2YHAA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
384
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
total genus 115
structure length 368
sequence length 384
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhaA01
3OYLA 3HS3A 3NF8A 1MB3A 1HNIA 4HNSA 1WSGA 1SRRA 3HSTB 1DJMA 2DTUA 5DKFA 4CJEA 3BBLA 3I0SA 3MEEA 3EULA 4L4UA 4FCYA 1JFVA 1FFWA 2FQYA 3M6MD 2NUBA 3SJJA 4CIEA 5C42A 2RF2A 2FQXA 2O4GA 4CGGA 4DSJA 3VQ9A 3QLTA 3OJUA 4KTQA 4CGHA 3OM0A 3F9KA 1VSIA 1BCMA 4FJ5A 2E4LA 4Z0NA 3C97A 4PYRA 2G8WA 4DSIA 4ETMA 1BIUA 4ZPJA 1LJUA 4DFKA 3RMBA 1IO2A 1X9MA 3SPYA 1NATA 3E01A 2J48A 1YK0A 3CZ5A 3G0ZA 5D2CA 1QP7A 3K58A 3EODA 3IPAA 1RZRA 2CD7A 1VSFA 4ZMSA 1L3UA 4RK7A 1IKWA 3OYMA 2GUIA 3O21A 1VSEA 4EYOA 4KTWA 4BE1A 2Q5CA 3BILA 3CFPA 1NOYA 4NCBA 1NKCA 5EWLA 3QLUC 4G0OA 1IKYA 4RY0A 4C8LA 1KVAA 3T38A 3KCNA 4HNQA 1VSLA 3OYHA 3ZSZA 4G1QA 4MRMA 5IUNC 4DTXA 5KTQA 3C94A 1KLNA 4KQCA 4H8KA 5JNSA 2D0AA 4JRPA 3DMJA 5HROA 4F11A 2FEPA 4KQ9A 3KD1E 1LWEA 2FMFA 1WAJA 3HP6A 3SZ2A 4CGIA 3KD5E 4EVQA 2O4IA 4ETNA 3H75A 3AO3A 1RT7A 4MLCA 4CFBA 5IULC 4HCBA 3AA4A 1NK9A 1DC7A 3NGIA 1EXQA 3HO1A 4LE1A 4O0IA 5J2PA 4N03A 1M5TA 4LDZA 1HYSA 1C1CA 4MR7A 2PE5A 3QETA 3QEMA 4I7FA 4ELTA 4KMRA 5KGWA 3NAEA 4IG3A 2JLEA 4JRQA 1NJYA 1A0OA 4RK5A 3JVDA 1L3SA 1J5OA 4YRZA 2DFFA 3PX6A 4RW6A 1QNLA 4DTSA 1B9FA 4W5TA 2GWRA 3A2FA 3LAMA 4IDKA 3QLVA 3OYBA 1ZH2A 2E4WA 5K14A 3MXIA 2IC3A 5TE9A 3KLIA 3LP2A 2FMIA 4Q0BA 4C8NA 4KHWA 1GOAA 4R5PA 4XXHA 3SAJA 3RRGA 3H1GA 2PUBA 3KKRA 3ZCMA 2PUDA 4LH4A 4M3YA 3EDCA 4IG0A 1JBEA 5FRMA 2A9OA 4RY9A 4LSLA 1U47A 4Z9BA 4MQEB 2IGIA 2OPPA 5DMRA 4CFCA 2VG6A 3VNAA 3AO2A 3W9SA 3UKJA 5GOTA 3I0RA 4CHPA 4HYEA 2FQWA 5TPWB 2PKXA 3V9UA 2AJQA 1D5WA 3I42A 3RVQA 5EU7A 2BE2A 3T19A 3Q7TA 2E6LA 4KHQA 4P1ZA 3ZSYA 7ABPA 4G0MA 3GL9A 4O0JA 1EAYA 2Z1GA 1G15A 1RDAA 4CF9A 3KK2A 1KCFA 2HPHA 4RK4A 4E7LA 1U2QA 1DCKA 3RVNA 4EZ6A 2GBZA 3AA5X 2AYXA 3MIZA 1CHNA 4MFBA 1ZBLA 4RKQA 4CEZA 3RVJA 1DBPA 3ZSRA 3O1JC 3TI0A 4B9UA 2X6SA 3V9WA 1UA1A 3LP1A 1U2PA 4UQGA 4JLHA 5KC8A 3LKBA 3N8IA 3SM9A 3IPCA 5C5EA 1S6QA 3K5OA 4MQ3A 4N76A 1BIZA 1LAWA 3HSYA 4MS4B 3M9XA 1WN7A 4GNRA 2A9PA 4MR9B 4LD0A 3KTOA 3RH0A 1C1AA 4CJWA 2M1ZA 1B00A 4RW4A 4AILC 1E6MA 3DOLA 1RT5A 3V6DA 5J2QA 1YS6A 2HMIA 2JVIA 2PL9A 3B2NA 1L5UA 4KHUA 5CYMA 2D0CA 2YKNA 3V9ZA 1JLGA 3QERA 4QPJC 1C0TA 3C95A 4CJPA 3VA0A 3M8PA 4F3TA 2W42A 4B9VA 3QEVA 2YHAA 3CQ8A 3H5VA 1CXQA 4F8JA 3WNFA 1VSHA 1X1PA 4OJRA 2PYJA 3V9XA 1NJZA 1X9WA 3S9HA 2FBTA 5C5CA 3OYNA 4FJXA 5TQ2B 1E2BA 3DM2A 4OPKA 3VQQA 1M5UA 1JXBA 5TQJA 3OMWA 4W5NA 3ISNC 5F64A 1GOBA 4M3XA 4FW2A 4CEQA 2MYNA 2EHGA 2HVIA 1GLGA 3OM1A 2X78A 1IKVA 3VN5A 4EUKA 1RXEA 3JTEA 2GX6A 4FJ7A 4B9NA 4AHUA 4D74A 1N6QA 1JYEA 4O1IA 4BDZA 4HUGA 4DFJA 3SI6A 4G86A 4FB4A 4MYRA 3ULDA 2IPAB 1A5XA 3ZSXA 2VG5A 3ILHA 4CECA 1BGXT 1SUQA 1DRJA 1VSDA 3TO5A 3OVNA 3RQIA 3H5LA 3E3MA 3D8UA 3P9YA 2ZWMA 3KIOA 2HHVA 2GI4A 2HHQA 2MYUA 3LKVA 2R25B 1BQNA 2HVHA 3RVOA 4NV3A 5I4CA 1FK9A 3DLRA 3DRSA 4XFKA 1JWLA 3OS0A 4IF4A 3NDKA 5JS1A 3OLZA 3T6KA 3GBVA 4RK0A 4XLTA 2IAJA 4EZ9A 2GBPA 1SL1A 3MMNA 4FK4A 3M8RA 4JAVC 3RVRA 2QW1A 2B4JA 4KI6A 4HHTA 1PHRA 4AH9A 4OLAA 1RCHA 2HQOA 3SQ4A 2OPSA 3O74A 3RVLA 5JNRA 1ABFA 2D5RA 4HNRA 1NXVA 5FROA 1VK0A 4C8MA 1U8TA 3AVLA 1EWVA 1S1WA 5EWMB 1RTHA 1Z25A 2PJUA 3NGZA 5SWMA 3CG4A 1BHLA 1VKRA 2F8SA 3AVAA 5IBQA 2V0NA 4IILA 2P5OA 4M41A 2FBVA 1Z17A 1DG9A 1JHZA 4FE7A 1YK1A 3Q7RA 1LWFA 2FVYA 2IKSA 2RKIA 4YR7A 4CK1A 5HP1A 2XRIA 3PX0A 3VQ7A 1FFSA 1LAVA 1MIHA 2PUAA 3QNNA 4FJ9A 3UK0A 5C24A 1JFTA 1TGOA 1CXUA 2Y1JA 3GWGA 4FM1A 1LK0A 2G8KA 4OKKA 2PYLA 5BRAA 4M3UA 1XHXA 4ELVA 2CHEA 4LE2A 3V1OA 5EWJB 4ID5A 5FWYB 4CBVA 1C4WA 3NHZA 3LUHA 1UAXA 4B9MA 3QX8A 2FC0A 3HM9A 2YNGA 4IKFA 4Z4IA 4FK0A 4FJ8A 4FJKA 3QLUA 4Z4EA 1NXTA 1NJXA 4GW6A 1HRHA 3SUQA 1TK8A 4CJ4A 4JP1A 3TAMA 4CE9A 2LP4Y 4E7PA 4CK2A 3VQPA 3FFIA 3RMAA 1NKBA 3LP0A 3NH2A 4HCCA 1ZAYA 2HW3A 3L3UA 4CJLA 2LSNA 1U0SY 2YHBA 3AO1A 1Q9YA 1E6LA 4D6XA 1D5AA 3AVMA 3L2QA 3RTVA 3OY9A 4DG1A 4DFPA 3ZT3A 5IUKC 1KRWA 3SUNA 2DFEA 4G0QA 4JB0A 1KVCA 2ZD1A 1RDDA 3OYDA 3EQ2A 4HVJA 4MQEA 3KK3A 5HQJA 1XHFA 3JYTA 1XHEA 1SV5A 3KLEA 1CYEA 5TPWA 1Z12A 1LW2A 4CEFA 1EP4A 1KVBA 1L3VA 2RPIA 3CYMA 1TK5A 1XWWA 5CNKA 5IUJC 4BWMA 1DTTA 4K8XA 4CJVA 4RSMA 3DGEC 1TJYA 3GRCA 4GVMA 3SG0A 2XO7A 3QEIA 3CFRA 3BDPA 2QXYA 1NXOA 3N0XA 2ZQBA 4IMIB 1PNTA 2KYRA 4Z4FA 5JS2A 3HVTA 3TWHA 1VSJA 5CYQA 4B8AB 1S9GA 2ZAYA 1C1BA 1FXXA 2WRZA 3HDGA 1KGSA 2PUGA 5KI6A 1ZY2A 4E7IA 3LUGA 4KB1A 3H5WA 4CIFA 3ZT1A 3UIQA 4WXEA 3RR7A 4CHZA 2X6NA 3DBIA 3DGFC 2JVJA 1VRTA 3C3WA 1GCAA 3QIPA 3K5NA 5KC9A 1TM2A 3SYZA 4M45A 2HNYA 3NBPA 4CEEA 3SQ0A 3D0PA 3L8BA 1VSKA 3OLYA 1CZ9A 4CEBA 1U49A 1WSEA 2DFHA 3TR8A 4KHSA 1ZBIA 4TN5A 3MA0A 4YS6A 3SNKA 2Z1JA 4K8ZA 4E1NA 3LUJA 4MS4A 4Z4HA 2PLNA 1TAQA 1EWKA 2RJNA 4MR9A 5FWXB 1NXWA 4QAGA 1Z13A 5JNUA 3PUFA 1JLAA 4RU1A 3O75A 5T3YA 5B3JA 4KRFA 1RNLA 1QQCA 3KLGA 4PQUA 2RN2A 3D45A 4AHVA 4W5RA 3M8SA 2FBYA 3TAFA 5IX8A 3AVCA 3VQEA 2E4ZA 3RVPA 3OS1A 1NJWA 4DMNA 4P98A 2XY8A 4BE0A 5CNMA 1SD5A 3PO5A 1NTRA 4DQQA 3LALA 1QP0A 1TLFA 5TQ2A 2VUIB 1XHZA 3A0RB 4IRXA 3BGRA 1T7PA 1SXGA 4N47A 4ZMRA 4EYQA 1ASWA 3ALYA 4PEVA 2P4UA 4DQSA 4DWIA 1ZBUA 3G85A 3HV2A 2FXIA 1JFSA 2HHUA 3OQOA 2YNHA 1Q8IA 3AO5A 1F4VA 4FJHA 1ZBHA 3K59A 2ID7A 1IG9A 4Z0UA 2QV0A 5HSGA 1B9DA 3VQDA 4OG2A 4Y9TA 1K66A 5JNWA 2KQ2A 2VWJA 1C0EA 2QSJA 3DLEA 1HJRA 4FLUA 2JBAB 4FJLA 4WE1A 4HTUA 2KFNA 1HEYA 4FZZA 1APBA 2R4QA 3THVA 3ILYA 4ZTFA 1ZYQA 2HHXA 2G8HA 1JL2A 2QVGA 2B1JA 4CJKA 1U04A 5ED4A 3QEKA 4Q6BA 3PV8A 2ZE2A 4N41A 6ABPA 3OYCA 1NXSA 2XY7A 2L18A 4F4KA 4EVRA 3ZT0A 1PNRA 1TVRA 4Z4GA 4W5QA 4KVFA 3TAPA 1MVOA 1LBIA 4CF8A 4XASA 5CNJA 3TABA 4KHNA 4E3SA 4DU1A 3KLFA 2R47A 3F7NA 1BDHA 2HHTA 3IRXA 3KKSA 3D02A 5BRJA 4B09A 4FE4A 3NFAA 1KFSA 3SQ2A 1DZ3A 1NXPA 1R0AA 1LWCA 1TL3A 3IAYA 1GOCA 3MEDA 3GA5A 5TPZD 4C8KA 4DQIA 5EWMA 3GT7A 4DTOA 3DLGA 4AHRA 3CKMA 3ZSWA 3HK2A 1LJLA 1RXIA 1DCFA 4DTJA 1N5YA 3OLVA 3I09A 1RBVA 3LOPA 5DCLA 2OA8A 2B4AA 1SKRA 3EY1A 3VQ8A 1W25A 4N5SA 2QKBA 1PUXA 4RZSA 2JCGA 4ID1A 3CM6A 3SQNA 3KTQA 2OQRA 4F2RA 3SQ1A 2KW4A 1ZGGA 1QSSA 1I39A 4YFUA 4DSKA 2N9UA 4NYNA 3HYFA 1RBRA 1UA0A 3I8DA 1L5YA 4FLTA 4MS3B 1ABEA 1KTQA 1HMVA 3B6PA 2G8UA 2E4VA 1Z2EA 4DU3A 5EWJA 1A5VA 1S8NA 4ETIA 1ZITA 1YIOA 3QELB 5FWYA 3AVFA 1D2AA 1M2FA 2LPMA 3NBMA 1SL0A 2HQBA 1ZDMA 4OKEA 4F12A 4FLVA 4NQRA 4DF8A 4O44A 4Y1CA 5T7BA 1NK6A 3VQCA 1C0UA 2F8TA 3TX6A 4CJ3A 2IPMA 1T8EA 5HRSA 5BR1A 2IDMA 3DLKA 4N0QA 2JRLA 3MEGA 1UDRA 1VPWA 3OLWA 2HNZA 3LUDA 5FDLA 3S99A 3N0WA 1HPZA 1JLFA 4PICA 2IOCA 3OS2A 1A04A 3TAGA 4QCLA 2IOYA 2FW0A 2KZZA 3AVGA 1YTUA 3OYEA 4N0PA 4DTPA 3C3KA 4GMJB 4C8OA 2Z1HA 4FZXC 2DY4A 1P6QA 1JLQA 3JPYA 2L17A 4B9SA 1X9SA 3QNOA 5CZ2A 1QMPA 1F21A 3AA2A 1ISRA 1S9EA 1KRPA 4B8CA 5E3JA 1T34A 3K5LA 4BDYA 1ITGA 3IP5A 1DP4A 1AB5A 3NHMA 1K6YA 2QKKA 1RT2A 5IEBA 3H5OA 3OQMA 1XI1A 3M9WA 2FN9A 2IPNA 4FJNA 3E61A 4MR8B 1U45A 3L2RA 4MS1B 2MYPA 1WETA 4BE2A 4FVMA 3TANA 1DBWA 3O4NA 1USGA 4M3ZA 4G0XA 3TD9A 2RGYA 1D9FA 1NK8A 3AV9A 4JA2A 4G0ZA 5CHYA 3LWLA 1Z16A 4BWJA 1Y1LA 1P2FA 3AO4A 3K4HA 1RTJA 3HL8A 1IIBA 3QEXA 3H08A 3ZT2A 3VA3A 1SL2A 3URMA 1RT1A 3O1IC 3MF4A 5JNVA 2NZUG 4CF2A 4DS4A 2FLKA 4XAQA 3NGYA 1TKZA 3A0UA 1WNSA 5IEJA 1TKXA 3T3FA 3NF9A 3QLVC 1BDJA 1DCMA 4KREA 3K57A 5KQPA 4EY3A 1VLZA 1NY5A 2LBPA 4BDPA 3QEPA 3JPWA 2JGUA 3NF7A 3JY6A 4NYFA 3RVMA 1NK0A 4DQPA 1Y97A 4J2AA 3C6UA 1BA2A 5FWXA 2IYNA 3LMKA 3HJFA 3NF6A 4NCGA 3LANA 4N56A 3HPGA 2G8FA 1UWBA 3OYFA 1JYFA 3DYAA 1WSJA 3RRHA 5HLFA 5DTEA 2GV9A 4M3RA 2YNFA 3U3GA 1JLBA 2RDMA 4WZZA 1RDCA 4O4GA 4KZKA 3CTPA 3SUOA 3HUUA 1IKXA 3CS3A 5KGXA 1ISSA 2NT3A 1TL1A 4B3OA 3VQBA 2D0BA 3P1GA 3OMXA 1SKSA 4OBBA 3F73A 3KYIB 2MSWA 3H1EA 1ZHHA 5I3UA 1BI4B 1JX6A 3DRRA 9ABPA 4IFYA 4H3KB 3HCWA 3P83D 2LIVA 1YMUA 4L85A 4D6YA 1YTAA 4YGXB 1TV6A 1B92A 4YNQA 5KQLA 2TMYA 4CJTA 2OPQA 4CF1A 1QO0D 1GUDA 3ASMA 1TVMA 3NHGA 1JDNA 3HUTA 4UHJA 3S3MA 1S1TA 3KYJB 2KZMA 2JBAA 1QPZA 3H5TA 2E4UA 2QU7A 5HBMA 3A10A 3CM5A 1D9DA 3SY8A 3WNGA 4I2QA 4DSFA 3O2SB 4O1HA 5HM6A 4ELUA 1RNHA 3SPZA 1RTDA 3O2JA 3VNBA 4YP9A 1JLEA 1NXXA 4GPAA 4JS4A 2Z1IA 1AB6A 1JLKA 1JXEA 2QVCA 3DLHA 1HNVA 2P1JA 4OPJA 2FEWB 1KFDA 3HEBA 4CFAA 2A1SA 4Q7EA 3IG1A 4FM2A 4EP4A 3M8QA 4RK1A 3SV3A 1FQWA 4JB2A 1MB0A 3LAKA 1D1QA 3QO9A 4FLZA 2YNIA 4OLBA 5D3GA 1BVHA 5DLEA 2HHWA 3H1FA 3TAQA 2H3HA 2B5JA 2WY2D 1QKKA 2X74A 1KLMA 2ID9A 4LE0A 1JL3A 4XIUA 4TSXA 1QTMA 1USKA 3QLHA 3FFXA 1U48A 3V1RA 2PAFA 4E19A 4KB0A 3TB6A 2HHSA 3BREA 4UHKA 4FYDA 1F51E 1EFAA 4CK3A 1KRXA 4YWHA 1SXIA 4NCAA 4J2BA 3IP6A 1RBSA 2IDOA 3F6PA 4PUOA 3ZT4A 3NNNA 4DTMA 2HQRA 3QK7A 3RWUA 3WNHA 3AVNA 2FKAA 2BGGA 4MS3A 1JL1A 4LSNA 2WB4A 1WSIA 4RWEA 4WXMA 3DI6A 4E1MA 1RTIA 3CLKA 3K9CA 2IS3A 3SV4A 2OZSA 4EYGA 3KSMA 4DLGA 3RVSA 1YS7A 3LDSA 4CEDA 4ZHRA 5FRNA 2WJAA 1DRKA 5CZ1A 4PE5B 1C0MA 2F96A 4CEAA 4F2SA 1DLOA 4DN6A 1ZGZA 4XARA 4QYWA 4RXUA 1TMYA 4CHNA 3CRNA 3K5MA 4LX8A 3CG7A 4DS5A 4WUTA 3VQ5A 2P5GA 3NCIA 4J2EA 1ASUA 4RXTA 4E0DA 4H4OA 1TK0A 4CJUA 4DU4A 3A3KA 4H60A 5BQ3A 4M88A 2ITGA 4ZYLA 3CU5A 3VQ6A 1OXBB 1W9HA 4DTUA 3N0RA 4M3WA 1QHTA 1MU2A 3CFYA 3JS5A 3LFTA 4RK6A 4DSLA 2PY5A 1JF8A 1J54A 4DF4A 3OYAA 3C6QA 4RY8A 3AVHA 4JASB 4KK3A 2FMKA 2GKGA 1M2EA 3DOKA 1DBQA 4EYKA 3LZJA 2QK9A 1HQEA 1BAPA 1A5WA 1HYVA 3KJXA 3L2UA 1P6UA 3OO0A 4KV7A 2VWKA 1ZBFA 3EJWA 3ITHA 1NK4A 1L3TA 4LRQA 5KQMA 4IBNA 3QINA 4MR8A 1E6KA 3SCXA 3V9SA 3IDOA 3MXJA 4MS1A 4FJIA 1QE1A 2E4YA 2L19A 1FFGA 4OTZA 3SUPA 2WJWA 3AVBA 4CJ5A 3LTEA 1QS4A 3DZDA 2G8VA 4PZ0A 3EZ5A 4S04A 1W0HA 2WONA 1KSPA 1XC9A 1H9CA 3AVKA 1C6VA 1I3CA 3HZHA 1EX4A 3UUGA 5KWSA 1RZRD 4FW1A 2R7YA 3FMVA 1JLCA 4F06A 4O5BA 1TAUA 3O3HA 3ZSOA 2HNDA 3CFOA 1Z26A 1SXHA 1URPA 1LV5A 4YLEA 4RDCA 2PUEA 4JS5A 1JDPA 3RR8A 1BCOA 1USIA 1ZN2A 3L3VA 3LUFA 4Z99A 1YVUA 1Z2DA 1VSMA 4FLYA 2ETJA 3JVIA 5PNTA 3HP9A 4DSEA 4RW8A 1GCGA 1NK5A 2A1RA 2OENG 2OZMA 2B6AA 1D4ZA 1BISA 4J2DA 3H5IA 3O4QA 5KRSA 3C3MA 4G0YA 4G0PA 1BDIA 3DRPA 5HKOA 4H3HB 4I9QA 2KTQA 2E6MA 1SKWA 2FSPA 3B6OA 3N6VA 4CJFA 1PEYA 2MYTA 3ROTA 4KFCA 1S1UA 4KAZA 1GUBA 2FEKA 5TPZA 3HPOA 4CERA 4NICA 1VRVA 2CWDA 2ATQA 3KLOA 4TLMB 3CHYA 1LW0A 3ROFA 3H6GA 4CF0A 3ZSQA 3HDVA 4YV7A 5JNTA 2X7XA 2OYQA 2R48A 4DFMA 3N75A 4HUFA 1JH9A 4KHYA 5HRPA 3KG2A 1BI4A 3O2QB 3FGZA 4FLWA 2WOMA 4AHCA 1RILA 4W5OA 1S6PA 3EYZA 3LPTA 5FBKA 3BRQA 3Q41A 4EVSA 4CHQA 5TQ0B 4FM0A 2XY6A 2M98A 4QICA 3T8YA 4LDAA 4MQFB 2FN8A 2Y1IA 3RMCA 1NK7A 1RBTA 4FXDA 4LZLA 1MAVA 3Q15C 4KK4A 1JKHA 3G10A 4H4MA 2YKMA 3PO4A 4CGDA 4B08A 4CESA 2BDPA 5KQGA 3U3YA 3PX4A 4DQDA 2WWVD 2PL1A 3LUCA 8ABPA 3Q9SA 4CFDA 1YMVA 4E7JA 4MLDA 1TKTA 4Y1DA 5B3JC 3SNNA 4MGEA 1ZVVA 3OQNA 3JSMA 4AHSA 1I3AA 2PUFA 3OO1A 3V81A 3G1WA 2AYZA 1DC8A 4OVLA 1EETA 3H6HA 2PMCA 5KRTA 4ICLA 3CZCA 4OGCA 4RW9A 5I42A 1RBUA 2JVKA 4DQRA 5CNIA 4E7KA 3S3NA 3KLNA 3LPUA 3O3GA 2QZJA 4ZJPA 4YCSA 3KJVA 1HYZA 3NE6A 4CEOA 3L2VA 3QESA 2IPLA 4CIGA 2MSKA 1FKOA 4B9LA 1CLQA 5E41A 3OLXA 4M3TA 2VUHB 4CJSA 4G97A 1BL3A 4WWHA 3LWMA 4F3OA 1WSFA 1TKDA 2A9QA 2JB9A 4BACA 4TMYA 1NOZA 3EQZA 1S5JA 4KNYA 1RPJA 3AVJA 1R8JA 3T1AA 1ASVA 2L2QA 2LUOA 1EKEA 2G8IA 3NH0A 3P5JA 3VQ4A 2XHBA 3MYYA 1J53A 4RV5A 2VG7A 4CGFA 3Q7SA 2NT4A 1EWTA 4O55A 1BQMA 5EWLB 5CY4A 4F8RA 1QP4A 3CG0A 3NNDA 4CCHA 1RDBA 4DLEA 3MM4A 4DADA 3LP3A 4MRMB 3IS9A 2I6FA 3DLBA 1Z18A 4MAAA 1UOCA 4E7HA 4DTRA 1CEYA 1IH7A 3FDFA 4FJJA 4KPYA 3OYKA 4EGSA 1T05A 2P9HA 4Z9AA 2P51A 3I5AA 4KKOA 4KI4A 3HT3A 1A2OA 4DTNA 4RXMA 3O3FA 3U6FA 4LH5A 3IP7A 1S1XA 4TLLB 1WSHA 4Z4CA 2HSGA 4RKRA 5DGCA 4OATA 2HB5A 3C6TA 4IMJB 2FBXA 4MR7B 1K68A 3KHTA 3EGCA 3KS9A 3GBPA 5HRRA 3QEMB 2QXFA 4M42A 6CHYA 1D8YA 2Q3SA 4I2PA 5J2MA 3QX9A 3GYBA 3PY8A 3LUAA 4CHYA 3TMYA 2DRIA 3EAFA 3FFWA 4EP5A 5DK5A 5J1EA 4IFVA 1QO0A 2H0AA 4CHOA 2QR3A 2VYCA 3I45A 3R0JA 1D1PA 4S05A 5ABPA 3AA3A 1QSYA 2RJOA 1RT3A 4RS3A 1ZH4A 3LUKA 1RT4A 2FLWA 3ZSVA 3F6CA 3RVKA 4I9LA 1OXKB 2XDYA 1Q9XA 1REVA 2I5JA 4FLXA 2WMYA 1NKEA 3CNBA 3L49A 2OPRA 1O1WA 1RT6A 4B9TA 1DTQA 1QSLA 1J9AA 3RMDA 4OKJA 4OGEA 2PZSA 1FKPA 2FMHA 4FK2A 3S3OA 4E89A 2A9RA 5SZTA 4L8RB 2BANA 3O1HB 3LZIA 4Q6WA 1EHCA 4RG8A 3GV0A 2PUCA 4YO7A 4O5AA 5HRNA 3MQ4A 3IP9A 4QOZB 3HVRA 3TAEA 3T95A 2EX3A 3KK1A 3NNSA 3MXMA 4FJGA 3MECA 4FZYA 4PWDA 3N53A 3QEWA 3WNEA 1Z15A 1L5ZA 4LY7A 2KFZA 1HQUA 4KO0A 1LBHA 3V1QA 4HUEA 1PEAA 4CGJA 5IC5A 2NZVG 3BRSA 3L6UA 4CJQA 3K2PA 3HXMA 3VQAA 1VRUA 3QIOA 2MSLA 3OYIA 4KFBA 4PA1A 4WT7A 5J2NA 4JOQA 3OYGA 3OYJA 2VK2A 2FTKE 4MPTA 1WLJA 5C25A 2E4XA 3AVIA 4KTZA 1QQBA 3V4IA 1WAFA 1KMIY 1ZESA 1FSPA 2YV0X 4ML3A 3MAQA 4KV8A 4AHTA 5TQ0A 4RW7A 4FJMA 5GQSA 1YT3A 2CHFA 4Q5VA 5FBHA 4MQFA 3KLHA 1J56A 1XWLA 3KKEA 4IGAA 3L2WA 4CJRA 4ZTJA 1T03A 3QELA 4PY5A 2O20A 2XY5A 4E7OA 3OJSA 2HJ9A 3HPHA 1CZBA 1S1VA 3NH1A 3FFTA 4QYMA 1QQAA 1U4BA 1P8AA 3TARA 2JK1A
chains in the Genus database with same CATH superfamily
1KU0A 1K86A 3G2MA 3OZBA 4WL0A 3L84A 4MGZR 2MWMA 1E1QD 2CNWA 4G4SP 5C8VA 2V7ZA 4EA6A 4D25A 4EPYA 1G5PA 1ENYA 1D09A 3W0LB 1LV7A 1RWXA 2UVPA 1CB7A 4G1UC 5H5JA 4TUYF 1SKQA 5BRFA 3LDLA 1OBOA 2HBMA 5DEIA 1KKUA 3VTAA 1PV4A 1GFIA 4PYRA 5L95A 2C5BA 2AOXA 3ELUA 3RVCA 4XVUA 3VH2A 3UJ6A 4ZVTA 4IFBA 5BV2P 4YIKA 4IDPA 1U4OA 1AGRA 1JKIA 3P2KA 1IKWA 1OASA 1MJGM 2Q5CA 3VPFA 1I94B 1GL7A 5K51A 4N6NA 2BEUB 1NOYA 4NFSA 1NKCA 4IVQA 4N5MA 4DMHA 1KVAA 3UK6A 3MCAA 1BYUA 1QLHA 1JUDA 1TKRA 1E1KA 4J0DA 1P7PA 1UDXA 2X1MA 3THRA 2FW7A 3KUCA 1EEHA 1N2SA 1VMEA 3KD1E 1XCOA 4WLUA 5KVCA 4HLUC 1NW4A 1M83A 4XB2A 1B41A 2P9TA 3NVAA 2O4IA 4ETNA 3G7UA 3U1TA 2ZIXB 4HWRA 1DC7A 3M4ZA 4LJ9A 1EXQA 1XP5A 4DR3B 5F0XA 4TMWA 4JEIA 2BE9A 5TJHA 5BT8A 1NVUQ 3PDIB 3Q11A 4BUJA 5KAMA 1F6DA 4CR8A 4JX8A 3QMMA 1KH3A 2DULA 2H17A 1J25A 1EK2A 4AAYA 2QZZA 4CMBA 3ICOA 5D1NA 1B42A 2QD3A 2VFAA 5FRMA 3VVMA 2Q7XA 3I37X 2GZSA 3AP1A 2WIBA 5BN4B 2W2LA 4C4SA 1TK2A 3VNAA 3DH0A 1CUFA 5TPWB 2GASA 1H5NA 1GRRA 4I2VA 5EUBA 3T19A 3BSSA 2RHTA 4WBNB 4LECA 3ZSYA 5DV9A 1U1CA 3GK3A 2GPNA 4BTLA 2Z6UA 3U4HA 5LJIA 4BBAA 2Z1GA 2IIQA 1MQ9A 1G15A 1HV8A 4BRAA 2EG9A 3T3PB 1KYVA 4CF9A 4PZYA 1OPRA 3WFJA 5E9AA 4IHJF 4FMDB 4RVGA 2WD8A 4PQEA 5K0NA 3RVNA 1DKNA 4QYIA 2EKQA 3R9WA 2F9FA 3GNLA 3TQQA 1SXJB 3WA7A 5I6DA 3AQ4A 2BJWA 3RODA 2OA0A 1CR1A 2R60A 3IUBA 1T5TA 1II9A 3K5OA 4YQEA 4GGOA 4MQ3A 2VLBA 1BU8A 1RPAA 2C1EA 2KLBA 1GGMA 5M1FA 3ANXA 3IOYA 1I10A 1VHTA 1YRAA 2A4MA 2VGMA 3V9ZA 1QLJA 2QS9A 1LVUA 3NFYA 3O1WA 4WBXC 4CG2A 1EB9A 1VSHA 2A5LA 4N0DA 3F3YA 3P97A 5JS7A 4DY4A 3VQQA 3OMWA 5I9SA 1L5RA 3IDAA 3RB8A 4V39A 1KP9A 5AQIA 2HVIA 3P9SA 4CMEA 3GROA 1GO2A 2GJKA 4GKBA 4JJZA 3BRCA 5FO0A 2VQFK 1N6QA 3FVVA 5JARA 2JC3A 1AY0A 3ZEUB 4J2HA 2JAUA 1TUIA 4QS9A 3RR2A 4HUTA 4B6FA 3A6EA 4PXYA 4I4TA 3UKDA 2GI4A 2POCA 2MYUA 2R25B 1BQNA 2HVHA 4NV3A 2QNBA 2WSSA 3RAGA 3AARA 2OBBA 2QB5A 1LF0A 3RBXA 4I8IA 2RB4A 3W8DA 1H69A 2QM1A 3AR5A 1I80A 2JLCA 4WZBB 2XBLA 3F2VA 2ZYGA 4C1NK 2A0WA 3M8RA 3OQVA 3O9TA 2ON6A 3O3OB 1LTKA 1PHRA 1ZXXA 3SQ4A 2NSDA 2CK3A 4KJXA 4F2HA 2X77A 2GOYA 3HUEA 1GTJ1 1WXXA 3TQHA 4BQOA 1YOVA 2GZ1A 4JVNA 3ZCUA 1ZUD1 5CM9C 3ZVNA 3T1YK 1HDZA 2IKSA 2RKIA 3ITKA 1E4VA 4NP6A 4Q3AA 5DCWA 3GDQA 2VJLA 3PX0A 1C0GA 2GSDA 1CY2A 4HQFA 1G55A 4DOMA 4FE3A 3PLAE 1CXUA 4LHEA 4CXMA 4NL4H 1C2TA 2PG3A 2O8NA 3UWOA 4N5NA 3C2QA 4HWSA 3R09A 4M3UA 4ELVA 3IKVA 3J80A 1BNCA 4YRIA 4DV4K 4MLHA 2B83A 2P35A 5KPTA 3RPEA 1VMDA 4IKFA 4ZO4A 3QVXA 3DM9B 1O58A 3C48A 4GW6A 1RJ9B 1XP8A 1CS0A 3A4TA 1W0JA 2J6HA 4P4TA 4QC2A 4I1OA 5KNDA 4LFAB 2Q4EA 2C7PA 4G4IA 1XRQA 1XQYA 1FJ2A 4W5JA 2DJIA 2AXQA 2ZB4A 1ACLA 3BE4A 4J76A 1PP4A 4R7GA 3H8JA 4C89A 2H8KA 3W9UA 1ADCA 1W85A 4OQFA 5AW0A 1UR5A 3MMSA 4NS1A 1YR6A 3VOAA 5CUQA 1DV1A 1DHRA 2J6IA 3KYDB 1ZK0A 1CYEA 4KLAA 3Q7QA 5IUJC 1F2TA 4ITVA 3GRCA 3MN1A 2XO7A 3RGWS 3FN4A 3ICCA 2H1RA 3SQMA 2W9XA 5AW8A 2FETA 3PSHA 1VYTA 2V7QD 3GIWA 1FXXA 4HCJA 4E7IA 2A8YA 4H1WA 2I65A 3M5CA 5JVDB 1P31A 1GG2A 2HNYA 3BL5A 4M0EA 2PWAA 3RSSA 5G2OA 2Y8EA 3EXG1 5ALOA 2YXBA 4KHSA 2PCLA 5LM3A 5MGBA 1QFXA 4W1QA 1YVPA 2Q4DA 4ZOCA 1G8SA 5G4KB 2QUJA 4QAGA 1MJ5A 4BNUA 3TZQA 3DKVA 4M0LA 1U0GA 3FPEA 1IG3A 3M8SA 1NRWA 2FBYA 2DVMA 1FXWA 4PNHA 4XQEA 4EHNA 2VYFA 4CMIB 3DFZA 1P4JA 2ZJ4A 4BE0A 3OQHA 4X8MA 3NRCA 5BV7A 4G07A 3WT0A 3RSQA 2NTVA 2VHQA 5EHGA 1QYVA 1RKBA 3B7GA 2EIXA 3OCUA 4EHJA 2QROA 3AKYA 4GLOA 5M29A 1Y80A 3I05A 4HH3C 1T5DX 5ETJA 1K6XA 2Q1NA 4MRAA 2Z57A 4B1WB 2C78A 4OG2A 3B6IA 1DJPA 1UKVY 4FZZA 2D1RA 2GEUA 5JYBA 2CZCA 1GTRA 4MGYR 4L57A 3HBAA 3PLAA 2DHQA 2L18A 3TZKA 1RZ3A 3DW3X 2JD1A 2CEAA 3WXKA 3AL2A 3GJXC 3M2TA 2H65A 4FE4A 1XEWX 2ZIEA 1KFSA 2NNWA 4NSNA 4E6EA 4WN9B 1II8B 2I6XA 2HDOA 1Z2PX 1OOEA 5H80A 3NVKA 3UVEA 5D5HA 3BKXA 2H5IA 1AKNA 4J9UE 3HK2A 2A3NA 1LEHA 4BRHA 1H2HA 5HZKA 4LOIA 3VO9A 1WIWA 3CSSA 1AQLA 5K3DA 1XJ5A 2XE7A 2JCGA 4XDZA 4RABA 4HVAA 4OHZA 1QX4A 4DRXA 2XBMA 2VSOA 4IJ5A 1U7PA 3I8DA 1HSZA 5E9QA 4AKTA 1G20E 4FVTA 1KTQA 4O4IF 1D0VA 2NRZA 2FF5A 1RHKA 1NVTA 4NJMB 1ZITA 5FWYA 4F5YA 3ZHUA 1M2FA 2LPMA 3ZWWA 2IUTA 4IWYA 3BC1A 1G8FA 1F06A 2WWFA 1N8TA 1BC5A 2VQEK 1TF7A 1I6WA 1UDRA 3DMHA 2R7AA 3LUDA 4OMDA 1K06A 2PR2A 4Y2UA 4NCIA 3KSZO 4ZJYA 1M6NA 3ASUA 2WUVA 1EFLA 4PM4A 3QVVA 4UU1A 2Z0MA 3S5JA 3C3KA 4J43A 3ESXA 4JLVA 4QOJA 2D0DA 3AUTA 5CFPA 2CLEB 3U49A 1IYZA 3L7OA 2MTBA 3FCUB 3FLMA 1SZ2A 3OTQA 3DVAB 5JH7A 4K88A 4MS1B 4JIMA 3PGKA 4ZEOA 2BEVB 4RKFA 4G0XA 5LYJF 3A9SA 4RSRA 2BLNA 3KOUA 5A3RA 1KYTA 1VGVA 3KOYA 1VTKA 4BVHA 1XGKA 3IQIX 1SCDA 1IVNA 1I2DA 2WC1A 2FSNA 4GZMA 4REOA 5BOSB 1TCVA 1TYDE 4NYFA 3QOFA 3NWPA 5HCNA 1XPOA 1G8HA 2Z09A 3L7JA 2IXGA 5CM8B 3CEHA 3FSRA 2GAFA 3NTLA 2NZ2A 5GZ6A 2G8FA 3D6AA 3NU1A 2ZSFA 3MTEA 4N6OA 2VO1A 4F9EA 3OY7A 1CS4C 2VPWA 1FU4A 3G8AA 5HA5A 1YVNA 1NUQA 4ZRDA 2HHHB 2JI8A 2XE6A 2EKPA 2JH3A 5JFGA 1Q84A 4M6WB 3ENOA 4URFA 3H1EA 3TS1A 4DABA 3D2FB 2ZWIA 4H7KA 3TF5A 3I6BA 2DBVO 3P2YA 3IV6A 3DBRB 4H3KB 3I2FA 4FEAA 2VT2A 1NMEA 4WEQA 1NJ1A 3M6FA 3JQDA 3HH8A 2C2MA 5P21A 4X90A 4YTEA 3QFCA 1ZU4A 2WM8A 2TMYA 3RLIA 3UT0A 4WY8A 1TVMA 1S1TA 3P71T 3TDMA 3H5TA 4ZVVA 4E07A 2ZF5O 5DTQA 4I2QA 1PWYE 3MWDA 4Q37A 2JJ2D 3HZ6A 1D4FA 4PCAA 1XNHA 1VBFA 3HYRA 3OFVA 1ZISA 1S3SA 2IKQA 1JXEA 2QVCA 4KXWA 3IBSA 3W8EA 5HDQA 3U4QB 4KH6A 1G20A 4CFAA 4UM8B 3Q98A 1I9GA 1TVKA 4OLBA 5DYWA 2WY2D 3JSAA 5K8CA 3GT4A 4XIUA 3WEEB 5CB4F 4Y3UA 4EO9A 3QFFA 4JI3K 1E3SA 4NYIR 4NC9A 4EG0A 4A9AA 1BG6A 1KVTA 5EIHA 1KZ7B 3CR7A 4UTRA 3HMKA 4BNWA 2C5GA 3N39C 3RWUA 3AH8A 3L4EA 1JILA 2RGRA 2V7QA 3RV3A 1ZD3A 5C8XA 1COZA 3RS3A 4BN0A 1JBQA 5A4FS 2J3LA 1UAYA 4KIFA 4MI1A 1XKXA 1DRKA 1MG5A 2EJBA 3Q7BA 3PGJA 5ITSA 4DN6A 2XDAA 2HIAA 2PRZA 1G8AA 1PKXA 1LQTA 5DT9A 2WTNA 5C51B 4E6PA 1XZLA 4H4OA 4TV9B 4RHEA 3EE6A 3PFIA 5G1PA 4R01A 2XZLA 1W9HA 2VI5A 2R8YA 4OXNA 1OLUB 3CZ4A 4Y7DA 4QKQA 3CINA 4L15A 2D0OB 4U2GA 4H1HA 4HC4A 1J54A 3HRKA 1PVVA 3D3NA 2Q3MA 3AVHA 3WNZA 5FOQA 2GKGA 3HWSA 1VE7A 5BW5A 2JZCA 3C6AA 1P6UA 3R3XA 3PQDA 2HO4A 5IM4F 2ZUEA 4RE5A 3MTQA 2JIOA 2UU9K 1RM3A 1LTHR 2R8PA 5DP2A 2NV2B 3V9SA 1S02A 1XZJA 3DHVA 1SZDA 1R4MB 3ANSA 4LBWA 1QQNA 1ZI8A 4NU8X 3AVKA 1G7RA 4B1VA 1ULAA 2O5RA 3H6EA 1S8AA 4FW1A 3D0KA 2V5AA 2QU8A 3FMPB 1RYMA 4FI3F 2XD4A 3B7PA 2HHAA 4XCVA 4N48A 1Q7EA 5J1TB 1O9HA 1CDEA 2HD4A 3VEXA 1DGKN 4IO9L 1W4RA 4DSEA 3DFKA 2IOFA 2AIRA 2AFVA 1BZYA 4OXQA 4YY3B 2CYCA 1Q20A 4G0PA 3NALA 4H3HB 4K2AA 3SK3A 2JHAA 1KK3A 3ED5A 2KE5A 2R6DA 4UATA 1GUBA 2CNKA 5KTYA 3O9UA 2CWDA 4BASA 4WESB 3F9MA 2O3SA 4AMBA 3WLTA 2IX3A 3AUUA 5B58C 3HN6A 1X8LA 1BI4A 4NARA 3NONA 1O13A 2DR3A 5IYZB 4I19A 2GPAA 4CQLB 4NXMB 2RGAA 2NUPB 2AMJA 4M98A 5JBIA 1GQOA 3FGNA 4RIFA 1UFQA 1C3XA 5EJ2A 4GE3A 4C7OA 4LDAA 1V8OA 2P3QA 1MT0A 1HQKA 3ASZA 1RFGE 1RBTA 4QUGA 4JT8A 3TLCA 1V7ZA 1KPIA 2F43A 3AR2A 4BC0A 2P3LA 4CGDA 3WDMA 3WIBA 5CGQB 4D9HA 2XYPA 1NZFA 1UMDA 5FNVB 4EWLA 1VI5A 1M90O 4O2BB 4O4JF 4KXNA 3R5FA 5ALWA 3RV4A 3E9RA 1MAAA 2Q9AA 3N28A 3O3GA 4ZV9A 4R1TA 3KWJA 1E9CA 3G0OA 1C7FA 4V0NA 3JQ8A 1DFIA 4DUYK 5DM60 2Q46A 3H9UA 3MZ0A 5B3AA 1NGEA 2HRZA 3LCUA 4DR1B 5JYCA 4ES6A 1SHLA 4YJ3F 1DX9A 1WW3A 1XALA 4IOCL 2O8BA 1C41A 4IZIA 2HJVA 4NAVA 4FS3A 2WWGA 3GEDA 4IIJF 4BHTA 3DV0A 3PP8A 4FHZA 3GRAA 2DX7A 3HA3A 1KSGA 3B1XA 1EWTA 3AYXB 1U8CB 3OOHA 3CWQA 1AUOA 1PZEA 4YACA 4IXWA 2Y76A 4CFSA 4BQRA 4PAGA 2XWSA 5F1PA 4YCJA 1NHWA 4K25A 4AP5A 3M1LA 5C8ZA 4D92A 1KA9H 2PBDA 4FPAA 3COWA 4I0WB 4ZVKA 2J07A 2QEXN 3CRZA 2DUMA 4FJJA 1Y0BA 3AONB 2OZKA 1STOA 2X0FA 5T64A 3KSBC 3KT0A 1AKQA 5H3LA 2GK4A 3KJQA 4AQ7A 4TLLB 1ZSNA 2FW8A 1IWPB 2YVAA 4M42A 4IVPA 2IXAA 4LS3A 4DLYA 3QX9A 4LFCK 2FJ0A 2LNDA 4J1QA 3CIPA 2BRUA 1X86B 3VKFA 5LKRA 2XB4A 2O2CA 3AFIA 2X6TA 3SF8A 3QEJA 3WTBA 4RQTA 3I2YX 2X19A 1QSYA 3BHMA 5CURA 1RT3A 1WF6A 4HRXA 2BFNA 1T2EA 4FOOA 1IEQA 3PXBA 4Y6SA 1OVYA 4Z51A 2JJ2A 3B36A 2I5JA 1R6TA 2CKMA 4L7VA 1SR8A 4HMQA 2FMHA 5IC6A 1TECE 3IRUA 3H3XA 4EKGA 1OXSC 1UEJA 1YZUA 5EG5A 3V1NA 2QD4A 4DKXA 3CE9A 3R7BA 4CE6A 1XC3A 1KZHA 2PXHA 3TNLA 3QE9Y 4KACA 3GRZA 3N53A 4OGWA 1Z15A 1GKKA 3AILA 5KDLA 1PEAA 2WJZB 4CGJA 3EVNA 1FYVA 3ZNNA 1OPXA 5JICA 1QQTA 4LXUA 2ZSBA 2EOAA 3M4JA 3QI7A 5JLAA 1SC1A 2XCUA 3G23A 4KTZA 4MW5A 3FR0A 2ZJOA 2J3DA 2OG2A 3ZWNA 1DAIA 5T8KC 2A3RA 4R5HA 3AEQA 4GBED 1YIDA 2P9LA 3P52A 3JX9A 3QELA 4ZP1A 1N6PA 1R6UA 1EBFA 1ZK2A 3GRFA 3RIXA 3HPHA 2H07A 1VFPA 2VHWA 1Y6FA 1WABA 1BMTA 3I9MA 2HUPA 4BY9E 2QTLA 3MD9A 3LCVB 4HNSA 2KW5A 2H63A 2CHVA 13PKA 1ECFA 2RGGA 4HVTA 4FOPA 3B52X 4D46A 1XRSB 1JFVA 1K9SA 1U9IC 3VPAA 4CIEA 1CLUA 2FJUA 3RF7A 4X64K 1HMPA 3FMIA 4BGEA 3MINB 1QKIA 4V2UA 1J6ZA 5KZMB 3AB7A 4AQYK 1M1YE 2FZKA 1XDBA 3DOFA 4BB0A 3D7EO 1GUAA 2OHIA 4ASUA 1ZNWA 4EI8A 4KQWA 1SG9A 2YMQA 3WGQA 3OZWA 5B64A 4JNKA 2G83A 4PRZA 3R75A 3IDQA 1SQ6A 1GPUA 3QVMA 4INPA 2YIDA 1RJDA 3Q7PA 1E2PA 1VSFA 1HOXA 2BF7A 4QDZA 3ZWOA 2R5FA 1KEWA 4YRCA 4BE1A 1WXFA 3IR6A 1F8XA 1WR8A 1CP3A 3BFKA 3CEAA 1DO2A 4HF7A 4ND8B 4RO0A 3U37A 1T25A 1KLNA 1UQTA 2VJKA 1RCUA 2FPPB 1EP9A 3RS8A 1UWVA 3P9NA 1THGA 3H75A 5KSZA 5U1PA 1WTAA 3FROA 4I5EA 3ME5A 2Q4BA 1HM5A 5K5EA 3OETA 2E49A 3QETA 3KPVA 4PPYA 3NKVA 2PZLA 3O08A 3CE6A 1MXFA 4TTTS 3O90A 5JC1A 4Q4JA 5BN8A 4EY7A 1MVLA 4BFYA 1XWIA 2ZBFA 2G9UA 3PV0A 2E4WA 3OKAA 4B45A 1QRDA 1BS1A 2ZSJA 4Q0BA 4C8NA 2HGZA 4XXHA 5A0VA 4TZ0A 2YINC 5H3CA 3TZLA 3ETEA 3LSTA 2BKEA 4YOVA 3SVLA 4PBRA 3KXDA 4E1AA 5THKA 2VG6A 1Q7TA 3W9SA 3K9WA 4I4CA 2FQWA 3M1AA 3RU3A 1YE3A 2GNOA 4I08A 4WKBA 4CTOA 4XX0B 3JALB 4PO3X 5C2JB 3BK7A 2PL5A 3O91A 4G6ZA 3OU7A 5I3ZA 2ZYAA 3KK2A 3ENKA 1V9SA 1RFQA 2ZI5A 1JI3A 1RW4A 1ICIA 1JMYA 2ZAOA 1GUZA 4WINA 4AYWA 4YJFA 4RKQA 3T1HB 5BSVA 3TVYA 3WYEA 4YBZA 3MMZA 3FPGA 4C7MA 1EX6A 1FDWA 3E3OA 3BB1A 5JFTA 4AO7A 4QEZA 3PPYA 3QVWA 4LD0A 5LLDA 2AD1A 4ZI3A 1AUQA 3TRDA 3DR3A 3GFRA 4NFHA 4F3KA 3E5HA 2PD3A 2FSSA 4O5OA 3AI2A 4YYEA 1JFFB 1M1YA 1GLBG 5LL6Z 2FBTA 1JNXX 5AKGA 5LZ9A 1CJUC 2QD1A 1QCCA 5TQJA 2JIQA 1G42A 2V54A 5J2UB 1F7VA 3RFUA 4P6VF 3I0MA 1RXEA 5CMLA 3TUIC 4B9NA 3NDIA 4AHUA 2GPTA 2ZBRA 4O1IA 4G5YA 3V97A 1JAYA 1X80A 1XMXA 2V4ZA 2VG5A 3AVQA 2RK4A 3SHWA 3O8CA 2QMYA 3KIOA 4CDNA 4IIBA 4I14A 3HBFA 1NLVA 2C03A 3I4LA 4XFKA 2GDJA 2ZCVA 4RTKA 5DYYA 4ON9A 3MMNA 2IYRA 2V1XA 3H2HA 2B4JA 1UK6A 3ND8A 1PSDA 1WQ3A 4NEHB 3W5JA 2B7LA 1XCGB 4HXFB 5TB5A 4A26A 3BRWA 4ZO7A 4B79A 2J9FA 1PWEA 2C7BA 2I8LA 4EELA 1B76A 1GGEA 1Z25A 3L7KA 4JLSA 2W4MA 5IBQA 3IURA 2CNOA 2FBVA 5NLLA 1YK1A 2VDWB 4M8NE 1RQXA 1DV2A 4JQYA 3R74A 3MT9A 3IP8A 4Z6KA 2VHCA 4EHKA 1WQ4A 4GXQA 4RTNA 1GDHA 2X9GA 1X1RA 3P39A 3ODGA 4A92A 3K72B 4D9NA 3H46O 4PCLA 3L4BA 4LE2A 2NP6A 4B8ZA 1KL7A 1BEEA 3NHZA 2WAYA 1YBAA 4PZUA 3QWIA 3IOBA 4M0FA 5EHQA 4KQKA 5K20A 3AR6A 1TQ2A 4IH4A 3NTUA 3TAMA 1W6UA 1Z6YA 5I8WA 2JFFA 4CK2A 3P96A 2NVUB 5ICGA 3ORHA 5M04A 3BAZA 2E5FA 3T4UA 2BOVA 4D6XA 1D5AA 5I3CA 4EMBA 3EG9A 3GEPA 4NK5A 2PKQO 3OY9A 2DY0A 4GV6A 2BFEA 1NT2A 1QZXA 1RDDA 1JAZA 4KO1S 3HR7A 5JZBA 4GR5A 2AA3A 5EL0A 5IRCD 4KSYA 1ISFA 1Q82O 1IV0A 4O1MA 2JJQA 4RSMA 3OTHA 4IGIA 1WZCA 4ID3A 2QX8A 4PSUA 1NA5A 1JAXA 3RSHA 1YVEI 4FGJA 2C2XA 1PG5A 3I39X 3ETGA 1U6ZA 4WXEA 2VNJA 3CH6A 5K1ZA 3BERA 5KAPA 4DE5A 5IZ4A 4R84A 4AMVA 5JHGB 2WHPA 1FDVA 4XR9A 4IIVA 4U7BA 4S1VA 3MCUA 4PG4A 2QWNA 3X1KA 1B0PA 4CEBA 1JIQA 4JEPA 2DFHA 3TR8A 4KIGA 3SJAA 4JJ6A 2F9MA 3KALA 5GPBA 5CDSA 5KCMA 2IXTA 3T5TA 4LHZA 4FMCF 4Z4HA 1WSDA 1P45A 4R2WA 3X43A 1AE1A 3O75A 4E31A 5DN9A 2VNSA 2VAMA 4BKRA 3KFVA 3D45A 4AHVA 4F5WA 1K08A 2QRKA 3T12A 1BEUB 2H1IA 3ZVLA 4B6OA 3SD7A 1ICEA 3N8KA 3KB2A 1QP0A 2KQUA 3E9CA 2FSUA 2ZIWB 3GJ0A 4ZARA 3CISA 3LVBA 3SU8A 4B46A 1JFSA 3CN7A 4TKVA 5C8YA 1Y1PA 3NMUF 3TI7A 2YV1A 3DEZA 3K6JA 4FJHA 4M37A 1IY2A 2B3DA 5EZYB 2C1ZA 1PFGA 4AX4A 1NURA 1FS4A 1UJ4A 3ZIAD 1TT5A 1GLCG 3EIWA 4HDKB 4EITA 1U04A 4GEGA 1U2TA 4R1OA 3PV8A 2H06A 2EKLA 1RYFA 2ZJ8A 3K35A 1WM1A 3GEIA 1V6SA 1ZRMA 1OLOA 1X42A 1YUBA 1V25A 2OG1A 2NGRA 5BN9A 3C45A 1PWXA 3W1EA 1X94A 4JZYA 3GA5A 2WM2A 1UCFA 4XYEA 4DTCA 3PFBA 1N3IA 4IJUA 4OGGA 2R1VB 1Z38A 4JD2B 1DCFA 4K28A 3I09A 4JP2A 2NO7A 4NULA 4L0CA 3BIJA 2IK8A 4AZTA 4DW8A 5AXDA 2MIIA 3EDMA 1GZHB 2OQRA 4BO5A 4WGFA 5D3KA 1T5OA 3W7AA 1OAOA 4HUQA 2N9UA 3HYFA 5KOYA 4QPNA 3FDZA 4NR0A 1HMVA 3TI9A 2W6LA 3RSEA 3S1LA 2MT9A 1G16A 1N33B 3TBHA 4NQRA 4L6IA 3V33A 5T7BA 1NK6A 2D54A 4RELA 5T4BA 1Q0UA 2OCKA 1SG6A 4HGRA 3D81A 4FYWA 4FMBB 3OLWA 2HNZA 5AFUA 3W90A 2PNFA 3QQ5A 5IKXA 1P2SA 2EAUA 3BFVA 4HMPA 1N2BA 1N78A 2WW8A 5ELMA 2W37A 2OO3A 3OC0A 1XVIA 2V9CA 4ONEA 1O94D 3KQPA 3SIPA 1JLQA 4CKXA 2JGRA 1KRPA 1GNVA 4B8CA 5JXHA 4ZV4A 2FSGA 2BFCA 3TKLA 2NPIA 3PXUA 2CGLA 1RT2A 1RLIA 5JMWA 4G81A 3UJDA 1JQJC 2YRWA 2LW7A 4BE2A 3AI7A 2AH5A 2V0CA 1NQTA 4A73A 1NK8A 4IZOA 5AJ3K 3HJTA 4U7JA 5HF9A 2ZT8A 1K98A 4KGZA 3AEXA 3NC1C 1MIOB 3H8WA 2VZ0A 4FDAA 5JNVA 2V59A 3WBJA 5EQJB 4PLTA 5EJFA 4R7ZA 3KZKA 1AUVA 2VPQA 3NGYA 4RD3A 2VWQA 4R81A 1N5LA 3V3TA 2A7QA 3QLVC 1GPH1 1KQNA 1W34A 4EY3A 4FQ5A 3R76A 1TZBA 4KBGA 2XUAA 3KU1A 2YICA 3CPSA 1G60A 1KS9A 1OFHA 3B5EA 4Q39A 4YCBA 3VGMA 3ETHA 3LBNA 4RYLA 4N56A 4YUYA 3OU6A 3W1WA 1WSJA 5HLFA 3JQ9C 2ATEA 5CB8A 3UF0A 2WSSD 2ZUDA 4FHCA 2WFAA 4RW0A 1TYQA 4QU5A 1U8YA 4BNZA 3OMXA 4OUDA 1CRQA 3KYIB 4X1KA 2PH3A 4RPGA 1O96B 1QZ6A 1K4KA 3ND7A 3BD8A 2PH5A 4M0CA 5CG2A 5F9HA 3GP3A 1Z6AA 3VO1A 3GLHE 1G8GA 3S29A 3PJRA 3VR0A 4XJVA 4AIIA 4IDCA 4I1VA 1M7GA 3IR5A 2IP2A 1GLLO 1GUDA 2W00A 2DLDA 4FVUA 1JDNA 4MRVA 1KEEB 4E1BA 3MGKA 2E4UA 2O7QA 3N4QA 3A10A 3SY8A 5HF8A 4F7WA 5BYAA 2QL5A 4D2IA 1F2UA 1RNHA 1TJNA 1JEEA 2QUAA 2IU3A 3ZD8A 3MN5A 3T3DA 1TUBA 1W1UA 1VL2A 2A1SA 2IEGA 1FNMA 3RU2A 4BLQA 2VCYA 2UV8A 4HN4B 4ZWNA 1WZUA 4FDLA 1KH2A 4ZO9A 3BCRA 3NBXX 3WLRA 2ID9A 3IOEA 5ALLA 5F3DA 1YQEA 1T9KA 3L0IB 4LMBA 5D3ZA 4FM9A 4QVIA 3X1DA 1W44A 2NLOA 1S6YA 3DSRA 1NKSA 5JDCA 2NYAA 4A1OA 5B7NA 4EY6A 1XFAA 4UBKA 2G8LA 4QYXA 4J2BA 1WXGA 5DYGA 3N2EA 4BROA 1HETA 3HJHA 5DW0A 2ZR9A 3WNHA 4RWEA 4DLZA 1KRHA 3K4PA 5BQ5A 4BFVA 3WJ7A 4PRYA 3UMCA 4JSYA 2WM3A 1BS2A 4E11A 3RJ5A 3V4RA 1IB0A 1ZX1A 3N05A 3TSCA 2FVXA 3AIOA 4F2SA 1FP1D 2H5LA 4XARA 1KC3A 5AKJA 4F9TA 1BMQA 3HFSA 5EINA 3V2IA 2UYGA 3U9TA 4Y6OA 2O8FB 2HW8A 1TK0A 4CJUA 1T9BA 3K0AA 4QOIA 2OESA 3UNXA 1IMOA 4JKGA 2BY4A 4B4KA 3RLFA 4DTUA 2GBLA 4QWWA 1I9CA 4BLUA 1O95A 5CDFE 4EKDA 3G7SA 3IJEB 3HY6A 1J22A 3C6QA 1GQRA 4EF4A 2WJYA 3DT6A 4JASB 4KK3A 2PO5A 3DYVA 2V6IA 2XUDA 3A6ZA 2OCXA 3EGIA 1IXKA 4HO1X 1Y6ZA 1BWQA 1YI0A 3INRA 1N7GA 4DJJA 4AF8A 2O23A 3HCRA 4N8SA 3DULA 1QXSA 2WT4A 3KWGA 4RF4A 3DLIA 4MR8A 4BE4A 5B6JA 4D9GA 4FFBA 4PSKA 1J42A 2XDQA 1C6VA 4X6XA 3PNLA 5KWSA 1JLCA 1DDIA 4UTZA 4D56A 3G5TA 3ZIAA 4C5AA 4YLEA 1YUMA 1XZHA 3GJ7A 4YAUA 3ZHVA 2Y9PB 4XQGA 4X20A 3T0IA 3ITNA 4MV0A 2WFBA 2UVQA 2R6AA 5CM2Z 3GLHA 2OO7A 2ODWA 1NGFA 3FA2A 3C15C 4HB0A 4HBZA 3CNQS 4MKXA 1HQYE 3OT5A 2EW2A 3HU2A 4ADSG 1QIKA 1E5QA 3MG9A 5LQMA 4UE3S 5JR3A 5TF4A 3HPOA 3F3MA 4HX2A 4R9SA 3R7AA 1FNDA 1D6MA 2QE7D 4TRMA 3H6GA 2QP3A 2DPXA 2QSZA 3K20A 2CXNA 1WP4A 2VK1A 4NAUA 3I73A 3WV4A 3BG5A 4JVSB 2A9VA 3P9ZA 4ODIA 3SYLA 5BN3A 3AHCA 2JLZA 3V1MA 4X66K 4PZEA 3JZFA 4E12A 2PANA 1ESMA 1YSCA 2XY6A 4WLVA 1WJGA 1SVSA 2PJRA 1K6EA 2BKAA 2QMHA 5AI6A 4HPXB 4HYYA 4COOA 1Q0RA 4HTFB 1FVOA 2QNIA 3LQ2A 1SBQA 4YRMA 4F9OA 4ZAYA 2OBFA 5HOEA 1N6IA 5EMJA 3ONFA 1QIGA 2X0RA 5FOVA 5HEKA 1NQOA 1HKCA 1E94E 2P79A 2AQKA 4BX9A 1YQWA 1H9AA 1O94A 3GEGA 5FQOA 2RHDA 1NUSA 4Q05A 4CKCA 4Z3KA 1NLFA 1FSGA 1HBJA 1F5NA 1ZL2A 5F7JA 3TD6A 3QESA 1U6IA 1MAHA 1ML3A 4L9SA 1CVRA 2A9QA 4O8KA 2WUWE 2DWPA 5J4KA 1LPMA 2DBZA 1DEOA 4MZXA 3EQZA 1EGAA 4BAUA 5LYYA 1AUPA 4RULA 3S40A 2VF5X 1ASVA 3ELYA 5CDFA 3PXXA 4L8FA 2LUOA 3KR0A 1YI8A 3OUZA 1EA5A 4K6OA 5EPEA 5DHQA 4AJJA 3ZXYA 5MGNA 2RBGA 3B9PA 1A9ZA 2P9FA 5FL7D 3B6ZA 4TM8A 4OIMA 1GNTA 3K2QA 4WJLA 4ROTA 1QP4A 3CG0A 3MCAB 3A1FA 5EESA 1YH3A 4QTYA 3EPJA 4MI6A 3IUYA 3EGVA 2N3ZA 2I6FA 1U3VA 2E7ZA 2Y6VA 2PX3A 3IELA 3KOOA 2YS7A 1SULA 4CLDA 3CO5A 4YALA 1GEGA 4MYDA 1R0XA 3BORA 3VR2D 4RA6B 5ADUS 2YX6A 2AB0A 1CUHA 3UHFA 3RSFA 2YBEA 1YDWA 4TX1A 4IXCA 2VWGA 1S2NA 1NRJB 1NVBA 3PNQA 1PFQA 1XI2A 3U6FA 5FAKA 4NZ9A 4EJ6A 3ZOKA 5EFOA 2A4KA 3NP9A 2QXFA 4NOLA 4CODB 2ROQA 1M6HA 1T2VA 3OW2M 3FPCA 4E5MA 5JHHB 1Q0LA 4ZPXA 2ZJRL 4O2RA 2VYQA 5BNIA 2DRIA 3H17A 3ANMA 4OL0A 3N5KA 2P9KA 2KPOA 1DX4A 2DSNA 1I7PA 1T3ZA 1W2HA 3DLAA 3ORYA 3EMBA 2JH8A 3H11A 2OHGA 4C21A 3FMGA 2FW1A 1F2VA 5COBA 1W0KD 3TTFA 4Y6GB 1OWOA 3TTXA 3SBGA 1KDZA 4L3WA 2Z56A 1O2DA 3UKUA 1ST3A 2ZUSA 1EFHA 1M8KA 4OKJA 4BIIA 4DYDA 3UAYA 3ROPA 5U4QA 4HPJB 3PHLA 3QKSA 1B8VA 1RRKA 1J0DA 1GQFA 4BFLA 2B6HA 2O0KA 3TAEA 4OP3A 3JRNA 5K0ZA 4E51A 2QTDA 3MECA 1NU6A 3UB3A 1JQ3A 1DE0A 1UKYA 4PC3A 1C8KA 4PN7A 3BFPA 3IA7A 4XCXA 2Q31A 3AJRA 1SKMA 5B1DA 3HPQA 4UKDA 1ZM2A 3AY9A 3L5OA 4WT7A 5AJZA 1YL6A 2CUZA 2FZ4A 4RTRA 1N36B 1Z5OA 2EFDB 5H8WA 3C5HA 3FDJA 3NDBB 4MVJM 4UNRA 1GGKA 4DLUA 4Q34A 4FJMA 3BWCA 1L4UA 4PL7A 3L2WA 4QBFA 2HEGA 5BSFA 2NOAA 4ZAFA 2JD2A 4HWTA 1OREA 3OJSA 4GKJB 3E9PA 4N9QA 2BHTA 4N3CA 4M1QA 1D2GA 4RQAA 3FFTA 2AUMA 1CD5A 4QJ3A 3FWNA 3O82A 4IJVA 4L95C 2G07A 3IKLA 2X9NA 2OFXA 4B6SA 3QYAA 2IEBA 5LZ5A 1OW3B 4RGQA 1GZSA 4RMJA 4GYYA 4AJHA 4PZLA 4K86A 3GQVA 4I4TB 3E9ZA 2BE7A 1YNOA 4IQGA 2B2CA 4B31A 4RENA 5FPEA 1ZIXA 3TRHA 4HP8A 2E5LK 1ESZA 3HOTA 2YBDA 5EJ9A 3R0XA 3V9AA 4ZVLA 1ZCBA 4ZOAA 3ZBUA 5I01A 1ST2A 3KB1A 3PB3A 1ZINA 2F3SA 4PPGA 2R68A 3K58A 4IWVA 1XLTC 1FNCA 3FGOA 3JQFC 3O21A 3HZOA 3RD5A 4EYOA 1YZVA 4BKPA 2QTAA 4V1CA 5BSWA 3U13A 2G0TA 1ZSYA 2AVNA 4YB8A 4OK5A 4C23A 2WU3A 1IRIA 2CFIA 3O9QA 2DZDA 2VR1A 3DOEA 3LQ1A 1N34K 2E48A 3OBWA 4KQ9A 4BLWA 3MK6A 5FPKA 4DLXA 4JKFA 3I04M 3GEHA 3W4JA 2WUDA 1M0WA 4I55A 4EVQA 2TRSB 4URUR 2MSEB 3LL3A 2QQ5A 3DE2X 3I8SA 5ICMA 1RLMA 2JJYA 1T24A 4LDZA 3EZNA 4C4TA 4ER7A 2QE7A 2RGNA 5HKLA 1RRVA 1RHUA 3KXLA 4ELTA 5JZSA 2JLEA 1Y3BE 3OKFA 4DR6B 4JGIA 4CKEA 1CS0B 2GWRA 1IHUA 1NF2A 4BXOA 4IDKA 1A95A 2FMIA 1KYZA 3L7BA 2ZE6A 4PNEA 5DVZA 2GLTA 2O7RA 4E5VA 4DLKA 1L7XA 4B6QA 4YV0A 1GL3A 2NUAA 1N32B 4LSLA 3IA2A 4FYYA 1DIBA 3ZH2A 4NH0A 4F93B 3DT8A 3MDQA 2WAMA 1F2TB 5GZ1A 5I9MA 4MW4A 1TM1E 1E3LA 7ABPA 1L3IA 4I5GA 2OFFA 1YQTA 4H27A 4ZQGA 1UBFA 1NL3A 1YR1A 4ENSA 2PUVA 1NASA 2WABA 1UAGA 3L05A 4QE3A 2C92A 4KUEA 4Q12A 1NW5A 5EEHA 1JTFA 4Y2HA 1DBPA 4X3OA 4BMNA 5ECGC 5HF6A 3QU7A 2CYBA 2PY6A 5JI3E 1HE4A 5KC8A 2FDRA 3IIIA 3QKIA 1HRDA 3KK0A 5AIAA 1Y5RA 3R20A 3FMOB 1P1KA 2ZU0C 3TL3A 5JU6A 5E6RA 2I6QA 5DCYA 2V7XA 1HX1A 3QMVA 4QPJC 4W9RA 3C1TA 4EG4A 3C95A 5FL7A 2QXTA 1VHWA 2AXPA 1X9WA 4L28A 4WNYA 5AH0A 4GNKA 4B0OA 1XNQK 4R98A 4J6FA 4JLOA 4LGCA 3VR2A 2R6GA 1PJSA 3IFRA 2HK7A 1Z63A 4G25A 1B8UA 2ZWVA 2ZSUA 3ZSXA 4KR9A 3O4IA 1JHAA 1DRJA 4G01B 3PUKA 1L7QA 4G3XA 3PPWA 4CL0A 3D8UA 3DEKA 2W6OA 1U3WA 3RVOA 3WGKA 5GV8A 3RTAA 1L9XA 3MT7A 1KZ4A 3LDFA 3ANNA 4EZ9A 1OVMA 4H7FA 4JAVC 1QVGM 4FSDA 2YL2A 5C10A 2NNWB 1Z82A 4X7RA 1VK0A 3PR2B 1W0KA 2R7KA 5K09A 3F5MA 1BHLA 2Z9DA 4EFLA 2X2EA 3AVAA 2X42A 1GFZA 1Y81A 3GG2A 3PXAA 3FWKA 4RCYA 3DEYX 4XPIA 4BO0A 4DRXB 2IELA 3G82C 4BECA 4DA6A 2VNHA 1F8YA 3SEFA 4Q3OA 3GT0A 2CHEA 4TT3D 5I4IA 4N82A 2WINI 1YDGA 5FWYB 4OY3A 4IVRA 1ZK3A 3CNNA 1OI7A 4B9MA 1G7CA 4K0KB 3AJDA 2P2GA 4DDHA 2R87A 2G36A 1VIYA 3QLUA 3SR4A 1NXTA 3DDCA 4AI6A 1TK8A 2HPAA 3H3JA 4RC9A 3X1JA 1CC1S 4TWJA 5AQXA 4LRXA 2COUA 1U0SY 3FUVA 2QD2A 2R8XA 1ZGBA 2EZTA 3UH1A 1JR2A 2DPLA 3M3ZA 3AIIA 3KVVA 3W2FA 3BCSA 1JKFA 1ZEJA 2Z08A 4HEQA 3AYZB 2AI1A 3FJ1A 2FMTA 1J20A 1Z12A 4P2BA 2DERA 1D9ZA 3INYA 5CNKA 4BWMA 2ZRGA 3B53X 3JRXA 4OQPA 4ZK6A 1NXOA 4FOLA 4EUFA 5JH7B 3FX2A 1QYIA 3L8CA 4QQ8A 3PNYA 4XWGA 3OI7A 3VNSA 4EHAA 3T5MA 4DDWA 3EDYA 4B32A 1PE0A 2ISSD 2Y1GA 5EHNA 2Q7OE 3Q6NA 2JVJA 4QLAA 1ZCZA 3B85A 2OGUA 2CNNA 2OXFA 2ARKA 1XEXA 4IOJA 4R40A 5AYVA 1ZP6A 4JLBA 2JCSA 1OLSB 1QAOA 4E15A 3I6IA 1CUWA 4D9CA 4BKMA 2GZMA 5E1BA 3RKSA 4DHWA 4IEIA 5A3QA 5D6NA 4ZVQA 4FKZA 2WLSA 4E1NA 3DXYA 1TAQA 1OXXK 2RJNA 3MRVA 1BN6A 2Z8XA 1EX1A 3WGTA 4LOLA 3ZGNA 5BR9A 3O9VA 3I01M 4BR4A 1Z5UA 1NMSA 1NYQA 1ZW6A 4LFBK 2P6PA 4TYMA 1JU9A 5G40A 3VDNB 2O59A 1T9AA 1JDSA 2MSNA 5JATA 1T0JB 3CJ7A 3HXPA 4XB6B 3Q40A 5KNDH 4PLFA 2QTFA 3PO5A 2YN0A 4ASUD 1I1HA 2OV8A 1JSXA 1JB9A 2VUIB 2IIVA 3KE9A 4WLOA 4DV1B 1IUOA 2JLAA 3BVPA 3N8NA 4B6RA 3W7BA 2G04A 1T35A 2GCEA 1ZBUA 1HG1A 4DNOA 2HHUA 3O4GA 1Q8IA 4M9RA 1YZTA 4BZZA 4G1VA 1XLWA 2XVMA 4MUGA 4LXXA 1P2GA 4ZGWA 3AKDA 3ZCSA 1ODTC 1B9DA 1YHYA 3IMEA 3PYLA 2FUG6 3THVA 3A8TA 2X5XA 2V8BA 2VH2A 3E9YA 3MWDB 4J0JA 1T9GR 2F8LA 1DKMA 3TD2A 5KNCA 2REXB 4ISCA 3WNBA 5AR1A 3B9BA 4KVFA 1C7RA 3IOCA 1VM6A 1G20B 1HZZC 1C3EA 4ZRMA 2IPOA 1TVKB 3NFAA 4U8GA 4QHSA 1LWCA 3IAYA 2UZ1A 3FXAA 2GRJA 4C6HA 1BO6A 1Z8DA 1BVUA 2I7XA 4YCNA 1O6FA 3UHOA 3R7SA 5D7NA 4FGLA 5TQVA 2FMUA 1SKRA 4KN5A 3LBAA 5ALTA 5JLFA 4COKA 1ZGGA 4R69A 1KMQA 4TTAA 5FULA 4YFUA 1SHZA 4DSKA 4EAHD 3CBGA 2AG1A 4F5DA 1KORA 4A6DA 2R8RA 3BHIA 2D5AA 4GKKK 1ONPA 1KFBB 1AQJA 2XQVA 1TCBA 1DC4A 3FBWA 2JFBA 3W6UA 3RGGA 3F71A 1JPJA 4JL5A 2RH8A 3HI6A 3WYBA 2IPMA 1UQRA 2NZXA 4DMRA 3JYHA 3FRJA 4Y2PA 3ROEA 2TMGA 3VC2A 2WTMA 1V48A 1TQDA 3H0EA 4BFZA 4P81A 2VHTA 3GHYA 5EIOA 3CA8A 4XE5A 2KZZA 4ZYYA 1FFEA 5AM1A 1H4TA 3TAHA 3Q8WA 2OV6A 5EJ7A 5HCUA 3GFFA 4RKWA 2GYWA 1ISIA 2ZVQX 5EZ6B 3N2ZB 2DH5A 1H3NA 4BDYA 3CVWA 2ZREA 5AOCA 1QHIA 2VSXA 1AB5A 3LLSA 4ZI5A 2A1TS 1NF8A 2IPNA 3MCVA 5JJ5A 1PYDA 5SV2A 3LBFA 3BF8A 5KQ8A 1TCAA 1KI3A 4CV1A 3LQYA 1OI2A 3VDXA 1YQUA 5AVYA 1ZG3A 2GK3A 3CGWA 4J8FA 4NESA 5AK0A 5JMTA 3KV3O 3LWLA 4C0AC 2ZU6A 3NB0A 1H6BA 4OHPA 4DV5K 1AKTA 3LBIA 1U31A 2ZSAA 3LHSA 4RLFA 2QL7A 4A3SA 4YAIA 5HJ2A 1Y63A 5BV1A 5ANRB 3N58A 1V45E 1DCMA 3UA3A 2R6FA 4X1YA 4PRLA 3D6NB 1BFUA 3V9PA 3HP1A 3B1YA 3BXZA 3EXFA 5KYXA 1V4NA 1VL6A 2G08A 3LMKA 1U6KA 3NF6A 2Z98A 4B3TK 1NW3A 2LV8A 3C5WP 2J4RA 4C4YA 2B99A 4R2JA 1M6EX 2HAEA 2YRXA 4D5GA 1JYFA 1I13A 5GJWC 4EZEA 2W6CX 3W79A 4P38A 3WFIA 5DM2A 4YAKA 1XRRA 4KRGA 1ULSA 5LOVF 2EWMA 1C8LA 3LXUX 1SKSA 1RCFA 3K05A 4I6EA 1QIHA 1PL8A 4EGJA 1BI4B 2WKRA 2XY4A 5D87A 1HT0A 4F1WA 1YCFA 3LYLA 3E7XA 1KBQA 4S1PA 1GOTA 1N2OA 3BRWD 2CMGA 1XA3A 3PVSA 1LZKA 2QAGC 2Q0SA 4JBYA 1P5HA 1IZYA 4TT3A 1K8XB 2VP4A 5EMLA 4LJAA 4QUKA 1QVWA 5AQJA 2GX9A 4ZZIA 1KNQA 2CJPA 2IH5A 4YRSA 5AM5A 2F43B 3I8OA 1WXDA 1E4OA 2FRDC 5LBTA 4ELUA 3GUHA 1EP1B 2GMWA 1JEJA 4FW8A 1FIUA 2Q41A 1NJIO 3MAGA 4U2EA 2IYFA 5HRAA 3FTFA 2XVXA 2I55A 1NFFA 4CDRA 3RRZA 1RWQA 3MWKA 1UMDB 2GAIA 1NSTA 1O8BA 4YC7A 2VCHA 3L7MA 1X3NA 1C9EA 1JDJA 3FTCA 2WJ4A 5E4FA 2ZBQA 3R3SA 1EEXB 2A88A 2VWPA 2CJXA 3BUSA 1WO8A 4HLUA 4EA8A 4GAEA 1PNOA 2O05A 1AN0A 1YR7A 1DTWA 3JQ8B 4OI0A 1Y8ZA 2ODAA 2W43A 1W5TA 5D85A 3MVEA 2XUQA 3DAWA 2WTXA 4CTMA 5AKKA 1VPLA 4MLZA 1VLJA 3SXJA 4EA9A 1NLYA 3EK2A 5CA0A 4CUKA 2C8LA 2WB2A 4WBNF 3HBMA 1GU1A 2O8BB 1OSNA 1LI7A 3P9PA 3CVXA 1D07A 3DV0B 3NDRA 2D1KA 2D7CA 1JPUA 1S9DA 3RVSA 1DL5A 1YS7A 4EL0A 1KIAA 4CF4A 5CZ1A 5A4IS 1JLRA 2Q6KA 3NATA 1ADGA 5L45A 3IUPA 3E8SA 1WP9A 2F96A 4FMDF 4EK9A 3J7AP 2QGFA 4B7ZA 2GZ3A 2PPVA 2XCTB 1XV5A 5AQQA 1CUXA 1BG3A 3VQ5A 4FZVA 1YBFA 3P20A 3WMGA 1G3QA 3LP6A 1EH5A 1PG0A 4Z8XA 3O5AA 4L6AA 2PMWB 3IKMA 4EI7A 3TWOA 4BWFB 5CFZA 4LC1A 4C76A 2VDOB 3ELWA 1XZ8A 2PS3A 4H4EA 3VJRA 1D6JA 3L9XA 2G0AA 2BGLA 2V55B 3QITA 2OT3B 4PZZA 3KT8A 2OFWA 3OO0A 4DTIA 3F4LA 3H2SA 5TJ9A 3KZCA 3RT9A 4LF6K 1TGYA 3DZ8A 4L5BA 5TEVA 4WXHA 1Q7YO 3FHLA 2X0EA 1CY6A 1E2KA 1G5IA 4W99A 3KQVA 3SF8B 1I3CA 3A36A 3QE3A 1ZOSA 3PFWO 5JQGB 5I7OA 3NTVA 3G2NA 4J94A 4J03A 4WOKA 4BUCA 4ENTA 5K05A 4WQ5C 1FMFA 2CV0A 3L0DA 1O97D 3RIEA 1NI5A 1M2OA 1PGOA 3LFHA 3DXFA 2L42A 1QYRA 3QX3A 4KKVA 2X0KA 4QZVA 2CV1A 4BDSA 3HSKA 1H9BA 5IMBA 4AQDA 1AUXA 3PCTA 1SKWA 4C22A 3REGA 5AHRA 1LS6A 1DJOA 2P7HA 3C14C 1WCYA 2XB6A 4JC0A 3U1BA 2FEKA 7GPBA 5JAMA 1PKEA 2XRFA 1E7RA 3KV1A 1U0TA 2FGJA 2G09A 2IS1A 2ZT6A 1M76A 1AQUA 3KX2A 1X1EA 2FPLA 2B4RO 3ZOZA 1HNWK 2NTNA 3QHPA 3WP0A 1NJGA 3VV3A 2ZIZA 3U19A 3DBLA 3ZW7A 1KAOA 4KQFA 1WMFA 3BRQA 1J5EB 3MS2A 4I6JA 5EXEA 2PV7A 4H3VA 3AEQB 1VP3A 1NJFA 2P9LB 4MO2A 3H2GA 4EI2A 4N54A 3BZUA 3MJCA 5K2OA 2UXDK 3PO4A 3AJEA 3TSOA 4BWGA 2WWVD 1YDFA 5ELZA 2QK4A 2IUYA 4EHLA 4P80A 2W6PA 1PR9A 5KYTA 4RJJA 1MO5A 2C96A 2HTEA 4CMJA 2JVKA 1KERA 1D2NA 1VLLA 3OMLA 2H48A 4PFKA 4OX9Y 5JCZA 1L4YA 1YRHA 2GSWA 4N18A 4XDGA 5JAHA 4E09A 5CEFA 5I7VA 3C87A 5I9NA 5ESDA 1BL3A 4EL5A 4TMYA 4C4AA 2F7SA 2QLNA 3CCLN 5HUHA 4KNYA 3M7IA 2GESA 6Q21A 1IBMB 2FRVA 2ANBA 3GZJA 1MH9A 2DFVA 1K88A 2NADA 4N9WA 3OX1A 4ZCRA 3CERA 3MNFA 1N8SA 5H83A 2H0QA 2WWRA 5C52B 2I66A 4DA4A 1C3OA 1NN1A 1V3QE 2FWMX 4PLYA 2JZNA 4P92A 3NVKI 3KSRA 1WXWA 1OH8A 3TPQA 4EEKA 3OPXA 3D6MA 3U09A 2PEZA 2Q6TA 4TTJA 1CY1A 3ID6C 2VYND 4QNRA 1M1XB 3ESAA 1W75A 4IP0A 3WB1A 4M0PA 4DR2K 1E8DA 1E0KA 4WFKA 1WSHA 1T6NA 1VYUA 2D3WA 4FLEA 4D9BA 3C6TA 5LP6F 1K68A 4UDYX 1VQNN 1N0UA 3H99A 3ZDXB 4Q4JB 3W5AA 1WPRA 4D43A 4Q15A 3PXGA 1YJ8A 2RIRA 1EBUA 5D51S 5A5VA 1ID1A 5FLYA 5IU6A 5DHSA 4PX3A 3IO3A 3T4XA 1NUPA 4H08A 4AJEA 4FN5A 3ZX2A 1R7RA 5K0GA 1CUGA 1XFDA 3AFHA 4MB6A 2CVHA 2RJOA 3BCHA 5C35A 1UQUA 1A71A 3PL1A 1Z6TA 2W2MA 4IOKA 5FL3A 3ZSVA 4GI7A 2V7UA 1MHPA 3VUEA 2X2PA 3P27A 4B9TA 1OGYA 3ZGYA 1PEKE 5DOVA 3AI1A 1FYEA 2DHDA 3LZIA 3W04A 3GV0A 1X8JA 3E53A 2IY8A 3EW7A 4OQEA 2AC4A 1XU7A 2AHRA 3PEEA 4FZYA 4Y2YA 3TTTA 1WB9A 2H59A 1L5ZA 2DU8A 2JGEA 4TZKA 1I01A 4YJFB 1IN1A 1ZI9A 3F90A 4Q1CA 5IBRA 5EE3A 1R18A 2VEDA 3NHJA 4JOQA 4ER0A 3WQQA 3C8DA 3T7EA 3I33A 4E46A 1SQSA 1EZ1A 3FF1A 2R6JA 3NQ41 5JSFA 4PZPA 4NBNA 3DAOA 1Q1BA 4TL9A 2RHWA 4AHTA 1MENA 5A4KA 2CHFA 3G1UA 3VTHA 2ACKA 1S2LA 4WCDA 4RY2A 4QXAA 3KLHA 2OBMA 1CF9A 3VU8A 1V4BA 2I7NA 3QU4A 1W93A 2QW9A 2H7CA 3HO8A 5KYGA 1M1YB 4HQOA 3ZHSA 5G0TA 4ILHA 4Y2TA 2J0QA 5TXGA 3ZX5A 1GJRA 2DUUA 3HS3A 1F8GA 4D80A 3DONA 3L6DA 1HNIA 1WSGA 3HNRA 1X80B 3IODA 5J47A 2A5JA 2NUBA 4MTCA 1GRQA 3SJJA 4U8HA 1NZJA 1NRIA 5TS2A 5FAXA 2O4GA 1FP7A 2QI2A 4CZMA 3C7AA 2VBIA 3CZAA 4IJMA 1ZBQA 3ZS9A 1CZLA 2X15A 4MYUA 2JCBA 1E1DA 3I2JA 3Q3CA 4DSIA 3V6MA 1WOQA 3WOHA 1UOQA 2ENUA 4QGBA 2BZ1A 4HTAA 5C37A 2PFKA 4DEVA 3UJ7A 1O95D 5ALYA 1TA9A 2HWKA 1YK0A 2Y1CA 3RTBA 1HKBA 1QP7A 3ZVKA 3CLTD 5G3YA 4Q4HA 2J9FB 1QTNA 5DGDA 1FTGA 3PC6A 4JOBA 4JI6B 2P8JA 1NBIA 1FRVA 1SKAA 2A6AA 2PKYX 4G1QA 1KI9A 2PJDA 2XZDA 4FWMA 2FE4A 1H6CA 1SD1A 3U9DA 2L69A 4GM1A 2BKVA 3EEFA 2W6QA 4TRRA 3MFQA 3ZXIA 3IAM6 3MWTA 4CGIA 5C5IA 4GKVA 2QTBA 2AZ4A 1IBKB 5SZIA 4CFBA 4HCBA 4A62A 1K7XB 1U0OC 3HO1A 4IMPA 1W88A 3RSZA 4D0GA 3ZQUA 5IN4A 5EPUA 3S68A 5A2QA 2XAAA 2B82A 5DTJA 3QEMA 2OCIA 1TMKA 1Y8RA 3UXYA 1A1VA 3ZI4A 1RZUA 4HFMA 4JRQA 3EXHC 1QGED 1E7SA 3GJ3A 3PX6A 3RANA 3MHTA 4D0LB 1L0BA 3BD9A 1HX7A 5E7JA 3OYBA 4NBVA 4H7DA 1P1FA 3N8DA 3LP2A 2G76A 2CLIB 2EJTA 3PQFA 4R5PA 5EHIA 4X6LA 4YRPA 3ZCMA 4AJLA 1VMAA 3RSCA 2J9YB 3MUEA 4RH0A 4F21A 2BFEB 4EJFA 3SZGA 3PRHA 3BYZA 4YT4A 3ZTTA 1T8PA 1WUHS 5CA1A 3I0RA 3OT4A 4HYEA 6REQA 1E20A 3GMIA 1QH0A 3V9UA 4Y2VA 3FSGD 5GINE 2E6LA 1PDVA 2PD4A 4R1QA 4MDEA 4JV5B 2HJRA 1GG9A 2IODA 3KR1A 5EY5B 2FX5A 4QBTA 2QYOA 3PYMA 2GPBA 4UAJA 4B1XB 2B36A 5KYWA 1SHKA 1ZUIA 3B6KA 3FPLA 4MQLA 2J6BA 1FA9A 3O3MB 1QOZA 4QUJA 2A3ZA 4UM5A 3CGGA 3AA5X 3HN2A 2H9YA 5A6VA 4CEZA 1WB4A 3FE1A 2WHPB 3RVJA 2C1XA 3EHEA 4UVEA 4A2QA 4TTPA 3DV9A 3VJLA 1A9RA 1EKXA 4UY8O 3OZFA 3LKBA 3WB2A 3TSWA 4ZEVA 2XH8A 3Q87B 5EE1A 5L7TA 1BGWA 1GPBA 1L8OA 1FY2A 4AZVA 3ZQ4A 1LVGA 2IS4A 2C9OA 2JVIA 4FWSA 4NNJA 5A6SA 2QXUA 3EGWA 4KR3A 3IQZA 3KJGA 1ACMA 3VGPA 4ENRA 3BZCA 2PYJA 3FOCA 3S9HA 3C74A 4BVFA 2QN8A 1UFRA 1E2BA 2B35A 1KO8A 3JD3A 2FRXA 3J8AA 4WMLA 1SCJA 2OM6A 5E26A 4KGXA 3GAMA 5BVHB 1FU7A 3KHYA 2YV2A 4TKVB 5C8YB 1I0ZA 1G9TA 4OHKA 2VYNA 5FXMA 4FB4A 4DDMA 1QGDA 2B5VA 4CECA 4R2LA 3DOCA 3IE2A 1TT5B 3DNPA 4ARCA 3K8YA 4L08A 4RF2A 2F48A 1VI2A 3DLRA 1W8DA 1RDUA 4D3DA 5LZ8A 3OF5A 3ICVA 1QNFA 1UPBA 3KXPA 2WAXA 4KI6A 5C31A 2Q97A 4OLFA 2XYVA 1Z4NA 1IUPA 3ZE1B 4UQPA 5DBIA 3GVHA 2CJYA 1PJTA 3AVLA 3W6NA 3E3NA 1LWOA 5LZ7A 3ZZMA 4M41A 4DCCA 2VF4X 3X1XA 3JYOA 4IXMA 5HP1A 2ECQA 1HPMA