 4CK1A 2IAJA 4J9LA 4J9OA 3UQSA 3T19A 3NGIA 4ZHRB 1HMVB 3MEEB 3C95A 3BSAA 3RMAA 1JLGB 3NAEA 4FYDA 3ZSYA 1EETB 3M8SA 3F9KA 2AGPA 1BQNB 4DQRA 1KLMB 1RT1A 3E01A 4NLYA 5J1EB 4NLGA 2ZD1B 3N6MA 4NLWA 2WOMA 3BREA 4I2QA 1U09A 3BSOA 4NLRA 5EUHA 2FVRA 2OPPA 2HNDA 2HNYB 1RTDA 1W9HA 2C28A 2XY5A 3OL6A 3C6TB 3EZUA 1UA1A 2OPQA 3KLEA 3CFRA 4MIBA 3NH2A 2V4RA 4L8RB 5KRSA 5DK5A 4IFYA 3OHAA 1LAVA 3UR0A 4FJLA 2UUWA 2C2EA 4DEZA 3FDSA 2E6MA 4NYZA 2PYJA 4H8KA 5KFAA 5I3UA 2D5RA 2FVCA 1HQEA 3VQEA 2VWKA 3ZT4A 2D3ZA 3LP0B 3QETA 2VA3A 3RMCA 4Y1DA 4F4KA 1ZBLA 2RF2A 3DOLB 1Z4UA 3AVFA 1QS4A 2E9ZA 4FZZA 4H4OB 4KI4A 3KLIA 3L2WA 3EY1A 1NKBA 2RPIA 4ECQA 2GBZA 2AGOA 1BHLA 3L2RA 3RB3A 3H4DA 3OYNA 3TAFA 4JV0A 3ALYA 4Y1CA 3MR2A 4C8NA 3RWUA 2XI3A 4B3OB 3IN5A 3QEPA 4RW9B 4FBUA 2HHWA 3DYAA 1WNEA 4J2AA 3S3MA 1LWEA 1NHUA 1S9GB 5HP1A 1JLAB 3LANA 2D7SA 3MEGA 4YP3A 1DTTA 2Z1IA 3GIJA 1JXBA 2OPRB 2ZQBA 1XR6A 1VSEA 4ECYA 1QSLA 3HVAA 1FXXA 2FVPA 2VG7B 1C1CB 4PUOB 4Q45A 3LP3A 1REVB 4J9QA 3VQSA 4I9LA 3MFHA 3VQ9A 4O0IA 2R2TA 5JXSA 1CXUA 2HW3A 5KFQA 3IRXB 4E7JA 3DRPA 2W9CB 3RR7A 4CEQA 3T5LA 2QE5A 4R0EA 1T7PA 5KFBA 3I5BA 1IKYA 2FJVA 1JLEB 4RW4A 3H5YA 3MEDA 4DMNA 4Z0UA 4W5NA 1C1AA 2ITGA 3D0PA 2Y1IA 4AH9A 4CFBA 3OYBA 3DI6B 4M3XA 1IKXA 2YNHB 3HVTB 4RG8A 3ISNC 4NLSA 4Z4FA 1J54A 4K50A 3TAMA 2W9BA 4KAZA 4I7FB 3KK1B 1TVRA 2VG5B 3AVMA 5FRNA 4UQGA 3GILA 5HRRA 2HHTA 2HWHA 5KFPA 3U3YA 5JUMA 3U6FA 3FFIB 4CF9A 1Q9XA 2D41A 4QOZB 3L3VA 2WRMA 1J9AA 1YVFA 1HYZA 3HYFA 2JLEA 4R5PB 1RDDA 4KKOB 4ZVFA 4M3YA 5EWGA 4WFYA 4KHMA 4Y2AA 4DTUA 1S1UA 2FJXA 3KLGB 2R8KA 4ZHRA 1IG9A 1HMVA 3MEEA 4HVJA 1SUQB 4KHWA 1TP7A 1I39A 4B9TA 1RNHA 1EETA 1BQNA 4OKEA 1KLMA 4DFPA 3RRHA 4AILC 3KHLA 4DFMA 4R8UB 3VA0A 5J1EA 2ZD1A 4DWIA 3K5NA 3KD5E 3VQAA 4URQU 2HNYA 4FBTA 4DSFA 4HCBA 1RTIB 4KO0B 2ASJA 3K59A 3GIMA 3C6TA 4BDYA 4DF4A 3PJXA 3QGIA 1RTHB 2AJQA 1WSJA 4ZP6A 4NYFA 1NJYA 3KHHA 3DLBA 3M8RA 3H2LA 2WK4A 2GC8A 4B9VA 4DSLA 3ICLA 1WSGA 2JEIA 2HNZB 3O3GA 3PVXA 2ETJA 4O3OA 1VSLA 3BSNA 2BQUA 3LP0A 2BANB 3VQ7A 3DOLA 4RUCA 1X9WA 3I8DA 4E1NA 4H4OA 2D3UA 3SI8A 5K14B 4TQSA 4W5RA 5KFMA 3SQ1A 4K4WA 1BI4B 1U49A 3CDWA 1U45A 5KGXA 4B3OA 4EP4A 3Q8QB 2OH2A 4RW9A 1RT3B 4WXWA 4CIFA 5HRPA 1S9GA 1JLAA 4KI6A 4M3ZA 2BQRA 1L3VA 3OYMA 3KLFB 3QEXA 5KG2A 1K6YA 4FJIA 3VQ8A 3MXMA 4HUFA 4XIUA 2BE2A 1S6QB 2VG6B 3BQ1A 2VG7A 1C1CA 4PUOA 4EYIB 3L2QA 2QKBA 1REVA 4CFDA 2BR0A 2DFHA 3ZSVA 4ED0A 5DMRA 3IRXA 4KB1A 2W9CA 3ZCMA 1W25A 1RBUA 3O4QA 2RKIB 3OYEA 4FLYA 5J2MB 2B4JA 1JLEA 1GX6A 1RBTA 3MF5A 1KHWA 4CJWA 3RB0A 3AVNA 4CJQA 2G8WA 3DI6A 3DLHA 2YNHA 3HVTA 2FVQA 4J9KA 2PY5A 3GIIA 3OY9A 4B9MA 3QNNA 1VRUB 5L1JA 1JIHA 1VSDA 4I7FA 3KK1A 2VG5A 4OLBA 5KT5A 4RU9A 1SKSA 5F8HA 4DTMA 3AVBA 5HROB 1NNDA 4E7KA 1SV5B 4FLVA 4IKAA 2DY4A 3RMDA 4ZTFA 3FFIA 3Q8PB 3G10A 1IH7A 5KFOA 2YNGB 1A5XA 4EO8A 2OPSB 3OVNA 3GYNA 3DMJB 3PV8A 3PUFA 1S9EB 4Y34A 4CFAA 4J9RA 4R5PA 1RT4B 4KKOA 4O3RA 4TY9A 1LWCB 2F8TA 4RNMA 3KLGA 3HPHA 4WFZA 4RUAA 4ELVA 4CEZA 1TAQA 3F73A 1SUQA 4RW8B 1RBRA 5J2QB 3MR6A 3RB6A 1NOYA 3Q8SB 1S6PB 4R8UA 1JLCB 5DQHA 3AO3A 4DSJA 3V9ZA 1GOAA 1F21A 1TV6B 1BIUA 3H4BA 1W0HA 2IMWP 1NJXA 3OLBA 3FSIA 3E51A 2DPJA 4KTQA 2XRIA 1RTIA 4M42A 4KO0A 3L3UA 1JLFB 4AHSA 1RTHA 5KG7A 3BSCA 4GMJB 5CYMB 2O4GA 5FROA 3ZSZA 4BDZA 3OYIA 4CK2A 4ID5B 1JLQA 3S3OA 2DTUA 2HNZA 5CZ2A 4J9PA 3AA2A 2HMIA 1RYSA 1JX4A 4CJPA 4ZVGA 1MU2B 2DFEA 4YQWA 4ECZA 2BANA 3QZ8A 4Z4GA 4IG0A 4WZQA 1HQUB 3HK2A 3V9SA 3DRRB 5K14A 3V1QA 1BI4A 4FJ5A 3G86A 5KFZA 3G6YA 1NK6A 4FLTA 2IOCA 5JS1A 3IGNA 1RT3A 4MKBA 3RBEA 3K5LA 2KW4A 4JS5A 3KLFA 4K4XA 4IKFA 4DG1B 3OYAA 4IH5A 2Z1JA 1IO2A 2HHUA 3ZT0A 4JUZA 1S6QA 2VG6A 4ECTA 4BE1A 4E1MA 4B9NA 4NRTA 3LDSA 4ECSA 5EDWA 4CJUA 4BE2A 1T8EA 3RBDA 5DQGA 4HYKA 1UWBB 1NK0A 4KPYA 4DL2A 4JRQA 3S9HA 4DS4A 5L1IA 4XPCA 2RKIA 4EBDA 5J2MA 4KB7A 4FK2A 4BDPA 4OGEA 3CDUA 1KVAA 2HHQA 3G6XA 3UIQA 3B6PA 5KGWA 3HVRA 2HB5A 1WN7A 3HPGA 3AVCA 3CG7A 2XHBA 2OZSA 4DSIA 2KZMA 4KE5A 3T3FA 1VRUA 3GV8B 3KKSA 3GV7B 3FQKA 1FK9B 3TAQA 1KVBA 1N6QB 5HROA 1SL0A 1SV5A 4B9LA 2YNGA 4Z4EA 3T1AA 2RDIA 2OPSA 3P83D 3DMJA 1I6JA 3AVGA 1S9EA 4K4YA 4K4VA 3GIKA 3VQCA 4CJ3A 1LW0A 1QQCA 2R7YA 3MTKA 1LWCA 1UA0A 4CHNA 2Y1JA 4FZXC 2E9RX 5KTQA 3NGZA 4LSLB 4RW8A 3JSMA 2RN2A 3L8BA 1XI1A 3UPFA 4E89A 5J2QA 4Y3CA 3LPTA 4Q5VA 3OSPA 3OS0A 2JC0A 3L2UA 4DFKA 4M41A 5HLFB 5EWEA 1JL1A 3HVWA 3HP6A 3PR5B 2IS3A 4IDKB 1S6PA 3NF9A 3KJVB 4NCAA 4F4XA 1JLCA 3A2FA 3SQ4A 4PWDB 4KAIA 3ZSQA 4DS5A 1TV6A 4KHQA 3AVAA 2OZMA 4MFBB 3BQ2A 3UDLA 3EZ5A 4NCGB 1N4LA 4JV1A 2ATLA 3QEIA 3C94A 4WE1B 3OYCA 1JLFA 2ILYA 2GIRA 4CJTA 3M8PB 3HP9A 5CYMA 2HHXA 3T5HA 2F8EX 2UVWA 4ID5A 4C8MA 4TYBA 1U04A 3OLAA 1SL2A 1B9DA 4AHCA 4NRUA 4ECWA 2YHAA 4QWEA 1MU2A 1RCHA 2XY7A 4IH6A 2R8GA 5F9LA 1SH2A 1XC9A 4EBEA 4O4GB 4CF2A 5KT6A 3KLVA 1S5JA 4FK0A 2XY6A 1C2PA 4CF1A 1HQUA 4B8AB 5KT2A 3DRRA 3QGGA 1VSMA 5J2PB 2ALZA 4CIEA 4OPJA 3AV9A 3ITHB 1L3SA 2DPIA 1C6VA 4DU3A 4AHTA 1SH3A 4Q8EA 1VSFA 1EX4A 4IFVB 1ASUA 3SUNA 1Y97A 4DQQA 3B6OA 3LZJA 1HNVB 4EBCA 2R2UA 1J53A 3CJ2A 1ZETA 4F8RA 1HARA 3SV3A 3NAIA 1TGOA 4C8LA 3TABA 4DG1A 1Z25A 4TYAA 2QV6A 5FDLB 4J2EA 5DLGA 4N5SA 2IC3B 3V1RA 3WNFA 3CVKA 1KFSA 2X6SA 3D45A 3WNHA 2JEFA 1VRTB 1K1SA 3KK3B 4LQ3A 4B8CA 1IM4A 1UWBA 3DDKA 3DRSB 1J5OB 4Z4HA 3ULDA 1ITGA 5KG5A 4MH8A 3SZ2A 4EYHB 4YMEA 3NFAA 3QEWA 1B92A 2W8LA 2WB4A 4O55A 3KLHA 1TL3B 3TAPA 3ZSOA 3QIPB 5KT3A 3PW0A 5KG1A 2P51A 2R2RA 4F4WA 3NBPB 4CEFA 3JYTB 4OGCA 4B9SA 4PQUB 4MK8A 3ASMA 4FJXA 1FK9A 4KREA 1N6QA 5KI6A 3QO9B 1GOBA 1ZBUA 1I3AA 4IR9A 3H40A 4J9SA 4I2PB 4QW9A 4Y2CA 4CEEA 4ED1A 4K4SA 2I1RA 1Q8IA 3DLKB 3AO5A 1RTJB 3RMBA 4NZ0A 3OYLA 4QPXA 1R0AB 1TKXB 1Z26A 1A5VA 3NGDA 2F96A 4CJLA 1JLGA 4LSLA 3CIZA 1TKZB 4ICLB 2P5OA 2V0NA 1CZ9A 5HLFA 4OKKA 4GC7A 3GQCA 5KFLA 4IDKA 1T94A 4ED3A 3O4NA 3KJVA 4PWDA 1WSHA 5L1KA 2XGQA 4MFBA 1BL3A 2UVVA 1U4BA 2JEJA 4IRKA 3HSTB 3H5UA 1RT5B 4NCGA 2G8IA 1TAUA 3ZT1A 3V9WA 3LAMA 2FLNA 3CDEA 4DTOA 4WE1A 3U3GA 2FJWA 3V4IB 4E7LA 2IM1A 4K8ZA 2J6SA 1QSYA 3SFUA 4YR2A 1A5WA 3WNEA 3M8PA 5FRMA 4AHVA 1ZYQA 3PR4A 2HWIA 2B6AB 1RYRA 3KK2B 3SQ2A 1RT7B 4K4ZA 2F8SA 3OJSA 1EP4B 4CHPA 1YT3A 2FVSA 3VQPA 1N5YB 3BGRB 1RBSA 3HM9A 4O4GA 3NHGA 3HKWA 4ZP8A 2IDOA 1ZTWA 4FZYA 1UAXA 4G1QB 1ZTTA 1T03B 3V9UA 4EZ9A 2GIQA 4IQXA 1VSJA 1GOCA 5J2PA 3ITHA 5KT4A 1NJZA 4IFVA 2Z1GA 2W8KA 4CECA 3T5KA 1NKEA 4PA1A 2VWJA 4E7HA 2HVIA 2X6NA 1HNVA 2EHGA 5KRTA 4LY7A 1WSIA 1C0TB 3AA5X 1Q9YA 4CJRA 4FJJA 4O3QA 2OPRA 2W9AA 1S97A 3OHBA 1O1WA 4AHUA 4EEYA 1CZBA 4EO6A 4QW8A 5FDLA 3CJ5A 1D9DA 3WNGA 5HBMB 3K57A 2IC3A 4ELTA 4CEDA 1VRTA 3KK3A 2UUTA 3DRSA 1J5OA 4FS2A 3PX4A 2P5GA 3CJ3A 1HRHA 2A1SA 3HO1A 4KV8B 4EP5A 1S10A 2BRLA 2AWZA 2Z1HA 4KSEB 4FM2A 4HKQA 4TY8B 1TL3A 3QIPA 4H4MB 2XO7A 2YKMB 4K4TA 4DLGA 2XGPA 5C42B 4CFCA 3NBPA 4CE9A 3VQQA 3JYTA 3TR8A 1S48A 5CYQB 3OL8A 4DU4A 4PQUA 1DTQB 1XR7A 2JEGA 4CESA 4FLUA 2IJNA 4CF8A 2X74A 3LP1B 4M94A 1N48A 1T05B 3QO9A 3MR5A 3TAEA 5I42B 4IG3B 2C2DA 2FBVA 4TXSA 1S0OA 1TL1B 4W5TA 1JXLA 3DLKA 1RTJA 4F50A 1QTMA 1D1UA 1S1VB 1EXQA 1R0AA 4B9UA 1TKXA 3AO1A 1JXEA 4TSXA 1LAWA 3RRGA 3CFOA 2AX1A 1TKZA 3NMAA 3NDKA 4ICLA 1G15A 1D5AA 5KFDA 1QAJA 3ZSXA 1SKRA 4CJFA 2AU0A 1ASWA 3IS9B 3H08A 4ZPCA 1NK9A 5E41A 1WNSA 1XWLA 3HT3A 4IOBA 1RT5A 4BACA 2G8FA 4FK4A 5KFHA 1D9FA 2FC0A 1KSPA 3QEVA 1L3UA 4XPEA 3V4IA 4I2QB 3HHKA 4O44B 1HPZB 1RDCA 4W5OA 1FKOB 3OJUA 2B6AA 3KK2A 4CERA 1RT7A 1U48A 4O3SA 2W42A 1EP4A 4H54A 5DGBA 1IKWB 1N5YA 4IFYB 4X2BA 3BGRA 1TK5A 4LQ9A 4NLPA 3I5AA 3KIOA 4ZMMA 5F8LA 3CQ8A 1HNIB 3EPIA 3NH0A 4RW7B 3V6KA 5KFRA 4G1QA 2UVUA 4O5BA 1T03A 2ASDA 4QCLA 4QAGA 1S1XB 1SH0A 1HQEB 3H5XA 1BISA 2G8VA 3LZIA 4DL5A 3MXIA 4PY5A 4TQRA 1ASVA 4CIGA 2KQ2A 3I0SB 5C5JA 3PW7A 4DQIA 4LSNB 2IBKA 3NCIA 2OYQA 5C25B 2FBXA 4DTNA 1C0TA 2FBTA 4J2BA 4FJNA 4O4RA 3BR9A 5KFIA 4KTZA 3SCXA 4MK7A 4E3SA 1JKHB 3FRZA 2IM3A 4DQSA 3V6DB 4F2RA 1LWEB 3V6HA 2XC9A 3S3NA 3C6UB 5J2NB 1WSFA 3TVKA 4KV8A 1L5UA 1RT6B 5KG6A 3DLGB 3EYZA 4FJ9A 4N56A 4TY8A 3SUOA 3G0ZA 2FLPA 4H4MA 3QIOA 1D0EA 2YKMA 4ZVHA 4Q8FA 3DRPB 1DLOB 1X1PA 3AA4A 1NK4A 3PW5A 5CYQA 4KBIA 1IKYB 4YNQA 1DTQA 1S49A 3MECB 4RW4B 4LH4A 2G8UA 3LP1A 3OYFA 1T05A 4DQPA 4M45A 4CHZA 3K5OA 4HHTA 1B9FA 4KHYA 1IKXB 3QLHB 4CHQA 4BWJA 4KRFA 3NH1A 1XR5A 4IG3A 3AO4A 4ED8A 2NUBA 1S0MA 1TL1A 4QWCA 1GX5A 1RT4A 2KFZA 5CZ1A 4O3NA 1QHTA 2GUIA 3DOKB 1WLJA 3CJ4A 4CJVA 3TAGA 3O3HA 1S1VA 3OS2A 4CGHA 3HPOA 3OYJA 3AA3A 4RNHA 4IRCA 2OA8A 3KHGA 2XCPA 4YR3A 3DLEB 2IM0A 2PZSA 3QERA 3OYHA 3VQ6A 3SYZA 3FQLA 3VA3A 1X9MA 4IRDA 2JC1A 1S1UB 5D3GB 4NLVA 3IS9A 2CJQA 3NAHA 2XY8A 5KFWA 1BGXT 3V81B 3KTQA 4QWBA 3I0RB 1ZBIA 2ATQA 4CGDA 3L2VA 4JS4A 1KCFA 1C0UB 5KFEA 4TN2A 3SQ0A 4HUGA 4O44A 3OL7A 1HPZA 4U6PA 2IJFA 4DTSA 3SNNA 1SL1A 1QUVA 1XHZA 4C8OA 3OS1A 1FKOA 4JV2A 5C24B 3HXMA 1RA7A 3SI6A 2FLLA 1VSIA 1LW2B 2C22A 3BJYA 1IKWA 2HAIA 4DU1A 1S1TB 3M9OB 3MXJA 1HNIA 4MQ3A 4FJ7A 3QGHA 4URGA 2YNIB 4OLAA 4RW7A 1S0NA 1S1XA 5KFYA 3ZSRA 4CF0A 3I0SA 3PHEA 4FCYA 4CCHA 2HHSA 4LSNA 4ED2A 1XHXA 5C25A 4GC6A 5KFGA 2V9WA 1D8YA 2R8IA 3SJJA 1BCOA 1RT2B 3RTVA 4DSEA 3MAQA 1RAJA 2D0AA 3I5CA 1JKHA 3VQ4A 1LWFB 4CJ5A 3V6DA 2KZZA 2ZKUA 4NCBA 1NKCA 3V9XA 2HHVA 2X78A 3C6UA 5KFKA 1HYSB 3IGVA 4O0JA 5J2NA 2BE2B 4U7CA 1RT6A 3DLGA 3BQ0A 1CLQA 1FKPB 4OVLA 2YV0X 2P1JA 4HUEA 4J9NA 5L1LA 5DQIA 1DLOA 2BRKA 4Q0BB 3P1GA 4GVMA 3SFGA 4CJSA 4FJGA 4CGGA 4FW1A 3MECA 1QE1B 5F8IA 4ZPAA 3T5JA 3QZ7A 2LSNA 2G8HA 2VA2A 2IA6A 2AGQA 2UVRA 4O3PA 4IR1A 2E4LA 4ECUA 4N41A 3QINA 4Z4CA 4KB0A 1EKEA 3QLHA 4C8KA 3THVA 1KLNA 5KFTA 2V4QA 4OL8A 3PO5A 3HL8A 4OJRA 3DOKA 3RAQA 3CWJA 1CXQA 4KFBB 4RNFA 3O3FA 2BGGA 4DTRA 3CYMA 3SV4A 4NLTA 4F4YA 3DLEA 3QESA 3AVJA 4N47A 3IAYA 4MIAA 5DGAA 3RB4A 5D3GA 1RDAA 2O4IA 4NLOA 5F8GA 1TK0A 3PY8A 5EU7A 3OYKA 1JL2A 5SZTA 4FLWA 4TLRA 3V81A 4LD0A 2J6TA 3CM5A 3AVIA 4CGJA 4OPKA 4ZPDA 5KFCA 3MFIA 4HCCA 3I0RA 2HVHA 4DSKA 4FXDA 5F8JA 4E19A 4FS1A 1YTUA 2W7OA 2IGIA 1C1BB 3SPZA 1C0UA 4ZP9A 4XO0A 4AHRA 3NL0A 3CJ0A 1BQMB 3AVLA 2KTQA 3SPYA 4CJKA 3G6VA 3TI0A 5JS2A 3KD1E 5F8MA 4F2SA 5C24A 4ECRA 1RBVA 1LW2A 2WTFA 2AX0A 3OL9A 4KHSA 2KFNA 2FBYA 1S1TA 2YKNB 2R8HA 1N56A 5KFVA 3RAXA 1BCMA 2BQ3A 1JLQB 2YNIA 5F8NA 1ZBHA 1CSJA 3OSNA 2HMIB 4FLZA 2J6UA 3KKRA 4FM1A 1RDBA 3MR3A 4HTUA 3N6NA 3H59A 4G3IA 1NK8A 5L9XA 4IG0B 5KG0A 1S1WB 2BDPA 3PO4A 1JLBB 4GW6A 4K8XA 4J9MA 1HYVA 4ELUA 4CEBA 4CJEA 4NLUA 4WYWA 3D5MA 2E6LA 1LV5A 4BWMA 4FJHA 3SUQA 1RT2A 2WONB 4NYNA 4K4UA 2XI2A 1UOCA 3M8QB 1LWFA 2QKKA 4F3TA 5KT7A 1VSHA 4MK9A 3V6JA 1TKTB 3KMQA 4M3UA 1SKWA 3LWLA 1HYSA 1S4FA 3Q8RB 4NLDA 4WYLA 3NGYA 4NLQA 3AVKA 2ZE2B 1TK8A 2PYLA 1TQLA 4F4ZA 2YNFB 3AO2A 1FKPA 1IKVB 3V1OA 4IBNA 1QSSA 4ECXA 2R2SA 4WXOA 3DM2B 3OYDA 2O5DA 4CJ4A 4FJMA 3TWHA 4RZRA 3QIDA 3AVHA 3TQ1A 4Q0BA 5DLFA 3VQBA 3LP2B 4KHRA 4KHNA 3TARA 1QE1A 2G8KA 4EZ6A 4RW6B 2C2RA 3ISND 3KNAA 1NJWA 2ILZA 3K5MA
chains in the Genus database with same CATH superfamily
2P9GA 2OHDA 2V9KA 2B5JB 3HSJA 4HVZA 5LMNJ 3ZYYX 3O2IA 4DV6J 4CLLA 4DR6J 5KFUA 4C98A 2F8MA 2VJUA 2MQPA 3M2VA 4KFBA 4CGIA 3JQKA 1Q82T 2CJYB 1RZMA 3TNVA 5LSRA 4OQJA 2A1RA 7FD1A 3ZNUA 1FRLA 4C3MA 3UCGA 5BR8J 1RHJB 4MKAA 4F3OA 4IH7A 4MKVA 2XWYA 5HRSA 3DDNA 4D3GA 4KH4A 5HO4A 4USVA 3SBTA 5HMWA 3NVMA 3VGTA 5KFJA 1X9JA 4ANCA 4M95A 2JLFA 3JTPA 3ILOA 4Z4IA 1KTQA 2V8PA 2RDJA 1C1BA 1NOZA 4DL3A 2OPPB 3NCRA 2ZBQA 4CEAA 3CO0P 4G1IA 1U47A 2GMJA 1W2IA 2JGUA 3CJSA 3VGKA 5CY4A 5IT4A 1J5EJ 1VSKA 1QAIA 2B7CB 3A8YA 1UJ5A 1VJQA 4DR7J 2DH7A 1BE4A 4DX8H 1S59A 4JI5F 4DTPA 4FXVA 3KHRA 2V8DA 1OS5A 2HQCA 3DOMA 2W7PA 3MHYA 4DR2K 2IM2A 3CJBA 4FF4A 4ZKAA 4TU9A 4CIOA 2EC0A 2E9TA 3KLIB 4ZJLA 3H5SA 4Q44A 1CVJA 2UUAJ 1N33K 2O8EA 3P49B 2XULA 2G2YA 3VGVA 2D4WA 4YFUA 2GAGC 1BA0A 3WT0A 2NSCA 1CLFA 2RHSB 1AUDA 3LALA 3DYAB 2AJ2A 3M8QA 1RXOB 3BO2A 2C3YA 3O9UA 4HLBA 5GADI 5K8PA 3SCJE 3MEGB 4QWDA 3EVOA 4HH1A 4DR5K 1FDBA 3CCJS 3CCLN 2Z56B 2ZE2A 2QMXA 2OEJA 2YNFA 4ZVEA 5A8KB 4LF7F 2DXEA 1VMBA 3MD1A 1UJ4A 2J0SD 3RUBL 1Z6RA 5GMDA 4DR3F 3KLHB 2D3O1 2F4VK 4ID1A 1IBKK 4N8OA 4M3RA 1MWKA 2QN6B 4FDFA 3NF6A 4ILMA 3TAMB 3VQ5A 1VI7A 4JI6J 2CG4A 4USWA 1TUYA 2O8DA 2GJIA 1BOTO 4C3LA 3GR0A 3GV5B 2HHHF 3CO9A 2WCXA 4B3SK 3O5BA 3IG1A 4CLUA 2CADA 2DHHA 4DTJA 1LXJA 2NXNA 4NOHA 2O67A 3BS9A 3T19A 3ZC4A 3MEEB 1NEEA 3RMAA 1JLGB 3ZETB 1XMQK 2DGVA 2HBQB 1CS4A 2AGPA 2QFIA 1KLMB 1RT1A 1OPIA 3H0PA 2SXLA 1EB0A 4OI4A 1NZAA 3M1FA 2R7RA 2QYGA 3V2UC 4OYBA 1X4EA 2C28A 2XY5A 4XTTA 1UA1A 3FCWA 2FLOA 4FF1A 1HJOA 3NH2A 2V4RA 2CZ9A 4L8RB 5KRSA 1K73O 4FJLA 3OHAA 1LAVA 4QS9A 2UUWA 1VQ7S 1NB2A 4ZA1A 1QZ6A 2E6MA 2LU2A 5KAKA 3CMAN 3CQXA 2W40A 3AQPA 4EHTA 2FVCA 3RSEB 4JHDB 4XH1A 1VQ5N 3QETA 4F4KA 3RMCA 2LQJA 1ZBLA 1Z4UA 1RWKB 4H4OB 1U8SA 5HATA 3EY1A 2RPIA 4EFAC 2RIJA 2ASYA 1FX4A 2ZC4A 3D6TB 4LFBJ 1ZS6A 3OYNA 3TAFA 5HJXA 4FPAA 2DT9A 2RB7A 1YJRA 4C8NA 3TTFA 4GKJF 1WNEA 4CH7A 3TSPA 1WBDA 1IVZA 4JD2B 4FVUA 2KL8A 3TSQA 4YP3A 1DTTA 1MWQA 4CBUA 4QU6A 2OPRB 3QFUA 4K59A 3D6FB 1VSEA 4ECYA 3HVAA 1T95A 3A12A 1N32F 4J9QA 4OYIA 3VQSA 5LL6d 3VQ9A 3VPZA 1Y64A 3DRPA 3SJHA 1U2RA 3T5LA 2P6TA 3VZIA 5BYRA 3KUEA 2QE5A 2V5HG 3AAPA 2COLA 2W1BA 2HZAA 2V8GA 1TUWA 4JI3F 1YJ9N 3DFEA 4Z0UA 1Q53A 2LEPA 4C97A 5FD1A 1WI6A 3DI6B 3EWGA 3JTNA 4YUDA 4LF9F 3KZBA 2HRYA 5M1PA 4MTPA 2W9BA 5AQHA 1HL6A 2VG5B 3AVMA 3GILA 2HWHA 2QWMA 1F5AA 5GAHI 2MKSA 3U6FA 4HTJA 2NNWA 2VHGA 4JI1K 2BUNA 4PZVA 1HQ2A 4IWVA 4QOZB 1G3OA 3HYFA 2AT1B 2XQCA 2JLEA 1KQSR 3UWTA 1RDDA 3C14B 4M3YA 4WQ5A 2XS7A 4WFYA 4HDHA 4ZLJA 2FJXA 4IJNA 2LLZA 4HVJA 3IRWP 4KHWA 2ZVSA 4KGMA 2DBBA 3SIPB 1RNHA 1EETA 2QG9B 2LA4A 3DNCA 4DFPA 3KHLA 1R7IA 3EEQA 2ZD1A 4DWIA 3VQAA 1RACB 3VAMA 3LUYA 2EFNA 1HI0P 1R59O 4JI5J 5EGYA 1JWWA 3TTCA 3OBIA 4DF4A 3GIMA 3C6TA 3NNCA 3QMQA 3PJXA 3MDFA 3QGIA 3OQ2A 4ZVOB 1WSJA 4ZP6A 3G82B 3MMBB 2O01C 3DLBA 2LEAA 4QQBA 2GC8A 2DGWA 2JEIA 3O08A 3C6AA 3GBTA 2GGPB 2VKRA 3PVXA 3W7BA 1S22A 2LKZA 4LF4K 4DXLA 1VCTA 3OPKA 1X9WA 1IJEB 4E1NA 3E1YA 3FSYA 4QU7A 2F1FA 1OH8A 3SQ1A 2GJ2A 4LSZB 1U45A 5LSOA 4CZHA 2GNKA 4EP4A 8RUCA 3U1LA 2KJVA 4CIFA 3CMES 3O9QA 3CCSS 4LF7J 4KI6A 1NGFA 1VQ6S 1L3VA 2WVCA 2GELA 3KLFB 5CABA 3EVWA 1KDNA 3QEXA 4YOUA 3VQ8A 3RYLA 2BE2A 1S6QB 2WZ1A 2VG6B 2DGUA 2CIMA 4PUOA 3T6BA 4EYIB 4DR3J 2QKBA 3TZWA 4CFDA 2K7KA 1HKAA 2BM1A 2K3IA 3TJ9A 1GLCG 2E5HA 3DGPA 1WUUA 4USJC 3X3UA 4BC9A 1QVGR 3ZCMA 3A0IX 2NXCA 2AEJA 1QHAA 1JLEA 3HCXA 2I6WA 1GX6A 3I32A 3MF5A 5DS7A 1GNKA 1LK7A 2KKZA 2IBOA 2ZNYA 5CD4H 3QRRA 1T6DA 3VGUA 5BRHA 2HHHJ 4J9KA 2PY5A 2JX2A 4IEIA 5D4LA 2AEMA 2DB1A 4LF2A 4YB5A 5IOLA 1RABB 3QNNA 3JQMA 5GMEA 2GZOA 1VSDA 1WSVA 4O5FA 3KK1A 1RU1A 1AB8A 2CH6A 4IKAA 3ULHA 2Y0BB 2VFVA 3Q8PB 1F9EB 1BXNA 4A8KA 2MGZA 3W64A 3DMJB 3LTOA 4J9RA 1WC1A 1RLCL 5G0RB 2HAFA 3VAFA 4BVPA 4DV5K 3OTOF 1CJTB 2IRXA 1FRKA 2X3DA 2QGFB 3SXLA 2E29A 3HPHA 4WFBL 2HGMA 4CEZA 2E8AA 4O8KA 1VQNN 5J2QB 1J6ZA 3POTB 2I7NA 4LF6F 2CNOB 3Q8SB 2MKJA 1YITN 2OTLN 4R8UA 1JLCB 4MT1A 3X1LB 2MKCA 2WVDA 1VQ9S 3V9ZA 1TV6B 1BIUA 1S72S 2MHNA 2CRLA 2JWKA 2XHCA 1W0HA 1PILA 4A8MP 3CDAA 4L76A 4KTQA 3TRGA 1RTIA 3FRYA 2Q1NA 3GJTB 4UQTA 2FHKA 1RTHA 3ELHA 3P6YC 3PXGa 3AXMA 4P6QA 3DXMA 2DCLA 2HNZA 3QJJA 4J9PA 2CJBA 1S12A 1GAOA 4CJPA 3FNNA 4RPFA 1MU2B 4MJKA 3Q7BA 2AMCB 2BANA 3MN6A 3P39A 4IG0A 4FWLA 4GKJJ 1HQUB 1F2HA 3DRRB 5K14A 3V1QA 3C16A 3EM1A 3G86A 5KFZA 3QT6A 3IGNA 2QEXS 2E1ZA 1RT3A 1U8WA 1MWYA 1ZAWA 4UTGA 1N32J 2G13A 3VAKA 1FERA 4BC5A 1EX8A 4M5MA 2D0OA 2CPDA 1ATSA 4K4XA 2Z1JA 1OO0B 1IO2A 4QYZK 2FHMA 2GVZA 1NMEB 4C48A 2H4YB 4E1MA 2JFKA 1S7IA 2R7VA 4I69A 1T8EA 4BE2A 2B9EA 4JI3J 3H90A 3RBDA 2NRRA 2QWLA 4JRQA 4I6MB 1U1KA 4F04B 1WDDA 5L1IA 1E4FT 4M5NA 4XPCA 3CC7N 4LF9J 2RKIA 4A57A 2V6AA 4KB7A 1IXKA 1ZM2A 3FKBA 4DCJB 4ZCMA 4W90B 2QLXA 1WB9A 2HVDA 1SJ1A 3R6MA 5KGWA 2HB5A 1WN7A 3VZHA 2GIFA 2DR8A 3AVCA 2NRTA 3CG7A 5HQMA 4CH1A 2FGCA 3VETA 4DSIA 2KZMA 3U8XA 4AQYK 1VRUA 2ZZTA 1N5QA 3SEOA 4BC4A 3GV7B 2LXUA 2K8GA 4B9LA 2GAHC 4BRHA 3FSXA 4Z4EA 1W7AA 1S0VA 5ETKA 1N0UA 3H42A 3GOIA 5FLXY 4CI0B 4A8XA 1CULB 4K4YA 3ZX2A 4FWPA 4CJ3A 3OFGA 2YX4A 2XTJP 2R7YA 1LWCA 3K89A 2WC9A 4KH0B 3BB5A 1O0PA 1OY6A 3NGZA 4LSLB 3JSMA 2RN2A 3L8BA 3OUYA 4E89A 3LPTA 3OSPA 4I67A 5EWEA 4KJIA 1JL1A 3HVWA 1LEOA 5J1NA 3HP6A 4IDKB 3H3NO 3UB5A 4ED5A 4KAIA 2O8BA 4KHQA 3SMPA 4QR2A 4YDUA 2DRDA 2QRRA 3HZEA 5AZJA 2ATLA 2KM8C 2PGCA 2J7KA 5K8NA 4IO9L 3ILLA 4M5JA 1RK8A 3C94A 2ZGZA 3QAEA 4WFBQ 1JLFA 2ILYA 2J9DA 3LDLA 3OFHA 4CJTA 4FPIA 5EX5A 3K7RA 2ZOMA 2F8EX 4M7XA 4ID5A 4C8MA 4NRUA 3ET6A 2XY7A 4CF2A 2B7BB 5KT6A 4U67L 4B3TK 4FWOA 1S5JA 4FK0A 3GJRB 5LJ5Y 1VISA 5KT2A 1Q16B 2DR6A 1VSMA 1FNMA 4PG8A 4KIAA 5J2PB 4OPJA 3AV9A 3IAS9 3QT5A 2DPIA 2DJWA 4Q8EA 4MLHA 2Q2RA 1FRHA 2QZ8A 1Y97A 4DQQA 3UN5A 5I9EB 4EBCA 3TU5A 3CJ2A 1S6OA 2DHXA 3CJKB 2DR7A 3HLUA 4FWQA 3TABA 1Y5NB 4J2EA 5DLGA 5IFMA 2IC3B 4NXMK 4PR6A 3CVKA 3V1RA 3WNFA 2X6SA 3U1NA 5DDPC 3D45A 4LQ3A 4B8CA 1GTHA 1UWBA 2F7VA 1J5OB 5C2FA 3N01A 5AQTA 4CLKA 4MH8A 1BO5O 4LFCF 5BRFA 1X0FA 3NFAA 3QEWA 4ISGA 2WB4A 5IM0A 5KT3A 1EARA 5KG1A 5E3PA 1T9WA 2R2RA 3OXFA 1B0VA 1FE0A 3QFWA 1NSQA 4B9SA 4OGCA 4MK8A 2I38A 1XN9A 1CC7A 1F2GA 3QWUA 1TMMA 3VVTA 1R6VA 2V4JB 3O9TA 3OTOJ 1N6QA 4KR0B 1GOBA 4RWTA 5E2QA 1ZBUA 2V63A 3QRPA 2IDEA 3H40A 4JI4K 4LF6J 1NGHA 3IBFB 4YHHF 1Q8IA 2I1RA 4ZITA 3RMBA 3THTA 4QYRA 3HULA 3ZO7A 3C19A 3OYLA 1R0AB 4RUBA 2K1RB 4P7TA 1TKZB 3CCQS 4ICLB 4OKKA 3MR7A 4ZPVR 4ED3A 1T94A 2HK2A 5CCLA 2IVOA 3O4NA 1FDNA 3KJVA 3PYEA 1PJ7A 2KH9A 4DUYK 3H5UA 1RT5B 3SAFA 4NCGA 4DPXA 5H9EK 5LM7E 3GFZA 3CC2N 2JHEA 3L7PA 4UF4A 3CJTA 3CDBA 2ZWHA 2EKNA 2V94A 4E7LA 3RGIA 3M8PA 3VOVA 5A2QU 3KK2B 3UDCA 4HHJA 5IWAJ 1EP4B 2FVSA 1BUPA 1UJ6A 3CD5A 4OX6A 3VQPA 5JVHQ 1RBSA 3NP5A 4K5RA 3DU6A 2LCWA 2J5AA 4ZP8A 3I55S 4IO9Q 4G1QB 1T03B 2CFXA 2XO6A 3V9UA 2BYCA 4FWSA 4IQXA 3G71N 1HWKA 4ZDNA 3EZOA 2ZJRL 3GU0A 4LR8A 4DCOB 5AQKA 4BCAA 3ZX3A 2FYXA 2W8KA 4WP8A 3UE2A 5M1KA 3I56S 2CPIA 4CI6A 4E7HA 2X6NA 2OO4A 3CCTA 1WSIA 4GY2B 3D2EA 1Q9YA 4CJRA 1K8AT 5F3TA 4O3QA 2WSCC 4GRSA 3OHBA 3VALA 4EEYA 1CZBA 3MMCB 1C0FA 5K5MA 2MJUA 1OH5A 1D9DA 2MSSA 2Y1RI 1FD2A 1XMOK 4JK9A 3MMAB 4HR2A 4X64F 1HRHA 2A1SA 4H0PA 4EP5A 2AV5A 2BRLA 2DNRA 2HZVA 1QD1A 4TY8B 1WC4A 3HTVA 3QQCD 4RX6A 4CFCA 1URRA 3TR8A 5BYQA 1U1NA 3RVCA 3HOTA 4PQUA 1XR7A 2JEGA 1PC5A 2HBJA 1VQ4S 1HW9A 3J7YI 2MZJA 3KG0A 3R27A 3M6VA 2MQQA 3MM9A 4M5GA 3TSUA 1HNWF 2OEMA 3QO9A 4OYZA 3R1HA 1R43A 3TAEA 3PEHA 2WW4A 3D2WA 1TL1B 4OZJA 2VKZG 4W5TA 3FR0A 1P8ZA 3MPDA 3R6LB 3DLKA 3E9PA 1VQON 1S1VB 1EXQA 2AX1A 3NDKA 2XYGB 4USMA 3R5DA 2ZH2A 1PAEX 1ZM9A 2NPFA 4PG5A 4U96A 4H5WA 2MTLA 4DV1K 2AU0A 1ASWA 3IXQA 4YOXA 1JJ2M 2P9UB 5E41A 5K8MA 3CJAA 2XYHB 4BACA 3JQJA 2QLJB 4M8LA 2D1KA 3UDEA 2E20A 5KFHA 2DTJA 2FC0A 4MAKA 1KSPA 5E33A 5AQYA 1OYEA 3M7VA 1L3UA 3BUZB 2BTFA 1HPZB 2FZGB 1N5VA 1RDCA 5L9NA 1UFKA 2QM1A 2ZJPQ 1NM1A 4H0YB 1N36K 1U48A 2O8CB 5DGBA 1FX2A 1VC0A 1N5YA 1I5OB 3QBWA 1HBOB 2V68A 4LQ9A 4J7CA 4Q2MA 1NJIO 3EPIA 5IZHA 3OR2A 4GV3A 5KFRA 2VUGA 4CNZA 2ASDA 1KONA 1HBUA 4ZCIA 3HHEA 2QIFA 3MXIA 3I0SB 5C5JA 2CQPA 2DGQA 3PW7A 2W2PP 3CIPA 2XYPB 2FSKA 1SVDA 3O3LA 3D1QA 5AXMA 5C25B 3OW2M 4USHA 2J7UA 5CZVA 3UKRA 5KFIA 5BPLA 3TWZA 4MK7A 2VBXA 4LFCJ 4E3SA 1Y5LB 3MCAB 2IM3A 3J7Z5 3V6DB 1YGYA 3OTBA 4F2RA 4WP3A 4P10A 3V6HA 2W4CA 3A13A 2A18A 2X1GA 2ZJRQ 3VAJA 3HHLD 3UW1A 5FPNA 2L41A 2XNRA 1WSFA 2DIVA 4XDCA 3P31A 3EDQB 3Q8VA 4FJ9A 4ZJQA 4DR2F 3D3CJ 4BREA 4MYTA 2YKMA 5ETSA 3DRPB 4USUA 3GONA 1U1MA 4HTLA 3PW5A 3L4QA 1S49A 1VQSA 4LH4A 1BD6A 3LP1A 4YHHJ 1T05A 1N33F 3JSRA 5B0EA 4HHTA 3I4PA 1B9FA 4DUZK 4IG3A 1M5SA 5HL7L 1GMWA 1DGKN 1E6VA 1MMDA 3Q89A 3DLLQ 1FHTA 1V9OA 5E26A 1RT4A 3LPEA 5CZ1A 2HQIA 3Q23A 4CJVA 3TAGA 2FC8A 3O3HA 3M32A 3HPOA 4DR5F 2DGOA 1VQPS 1XC3A 4BC7A 2OA8A 3KHGA 3HDSA 4YR3A 3VQ6A 1Q82O 2ZHAA 4ETZA 2L9NA 5C7PA 3MPVA 3O4WA 3R8YA 4IRDA 3CW2C 1URNA 3IS9A 4F9OA 2C3UA 1BGXT 5A0YB 3EO3A 2KT3A 4YOYA 2B0GA 2NZCA 3CJ7A 3W8GA 1ZBIA 3O44A 1UVIA 3GP9A 2OD4A 1IBKF 4XH4A 1G4CA 3L2VA 2NUUG 4JS4A 4MYUA 4RWXA 2H65B 4JYAK 4DTSA 3MM6A 4JV2A 5C24B 1RA7A 4PEOA 1LW2B 1S99A 2HAIA 1PAUB 2VONA 2P9KB 4JKBA 1YWXA 4B3SF 2YWWA 3MXJA 4MQ3A 4FJ7A 4OLAA 4RW7A 3CCES 1WOPA 3HHLB 2YX1A 3D2FA 2A3ZA 1VQ7N 3ZSRA 4KC5A 2VOPA 2M3DA 3I8BA 3PHEA 1XMQF 4LSNA 3BN7A 1XHXA 4M7YA 3T1YK 2C3OA 3BEGB 5KFGA 1VHFA 4U8VA 2R8IA 1BCOA 2Z2YB 1HFEL 4X64J 3VEWA 3MAQA 4OHZA 3VQ4A 3MCSA 4JNEA 4CJ5A 3CCMS 5DJBA 2KZZA 3KWIA 3M3ZA 2OSRA 3TX0A 2VQEK 3C6UA 1CJKB 2Q3PA 1SC4B 3G8SA 2HS0A 2BE2B 1RT6A 2EWSA 3DLGA 1HW8A 1SJQA 1UTAA 4ID8A 3WC0A 2YVSA 3DGPB 1WHXA 4J9NA 1HNWJ 4BRPA 1DLOA 2BRKA 2G1HA 1GXLA 3EL2A 1N8RT 1U0HA 2DHGA 4UY85 3RJMB 4WU3A 4ZPAA 3T5JA 2LSNA 3DLJA 2IA6A 1SB6A 1U6FA 4IR1A 4ECUA 3MDQA 2M52A 1SJRA 3PTWA 3HJVA 1KLNA 5KFTA 3D3BJ 1UVLA 4JV5J 1DFDA 1SJ4P 3DOKA 3SBMA 1X7VA 1R8AA 3CUNA 3RW7A 1CXQA 1JNRB 1MMNA 4RNFA 2YWEA 1M1GA 3CC4S 2ERRA 3EGNA 3CYMA 4MMOA 4CBWA 4PWUA 1YIJN 3M2RA 3DLEA 3GMGA 3W9IA 4QR0A 4CO3A 4N47A 2YTCA 3IAYA 3MPYA 2P2CB 1M5OC 5HANA 5HL7Q 2DHSA 4DU7A 4FLWA 3FE1A 1HX1A 4TLRA 2J6TA 4ZPDA 2ZDOA 2ASOA 3I0RA 5AQXA 3NOGA 4E19A 4FS1A 1YTUA 2W7OA 5A8WB 2PN6A 3SPZA 2PFFB 4XO0A 4AHRA 3ZTPA 3AVLA 2OUGA 2D0PA 3TI0A 5F8MA 2UZAA 3ENQA 2WTFA 3PEJA 5H1SV 4KHSA 4FOEA 2FBYA 1S1TA 5CA5A 4JI1F 1MSWD 5KFVA 1JJHA 3RAXA 4AL5A 1R8BA 3CJCA 2CNLB 2J6UA 2HGNA 3HSDA 1RDBA 3MAAB 1BG3A 2F65A 3N6NA 3M1VA 4ES2A 4M1KA 4IG0B 4LUBA 5KG0A 2BDPA 1JLBB 1HYVA 2R4FA 3BYRA 4CJEA 2HKEA 1RE1B 4WYWA 1LV5A 3EN9A 2EW9A 5GINA 4H0OA 3IR7B 3O8MA 2MLYA 4K4UA 2E88A 4DB3A 2EK6A 1LWFA 2GJFA 1P8GA 1X4DA 1CJVB 3FZBA 1Q5YA 3S1TA 4DR2J 2XLIA 1Q8KA 3KMQA 2EWHA 5F0UA 3TZXA 3LWLA 5LOQA 3J8AA 1S4FA 3ENWA 4WYLA 3IM9A 3AVKA 2DY9A 3BR8A 3CMEN 5CHCB 4F4ZA 3AO2A 2E66A 2NZ4A 1N33J 3FCHA 2F5GA 2E1CA 3DM2B 4LFAK 3C2PA 3OYDA 4Q2LA 4LF4F 4CJ4A 5DZ6A 2VBWA 3TQ1A 1Q0NA 2NXEA 3LP2B 1FT8A 4KHNA 2AKWB 4C4WA 2D69A 5D0HA 3D6RA 4EZ6A 1RKJA 4ILJA 1T6CA 4JK7A 3Q8YA 4CZIA 4DR5J 1NJWA 2HLUA 1HWJA 2ILZA 1NRKA 5IS2A 5AQVA 3M9MB 2GV9A 6FDRA 1YJNN 2YQ3A 3KDOA 1QAYA 2QMUB 2AYMA 3VF0B 4USKA 4OKJA 4JK8A 2QK9A 3U7JA 1VJWA 3NRBA 4WZMA 2N7CA 2I5JB 3I6PA 4FLXA 1QY7A 4DR1F 3PZPA 4NEZA 4CHYA 1VGYA 1HJRA 3SQGA 2LU1A 2IAJB 2C2NA 3MCMA 1VLOA 3GCXP 1IBKJ 1B7FA 4A8FA 2BJDA 1N88A 3T6JA 3V4MA 3JSMB 3TA2A 4XH5A 5AQMA 1FW6A 3OUYB 1F0XA 1AROP 4AM6A 3K58A 1JK9B 1O8BA 5B0FA 4DL4A 2WOMB 4CO0A 1MROA 1G99A 3R5GA 1QLNA 4B3SJ 4KHPK 5LJ3Y 1RTDB 5H9FK 5IT9Y 3G6ES 3N9UC 5KFSA 4RKUC 2OPQB 1VQ9N 1SKUB 1WSEA 4HEA9 1Q7LB 3MURP 3NXZA 2YKNA 1XMQJ 4N8NA 1WEXA 2VGMA 3KNGA 2RRAA 2X1AA 5I3UB 4IJAA 1N52B 5EN1A 2U2FA 3M9NB 3CI5A 2RF2B 5HRNA 2P9NA 1M5HA 2FZKB 2H5IB 2Q31A 1S1WA 2JVOA 2AHOB 3VN5A 5U47A 4E8UA 1KRPA 1TTHB 2EKYA 1MWMA 3QRQA 2DNPA 1HBMA 4OYOA 1NUEA 3DLRA 2NUHA 3QNOA 2DNKA 2WONA 3PW2A 3GG0A 3SUPA 2VL1A 3WIVA 4DL6A 4CK3A 3CCLS 5HP1B 5EWFA 3IO1A 2EFQA 1OYDA 4DTXA 2CQ2A 1NGEA 1ZZFA 4CLSA 5LJWA 3DU5A 2YH1A 5CH7B 4HT5A 3IUCA 3MWTA 1K0TA 1FVQA 1RDUA 3TANA 2QFJA 3HBTA 1IKVA 3LAKA 3HM8A 2DGXA 1RILA 2XBPA 5CYJA 4N76A 4M3TA 1L3TA 5C42A 2KB2A 1GLBG 4X65K 1T9UA 3NF7A 1WBBA 3ZT2A 2KJWA 1TL7B 5M2RA 4RNOA 4RW6A 2M8DB 2G4BA 3LDOA 1YUWA 5I42A 2JWLA 3QBCA 4RNNA 2JDJA 1TVRB 4OJ1A 2B5JA 4HI2A 5T7BA 2IFXA 4B08A 4E2FB 5C12A 3H98A 3ZSWA 3BDPA 2ZBIA 2P9IB 3N6LA 3N5BA 2XSFA 4DL7A 4OPHA 4QWAA 2K06A 1RAAB 4J9LA 4J9OA 3MK6A 2HQDA 3AGKA 1HMVB 2YHXA 1NDCA 2PIIA 2FSNA 3E2EA 1BQNB 4OPAA 5L39A 2UP1A 2IIHA 5AXNA 5J1EB 4WFAL 1LNQA 3N6MA 1U09A 1D8ZA 1WF0A 2FVRA 4LR9A 1K8KB 2OPPA 4JI1J 2HNYB 1UETA 1NGAA 4JI7K 4BHQA 2IRYA 3HI9A 3CFRA 3PRBA 3J7AN 3Q24A 3GSIA 1VQ5S 4X4OA 3BKFA 2C2EA 4DEZA 3W8PA 1YBAA 3SCLE 4EHUA 1ZOTA 1FWLA 1LFPA 3VWSA 4QZVB 1OIAA 5KFAA 2D5RA 2POKA 1R89A 1UW4A 3VQEA 3ZT4A 4Y1DA 3DOLB 5JJBA 1C4AA 3Q8UA 3KLIA 3L2WA 4ECQA 4JKCA 3CCZA 2KHDA 1TU0B 4JV0A 4Y1CA 2MQLA 4GKKF 1AZSB 4OMFG 4LVNP 2BW2A 1SQKA 4B3OB 1SBRA 3O6QA 4RW9B 2E1RA 2HHWA 3DYAA 1VIXA 2MLXA 2AYBA 3GYGA 4KGKA 1S9GB 1FI4A 1JLAB 1MW7A 1XNRK 1EWRA 1R8CA 2M9KA 3MEGA 2Y1LB 2MY7A 1JXBA 4LF4J 2ZQBA 2RDDA 2AJ1A 2P5VA 3PIOL 4CO4A 2MKIA 2FVPA 1QQMA 1REVB 3MFHA 4UZBA 2R2TA 5A8KA 1YJ9S 2HW3A 5KFQA 4E7JA 2W9CB 5AQPA 4M5IA 4DV2K 1T7PA 3I5BA 4YN3B 4GMKA 3UNYA 4B3TF 4RW4A 2VDIA 2AJ0A 4OYXA 2FD2A 2CUYA 2BW7A 2LFVA 1C1AA 1LWXA 2ITGA 1VQKN 4AH9A 4OYPA 4CFBA 2F9WA 3K5PA 1DRZA 4M3XA 1IKXA 2YNHB 3HVTB 4DR1J 4NLSA 4AD6A 4ILLA 3TAMA 2M70A 4I7FB 3S01A 1JCEA 1PKUA 2CH5A 2HHTA 2UUBK 2FUG9 4N7TA 2FGOA 5KFPA 1PYOB 3KFWX 4K0KJ 5L38A 4CF9A 3OA9A 3R2DJ 2D41A 5AT1B 1OSCA 2GS8A 4DHVA 1U26A 1X4AA 1J9AA 1YVFA 4NXMF 2ZBPA 4R5PB 4DV0K 4KKOB 1YKWA 4BLGA 4KHMA 2ASMA 4DTUA 3KLGB 1LQ9A 1WF2A 3MEEA 1EHWA 1SUQB 3AA9A 3ZETA 2BJ1A 2M7SA 1KLMA 1G2EA 4AILC 4IOAL 2HS3A 3GJQB 3VA0A 2VPWB 5RUBA 3KD5E 3MM8B 4GVBA 1GMWD 2PI4A 4FBTA 4HCBA 4KO0B 2CYYA 1UEUA 2RHQB 2AJQA 4WQ5C 3I31A 1TFYA 3KHHA 3M8RA 3PIPL 4UOFA 4B9VA 4CZJA 4M5DB 4B3RK 3ICLA 4JI4F 1Y3JA 4WU2A 4PPZA 4WFAQ 4O3OA 3RSEA 4JHDA 2DXFA 4AYBD 1FRJA 2RUGA 1YG0A 3I8DA 4H4OA 4JOUA 3EGWB 3CDWA 4WCEL 2XNQA 2RQ4A 2V7YA 2XMUA 5SUHA 4KY3A 3EKUA 3W0LA 4K7QA 5BR9A 4HL9A 4ED4A 4JD2A 1U1OA 4UOHA 2J9CA 4FWKA 2EFVA 1RSCA 2OANA 3VF2A 4NI2B 3QT8A 2W25A 3IP0A 1GEHA 1RAIB 3R5JB 1W25A 1RBUA 3OYEA 1RWMB 2LP4A 3AJDA 2LQ9A 1WG5A 3L7OA 3AJ2A 4CJWA 3RB0A 1X31C 3A4TA 3PIOQ 2J4RA 3DI6A 3SCKE 2MQNA 3GIIA 3OY9A 4C3KA 4B9MA 2APOA 1H38A 3ETMA 4FKYA 4ES1A 2VG5A 3SDEB 1RKIA 5AQOA 4H5NA 4FLVA 4B1YB 3KHYA 4U9RA 2V51B 1VK8A 2YNGB 2YBVA 5DO2A 1A5XA 3HI0A 3OVNA 4JKGA 4G65A 1S9EB 1WTBA 1RT4B 4TY9A 1QQOA 1XBWA 1F5BA 2EVZA 3HFKA 4PG7A 1T3VA 4RNMA 2OTLS 2F40A 4JKHA 4HHUA 4RW8B 2R7TA 1U2CA 3MUVP 1Z1ZA 2J8SA 4L75A 4CVNE 2JH3A 3U9ZA 3AO3A 1NH7A 4RBTA 4LF5K 3H4BA 2RE2A 2IMWP 4USTA 1B3TA 4IEEA 1WORA 4K5SA 3T1HF 4F3MA 1TUGB 3P4IA 4J8FA 4XDDA 1SQEA 3L3UA 2QMWA 4LF8F 3W3DA 3G82A 3MMBA 4GMJB 4AE5A 5CYMB 3BGLA 4L3KA 2O4GA 5FROA 4ZVSB 5HVHA 3M8ZA 4IOAQ 1JLQA 2VFTA 5IT9U 3S3OA 2DTUA 1YRTA 2GGPA 3RAMA 3AT1B 3HFZB 4K42A 2KXFA 3F41A 4GKKJ 1EZZB 2QLFB 1Q5VA 4UW2A 2J9DE 4Z4GA 4YY3K 2N4DA 2OD6A 1NGDA 4WZQA 4X62K 5E3CA 2EFPA 4DX7A 4DV1F 3G6YA 2FF6A 3TP2A 4FLTA 4RBUA 3PIPQ 1KQFB 1UVNA 3TEGA 4OZ5A 3RBEA 4HT7A 2J0WA 3KLFA 2BX6A 3LL3A 3OYAA 5L46A 1XJWB 1S6QA 5AQGA 2VG6A 4ECTA 3R5BA 1K8AO 2F9JA 1S5ZA 4B3TJ 3DN9A 4NRTA 3LDSA 1CBKA 4QOTA 5LMNK 3HSZA 4WCEQ 2JZ5A 1NK0A 4DL2A 1N36F 3S9HA 4DS4A 4CLFA 2BZ2A 2HFVA 3W5XA 3D67A 3M05A 1R31A 4AL6A 1NGCA 3L4BC 2RQKA 4BDPA 2VYPA 1FEEA 1KC8T 3FZHA 2HHQA 3R6GB 3VEZA 2CA9A 1EQMA 5JLHA 2QL9B 2XHBA 2HIYA 3DHXA 2OZSA 2UXCK 2HZCA 4HACB 4NXMJ 2NPIA 3ATUA 3MN5A 5DM7Q 1X4FA 5D4OA 2LMIA 2VC1A 3NY0A 3T1AA 3MWBA 2BOPA 3P83D 3DMJA 4JI2K 4AXJA 1UP1A 1Q7YT 1UKUA 2LXIA 3J7AP 2WVEA 4K4VA 5G0RA 1LW0A 3C15B 1CJTA 1UA0A 2R3VA 1J5EK 1JQGA 2A41A 3ID6A 5J2QA 4Q5VA 1RJJA 2ITMA 5HLFB 5L8RC 1DZ5A 3PR5B 2ZZMA 3B54A 2RSQA 1JLCA 3A2FA 4PWDB 3ZSQA 3AQOA 4C11B 4DS5A 1TV6A 2OZMA 1NLKL 3UDLA 5AQFA 3ZTOA 3EZ5A 1N4LA 4JI4J 4JV1A 1KD1O 5TKWA 2WVFA 3KXDA 1VFJA 3WDOA 3LPYA 1YQHA 2IVNA 4WE1B 3D9BA 4LRAA 2XMMA 5A2QO 2RQCA 2AZ1A 3T5HA 2A6OA 1RP5A 3P5BP 2LVWA 1U04A 1WKKA 3OLAA 3NNHA 2HF3A 1WC0A 4QWEA 2EK1A 1MU2A 4F36A 2R8GA 4BRFA 1HNXF 3GIRA 2KG1A 1HQUA 4B8AB 4A2AA 3DRRA 2N3OA 3QGGA 2HQGA 1IBMK 2YJFA 3CULA 1UWAA 2ZKTA 4CIEA 2ALZA 3ITHB 4B9QA 4PCQA 1Q95G 4AHTA 1EX4A 3SUNA 1AT1B 2X1BA 3W2VB 3B6OA 2PSZA 3WQUA 2R2UA 1BMQB 2ZFHA 5D6GA 3SV3A 2DRBA 3HD1A 1TGOA 2V8VA 4C8LA 1JJCB 3FZKA 3AB4B 2QV6A 2CQ0A 1AW0A 4JYAF 2JEFA 4OYMA 1VRTB 2V2ZA 3KK3B 4JI6K 4Y6IA 1IM4A 3DDKA 3DRSB 4WTYA 1EQYA 4I6MA 1ITGA 4X4TA 5KG5A 1VC5A 1W26A 2HRUA 1K47A 3IM8A 4Z37A 3W65A 4FO0A 5H1SQ 4X4UA 1TL4A 1B92A 4C1NI 2W8LA 3ONQA 4O55A 1RWXB 3CPEA 2CJ9A 2OKQA 1ESVA 1OSDA 1YJUA 3L6QA 4CEFA 3JYTB 1GMUA 4H5VA 4FYXB 1N5SA 3ASMA 2QJ3A 2O66A 4OI3A 3MM5B 3GCWP 1IR1A 2YCHA 2RS8A 4PL8A 1F5CA 1I3AA 4X4SA 2CGLA 4DL0C 1E3MA 3J7YU 2V50A 3HF5A 3AOBA 4ED1A 4DKWA 2VQEF 1CULA 1F3VA 4DCPB 3K0JA 5B8HA 1RTJB 4F0KA 4NZ0A 1YJTA 2E2QA 1Z26A 2NZTA 4C0HA 3NOCA 4LSLA 1WHYA 4LRCA 4DV7K 3T1HJ 2HRTA 2V0NA 1CZ9A 4A8SA 4GC7A 3GQCA 4Y2IA 3CC2S 4IDKA 2QC3A 1RAGB 3P4UB 8ATCB 3QFHA 2L3MA 4BS2A 3MI7X 4LF8J 3FGVA 4B1XB 4PKGA 2JEJA 4IRKA 1XQSC 3HSTB 3QPIA 1LXNA 4OHVA 4BRKA 4J37A 3CD0A 5GIPA 3V9WA 2PE8A 3CDEA 4DN0A 1KEKA 4RU2A 2FJWA 1HD1A 3PKYA 4F02A 1ZYQA 1NWKA 1YZ7A 2B6AB 2VPZB 3SQ2A 4P2XA 4A59A 4K4ZA 3OJSA 4H5TA 4DV1J 1FFWB 4P75A 2XS2A 2G2ZA 3BGRB 4OZ1A 3HM9A 1FKAF 4DBQA 2IDOA 2BKNA 1UAXA 4EZ9A 1OJ4A 3TUZC 1VSJA 4BG9A 5J2PA 5BN9A 4YOTA 4BRGA 1NJZA 3T5KA 4JI8F 1NKEA 5C0YA 2FJAB 2HVIA 1PIEA 3BF4A 1C0TB 1Q81O 1N36J 2RU9A 3CJKA 1FRXA 4BRLA 1S97A 2M2BA 1O1WA 1EAYC 4JP8A 4AHUA 3TR5A 2F9TA 1Q8BA 3W5YA 4NL5A 2EBGA 3WNGA 3MOZA 4OZNA 2IC3A 3VESA 1QVFM 5E0OA 4NB4A 2UUTA 3GG4A 2D9OA 1QTNB 1J5OA 1I51B 4FS2A 3FMWA 3KJNB 2GHWA 3QWPA 3CJ3A 3HO1A 4KV8B 2X3GA 3PCOB 3LDPA 5E3AA 4BR4A 5KOWA 3U4LA 4HKQA 3FZMA 2Q43A 4K4TA 1R6YA 3T41A 3G2XA 3LA0A 5C42B 2XGPA 4CE9A 4FVCA 1GXUA 1SQFA 3VQQA 1Y10A 4A46A 2IJRA 4AF1A 2IJNA 4CF8A 1V5VA 1N48A 3UKUB 2Q79A 3D6MB 1RBLA 2RNEA 3MR5A 1VQOS 5I42B 3CMQA 2C2DA 4BG8A 4IOXA 4JI5K 4TVAB 3F56A 4WTOB 1R0AA 1OH7A 3AO1A 1LAWA 3BBCA 1RCOB 2K1RA 3VTHA 4HI1A 1TKZA 1O5JA 4ICLA 4L3QA 1G15A 1D5AA 5KFDA 1RWPB 2FB0A 2ZOGA 2KRRA 3ZSXA 1SKRA 2ZH5A 4LFAF 3J81O 3NMRA 3IFRA 2E2PA 3H08A 1GMVA 5LJVA 1WNSA 3CNQP 1RT5A 2G8FA 2MEWA 2OTJS 4ZVRB 2XMKA 1UCNA 1QVFR 3QEVA 2HQ3A 3DXKB 2HPUA 3HHKA 4O44B 1R8HA 1DQAA 3M30A 1B70B 2RT3A 2ZBRA 2GQQA 3EVMA 1HNXJ 1I3OB 1WUAA 3NS7B 1FKOB 3KK2A 4LF7K 3Q86A 4U7BA 4O3SA 2W42A 3ENBA 1EP4A 1TK5A 1SI9A 3I5AA 4UOGA 3CQ8A 1HNIB 4DR3K 1G1XA 3G6EN 3V6KA 4O5BA 4G1QA 2UVUA 1T03A 4QCLA 4QAGA 4FWMA 1S1XB 3CJRA 1NGIA 3H5XA 1IBCB 4DX6A 3Q83A 4PY5A 4CIGA 2KQ2A 4OX9K 2MYFA 4KPCA 4DQIA 1H74A 1WOOA 4FXWA 4JYAJ 2OYQA 4DTNA 3H2VE 1X5TA 4KH6A 4NX9A 3BR9A 3C65A 3MMCA 1RWOB 2QA4N 3FRZA 4DQSA 3ULEB 2B9XA 4KHPF 2J0QD 2JRSA 5DZ7A 2CDRB 2XC9A 3S3NA 4MKYA 3W61A 4NXNK 3MMAA 3BY5A 2J9EA 1N34K 1X4BA 1ZBTA 5KG6A 2JFDA 4KGZB 4TY8A 3G0ZA 1IM6A 1HNZF 3DC2A 1K44A 2DEJA 4Q8FA 1YJWN 3AXKA 1X1PA 2HBMA 2G9OA 3FBCA 4BQZA 2IMOA 4C8YA 1D4XA 4YNQA 4RW4B 3DAWA 2R7UA 5D77A 4K41A 2VQEJ 4DQPA 2XSJB 4IOCQ 2ZJQL 1E4GT 5IV4A 1IKXB 3QLHB 1XR5A 5A8RB 3OVSA 2NUBA 3ZNJ1 4CJ7A 1TL1A 4QWCA 1FRMA 2OP5A 3UCUP 1WG1A 1F1BB 1Y0HA 4O3NA 1QHTA 4BROA 1Y11A 3CJ4A 3M6WA 1S77D 1U7LA 3PACA 2HBKA 1S1VA 3ZEUB 4PKDB 3OYJA 2F4FA 3PRVA 1CG2A 5CHIA 4ATNA 2Y3YA 4RNHA 3GFHA 2XCPA 1CJUB 3QERA 3OYHA 3FQLA 3VA3A 3CJ1A 3ZLJA 1RTZA 5KFWA 2LQ5A 2P9UA 5BYSA 3V81B 4M5LA 1SJ3P 3CCRN 3KTQA 4QWBA 4H4KC 5CCMA 4F26A 2OIHA 3I4HX 3DRYA 3JS9A 1H7XA 2W2QP 2PA3A 5CAAA 1C0UB 3THYB 1HPZA 3G4SS 2MZQA 4GVBB 2P9PB 5JMVA 3SNNA 3SCIE 1P6TA 3KVGA 3O8WA 3LDNA 3ATVA 3CPWM 5D0RA 1Q1KA 3OS1A 2DIUA 1DKGD 2KHCA 2E1YA 2NRVA 2E5JA 1VQ8N 2O8CA 2IDLA 3BJYA 2BVZA 1WD6A 1HBOA 2EI5A 3M9OB 2PDAA 4JI8J 3OTCA 3QGHA 4JI3K 2KFYA 3M5RA 1UFWA 1UL3A 2UXDF 3K17A 1NPRA 3ID8A 4NASA 2WVBA 4LF9K 1KWMA 5FIIA 3I0SA 2PMZD 4X4PA 3US5A 2PI5A 2HHSA 1GFWB 2KU7A 1TMJA 5C25A 2QA2A 2C2MB 3OXGA 1D8YA 2V9WA 3SJJA 1FJEB 2W41A 3N4PA 1RAJA 1ELOA 3QATA 3V6DA 4JBCA 4BRQA 1NKCA 2HHVA 4JI7F 3BEXA 2HS4A 4X4NA 1IG8A 2PA8D 3HT0A 5KFKA 1HYSB 3IMXA 3B82A 4DV3K 1IBLK 4U7CA 1FDAA 1CLQA 1FKPB 2YV0X 4DV4K 4HUEA 1ZM4A 3CJ8A 3IDHA 5DDRC 1HUXA 3HHNB 1Y4ZB 4P2SA 2MQ8A 3OV7A 3D66A 1KP6A 4CD3A 4Q0BB 4G6VB 2BJ3A 2A6MA 3SFGA 2AIRB 4CJSA 2VODA 1QE1B 1NSPA 3QZ7A 3UNGC 2AGQA 2E4LA 3QINA 2VQFK 1I1GA 3NVKA 1EKEA 5LXRA 3ZXWA 4NYPA 4M63C 3J80U 4LT6A 2V4QA 2CQIA 2JLGA 2DXDA 4OL8A 1YIJS 3PO5A 4ZLLA 3HL8A 4OJRA 3B78A 3EZWA 3RAQA 1XNRF 2KYZA 4LFAJ 3CWJA 2XEXA 1HI8A 2HLTA 3BBBA 3O3FA 4CNYA 4JKGB 4Y0FA 4NLTA 5AE3A 3THXB 3AVJA 3C7NA 3GYXB 1FTRA 2PT0A 2DISA 1TK0A 3ZX0A 3PY8A 3ISZA 3OYKA 5SZTA 2CPHA 4DV2F 4WKYA 5A0YA 3D0GE 3THPA 3MFIA 2LECA 3IBWA 2HVHA 3A5OC 4FXDA 2CVIA 2GQCA 3K0SA 1H0HB 5F8JA 1FJ7A 1TZ0A 2XZDB 1U2VB 1A0OB 3R2CJ 2ACYA 3CJ0A 1BQMB 1U25A 3ENVA 3F0NA 4CJKA 2E5IA 2WAQD 3G6VA 1PJ5A 3T9NA 5HJYA 3UDVA 5C24A 2UUBF 4HDGA 1LW2A 3PFEA 3UI3A 2HBYB 1D9AA 3W66A 3JB9k 2P9KA 1FO1A 2R8HA 2OAUA 1UW9A 3VGMA 1Y7PA 2RAQA 1JLQB 3A5MC 2QSWA 4KGXB 3OHRA 4DV0F 3OSNA 1F9HA 2H1YA 3HHLA 1T3OA 1Y00A 3MR3A 1XUPO 2HGLA 4HTUA 3AB2B 4G3IA 3OFFA 4KHPJ 2HFZA 5H9FJ 4ELUA 4NLUA 1OQ3A 4A5BA 4FJHA 2E44A 1I94F 4NYOA 4CZGA 2XMJA 2PBDA 2XI2A 1KQGB 1UOCA 3K2YA 2QKKA 1BHNA 3MUTP 5KT7A 4CYUB 4MK9A 3CSKA 1RQ0A 3OTOK 1TKTB 1HNZJ 3TJAA 4M3UA 3IWXA 1RHUB 2CPXA 1CJKA 2OELA 3NGYA 4X4QA 4NLQA 3EE8A 1V3RA 1FWKA 2RD5C 5AJ3F 5AQQA 4BRNA 1NGJA 4OX7A 4B3RF 4LF6K 3PYDA 4Y28C 5C15A 1P9QC 3E3XA 2CQ3A 3DCAA 2DNQA 2BJ8A 4CLZA 2PEHA 2EG1A 4RZRA 5HMZA 3TWHA 4YB7A 5DLFA 2V2QA 4JKDA 4DMZA 1NAQA 3MPUB 1YJNS 4KGVB 2AYGA 3W3SA 1IR2A 1H73A 2RVJA 4LREA 3CXCM 4YR0A 2F9DA 5KFXA 3NMUA 4BE0A 1Y5IB 3A5LC 5AE2A 2GO8A 3G9CA 3FLCO 4W5QA 4LH5A 3QB0A 2YPYA 3VF6A 4BRAA 2XS5A 4AM7A 4H0VB 4DPWA 1DEJA 5IWAK 2Y0SD 1LW0B 4OI2A 3ADAC 1U6ZA 2ZM6K 1HWLA 5BPMA 1H2TZ 2LDIA 4EMDA 4OZ3A 3P5JA 2QWRA 1U1PA 4DFJA 3E01B 4DR4F 4ZPBA 1T3NA 4JLHA 4E98A 2AQ4A 5A8WA 1VQLS 1WAJA 2E5GA 5AZIB 1KR4A 2HNDB 2XZWA 3NKYA 3R7NB 2DNLA 4GVEA 2QO3A 1X9SA 3J7ZT 1LOUA 1TUUA 3KLEB 3AY0A 2UXDJ 1X4HA 2O3DA 3GPAA 3KUGA 2DFFA 2AJFE 5KFFA 1L3KA 1P9YA 3RR8A 2FPHX 2GHPA 4UT4A 4Z2XA 2FC9A 4KTWA 5T41A 2MZSA 1T9VA 4A62A 3MAAA 2VC0A 1VK0A 2AA4A 2FY1A 3GSDA 3Q2TC 2NLWA 3K2PA 4CEOA 4OLPA 1JLBA 5DG7A 4P71A 3PJWA 4JI7J 4TKTA 3NF8A 2Q3SA 3PX6A 2BEFA 4A8QA 4LF5F 1P90A 1C0MA 2WHOA 5HBMA 3PJ9A 3M2UB 2XM3A 1WSRA 1CJVA 2R8JA 4F0MA 4I9QA 2DGTA 2FJBB 1ZZNA 4ZTJA 1RWVB 2CXEA 5C2CA 5F9NA 2QTDA 4M3WA 3TA0A 3KMSA 4NLXA 1EQ0A 4ECVA 2V69A 3DM2A 2DO4A 3IFEA 1PYTA 1VBZA 2OFHX 1WTFA 3LWMA 4B1VA 2AEFA 1BIZA 3LP2A 4YY3F 4KHUA 3MEDB 3P5TL 5LT5A 1RB0A 3AHPA 1XNRJ 2D74B 4CGFA 2ASLA 1EJ7L 4CHOA 1S7HA 2R7OA 4DPOA 5FPEA 1VHXA 1PG5B 5KFNA 2AYEA 1RDRA 1KFDA 3HJFA 4JKFA 1O6XA 3KOAA 1RA6A 2DYAA 3H3OB 4E0DA 1YSJA 3MGJA 1GLLO 2I5JA 3CTRA 4IO1A 4DV2J 3FEYB 3UCZP 2UUCK 3BH6B 2L48A 3M6GA 2A1BA 2YHBA 3CHWA 5DG8A 1S57A 4E7IA 4DUTA 4DN9A 1LOTB 2IAJA 1M1HA 3NGIA 4ZHRB 2NXJA 3B4DA 4YORA 3C95A 2C1EB 1FJGF 3BSAA 4IDHA 4QBUA 1BWVA 3UFCX 3ZSYA 3M8SA 4NLYA 2UUBJ 1HR0F 1PGZA 2LYVA 4NLGA 2WOMA 2QXLA 3BREA 1CZAN 1M5PC 3BSOA 3CQYA 4NLRA 2N82B 2HSEB 1X4GA 2UXCF 1RTDA 1W9HA 3OL6A 4DV0J 3EZUA 1NZ8A 2OPQA 4MIBA 2P9CA 4IFYA 3UR0A 2QWOA 2ROEA 3FDSA 4JI2F 4NYZA 2FDNA 2PYJA 4H8KA 2RS2A 5I3UA 3SMSA 3EXCX 2D3OR 2Z2LA 2AP1A 1M90T 3LP0B 3WXKA 1I94J 2RF2A 4P73A 1HA1A 3AVFA 2OEKA 2N4CA 1QS4A 2E9ZA 4FZZA 4KI4A 4ZLPA 3TX8A 1NKBA 2GBZA 5EXWA 4KQZA 1SC1B 3RB3A 1PBUA 4UY8T 1HKBA 1EKSA 3RWUA 3BGFA 4CZLA 2XI3A 3E8OA 2DRAA 5F1XA 5AJ3J 1SAZA 1G6BA 4B3RJ 4J2AA 1NHUA 1M1KT 4GNIA 1W2BM 5HP1A 3LANA 4MDAA 3Q0AA 3WC2A 2D7SA 3GIJA 1XR6A 1QSLA 5AQJA 2WBNA 3H20A 3PFOA 2OCEA 2VG7B 1C1CB 2ABYA 4A61A 4I9LA 4IXCA 1FESA 4O0IA 1KNZA 9ATCB 4IYQA 3IRXB 1T9TA 1RBAA 1VQKS 5BJRA 3THWB 1KVJA 1Q86O 4R0EA 3L95X 2FJVA 3MMJA 4QIEA 1TL7A 2CPFA 4DMNA 1VS3A 5I3QA 2RRBA 2O8FB 2Y1IA 2NCKL 2PMWA 1IBMF 3BO4A 3TUJC 3KDNA 2NXUA 4B1WB 4PG4A 2A6AA 1KC8O 2KN4A 3ISNC 3KG4A 4BR9A 4Z4FA 1J54A 4X4RA 3GG1A 2UU9F 2P9SB 4KAZA 1RGVA 1TVRA 5C2GA 4UQGA 1VIOA 3D1OA 4CLWA 3U3YA 5JUMA 4L3NA 3CT9A 3FFIB 3H1VX 3OFEA 2FJDB 3ZTSA 3A5NC 2P9IA 2R42A 2WRMA 3GFXA 1HYZA 4CM0A 4ZVFA 4DR4J 1X4CA 4Y2AA 1IN0A 2W2OP 1NLVA 2AD9A 2DH9A 2R8KA 1Q7YO 1IG9A 1HMVA 4BGBA 4P7VA 1TP7A 2KDOA 4B9TA 1I39A 3V5RA 2Q0RA 1BQNA 3VGLA 2GMLA 1BWEA 5F0XA 2GMHA 3MZIA 1X8DA 4DFMA 1W2BR 5J1EA 1FF2A 3DWLA 4B1UB 3K5NA 4C0OC 4GV9A 1MN9A 1FWPA 2ZH4A 1KOHA 1K8KA 5F3ZA 2YWGA 1JXVA 2HNYA 1MDUB 1B99A 3SSRA 3VCDA 4O0NA 2ASJA 4BDYA 4EAHD 1MG7A 4X64K 5C10A 1E6YB 3LGMA 4NYFA 1NJYA 3M30B 4GV6A 4X66K 4U7UD 2ETJA 1WI8A 4WPAA 2KT2A 1VSLA 2BQUA 3VQ7A 3DOLA 3H8YA 4RUCA 5MAOA 2BJ9A 4LF5J 2D3UA 4HWIA 3TW0A 4DV7F 5KFMA 3BF3A 2NRHA 3SQOP 1BI4B 1HNWK 4CRJA 2ZNZA 4A8YA 5KGXA 3ZFVA 1AZSA 2MY8A 2QWQA 4B3OA 2J0XA 2OH2A 3PRDA 3TOQA 4RW9A 3MCOA 3GE1A 2DEIA 4WXWA 3WBZA 4ZPTR 5D4NA 5HRPA 2VGNA 2Z30B 1S9GA 1BU6O 1WEYA 1JLAA 4O23A 4YDXA 3DDIA 2BQRA 3RW6A 4LBIA 5KG2A 5ETRA 3TZYA 4FJIA 3MXMA 4HUFA 4U67Q 4XIUA 4KBOA 4ZOSA 4YY3J 4JV5K 5GAEP 3L2QA 1REVA 2BR0A 2DFHA 1D3WA 5DMRA 4CM2A 2W9CA 4UOCA 1QUPA 3R7SB 5A76A 3O4QA 4FLYA 5J2MB 2B4JA 3IBCB 2VB6A 3CE8A 3MXHP 3AGRA 3AVNA 1U0SA 1H2VZ 3M4XA 2G8WA 3DLHA 1WC6A 2YNHA 3HVTA 1V3SA 1WOQA 5L1JA 1JIHA 1K9MT 2HMPA 4I7FA 4OLBA 5KT5A 4RU9A 2XLKA 3AVBA 5HROB 3OTEA 3QNWB 1SV5B 2FXUA 3RMDA 4ZTFA 3PNIA 3G10A 1IH7A 5KFOA 1FJGJ 3DHWC 2KM8B 5LMUF 4EO8A 2B51A 2OPSB 2W4PA 2PEBA 1ICEB 1X5PA 3HX9A 4DX5A 2ZF5O 4R5PA 4RTFD 4KKOA 4O3RA 5M1OA 1HR0J 4AXIA 3N0VA 4NLBA 3KLGA 1HHSA 3NNAA 1FDDA 2JSXA 3SSSA 3WX8A 3TJ8A 1SUQA 4ZK7M 5ETNA 2UXCJ 3SK3A 3RB6A 4DZ6A 1NOYA 1S6PB 5DQHA 2NREA 4DSJA 1GOAA 3CCUS 3MM8A 5DDQC 3O5TB 4PABA 4JI2J 3FSIA 2WSFC 2CQGA 2QSFA 4M42A 4KO0A 4AHSA 2NSBA 4N77A 3EJMA 1ZM3A 2E1AA 1R27B 3BSCA 4BDZA 3ZSZA 2OTJN 3OYIA 1S79A 3P96A 4M5DA 1KQKA 2H5EA 4CK2A 4U7UK 4CLPA 3WXMB 4ETXA 1ZAXA 2NRXA 3UN3A 3AD9C 2RUSA 1RYSA 3RBXA 4TU7A 2DNNA 4ZVGA 3UD4P 1KS2A 3R3TA 1VRQC 4ECZA 2ZC3A 3QZ8A 2VF3A 3VF4A 4X4VA 2C3MA 1NGBA 4JI0K 2UV8A 3RZAA 2V67A 4CLTA 3V9SA 4B02A 1AUSL 4D3HA 3WEEB 1NK6A 4FKXA 2ZUGA 4L74A 3EXYA 3FBBA 3G25A 1REGX 3K5LA 5B08A 5K9FA 3OBYA 4C7QA 3SBGA 4IKFA 4DG1B 2HHUA 4IH5A 3R9PA 3KJQB 3AA8A 4BE1A 4OJGA 3RU0A 4NI2A 4ECSA 3IC1A 5AFUH 4CJUA 4GVLA 5DQGA 4HYKA 2A10A 2EFOA 1IBMJ 4BR7A 2GQ2A 1J27A 1Y9OA 4LIRA 3D0IE 1ATRA 2M8HA 4EBDA 1XIQA 2VJVA 3IR6B 1JJ2R 2UU9J 4OGEA 3CDUA 3D7EO 2AP6A 1IJJA 4BRIA 4OX8A 5KPTA 3UIQA 3B6PA 3GDQA 1ATNA 3IAM9 2V2KA 1TYQA 3HPGA 3KYLA 3MPWA 3MMVA 4OX9F 4ZJOA 3T3FA 2VASA 4OHWA 3GV8B 3SDEA 3WHIA 1FK9B 3TAQA 1YRXA 3W1YC 2YPZA 1XEZA 2YNGA 2MZRA 2H5JB 1A9NB 4O8UA 3D6HB 5ADXA 3K9KA 1S9EA 1VLYA 1KTVA 2HBZB 1QQCA 4CTAB 3MTKA 4NXNF 3R5AA 4FZXC 3UN2A 4NA3A 4FL9A 3OVAA 2E9RX 3EDRB 4RW8A 2ALYB 1N34F 1QM9A 3UPFA 1X5OA 4DFKA 1NMDA 5FLXU 4M41A 1N0VC 4EI2A 3NF9A 3C7NB 3SQ4A 2YQ1A 5I4MA 3OW2R 1ZC6A 4MFBB 3BQ2A 3I96A 4OIXA 1FRIA 2G2OA 3HSCA 4PRFA 3MTJA 1FXRA 3OR1B 2F4VF 2M88A 3QICA 3OYCA 4ERDA 3QFPA 5CYMA 4U8YA 1B64A 3J7A1 2UVWA 2LXFA 3AOCA 4DV7J 4C23A 5HSPA 1C4CA 4CZCA 1B9DA 1Q18A 1YRUA 4RBVA 3G4SN 3C3LA 3A8IA 3EUNA 4LF1A 4H5RA 1YI2N 5HQ8A 1SH2A 3OT9A 4O4GB 3KJFB 4PAAA 1KQSM 3KLVA 2XY6A 1C2PA 2DD8S 4LRBA 1B0TA 1NBWA 1OY9A 3H6EA 1U1QA 4ZVPB 2MJNA 3WXLA 2ZWOA 2JOQA 1L3SA 4DU3A 3KG1A 5CXTA 4IFVB 1ASUA 4PWWA 1HNVB 1J53A 3QGPA 2FQQB 4F8RA 1HARA 3QMLA 4KYZA 4WP9A 1SC3B 1Z25A 2WSEC 4TYAA 5FDLB 2RE1A 3F9MA 4PQAA 2CNNB 3GLJA 3LDQA 3CF5L 1ULRA 3ILIA 2BM0A 3VR1A 3NGTA 2GEMA 5IC6B 4F0HA 4YMEA 2MSTA 1JNZB 2ZZNA 2CJAA 4B1ZA 4WQ4C 3WZ0A 4FNHA 1TL3B 3TAPA 3QIPB 5IC4B 4G9ZA 3CD6S 1V6HA 2P51A 2YQ0A 3NBPB 3CJ9A 2NRWA 2UXBK 4ZN3A 5LMUJ 4V1Ak 4QIFA 1XQIA 4HACA 3RRKA 1U24A 4ILGB 2IVPA 5ITHA 3P3DA 4RL1A 3CD7A 4IR9A 2BKOA 2ZH9A 4AL7A 4J9SA 4ZIWA 1J2VA 4Y2CA</