2CH6A

Crystal structure of human n-acetylglucosamine kinase in complex with adp and glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
343
structure length
343
Chain Sequence
AAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYL-D-GLUCOSAMINE KINASE
publication title Structures of Human N-Acetylglucosamine Kinase in Two Complexes with N-Acetylglucosamine and with Adp/Glucose: Insights Into Substrate Specificity and Regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 343
sequence length 343
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.59: N-acetylglucosamine kinase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch6A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch6A02
4C23A 2P9NB 4BRMA 3RSEB 1G99A 4B1ZA 4BRKA 3C0BA 4CZLA 5FPMA 1U2VB 3AAPA 2ZWHA 5F0XA 3BEXA 4CI6A 5AQYA 5EOYA 4HWIA 4I6MB 3ENOA 3WUHA 3MN5A 3DWLA 5AQUA 3C7NA 3GBTA 2QW9A 2E88A 2OANA 3CQXA 3VETA 3QBWA 3VF6A 2GWJA 3VENA 4BR7A 4E1JA 3SMSA 1Q18A 1OKJA 3GDQA 3O4WA 3DXKA 4CD3A 4QS9A 3LL3A 3QB0A 4FL9A 1V4TA 3IMXA 2D0PA 1WUAA 3U8XA 1R59O 4PKIA 1Y64A 2FF6A 3CI5A 4MO4A 2KHOA 3P4IA 1NMDA 1Z6RA 2FSNA 1KAYA 1WOQA 4JAXA 2F9TA 2P9SA 1ZBSA 2QXLA 2PBDA 2E2QA 3H1VX 3FR0A 3VESA 3SLCA 4FWQA 1X9JA 3JXUA 4L3QA 1QZ5A 4FWSA 1ESVA 2ASMA 5AQMA 3U9DA 5FPNA 4YDUA 4FWKA 2ZGYA 1HLUA 1GLLO 4CZMA 5ADXH 4B9QA 5AZJB 2CH6A 2IIRA 3LDQA 4WYBA 3ZEUA 4EFHA 3HSCA 5KQ8A 1LOTB 2NRHA 4H0PA 3WEEA 3WXKA 4EAHD 1MWMA 5AQNA 4FWLA 2A40A 2ZGZA 4BC4A 3EL2A 4JN4A 1U6ZA 5AQVA 3BUZB 4NB4A 3EZWA 1IJJA 4NO7A 4BVOA 4MLHA 3UKUB 2GTDA 3WXJA 1E4FT 3CERA 5AQPA 2E20A 3IFRA 2I7PA 3DAWA 4WQ5A 3VF4A 4QS8A 4CZGA 3H3OB 1X3NA 3MK6A 2P9UA 5AR0A 2HF4A 3QDKA 3A5OC 4EHUA 2W41A 5AQSA 1X3MA 2HMPA 4BRDA 2FLOA 1GLCG 4DB3A 2GELA 3LDPA 4B1XB 4CJ7A 1SAZA 4BRCA 4BR2A 3KVGA 3R6MA 3HZ6A 2P9NA 3FZHA 3ZETB 4K42A 2QWPA 3RSEA 1TYQA 3D2EB 3MN7A 2BTFA 4BR0A 1YXQA 1BA0A 4CZIA 1CZAN 1RGIA 3CETA 3H3NO 2YJFA 5BPMA 1NGHA 5E84A 1C0GA 4BR9A 5AQFA 5AQXA 4I6MA 2E1YA 3VEYA 5AZIA 2Q97A 3D7EO 2I7NA 1TUUA 3DXMA 1NGCA 2ASOA 3HM8A 2H3GX 1KAXA 3FZKA 4JNEA 3MN6A 3I33A 5EY4A 5AQKA 2IVPA 3U4LA 2YCHA 5F2RA 3CJ7A 2BUPA 3BF1A 4XH4A 3VEOA 4PL8A 4CZEA 4ISEA 3VF2A 2P9IA 2ZF5O 5AQHA 5FPDA 2E8AA 4BQZA 1H1VA 3ENHA 5BREA 1JCGA 3WQUA 3MCPA 4JD2B 3CQYA 3D2FB 5ELZA 2PAVA 3QFPA 3F9MA 2CGJA 2YI1A 3O1WA 3ULEA 1YVNA 4BREA 3ZX3A 3LDOA 2UYTA 3QFUA 1NBWA 5BRHA 3CIPA 4BVPA 5BN9A 1BUPA 2QWRA 4H5TA 2EWSA 4B1WB 4H5NA 3VPZA 4A2AA 2ASPA 2IVOA 3JS6A 2A6AA 4H5RA 3EKSA 4JHDB 4WQ4A 3LM2A 4BRIA 4IWVA 5AZJA 2V51B 1NGBA 3MN9A 4FOIA 2D0OA 5BRFA 3TPQA 4K43A 2GUPA 3O5BA 2P9LA 3W0LA 1YAGA 3ID8A 4BGBA 2AP1A 5AQWA 3CHWA 1D4XA 4FSVA 4DQ8A 3UKRA 1TUYA 4CBWA 3OHRA 4RCHA 3H46O 1HUXA 4DCHA 3ATVA 1HX1A 2CGKA 3AY9A 2E2OA 3L6QA 1YUWA 4BRQA 5KPTA 2QM1A 4WQ4C 1HKGA 2P9PB 3C7NB 3VEWA 2QWMA 5KPZA 4CZFA 3A5NC 1ZC6A 2A5XA 4BRNA 1K8KA 4H5VA 3CJAA 4BG9A 3WXLA 3VEVA 5AFUH 4AM6A 4KBOA 1IG8A 4GY2B 1V4SA 4BC2A 5BN8A 3DXKB 1NGJA 3S41A 1ATRA 4B1VA 3VEXA 3ZETA 4H0YB 1EQYA 2A41A 4O5FA 3D2EA 4YDUC 3DJCA 3O6WA 4Y0WA 4F9OA 4BRLA 5JLHA 3IUCA 1QZ6A 3M3ZA 2QWOA 4BGAA 5AQGA 3VOVA 2FSKA 3FLCO 5JMVA 3ATUA 3GG4A 4K25A 3MMVA 1LCUA 4PKHA 3KHYA 5F1XA 3LM9A 2YHYA 1HKCA 3CJ1A 5ADXA 2Q36A 1NGAA 3TU5A 3HBTA 3CJBA 4MLEA 4XH5A 1U2VA 4WQ5C 2VCPA 2Q0RA 1MDUB 2NZTA 3HTVA 3ZEUB 4FO0A 1HJOA 3GE1A 2E1ZA 3WEEB 5EXWA 1GLJO 2FXUA 2HF3A 5EX5A 1SQKA 4CBUA 4FWNA 4FPAA 2YHWA 2CH5A 3BP8A 1KAZA 3CJ9A 5I9EB 3SMPA 1BWFO 4BRPA 1SZ2A 3M1FA 4LC9B 4HTLA 2GWKA 4BG8A 1E4GT 1JCEA 3A8YA 2IVNA 5LJVA 4XEIA 1P8ZA 2W40A 2P9KB 5AQOA 3LDLA 3EKUA 1GLBG 2P9UB 1NM1A 4JHDA 4QS7A 3L0QA 3WXIA 4FWOA 2D4WA 3H45C 2E2PA 1BU6O 4BR4A 1RFQA 3FZFA 5TKYA 4H0XB 2AA4A 3QICA 4CZJA 4O8KA 1TYQB 2FSJA 4H0OA 1NGDA 4FPBA 2YJEA 1BOTO 3UE5A 5AQQA 5BR9A 3LDNA 4ISFA 2V52B 3I8BA 3U9ZA 2WUSA 1QHAA 3VERA 4BC3A 4AM7A 4BROA 1XUPO 4DHYA 4CD1A 5KPRA 4A62A 5AZIB 4BRHA 1NGEA 4FOEA 2P9PA 3DXMB 4IXCA 3MDQA 3AAQA 3GL1A 3A0IX 4CBXA 5EVZA 1QQMA 2J4RA 3FZMA 5JICA 3WQTA 3A5LC 3ZX0A 4RTFD 1QQOA 3SJHA 2Q0UA 5AQTA 2P9IB 5AQZA 1T6CA 4BRGA 3SK3A 5FPEA 3IDHA 4BC5A 1NGFA 2ITMA 5AQLA 1GLEG 2Q1NA 2Q2RA 2QWNA 3UKUA 2YHXA 3G25A 3ULEB 4H0TB 5B8HA 1T6DA 4B1YB 3AARA 3VGMA 4PKGA 3VGKA 1DKGD 4EHTA 3HI0A 1S3XA 4H5WA 1XQSC 4CZHA 3W3DA 2Q31A 4M7XA 2V7ZA 2DPNA 3J8AA 3VGLA 1KXPA 5KQDA 5JLFA 4XH1A 4A2BA 2P9SB 5BRDA 2P9LB 3FE1A 1NLVA 1BA1A 3EO3A 1NGGA 1NWKA 4BRFA 4IO8A 3GOIA 1ZXOA 3UB5A 4M7YA 3UKRB 1DGKN 2NLXA 3CJCA 4IJAA 3FZLA 2QWQA 1GLAG 5E26A 4BR5A 3R9PA 1T44A 4K41A 3O1BA 3L4IA 1GLFO 3QBXA 3VEZA 1XC3A 4B1UB 1C0FA 2P9KA 2A3ZA 3O08A 5BPNA 1Z05A 3KZBA 1GLDG 1MA9B 4JD2A 1K8KB 4MO5A 5AFUA 3D2FA 4Z94A 1BG3A 1ATSA 2F9WA 4FWRA 5LJWA 3BF3A 4FWPA 2D1KA 4A61A 1RDWX 3H1QA 5AQJA 4BQLA 1BDGA 3FFKB 3A5MC 4IJNA 3WT0A 2GEMA 3M6GA 1NGIA 2A42A 4ISGA 2QWLA 4CZKA 3O8MA 5AQIA 2E2NA 4EIAA 5BPLA 2VWBA 2CGLA 2VYPA 5LY3A 3ZX2A 2V7YA 1BO5O 4H0VB 4FWMA 1JCFA 2FF3B 1ATNA 3QMLA 4PL7A 4RWTA 3B8AX 4BRAA 4J8FA 1J6ZA 4M63C 4IZ9A 4H03B 1HKBA 1QQNA 1S22A 2HOEA 3H6EA 1MWKA 1HPMA 3FGUA 3O80A 3EN9A 1DEJA 5AQRA 4GNIA 5CE3A 3R8EA
chains in the Genus database with same CATH superfamily
1K6YA 1KTQA 1ASVA 2NRVA 4MDAA 3RSEB 1RT1A 4JI6K 3TAQA 3C0BA 3NVKA 4J2BA 3O9QA 3KWIA 4FK0A 2ZWHA 1GOAA 5F0XA 3C6UA 4CHQA 1RBUA 1ITGA 2O8EA 3VQDA 3ZSVA 4DFKA 1KLMA 3WUHA 1TKTA 5AQUA 3TSUA 3IKMA 3GBTA 4Z4CA 4FJJA 2WONA 2GWJA 3SV4A 3F73A 4CF8A 3VENA 5TKWA 4CIGA 4DV3K 4N47A 4FLZA 2I5JA 3V4IA 3OYDA 1O1WA 5JS2A 3IMXA 2DTUA 3OA9A 3H08A 3CYMA 3HYFA 4LSNA 1VSJA 3G6EN 1NK7A 3P4IA 1NMDA 3RMBA 1Z6RA 4OPJA 3F5TA 4JAXA 4CJ3A 4DG1A 4PA1A 2QXLA 1BCMA 2E2QA 1LWEA 3DYAA 3H1VX 4E3SA 5AJ3K 3L4QA 3ITHA 3SLCA 1ZBFA 4FWSA 1KFDA 1ESVA 1J5OA 3G71N 1N6QA 3U9DA 2W6KA 4YDUA 1UWBA 1L3VA 1TL1A 1GLLO 1OVQA 5ADXH 4JK7A 1SKSA 2P51A 5AZJB 1KC8O 3DRSA 4N76A 2CH6A 4WYBA 1GOBA 3ZEUA 4QAGA 3AVBA 2NRHA 4K8XA 1HJRA 3WXKA 4KI6A 1MWMA 2PYLA 4FWLA 3VN5A 3EL2A 3VA0A 4LY7A 3L3UA 3EZWA 1EWQA 3UKUB 1RT5A 2B4JA 3C95A 4DQPA 3CERA 3DAWA 4Z4IA 4I2PA 4QCLA 2OCEA 1ZBHA 4J2AA 5AR0A 1VQ5N 3TAGA 4CJUA 4EHUA 2YNIA 1Q86O 5HL7L 4AHSA 2HMPA 4KRFA 3CCSN 4BRCA 4NLBA 3KVGA 3R6MA 2P9NA 5MLCQ 3CCEN 1U49A 1YXQA 2G8WA 1BA0A 1CZAN 1RGIA 3CETA 3H3NO 5BPMA 3T1HK 2QEXN 4BY9C 1NU0A 2ZE2A 3QERA 4GKKK 3BDPA 3SZ2A 1TUUA 2AJQA 3V9UA 3EYZA 3FZKA 4JNEA 3MN6A 5EY4A 3LZIA 2YCHA 3OYAA 3BF1A 3VEOA 4CIFA 1FKOA 4PL8A 4CZEA 2D0BA 5AQHA 1DTQA 5FPDA 1JLFA 4BQZA 3AO1A 4JI5K 1JCGA 3QEIA 3CQYA 2HBJA 5ELZA 3T3FA 3CM5A 4CEFA 3LWMA 4DTPA 1IBMK 4B9MA 2CGJA 2YI1A 3ZT4A 4DTMA 3O3FA 3MEDA 4PQUA 3VTHA 3O9UA 3JAMO 5HBMA 5D3GA 2UYTA 3QFUA 4C8NA 1QTMA 3BZCA 4B08A 1LW2A 5BRHA 3OBYA 2OPQA 3THWA 4M42A 4BVPA 3M8QA 4DV5K 3K5MA 2YNGA 3CD6N 3VPZA 4JHDB 4Z0UA 3NH2A 3D6RA 4IWVA 2HNYA 2F8TA 3TPQA 3O5BA 2P9LA 1YAGA 3ID8A 5AQWA 3CHWA 1K8AO 4FSVA 1T05A 1KVBA 4DCHA 5A2QO 3ATVA 1HX1A 3C6AA 1VSMA 2O8EB 4WFBL 4BRQA 5KPTA 1C0MA 2P9PB 3VEWA 2GV9A 3NVMA 3LAMA 1QE1A 1NJIO 4BRNA 4H5VA 4NYFA 4PY5A 3SUQA 4AM6A 3NGZA 1WBDA 4GY2B 3TAFA 3AVAA 3WNFA 3VEXA 3MCAB 3VQAA 5FLXO 2A41A 1Z26A 4JS4A 3HOSA 3DJCA 3DI6A 4DF8A 3C6TA 1KFSA 3SAGA 1SKWA 2QTDA 5C0YA 4G1QA 3VQQA 1Q9YA 3E9LA 3VQ7A 5JMVA 3ATUA 1B9FA 1RTHA 4B9UA 3K57A 3DM2A 3CJ1A 3PX0A 4E1MA 3ULDA 3P1GA 4U67L 2Q36A 1T3VA 1U2VA 4WQ5C 2KFNA 1N33K 3CF5L 3ZEUB 1UOCA 1HJOA 2FC0A 3THXB 4KI4A 2YHWA 4Q0BA 3RMDA 3SMPA 3TTDA 4CEAA 1SUQA 3E01A 4HTLA 1WB9A 4DV6K 4FLXA 4JS5A 4CJRA 3TTCA 4A5BA 1EX4A 1KQSM 2QK9A 3JYTA 1RILA 1NM1A 1K73O 3CC7N 4O44A 3H45C 3KIOA 2HHTA 4EP4A 1RTJA 3SI6A 2AA4A 3QICA 4AH9A 3QIOA 3NGIA 2YJEA 4DTSA 4NXNK 5BR9A 4M45A 4OO1J 4C8MA 2HHVA 2WUSA 1QHAA 4BROA 4DHYA 4CD1A 1NGEA 2IGIA 3AVKA 2A1SA 1SKRA 2UXDK 5JVHL 5EVZA 4LD0A 2J4RA 2KW4A 3FZMA 3OS0A 4CF2A 1BHLA 3WQTA 1NK8A 3SJHA 2Q0UA 5AQTA 1NK4A 5FPEA 3I0SA 2Q1NA 2QWNA 2Q2RA 4AILC 4DSEA 1W0HA 3ZSYA 5HOOA 4CF9A 1YTUA 3VA3A 4BWMA 2F96A 1FXXA 2O8CB 1RBVA 4KHWA 4IG0A 1S6QA 1NJYA 1S1VA 2KQ2A 3W3DA 4JV5K 4M7XA 2V7ZA 4IEIA 5JLFA 1W7AA 3TWHA 1Q9XA 4ELUA 2NNWA 2GBZA 2P9LB 1NLVA 3HP9A 2E6MA 1ZYQA 3EZ5A 5KGXA 1VSLA 3SJJA 3LPTA 5LL6Z 1T44A 1RBTA 3ZSRA 1IBKK 1ZBIA 1XC3A 2KLAA 2P9KA 2A3ZA 1Z05A 3KZBA 3QINA 2BE2A 5AFUA 3D2FA 4Z94A 1BG3A 1BDGA 3OYKA 5M1FA 1NOZA 2HSTA 5K14A 3O8MA 3AO3A 4AF1A 4EIAA 5CHIA 3QNNA 1N32K 4KHNA 1LAVA 2VWBA 5GADP 4H0VB 1JCFA 3QMLA 3V6DA 3R3LA 1I3AA 4J8FA 1KD1O 2HHWA 4M63C 1U48A 1NMNA 4O4GA 4YOVA 4FCYA 1HKBA 1S22A 1JLAA 1QQNA 3HPGA 4YY3K 3FGUA 2KKZA 4GNIA 4DR5K 4C23A 4BRMA 3ID6A 4F4KA 4BRKA 2X6NA 5LMNK 1U2VB 4V19S 1KCFA 2OA8A 1NJXA 3BEXA 4JI8K 4CI6A 5AQYA 4I6MB 4LF9K 4JI0K 3DWLA 4DMNA 4CESA 3C7NA 3QETA 1WSJA 4W5TA 3AO2A 4KHYA 4CJKA 3OYJA 1HQEA 1S6PA 2HHQA 4BR7A 3NDKA 3ZSWA 4E1JA 3CCUN 3GDQA 1Y97A 4CD3A 3LL3A 3QB0A 4FL9A 4PKIA 1Y64A 1WSHA 3AVCA 4O55A 4CFBA 1WNSA 3OS1A 4MO4A 3NAEA 2O8FA 1I39A 2F9TA 1ZBSA 4FJ8A 2DFEA 3OYEA 3VESA 4WCEL 3OYHA 2X74A 4OPKA 4JEPA 3PSIA 4FWQA 1X9JA 3JXUA 4DR7K 2JGUA 1QZ5A 1VQ7N 4O5BA 4RW4A 1NKBA 2ASMA 1S1TA 4LF6K 1Q81O 3QEWA 4BWJA 1S9GA 1ZBUA 3VMFB 2VGNA 1HLUA 2KZZA 3CM6A 4F2SA 4FLVA 2Q3SA 4EFHA 5KQ8A 3HSCA 1Q8IA 4DR2K 4EAHD 2XO7A 4DFJA 3AA3A 1YIJN 4KKOA 2A40A 4IG3A 2ZGZA 1YJWN 1XMQK 2QKBA 4GMJB 3D0PA 1M1KO 3I0RA 1U6ZA 5AQVA 1B92A 3CXCM 3BUZB 3MXIA 3O3HA 4NO7A 4BVOA 3WXJA 4CJSA 2UU9K 4DSIA 1Q82O 4WQ5A 4ELTA 4CZGA 3H3OB 4OPHA 1X3NA 2HF4A 1R0AA 1FKPA 4CF1A 3A5OC 2W41A 1X3MA 2VG7A 4BRDA 1KLNA 1CXUA 4FJLA 2GELA 4CJ7A 3J7ZO 4JKBA 1TYQA 4CFCA 3I56N 2BTFA 4L8RB 4CZIA 3JSMA 4B3SK 4BR9A 3G10A 4EZ6A 3HM9A 3VEYA 4FK2A 3MWTA 2B5JA 2Z1HA 3D7EO 3NF7A 2VWKA 4HTUA 3HK2A 3DXMA 3KLIA 5KGWA 1NGCA 2ASOA 4RW7A 4B8CA 1OH5A 2LSNA 2ATQA 5AQKA 3U4LA 5F2RA 3NHGA 2BUPA 5HLFA 2HVHA 3N4QA 4BDPA 1OH7A 4CCHA 4CJLA 4JI3K 2P9IA 3DOLA 3S3MA 3ENHA 2XRIA 4M3TA 3VQEA 3WQUA 3D2FB 2OZSA 2OTLN 1HNWK 4ZTJA 4HHTA 4Z4GA 1NK5A 3MAQA 4NXMK 4CJPA 1NBWA 4PHTX 3HRGA 3LAKA 1VQMN 4JYAK 1BUPA 2QWRA 2VGMA 3U3GA 4M3WA 4BE0A 2G8KA 3NF8A 3AVLA 4KTWA 5JS1A 1QHTA 2A6AA 2O8DA 3EKSA 4HUFA 1RBSA 5CY4A 4NLCA 1NGBA 3MN9A 3KK7A 3OY9A 3RR8A 1HQUA 2AP1A 3ZYYX 3ZT0A 3AVJA 3L2VA 3UKRA 1EKEA 1HMVA 1HPZA 4RCHA 3H46O 3AGRA 5M1KA 1F21A 4WQ4C 4BDYA 3OYGA 2IS3A 2VQFK 3C7NB 5KPZA 3BGRA 2QWMA 4FM2A 3AVMA 4IOAL 2A5XA 1K8KA 5C25A 4BG9A 4JKDA 5GINA 5HP1A 5AFUH 1A5WA 1RDAA 1IG8A 1JXEA 4R5PA 1ATRA 4B1VA 4ID5A 4DQRA 4B9SA 4W5NA 3ZETA 4KH4A 3D2EA 3K5LA 4LF8K 1RTIA 3O6WA 1NKCA 4N56A 4YORA 1IKYA 2O8FB 1VAZA 1HR0K 3ZSQA 4KO0A 4F9OA 5JLHA 4DUYK 4KFBA 1TVRA 1RDDA 4B3RK 1BQMA 4GVMA 3V9SA 2FSKA 4FVMA 1WN7A 4LF5K 4FXDA 3FLCO 1GOCA 3Q7BA 3MMVA 3T1YK 3MWPA 3QEVA 2YHYA 1TAQA 3NH1A 4U7BA 3HBTA 4Z4HA 4MLEA 2HW3A 2VCPA 3FFIA 3KJVA 2Z1IA 2NZTA 3L2WA 1RTDA 4FJNA 1VRTA 4FJIA 2HBLA 4PWDA 4EZ9A 2DFFA 3O9TA 4O8UA 5I9EB 3CJ9A 5GAHP 3NBPA 4MFBA 3V1RA 1BWFO 4BRPA 4E19A 4YOWA 5BR8K 1E4GT 3KWGA 2KZMA 3T19A 3A8YA 3C65A 1LV5A 1LWCA 4FM0A 4DSLA 3MX5A 3L0QA 1VQKN 4DU4A 2HMIA 2D4WA 3OJSA 2E2PA 1S1WA 1RFQA 4KV8A 3FZFA 4CGGA 4B3TK 4GVEA 3PX6A 3OS2A 3CCQN 3LPUA 4CZJA 4O8KA 1TYQB 2FSJA 4H0OA 1NGDA 2XY6A 4KREA 4ISFA 3DLKA 3TABA 4HCCA 1XUPO 4OPAA 4BRHA 3OTOK 4FOEA 3KKSA 3DXMB 1DT9A 4IXCA 3AAQA 1IH7A 3ENBA 3NMUA 2WC9A 3ZX0A 2YHAA 4ID1A 4RTFD 4NCAA 2P9IB 5AQZA 3KLFA 2G8FA 3IG1A 4NYNA 3SK3A 5DK5A 2P5OA 3IDHA 4F3OA 4BC5A 1CZBA 5KRSA 4LH5A 3AGKA 3KK2A 1YJ9N 4JI1K 3V81A 1U4BA 1BIUA 1JJ2M 5IT9O 3AARA 4DLGA 3VGMA 1M90O 1YT3A 3SPZA 1HNXK 4CJWA 1DKGD 1WSIA 3J80O 4EHTA 3HI0A 5FDLA 1G15A 4OLBA 3L3VA 1VQON 4IFVA 3AV9A 4H5WA 3MXJA 3CCMN 3J8AA 1KXPA 3P38A 4IO9L 1FJGK 4XH1A 3SQ4A 3KLHA 2XY5A 1C1CA 5CYQA 2WFBA 3FE1A 1BA1A 3C94A 3EO3A 1QSSA 3GOIA 1ZXOA 5J2QA 3UKRB 1DGKN 3CJCA 4IJAA 3KLEA 1RDCA 3FZLA 2QWQA 1EWRA 1KRPA 4DV1K 5E26A 4BR5A 2BGGA 2PFUA 1C1AA 4TSXA 3CC4N 3G0ZA 5GAEP 2ZD1A 1JLEA 3O1BA 1GLFO 4JK8A 2UXBK 2YHBA 3VEZA 1IV0A 3AVNA 2WBNA 1GLDG 1MA9B 1S1UA 4JKAA 1K8KB 1WAFA 4KB0A 5HROA 4FWRA 2ZM6K 4FWPA 5M1PA 5AQJA 4BQLA 3FFKB 4IJNA 3WT0A 3QO9A 3BY5A 2QWLA 2OYQA 4OKEA 3A2FA 1BI4A 3LP2A 3ZT1A 2OPSA 1VSHA 4NCBA 4PL7A 3E66A 4GV3A 3B8AX 1VQ9N 1J6ZA 4IZ9A 4H8KA 2E4LA 2HOEA 1REVA 3NF6A 4FZXC 1VSDA 4BE2A 3EE8A 1T8EA 2P9NB 4KHUA 4M3ZA 3PO5A 1VQ4N 3SAHA 5FPMA 3LP0A 1L3SA 2R7YA 1JXBA 5EOYA 4HWIA 1XHXA 1VQ6N 4E7KA 3MN5A 2IAJA 4IOCL 3U6FA 2QW9A 2E88A 3CQXA 2D5RA 3QBWA 3VF6A 3KK3A 4RW8A 3NCIA 3HVTA 3CPWM 2ZJQL 5HRSA 1Q18A 2NRWA 4M3RA 4KB1A 1V4TA 3T1AA 2D0PA 3DLEA 3U8XA 2RF2A 1L3TA 1VQLN 2FF6A 3CI5A 3VQBA 2FBVA 2KHOA 4YOUA 1L3UA 1KAYA 1WOQA 4B9LA 2P9SA 2A1RA 3I8DA 5I42A 5C2FA 2PBDA 2BDPA 3FR0A 1RCHA 1UAXA 3VQCA 1UA0A 3CCRN 2F7TA 3THWB 3TSQA 5AQMA 1XHZA 3PLAA 3QNOA 5FRMA 1N36K 2WTUA 4CZMA 4YOYA 3LDQA 3F2KA 1YITN 1LOTB 3TAPA 3O4QA 4H4MA 3WEEA 4DV7K 3ZT2A 1T7PA 4Y1DA 1C1BA 3WNGA 1NJZA 4FZYA 3HPHA 2G8HA 3EE9A 3ZCMA 5HRPA 1VHXA 2O4GA 3SBTA 5FRNA 4FLTA 1CLQA 3CMEN 3AA4A 3P31A 4MLHA 2GTDA 4ILHA 5T7BA 3KLGA 5AQPA 4CERA 4CEDA 2I7PA 4FW1A 3VF4A 4EP5A 4QS8A 3MK6A 4RW6A 3QDKA 4DV2K 4IBNA 2UUCK 1W2BM 4JI2K 4JRQA 4DB3A 1GLCG 4CK2A 3LDPA 4B1XB 1SAZA 4BR2A 4A5AA 3HZ6A 1U47A 3FZHA 4K42A 4LF7K 3RSEA 4LFAK 4E1NA 4X64K 3MN7A 2HVIA 4BR0A 4QOZB 5IWAK 5J2MA 3P39A 5E84A 1C0GA 4GW6A 3IS9A 4FJ9A 3CFPA 5AQXA 2UUBK 3CC2N 3E9PA 3SUOA 4ILGB 4DV4K 4CK1A 2Q97A 2EX3A 1FW6A 2KFZA 2I7NA 3QLHA 5C2DA 1YI2N 3HM8A 5CZ2A 1YHQN 2X6SA 3I33A 2IVPA 4OGEA 3CJ7A 4XH4A 5DM6L 4LFCK 2QXFA 1NG9A 2HBMA 3RRGA 1IO2A 1Q7YO 1H1VA 4CHNA 3MCPA 4OJRA 3S3NA 1BCOA 1HNZK 3DLGA 4WFAL 3F9MA 4FJGA 4CJQA 4B3MK 3CG7A 4JKFA 3ZX3A 3MX2A 1VRUA 3LDOA 4CJTA 4CK3A 3SAFA 1P90A 2E6LA 5J2PA 3CIPA 4AHTA 3L8BA 4UQGA 4B1WB 3NGYA 3RWUA 2WOMA 1X1PA 2ASPA 1WAJA 2IVOA 3P5JA 4H5RA 3DLHA 3LM2A 5AZJA 1C0UA 2B6AA 2V51B 3K5NA 4FOIA 5M1QA 2D0OA 4K43A 1KVAA 3LANA 3SYZA 2RE2A 4O0JA 1SL1A 4BGBA 1NKEA 3J7YP 4DQ8A 3OYBA 1TUYA 1J54A 4CBWA 3C6HA 1OH8A 1HUXA 4DTRA 4UY8O 1VK0A 2UUAK 1MU2A 1OH6A 3SV3A 3L6QA 2QM1A 1HKGA 1UA1A 1ASUA 4CEEA 4JRPA 1ZC6A 1WLJA 4JI4K 4LF4K 3WXLA 4DR4K 2VWJA 4KBOA 1YTAA 4BC2A 5BN8A 3S41A 2NUBA 4W5QA 4MDBA 3L2QA 4H0YB 3V9XA 4FW2A 4O5FA 1K9MO 2Y1IA 3VQ4A 1HYZA 1XWLA 1VQ8N 3VQPA 2BH1A 4Y0WA 4BRLA 3HO1A 1Z25A 4JKGA 4X66K 1QZ6A 4KAZA 3KKRA 5AQGA 3VOVA 5HRRA 1TGOA 3RVCA 3ZSOA 3GG4A 4K25A 1C6VA 4PKHA 1CZ9A 3KHYA 3LM9A 2IOCA 4I7FA 1HKCA 1JLQA 3TI0A 4XH5A 3OYNA 2JWLA 4YOTA 1MDUB 3HTVA 3PY8A 4FO0A 5E41A 2E1ZA 3WEEB 3IAYA 1GLJO 1IKXA 2HF3A 4FWNA 5H1SQ 4CEBA 5SZTA 2CH5A 3K0SA 1KAZA 4HUEA 5KI6A 2ZQBA 1SZ2A 3M1FA 1JLGA 4LC9B 5CZ1A 3DLRA 4AHCA 4DUZK 4OX9K 4JLHA 2GWKA 1D9DA 4IOXA 5J2NA 2F4VK 4XEIA 3NFAA 2ZJRL 2W40A 2P9KB 5AQOA 2G8IA 3CQ8A 3LDLA 3EKUA 1GLBG 4JHDA 4QS7A 4FJHA 3WXIA 3RMAA 3SQ1A 5HRNA 4M3XA 2E5LK 1BU6O 2JWKA 3AVIA 4DKWA 5TKYA 3S3OA 1FK9A 2HB5A 2RN2A 3NH0A 1SL0A 4FPBA 4E89A 3UE5A 4DF4A 4BE1A 1RT4A 3LDNA 3VQ9A 4E7HA 2O8BA 1RT2A 4MQ3A 3WNHA 3VERA 3THVA 3ZT3A 5C15A 2NRXA 4A62A 4DQQA 1CXQA 3OJUA 4OKKA 1A5XA 4IEEA 4ICLA 2P9PA 3TARA 2G8VA 5M1NA 3OYMA 3DLLL 4CBXA 3U3YA 3PO4A 5JICA 3A5LC 1QQOA 5DM7L 2DY4A 1T6CA 2Z1GA 1NGFA 2ITMA 2NRZA 5AQLA 1SV5A 4W5RA 1GLEG 3LZJA 1XC9A 4K8ZA 3G25A 3AVGA 4M3UA 3KD5E 1RT3A 3HPOA 4H0TB 2PYJA 4B1YB 4ILJA 3S9HA 3QESA 1TAUA 4FLWA 1X9MA 4CGHA 4FJ7A 5C12A 4DTJA 1QQCA 4FYDA 4FVUA 1TKZA 1IKWA 1S3XA 4DTOA 2W42A 1XMOK 3NF9A 1D9FA 2DPNA 3K9KA 3QIPA 5KQDA 1RBRA 4A2BA 4F3TA 2RKIA 3LDSA 3P83D 1XNRK 3THXA 1NGGA 1NWKA 4IO8A 3UB5A 4CF0A 5CYMA 3M8PA 1QSYA 3PSFA 3CCLN 1JL1A 5SWMA 3HOTA 5I3UA 3SQ0A 3R9PA 4M3YA 4CEOA 4K41A 5EU7A 3L4IA 4DTUA 4F2RA 3LWLA 5C42A 3TAMA 3QBXA 4B1UB 4I9LA 5GIPA 4GV9A 4JD2A 4MO5A 2HHHK 5KRTA 4A61A 3WXMB 3B6OA 4DU3A 2GUIA 3CMAN 2GEMA 3M6GA 1NGIA 4XIUA 4CZKA 5AQIA 2OPPA 1DLOA 5BPLA 3ZSXA 3CFOA 2VQEK 5LY3A 2CGLA 2VYPA 4M41A 4OGCA 2V7YA 1BO5O 1S1XA 3DRPA 1TK8A 4FWMA 4FJMA 3T7ZA 2FF3B 3TAEA 3F9KA 4C1NK 2YKNA 4JKGB 4KH5A 1C0TA 4JKHA 4DR1K 1ASWA 1BGXT 1BIZA 4B9VA 3H6EA 4JK9A 3O80A 3EN9A 1DEJA 4B9NA 4JKEA 4CHZA 2G8UA 3OYLA 3E9OA 5CE3A 5KTQA 1IKVA 1QVFM 4DWIA 3CCJN 1G99A 4B1ZA 4BDZA 2YNFA 2Y1JA 4CZLA 4C8OA 4HVJA 4KHSA 1YF5L 4N5SA 2FBYA 3AAPA 4CHPA 5GIOA 4E7LA 4DS4A 3ENOA 4X62K 1NOYA 1J9AA 2ETJA 1IBLK 1TKDA 4CJ5A 3HXMA 2OANA 3VETA 1NJWA 2OZMA 1EETA 4CEQA 5DMRA 2W6LA 3SMSA 2O8CA 1OKJA 3O4WA 3DXKA 4QS9A 1HNVA 3B6PA 3HL8A 4RW9A 1WUAA 1R59O 3SCXA 4W5OA 3M5RA 1VQNN 4OLAA 5M1OA 2OPRA 4DQIA 2QI2A 4JKCA 2FSNA 1J5EK 1I94K 3SNNA 1NK9A 4ZTFA 1RT7A 4KHPK 4CIEA 1X9WA 4L3QA 1EO1A 3G4SN 3E1YA 3WNEA 5FROA 4AHRA 2O8BB 5FPNA 4FWKA 2ZGYA 4YHHK 3QEXA 1EXQA 2O8DB 4B9QA 2IIRA 3THYA 4H0PA 1VSFA 4G9ZA 1BL3A 1JL2A 2Z1JA 1VSEA 3QEPA 3PX4A 5AQNA 4E0DA 4BC4A 4JN4A 1JLCA 4Z4EA 4NB4A 3OYIA 1IJJA 4HCBA 2UXCK 3HSTB 3ASMA 5C24A 1E4FT 2E20A 3IFRA 1TK0A 4DFMA 2P9UA 1OVYA 2D0AA 3VTIA 3PV8A 5AQSA 4DU1A 2FLOA 4DFPA 3OVNA 4K0KK 3ZETB 3K2PA 2QWPA 1XNQK 3D2EB 4R79A 2RHKA 5JVGL 1E3MA 4IFEA 2YJFA 4YNQA 3O3GA 1NGHA 1EP4A 3ZLJA 3OYCA 5AQFA 1LWFA 4I6MA 2E1YA 2YX6A 1RT6A 5AZIA 2ITGA 1D8YA 3PIOL 1XI1A 1N34K 1QS4A 2H3GX 1KAXA 1ZBLA 4AHUA 4B9TA 3TTFA 4FJKA 4WF9L 2D0CA 3AO5A 4DSJA 4CEZA 3OYFA 4ISEA 3VF2A 1SL2A 2ZF5O 4LSLA 4DTNA 2E8AA 5BREA 4FZZA 2EHGA 4JD2B 3RTVA 2PAVA 3QFPA 3K58A 3O1WA 3ULEA 3ZSZA 4AQYK 1YVNA 4CGDA 4BREA 3TSPA 3DMJA 1WSEA 2HNDA 1TV6A 4J2DA 3ALYA 5BN9A 4B3OA 4OVLA 4H5TA 2EWSA 3N4PA 1NK6A 2XY7A 4H5NA 3RR7A 4B8AB 3RMCA 4A2AA 3JS6A 4E7JA 4WQ4A 1YJNN 4BRIA 4DSKA 2X78A 2VG5A 3SUNA 5BRFA 1HRHA 2GUPA 4PUOA 3EEQA 4YOXA 3W0LA 4CFAA 4DSFA 1D4XA 1LW0A 1S5JA 3SBGA 1L5UA 3AVFA 4KHQA 3OHRA 3VQ6A 1QVGM 2CGKA 3AY9A 4CE9A 4DR6K 2E2OA 4O0IA 4C8KA 1YUWA 4I9QA 3L2RA 3O4NA 4FLYA 3V9ZA 4A59A 4CZFA 4IKFA 3A5NC 3MEGA 1JLBA 2NRTA 3CJAA 3VEVA 3SQ2A 2DFHA 2XY8A 1RDBA 1V4SA 1NNEA 3DXKB 4N41A 1NGJA 4CFDA 1ILYA 4BACA 1B9DA 4Y1CA 4CHYA 1EQYA 4JI7K 4A57A 3HVRA 3MEEA 4CJFA 3I55N 4YDUC 4CJ4A 3KD1E 3TR8A 1W97L 4OKJA 4CGJA 5LMUK 3O9RA 2IC3A 3HP6A 3IUCA 3M3ZA 4BGAA 2QWOA 3CFRA 4DTXA 3D45A 4KTQA 1LCUA 2HBKA 4KH6A 5F1XA 2FBTA 2OTJN 5ADXA 5J1EA 4DQSA 1NGAA 3TU5A 4HUGA 2IDOA 2VG6A 4IFYA 3CJBA 4KTZA 3PUFA 3IRXA 4AHVA 2Q0RA 2P1JA 3HT3A 1QSLA 1N8RO 3KTQA 3THYB 3GE1A 1JKHA 1KSPA 5EXWA 2HHSA 2FXUA 5EX5A 1SQKA 3SUPA 4CBUA 4WFNL 4FPAA 3BP8A 4C1NI 1DTTA 1RDUA 1HYSA 4DLEA 2P5GA 5GAGP 4E7IA 4BG8A 4YFUA 3M8SA 1JCEA 3HJFA 1A5VA 2IVNA 4C8LA 5LJVA 4I2QA 1P8ZA 2YV0X 2JLEA 4H4OA 2P9UB 1SS6A 3MECA 4FWOA 4BR4A 3V9WA 4H0XB 1BI4B 3ISNC 3LP1A 4Z4FA 4GKJK 1BOTO 3LALA 5AQQA 2QKKA 2V52B 3I8BA 3BZKA 3U9ZA 1HYVA 3DOKA 1BISA 4BC3A 1T03A 4AM7A 3R1XA 1TL3A 5KPRA 2HHUA 5AZIB 4DV0K 4FM1A 1LAWA 3RRHA 4DS5A 4J2EA 3Q7CA 4CVNE 1WSGA 3MDQA 3GL1A 3A0IX 4X65K 2FBXA 1QQMA 1U04A 3L2UA 4RG8A 3VQ8A 4CW7B 1VSIA 3V1OA 3K9JA 1KVCA 3SPYA 4FJXA 4BRGA 3T69A 4KPYA 1TKXA 3UKUA 4F8RA 2YHXA 1X9SA 3AO4A 3ULEB 1VSKA 5B8HA 1T6DA 3V1QA 4PKGA 1J53A 1W9HA 3VGKA 2HHXA 2F8SA 4CGFA 3M8RA 3EY1A 1NK0A 4LH4A 3CPEA 4CJEA 3AVHA 4IDKA 3DLBA 4CHOA 2O4IA 4WE1A 3OW2M 4Q5VA 1XQSC 4CZHA 2Q31A 4NCGA 2YNHA 3VGLA 2ZJPL 2RPIA 4IDHA 4CGIA 2P9SB 3PIPL 5BRDA 4ELVA 4GV6A 1TK5A 4BRFA 4LFBK 4M7YA 1VQPN 2NLXA 3VQ5A 3OBWA 1GLAG 1YVUA 3DRRA 1WBBA 4FLUA 1WSFA 3UIQA 3KK1A 4FJ5A 2BANA 3K59A 2XHBA 4FK4A 2HNZA 1D5AA 1C0FA 5BPNA 3O08A 2GX9A 3NE6A 1U45A 2PY5A 3O9SA 3K5OA 4DR3K 3J7AP 1ATSA 2F9WA 1N5YA 5LJWA 3BF3A 2D1KA 1RDWX 3H1QA 3AA5X 1HNIA 2KTQA 3A5MC 2YKMA 2A42A 4ISGA 4ZHRA 2E2NA 4CECA 2PZSA 1S9EA 3ZX2A 1IG9A 1S72N 1ATNA 3LP3A 4RWTA 4BRAA 5C10A 1BQNA 2QA4N 4H03B 2NRRA 3TANA 5CR4A 4CJVA 1MWKA 1HPMA 3AA2A 5AQRA 3J81O 3MXMA 1RNHA 1O13A 3CCVN 3R8EA
chains in the Genus database with same CATH topology
4C23A 2NRVA 2P9NB 4MDAA 4BRMA 1QVFM 3RSEB 3CCJN 1G99A 3ID6A 4B1ZA 4BRKA 3C0BA 3NVKA 1VQ4N 3SAHA 4CZLA 3O9QA 3KWIA 5FPMA 1YF5L 1U2VB 3AAPA 2ZWHA 5F0XA 5GIOA 3BEXA 1YITN 4CI6A 5AQYA 5EOYA 4HWIA 4I6MB 3ENOA 1VQ6N 3WUHA 3MN5A 3DWLA 5AQUA 3C7NA 3TSUA 3IKMA 4IOCL 3GBTA 2QW9A 2E88A 2OANA 3CQXA 3VETA 3QBWA 3VF6A 2GWJA 3VENA 5TKWA 3CPWM 4BR7A 2ZJQL 4E1JA 3CCUN 3SMSA 1Q18A 1OKJA 2NRWA 3GDQA 3O4WA 3DXKA 4CD3A 4QS9A 3LL3A 3QB0A 4FL9A 1V4TA 3IMXA 2D0PA 1WUAA 3OA9A 3U8XA 1R59O 4PKIA 1VQNN 3M5RA 1VQLN 1Y64A 5M1OA 2FF6A 3CI5A 4MO4A 3G6EN 2KHOA 3P4IA 2QI2A 1NMDA 4JKCA 4YOUA 1Z6RA 2FSNA 3F5TA 1KAYA 1WOQA 4JAXA 2F9TA 2P9SA 1ZBSA 2QXLA 5C2FA 2PBDA 2E2QA 3H1VX 3FR0A 3VESA 4WCEL 4JEPA 3L4QA 3CCRN 3SLCA 4FWQA 1X9JA 3JXUA 4L3QA 2F7TA 1EO1A 1VQ7N 1QZ5A 3G4SN 3E1YA 4FWSA 1ESVA 2ASMA 3TSQA 5AQMA 3G71N 1Q81O 3U9DA 5FPNA 4YDUA 4FWKA 3PLAA 2ZGYA 2VGNA 1HLUA 3VMFB 5H1SQ 1GLLO 4CZMA 5ADXH 4JK7A 4B9QA 1KC8O 5AZJB 4YOYA 2CH6A 2IIRA 3F2KA 3LDQA 4WYBA 3ZEUA 3HSCA 4EFHA 1LOTB 2NRHA 4H0PA 5KQ8A 3WEEA 3WXKA 4EAHD 4G9ZA 1MWMA 5AQNA 4FWLA 1YIJN 2A40A 1YJWN 2ZGZA 3EE9A 4BC4A 3EL2A 4JN4A 1M1KO 1U6ZA 5AQVA 3CXCM 3SBTA 3BUZB 4NB4A 3EZWA 3CMEN 1IJJA 4NO7A 4BVOA 3P31A 4MLHA 3UKUB 2GTDA 3WXJA 4ILHA 1E4FT 3CERA 5AQPA 1Q82O 2E20A 3IFRA 2I7PA 3DAWA 4WQ5A 3VF4A 4QS8A 4CZGA 3H3OB 4OPHA 1X3NA 3MK6A 2P9UA 1OVYA 5AR0A 2HF4A 3QDKA 1VQ5N 3VTIA 3A5OC 4EHUA 1Q86O 5HL7L 2W41A 5AQSA 1X3MA 1W2BM 2HMPA 3CCSN 4BRDA 2FLOA 1GLCG 4DB3A 2GELA 3LDPA 4B1XB 4CJ7A 1SAZA 3J7ZO 4JKBA 4BRCA 4BR2A 4NLBA 3KVGA 3R6MA 4A5AA 3HZ6A 2P9NA 3FZHA 3ZETB 4K42A 2QWPA 5MLCQ 3RSEA 1TYQA 3CCEN 3D2EB 3MN7A 3I56N 2BTFA 4BR0A 1YXQA 4R79A 2RHKA 1BA0A 4CZIA 1CZAN 1RGIA 5JVGL 4IFEA 3CETA 3H3NO 2YJFA 5BPMA 3P39A 1NGHA 5E84A 1C0GA 2QEXN 4BR9A 4BY9C 5AQFA 5AQXA 4I6MA 3CC2N 3E9PA 2E1YA 3VEYA 2YX6A 3MWTA 4ILGB 5AZIA 2Q97A 3D7EO 3PIOL 2I7NA 1TUUA 3DXMA 1NGCA 5C2DA 2ASOA 3HM8A 2H3GX 1KAXA 1YI2N 1YHQN 3FZKA 4JNEA 3MN6A 3I33A 5EY4A 5AQKA 3TTFA 2IVPA 3U4LA 2YCHA 5F2RA 4WF9L 3CJ7A 2BUPA 3BF1A 4XH4A 3VEOA 3N4QA 4PL8A 4CZEA 5DM6L 4ISEA 3VF2A 2P9IA 2ZF5O 5AQHA 2HBMA 5FPDA 2E8AA 4BQZA 1Q7YO 1H1VA 3ENHA 5BREA 1JCGA 3WQUA 3MCPA 4JD2B 3CQYA 2HBJA 3D2FB 5ELZA 2PAVA 2OTLN 3QFPA 4WFAL 3F9MA 2CGJA 2YI1A 3O1WA 3ULEA 1YVNA 3VTHA 4BREA 3O9UA 4JKFA 3ZX3A 3MX2A 3TSPA 3LDOA 2UYTA 3QFUA 1NBWA 4PHTX 3HRGA 3SAFA 1P90A 5BRHA 1VQMN 3OBYA 3CIPA 4BVPA 5BN9A 1BUPA 2QWRA 4H5TA 2EWSA 2VGMA 3N4PA 4B1WB 3CD6N 4H5NA 3VPZA 4A2AA 2ASPA 2IVOA 3JS6A 2A6AA 4H5RA 3EKSA 4JHDB 4WQ4A 1YJNN 3LM2A 3D6RA 4IWVA 4BRIA 5AZJA 4NLCA 2V51B 1NGBA 3MN9A 4FOIA 2D0OA 5M1QA 3TPQA 4K43A 2GUPA 5BRFA 3KK7A 3O5BA 4YOXA 2P9LA 2RE2A 3W0LA 1YAGA 3ID8A 4BGBA 2AP1A 5AQWA 3ZYYX 3CHWA 1K8AO 1D4XA 4FSVA 3SBGA 4DQ8A 3UKRA 1TUYA 4CBWA 3OHRA 3C6HA 4RCHA 3H46O 1HUXA 4DCHA 1QVGM 4UY8O 3ATVA 1HX1A 2CGKA 3AY9A 3C6AA 3AGRA 2E2OA 3L6QA 4WFBL 1YUWA 5M1KA 4BRQA 5KPTA 2QM1A 4WQ4C 1HKGA 2P9PB 3C7NB 3VEWA 2QWMA 3NVMA 5KPZA 4A59A 4CZFA 4IOAL 1NJIO 3A5NC 1ZC6A 2A5XA 2NRTA 1K8KA 4BRNA 4H5VA 3CJAA 4BG9A 4JKDA 3WXLA 3VEVA 5GINA 5AFUH 4AM6A 4KBOA 1IG8A 4GY2B 1V4SA 4BC2A 5BN8A 3DXKB 1NGJA 3S41A 1ATRA 4B1VA 4MDBA 1ILYA 3VEXA 3MCAB 3ZETA 4H0YB 1EQYA 2A41A 4O5FA 4A57A 4KH4A 3D2EA 3I55N 3HOSA 4YDUC 1K9MO 3DJCA 1W97L 3O6WA 3SAGA 4YORA 1VQ8N 1VAZA 2BH1A 3O9RA 2QTDA 5C0YA 4Y0WA 4F9OA 4BRLA 5JLHA 4JKGA 3IUCA 1QZ6A 3M3ZA 2QWOA 4BGAA 5AQGA 3VOVA 2FSKA 3E9LA 3FLCO 3RVCA 5JMVA 3ATUA 3GG4A 4K25A 3Q7BA 3MMVA 1LCUA 4PKHA 2HBKA 3MWPA 3KHYA 4KH6A 5F1XA 3LM9A 2OTJN 2YHYA 1HKCA 3CJ1A 4U67L 5ADXA 2Q36A 1NGAA 3TU5A 4U7BA 1T3VA 3HBTA 3CJBA 4MLEA 4XH5A 1U2VA 4WQ5C 2JWLA 2VCPA 4YOTA 3CF5L 2Q0RA 1MDUB 2NZTA 3HTVA 3ZEUB 4FO0A 1N8RO 1HJOA 3GE1A 2E1ZA 3WEEB 5EXWA 1GLJO 2HBLA 2FXUA 2HF3A 5EX5A 1SQKA 4CBUA 4WFNL 4FWNA 3O9TA 4FPAA 2YHWA 2CH5A 3BP8A 1KAZA 3CJ9A 4O8UA 3SMPA 4C1NI 5I9EB 3TTDA 1RDUA 5GAHP 1BWFO 4BRPA 1SZ2A 3M1FA 4LC9B 4HTLA 5GAGP 4YOWA 2GWKA 4BG8A 1E4GT 3KWGA 4IOXA 1JCEA 3A8YA 2IVNA 3TTCA 5LJVA 3C65A 4XEIA 1P8ZA 2ZJRL 4A5BA 2W40A 2P9KB 5AQOA 3LDLA 1KQSM 3EKUA 1GLBG 2P9UB 3MX5A 1NM1A 4JHDA 4QS7A 1SS6A 3L0QA 1K73O 3CC7N 1VQKN 3WXIA 4FWOA 2D4WA 3H45C 2E2PA 1BU6O 4BR4A 1RFQA 2JWKA 3FZFA 4DKWA 4GVEA 3CCQN 5TKYA 4H0XB 2AA4A 3QICA 4CZJA 4O8KA 1TYQB 2FSJA 4H0OA 1NGDA 4FPBA 2YJEA 1BOTO 3UE5A 5AQQA 5BR9A 3LDNA 4OO1J 4ISFA 2V52B 3I8BA 3U9ZA 2WUSA 1QHAA 3VERA 4BC3A 4AM7A 5C15A 3R1XA 1XUPO 4OPAA 4BROA 4CD1A 4DHYA 2NRXA 4A62A 5AZIB 4BRHA 1NGEA 5KPRA 4IEEA 4FOEA 2P9PA 5M1NA 3Q7CA 3DXMB 1DT9A 3DLLL 4IXCA 3MDQA 3AAQA 3GL1A 3A0IX 5JVHL 4CBXA 5EVZA 1QQMA 2J4RA 3FZMA 3ENBA 3NMUA 5JICA 2WC9A 3WQTA 3A5LC 3ZX0A 4RTFD 1QQOA 3K9JA 3SJHA 5DM7L 2Q0UA 5AQTA 2P9IB 5AQZA 1T6CA 4BRGA 3SK3A 5FPEA 3T69A 3IDHA 4BC5A 1NGFA 2ITMA 2NRZA 5AQLA 1GLEG 2Q1NA 2Q2RA 2QWNA 3AGKA 3UKUA 2YHXA 1YJ9N 3G25A 3ULEB 4H0TB 5B8HA 1T6DA 1JJ2M 5HOOA 4B1YB 4ILJA 3AARA 3VGMA 4PKGA 3VGKA 1M90O 1DKGD 5C12A 4EHTA 3CPEA 4FVUA 3HI0A 1S3XA 1VQON 4H5WA 3OW2M 1XQSC 4CZHA 3W3DA 2Q31A 4M7XA 3CCMN 2V7ZA 2DPNA 3J8AA 3K9KA 1KXPA 3P38A 4IDHA 3VGLA 4IEIA 5JLFA 5KQDA 2ZJPL 4IO9L 4XH1A 4A2BA 2P9SB 2NNWA 3PIPL 5BRDA 2P9LB 2WFBA 1NLVA 3FE1A 1BA1A 4GV6A 3EO3A 1NGGA 1NWKA 4BRFA 4IO8A 3GOIA 1ZXOA 3UB5A 4M7YA 3UKRB 1VQPN 1DGKN 2NLXA 3CJCA 4IJAA 3FZLA 3OBWA 2QWQA 1GLAG 3CCLN 5E26A 4BR5A 3HOTA 2PFUA 3R9PA 3CC4N 1T44A 5GAEP 4K41A 3O1BA 3L4IA 1GLFO 4JK8A 3QBXA 3VEZA 1XC3A 2KLAA 4B1UB 1C0FA 2P9KA 2A3ZA 3O08A 2GX9A 5BPNA 1Z05A 3KZBA 5GIPA 4GV9A 2WBNA 1GLDG 1MA9B 4JKAA 4JD2A 1K8KB 3O9SA 4MO5A 3D2FA 4Z94A 5AFUA 1BG3A 1ATSA 2F9WA 4FWRA 5LJWA 3BF3A 4FWPA 2D1KA 5M1PA 4A61A 1RDWX 3H1QA 3WXMB 5AQJA 4BQLA 1BDGA 3FFKB 3A5MC 4IJNA 3CMAN 3WT0A 1S72N 2GEMA 3M6GA 5M1FA 1NGIA 2A42A 4ISGA 2QWLA 2HSTA 4CZKA 3O8MA 5AQIA 2E2NA 4AF1A 4EIAA 5CHIA 5BPLA 2VWBA 2CGLA 2VYPA 5LY3A 5GADP 3ZX2A 2V7YA 1BO5O 4H0VB 4FWMA 3T7ZA 1JCFA 2FF3B 1ATNA 3E66A 3QMLA 4PL7A 4RWTA 3B8AX 3R3LA 4BRAA 4C1NK 4GV3A 4J8FA 1VQ9N 5C10A 1KD1O 1J6ZA 4M63C 4IZ9A 4JKGB 4KH5A 4YOVA 2QA4N 4H03B 4JKHA 2NRRA 1HKBA 1QQNA 1S22A 2HOEA 5CR4A 3H6EA 1MWKA 1HPMA 2KKZA 3FGUA 3O80A 4JK9A 3EN9A 1DEJA 5AQRA 4JKEA 4GNIA 3EE8A 3E9OA 1O13A 3CCVN 5CE3A 3R8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C23 A;  2P9N B;  4BRM A;  3RSE B;  1G99 A;  4B1Z A;  4BRK A;  3C0B A;  4CZL A;  5FPM A;  1U2V B;  3AAP A;  2ZWH A;  5F0X A;  3BEX A;  4CI6 A;  5AQY A;  5EOY A;  4HWI A;  4I6M B;  3ENO A;  3WUH A;  3MN5 A;  3DWL A;  5AQU A;  3C7N A;  3GBT A;  2QW9 A;  2E88 A;  2OAN A;  3CQX A;  3VET A;  3QBW A;  3VF6 A;  2GWJ A;  3VEN A;  4BR7 A;  4E1J A;  3SMS A;  1Q18 A;  1OKJ A;  3GDQ A;  3O4W A;  3DXK A;  4CD3 A;  4QS9 A;  3LL3 A;  3QB0 A;  4FL9 A;  1V4T A;  3IMX A;  2D0P A;  1WUA A;  3U8X A;  1R59 O;  4PKI A;  1Y64 A;  2FF6 A;  3CI5 A;  4MO4 A;  2KHO A;  3P4I A;  1NMD A;  1Z6R A;  2FSN A;  1KAY A;  1WOQ A;  4JAX A;  2F9T A;  2P9S A;  1ZBS A;  2QXL A;  2PBD A;  2E2Q A;  3H1V X;  3FR0 A;  3VES A;  3SLC A;  4FWQ A;  1X9J A;  3JXU A;  4L3Q A;  1QZ5 A;  4FWS A;  1ESV A;  2ASM A;  5AQM A;  3U9D A;  5FPN A;  4YDU A;  4FWK A;  2ZGY A;  1HLU A;  1GLL O;  4CZM A;  5ADX H;  4B9Q A;  5AZJ B;  2CH6 A;  2IIR A;  3LDQ A;  4WYB A;  3ZEU A;  4EFH A;  3HSC A;  5KQ8 A;  1LOT B;  2NRH A;  4H0P A;  3WEE A;  3WXK A;  4EAH D;  1MWM A;  5AQN A;  4FWL A;  2A40 A;  2ZGZ A;  4BC4 A;  3EL2 A;  4JN4 A;  1U6Z A;  5AQV A;  3BUZ B;  4NB4 A;  3EZW A;  1IJJ A;  4NO7 A;  4BVO A;  4MLH A;  3UKU B;  2GTD A;  3WXJ A;  1E4F T;  3CER A;  5AQP A;  2E20 A;  3IFR A;  2I7P A;  3DAW A;  4WQ5 A;  3VF4 A;  4QS8 A;  4CZG A;  3H3O B;  1X3N A;  3MK6 A;  2P9U A;  5AR0 A;  2HF4 A;  3QDK A;  3A5O C;  4EHU A;  2W41 A;  5AQS A;  1X3M A;  2HMP A;  4BRD A;  2FLO A;  1GLC G;  4DB3 A;  2GEL A;  3LDP A;  4B1X B;  4CJ7 A;  1SAZ A;  4BRC A;  4BR2 A;  3KVG A;  3R6M A;  3HZ6 A;  2P9N A;  3FZH A;  3ZET B;  4K42 A;  2QWP A;  3RSE A;  1TYQ A;  3D2E B;  3MN7 A;  2BTF A;  4BR0 A;  1YXQ A;  1BA0 A;  4CZI A;  1CZA N;  1RGI A;  3CET A;  3H3N O;  2YJF A;  5BPM A;  1NGH A;  5E84 A;  1C0G A;  4BR9 A;  5AQF A;  5AQX A;  4I6M A;  2E1Y A;  3VEY A;  5AZI A;  2Q97 A;  3D7E O;  2I7N A;  1TUU A;  3DXM A;  1NGC A;  2ASO A;  3HM8 A;  2H3G X;  1KAX A;  3FZK A;  4JNE A;  3MN6 A;  3I33 A;  5EY4 A;  5AQK A;  2IVP A;  3U4L A;  2YCH A;  5F2R A;  3CJ7 A;  2BUP A;  3BF1 A;  4XH4 A;  3VEO A;  4PL8 A;  4CZE A;  4ISE A;  3VF2 A;  2P9I A;  2ZF5 O;  5AQH A;  5FPD A;  2E8A A;  4BQZ A;  1H1V A;  3ENH A;  5BRE A;  1JCG A;  3WQU A;  3MCP A;  4JD2 B;  3CQY A;  3D2F B;  5ELZ A;  2PAV A;  3QFP A;  3F9M A;  2CGJ A;  2YI1 A;  3O1W A;  3ULE A;  1YVN A;  4BRE A;  3ZX3 A;  3LDO A;  2UYT A;  3QFU A;  1NBW A;  5BRH A;  3CIP A;  4BVP A;  5BN9 A;  1BUP A;  2QWR A;  4H5T A;  2EWS A;  4B1W B;  4H5N A;  3VPZ A;  4A2A A;  2ASP A;  2IVO A;  3JS6 A;  2A6A A;  4H5R A;  3EKS A;  4JHD B;  4WQ4 A;  3LM2 A;  4BRI A;  4IWV A;  5AZJ A;  2V51 B;  1NGB A;  3MN9 A;  4FOI A;  2D0O A;  5BRF A;  3TPQ A;  4K43 A;  2GUP A;  3O5B A;  2P9L A;  3W0L A;  1YAG A;  3ID8 A;  4BGB A;  2AP1 A;  5AQW A;  3CHW A;  1D4X A;  4FSV A;  4DQ8 A;  3UKR A;  1TUY A;  4CBW A;  3OHR A;  4RCH A;  3H46 O;  1HUX A;  4DCH A;  3ATV A;  1HX1 A;  2CGK A;  3AY9 A;  2E2O A;  3L6Q A;  1YUW A;  4BRQ A;  5KPT A;  2QM1 A;  4WQ4 C;  1HKG A;  2P9P B;  3C7N B;  3VEW A;  2QWM A;  5KPZ A;  4CZF A;  3A5N C;  1ZC6 A;  2A5X A;  4BRN A;  1K8K A;  4H5V A;  3CJA A;  4BG9 A;  3WXL A;  3VEV A;  5AFU H;  4AM6 A;  4KBO A;  1IG8 A;  4GY2 B;  1V4S A;  4BC2 A;  5BN8 A;  3DXK B;  1NGJ A;  3S41 A;  1ATR A;  4B1V A;  3VEX A;  3ZET A;  4H0Y B;  1EQY A;  2A41 A;  4O5F A;  3D2E A;  4YDU C;  3DJC A;  3O6W A;  4Y0W A;  4F9O A;  4BRL A;  5JLH A;  3IUC A;  1QZ6 A;  3M3Z A;  2QWO A;  4BGA A;  5AQG A;  3VOV A;  2FSK A;  3FLC O;  5JMV A;  3ATU A;  3GG4 A;  4K25 A;  3MMV A;  1LCU A;  4PKH A;  3KHY A;  5F1X A;  3LM9 A;  2YHY A;  1HKC A;  3CJ1 A;  5ADX A;  2Q36 A;  1NGA A;  3TU5 A;  3HBT A;  3CJB A;  4MLE A;  4XH5 A;  1U2V A;  4WQ5 C;  2VCP A;  2Q0R A;  1MDU B;  2NZT A;  3HTV A;  3ZEU B;  4FO0 A;  1HJO A;  3GE1 A;  2E1Z A;  3WEE B;  5EXW A;  1GLJ O;  2FXU A;  2HF3 A;  5EX5 A;  1SQK A;  4CBU A;  4FWN A;  4FPA A;  2YHW A;  2CH5 A;  3BP8 A;  1KAZ A;  3CJ9 A;  5I9E B;  3SMP A;  1BWF O;  4BRP A;  1SZ2 A;  3M1F A;  4LC9 B;  4HTL A;  2GWK A;  4BG8 A;  1E4G T;  1JCE A;  3A8Y A;  2IVN A;  5LJV A;  4XEI A;  1P8Z A;  2W40 A;  2P9K B;  5AQO A;  3LDL A;  3EKU A;  1GLB G;  2P9U B;  1NM1 A;  4JHD A;  4QS7 A;  3L0Q A;  3WXI A;  4FWO A;  2D4W A;  3H45 C;  2E2P A;  1BU6 O;  4BR4 A;  1RFQ A;  3FZF A;  5TKY A;  4H0X B;  2AA4 A;  3QIC A;  4CZJ A;  4O8K A;  1TYQ B;  2FSJ A;  4H0O A;  1NGD A;  4FPB A;  2YJE A;  1BOT O;  3UE5 A;  5AQQ A;  5BR9 A;  3LDN A;  4ISF A;  2V52 B;  3I8B A;  3U9Z A;  2WUS A;  1QHA A;  3VER A;  4BC3 A;  4AM7 A;  4BRO A;  1XUP O;  4DHY A;  4CD1 A;  5KPR A;  4A62 A;  5AZI B;  4BRH A;  1NGE A;  4FOE A;  2P9P A;  3DXM B;  4IXC A;  3MDQ A;  3AAQ A;  3GL1 A;  3A0I X;  4CBX A;  5EVZ A;  1QQM A;  2J4R A;  3FZM A;  5JIC A;  3WQT A;  3A5L C;  3ZX0 A;  4RTF D;  1QQO A;  3SJH A;  2Q0U A;  5AQT A;  2P9I B;  5AQZ A;  1T6C A;  4BRG A;  3SK3 A;  5FPE A;  3IDH A;  4BC5 A;  1NGF A;  2ITM A;  5AQL A;  1GLE G;  2Q1N A;  2Q2R A;  2QWN A;  3UKU A;  2YHX A;  3G25 A;  3ULE B;  4H0T B;  5B8H A;  1T6D A;  4B1Y B;  3AAR A;  3VGM A;  4PKG A;  3VGK A;  1DKG D;  4EHT A;  3HI0 A;  1S3X A;  4H5W A;  1XQS C;  4CZH A;  3W3D A;  2Q31 A;  4M7X A;  2V7Z A;  2DPN A;  3J8A A;  3VGL A;  1KXP A;  5KQD A;  5JLF A;  4XH1 A;  4A2B A;  2P9S B;  5BRD A;  2P9L B;  3FE1 A;  1NLV A;  1BA1 A;  3EO3 A;  1NGG A;  1NWK A;  4BRF A;  4IO8 A;  3GOI A;  1ZXO A;  3UB5 A;  4M7Y A;  3UKR B;  1DGK N;  2NLX A;  3CJC A;  4IJA A;  3FZL A;  2QWQ A;  1GLA G;  5E26 A;  4BR5 A;  3R9P A;  1T44 A;  4K41 A;  3O1B A;  3L4I A;  1GLF O;  3QBX A;  3VEZ A;  1XC3 A;  4B1U B;  1C0F A;  2P9K A;  2A3Z A;  3O08 A;  5BPN A;  1Z05 A;  3KZB A;  1GLD G;  1MA9 B;  4JD2 A;  1K8K B;  4MO5 A;  5AFU A;  3D2F A;  4Z94 A;  1BG3 A;  1ATS A;  2F9W A;  4FWR A;  5LJW A;  3BF3 A;  4FWP A;  2D1K A;  4A61 A;  1RDW X;  3H1Q A;  5AQJ A;  4BQL A;  1BDG A;  3FFK B;  3A5M C;  4IJN A;  3WT0 A;  2GEM A;  3M6G A;  1NGI A;  2A42 A;  4ISG A;  2QWL A;  4CZK A;  3O8M A;  5AQI A;  2E2N A;  4EIA A;  5BPL A;  2VWB A;  2CGL A;  2VYP A;  5LY3 A;  3ZX2 A;  2V7Y A;  1BO5 O;  4H0V B;  4FWM A;  1JCF A;  2FF3 B;  1ATN A;  3QML A;  4PL7 A;  4RWT A;  3B8A X;  4BRA A;  4J8F A;  1J6Z A;  4M63 C;  4IZ9 A;  4H03 B;  1HKB A;  1QQN A;  1S22 A;  2HOE A;  3H6E A;  1MWK A;  1HPM A;  3FGU A;  3O80 A;  3EN9 A;  1DEJ A;  5AQR A;  4GNI A;  5CE3 A;  3R8E A; 
#chains in the Genus database with same CATH topology
 1K6Y A;  1KTQ A;  1ASV A;  2NRV A;  4MDA A;  3RSE B;  1RT1 A;  4JI6 K;  3TAQ A;  3C0B A;  3NVK A;  4J2B A;  3O9Q A;  3KWI A;  4FK0 A;  2ZWH A;  1GOA A;  5F0X A;  3C6U A;  4CHQ A;  1RBU A;  1ITG A;  2O8E A;  3VQD A;  3ZSV A;  4DFK A;  1KLM A;  3WUH A;  1TKT A;  5AQU A;  3TSU A;  3IKM A;  3GBT A;  4Z4C A;  4FJJ A;  2WON A;  2GWJ A;  3SV4 A;  3F73 A;  4CF8 A;  3VEN A;  5TKW A;  4CIG A;  4DV3 K;  4N47 A;  4FLZ A;  2I5J A;  3V4I A;  3OYD A;  1O1W A;  5JS2 A;  3IMX A;  2DTU A;  3OA9 A;  3H08 A;  3CYM A;  3HYF A;  4LSN A;  1VSJ A;  3G6E N;  1NK7 A;  3P4I A;  1NMD A;  3RMB A;  1Z6R A;  4OPJ A;  3F5T A;  4JAX A;  4CJ3 A;  4DG1 A;  4PA1 A;  2QXL A;  1BCM A;  2E2Q A;  1LWE A;  3DYA A;  3H1V X;  4E3S A;  5AJ3 K;  3L4Q A;  3ITH A;  3SLC A;  1ZBF A;  4FWS A;  1KFD A;  1ESV A;  1J5O A;  3G71 N;  1N6Q A;  3U9D A;  2W6K A;  4YDU A;  1UWB A;  1L3V A;  1TL1 A;  1GLL O;  1OVQ A;  5ADX H;  4JK7 A;  1SKS A;  2P51 A;  5AZJ B;  1KC8 O;  3DRS A;  4N76 A;  2CH6 A;  4WYB A;  1GOB A;  3ZEU A;  4QAG A;  3AVB A;  2NRH A;  4K8X A;  1HJR A;  3WXK A;  4KI6 A;  1MWM A;  2PYL A;  4FWL A;  3VN5 A;  3EL2 A;  3VA0 A;  4LY7 A;  3L3U A;  3EZW A;  1EWQ A;  3UKU B;  1RT5 A;  2B4J A;  3C95 A;  4DQP A;  3CER A;  3DAW A;  4Z4I A;  4I2P A;  4QCL A;  2OCE A;  1ZBH A;  4J2A A;  5AR0 A;  1VQ5 N;  3TAG A;  4CJU A;  4EHU A;  2YNI A;  1Q86 O;  5HL7 L;  4AHS A;  2HMP A;  4KRF A;  3CCS N;  4BRC A;  4NLB A;  3KVG A;  3R6M A;  2P9N A;  5MLC Q;  3CCE N;  1U49 A;  1YXQ A;  2G8W A;  1BA0 A;  1CZA N;  1RGI A;  3CET A;  3H3N O;  5BPM A;  3T1H K;  2QEX N;  4BY9 C;  1NU0 A;  2ZE2 A;  3QER A;  4GKK K;  3BDP A;  3SZ2 A;  1TUU A;  2AJQ A;  3V9U A;  3EYZ A;  3FZK A;  4JNE A;  3MN6 A;  5EY4 A;  3LZI A;  2YCH A;  3OYA A;  3BF1 A;  3VEO A;  4CIF A;  1FKO A;  4PL8 A;  4CZE A;  2D0B A;  5AQH A;  1DTQ A;  5FPD A;  1JLF A;  4BQZ A;  3AO1 A;  4JI5 K;  1JCG A;  3QEI A;  3CQY A;  2HBJ A;  5ELZ A;  3T3F A;  3CM5 A;  4CEF A;  3LWM A;  4DTP A;  1IBM K;  4B9M A;  2CGJ A;  2YI1 A;  3ZT4 A;  4DTM A;  3O3F A;  3MED A;  4PQU A;  3VTH A;  3O9U A;  3JAM O;  5HBM A;  5D3G A;  2UYT A;  3QFU A;  4C8N A;  1QTM A;  3BZC A;  4B08 A;  1LW2 A;  5BRH A;  3OBY A;  2OPQ A;  3THW A;  4M42 A;  4BVP A;  3M8Q A;  4DV5 K;  3K5M A;  2YNG A;  3CD6 N;  3VPZ A;  4JHD B;  4Z0U A;  3NH2 A;  3D6R A;  4IWV A;  2HNY A;  2F8T A;  3TPQ A;  3O5B A;  2P9L A;  1YAG A;  3ID8 A;  5AQW A;  3CHW A;  1K8A O;  4FSV A;  1T05 A;  1KVB A;  4DCH A;  5A2Q O;  3ATV A;  1HX1 A;  3C6A A;  1VSM A;  2O8E B;  4WFB L;  4BRQ A;  5KPT A;  1C0M A;  2P9P B;  3VEW A;  2GV9 A;  3NVM A;  3LAM A;  1QE1 A;  1NJI O;  4BRN A;  4H5V A;  4NYF A;  4PY5 A;  3SUQ A;  4AM6 A;  3NGZ A;  1WBD A;  4GY2 B;  3TAF A;  3AVA A;  3WNF A;  3VEX A;  3MCA B;  3VQA A;  5FLX O;  2A41 A;  1Z26 A;  4JS4 A;  3HOS A;  3DJC A;  3DI6 A;  4DF8 A;  3C6T A;  1KFS A;  3SAG A;  1SKW A;  2QTD A;  5C0Y A;  4G1Q A;  3VQQ A;  1Q9Y A;  3E9L A;  3VQ7 A;  5JMV A;  3ATU A;  1B9F A;  1RTH A;  4B9U A;  3K57 A;  3DM2 A;  3CJ1 A;  3PX0 A;  4E1M A;  3ULD A;  3P1G A;  4U67 L;  2Q36 A;  1T3V A;  1U2V A;  4WQ5 C;  2KFN A;  1N33 K;  3CF5 L;  3ZEU B;  1UOC A;  1HJO A;  2FC0 A;  3THX B;  4KI4 A;  2YHW A;  4Q0B A;  3RMD A;  3SMP A;  3TTD A;  4CEA A;  1SUQ A;  3E01 A;  4HTL A;  1WB9 A;  4DV6 K;  4FLX A;  4JS5 A;  4CJR A;  3TTC A;  4A5B A;  1EX4 A;  1KQS M;  2QK9 A;  3JYT A;  1RIL A;  1NM1 A;  1K73 O;  3CC7 N;  4O44 A;  3H45 C;  3KIO A;  2HHT A;  4EP4 A;  1RTJ A;  3SI6 A;  2AA4 A;  3QIC A;  4AH9 A;  3QIO A;  3NGI A;  2YJE A;  4DTS A;  4NXN K;  5BR9 A;  4M45 A;  4OO1 J;  4C8M A;  2HHV A;  2WUS A;  1QHA A;  4BRO A;  4DHY A;  4CD1 A;  1NGE A;  2IGI A;  3AVK A;  2A1S A;  1SKR A;  2UXD K;  5JVH L;  5EVZ A;  4LD0 A;  2J4R A;  2KW4 A;  3FZM A;  3OS0 A;  4CF2 A;  1BHL A;  3WQT A;  1NK8 A;  3SJH A;  2Q0U A;  5AQT A;  1NK4 A;  5FPE A;  3I0S A;  2Q1N A;  2QWN A;  2Q2R A;  4AIL C;  4DSE A;  1W0H A;  3ZSY A;  5HOO A;  4CF9 A;  1YTU A;  3VA3 A;  4BWM A;  2F96 A;  1FXX A;  2O8C B;  1RBV A;  4KHW A;  4IG0 A;  1S6Q A;  1NJY A;  1S1V A;  2KQ2 A;  3W3D A;  4JV5 K;  4M7X A;  2V7Z A;  4IEI A;  5JLF A;  1W7A A;  3TWH A;  1Q9X A;  4ELU A;  2NNW A;  2GBZ A;  2P9L B;  1NLV A;  3HP9 A;  2E6M A;  1ZYQ A;  3EZ5 A;  5KGX A;  1VSL A;  3SJJ A;  3LPT A;  5LL6 Z;  1T44 A;  1RBT A;  3ZSR A;  1IBK K;  1ZBI A;  1XC3 A;  2KLA A;  2P9K A;  2A3Z A;  1Z05 A;  3KZB A;  3QIN A;  2BE2 A;  5AFU A;  3D2F A;  4Z94 A;  1BG3 A;  1BDG A;  3OYK A;  5M1F A;  1NOZ A;  2HST A;  5K14 A;  3O8M A;  3AO3 A;  4AF1 A;  4EIA A;  5CHI A;  3QNN A;  1N32 K;  4KHN A;  1LAV A;  2VWB A;  5GAD P;  4H0V B;  1JCF A;  3QML A;  3V6D A;  3R3L A;  1I3A A;  4J8F A;  1KD1 O;  2HHW A;  4M63 C;  1U48 A;  1NMN A;  4O4G A;  4YOV A;  4FCY A;  1HKB A;  1S22 A;  1JLA A;  1QQN A;  3HPG A;  4YY3 K;  3FGU A;  2KKZ A;  4GNI A;  4DR5 K;  4C23 A;  4BRM A;  3ID6 A;  4F4K A;  4BRK A;  2X6N A;  5LMN K;  1U2V B;  4V19 S;  1KCF A;  2OA8 A;  1NJX A;  3BEX A;  4JI8 K;  4CI6 A;  5AQY A;  4I6M B;  4LF9 K;  4JI0 K;  3DWL A;  4DMN A;  4CES A;  3C7N A;  3QET A;  1WSJ A;  4W5T A;  3AO2 A;  4KHY A;  4CJK A;  3OYJ A;  1HQE A;  1S6P A;  2HHQ A;  4BR7 A;  3NDK A;  3ZSW A;  4E1J A;  3CCU N;  3GDQ A;  1Y97 A;  4CD3 A;  3LL3 A;  3QB0 A;  4FL9 A;  4PKI A;  1Y64 A;  1WSH A;  3AVC A;  4O55 A;  4CFB A;  1WNS A;  3OS1 A;  4MO4 A;  3NAE A;  2O8F A;  1I39 A;  2F9T A;  1ZBS A;  4FJ8 A;  2DFE A;  3OYE A;  3VES A;  4WCE L;  3OYH A;  2X74 A;  4OPK A;  4JEP A;  3PSI A;  4FWQ A;  1X9J A;  3JXU A;  4DR7 K;  2JGU A;  1QZ5 A;  1VQ7 N;  4O5B A;  4RW4 A;  1NKB A;  2ASM A;  1S1T A;  4LF6 K;  1Q81 O;  3QEW A;  4BWJ A;  1S9G A;  1ZBU A;  3VMF B;  2VGN A;  1HLU A;  2KZZ A;  3CM6 A;  4F2S A;  4FLV A;  2Q3S A;  4EFH A;  5KQ8 A;  3HSC A;  1Q8I A;  4DR2 K;  4EAH D;  2XO7 A;  4DFJ A;  3AA3 A;  1YIJ N;  4KKO A;  2A40 A;  4IG3 A;  2ZGZ A;  1YJW N;  1XMQ K;  2QKB A;  4GMJ B;  3D0P A;  1M1K O;  3I0R A;  1U6Z A;  5AQV A;  1B92 A;  3CXC M;  3BUZ B;  3MXI A;  3O3H A;  4NO7 A;  4BVO A;  3WXJ A;  4CJS A;  2UU9 K;  4DSI A;  1Q82 O;  4WQ5 A;  4ELT A;  4CZG A;  3H3O B;  4OPH A;  1X3N A;  2HF4 A;  1R0A A;  1FKP A;  4CF1 A;  3A5O C;  2W41 A;  1X3M A;  2VG7 A;  4BRD A;  1KLN A;  1CXU A;  4FJL A;  2GEL A;  4CJ7 A;  3J7Z O;  4JKB A;  1TYQ A;  4CFC A;  3I56 N;  2BTF A;  4L8R B;  4CZI A;  3JSM A;  4B3S K;  4BR9 A;  3G10 A;  4EZ6 A;  3HM9 A;  3VEY A;  4FK2 A;  3MWT A;  2B5J A;  2Z1H A;  3D7E O;  3NF7 A;  2VWK A;  4HTU A;  3HK2 A;  3DXM A;  3KLI A;  5KGW A;  1NGC A;  2ASO A;  4RW7 A;  4B8C A;  1OH5 A;  2LSN A;  2ATQ A;  5AQK A;  3U4L A;  5F2R A;  3NHG A;  2BUP A;  5HLF A;  2HVH A;  3N4Q A;  4BDP A;  1OH7 A;  4CCH A;  4CJL A;  4JI3 K;  2P9I A;  3DOL A;  3S3M A;  3ENH A;  2XRI A;  4M3T A;  3VQE A;  3WQU A;  3D2F B;  2OZS A;  2OTL N;  1HNW K;  4ZTJ A;  4HHT A;  4Z4G A;  1NK5 A;  3MAQ A;  4NXM K;  4CJP A;  1NBW A;  4PHT X;  3HRG A;  3LAK A;  1VQM N;  4JYA K;  1BUP A;  2QWR A;  2VGM A;  3U3G A;  4M3W A;  4BE0 A;  2G8K A;  3NF8 A;  3AVL A;  4KTW A;  5JS1 A;  1QHT A;  2A6A A;  2O8D A;  3EKS A;  4HUF A;  1RBS A;  5CY4 A;  4NLC A;  1NGB A;  3MN9 A;  3KK7 A;  3OY9 A;  3RR8 A;  1HQU A;  2AP1 A;  3ZYY X;  3ZT0 A;  3AVJ A;  3L2V A;  3UKR A;  1EKE A;  1HMV A;  1HPZ A;  4RCH A;  3H46 O;  3AGR A;  5M1K A;  1F21 A;  4WQ4 C;  4BDY A;  3OYG A;  2IS3 A;  2VQF K;  3C7N B;  5KPZ A;  3BGR A;  2QWM A;  4FM2 A;  3AVM A;  4IOA L;  2A5X A;  1K8K A;  5C25 A;  4BG9 A;  4JKD A;  5GIN A;  5HP1 A;  5AFU H;  1A5W A;  1RDA A;  1IG8 A;  1JXE A;  4R5P A;  1ATR A;  4B1V A;  4ID5 A;  4DQR A;  4B9S A;  4W5N A;  3ZET A;  4KH4 A;  3D2E A;  3K5L A;  4LF8 K;  1RTI A;  3O6W A;  1NKC A;  4N56 A;  4YOR A;  1IKY A;  2O8F B;  1VAZ A;  1HR0 K;  3ZSQ A;  4KO0 A;  4F9O A;  5JLH A;  4DUY K;  4KFB A;  1TVR A;  1RDD A;  4B3R K;  1BQM A;  4GVM A;  3V9S A;  2FSK A;  4FVM A;  1WN7 A;  4LF5 K;  4FXD A;  3FLC O;  1GOC A;  3Q7B A;  3MMV A;  3T1Y K;  3MWP A;  3QEV A;  2YHY A;  1TAQ A;  3NH1 A;  4U7B A;  3HBT A;  4Z4H A;  4MLE A;  2HW3 A;  2VCP A;  3FFI A;  3KJV A;  2Z1I A;  2NZT A;  3L2W A;  1RTD A;  4FJN A;  1VRT A;  4FJI A;  2HBL A;  4PWD A;  4EZ9 A;  2DFF A;  3O9T A;  4O8U A;  5I9E B;  3CJ9 A;  5GAH P;  3NBP A;  4MFB A;  3V1R A;  1BWF O;  4BRP A;  4E19 A;  4YOW A;  5BR8 K;  1E4G T;  3KWG A;  2KZM A;  3T19 A;  3A8Y A;  3C65 A;  1LV5 A;  1LWC A;  4FM0 A;  4DSL A;  3MX5 A;  3L0Q A;  1VQK N;  4DU4 A;  2HMI A;  2D4W A;  3OJS A;  2E2P A;  1S1W A;  1RFQ A;  4KV8 A;  3FZF A;  4CGG A;  4B3T K;  4GVE A;  3PX6 A;  3OS2 A;  3CCQ N;  3LPU A;  4CZJ A;  4O8K A;  1TYQ B;  2FSJ A;  4H0O A;  1NGD A;  2XY6 A;  4KRE A;  4ISF A;  3DLK A;  3TAB A;  4HCC A;  1XUP O;  4OPA A;  4BRH A;  3OTO K;  4FOE A;  3KKS A;  3DXM B;  1DT9 A;  4IXC A;  3AAQ A;  1IH7 A;  3ENB A;  3NMU A;  2WC9 A;  3ZX0 A;  2YHA A;  4ID1 A;  4RTF D;  4NCA A;  2P9I B;  5AQZ A;  3KLF A;  2G8F A;  3IG1 A;  4NYN A;  3SK3 A;  5DK5 A;  2P5O A;  3IDH A;  4F3O A;  4BC5 A;  1CZB A;  5KRS A;  4LH5 A;  3AGK A;  3KK2 A;  1YJ9 N;  4JI1 K;  3V81 A;  1U4B A;  1BIU A;  1JJ2 M;  5IT9 O;  3AAR A;  4DLG A;  3VGM A;  1M90 O;  1YT3 A;  3SPZ A;  1HNX K;  4CJW A;  1DKG D;  1WSI A;  3J80 O;  4EHT A;  3HI0 A;  5FDL A;  1G15 A;  4OLB A;  3L3V A;  1VQO N;  4IFV A;  3AV9 A;  4H5W A;  3MXJ A;  3CCM N;  3J8A A;  1KXP A;  3P38 A;  4IO9 L;  1FJG K;  4XH1 A;  3SQ4 A;  3KLH A;  2XY5 A;  1C1C A;  5CYQ A;  2WFB A;  3FE1 A;  1BA1 A;  3C94 A;  3EO3 A;  1QSS A;  3GOI A;  1ZXO A;  5J2Q A;  3UKR B;  1DGK N;  3CJC A;  4IJA A;  3KLE A;  1RDC A;  3FZL A;  2QWQ A;  1EWR A;  1KRP A;  4DV1 K;  5E26 A;  4BR5 A;  2BGG A;  2PFU A;  1C1A A;  4TSX A;  3CC4 N;  3G0Z A;  5GAE P;  2ZD1 A;  1JLE A;  3O1B A;  1GLF O;  4JK8 A;  2UXB K;  2YHB A;  3VEZ A;  1IV0 A;  3AVN A;  2WBN A;  1GLD G;  1MA9 B;  1S1U A;  4JKA A;  1K8K B;  1WAF A;  4KB0 A;  5HRO A;  4FWR A;  2ZM6 K;  4FWP A;  5M1P A;  5AQJ A;  4BQL A;  3FFK B;  4IJN A;  3WT0 A;  3QO9 A;  3BY5 A;  2QWL A;  2OYQ A;  4OKE A;  3A2F A;  1BI4 A;  3LP2 A;  3ZT1 A;  2OPS A;  1VSH A;  4NCB A;  4PL7 A;  3E66 A;  4GV3 A;  3B8A X;  1VQ9 N;  1J6Z A;  4IZ9 A;  4H8K A;  2E4L A;  2HOE A;  1REV A;  3NF6 A;  4FZX C;  1VSD A;  4BE2 A;  3EE8 A;  1T8E A;  2P9N B;  4KHU A;  4M3Z A;  3PO5 A;  1VQ4 N;  3SAH A;  5FPM A;  3LP0 A;  1L3S A;  2R7Y A;  1JXB A;  5EOY A;  4HWI A;  1XHX A;  1VQ6 N;  4E7K A;  3MN5 A;  2IAJ A;  4IOC L;  3U6F A;  2QW9 A;  2E88 A;  3CQX A;  2D5R A;  3QBW A;  3VF6 A;  3KK3 A;  4RW8 A;  3NCI A;  3HVT A;  3CPW M;  2ZJQ L;  5HRS A;  1Q18 A;  2NRW A;  4M3R A;  4KB1 A;  1V4T A;  3T1A A;  2D0P A;  3DLE A;  3U8X A;  2RF2 A;  1L3T A;  1VQL N;  2FF6 A;  3CI5 A;  3VQB A;  2FBV A;  2KHO A;  4YOU A;  1L3U A;  1KAY A;  1WOQ A;  4B9L A;  2P9S A;  2A1R A;  3I8D A;  5I42 A;  5C2F A;  2PBD A;  2BDP A;  3FR0 A;  1RCH A;  1UAX A;  3VQC A;  1UA0 A;  3CCR N;  2F7T A;  3THW B;  3TSQ A;  5AQM A;  1XHZ A;  3PLA A;  3QNO A;  5FRM A;  1N36 K;  2WTU A;  4CZM A;  4YOY A;  3LDQ A;  3F2K A;  1YIT N;  1LOT B;  3TAP A;  3O4Q A;  4H4M A;  3WEE A;  4DV7 K;  3ZT2 A;  1T7P A;  4Y1D A;  1C1B A;  3WNG A;  1NJZ A;  4FZY A;  3HPH A;  2G8H A;  3EE9 A;  3ZCM A;  5HRP A;  1VHX A;  2O4G A;  3SBT A;  5FRN A;  4FLT A;  1CLQ A;  3CME N;  3AA4 A;  3P31 A;  4MLH A;  2GTD A;  4ILH A;  5T7B A;  3KLG A;  5AQP A;  4CER A;  4CED A;  2I7P A;  4FW1 A;  3VF4 A;  4EP5 A;  4QS8 A;  3MK6 A;  4RW6 A;  3QDK A;  4DV2 K;  4IBN A;  2UUC K;  1W2B M;  4JI2 K;  4JRQ A;  4DB3 A;  1GLC G;  4CK2 A;  3LDP A;  4B1X B;  1SAZ A;  4BR2 A;  4A5A A;  3HZ6 A;  1U47 A;  3FZH A;  4K42 A;  4LF7 K;  3RSE A;  4LFA K;  4E1N A;  4X64 K;  3MN7 A;  2HVI A;  4BR0 A;  4QOZ B;  5IWA K;  5J2M A;  3P39 A;  5E84 A;  1C0G A;  4GW6 A;  3IS9 A;  4FJ9 A;  3CFP A;  5AQX A;  2UUB K;  3CC2 N;  3E9P A;  3SUO A;  4ILG B;  4DV4 K;  4CK1 A;  2Q97 A;  2EX3 A;  1FW6 A;  2KFZ A;  2I7N A;  3QLH A;  5C2D A;  1YI2 N;  3HM8 A;  5CZ2 A;  1YHQ N;  2X6S A;  3I33 A;  2IVP A;  4OGE A;  3CJ7 A;  4XH4 A;  5DM6 L;  4LFC K;  2QXF A;  1NG9 A;  2HBM A;  3RRG A;  1IO2 A;  1Q7Y O;  1H1V A;  4CHN A;  3MCP A;  4OJR A;  3S3N A;  1BCO A;  1HNZ K;  3DLG A;  4WFA L;  3F9M A;  4FJG A;  4CJQ A;  4B3M K;  3CG7 A;  4JKF A;  3ZX3 A;  3MX2 A;  1VRU A;  3LDO A;  4CJT A;  4CK3 A;  3SAF A;  1P90 A;  2E6L A;  5J2P A;  3CIP A;  4AHT A;  3L8B A;  4UQG A;  4B1W B;  3NGY A;  3RWU A;  2WOM A;  1X1P A;  2ASP A;  1WAJ A;  2IVO A;  3P5J A;  4H5R A;  3DLH A;  3LM2 A;  5AZJ A;  1C0U A;  2B6A A;  2V51 B;  3K5N A;  4FOI A;  5M1Q A;  2D0O A;  4K43 A;  1KVA A;  3LAN A;  3SYZ A;  2RE2 A;  4O0J A;  1SL1 A;  4BGB A;  1NKE A;  3J7Y P;  4DQ8 A;  3OYB A;  1TUY A;  1J54 A;  4CBW A;  3C6H A;  1OH8 A;  1HUX A;  4DTR A;  4UY8 O;  1VK0 A;  2UUA K;  1MU2 A;  1OH6 A;  3SV3 A;  3L6Q A;  2QM1 A;  1HKG A;  1UA1 A;  1ASU A;  4CEE A;  4JRP A;  1ZC6 A;  1WLJ A;  4JI4 K;  4LF4 K;  3WXL A;  4DR4 K;  2VWJ A;  4KBO A;  1YTA A;  4BC2 A;  5BN8 A;  3S41 A;  2NUB A;  4W5Q A;  4MDB A;  3L2Q A;  4H0Y B;  3V9X A;  4FW2 A;  4O5F A;  1K9M O;  2Y1I A;  3VQ4 A;  1HYZ A;  1XWL A;  1VQ8 N;  3VQP A;  2BH1 A;  4Y0W A;  4BRL A;  3HO1 A;  1Z25 A;  4JKG A;  4X66 K;  1QZ6 A;  4KAZ A;  3KKR A;  5AQG A;  3VOV A;  5HRR A;  1TGO A;  3RVC A;  3ZSO A;  3GG4 A;  4K25 A;  1C6V A;  4PKH A;  1CZ9 A;  3KHY A;  3LM9 A;  2IOC A;  4I7F A;  1HKC A;  1JLQ A;  3TI0 A;  4XH5 A;  3OYN A;  2JWL A;  4YOT A;  1MDU B;  3HTV A;  3PY8 A;  4FO0 A;  5E41 A;  2E1Z A;  3WEE B;  3IAY A;  1GLJ O;  1IKX A;  2HF3 A;  4FWN A;  5H1S Q;  4CEB A;  5SZT A;  2CH5 A;  3K0S A;  1KAZ A;  4HUE A;  5KI6 A;  2ZQB A;  1SZ2 A;  3M1F A;  1JLG A;  4LC9 B;  5CZ1 A;  3DLR A;  4AHC A;  4DUZ K;  4OX9 K;  4JLH A;  2GWK A;  1D9D A;  4IOX A;  5J2N A;  2F4V K;  4XEI A;  3NFA A;  2ZJR L;  2W40 A;  2P9K B;  5AQO A;  2G8I A;  3CQ8 A;  3LDL A;  3EKU A;  1GLB G;  4JHD A;  4QS7 A;  4FJH A;  3WXI A;  3RMA A;  3SQ1 A;  5HRN A;  4M3X A;  2E5L K;  1BU6 O;  2JWK A;  3AVI A;  4DKW A;  5TKY A;  3S3O A;  1FK9 A;  2HB5 A;  2RN2 A;  3NH0 A;  1SL0 A;  4FPB A;  4E89 A;  3UE5 A;  4DF4 A;  4BE1 A;  1RT4 A;  3LDN A;  3VQ9 A;  4E7H A;  2O8B A;  1RT2 A;  4MQ3 A;  3WNH A;  3VER A;  3THV A;  3ZT3 A;  5C15 A;  2NRX A;  4A62 A;  4DQQ A;  1CXQ A;  3OJU A;  4OKK A;  1A5X A;  4IEE A;  4ICL A;  2P9P A;  3TAR A;  2G8V A;  5M1N A;  3OYM A;  3DLL L;  4CBX A;  3U3Y A;  3PO4 A;  5JIC A;  3A5L C;  1QQO A;  5DM7 L;  2DY4 A;  1T6C A;  2Z1G A;  1NGF A;  2ITM A;  2NRZ A;  5AQL A;  1SV5 A;  4W5R A;  1GLE G;  3LZJ A;  1XC9 A;  4K8Z A;  3G25 A;  3AVG A;  4M3U A;  3KD5 E;  1RT3 A;  3HPO A;  4H0T B;  2PYJ A;  4B1Y B;  4ILJ A;  3S9H A;  3QES A;  1TAU A;  4FLW A;  1X9M A;  4CGH A;  4FJ7 A;  5C12 A;  4DTJ A;  1QQC A;  4FYD A;  4FVU A;  1TKZ A;  1IKW A;  1S3X A;  4DTO A;  2W42 A;  1XMO K;  3NF9 A;  1D9F A;  2DPN A;  3K9K A;  3QIP A;  5KQD A;  1RBR A;  4A2B A;  4F3T A;  2RKI A;  3LDS A;  3P83 D;  1XNR K;  3THX A;  1NGG A;  1NWK A;  4IO8 A;  3UB5 A;  4CF0 A;  5CYM A;  3M8P A;  1QSY A;  3PSF A;  3CCL N;  1JL1 A;  5SWM A;  3HOT A;  5I3U A;  3SQ0 A;  3R9P A;  4M3Y A;  4CEO A;  4K41 A;  5EU7 A;  3L4I A;  4DTU A;  4F2R A;  3LWL A;  5C42 A;  3TAM A;  3QBX A;  4B1U B;  4I9L A;  5GIP A;  4GV9 A;  4JD2 A;  4MO5 A;  2HHH K;  5KRT A;  4A61 A;  3WXM B;  3B6O A;  4DU3 A;  2GUI A;  3CMA N;  2GEM A;  3M6G A;  1NGI A;  4XIU A;  4CZK A;  5AQI A;  2OPP A;  1DLO A;  5BPL A;  3ZSX A;  3CFO A;  2VQE K;  5LY3 A;  2CGL A;  2VYP A;  4M41 A;  4OGC A;  2V7Y A;  1BO5 O;  1S1X A;  3DRP A;  1TK8 A;  4FWM A;  4FJM A;  3T7Z A;  2FF3 B;  3TAE A;  3F9K A;  4C1N K;  2YKN A;  4JKG B;  4KH5 A;  1C0T A;  4JKH A;  4DR1 K;  1ASW A;  1BGX T;  1BIZ A;  4B9V A;  3H6E A;  4JK9 A;  3O80 A;  3EN9 A;  1DEJ A;  4B9N A;  4JKE A;  4CHZ A;  2G8U A;  3OYL A;  3E9O A;  5CE3 A;  5KTQ A;  1IKV A;  1QVF M;  4DWI A;  3CCJ N;  1G99 A;  4B1Z A;  4BDZ A;  2YNF A;  2Y1J A;  4CZL A;  4C8O A;  4HVJ A;  4KHS A;  1YF5 L;  4N5S A;  2FBY A;  3AAP A;  4CHP A;  5GIO A;  4E7L A;  4DS4 A;  3ENO A;  4X62 K;  1NOY A;  1J9A A;  2ETJ A;  1IBL K;  1TKD A;  4CJ5 A;  3HXM A;  2OAN A;  3VET A;  1NJW A;  2OZM A;  1EET A;  4CEQ A;  5DMR A;  2W6L A;  3SMS A;  2O8C A;  1OKJ A;  3O4W A;  3DXK A;  4QS9 A;  1HNV A;  3B6P A;  3HL8 A;  4RW9 A;  1WUA A;  1R59 O;  3SCX A;  4W5O A;  3M5R A;  1VQN N;  4OLA A;  5M1O A;  2OPR A;  4DQI A;  2QI2 A;  4JKC A;  2FSN A;  1J5E K;  1I94 K;  3SNN A;  1NK9 A;  4ZTF A;  1RT7 A;  4KHP K;  4CIE A;  1X9W A;  4L3Q A;  1EO1 A;  3G4S N;  3E1Y A;  3WNE A;  5FRO A;  4AHR A;  2O8B B;  5FPN A;  4FWK A;  2ZGY A;  4YHH K;  3QEX A;  1EXQ A;  2O8D B;  4B9Q A;  2IIR A;  3THY A;  4H0P A;  1VSF A;  4G9Z A;  1BL3 A;  1JL2 A;  2Z1J A;  1VSE A;  3QEP A;  3PX4 A;  5AQN A;  4E0D A;  4BC4 A;  4JN4 A;  1JLC A;  4Z4E A;  4NB4 A;  3OYI A;  1IJJ A;  4HCB A;  2UXC K;  3HST B;  3ASM A;  5C24 A;  1E4F T;  2E20 A;  3IFR A;  1TK0 A;  4DFM A;  2P9U A;  1OVY A;  2D0A A;  3VTI A;  3PV8 A;  5AQS A;  4DU1 A;  2FLO A;  4DFP A;  3OVN A;  4K0K K;  3ZET B;  3K2P A;  2QWP A;  1XNQ K;  3D2E B;  4R79 A;  2RHK A;  5JVG L;  1E3M A;  4IFE A;  2YJF A;  4YNQ A;  3O3G A;  1NGH A;  1EP4 A;  3ZLJ A;  3OYC A;  5AQF A;  1LWF A;  4I6M A;  2E1Y A;  2YX6 A;  1RT6 A;  5AZI A;  2ITG A;  1D8Y A;  3PIO L;  1XI1 A;  1N34 K;  1QS4 A;  2H3G X;  1KAX A;  1ZBL A;  4AHU A;  4B9T A;  3TTF A;  4FJK A;  4WF9 L;  2D0C A;  3AO5 A;  4DSJ A;  4CEZ A;  3OYF A;  4ISE A;  3VF2 A;  1SL2 A;  2ZF5 O;  4LSL A;  4DTN A;  2E8A A;  5BRE A;  4FZZ A;  2EHG A;  4JD2 B;  3RTV A;  2PAV A;  3QFP A;  3K58 A;  3O1W A;  3ULE A;  3ZSZ A;  4AQY K;  1YVN A;  4CGD A;  4BRE A;  3TSP A;  3DMJ A;  1WSE A;  2HND A;  1TV6 A;  4J2D A;  3ALY A;  5BN9 A;  4B3O A;  4OVL A;  4H5T A;  2EWS A;  3N4P A;  1NK6 A;  2XY7 A;  4H5N A;  3RR7 A;  4B8A B;  3RMC A;  4A2A A;  3JS6 A;  4E7J A;  4WQ4 A;  1YJN N;  4BRI A;  4DSK A;  2X78 A;  2VG5 A;  3SUN A;  5BRF A;  1HRH A;  2GUP A;  4PUO A;  3EEQ A;  4YOX A;  3W0L A;  4CFA A;  4DSF A;  1D4X A;  1LW0 A;  1S5J A;  3SBG A;  1L5U A;  3AVF A;  4KHQ A;  3OHR A;  3VQ6 A;  1QVG M;  2CGK A;  3AY9 A;  4CE9 A;  4DR6 K;  2E2O A;  4O0I A;  4C8K A;  1YUW A;  4I9Q A;  3L2R A;  3O4N A;  4FLY A;  3V9Z A;  4A59 A;  4CZF A;  4IKF A;  3A5N C;  3MEG A;  1JLB A;  2NRT A;  3CJA A;  3VEV A;  3SQ2 A;  2DFH A;  2XY8 A;  1RDB A;  1V4S A;  1NNE A;  3DXK B;  4N41 A;  1NGJ A;  4CFD A;  1ILY A;  4BAC A;  1B9D A;  4Y1C A;  4CHY A;  1EQY A;  4JI7 K;  4A57 A;  3HVR A;  3MEE A;  4CJF A;  3I55 N;  4YDU C;  4CJ4 A;  3KD1 E;  3TR8 A;  1W97 L;  4OKJ A;  4CGJ A;  5LMU K;  3O9R A;  2IC3 A;  3HP6 A;  3IUC A;  3M3Z A;  4BGA A;  2QWO A;  3CFR A;  4DTX A;  3D45 A;  4KTQ A;  1LCU A;  2HBK A;  4KH6 A;  5F1X A;  2FBT A;  2OTJ N;  5ADX A;  5J1E A;  4DQS A;  1NGA A;  3TU5 A;  4HUG A;  2IDO A;  2VG6 A;  4IFY A;  3CJB A;  4KTZ A;  3PUF A;  3IRX A;  4AHV A;  2Q0R A;  2P1J A;  3HT3 A;  1QSL A;  1N8R O;  3KTQ A;  3THY B;  3GE1 A;  1JKH A;  1KSP A;  5EXW A;  2HHS A;  2FXU A;  5EX5 A;  1SQK A;  3SUP A;  4CBU A;  4WFN L;  4FPA A;  3BP8 A;  4C1N I;  1DTT A;  1RDU A;  1HYS A;  4DLE A;  2P5G A;  5GAG P;  4E7I A;  4BG8 A;  4YFU A;  3M8S A;  1JCE A;  3HJF A;  1A5V A;  2IVN A;  4C8L A;  5LJV A;  4I2Q A;  1P8Z A;  2YV0 X;  2JLE A;  4H4O A;  2P9U B;  1SS6 A;  3MEC A;  4FWO A;  4BR4 A;  3V9W A;  4H0X B;  1BI4 B;  3ISN C;  3LP1 A;  4Z4F A;  4GKJ K;  1BOT O;  3LAL A;  5AQQ A;  2QKK A;  2V52 B;  3I8B A;  3BZK A;  3U9Z A;  1HYV A;  3DOK A;  1BIS A;  4BC3 A;  1T03 A;  4AM7 A;  3R1X A;  1TL3 A;  5KPR A;  2HHU A;  5AZI B;  4DV0 K;  4FM1 A;  1LAW A;  3RRH A;  4DS5 A;  4J2E A;  3Q7C A;  4CVN E;  1WSG A;  3MDQ A;  3GL1 A;  3A0I X;  4X65 K;  2FBX A;  1QQM A;  1U04 A;  3L2U A;  4RG8 A;  3VQ8 A;  4CW7 B;  1VSI A;  3V1O A;  3K9J A;  1KVC A;  3SPY A;  4FJX A;  4BRG A;  3T69 A;  4KPY A;  1TKX A;  3UKU A;  4F8R A;  2YHX A;  1X9S A;  3AO4 A;  3ULE B;  1VSK A;  5B8H A;  1T6D A;  3V1Q A;  4PKG A;  1J53 A;  1W9H A;  3VGK A;  2HHX A;  2F8S A;  4CGF A;  3M8R A;  3EY1 A;  1NK0 A;  4LH4 A;  3CPE A;  4CJE A;  3AVH A;  4IDK A;  3DLB A;  4CHO A;  2O4I A;  4WE1 A;  3OW2 M;  4Q5V A;  1XQS C;  4CZH A;  2Q31 A;  4NCG A;  2YNH A;  3VGL A;  2ZJP L;  2RPI A;  4IDH A;  4CGI A;  2P9S B;  3PIP L;  5BRD A;  4ELV A;  4GV6 A;  1TK5 A;  4BRF A;  4LFB K;  4M7Y A;  1VQP N;  2NLX A;  3VQ5 A;  3OBW A;  1GLA G;  1YVU A;  3DRR A;  1WBB A;  4FLU A;  1WSF A;  3UIQ A;  3KK1 A;  4FJ5 A;  2BAN A;  3K59 A;  2XHB A;  4FK4 A;  2HNZ A;  1D5A A;  1C0F A;  5BPN A;  3O08 A;  2GX9 A;  3NE6 A;  1U45 A;  2PY5 A;  3O9S A;  3K5O A;  4DR3 K;  3J7A P;  1ATS A;  2F9W A;  1N5Y A;  5LJW A;  3BF3 A;  2D1K A;  1RDW X;  3H1Q A;  3AA5 X;  1HNI A;  2KTQ A;  3A5M C;  2YKM A;  2A42 A;  4ISG A;  4ZHR A;  2E2N A;  4CEC A;  2PZS A;  1S9E A;  3ZX2 A;  1IG9 A;  1S72 N;  1ATN A;  3LP3 A;  4RWT A;  4BRA A;  5C10 A;  1BQN A;  2QA4 N;  4H03 B;  2NRR A;  3TAN A;  5CR4 A;  4CJV A;  1MWK A;  1HPM A;  3AA2 A;  5AQR A;  3J81 O;  3MXM A;  1RNH A;  1O13 A;  3CCV N;  3R8E A; 
#chains in the Genus database with same CATH homology
 4C23 A;  2NRV A;  2P9N B;  4MDA A;  4BRM A;  1QVF M;  3RSE B;  3CCJ N;  1G99 A;  3ID6 A;  4B1Z A;  4BRK A;  3C0B A;  3NVK A;  1VQ4 N;  3SAH A;  4CZL A;  3O9Q A;  3KWI A;  5FPM A;  1YF5 L;  1U2V B;  3AAP A;  2ZWH A;  5F0X A;  5GIO A;  3BEX A;  1YIT N;  4CI6 A;  5AQY A;  5EOY A;  4HWI A;  4I6M B;  3ENO A;  1VQ6 N;  3WUH A;  3MN5 A;  3DWL A;  5AQU A;  3C7N A;  3TSU A;  3IKM A;  4IOC L;  3GBT A;  2QW9 A;  2E88 A;  2OAN A;  3CQX A;  3VET A;  3QBW A;  3VF6 A;  2GWJ A;  3VEN A;  5TKW A;  3CPW M;  4BR7 A;  2ZJQ L;  4E1J A;  3CCU N;  3SMS A;  1Q18 A;  1OKJ A;  2NRW A;  3GDQ A;  3O4W A;  3DXK A;  4CD3 A;  4QS9 A;  3LL3 A;  3QB0 A;  4FL9 A;  1V4T A;  3IMX A;  2D0P A;  1WUA A;  3OA9 A;  3U8X A;  1R59 O;  4PKI A;  1VQN N;  3M5R A;  1VQL N;  1Y64 A;  5M1O A;  2FF6 A;  3CI5 A;  4MO4 A;  3G6E N;  2KHO A;  3P4I A;  2QI2 A;  1NMD A;  4JKC A;  4YOU A;  1Z6R A;  2FSN A;  3F5T A;  1KAY A;  1WOQ A;  4JAX A;  2F9T A;  2P9S A;  1ZBS A;  2QXL A;  5C2F A;  2PBD A;  2E2Q A;  3H1V X;  3FR0 A;  3VES A;  4WCE L;  4JEP A;  3L4Q A;  3CCR N;  3SLC A;  4FWQ A;  1X9J A;  3JXU A;  4L3Q A;  2F7T A;  1EO1 A;  1VQ7 N;  1QZ5 A;  3G4S N;  3E1Y A;  4FWS A;  1ESV A;  2ASM A;  3TSQ A;  5AQM A;  3G71 N;  1Q81 O;  3U9D A;  5FPN A;  4YDU A;  4FWK A;  3PLA A;  2ZGY A;  2VGN A;  1HLU A;  3VMF B;  5H1S Q;  1GLL O;  4CZM A;  5ADX H;  4JK7 A;  4B9Q A;  1KC8 O;  5AZJ B;  4YOY A;  2CH6 A;  2IIR A;  3F2K A;  3LDQ A;  4WYB A;  3ZEU A;  3HSC A;  4EFH A;  1LOT B;  2NRH A;  4H0P A;  5KQ8 A;  3WEE A;  3WXK A;  4EAH D;  4G9Z A;  1MWM A;  5AQN A;  4FWL A;  1YIJ N;  2A40 A;  1YJW N;  2ZGZ A;  3EE9 A;  4BC4 A;  3EL2 A;  4JN4 A;  1M1K O;  1U6Z A;  5AQV A;  3CXC M;  3SBT A;  3BUZ B;  4NB4 A;  3EZW A;  3CME N;  1IJJ A;  4NO7 A;  4BVO A;  3P31 A;  4MLH A;  3UKU B;  2GTD A;  3WXJ A;  4ILH A;  1E4F T;  3CER A;  5AQP A;  1Q82 O;  2E20 A;  3IFR A;  2I7P A;  3DAW A;  4WQ5 A;  3VF4 A;  4QS8 A;  4CZG A;  3H3O B;  4OPH A;  1X3N A;  3MK6 A;  2P9U A;  1OVY A;  5AR0 A;  2HF4 A;  3QDK A;  1VQ5 N;  3VTI A;  3A5O C;  4EHU A;  1Q86 O;  5HL7 L;  2W41 A;  5AQS A;  1X3M A;  1W2B M;  2HMP A;  3CCS N;  4BRD A;  2FLO A;  1GLC G;  4DB3 A;  2GEL A;  3LDP A;  4B1X B;  4CJ7 A;  1SAZ A;  3J7Z O;  4JKB A;  4BRC A;  4BR2 A;  4NLB A;  3KVG A;  3R6M A;  4A5A A;  3HZ6 A;  2P9N A;  3FZH A;  3ZET B;  4K42 A;  2QWP A;  5MLC Q;  3RSE A;  1TYQ A;  3CCE N;  3D2E B;  3MN7 A;  3I56 N;  2BTF A;  4BR0 A;  1YXQ A;  4R79 A;  2RHK A;  1BA0 A;  4CZI A;  1CZA N;  1RGI A;  5JVG L;  4IFE A;  3CET A;  3H3N O;  2YJF A;  5BPM A;  3P39 A;  1NGH A;  5E84 A;  1C0G A;  2QEX N;  4BR9 A;  4BY9 C;  5AQF A;  5AQX A;  4I6M A;  3CC2 N;  3E9P A;  2E1Y A;  3VEY A;  2YX6 A;  3MWT A;  4ILG B;  5AZI A;  2Q97 A;  3D7E O;  3PIO L;  2I7N A;  1TUU A;  3DXM A;  1NGC A;  5C2D A;  2ASO A;  3HM8 A;  2H3G X;  1KAX A;  1YI2 N;  1YHQ N;  3FZK A;  4JNE A;  3MN6 A;  3I33 A;  5EY4 A;  5AQK A;  3TTF A;  2IVP A;  3U4L A;  2YCH A;  5F2R A;  4WF9 L;  3CJ7 A;  2BUP A;  3BF1 A;  4XH4 A;  3VEO A;  3N4Q A;  4PL8 A;  4CZE A;  5DM6 L;  4ISE A;  3VF2 A;  2P9I A;  2ZF5 O;  5AQH A;  2HBM A;  5FPD A;  2E8A A;  4BQZ A;  1Q7Y O;  1H1V A;  3ENH A;  5BRE A;  1JCG A;  3WQU A;  3MCP A;  4JD2 B;  3CQY A;  2HBJ A;  3D2F B;  5ELZ A;  2PAV A;  2OTL N;  3QFP A;  4WFA L;  3F9M A;  2CGJ A;  2YI1 A;  3O1W A;  3ULE A;  1YVN A;  3VTH A;  4BRE A;  3O9U A;  4JKF A;  3ZX3 A;  3MX2 A;  3TSP A;  3LDO A;  2UYT A;  3QFU A;  1NBW A;  4PHT X;  3HRG A;  3SAF A;  1P90 A;  5BRH A;  1VQM N;  3OBY A;  3CIP A;  4BVP A;  5BN9 A;  1BUP A;  2QWR A;  4H5T A;  2EWS A;  2VGM A;  3N4P A;  4B1W B;  3CD6 N;  4H5N A;  3VPZ A;  4A2A A;  2ASP A;  2IVO A;  3JS6 A;  2A6A A;  4H5R A;  3EKS A;  4JHD B;  4WQ4 A;  1YJN N;  3LM2 A;  3D6R A;  4IWV A;  4BRI A;  5AZJ A;  4NLC A;  2V51 B;  1NGB A;  3MN9 A;  4FOI A;  2D0O A;  5M1Q A;  3TPQ A;  4K43 A;  2GUP A;  5BRF A;  3KK7 A;  3O5B A;  4YOX A;  2P9L A;  2RE2 A;  3W0L A;  1YAG A;  3ID8 A;  4BGB A;  2AP1 A;  5AQW A;  3ZYY X;  3CHW A;  1K8A O;  1D4X A;  4FSV A;  3SBG A;  4DQ8 A;  3UKR A;  1TUY A;  4CBW A;  3OHR A;  3C6H A;  4RCH A;  3H46 O;  1HUX A;  4DCH A;  1QVG M;  4UY8 O;  3ATV A;  1HX1 A;  2CGK A;  3AY9 A;  3C6A A;  3AGR A;  2E2O A;  3L6Q A;  4WFB L;  1YUW A;  5M1K A;  4BRQ A;  5KPT A;  2QM1 A;  4WQ4 C;  1HKG A;  2P9P B;  3C7N B;  3VEW A;  2QWM A;  3NVM A;  5KPZ A;  4A59 A;  4CZF A;  4IOA L;  1NJI O;  3A5N C;  1ZC6 A;  2A5X A;  2NRT A;  1K8K A;  4BRN A;  4H5V A;  3CJA A;  4BG9 A;  4JKD A;  3WXL A;  3VEV A;  5GIN A;  5AFU H;  4AM6 A;  4KBO A;  1IG8 A;  4GY2 B;  1V4S A;  4BC2 A;  5BN8 A;  3DXK B;  1NGJ A;  3S41 A;  1ATR A;  4B1V A;  4MDB A;  1ILY A;  3VEX A;  3MCA B;  3ZET A;  4H0Y B;  1EQY A;  2A41 A;  4O5F A;  4A57 A;  4KH4 A;  3D2E A;  3I55 N;  3HOS A;  4YDU C;  1K9M O;  3DJC A;  1W97 L;  3O6W A;  3SAG A;  4YOR A;  1VQ8 N;  1VAZ A;  2BH1 A;  3O9R A;  2QTD A;  5C0Y A;  4Y0W A;  4F9O A;  4BRL A;  5JLH A;  4JKG A;  3IUC A;  1QZ6 A;  3M3Z A;  2QWO A;  4BGA A;  5AQG A;  3VOV A;  2FSK A;  3E9L A;  3FLC O;  3RVC A;  5JMV A;  3ATU A;  3GG4 A;  4K25 A;  3Q7B A;  3MMV A;  1LCU A;  4PKH A;  2HBK A;  3MWP A;  3KHY A;  4KH6 A;  5F1X A;  3LM9 A;  2OTJ N;  2YHY A;  1HKC A;  3CJ1 A;  4U67 L;  5ADX A;  2Q36 A;  1NGA A;  3TU5 A;  4U7B A;  1T3V A;  3HBT A;  3CJB A;  4MLE A;  4XH5 A;  1U2V A;  4WQ5 C;  2JWL A;  2VCP A;  4YOT A;  3CF5 L;  2Q0R A;  1MDU B;  2NZT A;  3HTV A;  3ZEU B;  4FO0 A;  1N8R O;  1HJO A;  3GE1 A;  2E1Z A;  3WEE B;  5EXW A;  1GLJ O;  2HBL A;  2FXU A;  2HF3 A;  5EX5 A;  1SQK A;  4CBU A;  4WFN L;  4FWN A;  3O9T A;  4FPA A;  2YHW A;  2CH5 A;  3BP8 A;  1KAZ A;  3CJ9 A;  4O8U A;  3SMP A;  4C1N I;  5I9E B;  3TTD A;  1RDU A;  5GAH P;  1BWF O;  4BRP A;  1SZ2 A;  3M1F A;  4LC9 B;  4HTL A;  5GAG P;  4YOW A;  2GWK A;  4BG8 A;  1E4G T;  3KWG A;  4IOX A;  1JCE A;  3A8Y A;  2IVN A;  3TTC A;  5LJV A;  3C65 A;  4XEI A;  1P8Z A;  2ZJR L;  4A5B A;  2W40 A;  2P9K B;  5AQO A;  3LDL A;  1KQS M;  3EKU A;  1GLB G;  2P9U B;  3MX5 A;  1NM1 A;  4JHD A;  4QS7 A;  1SS6 A;  3L0Q A;  1K73 O;  3CC7 N;  1VQK N;  3WXI A;  4FWO A;  2D4W A;  3H45 C;  2E2P A;  1BU6 O;  4BR4 A;  1RFQ A;  2JWK A;  3FZF A;  4DKW A;  4GVE A;  3CCQ N;  5TKY A;  4H0X B;  2AA4 A;  3QIC A;  4CZJ A;  4O8K A;  1TYQ B;  2FSJ A;  4H0O A;  1NGD A;  4FPB A;  2YJE A;  1BOT O;  3UE5 A;  5AQQ A;  5BR9 A;  3LDN A;  4OO1 J;  4ISF A;  2V52 B;  3I8B A;  3U9Z A;  2WUS A;  1QHA A;  3VER A;  4BC3 A;  4AM7 A;  5C15 A;  3R1X A;  1XUP O;  4OPA A;  4BRO A;  4CD1 A;  4DHY A;  2NRX A;  4A62 A;  5AZI B;  4BRH A;  1NGE A;  5KPR A;  4IEE A;  4FOE A;  2P9P A;  5M1N A;  3Q7C A;  3DXM B;  1DT9 A;  3DLL L;  4IXC A;  3MDQ A;  3AAQ A;  3GL1 A;  3A0I X;  5JVH L;  4CBX A;  5EVZ A;  1QQM A;  2J4R A;  3FZM A;  3ENB A;  3NMU A;  5JIC A;  2WC9 A;  3WQT A;  3A5L C;  3ZX0 A;  4RTF D;  1QQO A;  3K9J A;  3SJH A;  5DM7 L;  2Q0U A;  5AQT A;  2P9I B;  5AQZ A;  1T6C A;  4BRG A;  3SK3 A;  5FPE A;  3T69 A;  3IDH A;  4BC5 A;  1NGF A;  2ITM A;  2NRZ A;  5AQL A;  1GLE G;  2Q1N A;  2Q2R A;  2QWN A;  3AGK A;  3UKU A;  2YHX A;  1YJ9 N;  3G25 A;  3ULE B;  4H0T B;  5B8H A;  1T6D A;  1JJ2 M;  5HOO A;  4B1Y B;  4ILJ A;  3AAR A;  3VGM A;  4PKG A;  3VGK A;  1M90 O;  1DKG D;  5C12 A;  4EHT A;  3CPE A;  4FVU A;  3HI0 A;  1S3X A;  1VQO N;  4H5W A;  3OW2 M;  1XQS C;  4CZH A;  3W3D A;  2Q31 A;  4M7X A;  3CCM N;  2V7Z A;  2DPN A;  3J8A A;  3K9K A;  1KXP A;  3P38 A;  4IDH A;  3VGL A;  4IEI A;  5JLF A;  5KQD A;  2ZJP L;  4IO9 L;  4XH1 A;  4A2B A;  2P9S B;  2NNW A;  3PIP L;  5BRD A;  2P9L B;  2WFB A;  1NLV A;  3FE1 A;  1BA1 A;  4GV6 A;  3EO3 A;  1NGG A;  1NWK A;  4BRF A;  4IO8 A;  3GOI A;  1ZXO A;  3UB5 A;  4M7Y A;  3UKR B;  1VQP N;  1DGK N;  2NLX A;  3CJC A;  4IJA A;  3FZL A;  3OBW A;  2QWQ A;  1GLA G;  3CCL N;  5E26 A;  4BR5 A;  3HOT A;  2PFU A;  3R9P A;  3CC4 N;  1T44 A;  5GAE P;  4K41 A;  3O1B A;  3L4I A;  1GLF O;  4JK8 A;  3QBX A;  3VEZ A;  1XC3 A;  2KLA A;  4B1U B;  1C0F A;  2P9K A;  2A3Z A;  3O08 A;  2GX9 A;  5BPN A;  1Z05 A;  3KZB A;  5GIP A;  4GV9 A;  2WBN A;  1GLD G;  1MA9 B;  4JKA A;  4JD2 A;  1K8K B;  3O9S A;  4MO5 A;  3D2F A;  4Z94 A;  5AFU A;  1BG3 A;  1ATS A;  2F9W A;  4FWR A;  5LJW A;  3BF3 A;  4FWP A;  2D1K A;  5M1P A;  4A61 A;  1RDW X;  3H1Q A;  3WXM B;  5AQJ A;  4BQL A;  1BDG A;  3FFK B;  3A5M C;  4IJN A;  3CMA N;  3WT0 A;  1S72 N;  2GEM A;  3M6G A;  5M1F A;  1NGI A;  2A42 A;  4ISG A;  2QWL A;  2HST A;  4CZK A;  3O8M A;  5AQI A;  2E2N A;  4AF1 A;  4EIA A;  5CHI A;  5BPL A;  2VWB A;  2CGL A;  2VYP A;  5LY3 A;  5GAD P;  3ZX2 A;  2V7Y A;  1BO5 O;  4H0V B;  4FWM A;  3T7Z A;  1JCF A;  2FF3 B;  1ATN A;  3E66 A;  3QML A;  4PL7 A;  4RWT A;  3B8A X;  3R3L A;  4BRA A;  4C1N K;  4GV3 A;  4J8F A;  1VQ9 N;  5C10 A;  1KD1 O;  1J6Z A;  4M63 C;  4IZ9 A;  4JKG B;  4KH5 A;  4YOV A;  2QA4 N;  4H03 B;  4JKH A;  2NRR A;  1HKB A;  1QQN A;  1S22 A;  2HOE A;  5CR4 A;  3H6E A;  1MWK A;  1HPM A;  2KKZ A;  3FGU A;  3O80 A;  4JK9 A;  3EN9 A;  1DEJ A;  5AQR A;  4JKE A;  4GNI A;  3EE8 A;  3E9O A;  1O13 A;  3CCV N;  5CE3 A;  3R8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...