1FKPA

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
542
structure length
541
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 147
structure length 541
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fkpA05
3DYAB 3VA0A 5F8IA 1C6VA 2XO7A 1LWCA 1GOCA 4YMEA 2G8FA 4K4WA 2JEIA 4DL7A 1LWCB 4NCBA 3OJUA 2GC8A 3OL6A 1BGXT 3TWHA 5KFCA 2B43A 3GILA 1S9GA 2W8KA 5KFZA 1KVBA 4ECWA 4PWDA 1DLOA 3VQCA 2QE5A 1S9GB 4J9PA 1VSIA 4I7FA 3NAHA 4PWDB 3O3FA 2ALZA 1DLOB 4ELTA 3RMDA 4DTJA 1KFDA 4I7FB 3PJWA 1RTIA 4EO8A 4FS1A 3SI6A 4FK0A 3QZ8A 4DFKA 1NJYA 1RTIB 3E51A 3NKYA 1TV6A 4DTSA 1T94A 3DLEA 2XCAA 1JXEA 2BRLA 1TV6B 1SUQA 4NLSA 4R5PA 3DLEB 5KT3A 4MKBA 1SUQB 4YQWA 3EZUA 4LY7A 4C8OA 1IKXA 4FVMA 3MFHA 4DU4A 2R2UA 2WHOA 3V1RA 3D5MA 4ZMMA 4OJRA 1IKXB 1RBUA 2BQ3A 3I8DA 4QWEA 3OLBA 1S4FA 1ASWA 3VQSA 4EP4A 3RAXA 3C94A 3L2WA 3QGIA 3BQ0A 4KTZA 4NYNA 5HROA 5F8MA 2B5JA 4HUGA 5J2NA 3MF5A 3WNFA 5HROB 4LQ9A 4CHQA 2B5JB 5J2NB 5C24B 3M8PA 2I1RA 3OYLA 3M8PB 2HWIA 3WNHA 3RMCA 3LZJA 1EP4A 4M3RA 1QAJA 1T03A 1KTQA 4IH5A 1EP4B 3LANA 2FJVA 1T03B 1JLFA 3RR8A 3ZT0A 5KFHA 4NLWA 4TQRA 3SUNA 1JLFB 2YNHA 3LZIA 2NUBA 4FJLA 1WSGA 2G8HA 4G3IA 3DMJA 2YNHB 4C8LA 2XRIA 5DQHA 3ISND 3OYMA 4YR3A 3NAIA 4AHUA 4FS2A 4CJUA 4DL4A 2EX3A 4CHPA 1RT4B 5KT7A 4AHVA 3GV7B 3B6OA 1IKYA 4YFUA 5JS2A 4DTUA 2X6NA 1IKYB 3OS0A 1S1TA 1S10A 4CHOA 5KFRA 1JXLA 1S1VA 2UUTA 4KRFA 4CEZA 4ECUA 3PW2A 2X6SA 1S1TB 1S1VB 1WNEA 3KHHA 2BE2A 4OLAA 2HVHA 2HNZA 4CJVA 3QEIA 3AA5X 1QTMA 2BE2B 4MK9A 4DLEA 4QOZB 3IGNA 5KG5A 3G6VA 4ED3A 3KKRA 3ZT4A 2HNYA 4RW4B 5KFFA 4TY9A 2VG6A 3OLAA 2HNYB 5J2QA 3H5UA 4Y2AA 2VG6B 2PYJA 4PQUA 2C2RA 1IKWA 1SH2A 4NLVA 2YKMA 3H2LA 5L1IA 2HW3A 4NCGA 1KFSA 4PQUB 4CF2A 4QWCA 2Z1GA 4CJKA 1IKWB 2YKMB 3QIDA 4NLUA 4NCGB 4M95A 1ASVA 4O55A 2OPQA 3QNNA 3LDSA 4ZVFA 4KPYA 5CZ2A 2OPQB 4F4ZA 2ATQA 1YTAA 3MR6A 3KLFA 1GOBA 3OHBA 4I2PA 3KLFB 4CESA 4BDZA 2IC3A 1YTUA 5KFXA 1QSLA 4I2PB 1S0MA 4CFDA 2IC3B 3I0RB 3NCIA 2XY6A 2YNGA 5KGXA 3V1OA 3OVNA 4KHUA 1BQNA 3SQ0A 5DK5A 1NK8A 4FK4A 2XI2A 1BQNB 1RDBA 4TQSA 1VSJA 1BI4A 1W0HA 4NLYA 4CE9A 5KT2A 4FLTA 4B9LA 3NGZA 4FW1A 1KLMA 4CF0A 3M8QA 5EU7A 1JKHA 3QNOA 1KLMB 3M8QB 5KFLA 4FJKA 1JKHB 1TKZA 2FVPA 3QGGA 3IG1A 1TKZB 4Q44A 3BREA 1IKVA 3AVKA 1RT6A 3IG1B 4AHTA 3DRSB 5DGAA 1RTJB 3CJ3A 4ECRA 4CJRA 1RT6B 1SKRA 2WTFA 4I2QA 3HPHA 2GIQA 3NDKA 5KTQA 4CEFA 4QWDA 4I2QB 1MMLA 4CGJA 1O1WA 3OSPA 4FLVA 1BL3A 2QXFA 3HXMA 1NOZA 1RILA 4CGHA 2WRMA 4FM0A 4Q8FA 2UVWA 3RWUA 4BE0A 3ASMA 1HPZA 1EKEA 4ELVA 3QERA 1QHTA 4U7CA 4LH5A 2KZMA 1ZBFA 5D3GA 4IH7A 1X1PA 3PX6A 3BR9A 4J2DA 5D3GB 5KGWA 2OZSA 1TP7A 4CFCA 4ID5B 4ED8A 4H4MA 5HRSA 1KLNA 1TAUA 2G8VA 4NLDA 2IM0A 4FZZA 2C28A 4H4MB 1L3VA 2R2RA 3PX0A 3NMAA 1N48A 1U49A 5DQGA 3ZSQA 2XY7A 1S0OA 4B08A 5CZ1A 3QEXA 4DL3A 4ZPCA 1C1BA 3AO1A 3OYJA 3HYFA 3DI6A 1C1BB 3LAKA 4AHSA 1FKPB 3RBDA 4LD0A 4RNHA 3DI6B 3P1GA 3FFIA 2G8KA 3FFIB 2DPIA 1RNHA 1X9MA 2PZSA 3PO5A 4PY5A 1VRUA 4WFXA 1VRUB 2WK4A 3TAPA 4OVLA 1I6JA 4KKOA 3CJ2A 1S6QA 4M3WA 5KT5A 4IDKA 4KKOB 2GUIA 1S6QB 3RB4A 4CCHA 4Z0UA 2XHBA 4CGDA 4J2BA 3WNGA 3AV9A 2F96A 1VSMA 3MEDA 1TQLA 3AVBA 4FJ5A 3KLIA 3MEDB 4B9NA 1TAQA 3SUOA 4TSXA 1OS5A 4NLXA 4JV2A 3SNNA 2XC9A 4NLGA 2YNIA 3CFRA 3AVAA 1A5WA 1TL3A 1IH7A 2YNIB 1NJZA 1TL3B 1VSKA 1ZTTA 4FM2A 4O3SA 3VQBA 3PR4A 2DFFA 2UUWA 2E9RX 2QK9A 3V6KA 4DQPA 3H59A 2BR0A 2IOCA 4R0EA 5F9NA 3L2VA 2BQUA 2R8GA 4CIEA 3U3YA 4FBTA 3EY1A 2O5DA 4LSNA 3SQ2A 4MH8A 1VSHA 3PW7A 1WN7A 1HRHA 4KHSA 4M42A 2YV0X 4LSNB 5KFKA 1TK5A 3UQSA 4MIBA 3NFAA 3V9ZA 4KHQA 1CSJA 2ZD1A 2QKKA 4CJ4A 2ITGA 1YVFA 3VQ6A 4URSA 2BANA 3A2FA 2RF2A 2ZD1B 2JLEA 1RT2A 3LP2B 2BANB 4CJLA 2RF2B 4B9VA 4RW6A 1RT2B 2FBVA 4HYKA 4RW6B 3KK3A 4WE1A 4IOBA 4YR2A 4IRCA 2OPRA 3AA4A 3KK3B 1HYSA 4WE1B 4ECYA 4TY8A 4KHYA 2OPRB 4DFMA 4ZP9A 1KSPA 3G10A 4DEZA 4BWMA 4ICLB 4B3OB 3OYIA 3V9WA 4KHWA 2AQ4A 3AVCA 3Q8QB 4J9MA 4MK8A 2AJQA 4CJ3A 2X74A 3D0PA 1I39A 5F8HA 3SV4A 4M3UA 4J2AA 3KLEA 1UA0A 4YR0A 3KLEB 3PO4A 2OPPA 4TYBA 4MK7A 4KTWA 4QAGA 5J1EA 1CLQA 3O3HA 2OPPB 5I3UA 4EYHB 5J1EB 4DSJA 1TKDA 4WZQA 5I3UB 4OPKA 4N76A 4CF9A 5K14A 3MXMA 2KFZA 4NLQA 3NF9A 2HMIA 2V4RA 5K14B 3VQ4A 2FBTA 1R0AA 3TAMA 2HMIB 3PUFA 2VG7A 1S0NA 1JLBA 2HAIA 4BDYA 1R0AB 3TAMB 4F4XA 2VG7B 1JLBB 2FVQA 1JLQA 4B9UA 3VQDA 4DTRA 1JLQB 4OKKA 4RUAA 1CXUA 3OY9A 4DSKA 3THVA 4ECVA 1LV5A 4QWBA 2AX0A 4ID1A 1IM4A 4H54A 5EWGA 4DL6A 2V0NA 4XO0A 3T5LA 2D7SA 4CFAA 2YNFA 1A5VA 4KAZA 4CJFA 2D0BA 4CJPA 2YNFB 2QKBA 1K1QA 3AA2A 4G1QA 2JEJA 4FXDA 3KLGA 4DFPA 4O4GA 3K5LA 1C1AA 1U4BA 4G1QB 1TGOA 3VQPA 3KLGB 3OYFA 4O4GB 4KHRA 1QS4A 3PW4A 4FK2A 1RT1A 5C5JA 4O4RA 1RT1B 3NAEA 5KRSA 4ECQA 3RTVA 3EPGA 3AO5A 2R7YA 4TYAA 3KHRA 4W5OA 4DMNA 3E01A 2HB5A 3I5CA 4F3OA 3MECA 4URGA 3E01B 3CM6A 4CGFA 4B9TA 3OYNA 2AWZA 3MECB 1QE1A 3M9MB 1ZYQA 3GIMA 3ITHA 3RB0A 4KSEB 3HJFA 2AX1A 1QE1B 2HWHA 3G6XA 1KVAA 1LW2A 3ITHB 4QPXA 4J9QA 2CKWA 1LW2B 4IRKA 2YHAA 1EXQA 2R2SA 4X2BA 1J53A 2XI3A 3AVNA 2DFEA 2I5JA 3QESA 2IM3A 4PA1A 3DM2A 4GMJB 5C24A 2VWJA 2HHQA 2I5JB 4N56A 4ZVEA 3RRGA 4Z4EA 4O3OA 1RYRA 3DM2B 1JL2A 3T1AA 4HHTA 4ED0A 5KG3A 1XHZA 4RW8A 4Q8EA 3O4NA 4Y1CA 4J2EA 4RW8B 3TI0A 3CYMA 2XCPA 4KO0A 1UOCA 4CIFA 1D5AA 3U3GA 3LPUA 1C2PA 4CEBA 2P51A 4KO0B 4FJ8A 1FKOA 4Q43A 2A1RA 1VK0A 3MR2A 2XY8A 3K5OA 1FKOB 4U6PA 4W5TA 4Y2CA 3CQ8A 4OGEA 5EWEA 4PUOA 1BCMA 2E6LA 4E7JA 4PUOB 4DSLA 3ZSWA 1ZBUA 3JYTA 1QAIA 1RT4A 3JYTB 5KFEA 4JUZA 4KI4A 1SL2A 4NYFA 4OKEA 4XIUA 3IS9A 2O4GA 5KFGA 2OYQA 4IFVA 3SQ4A 3IS9B 2XGQA 1WSHA 4DTXA 1ZBLA 4EO6A 4IFVB 4ZP6A 4H8KA 1NNDA 4M3XA 5F8LA 4O5BA 3SUPA 4DSIA 3GQCA 3HPOA 1TKTA 1SH3A 3MXIA 2D0AA 1S1XB 4F50A 3NE6A 3I0SA 1TKTB 1HJRA 2BGGA 1RT3B 2G8WA 1W9HA 3I0SB 3F9KA 3CIZA 2UVUA 1ASUA 2WB4A 4RW4A 2J6TA 4JV0A 4RNMA 4YP3A 3KD5E 3KHLA 4CJWA 4DG1A 5C42A 3SV3A 2Y1JA 4MIAA 3S9HA 4IG0A 5KFBA 5DLGA 2IAJA 3S3OA 4DG1B 5C42B 1N4LA 3DLBA 4IG0B 2IAJB 3CFOA 3MTKA 5T14A 2FJXA 2RDIA 3VQ5A 4IQXA 3QINA 1D9DA 4ZVHA 3I5AA 3NHGA 3QZ7A 4N41A 3V81A 4O44A 2Q3SA 4NLTA 3OYHA 2XWYA 3VN5A 3V81B 2KW4A 4O44B 1TK0A 3G86A 4DF8A 2Z1HA 4CFBA 1VRTA 4EBDA 4IR1A 4KV8B 3I0RA 1J5OA 4ECTA 3QEVA 3LWMA 4F4KA 1VRTB 1RAJA 1S9EA 1J5OB 1NJWA 1C1CB 4EP5A 4W5NA 4K8XA 1XR5A 1S9EB 1JLAA 2R2TA 4HUEA 3FSIA 4R8UB 4MKAA 1U47A 4NLRA 1JLAB 3CDWA 4RW7A 4GC7A 4E7IA 4K4XA 3N6LA 3ALYA 4HTUA 4RW7B 2E9ZA 3V6HA 4RZRA 1LAWA 3AVHA 3TAFA 2HHXA 5KFNA 4Y1DA 3SFUA 2J6SA 4I9LA 4WYWA 3BQ2A 4ED7A 4J9KA 3QLHA 3DRSA 1IO2A 3K5NA 1RTJA 4E1NA 3QLHB 1S49A 4EYIB 1D1UA 5KFOA 2V4QA 1HNIA 2RN2A 4K4YA 1HNIB 4W5QA 3VQQA 5KFJA 3H98A 1WNSA 4K4TA 3H5YA 5F8JA 4E89A 3QETA 4BWJA 2Z1IA 3L3UA 2ILYA 4CF8A 4OL8A 4FW2A 4Z4GA 1ZBIA 3DOKB 1CZ9A 3JSMA 2FVRA 4O3PA 3KNAA 4ID5A 5J2MA 2P1JA 3JSMB 2VA3A 3ICLA 5DGBA 3O3GA 4EEYA 5J2MB 4ECZA 3V9XA 3V4IA 3TARA 4J9RA 3AVJA 3OYGA 2JGUA 1IG9A 3V4IB 3BSNA 1S5JA 5FROA 4OLBA 2ZKUA 2E4LA 3EZ5A 3PV8A 3DLHA 1BIUA 4GC6A 3ZSRA 3HHKA 4DSEA 3G6YA 3C95A 2IM1A 5KG0A 3OYBA 2O4IA 4ZPDA 3S3NA 2B6AA 5DG9A 4DFJA 4QCLA 2IS3A 4JS4A 1Q9YA 1FKPA 2B6AB 5HBMA 4Y3CA 2D5RA 4HCBA 3NGDA 2XY5A 5HBMB 4B9MA 2D41A 4DTPA 1U09A 3RMBA 3T19A 4M3TA 4ZVGA 4ZTFA 2HHSA 3H5XA 4LH4A 4IG3A 1SL1A 4ED6A 4IG3B 4K8ZA 1JX4A 3RMAA 5HRRA 3VQEA 3CJ0A 4CJTA 4MFBB 4CJEA 4RNOA 3TABA 3ZT1A 4ZPBA 3BDPA 5F9LA 3DLKA 5KI6A 4ECSA 5CYMA 4CEQA 5KG4A 3DLKB 4RU9A 5CYMB 1NOYA 4F4YA 1G15A 2D3ZA 2RKIA 2KQ2A 3NGIA 1SH0A 1NJXA 2RKIB 3TR8A 3FQKA 4AHCA 3CO9A 3NH0A 2R8HA 1Z25A 2LSNA 1NK0A 3TAGA 5KFQA 3GIJA 1NK7A 4F3TA 1WAFA 4EZ6A 3CVKA 3AVMA 4AH9A 1I3AA 2JEFA 5F8NA 4ELUA 3LP0A 2D3UA 2ASLA 3EPIA 4TN2A 3OL7A 3LP0B 4O3RA 4KBIA 2FBXA 2EHGA 3FQLA 5KRTA 5JS1A 3LP2A 5CYQA 1ZBHA 3OYEA 3QIPA 5CYQB 4WYLA 4FJ7A 1RDDA 3QIPB 1NKCA 5DQIA 5KG1A 2JEGA 1JL1A 4KFBA 4KAIA 2W9AA 4KFBB 4ICLA 4B3OA 5KFMA 4FM1A 1RYSA 4Q0BA 4Z4CA 3L3VA 3C6UA 4DQRA 4LSLA 4Q0BB 4CEDA 4KI6A 5L1KA 3C6UB 2BQRA 4K4VA 4LSLB 4DLGA 4ED1A 2FLNA 3VA3A 3KLVA 4K4ZA 1LW0A 4CK2A 2KTQA 3GIIA 3KTQA 2J6UA 1LW0B 3ZSOA 4RW9A 1K6YA 4FJIA 1GOAA 4ECXA 1YVUA 2IMWP 1TL1B 3ISNC 4E0DA 4RW9B 4FZYA 3PR5B 1KCFA 2YHBA 1RT7A 2OA8A 5KFDA 3WNEA 1WSEA 1NK5A 3K59A 3DRPA 1RT7B 1X9SA 2F8TA 3GIKA 4B8CA 1LWEA 4AILC 3DRPB 5KFWA 3VQ7A 3LP1A 5KFAA 3ZSVA 4DS5A 1LWEB 4FJHA 4BE2A 3LP1B 3PW5A 4CEAA 2OZMA 3RAQA 3CWJA 4FJ9A 4XPCA 3M8SA 4FJMA 5DLFA 3V9UA 2PYLA 5KFYA 2W7PA 4FLUA 2ASDA 4N47A 3RB6A 3H4DA 3RRHA 1J9AA 4L8RB 2WONA 2W9BB 4FJXA 2WONB 2XGPA 2V9WA 2E6MA 4N5SA 3BGRA 2KFNA 3NF8A 4M45A 3BGRB 1BQMA 3NH1A 3QO9B 1REVA 5KFUA 3RB3A 3IRXA 1BQMB 1TKXA 1XR6A 1REVB 2F8SA 1UWBA 3IRXB 1TKXB 2FVSA 4B8AB 3V9SA 1UWBB 4M3YA 3PW0A 4IBNA 3OS1A 4FCYA 3OS2A 3F73A 3CJ5A 2GIRA 4DL5A 2RDJA 3RR7A 3LWLA 2ATLA 5KFVA 3AVGA 4MQ3A 3T5HA 1U04A 4CHNA 3HT3A 4M3ZA 1QSYA 2UVVA 1KHVA 3UDLA 1WSFA 3P5JA 1C0UA 3HK2A 4F8RA 2R8IA 2VWKA 4DF4A 5EWFA 2C2DA 3LP3A 1MU2A 1C0UB 3SQ1A 1RCHA 1VSLA 5HRNA 4E7KA 1MU2B 3BSOA 1X9WA 4KTQA 5FRNA 4R5PB 4C8KA 1J54A 4KB1A 3OL9A 4RNNA 4NCAA 3ZCMA 1YT3A 3P83D 4IH6A 2FBYA 3CJ4A 3H40A 3UPFA 1HQUA 3BQ1A 4HUFA 4K50A 1HQUB 3HP9A 2BRKA 2VA2A 3OYAA 1L5UA 1XC9A 3DOLA 4HCCA 3V6DA 1HNVA 1L3SA 1RT5A 1D0EA 3DOLB 3K2PA 3V6DB 1HNVB 3SI8A 1RT5B 5EDWA 2W7OA 2C2EA 4WXOA 3LAMA 3IN5A 1BHLA 1RDAA 4O3NA 3QEWA 3KKSA 4J9SA 3CFPA 3EYZA 5E41A 3CM5A 4QWAA 3IGVA 1LAVA 1WAJA 5DG7A 1FK9A 4J9LA 2E9TA 1FK9B 2B4JA 2P5GA 3AVFA 1S6PA 3DMJB 4TLRA 1SKSA 2HNDA 3NF7A 4GW6A 4BE1A 1S6PB 2DTUA 4CGGA 2HNDB 1XR7A 2IA6A 4JS5A 3Q8RB 1S1XA 1KHWA 3KMQA 1RT3A 5HP1A 4NZ0A 4FZXC 4DL2A 2RPIA 3PJXA 3VQ9A 1XWLA 5HP1B 5KT6A 3MFIA 1B92A 4DS4A 3OHAA 3L2RA 2W9CA 3H08A 4Z4HA 2W9CB 3PHEA 5T7BA 1RTDA 3NL0A 4CEEA 1VSEA 2C22A 5J2PA 1RTDB 4I9QA 2W8LA 5JUMA 3AO2A 3HVRA 5JXSA 5J2PB 4O3QA 2HNZB 3SUQA 1RDRA 1TK8A 2D0CA 3SYZA 4FJNA 3KMSA 1RBVA 5DMRA 4WZMA 3HVTA 3I5BA 4WFYA 4QW8A 3HVTB 4KB7A 1NHVA 4DTOA 3OYDA 3LALA 2HHWA 3AVLA 1F21A 3SPZA 5J2QB 1BCOA 4Z4IA 4KV8A 3RBEA 4M94A 4F2SA 1L3UA 2P5OA 3SCXA 1VSFA 1C1CA 1JXBA 5KFSA 4NRTA 1EETA 1D8YA 3Q8SB 1HARA 4C8NA 4R8UA 1EETB 2QV6A 3T5KA 1SV5A 3DDKA 1XI1A 1Z4UA 3K5MA 1T05A 1QSSA 5CY4A 1SV5B 3GV8B 4XPEA 1T05B 3BJYA 4AHRA 3BSCA 3AO3A 1T8EA 4HVJA 3QIOA 3T5JA 3M9OB 2DY4A 1JIHA 4CF1A 4EBEA 2YNGB 4WFZA 2FLLA 1WLJA 3OYCA 3SZ2A 1HYVA 3NBPA 5HLFA 2IGIA 4CK1A 4Z4FA 4DQQA 3MR3A 1BI4B 4CHYA 1RDCA 3NBPB 5HLFB 4EBCA 1CZBA 1N5YA 4CK3A 3GYNA 1N5YB 3V6JA 1LWFA 4FJGA 3U6FA 5SWMA 4M41A 4IRDA 4FLWA 1LWFB 1T3NA 1QQCA 4BDPA 3DLGA 1B9DA 2X78A 4CECA 3DLGB 5KT4A 1IKVB 3DOKA 3K58A 3AO4A 1NKEA 2F8EX 3NGYA 3ZSYA 3KHGA 3HO1A 2ETJA 2KZZA 5EUHA 2HHVA 4CJ5A 3PX4A 3DLRA 4DU3A 4IKFA 4Y34A 3KOAA 1JLEA 3KJVA 4JLHA 1CXQA 4KHNA 1JLEB 2G8IA 3KJVB 2OPSA 1HPZB 3OSNA 4CJQA 4CHZA 3KIOA 2DFHA 2FJWA 4EZ9A 5F8GA 4KHMA 1DTQA 2OPSB 4W5RA 1DTQB 2W42A 1BISA 4KE5A 2ZQBA 4ZP7A 3ZT2A 3O4QA 1QUVA 1NK4A 4KREA 4H4OA 1D9FA 4CGIA 4E19A 4FBUA 3L2UA 4RG8A 3NF6A 4H4OB 4OPJA 3HPGA 4O0JA 3M8RA 1ZTWA 2JC1A 3SFGA 3UR0A 4GVMA 4B9SA 1S1UA 4Q45A 3PVXA 1UA1A 3UIQA 1S1UB 4JRQA 4MFBA 3MR5A 4CJSA 4UQGA 1SKWA 1S97A 2IBKA 3KD1E 1RBSA 1HMVA 4QW9A 3VQ8A 4E3SA 5KG2A 1HMVB 1B9FA 3KK2A 1HQEA 2AGOA 2Y1IA 1GX6A 1S9FA 3HVWA 4BACA 1NHUA 3KK2B 1HQEB 3N6MA 4F2RA 1Y97A 2OH2A 5C25A 3OL8A 4ZPAA 5FRMA 1HYZA 1C0MA 5C25B 4URQU 4DSFA 4IDKB 2UVRA 3D45A 1RTHA 2R8KA 3SJJA 1RTHB 4FLZA 3H5SA 5KFIA 1Z26A 1RA6A 2IJNA 4NLOA 4J9OA 3HKWA 4F4WA 3KLIB 3C6TA 3KLHA 2FLPA 1RA7A 4ZHRA 5KG6A 5SZTA 3C6TB 3KLHB 4RUCA 3MEEA 3TVKA 3MXJA 1XHXA 4ZHRB 3DRRA 3H4BA 1SL0A 1NK6A 3MEEB 4WXWA 3DRRB 1NKBA 3HM9A 3G0ZA 4FLYA 3CDEA 4JRPA 2IJFA 1RBRA 2DPJA 4ZP8A 2AGQA 4NLPA 2R8JA 3CG7A 4LQ3A 1ZETA 4FJJA 1NK9A 4E7LA 4K4UA 4YNQA 4ZTJA 2AU0A 1K1SA 3TQ1A 3D28A 4DTMA 1Q8IA 5L1LA 4CERA 3BSAA 5KG7A 2ASJA 3HSTB 2GV9A 1JLGA 4NRUA 3V1QA 1Q9XA 1JLGB 2PY5A 3T3FA 4DWIA 3SPYA 1L3TA 3L2QA 1JLCA 5DG8A 2JC0A 3AA3A 4NYZA 1JLCB 3HVAA 4E1MA 3QYYA 2VG5A 3ULDA 4RNFA 2VG5B 1U45A 3PY8A 1TVRA 1FXXA 2AGPA 4KB0A 1GX5A 2YKNA 3M9NB 3FRZA 3VQAA 3OJSA 4O0IA 3FDSA 1KRPA 1TVRB 1HYSB 1U48A 4TY8B 3IAYA 2HHTA 2YKNB 4DU1A 2HVIA 2BDPA 5I42A 1RBTA 3TANA 1DTTA 3PZPA 3ZT3A 1TL1A 3OYKA 3CDUA 5I42B 1DTTB 1T7PA 4C8MA 1VSDA 2CJQA 2A1SA 2HHUA 3MEGA 3S3MA 1A5XA 4OKJA 1WSJA 3LPTA 4OGCA 3MEGB 2EC0A 1BIZA 4IFYA 4E7HA 1KVCA 4TXSA 3QGHA 4DQSA 4IFYB 3HP6A 2WCXA 4K4SA 1S1WA 1ITGA 3KK1A 5L1JA 5L9XA 1N56A 1S1WB 4FYDA 2IDOA 3MAQA 3KK1B 4IKAA 2ZE2A 4Q5VA 1N6QA 4IR9A 4FLXA 3Q8PB 2ZE2B 4JV1A 1N6QB 3TAEA 4CIGA 3AVIA 2W9BA 2ILZA 3TAQA 3K57A 4CEOA 4HKQA 4ED2A 2G8UA 3QEPA 5KFPA 5FDLA 1UAXA 1W25A 3B6PA 3ZSXA 1S48A 1WSIA 5FDLB 1EX4A 3ZSZA 4J9NA 5KFTA 2WOMA 5HRPA 2IM2A 4DQIA 4DTNA 3QO9A 2GBZA 3HL8A 1C0TA 2FVCA 2WOMB 2Z1JA 3L8BA 3DYAA 3N6NA 3NH2A 3GV5B 2FC0A 1C0TB
chains in the Genus database with same CATH superfamily
2XZDB 3VA0A 3J7AP 5F8IA 4UUXA 4OYOA 1LWCA 5DZ6A 2MPUA 3VTHA 4GO5X 4K4WA 2QYCA 1R0CB 4NCBA 2XSJB 4CO4A 1ZPVA 3GG1A 4U7UD 2FSJA 2ZWPA 1S72N 5EX3A 4DPUA 1KVBA 5KOXA 1Y4ZB 4DR5K 2MJUA 3CMQA 2FHMA 2QE5A 1OJ4A 1VSIA 1K47A 3NAHA 5IT9U 3RMDA 3QBWA 2LXFA 3PJWA 3Q89A 4LF9J 1H38A 5HATA 1RTIB 3E51A 3EGWB 1T94A 3DLEA 3S7RA 2H1YA 4YORA 3Q86A 1TV6B 4JI8K 2RSQA 1SUQA 2OTLS 4NLSA 4XH5A 1IV0A 4USTA 5KT3A 4YQWA 3ILIA 1E4GT 2QIFA 1IKXA 3DRXA 4X4UA 2WHOA 3D6FB 4ZMMA 1VYAA 4EP4A 2C3PA 3RAXA 3ZTPA 2DHXA 3L2WA 3ENVA 2P9NB 3VZHA 2VFVA 5HROB 3T7ZA 4DV7F 1T3VA 3BGLA 3MX2A 1FWKA 4LR7A 3H1VX 3EJMA 5IV4A 3ZO7A 2CRLA 3M8PB 3SAHA 4LF2A 3RMCA 2C2OB 3C15A 3CIPA 1EP4A 3MURP 4M3RA 3MM6B 1JLFA 4AXJA 2M88A 2UXCK 2YNHA 4FJLA 2MY8A 1XIQA 3OBYA 4AYBD 1KQSM 2E1RA 3ET6B 2CDRB 2XRIA 4LF8K 3ZZZA 2X3GA 4HWIA 4LRBA 1WSVA 4C48A 1NGFA 3AB2B 3HSCA 4AHUA 4CZHA 1RT4B 5HI7A 3VF0B 2V2ZA 3HD2A 5AQFA 3RG6A 2K7JA 3JAMU 1IKYB 1S10A 3QWPA 1JXLA 4KRFA 1VQMS 4JHDB 2ZM6F 2BE2A 2CQCA 1N5QA 4KY3A 5SUHA 2HNZA 4CJVA 1Q81O 4I6WA 4R79A 2F9DA 1WOOA 4QOZB 4AT1B 1AUSL 2HNYA 3S1TA 5KFFA 3WC2A 4K7QA 2CPZA 5J2QA 3C14A 2COLA 4PQUA 4C23A 3H2LA 4NCGA 1VQOS 1RWUA 1KFSA 3MWBA 4CF2A 2KVIA 1IKWB 2YKMB 3QIDA 1PGZA 1ASVA 3QNNA 3ZFVA 4ZVFA 3IFEA 1MDUB 2OPQB 2DNGA 4J9UE 3MX5A 2VJVA 2MSTA 2KT2A 1PBAA 1QAYA 4ZPVR 3LQVA 3KLFB 1Q8LA 1ROFA 4CESA 1QSLA 1T9XA 3QATA 4NB4A 5C0YA 3NCIA 4PYAA 3OVNA 4PL8A 4KHUA 1BQNA 1DARA 4P75A 3H3NO 4P7TA 1HQ2A 5D4NA 3QT6A 3M6WA 3U9DA 5DM7Q 1RWWB 2DTJA 4CE9A 4B9LA 2QGFB 1DY3A 3M8QA 5EU7A 3Q83A 1JQGA 5B08A 1KLMB 4FJKA 4JI5K 5BXIA 1JKHB 3JXOA 2FJAB 1TKZA 1QVGM 4O0NA 1QVFR 3QGGA 2CPDA 3IG1A 4WIIA 5F1XA 3BREA 3AVKA 1VK8A 1RT6A 1U1MA 2KRRA 1IBKF 3DRSB 4WP9A 2NUUG 3QAUA 2AMCB 1VQ9S 4CJRA 1SC1B 4I6YA 5ETMA 3NDKA 4HL9A 4ZS6A 5KTQA 2UUBF 2A5XA 4CEFA 4AUKA 1O1WA 1NZ8A 2I6WA 1BL3A 4RCHA 4PXBA 4M5GA 1EKRA 1JB0C 3RWUA 3HHLA 3BEGB 2DNOA 1ELOA 1CJUB 5BR9A 1QHTA 4LIWA 5B0CA 3DXSX 1RSCA 2KZMA 4MTPA 2ADCA 3W9HA 4WU2A 5CE3A 4OZ2A 2F5GA 1A6LA 5D3GB 5KGWA 1TP7A 3PFOA 4ID5B 2CADA 2GVZA 2LA4A 1BC6A 2HRTA 1UEKA 4ILLA 4YHHK 4H4MA 2WVCA 1VS3A 1P8GA 5HRSA 1U1OA 4FZZA 2W25A 3ENQA 2KFYA 1L3VA 2R2RA 3ZNUA 3NMAA 2A6OA 1IJJA 3FZ2A 1NEEA 5DQGA 2XY7A 4BBYA 3QEXA 1U8WA 4WFBL 1DURA 4DL3A 4ZPCA 4DR4J 3QBXA 2E1CA 2CFXA 2I0XA 3Q2SC 3Q8YA 4JKGA 4LD0A 4RNHA 3P1GA 3R3LA 3FFIA 2V63A 2Z56B 5GAHP 4KGKA 2PZSA 3PO5A 4UUWA 2MGZA 1WBBA 2HBRB 2QLXA 1SQGA 2HRUA 2BTFA 4LREA 3TVZA 2ZITA 3D2WA 2P9PA 3GCXP 4BRFA 2YWEA 4MO4A 2J9EA 1UVKA 4Z0UA 1ZBSA 4CGDA 5DDPC 2F96A 2XNQA 3T1HF 2RHKA 3AXKA 4B9NA 1BDGA 4TSXA 1OS5A 4NLXA 1HI8A 2XC9A 4NLGA 4GV9A 2J76E 3AAWB 3CFRA 3AVAA 1IH7A 4OZLA 1FDAA 3A4TA 3O5TB 3O9RA 5H1SV 1Q8BA 2UUCK 3PR4A 1MN7A 3VESA 2XMTA 3X3UA 4FZVA 2QK9A 4NXNJ 2IOCA 4CIEA 3U3YA 2O5DA 4UOGA 4MH8A 5AE2A 1VQKS 4M42A 2YV0X 4LSNB 5KFKA 1TK5A 1SB6A 3V9ZA 4KHQA 2E44A 2P9IB 1RU1A 2ITGA 3VQ6A 2BANA 4HHHA 3G4SS 3LP2B 2RF2B 4RW6A 4PCQA 2DGSA 5BRFA 4DR3K 4NMLA 3BGFA 4QR0A 4ECYA 4UTGA 4TY8A 3MAHA 2OPRB 3E2EA 4LRAA 4CLSA 2KXHA 3TJ8A 4DUZJ 1KSPA 2DH9A 3G10A 2AJ2A 1U1LA 4DV3J 1FNMA 4KHWA 2ZC4A 2UU9F 2X74A 1I39A 4NXMK 3SV4A 1GNKA 2JSXA 3D7SB 4DU8A 1OH7A 2FZGB 2CPIA 4YR0A 1Y3JA 3GDQA 4JBCA 4AQYF 2DBBA 2GVDA 5J1EA 2FGCA 1CLQA 3TO8A 3I56S 5I3UA 1TKDA 4N76A 2J7KA 2CGJA 5FIIA 3VQ4A 5LJVA 5L38A 1R0AA 1HX1A 1SIZA 3POTB 4CLLA 1JLQA 1XNRF 3Q8UA 1T3OA 3NVMA 4RUAA 3IRWP 3AOCA 2FDNA 5IC4B 4I6MA 4H54A 3EGNA 1E6VB 3T5LA 2D7SA 4CFAA 4M5DB 1A5VA 3U4LA 4RR5A 4CJFA 1MWQA 2Y8YA 2GQ2A 2YKPA 1HBMB 1F5CA 1R8BA 2H48B 2YHYA 2ZWOA 4QS8A 2GHWA 1CJTA 4BRGA 1C1AA 4G1QB 1TGOA 3VQPA 1HWIA 4JP8A 1I3OB 5J1PA 3PW4A 4FK2A 4HVZA 3SLCA 4O4RA 1QQMA 4CI6A 4ECQA 2QW9A 1QAXA 3D66A 3EPGA 1HNZJ 3FFKB 4ED4A 2XMAA 4TYAA 4JI0K 2X1AA 4DUTA 3E01A 2YX6A 5GAHU 3MECA 4B9TA 4CGFA 4NEZA 3OYNA 2AWZA 3M9MB 2D69A 3ITHA 3RB0A 5FPNA 2AX1A 4ZITA 3MMJA 1Z6RA 4M7XA 1LW2A 3HULA 4RBVA 2HFVA 2HBMA 4X65K 2DRDA 2CKWA 1WEZA 2P9KB 2R2SA 3EVOA 2JVOA 4WQ4A 5AXNA 2DFEA 2DGWA 5ADXA 1RCXB 2I5JB 2HF4A 4OYIA 3RRGA 4NA2A 1V3SA 1RYRA 1D09B 3D67A 1MN9A 3EVMA 5KG3A 4RW8A 3O4NA 4ZIWA 3I82A 4J2EA 4Y6IA 3TI0A 2A42A 3SSSA 4FWLA 5C10A 4KO0B 2J0QD 4FJ8A 1H1VA 3O2IA 2VC1A 4YDXA 3FSXA 4W5TA 3B8HA 3CQ8A 4OGEA 1MROB 3SDEB 4OI4A 2QWPA 1BCMA 1Y10A 1HHTP 3PLAA 2GNKA 1U1KA 5LMUJ 2J8SA 1IJFB 3JYTA 3T1YJ 5KFEA 1SL2A 2CPFA 5E3RA 3VGVA 1YUWA 2O4GA 1RISA 1X0PA 4TNOA 2OYQA 1IR1A 3IC1A 3SQ4A 5L46A 4FWQA 1WSHA 4JI6F 4LFAF 4IFVB 4LF9K 2ZOMA 4B02A 3C7NA 4M1KA 4GV6A 1MW7A 3GQCA 2AHOB 5CD4A 3K9JA 3MXIA 2D0AA 4F50A 5AQNA 1Q5YA 3NGRA 4RU2A 1V6HA 2BGGA 1RT3B 1CQMA 2WUSA 1FW6A 3I0SB 1LXNA 2XG8A 5GMDA 1R0BG 4CIOA 2WB4A 3GR0A 4KGZB 2O66A 2J6TA 3OTEA 1RGIA 5ETRA 4RNMA 1NGCA 2CPEA 4DG1A 3SV3A 3QAEA 2VOPA 5DLGA 3R7SB 1LOUA 1N4LA 1M1GA 3EKUA 4IG0B 2IAJB 5BYRA 3MTKA 5T14A 5BREA 4E98A 1D9DA 1H73A 2H51B 3I5AA 3VF4A 3QZ7A 3IA0A 3DNCA 4ZVTB 3LM2A 1RDUA 2XWYA 1C4CA 5BR8F 4LBPA 3MCNA 2VWBA 2Z1HA 3I9ZA 4IR1A 4KV8B 4GV3A 1LXJA 1GLAG 5M1FA 2XYPB 4YB7A 1S9EA 1J5OB 3OW2R 1NJWA 3M8WA 3CJTA 1G3OA 2GGPA 4H0XB 2V8PA 4HUEA 4ZLLA 2VFTA 3BYRA 1JJCB 3CCUN 4NLRA 1JLAB 2WTUA 3CDWA 3E9OA 3ALYA 4HTUA 2VUGA 1FRLA 1OY9A 1YDLA 3AVHA 2OAUA 3CCSN 2MQOA 4Y1DA 5LJ3Y 2JWKA 4PEOA 2J6SA 3HI0A 4ES1A 3BQ2A 2V8DA 4CRJA 1O51A 2LEBA 2CQGA 2KHDA 1MMDA 4C11A 1HNWK 1QDUB 3LH2S 1KWMA 3SMPA 3THTA 3I96A 4EYIB 1SAZA 1KBRA 4PQAA 1YRTA 2NXUA 4HDGA 5KFJA 3H5YA 5F8JA 4E89A 2UV8A 3F44A 3K8VA 4KH1B 2ILYA 4TU9A 8AT1B 3OV7A 4C1NK 5DM6L 1R31A 4H5WA 2OI2A 3KNAA 3JSMB 4DV7J 2VA3A 1BOTO 1NGAA 5J2MB 3CC4S 3J81Y 3EVWA 4ECZA 3V9XA 1U25A 2YX7A 4W98A 1NLKL 4DR7F 4PXCA 1IG9A 3TNVA 1S5JA 2L48A 2VASA 3RBXA 4OLBA 3TW0A 1GK8A 2DR6A 2IM1A 5KG0A 3ENOA 3OYBA 3T9ZA 3HMJG 3S3NA 3O80A 3NNAA 1C0FA 2MMYA 5A76A 4DZ6A 2NZCA 1FKPA 2B6AB 4A46A 1NU4A 2D5RA 2FZCB 4B9MA 2FJBB 3BN7A 1G6BA 2GJFA 3T19A 4M3TA 4ZTFA 5LM7E 4DXLA 3UE5A 1UPMB 2R4FA 1SKUB 5BN8A 3HSZA 2CQBA 3SCJE 3RMAA 2ADBA 1N54B 3HHDA 4CJEA 3CO0P 3TABA 1URRA 3BF3A 1KC8T 3BDPA 2GELA 2HVDA 4OQJA 3DLKA 3CCWA 4ECSA 1U1RA 4FN5A 3OTBA 3R7NB 1NOYA 2ZM6J 4HHJA 4B3SF 2PAVA 3HCXA 1PSDA 1NJXA 2RKIB 4H5NA 4AHCA 3CO9A 4DX7A 2R8HA 3GBTA 1Y5LB 1ILYA 2LSNA 2IVPA 3M1VB 4FO0A 4KRWA 3KJQB 5TKYA 3TAGA 3GIJA 4F3TA 4FWMA 4ZN3A 2QWLA 1HBOB 3AVMA 3W62A 2LU2A 1F5BA 3O08A 5F8NA 3EGVA 1NGDA 3ID8A 4IEEA 4I0WA 3IAS9 2BKOA 1RHMB 3BYPA 2RT3A 1SQKA 3LP0B 4CH1A 4U8YA 5E5NA 4K5SA 1Y64A 5JS1A 3G25A 2ZC3A 1NB7A 1N34F 5CYQA 3OYEA 5ADZA 1WG5A 4WYLA 2YQ3A 4HH0A 1WTBA 3KWMA 4DR4K 4JKBA 1E4FT 1SJ4P 3LDOA 2RRBA 2NLWA 5B0BA 3SIPB 1F2HA 2MQPA 4ICLA 2O8DA 4B3OA 2GCFA 3L3VA 3K0JA 3ILOA 3IP0A 3M32B 4K4VA 2E5LF 4LSLB 4BGBA 1TMJA 1LK5A 4YN3B 2E2PA 3VA3A 1XUPO 2Q36A 3UN5A 2J7WA 1IBKJ 1LW0B 1KD1O 3W66A 3ZSOA 4FJIA 4FWKA 2POKA 4YDDB 1BG3A 1E6YB 2ASOA 3MCOA 2YHBA 1S72S 1QLNA 1RT7A 1ATSA 2OA8A 5KFDA 1NK5A 3J7ZO 4F67A 3GIKA 4B8CA 1LWEA 1NO8A 5KFWA 2YWHA 3VQ7A 3ZSVA 2PEHA 1NXIA 4BE2A 2KT3A 3CWJA 4Z7CA 1GFWB 2IHR1 1UJ5A 4N47A 5CA5A 3RRHA 1GMWA 1VR6A 2HIYA 4L73A 1OIAA 1VQ8S 4TU8A 2XGPA 2VB6A 2GUPA 4P73A 3DOMA 4M45A 1T9UA 2JLGA 3VALA 3CJBA 2OD4A 3MMVA 3NRBA 3DXMB 2G13A 1UWBA 2HQCA 1S5ZA 2IVMA 1K9MO 1EAYC 3FCVA 3OS1A 4F04B 3NS6A 6FD1A 2IRXA 2LEPA 2HQ3A 3U7JA 3O9SA 4HEA9 1R6YA 4DV4F 1XMQJ 3W2WB 1RAHB 1VJWA 4BROA 5LXYA 3HT3A 1Q7LB 2YH0A 3OHRA 1YI2S 1YJTA 1FHTA 1EO1A 1V9OA 1C0UA 3HK2A 4F8RA 5MAOA 3DXKB 2R8IA 2VWKA 1MU2A 3H45C 5FLXY 3E3XA 3A13A 3BSOA 4KTQA 5FRNA 4R5PB 1DQAA 2C3OA 3G71S 2Y0BB 2D9OA 1X4CA 1YT3A 4IH6A 1Q95G 2FBYA 3CJ4A 3UPFA 2ASMA 3NMRA 2EBEA 1VQLN 4HCCA 3V6DA 2KDOA 2VC0A 1KVIA 3DOLB 5AXKA 3BO4A 2P9SA 1RT5B 4K5RA 1HBNA 3AARA 5EDWA 2OFHX 2C2EA 2A41A 4WXOA 3LAMA 2B3TB 4LT6A 4O3NA 3BGOP 3KKSA 2VQEF 3VWSA 3CFPA 3CM5A 4QWAA 2IIRA 3IBFB 3SQGA 1ZXOA 4C98A 4PL7A 1OPIA 6AT1B 1KVJA 3G9CA 4BRHA 2B4JA 3DMJB 3CD0A 3CMEN 1HBUA 4HACB 1RAIB 4GW6A 2W7AA 5LY3A 3MMAA 3C16B 1U02A 2M4MA 2UU9J 1WBDA 2JWNA 1S1XA 3KMQA 2G1DA 4DL2A 1KS2A 4AQYJ 5HP1B 3VF6A 3TU5A 1Y5NB 2X1BA 4WK3A 3UDCA 4C8YA 1K8KA 3MUTP 2E5JA 2D0PA 2W9CB 3PHEA 2HGMA 1XMBA 1YIJN 3Q24A 1VSEA 1WEYA 5LMNJ 2RDDA 3AO2A 2ZEJA 5JXSA 5J2PB 3MUVP 4O3QA 3SUQA 1U7LA 4WTOB 3KMSA 5DMRA 2RRNA 4WZMA 3HVTA 4C3KA 4DCPB 1XNRJ 2A3JA 1VQ7S 4CYUB 3IR6B 4DTOA 2V4JA 1NM1A 1HA1A 2HHWA 2PFFB 1IR2A 1SI9A 3M7VA 3ILJA 1VSFA 4IDHA 2WAQD 1RXOB 1IN0A 4ZPTR 4KQZA 3UO0A 4EGLA 4BR0A 1HARA 4R8UA 1MSWD 1X31C 3BKTA 3DDKA 1XI1A 3ZTSA 1SV5B 3GV8B 2QRRA 3BJYA 1FNOA 2CA9A 2Z57B 3VENA 2W6LA 2YNGB 4WFZA 2QYGA 3T1YK 2F40A 4IO9Q 2OO4A 3SZ2A 3MMBA 5JLHA 2OMOA 2KHOA 1IBLF 4K0KJ 1OSCA 4DQQA 2BJ3A 1BI4B 3NBPB 3G6EN 4DV1J 4EBCA 4QQBA 2YXLA 2AJ1A 3GYNA 4V19X 4F9OA 3V6JA 5SWMA 4JI1F 2XNRA 4PPDA 1GMVA 3CDAA 3DLGA 1SC4B 1B0PA 1B9DA 4GO7X 5IZHA 1P1LA 3M6GA 4BRLA 2ETJA 4LF6K 2HHVA 4QZVB 3Q0AA 4CJ5A 1YBAA 2ZKTA 1PJ7A 2HFUA 4H0PA 3E9LA 1BMQB 1JLEA 1Y9OA 3LTOA 1YVNA 1WD6A 3O8WA 4FYXB 2VPXB 5AQUA 4CHZA 4DUYK 5F8GA 2R7WA 2VYPA 4OYPA 3SSRA 2XEXA 5GAEP 3L4BC 1QUVA 4LR8A 2DH7A 3CHWA 4H4OA 2YWWA 1D9FA 4CGIA 2DITA 5EN1A 3L2UA 3NF6A 3ZX0A 4X62F 2GW8A 3M8RA 5LL6d 2XMJA 2F4FA 1S7IA 5FLXO 1UA1A 1J5EJ 2F4VF 4ZCLA 1S1UB 2KJVA 2ZH8A 4MFBA 3CQXA 2ROEA 3MR5A 4CJSA 1ZA2B 3LL3A 4JI7K 2IBKA 3NWRA 1HMVA 3J81U 4LFAJ 4E3SA 2WZ1A 2UXDK 2AGOA 1GX6A 1HQEB 5AXMA 3I55S 2OH2A 5C25A 3OXGA 3QFPA 1YJNS 1YX2A 3CJ8A 5FRMA 2KYZA 1HYZA 2LU1A 4WP3A 2BM1A 4GVEA 4DSFA 2BJ9A 1VK3A 2G2OA 3VGKA 1RTHA 2PD1A 3CT9A 3CF5L 1UW4A 3QFUA 2A0FB 3N0VA 4A8FA 4DCHA 2ROGA 2FTRA 1LFPA 1YWXA 2IJNA 2RQCA 4FPIA 2EWHA 2NREA 4LF7F 4NLOA 4GKKF 1IR0A 2WVBA 3HKWA 4Y65A 2IVNA 2DEIA 4M63A 1DRZA 3MEEA 2R7QA 3O9QA 4E8UA 1APSA 3C65A 1NK6A 3ZZ0A 4FLYA 3CDEA 4NWBA 4CJ7A 5BR8J 2N7YA 3IWLA 2R8JA 2CYYA 1N88A 3OUYA 4DR2F 5F2RA 1XTZA 1Q8IA 4E2FB 3BSAA 2QWRA 1HNXF 2N82B 2DCLA 1RLDA 3MEKA 2OFGX 4USHA 2ZZMA 3CETA 4PABA 1OWXA 3C19A 2R7UA 5CH7B 3T3FA 3L2QA 1TMMA 2NRRA 4NYZA 1JLCB 1QY7A 3HVAA 1U1QA 4E1MA 3QYYA 3VAKA 1GTEA 3MPVA 4M5IA 1U45A 2AGPA 1FXXA 2ZF5O 4KB0A 1GX5A 1CULA 3VQAA 3OJSA 1TVRB 1U48A 3PYFA 1XMOF 5I42A 3TANA 2B56A 1DTTA 3GYXB 3BO2A 3ZT3A 2YWKA 3OYKA 2NRZA 3JTOA 1T7PA 3LPTA 4OGCA 2FHJD 3MEGB 2EC0A 3ZZUA 1BIZA 4X66F 2RNEA 3I8BA 4E7HA 3VEWA 3UKRA 2W2MP 4TXSA 3PCOB 2HZAA 3QGHA 4DQSA 1F9EB 1UVNA 3CD5A 1N56A 1S1WB 1NU0A 4Q5VA 1P8ZA 2DEJA 4FLXA 3Q8PB 2ZE2B 4JV1A 1UWAA 3HT0A 3THPA 3TAEA 1ZM9A 5BPMA 4DR7J 2ILZA 1P6TA 3K57A 2JNJA 4ED2A 4HKQA 1I51B 1BY9A 5IQ6A 5FDLA 1UAXA 4IOCL 2PIIA 4JI4K 4NZ7A 3ZSXA 3MDFA 4M5LA 1S48A 1WSIA 1N32K 4C2MA 5A2QY 3F5TA 2WOMA 4QIWD 2IM2A 4DTNA 2QA1A 2RU9A 3GV5B 1C0TB 5CZVA 1NGJA 1C6VA 1S79A 3FC9A 1KR4A 1GOCA 4JKFA 1BA1A 1CJVA 1LWCB 5ETKA 3FVYA 3R1LA 3Q8VA 3U02A 2ATCB 5AQJA 4LFBF 4NX9A 4EWTA 1SIWB 5KFZA 1DLOA 2HHPA 4I7FA 3GFZA 3O3FA 3TA0A 4FS1A 2DNKA 3TR5A 4W92B 3FLCO 3NKYA 5DZ7A 4U7UK 1M5OC 4DTSA 3K89A 3NNCA 2RAQA 2ZH2A 1Q53A 2RQKA 3T69A 4KH5A 3DLEB 2BMBA 3IKMA 4MKBA 5AJ3F 1SUQB 2B9YA 4LY7A 3D5MA 3JTPA 4OJRA 1IKXB 5H9EK 4YY3J 2R7TA 3I8DA 2V5HG 3OLBA 3NGKA 3M3ZA 2DKOB 1PAEX 4PAAA 2NYHA 4BC4A 5F8MA 1UP1A 3GFYA 4HUGA 5J2NA 2F7TA 3WNFA 3R5CA 1N33F 5BPNA 5C24B 5JVHQ 5AR0A 4CDIA 2AIRB 2HWIA 1N34J 1QQOA 3WNHA 3QWUA 3VEVA 3PIOQ 2XYHB 1RGVA 1T03A 3C15B 4IH5A 1EP4B 4DR6K 3N79A 3LANA 3DHXA 1UL3A 2MKJA 5HSPA 4FSVA 3ZT0A 4NLWA 1JLFB 4YDUC 2NUBA 4EFHA 2KJWA 2G8HA 4G3IA 4EU0A 2NXCA 2YNHB 4RBUA 5ETLA 3SEOA 4OX9F 1TUVA 4OJGA 2F7VA 2FD2A 3OTOF 2E5LJ 2V2KA 4CJUA 4KHPK 2V51B 1OYEA 3H3OB 5L39A 1XMQK 5KT7A 4AHVA 1P27B 4FYWB 2YJFA 4LBHA 3GV7B 2V8GA 3B6OA 3O6QA 1FI4A 2HFZA 2EKNA 2FHKA 3QFHA 5M1OA 2ZJRL 1S1VA 4CEZA 3LOUA 2QL9B 3PW2A 1ZM4A 1WNEA 1WSRA 2HOEA 3QEIA 3AA5X 2BE2B 4DLEA 2HF3A 3NWGA 1YJVA 4CLKA 5KG5A 2MEWA 4ED3A 2OEJA 5D0HA 5I3QA 4RW4B 4U8VA 2VG6A 1NAQA 1XBWA 2HNYB 2VPZB 4B3RJ 1DKGD 4BVOA 1SH2A 3C14B 5L1IA 4PQUB 2Z1GA 5D78A 4NCGB 4O55A 1RAEB 3NEKA 4FWPA 5CZ2A 1VHXA 4X4NA 2BJ7A 2ZH7A 1YTAA 3P8BB 3MR6A 1YHQN 1WWHA 1OKJA 3TUZC 1GOBA 4CBXA 1I94K 3W2VA 4I2PA 2HHHK 4BDZA 2IC3A 4EFAC 1DQ9A 4YB5A 4M5KA 1N0UA 3GIRA 2QSFA 3U27A 4HR2A 4UY8T 3BPSP 5DK5A 1G2EA 4FK4A 4KGMA 1BQNB 1FJCA 1Z2ZA 3JTNA 4C9DA 4TQSA 1VQMN 4CO5A 3PM9A 1VSJA 2YTCA 4NLYA 3PHTA 3FGVA 2MY7A 4DV4J 1T9VA 5IM0A 1SCJB 4RO0A 3QNOA 4PXEA 4CLPA 2PO4A 3M8QB 2XWXA 3GYGA 5KFLA 2E29A 4XDCA 1R6VA 1FJ7A 4F0KA 2LQBA 1TKZB 1R89A 3EE3A 3PYGA 1K0TA 4Q44A 3IG1B 2QWQA 1IQZA 5DS7A 4AHTA 4JKCA 5DGAA 1RTJB 2ZH1A 4ECRA 1RT6B 1SKRA 1VQON 4QWDA 3MCAB 3OSPA 4FLVA 4I56A 3IFRA 3ZEUA 1VQNN 2QXFA 2J9CA 5LMNK 4JEPA 5GAGI 2WRMA 4ZVUB 2MKYA 4Q8FA 3AH6A 1T9TA 4CLZA 3CPWM 1Q7YT 2WSFC 2VIHA 3ASMA 3HHLB 4ELVA 5DRKA 1NJIO 4O23A 3QERA 3ILLA 4U7CA 1ZBFA 2J4RA 2Z0GA 3SAGA 1BA0A 1XNRK 4JN4A 1X1PA 3PX6A 3HFZB 4YEAA 2JLFA 1JJ2M 3D54A 2OZSA 2Z58B 5IT0A 1X9JA 3G8QA 4ZOSA 4CBWA 2GVZB 1BU6O 3KFWX 2IM0A 3U1MA 4H4MB 4ZA1A 2FIUA 2IRUA 2KB2A 5AQMA 3WQTA 1UPPA 2VBZA 1X5SA 2F63A 2VQEJ 1DEJA 3HOSA 3GB0A 5CZ1A 2KN4A 1U24A 2QLFB 1C1BA 1T9YA 3AO1A 3PSFA 5KPRA 2HRYA 5FPDA 3H1QA 3DI6A 3CJSA 4OO1J 1ATRA 3DC2A 5BRHA 5E0OA 2G8KA 4JKGB 1D8ZA 3FFIB 1VQ9N 2Q31A 2DPIA 3NMUA 2W2NP 3LPYA 3EN9A 3CSKA 2MGZB 2VFUA 4K0KK 4ANEA 3GJQB 2CGKA 4DV1K 5KT5A 1PC4A 3AD7C 4DX8H 2Z30B 3Q22A 2P9PB 2XB2D 1S12A 4CCHA 1YBTA 4JI3F 4J2BA 3WNGA 5DM6Q 3I6PA 1FD2A 2RIJA 4ES3A 1RBOB 3KLIA 2WVFA 3B82A 2FYXA 3CCVS 2P9EA 1WI8A 3UKUA 1TL3A 2DHSA 3VF2A 1ZTTA 2V2QA 3QJLA 4FM2A 1GH8A 2DFFA 5AQVA 2Q6BA 1AW0A 3H7HB 4DQPA 1U2CA 4R0EA 5F9NA 1Q1KA 2BQUA 2R8GA 2LA6A 4NYPA 3I33A 3CJKA 2OSQA 2B9XA 4OYXA 1WN7A 4OZ0A 3PRDA 3NFAA 4NO7A 5AQXA 2ZD1A 4CJ4A 3A2FA 1ZPWX 2A2CA 2IVOA 2BANB 4ILHA 4DR1F 1FXDA 2VPYB 4B9VA 3EDQB 3I9V9 2FBVA 1J5EK 4RW6B 2APOA 2VPWB 3KK3A 2DRAA 4P6QA 4YR2A 4IRCA 2A40A 1HYSA 5C2FA 2CQ3A 5B0AA 4DFMA 2VBXA 4USIA 1IBLJ 1WF2A 4DOZA 1ZA1B 4QPTA 2XZWA 2B7CB 4OJ3A 1H98A 3Q8QB 4J9MA 2AJQA 5F8HA 4JI2F 5ETTA 3AD9C 4JI1J 1UA0A 3J80Y 5EX5A 2VOOA 3UCZP 2OPPA 1QD1A 4MK7A 2CQ0A 2XO6A 2GVDB 5J1EB 3HHLD 1UEUA 1M5VC 5I3UB 4CF9A 5K14A 4HT7A 1FX2A 4TU7A 3N9UC 1VQKN 4CLYA 4FPRA 3M2RA 1W7AA 4LR9A 3TAMA 4J5OA 4EUVA 2BV3A 3CNQP 3PUFA 2VG7A 1Z1ZA 1S0NA 1JLBA 1R0AB 4F4XA 2D3O1 2E88A 2K1RA 3SAFA 2GWJA 1NRKA 4DTRA 4CZEA 1Q86O 1JLQB 3GTYX 4AM6A 4ECVA 2KRBA 4LF4K 2GJIA 4WTYA 1FT8A 4TLQA 1VQ6S 4X62J 2V0NA 2BBEA 4XO0A 3M05A 4I6MB 5BJRA 2YNFA 1HLWA 3N5BA 2B8PA 3RYLA 4KAZA 5BYSA 2ZVSA 1RB0A 2GX9A 2D0BA 2F4VJ 1FDDA 1WKJA 2HBLA 2LDIA 4ER8A 3K5LA 5E3QA 4ZIVA 3DN9A 1CJTB 4TVAB 3OYFA 2MZTA 2HBQB 1QS4A 2HBJA 3W8GA 1RT1A 3B78A 3I56N 5C5JA 3VV2B 4X4SA 4F0MA 5KRSA 4X84A 2QA4G 2R7YA 1FE0A 2KU7A 3WBZA 3A8EA 1UVIA 4K59A 3I5CA 5A2QU 4F3OA 3E01B 2ZGZA 3MECB 1QE1A 3SK3A 2QWNA 4LF5K 1XNQK 3CD7A 3HJFA 4F7VA 3CCQS 1KVAA 4WQ5A 3BN4A 3ITHB 1S59A 4LF7J 6FDRA 5DJBA 1LW2B 4IRKA 2YHAA 3BZCA 4ISGA 2J0SD 3RUBL 3EEQA 4JV5K 3G96A 4YOYA 5BYQA 1UCNA 4PA1A 4GMJB 4N56A 3PRBA 1BWVA 4O3OA 4DV2F 4MDAA 2RQMA 4L3QA 2MXYA 2O1PA 1BE4A 1C4AA 1YITN 4Q8EA 3KYLA 4RW8B 3MM6A 3CYMA 1UOCA 4CT9A 4X4QA 1HNXJ 2P51A 1VAZA 4DHYA 1YK9A 2A1RA 3EZWA 3KKFA 2CPHA 1TL5A 4X64J 4PUOA 3TWZA 4B3TJ 1XK8A 3PYEA 4Q7AA 4E7JA 4DSLA 4C0OC 5HQ8A 3HD1A 2UUAF 1ZBUA 2DGQA 2DXEA 4P71A 1RT4A 3JYTB 2Y0SD 1X5TA 4NYFA 1PYSB 4OKEA 3DFEA 2Q0UA 2CDQA 3IS9A 3MK6A 4IOAL 3QMLA 2XGQA 4DTXA 3PXGa 2GO8A 4EO6A 4IO1A 3MCMA 5ETSA 4H8KA 2WB1D 4C0HA 3KJFB 2H5EA 3BDEA 4DSIA 2MKSA 1SH3A 4FKXA 2BA9A 3C7NB 4X66J 3U1LA 2G8WA 1Y3KA 4OYWA 1U1NA 2UVUA 4JKDA 2Z2LA 2XLKA 1FO1A 5AE1A 3L7PA 4YY3K 3VEZA 3LGMA 3KHLA 4MIAA 4DG1B 3G6ES 3DLBA 4LRCA 5AFUH 5AQKA 2Q79A 1B64A 2FJXA 5F41A 1H6KX 2CJBA 1H2VZ 4O44A 3MHYA 2BUPA 4RL1A 4NLTA 3OYHA 2KW4A 4DF8A 1VRTA 2DGXA 3UWTA 5IWAJ 4A5BA 3LWMA 3QEVA 1T02A 1WOQA 1C1CB 3NGSA 1XR5A 1S9EB 2AEFA 3R5JB 2R2TA 1TUWA 3SMZA 2GGPB 4E7IA 1KVKA 3FZMA 2OMLA 4QOTA 5KAKA 2GQQA 2E1MC 1PYOB 3V6HA 3CW2C 1NPPA 4UOCA 4RZRA 1R59O 3KDNA 1NUEA 4WWSA 4DR5F 2DJWA 3CC7S 5HVFA 4I9LA 1KC8O 1UKUA 4CO2A 1D4XA 3QLHA 3DRSA 2AEMA 2ABYA 3EWGA 1IO2A 7AT1B 5M1QA 1F6TA 4E1NA 2QJ3A 2HKEA 2F8MA 4WFNL 5F3TA 3OR2A 4JI8F 4OPHA 2P9LA 1JWWA 1R8CA 4IZ9A 4USUA 3VQQA 3H98A 4M5JA 3MAAA 2Y8WA 2FF6A 2CPXA 5D4OA 2ZH6A 2Z1IA 1OPZA 2ROPA 3FSYA 3I31A 3MPUB 1FRXA 3DOKB 1B7YB 2O3DA 1CZ9A 2ZGYA 1VLYA 4AL6A 3VGMA 5B0DA 1YBUA 1JNZB 5IOLA 1YAGA 3K7RA 4ID5A 4B3RK 3M5RA 3ICLA 1N33J 4HI1A 5DGBA 2SXLA 3V4IA 3TARA 2D1CA 3D9BA 3TVYA 4WFAL 5FROA 4CI0B 3EZ5A 3PV8A 3DLHA 1BIUA 5HJYA 4GC6A 3HHKA 3ZSRA 4DSEA 3TZXA 4ITSA 2F65A 4KPCA 1YZ7A 5HBMA 2Q6CA 1U2VA 4HCBA 2XY5A 2UXCF 3TSQA 4DTPA 1U09A 2PA8D 4OX9J 1X3NA 3H20A 5D4PA 1YJUA 4IG3A 4LF8F 1OYDA 3J7YI 4BR5A 3GG0A 1SL1A 4ED6A 3JSRA 5LSRA 2P2CB 3T41A 3TRGA 3KWGA 1R7IA 1L3KA 2QTDA 4CZGA 3ZT1A 1A9NB 4BR4A 4OZ3A 1YJRA 2GHPA 5CYMA 2EG1A 3DLKB 3M6VA 3R7BB 4RU9A 1G15A 1REGX 2D3ZA 2HVZA 2BJ1A 2KQ2A 3CC4N 3NGIA 5AQQA 3NH0A 3S01A 2CQ1A 4DX6A 1X4GA 1NNEA 1WC4A 4JKHA 2HEKA 3ZZTA 1NMEB 2FXUA 4UOFA 3BM7A 4R0JA 4AH9A 2HBYB 3VEOA 4A2BA 4ELUA 5GIPA 3MMCA 1VIXA 1HI1A 2MZJA 4CLFA 3NNHA 2D3UA 4L76A 2P9IA 2OEMA 3A3PB 3CIMA 5KRTA 5B0FA 3LP2A 3LPEA 2DISA 3SJHA 5CYQB 1O6XA 1NKCA 1JNRB 5DQIA 1K0VA 1YKWA 4LMZA 3W3DA 2JEGA 1JL1A 2Z2ZA 4L3NA 3W5ZA 3FE1A 3TPQA 2VFRA 2C1EB 2OEKA 3R2CJ 4XTTA 5KFMA 4O5FA 4FM1A 4XDDA 4Q0BA 5C7PA 4Z4CA 5ADXH 3C6UA 4DQRA 4WCEL 4CEDA 4KI6A 1K73O 2BQRA 4CZIA 2M70A 3L95X 3MM9B 4JI5F 1TU0B 5H9FK 3GIIA 1AFJA 4JK9A 1EKSA 4ECXA 1YVUA 1TL1B 3JS6A 3FUYA 3ETMA 4MAKA 4E0DA 1QZ6A 2O01C 2FY1A 3PR5B 1HJOA 1DZ5A 2QC3A 2JWLA 3O3LA 2VQFK 1RT7B 2DY9A 4RBTA 5JMNA 1SZ2A 1BWEA 1BUPA 1CZAN 2V6AA 3LP1A 2BYCA 2A1BA 5KFAA 1W2BR 4XEIA 5D4LA 1LWEB 5E2QA 3WHIA 1UFWA 2DNRA 4CLWA 2YVSA 4FJ9A 4Z94A 1LWXA 3KJNB 4FJMA 5DLFA 4QYZJ 5TKWA 2MKIA 4OZNA 5KFYA 4USKA 1KAYA 4FLUA 1FDBA 2OTJS 3TQEA 4BG8A 1B70B 2YY3A 4F36A 1QJHA 1VC6A 2WONA 4YHHF 4LUBA 2V9WA 3MN5A 1MNEA 2E6MA 2C2NA 4GY2B 1HR0K 3J80U 4N5SA 3KG1A 3BGRA 2ZZTA 1T95A 3M6UA 4L75A 3NF8A 3DOMB 1BQMA 3R1HA 4CW7B 3QO9B 1REVA 3RB3A 3IRXA 2FVSA 4MDBA 3LDLA 1UWBB 2IFXA 5A6PA 2BJ8A 3M30A 4DL5A 2RDJA 4A8WA 3LWLA 4CD3A 3SXLA 5KFVA 3AVGA 2PBDA 2CVEA 1M0SA 2VDIA 4A8OA 1KN6A 3FZHA 3O9TA 2M52A 4JI1K 1X5PA 5C15A 3UDLA 1LNQA 1WHYA 5BN9A 2DVIA 5EWFA 1C0UB 3P5BP 2CZ9A 2W41A 3O5BA 3HM8A 1VSLA 4E7KA 1MU2B 3L4QA 3BEXA 3DGPA 4C8KA 2QLWA 3KUGA 2UV8G 1VQ8N 4HTLA 1RHRB 4RNNA 4NCAA 3ZCMA 4JOUA 1Q16B 3U1NA 2E20A 5AXLA 1WTFA 1HQUA 2YJEA 3BQ1A 3WXLA 3CJ1A 4QIGA 2BRKA 4CT8A 4N77A 1XC9A 3ELHA 1D3WA 1VQYA 2KI2A 1GLLO 1D0EA 2NXNA 3K2PA 3V6DB 4U95A 3SI8A 1AB8A 2W7OA 3J81j 2P9SB 1HBNB 3IN5A 1RDWX 1UJ6A 4DR1J 4AL5A 3QEWA 4OFZA 2BJEA 3IGVA 1KAZA 3IO1A 4DR3F 1WAJA 1FK9A 4J9LA 1YI2N 2B9EA 3SQGB 4TKTA 3BKUA 4OHYA 3CE8A 5HN0A 1VOMA 2YWFA 1NSAA 2HNDA 1YHQS 3NF7A 4K25A 4BE1A 1DGKN 2BKPA 1HBUB 1TUGB 5E3PA 3VAJA 2IA6A 8ATCB 3MMAB 2FQQB 3G71N 4IJAA 4JK7A 4ENOA 2V8VA 4USWA 4NXMF 1RT3A 4NZ0A 1VC5A 1AZSA 1RE1B 2CGLA 4LVNP 2FJDB 2A3ZA 2DGUA 2L9DA 5T7BA 2BOPA 1K8KB 4IO8A 4I9QA 1J27A 2NCKL 1GXTA 2DGTA 1RDRA 1TK8A 2D0CA 2CWKA 3M2VA 4P74A 2BACA 4OHVA 3TTCA 3OVSA 3NOCA 1GMWD 3HVTB 4BS2A 3L6QA 2GAHC 4JK8A 3N28A 4FYYB 2RILA 3AVLA 4AM7A 1BCOA 4Z4IA 4KV8A 2V4JB 3RBEA 4M94A 4F2SA 1L3UA 3SCXA 3VAGA 1NSKL 1JXBA 4NRTA 1VQNS 1D8YA 3DU6A 5D0GA 4C8NA 4CLUA 3V2UC 1U0HA 2KKHA 4P2MA 2ZHBA 2GZOA 4DX5A 4LJMA 4HH1A 1T05A 3HLUA 1SVDA 4OV6A 4PKDB 1Q79A 4X64K 3CPEA 3CERA 1KOOA 3AO3A 4B3TK 1RFQA 3ZETA 1UVLA 4EBEA 4AL7A 2EFGA 4EAHD 2XHCA 2R3VA 2LP4A 3BS9A 4XAKA 3OYCA 3B54A 2ZJRQ 4LVOP 5AE3A 5HLFA 4NA1A 1YSJA 4JI0F 1RDCA 4CHYA 3CCZA 1N5YA 3HDSA 4CK3A 4UOHA 1G7CB 1LQ9A 3CCRS 4P2XA 2B4PA 2HSEB 4NASA 3PKYA 4FF1A 1RUSA 3BUZB 4IRDA 4A8XA 4LFCK 1VQ7N 1QQCA 4QS9A 2PMWA 1WC0A 3ULHA 2ZH3A 3DLGB 5KT4A 3K58A 1IKVB 1S7HA 3VPZA 1GMUA 3UE2A 4X65F 2E5HA 4M5MA 1HHQA 2CNOB 2F8EX 1OMSA 4YB6A 4CLTA 2YCHA 4WF9Q 1VHFA 3OR1A 3C3LA 2OCEA 4PXDA 3PX4A 4PWWA 2DR5A 1ZBTA 2JVRA 4DV2J 3DLRA 1OO0B 5GAGP 2Z8QA 4Y34A 3KOAA 3KJVA 4JLHA 3MXHP 4OPAA 1JLEB 2HK2A 2OPSA 1HPZB 1DT9A 4CJQA 3KIOA 2DFHA 4KHMA 1DTQA 1FJGK 3HHLC 5BRDA 4F26A 4A62A 2VDHA 3FBBA 5C12A 1ZZNA 2ZOFA 5IWAK 3O4QA 2KG1A 4YOEA 1OY8A 1KQSR 4MO5A 4E19A 3H2UB 1GLDG 3NCRA 1U1PA 4L72B 4H4OB 5AT1B 1ZTWA 1PAUB 3UR0A 2CQIA 4B9SA 4BREA 4Q45A 2FLOA 3PVXA 4CNZA 3UIQA 1PJ6A 2ZHAA 2IIHA 1WF0A 4UQGA 2QA4S 2LVWA 1S97A 1F5AA 3C8YA 2Z4PA 2IYIA 5AFUA 4OX8A 1RBSA 4QW9A 2BABA 1GAOA 3VQ8A 4G65A 1HMVB 5HK4A 4K2JA 4LF9F 1X0FA 1NHUA 3N6MA 1EQMA 2LQ8A 4BR2A 3MDQA 1TFWA 4ZPAA 2E1AA 5C25B 1HWKA 5MLCQ 4IDKB 3R9LA 3Q7BA 3R5AA 2R8KA 3AAPA 2H3EB 4F25A 1RTHB 4FLZA 1VQPN 3SSQA 4NOHA 3HF5A 5HMWA 1HBOA 1Z26A 4J9OA 1HKBA 3C6TA 3KLHA 2FLPA 2GIFA 1MLAA 2KL8A 2YBVA 2QXLA 3HFKA 3MXJA 1XHXA 3DRRA 1PC5A 3THXA 1XJWB 3MEEB 3ZTQA 1OH6A 4WXWA 3LGHA 3NCQA 1NKBA 1IWAA 1RBRA 2DPJA 3U9ZA 4ZP8A 1M1KT 3FMWA 2ALYB 1OH5A 4LQ3A 2W01A 4K4UA 4ZTJA 2AU0A 5AZJA 4DTMA 3OUYB 4A2AA 3N4PA 2WBMA 1EJ7L 3WXKA 4J9VA 1Q9XA 2J0WA 2NXJA 3I55N 3M32A 1YJNN 3AA8A 4DR5J 2VG5A 3ULDA 2QX0A 4ETZA 1QVGR 2AF6A 1VQ5S 2U2FA 3PEHA 2YKNA 3FRZA 4FWNA 3J7AN 3BH7B 3GOIA 4IWVA 1CULB 3MN6A 2HVIA 1RWNB 2BDPA 1VLOA 4WKYA 3PZPA 5CXTA 1HNWF 3E66A 5I42B 1DTTB 1VSDA 2CJQA 1NMNA 3CCES 2C3UA 4OKJA 1HIYA 1WSJA 2FC8A 5GMEA 4IFYA 1IBMJ 1DQ8A 2DO4A 3HP6A 4FL9A 3UKRB 1CLFA 5L1JA 2NRWA 3PFEA 5L9XA 2W4DA 5T41A 2M7SA 3MAQA 5CAAA 1N6QA 1BXNA 2EFQA 3KVGA 4E1JA 2L3MA 2HAFA 2MLXA 2ZJQL 3T9NA 1VIOA 4RUHA 4IUFA 4FNHA 4M8LA 2GHVC 3O8MA 3QEPA 5KFPA 2G1HA 3BV8A 2M8HA 3AJDA 5FDLB 3VERA 2NNWA 5GAGU 4DQIA 2GBZA 3QFWA 2WOMB 5EY4A 3DYAA 3NH2A 1NDCA 5F0WA 3MM7A 4QR2A 2CNKB 2XO7A 1GXLA 4ALZA 2B51A 2MQNA 4DL7A 3DLLQ 4LF8J 3ZX2A 3BF1A 2GC8A 1YITS 1N36K 1CJVB 3OL6A 2YPYA 1BGXT 2LKZA 2M3DA 2V50A 3TWHA 2EFOA 5KFCA 2KKZA 4G1IA 1S9GA 4ECWA 4PWDA 1V5VA 4J9PA 2ALZA 1DLOB 4ELTA 5JMVA 1KFDA 1X4EA 2HS0A 4I7FB 1FXRA 1MWZA 1FA0A 4EO8A 3SI6A 3QZ8A 3CCMS 4DFKA 2L9NA 3D6HB 5L8RC 2XCAA 1JXEA 2BRLA 5D0EA 3LF0A 4R5PA 2QMUB 3A8JA 3EZUA 1HW8A 4C8OA 4FVMA 2QO3A 2GQCA 2XHWA 3CQYA 3V1RA 3RJMB 3WIVA 1G1XA 4GKJJ 1V5IB 1S4FA 4KT0C 3NVKA 3VQSA 1IWGA 2KXNB 4DHVA 3QGIA 3BQ0A 4KTZA 2ZH9A 4NYNA 2B5JA 1YQHA 2ZVIA 2V52B 4LQ9A 2AYGA 2MZSA 5J2NB 1RAAB 1V4SA 5LJWA 3EKSA 4BC3A 3OYLA 4WQ4C 3LZJA 3HX9A 1X5OA 1ULRA 4DV0K 1KTQA 5B09A 3K0SA 3D68A 2FJVA 1T03B 3MCSA 2RU3A 2AYBA 2QMWA 3JB9k 4HHUA 3RR8A 4UY8O 4PR6A 4DR4F 4TQRA 3LZIA 3SMSA 1WSGA 3DMJA 4MJKA 2RS2A 4C8LA 2OSRA 3VGTA 3VQTA 2J9DE 3C16A 3ISND 1WHVA 4J91A 3OYMA 2ZNZA 2QI2A 1MA9B 4UZCA 2OJ3A 4I64A 1EWRA 4B1YB 4JI5J 5ITHA 4B1VA 4CHPA 1PBUA 3D3BJ 2QA2A 4LRFA 1EQ0A 2H4WB 5JS2A 3F0NA 3F56A 2X6NA 3OS0A 1S1TA 5KFRA 2UUTA 5C2CA 1PYTA 1FF2A 4ECUA 1U8SA 1ITPA 2MYFA 1K8AO 1S1VB 1VDHA 2DT9A 4DV6J 2HLTA 4OLAA 1F60B 2HVHA 3SBGA 3VGLA 4MK9A 2XMWA 4J7CA 3D6TB 1H0HB 1A7GE 2HGLA 2DCUB 3G6VA 3KKRA 1RWXB 4Y2MA 4TY9A 1UZDA 3H5UA 4Y2AA 2VG6B 3W1YC 1X3MA 4YOXA 2QFJA 2PYJA 4NLVA 2HW3A 2O8EB 4QWCA 4NLUA 4M95A 4RX6A 3LDSA 2ATQA 2E5IA 3PJ9A 3HZ6A 1RHKB 1KAXA 1S77D 2VBWA 5HL7L 3OHBA 2EI5A 4JD2A 3R3TA 4FVUA 3W2VB 1CS4A 4I2PB 1S0MA 2IC3B 3TA1A 3I0RB 2VL1A 2NRTA 1XQSC 3P49B 2XY6A 2YNGA 1NBEB 5KGXA 3KG0A 1VI7A 2YWGA 3SQ0A 2CUYA 1NK8A 3FMBA 3MR7A 4H0VB 1H3DA 1RDBA 4H4KA 4DV5F 3ZZYA 2OKQA 3CXCM 5AQGA 2PGCA 3MI7X 1BI4A 5IT9O 2C2ZB 4EI2A 3MM5A 4FW1A 4KC5A 4PWUA 3EX7B 1JK9B 1G99A 1WDDA 2ZBRA 5IM0B 1WORA 2HZVA 2FVPA 1NGEA 2EBGA 1KTVA 1RKJA 3O9UA 4M5HA 5KOWA 3CJ3A 3HJVA 2WTFA 4PG7A 3IWXA 4I2QA 3HPHA 2GIQA 5E3AA 3ZC4A 5G4DA 1FEEA 1UW9A 1A0OB 2A6MA 3ZTOA 3HXMA 3EM1A 3AY0A 1NOZA 1RILA 4CGHA 3ZEUB 4FM0A 4MKVA 2PN6A 3TSPA 3A8YA 1M90T 3CI5A 1EKEA 1UZHA 3PRVA 2C42A 4LH5A 1NH8A 3NOGA 4IH7A 3EDRB 4ID8A 1W2IA 3VZIA 1PCAA 1EB0A 3MZIA 4ED8A 4OX6A 2AJFE 1TAUA 3UR3C 4BC5A 5T7LA 4NLDA 3EGZA 3VOVA 1YTYA 5ETOA 1JJ4A 2ITMA 3ZSQA 5ETPA 1TYQA 2E7VA 5MLCV 1EX8A 1AUDA 2CJXB 3HYFA 1C1BB 3LAKA 3RBDA 3E8OA 2MHEA 3DI6B 1RACB 1NDPA 3NCPA 2GMHA 5E7OB 3UDEA 1X9MA 1IVZA 3OVAA 4PY5A 1VRUA 4WFNQ 5AQWA 1RAFB 4EK2A 1T44A 3M1FA 3J7YP 1H2TZ 4PZVA 2WK4A 4OVLA 4KKOA 1S6QA 4M3WA 2FUG9 2V2VA 3MD3A 3JAMO 2GUIA 3THYA 1R3NA 1RWOB 3NLCA 3RB4A 4FPBA 3AV9A 3DXBA 1J2VA 1VSMA 3MEDA 1TQLA 4FJ5A 4C0BA 1TAQA 3QSIA 4OMFG 4A59A 2EW9A 2KYXA 3PNIA 3GJTB 4ZVOB 5E84A 5LL6Z 3WX4A 2YNIA 3AGRA 1A5WA 3UKUB 1X4BA 2ZUAA 2MQ8A 1TL3B 1VSKA 3QT8A 2WBNA 5HOOA 2YHWA 3VQBA 2NZTA 3LDPA 4ISFA 2AJ4A 2UUWA 3V6KA 4CZMA 3CC2S 2BR0A 3L2VA 1EIYB 3KDOA 3G87A 3LM9A 3J7A1 1Y0HA 9ATCB 2X1GA 1VSHA 3CJKB 2YX4A 4KHSA 2G4BA 3UQSA 2PI5A 4MIBA 3R8EA 1CSJA 2QKKA 1WB9A 2ZD1B 2JLEA 1RT2A 4DN9A 2XLJA 2G0JA 4CJLA 4F3QA 4HYKA 1WEXA 3C6AA 1FESA 5K8NA 2VF3A 4WE1A 2HS4A 5FD1A 2PI4A 3W63A 3AA4A 3R5BA 3KK3B 2NYIA 3T1YF 2H3GX 5KPZA 4ZP9A 3EE8A 5HVGA 3L3CA 4W90B 4BWMA 4DEZA 3OYIA 3OT9A 3CCVN 4L3KA 3V9WA 1K44A 3W8PA 4MK8A 4FWRA 3KWIA 3D0PA 3VGSA 4M3UA 4J2AA 3KLEA 4KTWA 4J37A 3SCIE 4OHXA 4X65J 3CJ7A 3CB4A 2OPPB 3O3HA 3CMAS 2UUBJ 5B7WA 3AJ2A 5LJ5Y 2ZOGA 5DDOC 4JAXA 1HKCA 4PG6A 2OLWA 2KFZA 4LF6F 2HMIA 5K14B 3ULEA 2B4OA 3ZNJ1 3P3DA 4C6AA 1LK7A 1I5OB 2PA3A 3M2RB 4F3MA 3RBZA 2YH1A 4BDYA 2FGOA 3TAMB 3GU0A 3AJ1A 3V5RA 2VG7B 1JLBB 3N01A 4B9UA 3VQDA 4IXCA 2MLYA 2K1RB 4OKKA 4DUYF 3I4HX 4NXNK 3OY9A 4DKWA 2H5IB 5K8PA 1LV5A 5CCMA 4QWBA 2AEJA 2AX0A 2AT1B 1IM4A 5EWGA 2VHGA 1NGHA 5AQIA 4DL6A 4RKUC 8RUCA 2OANA 5K5MA 5HVHA 5K20B 1IM6A 4CJPA 2YNFB 2QKBA 1K1QA 2DK2A 4WCEQ 2HBZB 4MYUA 2JEJA 4FXDA 3KLGA 4O4GA 5HAOA 3GLJA 1U4BA 2CNNB 3R5DA 3R5GA 4P2FA 4UZBA 2RH3A 4JI7F 3D2EA 2W2PP 3QSYB 1RT1B 2Y1LB 3NAEA 3TZZA 2ZZNA 4FXWA 1KOHA 4QU7A 2UXDF 4DUZK 2W6KA 2P6TA 1NGIA 4OHWA 3CJAA 4A8MP 1UTAA 3KHRA 4DV3K 4W5OA 4B3MF 2HB5A 3ZTRA 3OTDA 2QEXS 4B17A 4URGA 3W64A 1TL7A 1JMTA 3T1HJ 3J7YU 1IBMK 4BGAA 1QE1B 1QVFM 2VKZG 1S99A 4J9QA 3A12A 2GEMA 4PKHA 2XI3A 3D0IE 2AD9A 4ZLPA 1VQ6N 2DD8S 3DM2A 2DXDA 5C24A 2VWJA 2HHQA 4ZVEA 3T1AA 3WZ0A 4HHTA 2QL5B 3MM8A 4ED0A 1YJWS 5FJ4A 1XHZA 2NXEA 3O1WA 4BCAA 2DNHA 4N8NA 4Y1CA 3QJJA 3D3CJ 2UYTA 1AYEA 2HBKA 2MJNA 2XCPA 2ACYA 3B4MA 3U3GA 4A8QA 1C2PA 4CEBA 1SQFA 1FKOA 2V8HA 4Q43A 5C2DA 3E9PA 4U6PA 2ZNYA 3M4XA 4Y2CA 2KVQE 5RUBA 1GLBG 3HSGA 2NRXA 4PHTX 5M1KA 2P9CA 3ZLJA 4DQ8A 2QLJB 3VHQA 2E6LA 4PUOB 4P2SA 2JRSA 3PIPL 3RSEA 4FYVB 4BY9C 5EVZA 2IYGA 1QAIA 2FB0A 2JOQA 5CCLA 3DGVA 4C97A 2BW2A 2KM8C 4KI4A 1PO6A 2HQGA 4XIUA 3LA0A 3CCQN 1FFGB 1CQNA 5KFGA 1HNWJ 2IBOA 4B1UB 3IS9B 4IO9L 1ZBLA 1S6UA 4ZP6A 1ATNA 5AQHA 4FVCA 3OFHA 1NNDA 3EXYA 3OBWA 1HNZK 3R6MA 1HL6A 5AQZA 3SUPA 1FE4A 4BR9A 5A8WA 1TKTA 2ZFHA 2CQDA 3G2XA 4OX7A 1Q18A 3NE6A 3THWA 3QICA 1HJRA 5JJBA 3CIZA 2VU5A 3HZGA 3ZZRA 2ZBIA 4RW4A 2HFNA 3GL1A 4NL5A 2FSNA 3UB5A 4CTAA 3FGUA 4GKJK 2K3IA 3KD5E 4JYAF 1RLCL 3FRYA 5C42A 4CJWA 1VC0A 4ILRA 3FZBA 2MHNA 3OFEA 1NSQA 3P38A 2RDIA 3VQ5A 4IQXA 3QINA 4ZVHA 1JXVA 1HD1A 1IG8A 2B0GA 1Q82T 3L4IA 9RUBA 2DIVA 4DL0C 3V81A 1IXKA 4JI4F 3AXMA 2Q3SA 2G0CA 4IJNA 2BE9B 3VN5A 4O44B 1N32F 4CFBA 3TJAA 3M8YA 4ECTA 2PC6A 2IJRA 1X7VA 1Z2LA 4C3LA 1VRTB 2Q97A 3C2PA 2PE8A 1RAJA 2DHAA 4EP5A 4W5NA 3LUYA 4MKAA 3CJRA 4RW7A 4K4XA 3N6LA 2L08A 2K3KA 1YF5L 3ADAC 3CD6S 5LMUK 5ETVA 3TAFA 2FSKA 2WC9A 3SFUA 4QBUA 3D7EO 1FRIA 4WYWA 1Y11A 1N8RT 1AFIA 3VEYA 5CHCB 5AQLA 3K5NA 1RTJA 3QLHB 4CO0A 2O8CA 5KFOA 2V4QA 1HNIA 4OIXA 2VGNA 1BHNA 3IMXA 4K4YA 3OR2B 2X7IA 4DV6K 2P9LB 4UQTA 1WHXA 1WNSA 2NRHA 3QETA 2AZ3A 1N52B 2MKHA 3PYDA 4BWJA 3UVJA 3MAAB 3Q7CA 4CF8A 4OL8A 1ZBIA 2P8IA 4O3PA 3LDNA 1NPKA 4DMZA 3MOJB 5GAEI 4EEYA 4PRFA 1FVSA 2LQ9A 1R43A 4J9RA 3UCUP 2XSFA 4UT4A 4L74A 3GE1A 3V4IB 3BSNA 1VCTA 4ZJQA 2DHHA 1CC7A 5CZXA 1VQPS 3G6YA 3IBWA 1XC3A 4ZVRB 4NYOA 4DR6F 2C3YA 3CC7N 4BRMA 4U7BA 5DG9A 4DFJA 4QCLA 4CD1A 1Q9YA 3JXUA 3NGDA 3FZLA 5HBMB 5LT5A 2D41A 1U2VB 4K41A 3RMBA 4BR7A 4A61A 4ZVGA 2PFDA 1DAXA 4IG3B 1CC8A 4K8ZA 1CPZA 1U2FA 3M2UA 1JX4A 3ENBA 3CULA 4FWOA 4QIFA 3CJ0A 3FEXB 1BQXA 1PIEA 3CCLS 4KHPF 4FF3A 2RRAA 1HD0A 3NY0A 2ZBPA 1XMQF 3I32A 4JI6J 2DIUA 1ZC6A 5KI6A 3BGUA 2Q2RA 4EIAA 5KG4A 1DJ0A 2AA4A 5CYMB 4F4YA 1XERA 3HHNB 4B9QA 1RADB 2EPIA 5D0RA 1SH0A 1FNXH 1GLCG 5E3CA 3FQKA 2VZ9A 1YLXA 3DCAA 1NJIT 1FRJA 3VETA 4EZ6A 3RZAA 5A8KA 4OI0A 4OI6A 2M8DB 4CM2A 2W2QP 4DV7K 2JFDA 3EPIA