2YHAA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
384
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
total genus 115
structure length 368
sequence length 384
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhaA01
1WAFA 3SYZA 2QR3A 5HRNA 5E41A 3IPCA 3SPYA 2QZJA 1XHEA 1BDHA 1JLEA 4G0XA 3OY9A 2HHUA 4FJKA 2NZVG 3MEEA 1JLGA 1QQCA 1BDIA 5TQ2B 1TLFA 1ZESA 2FMHA 3JTEA 3M9WA 4DFMA 2FEKA 5JNWA 3L3UA 4IMIB 4EVRA 3KKEA 4Q6WA 1RT1A 1HQEA 2FQWA 3RR7A 4KHQA 1LJUA 3U3YA 3FFIA 4MRMA 2V0NA 3NF8A 3EYZA 5IEBA 3VQCA 1NXWA 4YCSA 1WSEA 2ZWMA 3TAMA 3NFAA 2LBPA 3QEPA 3PUFA 3OYDA 4P98A 1M2EA 4CF8A 3QLTA 4WE1A 4RV5A 5IUJC 5HRRA 4Z4HA 1T05A 1S1XA 1VSJA 1Z15A 3MAQA 1Y97A 1TMYA 4OTZA 3MEGA 1HJRA 3ZSXA 4B08A 2IPLA 1KMIY 2HQOA 4DSKA 5E3JA 2ID9A 3LUAA 1IH7A 3RMDA 3GT7A 3DRPA 3FFXA 3VQDA 1UA1A 3C6UA 1DCMA 1TKDA 4W5OA 1E6MA 2E4VA 1TKTA 2FC0A 1EWVA 2BE2A 4RS3A 4IDKA 1R8JA 4EYKA 4F2RA 3M8RA 3K59A 3QLVC 4IKFA 5FWYA 5KRTA 3MM4A 4ID5A 4DF4A 2WY2D 4RW8A 3EDCA 3OYIA 5HSGA 4OATA 1SKRA 3IP6A 4S05A 3VQ7A 2L17A 3E3MA 3QELB 4FLUA 3CM5A 4G0ZA 1JFTA 3QERA 4E7LA 4MS1A 1BI4A 1TAUA 1J54A 5BRAA 2JLEA 1ZITA 2RGYA 2IOCA 5FRNA 1B9DA 3F9KA 3SUQA 2IYNA 1D1QA 3NAEA 1NXOA 3P1GA 3EULA 1TKZA 1CZBA 2PY5A 4NYFA 2RPIA 4M41A 1JF8A 2FMIA 1FXXA 3K57A 1DTQA 2HHWA 3KJVA 4FLVA 3TI0A 3T38A 4OVLA 4AHSA 4DLEA 4ZHRA 5CNKA 3VNAA 3CZCA 4DS5A 4YNQA 2OPRA 3OYKA 4N5SA 4YV7A 3SUOA 1U2PA 2OPPA 4M42A 2P51A 1KLMA 1NOZA 2B4AA 4GVMA 4KTQA 3QLUA 4Q7EA 5KQPA 4KAZA 1BIZA 2KFZA 3ZT1A 4M3ZA 4O1HA 2G8HA 2FTKE 2HNDA 2E4YA 3UIQA 3QEKA 4CEEA 4CJVA 1L5UA 1RT7A 4OLAA 1KSPA 3G0ZA 4CFDA 2VK2A 3MF4A 1WETA 3VN5A 4N41A 4KHNA 4CERA 2HJ9A 3TAQA 1UDRA 3C3MA 3GYBA 1JFSA 2O4IA 2MYPA 3SQ1A 4CGHA 3EODA 9ABPA 4N0QA 3TD9A 3RVSA 3A0UA 3EQ2A 2MYNA 3V9UA 3Q41A 4PY5A 1KFDA 2HQBA 4FZYA 3GWGA 1SXHA 5IBQA 3JSMA 3MMNA 2AYZA 4CE9A 3TMYA 1SL0A 2KTQA 4O44A 4Y9TA 1GOAA 1WSFA 1SL1A 4FLTA 1SKSA 4CGIA 3V1QA 3HV2A 1C0EA 2X6SA 3NCIA 1ZVVA 1NJYA 3RVLA 4KK4A 4J2DA 4FM0A 4XASA 1HYSA 3SUNA 4J2EA 1C6VA 3SZ2A 1NK5A 3OYHA 3F73A 4MS3B 1RNLA 1LK0A 3OLXA 1JLQA 4FLYA 4F11A 3Q7SA 1YVUA 1Q9XA 3TB6A 3HVTA 1DRJA 1WSIA 3O1HB 5EWJB 5ED4A 3PX6A 3HPGA 4FW1A 1B92A 4H4MA 5CNMA 4K8XA 2GKGA 4FW2A 1D8YA 2AYXA 4DTSA 5TQJA 4CEQA 4Q0BA 3DYAA 3V9XA 1CXQA 4F12A 4I2QA 3VA3A 2XY7A 2P5OA 1VK0A 3U3GA 3M8SA 1VSFA 4B8CA 3LP1A 4RXTA 1ZBHA 2HNYA 3RVQA 4KTZA 3A2FA 1KVCA 4XARA 4FJLA 4MQ3A 4P1ZA 3ROFA 4ETNA 3ZSYA 3AA4A 4YO7A 3PX4A 3LKVA 4DTUA 1RTJA 2ZQBA 4FVMA 1RT3A 4W5RA 1DZ3A 3GL9A 4QICA 3LUDA 4AH9A 3HDVA 3MXMA 2PYJA 4B9MA 4TLLB 1ASVA 2OPSA 4HUFA 4W5TA 4CF0A 3P83D 4HUEA 4I9LA 3L49A 2GUIA 1BCMA 3QK7A 1EWKA 3OMWA 2M1ZA 1GUBA 3OLYA 5J1EA 3GA5A 4IRXA 1HPZA 2ZE2A 4LDAA 2VUHB 1Z18A 3KLFA 2DRIA 1NKBA 1I39A 1P8AA 3CLKA 4MRMB 1QHTA 4QOZB 1ZGGA 4PA1A 4D74A 3NHGA 4DSIA 3T19A 2G8VA 2JK1A 4CHNA 1S1TA 1FKPA 4UHKA 3H75A 2DTUA 4JB0A 1EKEA 2Y1IA 1LW0A 3S3MA 4B9TA 3CQ8A 2H3HA 1D2AA 3TANA 1U48A 4KHYA 3T1AA 3MQ4A 4CJ5A 3AVNA 4RW9A 4RK1A 4IFYA 5I42A 3FFTA 4ZMRA 2PL9A 3KYIB 1QSSA 4Y1DA 3F7NA 2E6MA 5J2PA 3A10A 1YT3A 2E4WA 4KNYA 4KFBA 2HMIA 1FFGA 1XHFA 5C5EA 4KTWA 3AVBA 3SCXA 3SNNA 3HSTB 2WRZA 3OLZA 3NBPA 4YWHA 3AO5A 3H5LA 4UQGA 1I3CA 3O4QA 5JNRA 1VRTA 4YLEA 3CG0A 4MQFB 2HSGA 1SUQA 4C8LA 1PEAA 5HROA 1PEYA 2PMCA 1EAYA 3NHZA 1DBQA 3LDSA 4Z4EA 1YMVA 3N75A 3HXMA 4YP9A 1TK5A 2MYUA 3CFYA 4DQPA 3LUCA 3LKBA 3QLHA 2P5GA 1DBPA 4OGCA 5DLEA 1KRWA 4GMJB 3I8DA 1L3VA 4CF1A 1VSKA 4CECA 1LAWA 2D0BA 4FJNA 4E7JA 2QKKA 3OYEA 2RKIA 1YTAA 3AA3A 1S9EA 2L18A 1JLFA 4Z0UA 5EWJA 3CU5A 3O21A 3S3OA 3OJSA 2PL1A 1HYZA 3CG7A 4CIFA 4CIGA 4ZTFA 3OVNA 2FW0A 3CM6A 5BRJA 3AVJA 3PY8A 3OYJA 2QXFA 1WSJA 3RH0A 3HEBA 1LBIA 4Z9BA 2IGIA 2FEWB 1Z25A 4MFBA 2JB9A 4DTOA 3CFPA 2YNFA 4CEAA 1BL3A 2QKBA 2RN2A 4RK6A 4DSLA 4IGAA 4HNQA 5BQ3A 1NJWA 4FJXA 3P9YA 3QIPA 4PUOA 1DG9A 1C1BA 2E6LA 2HW3A 3SV3A 3LP2A 4NCAA 1DC8A 5KWSA 1NJZA 2GBZA 1Z16A 2GX6A 1T7PA 4YR7A 5KTQA 2DFFA 3NF6A 1FSPA 4GPAA 3O1IC 1EP4A 1BGXT 4RK5A 3TABA 3MEDA 2NZUG 1QO0D 3AVHA 1D9FA 3V1OA 5HP1A 4CGFA 2WMYA 1BQNA 4Z99A 4WXEA 1GOBA 3C97A 3TAGA 4DADA 3ZSQA 3LPUA 1B00A 5HKOA 2E4LA 2PAFA 4ETIA 3HPOA 3GBVA 5JNUA 5DKFA 2JVJA 3ILYA 5CYMA 4ZMSA 3AVKA 2M98A 4KFCA 1RDBA 2GBPA 1I3AA 1JLCA 3AV9A 2OZSA 3TAPA 3HS3A 1UOCA 3T8YA 1WSGA 3UKJA 4O0JA 3V9ZA 4HNRA 2BGGA 1SRRA 4DQSA 3NHMA 1S6PA 5B3JC 2BANA 1BQMA 4KV7A 3BGRA 3DI6A 3K5LA 3K58A 3QEMA 1ZY2A 2NT4A 3JVIA 3C95A 2LIVA 3L6UA 3KD5E 4OJRA 3IAYA 4FJGA 3CS3A 3W9SA 3ZSRA 2LUOA 1CEYA 5C42A 3TAFA 3C94A 1IKVA 1REVA 3KKRA 2HHVA 4B9NA 2KFNA 3JY6A 4FJJA 4DSFA 3DLGA 4E7KA 2PUFA 1RBTA 4DFJA 3V81A 3L2VA 1K6YA 3LWMA 2X74A 3B6OA 1KFSA 2DFEA 3DGEC 1B9FA 3SAJA 4OKJA 4RY9A 5DTEA 3VQBA 1BCOA 3VQ5A 1KVBA 2QK9A 4NV3A 4CBVA 2WJWA 1YTUA 1NK8A 4FJHA 3RRGA 3NBMA 3F6PA 1F51E 3HJFA 4O1IA 1DC7A 4ZPJA 3SJJA 3SQNA 3QEWA 4MQEA 1QQBA 4NYNA 1L3TA 1XHZA 2KW4A 3T6KA 1PNTA 4O5BA 1NXVA 2GI4A 4KI6A 4E0DA 3SM9A 3AO1A 4IMJB 3A3KA 2KYRA 1VRUA 3VQAA 3D8UA 1UA0A 1BIUA 1U47A 4KI4A 2YHBA 3HM9A 1T03A 2PUCA 1LWEA 2A9OA 3L8BA 2ZD1A 3RVMA 3EAFA 1ZYQA 1WSHA 2E4UA 3KHTA 2HB5A 3I45A 2FBXA 4LE0A 2R25B 4CK2A 2LSNA 4E7PA 1L3SA 2G8WA 5EU7A 4TSXA 2DFHA 2Z1HA 1RDDA 3WNGA 2LPMA 4NICA 5DMRA 1TK0A 2HQRA 1XI1A 4CHZA 4FLXA 4B9VA 2FMKA 4KK3A 1WAJA 1F4VA 2QW1A 4N47A 3JPWA 5KC9A 3ZSVA 1CXUA 2JGUA 5HM6A 2GWRA 1RPJA 4HVJA 1Z13A 3KTOA 4HUGA 1A5VA 1LJLA 2H0AA 2L2QA 1NXSA 3SPZA 1ZGZA 5T7BA 5KGXA 4FB4A 3AVCA 2XDYA 3C3WA 4G0YA 4OKKA 5I3UA 3ULDA 1EXQA 4CESA 3HUTA 1NK6A 4CJFA 1QPZA 1SV5A 4Z9AA 4L4UA 1VKRA 4CEFA 3PO5A 3FGZA 2VUIB 1K66A 4QPJC 2IPMA 4QCLA 2Q5CA 3NF7A 4QAGA 5J2NA 2QXYA 4JA2A 4FJ5A 5CNIA 4BWJA 1C0MA 4NCGA 4CJEA 5BR1A 4CJTA 5DGCA 1L5ZA 3DLKA 3EY1A 4OLBA 3OO0A 1C1CA 1BVHA 3DRSA 4B3OA 5HRPA 3HL8A 1YMUA 2A1RA 4DSEA 3AVAA 3RVRA 4DQDA 4CJLA 4RKRA 4RG8A 3L2QA 5IEJA 4CJ3A 1EWTA 3CHYA 4N76A 3AVLA 4Z4IA 4KHUA 2FEPA 2VG7A 3LPTA 4LE1A 4MAAA 6ABPA 5IX8A 1FKOA 2N9UA 1NOYA 5TQ0A 2YHAA 2YKMA 1N6QA 4RKQA 4MS1B 1LBHA 2MSWA 3KLOA 1KTQA 1AB5A 3C6QA 4CJWA 3M6MD 1NJXA 3HT3A 4L8RB 3NH1A 3AA5X 2WOMA 4FJIA 1RTHA 3LUHA 3QEMB 4MR9B 3MIZA 3QLVA 5FWYB 4NCBA 4FJ8A 2IPNA 5CNJA 1K68A 3DLEA 1TL3A 1TVMA 4CCHA 2JBAB 2A1SA 4LSLA 3TO5A 3NF9A 2JVKA 1PNRA 3N0WA 1AB6A 3BRSA 2HHXA 2YV0X 4CFCA 4PYRA 4CJPA 1IIBA 2TMYA 2F8TA 1JXEA 1RTDA 5DK5A 1BDJA 1RT4A 3O2SB 4BE0A 4PE5B 3DMJA 2E4ZA 2JVIA 4DQRA 5TE9A 4EZ9A 4KO0A 1LWCA 4DTNA 3RVKA 1UWBA 2QSJA 3NGYA 5JNSA 4PEVA 5EWMB 5GQSA 3KK3A 1JL3A 3ROTA 4ELVA 1RT6A 1IKXA 3A0RB 1M2FA 4F06A 4F8JA 4FCYA 4CGGA 1Y1LA 3TAEA 1W9HA 3KLGA 3NE6A 5D3GA 5FBKA 3DZDA 1KRXA 1C1AA 3HZHA 1JYFA 3NH2A 3B2NA 3EJWA 4H8KA 3RVPA 4GW6A 2Z1GA 3VQQA 3JPYA 4RXUA 4XXHA 3DM2A 2PYLA 3HVRA 2IC3A 1ASWA 3M8QA 3P5JA 4CGJA 4C8OA 4Z4FA 4NQRA 1QTMA 1HEYA 4LH4A 1ZDMA 3KCNA 4E89A 3THVA 1CYEA 4JB2A 4M3UA 3O1JC 1RNHA 4Y1CA 4FLWA 4M45A 1U0SY 1DCFA 1JLBA 3OLWA 3TARA 2YNHA 3H6GA 4MS3A 2IKSA 3WNFA 1R0AA 4RW7A 4EVQA 2O4GA 1BAPA 2YNIA 4MQEB 3DRRA 2OQRA 4G0OA 1P6UA 3GRCA 4IG3A 1TGOA 1BA2A 4AHUA 2W42A 1X9MA 4ELTA 4MQFA 3HDGA 4EP5A 3QNNA 1U49A 1TVRA 1TM2A 1NXPA 3KLIA 2G8IA 6CHYA 2R47A 3NNNA 5T3YA 4BACA 3O3HA 4CEZA 1IG9A 3Q15C 3N8IA 4DFPA 5IULC 4FJ9A 2XHBA 4CJRA 3L3VA 1IKYA 1VSEA 4KV8A 2OZMA 4H60A 3AVIA 4Z4GA 3C3KA 4WXMA 1GOCA 4QYMA 4RW4A 1LV5A 1D9DA 3V4IA 1ZN2A 1RBSA 1IKWA 1J53A 4OKEA 3NGIA 1QKKA 4CF9A 1YS6A 4O55A 4KMRA 2E4XA 4GNRA 2YNGA 4DU4A 2P9HA 4JOQA 3IS9A 1PUXA 3JVDA 1RXEA 4KZKA 3N0XA 1OXBB 1LW2A 2B4JA 4DWIA 1ISSA 1RILA 4AHTA 4UHJA 3CG4A 4IG0A 3BBLA 4LH5A 3RTVA 1BI4B 1EX4A 4M3WA 5CY4A 1EHCA 1S5JA 1RT2A 4DG1A 1MB3A 3OYBA 1VSDA 3H5TA 4KREA 5TQ2A 4DTJA 2ID7A 4I2PA 3CFOA 1WLJA 3V9SA 2O20A 4G1QA 4FXDA 3S3NA 2Z1IA 3VQ6A 4PQUA 1NATA 1QO0A 1ABFA 1ZAYA 4N56A 4RY8A 5KI6A 1GCAA 1ABEA 2I6FA 3URMA 3NDKA 3HCWA 4HTUA 4EUKA 3CTPA 3OO1A 2A9RA 4BWMA 3ZCMA 3V1RA 3ALYA 4XLTA 3D45A 3QIOA 4Q6BA 1LAVA 4WUTA 1XC9A 3ZSOA 1TKXA 1X9SA 5TQ0B 1Z17A 1BHLA 4FK4A 3H08A 3ITHA 3RMBA 1Z2DA 3BRQA 2XRIA 3D0PA 3IP9A 3QEVA 4HCBA 1U2QA 4DQIA 3QNOA 2R4QA 3VQPA 1ITGA 4CHPA 1XWWA 4E7HA 2F8SA 4MR7A 3NNDA 3ZSWA 1UAXA 1QSLA 3KTQA 4G86A 1QE1A 3PX0A 1M5UA 3RMAA 4AILC 3RVNA 4LX8A 1JFVA 5KGWA 4LD0A 2LP4Y 2A9PA 1J9AA 3HK2A 3K9CA 3AO4A 3VQ4A 4YS6A 3JS5A 1XWLA 2CHFA 3OYLA 3G85A 2PLNA 3OYNA 4ZTJA 3TR8A 4EYOA 4Z4CA 1D4ZA 1VSIA 3FFWA 5PNTA 4KKOA 4PZ0A 4JRPA 4M3TA 1D5WA 3NGZA 1SXIA 3DBIA 3MA0A 4TLMB 3ZT2A 4EP4A 1JH9A 3KIOA 1YK1A 4CJ4A 4H3HB 3OYGA 4F3OA 2QV0A 3E01A 4MPTA 2VG6A 4EY3A 4KHSA 1S6QA 2PUGA 1ZBUA 1E2BA 4BDYA 1E6KA 3IRXA 2IOYA 3ZT0A 3SNKA 3LUKA 4WWHA 4RDCA 3U6FA 4N03A 4MGEA 3LANA 4I9QA 1W0HA 1U04A 3H6HA 2CHEA 4MS4B 5SZTA 4CJSA 2HPHA 3I0SA 3OLVA 4KB1A 4RZSA 5JNTA 2PE5A 3KSMA 2IAJA 4CFAA 5C25A 3LFTA 4I7FA 4FK2A 4FE7A 2VWJA 1APBA 4FJ7A 4AHVA 3SG0A 3VQ9A 3OS0A 1D5AA 2HHQA 1JL2A 1QP4A 5FWXA 4EYQA 5KC8A 3LUGA 2PKXA 3LAKA 1RXIA 3QESA 1ZBIA 3H5WA 3HPHA 3KJXA 3ILHA 3HP9A 4RK7A 4DMNA 1YIOA 2QVGA 3QX9A 3SI6A 4O5AA 2MSKA 1RCHA 3LP3A 2XO7A 4EVSA 3OS2A 4RU1A 3PO4A 3MXJA 1C0TA 1X9WA 1YK0A 4E3SA 3WNEA 4CIEA 1DP4A 3IP7A 2FLWA 2FVYA 1NXTA 4OG2A 1MVOA 4CF2A 1NK7A 1JDPA 1VPWA 4RK0A 1DBWA 2OYQA 1JDNA 1JYEA 2RF2A 1G15A 3HUUA 4HNSA 5D2CA 5FRMA 2FBTA 3SQ2A 1VLZA 1WN7A 2IPAB 4HYEA 1P6QA 3O75A 4EYGA 4DU1A 3H5VA 1CZ9A 4DU3A 1EETA 3DLHA 5HBMA 1QP0A 3QLUC 5K14A 3SQ0A 4MR9A 4DTPA 2R48A 2JRLA 1TJYA 3LWLA 4KPYA 5IC5A 3NNSA 3DOLA 3OQOA 1XHXA 4W5NA 1JKHA 4G0MA 4O0IA 2IDMA 2IDOA 4MR7B 1ZH2A 3AO3A 4RK4A 1EFAA 5CYQA 3KK2A 3ASMA 3Q7TA 3LOPA 5FDLA 4KQ9A 3H5IA 3OYCA 1C4WA 3RQIA 3OYFA 3VQEA 4MR8B 3RVOA 3KLNA 4FM1A 4JLHA 3IP5A 4C8KA 4DFKA 4M3YA 2D5RA 3MECA 1T8EA 3HP6A 1SD5A 4OPKA 2AJQA 3EQZA 4IFVA 4YGXB 1L3UA 4CJQA 2OA8A 5EWMA 3G10A 8ABPA 1VRVA 4M3RA 3ZSZA 3O3FA 4IF4A 3CYMA 1HRHA 3V6DA 4CJUA 4XIUA 5GOTA 1GUDA 1A2OA 1LWFA 2DY4A 3AVMA 3JYTA 3LTEA 4JASB 3K5OA 4MLDA 3Q7RA 4KQCA 4RXMA 4PICA 1HMVA 4F3TA 4S04A 4FLZA 2JBAA 1NKEA 1FFSA 2Q3SA 5F64A 3KG2A 5KQMA 1A5WA 4LE2A 1NXXA 1S8NA 5KQLA 2FQXA 2MSLA 4DN6A 1ZBLA 4CEOA 2CWDA 1C0UA 1RZRD 1NY5A 3NH0A 1O1WA 2XY8A 2PUEA 4H3KB 5FROA 4IBNA 1S1WA 4CK3A 2D0CA 1JLKA 4MLCA 3S99A 4XFKA 2EHGA 3I42A 3BDPA 3OQNA 1TV6A 1IO2A 1W25A 5HRSA 4KVFA 1RZRA 2FBVA 3H1FA 1FK9A 4FK0A 3VNBA 4JP1A 3LZIA 5TPZD 1H9CA 4CJKA 3OMXA 1CHNA 3KKSA 2FXIA 1VSHA 3SQ4A 2RJOA 4QYWA 1KLNA 1QSYA 4FZXC 2D0AA 4HCCA 1QP7A 2ATQA 1JX6A 1A04A 3O3GA 3OM0A 3DGFC 4J2BA 3ZT3A 2FLKA 4JS5A 3QELA 1Q9YA 3OJUA 4E1NA 4F8RA 4BDPA 4BE2A 2Z1JA 4CEBA 2VWKA 2B1JA 3UUGA 3KLEA 2NT3A 4DLGA 5TPWB 1DTTA 5J2MA 2I5JA 5JNVA 4B09A 3FDFA 4EZ6A 2KZMA 2BDPA 2X7XA 3OQMA 5I4CA 3MYYA 5CZ2A 5IUKC 3H1GA 4KHWA 4LSNA 3GBPA 4LY7A 2X6NA 2KZZA 2HVHA 2PZSA 1Q8IA 5JS1A 1RBUA 3DLBA 4R5PA 4G97A 3O2JA 1ZBFA 1Z26A 4YFUA 3QX8A 5EWLB 2HNZA 1CLQA 1J5OA 3QEXA 4KRFA 3CFRA 4E7OA 2WWVD 3N6VA 2WJAA 2R7YA 1TL1A 2P4UA 3ISNC 5CHYA 4OBBA 5HQJA 4LZLA 4M3XA 3RRHA 4E1MA 1A5XA 2PJUA 3G1WA 3HSYA 2PUDA 1FFWA 3HYFA 2YKNA 4DF8A 1VSLA 1ASUA 2FN8A 1KCFA 3CZ5A 4MYRA 4FE4A 4FZZA 3OM1A 3O2QB 2VG5A 2P1JA 2HVIA 3V9WA 3IPAA 3CNBA 5HLFA 4MR8A 2FBYA 1DLOA 1JL1A 1RDCA 4L85A 1F21A 3RMCA 4MS4A 4RSMA 2OPQA 3IG1A 5CZ1A 3OS1A 4WT7A 1S1VA 4ICLA 1DJMA 1URPA 3VA0A 3I0RA 2XY6A 1RBRA 4G0QA 1RBVA 7ABPA 4F4KA 1HNVA 3KYJB 5C24A 3SUPA 4TN5A 3F6CA 1GCGA 4CEDA 4FYDA 3R0JA 1U45A 1QNLA 5JS2A 1S9GA 5B3JA 4RY0A 2PUBA 3CRNA 4RWEA 4W5QA 4FM2A 3AA2A 3I09A 1JBEA 1A0OA 1JWLA 1SL2A 4KB0A 3EGCA 1DCKA 1TAQA 5C5CA 2RJNA 4EGSA 5TPWA 2G8KA 4H4OA 2B6AA 4C8MA 3GV0A 4IILA 4AHCA 3O4NA 1KRPA 3C6TA 5EWLA 3HO1A 3T95A 3Q9SA 3AO2A 3KLHA 5DCLA 1U8TA 1MU2A 1KGSA 4ZJPA 3OYMA 4Q5VA 2L19A 1MB0A 4OPJA 4DTMA 2QVCA 1KVAA 4DQQA 4XAQA 4ID1A 3L2RA 2J48A 4AHRA 5ABPA 2KQ2A 3T3FA 3MXIA 1QS4A 3BILA 1Z12A 1USGA 1VSMA 1MAVA 4CFBA 1RDAA 4JRQA 2QU7A 1GLGA 4G0PA 2FN9A 2X78A 2HHTA 4C8NA 1RT5A 1E6LA 4O4GA 4E7IA 3QINA 2FMFA 4RW6A 1Z2EA 3ZT4A 2HHSA 3KD1E 3LAMA 4TMYA 5SWMA 3K5NA 3TX6A 1USKA 3LP0A 1SKWA 5IUNC 3AVFA 3H1EA 4D6XA 1JLAA 4B8AB 1HNIA 2Y1JA 4CGDA 2RDMA 1JHZA 4M88A 1N5YA 1L5YA 1NTRA 1P2FA 2B5JA 1NK9A 1MIHA 3D02A 1ZHHA 3N53A 3K4HA 1M5TA 2WB4A 4ZYLA 4CK1A 3QEIA 4J2AA 1OXKB 1YS7A 5FBHA 3E61A 2ZAYA 2PUAA 3S9HA 3SV4A 3CKMA 3UK0A 2JCGA 3WNHA 2VYCA 1QMPA 2XY5A 5KRSA 1JXBA 3LUFA 3RWUA 5J2QA 3AVGA 1D1PA 2ETJA 4DSJA 3H5OA 4N0PA 2ITGA 4ELUA 4FJMA 1PHRA 5TPZA 4DS4A 2G8UA 2OENG 3DOKA 4B9UA 1TK8A 2GV9A 2NUBA 3QO9A 1DRKA 2MYTA 3QETA 3L2UA 3VQ8A 3SY8A 1BISA 1NKCA 1T34A 4OGEA 1NK4A 4F2SA 4HHTA 3LUJA 3M8PA 3LZJA 1S1UA 4ML3A 4BDZA 3PV8A 4Z0NA 1WNSA 3OYAA 1HQUA 4K8ZA 3IDOA 1RTIA 4B9SA 4B9LA 1U4BA 4YRZA 3N0RA 3LALA 2FKAA 4DTRA 4LDZA 5KQGA 4CHQA 3TWHA 3K5MA 3O74A 3KS9A 4LRQA 3L2WA 4JAVC 4BE1A 3EZ5A 4DTXA 2EX3A 4PWDA 1X1PA 4CHOA 2FSPA 4D6YA 1FQWA 1ZH4A 4ETMA 5FWXB 3RR8A 3RVJA 2A9QA 3KK1A 2CD7A 2IS3A 3LMKA 4WZZA 1SXGA 3K2PA 1HYVA 3BREA 1USIA 4CHYA 1QQAA 4JS4A 1ISRA 2FQYA 4E19A 2G8FA 3I5AA 2F96A 2WONA 1J56A 3DLRA 1NK0A 3M9XA 3B6PA 3FMVA
chains in the Genus database with same CATH superfamily
1UOQA 3WNQA 4MVJG 1SGWA 3VERA 3ZUGA 1ZNXA 5EHGA 3Q8LA 1BHO1 1XHEA 4Y0WA 1P2TA 4FMCF 3JXUA 3OY9A 2HHUA 4FB5A 2V7BA 2QTVB 2QN8A 2RHKA 3HU2A 1AMNA 1JLGA 4ZVKA 5TS2A 4RPHA 1BW9A 1ZESA 2XT6A 4O1MA 3IOCA 2C9DA 1JEQB 1HG0A 3GCGA 2RGGA 3HPQA 4DFMA 1P0MA 3NBXX 4D3YA 5J1TB 5FTWA 4CTKA 3O9SA 3F3MA 3DO8A 2FDRA 3O8MA 1D6NA 1AM4D 3PHHA 5EJGA 1QJCA 2ZRIA 1XXHE 2X4IA 3QRWA 1WZCA 5IAKA 1AQNA 1C3XA 2CMFA 1GJRA 1ZXBA 1HQEA 1C80A 4ZOLF 2VWBA 1V7PC 1ISFA 5HPYB 2HSEA 2EP5A 1ZVMA 2R2AA 2JFGA 4L1KA 5CH5A 2EZ9A 2CNWA 3TMKA 6NULA 5HIAA 2G09A 2Q28A 2WKSA 1NW7A 4KH6A 2OEPA 3LA6A 5EY4A 1DDIA 1LPSA 3EXHB 1ID8A 1NRWA 1E1QD 2WK1A 3FDZA 4HDNB 5KYKA 1WSEA 1JDZA 3TAMA 4AI6A 5FL3A 9ATCA 4WOKA 2R751 1ECCA 3TFQA 3KXDA 5ALQA 4AF7A 3TK1A 3PUFA 1Q77A 1RWBA 3CEJA 3OYDA 4QDTA 3PGMA 3ZCRA 2QWLA 4CF8A 1QIMA 2FQQA 3QKWA 4NJMB 5D7BA 2EFGA 2ZDHA 1U0GA 4RV5A 5K4AA 4IXMA 4Q1FA 3SYMA 3S3TA 4K25A 5AQLA 1L7PA 5CR4A 3DOIA 1UANA 4DXAA 1U9JA 2RHMA 3A8TA 2JFNA 1U2VA 3I1JA 4I2VA 2QIOA 1K06A 1M8KA 2B7LA 1CJVC 4FYJA 4D99A 1PZFA 4MWDA 2JFYA 3DUFA 4DMHA 1Z15A 4E2YA 1CF4A 1HOXA 4NZNA 3MEQA 1TMYA 1CG6A 3ID8A 1QR2A 1JEJA 1ODIA 3NYRA 2BTFA 1G6Q1 1ULAA 1HFJA 4D9EA 4HNAB 4CT4B 2PSFA 1HKHA 4FGKA 5IKOA 3STHA 3ZH9B 3SQWA 1CUJA 4M3NA 5GOZA 1IN8A 1B0PA 1MW8X 3CBQA 2IVOA 1MV5A 3MCZA 3HTXA 3Q88A 2ZVJA 2AJCA 2Y77A 4KTTE 1V7QA 2X9NA 5E3JA 3WGGA 5CYGA 1OAOC 1C2YA 2ID9A 4K87A 4M8NE 4HPJB 1IH7A 4H3VA 2ILTA 5AFUH 3HGMA 1T4CA 2QLJA 3GT7A 2ZRJA 3FFXA 4EO7A 3VQDA 4CKBA 5CCBA 2ZUCA 3GARA 3OZRA 3UT0A 5IDXA 1LF5A 1LLFA 3LQ1A 3E22B 4HGNA 4LVNA 2E4VA 4UM5A 1Y89A 3R24A 1H1DA 3R5FA 4HC4A 3AQIA 4OHPA 5TXGA 3GFSA 2BE2A 1W59A 3KBOA 4M22A 5FRDA 4PYJA 2YZ7A 1R8JA 1XROA 4M83A 1EZ4A 3C7NA 3P97A 3VO9A 4FFWA 1XD2B 1E5XA 3T69A 3K59A 4X60A 3AR6A 1GKUB 1OHHA 4IKFA 2CVHA 2Q4BA 2VPTA 1R12A 4PBTA 3TGLA 4WOPA 3ONVA 1U7WA 2HU8A 3ZWCA 4CD1A 1ONOA 4AL4A 4Z1MD 4KH5A 5FWYA 5D5HA 1QE3A 2WY2D 2AG8A 5AKJA 4D4MA 4WTOA 3RUDA 5EJ5A 1XMOB 4H7EA 4DCNA 4OXKA 4BGVA 1KO1A 2G6TA 4P6VF 3VPXA 1V5WA 1R0ZA 4EG8A 5MGNA 1E3DA 1S5PA 3BTUA 1Q6YA 2L17A 3D64A 4UAVA 2ZRCA 3SLKA 2F1HA 3E81A 2I8LA 1KYXA 2JEZA 4OA8A 3DFIA 1JFTA 3WLPA 1FFEA 1YBVA 3OM8A 1BI4A 2E89A 3PJDA 4ZC8A 2BSAA 3R3LA 3CCEN 4L0MA 1L5NA 4B3BA 5L8VA 4JY7A 1NG9A 3AHEA 1G38A 1J54A 4ND3A 4OPAA 1ZOLA 2J5QA 1FNNA 3CLTC 2Q46A 3HWRA 5TJHA 2H17A 5BRAA 5I7VA 2B8EA 3HA5A 4KH0A 4JL6A 5KSPA 4Y6QA 1QE0A 2G77B 1Y4SA 2YFKA 3L5OA 3ILXA 1RAEA 2VT3A 3NTXA 4IDFA 2WHQA 5I9NA 5IYZA 4HFMA 2QL9A 4HUQA 1QH8B 5DBEX 1NXOA 1I3KA 4R40A 4AY3A 3WDMA 4G8DA 4Q7KA 1TKZA 4RULA 3MT7A 4GOMD 4DUYB 4ISGA 3H9GA 2XTNA 1OH7A 4NZPA 2H4ZA 5AIBA 4OD0A 3DDWA 1R8YA 2KLHA 4MUYA 4DCJA 2AFVA 3AEQA 4TGLA 1ST2A 5IK2A 4M1EA 4RGBA 4PPQA 2QM8A 3LT5A 1XZCA 4RKYA 4DIMA 1FXXA 1JBQA 5SZIA 1K1EA 4ZT2A 1WU8A 2XA2A 4QPCA 1AXEA 5BSFA 3SLCA 1EX6A 2IHUA 4UTXA 4FCWA 1GAJA 1X7WB 1T0UA 1QVFM 1X77A 2HA2A 2HEIA 1E2UA 3WGMA 4OVLA 3QI7A 3HJCA 4NMHA 1FL9A 1FDWA 3N8KA 4OAOA 3V7WA 3EGXA 4ZHRA 2X14A 4Q00A 4ESVA 2YV3A 4X63A 5CNKA 4FI3F 5T41A 2DERA 2IYZA 1IY8A 3ZE1B 1SY7A 2XY4A 4O8ZA 3TCXB 4R5MA 1EDBA 3MBIA 3P94A 1KP2A 3N2GA 4RY2A 5DHFA 3S70A 4D4JA 1CE8A 4TWRA 4FPAA 2WIFA 2A40A 5EKSA 1U2PA 3G5UA 5JCZA 2ZRDA 2P51A 4FS3A 4G41A 4TV8F 3TSYA 2H0RA 2AOUB 3DD1A 2E5WA 1TYAE 4Y98A 5GM1A 1GRRA 4EABA 5JASA 1HEUA 1JU4A 4KAZA 2HIGA 1BIZA 3LT1A 2HF9A 3N0TA 5KQPA 3I5XA 4M3ZA 1XA0A 2ZWVA 2OV1A 4G63A 1NSFA 3K9JA 3CPSA 2ACKA 4QEZA 1IBKK 4PLGA 3REOA 4CM8A 3O9QA 3KOWA 1DFIA 3QEKA 2OGZA 3QWIA 1DU4A 2RGNC 4MXDA 5H16A 2X0KA 1F6BA 2PX8A 2WG2A 3D3WB 3TW8B 4DWOA 3PDCA 2GZAA 1EUCA 4I19A 2NUAA 4JP5A 4BZZA 4A0GA 5KMGA 3THYA 4GPIB 4PW0A 4YP7A 3MF4A 4BO8A 3L8MA 1K6IA 5ADXA 3IA7A 3WLFA 1R5BA 3ITKA 3VKFA 4J1TA 3X1YA 4CI6A 3AQ4A 1WETA 1AKMA 2J7PD 4CERA 3MTBA 4R1QA 5JZOA 3PQFA 2G72A 4NEHB 4F38A 1QU2A 1QHNA 1GL6A 3C3MA 1KEEB 5D01A 2O4IA 4CLEA 2IXTA 5IMSA 3SQ1A 5LXTB 3F5TA 4ZVVA 3R8FA 4CGHA 1GNRA 1HH4A 4BRZA 3ZIAD 4C6TB 1FZQA 3IDSA 4LPSA 1VHWA 1T13A 2R6DA 3H2HA 3EQ2A 1F2UA 3FGOA 3V9UA 2W93A 2YWCA 2VYNA 3H4MA 1EUCB 4KQKA 2B78A 5F7OA 3SJ7A 2FJPA 2P4HX 2HWUA 3F2IA 4FZYA 1NVAA 3GDWA 2EV9A 2SHKA 3G0GA 3UOWA 4ZI3A 7MDHA 5I45A 2ZJ8A 2QROA 2Q50A 4DXDA 1L6RA 3OFNA 1XZ8A 2GF9A 1RJFA 1CUXA 2Q0XA 3FBTA 3E7PA 1DIRA 2HPVA 4JYBA 2OUKA 2RC5A 2QQ0A 5FA5A 1SL0A 3TMYA 3P9XA 1FFYA 4F84A 2Q6KA 3B6EA 3X2SA 3NHJA 4AF6A 3HZOA 4FVUA 2EFYA 2KTQA 1SFRA 3W3DA 5FTNA 3ZG6A 3H7AA 3QV2A 3VYSB 4KODA 1AH2A 1D4FA 2FF5A 1R7RA 1G7TA 1BKYA 2OE2A 3Q2IA 1YA8A 3ONWA 2VAPA 1SL1A 1QFJA 2OV8A 1HDIA 1U99A 4FLTA 2BJWA 2RHDA 1N6KA 3AR4A 3I9V1 2MOKA 4LRXA 1X7DA 3GEBA 4RLQA 1ULHA 4TTRA 4WZBB 1FLDA 1Q16A 2QZZA 4YOUA 2Z2ZA 3TR0A 1VDMA 1O5IA 2FPIB 3VR4H 1XQ1A 1YQXA 2Y1FA 3MINA 2PRJA 3ZUPA 1AKRA 1D0SA 2GT1A 2VCEA 5CT9A 5BQXA 2CUZA 4IXCA 1WLYA 1G55A 4A2WA 4LF5K 4HLNA 2PWYA 4KK4A 1W96A 2YJZA 4FM0A 3LI2A 2HBKA 1HYSA 4MZDA 4KLRA 1EUZA 1RRVA 3K9BA 4BQIA 4QO8A 3I9FA 3VESA 1NK5A 2CDCA 3JSAA 4L08A 3IPRA 4RANA 4UBIA 3AHCA 1UODA 2M6KA 3RU2A 1EK5A 2YUTA 3OFSA 3OYHA 2QY6A 4PSUA 5LB2A 3B38A 3IP3A 1RNLA 2W2OA 1R74A 1LK0A 5KOHB 1VAZA 3OTOK 4ADSG 4TSFD 1JQAA 2GXQA 5BV0A 2C07A 5JNLA 1JG7A 4U2DA 3Q7SA 2JAUA 4WY5A 5H81A 2V58A 1EUYA 2CZCA 3V8NA 1C3JA 4AF8A 3PDIB 1XK6A 3NPMA 3PFIA 3WGTA 1G7RA 4KGXA 3WISA 3EH2A 3L6OO 3HPGA 2WAMA 1YULA 3KTDA 4F72A 4J8FA 3RRZA 3OTOB 4IWYA 5A0VA 3KIPA 2NSYA 2FMUA 4GX1A 4IGKA 4KWCA 3RLIA 1TA4A 1D8YA 2P1ZA 5E95A 1KMMA 2B21A 1I2BA 1VHXA 3C6HA 1WU7A 1HTBA 5TQJA 4CEQA 2P0EA 3NBQA 4N3AA 4F3KA 2JLVA 1W4AA 7GPBA 1WZ2A 3L9XA 1VA4A 3OQIA 1U2GA 1A7KA 2WIDA 2SECE 2AEFA 2XY7A 4PRKA 3GGPA 4CV1A 5CCEA 2G9UA 1DC3A 4QSMA 5AQJA 1IIRA 2ACEA 4LPKA 3I56N 1VSFA 3FJOA 3EF3A 1L1QA 1NF8A 1S72N 3G7UA 5HF8A 2IXFA 2HCFA 2N3ZA 3K0AA 1H2BA 1V8OA 1Z73A 4RXTA 3RT9A 3QBVA 3W05A 1CXZA 3ZD6A 3QUSA 4UOQA 4WXYB 1H5UA 3L7CA 3K9WA 5FA8A 2HNYA 2ZGZA 4P33A 4TL9A 4KTZA 4PQYA 1JYSA 3EGEA 3U7QB 1AUVA 3D5QA 1T6XA 3C74A 3QVKA 1U7OA 5JQGF 3A9RA 3HN7A 3TQQA 2DUNA 3ROZA 3S1SA 1U81A 1JLSA 3H2YA 4ZI7B 4FSXA 2O8EB 4E11A 4ETNA 3ZSYA 3AA4A 1XTVA 3ZGNA 2VA9A 1K9MO 3QWAA 4CODB 3HVKA 3LY5A 3T9FA 1HNXK 1ZXXA 4YDHB 1GRQA 4DTUA 1RTJA 3I04M 4KZPA 4PLZA 2ZQBA 4PVDA 4QRHA 1DZ3A 4X64K 4W5RA 3TRFA 4DJTA 3GL9A 2BGKA 2WT9A 2XYGA 3CX3A 3LPLA 2WPDD 1T2CA 1UM8A 1IYZA 2C2GA 3HDVA 3TJMA 1O6ZA 3L4SO 5FBVB 2J9ZB 5BV8A 1UBHS 2ZRNA 2BYTA 2VZLA 3CUEF 3KR9A 4GL2A 3F9CA 5GAGP 3A4VA 2WT4A 2OPSA 1P0FA 2QRNA 2BI7A 1NBIA 1G8YA 3P83D 4HUEA 2RBEA 3C8ZA 2ZIAA 2O8EA 2GUIA 1W581 4Y2XA 4CNBA 1BXGA 1C9KA 2HNBA 2G9RA 2AOVA 3BUSA 3UBMA 3KZNA 2FOIA 3M6IA 3KB6A 1ZW6A 2G07A 5A4DA 3H2BA 3IKMB 1N1MA 3OLYA 3BQ9A 5FFFA 3W2IA 4H7JA 2A42A 1N32K 1IBMK 1T2VA 2JATA 2QI2A 2MIIA 2AOTA 3GA5A 4WZBA 1HPZA 5JO0A 3BXEA 3LAWA 5LMNK 5BYBA 3BWYA 5F9MA 3OQPA 3FB1A 4FP9A 1J06A 2VHCA 3RRNA 2DRIA 1MDBA 1ULSA 1NKBA 3NETA 4C43A 1QYDA 1DIAA 1IBLK 1I39A 3BE5A 3E9ZA 2WAAA 1IC6A 2YZMA 1P8AA 3UPTA 1ODCA 4R6XA 4LVCA 1U8EA 1PVOA 4QOZB 1ZGGA 1OFUX 4V0QA 4PA1A 3ISTA 3N5CA 1E3WA 1O5OA 2A2ZA 4CF6A 3T19A 1VHLA 2AD5A 1PZNA 4HPXB 4L95C 4B2IA 4QUAA 4YALA 2JK1A 4U7GA 4CHNA 3TSWA 4PNEA 1VMEA 1AS3A 3B20A 4NYJQ 3HKBB 2AUNA 3HM8A 1JKJB 1T36A 2BF7A 1JIVA 2CFRA 3MCAB 1FC0A 2JFOA 2QZ9A 4H0FA 1NGCA 1V4SA 1YKSA 2O0MA 2ZIFA 3COVA 3OCJA 4ECEA 1ZU4A 4PZ9A 5REQB 3C70A 3H75A 2DTUA 1EK0A 2H4XA 2V7PA 2CGKA 3D81A 3KZOA 2I1WA 3EFOA 1PDVA 4KYIB 1ENPA 3T3PB 1K8AO 2W7TA 3S3MA 4B9TA 4EO9A 1QF6A 1OREA 1PV1A 2P2SA 4IGIA 4JI1B 3U44A 2GARA 2AB0A 5E2IA 1H8HD 2WTUA 2WG1A 3AVNA 4TS9A 1BG3A 1PL7A 4ESOA 1RLMA 1NI5A 3M6VA 3QY0A 2BGWA 4YDRA 1C3OB 5EEGA 5I42A 1MRSA 1Q2UA 2P77A 2EZTA 5CAEB 4ARCA 1OASA 1J8DA 4D8TA 2LNDA 1TM4E 4DDWA 4I6MB 1USUA 1ZBQA 1ZM9A 3COZA 4HAVA 4QBIA 5AI9A 2W2KA 3T4EA 2OOKA 4ZJZA 4IWNA 1VLLA 1Q7YO 3OTGA 4Y9DA 5AM4A 2OILA 3WDKA 3CB2A 5CX1B 3A10A 5IJAA 2BGIA 3GLUA 5ALVA 4ZOEA 4LI3X 3HCPA 3PQ5A 3ID6A 4IEFB 4G5QA 5EXWA 4W1PA 2FW7A 1WXHA 2QHXA 3ZKAA 2R6HA 2QTAA 1R10A 5C5EA 1KERA 4UTVA 2X3FA 4CBWA 1CJTC 2GJ9A 3M34A 4OUDB 1YCDA 4WHMA 4ZQEA 2M32A 5GVRA 2YFYA 3C5CA 5F7XA 3SNNA 1JA9A 3MCVA 4RF4A 3TLZA 1MORA 2OFFA 1IUNA 1K27A 1U28C 2MSCB 4LSWA 4BMVA 2J7PA 3WUHA 4A3SA 4V1CI 4UQGA 2V6GA 3QICA 4PANA 5P21A 3UK2A 5JNRA 3AJ9A 2D0OA 4YLEA 2K6GA 3JD3A 1MO2A 4YGYA 1NLMA 1JAXA 3JAMO 2ISCA 1WF3A 2Q7OE 1PEYA 3VJKA 5C7LO 1EAYA 1JEEA 1SU4A 4DR4K 5CIQA 3RK1A 4RPLA 2H2AA 3NHZA 5AVXA 3BT7A 2OGSA 1OJLA 5CLGA 5EIFA 3VQTA 4ZYWA 3EAGA 4QODA 3N5KA 1UFRA 3T4XA 2I2DA 3HXMA 1LA2A 3JCZA 3EZYA 3FTQA 4B2LA 4QECA 3OJ0A 3R4VA 3OZCA 4OGCA 1RAAA 2VK8A 3C45A 3HYNA 3PI7A 4PFSA 5EXDA 4B1YB 4OLFA 5IW8A 4AJPA 2FP4A 3LPCA 1BA3A 1O94D 2H9YA 1EK6A 4UC0A 1BS1A 1LAWA 2B98A 2D0BA 5F2KA 3VH1A 4KHPK 1KJWA 3ENNA 3DFMA 3OYEA 5CVDA 5EXXA 2RKIA 1Y1RA 5IP5A 2ZRPA 2NRHA 1PZHA 4RLSA 3RTBA 3BPSA 4C06A 5EWJA 3OZAA 3RYTC 1RMYA 3CU5A 4WQ5C 4R2XA 3O8BA 3GLHB 1NT2A 3T3GA 1E1KA 1M8PA 2YHYA 1UUFA 3AJAA 3KXIA 3ZDEA 3S3OA 1QH8A 2VR1A 4B17A 3BL5A 3JQ9A 3CG7A 4CIFA 4RDIA 1X1DA 2WAYA 4L9RA 4MI3A 1L5WA 2O8FB 3LSYA 5I8WA 3Q2KA 3CM6A 2GN9A 3GUCA 4HBGA 1IG8A 5EZSA 3GRUA 3ZD7A 2IDKA 4TV9A 2BH1A 1E63A 1YDGA 4G3XA 4D5GA 3RH0A 1XCOA 2TSYB 1JBKA 5HUHA 5HVNA 1GKYA 3RK4A 1LBIA 4HQFA 2IGIA 1F0KA 3AINA 3OWXA 3RHSA 4BB5A 1C1XB 3BRWA 3LVRE 4AJOA 4YJ2A 1Y5IA 5KSWB 4B3CA 3W3ZB 3CFPA 2YNFA 2BMEA 3PC8C 5EP4A 4CEHA 3EKSA 1CY8A 5L3SA 3T5TA 5LLTA 4UREA 3K5PA 3CCVN 3A11A 1EBBA 4LYEA 4ZAVA 5D3MB 1NJWA 1PJQA 1TT5B 3H3XA 2NO7A 1WBDA 2Y1WA 3Q12A 4NDNE 4D45A 5C8YF 2XSZD 1QYCA 1SKAA 4MUXA 1JDBB 3WKAA 3HU5A 3NT5A 4YOVA 4KBFA 1C1BA 2IBTA 1IUKA 8ATCA 1DADA 1YIDA 3NW9A 8OHMA 4MIEA 3LP2A 2H7CA 3IHKA 4MVJM 1NOKA 3LOUA 5G02A 2OLEA 4BNDB 4JHXA 2NXWA 1NF2A 3BXOA 3HCDA 4M7PA 5FV7A 4FDTA 5B8HA 5ETJA 1NJZA 1FNBA 2IEIA 5F76A 3GVCA 4ZWNA 2GX6A 4IHJA 3MAAC 1T7PA 1ZZGA 4YMUA 4YR7A 3FWPA 5KTQA 3VYUB 1WPXA 1F8UA 4OJTA 2VJOA 2PMEA 1WHTA 4JHDB 2AD1A 3GLRA 3HCOA 4JI6B 4EVIA 4AQDA 3EVBA 4HMOA 4LDNA 1E3TA 5JCPA 1NMYA 2B36A 2HO4A 3O1IC 4GPAA 4J6EA 5DWVA 1EP4A 4CZ2A 3A1FA 1BGXT 1U5AA 2E9SA 2XR1A 2BVNA 2YWBA 7REQA 2EZ8A 3ZETA 2NTEA 4MW2A 2I71A 3TABA 3MEDA 4XKJA 4XYBA 4IQGA 4O2AF 4FYYA 1LNZA 3DBLA 1HFWA 1XBTA 1PFVA 2P9ZA 5C10A 1XJWA 4GMDA 2BM8A 1NJ6A 1DG1G 2R8YA 1DRUA 4BLVA 5DB4A 4AJLA 2D2XA 4YCDA 2R2GA 1XZNA 4L02A 3IURA 1KJJA 5DIFA 2VJPA 5AUPB 4PPGA 5F3DA 2IY9A 1H3EA 3SDBA 1T8YA 1ZOIA 2Q1YA 1BS9A 3HBFA 4POAA 1GGEA 4AN4A 5LP6A 1E0AA 3Q0IA 1GOBA 4QULA 1EI9A 1WCYA 4GGMX 4QDKA 3NKFA 3OG9A 4GVXA 4M53A 4OK3A 1XXHA 5CA0B 3V4RA 5HX7A 1IOVA 3BIOA 3LPUA 5BREA 2SNIE 1ZBSA 1NV9A 1RJGA 4JX8A 4R9SA 3IVRA 4Q4JB 3UAGA 4EJSC 3DLTA 4Q9HA 3EOAI 3N86A 4EUNA 2F17A 3HPOA 3ZY5A 4ETIA 1NMDA 3G5MA 4OX9K 3EO3A 2AG0A 4JC0A 4LXHA 4YJ2F 3PU6A 5I9MA 1KE2A 2LW7A 4DSAA 3KETA 3ILYA 1JHDA 2ZYIA 3AVKA 5A3QA 3PGA1 1U2GC 1YACA 1CEQA 4NV1A 4QO7A 3H8VA 2GBPA 3MLAA 3A26A 4WXHA 3P0HA 4YQFA 1QONA 1JLCA 1TM3E 2PS0A 2OZSA 2ODBA 3FNEA 5IJ0B 1LVHA 1CLEA 1JWBB 4X7MA 3DE4X 1AK2A 4M2LA 1Q11A 3KQWA 2BGGA 4FNOA 5JI2E 3QVSA 4BNIA 1QK3A 3UYLA 2PO7A 4TYQA 3HGTA 4IX9A 5B3JC 4HAUA 3QOWA 2TMDA 4UEKA 1F8FA 3GRAA 3FHJA 4K2AA 5E26A 4KV7A 3BGRA 3I2YX 3K5LA 4GPEA 4M38A 1IM2A 3K58A 2BBOA 5HXAA 3ZDYB 5AW9A 2D7DA 4NB4A 4CMCA 4BMDA 2KW5A 3QVWA 5K20A 1QQ6A 2CLKB 4WDQA 2NUTA 2NT4A 1YR8A 1IWOA 2LIVA 3GGJA 3PFKA 4HGZA 3VMMA 3D2LA 2BGJA 3P0FA 1K6XA 2BL4A 4ZMBA 1GT6A 2NZ8A 2I6XA 4OJRA 4FJGA 3ESXA 3CS3A 4YT8A 4XEHA 2C1EA 1GZDA 2FMTA 2QRVB 1CEYA 3CVUA 1PR2A 1OVMA 2HQSA 1W36B 3QW2A 1KMNA 2AE2A 4B6FA 4ER0A 5HKOA 2OKCA 4ENPA 3TAFA 5GY7A 1U31A 2A4KA 1QZ5A 3L8HA 4FMCB 1IZ7A 1R88A 3TYXA 2NU9B 2HHVA 3BXHA 2WNIA 4PTYA 3IBGA 4AROA 3ASZA 2GJKA 5BSGA 2XDWA 1P2UA 2QRLA 3FYHA 4J07A 2LZ0A 2HFKA 3B85A 3TOSA 4C01A 4ICIA 3B8EA 4ITVA 8LDHA 4DFJA 2IOFK 3AO0B 4PLFA 1ZSVA 1KYIA 1XSEA 3HKDB 2UYHA 1RRCA 3B6OA 1KVUA 3EXIB 1KFSA 3GK3A 3HRGA 4QLBA 4J0DA 2Z98A 1P4AA 3DONA 1Q1EA 2H4JA 3ZWPA 3RSEA 4B71A 3AY6A 3WK6A 5ITSA 4BX3A 1AD2A 3JYHA 2QK9A 3PQ7A 3T7IA 2V5AA 5T5QA 4AW9A 1Y1PA 2I6TA 3BH6A 1L6IA 2QRVA 1TA9A 4B1XB 1YB7A 1L7NA 5I9SA 1K7XB 3EASA 1NK8A 4FJHA 5JSZB 1I0LA 4JFRA 2OCEA 1F51E 3ZS9A 2YHIB 2C4WA 5AZJB 1VB5A 5EIWA 2WVGA 5F2OA 3SS7X 3WBKA 4CKEA 1HYGA 1DC7A 1IEVA 1XD9A 1U2TA 2BFAA 2A3NA 3VZQA 1E1RD 3WLKX 3SF0A 1U2DC 1YZVA 2XTJA 3CBGA 4Q9AA 3CH5A 1XO1A 2JLSA 4YHHB 1VSVA 4XM0A 3AM1A 1ECFA 4DKWA 4ZQCB 2OHFA 2H3GX 4Y9SA 5H3CA 4P54A 2WJIA 3T9DA 5CHEA 2CXRA 3EIUA 3TQIA 1EFPB 5ALWA 1L4BA 4HYQA 4H0XB 3HA2A 1YL7A 2KYRA 3RANA 1K6JA 3KDAA 4DR3K 1GZUA 2GXSA 1CUCA 2YY5A 1KGDA 3HR8A 3GCDA 1MDUB 2Y93A 1TZKA 4DB4A 4FWLA 1BIUA 4RTLA 1FU8A 2QVLA 3DFFA 4QDZA 4BG9A 4MWEA 4GPZA 5LWQA 4H35A 4IY1A 2AKEA 2JFQA 5LNK6 1T6YA 4EARA 1PR6A 1LWEA 1NW9B 1UFQA 2A9OA 3LM8A 1V9LA 3MVEA 4MW6A 4YDSA 1ISHA 3FTCA 1GL9B 1XAJA 3RVMA 2EW1A 4EG4A 2G0TA 2BFWA 2C5SA 1B0UA 4MMXB 3KHTA 5B57C 1KQPA 1OF1A 3HU3A 5CDUA 4O4JF 4EGJA 3AM3A 3HUFA 2FSHA 1COWA 2CLEB 4GD3Q 1JJAA 4I08A 1SUIA 3ME5A 4P3NA 2XMBA 4U1RA 3S5UA 4NOMA 3NM6B 4E7PA 1L3SA 4DMGA 1Z36A 2G8WA 1K3TA 2QL6A 1FU7A 5H8WA 3U4QA 2JH8A 3KAPA 4IAOA 1DO2A 1KQSM 3WNGA 1TGYA 4JKGB 4DJFC 2PKRA 4IQ8A 2W2MA 3THXA 2WVHA 3MWEA 5JXGA 3W5AA 2G36A 2O52A 3ETHA 1TUUA 4JEHA 4OI2A 3U4GA 1RFGE 1RI2A 4R8SA 1HBJA 1XQXA 4ZODA 2IS4A 4G1MB 3PVZA 2AN4A 2C1ZA 3A6FA 1P33A 2HJRA 1AUXA 4M9XA 2FMKA 4KK3A 2OXTA 4F5WA 4HAWA 4TZKA 5AJVB 5BUCA 4C5BA 4KGDA 1W4ZA 3SAFA 3KZVA 3OJXA 3K9HA 5LQCA 4MMYB 5KC9A 3COJA 1G8SA 1WDMA 3SXUB 3L84A 2EJVA 2YWFA 3VEWA 4DV3K 5EHIA 2B3TA 4FHDA 1T6BY 2BEUA 4JI2K 2E85A 5AQSA 2JFHA 3HVIA 4RMJA 5HJ2A 3EIXA 4BNLA 1CXUA 1MZVA 3RWOA 1E2FA 1JFLA 2JGUA 4WRRA 4LWZA 2NO0A 5HM6A 2UUAB 2HIHA 5U1PA 4Y2JA 4LFCB 5AKZA 3LDNA 1CZUA 3UHFA 1V8FA 3V8PA 1EGMB 4M36A 2I7PA 1IZ8A 1LJLA 2DTEA 2H0AA 2UVPB 5BSWA 4DR7B 2L2QA 2OB1A 2A8YA 3QJYA 4M8LA 2P6MA 1KDPA 5LLDA 5KGXA 1OWMA 3AVCA 5DPMA 1T2DA 4R1OA 5E7QA 4LFCK 4A16A 2JHGA 4OKKA 3CF4G 5I3UA 3DWFA 1B8UA 1YUWA 3ULDA 3EW7A 3HUTA 3PLRA 1D9ZA 3GLIA 3OKPA 1VJTA 3L8ZA 2JCVA 5TS3A 2CL5A 3PYLA 1SV5A 3IQGX 1ZC4A 3KZCA 3RHTA 1QPZA 2NRRA 4IH1A 3VHQA 3ZDDA 1R6UA 3SBOA 5C18A 1P62B 2VZ0A 2FG7C 2YJFA 4DQ0A 1PD1A 2F3TA 2WV7A 2Z9CA 1IB6A 2NVUB 4HWIA 3HMKA 1IMOA 4LVOA 1JHOA 2FFHA 2VUIB 2REOA 2W9XA 3D1VA 4QPJC 2IPMA 4HV4A 5FNVA 4QCLA 1WDLA 5DNCA 5LOVF 4QAGA 2C7QA 4V1CA 5ALNA 4EZEA 4L8WB 1U0OC 4KH4A 4B9QA 2GD6A 4YRKA 3DLKA 2AFHE 4GU5A 2KSQA 4BO7A 3EY1A 3OQMA 4OLBA 2W0MA 1C1CA 1KPGA 2ZS8A 4ZA2A 3WSWA 3QPWA 4B3OA 5HRPA 1JGTA 2Q6VA 2QX9A 4E5YA 1OH5A 4KIGA 3EQ6A 5LJIA 2NZ2A 4JKYA 1ADBA 4BOYA 4HFNA 3AVAA 1XRQA 1ZWLA 4CJLA 3OIVA 5JADA 1YRYE 3W6NA 5CFOA 3P9KA 3NHYA 2V6IA 3E05A 4CCWA 5LM3A 4AQYK 1IBRA 2O2XA 3TE6A 4CJ3A 2F4VB 4Q02A 1KIAA 1XMIA 2QJOA 3OZFA 4N76A 1T24A 2CZQA 1VHTA 4KHUA 2Z5GA 4KOAA 2H7XA 1O89A 5AJUA 3UGQA 1MIOA 6ABPA 4BUJA 1ZPDA 1A7AA 5IX8A 2UYGA 2AWOA 5CM2Z 2O0HA 5TQ0A 1A9SA 3K4QA 1ZI8A 1UADA 4D57A 3TUIC 2FZGA 4UHFA 4M60A 4B4VA 2YKMA 4DMFA 2JHAA 1SUFA 2ZJ7A 4RKQA 3ND7A 4ZAFA 4MS1B 1KDTA 3RKSA 4KITB 5JJIA 2AHOA 2UXCK 5TJ9A 1YAHA 3QSYA 2Q4EA 1HK7A 4OHRA 5TMBA 1KOLA 5A5DA 1KTQA 2ZJ4A 3EB9A 4KI7A 4CLXA 3NIBA 2P2CA 2CYBA 3D2FA 1N1GA 3M6MD 3ORRA 4UU1A 1HT1E 1TUBA 4D8UA 3AA5X 3WI7A 4HDKB 1J2JA 1U4SA 1SULA 5I7FA 1RTHA 4Y2RA 2VYFA 2UXCB 1KO8A 4L6AA 4Q4HB 3ER9A 3AI1A 2XBLA 3UK6A 1F1BA 2P9KA 3GR6A 4MPRA 5FWYB 5TT1A 1M1YB 2UZ1B 3NYIA 2IPNA 721PA 2EZUA 2FPXA 2ZRGA 1EGVB 3RVBA 1XE3A 3IFSA 3CQXA 1I7DA 2G5CA 4PTLA 1M2JA 1KI6B 3THSA 2NRXA 3WXKA 1UPTA 2ZVDA 2A6AA 2YHUA 2WTNA 1JTVA 1EK2A 1GDDA 4JZKA 4TL7A 1JFFB 3P4UA 4MA0A 1A77A 4O3FA 3NEAA 5JG7A 3SJZA 2VDLB 5AFUA 3HFSA 4C0XA 3E70C 4HAXA 6REQB 4ZVNA 1YKGA 2K2QB 1O03A 2ONKA 2CUKA 2SKDA 1ZIOA 3EG5A 3SBGA 1USWA 4W7HA 4RAQA 4Z8YA 2R86A 2YVLA 3BD9A 3E7DA 3LC1O 5LMUK 2W58A 3FPKA 4L73A 3CGGA 4KPUA 5AJWA 2Q5JA 1DEJA 3VF2A 3RSLA 4YIHA 1YS4A 1CEEA 1UM9A 1W94A 4D82A 1VQON 3HYLA 2H65A 1IG0A 3B1YA 3JWGA 3FA2A 3QFRA 4LJ4A 4PYRA 3S40A 3TD6A 4YT4A 1D0IA 3LX5A 5G0UA 1I2MA 1JXEA 2I6UA 1HL3A 1OBCA 4RWTA 5BPFA 2QMZA 3E0QA 5K03A 3FPHA 1QNFA 5HE8A 2HHJA 4GZMA 4EJFA 3LIIA 5J5AA 1G42A 5CDTA 2EW8A 3MOGA 2P41A 3ZLJA 4EO4A 5KKAA 1DGKN 2GJAA 3HB1A 2BLNA 1KFJB 4WXRA 3RIHA 2JCYA 2QYTA 4IOLA 5EC8A 5M1QA 3AFMA 4YRPA 3K0EA 3DMJA 4DRXB 3GUHA 4I9UA 4DSZA 4EG5A 2DETA 2D5LA 4DW8A 5TE9A 2HA4A 4I5EA 2FK7A 3LLMA 3ZE9A 3ZCQA 1E9DA 4M8KA 2HBLA 4S3MA 1F48A 5ENZA 3WWOA 4FOEA 5AR0A 2HV8A 2NLOA 3BK1A 3PVSA 4DLUA 4W9NC 5DSTA 1PJAA 2QSJA 3NGYA 1KEUA 1WHTB 4M0FA 1D03A 2WIAA 3D2AA 3B1FA 4LXGA 4HAZA 4MROA 4W82A 3QE0A 2KLBA 3GPCA 3LBIA 3M9LA 4KNWA 5EWMB 4Q19A 4KSYA 2W6QA 1U63A 4EQ6B 2I4IA 5A2QO 1CFJA 5C8YA 1JL3A 3RTEA 4ELVA 5ALEA 2N75A 4INAA 1OT3A 1X7XA 2YV4A 5DN6A 5IKMA 1QVVA 2J0EA 4IJNA 4ILKA 2Q99A 2QTZA 3QEAZ 1Y1LA 1QZ6A 4CCYA 3O4WA 4CIXA 1UKYA 3MC1A 2QWPA 1YQQA 2VDKB 5FBKA 4EFLA 3PSIA 1U2EA 1BFKA 2VNIA 4PX9A 1J97A 5BW4A 4OJKA 3UMGA 4Y1GA 1JYFA 1BQEA 4CMAA 3LX6A 1M3SA 1HDEA 3RIXA 3NH2A 3SCZA 4C2TA 4H7IA 5K51A 4OK5A 4QWWA 3RR2A 3T35A 4BHTA 4EA8A 2VF7A 2ORWA 4QQ8A 3CR3C 1QF7A 4YCAA 2EGUA 4N5IX 5FTMA 3RVPA 1GLCG 4BLQA 3LHSA 4ERNA 4DR1B 2FWMX 4GX5A 4ND8A 3TQHA 3VQQA 2P6OA 4JU9A 1WR8A 2VGMA 1DO0A 1PG5A 1LRJA 1Y3HA 2LXNA 1LPBB 5KTOA 4IGEA 5I7HA 5JFOA 3RS9A 1CZOA 2ETXA 3D54D 1QHXA 4C8OA 1NAIA 5E3HA 1HEYA 2CE2X 4MV1A 3O08A 3WFZA 3F2VA 1E1CA 1I6LA 1H3NA 1E7MA 2PWZA 1GFWA 3TZLA 4YORA 1D2RA 5ICMA 3THVA 1PN3A 1HRKA 4MQ6A 1N36B 4HMPA 2YWJA 3B6IA 2CWWA 3DZIA 1WCV1 4JB2A 4M3UA 4JEMA 4AULA 4EUHA 4Y1CA 1I9GA 1PHPA 2Z1MA 3D6RA 3RC9A 1DCFA 3EDYA 5AT1A 4JXJA 1LPNA 2ZYUX 4L0QA 1IBMB 3R5KA 3LCRA 3EXAA 2GM4A 1GPMA 3TTWA 1J1IA 2YNHA 2QXTA 2Q0RA 1L7RA 1C8LA 4U39A 2RB4A 4UDXX 3ZWOA 2G06A 3S1AA 5CXUA 3TKLA 5JC1A 2HDOA 4OGWA 4RW7A 2QUKA 3MFQA 4LI0A 1VL0A 3ETGA 2C2XA 4P8RA 3ABIA 4ZOLB 1WVMA 4JR2A 3RFTA 3V97A 4MQ4A 4D4IA 2ZB4A 3LCJA 2WBLC 1R0XA 4EJ0A 4Z6KA 4EHNA 5AQYA 4F4JA 1JB9A 4JJIA 1TGOA 2QUAA 4GMXA 1YGYA 4L5BA 2BGLA 2TYSB 3WQSB 4H5WA 4BR7A 1R5JA 1LLDA 5A5GA 3IJ5A 3ENZA 4AHUA 1FBTA 4FQ5A 1PE0A 2FPIA 4EP5A 1IV0A 1WNFA 4LSGA 1CW2B 1JG1A 3OKCA 2YOFA 3H1PA 4UBNA 1TM2A 1NXPA 3GNTA 3O8NA 2G8IA 2SKEA 5EESA 4YJDA 3FVVA 1EUQA 5KOJB 4NBRA 1JSRA 3OLQA 5TSDA 4BACA 2CZGA 1XMPA 2EKZA 3WLNA 4AS3A 3IUQA 4MAMA 3S2GA 2A0KA 3Q15C 3JZFA 4P53A 3GJYA 5CPBA 3SE7A 4DFPA 1A1SA 1LX7A 2R62A 3GOQA 1MEEA 1X1AA 1HMYA 3E23A 3A2LA 4RA6B 1CUZA 2GD0A 1YRWA 3L1UA 3ZEUA 3R0XA 4TKUB 3ICQB 3WKEA 2XHBA 3H17A 1T15A 4CJRA 2AX4A 2D13A 5FR2A 5EIEA 3E48A 1VSEA 2Q5HA 3OPQA 1VJDA 2ZZMA 1NNEA 3BD6A 1IVSA 1AGRA 1VJRA 5CT5A 1L4NA 3OI7A 4WXMA 1GOCA 2C4TA 2RHJA 3S2YA 3IIKA 4DSTA 1LV5A 2WP0A 4JJ7A 4UAUA 4HDMA 3B1VA 3OX1A 3L4BC 3AF4A 2D1TA 3HN2A 3QVTA 1WD5A 1SCUB 2HYDA 1G21A 4S1NA 1IKWA 3W8NA 1J53A 3AF0A 1E7WA 2J0QA 4OKEA 3VAYA 4CF9A 1SAYA 2AT1A 4FFMA 4A10A 1N0IA 1VQPN 4N18A 1G99A 1KK0A 3GELA 3IO5A 3NUQA 4O55A 4NMLA 2DPGA 1XPJA 1ZJ4A 3F8SA 1H0SA 2AMVA 1EHYA 2ZWIA 3DZGA 3LO5A 4ZT4A 4TV8B 5C2JB 1VKHA 4OSPA 4DU4A 4D9NA 2X0EA 1ZD8A 2MINB 1QH0A 2XNJA 4LTDA 4DUGD 1CQIA 2AS0A 1BC5A 3FAZA 1XZBA 1FMFA 2XMDA 2I2BA 1U7ZA 3HBAA 2J5RA 3L8DA 4G4JA 4LG1A 3UMVA 2P9CA 1LX6A 1OXBB 1LW2A 2C3MA 4LZJA 5IT5A 2F3RA 4M9RA 1BRMA 3A7EA 2PA0A 1MH1A 3KSDO 5LKAA 1YS1X 3T5PA 4HLUA 4P86A 4HNUA 4IG0A 4RTJA 3M5CA 5JSFA 5IM5A 3IKTA 2OFWA 4LH5A 3C39A 3RTVA 1AKEA 1OXXK 4C08A 3BSSA 2EU8A 2GBFA 5CB4F 5CY4A 3OU2A 4C0JA 3OICA 3M4XA 2HT1A 1JECA 4G8JA 3MTGA 1S5JA 3CXRA 5F73A 1XN1A 2OMEA 1RKQA 1W88B 1M1NB 2PQ6A 4RLFA 2CLLB 2QRMA 4RTQA 5F98A 1XC7A 3ZTYA 1VQKN 3P0RA 2NG1A 1Q2XA 2A5DA 3AP2A 4LXTA 4MW4A 4P93A 3A70A 5ALSA 5BSVA 2D3TA 2UUBK 4B73A 2QY9A 2WQZA 3OZEA 3ZWQA 2FSJA 2A84A 3ONDA 4WZAA 1EX7A 1ST3A 4ARZB 1SC3A 3TRKA 1NGFA 1CQJB 1TZJA 3ON5A 5ALHA 4DTJA 3GRPA 2ZJQL 4N5LA 1D6MA 1FX0A 3R8XA 4WLUA 3GJ3A 4RENA 1DBIA 2E48A 1N3YA 2NRWA 1YNSA 1WLJA 3IVGA 1EGQA 3EH1A 1KKMA 4LYJA 4ZOCA 4LOIA 4D4HA 3BXGA 4JMLA 1Z4LA 3T54A 2HNAA 1SUWA 4MOWA 3IB6A 1YAGA 5CGQB 4ZV4A 4MVJH 2ZGYA 4ZZ3A 5AK0A 1Y64A 2FPPA 2GN1A 4IOCL 1BWFO 5KNBH 4CM7A 2WF6A 3NASA 5IPFA 1AXRA 1P4SA 1QV7A 5C2DA 1E8MA 3CIPA 1GCAA 4G65A 1ABEA 4I4IA 3WBFA 1RBQA 2YMLA 1CUIA 2CMKA 3Q9LA 4BC1A 1BU5A 1SOMA 3AU8A 3DEJA 3NT4A 1UK8A 2V4MA 3PIPL 4COKA 4HTUA 3GCZA 4LHWA 4EUKA 3WFJA 4EB3A 1VI6A 1ZD5A 2A9RA 2VJCA 2AXEA 4G5GA 5JAHA 3VTAA 2G9NA 3EPJA 1BVYF 3DQPA 4BJHB 4EKDA 3IUPA 5A2GA 3ALYA 5NLLA 4ZTUB 3JD1A 4QYSA 3K15A 3QIOA 4E22A 1BEEA 3RU9A 1JKMA 4QYTA 3DW3X 3RUHA 1HG1A 2X9GA 1GCUA 1L7QA 3GL1A 2FFBA 5KQSA 1BMDA 5DM0A 3ZSOA 1SM4A 3C6YA 3ATUA 3Q8XB 1X9SA 3CT6A 2QSZA 2HHAA 4FK4A 4OF4A 3V8QA 1Z2DA 4OB8A 3L93A 3IQEA 4TMZA 2XRIA 4PQRA 4O3MA 2PIAA 3AEQB 3BIJA 4MDBA 3IP9A 3I8SA 3QEVA 2VQEK 4HCBA 4R2LA 2IY7A 1Z3CA 3PQEA 2FRVA 3HM2A 5JVDB 3UA3A 5J4VA 5JFTA 2BMVA 5BORA 2XEDA 4M1WA 5ITZB 4X1IB 3MJHA 3NAZA 3ZJVA 1ITGA 1XWWA 4DV6B 4YCJA 4HEJA 2F8SA 4BZXA 1C7IA 1LQTA 1SEPA 2YYAA 4BFZA 1Y34E 2FF7A 1OFUA 4D42A 5AUNB 3ICEA 2GCGA 2EQ5A 3GZ4A 1U1CA 2X4LA 1QE1A 1JR2A 2NU6B 2AVNA 4DV6K 3MX2A 1SJ9A 1T8WA 1HT0A 2GEKA 3BFXA 1XEXA 4INPA 1YOBA 1LNQA 4UNRA 3RVNA 4G89A 4LX8A 2FW6A 5F7ZA 3SX4A 1HC7A 5KGWA 5D1HA 3TTDA 1MB2A 3SS9X 4BLSA 1UAAA 4BGBA 3VDMA 4RE5A 3OBIA 4YAEA 4DUPA 4G9BA 5SYNA 4CNQA 3I32A 1B1AA 4BQNA 3HK2A 3DMTC 5IFKA 1EMDA 1EP3B 1IAQA 3L7YA 1Z05A 4H59A 5DHUA 5AW2A 3UJ8A 1RQPA 4QGGA 4CM5A 2FY8A 1NP6A 1J4AA 1CZNA 1EA5A 1W5AA 2C2MA 2V5VA 3K2BA 4U3JA 5CFRA 5JRDS 1SZPA 1XELA 3LBYA 3MWYW 4O29A 5LQDA 4PFJA 1Y9ZA 1TRHA 1TQDA 3DBRA 2GZMA 4WYBA 4S2EA 4EYOA 3AI2A 3B8HA 3QXJA 1YHZA 4UXJA 2QTHA 3D7LA 3DYIA 4PXSA 4UHEA 1G3UA 1LI7A 4BKQA 1AKWA 1I5EA 4PZ0A 1QH9A 3N7AA 4C6HA 4LF9B 1NU8A 4J0EA 4Z51A 3JQ8B 4JRPA 2G4LA 4YDUA 3L79A 4MW5A 3NIGB 2FSKA 2RAUA 1TYQB 3SN6A 2NTVA 1AUPA 1PBNA 3PC8A 3U1TA 4K9LA 3L46A 4Q47A 5IVDA 1LC0A 3DWIA 4NH0A 1JH9A 1Q0HA 1S4QA 2FUCA 2QMHA 3I34X 5FXMA 3UFXA 2D3WA 2CJPA 1U2ZA 2J4FA 2R5FA 3AC0A 4P0TA 4CFYA 4ZJYA 4ZYUA 3MFYA 4BP1A 2WINI 4H3HB 4CKZA 2M2IA 3J80A 5B4UA 3OYGA 5DI9A 3EWIA 5BPLA 4UE6A 3CINA 2EHDA 4N82A 3U19A 1M8FA 3X2EA 1XL0A 2EG9A 4N54A 3KZXA 5JD5A 4CZIA 1HFEL 3GFQA 4JC5A 5GGYA 5L4NA 4EY3A 2AGVA 4KHSA 1N6OA 1X1TA 2DPYA 2GRAA 1S6QA 3G5LA 5BOVA 1VYHA 2FWAA 2PUGA 2BISA 3UJ7A 4CL8A 4U6NA 5K0FA 3JS6A 5CLJA 3D3KA 4RA9B 2GO7A 4MRAA 3ZT0A 3L7LA 4RORA 3EC7A 4W5JA 2WZBA 4I5IA 4RVSA 4WWHA 5G41A 3DVAB 4FHCA 4BV8A 4IXWA 3JAMA 4ZHQF 1KL7A 4N03A 5K09A 2IBSA 2GJ4A 1H5QA 3DOJA 3P9RA 3IFRA 4EZIA 4U2CA 5FA6A 4MGEA 3LANA 4FD3A 5HDBB 2AMJA 4G37A 5JOQA 5FWNA 1VE3A 4L2IB 1AG9A 1EDOA 4MRNA 3ETEA 1IWPB 1W73A 1UXHA 5F2RA 5M1OA 1CHDA 1VCIA 3I23A 5KVAA 1FDIA 1YC5A 4MS4B 2P9IA 1UT8A 1V4VA 5E9QA 4MLEA 1H4VB 5JDCC 5EJ2A 1SUBA 4J7AA 4U7BA 1Z6PA 2DT5A 5LP6C 3KELA 2WF7A 5T64A 3T5DA 4JHLA 4TYWA 2DH5A 4C1BA 4CFAA 1I7NA 3PD0A 5C25A 5EVJA 4OI1A 4BQEA 3PEVA 1E66A 1HA3A 1UBCA 1C1DA 1JKXA 4KIWA 1CRWG 1JB1A 3IMGA 1W29A 2YOHA 2Q45A 3D7RA 3BA6A 3L7NA 5E9JA 3ZYCA 4ED9A 4UOZA 2H11A 1RKUA 4CM3A 4QOFA 2PQ0A 4BBJA 3CPEA 1VQ6N 5K99A 3KE8A 4BQZA 4Q3KA 3QIAA 3UXHA 2IXDA 1GVHA 4PNPA 3BZBA 4GWKA 4NP6A 4IF6A 5HTOA 3K9NA 3AFNA 4HDAA 5I5EA 3CEMA 4K1XA 2P0YA 2BFNA 5DWDA 5FLEX 3ZHXA 3LUGA 5JWHA 3S81A 1ZSYA 4XWYA 1PJ4A 3SMSA 2NPOA 4YY3B 4HDOB 1RXIA 1YS2X 4ISCA 1PP4A 1AV7A 1S2OA 4AJ2A 2NO1A 5KYWA 1R6DA 2C9YA 2FFRA 4RZXA 2GTHA 1ZFNA 2C1XA 3TECE 4XGNA 5A2QA 1JEOA 3ILHA 2C95A 1YZLA 3CERA 4MKIA 3HP9A 4CD3A 1H22A 4IVPA 2G28A 3O3NB 4HB2A 4DMNA 1YIOA 2HKIA 3V4FA 4LFBK 3QX7A 1MEJA 1MA3A 3QX9A 4HEHA 4HWOA 1P5HA 3KTAB 2X22A 4GWLA 1RCHA 1V5IA 1WJGA 2FA9A 3LDQA 1UJMA 1NLVA 1RAGA 3CEAA 4N5HX 3MHTA 4LA4A 1NL3A 4YMHA 4I9GA 4UHBA 1NGDA 4XYGA 3RB8A 2Q5OA 1CP3A 4DEXA 1M0TA 4RU1A 3P2OA 3VYTB 1NGSA 2B6NA 3MXJA 2GA8A 2JKYA 3NU1A 1M2WA 4MUKA 4EHJA 1N0VC 1SKUA 4DHYA 2WKWA 4E3SA 1DP4A 3WNEA 4CIEA 1PRYA 2AJ8A 1F9EA 2FVYA 4LECA 4BN0A 4F7WA 3TTVA 4DB2A 1RIFA 2WILA 2R00A 2ZSHA 1PVDA 1SCKA 2JDIA 2C42A 2ORVA 2V45A 4BNTA 3P2IA 2W8ZA 1MVOA 2IYAA 2X19A 2H0QA 1DJNA 3QF4B 2YW2A 2FG6C 4LY0A 4Q0MA 4Z9XA 1VPWA 5DM6L 4GV3A 2A0XA 3GT3A 2OYQA 4FFSA 4JI3K 2A0YA 2XMSA 4IV0A 3CRZA 1JYEA 3ZVKA 3RREA 2KHOA 2ZUDA 5ALKA 3OFJA 4KPFC 1VQ7N 4V02A 5SICE 4RD3A 5TVKA 4BNZA 1BA0A 2FBTA 4UCWA 1CR6A 2KHZA 2XB6A 2H5IA 2PSJA 5CD9A 1Q7TA 2HBYA 1VLZA 2FV8A 4CDMA 1B0AA 2IYLD 1VJCA 2I4OA 1RCTE 2IPAB 1NASA 3PG5A 1P6QA 4IXTA 4LOAA 4CVNA 4EYGA 4Z7QB 5C1DA 4NBLA 3HDTA 3D3NA 2VH2A 3N2ZB 3GNLA 4IIXA 1DINA 4JYMA 1ZD9A 5FDFA 4OXYA 4AJKA 2J0UB 1LJ8A 4KR0A 1QZTA 2O19A 1O94A 3LO8A 5EHQA 4B6EA 1UT5A 5IG2A 2VCHA 3TTYA 2VGNA 5K14A 4NBKA 5HW0A 3WLSA 2A4MA 2A59A 2PZAA 1PWHA 1YFZA 4XGRA 2OYCA 1KEZA 1NN3A 1QFMA 1E2DA 1TJYA 3LWLA 2CNOA 2H9AA 3B3JA 2HA3A 2O3SA 2X9LA 3CUWA 3PHLA 4N1AA 3X1JA 4M7XA 1HDZA 2JIQA 3E9PA 4H0TB 4FZ5A 3TVYA 4S24A 1XCGB 1USVA 5BYAA 3NNSA 1FJGK 2UDPA 3I1IA 1OWOA 5E38A 4P3YA 3GAZA 3RARA 1XHXA 1KHTA 5FPHA 2CDRA 4BGDA 1GADO 2C5FA 1VOTA 2CNWD 4MAFA 2N42A 5LQAA 3C16C 3AU9A 3ZGZA 4JDUA 2B4KA 5J4HA 2GQ0A 4A6XA 4IYRA 2IDOA 1R9MA 1PS9A 2AR0A 3E35A 4TKUA 1DELA 3ZEUB 4Q4LA 3FI9A 4L5JA 1EFAA 2APJA 1NU0A 2RCNA 2PUHA 4K81B 4JLWA 3T7DA 1VLHA 2WFLA 1JH8A 3JQCA 4H1TA 4HTLA 1D7AA 3WSTA 3I0MA 3M33A 2UZIR 1DC4A 2ZE8A 3R7NA 1P1HA 1C4WA 1YKFA 3OWOA 3RQIA 3O0DA 4BRSA 1W30A 4YP5A 3VQEA 4X0EA 1DX6A 4FCTA 1TEVA 4GSYA 2GD1O 1HDOA 3DHYA 3MW8A 2FSUA 3KLNA 4FM1A 3IP5A 4C8KA 1T0JB 4DFKA 4M3YA 2V7EA 2FI1A 4WQ4C 2OM2A 3JALB 4KBYA 2R6CA 1JIXA 2I4RA 3IBFA 4HEA1 1N33K 5CFPA 2VTBB 1RMTA 2J3QA 4QD3A 4C7KA 4GT1A 1RPNA 1Z8HA 4ZO4A 1SD5A 3WGOA 3ISVA 2ZROA 3X2FA 3RU3A 4KI0A 4CV3A 4DE5A 2JFPA 3D6VA 2ZWHA 3DP7A 3DZHA 3UC5A 4B82A 5KWJA 4ZEXA 4YHHK 4JLOA 2FWRA 4D0RA 2ZS9A 3A25A 1FIUA 1R0CA 4YGXB 4Z49A 3TVTA 1K2WA 4CJQA 2P11A 1UZUA 4F1KA 4BRGA 1K08A 3PJFA 4O4IA 4M3RA 1U7DA 3O3FA 1Q19A 3LLSA 3OLCX 3PNPA 3OZ7A 1NRIA 3CYMA 1Q3KA 4G07A 4K9PA 1HRHA 3SZRA 3WGHA 3ZWXA 3R09A 5FPYA 3K73O 5AOVA 1K8KB 5EJIA 5HG0A 3TLEA 4BJ3A 1Q0RA 4PAQA 3GNSA 3JYTA 3NV7A 1FP4B 3K09A 4H0PA 3BWEA 4P92A 4QXMA 1TNDA 2F43B 1E3JA 1KH2A 3BZWA 4RXMA 5HF9A 4ZI7F 1N2JA 2VS1A 1NVFA 4S04A 2PG3A 4FLZA 2X77A 4Y7DA 2XV1A 3JYLA 1NKEA 3RSCA 4QYIA 1HZJA 3SYLA 4DJDC 1D2EA 1GY8A 3DEHA 1CDDA 2XSZA 2NSJA 3MK31 4E5NA 4AYWA 1A5WA 1MF7A 2Q27A 2Z56A 1DT9A 1DBRA 4KHZA 4LE2A 4K9QA 3B9BA 1AZLA 1S8NA 3HB5X 1FUYB 1UWKA 4OUKX 1C0UA 3SHQA 1H1LA 2PX6A 5BWLA 3AHJA 3JQGA 4GW3A 7YASA 1M1ZA 4H7FA 4FWNA 1QDLB 4H3KB 3DPSA 4WFKA 3SD7A 4ER6A 4IBNA 1A8HA 4CZGA 1H6DA 4KO3S 2WJYA 1UZMA 3A36A 3KKLA 4NHOA 4OQLA 3LPNA 5A3VA 3W77A 1TZCA 2RI0A 3M0EA 3S99A 3W6OA 1JQDA 2Q3HA 1E3WB 4XFKA 4ZTBA 2BHSA 5JHGB 2Q49A 4FGWA 3I42A 1X8JA 4G0NA 4RHCA 1RI4A 3T1QA 3WNBA 3NG1A 3BBPA 1IO2A 2NIPA 1W25A 4AK9A 1LH0A 3FETA 2IW3A 3HEMA 3OCCA 3RBZA 4BRIA 5J47A 1JI0A 4E0BA 3AI3A 2CXTA 3OD1A 1WTCA 2H8GA 2VDWB 5AVWA 1EE9A 4MV6A 4CKCA 3P7MA 4KW7A 4QFMA 5FFMA 1QQ5A 3JQAA 3L3BA 1KAQA 4NMXB 2BFDB 3R7AA 1M0WA 4LUCA 4ZD6A 3K7EA 2P5YA 1SMKA 2BH9A 5LQMA 3VNBA 1G3MA 4JP1A 2YVQA 1W6UA 3M4YA 2O5CA 4DV4K 2H57A 1CPYA 1QRAA 3RYIB 1LZLA 4EATA 5C8VA 4J1SA 4PCUA 4P7JA 1K89A 3W5HA 2IHJA 3CKLA 4D9MA 4YJGB 1L8XA 1G8MA 5AR1A 5KJEA 2DBQA 2RJOA 2BTQA 3GF4A 3KLPX 4QYWA 4QX6A 5T8KC 1P5RA 4GZLA 4R2IA 1G5FA 3SVLA 2WMOB 5IVIA 5JJ5A 1TLTA 5BR4A 1Z0ZA 4QBTA 4G2NA 5E6RB 4DV2K 2GDJA 1CKEA 2E6KA 1NGGA 2E1RA 1CUEA 3FBWA 1NR5A 4HYTA 4HD8A 1JX6A 3UMYA 1LW7A 1Y9JA 3O3GA 1X80B 2B7BA 5BOSA 4WKCA 2OD7A 3OM0A 3VC2A 3DGFC 2WSSA 3QELA 1QH1A 1UMBA 5ARDA 1UBRS 1Z22A 4KRXA 5FOWA 3OJUA 1X0VA 3KRTA 2YVKA 4JVOA 1U0HC 1UDCA 1EFRA 3NTUA 1P4HA 4DLRA 1ULZA 1G66A 3FNHA 5GADP 1SC6A 1DB3A 1HDGO 2VSOA 2B1JA 2N1MA 2AFIB 3N8DA 1GHTA 4N0MA 3DL4A 1M67A 3W3AD 2JJ2A 1KHHA 2GWHA 2O7SA 2R8EA 3R0QA 4ZQGA 3L4IA 5K2MA 1DTTA 1I4WA 2ZXFA 1FYFA 3U8XA 2I4TA 2I5JA 3DBVO 3F3SA 5IJWA 1PL6A 1JT2A 2Q4TA 3EG9B 3VKVA 5BW5A 1XU9A 5JNVA 4B09A 4IO1A 1P3DA 1YXMA 3R8EA 1BCSA 4RCVA 4TLCA 5GM2A 3ZDZB 3RG8A 2UYTA 4YT2A 5JSKA 4AUNA 1OPXA 3GH1A 2OZLA 4C4SA 2OHOA 2XI4A 3UO8B 5I4CA 3GLKA 4Z86A 2YHIA 1GQRA 3N70A 5L6LB 1N2BA 4LOKA 2FGJA 1NBWB 3B1KA 1SQ5A 1MH9A 1NJSA 4RX1A 2Z2JA 1QS0A 1A9QA 2HVHA 3BEXA