2YHAA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
384
structure length
368
Chain Sequence
b'VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
total genus 115
structure length 368
sequence length 384
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhaA01
1EX4A 5B3JA 1DG9A 4LD0A 1L5YA 5HRSA 1GOAA 4FE4A 1ABFA 1G15A 2PE5A 2KZMA 4GVMA 4PUOA 2IOYA 3V9SA 3HDGA 2ID7A 1RCHA 1NXVA 4Q6WA 4HTUA 4E7OA 1E6KA 1CYEA 4KPYA 3LTEA 3OMXA 1RT6A 4J2AA 1PNRA 3RMBA 3KK2A 3LZIA 4BACA 1Z15A 3HJFA 2YNHA 4DQQA 3KLGA 3EQ2A 4JS5A 4F8JA 2BGGA 1AB6A 4I2QA 4JRQA 4F2SA 3H5VA 2PYLA 3IP7A 3NFAA 2A1SA 4CIEA 3VQBA 3RVNA 3I8DA 3N6VA 3H1GA 4IKFA 3OLYA 1GCAA 3AVJA 1Q9XA 3HK2A 3QEKA 1CXQA 4KHQA 5TPZA 3OYJA 4MS4A 3DZDA 4F2RA 3HDVA 2LSNA 3TO5A 4E7PA 1JYFA 3V9UA 4MPTA 1VPWA 3L2QA 1RBRA 1XHEA 4BE1A 5FBKA 1D5AA 1HYVA 3OYDA 4XFKA 3OLWA 1QTMA 5EWJB 3AO1A 3EAFA 3RRGA 2H0AA 4H60A 1HPZA 3BRQA 1IH7A 3RMAA 4Q0BA 4MS1A 4CESA 2JCGA 5J2NA 3VQ8A 3SYZA 1Z17A 4E1NA 1U2PA 2HQOA 3OLVA 4DG1A 3OYMA 3O1JC 2BDPA 1TKTA 3CZCA 3AA2A 4YR7A 3ZSVA 2HHTA 3ISNC 3TI0A 4DSJA 1U47A 4KREA 3HPHA 2XY8A 3M8PA 4JB2A 3QELB 4FLTA 2RPIA 4G0YA 1BL3A 3CNBA 3DGEC 3DLHA 3QEPA 1BA2A 3T1AA 3QX9A 4YWHA 4G0MA 3L3VA 2NT3A 4L85A 2FQWA 4OJRA 1NJZA 1MIHA 4O5AA 4FE7A 3H6HA 4XLTA 4YFUA 2OA8A 4QICA 3AA4A 3O3HA 4HUGA 1YMUA 1KCFA 1KRWA 4CFDA 2RJOA 1ZY2A 3KYIB 3ZSYA 4CJPA 4KQCA 1SXHA 4KHYA 4OLBA 1HMVA 3H08A 2G8FA 3LPUA 3NNNA 2OQRA 3M8RA 3AV9A 2FSPA 4KV7A 3LZJA 4CEBA 1RZRD 1RDAA 4YGXB 5J2MA 2GX6A 1VRVA 1A0OA 4NCBA 2LBPA 1JYEA 4FW2A 3WNEA 3LUHA 3TD9A 3T19A 4B8AB 3ROTA 3AVBA 3DLRA 4IILA 3GBVA 1ZH4A 1D8YA 3QIOA 4MYRA 4Z4IA 4CGDA 2PUFA 3TAMA 3EZ5A 3SJJA 1IKXA 3ZT3A 3LP3A 1RTHA 1WLJA 2XHBA 4LDAA 3LWMA 2JVJA 4FJ9A 3JPYA 4RKQA 3NNDA 4RKRA 5C5CA 4FYDA 4BDPA 1TV6A 3JVDA 3LWLA 4NICA 3TAPA 4PWDA 4CF1A 1Y1LA 5HRRA 2DFHA 3DI6A 3K5OA 1DZ3A 1RTJA 3OY9A 3RR7A 4JASB 3VNBA 3JYTA 4LSLA 1D1QA 5DLEA 4UHJA 2EX3A 3H5WA 4Q6BA 4KB1A 4E7LA 1JX6A 2HQRA 1JKHA 4B3OA 3HS3A 1QHTA 4RXMA 3MAQA 5ABPA 4H4MA 4CFBA 1NXSA 4RY9A 4UHKA 3IP6A 4DTOA 4IF4A 4RK5A 3QLUC 3IP9A 1APBA 1X9WA 3UKJA 2HHVA 1WSIA 4N5SA 4DSEA 3C94A 3LAMA 2B5JA 4M3TA 3ULDA 1E6MA 4O0IA 1JLBA 1NXWA 1ZBHA 3SQ0A 5HROA 1KLMA 4DTJA 3KS9A 3L3UA 2HQBA 1A5WA 1M2EA 2GWRA 1ZBLA 4PYRA 3M6MD 1SKRA 3VQ7A 4LX8A 1S5JA 2HHXA 1JL1A 2GI4A 3O4NA 2IPLA 4FLUA 3V6DA 4HVJA 4HHTA 1BDIA 3K2PA 1Z2DA 4ID1A 1EWKA 2FXIA 4ICLA 3HV2A 3SZ2A 3S3NA 1RT1A 1HJRA 4CF2A 3CG7A 3O1IC 2XY6A 3QEWA 2MSKA 3FGZA 4G0OA 1U4BA 1KRPA 4KTZA 1R0AA 4CJLA 4HYEA 3QEIA 4OPKA 2DY4A 4CJ4A 3ZT4A 3QETA 2E6MA 4Z0NA 4FJXA 3QEMB 4RW8A 2HVIA 3LMKA 2G8KA 4TLMB 4N03A 4BE0A 4LE2A 5TQ2A 4QYMA 4TN5A 4FCYA 4G0ZA 2NT4A 3L2VA 3CFPA 2O4IA 2CD7A 1TKXA 1DCKA 1SV5A 3OQMA 1HQEA 4KK3A 2P5GA 4OGCA 1M5UA 1TK5A 4DTXA 4DS4A 4XARA 2YNGA 5JS1A 4YV7A 2ATQA 5CHYA 1C4WA 1ITGA 4CEZA 1WN7A 1TK8A 4F8RA 2A9PA 2ZD1A 4Z4GA 5GQSA 1Z13A 3NGYA 4FJ5A 1NK9A 4TSXA 3KKRA 4FJKA 4WZZA 4IMJB 5J2QA 1S1WA 1XHXA 3NDKA 1URPA 1TM2A 3CQ8A 3WNGA 5J1EA 3N75A 4DSFA 1BHLA 4MFBA 2PYJA 2OPRA 3O74A 3QINA 3BDPA 2P9HA 3OLZA 3BGRA 1TK0A 2E4LA 4Z9AA 5JNSA 3IAYA 3PX6A 4B9SA 4MR7B 1R8JA 2LPMA 4S04A 1X9SA 3I0SA 2Z1JA 4EYOA 2QK9A 1EP4A 1IO2A 3CS3A 3ALYA 1TJYA 2PL9A 4HUEA 5FWXA 1LK0A 2G8WA 2FQXA 4DN6A 2OPQA 1DCMA 5CNKA 1KVBA 4C8NA 1ISSA 1J5OA 3Q15C 4JB0A 1CLQA 3ZSOA 3QNNA 3K58A 3HEBA 1FK9A 2WY2D 1LAWA 1S1TA 4CF9A 1IG9A 4IDKA 1T05A 4Q7EA 2I6FA 4HCCA 3KSMA 4M3XA 3AVCA 1GUDA 1P6UA 2MYNA 2BE2A 5KTQA 4RK4A 4RW9A 1BDJA 2YHAA 4O4GA 1X9MA 4KV8A 4DADA 4XAQA 4DTSA 3A10A 1TKZA 4N47A 1SUQA 3B6PA 3RVOA 3S3MA 5SWMA 4F11A 4EP4A 3RWUA 3F73A 1GOBA 2A9QA 1TGOA 3K9CA 4EVQA 2DTUA 4BWJA 1QKKA 4B9UA 3C97A 4FM1A 1XC9A 5JNUA 5DMRA 1NK6A 1BIZA 3FMVA 5HRPA 3Q7TA 3K5NA 4N0QA 3JTEA 4FM2A 1CHNA 2F96A 4E3SA 3OJUA 2VK2A 4YP9A 1XHZA 3IPAA 3RQIA 4N41A 1P6QA 2JBAB 3O2SB 4NQRA 2VWJA 2OENG 1L5ZA 3PX0A 3O2JA 4AILC 3KD1E 1BI4A 3NF8A 3I09A 4F3OA 2PAFA 1BVHA 3OYAA 4DU3A 3GL9A 4KAZA 5DGCA 4RWEA 3DLKA 2D0BA 1T34A 1ZITA 4DSIA 3OYBA 1U0SY 1ZESA 1S1UA 2R7YA 1B9FA 4RXUA 4DQIA 2FW0A 3QEVA 1BCOA 4Z4CA 3MF4A 1M5TA 4QYWA 3V81A 1ZBIA 2R4QA 1GOCA 3MIZA 4MR8A 5I4CA 1SKWA 5TPWA 4IFVA 2V0NA 3T6KA 2PUDA 3N8IA 4E89A 4I2PA 3C3KA 3AVHA 3SG0A 2YKNA 4DTUA 1XWWA 8ABPA 2A9OA 3WNHA 3DRRA 3OVNA 4CE9A 1VRUA 5T3YA 5HSGA 4O55A 1J56A 3DOLA 2IPNA 4J2BA 4OBBA 3QLUA 4EYKA 3HP9A 1NATA 3D8UA 2VG7A 3HP6A 3P83D 3KTOA 4MQEA 1TAUA 3KHTA 4CEFA 4CHYA 3QO9A 3ZSXA 3SV3A 3PV8A 3KYJB 5TQ0B 1TAQA 5KQLA 3LPTA 3WNFA 4CGHA 5HKOA 1JLCA 3MEDA 2IC3A 1WSJA 4CHQA 2AJQA 4IFYA 4PY5A 3QIPA 2A9RA 3TAEA 3FFIA 3EQZA 2ZAYA 1WSHA 1TVRA 2IDOA 1IKWA 4BDZA 1E2BA 4DTMA 1UAXA 1LWCA 3ZSQA 4UQGA 3B2NA 3M8QA 2WJAA 5CYMA 1YMVA 3JPWA 5HLFA 1DBPA 1YS6A 2A1RA 4F06A 5CY4A 4RY0A 3U3YA 4RXTA 4ELTA 4Z4EA 4YLEA 3ZT0A 1VK0A 4MS4B 4O5BA 2HNYA 2HHWA 4OVLA 5FWYA 5DCLA 4OPJA 1REVA 5I3UA 5CYQA 1F51E 3KK1A 3N53A 3AA5X 4OG2A 1CZ9A 3AVMA 3EODA 4CEDA 3N0WA 4C8OA 4PE5B 2VUIB 3M9WA 2RJNA 2ITGA 2PZSA 3DLBA 2ZWMA 1F21A 2GBPA 4CK2A 2OZMA 2HNZA 1JBEA 4CJWA 4W5QA 3MMNA 3MXJA 4LH5A 4YO7A 2FBTA 3OYHA 1BCMA 3N0RA 2FKAA 4C8MA 3I45A 2PUGA 3K4HA 5EWLB 2DFEA 3C6TA 5BRAA 1ZGZA 5EWJA 1TL3A 4F4KA 4YCSA 4W5RA 1EFAA 3VQCA 4CJUA 1OXKB 1L3VA 1HYSA 2ETJA 2JVKA 3C3WA 5TE9A 4FJHA 3OYGA 4RY8A 3U3GA 1QPZA 3TANA 4CJ5A 4G97A 2KYRA 4E1MA 1NJXA 3SAJA 5CNJA 3SPYA 3FFXA 5IUNC 4Z0UA 1YK0A 3H5LA 4AHRA 4ZYLA 2J48A 1EETA 1VSDA 3OS1A 3QELA 3A0UA 1GLGA 3LOPA 4NV3A 4TLLB 3LAKA 1USIA 5CNMA 5F64A 1EWVA 3PY8A 3MYYA 4KHNA 1S1XA 1N6QA 2FBYA 1FKOA 4EZ9A 3T95A 2E4ZA 2QSJA 1HEYA 3ZSWA 1JLKA 3RH0A 1S9GA 1F4VA 4Z9BA 5C5EA 1DTQA 4D6XA 1JH9A 1FKPA 2PLNA 4RK7A 1U04A 2M1ZA 4H8KA 2E4XA 3O3FA 2IPMA 4DFMA 3CKMA 5JNVA 3Q7SA 3F6PA 4CHPA 1MAVA 4RK1A 4CHOA 3O3GA 1QQCA 4WXMA 3OYLA 4E19A 5KRSA 4DLEA 3EJWA 1VRTA 3OQOA 4M41A 3ITHA 2FN8A 4H4OA 4KB0A 4MAAA 3KJVA 4J2EA 4ETIA 3NGZA 4OTZA 2HSGA 3T38A 1UA0A 2QXFA 4DU4A 3LFTA 1U48A 4IMIB 5KQPA 2E4YA 3PUFA 4CHNA 1JHZA 1RXIA 4EVRA 5E41A 1NOZA 4GNRA 3K5LA 4DQDA 4CIGA 4ZMRA 3P1GA 5HP1A 2IDMA 4WUTA 2KTQA 4RW7A 4RSMA 2EHGA 1C1AA 4KHUA 4CCHA 1ZHHA 3OM1A 1RT2A 3ILHA 4FZYA 4CIFA 3D0PA 6CHYA 1CXUA 3SQ1A 4W5TA 1B92A 1L3TA 1P8AA 1KVCA 3KKEA 3SI6A 4CJEA 1BISA 2VYCA 2PJUA 1PHRA 1Z18A 2QKKA 1ASVA 1LBHA 2QR3A 4XIUA 3CG4A 4ZHRA 3L2RA 4DFKA 3QLVC 1KVAA 2JGUA 1ZN2A 2RDMA 1D4ZA 4KFBA 1VSIA 1D2AA 3C3MA 1C0MA 2PUAA 2IGIA 2NUBA 3LUDA 3CLKA 5C25A 2HB5A 4CEAA 1DBQA 2HHUA 3UK0A 4DQPA 1RT4A 3HVRA 1UWBA 4DTNA 2L2QA 1ABEA 3RVJA 4AHUA 4MS3A 4GW6A 3RR8A 3AO5A 1KRXA 2F8SA 4LH4A 4CF0A 3NE6A 2JK1A 1T7PA 4PQUA 1RBSA 3O21A 2IS3A 3G10A 1TLFA 4JOQA 3HVTA 4E7IA 1VLZA 2WJWA 1IKYA 1EKEA 3KG2A 4YS6A 3GRCA 1DLOA 4WE1A 1RTIA 3NHMA 5TQ2B 3N0XA 3OO1A 3KCNA 4CHZA 1JDPA 4PICA 4CEQA 3DYAA 2YKMA 3AVNA 3FDFA 3MXMA 3TAGA 1L5UA 2D0CA 3HM9A 2PUCA 4FJLA 5KI6A 3PO5A 4O1IA 5IEJA 4JS4A 4H3KB 3CM5A 4DLGA 3JVIA 4IG3A 4MLDA 2QVGA 3IS9A 3QERA 4AHSA 1BIUA 1KMIY 2PKXA 2QZJA 3L2UA 4RZSA 5BR1A 1JWLA 3D45A 3U6FA 1DC7A 5CNIA 5DTEA 1JFSA 4CF8A 4ETNA 4B9MA 4JRPA 1T8EA 3GYBA 2G8HA 4FJJA 2MYTA 4EZ6A 1NXPA 2E4UA 3NF6A 3SV4A 4PEVA 3NHZA 4MR9B 5T7BA 3OS0A 1S6QA 4FXDA 4FJ7A 3OYEA 1O1WA 4DF4A 4FLZA 2L19A 4M45A 4MGEA 3BILA 3NGIA 1QE1A 4RV5A 4CJQA 1SKSA 2FEKA 1JXEA 4OLAA 2E4WA 4HNQA 1K68A 1PNTA 2FVYA 1N5YA 1FFSA 1NXOA 3OYNA 1T03A 2GUIA 4OKKA 3OQNA 2PMCA 4MQ3A 3M8SA 1H9CA 4IRXA 3RMCA 2X6NA 1JXBA 3O4QA 4FVMA 1S6PA 1RBTA 1Z26A 3IRXA 4EYGA 1WAJA 4MRMB 1KLNA 3NHGA 3AVKA 3OYKA 4FJIA 1C0EA 4R5PA 3T3FA 1HNVA 5IX8A 3S3OA 1DBWA 1QP7A 3EYZA 2XRIA 2OZSA 4IBNA 4ELUA 5E3JA 3LUJA 1LJUA 2D5RA 3NF7A 4RS3A 1NK5A 4I9QA 2MSWA 4B9TA 1JF8A 4AHVA 4WT7A 1C1CA 1P2FA 1USKA 4N76A 1YIOA 2L17A 4KVFA 4D6YA 2Z1GA 4CJRA 4EP5A 1FSPA 1ZBFA 3QX8A 1UDRA 1VSLA 2AYXA 2O4GA 3CFRA 1K6YA 4CGFA 3BREA 5PNTA 3LP0A 1QO0A 4FK0A 2R48A 1RBVA 1UOCA 2QV0A 3BBLA 4L8RB 1OXBB 4CJFA 4NYFA 2PUBA 5JNWA 5HQJA 3Q7RA 3GT7A 1DJMA 4M3UA 4W5NA 3FFWA 1BAPA 2G8VA 1YTUA 2FMIA 3RVQA 2PY5A 4FK4A 4RW4A 3LUAA 1NKEA 4FLVA 3DRSA 2GBZA 1DRJA 3O2QB 1U49A 2FLWA 4CECA 5EWMB 2Z1HA 3SUQA 4K8ZA 1BI4B 4KI6A 4CFCA 3DMJA 1CZBA 3OM0A 4DSKA 3OS2A 3A2FA 3HSYA 4OATA 1WNSA 1U2QA 4ZJPA 4ZPJA 1S9EA 3V1RA 4JAVC 4RK6A 1XHFA 1RDDA 5IEBA 3SQ4A 3SPZA 2MYUA 3L6UA 2YNFA 3KJXA 1ZAYA 3VNAA 4MR8B 3KLOA 1PUXA 2IPAB 5SZTA 4KHWA 4KO0A 3NBMA 4KTWA 3NBPA 3LP1A 3CG0A 5TPZD 3S99A 3C6QA 4G1QA 4ZTJA 4FK2A 2PUEA 2RF2A 3AVIA 3HSTB 1D5WA 1BQMA 4CJVA 1HNIA 2R47A 1C0TA 4MQFB 3CZ5A 1A5XA 2JVIA 3KLEA 4B9VA 2HNDA 3H1EA 4C8LA 4EYQA 2VG5A 3TMYA 3IP5A 2HJ9A 2KW4A 1YTAA 5KC8A 1RBUA 4BDYA 3RVLA 3MXIA 2VWKA 2FQYA 4DFJA 1I39A 3NH1A 4E7KA 3R0JA 1FFWA 1LBIA 1VKRA 3RVPA 4DTRA 3P9YA 3DRPA 4YNQA 3SUPA 3QESA 4M42A 1RT7A 2QVCA 3LDSA 2YHBA 4HNRA 4B9LA 2XO7A 1U8TA 4B9NA 3BRSA 1X1PA 5KGXA 4O44A 1VSJA 3VQDA 3QLVA 5IC5A 3VQEA 1DC8A 4FJNA 4D74A 1RILA 3OYFA 1GUBA 2N9UA 4G0QA 3MEGA 1MU2A 2P1JA 4BE2A 3VN5A 4KRFA 4I7FA 3KIOA 3OLXA 3S9HA 1L3SA 3RTVA 2OPPA 2LUOA 3KLNA 5TQ0A 4MLCA 3SUOA 4B8CA 3C6UA 3AVGA 4RU1A 1VSKA 3SNKA 1RT3A 4M3WA 3F7NA 1UA1A 4KTQA 1ISRA 4LDZA 3O1HB 2P5OA 2AYZA 5FROA 3V9XA 4OGEA 2KQ2A 1NXTA 4AHTA 2KFZA 3OJSA 4H3HB 5FWYB 3RVRA 1LAVA 4E0DA 4Y9TA 4PZ0A 2B4AA 3SM9A 4FM0A 1JFVA 1TMYA 4FJMA 4CK3A 2G8UA 1QQAA 1QP4A 4K8XA 2ID9A 5D3GA 4I9LA 1NK4A 2OPSA 1LV5A 2O20A 4G0XA 2I5JA 4OKEA 1TKDA 4EGSA 5EU7A 2Q5CA 1ASUA 4MS1B 3IG1A 1DRKA 2CHFA 5IULC 5ED4A 2FC0A 2QU7A 2W42A 3KK3A 4NCGA 3V1QA 4XASA 1SL2A 3GA5A 4N56A 3A0RB 3F9KA 1ASWA 3NH0A 1HQUA 2DFFA 1SD5A 3D02A 1QSLA 2FN9A 2X6SA 3LKBA 1W25A 5GOTA 4CJTA 1RPJA 5D2CA 4M88A 5JNTA 1LW2A 2KFNA 4ID5A 2FBXA 2FEWB 3UUGA 1MVOA 6ABPA 3CM6A 3VQ9A 5EWLA 4DQRA 5IUKC 1NK0A 4FZXC 4M3ZA 3MM4A 3DM2A 4E7JA 3T8YA 2IKSA 3L2WA 2FEPA 3TABA 4IG0A 2MSLA 1IIBA 4FJ8A 4P98A 4EVSA 3HPGA 2MYPA 5KGWA 4CGJA 4ML3A 1CEYA 3IDOA 4O0JA 3VQAA 1I3AA 3AVFA 1PEYA 3H1FA 2FBVA 1FFGA 3QNOA 3V9WA 3KLIA 3DBIA 3OYIA 2X78A 1Z2EA 3HL8A 3C95A 1JLGA 4CJ3A 1KTQA 3SQNA 3HPOA 5KC9A 3LP2A 3HT3A 1NK7A 4HUFA 3NH2A 3G1WA 3RVMA 1D9FA 1YK1A 1VSMA 3FFTA 2OYQA 1QSYA 4B09A 1KSPA 1J53A 3DGFC 1A2OA 4EY3A 1Z25A 3KD5E 3IPCA 3AO2A 1E6LA 3QK7A 3I0RA 5HM6A 2XY7A 1ZGGA 1JLEA 3VA3A 3GWGA 1LWFA 2RN2A 4GPAA 1NXXA 1NKCA 1ZYQA 5CZ1A 3QEXA 4Z4FA 3THVA 4KNYA 4FLXA 3TAQA 2QXYA 1QQBA 3NF9A 1HRHA 3LKVA 4XXHA 3O75A 2R25B 4LE0A 4S05A 3ZSRA 2X74A 2WONA 4AH9A 1J9AA 4CERA 3ZT1A 1DCFA 1SXIA 3RVKA 1JLFA 4DWIA 1USGA 5FRMA 1BQNA 1NY5A 4HCBA 2LIVA 1QSSA 2YNIA 3RRHA 1MB0A 4C8KA 4FJGA 3LUKA 2G8IA 2VUHB 3SUNA 3Q9SA 2M98A 5KWSA 5JNRA 4PA1A 4CK1A 2QW1A 1ZBUA 1M2FA 5DK5A 4RG8A 2HVHA 4LSNA 2Q3SA 5B3JC 2GV9A 1JDNA 4LE1A 1DP4A 3MA0A 1EXQA 1QNLA 4HNSA 1LWEA 4LY7A 5KQGA 1Z12A 1DTTA 5KQMA 4Y1DA 1QP0A 4QOZB 1RZRA 1GCGA 2YV0X 2FLKA 4N0PA 4EUKA 4DS5A 3EDCA 3SY8A 3AO3A 3SQ2A 3EGCA 4MS3B 2H3HA 4FZZA 1J54A 3OMWA 3W9SA 2XY5A 1D1PA 2NZVG 1MB3A 1WSFA 4CJKA 3H5TA 5FBHA 1JLAA 2HHQA 5JS2A 3K57A 5BRJA 2B1JA 3NNSA 3VQPA 1PEAA 3KLFA 2IYNA 2RGYA 3L8BA 5KRTA 3CYMA 4FB4A 3OYCA 3DLGA 1RXEA 1ZH2A 3LANA 2CWDA 3NCIA 3HUUA 5HRNA 3KLHA 4KZKA 1EHCA 4KQ9A 2WB4A 3HXMA 3MECA 1JLQA 5BQ3A 3DLEA 3AA3A 1NJYA 3H5OA 5DKFA 3A3KA 4DF8A 1C6VA 4J2DA 3H75A 5TQJA 2XDYA 4F12A 4FLWA 3QEMA 4Z4HA 3MEEA 3PX4A 4DQSA 3LUCA 3TX6A 3HYFA 2CHEA 5C24A 1SXGA 4B08A 1VSEA 4Z99A 1D9DA 3CU5A 3Q41A 4JA2A 1SL1A 3I5AA 2HPHA 1Q9YA 1YS7A 4CFAA 1XWLA 1C0UA 3RMDA 4G0PA 3VA0A 1VSFA 3ZCMA 1K66A 3TARA 1QO0D 3CFOA 3AO4A 3V1OA 4G86A 1HYZA 4YRZA 3TR8A 4Y1CA 1EAYA 4Q5VA 1TVMA 4DTPA 4ETMA 2X7XA 3UIQA 1W9HA 3NAEA 1BGXT 2IOCA 3VQQA 5FWXB 4E7HA 3CHYA 4WWHA 2B4JA 4MR9A 2FMKA 1I3CA 5CZ2A 2HHSA 4MR7A 2JLEA 2VG6A 1AB5A 5IUJC 1RNHA 2D0AA 3EY1A 3HUTA 2ZQBA 3I42A 4NYNA 3TB6A 3L49A 1W0HA 4RW6A 4DMNA 2ZE2A 3DOKA 3E61A 4RK0A 1U45A 1VSHA 4CBVA 3JY6A 1JFTA 4LZLA 2Z1IA 1RDBA 1RTDA 2GKGA 1Z16A 3EULA 3OO0A 4FLYA 5J2PA 5FRNA 1FQWA 3G85A 4JP1A 3TAFA 3KTQA 1B9DA 4MRMA 3B6OA 4IGAA 4L4UA 4CEEA 4GMJB 3M9XA 1KFDA 2WOMA 1WAFA 1KFSA 1NJWA 3KKSA 4M3YA 1L3UA 9ABPA 3LALA 1A5VA 1C1BA 4P1ZA 2FMFA 4DSLA 3CRNA 5C42A 1YT3A 1IKVA 4JLHA 4ZMSA 2E4VA 1ZVVA 5IBQA 3E01A 3VQ4A 2JRLA 4QPJC 5I42A 3JSMA 7ABPA 4QAGA 4LRQA 3K5MA 3MQ4A 4BWMA 1RDCA 4NCAA 4OKJA 3AVLA 4W5OA 4KMRA 3ASMA 2FMHA 3K59A 3GV0A 4CEOA 3AVAA 4AHCA 2QKBA 1TL1A 2KZZA 3JS5A 2IAJA 3ZSZA 4KHSA 2WMYA 3HZHA 4ZTFA 3SCXA 1NKBA 1FXXA 2L18A 1Y97A 3QLHA 3HO1A 1JL3A 2LP4Y 1SL0A 1XI1A 2B6AA 1EWTA 4FW1A 4RDCA 3HCWA 1QS4A 1SRRA 3VQ5A 2P4UA 1LJLA 1BDHA 4M3RA 3URMA 1RT5A 3G0ZA 3LUFA 4O1HA 2WRZA 2JBAA 3H5IA 2WWVD 5EWMA 3P5JA 1WSEA 4CJSA 2F8TA 3ZT2A 5TPWB 4KKOA 5HBMA 4TMYA 3ROFA 3TWHA 1NK8A 1QMPA 2HMIA 1Q8IA 4CGGA 3PO4A 3H6GA 4DU1A 3V4IA 4KK4A 3CFYA 1S1VA 2FTKE 2DRIA 2TMYA 4CGIA 5FDLA 1RNLA 1NTRA 3E3MA 4ELVA 4KI4A 3ILYA 3LUGA 1KGSA 2Y1JA 2E6LA 4F3TA 1WETA 3GBPA 3SNNA 1LW0A 2JB9A 3QLTA 2PL1A 1B00A 2NZUG 2BANA 5K14A 4QCLA 1YVUA 2Y1IA 3F6CA 4WXEA 4KFCA 3VQ6A 4MQEB 4MQFA 2HW3A 2RKIA 1S8NA 1JL2A 3CTPA 3RVSA 1ZDMA 1WSGA 1NOYA 3V9ZA 2P51A 4DFPA 1A04A
chains in the Genus database with same CATH superfamily
2X8LA 1KIAA 4YEDA 4I1OA 2N1BA 1G8PA 3FCUB 3LX6A 2ZR8A 3LRPA 4J0EA 2JFQA 5D00A 3GEPA 1GKYA 1QHGA 2VS1A 3E53A 3SMVA 3CM0A 4BMDA 3OMXA 1IMOA 3OZEA 1NGHA 4QGBA 4RPGA 2YHSA 4HMOA 3QBJA 3H3OB 4BFZA 2D1YA 1A8UA 1OY1A 3ZNNA 4JRQA 2AFHE 2LVBA 4DDHA 4G09A 5KWVA 4GKJK 1XQ6A 2DFKB 1T8RA 4J75A 2XHZA 2LSNA 1G5IA 1ZJWA 2PGOA 3L2QA 1RBRA 2W0SA 5FBKA 5DWDA 4L8VA 5B7GA 2CK3A 5H0IA 2JLYA 1DRWA 3PQ2A 2J5BA 1HPZA 3UV3A 4R9UC 1PGQA 3DOJA 5JVDA 2IHYA 4PF1A 4EMSA 1UH5A 3TTSA 2IIPA 2XEDA 4BRZA 1BEUB 4KUGA 3E5NA 2GYUA 2IRWA 1I9CA 4DG1A 1W59A 5T4FA 2PR2A 1J00A 3ND9A 1M1UA 4REQA 2X7JA 1O2DA 2JDIA 1KVSA 3JWJA 5BT9A 3KOZA 5IHPA 2O1WA 4DY4A 2WD8A 3EPPA 1KBQA 2F3PA 4L85A 5FBVB 1VJTA 1UJ6A 3MMZA 1CJBA 3TEFA 1KARA 3AA4A 3VKHA 2FPLA 3A9WA 1S3XA 4CBXA 4OK5A 4WK2B 2AW3A 3T0IA 1DKRA 4OLBA 4UHCA 3OPMA 1ST3A 2ZWPA 1W5FA 3R0VA 4FFBB 3R7SA 2Y92A 1X38A 4Q66C 4KNVA 3WGYA 3D2EA 3UUEA 5C5IA 2EU8A 1F3OA 2JFBA 3CIFA 3IC5A 2ZZKA 3KXKA 4BLRA 5L4LA 2ISCA 1XZKA 3SJJA 1VA4A 4BVLA 3D81A 3QEJA 1JFFB 1NU0A 1GZ5A 4FYDA 1VL2A 1M0WA 3CUWA 4BDPA 3ND8A 4EF5A 3JVDA 1XLUA 5DJ5A 3F3SA 1W1WA 1X0XA 3ZWCA 4JKIA 1TW2A 1RTJA 5DNWA 4AIRA 4V02A 3M5PA 4ZCIA 5J2TB 2HR1A 3TW8A 1OYVA 2VP3A 2BCJQ 2JLAA 4H0OA 4FOLA 5DM0A 1VYUA 4BQIA 1CR0A 3GCWA 1W1IA 1QRSA 1JDUA 1P1RA 1TEZA 1YL7A 3RHFA 4YJ3F 1IPEA 1YU9A 1JAZA 4LZOA 3PZRA 3WEEB 1DO2A 1EXMA 4Q37A 4F7WA 2NTYC 1BN6A 2H7XA 2AE1A 4IBOA 5HDBB 1XD9A 6AT1A 1EUDB 3KLBA 2OBBA 3BWXA 3S8EA 1VCNA 4FILA 4BRKA 4MJ7A 3BDVA 3WICA 4IKOA 4PFQA 4UVDA 4ZYYA 5IJWA 3O9MA 3QEIA 2V98A 3ZT4A 3SK3A 3MT8A 1G3UA 1JR3E 3TH5A 3Q7CA 2AR0A 4QYMA 1R0KA 2IHVA 2PQ0A 2DFLA 5KEIA 3HXTA 3PIDA 2RCYA 4D43A 2W9XA 3HKEA 1E7WA 2IGBA 2A9PA 4EFMA 1OZFA 1XN1A 4EKGA 4M83A 5J2QA 4CLOB 4EFLA 4EDFA 3UMBA 4DEYA 4HXYA 1RHUA 1VDZA 1BHLA 5JXGA 2I2BA 2OPRA 1Z4NA 4ALJA 2P3OA 1N5OX 3I5XA 1PGJA 4O3FA 4WFNL 1O87A 1GG5A 1U4NA 1M6VA 2HGZA 1TJYA 4PXAA 4Q1CA 4FOSA 4R40A 3I01M 2JCVA 5FQOA 2REQA 4QOGA 3EVBA 3PPYA 5EHZA 3GDFA 5DN6D 1Z2NX 2XF2A 2WY2D 4Z9FA 2GDZA 2AX3A 2EGUA 4FSXA 5GINA 2FZLA 1GLLO 1B0AA 1YKGA 4BC5A 2J30A 1PK8A 4DADA 3HNOA 2FPUA 3QOXA 4MQ4A 2FZWA 1SUQA 3QE2A 4IOMA 3RVOA 3ANLA 3WLHA 1TGOA 2OCYC 4G1MB 4KL8S 4FWRA 4ZZ2A 4E21A 1NGIA 4DSNA 2W2QA 2MT9A 4D3XA 4YQZA 4QFBA 4BZQA 2YDXA 5L4SA 2HLDA 3M4ZA 3R41A 1V5EA 4DF3A 2DF8A 5AQWA 3S3TA 3U6KA 2JBWA 2PUHA 1JIXA 2VJYA 4L16A 2IYLD 5IJ0B 4F3OA 2LCFA 2O2CA 1TRHA 5AQZA 3GT4A 1HKCA 1ZITA 3QBTA 2FB9A 5LQAA 1S1UA 3DC2A 4ZJYA 2YWJA 1KY4A 4P2GA 4ER7A 4J91A 4I1YA 3HDTA 4EHKA 2AEFA 2ZJ2A 1TCVA 3QYFA 2ZRQA 4O2AA 1UM9B 1H3NA 3TLKA 1ODTC 3U3KA 1SVLA 1LY1A 4EJSA 2PGAA 1V2GA 3FZEA 1M8JA 4GI1A 1C9MA 3C39A 2OCXA 1AGPA 4D98A 3NHJA 4CVNA 1H8HA 3NKVA 4G23A 2Z43A 4DV2K 1WEHA 3PTAA 2IC3A 3AEUA 1E4EA 4FWLA 5E6SB 1KEEA 2A14A 3UMVA 3SZMA 3WQQA 3B1KA 1MEOA 1NVDA 4N39A 3OWXA 4URXR 3FKJA 5E9WA 3CNEA 4EF4A 3OTOB 4OPMA 3UICA 4M22A 4N9WA 4TVBA 1FSFA 2F1IA 4XD7D 4BNJA 1BOOA 1XQ9A 4Z4EA 2WV9A 1DPFA 3PUVA 5AFUA 5FAKA 2AGVA 2JWKA 5GIOA 4KDCA 1XDBA 3IKLA 4B4KA 3OU2A 2V7TA 3U60B 1CUSA 3OT1B 1T3LA 2X9NA 4F1JA 4BR4A 1R6DA 2B5OA 3GQVA 4BVFA 2BI8A 3DAFA 2YJEA 3O8QA 1QHNA 1GDHA 4YO7A 1IIRA 1ZMOA 3N0RA 1H42A 1GQFA 1E2UA 5BRAA 1RC8A 1GEGA 1I13A 1SBTA 1QG6A 3ONNA 4GNIA 2D0PA 3QPVA 4MJLA 4JI3B 4MB0A 2XYHA 4ZYTA 3M82A 4BZXA 5CNJA 3M6VA 3T7AA 3SHWA 4HTFA 1QLHA 4XWOA 1YR9A 3V8MA 2DPNA 1N3IA 1MQSA 2Q6OA 2YV2A 1H05A 2FBYA 2QA4N 1X2BA 3NHFA 3A6JA 3CJ1A 1RWKA 1U5BB 4K7JA 5C5EA 1FKPA 4DA9A 3NGLA 3ROMA 2IPMA 3MWEA 4W1PA 1J6UA 1JG3A 5LVAA 2GEJA 3GQBB 4BQNA 1PV4A 3W0LA 3A4YA 5K0LA 4C03A 2BJHA 4KB0A 1JILA 4X61A 2HSGA 2JFPA 3DP9A 2WVJA 3WLSA 4E5YA 1S3SA 4Z5XA 4EWLA 4TWZA 3ENHA 1XR3A 4BFTA 1H6BA 2B92A 3UOWA 2NVOA 5HP1A 5JZSA 3T3DA 1BS1A 2IDMA 4IDAA 2WYOA 2EWSA 4DIDA 3QY9A 4PSKA 1ZJ4A 4LYDA 3SQ1A 1RQPA 1L4GA 4A16A 5JYBA 2PWAA 3GLGB 2R7KA 1ZRHA 1EQUA 3FLBA 4KVAA 1UMDA 3NM6B 4JVMA 1EXNA 1KIFA 3HQ4O 4RTNA 2IGIA 3QNUA 4Q4JB 2YN2A 4FMDB 4FI3C 4DQPA 3B3QA 4NC9A 1UWBA 2NGRA 1ZKDA 1DX4A 1JS1X 2ZGYA 2D2EA 3M7IA 3MCPA 4EY4A 3C7AA 4LH4A 1JQ3A 4AJ2A 1TCBA 1TLFA 4TT3A 3BCRA 4UPDA 3ZD9A 2XUGA 2IUEA 1OWLA 1Z6AA 1A9ZA 1L5UA 3TAGA 2IP1A 2J9YB 2SKCA 2D0CA 2H2WA 1NQOA 3UFBA 3KKPA 3JVIA 1Q7YO 4FW8A 1F8GA 1ESCA 2CHQA 1T0IA 2QW0X 2PKXA 5L7WA 5CNIA 1JA0A 1YFJA 1WXFA 5DV9A 4P0PB 4CMKA 1H0KA 2WWIA 3FD8A 4XPIB 2G8HA 1A1SA 4HX5A 5DCYA 3QU7A 3L6CA 4OQEA 4JUDX 1FJGK 5F98A 4DF4A 4B3HA 2L19A 2HF2A 3LLCA 2WIBA 5BOSA 2WU1A 3VR4D 2YWCA 4FYXA 5C7OO 3ETEA 1Q0ZA 1T8SA 4R54A 1BA0A 3PCTA 2EJCA 2ZYRA 2FMUA 1F2DA 1M33A 1C1YA 4WZBB 3GNQA 3NHGA 2WIAA 3ONEA 4ZZ3A 1USUA 2W58A 3NBFA 3TK1A 3EYZA 1E2FA 1M8FA 3QXCA 2C3PA 1N7IA 1M1YA 1RKXA 4WNCA 2XXBA 4GKJB 2WLSA 3H2SA 4FR0A 2OGSA 4LJRA 1FQOA 3JQ8A 2IYEA 4CRWB 5BWCA 3VU0A 4CGFA 4OJQA 1PQWA 2FSHA 4Y1GA 3IELA 2PD3A 4J0KA 2QUAA 2R2AA 3SLKA 2ZU0C 4LFAK 3E9NA 1BCSB 3VA7A 4YLGA 5FPEA 3K0AB 3FM9A 4UVIA 2XGJA 1XDSA 2DY1A 1BMFD 1SXJB 4GOND 4OM7A 2BH9A 1AJEA 5BUCA 4NPHA 4ACBA 3BGOS 1C7EA 4HGYA 3ZV3A 2ODBA 1YZQA 4PYQA 2ONJA 2RGCA 3A3PA 1VQ5N 2X40A 4V0RA 3QVJA 2P9ZA 3ZDZB 4QXQA 3IEMA 1N3BA 3GBTA 4JAVC 1DXYA 3PNPA 3IQEA 3ZEIA 2H1SA 2IYWA 4CJ7A 3LP8A 3OA9A 4B8YA 1V45E 1HJOA 4UFOA 4DMGA 3FR8A 3NVKA 3JQFA 1D5WA 2OO5C 1QQNA 4KI0A 2OLKA 2HNDA 3WUHA 3H1EA 2CUZA 2RI1A 3IP5A 2HJ9A 1XQYA 4JMLA 4C4XA 3CR7A 1H5UA 4TYMA 3BUZB 3CUTA 1OH8A 1RT7A 1T0HB 2H4YA 1YZKA 1ZD5A 1DXQA 2O1SA 3NKLA 4ZVRA 4BE2A 5FUVA 4TVKA 2ZJAA 4I7FA 3TRJA 5JD4A 4RQBA 1HNXB 3RTVA 2LUOA 3K9NA 1NVWQ 2AG8A 4IV0A 3HP4A 3C43A 1GUZA 4M3WA 4L1KA 2CFIA 1KO4A 4UXHA 1PGOA 2BVNA 1IN8A 4LHSA 3SM9A 4XB6B 3SMSA 5MDHA 3P9ZA 2ID9A 5JRZA 2Z30A 4FHZA 2WQZA 5EU7A 4RHYA 3PSFA 2NXEA 4DC9A 4OKNA 3O8LA 5IZ4A 4G1UC 3KK3A 3L4JA 1TKAA 5EOYA 1SOVA 4E33A 1T5LA 4A0FA 3ECAA 4XEIA 3HJAA 2QDKA 5FFMA 3X2SA 1CQIA 5AYVA 1M6HA 3NBAA 3CLUC 3I1JA 1JMVA 3F5TA 1KQ3A 5F51A 3C4JA 4KIJA 4IFIA 2AJDA 4S35A 1NUUA 2FEPA 2QMQA 1IIBA 3NAMA 2B37A 2WU3A 1R5JA 5IWAK 4BGEA 3OCVA 1GQRA 5CD9A 3H1PA 4AG5A 3V9WA 4C1NK 3G0OA 5IBPA 2B36A 1DTWA 3L1HA 3SF8B 1T4GA 4B6RA 3HL8A 2Y71A 2OFPA 3SVTA 4M49A 3SQNA 3HPOA 4D97A 1N2JA 3LP2A 3QOWA 4HUFA 1KYVA 4NE2A 4EI7A 1EM6A 1F06A 4QZVA 4B0OA 4C2TA 3OUTA 3PLAA 3TS1A 1CJCA 2X9LA 4GZ3A 5JMTA 2VVTA 2X0NA 2ZJ6A 1E6LA 3I0RA 2OD2A 1EJ6A 4AZVA 1NKCA 2IVOA 1E61A 4S2EA 2YHWA 1NW5A 3ZJ5A 3OHPA 4K9LA 4NAUA 4EFKA 4UBJA 1OGYA 1E4GT 5AQQA 5EMNA 3ELUA 3LE8A 1G5HA 3O1LA 3V8VA 1L5GB 4RF4A 3AVUA 4XDYA 5JNLA 5FRMA 3G1TA 2QZPA 3AB7A 1QYXA 3RRMA 5C9ZA 2BBSA 4OUDB 3I61A 3ON5A 2ZI4A 4I2VA 2C5SA 1PQUA 1G3RA 3J81O 1K2WA 5C37A 2QJRA 2W7TA 1XZDA 2HMSA 5E1OA 1QVRA 4RHEA 5IWCA 3FJ1A 1EK6A 4Z0HO 3AV0B 1F2TB 3ICQB 2FLKA 4N0PA 4EUKA 3R8FA 1C9DB 1K5HA 4FZZA 3LBNA 2DY0A 3W9SA 3GOQA 2NZVG 4EW3A 3BZKA 3A1EA 2HCBA 4FYHA 2XBUA 4G5QA 1DO8A 4PSDA 2GRAA 2F9FA 2IYNA 4NOLA 1AUVA 1C3OA 2AFVA 3LC2O 4J2HA 4X1KB 3D54D 2V4UA 3UC5A 5FIUA 3CXRA 1R0XA 2J07A 2NRXA 1VQMN 1AXGA 2JFOA 5BQ3A 2YZ7A 1BRTA 5DI3B 1LI4A 3QV1A 1OFUX 2EGGA 1YA6A 1ZZEA 5CU7A 5TQJA 3B5EA 2XDYA 3DH0A 4DQSA 1QDUA 1O6BA 2GK7A 2C7GA 2HPHA 3A4IA 1YS7A 3FBWA 1P75A 4B3BA 1ADYA 4KO1S 1VSFA 1L7DA 4DCUA 4IUDS 1PL6A 2ZRLA 1NDUA 4BKUA 4DDWA 2E55A 2W6OA 2VRCD 4EKYA 1XJCA 1KMHA 2ZE8A 4RA6A 1R8SA 1CF2O 3HPRA 1B3RA 3UFXA 2WSLA 1NX9A 1BKSB 1XVAA 3M3DA 3RTDA 1J49A 5A4AA 3FWZA 2O3UA 1UBCA 1F6WA 3WP0A 4Q01A 5FUXA 4BR9A 2PWPA 3TSPA 4M0PA 1CD5A 4MR7A 3FMIA 4Y1FA 5IUJC 1R9GA 3IUQA 4RSHA 3BA1A 4URFA 3DOKA 1DC5A 2X5KO 2GN1A 4QPCA 2Z1IA 2I66A 1XKTA 7REQA 3G85A 4MRMA 3MRTA 1V96A 1XUOA 3H13A 3KKSA 4M3YA 1D4AA 9ABPA 3KQUA 2WIFA 4DSLA 4RVFA 4D9EA 1JIQA 4N49A 1XZFA 4EB8A 1CDDA 1UKEA 1CEEA 4QPJC 4CIYA 2Q6KA 4PZ9A 5B6PA 4D9IA 1RXYA 2QRMA 4WQMA 1DKOA 4AJPA 3AR2A 3QFSA 3GV0A 1YU6A 1A3CA 2KZZA 2IAJA 1X70A 1NKBA 2V9PA 3QLHA 3N74A 4BQEA 3QKIA 1D07A 1I24A 3TTWA 2PMDA 3I72A 3HZRA 3A1WA 5K3EA 3QLEA 1JG2A 4C0LA 4KPUB 3WGVA 2AWNA 5B4TA 2FZCA 4CIAA 2VPWA 4BAGA 5ALIA 4HB3A 4CM8B 3E22B 5K8TA 2NUTB 3TWHA 1QWSA 1XXHA 4HZIA 3ZBQA 1XUPO 3H6GA 1C1XB 3IUPA 4E5NA 3H2JA 2CC2A 1HKUA 2XUIA 1CXZA 2YMLA 3MUNA 2Q6LA 3RIGA 4PZPA 1TVKB 4GGMX 3RS2A 1W5AA 3RSQA 3HJNA 3NOOA 5KS2A 4PN3A 2JGLA 1B00A 2FWAA 2G04A 1M2JA 5K14A 4EHAA 4ZO7A 3VQ6A 4I50F 2HW3A 5L3ZA 1AHNA 3IQDB 5M34A 4INPA 2NSJA 2ZB8A 1Z6PA 1YZTA 1LUAA 5B3JA 1L5YA 1E20A 1OZGA 1K7EB 2ZT6A 3SJBA 4LJ8A 1PUJA 3IKMA 3OE7A 2GJ4A 4DM7A 1WMDA 3MAAC 1T10A 4D25A 1HDYA 1E6UA 1LWOA 2QROA 2XLCA 1TFRA 3IAHA 3K1ZA 1Q84A 2XCQA 1TQ6A 3HO8A 1OILA 2B4RO 3SJHA 2VT7A 5EYPB 2VH1A 4ODIA 3BM5A 3SC2B 2Q0QA 5J2UF 3FUUA 5GINE 5SV2A 4U2CA 3IVXA 5FHQA 3D2CA 3BMCB 2Y1DA 2CVZA 1DQSA 3KUKA 5LP6F 2ZTMA 4ZVUA 4EKIA 4CEIA 3W2TA 3DDHA 4N18A 4BCCA 4MV6A 5JVHL 1WZ2A 3OEHD 1JYFA 4KN6A 5KYYB 3VFDA 4UHHA 1HYVA 4XFKA 2PV0A 4RD6A 3PF8A 4HDNA 5CT4A 4B6QA 2VTDA 1JDBB 1EBFA 2J6BA 2YS6A 5M2QA 2Q2RA 1Z47A 1HDZA 1MAHA 4GEGA 3AHJA 2QBYA 1N2IA 3ME5A 1JALA 3M8PA 3K09A 2ZAMA 2WTBA 4LHVA 1LDEA 3IAM1 3DBHA 3P2EA 3NXKA 1P1FA 1LDGA 3CX7A 3WYCA 4G25A 1ZRMA 2BGIA 1Z6XA 2EQ5A 2F4VK 1X7YA 1O6FA 3TN7A 4DANA 4D9BA 3L46A 2RGGA 3UJHA 4B2PA 2W2LD 1DBRA 3ITNA 2HIHA 4UJ3A 1NRJB 3IV6A 4R2XA 3IAFA 1HZJA 1FJGB 1HQDA 1Z8FA 4CVNE 3O03A 5L53A 1Q0PA 3KB8A 4FFRA 3A4MA 3BWYA 5IU6A 2AXQA 4FJ9A 4OQLA 4KEAA 1G5QA 5HFAA 1TV6A 4YRRA 2C61A 2E1ZA 4ISGA 1W36B 5AIBA 4X62B 4CM4A 1Y1LA 3JARA 2BUBA 3IBYA 2A33A 1V26A 2HQRA 3NC0C 1QHTA 1M54A 3UENA 5AP9A 4ZWNA 5E7QA 3ROPA 1JDTA 5A6VA 3DMYA 1PDWA 1CIVA 5HUHA 1WSIA 2IY9A 2YIMA 4FGKA 3AUXA 2OYCA 2GYWA 5LMZA 1Q22A 4H1VA 4UTZA 1ZP6A 3LTNC 1A5WA 1H9BA 4QLOA 5FCDA 3B8HA 4MKGA 1E7QA 1BYIA 2O2EA 2EX1A 1ZVKA 1L4UA 2ZJPL 4PLGA 1EFUA 3TW4A 2NU7B 3OPVA 3H2BA 2GEVA 1U4BA 2Q1WA 3FSRA 4Y2RA 4LMPA 5K3SA 2PHZA 3KQVA 3I37X 3TEJA 3WLMA 4NBKA 4X7BA 4BMNA 5DB4A 1OH6A 1LX7A 2CLHB 5IDXA 2P5GA 1HDRA 5GMOA 3W7AA 3WQTA 4XARA 1Q1AA 4EELA 2Y8EA 1JFLA 1YBMA 2H7YA 1NM5C 3LZDA 4OK3A 1CUBA 2HXYA 4IX1A 1SBIA 2OV6A 1E1QA 2C2MA 1B14A 2I6GA 2LDBA 4IKEA 4KH5A 2Q41A 2B0CA 2F3QA 2YYZA 1CUVA 2Q0HA 5J1EA 3N75A 1ZICA 2I6UA 4G89A 3B51X 4MFBA 1D0IA 4U5XA 4IPTA 2IXBA 1B74A 2HO4A 3PX6A 3ZCUA 4PPNA 3RYFA 3BQNB 3G7NA 4OL0A 1M5RA 1IO2A 3BULA 1VLVA 3AYZB 3WRWA 3ZE2B 3S41A 3PDIA 3HXKA 3S2UA 4C8NA 3D3JA 4E4RA 3HDYA 4IDNA 4XH4A 1RQRA 1NUHA 2B2NA 3OBYA 2E5WA 2BEWB 1J2JA 1CLQA 4BC1A 3B2QA 3B6IA 5E6RB 1Y3AA 1HT3A 3UAZA 2AJLI 4CF9A 2GO7A 3N87A 2ZRBA 3AVCA 2CYAA 2J46A 4H5WA 5ULLA 4RW9A 2IHZA 5DTQA 2P2NA 2G6BA 2RAFA 3SWWA 4YHHB 2C84A 4FYVA 2F48A 3VO2A 3UJ8A 2VK1A 2HCRA 1HNWB 2R87A 4L8GA 3HCFA 5SWMA 2ORYA 4INJA 1UEXC 4BWJA 2QTAA 3C5HA 3REQA 1QR2A 5A5FA 4B9UA 5JNUA 3II6X 2C57A 3W5HA 3PQFA 3PD1A 2N0SA 3LH5A 1B23P 2Z4RA 3BXFA 1W75A 1BW9A 5JICA 4V24A 5CK4A 1RWVA 3D8SA 3JW8A 3BFXA 4I7EA 5FA8A 1WW8A 5A4FS 4NSNA 1J22A 5D86A 1SC6A 5U1PA 1VKNA 4IW3B 2PFUA 1HT2E 1LVHA 4B1XB 1Q0QA 2BCGY 4HGQA 4PIVA 3NVAA 3VHXA 1M5TA 3BK7A 3ZHVA 2ZM5A 3CLRC 3KQWA 1P8JA 5ADVA 1ICEA 1Q7TA 4HNVA 5B2EA 4CKCA 1P3Y1 3KX2A 4XWYA 3V1UA 5CFNA 4E1JA 1ZEJA 4O55A 1OFVA 5AQRA 4LMBA 3SBTA 3IIKA 3T61A 3HP9A 3DXYA 1W87A 1KXPA 4KG7A 3BWMA 5JRDS 4C6TB 5FEMA 3QRWA 3K1JA 3BY5A 2XMRA 3GCDA 3L0BA 3OAAA 5DGIA 1XGKA 2A5GA 1IK6A 3TIIA 5A0VA 3I2YX 4A2PA 5FYDA 1PFYA 1S4MA 3FFIA 2ZAYA 1LPAB 2BLLA 1RZVA 4QM6A 3RRJA 4ZYXA 1QGED 3LL3A 2WJ6A 3UMMA 1DBPA 1M1YE 2ZCVA 3DEZA 2OFWA 2Q3HA 4JB8A 2Z04A 3H3XA 2JFXA 3C0KA 4ZARA 4DLSA 1GGVA 1T1JA 3DBRB 2Z0MA 2VUIB 1F21A 4RFSA 2XVAA 2HNZA 1II9A 3N2EA 2AP1A 4ZT7A 5DISB 2J0EA 1EEXB 4K6OA 2ZULA 1TL3A 2RGXA 1LKZA 2DQYA 3QWIA 3VQCA 3CURA 1HL7A 1OXKB 3AETA 1WO8A 1VLHA 2BI4A 4CKYA 3L04A 4OB8A 4AY5A 2UXCB 4KSYA 5DWVA 3VEYA 4Z49A 3TRDA 2KYRA 3WWPA 2G28A 4CMCA 4ENSA 3FSGD 1ZJ5A 1L1RA 1AKNA 5IUNC 4OHOA 1TQ2A 4B46A 3OS1A 4GGPA 3SLRA 2OK8A 4BJ3A 3HWSA 4MYCA 4N40A 1ZM2A 5HYVA 4MHTA 5KTTA 1AGXA 2Y6VA 3AHGA 2ODQA 3W5DA 3UM9A 1KBOA 2VTBB 4CLXA 2OFFA 2YWFA 3WLRA 1HEYA 5K1ZA 5IJAA 5GAJA 4QWMA 1NZFA 3KOWA 3C48A 4R9VA 4R2MA 5TKWA 3X1KA 3IDHA 4PN7A 1A9QA 4N7MA 4RH3A 2HF7A 2CGKA 4DLEA 4A62A 4ND2A 1PFWA 3AKCA 4A23A 1B7GO 2XXAB 4RA9A 4CLEA 3LLMA 4J3JA 2A0UA 2GAJA 4QHSA 4U1RA 1OV6A 4PZYA 3VEZA 2Z4TA 2J0QA 1P7VA 2NQ2C 2I7NA 3ICOA 5AMXA 3SJ7A 3SE0A 1ZEMA 2ONKA 4UAVA 4G5OA 5AT1A 3WIDA 3OM1A 3ZGVA 2BW0A 2YQ5A 3BMNB 2CN1A 2AG0A 4MP8A 3QWFA 5JBQA 3O0TA 1VQLN 4GKKK 3TLGB 1WA5A 2ON6A 4FNMA 1LPMA 5DNVA 2PUAA 5L3VA 4CZFA 2C8VA 2HHUA 3HVRA 5T41A 2W93A 2VZEA 4C6RA 1KRXA 4NF2A 1WUKS 5AICA 1YQTA 1GXSA 5DK6A 5JBNA 4WKBA 3PNYA 3O21A 2OORC 1OI7A 4YUZA 1ZNQO 2WF5A 1UDWA 4AZTA 1K4MA 2NX2A 4JI3K 4YJGA 1WUHS 2WHYA 3X1JA 3H8JA 5K8LA 4ZGGA 4EBBA 1C3EA 4WHMA 2IW1A 1OROA 3FNBA 3HXOA 3Q0EA 3IHKA 1H2XA 1MX5A 3MXMA 3IP3A 3CF0A 1TIPA 1Y7HA 3KNZA 4H3KB 3MJDA 4RPLA 3KT8A 2ZYVX 1U0LA 3O7WA 2IX3A 1ID1A 4IUBS 3PR2B 5G0VA 3SE7A 4OXRA 5LLSA 1NQTA 1Z4KA 4O4IF 1T3GA 1JP7A 2NSLA 3MCAB 2V8BA 1K0FA 3CSUA 3LX4A 2KW5A 1RJ9A 4K9DA 3PLAE 1H5QA 1BWFO 2BEVB 2JJYA 4DLTA 2OVFA 1G19A 5DHUA 3K9WA 1J39A 4FTWA 3KQQA 2CHVA 1QYCA 3WFIA 2VJAA 4F6CA 4N12A 4I4IA 1NJ2A 1GG2A 2PL5A 3GDGA 5EIHA 5H3CA 2ILTA 1K8QA 5JWRA 4ZQGA 4GE0A 2OEPA 5CX4A 2VJBA 2VJPA 2C0PA 3AEYA 2W70A 3KR9A 5HRAA 1X1SA 5L95A 1BXRB 4CJRA 3O7MA 1P9RA 1N9GA 5T5QA 4Y2TA 3WRYA 5ALVA 4D46A 4C1NI 4QPPA 4AG3A 4FK0A 4X63A 1WBJB 3KUUA 2C82A 1NX6A 2PRSA 1E4FT 3G8DA 2PVPA 3E7FA 3RKUA 2ZSUA 1OXBB 4HS9A 2PS9A 3QFFA 2WPDD 3KALA 4MGYR 2XCSB 1X1RA 1EI9A 2YC2C 1L4EA 4YOYA 5H8WA 4BTEA 2PY5A 1FW6A 2HU8A 1RXWA 2GBZA 3O2QB 3KHUA 1T3VA 5F5XA 2Z1HA 1Y8QB 1MR3F 1DUVG 3OM0A 4ARIA 2VZ8A 2V7PA 5KPTA 2HV8A 4KUEA 3T1OA 1YZYA 4Q4HB 3QG1A 2I5PO 4TTTS 1NW3A 1T6NA 2Y1KA 1EB8A 3MJ4A 3N2LA 1G6KA 4IEFB 2ZIAA 3HSTB 4HZGA 3NU1A 2VDNB 1TUUA 1JHAA 1L8OA 3G79A 3NHBA 1QPGA 3PJGA 4QDZA 4MW0A 2P1RA 1LLUA 2VWQA 1X9GA 1LBIA 1SULA 2J4CA 2ONCA 3SSAA 5CTJA 1U8TA 4OOFA 3CF4G 2I99A 5AKEA 5KGXA 2P41A 4O44A 3VQDA 2XE4A 1GR0A 3U4MA 4CW7B 4TUYF 4KFRA 1GNSA 4LRSB 4X1IA 5BNZA 3AEZA 4BRDA 4Q4AB 4GR4A 4MLCA 4MUJA 3X1WA 5DU2A 1P45A 4HDRA 1U02A 3F7NA 1UA1A 1OASA 3PLRA 1GSIA 4EEXA 4K9SA 3DJYA 3OJSA 4POAA 3EW7A 2QTHA 1X7XB 3KB2A 1ITZA 1M34A 2PS0A 2I80A 4PC7A 3WLKX 1T8WA 5TC4A 1E9RA 1I10A 3R7NA 4F1KA 3CUKA 5EC8A 3W8DA 2HRZA 3CNHA 2XA9A 2EEZA 1VI5A 1Y1RA 3E58A 1BHO1 3ZQUA 2PPLA 1XCBA 4LRYA 3RG8A 2P9PA 1DIRA 2BTQB 2DPGA 2VDWB 5AQGA 3JALA 2HCTA 3O3NB 2GEKA 3OJXA 1K6XA 1AGYA 3GPLA 3R3WA 4B75A 4H15A 2NO1A 1D5CA 4EA9A 2XZDA 1SQ6A 2NLOA 5AXAA 3L2WA 3BE5A 1R16A 3I32A 1V35A 2P9KB 2Y6UA 4PCUA 3U39A 3L05A 1Y34E 1Q7BA 1HKHA 3MJSA 3M2TA 4KWIA 5B58C 1QRAA 1XXHE 4HLNA 1Z56C 3I58A 1Z07A 4YBZA 4RZUA 4EG8A 1O94A 1ZIOA 1R0CA 5HJ2A 2XMQA 3PI6A 3HFJA 3IOCA 3HHEA 5C4GB 4FXPA 4DBLE 1PSWA 2W4QA 3VC7A 2WHQA 1P1BA 4IOCL 2X13A 3JD1A 3ZPXA 2OXTA 2YJNA 1VSMA 3EXIB 2XR1A 5U9CA 3S1SA 1VL8A 3T0FA 1V9CA 5I01A 1U9IC 4R1NA 3SHFA 3E81A 3MNFA 4G0VA 1VKHA 5AK5A 1WULS 4J7XA 1SZPA 2YCBA 3PC2A 1TLTA 3AG6A 4H17A 4JS0A 2R25B 1T0BA 2AJBA 2EATA 3OF2A 1PYDA 1I4OA 1HNXK 2X4DA 1J9AA 4DHYA 2RH4A 2WQ7A 1ND6A 1USGA 2IXGA 2AVNA 2JHFA 4M38A 1QH1A 4DKXA 1GPYA 1ODCA 3AUTA 1GA6A 3TTUA 1AUQA 2VA9A 1GZ7A 3TTTA 3ZCXA 1II0A 3DKIA 4W5HA 3C8MA 2IXDA 3BD8A 3PQEA 1Z83A 3KAJA 2Y0EA 4HNSA 1RE0A 2D5AA 4P6VF 3DWLA 4ZCLA 2H3HA 5KQ8A 4JYCA 1CYDA 3EXG1 4HNUA 5EVZA 4KWTA 4EIWA 1E4VA 3FOCA 4BQLA 1ZRSA 1QRRA 2QMUA 2XRZA 1ZU4A 2CXQA 4HDKB 1XZHA 4EHBA 1GZ6A 2OZKA 2DLCX 721PA 1VC2A 4AS1A 4NNJA 1QK4A 4AN1A 3FOZA 4KQHA 2IX9A 2J5QA 4C08A 2VZ0A 3IP8A 4KR9A 2FPXA 2ONYA 3N4QA 4X95A 3DEFA 4JFRA 1O3YA 4WCFB 3U7IA 3VA0A 3NMUA 3F8TA 2NXWA 4A5OA 3WGHA 4MDFA 1WZIA 4TUYB 2WR8A 1Z3CA 2OKCA 2AC7A 4F84A 4GY2B 1QTNA 3ET4A 2P3QA 1U2DC 3PNOA 3PP8A 2QTWB 1NI4B 3V7FA 2NN3C 2TS1A 1TUYA 2FMKA 1SC3A 2H1HA 4R31A 3U2QA 4V38A 2JLUA 1KIMA 1C29B 2PX8A 3ZJVA 4G8DA 1FXWA 3IAXA 1PGNA 5DM2A 3KYCB 5HVNA 3U4QA 3BXZA 2AFHB 1CF4A 1BX1A 4DM3A 5JY6A 4QU9A 5DZSA 4JX8A 1W7AA 1ZNXA 3P96A 3DMHA 3H84A 1EB9A 4L4UA 3FDIA 3VPAA 4BU0A 4OXKA 5KTKA 2VP2A 3N2GA 2PLFA 3RFXA 3UAWA 3DLIA 1O1YA 1BA3A 4TKUA 2I03A 3K5MA 3UPTA 2G17A 1PWXA 2R6ZA 3AVLA 3RTBA 1G66A 1Y81A 1W88A 2UVDA 3P2JA 2BF4A 4UDYX 1E69A 3W4IA 1UOPA 4IQGA 5LZ7A 2A1TR 5ENDA 1B6GA 4M3RA 2X1LA 4OI2A 2EBUA 2E2PA 3AY3A 4HH3C 2PUJA 1CS0A 1W4AA 2F67A 5TPWB 1FIUA 4Q1EA 4ZICA 4IXMA 5FYQA 3I33A 4DR6B 3PO4A 5FPHA 2RH5A 1Q1EA 1QC5B 1BCRA 2J3EA 4BPBA 3CFYA 1FC0A 1S1VA 3WXMB 2GZMA 2V7YA 4M1QA 4WZAA 1NTRA 3ILYA 2O8BA 3UJDA 3C24A 3V4PB 2QQEA 3NS7A 3H7IA 1EGHA 3HUEA 3NEYA 3G68A 3UAGA 4YDUC 3SIWA 2VG8A 3EBOA 3KZKA 4MQFA 4JQOA 2FX3A 3D6HA 2O8EA 2EYUA 4QYIB 1UM8A 1WNFA 3GZNA 4FQ5A 1FP7A 1EX4A 5SY4A 1OZHA 3VF4A 2HJHA 3FAZA 1F7UA 2PFSA 3QMMA 5KJFA 4BX2A 1NMNA 1PD0A 1XZQA 1U90A 4JKCA 1EJ0A 4WV3A 4PUOA 1NXVA 1PYGA 3W6UA 2OHVA 1IZ0A 1BEEA 5BPFA 2YWHA 4JJFA 2FGKA 4YOTA 1ODJA 3HY4A 1NNUA 2POCA 2ZYTX 4YJ3B 4F8JA 4G8BA 1T43A 4I2QA 2DTXA 4C78A 1N5KA 1FRZA 1WCIA 1HFJA 4CIEA 3ACCA 5F2RA 2PZLA 3QXGA 3C7NB 3N6VA 4BJ5A 3VGJA 1YVRA 4FP9A 2HIMA 3GN1A 4BATA 4GKKB 3NCTA 2BGMA 4N8EA 2ZAGA 3DWGA 3CC7N 1FMJA 1UKAA 4WNIA 3H7AA 1C8LA 1FP4B 3AF5A 4R51A 3RRGA 4GFDA 4XIGS 1MRZA 4BUCA 2IWHA 2OZVA 2FPIB 2GGSA 4CESA 2IYYA 1G18A 5J4KA 2W2KB 3U44A 2B3DA 5KHAA 2ZIXB 5FPDA 4HZUB 3RT1A 4F71A 1Z4MA 5ESDA 4E09A 2SCUA 1G7CA 1VA5A 1KK2A 1RT9A 3W5BA 1JDJA 3ID6A 3HA7A 5FV4A 1X80A 3L1KA 4YWHA 3L3VA 4CL8A 3NTRA 4E94A 2FQWA 4EQ6B 3F2VA 2VK4A 3LRXA 4FE7A 5CB6A 4BXOA 4YFUA 2H9YA 4H6PA 3VYWA 2OA8A 1GLAG 1H6CA 3O9ZA 3VJLA 2WVGA 1AF7A 5ITZA 5DW0A 2GMWA 3KYIB 4CJPA 1L4BA 5E26A 3I62A 1WUIS 4KHYA 2AOUB 1BWPA 3QVUA 2FPPA 4OGKA 3RUHA 1RZRD 1YRQA 3MELA 4GOKA 2RHDA 1QHHA 1QCZA 3LUHA 3N3BC 3G0DA 2GCGA 3RM3A 4JI4B 3GROA 3AVBA 4BNYA 4IILA 1G5PA 2QRVB 4C0SA 4DLNA 3SVLA 4KV9A 3J7TA 1E7RA 2OWDA 1OOEA 5D3MA 2G1JA 3IS3A 3GLRA 1N1EA 1WLJA 2XHBA 2RHJA 4PZCA 3AG5A 5C5CA 3C3YA 2WUFA 4YGYA 1H1VA 3R0QA 3TOXA 4DILA 3EGDA 1J25A 4LV8B 3PR3A 3B1VA 1QH8B 4EB6B 3C15C 3G8YA 1NNEA 3TOVA 5C1BA 3ZWDA 3IULA 3DBLB 3KEQA 4LX0A 3MK6A 2IC5A 2YMMA 1U4SA 1AKRA 5KYKA 4DTOA 2VJNA 4MDEA 2FF6A 2D5CA 3AESB 1YT5A 1W5TA 2B5JA 1QUEA 5FPNA 5GY7A 1RCTE 3HKBB 3JSAA 1KKUA 2HQBA 1TUGA 3OCXA 4NFLA 2R8PA 1FUYB 2JCBA 3ZNPA 2G7ZA 1BJTA 2JAOA 3AVQA 4HVJA 3K9HA 4G9BA 2B69A 3JQGA 1RRCA 3FCXA 1UT8A 3F67A 4P3PA 3VC3A 5TGTA 3F0TA 4F3CA 5COAA 2PGIA 1FFBA 2P75A 3RFVA 4YT5A 5JPCA 3QETA 4P08A 4YIHA 2BFBB 4HCJA 3EZ7A 4OQNA 3PFHA 4FIZA 3AKDA 3NANA 3P94A 1Y9DA 2NT4A 1TKXA 3F6YA 3GLFE 4ND7A 4PHFA 1USVA 1RI2A 3W90A 4M54A 3QP9A 1ZL0A 4NDAA 4PLYA 1YC2A 4AW9A 3PPVA 3OBIA 4K6KA 1XVTA 4LW8A 2WVAA 1SC9A 4NBWA 4FX5A 3MMPA 1BRMA 1M2OB 3QMVA 3HN7A 4TSRA 3WXLA 5KPDA 1EEHA 1TK0A 3PSIA 2PJDA 5JT1A 1T6DA 3L8YA 1LCIA 1T5OA 2EW2A 4FCVA 5TSDA 5G0WA 3K15A 4O5OA 3EOZA 3HCNA 1KVBA 1K97A 3NDBB 3TQRA 4X62K 3TIVA 1RYMA 1LNSA 1LAWA 4LHZA 5E9AA 3UHPA 3G7UA 1KZ1A 2H4HA 2O57A 4AF7A 2YMPA 3QKRB 2ZBPA 3DE6X 3U9SA 3HXPA 1SUBA 1W76A 3AEQA 1TIBA 4O4GA 2BKXA 3AJRA 1I4EB 4DTSA 4ZALA 3C3PA 1Q21A 1NMDA 1QG4A 2HYIC 1E2GA 2QRUA 2HA4A 1I9GA 1CIJA 4B85A 1O0SA 1H8EA 4XW2A 2A9QA 3AQ4A 4P92A 3WMRA 2RGRA 4OKSA 4JQCA 5AIAA 2VSFA 5IMSA 4EPYA 4HUQB 2OCEA 3L93A 1W85A 3NW9A 3O2SB 3DOUA 2QTVB 3EPRA 2RSLA 2Q6TA 1SURA 5JJ5A 4AMBA 2XOEA 4C0WA 3DE5X 4WH0A 1U2GA 3GG2A 1O97C 3HCOA 2CFTA 5M29A 2ZVDA 4O8CA 2P9JA 1AQYA 4RSGA 4FDUA 1N57A 4FWNA 4INAA 5K20A 3QI7A 4EARA 4WSOA 2PH7A 4Z4CA 4NJMA 5I4CA 3TJZA 4IYJA 4U2DA 4MYDA 4E46A 4RYLA 3OZWA 1I01A 1XFDA 4B2YA 4RZIA 1V3QE 1KPHA 3G9XA 4DEVA 1P5JA 1E3EA 2IPNA 2EKLA 4M98A 1OVYA 2IQIA 5FNVF 2QM0A 2H1VA 3WHPA 2R4TA 3KTOA 4JXXA 1KL7A 1TYZA 2O6HA 1UJCA 3MEDA 2MDTA 4CHQA 2CB0A 5EKUA 3FYUA 4N8DA 2P1DA 2JS7A 3N4PA 3KJZA 3W5SA 3TAEA 2VGMA 4BDZA 4A2AA 1VL5A 4DV7K 1G4HA 2ZUUA 4L51A 1GYRA 4QRDA 2A1RA 1M72A 1EDDA 1XCMA 4BE4A 2PZMA 1VK0A 3M4NA 1XEXA 4KPFC 1REVA 4NK4A 1YVDA 5CM9C 4BRQA 3WX0A 3FOAA 4JJAA 2DC1A 3KK1A 3N53A 4IMRA 3AA5X 2YXLA 3QJ5A 3EODA 4YHHK 1GL6A 6PFKA 2OT3B 2PZSA 5EXPA 5JYDA 5CW2A 2CLIB 3CNQS 1HNWK 1G8KA 4A82A 1Z0AA 4IXCA 1TW3A 1N6KA 4WUVA 3PUXA 3R7DA 4L5BA 4P4SB 2XYGA 4C8MA 3MJHA 1PFVA 1I7QB 5EWLB 3FLAA 5K99A 3CYFA 1YMQA 4LEIA 1JQDA 5CDYA 4OXQA 4RJIA 4ARAA 2R8OA 2BAGA 1QFJA 4B6SA 3GFBA 1Y33E 2FW1A 1UBFA 1O0BA 4QYTA 4YRMA 2I3BA 2AUNA 1K75A 2PZAA 2NV6A 2G08A 3ZWMA 3PEYA 3QELA 2QE7D 1YZLA 1KO7A 4NV3A 1FUKA 1NN5A 5F64A 3RYTC 3U4IA 3UWDA 1Q15A 4KHNA 1KGDA 2YNMD 4YROA 1IZZA 1E1RA 1JDZA 2H2GA 1KP9A 1RLUA 2CCGA 1SQGA 4G5FA 4HKTA 3PNKA 2FKNA 3HJUA 1ZIPA 3CLVA 2VRBA 4GI7A 4IDQA 1OAKA 3C6YA 3G5TA 2CEKA 1J9ZA 3W2FA 4CDMA 2JI7A 5EZYA 4IIEA 2QPAA 3K9KA 4JGGA 3BL8A 3WKBA 1CZAN 3QQPA 4H4OA 2TRSB 3H8SA 4MROA 4PRLA 3TR6A 1T5SA 1KJZA 2VATA 3VBCA 1JPJA 2QM7A 4DJEC 3TRHA 2Q5FA 1A27A 3K5LA 1VXOA 5C4MA 1N75A 4L5CA 1UFOA 3V8QA 2HOQA 4DWVA 1G21A 2FF7A 1V43A 1M34E 4JP5A 3U49A 1T4CA 6CHYA 1JEYB 4GV9A 5TF0A 2NVBA 2V58A 3KKEA 4RQAA 3RSOA 1P2VA 2GPNA 3LNCA 1WP9A 1WWKA 4PNPA 2MIIA 1W47A 4AJIA 3U5TA 4AUMA 4JGIA 1DWUA 1FFXB 3CLKA 3QMLA 3VVBA 1QM5A 2D1SA 5CT8A 3HGQA 2YCLA 4PRKA 1EUYA 5E3IA 5JVDF 1T7PA 1ZRNA 4MO5A 1XLTA 2PS3A 4QJ3A 2R2GA 3UNXA 4NE9A 3D3WA 2PGXA 2UXCK 4C43A 1DLOA 5CG1A 5G0SA 2YY7A 3OWHA 5LDHA 2VAXA 1QTQA 3GRZA 1IY9A 4FE3A 4IGEA 2HDOA 4JLDA 4TYNA 1Z68A 4YV2A 3F3KA 1GIAA 1Y89A 4UBLA 4RCYA 4QNNA 5IEJA 1JA1A 2RARA 2GM5A 2CHUA 2QVGA 5KNDH 3NWJA 3PXGA 3HEMA 4Q16A 2R6AA 2KS6A 5FNVB 5DTEA 2B8TA 5C81A 5CYGA 5JADA 1QQOA 3D6UA 1T8EA 2CL5A 3GYBA 4JJGA 2E3JA 4FJJA 3O4IA 1PJRA 3JYQA 4CFYA 2J0VA 1EVZA 4EFDA 1OXSC 2BFEA 1EFRD 4MGEA 4DQ0A 2O8CA 2YQ4A 1TT7A 2YMQA 2CSXA 4CJQA 1ZQ1A 3E48A 1VL0A 5E1MA 3IMFA 2FVYA 1ARZA 3AF0A 3PPXA 4A8JA 2R86A 4EFHA 1S6PA 4EKNB 4DZRA 3B85A 4K46A 4JYMA 3FPSA 2VRWA 4G4SP 1U0TA 3RSEA 1QLWA 5AVJA 1JJ7A 2HZ7A 4JUCA 1H2EA 1XIVA 1CNMA 3R0ZA 1VLQA 4XEHA 1D7OA 1NLZA 3SBGA 4WT7A 1HQYE 2O3SA 4KVFA 4KXFB 4G0NA 4HQKA 3HJHA 4IH9A 3COZA 3K8QA 1EK0A 3CFRA 3DPSA 1H0RA 3A6LA 3GRFA 3TGLA 3EIEA 4B7XA 2R48A 3OIWA 1IE3A 1NUAA 3QFHA 1VB5A 3F98A 1JLRA 3KVNA 3QEAZ 3EHDA 3A9VA 2PK3A 1U7HA 2QMZA 1N0VC 3BZWA 5BNWA 5DASA 1XG5A 4KXWA 2C9ZA 3IODA 4AZSA 1S5PA 4CEJA 5EWMB 4OQYA 3OTIA 3RWOA 4AWBA 1BI4B 2YXBA 3DMJA 1ZBQA 3ESZA 4FM9A 5IN5A 1EM8A 3LXXA 4TRJA 3HSYA 5C32A 2HM7A 4NEQA 4ZJPA 5K3AA 3CEPB 3DYVA 4X9XA 3ZDQA 3SPZA 4MX8A 4IHJA 1G3QA 1W6RA 4HGNA 1Q12A 3PX7A 3LP1A 4PHCA 3MHPA 5C1IA 4IOXA 2EZ8A 1RGIA 3MRXA 1ZK3A 3OEED 1AV6A 3ZJTA 2Q49A 5EXWA 3ICVA 4HPJB 1XV5A 2C98A 2HC9A 4EA8A 1MUUA 4HYQA 4H7DA 3VPSA 4FL9A 3EN0A 2AXEA 2ZPAA 3VXKA 1XEAA 4EJ6A 4X91A 2NNLD 5I9LA 2ODPA 4DTRA 4EI8A 2AKAB 2VJCA 1UOOA 4B9NA 3NEAA 3QLVA 3AGRA 3DOFA 2N9UA 4G0QA 4PRYA 2FF5A 4ADSG 4L15A 2Q4DA 4ER6A 4M55A 4ILKA 3VR5H 4ZN6A 2Q5LA 1AQ6A 3KLNA 5DGTA 5JW6A 4YP1A 1FXWF 3M33A 1HM5A 5E3HA 4N5NA 4FSVA 1KR5A 2O0JA 4UTVA 4WMLA 1GUYA 2FPGA 4PRZA 5KUTA 5FWYB 5EX5A 4Y9TA 4D0RA 4EW6A 4N0DA 1EU1A 3W34A 2W8BA 3C1TA 3CT4A 3ESRA 1HTTA 2VQDA 5BRDA 1P4RA 1X1DA 5CDUA 2GXUA 2QJFA 3OQIB 5JVDB 2BKVA 4MCIA 2EKQA 3EF3A 1DRKA 5FP0A 2GD2A 3SXJA 1LSJA 2QX8A 3A70A 2O5EA 2XRYA 2Y1GA 1A5ZA 2H5JA 2CBXA 4ZT6A 4ID5A 3FGNA 2FBXA 1ORIA 3AUKA 4QGSA 2JGKA 1CUXA 3AM5A 4FZXC 1ZUNA 5A1TA 5A5DA 3DM2A 4NZPA 4H9GA 2XMZA 5LZ4A 4FJ8A 5LYJA 4O0JA 3B3FA 4BG8A 4M1MA 3P52A 4HADA 4XJVA 3HCAA 4GWKA 3QNOA 2FSIA 4FD3A 2X78A 2ZJYA 3NDJA 2EW8A 3R76A 4QTUB 4WZAE 4URWR 3OFSA 1E1YA 3TRFA 3D2EB 5EXTA 4ZYZA 2XUPA 3W8EA 4YCMA 3W7BA 4DOMA 4PYOA 5DXAA 2ZUFA 4O2AF 3PQ7A 1TTQB 3R5HA 3B1XA 1ECCA 2X19A 4YYZA 1QF7A 1SUPA 5HM6A 3OU7A 1JCEA 1PG2A 1R4MA 3EWNA 2A0WA 2IITA 2C5AA 3DZKA 3IPXA 1QV7A 2ZYSA 1Y98A 3TAQA 2VAVA 2XDAA 1NIPA 2FPKA 2Q45A 4FDVA 1FFAA 4GC5A 4O63O 2WONA 1NFFA 3LM9A 5H82A 3RVKA 1LSUA 3OFKA 2NTEA 4HCBA 3X1MA 1A98A 4HGRA 1JB1A 5ECWA 2WZDA 2G9QA 1YR2A 2WE7A 3L4KA 3E0QA 1IYZA 3VUFA 3ERCA 1OWNA 2H11A 3LX5A 4PZEA 1SD1A 4OJTA 1REQB 4BNFA 5AHXA 5GIOE 4Y6PA 2GV9A 2A42A 4W8HA 1DP4A 1LW6E 2JLBA 3OX1A 1SOAA 5JD5A 4ZQBA 5JCPA 4UFNA 1ZFNA 5L6LB 5JZVA 1VJ0A 2NZYA 3H1AA 4FT2A 1MF7A 1IZ9A 2XY5A 1H2BA 3ESDA 2QGFA 4LBZA 1ML3A 4OH7A 3MSXA 4B32A 4BNUA 1F0KA 1NT4A 4HDOB 2Y1WA 1CHDA 3NTUA 3PVSA 2YR0A 1R0YA 3BORA 1PS9A 2BEKA 3H9QA 3E5MA 1B42A 2BHRA 4WK4B 5ICFA 1KMCA 4JJ7A 4ZFNA 1KMQA 5DGHA 3AA3A 1IBCA 3IX7A 1YJXA 2ZWHA 3N05A 2O0KA 4DWWA 3L7CA 4J2DA 3H75A 1NGJA 4X93A 3ZQJA 1H2WA 5C24A 3O4JA 4M3NA 4YH1A 3LGAA 4I50B 4R01A 1H3EA 4K2AA 1QB7A 3VPCA 2DG2A 2Q0RA 4NECA 3O8MA 1K66A 4ZZIA 4MJXA 4XGNA 3A11A 4U39A 4J4HA 5BXYA 3A9UA 5CR9A 2I54A 1QZZA 3EZGA 4IIVA 2I65A 3RHSA 2OTJN 3DULA 4MVJD 1M6VB 3F9CA 2DOKA 1RI1A 1DS6A 3IOEA 3TPZA 1GADO 4MR9A 3GZJA 2IYUA 2REQB 2WKPA 5HQ3A 1Q1BA 1XC7A 1MJ5A 4WXPA 5FTMA 3MT9A 1BQEA 5J2UB 3HWRA 3O0DA 1QONA 3OZCA 3KFVA 4DV7B 3QHQA 5LP6B 4DA6A 2BP7A 1Z16A 2C9CA 3OO0A 3F6BX 1YB7A 4BO6A 4Q9NA 2GR9A 4FHFA 1EX6A 1P80A 5KNLA 3R23A 1KFDA 3MZ0A 5CAEA 3HB1A 5EHIA 3FUVA 2GAOA 2ANBA 1UP7A 1X86B 4XOIA 4ZMSA 4RVOA 1ZVVA 4KAFA 5B1SA 2OTCA 3FZFA 2CNBA 4LRQA 1Z8NA 3MVEA 3G2IA 5IKOA 4QGFA 7YASA 1P39A 4YJDA 3T7CA 1LC3A 2V7QD 1Q82O 1LTQA 2VAMA 3PUIA 2L18A 3KHYA 3AL0C 4UMDA 2Y99A 5EHXA 5DMXA 3VQ5A 3SOZA 1N1MA 2BGUA 3EXHC 1GA1A 4TS3A 4B7CA 3OZUA 5DP2A 4LDJA 3C87A 2IE0A 3IMXA 1EVJA 5B36A 1W0KA 5H59A 4KFSA 3TI9A 3GFTA 3B53X 1BMDA 3ICWA 1P74A 2RK4A 3C6XA 3HFGA 3LF2A 4JOSA 4ZODA 3EF0A 2YV5A 4O2AB 4E2XA 4MVWA 2RB4A 3CVJA 4WGFA 2CLOB 2CLKB 1V8OA 2DRIA 3F4BA 3GA0A 1HNZB 3L06A 2QWRA 3COWA 1KPIA 3QVXA 1WETA 2IEZA 1X1AA 3V7WA 1G5FA 1JKIA 4Z0TA 2A7QA 2Y4OA 3ED1A 4GSLA 1PZNA 3W79A 4FDTA 5WRFA 3KO8A 5ALQA 3AEUB 4MQ6A 2B1IA 1HI9A 1KEEB 3PWTA 2YOFA 2JNWA 4ND3A 4LD0A 3NDIA 1T2UA 1WCV1 2KJQA 1FUIA 4BVGA 1HFEL 1YB1A 1XL0A 1TF7A 4KKXB 5CD1A 1XC3A 3EG5A 4IEIA 3G2KA 1CFJA 4N65A 2GERA 2JZCA 1XJ0A 4KE7A 3LZIA 3WQSB 4I0WB 4J29A 3ATVA 5C3UA 4EPVA 2E20A 4BB9A 1P5FA 4RMHA 1K4KA 2H2DA 3VQBA 1JTEA 4H0NA 3A05A 3QEKA 2B8JA 4JNKA 3O8QB 2ZIGA 5JD3A 1FLVA 3TO5A 1JT9A 4TXMA 1E6WA 2WZBA 2Z2JA 3UVEA 1TAGA 3PEFA 1TYAE 3M6FA 3W3AH 5BRFA 1I1OA 2D0PB 2E82A 1C3VA 1WVGA 2BMJA 2VCPA 3DE7X 3OOEA 2BFWA 4DM4A 1Z17A 2Y68A 2SKDA 3PYXA 4QELA 2GETA 2ZJ1A 1ZJYA 4LF9K 4E1VA 1I4DD 3O1JC 1QSGA 2DT5A 3AA2A 2BHSA 2HHTA 3HPHA 3C6HA 4HTFB 4QOIA 3IUNA 1BL3A 1XNHA 1HZZC 2QWQA 1G8MA 4N6GA 2V3CC 1T9KA 2GS9A 4NCKA 1AMOA 3RS7A 3GLSA 5BN9A 1U1EA 1NOIA 5BXQC 2XNJA 3WV5A 4DR6K 1NE7A 4KBOA 2AMVA 3VZCA 2QZ4A 4D5GA 2G5GX 3M49A 3K2QA 3P9CA 2WTAA 2YRXA 1CB0A 2ZB2A 3EDQA 3ZDDA 5HM8A 4ZCSA 2PBRA 2H4XA 2OQRA 5EQFA 4RTJA 4KV7A 3LZJA 1U9CA 3QZUA 1XSEA 1Y48E 4FW2A 1E5VA 4AC9A 1NGSA 1KMNA 4FDAA 4DT1A 4MI1A 3GEEA 2IZOA 5J1SB 2IUUA 5LQCA 2HLPA 2IUYA 3ZT3A 3LP3A 3MWGA 2C8JA 4L02A 4XRGA 3TR5A 4NOKA 4DARA 3ESYA 2I4IA 4IIXA 5HKKA 4K25A 5TARA 1YRYE 3LHDA 4NJEA 2XI4A 1FTWA 4M9ZA 3PUYA 2HJWA 4RTPA 2WFLA 1F2UA 3IPYA 4DA8A 2QL7A 2ZP1A 3BSFA 3OZIA 4JD2A 3NHLA 4ZT4A 1L7NA 4KB1A 3NBKA 4B3OA 4DLAA 2QRNA 4ECAA 3IAEA 3A5LC 3PSHA 1WQ3A 4PZLA 1COZA 2RAUA 4RTFD 2X3FA 1SVUA 2N46A 2QRLA 1UMDB 2QPOA 1ZH6A 2Z08A 3L8MA 3OQJA 3T5TA 2JIRA 3EPJA 3TL2A 4H7IA 2A9FA 1NONA 1UMBA 4LJ9A 5A4JA 1UIMA 4R2JA 1JL1A 4RFLA 4TRNA 2G40A 4OMDA 1UKVY 2QT1A 2G0AA 4IMPA 4FSDA 3HV2A 4J0HA 1DAIA 4NAHA 3SBOA 7MHTA 3E5RA 2XY6A 3HO6A 4H0FA 1C9YA 3Q5EA 5DHFA 1H4VB 4FWKA 1Y9JA 4KN8A 4YO8A 3FGUA 3NPAA 4X5OA 1ZA1A 4DJTA 1Z88A 1MVLA 2AK2A 1NVVR 4UTOA 5KVVA 3JQBC 1IJFA 4QS7A 2DPXA 2QWMA 1TQDA 4KH0A 1KF0A 3WJAA 1NPTO 1Z6YA 4WD3A 4CEZA 4JXKA 4P31A 3ZG6A 2ISQA 5DBEX 3HXLA 3AERA 3AILA 2GUGA 1URPA 2IY8A 4D9JA 4IRUB 3MBKA 1US8A 1J5PA 1L3IA 4J90A 2F4NA 4JI4K 1GSAA 4IIUA 4DVGA 3BGRA 5FWNA 4CHTA 5EZYF 5JNSA 4IG4A 2EWWA 1JU9A 2LPMA 4QUIA 4L9WA 5ADXA 3Q9UA 4Y67A 5EJMA 4TROA 2FG7C 3AR3A 4G1BA 5JBIA 4EMUA 5LMUK 1M1YB 3K6JA 4GIBA 4IJQA 2A0XA 1JEQA 4EUFA 1JVBA 2C5EA 3L7LA 1IB0A 2QNBA 4HAYA 4JVNA 1G21E 4N9QA 3SXUA 2VSXA 4N5LA 3JQ8B 1BH2A 1SIOA 1Z8HA 2MYNA 3LDQA 3U9DA 1NVBA 1YTLA 5JZMA 2VPXA 4MZXA 1FTGA 2PKRA 3RTCA 3TIFA 2YWDA 1O9HA 2QTTA 2J59A 4EAAA 1TK3A 2JANA 5DRYA 4EP4A 1VJ5A 4KWCA 1NVGA 1U0RA 3VU9A 5CBPA 1RYYA 1D1SA 3WK7A 1TKRA 1NGAA 1V0JA 4C14A 4IM7A 1EP3B 2VDLB 4F91B 2XB2A 1K86A 4DQXA 5LBIA 1M1NB 1E1CA 5IP5A 2HTEA 4J16C 4GI2A