1FKPA

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
542
structure length
541
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 147
structure length 541
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fkpA05
2BQUA 4KHMA 3CJ0A 3FFIA 4O4GB 2AWZA 4FJKA 1S9EB 1B9FA 4K4WA 1RTDB 4EBCA 2YNFA 3P1GA 1S1UB 5HRPA 3PUFA 1YVUA 4CGFA 1LAWA 4E0DA 3RMBA 4HUGA 4NLQA 3BQ2A 2ITGA 3MECA 1TAQA 3IAYA 3DOKA 1LW2B 3RB3A 3SPZA 4M3WA 4I2QA 3RTVA 1JKHA 1S6QA 5KT3A 5KFPA 5KFWA 1ZYQA 5KFJA 1Q9YA 3HHKA 4B9VA 3NHGA 4H54A 1JLEA 2R8GA 3DM2A 1JLQA 1NKBA 3UR0A 3OYBA 1RTJA 4ED0A 3QZ8A 2B5JA 5F8LA 2OPPA 3D28A 4ELVA 1R0AB 4NRUA 4NLDA 2IGIA 1WAFA 4FM1A 5KFVA 4BE1A 4FLTA 4U7CA 2D41A 3OYEA 4U6PA 2F8TA 3LP0B 3O3GA 4FLYA 3MECB 1S48A 3WNFA 5KFEA 4ZVGA 3KK3A 2IM3A 3NFAA 2KW4A 4I2QB 5F8IA 3OL7A 3HYFA 5KG5A 4QWDA 1HQUA 3OL6A 4O3NA 1HYSA 2YKMB 4PWDB 5KFBA 4O55A 3O3HA 1R0AA 4CJEA 2FVCA 4RW4B 1IKVA 1QQCA 5DG8A 2E9ZA 3DLHA 1JXBA 3N6MA 2VG5B 1TVRB 3KLEB 4O44B 3AVIA 4AHVA 4TYBA 3PW7A 3MEDA 4FCYA 2BANA 3KTQA 3PY8A 2ZE2B 4B9LA 5KGWA 3LANA 5JXSA 2VG6A 4DG1B 4YR0A 3VQ5A 4HUFA 1RDRA 5K14A 2AGOA 5DQGA 5KG0A 1RDAA 2GIRA 1JLCA 3QEVA 3H4DA 3V81A 2YNHA 4FXDA 4HVJA 1WSJA 3B6PA 2YNGB 4DSLA 3V1RA 4ZPBA 1FKPB 1U09A 1YTAA 3OYHA 3LZIA 5FDLB 3KLEA 4PUOA 4OKKA 2X6SA 4CEAA 4NLOA 2JLEA 1NHUA 3MEDB 1HQEA 1JLFB 4R5PB 4NLWA 2V4QA 2VG6B 1KHWA 3TAMB 2D0CA 4HYKA 3CM5A 1DLOB 1RDDA 4KKOB 2HHVA 3E01A 1WLJA 3KIOA 1BCMA 2XRIA 3M8SA 1NK8A 4TY8B 2VG7A 4NYZA 4KHQA 4IBNA 4EYIB 3RB0A 1S1WB 1RA6A 3TR8A 4N47A 2OA8A 2OPQA 4NLYA 2ALZA 4ICLB 1LWCB 4FS2A 4Z4FA 1JLFA 4G1QB 1DTTA 1LWEA 1GOBA 3KMQA 2O4GA 4YNQA 1D1UA 3OYFA 4LSNB 2IC3A 4AILC 1FK9B 3PJWA 4KFBA 1SV5A 4JV0A 4J9KA 2EX3A 1NK4A 3S3OA 4M3YA 2BQ3A 3CDUA 2B6AA 3D5MA 4RNHA 3S9HA 5CYMB 3V6DB 4CGHA 4JLHA 1JIHA 5DGBA 4Y34A 5KI6A 4G1QA 1JLBA 3G0ZA 2XY8A 5KFQA 3CFOA 3K2PA 1S9FA 3AO2A 3ZT3A 4RW8B 4F4XA 2XC9A 4DTOA 2RF2B 2E9TA 4X2BA 1MMLA 1RBRA 3FSIA 3GIIA 3KKSA 4I9LA 5KG7A 2QXFA 3QGIA 3AVNA 4KFBB 3ULDA 4FZYA 5CZ2A 3ZSZA 1RT6A 2ATLA 1N56A 4ZTJA 5DLGA 4CGDA 3MEGA 4E1NA 4MIAA 1XHXA 3Q8QB 4XPEA 2GBZA 1X9SA 3DLKB 4KI4A 1KSPA 3KHGA 1HNIB 1IKWA 4CEDA 1UOCA 3NAHA 3M8PB 3I8DA 4K8XA 5KT5A 1CZBA 5F9NA 2YNIB 4MFBB 1FKOB 1ZBFA 3G10A 4KO0B 4CGJA 1NNDA 4F50A 3D45A 4IR1A 4J9PA 2HW3A 4I2PB 4FJ9A 4CJ3A 3KD5E 3QEPA 4CHYA 3NGDA 3HO1A 4M95A 3MEGB 3H4BA 3GIKA 4CHPA 1RTHB 4CHOA 3VQCA 4O4GA 3MXIA 5HROA 4IKAA 1S9EA 2P51A 4KAIA 3MAQA 2FJWA 3BQ1A 3QIDA 4F8RA 4DFPA 1WNEA 1WSIA 4KHYA 1NKEA 4JRPA 4WXWA 5KG4A 4CJTA 3PX0A 3SUOA 1QSSA 4URGA 3SFGA 4CJWA 1L3SA 1DTQA 1XR6A 4WYLA 3RAQA 4CGGA 3SQ4A 3TWHA 2ILZA 4RU9A 2ZKUA 3UIQA 1JKHB 3GQCA 3EY1A 5HROB 3NE6A 2WRMA 1JLEB 3ASMA 3V1OA 1K1SA 4DQIA 4FLXA 4EO8A 2IM0A 4LQ3A 4CEEA 5HRNA 3VQ4A 2GC8A 4RUCA 3SJJA 3KLHB 2HMIA 4EZ9A 2CJQA 1ITGA 4FLVA 5HBMA 3ZT4A 3ZSQA 1L5UA 1UWBB 3BGRB 4CFAA 3G6VA 3KK3B 2E9RX 1WN7A 4F4ZA 3VQAA 2IDOA 1VSLA 4WZMA 4DL7A 5J2QB 2W7PA 1W0HA 1HYSB 4J9NA 3PX6A 3LP1B 3VQ7A 4CFCA 4NLTA 3H08A 4IG0A 4I7FA 5C42A 1XC9A 4J9LA 5EUHA 3AA4A 2RDIA 3SNNA 3EZUA 3I0RA 1RBVA 2C22A 5J2MA 4ECXA 1RYSA 4O4RA 1EP4B 4EO6A 3ITHB 2Z1HA 2CKWA 1UWBA 3ZSXA 2JEJA 1VSJA 5T14A 4KHNA 2QKBA 3OS0A 5L1JA 1KVCA 2GIQA 3CJ3A 3FQLA 1NKCA 4QW8A 4DG1A 4JUZA 3GV8B 3K5NA 4J9MA 2R2RA 3RMAA 2W9CB 4I7FB 3AVAA 4CJ4A 4CEQA 4PA1A 4C8KA 1MU2B 4J2AA 3DLBA 5KGXA 1FKPA 3MEEA 3WNHA 3I0RB 5KFZA 3BR9A 1VSIA 1RT4A 4PUOB 4HTUA 3LPTA 3OYCA 1KVAA 1U47A 4TQRA 3DI6A 1HQEB 4HUEA 4YR2A 1N4LA 3V6KA 4J9RA 4DL6A 3GILA 2XY5A 3KK2B 4Y2AA 5KFRA 5KTQA 1EX4A 3C6UB 1ASVA 4IG3B 5KT4A 3QETA 1XI1A 4FJJA 1QSYA 2ZQBA 1X1PA 4FJHA 4FS1A 4KAZA 3OYNA 3DI6B 5L1KA 1LWEB 3CFPA 2G8IA 4KHSA 3L2RA 1HNVB 4K4UA 4ECQA 3LAKA 1SH2A 1TKDA 1BQNB 2VA2A 4DQQA 4ED3A 3HVTA 2AX1A 1CZ9A 1D5AA 1S0OA 1FXXA 3C6UA 4CF8A 4CGIA 2YHAA 4IG3A 3CJ4A 4IFYB 5HLFA 4UQGA 3PX4A 4IFVA 3ALYA 3V6DA 3V9XA 4CK2A 4CF9A 4L8RB 4CHQA 3SUQA 4J2BA 3K59A 3HVRA 3M9OB 1QTMA 2PYJA 3KHHA 2RDJA 3DRRB 3NGZA 4KB0A 3CFRA 4DFJA 1S1UA 4ZPDA 3K5LA 4Q8EA 3QZ7A 4M3RA 3TAQA 3T5LA 1VRUA 4ZP8A 3PV8A 4Q5VA 3D0PA 4DTNA 3VQPA 3RWUA 3ZT0A 1EKEA 3RRHA 1LW2A 3OS2A 4AHRA 4O0IA 3IGNA 3MXMA 3TAEA 1L3VA 1UA0A 3QEIA 4BWMA 3DRRA 4B8CA 4CHNA 4J9OA 3NBPB 2R2SA 4OKJA 5F8GA 3UPFA 5KG2A 4QWBA 4W5QA 3M9NB 3TI0A 2E6MA 4EP5A 1J53A 3BJYA 2JC1A 5KG3A 1O1WA 1IH7A 1HYZA 1S0NA 1WSHA 1C0TB 4IRKA 3KLVA 4OLBA 1HQUB 2HHXA 1GX5A 4ED1A 1D9FA 1N48A 3DYAA 4CK3A 5KG1A 4W5NA 5F8JA 1JLGA 4B9TA 4ZHRA 5KG6A 3TABA 1IKVB 3G6YA 5D3GB 1LAVA 1T05B 3I0SB 3CJ5A 2VWKA 4IDKB 2FLLA 1U4BA 3HXMA 3PO5A 2IAJA 2AJQA 1RT1B 2I1RA 2HNZB 1TK5A 4O3PA 5DQIA 5I42A 1BI4B 4NZ0A 1S1VB 3RMCA 2RPIA 4BE0A 4Z4CA 1F21A 4E7LA 5KFIA 3K5OA 3DYAB 1A5XA 3T1AA 1KFSA 3KK1B 3V81B 2DFHA 1WSEA 1C2PA 1L3UA 3NGIA 3H98A 1KVBA 3BREA 4J2EA 2AQ4A 4FJXA 2W9AA 1KLMA 4J9SA 3DMJB 4JS4A 2O5DA 1Z25A 1G15A 3SQ2A 2WB4A 2HHWA 4KI6A 3B6OA 3KLHA 2HMIB 4IOBA 1BI4A 3QIPB 3SQ0A 2G8UA 4FYDA 4QWEA 4RNMA 3TAMA 4B9UA 4WXOA 5EWFA 3RBDA 2OPRB 4R8UA 1DLOA 1TGOA 3VQDA 4Y1CA 4CIEA 3GIMA 2XGQA 3KLIB 3K58A 4GC7A 3NF6A 4CJVA 2HVIA 1ZBIA 2RKIA 3C6TA 3KJVB 1S1WA 2QKKA 2OYQA 3DMJA 4M45A 3HP9A 5C42B 4C8MA 1NHVA 4MK8A 1S10A 1BQMB 4K4TA 1J54A 1LWCA 3BSAA 4OLAA 2RN2A 3K5MA 4M3XA 1HMVB 4TQSA 3OVNA 1U48A 1C0UB 3U6FA 1I39A 4LSNA 3MR3A 5DGAA 1Z26A 4ZTFA 2IC3B 3T5KA 2IBKA 3LP2A 3V4IA 1T03B 3QYYA 3DDKA 2HB5A 4FBUA 2DPIA 1SV5B 1IG9A 4WE1B 4RW7A 1Q9XA 3QNNA 4OGCA 5J2NB 4M3ZA 3VN5A 2J6SA 3U3GA 4NLUA 2OPSB 4GW6A 5DG7A 4ECTA 3JYTA 1CXQA 4DLEA 1RT2B 3QGGA 2RF2A 1ZBUA 1GOCA 2EC0A 2G8VA 4GVMA 2C28A 4Y3CA 4CEOA 4RW6A 4KTZA 4NYFA 4KRFA 1NK5A 4YQWA 4WE1A 1TAUA 4O3RA 1VRTB 1XR7A 1RT3B 3BSOA 1RT5A 3VA3A 3QERA 1HJRA 3O4NA 2OPSA 4O3SA 3JYTB 4DU4A 5F8NA 3DLKA 2I5JB 3DLGA 1XR5A 4PY5A 4Q8FA 3M8PA 1I6JA 1NK7A 4GC6A 4XIUA 4KO0A 4Y2CA 4CIGA 2W9BB 1QUVA 4IH6A 4DL2A 1NK9A 1BQNA 3OSNA 3DRPB 4ED6A 3NH2A 5C25A 4NCAA 2KTQA 1D8YA 1VK0A 5HLFB 5KFOA 4KV8A 1S6PA 3NCIA 4QAGA 1RTHA 1JLAA 5EWGA 1Y97A 1IKXB 2IMWP 3H2LA 2AGPA 1YT3A 4DFMA 2KFZA 3WNEA 2QE5A 1S0MA 2G8KA 2FLPA 3IG1A 1RBTA 1YVFA 2IM1A 2XI3A 4DU3A 3FDSA 4OPKA 2B43A 1DTQB 3I5AA 1SKSA 4C8LA 3H5XA 3KLGB 4B08A 1S6PB 5HP1A 3CIZA 4DSFA 4M42A 3VQ9A 3BDPA 3Q8RB 3F9KA 2P5OA 4KHWA 1C6VA 2JEIA 2DPJA 3AVCA 4DTMA 4E7HA 1GOAA 4RNFA 1ZETA 3LAMA 3EZ5A 1TKTA 2WTFA 1TV6A 4FJ7A 2WHOA 3G6XA 4CF1A 2AX0A 4CFBA 3EYZA 3DLRA 3OYAA 4K4XA 4LSLB 3HK2A 3DOKB 4KE5A 3V9SA 5HP1B 1C0TA 4ED8A 1D0EA 5J2QA 1TKXA 4B8AB 3DM2B 3WNGA 5C24A 2FBTA 3IN5A 2OPPB 2YKNB 2IS3A 3LP1A 3BQ0A 3MR6A 4PQUA 3OYLA 4Z4IA 2VWJA 2D0BA 2ETJA 4IDKA 3GV7B 4TY9A 2UVUA 2HHQA 1WSGA 1S1XA 3OY9A 3KHLA 4K4ZA 2HNYB 3RB6A 2ZD1B 2R2TA 4AHCA 2V4RA 4BDYA 2G8WA 2G8HA 3QLHA 2P1JA 3ZSVA 3NDKA 3NAIA 1K6YA 3MFHA 5L1IA 5T7BA 3AA2A 4FK2A 4MKAA 1RDCA 4J2DA 3QEWA 4PQUB 2X74A 4FJGA 3FFIB 1RBUA 3C95A 2E4LA 3KLFA 1A5WA 2FVPA 2V9WA 5EWEA 1RT4B 1S1TA 1RYRA 1GX6A 1CSJA 2YNFB 4DTPA 4MK7A 1NJWA 3PW5A 2ZD1A 4FW1A 4E7IA 2XCPA 4QWAA 1L3TA 2W8LA 3QLHB 3KHRA 5K14B 5KT2A 4FJ5A 4OVLA 1RCHA 1JLCB 4W5OA 4YR3A 3QGHA 1B92A 4FM0A 2FBVA 2HHSA 4AHTA 2FBXA 4Z4HA 3AO5A 4HKQA 5KRTA 1TKZA 2V0NA 1I3AA 1S1TB 1BQMA 1RT7A 3THVA 4B9SA 3NF8A 4ECVA 3QINA 2UUTA 2IJNA 2KZMA 4DTUA 3H5YA 3SCXA 2BQRA 4CK1A 2XY6A 1ZBHA 3RRGA 3NMAA 1T03A 3ZSRA 4ZP7A 4FJIA 3OYIA 3V9WA 4RW7B 4M3TA 4KPYA 4PWDA 3PR5B 4WZQA 3L2UA 3PVXA 5JS1A 4IRCA 2XO7A 2J6TA 3FRZA 5DLFA 3LZJA 1U49A 1C1AA 4MIBA 3CYMA 1QSLA 3M8QA 3NH0A 1SUQB 4ECYA 1IO2A 3OSPA 2IOCA 2ZE2A 1BISA 4OL8A 3L2VA 4H8KA 1ASWA 4EZ6A 4HCBA 4O3QA 3ICLA 3OYDA 1Z4UA 3M8RA 5KFLA 4CF0A 1JLBB 4J9QA 2O4IA 4KSEB 2XHBA 5CYQA 5KFDA 5FDLA 3RAXA 3SYZA 4FJLA 3UQSA 1EETA 4FZXC 3P83D 1RT6B 2UVVA 2J6UA 3T5JA 4TLRA 1BCOA 4ECSA 3CM6A 4ZPCA 4JRQA 2IJFA 1HYVA 4KKOA 3BSCA 2UUWA 4NLGA 3HJFA 2FVSA 4URQU 4O5BA 1U45A 2X6NA 4TY8A 4DWIA 1J5OB 3AO3A 4TSXA 1NJXA 2WCXA 3TAPA 3Q8PB 2PY5A 2HHUA 2OPQB 5J1EA 4DF4A 3IRXA 3AVKA 1FKOA 4MFBA 4N56A 1EETB 3H40A 2AGQA 1RTIB 4O3OA 4ELTA 3AA3A 3LALA 2HNZA 1C1BB 2WOMA 5I42B 4DEZA 4KHRA 1HPZB 2FC0A 1S1VA 3O3FA 4CEFA 4F2SA 4K4YA 2UVWA 2DFFA 3HPHA 5DG9A 3CDEA 3OJUA 1KHVA 3ZSYA 5FRNA 5KFXA 3OLAA 1TK0A 3KK1A 1VSFA 4DQPA 1KCFA 4CEBA 4EBEA 3I5CA 3ZSWA 4JS5A 4EEYA 3DOLB 1TKTB 1RTIA 3QEXA 4CESA 3UDLA 5F8HA 1C1BA 2WOMB 4RW8A 2XWYA 3T19A 5KT7A 4LH4A 4XPCA 4E1MA 3F73A 3QIPA 5KFCA 4NCBA 4K8ZA 1Q8IA 5EDWA 3GV5B 3NF9A 1C1CB 3K57A 2OPRA 4R8UB 3CVKA 2EHGA 2WK4A 3EPGA 2GUIA 2DY4A 4MKBA 3JSMB 4FJMA 1A5VA 1SL0A 2G8FA 3KJVA 2HWIA 4XO0A 5SWMA 1KLNA 3VA0A 3ZT1A 2BR0A 3ISNC 2PYLA 3NF7A 4H4OB 4N41A 5F9LA 2W42A 2KFNA 5HBMB 4CJKA 4N76A 3CO9A 4CJSA 1SKRA 1W25A 3AA5X 1NOYA 4DS5A 4Q45A 4CJQA 2YHBA 3NH1A 4CJFA 4ECRA 3SV4A 4K4VA 1QS4A 4CECA 3L8BA 2D3UA 2R8JA 5JUMA 3RMDA 2KQ2A 3ZT2A 1RBSA 1WAJA 4LH5A 4IG0B 4RNOA 2A1RA 4H4OA 3OLBA 3AV9A 4DU1A 2F8SA 3P5JA 4WFZA 3IGVA 4BDPA 1RT2A 4F3TA 5L9XA 5KFTA 2OZMA 4ZVFA 3MXJA 4WFYA 4KTWA 4DL5A 1S5JA 4CJLA 3V6JA 4G3IA 4FLUA 2BDPA 2W9CA 4C8OA 1NJYA 1JXLA 1UAXA 4Z0UA 4TYAA 3SPYA 1CXUA 4DS4A 2ASJA 3DLGB 1RILA 3RR7A 3SI6A 3MR2A 5HRRA 3MF5A 4NCGB 4FJ8A 5E41A 2W9BA 4IQXA 2Z1GA 4ED7A 4F4KA 3CWJA 3N6LA 4Z4GA 1NJZA 3PJXA 4ECWA 2C2EA 4Q0BB 3VQEA 4FK4A 4E3SA 4FZZA 4B9NA 3IS9B 2D7SA 4DL3A 4W5RA 3HVAA 4FBTA 4TN2A 4DTSA 2D3ZA 4LY7A 3MTKA 1RTJB 3EPIA 1HRHA 1TK8A 3GYNA 1WSFA 2W7OA 4IRDA 4CCHA 4NCGA 4QWCA 3C94A 1RNHA 3M8QB 3T5HA 1ZTTA 4CHZA 5J2MB 4WYWA 1EP4A 3A2FA 3G86A 2AU0A 5J2PA 1U04A 3OL9A 3TANA 2XGPA 3AVJA 5I3UB 3SI8A 1C0MA 2F96A 2XCAA 3KLGA 1CLQA 1REVA 4IFYA 4F3OA 2DTUA 2IA6A 4ECUA 1K1QA 2R8HA 4I9QA 4OGEA 1KTQA 1TQLA 5KFFA 3QO9A 3MEEB 4IH7A 1X9WA 4B9MA 5CYQB 1TV6B 3RR8A 2VG5A 3V9UA 2HWHA 1JXEA 1XHZA 1TL3A 4ID5A 5J2PB 1VRUB 2BANB 3GIJA 3PW2A 2OH2A 4E19A 4K4SA 4DSKA 1REVB 2FVRA 2B4JA 4BWJA 4Y1DA 3KK2A 3Q8SB 4CERA 3HKWA 4OKEA 3DRSB 4ZVEA 5C24B 3L3UA 4DSIA 2YKNA 3NBPA 3MR5A 4IR9A 3V9ZA 3VQSA 2Z1JA 1T3NA 4BACA 5J1EB 5KFAA 3IRXB 1TL3B 3TQ1A 1LW0B 3LPUA 5F8MA 4ID5B 3OL8A 5DMRA 3SV3A 1RDBA 3CQ8A 1S1XB 4DQRA 2HNYA 4BDZA 3NL0A 1S4FA 2QK9A 2JC0A 3NAEA 3E01B 3HVTB 5L1LA 1LWFB 4KHUA 1RA7A 1EXQA 3KNAA 3BSNA 5DK5A 3OYMA 3U3YA 2VG7B 4KB7A 3RB4A 3HSTB 1JLGB 3TAFA 4IFVB 4DLGA 4CJRA 3AVBA 5KFKA 5D3GA 3SQ1A 4ICLA 2P5GA 3KLFB 2R8IA 1HARA 3DOLA 4K50A 1DTTB 2R2UA 2ASDA 3DLEB 2IAJB 4CF2A 4RNNA 3TVKA 4FLWA 1YTUA 5KT6A 4FVMA 3HPGA 4LQ9A 1T8EA 3H5SA 4ELUA 1FK9A 1QAJA 1C1CA 3L2QA 4EYHB 3TAGA 4IKFA 5KFSA 3LWMA 3RBEA 3L3VA 5FROA 1QE1B 4RZRA 4CJUA 4ED2A 4RG8A 4ID1A 2JEGA 3I5BA 3HM9A 1TKZB 4CIFA 4WFXA 1KLMB 1VSMA 2XY7A 1J9AA 3AO1A 5FRMA 1TL1B 3DLEA 2D5RA 3OJSA 1RT7B 5KFHA 3QIOA 3OHAA 3L2WA 1VSKA 4NLPA 2D0AA 3VQ6A 4ZPAA 3V6HA 2FBYA 3AVFA 1QE1A 2C2DA 2BE2B 4O0JA 1S9GA 3KLIA 3VQQA 1S6QB 5JS2A 4JV1A 2OZSA 1T94A 1VSEA 1SH0A 4NLSA 3PW0A 1NK6A 3HL8A 4E7JA 3AO4A 1JLQB 4KREA 1VSHA 1TL1A 2B5JB 1SL2A 2IM2A 4YFUA 3S3MA 1TP7A 4Q43A 3OYJA 1HNIA 4ZHRB 4OJRA 1HMVA 4E89A 4CFDA 1QAIA 1C0UA 2KZZA 2VA3A 1BIZA 4NYNA 3CG7A 1T05A 3ZSOA 1SUQA 3I0SA 3PO4A 4AH9A 3LP0A 3HVWA 2BE2A 1RT1A 1ZTWA 2UVRA 3KOAA 4I2PA 3LP2B 1S9GB 4M94A 3SFUA 3OYGA 1B9DA 5KFGA 4F2RA 5EU7A 2BRLA 4DF8A 4DFKA 1VSDA 2YKMA 3LP3A 1ZBLA 2FJXA 1XWLA 5C5JA 1LV5A 4M3UA 2HAIA 4H4MA 4RW4A 2PZSA 3HPOA 5CY4A 2HHTA 2Y1IA 3NGYA 1TVRA 3OHBA 2ASLA 4O44A 3KKRA 4HHTA 3S3NA 2BGGA 4FM2A 1KFDA 3AVLA 4LD0A 4RW6B 4ZMMA 4DL4A 2QV6A 4N5SA 2Y1JA 4NLRA 4Q0BA 4DSJA 5KFNA 1RT3A 4FW2A 3E51A 4TXSA 4DTRA 2ILYA 1RT5B 3IS9A 2GV9A 3SUPA 2W8KA 2YNHB 2FJVA 4H4MB 4RW9A 4KB1A 5HRSA 3H5UA 2YNGA 1J5OA 2RKIB 3C6TB 2R7YA 3ZCMA 2I5JA 3CDWA 1IKYA 4OPJA 3PR4A 4IH5A 3KMSA 2JEFA 4M41A 4R5PA 3DRPA 1IM4A 4DQSA 3N6NA 4W5TA 4FJNA 5C25B 3BGRA 1RAJA 1HPZA 3AVGA 3LDSA 3SUNA 1JL2A 5I3UA 2JGUA 2R8KA 3V1QA 3HP6A 4URSA 3QNOA 2FVQA 4GMJB 1T7PA 2F8EX 2E6LA 4RW9B 2ATQA 3V4IB 2C2RA 4CJPA 3VQ8A 4HCCA 5CZ1A 1IKYB 4Q44A 3QO9B 5KFMA 4F4WA 2BRKA 5J2NA 4MH8A 4KTQA 1X9MA 4AHUA 4ZP6A 3IG1B 2YV0X 4E7KA 2HNDB 3ITHA 1BL3A 1S49A 1BGXT 4DTXA 4QPXA 2HVHA 3SZ2A 4QCLA 4R0EA 1D9DA 1N6QA 3T3FA 2A1SA 3OYKA 3PW4A 4CEZA 1BHLA 3JSMA 3VQBA 1SKWA 3DRSA 1VRTA 1JL1A 4Z4EA 1SL1A 2B6AB 4QW9A 5CYMA 4CJ5A 3PHEA 1MU2A 3AVMA 3LWLA 5KFYA 3KD1E 4ZP9A 2HNDA 1S97A 4ECZA 1LW0A 2XI2A 4NLXA 3TARA 1N6QB 2Z1IA 4LSLA 4ZVHA 4DTJA 4CE9A 4BE2A 4YMEA 1BIUA 4B3OB 2LSNA 4QOZB 1SH3A 1N5YA 1OS5A 1TKXB 4EP4A 4C8NA 4NLVA 3HT3A 3M9MB 3FQKA 1LWFA 4DMNA 1KRPA 3OS1A 3NKYA 1UA1A 3O4QA 4FK0A 2WONB 2DFEA 4EBDA 4KV8B 4AHSA 1NOZA 4YP3A 4F4YA 5DQHA 3PZPA 1ASUA 1JLAB 2X78A 1IKXA 2FLNA 4RUAA 4JV2A 1IKWB 1QHTA 4MK9A 2YNIA 1NK0A 5KRSA 4MQ3A 3QESA 1HNVA 1RTDA 3AVHA 4B3OA 4KBIA 3ISND 1N5YB 3CJ2A 4DSEA 5KFUA 3H59A 5SZTA 3MFIA 2NUBA 2Q3SA 4FLZA 1WNSA 2WONA 1JX4A 1W9HA 4NRTA
chains in the Genus database with same CATH superfamily
1HI1A 2BQUA 4JI5J 2NCKL 2CNOB 2BXJA 4BRLA 4NMXA 4K4WA 1FKAF 1TL5A 4Z94A 1U25A 4H4KA 4CLFA 4GVEA 2PAVA 3PUFA 2M7SA 2P9IB 5B8HA 3UO0A 2VPYB 4HUGA 1NBWA 2ZWHA 4NLQA 3TZXA 3BQ2A 3B54A 1V6HA 4DV1F 2ITGA 1EJ7L 3G9CA 4JI3J 5AQIA 3PEHA 4L72B 3RSEA 3RTVA 3DXMA 1S6QA 5KFPA 2B8PA 5KFWA 4OYWA 3HHKA 4B9VA 4H54A 1XNQF 4A47A 1NKBA 1JLQA 3SCKE 3UR0A 1PBAA 2QIFA 2B5JA 3F41A 2OPPA 2FSKA 1S76D 1R0AB 4NLDA 2IGIA 3O9SA 2PC6A 5AFUA 1WSVA 4U7CA 3CD0A 2BUNA 3ZZPA 1Z05A 2M8HA 3PYFA 5CHIA 4AT1B 3OYEA 4U6PA 3LP0B 4FLYA 5I3QA 3LOUA 1S48A 2XHCA 4ZVGA 2FIUA 1X8DA 3M8ZA 4YOUA 3DXMB 3OL7A 5AQXA 5KG5A 1HW8A 1RQ0A 3QFHA 4DR7F 1S59A 1XMOK 4HI1A 4A2BA 2R7QA 4O55A 1R0AA 4CJEA 1Q78A 5CD4H 3EZWA 3AXMA 4RW4B 4PABA 5EX5A 4DPYA 5DG8A 3DLHA 3N6MA 1T44A 2P2CB 4OZNA 2MKKA 1G7CB 4TYBA 2UXDK 1U1RA 4FCYA 1CJUB 2QLWA 2ZE2B 3LDPA 1H3DA 4B9LA 4HH0A 2MQNA 3D1OA 2JWNA 2CQIA 4YR0A 1D8ZA 2D3O1 3OR2B 5DQGA 3SAGA 5AQOA 5AQPA 1JLCA 4G6VB 3QEVA 3CJ8A 5HO4A 1WSJA 3KG4A 3B6PA 4X66K 1T0TV 1FKPB 3ET6A 2QLBB 3LZIA 1FJGK 4OX9K 2Y3YA 4K2JA 1UAWA 4OKKA 3DLLL 2QLFB 3GBTA 4K0KF 1HQEA 1JLFB 3SEOA 4M7YA 4NLWA 4UZBA 3TAMB 1U2FA 3TO8A 4TNOA 3EXYA 4JI7J 1WLJA 2B4VA 3OFGA 4DUYF 1SQGA 3HFVA 1HKCA 2XRIA 3M8SA 2LYVA 2ZM6K 4KHQA 2V7ZA 4IBNA 4HDHA 1S1WB 4BC3A 2OA8A 2OPQA 3CDAA 1LWCB 1ZAXA 2F9TA 4DI6A 1JLFA 4G1QB 1U2CA 1DRZA 3MGJA 4CIOA 1GOBA 1IBKJ 4YNQA 4DN0A 2AV5A 1D1UA 3FMBA 2VQFJ 2FZKB 5B08A 1VI7A 1NO8A 4M5IA 3PJWA 5K8OA 3MN7A 3MPVA 1Z6RA 1YRXA 1KNZA 2ZNZA 2BQ3A 3ZEUA 2HHPA 5CYMB 3V6DB 4JLHA 2QT7A 5DGBA 3OTDA 4Y34A 4G1QA 1JLBA 3G0ZA 3QJJA 5KFQA 1GMWD 2MB0B 1EWRA 3AO2A 3G6ES 2XLKA 4RW8B 1ZXOA 4JHDA 4DTOA 4BGBA 2E9TA 4M5JA 4CLPA 4X2BA 1MMLA 5MLCV 1RBRA 3FSIA 3KKSA 4I9LA 5KG7A 3QGIA 2HIQA 4KFBB 3AGKA 4NXMK 3ULDA 4FZYA 4NPOA 3V5RA 3R27A 5DLGA 3AY0A 3AT1B 3T1HK 4CGDA 1G1XA 1XTZA 3BDEA 3MEGA 2JVOA 1XHXA 3Q8QB 4OX6A 3QAUA 1S6UA 1IKWA 3CCVN 2ZWOA 3G4SN 2ZOFA 4DR5K 5F9NA 2GMJA 4CH0S 4E98A 2P9UB 2PDAA 4F50A 4CP5A 3J7YP 3MM5A 1MROA 4JKAA 1RJJA 4LRFA 4I2PB 4DV6F 1R0BG 3E66A 4CJ3A 4V19J 3L0QA 4FWMA 3QMLA 1Y5IB 5DDQC 1UETA 1KD1O 3ZXWA 4IKAA 1OQ6A 3FZBA 2P51A 3EVWA 2FJWA 5H1SQ 4ES2A 2P9UA 1WSIA 3HLUA 2NNWA 5KG4A 3NCQA 3PX0A 3FE1A 1IBLJ 3ID6A 2X1FA 3P39A 4WYLA 1AFJA 4IJNA 3VENA 1OY9A 2ILZA 4RU9A 2ZKUA 5EX3A 2I7NA 1J5EJ 3EDQB 3GQCA 3J7AN 2IPOB 5D15A 3NE6A 4BR9A 3V1OA 1K1SA 1XMQF 4DQIA 4FLXA 3PNIA 4JYAK 4CEEA 1N33K 1UVIA 4B3RJ 1CQNA 2HQFA 3GPAA 3VAIA 3J80O 2NRXA 1B3TA 1NGCA 4PHTX 3ZSQA 2VPXB 3NWGA 4B3SF 4PPZA 1UWBB 2E5IA 1FX4A 1KKHA 4A2AA 3KK3B 2E9RX 1FE0A 5CYJA 3VQAA 3A12A 3UCGA 1VSLA 4QJVA 2EFVA 5J2QB 1W0HA 3VF2A 2CQGA 2AZ3A 1NGBA 3U8XA 3GB0A 3R6MA 2DHHA 4U7BA 1MN7A 2H65B 3G71N 4IG0A 4OLOA 2QSWA 5L38A 1UEUA 1CJTB 2C22A 1RP5A 4ECXA 1RYSA 5CR4A 1SC6A 2Z1HA 3ZSXA 3HHLB 2JEJA 2QWRA 5T14A 4PKDB 2QKBA 2QLJB 1UW4A 1VQMS 4BC2A 2E66A 2HWTA 4ITSA 3QT8A 1T11A 4JUZA 4K8RA 4LRAA 2R2RA 2DB1A 2W9CB 4FZVA 3BYRA 2XS7A 1HWLA 4CEQA 4C8KA 1R8PA 1X0FA 1FKPA 1RKJA 2M5YA 1RT4A 4HTUA 3OYCA 3WIUA 4F67A 1HQEB 2Z2YB 4YR2A 4KRWA 3V6KA 4ZPTR 4DL6A 5H9EJ 1P90A 2LA4A 1WOOA 4FP9A 4KQZA 4K59A 2GVZA 2ASPA 5IC6B 1EB0A 2AKWB 1Y11A 2HYIB 2DNYA 3QETA 2RD5C 1QSYA 4ZA1A 1HW9A 4FS1A 4KAZA 3OYNA 2BJEA 2YQ1A 1H2UX 1WG4A 2K3KA 5E3QA 2CGKA 1HNVB 3L4QA 2B4UA 3IBWA 2BM0A 4K4UA 4ECQA 1TKDA 4JK8A 1X5SA 4ED3A 3HVTA 5IWAF 2B56A 3OV7A 1LFPA 1D5AA 4IEIA 4CGIA 2YHAA 2BACA 2PEBA 3CJ4A 2HK2A 4UQGA 1A0OB 3AB4B 3M30B 3V6DA 4CK2A 1XK8A 4CF9A 4L8RB 3PIPQ 2PGCA 2ABYA 2DR8A 1FI4A 2RDJA 1KOHA 3SAFA 2XYGB 4MO4A 3BKTA 4ZPDA 3K5LA 2FXUA 5JJBA 2BEFA 1RB0A 4M3RA 4JI4J 2C3MA 4ZP8A 3OTBA 3D0PA 1QVFR 3R1XA 3VQPA 4OJ1A 2Q2RA 1N36J 3RRHA 3CCLN 5LSOA 4WFAL 4O0IA 2C2ZB 3OVSA 3KKFA 3MXMA 4HACA 3DRRA 3QFWA 3ENVA 4J9OA 2F3JA 1ZPVA 2QO3A 3E8OA 4U96A 2V8DA 2AF6A 4LRCA 2F7VA 1X9JA 2P6TA 5KG3A 3BZQA 4DV4K 1O1WA 1OPZA 1G2EA 2VJVA 5F41A 2UU9K 4OLBA 4WPAA 3LM9A 4UY85 1RGIA 4MLHA 2HHXA 1GX5A 4C11A 1V5VA 1QM9A 3DYAA 2LA6A 5IWAJ 5F8JA 3K8WA 4P2MA 1OYEA 5D3GB 5LL6d 3UE5A 3CJ5A 3R5AA 2EFGA 3PO5A 3KWIA 2AJQA 4H5RA 4DX8H 2FJAB 4JI0K 2J9CA 4C1NK 3GSIA 3K5OA 1DURA 3DYAB 4AFFA 2CPFA 3ENBA 3H1VX 3KK1B 4A8SA 3H98A 1H0HB 1KVBA 3BREA 3Q0AA 3QJPA 1K47A 4JKFA 3EZOA 4FJXA 2IBOA 2Q97A 1KLMA 2MQLA 4LF5F 3W1YC 1Z25A 3L6QA 4DV3F 2YQ3A 4OPHA 3SQ0A 3CF5Q 2E2NA 1NGHA 1U26A 1WKKA 3TAMA 4KT0C 3RBDA 1FD8A 1DLOA 1NB2A 4XDDA 3MM6A 1BA0A 1S1WA 2QKKA 2OYQA 3S7RA 1DHMA 4M45A 1PO6A 1NCLA 4I6AA 4ZJQA 4C8MA 1XMOF 2MZ1A 2XZDB 3E1YA 3BSAA 4DJBA 3K5MA 4M3XA 1P9QC 1CJTA 1HMVB 5K5MA 1NBEB 3U6FA 2V9KA 4QR2A 4LSNA 5DGAA 2LMIA 5A8KB 4USKA 1LOTB 1UMJA 2W1BA 3DDKA 4FBUA 2HB5A 4X62F 4MKVA 4CZLA 1Q9XA 2J6SA 2OPSB 1FEHA 5M1PA 4CYUA 1R8BA 4JI7F 1WKLA 1RT2B 3QGGA 1SKUB 4JHDB 4ZOSA 2DGSA 1ICEB 5A8KA 2P9GA 3GONA 4GVMA 2QM1A 3CCSS 4P2XA 4CEOA 3VGLA 2ZKTA 2AJFE 1MWYA 4NYFA 3QDKA 1VRTB 3CCSN 3VR1A 2HHHJ 1RT3B 3ENAA 2UXCK 2CJAA 3QRPA 1HJRA 2OPSA 2KXNB 2E1CA 3LDLA 3WQPA 4LF4J 3DLKA 4JI4F 4ZKAA 1RHUB 2W4PA 4CIGA 3VMFB 1S7IA 4H0VB 4OI4A 4IH6A 4DV5K 1FVQA 5DJBA 2Z0GA 3NH2A 2YKQA 2MKJA 9ATCB 1IWGA 1VYAA 5CCMA 2FF6A 5HLFB 5KFOA 1Y97A 2IMWP 4DFMA 2RU9A 3WNEA 2V67A 4C9DA 3RG6A 2FLPA 3OUYA 1N5VA 2M4MA 3P8BB 2ZEJA 1BD6A 4DU3A 1J5EK 4FOIA 3G82A 3EICA 1DTQB 1SKSA 4DZ6A 1T95A 2ASMA 4MMOA 5HP1A 3GJQB 3CIZA 3N4QA 4HR2A 3Q8RB 5AQNA 4K43A 3SCIE 1HI8A 3CQXA 1C6VA 1GOAA 4RNFA 4L73A 2F63A 1K9MO 4FJ7A 1LK5A 4DHVA 2P9IA 1O5JA 1VQNS 4K4XA 4KE5A 1RGVA 5HP1B 1C0TA 3NRBA 2R42A 3U7JA 3ILJA 1X5TA 1X4FA 5J2QA 5HK4A 1FCAA 3IN5A 2IS3A 2OTJS 2J7WA 6FDRA 3MR6A 3T1HF 3OYLA 2DCUB 2WUSA 3GV7B 4UT4A 4TY9A 1FNMA 2UVUA 2HHQA 1I5OB 1PYTA 2KHCA 1RWWB 2HNYB 4IOCL 4DPWA 4GV3A 2ZBCA 4BDYA 3QLHA 3DDIA 4YB7A 3CNQP 5T7BA 3MFHA 4MKAA 3OFEA 3QEWA 4Z7YA 2KKZA 4OX9F 1Y5LB 3C95A 5J1PA 2FVPA 1NU0A 1RYRA 1HWKA 2PT0A 2AP1A 1DY3A 3IWLA 4DTPA 4MK7A 3W9JA 2CJYB 2XCPA 4QWAA 3N5BA 4W90B 3VGSA 2UXBF 5KT2A 1UVNA 4OVLA 3I87A 1JLCB 3QGHA 4FM0A 3R2CJ 4DUYJ 2V0NA 1YJTA 1P8ZA 5C2GA 2C1EB 1RXOB 2L48A 3QINA 2UUTA 2IJNA 2KZMA 4LFBK 5IT0A 4P52A 1VQMN 4RX6A 4DTUA 2BVZA 3A8EA 3HDSA 3AHPA 4KHPF 4HLBA 1QDUB 5THWA 3NMAA 1VBZA 2CNNB 4FJIA 4BC9A 3OYIA 1URRA 2VL1A 1ATSA 2R7TA 4M3TA 4ZLLA 4KPYA 4LF1A 4PWDA 3PR5B 3L2UA 4IRCA 2RS8A 2F4VF 2XO7A 3C2PA 1U49A 1YBTA 4OZ2A 5GMEA 2AYBA 2X7IA 4DX5A 1VBKA 4MYUA 2OD6A 3AGRA 4I4BA 4JI3K 1FF2A 3OSPA 2QWMA 3NGKA 1FRHA 1ASWA 4EZ6A 2GA7A 2MLZA 4HCBA 3SIPB 1HNZF 4A61A 1GLBG 4O8UA 1NSPA 2QMXA 3ZZZA 3M8RA 3K17A 4CF0A 1RUSA 1NG9A 2QZ8A 3UB5A 1KTVA 4DV4J 5AE3A 5KFDA 2UYTA 5F3TA 1TL4A 2FLOA 2KT3A 4FZXC 2G0CA 1F5AA 4F02A 1Q7YO 2UVVA 2FY1A 2Q79A 3T5JA 4ZPCA 2IJFA 2VB6A 4NYPA 3SSQA 2AMCB 2MYFA 2DPNA 3O5TB 2SXLA 1R43A 2X6NA 3EL2A 4TY8A 4DWIA 1XNQK 3WXMB 3AO3A 3R7SB 2QN6B 1NMNA 2PY5A 2HHUA 1FA0A 5J1EA 3ZTPA 4YEAA 1NUEA 2AGQA 3GG4A 2FC0A 1FRXA 4X65K 4BVOA 4CEFA 3W2WA 3LPEA 2DNLA 4K4YA 4MIWA 2UVWA 1N8RT 1KHVA 2V2KA 4XTTA 2E1RA 5AQQA 5KFXA 5EN1A 3KK1A 2QW9A 3IBFB 4DV1K 3Q8UA 2MSTA 2J0SD 1ZA1B 3R7NB 4CESA 2YBVA 5F8HA 2GJ2A 1FNXH 1OH8A 4E1MA 4LH4A 4XPCA 4QS9A 4K8ZA 1Q8IA 3BB5A 2V34A 2R7RA 3K57A 2WVCA 3CVKA 1EQYA 2EHGA 4OX9J 3QT7A 3EPGA 1OSCA 2DY4A 3JSMB 4FYXB 4MTPA 4FJMA 1KVIA 5EGYA 4YOWA 5IS2A 2HWIA 4XO0A 4ZDNA 4OIXA 3TX8A 1NWKA 2CPYA 1LOUA 3NCPA 2HF4A 3CMAS 4Y2MA 2PYLA 2VDIA 1QVGR 2KFNA 5F9LA 2W42A 2UP1A 3EE3A 5ETKA 4N76A 4PG7A 3EJMA 3AA5X 1NOYA 2YHBA 3DU6A 1SZ2A 2LEPA 3GL1A 3R5JB 1X3MA 3P3DA 3NLCA 2ZUAA 2I8EA 4NLBA 1GMVA 4DU7A 5JUMA 1GXTA 1CBKA 4LH5A 2IMOA 1OWXA 2D0PA 1N34K 4KHPK 3MDFA 3NGTA 3OLBA 3AV9A 4PYDA 3M6GA 1FRKA 2KRBA 4OYAA 1RT2A 3K9KA 2GJFA 1FD2A 5LMNK 2ZC3A 3D7SB 5KFTA 2OZMA 4ZVFA 4DL5A 3WHIA 4DOZA 2DH8A 1X4HA 4ZPVR 4HDGA 5AXKA 3CCES 2W9CA 1FT8A 1AYEA 3RBZA 1SS6A 1HBUB 1JXLA 3I96A 2VJUA 4TYAA 1UAXA 3JTPA 4JD2B 2ASJA 3BKUA 3R97A 3M5RA 2DHGA 1RILA 2QC3A 4X4RA 4FJ8A 5AQGA 3TSUA 2HEKA 4ED7A 4Z4GA 2DTJA 3VQEA 4CO4A 4FZZA 2KT5A 4X4NA 4DL3A 2RUGA 2EW9A 4FBTA 1IR2A 4DTSA 3W61A 5C2FA 1HRHA 1GXLA 3W2VA 5BR8F 1UVMA 2EKYA 1JCGA 2W7OA 4YDUC 3NCRA 1YJRA 2VKRA 1W2BR 4OHYA 3R1LA 3BBCA 3T5HA 4JI1F 1ZBSA 1V3SA 4WYWA 2ZH6A 3CIMA 4CBWA 3BUZB 3TANA 2XGPA 5I3UB 3VZIA 1C0MA 3QAEA 2B9YA 3IUCA 2XCAA 1F3VA 4M5DA 1CLQA 3MWBA 2DTUA 3JS9A 1K1QA 3GCXP 2CFXA 3TA0A 3JAMU 1N33J 1KTQA 1UEKA 1GTHA 4DN9A 3MEEB 1P27B 2VG5A 3V9UA 1TL3A 3MPDA 5J2PB 3FZFA 3M2RA 1U7LA 3NS5A 4LF9J 5KPTA 2N3LA 1LNQA 3KK2A 3Q8SB 2OFGX 4B1WB 3IR7B 4CO1A 1TFWA 5JVGQ 2VU5A 2W2MP 4OKEA 5C24B 2FZCB 2L9DA 1RISA 3GE1A 3V9ZA 1KXPA 2Z1JA 5D4PA 1T3NA 5J1EB 3HHDA 4LF6F 3IRXB 1TL3B 2NUHA 1TZ0A 4USJC 3OW2M 3FZHA 3SV3A 3WC0A 1UW9A 1AW0A 2YPYA 3VF4A 3NAEA 4BLGA 2LECA 3EXCX 4KHUA 1RA7A 1UL3A 4C8YA 3BSNA 3OYMA 4KB7A 3RB4A 4M7XA 1JCEA 3KJNB 5D6GA 3O9UA 4L3KA 3TAFA 3PHTA 4ICLA 2ZC4A 1HARA 2M3DA 3BS9A 4K50A 2A18A 2VH7A 5EOYA 2R2UA 2LXFA 2W40A 2IAJB 3L09A 4RNNA 3TVKA 4IEEA 4ES3A 5KT6A 2H3GX 4L3NA 3PEJA 1N0VC 1ELOA 4BR7A 4A57A 3VOVA 1T8EA 2AEFA 1C1CA 4EYHB 4IKFA 1RADB 4CO2A 5GMDA 3CCWA 4CJUA 4ED2A 4RG8A 5DO2A 2JEGA 2UUCK 4Y28C 1KLMB 2PA3A 1DQ9A 1J9AA 2BUPA 3DLEA 2D5RA 3OJSA 1I94J 1W2BM 3JQJA 4CD3A 4J9VA 3L2WA 4NLPA 4YDDB 3VZHA 4ZPAA 3BBBA 5ELZA 3B78A 1H38A 3VEXA 3K9JA 1IQZA 2C2DA 2BE2B 4YY3J 1UVLA 3OQ2A 4FPBA 4CZGA 5JS2A 4OZ3A 5HMYA 3VAGA 4OZ1A 2G4BA 2OZSA 5D77A 4NLSA 3PW0A 3AJ1A 4M5KA 1VSHA 4Q43A 3H1QA 1M0SA 1U24A 4C4WA 3BN4A 1HMVA 2YPZA 4OJRA 4WBFA 3ZSOA 2H5IB 1SUQA 3MM7B 3SDEA 1EKSA 1RT1A 1H74A 2BJ9A 1ZTWA 2FC8A 5BR8J 1ROFA 5KFGA 4NXMF 2C2OB 5EU7A 4NXNJ 2BRLA 3CXCM 1Q82O 4AQYK 4DFKA 2YKMA 3OBYA 2FJXA 5C5JA 1LV5A 2MHEA 2AT1B 3BGUA 2VONA 2ZH2A 1C0GA 3QATA 2ZNYA 3N28A 1GK8A 3S3NA 2MHNA 4RW6B 1M1KO 4ZMMA 3RZAA 5AZJA 3KFWX 2Y1JA 4ZN3A 5KFNA 1RT3A 1UTAA 4DTRA 2CQCA 3IS9A 3OBWA 4U7UD 2YNHB 2FJVA 4JKDA 4H4MB 2IHR1 4DPUA 2YNGA 3BPSP 3D3BJ 2RKIB 3C6TB 3VQTA 2PSZA 5AQKA 3CDWA 1IKYA 1JJ2M 2EBGA 2YWKA 4CTAA 3EGZA 1EX8A 1WB9A 2P9NA 2XMVA 2JEFA 4M41A 1WORA 1BXNA 2WVDA 3N6NA 5F0UA 5C25B 3BGRA 1KAXA 1FDDA 2BJ7A 5I3UA 2JGUA 3W60A 2FVQA 4GMJB 2PA8D 2F8EX 4DV1J 1JWWA 4ZS6A 2JFDA 2ROEA 3HD1A 1IKYB 1FDNA 5GAGI 3QO9B 1LQ9A 3ENWA 5KFMA 2BRKA 5J2NA 4KTQA 2LP4A 4BR0A 2YV0X 3A8JA 1ATNA 1Q86T 4DCHA 5JVHQ 3ITHA 3QWUA 4PAAA 4QPXA 3P4UB 2P9KB 3BM7A 2CQ4A 4ETZA 2VCPA 3T3FA 2C42A 2W2NP 3W3DA 3MAAB 1WUUA 4XDCA 1JL1A 2FHKA 4ZITA 2B6AB 4CO0A 2G1HA 5C7PA 3PHEA 1MU2A 3ULHA 4Z2XA 4B1VA 3LWLA 3MM8B 4LF8F 2WC9A 2G2YA 3C16B 1S97A 3UD3P 4Y65A 1N6QB 2UUCF 4DTJA 3THXA 2IRUA 4OZ5A 3M1VB 4CE9A 2KG0A 4BE2A 4YMEA 2ZM6J 4B3OB 1N5YA 1TKXB 4MKYA 3MOJB 3MPUB 2DFEA 2OJ3A 2W41A 3H45C 4KV8B 1NOZA 2MZQA 4LFAK 3VGMA 4USMA 4ZCKA 1HLWA 2CZ4A 4EHUA 5KRSA 3THXB 4WP8A 1RTDA 5E3AA 3J81U 4EUVA 4B3OA 4WP3A 4BC7A 2VV5A 4P6QA 7FDRA 3MZIA 4IOAQ 2BMBA 1HX1A 2ASOA 2F8HA 2F4VK 3I31A 2O8EA 4FLZA 3H6EA 1VQ9S 4KHMA 1DGKN 3QFUA 1IBCB 1LK7A 2YWEA 2AWZA 1IR1A 4FJKA 1S9EB 4L6V3 4IZ9A 2ZH3A 4NI2B 3ULEA 5AQUA 1Z2ZA 3VETA 5LMUK 4DR4K 3RW6A 3P1GA 3A8IA 3WXJA 4BR4A 3I56S 2ZDOA 1N54B 2NRZA 2HVZA 5I4MA 1X4GA 1N5TA 1JKHA 1Q9YA 2BW7A 2R8GA 3TUPA 4A8WA 4DR5J 4ED0A 4NRUA 2FY8A 1OH5A 5E7OB 1WAFA 3EM1A 1E6VB 1VQPN 4FLTA 2YX6A 4QR1A 3CERA 2K3IA 3MM7A 3A5NC 3ZNJ1 4YB5A 3WNFA 5D4LA 2IM3A 2Y8WA 3FCWA 1HQUA 3HZEA 3R3LA 1K8KB 3O08A 3MMCB 4PWDB 3D2WA 3O3HA 3PCOB 2D1KA 1ITPA 1IKVA 1QQCA 2OLWA 1R31A 1S12A 5AQYA 3J7YU 1JXBA 4OHWA 1VBYA 5KQDA 2E2PA 4TU7A 4P9SA 1RU2A 4CZKA 3KTQA 1E4FT 3PY8A 1KN6A 1NMDA 3AA9A 3AARA 5KGWA 4BROA 2FGCA 2AEMA 4DG1B 2YH0A 4CNZA 1YJUA 4BBYA 4HUFA 2AGOA 5KG0A 4X4VA 2GIRA 2LEAA 1PSDA 2OTLN 1QQOA 3M6UA 1F5BA 3IP0A 4Y2IA 5IM0A 4DSLA 2O8CB 4ZPBA 1U09A 3HSGA 2CNKB 3J80U 3KLEA 4CTAB 1WG1A 3K5PA 4CEAA 1N33F 3ILOA 4LFCF 1KHWA 2A42A 3CSKA 2ZBPA 3MR7A 3WX8A 3ZTSA 3ENOA 4KIAA 1RDDA 4FWKA 1VIOA 3CW2C 2HHVA 3E01A 4JNEA 4JI6J 4IO8A 4Q7AA 3T1YF 2HSEB 1MDUB 4NYZA 4EYIB 3EVMA 3SAHA 4NLYA 3I9V9 4PPDA 2ALZA 5CABA 1FTCA 1FDBA 4CZMA 4KH1B 3FZLA 3KMQA 5A0YA 3JB9k 2P9KA 3J7ZT 3KUHA 4AILC 4CBXA 2VUGA 3LM2A 2XMWA 2LCWA 1SV5A 2GEMA 3M6XA 3S3OA 3D2FA 4M3YA 4X62J 3CDUA 2B6AA 3D5MA 4F9OA 4CGHA 1HNZJ 3MUTP 4OV1A 3R9LA 4H0TB 3K2PA 1S9FA 1T6DA 3ZT3A 3IBCB 1HD1A 1NSKL 2RF2B 3CIPA 3IKMA 3I9ZA 3TSQA 3GIIA 3LQVA 2QXFA 5CZ2A 2D0OA 1N56A 3N4WA 4PKIA 2IRXA 4V19X 2O66A 2H48B 1FESA 4E1NA 4WIIA 1YHQN 1VQ8N 4K2XA 4XPEA 1JNZB 1YVNA 4KI4A 4KGZB 1KSPA 1Y5NB 1HNIB 4CEDA 3NAHA 3M8PB 5KT5A 2XLJA 7FD1A 4KO0B 4CGJA 3R3TA 2MGZB 3F0NA 4AQYJ 2HW3A 2NS1B 4FJ9A 1X5PA 2HBJA 3QEPA 3CCVS 4CHYA 3NGDA 4FL9A 3P38A 1NGGA 1GNKA 3CB4A 2WW8A 3WUHA 3MXIA 5HROA 3QWPA 2RDDA 1B99A 2L9WA 4NI2A 4KH5A 3BQ1A 4F8RA 3IMQJ 4KHYA 1FXRA 2YX1A 1HD0A 2EK1A 4M1KA 1UCNA 2XWXA 1N36K 4U67L 1YZ6A 1U6BA 1Z2LA 4NEZA 1YI2S 2HIYA 2UXDJ 1N5QA 4NEYA 1ZH5A 1SJRA 3DJCA 1JKHB 1OO0B 4B3MF 3EY1A 1T9UA 1RU1A 4CM2A 5HROB 2V7YA 3IDHA 3ASMA 1CJKB 1RLCL 4EO8A 4UUXA 4E1JA 3GR1A 4DDFA 2GC8A 2GTDA 4RUCA 1CVJA 1IJFB 3KLHB 2HMIA 5FD1A 2ZJQQ 2MPUA 5DS7A 1QQNA 1FHTA 4EZ9A 4FLVA 5HBMA 5HI7A 1SI9A 3HFZB 3BGRB 3G6VA 1WN7A 4F4ZA 1PAEX 1CPZA 4DL7A 2HBZB 4FF3A 2MKSA 1B0TA 1LKZA 3PX6A 4QIWD 3W2VB 3CC7N 4CFCA 4NLTA 3CJTA 4I7FA 5C42A 4HTLA 3C6AA 5EUHA 3AA4A 2V2VA 5LXRA 3EZUA 3MCOA 5FPEA 5MLCQ 5J2MA 3CD6N 1V4TA 2CA9A 4LF7F 1EP4B 3ITHB 3UDVA 3CC4S 3HD2A 2WSCC 1VSJA 5L1JA 1KVCA 2GIQA 3N9UC 4DCPB 3WXLA 4DG1A 1WOSA 2A5XA 2PN6A 3GV8B 3R5DA 4J9MA 3MUVP 2RVJA 2KM8C 3UNGC 3TQEA 4PA1A 2DNHA 3UNYA 1MU2B 4J2AA 3DLBA 2UXDF 3S1TA 5JLFA 3WNHA 2G1DA 2EFPA 5KFZA 2CQ3A 4TQRA 3A13A 4CZJA 4J91A 4GKKF 2UUBJ 4HUEA 2Z2ZA 3R5GA 4JI2K 2JSXA 4DR4F 1KQFB 4WTYA 3KK2B 5KFRA 4FO0A 5KTQA 2VYPA 3CC4N 3W66A 1WKJA 2RT3A 4D3GA 4IG3B 4KHPJ 1ASVA 4C3LA 2ZHBA 5KT4A 2IDEA 2QI2A 1U0HA 1NEEA 1DFDA 4FJJA 3D67A 2RS2A 4NLCA 4A59A 4FJHA 2R9LA 3DI6B 5L1KA 3CFPA 3TP2A 2F4VJ 4A8YA 4RBTA 3LAKA 4BC4A 4WFNQ 1EO1A 2AX1A 2NXNA 4F3MA 2ZUGA 1Q79A 1JNRB 1KQSM 3JQKA 4IG3A 3PX4A 1WDTA 3TRGA 3MMBB 2EK6A 1YJ7A 3SUQA 1RWUA 2ERRA 4ZN1A 1QTMA 3KHHA 1KEKA 2DNNA 1HKAA 3TJ9A 1XN9A 4DFJA 1F9EB 1G6BA 2QGFB 1S1UA 2DCLA 4M5LA 3BR8A 4G9ZA 1MSWD 1M5HA 4Q5VA 3X3UA 1DQAA 3ZT0A 1BQXA 4AHRA 5HMXA 3IGNA 4W4MA 5AJ3J 2X1AA 4U9RA 4CHNA 2R2SA 4ZLJA 1ZM9A 4OKJA 5KG2A 3UPFA 4JOUA 4QWBA 5IV3A 3TI0A 4ZLPA 5FIIA 1E6VA 3D54A 1J53A 3Q8VA 3FVYA 2EG2A 4DV2J 3UVJB 3S8SA 2ADBA 1Y3KA 1S0NA 1GMWA 3T69A 3BGLA 4A8FA 4LFCK 1HQUB 3W9HA 3RBXA 2OCEA 4EFHA 4X4TA 5ADXH 4N7TA 2RQ4A 4WKYA 2OO4A 1YIJS 2A1BA 2QLXA 2HMPA 5KG1A 1SC4B 1JLGA 4ZHRA 3G6YA 1WHWA 2VF3A 2VWKA 2FLLA 1U4BA 3UVJA 2HNZB 2OGUA 3D4JA 5DQIA 4KBOA 2ZJPL 1F21A 1D9AA 4E7LA 1F9FA 3HHLD 1A5XA 4WK1A 1KFSA 5B0EA 1KOOA 1WSEA 1C2PA 5LXYA 2D1CA 1JK9B 4J2EA 1VQOS 5AXLA 2O8CA 4GO7X 3UFCX 2AQ4A 4J9SA 1IBMJ 3BN7A 2HHWA 1G15A 3SQ2A 3KLHA 2HMIB 4IOBA 2LXIA 4JN4A 2ZVSA 2G8UA 4BGAA 1AUSL 1FERA 4WXOA 4B3SJ 5AQFA 2OPRB 4R8UA 4ED4A 4D3HA 4G1PA 1KWMA 4Y1CA 3SJHA 2COLA 3K58A 3KLIB 2DIUA 3NF6A 3ISZA 2OMOA 3C6TA 4F3QA 2KN4A 1LFWA 2NUUG 3VF0B 1F60B 3HP9A 4ZIWA 5C42B 1S10A 1VFJA 1J54A 5BXIA 4ILJA 3M2VB 4L3QA 2DR6A 2RRBA 2CG4A 4TQSA 1U48A 5IQ6A 2PMHA 1YHQS 2DVIA 3OVNA 3BEXA 3SK3A 3Q83A 1J2VA 5A0YB 3SSRA 3LDOA 2CDRB 2Q31A 2ZH8A 3IRWP 3F9MA 1UEVA 4QBUA 1RAAB 3QYYA 3O3LA 3BEGB 1IG9A 4WE1B 4CI6A 4RW7A 4WFBQ 2N82B 4LRDA 3U3GA 4NLUA 2MZRA 4EAHD 3GCWP 4JK9A 3UE2A 1CXQA 1UWAA 2XNQA 4DLEA 5GAHP 4LMZA 2RF2A 4BS2A 1U6FA 4BRMA 2EC0A 5F1XA 2C28A 4Y3CA 4KTZA 3BO4A 4DR1F 1SAZA 4OLPA 4KRFA 4WE1A 1TMJA 4O3RA 1XC3A 5AT1B 1XR7A 5L39A 3WEEB 5BPLA 4TU9A 4CI0B 3EE9A 2I0XA 3V2UC 2GV1A 4DU4A 4JI5K 2CNLB 2FZGB 3SCLE 4Q8FA 3W8GA 1I6JA 2HQDA 4HHHA 1MA9B 2W9BB 2AYMA 5BREA 2FYXA 1NK9A 1PYSB 3OSNA 1QD1A 3KXDA 3PYEA 4USVA 4JI1J 1U0SA 2QG9B 2IYGA 1QAXA 1Z1ZA 3RGIA 5FPMA 3UKRA 2DEIA 2XEXA 1VK0A 3P96A 4CLUA 4KV8A 3CCEN 3MMBA 1RTHA 2DNZA 5EWGA 4DR3J 1NLVA 4PRFA 2AGPA 2HQ3A 4CLSA 3Q7CA 3ZX2A 3IG1A 1HQ2A 2P9SA 1YVFA 3MTJA 4C3MA 4P72A 2P9PB 3EN9A 1IVZA 1CLFA 3I56N 3DAWA 5A8WB 3LGNA 4ZLNA 3IM8A 2YJEA 1FRJA 4OZLA 1RWVB 4M42A 1IWAA 3BDPA 3VESA 1P6TA 3FEYB 2DPJA 2CWKA 3AVCA 3M32A 1Q1KA 3VAJA 1TKTA 2BV3A 3KK7A 4QYZJ 1TV6A 4KJIA 3FGUA 3B6BA 3J81j 2C2MB 4CF1A 1Y9OA 3PJ9A 3EYZA 3DLRA 3P31A 2C2KB 1APSA 3AJDA 3HK2A 3OXFA 2P9LB 2Z57B 2NRVA 1D0EA 1QLNA 3DWLA 4J9UE 4B8AB 5CQGA 3WNGA 1IBMF 2MZTA 1GFWB 3LP1A 5D8HB 2D3OR 4Y0FA 1HNWJ 2N4CA 1M5SA 3C7NB 1X4CA 1QQMA 3EVOA 3GE9A 2D0BA 2ETJA 4FWOA 4IDKA 3MK6A 3KZBA 2LU1A 1BLUA 2NYIA 1WSGA 2E1PA 4H03B 1S1XA 3KHLA 4K4ZA 1T9TA 2Q3PA 5LT5A 3RB6A 2ITMA 4EK2A 1K8KA 2OELA 3H8YA 4FDFA 2GMLA 3MEKA 3L95X 1PILA 2BZ2A 1WF0A 2ATCB 2WVFA 3AA2A 4FK2A 3UKUB 1RDCA 2KO1A 1HNXF 1RBUA 1RWOB 5FPDA 3KLFA 1A5WA 5EWEA 5K8MA 3ZZYA 2H1YA 4DR7J 2DGWA 4PG8A 2ZD1A 4USUA 3UCZP 3CCRN 1DEJA 3GSDA 1IBKK 4E8UA 1VJWA 1TUWA 3DOMB 4NA2A 4W5OA 4X64F 2FBVA 2UXBK 1V9OA 4ZCMA 1K0TA 1FRLA 4AHTA 5IM0B 4FKYA 4Z4HA 5IT9U 3G8SA 2QA2A 5KRTA 3KHYA 1S1TB 4B3MK 2GELA 1O51A 1RT7A 5GAEI 5E3RA 3ZTQA 3THVA 2Y1RI 2W2PP 2MZJA 4DV0J 3LW5C 2MQMA 4KY3A 4YOXA 4O8KA 5ADZA 1KDNA 2XY6A 1Q7LB 4AYBD 3GYGA 3RRGA 3IMXA 5F0XA 4ZCIA 1T03A 4F0KA 1ZBTA 4I6YA 1AFIA 2VFSA 4XH5A 2ZH7A 4RLEA 1WOPA 3L7OA 3PVXA 2WVEA 4JAXA 3JAMO 5JS1A 2J6TA 3FRZA 2GIFA 2LU2A 1C1AA 2ZBIA 3QMQA 4U7UK 3M8QA 4P74A 3NH0A 1KVKA 2Q0RA 2XZWA 3RRKA 3POTA 2J8AA 5BYRA 5FJ4A 4X4SA 4OL8A 5AQMA 3O2IA 3L2VA 4FWRA 2DXFA 1Q5VA 2ALYB 3NEKA 3K89A 4OJ3A 1RDWX 5KFLA 4N8NA 1YRUA 4FPRA 2HKEA 3HSJA 1FWPA 4J90A 2CUYA 1KAYA 3VAHA 5I3PA 3AB2B 2CPXA 2MQOA 4YN3B 2V69A 3UQSA 1EETA 4JYAJ 1RT6B 3D66A 1U1NA 2J6UA 4U8VA 1VRQC 4TLRA 1DAXA 1BCOA 1LXJA 1TUVA 1HYVA 3BSCA 2OANA 4DPOA 4FNHA 3NG8A 4A4JA 2P9EA 3VVTA 3NGSA 3TAPA 4KC5A 4AXIA 3AVKA 3A3NB 1EETB 1QTNB 3H40A 5ETRA 2IVMA 1ZAWA 5HMZA 4KH0B 4ELTA 2P9SB 3H3NO 3AA3A 2HNZA 1C1BB 2WOMA 4P2SA 3PSIA 4EMDA 4KHRA 2JFKA 1S1VA 1WTBA 3O3FA 2DNOA 4F2SA 4PG6A 3M05A 2BA9A 5M2UA 4FPAA 5DG9A 3CDEA 1ILYA 2CPJA 1VQ5N 3ZSYA 1TK0A 1NGDA 4AE5A 4CEBA 2C2NA 3I5CA 1K8AO 4JS5A 4EEYA 1K73T 3PDNA 3DOLB 4DV6J 4RUHA 3B4DA 1OPIA 3UDLA 3O9RA 2R7SA 2ZGZA 2RRNA 3T9ZA 4RW8A 2BKPA 3F73A 2XWYA 3DHWC 3VGVA 3AAWB 8AT1B 4NCBA 4C1NI 2MZSA 3TPQA 4LBPA 2PI4A 2BE7D 1X4BA 1UJ6A 3VAFA 3IC1A 1Q8BA 4FWLA 4O0NA 5ETOA 4YOVA 1K0VA 2FSJA 2YWHA 1A5VA 3CCQS 2G8FA 3JSBA 3KJVA 4GKJF 3C14B 4WU3A 5K8PA 5SWMA 1H72C 1IBLF 3M6WA 3VA0A 2RE2A 4N41A 1VQYA 3CJ1A 5HBMB 1BOTO 4CJKA 3U1MA 3AODA 3CO9A 1UFWA 2LLZA 1SJQA 5HVFA 2R7VA 3MM5B 4NA3A 2ZM6F 3SV4A 3U9ZA 1QS4A 5FLXO 3OTOF 3RMDA 1RBSA 2ZH5A 1HI0P 4FPIA 2N7YA 2A1RA 5E3PA 4H4OA 2MQPA 2W25A 3O6WA 5GMKa 2JRSA 2F8SA 4WFZA 3K8VA 4BDPA 1N34F 2EVZA 1RI7A 5L9XA 5LOQA 1T9VA 5B0AA 2DHAA 3LTOA 1CQMA 2NREA 4YHHK 4WFYA 1FDAA 3UDCA 4NB4A 1S57A 3V6JA 4EIAA 4G3IA 3H42A 2YKOA 2HBQB 2FD2A 2OUGA 4LVOP 4C8OA 4H5TA 3H0PA 2Z2MA 3HOTA 1X4EA 1YJ9N 2CXEA 4DR6F 5CE3A 3SXLA 2PFFB 3QNWB 1TYQB 4RTFD 3FNNA 3GFHA 3DLGB 3SI6A 3C8YA 2IY5B 4AUKA 3SMZA 3MR2A 3MF5A 4NCGB 3AY9A 4MDBA 1PYOB 1VC6A 5G0RB 4IQXA 4NX9A 4OYZA 2Z1GA 1Q7YT 4F4KA 3CWJA 3PJXA 2G0JA 5DDPC 2C2EA 4FK4A 5IV4A 2DNQA 3HSDA 2X1BA 3UKRB 3HVAA 2H9ZA 1YJWN 5EVZA 1RTJB 3EPIA 2M88A 4DXLA 3LH2S 3T6JA 3QQCD 4CCHA 4NCGA 1RNHA 3ZETA 1OYDA 2F1FA 5FLXU 3CHWA 5IWAK 2GFFA 3A2FA 3G86A 2AU0A 2IRYA 2K1RA 3GJTB 4LF7J 1NDCA 2ZJRL 2JVRA 4UUWA 2F96A 3J7A1 3LGMA 2X51A 3BPDA 1CULB 4BRCA 3QPIA 4X65J 4OI2A 2R8HA 2DO4A 4DPTA 5L8RC 5F3ZA 1TQLA 5KFFA 2N3OA 1CG2A 2IFXA 3M32B 1NU4A 4IH7A 2XULA 5CYQB 1TV6B 2XMKA 2HWHA 2ZVIA 5LL6Z 5DM6L 1XHZA 2OSQA 4MJKA 2ROPA 3D7EO 2OH2A 3TX0A 5C2DA 1HR0F 4K4SA 2H3EB 4BWJA 2A2CA 4NXNF 5B0BA 3OR2A 4I6MB 3NNAA 3O1WA 2VICA 4RCHA 3VQSA 5AQZA 2FJDB 8RUCA 2E7XA 2GWJA 3LPUA 5DMRA 3MN5A 2KHDA 2FHMA 3I82A 2CZ9A 1RDBA 1FJGJ 4BY9C 3CQ8A 2DNRA 4ATNA 1NPKA 2B4PA 4B9QA 1S1XB 2A6AA 4BDZA 3VVUA 1S4FA 3VEWA 2QK9A 4DV0F 1EXQA 2RAQA 3U3YA 1NDKA 2VG7B 4OHXA 5D0RA 1J6ZA 1JLGB 3P6YC 4IFVB 4DLGA 3SQ1A 1YWXA 2CVIA 2R8IA 3DOLA 3LPYA 5MAOA 2O8BB 2BJ1A 2NLWA 1YTUA 2OIHA 5IFMA 3KJQB 3NGRA 3TA1A 1S3XA 3HPGA 1CS4B 1CJVA 3DRXA 1DBDA 1QAJA 3RBEA 3J7YI 3VHQA 2VBXA 4AXJA 1S4EA 4B3MJ 3DGPB 3ZEUB 4CH1A 2QSFA 2DH9A 3HM9A 4OI6A 4WFXA 2XY7A 1YX2A 3W9IA 2QTDA 1TL1B 4RR5A 1RT7B 3UD5A 2HHHK 1HBNB 3OHAA 3U02A 1VSKA 3ATUA 2VDHA 3W3SA 2DIVA 2AEJA 4EGLA 2N4DA 2DH7A 3NWRA 1N8RO 1N0UA 4K0KK 2HGNA 4O0JA 3CCJN 4YDUA 3VQQA 1S6QB 1T94A 3CCLS 3HL8A 1SVDA 2KH9A 1JLQB 3CCJS 4KREA 1XUPO 1AXQA 5M2PA 2ZITA 4M5GA 2POKA 1VMBA 2PI5A 2QWOA 4WP9A 2F65A 1F0XA 2HFNA 1C0UA 2KZZA 4NYNA 2ZDPA 4DCJB 3AD9C 3PO4A 4F25A 4L76A 3LP0A 1H98A 2R7OA 3VEVA 3MX5A 3GJRB 3LP2B 1B9DA 2V2ZA 4F2RA 2XMAA 3SMPA 5DM6Q 5A2QY 4DF8A 1VSDA 3PRBA 4C8ZA 1H6KX 1ZBLA 2LVWA 2DRBA 1WHYA 3OR1A 4RW4A 3HPOA 3D3CJ 1TMMA 2Y1IA 4JI3F 2YJFA 3NGYA 1UJ5A 2ASLA 4FM2A 1KFDA 3UWTA 3AVLA 2FC9A 5K8NA 5HANA 2UU9F 3GU0A 4DL4A 3FZ2A 1RACB 4Q0BA 4DSJA 4CZFA 3E51A 3CCMN 2ILYA 1RT5B 4ILGB 2GV9A 2MMYA 3FLCO 4KB1A 3L3CA 3J7AP 1AZSA 5HRSA 1RBLA 4BRAA 1J5OA 5A6WA 3ZCMA 5JMVA 3ET6B 4Y2KA 2E20A 2I5JA 4ANCA 5HL7Q 3PR4A 4OJGA 1HBMB 3A3OB 2K06A 4DQSA 3KG0A 1BDGA 1RAJA 3SUNA 1JL2A 1YJNS 1B7FA 3NXZA 1HLUA 3V4IB 2C2RA 4DV6K 1WDDA 1RAIB 2FB0A 4Q44A 1I94F 1JXVA 4MYTA 5CD4A 3NOCA 2HQGA 4MH8A 1X9MA 4KGXB 4ZP6A 3IG1B 2YHXA 3THWA 3MM9A 1BG3A 1IJJA 1K9MT 1Y00A 2YVSA 4PG5A 3SZ2A 4WIQA 4QCLA 5ETTA 2R4FA 4R0EA 4JV5K 1D9DA 3D1HA 2A1SA 1XMBA 3NNCA 3AOCA 3VQBA 1SKWA 1VRTA 1WJ9A 4QW9A 5CYMA 2F8MA 3PXGa 1VQKN 1IR0A 5KFYA 4WCEL 3KD1E 4FN5A 3PACA 3O6QA 4YDXA 3D1QA 4ECZA 1BC6A 4QIFA 3TARA 2Z1IA 2O8DA 3HOSA 2Q0UA 4GVBB 1TTHB 1B7YB 4H5WA 1SH3A 5IQQA 3ZZRA 1LCUA 4C8NA 4NLVA 3HT3A 5D4OA 3FQKA 2L3MA 4DMNA 2AP6A 4LFBJ 1X4AA 3OS1A 3NKYA 3O4QA 1FRIA 3WT0A 4YP3A 4DUYK 2NR0A 3C7NA 1JLAB 2E5LF 1IKXA 2YX4A 2FLNA 4RUAA 4JV2A 3LGHA 2X1GA 3RUBL 4F26A 3PIOL 3QESA 4JV5F 1HNVA 2PD1A 1KONA 2VHGA 1DZ5A 3VALA 4JI2F 1V3ZA 2VFVA 3CJ2A 3BP8A 5KFUA 4X62K 4FXVA 1ZC6A 3H59A 2VWBA 4H5NA 2QA4N 2WONA 1RAOA 3DRYA 4Y6IA 4NRTA 1SC3B 3JSRA 4X4QA 3TTFA 3CJ0A 3MWPA 4R79A 4X4PA 2I2YA 3FFIA 3T1YJ 2E44A 1NH7A 3CC2N 3A4TA 1B9FA 2E5GA 3TR5A 1N5SA 2ACYA 4EBCA 2YNFA 1F5CA 3OTOJ 2Q36A 4H5VA 2QYCA 2NQPA 5HRPA 1WC5A 2QTWA 2BJDA 1NSQA 1YVUA 4CGFA 4E0DA 2OHDA 3RMBA 2F5GA 1HNWF 3DLJA 2E7WA 3SQGB 1TAQA 3IAYA 2DEJA 3DOKA 3RB3A 4I2QA 3OPKA 5ETPA 5KT3A 1ZYQA 5KFJA 2EC2A 3DM2A 2XSFA 1L3KA 3D68A 3OYBA 1RTJA 1HWIA 3QZ8A 1GLDG 3CJ7A 3ID8A 3VEZA 4USHA 4FM1A 2DR7A 4LF7K 2V8HA 2B8QA 2D41A 3ZFVA 5KPRA 2F4FA 3O3GA 4PZVA 1VC5A 3KK3A 1CJUA 3NFAA 2KW4A 3A1YG 4I2QB 3A8KA 5F8IA 3HYFA 3G2XA 2HRYA 3OL6A 1BE4A 4NE9C 4HTIA 2FVCA 3R5CA 1C4CA 2K8GA 3EX7B 3R1HA 2CH6A 4DU8A 1Q0NA 4ERDA 4X64J 5GAHI 3ADAC 3VGUA 1TVRB 4CLTA 3POTB 2QWNA 3AVIA 1WTFA 6AT1B 3HHLA 3MEDA 2BANA 1TUYA 1SIZA 5JXSA 4OQJA 2VG6A 3VQ5A 5K14A 2GMHA 2G0IA 1RDAA 3V81A 2BBEA 4V19S 1YTAA 3OYHA 1YLXA 2X6SA 3HJVA 4NLOA 3HRGA 1NHUA 3MEDB 1RCXB 2V6AA 4DR6K 4B3TK 4R5PB 2V4QA 2VG6B 1KP6A 2GVDB 3VTIA 2D0CA 2YHYA 1G3OA 2NZTA 1DLOB 4KKOB 3KIOA 3J7Z5 1BCMA 4DV4F 3PYDA 2O67A 2NRRA 2VG7A 3UN5A 4LF6J 3RB0A 3TR8A 1VQ8S 4N47A 4UY8T 5BN8A 4WCEQ 7AT1B 4DUZJ 4PL8A 4FWNA 4RBUA 1PJ7A 3CE8A 4Z37A 4DR7K 1HPMA 4Z7CA 2V8PA 2QX0A 1I51B 3THWB 2GVDA 2O4GA 3OYFA 4LSNB 3H2UB 2IC3A 4GV6A 1FK9B 2QRRA 3QGPA 1D09B 2L08A 3IWNC 4KFBA 1HJOA 4J9KA 4ZIVA 1NK4A 4FF1A 5A8RA 4CJ7A 3S9HA 1SCJB 4RNHA 4AD6A 1JIHA 1FWLA 5KI6A 2DT9A 4JI2J 2ZH1A 3HSCA 2XY8A 3CFOA 3W62A 2HBRB 2XC9A 3TWZA 1JMTA 2VD3A 2J5AA 2CVEA 5ETQA 3QFPA 3DFEA 5CA5A 5LMNJ 2PEHA 3AVNA 1VS3A 1X0PA 2KU7A 3ZSZA 1M5OC 1MROB 1RTZA 2ATLA 4QIEA 3P5TL 3QBXA 5BYSA 3W5YA 4P2FA 1YQHA 2XTJP 2GWKA 4TVAB 4J8FA 3WBZA 3DLKB 3BF3A 3KHGA 3J8AA 3I8DA 4K8XA 3S41A 2CRLA 3MCMA 4MFBB 1FKOB 3G10A 1YAGA 3D45A 4IR1A 3CJBA 4J9PA 3I6PA 5JICA 2VQEK 3U1LA 4NO7A 1BU6O 2BTFA 4F0MA 4OMFG 4M95A 5LM7E 3TUJC 4C11B 3MEGB 3UD4P 1TFYA 1OSDA 4CHPA 1ESVA 4CHOA 5M1QA 4BR2A 3DHXA 3MAQA 2H4WB 3QIDA 3ENQA 3EDRB 1O0PA 4UW2A 1NDPA 4PWWA 4WXWA 4RJVA 2DGOA 3BV8A 4URGA 3CJCA 1UFLA 3SFGA 2HFZA 1WOQA 4CJWA 1DTQA 4B1ZA 4ZVTB 1XR6A 4WFNL 3SQ4A 3TWHA 1MN9A 3HFKA 1Q82T 4ILLA 2O8FB 4DPXA 3UIQA 2I38A 3W5ZA 5A76A 1VOMA 3U27A 1H1VA 2WRMA 2RRAA 1AZSB 1TYQA 4LQ3A 3VQ4A 2A6OA 4DV2K 4C7QA 2CJQA 4CO5A 4CM0A 3ZT4A 1SJ1A 3FFKB 4CFAA 3HZ6A 4BRGA 2V63A 4OX8A 3UR3C 4A8OA 4LT6A 2IVYA 1EARA 2CJBA 1NLKL 2W7PA 5E33A 2E1AA 4RWXA 2EBEA 3PSFA 4LRBA 1YBUA 2CQ1A 2RILA 1BY9A 3H08A 3TU5A 1X7VA 3O44A 5AE1A 4C0OC 1XC9A 5L46A 2RDIA 3SNNA 4GRSA 3I0RA 2U2FA 3O1BA 1YZ7A 4EO6A 3MM9B 1UWBA 2LEBA 2WVBA 3FQLA 3K0SA 3WX4A 1NKCA 2UUBF 4DV7K 4CLYA 3RMAA 3AVAA 3UI3A 2X3DA 4QQBA 3BO3A 3I0RB 4FWSA 3LPTA 4LJMA 1U47A 1KVAA 2NLXA 3Q2TC 4LIWA 3OW2R 2EFOA 4M5MA 1Q8KA 4IO1A 3R9PA 3EKSA 3T9NA 4ZVPB 3CJKA 1ZA2B 1S6OA 1J27A 4Y2AA 1RAEB 3I33A 2XSJA 1EX4A 5KOXA 3C6UB 2XHWA 4KYZA 3TEGA 4ZJOA 3IFEA 2UUCJ 1X1PA 2D9PA 2J0XA 4J7CA 3L4IA 1HFEL 2C3OA 4KHSA 2OD4A 4DV7F 3NS7B 2GVZB 5M1NA 2VA2A 4CLWA 4DQQA 3JTOA 4DR2J 1CZ9A 2CWXA 2E5HA 3C6UA 1GH8A 1NH8A 2JOQA 2Z58B 4IFYB 5HLFA 3X1LB 4IFVA 2RSQA 1S7HA 3V9XA 3DXKA 4J2BA 3M9OB 4NXNK 5AJ3F 3D2EA 3DRRB 3NGZA 4BG8A 1U1OA 2EPIA 3TJ8A 1R89A 2EXUA 2KKHA 2EFNA 5IXUA 3FSXA 4Q8EA 1MW7A 2KVQE 4UTGA 3GFZA 2A41A 3SQGA 3P45B 3OS2A 4K25A 4UOFA 3RSEB 1X3NA 1W26A 5LMUF 3TAEA 4GKJJ 2L9NA 3QEIA 4BWMA 2WB1D 4B8CA 5GAGP 5F8GA 4DX7A 2DRAA 3M9NB 4JBCA 4GNIA 3ZTOA 2LFVA 4RWWA 2JC1A 1RHRB 3A8YA 1U1QA 1WSHA 1C0TB 1VBXA 1XMQJ 2JDJA 1V4SA 4IO9Q 4ED1A 1N48A 4CZHA 5AQLA 4W5NA 4B9TA 2WTUA 5KG6A 4ALZA 5HN0A 3KVGA 1LAVA 1T05B 2I9SA 1XNQJ 2KB2A 4IYQA 1YJVA 1P1TA 2IAJA 3MHYA 2I1RA 4GKKJ 2KDOA 5I42A 3WZ0A 1BI4B 4NZ0A 1B64A 3RMCA 3OFHA 2V68A 4R25A 5EX0A 5KFIA 3O8MA 2VQFF 2QL7B 1SQEA 3T1AA 2PO4A 3T7ZA 3V81B 2DFHA 1L3UA 4W92B 5AR0A 1R3NA 2BH1A 4FSVA 3GFYA 2WB4A 2F9JA 4KI6A 2AIRB 3B6OA 4DKWA 1IG8A 1BI4A 4USTA 5ITHA 4FYDA 1IN0A 4QWEA 4L74A 5EWFA 4B9UA 3QJLA 2B9XA 4BRHA 4ED5A 2IA0A 2W01A 4CIEA 2XGQA 4CJVA 3Q2SC 3RAMA 1LWCA 1NGIA 4OLAA 4ZVSB 4G1IA 2GUPA 4CYUB 1XERA 2MQ8A 2XS2A 2CGLA 3W7BA 3MR3A 4DUTA 2HZCA 1Z26A 3HSZA 2IC3B 2IBKA 3CI5A 3V4IA 4K5SA 3VAKA 5F2RA 1MWZA 2DPIA 4UF4A 4H0XB 4PWUA 2QXLA 3QNNA 1GLJO 4OGCA 4OYPA 4EU0A 3VN5A 4M3ZA 4ECTA 3JYTA 5D4NA 4KR0B 1N34J 2GQQA 2NRTA 3IAM9 2FJEB 4RW6A 5IC4B 1M90T 1T02A 1NK5A 1TAUA 4B3TF 2XSJB 1R59O 3BSOA 3FCVA 5DDOC 1GLFO 3VA3A 3O4NA 5SUHA 3G87A 2HURA 2JLFA 3JYTB 2E5LK 2NXUA 2M70A 5HAOA 1XR5A 3G8QA 3O1LA 3D6HB 1NK7A 2O8DB 4XIUA 4GC6A 3O9QA 4ES1A 5LMUJ 3IAS9 4GVBA 1GAOA 4C97A 2CIMA 1QUVA 4DL2A 2VKZG 3ATVA 2HRUA 3PLAA 4ED6A 5C25A 1KQSR 4NCAA 2KTQA 1QHAA 1D8YA 1FFWB 4DHYA 2GO8A 2OI2A 2HS4A 4WYBA 2FGOA 2QWPA 1WBBA 1S6PA 3CCTA 4ZVQB 2HLTA 3NCIA 4GY2B 4QAGA 4IOXA 1JLAA 1IKXB 1UP1A 2CJXB 2V8VA 3TSPA 3H2LA 4LF9F 2CQDA 1YT3A 2KFZA 2QE5A 3LDQA 1S0MA 2G8KA 3R7BB 2Q1LA 4IWVA 3ILIA 3A5OC 2VIHA 1MWMA 3O4WA 3FDSA 3PYGA 4OPKA 2B43A 3WIVA 3I5AA 3MD1A 3W2WB 2O8FA 3HTVA 3T41A 1S6PB 3AD8C 1YG0A 4XAKA 2QWLA 5E0OA 4LBHA 4DSFA 3VQ9A 2P5OA 4KHWA 3FZMA 1NNEA 3HZGA 5BPMA 3LAMA 1IM6A 3EZ5A 1VQ7S 1YDLA 3EKUA 3FBFA 3OHRA 2WHOA 3G6XA 2UXCF 3CD6S 2AX0A 1NB7A 2DY1A 3OYAA 4AL5A 2QEXN 1U1LA 2PFUA 1T9YA 4LSLB 3S6EA 3DOKB 1VGYA 4ED8A 3CC7S 5BRDA 2YWGA 4K5RA 4B1XB 1TKXA 3Q24A 1JB0C 3DM2B 2DISA 5C24A 4I67A 3ZX3A 2DYAA 2OPPB 1NGAA 3D6FB 4FF2A 4PQUA 2VWJA 1W2IA 4BRDA 3AAPA 4OZJA 5AQVA 3SLCA 5DM7Q 1AB8A 2DHSA 1NDLA 4LC9B 3IXQA 5BPNA 2R2TA 2CDQA 2FQQB 4AHCA 3DKDA 2V4RA 1M1HA 3TZYA 2G8HA 4I68A 3WQTA 3ZSVA 3NDKA 2VQEF 5L1IA 2C3PA 3C19A 4GO5X 4PQUB 2ZOMA 4FJGA 2XBPA 1BHNA 4CBUA 5AQJA 2V9WA 1JQGA 1KR4A 4FOEA 3TTDA 5M1OA 5BJRA 5H9EK 2QMUB 1RT4B 2QYGA 1RK8A 1GX6A 2PMZD 4NWBA 3CJ9A 2F40A 2Q1NA 1NJWA 4FW1A 4E7IA 1L3TA 2V5HG 5CAAA 3D6RA 3QLHB 5K14B 4FJ5A 4EWTA 3G8TA 2K7KA 3OD2A 4CLKA 1YJNN 4KGMA 1GT8A 1I3AA 2GQ2A 3R8YA 1TU0B 1R0CB 4NZ6A 2HHHF 4DL0C 1SC1B 3ZTRA 1R8CA 2HBMA 2W7AA 5HVHA 3H5YA 1AT1B 1F9HA 5AZIA 3SCXA 4CK1A 2RHQB 1FTRA 4A5AA 4GVLA 1ZBHA 5LJ3Y 1HHTP 2XO6A 3ZSRA 2HQIA 1KQKA 1URNA 5EXWA 3V9WA 5RUBA 4FWPA 4JI1K 1B0VA 3M30A 2YXLA 4WZQA 4F36A 4QU7A 4WKRA 3LZJA 3BZKA 5E5NA 3KYLA 3CYMA 1QSLA 2P6SA 1SUQB 1VK3A 4BVPA 4K42A 3SCJE 3N5FA 1EKRA 2C3UA 4ZVRB 1IO2A 2IOCA 1BISA 3TUZC 2ZFHA 4H8KA 2CJKA 2V8GA 3ICLA