2YHAA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
384
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
total genus 115
structure length 368
sequence length 384
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhaA01
3RVMA 4DQPA 7ABPA 8ABPA 4PEVA 5HBMA 4KTQA 2PUCA 1NKEA 5C25A 2KTQA 3P83D 2EHGA 2VG7A 2FVYA 3EYZA 1LBHA 3CZCA 3RWUA 3KLOA 4WXMA 3L2RA 1NOZA 4UQGA 1HQUA 2PKXA 3HCWA 4DU4A 1LWFA 1TKZA 3TAPA 3OYHA 4XFKA 1GOBA 1JWLA 1JXBA 3SQ2A 3ROTA 3VQEA 1C0MA 3GA5A 2EX3A 3CHYA 2LSNA 3JSMA 1TL3A 2FBTA 4N5SA 4W5OA 3K4HA 3A2FA 1T7PA 1SKWA 2IOCA 3GYBA 2YKMA 4KQCA 3HUTA 4FVMA 1BDJA 3F6CA 3I5AA 4DN6A 1BCMA 2N9UA 4JASB 1RT3A 4RK4A 3V1QA 3IP7A 1ZAYA 4DTPA 1DJMA 3QELB 2XO7A 4DADA 5EWLB 1Z18A 4M3ZA 2OZMA 3DMJA 2MYUA 3VQ6A 1JX6A 3CM6A 2JVJA 2QKBA 3SPYA 3GBVA 4PE5B 4LSLA 3HUUA 3E3MA 1JDPA 3QERA 3KD5E 1NJZA 3V1RA 5FBHA 3HVRA 1S9EA 1TAUA 1PNTA 3OVNA 2JRLA 3PUFA 5CYQA 1QP7A 2VG6A 1FSPA 4YP9A 4DQSA 2YV0X 1RT1A 5DK5A 4RWEA 1HYVA 3ISNC 3OYAA 5CYMA 1JL2A 1VSLA 1Z16A 3NDKA 2WWVD 3RVNA 2KFNA 3T6KA 3N53A 5IULC 4G1QA 3ZT4A 4RU1A 3LZIA 3SM9A 4DLGA 4DTNA 5HRNA 2HNDA 1RT4A 4B08A 1QP0A 1Y97A 1JLAA 1KFDA 3JYTA 3FFXA 4GW6A 1M5TA 4CJQA 1ZGGA 4FJIA 4ZTJA 2QSJA 1KRXA 2QR3A 1A04A 2G8HA 3LOPA 4M88A 4B9LA 4B3OA 3HK2A 3QEVA 1QPZA 4LH5A 4MGEA 4KKOA 4CJEA 1NXWA 1MB3A 4FJ7A 2HHVA 3NGIA 2ZQBA 5FBKA 1QQBA 4FLVA 4TSXA 3G85A 1JLEA 4CHYA 4E1NA 3QEMA 4NYFA 3IAYA 4HUGA 2IPLA 4IDKA 1QMPA 1FK9A 1B9FA 4FJLA 3U3GA 4LX8A 3ZT0A 2IDOA 1VSMA 1RTJA 2LIVA 4JB0A 2G8KA 1UOCA 1XWLA 1YIOA 1GUBA 4Q0BA 4G0PA 3OM1A 3SCXA 1P6UA 4E7HA 4JRPA 1MB0A 4BWJA 4DTOA 5TPWA 2OPPA 1SKSA 4DTSA 1ZBHA 4F2RA 4WWHA 3TABA 1JXEA 4DQRA 3OYIA 1FFGA 2Y1IA 2HB5A 3I09A 3VA0A 3LMKA 1D1PA 4KREA 4MPTA 4C8OA 1BQNA 4CERA 3AO3A 2QU7A 3Q41A 3S3MA 3OLZA 3LAMA 4CJKA 5HRSA 1AB5A 3LUDA 4ZMRA 4OLBA 4DFMA 1JKHA 4H4OA 3OO0A 4IFVA 3BREA 1UAXA 4PWDA 4ZTFA 5E3JA 3N0RA 3VQAA 1Q8IA 2FTKE 1BI4B 3WNHA 5J2PA 3EQ2A 3AA4A 4FK4A 4FLZA 1DC8A 3HDGA 4CJRA 3NH1A 4DSKA 3CTPA 1I3AA 3HPOA 3H1FA 4HHTA 4DQIA 4Z4GA 3DZDA 5KTQA 4DTXA 4O1IA 1HNVA 1RDBA 1ZYQA 1RDDA 4CK2A 3MF4A 5E41A 5DKFA 4ELUA 5ABPA 2A9RA 2G8UA 2HVIA 1BL3A 4ID1A 2JB9A 3URMA 1FKPA 1TKXA 3OO1A 4DTUA 4YS6A 2JVIA 4Y1CA 3NCIA 1L5ZA 4CJVA 4OTZA 4MS1A 4CGGA 2OPRA 5TPWB 2XY7A 4MS4B 1RTHA 1JDNA 4MR7A 4PICA 4RG8A 1RZRA 4JS5A 1BHLA 4I2PA 3V9WA 3PX0A 4J2BA 4IG3A 2DRIA 3D02A 2PE5A 1Q9XA 4IGAA 3BRQA 3KKSA 4N0PA 3FGZA 1HQEA 3N0WA 5K14A 5J2NA 4B9SA 3QIOA 2CHFA 1L3TA 2BGGA 3AVBA 4B9MA 1NY5A 2P5OA 4FLXA 3BGRA 1RPJA 1EKEA 4I2QA 3IPCA 1N6QA 1Z2DA 2FBYA 1UA0A 1NJXA 1ABFA 3KKRA 1JHZA 2IYNA 4CFAA 1DC7A 4E7JA 1CXUA 2FLKA 2PUDA 5FWYA 2PL9A 1CYEA 3DLBA 3CG4A 1GUDA 5KQMA 5FWXB 4O0JA 4IBNA 1UDRA 3L6UA 3AA5X 4Q7EA 4H4MA 4ETIA 4CJTA 2DFHA 3T19A 5IUNC 1YTAA 4L4UA 4MS4A 3F6PA 3UUGA 2X78A 4O44A 3KD1E 1USIA 2ZWMA 1IKXA 4R5PA 3O2SB 4CEEA 4Z9AA 2E4YA 4WT7A 4EZ9A 5FRMA 3HVTA 3ZSRA 2DFEA 1X1PA 4ETMA 4YCSA 2IS3A 4KVFA 1B92A 3CG0A 3C3KA 4CJ5A 2B5JA 3O3FA 2JK1A 3R0JA 4CGJA 1DCFA 1USGA 2HHXA 1KCFA 4P98A 4RW6A 3K5LA 4FLUA 3OQNA 1WSHA 3RVKA 3C97A 3NAEA 3QLVA 5D2CA 3JVDA 4RW8A 1XC9A 1EP4A 3G0ZA 2E4VA 1RNHA 1MAVA 3DLEA 3KSMA 4O4GA 4KV8A 1SD5A 4FW2A 2GUIA 3N0XA 4J2AA 4ELVA 3P9YA 4PQUA 2HHWA 4CE9A 1BIZA 3VQCA 4MAAA 3ITHA 3DRRA 1ISRA 4CGDA 1D1QA 1WETA 1J54A 3QELA 4HYEA 3ZSYA 4MRMB 4XAQA 1ZGZA 4DTJA 2ETJA 3RRHA 4E7LA 4DF8A 1PEYA 1D9FA 3NF8A 3TAGA 3V9SA 1Y1LA 1T05A 3L3VA 1SV5A 2MYPA 4QAGA 3LUFA 4CJPA 3C6QA 4KHUA 1TL1A 4HTUA 3I42A 4KK4A 3BILA 3BRSA 1N5YA 3OYGA 4EZ6A 3OM0A 5BR1A 1TV6A 1BQMA 4BWMA 4Z4CA 2QVGA 3TR8A 3OJUA 5TPZA 2PYJA 1JLBA 3MYYA 2IPMA 2WOMA 1TKDA 3M9WA 4OLAA 5T7BA 4XLTA 4E7OA 4YNQA 1ZBLA 4E89A 4Z99A 3HEBA 1FXXA 2IC3A 2PAFA 4KRFA 3GL9A 1LJLA 2ID7A 1HRHA 2VG5A 4CJ4A 1CEYA 3H75A 5C5EA 4CJSA 2KZMA 2R4QA 4CGFA 4ZHRA 3P1GA 5SWMA 1R8JA 3E61A 1S1VA 1RXEA 1WSGA 4E0DA 3MEDA 4HUEA 3M8RA 2O4GA 2FLWA 3O4QA 1VSKA 3DRPA 3NF6A 5JNVA 1ZDMA 1G15A 1S1TA 1F51E 3LKBA 4KI4A 5CNJA 1JFSA 2RJNA 4G0QA 4FCYA 4O0IA 2A9QA 3UKJA 3OMWA 1T34A 1U48A 4KB0A 2F96A 4RY9A 1D9DA 2ATQA 3V81A 2FC0A 1DLOA 2LPMA 5JS2A 4QYWA 2FBVA 3RVQA 1C1CA 4KFBA 4KQ9A 4LDAA 1L3VA 3O74A 3QIPA 2WJAA 1M2FA 5HRPA 2QV0A 3OYJA 3ILYA 1HYSA 4DQDA 1IH7A 4QCLA 1P8AA 2HJ9A 2KQ2A 3MEEA 3H5IA 3C3WA 4EYQA 2R48A 3I8DA 1RBSA 2G8FA 1HYZA 3SUNA 4DLEA 4LRQA 1D2AA 1DBWA 3S9HA 4LE0A 3ZSQA 3CG7A 4G97A 1SL1A 4IG0A 3N8IA 1J9AA 4FJJA 1LW0A 2A9OA 3OLWA 4N41A 3O3GA 4G0XA 3FFWA 2FQWA 4M3UA 1QNLA 1U0SY 2FSPA 1XHZA 3CKMA 4CEAA 1WSEA 3PV8A 3AVFA 1PHRA 4BDZA 1BI4A 3ZT2A 3KTQA 4MQEB 3AVLA 3LAKA 2HW3A 3NHMA 1Z15A 4DG1A 1KRWA 1VSEA 4ELTA 3SAJA 1MVOA 3QNOA 3CLKA 4RKRA 1K68A 1S1XA 4DF4A 3SUPA 1LW2A 5KI6A 4D6XA 4K8XA 4OKKA 3SUQA 3NNDA 1XI1A 1TKTA 5FRNA 1ASVA 1D5WA 3N6VA 3QLUA 2AYZA 2PUEA 2QK9A 1ABEA 4FM2A 3OYEA 2FQXA 3LUHA 4JRQA 4UHKA 1B9DA 4FJ9A 3HP6A 4RV5A 4TLMB 4FK2A 4CHQA 4AHUA 1PNRA 1Z25A 3LFTA 5EWJB 2QW1A 4CF9A 1K66A 3ZSWA 5HP1A 2B6AA 2YNFA 4RK6A 3I45A 4N76A 3RR8A 1Z12A 1C1BA 4F8JA 5CNKA 4AILC 1KGSA 4OVLA 5CNIA 1S6PA 3GV0A 1KVAA 1CZ9A 3EZ5A 4C8KA 1XHEA 1S1UA 1TAQA 3H6GA 2MSLA 4YRZA 4BDPA 4MQEA 1SXHA 2DY4A 5DTEA 4CEOA 4NYNA 3RMCA 3L8BA 1Z17A 4BE2A 4G86A 4RZSA 4NCGA 3LUKA 3TAMA 2PJUA 4W5NA 3A0UA 3CRNA 3AO2A 1EHCA 3LWLA 3H5OA 2G8VA 5TQ0B 1JH9A 3OYLA 3SQ1A 4DS5A 3K5MA 2FEWB 2JCGA 1JF8A 2G8WA 3ASMA 1YS7A 3CYMA 3EJWA 5TQJA 4F11A 5HRRA 4PUOA 2OQRA 5EWMB 2IPNA 3NF7A 3VQ8A 3RVSA 4CK3A 1RT7A 4L85A 1DRJA 3WNEA 4KTZA 3DLHA 4MLDA 3D45A 1TK8A 3BBLA 5FDLA 5KRSA 4Z4HA 1L5YA 3OMXA 2FBXA 3LTEA 5C42A 3G10A 1JLFA 1E2BA 2B1JA 1TVMA 3AO4A 2JBAB 2O20A 4NCBA 4DMNA 3U6FA 1HEYA 5GOTA 2MSWA 3IP5A 3KJXA 1UA1A 3KK3A 4CHNA 4M3TA 3UIQA 5HKOA 3C95A 2NZUG 3A10A 3KK1A 4MS3B 4LD0A 4B9NA 2ITGA 3V1OA 3NNSA 4K8ZA 4BE1A 1DP4A 4KFCA 2RPIA 4H60A 1W25A 5J2QA 2HQRA 3NF9A 2QVCA 3OYKA 4BE0A 5ED4A 3O1JC 1JLGA 3N75A 1IKVA 3V6DA 5KWSA 4C8MA 2KW4A 3UK0A 3ZT1A 5DCLA 4EUKA 2OA8A 3HSTB 2PL1A 5IX8A 2AYXA 3EAFA 4OGCA 3JPYA 1QHTA 1WAJA 3LDSA 3S3NA 3MXIA 1SUQA 5DMRA 3HJFA 5JNSA 3DOKA 2GX6A 1GCAA 3O1IC 3T3FA 4RW7A 5PNTA 4GMJB 1JYEA 3CFYA 4RS3A 3VNAA 5I3UA 2Z1JA 2JBAA 1TM2A 2DTUA 3TAQA 4KHNA 4AHSA 4IKFA 3K2PA 1BGXT 1QSYA 4CESA 2DFFA 4MFBA 3FDFA 3RVJA 1VSDA 4S04A 1BISA 4KMRA 1EWKA 4CFDA 5EU7A 3EULA 4FZYA 4Z0UA 3H5TA 1VSJA 1M5UA 1JFTA 4BACA 4NV3A 3MIZA 1C1AA 3SI6A 3SJJA 2OENG 2MYNA 1U8TA 1VKRA 3NGZA 4KO0A 2YNHA 4G0ZA 4CIGA 5EWLA 3PY8A 3NNNA 3OQOA 4N47A 4QOZB 4JB2A 4LSNA 3OS0A 3QESA 3OYMA 5IBQA 3F73A 3KYIB 2PY5A 2MYTA 3L2UA 5IC5A 3VQ7A 5TPZD 4RSMA 1QTMA 1JL3A 3CS3A 3TAFA 1WNSA 4YGXB 1RT6A 3ZSZA 5J1EA 1YVUA 4YV7A 5TQ2B 4FJHA 3H1GA 1TJYA 3TI0A 2V0NA 3GWGA 1BDHA 1C0EA 1DCMA 4MLCA 3OYDA 2P9HA 4AHCA 3MEGA 1RBVA 3THVA 3MXJA 4LY7A 1PEAA 1QKKA 4RY0A 4F12A 1W9HA 3OYCA 3KHTA 4G0OA 1FQWA 1JYFA 4WE1A 1CLQA 3QLTA 1DBQA 3C6TA 4Q6WA 2X74A 3AVNA 4ICLA 4DSIA 3PX4A 1DRKA 1FKOA 4CEZA 4CIEA 4DSLA 4F3TA 2X6NA 5JNWA 5KC8A 4LE1A 3S99A 2IDMA 1WN7A 3TMYA 4CJLA 1BCOA 4WUTA 3LUGA 2P51A 2YHAA 3ALYA 3TX6A 4EGSA 3L3UA 3F7NA 1U2QA 4DFPA 5JNRA 3H1EA 4MYRA 3CNBA 1O1WA 4YR7A 2IKSA 4Z0NA 4RKQA 4IRXA 3W9SA 3AVHA 2Q5CA 2XHBA 2PUGA 4J2DA 4JOQA 4C8LA 3B6OA 4PYRA 3B6PA 3IP9A 4CHOA 2F8SA 3QEXA 3SPZA 2Z1GA 4RK0A 1DG9A 1VPWA 3RQIA 4KI6A 1NXSA 5TQ2A 4O1HA 2BE2A 1QP4A 4KHSA 4O55A 1W0HA 2GBPA 2I6FA 4MR9B 3QNNA 3JVIA 3SV3A 3M8SA 1QE1A 3LUAA 2E4WA 4N0QA 4DSEA 3I0SA 3IP6A 4HVJA 1HPZA 2YNIA 1EWTA 1WSIA 3E01A 4F4KA 4MQFB 4I9QA 3LPTA 3QEPA 3C94A 1ZESA 2WB4A 4S05A 2MSKA 2E4UA 2WJWA 4CHPA 1QO0A 1U49A 3AV9A 3SNNA 1WLJA 1ZBUA 5EWJA 2ZE2A 1YK1A 4EVSA 4DU1A 3I0RA 2R47A 4NCAA 3LP1A 1GOCA 1C4WA 3DLGA 4B9TA 2P5GA 5IUKC 1NXPA 5I4CA 5I42A 4W5RA 3C6UA 1GOAA 2F8TA 4XXHA 1BIUA 4DTMA 3HM9A 1NK5A 1L3UA 4OJRA 3D8UA 1APBA 2YKNA 2RGYA 4Z4EA 4CGHA 2QXFA 1LAVA 3TANA 3U3YA 4Z9BA 1EX4A 1AB6A 5KGWA 4H8KA 5BRAA 1QSSA 1UWBA 2RN2A 2IOYA 3WNFA 4M3RA 3MQ4A 4YO7A 1NXXA 1BAPA 3NBMA 3TARA 1BDIA 1ZH4A 2WONA 3ZSVA 1U47A 2AJQA 3K5OA 4ZMSA 3DGFC 3RVOA 3H5WA 3FMVA 3TO5A 1DTQA 3LZJA 4MQFA 3OQMA 3OS2A 2HQOA 5J2MA 2JVKA 4MS1B 5HROA 1CHNA 1YMVA 3KJVA 2B4AA 1IG9A 1JBEA 4OATA 3L2WA 2A1SA 2JGUA 4DSFA 1K6YA 1A0OA 4H3HB 1YMUA 5TE9A 3KG2A 4EYKA 2VK2A 4HNRA 4N56A 1R0AA 4GVMA 2QXYA 4RXUA 4FJNA 3JPWA 3QK7A 4FK0A 1D4ZA 5FROA 3QX8A 3ROFA 2Q3SA 4KV7A 1JFVA 4ID5A 4JP1A 2R25B 2GV9A 2XY5A 1NK7A 2P4UA 3NHZA 5FWYB 4IMIB 2HHQA 1NXOA 1VRVA 3OJSA 1C0UA 1VRTA 1X9MA 3KLEA 4DQQA 1QO0D 5DLEA 2ZD1A 4DWIA 1VSHA 2IPAB 4MS3A 4E3SA 1DTTA 3AVJA 1ZBFA 3IG1A 3LANA 1DCKA 4RDCA 3KCNA 5KQGA 3M9XA 5D3GA 3DOLA 1KMIY 3IS9A 3V9ZA 1ZVVA 3O75A 4G0YA 3O1HB 4RXTA 3M8PA 1VLZA 1ITGA 1WAFA 4E19A 4JAVC 2HHTA 1L3SA 3HP9A 5C5CA 2HNZA 3HT3A 3V9UA 4RXMA 4JS4A 1ZH2A 3IDOA 4EY3A 3KLGA 4M3XA 4MR8B 1YT3A 1S9GA 3VQDA 1D5AA 3RVPA 4ZJPA 2XY6A 1ASUA 2CHEA 3KTOA 3V4IA 1PUXA 5BQ3A 2L19A 2B4JA 4RK1A 2LBPA 2FN9A 2D0BA 4EVRA 3RMBA 2FKAA 2WMYA 3TD9A 4CK1A 3ULDA 1ZBIA 5CZ2A 1NK4A 3Q7RA 4OKJA 4LZLA 3HO1A 3H6HA 3JY6A 1XWWA 4FE4A 2WRZA 4QYMA 5JNUA 3DGEC 3OYFA 1LWEA 1USKA 3T95A 4P1ZA 2KFZA 1FFSA 3CQ8A 4AH9A 4KTWA 4FJXA 1KVBA 4KHQA 2M98A 4HUFA 3V9XA 3GRCA 3GBPA 2VWKA 2HQBA 3HS3A 3QEMB 4MR8A 3PX6A 3NFAA 4DFJA 1SL0A 2VYCA 3RH0A 4E1MA 4CJ3A 2H0AA 4RW9A 3AO5A 3OYNA 5C24A 4FLYA 4PA1A 1Z26A 9ABPA 4CCHA 4EP5A 4B9UA 2FEKA 4RY8A 4OPJA 3EQZA 2BDPA 2E4XA 4FZZA 3FFIA 1X9SA 4F3OA 2E6LA 3B2NA 3MA0A 4FJ8A 2GKGA 3AVCA 3T8YA 2XRIA 1ZY2A 2RJOA 4CEQA 1NXTA 3SYZA 1DZ3A 1F4VA 2I5JA 4KK3A 1KLNA 3ZSXA 4CF1A 1U4BA 3QX9A 3M8QA 4AHRA 1RNLA 3LP2A 4CECA 4DU3A 3VQPA 1NKBA 3CZ5A 3S3OA 4ML3A 1XHXA 4FYDA 3CM5A 1EAYA 4Z4FA 4PY5A 1NXVA 2PUAA 4CF2A 4DS4A 3L49A 4KPYA 3RMDA 4HCCA 3DYAA 2NZVG 1JLQA 1TK5A 3K58A 3LALA 4MR7B 4G0MA 4E7IA 1C6VA 4M42A 3QEIA 2L2QA 3ZCMA 2FMIA 3LWMA 3A3KA 3L2VA 1RT5A 1NK0A 1RBRA 5IEBA 1A5VA 1H9CA 3AVAA 3SUOA 3LP0A 2NT3A 4FJGA 1J5OA 2PYLA 3MECA 3K59A 3HYFA 1QQCA 4LE2A 4CBVA 1A5XA 2IGIA 3KLNA 3EY1A 2FMFA 4IF4A 1SL2A 1LBIA 4HNSA 2E4LA 4GPAA 3NH0A 1A5WA 2RF2A 4AHVA 3K57A 1F21A 3SZ2A 1KSPA 3AA2A 1CXQA 3RVRA 3KS9A 4N03A 4E7KA 3QO9A 1URPA 3NGYA 4TLLB 3VQQA 1E6LA 5IUJC 3ILHA 4FB4A 4EYGA 2QZJA 2P1JA 3EGCA 4OBBA 4M3YA 2FMHA 5T3YA 3DLKA 2HMIA 2W42A 3K5NA 4DTRA 4KHYA 3AVKA 4NICA 4CEFA 3NHGA 5HM6A 5FWXA 4C8NA 1EWVA 3LUJA 3HXMA 1D8YA 1RTIA 4OKEA 3JS5A 3OS1A 1IKYA 4D6YA 4Z4IA 1QQAA 2Z1HA 4FLTA 4J2EA 3BDPA 1TLFA 2CD7A 2XY8A 5GQSA 3VQ4A 4FJMA 3O3HA 1Q9YA 3TWHA 2Y1JA 2OPQA 3F9KA 2BANA 4L8RB 4FLWA 1TK0A 3HL8A 2OZSA 1KTQA 4DFKA 3WNGA 2L18A 1ZITA 5KRTA 5JNTA 4FM1A 1RBUA 1SXGA 3O4NA 4QICA 1ZN2A 2LUOA 1X9WA 2PMCA 3IPAA 4E7PA 4ETNA 5B3JC 4B8AB 3KLHA 1Z2EA 4OGEA 4W5TA 1YS6A 3OLXA 4FJ5A 4LDZA 3RTVA 1RDCA 3KYJB 2OPSA 5KC9A 3RVLA 2A1RA 4M3WA 3KLFA 4CFCA 4EYOA 4MRMA 4KZKA 3DLRA 1ISSA 4OG2A 4DSJA 4HNQA 3SQNA 3TAEA 3P5JA 1J56A 3CFPA 2L17A 4IILA 6CHYA 3CU5A 1BVHA 1RT2A 1LV5A 1RXIA 3VQBA 4FM0A 4B9VA 5SZTA 5HLFA 1U04A 3ZT3A 4CGIA 4FZXC 1GCGA 4CEBA 5KGXA 4FJKA 2VWJA 3OYBA 1S1WA 4B8CA 3Q7SA 1S8NA 3K9CA 5KQPA 3IRXA 3Q15C 4M41A 1M2EA 5CHYA 1NOYA 3H08A 4Q6BA 4Y9TA 2CWDA 1U45A 2PUFA 3A0RB 1LJUA 2RDMA 4KAZA 3SY8A 1VSFA 3HPGA 3M6MD 4WXEA 2D0CA 4WZZA 1EXQA 4FXDA 4Q5VA 3MM4A 3EDCA 1DBPA 3AVGA 4HCBA 4CF8A 1GLGA 3MXMA 4RW4A 3QEKA 4CJUA 1FFWA 2O4IA 2HHUA 3HV2A 3RRGA 4YFUA 3DI6A 1B00A 3VNBA 2PUBA 3DRSA 1OXKB 3SV4A 1T03A 6ABPA 2R7YA 4KHWA 4XARA 5KQLA 3AO1A 1SKRA 2NT4A 2OYQA 3HDVA 3Q9SA 3AVIA 2ID9A 3KLIA 2HSGA 1P2FA 1NATA 3QLVC 1RCHA 1ASWA 4GNRA 2IAJA 3QETA 3GT7A 1OXBB 1P6QA 2FQYA 4ZYLA 3NE6A 3D0PA 3VQ9A 2GBZA 3CFRA 1TMYA 4AHTA 1KRPA 3VQ5A 4O5AA 3DM2A 5B3JA 1KVCA 4RK5A 1HJRA 3AA3A 1EETA 3JTEA 2X6SA 3FFTA 4KNYA 2VUIB 4F8RA 1NKCA 1WSFA 1IKWA 2JLEA 2X7XA 1HNIA 4FW1A 2FN8A 2A9PA 5HQJA 1XHFA 2LP4Y 1YTUA 3MMNA 1QSLA 2RKIA 2D5RA 4XASA 1NJWA 2FW0A 3QLHA 4EP4A 3H5VA 5F64A 2XDYA 1TVRA 1S6QA 4H3KB 3AVMA 2E6MA 3RMAA 3H5LA 5IEJA 1C0TA 3LKVA 2M1ZA 4O5BA 3OLVA 5DGCA 3KKEA 4CIFA 4F2SA 3MAQA 4KB1A 5CZ1A 5CNMA 1VK0A 1I39A 1QS4A 3DBIA 3VA3A 4RK7A 1VSIA 3PO4A 2KYRA 2NUBA 4YLEA 1IIBA 2FEPA 4JA2A 1KFSA 1YK0A 2KZZA 1JL1A 1SXIA 3QINA 1WSJA 1CZBA 3HSYA 3T38A 4CJWA 1REVA 4UHJA 4JLHA 1S5JA 1RTDA 2Z1IA 2G8IA 2TMYA 1RZRD 2D0AA 3LUCA 2PLNA 2QKKA 1NK8A 4B09A 4XIUA 4CEDA 3NBPA 2HHSA 5HSGA 3NH2A 4CJFA 2PZSA 4CHZA 1RBTA 1NK9A 1A2OA 2E4ZA 3SQ0A 4MR9A 4BDYA 2YHBA 3O2JA 4TMYA 4F06A 1JLCA 4EVQA 4D74A 3G1WA 3KIOA 4Y1DA 3RR7A 1NJYA 1Z13A 5TQ0A 1LAWA 4IFYA 2HVHA 2WY2D 4QPJC 1HMVA 3SNKA 4FE7A 4ZPJA 1I3CA 1EFAA 2FXIA 2H3HA 3C3MA 3LP3A 4I9LA 4CF0A 3HPHA 1VRUA 1BA2A 1U2PA 3OY9A 3SG0A 1L5UA 1MU2A 3TB6A 4NQRA 1LK0A 3HZHA 4W5QA 3O21A 3QLUC 4TN5A 1T8EA 5CY4A 4PZ0A 4MQ3A 1TGOA 4YWHA 1J53A 4CFBA 3L2QA 3EODA 1NK6A 1NTRA 5EWMA 3LPUA 1SRRA 2ZAYA 2GWRA 1MIHA 4I7FA 3KK2A 3CFOA 4IMJB 2J48A 1JLKA 2VUHB 2HPHA 3O2QB 1RILA 3T1AA 4LH4A 1RDAA 1E6KA 2HNYA 3PO5A 1KLMA 2YNGA 4OPKA 5BRJA 3QEWA 1ZHHA 3ZSOA 2FMKA 1IO2A 2GI4A 4M45A 1LWCA 3OLYA 1E6MA 3Q7TA 3SQ4A 3VN5A 5JS1A
chains in the Genus database with same CATH superfamily
2W4IA 4TLDA 4KMOA 2UUPA 2FZEA 4X8LA 3RVMA 2IW3A 3DXKA 4DQPA 3DE3X 4RSRA 3TKLA 3WLJA 1UP4A 2J7KA 3OD1A 5FI0B 1WDWB 2W2VA 3GP8A 3CVYA 2JDIA 3E2IA 2YQ4A 5ERGB 3UHOA 3V7FA 5EMMA 2JI6A 4CPDA 4UQPA 2A0KA 5EIBD 4QJIA 2XNDD 2KTQA 4KMSA 3P83D 2DFTA 3HR4A 3HJRA 3IAS6 3JSAA 3K53A 4LVUA 4QATA 3GFPA 4BVEA 1XRMA 4CEHA 2O2ZA 3RBVA 1GAXA 1VSVA 3CZCA 3PC8A 3ND6A 3FOEC 1XHLA 1XFDA 4Y2PA 4FOIA 4M7RA 2CNNA 2O2HA 1FDVA 2WT9A 1Y48E 3L6QA 2B61A 2UDPA 4KQXA 5U4QA 3DEJA 2IYAA 2Z43A 3JZAA 3L2RA 1PTJA 4FQ5A 4UQGA 1NBWB 2VA8A 4H18A 3WQRA 3GAMA 1QHXA 2GZDA 2CHVA 4DJFC 3BT7A 2YV4A 1OI2A 1E7MA 4JC8A 3DMTC 3KKQA 1YKGA 4I5IA 4R2IA 3EEIA 3NUZA 4I50F 3M49A 2R79A 2BONA 2NRWA 3FX2A 1BXKA 4CF7A 3FWHA 1T2NA 4BX9A 2J4DA 2QE6A 1EFHA 2Q27A 4P35A 1BVUA 1U7HA 2VH5R 4V3CA 3U44A 1JWLA 1Q14A 2J45A 4LYAA 3UKUB 1DAGA 4UBIA 5F73A 3KQUA 4R5HA 1XTKA 2FN4A 2V0CA 4XCXA 3MLEA 3SQ2A 4DNQA 4ZC8A 1PR0A 2QJRA 4IW3B 3A25A 1NV8A 1X8KA 1UKAA 2HSJA 1IL0A 3U49A 3UAXA 2ZUVA 2EIHA 4EP1A 5KPTA 5JANA 4CZLA 3Q9UA 3TRJA 1H2XA 3WYAA 2ZTUA 3DV0A 4AJLA 4XRRA 4NB4A 1QIGA 1NTOA 1T7PA 1PJRA 2HNAA 2Z2ZA 4P4LA 3DXXA 3PD7A 4K9DA 4UTZA 4XTRA 3RVDA 2FF6A 4C03A 4RANA 5DH9A 3QWBA 4IUDS 1ZKMA 1QX3A 5FTJA 1SIUA 5EJ8A 2QRNA 1RT3A 3ELDA 2NO7A 3L4BA 3EA5A 1QC5A 3F0TA 1ATSA 1NW4A 1TUUA 5TGDA 2E5WA 4X66K 3S5JA 4UOZA 2UUCB 5K0TA 3FM9A 1CJCA 1G63A 1V25A 4BHTA 2BEWB 2DPYA 4ZVSA 3OFKA 2JD2A 1FMFA 3U56A 3NEJA 1CUHA 2HCJB 4Q7JB 4CEJA 2XO7A 4DIDA 2C3MA 3NV7A 5EWLB 1UPCA 1QYCA 2FRDC 3KU4A 4G5YA 2V7EA 2ZAMA 3DMJA 4NPHA 2V5VA 3VQ6A 3ORRA 3SM3A 4KH6A 1YUBA 5BW5A 5LXTF 1HTTA 4WY8A 1Z5ZA 5IABA 1RI2A 2FR8A 3SEAA 2PCLA 4HDMB 2QZSA 4IUCS 2CXRA 4OLHA 3ORYA 5CMLA 1L5HB 5CX1B 4WJLA 2Z1DA 3GGPA 5LQNA 1HR0K 4MDFA 1FL9A 4RH3A 1WBBA 3ZOKA 1S9EA 1PNTA 1VHTA 2C95A 3BSSA 4EFKA 4IIEA 1Y9JA 2WILA 1JWAB 2Q5OA 3ACCA 3FRJA 3N8DA 3D6VA 1YJXA 1BZYA 4OIMA 5FI1B 2FWRA 2QD5A 3H4TA 3R6WA 4YP9A 1RT1A 1PK7A 1N1EA 3NEYA 1GN8A 5IT0A 1WABA 2QYOA 1JJ2M 1G3QA 3NMUA 3AVQA 5G1NA 1G5PA 1MUUA 3ITEA 3RIMA 3RRZA 3WOVA 1GZUA 1JL2A 2ZRCA 5AW5A 2W00A 1W48A 3GFSA 2CLLB 2PJRA 3D8RA 3BF1A 4MP6A 1D6NA 3MXOA 5TC4A 5HUHA 4AJKA 2ZR7A 2XY4A 1WPQA 1UBJS 2NZYA 2XUPA 2YNMC 3AHDA 2I3BA 3L6EA 1RYZA 2BFPA 4M0UA 3NBYC 4G1QA 3ZT4A 4CL2A 2SCUB 4TYWA 2GPJA 2B2CA 4RSHA 3CH4B 3MCZA 1A7KA 1BS2A 4DLGA 3RRMA 3SM9A 4C1NA 2CT8A 2GRJA 1ZM9A 5HRNA 2AI2A 4R1UA 4BATA 3USCS 4B08A 4EJSA 1QP0A 5BXYA 1J90A 2HZ7A 2DTXA 1DRVA 4AJ2A 1KFDA 3CMAN 1EVYA 2GASA 3IR6A 4TMZA 3USES 1NLUA 3AL2A 5AHRA 2L0XA 3QQPA 1EHYA 2VHCA 3DLLL 1M2KA 4IY1A 1BEEA 2G04A 3QKUA 3I8XA 4IQ4A 1N7JA 4BP1A 5SV2A 2PO5A 4FJIA 5KYGA 1UDAA 4IJWA 1AKEA 2RB5A 5EJIA 3TBHA 3UN1A 3LHIA 4CLDA 1VQ1A 3DYVA 3Q8MA 3ZHVA 1Q7CA 4J6EA 2C00A 2G88A 4YUWA 3LOPA 2P9IA 4B9LA 3TVYA 1QQ5A 3HFGA 4LAFA 4DG8A 3W4JA 2AEEA 4JI5B 5EMNA 1EHIA 2AFIB 1WG8A 2IUFA 4KKXB 5JPIA 3RU2A 3C8UA 4HOYA 4NZNA 2R60A 4MGEA 4BO1A 3BE6A 1ZRMA 3MWEB 1XMOK 3ENHA 1PCXA 1JEYB 2GMWA 2JK0A 2JLRA 5T5QA 1RAFA 4EL5A 2HHVA 3VH1A 4DDMA 4XWKA 2PD3A 3C39A 4RIEA 4BRSA 1DG3A 2COKA 2FETA 5E4YA 1XRJA 1WW3A 2HIMA 1QQBA 1WVIA 4RVGA 1CIVA 3ZWCA 5L4SA 1BQ4A 1RSZA 4MITA 4YALA 2W2LA 1I4TD 3U3MA 1UBMS 8GPBA 4QJ5A 4J76A 3HKDA 3ZGXA 1WPGA 1X7YA 3OCCA 2NPOA 4OBXA 5E2IA 2DWQA 3T1VA 1K73O 5FP0A 3AEKA 2NLOA 4CHYA 3ICWA 3PITA 3IAYA 4IS3A 3EZFA 3K0FA 4PKGA 1ECJA 2P2NA 4HUGA 1H8ED 2QS9A 1UWVA 4B3GA 1TUGA 4M7WA 1D0VA 1GITA 1SB8A 2RHHA 1VC2A 3LG2A 4DEXA 1EQAA 3G7SA 3IE0A 4XFDA 1NLVA 1BMDA 1RJWA 2WWYA 2VDLB 1CVIA 1GSAA 3KKLA 2ORIA 3PGXA 4LCJA 2ZITA 2GBFA 3IOYA 2VCPA 3KR9A 5AKLA 4BQZA 2YCHA 3AKYA 3ZT0A 3Q3EA 2IDOA 2R44A 3KOYA 4LS3A 4REQA 2AIRA 3UYKA 1U2ZA 1TQ8A 3SGLA 2JI4A 4ARSA 1LX7A 4FZ3A 4OGGA 1IBCA 2WPDA 1N0IA 2R6JA 3O3MB 1L3CA 4IHJB 3TVTA 4GI3A 2HT6A 4LC9B 1YIOA 1G4UR 4P86A 4YP1A 4QU9A 3HJCA 3SQWA 3ZU4A 2ZPTX 3DNMA 1GILA 4RLQA 4E7HA 1Y3IA 1G21B 2LWIA 4JRPA 1W36D 3ULKA 4J90A 1YR9A 4JYAB 1BQ3A 4D9KA 2AEFA 3CT6A 3H86A 3JATA 5G1OA 4EHNA 2OPPA 1ZBHA 4DTSA 3GRKA 5PGMA 1CUAA 1SUFA 3STUA 4BMZA 2ODWA 1NU0A 4D8VA 1VSTA 2QL5A 1E6WA 5JARA 4ZDJA 1MHTA 1ECPA 4FWPA 3OU6A 1S8FA 2WKQA 4ZGWA 2Y6UA 1FFGA 1G5TA 2WIKA 3I09A 3LMKA 3NB0A 5CFZA 3QPVA 3QRWA 2CBGA 4MPTA 5IAJA 3U7JA 1ZIDA 2P0EA 3O3NB 4YK7A 3LD9A 1OKJA 3RAPR 1ZI6A 1KTVA 2NM0A 3QHAA 1TJNA 4JN6B 4AKIA 1XELA 2EU8A 4CERA 2QG6A 3RE1A 1L8XA 1LVHA 2EFGA 1AQNA 5ALPA 5DF1A 5G53C 2WG2A 1PJZA 4HR7A 3SJUA 2QU7A 3Q41A 3S3MA 4KO2S 4BQRA 1IZZA 1KE1A 5J59A 5HR5A 1PL7A 5HRSA 3WYFA 3R77A 1F7UA 4C4RA 1R0RE 3HMKA 1XC7A 4GMXA 1LI7A 2N46A 4U2KA 1WVMA 3TZHA 1WMSA 2WHPA 3IKLA 3LA6A 3SR3A 4F86A 5J58A 2FF7A 1NGEA 4H4OA 1L4HA 5SY6A 4EI8A 3AVXA 3ZDYB 2CCGA 2EAUA 3LYAA 3IQFA 3GLQA 5IZCC 1UAXA 2QM0A 1G3MA 4FIDA 1O3YA 3NFYA 2YCLA 3N0RA 3VQAA 1RM3A 3WRXC 3DWEX 2FTKE 2E1PA 4JNEA 1KEEA 2QTVB 2JJ2A 4QUIA 3ZJTA 3B1FA 4FK4A 1QM5A 4FLZA 3UMSA 3HJGA 1DC8A 1B7GO 2Z4SA 3AF4A 4I1RA 1YBMA 1ATIA 1AKVA 2WQZA 2ZQ5A 1RKQA 4UTPA 1DVRA 4CJRA 2OZEA 2WVHA 3GNLA 3H9QA 5DM7L 1WB4A 1G21E 4D4GA 3F6RA 2V3CC 4HATA 5G4KA 3GCWA 1KAGA 1A9TA 1SUDA 2GZ1A 2JAOA 2WINI 3Q87B 4Z4GA 2HPZA 3DZDA 2PFGA 1GLDG 5DULA 4B1FA 4GOLD 1NJIO 3OESA 5KQ8A 1BE6A 1RDBA 1VA4A 3VO1A 2XUFA 1RDDA 3SFTA 1WIWA 3BQ9A 3D4BA 4H3VA 4CK2A 4JKYA 1E4GT 1PZEA 5EFOA 5E41A 3KQQA 1KTIA 1NYTA 3B9BA 4P3NA 4G9BA 5AQNA 3ZE8A 2G8UA 3DULA 3ZZUA 1BL3A 4ALIA 5ABPA 3OC6A 4FWQA 1FKPA 3LL7A 4K9QA 1TKXA 4DTUA 2RHTA 3D6AA 2O7RA 2XWBF 3PX3A 1TGVA 4BAUA 2HF8A 2CNBA 5AHXA 4IFIA 3NCIA 1OFIA 4Z0HO 1YJWN 4CJVA 2GRAA 1NLZA 1YB1A 4L1KA 3CXUA 4AX4A 1KK3A 4QRIA 2OPRA 1T91A 3ZC3A 2H8GA 4MS4B 4CR6A 1H2WA 2NVWA 4DQ0A 3LIIA 2YJGA 1DKRA 3GJ8A 1MA9B 3PXGA 1CUYA 2EZ4A 2Z5FA 1UEJA 3TSWA 5D84A 1LU9A 2D7JA 2GEBA 2NQ2C 3IOCA 4PKIA 4A57A 2FPKA 2V9ZA 2XTNA 4W1SA 9GPBA 1OWPA 2CFIA 4JS5A 4OM7A 2VSOA 1BHLA 4KDEA 2NO6A 1Z8DA 2C58A 3I8OA 5TR9A 3D7RA 5AM3A 1N8NA 5DXAA 3LY9A 2XHEA 1FPQA 1NPTO 4ZC1A 1JKFA 3G6KA 1JHOA 3FNQA 4AULA 4L78A 3BOSA 2JIPA 4C4PA 5HX7A 3FOCA 3Q1LA 3DFUA 3ED5A 2Z8XA 3NJRA 3H1QA 1W97L 1AV7A 1GUYA 1GPYA 1T8YA 1V5FA 2LKDA 2AJBA 2DWOA 2ZYRA 3N0WA 1VSBA 2O3TA 4YEDA 4E46A 2QXUA 1Y0BA 3N3AC 4ZQIA 2OXCA 2WM3A 3CBQA 4GX1A 3QXXA 3OZDA 3QBVA 4BB6A 3AVBA 4JYBA 3RO7A 2GUWA 1JA9A 3HN7A 1GU1A 3PKJA 4BB9A 5KDDA 3LCMA 2NYRA 3BGRA 1BCSB 3AB7A 3IMEA 4NCKA 4PRKA 4IRMA 5AKZA 3R1IA 2GZRA 4KI7A 1PR3A 1REQB 5K09A 1Z5PA 2YMLA 1IUOA 4PQYA 4Q47A 4NBNA 1XEXB 5LZ5A 3HZRA 5B4VA 3SDBA 1MXHA 4WADA 2WK1A 1JQDA 1G6HA 1SHJA 2JIZA 1L8AA 4N7MA 5AJXA 2GWKA 4F3NA 4JX8A 1MRNA 3KKRA 3U13A 2IYNA 4OO3A 4Y2XA 4YPFA 2IYUA 2YC2C 2EP5A 1CXUA 2FLKA 3MRVA 4OQFA 5DGXA 1PJTA 4Y7DA 2V97A 4XX0B 2PUDA 1F48A 1QV9A 4DBVO 1OMOA 1NOIA 3WXMB 3QM1A 3OX2A 2FSFA 4I5FA 4KXXA 1DKQA 1R6VA 1NM5C 1SVIA 1GUDA 2CFCA 2DUJA 2WIGA 2X14A 2POQX 4O0JA 4WVLA 3AB8A 4IKEA 4Y6SA 5JW6A 3WGHA 3P31A 1SXQA 3JQQA 3G0BA 4JEMA 2FPMA 1NW8A 2G6BA 2Q2RA 2QIPA 3L6UA 5JI2E 5B1DA 2IYPA 3MK6A 2DE0X 1KBZA 1SUBA 3GA7A 2GS9A 2HSDA 3OFNA 3VTKA 4B7CA 5HIKA 5K6RA 2PA3A 3DMDA 3I1IA 1ZRNA 3O26A 3AEXA 2D1QA 3N1UA 3HYSA 1ZRHA 2FSIA 1A9QA 1YR2A 3PICA 1M7HA 4FLEA 1RYFA 5ITZB 1E1RA 1ZD3A 1JBQA 4L4UA 4MKXA 3PGVA 1I94K 3UUGA 2X78A 1IOVA 3KD1E 2AN9A 1GLAG 3CNQS 3HADA 4R5PA 2CXNA 4Z9AA 2HDOA 4WT7A 3CPSA 5BREA 4YHHK 2XYPA 1JXOA 3D3NA 3ZSRA 3EZLA 1HDEA 1L7AA 1UMDA 3MWPA 3SSMA 3PXEA 1WNFA 1SQKA 2X3YA 4J4HA 3HP7A 4W63A 2OFWA 3VUEA 1AKNA 4ETMA 1TCVA 3L7IA 1A76A 2H31A 2YRWA 1B92A 2CFOA 2LRHA 4D3YA 3JWGA 4YAGA 2VDKB 4EHKA 4EX6A 1DRUA 2VHTA 1JBKA 5T4EA 4P82A 2NV6A 1YI1A 2OK8A 3R0JA 1OBCA 4FI3C 1ENZA 3UW1A 1ORRA 4CGJA 3OPYB 3QMWA 4CIAA 2Q29A 4P98A 4RW6A 2Y2UA 1MC4A 4AKGA 4L8VA 3P0EA 3TF5A 4HTAA 3UK7A 4GXNA 4BCCA 2AC7A 1IOLA 5GJVC 2GJAA 4MTCA 2AZXA 1YOBA 3PGLA 4OPHA 2HU2A 2UU9B 5C7YA 3FIJA 3L7AA 5KEIA 3BA6A 3K1TA 1NWHA 5AT1A 2NXCA 2ZBQA 1DAHA 2GVZC 4CM9A 3GPCA 1Q57A 1PSDA 3CIFA 3VEOA 4AC9A 1N32B 1MLDA 3RDPA 1QRAA 3B6MA 4BNXA 3VR6H 4I81A 1JQLB 1CQJB 1IUPA 1SG6A 1XZKA 4R1NA 4J2AA 1UPBA 4H1VA 1JIVA 1P0MA 2WHYA 2ZAOA 5DHQA 1EFPB 5FNVB 4Z0TA 4Z7OB 4M9QA 1C50A 4PQUA 2HHWA 2V96A 4P6VF 4RGQA 9LDTA 3QVKA 1BIZA 4BFTA 5LOVF 4HKTA 4U0JA 3F5TA 4BR4A 4HX5A 4U1RA 3ITHA 1H6DA 3UK6A 4EB0A 1ISRA 3OEWA 4F21A 1SJ9A 4JC0A 4CGDA 1MABB 3GD5A 5HIIA 4D8XA 4XQ9A 3EFHA 2EZ9A 3AY6A 1P77A 1J54A 3ZETB 3AEZA 4Z7NB 2VPWA 3E3LA 2RB4A 3Q8LA 3VDRA 3U7QB 1YJ9N 4QULA 4HYEA 2O6HA 2QPLA 2DHCA 4D80A 3VKHA 1U1DA 3ZSYA 3TTXA 1R4NB 4P53A 4QOJA 2GN6A 2W70A 4OYRA 3RODA 2WWTA 4DTJA 4L75A 2IVNA 1S8OA 2OESA 4TV8A 5TJHA 3SYNA 3VR5H 5BSFA 3RKUA 1PEYA 3PL1A 3H3OB 5IDXA 3ZVMA 2FRXA 4OEHA 3TAGA 1D8TA 1WPXA 3PI6A 1CJSA 5FOSA 1K8RA 1NVTA 1UJ5A 4U7BA 1N2CA 3V9SA 1TFUA 3ZE9A 3ZDBA 4CBUA 3GB9A 1EXWA 3CETA 2BVNA 2Q49A 2W6JA 4JJKA 5G41A 4CXMA 3IL2A 4YRSA 4IDDA 3G6WA 4QAGA 1Y9EA 1BFUA 2YI1A 3IALA 4JQOA 1U28C 3I42A 2E4AA 3D8TA 3HCCA 5EXWA 5KB3A 1NM1A 2PRZA 4Z51A 2DJ5A 4UQLA 3BILA 2TMGA 1DCTA 1TECE 3OYGA 1GQSA 2ZYVX 3UKOA 5BR1A 4DSTA 4BWMA 1WSWA 1IHYA 1SC6A 3C3CA 1YR1A 5TPZA 3F67A 3UKDA 3WIUA 3D31A 1LBTA 5DN6D 5KNBD 1E7RA 3S2EA 13PKA 2FR0A 4FXPA 1AQUA 2Y0BA 4JYPA 4UUMA 4M9SA 3FPJA 4B3DA 4CKBA 2Y0CA 2HC9A 2DBRA 1XVIA 3EIFA 3IIMA 2PT5A 3FUTA 3M9WA 4ZCSA 4XYEA 3OE7D 3BS4A 3E3NA 3OOJA 1X80A 2J6CA 5CD9A 4S12A 1YBHA 1V7CA 3ZY6A 1A72A 1ZBLA 1F5NA 3MGBA 2IYYA 1C9NA 4F8YA 5KVCA 1JSRA 3ITNA 4LEIA 4CNBA 4OXIA 1LJLA 3G9XA 3HWRA 1Z2AA 4Y2UA 2WHXA 4AG3A 3E5NA 3HJTA 4WF9L 1Z34A 5DNUA 3DT8A 5FR1A 1DEHA 1IHOA 1ZK1A 2J3JA 2O0MA 3OPNA 5GM2A 3SHWA 3L4JA 1CEYA 1FDUA 2NSJA 2QG9A 1G0OA 2WWWA 1NU6A 1ZMXA 2VK8A 4MVJP 4IBOA 3UGTA 2KZMA 1R0XA 4CGFA 1K3FA 3PHHA 4JX9A 5H70A 1KE2A 5AQZA 1ZYUA 4ZHRA 1F2DA 1MQSA 4YPVA 2EHJA 3L4KA 3RSEB 2XUIA 3R7NA 2YNMD 3ENNA 1RXYA 3EPPA 4E0DA 1GPLA 1OLUB 2BTQB 2QPTA 4G6ZA 4K1XA 1JTEA 3A8TA 1U2SA 2O8BB 4RA9A 3D2EA 5IVDA 3VM6A 5IJ9A 1YIJN 1U0NA 2BGMA 3TPQA 2WG0A 3DQQA 4M46A 3RJTA 4EY4A 4TKVA 1SAZA 4D98A 3D5TA 3IUJA 2Z95A 2VO1A 5BY2A 4LDNA 3GJZA 2Q7OE 2XYHA 3NF6A 2H1OA 1PTKA 1CP2A 2IIPA 3A1TA 2FSGA 3DBHA 2WFAA 5KVQA 2HBKA 2QN7A 1AOXA 3GGJA 1AX9A 1F51E 3KAJA 1ZG3A 3DMRA 5C7LO 5JAMA 4HGPA 2FPIA 1K7SN 3EAQA 2IS6A 3EIXA 4KI4A 3MPOA 4TX1A 5CNJA 5CGQB 3P2KA 2ZWHA 1XTIA 2PEZA 2RGBA 1OYYA 2YZ7A 4W99A 1M2GA 2AL7A 3LCVB 1BG3A 1U90A 1TJ5A 4G0QA 3A6LA 4C3UA 1HTWA 4R5MA 4OPMA 4ZCMA 3OMWA 2EWWA 2P2SA 5J2TF 2CVPA 3LVFO 4GKJK 3BULA 3LGSA 4RY9A 2JIDA 4R8KA 2PTGA 5AZJB 3SXUB 4H17A 1O5OA 2QYTA 4ZVMA 2D5IA 3VJKA 2FBVA 4A0RA 3RVQA 2CFRA 2CCKA 1ZGBA 4MQLA 2KX7A 1SCJA 5JZMA 3NBQA 2I6SA 2H3EA 4HDAA 1M1KO 3MOSA 1MH9A 1NW9B 3EG5A 3HYCA 3MSCA 4ER5A 3RRFA 3UCEA 4G56A 3ZJUA 1ND6A 1DMSA 5BVHB 1VIDA 3F5FA 4CF3A 2HU7A 2FG6C 1PNQA 1Z0KA 2LKCA 4FDMA 4XWTA 3OYJA 5L7TA 1U7WA 4CV3A 5AO9A 2HJ9A 5AW3A 2GYYA 3DS8A 4GMFA 3H5IA 4A2AA 1FLVA 3KIPA 2E48A 3KO8A 4E2ZA 2IBSA 3ZE1B 3I9NA 2GTDA 4DSNA 4EYQA 5K8CA 3D7EO 2GN8A 3GWZA 5LNK6 2AEJA 5JJKA 4X1KA 2QG4A 2E6UX 2G8LA 3FNBA 3HXKA 4OMDA 4B3IA 3K2EA 1ZZGA 1SQGA 4LRQA 5AOVA 4C4OA 3AXSA 2GEFA 3KKMA 3Q5DA 4U5QA 5HBRA 1KK2A 1Q18A 5A9TA 3TD2A 3ZYCA 3CG7A 1PFVA 4KE9A 4QLBA 4CT0A 5BUSA 2VDJA 4AUKA 3QP9A 1SIBE 3W1EA 1XLUA 3VHQA 4N41A 3JYNA 2P2YA 3O3GA 1Z0DA 4KCGA 2HRRA 4G0XA 3F7MA 4L3OA 4LRWA 4MARA 1L5NA 2EGUA 1AE1A 2FSPA 3H17A 1TTTA 4BXOB 4F46A 1XOIA 1L4YA 1VLLA 1E62A 2X0NA 3LLVA 3KPWA 4R2XA 1WSEA 2ZCJA 3PV8A 3AR6A 1ZZEA 5H0IA 3CCJN 1H2YA 1O95A 4G1VA 5A5DA 2H54A 1YZNA 3TKAA 3K1ZA 5EIHA 1RBZA 3AVFA 2PH1A 3FBWA 4DA0A 4BDZA 1TXGA 3ZT2A 1V96A 1YT5A 3FKSA 4KEAA 3WFZA 3AVLA 2A4MA 1DIAA 1ULZA 3L7OA 3NHMA 4GE3A 3RBXA 3KQYA 4C4TA 1KRWA 2G1JA 2JJ1D 3D6TB 4ELTA 3GJYA 1T8SA 3SAJA 2D0PA 1RI1A 1K68A 5LJVA 1A69A 1WB9A 3UM9A 3OQHA 5B4UA 3L7JA 5KTKA 5M29A 3T3NA 1ICIA 1WKBA 3TUZC 4D6XA 4JKGB 4K8XA 1C9MA 1IJJA 3OA0A 4HAWA 4OYLA 3SXUA 5BUCA 5IYZA 1AK2A 2Q36A 3SUQA 4GAEA 1C0LA 1GR1A 2XMCA 2AGVA 3JQGB 3W04A 4C7KA 3P26A 1OF1A 1EIZA 1R6AA 1AURA 1QCCA 3AUTA 2P90A 2UVQA 2XSZD 3K9HA 5KX5A 4YIHA 4HVTA 2ODPA 2CLFB 4D6PA 5JEDA 4X65K 1IOZA 3OYEA 2VYQA 8MHTA 2PGXA 1RJDA 1B9DA 3SJHA 4GV9A 1ZCFA 1NI4A 5EJ4A 4V1CI 2J5QA 3FR0A 1PNVA 2MTBA 4GUDA 2HBJA 4RV5A 4CN8A 3BB3A 4A36A 1ODJA 1JAZA 1XNQB 4FO0A 3GOHA 3ZS9A 1EBUA 3C24A 4ZDWA 1Z25A 2WYUA 4Y1GA 3LP5A 4RE5A 3R8EA 2B6AA 3HUFA 1OBFO 4KC0A 4LWQA 2ODTX 3ZDCA 1N1MA 5AHWA 5H1SQ 2EG9A 2VBCA 5JVDB 1IN6A 3PJRA 1Z7GA 2XCIA 4RYDA 3ZDDA 2HMSA 2VR1A 5A2GA 1QQTA 2WHRA 4F8JA 4M53A 1CKEA 3R7DA 4QL3A 5JY6A 1ZD9A 1FNSA 2FX2A 2JJ1A 3V48A 5A7FA 3AC0A 3HNPA 3FMOB 3RUFA 4ZIRA 1S6PA 2P77A 1R6XA 1CDDA 5AP9A 3DV2A 3KXPA 3MRTA 4UM5A 4G2TA 3QKRB 3IHTA 1KVAA 4F56A 1XHEA 1OHHA 1XZMA 2OCAA 1JT2A 1NW6A 1V3TA 2DETA 1N33K 2QUBA 2Y1EA 1EJ0A 3ZK8A 3SX4A 4RD6A 3KHSA 3HBLA 4G5SA 3UA3A 4B43A 5BW8A 1SXHA 6ADHA 4GECA 2H0QA 1XEXA 2O3JA 3T7SA 2ODEA 2MR6A 2FWAA 3OI7A 3QFSA 1QYDA 2N0SA 3OEHD 3H8VA 3UH1A 3VKUA 1BN6A 4Z3KA 2PGJA 4LRSB 5KOJB 4BE2A 1D6MA 1Z6TA 2Z04A 1AZLA 2WP8J 4NCGA 3JWEA 2PKCA 4L7VA 2PJUA 3DP9A 3M3PA 3MAJA 3A0UA 1TCUA 3PRYA 4Q3BA 4Q7LA 4RETA 3WB2A 4EBFA 10MHA 4BQIA 3N5KA 2A5FA 3IA2A 3H5OA 4W9RA 4YRPA 2DR2A 3SZOA 3CLUD 3DXYA 3EIHA 2BFBA 3SQ1A 4FHEA 1L3IA 1KSHA 2H1LA 2JATA 3FZMA 3EZ7A 3G17A 2D2FA 3KEFA 3PUJA 4FNMA 4LJ6A 4NJMB 1ZNZA 2P9JA 3HDJA 3I01M 4G07A 4LZOA 4OJQA 5L3ZA 4BJ1A 2JLXA 4ZEWA 4IH4A 1Z6AA 5J2UA 5CPFA 5EZYF 4GPZA 3O93A 3T7JA 5MN6A 4K8RB 3H8SA 4IJNA 4F11A 2R66A 5K20A 1MJGA 1HORA 5HYVA 1BO6A 3R5SA 4MROA 1SKAA 4RLFA 4X0EA 3TDNA 4GYKA 1XPRA 4RTPA 3G3EA 1QQ6A 2BC9A 3E1SA 5A2QA 3ABOB 3KZBA 3A3NA 3IA7A 5C8XA 4CODB 1T9CA 1VGVA 3DLHA 4L08A 1XEAA 3ABRB 2G36A 2YWEA 4B1VA 2RGGA 2W6ID 2XWSA 3Q6IA 3KQNA 4GO1A 3AX6A 3BBLA 1KI6A 5JDIC 2GARA 5AI5A 2I2BA 3CZ4A 5CFLA 4Z4HA 3JQEA 4MGIR 1L5YA 4CM3A 1NJGA 2OV3A 5ICMA 1QE5A 4PG6A 3MS7A 2K7ZA 2FUEA 3LQYA 1GA4A 3IEPA 1NUPA 3KVVA 5C3MA 2DGDA 4GKKK 1GQ2A 2P9EA 3QUSA 2QPOA 4KV9A 4OP2A 2EARA 5GVRA 2WYOA 2A59A 1N4AA 2O20A 5K8LA 4EQ6B 2CJWB 2VP4A 2W2LD 3ZBQA 3U6FA 1J1UA 2RGXA 2QTRA 3R8XA 4AZ0B 1S01A 5CBKA 1IHPA 2MSWA 4UMFA 2ETXA 2H4HA 1IHDA 5HKOA 3RLFA 3V1NA 2G4LA 4DIOA 1CY2A 5U9CA 3UPTA 1A8UA 4Y2RA 3UFXA 3V4FA 1WDKA 1XQ1A 2P0AA 2RHWA 4MV4A 3KK1A 4X62K 3DMNA 3DXKB 4MS3B 4FD2A 2EL7A 4JY7A 4PC3A 3L4QA 4ISGA 4LD0A 5HS6A 1MO5A 2ITGA 1OLOA 3FRHA 3RS3A 4K03A 3QFRA 4KE8A 1X13A 2C2BA 4OD0A 2FLOA 2VOJA 1LDEA 3N9IA 1YJCA 1V16B 2B34A 4PTLA 1BH6A 3BWYA 5CLJA 1WHSA 2CH5A 2N42A 1ZWLA 4K8ZA 4KFCA 4GDFA 3TZLA 5DHUA 5REQA 2FX3A 5IKPA 4BE9A 2VQDA 3EXG1 3SC6A 1QVAA 3AW8A 3BMXA 5FT9A 5KVAA 1KAZA 4NABA 1SQ0A 3A5MC 3AIOA 1I10A 3MMVA 3PL5A 4FDVA 3T7KA 4BMPB 4BE0A 2CGKA 2ZKLA 1A71A 3ASZA 2M6SA 2CLCX 5BV7A 1JLGA 1RHJA 1U0HC 4PX5A 1MNAA 4RE6A 2QVZX 2J5BA 5ECWA 1DQRA 1M1XB 3GW8A 4EKYA 5HXAA 1SVKA 1NQOA 1EIWA 3CNNA 3T9CA 5KNBH 5DCLA 3SLGA 4EUKA 2A40A 1B1AA 3KEMA 5C4IA 5HJEA 3ZHBA 4B4UA 1M1YA 5CVEA 4EG6A 2XMSA 5LMCA 3U44B 2V0GA 2IPOA 1QHTA 2HWWA 2XYQA 1W85A 3L1UA 5FHRA 4JI0K 1KDTA 3SE0A 2Z6AA 4Y8VA 1GGNA 3QYPA 4E88A 3EZXA 2GX6A 3CVVA 3UC9A 3T3FA 3DNFA 4DF3A 4ZU6X 4EPWA 4TRRA 3WSWA 3BFKA 1TTPB 3MELA 1V43A 1RYBA 4GMJB 1NVWQ 3CFYA 2H2DA 5FTMA 2IXFA 5C5DA 2JJQA 1XU4A 1XXHE 3KVNA 2ZSDA 3I28A 5EHIA 3SD7A 4B2PA 4MIYA 3WX0A 1TM2A 4NSNA 4Z8YA 3ZBUA 1GDDA 4LYFA 3CJQA 2WMNB 2FP4A 1LF5A 4KQIA 3F6SA 3HU2A 4XIGS 2YWCA 4ZAYA 4BKMA 1Y81A 5LBUA 3ZD8A 1C0GA 1F2TB 4ZCQA 4YFVA 4F4DA 3OAAA 4CESA 1GZ5A 4JN4A 3ISVA 4LFBB 1VSDA 4UMVA 4CKCB 1H2AS 3KWIA 2ZJ3A 5LP6A 1EWKA 3MTIA 1O96A 2PV0A 4MV6A 4DR4K 3S44A 1C4OA 3VU1A 4ND8A 3OU2A 1GIAA 2BV3A 3T3OA 1IC6A 2W58A 3HN6A 3OT1A 3UGKA 1Q1QA 2PSDA 3M6VA 1Z5VA 1W2HA 2XDQA 4BACA 4NV3A 1Q7BA 1SVOA 4QD3A 4PYKA 5DEOA 2NU8B 1C3XA 1O94A 4OI4A 3TIFA 5DOVA 1T8TA 1SCUB 1VKRA 3NGZA 3E6AA 4KO0A 1E2JA 2CLEB 3EGWA 4FNAA 5F3RA 1G9XA 1XYGA 1YQGA 4BASA 3LC7O 3TDMA 1R6TA 1CQWA 1FYVA 2F67A 3JASB 4IMPA 4KBYA 1Y64A 2RFLA 5DISB 3UAWA 4XQEA 3Q72A 3NGXA 2FQQA 4F4FA 5AVRA 5K0EA 4LSNA 3C0BA 5D00A 2O8BA 3F73A 1E1QD 4LA4A 3HCPA 5IBQA 3ZKWB 2PY5A 5TQ2B 4D42A 2MYTA 1T1GA 3CXRA 3L2UA 5CA0B 2WB2A 3VFDA 1R37A 1ODIA 3KTFA 3VZDA 3RRYA 4HDRA 4EABA 1P75A 5DGHA 1KNQA 4IO0A 3D3KA 1FRZA 4Q34A 1QTMA 3A1CA 5EY4A 1UMBA 5G0UA 3BE5A 4JBLA 2CDRA 2GNOA 2H9IA 2IIBA 1RT6A 3HFRA 1BFKA 1XA4A 1GRNA 5E3IA 5HJ2A 4A4DA 1VGRA 3NZEA 2J4RA 4K9SA 3MAAC 1TE2A 5EIXA 4IOCL 4A5OA 4FJHA 2NU9A 3H1GA 4OI2A 1LBEA 1O97C 3A6EA 3OWXA 2HBMA 1PP4A 3KQMA 1VDZA 5JXHA 1IPHA 3LS2A 1O87A 5CK4A 1MQ8B 3HC7A 4JP2A 4R51A 4ZDIA 2WIDA 4QGHA 1HFJA 2WG1A 1C0EA 4S0XA 4A8HA 4GXRA 1P60A 3HVHA 4CTJA 4CHTA 3EUFA 3RABA 1GKIA 3MEGA 1RBVA 4LXYA 3MXJA 1QS0A 1UXHA 3D81A 1C1XB 1OW3B 2ECQA 3KHTA 3QG5A 1PS0A 2AJCA 4G0OA 3RSZA 1FQWA 3HBFA 3K6JA 4ARBA 3Q3GE 2LE0A 2FZ5A 3AUAA 4QRDA 3VV2A 1OXVA 4Q66C 4WE1A 1CLQA 4Q4AA 4WKOA 4A8TA 3AZQA 1BKYA 4YREA 1XCBA 2QTMA 1WCYA 2BF4A 3EIUA 1NUSA 3V1LA 2X74A 3TM5A 4PLGA 2R87A 3HYTA 4YDRA 3ZQJA 4JVLA 3MK31 5AKEA 3PX4A 1M6VA 2I7TA 4CEZA 1C4XA 2IUTA 2PMDA 2Q3HA 2ZU0C 3F8WA 2J9FB 3HCFA 3PX2A 1JKIA 2X6NA 4P7GA 3KWLA 5KC8A 3SBGA 3C41J 5HTOA 4GGOA 5CG1A 2J33A 1Y80A 1DARA 1H6CA 4XSGA 3S99A 1Z63A 2ICAA 3EKSA 2OORA 2JFXA 1P62B 1K4KA 1XB2A 2GK3A 1CVLA 3TMYA 2E2NA 1BCOA 4CJLA 2VT3A 1WCIB 3FLEA 4NV0A 5AXCA 2YBEA 1LDYA 1WV0A 4KE7A 1ADBA 1O03A 3GNSA 4KN5A 3TX6A 2YHAA 4BB5A 1UJ4A 5AVQA 3F7NA 5GINE 1U2QA 2CV2A 4DFPA 2J5KA 1M1NA 3H1EA 1UEIA 1AJEA 4MYRA 2F6RA 1CRWG 3CNBA 4FYYA 2FMTA 1YDWA 5FQNA 1ZSVA 2P9PB 3PB3A 3WIVA 4DR1B 3TW6A 1TM3E 4CCAA 4MP8A 4X8HA 2BN4A 3NBXX 5IBRA 3AVHA 4UD2A 4YYEA 4DB2A 1CW2B 2D3TA 2IPXA 2I78A 1TYQB 1FUKA 2YWRA 4KAFA 2PUGA 2WZCA 3NQ41 3IB3A 3NBFA 2FPSA 4HDRB 3ZQUA 5BSWA 1N0WA 1ODLA 2WFBA 1SH7A 1STOA 2BPOA 2DM6A 2R5WA 1TJ3A 3A9WA 3L5KA 3E22A 2C5HA 2EFEB 4FDLA 3QUAA 3WKBA 3ZY3A 1CR0A 3QEXA 4N1AA 3EDQA 5IFLA 4DJEC 3SPZA 3X1JA 3SZGA 5DI9A 3MTQA 1IG3A 1VPWA 3Q5EA 1KP2A 1E3JA 2PKQP 5HFAA 1F6WA 1NXSA 3E5HA 5FAKA 4XGRA 1V5IA 3LCRA 2J0VA 4O1HA 4AIIA 1Y8ZA 4KH5A 1U7TA 2BE2A 3BMOB 5CJJA 1GXSB 4I8XA 3X3HA 4Q24A 5IG2A 2NYUA 1P8ZA 1IH8A 2I4RA 3H7IA 4U2EA 1Q5PA 4EG0A 2XQVA 1V5WA 1GGMA 1J9ZA 3MHPA 2VJLA 1AHPA 2AR7A 4M0DA 4EPTA 2ZXFA 4PQEA 1YAJA 3SV3A 1E2KA 5WRFA 1YVEI 1QE1A 3MBOA 5K8TA 1G59A 2E4WA 4R9SA 1DKMA 4G0VA 1E2EA 4AQYK 2D4AA 3NDJA 1HDZA 3E9DA 3ND8A 2P9UA 1K7YA 4NBKA 2YNIA 1K0FA 2JLAA 3MT7A 3MD0A 3E01A 1N2OA 2PH7A 3ATVA 1GRRA 2AOUB 4PYLA 5ESRA 1ZK4A 3LPTA 1Y4ZA 2IHTA 3B5JA 3BDAA 2PQ6A 3VMFA 1U80A 3T4UA 3AL3A 3TCNA 5K8UA 3HTXA 4MYCA 1E63A 2MSCB 2RC6A 2ROQA 3JYHA 3NWOA 3LAWA 3H2GA 3DBVO 1M83A 3GNQA 2X8BA 4KH1A 4URYR 2V59A 1PJQA 2VKQA 2Q2OA 4NRDA 4V0SA 3DDHA 3V3TA 3BF3A 2ZVPX 1N33B 5C8YF 1HK7A 1OLSB 3RFCA 3EQ6A 1WLJA 3G2NA 1Q44A 3O82A 5EWJA 3W9UA 3ZD9A 1ISJA 2SECE 3DR5A 4ND2A 4QO8A 1H2BA 2GXSA 4PAQA 1DX9A 1H9BA 2OKGA 3DTYA 4Q0MA 1YFKA 1PT7A 2FJUA 2Q9CA 3UCFA 2XUDA 3T7DA 5FPSA 2BI8A 4PCAA 4FINA 5KYUB 3QU2A 1IN8A 3TSUA 2MINB 1OWMA 2P5GA 1HM5A 3UEOA 1JECA 3DPSA 3W8FA 4B1YB 4OHUA 1WUHS 1QGUA 4B80A 5I4CA 1NXPA 1N6OA 2QVBA 1JAIA 3RS0A 2Y1KA 3AT1A 1PW7A 1K98A 5I42A 1TU4A 2X0IA 3M5PA 4JSTA 4PWZA 3HH8A 5SZHB 3S6JA 3INNA 4C4AA 1CUVA 4UEKA 5MHTA 2E18A 1GOAA 2F8TA 2RHKA 2I65A 5KMGB 1KQFA 4YCLA 3R9PA 2FY8A 3GVIA 3K92A 3UOAB 1L3UA 1ACMA 3CQXA 1SQ6A 4LBYA 5KNCH 4GP7A 1QIJA 4Z4EA 1U2EA 4CGHA 3N8KA 3NDRA 4URUR 1RJEA 2Q5QA 2R8BA 3OSZA 3TANA 3DC2A 1K5PA 2WOOA 4MV3A 4MUKA 2C7RA 2EKDA 4ZOAA 4Z9BA 1AB6A 2Z8YA 3GLFB 3B6ZA 1KMQA 2O0LA 4M9RA 4MUJA 3TCKA 2Z6QA 1KS9A 1NT4A 3ZHCA 5BWLA 5IAOA 4YOWA 4RVSA 3WDLA 1L6RA 2YWHA 1UWBA 5JATA 2RN2A 1KC3A 2GLTA 2IOYA 3C5EA 2JH8A 5LQMA 4BZXA 3O94A 4CWAA 2PZMA 2J7PA 2CE7A 4M3RA 2B25A 3GYGA 3MQ4A 4KO4S 4OHKA 5GONF 1T35A 1GPDG 3PDIA 4BNHA 1MIOB 3CR8A 1XZIA 1EYZA 2C98A 4ZCTA 2KKZA 5GIPE 1BDIA 3K2IA 1VMKA 2B1GA 3LUBA 2PWPA 2YV5A 1KC8O 5J4LA 5LZ4A 4OQPA 4AP9A 2IF2A 4H6PA 2EJBA 4H5RA 2UZ1B 4OCZA 5L4LA 3S81A 3TLXA 1OFGA 3TN7A 3FWZA 2W6ZA 2D8MA 3DPIA 2VNAA 3WFIA 1I4EB 5FLXO 3ESRA 2Q9UA 5GIOA 2HQOA 2NWQA 5J2MA 1T4DA 2NUPA 2ZAGA 5LM3A 3I3OA 5JQWA 2F4VB 5HTKA 2XCQA 3HJHA 3O7WA 2AG1A 4N12A 2OCYC 4EMUA 4IUYA 5AICA 2VWPA 5JZBA 3CIOA 1HLPA 3QBEA 2A1SA 2JGUA 1Z0ZA 4RD2A 1W5BA 1K6YA 5KSOA 1XMSA 4KO1S 3VEYA 4CM6A 2IH4A 3EIQA 2P6NA 4ERXA 1TJPB 4GVPA 3WAJA 1YMUA 3NDPA 1KC1A 4F9FA 3LOUA 2AG5A 1Y6ZA 1D4FA 2RAFA 3CQ9A 4EYKA 4NMWA 6PFKA 3BMQA 1CY8A 1VDMA 1T15A 4FJNA 2BH1A 2X42A 3B82A 2VWBA 1TDJA 3CLUC 4FSDA 2CJXA 2K7FA 3W5CA 5LYJA 2BRUA 1YAHA 2GJ9A 2XR1A 3BPSA 3U62A 3UJDA 3QK7A 4ARAA 3K9KA 2C20A 2O8FB 2DU8A 5AQRA 1S1MA 3QX8A 1CXZA 5LA6A 4CV2A 3IIIA 3R0XA 2P3QA 3ROFA 4CM8A 5TLSA 4KV7A 2I91A 1JFVA 2J0EA 2UUBK 4D9CA 4DIKA 4LK3A 1CHDA 4WXYB 1V11B 4JUAA 2A78A 2F9LA 2XY5A 2P4UA 4MKFA 1ODCA 2Z09A 4M89A 1IUNA 3NHZA 4UBMA 1GGKA 3DOFA 3FKQA 5CVJA 3UGJA 2BFDB 5JRZA 2CSXA 2B5WA 2WNIA 3SMVA 2J6HA 1VRVA 3C1AA 3OJSA 2AR9A 4XIIA 3ZG6A 1N1GA 4OFBA 4UCQA 1Z4IA 2ISSD 1ZGCA 3C85A 4JVMA 3F5SA 1UKBA 4LYJA 5KDLA 5A7GA 3O6WA 4DQQA 1IZ0A 1P9RA 3AI7A 4MKRA 2WA1A 5D5QA 4D96A 4YAKA 1ZJWA 1Q15A 4ND1A 1N6NA 3ONEA 4MS3A 2OAEA 3HI4A 1GNLA 1SK8A 3CX3A 3TR0A 5HUJA 1KFCB 2G07A 1N0UA 1DTTA 2FN3A 2C84A 5A7HA 2X2EA 2NNWB 4F0JA 1YUWA 5CA1A 2X58A 3LANA 1YF3A 4GL2A 1MNQA 5EZQA 3OUUA 5LLSA 2P75A 1DFIA 4D0GA 1R5NA 5KQGA 3NTOA 3M9XA 3BSWA 4K9KA 5D3GA 4DXAA 4DR7B 1GLCG 4HPJB 4X97A 3SJ7A 3TPFA 1CZAN 2PMWB 4BV9A 2H65A 4TXHA 1PLJA 3IS9A 3F2KA 1XRRA 2YC4C 3O75A 4Q6BA 5IW8A 3TW4A 4D1YA 3G0HA 4BNVA 1E2DA 3PU6A 4FWTA 4Q05A 3BZBA 3K70C 4QS8A 3T3HA 3I56N 3MN9A 1VLZA 2GBCA 5K0LA 1J5XA 2NO5A 1SU7A 5KHLB 1GNQA 3U48A 4JAVC 4MV9A 2HHTA 1BXGA 2ZVDA 4H0PA 3SR4A 3V2IA 4DCOA 3GC6A 4UFPA 2C5EA 3EK2A 2OD2A 2HNZA 4I14A 2FWJA 3HT3A 1GOTA 4LRUA 3V9UA 3KKOA 3TRIA 2C7PA 4H6XA 3UT6A 1N3YA 3O4VA 4JS4A 3HB0A 5SYNA 1ZH2A 3SQOA 1U1CA 5JCJD 3KLGA 3G9ZA 2A6AA 1PN3A 3UXEA 1YT3A 1L8OA 1THGA 1KPIA 2ORYA 3DT6A 3UMCA 4L3WA 3TKYA 4H1UA 3CUKA 3BIWA 1ADFA 4DQLA 5IHXA 2X2FA 4CCSA 2FZ4A 1DMRA 3ROXA 2FFBA 2QR2A 3HJNA 5JCOA 4TOIA 1C41A 3X2EA 2K5UA 4B40A 3GPIA 1ASUA 2WUGA 1K89A 1QKIA 3DVSX 2F3UA 1PUXA 1RFQA 1C14A 1KJ9A 1PQWA 3JD0A 4UXHA 5J2TB 4DREA 2L19A 4JLBA 1NBOA 1KVUA 3LDUA 4RK1A 2E1ZA 1SXJB 3W5DA 1RLUA 2EEPA 2FN9A 2PZBA 4ZOBA 2P6RA 4KGXA 2SCUA 2X76A 4FN4A 3CRMA 4B35A 1CQIA 2GCGA 2HWXA 3GZTB 1XGKA 3TTYA 5JMOA 5EHZA 2VG8A 4FWMA 3TD9A 1EWYA 3FUCA 2X4IA 3EDMA 1OH5A 2GCOA 4D02A 2A7QA 2C77A 3RRXA 2ZS8A 4YMTA 3NH9A 2ZIUB 1ACJA 4LZLA 4ZI7F 3DEZA 4OB8A 4RTNA 3ZCPA 4WJZA 2Z3ZA 5JYCA 3TMAA 1RM5A 1JWBB 1YBFA 4DSZA 1Q84A 2YFYA 1LPBB 4QTZA 4LOAA 3PVCA 3EVEA 1ZIXA 3EVNA 1C0IA 4QEKA 1QH8A 2DF8A 2EC5A 1NJFA 4FE4A 3TECE 3PUZA 5AKXA 4UVIA 4I1SA 1ZXXA 5I3ZA 3AF1A 2A92A 6REQA 1HJOA 1I6MA 3DMPA 4HWKA 5M1NA 1ENYA 1KKMA 1ECCA 1OZ0A 4PG7A 2Q07A 1QTRA 3SQLA 1RACA 5CLLA 3T5MA 2QRMA 3AY0A 5JC1A 4LF9B 2H4YA 3EE8A 1XRNA 4ABYA 2R6R1 2R85A 1OFTA 3IAAA 4ZCIA 1B73A 4CIYA 4P36A 5MFZA 2B5OA 2C0QA 3BHMA 4XCQA 1DBRA 1FFSA 3A6PC 1ULHA 1WZ2A 1PR1A 1RPNA 2P5UA 3STHA 4FJXA 1RJGA 3ENOA 3OE5A 3WDKA 3ZKWA 1DGQA 2G7MC 2YUTA 1UBLS 1HZZC 3U9SA 2BEVB 4PO3X 2QTGA 2KJQA 3OEHA 5K4HA 5BUZA 3SZMA 1KI2A 3NTRA 4XH5A 3JD1A 4M8SA 3SU8A 5D3QA 5I7AA 1S5PA 1SBZA 3RSFA 4YP6A 3V9XA 1YD7A 4D9EA 3LBFA 4IFTA 4N8SA 5IDQA 3GBPA 3SVLA 4IO8A 3HEAA 2VWKA 1KEZA 1KSFX 2JIOA 3IESA 4HC4A 3NFAA 1LNSA 2NSDA 1QYVA 2YRFA 4UFOA 3S8EA 4UHDA 4DFJA 1N5DA 4BMYA 3RH0A 3CUWA 1QFSA 1XTSA 3AKDA 3IVAA 4AICA 1KAYA 1R0LA 4E1MA 3JQRA 4CJ3A 5AQVA 4US2R 2HIAA 3QXSA 2Q5JA 1DV2A 2B4QA 2LNDA 1ODFA 3N7TA 4DHEA 4DSUA 3IUBA 2YVLA 4JKAA 2O8DA 1O2DA 2QU8A 1Z26A 2OILA 3C65A 1CETA 3TSYA 4PIPA 3VBCA 1VKOA 2J07A 3AQIA 5FL3A 9ABPA 5J23A 3NI2A 2CBXA 4I66A 5IDWA 3HXPA 3M2PA 1W1IA 1A5ZA 3IDHA 1JG4A 2HFJA 1JHXA 3A27A 2GCOB 1YAGA 3FDIA 4PVCA 1FB5A 4YJKA 5BOVA 4YCMA 1AGRA 1OAKA 3QFCA 4PRZA 5JSUA 2P4HX 3OJWA 2VXBA 4FDAA 1HMPA 2HBLA 1SKYB 1GPMA 1XLTA 1C29B 4FZZA 3NPMA 1KSJA 4HJRA 1ECFA 1O97D 4EKEA 2NTJA 4CG1A 1USWA 1X9SA 1ONNA 3UJ8A 1QU2A 1JR6A 4J03A 4TKLA 3SYTA 4JBGA 4X71A 2RE8A 2HR1A 2B92A 5HRUA 1A9RA 4F1KA 2WDZA 1T4GA 1SOAA 4YJ3F 2GKGA 1VGQA 1FNNA 2O4UX 3MUEA 3OA2A 5AKIA 2XRIA 5FUWA 2VF7A 3ST7A 2A1TR 3QEJA 4MMZB 3WXKA 1G6Q1 1NJ1A 3JYOA 5K0NA 2RJ3A 3UK2A 1NAIA 3G5MA 1YCFA 1A77A 1UF9A 4JGIA 4JT8A 1K6XA 3MFYA 4WAUA 1EO1A 3B8HA 2H1HA 1U31A 2FN7A 5J5CA 3O8OB 2VRWA 4IDCA 2I5JA 1RFGE 1RZUA 3ESBA 1DUSA 1O08A 1TQ4A 1GGVA 1VECA 3FZGA 3K31A 4KQ1A 1E4EA 4TKVB 1QR2A 2X7HA 3SLRA 3C2QA 1L5RA 3FWPA 4JT2A 1RNLA 4B31A 3FDZB 3M89A 3M34A 4BGIA 1RWPA 3B2EA 3EHEA 4F6CA 4CECA 1PFQA 5COBA 3EARA 2AH5A 1JIKA 1ZN7A 2IYVA 1TVKB 4RD1A 1XTRA 4B44A 4DJ5X 5L53A 3DEHA 3IERA 1TEXA 4BFWA 1QDUA 4ML3A 1XHXA 4CI0B 5HF5A 4NARA 2BFCA 4FYDA 5KNLA 5EXEA 5THKA 3P4YA 1BUPA 4UTOA 3WQTA 4PY5A 2AS0A 1XLVA 2CF5A 3D3JA 5ETJA 2PUAA 2F9TA 3RWBA 4CFSA 1BD4A 3L49A 3QKSA 4JOBA 5FL7A 4KPYA 3R6DA 3UJBA 5CT4A 5EPUA 4DCUA 1NT2A 1EDEA 3I23A 5CDUA 2FSVA 2ONJA 5CW1A 5GQSA 4QTXA 4D8UA 3PHLA 4YBRA 2ZUSA 1U2DA 4TMKA 3V4LA 2P35A 2P5TB 4YXWD 4BVPA 2IA5A 3HM8A 2P6OA 2X8JB 3ET4A 3QVMA 2PX4A 4Q7KA 3K58A 1BHQ1 1TKAA 3LALA 2XE7A 2A5XA 4UZEA 3UAVA 1P5FA 2VSXA 3OM9A 3FYCA 4MINA 2DR0A 1E5QA 3FHJA 1EDZA 3KKPA 5C2FA 1ZXLA 3JQCA 3D4IA 4KW7A 4WEQA 2L2QA 1RIIA 3L0IB 1NBEA 1V6AA 3ZCMA 5FOXA 4OHBA 5EJGA 5IBCA 16PKA 1ANKA 1NNUA 2FMIA 4Q1CA 3V8NA 1KDRA 1RT5A 3I6YA 4CIBA 5GY7A 3IVRA 4IJUA 3AF3A 4XJSA 5KKCA 3N39C 5LLDA 1H9CA 1J4AA 4O02B 2Z8YM 3WWPA 1ML4A 1B0AA 3SUOA 2I4OA 3OVMA 4RGVA 5AK0A 2ZR9A 4LYYA 2ZRFA 4Z49A 3MECA 3I0MA 1A2QA 2V7BA 2WIAA 4EKDA 1TM1E 1KP9A 2A1UA 2EDCA 4KVZA 1R5BA 3KELA 1EFRD 3L0OA 3O8DA 3N7AA 4LY6A 4RWZA 1T5DX 1IXSB 4JYAK 1X0XA 3BXPA 4RL6A 4AO7A 4CBVA 4F3CA 5CFRA 4OKSA 4CEIB 3I9KA 5TMEA 2JJ2D 1MDUB 1M2VA 2IVFA 3GFVA 1J07A 2BZ0A 4DCJA 4D43A 2FPXA 3NX4A 3R74A 1LZLA 5LMUB 3CX7A 2Y1CA 3FCCA 4QUHA 4GPAA 4WXPA 3RC1A 1UC9A 1IFXA 4A5BA 5IKOA 3OQ1A 3NH0A 2DFLA 1K75A 2MDTA 3AOGA 3LXUX 3LBNA 2FLVA 4R1PA 5B6JA 4YYZA 5EJEA 3FDZA 5J63A 4DKXA 4PGFA 2WTEA 3NG1A 2VF8A 4EIAA 4IVPA 1P9NA 2C07A 4QJBA 2REOA 1D03A 4QT0A 4B75A 2ADOA 2QQ0A 5IT4A 2Y71A 4WD3A 1JHQA 1PFKA 3PC6A 5JV5A 1CXQA 4L3QA 2QI9C 3HKBA 4ALJA 5AQSA 3C6KA 3ZWWA 1KZ1A 4N03A 3FPCA 3PD1A 3QO9A 3UFBA 1R1DA 2QUZA 1URPA 1YA4A 3BGIA 3NEPX 3UTCA 1L4LA 2BFCB 2QMQA 4KQ6A 4YBZA 1A9OA 5GWXA 1PDOA 3VQQA 4MV0A 3Q3JB 5IUJC 3E4CA 3O8QA 4CQLA 4KH4A 4YY3B 1P7PA 3G59A 4QUKA 3B51X 4XB6B 4OHYA 3PFCA 1M0WA 4ZHSA 5JLJA 2QZJA 3I9V6 3JCZA 1M67A 4ZQCB 1D4AA 3E15A 4EJ2A 2V9CA 4M3YA 2CL7X 2FMHA 3BCUA 4K8OA 4L50A 2ANBA 5E4TA 4L51A 4RV9A 1GGHA 4PCUA 4C04A 1LK5A 5E1BA 4G5OA 4DTRA 3MBKA 2OT3B 4QUDA 4BUZA 1X94A 2I6GA 3TNYA 5HM8A 2QK4A 3QVXA 4RULA 4H1WA 3M5RA 5DTIA 4OK3A 3CV3A 4TMXA 3UPUA 1KY4A 4M1TA 3UW3A 2ERCA 4IIJF 3FCSB 2YZNA 3NIFB 4DWOA 1BA0A 3ENBA 4KRXA 3QBWA 1XVVA 4ZYYA 4HDSB 4LY3A 2FWMX 4HQLA 3VPDA 3W06A 2LGJA 4B46A 4CM5A 1D8YA 1AMNA 4OQZA 4J7XA 1XG5A 3W7VA 121PA 4F5DA 4DPMA 1IKYA 1CQXA 4OGLA 3GN2A 1DAFA 4KHPB 5I7UA 3A2LA 3NM6B 5A05A 4IIYA 3WICA 4BLTA 2C29D 2YJFA 4FLTA 4J2EA 4YVFA 1UBNA 1X9IA 3FHCB 1SCDA 4JUCA 4N54A 4CM4B 3K9FC 2BGLA 2XKJE 3D6MA 3K6RA 2GFQA 2V9PA 2AVNA 3M3ZA 4IGKA 1MX3A 4JSYA 1K3UB 2GWHA 3HA2A 3N59A 1Q9YA 4X54A 1IBMB 4QQRA 5ELLA 2PMEA 2YY6A 3FNEA 3CKKA 2X8AA 4JLKA 3IOBA 3QLJA 4L8RB 3NGMA 4CKWA 3HL8A 1JU3A 2XYRA 1Z2NX 5HILA 3FOWA 1ESMA 3BL5A 1MJFA 4GT1A 4UNQA 3CZPA 1S4MA 4N5LA 1COWA 4MK4A 2YS6A 2ZWIA 2O57A 1NX9A 2D2EA 1LWNA 1HLFA 1A7AA 1RBUA 3INYA 4PIMA 1LWOA 4BPRA 1U2GA 3DF7A 3DW3X 4DLLA 4KX3A 4YCJA 3ZDRA 2JFHA 1W75A 1XQ6A 1KQOA 3IPAA 4U02A 1XZFA 3SYMA 4ETNA 2NRXA 1LQ2A 4V0LA 5P8WA 2ZREA 5B3JC 4OQYA 3KBOA 4MA5A 5L6MB 1AUVA 5BRFA 4KB5A 4C2BA 1YHZA 5FIUA 2AZMA 3IEIA 1FJHA 4JT9A 3DXZA 4PSCA 4Y6RA 2DFPA 3AU9A 2QLTA 3CCMN 1GLNA 3F3YA 5DNWA 2VZ8A 3T61A 5FBQB 1UKZA 2B0JA 1A2BA 2E49A 1OXXK 4TV8B 4UE6A 3HWWA 4D0SA 1G7CA 2HGZA 1EFCA 4DV4K 2VDVE 4WLEA 3CEMA 2IHUA 2FKNA 3KYJB 1PWZA 1LLCA 4DM4A 2ZJOA 3CF4G 2YZMA 3H1AA 4IXTA 3E84A 2AQKA 3TQHA 3HU3A 1OWOA 3AVTA 4WSOA 4EWLA 1NAHA 4FYVA 4Q4JB 4M3WA 4Q48A 2ZBPA 2YXDA 4YACA 5J2UB 2C2GA 3GRRA 3V8MA 4CFCA 1BO5O 1IBLK 3TNDA 1D9XA 1C2TA 4M6WA 1DKLA 1T1IA 1TLLA 3VNRA 1ZM2A 4DSJA 3K72B