2CH6A

Crystal structure of human n-acetylglucosamine kinase in complex with adp and glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
343
structure length
343
Chain Sequence
AAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYL-D-GLUCOSAMINE KINASE
publication title Structures of Human N-Acetylglucosamine Kinase in Two Complexes with N-Acetylglucosamine and with Adp/Glucose: Insights Into Substrate Specificity and Regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 343
sequence length 343
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.59: N-acetylglucosamine kinase.
pdb deposition date 2006-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch6A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2ch6A02
4FWNA 1YXQA 1Z6RA 1IG8A 2VYPA 1BUPA 2HF3A 2P9IA 2FXUA 1NGBA 1DKGD 2A3ZA 2UYTA 1KAZA 3VOVA 2E20A 5I9EB 1HLUA 2YHWA 2HOEA 3QMLA 5AQHA 1WUAA 5AQLA 3QBXA 4H5VA 4A2AA 2V7YA 5F1XA 3BP8A 2DPNA 4BRNA 5FPNA 3FZKA 3CJ9A 4IJAA 4DCHA 2IVPA 2F9TA 3HBTA 3U8XA 1SQKA 3RSEA 3HZ6A 4IZ9A 3TPQA 4BRPA 1Z05A 1KAYA 3IFRA 3J8AA 2P9NA 3BUZB 3O08A 3S41A 1GLLO 1BDGA 3LL3A 2IIRA 4CBUA 2FSKA 4BC5A 4BC2A 3DXKB 2VCPA 1CZAN 3LDNA 1X3NA 3VGKA 3H3NO 4HWIA 3UKUB 5KQDA 3VEYA 2GTDA 5AQYA 3GE1A 3LDPA 3MK6A 4JHDA 4FWPA 4HTLA 2HMPA 1QQOA 3MDQA 2YI1A 1YVNA 1MWKA 5BN8A 3IUCA 3CQYA 3JXUA 4Y0WA 5LY3A 1K8KB 1U6ZA 5AQZA 1X9JA 2GELA 4BGAA 4DQ8A 5EVZA 3SK3A 4EHUA 4H5RA 3ID8A 2FSJA 2FLOA 2I7PA 1NGCA 4K25A 1ZXOA 5BREA 3VERA 2A40A 2P9SB 5AQOA 3CIPA 3CJBA 4JD2A 4BREA 4PKIA 4FWLA 1ATRA 3ZX0A 5CE3A 2E2PA 1ZC6A 4A2BA 4B1WB 1OKJA 2Q97A 1NBWA 3VEOA 4CBXA 3P4IA 2P9PA 3M1FA 4H5TA 4IWVA 3H46O 1QQMA 3VF6A 4CZKA 1G99A 4JN4A 4NB4A 1TUUA 3ULEA 4CZGA 3VPZA 1NGAA 3DWLA 3LM2A 1TYQB 4BRDA 2FF3B 3QFUA 3VGLA 4WQ5C 1NGHA 4YDUC 2F9WA 1QQNA 3IDHA 5E26A 3D2FA 2ASPA 4WQ4C 2ZF5O 3QICA 3KHYA 1GLDG 2NZTA 3BEXA 3AARA 4IXCA 3DAWA 5KPRA 3U4LA 4CBWA 4FOIA 1ATNA 4FOEA 4RTFD 5BPNA 2FSNA 3TU5A 1TUYA 4BR4A 3L0QA 3D2EB 3HM8A 4FPBA 3EZWA 1D4XA 3HI0A 2E1YA 1NGIA 5AQTA 3HSCA 4BRKA 1GLFO 4CZMA 3VEVA 1JCEA 3VEWA 5AQRA 4MLHA 4BRIA 5B8HA 1BO5O 1IJJA 3FZMA 3C7NB 4K41A 3FE1A 4K43A 4FSVA 2BTFA 2QXLA 5AFUH 4H0OA 3A5LC 3O80A 3VESA 2CH6A 2A6AA 2CGJA 2D0PA 5KPZA 4FWKA 1QZ5A 4J8FA 2I7NA 2ITMA 4RWTA 5BPLA 3MN7A 3CI5A 4H0VB 3W0LA 4RCHA 3AY9A 3UB5A 4EFHA 2A5XA 5AQPA 4MO4A 4BVPA 4GY2B 4XH1A 5JLHA 5BRHA 4L3QA 5AQJA 2YHXA 3U9ZA 4B1UB 4PL8A 3BF3A 3M3ZA 3QB0A 3SMSA 3CJAA 3FZHA 1GLBG 2P9UA 2HF4A 3WEEA 1KXPA 5FPMA 2QW9A 4FPAA 2PAVA 3O1BA 4XH4A 4AM7A 5ADXH 3EL2A 3ZEUA 3EN9A 4CI6A 1DGKN 4XEIA 3ZETA 3WXJA 3VENA 3ATUA 4I6MB 4M7XA 3GL1A 1HUXA 3ENOA 2D1KA 2Q2RA 3U9DA 1QHAA 3SLCA 4CD1A 5AQIA 1RFQA 3GDQA 3L6QA 5EY4A 3A5OC 5AQQA 2Q36A 3H1VX 4H5WA 4BQLA 4PKHA 1U2VB 2QWPA 4FWRA 4BR9A 3I8BA 3DXMB 1BWFO 3R9PA 3F9MA 3HTVA 3R6MA 2YJFA 1WOQA 3C0BA 2P9IB 2IVNA 4FO0A 1GLAG 4BG9A 2KHOA 2NRHA 1NGJA 3KVGA 2ZGZA 2CGKA 1BG3A 4BRCA 5AZJA 2EWSA 4ISEA 1HJOA 5AQGA 1ATSA 4EIAA 2E2OA 2E2NA 5AQMA 2P9LA 4FWMA 4H0TB 4BROA 1HX1A 2D0OA 4LC9B 4BGBA 5BPMA 1NGFA 3L4IA 1NMDA 3A0IX 3CERA 3RSEB 4KBOA 3VF4A 3WXIA 2P9NB 4IO8A 5AQFA 2ZGYA 4BR2A 4WQ5A 1YUWA 4YDUA 3CETA 4QS7A 1C0FA 1BU6O 4WQ4A 5LJVA 2CGLA 1HPMA 4BR7A 3LDOA 5TKYA 2GWJA 3AAQA 2QM1A 1GLJO 2YJEA 4BRMA 4JNEA 4FWOA 1RGIA 1HKGA 5F2RA 1X3MA 2Q1NA 1GLEG 4CZJA 4BC4A 5F0XA 1QZ6A 2YHYA 5E84A 4BRLA 4H5NA 4JHDB 3ZEUB 1S3XA 1KAXA 3ENHA 4JAXA 2GEMA 3QFPA 4BRAA 3QDKA 4H0XB 3H6EA 3DXKA 5JLFA 4NO7A 4H03B 1H1VA 2W40A 5AFUA 3ATVA 3EO3A 3MN6A 3UKUA 3WT0A 4BR5A 1JCFA 3JS6A 2E2QA 2A42A 3CHWA 1BOTO 4BC3A 4EHTA 4JD2B 3EKUA 4FL9A 2H3GX 1MDUB 1YAGA 3GBTA 2GWKA 4PKGA 1LOTB 1T44A 4PL7A 1XQSC 5AQXA 1XUPO 4MO5A 1RDWX 1K8KA 2Q0RA 2YCHA 4K42A 2P9PB 4BRGA 2WUSA 3GG4A 3W3DA 3UKRA 3H3OB 4QS8A 5AQKA 3B8AX 4XH5A 2P9SA 5JICA 3ULEB 5AQVA 2Q31A 5ADXA 3WXKA 5AQWA 5LJWA 4FWSA 3VETA 4B1ZA 2ASMA 3VEZA 3FGUA 3D2FB 5BR9A 3AAPA 2V51B 4IJNA 1XC3A 3KZBA 3WXLA 5KPTA 5FPEA 2D4WA 4BG8A 4CZHA 2VWBA 5BN9A 2J4RA 2Q0UA 1NLVA 2ZWHA 3O6WA 3LDLA 3FFKB 4F9OA 5KQ8A 1TYQA 3D7EO 3ZX2A 5AQSA 3VEXA 1NWKA 3GOIA 5AZIA 4BQZA 2P9KA 4O8KA 3UE5A 3CJ1A 4B1VA 4EAHD 5BRDA 1Q18A 3VF2A 2OANA 1DEJA 1MWMA 3IMXA 1SZ2A 3O8MA 1NGGA 2AP1A 1NM1A 1T6DA 4AM6A 4BRHA 2IVOA 3CQXA 4DB3A 4BR0A 1J6ZA 2E1ZA 2QWOA 4B1XB 3D2EA 5JMVA 3FLCO 3CJCA 1S22A 3SMPA 3WQUA 4BRQA 4M63C 1E4GT 2ASOA 2NLXA 5EXWA 3FZLA 4CZEA 3SJHA 3UKRB 4H0YB 3I33A 1GLCG 4CZFA 3A5NC 3LM9A 3ZX3A 4CZIA 3MN9A 3MCPA 1SAZA 5EX5A 1LCUA 4CD3A 1NGEA 2QWQA 1Y64A 3C7NA 3QBWA 4QS9A 4C23A 1HKBA 1V4SA 2P9UB 3FR0A 3WEEB 3OHRA 2GUPA 2FF6A 4E1JA 2QWNA 3FZFA 1E4FT 3H1QA 3O5BA 3A8YA 1ESVA 2BUPA 4A61A 5FPDA 1ZBSA 3O4WA 2W41A 1MA9B 2V52B 3ZETB 1T6CA 3CJ7A 4ISGA 4B9QA 3BF1A 2V7ZA 3R8EA 4GNIA 5EOYA 5AQNA 2PBDA 4MLEA 4BVOA 4WYBA 2CH5A 5AZIB 4B1YB 4CZLA 2P9KB 4CJ7A 1BA1A 2AA4A 2E88A 3G25A 3MMVA 5ELZA 4ISFA 4Z94A 4DHYA 3DJCA 4H0PA 1JCGA 3WQTA 4FWQA 1P8ZA 1NGDA 3EKSA 4BRFA 1BA0A 1V4TA 4M7YA 4I6MA 5AZJB 1C0GA 4A62A 3VGMA 5AQUA 1EQYA 3A5MC 3M6GA 1HKCA 5AR0A 2P9LB 3LDQA 3MN5A 5BRFA 2QWMA 2E8AA 2A41A 1R59O 1U2VA 2QWLA 2QWRA 3O1WA 3WUHA 3DXMA 3H45C 4O5FA
chains in the Genus database with same CATH superfamily
1YXQA 3BDPA 1BUPA 2HF3A 1VRUA 2FXUA 1NGBA 4TSXA 5E41A 3WNFA 3VA0A 3QMLA 5AQHA 1VRTA 2F96A 4CW7B 3WXMB 3D0PA 3KD1E 1QHTA 3QBXA 4H5VA 3L2UA 3E9PA 3J7ZO 5F1XA 4KAZA 1VQNN 5FPNA 5H1SQ 4LD0A 4DG1A 5BR8K 1P90A 1SQKA 3RSEA 3HZ6A 4IZ9A 1Z05A 3O08A 1GLLO 4JK8A 3KD5E 4C8OA 3U6FA 4OPHA 5GAHP 3D45A 4CERA 3LDNA 3VGKA 4ILHA 4CJ3A 2F8SA 4CFAA 5MLCQ 3E1YA 4CEBA 3OYAA 4YOTA 3VQPA 4HTLA 1K9MO 3MDQA 4Z4GA 1MWKA 3IUCA 3CQYA 3JXUA 3AO4A 3IKMA 3QETA 2O4GA 3SAGA 5EVZA 1VQON 4H5RA 4DTSA 4YHHK 2KQ2A 2F8TA 2FLOA 4K25A 5C10A 1Q7YO 4FLYA 1U4BA 4RW4A 4BREA 2DY4A 5C2DA 3HL8A 4ID1A 3VQBA 2VQFK 3MXIA 1RDDA 4DV0K 1OH6A 4B1WB 3PSFA 2KTQA 1RBTA 4CBXA 3N4QA 2O8EB 4H4OA 2PYLA 1SV5A 2GUIA 5LMNK 3VPZA 3DWLA 1Q86O 3LM2A 4YFUA 1EO1A 1Q81O 3QFUA 3NBPA 3T1AA 1U04A 2F9WA 3CPWM 4PQUA 1WLJA 1BIUA 2ZF5O 1YJWN 3QIPA 3QICA 2NZTA 3VQCA 4Q5VA 3TSQA 3HT3A 2YX6A 1ZYQA 2HVIA 2W6KA 3K0SA 4RTFD 1O1WA 5BPNA 4M3ZA 4NXMK 3NE6A 2XY6A 1NKCA 1TUYA 4BR4A 1NK4A 2O8BA 3C95A 3HM8A 2PZSA 3EZWA 1NGIA 5AQTA 4RW7A 1JCEA 1L3VA 5CHIA 5B8HA 3AA3A 4CIGA 4DTNA 4OVLA 3FZMA 3C7NB 2GBZA 4K41A 2FBYA 3K59A 2BTFA 4CF9A 5AFUH 3NH2A 3CCQN 3LPTA 3MX5A 4H0OA 3DRPA 1HR0K 3SYZA 2E4LA 4RW9A 4Z4CA 2I7NA 3OYDA 3MN7A 3OS0A 5GAEP 3CM5A 1I39A 2A5XA 4DU1A 3AVGA 2G8HA 5AQJA 3PX4A 1N36K 4B1UB 3M3ZA 1VSDA 4CEOA 1YF5L 2HF4A 2P9UA 5JS2A 3NVKA 3RVCA 2KFZA 4PUOA 3AGRA 3WNHA 2DFFA 1JL1A 4AM7A 4B9LA 3ZEUA 3EN9A 2UXDK 4XEIA 3WXJA 3F73A 3HP6A 3HVTA 3DLEA 3ENOA 3U9DA 1JKHA 2DFHA 3L6QA 5EY4A 3A5OC 3LWMA 2NRXA 2Q36A 4BQLA 4FWRA 3DXMB 4FYDA 2YJFA 4MDBA 3KK1A 1ZBHA 4DR4K 3JYTA 3EZ5A 1NGJA 3AA2A 2ZGZA 1BIZA 2G8UA 3P1GA 5C25A 4YOUA 4B8AB 3LAMA 5T7BA 1HX1A 4WE1A 4LC9B 4DFKA 1NGFA 3HK2A 2O8CB 4E3SA 1N5YA 4BR2A 1QSYA 2VG7A 2G8WA 3OYLA 1BU6O 3PO5A 3LDOA 2QM1A 1SUQA 4BRMA 4KO0A 1RBRA 1W0HA 4OKEA 1RGIA 1HKGA 3TTFA 1KD1O 3AVJA 4AF1A 4FW1A 5FROA 3O3FA 3DLGA 4DFMA 3THWA 4O4GA 4F2SA 3AA4A 1T3VA 3NGIA 1QZ6A 4AHCA 4BRLA 4JI3K 3C6TA 3MCAB 5C42A 2B6AA 4BRAA 1TK0A 4CEDA 1SL0A 4CJSA 3QDKA 3K5NA 1WN7A 4NLCA 1ZBIA 4CGIA 3J7YP 4H03B 1H1VA 5KGXA 4H4MA 3MN6A 3O3HA 4CEAA 2E6MA 3PUFA 4FJMA 2E2QA 1FW6A 3PY8A 1BOTO 1RDCA 3AVHA 1S5JA 1M1KO 4FL9A 4Z0UA 4NYNA 3VA3A 4E89A 5M1KA 1OH8A 1MDUB 4RG8A 1T44A 4KTQA 5HRRA 2KZMA 3MEGA 2P9PB 4DV5K 1RTDA 4OGCA 4QS8A 1WSJA 1OH7A 3B8AX 3OJUA 4DUZK 4B9MA 1C1BA 3UIQA 4DSLA 3ULEB 4W5QA 3TAQA 1S6PA 3AVNA 2ZM6K 3VEZA 3PIOL 3D2FB 3AAPA 2V51B 1XC9A 3N4PA 4IJNA 3K9JA 1WNSA 5FPEA 2ETJA 3OYNA 2O8EA 4L8RB 4DQRA 1XMOK 5K14A 3P38A 4BG8A 2VWBA 5BN9A 2Q0UA 4DS4A 2WONA 1RNHA 4J2EA 4E19A 4DTPA 3VEXA 1NWKA 4CF0A 3SQ1A 2QKKA 4BDPA 3VQEA 4BQZA 2P9KA 2E6LA 3CJ1A 3T19A 1B92A 5BRDA 2FBTA 1ILYA 4J2BA 3ZYYX 3E9OA 3RMDA 2JGUA 1Q9YA 3VMFB 2OANA 3ZSQA 5GADP 1MWMA 3IMXA 3QEPA 1T6DA 1E3MA 1WB9A 4AM6A 2NRTA 4BRHA 4FM0A 4DTOA 4DF4A 4CJVA 1BCMA 4BR0A 2QWOA 3CF5L 3HXMA 5J2NA 3C6HA 3WQUA 3EYZA 3QNNA 4LF7K 2HHSA 2ASOA 5EXWA 3SJHA 3UKRB 2A1SA 3PV8A 1JXBA 1IBMK 1GLCG 4GV6A 1D9DA 3QESA 4CD3A 3C7NA 4CIEA 4C23A 1NK8A 4M3UA 1QSSA 4LF8K 4OX9K 1HKBA 3VQ9A 1V4SA 4M45A 3RR7A 3WEEB 3SNNA 4DR2K 4CFCA 4PY5A 2GUPA 4E1JA 1ASWA 3VQAA 1E4FT 1U49A 3NMUA 2PFUA 4F3OA 1ESVA 4A61A 3QO9A 1ZBSA 2HMIA 1MA9B 3OBYA 2WTUA 1T6CA 3HPOA 4ISGA 3BF1A 2OTJN 2V7ZA 1Q82O 2AJQA 4GNIA 5C15A 4MLEA 3OBWA 1RBVA 4K8ZA 3G25A 3SBTA 1C0TA 1KTQA 1IKVA 2OPPA 4DHYA 3DJCA 3THXB 4BACA 1NGDA 4GV3A 3SPYA 4CJQA 1RILA 3SUQA 4DQIA 3A5MC 4RW8A 3CFRA 3MN5A 3CCVN 2FBXA 1YJNN 4WCEL 4MQ3A 2OPSA 3HYFA 2QWRA 3DXMA 3KLEA 3H45C 3HM9A 2ZJQL 4O5FA 4FWNA 4HHTA 4CEFA 4OPKA 1DKGD 4CGHA 2UYTA 3TSPA 1KCFA 4FJ5A 1CXQA 4DLEA 2YHWA 4LF6K 4FM1A 3RRHA 5AQLA 4A2AA 3BP8A 2FBVA 4CJWA 3TAGA 2HHQA 4DCHA 2O8CA 2F9TA 3HBTA 4ID5A 3IS9A 4IEEA 3S41A 3H08A 4DKWA 1BDGA 3KWIA 4C8KA 1BQNA 4BC2A 3DXKB 1LWCA 4HVJA 1NNEA 4YNQA 3TARA 3CFPA 3UKUB 4HWIA 3DI6A 4O0IA 1C1CA 1X1PA 4LF4K 1NJIO 1RT1A 3GE1A 3ZLJA 1QQOA 3R3LA 5M1FA 2QEXN 3L2VA 4H8KA 4CF2A 2ITGA 5LY3A 4MFBA 3KLGA 4JKBA 1X9JA 2GELA 2IC3A 4G1QA 4EHUA 3MAQA 4JRQA 2I7PA 4CEEA 1ZXOA 5M1NA 5BREA 1T03A 3VERA 5J2MA 1ATRA 3TANA 3TSUA 3ISNC 3M5RA 3I8DA 2E2PA 4A2BA 1VSIA 1OKJA 4YORA 3QEXA 2P9PA 3DLBA 3VF6A 4ELVA 4E7KA 4J2DA 4CZKA 1VSFA 4KREA 1SKWA 4NB4A 1J5EK 3ULEA 4DV7K 4GMJB 4BRDA 1NGHA 2RE2A 3RRGA 1QQNA 1N34K 3D2FA 1JLCA 3CYMA 4AHVA 2NRVA 4OKJA 4IFEA 4IXCA 1L3UA 4FW2A 3U4LA 4CBWA 4NXNK 3O9QA 2FSNA 3NVMA 3P39A 1YT3A 3DRSA 2HHTA 1MU2A 5HLFA 4JEPA 3D2EB 1IV0A 4FPBA 3HI0A 1VSMA 4W5OA 1NK0A 1L3SA 4IBNA 2ZD1A 4BRKA 4W5NA 4KHSA 4CZMA 4FJ7A 3P31A 3VEWA 5AQRA 4DQQA 4GKJK 3KK3A 1HNZK 3MWPA 1BO5O 4B3TK 1N33K 1VK0A 2X74A 4O5BA 3FE1A 4CF8A 2QI2A 4FSVA 2HHUA 2RF2A 2QXLA 3NH0A 4GVMA 4ICLA 4NLBA 4BE2A 3VESA 1DLOA 4E7IA 2LSNA 3SUNA 2CGJA 3V9XA 4BDZA 5KPZA 3KWGA 3QLHA 4J8FA 4YOWA 3MEDA 4OKKA 4RWTA 1CZBA 3HPHA 4H0VB 2Z1IA 4RCHA 4B9TA 5AQPA 1JL2A 4FJLA 3NF8A 4IKFA 1NOZA 3KK7A 2YHXA 1Y97A 3HOTA 5KRTA 1IKYA 2KW4A 1TKTA 3WEEA 4ILJA 1KXPA 4JI0K 1YITN 1GOCA 4YY3K 1HNVA 4EZ6A 2HB5A 4XH4A 1EETA 5ADXH 3MXMA 4DSJA 3EL2A 4V19S 3EE9A 4I6MB 4PWDA 1HUXA 3SI6A 1FKOA 4B08A 4CD1A 3O4QA 5AQIA 1RFQA 4JKFA 3G0ZA 4QCLA 5M1QA 2QWPA 1VSEA 2ZQBA 1FXXA 1BWFO 3F9MA 3HTVA 1RT5A 3R6MA 4Z4HA 3NHGA 1SL1A 1GOAA 1KVCA 2P9IB 4FO0A 3THXA 5HL7L 2NRHA 5I42A 2FC0A 1JLGA 3KVGA 2NRRA 4B8CA 4M42A 4W5TA 3WNEA 3OTOK 2X6NA 4EIAA 2E2OA 4DWIA 2E2NA 4KI6A 4EP4A 4LFBK 4M3YA 4BGBA 1S1WA 4R5PA 4OLAA 4KTWA 1RTHA 4ELTA 3WXIA 1B9FA 4IO8A 5KI6A 5AQFA 3ZT3A 1ITGA 1C6VA 3CFOA 1KQSM 1NG9A 4QS7A 3M8SA 4CJLA 1K73O 4FJNA 2YKNA 3Q7BA 1WBBA 4CGDA 2CGLA 3SAHA 3ASMA 1GLJO 4LFCK 3BZKA 4JNEA 1Q8IA 3E66A 2NUBA 2Q1NA 1GLEG 4CZJA 4BC4A 3SUPA 3PO4A 4JS4A 4JHDB 5J1EA 1QE1A 3OYFA 4IFVA 4JAXA 2GEMA 3LALA 4JKEA 4NCGA 5SWMA 5C12A 4DTUA 4DFJA 3DXKA 5JLFA 4NO7A 1S1VA 3TWHA 3ZT2A 3ATVA 3EO3A 5CZ1A 5AFUA 3UKUA 4OO1J 1VQMN 3JS6A 4CF1A 4EHTA 2IS3A 2H3GX 3TTCA 2HNZA 1LV5A 1YAGA 3GBTA 3ZSXA 2GWKA 1LOTB 5LL6Z 5AQXA 3TI0A 1FK9A 4IDKA 5J2QA 2BGGA 4K42A 4BRGA 2WBNA 3GG4A 3SQ2A 4Q0BA 3H3OB 2Z1JA 1VSHA 5AQKA 4FLWA 2X6SA 3QINA 2Y1IA 2R7YA 2QKBA 3LP2A 5JVGL 3DLHA 4KB0A 3WXKA 2DTUA 5AQWA 5LJWA 4B1ZA 3K5OA 4CGGA 2A1RA 4YOVA 4O55A 3WXLA 4DV1K 3J7AP 2KZZA 1NK9A 4DV6K 3L2WA 2OPRA 3NF6A 4B9VA 4AHUA 2UU9K 1W97L 3LDSA 4PA1A 4CHZA 3LDLA 5KQ8A 3CC2N 1UA1A 2RN2A 4MDAA 3GOIA 5AZIA 3VN5A 4O8KA 4CJ5A 1KVAA 4DQPA 4IFYA 4CGJA 1XNRK 3I0RA 1I3AA 3O8MA 1NGGA 1RDAA 3CQXA 4DB3A 3OJSA 2E1ZA 4CEZA 4B1XB 3D2EA 4CJUA 4KRFA 3ZCMA 3SMPA 4M63C 1I94K 2WC9A 4CK3A 2UUAK 2NLXA 3ZT4A 3OYHA 3PX6A 1N6QA 3RR8A 3FZLA 4CZEA 1RBUA 3K9KA 5FRMA 1BISA 4CZFA 3A5NC 4CZIA 3FFIA 3MN9A 3MCPA 5EX5A 1LCUA 4CGFA 2QK9A 1Y64A 4QS9A 2UUBK 3V9UA 4B3OA 4DSKA 2YNGA 3QEIA 3FR0A 4ZTJA 4Y1CA 1YIJN 2FF6A 3FZFA 3KKSA 4LF5K 3SUOA 4DV4K 3CCRN 2VGMA 4ILGB 3V4IA 4B9QA 1VAZA 3T3FA 2D0BA 3CPEA 5HP1A 2WOMA 5AQNA 4BVOA 3AGKA 1BA1A 4CJ7A 3J81O 1NK6A 3LP1A 1TKXA 3THVA 3NGYA 4JI6K 1V4TA 5GAGP 4KH6A 1QSLA 4I6MA 3SCXA 4A62A 3VGMA 3IG1A 1HNXK 2D0AA 4GV9A 5BRFA 2HBJA 3SV3A 4N5SA 4KHPK 3ID6A 1VQ8N 2OYQA 3Q7CA 2A41A 3AV9A 3L8BA 1YVUA 3G10A 4FJGA 1WSFA 2QWLA 3O1WA 1EX4A 2HHWA 2VYPA 2P9IA 3NH1A 4I9QA 2HBKA 5I9EB 4JKAA 4O0JA 2HOEA 1IH7A 3V81A 1U45A 1WUAA 1XMQK 3VTHA 1IKWA 1J54A 3V6DA 4LSLA 3KTQA 5HOOA 1T8EA 1NJWA 4IJAA 4JI5K 2YNHA 1YI2N 1JLFA 3OW2M 1BL3A 3U8XA 1KC8O 5FDLA 3TPQA 1KAYA 1ASVA 1L5UA 5LMUK 4HCBA 2YNFA 2IIRA 4CBUA 2FSKA 2G8KA 4KV8A 2VCPA 1CZAN 1X3NA 4M3XA 3KLHA 3MXJA 3ZSYA 3VEYA 2GTDA 2P1JA 3HVRA 3LAKA 3OYJA 3LDPA 1XI1A 2OZSA 3ZT1A 4JHDA 1WBDA 2HMPA 1J53A 4DQSA 2YI1A 1RTJA 4B3RK 5BN8A 2BANA 4A57A 2VG6A 1D8YA 1RT2A 1U6ZA 3NCIA 4GVEA 3SK3A 4DUYK 4X62K 4JI8K 4O44A 4JI4K 3ID8A 3K57A 2FSJA 3CC7N 1IO2A 1X9MA 3NDKA 5AQOA 4E7LA 3CIPA 3QIOA 3CJBA 4HTUA 5DM7L 4PKIA 3HPGA 3HSTB 2YHAA 4FWLA 4DV3K 5FLXO 1S6QA 5GINA 3OYMA 5CE3A 1XWLA 4A5BA 2OPQA 4CJ4A 4DR1K 1NBWA 3VEOA 4EZ9A 3IRXA 3V1QA 4KHNA 1N8RO 1QQMA 1UAXA 2YNIA 3V9SA 3RMCA 1TUUA 1W9HA 4ELUA 4M3RA 4NCAA 5KTQA 1TYQB 2FF3B 3NAEA 4FK2A 3VGLA 1CZ9A 4AH9A 1RTIA 3A2FA 3RMBA 2XO7A 2ASPA 1NKEA 1SKRA 3KHYA 4DTJA 1GLDG 3BEXA 1HYZA 3SJJA 3DAWA 4FOIA 3BY5A 3PLAA 2P51A 1O13A 3J80O 4DR7K 5CYMA 4I9LA 1QVGM 1JLEA 1VQPN 3K5MA 1D4XA 3E9LA 1REVA 3HSCA 1GLFO 4DU4A 3VEVA 4MLHA 4LSNA 4BRIA 1VQLN 1S1TA 1IJJA 1X9SA 4J2AA 4AHSA 1B9DA 3P83D 3AA5X 4KHQA 1QS4A 4DMNA 4B9UA 4GKKK 3O80A 3T1YK 3PIPL 1SKSA 1DTTA 4OGEA 2O8FB 1QZ5A 3G4SN 1TKDA 4JKDA 4CVNE 5BPLA 5IWAK 1RBSA 3OA9A 4C8NA 1Q9XA 1S9EA 3CG7A 3AY9A 4EFHA 4DU3A 4GY2B 4KFBA 4CHOA 4CJTA 5BRHA 4DTMA 2B4JA 4HUEA 3U9ZA 4OLBA 3QB0A 3SMSA 1NK7A 3CJAA 5FPMA 4FPAA 2PAVA 3ULDA 3AO3A 1EP4A 2UUCK 2HNDA 1T05A 2ATQA 3LP3A 1F21A 3AVBA 1N32K 4B3MK 2GX9A 5CZ2A 1IBKK 1K6YA 1RDUA 1RT7A 4I7FA 4JI2K 3EEQA 4CI6A 4AILC 3LP0A 4M7XA 3GL1A 3AVAA 4ZHRA 2ZJPL 4FM2A 1VSLA 2Q2RA 3SLCA 3OS1A 3CQ8A 3GDQA 1BCOA 1HPZA 3F9KA 5AQQA 3U3GA 4H5WA 1RT6A 4PKHA 1U2VB 1KFSA 4BR9A 3ITHA 1T7PA 3R9PA 1WOQA 1LAWA 3C0BA 2IVNA 1TL1A 4BG9A 2KHOA 2CGKA 1BG3A 2EWSA 3MX2A 4DFPA 3VQQA 1HJOA 4NYFA 5I3UA 2BE2A 5AQMA 1NU0A 4H0TB 4BROA 3JSMA 2D0OA 3RMAA 3L4IA 1NMDA 1WSGA 1JJ2M 3CERA 2P9NB 4JK7A 4KHWA 4R79A 2HNYA 3CXCM 5LJVA 1HPMA 3BZCA 4F8RA 4OPAA 4KB1A 1FKPA 2YJEA 4JK9A 3CC4N 1KLNA 4FWOA 1UA0A 4C8MA 1X3MA 3TR8A 5HRSA 2YHYA 5E84A 1A5WA 2OTLN 3K2PA 3WNGA 4H5NA 3ZEUB 3K5LA 3RTVA 1EWRA 1KAXA 4DSFA 4JLHA 4FLVA 1LW2A 3OYBA 4H0XB 1VQ7N 1S72N 5GIOA 2W40A 4NCBA 3WT0A 4C1NI 4BR5A 4K0KK 3CCUN 1BQMA 2HHXA 2A42A 1G15A 4IOXA 2NNWA 3AVIA 4JD2B 2NRWA 3O9TA 1SS6A 3DOLA 4CIFA 5J2PA 1XQSC 1XUPO 4KI4A 4MO5A 1RDWX 3F2KA 2YCHA 3TTDA 3HJFA 4GW6A 3VQDA 2VG5A 3UKRA 4IG0A 5KGWA 4XH5A 1L3TA 4U7BA 5JICA 2VGNA 4CHQA 4G9ZA 1HQUA 1S1UA 5ADXA 2BH1A 4FWSA 3LZJA 1NJYA 1KVBA 4DR3K 1BI4B 2ASMA 4PHTX 3FGUA 5BR9A 2HW3A 3KZBA 5KPTA 3THWB 3HO1A 3L3VA 4WF9L 4Y1DA 4CZHA 2XHBA 4KH4A 2ZWHA 3O6WA 3FFKB 4F9OA 3SPZA 2KFNA 1TYQA 4FLTA 2D0CA 5JVHL 1CXUA 3OYGA 3L2RA 3CCSN 5AQSA 3O9RA 1ZBUA 3O3GA 2QXFA 1YHQN 3OYIA 2NRZA 3CM6A 4EAHD 4CK2A 1ZBLA 1Q18A 1Z25A 1DEJA 4JI7K 2AP1A 2IVOA 4FZYA 2F7TA 1J6ZA 4A5AA 2VWKA 1S1XA 5JMVA 1EXQA 1S22A 3CJCA 3R1XA 3DLKA 2GV9A 4LFAK 4E7HA 2E5LK 3OS2A 3P5JA 3ZX3A 4FK4A 4JKCA 1NGEA 2QWQA 1NOYA 4FZZA 2OZMA 4DS5A 3DMJA 1A5XA 1LW0A 3O9UA 2RHKA 3OHRA 3CCMN 1VQ9N 5M1OA 1JXEA 2QWNA 4KTZA 1OH5A 2O8FA 3A8YA 4FJIA 3SQ4A 5IT9O 3CD6N 5FPDA 2BDPA 3O4WA 2W41A 2V52B 3VQ5A 3PX0A 3ZETB 4CCHA 4AHTA 3R8EA 5EOYA 3ALYA 1NK5A 4WYBA 2CH5A 3AVFA 4BDYA 1IG9A 4CZLA 2P9KB 2AA4A 2E88A 1NJXA 5ELZA 4ISFA 3TAPA 4XIUA 4LH4A 3IAYA 1IKXA 4FWQA 2ZJRL 4BRFA 3EKSA 4M7YA 3ZSOA 3S9HA 3CMAN 5AZJB 1C0UA 4F4KA 2O8DB 1ASUA 4KKOA 1EQYA 3M6GA 5AR0A 4AQYK 2P9LB 3LDQA 1TK5A 4FCYA 3TAEA 1U2VA 1EKEA 3G71N 3WUHA 1TV6A 1Z6RA 1IG8A 3G6EN 4JKGB 3L2QA 3NGZA 2A3ZA 1KAZA 3VOVA 2E20A 1BHLA 1HLUA 2KKZA 4IDHA 2YV0X 2B5JA 5EU7A 2V7YA 3MWTA 4FZXC 3C94A 2DPNA 4BRNA 4FXDA 3FZKA 3CJ9A 2IVPA 4IO9L 1D5AA 1VQ4N 3S3OA 4BRPA 3AO5A 3IFRA 2EHGA 2P9NA 1KLMA 3BUZB 3J8AA 4N56A 3LL3A 4Z4IA 2HVHA 4BC5A 4K8XA 3H3NO 3CCLN 2IOCA 2QTDA 4CJKA 5KQDA 3D6RA 5AQYA 3ZSWA 3MK6A 1VQ5N 4FWPA 4IOCL 1YVNA 4FJHA 4DTRA 4N76A 3SV4A 4Y0WA 3NFAA 1K8KB 5AQZA 4BGAA 4DQ8A 1RT4A 5D3GA 2W6LA 3MECA 1NGCA 5FRNA 1TAUA 4B9NA 2Y1JA 2A40A 1YTAA 2P9SB 4JD2A 4JKHA 2KLAA 3CMEN 4KH5A 4OPJA 3ZX0A 3SZ2A 3HRGA 1ZC6A 2W42A 4DR6K 2Q97A 4HUGA 2IAJA 3P4IA 3M1FA 4H5TA 4IWVA 3H46O 3DLLL 4DF8A 3AO1A 4B3SK 1G99A 1LAVA 3DM2A 3VQ4A 4JN4A 2P5OA 2UXBK 4CZGA 1NGAA 4E0DA 4CHYA 1QQCA 4WQ5C 3O9SA 2XY5A 2HHHK 4YDUC 1BI4A 3IDHA 5E26A 4WQ4C 1HRHA 1C1AA 4CECA 2XY8A 4N41A 1IBLK 3AARA 4X65K 4CHPA 1UOCA 5KPRA 3TAMA 1OVYA 3B6PA 1ATNA 3LANA 4FOEA 1WSIA 4JS5A 3DOKA 3SBGA 3TU5A 3THYB 4E1NA 3VTIA 2UXCK 1OVQA 3L0QA 5AJ3K 3SAFA 2JWKA 1CLQA 3O4NA 2E1YA 4BE1A 4Z4FA 3QERA 4IEIA 3M8PA 4F3TA 4IOAL 4CFBA 4WFBL 1YTUA 1DT9A 4WFAL 3T69A 4C1NK 1RCHA 2VWJA 1EWQA 3ZT0A 1X9WA 1HNWK 4K43A 1TGOA 1QTMA 3V1OA 4FLXA 4E1MA 1J5OA 1YJ9N 2OA8A 3A5LC 4QOZB 2CH6A 4FK0A 2A6AA 2Z1HA 2D0PA 4YOXA 3AVKA 4FWKA 2ITMA 2G8FA 1W7AA 1W2BM 3CI5A 3C65A 3W0LA 3OYEA 3UB5A 4MO4A 4BVPA 2XRIA 4XH1A 1WAFA 5JLHA 2HBMA 4L3QA 3V9WA 2HBLA 4M41A 3HOSA 4X66K 1VHXA 4PL8A 3BF3A 1HYVA 1SL2A 2XY7A 3FZHA 3S3MA 1GLBG 3T7ZA 4CJFA 2QW9A 3O1BA 3QNOA 4CJEA 4QAGA 5HBMA 4CK1A 1WAJA 3OYCA 1DGKN 1HNIA 3ZETA 3QEVA 3VENA 3ATUA 3B6OA 2YHBA 1RDBA 3C6UA 1KFDA 2D1KA 1QHAA 4FJXA 3KLIA 4AHRA 3VQ6A 1J9AA 3H1VX 4M3WA 3CCJN 4BWMA 3I8BA 4WFNL 4FJ9A 3JAMO 4HUFA 1GLAG 4KHYA 1TKZA 1NJZA 5C24A 5M1PA 4CESA 4OJRA 4BRCA 5AZJA 2O8DA 4ISEA 1XHXA 5AQGA 4FLZA 4DSIA 5KRSA 1ATSA 3ENBA 2P9LA 4FWMA 3C6AA 2DFEA 2JWLA 5BPMA 3A0IX 2VQEK 1UWBA 3RSEB 4KBOA 3VF4A 4FJKA 2JLEA 4LH5A 2ZGYA 4JKGA 4WQ5A 1YUWA 3KIOA 5JS1A 4YDUA 3CETA 4JYAK 1C0FA 4WQ4A 1C0MA 4BR7A 2ZE2A 2RPIA 5TKYA 4DLGA 4CE9A 2GWJA 3AAQA 4JRPA 2F4VK 3LPUA 4FJ8A 5F2RA 1FJGK 3TABA 5GIPA 4JV5K 5F0XA 2PY5A 4DV2K 3K58A 4I2QA 1S3XA 2X78A 3ENHA 3S3NA 3AO2A 3L3UA 3QFPA 4U67L 1K8AO 2G8IA 3H6EA 2IGIA 4X64K 4A59A 4E7JA 5TKWA 1TL3A 5DMRA 1JCFA 1QVFM 2IDOA 3CHWA 4BC3A 1M90O 2G8VA 3EKUA 4O8UA 3OVNA 1NMNA 3DLRA 5SZTA 3T1HK 4ZTFA 4PKGA 4PL7A 1Z26A 1K8KA 3VQ8A 5DK5A 4CHNA 2Q0RA 4BE0A 4UY8O 3KJVA 2WUSA 3W3DA 4M3TA 3L4QA 1HJRA 5C2FA 4FVUA 2P9SA 4RW6A 4FLUA 3EY1A 5AQVA 2O4IA 1U47A 2Q31A 3ZSRA 4W5RA 2P5GA 1LWFA 4LF9K 3VETA 1BGXT 4F2RA 4N47A 1XC3A 3DYAA 5HRNA 1TVRA 2EX3A 2D4WA 1KRPA 3ZSVA 1HMVA 3LWLA 3NF7A 2J4RA 2WFBA 1NLVA 2YKMA 4BWJA 1VSJA 1GOBA 2O8BB 5HROA 4FJJA 3V9ZA 3D7EO 3M8QA 3ZX2A 4JI1K 2QA4N 1WSHA 4Z4EA 3KK2A 3UE5A 4B1VA 1TAQA 1D9FA 1DTQA 4CEQA 3LZIA 3VF2A 5CY4A 1SZ2A 4CFDA 1NM1A 3NF9A 3THYA 3HP9A 1RT3A 1U48A 3KKRA 3I55N 1ZBFA 3FLCO 4BRQA 4DSEA 4UQGA 1E4GT 3M8RA 4CJPA 4H0YB 5HRPA 3I33A 1VQ6N 3OY9A 1TK8A 1S9GA 3LM9A 3F5TA 4LY7A 3RWUA 4KPYA 1SAZA 3QBWA 3AVMA 4CJRA 2Z1GA 3VQ7A 1JLBA 5CYQA 1A5VA 2P9UB 1NKBA 4KHUA 4YOYA 3I0SA 3EE8A 1HQEA 2Q3SA 3H1QA 3O5BA 1VQKN 5DM6L 2BUPA 4DTXA 3QEWA 1XNQK 4B9SA 5A2QO 1WSEA 4IG3A 3CJ7A 2RKIA 3BGRA 2D5RA 4FVMA 5CR4A 3AVLA 2HHVA 1JLQA 3OYKA 3KLFA 3DRRA 4HCCA 4EP5A 2PBDA 1HYSA 2PYJA 1VSKA 5AZIB 4B1YB 3AVCA 3U3YA 3PSIA 3ZSZA 3MMVA 3I56N 4Z94A 3SQ0A 4BY9C 3E01A 4H0PA 3MEEA 1JCGA 3WQTA 5C0YA 1P8ZA 1BA0A 3TAFA 4DR5K 2OCEA 1C0GA 5AQUA 1KSPA 4I2PA 1LWEA 1JLAA 1HKCA 3V1RA 2QWMA 2E8AA 1R0AA 2I5JA 1XHZA 1R59O 4C8LA 3CCEN 2HSTA
chains in the Genus database with same CATH topology
4FWNA 1YXQA 1Z6RA 1IG8A 3G6EN 2VYPA 1BUPA 2HF3A 4JKGB 2P9IA 2FXUA 1NGBA 1DKGD 2A3ZA 2UYTA 3TSPA 1KAZA 2HBKA 2E20A 2KKZA 1HLUA 4IDHA 3VOVA 4JKAA 5I9EB 2YHWA 2HOEA 3QMLA 5AQHA 1WUAA 3WXMB 5AQLA 3VTHA 3QBXA 4H5VA 4A2AA 2V7YA 3E9PA 3MWTA 3J7ZO 5HOOA 5F1XA 3BP8A 2DPNA 4BRNA 1VQNN 5FPNA 3FZKA 3CJ9A 4IJAA 4DCHA 2IVPA 5H1SQ 1YI2N 4IO9L 2F9TA 3HBTA 1P90A 3U8XA 1SQKA 3RSEA 3HZ6A 3OW2M 4IZ9A 3TPQA 4BRPA 1Z05A 1KC8O 1KAYA 4IEEA 3IFRA 3J8AA 2P9NA 3BUZB 3O08A 3S41A 4DKWA 1GLLO 1BDGA 3LL3A 4JK8A 3KWIA 2IIRA 4CBUA 2FSKA 4BC5A 4OPHA 4BC2A 3DXKB 5GAHP 2VCPA 1CZAN 3LDNA 1X3NA 3VGKA 3H3NO 4HWIA 3UKUB 3CCLN 2QTDA 5KQDA 4ILHA 3VEYA 2GTDA 3D6RA 5AQYA 1NJIO 3GE1A 3LDPA 5MLCQ 3E1YA 3MK6A 1VQ5N 4JHDA 4YOTA 4FWPA 4HTLA 2HMPA 1QQOA 3R3LA 5M1FA 2QEXN 1K9MO 4IOCL 3MDQA 2YI1A 1YVNA 1MWKA 5BN8A 3IUCA 4A57A 3CQYA 3JXUA 4Y0WA 5LY3A 3IKMA 1K8KB 3SAGA 4JKBA 1U6ZA 5AQZA 1X9JA 2GELA 4BGAA 4DQ8A 4GVEA 5EVZA 3SK3A 4EHUA 1VQON 4H5RA 3ID8A 2FSJA 2FLOA 2I7PA 1NGCA 4K25A 1ZXOA 5C10A 5M1NA 1Q7YO 3CC7N 5BREA 3VERA 2A40A 2P9SB 5AQOA 3CIPA 3CJBA 4JD2A 4BREA 4PKIA 5DM7L 4JKHA 2KLAA 4FWLA 1ATRA 3CMEN 4KH5A 3TSUA 5C2DA 3M5RA 5GINA 3ZX0A 5CE3A 2E2PA 3HRGA 4A5BA 1ZC6A 4A2BA 4B1WB 1OKJA 2Q97A 1NBWA 3VEOA 4CBXA 4YORA 3N4QA 3P4IA 2P9PA 3M1FA 4H5TA 1N8RO 4IWVA 3H46O 3DLLL 1QQMA 3VF6A 4CZKA 1G99A 4JN4A 4NB4A 1TUUA 3ULEA 4CZGA 3VPZA 1NGAA 3DWLA 1Q86O 3LM2A 1TYQB 4BRDA 2FF3B 1EO1A 1Q81O 3QFUA 3VGLA 4WQ5C 3O9SA 1NGHA 2RE2A 4YDUC 2F9WA 1QQNA 3IDHA 3CPWM 5E26A 3D2FA 2ASPA 4WQ4C 2ZF5O 1YJWN 3QICA 3KHYA 2NRVA 1GLDG 2NZTA 3BEXA 4IFEA 3AARA 4IXCA 3DAWA 3TSQA 5KPRA 3U4LA 4CBWA 1OVYA 2YX6A 1ATNA 4FOIA 3PLAA 4FOEA 4RTFD 1O13A 3O9QA 5BPNA 2FSNA 3NVMA 3P39A 3SBGA 3TU5A 1TUYA 4BR4A 3VTIA 1QVGM 1VQPN 4JEPA 3L0QA 3D2EB 3HM8A 3SAFA 4FPBA 2JWKA 3EZWA 1D4XA 3HI0A 2E1YA 3E9LA 1NGIA 5AQTA 3HSCA 4BRKA 4IEIA 1GLFO 4CZMA 3VEVA 1JCEA 4IOAL 4WFBL 3P31A 3VEWA 5AQRA 4MLHA 5CHIA 1DT9A 4WFAL 4BRIA 5B8HA 3MWPA 1BO5O 3T69A 4C1NK 1IJJA 1VQLN 3FZMA 3C7NB 4K41A 3FE1A 4K43A 2QI2A 4FSVA 2BTFA 2QXLA 5AFUH 3CCQN 1YJ9N 3MX5A 4NLBA 4H0OA 3A5LC 3O80A 3VESA 2CH6A 3PIPL 2A6AA 2CGJA 2D0PA 4YOXA 5KPZA 3KWGA 4FWKA 1QZ5A 4YOWA 4J8FA 2I7NA 2ITMA 4RWTA 4JKDA 3G4SN 5BPLA 3MN7A 1W2BM 3OA9A 3CI5A 3C65A 4H0VB 3W0LA 5GAEP 4RCHA 3AY9A 3UB5A 4EFHA 2A5XA 5AQPA 4MO4A 4BVPA 4GY2B 4XH1A 5JLHA 5BRHA 2HBMA 3KK7A 4L3QA 2HBLA 5AQJA 2YHXA 3HOSA 3U9ZA 4B1UB 3HOTA 4PL8A 3BF3A 3M3ZA 3QB0A 3SMSA 3CJAA 3FZHA 2HF4A 2P9UA 1GLBG 1YF5L 4ILJA 3WEEA 3NVKA 1KXPA 3T7ZA 5FPMA 3RVCA 1YITN 2QW9A 4FPAA 2PAVA 3O1BA 3AGRA 4XH4A 4AM7A 5ADXH 3EL2A 2GX9A 3ZEUA 1RDUA 3EN9A 3EE9A 1DGKN 4CI6A 4XEIA 3ZETA 3WXJA 3VENA 3ATUA 4I6MB 4M7XA 3GL1A 2ZJPL 1HUXA 3ENOA 2D1KA 2Q2RA 3U9DA 1QHAA 3SLCA 4CD1A 5AQIA 1RFQA 3GDQA 3L6QA 4JKFA 5EY4A 3A5OC 5AQQA 2NRXA 2Q36A 5M1QA 3H1VX 4H5WA 4BQLA 4PKHA 1U2VB 2QWPA 4FWRA 4BR9A 3CCJN 3I8BA 3DXMB 1BWFO 3R9PA 4WFNL 3F9MA 3HTVA 3R6MA 2YJFA 4MDBA 1WOQA 3C0BA 2P9IB 2IVNA 4FO0A 1GLAG 4BG9A 2KHOA 5HL7L 2NRHA 1NGJA 3KVGA 2NRRA 2ZGZA 5M1PA 2CGKA 1BG3A 4BRCA 5AZJA 2EWSA 3MX2A 4ISEA 1HJOA 5AQGA 4YOUA 1ATSA 3ENBA 4EIAA 2E2OA 2E2NA 5AQMA 2P9LA 4FWMA 4H0TB 4BROA 3C6AA 1HX1A 2D0OA 2JWLA 4LC9B 4BGBA 5BPMA 2ZJQL 1NGFA 3L4IA 1NMDA 3A0IX 1JJ2M 3CERA 3RSEB 4KBOA 3VF4A 3WXIA 2P9NB 4IO8A 5AQFA 2ZGYA 4JKGA 4WQ5A 4BR2A 1YUWA 4JK7A 4YDUA 1KQSM 3CETA 4QS7A 4R79A 1C0FA 1K73O 3CXCM 1BU6O 4WQ4A 3Q7BA 5LJVA 2CGLA 1HPMA 4BR7A 3LDOA 5TKYA 3SAHA 2GWJA 3AAQA 2QM1A 4OPAA 1GLJO 2YJEA 4JK9A 4BRMA 3CC4N 4JNEA 4FWOA 1RGIA 1HKGA 5F2RA 3E66A 3TTFA 1KD1O 1X3MA 2Q1NA 4AF1A 5GIPA 1GLEG 4CZJA 4BC4A 5F0XA 1T3VA 1QZ6A 2YHYA 5E84A 2OTLN 4BRLA 4H5NA 4JHDB 3ZEUB 3MCAB 1S3XA 1KAXA 3ENHA 4JAXA 2GEMA 3QFPA 4JKEA 4BRAA 4U67L 3QDKA 4H0XB 1K8AO 5C12A 4NLCA 1VQ7N 3H6EA 3DXKA 1S72N 5JLFA 5GIOA 4NO7A 4A59A 4H03B 1H1VA 2W40A 5TKWA 5AFUA 3ATVA 3EO3A 3MN6A 3UKUA 3WT0A 4C1NI 4OO1J 1VQMN 4BR5A 1JCFA 3CCUN 3JS6A 2E2QA 1QVFM 2A42A 3CHWA 1BOTO 2NNWA 4IOXA 4BC3A 4EHTA 1M1KO 4JD2B 1M90O 2NRWA 3EKUA 4FL9A 2H3GX 4O8UA 3TTCA 5M1KA 1MDUB 3O9TA 1YAGA 3GBTA 2GWKA 1SS6A 4PKGA 1LOTB 1T44A 4PL7A 1XQSC 5AQXA 1XUPO 4MO5A 1RDWX 1K8KA 3F2KA 2Q0RA 2YCHA 3TTDA 4K42A 2P9PB 4BRGA 4UY8O 2WBNA 2WUSA 3GG4A 3W3DA 3UKRA 3L4QA 3H3OB 5C2FA 4FVUA 4QS8A 5AQKA 3B8AX 4XH5A 2P9SA 4U7BA 5JICA 2VGNA 3ULEB 4G9ZA 5AQVA 5JVGL 2Q31A 5ADXA 3WXKA 5AQWA 5LJWA 2BH1A 4FWSA 3VETA 4B1ZA 2ASMA 3VEZA 4PHTX 3PIOL 3FGUA 3D2FB 5BR9A 3AAPA 2V51B 3N4PA 4YOVA 4IJNA 1XC3A 3K9JA 3KZBA 3WXLA 5KPTA 5FPEA 2D4WA 4WF9L 1VQ4N 3P38A 4BG8A 4CZHA 2VWBA 5BN9A 4KH4A 2J4RA 2WFBA 2Q0UA 1NLVA 1W97L 2ZWHA 3O6WA 3LDLA 3FFKB 4F9OA 5KQ8A 1TYQA 3CC2N 3D7EO 5JVHL 3ZX2A 3CCSN 5AQSA 3O9RA 4MDAA 3VEXA 1NWKA 3GOIA 2QA4N 5AZIA 4BQZA 2P9KA 4O8KA 3UE5A 3CJ1A 1YHQN 4B1VA 2NRZA 4EAHD 5BRDA 1ILYA 3ZYYX 3E9OA 1Q18A 3VF2A 3VMFB 2OANA 1DEJA 5GADP 1MWMA 3IMXA 1SZ2A 3O8MA 1NGGA 2AP1A 1NM1A 1T6DA 4AM6A 2NRTA 4BRHA 2IVOA 3CQXA 4DB3A 4BR0A 2F7TA 1J6ZA 2E1ZA 2QWOA 4B1XB 3I55N 3D2EA 4A5AA 3CF5L 5JMVA 3C6HA 3CJCA 1S22A 3FLCO 3SMPA 3R1XA 3WQUA 4BRQA 4M63C 2WC9A 1E4GT 2ASOA 2NLXA 5EXWA 3FZLA 4CZEA 3K9KA 3SJHA 3UKRB 4H0YB 3I33A 1VQ6N 4GV6A 1GLCG 4CZFA 3A5NC 3LM9A 3ZX3A 3F5TA 3MN9A 4CZIA 3MCPA 1SAZA 5EX5A 1LCUA 4JKCA 4CD3A 1NGEA 2QWQA 1Y64A 3C7NA 3QBWA 4QS9A 4C23A 1HKBA 3O9UA 1V4SA 2RHKA 2P9UB 3FR0A 3WEEB 3OHRA 3CCMN 1VQ9N 2GUPA 1YIJN 2FF6A 5M1OA 4E1JA 4YOYA 2QWNA 3FZFA 1E4FT 3NMUA 3EE8A 3H1QA 2PFUA 3O5BA 1VQKN 3A8YA 5DM6L 1ESVA 3CCRN 2BUPA 2VGMA 4A61A 3CD6N 5FPDA 4ILGB 1ZBSA 3O4WA 2W41A 2V52B 1MA9B 3OBYA 3ZETB 1T6CA 3CJ7A 4ISGA 4B9QA 5CR4A 1VAZA 3BF1A 2OTJN 2V7ZA 3R8EA 1Q82O 4GNIA 5EOYA 3CPEA 5C15A 5AQNA 2PBDA 4MLEA 4BVOA 3OBWA 4WYBA 2CH5A 5AZIB 4B1YB 4CZLA 2P9KB 3AGKA 1BA1A 2AA4A 2E88A 3G25A 3MMVA 3SBTA 5ELZA 4ISFA 4CJ7A 3I56N 4Z94A 4BY9C 4DHYA 3DJCA 4H0PA 1JCGA 3WQTA 5C0YA 4FWQA 1P8ZA 2ZJRL 1NGDA 3EKSA 4BRFA 1BA0A 1V4TA 4M7YA 5GAGP 4KH6A 4I6MA 3CMAN 5AZJB 1C0GA 4A62A 3VGMA 5AQUA 4GV3A 4GV9A 1EQYA 3A5MC 3M6GA 1HKCA 5AR0A 2P9LB 3LDQA 3MN5A 5BRFA 2QWMA 2HBJA 3CCVN 2E8AA 1YJNN 3ID6A 4WCEL 1VQ8N 3Q7CA 2A41A 1R59O 1U2VA 3G71N 2QWLA 2QWRA 3O1WA 3WUHA 3CCEN 3DXMA 2HSTA 3H45C 4O5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWN A;  1YXQ A;  1Z6R A;  1IG8 A;  2VYP A;  1BUP A;  2HF3 A;  2P9I A;  2FXU A;  1NGB A;  1DKG D;  2A3Z A;  2UYT A;  1KAZ A;  3VOV A;  2E20 A;  5I9E B;  1HLU A;  2YHW A;  2HOE A;  3QML A;  5AQH A;  1WUA A;  5AQL A;  3QBX A;  4H5V A;  4A2A A;  2V7Y A;  5F1X A;  3BP8 A;  2DPN A;  4BRN A;  5FPN A;  3FZK A;  3CJ9 A;  4IJA A;  4DCH A;  2IVP A;  2F9T A;  3HBT A;  3U8X A;  1SQK A;  3RSE A;  3HZ6 A;  4IZ9 A;  3TPQ A;  4BRP A;  1Z05 A;  1KAY A;  3IFR A;  3J8A A;  2P9N A;  3BUZ B;  3O08 A;  3S41 A;  1GLL O;  1BDG A;  3LL3 A;  2IIR A;  4CBU A;  2FSK A;  4BC5 A;  4BC2 A;  3DXK B;  2VCP A;  1CZA N;  3LDN A;  1X3N A;  3VGK A;  3H3N O;  4HWI A;  3UKU B;  5KQD A;  3VEY A;  2GTD A;  5AQY A;  3GE1 A;  3LDP A;  3MK6 A;  4JHD A;  4FWP A;  4HTL A;  2HMP A;  1QQO A;  3MDQ A;  2YI1 A;  1YVN A;  1MWK A;  5BN8 A;  3IUC A;  3CQY A;  3JXU A;  4Y0W A;  5LY3 A;  1K8K B;  1U6Z A;  5AQZ A;  1X9J A;  2GEL A;  4BGA A;  4DQ8 A;  5EVZ A;  3SK3 A;  4EHU A;  4H5R A;  3ID8 A;  2FSJ A;  2FLO A;  2I7P A;  1NGC A;  4K25 A;  1ZXO A;  5BRE A;  3VER A;  2A40 A;  2P9S B;  5AQO A;  3CIP A;  3CJB A;  4JD2 A;  4BRE A;  4PKI A;  4FWL A;  1ATR A;  3ZX0 A;  5CE3 A;  2E2P A;  1ZC6 A;  4A2B A;  4B1W B;  1OKJ A;  2Q97 A;  1NBW A;  3VEO A;  4CBX A;  3P4I A;  2P9P A;  3M1F A;  4H5T A;  4IWV A;  3H46 O;  1QQM A;  3VF6 A;  4CZK A;  1G99 A;  4JN4 A;  4NB4 A;  1TUU A;  3ULE A;  4CZG A;  3VPZ A;  1NGA A;  3DWL A;  3LM2 A;  1TYQ B;  4BRD A;  2FF3 B;  3QFU A;  3VGL A;  4WQ5 C;  1NGH A;  4YDU C;  2F9W A;  1QQN A;  3IDH A;  5E26 A;  3D2F A;  2ASP A;  4WQ4 C;  2ZF5 O;  3QIC A;  3KHY A;  1GLD G;  2NZT A;  3BEX A;  3AAR A;  4IXC A;  3DAW A;  5KPR A;  3U4L A;  4CBW A;  4FOI A;  1ATN A;  4FOE A;  4RTF D;  5BPN A;  2FSN A;  3TU5 A;  1TUY A;  4BR4 A;  3L0Q A;  3D2E B;  3HM8 A;  4FPB A;  3EZW A;  1D4X A;  3HI0 A;  2E1Y A;  1NGI A;  5AQT A;  3HSC A;  4BRK A;  1GLF O;  4CZM A;  3VEV A;  1JCE A;  3VEW A;  5AQR A;  4MLH A;  4BRI A;  5B8H A;  1BO5 O;  1IJJ A;  3FZM A;  3C7N B;  4K41 A;  3FE1 A;  4K43 A;  4FSV A;  2BTF A;  2QXL A;  5AFU H;  4H0O A;  3A5L C;  3O80 A;  3VES A;  2CH6 A;  2A6A A;  2CGJ A;  2D0P A;  5KPZ A;  4FWK A;  1QZ5 A;  4J8F A;  2I7N A;  2ITM A;  4RWT A;  5BPL A;  3MN7 A;  3CI5 A;  4H0V B;  3W0L A;  4RCH A;  3AY9 A;  3UB5 A;  4EFH A;  2A5X A;  5AQP A;  4MO4 A;  4BVP A;  4GY2 B;  4XH1 A;  5JLH A;  5BRH A;  4L3Q A;  5AQJ A;  2YHX A;  3U9Z A;  4B1U B;  4PL8 A;  3BF3 A;  3M3Z A;  3QB0 A;  3SMS A;  3CJA A;  3FZH A;  1GLB G;  2P9U A;  2HF4 A;  3WEE A;  1KXP A;  5FPM A;  2QW9 A;  4FPA A;  2PAV A;  3O1B A;  4XH4 A;  4AM7 A;  5ADX H;  3EL2 A;  3ZEU A;  3EN9 A;  4CI6 A;  1DGK N;  4XEI A;  3ZET A;  3WXJ A;  3VEN A;  3ATU A;  4I6M B;  4M7X A;  3GL1 A;  1HUX A;  3ENO A;  2D1K A;  2Q2R A;  3U9D A;  1QHA A;  3SLC A;  4CD1 A;  5AQI A;  1RFQ A;  3GDQ A;  3L6Q A;  5EY4 A;  3A5O C;  5AQQ A;  2Q36 A;  3H1V X;  4H5W A;  4BQL A;  4PKH A;  1U2V B;  2QWP A;  4FWR A;  4BR9 A;  3I8B A;  3DXM B;  1BWF O;  3R9P A;  3F9M A;  3HTV A;  3R6M A;  2YJF A;  1WOQ A;  3C0B A;  2P9I B;  2IVN A;  4FO0 A;  1GLA G;  4BG9 A;  2KHO A;  2NRH A;  1NGJ A;  3KVG A;  2ZGZ A;  2CGK A;  1BG3 A;  4BRC A;  5AZJ A;  2EWS A;  4ISE A;  1HJO A;  5AQG A;  1ATS A;  4EIA A;  2E2O A;  2E2N A;  5AQM A;  2P9L A;  4FWM A;  4H0T B;  4BRO A;  1HX1 A;  2D0O A;  4LC9 B;  4BGB A;  5BPM A;  1NGF A;  3L4I A;  1NMD A;  3A0I X;  3CER A;  3RSE B;  4KBO A;  3VF4 A;  3WXI A;  2P9N B;  4IO8 A;  5AQF A;  2ZGY A;  4BR2 A;  4WQ5 A;  1YUW A;  4YDU A;  3CET A;  4QS7 A;  1C0F A;  1BU6 O;  4WQ4 A;  5LJV A;  2CGL A;  1HPM A;  4BR7 A;  3LDO A;  5TKY A;  2GWJ A;  3AAQ A;  2QM1 A;  1GLJ O;  2YJE A;  4BRM A;  4JNE A;  4FWO A;  1RGI A;  1HKG A;  5F2R A;  1X3M A;  2Q1N A;  1GLE G;  4CZJ A;  4BC4 A;  5F0X A;  1QZ6 A;  2YHY A;  5E84 A;  4BRL A;  4H5N A;  4JHD B;  3ZEU B;  1S3X A;  1KAX A;  3ENH A;  4JAX A;  2GEM A;  3QFP A;  4BRA A;  3QDK A;  4H0X B;  3H6E A;  3DXK A;  5JLF A;  4NO7 A;  4H03 B;  1H1V A;  2W40 A;  5AFU A;  3ATV A;  3EO3 A;  3MN6 A;  3UKU A;  3WT0 A;  4BR5 A;  1JCF A;  3JS6 A;  2E2Q A;  2A42 A;  3CHW A;  1BOT O;  4BC3 A;  4EHT A;  4JD2 B;  3EKU A;  4FL9 A;  2H3G X;  1MDU B;  1YAG A;  3GBT A;  2GWK A;  4PKG A;  1LOT B;  1T44 A;  4PL7 A;  1XQS C;  5AQX A;  1XUP O;  4MO5 A;  1RDW X;  1K8K A;  2Q0R A;  2YCH A;  4K42 A;  2P9P B;  4BRG A;  2WUS A;  3GG4 A;  3W3D A;  3UKR A;  3H3O B;  4QS8 A;  5AQK A;  3B8A X;  4XH5 A;  2P9S A;  5JIC A;  3ULE B;  5AQV A;  2Q31 A;  5ADX A;  3WXK A;  5AQW A;  5LJW A;  4FWS A;  3VET A;  4B1Z A;  2ASM A;  3VEZ A;  3FGU A;  3D2F B;  5BR9 A;  3AAP A;  2V51 B;  4IJN A;  1XC3 A;  3KZB A;  3WXL A;  5KPT A;  5FPE A;  2D4W A;  4BG8 A;  4CZH A;  2VWB A;  5BN9 A;  2J4R A;  2Q0U A;  1NLV A;  2ZWH A;  3O6W A;  3LDL A;  3FFK B;  4F9O A;  5KQ8 A;  1TYQ A;  3D7E O;  3ZX2 A;  5AQS A;  3VEX A;  1NWK A;  3GOI A;  5AZI A;  4BQZ A;  2P9K A;  4O8K A;  3UE5 A;  3CJ1 A;  4B1V A;  4EAH D;  5BRD A;  1Q18 A;  3VF2 A;  2OAN A;  1DEJ A;  1MWM A;  3IMX A;  1SZ2 A;  3O8M A;  1NGG A;  2AP1 A;  1NM1 A;  1T6D A;  4AM6 A;  4BRH A;  2IVO A;  3CQX A;  4DB3 A;  4BR0 A;  1J6Z A;  2E1Z A;  2QWO A;  4B1X B;  3D2E A;  5JMV A;  3FLC O;  3CJC A;  1S22 A;  3SMP A;  3WQU A;  4BRQ A;  4M63 C;  1E4G T;  2ASO A;  2NLX A;  5EXW A;  3FZL A;  4CZE A;  3SJH A;  3UKR B;  4H0Y B;  3I33 A;  1GLC G;  4CZF A;  3A5N C;  3LM9 A;  3ZX3 A;  4CZI A;  3MN9 A;  3MCP A;  1SAZ A;  5EX5 A;  1LCU A;  4CD3 A;  1NGE A;  2QWQ A;  1Y64 A;  3C7N A;  3QBW A;  4QS9 A;  4C23 A;  1HKB A;  1V4S A;  2P9U B;  3FR0 A;  3WEE B;  3OHR A;  2GUP A;  2FF6 A;  4E1J A;  2QWN A;  3FZF A;  1E4F T;  3H1Q A;  3O5B A;  3A8Y A;  1ESV A;  2BUP A;  4A61 A;  5FPD A;  1ZBS A;  3O4W A;  2W41 A;  1MA9 B;  2V52 B;  3ZET B;  1T6C A;  3CJ7 A;  4ISG A;  4B9Q A;  3BF1 A;  2V7Z A;  3R8E A;  4GNI A;  5EOY A;  5AQN A;  2PBD A;  4MLE A;  4BVO A;  4WYB A;  2CH5 A;  5AZI B;  4B1Y B;  4CZL A;  2P9K B;  4CJ7 A;  1BA1 A;  2AA4 A;  2E88 A;  3G25 A;  3MMV A;  5ELZ A;  4ISF A;  4Z94 A;  4DHY A;  3DJC A;  4H0P A;  1JCG A;  3WQT A;  4FWQ A;  1P8Z A;  1NGD A;  3EKS A;  4BRF A;  1BA0 A;  1V4T A;  4M7Y A;  4I6M A;  5AZJ B;  1C0G A;  4A62 A;  3VGM A;  5AQU A;  1EQY A;  3A5M C;  3M6G A;  1HKC A;  5AR0 A;  2P9L B;  3LDQ A;  3MN5 A;  5BRF A;  2QWM A;  2E8A A;  2A41 A;  1R59 O;  1U2V A;  2QWL A;  2QWR A;  3O1W A;  3WUH A;  3DXM A;  3H45 C;  4O5F A; 
#chains in the Genus database with same CATH topology
 1YXQ A;  3BDP A;  1BUP A;  2HF3 A;  1VRU A;  2FXU A;  1NGB A;  4TSX A;  5E41 A;  3WNF A;  3VA0 A;  3QML A;  5AQH A;  1VRT A;  2F96 A;  4CW7 B;  3WXM B;  3D0P A;  3KD1 E;  1QHT A;  3QBX A;  4H5V A;  3L2U A;  3E9P A;  3J7Z O;  5F1X A;  4KAZ A;  1VQN N;  5FPN A;  5H1S Q;  4LD0 A;  4DG1 A;  5BR8 K;  1P90 A;  1SQK A;  3RSE A;  3HZ6 A;  4IZ9 A;  1Z05 A;  3O08 A;  1GLL O;  4JK8 A;  3KD5 E;  4C8O A;  3U6F A;  4OPH A;  5GAH P;  3D45 A;  4CER A;  3LDN A;  3VGK A;  4ILH A;  4CJ3 A;  2F8S A;  4CFA A;  5MLC Q;  3E1Y A;  4CEB A;  3OYA A;  4YOT A;  3VQP A;  4HTL A;  1K9M O;  3MDQ A;  4Z4G A;  1MWK A;  3IUC A;  3CQY A;  3JXU A;  3AO4 A;  3IKM A;  3QET A;  2O4G A;  3SAG A;  5EVZ A;  1VQO N;  4H5R A;  4DTS A;  4YHH K;  2KQ2 A;  2F8T A;  2FLO A;  4K25 A;  5C10 A;  1Q7Y O;  4FLY A;  1U4B A;  4RW4 A;  4BRE A;  2DY4 A;  5C2D A;  3HL8 A;  4ID1 A;  3VQB A;  2VQF K;  3MXI A;  1RDD A;  4DV0 K;  1OH6 A;  4B1W B;  3PSF A;  2KTQ A;  1RBT A;  4CBX A;  3N4Q A;  2O8E B;  4H4O A;  2PYL A;  1SV5 A;  2GUI A;  5LMN K;  3VPZ A;  3DWL A;  1Q86 O;  3LM2 A;  4YFU A;  1EO1 A;  1Q81 O;  3QFU A;  3NBP A;  3T1A A;  1U04 A;  2F9W A;  3CPW M;  4PQU A;  1WLJ A;  1BIU A;  2ZF5 O;  1YJW N;  3QIP A;  3QIC A;  2NZT A;  3VQC A;  4Q5V A;  3TSQ A;  3HT3 A;  2YX6 A;  1ZYQ A;  2HVI A;  2W6K A;  3K0S A;  4RTF D;  1O1W A;  5BPN A;  4M3Z A;  4NXM K;  3NE6 A;  2XY6 A;  1NKC A;  1TUY A;  4BR4 A;  1NK4 A;  2O8B A;  3C95 A;  3HM8 A;  2PZS A;  3EZW A;  1NGI A;  5AQT A;  4RW7 A;  1JCE A;  1L3V A;  5CHI A;  5B8H A;  3AA3 A;  4CIG A;  4DTN A;  4OVL A;  3FZM A;  3C7N B;  2GBZ A;  4K41 A;  2FBY A;  3K59 A;  2BTF A;  4CF9 A;  5AFU H;  3NH2 A;  3CCQ N;  3LPT A;  3MX5 A;  4H0O A;  3DRP A;  1HR0 K;  3SYZ A;  2E4L A;  4RW9 A;  4Z4C A;  2I7N A;  3OYD A;  3MN7 A;  3OS0 A;  5GAE P;  3CM5 A;  1I39 A;  2A5X A;  4DU1 A;  3AVG A;  2G8H A;  5AQJ A;  3PX4 A;  1N36 K;  4B1U B;  3M3Z A;  1VSD A;  4CEO A;  1YF5 L;  2HF4 A;  2P9U A;  5JS2 A;  3NVK A;  3RVC A;  2KFZ A;  4PUO A;  3AGR A;  3WNH A;  2DFF A;  1JL1 A;  4AM7 A;  4B9L A;  3ZEU A;  3EN9 A;  2UXD K;  4XEI A;  3WXJ A;  3F73 A;  3HP6 A;  3HVT A;  3DLE A;  3ENO A;  3U9D A;  1JKH A;  2DFH A;  3L6Q A;  5EY4 A;  3A5O C;  3LWM A;  2NRX A;  2Q36 A;  4BQL A;  4FWR A;  3DXM B;  4FYD A;  2YJF A;  4MDB A;  3KK1 A;  1ZBH A;  4DR4 K;  3JYT A;  3EZ5 A;  1NGJ A;  3AA2 A;  2ZGZ A;  1BIZ A;  2G8U A;  3P1G A;  5C25 A;  4YOU A;  4B8A B;  3LAM A;  5T7B A;  1HX1 A;  4WE1 A;  4LC9 B;  4DFK A;  1NGF A;  3HK2 A;  2O8C B;  4E3S A;  1N5Y A;  4BR2 A;  1QSY A;  2VG7 A;  2G8W A;  3OYL A;  1BU6 O;  3PO5 A;  3LDO A;  2QM1 A;  1SUQ A;  4BRM A;  4KO0 A;  1RBR A;  1W0H A;  4OKE A;  1RGI A;  1HKG A;  3TTF A;  1KD1 O;  3AVJ A;  4AF1 A;  4FW1 A;  5FRO A;  3O3F A;  3DLG A;  4DFM A;  3THW A;  4O4G A;  4F2S A;  3AA4 A;  1T3V A;  3NGI A;  1QZ6 A;  4AHC A;  4BRL A;  4JI3 K;  3C6T A;  3MCA B;  5C42 A;  2B6A A;  4BRA A;  1TK0 A;  4CED A;  1SL0 A;  4CJS A;  3QDK A;  3K5N A;  1WN7 A;  4NLC A;  1ZBI A;  4CGI A;  3J7Y P;  4H03 B;  1H1V A;  5KGX A;  4H4M A;  3MN6 A;  3O3H A;  4CEA A;  2E6M A;  3PUF A;  4FJM A;  2E2Q A;  1FW6 A;  3PY8 A;  1BOT O;  1RDC A;  3AVH A;  1S5J A;  1M1K O;  4FL9 A;  4Z0U A;  4NYN A;  3VA3 A;  4E89 A;  5M1K A;  1OH8 A;  1MDU B;  4RG8 A;  1T44 A;  4KTQ A;  5HRR A;  2KZM A;  3MEG A;  2P9P B;  4DV5 K;  1RTD A;  4OGC A;  4QS8 A;  1WSJ A;  1OH7 A;  3B8A X;  3OJU A;  4DUZ K;  4B9M A;  1C1B A;  3UIQ A;  4DSL A;  3ULE B;  4W5Q A;  3TAQ A;  1S6P A;  3AVN A;  2ZM6 K;  3VEZ A;  3PIO L;  3D2F B;  3AAP A;  2V51 B;  1XC9 A;  3N4P A;  4IJN A;  3K9J A;  1WNS A;  5FPE A;  2ETJ A;  3OYN A;  2O8E A;  4L8R B;  4DQR A;  1XMO K;  5K14 A;  3P38 A;  4BG8 A;  2VWB A;  5BN9 A;  2Q0U A;  4DS4 A;  2WON A;  1RNH A;  4J2E A;  4E19 A;  4DTP A;  3VEX A;  1NWK A;  4CF0 A;  3SQ1 A;  2QKK A;  4BDP A;  3VQE A;  4BQZ A;  2P9K A;  2E6L A;  3CJ1 A;  3T19 A;  1B92 A;  5BRD A;  2FBT A;  1ILY A;  4J2B A;  3ZYY X;  3E9O A;  3RMD A;  2JGU A;  1Q9Y A;  3VMF B;  2OAN A;  3ZSQ A;  5GAD P;  1MWM A;  3IMX A;  3QEP A;  1T6D A;  1E3M A;  1WB9 A;  4AM6 A;  2NRT A;  4BRH A;  4FM0 A;  4DTO A;  4DF4 A;  4CJV A;  1BCM A;  4BR0 A;  2QWO A;  3CF5 L;  3HXM A;  5J2N A;  3C6H A;  3WQU A;  3EYZ A;  3QNN A;  4LF7 K;  2HHS A;  2ASO A;  5EXW A;  3SJH A;  3UKR B;  2A1S A;  3PV8 A;  1JXB A;  1IBM K;  1GLC G;  4GV6 A;  1D9D A;  3QES A;  4CD3 A;  3C7N A;  4CIE A;  4C23 A;  1NK8 A;  4M3U A;  1QSS A;  4LF8 K;  4OX9 K;  1HKB A;  3VQ9 A;  1V4S A;  4M45 A;  3RR7 A;  3WEE B;  3SNN A;  4DR2 K;  4CFC A;  4PY5 A;  2GUP A;  4E1J A;  1ASW A;  3VQA A;  1E4F T;  1U49 A;  3NMU A;  2PFU A;  4F3O A;  1ESV A;  4A61 A;  3QO9 A;  1ZBS A;  2HMI A;  1MA9 B;  3OBY A;  2WTU A;  1T6C A;  3HPO A;  4ISG A;  3BF1 A;  2OTJ N;  2V7Z A;  1Q82 O;  2AJQ A;  4GNI A;  5C15 A;  4MLE A;  3OBW A;  1RBV A;  4K8Z A;  3G25 A;  3SBT A;  1C0T A;  1KTQ A;  1IKV A;  2OPP A;  4DHY A;  3DJC A;  3THX B;  4BAC A;  1NGD A;  4GV3 A;  3SPY A;  4CJQ A;  1RIL A;  3SUQ A;  4DQI A;  3A5M C;  4RW8 A;  3CFR A;  3MN5 A;  3CCV N;  2FBX A;  1YJN N;  4WCE L;  4MQ3 A;  2OPS A;  3HYF A;  2QWR A;  3DXM A;  3KLE A;  3H45 C;  3HM9 A;  2ZJQ L;  4O5F A;  4FWN A;  4HHT A;  4CEF A;  4OPK A;  1DKG D;  4CGH A;  2UYT A;  3TSP A;  1KCF A;  4FJ5 A;  1CXQ A;  4DLE A;  2YHW A;  4LF6 K;  4FM1 A;  3RRH A;  5AQL A;  4A2A A;  3BP8 A;  2FBV A;  4CJW A;  3TAG A;  2HHQ A;  4DCH A;  2O8C A;  2F9T A;  3HBT A;  4ID5 A;  3IS9 A;  4IEE A;  3S41 A;  3H08 A;  4DKW A;  1BDG A;  3KWI A;  4C8K A;  1BQN A;  4BC2 A;  3DXK B;  1LWC A;  4HVJ A;  1NNE A;  4YNQ A;  3TAR A;  3CFP A;  3UKU B;  4HWI A;  3DI6 A;  4O0I A;  1C1C A;  1X1P A;  4LF4 K;  1NJI O;  1RT1 A;  3GE1 A;  3ZLJ A;  1QQO A;  3R3L A;  5M1F A;  2QEX N;  3L2V A;  4H8K A;  4CF2 A;  2ITG A;  5LY3 A;  4MFB A;  3KLG A;  4JKB A;  1X9J A;  2GEL A;  2IC3 A;  4G1Q A;  4EHU A;  3MAQ A;  4JRQ A;  2I7P A;  4CEE A;  1ZXO A;  5M1N A;  5BRE A;  1T03 A;  3VER A;  5J2M A;  1ATR A;  3TAN A;  3TSU A;  3ISN C;  3M5R A;  3I8D A;  2E2P A;  4A2B A;  1VSI A;  1OKJ A;  4YOR A;  3QEX A;  2P9P A;  3DLB A;  3VF6 A;  4ELV A;  4E7K A;  4J2D A;  4CZK A;  1VSF A;  4KRE A;  1SKW A;  4NB4 A;  1J5E K;  3ULE A;  4DV7 K;  4GMJ B;  4BRD A;  1NGH A;  2RE2 A;  3RRG A;  1QQN A;  1N34 K;  3D2F A;  1JLC A;  3CYM A;  4AHV A;  2NRV A;  4OKJ A;  4IFE A;  4IXC A;  1L3U A;  4FW2 A;  3U4L A;  4CBW A;  4NXN K;  3O9Q A;  2FSN A;  3NVM A;  3P39 A;  1YT3 A;  3DRS A;  2HHT A;  1MU2 A;  5HLF A;  4JEP A;  3D2E B;  1IV0 A;  4FPB A;  3HI0 A;  1VSM A;  4W5O A;  1NK0 A;  1L3S A;  4IBN A;  2ZD1 A;  4BRK A;  4W5N A;  4KHS A;  4CZM A;  4FJ7 A;  3P31 A;  3VEW A;  5AQR A;  4DQQ A;  4GKJ K;  3KK3 A;  1HNZ K;  3MWP A;  1BO5 O;  4B3T K;  1N33 K;  1VK0 A;  2X74 A;  4O5B A;  3FE1 A;  4CF8 A;  2QI2 A;  4FSV A;  2HHU A;  2RF2 A;  2QXL A;  3NH0 A;  4GVM A;  4ICL A;  4NLB A;  4BE2 A;  3VES A;  1DLO A;  4E7I A;  2LSN A;  3SUN A;  2CGJ A;  3V9X A;  4BDZ A;  5KPZ A;  3KWG A;  3QLH A;  4J8F A;  4YOW A;  3MED A;  4OKK A;  4RWT A;  1CZB A;  3HPH A;  4H0V B;  2Z1I A;  4RCH A;  4B9T A;  5AQP A;  1JL2 A;  4FJL A;  3NF8 A;  4IKF A;  1NOZ A;  3KK7 A;  2YHX A;  1Y97 A;  3HOT A;  5KRT A;  1IKY A;  2KW4 A;  1TKT A;  3WEE A;  4ILJ A;  1KXP A;  4JI0 K;  1YIT N;  1GOC A;  4YY3 K;  1HNV A;  4EZ6 A;  2HB5 A;  4XH4 A;  1EET A;  5ADX H;  3MXM A;  4DSJ A;  3EL2 A;  4V19 S;  3EE9 A;  4I6M B;  4PWD A;  1HUX A;  3SI6 A;  1FKO A;  4B08 A;  4CD1 A;  3O4Q A;  5AQI A;  1RFQ A;  4JKF A;  3G0Z A;  4QCL A;  5M1Q A;  2QWP A;  1VSE A;  2ZQB A;  1FXX A;  1BWF O;  3F9M A;  3HTV A;  1RT5 A;  3R6M A;  4Z4H A;  3NHG A;  1SL1 A;  1GOA A;  1KVC A;  2P9I B;  4FO0 A;  3THX A;  5HL7 L;  2NRH A;  5I42 A;  2FC0 A;  1JLG A;  3KVG A;  2NRR A;  4B8C A;  4M42 A;  4W5T A;  3WNE A;  3OTO K;  2X6N A;  4EIA A;  2E2O A;  4DWI A;  2E2N A;  4KI6 A;  4EP4 A;  4LFB K;  4M3Y A;  4BGB A;  1S1W A;  4R5P A;  4OLA A;  4KTW A;  1RTH A;  4ELT A;  3WXI A;  1B9F A;  4IO8 A;  5KI6 A;  5AQF A;  3ZT3 A;  1ITG A;  1C6V A;  3CFO A;  1KQS M;  1NG9 A;  4QS7 A;  3M8S A;  4CJL A;  1K73 O;  4FJN A;  2YKN A;  3Q7B A;  1WBB A;  4CGD A;  2CGL A;  3SAH A;  3ASM A;  1GLJ O;  4LFC K;  3BZK A;  4JNE A;  1Q8I A;  3E66 A;  2NUB A;  2Q1N A;  1GLE G;  4CZJ A;  4BC4 A;  3SUP A;  3PO4 A;  4JS4 A;  4JHD B;  5J1E A;  1QE1 A;  3OYF A;  4IFV A;  4JAX A;  2GEM A;  3LAL A;  4JKE A;  4NCG A;  5SWM A;  5C12 A;  4DTU A;  4DFJ A;  3DXK A;  5JLF A;  4NO7 A;  1S1V A;  3TWH A;  3ZT2 A;  3ATV A;  3EO3 A;  5CZ1 A;  5AFU A;  3UKU A;  4OO1 J;  1VQM N;  3JS6 A;  4CF1 A;  4EHT A;  2IS3 A;  2H3G X;  3TTC A;  2HNZ A;  1LV5 A;  1YAG A;  3GBT A;  3ZSX A;  2GWK A;  1LOT B;  5LL6 Z;  5AQX A;  3TI0 A;  1FK9 A;  4IDK A;  5J2Q A;  2BGG A;  4K42 A;  4BRG A;  2WBN A;  3GG4 A;  3SQ2 A;  4Q0B A;  3H3O B;  2Z1J A;  1VSH A;  5AQK A;  4FLW A;  2X6S A;  3QIN A;  2Y1I A;  2R7Y A;  2QKB A;  3LP2 A;  5JVG L;  3DLH A;  4KB0 A;  3WXK A;  2DTU A;  5AQW A;  5LJW A;  4B1Z A;  3K5O A;  4CGG A;  2A1R A;  4YOV A;  4O55 A;  3WXL A;  4DV1 K;  3J7A P;  2KZZ A;  1NK9 A;  4DV6 K;  3L2W A;  2OPR A;  3NF6 A;  4B9V A;  4AHU A;  2UU9 K;  1W97 L;  3LDS A;  4PA1 A;  4CHZ A;  3LDL A;  5KQ8 A;  3CC2 N;  1UA1 A;  2RN2 A;  4MDA A;  3GOI A;  5AZI A;  3VN5 A;  4O8K A;  4CJ5 A;  1KVA A;  4DQP A;  4IFY A;  4CGJ A;  1XNR K;  3I0R A;  1I3A A;  3O8M A;  1NGG A;  1RDA A;  3CQX A;  4DB3 A;  3OJS A;  2E1Z A;  4CEZ A;  4B1X B;  3D2E A;  4CJU A;  4KRF A;  3ZCM A;  3SMP A;  4M63 C;  1I94 K;  2WC9 A;  4CK3 A;  2UUA K;  2NLX A;  3ZT4 A;  3OYH A;  3PX6 A;  1N6Q A;  3RR8 A;  3FZL A;  4CZE A;  1RBU A;  3K9K A;  5FRM A;  1BIS A;  4CZF A;  3A5N C;  4CZI A;  3FFI A;  3MN9 A;  3MCP A;  5EX5 A;  1LCU A;  4CGF A;  2QK9 A;  1Y64 A;  4QS9 A;  2UUB K;  3V9U A;  4B3O A;  4DSK A;  2YNG A;  3QEI A;  3FR0 A;  4ZTJ A;  4Y1C A;  1YIJ N;  2FF6 A;  3FZF A;  3KKS A;  4LF5 K;  3SUO A;  4DV4 K;  3CCR N;  2VGM A;  4ILG B;  3V4I A;  4B9Q A;  1VAZ A;  3T3F A;  2D0B A;  3CPE A;  5HP1 A;  2WOM A;  5AQN A;  4BVO A;  3AGK A;  1BA1 A;  4CJ7 A;  3J81 O;  1NK6 A;  3LP1 A;  1TKX A;  3THV A;  3NGY A;  4JI6 K;  1V4T A;  5GAG P;  4KH6 A;  1QSL A;  4I6M A;  3SCX A;  4A62 A;  3VGM A;  3IG1 A;  1HNX K;  2D0A A;  4GV9 A;  5BRF A;  2HBJ A;  3SV3 A;  4N5S A;  4KHP K;  3ID6 A;  1VQ8 N;  2OYQ A;  3Q7C A;  2A41 A;  3AV9 A;  3L8B A;  1YVU A;  3G10 A;  4FJG A;  1WSF A;  2QWL A;  3O1W A;  1EX4 A;  2HHW A;  2VYP A;  2P9I A;  3NH1 A;  4I9Q A;  2HBK A;  5I9E B;  4JKA A;  4O0J A;  2HOE A;  1IH7 A;  3V81 A;  1U45 A;  1WUA A;  1XMQ K;  3VTH A;  1IKW A;  1J54 A;  3V6D A;  4LSL A;  3KTQ A;  5HOO A;  1T8E A;  1NJW A;  4IJA A;  4JI5 K;  2YNH A;  1YI2 N;  1JLF A;  3OW2 M;  1BL3 A;  3U8X A;  1KC8 O;  5FDL A;  3TPQ A;  1KAY A;  1ASV A;  1L5U A;  5LMU K;  4HCB A;  2YNF A;  2IIR A;  4CBU A;  2FSK A;  2G8K A;  4KV8 A;  2VCP A;  1CZA N;  1X3N A;  4M3X A;  3KLH A;  3MXJ A;  3ZSY A;  3VEY A;  2GTD A;  2P1J A;  3HVR A;  3LAK A;  3OYJ A;  3LDP A;  1XI1 A;  2OZS A;  3ZT1 A;  4JHD A;  1WBD A;  2HMP A;  1J53 A;  4DQS A;  2YI1 A;  1RTJ A;  4B3R K;  5BN8 A;  2BAN A;  4A57 A;  2VG6 A;  1D8Y A;  1RT2 A;  1U6Z A;  3NCI A;  4GVE A;  3SK3 A;  4DUY K;  4X62 K;  4JI8 K;  4O44 A;  4JI4 K;  3ID8 A;  3K57 A;  2FSJ A;  3CC7 N;  1IO2 A;  1X9M A;  3NDK A;  5AQO A;  4E7L A;  3CIP A;  3QIO A;  3CJB A;  4HTU A;  5DM7 L;  4PKI A;  3HPG A;  3HST B;  2YHA A;  4FWL A;  4DV3 K;  5FLX O;  1S6Q A;  5GIN A;  3OYM A;  5CE3 A;  1XWL A;  4A5B A;  2OPQ A;  4CJ4 A;  4DR1 K;  1NBW A;  3VEO A;  4EZ9 A;  3IRX A;  3V1Q A;  4KHN A;  1N8R O;  1QQM A;  1UAX A;  2YNI A;  3V9S A;  3RMC A;  1TUU A;  1W9H A;  4ELU A;  4M3R A;  4NCA A;  5KTQ A;  1TYQ B;  2FF3 B;  3NAE A;  4FK2 A;  3VGL A;  1CZ9 A;  4AH9 A;  1RTI A;  3A2F A;  3RMB A;  2XO7 A;  2ASP A;  1NKE A;  1SKR A;  3KHY A;  4DTJ A;  1GLD G;  3BEX A;  1HYZ A;  3SJJ A;  3DAW A;  4FOI A;  3BY5 A;  3PLA A;  2P51 A;  1O13 A;  3J80 O;  4DR7 K;  5CYM A;  4I9L A;  1QVG M;  1JLE A;  1VQP N;  3K5M A;  1D4X A;  3E9L A;  1REV A;  3HSC A;  1GLF O;  4DU4 A;  3VEV A;  4MLH A;  4LSN A;  4BRI A;  1VQL N;  1S1T A;  1IJJ A;  1X9S A;  4J2A A;  4AHS A;  1B9D A;  3P83 D;  3AA5 X;  4KHQ A;  1QS4 A;  4DMN A;  4B9U A;  4GKK K;  3O80 A;  3T1Y K;  3PIP L;  1SKS A;  1DTT A;  4OGE A;  2O8F B;  1QZ5 A;  3G4S N;  1TKD A;  4JKD A;  4CVN E;  5BPL A;  5IWA K;  1RBS A;  3OA9 A;  4C8N A;  1Q9X A;  1S9E A;  3CG7 A;  3AY9 A;  4EFH A;  4DU3 A;  4GY2 B;  4KFB A;  4CHO A;  4CJT A;  5BRH A;  4DTM A;  2B4J A;  4HUE A;  3U9Z A;  4OLB A;  3QB0 A;  3SMS A;  1NK7 A;  3CJA A;  5FPM A;  4FPA A;  2PAV A;  3ULD A;  3AO3 A;  1EP4 A;  2UUC K;  2HND A;  1T05 A;  2ATQ A;  3LP3 A;  1F21 A;  3AVB A;  1N32 K;  4B3M K;  2GX9 A;  5CZ2 A;  1IBK K;  1K6Y A;  1RDU A;  1RT7 A;  4I7F A;  4JI2 K;  3EEQ A;  4CI6 A;  4AIL C;  3LP0 A;  4M7X A;  3GL1 A;  3AVA A;  4ZHR A;  2ZJP L;  4FM2 A;  1VSL A;  2Q2R A;  3SLC A;  3OS1 A;  3CQ8 A;  3GDQ A;  1BCO A;  1HPZ A;  3F9K A;  5AQQ A;  3U3G A;  4H5W A;  1RT6 A;  4PKH A;  1U2V B;  1KFS A;  4BR9 A;  3ITH A;  1T7P A;  3R9P A;  1WOQ A;  1LAW A;  3C0B A;  2IVN A;  1TL1 A;  4BG9 A;  2KHO A;  2CGK A;  1BG3 A;  2EWS A;  3MX2 A;  4DFP A;  3VQQ A;  1HJO A;  4NYF A;  5I3U A;  2BE2 A;  5AQM A;  1NU0 A;  4H0T B;  4BRO A;  3JSM A;  2D0O A;  3RMA A;  3L4I A;  1NMD A;  1WSG A;  1JJ2 M;  3CER A;  2P9N B;  4JK7 A;  4KHW A;  4R79 A;  2HNY A;  3CXC M;  5LJV A;  1HPM A;  3BZC A;  4F8R A;  4OPA A;  4KB1 A;  1FKP A;  2YJE A;  4JK9 A;  3CC4 N;  1KLN A;  4FWO A;  1UA0 A;  4C8M A;  1X3M A;  3TR8 A;  5HRS A;  2YHY A;  5E84 A;  1A5W A;  2OTL N;  3K2P A;  3WNG A;  4H5N A;  3ZEU B;  3K5L A;  3RTV A;  1EWR A;  1KAX A;  4DSF A;  4JLH A;  4FLV A;  1LW2 A;  3OYB A;  4H0X B;  1VQ7 N;  1S72 N;  5GIO A;  2W40 A;  4NCB A;  3WT0 A;  4C1N I;  4BR5 A;  4K0K K;  3CCU N;  1BQM A;  2HHX A;  2A42 A;  1G15 A;  4IOX A;  2NNW A;  3AVI A;  4JD2 B;  2NRW A;  3O9T A;  1SS6 A;  3DOL A;  4CIF A;  5J2P A;  1XQS C;  1XUP O;  4KI4 A;  4MO5 A;  1RDW X;  3F2K A;  2YCH A;  3TTD A;  3HJF A;  4GW6 A;  3VQD A;  2VG5 A;  3UKR A;  4IG0 A;  5KGW A;  4XH5 A;  1L3T A;  4U7B A;  5JIC A;  2VGN A;  4CHQ A;  4G9Z A;  1HQU A;  1S1U A;  5ADX A;  2BH1 A;  4FWS A;  3LZJ A;  1NJY A;  1KVB A;  4DR3 K;  1BI4 B;  2ASM A;  4PHT X;  3FGU A;  5BR9 A;  2HW3 A;  3KZB A;  5KPT A;  3THW B;  3HO1 A;  3L3V A;  4WF9 L;  4Y1D A;  4CZH A;  2XHB A;  4KH4 A;  2ZWH A;  3O6W A;  3FFK B;  4F9O A;  3SPZ A;  2KFN A;  1TYQ A;  4FLT A;  2D0C A;  5JVH L;  1CXU A;  3OYG A;  3L2R A;  3CCS N;  5AQS A;  3O9R A;  1ZBU A;  3O3G A;  2QXF A;  1YHQ N;  3OYI A;  2NRZ A;  3CM6 A;  4EAH D;  4CK2 A;  1ZBL A;  1Q18 A;  1Z25 A;  1DEJ A;  4JI7 K;  2AP1 A;  2IVO A;  4FZY A;  2F7T A;  1J6Z A;  4A5A A;  2VWK A;  1S1X A;  5JMV A;  1EXQ A;  1S22 A;  3CJC A;  3R1X A;  3DLK A;  2GV9 A;  4LFA K;  4E7H A;  2E5L K;  3OS2 A;  3P5J A;  3ZX3 A;  4FK4 A;  4JKC A;  1NGE A;  2QWQ A;  1NOY A;  4FZZ A;  2OZM A;  4DS5 A;  3DMJ A;  1A5X A;  1LW0 A;  3O9U A;  2RHK A;  3OHR A;  3CCM N;  1VQ9 N;  5M1O A;  1JXE A;  2QWN A;  4KTZ A;  1OH5 A;  2O8F A;  3A8Y A;  4FJI A;  3SQ4 A;  5IT9 O;  3CD6 N;  5FPD A;  2BDP A;  3O4W A;  2W41 A;  2V52 B;  3VQ5 A;  3PX0 A;  3ZET B;  4CCH A;  4AHT A;  3R8E A;  5EOY A;  3ALY A;  1NK5 A;  4WYB A;  2CH5 A;  3AVF A;  4BDY A;  1IG9 A;  4CZL A;  2P9K B;  2AA4 A;  2E88 A;  1NJX A;  5ELZ A;  4ISF A;  3TAP A;  4XIU A;  4LH4 A;  3IAY A;  1IKX A;  4FWQ A;  2ZJR L;  4BRF A;  3EKS A;  4M7Y A;  3ZSO A;  3S9H A;  3CMA N;  5AZJ B;  1C0U A;  4F4K A;  2O8D B;  1ASU A;  4KKO A;  1EQY A;  3M6G A;  5AR0 A;  4AQY K;  2P9L B;  3LDQ A;  1TK5 A;  4FCY A;  3TAE A;  1U2V A;  1EKE A;  3G71 N;  3WUH A;  1TV6 A;  1Z6R A;  1IG8 A;  3G6E N;  4JKG B;  3L2Q A;  3NGZ A;  2A3Z A;  1KAZ A;  3VOV A;  2E20 A;  1BHL A;  1HLU A;  2KKZ A;  4IDH A;  2YV0 X;  2B5J A;  5EU7 A;  2V7Y A;  3MWT A;  4FZX C;  3C94 A;  2DPN A;  4BRN A;  4FXD A;  3FZK A;  3CJ9 A;  2IVP A;  4IO9 L;  1D5A A;  1VQ4 N;  3S3O A;  4BRP A;  3AO5 A;  3IFR A;  2EHG A;  2P9N A;  1KLM A;  3BUZ B;  3J8A A;  4N56 A;  3LL3 A;  4Z4I A;  2HVH A;  4BC5 A;  4K8X A;  3H3N O;  3CCL N;  2IOC A;  2QTD A;  4CJK A;  5KQD A;  3D6R A;  5AQY A;  3ZSW A;  3MK6 A;  1VQ5 N;  4FWP A;  4IOC L;  1YVN A;  4FJH A;  4DTR A;  4N76 A;  3SV4 A;  4Y0W A;  3NFA A;  1K8K B;  5AQZ A;  4BGA A;  4DQ8 A;  1RT4 A;  5D3G A;  2W6L A;  3MEC A;  1NGC A;  5FRN A;  1TAU A;  4B9N A;  2Y1J A;  2A40 A;  1YTA A;  2P9S B;  4JD2 A;  4JKH A;  2KLA A;  3CME N;  4KH5 A;  4OPJ A;  3ZX0 A;  3SZ2 A;  3HRG A;  1ZC6 A;  2W42 A;  4DR6 K;  2Q97 A;  4HUG A;  2IAJ A;  3P4I A;  3M1F A;  4H5T A;  4IWV A;  3H46 O;  3DLL L;  4DF8 A;  3AO1 A;  4B3S K;  1G99 A;  1LAV A;  3DM2 A;  3VQ4 A;  4JN4 A;  2P5O A;  2UXB K;  4CZG A;  1NGA A;  4E0D A;  4CHY A;  1QQC A;  4WQ5 C;  3O9S A;  2XY5 A;  2HHH K;  4YDU C;  1BI4 A;  3IDH A;  5E26 A;  4WQ4 C;  1HRH A;  1C1A A;  4CEC A;  2XY8 A;  4N41 A;  1IBL K;  3AAR A;  4X65 K;  4CHP A;  1UOC A;  5KPR A;  3TAM A;  1OVY A;  3B6P A;  1ATN A;  3LAN A;  4FOE A;  1WSI A;  4JS5 A;  3DOK A;  3SBG A;  3TU5 A;  3THY B;  4E1N A;  3VTI A;  2UXC K;  1OVQ A;  3L0Q A;  5AJ3 K;  3SAF A;  2JWK A;  1CLQ A;  3O4N A;  2E1Y A;  4BE1 A;  4Z4F A;  3QER A;  4IEI A;  3M8P A;  4F3T A;  4IOA L;  4CFB A;  4WFB L;  1YTU A;  1DT9 A;  4WFA L;  3T69 A;  4C1N K;  1RCH A;  2VWJ A;  1EWQ A;  3ZT0 A;  1X9W A;  1HNW K;  4K43 A;  1TGO A;  1QTM A;  3V1O A;  4FLX A;  4E1M A;  1J5O A;  1YJ9 N;  2OA8 A;  3A5L C;  4QOZ B;  2CH6 A;  4FK0 A;  2A6A A;  2Z1H A;  2D0P A;  4YOX A;  3AVK A;  4FWK A;  2ITM A;  2G8F A;  1W7A A;  1W2B M;  3CI5 A;  3C65 A;  3W0L A;  3OYE A;  3UB5 A;  4MO4 A;  4BVP A;  2XRI A;  4XH1 A;  1WAF A;  5JLH A;  2HBM A;  4L3Q A;  3V9W A;  2HBL A;  4M41 A;  3HOS A;  4X66 K;  1VHX A;  4PL8 A;  3BF3 A;  1HYV A;  1SL2 A;  2XY7 A;  3FZH A;  3S3M A;  1GLB G;  3T7Z A;  4CJF A;  2QW9 A;  3O1B A;  3QNO A;  4CJE A;  4QAG A;  5HBM A;  4CK1 A;  1WAJ A;  3OYC A;  1DGK N;  1HNI A;  3ZET A;  3QEV A;  3VEN A;  3ATU A;  3B6O A;  2YHB A;  1RDB A;  3C6U A;  1KFD A;  2D1K A;  1QHA A;  4FJX A;  3KLI A;  4AHR A;  3VQ6 A;  1J9A A;  3H1V X;  4M3W A;  3CCJ N;  4BWM A;  3I8B A;  4WFN L;  4FJ9 A;  3JAM O;  4HUF A;  1GLA G;  4KHY A;  1TKZ A;  1NJZ A;  5C24 A;  5M1P A;  4CES A;  4OJR A;  4BRC A;  5AZJ A;  2O8D A;  4ISE A;  1XHX A;  5AQG A;  4FLZ A;  4DSI A;  5KRS A;  1ATS A;  3ENB A;  2P9L A;  4FWM A;  3C6A A;  2DFE A;  2JWL A;  5BPM A;  3A0I X;  2VQE K;  1UWB A;  3RSE B;  4KBO A;  3VF4 A;  4FJK A;  2JLE A;  4LH5 A;  2ZGY A;  4JKG A;  4WQ5 A;  1YUW A;  3KIO A;  5JS1 A;  4YDU A;  3CET A;  4JYA K;  1C0F A;  4WQ4 A;  1C0M A;  4BR7 A;  2ZE2 A;  2RPI A;  5TKY A;  4DLG A;  4CE9 A;  2GWJ A;  3AAQ A;  4JRP A;  2F4V K;  3LPU A;  4FJ8 A;  5F2R A;  1FJG K;  3TAB A;  5GIP A;  4JV5 K;  5F0X A;  2PY5 A;  4DV2 K;  3K58 A;  4I2Q A;  1S3X A;  2X78 A;  3ENH A;  3S3N A;  3AO2 A;  3L3U A;  3QFP A;  4U67 L;  1K8A O;  2G8I A;  3H6E A;  2IGI A;  4X64 K;  4A59 A;  4E7J A;  5TKW A;  1TL3 A;  5DMR A;  1JCF A;  1QVF M;  2IDO A;  3CHW A;  4BC3 A;  1M90 O;  2G8V A;  3EKU A;  4O8U A;  3OVN A;  1NMN A;  3DLR A;  5SZT A;  3T1H K;  4ZTF A;  4PKG A;  4PL7 A;  1Z26 A;  1K8K A;  3VQ8 A;  5DK5 A;  4CHN A;  2Q0R A;  4BE0 A;  4UY8 O;  3KJV A;  2WUS A;  3W3D A;  4M3T A;  3L4Q A;  1HJR A;  5C2F A;  4FVU A;  2P9S A;  4RW6 A;  4FLU A;  3EY1 A;  5AQV A;  2O4I A;  1U47 A;  2Q31 A;  3ZSR A;  4W5R A;  2P5G A;  1LWF A;  4LF9 K;  3VET A;  1BGX T;  4F2R A;  4N47 A;  1XC3 A;  3DYA A;  5HRN A;  1TVR A;  2EX3 A;  2D4W A;  1KRP A;  3ZSV A;  1HMV A;  3LWL A;  3NF7 A;  2J4R A;  2WFB A;  1NLV A;  2YKM A;  4BWJ A;  1VSJ A;  1GOB A;  2O8B B;  5HRO A;  4FJJ A;  3V9Z A;  3D7E O;  3M8Q A;  3ZX2 A;  4JI1 K;  2QA4 N;  1WSH A;  4Z4E A;  3KK2 A;  3UE5 A;  4B1V A;  1TAQ A;  1D9F A;  1DTQ A;  4CEQ A;  3LZI A;  3VF2 A;  5CY4 A;  1SZ2 A;  4CFD A;  1NM1 A;  3NF9 A;  3THY A;  3HP9 A;  1RT3 A;  1U48 A;  3KKR A;  3I55 N;  1ZBF A;  3FLC O;  4BRQ A;  4DSE A;  4UQG A;  1E4G T;  3M8R A;  4CJP A;  4H0Y B;  5HRP A;  3I33 A;  1VQ6 N;  3OY9 A;  1TK8 A;  1S9G A;  3LM9 A;  3F5T A;  4LY7 A;  3RWU A;  4KPY A;  1SAZ A;  3QBW A;  3AVM A;  4CJR A;  2Z1G A;  3VQ7 A;  1JLB A;  5CYQ A;  1A5V A;  2P9U B;  1NKB A;  4KHU A;  4YOY A;  3I0S A;  3EE8 A;  1HQE A;  2Q3S A;  3H1Q A;  3O5B A;  1VQK N;  5DM6 L;  2BUP A;  4DTX A;  3QEW A;  1XNQ K;  4B9S A;  5A2Q O;  1WSE A;  4IG3 A;  3CJ7 A;  2RKI A;  3BGR A;  2D5R A;  4FVM A;  5CR4 A;  3AVL A;  2HHV A;  1JLQ A;  3OYK A;  3KLF A;  3DRR A;  4HCC A;  4EP5 A;  2PBD A;  1HYS A;  2PYJ A;  1VSK A;  5AZI B;  4B1Y B;  3AVC A;  3U3Y A;  3PSI A;  3ZSZ A;  3MMV A;  3I56 N;  4Z94 A;  3SQ0 A;  4BY9 C;  3E01 A;  4H0P A;  3MEE A;  1JCG A;  3WQT A;  5C0Y A;  1P8Z A;  1BA0 A;  3TAF A;  4DR5 K;  2OCE A;  1C0G A;  5AQU A;  1KSP A;  4I2P A;  1LWE A;  1JLA A;  1HKC A;  3V1R A;  2QWM A;  2E8A A;  1R0A A;  2I5J A;  1XHZ A;  1R59 O;  4C8L A;  3CCE N;  2HST A; 
#chains in the Genus database with same CATH homology
 4FWN A;  1YXQ A;  1Z6R A;  1IG8 A;  3G6E N;  2VYP A;  1BUP A;  2HF3 A;  4JKG B;  2P9I A;  2FXU A;  1NGB A;  1DKG D;  2A3Z A;  2UYT A;  3TSP A;  1KAZ A;  2HBK A;  2E20 A;  2KKZ A;  1HLU A;  4IDH A;  3VOV A;  4JKA A;  5I9E B;  2YHW A;  2HOE A;  3QML A;  5AQH A;  1WUA A;  3WXM B;  5AQL A;  3VTH A;  3QBX A;  4H5V A;  4A2A A;  2V7Y A;  3E9P A;  3MWT A;  3J7Z O;  5HOO A;  5F1X A;  3BP8 A;  2DPN A;  4BRN A;  1VQN N;  5FPN A;  3FZK A;  3CJ9 A;  4IJA A;  4DCH A;  2IVP A;  5H1S Q;  1YI2 N;  4IO9 L;  2F9T A;  3HBT A;  1P90 A;  3U8X A;  1SQK A;  3RSE A;  3HZ6 A;  3OW2 M;  4IZ9 A;  3TPQ A;  4BRP A;  1Z05 A;  1KC8 O;  1KAY A;  4IEE A;  3IFR A;  3J8A A;  2P9N A;  3BUZ B;  3O08 A;  3S41 A;  4DKW A;  1GLL O;  1BDG A;  3LL3 A;  4JK8 A;  3KWI A;  2IIR A;  4CBU A;  2FSK A;  4BC5 A;  4OPH A;  4BC2 A;  3DXK B;  5GAH P;  2VCP A;  1CZA N;  3LDN A;  1X3N A;  3VGK A;  3H3N O;  4HWI A;  3UKU B;  3CCL N;  2QTD A;  5KQD A;  4ILH A;  3VEY A;  2GTD A;  3D6R A;  5AQY A;  1NJI O;  3GE1 A;  3LDP A;  5MLC Q;  3E1Y A;  3MK6 A;  1VQ5 N;  4JHD A;  4YOT A;  4FWP A;  4HTL A;  2HMP A;  1QQO A;  3R3L A;  5M1F A;  2QEX N;  1K9M O;  4IOC L;  3MDQ A;  2YI1 A;  1YVN A;  1MWK A;  5BN8 A;  3IUC A;  4A57 A;  3CQY A;  3JXU A;  4Y0W A;  5LY3 A;  3IKM A;  1K8K B;  3SAG A;  4JKB A;  1U6Z A;  5AQZ A;  1X9J A;  2GEL A;  4BGA A;  4DQ8 A;  4GVE A;  5EVZ A;  3SK3 A;  4EHU A;  1VQO N;  4H5R A;  3ID8 A;  2FSJ A;  2FLO A;  2I7P A;  1NGC A;  4K25 A;  1ZXO A;  5C10 A;  5M1N A;  1Q7Y O;  3CC7 N;  5BRE A;  3VER A;  2A40 A;  2P9S B;  5AQO A;  3CIP A;  3CJB A;  4JD2 A;  4BRE A;  4PKI A;  5DM7 L;  4JKH A;  2KLA A;  4FWL A;  1ATR A;  3CME N;  4KH5 A;  3TSU A;  5C2D A;  3M5R A;  5GIN A;  3ZX0 A;  5CE3 A;  2E2P A;  3HRG A;  4A5B A;  1ZC6 A;  4A2B A;  4B1W B;  1OKJ A;  2Q97 A;  1NBW A;  3VEO A;  4CBX A;  4YOR A;  3N4Q A;  3P4I A;  2P9P A;  3M1F A;  4H5T A;  1N8R O;  4IWV A;  3H46 O;  3DLL L;  1QQM A;  3VF6 A;  4CZK A;  1G99 A;  4JN4 A;  4NB4 A;  1TUU A;  3ULE A;  4CZG A;  3VPZ A;  1NGA A;  3DWL A;  1Q86 O;  3LM2 A;  1TYQ B;  4BRD A;  2FF3 B;  1EO1 A;  1Q81 O;  3QFU A;  3VGL A;  4WQ5 C;  3O9S A;  1NGH A;  2RE2 A;  4YDU C;  2F9W A;  1QQN A;  3IDH A;  3CPW M;  5E26 A;  3D2F A;  2ASP A;  4WQ4 C;  2ZF5 O;  1YJW N;  3QIC A;  3KHY A;  2NRV A;  1GLD G;  2NZT A;  3BEX A;  4IFE A;  3AAR A;  4IXC A;  3DAW A;  3TSQ A;  5KPR A;  3U4L A;  4CBW A;  1OVY A;  2YX6 A;  1ATN A;  4FOI A;  3PLA A;  4FOE A;  4RTF D;  1O13 A;  3O9Q A;  5BPN A;  2FSN A;  3NVM A;  3P39 A;  3SBG A;  3TU5 A;  1TUY A;  4BR4 A;  3VTI A;  1QVG M;  1VQP N;  4JEP A;  3L0Q A;  3D2E B;  3HM8 A;  3SAF A;  4FPB A;  2JWK A;  3EZW A;  1D4X A;  3HI0 A;  2E1Y A;  3E9L A;  1NGI A;  5AQT A;  3HSC A;  4BRK A;  4IEI A;  1GLF O;  4CZM A;  3VEV A;  1JCE A;  4IOA L;  4WFB L;  3P31 A;  3VEW A;  5AQR A;  4MLH A;  5CHI A;  1DT9 A;  4WFA L;  4BRI A;  5B8H A;  3MWP A;  1BO5 O;  3T69 A;  4C1N K;  1IJJ A;  1VQL N;  3FZM A;  3C7N B;  4K41 A;  3FE1 A;  4K43 A;  2QI2 A;  4FSV A;  2BTF A;  2QXL A;  5AFU H;  3CCQ N;  1YJ9 N;  3MX5 A;  4NLB A;  4H0O A;  3A5L C;  3O80 A;  3VES A;  2CH6 A;  3PIP L;  2A6A A;  2CGJ A;  2D0P A;  4YOX A;  5KPZ A;  3KWG A;  4FWK A;  1QZ5 A;  4YOW A;  4J8F A;  2I7N A;  2ITM A;  4RWT A;  4JKD A;  3G4S N;  5BPL A;  3MN7 A;  1W2B M;  3OA9 A;  3CI5 A;  3C65 A;  4H0V B;  3W0L A;  5GAE P;  4RCH A;  3AY9 A;  3UB5 A;  4EFH A;  2A5X A;  5AQP A;  4MO4 A;  4BVP A;  4GY2 B;  4XH1 A;  5JLH A;  5BRH A;  2HBM A;  3KK7 A;  4L3Q A;  2HBL A;  5AQJ A;  2YHX A;  3HOS A;  3U9Z A;  4B1U B;  3HOT A;  4PL8 A;  3BF3 A;  3M3Z A;  3QB0 A;  3SMS A;  3CJA A;  3FZH A;  2HF4 A;  2P9U A;  1GLB G;  1YF5 L;  4ILJ A;  3WEE A;  3NVK A;  1KXP A;  3T7Z A;  5FPM A;  3RVC A;  1YIT N;  2QW9 A;  4FPA A;  2PAV A;  3O1B A;  3AGR A;  4XH4 A;  4AM7 A;  5ADX H;  3EL2 A;  2GX9 A;  3ZEU A;  1RDU A;  3EN9 A;  3EE9 A;  1DGK N;  4CI6 A;  4XEI A;  3ZET A;  3WXJ A;  3VEN A;  3ATU A;  4I6M B;  4M7X A;  3GL1 A;  2ZJP L;  1HUX A;  3ENO A;  2D1K A;  2Q2R A;  3U9D A;  1QHA A;  3SLC A;  4CD1 A;  5AQI A;  1RFQ A;  3GDQ A;  3L6Q A;  4JKF A;  5EY4 A;  3A5O C;  5AQQ A;  2NRX A;  2Q36 A;  5M1Q A;  3H1V X;  4H5W A;  4BQL A;  4PKH A;  1U2V B;  2QWP A;  4FWR A;  4BR9 A;  3CCJ N;  3I8B A;  3DXM B;  1BWF O;  3R9P A;  4WFN L;  3F9M A;  3HTV A;  3R6M A;  2YJF A;  4MDB A;  1WOQ A;  3C0B A;  2P9I B;  2IVN A;  4FO0 A;  1GLA G;  4BG9 A;  2KHO A;  5HL7 L;  2NRH A;  1NGJ A;  3KVG A;  2NRR A;  2ZGZ A;  5M1P A;  2CGK A;  1BG3 A;  4BRC A;  5AZJ A;  2EWS A;  3MX2 A;  4ISE A;  1HJO A;  5AQG A;  4YOU A;  1ATS A;  3ENB A;  4EIA A;  2E2O A;  2E2N A;  5AQM A;  2P9L A;  4FWM A;  4H0T B;  4BRO A;  3C6A A;  1HX1 A;  2D0O A;  2JWL A;  4LC9 B;  4BGB A;  5BPM A;  2ZJQ L;  1NGF A;  3L4I A;  1NMD A;  3A0I X;  1JJ2 M;  3CER A;  3RSE B;  4KBO A;  3VF4 A;  3WXI A;  2P9N B;  4IO8 A;  5AQF A;  2ZGY A;  4JKG A;  4WQ5 A;  4BR2 A;  1YUW A;  4JK7 A;  4YDU A;  1KQS M;  3CET A;  4QS7 A;  4R79 A;  1C0F A;  1K73 O;  3CXC M;  1BU6 O;  4WQ4 A;  3Q7B A;  5LJV A;  2CGL A;  1HPM A;  4BR7 A;  3LDO A;  5TKY A;  3SAH A;  2GWJ A;  3AAQ A;  2QM1 A;  4OPA A;  1GLJ O;  2YJE A;  4JK9 A;  4BRM A;  3CC4 N;  4JNE A;  4FWO A;  1RGI A;  1HKG A;  5F2R A;  3E66 A;  3TTF A;  1KD1 O;  1X3M A;  2Q1N A;  4AF1 A;  5GIP A;  1GLE G;  4CZJ A;  4BC4 A;  5F0X A;  1T3V A;  1QZ6 A;  2YHY A;  5E84 A;  2OTL N;  4BRL A;  4H5N A;  4JHD B;  3ZEU B;  3MCA B;  1S3X A;  1KAX A;  3ENH A;  4JAX A;  2GEM A;  3QFP A;  4JKE A;  4BRA A;  4U67 L;  3QDK A;  4H0X B;  1K8A O;  5C12 A;  4NLC A;  1VQ7 N;  3H6E A;  3DXK A;  1S72 N;  5JLF A;  5GIO A;  4NO7 A;  4A59 A;  4H03 B;  1H1V A;  2W40 A;  5TKW A;  5AFU A;  3ATV A;  3EO3 A;  3MN6 A;  3UKU A;  3WT0 A;  4C1N I;  4OO1 J;  1VQM N;  4BR5 A;  1JCF A;  3CCU N;  3JS6 A;  2E2Q A;  1QVF M;  2A42 A;  3CHW A;  1BOT O;  2NNW A;  4IOX A;  4BC3 A;  4EHT A;  1M1K O;  4JD2 B;  1M90 O;  2NRW A;  3EKU A;  4FL9 A;  2H3G X;  4O8U A;  3TTC A;  5M1K A;  1MDU B;  3O9T A;  1YAG A;  3GBT A;  2GWK A;  1SS6 A;  4PKG A;  1LOT B;  1T44 A;  4PL7 A;  1XQS C;  5AQX A;  1XUP O;  4MO5 A;  1RDW X;  1K8K A;  3F2K A;  2Q0R A;  2YCH A;  3TTD A;  4K42 A;  2P9P B;  4BRG A;  4UY8 O;  2WBN A;  2WUS A;  3GG4 A;  3W3D A;  3UKR A;  3L4Q A;  3H3O B;  5C2F A;  4FVU A;  4QS8 A;  5AQK A;  3B8A X;  4XH5 A;  2P9S A;  4U7B A;  5JIC A;  2VGN A;  3ULE B;  4G9Z A;  5AQV A;  5JVG L;  2Q31 A;  5ADX A;  3WXK A;  5AQW A;  5LJW A;  2BH1 A;  4FWS A;  3VET A;  4B1Z A;  2ASM A;  3VEZ A;  4PHT X;  3PIO L;  3FGU A;  3D2F B;  5BR9 A;  3AAP A;  2V51 B;  3N4P A;  4YOV A;  4IJN A;  1XC3 A;  3K9J A;  3KZB A;  3WXL A;  5KPT A;  5FPE A;  2D4W A;  4WF9 L;  1VQ4 N;  3P38 A;  4BG8 A;  4CZH A;  2VWB A;  5BN9 A;  4KH4 A;  2J4R A;  2WFB A;  2Q0U A;  1NLV A;  1W97 L;  2ZWH A;  3O6W A;  3LDL A;  3FFK B;  4F9O A;  5KQ8 A;  1TYQ A;  3CC2 N;  3D7E O;  5JVH L;  3ZX2 A;  3CCS N;  5AQS A;  3O9R A;  4MDA A;  3VEX A;  1NWK A;  3GOI A;  2QA4 N;  5AZI A;  4BQZ A;  2P9K A;  4O8K A;  3UE5 A;  3CJ1 A;  1YHQ N;  4B1V A;  2NRZ A;  4EAH D;  5BRD A;  1ILY A;  3ZYY X;  3E9O A;  1Q18 A;  3VF2 A;  3VMF B;  2OAN A;  1DEJ A;  5GAD P;  1MWM A;  3IMX A;  1SZ2 A;  3O8M A;  1NGG A;  2AP1 A;  1NM1 A;  1T6D A;  4AM6 A;  2NRT A;  4BRH A;  2IVO A;  3CQX A;  4DB3 A;  4BR0 A;  2F7T A;  1J6Z A;  2E1Z A;  2QWO A;  4B1X B;  3I55 N;  3D2E A;  4A5A A;  3CF5 L;  5JMV A;  3C6H A;  3CJC A;  1S22 A;  3FLC O;  3SMP A;  3R1X A;  3WQU A;  4BRQ A;  4M63 C;  2WC9 A;  1E4G T;  2ASO A;  2NLX A;  5EXW A;  3FZL A;  4CZE A;  3K9K A;  3SJH A;  3UKR B;  4H0Y B;  3I33 A;  1VQ6 N;  4GV6 A;  1GLC G;  4CZF A;  3A5N C;  3LM9 A;  3ZX3 A;  3F5T A;  3MN9 A;  4CZI A;  3MCP A;  1SAZ A;  5EX5 A;  1LCU A;  4JKC A;  4CD3 A;  1NGE A;  2QWQ A;  1Y64 A;  3C7N A;  3QBW A;  4QS9 A;  4C23 A;  1HKB A;  3O9U A;  1V4S A;  2RHK A;  2P9U B;  3FR0 A;  3WEE B;  3OHR A;  3CCM N;  1VQ9 N;  2GUP A;  1YIJ N;  2FF6 A;  5M1O A;  4E1J A;  4YOY A;  2QWN A;  3FZF A;  1E4F T;  3NMU A;  3EE8 A;  3H1Q A;  2PFU A;  3O5B A;  1VQK N;  3A8Y A;  5DM6 L;  1ESV A;  3CCR N;  2BUP A;  2VGM A;  4A61 A;  3CD6 N;  5FPD A;  4ILG B;  1ZBS A;  3O4W A;  2W41 A;  2V52 B;  1MA9 B;  3OBY A;  3ZET B;  1T6C A;  3CJ7 A;  4ISG A;  4B9Q A;  5CR4 A;  1VAZ A;  3BF1 A;  2OTJ N;  2V7Z A;  3R8E A;  1Q82 O;  4GNI A;  5EOY A;  3CPE A;  5C15 A;  5AQN A;  2PBD A;  4MLE A;  4BVO A;  3OBW A;  4WYB A;  2CH5 A;  5AZI B;  4B1Y B;  4CZL A;  2P9K B;  3AGK A;  1BA1 A;  2AA4 A;  2E88 A;  3G25 A;  3MMV A;  3SBT A;  5ELZ A;  4ISF A;  4CJ7 A;  3I56 N;  4Z94 A;  4BY9 C;  4DHY A;  3DJC A;  4H0P A;  1JCG A;  3WQT A;  5C0Y A;  4FWQ A;  1P8Z A;  2ZJR L;  1NGD A;  3EKS A;  4BRF A;  1BA0 A;  1V4T A;  4M7Y A;  5GAG P;  4KH6 A;  4I6M A;  3CMA N;  5AZJ B;  1C0G A;  4A62 A;  3VGM A;  5AQU A;  4GV3 A;  4GV9 A;  1EQY A;  3A5M C;  3M6G A;  1HKC A;  5AR0 A;  2P9L B;  3LDQ A;  3MN5 A;  5BRF A;  2QWM A;  2HBJ A;  3CCV N;  2E8A A;  1YJN N;  3ID6 A;  4WCE L;  1VQ8 N;  3Q7C A;  2A41 A;  1R59 O;  1U2V A;  3G71 N;  2QWL A;  2QWR A;  3O1W A;  3WUH A;  3CCE N;  3DXM A;  2HST A;  3H45 C;  4O5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...