2YHAA

Crystal structure of the n. crassa qde-2 ago mid-piwi domains
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
384
structure length
368
Chain Sequence
VKVARPCRKIEKWTYLELKGSKANEGVPQAMTAFAEFLNRTGIPINPRFSPGMSMSVPGSEKEFFAKVKELMSSHQFVVVLLPRKDVAIYNMVKRAADITFGVHTVCCVAEKFLSTKGQLGYFANVGLKVNLKFGGTNHNIKTPIPLLAKGKTMVVGYDVTHPTNLAAGQSPASAPSIVGLVSTIDQHLGQWPAMVWNNPHGQESMTEQFTDKFKTRLELWRSNPANNRSLPENILIFRDGVSEGQFQMVIKDELPLVRAACKLVYPAGKLPRITLIVSVHYTVLVDEIFRADYGNKAADTLEQLTHDMCYLCPPAYYADLVCDRARIHQKELFDALDENDSVKTDDFARWGNSGAVHPNLRNSMYYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POST-TRANSCRIPTIONAL GENE SILENCING PROTEIN QDE-2
publication title Crystal Structure of the Mid-Piwi Lobe of a Eukaryotic Argonaute Protein
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Rna binding protein
total genus 115
structure length 368
sequence length 384
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yhaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2yhaA01
3QELA 1D8YA 4H4MA 3LANA 4XLTA 3Q41A 4IBNA 1NXSA 3RH0A 3OYFA 2IOCA 4GNRA 5HSGA 1KVBA 2KW4A 3NDKA 3SV4A 5CNKA 4F3TA 2IDOA 1S9GA 4WWHA 2E6LA 2B5JA 4HCBA 4N41A 2VUHB 3V81A 4HNSA 5TQ2A 2I6FA 4CF0A 4ZYLA 4MQFB 1RTHA 3KJXA 1DJMA 3O3GA 3OO1A 2HNYA 5ABPA 4DADA 3OLWA 4CIGA 1RILA 1VSJA 1O1WA 3AA3A 2X74A 4Y1DA 1PUXA 5CY4A 1BVHA 4AHSA 3K9CA 5EWJB 5EWLA 2XY5A 4DU4A 4CEOA 2GBZA 4CJQA 2OQRA 5TPZA 1SKWA 4IFVA 4M3UA 5EWMA 4CFAA 4F2RA 1CHNA 3OLYA 2Y1JA 4FZYA 4JLHA 4RW8A 1USKA 2DFEA 2OENG 4JRPA 4Y9TA 4RXTA 1RT4A 4FLXA 3DOLA 3S99A 5DMRA 4MR9B 1GOBA 2BDPA 1IIBA 1RDAA 1TMYA 4CEBA 4UHKA 3L8BA 5DKFA 3K59A 4DFKA 2L19A 1ABEA 4QYMA 1USIA 1CLQA 2FLKA 2ZE2A 3TAGA 3LUAA 2VWJA 1NK5A 3AVGA 4M3ZA 4DLGA 1TAQA 3NGYA 4Q5VA 2HMIA 3OVNA 3GBPA 2IPAB 2PJUA 2AJQA 1DLOA 3H5IA 1E2BA 3ZT4A 1NK8A 4XXHA 5KC9A 2ITGA 1QSYA 3H6GA 2YV0X 3FFXA 4CF8A 4DTJA 3OYCA 1NKCA 3EULA 3L3UA 5GOTA 3AO5A 3ZT2A 3IPAA 1NXWA 4RKQA 1TKDA 1YTUA 1VRTA 2XY7A 2LPMA 3AA2A 3HPHA 1U8TA 4MS4A 1QQAA 5TQ0A 1J54A 4FZZA 1KCFA 3LP1A 1C1CA 3I09A 4QPJC 4PY5A 4FLVA 5I3UA 3DBIA 1MAVA 1L3VA 3IG1A 1NKEA 2FQXA 1ASVA 4ZJPA 4EYOA 1RTIA 3FFWA 1C0EA 3KKEA 3VA3A 2OPQA 3HP6A 4FW1A 1F51E 2A9RA 4FE7A 4H3HB 4QICA 4KHNA 1CEYA 3T38A 3O2QB 1C0TA 1BIUA 2XRIA 3SQ2A 2WJAA 4CJ4A 2XDYA 3NF6A 3SQ4A 3H1EA 4PYRA 1SL2A 3NH1A 4IG0A 3DLHA 1YMUA 1S1VA 2OZMA 3LZIA 2FVYA 1I3CA 3A0UA 4MR8B 5K14A 9ABPA 1EKEA 1HEYA 4PZ0A 3KYJB 2NT3A 2EHGA 2YNHA 3SJJA 4FJGA 1NY5A 4M3WA 4EZ6A 4BE1A 3KJVA 1PHRA 3QEKA 2HHVA 4CEEA 1BDIA 1GLGA 2MSLA 4CE9A 2CWDA 2QXYA 3O74A 5JNTA 3KLEA 4AHCA 2CD7A 1EHCA 1KVCA 3HM9A 4FB4A 4OKKA 4KRFA 3C6QA 2KYRA 1Z18A 4S05A 3O75A 4B3OA 4L8RB 2IKSA 2IPMA 5I42A 3K5LA 4LX8A 4CJ5A 4BDYA 1IKYA 4CEFA 3SZ2A 3MQ4A 5C24A 4L85A 3HS3A 3SG0A 4D6XA 1DRJA 3HCWA 2PE5A 2GWRA 1DCMA 2MYPA 4CIFA 3EY1A 4M3TA 1JLCA 3RMAA 2QSJA 4FJLA 3LTEA 3VNAA 5HKOA 4KV7A 2TMYA 4ID5A 4MS3B 2LIVA 2M98A 2L18A 1USGA 3P1GA 4AHRA 3AVMA 3K5MA 1U0SY 4FCYA 2HHTA 1J56A 3C6UA 3KLGA 1RXEA 1SXGA 3TANA 4YNQA 1B00A 5J2QA 4RK1A 3LKBA 3KK3A 3N8IA 4NCAA 4ZHRA 4TN5A 3HZHA 3AA5X 3KLHA 2RPIA 1P6UA 4OLBA 4EZ9A 1F21A 4MQ3A 4I2QA 1LAWA 4DSJA 3LUKA 1GCAA 4RW6A 2D0AA 4Q6WA 2MSKA 3KCNA 2E4VA 3QLVC 2J48A 3MF4A 4M88A 3KIOA 3VQQA 4W5RA 1NTRA 1R0AA 4KAZA 2B4AA 3C97A 3O2JA 4CJUA 1ZITA 4FLWA 1RT2A 4LZLA 4E3SA 2RDMA 1Y1LA 4B9MA 4KHWA 3KSMA 2HQRA 2E4LA 4DU3A 1T03A 2FEKA 1DP4A 3G10A 4DSKA 3BILA 1JFTA 5C5CA 5J1EA 1H9CA 3CNBA 3OMXA 4Q0BA 5FDLA 1N6QA 3OMWA 1VSDA 2Z1IA 3Q9SA 2IC3A 5JNSA 3DZDA 4Q7EA 4Z4GA 4Z0UA 5TPWA 2G8FA 2RKIA 4G0ZA 3AVJA 1IKVA 4DS4A 1ZBUA 3RVKA 4CHNA 2KZMA 3F6CA 3HYFA 5DLEA 3V9XA 4KPYA 2WRZA 1LBIA 4Y1CA 4BE0A 3VQPA 4FVMA 1HYZA 1SL1A 4LDZA 4G97A 2VUIB 2IDMA 3Q15C 1X9WA 1WLJA 4PA1A 2D0CA 4O5AA 1SUQA 3JTEA 2NT4A 3JVIA 1RT1A 1UA0A 1BISA 2PUCA 3IP5A 1E6MA 4LE0A 1SXIA 1A5WA 1WAJA 3ZSXA 3CG4A 1OXBB 3DRSA 2A1SA 3V9UA 2WJWA 2HQBA 2RN2A 1SXHA 3AVLA 2CHEA 1IKWA 1M5TA 1EWKA 4IGAA 3OLVA 3TR8A 2P5GA 4KKOA 5IBQA 3V1RA 5KGWA 1PEAA 4FJHA 5FWXB 4CGGA 4GPAA 3LUJA 2BE2A 5E3JA 1REVA 4DN6A 4B9TA 1ISSA 3BGRA 1RT3A 1JL2A 4AHVA 3ISNC 1ZGGA 2QV0A 5HRRA 1T05A 5J2NA 3LUGA 3QNOA 2IPNA 1EXQA 4CFDA 3RVQA 4QYWA 1JKHA 1QTMA 2W42A 1TJYA 4F12A 4LH5A 5IEJA 4MR7B 2HVIA 3LP0A 4OATA 1NKBA 1RBVA 3T8YA 1JFSA 2HNDA 1JLBA 4RK0A 3KLNA 3QEPA 3ZT3A 3ZSRA 4LD0A 1JXBA 4IFYA 3BDPA 2HPHA 1KLNA 1CXQA 4CJ3A 3RTVA 3IPCA 3V9ZA 3MXMA 1WN7A 5BRAA 1NOYA 3N75A 3M8QA 3AO4A 1RDDA 4MQFA 3SCXA 1NK0A 2QKKA 2Z1GA 2KTQA 2KFNA 3NHZA 3SAJA 3LPTA 4K8XA 1WSEA 1WSJA 1XHXA 4MS1B 3T95A 3CZCA 3QEMB 3H1GA 1ITGA 4C8OA 4JS5A 2WMYA 1ZBLA 5FRMA 1HJRA 4KREA 3OYEA 4QOZB 2IYNA 4F4KA 1QQCA 3G85A 1JX6A 3CRNA 5B3JC 2YHBA 3ITHA 3SUOA 5F64A 4TLLB 1ZBFA 4FLUA 2DFFA 1ZHHA 5CNMA 3CU5A 3AO3A 3Q7SA 1LBHA 1Q8IA 4N0QA 1MB3A 4DTMA 2P51A 4IRXA 2PUFA 3PX6A 1D1PA 3SNKA 3U3GA 3VQ4A 3MXJA 4EVSA 3JSMA 3CM6A 4AH9A 2NUBA 1SKRA 2FEPA 4KQ9A 4ETMA 1RZRD 4NYFA 3D8UA 3QNNA 1LWFA 4LY7A 4KHSA 2N9UA 2A9OA 6CHYA 5TQJA 3QEVA 4IMIB 5JNUA 2GBPA 1JLQA 3KD5E 1XWWA 3AVFA 4P98A 2PUAA 1I39A 1KRXA 3OYLA 4CERA 4O0JA 4CF9A 1BAPA 3QETA 5DK5A 3DOKA 4W5TA 3NF7A 1VRUA 5FRNA 1FXXA 4FK2A 3Q7RA 3ZT0A 3EJWA 3QIPA 2HHXA 4RDCA 4M3YA 2FBTA 1FQWA 1YTAA 1ZVVA 3QK7A 4Z9AA 2PY5A 1FFSA 1M2FA 3LUFA 3JS5A 4IKFA 2LUOA 1CZBA 3OS1A 1JHZA 3V1OA 4CFBA 2HVHA 2OPRA 5KGXA 1GUBA 1VK0A 3DLRA 1K66A 4ZPJA 4E89A 5KQPA 3ULDA 5JNVA 1KLMA 1BDJA 1GOCA 4DQIA 4EUKA 1KGSA 3QIOA 4CF1A 2DY4A 1ZBIA 3VQ9A 4MRMB 4CESA 4N5SA 3OQNA 3CFYA 3VQCA 1EAYA 3S3NA 2QZJA 3PX4A 2FEWB 2H0AA 5T3YA 4BWJA 1TGOA 7ABPA 4ZMSA 3AV9A 4YO7A 4G1QA 3T6KA 2PYJA 3SYZA 2RJOA 1A5XA 4CHPA 1E6KA 1S6PA 1HMVA 1IG9A 2PKXA 2QVGA 2WONA 2E6MA 3TWHA 1JF8A 2R4QA 1DCFA 3NF9A 5IUKC 1R8JA 4FK0A 1WSFA 3DMJA 4JASB 4CJPA 3CG7A 2HHUA 3SQ0A 4J2BA 6ABPA 1ABFA 2JLEA 2YNFA 3VQAA 3CM5A 4DSEA 1FKOA 4NYNA 3CTPA 3OO0A 1JH9A 1NXVA 3QLUA 4QCLA 3QLVA 1S1WA 4WXEA 1QS4A 1SL0A 4F06A 4CCHA 2FXIA 3H08A 4WUTA 4FM2A 3LP3A 3LMKA 3DRPA 4DTPA 4C8NA 1YS7A 3EZ5A 1B9DA 3LFTA 3O1HB 4YR7A 2O20A 4FJJA 2Z1HA 1VSEA 1GUDA 3MIZA 4RU1A 3ZCMA 2FSPA 1MB0A 2MYTA 1DBQA 3B6OA 4H60A 5BQ3A 4KVFA 1UOCA 3QEWA 2HQOA 4KV8A 3AVCA 1D5AA 3FMVA 2DRIA 2VWKA 4KZKA 3JYTA 4Z4CA 3IDOA 4KK4A 1U48A 4AILC 4B9NA 3QX8A 4Z99A 2E4XA 3WNHA 2R7YA 2O4GA 3E61A 5D2CA 3EGCA 4OLAA 4Z4EA 1A5VA 3O21A 3DM2A 5TQ2B 1YK0A 4N76A 3CYMA 1TM2A 5FROA 2RF2A 1C0UA 3IRXA 1RNLA 4RKRA 1U4BA 3P83D 4BACA 4FJ8A 2G8WA 3NNNA 4PQUA 1BI4A 2A1RA 4I2PA 5KRTA 3K57A 1VSHA 4KNYA 1TAUA 2B1JA 5D3GA 3O3FA 5CYQA 1U49A 3HDVA 4FJMA 5EWMB 1HYVA 2YKNA 1T34A 3NBPA 4D74A 2PUBA 1XHEA 2HW3A 1X9SA 3NCIA 3VQ6A 4EYGA 3NNSA 3L6UA 1LV5A 2P5OA 1RTDA 2G8HA 4JB0A 3OYIA 2QW1A 3HPOA 1JBEA 1ZN2A 4NQRA 1VSMA 1QO0D 3RMCA 1KSPA 3CKMA 4CGHA 4ICLA 4NICA 1EFAA 3CFOA 1WSIA 4RK5A 2HHWA 1I3AA 4PICA 2ETJA 5GQSA 1VPWA 4JOQA 2LSNA 4I9LA 3EYZA 2V0NA 2OPSA 3MEDA 2D5RA 4GW6A 4J2DA 4FJNA 2PUDA 4DQQA 1FFGA 3H5WA 4FXDA 3QINA 2AYXA 1DTQA 1C1BA 3SNNA 1HQUA 5KC8A 1DBPA 5FWYB 2XY6A 3L2UA 2JVIA 4ETNA 3QX9A 5IULC 4XASA 3G1WA 2P9HA 3L49A 1OXKB 4JAVC 3FGZA 1KVAA 1VRVA 2E4WA 5IX8A 2IAJA 3AVAA 3BBLA 4MS4B 4FM1A 1IH7A 4FLYA 4FJ9A 2KFZA 2FBYA 2XY8A 1Z26A 2YNGA 5FWXA 2Y1IA 4CEZA 5B3JA 1SRRA 3IS9A 3VQEA 2OA8A 4H3KB 2NZVG 3CS3A 3QLUC 1L5ZA 1C6VA 2AYZA 5KRSA 4YS6A 3NBMA 1RBRA 4RS3A 1LK0A 4NV3A 3CQ8A 4OKEA 3KTOA 1JXEA 5JS2A 1CZ9A 5HRNA 1JYEA 1WETA 1KRPA 4I7FA 3QO9A 2X7XA 2R48A 1BCOA 4N56A 4Q6BA 2JBAB 4LRQA 2GI4A 4RW7A 3LPUA 3L2RA 3OS0A 3KLFA 3M8RA 3RRGA 3OJUA 1RDBA 1NXOA 1D9FA 3C95A 4MLCA 4TSXA 3KS9A 2IS3A 4PUOA 5IEBA 1XHZA 2EX3A 4FLTA 1X1PA 3SV3A 4O5BA 4YCSA 1L5UA 3QESA 2L17A 1DZ3A 2FBVA 4O4GA 3UUGA 4CJLA 5DTEA 4XIUA 3NF8A 2LBPA 3HUTA 1RT5A 3L2QA 3V4IA 5HP1A 1ZESA 8ABPA 3M8PA 1N5YA 3VN5A 2HSGA 3ZSVA 1U2QA 3N53A 3F9KA 2PUGA 3FDFA 4J2EA 4MQEB 1D4ZA 5T7BA 4MS1A 3QEMA 4BDZA 1JFVA 4CBVA 4CJTA 4KI4A 2FQYA 4C8LA 4DU1A 4B9LA 3K5NA 2JK1A 2O4IA 1BDHA 3OYNA 3NGIA 5HRSA 1JDNA 3SPYA 3F7NA 4OG2A 4QAGA 3T1AA 4HTUA 3SI6A 1JLFA 4OGCA 4B9VA 1ZGZA 4EP5A 2I5JA 3HT3A 4E7PA 4O1HA 4OGEA 3B2NA 3L3VA 5HQJA 4HYEA 5CZ2A 4FM0A 1WNSA 1W25A 4CJFA 1S6QA 4ZTFA 2JGUA 3HL8A 1JL3A 1EWTA 2L2QA 1U47A 3DLKA 2P4UA 2B4JA 3EDCA 3UK0A 1RZRA 5IUJC 1ZAYA 4CFCA 3T3FA 1RNHA 4BWMA 2QU7A 3OYAA 3O4QA 1HPZA 4W5NA 2G8KA 4PWDA 2PLNA 4DF8A 1BHLA 3PX0A 3LKVA 3R0JA 2ZQBA 4H4OA 2PUEA 3GT7A 4CGFA 4NCGA 1IO2A 1HNVA 3C3WA 1TVMA 1NXXA 4PE5B 5KQGA 4O55A 2Z1JA 3V1QA 3OYHA 4YGXB 2FC0A 4LE2A 2WOMA 4OPKA 4OPJA 1JLGA 1DRKA 1NXTA 3MEEA 2X6NA 3LUHA 3ILHA 1BQNA 3OYDA 4ID1A 4G0PA 4CJWA 3MA0A 1RTJA 3M9XA 4WT7A 3H5TA 1M5UA 3N6VA 2BANA 4PEVA 1QMPA 4N47A 4Z4IA 4FJ5A 4S04A 1ZH4A 5KQMA 3OQMA 3H5OA 1C0MA 4E7JA 3HO1A 4E7OA 1RBTA 1VSFA 2PAFA 1JWLA 2Q3SA 4XARA 4K8ZA 3HSYA 1BCMA 5EWJA 2ZWMA 5HM6A 4G0YA 3SUQA 1D5WA 3Q7TA 3OM1A 5FBHA 3DLEA 2JVJA 4TLMB 1EX4A 3M6MD 3WNGA 2PL1A 3U6FA 4G0QA 5JS1A 1B92A 1NOZA 3P9YA 1QKKA 1M2EA 3RR8A 1S1TA 1HNIA 1WSHA 4P1ZA 2KZZA 4KHYA 4EGSA 3JPWA 3KK1A 1DC7A 1W0HA 5SZTA 3NH2A 3EODA 4NCBA 4DTUA 1A0OA 2JVKA 1QE1A 4MR9A 3DRRA 4Z0NA 2RJNA 1B9FA 3AVHA 4DLEA 4WE1A 1NK6A 3NE6A 4DTOA 1LWEA 1TLFA 1HQEA 3KTQA 1W9HA 4HNQA 3O4NA 2LP4Y 3LAMA 4ZTJA 1KMIY 4O1IA 5IUNC 3C3KA 4O0IA 4RY0A 4JA2A 2PL9A 3CFRA 3RVJA 4EP4A 4GMJB 1NXPA 1RDCA 1P6QA 4YWHA 2VYCA 3IP6A 3GL9A 1YS6A 1JLAA 2FLWA 4O44A 4M3RA 4KMRA 1Z25A 3K5OA 3TAMA 4F11A 2HNZA 3MAQA 1MU2A 1TKXA 2MYUA 3VA0A 5HRPA 2ID9A 1RPJA 1E6LA 4ETIA 4MYRA 4DG1A 1QQBA 3QLHA 3H5LA 4FJXA 1PNRA 3L2WA 4HHTA 1ZY2A 1RBSA 5HBMA 4ELUA 3HVTA 1VKRA 1JLKA 1LWCA 1QHTA 1TKZA 1WAFA 4DTRA 4ELTA 1QPZA 3AVNA 4RWEA 1BIZA 4YRZA 3PUFA 2R47A 3L2VA 4KI6A 3CLKA 4LH4A 2OYQA 4L4UA 2NZUG 1C4WA 2FBXA 3TAPA 2VG5A 4CHQA 1Z16A 4KHQA 2QKBA 1BQMA 1NK4A 4FJKA 4IILA 4M3XA 1KFDA 2BGGA 1Z17A 1ZH2A 3A10A 3N0XA 1NK7A 4ELVA 3TI0A 1WSGA 4YP9A 3HPGA 5KI6A 3ZSYA 3PY8A 3H75A 4MR8A 3C94A 3BRQA 4C8KA 4KTWA 1UWBA 4UHJA 3SUPA 3AA4A 3LDSA 1VLZA 1TKTA 4DFMA 2FN8A 2PYLA 2VG6A 4HVJA 3F6PA 3DI6A 4CIEA 5DGCA 4E7HA 4CGIA 3TX6A 1QSLA 3KKSA 1P8AA 2FQWA 4R5PA 5CHYA 3D0PA 1JDPA 1KFSA 1ZDMA 2G8UA 2H3HA 4HUGA 3OS2A 4W5QA 3BRSA 1LW0A 3WNEA 2E4ZA 3IP7A 4RK7A 4CJEA 1DTTA 2WY2D 4E7LA 4XAQA 2F8TA 5I4CA 3OYMA 3TO5A 3JVDA 2JB9A 1QO0A 2M1ZA 3HJFA 1X9MA 1G15A 1TL1A 1QNLA 1P2FA 1HYSA 4MGEA 3OJSA 3HDGA 2XO7A 4RY9A 3TD9A 4FJ7A 3AO2A 3NGZA 3OQOA 5TE9A 4IMJB 2DTUA 4KQCA 4RSMA 4XFKA 3QELB 3ROFA 5FWYA 4EVRA 3V6DA 4YV7A 3TABA 5HROA 1A2OA 4JRQA 1YK1A 1K68A 1QP7A 4MS3A 1SV5A 1BL3A 1BA2A 3RVPA 3KHTA 3CG0A 2KQ2A 4RW4A 2Q5CA 4OJRA 3I0SA 3PV8A 1FFWA 3PO4A 1NJZA 4CECA 1D1QA 3B6PA 1SKSA 1EP4A 3I5AA 5SWMA 3K2PA 4FLZA 3I42A 4MLDA 1NJYA 4Z9BA 4OVLA 5PNTA 2HHSA 3O2SB 3C6TA 1QSSA 3RVNA 5BR1A 3DGFC 1Z15A 5TPZD 5EWLB 4DQSA 4DTSA 1KTQA 3DLGA 1JLEA 3AO1A 4KB0A 1PNTA 3CZ5A 4GVMA 1RT7A 4D6YA 3F73A 1RBUA 2G8IA 3IAYA 3A0RB 1RCHA 1RT6A 2FN9A 2JBAA 4ML3A 2A9PA 3LUCA 4RK4A 4HNRA 2FMHA 4RK6A 4JP1A 4F3OA 5CNJA 3QERA 4DMNA 3D02A 2GX6A 1TK0A 4CF2A 2MSWA 3K4HA 1ZYQA 4CJVA 1GCGA 5E41A 5KTQA 3S3OA 3I0RA 4KFCA 4WXMA 4M45A 3H5VA 4M42A 3HXMA 2GUIA 3LP2A 1DCKA 4AHUA 3OYJA 2E4UA 4G0MA 4RY8A 4N03A 4E7KA 3OYKA 2JCGA 3C3MA 2VG7A 3TAEA 4H8KA 1T8EA 4UQGA 3HEBA 3UKJA 2YNIA 2D0BA 3QEXA 4E7IA 4MQEA 3V9WA 3DLBA 2YHAA 4W5OA 3NH0A 4G0OA 1NK9A 1NJWA 3HSTB 3ZSZA 1NATA 3A3KA 3AVKA 4B08A 4CHOA 1CYEA 1J5OA 4KK3A 3G0ZA 3SUNA 3TAQA 2F96A 3ZSQA 1ASUA 4KTZA 3JY6A 2ZAYA 3MM4A 4HUFA 1KRWA 5TQ0B 2E4YA 4J2AA 1MIHA 2P1JA 4RXMA 2QVCA 4DSIA 4OBBA 3RVSA 2R25B 3KK2A 4CJSA 4KFBA 2IPLA 3M8SA 4DSFA 3NHGA 3ZT1A 3LAKA 4FE4A 4DTNA 4MPTA 1FKPA 2QK9A 2B6AA 3VQBA 1VSLA 1YMVA 2QR3A 5CYMA 3ROTA 3RQIA 5DCLA 1SD5A 4B8CA 1JYFA 2QXFA 2GKGA 4CGJA 3HK2A 4IDKA 3HV2A 1FSPA 1FK9A 2FMIA 5HLFA 3O1IC 1LJLA 3OLXA 5FBKA 1PEYA 3KLOA 1UAXA 3RVLA 4KB1A 4RW9A 1ZBHA 3UIQA 4E1NA 1BI4B 1XHFA 5CNIA 3KG2A 1YIOA 4MR7A 3S3MA 3FFTA 4CK1A 3ZSOA 3V9SA 1J9AA 3VNBA 1ASWA 2X78A 3AVBA 2CHFA 2IOYA 3MXIA 3HUUA 3PO5A 1U2PA 1XWLA 3QEIA 4FK4A 1C1AA 3VQ8A 3O1JC 1URPA 3HVRA 3LWLA 3K58A 5EU7A 1S5JA 5C25A 4BDPA 5C5EA 1APBA 4Z4HA 1HRHA 1UA1A 3MMNA 1AB5A 4F2SA 1UDRA 4I9QA 3CHYA 5JNRA 3KKRA 4CJKA 3DGEC 1TVRA 1Y97A 3RVMA 4FJIA 1EETA 4CJRA 4OKJA 4CEAA 3VQ5A 1TK8A 1Z12A 1K6YA 1VSKA 1IKXA 1AB6A 2OPPA 1S9EA 5J2MA 1JL1A 3RR7A 3RMBA 2GV9A 3TARA 4KO0A 3S9HA 3ASMA 3RWUA 3OY9A 3GA5A 3THVA 1TL3A 2JRLA 3E3MA 5KWSA 1MVOA 1DC8A 2ATQA 3WNFA 4AHTA 3OYGA 1F4VA 2FKAA 3GRCA 3I45A 4LSLA 3JPYA 4CK3A 3H6HA 4DFPA 4IG3A 4WZZA 1QP4A 2F8SA 4F8RA 4N0PA 4LDAA 4DQPA 5KQLA 1YT3A 4B9UA 3MEGA 4RV5A 4DQDA 3N0WA 3RRHA 3NAEA 4DQRA 4G86A 1NJXA 2HB5A 3M9WA 3ZSWA 5BRJA 1YVUA 3W9SA 4M41A 3IP9A 4MFBA 1DG9A 1Q9YA 2ZD1A 1S1UA 3EAFA 4CHZA 4E1MA 3EQ2A 2A9QA 1LAVA 1Q9XA 3TAFA 2PZSA 4CEQA 4HUEA 5IC5A 3A2FA 1BGXT 4Z4FA 4F8JA 3RMDA 5CZ1A 4FYDA 3U3YA 4EYKA 5J2PA 1CXUA 5C42A 3VQDA 4KTQA 4RXUA 4E0DA 1A04A 3GWGA 4LSNA 3GBVA 2HJ9A 3FFIA 1DBWA 3P5JA 3BREA 4IF4A 1GOAA 4FW2A 4RZSA 4B09A 4DS5A 3NNDA 3SPZA 4HCCA 4DTXA 2PMCA 3SQNA 2WWVD 3TMYA 2FTKE 3MYYA 4G0XA 5TPWB 3LUDA 4JS4A 1U45A 3LALA 3EQZA 4RG8A 1LJUA 4MAAA 1T7PA 2OZSA 4BE2A 4MRMA 1L3UA 2X6SA 3VQ7A 3SM9A 4EVQA 1S8NA 1Z2DA 3RVRA 4CHYA 4CGDA 4JB2A 4OTZA 2FMKA 2DFHA 4KHUA 1XC9A 3LZJA 1ISRA 3ALYA 3OYBA 5ED4A 3E01A 3T19A 4B9SA 4DSLA 3I8DA 3KD1E 3GV0A 4EYQA 3KLIA 1J53A 4DWIA 3ILYA 3RVOA 3DYAA 2XHBA 3D45A 1L3SA 1D2AA 2ID7A 3OLZA 3HP9A 1S1XA 4B8AB 4E19A 3SQ1A 3CFPA 1Z2EA 4CK2A 5JNWA 2RGYA 2WB4A 2FMFA 3NFAA 4DFJA 4EY3A 2IGIA 1L5YA 4YLEA 2VK2A 3MECA 1U04A 4FZXC 2MYNA 1D9DA 3SY8A 3LOPA 1TV6A 2G8VA 3AVIA 4ZMRA 1RXIA 2HHQA 4DF4A 3QLTA 1L3TA 1QP0A 1XI1A 2YKMA 3OM0A 1Z13A 3O3HA 4C8MA 1TK5A 1EWVA 4TMYA 3LWMA 1VSIA 3KYIB 3N0RA 3GYBA 3TB6A 3URMA 3NHMA 4LE1A 4YFUA 4CEDA 2FW0A 3H1FA 1LW2A
chains in the Genus database with same CATH superfamily
1TQ6A 4AZ3A 2XUKA 5IVPA 1KAGA 1NXSA 1QYXA 3ETDA 2C2ZA 4I8IA 5JDIC 1HE3A 5C3MA 1KS9A 1PZMA 5LXTB 4E5YA 5JMPA 2Y05A 3TWOA 1E5XA 5TQ2A 1GA6A 2VCYA 5LYJF 5KPZA 1E0SA 1NR5A 5JZ9A 2VNHA 2YRFA 4IJAA 1ECLA 1JT9A 1OTHA 3K9NA 3UMFA 3X1KA 3VTKA 1TMOA 1N34B 5AQYA 2PXAA 1YOBA 2OQRA 2V5VA 1AF4A 2B4YA 5C18A 4ZAYA 1U2GC 1Y9EA 3FSGA 1VDMA 1KP2A 4AP5A 2V7GA 5CCBA 4I2NA 4NMWA 1TB4A 1MAUA 1Y7PA 4K0RA 3FTQA 4BNFA 1TMYA 3WIVA 1W1IA 4UBNA 3EXIA 1YXQA 5T6BA 2BM1A 4OGKA 2CYAA 3TAGA 3DDOA 3OHSX 4RC9A 4D80A 5HOEA 1QHIA 4XX0A 5EIBD 4RHTA 1J97A 3BMOB 3F9RA 4NRDA 4ZYYA 1BHJA 1Q0RA 4I1YA 4ND7A 3MCAA 3SFVA 3W04A 5D01A 1SKUA 1W88B 1M0WA 2ZJ7A 2EQAA 3COYA 5GOTA 4QDOA 1K63A 4HTFB 4FYWA 1TKDA 4IUDS 3SK3A 1MO5A 5AKJA 3OHRA 1C7RA 2YNMD 1JCEA 1C1CA 2VQEK 3PCRB 2BFWA 3DDSA 3T34A 1O94D 2E55A 2L42A 2G7MC 1Z0IA 4OSPA 3H13A 4ZCSA 4FQ8A 5LZ4A 3J8AA 2WG0A 4RADA 3TBFA 1PEDA 2A9RA 2ZJ1A 1U98A 5F4ZA 4F9GA 3RG2A 1VMKA 1IN5A 3SQ2A 4LF9K 4OHOA 4UUOA 1QNFA 3I2GA 3NH1A 4TMFA 3KPUA 4UTOA 2CLSA 4X6LA 4IL5A 1P0IA 5F1PA 1TU3A 3IYLW 1NY5A 3ZX0A 3THXB 1RAIA 4PZUA 5BR7A 4BROA 4UOZA 1T6DA 3V2HA 4ZRNA 1GLGA 5FHRA 4CE9A 5EX5A 4Q1DA 3PP8A 1VG8A 3C6QA 2KHZA 5BW8A 3HKEA 2V9CA 2OXIA 3HUEA 1QFJA 2X8WA 4JT4A 3RC3A 5L45A 1Y7HA 1WZIA 4FWNA 1TT5A 1KE1A 1R6UA 4LI0A 3HCWA 3F9MA 2D7DA 2OR3A 1J9ZA 4Q1BA 5HCUA 5K9ZA 4MS3B 2I3DA 3CX3A 3IR6A 2BGRA 4LJ5A 1T3GA 2PWYA 5AK0A 5ELXA 5K01A 1L5FA 3GPCA 1C0PA 4RK1A 5HQ3A 1HQDA 1SOAA 3GBTA 3AWIA 2YHIB 1RWWA 3CMAN 4PL8A 3LUKA 3FSJX 5BQFA 1XMQK 1RJEA 1YH3A 1JR3D 1NY6A 2VYVA 1R4MA 4KDCA 1ZITA 5T57A 1WBJB 3OF5A 4XJSA 1WF6A 3KSMA 3KPVA 4X91A 4OQPA 4AZSA 3KIPA 5ERYA 4ZYUA 4Q7EA 5FPSA 3A6PC 1JIIA 1NI4B 5AOBA 3DONA 4Y3UA 4CHNA 4Y1RB 4MB6A 1P9LA 5JBQA 1DDOA 1QH8B 1MVNA 821PA 2X9QA 2QXUA 5F78A 1HYZA 4FZRA 2R2GA 3CLTC 3DLCA 4NXNB 3HYLA 1BDGA 4P0TA 1IONA 1V6AA 1WZNA 1RT1A 1UT5A 3NV9A 2IU0A 1HDXA 3RSFA 4XR9A 2JAHA 4DR4K 3C7AA 4ZOQI 2JH8A 3QLJA 4IKPA 3I0ZA 1Q21A 4BBPA 2QTFA 3U49A 1R50A 4L4RA 4NAHA 1KR2A 2J31A 4Y2PA 4B17A 4DILA 5AW8A 1NBMA 2JWLA 3L4KA 3GEEA 4JNEA 4ZCLA 5EJIA 4AHVA 2YWDA 4JEUA 1AGPA 1IN1A 3NLLA 3WXIA 3EEOA 4D3YA 4G84A 2QPOA 5AQIA 3TQQA 3DHEA 4KH0A 5IEJA 4BL5A 3ACCA 2R6ZA 5AKHA 3C2QA 3EZWA 4EF5A 4D8VA 3BE8A 3T41A 1ZGAA 1EE1A 5CX4A 3AI7A 1TM5E 1Q17A 2XVZA 4NENA 4U63A 2FCRA 3D2FA 3MHTA 1PTKA 4DWOA 3GEGA 3CZCA 1ITGA 2FZVA 4K3VA 2OXTA 3HRGA 3CXCM 4YNBA 4NJEB 1I3NA 4XEUA 4YUYA 1OREA 3QYFA 2AN9A 2J4FA 2DFFA 1TO6A 3IP1A 5FNVB 1RE1A 4LK2A 2EHDA 3BJZA 3G9XA 2Q3LA 2IXAA 4Z9XA 3SQDA 4MGZR 4MW1A 3L8GA 2WWFA 1SKRA 5KUTA 1QCZA 5CDFE 4QREA 3PC8C 3DF7A 1CP2A 1V37A 1JIKA 1FDRA 4PYMA 4DR2B 1WVGA 4FYIA 5J47A 2H1SA 4G5FA 2WHEA 1X0XA 3I9KA 4L5CA 5CYFA 2HHJA 4RVFA 3LI2A 1KRXA 3OTWA 4E5SA 3L0PA 1ID1A 1QTQA 4UM9B 5FRNA 1UKAA 1ZONA 3WQUA 1G66A 1ECFA 1NYLA 2DT5A 4P4LA 3F8WA 5EXPA 4ROSA 3JZIA 4AI6A 3M6UA 3VMFA 4L4XA 4V24A 3FWNA 3E5RA 4E5KA 2CMKA 2Q2QA 4ZICA 1CZBA 1EFRA 4IWNA 2X4GA 4MVWA 3WB0A 4CFBA 1P7PA 3A11A 4P4NA 5E4TA 2G4VA 3SSOA 4X97A 3ESDA 3UBMA 3FGUA 3QIOA 3ENZA 3N2GB 1ZBIA 1Q91A 1PBTA 2WHYA 3DPUA 1QV6A 1EAYA 2P9NB 3QFFA 3S3NA 3PX4A 1WM1A 2V3WA 1IHDA 4UCFA 1U1IA 4N0EA 3IUEA 4KACA 4BECA 3WSVA 4Z53A 5A4MS 3NTRA 4HDKB 1S6PA 4RSRA 3GUHA 3OJWA 4FK0A 3I30X 4FWPA 4YDUC 1NMQA 4Y2YA 5IM5A 4DSEA 3OBYA 2ZI3A 4YYZA 4TMKA 1QDLB 1EWYA 1TC1A 4QOIA 3VJMA 3TOSA 1T1JA 1RC8A 3EZ5A 5F4BA 3ETLA 3O1HB 3MWGA 1RI5A 4B3HA 4DQVA 4GPD1 1QK3A 1GU7A 4I1UA 4MO5A 3Q11A 2V0CA 2YVAA 3QE0A 2WHXA 3SHFA 2DRIA 1W19A 4LZNA 4C08A 4PSCA 4LOAA 1RDWX 1GPWB 4KK4A 3MWDB 3LM2A 1U48A 3H45C 4HT3B 4ZDJA 3SR3A 1MZVA 3HU1A 4EG0A 1V0JA 1YB5A 2H85A 4CMKA 3T1HB 1FX1A 4G5XA 3DM2A 5C7LO 2EATA 4HWKA 2FGKA 5AQFA 2UKDA 3JQ9C 2V7QD 4CDNA 1BI4A 3CUUA 5ITVA 1QIGA 1XP5A 5F21A 4R1MA 3KSZO 4GO1A 3AJ8A 1E1QA 1QPGA 3GZJA 1IY9A 1P62B 2BFBA 1G21A 2PUBA 1N6KA 5B53A 2Q5OA 2P35A 4DJFC 3NHSA 2GHRA 1H22A 1E4FT 5TRTA 2IXGA 3N2KA 4G8CA 3HPOA 2R7MA 2PGJA 1VJGA 5EIEA 2BMJA 4KQGA 2FPMA 2GF0A 2NSHA 3BD7A 3E35A 1NVFA 2HDWA 3DBRA 4RK5A 3WIBA 4QEZA 4IRUB 4MO2A 4ENWA 3EIXA 2X2EA 3DVAB 3ZDZB 3VDQA 4U7BA 1K5PA 4BNVA 5ILGA 5HKKA 1XQVA 5CT8A 5H3CA 3OD1A 1KAXA 1U99A 2CE2X 5A4AA 3WTCA 3VI4B 4EJ0A 1JBQA 4KVAA 2PV0A 1ZOOA 4GR4A 3UK1A 1UZLA 1XAHA 2AWOA 4FLYA 1PJAA 4QDKA 2DPYA 4R68A 1N1DA 1M76A 2DQYA 4TT3A 4DG5A 4F56A 4D3ZA 1P9OA 3DSRA 1PV4A 3H05A 1JEDA 1TGYA 1TPYA 3MBKA 1N0VC 5INTA 1ZU5A 4PLPA 4DHYA 4WYBA 4BLTA 1IVNA 3U4GA 8MHTA 4RQUA 1J4AA 3QIAA 3TLAA 1JDBB 3H1QA 3AEYA 2WNIA 5GJWC 5I9NA 5SZIA 1TCAA 3BN3A 5LOVA 3QESA 4K6OA 4TM8A 3IQFA 2EBFX 4KYTA 3EAGA 4FOTA 5JD4A 2OO5C 4CM9D 4TMVA 3BTVA 4YUVA 1N2EA 5GY7A 1LTHR 1KRHA 1GXSB 3S5JA 1EYZA 3DEZA 1E2DA 3NEYA 3AY0A 3IMGA 5FUMA 4H7EA 4QAGA 4LF8K 1P91A 1NYRA 5LPNA 4QRDA 5CYPA 3ZDYB 1KJZA 3KB6A 3F5QA 4CM7A 1D8TA 4G4IA 1ODIA 3U56A 5J2UB 5L3QA 2HREA 4OGEA 5CAEA 3W2TA 4OMDA 1QMGA 1NULA 5LIPA 3KKQA 4ZTFA 4ZO4A 3V4VB 4U7PB 4BRDA 2P77A 3D4BA 2Q50A 3IKMA 1RZRA 2GN4A 1ZJYA 5CPBA 4QLBA 1Y4DE 1V3TA 1EX1A 4FWLA 4GPEA 4DF8A 2NU9A 4N49A 2PUEA 1NXXA 5D3KA 3VEWA 1TMKA 3PPWA 1AQNA 4YDQA 3VR6H 3RTGA 1A8QA 3W2FA 5IXSA 5AKKA 3M9XA 4LJAA 1M5UA 1G8SA 2BGWA 3FVWA 5I9EB 4PEVA 1VQ8N 2XF2A 3QVJA 5GM2A 4BTVA 4E7JA 1NDQA 2AHOA 1N2JA 1VSFA 2R751 2MR5A 2Y66A 4DCSA 2I3BA 3E53A 5HM6A 2TMKA 1D5WA 4H3VA 3K0KA 4B2LA 4FMDB 4EITA 4IUYA 5T4EA 4UNNA 2B36A 4HJXA 4KXQA 3IBFA 4GVXA 4Q7QA 4WBNB 3DBHB 1J20A 2FN4A 4H1TA 3USZA 1EG2A 3JPWA 3O9UA 3KK1A 4LJ7A 2ZROA 3A37A 4TRMA 3I1IA 1CS0B 1E7RA 3PE3A 3FKJA 5JY6A 4UDOA 1CUZA 5JECA 5LZ2A 3L7LA 1W9HA 4EZEA 1BFUA 4ZCRA 3IMXA 1DZIA 4CCWA 4GV6A 2IYXA 3C3KA 5L40A 2VGMA 3AUXA 3QUTA 4UPEA 1XJ0A 5FAXA 3RRNA 1OE0A 3KHUA 3ZTYA 2Y2VA 5IAEA 1J8VA 3SYKA 1ZK3A 5DOVA 4KMRA 1ZFNA 1UBGA 3NIDB 2ZJRL 4HQNA 3CCEN 4EHIA 4ETIA 4HLDA 1VC2A 1XYVA 5GOZA 2PUJA 2PSEA 5IM4A 2XLBA 1RRCA 6ADHA 2GFIA 3HCEA 1BIZA 4ARIA 1TF5A 2Q3JA 3RUFA 4F21A 4JV5K 4HVLA 3TAPA 2B98A 1JJ7A 3JQAA 6NULA 4FJKA 5BY2A 1S1CA 4OD0A 3PR1A 3HYTA 1W49A 1VJTA 3SC3A 4R8MA 3BRQA 1HG1A 2OHOA 5HZMA 1WDTA 3SJAA 1GHTA 2BAGA 4GMKA 5A0VA 5JBIA 3HYNA 3D0PA 2OKCA 5KHOC 3L1JA 2YWCA 2BHNA 5FPKA 2F8TA 3TO5A 2V7TA 4GZ6A 2CVOA 2M1ZA 1GTL1 3K6SB 1X9MA 1ZRNA 2EZTA 3VRHA 1DAKA 2PQMA 2FWMX 4UUMA 3RQSA 3OE4A 4H6VA 1S2NA 2J0EA 5H1YA 2DTUA 2XWSA 2YFKA 4W9NC 2NLOA 4AZ3B 1YK1A 4IHKA 3DTNA 1VCNA 1CUIA 4A8PA 2XGSA 5KX5A 3BWEA 1WQ3A 3PFWO 1QV9A 3SYLA 3PO4A 3HR4A 3O7MA 2WE7A 4CECA 3WOVA 4K6CA 2FG5A 4OK6A 3E05A 2I4IA 4TYPA 2ZE7A 3AXSA 1C2YA 2VJOA 1UMBA 3FPCA 3B3QA 1SOUA 1KEWA 2C9OA 4AKGA 4DV5K 2DQKA 5AQVA 3Q7PA 2PX2A 2FOIA 1QRDA 4ZQBA 4KYUA 4L75A 5K3OA 3A0RB 3VC7A 2IHTA 3LFHA 2PZAA 2QIOA 4QDUA 4PTLA 7ADHA 3WKBA 3SFZA 4CJVA 2J6BA 4AO7A 1TZ2A 4MGYR 5BSTA 4WESB 4MV9A 5FEMA 3FCCA 1QH1B 1LH0A 2EBWA 4AHUA 2O8BA 4G0MA 3EWIA 3MTEA 1DE0A 4QXAA 4XX0B 3TAEA 4BJ6A 4J1SA 4J9UE 4ID3A 3V3KA 3BZBA 4UQGA 3HCDA 4CW7A 3BC1A 4E7IA 3VF4A 4Z51A 3MCAB 2CUZA 3RSGA 1QAMA 1VE5A 2BFFA 4D56A 4MEBA 3E7WA 3LF1A 2HADA 4N39A 3DOCA 3LQKA 4BGDA 2DKOA 1Q0QA 3HJTA 2CLFB 1D4OA 4EG3A 4WUVA 3PSIA 4FYXA 4GOLD 3RYCB 1RVDA 3ETNA 3OKAA 5JALA 3B7PA 5LUAA 3VO9A 3D4PA 5F7OA 4K6MA 3A2LA 3HFJA 4JUDX 4KB1A 4D43A 5MN4A 4JKEA 4BKPA 4WCEL 2VJBA 1KY3A 3IPRA 1QF9A 3ZE6A 1QQMA 4WN3A 5DSTA 3V4RA 1XWLA 4N3BA 5H1SQ 1SQGA 4RKFA 1URPA 3LWLA 1WXDA 2AOTA 4YCBA 4DMLA 1TDJA 4LQLA 4A4DA 1WZEA 2C5GA 3TB4A 3JAMA 4H77A 1Q7RA 4CQMB 1GGJA 3MCVA 3KKRA 3RVMA 2Q5LA 3HDHA 3VX3A 3A7DA 4FQ5A 3KOXA 1DQRA 3I01A 2X40A 2E7ZA 3DEIA 1W87A 2ZIXA 1TT5B 3LQRA 1U7DA 3PQEA 1X13A 2BVNA 4NVRA 1OBHA 4AHTA 1IOVA 1QKIA 2XDWA 1Z2PX 3JVVA 1XMSA 5EGNA 4P36A 4F8RA 2ZIWB 1YT3A 2V52B 5HS4A 4IQGA 5BXQC 1YVUA 2Z4TA 1CQWA 3TNLA 4US0R 4QL3A 1OB5A 2ZD1A 3FVVA 5AQSA 5HQ3B 1LTKA 4LV8B 4NCJA 3E9PA 1Z0AA 1E3TA 1IHYA 3TTDA 2FB9A 1QKJA 1J2UA 1N32B 3ETHA 3A8TA 4DXDA 1FDVA 3TMKA 2D1SA 1R4MB 5H68A 2O0JA 1Z6AA 2F90A 3W5DA 2I6UA 1R0SA 1N0HA 3BXZA 3DEHA 5C1PA 1X6VA 5G3YA 4B09A 2O57A 3PBKA 3ZIAA 2FMXA 2PMCA 2C78A 3MYYA 2GCEA 4CG1A 2V4MA 5FBZA 3MTBA 2A5FA 4GL4A 5FO1A 2DPMA 4PWZA 3WSWA 1HG0A 1QZXA 4KHUA 4U8HA 1PV2A 5IH3A 3QPBA 4ER0A 1NW5A 3ALYA 1VSVA 3GUCA 2VP0A 5JAMA 1NGGA 3VSEA 4BNNA 3GV0A 3NETA 1DIBA 1AH2A 4YOWA 3CFPA 2UYHA 2E4AA 2EKDA 3WQTA 3NFAA 1G6Q1 2O07A 2IGIA 1FP7A 4YLEA 1A5ZA 1IG0A 3REQA 4EQZA 1ND5A 1SMKA 3DWGA 1DGQA 2HHQA 1M34E 4NJMB 3AL0C 3WYCA 1V8OA 4BMXA 1PZFA 2XDQA 2A1TR 1DBVO 3E4CA 1PDWA 4B3XA 4LE1A 4J8FA 2H4XA 1LW2A 4XQGA 4EL0A 1Y9DA 1B14A 2EKZA 2EU8A 4N41A 1QYIA 5AOVA 1TKRA 4P3KA 4A2PA 2QTNA 3NOQA 4MVJD 4NENB 3D2FB 4PZ9A 1MGPA 1JDZA 2ODPA 5KJCA 1SCIA 4O4LF 1I2MA 2X74A 3EE9A 5AW7A 3SEQA 1M7GA 1NJ5A 3EOAI 3UJ3X 4XGIA 1SKWA 1FS4A 1LNQA 3BMXA 2FAXA 3E9YA 5HMMA 4B4WA 3U8XA 5CA1F 4LY9A 3U1TA 4BFTA 3QMLA 3DV0A 2FMTA 3UM9A 1W75A 2ZJ2A 1BRTA 3HHPA 4EB8A 5DKFA 3WHIA 3JAMO 1LDGA 2Z09A 5AO9A 2ZITA 5EJ4A 1ODFA 3QEAZ 1L1EA 3ADKA 1YZFA 4BQPA 4IVNA 3RS5A 1UDAA 3EMVA 3DM5A 3GBPA 1XCPA 5AQUA 2PJUA 4UVEA 5CVJA 1C1HA 1G20E 1DLOA 4FD2A 3ZT4A 3AIOA 4LY6A 3T4PA 4H7FA 3DVSX 3QJYA 3VMFB 5CB4F 1OXUA 3ZDEA 3FFXA 4R6XA 3OYCA 2G5TA 3L6CA 4B79A 3ZT2A 4EY8A 3AA2A 3BYZA 2W98A 2HMPA 1CQPA 1UPTA 1U2VA 5THXA 1JQ5A 1XEXA 2JEOA 3TQRA 5AQNA 1IAVA 2RCYA 3OWOA 3ND9A 1YS1X 1C0EA 3ZEAA 3BG5A 3O9RA 4AROA 5GIPE 2WDZA 1ZN7A 4FW1A 3DKKA 1GFSA 1CEYA 1VQ4N 3SLGA 3T38A 1P39A 1W6UA 2V7UA 2G28A 1WA5A 2YFHA 2WVJA 1VE6A 4US1R 5AQXA 2IVZA 3L4BA 3VYWA 3D8NA 1U3CA 3BMNA 3PUZA 2IU6A 5C37A 4J6FA 2WUWE 4CNBA 3LU1A 1Q2XA 3JQDA 2YNHA 1KXPA 5KNBH 1WHSA 3WLEA 4EZ6A 4E08A 1U0GA 3DEFA 3E9EA 5DP1A 1BCSA 5FLXO 2XYQA 3HVKA 4CEEA 2A0XA 4M1ZA 3X1JA 1ZOLA 4IOAL 3WJ1A 1A5SB 3THYA 4NG4A 4QA9A 1DPFA 3WYBA 4RM3A 2KYRA 1QOPB 2JGEA 3R5XA 1P7ZA 3ILSA 4HXEB 4BX9A 2UYTA 1T2AA 3WMGA 2OXEA 2WIKA 2J46A 1U9JA 1EMDA 3E9OA 1A7AA 5AW9A 2PT6A 3I6BA 5IJ9A 8ADHA 2F9LA 1W94A 4KV7A 4ID5A 4RETA 1QR2A 4YJDA 2RGNC 5D5QA 2P5YA 3AFHA 3CNLA 3B52X 4YNQA 3NBAA 2VNSA 1A27A 3KXDA 2YRXA 3O31A 2Y0PA 1M1NA 5K20A 3KLPX 2A35A 1GFWA 4YMLA 5HYVA 1U6KA 2WD7A 2XDAA 2MSKA 2ZOSA 3UCFA 3A4MA 2HR1A 4W5RA 1F48A 1QGED 3KUUA 4CJUA 1RXYA 5F23A 3TM5A 2LTAA 4LZLA 2JEYA 4UU0A 3S2SA 4B9MA 4NF2A 2FRVA 1OHHA 4TZTA 2CJPA 3C6AA 4I1VA 4KO3S 3M3DA 1ZXXA 1D6NA 3AZOA 5CR9A 3IAS1 1MKYA 1J2JA 4Z4GA 4C01A 3T1TA 1HR0K 1W0JA 2O1XA 4G0ZA 3DBRB 3OOYA 4CG3A 2WPDA 3ZJYA 2VAWA 3KHSA 3KFLA 2FWIA 2HBLA 4NBRA 4UQLA 2EYUA 2GPBA 1LBIA 4BO8A 4BE0A 4CL8A 4H6WA 1Q7TA 3WGTA 1P17A 1F17A 1ATZA 3VR3A 1WAJA 1QHFA 2IITA 2WKQA 4NE7A 4A2QA 4IEIA 1A2BA 1V41E 1ACLA 4X66K 3U44A 3QU9A 3L4EA 1M1YB 1V5FA 1WMBA 3PKZA 1KY5A 3V7NA 2VHVA 5IF3A 2PWZA 3FWYA 2VQDA 4J76A 5SICE 4B9TA 2VQEB 3ISNC 1HLDA 4YP7A 2IPNA 2ZUWA 5G0UA 3ADCA 2WE8A 2XYVA 2NADA 5FTMA 5AKGA 4X92A 4MWDA 3UPTA 4DHEA 1RQ2A 2IX9A 4ZO8A 1IBLK 1JLBA 1SULA 4LF9B 1R4AA 4OGFA 4FYHA 5LOVB 3JS6A 4PNZA 2X9VA 3V9ZA 4UNIA 3PUXA 1LCUA 4OMFG 3NM4A 4IDHA 3M8QA 4ZVNA 1UFOA 4INAA 4FP9A 5B5SA 1UOQA 2KTQA 1REQA 1J9EA 2CXQA 1WOQA 3LS2A 4WECA 3OM8A 2WQ7A 1YQDA 5H7XA 4DVJA 4DBVO 4KFTA 4AKIA 2FP4A 2WU8A 4DR7B 4MYTA 2OHGA 3GZ4A 3Q7SA 2PUFA 5L3QB 4PLTA 5CAEB 1VBMA 4BFWA 2PPLA 2YR0A 2FEPA 3FR0A 4C5CA 1V8PA 1MOQA 4X54A 4H0OA 3IKMB 5BN9A 3S7ZA 1KIFA 5E95A 5LMNK 3GWZA 5KNCA 2NU9B 1BAPA 4NZNA 1ETUA 4U8GA 2OCDA 3T4EA 3D6RA 4RDCA 3V1UA 3V8VA 1XMQB 1AKQA 3GEMA 4KHZA 3THWA 3PNPA 2VTDA 3JS5A 3K9LA 4KWCA 1NF9A 2O2HA 3OS1A 3FMOB 2DC1A 3L6DA 4OI0A 2PWBA 2A14A 5JO9A 4X1KA 4ZD6A 4DCOA 3KUDA 2XNKA 1A50B 1GN8A 1GFZA 1Y33E 3D81A 5DM60 1NTOA 3AR6A 3BF7A 4FR5A 2Q0XA 3PQ2A 3AV9A 1YXMA 4RIFA 2EC5A 1FMCA 4KR7A 4H59A 4TSFA 3GJ8A 1U9IA 4A8TA 1ONPA 1T5IA 4L28A 3L05A 1T1IA 3QFSA 4QM6A 3CG7A 3SQ0A 4J2BA 1JU4A 5HIKA 3VQAA 4NYNA 2WV9A 3R3WA 4FFWA 2O8NA 4KRXA 4YORA 1S1WA 2I7DA 1BHQ1 4ZALA 2AFIE 2BGLA 3Q3HA 3TPFA 2FXIA 4DR4B 1DJQA 4O2AA 2JJ2A 2JFGA 1ADCA 3VR5H 5JC1A 4GLFA 1FVFA 1VSEA 3DMPA 5BN4B 1EFPA 2NTNA 4QGAA 5A1JA 4AMYA 3WK4A 1MB0A 1ZL2A 3O9QA 1A9RA 4F4UA 3B3GA 1LY1A 4I4CA 4KBYA 4R5HA 5C0OE 4DEVA 2WICA 5DX1A 1KZ4A 4AMGA 1D5AA 4NWIA 3VAAA 4Z4CA 5IWCA 3DFIA 2RHBA 2QP9X 4KNVA 4HRVA 4Z99A 1CUXA 1TKBA 2B35A 5JVHL 1NLUA 3FWPA 1NJ6A 1TCVA 5D2CA 1IQ0A 5FQNA 1UBRS 2P4QA 4LF6K 4N76A 1CRQA 1OH5A 2AGVA 2EV9A 3HFGA 3PC4A 2BP7A 3MTAA 3JQAB 3HM8A 3ILVA 3AUJB 2KPOA 1H4QA 1STOA 1VKOA 1WF3A 5LC1A 2B1JA 4YRTA 1CE8A 2N46A 3RFTA 3HDVA 1XSEA 2O06A 1AMUA 1IMOA 2GD2A 1PT7A 4DC1A 3PC6A 3IHWA 3NHBA 1Q81O 2AR7A 2P5OA 4JB0A 1A9YA 1LI4A 4KQEA 4NQRA 4TLDA 4R9RA 3LM9A 3M82A 1EXDA 1LW7A 4Q00A 4D9NA 1J0DA 1E2GA 1VPWA 4DA6A 2YXBA 2J07A 4JJ6A 4R2LA 3K3PA 3B2EA 2ZBQA 2WINI 5LB4A 1DTQA 2BGKA 2O52A 1NJGA 3LG2A 1QVAA 4IOLA 5FTWA 2JVIA 2F62A 1BCRA 5CA0A 3QU4A 1AGNA 1NKSA 4N5HX 1AKEA 2FV8A 4ESOA 2WB2A 2WYIA 5KX5B 2NVOA 1QG4A 1OVYA 5TR9A 2ID8A 4EHUA 4FJ9A 1NOKA 2PXCA 3I83A 1YRYE 1M0TA 5B3JA 2B1QA 4BE4A 4Q3EA 1JALA 2B61A 3QLUC 2X86A 2V5AA 3FCAA 2YZ7A 1UMBB 1Y3BE 4IMRA 4PO8A 4Z5XA 4IHJA 1CZ9A 2H1IA 2PX8A 4P4UA 4L73A 2W8BB 4QOSA 1M75A 5EHQA 1BDBA 2XE6A 2I2XB 3OJUA 2R7KA 1HE5A 3IVMA 4IJMA 1WB6A 3HDYA 4XGNA 3VR2A 1JEAA 1KZGB 2MCFA 2LKCA 4JBIA 5FKJA 1E94E 3K9WA 3PWZA 1HFKA 3T9BA 3M8PA 2ITMA 1ZEMA 1HFEL 4LXTA 3NYQA 2YVUA 4FWMA 3DFZA 1DV1A 4XUGB 3M33A 3N53A 4CW7B 1B16A 3TAUA 4F72A 4ZDWA 4DLUA 5T7BA 4F2GA 1KZYC 2YCLA 4IICA 3RTCA 4CJTA 1R7RA 3ET4A 4KI4A 4M22A 1E4GT 2VWQA 3DHNA 4B9LA 1Z45A 2Y4NA 1UH5A 1TQHA 2Z3WA 3SI6A 4A1FA 4AY3A 3HLYA 3L0YA 1VYUA 3JXEA 4ZC8A 2WV7A 4LXYA 5EJFA 4PC1A 1WNSA 1JL3A 5ER9A 3DLKA 3TVTA 2X6QA 3A1WA 2W6PA 4KDEA 3TZCA 4AJ2A 3QU2A 3LBIA 1YZYA 5BWNA 3I05A 2BHLA 2OHJA 1COZA 1R0LA 4W1RA 1YZ3A 4K0KK 1HSOA 3C3WA 3SSAA 1ESNA 1XZQA 3RS2A 1JRLA 1JWAB 1BDMA 5B8HA 1SHUX 9LDTA 5GP1A 3LHIA 5DPMA 3VV3A 3HTXA 2WJVA 4G0PA 5AQGA 4ENVA 2IYUA 3OPXA 1QIEA 2CFIA 2PIAA 1FDWA 2Q3SA 6AT1A 4UQOA 3AF2A 4HRAA 3NIFB 3RYTC 1MCZA 2AI3A 2ZIXB 3DLEA 4YALA 3DTYA 1OXVA 4LOJA 4ACAA 4BBZA 4Q9IA 2I66A 3CSUA 3PFKA 3N2EA 3K9FC 2X5NA 4Q4DA 3N74A 5J4LA 2FSSA 1PE0A 4M9RA 2DUUA 1FMJA 3KXPA 1H8EA 1IATA 1FTWA 3F9CA 4JYPA 4G0NA 1YAHA 1UF9A 3I23A 2YXNA 3B5IA 3LCCA 1Z8HA 3V4SA 1E2MA 3FJ1A 3OIUA 3L1VA 3VGMA 2NG1A 4MARA 2XGOA 3O4JA 2Z6AA 3IP6A 4PSAA 5ADXA 1ZGCA 3EVEA 1RSZA 4D4KA 5ITSA 4KDRA 1EX6A 4R41A 4GP9A 5AFUA 2ID9A 1EXWA 1IUNA 1E6LA 4A2CA 4U9HS 1LNSA 5KQSA 4MYRA 2WAYA 1TRHA 3H5LA 3L2WA 2C61A 2IGTA 3HLKA 1M83A 3TKYA 4NFYA 2X8AA 4BQIA 2QN6A 5CFOA 3TLJA 2F9WA 3PUFA 1TX4B 1XROA 3ED1A 3AJAA 3NAMA 1UWLA 3LPMA 4EG8A 2CDRA 4BP3A 1VCHA 4CHQA 3LX4A 5BPLA 4YP9A 1Y5NA 3SHQA 5AZIA 1SIBE 1E7WA 1DAPA 1VLZA 5CVTA 5LYYA 1ADYA 3QKRA 2CEKA 5EMHA 3SSNA 4F3YA 3MMVA 1JPNA 3EHDA 4LF8B 5T8KC 2SCUA 4HDRA 3OZTA 2AMFA 4NO7A 3DBOB 1MZPA 3QH4A 3CQXA 2IA5A 5DDIP 1UBNA 3MN1A 3K0FB 3HOSA 2XDQB 4TXJA 3ES9A 3ZE1B 3PEYA 3GY0A 1P2FA 2BFAA 4KE6A 1W4CA 3BGDA 4RSMA 2AXQA 4OMUA 4OREX 4YV7A 3L1KA 1NM1A 2YKGA 3B36A 5HX7A 1G5IA 4P7FA 4S24A 3O8LA 3CETA 4Z94A 3UPUA 2BJWA 1G18A 3PUYA 1E5DA 2G1JA 4BXOA 1NJZA 3B6PA 3P9RA 1IWOA 4EJSA 1KFBB 1QFMA 4EPTA 4Q16A 3LYAA 3WWOA 2GD0A 3TNFA 2QA4N 3D8HA 2QLMA 2C4HA 5DYYA 4H5WA 3G5UA 4BNHA 1UPUA 4QU5A 1T1GA 3HL0A 4HGRA 3F5MA 1KAOA 4WKBA 2PZGA 4OHFA 2VHYA 3OEHA 3HV0A 4LJLA 1O0CA 4QAQA 3L84A 5B1YA 2XD4A 4NYMR 3FLAA 2R1ZA 4QOHA 2GX6A 3VESA 2QQ5A 3KZOA 3LV8A 4BO7A 1PJ3A 3FF1A 1T1RA 2G1UA 2VTBA 3JQBC 2CSXA 3NIBA 6Q21A 1DCKA 3RF7A 5BW6B 4E7KA 2W7TA 3N8NA 4AP6A 3NR2A 4AXBA 3IBGA 2Z2KA 3ELWA 4I9FA 3HEBA 1E7MA 2GTIA 1MNAA 4KQKA 3ZSZA 3NZEA 1BZYA 4LYJA 1SCQA 5E9WA 4AJKA 2ZM6K 3L5KA 1QTRA 5SV2A 3GJ0A 4HUFA 2RGCA 3CLTD 4J2AA 1T15A 2FH5B 4PIVA 3PFGA 1U2VB 5DASA 1XEXB 3R9KA 3FVQA 3RWBA 4YVFA 3CVOA 3OETA 2OCGA 4RSHA 3KV1A 2Q9AA 1UXKA 4AJ4A 4OF4A 1V9CA 3BZKA 2Z6QA 1C7QA 1YQEA 4C4PA 2R66A 5K99A 4CJXA 1LJLA 1XCBA 2FCAA 4GAEA 2ZB7A 5BN5A 1YJ5A 2VI5A 4DIFA 3K0HA 4CBXA 4UDXX 4HEJA 4JV5B 3BMNB 3EF3A 3DE3X 4M87A 3NVKI 4XD7A 1WHSB 1QF6A 3RABA 2UZIR 1BCSB 1GNTA 5I7VA 1HRHA 3CNQS 3D1VA 1FNSA 5I7RA 4H4CA 4OKJA 1UDCA 5C31A 4D98A 4YRPA 2DFPA 3ZQKA 2XMCA 2GV9A 2A40A 1H4TA 4D9IA 3Q5DA 5LKRA 3BERA 1LLFA 2H51A 1NU8A 2GBGA 4Q4JA 4ZYWA 3LHKA 3LCUA 4GXQA 3GRCA 1LV7A 4JCCA 5IJ9B 4X20B 3IIEA 4IG3A 2ZUCA 4JLSA 2CVPA 1SBQA 2YIJA 5JV5A 4B71A 1G7SA 1M1NB 1TECE 3UF0A 2IYRA 1LAVA 2DR0A 1C41A 3QEBZ 1SUSA 1D0VA 3FYCA 1XZDA 2QWQA 1YUMA 2WKWA 4YPFA 2QRPA 2I99A 3H2ZA 2GZ1A 4ZO6A 5ERXA 4BP9A 2Q4DA 5ICMA 1JE1A 1QYVA 2EZ4A 2B20A 4IOXA 2Z1DA 2HTEA 4TL7A 4DV5B 4Z1OA 3KQUA 1XDGA 2CUTA 1W76A 1NGCA 1ISPA 2PBFA 1NVUQ 1ZU4A 3FYTA 3LUDA 3CEPB 1JKFA 2ZRKA 2WP8J 3GU3A 4PV7A 2FOXA 3TFOA 2XUZA 2HBKA 1T1SA 1MJNA 3JWEA 4FNAA 4JGBA 4YFVA 3C6BA 1G291 3RVRA 3EZNA 2GFHA 4RVOA 4CTOA 4IF6A 4DDKA 3PNQA 1ONNA 4J1QA 2EFHB 1KI9A 4Q1CA 2ZI4A 5I9BA 4MLEA 3U1VA 1YZHA 3TGWA 2G76A 5JBNA 4DCGA 3CERA 1J53A 1Q0SA 2VHCA 3U44B 2XHBA 3DBLA 1CZRA 1R5OA 2ID7A 4QYSA 4B8AB 2C7BA 3FZLA 3AK4A 3HGQA 1XLUA 4EJ2A 1POWA 3NAGA 3WL4A 2Z3VA 1N5IA 1AY0A 4ZIRA 1MMFB 3CY6A 2HDNB 2GZHA 1PAUA 4HDMA 2ZUUA 4N01A 2XT9A 2G06A 5H81A 4YFUA 2X4DA 3ZGYA 3C74A 3T5BA 4RCZA 1D8YA 3FZYA 4H4MA 1AC5A 2PD3A 5JAUA 1AS0A 3TZBA 1N7GA 5DTJA 1O0BA 4HADA 4Q9LA 1PFUA 4WOJA 3G8YA 2IYWA 4Q02A 1WUJS 2VSOA 3L41A 2WF9A 2XNCA 1USVA 5BNIA 2BCEA 3H5AA 3FY4A 13PKA 2ZAIA 4NHEA 2MDTA 1REQB 5CBPB 4MP6A 4INOA 4C07A 2JJYA 2JBHA 3H8WA 2WLSA 2GNOA 2FP4B 3F9IA 1N8SA 1B6TA 4EF6A 4JEMA 5JS8A 1H3NA 4LF7K 5FLYA 3OLYA 4YHHK 3B3AA 2EP7A 4AY6A 4P31A 3VENA 1I10A 4YA6A 4BFSA 1G0NA 4UXIA 2LD4A 4L3WA 1V9SA 3TFQA 5AJVB 3WNDA 3OCWA 4MR9B 4LYDA 4IJVA 2YV3A 2JGLA 5JRDS 3K59A 4YFYA 1T91A 5CFQA 1WB9A 4U7WA 1YJBA 5DN6A 2AG5A 4EGFA 1ZRSA 4Z0PA 3E8SA 4DNQA 3RS0A 3CE9A 2RBEA 2XKBA 4AF6A 3UKUA 3W0LA 3THWB 4PW0A 5JHGB 2DMRA 2JJQA 3U19A 1U1EA 1IZ8A 2CMDA 2XBLA 4G5YA 4RPJA 2WZBA 1MDBA 4ZGBA 1T3VA 5DGDA 2Y0CA 2XTMA 3WL8A 3V5NA 4HXFB 3AUFA 3HXLA 4X1KB 1DO0A 4ZU3A 4PY5A 2C9MA 4KQIA 1TZBA 4WN9A 3EL2A 3A6LA 4EMBA 4TQGA 2ZTSA 2UUBK 1F51E 1VLLA 4LFBK 2XRIA 5DGHA 4PG4A 2JPDA 4B35A 5EZ5A 3T1YK 1S1VA 4RTSA 1VPEA 4MXDA 2V7BA 2Y8EA 2E9SA 4GOXA 3FE1A 1T8RA 4EHFA 3SJJA 4XJXA 3LT4A 3O9ZA 4BNWA 4O2AB 2JNWA 1QRSA 5AP9A 5B58T 2QNIA 2YWXA 4KRFA 2JFQA 2NYRA 3RAFC 1XTUA 1GR1A 1L5MA 4CJ5A 3T61A 3NWOA 1T36A 1DC5A 1N33K 2ZS7A 2DX7A 4QASA 1N5RA 4D6XA 2CDNA 4CIFA 3SKVA 3ETEA 5JOQA 3ADBA 1O58A 1UJNA 2D4WA 3AF5A 1NONA 4REQA 1PZNA 2Q4OA 3P1GA 3AVMA 1UP4A 1EI9A 1R8YA 3KLGA 5FPEA 4KXYA 4R8SA 4L07A 1DT3A 2R8XA 4X3PA 4FJ0A 5JSYA 4IXNA 4ZHRA 1ZD5A 2XGMA 5FWAA 5BSKA 1VG9B 4EZ9A 1NQVA 1OY1A 1GT91 2L69A 1GCAA 3F3YA 2J48A 2DWPA 4GM4A 5LD2C 2HNBA 2ZJ8A 2I76A 4E5DA 4JXJA 1CE8B 3D54D 4KU4A 3I62A 2XVMA 4JI0K 3F49S 4EOGA 1LBSA 2NYUA 5HMLA 4OBXA 1IU9A 5CH5A 1AMOA 3UPDA 5H16A 4WVFA 4BR0A 1UBLS 2CYBA 3JSAA 2Z1IA 1Z9BA 1P2SA 4OYLA 3ZWKA 4L0DA 2JZCA 5ILQA 4KI0A 5K3EA 5DIZA 3V9XA 3ZJTA 2RGUA 4W6QA 3R9PA 4UM8B 1LOTB 2MMCA 3D4LA 3HN7A 3VQPA 4FVMA 1JSRA 3CIOA 2IDMA 3GP8A 2XHEA 3HJCA 4QODA 3JVIA 4DR1K 4EMTA 3OQHA 1MRZA 5L7TA 5DCYA 2IU4A 3T06B 1OXBB 1XX6A 4B75A 2A1SA 2RBGA 2RKOA 2CJYA 4ZANA 2DE0X 1SXHA 2XOKA 1IKWA 1VJDA 4HN9A 1ILEA 4L9AA 2PT9A 2IXTA 1LRKA 4B6EA 1VA5A 3B6MA 2BE2A 5E3JA 2CHVA 1Y89A 3R3VA 1JL2A 1SN7A 3T5MA 3I4CA 1KFJB 2QL7A 3Q0EA 1M2WA 4IHJB 4M7YA 3BCHA 2WIBA 2E1RA 3D3JA 4MUJA 4K2HA 2HVIA 4HQ6A 2QPLA 4KQFA 3D3WA 4HVAA 2AN1A 4P34A 4C0BA 1U7HA 1MPXA 1KK1A 4AJPA 1GTSA 5F5NA 3U7QA 2HLHA 3WLIA 4L6CA 3KJZA 5BRAA 1HYEA 3OKPA 4J90A 2C5SA 3FHLA 3G2JA 5KVVA 1X80A 2PLRA 2POCA 1A9XA 4Q4AA 5FT9A 3MEQA 4G1EB 3BT7A 4F46A 1NURA 1TW2A 5T41A 1BE8A 5IK2D 1A5TA 1I01A 4YOYA 4E32A 4I50F 1GKIA 3A9TA 4BU0A 3PDUA 1YQ9A 5F64A 1PQWA 4LY3A 1T9ZA 1IPHA 2M6SA 1MRSA 1G5RA 4DTMA 3A3OA 2X76A 4NS4A 1V2GA 3C4JA 3PLAE 4EIWA 3ZXSA 2NO9A 2DOKA 3B5EA 3C7DB 5DNDA 3MMZA 1DQZA 4E1AA 1P9NA 1AK9A 4BRQA 2BZ0A 4CWAA 2B21A 2P1RA 4N5DA 3KD5E 2JIZA 3LDQA 4GEGA 1JFFA 3RIHA 3WJAA 3I9MA 2OESA 5CPFA 5DWVA 3FTCA 2HHXA 1GZSA 4MCHA 3ZBUA 1LPAB 3O2NA 3N3BC 1PP4A 2MSDB 4BFZA 1J24A 2LUOA 1JHZA 3B6IA 1RWNA 1T5HX 1SO8A 2JCXA 3U4QA 5EP1A 3DT8A 4WFBL 5JNVA 3LRXA 3EXEA 4MWCA 2OBFA 5E2BA 1XF9A 1GRQA 2HYDA 1HKCA 4QJ4A 2ZYSA 2FEWB 2IYOA 4JP8A 1HR0B 4LYAA 4PFJA 3MCPA 1TD1A 4OQQA 4EBFA 1Z22A 2IP4A 1U31A 4Q66C 1IG9A 4RCHA 1I6WA 2AEEA 4BRSA 2WONA 3V8MA 3H9GA 1T8TA 2R4QA 4WOPA 4EB0A 2FF5A 1W34A 1R8JA 2GJ9A 2IUEA 3ID8A 2ZSHA 2GVDC 3TLMA 3UH0A 3ST7A 4WXEA 3CJBA 1GGNA 2VRCA 1W0CA 3DCJA 4WZ6A 1KBZA 3R1XA 4DTPA 4X66B 1NIJA 4FJ2A 5K8UA 3QFHA 2CL0X 4Y1FA 1V25A 2MYTA 5KPJA 1SHKA 4OXRA 4H60A 2GCGA 3LC0A 3H1PA 4E6EA 2WU3A 2FHSA 4BRFA 4X45A 4XWOA 3DOJA 4EUHA 1BW9A 4YJ2A 4J0HA 3GDWA 4B9NA 5JATA 4L3VA 1KARA 3M70A 4TMZA 4NBWA 1IBLB 4HBGA 3NUZA 4Z4EA 4NONA 4DCUA 3AM1A 1L4UA 2WSIA 1WUKS 1L4GA 5E7JA 4OLFA 5TQ2B 1YK0A 1ZKDA 5TV2A 5F9HA 1IZ0A 2G77B 1I51A 2IYVA 2FSVC 4HDOB 5CRIA 2UU9K 3IRXA 2I87A 1N6RA 2Q6LA 4ZEOA 2P4HX 1DPGA 1VSHA 3U81A 3AR8A 1OBOA 1K4KA 3HFRA 2O0LA 3KU4A 3OUTA 2BC9A 3UGTA 1V4NA 5T5QA 2FKNA 3NCIA 3L43A 1W93A 4ILJA 2VF5X 4UNQA 4D5EA 2SCUB 4HDRB 3LIIA 1T8WA 3FFKB 3TSPA 1RZ3A 5HTOA 2QS9A 5ECWA 3EXIB 1A72A 2ZI9A 1XR3A 1JGTA 1BJRE 3WDLA 2LSNA 5DYIA 2B99A 4YQEA 2D5RA 4GW6A 2ZBVA 3H5WA 4HDSA 1Q1NA 3GJYA 3QINA 4U00A 1RPZA 2VSXA 2EW1A 3PT9A 1CD5A 5LMNB 2OC4A 4BJ3A 1XDSA 2PY6A 3VO8A 1K6EA 5TGTA 3JZDA 1G4HA 2CZCA 4I4IA 3ROMA 2OQVA 2XUGA 1AJEA 4D45A 3GPDG 2IC5A 4HLUC 1Q57A 4EJSB 4IX9A 4WADA 4BAZA 3K92A 2R7AA 2RH4A 4V1CI 4Q93A 1C9NA 3BWVA 3W8DA 3MOSA 3AOGA 1P33A 5IT4A 3LW7A 3CQ8A 4XSGA 4GOMD 4FFSA 1JYEA 4ILKA 4X84A 1WETA 1ZMTA 4PIPA 5CHIA 2AMJA 4I7FA 4EP1A 4NZ9A 2ZETA 2BT4A 2I65A 3H1AA 5JWHA 4IKEA 4L15A 3OS0A 4DCPA 3F4BA 3UOGA 1CUYA 3I5YA 1RDBA 2Z57A 2EBHX 4UAJA 4MLCA 3B6EA 2J0VA 1VDZA 1XHZA 3U0VA 3UANA 3RWOA 1WQ1R 2Q9CA 4XYLA 2VTBB 1GL7A 5DTEA 3S70A 5EESA 1RT5A 3HB7A 1YE5A 3SKXA 5ALGA 1BVRA 4E09A 3IALA 4BFUA 3O8QA 2XIQA 5LR6A 2MSEB 3HKEB 2W8ZA 1SCNE 4F9OA 4CBVA 3TCKA 3CUSA 4X6UA 3AGQA 3I53A 3ZY2A 1TC2A 3AVWA 2XYRA 4TS1A 4FT2A 4OGCA 1MJGM 5BSHA 5DP2A 3NAZA 5KWIA 4H7DA 2HU2A 3EW7A 3B2NA 3VUFA 1QRTA 2RCNA 4DA9A 5L4LA 5CZ2A 2CBZA 2G0AA 4QXPA 3Q10A 4JIGA 4OXIA 3BFKA 1WU8A 1PSWA 1NAIA 3GVHA 1XF1A 4HVCA 3VI3B 2RAFA 2QPAA 3BIWA 2B5WA 2JIQA 4IDPA 2C8VA 4LF6B 4FMBB 4IEEA 3HA7A 4PWDA 3VX4A 2A5GA 4BE7B 2ZQBA 2H7XA 4NCGA 1HNVA 4NU5A 3ZEUA 4JOSA 1TUGA 1K6XA 5EPEA 2ZJOA 4DCTA 4OGGA 4EH1A 2YJTD 3M1AA 2NVBA 2WOMA 2ZYGA 4LYYA 3Q3IA 5LA6A 1NMEA 3TTUA 2G3YA 4E0BA 1EQYA 1DEOA 5DTMA 4LSGA 1F8FA 2QIPA 3H5TA 5MN6A 1JEEA 2BANA 1AS2A 4N47A 4S04A 5DHAA 2JFWA 4BC4A 1RBTA 3V7UA 1NVWQ 4BJHB 4M7WA 4LNHA 1HT3A 4AKHA 2Q3MA 4QULA 2W6CX 4G0YA 5KYYA 1TQ4A 4Q4JB 4HNUA 4ZYVA 4R51A 3B1WA 1WKVA 1H8HD 3G8BA 3QWHA 3WK8A 2X3FA 4MKIA 3SVZA 1G3IA 1L5OA 5IFLA 2V8BA 1RYZA 2J3IA 1WEHA 5JHHB 4XVRA 4LXGA 1KSGA 2IT1A 3C1OA 4MQLA 2XJ9A 3LAMA 1B0AA 4OGLA 2VH2A 1QVZA 2AUMA 1Z4QA 3E3NA 1YBVA 4JT8A 3DKRA 3ZZTA 2PL9A 1KNQA 1ZSVA 4EP4A 4GMJB 1EINA 2P9LA 1P6QA 1I33A 3GEIA 1Z5GA 2CEAA 4AULA 2HJGA 4M0FA 2H59A 4DIDA 2HNZA 4F38A 2PG3A 3MAQA 5HRPA 1E6EA 1DKUA 1NVVQ 1C9KA 1SB8A 4E15A 3CJQA 4EAHD 2Q2OA 1HFWA 3GJ4A 4P38A 5A2QA 4PBSA 4B5LA 3W6ZA 4TXLA 2ZBUA 4INJA 2OV8A 3QVVA 2QN1A 4DWWA 3GX1A 3CLKA 3TXAA 4TWAA 1UOEA 3V8NA 2XT6A 1FTGA 1C3VA 1XA0A 3DZCA 5KVQA 4R79A 4F6CA 4EA6A 3G6WA 1SKYB 1U2SA 4MR8A 3O3CA 1GEGA 1UWBA 1IPEA 1PT6A 2Y1KA 3CW8X 2ABWA 1OGJA 1BUPA 2EW2A 4U6NA 1HQYE 3BRSA 4DY4A 1B8VA 4DE5A 4OSEA 1PS8A 5I4CA 4H5RA 2V0GA 3MX5A 2JDID 4ZIRB 3UV7A 1FU8A 2PZMA 2ZBGA 4JK9A 4BNLA 1B8NA 4AURA 1UINA 3OQOA 2H9AA 1Y4UA 1V6SA 2B37A 2X5OA 4NY1A 4RJJA 2HO5A 4AT1A 2G6BA 4MUYA 1GV1A 5CVCA 3NP9A 5HROA 4JRQA 4EX7A 3DP9A 4GQBA 3GVXA 4K0KB 1Y7IA 4B4VA 1VKHA 4JI3K 2IBSA 3UQYS 2LXNA 4JH0A 1YI8A 3TKAA 3OCJA 2I3ZA 2GK6A 2X19A 2VYNA 5IAOA 3MJRA 4MLDA 2G0NA 3I6MA 4Z9BA 3VKUA 4F93B 3S8EA 2HHSA 4G9ZA 3ELDA 5AQEA 3IE2A 4D3DA 1DARA 3AO1A 1AE1A 1PNTA 3CZ5A 3L7JA 3OX4A 4DEYA 1GG2A 4W1SA 1QTNA 8LDHA 2CLOB 3IMEA 4IQ4A 5BT8A 3ZHSA 3WBFA 4G4GA 2P90A 1WXWA 2V7ZA 3UUEA 2WUEA 1U2DC 4TYQA 4NIMA 1ZYQA 4XWTA 3V1TC 2VHXA 2FEAA 5KTPA 4YXFA 3UB5A 4KFCA 4HGNA 4O59O 3QNWA 5LZ7A 3PFCA 4B2IA 1T9CA 4X6YA 4B31A 5A05A 5JXWA 4Z0HO 1VPTA 2I2DA 4M2LA 1UODA 4DYVA 4MPRA 4HHEA 2OOSA 3C8MA 4MUAA 4K8RB 3HB9A 3K5HA 2IYEA 3UKUB 2WFMA 4G0OA 1V5GA 2FP3A 2JAPA 5AI4A 3QTLA 4KPFC 4CKXA 4B08A 4CHOA 4HBZA 1Z5PA 3GLGA 1PW5A 3G0ZA 3SUNA 4YOXA 1RHJA 2VK8A 3OQPA 4MWGA 2HJHA 1LVGA 2HBYA 3QFTA 5JD5A 4EKEA 2QN7A 1JZTA 4BNYA 4OXXA 2HZ7A 1KIMA 3IV7A 3S8YA 3K8OE 4PN3A 1UUFA 1PR3A 3KEFA 3FDXA 1LSOA 1QCYA 5JLFA 4TVBA 5DLYA 3BQMB 2JGIA 4RW9A 1UK9A 2R96A 3NXKA 2BSAA 4OKIA 1WTCA 1BI4B 2LDXA 1CETA 3KOYA 4EG5A 4MR7A 2WA1A 2ZXFA 2XRZA 4R40A 3EN0A 1DUIA 4MIOA 5JH7F 3HCAA 2G40A 4G67A 2BFBB 2GLUA 4IOCL 1G21B 5EU7A 4WKCA 4UE2A 2O1SA 5C25A 2R8OA 1AB5A 3FHCB 1P1RA 3N2KB 4I9QA 3WLHA 3EQ6A 1EK5A 3A26A 1FRQA 4DPMA 4L8WB 4E12A 3SE0A 3WQHA 2RAPA 3ONDA 2R6CA 5A04A 5J2MA 3JALA 4LHXA 2HN9A 1JIQA 1W2BM 1YSCA 1T4GA 1X1DA 3UHFA 1T36B 2WR8A 3VHLB 5D87A 2VT7A 5AVKA 4GF5A 2VDUE 1EWQA 5I45A 3OPYA 4DDVA 4REQB 3PKJA 4GRDA 4OHKA 3RYHA 2IIBA 4RNCA 4IG4A 3BWCA 4OU4A 5HBGA 2A9QA 3PGMA 4CEQA 4JXXA 3ZNNA 2BKAA 1T0BA 5CZ1A 3KJIA 1RGIA 1MB4A 1CXUA 4W5WA 1Z4PX 3VQDA 3PI6A 4PS1A 1HGXA 3IHKA 1OBCA 4I5DA 3ZE0B 4I4TA 2I7XA 1V8ZA 5K0BA 3GYGA 2V7WA 4IF4A 2DAPA 3VR4A 4PYJA 2C5AA 4XCXA 2AXPA 4TWZA 1U45A 1GU0A 1QR6A 1BS2A 2P27A 4GI3A 4K9OA 1T7PA 1TK2A 3RS9A 2WFZA 5EJ6A 4G0WA 4MRMA 3VQ7A 5AOCA 1SG9A 2B1GA 2WJYA 4ND6A 1FP4A 3TF5A 5AW3A 1JHRA 3N39C 5A3JA 1ZINA 2FMKA 4JIMA 3UAVA 2P9SA 3CPJB 4XPIA 1J1IA 5KHAA 4FKZA 4KIUA 3C3CA 1EVYA 1LUAA 3ECAA 2MR6A 1P8JA 3T19A 1KOLA 2N47A 2DPGA 5FI5A 221PA 4NLCA 3D5QA 2WC1A 1VIYA 4F2HA 2ZM6B 3BDAA 2RGYA 5CT9A 2AOUA 4QATA 2DBRA 3V2UA 5B58C 5GADl 5JCOC 2QD1A 1UWKA 4B3FX 1D9DA 4M1MA 2VDWA 1DC4A 1CSEE 3EQ9A 4C4YA 2XQIA 1AHPA 5J40A 5AKYA 1R4NA 2R62A 3ZHUA 3QPAA 1N8RO 1S2IA 4GYKA 2PH1A 3RSLA 1XTZA 2VSNA 2P1DA 4CEDA 5DLPA 5B6JA 2CT8A 3A3PA 3FZQA 5HSGA 4F3RA 3GP3A 1YCGA 4YUZA 5LZ8A 3QQPA 2E6LA 4UHBA 4FX5A 1XT6A 1NPYA 3KJXA 5EFOA 5UKDA 1R88A 1A9XB 1J23A 1VSJA 2J4CA 1X1RA 1S3SA 1HV8A 5EWLA 5AVWA 4CEOA 1CXZA 2P9ZA 3I32A 2OXFA 3E9MA 3QE4A 1N2BA 1XPJA 4NR0A 5K8IA 4RW8A 1USKA 3ZQJA 4K03A 3BH6A 4OHVA 2V65A 1QM5A 2B9EA 1NNEA 2C9BA 3HEAA 3E23A 4E21A 4P3PA 5KTTA 5DMRA 3M2TA 1L7XA 1RAEA 3ZY5A 1DV2A 2PZLA 3M6XA 4DFKA 1RLJA 1ZD1A 4QYMA 2FLKA 4OGWA 4YAOA 4EGQA 3N8DA 3S28A 2LCQA 3I37X 1JFFB 2ZYVX 3DNPA 3DZJA 3OVNA 4H5NA 2IPAB 3TEJA 3IUBA 3H5IA 3RUIA 3CPSA 4EFLA 3J80A 1IHXA 2V8OA 1QGOA 5K6AA 5JSUA 3K09A 2FUG6 5BMVA 1XRMA 1X87A 4D42A 3CLUD 1TUIA 4MW4A 2R2AA 3U4QB 3NYRA 4V0RA 4QO7A 4QPJC 3H2HA 2IUFA 2BDEA 3F8TA 1ADBA 4KIFA 3FFWA 2QQGA 3KKEA 3JVEA 5CEFA 1X1CA 4DLAA 1KC1A 4YMIA 3AF6A 2VJLA 4RORA 3ZK7A 4JI6K 1ZX1A 3MTQA 1VQ1A 2ODNA 3INTA 5K3BA 2GEFA 1MORA 3MT9A 4CLRA 2WMOB 1ST3A 4JZKA 3FW1A 5L6LB 1EKEA 2HUNA 3V9AA 1RYYA 1PL0A 4KFRA 4AX8A 5HOQA 4D9KA 2IEAA 3TUJC 2QXYA 2VZ8A 2CD7A 3HGTA 4W9MC 5FO0A 3GUUA 3KT6A 4WZBA 1Y3HA 1VKJA 2POQX 1G64A 1KEVA 2GHQA 2HYIC 4ZV4A 3G9QA 2J3EA 4C04A 2WAMA 5AW0A 4RGVA 1ACMA 3CLUC 3C16C 4IZ9A 3G9ZA 4RD6A 3IT3A 2PE5A 3W3AH 1HTWA 4M3TA 3TFWA 4YJ2B 3U7JA 4JA0A 2XKJE 2VDNB 4MWTA 3EASA 1L1FA 2VDRB 3JYOA 2Q31A 4CZ2A 1SXJA 1NVDA 3ZY3A 1QJ4A 3E84A 1B00A 3N8IA 3K2EA 2OQ2A 1G3QA 1N36K 1BH2A 2HRRA 4DMGA 3E8MA 1XVIA 3MF4A 1DT9A 2V6IA 3PU6A 4K46A 3VYVA 1KU6A 2BRUA 1P4GA 4W7SA 2RIRA 2ZUBA 4B3SK 4DB3A 2QZ4A 1U3FA 4FSXA 2Y67A 4DSKA 2ZUTA 2HRQA 2REQA 1LF5A 2Y0DA 4GI2A 4LF7B 1FIUA 4YHHB 4R9SA 2YIDA 3VNSA 3ENQA 2A30A 5IYZF 2YMMA 4DS4A 2YVKA 5C1IA 4B9QA 1B15A 3OIWA 3CUEF 4YCLA 2OUKA 5ECGC 1LEHA 1N2ZA 3FMPB 4HWSA 1ULUA 2O8BB 4BASA 5FR1A 4UEOA 5H82A 4HDSB 1X9WA 1WLJA 5KZMB 1RTTA 5SY9A 3CC2N 1B8PA 1KVRA 3MJHA 3OTIA 3EG5A 4E4RA 2F3QA 2PX5A 2W2LA 2YV2A 2BFFB 3V9UA 4CM5A 2HQBA 2D5BA 4XDZA 3BDIA 3AVLA 4BN5A 3TQSA 2JAXA 2P5GA 1IVYA 5DX8A 3UNXA 1Q50A 2ZUVA 2B0CA 4ZQEA 3PR3A 4LY0A 1AD2A 3GCXA 1KDTA 3RARA 1YMQA 1GLFO 2IS2A 1EH5A 3MTJA 1SS6A 4X00A 4IDNA 4HPXB 1JKHA 2I54A 1E66A 3OOJA 2UUBB 2J67A 2C9CA 4LFBB 1FRFS 1EBBA 1T9BA 2GRAA 4QTZA 5D6NA 3ZT3A 2VH5R 4JMLA