2CH6A

Crystal structure of human n-acetylglucosamine kinase in complex with adp and glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
343
structure length
343
Chain Sequence
AAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYL-D-GLUCOSAMINE KINASE
publication title Structures of Human N-Acetylglucosamine Kinase in Two Complexes with N-Acetylglucosamine and with Adp/Glucose: Insights Into Substrate Specificity and Regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 343
sequence length 343
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.59: N-acetylglucosamine kinase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch6A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch6A02
3FGUA 1NGHA 3FLCO 4BR2A 5EOYA 5AQPA 3VEOA 5AQTA 1LOTB 3WXIA 3QICA 4M7YA 4CJ7A 3WXJA 3I33A 2HF3A 4FPAA 2Q31A 2E1ZA 4CZFA 1QZ5A 3UKRB 3ULEB 4EHUA 3DXKA 3EKSA 2PAVA 1ZC6A 3CQYA 1QZ6A 4HWIA 1NGJA 5BRHA 3H6EA 5BRDA 3H1QA 3KHYA 3M1FA 2V7ZA 3W3DA 3WQUA 1T44A 5AQZA 2QWMA 2YHWA 4BC3A 3MCPA 5FPEA 1LCUA 4CZMA 3JXUA 4AM7A 1NGDA 3M3ZA 4FWSA 3QFUA 1QQNA 4K42A 3LL3A 1SZ2A 3R9PA 4BREA 4H03B 2GEMA 3A5OC 3BUZB 3I8BA 4CD3A 5AQNA 2Q2RA 3SMPA 2E2QA 4H5NA 2P9KB 4XH1A 2QWLA 1BA0A 1BUPA 2CGLA 1C0FA 4K41A 4QS7A 2CH5A 1R59O 3EKUA 1OKJA 4L3QA 1BG3A 1ESVA 4YDUA 1TYQB 3CHWA 5KPTA 3P4IA 1QQOA 5AQOA 3IMXA 5AQRA 1J6ZA 1NBWA 3O1BA 3O8MA 5F1XA 2AA4A 3EL2A 5KQ8A 3HM8A 5AQJA 4FWKA 1Q18A 3JS6A 4B9QA 3WXKA 5AQUA 3WXLA 4WQ4C 3ATUA 5EXWA 2HF4A 1KAYA 5AFUH 3VF6A 4H0OA 2BTFA 4CZJA 3ZX3A 3UE5A 3AY9A 4A2BA 4BRKA 1GLFO 1IJJA 3QB0A 1MDUB 4MLEA 2IIRA 4RCHA 3VERA 3HI0A 1BA1A 3O80A 5CE3A 2FSKA 5AQSA 4FPBA 3VF2A 4BC2A 4MLHA 1GLAG 2IVNA 4PKIA 5B8HA 4MO4A 3CERA 4PL8A 3FZMA 3S41A 2P9UA 4H5WA 4CZIA 5LJWA 1BWFO 4XEIA 1NGEA 3U9ZA 4I6MA 5E84A 3MN9A 1WUAA 2HOEA 1ZXOA 1G99A 3ZETA 4BR0A 2ZGZA 1MWMA 4FOEA 1U6ZA 2YJEA 4CI6A 1H1VA 3WEEA 4AM6A 2OANA 4CZEA 5ADXH 3ENHA 2VWBA 2D0PA 4FWRA 4IJAA 4K25A 1JCEA 1K8KA 3UKRA 4B1WB 1HKBA 4FWMA 1X3MA 5FPDA 2QWQA 4PKGA 5AQQA 4BRLA 1P8ZA 2V52B 3CJBA 1HLUA 3ZX2A 2F9WA 2E1YA 4CZGA 1GLCG 4BR4A 3L6QA 3EN9A 5AR0A 4DCHA 3WEEB 1E4FT 1KAXA 1Z05A 1V4SA 3QDKA 1CZAN 3FE1A 1MA9B 2YI1A 1K8KB 2P9SB 3VPZA 4BRGA 1XQSC 3DXMB 5FPMA 2KHOA 4A2AA 4BRFA 2CH6A 3AAPA 3M6GA 4YDUC 5BREA 3A0IX 2Q1NA 2P9KA 2YCHA 3MMVA 4H5VA 2DPNA 1YXQA 4CD1A 5BPLA 2GUPA 2EWSA 3UB5A 3LDNA 3UKUA 3O1WA 5KQDA 4CZKA 4FWPA 3MN5A 4BRCA 4BQZA 4FSVA 1DKGD 3WUHA 2FXUA 3FZHA 3AAQA 1TYQA 1MWKA 3G25A 5F0XA 2P9LA 3VGLA 2VCPA 1ATNA 1ATSA 3O4WA 1T6DA 3O5BA 4IZ9A 1NLVA 1YAGA 3L4IA 2ITMA 5I9EB 3UKUB 3DAWA 4K43A 3CJ7A 4BR5A 2ZF5O 2I7NA 1BDGA 4FWNA 5LJVA 2PBDA 1TUYA 2E8AA 2NRHA 2P9IA 1JCFA 2Q0RA 1E4GT 4B1YB 3D2FB 3R6MA 5AQKA 2P9LB 3VOVA 3WT0A 1Z6RA 3VENA 4BRHA 5JLFA 2Q97A 4B1XB 2E2PA 5EX5A 1YUWA 3FR0A 2WUSA 1X3NA 3CJAA 3U8XA 4DB3A 2E20A 5AQVA 4CZHA 2P9IB 3TU5A 2FLOA 2FF6A 3ZX0A 3A8YA 3VGMA 1GLJO 1S3XA 3BF3A 4NB4A 4JD2A 4QS9A 3LDPA 2GWKA 4J8FA 5AZJB 4H0VB 2GWJA 2E2OA 4BRAA 4EFHA 3VF4A 2A6AA 1BO5O 5AQXA 1KAZA 5BRFA 3GDQA 3FZFA 2D0OA 2NLXA 4H0YB 4F9OA 3D2EB 4WQ5A 3SLCA 2A5XA 4CBXA 2ASOA 4B1UB 3IUCA 3QMLA 1EQYA 4JN4A 3BP8A 3VESA 1NGAA 2YJFA 2YHXA 4JD2B 2E88A 1WOQA 2QWOA 3GG4A 4FO0A 5AQGA 4H5RA 4H0PA 1SQKA 4RWTA 3H46O 2YHYA 5TKYA 4BRIA 3GOIA 3VGKA 2CGJA 4DQ8A 5FPNA 4BROA 3CIPA 5AZIA 2QWRA 4HTLA 2P9SA 5EVZA 3DXMA 1IG8A 5KPRA 2J4RA 2E2NA 3GL1A 4JAXA 4BVOA 4Z94A 3VEZA 4B1VA 4BR9A 2A42A 4JHDA 4NO7A 3RSEB 4BQLA 1GLDG 5BR9A 4CBUA 3HTVA 3MK6A 4O5FA 3H1VX 5AZIB 3AARA 4ISEA 4PKHA 2D4WA 2AP1A 3MN7A 3MN6A 1BOTO 2V51B 3OHRA 2UYTA 1RFQA 1HUXA 1X9JA 4M7XA 1DEJA 2P9NB 5BN8A 3C7NB 2ZGYA 3U9DA 4BR7A 4JHDB 3D7EO 4B1ZA 2A3ZA 5AQYA 3QBXA 3ENOA 1NGIA 2ASPA 2FF3B 2QW9A 1YVNA 2ASMA 2CGKA 3FZLA 3MDQA 3FZKA 5JICA 1QQMA 4BRQA 4IO8A 4BGAA 2VYPA 3CETA 2ZWHA 2QWPA 5EY4A 3L0QA 3D2FA 2W40A 2A41A 1NMDA 3W0LA 4LC9B 1U2VA 4BRDA 1RGIA 5AQIA 3F9MA 3DJCA 3R8EA 3LDLA 2NZTA 4H0TB 1HKGA 3IDHA 2V7YA 4MO5A 1GLLO 5AQWA 3VEWA 5LY3A 3TPQA 5ELZA 4FWLA 4PL7A 3DXKB 4BC5A 4WQ5C 2QXLA 2GELA 3B8AX 2IVPA 2P9PA 1BU6O 4FWQA 5BPMA 3U4LA 4BGBA 3ID8A 2Q0UA 4C23A 1U2VB 3LM2A 5AZJA 3BF1A 3VETA 4EIAA 3H3OB 1HX1A 3VEYA 4EHTA 3O6WA 4GNIA 5AQHA 4KBOA 3D2EA 4BC4A 1RDWX 3QFPA 4FL9A 1NGFA 2Q36A 2QM1A 2P9PB 5F2RA 3IFRA 1HPMA 3A5LC 4E1JA 3ZEUA 1JCGA 4QS8A 4XH5A 3GBTA 1C0GA 4WYBA 3WQTA 2D1KA 3GE1A 3KZBA 1NM1A 3QBWA 1KXPA 1T6CA 3CQXA 1NGCA 1HKCA 1HJOA 5AQFA 3ATVA 5AFUA 3HZ6A 2I7PA 3CJCA 3EO3A 1GLBG 3CJ1A 5E26A 1TUUA 3LDOA 5AQLA 1NGBA 1DGKN 5KPZA 3J8AA 2HMPA 3SK3A 3LM9A 4GY2B 4BVPA 3A5MC 3A5NC 4H0XB 4M63C 1NGGA 2H3GX 3C0BA 3VEVA 3ZEUB 3SJHA 4BRMA 1QHAA 4H5TA 2FSJA 4ISGA 5JMVA 1GLEG 4BG8A 1ZBSA 3DWLA 4BG9A 2A40A 3VEXA 4ISFA 4O8KA 1SAZA 4FOIA 4XH4A 3RSEA 4IXCA 3HBTA 2QWNA 4FWOA 1Y64A 2GTDA 3H3NO 4A62A 2IVOA 3LDQA 2W41A 4CZLA 1ATRA 2BUPA 5ADXA 1XC3A 5BN9A 5BPNA 2F9TA 5AQMA 3SMSA 2P9NA 3C7NA 2FSNA 1NWKA 1XUPO 3EZWA 3HSCA 4IWVA 3CJ9A 4EAHD 3H45C 4Y0WA 4JNEA 4BRNA 2P9UB 4WQ4A 4BRPA 3KVGA 1D4XA 1S22A 4IJNA 4I6MB 3ULEA 3BEXA 4A61A 5JLHA 4RTFD 4DHYA 1V4TA 3FFKB 3O08A 3ZETB 4CBWA 3CI5A
chains in the Genus database with same CATH superfamily
3FGUA 3ISNC 3FFIA 3OYKA 4CIFA 5EOYA 4M3RA 3THYB 3CCLN 4B9TA 4JV5K 3VEOA 2B6AA 1KC8O 1LOTB 4CF8A 4B9VA 4KTQA 2W6KA 3I33A 1EWRA 2HF3A 4CZFA 3HT3A 4DFJA 3MEGA 4PUOA 1QZ5A 4EHUA 4DV7K 3THVA 1O1WA 4CHYA 1Q81O 2YNIA 1W97L 5BRHA 5BRDA 4FXDA 4M3YA 1U49A 3W3DA 3M8SA 4DTJA 1T44A 3VQPA 1ZBLA 5AQZA 3K0SA 2YHWA 1BISA 3PX4A 3L3UA 4CZMA 3HXMA 3KKSA 4AM7A 1UAXA 4BE2A 3RMCA 2UUCK 5C2DA 4K42A 2HNDA 5A2QO 3R9PA 4BREA 4H03B 4B8CA 3NF9A 3ZSOA 1YJWN 4ELVA 3SMPA 1BCOA 4AHSA 4IG3A 4PWDA 4Z4GA 4KREA 2CGLA 1C0FA 2O8FA 4CJ5A 1R59O 1ASVA 1YI2N 4Z0UA 3PO4A 3EKUA 2XHBA 2O8DA 3F9KA 3L2UA 1TYQB 5C15A 2UUBK 1VHXA 1LWFA 1BIZA 1IKXA 1NBWA 1TKXA 1S72N 1T3VA 4C8MA 2HNYA 3EL2A 5KQ8A 3TI0A 2YNGA 4B9QA 3WXKA 5AQUA 3WXLA 4WQ4C 1M90O 3KK1A 4JKCA 3ATUA 5EXWA 2HF4A 4DMNA 4CJ3A 4WE1A 4H0OA 1WLJA 1BI4B 3SAGA 3K5MA 4CZJA 3UE5A 3AY9A 1GLFO 2YHBA 1MDUB 5CE3A 5AQSA 4BC2A 3EE8A 1GLAG 2IVNA 4MO4A 3LALA 2Z1IA 4GV6A 4I2QA 1HR0K 3HRGA 2P9UA 1XHZA 2VWKA 4IEIA 5E84A 3MN9A 3DM2A 4CJWA 1WUAA 3LZJA 4F2SA 3SV3A 2HOEA 1ZXOA 3ZETA 1KSPA 1MWMA 4CJFA 3J81O 4FJJA 2YJEA 4E7JA 4CI6A 2QKKA 1DT9A 3QERA 3WEEA 4DTXA 4CZEA 4Q0BA 5ADXH 1J54A 3OYMA 1W9HA 5LL6Z 3CM5A 4DR2K 1HKBA 5FPDA 1WBDA 3DLEA 4PKGA 5AQQA 1P8ZA 2E4LA 4E1NA 1I39A 3T69A 4FYDA 1D9FA 2Y1JA 2E1YA 3G6EN 4CZGA 2KFNA 1G15A 1GLCG 3D0PA 3EN9A 1JLAA 4DCHA 2B5JA 2X78A 3O9UA 3PX6A 1RT7A 2PZSA 1MA9B 2IOCA 1K8KB 2YI1A 5CY4A 4AHRA 1NJYA 3M6GA 3KWIA 4JI5K 3PIPL 4DQRA 3HPGA 3A0IX 2BGGA 2O8CB 2YCHA 3CPEA 4DV0K 2HHHK 2RKIA 4CW7B 4KB1A 3V9WA 2EWSA 3NVMA 1N32K 3CCUN 1JLBA 3AA3A 3O1WA 1A5WA 5KQDA 5SZTA 3OYIA 1JLGA 3MN5A 4DSKA 3NGIA 2FXUA 3FZHA 4E0DA 4LF4K 4DG1A 3KK7A 3O3FA 4QAGA 4NYFA 2R7YA 3G0ZA 2VCPA 4IKFA 2HSTA 3LANA 2O8EA 3O5BA 3RTVA 3JYTA 3L4IA 3R3LA 4IO9L 1S1XA 3KLEA 2ZF5O 1EKEA 2Q3SA 3V9SA 2E8AA 2P9IA 2Q0RA 1E4GT 4B1YB 3QIPA 3D2FB 1D9DA 4A5AA 2P9LB 1NJZA 1MU2A 1Z6RA 4OGEA 2QK9A 1YUWA 3VQDA 2NUBA 4OPHA 4AHVA 5FDLA 4LF5K 1RTIA 1N34K 1IO2A 4CEZA 2E20A 1NMNA 3P39A 4OKKA 3IRXA 1C0UA 2OYQA 3VQCA 2KKZA 3U3GA 3A8YA 3VGMA 1GLJO 3A2FA 3BF3A 3DRPA 4CJ4A 4HTUA 4JI3K 1RT6A 4IDKA 5AZJB 2GWJA 4DTSA 4EFHA 3NMUA 3F73A 3CC4N 4F9OA 4B3OA 3D2EB 3T19A 4BDPA 3SLCA 2A5XA 4CBXA 1CZBA 3TANA 5SWMA 2YJFA 4CK2A 4CFDA 4JD2B 3CCSN 4FLXA 3LP2A 3SNNA 3CC7N 4H5RA 4RWTA 1NKCA 3T1YK 5MLCQ 1UA1A 4OLAA 2YHYA 1I94K 3VN5A 4K0KK 4LY7A 5FPNA 2QWRA 4HTLA 1RCHA 3OYGA 3DXMA 2J4RA 5GADP 1VQ8N 4JAXA 4DR7K 4BVOA 3QEXA 3EYZA 4B1VA 1OH5A 4HVJA 3RSEB 5BR9A 3C6UA 4FM2A 4PY5A 4DTOA 4DF8A 1VQ7N 1S6QA 5AZIB 1BQNA 1JXBA 4IFYA 3DMJA 4O8UA 3TAGA 3MN6A 4JRQA 1BOTO 2YHAA 4DTNA 2O8BA 1HUXA 1DEJA 3BZKA 1W2BM 5KGXA 4W5RA 5JVHL 3I56N 1QQCA 2VG7A 4ID1A 4F3OA 2ASPA 1C0TA 4A59A 2FBYA 3MDQA 4ID5A 1QQMA 3ULDA 1EP4A 2P1JA 2ZWHA 5JS2A 4LFCK 4H4OA 4CGGA 3ID6A 5C25A 3AO3A 4N76A 4LC9B 2VGMA 4CIGA 4DR4K 4BRDA 1RGIA 4M45A 3R8EA 4YHHK 4H0TB 4B9UA 3CF5L 3IDHA 4CGDA 1GLLO 4FWLA 4BC5A 2OCEA 2GELA 2P9PA 4FWQA 2Q0UA 5KGWA 4C23A 3TAQA 1HNZK 1QHTA 2PFUA 3BF1A 5KTQA 4DV1K 3NFAA 3DYAA 3OS1A 5AQHA 3OYDA 4FVUA 4K8ZA 4BC4A 5JVGL 3V9XA 2HBMA 1T7PA 1FW6A 4N41A 2VWJA 4E1JA 4N47A 5LMUK 3VQ9A 1LV5A 2UUAK 3ITHA 3GE1A 3KZBA 5HOOA 1HKCA 4C8NA 4FLVA 2QA4N 3CJCA 3EO3A 3HPOA 1JL2A 1XMQK 2O8FB 3SBTA 3VQEA 2OA8A 3SK3A 4GY2B 4JLHA 2G8FA 4KKOA 1KFSA 2XO7A 4CJQA 3ZEUB 4KV8A 1XC9A 2G8UA 4B9LA 2FSJA 5T7BA 4B9SA 4ISFA 3J7AP 3SV4A 4FOIA 1VQ6N 4FZZA 4IXCA 3TSUA 2KZZA 2QWNA 4I9LA 3CCRN 1UOCA 4KH6A 5CR4A 2PYLA 4AILC 4EZ9A 3AVGA 1S1WA 4E19A 5BPNA 2KZMA 1TVRA 2P9NA 3ZYYX 1VSFA 1XUPO 3HSCA 3M5RA 3WNEA 2B4JA 1XI1A 5E41A 4CECA 3OYFA 2IC3A 2P9UB 4WQ4A 3NBPA 1S22A 4IJNA 3DLRA 3ULEA 5HROA 4DR1K 1BQMA 3ZETB 3CI5A 3LDNA 2E5LK 3P5JA 1NU0A 1ASWA 1UWBA 3T1AA 4KI4A 5AQPA 2UXCK 1KCFA 2NRWA 1R0AA 4M7YA 3VQBA 3WNFA 4DUYK 3EY1A 4FPAA 3OY9A 2E1ZA 1RBVA 3EKSA 3RWUA 1F21A 1K6YA 4HWIA 3H6EA 4I9QA 5FRNA 1VQ4N 4RG8A 4BC3A 1LCUA 3AVMA 1NGDA 4FWSA 1WN7A 3M8QA 2EHGA 3THWB 3TTCA 4FJ7A 1RT2A 1SZ2A 3SAHA 1N5YA 2GEMA 3A5OC 2QTDA 1IKYA 3I8BA 4CJKA 1QVFM 3G10A 2E2QA 2NRTA 3ZSRA 3RRGA 1HNXK 3BY5A 2HNZA 3I0RA 3P38A 4KAZA 3SQ4A 2VGNA 2W42A 3DLKA 2O4GA 1OKJA 1IV0A 1ESVA 1N8RO 3CHWA 5KPTA 3P4IA 3ENBA 5AQOA 3LZIA 5AQRA 1ITGA 1J6ZA 3LPUA 1L3UA 4JKDA 2AA4A 4FWKA 1Q18A 3OBYA 4KTWA 3OJUA 1HJRA 1VQKN 4YOTA 4B3SK 4BRKA 4RCHA 4CJEA 3V1OA 4KH4A 3O80A 2FSKA 2OPSA 4PKIA 5B8HA 3TTDA 3OBWA 3ZT1A 1S6PA 3MX5A 5LJWA 4CZIA 1Q9YA 1BWFO 1NGEA 4I6MA 3DLHA 2PY5A 4BR0A 4JI2K 3VA3A 2BH1A 1Y97A 2ZGZA 4FJXA 3DOKA 3AVAA 3RR7A 3M8PA 3ALYA 4DR5K 3MCAB 3HP9A 4E7LA 2VWBA 1M1KO 2D0PA 4O44A 1JCEA 2DTUA 4LH5A 1IKWA 1BL3A 4M3UA 5LMNK 3PLAA 4LF8K 2G8HA 1S1TA 3CJBA 2UU9K 4JKFA 4KPYA 3HVRA 4BR4A 5AR0A 4HUGA 1E4FT 1KAXA 1V4SA 3QINA 1YJ9N 1RBRA 4BRGA 4KHQA 4DR6K 1XQSC 3DXMB 4CK3A 4BRFA 4MQ3A 4OPAA 4AHUA 1S1VA 4YDUC 5BREA 3SQ0A 4LSNA 2VQEK 3E1YA 2Q1NA 2P9KA 1GOBA 4I2PA 2YKNA 3MMVA 3HM9A 4QCLA 2DPNA 5BPLA 1YTUA 5JS1A 3OYLA 3UB5A 4E7IA 2F8TA 3UKUA 4CZKA 3HO1A 4BRCA 4CEQA 4FSVA 3AGRA 1RTDA 3DLBA 4BWJA 1NK0A 5FROA 5F0XA 3VGLA 3AO1A 1ATSA 3O4WA 3KJVA 1S5JA 4IZ9A 5EU7A 4JI4K 1J9AA 4CF1A 3DAWA 5KRSA 3ZT0A 3TSQA 1BDGA 2Z1GA 3NE6A 1JCFA 5DM7L 3R6MA 1P90A 3WT0A 4BRHA 4FLTA 5EX5A 1YITN 1JKHA 1RBTA 1DTQA 3CJAA 4AF1A 5HRPA 2HW3A 3TU5A 3ZX0A 3OVNA 1VQ5N 4QS9A 5I3UA 3HYFA 3NH0A 3LDPA 2GWKA 3E9PA 2Z1JA 4H0VB 1RBSA 2WFBA 2E2OA 3J80O 1BO5O 2W6LA 2F96A 5CHIA 3TAEA 2A1RA 1C1CA 2D0OA 4H0YB 4CFAA 4CFBA 3EE9A 4B1UB 3IUCA 1RT3A 4JN4A 3NGYA 3JSMA 1VQNN 2E88A 1WOQA 3I0SA 4DQQA 1B9FA 3OYNA 4CF0A 4JYAK 3AVLA 1RT4A 4BDYA 4CEAA 4H0PA 3AVHA 4YOWA 3H46O 5TKYA 4C8KA 1RDBA 2CGJA 4ELTA 3O9TA 2ZM6K 5EVZA 1IG8A 5KPRA 5DK5A 4CF2A 4V19S 3OW2M 4LSLA 1K8AO 3GL1A 3HJFA 3OS0A 4E3SA 1NK5A 4Z94A 3I55N 5C0YA 4CBUA 3HTVA 4FM1A 1HNVA 3H1VX 3QETA 3SZ2A 1IBMK 3K2PA 3OYHA 2D4WA 2AP1A 4CJTA 1KVAA 1VSKA 3DRSA 4KHUA 4M7XA 4B3TK 2P9NB 4WF9L 1KLMA 3NCIA 5AJ3K 1VQLN 3E01A 4EP5A 1HNWK 4BR7A 4JHDB 1SKRA 2BE2A 1Q82O 3T3FA 4B9NA 5AQYA 3QBXA 4B9MA 1NGIA 4DSIA 1YVNA 5J2PA 5JICA 3QEPA 2QWPA 3NH2A 5EY4A 3CFPA 4KFBA 3SYZA 3L0QA 4Y1CA 1Q7YO 2ZQBA 1WSGA 1U2VA 1OVQA 3VQ5A 5GINA 3EEQA 4MO5A 1JXEA 3TPQA 1VAZA 2D5RA 3MEDA 3O4QA 4W5QA 3O9SA 1QTMA 4WQ5C 3DI6A 1BU6O 4GV3A 1X9WA 3ID8A 3AA5X 3SI6A 3PSFA 4LF6K 3S9HA 1W7AA 1S9EA 3H3OB 3VEYA 2HHVA 1IG9A 1NK6A 4NCAA 1EO1A 1DLOA 3VQ7A 2Q36A 1HQEA 3G4SN 3A5LC 3GBTA 1QVGM 3MXMA 2YV0X 4ILJA 2D1KA 3TAPA 1QSLA 1KXPA 3PO5A 5AFUA 3RVCA 3HZ6A 4FJNA 3CJ1A 5AQLA 1TUUA 5KPZA 2KLAA 5CZ2A 3L2WA 5GIOA 3A5MC 1FJGK 4L8RB 5M1PA 3C0BA 3DLGA 1BHLA 2ZJRL 3BGRA 4H5TA 5M1OA 5D3GA 3AVNA 4KHPK 4E7HA 1ZBSA 3L3VA 4BG9A 1CXQA 3P1GA 4Q5VA 4JKBA 5CZ1A 4FWOA 1Y64A 4ICLA 3CMAN 4A62A 3PIOL 2IVOA 3E66A 1LW0A 4HCBA 4KHWA 4RW4A 3K5NA 2F9TA 2I5JA 3EZWA 4IWVA 3THYA 4EAHD 1WSEA 2WOMA 3H45C 3KLIA 4FZXC 3PX0A 4JNEA 3P83D 2IGIA 2E6LA 4UQGA 3AO2A 3KVGA 4Z4EA 4I6MB 4BE1A 1NJWA 1V4TA 4CBWA 4DLGA 1RT1A 2JGUA 1B92A 2OPPA 4U7BA 1EETA 1JJ2M 3CD6N 2XRIA 3O3HA 3QICA 3T1HK 4CEEA 3WXJA 1RDDA 4DTUA 3BDPA 3NVKA 2Q31A 1RNHA 3IKMA 1KTQA 4PHTX 3DXKA 2PAVA 1ZC6A 3PY8A 3CQYA 4KB0A 4O4GA 4DU4A 4CJUA 2GV9A 1TV6A 1OH6A 3WQUA 4FVMA 3V9ZA 2QEXN 4GW6A 4EP4A 5CYMA 3OS2A 3M3ZA 3QFUA 2F4VK 4NLCA 3LL3A 2HVHA 3VTIA 4YOYA 5C10A 1VQPN 5AQNA 1CLQA 2P9KB 1K9MO 1CXUA 4LFAK 4DR3K 4FK2A 2OTLN 5CYQA 1BGXT 4K41A 2HHSA 1RDCA 2VQFK 3ASMA 2CH5A 1QS4A 1LWCA 4DQSA 4L3QA 1NNEA 1ZBUA 4YDUA 4FJ5A 1C0MA 1KFDA 3F5TA 5J2QA 1QQOA 1L3SA 3KKRA 2OPQA 3WNHA 2FBXA 3O1BA 2HVIA 3ZT4A 1GOCA 2G8VA 3HM8A 1SKSA 3JS6A 4FCYA 2O8DB 5AFUH 1KAYA 1YT3A 3VF6A 2BTFA 5J2MA 1Z26A 1IJJA 3QB0A 4MLEA 2IIRA 3VERA 3CCJN 4WFBL 4FPBA 3ZCMA 3AVJA 4DKWA 3HVTA 3QEWA 4PL8A 4JI1K 1TK5A 3FZMA 3VQ8A 4FJ9A 3S41A 4XIUA 4H5WA 4M41A 3G71N 2OTJN 4Z4HA 1ZBFA 3SPZA 1J53A 1UA0A 3U9ZA 3RMDA 3NF7A 3V6DA 5TKWA 1EX4A 4X65K 1ZYQA 2IDOA 1G99A 1REVA 2WBNA 4Y1DA 1U6ZA 3LP0A 2E6MA 4IOXA 4DV5K 1H1VA 2OANA 2VG5A 4IJAA 4K25A 4O5BA 1K8KA 3UKRA 3VQ4A 4RW8A 4FW2A 4B1WB 3TSPA 2QWQA 2BDPA 2NRRA 2V52B 2O8CA 3CYMA 2F9WA 2F8SA 3DRRA 4BDZA 4FJMA 2F7TA 3L6QA 3C95A 3WEEB 5DM6L 1J5OA 1VRUA 3QDKA 1CZAN 3K58A 3AVCA 3TWHA 3KLGA 3SJJA 1RDUA 5FPMA 3NAEA 1KRPA 3AAPA 1HMVA 2KFZA 2HBJA 2RF2A 3H08A 1VQMN 4H5VA 1JLEA 4B08A 4NYNA 1YHQN 2GUPA 4FK0A 5GAGP 3K9KA 4JK7A 2HHQA 1SKWA 2OZMA 3WUHA 4U67L 1WBBA 3BZCA 4FJ8A 3AAQA 1MWKA 3G25A 4E89A 4WFNL 3AA2A 1TK0A 2P9LA 4X64K 1T8EA 2ETJA 1ATNA 2HHUA 1WSIA 3V9UA 4M42A 1VSDA 4DQPA 1TL1A 4DV2K 1NLVA 2P5OA 2ITMA 4K43A 4BR5A 2I7NA 4FWNA 4RW6A 2PBDA 5LJVA 4CCHA 4OPJA 5HRSA 3E9OA 3MEEA 1EXQA 3QEVA 4NXNK 4O55A 3KK3A 4A57A 4FJIA 4CHZA 4IEEA 4AHCA 4FJKA 2Q97A 4CEFA 2E2PA 2O8EB 1WAFA 3FR0A 4DB3A 3KK2A 3V1RA 3LAKA 4C1NK 2IAJA 2P9IB 2FLOA 1TGOA 4MDBA 1S3XA 2XY7A 3MWPA 3CM6A 4JD2A 3VMFB 2RN2A 4K8XA 1YVUA 4GVEA 2HHTA 3C94A 3T7ZA 3VF4A 1NOZA 1B9DA 4PA1A 4N56A 1KAZA 3O9QA 4KI6A 5BRFA 2PYJA 3QIOA 2OPRA 3K5LA 3UIQA 2NLXA 3CCVN 4ZTJA 4WQ5A 2Z1HA 3QNNA 3QMLA 1EQYA 3BP8A 2YHXA 4DSFA 2QWOA 2YNFA 3GG4A 1QE1A 4B8AB 5AQGA 2RHKA 2ATQA 1SQKA 4W5OA 4CHPA 4GVMA 3JAMO 4BRIA 4DQ8A 2ITGA 4W5NA 3SUPA 5AZIA 3K5OA 3HOSA 2P9SA 3CCEN 5K14A 1DTTA 2X74A 1NK9A 3PSIA 4G1QA 4GV9A 2E2NA 1Q9XA 4DFPA 1JLQA 2DFFA 4O0JA 4BR9A 2HBKA 4NO7A 4DTRA 1YIJN 3MK6A 3CCMN 5FLXO 3J7ZO 4O5FA 4OKEA 3WXMB 2P5GA 4R79A 2LSNA 4ISEA 3OHRA 3MN7A 2UYTA 3LDSA 4DTPA 3AVBA 1RFQA 1X9JA 3ZT2A 4H4MA 3HSTB 4J2EA 3U9DA 5KI6A 3KLFA 3HPHA 3P31A 2WTUA 3C6TA 3D7EO 4OGCA 4B1ZA 1D5AA 1RTJA 1LW2A 3THXA 3ENOA 3VTHA 2QW9A 4DS4A 4KHNA 2CGKA 3IAYA 4BRQA 1RDAA 5GIPA 1LWEA 2VYPA 3CETA 2O8BB 3PUFA 2W40A 4M3WA 3W0LA 1IBKK 5AQIA 3F9MA 1FXXA 3DJCA 1S9GA 1HKGA 1NKEA 2V7YA 3V81A 5ELZA 4KH5A 2X6SA 3D45A 3DXKB 4X66K 2IVPA 3KWGA 4E7KA 1FKPA 3U4LA 3TARA 4LFBK 4BGBA 3LM2A 1U48A 1KQSM 2DFEA 4CIEA 3VETA 4EIAA 1HX1A 4EHTA 3O6WA 4CEOA 4GNIA 5DMRA 4KBOA 1NJXA 3SPYA 1RDWX 3O4NA 3AGKA 4FL9A 1NGFA 1D8YA 1OVYA 2P9PB 2ZE2A 3B6PA 4KTZA 4DFMA 3SBGA 4IDHA 4OO1J 3IFRA 3AO5A 3ZEUA 1JCGA 1SL1A 3K57A 4WYBA 4OJRA 1NM1A 3QBWA 1I3AA 3CQXA 5AQFA 4DUZK 1DGKN 3OYEA 3E9LA 3J8AA 3RRHA 4OPKA 3LM9A 3NGZA 3L2RA 1BCMA 5C12A 4H0XB 4M63C 1VSMA 2H3GX 4DSLA 4M3ZA 4IG0A 4CVNE 4NCGA 1WSHA 3CMEN 1NK7A 3SJHA 4CHNA 4C8OA 4LF9K 5JMVA 1GLEG 4IFVA 4BG8A 2GUIA 3DWLA 2A40A 4LF7K 3HBTA 4FLZA 2WONA 4OVLA 3H3NO 5I42A 3LDQA 1KLNA 2W41A 3B6OA 4CJSA 1NK8A 4DS5A 1ATRA 1SS6A 2BUPA 1XC3A 5BN9A 5AQMA 3SMSA 4BY9C 4YY3K 3KLHA 3C7NA 3NHGA 1BIUA 1WB9A 4CHQA 4CEBA 3QESA 3CXCM 4BRNA 3WNGA 3C65A 4BRPA 1NJIO 4YORA 5M1QA 4DSJA 1D4XA 4YOVA 1U47A 5JLHA 1YTAA 4DHYA 3CQ8A 1VSLA 4LD0A 1NGHA 3FLCO 4BR2A 1WSFA 1XWLA 1Q8IA 2P51A 1VSHA 1LAVA 5AQTA 5J1EA 3WXIA 4JI8K 1RILA 4CJ7A 3ZSWA 4OX9K 4JKEA 4EZ6A 3ULEB 3UKRB 3OJSA 1C6VA 3THWA 4O0IA 1IBLK 1QZ6A 1EWQA 1ASUA 1NGJA 4F4KA 3K59A 3H1QA 4CEDA 3KHYA 3M1FA 2V7ZA 3AV9A 3O3GA 1ZBHA 2Y1IA 4Z4IA 3L2QA 4JS4A 2QWMA 4A5BA 4OKJA 4JEPA 4F8RA 3MCPA 5FPEA 4HUEA 1S1UA 3JXUA 1RT5A 4J2DA 2YKMA 3IS9A 3S3MA 3AA4A 1QQNA 5IT9O 4FLYA 4ZHRA 2JLEA 1N33K 4GMJB 4JKGA 1TKTA 3AVKA 3BUZB 4CD3A 3EZ5A 4BACA 2ZD1A 2Q2RA 4H5NA 4XH1A 3VA0A 2A1SA 2QWLA 1VQON 1VQ9N 4AQYK 1BA0A 1BUPA 3VQAA 2JWLA 3CPWM 4FM0A 4QS7A 3NF6A 3O9RA 2UXBK 4NXMK 3D6RA 1VRTA 1TK8A 1L3VA 4NCBA 4IOAL 4G9ZA 4ILHA 1C1AA 3Q7CA 1BG3A 3MECA 1E3MA 4DF4A 4M3XA 1SUQA 1HPZA 3IMXA 1VSJA 1TKZA 3O8MA 4DTMA 4CJVA 4JKHA 5F1XA 1RTHA 4KHYA 4AHTA 3L8BA 4FK4A 3M8RA 2O4IA 5J2NA 1SL2A 1KD1O 5AQJA 4ILGB 1GOAA 3R1XA 3F2KA 1L5UA 3SAFA 4DV4K 3SQ1A 3SUOA 2ZJPL 1RBUA 3ZX3A 3LWLA 4A2BA 1XNRK 3HI0A 1BA1A 3IG1A 3VF2A 4CFCA 4MLHA 3CERA 1WAJA 3SUQA 4JI7K 4I7FA 4XEIA 5HRNA 1W0HA 5C2FA 1T03A 4FOEA 3ZSVA 2FBTA 3CFRA 3VQ6A 3QNOA 4RW7A 2WC9A 3OTOK 4CGFA 4AM6A 4QOZB 4B3MK 3ENHA 4B3RK 1IH7A 3ZLJA 4FWRA 4UY8O 4FWMA 1X3MA 1O13A 4DU1A 2UXDK 3SUNA 1KVBA 3K9JA 3MX2A 4LH4A 4BRLA 4YOXA 3NF8A 1HLUA 3ZX2A 4Z4CA 5C24A 4CJPA 4C8LA 5HBMA 3HL8A 4N5SA 5M1NA 1Z05A 1NKBA 3FE1A 1IKVA 2P9SB 3VPZA 2KHOA 4A2AA 2G8IA 4DLEA 2CH6A 4ZTFA 4PQUA 1YJNN 4F3TA 3ZSYA 1LAWA 1JL1A 1HNIA 1N6QA 1SL0A 2NRXA 1YXQA 4CD1A 2RE2A 3LWMA 3CC2N 5M1KA 4OLBA 2QXFA 3RMAA 4FWPA 4BQZA 1FK9A 1DKGD 3MXJA 4JI0K 1VSEA 1TYQA 2G8WA 4KHSA 3KIOA 3L2VA 1CZ9A 1N36K 2X6NA 1TAUA 4IOCL 5HL7L 3V1QA 1T6DA 4FJLA 5C42A 3THXB 1YAGA 3RR8A 1HYZA 5I9EB 3UKUB 2KTQA 2XY5A 3AVIA 3CJ7A 1XNQK 1U45A 1Z25A 1TUYA 2NRHA 3KD1E 1BI4A 1L3TA 5AQKA 3MWTA 3VOVA 3OYBA 3VENA 5JLFA 4B1XB 3OYCA 1C1BA 4CJLA 3CFOA 4YNQA 4MFBA 1OH7A 2WUSA 1VSIA 1X3NA 2VG6A 3U8XA 1HRHA 5AQVA 4CZHA 3CCQN 1QSSA 1A5VA 2FF6A 2KW4A 4NB4A 3LP1A 4KO0A 4IBNA 3U3YA 4J8FA 3SCXA 2RPIA 4CHOA 4BRAA 2A6AA 5AQXA 5M1FA 4Z4FA 4FLUA 3GDQA 3FZFA 4JKAA 4HHTA 1JLCA 4FJHA 3N4QA 3OA9A 2QKBA 2XY6A 4GKJK 2ASOA 2GX9A 3U6FA 3VESA 4HUFA 1NGAA 3HOTA 4JI6K 4KRFA 2YNHA 4FO0A 1T05A 2XY8A 3ZT3A 5IWAK 5BR8K 2HMIA 3LPTA 4H8KA 4DFKA 5FRMA 2NRVA 3GOIA 3VGKA 4BROA 4YOUA 1JLFA 3CIPA 3KTQA 2OZSA 4J2AA 1X9SA 1K73O 1NG9A 2HHWA 1KVCA 1YF5L 1NK4A 2D0AA 4GKKK 3DLLL 1WSJA 3HP6A 3VEZA 2A42A 3QO9A 4JHDA 4DU3A 3TAFA 4BQLA 1GLDG 3RMBA 4J2BA 4NLBA 4CERA 2G8KA 4CGHA 2JWKA 1HQUA 1TAQA 4CK1A 3AARA 5HLFA 4PKHA 2V51B 1ILYA 1TL3A 2D0CA 4CJRA 3AO4A 4DV6K 3C6AA 5BN8A 3C7NB 2ZGYA 1A5XA 4IFEA 3Q7BA 2A3ZA 2YX6A 4BWMA 5KRTA 2FF3B 1Q86O 3MXIA 2ASMA 3FZLA 4ELUA 4C1NI 3FZKA 2NRZA 3N4PA 3TABA 4IO8A 4BGAA 3KD5E 1QSYA 4X62K 3D2FA 1X1PA 2A41A 1FKOA 3J7YP 1HYSA 3S3OA 1NOYA 2FBVA 2DFHA 3LDLA 2NZTA 4CESA 4M3TA 5GAHP 3VEWA 5AQWA 5LY3A 2NNWA 4RW9A 4CF9A 5H1SQ 5HP1A 4PL7A 2FC0A 4YFUA 2QXLA 3B8AX 1SV5A 4FW1A 4HCCA 3ZSQA 5BPMA 2QI2A 2GBZA 5HRRA 1U2VB 3NDKA 4WFAL 5AZJA 3TTFA 1J5EK 3PV8A 3TR8A 3D2EA 3VQQA 3QFPA 2QM1A 5F2RA 3CG7A 4JKGB 3TAMA 4BE0A 1HPMA 4QS8A 1U04A 4XH5A 1C0GA 4JS5A 4MDAA 3WQTA 1T6CA 3SQ2A 1NGCA 1HJOA 3QEIA 3ATVA 4DQIA 2I7PA 3S3NA 2D0BA 2IS3A 1GLBG 3LP3A 5E26A 4AH9A 3LDOA 4W5TA 3L4QA 1NGBA 4FJGA 3AVFA 2HMPA 4CGIA 3NH1A 4BVPA 3MAQA 3OYAA 1XMOK 3A5NC 1NGGA 4DV3K 2EX3A 4WCEL 3VEVA 3LAMA 2HHXA 3OYJA 4BRMA 1QHAA 4ISGA 1ZBIA 4JK9A 3VEXA 4O8KA 1SAZA 4JK8A 4XH4A 2KQ2A 3RSEA 3V4IA 1XHXA 5GAEP 3I8DA 2GTDA 3C6HA 1U4BA 4TSXA 4CZLA 3ZSXA 3HK2A 5ADXA 4CGJA 2HB5A 4CE9A 4DWIA 2FSNA 1NWKA 1TKDA 4FLWA 3CJ9A 2AJQA 2HBLA 4Y0WA 3ZSZA 4FZYA 3DOLA 4DSEA 1VK0A 4R5PA 1OH8A 2BANA 4F2RA 3BEXA 4A61A 4RTFD 2ZJQL 4E1MA 1HYVA 1WNSA 3FFKB 3O08A 3QLHA 4JRPA 1X9MA 2DY4A 1NMDA
chains in the Genus database with same CATH topology
3FGUA 1NGHA 3FLCO 4BR2A 4U7BA 3CCLN 5EOYA 5AQPA 1JJ2M 3VEOA 3CD6N 2NRWA 5AQTA 1LOTB 3WXIA 1KC8O 3CI5A 3QICA 4M7YA 4CJ7A 3WXJA 3I33A 3NVKA 2HF3A 4FPAA 2Q31A 4JKEA 2E1ZA 4CZFA 3IKMA 1QZ5A 3UKRB 3ULEB 4EHUA 3DXKA 3EKSA 4PHTX 2PAVA 1ZC6A 1Q81O 3CQYA 1QZ6A 4HWIA 1NGJA 1W97L 5BRHA 3H6EA 5BRDA 3H1QA 3KHYA 3M1FA 2V7ZA 3W3DA 3WQUA 1T44A 1VQ4N 5AQZA 2QEXN 2QWMA 4A5BA 2YHWA 4BC3A 4JEPA 3MCPA 5FPEA 1LCUA 4CZMA 3JXUA 4AM7A 1NGDA 3M3ZA 4FWSA 3QFUA 1QQNA 5C2DA 4K42A 4NLCA 3TTCA 3LL3A 1SZ2A 3SAHA 3R9PA 4BREA 4H03B 4JKGA 3VTIA 2GEMA 3A5OC 3BUZB 4YOYA 1YJWN 2QTDA 5C10A 3I8BA 4CD3A 1VQPN 5AQNA 2Q2RA 3SMPA 1QVFM 2E2QA 4H5NA 2P9KB 1K9MO 2NRTA 4XH1A 2QWLA 1VQON 1VQ9N 1BA0A 1BUPA 2JWLA 3CPWM 2CGLA 2OTLN 1C0FA 4K41A 4QS7A 3O9RA 3P38A 2CH5A 1R59O 3D6RA 2VGNA 1YI2N 3EKUA 4G9ZA 4IOAL 1OKJA 4ILHA 4L3QA 3Q7CA 1BG3A 1ESVA 4YDUA 1TYQB 5C15A 1N8RO 3CHWA 3F5TA 5KPTA 3P4IA 3ENBA 1QQOA 5AQOA 3IMXA 5AQRA 1J6ZA 1NBWA 1S72N 3O1BA 3O8MA 1T3VA 5F1XA 4JKHA 4JKDA 2AA4A 3EL2A 5KQ8A 1KD1O 3HM8A 5AQJA 4ILGB 4FWKA 1Q18A 3OBYA 3JS6A 4B9QA 3R1XA 3F2KA 5AQUA 4WQ4C 3WXLA 3WXKA 3SAFA 1M90O 4JKCA 3ATUA 5EXWA 2HF4A 1KAYA 5AFUH 2ZJPL 1VQ6N 3VF6A 4H0OA 1VQKN 2BTFA 4YOTA 3SAGA 4CZJA 3ZX3A 3UE5A 3AY9A 4A2BA 4BRKA 1GLFO 1IJJA 3QB0A 1MDUB 4MLEA 2IIRA 4RCHA 3VERA 3CCJN 3HI0A 1BA1A 3O80A 4KH4A 5CE3A 4WFBL 2FSKA 5AQSA 4FPBA 3VF2A 4BC2A 4DKWA 4MLHA 3EE8A 1GLAG 2IVNA 4PKIA 5B8HA 4MO4A 3TTDA 3CERA 4PL8A 3OBWA 3FZMA 4GV6A 3MX5A 3HRGA 2P9UA 4H5WA 3S41A 4CZIA 5LJWA 3G71N 2OTJN 1BWFO 4XEIA 1NGEA 3U9ZA 4I6MA 4IEIA 5E84A 3MN9A 1WUAA 5TKWA 2HOEA 1ZXOA 1G99A 3ZETA 2BH1A 2WBNA 1MWMA 2ZGZA 4FOEA 4BR0A 5C2FA 1U6ZA 4IOXA 2YJEA 4CI6A 2WC9A 1DT9A 3MCAB 1H1VA 3WEEA 4AM6A 2OANA 4CZEA 5ADXH 3ENHA 1M1KO 2VWBA 2D0PA 4FWRA 4IJAA 4UY8O 4K25A 1JCEA 1K8KA 3UKRA 4B1WB 1HKBA 4FWMA 1X3MA 3TSPA 5FPDA 2QWQA 1O13A 3PLAA 3K9JA 3MX2A 4PKGA 1P8ZA 5AQQA 4BRLA 2NRRA 2V52B 3CJBA 4YOXA 3T69A 4JKFA 1HLUA 3ZX2A 2F9WA 2E1YA 3G6EN 4CZGA 1GLCG 2F7TA 3L6QA 3EN9A 4BR4A 5AR0A 4DCHA 3WEEB 1E4FT 1KAXA 3O9UA 5M1NA 1Z05A 5DM6L 1V4SA 3QDKA 1CZAN 3FE1A 1MA9B 1YJ9N 2YI1A 1K8KB 2P9SB 1RDUA 3VPZA 4BRGA 1XQSC 3DXMB 5FPMA 2KHOA 4A2AA 4BRFA 4OPAA 2CH6A 3AAPA 3KWIA 3M6GA 4YDUC 5BREA 2HBJA 3PIPL 1YJNN 3A0IX 3E1YA 2Q1NA 1VQMN 2P9KA 2YCHA 3CPEA 3MMVA 4H5VA 2NRXA 2DPNA 1YXQA 4CD1A 1YHQN 5BPLA 2GUPA 2RE2A 3CC2N 2EWSA 3NVMA 3CCUN 5M1KA 5GAGP 3K9KA 4JK7A 3UB5A 3LDNA 3UKUA 3O1WA 5KQDA 4CZKA 4FWPA 3MN5A 4BRCA 4BQZA 4FSVA 1DKGD 3AGRA 3WUHA 2FXUA 3FZHA 4U67L 3KK7A 3AAQA 1TYQA 1MWKA 3G25A 5F0XA 4WFNL 2P9LA 3VGLA 2VCPA 4IOCL 1ATNA 1ATSA 2HSTA 3O4WA 5HL7L 1T6DA 3O5BA 4IZ9A 1NLVA 1YAGA 3L4IA 2ITMA 5I9EB 3UKUB 3R3LA 3DAWA 4K43A 3CJ7A 4BR5A 4IO9L 2ZF5O 2I7NA 3TSQA 1BDGA 4FWNA 5LJVA 2PBDA 1TUYA 2E8AA 2NRHA 2P9IA 1JCFA 5DM7L 2Q0RA 1E4GT 4B1YB 3E9OA 3D2FB 3R6MA 1P90A 4A5AA 5AQKA 2P9LB 4A57A 3MWTA 4IEEA 3VOVA 3WT0A 1Z6RA 3VENA 4BRHA 5JLFA 2Q97A 4B1XB 2E2PA 5EX5A 1YITN 1YUWA 3FR0A 2WUSA 1X3NA 4OPHA 4AF1A 3CJAA 3U8XA 4DB3A 2E20A 3P39A 5AQVA 4C1NK 4CZHA 2P9IB 3TU5A 3CCQN 2FLOA 2FF6A 2KKZA 4MDBA 3ZX0A 3A8YA 3VGMA 1VQ5N 1GLJO 1S3XA 3BF3A 4NB4A 3MWPA 4JD2A 4QS9A 3VMFB 3LDPA 2GWKA 3E9PA 4J8FA 4GVEA 5AZJB 4H0VB 2GWJA 2WFBA 2E2OA 4BRAA 3T7ZA 3VF4A 2A6AA 1BO5O 5AQXA 4EFHA 3NMUA 5M1FA 1KAZA 3O9QA 5BRFA 5CHIA 3GDQA 3FZFA 4JKAA 3CC4N 2D0OA 2NLXA 4H0YB 4F9OA 3CCVN 3N4QA 3OA9A 3D2EB 4WQ5A 3SLCA 2A5XA 3EE9A 4CBXA 2ASOA 4B1UB 2GX9A 3IUCA 3QMLA 1EQYA 4JN4A 3BP8A 3VESA 1NGAA 3HOTA 2YJFA 1VQNN 2YHXA 4JD2B 2E88A 1WOQA 2QWOA 3GG4A 4FO0A 3CCSN 3CC7N 5AQGA 4H5RA 2RHKA 4H0PA 1SQKA 4RWTA 5MLCQ 4YOWA 3H46O 2YHYA 5TKYA 2NRVA 4BRIA 3GOIA 3VGKA 2CGJA 4DQ8A 5FPNA 4YOUA 4BROA 3CIPA 5AZIA 2QWRA 4HTLA 3HOSA 2P9SA 3O9TA 1K73O 5EVZA 3CCEN 3DXMA 1IG8A 5KPRA 2J4RA 1YF5L 5GADP 3OW2M 2E2NA 1VQ8N 4GV9A 3DLLL 1K8AO 3GL1A 4JAXA 4BVOA 4Z94A 3VEZA 4B1VA 4BR9A 3I55N 2A42A 4JHDA 2HBKA 4NO7A 3RSEB 4BQLA 1YIJN 1GLDG 5BR9A 5C0YA 4CBUA 4NLBA 3HTVA 3MK6A 3CCMN 3J7ZO 2JWKA 1VQ7N 4O5FA 3H1VX 3WXMB 5AZIB 3AARA 4R79A 4ISEA 4PKHA 4O8UA 2D4WA 2AP1A 3MN7A 3MN6A 1BOTO 2V51B 3OHRA 1ILYA 2UYTA 1RFQA 1HUXA 1X9JA 4M7XA 1DEJA 3C6AA 1W2BM 2P9NB 5BN8A 4WF9L 3C7NB 2ZGYA 5JVHL 3U9DA 1VQLN 4IFEA 3P31A 3I56N 4BR7A 4JHDB 3Q7BA 3D7EO 4B1ZA 2A3ZA 1Q82O 5AQYA 2YX6A 3ENOA 3QBXA 1NGIA 3VTHA 2ASPA 2FF3B 2QW9A 1Q86O 1YVNA 2ASMA 2CGKA 3FZLA 3MDQA 3FZKA 2NRZA 1QQMA 3N4PA 4IO8A 4A59A 4BGAA 4BRQA 4C1NI 5JICA 2VYPA 5GIPA 3CETA 2ZWHA 2QWPA 5EY4A 3L0QA 1Q7YO 3D2FA 3ID6A 2W40A 2A41A 3W0LA 4LC9B 1U2VA 2VGMA 4BRDA 1RGIA 5AQIA 3F9MA 3DJCA 3R8EA 3LDLA 5GINA 2NZTA 4H0TB 1HKGA 3CF5L 3IDHA 2V7YA 4MO5A 5GAHP 1GLLO 5AQWA 3VEWA 5LY3A 3TPQA 1VAZA 5ELZA 4KH5A 2NNWA 5H1SQ 4FWLA 3O9SA 4PL7A 3DXKB 4BC5A 4WQ5C 2QXLA 2GELA 3B8AX 2IVPA 2P9PA 1BU6O 4FWQA 3KWGA 5BPMA 4GV3A 2QI2A 3U4LA 4BGBA 3ID8A 2Q0UA 4C23A 1U2VB 3LM2A 4WFAL 5AZJA 2PFUA 3BF1A 3TTFA 1KQSM 3VETA 4EIAA 3H3OB 1HX1A 3VEYA 4EHTA 3O6WA 4GNIA 5AQHA 4FVUA 4KBOA 3D2EA 1EO1A 4BC4A 5JVGL 1RDWX 3QFPA 3AGKA 4FL9A 1NGFA 2Q36A 2QM1A 1OVYA 2HBMA 2P9PB 5F2RA 3SBGA 4JKGB 4IDHA 3G4SN 3IFRA 4OO1J 1HPMA 3A5LC 4E1JA 3ZEUA 1JCGA 4QS8A 4XH5A 3GBTA 1QVGM 1C0GA 4MDAA 4WYBA 4ILJA 3WQTA 2D1KA 3GE1A 3KZBA 1NM1A 3QBWA 1KXPA 1T6CA 5HOOA 3CQXA 1NGCA 1HKCA 1HJOA 5AQFA 3ATVA 3RVCA 3HZ6A 5AFUA 2QA4N 2I7PA 3CJCA 3EO3A 1GLBG 3CJ1A 5E26A 1TUUA 3LDOA 5AQLA 3L4QA 1NGBA 1DGKN 5KPZA 2KLAA 3E9LA 2HMPA 3J8AA 3SBTA 3SK3A 5GIOA 3LM9A 4GY2B 4BVPA 3A5MC 5C12A 3A5NC 4H0XB 4M63C 1NGGA 2H3GX 5M1PA 3C0BA 4WCEL 3VEVA 3CMEN 3ZEUB 3SJHA 4BRMA 2ZJRL 1QHAA 4H5TA 2FSJA 4ISGA 5M1OA 5JMVA 4JK9A 1GLEG 4BG8A 1ZBSA 3DWLA 4BG9A 2A40A 3VEXA 4ISFA 4O8KA 1SAZA 4FOIA 4JK8A 4XH4A 4JKBA 4IXCA 3RSEA 3HBTA 3TSUA 2QWNA 4FWOA 5GAEP 1Y64A 3CCRN 3CMAN 2GTDA 3H3NO 4A62A 3PIOL 3C6HA 2IVOA 3E66A 3LDQA 2W41A 4KH6A 5CR4A 4CZLA 1ATRA 1SS6A 2BUPA 5ADXA 1XC3A 5BN9A 5BPNA 2F9TA 5AQMA 3SMSA 4BY9C 2P9NA 3C7NA 3ZYYX 2FSNA 1NWKA 1XUPO 3EZWA 3HSCA 4IWVA 3CJ9A 3M5RA 4EAHD 2HBLA 3H45C 4Y0WA 4JNEA 3CXCM 4BRNA 2P9UB 3C65A 4WQ4A 4BRPA 1NJIO 4YORA 5M1QA 3KVGA 1D4XA 1S22A 4IJNA 4I6MB 3ULEA 3BEXA 4A61A 4YOVA 5JLHA 4RTFD 4DHYA 2ZJQL 1V4TA 3FFKB 3O08A 3ZETB 4CBWA 1NMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGU A;  1NGH A;  3FLC O;  4BR2 A;  5EOY A;  5AQP A;  3VEO A;  5AQT A;  1LOT B;  3WXI A;  3QIC A;  4M7Y A;  4CJ7 A;  3WXJ A;  3I33 A;  2HF3 A;  4FPA A;  2Q31 A;  2E1Z A;  4CZF A;  1QZ5 A;  3UKR B;  3ULE B;  4EHU A;  3DXK A;  3EKS A;  2PAV A;  1ZC6 A;  3CQY A;  1QZ6 A;  4HWI A;  1NGJ A;  5BRH A;  3H6E A;  5BRD A;  3H1Q A;  3KHY A;  3M1F A;  2V7Z A;  3W3D A;  3WQU A;  1T44 A;  5AQZ A;  2QWM A;  2YHW A;  4BC3 A;  3MCP A;  5FPE A;  1LCU A;  4CZM A;  3JXU A;  4AM7 A;  1NGD A;  3M3Z A;  4FWS A;  3QFU A;  1QQN A;  4K42 A;  3LL3 A;  1SZ2 A;  3R9P A;  4BRE A;  4H03 B;  2GEM A;  3A5O C;  3BUZ B;  3I8B A;  4CD3 A;  5AQN A;  2Q2R A;  3SMP A;  2E2Q A;  4H5N A;  2P9K B;  4XH1 A;  2QWL A;  1BA0 A;  1BUP A;  2CGL A;  1C0F A;  4K41 A;  4QS7 A;  2CH5 A;  1R59 O;  3EKU A;  1OKJ A;  4L3Q A;  1BG3 A;  1ESV A;  4YDU A;  1TYQ B;  3CHW A;  5KPT A;  3P4I A;  1QQO A;  5AQO A;  3IMX A;  5AQR A;  1J6Z A;  1NBW A;  3O1B A;  3O8M A;  5F1X A;  2AA4 A;  3EL2 A;  5KQ8 A;  3HM8 A;  5AQJ A;  4FWK A;  1Q18 A;  3JS6 A;  4B9Q A;  3WXK A;  5AQU A;  3WXL A;  4WQ4 C;  3ATU A;  5EXW A;  2HF4 A;  1KAY A;  5AFU H;  3VF6 A;  4H0O A;  2BTF A;  4CZJ A;  3ZX3 A;  3UE5 A;  3AY9 A;  4A2B A;  4BRK A;  1GLF O;  1IJJ A;  3QB0 A;  1MDU B;  4MLE A;  2IIR A;  4RCH A;  3VER A;  3HI0 A;  1BA1 A;  3O80 A;  5CE3 A;  2FSK A;  5AQS A;  4FPB A;  3VF2 A;  4BC2 A;  4MLH A;  1GLA G;  2IVN A;  4PKI A;  5B8H A;  4MO4 A;  3CER A;  4PL8 A;  3FZM A;  3S41 A;  2P9U A;  4H5W A;  4CZI A;  5LJW A;  1BWF O;  4XEI A;  1NGE A;  3U9Z A;  4I6M A;  5E84 A;  3MN9 A;  1WUA A;  2HOE A;  1ZXO A;  1G99 A;  3ZET A;  4BR0 A;  2ZGZ A;  1MWM A;  4FOE A;  1U6Z A;  2YJE A;  4CI6 A;  1H1V A;  3WEE A;  4AM6 A;  2OAN A;  4CZE A;  5ADX H;  3ENH A;  2VWB A;  2D0P A;  4FWR A;  4IJA A;  4K25 A;  1JCE A;  1K8K A;  3UKR A;  4B1W B;  1HKB A;  4FWM A;  1X3M A;  5FPD A;  2QWQ A;  4PKG A;  5AQQ A;  4BRL A;  1P8Z A;  2V52 B;  3CJB A;  1HLU A;  3ZX2 A;  2F9W A;  2E1Y A;  4CZG A;  1GLC G;  4BR4 A;  3L6Q A;  3EN9 A;  5AR0 A;  4DCH A;  3WEE B;  1E4F T;  1KAX A;  1Z05 A;  1V4S A;  3QDK A;  1CZA N;  3FE1 A;  1MA9 B;  2YI1 A;  1K8K B;  2P9S B;  3VPZ A;  4BRG A;  1XQS C;  3DXM B;  5FPM A;  2KHO A;  4A2A A;  4BRF A;  2CH6 A;  3AAP A;  3M6G A;  4YDU C;  5BRE A;  3A0I X;  2Q1N A;  2P9K A;  2YCH A;  3MMV A;  4H5V A;  2DPN A;  1YXQ A;  4CD1 A;  5BPL A;  2GUP A;  2EWS A;  3UB5 A;  3LDN A;  3UKU A;  3O1W A;  5KQD A;  4CZK A;  4FWP A;  3MN5 A;  4BRC A;  4BQZ A;  4FSV A;  1DKG D;  3WUH A;  2FXU A;  3FZH A;  3AAQ A;  1TYQ A;  1MWK A;  3G25 A;  5F0X A;  2P9L A;  3VGL A;  2VCP A;  1ATN A;  1ATS A;  3O4W A;  1T6D A;  3O5B A;  4IZ9 A;  1NLV A;  1YAG A;  3L4I A;  2ITM A;  5I9E B;  3UKU B;  3DAW A;  4K43 A;  3CJ7 A;  4BR5 A;  2ZF5 O;  2I7N A;  1BDG A;  4FWN A;  5LJV A;  2PBD A;  1TUY A;  2E8A A;  2NRH A;  2P9I A;  1JCF A;  2Q0R A;  1E4G T;  4B1Y B;  3D2F B;  3R6M A;  5AQK A;  2P9L B;  3VOV A;  3WT0 A;  1Z6R A;  3VEN A;  4BRH A;  5JLF A;  2Q97 A;  4B1X B;  2E2P A;  5EX5 A;  1YUW A;  3FR0 A;  2WUS A;  1X3N A;  3CJA A;  3U8X A;  4DB3 A;  2E20 A;  5AQV A;  4CZH A;  2P9I B;  3TU5 A;  2FLO A;  2FF6 A;  3ZX0 A;  3A8Y A;  3VGM A;  1GLJ O;  1S3X A;  3BF3 A;  4NB4 A;  4JD2 A;  4QS9 A;  3LDP A;  2GWK A;  4J8F A;  5AZJ B;  4H0V B;  2GWJ A;  2E2O A;  4BRA A;  4EFH A;  3VF4 A;  2A6A A;  1BO5 O;  5AQX A;  1KAZ A;  5BRF A;  3GDQ A;  3FZF A;  2D0O A;  2NLX A;  4H0Y B;  4F9O A;  3D2E B;  4WQ5 A;  3SLC A;  2A5X A;  4CBX A;  2ASO A;  4B1U B;  3IUC A;  3QML A;  1EQY A;  4JN4 A;  3BP8 A;  3VES A;  1NGA A;  2YJF A;  2YHX A;  4JD2 B;  2E88 A;  1WOQ A;  2QWO A;  3GG4 A;  4FO0 A;  5AQG A;  4H5R A;  4H0P A;  1SQK A;  4RWT A;  3H46 O;  2YHY A;  5TKY A;  4BRI A;  3GOI A;  3VGK A;  2CGJ A;  4DQ8 A;  5FPN A;  4BRO A;  3CIP A;  5AZI A;  2QWR A;  4HTL A;  2P9S A;  5EVZ A;  3DXM A;  1IG8 A;  5KPR A;  2J4R A;  2E2N A;  3GL1 A;  4JAX A;  4BVO A;  4Z94 A;  3VEZ A;  4B1V A;  4BR9 A;  2A42 A;  4JHD A;  4NO7 A;  3RSE B;  4BQL A;  1GLD G;  5BR9 A;  4CBU A;  3HTV A;  3MK6 A;  4O5F A;  3H1V X;  5AZI B;  3AAR A;  4ISE A;  4PKH A;  2D4W A;  2AP1 A;  3MN7 A;  3MN6 A;  1BOT O;  2V51 B;  3OHR A;  2UYT A;  1RFQ A;  1HUX A;  1X9J A;  4M7X A;  1DEJ A;  2P9N B;  5BN8 A;  3C7N B;  2ZGY A;  3U9D A;  4BR7 A;  4JHD B;  3D7E O;  4B1Z A;  2A3Z A;  5AQY A;  3QBX A;  3ENO A;  1NGI A;  2ASP A;  2FF3 B;  2QW9 A;  1YVN A;  2ASM A;  2CGK A;  3FZL A;  3MDQ A;  3FZK A;  5JIC A;  1QQM A;  4BRQ A;  4IO8 A;  4BGA A;  2VYP A;  3CET A;  2ZWH A;  2QWP A;  5EY4 A;  3L0Q A;  3D2F A;  2W40 A;  2A41 A;  1NMD A;  3W0L A;  4LC9 B;  1U2V A;  4BRD A;  1RGI A;  5AQI A;  3F9M A;  3DJC A;  3R8E A;  3LDL A;  2NZT A;  4H0T B;  1HKG A;  3IDH A;  2V7Y A;  4MO5 A;  1GLL O;  5AQW A;  3VEW A;  5LY3 A;  3TPQ A;  5ELZ A;  4FWL A;  4PL7 A;  3DXK B;  4BC5 A;  4WQ5 C;  2QXL A;  2GEL A;  3B8A X;  2IVP A;  2P9P A;  1BU6 O;  4FWQ A;  5BPM A;  3U4L A;  4BGB A;  3ID8 A;  2Q0U A;  4C23 A;  1U2V B;  3LM2 A;  5AZJ A;  3BF1 A;  3VET A;  4EIA A;  3H3O B;  1HX1 A;  3VEY A;  4EHT A;  3O6W A;  4GNI A;  5AQH A;  4KBO A;  3D2E A;  4BC4 A;  1RDW X;  3QFP A;  4FL9 A;  1NGF A;  2Q36 A;  2QM1 A;  2P9P B;  5F2R A;  3IFR A;  1HPM A;  3A5L C;  4E1J A;  3ZEU A;  1JCG A;  4QS8 A;  4XH5 A;  3GBT A;  1C0G A;  4WYB A;  3WQT A;  2D1K A;  3GE1 A;  3KZB A;  1NM1 A;  3QBW A;  1KXP A;  1T6C A;  3CQX A;  1NGC A;  1HKC A;  1HJO A;  5AQF A;  3ATV A;  5AFU A;  3HZ6 A;  2I7P A;  3CJC A;  3EO3 A;  1GLB G;  3CJ1 A;  5E26 A;  1TUU A;  3LDO A;  5AQL A;  1NGB A;  1DGK N;  5KPZ A;  3J8A A;  2HMP A;  3SK3 A;  3LM9 A;  4GY2 B;  4BVP A;  3A5M C;  3A5N C;  4H0X B;  4M63 C;  1NGG A;  2H3G X;  3C0B A;  3VEV A;  3ZEU B;  3SJH A;  4BRM A;  1QHA A;  4H5T A;  2FSJ A;  4ISG A;  5JMV A;  1GLE G;  4BG8 A;  1ZBS A;  3DWL A;  4BG9 A;  2A40 A;  3VEX A;  4ISF A;  4O8K A;  1SAZ A;  4FOI A;  4XH4 A;  3RSE A;  4IXC A;  3HBT A;  2QWN A;  4FWO A;  1Y64 A;  2GTD A;  3H3N O;  4A62 A;  2IVO A;  3LDQ A;  2W41 A;  4CZL A;  1ATR A;  2BUP A;  5ADX A;  1XC3 A;  5BN9 A;  5BPN A;  2F9T A;  5AQM A;  3SMS A;  2P9N A;  3C7N A;  2FSN A;  1NWK A;  1XUP O;  3EZW A;  3HSC A;  4IWV A;  3CJ9 A;  4EAH D;  3H45 C;  4Y0W A;  4JNE A;  4BRN A;  2P9U B;  4WQ4 A;  4BRP A;  3KVG A;  1D4X A;  1S22 A;  4IJN A;  4I6M B;  3ULE A;  3BEX A;  4A61 A;  5JLH A;  4RTF D;  4DHY A;  1V4T A;  3FFK B;  3O08 A;  3ZET B;  4CBW A;  3CI5 A; 
#chains in the Genus database with same CATH topology
 3FGU A;  3ISN C;  3FFI A;  3OYK A;  4CIF A;  5EOY A;  4M3R A;  3THY B;  3CCL N;  4B9T A;  4JV5 K;  3VEO A;  2B6A A;  1KC8 O;  1LOT B;  4CF8 A;  4B9V A;  4KTQ A;  2W6K A;  3I33 A;  1EWR A;  2HF3 A;  4CZF A;  3HT3 A;  4DFJ A;  3MEG A;  4PUO A;  1QZ5 A;  4EHU A;  4DV7 K;  3THV A;  1O1W A;  4CHY A;  1Q81 O;  2YNI A;  1W97 L;  5BRH A;  5BRD A;  4FXD A;  4M3Y A;  1U49 A;  3W3D A;  3M8S A;  4DTJ A;  1T44 A;  3VQP A;  1ZBL A;  5AQZ A;  3K0S A;  2YHW A;  1BIS A;  3PX4 A;  3L3U A;  4CZM A;  3HXM A;  3KKS A;  4AM7 A;  1UAX A;  4BE2 A;  3RMC A;  2UUC K;  5C2D A;  4K42 A;  2HND A;  5A2Q O;  3R9P A;  4BRE A;  4H03 B;  4B8C A;  3NF9 A;  3ZSO A;  1YJW N;  4ELV A;  3SMP A;  1BCO A;  4AHS A;  4IG3 A;  4PWD A;  4Z4G A;  4KRE A;  2CGL A;  1C0F A;  2O8F A;  4CJ5 A;  1R59 O;  1ASV A;  1YI2 N;  4Z0U A;  3PO4 A;  3EKU A;  2XHB A;  2O8D A;  3F9K A;  3L2U A;  1TYQ B;  5C15 A;  2UUB K;  1VHX A;  1LWF A;  1BIZ A;  1IKX A;  1NBW A;  1TKX A;  1S72 N;  1T3V A;  4C8M A;  2HNY A;  3EL2 A;  5KQ8 A;  3TI0 A;  2YNG A;  4B9Q A;  3WXK A;  5AQU A;  3WXL A;  4WQ4 C;  1M90 O;  3KK1 A;  4JKC A;  3ATU A;  5EXW A;  2HF4 A;  4DMN A;  4CJ3 A;  4WE1 A;  4H0O A;  1WLJ A;  1BI4 B;  3SAG A;  3K5M A;  4CZJ A;  3UE5 A;  3AY9 A;  1GLF O;  2YHB A;  1MDU B;  5CE3 A;  5AQS A;  4BC2 A;  3EE8 A;  1GLA G;  2IVN A;  4MO4 A;  3LAL A;  2Z1I A;  4GV6 A;  4I2Q A;  1HR0 K;  3HRG A;  2P9U A;  1XHZ A;  2VWK A;  4IEI A;  5E84 A;  3MN9 A;  3DM2 A;  4CJW A;  1WUA A;  3LZJ A;  4F2S A;  3SV3 A;  2HOE A;  1ZXO A;  3ZET A;  1KSP A;  1MWM A;  4CJF A;  3J81 O;  4FJJ A;  2YJE A;  4E7J A;  4CI6 A;  2QKK A;  1DT9 A;  3QER A;  3WEE A;  4DTX A;  4CZE A;  4Q0B A;  5ADX H;  1J54 A;  3OYM A;  1W9H A;  5LL6 Z;  3CM5 A;  4DR2 K;  1HKB A;  5FPD A;  1WBD A;  3DLE A;  4PKG A;  5AQQ A;  1P8Z A;  2E4L A;  4E1N A;  1I39 A;  3T69 A;  4FYD A;  1D9F A;  2Y1J A;  2E1Y A;  3G6E N;  4CZG A;  2KFN A;  1G15 A;  1GLC G;  3D0P A;  3EN9 A;  1JLA A;  4DCH A;  2B5J A;  2X78 A;  3O9U A;  3PX6 A;  1RT7 A;  2PZS A;  1MA9 B;  2IOC A;  1K8K B;  2YI1 A;  5CY4 A;  4AHR A;  1NJY A;  3M6G A;  3KWI A;  4JI5 K;  3PIP L;  4DQR A;  3HPG A;  3A0I X;  2BGG A;  2O8C B;  2YCH A;  3CPE A;  4DV0 K;  2HHH K;  2RKI A;  4CW7 B;  4KB1 A;  3V9W A;  2EWS A;  3NVM A;  1N32 K;  3CCU N;  1JLB A;  3AA3 A;  3O1W A;  1A5W A;  5KQD A;  5SZT A;  3OYI A;  1JLG A;  3MN5 A;  4DSK A;  3NGI A;  2FXU A;  3FZH A;  4E0D A;  4LF4 K;  4DG1 A;  3KK7 A;  3O3F A;  4QAG A;  4NYF A;  2R7Y A;  3G0Z A;  2VCP A;  4IKF A;  2HST A;  3LAN A;  2O8E A;  3O5B A;  3RTV A;  3JYT A;  3L4I A;  3R3L A;  4IO9 L;  1S1X A;  3KLE A;  2ZF5 O;  1EKE A;  2Q3S A;  3V9S A;  2E8A A;  2P9I A;  2Q0R A;  1E4G T;  4B1Y B;  3QIP A;  3D2F B;  1D9D A;  4A5A A;  2P9L B;  1NJZ A;  1MU2 A;  1Z6R A;  4OGE A;  2QK9 A;  1YUW A;  3VQD A;  2NUB A;  4OPH A;  4AHV A;  5FDL A;  4LF5 K;  1RTI A;  1N34 K;  1IO2 A;  4CEZ A;  2E20 A;  1NMN A;  3P39 A;  4OKK A;  3IRX A;  1C0U A;  2OYQ A;  3VQC A;  2KKZ A;  3U3G A;  3A8Y A;  3VGM A;  1GLJ O;  3A2F A;  3BF3 A;  3DRP A;  4CJ4 A;  4HTU A;  4JI3 K;  1RT6 A;  4IDK A;  5AZJ B;  2GWJ A;  4DTS A;  4EFH A;  3NMU A;  3F73 A;  3CC4 N;  4F9O A;  4B3O A;  3D2E B;  3T19 A;  4BDP A;  3SLC A;  2A5X A;  4CBX A;  1CZB A;  3TAN A;  5SWM A;  2YJF A;  4CK2 A;  4CFD A;  4JD2 B;  3CCS N;  4FLX A;  3LP2 A;  3SNN A;  3CC7 N;  4H5R A;  4RWT A;  1NKC A;  3T1Y K;  5MLC Q;  1UA1 A;  4OLA A;  2YHY A;  1I94 K;  3VN5 A;  4K0K K;  4LY7 A;  5FPN A;  2QWR A;  4HTL A;  1RCH A;  3OYG A;  3DXM A;  2J4R A;  5GAD P;  1VQ8 N;  4JAX A;  4DR7 K;  4BVO A;  3QEX A;  3EYZ A;  4B1V A;  1OH5 A;  4HVJ A;  3RSE B;  5BR9 A;  3C6U A;  4FM2 A;  4PY5 A;  4DTO A;  4DF8 A;  1VQ7 N;  1S6Q A;  5AZI B;  1BQN A;  1JXB A;  4IFY A;  3DMJ A;  4O8U A;  3TAG A;  3MN6 A;  4JRQ A;  1BOT O;  2YHA A;  4DTN A;  2O8B A;  1HUX A;  1DEJ A;  3BZK A;  1W2B M;  5KGX A;  4W5R A;  5JVH L;  3I56 N;  1QQC A;  2VG7 A;  4ID1 A;  4F3O A;  2ASP A;  1C0T A;  4A59 A;  2FBY A;  3MDQ A;  4ID5 A;  1QQM A;  3ULD A;  1EP4 A;  2P1J A;  2ZWH A;  5JS2 A;  4LFC K;  4H4O A;  4CGG A;  3ID6 A;  5C25 A;  3AO3 A;  4N76 A;  4LC9 B;  2VGM A;  4CIG A;  4DR4 K;  4BRD A;  1RGI A;  4M45 A;  3R8E A;  4YHH K;  4H0T B;  4B9U A;  3CF5 L;  3IDH A;  4CGD A;  1GLL O;  4FWL A;  4BC5 A;  2OCE A;  2GEL A;  2P9P A;  4FWQ A;  2Q0U A;  5KGW A;  4C23 A;  3TAQ A;  1HNZ K;  1QHT A;  2PFU A;  3BF1 A;  5KTQ A;  4DV1 K;  3NFA A;  3DYA A;  3OS1 A;  5AQH A;  3OYD A;  4FVU A;  4K8Z A;  4BC4 A;  5JVG L;  3V9X A;  2HBM A;  1T7P A;  1FW6 A;  4N41 A;  2VWJ A;  4E1J A;  4N47 A;  5LMU K;  3VQ9 A;  1LV5 A;  2UUA K;  3ITH A;  3GE1 A;  3KZB A;  5HOO A;  1HKC A;  4C8N A;  4FLV A;  2QA4 N;  3CJC A;  3EO3 A;  3HPO A;  1JL2 A;  1XMQ K;  2O8F B;  3SBT A;  3VQE A;  2OA8 A;  3SK3 A;  4GY2 B;  4JLH A;  2G8F A;  4KKO A;  1KFS A;  2XO7 A;  4CJQ A;  3ZEU B;  4KV8 A;  1XC9 A;  2G8U A;  4B9L A;  2FSJ A;  5T7B A;  4B9S A;  4ISF A;  3J7A P;  3SV4 A;  4FOI A;  1VQ6 N;  4FZZ A;  4IXC A;  3TSU A;  2KZZ A;  2QWN A;  4I9L A;  3CCR N;  1UOC A;  4KH6 A;  5CR4 A;  2PYL A;  4AIL C;  4EZ9 A;  3AVG A;  1S1W A;  4E19 A;  5BPN A;  2KZM A;  1TVR A;  2P9N A;  3ZYY X;  1VSF A;  1XUP O;  3HSC A;  3M5R A;  3WNE A;  2B4J A;  1XI1 A;  5E41 A;  4CEC A;  3OYF A;  2IC3 A;  2P9U B;  4WQ4 A;  3NBP A;  1S22 A;  4IJN A;  3DLR A;  3ULE A;  5HRO A;  4DR1 K;  1BQM A;  3ZET B;  3CI5 A;  3LDN A;  2E5L K;  3P5J A;  1NU0 A;  1ASW A;  1UWB A;  3T1A A;  4KI4 A;  5AQP A;  2UXC K;  1KCF A;  2NRW A;  1R0A A;  4M7Y A;  3VQB A;  3WNF A;  4DUY K;  3EY1 A;  4FPA A;  3OY9 A;  2E1Z A;  1RBV A;  3EKS A;  3RWU A;  1F21 A;  1K6Y A;  4HWI A;  3H6E A;  4I9Q A;  5FRN A;  1VQ4 N;  4RG8 A;  4BC3 A;  1LCU A;  3AVM A;  1NGD A;  4FWS A;  1WN7 A;  3M8Q A;  2EHG A;  3THW B;  3TTC A;  4FJ7 A;  1RT2 A;  1SZ2 A;  3SAH A;  1N5Y A;  2GEM A;  3A5O C;  2QTD A;  1IKY A;  3I8B A;  4CJK A;  1QVF M;  3G10 A;  2E2Q A;  2NRT A;  3ZSR A;  3RRG A;  1HNX K;  3BY5 A;  2HNZ A;  3I0R A;  3P38 A;  4KAZ A;  3SQ4 A;  2VGN A;  2W42 A;  3DLK A;  2O4G A;  1OKJ A;  1IV0 A;  1ESV A;  1N8R O;  3CHW A;  5KPT A;  3P4I A;  3ENB A;  5AQO A;  3LZI A;  5AQR A;  1ITG A;  1J6Z A;  3LPU A;  1L3U A;  4JKD A;  2AA4 A;  4FWK A;  1Q18 A;  3OBY A;  4KTW A;  3OJU A;  1HJR A;  1VQK N;  4YOT A;  4B3S K;  4BRK A;  4RCH A;  4CJE A;  3V1O A;  4KH4 A;  3O80 A;  2FSK A;  2OPS A;  4PKI A;  5B8H A;  3TTD A;  3OBW A;  3ZT1 A;  1S6P A;  3MX5 A;  5LJW A;  4CZI A;  1Q9Y A;  1BWF O;  1NGE A;  4I6M A;  3DLH A;  2PY5 A;  4BR0 A;  4JI2 K;  3VA3 A;  2BH1 A;  1Y97 A;  2ZGZ A;  4FJX A;  3DOK A;  3AVA A;  3RR7 A;  3M8P A;  3ALY A;  4DR5 K;  3MCA B;  3HP9 A;  4E7L A;  2VWB A;  1M1K O;  2D0P A;  4O44 A;  1JCE A;  2DTU A;  4LH5 A;  1IKW A;  1BL3 A;  4M3U A;  5LMN K;  3PLA A;  4LF8 K;  2G8H A;  1S1T A;  3CJB A;  2UU9 K;  4JKF A;  4KPY A;  3HVR A;  4BR4 A;  5AR0 A;  4HUG A;  1E4F T;  1KAX A;  1V4S A;  3QIN A;  1YJ9 N;  1RBR A;  4BRG A;  4KHQ A;  4DR6 K;  1XQS C;  3DXM B;  4CK3 A;  4BRF A;  4MQ3 A;  4OPA A;  4AHU A;  1S1V A;  4YDU C;  5BRE A;  3SQ0 A;  4LSN A;  2VQE K;  3E1Y A;  2Q1N A;  2P9K A;  1GOB A;  4I2P A;  2YKN A;  3MMV A;  3HM9 A;  4QCL A;  2DPN A;  5BPL A;  1YTU A;  5JS1 A;  3OYL A;  3UB5 A;  4E7I A;  2F8T A;  3UKU A;  4CZK A;  3HO1 A;  4BRC A;  4CEQ A;  4FSV A;  3AGR A;  1RTD A;  3DLB A;  4BWJ A;  1NK0 A;  5FRO A;  5F0X A;  3VGL A;  3AO1 A;  1ATS A;  3O4W A;  3KJV A;  1S5J A;  4IZ9 A;  5EU7 A;  4JI4 K;  1J9A A;  4CF1 A;  3DAW A;  5KRS A;  3ZT0 A;  3TSQ A;  1BDG A;  2Z1G A;  3NE6 A;  1JCF A;  5DM7 L;  3R6M A;  1P90 A;  3WT0 A;  4BRH A;  4FLT A;  5EX5 A;  1YIT N;  1JKH A;  1RBT A;  1DTQ A;  3CJA A;  4AF1 A;  5HRP A;  2HW3 A;  3TU5 A;  3ZX0 A;  3OVN A;  1VQ5 N;  4QS9 A;  5I3U A;  3HYF A;  3NH0 A;  3LDP A;  2GWK A;  3E9P A;  2Z1J A;  4H0V B;  1RBS A;  2WFB A;  2E2O A;  3J80 O;  1BO5 O;  2W6L A;  2F96 A;  5CHI A;  3TAE A;  2A1R A;  1C1C A;  2D0O A;  4H0Y B;  4CFA A;  4CFB A;  3EE9 A;  4B1U B;  3IUC A;  1RT3 A;  4JN4 A;  3NGY A;  3JSM A;  1VQN N;  2E88 A;  1WOQ A;  3I0S A;  4DQQ A;  1B9F A;  3OYN A;  4CF0 A;  4JYA K;  3AVL A;  1RT4 A;  4BDY A;  4CEA A;  4H0P A;  3AVH A;  4YOW A;  3H46 O;  5TKY A;  4C8K A;  1RDB A;  2CGJ A;  4ELT A;  3O9T A;  2ZM6 K;  5EVZ A;  1IG8 A;  5KPR A;  5DK5 A;  4CF2 A;  4V19 S;  3OW2 M;  4LSL A;  1K8A O;  3GL1 A;  3HJF A;  3OS0 A;  4E3S A;  1NK5 A;  4Z94 A;  3I55 N;  5C0Y A;  4CBU A;  3HTV A;  4FM1 A;  1HNV A;  3H1V X;  3QET A;  3SZ2 A;  1IBM K;  3K2P A;  3OYH A;  2D4W A;  2AP1 A;  4CJT A;  1KVA A;  1VSK A;  3DRS A;  4KHU A;  4M7X A;  4B3T K;  2P9N B;  4WF9 L;  1KLM A;  3NCI A;  5AJ3 K;  1VQL N;  3E01 A;  4EP5 A;  1HNW K;  4BR7 A;  4JHD B;  1SKR A;  2BE2 A;  1Q82 O;  3T3F A;  4B9N A;  5AQY A;  3QBX A;  4B9M A;  1NGI A;  4DSI A;  1YVN A;  5J2P A;  5JIC A;  3QEP A;  2QWP A;  3NH2 A;  5EY4 A;  3CFP A;  4KFB A;  3SYZ A;  3L0Q A;  4Y1C A;  1Q7Y O;  2ZQB A;  1WSG A;  1U2V A;  1OVQ A;  3VQ5 A;  5GIN A;  3EEQ A;  4MO5 A;  1JXE A;  3TPQ A;  1VAZ A;  2D5R A;  3MED A;  3O4Q A;  4W5Q A;  3O9S A;  1QTM A;  4WQ5 C;  3DI6 A;  1BU6 O;  4GV3 A;  1X9W A;  3ID8 A;  3AA5 X;  3SI6 A;  3PSF A;  4LF6 K;  3S9H A;  1W7A A;  1S9E A;  3H3O B;  3VEY A;  2HHV A;  1IG9 A;  1NK6 A;  4NCA A;  1EO1 A;  1DLO A;  3VQ7 A;  2Q36 A;  1HQE A;  3G4S N;  3A5L C;  3GBT A;  1QVG M;  3MXM A;  2YV0 X;  4ILJ A;  2D1K A;  3TAP A;  1QSL A;  1KXP A;  3PO5 A;  5AFU A;  3RVC A;  3HZ6 A;  4FJN A;  3CJ1 A;  5AQL A;  1TUU A;  5KPZ A;  2KLA A;  5CZ2 A;  3L2W A;  5GIO A;  3A5M C;  1FJG K;  4L8R B;  5M1P A;  3C0B A;  3DLG A;  1BHL A;  2ZJR L;  3BGR A;  4H5T A;  5M1O A;  5D3G A;  3AVN A;  4KHP K;  4E7H A;  1ZBS A;  3L3V A;  4BG9 A;  1CXQ A;  3P1G A;  4Q5V A;  4JKB A;  5CZ1 A;  4FWO A;  1Y64 A;  4ICL A;  3CMA N;  4A62 A;  3PIO L;  2IVO A;  3E66 A;  1LW0 A;  4HCB A;  4KHW A;  4RW4 A;  3K5N A;  2F9T A;  2I5J A;  3EZW A;  4IWV A;  3THY A;  4EAH D;  1WSE A;  2WOM A;  3H45 C;  3KLI A;  4FZX C;  3PX0 A;  4JNE A;  3P83 D;  2IGI A;  2E6L A;  4UQG A;  3AO2 A;  3KVG A;  4Z4E A;  4I6M B;  4BE1 A;  1NJW A;  1V4T A;  4CBW A;  4DLG A;  1RT1 A;  2JGU A;  1B92 A;  2OPP A;  4U7B A;  1EET A;  1JJ2 M;  3CD6 N;  2XRI A;  3O3H A;  3QIC A;  3T1H K;  4CEE A;  3WXJ A;  1RDD A;  4DTU A;  3BDP A;  3NVK A;  2Q31 A;  1RNH A;  3IKM A;  1KTQ A;  4PHT X;  3DXK A;  2PAV A;  1ZC6 A;  3PY8 A;  3CQY A;  4KB0 A;  4O4G A;  4DU4 A;  4CJU A;  2GV9 A;  1TV6 A;  1OH6 A;  3WQU A;  4FVM A;  3V9Z A;  2QEX N;  4GW6 A;  4EP4 A;  5CYM A;  3OS2 A;  3M3Z A;  3QFU A;  2F4V K;  4NLC A;  3LL3 A;  2HVH A;  3VTI A;  4YOY A;  5C10 A;  1VQP N;  5AQN A;  1CLQ A;  2P9K B;  1K9M O;  1CXU A;  4LFA K;  4DR3 K;  4FK2 A;  2OTL N;  5CYQ A;  1BGX T;  4K41 A;  2HHS A;  1RDC A;  2VQF K;  3ASM A;  2CH5 A;  1QS4 A;  1LWC A;  4DQS A;  4L3Q A;  1NNE A;  1ZBU A;  4YDU A;  4FJ5 A;  1C0M A;  1KFD A;  3F5T A;  5J2Q A;  1QQO A;  1L3S A;  3KKR A;  2OPQ A;  3WNH A;  2FBX A;  3O1B A;  2HVI A;  3ZT4 A;  1GOC A;  2G8V A;  3HM8 A;  1SKS A;  3JS6 A;  4FCY A;  2O8D B;  5AFU H;  1KAY A;  1YT3 A;  3VF6 A;  2BTF A;  5J2M A;  1Z26 A;  1IJJ A;  3QB0 A;  4MLE A;  2IIR A;  3VER A;  3CCJ N;  4WFB L;  4FPB A;  3ZCM A;  3AVJ A;  4DKW A;  3HVT A;  3QEW A;  4PL8 A;  4JI1 K;  1TK5 A;  3FZM A;  3VQ8 A;  4FJ9 A;  3S41 A;  4XIU A;  4H5W A;  4M41 A;  3G71 N;  2OTJ N;  4Z4H A;  1ZBF A;  3SPZ A;  1J53 A;  1UA0 A;  3U9Z A;  3RMD A;  3NF7 A;  3V6D A;  5TKW A;  1EX4 A;  4X65 K;  1ZYQ A;  2IDO A;  1G99 A;  1REV A;  2WBN A;  4Y1D A;  1U6Z A;  3LP0 A;  2E6M A;  4IOX A;  4DV5 K;  1H1V A;  2OAN A;  2VG5 A;  4IJA A;  4K25 A;  4O5B A;  1K8K A;  3UKR A;  3VQ4 A;  4RW8 A;  4FW2 A;  4B1W B;  3TSP A;  2QWQ A;  2BDP A;  2NRR A;  2V52 B;  2O8C A;  3CYM A;  2F9W A;  2F8S A;  3DRR A;  4BDZ A;  4FJM A;  2F7T A;  3L6Q A;  3C95 A;  3WEE B;  5DM6 L;  1J5O A;  1VRU A;  3QDK A;  1CZA N;  3K58 A;  3AVC A;  3TWH A;  3KLG A;  3SJJ A;  1RDU A;  5FPM A;  3NAE A;  1KRP A;  3AAP A;  1HMV A;  2KFZ A;  2HBJ A;  2RF2 A;  3H08 A;  1VQM N;  4H5V A;  1JLE A;  4B08 A;  4NYN A;  1YHQ N;  2GUP A;  4FK0 A;  5GAG P;  3K9K A;  4JK7 A;  2HHQ A;  1SKW A;  2OZM A;  3WUH A;  4U67 L;  1WBB A;  3BZC A;  4FJ8 A;  3AAQ A;  1MWK A;  3G25 A;  4E89 A;  4WFN L;  3AA2 A;  1TK0 A;  2P9L A;  4X64 K;  1T8E A;  2ETJ A;  1ATN A;  2HHU A;  1WSI A;  3V9U A;  4M42 A;  1VSD A;  4DQP A;  1TL1 A;  4DV2 K;  1NLV A;  2P5O A;  2ITM A;  4K43 A;  4BR5 A;  2I7N A;  4FWN A;  4RW6 A;  2PBD A;  5LJV A;  4CCH A;  4OPJ A;  5HRS A;  3E9O A;  3MEE A;  1EXQ A;  3QEV A;  4NXN K;  4O55 A;  3KK3 A;  4A57 A;  4FJI A;  4CHZ A;  4IEE A;  4AHC A;  4FJK A;  2Q97 A;  4CEF A;  2E2P A;  2O8E B;  1WAF A;  3FR0 A;  4DB3 A;  3KK2 A;  3V1R A;  3LAK A;  4C1N K;  2IAJ A;  2P9I B;  2FLO A;  1TGO A;  4MDB A;  1S3X A;  2XY7 A;  3MWP A;  3CM6 A;  4JD2 A;  3VMF B;  2RN2 A;  4K8X A;  1YVU A;  4GVE A;  2HHT A;  3C94 A;  3T7Z A;  3VF4 A;  1NOZ A;  1B9D A;  4PA1 A;  4N56 A;  1KAZ A;  3O9Q A;  4KI6 A;  5BRF A;  2PYJ A;  3QIO A;  2OPR A;  3K5L A;  3UIQ A;  2NLX A;  3CCV N;  4ZTJ A;  4WQ5 A;  2Z1H A;  3QNN A;  3QML A;  1EQY A;  3BP8 A;  2YHX A;  4DSF A;  2QWO A;  2YNF A;  3GG4 A;  1QE1 A;  4B8A B;  5AQG A;  2RHK A;  2ATQ A;  1SQK A;  4W5O A;  4CHP A;  4GVM A;  3JAM O;  4BRI A;  4DQ8 A;  2ITG A;  4W5N A;  3SUP A;  5AZI A;  3K5O A;  3HOS A;  2P9S A;  3CCE N;  5K14 A;  1DTT A;  2X74 A;  1NK9 A;  3PSI A;  4G1Q A;  4GV9 A;  2E2N A;  1Q9X A;  4DFP A;  1JLQ A;  2DFF A;  4O0J A;  4BR9 A;  2HBK A;  4NO7 A;  4DTR A;  1YIJ N;  3MK6 A;  3CCM N;  5FLX O;  3J7Z O;  4O5F A;  4OKE A;  3WXM B;  2P5G A;  4R79 A;  2LSN A;  4ISE A;  3OHR A;  3MN7 A;  2UYT A;  3LDS A;  4DTP A;  3AVB A;  1RFQ A;  1X9J A;  3ZT2 A;  4H4M A;  3HST B;  4J2E A;  3U9D A;  5KI6 A;  3KLF A;  3HPH A;  3P31 A;  2WTU A;  3C6T A;  3D7E O;  4OGC A;  4B1Z A;  1D5A A;  1RTJ A;  1LW2 A;  3THX A;  3ENO A;  3VTH A;  2QW9 A;  4DS4 A;  4KHN A;  2CGK A;  3IAY A;  4BRQ A;  1RDA A;  5GIP A;  1LWE A;  2VYP A;  3CET A;  2O8B B;  3PUF A;  2W40 A;  4M3W A;  3W0L A;  1IBK K;  5AQI A;  3F9M A;  1FXX A;  3DJC A;  1S9G A;  1HKG A;  1NKE A;  2V7Y A;  3V81 A;  5ELZ A;  4KH5 A;  2X6S A;  3D45 A;  3DXK B;  4X66 K;  2IVP A;  3KWG A;  4E7K A;  1FKP A;  3U4L A;  3TAR A;  4LFB K;  4BGB A;  3LM2 A;  1U48 A;  1KQS M;  2DFE A;  4CIE A;  3VET A;  4EIA A;  1HX1 A;  4EHT A;  3O6W A;  4CEO A;  4GNI A;  5DMR A;  4KBO A;  1NJX A;  3SPY A;  1RDW X;  3O4N A;  3AGK A;  4FL9 A;  1NGF A;  1D8Y A;  1OVY A;  2P9P B;  2ZE2 A;  3B6P A;  4KTZ A;  4DFM A;  3SBG A;  4IDH A;  4OO1 J;  3IFR A;  3AO5 A;  3ZEU A;  1JCG A;  1SL1 A;  3K57 A;  4WYB A;  4OJR A;  1NM1 A;  3QBW A;  1I3A A;  3CQX A;  5AQF A;  4DUZ K;  1DGK N;  3OYE A;  3E9L A;  3J8A A;  3RRH A;  4OPK A;  3LM9 A;  3NGZ A;  3L2R A;  1BCM A;  5C12 A;  4H0X B;  4M63 C;  1VSM A;  2H3G X;  4DSL A;  4M3Z A;  4IG0 A;  4CVN E;  4NCG A;  1WSH A;  3CME N;  1NK7 A;  3SJH A;  4CHN A;  4C8O A;  4LF9 K;  5JMV A;  1GLE G;  4IFV A;  4BG8 A;  2GUI A;  3DWL A;  2A40 A;  4LF7 K;  3HBT A;  4FLZ A;  2WON A;  4OVL A;  3H3N O;  5I42 A;  3LDQ A;  1KLN A;  2W41 A;  3B6O A;  4CJS A;  1NK8 A;  4DS5 A;  1ATR A;  1SS6 A;  2BUP A;  1XC3 A;  5BN9 A;  5AQM A;  3SMS A;  4BY9 C;  4YY3 K;  3KLH A;  3C7N A;  3NHG A;  1BIU A;  1WB9 A;  4CHQ A;  4CEB A;  3QES A;  3CXC M;  4BRN A;  3WNG A;  3C65 A;  4BRP A;  1NJI O;  4YOR A;  5M1Q A;  4DSJ A;  1D4X A;  4YOV A;  1U47 A;  5JLH A;  1YTA A;  4DHY A;  3CQ8 A;  1VSL A;  4LD0 A;  1NGH A;  3FLC O;  4BR2 A;  1WSF A;  1XWL A;  1Q8I A;  2P51 A;  1VSH A;  1LAV A;  5AQT A;  5J1E A;  3WXI A;  4JI8 K;  1RIL A;  4CJ7 A;  3ZSW A;  4OX9 K;  4JKE A;  4EZ6 A;  3ULE B;  3UKR B;  3OJS A;  1C6V A;  3THW A;  4O0I A;  1IBL K;  1QZ6 A;  1EWQ A;  1ASU A;  1NGJ A;  4F4K A;  3K59 A;  3H1Q A;  4CED A;  3KHY A;  3M1F A;  2V7Z A;  3AV9 A;  3O3G A;  1ZBH A;  2Y1I A;  4Z4I A;  3L2Q A;  4JS4 A;  2QWM A;  4A5B A;  4OKJ A;  4JEP A;  4F8R A;  3MCP A;  5FPE A;  4HUE A;  1S1U A;  3JXU A;  1RT5 A;  4J2D A;  2YKM A;  3IS9 A;  3S3M A;  3AA4 A;  1QQN A;  5IT9 O;  4FLY A;  4ZHR A;  2JLE A;  1N33 K;  4GMJ B;  4JKG A;  1TKT A;  3AVK A;  3BUZ B;  4CD3 A;  3EZ5 A;  4BAC A;  2ZD1 A;  2Q2R A;  4H5N A;  4XH1 A;  3VA0 A;  2A1S A;  2QWL A;  1VQO N;  1VQ9 N;  4AQY K;  1BA0 A;  1BUP A;  3VQA A;  2JWL A;  3CPW M;  4FM0 A;  4QS7 A;  3NF6 A;  3O9R A;  2UXB K;  4NXM K;  3D6R A;  1VRT A;  1TK8 A;  1L3V A;  4NCB A;  4IOA L;  4G9Z A;  4ILH A;  1C1A A;  3Q7C A;  1BG3 A;  3MEC A;  1E3M A;  4DF4 A;  4M3X A;  1SUQ A;  1HPZ A;  3IMX A;  1VSJ A;  1TKZ A;  3O8M A;  4DTM A;  4CJV A;  4JKH A;  5F1X A;  1RTH A;  4KHY A;  4AHT A;  3L8B A;  4FK4 A;  3M8R A;  2O4I A;  5J2N A;  1SL2 A;  1KD1 O;  5AQJ A;  4ILG B;  1GOA A;  3R1X A;  3F2K A;  1L5U A;  3SAF A;  4DV4 K;  3SQ1 A;  3SUO A;  2ZJP L;  1RBU A;  3ZX3 A;  3LWL A;  4A2B A;  1XNR K;  3HI0 A;  1BA1 A;  3IG1 A;  3VF2 A;  4CFC A;  4MLH A;  3CER A;  1WAJ A;  3SUQ A;  4JI7 K;  4I7F A;  4XEI A;  5HRN A;  1W0H A;  5C2F A;  1T03 A;  4FOE A;  3ZSV A;  2FBT A;  3CFR A;  3VQ6 A;  3QNO A;  4RW7 A;  2WC9 A;  3OTO K;  4CGF A;  4AM6 A;  4QOZ B;  4B3M K;  3ENH A;  4B3R K;  1IH7 A;  3ZLJ A;  4FWR A;  4UY8 O;  4FWM A;  1X3M A;  1O13 A;  4DU1 A;  2UXD K;  3SUN A;  1KVB A;  3K9J A;  3MX2 A;  4LH4 A;  4BRL A;  4YOX A;  3NF8 A;  1HLU A;  3ZX2 A;  4Z4C A;  5C24 A;  4CJP A;  4C8L A;  5HBM A;  3HL8 A;  4N5S A;  5M1N A;  1Z05 A;  1NKB A;  3FE1 A;  1IKV A;  2P9S B;  3VPZ A;  2KHO A;  4A2A A;  2G8I A;  4DLE A;  2CH6 A;  4ZTF A;  4PQU A;  1YJN N;  4F3T A;  3ZSY A;  1LAW A;  1JL1 A;  1HNI A;  1N6Q A;  1SL0 A;  2NRX A;  1YXQ A;  4CD1 A;  2RE2 A;  3LWM A;  3CC2 N;  5M1K A;  4OLB A;  2QXF A;  3RMA A;  4FWP A;  4BQZ A;  1FK9 A;  1DKG D;  3MXJ A;  4JI0 K;  1VSE A;  1TYQ A;  2G8W A;  4KHS A;  3KIO A;  3L2V A;  1CZ9 A;  1N36 K;  2X6N A;  1TAU A;  4IOC L;  5HL7 L;  3V1Q A;  1T6D A;  4FJL A;  5C42 A;  3THX B;  1YAG A;  3RR8 A;  1HYZ A;  5I9E B;  3UKU B;  2KTQ A;  2XY5 A;  3AVI A;  3CJ7 A;  1XNQ K;  1U45 A;  1Z25 A;  1TUY A;  2NRH A;  3KD1 E;  1BI4 A;  1L3T A;  5AQK A;  3MWT A;  3VOV A;  3OYB A;  3VEN A;  5JLF A;  4B1X B;  3OYC A;  1C1B A;  4CJL A;  3CFO A;  4YNQ A;  4MFB A;  1OH7 A;  2WUS A;  1VSI A;  1X3N A;  2VG6 A;  3U8X A;  1HRH A;  5AQV A;  4CZH A;  3CCQ N;  1QSS A;  1A5V A;  2FF6 A;  2KW4 A;  4NB4 A;  3LP1 A;  4KO0 A;  4IBN A;  3U3Y A;  4J8F A;  3SCX A;  2RPI A;  4CHO A;  4BRA A;  2A6A A;  5AQX A;  5M1F A;  4Z4F A;  4FLU A;  3GDQ A;  3FZF A;  4JKA A;  4HHT A;  1JLC A;  4FJH A;  3N4Q A;  3OA9 A;  2QKB A;  2XY6 A;  4GKJ K;  2ASO A;  2GX9 A;  3U6F A;  3VES A;  4HUF A;  1NGA A;  3HOT A;  4JI6 K;  4KRF A;  2YNH A;  4FO0 A;  1T05 A;  2XY8 A;  3ZT3 A;  5IWA K;  5BR8 K;  2HMI A;  3LPT A;  4H8K A;  4DFK A;  5FRM A;  2NRV A;  3GOI A;  3VGK A;  4BRO A;  4YOU A;  1JLF A;  3CIP A;  3KTQ A;  2OZS A;  4J2A A;  1X9S A;  1K73 O;  1NG9 A;  2HHW A;  1KVC A;  1YF5 L;  1NK4 A;  2D0A A;  4GKK K;  3DLL L;  1WSJ A;  3HP6 A;  3VEZ A;  2A42 A;  3QO9 A;  4JHD A;  4DU3 A;  3TAF A;  4BQL A;  1GLD G;  3RMB A;  4J2B A;  4NLB A;  4CER A;  2G8K A;  4CGH A;  2JWK A;  1HQU A;  1TAQ A;  4CK1 A;  3AAR A;  5HLF A;  4PKH A;  2V51 B;  1ILY A;  1TL3 A;  2D0C A;  4CJR A;  3AO4 A;  4DV6 K;  3C6A A;  5BN8 A;  3C7N B;  2ZGY A;  1A5X A;  4IFE A;  3Q7B A;  2A3Z A;  2YX6 A;  4BWM A;  5KRT A;  2FF3 B;  1Q86 O;  3MXI A;  2ASM A;  3FZL A;  4ELU A;  4C1N I;  3FZK A;  2NRZ A;  3N4P A;  3TAB A;  4IO8 A;  4BGA A;  3KD5 E;  1QSY A;  4X62 K;  3D2F A;  1X1P A;  2A41 A;  1FKO A;  3J7Y P;  1HYS A;  3S3O A;  1NOY A;  2FBV A;  2DFH A;  3LDL A;  2NZT A;  4CES A;  4M3T A;  5GAH P;  3VEW A;  5AQW A;  5LY3 A;  2NNW A;  4RW9 A;  4CF9 A;  5H1S Q;  5HP1 A;  4PL7 A;  2FC0 A;  4YFU A;  2QXL A;  3B8A X;  1SV5 A;  4FW1 A;  4HCC A;  3ZSQ A;  5BPM A;  2QI2 A;  2GBZ A;  5HRR A;  1U2V B;  3NDK A;  4WFA L;  5AZJ A;  3TTF A;  1J5E K;  3PV8 A;  3TR8 A;  3D2E A;  3VQQ A;  3QFP A;  2QM1 A;  5F2R A;  3CG7 A;  4JKG B;  3TAM A;  4BE0 A;  1HPM A;  4QS8 A;  1U04 A;  4XH5 A;  1C0G A;  4JS5 A;  4MDA A;  3WQT A;  1T6C A;  3SQ2 A;  1NGC A;  1HJO A;  3QEI A;  3ATV A;  4DQI A;  2I7P A;  3S3N A;  2D0B A;  2IS3 A;  1GLB G;  3LP3 A;  5E26 A;  4AH9 A;  3LDO A;  4W5T A;  3L4Q A;  1NGB A;  4FJG A;  3AVF A;  2HMP A;  4CGI A;  3NH1 A;  4BVP A;  3MAQ A;  3OYA A;  1XMO K;  3A5N C;  1NGG A;  4DV3 K;  2EX3 A;  4WCE L;  3VEV A;  3LAM A;  2HHX A;  3OYJ A;  4BRM A;  1QHA A;  4ISG A;  1ZBI A;  4JK9 A;  3VEX A;  4O8K A;  1SAZ A;  4JK8 A;  4XH4 A;  2KQ2 A;  3RSE A;  3V4I A;  1XHX A;  5GAE P;  3I8D A;  2GTD A;  3C6H A;  1U4B A;  4TSX A;  4CZL A;  3ZSX A;  3HK2 A;  5ADX A;  4CGJ A;  2HB5 A;  4CE9 A;  4DWI A;  2FSN A;  1NWK A;  1TKD A;  4FLW A;  3CJ9 A;  2AJQ A;  2HBL A;  4Y0W A;  3ZSZ A;  4FZY A;  3DOL A;  4DSE A;  1VK0 A;  4R5P A;  1OH8 A;  2BAN A;  4F2R A;  3BEX A;  4A61 A;  4RTF D;  2ZJQ L;  4E1M A;  1HYV A;  1WNS A;  3FFK B;  3O08 A;  3QLH A;  4JRP A;  1X9M A;  2DY4 A;  1NMD A; 
#chains in the Genus database with same CATH homology
 3FGU A;  1NGH A;  3FLC O;  4BR2 A;  4U7B A;  3CCL N;  5EOY A;  5AQP A;  1JJ2 M;  3VEO A;  3CD6 N;  2NRW A;  5AQT A;  1LOT B;  3WXI A;  1KC8 O;  3CI5 A;  3QIC A;  4M7Y A;  4CJ7 A;  3WXJ A;  3I33 A;  3NVK A;  2HF3 A;  4FPA A;  2Q31 A;  4JKE A;  2E1Z A;  4CZF A;  3IKM A;  1QZ5 A;  3UKR B;  3ULE B;  4EHU A;  3DXK A;  3EKS A;  4PHT X;  2PAV A;  1ZC6 A;  1Q81 O;  3CQY A;  1QZ6 A;  4HWI A;  1NGJ A;  1W97 L;  5BRH A;  3H6E A;  5BRD A;  3H1Q A;  3KHY A;  3M1F A;  2V7Z A;  3W3D A;  3WQU A;  1T44 A;  1VQ4 N;  5AQZ A;  2QEX N;  2QWM A;  4A5B A;  2YHW A;  4BC3 A;  4JEP A;  3MCP A;  5FPE A;  1LCU A;  4CZM A;  3JXU A;  4AM7 A;  1NGD A;  3M3Z A;  4FWS A;  3QFU A;  1QQN A;  5C2D A;  4K42 A;  4NLC A;  3TTC A;  3LL3 A;  1SZ2 A;  3SAH A;  3R9P A;  4BRE A;  4H03 B;  4JKG A;  3VTI A;  2GEM A;  3A5O C;  3BUZ B;  4YOY A;  1YJW N;  2QTD A;  5C10 A;  3I8B A;  4CD3 A;  1VQP N;  5AQN A;  2Q2R A;  3SMP A;  1QVF M;  2E2Q A;  4H5N A;  2P9K B;  1K9M O;  2NRT A;  4XH1 A;  2QWL A;  1VQO N;  1VQ9 N;  1BA0 A;  1BUP A;  2JWL A;  3CPW M;  2CGL A;  2OTL N;  1C0F A;  4K41 A;  4QS7 A;  3O9R A;  3P38 A;  2CH5 A;  1R59 O;  3D6R A;  2VGN A;  1YI2 N;  3EKU A;  4G9Z A;  4IOA L;  1OKJ A;  4ILH A;  4L3Q A;  3Q7C A;  1BG3 A;  1ESV A;  4YDU A;  1TYQ B;  5C15 A;  1N8R O;  3CHW A;  3F5T A;  5KPT A;  3P4I A;  3ENB A;  1QQO A;  5AQO A;  3IMX A;  5AQR A;  1J6Z A;  1NBW A;  1S72 N;  3O1B A;  3O8M A;  1T3V A;  5F1X A;  4JKH A;  4JKD A;  2AA4 A;  3EL2 A;  5KQ8 A;  1KD1 O;  3HM8 A;  5AQJ A;  4ILG B;  4FWK A;  1Q18 A;  3OBY A;  3JS6 A;  4B9Q A;  3R1X A;  3F2K A;  5AQU A;  4WQ4 C;  3WXL A;  3WXK A;  3SAF A;  1M90 O;  4JKC A;  3ATU A;  5EXW A;  2HF4 A;  1KAY A;  5AFU H;  2ZJP L;  1VQ6 N;  3VF6 A;  4H0O A;  1VQK N;  2BTF A;  4YOT A;  3SAG A;  4CZJ A;  3ZX3 A;  3UE5 A;  3AY9 A;  4A2B A;  4BRK A;  1GLF O;  1IJJ A;  3QB0 A;  1MDU B;  4MLE A;  2IIR A;  4RCH A;  3VER A;  3CCJ N;  3HI0 A;  1BA1 A;  3O80 A;  4KH4 A;  5CE3 A;  4WFB L;  2FSK A;  5AQS A;  4FPB A;  3VF2 A;  4BC2 A;  4DKW A;  4MLH A;  3EE8 A;  1GLA G;  2IVN A;  4PKI A;  5B8H A;  4MO4 A;  3TTD A;  3CER A;  4PL8 A;  3OBW A;  3FZM A;  4GV6 A;  3MX5 A;  3HRG A;  2P9U A;  4H5W A;  3S41 A;  4CZI A;  5LJW A;  3G71 N;  2OTJ N;  1BWF O;  4XEI A;  1NGE A;  3U9Z A;  4I6M A;  4IEI A;  5E84 A;  3MN9 A;  1WUA A;  5TKW A;  2HOE A;  1ZXO A;  1G99 A;  3ZET A;  2BH1 A;  2WBN A;  1MWM A;  2ZGZ A;  4FOE A;  4BR0 A;  5C2F A;  1U6Z A;  4IOX A;  2YJE A;  4CI6 A;  2WC9 A;  1DT9 A;  3MCA B;  1H1V A;  3WEE A;  4AM6 A;  2OAN A;  4CZE A;  5ADX H;  3ENH A;  1M1K O;  2VWB A;  2D0P A;  4FWR A;  4IJA A;  4UY8 O;  4K25 A;  1JCE A;  1K8K A;  3UKR A;  4B1W B;  1HKB A;  4FWM A;  1X3M A;  3TSP A;  5FPD A;  2QWQ A;  1O13 A;  3PLA A;  3K9J A;  3MX2 A;  4PKG A;  1P8Z A;  5AQQ A;  4BRL A;  2NRR A;  2V52 B;  3CJB A;  4YOX A;  3T69 A;  4JKF A;  1HLU A;  3ZX2 A;  2F9W A;  2E1Y A;  3G6E N;  4CZG A;  1GLC G;  2F7T A;  3L6Q A;  3EN9 A;  4BR4 A;  5AR0 A;  4DCH A;  3WEE B;  1E4F T;  1KAX A;  3O9U A;  5M1N A;  1Z05 A;  5DM6 L;  1V4S A;  3QDK A;  1CZA N;  3FE1 A;  1MA9 B;  1YJ9 N;  2YI1 A;  1K8K B;  2P9S B;  1RDU A;  3VPZ A;  4BRG A;  1XQS C;  3DXM B;  5FPM A;  2KHO A;  4A2A A;  4BRF A;  4OPA A;  2CH6 A;  3AAP A;  3KWI A;  3M6G A;  4YDU C;  5BRE A;  2HBJ A;  3PIP L;  1YJN N;  3A0I X;  3E1Y A;  2Q1N A;  1VQM N;  2P9K A;  2YCH A;  3CPE A;  3MMV A;  4H5V A;  2NRX A;  2DPN A;  1YXQ A;  4CD1 A;  1YHQ N;  5BPL A;  2GUP A;  2RE2 A;  3CC2 N;  2EWS A;  3NVM A;  3CCU N;  5M1K A;  5GAG P;  3K9K A;  4JK7 A;  3UB5 A;  3LDN A;  3UKU A;  3O1W A;  5KQD A;  4CZK A;  4FWP A;  3MN5 A;  4BRC A;  4BQZ A;  4FSV A;  1DKG D;  3AGR A;  3WUH A;  2FXU A;  3FZH A;  4U67 L;  3KK7 A;  3AAQ A;  1TYQ A;  1MWK A;  3G25 A;  5F0X A;  4WFN L;  2P9L A;  3VGL A;  2VCP A;  4IOC L;  1ATN A;  1ATS A;  2HST A;  3O4W A;  5HL7 L;  1T6D A;  3O5B A;  4IZ9 A;  1NLV A;  1YAG A;  3L4I A;  2ITM A;  5I9E B;  3UKU B;  3R3L A;  3DAW A;  4K43 A;  3CJ7 A;  4BR5 A;  4IO9 L;  2ZF5 O;  2I7N A;  3TSQ A;  1BDG A;  4FWN A;  5LJV A;  2PBD A;  1TUY A;  2E8A A;  2NRH A;  2P9I A;  1JCF A;  5DM7 L;  2Q0R A;  1E4G T;  4B1Y B;  3E9O A;  3D2F B;  3R6M A;  1P90 A;  4A5A A;  5AQK A;  2P9L B;  4A57 A;  3MWT A;  4IEE A;  3VOV A;  3WT0 A;  1Z6R A;  3VEN A;  4BRH A;  5JLF A;  2Q97 A;  4B1X B;  2E2P A;  5EX5 A;  1YIT N;  1YUW A;  3FR0 A;  2WUS A;  1X3N A;  4OPH A;  4AF1 A;  3CJA A;  3U8X A;  4DB3 A;  2E20 A;  3P39 A;  5AQV A;  4C1N K;  4CZH A;  2P9I B;  3TU5 A;  3CCQ N;  2FLO A;  2FF6 A;  2KKZ A;  4MDB A;  3ZX0 A;  3A8Y A;  3VGM A;  1VQ5 N;  1GLJ O;  1S3X A;  3BF3 A;  4NB4 A;  3MWP A;  4JD2 A;  4QS9 A;  3VMF B;  3LDP A;  2GWK A;  3E9P A;  4J8F A;  4GVE A;  5AZJ B;  4H0V B;  2GWJ A;  2WFB A;  2E2O A;  4BRA A;  3T7Z A;  3VF4 A;  2A6A A;  1BO5 O;  5AQX A;  4EFH A;  3NMU A;  5M1F A;  1KAZ A;  3O9Q A;  5BRF A;  5CHI A;  3GDQ A;  3FZF A;  4JKA A;  3CC4 N;  2D0O A;  2NLX A;  4H0Y B;  4F9O A;  3CCV N;  3N4Q A;  3OA9 A;  3D2E B;  4WQ5 A;  3SLC A;  2A5X A;  3EE9 A;  4CBX A;  2ASO A;  4B1U B;  2GX9 A;  3IUC A;  3QML A;  1EQY A;  4JN4 A;  3BP8 A;  3VES A;  1NGA A;  3HOT A;  2YJF A;  1VQN N;  2YHX A;  4JD2 B;  2E88 A;  1WOQ A;  2QWO A;  3GG4 A;  4FO0 A;  3CCS N;  3CC7 N;  5AQG A;  4H5R A;  2RHK A;  4H0P A;  1SQK A;  4RWT A;  5MLC Q;  4YOW A;  3H46 O;  2YHY A;  5TKY A;  2NRV A;  4BRI A;  3GOI A;  3VGK A;  2CGJ A;  4DQ8 A;  5FPN A;  4YOU A;  4BRO A;  3CIP A;  5AZI A;  2QWR A;  4HTL A;  3HOS A;  2P9S A;  3O9T A;  1K73 O;  5EVZ A;  3CCE N;  3DXM A;  1IG8 A;  5KPR A;  2J4R A;  1YF5 L;  5GAD P;  3OW2 M;  2E2N A;  1VQ8 N;  4GV9 A;  3DLL L;  1K8A O;  3GL1 A;  4JAX A;  4BVO A;  4Z94 A;  3VEZ A;  4B1V A;  4BR9 A;  3I55 N;  2A42 A;  4JHD A;  2HBK A;  4NO7 A;  3RSE B;  4BQL A;  1YIJ N;  1GLD G;  5BR9 A;  5C0Y A;  4CBU A;  4NLB A;  3HTV A;  3MK6 A;  3CCM N;  3J7Z O;  2JWK A;  1VQ7 N;  4O5F A;  3H1V X;  3WXM B;  5AZI B;  3AAR A;  4R79 A;  4ISE A;  4PKH A;  4O8U A;  2D4W A;  2AP1 A;  3MN7 A;  3MN6 A;  1BOT O;  2V51 B;  3OHR A;  1ILY A;  2UYT A;  1RFQ A;  1HUX A;  1X9J A;  4M7X A;  1DEJ A;  3C6A A;  1W2B M;  2P9N B;  5BN8 A;  4WF9 L;  3C7N B;  2ZGY A;  5JVH L;  3U9D A;  1VQL N;  4IFE A;  3P31 A;  3I56 N;  4BR7 A;  4JHD B;  3Q7B A;  3D7E O;  4B1Z A;  2A3Z A;  1Q82 O;  5AQY A;  2YX6 A;  3ENO A;  3QBX A;  1NGI A;  3VTH A;  2ASP A;  2FF3 B;  2QW9 A;  1Q86 O;  1YVN A;  2ASM A;  2CGK A;  3FZL A;  3MDQ A;  3FZK A;  2NRZ A;  1QQM A;  3N4P A;  4IO8 A;  4A59 A;  4BGA A;  4BRQ A;  4C1N I;  5JIC A;  2VYP A;  5GIP A;  3CET A;  2ZWH A;  2QWP A;  5EY4 A;  3L0Q A;  1Q7Y O;  3D2F A;  3ID6 A;  2W40 A;  2A41 A;  3W0L A;  4LC9 B;  1U2V A;  2VGM A;  4BRD A;  1RGI A;  5AQI A;  3F9M A;  3DJC A;  3R8E A;  3LDL A;  5GIN A;  2NZT A;  4H0T B;  1HKG A;  3CF5 L;  3IDH A;  2V7Y A;  4MO5 A;  5GAH P;  1GLL O;  5AQW A;  3VEW A;  5LY3 A;  3TPQ A;  1VAZ A;  5ELZ A;  4KH5 A;  2NNW A;  5H1S Q;  4FWL A;  3O9S A;  4PL7 A;  3DXK B;  4BC5 A;  4WQ5 C;  2QXL A;  2GEL A;  3B8A X;  2IVP A;  2P9P A;  1BU6 O;  4FWQ A;  3KWG A;  5BPM A;  4GV3 A;  2QI2 A;  3U4L A;  4BGB A;  3ID8 A;  2Q0U A;  4C23 A;  1U2V B;  3LM2 A;  4WFA L;  5AZJ A;  2PFU A;  3BF1 A;  3TTF A;  1KQS M;  3VET A;  4EIA A;  3H3O B;  1HX1 A;  3VEY A;  4EHT A;  3O6W A;  4GNI A;  5AQH A;  4FVU A;  4KBO A;  3D2E A;  1EO1 A;  4BC4 A;  5JVG L;  1RDW X;  3QFP A;  3AGK A;  4FL9 A;  1NGF A;  2Q36 A;  2QM1 A;  1OVY A;  2HBM A;  2P9P B;  5F2R A;  3SBG A;  4JKG B;  4IDH A;  3G4S N;  3IFR A;  4OO1 J;  1HPM A;  3A5L C;  4E1J A;  3ZEU A;  1JCG A;  4QS8 A;  4XH5 A;  3GBT A;  1QVG M;  1C0G A;  4MDA A;  4WYB A;  4ILJ A;  3WQT A;  2D1K A;  3GE1 A;  3KZB A;  1NM1 A;  3QBW A;  1KXP A;  1T6C A;  5HOO A;  3CQX A;  1NGC A;  1HKC A;  1HJO A;  5AQF A;  3ATV A;  3RVC A;  3HZ6 A;  5AFU A;  2QA4 N;  2I7P A;  3CJC A;  3EO3 A;  1GLB G;  3CJ1 A;  5E26 A;  1TUU A;  3LDO A;  5AQL A;  3L4Q A;  1NGB A;  1DGK N;  5KPZ A;  2KLA A;  3E9L A;  2HMP A;  3J8A A;  3SBT A;  3SK3 A;  5GIO A;  3LM9 A;  4GY2 B;  4BVP A;  3A5M C;  5C12 A;  3A5N C;  4H0X B;  4M63 C;  1NGG A;  2H3G X;  5M1P A;  3C0B A;  4WCE L;  3VEV A;  3CME N;  3ZEU B;  3SJH A;  4BRM A;  2ZJR L;  1QHA A;  4H5T A;  2FSJ A;  4ISG A;  5M1O A;  5JMV A;  4JK9 A;  1GLE G;  4BG8 A;  1ZBS A;  3DWL A;  4BG9 A;  2A40 A;  3VEX A;  4ISF A;  4O8K A;  1SAZ A;  4FOI A;  4JK8 A;  4XH4 A;  4JKB A;  4IXC A;  3RSE A;  3HBT A;  3TSU A;  2QWN A;  4FWO A;  5GAE P;  1Y64 A;  3CCR N;  3CMA N;  2GTD A;  3H3N O;  4A62 A;  3PIO L;  3C6H A;  2IVO A;  3E66 A;  3LDQ A;  2W41 A;  4KH6 A;  5CR4 A;  4CZL A;  1ATR A;  1SS6 A;  2BUP A;  5ADX A;  1XC3 A;  5BN9 A;  5BPN A;  2F9T A;  5AQM A;  3SMS A;  4BY9 C;  2P9N A;  3C7N A;  3ZYY X;  2FSN A;  1NWK A;  1XUP O;  3EZW A;  3HSC A;  4IWV A;  3CJ9 A;  3M5R A;  4EAH D;  2HBL A;  3H45 C;  4Y0W A;  4JNE A;  3CXC M;  4BRN A;  2P9U B;  3C65 A;  4WQ4 A;  4BRP A;  1NJI O;  4YOR A;  5M1Q A;  3KVG A;  1D4X A;  1S22 A;  4IJN A;  4I6M B;  3ULE A;  3BEX A;  4A61 A;  4YOV A;  5JLH A;  4RTF D;  4DHY A;  2ZJQ L;  1V4T A;  3FFK B;  3O08 A;  3ZET B;  4CBW A;  1NMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...