3CG7A

Crystal structure of cell-death related nuclease 4 (crn-4)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
296
structure length
296
Chain Sequence
YQHCPFDTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFERVLPLVVTTIRAGDFRLEMYGVCRYCRKGMDVCGTSHQQTPHDLYKNEEDPIHFAKIAGYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, apoptosis
molecule keywords Cell death-related nuclease 4
publication title Crystal structure of CRN-4: implications for domain function in apoptotic DNA degradation
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 89
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cg7A01
2QKKA 3QETA 1REVA 2HNDA 2VWJA 4M3XA 1BIZA 1S1WA 1J53A 4WE1A 4B3OA 1HYSA 3T3FA 1RT4A 4ID1A 3RR7A 1B92A 2ZE2A 1WSFA 3HSTB 4UQGA 2IGIA 3RMBA 3OS1A 3VQEA 1ZBUA 5FROA 3NGIA 4E7HA 3ZSOA 4HCBA 3VQ8A 3U6FA 1LWCA 3HPHA 3OS2A 3AVCA 4B8AB 3KLEA 1WAJA 2BDPA 1D9DA 2HB5A 2YV0X 4AHVA 4B08A 4DTPA 3ZSZA 4CE9A 2Z1HA 5FRMA 3L2UA 4F3TA 4GMJB 1TV6A 3QEXA 1EKEA 4CJSA 2IAJA 1KRPA 1TKTA 1TAQA 4QCLA 4N76A 4RW4A 4MQ3A 3LPUA 4DFPA 1NKCA 1N6QA 4CFCA 1LW0A 2IS3A 1S5JA 4Z4CA 2B4JA 4FXDA 4KHSA 1JLEA 4FLXA 5CZ2A 4CJKA 4Q0BA 4F2RA 1VSDA 5T7BA 4M3RA 1SUQA 3L3VA 3MEGA 2RKIA 1D5AA 1VSMA 3NGYA 4EP4A 3K5LA 5J2NA 3TAEA 1X9MA 2Z1GA 5D3GA 1CZ9A 2P5OA 1KCFA 4CGIA 3OVNA 1NK9A 3NHGA 3AVJA 2F96A 2W42A 3CFRA 1CZBA 2XY7A 3V6DA 1SV5A 3OYHA 4CIGA 3ZSYA 3I0SA 3ZT1A 2YNGA 1WAFA 3LP2A 1TL1A 3OYMA 1IG9A 1BQNA 2IDOA 3AO1A 1X1PA 3C95A 2Y1JA 1TKDA 4J2AA 1JLAA 3CG7A 4I2PA 4Z4EA 1RT6A 4G1QA 4H8KA 3ZSVA 4FZZA 4Z4IA 4HTUA 2DFHA 1C1AA 1W0HA 3QERA 1T8EA 3CFPA 1DTTA 4E7KA 1LWEA 2D0AA 1FKOA 4LH5A 3LWMA 3OS0A 1FXXA 3SQ0A 3VQAA 2ETJA 2DFEA 3OJUA 3AVMA 1A5WA 3V1RA 2BANA 3VQ9A 3LZIA 4ELUA 3HXMA 4CIFA 4M45A 3KD5E 4CJ4A 1WSEA 3V81A 4J2EA 3KK1A 1NK8A 1J9AA 3OYEA 1VK0A 4IG3A 1HRHA 2HW3A 2YHBA 3D45A 3DRSA 3KLHA 1WNSA 2XO7A 4DSFA 4HUEA 3TAQA 4ZTJA 1ASVA 4LY7A 4CF1A 3D0PA 2YNIA 3DYAA 4JS5A 2VG6A 4DSEA 4FK4A 2HHVA 4FJXA 2A1SA 3M8QA 1BIUA 2RN2A 4BE1A 1WLJA 4OKEA 1NK7A 3ZT0A 3RMDA 3ZT3A 5KRSA 2ZD1A 4IFVA 4Y1CA 3DLBA 4GW6A 1RTDA 4KHNA 3HVTA 4DQIA 3AVKA 4OLBA 3AVLA 3F73A 3NAEA 3S9HA 2G8KA 3OYFA 2RF2A 4CJRA 2O4IA 2E6MA 4DTSA 3KLGA 4BWMA 3L8BA 5KI6A 3VQQA 4CHQA 1U4BA 1IKYA 3S3NA 1JL2A 3TARA 1Q9YA 2G8HA 1NK6A 1GOBA 4JRQA 4N41A 1WN7A 2OPQA 2X6SA 3ZCMA 1TKZA 3S3MA 1T05A 2FBVA 3I8DA 2PY5A 4EZ9A 1UAXA 2GUIA 3C6UA 2G8IA 3AA5X 1HQUA 4CK3A 1HNVA 3NFAA 3DRRA 4O4GA 1WSIA 2G8FA 2EHGA 4DSKA 1NJWA 2HHTA 2WONA 3VQDA 4H4MA 2XY5A 4H4OA 1UA1A 3RMCA 3T1AA 2HVHA 3G10A 3NF9A 3ITHA 3M8RA 3PX4A 1SL2A 4KHQA 1RT5A 3SQ4A 4CGDA 4CEDA 4FCYA 3HO1A 4W5OA 3NGZA 4FJ9A 4F4KA 4DTNA 3V4IA 4KTWA 3V9WA 1RBVA 1CLQA 1C0MA 1IKXA 1IH7A 1LW2A 4FW2A 4PWDA 4FM2A 4CFDA 1R0AA 1RTJA 4PUOA 3ZT2A 1ZBFA 2NUBA 1NJXA 4CF2A 1LAWA 1K6YA 1C0TA 4E3SA 2D5RA 3B6OA 4B9MA 1BI4A 3HP6A 4DSLA 4I9QA 3NE6A 3DI6A 3C94A 4B9VA 3WNHA 4ICLA 1ASWA 4O0JA 5E41A 1NKBA 2HMIA 3KJVA 1VSLA 2E6LA 4B9UA 3SJJA 3AVBA 1S9GA 3P5JA 4CESA 4OVLA 5HRNA 4E19A 4DTXA 4KTQA 4CJPA 3AVNA 1U45A 4O44A 3CQ8A 3OYIA 2G8WA 4CJVA 2HHXA 4KB0A 4CJUA 4JRPA 3RR8A 3V1OA 4I2QA 4KKOA 4O5BA 4DU1A 3S3OA 4FJLA 3OY9A 4M3YA 3VQCA 4O0IA 3VQ6A 2HHQA 4DG1A 1BCMA 3G0ZA 5C42A 1NK4A 4N5SA 3WNGA 2Q3SA 2KZZA 3TI0A 3HM9A 2Z1JA 1W9HA 3QNOA 4AH9A 4CJ5A 5HROA 2DFFA 4CF8A 3AVFA 3K5MA 3P1GA 1U47A 4NYNA 4FJ7A 3MAQA 1TK0A 3NF7A 1J54A 1U04A 3ASMA 4FJIA 4FJ5A 1D9FA 3DRPA 5CZ1A 2OA8A 4BDPA 1JXEA 3LZJA 2D0BA 4DF8A 3MXMA 1JXBA 1FK9A 4FM1A 1RCHA 3DOKA 4AHUA 3LAKA 4AILC 1RDBA 2X6NA 2HVIA 1UOCA 4DFMA 1VSKA 3QIPA 1KFDA 4IDKA 3KLFA 1BCOA 3OYCA 1C0UA 4B9LA 2OYQA 1VSIA 4DMNA 3ZSWA 4FJGA 1RT7A 4RW8A 3SUQA 3LP3A 3TWHA 4CK1A 3V1QA 2G8UA 1YTUA 3AO5A 3VQ7A 1A5VA 3AVGA 1EETA 4KV8A 4E89A 3LAMA 1HYVA 4KHUA 3NBPA 4QAGA 2R7YA 3SUOA 1L3TA 3TAFA 1NOYA 4IG0A 4Z4HA 3HP9A 3MXIA 3IRXA 4RW9A 3V9SA 4FJJA 4CHOA 3OYGA 1VRTA 4HUFA 4I9LA 3VN5A 3RTVA 3TABA 3PX0A 1NJYA 5JS2A 2F8TA 3EY1A 3LP1A 1SL1A 4DTJA 4TSXA 4ELTA 3AO3A 5SZTA 4J2BA 1NK5A 1SKWA 3AO4A 2VG7A 2KZMA 2DY4A 3I0RA 2B6AA 2YKMA 4CFBA 4XIUA 1WSJA 3NH1A 1GOCA 4W5QA 2GV9A 3O3FA 4KHWA 1L3VA 4LSLA 1B9DA 3QLHA 3WNEA 1Q8IA 1LV5A 4FW1A 4CCHA 1SKSA 3RMAA 5J1EA 1KVCA 1HNIA 3ALYA 4DQRA 5HRPA 4FLWA 4FLTA 2Y1IA 3SI6A 4FJ8A 2KFNA 4B9NA 3HVRA 4IFYA 4KO0A 4CHPA 2KFZA 4FYDA 3OJSA 4CJEA 1TL3A 3PUFA 3DLHA 1KVAA 1VSEA 1HYZA 2HNYA 3K58A 4FZXC 3DLRA 4KPYA 4NCBA 1XC9A 4CEEA 3PO5A 3LALA 4FVMA 5C24A 4DLGA 4CF9A 3THVA 4BWJA 1I39A 4CHNA 3M8SA 1TK8A 3V9XA 3K57A 4OGCA 4DU4A 2X74A 1Y97A 3AVAA 4JS4A 4KTZA 4E7JA 3OYBA 1KFSA 1ITGA 5JS1A 3NH0A 1VSHA 2ITGA 2OPRA 5DMRA 4Z0UA 3QEIA 2WOMA 4C8NA 3FFIA 4OPKA 3HPGA 3NF6A 4Y1DA 4CEZA 3MECA 4CJLA 4CJFA 1QE1A 5DK5A 4J2DA 4CGGA 4DTRA 3SPYA 3VQBA 4CGJA 4CEOA 5KGWA 4KI6A 1BL3A 3AVIA 4DFKA 1LWFA 2QK9A 1RT3A 5C25A 3SQ1A 4OKJA 1TKXA 1YT3A 1B9FA 3AV9A 3O3HA 4N56A 1CXQA 2OZMA 2PYJA 3A2FA 4B8CA 5J2QA 3QO9A 2PZSA 1S1UA 2XY6A 4CGFA 3ZT4A 1QSLA 3HK2A 3QINA 4CJTA 4DQQA 3KIOA 2VG5A 2FBYA 4CFAA 2A1RA 1SKRA 1TGOA 2HNZA 4Z4FA 4HHTA 4CERA 4C8OA 2HHWA 2QXFA 1DLOA 4RW6A 3B6PA 3TAMA 3TR8A 3E01A 1JKHA 1Q9XA 2HHSA 4L8RB 4DSIA 3EZ5A 2KTQA 2LSNA 3L2VA 3BGRA 3NCIA 5SWMA 3OYAA 4M3TA 4CJ3A 3O3GA 2JGUA 5HRSA 1YVUA 4AHTA 4FJMA 4N47A 1KSPA 1TAUA 3SUPA 4KFBA 1EXQA 4B9SA 1XHXA 2P5GA 4K8XA 2IOCA 1QQCA 1RBTA 3H08A 4HUGA 3SZ2A 3SPZA 5HLFA 1RDCA 5CYMA 1XWLA 4DSJA 1C1CA 1S1XA 4MFBA 5J2PA 1ZYQA 4NYFA 3UIQA 3P83D 3L2WA 3OYDA 4CF0A 4FJKA 1C1BA 4CECA 2P1JA 3ZSXA 4RW7A 4ID5A 1GOAA 1JLCA 1RT2A 1JLQA 3AA4A 3JSMA 4BDZA 4ELVA 4NCAA 3KKRA 4FJNA 1RDDA 5KRTA 4CEAA 1FKPA 1RBRA 2VWKA 4CEBA 3TAGA 5FRNA 2FBXA 1IO2A 4F3OA 1S6PA 5I42A 2HHUA 3M8PA 3AO2A 3KD1E 4E1NA 4KAZA 4CK2A 4FLUA 3V9UA 3RRHA 5KTQA 4W5TA 3QEVA 1N5YA 4KB1A 4OPJA 4CEQA 4BDYA 4NCGA 4I7FA 1RTIA 3LPTA 4EP5A 4DF4A 3QNNA 1ZBIA 4E7LA 4CJQA 4FLVA 3CM6A 1MU2A 4O55A 4CGHA 1HMVA 1RNHA 4YNQA 3SV4A 4F2SA 4RG8A 4KI4A 2YNHA 3K59A 5KGXA 4AHRA 4AHSA 3RRGA 2DTUA 1U49A 2XRIA 2ZQBA 3ZSRA 3O4QA 4KHYA 1JLFA 3MEEA 3NDKA 3LDSA 3K2PA 4DTMA 4DTOA 4K8ZA 3IS9A 1RILA 1L5UA 4B9TA 4KREA 3JYTA 3C6TA 1X9SA 4M3ZA 4DQSA 3DLEA 4QOZB 4GVMA 4M41A 1KLMA 3U3YA 3HJFA 2B5JA 4EZ6A 1BI4B 4OJRA 3OYJA 1C6VA 4FZYA 1TVRA 3DLGA 3ZSQA 2YKNA 1RBSA 3OYKA 1QTMA 2E4LA 4M3UA 5CYQA 2FBTA 1S9EA 2XY8A 3DMJA 4YFUA 3AA3A 1F21A 3VQ4A 4DFJA 3TANA 1QSYA 1KLNA 1JLBA 4DS4A 3ISNC 1RT1A 2GBZA 3HT3A 4IKFA 3SQ2A 3K5NA 4E1MA 1ASUA 2O4GA 2I5JA 2XHBA 1Z25A 4CHYA 2P51A 5I3UA 4M42A 1S1VA 1L3UA 4FM0A 1NKEA 1U48A 3KKSA 5HRRA 3DLKA 4PA1A 4F8RA 4R5PA 4DS5A 5FDLA 4DWIA 2Z1IA 4E0DA 1BHLA 3F9KA 4LH4A 4C8MA 2YHAA 4HVJA 1WSHA 3AA2A 1EP4A 4CEFA 2BGGA 3VA3A 1XHZA 1QSSA 1QHTA 1JL1A 2RPIA 4FK2A 3QEWA 5HP1A 1T03A 3OYNA 4FLZA 1TK5A 4LD0A 3VQPA 4CHZA 1KVBA 1RBUA 3TAPA 2G8VA 4KRFA 1BISA 3VA0A 1HQEA 2ATQA 4DLEA 3ULDA 2AJQA 1A5XA 1LAVA 2PYLA 3L2RA 3QIOA 4FLYA 3SCXA 4W5NA 3KTQA 4DQPA 2KQ2A 3L3UA 3IG1A 1VSFA 3RWUA 2YNFA 1IKVA 3NF8A 1NJZA 1CXUA 2D0CA 3QEPA 4HCCA 3K5OA 3KK3A 2F8SA 3O4NA 4PQUA 3VQ5A 3LWLA 1I3AA 1NOZA 1S1TA 5CY4A 2JLEA 3V9ZA 1BGXT 3OYLA 1RDAA 2EX3A 2BE2A 3CM5A 4ZTFA 1D8YA 3U3GA 4FK0A 3IAYA 2QKBA 1RTHA 4IBNA 5K14A 3SUNA 3PY8A 4Q5VA 1L3SA 1X9WA 2OZSA 1XI1A 4BE2A 3QESA 1G15A 1T7PA 5HBMA 1IKWA 3MXJA 4Z4GA 3DM2A 5EU7A 1ZBLA 4C8KA 1WSGA 2KW4A 4LSNA 4DU3A 1SL0A 3PV8A 4W5RA 1NK0A 3HPOA 1O1WA 4ZHRA 1KTQA 1J5OA 3BDPA 4PY5A 1VSJA 2OPSA 4M3WA 3SNNA 5J2MA 1UA0A 3PX6A 1VRUA 1S6QA 3EYZA 4FJHA 3SYZA 4OKKA 3HL8A 1BQMA 4BACA 3T19A 1ZBHA 4CJWA 3WNFA 3HYFA 3L2QA 3DOLA 1DTQA 2X78A 4JLHA 4BE0A 3NH2A 1EX4A 4C8LA 3LP0A 4AHCA 4E7IA 3MEDA 3KK2A 1HJRA 4DTUA 3AVHA 1UWBA 1JLGA 2FC0A 4CIEA 3PO4A 3LANA 4OLAA 1HPZA 2OPPA 3CYMA 3CFOA 4OGEA 3SV3A 1QS4A 3KLIA 2IC3A 1Z26A 1YTAA
chains in the Genus database with same CATH superfamily
2QKKA 2HNDA 5AQZA 1BIZA 1S1WA 1J53A 3CD6N 3CXCM 1RT4A 4NLBA 3RR7A 1C0FA 1Z6RA 3VEWA 3OS1A 5BN9A 2Q1NA 4H0XB 4HWIA 3VQ8A 3AGRA 4ISFA 2D0PA 4AHVA 4DTPA 2Z1HA 5LL6Z 3L6QA 3QEXA 1MWMA 4JHDB 4I6MB 4UY8O 1TAQA 3TSQA 4G9ZA 4QCLA 4RW4A 3MN7A 1N6QA 4BR2A 2IS3A 3GE1A 3ID6A 1N33K 3IMXA 4CJKA 3L3VA 4DR4K 1D5AA 1VSMA 3NGYA 3BZCA 3QMLA 3NHGA 3AVJA 1XNRK 2W42A 1QZ5A 3V6DA 2XY7A 3OYHA 3C7NA 2VYPA 3ZSYA 4YORA 5C15A 3AO1A 1M1KO 4LFCK 3VTIA 4Z4EA 3CG7A 2HBJA 4G1QA 1IG8A 4X62K 2DFHA 1T8EA 1LWEA 3MK6A 3LWMA 3OJUA 4FWNA 4ELUA 4DR1K 4B1VA 3HXMA 1NMNA 4M45A 4CJ4A 1WSEA 1YIJN 2F9TA 4DV3K 1K8KA 3OYEA 1VK0A 4ZTJA 4DR5K 1T44A 2FLOA 1ASVA 1T3VA 4LY7A 1QHAA 2VG6A 4FJXA 3ZETA 2CH5A 4BC5A 2P9SB 3SBGA 4OKEA 2VGMA 1NK7A 3RMDA 3ZLJA 5KRSA 1OH7A 4JEPA 5BREA 4GW6A 4KHNA 4NLCA 2RF2A 2GWKA 3MX5A 1BOTO 3L0QA 1U4BA 4BGAA 4N41A 3ZCMA 4EZ9A 4OPHA 2A5XA 4L3QA 4CK3A 1HNVA 4GV9A 3FFKB 4ILJA 4DSKA 4U67L 3PSIA 3C7NB 2HVHA 3PX4A 1SL2A 3ITHA 4KHQA 4CGDA 4FCYA 5BPLA 1ATNA 4O8KA 3PIOL 1VQNN 1NGIA 3V9WA 3W0LA 4A2BA 1VHXA 1R0AA 1RTJA 1NJXA 4H5WA 1K6YA 5E26A 4BC2A 3B6OA 4E3SA 4DSLA 1K8AO 4I9QA 1TYQA 2YX6A 1K8KB 3O80A 3WNHA 4B1ZA 2HMIA 3KJVA 2E6LA 4IEEA 4E19A 2ZWHA 3OYIA 1VQ7N 2G8WA 5AZIB 4CJUA 5HL7L 1GLJO 3V1OA 5AQOA 4DU1A 4FWPA 4BRFA 5BPMA 4JKFA 1GLEG 3VQCA 3VQ6A 3G0ZA 4IDHA 4YOYA 2P9PA 4N5SA 2Q3SA 1ATSA 3AAPA 3HM9A 1NGHA 4BRPA 1M90O 4CF8A 1U47A 3W3DA 1TK0A 4DUYK 4FJIA 3H45C 3DRPA 3THWA 4CZFA 4MDAA 4F9OA 4BC3A 2HVIA 1UOCA 1U2VA 3QIPA 4IDKA 2W41A 2V52B 4LF5K 3ZSWA 4DUZK 5KPZA 4B9QA 3BF1A 4CK1A 1A5VA 4KV8A 4E89A 1LOTB 3SUOA 3TAFA 1NOYA 3HP9A 4RW9A 1VRTA 4HUFA 3RTVA 4CD1A 4DTJA 3H46O 4ELTA 4J2BA 4J8FA 2W40A 1YI2N 2KZMA 2DY4A 1YJ9N 3I0RA 3O8MA 4ILGB 2GV9A 4KHWA 4AM6A 4NXMK 4O5FA 4LSLA 4BVPA 1GLDG 3QLHA 4LFAK 4JKGA 1KVCA 2KLAA 2VWBA 5HRPA 1D4XA 3D7EO 3HVRA 4A57A 5BRHA 4CJEA 4IO8A 1VSEA 3C0BA 4FSVA 3VTHA 4BWJA 1I39A 1IJJA 3BZKA 4CHNA 3M8SA 3PLAA 3V9XA 3K57A 3THWB 4OGCA 4DU4A 2X74A 4JS4A 5I9EB 3GG4A 1VSHA 2ITGA 5DMRA 4C8NA 4OPKA 2PFUA 4CJLA 4CJFA 2IVNA 1QE1A 2P9UA 1VQKN 4EHUA 1LWFA 1RT3A 2OCEA 3O6WA 1B9FA 4N56A 2ZJPL 2JWLA 1O13A 2DPNA 3J7ZO 4M7XA 3ENHA 4CGFA 3ZT4A 2XY6A 2A41A 3QINA 4BR7A 2A1RA 4CERA 3KK7A 2QXFA 3B6PA 2KHOA 1WBBA 3NCIA 3MCAB 5SWMA 1HNXK 4JKAA 2JGUA 4AHTA 3AGKA 3CCSN 3SUPA 2P5GA 1RBTA 1RDCA 1XWLA 1EQYA 4MFBA 4NYFA 5FPDA 3P83D 4CF0A 5F2RA 4FJKA 4CECA 2P1JA 3ZSXA 4BG8A 2NRVA 1JLCA 1GOAA 3U4LA 4NCAA 3DXKB 2BUPA 2QWLA 1NJIO 4CEAA 1T6CA 4CBUA 4CEBA 3WXIA 3HOSA 2HHUA 4E1NA 5KQDA 4KB1A 4EP5A 3QNNA 3D2EA 5KQ8A 2P9UB 1HMVA 4CGHA 1RNHA 1S22A 1VQMN 3FZHA 4RG8A 3BP8A 5BR8K 5KGXA 4EIAA 1VQ4N 3VEOA 4H0YB 3O4QA 3F9MA 3NDKA 4DTMA 4DTOA 5LMUK 1GLLO 4K8ZA 4M3ZA 3VOVA 4M41A 3FZKA 2QXLA 3HJFA 1C6VA 3DLGA 1RBSA 1QTMA 2YHWA 2ZJRL 1S9EA 3DAWA 3HSCA 3DMJA 4X66K 3VQ4A 1QSYA 1JLBA 1NGAA 4KBOA 4IKFA 4JI1K 3K5NA 4E1MA 2O4GA 1Z25A 3CCLN 4F8RA 1ATRA 3M3ZA 4KH5A 2Z1IA 2W6LA 4E0DA 5AQFA 3MCPA 1QSSA 1JL1A 2RPIA 2GELA 4ILHA 1T03A 2F9WA 4FLZA 1KVBA 3VESA 1HQEA 2ATQA 4IZ9A 4DLEA 3ULDA 2AJQA 3R3LA 3QIOA 4DQPA 2KQ2A 3HZ6A 3K5OA 4LFBK 5CY4A 1R59O 3OYLA 5AQXA 3U3GA 4FO0A 5LJVA 1XI1A 1IBMK 3TTCA 3E9OA 3QESA 1G15A 1T7PA 5HBMA 1VQLN 2F7TA 3K9JA 3DM2A 3E1YA 3EE9A 1J6ZA 4DV0K 5AQUA 5JVHL 3PV8A 4PY5A 3TSUA 3BDPA 2IIRA 4BR0A 1H1VA 4FJHA 3SYZA 2FSJA 1BA1A 3CF5L 2GEMA 3SAFA 1XC3A 2NLXA 3DOLA 1NU0A 4BE0A 4C8LA 4JI0K 2ITMA 4AHCA 1HJRA 4DTUA 3AVHA 1JLGA 3THYB 1HPZA 3CFOA 3SV3A 5AFUA 3CCEN 1MWKA 1Z26A 3FR0A 3QETA 2GX9A 2VWJA 3LDOA 5JMVA 1Q81O 3WXMB 2ZE2A 1WSFA 3HSTB 3CMAN 3RMBA 4CZHA 3ZSOA 4YOWA 2PAVA 1LWCA 3LM2A 3U6FA 1S72N 3AVCA 3KLEA 1NLVA 1WAJA 2YV0X 4B08A 2P9IA 4BGBA 4F3TA 2D1KA 5GAEP 1EKEA 4YY3K 3QBWA 1KRPA 4JD2A 5AQYA 2JWKA 1YUWA 2IVPA 5GAHP 2PBDA 1JLEA 4F2RA 4DV2K 5T7BA 3MEGA 3TAEA 1X3NA 3QB0A 4EP4A 4EHTA 4MDBA 1KCFA 3O9TA 3H1QA 3M1FA 3I0SA 3LP2A 1IBKK 1TL1A 2IDOA 3CC7N 3O9SA 3MDQA 3BY5A 4HTUA 1C1AA 1W0HA 4E7KA 5AZJB 3OS0A 4BRGA 3VQAA 4GKKK 3LM9A 2VQFK 3AVMA 2BANA 3VQ9A 4ISGA 4CIFA 3KD5E 3O5BA 4CZMA 5CE3A 3V81A 4J2EA 4ISEA 3DLLL 4IG3A 2YHBA 2A3ZA 4HTLA 4DSFA 3TAQA 4JK8A 4BC4A 4CF1A 3D0PA 4JS5A 1DT9A 3ZX3A 3M8QA 2P9NB 2RN2A 4BE1A 3ZT0A 4IO9L 2VCPA 3C6AA 3HVTA 3AVLA 3F73A 2G8KA 4QS9A 3ZYYX 2E6MA 3L8BA 3S3NA 4H0PA 1JL2A 4FWSA 1W2BM 2G8HA 1NK6A 1GOBA 4JRQA 3P38A 2FSKA 2X6SA 3S3MA 2PY5A 3GDQA 4LF8K 2FBVA 3EO3A 2G8IA 4RCHA 3CPEA 3WUHA 1WSIA 3HM8A 1NNEA 3O1BA 4H4MA 4Z94A 1UA1A 3RMCA 3T1AA 4DKWA 1W7AA 5JLHA 4MO5A 3HO1A 4IEIA 3NGZA 3V4IA 4KTWA 4EAHD 1C0MA 1RDUA 1NBWA 4FW2A 1BO5O 2ZF5O 4DR7K 2NUBA 1QVFM 2E2QA 3CETA 3EZWA 3O1WA 4EFHA 3NE6A 3DI6A 3C94A 4B9VA 1HKCA 3VETA 1U6ZA 3SJJA 1FW6A 4B3RK 3U9ZA 3K9KA 4K25A 4O44A 1YVNA 4CJVA 2HHXA 3O4WA 2EWSA 4O5BA 4KKOA 3RSEB 3S3OA 2O8CB 2ASMA 1BCMA 3CJAA 5GAGP 3TI0A 1NGBA 1W9HA 3QNOA 2DFFA 2NRZA 3AVFA 4FJ7A 1U04A 3MN5A 4FJ5A 1D9FA 2OA8A 1JXEA 4BRKA 2A42A 1QQNA 3MXMA 1JXBA 1FK9A 3DOKA 4AHUA 4JI7K 2YHXA 3CMEN 3HI0A 5ADXH 2AP1A 1BCOA 3OYCA 2ZGYA 1NGGA 4B9LA 2V7ZA 2OYQA 4DMNA 4CJ7A 3R8EA 1RT7A 4RW8A 1ILYA 3LP3A 3TWHA 4R79A 2G8UA 3ZX0A 3NBPA 4QAGA 4JI5K 3ZEUA 5AQQA 4IG0A 4JNEA 2IVOA 3V9SA 4CHOA 3OYGA 3PX0A 1OH5A 5JS2A 2F8TA 3N4PA 4H5NA 3CCVN 3AO3A 3AO4A 1T6DA 4CFBA 3Q7CA 4XIUA 1WSJA 3NH1A 1L3VA 4IXCA 1LV5A 1K9MO 1XNQK 4PL7A 3G25A 2Y1IA 2KZZA 4FLTA 4B9NA 4KO0A 4CHPA 3G4SN 4FYDA 3OJSA 3DLHA 1MDUB 2HNYA 3DLRA 4KPYA 1XC9A 3PO5A 5CR4A 2YJEA 3LALA 3THVA 4DR6K 3HBTA 1QQMA 2ASOA 1ITGA 3CJ7A 1N36K 4CZLA 4J2DA 4DTRA 2E2NA 2E88A 2GUPA 4CGJA 5KGWA 1BL3A 4DFKA 3VENA 3E9PA 3SQ1A 3NMUA 3AV9A 3O3HA 4A5BA 5J2QA 1KD1O 3QO9A 5EX5A 1S1UA 3KHYA 3HK2A 3LDLA 4XH5A 4DQQA 3C65A 3KIOA 2VG5A 2FBYA 4CFAA 4Z4FA 2HHWA 1QZ6A 2UYTA 4HHTA 5TKWA 1DLOA 3TAMA 1QVGM 2ASPA 5AQGA 4A5AA 1JKHA 3J81O 3EEQA 1Q9XA 4L8RB 3EZ5A 2LSNA 3L2VA 3ZETB 3GOIA 3N4QA 2HHHK 4KFBA 2IOCA 3H08A 3SK3A 1CZAN 3SPZA 5HLFA 1N8RO 5J2PA 1ZYQA 3UIQA 3IDHA 1C1BA 1VQPN 4ID5A 1RT2A 3AA4A 5ELZA 1JLQA 1FKPA 1NM1A 1RBRA 2Q31A 4JKCA 2FBXA 5IT9O 4F3OA 1S6PA 5I42A 3M8PA 4KAZA 4CK2A 3V9UA 3RRHA 4W5TA 3QEVA 4YOXA 3CHWA 1E4FT 3CIPA 4DF4A 3RVCA 3CM6A 5M1FA 3J80O 1I94K 4H5VA 4FWQA 3SV4A 4QS7A 2YNHA 4IOCL 3O9QA 4U7BA 3OA9A 3JXUA 3IS9A 4WYBA 1L5UA 2BTFA 4KREA 4FOEA 3DLEA 4QOZB 1OVQA 3FE1A 1KLMA 2B5JA 3MN6A 1TVRA 1GLBG 1TYQB 5BPNA 4AQYK 5CYQA 2FBTA 4YFUA 1KLNA 1F21A 3TANA 4LF7K 2Q0RA 1RT1A 2WBNA 2GBZA 3HT3A 2NRRA 3SQ2A 5I3UA 1S1VA 4FM0A 3L4QA 1U48A 3KKSA 3DLKA 4PA1A 4R5PA 3WXKA 4JK9A 1BHLA 2HBLA 3AA2A 1EP4A 3VA3A 2QEXN 5AQSA 2P9PB 5DM6L 5AQLA 4LD0A 3UKUA 3B8AX 3G71N 4B3MK 1BISA 4YDUC 2AA4A 3L2RA 4W5NA 2RHKA 3KTQA 3LDNA 3ULEA 3HRGA 4FPBA 1KXPA 4PQUA 3PIPL 4YDUA 3CC4N 3LWLA 2JLEA 1KQSM 3V9ZA 1BGXT 1RDAA 2QWRA 4C1NI 3IAYA 4IBNA 1U2VB 5K14A 3ENOA 5IWAK 1X9WA 2UXDK 3UKRA 5BR9A 4BE2A 4WF9L 3ENBA 4K0KK 1MA9B 4BRQA 3GBTA 3A0IX 4B1WB 3WXJA 4QS8A 3ATUA 4C8KA 3R6MA 4DU3A 1SL0A 3U9DA 3HPOA 4ZHRA 4WCEL 2OPSA 3LDQA 1E4GT 1UA0A 3PX6A 4OKKA 5FPEA 2QM1A 4K41A 3MEDA 3KK2A 3CC2N 1HUXA 1UWBA 4BRLA 2FC0A 4JKGB 3LANA 4OLAA 4PHTX 3CQYA 5MLCQ 4E1JA 1C0TA 1YTAA 1REVA 4M3XA 3T1YK 2FXUA 2QTDA 3T3FA 1B92A 4BY9C 3OHRA 3HTVA 1BDGA 5LMNK 5FROA 2D4WA 3HPHA 3VEZA 5EY4A 1K73O 2A40A 3ZSZA 2KKZA 4FL9A 5C12A 3A5LC 2FF6A 4GMJB 1TV6A 2HMPA 3UKRB 3BEXA 2NRWA 4H0TB 4MQ3A 5CHIA 3LPUA 4DFPA 1NKCA 4CFCA 1LW0A 1S5JA 1X9JA 2B4JA 4FXDA 4KHSA 4FLXA 1NWKA 4KRFA 4M3RA 2RKIA 5D3GA 4H0OA 1RDWX 3OVNA 1SQKA 1HNWK 1P90A 5BRDA 3CFRA 3T69A 1WBDA 1WAFA 1IG9A 3NVMA 1BQNA 3KVGA 1TKDA 4CD3A 1JLAA 4BR5A 4I2PA 4Z4IA 4FZZA 1IV0A 3M5RA 3QERA 3LDPA 1DTTA 2D0AA 1FKOA 4LH5A 3THXA 5HOOA 2UU9K 1OVYA 2ETJA 2DFEA 5BRFA 3R9PA 1KAZA 4OX9K 3KK1A 1J9AA 1IBLK 1HRHA 3D45A 3KLHA 3FZMA 3FZLA 1WNSA 4FOIA 4HUEA 2YNIA 4FK4A 1XMQK 4H0VB 4CBXA 2FSNA 1WB9A 2ZD1A 3D2EB 2QWMA 4IFVA 3DLBA 4GY2B 3WXLA 1RTDA 4DQIA 3NAEA 3H6EA 3OYFA 2O4IA 4KH4A 4DTSA 1EWRA 2HF4A 5KI6A 3OTOK 3R1XA 4JAXA 1Q9YA 2OPQA 3F5TA 1T05A 4JKDA 1UAXA 3AA5X 1HQUA 3DRRA 1FJGK 4B3SK 4XEIA 2HHTA 2BH1A 3VQDA 2XY5A 2QWNA 4CW7B 5AQTA 3M8RA 3NF9A 4MO4A 3SQ4A 4CEDA 3CCUN 4FJ9A 2O8EA 4DTNA 3EE8A 2NRTA 3I56N 1RBVA 1LW2A 4PWDA 4FM2A 4DV7K 2UUBK 4CFDA 1HKGA 1ZBFA 1QQOA 5FLXO 4CF2A 1LAWA 4B9MA 1BI4A 3CJ9A 1JCEA 3HP6A 2F4VK 4ICLA 1ASWA 5E41A 4YOUA 1VSLA 4B9UA 3AVBA 1S9GA 4CESA 4OVLA 5HRNA 4KTQA 3G6EN 1ZC6A 1YJNN 4KB0A 4DB3A 4AF1A 2HHQA 1HPMA 3WNGA 2E8AA 1J5EK 2Q36A 2NRXA 1HNZK 2Z1JA 4PL8A 5HROA 4AH9A 4CJ5A 3K5MA 3MWTA 1YITN 4NYNA 4AM7A 3MAQA 4K42A 3ASMA 1OH8A 5CZ1A 4BDPA 3LZJA 2D0BA 4DF8A 3TU5A 3WEEA 4C1NK 1RCHA 4AILC 3SJHA 2X6NA 1VSKA 4Y0WA 1KFDA 2CGJA 3KLFA 1C0UA 2O8EB 3AY9A 3SUQA 1YTUA 1NGFA 4WFBL 1EETA 4KHUA 3LAMA 3KWIA 2UUAK 4JKHA 4Z4HA 2UXBK 3IRXA 4BRMA 4FJJA 3CI5A 3VN5A 5C10A 1NK5A 5TKYA 2VG7A 3EKSA 2B6AA 2GWJA 3O3FA 1GOCA 3TTFA 3WNEA 1Q8IA 3LL3A 4FW1A 4CCHA 1SKSA 3RMAA 2P9IB 5AQMA 3ALYA 4DQRA 1VQ9N 3SI6A 4FLWA 4CZEA 2KFNA 1NGJA 1TL3A 4JD2B 1KVAA 2WTUA 4BRAA 4FZXC 5C24A 4CF9A 5M1QA 3FLCO 1NGCA 3AVAA 5JS1A 1KFSA 1Q18A 3GL1A 4Z0UA 3QEIA 1YHQN 4BREA 3NF6A 3DWLA 4CEZA 4MLEA 5DK5A 3SPYA 4GV3A 4CEOA 4XH1A 4I6MA 4WFNL 3AVIA 5F1XA 5JVGL 3CJCA 4O8UA 1TKXA 2HF3A 3UE5A 1YT3A 1LCUA 2OZMA 3VEVA 2PYJA 5BN8A 3CCQN 2PZSA 2E2OA 1QSLA 3AAQA 4DV5K 4CJTA 1BA0A 1TGOA 2HNZA 1WUAA 4C8OA 4WFAL 4NB4A 4RW6A 3E01A 1HR0K 4BVOA 1BU6O 4M3TA 4CJ3A 5AQWA 3CPWM 4BROA 5HRSA 2NRHA 1YAGA 4FJMA 1S3XA 1GLFO 4B9SA 5GINA 4K8XA 1QQCA 4DSJA 4KHPK 3SZ2A 1W97L 2YCHA 5M1OA 3ZX2A 3OYDA 4RW7A 3MWPA 3C6HA 3JSMA 3KKRA 3VF4A 4FJNA 1RDDA 2CH6A 4IOXA 5KRTA 2VWKA 3TAGA 2HSTA 5A2QO 3AO2A 3KD1E 2P9SA 2YJFA 4FLUA 5KTQA 1WOQA 4CEQA 5M1PA 4I7FA 1RTIA 3LPTA 1ZBIA 4GNIA 4CJQA 4E7LA 4FLVA 2HBKA 4M63C 1ZXOA 1SZ2A 5EVZA 4F2SA 4KI4A 3K59A 2DTUA 3RRGA 2XRIA 3ZSRA 1JLFA 3MEEA 3LDSA 3K2PA 4PKHA 3JYTA 3C6TA 4DQSA 4GV6A 4GVMA 1RGIA 4DHYA 5FPNA 4OJRA 3H3OB 4FZYA 3ZSQA 2YKNA 5GADP 2QW9A 3OYKA 2E4LA 1XQSC 4CBWA 1N32K 4DS4A 3ISNC 2E20A 4CHYA 2P51A 1KAYA 1HJOA 1NKEA 2ZM6K 2RE2A 4DS5A 5FDLA 4YOVA 1RFQA 3F9KA 3T7ZA 4JK7A 4C8MA 2YHAA 4HVJA 1WSHA 2BGGA 2Q97A 1XHZA 4IFEA 5E84A 4FK2A 2D0OA 3QEWA 4FVUA 4OPAA 3OYNA 1C0GA 1TK5A 4CHZA 1RBUA 3VA0A 4JYAK 1A5XA 1LAVA 3SCXA 2NNWA 4BRIA 2E5LK 2O8BA 4LF4K 1VSFA 3RWUA 1IKVA 3NF8A 3QICA 1NJZA 2D0CA 3QEPA 2O8DA 5AZIA 3KK3A 1TUYA 3VQ5A 1NOZA 1S1TA 3P4IA 2GTDA 2BE2A 4ZTFA 3SUNA 3OBWA 3PY8A 4Q5VA 3CCRN 3O08A 2OZSA 2Q0UA 5B8HA 3J7AP 5C0YA 1P8ZA 1IKWA 4M7YA 4K43A 2E1ZA 2Q2RA 3BUZB 1NGDA 4B3TK 4JI2K 1VQ8N 2O8FA 3ZEUB 1WSGA 3VGMA 4W5RA 1O1WA 3MN9A 1KTQA 1VSJA 3Q7BA 5J2MA 4LF6K 3EKUA 2OTJN 2J4RA 1OKJA 1VRUA 1S6QA 3EYZA 1BUPA 1V4SA 4DV1K 1ZBHA 4CJWA 3HYFA 1DTQA 2X78A 4JLHA 3WQTA 4DCHA 3NH2A 4H03B 5EOYA 3VGKA 5JICA 4LF9K 1XUPO 4CIEA 3PO4A 3CYMA 1TUUA 3DXMA 4B1YB 1QS4A 3KLIA 2IC3A 5LJWA 1DEJA 2QWPA 4B3OA 1HYSA 4WE1A 5KPTA 4ID1A 2O8BB 2NZTA 4GVEA 4UQGA 2IGIA 3SMPA 4BRDA 3IUCA 1N34K 3VQEA 4JI4K 1ZBUA 4A62A 3NGIA 4E7HA 2O8DB 4HCBA 3OS2A 2P9KA 4B8AB 5AFUH 2BDPA 1D9DA 2HB5A 4PKIA 4CE9A 5FRMA 3L2UA 1OH6A 4CJSA 2IAJA 1VAZA 1TKTA 3MX2A 4CI6A 4N76A 1JCFA 4BR4A 4Z4CA 1V4TA 4CZIA 5CZ2A 4Q0BA 3JS6A 2O8FB 1Q7YO 1VSDA 1SUQA 3K5LA 4JI6K 1X9MA 5J2NA 2WC9A 2HOEA 2Z1GA 1CZ9A 2P5OA 4CGIA 1NK9A 2F96A 3TPQA 1CZBA 5H1SQ 3CJ1A 1SV5A 4CIGA 3ZT1A 4CZKA 3A5OC 2YNGA 3OYMA 3C95A 2Y1JA 4J2AA 1X1PA 3S41A 3VPZA 1G99A 2UUCK 1RT6A 4H8KA 1Q86O 3ZSVA 3BF3A 3EL2A 3SMSA 3CFPA 3HOTA 3SBTA 1FXXA 3SQ0A 4KH6A 3IKMA 3DXMB 1A5WA 3V1RA 3LZIA 2P9LA 1VQON 4A2AA 3CQXA 1YJWN 1NK8A 2HW3A 3DRSA 1XMOK 4FWKA 2XO7A 5AQJA 3J8AA 4DSEA 2HHVA 3DYAA 4FPAA 3VF2A 4BQZA 2A1SA 1BIUA 1WLJA 2P9KB 4PKGA 3NVKA 5AQIA 3ZT3A 4JV5K 4Y1CA 1JCGA 3AVKA 4OLBA 1SS6A 3CJBA 3WQUA 5F0XA 3S9HA 4CJRA 3KLGA 3DXKA 4BWMA 3VQQA 4CHQA 1IKYA 3TARA 5LY3A 5AQVA 1WN7A 3QBXA 1TKZA 3I8DA 2GUIA 3C6UA 3NFAA 1DKGD 2VQEK 4O4GA 3VERA 2G8FA 2EHGA 1NJWA 1KAXA 2WONA 4JI3K 4H4OA 4BRNA 1YF5L 3G10A 1YXQA 4GKJK 1RT5A 3IFRA 3SAHA 2QWOA 4W5OA 4CZGA 4CZJA 5GIOA 3VMFB 4F4KA 1CLQA 1IKXA 1IH7A 5C2DA 4PUOA 4NO7A 3ZT2A 3K0SA 4IJNA 2D5RA 3T1HK 2P9LB 3UKUB 4O0JA 5AR0A 1NKBA 4OO1J 3P5JA 4WQ5C 1DGKN 1HKBA 4CVNE 3ULEB 4DTXA 4CJPA 3AVNA 1U45A 4WQ4C 3CQ8A 4JRPA 3I8BA 3VF6A 3RR8A 4I2QA 3I55N 4FJLA 1HX1A 3OY9A 4WQ5A 4M3YA 4O0IA 4DG1A 5C42A 1NK4A 4WQ4A 4IWVA 5JLFA 5ADXA 1Z05A 2YHYA 3P1GA 5M1NA 1E3MA 3NF7A 1J54A 2E2PA 4IOAL 2V51B 4X65K 2H3GX 1GLCG 4FM1A 3LAKA 1RDBA 4DFMA 5M1KA 1HLUA 3TTDA 4BRCA 1VSIA 5AQPA 4YHHK 4FJGA 3CERA 2FF3B 3V1QA 3AO5A 3FGUA 3VQ7A 2CGKA 3AVGA 1HYVA 2R7YA 1L3TA 3MXIA 3TSPA 4DV6K 5DM7L 3OW2M 4I9LA 3TABA 1NJYA 1ESVA 3EY1A 3LP1A 2QWQA 1SL1A 4TSXA 5SZTA 3VEYA 1SKWA 3F2KA 3H1VX 3FZFA 2YKMA 2E1YA 2ZGZA 4W5QA 3DJCA 1B9DA 3M6GA 4FWLA 3THYA 5J1EA 1HNIA 4NXNK 3KWGA 4FJ8A 2QI2A 4IFYA 2KFZA 4DR3K 3PUFA 4FWRA 3A5MC 1HYZA 5C2FA 3K58A 4NCBA 4CEEA 2WUSA 4FVMA 4DLGA 4RTFD 1VQ6N 1TK8A 2YI1A 3AARA 1Y97A 4E7JA 4KTZA 3KZBA 3OYBA 1BG3A 3NH0A 2OPRA 2WOMA 3FFIA 4H5TA 3VEXA 3HPGA 4Y1DA 3UB5A 3MECA 4B1UB 4CGGA 3VQBA 4IJAA 1NMDA 4KI6A 4BR9A 2QK9A 5C25A 4JKEA 4OKJA 3J7YP 1CXQA 5FPMA 1GLAG 3A8YA 3A2FA 4B8CA 1BWFO 3THXB 3P31A 2I7NA 3ATVA 4V19S 5AQRA 2A6AA 1JJ2M 1SKRA 2OANA 3O9UA 3CCJN 4XH4A 3TR8A 4DV4K 4H5RA 3A5NC 2HHSA 4DSIA 2KTQA 4YOTA 3BGRA 3L4IA 3QDKA 3OYAA 3PSFA 3O3GA 1YVUA 1TAUA 4N47A 1KSPA 1NGEA 5AZJA 1Y64A 1EXQA 1XHXA 4MLHA 4HUGA 5CYMA 2ZJQL 1C1CA 1S1XA 4BG9A 2HBMA 3L2WA 2W6KA 4ELVA 1EWQA 4BDZA 5FRNA 1IO2A 3O9RA 2P9NA 2QA4N 4A61A 1N5YA 4OPJA 3D6RA 4BDYA 4NCGA 4DQ8A 3WT0A 1MU2A 4O55A 4BRHA 4YNQA 2VGNA 4AHRA 4AHSA 1U49A 2ZQBA 4KHYA 1RILA 4B9TA 5GIPA 1X9SA 4JKBA 3OBYA 3U3YA 4JN4A 4X64K 1BI4B 1SAZA 3OYJA 4EZ6A 4LC9B 3D2FA 4M3UA 3EN9A 2XY8A 3AA3A 4DFJA 2V7YA 3QFPA 3P39A 3H3NO 1ASUA 2I5JA 2XHBA 4M42A 1L3UA 5HRRA 3SLCA 1KC8O 4DWIA 4LH4A 1X3MA 4CEFA 2WFBA 1QHTA 4B1XB 5HP1A 3I33A 5AQNA 4DR2K 3VQPA 3TAPA 2G8VA 2I7PA 2PYLA 3VGLA 4FLYA 3L3UA 3IG1A 2YNFA 5AQKA 1CXUA 4HCCA 4C23A 1Q82O 2F8SA 3O4NA 3WEEB 1I3AA 3SAGA 3RSEA 2EX3A 3CM5A 5EXWA 4FK0A 1D8YA 2O8CA 4FWOA 2QKBA 1RTHA 1L3SA 1NG9A 4JHDA 4A59A 1ZBSA 5AJ3K 4JI8K 1VQ5N 3MXJA 4Z4GA 3ID8A 5EU7A 1ZBLA 5AQHA 1EO1A 2KW4A 4LSNA 1NK0A 5KPRA 2CGLA 4FWMA 1J5OA 4M3WA 3SNNA 3D2FB 3HL8A 1BQMA 4BACA 3T19A 3MMVA 3WNFA 4BQLA 3L2QA 3JAMO 2UXCK 3QFUA 3E66A 1EX4A 3LP0A 4E7IA 3CCMN 2OTLN 4RWTA 2OPPA 3E9LA 4OGEA 3U8XA
chains in the Genus database with same CATH topology
2QKKA 3QETA 1REVA 2HNDA 2VWJA 4M3XA 1BIZA 1S1WA 1J53A 4WE1A 4B3OA 1HYSA 3T3FA 1RT4A 4ID1A 3RR7A 1B92A 2ZE2A 1WSFA 3HSTB 4UQGA 2IGIA 3RMBA 3OS1A 3VQEA 1ZBUA 5FROA 3NGIA 4E7HA 3ZSOA 4HCBA 3VQ8A 3U6FA 1LWCA 3HPHA 3OS2A 3AVCA 4B8AB 3KLEA 1WAJA 2BDPA 1D9DA 2HB5A 2YV0X 4AHVA 4B08A 4DTPA 3ZSZA 4CE9A 2Z1HA 5FRMA 3L2UA 4F3TA 4GMJB 1TV6A 3QEXA 1EKEA 4CJSA 2IAJA 1KRPA 1TKTA 1TAQA 4QCLA 4N76A 4RW4A 4MQ3A 3LPUA 4DFPA 1NKCA 1N6QA 4CFCA 1LW0A 2IS3A 1S5JA 4Z4CA 2B4JA 4FXDA 4KHSA 1JLEA 4FLXA 5CZ2A 4CJKA 4Q0BA 4F2RA 1VSDA 5T7BA 4M3RA 1SUQA 3L3VA 3MEGA 2RKIA 1D5AA 1VSMA 3NGYA 4EP4A 3K5LA 5J2NA 3TAEA 1X9MA 2Z1GA 5D3GA 1CZ9A 2P5OA 1KCFA 4CGIA 3OVNA 1NK9A 3NHGA 3AVJA 2F96A 2W42A 3CFRA 1CZBA 2XY7A 3V6DA 1SV5A 3OYHA 4CIGA 3ZSYA 3I0SA 3ZT1A 2YNGA 1WAFA 3LP2A 1TL1A 3OYMA 1IG9A 1BQNA 2IDOA 3AO1A 1X1PA 3C95A 2Y1JA 1TKDA 4J2AA 1JLAA 3CG7A 4I2PA 4Z4EA 1RT6A 4G1QA 4H8KA 3ZSVA 4FZZA 4Z4IA 4HTUA 2DFHA 1C1AA 1W0HA 3QERA 1T8EA 3CFPA 1DTTA 4E7KA 1LWEA 2D0AA 1FKOA 4LH5A 3LWMA 3OS0A 1FXXA 3SQ0A 3VQAA 2ETJA 2DFEA 3OJUA 3AVMA 1A5WA 3V1RA 2BANA 3VQ9A 3LZIA 4ELUA 3HXMA 4CIFA 4M45A 3KD5E 4CJ4A 1WSEA 3V81A 4J2EA 3KK1A 1NK8A 1J9AA 3OYEA 1VK0A 4IG3A 1HRHA 2HW3A 2YHBA 3D45A 3DRSA 3KLHA 1WNSA 2XO7A 4DSFA 4HUEA 3TAQA 4ZTJA 1ASVA 4LY7A 4CF1A 3D0PA 2YNIA 3DYAA 4JS5A 2VG6A 4DSEA 4FK4A 2HHVA 4FJXA 2A1SA 3M8QA 1BIUA 2RN2A 4BE1A 1WLJA 4OKEA 1NK7A 3ZT0A 3RMDA 3ZT3A 5KRSA 2ZD1A 4IFVA 4Y1CA 3DLBA 4GW6A 1RTDA 4KHNA 3HVTA 4DQIA 3AVKA 4OLBA 3AVLA 3F73A 3NAEA 3S9HA 2G8KA 3OYFA 2RF2A 4CJRA 2O4IA 2E6MA 4DTSA 3KLGA 4BWMA 3L8BA 5KI6A 3VQQA 4CHQA 1U4BA 1IKYA 3S3NA 1JL2A 3TARA 1Q9YA 2G8HA 1NK6A 1GOBA 4JRQA 4N41A 1WN7A 2OPQA 2X6SA 3ZCMA 1TKZA 3S3MA 1T05A 2FBVA 3I8DA 2PY5A 4EZ9A 1UAXA 2GUIA 3C6UA 2G8IA 3AA5X 1HQUA 4CK3A 1HNVA 3NFAA 3DRRA 4O4GA 1WSIA 2G8FA 2EHGA 4DSKA 1NJWA 2HHTA 2WONA 3VQDA 4H4MA 2XY5A 4H4OA 1UA1A 3RMCA 3T1AA 2HVHA 3G10A 3NF9A 3ITHA 3M8RA 3PX4A 1SL2A 4KHQA 1RT5A 3SQ4A 4CGDA 4CEDA 4FCYA 3HO1A 4W5OA 3NGZA 4FJ9A 4F4KA 4DTNA 3V4IA 4KTWA 3V9WA 1RBVA 1CLQA 1C0MA 1IKXA 1IH7A 1LW2A 4FW2A 4PWDA 4FM2A 4CFDA 1R0AA 1RTJA 4PUOA 3ZT2A 1ZBFA 2NUBA 1NJXA 4CF2A 1LAWA 1K6YA 1C0TA 4E3SA 2D5RA 3B6OA 4B9MA 1BI4A 3HP6A 4DSLA 4I9QA 3NE6A 3DI6A 3C94A 4B9VA 3WNHA 4ICLA 1ASWA 4O0JA 5E41A 1NKBA 2HMIA 3KJVA 1VSLA 2E6LA 4B9UA 3SJJA 3AVBA 1S9GA 3P5JA 4CESA 4OVLA 5HRNA 4E19A 4DTXA 4KTQA 4CJPA 3AVNA 1U45A 4O44A 3CQ8A 3OYIA 2G8WA 4CJVA 2HHXA 4KB0A 4CJUA 4JRPA 3RR8A 3V1OA 4I2QA 4KKOA 4O5BA 4DU1A 3S3OA 4FJLA 3OY9A 4M3YA 3VQCA 4O0IA 3VQ6A 2HHQA 4DG1A 1BCMA 3G0ZA 5C42A 1NK4A 4N5SA 3WNGA 2Q3SA 2KZZA 3TI0A 3HM9A 2Z1JA 1W9HA 3QNOA 4AH9A 4CJ5A 5HROA 2DFFA 4CF8A 3AVFA 3K5MA 3P1GA 1U47A 4NYNA 4FJ7A 3MAQA 1TK0A 3NF7A 1J54A 1U04A 3ASMA 4FJIA 4FJ5A 1D9FA 3DRPA 5CZ1A 2OA8A 4BDPA 1JXEA 3LZJA 2D0BA 4DF8A 3MXMA 1JXBA 1FK9A 4FM1A 1RCHA 3DOKA 4AHUA 3LAKA 4AILC 1RDBA 2X6NA 2HVIA 1UOCA 4DFMA 1VSKA 3QIPA 1KFDA 4IDKA 3KLFA 1BCOA 3OYCA 1C0UA 4B9LA 2OYQA 1VSIA 4DMNA 3ZSWA 4FJGA 1RT7A 4RW8A 3SUQA 3LP3A 3TWHA 4CK1A 3V1QA 2G8UA 1YTUA 3AO5A 3VQ7A 1A5VA 3AVGA 1EETA 4KV8A 4E89A 3LAMA 1HYVA 4KHUA 3NBPA 4QAGA 2R7YA 3SUOA 1L3TA 3TAFA 1NOYA 4IG0A 4Z4HA 3HP9A 3MXIA 3IRXA 4RW9A 3V9SA 4FJJA 4CHOA 3OYGA 1VRTA 4HUFA 4I9LA 3VN5A 3RTVA 3TABA 3PX0A 1NJYA 5JS2A 2F8TA 3EY1A 3LP1A 1SL1A 4DTJA 4TSXA 4ELTA 3AO3A 5SZTA 4J2BA 1NK5A 1SKWA 3AO4A 2VG7A 2KZMA 2DY4A 3I0RA 2B6AA 2YKMA 4CFBA 4XIUA 1WSJA 3NH1A 1GOCA 4W5QA 2GV9A 3O3FA 4KHWA 1L3VA 4LSLA 1B9DA 3QLHA 3WNEA 1Q8IA 1LV5A 4FW1A 4CCHA 1SKSA 3RMAA 5J1EA 1KVCA 1HNIA 3ALYA 4DQRA 5HRPA 4FLWA 4FLTA 2Y1IA 3SI6A 4FJ8A 2KFNA 4B9NA 3HVRA 4IFYA 4KO0A 4CHPA 2KFZA 4FYDA 3OJSA 4CJEA 1TL3A 3PUFA 3DLHA 1KVAA 1VSEA 1HYZA 2HNYA 3K58A 4FZXC 3DLRA 4KPYA 4NCBA 1XC9A 4CEEA 3PO5A 3LALA 4FVMA 5C24A 4DLGA 4CF9A 3THVA 4BWJA 1I39A 4CHNA 3M8SA 1TK8A 3V9XA 3K57A 4OGCA 4DU4A 2X74A 1Y97A 3AVAA 4JS4A 4KTZA 4E7JA 3OYBA 1KFSA 1ITGA 5JS1A 3NH0A 1VSHA 2ITGA 2OPRA 5DMRA 4Z0UA 3QEIA 2WOMA 4C8NA 3FFIA 4OPKA 3HPGA 3NF6A 4Y1DA 4CEZA 3MECA 4CJLA 4CJFA 1QE1A 5DK5A 4J2DA 4CGGA 4DTRA 3SPYA 3VQBA 4CGJA 4CEOA 5KGWA 4KI6A 1BL3A 3AVIA 4DFKA 1LWFA 2QK9A 1RT3A 5C25A 3SQ1A 4OKJA 1TKXA 1YT3A 1B9FA 3AV9A 3O3HA 4N56A 1CXQA 2OZMA 2PYJA 3A2FA 4B8CA 5J2QA 3QO9A 2PZSA 1S1UA 2XY6A 4CGFA 3ZT4A 1QSLA 3HK2A 3QINA 4CJTA 4DQQA 3KIOA 2VG5A 2FBYA 4CFAA 2A1RA 1SKRA 1TGOA 2HNZA 4Z4FA 4HHTA 4CERA 4C8OA 2HHWA 2QXFA 1DLOA 4RW6A 3B6PA 3TAMA 3TR8A 3E01A 1JKHA 1Q9XA 2HHSA 4L8RB 4DSIA 3EZ5A 2KTQA 2LSNA 3L2VA 3BGRA 3NCIA 5SWMA 3OYAA 4M3TA 4CJ3A 3O3GA 2JGUA 5HRSA 1YVUA 4AHTA 4FJMA 4N47A 1KSPA 1TAUA 3SUPA 4KFBA 1EXQA 4B9SA 1XHXA 2P5GA 4K8XA 2IOCA 1QQCA 1RBTA 3H08A 4HUGA 3SZ2A 3SPZA 5HLFA 1RDCA 5CYMA 1XWLA 4DSJA 1C1CA 1S1XA 4MFBA 5J2PA 1ZYQA 4NYFA 3UIQA 3P83D 3L2WA 3OYDA 4CF0A 4FJKA 1C1BA 4CECA 2P1JA 3ZSXA 4RW7A 4ID5A 1GOAA 1JLCA 1RT2A 1JLQA 3AA4A 3JSMA 4BDZA 4ELVA 4NCAA 3KKRA 4FJNA 1RDDA 5KRTA 4CEAA 1FKPA 1RBRA 2VWKA 4CEBA 3TAGA 5FRNA 2FBXA 1IO2A 4F3OA 1S6PA 5I42A 2HHUA 3M8PA 3AO2A 3KD1E 4E1NA 4KAZA 4CK2A 4FLUA 3V9UA 3RRHA 5KTQA 4W5TA 3QEVA 1N5YA 4KB1A 4OPJA 4CEQA 4BDYA 4NCGA 4I7FA 1RTIA 3LPTA 4EP5A 4DF4A 3QNNA 1ZBIA 4E7LA 4CJQA 4FLVA 3CM6A 1MU2A 4O55A 4CGHA 1HMVA 1RNHA 4YNQA 3SV4A 4F2SA 4RG8A 4KI4A 2YNHA 3K59A 5KGXA 4AHRA 4AHSA 3RRGA 2DTUA 1U49A 2XRIA 2ZQBA 3ZSRA 3O4QA 4KHYA 1JLFA 3MEEA 3NDKA 3LDSA 3K2PA 4DTMA 4DTOA 4K8ZA 3IS9A 1RILA 1L5UA 4B9TA 4KREA 3JYTA 3C6TA 1X9SA 4M3ZA 4DQSA 3DLEA 4QOZB 4GVMA 4M41A 1KLMA 3U3YA 3HJFA 2B5JA 4EZ6A 1BI4B 4OJRA 3OYJA 1C6VA 4FZYA 1TVRA 3DLGA 3ZSQA 2YKNA 1RBSA 3OYKA 1QTMA 2E4LA 4M3UA 5CYQA 2FBTA 1S9EA 2XY8A 3DMJA 4YFUA 3AA3A 1F21A 3VQ4A 4DFJA 3TANA 1QSYA 1KLNA 1JLBA 4DS4A 3ISNC 1RT1A 2GBZA 3HT3A 4IKFA 3SQ2A 3K5NA 4E1MA 1ASUA 2O4GA 2I5JA 2XHBA 1Z25A 4CHYA 2P51A 5I3UA 4M42A 1S1VA 1L3UA 4FM0A 1NKEA 1U48A 3KKSA 5HRRA 3DLKA 4PA1A 4F8RA 4R5PA 4DS5A 5FDLA 4DWIA 2Z1IA 4E0DA 1BHLA 3F9KA 4LH4A 4C8MA 2YHAA 4HVJA 1WSHA 3AA2A 1EP4A 4CEFA 2BGGA 3VA3A 1XHZA 1QSSA 1QHTA 1JL1A 2RPIA 4FK2A 3QEWA 5HP1A 1T03A 3OYNA 4FLZA 1TK5A 4LD0A 3VQPA 4CHZA 1KVBA 1RBUA 3TAPA 2G8VA 4KRFA 1BISA 3VA0A 1HQEA 2ATQA 4DLEA 3ULDA 2AJQA 1A5XA 1LAVA 2PYLA 3L2RA 3QIOA 4FLYA 3SCXA 4W5NA 3KTQA 4DQPA 2KQ2A 3L3UA 3IG1A 1VSFA 3RWUA 2YNFA 1IKVA 3NF8A 1NJZA 1CXUA 2D0CA 3QEPA 4HCCA 3K5OA 3KK3A 2F8SA 3O4NA 4PQUA 3VQ5A 3LWLA 1I3AA 1NOZA 1S1TA 5CY4A 2JLEA 3V9ZA 1BGXT 3OYLA 1RDAA 2EX3A 2BE2A 3CM5A 4ZTFA 1D8YA 3U3GA 4FK0A 3IAYA 2QKBA 1RTHA 4IBNA 5K14A 3SUNA 3PY8A 4Q5VA 1L3SA 1X9WA 2OZSA 1XI1A 4BE2A 3QESA 1G15A 1T7PA 5HBMA 1IKWA 3MXJA 4Z4GA 3DM2A 5EU7A 1ZBLA 4C8KA 1WSGA 2KW4A 4LSNA 4DU3A 1SL0A 3PV8A 4W5RA 1NK0A 3HPOA 1O1WA 4ZHRA 1KTQA 1J5OA 3BDPA 4PY5A 1VSJA 2OPSA 4M3WA 3SNNA 5J2MA 1UA0A 3PX6A 1VRUA 1S6QA 3EYZA 4FJHA 3SYZA 4OKKA 3HL8A 1BQMA 4BACA 3T19A 1ZBHA 4CJWA 3WNFA 3HYFA 3L2QA 3DOLA 1DTQA 2X78A 4JLHA 4BE0A 3NH2A 1EX4A 4C8LA 3LP0A 4AHCA 4E7IA 3MEDA 3KK2A 1HJRA 4DTUA 3AVHA 1UWBA 1JLGA 2FC0A 4CIEA 3PO4A 3LANA 4OLAA 1HPZA 2OPPA 3CYMA 3CFOA 4OGEA 3SV3A 1QS4A 3KLIA 2IC3A 1Z26A 1YTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKK A;  3QET A;  1REV A;  2HND A;  2VWJ A;  4M3X A;  1BIZ A;  1S1W A;  1J53 A;  4WE1 A;  4B3O A;  1HYS A;  3T3F A;  1RT4 A;  4ID1 A;  3RR7 A;  1B92 A;  2ZE2 A;  1WSF A;  3HST B;  4UQG A;  2IGI A;  3RMB A;  3OS1 A;  3VQE A;  1ZBU A;  5FRO A;  3NGI A;  4E7H A;  3ZSO A;  4HCB A;  3VQ8 A;  3U6F A;  1LWC A;  3HPH A;  3OS2 A;  3AVC A;  4B8A B;  3KLE A;  1WAJ A;  2BDP A;  1D9D A;  2HB5 A;  2YV0 X;  4AHV A;  4B08 A;  4DTP A;  3ZSZ A;  4CE9 A;  2Z1H A;  5FRM A;  3L2U A;  4F3T A;  4GMJ B;  1TV6 A;  3QEX A;  1EKE A;  4CJS A;  2IAJ A;  1KRP A;  1TKT A;  1TAQ A;  4QCL A;  4N76 A;  4RW4 A;  4MQ3 A;  3LPU A;  4DFP A;  1NKC A;  1N6Q A;  4CFC A;  1LW0 A;  2IS3 A;  1S5J A;  4Z4C A;  2B4J A;  4FXD A;  4KHS A;  1JLE A;  4FLX A;  5CZ2 A;  4CJK A;  4Q0B A;  4F2R A;  1VSD A;  5T7B A;  4M3R A;  1SUQ A;  3L3V A;  3MEG A;  2RKI A;  1D5A A;  1VSM A;  3NGY A;  4EP4 A;  3K5L A;  5J2N A;  3TAE A;  1X9M A;  2Z1G A;  5D3G A;  1CZ9 A;  2P5O A;  1KCF A;  4CGI A;  3OVN A;  1NK9 A;  3NHG A;  3AVJ A;  2F96 A;  2W42 A;  3CFR A;  1CZB A;  2XY7 A;  3V6D A;  1SV5 A;  3OYH A;  4CIG A;  3ZSY A;  3I0S A;  3ZT1 A;  2YNG A;  1WAF A;  3LP2 A;  1TL1 A;  3OYM A;  1IG9 A;  1BQN A;  2IDO A;  3AO1 A;  1X1P A;  3C95 A;  2Y1J A;  1TKD A;  4J2A A;  1JLA A;  3CG7 A;  4I2P A;  4Z4E A;  1RT6 A;  4G1Q A;  4H8K A;  3ZSV A;  4FZZ A;  4Z4I A;  4HTU A;  2DFH A;  1C1A A;  1W0H A;  3QER A;  1T8E A;  3CFP A;  1DTT A;  4E7K A;  1LWE A;  2D0A A;  1FKO A;  4LH5 A;  3LWM A;  3OS0 A;  1FXX A;  3SQ0 A;  3VQA A;  2ETJ A;  2DFE A;  3OJU A;  3AVM A;  1A5W A;  3V1R A;  2BAN A;  3VQ9 A;  3LZI A;  4ELU A;  3HXM A;  4CIF A;  4M45 A;  3KD5 E;  4CJ4 A;  1WSE A;  3V81 A;  4J2E A;  3KK1 A;  1NK8 A;  1J9A A;  3OYE A;  1VK0 A;  4IG3 A;  1HRH A;  2HW3 A;  2YHB A;  3D45 A;  3DRS A;  3KLH A;  1WNS A;  2XO7 A;  4DSF A;  4HUE A;  3TAQ A;  4ZTJ A;  1ASV A;  4LY7 A;  4CF1 A;  3D0P A;  2YNI A;  3DYA A;  4JS5 A;  2VG6 A;  4DSE A;  4FK4 A;  2HHV A;  4FJX A;  2A1S A;  3M8Q A;  1BIU A;  2RN2 A;  4BE1 A;  1WLJ A;  4OKE A;  1NK7 A;  3ZT0 A;  3RMD A;  3ZT3 A;  5KRS A;  2ZD1 A;  4IFV A;  4Y1C A;  3DLB A;  4GW6 A;  1RTD A;  4KHN A;  3HVT A;  4DQI A;  3AVK A;  4OLB A;  3AVL A;  3F73 A;  3NAE A;  3S9H A;  2G8K A;  3OYF A;  2RF2 A;  4CJR A;  2O4I A;  2E6M A;  4DTS A;  3KLG A;  4BWM A;  3L8B A;  5KI6 A;  3VQQ A;  4CHQ A;  1U4B A;  1IKY A;  3S3N A;  1JL2 A;  3TAR A;  1Q9Y A;  2G8H A;  1NK6 A;  1GOB A;  4JRQ A;  4N41 A;  1WN7 A;  2OPQ A;  2X6S A;  3ZCM A;  1TKZ A;  3S3M A;  1T05 A;  2FBV A;  3I8D A;  2PY5 A;  4EZ9 A;  1UAX A;  2GUI A;  3C6U A;  2G8I A;  3AA5 X;  1HQU A;  4CK3 A;  1HNV A;  3NFA A;  3DRR A;  4O4G A;  1WSI A;  2G8F A;  2EHG A;  4DSK A;  1NJW A;  2HHT A;  2WON A;  3VQD A;  4H4M A;  2XY5 A;  4H4O A;  1UA1 A;  3RMC A;  3T1A A;  2HVH A;  3G10 A;  3NF9 A;  3ITH A;  3M8R A;  3PX4 A;  1SL2 A;  4KHQ A;  1RT5 A;  3SQ4 A;  4CGD A;  4CED A;  4FCY A;  3HO1 A;  4W5O A;  3NGZ A;  4FJ9 A;  4F4K A;  4DTN A;  3V4I A;  4KTW A;  3V9W A;  1RBV A;  1CLQ A;  1C0M A;  1IKX A;  1IH7 A;  1LW2 A;  4FW2 A;  4PWD A;  4FM2 A;  4CFD A;  1R0A A;  1RTJ A;  4PUO A;  3ZT2 A;  1ZBF A;  2NUB A;  1NJX A;  4CF2 A;  1LAW A;  1K6Y A;  1C0T A;  4E3S A;  2D5R A;  3B6O A;  4B9M A;  1BI4 A;  3HP6 A;  4DSL A;  4I9Q A;  3NE6 A;  3DI6 A;  3C94 A;  4B9V A;  3WNH A;  4ICL A;  1ASW A;  4O0J A;  5E41 A;  1NKB A;  2HMI A;  3KJV A;  1VSL A;  2E6L A;  4B9U A;  3SJJ A;  3AVB A;  1S9G A;  3P5J A;  4CES A;  4OVL A;  5HRN A;  4E19 A;  4DTX A;  4KTQ A;  4CJP A;  3AVN A;  1U45 A;  4O44 A;  3CQ8 A;  3OYI A;  2G8W A;  4CJV A;  2HHX A;  4KB0 A;  4CJU A;  4JRP A;  3RR8 A;  3V1O A;  4I2Q A;  4KKO A;  4O5B A;  4DU1 A;  3S3O A;  4FJL A;  3OY9 A;  4M3Y A;  3VQC A;  4O0I A;  3VQ6 A;  2HHQ A;  4DG1 A;  1BCM A;  3G0Z A;  5C42 A;  1NK4 A;  4N5S A;  3WNG A;  2Q3S A;  2KZZ A;  3TI0 A;  3HM9 A;  2Z1J A;  1W9H A;  3QNO A;  4AH9 A;  4CJ5 A;  5HRO A;  2DFF A;  4CF8 A;  3AVF A;  3K5M A;  3P1G A;  1U47 A;  4NYN A;  4FJ7 A;  3MAQ A;  1TK0 A;  3NF7 A;  1J54 A;  1U04 A;  3ASM A;  4FJI A;  4FJ5 A;  1D9F A;  3DRP A;  5CZ1 A;  2OA8 A;  4BDP A;  1JXE A;  3LZJ A;  2D0B A;  4DF8 A;  3MXM A;  1JXB A;  1FK9 A;  4FM1 A;  1RCH A;  3DOK A;  4AHU A;  3LAK A;  4AIL C;  1RDB A;  2X6N A;  2HVI A;  1UOC A;  4DFM A;  1VSK A;  3QIP A;  1KFD A;  4IDK A;  3KLF A;  1BCO A;  3OYC A;  1C0U A;  4B9L A;  2OYQ A;  1VSI A;  4DMN A;  3ZSW A;  4FJG A;  1RT7 A;  4RW8 A;  3SUQ A;  3LP3 A;  3TWH A;  4CK1 A;  3V1Q A;  2G8U A;  1YTU A;  3AO5 A;  3VQ7 A;  1A5V A;  3AVG A;  1EET A;  4KV8 A;  4E89 A;  3LAM A;  1HYV A;  4KHU A;  3NBP A;  4QAG A;  2R7Y A;  3SUO A;  1L3T A;  3TAF A;  1NOY A;  4IG0 A;  4Z4H A;  3HP9 A;  3MXI A;  3IRX A;  4RW9 A;  3V9S A;  4FJJ A;  4CHO A;  3OYG A;  1VRT A;  4HUF A;  4I9L A;  3VN5 A;  3RTV A;  3TAB A;  3PX0 A;  1NJY A;  5JS2 A;  2F8T A;  3EY1 A;  3LP1 A;  1SL1 A;  4DTJ A;  4TSX A;  4ELT A;  3AO3 A;  5SZT A;  4J2B A;  1NK5 A;  1SKW A;  3AO4 A;  2VG7 A;  2KZM A;  2DY4 A;  3I0R A;  2B6A A;  2YKM A;  4CFB A;  4XIU A;  1WSJ A;  3NH1 A;  1GOC A;  4W5Q A;  2GV9 A;  3O3F A;  4KHW A;  1L3V A;  4LSL A;  1B9D A;  3QLH A;  3WNE A;  1Q8I A;  1LV5 A;  4FW1 A;  4CCH A;  1SKS A;  3RMA A;  5J1E A;  1KVC A;  1HNI A;  3ALY A;  4DQR A;  5HRP A;  4FLW A;  4FLT A;  2Y1I A;  3SI6 A;  4FJ8 A;  2KFN A;  4B9N A;  3HVR A;  4IFY A;  4KO0 A;  4CHP A;  2KFZ A;  4FYD A;  3OJS A;  4CJE A;  1TL3 A;  3PUF A;  3DLH A;  1KVA A;  1VSE A;  1HYZ A;  2HNY A;  3K58 A;  4FZX C;  3DLR A;  4KPY A;  4NCB A;  1XC9 A;  4CEE A;  3PO5 A;  3LAL A;  4FVM A;  5C24 A;  4DLG A;  4CF9 A;  3THV A;  4BWJ A;  1I39 A;  4CHN A;  3M8S A;  1TK8 A;  3V9X A;  3K57 A;  4OGC A;  4DU4 A;  2X74 A;  1Y97 A;  3AVA A;  4JS4 A;  4KTZ A;  4E7J A;  3OYB A;  1KFS A;  1ITG A;  5JS1 A;  3NH0 A;  1VSH A;  2ITG A;  2OPR A;  5DMR A;  4Z0U A;  3QEI A;  2WOM A;  4C8N A;  3FFI A;  4OPK A;  3HPG A;  3NF6 A;  4Y1D A;  4CEZ A;  3MEC A;  4CJL A;  4CJF A;  1QE1 A;  5DK5 A;  4J2D A;  4CGG A;  4DTR A;  3SPY A;  3VQB A;  4CGJ A;  4CEO A;  5KGW A;  4KI6 A;  1BL3 A;  3AVI A;  4DFK A;  1LWF A;  2QK9 A;  1RT3 A;  5C25 A;  3SQ1 A;  4OKJ A;  1TKX A;  1YT3 A;  1B9F A;  3AV9 A;  3O3H A;  4N56 A;  1CXQ A;  2OZM A;  2PYJ A;  3A2F A;  4B8C A;  5J2Q A;  3QO9 A;  2PZS A;  1S1U A;  2XY6 A;  4CGF A;  3ZT4 A;  1QSL A;  3HK2 A;  3QIN A;  4CJT A;  4DQQ A;  3KIO A;  2VG5 A;  2FBY A;  4CFA A;  2A1R A;  1SKR A;  1TGO A;  2HNZ A;  4Z4F A;  4HHT A;  4CER A;  4C8O A;  2HHW A;  2QXF A;  1DLO A;  4RW6 A;  3B6P A;  3TAM A;  3TR8 A;  3E01 A;  1JKH A;  1Q9X A;  2HHS A;  4L8R B;  4DSI A;  3EZ5 A;  2KTQ A;  2LSN A;  3L2V A;  3BGR A;  3NCI A;  5SWM A;  3OYA A;  4M3T A;  4CJ3 A;  3O3G A;  2JGU A;  5HRS A;  1YVU A;  4AHT A;  4FJM A;  4N47 A;  1KSP A;  1TAU A;  3SUP A;  4KFB A;  1EXQ A;  4B9S A;  1XHX A;  2P5G A;  4K8X A;  2IOC A;  1QQC A;  1RBT A;  3H08 A;  4HUG A;  3SZ2 A;  3SPZ A;  5HLF A;  1RDC A;  5CYM A;  1XWL A;  4DSJ A;  1C1C A;  1S1X A;  4MFB A;  5J2P A;  1ZYQ A;  4NYF A;  3UIQ A;  3P83 D;  3L2W A;  3OYD A;  4CF0 A;  4FJK A;  1C1B A;  4CEC A;  2P1J A;  3ZSX A;  4RW7 A;  4ID5 A;  1GOA A;  1JLC A;  1RT2 A;  1JLQ A;  3AA4 A;  3JSM A;  4BDZ A;  4ELV A;  4NCA A;  3KKR A;  4FJN A;  1RDD A;  5KRT A;  4CEA A;  1FKP A;  1RBR A;  2VWK A;  4CEB A;  3TAG A;  5FRN A;  2FBX A;  1IO2 A;  4F3O A;  1S6P A;  5I42 A;  2HHU A;  3M8P A;  3AO2 A;  3KD1 E;  4E1N A;  4KAZ A;  4CK2 A;  4FLU A;  3V9U A;  3RRH A;  5KTQ A;  4W5T A;  3QEV A;  1N5Y A;  4KB1 A;  4OPJ A;  4CEQ A;  4BDY A;  4NCG A;  4I7F A;  1RTI A;  3LPT A;  4EP5 A;  4DF4 A;  3QNN A;  1ZBI A;  4E7L A;  4CJQ A;  4FLV A;  3CM6 A;  1MU2 A;  4O55 A;  4CGH A;  1HMV A;  1RNH A;  4YNQ A;  3SV4 A;  4F2S A;  4RG8 A;  4KI4 A;  2YNH A;  3K59 A;  5KGX A;  4AHR A;  4AHS A;  3RRG A;  2DTU A;  1U49 A;  2XRI A;  2ZQB A;  3ZSR A;  3O4Q A;  4KHY A;  1JLF A;  3MEE A;  3NDK A;  3LDS A;  3K2P A;  4DTM A;  4DTO A;  4K8Z A;  3IS9 A;  1RIL A;  1L5U A;  4B9T A;  4KRE A;  3JYT A;  3C6T A;  1X9S A;  4M3Z A;  4DQS A;  3DLE A;  4QOZ B;  4GVM A;  4M41 A;  1KLM A;  3U3Y A;  3HJF A;  2B5J A;  4EZ6 A;  1BI4 B;  4OJR A;  3OYJ A;  1C6V A;  4FZY A;  1TVR A;  3DLG A;  3ZSQ A;  2YKN A;  1RBS A;  3OYK A;  1QTM A;  2E4L A;  4M3U A;  5CYQ A;  2FBT A;  1S9E A;  2XY8 A;  3DMJ A;  4YFU A;  3AA3 A;  1F21 A;  3VQ4 A;  4DFJ A;  3TAN A;  1QSY A;  1KLN A;  1JLB A;  4DS4 A;  3ISN C;  1RT1 A;  2GBZ A;  3HT3 A;  4IKF A;  3SQ2 A;  3K5N A;  4E1M A;  1ASU A;  2O4G A;  2I5J A;  2XHB A;  1Z25 A;  4CHY A;  2P51 A;  5I3U A;  4M42 A;  1S1V A;  1L3U A;  4FM0 A;  1NKE A;  1U48 A;  3KKS A;  5HRR A;  3DLK A;  4PA1 A;  4F8R A;  4R5P A;  4DS5 A;  5FDL A;  4DWI A;  2Z1I A;  4E0D A;  1BHL A;  3F9K A;  4LH4 A;  4C8M A;  2YHA A;  4HVJ A;  1WSH A;  3AA2 A;  1EP4 A;  4CEF A;  2BGG A;  3VA3 A;  1XHZ A;  1QSS A;  1QHT A;  1JL1 A;  2RPI A;  4FK2 A;  3QEW A;  5HP1 A;  1T03 A;  3OYN A;  4FLZ A;  1TK5 A;  4LD0 A;  3VQP A;  4CHZ A;  1KVB A;  1RBU A;  3TAP A;  2G8V A;  4KRF A;  1BIS A;  3VA0 A;  1HQE A;  2ATQ A;  4DLE A;  3ULD A;  2AJQ A;  1A5X A;  1LAV A;  2PYL A;  3L2R A;  3QIO A;  4FLY A;  3SCX A;  4W5N A;  3KTQ A;  4DQP A;  2KQ2 A;  3L3U A;  3IG1 A;  1VSF A;  3RWU A;  2YNF A;  1IKV A;  3NF8 A;  1NJZ A;  1CXU A;  2D0C A;  3QEP A;  4HCC A;  3K5O A;  3KK3 A;  2F8S A;  3O4N A;  4PQU A;  3VQ5 A;  3LWL A;  1I3A A;  1NOZ A;  1S1T A;  5CY4 A;  2JLE A;  3V9Z A;  1BGX T;  3OYL A;  1RDA A;  2EX3 A;  2BE2 A;  3CM5 A;  4ZTF A;  1D8Y A;  3U3G A;  4FK0 A;  3IAY A;  2QKB A;  1RTH A;  4IBN A;  5K14 A;  3SUN A;  3PY8 A;  4Q5V A;  1L3S A;  1X9W A;  2OZS A;  1XI1 A;  4BE2 A;  3QES A;  1G15 A;  1T7P A;  5HBM A;  1IKW A;  3MXJ A;  4Z4G A;  3DM2 A;  5EU7 A;  1ZBL A;  4C8K A;  1WSG A;  2KW4 A;  4LSN A;  4DU3 A;  1SL0 A;  3PV8 A;  4W5R A;  1NK0 A;  3HPO A;  1O1W A;  4ZHR A;  1KTQ A;  1J5O A;  3BDP A;  4PY5 A;  1VSJ A;  2OPS A;  4M3W A;  3SNN A;  5J2M A;  1UA0 A;  3PX6 A;  1VRU A;  1S6Q A;  3EYZ A;  4FJH A;  3SYZ A;  4OKK A;  3HL8 A;  1BQM A;  4BAC A;  3T19 A;  1ZBH A;  4CJW A;  3WNF A;  3HYF A;  3L2Q A;  3DOL A;  1DTQ A;  2X78 A;  4JLH A;  4BE0 A;  3NH2 A;  1EX4 A;  4C8L A;  3LP0 A;  4AHC A;  4E7I A;  3MED A;  3KK2 A;  1HJR A;  4DTU A;  3AVH A;  1UWB A;  1JLG A;  2FC0 A;  4CIE A;  3PO4 A;  3LAN A;  4OLA A;  1HPZ A;  2OPP A;  3CYM A;  3CFO A;  4OGE A;  3SV3 A;  1QS4 A;  3KLI A;  2IC3 A;  1Z26 A;  1YTA A; 
#chains in the Genus database with same CATH topology
 2QKK A;  2HND A;  5AQZ A;  1BIZ A;  1S1W A;  1J53 A;  3CD6 N;  3CXC M;  1RT4 A;  4NLB A;  3RR7 A;  1C0F A;  1Z6R A;  3VEW A;  3OS1 A;  5BN9 A;  2Q1N A;  4H0X B;  4HWI A;  3VQ8 A;  3AGR A;  4ISF A;  2D0P A;  4AHV A;  4DTP A;  2Z1H A;  5LL6 Z;  3L6Q A;  3QEX A;  1MWM A;  4JHD B;  4I6M B;  4UY8 O;  1TAQ A;  3TSQ A;  4G9Z A;  4QCL A;  4RW4 A;  3MN7 A;  1N6Q A;  4BR2 A;  2IS3 A;  3GE1 A;  3ID6 A;  1N33 K;  3IMX A;  4CJK A;  3L3V A;  4DR4 K;  1D5A A;  1VSM A;  3NGY A;  3BZC A;  3QML A;  3NHG A;  3AVJ A;  1XNR K;  2W42 A;  1QZ5 A;  3V6D A;  2XY7 A;  3OYH A;  3C7N A;  2VYP A;  3ZSY A;  4YOR A;  5C15 A;  3AO1 A;  1M1K O;  4LFC K;  3VTI A;  4Z4E A;  3CG7 A;  2HBJ A;  4G1Q A;  1IG8 A;  4X62 K;  2DFH A;  1T8E A;  1LWE A;  3MK6 A;  3LWM A;  3OJU A;  4FWN A;  4ELU A;  4DR1 K;  4B1V A;  3HXM A;  1NMN A;  4M45 A;  4CJ4 A;  1WSE A;  1YIJ N;  2F9T A;  4DV3 K;  1K8K A;  3OYE A;  1VK0 A;  4ZTJ A;  4DR5 K;  1T44 A;  2FLO A;  1ASV A;  1T3V A;  4LY7 A;  1QHA A;  2VG6 A;  4FJX A;  3ZET A;  2CH5 A;  4BC5 A;  2P9S B;  3SBG A;  4OKE A;  2VGM A;  1NK7 A;  3RMD A;  3ZLJ A;  5KRS A;  1OH7 A;  4JEP A;  5BRE A;  4GW6 A;  4KHN A;  4NLC A;  2RF2 A;  2GWK A;  3MX5 A;  1BOT O;  3L0Q A;  1U4B A;  4BGA A;  4N41 A;  3ZCM A;  4EZ9 A;  4OPH A;  2A5X A;  4L3Q A;  4CK3 A;  1HNV A;  4GV9 A;  3FFK B;  4ILJ A;  4DSK A;  4U67 L;  3PSI A;  3C7N B;  2HVH A;  3PX4 A;  1SL2 A;  3ITH A;  4KHQ A;  4CGD A;  4FCY A;  5BPL A;  1ATN A;  4O8K A;  3PIO L;  1VQN N;  1NGI A;  3V9W A;  3W0L A;  4A2B A;  1VHX A;  1R0A A;  1RTJ A;  1NJX A;  4H5W A;  1K6Y A;  5E26 A;  4BC2 A;  3B6O A;  4E3S A;  4DSL A;  1K8A O;  4I9Q A;  1TYQ A;  2YX6 A;  1K8K B;  3O80 A;  3WNH A;  4B1Z A;  2HMI A;  3KJV A;  2E6L A;  4IEE A;  4E19 A;  2ZWH A;  3OYI A;  1VQ7 N;  2G8W A;  5AZI B;  4CJU A;  5HL7 L;  1GLJ O;  3V1O A;  5AQO A;  4DU1 A;  4FWP A;  4BRF A;  5BPM A;  4JKF A;  1GLE G;  3VQC A;  3VQ6 A;  3G0Z A;  4IDH A;  4YOY A;  2P9P A;  4N5S A;  2Q3S A;  1ATS A;  3AAP A;  3HM9 A;  1NGH A;  4BRP A;  1M90 O;  4CF8 A;  1U47 A;  3W3D A;  1TK0 A;  4DUY K;  4FJI A;  3H45 C;  3DRP A;  3THW A;  4CZF A;  4MDA A;  4F9O A;  4BC3 A;  2HVI A;  1UOC A;  1U2V A;  3QIP A;  4IDK A;  2W41 A;  2V52 B;  4LF5 K;  3ZSW A;  4DUZ K;  5KPZ A;  4B9Q A;  3BF1 A;  4CK1 A;  1A5V A;  4KV8 A;  4E89 A;  1LOT B;  3SUO A;  3TAF A;  1NOY A;  3HP9 A;  4RW9 A;  1VRT A;  4HUF A;  3RTV A;  4CD1 A;  4DTJ A;  3H46 O;  4ELT A;  4J2B A;  4J8F A;  2W40 A;  1YI2 N;  2KZM A;  2DY4 A;  1YJ9 N;  3I0R A;  3O8M A;  4ILG B;  2GV9 A;  4KHW A;  4AM6 A;  4NXM K;  4O5F A;  4LSL A;  4BVP A;  1GLD G;  3QLH A;  4LFA K;  4JKG A;  1KVC A;  2KLA A;  2VWB A;  5HRP A;  1D4X A;  3D7E O;  3HVR A;  4A57 A;  5BRH A;  4CJE A;  4IO8 A;  1VSE A;  3C0B A;  4FSV A;  3VTH A;  4BWJ A;  1I39 A;  1IJJ A;  3BZK A;  4CHN A;  3M8S A;  3PLA A;  3V9X A;  3K57 A;  3THW B;  4OGC A;  4DU4 A;  2X74 A;  4JS4 A;  5I9E B;  3GG4 A;  1VSH A;  2ITG A;  5DMR A;  4C8N A;  4OPK A;  2PFU A;  4CJL A;  4CJF A;  2IVN A;  1QE1 A;  2P9U A;  1VQK N;  4EHU A;  1LWF A;  1RT3 A;  2OCE A;  3O6W A;  1B9F A;  4N56 A;  2ZJP L;  2JWL A;  1O13 A;  2DPN A;  3J7Z O;  4M7X A;  3ENH A;  4CGF A;  3ZT4 A;  2XY6 A;  2A41 A;  3QIN A;  4BR7 A;  2A1R A;  4CER A;  3KK7 A;  2QXF A;  3B6P A;  2KHO A;  1WBB A;  3NCI A;  3MCA B;  5SWM A;  1HNX K;  4JKA A;  2JGU A;  4AHT A;  3AGK A;  3CCS N;  3SUP A;  2P5G A;  1RBT A;  1RDC A;  1XWL A;  1EQY A;  4MFB A;  4NYF A;  5FPD A;  3P83 D;  4CF0 A;  5F2R A;  4FJK A;  4CEC A;  2P1J A;  3ZSX A;  4BG8 A;  2NRV A;  1JLC A;  1GOA A;  3U4L A;  4NCA A;  3DXK B;  2BUP A;  2QWL A;  1NJI O;  4CEA A;  1T6C A;  4CBU A;  4CEB A;  3WXI A;  3HOS A;  2HHU A;  4E1N A;  5KQD A;  4KB1 A;  4EP5 A;  3QNN A;  3D2E A;  5KQ8 A;  2P9U B;  1HMV A;  4CGH A;  1RNH A;  1S22 A;  1VQM N;  3FZH A;  4RG8 A;  3BP8 A;  5BR8 K;  5KGX A;  4EIA A;  1VQ4 N;  3VEO A;  4H0Y B;  3O4Q A;  3F9M A;  3NDK A;  4DTM A;  4DTO A;  5LMU K;  1GLL O;  4K8Z A;  4M3Z A;  3VOV A;  4M41 A;  3FZK A;  2QXL A;  3HJF A;  1C6V A;  3DLG A;  1RBS A;  1QTM A;  2YHW A;  2ZJR L;  1S9E A;  3DAW A;  3HSC A;  3DMJ A;  4X66 K;  3VQ4 A;  1QSY A;  1JLB A;  1NGA A;  4KBO A;  4IKF A;  4JI1 K;  3K5N A;  4E1M A;  2O4G A;  1Z25 A;  3CCL N;  4F8R A;  1ATR A;  3M3Z A;  4KH5 A;  2Z1I A;  2W6L A;  4E0D A;  5AQF A;  3MCP A;  1QSS A;  1JL1 A;  2RPI A;  2GEL A;  4ILH A;  1T03 A;  2F9W A;  4FLZ A;  1KVB A;  3VES A;  1HQE A;  2ATQ A;  4IZ9 A;  4DLE A;  3ULD A;  2AJQ A;  3R3L A;  3QIO A;  4DQP A;  2KQ2 A;  3HZ6 A;  3K5O A;  4LFB K;  5CY4 A;  1R59 O;  3OYL A;  5AQX A;  3U3G A;  4FO0 A;  5LJV A;  1XI1 A;  1IBM K;  3TTC A;  3E9O A;  3QES A;  1G15 A;  1T7P A;  5HBM A;  1VQL N;  2F7T A;  3K9J A;  3DM2 A;  3E1Y A;  3EE9 A;  1J6Z A;  4DV0 K;  5AQU A;  5JVH L;  3PV8 A;  4PY5 A;  3TSU A;  3BDP A;  2IIR A;  4BR0 A;  1H1V A;  4FJH A;  3SYZ A;  2FSJ A;  1BA1 A;  3CF5 L;  2GEM A;  3SAF A;  1XC3 A;  2NLX A;  3DOL A;  1NU0 A;  4BE0 A;  4C8L A;  4JI0 K;  2ITM A;  4AHC A;  1HJR A;  4DTU A;  3AVH A;  1JLG A;  3THY B;  1HPZ A;  3CFO A;  3SV3 A;  5AFU A;  3CCE N;  1MWK A;  1Z26 A;  3FR0 A;  3QET A;  2GX9 A;  2VWJ A;  3LDO A;  5JMV A;  1Q81 O;  3WXM B;  2ZE2 A;  1WSF A;  3HST B;  3CMA N;  3RMB A;  4CZH A;  3ZSO A;  4YOW A;  2PAV A;  1LWC A;  3LM2 A;  3U6F A;  1S72 N;  3AVC A;  3KLE A;  1NLV A;  1WAJ A;  2YV0 X;  4B08 A;  2P9I A;  4BGB A;  4F3T A;  2D1K A;  5GAE P;  1EKE A;  4YY3 K;  3QBW A;  1KRP A;  4JD2 A;  5AQY A;  2JWK A;  1YUW A;  2IVP A;  5GAH P;  2PBD A;  1JLE A;  4F2R A;  4DV2 K;  5T7B A;  3MEG A;  3TAE A;  1X3N A;  3QB0 A;  4EP4 A;  4EHT A;  4MDB A;  1KCF A;  3O9T A;  3H1Q A;  3M1F A;  3I0S A;  3LP2 A;  1IBK K;  1TL1 A;  2IDO A;  3CC7 N;  3O9S A;  3MDQ A;  3BY5 A;  4HTU A;  1C1A A;  1W0H A;  4E7K A;  5AZJ B;  3OS0 A;  4BRG A;  3VQA A;  4GKK K;  3LM9 A;  2VQF K;  3AVM A;  2BAN A;  3VQ9 A;  4ISG A;  4CIF A;  3KD5 E;  3O5B A;  4CZM A;  5CE3 A;  3V81 A;  4J2E A;  4ISE A;  3DLL L;  4IG3 A;  2YHB A;  2A3Z A;  4HTL A;  4DSF A;  3TAQ A;  4JK8 A;  4BC4 A;  4CF1 A;  3D0P A;  4JS5 A;  1DT9 A;  3ZX3 A;  3M8Q A;  2P9N B;  2RN2 A;  4BE1 A;  3ZT0 A;  4IO9 L;  2VCP A;  3C6A A;  3HVT A;  3AVL A;  3F73 A;  2G8K A;  4QS9 A;  3ZYY X;  2E6M A;  3L8B A;  3S3N A;  4H0P A;  1JL2 A;  4FWS A;  1W2B M;  2G8H A;  1NK6 A;  1GOB A;  4JRQ A;  3P38 A;  2FSK A;  2X6S A;  3S3M A;  2PY5 A;  3GDQ A;  4LF8 K;  2FBV A;  3EO3 A;  2G8I A;  4RCH A;  3CPE A;  3WUH A;  1WSI A;  3HM8 A;  1NNE A;  3O1B A;  4H4M A;  4Z94 A;  1UA1 A;  3RMC A;  3T1A A;  4DKW A;  1W7A A;  5JLH A;  4MO5 A;  3HO1 A;  4IEI A;  3NGZ A;  3V4I A;  4KTW A;  4EAH D;  1C0M A;  1RDU A;  1NBW A;  4FW2 A;  1BO5 O;  2ZF5 O;  4DR7 K;  2NUB A;  1QVF M;  2E2Q A;  3CET A;  3EZW A;  3O1W A;  4EFH A;  3NE6 A;  3DI6 A;  3C94 A;  4B9V A;  1HKC A;  3VET A;  1U6Z A;  3SJJ A;  1FW6 A;  4B3R K;  3U9Z A;  3K9K A;  4K25 A;  4O44 A;  1YVN A;  4CJV A;  2HHX A;  3O4W A;  2EWS A;  4O5B A;  4KKO A;  3RSE B;  3S3O A;  2O8C B;  2ASM A;  1BCM A;  3CJA A;  5GAG P;  3TI0 A;  1NGB A;  1W9H A;  3QNO A;  2DFF A;  2NRZ A;  3AVF A;  4FJ7 A;  1U04 A;  3MN5 A;  4FJ5 A;  1D9F A;  2OA8 A;  1JXE A;  4BRK A;  2A42 A;  1QQN A;  3MXM A;  1JXB A;  1FK9 A;  3DOK A;  4AHU A;  4JI7 K;  2YHX A;  3CME N;  3HI0 A;  5ADX H;  2AP1 A;  1BCO A;  3OYC A;  2ZGY A;  1NGG A;  4B9L A;  2V7Z A;  2OYQ A;  4DMN A;  4CJ7 A;  3R8E A;  1RT7 A;  4RW8 A;  1ILY A;  3LP3 A;  3TWH A;  4R79 A;  2G8U A;  3ZX0 A;  3NBP A;  4QAG A;  4JI5 K;  3ZEU A;  5AQQ A;  4IG0 A;  4JNE A;  2IVO A;  3V9S A;  4CHO A;  3OYG A;  3PX0 A;  1OH5 A;  5JS2 A;  2F8T A;  3N4P A;  4H5N A;  3CCV N;  3AO3 A;  3AO4 A;  1T6D A;  4CFB A;  3Q7C A;  4XIU A;  1WSJ A;  3NH1 A;  1L3V A;  4IXC A;  1LV5 A;  1K9M O;  1XNQ K;  4PL7 A;  3G25 A;  2Y1I A;  2KZZ A;  4FLT A;  4B9N A;  4KO0 A;  4CHP A;  3G4S N;  4FYD A;  3OJS A;  3DLH A;  1MDU B;  2HNY A;  3DLR A;  4KPY A;  1XC9 A;  3PO5 A;  5CR4 A;  2YJE A;  3LAL A;  3THV A;  4DR6 K;  3HBT A;  1QQM A;  2ASO A;  1ITG A;  3CJ7 A;  1N36 K;  4CZL A;  4J2D A;  4DTR A;  2E2N A;  2E88 A;  2GUP A;  4CGJ A;  5KGW A;  1BL3 A;  4DFK A;  3VEN A;  3E9P A;  3SQ1 A;  3NMU A;  3AV9 A;  3O3H A;  4A5B A;  5J2Q A;  1KD1 O;  3QO9 A;  5EX5 A;  1S1U A;  3KHY A;  3HK2 A;  3LDL A;  4XH5 A;  4DQQ A;  3C65 A;  3KIO A;  2VG5 A;  2FBY A;  4CFA A;  4Z4F A;  2HHW A;  1QZ6 A;  2UYT A;  4HHT A;  5TKW A;  1DLO A;  3TAM A;  1QVG M;  2ASP A;  5AQG A;  4A5A A;  1JKH A;  3J81 O;  3EEQ A;  1Q9X A;  4L8R B;  3EZ5 A;  2LSN A;  3L2V A;  3ZET B;  3GOI A;  3N4Q A;  2HHH K;  4KFB A;  2IOC A;  3H08 A;  3SK3 A;  1CZA N;  3SPZ A;  5HLF A;  1N8R O;  5J2P A;  1ZYQ A;  3UIQ A;  3IDH A;  1C1B A;  1VQP N;  4ID5 A;  1RT2 A;  3AA4 A;  5ELZ A;  1JLQ A;  1FKP A;  1NM1 A;  1RBR A;  2Q31 A;  4JKC A;  2FBX A;  5IT9 O;  4F3O A;  1S6P A;  5I42 A;  3M8P A;  4KAZ A;  4CK2 A;  3V9U A;  3RRH A;  4W5T A;  3QEV A;  4YOX A;  3CHW A;  1E4F T;  3CIP A;  4DF4 A;  3RVC A;  3CM6 A;  5M1F A;  3J80 O;  1I94 K;  4H5V A;  4FWQ A;  3SV4 A;  4QS7 A;  2YNH A;  4IOC L;  3O9Q A;  4U7B A;  3OA9 A;  3JXU A;  3IS9 A;  4WYB A;  1L5U A;  2BTF A;  4KRE A;  4FOE A;  3DLE A;  4QOZ B;  1OVQ A;  3FE1 A;  1KLM A;  2B5J A;  3MN6 A;  1TVR A;  1GLB G;  1TYQ B;  5BPN A;  4AQY K;  5CYQ A;  2FBT A;  4YFU A;  1KLN A;  1F21 A;  3TAN A;  4LF7 K;  2Q0R A;  1RT1 A;  2WBN A;  2GBZ A;  3HT3 A;  2NRR A;  3SQ2 A;  5I3U A;  1S1V A;  4FM0 A;  3L4Q A;  1U48 A;  3KKS A;  3DLK A;  4PA1 A;  4R5P A;  3WXK A;  4JK9 A;  1BHL A;  2HBL A;  3AA2 A;  1EP4 A;  3VA3 A;  2QEX N;  5AQS A;  2P9P B;  5DM6 L;  5AQL A;  4LD0 A;  3UKU A;  3B8A X;  3G71 N;  4B3M K;  1BIS A;  4YDU C;  2AA4 A;  3L2R A;  4W5N A;  2RHK A;  3KTQ A;  3LDN A;  3ULE A;  3HRG A;  4FPB A;  1KXP A;  4PQU A;  3PIP L;  4YDU A;  3CC4 N;  3LWL A;  2JLE A;  1KQS M;  3V9Z A;  1BGX T;  1RDA A;  2QWR A;  4C1N I;  3IAY A;  4IBN A;  1U2V B;  5K14 A;  3ENO A;  5IWA K;  1X9W A;  2UXD K;  3UKR A;  5BR9 A;  4BE2 A;  4WF9 L;  3ENB A;  4K0K K;  1MA9 B;  4BRQ A;  3GBT A;  3A0I X;  4B1W B;  3WXJ A;  4QS8 A;  3ATU A;  4C8K A;  3R6M A;  4DU3 A;  1SL0 A;  3U9D A;  3HPO A;  4ZHR A;  4WCE L;  2OPS A;  3LDQ A;  1E4G T;  1UA0 A;  3PX6 A;  4OKK A;  5FPE A;  2QM1 A;  4K41 A;  3MED A;  3KK2 A;  3CC2 N;  1HUX A;  1UWB A;  4BRL A;  2FC0 A;  4JKG B;  3LAN A;  4OLA A;  4PHT X;  3CQY A;  5MLC Q;  4E1J A;  1C0T A;  1YTA A;  1REV A;  4M3X A;  3T1Y K;  2FXU A;  2QTD A;  3T3F A;  1B92 A;  4BY9 C;  3OHR A;  3HTV A;  1BDG A;  5LMN K;  5FRO A;  2D4W A;  3HPH A;  3VEZ A;  5EY4 A;  1K73 O;  2A40 A;  3ZSZ A;  2KKZ A;  4FL9 A;  5C12 A;  3A5L C;  2FF6 A;  4GMJ B;  1TV6 A;  2HMP A;  3UKR B;  3BEX A;  2NRW A;  4H0T B;  4MQ3 A;  5CHI A;  3LPU A;  4DFP A;  1NKC A;  4CFC A;  1LW0 A;  1S5J A;  1X9J A;  2B4J A;  4FXD A;  4KHS A;  4FLX A;  1NWK A;  4KRF A;  4M3R A;  2RKI A;  5D3G A;  4H0O A;  1RDW X;  3OVN A;  1SQK A;  1HNW K;  1P90 A;  5BRD A;  3CFR A;  3T69 A;  1WBD A;  1WAF A;  1IG9 A;  3NVM A;  1BQN A;  3KVG A;  1TKD A;  4CD3 A;  1JLA A;  4BR5 A;  4I2P A;  4Z4I A;  4FZZ A;  1IV0 A;  3M5R A;  3QER A;  3LDP A;  1DTT A;  2D0A A;  1FKO A;  4LH5 A;  3THX A;  5HOO A;  2UU9 K;  1OVY A;  2ETJ A;  2DFE A;  5BRF A;  3R9P A;  1KAZ A;  4OX9 K;  3KK1 A;  1J9A A;  1IBL K;  1HRH A;  3D45 A;  3KLH A;  3FZM A;  3FZL A;  1WNS A;  4FOI A;  4HUE A;  2YNI A;  4FK4 A;  1XMQ K;  4H0V B;  4CBX A;  2FSN A;  1WB9 A;  2ZD1 A;  3D2E B;  2QWM A;  4IFV A;  3DLB A;  4GY2 B;  3WXL A;  1RTD A;  4DQI A;  3NAE A;  3H6E A;  3OYF A;  2O4I A;  4KH4 A;  4DTS A;  1EWR A;  2HF4 A;  5KI6 A;  3OTO K;  3R1X A;  4JAX A;  1Q9Y A;  2OPQ A;  3F5T A;  1T05 A;  4JKD A;  1UAX A;  3AA5 X;  1HQU A;  3DRR A;  1FJG K;  4B3S K;  4XEI A;  2HHT A;  2BH1 A;  3VQD A;  2XY5 A;  2QWN A;  4CW7 B;  5AQT A;  3M8R A;  3NF9 A;  4MO4 A;  3SQ4 A;  4CED A;  3CCU N;  4FJ9 A;  2O8E A;  4DTN A;  3EE8 A;  2NRT A;  3I56 N;  1RBV A;  1LW2 A;  4PWD A;  4FM2 A;  4DV7 K;  2UUB K;  4CFD A;  1HKG A;  1ZBF A;  1QQO A;  5FLX O;  4CF2 A;  1LAW A;  4B9M A;  1BI4 A;  3CJ9 A;  1JCE A;  3HP6 A;  2F4V K;  4ICL A;  1ASW A;  5E41 A;  4YOU A;  1VSL A;  4B9U A;  3AVB A;  1S9G A;  4CES A;  4OVL A;  5HRN A;  4KTQ A;  3G6E N;  1ZC6 A;  1YJN N;  4KB0 A;  4DB3 A;  4AF1 A;  2HHQ A;  1HPM A;  3WNG A;  2E8A A;  1J5E K;  2Q36 A;  2NRX A;  1HNZ K;  2Z1J A;  4PL8 A;  5HRO A;  4AH9 A;  4CJ5 A;  3K5M A;  3MWT A;  1YIT N;  4NYN A;  4AM7 A;  3MAQ A;  4K42 A;  3ASM A;  1OH8 A;  5CZ1 A;  4BDP A;  3LZJ A;  2D0B A;  4DF8 A;  3TU5 A;  3WEE A;  4C1N K;  1RCH A;  4AIL C;  3SJH A;  2X6N A;  1VSK A;  4Y0W A;  1KFD A;  2CGJ A;  3KLF A;  1C0U A;  2O8E B;  3AY9 A;  3SUQ A;  1YTU A;  1NGF A;  4WFB L;  1EET A;  4KHU A;  3LAM A;  3KWI A;  2UUA K;  4JKH A;  4Z4H A;  2UXB K;  3IRX A;  4BRM A;  4FJJ A;  3CI5 A;  3VN5 A;  5C10 A;  1NK5 A;  5TKY A;  2VG7 A;  3EKS A;  2B6A A;  2GWJ A;  3O3F A;  1GOC A;  3TTF A;  3WNE A;  1Q8I A;  3LL3 A;  4FW1 A;  4CCH A;  1SKS A;  3RMA A;  2P9I B;  5AQM A;  3ALY A;  4DQR A;  1VQ9 N;  3SI6 A;  4FLW A;  4CZE A;  2KFN A;  1NGJ A;  1TL3 A;  4JD2 B;  1KVA A;  2WTU A;  4BRA A;  4FZX C;  5C24 A;  4CF9 A;  5M1Q A;  3FLC O;  1NGC A;  3AVA A;  5JS1 A;  1KFS A;  1Q18 A;  3GL1 A;  4Z0U A;  3QEI A;  1YHQ N;  4BRE A;  3NF6 A;  3DWL A;  4CEZ A;  4MLE A;  5DK5 A;  3SPY A;  4GV3 A;  4CEO A;  4XH1 A;  4I6M A;  4WFN L;  3AVI A;  5F1X A;  5JVG L;  3CJC A;  4O8U A;  1TKX A;  2HF3 A;  3UE5 A;  1YT3 A;  1LCU A;  2OZM A;  3VEV A;  2PYJ A;  5BN8 A;  3CCQ N;  2PZS A;  2E2O A;  1QSL A;  3AAQ A;  4DV5 K;  4CJT A;  1BA0 A;  1TGO A;  2HNZ A;  1WUA A;  4C8O A;  4WFA L;  4NB4 A;  4RW6 A;  3E01 A;  1HR0 K;  4BVO A;  1BU6 O;  4M3T A;  4CJ3 A;  5AQW A;  3CPW M;  4BRO A;  5HRS A;  2NRH A;  1YAG A;  4FJM A;  1S3X A;  1GLF O;  4B9S A;  5GIN A;  4K8X A;  1QQC A;  4DSJ A;  4KHP K;  3SZ2 A;  1W97 L;  2YCH A;  5M1O A;  3ZX2 A;  3OYD A;  4RW7 A;  3MWP A;  3C6H A;  3JSM A;  3KKR A;  3VF4 A;  4FJN A;  1RDD A;  2CH6 A;  4IOX A;  5KRT A;  2VWK A;  3TAG A;  2HST A;  5A2Q O;  3AO2 A;  3KD1 E;  2P9S A;  2YJF A;  4FLU A;  5KTQ A;  1WOQ A;  4CEQ A;  5M1P A;  4I7F A;  1RTI A;  3LPT A;  1ZBI A;  4GNI A;  4CJQ A;  4E7L A;  4FLV A;  2HBK A;  4M63 C;  1ZXO A;  1SZ2 A;  5EVZ A;  4F2S A;  4KI4 A;  3K59 A;  2DTU A;  3RRG A;  2XRI A;  3ZSR A;  1JLF A;  3MEE A;  3LDS A;  3K2P A;  4PKH A;  3JYT A;  3C6T A;  4DQS A;  4GV6 A;  4GVM A;  1RGI A;  4DHY A;  5FPN A;  4OJR A;  3H3O B;  4FZY A;  3ZSQ A;  2YKN A;  5GAD P;  2QW9 A;  3OYK A;  2E4L A;  1XQS C;  4CBW A;  1N32 K;  4DS4 A;  3ISN C;  2E20 A;  4CHY A;  2P51 A;  1KAY A;  1HJO A;  1NKE A;  2ZM6 K;  2RE2 A;  4DS5 A;  5FDL A;  4YOV A;  1RFQ A;  3F9K A;  3T7Z A;  4JK7 A;  4C8M A;  2YHA A;  4HVJ A;  1WSH A;  2BGG A;  2Q97 A;  1XHZ A;  4IFE A;  5E84 A;  4FK2 A;  2D0O A;  3QEW A;  4FVU A;  4OPA A;  3OYN A;  1C0G A;  1TK5 A;  4CHZ A;  1RBU A;  3VA0 A;  4JYA K;  1A5X A;  1LAV A;  3SCX A;  2NNW A;  4BRI A;  2E5L K;  2O8B A;  4LF4 K;  1VSF A;  3RWU A;  1IKV A;  3NF8 A;  3QIC A;  1NJZ A;  2D0C A;  3QEP A;  2O8D A;  5AZI A;  3KK3 A;  1TUY A;  3VQ5 A;  1NOZ A;  1S1T A;  3P4I A;  2GTD A;  2BE2 A;  4ZTF A;  3SUN A;  3OBW A;  3PY8 A;  4Q5V A;  3CCR N;  3O08 A;  2OZS A;  2Q0U A;  5B8H A;  3J7A P;  5C0Y A;  1P8Z A;  1IKW A;  4M7Y A;  4K43 A;  2E1Z A;  2Q2R A;  3BUZ B;  1NGD A;  4B3T K;  4JI2 K;  1VQ8 N;  2O8F A;  3ZEU B;  1WSG A;  3VGM A;  4W5R A;  1O1W A;  3MN9 A;  1KTQ A;  1VSJ A;  3Q7B A;  5J2M A;  4LF6 K;  3EKU A;  2OTJ N;  2J4R A;  1OKJ A;  1VRU A;  1S6Q A;  3EYZ A;  1BUP A;  1V4S A;  4DV1 K;  1ZBH A;  4CJW A;  3HYF A;  1DTQ A;  2X78 A;  4JLH A;  3WQT A;  4DCH A;  3NH2 A;  4H03 B;  5EOY A;  3VGK A;  5JIC A;  4LF9 K;  1XUP O;  4CIE A;  3PO4 A;  3CYM A;  1TUU A;  3DXM A;  4B1Y B;  1QS4 A;  3KLI A;  2IC3 A;  5LJW A;  1DEJ A;  2QWP A;  4B3O A;  1HYS A;  4WE1 A;  5KPT A;  4ID1 A;  2O8B B;  2NZT A;  4GVE A;  4UQG A;  2IGI A;  3SMP A;  4BRD A;  3IUC A;  1N34 K;  3VQE A;  4JI4 K;  1ZBU A;  4A62 A;  3NGI A;  4E7H A;  2O8D B;  4HCB A;  3OS2 A;  2P9K A;  4B8A B;  5AFU H;  2BDP A;  1D9D A;  2HB5 A;  4PKI A;  4CE9 A;  5FRM A;  3L2U A;  1OH6 A;  4CJS A;  2IAJ A;  1VAZ A;  1TKT A;  3MX2 A;  4CI6 A;  4N76 A;  1JCF A;  4BR4 A;  4Z4C A;  1V4T A;  4CZI A;  5CZ2 A;  4Q0B A;  3JS6 A;  2O8F B;  1Q7Y O;  1VSD A;  1SUQ A;  3K5L A;  4JI6 K;  1X9M A;  5J2N A;  2WC9 A;  2HOE A;  2Z1G A;  1CZ9 A;  2P5O A;  4CGI A;  1NK9 A;  2F96 A;  3TPQ A;  1CZB A;  5H1S Q;  3CJ1 A;  1SV5 A;  4CIG A;  3ZT1 A;  4CZK A;  3A5O C;  2YNG A;  3OYM A;  3C95 A;  2Y1J A;  4J2A A;  1X1P A;  3S41 A;  3VPZ A;  1G99 A;  2UUC K;  1RT6 A;  4H8K A;  1Q86 O;  3ZSV A;  3BF3 A;  3EL2 A;  3SMS A;  3CFP A;  3HOT A;  3SBT A;  1FXX A;  3SQ0 A;  4KH6 A;  3IKM A;  3DXM B;  1A5W A;  3V1R A;  3LZI A;  2P9L A;  1VQO N;  4A2A A;  3CQX A;  1YJW N;  1NK8 A;  2HW3 A;  3DRS A;  1XMO K;  4FWK A;  2XO7 A;  5AQJ A;  3J8A A;  4DSE A;  2HHV A;  3DYA A;  4FPA A;  3VF2 A;  4BQZ A;  2A1S A;  1BIU A;  1WLJ A;  2P9K B;  4PKG A;  3NVK A;  5AQI A;  3ZT3 A;  4JV5 K;  4Y1C A;  1JCG A;  3AVK A;  4OLB A;  1SS6 A;  3CJB A;  3WQU A;  5F0X A;  3S9H A;  4CJR A;  3KLG A;  3DXK A;  4BWM A;  3VQQ A;  4CHQ A;  1IKY A;  3TAR A;  5LY3 A;  5AQV A;  1WN7 A;  3QBX A;  1TKZ A;  3I8D A;  2GUI A;  3C6U A;  3NFA A;  1DKG D;  2VQE K;  4O4G A;  3VER A;  2G8F A;  2EHG A;  1NJW A;  1KAX A;  2WON A;  4JI3 K;  4H4O A;  4BRN A;  1YF5 L;  3G10 A;  1YXQ A;  4GKJ K;  1RT5 A;  3IFR A;  3SAH A;  2QWO A;  4W5O A;  4CZG A;  4CZJ A;  5GIO A;  3VMF B;  4F4K A;  1CLQ A;  1IKX A;  1IH7 A;  5C2D A;  4PUO A;  4NO7 A;  3ZT2 A;  3K0S A;  4IJN A;  2D5R A;  3T1H K;  2P9L B;  3UKU B;  4O0J A;  5AR0 A;  1NKB A;  4OO1 J;  3P5J A;  4WQ5 C;  1DGK N;  1HKB A;  4CVN E;  3ULE B;  4DTX A;  4CJP A;  3AVN A;  1U45 A;  4WQ4 C;  3CQ8 A;  4JRP A;  3I8B A;  3VF6 A;  3RR8 A;  4I2Q A;  3I55 N;  4FJL A;  1HX1 A;  3OY9 A;  4WQ5 A;  4M3Y A;  4O0I A;  4DG1 A;  5C42 A;  1NK4 A;  4WQ4 A;  4IWV A;  5JLF A;  5ADX A;  1Z05 A;  2YHY A;  3P1G A;  5M1N A;  1E3M A;  3NF7 A;  1J54 A;  2E2P A;  4IOA L;  2V51 B;  4X65 K;  2H3G X;  1GLC G;  4FM1 A;  3LAK A;  1RDB A;  4DFM A;  5M1K A;  1HLU A;  3TTD A;  4BRC A;  1VSI A;  5AQP A;  4YHH K;  4FJG A;  3CER A;  2FF3 B;  3V1Q A;  3AO5 A;  3FGU A;  3VQ7 A;  2CGK A;  3AVG A;  1HYV A;  2R7Y A;  1L3T A;  3MXI A;  3TSP A;  4DV6 K;  5DM7 L;  3OW2 M;  4I9L A;  3TAB A;  1NJY A;  1ESV A;  3EY1 A;  3LP1 A;  2QWQ A;  1SL1 A;  4TSX A;  5SZT A;  3VEY A;  1SKW A;  3F2K A;  3H1V X;  3FZF A;  2YKM A;  2E1Y A;  2ZGZ A;  4W5Q A;  3DJC A;  1B9D A;  3M6G A;  4FWL A;  3THY A;  5J1E A;  1HNI A;  4NXN K;  3KWG A;  4FJ8 A;  2QI2 A;  4IFY A;  2KFZ A;  4DR3 K;  3PUF A;  4FWR A;  3A5M C;  1HYZ A;  5C2F A;  3K58 A;  4NCB A;  4CEE A;  2WUS A;  4FVM A;  4DLG A;  4RTF D;  1VQ6 N;  1TK8 A;  2YI1 A;  3AAR A;  1Y97 A;  4E7J A;  4KTZ A;  3KZB A;  3OYB A;  1BG3 A;  3NH0 A;  2OPR A;  2WOM A;  3FFI A;  4H5T A;  3VEX A;  3HPG A;  4Y1D A;  3UB5 A;  3MEC A;  4B1U B;  4CGG A;  3VQB A;  4IJA A;  1NMD A;  4KI6 A;  4BR9 A;  2QK9 A;  5C25 A;  4JKE A;  4OKJ A;  3J7Y P;  1CXQ A;  5FPM A;  1GLA G;  3A8Y A;  3A2F A;  4B8C A;  1BWF O;  3THX B;  3P31 A;  2I7N A;  3ATV A;  4V19 S;  5AQR A;  2A6A A;  1JJ2 M;  1SKR A;  2OAN A;  3O9U A;  3CCJ N;  4XH4 A;  3TR8 A;  4DV4 K;  4H5R A;  3A5N C;  2HHS A;  4DSI A;  2KTQ A;  4YOT A;  3BGR A;  3L4I A;  3QDK A;  3OYA A;  3PSF A;  3O3G A;  1YVU A;  1TAU A;  4N47 A;  1KSP A;  1NGE A;  5AZJ A;  1Y64 A;  1EXQ A;  1XHX A;  4MLH A;  4HUG A;  5CYM A;  2ZJQ L;  1C1C A;  1S1X A;  4BG9 A;  2HBM A;  3L2W A;  2W6K A;  4ELV A;  1EWQ A;  4BDZ A;  5FRN A;  1IO2 A;  3O9R A;  2P9N A;  2QA4 N;  4A61 A;  1N5Y A;  4OPJ A;  3D6R A;  4BDY A;  4NCG A;  4DQ8 A;  3WT0 A;  1MU2 A;  4O55 A;  4BRH A;  4YNQ A;  2VGN A;  4AHR A;  4AHS A;  1U49 A;  2ZQB A;  4KHY A;  1RIL A;  4B9T A;  5GIP A;  1X9S A;  4JKB A;  3OBY A;  3U3Y A;  4JN4 A;  4X64 K;  1BI4 B;  1SAZ A;  3OYJ A;  4EZ6 A;  4LC9 B;  3D2F A;  4M3U A;  3EN9 A;  2XY8 A;  3AA3 A;  4DFJ A;  2V7Y A;  3QFP A;  3P39 A;  3H3N O;  1ASU A;  2I5J A;  2XHB A;  4M42 A;  1L3U A;  5HRR A;  3SLC A;  1KC8 O;  4DWI A;  4LH4 A;  1X3M A;  4CEF A;  2WFB A;  1QHT A;  4B1X B;  5HP1 A;  3I33 A;  5AQN A;  4DR2 K;  3VQP A;  3TAP A;  2G8V A;  2I7P A;  2PYL A;  3VGL A;  4FLY A;  3L3U A;  3IG1 A;  2YNF A;  5AQK A;  1CXU A;  4HCC A;  4C23 A;  1Q82 O;  2F8S A;  3O4N A;  3WEE B;  1I3A A;  3SAG A;  3RSE A;  2EX3 A;  3CM5 A;  5EXW A;  4FK0 A;  1D8Y A;  2O8C A;  4FWO A;  2QKB A;  1RTH A;  1L3S A;  1NG9 A;  4JHD A;  4A59 A;  1ZBS A;  5AJ3 K;  4JI8 K;  1VQ5 N;  3MXJ A;  4Z4G A;  3ID8 A;  5EU7 A;  1ZBL A;  5AQH A;  1EO1 A;  2KW4 A;  4LSN A;  1NK0 A;  5KPR A;  2CGL A;  4FWM A;  1J5O A;  4M3W A;  3SNN A;  3D2F B;  3HL8 A;  1BQM A;  4BAC A;  3T19 A;  3MMV A;  3WNF A;  4BQL A;  3L2Q A;  3JAM O;  2UXC K;  3QFU A;  3E66 A;  1EX4 A;  3LP0 A;  4E7I A;  3CCM N;  2OTL N;  4RWT A;  2OPP A;  3E9L A;  4OGE A;  3U8X A; 
#chains in the Genus database with same CATH homology
 2QKK A;  3QET A;  1REV A;  2HND A;  2VWJ A;  4M3X A;  1BIZ A;  1S1W A;  1J53 A;  4WE1 A;  4B3O A;  1HYS A;  3T3F A;  1RT4 A;  4ID1 A;  3RR7 A;  1B92 A;  2ZE2 A;  1WSF A;  3HST B;  4UQG A;  2IGI A;  3RMB A;  3OS1 A;  3VQE A;  1ZBU A;  5FRO A;  3NGI A;  4E7H A;  3ZSO A;  4HCB A;  3VQ8 A;  3U6F A;  1LWC A;  3HPH A;  3OS2 A;  3AVC A;  4B8A B;  3KLE A;  1WAJ A;  2BDP A;  1D9D A;  2HB5 A;  2YV0 X;  4AHV A;  4B08 A;  4DTP A;  3ZSZ A;  4CE9 A;  2Z1H A;  5FRM A;  3L2U A;  4F3T A;  4GMJ B;  1TV6 A;  3QEX A;  1EKE A;  4CJS A;  2IAJ A;  1KRP A;  1TKT A;  1TAQ A;  4QCL A;  4N76 A;  4RW4 A;  4MQ3 A;  3LPU A;  4DFP A;  1NKC A;  1N6Q A;  4CFC A;  1LW0 A;  2IS3 A;  1S5J A;  4Z4C A;  2B4J A;  4FXD A;  4KHS A;  1JLE A;  4FLX A;  5CZ2 A;  4CJK A;  4Q0B A;  4F2R A;  1VSD A;  5T7B A;  4M3R A;  1SUQ A;  3L3V A;  3MEG A;  2RKI A;  1D5A A;  1VSM A;  3NGY A;  4EP4 A;  3K5L A;  5J2N A;  3TAE A;  1X9M A;  2Z1G A;  5D3G A;  1CZ9 A;  2P5O A;  1KCF A;  4CGI A;  3OVN A;  1NK9 A;  3NHG A;  3AVJ A;  2F96 A;  2W42 A;  3CFR A;  1CZB A;  2XY7 A;  3V6D A;  1SV5 A;  3OYH A;  4CIG A;  3ZSY A;  3I0S A;  3ZT1 A;  2YNG A;  1WAF A;  3LP2 A;  1TL1 A;  3OYM A;  1IG9 A;  1BQN A;  2IDO A;  3AO1 A;  1X1P A;  3C95 A;  2Y1J A;  1TKD A;  4J2A A;  1JLA A;  3CG7 A;  4I2P A;  4Z4E A;  1RT6 A;  4G1Q A;  4H8K A;  3ZSV A;  4FZZ A;  4Z4I A;  4HTU A;  2DFH A;  1C1A A;  1W0H A;  3QER A;  1T8E A;  3CFP A;  1DTT A;  4E7K A;  1LWE A;  2D0A A;  1FKO A;  4LH5 A;  3LWM A;  3OS0 A;  1FXX A;  3SQ0 A;  3VQA A;  2ETJ A;  2DFE A;  3OJU A;  3AVM A;  1A5W A;  3V1R A;  2BAN A;  3VQ9 A;  3LZI A;  4ELU A;  3HXM A;  4CIF A;  4M45 A;  3KD5 E;  4CJ4 A;  1WSE A;  3V81 A;  4J2E A;  3KK1 A;  1NK8 A;  1J9A A;  3OYE A;  1VK0 A;  4IG3 A;  1HRH A;  2HW3 A;  2YHB A;  3D45 A;  3DRS A;  3KLH A;  1WNS A;  2XO7 A;  4DSF A;  4HUE A;  3TAQ A;  4ZTJ A;  1ASV A;  4LY7 A;  4CF1 A;  3D0P A;  2YNI A;  3DYA A;  4JS5 A;  2VG6 A;  4DSE A;  4FK4 A;  2HHV A;  4FJX A;  2A1S A;  3M8Q A;  1BIU A;  2RN2 A;  4BE1 A;  1WLJ A;  4OKE A;  1NK7 A;  3ZT0 A;  3RMD A;  3ZT3 A;  5KRS A;  2ZD1 A;  4IFV A;  4Y1C A;  3DLB A;  4GW6 A;  1RTD A;  4KHN A;  3HVT A;  4DQI A;  3AVK A;  4OLB A;  3AVL A;  3F73 A;  3NAE A;  3S9H A;  2G8K A;  3OYF A;  2RF2 A;  4CJR A;  2O4I A;  2E6M A;  4DTS A;  3KLG A;  4BWM A;  3L8B A;  5KI6 A;  3VQQ A;  4CHQ A;  1U4B A;  1IKY A;  3S3N A;  1JL2 A;  3TAR A;  1Q9Y A;  2G8H A;  1NK6 A;  1GOB A;  4JRQ A;  4N41 A;  1WN7 A;  2OPQ A;  2X6S A;  3ZCM A;  1TKZ A;  3S3M A;  1T05 A;  2FBV A;  3I8D A;  2PY5 A;  4EZ9 A;  1UAX A;  2GUI A;  3C6U A;  2G8I A;  3AA5 X;  1HQU A;  4CK3 A;  1HNV A;  3NFA A;  3DRR A;  4O4G A;  1WSI A;  2G8F A;  2EHG A;  4DSK A;  1NJW A;  2HHT A;  2WON A;  3VQD A;  4H4M A;  2XY5 A;  4H4O A;  1UA1 A;  3RMC A;  3T1A A;  2HVH A;  3G10 A;  3NF9 A;  3ITH A;  3M8R A;  3PX4 A;  1SL2 A;  4KHQ A;  1RT5 A;  3SQ4 A;  4CGD A;  4CED A;  4FCY A;  3HO1 A;  4W5O A;  3NGZ A;  4FJ9 A;  4F4K A;  4DTN A;  3V4I A;  4KTW A;  3V9W A;  1RBV A;  1CLQ A;  1C0M A;  1IKX A;  1IH7 A;  1LW2 A;  4FW2 A;  4PWD A;  4FM2 A;  4CFD A;  1R0A A;  1RTJ A;  4PUO A;  3ZT2 A;  1ZBF A;  2NUB A;  1NJX A;  4CF2 A;  1LAW A;  1K6Y A;  1C0T A;  4E3S A;  2D5R A;  3B6O A;  4B9M A;  1BI4 A;  3HP6 A;  4DSL A;  4I9Q A;  3NE6 A;  3DI6 A;  3C94 A;  4B9V A;  3WNH A;  4ICL A;  1ASW A;  4O0J A;  5E41 A;  1NKB A;  2HMI A;  3KJV A;  1VSL A;  2E6L A;  4B9U A;  3SJJ A;  3AVB A;  1S9G A;  3P5J A;  4CES A;  4OVL A;  5HRN A;  4E19 A;  4DTX A;  4KTQ A;  4CJP A;  3AVN A;  1U45 A;  4O44 A;  3CQ8 A;  3OYI A;  2G8W A;  4CJV A;  2HHX A;  4KB0 A;  4CJU A;  4JRP A;  3RR8 A;  3V1O A;  4I2Q A;  4KKO A;  4O5B A;  4DU1 A;  3S3O A;  4FJL A;  3OY9 A;  4M3Y A;  3VQC A;  4O0I A;  3VQ6 A;  2HHQ A;  4DG1 A;  1BCM A;  3G0Z A;  5C42 A;  1NK4 A;  4N5S A;  3WNG A;  2Q3S A;  2KZZ A;  3TI0 A;  3HM9 A;  2Z1J A;  1W9H A;  3QNO A;  4AH9 A;  4CJ5 A;  5HRO A;  2DFF A;  4CF8 A;  3AVF A;  3K5M A;  3P1G A;  1U47 A;  4NYN A;  4FJ7 A;  3MAQ A;  1TK0 A;  3NF7 A;  1J54 A;  1U04 A;  3ASM A;  4FJI A;  4FJ5 A;  1D9F A;  3DRP A;  5CZ1 A;  2OA8 A;  4BDP A;  1JXE A;  3LZJ A;  2D0B A;  4DF8 A;  3MXM A;  1JXB A;  1FK9 A;  4FM1 A;  1RCH A;  3DOK A;  4AHU A;  3LAK A;  4AIL C;  1RDB A;  2X6N A;  2HVI A;  1UOC A;  4DFM A;  1VSK A;  3QIP A;  1KFD A;  4IDK A;  3KLF A;  1BCO A;  3OYC A;  1C0U A;  4B9L A;  2OYQ A;  1VSI A;  4DMN A;  3ZSW A;  4FJG A;  1RT7 A;  4RW8 A;  3SUQ A;  3LP3 A;  3TWH A;  4CK1 A;  3V1Q A;  2G8U A;  1YTU A;  3AO5 A;  3VQ7 A;  1A5V A;  3AVG A;  1EET A;  4KV8 A;  4E89 A;  3LAM A;  1HYV A;  4KHU A;  3NBP A;  4QAG A;  2R7Y A;  3SUO A;  1L3T A;  3TAF A;  1NOY A;  4IG0 A;  4Z4H A;  3HP9 A;  3MXI A;  3IRX A;  4RW9 A;  3V9S A;  4FJJ A;  4CHO A;  3OYG A;  1VRT A;  4HUF A;  4I9L A;  3VN5 A;  3RTV A;  3TAB A;  3PX0 A;  1NJY A;  5JS2 A;  2F8T A;  3EY1 A;  3LP1 A;  1SL1 A;  4DTJ A;  4TSX A;  4ELT A;  3AO3 A;  5SZT A;  4J2B A;  1NK5 A;  1SKW A;  3AO4 A;  2VG7 A;  2KZM A;  2DY4 A;  3I0R A;  2B6A A;  2YKM A;  4CFB A;  4XIU A;  1WSJ A;  3NH1 A;  1GOC A;  4W5Q A;  2GV9 A;  3O3F A;  4KHW A;  1L3V A;  4LSL A;  1B9D A;  3QLH A;  3WNE A;  1Q8I A;  1LV5 A;  4FW1 A;  4CCH A;  1SKS A;  3RMA A;  5J1E A;  1KVC A;  1HNI A;  3ALY A;  4DQR A;  5HRP A;  4FLW A;  4FLT A;  2Y1I A;  3SI6 A;  4FJ8 A;  2KFN A;  4B9N A;  3HVR A;  4IFY A;  4KO0 A;  4CHP A;  2KFZ A;  4FYD A;  3OJS A;  4CJE A;  1TL3 A;  3PUF A;  3DLH A;  1KVA A;  1VSE A;  1HYZ A;  2HNY A;  3K58 A;  4FZX C;  3DLR A;  4KPY A;  4NCB A;  1XC9 A;  4CEE A;  3PO5 A;  3LAL A;  4FVM A;  5C24 A;  4DLG A;  4CF9 A;  3THV A;  4BWJ A;  1I39 A;  4CHN A;  3M8S A;  1TK8 A;  3V9X A;  3K57 A;  4OGC A;  4DU4 A;  2X74 A;  1Y97 A;  3AVA A;  4JS4 A;  4KTZ A;  4E7J A;  3OYB A;  1KFS A;  1ITG A;  5JS1 A;  3NH0 A;  1VSH A;  2ITG A;  2OPR A;  5DMR A;  4Z0U A;  3QEI A;  2WOM A;  4C8N A;  3FFI A;  4OPK A;  3HPG A;  3NF6 A;  4Y1D A;  4CEZ A;  3MEC A;  4CJL A;  4CJF A;  1QE1 A;  5DK5 A;  4J2D A;  4CGG A;  4DTR A;  3SPY A;  3VQB A;  4CGJ A;  4CEO A;  5KGW A;  4KI6 A;  1BL3 A;  3AVI A;  4DFK A;  1LWF A;  2QK9 A;  1RT3 A;  5C25 A;  3SQ1 A;  4OKJ A;  1TKX A;  1YT3 A;  1B9F A;  3AV9 A;  3O3H A;  4N56 A;  1CXQ A;  2OZM A;  2PYJ A;  3A2F A;  4B8C A;  5J2Q A;  3QO9 A;  2PZS A;  1S1U A;  2XY6 A;  4CGF A;  3ZT4 A;  1QSL A;  3HK2 A;  3QIN A;  4CJT A;  4DQQ A;  3KIO A;  2VG5 A;  2FBY A;  4CFA A;  2A1R A;  1SKR A;  1TGO A;  2HNZ A;  4Z4F A;  4HHT A;  4CER A;  4C8O A;  2HHW A;  2QXF A;  1DLO A;  4RW6 A;  3B6P A;  3TAM A;  3TR8 A;  3E01 A;  1JKH A;  1Q9X A;  2HHS A;  4L8R B;  4DSI A;  3EZ5 A;  2KTQ A;  2LSN A;  3L2V A;  3BGR A;  3NCI A;  5SWM A;  3OYA A;  4M3T A;  4CJ3 A;  3O3G A;  2JGU A;  5HRS A;  1YVU A;  4AHT A;  4FJM A;  4N47 A;  1KSP A;  1TAU A;  3SUP A;  4KFB A;  1EXQ A;  4B9S A;  1XHX A;  2P5G A;  4K8X A;  2IOC A;  1QQC A;  1RBT A;  3H08 A;  4HUG A;  3SZ2 A;  3SPZ A;  5HLF A;  1RDC A;  5CYM A;  1XWL A;  4DSJ A;  1C1C A;  1S1X A;  4MFB A;  5J2P A;  1ZYQ A;  4NYF A;  3UIQ A;  3P83 D;  3L2W A;  3OYD A;  4CF0 A;  4FJK A;  1C1B A;  4CEC A;  2P1J A;  3ZSX A;  4RW7 A;  4ID5 A;  1GOA A;  1JLC A;  1RT2 A;  1JLQ A;  3AA4 A;  3JSM A;  4BDZ A;  4ELV A;  4NCA A;  3KKR A;  4FJN A;  1RDD A;  5KRT A;  4CEA A;  1FKP A;  1RBR A;  2VWK A;  4CEB A;  3TAG A;  5FRN A;  2FBX A;  1IO2 A;  4F3O A;  1S6P A;  5I42 A;  2HHU A;  3M8P A;  3AO2 A;  3KD1 E;  4E1N A;  4KAZ A;  4CK2 A;  4FLU A;  3V9U A;  3RRH A;  5KTQ A;  4W5T A;  3QEV A;  1N5Y A;  4KB1 A;  4OPJ A;  4CEQ A;  4BDY A;  4NCG A;  4I7F A;  1RTI A;  3LPT A;  4EP5 A;  4DF4 A;  3QNN A;  1ZBI A;  4E7L A;  4CJQ A;  4FLV A;  3CM6 A;  1MU2 A;  4O55 A;  4CGH A;  1HMV A;  1RNH A;  4YNQ A;  3SV4 A;  4F2S A;  4RG8 A;  4KI4 A;  2YNH A;  3K59 A;  5KGX A;  4AHR A;  4AHS A;  3RRG A;  2DTU A;  1U49 A;  2XRI A;  2ZQB A;  3ZSR A;  3O4Q A;  4KHY A;  1JLF A;  3MEE A;  3NDK A;  3LDS A;  3K2P A;  4DTM A;  4DTO A;  4K8Z A;  3IS9 A;  1RIL A;  1L5U A;  4B9T A;  4KRE A;  3JYT A;  3C6T A;  1X9S A;  4M3Z A;  4DQS A;  3DLE A;  4QOZ B;  4GVM A;  4M41 A;  1KLM A;  3U3Y A;  3HJF A;  2B5J A;  4EZ6 A;  1BI4 B;  4OJR A;  3OYJ A;  1C6V A;  4FZY A;  1TVR A;  3DLG A;  3ZSQ A;  2YKN A;  1RBS A;  3OYK A;  1QTM A;  2E4L A;  4M3U A;  5CYQ A;  2FBT A;  1S9E A;  2XY8 A;  3DMJ A;  4YFU A;  3AA3 A;  1F21 A;  3VQ4 A;  4DFJ A;  3TAN A;  1QSY A;  1KLN A;  1JLB A;  4DS4 A;  3ISN C;  1RT1 A;  2GBZ A;  3HT3 A;  4IKF A;  3SQ2 A;  3K5N A;  4E1M A;  1ASU A;  2O4G A;  2I5J A;  2XHB A;  1Z25 A;  4CHY A;  2P51 A;  5I3U A;  4M42 A;  1S1V A;  1L3U A;  4FM0 A;  1NKE A;  1U48 A;  3KKS A;  5HRR A;  3DLK A;  4PA1 A;  4F8R A;  4R5P A;  4DS5 A;  5FDL A;  4DWI A;  2Z1I A;  4E0D A;  1BHL A;  3F9K A;  4LH4 A;  4C8M A;  2YHA A;  4HVJ A;  1WSH A;  3AA2 A;  1EP4 A;  4CEF A;  2BGG A;  3VA3 A;  1XHZ A;  1QSS A;  1QHT A;  1JL1 A;  2RPI A;  4FK2 A;  3QEW A;  5HP1 A;  1T03 A;  3OYN A;  4FLZ A;  1TK5 A;  4LD0 A;  3VQP A;  4CHZ A;  1KVB A;  1RBU A;  3TAP A;  2G8V A;  4KRF A;  1BIS A;  3VA0 A;  1HQE A;  2ATQ A;  4DLE A;  3ULD A;  2AJQ A;  1A5X A;  1LAV A;  2PYL A;  3L2R A;  3QIO A;  4FLY A;  3SCX A;  4W5N A;  3KTQ A;  4DQP A;  2KQ2 A;  3L3U A;  3IG1 A;  1VSF A;  3RWU A;  2YNF A;  1IKV A;  3NF8 A;  1NJZ A;  1CXU A;  2D0C A;  3QEP A;  4HCC A;  3K5O A;  3KK3 A;  2F8S A;  3O4N A;  4PQU A;  3VQ5 A;  3LWL A;  1I3A A;  1NOZ A;  1S1T A;  5CY4 A;  2JLE A;  3V9Z A;  1BGX T;  3OYL A;  1RDA A;  2EX3 A;  2BE2 A;  3CM5 A;  4ZTF A;  1D8Y A;  3U3G A;  4FK0 A;  3IAY A;  2QKB A;  1RTH A;  4IBN A;  5K14 A;  3SUN A;  3PY8 A;  4Q5V A;  1L3S A;  1X9W A;  2OZS A;  1XI1 A;  4BE2 A;  3QES A;  1G15 A;  1T7P A;  5HBM A;  1IKW A;  3MXJ A;  4Z4G A;  3DM2 A;  5EU7 A;  1ZBL A;  4C8K A;  1WSG A;  2KW4 A;  4LSN A;  4DU3 A;  1SL0 A;  3PV8 A;  4W5R A;  1NK0 A;  3HPO A;  1O1W A;  4ZHR A;  1KTQ A;  1J5O A;  3BDP A;  4PY5 A;  1VSJ A;  2OPS A;  4M3W A;  3SNN A;  5J2M A;  1UA0 A;  3PX6 A;  1VRU A;  1S6Q A;  3EYZ A;  4FJH A;  3SYZ A;  4OKK A;  3HL8 A;  1BQM A;  4BAC A;  3T19 A;  1ZBH A;  4CJW A;  3WNF A;  3HYF A;  3L2Q A;  3DOL A;  1DTQ A;  2X78 A;  4JLH A;  4BE0 A;  3NH2 A;  1EX4 A;  4C8L A;  3LP0 A;  4AHC A;  4E7I A;  3MED A;  3KK2 A;  1HJR A;  4DTU A;  3AVH A;  1UWB A;  1JLG A;  2FC0 A;  4CIE A;  3PO4 A;  3LAN A;  4OLA A;  1HPZ A;  2OPP A;  3CYM A;  3CFO A;  4OGE A;  3SV3 A;  1QS4 A;  3KLI A;  2IC3 A;  1Z26 A;  1YTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...