2YHAA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
384
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
total genus 115
structure length 368
sequence length 384
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhaA01
1FXXA 1EFAA 5D2CA 3VQ9A 4CCHA 1D1QA 2LBPA 4LE1A 4Z4IA 5CYQA 3NF7A 3UIQA 4E3SA 1Z26A 5HLFA 4KHQA 1P6QA 2FBTA 3O2JA 4IFYA 4Z99A 1C0MA 3OY9A 1J54A 4HCCA 1NKCA 1HNVA 3ASMA 3QEVA 4FXDA 3HPHA 4MRMA 3ZSQA 3CS3A 1M2EA 4NV3A 1J5OA 5FWXB 3DRSA 4ELUA 3LPTA 4RS3A 4LDAA 3VQQA 2HQOA 3AO1A 3L2UA 3H75A 3C94A 1SXGA 4B08A 4MPTA 4XFKA 3MAQA 4E1MA 2YHBA 3NAEA 4IILA 3HDGA 4CGFA 2P51A 1RDAA 4CIFA 4MS3A 3ZSXA 1S1WA 4FJKA 4PQUA 4KHSA 1PNTA 3OS0A 5EWMA 4E7HA 1OXKB 4XAQA 2E4ZA 2KFNA 2O4GA 3KLIA 4H8KA 5J2MA 1TVRA 1J53A 3CYMA 3NE6A 3SZ2A 2JBAA 3I09A 4CESA 3TARA 4MGEA 4TSXA 3GWGA 4D74A 4CHYA 1BIZA 1X9MA 3AVJA 1BI4A 2PYLA 3RMBA 2G8UA 4ZMSA 4R5PA 2FLKA 5CNMA 3H1EA 1LBIA 5J2PA 3DLBA 1XHFA 4H4MA 3S3OA 4WXMA 2QZJA 1S9GA 3EODA 4BWMA 4N5SA 3H5VA 1RXEA 4K8XA 1MIHA 5J1EA 1USIA 1F21A 4CEDA 1LWFA 4W5RA 3SNKA 3SY8A 4Z4HA 3KS9A 4RK7A 2LUOA 2Z1IA 4Z0NA 1X9SA 3I0SA 4YR7A 4ETNA 4O5AA 2PUBA 4CERA 4EZ9A 1S1XA 2IC3A 3OYAA 1E6KA 2IPLA 3ALYA 3T38A 4E7LA 1QP0A 1BISA 3A0UA 4EP4A 4DTOA 4JA2A 4FJ7A 3LKBA 1Q9YA 3THVA 4E0DA 3LP3A 1M5TA 1YS7A 1EHCA 2YNIA 3HEBA 5TPWA 4DWIA 1A04A 2L17A 1QQAA 2DRIA 3V9WA 4G97A 1QS4A 2B1JA 1VSIA 1ZBUA 2HB5A 4AHUA 4FZXC 3HS3A 4PA1A 1JDPA 3A3KA 1QSYA 4EYOA 4ID1A 3CZ5A 3QLVA 2PUCA 1WSIA 3CFYA 4FW2A 2XHBA 4PUOA 3OM1A 3SQ0A 4Z4EA 1BL3A 1EETA 3UK0A 3HT3A 4N03A 5DMRA 4QPJC 5HSGA 2JRLA 3OYNA 3Q7TA 1YK0A 4H4OA 3N8IA 4JRQA 1EWTA 1DJMA 4CJUA 1W9HA 1NOYA 4CGIA 3P83D 4TMYA 3KK3A 2RF2A 1SKSA 2G8HA 1S1UA 4EVQA 2PUGA 4J2DA 1IH7A 3GBVA 1O1WA 3T95A 3V9SA 4QAGA 3IDOA 3D0PA 4O5BA 4KQCA 4G0QA 3CZCA 3ILYA 4KB0A 1S6PA 1L3VA 1E2BA 4WT7A 3TAEA 4FJLA 5JNUA 1QMPA 3RRGA 4CE9A 1JWLA 1MVOA 2F8TA 3LTEA 3O75A 1IKYA 2I6FA 1EWKA 2JCGA 1RBRA 4M3UA 1QO0A 5ABPA 5CZ2A 3H5OA 3CG7A 4CF9A 5HRNA 3OQNA 1K6YA 3T19A 4MS1A 1TGOA 1D8YA 4DSKA 1ASVA 3Q41A 4ETMA 1GOBA 2HHUA 2G8FA 1RBVA 2RGYA 3DYAA 4FW1A 1F4VA 3E01A 4F06A 1YK1A 3HM9A 4O4GA 3RVQA 4F11A 5JNVA 1GLGA 3KD5E 4FYDA 3HVRA 2X78A 1ZBHA 2FN9A 4KI4A 1IG9A 4CEQA 3O2QB 1BDHA 4RW6A 2YKNA 3O3FA 4B9UA 3M6MD 5DCLA 2WWVD 4RW7A 4HNRA 2OPRA 2QW1A 1TK5A 1TKZA 3BGRA 5I4CA 1U2PA 2QXYA 2JBAB 3NGZA 2IS3A 4RSMA 3L2WA 1A5XA 2PLNA 2OZSA 3KLFA 3JVIA 1ZDMA 4LZLA 4DU1A 1QTMA 4ZMRA 5DGCA 1NXVA 4GPAA 3QELB 4YV7A 2OQRA 5EWMB 1ZN2A 5E41A 2GI4A 3KYJB 2P4UA 2B4JA 4CEAA 2OENG 3KLHA 1FFSA 4ZPJA 2HNYA 3TAPA 3KKEA 3H5LA 3LANA 4WXEA 3HP9A 2P5GA 4B09A 1NATA 4KB1A 1HQUA 3L3UA 4XARA 4ETIA 4KFBA 2FC0A 3DLGA 1WSEA 4JLHA 2QVGA 3RVMA 8ABPA 3N0XA 2MYNA 1KCFA 3DBIA 5J2NA 1NJXA 3OLZA 2A1RA 5EWJA 4CJKA 3ROFA 2D0CA 1Q9XA 4EYGA 4CIEA 4F4KA 3DZDA 4YLEA 2FMFA 1JLCA 4BE0A 1WETA 3VQBA 3KK2A 3T3FA 5GOTA 5KQLA 4AHCA 4FLZA 1FKPA 3GBPA 4AH9A 3KTOA 3LUJA 1EAYA 2VK2A 1JL1A 3LALA 2QKBA 2OPSA 1DC7A 1A5VA 2A9PA 3NH2A 4LH5A 4F8JA 4NCAA 3TABA 1B92A 3T1AA 3OYBA 4CJVA 4OKKA 3SQ1A 3LWMA 3G85A 1KVCA 4KO0A 3QEIA 3H6HA 5FRMA 2P1JA 2R4QA 3MMNA 3Q7RA 1ZGGA 3AVHA 3QEKA 3QESA 4B9VA 2GBZA 3P5JA 1NJWA 1YMUA 2F8SA 3OMWA 3AO4A 3ULDA 1C0EA 3NH1A 1NXWA 1VRVA 2IPAB 4QICA 4KKOA 1U45A 4F3OA 4G0ZA 5CNJA 1NK7A 1WN7A 1Q8IA 4MLDA 4LRQA 4OATA 3K2PA 2J48A 5KRSA 2FSPA 1VSJA 2Z1JA 3KSMA 4DU3A 1SD5A 5PNTA 3LP0A 2KFZA 1D5AA 3ZSZA 4Y1DA 1Z15A 1IKWA 5F64A 4JS5A 3OYDA 2R7YA 3C6QA 1D5WA 3CFRA 1RT7A 4FJMA 5BR1A 3IG1A 1TKTA 2F96A 3LP2A 5FBHA 1RZRD 3AVNA 2GV9A 1P6UA 2WJAA 2NZVG 2E6LA 4YS6A 3C3MA 2HHTA 1DTTA 1C0TA 3HCWA 4E7PA 4DTSA 3CG0A 4D6YA 4NQRA 4JB0A 2FQWA 4IF4A 1L5UA 5TPZA 1WSJA 3VQDA 5KQGA 4MRMB 4I7FA 3TANA 5HRPA 1JFVA 2PUAA 3CHYA 3BDPA 3BBLA 1K66A 3A0RB 1ISRA 2M1ZA 1EX4A 3HPOA 1BIUA 4QYWA 1ASWA 3L3VA 4FB4A 1C4WA 4G86A 2ATQA 1T34A 4RW8A 3HUTA 3U3GA 1GCAA 4E89A 3TI0A 3B6PA 5TQ0A 1EP4A 3TO5A 1JBEA 1QNLA 4IRXA 4MS4A 1LAVA 4MR7B 4CJEA 3H1FA 3ZT1A 1VRTA 3VQCA 1BAPA 4I9LA 4KHWA 1RPJA 1LAWA 2D0AA 1KTQA 3NFAA 2WY2D 2JLEA 3UKJA 3QELA 4NCBA 4MQFA 4AHSA 1L5YA 3CRNA 1WAJA 3JTEA 2G8IA 3DGFC 3L2VA 4W5QA 4FLYA 5C5CA 1BCOA 2CHEA 1RTJA 1VSHA 1GUDA 3O1IC 2E6MA 2R47A 3I42A 3K58A 1TMYA 3PUFA 4AILC 1ZYQA 4MQEA 4B9SA 6ABPA 4CK2A 1HYSA 2ETJA 4G0YA 3ZSYA 4L85A 1VSLA 4RXMA 1RTHA 4DLGA 2LP4Y 2X6SA 3QEXA 1D9DA 5HRSA 4DFKA 1TKDA 2XY6A 2FN8A 1JKHA 3RTVA 3EDCA 1PEYA 4CF1A 3MEDA 3QLVC 2MSWA 1QP7A 2AJQA 2G8VA 4IKFA 2Q5CA 4Y9TA 2NUBA 1LBHA 4DFMA 3O21A 2VWKA 4KAZA 3PO5A 2MSKA 1JLEA 2M98A 1WLJA 4BWJA 4RW9A 2IPNA 1LV5A 3O3GA 3PV8A 3URMA 1YIOA 1UAXA 4XASA 3L49A 3K5OA 3GRCA 2WB4A 3WNFA 3DLRA 1ZBLA 3MA0A 4FM1A 4RG8A 1RTIA 3QEPA 3QERA 4DF8A 2A9QA 1KRPA 1A0OA 2PMCA 2HVIA 3ZT2A 1NXOA 4YCSA 2X7XA 2B5JA 4RY0A 3JPYA 4CJRA 4CFBA 4RKRA 3OLXA 1NK5A 2FW0A 1UWBA 3P1GA 3FFWA 2GUIA 3WNEA 2AYXA 2CD7A 1I3AA 4BE2A 1S6QA 3AO3A 2VWJA 2LPMA 1L5ZA 4TN5A 3HJFA 2HW3A 3VQ4A 3RVLA 5D3GA 3OVNA 3TR8A 3MXMA 3HL8A 4G0PA 4RDCA 2ZE2A 3QNNA 1NXPA 2BE2A 2KTQA 4MFBA 4HVJA 4M42A 1L3UA 3KLEA 2BANA 3CKMA 5KI6A 4DMNA 1LW2A 3AVGA 4J2EA 1BVHA 3JPWA 1D9FA 1N6QA 2HHXA 3V1QA 4K8ZA 1TLFA 2IOCA 4RY8A 5J2QA 4GW6A 4RXTA 1XHZA 4DG1A 3EJWA 3CQ8A 4Z0UA 1JL3A 3MQ4A 9ABPA 4HTUA 5ED4A 2IYNA 3OYGA 4HNQA 3EULA 3SV3A 1U4BA 4IFVA 3D02A 2IDMA 1JH9A 3V6DA 5KWSA 1DP4A 3HV2A 3O2SB 4ZYLA 4CFDA 4YRZA 4CIGA 4F12A 3HP6A 2OA8A 1NK4A 3OYIA 4CGGA 3SCXA 4MR8B 5T3YA 5KTQA 3OYLA 4H3HB 4M3WA 2PUEA 4M88A 3IS9A 1QKKA 1CZBA 3L2RA 3HPGA 3MECA 2E4LA 5IUJC 2HHSA 3MF4A 4AHTA 1LWCA 3AVLA 3EYZA 3T8YA 3C3WA 3DMJA 1DLOA 1REVA 4DSEA 4M45A 5SZTA 1KFDA 1X9WA 4UHJA 2V0NA 4Z9BA 3QIPA 3M8QA 3WNGA 2CWDA 3QEWA 3VA0A 1S5JA 2Y1IA 2GX6A 3H5IA 4OPKA 3HUUA 1AB5A 3I45A 7ABPA 1J9AA 2R48A 1UDRA 4QOZB 4HUFA 3RR8A 3BRSA 2G8KA 2FEKA 1ZHHA 3TMYA 4EYKA 2HSGA 1EKEA 3QLUC 4FJIA 3GYBA 1RCHA 1SL0A 2ITGA 4OLAA 3NHGA 1BQMA 4N41A 4FCYA 4KTWA 4OGCA 2AYZA 2PL9A 1PEAA 1D2AA 1S9EA 4MR8A 4N0PA 3F9KA 1ZITA 5IX8A 4RZSA 4O1HA 3N0RA 2P9HA 3SQ2A 4UHKA 2XY8A 3IAYA 3SNNA 2HPHA 1JHZA 1JYFA 3G0ZA 4OLBA 3WNHA 5JS2A 1B9FA 5EWJB 4WUTA 4F8RA 4CFAA 4RV5A 3KTQA 3DRRA 2FXIA 5DTEA 1GCGA 1PHRA 3IP6A 4IMIB 3S9HA 4W5NA 1C0UA 4KHNA 1OXBB 1YMVA 3TX6A 3QX9A 4J2AA 4EUKA 3JY6A 4DTXA 1BGXT 5CZ1A 1WSFA 1P8AA 4Q5VA 4EY3A 1U49A 3HO1A 1SXHA 2PUDA 3LUCA 1Z16A 4Q0BA 3KLGA 3AVMA 1KVAA 2W42A 1DC8A 5TQ2A 1UOCA 4OTZA 1Y1LA 3KYIB 2NT4A 2X6NA 3FGZA 3NH0A 3OLYA 4P98A 2MYUA 3ITHA 1CXQA 2DFHA 3E3MA 4IMJB 3EQ2A 1I39A 2JVJA 1XWWA 4FJ5A 1DRKA 1DZ3A 3ISNC 1UA1A 4XIUA 2GKGA 3OJSA 3OJUA 3O1HB 4FLWA 3V9ZA 3NDKA 3TAQA 1ZBIA 3AO2A 3FFIA 4C8NA 4BE1A 3L2QA 5HQJA 3ILHA 2OPPA 3MXIA 2Q3SA 1SXIA 4DTUA 2A9RA 3VNAA 4CHZA 4MYRA 3RMAA 1UA0A 1Y97A 3RVOA 1TK8A 5FDLA 3I8DA 2FQYA 3KCNA 1K68A 1HQEA 1HMVA 4CJQA 3E61A 4M3YA 1QP4A 3OS2A 1DCFA 4CGDA 1HRHA 1CZ9A 3AA4A 1JLFA 4NICA 3O1JC 3S3MA 4B9NA 4HYEA 3V1OA 3IP5A 1L3TA 2HNZA 3VQ7A 3TAGA 3ZSOA 3S99A 1TL1A 1RT5A 1KVBA 2FVYA 4GNRA 4CECA 4E1NA 1SV5A 4KQ9A 5EU7A 1C1BA 3NCIA 5HROA 4B9LA 1NXXA 4GVMA 1URPA 1USKA 4FJJA 1C1AA 5FROA 5BRJA 3HZHA 4TLLB 3MEEA 4MAAA 1LWEA 4ID5A 4KTQA 4MR9B 2L2QA 4DTNA 5IC5A 1S1VA 2GBPA 1JFSA 3OYMA 4YP9A 2OPQA 3LUGA 4F2SA 5FRNA 4O1IA 4KFCA 1JX6A 4C8OA 3PX6A 5TQ0B 3RVJA 1YS6A 1VPWA 4C8LA 3AA3A 4HHTA 3VQ5A 2BGGA 2YHAA 1KRXA 4YNQA 4D6XA 3RVNA 3D8UA 4KREA 2KW4A 3NF8A 4KV8A 2PL1A 4BACA 5KC9A 3LOPA 2QXFA 4FJNA 2CHFA 1TAUA 4Z4CA 1QQCA 4FVMA 1B9DA 4RK0A 4OJRA 3SUPA 5B3JA 2KYRA 4CJWA 4PYRA 1MU2A 1NKEA 1FQWA 4KZKA 2E4UA 2HMIA 1B00A 1LJLA 3QLTA 3Q7SA 2RJOA 2FLWA 3CFOA 5HP1A 3OYFA 2WJWA 3TD9A 1QSLA 3V9XA 1FKOA 2XRIA 3HSYA 3OYKA 5CY4A 2Z1GA 3JSMA 4LH4A 3G10A 4CF0A 3RMDA 4BDYA 1NKBA 1KRWA 3H1GA 5KGWA 1NJZA 4MQ3A 3LFTA 1QO0D 3V1RA 4CHNA 1U2QA 3LUDA 3H5WA 4EGSA 2A1SA 3DM2A 4E19A 2KZZA 5EWLA 3S3NA 3QEMB 4C8KA 1HNIA 2ID9A 3SQNA 1KLMA 3NNSA 2O4IA 2FTKE 3RVKA 4ZJPA 5C5EA 4DN6A 3CFPA 1E6MA 2HVHA 3DLEA 4NCGA 4OGEA 1J56A 4FJ8A 1ISSA 3LUKA 3GV0A 3O3HA 5EWLB 4CJLA 5HBMA 1EWVA 4O0JA 4F3TA 3FFXA 2RJNA 1KFSA 3AA2A 1RT1A 4PE5B 5IEJA 3K5NA 1Z12A 5I42A 4KI6A 1L3SA 2XY7A 1A5WA 1QE1A 1XI1A 4I2QA 3QK7A 4DQIA 3U3YA 1RDCA 3QINA 5T7BA 2YV0X 2FBVA 3SUOA 4FK0A 4IBNA 3RMCA 3W9SA 2D5RA 1LK0A 3K57A 4FJHA 5KQMA 4OPJA 3SAJA 4PICA 1R8JA 1IIBA 3L8BA 3BRQA 3AVCA 3NNDA 3CTPA 4MS3B 4OKEA 3JS5A 2IAJA 4CK1A 3K4HA 1VSMA 3HDVA 4HUGA 5CNKA 3DRPA 2HNDA 3K5LA 4E7KA 2NT3A 2FMKA 1GOCA 1TL3A 5FWXA 4KPYA 3SPZA 4CHQA 2QU7A 1CXUA 4AHVA 3AV9A 4Q7EA 4DLEA 4DQRA 1ZH4A 3Q15C 3ZSWA 4M3XA 3KJVA 2HQBA 1WSGA 3U6FA 1YTUA 3EGCA 1NK6A 4FE4A 5CHYA 1Z2DA 4OBBA 3O4QA 2XY5A 1WAFA 1W25A 1ZGZA 3F6CA 3ZSVA 5BQ3A 1T05A 3Q9SA 1BDJA 1RBUA 1SUQA 5FWYB 2ZAYA 3CU5A 2JB9A 3OO0A 2E4WA 4N0QA 4KVFA 1LJUA 4UQGA 1ABEA 2VUHB 4FJXA 3FFTA 4M41A 3NF6A 1T8EA 4CF2A 4DSIA 4KK3A 4RW4A 3C95A 4B9MA 3PX4A 4B9TA 1YVUA 4HUEA 1DCMA 3ZCMA 3MIZA 1XHXA 3TWHA 2YNFA 3N53A 2D0BA 1QSSA 1NOZA 2KQ2A 1XC9A 1KMIY 4KMRA 5IUNC 5B3JC 3BILA 4Z4FA 4DTMA 1SKWA 3VN5A 3LKVA 4WZZA 4ZTFA 1BQNA 4CGHA 1BDIA 3LAKA 5HRRA 4LD0A 5KC8A 2FKAA 1ZY2A 4MLCA 4RK1A 2MYTA 3MYYA 2E4VA 3LDSA 1VRUA 3ROTA 1SRRA 2LSNA 2DTUA 3EAFA 1HEYA 4CK3A 1USGA 2DY4A 1MAVA 3K9CA 4H60A 3UUGA 4LE0A 1H9CA 4AHRA 1NXSA 4DQQA 3GL9A 1CEYA 4CEEA 1VKRA 2A9OA 1Z17A 1W0HA 2Y1JA 1LW0A 3N6VA 2PE5A 3K5MA 3OLVA 2FBYA 3SJJA 2ZWMA 4CBVA 1DCKA 4RK4A 3MXJA 4G1QA 1U48A 3RQIA 5CYMA 1DTQA 5FBKA 1PUXA 1XWLA 3PY8A 3I5AA 3VA3A 1CLQA 2RN2A 2IDOA 2MSLA 4WE1A 2EX3A 4DFJA 4OG2A 3RVRA 2E4YA 2X74A 5DLEA 3C6UA 2VYCA 1FFWA 3RR7A 2JK1A 4PWDA 4BDZA 3NNNA 3CG4A 5I3UA 1ITGA 3PO4A 1JF8A 3V9UA 3AVFA 1P2FA 1MB0A 3LAMA 3OQMA 4DTJA 2HJ9A 4P1ZA 3JYTA 4ZTJA 1C6VA 2LIVA 3CLKA 4G0MA 1D1PA 5HKOA 3V4IA 4FZZA 1NK0A 5TQJA 1RT6A 3V81A 1ZESA 4TLMB 4KNYA 5BRAA 3VQPA 5TPWB 2HHQA 2N9UA 2PAFA 5GQSA 3AA5X 4Q6WA 2P5OA 2RPIA 3RRHA 4LX8A 3SUNA 1F51E 3OYJA 4MR9A 2VUIB 2ZQBA 4B3OA 3AO5A 2XDYA 1RT2A 2L18A 4FM0A 1D4ZA 2HQRA 2WRZA 3IRXA 3M9WA 3VQAA 3SUQA 1RT4A 4O44A 1APBA 4IDKA 1BA2A 3HSTB 1T7PA 1CYEA 3KJXA 1ZVVA 1JDNA 4JRPA 4JAVC 2BDPA 2IPMA 5CNIA 4PEVA 3EY1A 4CJPA 3DLHA 3N0WA 1U0SY 4DSFA 3F6PA 1QPZA 2VG7A 2RKIA 3OM0A 4CJ3A 4OKJA 1TVMA 3OQOA 2PJUA 4LSLA 4RU1A 5C25A 2H3HA 1NJYA 3GA5A 4DF4A 3LP1A 1DBWA 4G0XA 4EYQA 1BI4B 3QIOA 5IUKC 4YO7A 4IGAA 3HXMA 4DFPA 3IP7A 3KIOA 4KHUA 3QO9A 1WSHA 1HYZA 2H0AA 2MYPA 3EQZA 4E7OA 3M8PA 1RDBA 3SM9A 5JNTA 3DGEC 4FK4A 3KD1E 2FMHA 2IKSA 3G1WA 4YWHA 1ZBFA 4JB2A 2JVKA 4QCLA 4CEFA 4LE2A 2QK9A 1NK9A 2KZMA 4F2RA 3I0RA 1TJYA 5FWYA 3M8RA 1MB3A 1DRJA 3CM6A 3DOKA 1RXIA 4J2BA 3QETA 4H3KB 3VNBA 4RK6A 5TQ2B 1BHLA 2PY5A 1SL2A 3OLWA 1JFTA 3HYFA 3NF9A 1C1CA 3C3KA 1JLAA 1DBPA 3LMKA 5HM6A 3RH0A 4EVRA 1X1PA 1S1TA 1RNHA 4EVSA 4CJSA 1ABFA 4LSNA 3N75A 4M3TA 5JNSA 3CNBA 1HJRA 3MEGA 4RY9A 4EZ6A 1QQBA 3SQ4A 1JYEA 1VSKA 4M3ZA 2L19A 2QVCA 4I9QA 4KV7A 2IOYA 3DLKA 4OVLA 1SL1A 1G15A 3M9XA 3TB6A 1YT3A 4FLXA 4DS5A 4JASB 1A2OA 4FLTA 4W5OA 4CHOA 2E4XA 3D45A 2R25B 2TMYA 1I3CA 2FMIA 4CEZA 3HK2A 3QLHA 2EHGA 1RILA 4Z4GA 3OYEA 3M8SA 2PUFA 1Z13A 1TAQA 3RVPA 4PY5A 1RNLA 5IBQA 2VG6A 2NZUG 3KHTA 2OZMA 2YKMA 1RTDA 4XLTA 2FBXA 2G8WA 1YTAA 3A2FA 1Z25A 1M5UA 2PKXA 2JGUA 4JS4A 3T6KA 4NYFA 3JVDA 3RVSA 2HHWA 2IGIA 5KRTA 4HNSA 4O0IA 4RXUA 3KG2A 4WWHA 3H6GA 3OO1A 4G0OA 3GT7A 1EXQA 4KK4A 2PZSA 4QYMA 4ELVA 3IPCA 3KLOA 1ASUA 3ZT4A 1U04A 1ZH2A 3NGIA 4Y1CA 3ZT3A 4CHPA 2OYQA 4ELTA 2QR3A 5JNRA 4DQPA 1U47A 1DG9A 3KLNA 5IULC 4JP1A 1IKVA 2DFEA 2ID7A 4IG0A 4KRFA 5SWMA 1TK0A 3FDFA 3QEMA 4ZHRA 4FLUA 4JOQA 4CEBA 4FJGA 4DS4A 1QHTA 1TV6A 4KTZA 4CGJA 3A10A 4LDZA 2O20A 3NBPA 3MM4A 4KHYA 4CJ5A 2YNHA 3NGYA 3AVIA 2WOMA 4CJ4A 4Z9AA 4YFUA 1KLNA 1VLZA 6CHYA 4DTRA 3LUHA 1U8TA 3VQ6A 1N5YA 4N76A 1IKXA 3BREA 4XXHA 1VSDA 3AVAA 4CF8A 1JLQA 3ZSRA 3SYZA 3FMVA 4CEOA 5C42A 2QKKA 2YNGA 1RDDA 4FLVA 3SV4A 1Z2EA 2XO7A 2WONA 4DTPA 1AB6A 3QLUA 4S04A 4N47A 1BCMA 5K14A 3TAMA 3TAFA 4MQFB 3K59A 1FFGA 4FZYA 1NXTA 3LZJA 1VSEA 3O4NA 4FJ9A 4L4UA 4O55A 4W5TA 1R0AA 2B4AA 3CM5A 3O74A 5DK5A 4MR7A 2Z1HA 4CFCA 4DQDA 4MS4B 5JS1A 2VG5A 2B6AA 1IO2A 4E7JA 3SPYA 4FE7A 1FK9A 3RWUA 4DQSA 5C24A 1JLBA 3SI6A 3NHZA 4I2PA 1DBQA 3KKSA 3IPAA 1VK0A 2RDMA 5KQPA 4GMJB 1CHNA 3F7NA 3OYCA 4YGXB 3LZIA 1JLGA 4FK2A 4PZ0A 1KGSA 1WNSA 1RZRA 1T03A 4DSLA 1Z18A 4RKQA 1NTRA 2FEWB 2QV0A 2JVIA 3VQ8A 3DOLA 3NHMA 4RK5A 1KSPA 3B6OA 4HCBA 1S8NA 1TM2A 1SKRA 1PNRA 3LPUA 3C97A 4ML3A 4BDPA 1RT3A 2I5JA 4S05A 1NY5A 1GUBA 2WMYA 3IP9A 1JXBA 3VQEA 1FSPA 4IG3A 3NBMA 4RWEA 1GOAA 4B8AB 3LWLA 4MS1B 1RBSA 4L8RB 1E6LA 3H5TA 3AVKA 3QNOA 4DU4A 3F73A 2FQXA 3SG0A 3H08A 1HYVA 4CJTA 3R0JA 1JL2A 4NYNA 3OYHA 1JLKA 3OMXA 4E7IA 3AVBA 3KK1A 4N56A 3C6TA 4EP5A 3LUFA 1RBTA 3QX8A 4MQEB 2DFFA 2FEPA 1VSFA 1NK8A 3L6UA 4C8MA 1JXEA 1XHEA 3EZ5A 5DKFA 4CJFA 3LUAA 2GWRA 2PYJA 2QSJA 5KGXA 3ZT0A 3DI6A 4DSJA 3KKRA 3OS1A 4B8CA 1ZAYA 4FM2A 1M2FA 2HHVA 5TE9A 3B2NA 4LY7A 5E3JA 4Q6BA 1TKXA 3PX0A 3HVTA 4ICLA 4M3RA 3P9YA 1HPZA 5JNWA 5TPZD 2ZD1A 5IEBA 4DADA
chains in the Genus database with same CATH superfamily
3UBMA 1CUBA 2CNNA 5FA8A 3EOZA 4E03A 2G88A 1XCGB 1VJCA 3JVEA 1DXHA 1D4FA 1MORA 1XLWA 2XIQA 2LBPA 2WICA 4LE1A 1CUIA 4YRCA 2LNDA 4ZHQA 4KXMA 3NF7A 3RYHB 3QBXA 3QU7A 4Q00A 1Z26A 4RF3A 2OD2A 4NARA 3CI5A 2J6IA 3I3OA 4U2FA 2HHCA 1IHOA 4ZDIA 1SUDA 3AMVA 4GMGA 4F93B 4GL4A 4EKEA 4FFLA 1JLLB 2NYAA 5FPMA 5B7NA 2QD4A 1PFKA 1P6QA 2FBTA 3H8SA 2XOKD 1KI7A 1MW9X 1FVFA 2AOTB 2P5YA 4AUEA 3GLKA 1NOIA 2VF4X 3BZKA 1Y5NA 1G41A 2ACKA 1PN3A 1E5LA 1XD2B 1DG1G 2OECA 4JQSA 5EXTA 1MW8X 1MUUA 2C03A 2P1RA 1CE8B 2PT5A 1R00A 2XE6A 1Q0LA 4B17A 1L7NA 1GT6A 3GLTA 4WFAL 4N5IX 4XGIA 5J5VA 3RSSA 3UFXB 1T9ZA 2PSEA 3PV0A 5BR7A 2R7KA 2QL9A 4S2EA 4UBLA 5A3RA 2AOWA 2PXHA 5IMSA 3OUTA 4JQYA 2PMFA 5EIBC 5DJ5A 1GPYA 2C5HA 4M0UA 1VL0A 4M0DA 3ADKA 4JHDA 1F2TA 1TYCA 3AEUA 5ETJA 1UDWA 4CF3A 4EBBA 1ZUIA 3LPTA 1HDYA 3Q7CA 1ZMBA 4JVNA 4LDAA 4OI4A 4DIUA 4CIDA 4L8LA 4QUDA 2QBYA 3AO1A 1KVRA 3OEHA 3H75A 3QNUA 2AR9A 2GK4A 3CR8A 1YKSA 1QYRA 4HDQB 3C94A 1SXGA 4OQDA 2J5XA 2GEBA 4EARA 4N5NA 3H3NO 4NBLA 3K71B 2YQ5A 1FYXA 4MPTA 3I8OA 5LNK6 4NYMQ 4JI0B 4Z1MA 3NAEA 1NBOA 4IILA 1S1CA 4IH9A 4CIFA 4MS3A 2J0VA 1QG4A 3ZSXA 4LVUA 4NBKA 3SXUB 4BFXA 3D4NA 1P3JA 1SKUA 3GLHB 3N8GA 5BVHA 3FM9A 2IIRA 1VJ1A 2YYYA 1ZOPA 3IBSA 2ZTMA 4L76A 3KCQA 2QMQA 1PNTA 2FLVA 2PX8A 3ZXSA 3VR4H 1EYZA 4UAVA 4MCAA 5FOUA 3GC6A 2OXIA 5A4JA 5LLTA 2VS1A 3CPSA 1N6RA 4Z7OB 1RCUA 3GEPA 1ZNQO 2R9VA 4DJTA 1V5FA 2Z2YA 2YN4A 2OB2A 3F90A 5DCWA 4FHEA 2P9FA 3AF1A 3B85A 4YRPA 5J2MA 3ABRB 4A16A 4IOAL 1GQOA 2B4QA 2O8FB 2WG0A 2OWDA 1YDWA 3HNRA 4WFBL 1P62B 1J53A 3CYMA 3NC4A 3SZ2A 4CCAA 4HDKB 2WIKA 2AK3A 3GWGA 4D74A 1F3OA 5EEHA 4PZAA 3TUJC 3Q8MA 1KAXA 1X9MA 5CB4B 2AFHB 5LYJF 4OXKA 2DLDA 3AVJA 4IHJF 2PR2A 3HMKA 4N5DA 2Q8PA 1VECA 1T2CA 3ZNOA 4UUOA 1C0GA 3UMSA 5HRAA 1YGPA 3A2NA 3U61B 1BOTO 1UCFA 3M6AA 3H1EA 2I66A 3IAS6 5J2PA 3DLBA 2CWWA 1H5UA 4XW2A 3SQWA 2X40A 2VK8A 3AKCA 2ATCA 3B82A 3C1AA 4WXMA 3EODA 2YIJA 1ZA2A 4QFCA 4QNMA 1RXEA 3F98A 2H29A 4OH7A 3QBJA 2A0FA 4D79A 5IFKA 1WVIA 2HHJA 4B3MB 3W8NA 3JWIA 4J6FA 1Z08A 3D7MA 1LFDB 1XZQA 3R7DA 3U7EB 4F92B 1MVLA 3ZXYA 2IELA 4QDXA 3CF0A 2PKQO 1WCIA 3PUIA 1AF7A 3W9UA 4EW6A 1BMQA 1LSSA 2GLUA 3KAKA 5HZMA 5BRHA 5DHRA 3L4BC 3SNKA 4CBWA 5JSYA 2VDLB 1YR2A 1N1MA 4E15A 4RK7A 4ND8A 1YMQA 2EERA 1K08A 3A9RA 3LGAA 1I3LA 1E3EA 3ONDA 4M86A 2Z1IA 1VMEA 4CU2A 2VZLA 4WKOA 1D2HA 1G1AA 3NBXX 3I0SA 3LDNA 3STUA 4HZUB 3ZXUB 2DXIA 1TYDE 4ETNA 4LFBK 4O5AA 3ETNA 1M0EA 2POQX 5IAJA 4EZ9A 2V9ZA 3MTAA 5G0SA 1KI6B 1EO1A 3M1AA 2XB8A 5FTWA 3FW1A 4ZVQA 3WDLA 3I5XA 4P81A 4DLZA 3HN7A 2AA4A 4M60A 2WJPA 5EXPA 1C7QA 1XVAA 4YAFA 1P2VA 2HCBA 4UBIA 3W8EA 4E7LA 2DWOA 4GPBA 4Q37A 5HZKA 1XEAA 2FB9A 2ZUUA 2H2HA 2C1EA 3I1IA 1U9JA 3FZEA 3R40A 2A9VA 3A0UA 3UGQA 4B82A 1GV0A 4DTOA 1FMTA 1FFCA 1ZM4A 3COSA 4URFA 3FWPA 5CURA 3GFPA 1VL1A 1HLDA 4AJLA 1GDTA 5EZYB 4EW3A 3I9V6 1T2EA 1R0LA 4KFTA 2GEUA 3HCFA 4E0DA 1MG0A 1WW3A 1P45A 3LP3A 1I4LD 1UT8A 2QEQA 3BIOA 3L84A 1M5TA 4K5QA 4QHYA 3WLOA 2RB4A 3F5FA 1DKRA 1Z4NA 2CHUA 2YNIA 4I1UA 1G8FA 2I6UA 5TPWA 1A04A 3ZE9A 4QFBA 3O2NA 5LOVA 1M90O 3F7TA 3IEIA 4DIMA 2FE4A 2I9KA 5BSVA 5TMPA 1P4HA 2UVPB 3A1SA 2ANBA 3E9DA 2B1JA 4S1VA 3IMXA 1K8RA 2GBLC 4HAZA 1ZBUA 4AHUA 2H7XA 1L5LA 4YY3B 2P9GA 5AK4A 3U19A 2FW9A 3NASA 3SX4A 1MJNA 3QFFA 1AKRA 3KWLA 1ZJ6A 1JDPA 1XNQB 3QFPA 1QGAA 1RLUA 4JJAA 3H04A 1QSYA 2W6CX 4EENA 3A9UA 5LQJA 4M7PA 1C30A 3LOUA 3QKWA 4EYOA 3DC2A 3LWDA 4ZEWA 4ID1A 2ERCA 4WOBA 5CYOA 3D8SA 2VUTA 1WSBA 4HJXA 3UJHA 2ZTUA 3QLVA 1WSIA 2XBLA 4K40A 2J0UA 2XHBA 4PUOA 3AZQA 3MDQA 1F1BA 3Q2OA 5C1OA 2GAFA 2OK8A 2IU4A 3G8CA 1Z06A 1BL3A 4ZHQB 4J0IA 1F9AA 2ZRDA 4NDNE 2DQKA 3HT3A 3R3VA 5DMRA 2RG1A 5FAXA 4BGVA 3FTEA 4CKWA 2XRFA 1XKXA 2YY7A 2FDRA 3ZCQA 2CV1A 3G0IA 1YK0A 4CIYA 4M1KA 1EWTA 2P7IA 3PNVA 2W43A 3WQSB 1V9LA 5AZJB 3VU1A 2PTGA 1A2KC 1A9TA 4J2TA 4XEUA 5AW7A 3RIEA 4TWBA 5H59A 2Z6VA 1W9HA 2O2EA 5BQPA 3GUZA 3GUVA 4B85A 1TUYA 1L8QA 2EFHB 4TKZA 4NC9A 3AGPA 1IHDA 3KK3A 4FN4A 4NJMA 5EJ2A 4M1WA 3WMXA 5EJ6A 4PS1A 4DJ5X 2G8HA 2VA8A 1FNNA 4E4TA 1BX3A 1FYVA 1UKZA 2RHRA 4JEMA 1IH7A 4K9RA 4LG1A 2EGHA 3GBVA 4S1OA 3ZCVA 1H1TA 4KQHA 3PUJA 5K9ZA 1ZO8A 3V9SA 1VCNA 2FPMA 1XN4A 3IDOA 4EFKA 2UYTA 4UZEA 4O5BA 4CMGA 3FNHA 5KDOA 1JQ3A 2QKYA 1T3TA 2WSYB 4G0QA 3TLJA 4A1FA 4KB0A 2ZRQA 4AD8A 3D3QA 3VZQA 3DDHA 4KBYA 1VM6A 1ZFNA 5KSPA 3M6IA 4C1BA 1XAJA 2HWUA 2YFYA 1O9GA 3PF9A 4KH6A 1JMVA 2DQ4A 2DUNA 1YDHA 4HEQA 5ENVA 3RRGA 2JLBA 4QG3A 3H11A 3STHA 4EB6A 4IINA 2LTAA 4RSRA 1O8BA 1JPNA 3LTEA 3A7DA 1L9XA 3U9ZA 4I2VA 4DC1A 2O4UX 4KN5A 1PZHA 4GI2A 1N2JA 4YCMA 1IUPA 4OU5A 4AW9A 3LLMA 4UREA 3AWDA 5JJCA 1B8PA 4GICA 1Q7TA 1BN7A 4WE3A 1IM8A 4MQBA 2XYPA 1ZJJA 3GHHA 4M3UA 1M8PA 3E9RA 3QHQA 4GOXA 3UWOA 1FNMA 1L4BA 3FHCB 3R44A 3DG9A 2X8AA 4PC7A 5TVGA 2X0NA 1B73A 2YWHA 3DL0A 4YXFA 1QO0A 3GJ5A 3EGXB 3WAKA 1N57A 1PDWA 4TS1A 5H9WA 4BLWA 3FOZA 4G0VA 2FPRA 4F1KA 1QFXA 2EYQA 3MERA 2X2FA 1VMAA 1CUHA 1U3CA 5K4AA 2I2XB 1KI6A 3T19A 2YY6A 3RYFA 2F17A 4JEIA 3RS4A 2H1OA 3KEMA 1H3NA 4BR2A 4UMEA 3F0TA 1N1EA 4DSKA 4MYDA 1HKUA 3CW8X 2ZULA 4RQBA 1YFKA 2QM1A 4IO0A 2HHUA 4PYIA 2ZF5O 3DEIA 3F6YA 1JJ2M 3O4RA 3MGBA 4JEPA 4QS8A 2PZMA 2HLHA 3I6ZA 3PSAA 4TT3A 2JD1A 5FR2A 4DLTA 1YR3A 4EI9A 5AVUA 4AQYB 1Q3TA 1F4VA 3E01A 1N34B 2H3GX 2ZI4A 1X14A 2Y0EA 3QVGA 4TYNA 3E05A 4HX2A 1P29A 4KH1A 4YJKA 3RVQA 4B3MK 3NV7A 3EZYA 4MUHA 3VVCA 4P2BA 4QOEA 4DY6A 3KD5E 4FYDA 4FO0A 5J1TB 4X3OA 4PCUA 3SHWA 4ALIA 4M1QA 4X0EA 2AJ8A 3PUKA 4UE6A 1NRIA 5C2DA 1ZBHA 2PBRA 4G1UC 4H0PA 4CEQA 1I2ZA 1W0CA 4RX1A 4E5KA 1E3QA 4K6KA 4K9OA 4UE2A 4RW6A 1WBDA 1FS5A 2Z1DA 5IH7A 1I7LA 3O3FA 4B9UA 2C5EA 4AN0A 1IULA 4BVBA 2JD2A 2WBLC 4MTCA 3VPHA 4HGYA 2OPRA 1I0ZA 3I83A 1W0JD 3K5HA 4K3UA 2IYOA 2WWGA 4LJ8A 3CLRD 5IKEA 1II0A 1QVWA 3HKDA 2BLNA 1TMOA 5I4CA 4WRRA 1U2PA 1E1LA 1P3Y1 1HH4A 1RM4A 1SOUA 2QXYA 1TU4A 2P4HX 2Y2UA 5DXJA 4YPVA 2C8VA 4E46A 5JASA 5HNKA 2JBAB 1V5WA 4RSMA 4L27A 3V4FA 2EARA 1KQSM 2GEDA 1A5XA 3HRHA 3QVMA 4OHZA 4RM3A 4PHFA 2P9KB 4MWTA 3RAJA 5AQFA 1GPAA 4RESA 1ZDMA 4ZALA 4JJ7A 2Y9MB 2EBHX 1VQ9N 3T9BA 3LDOA 5EJEA 1SHZA 3NYRA 3OE7A 2XE7A 1OLSB 3WLPA 4NZNA 4WAUA 5EL0A 2C8JA 5F33A 4AICA 3VOSA 4CL3A 4G8DA 1G0OA 3IESA 2XKJE 3T9CA 1QH1B 3EIXA 3N28A 2R7NA 4HWTA 5JECA 4ISCA 2AX4A 4KO1S 3UT5B 3RAEC 1TJ5A 2EQBA 3KYJB 4IJ5A 4CEAA 4GNIA 1FFSA 3H9QA 3M4XA 4ZPJA 3NHPA 2HNYA 4QHTA 4WL0A 5DDIP 3CLTD 2XHEA 5HBRA 2DMRA 5B8HA 1QR2A 3HVJA 3SBGA 5REQA 1YT5A 1IHUA 3AFHA 2F55A 3VHXA 3L3UA 1G9XA 5TQVA 4HQFA 3IPYA 1M10A 3C14C 3RW9A 2JGRA 4EQ6B 4ETIA 3DLGA 1WSEA 4CZLA 4NXNK 4G01B 1L5HA 4HXYA 1FDSA 1QVZA 2CBXA 2CFIA 4N5HX 4P3NA 4ZAVA 3CONA 3I9MA 4IX9A 3LE8A 2B1QA 1CFJA 4GAEA 5JSUA 1YZUA 2J3LA 4WZAB 5J2NA 4LYHA 1NJXA 4X6YA 5BUQA 4I3GA 1NHGA 5M1OA 1BIFA 4QECA 1HOXA 5IDYA 4QZVA 2D0CA 4K05A 4CIEA 1YBHA 2Z8ZA 4F6CA 4R1OA 3CEMA 1UPUA 4J75A 2NU6B 5AI6A 2BMJA 3IHKA 3L6DA 2C5GA 3L0QA 4BE0A 2GEFA 4TLEA 4CQLB 2A7QA 5GOTA 4R71A 4AHCA 4FLZA 2ZTLA 3KEGA 3CZ4A 3IUQA 4AH9A 2HF4A 2D54A 2QNBA 5I9SA 4B9AA 2DFNA 2JGFA 5AUQA 1XTIA 4J1NA 4V0QA 4ZJZA 4BLUA 3TQOA 3J8AA 1DIRA 1JL1A 5GIPA 3O9MA 1LWOA 3LALA 2QKBA 1V8ZA 4MIKA 5AJHA 2DCMA 5BW6B 2GOYA 2QEXN 1PCXA 2QPLA 3UN1A 3WVNA 5TY0A 2X19A 4IGEA 1IOWA 4ZVUA 2CFTA 2IZ7A 5JDIA 2FKNA 1FNCA 4Q9DA 3WNCA 2ZIVB 3OU6A 4A8PA 4EG1A 5INTA 3EVEA 3EA4A 3A2LA 3TABA 2O5VA 2YV1A 1Z6TA 4PPGA 3C7NB 1GTL1 1YU6A 3BA6A 4BNHA 3ETLA 3UW1A 4CJVA 5KCZA 1T5OA 3A58B 3SQ1A 3P9NA 1XK7A 4ERXA 4RHTA 2ZB4A 1G7SA 3BDVA 2OZEA 5JD3A 3I61A 2I99A 4FPXA 3LKDA 4EKGA 3MC1A 3MFYA 1CT9A 1L4KA 1Z7EA 4DNFA 3I62A 2BKEA 4ZO7A 2R4QA 3I5MA 2ZQ5A 3Q7RA 2DQZA 3FVTA 3A32A 5G40A 4H18A 3AVHA 1PTJC 4X95A 5FPQA 3QESA 1DWPA 3QWAA 4WQ4C 3DEAA 1V6AA 3FBGA 3IVXA 3SC3A 3VSCA 3CUUA 3AILA 4G4GA 2ZYAA 4WLFA 2AQKA 2XPCA 3R7BA 2X1MA 1XTVA 2N42A 3BD7A 4KQMA 3GDQA 2IUTA 5DTQA 1C0EA 3DAPA 3OP4A 1VRVA 2ODWA 2OT3B 3F9RA 3G2HA 4FGWA 5TIIA 2DWPA 3L07A 3MT7A 4QTUB 2GTPA 2A3ZA 1SOAA 3VYRB 1NW8A 4HH4A 2ABWA 5G02A 1K0UA 2UUPA 4V0NA 3BCSA 1AGNA 4TTAA 2D1RA 3QE3A 1NK7A 2ZCUA 3ND9A 3GAFA 1CZHA 2DY1A 3H2GA 1Q8IA 1N6LA 3I1JA 1HNZB 3R5SA 3SBEA 2I8CA 2A5XA 4GOKA 2Q4OA 1N0IA 2GHTA 4OATA 4M8KA 3T1YB 4G8JA 3AVXA 4X7RA 3NCHA 5AUPB 3PQ7A 3DFMA 2GM4A 4DU3A 5C8VA 5PNTA 3DE7X 3PFNA 1V3UA 2ST1A 3ZSZA 3KD3A 3WGKA 1UQRA 1V4BA 5HTOA 4ZC1A 4EY4A 3L8YA 5F4ZA 2DYKA 1PYGA 1Y8RA 3OIGA 1KU6A 1IMOA 1EVYA 3A1TA 2G25A 1MB9A 4BJ1A 5E38A 1ZIXA 2IHTA 3ZTYA 2IF0A 3FSEA 3KWFA 4S0XA 1XTUA 4ID3A 4PC2A 1SBTA 1W0KA 2BMFA 4C0QC 1S2LA 2AV6A 3CF6R 2GLTA 4BFZA 5DHTA 3H2SA 3V46A 4C04A 1GGEA 4MO4A 3EDOA 4ISFA 1JDBB 1M73E 3R7WA 5IZCC 4GEKA 4B3RK 4DR3K 2EJUA 4WH0A 4V0RA 5BR9A 1IZ9A 3FYUC 4YDSA 4CMAA 2F43A 1IONA 1IXKA 1J99A 1JA1A 3FWZA 3K6KA 3LDGA 1ODKA 4KDEA 2HSWA 3LP2A 5HFNA 2C4KA 2PT7A 3FTPA 3SSOA 3AQIA 4H17A 1KZ7B 4C4ZA 4FEEA 4UMVA 4MA5A 5KMGB 3U17A 4DFDA 3QZUA 4RHXA 2C2KA 3AVNA 1R12A 3KVYA 1R15A 3SK3A 2G4LA 5BR4A 2OVFA 3LI2A 1P6UA 4MRNA 3BFJA 5KSOA 3DKRA 2ZIXB 1CFZA 1CQXA 2YHYA 2WJAA 5D7BA 1F0KA 1XP8A 4YS6A 3C3MA 4QLAA 2HHTA 3IA2A 5IS2A 3TVYA 1K6XA 4FZJA 1FF9A 1I4WA 3R3ZA 3E9ZA 1NQAO 3BMNB 5AQGA 4RWTA 1RAGA 3C7KA 4QYSA 3ZHYA 4B74A 4U2KA 1MABA 2JIQA 3OJCA 4QQKA 4OK6A 4A26A 2IXFA 3SJ7A 5E1MA 4JNEA 1QCDA 4NQRA 1OSNA 2X15A 4JB0A 3X43A 1BXZA 1WDMA 2GYUA 1TOAA 3DNPA 3DZKA 4BNJA 2AKAB 5AD1A 3A8TA 1VCMA 3MGGA 5FIUA 3EHDA 1HZJA 1Q44A 3GRVA 3VTAA 1UC5B 4Y2JA 1JXMA 1I6LA 5JJBA 2TMGA 1ZCJA 4TTIA 1HORA 3QFTA 5EJ7A 1JFVA 3DDOA 3DZBA 5JI3E 2PUAA 4NB4A 4LRTB 2D2VA 4HMQA 4FYVA 1DIGA 1V16B 1D2CA 4YBRA 1FQOA 1K66A 1W44A 2VF8A 5LMUK 1DJOA 2K2WA 4OB8A 1ISRA 3DMRA 3ON5A 2M1ZA 4WCDA 1H8EA 1Z35A 4WJKB 1MB4A 4YOYA 5AVYA 4OFBA 5THQA 3BXXA 1XAHA 2QMYA 3GGOA 3H2KA 1C4WA 1HL3A 1ORDA 3O3CA 2HU8A 4GBGA 5AQEA 2IF2A 3GEGA 4G86A 4MKIA 4ZXPA 5SY6A 1WZUA 3ZI0A 1C7FA 3HUTA 1AHNA 3ED5A 3TVTA 4AY5A 1GCAA 3IFSA 4KPGA 4XSHA 4LF9K 2RJ3A 3HB9A 1GQQA 1VLLA 2E89A 1D4OA 1QHAA 2UVQA 1EP4A 4G9GA 1VFNA 3QYJA 1O94C 1YBFA 1K4MA 2RHLA 5E9AA 3AM4A 1JBEA 2RHJA 1VYHA 2F3UA 4MW7A 2MSCB 4XUDA 4XRGA 4I4LA 5FFNA 3C5EA 5H70A 5K3OA 3BSFA 1JPJA 1ULUA 4WQMA 5CYGA 4K1XA 4HLDA 4PQFA 4NX2A 4X60A 1Y7TA 1BAPA 1ZSVA 3ZHTA 4I9LA 2CFOA 3BXPA 4UVHA 4Q39A 4Z53A 3TTDA 4LCEA 1LTHR 4F3NA 3H0EA 3H3JA 1FZQA 1I7QB 2D0AA 1YZKA 2ZSKA 1QQOA 3VGLA 1J22A 2GSDA 1VTKA 2I4LA 3FOAA 4FC6A 1Z33A 3IGFA 4JJ4A 3UKJA 4D3XA 5K6TA 4JBIA 5AXCA 2GEMA 4L72A 3CRNA 3JYLA 2YXNA 2OZVA 4NS1A 1HE2A 1NGDA 4RF4A 3NMUA 1UBLS 2FEOA 4JLWA 3ZX5A 1VPLA 3VGKA 2CHEA 2IDJA 1VSHA 3GFQA 3IEUA 3TSOA 5HIKA 4ITRC 2WYWA 1V1MA 2PBLA 4JMPA 3TNJA 1JLMA 3LXRA 5KQSA 1IMJA 2B30A 1GUDA 1LPOA 3MWKA 2C98A 3Q3VA 4X64K 3H1AA 4Q1AA 4C0AC 3ZW8A 4TXJA 2Z6AA 4CMJA 4GOOD 3HV0A 3L6OO 1R9JA 1TMYA 1U5BA 1PFVA 1TF5A 8ATCA 1FYWA 1L5MA 1PZFA 1VQ5N 3PUFA 3KVNA 2AJLI 1KMQA 4AILC 1NUTA 4FZVA 4IOMA 1ZYQA 4KTVE 2ZSIA 5BW4A 1IWOA 4E94A 2QW8A 2H8GA 3Q2IA 2QTZA 4LJLA 1HYSA 1SQ0A 1K6MA 2ZE6A 3E7FA 1KDPA 3N8DA 3QJGA 4G0YA 4ALMA 3ZSYA 3VPCA 4ND7A 2H00A 5AVWA 1XGKA 1EVIA 6GPBA 4F4HA 4BJ6A 3KL4A 3K8OE 1A27A 4E5MA 1GPWB 1Q50A 1RKQA 1UZMA 2QAGC 1E9EA 4OX9Y 2JIOA 3VF4A 3OZRA 1S8FA 3ZX0A 1FX0A 4Y2YA 5CJJA 1LPAB 3NV9A 1TXGA 5DB4A 4XQ9A 5ADXH 3J7ZO 1WQ3A 2BV3A 1BXRA 3JU3A 3ANSA 4MYCA 1F17A 5LDHA 1ZD2P 2HWKA 3QLVC 1I5OA 1OI7A 1WB6A 2MSWA 1PJZA 3HCAA 3HABA 4KI0A 4Q18A 5DP2A 2TS1A 2F67A 1R5JA 4RTSA 4DR5B 4IKFA 1NW4A 3BERA 2Q5CA 1BW9A 3RU7A 1MAHA 3ZS9A 3HI0A 1ZIDA 2ZDHA 4GDFA 1EFRA 2AN3A 2AFIA 4YN3A 5HWSA 2XGGA 3LQKA 2MSKA 2Z9BA 2JA2A 2RONA 4RCZA 4TPKA 3G2LA 5AI5A 3MPUA 1WLJA 1Y48E 3EKSA 4HLNA 2OCAA 3HGQA 3U7FB 1FP4A 3UB4A 1YIOA 1F9EA 2W22A 3MK6A 5AQJA 3O82A 4GZ3A 4IV5A 3X1WA 3L49A 1R6TA 4RSHA 4UUBA 3DLRA 1H05A 1P9LA 2IIQA 4HO1X 3LM8A 3Q5EA 3MWYW 1WHTB 1Q22A 1RTIA 3QEPA 2ZAMA 5HF5A 4ZIRA 3QERA 1NJSA 2QRVA 4NR0A 3PCTA 4EMSA 4LRYA 1EJBA 3BE4A 3QBVA 1SQSA 1MOPA 1SZPA 2BTEA 3VR4D 4C1NA 1YS4A 1LC0A 2FU5C 2C7QA 1NXOA 4C0WA 4YCSA 2JCXA 1KZHA 4FCWA 5CFPA 5IT0A 1SNYA 2A57A 2ZWVA 4JD5A 4EKIA 3KQUA 4YRJA 3EWSA 2V74B 3H9BA 3QF4B 4RKRA 5KU1A 4H35A 1YL7A 2P9PB 2YR0A 1ISIA 4ZO6A 5TF4A 2OBYA 2ZI5A 3WG9A 4EA9A 3FFAA 1UWBA 1B8OA 3P1GA 3EGIA 3MT0A 4ZT4A 4TRMA 4CL8A 4K3VA 3GGJA 3SYNA 3FFWA 1KEWA 1VB3A 2O5CA 1CXZA 3LBFA 4NFHA 3WNEA 2CD7A 4ZOEA 4ADSG 1AUXA 2WAAA 4IF6A 4BE2A 2QMZA 5EN4A 2BGUA 3LBYA 5TT1A 2HRDA 3HYCA 4INOA 1WMDA 3L8ZA 5FUBA 3U1BA 1JIQA 4Y6PA 1G5IA 1TEVA 1X7ZA 2C58A 2QTHA 2FOIA 2G1PA 3GELA 5KJFA 2ZRIA 5H3HA 4QWMA 5D3GA 4NS4A 4Q34A 3LPNA 2YWFA 3O9QA 3DXYA 521PA 2FN7A 3AGRA 4DMCA 1KP9A 2QR5A 3VTKA 2Q46A 2P7HA 2WM9B 3CC2N 2BY4A 4XB6B 3AVWA 4M0KA 4YASA 1ICIA 3OZXA 4FK8A 5DF1A 2C2HA 3AIIA 1MC8A 1P0FA 4O0LA 4OAQA 4NZ9A 4NEHB 4CTOA 5JZSA 1AS3A 2H4XA 2OC9A 3MNFA 3FKSD 2C42A 5JZVA 2FRDA 3O3MB 1XK6A 6REQA 3EGWA 4KQ2A 5ES4B 4DR2K 1PZXA 1ZD4A 1OT5A 1ZOSA 2HLNA 3CB2A 3O3NB 3OPVA 3V1QA 4K8ZA 2ZYDA 4AYWA 4BEJA 3TFOA 5BMOA 4U63A 3IAS1 3AUSA 3L5OA 1OCEA 7ADHA 4RY8A 1TM3E 4YR9A 5LP1A 4Y67A 2F3PA 5M3BA 2O8VA 1U8AA 4LZWA 3RRBA 3EJWA 1TEZA 3MQ4A 2E5LK 1ESDA 9ABPA 1UDBA 4DR1B 2PBFA 1D09A 2CMGA 4O4LA 2FP4B 2PS3A 1J8YF 3UJPA 4R3WA 2Q62A 3QXCA 4BRAA 2RE2A 4NY1A 3SOZA 2DG2A 3TSAA 3LY9A 1CD5A 2IYNA 3OYGA 3ZW7A 3IFRA 4YX9A 4PW0A 2UVPA 2X7JA 3NDJA 2HI0A 2HKIA 4FOPA 3WFIA 2P91A 4ENSA 1VLHA 1WQ1R 4BU0A 4E1VA 4Q93A 4S24A 3TPFA 1NJIO 1AQNA 4ILJA 1JA0A 5DYWA 1C14A 3LQRA 1I2BA 1DP4A 1IAVA 3DV0A 1UADA 1A8PA 3J7TA 2A0WA 2J3IA 1U0EA 4KWIA 4US1R 3S6JA 4YRZA 5KYVA 1E5XA 2OA8A 2BEJA 3L4EA 3SF8B 2LCQA 1T36B 3F67A 3VRHA 2ZRFA 3OYIA 2A58A 3R7WB 3SCXA 1S7CA 3INRA 1Q0HA 1DI0A 1EIZA 1V6CA 2HUPA 3AHIA 3OYLA 3JQAB 3K0EA 3GARA 4H3HB 1HE1C 5HK9A 2CNWA 2YW2A 3FVVA 2Q3HA 2XTAA 5A4KA 1GOTA 4D82A 2HPZA 3EF1A 2HSTA 3KHSA 1NP3A 4WK0B 3QVVA 3BIFA 1JCEA 4EAHD 2QAIA 5B58C 1FTWA 3UC9A 5AFUH 2NPIA 1KL7A 3R0VA 3ZUGA 1U2VA 3J80O 2QQ0A 2ZI9A 3RS9A 3ORFA 3T0FA 4HXEB 3MECA 4RUKA 1YZHA 3MAJA 1Y0BA 5IG2A 2X9GA 2VZEA 3ADBA 4AHTA 5IBCA 4ZVNA 3AL2A 3S7TA 1GD1O 3L0IB 4K42A 1RHUA 2DBRA 3W79A 4TWRA 4EZIA 3FJOA 4DSEA 2FF5A 1KFDA 4M38A 4E2ZA 2FZWA 4JBWA 3WGJA 4RV4A 4UDOA 3VR2A 1X9WA 4EMBA 1GCOA 4IFIA 4MITA 1CVRA 4I2NA 4XH1A 1PEKE 1Q1QA 2CN1A 2YMQA 1CX9B 1LV8A 1W0KD 2VZ9A 2E1YA 4DHWA 5JAMA 2XMQA 5K0GA 2CWDA 2OGTA 1YJ8A 3BD9A 3H0KA 5UKDA 4BC0A 4NAVA 4KI7A 4GV6A 1T6NA 3PNOA 1G38A 4PO9A 1Z6QA 1YJQA 1QE0A 2CFSA 2KPOA 3C4VA 1XRRA 1MJGM 3RM3A 4OPKA 1U98A 1U8YA 1G7CA 4FNAA 1TCAA 4QGHA 2ONYA 1Z36A 4HEA6 4XUCA 1ECGA 4FYPA 1RRGA 1T5BA 4H1UA 4HHEA 3I45A 3KZBA 1O95D 1J9AA 2P2SA 4HUQB 4QQFA 7ABPA 1BOOA 2HK6A 1QF6A 1B2LA 1B6SA 3NG1A 4IXWA 5EKDA 4YK7A 2OV1A 3P9IA 4Y2SA 4HUFA 1IJFA 3M5CA 4C23A 3RR8A 4EFNA 3BRSA 2NO7A 3I2FA 2XSZD 1ZYUA 2GBIA 4Q3OA 3NEJA 1NVBA 1ZHHA 4N6NA 4QELA 4IDOA 1VYTA 3LQ1A 4MRPA 1WUJS 4EYKA 2HSGA 1X9HA 4QQNA 4AS2A 3GYBA 2VBFA 3WK5A 4BPRA 4WFKA 2ZUEA 4B3TB 4Z0HO 3E84A 4ZQGA 1L7BA 1L5KA 3V2UA 2NAPA 1Z82A 5EKTA 1SL0A 2WV9A 3N2KA 2HUNA 4FFBA 3GA7A 1CP3A 3AL3A 3BD8A 4OLAA 4NNJA 3NHGA 3TTVA 2GJ9A 3UT0A 4P4NA 1AQJA 3I01M 2CXUA 5LC1A 2W58A 4G8CA 4AQYK 3V1KA 2PZ8A 4PYNA 4HR7A 4UNPA 3H86A 5D85A 1UXJA 1VBKA 3W0LB 4ANFA 2A41A 3R23A 1NBIA 4LNUA 3I6MA 3AWIA 4JT2A 4XCVA 3DPUA 1U2RA 3NAZA 4FSDA 1JQ5A 1LCIA 1QDUA 4XWGA 4D56A 4EHJA 1XJ0A 3AEQA 1SG0A 3RKUA 4C0XA 4CW7B 1JQBA 1N0WA 4TKLA 5IX8A 4RZSA 1AJEA 2OGSA 1YZTA 3SC6A 5AKYA 1BH2A 4P2GA 5IJ0A 1MEEA 3KVOA 1ZGAA 1H8ED 1I94B 3SQ2A 4Z7QB 3W90A 1KC8O 5KX5B 2YS6A 4DV0B 1ESNA 1ONBA 2VHEA 3BCRA 5H9VA 5ITZB 5EC8A 4IRMA 2HSJA 2HPHA 2Z0MA 1NY6A 1WNFA 2WU0A 4DLVA 4DQ0A 1IFXA 1QNFA 4AKEA 1QK4A 5DGTA 1Q1EA 4YJ3A 1CJKC 5K0ZA 5MF6A 2P9LB 1VQON 2V7WA 1XNJA 3CF2A 4YO8A 4DR1K 4HYYA 4M0FA 5EWJB 2VTBB 1VDZA 3R5HA 3WOVA 3UPTA 4CFAA 3O7MA 3QENA 3BE6A 3DRRA 4DB4A 2QBYB 2BLLA 1N8KA 1OX6A 1Z56C 2BRUC 2I6XA 2V6MA 2OMEA 2VPWA 4QYTA 1GCGA 5HIJA 2IYQA 4Q9IA 3DAHA 2QLNA 3NVMB 1XO1A 4C0SA 4KHNA 1RCTE 1MQ8B 1TU3A 1SG9A 2BL4A 2XYHA 2QYTA 3FCOA 4P34A 5EGSA 3VVLA 5LZ2A 1YF5L 1AOXA 2NTYC 2ZIEA 3OJXA 3ZEUA 1T4CA 4Q15A 2FWBA 3PC2A 1D2MA 1LVUA 3A6ZA 4TOIA 4TT8A 2QY6A 3UFXA 4IZ9A 1P90A 3TPQA 1YJNN 4LWPA 2PCLA 2XRMA 1W6RA 2QVXX 5U9CA 2FZLA 2EX1A 4GP7A 5ALNA 2R8EA 3T5BA 5JYEA 2PGDA 2IUUA 4DKXA 5AK5A 4YT4A 5CFOA 4V2IA 4OREX 2QN6A 1LPNA 1OXVA 2I3DA 3H4MA 3R2JA 4FFWA 3OVMA 5ERGB 3NHSA 3U7QB 1MC1A 3KVRA 1W1UA 3NKLA 4MA0A 1H2FA 2C29D 3BDAA 7GPBA 1JLLA 4HBGA 1BXKA 4R1MA 4BLVA 4RIIA 1BC5A 4HAYA 3GNSA 4EFHA 1KVAA 3TW8A 5AVJA 1PQYA 1VKZA 5AJ3K 1M1NA 1DC8A 1M34E 3CGGA 1U0TA 2HZ7A 1YVRA 3M6UA 2PR7A 3BKXA 4TZ6A 3KJFA 2FE1A 4OTZA 2AA3A 4AROA 2QTVB 1F06A 3F6BX 3M2PA 4B9QA 2F9LA 2X6NA 3IURA 2VYVD 4RJKA 2JLVA 3JQ6A 1SCNE 4KVZA 5A05A 3IUBA 1GNLA 3V1YA 1SU6A 3BF8A 3SIPA 4P98A 1C9NA 4LZZA 4MP6A 1WOYA 3HACA 2FAXA 4HAIA 4LY0A 1QQNA 4D8TA 2P8SA 1U1FA 1JTFA 3EQ2A 1I39A 3EXEB 3UYKA 4DE5A 5B4TA 2JVJA 1EXVA 3GMSA 1A4UA 3D7EO 5J47A 3P8ZA 1XWWA 4ZI7F 1DZ3A 4NBWA 2HBZA 3ETGA 5H1YA 3MN1A 3TTWA 3GRAA 3PK0A 2DJIA 4DV1B 2W2PA 3OJUA 4FT2A 1Y3HA 3LWZA 1NUPA 5BVGB 1QH0A 3JASA 3A70A 3I2JA 2JCVA 3KYDB 1G3RA 5DNCA 4UU1A 4IWNA 1ZBIA 1NP7A 1OXXK 5EJGA 3IEVA 5FOWA 2JI7A 3AP1A 1XL1A 2Y6VA 4EG6A 4HWKA 3L2QA 1FTNA 1YQGA 4KGVA 4IRUB 1W49A 4BQZA 4OJTA 1IDOA 1XTPA 3NS7A 4DTUA 2A9RA 2DHRA 1C7ZA 3GIWA 3MIIA 2IEGA 4U9IS 1GG9A 2CBZA 5F2NA 1P7ZA 1P2DA 2J9XB 1UA0A 4MCJA 1NLUA 4FKMA 5KOHB 1U2ZA 3VO1A 1GAJA 1UANA 1RS0A 4PTYA 1DQYA 3I8DA 2FQYA 4YIHA 2Y1FA 4MPDA 5DMHA 2EHDA 3KELA 4NH4A 1HQEA 3FPBA 4NLCA 2WM8A 2EW8A 4BFCA 4IMPA 3MHTA 4CJQA 1FSFA 1L7VC 2O3RA 3K1TA 3QE4A 4UASA 5IVPA 3H2BA 1NSFA 5HG0A 3KQYA 2PGXA 2F9FA 5KTSA 3Q3JB 1DCFA 2JIDA 3UKUA 2CB9A 1QCZA 3RD5A 3U2QA 1BVYF 3AA4A 3VFDA 4GXNA 2QQ5A 2CW5A 3S3MA 3OE1A 4G5YA 2FSIA 3OTQA 1OXTA 3CLRC 4PAGA 1RGIA 3I30X 1HTBA 4DBZA 4F3KA 1N8TA 1I2CA 4W9RA 1E8MA 4Z54A 1AXGA 1BKSB 2ZB3A 4TM8A 5BN4A 1ZCAA 3UGJA 3A3PA 3G9QA 3G8BA 4TVSA 5K2OA 4JBXA 4JX8A 5CHIA 1Q2UA 1RYMA 4L6AA 3H11B 2IHKA 1SJ9A 3QVWA 4Z2AA 5EU7A 4QEZA 1C1BA 5HROA 1NUSA 4A10A 5LPNA 2E2OA 1JEEA 1MH9A 4R5MA 4B9LA 4JKHA 3WAGA 1TADA 5JSKA 3T3IA 3W3DA 1OFGA 1SBIA 4OGGA 1QKJA 3FOBA 2B83A 5WRFA 4BNUA 2CSXA 4NBVA 1GEGA 4X97A 1FLVA 4V0ME 4EZEA 3MEEA 4K9MA 1RKVA 2FZVA 3GAAA 4MAFA 2XTJA 1EIWA 1JNXX 2XDQB 3NZEA 3MUEA 2WJ6A 4DAOA 4ID5A 2FJUA 1NUAA 2ZYVX 3H05A 3LX4A 5C1DA 1XA3A 2JJ8A 1C81A 1N3IA 1OBOA 2CHQA 2I80A 2VDMB 2XWPA 1XMPA 3EB9A 2EP7A 5TXGA 3SMQA 4MI9A 2UZ0A 2XYQA 2XADA 3T3GA 3ZK7A 2GK6A 4EF6A 4ZYWA 3EX7C 4BRGA 3P2OA 1R6VA 2A14A 2X9QA 2BUAA 2XKKA 5F7JA 3IVGA 4REQB 4ZVSA 2BGWA 4F2SA 2Q6VA 4O1IA 4YOTA 1P77A 1VL6A 4OJKA 2VYFA 4QNRA 3U49A 1I5RA 4B4VA 4R1TA 1F0YA 1W4CA 5B1HA 4DQLA 5ALRA 1CP2A 4HWSA 1Z0JA 3GF4A 4PZYA 4HH3C 5E0OA 4WZ6A 4LNHA 2V6JA 3NYIA 2QA4N 3PNYA 3RVJA 1VE7A 1XZGA 4E51A 1Q0SA 2J0UB 4B3BA 5BP7A 5TKWA 5ALFA 5DNYB 4LHYA 5AQWA 5IN5A 1KO5A 4XQ0A 4IIEA 5ALJA 3W9YA 4YRAA 1SCQA 4DUPA 3U44B 3DHYA 1N32K 1VHWA 2UYHA 1EFHA 3VOVA 3K09C 2BGGA 1UBEA 1PKXA 4YNQA 3DTTA 3U7QA 1AHHA 3ZDZB 1ZD3A 1QC5B 2RAPA 3B1VA 2OAP1 5KEIA 3RVNA 2W40A 1QHGA 3D8UA 3RUEA 1M3SA 4B3JA 1L4YA 1UK8A 3A05A 1A5TA 3UZUA 3PZBA 1GPUA 1KSJA 3PUYA 1UZLA 2QGFA 3L4KA 5IT5A 3EF3A 4CV2A 2IY9A 3C8ZA 1UPAA 3IB3A 3LQQA 3R6WA 3DONA 3OCVA 3RJ5A 3PHIA 1TAUA 4O4LF 4NIMA 4MI6A 1ZKMA 2YVUA 4Z5XA 2VDWB 4Z4CA 4NPHA 1QQCA 4TMKA 3ONVA 4EGJA 4E12A 2TRSB 1VPDA 4RK0A 1EI9A 3HZ6A 4RKWA 3RS5A 1W5FA 1M75A 2WVGA 4DMFA 1RJ9B 3QPCA 1E63A 3CCJN 1RHMA 5KYUA 5HS6A 1OKKA 2X2EA 1C9KA 2O2GA 1FP7A 2RHMA 2NU7B 5A6SA 3ESQA 2Y77A 1MVNA 1R0BA 3DFKA 3I2IA 4J07A 4WACA 5KTYA 1I10A 3FPHA 1MU2A 1FTSA 2XTNA 3LHFA 5CGZA 2O0HA 3FVWA 3CZQA 3P0RA 3DL2A 2V4MA 3IHTA 3CQYA 1ZD1A 1UMCA 3PNPA 3Q8WA 5D5QA 3MJRA 4P5EA 3OM9A 3QLTA 4L2IA 4JI3B 5EGNA 3WA6A 3IP3A 5ITZA 1YZ3A 1JU3A 2VXYA 5GADl 1U0JA 5AR0A 1D2GA 4GD3Q 2SCUB 1U4SA 1WB9A 1X3SA 5KYGA 2WSLA 4GBMA 1DUSA 2FH5B 2FSNA 4PX3A 3K1AB 2EL7A 2IV7A 3RSCA 4X7PA 3KXDA 2UXBK 2EHJA 5LM3A 2XRIA 1KPGA 3AEQB 1L4EA 1U2GC 3JD3A 1B7GO 1MTZA 1YE8A 2ZBEA 3I2KA 5BYBA 3PFWO 5CY4A 2H0QA 1QUFA 3GRZA 5JS6A 4TWJA 4Q05A 3WK8A 1NKBA 4V3BA 1K8ZB 1HX1A 3H1GA 1YZQA 3W5CA 1UJ6A 1QO0D 3V1RA 3OZ7A 2W4IA 1L1EA 4DV6K 1TKAA 2HA0A 2WWIA 3ECSA 2JATA 4GYWA 3OM8A 4LY3A 5EIBD 2CXPA 2NO6A 3S1LA 3HFJA 4AY3A 5GM1A 5FAKA 4ZTZB 3TSQA 5AWFC 2CGLA 1JB1A 5FL3A 1RYNA 3LNTA 3ETDA 5B1DA 2ZJ8A 2VC2B 4U1RA 1T35A 2B21A 3ZY6A 2WLTA 4EGSA 3JWGA 4JK7A 4KX3A 3DCIA 4OQ4A 3ENNA 5H80A 4EGFA 4E19A 4GI7A 3PB3A 3EASA 3D2LA 4PGAA 4Q3BA 1G2PA 2ERXA 4MVJP 2KMLA 3A3YA 4XOUA 4ZCQA 3FCUB 4C8KA 1JKFA 1G21E 1L8AA 2CLDX 2WYIA 3VC2A 1E5TA 1UK7A 3PG5A 3SQNA 4LOIA 3A1FA 4MPPA 2VT2A 3GZTB 3PT9A 3TLCA 3PE6A 1NI5A 1UMDA 5J2UA 4AWBA 3IKMB 2NSYA 1TUBB 1S8OA 4MDBA 4CMBA 5C5EA 2A0UA 4M0EA 2HVHA 1QM5A 2IYXA 5SZHB 3B3QA 2FF3B 2IYFA 3DLEA 3A1NA 4GGMX 5BWCA 3WQQA 2YNMA 4NCGA 1OJ7A 4QOJA 4BNNA 4C89A 5B2EA 1NBAA 1RD4A 1FSGA 4IHJB 5LP6B 2O19A 3L0SA 3CT6A 4BQRA 4HRAA 2L82A 4E3WA 3H87A 3O3HA 2EFGA 3JAMO 3ISJA 4ID9A 3TZLA 3N8HA 1ZSYA 1FJ2A 1PS9A 1UJ5A 2J32A 1ZL0A 2ZVQX 3NHKA 3C85A 1U6JA 5FNVB 1VPEA 3OC0A 4JENA 3FNGA 4K6MA 4GZ6A 4PE5B 4X1OA 1IWBB 3FRHA 5AVOA 1G9TA 3WWOA 2GPYA 3S2FA 4V1CA 4DJJA 5IEJA 2FYTA 3K5NA 1XC3A 3GD5A 2GD2A 2ADFA 3ZV3A 4HVLA 2FFBA 5E6UB 5DXAA 3RC7A 5M2QA 1A5WA 1JAHA 1F2UA 3AY3A 1G20B 4HDCA 1TI7A 5HKLA 2G8NA 3BX1A 2EG9A 3U4IA 4WZAE 4QARA 4DIOA 1DEOA 3KKQA 4DQIA 4OO1J 3QK7A 2IH2A 1OFHA 6NULA 1T2NA 3BWXA 3OZEA 3Q5DA 2Q3MA 1GSAA 4YQFA 2YV0X 1X92A 4JITA 2GVDC 3UOGA 1VQ7N 2JDIA 1RXSA 3C5CA 3A26A 3GW8A 1EPUA 3LPDA 3RMCA 1OILA 1NGCA 2B5OA 2R96A 2ZJOA 1G5TA 1E2NA 1FXSA 2GZ3A 3QM1A 2NTEA 3SAJA 4AKTA 4C7KA 3QU4A 3DCNA 1IIBA 3L8BA 3FMOB 4ZP1A 2GHIA 2NU9A 1UZNA 2NVUA 2XUZA 3WE7A 1PWYE 3L8EA 3Q4GA 4PTLA 4UBJA 5GAHP 5HM8A 1BVUA 4BJHB 2IEBA 2HMTA 2P9ZA 4K9QA 5GV8A 1JSRA 4C7OA 2GX9A 1FFHA 1E99A 1QGYA 3GDHA 5AW6A 1PTKA 4FHFA 1XD2A 3KTDA 3MYRA 1Z74A 1VSMA 2RFLA 5EMJA 2FQQA 1WO8A 1BE8A 3WHPA 4EGAA 3BL5A 1AK1A 2GYVA 3IPRA 3G0OA 4AN4A 3GPIA 1E62A 2CXRA 3GVIA 4I1PA 4FNOA 1KJNA 1Z47A 2HNDA 3K5LA 1F8UA 1Z6YA 1PJAA 2C5BA 3D8RA 2BFMA 1CJBA 1VSUA 4LYAA 3EMVA 5ALEA 1AKQA 5DGHA 1C1HA 3E23A 2WQ7A 4BY9C 1DBVO 3V1NA 2XNSA 1KAQA 2E5LB 1EK6A 2LCIA 3SPZA 3M70A 4JYBA 4ABYA 4RVFA 10MHA 1Z38A 4GSYA 4OHPA 2QU7A 3OOSA 4BNYA 3EGVA 3AXTA 1A5SB 3CISA 3ZI4A 2WAXA 1CQZA 1G66A 4H77A 2EF1A 3LXXA 1A1VA 1W5TA 2DFVA 2PEYA 2EYUA 3KQTA 4C7MA 5MGBA 3C7TA 1ZH4A 3L92A 3Q15C 4ZI7B 4FQ8A 5KNCH 1KGDA 1X1AA 4JSYA 4UBKA 4PBRA 1DEAA 1BDHA 3KJVA 3HFGA 2HQBA 3U6FA 1PSDA 4CEJA 2GJAA 3IJ5A 5CCXA 1NK6A 5JAQA 3QBDA 1Z2DA 1WMFA 5AOAA 1ZRMA 1C9JA 4OLJA 4ZTBA 1H6BA 1Q0PA 1WAFA 3QB0A 2WIAA 4UHHA 3QU5A 2ONZA 4PV7A 1TLLA 4B1WB 1Y4SA 5FYQA 1BCSB 2WTEA 5FP0A 4CNBA 3CSSA 4HDAA 2DT5A 1DQZA 3T3HA 4CCYB 4LXUA 2QIPA 2D7DA 2YMLA 4QE3A 3BEOA 1DUIA 2I55A 4MK4A 4O3FA 4YCBA 4D8XA 2HF2A 2OTJN 2P40A 5FWYB 4D8WA 2JB9A 3H1TA 2ECOA 3VR6H 4KVFA 3RVBA 4TS4A 4UQGA 2F8LA 2J3DA 1RBMA 4G65A 3PITA 4KN6A 3NHJA 3EARA 3R8EA 1CQPA 3KEFA 2V1UA 3HNPA 1T8EA 1E3WA 1J49A 3A9WA 4PF1A 4YHBA 5TMDA 4FS3A 3PPYA 4RW4A 4FOIA 1JHAA 1OLOA 2Q28A 3D6UA 4JSTA 4ZRDA 2OA0A 3SEZA 3G3EA 4IFEA 4B9MA 1WRBA 2UZ1A 3GDFA 4KJZA 1UKYA 2BKVA 3PX4A 1R8QA 1UF9A 3KAJA 2FZGA 1N6IA 2XR1A 1QF7A 3OEED 4TTTS 3T4XA 3T9FA 4B6PA 4HQKA 1KI3A 3BULA 5FLXA 2ATIA 1EK2A 1J9ZA 2CCJA 4H5WA 4OPAA 4Z2YA 2VIIA 1XHXA 1JCFA 4W6ZA 4JCCA 4QU8A 3PTZA 4WBNA 4CEHB 2YNFA 1H4VB 1ORIA 1Z88A 4EYSA 1HX7A 3WLHA 2D0BA 1QSSA 2KQ2A 1NU6A 3N6XA 5AQYA 1TYAE 3KR2A 4JVLA 4K9LA 4QNNA 3EN0A 1NX6A 2DLCX 1UMDB 3N4PA 3CQXA 4JKYA 4U7BA 3MW8A 3B9QA 4Z9FA 1DAIA 3PYMA 2XI4A 4Z4FA 1YUMA 5AM5A 4GY2B 4RFVA 2X1HA 4LBWA 3RU2A 3KYCB 4OQZA 3PUHA 8MHTA 1TM1E 2V7XA 1FU8A 3T0IA 2JZCA 2FG7C 2XYRA 2II6A 3T5DA 1NE7A 3AX6A 4GVXA 3TBHA 5AVTA 1N2CB 2VNKA 3N0TA 5F5LA 3LW8A 4RKYA 5A7HA 2WOOA 3JRWA 4P4SA 4QOSA 1OB5A 2JHAA 5JMOA 2J9RA 1GARA 5G0WA 4D1YA 2FKAA 5HGXA 2RD2A 1ZY2A 4JV5K 2EP5A 2MYTA 2P77A 3OWXA 2YN2A 5LQDA 1DE0A 4LC0A 3ROTA 1VRUA 3ZWOA 9LDTA 1SRRA 3OCZA 5ANRB 1GVHA 2JFPA 5DASA 3EAFA 1SCDA 3CMMA 4CM6A 3HO8A 3LSTA 1WUIS 3VEVA 2FP3A 2I9PA 3W7AA 3SSNA 1QRSA 1ESMA 3AOEA 3B51X 3LW7A 1SXQA 5HCUA 4FDTA 3EF0A 2K7FA 5KPDA 5LMNK 2C07A 1MAVA 3KUXA 4P08A 3VR2D 1Z7BA 4LTMA 3GY0A 3LECA 2UZ4A 3T41A 1YOBA 3NALA 4QT0A 4AHRA 3FOWA 2HFKA 1JKIA 5IAEA 1Y9EA 3VTIA 2WNSA 3B12A 1QVGM 4MJLA 5HCNA 5BRNA 3UAGA 1CEYA 3K1AA 5K3FA 2HZBA 3I6YA 3K70B 1IN7A 1Q0UA 1TVKA 1H4TA 3DFFA 1Z17A 2A9OA 3O94A 3NWPA 4AO6A 2XW6A 4CZGA 1F7VA 4J0QA 2PE5A 4JI4B 3OE7D 5JYDA 3E8SA 1I01A 4P7FA 4KBOA 1YVEI 2XVZA 2ZWMA 1WXIA 3TNLA 4F4FA 1LSOA 3S29A 4CBVA 1R5NA 3JSXA 3STXA 4UZSA 5DM7L 3MXJA 3SNHA 4ZC8A 3VJMA 5CB6A 3HJCA 2CLHB 4G1QA 1P9WA 3DT9A 1RIIA 2ODEA 2YJ6A 4NP6A 4U7PB 4WK4B 4DPMA 1RYZA 1VQMN 1ISJA 3OQIA 3WIEA 1T9DA 4QM6A 3UK7A 1KY4A 3I5AA 4G2TA 5CT8A 2G1AA 4EVIA 1IBCA 5I5EA 4UEJA 2ZKLA 2MSLA 1YQEA 2EW2A 3HGMA 4JP3A 4PBSA 2VDWA 2FMUA 2B8WA 4W1SA 1QK3A 3HKCB 3WLFA 2QX9A 2ZXUA 4QXRA 2RHDA 3A4NA 1E2QA 3MS2A 4MULA 2EX3A 4FX2A 4A82A 4B7CA 1T9HA 4DDVA 4O3MA 2K5UA 2I1QA 4KIUA 4QPDA 1KIFA 1UP7A 5JCOC 4M98A 5JICA 5JXGA 3N2ZB 1NW3A 2W2KA 3PR2B 5A3JA 5F78A 2NO9A 2ZPAA 5ALWA 2D2EA 4PLGA 4G1MB 4CRWB 1GLFO 4H5RA 1W30A 3VH4A 4CKCB 4RZHA 4YLYA 3PO4A 2H11A 4GR9A 1OQAA 1VI6A 3FVQA 1O0CA 3IP1A 3IPLA 3V9UA 1VDMA 2C2OA 1HR0B 3T1OA 3OQMA 3DW1X 1DNPA 2PGNA 3IJRA 4YRSA 1PSWA 2F3QA 3GLIA 2XMBA 2XOEA 3JYTA 2IWHA 3X1MA 5I8PA 5AUOB 4FD2A 4G0MA 2ASMA 1KU0A 5IU6A 3GCXA 2XJ9A 3WAJA 4XPIB 1N78A 5HS4A 2RKOA 3MINA 4YNBA 1RT6A 2ZJRL 1X0XA 4IEIA 4MYUA 1TM4E 1PJ3A 4PYJA 1U4OA 3KQSA 3V81A 1HDEA 1VE6A 5J4VA 2BH9A 3WMEA 1KHHA 1G20E 4MO5A 4TLMB 3D3WA 2IBSA 2P90A 5CDHA 3HVUA 1UWKA 1ZMOA 1WXWA 1IY0A 1E98A 1EGQA 3PFKA 1WKVA 3R7SA 3KX2A 1XSEA 2PTHA 3ZWYA 1OU0A 4ALJA 2IW3A 5GQSA 3JWHA 3TZKA 4V39A 3UJ9A 5KSWB 3AA5X 4Q24A 3H16A 3RRHA 3WXKA 1N2IA 2WFZA 3SUNA 1HKHA 1F51E 2AMVA 3ORHA 4KU4A 3O9TA 4JR1A 4WHMA 3RSQA 4GQBA 3Q10A 1QDLB 3OEEA 5DWVA 2O8DB 2Z4TA 4OBXA 4LJ5A 1O6BA 1W87A 2CL6X 3V9PA 3AO5A 2R8RA 1MEOA 2XDYA 3VQTA 4EG4A 4CF4A 4OQNA 1ZD5A 3L7OA 2L18A 4G1FA 3WGNA 1OR8A 1JJFA 2CXHA 1P1KA 3GXBA 2HQRA 3T5GA 3ZWWA 1YQUA 1E9VA 1RMTA 4AYXA 2R84A 1WV0A 3Q3IA 3C6MA 1B16A 1JBKA 5C3MA 3TTFA 4CF5A 2W0MA 4IDKA 1FW6A 2X5NA 1QOQB 1PT5A 4JBLA 4ENUA 4LCJA 3RVDA 4EL5A 1GPKA 2V7QA 4MYSA 3KJXA 3PDCA 1UT5A 1JDNA 2F43B 1T0UA 4JRPA 1QYDA 4KGDA 4E32A 4P82A 4JP2A 3ZZ0A 5ITSA 2JGAA 4JLKA 4RZIA 4BO2A 1V96A 4TXMA 1T0HB 5CNIA 2P78A 7REQA 1HZZC 1KQ3A 3EY1A 3EW7A 4CJPA 2FUNB 2NGRA 4NHEA 4D0LB 4GI1A 2IHYA 2A8YA 3CKLA 2BMVA 5LYJB 5JALA 1Q1NA 1HV8A 5FPEA 3F3SA 3ZK9A 1U0SY 3W1EA 4PQYA 5JRDS 3OZCA 3GOIA 1J2YA 2RI1A 3C3XA 2ODTX 2J9GA 3DO6A 2Y6UA 4F1WA 1JHQA 1ZM3A 3A8YA 1EHYA 1VQNN 1RHKA 1T5TA 3F6PA 4F9GA 5BQFA 3CC4N 1PJBA 3OM0A 3VEOA 1T13A 4MKGA 2QPAA 1TRKA 4OKJA 3CCFA 3EZLA 4MLPA 2O6LA 2RCYA 3ZOZA 2ZTVA 2VH2A 4GOND 4UD2A 5CVVA 4LSLA 1NJYA 4LF8B 4QVKA 2JCSA 2RKBA 5BV1A 1GNTA 1ZVMA 5CEJA 3SBOA 1SZCA 1P39A 1R9MA 2RGRA 5GMOA 1FFXB 4C14A 3CH4B 2A1IA 2CNDA 1LNQA 4UY8O 1E66A 3QIOA 4ZI2A 3IUPA 1H3FA 4MEAA 4DFPA 4OEHA 2G63A 4JJ8A 3CCSN 5JPIA 3U9LA 5BV8A 3UJ7A 4IOCL 2O23A 1X74A 4Y2TA 1OROA 1GSIA 4AJEA 1XKLA 5ILOA 1WSHA 1H1LA 4XH5A 1ODIA 1XTTA 1IY8A 3PKJA 4PLZA 4X63A 2BW0A 2MYPA 3E5NA 4E7OA 3M8PA 1PQPA 2NTNA 2FFQA 3T1HK 1U9IA 3R8FA 3I1FA 5A04A 2HMWA 5AESA 5JNTA 3T7SA 3IKVA 3DCYA 2BZ0A 3T1HB 3V2GA 4XH4A 4DT1A 1B93A 3DAOA 5JLHA 2O8CB 1BXGA 1OFVA 3F4LA 3MXOA 2J3EA 1B41A 1QX4A 1KI1A 5FLKA 4HN2A 1X6VA 5E95A 1JIIA 2J3KA 3G1WA 2FGKA 2JHGA 4XWKA 1KSHA 1ZBFA 2QP9X 4RDHA 2E48A 4YWHA 3B13B 3VC1A 5IKMA 1JDZA 3V42A 3BT7A 3V4ZA 2R8ZA 3GMIA 4DQ8A 4H4DA 4CIWA 3V7YA 4UEQA 3OIUA 1MU0A 3CVJA 4R68A 2O2JA 5FYDA 2KZMA 1T4MA 4J0EA 1GPDG 1IG0A 3C0KA 3I0RA 3L4SO 1VMDA 5NULA 4AC9A 4BVJA 3M5DA 3E3OA 1MB3A 3GRPA 1N2GA 1JFTA 1QKIA 3DA8A 1II8A 4G8BA 1H2HA 2D0IA 2JASA 4JQZA 1DWUA 1QIMA 2WC1A 3E9CA 2QTVA 4HN4B 4J2BA 3R5XA 5EZ5A 1AGRA 3H13A 1SEPA 1T3GA 1TPYA 4L3VA 3VNBA 1EUDB 1RI4A 2AWOA 1M1NB 1BHLA 5K03A 3ZE7A 4HVCA 2CLOB 3S4YA 3HYFA 2WQ6A 1ZG3A 4EI2A 4FE3A 3GPBA 4ZV7A