3CG7A

Crystal structure of cell-death related nuclease 4 (crn-4)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
296
structure length
296
Chain Sequence
YQHCPFDTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFERVLPLVVTTIRAGDFRLEMYGVCRYCRKGMDVCGTSHQQTPHDLYKNEEDPIHFAKIAGYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell death-related nuclease 4
publication title Crystal structure of CRN-4: implications for domain function in apoptotic DNA degradation
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase, apoptosis
total genus 89
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cg7A01
5C25A 3AV9A 2P5GA 1YTAA 4CJTA 5D3GA 5EU7A 2E4LA 4IG3A 4BE0A 4NCBA 1U4BA 5FRNA 3AVAA 4CHQA 1CZBA 4N56A 4B9TA 4FZZA 2IAJA 3OJUA 1A5WA 4GW6A 4FJLA 1UWBA 3NH1A 1I39A 4KAZA 3HPGA 3VQ8A 2BDPA 3S3MA 4C8KA 3D0PA 3D45A 4Z4IA 2P5OA 3DRSA 4CJWA 1HPZA 3V1RA 4FW1A 4JLHA 4B8CA 3S9HA 1QQCA 4H8KA 3DYAA 1KVAA 4E89A 2DFHA 4FLVA 4ELUA 4IDKA 2OZMA 4DFKA 3L2RA 2HNDA 2KW4A 3WNFA 3DLEA 4M3WA 1R0AA 1ZBIA 4OKKA 2FBXA 3HPHA 4CGFA 3MXIA 2VWJA 1Z26A 1NK7A 1JLEA 4FJ5A 1JXBA 1S1UA 1TL1A 3PUFA 3OVNA 1FK9A 3PV8A 3UIQA 4O44A 4CCHA 3LPUA 3V81A 5HRRA 4HCBA 3L3UA 3SJJA 3VQ5A 3MXMA 4B9VA 4K8XA 2PY5A 4PQUA 1L3VA 4IG0A 2HHXA 3V6DA 4NCAA 3VA3A 1C1CA 3CG7A 1Z25A 1S1TA 3NF6A 3ULDA 4E7JA 3L2WA 1NOYA 4KHQA 4CJSA 3V9ZA 4DTOA 2YNGA 2OPPA 1NK5A 4I9LA 3U6FA 4Z4FA 3K57A 1J9AA 4OGCA 1KVCA 5J2NA 3NFAA 1SL0A 1JLAA 3VQQA 2E6LA 3V9XA 1KSPA 4KI4A 3QETA 1T05A 4J2DA 4FM2A 3HJFA 3RTVA 1HRHA 3B6OA 3ZSQA 1U47A 2RPIA 1S1WA 4LH4A 3IG1A 4F4KA 1VSFA 3LP3A 3H08A 4EP5A 2BE2A 3DOLA 4DQIA 4LY7A 1VSLA 4DQQA 1J53A 1EXQA 3HP9A 1HQUA 3HXMA 4DFJA 1Y97A 4KRFA 2YNFA 3OS2A 2A1RA 5K14A 4JS5A 2Z1IA 3TAGA 1X9MA 1TKXA 1NKBA 2D0CA 1SUQA 4FK4A 3JYTA 4BE1A 1TK8A 4NYNA 1RDAA 3L2UA 3NDKA 3I8DA 4H4OA 3CFOA 1TVRA 4ID1A 3HM9A 1L3SA 4CHYA 3K2PA 4L8RB 2X78A 4CEEA 2RKIA 4CJRA 4OPKA 3B6PA 1IKVA 5KRSA 3KLIA 4FJ9A 3MXJA 4O4GA 3O3HA 3OYBA 4ELVA 1TKTA 4EP4A 4N41A 4CEZA 3LDSA 3DMJA 4DU3A 5J2QA 1NK9A 4CFAA 3VQ4A 3TI0A 4B3OA 3M8QA 1MU2A 3LZIA 4YNQA 3S3OA 1NJWA 1BI4B 3ZSRA 4KFBA 4CJPA 5HP1A 1BIZA 1SV5A 4DTUA 3AVBA 1J5OA 1RT7A 4CECA 1NOZA 4ZHRA 1WNSA 2ZE2A 4Z0UA 4FCYA 4E7KA 3ZSZA 4HUEA 3SQ4A 4FJNA 3KLFA 4F8RA 4FJXA 4CF9A 4DQPA 2O4IA 3O4QA 1SKRA 1LV5A 1WSIA 3OYAA 4CE9A 1VSJA 4ZTJA 2PYLA 3PO5A 3KD5E 2BGGA 4M3ZA 5FDLA 1RT4A 4CJEA 3CFRA 3U3GA 3CM5A 4M3UA 4M3TA 1QSLA 2VG6A 2X6NA 4CF0A 2OPRA 4CK3A 5DK5A 3K5MA 3TWHA 3AVJA 3AVGA 5I3UA 3HVRA 2HVIA 3K5LA 4DWIA 3AO1A 3HSTB 3PX4A 4FZYA 1KTQA 1CXQA 1XI1A 1IO2A 4F3TA 2YKMA 2IC3A 1REVA 1KVBA 3WNEA 3LP2A 1JLBA 1JKHA 4R5PA 4KI6A 1BQMA 4CEQA 4CJKA 3U3YA 1C0TA 2FBYA 3I0SA 1TL3A 3KLEA 2NUBA 2YNIA 3KTQA 3EYZA 3DLKA 1S1VA 4CJFA 1NJYA 4DQSA 3S3NA 4QOZB 4DS5A 4F2RA 4E3SA 2X74A 4AHSA 4CGHA 3DLHA 4DF4A 2D0AA 3VQPA 3QEXA 4CEBA 3BDPA 4OLBA 4AHCA 3NH2A 3NBPA 1D9DA 4LSLA 3EZ5A 3HL8A 3VA0A 2XRIA 3ZT3A 3AO3A 4PUOA 2F8TA 2IGIA 1JLCA 4DTNA 1C0UA 4PA1A 3NF9A 5DMRA 4AILC 3LPTA 3RMCA 1SL2A 3AVLA 4EZ9A 4FJHA 3ZSVA 3PY8A 3DRRA 4QAGA 5SZTA 4M41A 1KCFA 1HJRA 4CFDA 3QEWA 3HVTA 4GMJB 4C8NA 4HUFA 1RT1A 3T19A 1UA0A 3ZSYA 1FXXA 4G1QA 1JLQA 1NK6A 4ELTA 2HNZA 3QEPA 3RRGA 1WAJA 2B6AA 4RW7A 2AJQA 4CF1A 4FJKA 5J1EA 3KD1E 1UAXA 2GUIA 1LWFA 3IRXA 4B9NA 1RILA 4CHZA 2HVHA 1D8YA 1VSIA 3EY1A 3ALYA 4FLWA 3SPYA 3FFIA 3DLGA 3QLHA 2JLEA 4O0IA 3TR8A 4N5SA 4W5OA 3SUPA 2HW3A 3LWMA 3M8RA 4HUGA 1XHXA 3AVNA 1KLMA 3ZT4A 3AA2A 1ZBHA 2QXFA 3HPOA 3LAMA 1VRTA 3OS0A 4FJ8A 2F96A 4LH5A 5CYQA 1S5JA 2OYQA 1W9HA 2WOMA 2HHWA 1BISA 4DS4A 4HVJA 2HHVA 2W42A 1QE1A 4FLZA 3ZT2A 3QNNA 2VG7A 4FLYA 2ATQA 3TAFA 2KZZA 3HT3A 3SYZA 4GVMA 4FW2A 3TAQA 4F2SA 3KIOA 3OYGA 2HHTA 4LSNA 2GBZA 1IKXA 1SKWA 1B9DA 3K5NA 1ITGA 4HHTA 3CFPA 4Y1DA 5KTQA 2HHSA 2LSNA 2EX3A 1RCHA 4IFVA 1EX4A 1G15A 4AHUA 3OY9A 3SV4A 4DG1A 1KFSA 3MEDA 1VSMA 5C24A 4KPYA 4Q0BA 4DLGA 4DMNA 1WLJA 3RWUA 1CZ9A 2Z1JA 4W5NA 4KO0A 3G10A 1VRUA 4DU4A 1JL2A 4K8ZA 1LWEA 4FZXC 2QKBA 1B92A 1IKYA 4AHTA 1NKEA 3RRHA 3SQ2A 4FJ7A 1U04A 3WNHA 4KB1A 3O4NA 4HTUA 4DTXA 4B9MA 3LANA 3ZSWA 1ASWA 3CM6A 4RW8A 2QKKA 5E41A 4CHOA 4KKOA 4BWMA 5KI6A 1EKEA 3KLGA 1BHLA 4M45A 1VSHA 2G8VA 2D5RA 4DSLA 4KHUA 3VQCA 1BCMA 1RT2A 1S1XA 2YHBA 4CGDA 4CGIA 3OYJA 3QIPA 4J2EA 5CZ2A 4OJRA 4DU1A 1QSYA 4OVLA 4RW4A 3OS1A 3OYHA 3OYNA 4Z4CA 4KHYA 2XY8A 2IDOA 3OYMA 4F3OA 3QEIA 2G8KA 4CJLA 4CJ5A 3OJSA 3L2VA 3DLBA 3AA3A 5T7BA 2IOCA 1ZBFA 4MFBA 4DFMA 2O4GA 5HRNA 2XHBA 1SKSA 1VSEA 1EETA 1JLGA 2OPQA 3KJVA 1U48A 3ZT1A 1SL1A 1NK0A 1NJXA 1S9EA 2JGUA 3C95A 4OKEA 3VQDA 2HMIA 4B9UA 2EHGA 1RTJA 2VG5A 3KLHA 3QEVA 3V9WA 1N5YA 4FLTA 5SWMA 4B8AB 2HB5A 3P83D 1C1AA 3MEGA 3T3FA 4KTQA 4CESA 4JRQA 2ITGA 4I2PA 4ZTFA 4KV8A 5KRTA 4EZ6A 4DTPA 4M3YA 4O55A 4FM1A 1T8EA 2P1JA 2OA8A 3LALA 5HRPA 4FM0A 2HHQA 2YKNA 4CJUA 3NCIA 1BGXT 1RNHA 3LZJA 4Z4EA 1EP4A 1NKCA 1WSJA 4CFCA 4B9LA 1DTQA 3DRPA 1RT5A 3G0ZA 3O3GA 3THVA 1N6QA 1WSGA 4I7FA 1ASUA 4C8MA 2QK9A 3C94A 4YFUA 1NK8A 4CHPA 1K6YA 4RG8A 1TAUA 3NGYA 1JXEA 1TV6A 3DM2A 1RBUA 2P51A 3NE6A 3SV3A 4BDPA 3DOKA 4FVMA 4IBNA 5C42A 1ZYQA 1DLOA 1RBTA 3L3VA 3QNOA 4E19A 2G8FA 2Z1HA 4JS4A 3IAYA 4ICLA 4DSEA 1ZBLA 4CHNA 1QTMA 2KZMA 4O5BA 3NF8A 2A1SA 5KGXA 1HYZA 4E7HA 5J2PA 2KTQA 3K5OA 3PX0A 4KTWA 4DQRA 3SCXA 1XHZA 1RDBA 2DFFA 1YVUA 1IG9A 1RBVA 1HMVA 3LAKA 4C8LA 1LWCA 1B9FA 3NF7A 4MQ3A 1A5VA 3V9SA 3C6TA 3VQAA 1KRPA 4BE2A 2F8SA 4FXDA 4DSFA 1T03A 2PYJA 1BCOA 1GOAA 2YNHA 4OGEA 1IH7A 1VK0A 3L8BA 3T1AA 1C6VA 2RF2A 3IS9A 4CJQA 4I9QA 3TARA 3E01A 3ZSOA 2OZSA 2KFNA 3ZSXA 2KQ2A 2RN2A 4CIGA 3HP6A 4DTSA 5CY4A 1RT3A 1A5XA 3CYMA 5HLFA 2DTUA 3RMBA 3NAEA 5HBMA 1X1PA 3DLRA 4RW9A 4CK1A 3O3FA 3AVHA 1QHTA 2ETJA 4KTZA 3M8SA 4KREA 4CGJA 4J2BA 2X6SA 4W5RA 2R7YA 2FC0A 4H4MA 4DF8A 3AVKA 4UQGA 3SI6A 4B9SA 2FBVA 3F9KA 1WSHA 2G8IA 4E7IA 1Q8IA 1S9GA 1RT6A 1JL1A 4AHRA 3SPZA 1TKZA 4DTJA 2DFEA 4RW6A 1VSDA 3LP1A 4O0JA 3PO4A 1LW2A 3TABA 1X9WA 4LD0A 2HHUA 1D9FA 4WE1A 3QIOA 4CEDA 1I3AA 3AA4A 3KK1A 4FLXA 4NCGA 4FLUA 3SQ1A 3ASMA 1HYVA 4KHSA 3OYLA 4E0DA 4BDYA 3OYKA 1BIUA 5JS2A 5KGWA 1NJZA 4E1NA 4CK2A 4FJMA 4KHNA 4OLAA 1X9SA 1BQNA 3TAEA 3A2FA 1KFDA 3P1GA 1TKDA 1NK4A 4DSIA 4CGGA 3NH0A 3V1QA 1HYSA 3AVIA 1TGOA 2YV0X 3KKRA 4IKFA 4TSXA 4CJ4A 2PZSA 1GOCA 1CLQA 3OYFA 1RBRA 2DY4A 4FK0A 1D5AA 1LAWA 1U45A 4FYDA 1KLNA 2XY6A 1C1BA 1WN7A 3LP0A 2D0BA 4CIFA 4M42A 3OYEA 2B4JA 3HYFA 1JLFA 3QO9A 3RR8A 1L3UA 3NHGA 3ZT0A 3AVMA 5J2MA 1L3TA 1L5UA 5HRSA 1RDCA 3SUNA 1IKWA 1TAQA 1WSEA 1RBSA 4CFBA 3AO4A 1ASVA 3MECA 3K58A 4N47A 1U49A 4OKJA 4M3RA 1TK0A 2G8UA 1O1WA 2BANA 2XY5A 5I42A 1ZBUA 4DSJA 3DI6A 3ZCMA 1W0HA 3V4IA 5JS1A 3VQEA 4NYFA 3AVCA 3C6UA 3OYCA 2YHAA 3NGIA 3TAMA 2VWKA 2G8WA 4FJJA 4M3XA 1UA1A 5FROA 1RDDA 3VQ6A 2G8HA 3RR7A 4BWJA 1HNVA 3V1OA 1XC9A 4DSKA 1WSFA 1BL3A 1HQEA 4E7LA 4FJIA 1HNIA 1TK5A 3HK2A 1XWLA 4I2QA 3VN5A 4AHVA 1QSSA 4W5QA 3PX6A 3AO5A 4KHWA 4CJVA 3AO2A 4B08A 2IS3A 3SUQA 4DLEA 4BDZA 4JRPA 1UOCA 3RMDA 2B5JA 1QS4A 3HO1A 3AVFA 3I0RA 1GOBA 2Z1GA 2I5JA 1Q9YA 1FKPA 3SNNA 4DTRA 3ITHA 1RTHA 4Z4GA 4W5TA 2ZQBA 3QESA 4DFPA 4J2AA 4CEFA 1LAVA 4PY5A 4CIEA 3LWLA 4N76A 1CXUA 4CF8A 3QERA 1J54A 1S6PA 4CF2A 2FBTA 2E6MA 3KK2A 1BI4A 2GV9A 2OPSA 3P5JA 2Y1IA 3CQ8A 1RTIA 1VSKA 3VQBA 3SUOA 4DTMA 2XY7A 4PWDA 4E1MA 2Q3SA 4IFYA 4XIUA 2XO7A 4AH9A 1S6QA 4OPJA 3TANA 1FKOA 2HNYA 4KB0A 2KFZA 3L2QA 4Y1CA 3AA5X 3WNGA 3KK3A 3JSMA 3QINA 4CERA 4QCLA 5CYMA 1DTTA 4Z4HA 1Q9XA 3VQ9A 3BGRA 1LW0A 3OYIA 3ISNC 1RTDA 1YT3A 3NGZA 5FRMA 3MAQA 5CZ1A 4BACA 4ID5A 4FJGA 4Q5VA 3K59A 5HROA 4C8OA 1C0MA 3SQ0A 3M8PA 1T7PA 2ZD1A 3KKSA 4CEOA 3F73A 3V9UA 3TAPA 4HCCA 4FK2A 1YTUA 3MEEA 3OYDA 4CJ3A 1F21A 3SZ2A 4CEAA 2WONA 1WAFA 3VQ7A 3RMAA 2Y1JA
chains in the Genus database with same CATH superfamily
3F5TA 3AV9A 3O9TA 2P5GA 3GE1A 4IG3A 4C23A 4N56A 3THXB 4FZZA 2IAJA 2BDPA 3D0PA 4Z4IA 5F2RA 3H46O 3MWTA 4BRMA 4H0VB 3V1RA 2OTLN 4DR4K 3S9HA 3DYAA 4GNIA 5FPNA 4FLVA 4ELUA 4JHDA 1WOQA 3WXIA 3HPHA 3K0SA 2VWJA 1NK7A 1VQ5N 1JLEA 3LDQA 2ZJRL 4IJNA 3UIQA 3L6QA 3V81A 3VEYA 3MXMA 2Q97A 1V4SA 4PQUA 4BREA 3V6DA 5BN9A 4B3MK 3CG7A 1Z25A 5AQJA 2P9PA 4E7JA 3L2WA 4CJSA 4ILHA 1NK5A 2YNGA 4Z4FA 3C7NB 2UUCK 4JKFA 4OGCA 3IFRA 3NFAA 1OH8A 1W97L 1ILYA 3HJFA 4BC4A 4LF6K 3ID6A 3ZSQA 1U47A 3ZEUB 4F4KA 3LP3A 4DFJA 5CHIA 4PL7A 4KRFA 2A1RA 4JS5A 2Z1IA 1TKXA 2D0CA 4U7BA 3JYTA 1TK8A 3L2UA 4NB4A 4H4OA 3CFOA 1TVRA 2P9NB 3K2PA 4CJRA 4OPKA 4FJ9A 4CI6A 3MXJA 3EKSA 1N32K 3GOIA 4N41A 4B1UB 1NK9A 3DMJA 3DXMB 3LZIA 3BZKA 1NJWA 3ZSRA 4RCHA 1J5OA 1RT7A 3GL1A 1WNSA 3N4PA 4BRCA 3ZSZA 4HUEA 3KLFA 4F8RA 1NM1A 2O4IA 4FO0A 2WUSA 1WSIA 3KD5E 2PYLA 4JN4A 5FDLA 3U3GA 4E1JA 2X6NA 2OPRA 4CK3A 5I3UA 4GV3A 4DWIA 3HSTB 4A5BA 1RDWX 1XI1A 1IO2A 3VERA 1KVBA 5CR4A 4CJKA 3U3YA 2V7YA 3I0SA 5GAEP 2YNIA 3EYZA 1BWFO 4K42A 4CJFA 5FPEA 3S3NA 4DS5A 1ATRA 2YHYA 2NRRA 4DF4A 4OLBA 3NH2A 3NBPA 4LSLA 4JKCA 3EZ5A 1K73O 2F8TA 1JLCA 3BUZB 1SL2A 4A2BA 4DCHA 3RMCA 4JHDB 3PY8A 4QAGA 4M41A 4BROA 4MO5A 3QEWA 4C8NA 4BR0A 4HUFA 3T19A 5KPRA 3LDNA 4LF7K 2HNZA 5BPMA 4DR7K 2B6AA 4RW7A 4CF1A 2AP1A 4JD2A 5M1PA 3IRXA 4JYAK 1D8YA 1VSIA 3ALYA 1YJNN 1WB9A 3FFIA 3QLHA 5HL7L 2P9PB 1DKGD 3WXJA 1MWKA 4N5SA 3SUPA 3CD6N 4HUGA 3MX5A 2YCHA 3HPOA 4LH5A 1HUXA 2HF4A 3W0LA 4GKJK 3HT3A 3SYZA 3PLAA 4GVMA 3TAQA 3CCVN 4LSNA 2QA4N 3UKUA 1SKWA 1M1KO 4NXNK 1B9DA 5KTQA 4K41A 4IFVA 2NRZA 1HKCA 3E9OA 3O5BA 1VSMA 5C24A 1DGKN 3GBTA 1WLJA 2Z1JA 4H0TB 4KO0A 3G10A 4DR3K 1VQMN 1IKYA 4FJ7A 5AQTA 3O4NA 4DTXA 3ZSWA 3CM6A 3TSUA 4CHOA 1EKEA 4H03B 1BHLA 1VSHA 2NZTA 3JXUA 5BREA 1S1XA 4CGIA 4R79A 2NRWA 3QIPA 4J2EA 4OJRA 4DU1A 1QSYA 3OYHA 4F3OA 1LOTB 3CJ1A 5AZJB 3FE1A 2IOCA 3VEOA 4DFMA 3VGMA 4KH5A 1VSEA 3ZT1A 3EL2A 1S9EA 4IEEA 3V9WA 4B8AB 3P83D 2VCPA 4UY8O 4JV5K 4GVEA 5JLFA 1EQYA 5KRTA 4EZ6A 1T8EA 2CGLA 2P1JA 2OA8A 4IZ9A 4BRQA 4H5WA 2QI2A 1BGXT 2OCEA 4Z4EA 1WSJA 4K0KK 4L3QA 5F1XA 3DRPA 1N6QA 4PKGA 4ISGA 4I7FA 4C8MA 3VEZA 4CZIA 4RG8A 1JXEA 1RBUA 3SV3A 4BDPA 3HOTA 1ZYQA 3A0IX 1DLOA 3KWIA 5AQFA 5BR9A 3U8XA 4WQ4C 2A1SA 3BF1A 1XHZA 1HX1A 2DFFA 4A59A 3R3LA 2FSJA 2O8DA 1B9FA 3N4QA 3VQAA 4BE2A 4CW7B 1T03A 3CHWA 1BCOA 1VK0A 1Q86O 4BGBA 1JCFA 2RF2A 4CJQA 1BDGA 1IG8A 3ULEA 2KQ2A 4CIGA 3I55N 2O8FB 1NNEA 1P90A 3CYMA 5ADXA 4CVNE 5HBMA 4DV5K 2P9SA 3ZLJA 4IEIA 2R7YA 4B9SA 2ZJQL 2G8IA 3UKUB 4E7IA 3SPZA 3OTOK 4NXMK 5IT9O 1KQSM 2QM1A 3PO4A 2NNWA 2HHUA 3SQ1A 3A5NC 3KK1A 1DT9A 3OYLA 3O9SA 5LMUK 1YUWA 1NJZA 3SK3A 4CK2A 4KHNA 1N33K 3P1GA 1NGAA 1Q81O 4DSIA 1HYSA 3AVIA 2YV0X 3KKRA 4TSXA 4H0XB 2PZSA 1OKJA 1G99A 4XH5A 2DY4A 2NRXA 3WEEA 2P9IA 1D5AA 4FYDA 2XY6A 1WN7A 3LP0A 4DV4K 3OYEA 1IJJA 3RR8A 3CC2N 5J2MA 5HRSA 4FWKA 1TK0A 4OPHA 3DAWA 4BRHA 2NRTA 5LJVA 1W0HA 5M1KA 4XH4A 3CETA 5AQHA 3VQEA 2VGMA 3E66A 2VWKA 3CMAN 3E9LA 1UA1A 1RDDA 3RR7A 5AQPA 3T1HK 4E7LA 3HK2A 1TK5A 3VN5A 3U9DA 4AHVA 3AO5A 4B08A 3THYB 4BDZA 4IOCL 3RMDA 1H1VA 1CZAN 4DV0K 3HO1A 2HOEA 2I5JA 1Q9YA 4AQYK 1YF5L 4DTRA 1HR0K 3QFUA 1WBBA 2VYPA 2ZQBA 3H1VX 3KZBA 2ASPA 1LAVA 3DWLA 4RWTA 3AAQA 3UE5A 1VQ9N 1BI4A 3P5JA 2E2OA 2F7TA 2PBDA 3KWGA 1VSKA 4JI8K 3TANA 4OPJA 1S6QA 2HBKA 2Q36A 3AA5X 1N36K 3RSEA 3QINA 4O5FA 2HBMA 1DTTA 5BRHA 1RTDA 1YT3A 5BRDA 3HI0A 5LMNK 5CZ1A 4BACA 4ID5A 5HROA 4C8OA 1S22A 3SQ0A 2ZD1A 4CEOA 4FK2A 4JKEA 3V9UA 1R59O 1WAFA 5I9EB 5IWAK 3VGLA 3RMAA 1YTAA 4CJTA 2E4LA 4NCBA 1U4BA 2P9SB 2QWQA 1NGJA 4A57A 1CZBA 4CHQA 3DLLL 3OJUA 4GW6A 5AZIA 4KAZA 5KQDA 3M3ZA 4DR2K 4CJWA 4BY9C 3IUCA 4B1ZA 4FW1A 4JLHA 5GINA 4E89A 1KVAA 2DFHA 4IDKA 2OZMA 5AR0A 3DLEA 1R0AA 4FL9A 4OKKA 3AARA 4CGFA 1QHAA 1Z26A 1JXBA 3OVNA 3M1FA 3PV8A 3J7YP 3WT0A 4A5AA 5HRRA 3L3UA 3SJJA 4DUZK 3CCSN 2O8CA 3VQ5A 4AF1A 3WEEB 4K8XA 3K9KA 3TPQA 1NOYA 4I9LA 4DR6K 1SL0A 1JLAA 2E6LA 3BP8A 3QETA 4ILJA 5JLHA 4J2DA 3VESA 4H5RA 2RPIA 2E1YA 4LH4A 1QVGM 4EP5A 2BE2A 2E2NA 4DQQA 1J53A 3VF6A 3HXMA 2YNFA 3OBYA 4JI4K 3OS2A 5GIOA 1FJGK 3M5RA 4NYNA 1T6DA 1KXPA 1RDAA 3HM9A 4CHYA 2RKIA 1YI2N 4EP4A 4DU3A 2GWJA 5J2QA 4CFAA 2F4VK 4B3OA 3M8QA 3O1BA 1OVQA 1BI4B 4DTUA 3AVBA 2ZE2A 4Z0UA 3J81O 4FCYA 4DR1K 2JWKA 1SAZA 3SQ4A 4FJNA 2ITMA 4CF9A 5AQXA 3U9ZA 5JVGL 3OYAA 4CE9A 3T1YK 3HOSA 3CFRA 3CM5A 4V19S 3E9PA 5C2FA 4CF0A 5DK5A 3TWHA 3R9PA 3AVGA 3HVRA 1LCUA 3AO1A 3WUHA 2YKMA 2IC3A 1QQOA 1JKHA 4R5PA 2D0PA 3CIPA 2JWLA 3G25A 2NUBA 3KTQA 3DLKA 5AZIB 4QOZB 4IFEA 2X74A 4CGHA 2F9TA 2I7NA 4IO9L 3VQPA 5LJWA 4MDBA 4PUOA 3ZT3A 3MX2A 1XNRK 5AQNA 3LPTA 4FJHA 3ZSVA 1KCFA 4FWQA 3EEQA 3HVTA 4CZLA 4ELTA 4JKGA 4LF4K 2AJQA 5J1EA 3KD1E 2CH6A 1E3MA 5B8HA 3KVGA 4O0IA 2A5XA 1XHXA 3AA2A 2QXFA 4GKKK 2RE2A 2E88A 1S5JA 5MLCQ 2OYQA 2HHWA 5HOOA 3NVMA 3CC7N 1QE1A 4FLZA 3WQUA 1BG3A 3QNNA 2VG7A 4FLYA 3DXKB 5ELZA 1QZ6A 3A5MC 2HHTA 5GAHP 5AQWA 2GEMA 1KD1O 3BF3A 3K5NA 1ITGA 1ZC6A 2E8AA 2HHSA 2LSNA 2EX3A 1G15A 3P38A 4BR2A 5AQOA 1HNZK 4LC9B 3EN9A 4W5NA 1LWEA 4AHTA 3G71N 3VEVA 4PL8A 4FWLA 2Q31A 4B9MA 1VQPN 5E41A 4JEPA 2G8VA 3KHYA 3KLGA 5JMVA 2D5RA 5BN8A 3ENOA 1I94K 1RT2A 1KAZA 4CGDA 2O8EB 4OVLA 3ENBA 4Z4CA 4KHYA 2IDOA 3TU5A 1MA9B 3QEIA 4J8FA 2G8KA 4CJLA 1EO1A 4H5VA 3R8EA 5T7BA 1T3VA 1ZBFA 3C6AA 3EE8A 5HRNA 2P9KA 1YJWN 1SKSA 3KJVA 1SL1A 2A40A 2JGUA 3C95A 3ENHA 2HMIA 3BEXA 4FPBA 3ZX2A 1N5YA 1U2VA 2HB5A 4FSVA 1U6ZA 3MDQA 1K8KB 1HJOA 4IO8A 4KV8A 4O55A 4LF8K 4CJUA 1RNHA 3CPWM 4CFCA 2IVOA 1EWRA 3G0ZA 1RT5A 4JI1K 4H5TA 2QK9A 1NK8A 1TAUA 1K6YA 3G6EN 1TV6A 2P51A 3NE6A 3DOKA 4IBNA 1KAXA 1RBTA 5M1FA 3I8BA 1NGEA 2G8FA 4DSEA 2KZMA 4O5BA 4KH6A 5KGXA 2P9UA 4DV3K 1QQNA 4JKGB 3K5OA 3PX0A 2KTQA 4FVUA 1RDBA 5AQGA 3BZCA 1RBVA 1IG9A 1A5VA 3C6TA 4DSFA 2I7PA 3FFKB 3L8BA 1IH7A 4CBWA 1C6VA 2YHWA 3E01A 5BPNA 3ZSXA 4DTSA 3THWA 1OH6A 5HLFA 3RMBA 3DLRA 3O3FA 2CGKA 3AVHA 3C6HA 2YX6A 2VQFK 4CGJA 4W5RA 3CCQN 3CJ9A 4EFHA 2DPNA 3SBGA 4DF8A 3VENA 2ZWHA 3F9KA 3MN9A 4B3RK 1Q8IA 1O13A 1RT6A 4OPAA 4DTJA 1GLLO 4RW6A 5F0XA 4I6MA 3UKRA 1XMQK 3QIOA 3MWPA 3LM9A 4FLUA 4FWRA 1HYVA 4XH1A 3OYKA 4BC2A 1BQNA 5AQMA 1NK4A 3L4QA 1XNQK 3NH0A 3V1QA 3UB5A 4YORA 4CJ4A 3I33A 1CLQA 4YOWA 1C0FA 4FK0A 1LAWA 5EY4A 3PIOL 2B4JA 4X66K 3QO9A 3JAMO 1L3TA 1RDCA 3I56N 4Z94A 1WSEA 1RBSA 2D1KA 3K58A 1YJ9N 3A5LC 4OKJA 4M3RA 2BANA 2XY5A 5I42A 4JK9A 3CMEN 4B3TK 3OYCA 3AVCA 4FJJA 2BH1A 2YHAA 3TAMA 5A2QO 3VQ6A 4BWJA 3V1OA 2KKZA 3C0BA 4U67L 4FJIA 1HNIA 4DHYA 4W5QA 2WC9A 1NLVA 3ATUA 4DLEA 2ZGYA 4JRPA 2B5JA 1QS4A 1QVFM 3AVFA 2Z1GA 5AQRA 3F9MA 3RVCA 5AJ3K 4F9OA 3ITHA 4LF9K 1RTHA 4W5TA 3QESA 4OO1J 4J2AA 4PY5A 4WQ4A 4M7YA 3QERA 2FBTA 1RDUA 3IKMA 3J7AP 3SUOA 4IJAA 3O9QA 2XO7A 5C0YA 1FKOA 3QBXA 5CYMA 3FZLA 3VQ9A 1LW0A 2QXLA 4FJGA 3CXCM 3M8PA 1T7PA 4DKWA 3KKSA 4HCCA 3TAPA 4JNEA 4CJ3A 4JD2B 5ADXH 3SZ2A 3LWLA 2Q1NA 3THWB 5EOYA 5EU7A 3E1YA 4BE0A 2HMPA 3ZETA 3J8AA 4B9TA 1A5WA 4FJLA 1UWBA 4NLCA 1I39A 3NH1A 3TTCA 4FWOA 4QS8A 4C8KA 3D45A 2P5OA 3DRSA 3BY5A 1HPZA 4LFCK 1QQCA 1N34K 1BU6O 4DFKA 3L2RA 2HNDA 2KW4A 4M3WA 4DB3A 2UUAK 3TSPA 4FPAA 4FJ5A 3PUFA 3MN5A 1TYQA 3MK6A 3R1XA 3CERA 4B9VA 1FW6A 1L3VA 4IG0A 3VA3A 3NF6A 3ULDA 4KHQA 5JICA 3SMSA 4DTOA 3EKUA 1J9AA 3FZFA 3MN7A 4KI4A 5FPDA 4BRKA 4FM2A 2QWMA 1HRHA 4FWNA 3IG1A 3H08A 3QFPA 4HWIA 3HP9A 1Y97A 3B8AX 3D7EO 5K14A 3TAGA 1X9MA 2HF3A 1Q7YO 1HKBA 4FWMA 4FK4A 4BRPA 3NDKA 2H3GX 1GLBG 4ID1A 4AM6A 3D2EA 1K9MO 4L8RB 3CJCA 3HZ6A 3ZYYX 1IKVA 4JI6K 4CJ7A 3CCUN 4O4GA 1GLEG 4HTLA 4KBOA 4QS9A 2OTJN 1M90O 4CEZA 5AFUA 1NGCA 2V7ZA 3VQ4A 3TI0A 3S3OA 2E20A 1NGBA 3EZWA 4CZEA 4KFBA 5HP1A 1BIZA 1SV5A 2GUPA 4ZHRA 1S72N 1VQ6N 4E7KA 2YHXA 4K25A 4B9QA 3O4QA 2UUBK 1LV5A 2BGGA 4M3ZA 1RT4A 3SMPA 4CJEA 4BR9A 4M3TA 1QSLA 3AVJA 1HNXK 5AQYA 3JS6A 3PX4A 2O8DB 1KTQA 1CXQA 1GLDG 4F3TA 3WNEA 3LP2A 4X65K 4YHHK 4KI6A 1XQSC 1TL3A 3ZETB 3KLEA 3ULEB 3Q7CA 5AQLA 5EVZA 5M1QA 3H6EA 4F2RA 1J5EK 3DLHA 4CEBA 3VA0A 4A2AA 2Q0RA 3OW2M 1C0UA 4PA1A 5DMRA 1QZ5A 5BR8K 3W3DA 3NMUA 3DRRA 5SZTA 2QWNA 4BG9A 4CFDA 2ZF5O 4GMJB 1UA0A 1RT1A 3TTFA 4G1QA 3J80O 4GY2B 2D4WA 1YAGA 3O4WA 1X9JA 2GUIA 3O80A 4CHZA 2HVHA 3SPYA 2NRHA 3DLGA 3TR8A 4W5OA 2HW3A 3HM8A 2FF6A 1ZBHA 3THXA 2P9IB 1VRTA 5CYQA 3NVKA 1NGFA 1W9HA 2WOMA 2W41A 2HHVA 2W42A 2CH5A 3TAFA 2KZZA 4FW2A 4H5NA 3KIOA 3IDHA 4WFAL 4JKHA 2V51B 2UYTA 2A3ZA 4B1WB 4HHTA 4BR7A 4Y1DA 2GELA 1NJIO 2IIRA 4RTFD 4DG1A 2AA4A 2IVPA 4Q0BA 4DMNA 3D2EB 1CZ9A 3T7ZA 1BOTO 4DU4A 4K8ZA 2QKBA 1BO5O 3O1WA 4BC3A 1NKEA 4PKIA 4CZHA 2ZGZA 1U04A 4CZGA 4HTUA 4LF5K 5EX5A 4RW8A 2QKKA 1YVNA 1NG9A 5KI6A 4DSLA 4CZJA 1ZBSA 1GLJO 4KHUA 4CD1A 3VQCA 1BCMA 2W40A 4IWVA 4YOUA 2YHBA 4BRNA 3OYJA 3EO3A 3OS1A 3ZEUA 3OYNA 1XMOK 5H1SQ 4CJ5A 3L2VA 3DLBA 2ASMA 3MN6A 3CCJN 2O4GA 3RSEB 2XHBA 4B3SK 1JLGA 2OPQA 1X3MA 4DV2K 1NJXA 3VQDA 2BTFA 4OKEA 2EHGA 1RTJA 2VG5A 3CPEA 3VEWA 4B1XB 2P9NA 4ISEA 2P9LA 3LM2A 1C1AA 3MEGA 3P4IA 4A62A 1OH5A 4CESA 4DV6K 4JKDA 4JI5K 4JRQA 3HRGA 2ITGA 3AAPA 4I2PA 4ZTFA 4FM1A 3SAFA 5HRPA 4FM0A 2EWSA 3NCIA 3LZJA 3DXMA 1EP4A 1NKCA 3THVA 4JI0K 1ASUA 1NBWA 1ATNA 3C94A 4CHPA 3NGYA 3DM2A 3SAHA 5C42A 3L3VA 1K8AO 5BRFA 4JAXA 4E19A 2Z1HA 4JS4A 3IAYA 4ICLA 1QTMA 3H1QA 4E7HA 3CCRN 4KTWA 4DQRA 5KPTA 2ZM6K 4C8LA 3V9SA 3NF7A 4MQ3A 1GOAA 2W6LA 3T1AA 3IS9A 5C2DA 5GIPA 3GG4A 4I9QA 3TARA 2O8CB 2KFNA 2RN2A 3HP6A 1RT3A 2BUPA 4KHPK 3NAEA 1X1PA 4RW9A 4EHTA 4KTZA 4J2BA 4H4MA 4UQGA 3SI6A 1NGDA 4O8KA 1S9GA 4BQZA 1JL1A 4AHRA 3PSFA 5LL6Z 4XEIA 2DFEA 4GV6A 4O0JA 1NU0A 1X9WA 4LD0A 4LFBK 3VPZA 1D9FA 3AA4A 1D4XA 4KHSA 3ASMA 4BRDA 2FSNA 4BDYA 4FJMA 4E1NA 2UXDK 1BA0A 3TAEA 1TKDA 1V4TA 1N8RO 4CGGA 2VGNA 1RBRA 4IOAL 3SLCA 2D0BA 4CIFA 4M42A 2QW9A 3HYFA 1JLFA 1SS6A 4NLBA 3AVMA 1L5UA 3SUNA 3G4SN 3FZKA 5C10A 4K43A 2ZJPL 1YIJN 2G8UA 3K9JA 5DM6L 3A5OC 1ZBUA 4DSJA 3HTVA 3VMFB 3NGIA 3IMXA 5FROA 4FOEA 4JK7A 2G8HA 1HNVA 1XC9A 4JI7K 2P9LB 4ILGB 1WSFA 3FLCO 1BL3A 3PIPL 1NMNA 1HQEA 1XWLA 4I2QA 3OBWA 4WFBL 3PX6A 4CJVA 3AO2A 1ZXOA 3SUQA 1UOCA 1IBKK 1XUPO 3I0RA 1GOBA 1FKPA 1XC3A 4BRGA 1NMDA 3ATVA 4Z4GA 4H0OA 1VQNN 4DFPA 4N76A 1CXUA 1J54A 1S6PA 3QMLA 4CF2A 5TKWA 2GV9A 4GV9A 2Y1IA 1RTIA 3CQYA 4DTMA 2Q3SA 1RFQA 4XIUA 4KB0A 5AZJA 2QWRA 4C1NK 2VWBA 4Y1CA 3KK3A 4QCLA 4YDUA 3CCEN 4Z4HA 4JK8A 3BGRA 3OYIA 3ISNC 3SJHA 4Q5VA 3K59A 3AY9A 3F73A 1YTUA 3MEEA 1YHQN 4CEAA 4DQ8A 3VQ7A 3ZSOA 4EIAA 1NWKA 2FF3B 5C25A 2Y1JA 3U4LA 1NGGA 5AQKA 5D3GA 4YDUC 3AGKA 1YXQA 4YOXA 5FRNA 4FWPA 2Q2RA 3AVAA 3HSCA 5GAGP 2V52B 2Q0UA 4DR5K 3HPGA 3VQ8A 3S3MA 3WQTA 4DUYK 4LFAK 2HSTA 2UXCK 2VQEK 4BRLA 1IV0A 4BR4A 4B8CA 4H8KA 2FXUA 3LL3A 3WNFA 1ZBIA 4DV1K 5CE3A 2FBXA 1P8ZA 3MXIA 4EAHD 1S1UA 1TL1A 3CJBA 1FK9A 4WF9L 4CZKA 4O44A 4CCHA 3LPUA 4HCBA 2PAVA 2KLAA 5C15A 1TUUA 1JCGA 2PY5A 3P39A 3SBTA 2QEXN 2HHXA 2O8FA 4NCAA 1C1CA 1S1TA 1HKGA 1VQON 4JI2K 4BQLA 3V9ZA 2OPPA 3MMVA 3CCMN 4M63C 3U6FA 3K57A 1KVCA 5J2NA 3OA9A 1MDUB 3VQQA 2QWOA 3V9XA 1IBMK 1KSPA 4OX9K 1WUAA 1T05A 3RTVA 3B6OA 1S1WA 1VSFA 1ESVA 3O8MA 3O08A 3DOLA 4DQIA 4LY7A 1VSLA 1EXQA 1HQUA 2A6AA 3VF2A 4BR5A 2F9WA 3H45C 4KH4A 2P9KB 1NKBA 1SUQA 3A8YA 5JVHL 4BE1A 1HNWK 3I8DA 3M6GA 4BC5A 1L3SA 1U2VB 2X78A 4BVPA 4CEEA 3B6PA 5KRSA 3KLIA 2IVNA 3O3HA 3OYBA 4ELVA 1TKTA 5M1NA 3LDSA 1MU2A 4YNQA 5DM7L 4CJPA 1VHXA 1W7AA 4CECA 1Q82O 1NOZA 2NRVA 3HBTA 1GLAG 4FJXA 4DQPA 4YY3K 4JKAA 3Q7BA 1SKRA 3PO5A 1VSJA 4ZTJA 3FGUA 2E1ZA 2P9UB 2A41A 4FOIA 4M3UA 2VG6A 3K5MA 1VQ4N 2HVIA 3THYA 3K5LA 4FZYA 2GWKA 1REVA 1JLBA 2NLXA 1BQMA 3O9RA 4CEQA 1C0TA 2FBYA 1E4FT 5TKYA 4YOVA 1S1VA 1NJYA 4DQSA 4E3SA 4AHSA 4B1YB 2HHHK 3D2FA 3FR0A 2D0AA 3L4IA 4PKHA 3QEXA 3VETA 3BDPA 4AHCA 1D9DA 3HL8A 2XRIA 3AO3A 4B1VA 2IGIA 2FLOA 1NGIA 4DTNA 4AILC 3NF9A 4WCEL 3AVLA 3C65A 4EZ9A 5KQ8A 2O8BA 1HJRA 1TUYA 2GTDA 4FWSA 1ATSA 3ZSYA 1FXXA 4I6MB 1JLQA 3UKRB 3ZX3A 1NK6A 1WBDA 3CF5L 3QEPA 3RRGA 1WAJA 2E5LK 4FJKA 2HBLA 1UAXA 1LWFA 4B9NA 1RILA 3EY1A 4FLWA 2JLEA 2PFUA 5GADP 3LWMA 3M8RA 3F2KA 3MCPA 3AVNA 5E26A 1KLMA 2KHOA 3ZT4A 3CJ7A 1T44A 3LAMA 2D0OA 4JKBA 3OS0A 4FJ8A 2F96A 1BISA 4DS4A 3FZMA 4HVJA 4MLHA 3ZT2A 1T6CA 2ATQA 4F2SA 3OYGA 1VQLN 5EXWA 2GBZA 1IKXA 4YOYA 1BUPA 4X62K 4QS7A 2GX9A 4MO4A 4PHTX 4EHUA 3CFPA 1RCHA 1EX4A 4AHUA 3OY9A 3SV4A 4BVOA 1KFSA 3MEDA 4KPYA 4DLGA 3RWUA 4O8UA 3QICA 1VRUA 3O6WA 5FPMA 5AFUH 1JL2A 5KPZA 4FZXC 3CQXA 1B92A 3OHRA 3RRHA 2RHKA 3SQ2A 3WNHA 4KB1A 1EWQA 4JI3K 3LANA 1IBLK 1ASWA 3LDLA 1MWMA 4KKOA 4BWMA 4M45A 1W2BM 4CD3A 2WBNA 1DEJA 5CZ2A 2QTDA 4RW4A 2XY8A 3OYMA 2OANA 1RGIA 4A61A 3OJSA 4BRFA 3AA3A 3VEXA 5LY3A 3SAGA 4MFBA 4H0PA 1J6ZA 1EETA 1U48A 1NK0A 4CZFA 4B9UA 4WQ5A 3QEVA 3KLHA 4FLTA 5SWMA 3T3FA 4KTQA 3WXLA 4M3YA 4DTPA 5C12A 4M7XA 1KAYA 2W6KA 3LALA 4YOTA 2HHQA 1SQKA 2YKNA 3R6MA 1YITN 4B9LA 1DTQA 1S3XA 3O3GA 3LDPA 1WSGA 3D2FB 4WQ5C 3ZX0A 4YFUA 1SZ2A 4FVMA 5M1OA 1Y64A 4CBUA 3WXKA 3QNOA 5AQUA 2O8BB 4BGAA 1ZBLA 5AQZA 1X3NA 4CZMA 4CHNA 5AQVA 3PSIA 3NF8A 1HYZA 2A42A 5J2PA 3SCXA 4MLEA 3H3OB 1YVUA 3VTIA 1OH7A 2QWPA 1HMVA 3LAKA 1LWCA 2F8SA 1JCEA 1KRPA 4FXDA 4H0YB 2PYJA 3CI5A 4IOXA 1TYQB 4OGEA 2YNHA 3QDKA 1VQ8N 4BG8A 2OZSA 2QWLA 5CY4A 4G9ZA 3VTHA 1A5XA 3GDQA 2DTUA 1HLUA 3KK7A 3WXMB 3O9UA 4CK1A 1QHTA 2ETJA 3M8SA 4KREA 2X6SA 4BRAA 2FC0A 3AVKA 1Q18A 2FBVA 5AQQA 1WSHA 4BRIA 1TKZA 1VSDA 2WFBA 3LP1A 1LW2A 3TABA 4WE1A 4CEDA 1I3AA 4AM7A 3CJAA 4FLXA 4NCGA 4E0DA 1Z05A 4NO7A 1BIUA 5JS2A 5KGWA 5BPLA 4OLAA 1X9SA 3A2FA 1KFDA 1QQMA 1NGHA 5FLXO 1TGOA 4IKFA 3P31A 3S41A 1GOCA 3OYFA 2UU9K 1U45A 1KLNA 1C1BA 2HBJA 5AQSA 3MCAB 1GLCG 1L3UA 3NHGA 3ZT0A 3C7NA 3VF4A 3DXKA 1IKWA 1TAQA 4CFBA 4MDAA 3AO4A 1ASVA 3MECA 4N47A 3T69A 1U49A 2J4RA 1O1WA 1VAZA 3DI6A 3ZCMA 3V4IA 5JS1A 4NYFA 3C6UA 2G8WA 4M3XA 3J7ZO 3VGKA 3DJCA 2E2QA 2UXBK 4DSKA 2YJFA 2CGJA 3VOVA 3CCLN 1QSSA 4KHWA 4IXCA 2IS3A 2FSKA 4WFNL 4Y0WA 1OVYA 3TTDA 4CBXA 1C0GA 3D6RA 4X64K 3SNNA 1Z6RA 3FZHA 3CC4N 2E2PA 4IDHA 4DV7K 4CEFA 4CIEA 3H3NO 2O8EA 4CF8A 1GLFO 2ASOA 2E6MA 3KK2A 2YI1A 2OPSA 3ID8A 3LDOA 1KC8O 3CQ8A 3VQBA 3QB0A 1E4GT 2WTUA 4ISFA 5E84A 2XY7A 1JJ2M 4E1MA 5AQIA 4PWDA 4IFYA 2KFZA 4AH9A 1HPMA 3EE9A 2HNYA 4C1NI 3L2QA 3WNGA 3JSMA 4CERA 1VQKN 1Q9XA 3NGZA 1VQ7N 5FRMA 3MAQA 2YJEA 1BA1A 1C0MA 3AGRA 3L0QA 1K8KA 3OYDA 1F21A 4WYBA 2WONA 3TSQA 3QBWA
chains in the Genus database with same CATH topology
5C25A 3AV9A 2P5GA 1YTAA 4CJTA 5D3GA 5EU7A 2E4LA 4IG3A 4BE0A 4NCBA 1U4BA 5FRNA 3AVAA 4CHQA 1CZBA 4N56A 4B9TA 4FZZA 2IAJA 3OJUA 1A5WA 4GW6A 4FJLA 1UWBA 3NH1A 1I39A 4KAZA 3HPGA 3VQ8A 2BDPA 3S3MA 4C8KA 3D0PA 3D45A 4Z4IA 2P5OA 3DRSA 4CJWA 1HPZA 3V1RA 4FW1A 4JLHA 4B8CA 3S9HA 1QQCA 4H8KA 3DYAA 1KVAA 4E89A 2DFHA 4FLVA 4ELUA 4IDKA 2OZMA 4DFKA 3L2RA 2HNDA 2KW4A 3WNFA 3DLEA 4M3WA 1R0AA 1ZBIA 4OKKA 2FBXA 3HPHA 4CGFA 3MXIA 2VWJA 1Z26A 1NK7A 1JLEA 4FJ5A 1JXBA 1S1UA 1TL1A 3PUFA 3OVNA 1FK9A 3PV8A 3UIQA 4O44A 4CCHA 3LPUA 3V81A 5HRRA 4HCBA 3L3UA 3SJJA 3VQ5A 3MXMA 4B9VA 4K8XA 2PY5A 4PQUA 1L3VA 4IG0A 2HHXA 3V6DA 4NCAA 3VA3A 1C1CA 3CG7A 1Z25A 1S1TA 3NF6A 3ULDA 4E7JA 3L2WA 1NOYA 4KHQA 4CJSA 3V9ZA 4DTOA 2YNGA 2OPPA 1NK5A 4I9LA 3U6FA 4Z4FA 3K57A 1J9AA 4OGCA 1KVCA 5J2NA 3NFAA 1SL0A 1JLAA 3VQQA 2E6LA 3V9XA 1KSPA 4KI4A 3QETA 1T05A 4J2DA 4FM2A 3HJFA 3RTVA 1HRHA 3B6OA 3ZSQA 1U47A 2RPIA 1S1WA 4LH4A 3IG1A 4F4KA 1VSFA 3LP3A 3H08A 4EP5A 2BE2A 3DOLA 4DQIA 4LY7A 1VSLA 4DQQA 1J53A 1EXQA 3HP9A 1HQUA 3HXMA 4DFJA 1Y97A 4KRFA 2YNFA 3OS2A 2A1RA 5K14A 4JS5A 2Z1IA 3TAGA 1X9MA 1TKXA 1NKBA 2D0CA 1SUQA 4FK4A 3JYTA 4BE1A 1TK8A 4NYNA 1RDAA 3L2UA 3NDKA 3I8DA 4H4OA 3CFOA 1TVRA 4ID1A 3HM9A 1L3SA 4CHYA 3K2PA 4L8RB 2X78A 4CEEA 2RKIA 4CJRA 4OPKA 3B6PA 1IKVA 5KRSA 3KLIA 4FJ9A 3MXJA 4O4GA 3O3HA 3OYBA 4ELVA 1TKTA 4EP4A 4N41A 4CEZA 3LDSA 3DMJA 4DU3A 5J2QA 1NK9A 4CFAA 3VQ4A 3TI0A 4B3OA 3M8QA 1MU2A 3LZIA 4YNQA 3S3OA 1NJWA 1BI4B 3ZSRA 4KFBA 4CJPA 5HP1A 1BIZA 1SV5A 4DTUA 3AVBA 1J5OA 1RT7A 4CECA 1NOZA 4ZHRA 1WNSA 2ZE2A 4Z0UA 4FCYA 4E7KA 3ZSZA 4HUEA 3SQ4A 4FJNA 3KLFA 4F8RA 4FJXA 4CF9A 4DQPA 2O4IA 3O4QA 1SKRA 1LV5A 1WSIA 3OYAA 4CE9A 1VSJA 4ZTJA 2PYLA 3PO5A 3KD5E 2BGGA 4M3ZA 5FDLA 1RT4A 4CJEA 3CFRA 3U3GA 3CM5A 4M3UA 4M3TA 1QSLA 2VG6A 2X6NA 4CF0A 2OPRA 4CK3A 5DK5A 3K5MA 3TWHA 3AVJA 3AVGA 5I3UA 3HVRA 2HVIA 3K5LA 4DWIA 3AO1A 3HSTB 3PX4A 4FZYA 1KTQA 1CXQA 1XI1A 1IO2A 4F3TA 2YKMA 2IC3A 1REVA 1KVBA 3WNEA 3LP2A 1JLBA 1JKHA 4R5PA 4KI6A 1BQMA 4CEQA 4CJKA 3U3YA 1C0TA 2FBYA 3I0SA 1TL3A 3KLEA 2NUBA 2YNIA 3KTQA 3EYZA 3DLKA 1S1VA 4CJFA 1NJYA 4DQSA 3S3NA 4QOZB 4DS5A 4F2RA 4E3SA 2X74A 4AHSA 4CGHA 3DLHA 4DF4A 2D0AA 3VQPA 3QEXA 4CEBA 3BDPA 4OLBA 4AHCA 3NH2A 3NBPA 1D9DA 4LSLA 3EZ5A 3HL8A 3VA0A 2XRIA 3ZT3A 3AO3A 4PUOA 2F8TA 2IGIA 1JLCA 4DTNA 1C0UA 4PA1A 3NF9A 5DMRA 4AILC 3LPTA 3RMCA 1SL2A 3AVLA 4EZ9A 4FJHA 3ZSVA 3PY8A 3DRRA 4QAGA 5SZTA 4M41A 1KCFA 1HJRA 4CFDA 3QEWA 3HVTA 4GMJB 4C8NA 4HUFA 1RT1A 3T19A 1UA0A 3ZSYA 1FXXA 4G1QA 1JLQA 1NK6A 4ELTA 2HNZA 3QEPA 3RRGA 1WAJA 2B6AA 4RW7A 2AJQA 4CF1A 4FJKA 5J1EA 3KD1E 1UAXA 2GUIA 1LWFA 3IRXA 4B9NA 1RILA 4CHZA 2HVHA 1D8YA 1VSIA 3EY1A 3ALYA 4FLWA 3SPYA 3FFIA 3DLGA 3QLHA 2JLEA 4O0IA 3TR8A 4N5SA 4W5OA 3SUPA 2HW3A 3LWMA 3M8RA 4HUGA 1XHXA 3AVNA 1KLMA 3ZT4A 3AA2A 1ZBHA 2QXFA 3HPOA 3LAMA 1VRTA 3OS0A 4FJ8A 2F96A 4LH5A 5CYQA 1S5JA 2OYQA 1W9HA 2WOMA 2HHWA 1BISA 4DS4A 4HVJA 2HHVA 2W42A 1QE1A 4FLZA 3ZT2A 3QNNA 2VG7A 4FLYA 2ATQA 3TAFA 2KZZA 3HT3A 3SYZA 4GVMA 4FW2A 3TAQA 4F2SA 3KIOA 3OYGA 2HHTA 4LSNA 2GBZA 1IKXA 1SKWA 1B9DA 3K5NA 1ITGA 4HHTA 3CFPA 4Y1DA 5KTQA 2HHSA 2LSNA 2EX3A 1RCHA 4IFVA 1EX4A 1G15A 4AHUA 3OY9A 3SV4A 4DG1A 1KFSA 3MEDA 1VSMA 5C24A 4KPYA 4Q0BA 4DLGA 4DMNA 1WLJA 3RWUA 1CZ9A 2Z1JA 4W5NA 4KO0A 3G10A 1VRUA 4DU4A 1JL2A 4K8ZA 1LWEA 4FZXC 2QKBA 1B92A 1IKYA 4AHTA 1NKEA 3RRHA 3SQ2A 4FJ7A 1U04A 3WNHA 4KB1A 3O4NA 4HTUA 4DTXA 4B9MA 3LANA 3ZSWA 1ASWA 3CM6A 4RW8A 2QKKA 5E41A 4CHOA 4KKOA 4BWMA 5KI6A 1EKEA 3KLGA 1BHLA 4M45A 1VSHA 2G8VA 2D5RA 4DSLA 4KHUA 3VQCA 1BCMA 1RT2A 1S1XA 2YHBA 4CGDA 4CGIA 3OYJA 3QIPA 4J2EA 5CZ2A 4OJRA 4DU1A 1QSYA 4OVLA 4RW4A 3OS1A 3OYHA 3OYNA 4Z4CA 4KHYA 2XY8A 2IDOA 3OYMA 4F3OA 3QEIA 2G8KA 4CJLA 4CJ5A 3OJSA 3L2VA 3DLBA 3AA3A 5T7BA 2IOCA 1ZBFA 4MFBA 4DFMA 2O4GA 5HRNA 2XHBA 1SKSA 1VSEA 1EETA 1JLGA 2OPQA 3KJVA 1U48A 3ZT1A 1SL1A 1NK0A 1NJXA 1S9EA 2JGUA 3C95A 4OKEA 3VQDA 2HMIA 4B9UA 2EHGA 1RTJA 2VG5A 3KLHA 3QEVA 3V9WA 1N5YA 4FLTA 5SWMA 4B8AB 2HB5A 3P83D 1C1AA 3MEGA 3T3FA 4KTQA 4CESA 4JRQA 2ITGA 4I2PA 4ZTFA 4KV8A 5KRTA 4EZ6A 4DTPA 4M3YA 4O55A 4FM1A 1T8EA 2P1JA 2OA8A 3LALA 5HRPA 4FM0A 2HHQA 2YKNA 4CJUA 3NCIA 1BGXT 1RNHA 3LZJA 4Z4EA 1EP4A 1NKCA 1WSJA 4CFCA 4B9LA 1DTQA 3DRPA 1RT5A 3G0ZA 3O3GA 3THVA 1N6QA 1WSGA 4I7FA 1ASUA 4C8MA 2QK9A 3C94A 4YFUA 1NK8A 4CHPA 1K6YA 4RG8A 1TAUA 3NGYA 1JXEA 1TV6A 3DM2A 1RBUA 2P51A 3NE6A 3SV3A 4BDPA 3DOKA 4FVMA 4IBNA 5C42A 1ZYQA 1DLOA 1RBTA 3L3VA 3QNOA 4E19A 2G8FA 2Z1HA 4JS4A 3IAYA 4ICLA 4DSEA 1ZBLA 4CHNA 1QTMA 2KZMA 4O5BA 3NF8A 2A1SA 5KGXA 1HYZA 4E7HA 5J2PA 2KTQA 3K5OA 3PX0A 4KTWA 4DQRA 3SCXA 1XHZA 1RDBA 2DFFA 1YVUA 1IG9A 1RBVA 1HMVA 3LAKA 4C8LA 1LWCA 1B9FA 3NF7A 4MQ3A 1A5VA 3V9SA 3C6TA 3VQAA 1KRPA 4BE2A 2F8SA 4FXDA 4DSFA 1T03A 2PYJA 1BCOA 1GOAA 2YNHA 4OGEA 1IH7A 1VK0A 3L8BA 3T1AA 1C6VA 2RF2A 3IS9A 4CJQA 4I9QA 3TARA 3E01A 3ZSOA 2OZSA 2KFNA 3ZSXA 2KQ2A 2RN2A 4CIGA 3HP6A 4DTSA 5CY4A 1RT3A 1A5XA 3CYMA 5HLFA 2DTUA 3RMBA 3NAEA 5HBMA 1X1PA 3DLRA 4RW9A 4CK1A 3O3FA 3AVHA 1QHTA 2ETJA 4KTZA 3M8SA 4KREA 4CGJA 4J2BA 2X6SA 4W5RA 2R7YA 2FC0A 4H4MA 4DF8A 3AVKA 4UQGA 3SI6A 4B9SA 2FBVA 3F9KA 1WSHA 2G8IA 4E7IA 1Q8IA 1S9GA 1RT6A 1JL1A 4AHRA 3SPZA 1TKZA 4DTJA 2DFEA 4RW6A 1VSDA 3LP1A 4O0JA 3PO4A 1LW2A 3TABA 1X9WA 4LD0A 2HHUA 1D9FA 4WE1A 3QIOA 4CEDA 1I3AA 3AA4A 3KK1A 4FLXA 4NCGA 4FLUA 3SQ1A 3ASMA 1HYVA 4KHSA 3OYLA 4E0DA 4BDYA 3OYKA 1BIUA 5JS2A 5KGWA 1NJZA 4E1NA 4CK2A 4FJMA 4KHNA 4OLAA 1X9SA 1BQNA 3TAEA 3A2FA 1KFDA 3P1GA 1TKDA 1NK4A 4DSIA 4CGGA 3NH0A 3V1QA 1HYSA 3AVIA 1TGOA 2YV0X 3KKRA 4IKFA 4TSXA 4CJ4A 2PZSA 1GOCA 1CLQA 3OYFA 1RBRA 2DY4A 4FK0A 1D5AA 1LAWA 1U45A 4FYDA 1KLNA 2XY6A 1C1BA 1WN7A 3LP0A 2D0BA 4CIFA 4M42A 3OYEA 2B4JA 3HYFA 1JLFA 3QO9A 3RR8A 1L3UA 3NHGA 3ZT0A 3AVMA 5J2MA 1L3TA 1L5UA 5HRSA 1RDCA 3SUNA 1IKWA 1TAQA 1WSEA 1RBSA 4CFBA 3AO4A 1ASVA 3MECA 3K58A 4N47A 1U49A 4OKJA 4M3RA 1TK0A 2G8UA 1O1WA 2BANA 2XY5A 5I42A 1ZBUA 4DSJA 3DI6A 3ZCMA 1W0HA 3V4IA 5JS1A 3VQEA 4NYFA 3AVCA 3C6UA 3OYCA 2YHAA 3NGIA 3TAMA 2VWKA 2G8WA 4FJJA 4M3XA 1UA1A 5FROA 1RDDA 3VQ6A 2G8HA 3RR7A 4BWJA 1HNVA 3V1OA 1XC9A 4DSKA 1WSFA 1BL3A 1HQEA 4E7LA 4FJIA 1HNIA 1TK5A 3HK2A 1XWLA 4I2QA 3VN5A 4AHVA 1QSSA 4W5QA 3PX6A 3AO5A 4KHWA 4CJVA 3AO2A 4B08A 2IS3A 3SUQA 4DLEA 4BDZA 4JRPA 1UOCA 3RMDA 2B5JA 1QS4A 3HO1A 3AVFA 3I0RA 1GOBA 2Z1GA 2I5JA 1Q9YA 1FKPA 3SNNA 4DTRA 3ITHA 1RTHA 4Z4GA 4W5TA 2ZQBA 3QESA 4DFPA 4J2AA 4CEFA 1LAVA 4PY5A 4CIEA 3LWLA 4N76A 1CXUA 4CF8A 3QERA 1J54A 1S6PA 4CF2A 2FBTA 2E6MA 3KK2A 1BI4A 2GV9A 2OPSA 3P5JA 2Y1IA 3CQ8A 1RTIA 1VSKA 3VQBA 3SUOA 4DTMA 2XY7A 4PWDA 4E1MA 2Q3SA 4IFYA 4XIUA 2XO7A 4AH9A 1S6QA 4OPJA 3TANA 1FKOA 2HNYA 4KB0A 2KFZA 3L2QA 4Y1CA 3AA5X 3WNGA 3KK3A 3JSMA 3QINA 4CERA 4QCLA 5CYMA 1DTTA 4Z4HA 1Q9XA 3VQ9A 3BGRA 1LW0A 3OYIA 3ISNC 1RTDA 1YT3A 3NGZA 5FRMA 3MAQA 5CZ1A 4BACA 4ID5A 4FJGA 4Q5VA 3K59A 5HROA 4C8OA 1C0MA 3SQ0A 3M8PA 1T7PA 2ZD1A 3KKSA 4CEOA 3F73A 3V9UA 3TAPA 4HCCA 4FK2A 1YTUA 3MEEA 3OYDA 4CJ3A 1F21A 3SZ2A 4CEAA 2WONA 1WAFA 3VQ7A 3RMAA 2Y1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C25 A;  3AV9 A;  2P5G A;  1YTA A;  4CJT A;  5D3G A;  5EU7 A;  2E4L A;  4IG3 A;  4BE0 A;  4NCB A;  1U4B A;  5FRN A;  3AVA A;  4CHQ A;  1CZB A;  4N56 A;  4B9T A;  4FZZ A;  2IAJ A;  3OJU A;  1A5W A;  4GW6 A;  4FJL A;  1UWB A;  3NH1 A;  1I39 A;  4KAZ A;  3HPG A;  3VQ8 A;  2BDP A;  3S3M A;  4C8K A;  3D0P A;  3D45 A;  4Z4I A;  2P5O A;  3DRS A;  4CJW A;  1HPZ A;  3V1R A;  4FW1 A;  4JLH A;  4B8C A;  3S9H A;  1QQC A;  4H8K A;  3DYA A;  1KVA A;  4E89 A;  2DFH A;  4FLV A;  4ELU A;  4IDK A;  2OZM A;  4DFK A;  3L2R A;  2HND A;  2KW4 A;  3WNF A;  3DLE A;  4M3W A;  1R0A A;  1ZBI A;  4OKK A;  2FBX A;  3HPH A;  4CGF A;  3MXI A;  2VWJ A;  1Z26 A;  1NK7 A;  1JLE A;  4FJ5 A;  1JXB A;  1S1U A;  1TL1 A;  3PUF A;  3OVN A;  1FK9 A;  3PV8 A;  3UIQ A;  4O44 A;  4CCH A;  3LPU A;  3V81 A;  5HRR A;  4HCB A;  3L3U A;  3SJJ A;  3VQ5 A;  3MXM A;  4B9V A;  4K8X A;  2PY5 A;  4PQU A;  1L3V A;  4IG0 A;  2HHX A;  3V6D A;  4NCA A;  3VA3 A;  1C1C A;  3CG7 A;  1Z25 A;  1S1T A;  3NF6 A;  3ULD A;  4E7J A;  3L2W A;  1NOY A;  4KHQ A;  4CJS A;  3V9Z A;  4DTO A;  2YNG A;  2OPP A;  1NK5 A;  4I9L A;  3U6F A;  4Z4F A;  3K57 A;  1J9A A;  4OGC A;  1KVC A;  5J2N A;  3NFA A;  1SL0 A;  1JLA A;  3VQQ A;  2E6L A;  3V9X A;  1KSP A;  4KI4 A;  3QET A;  1T05 A;  4J2D A;  4FM2 A;  3HJF A;  3RTV A;  1HRH A;  3B6O A;  3ZSQ A;  1U47 A;  2RPI A;  1S1W A;  4LH4 A;  3IG1 A;  4F4K A;  1VSF A;  3LP3 A;  3H08 A;  4EP5 A;  2BE2 A;  3DOL A;  4DQI A;  4LY7 A;  1VSL A;  4DQQ A;  1J53 A;  1EXQ A;  3HP9 A;  1HQU A;  3HXM A;  4DFJ A;  1Y97 A;  4KRF A;  2YNF A;  3OS2 A;  2A1R A;  5K14 A;  4JS5 A;  2Z1I A;  3TAG A;  1X9M A;  1TKX A;  1NKB A;  2D0C A;  1SUQ A;  4FK4 A;  3JYT A;  4BE1 A;  1TK8 A;  4NYN A;  1RDA A;  3L2U A;  3NDK A;  3I8D A;  4H4O A;  3CFO A;  1TVR A;  4ID1 A;  3HM9 A;  1L3S A;  4CHY A;  3K2P A;  4L8R B;  2X78 A;  4CEE A;  2RKI A;  4CJR A;  4OPK A;  3B6P A;  1IKV A;  5KRS A;  3KLI A;  4FJ9 A;  3MXJ A;  4O4G A;  3O3H A;  3OYB A;  4ELV A;  1TKT A;  4EP4 A;  4N41 A;  4CEZ A;  3LDS A;  3DMJ A;  4DU3 A;  5J2Q A;  1NK9 A;  4CFA A;  3VQ4 A;  3TI0 A;  4B3O A;  3M8Q A;  1MU2 A;  3LZI A;  4YNQ A;  3S3O A;  1NJW A;  1BI4 B;  3ZSR A;  4KFB A;  4CJP A;  5HP1 A;  1BIZ A;  1SV5 A;  4DTU A;  3AVB A;  1J5O A;  1RT7 A;  4CEC A;  1NOZ A;  4ZHR A;  1WNS A;  2ZE2 A;  4Z0U A;  4FCY A;  4E7K A;  3ZSZ A;  4HUE A;  3SQ4 A;  4FJN A;  3KLF A;  4F8R A;  4FJX A;  4CF9 A;  4DQP A;  2O4I A;  3O4Q A;  1SKR A;  1LV5 A;  1WSI A;  3OYA A;  4CE9 A;  1VSJ A;  4ZTJ A;  2PYL A;  3PO5 A;  3KD5 E;  2BGG A;  4M3Z A;  5FDL A;  1RT4 A;  4CJE A;  3CFR A;  3U3G A;  3CM5 A;  4M3U A;  4M3T A;  1QSL A;  2VG6 A;  2X6N A;  4CF0 A;  2OPR A;  4CK3 A;  5DK5 A;  3K5M A;  3TWH A;  3AVJ A;  3AVG A;  5I3U A;  3HVR A;  2HVI A;  3K5L A;  4DWI A;  3AO1 A;  3HST B;  3PX4 A;  4FZY A;  1KTQ A;  1CXQ A;  1XI1 A;  1IO2 A;  4F3T A;  2YKM A;  2IC3 A;  1REV A;  1KVB A;  3WNE A;  3LP2 A;  1JLB A;  1JKH A;  4R5P A;  4KI6 A;  1BQM A;  4CEQ A;  4CJK A;  3U3Y A;  1C0T A;  2FBY A;  3I0S A;  1TL3 A;  3KLE A;  2NUB A;  2YNI A;  3KTQ A;  3EYZ A;  3DLK A;  1S1V A;  4CJF A;  1NJY A;  4DQS A;  3S3N A;  4QOZ B;  4DS5 A;  4F2R A;  4E3S A;  2X74 A;  4AHS A;  4CGH A;  3DLH A;  4DF4 A;  2D0A A;  3VQP A;  3QEX A;  4CEB A;  3BDP A;  4OLB A;  4AHC A;  3NH2 A;  3NBP A;  1D9D A;  4LSL A;  3EZ5 A;  3HL8 A;  3VA0 A;  2XRI A;  3ZT3 A;  3AO3 A;  4PUO A;  2F8T A;  2IGI A;  1JLC A;  4DTN A;  1C0U A;  4PA1 A;  3NF9 A;  5DMR A;  4AIL C;  3LPT A;  3RMC A;  1SL2 A;  3AVL A;  4EZ9 A;  4FJH A;  3ZSV A;  3PY8 A;  3DRR A;  4QAG A;  5SZT A;  4M41 A;  1KCF A;  1HJR A;  4CFD A;  3QEW A;  3HVT A;  4GMJ B;  4C8N A;  4HUF A;  1RT1 A;  3T19 A;  1UA0 A;  3ZSY A;  1FXX A;  4G1Q A;  1JLQ A;  1NK6 A;  4ELT A;  2HNZ A;  3QEP A;  3RRG A;  1WAJ A;  2B6A A;  4RW7 A;  2AJQ A;  4CF1 A;  4FJK A;  5J1E A;  3KD1 E;  1UAX A;  2GUI A;  1LWF A;  3IRX A;  4B9N A;  1RIL A;  4CHZ A;  2HVH A;  1D8Y A;  1VSI A;  3EY1 A;  3ALY A;  4FLW A;  3SPY A;  3FFI A;  3DLG A;  3QLH A;  2JLE A;  4O0I A;  3TR8 A;  4N5S A;  4W5O A;  3SUP A;  2HW3 A;  3LWM A;  3M8R A;  4HUG A;  1XHX A;  3AVN A;  1KLM A;  3ZT4 A;  3AA2 A;  1ZBH A;  2QXF A;  3HPO A;  3LAM A;  1VRT A;  3OS0 A;  4FJ8 A;  2F96 A;  4LH5 A;  5CYQ A;  1S5J A;  2OYQ A;  1W9H A;  2WOM A;  2HHW A;  1BIS A;  4DS4 A;  4HVJ A;  2HHV A;  2W42 A;  1QE1 A;  4FLZ A;  3ZT2 A;  3QNN A;  2VG7 A;  4FLY A;  2ATQ A;  3TAF A;  2KZZ A;  3HT3 A;  3SYZ A;  4GVM A;  4FW2 A;  3TAQ A;  4F2S A;  3KIO A;  3OYG A;  2HHT A;  4LSN A;  2GBZ A;  1IKX A;  1SKW A;  1B9D A;  3K5N A;  1ITG A;  4HHT A;  3CFP A;  4Y1D A;  5KTQ A;  2HHS A;  2LSN A;  2EX3 A;  1RCH A;  4IFV A;  1EX4 A;  1G15 A;  4AHU A;  3OY9 A;  3SV4 A;  4DG1 A;  1KFS A;  3MED A;  1VSM A;  5C24 A;  4KPY A;  4Q0B A;  4DLG A;  4DMN A;  1WLJ A;  3RWU A;  1CZ9 A;  2Z1J A;  4W5N A;  4KO0 A;  3G10 A;  1VRU A;  4DU4 A;  1JL2 A;  4K8Z A;  1LWE A;  4FZX C;  2QKB A;  1B92 A;  1IKY A;  4AHT A;  1NKE A;  3RRH A;  3SQ2 A;  4FJ7 A;  1U04 A;  3WNH A;  4KB1 A;  3O4N A;  4HTU A;  4DTX A;  4B9M A;  3LAN A;  3ZSW A;  1ASW A;  3CM6 A;  4RW8 A;  2QKK A;  5E41 A;  4CHO A;  4KKO A;  4BWM A;  5KI6 A;  1EKE A;  3KLG A;  1BHL A;  4M45 A;  1VSH A;  2G8V A;  2D5R A;  4DSL A;  4KHU A;  3VQC A;  1BCM A;  1RT2 A;  1S1X A;  2YHB A;  4CGD A;  4CGI A;  3OYJ A;  3QIP A;  4J2E A;  5CZ2 A;  4OJR A;  4DU1 A;  1QSY A;  4OVL A;  4RW4 A;  3OS1 A;  3OYH A;  3OYN A;  4Z4C A;  4KHY A;  2XY8 A;  2IDO A;  3OYM A;  4F3O A;  3QEI A;  2G8K A;  4CJL A;  4CJ5 A;  3OJS A;  3L2V A;  3DLB A;  3AA3 A;  5T7B A;  2IOC A;  1ZBF A;  4MFB A;  4DFM A;  2O4G A;  5HRN A;  2XHB A;  1SKS A;  1VSE A;  1EET A;  1JLG A;  2OPQ A;  3KJV A;  1U48 A;  3ZT1 A;  1SL1 A;  1NK0 A;  1NJX A;  1S9E A;  2JGU A;  3C95 A;  4OKE A;  3VQD A;  2HMI A;  4B9U A;  2EHG A;  1RTJ A;  2VG5 A;  3KLH A;  3QEV A;  3V9W A;  1N5Y A;  4FLT A;  5SWM A;  4B8A B;  2HB5 A;  3P83 D;  1C1A A;  3MEG A;  3T3F A;  4KTQ A;  4CES A;  4JRQ A;  2ITG A;  4I2P A;  4ZTF A;  4KV8 A;  5KRT A;  4EZ6 A;  4DTP A;  4M3Y A;  4O55 A;  4FM1 A;  1T8E A;  2P1J A;  2OA8 A;  3LAL A;  5HRP A;  4FM0 A;  2HHQ A;  2YKN A;  4CJU A;  3NCI A;  1BGX T;  1RNH A;  3LZJ A;  4Z4E A;  1EP4 A;  1NKC A;  1WSJ A;  4CFC A;  4B9L A;  1DTQ A;  3DRP A;  1RT5 A;  3G0Z A;  3O3G A;  3THV A;  1N6Q A;  1WSG A;  4I7F A;  1ASU A;  4C8M A;  2QK9 A;  3C94 A;  4YFU A;  1NK8 A;  4CHP A;  1K6Y A;  4RG8 A;  1TAU A;  3NGY A;  1JXE A;  1TV6 A;  3DM2 A;  1RBU A;  2P51 A;  3NE6 A;  3SV3 A;  4BDP A;  3DOK A;  4FVM A;  4IBN A;  5C42 A;  1ZYQ A;  1DLO A;  1RBT A;  3L3V A;  3QNO A;  4E19 A;  2G8F A;  2Z1H A;  4JS4 A;  3IAY A;  4ICL A;  4DSE A;  1ZBL A;  4CHN A;  1QTM A;  2KZM A;  4O5B A;  3NF8 A;  2A1S A;  5KGX A;  1HYZ A;  4E7H A;  5J2P A;  2KTQ A;  3K5O A;  3PX0 A;  4KTW A;  4DQR A;  3SCX A;  1XHZ A;  1RDB A;  2DFF A;  1YVU A;  1IG9 A;  1RBV A;  1HMV A;  3LAK A;  4C8L A;  1LWC A;  1B9F A;  3NF7 A;  4MQ3 A;  1A5V A;  3V9S A;  3C6T A;  3VQA A;  1KRP A;  4BE2 A;  2F8S A;  4FXD A;  4DSF A;  1T03 A;  2PYJ A;  1BCO A;  1GOA A;  2YNH A;  4OGE A;  1IH7 A;  1VK0 A;  3L8B A;  3T1A A;  1C6V A;  2RF2 A;  3IS9 A;  4CJQ A;  4I9Q A;  3TAR A;  3E01 A;  3ZSO A;  2OZS A;  2KFN A;  3ZSX A;  2KQ2 A;  2RN2 A;  4CIG A;  3HP6 A;  4DTS A;  5CY4 A;  1RT3 A;  1A5X A;  3CYM A;  5HLF A;  2DTU A;  3RMB A;  3NAE A;  5HBM A;  1X1P A;  3DLR A;  4RW9 A;  4CK1 A;  3O3F A;  3AVH A;  1QHT A;  2ETJ A;  4KTZ A;  3M8S A;  4KRE A;  4CGJ A;  4J2B A;  2X6S A;  4W5R A;  2R7Y A;  2FC0 A;  4H4M A;  4DF8 A;  3AVK A;  4UQG A;  3SI6 A;  4B9S A;  2FBV A;  3F9K A;  1WSH A;  2G8I A;  4E7I A;  1Q8I A;  1S9G A;  1RT6 A;  1JL1 A;  4AHR A;  3SPZ A;  1TKZ A;  4DTJ A;  2DFE A;  4RW6 A;  1VSD A;  3LP1 A;  4O0J A;  3PO4 A;  1LW2 A;  3TAB A;  1X9W A;  4LD0 A;  2HHU A;  1D9F A;  4WE1 A;  3QIO A;  4CED A;  1I3A A;  3AA4 A;  3KK1 A;  4FLX A;  4NCG A;  4FLU A;  3SQ1 A;  3ASM A;  1HYV A;  4KHS A;  3OYL A;  4E0D A;  4BDY A;  3OYK A;  1BIU A;  5JS2 A;  5KGW A;  1NJZ A;  4E1N A;  4CK2 A;  4FJM A;  4KHN A;  4OLA A;  1X9S A;  1BQN A;  3TAE A;  3A2F A;  1KFD A;  3P1G A;  1TKD A;  1NK4 A;  4DSI A;  4CGG A;  3NH0 A;  3V1Q A;  1HYS A;  3AVI A;  1TGO A;  2YV0 X;  3KKR A;  4IKF A;  4TSX A;  4CJ4 A;  2PZS A;  1GOC A;  1CLQ A;  3OYF A;  1RBR A;  2DY4 A;  4FK0 A;  1D5A A;  1LAW A;  1U45 A;  4FYD A;  1KLN A;  2XY6 A;  1C1B A;  1WN7 A;  3LP0 A;  2D0B A;  4CIF A;  4M42 A;  3OYE A;  2B4J A;  3HYF A;  1JLF A;  3QO9 A;  3RR8 A;  1L3U A;  3NHG A;  3ZT0 A;  3AVM A;  5J2M A;  1L3T A;  1L5U A;  5HRS A;  1RDC A;  3SUN A;  1IKW A;  1TAQ A;  1WSE A;  1RBS A;  4CFB A;  3AO4 A;  1ASV A;  3MEC A;  3K58 A;  4N47 A;  1U49 A;  4OKJ A;  4M3R A;  1TK0 A;  2G8U A;  1O1W A;  2BAN A;  2XY5 A;  5I42 A;  1ZBU A;  4DSJ A;  3DI6 A;  3ZCM A;  1W0H A;  3V4I A;  5JS1 A;  3VQE A;  4NYF A;  3AVC A;  3C6U A;  3OYC A;  2YHA A;  3NGI A;  3TAM A;  2VWK A;  2G8W A;  4FJJ A;  4M3X A;  1UA1 A;  5FRO A;  1RDD A;  3VQ6 A;  2G8H A;  3RR7 A;  4BWJ A;  1HNV A;  3V1O A;  1XC9 A;  4DSK A;  1WSF A;  1BL3 A;  1HQE A;  4E7L A;  4FJI A;  1HNI A;  1TK5 A;  3HK2 A;  1XWL A;  4I2Q A;  3VN5 A;  4AHV A;  1QSS A;  4W5Q A;  3PX6 A;  3AO5 A;  4KHW A;  4CJV A;  3AO2 A;  4B08 A;  2IS3 A;  3SUQ A;  4DLE A;  4BDZ A;  4JRP A;  1UOC A;  3RMD A;  2B5J A;  1QS4 A;  3HO1 A;  3AVF A;  3I0R A;  1GOB A;  2Z1G A;  2I5J A;  1Q9Y A;  1FKP A;  3SNN A;  4DTR A;  3ITH A;  1RTH A;  4Z4G A;  4W5T A;  2ZQB A;  3QES A;  4DFP A;  4J2A A;  4CEF A;  1LAV A;  4PY5 A;  4CIE A;  3LWL A;  4N76 A;  1CXU A;  4CF8 A;  3QER A;  1J54 A;  1S6P A;  4CF2 A;  2FBT A;  2E6M A;  3KK2 A;  1BI4 A;  2GV9 A;  2OPS A;  3P5J A;  2Y1I A;  3CQ8 A;  1RTI A;  1VSK A;  3VQB A;  3SUO A;  4DTM A;  2XY7 A;  4PWD A;  4E1M A;  2Q3S A;  4IFY A;  4XIU A;  2XO7 A;  4AH9 A;  1S6Q A;  4OPJ A;  3TAN A;  1FKO A;  2HNY A;  4KB0 A;  2KFZ A;  3L2Q A;  4Y1C A;  3AA5 X;  3WNG A;  3KK3 A;  3JSM A;  3QIN A;  4CER A;  4QCL A;  5CYM A;  1DTT A;  4Z4H A;  1Q9X A;  3VQ9 A;  3BGR A;  1LW0 A;  3OYI A;  3ISN C;  1RTD A;  1YT3 A;  3NGZ A;  5FRM A;  3MAQ A;  5CZ1 A;  4BAC A;  4ID5 A;  4FJG A;  4Q5V A;  3K59 A;  5HRO A;  4C8O A;  1C0M A;  3SQ0 A;  3M8P A;  1T7P A;  2ZD1 A;  3KKS A;  4CEO A;  3F73 A;  3V9U A;  3TAP A;  4HCC A;  4FK2 A;  1YTU A;  3MEE A;  3OYD A;  4CJ3 A;  1F21 A;  3SZ2 A;  4CEA A;  2WON A;  1WAF A;  3VQ7 A;  3RMA A;  2Y1J A; 
#chains in the Genus database with same CATH topology
 3F5T A;  3AV9 A;  3O9T A;  2P5G A;  3GE1 A;  4IG3 A;  4C23 A;  4N56 A;  3THX B;  4FZZ A;  2IAJ A;  2BDP A;  3D0P A;  4Z4I A;  5F2R A;  3H46 O;  3MWT A;  4BRM A;  4H0V B;  3V1R A;  2OTL N;  4DR4 K;  3S9H A;  3DYA A;  4GNI A;  5FPN A;  4FLV A;  4ELU A;  4JHD A;  1WOQ A;  3WXI A;  3HPH A;  3K0S A;  2VWJ A;  1NK7 A;  1VQ5 N;  1JLE A;  3LDQ A;  2ZJR L;  4IJN A;  3UIQ A;  3L6Q A;  3V81 A;  3VEY A;  3MXM A;  2Q97 A;  1V4S A;  4PQU A;  4BRE A;  3V6D A;  5BN9 A;  4B3M K;  3CG7 A;  1Z25 A;  5AQJ A;  2P9P A;  4E7J A;  3L2W A;  4CJS A;  4ILH A;  1NK5 A;  2YNG A;  4Z4F A;  3C7N B;  2UUC K;  4JKF A;  4OGC A;  3IFR A;  3NFA A;  1OH8 A;  1W97 L;  1ILY A;  3HJF A;  4BC4 A;  4LF6 K;  3ID6 A;  3ZSQ A;  1U47 A;  3ZEU B;  4F4K A;  3LP3 A;  4DFJ A;  5CHI A;  4PL7 A;  4KRF A;  2A1R A;  4JS5 A;  2Z1I A;  1TKX A;  2D0C A;  4U7B A;  3JYT A;  1TK8 A;  3L2U A;  4NB4 A;  4H4O A;  3CFO A;  1TVR A;  2P9N B;  3K2P A;  4CJR A;  4OPK A;  4FJ9 A;  4CI6 A;  3MXJ A;  3EKS A;  1N32 K;  3GOI A;  4N41 A;  4B1U B;  1NK9 A;  3DMJ A;  3DXM B;  3LZI A;  3BZK A;  1NJW A;  3ZSR A;  4RCH A;  1J5O A;  1RT7 A;  3GL1 A;  1WNS A;  3N4P A;  4BRC A;  3ZSZ A;  4HUE A;  3KLF A;  4F8R A;  1NM1 A;  2O4I A;  4FO0 A;  2WUS A;  1WSI A;  3KD5 E;  2PYL A;  4JN4 A;  5FDL A;  3U3G A;  4E1J A;  2X6N A;  2OPR A;  4CK3 A;  5I3U A;  4GV3 A;  4DWI A;  3HST B;  4A5B A;  1RDW X;  1XI1 A;  1IO2 A;  3VER A;  1KVB A;  5CR4 A;  4CJK A;  3U3Y A;  2V7Y A;  3I0S A;  5GAE P;  2YNI A;  3EYZ A;  1BWF O;  4K42 A;  4CJF A;  5FPE A;  3S3N A;  4DS5 A;  1ATR A;  2YHY A;  2NRR A;  4DF4 A;  4OLB A;  3NH2 A;  3NBP A;  4LSL A;  4JKC A;  3EZ5 A;  1K73 O;  2F8T A;  1JLC A;  3BUZ B;  1SL2 A;  4A2B A;  4DCH A;  3RMC A;  4JHD B;  3PY8 A;  4QAG A;  4M41 A;  4BRO A;  4MO5 A;  3QEW A;  4C8N A;  4BR0 A;  4HUF A;  3T19 A;  5KPR A;  3LDN A;  4LF7 K;  2HNZ A;  5BPM A;  4DR7 K;  2B6A A;  4RW7 A;  4CF1 A;  2AP1 A;  4JD2 A;  5M1P A;  3IRX A;  4JYA K;  1D8Y A;  1VSI A;  3ALY A;  1YJN N;  1WB9 A;  3FFI A;  3QLH A;  5HL7 L;  2P9P B;  1DKG D;  3WXJ A;  1MWK A;  4N5S A;  3SUP A;  3CD6 N;  4HUG A;  3MX5 A;  2YCH A;  3HPO A;  4LH5 A;  1HUX A;  2HF4 A;  3W0L A;  4GKJ K;  3HT3 A;  3SYZ A;  3PLA A;  4GVM A;  3TAQ A;  3CCV N;  4LSN A;  2QA4 N;  3UKU A;  1SKW A;  1M1K O;  4NXN K;  1B9D A;  5KTQ A;  4K41 A;  4IFV A;  2NRZ A;  1HKC A;  3E9O A;  3O5B A;  1VSM A;  5C24 A;  1DGK N;  3GBT A;  1WLJ A;  2Z1J A;  4H0T B;  4KO0 A;  3G10 A;  4DR3 K;  1VQM N;  1IKY A;  4FJ7 A;  5AQT A;  3O4N A;  4DTX A;  3ZSW A;  3CM6 A;  3TSU A;  4CHO A;  1EKE A;  4H03 B;  1BHL A;  1VSH A;  2NZT A;  3JXU A;  5BRE A;  1S1X A;  4CGI A;  4R79 A;  2NRW A;  3QIP A;  4J2E A;  4OJR A;  4DU1 A;  1QSY A;  3OYH A;  4F3O A;  1LOT B;  3CJ1 A;  5AZJ B;  3FE1 A;  2IOC A;  3VEO A;  4DFM A;  3VGM A;  4KH5 A;  1VSE A;  3ZT1 A;  3EL2 A;  1S9E A;  4IEE A;  3V9W A;  4B8A B;  3P83 D;  2VCP A;  4UY8 O;  4JV5 K;  4GVE A;  5JLF A;  1EQY A;  5KRT A;  4EZ6 A;  1T8E A;  2CGL A;  2P1J A;  2OA8 A;  4IZ9 A;  4BRQ A;  4H5W A;  2QI2 A;  1BGX T;  2OCE A;  4Z4E A;  1WSJ A;  4K0K K;  4L3Q A;  5F1X A;  3DRP A;  1N6Q A;  4PKG A;  4ISG A;  4I7F A;  4C8M A;  3VEZ A;  4CZI A;  4RG8 A;  1JXE A;  1RBU A;  3SV3 A;  4BDP A;  3HOT A;  1ZYQ A;  3A0I X;  1DLO A;  3KWI A;  5AQF A;  5BR9 A;  3U8X A;  4WQ4 C;  2A1S A;  3BF1 A;  1XHZ A;  1HX1 A;  2DFF A;  4A59 A;  3R3L A;  2FSJ A;  2O8D A;  1B9F A;  3N4Q A;  3VQA A;  4BE2 A;  4CW7 B;  1T03 A;  3CHW A;  1BCO A;  1VK0 A;  1Q86 O;  4BGB A;  1JCF A;  2RF2 A;  4CJQ A;  1BDG A;  1IG8 A;  3ULE A;  2KQ2 A;  4CIG A;  3I55 N;  2O8F B;  1NNE A;  1P90 A;  3CYM A;  5ADX A;  4CVN E;  5HBM A;  4DV5 K;  2P9S A;  3ZLJ A;  4IEI A;  2R7Y A;  4B9S A;  2ZJQ L;  2G8I A;  3UKU B;  4E7I A;  3SPZ A;  3OTO K;  4NXM K;  5IT9 O;  1KQS M;  2QM1 A;  3PO4 A;  2NNW A;  2HHU A;  3SQ1 A;  3A5N C;  3KK1 A;  1DT9 A;  3OYL A;  3O9S A;  5LMU K;  1YUW A;  1NJZ A;  3SK3 A;  4CK2 A;  4KHN A;  1N33 K;  3P1G A;  1NGA A;  1Q81 O;  4DSI A;  1HYS A;  3AVI A;  2YV0 X;  3KKR A;  4TSX A;  4H0X B;  2PZS A;  1OKJ A;  1G99 A;  4XH5 A;  2DY4 A;  2NRX A;  3WEE A;  2P9I A;  1D5A A;  4FYD A;  2XY6 A;  1WN7 A;  3LP0 A;  4DV4 K;  3OYE A;  1IJJ A;  3RR8 A;  3CC2 N;  5J2M A;  5HRS A;  4FWK A;  1TK0 A;  4OPH A;  3DAW A;  4BRH A;  2NRT A;  5LJV A;  1W0H A;  5M1K A;  4XH4 A;  3CET A;  5AQH A;  3VQE A;  2VGM A;  3E66 A;  2VWK A;  3CMA N;  3E9L A;  1UA1 A;  1RDD A;  3RR7 A;  5AQP A;  3T1H K;  4E7L A;  3HK2 A;  1TK5 A;  3VN5 A;  3U9D A;  4AHV A;  3AO5 A;  4B08 A;  3THY B;  4BDZ A;  4IOC L;  3RMD A;  1H1V A;  1CZA N;  4DV0 K;  3HO1 A;  2HOE A;  2I5J A;  1Q9Y A;  4AQY K;  1YF5 L;  4DTR A;  1HR0 K;  3QFU A;  1WBB A;  2VYP A;  2ZQB A;  3H1V X;  3KZB A;  2ASP A;  1LAV A;  3DWL A;  4RWT A;  3AAQ A;  3UE5 A;  1VQ9 N;  1BI4 A;  3P5J A;  2E2O A;  2F7T A;  2PBD A;  3KWG A;  1VSK A;  4JI8 K;  3TAN A;  4OPJ A;  1S6Q A;  2HBK A;  2Q36 A;  3AA5 X;  1N36 K;  3RSE A;  3QIN A;  4O5F A;  2HBM A;  1DTT A;  5BRH A;  1RTD A;  1YT3 A;  5BRD A;  3HI0 A;  5LMN K;  5CZ1 A;  4BAC A;  4ID5 A;  5HRO A;  4C8O A;  1S22 A;  3SQ0 A;  2ZD1 A;  4CEO A;  4FK2 A;  4JKE A;  3V9U A;  1R59 O;  1WAF A;  5I9E B;  5IWA K;  3VGL A;  3RMA A;  1YTA A;  4CJT A;  2E4L A;  4NCB A;  1U4B A;  2P9S B;  2QWQ A;  1NGJ A;  4A57 A;  1CZB A;  4CHQ A;  3DLL L;  3OJU A;  4GW6 A;  5AZI A;  4KAZ A;  5KQD A;  3M3Z A;  4DR2 K;  4CJW A;  4BY9 C;  3IUC A;  4B1Z A;  4FW1 A;  4JLH A;  5GIN A;  4E89 A;  1KVA A;  2DFH A;  4IDK A;  2OZM A;  5AR0 A;  3DLE A;  1R0A A;  4FL9 A;  4OKK A;  3AAR A;  4CGF A;  1QHA A;  1Z26 A;  1JXB A;  3OVN A;  3M1F A;  3PV8 A;  3J7Y P;  3WT0 A;  4A5A A;  5HRR A;  3L3U A;  3SJJ A;  4DUZ K;  3CCS N;  2O8C A;  3VQ5 A;  4AF1 A;  3WEE B;  4K8X A;  3K9K A;  3TPQ A;  1NOY A;  4I9L A;  4DR6 K;  1SL0 A;  1JLA A;  2E6L A;  3BP8 A;  3QET A;  4ILJ A;  5JLH A;  4J2D A;  3VES A;  4H5R A;  2RPI A;  2E1Y A;  4LH4 A;  1QVG M;  4EP5 A;  2BE2 A;  2E2N A;  4DQQ A;  1J53 A;  3VF6 A;  3HXM A;  2YNF A;  3OBY A;  4JI4 K;  3OS2 A;  5GIO A;  1FJG K;  3M5R A;  4NYN A;  1T6D A;  1KXP A;  1RDA A;  3HM9 A;  4CHY A;  2RKI A;  1YI2 N;  4EP4 A;  4DU3 A;  2GWJ A;  5J2Q A;  4CFA A;  2F4V K;  4B3O A;  3M8Q A;  3O1B A;  1OVQ A;  1BI4 B;  4DTU A;  3AVB A;  2ZE2 A;  4Z0U A;  3J81 O;  4FCY A;  4DR1 K;  2JWK A;  1SAZ A;  3SQ4 A;  4FJN A;  2ITM A;  4CF9 A;  5AQX A;  3U9Z A;  5JVG L;  3OYA A;  4CE9 A;  3T1Y K;  3HOS A;  3CFR A;  3CM5 A;  4V19 S;  3E9P A;  5C2F A;  4CF0 A;  5DK5 A;  3TWH A;  3R9P A;  3AVG A;  3HVR A;  1LCU A;  3AO1 A;  3WUH A;  2YKM A;  2IC3 A;  1QQO A;  1JKH A;  4R5P A;  2D0P A;  3CIP A;  2JWL A;  3G25 A;  2NUB A;  3KTQ A;  3DLK A;  5AZI B;  4QOZ B;  4IFE A;  2X74 A;  4CGH A;  2F9T A;  2I7N A;  4IO9 L;  3VQP A;  5LJW A;  4MDB A;  4PUO A;  3ZT3 A;  3MX2 A;  1XNR K;  5AQN A;  3LPT A;  4FJH A;  3ZSV A;  1KCF A;  4FWQ A;  3EEQ A;  3HVT A;  4CZL A;  4ELT A;  4JKG A;  4LF4 K;  2AJQ A;  5J1E A;  3KD1 E;  2CH6 A;  1E3M A;  5B8H A;  3KVG A;  4O0I A;  2A5X A;  1XHX A;  3AA2 A;  2QXF A;  4GKK K;  2RE2 A;  2E88 A;  1S5J A;  5MLC Q;  2OYQ A;  2HHW A;  5HOO A;  3NVM A;  3CC7 N;  1QE1 A;  4FLZ A;  3WQU A;  1BG3 A;  3QNN A;  2VG7 A;  4FLY A;  3DXK B;  5ELZ A;  1QZ6 A;  3A5M C;  2HHT A;  5GAH P;  5AQW A;  2GEM A;  1KD1 O;  3BF3 A;  3K5N A;  1ITG A;  1ZC6 A;  2E8A A;  2HHS A;  2LSN A;  2EX3 A;  1G15 A;  3P38 A;  4BR2 A;  5AQO A;  1HNZ K;  4LC9 B;  3EN9 A;  4W5N A;  1LWE A;  4AHT A;  3G71 N;  3VEV A;  4PL8 A;  4FWL A;  2Q31 A;  4B9M A;  1VQP N;  5E41 A;  4JEP A;  2G8V A;  3KHY A;  3KLG A;  5JMV A;  2D5R A;  5BN8 A;  3ENO A;  1I94 K;  1RT2 A;  1KAZ A;  4CGD A;  2O8E B;  4OVL A;  3ENB A;  4Z4C A;  4KHY A;  2IDO A;  3TU5 A;  1MA9 B;  3QEI A;  4J8F A;  2G8K A;  4CJL A;  1EO1 A;  4H5V A;  3R8E A;  5T7B A;  1T3V A;  1ZBF A;  3C6A A;  3EE8 A;  5HRN A;  2P9K A;  1YJW N;  1SKS A;  3KJV A;  1SL1 A;  2A40 A;  2JGU A;  3C95 A;  3ENH A;  2HMI A;  3BEX A;  4FPB A;  3ZX2 A;  1N5Y A;  1U2V A;  2HB5 A;  4FSV A;  1U6Z A;  3MDQ A;  1K8K B;  1HJO A;  4IO8 A;  4KV8 A;  4O55 A;  4LF8 K;  4CJU A;  1RNH A;  3CPW M;  4CFC A;  2IVO A;  1EWR A;  3G0Z A;  1RT5 A;  4JI1 K;  4H5T A;  2QK9 A;  1NK8 A;  1TAU A;  1K6Y A;  3G6E N;  1TV6 A;  2P51 A;  3NE6 A;  3DOK A;  4IBN A;  1KAX A;  1RBT A;  5M1F A;  3I8B A;  1NGE A;  2G8F A;  4DSE A;  2KZM A;  4O5B A;  4KH6 A;  5KGX A;  2P9U A;  4DV3 K;  1QQN A;  4JKG B;  3K5O A;  3PX0 A;  2KTQ A;  4FVU A;  1RDB A;  5AQG A;  3BZC A;  1RBV A;  1IG9 A;  1A5V A;  3C6T A;  4DSF A;  2I7P A;  3FFK B;  3L8B A;  1IH7 A;  4CBW A;  1C6V A;  2YHW A;  3E01 A;  5BPN A;  3ZSX A;  4DTS A;  3THW A;  1OH6 A;  5HLF A;  3RMB A;  3DLR A;  3O3F A;  2CGK A;  3AVH A;  3C6H A;  2YX6 A;  2VQF K;  4CGJ A;  4W5R A;  3CCQ N;  3CJ9 A;  4EFH A;  2DPN A;  3SBG A;  4DF8 A;  3VEN A;  2ZWH A;  3F9K A;  3MN9 A;  4B3R K;  1Q8I A;  1O13 A;  1RT6 A;  4OPA A;  4DTJ A;  1GLL O;  4RW6 A;  5F0X A;  4I6M A;  3UKR A;  1XMQ K;  3QIO A;  3MWP A;  3LM9 A;  4FLU A;  4FWR A;  1HYV A;  4XH1 A;  3OYK A;  4BC2 A;  1BQN A;  5AQM A;  1NK4 A;  3L4Q A;  1XNQ K;  3NH0 A;  3V1Q A;  3UB5 A;  4YOR A;  4CJ4 A;  3I33 A;  1CLQ A;  4YOW A;  1C0F A;  4FK0 A;  1LAW A;  5EY4 A;  3PIO L;  2B4J A;  4X66 K;  3QO9 A;  3JAM O;  1L3T A;  1RDC A;  3I56 N;  4Z94 A;  1WSE A;  1RBS A;  2D1K A;  3K58 A;  1YJ9 N;  3A5L C;  4OKJ A;  4M3R A;  2BAN A;  2XY5 A;  5I42 A;  4JK9 A;  3CME N;  4B3T K;  3OYC A;  3AVC A;  4FJJ A;  2BH1 A;  2YHA A;  3TAM A;  5A2Q O;  3VQ6 A;  4BWJ A;  3V1O A;  2KKZ A;  3C0B A;  4U67 L;  4FJI A;  1HNI A;  4DHY A;  4W5Q A;  2WC9 A;  1NLV A;  3ATU A;  4DLE A;  2ZGY A;  4JRP A;  2B5J A;  1QS4 A;  1QVF M;  3AVF A;  2Z1G A;  5AQR A;  3F9M A;  3RVC A;  5AJ3 K;  4F9O A;  3ITH A;  4LF9 K;  1RTH A;  4W5T A;  3QES A;  4OO1 J;  4J2A A;  4PY5 A;  4WQ4 A;  4M7Y A;  3QER A;  2FBT A;  1RDU A;  3IKM A;  3J7A P;  3SUO A;  4IJA A;  3O9Q A;  2XO7 A;  5C0Y A;  1FKO A;  3QBX A;  5CYM A;  3FZL A;  3VQ9 A;  1LW0 A;  2QXL A;  4FJG A;  3CXC M;  3M8P A;  1T7P A;  4DKW A;  3KKS A;  4HCC A;  3TAP A;  4JNE A;  4CJ3 A;  4JD2 B;  5ADX H;  3SZ2 A;  3LWL A;  2Q1N A;  3THW B;  5EOY A;  5EU7 A;  3E1Y A;  4BE0 A;  2HMP A;  3ZET A;  3J8A A;  4B9T A;  1A5W A;  4FJL A;  1UWB A;  4NLC A;  1I39 A;  3NH1 A;  3TTC A;  4FWO A;  4QS8 A;  4C8K A;  3D45 A;  2P5O A;  3DRS A;  3BY5 A;  1HPZ A;  4LFC K;  1QQC A;  1N34 K;  1BU6 O;  4DFK A;  3L2R A;  2HND A;  2KW4 A;  4M3W A;  4DB3 A;  2UUA K;  3TSP A;  4FPA A;  4FJ5 A;  3PUF A;  3MN5 A;  1TYQ A;  3MK6 A;  3R1X A;  3CER A;  4B9V A;  1FW6 A;  1L3V A;  4IG0 A;  3VA3 A;  3NF6 A;  3ULD A;  4KHQ A;  5JIC A;  3SMS A;  4DTO A;  3EKU A;  1J9A A;  3FZF A;  3MN7 A;  4KI4 A;  5FPD A;  4BRK A;  4FM2 A;  2QWM A;  1HRH A;  4FWN A;  3IG1 A;  3H08 A;  3QFP A;  4HWI A;  3HP9 A;  1Y97 A;  3B8A X;  3D7E O;  5K14 A;  3TAG A;  1X9M A;  2HF3 A;  1Q7Y O;  1HKB A;  4FWM A;  4FK4 A;  4BRP A;  3NDK A;  2H3G X;  1GLB G;  4ID1 A;  4AM6 A;  3D2E A;  1K9M O;  4L8R B;  3CJC A;  3HZ6 A;  3ZYY X;  1IKV A;  4JI6 K;  4CJ7 A;  3CCU N;  4O4G A;  1GLE G;  4HTL A;  4KBO A;  4QS9 A;  2OTJ N;  1M90 O;  4CEZ A;  5AFU A;  1NGC A;  2V7Z A;  3VQ4 A;  3TI0 A;  3S3O A;  2E20 A;  1NGB A;  3EZW A;  4CZE A;  4KFB A;  5HP1 A;  1BIZ A;  1SV5 A;  2GUP A;  4ZHR A;  1S72 N;  1VQ6 N;  4E7K A;  2YHX A;  4K25 A;  4B9Q A;  3O4Q A;  2UUB K;  1LV5 A;  2BGG A;  4M3Z A;  1RT4 A;  3SMP A;  4CJE A;  4BR9 A;  4M3T A;  1QSL A;  3AVJ A;  1HNX K;  5AQY A;  3JS6 A;  3PX4 A;  2O8D B;  1KTQ A;  1CXQ A;  1GLD G;  4F3T A;  3WNE A;  3LP2 A;  4X65 K;  4YHH K;  4KI6 A;  1XQS C;  1TL3 A;  3ZET B;  3KLE A;  3ULE B;  3Q7C A;  5AQL A;  5EVZ A;  5M1Q A;  3H6E A;  4F2R A;  1J5E K;  3DLH A;  4CEB A;  3VA0 A;  4A2A A;  2Q0R A;  3OW2 M;  1C0U A;  4PA1 A;  5DMR A;  1QZ5 A;  5BR8 K;  3W3D A;  3NMU A;  3DRR A;  5SZT A;  2QWN A;  4BG9 A;  4CFD A;  2ZF5 O;  4GMJ B;  1UA0 A;  1RT1 A;  3TTF A;  4G1Q A;  3J80 O;  4GY2 B;  2D4W A;  1YAG A;  3O4W A;  1X9J A;  2GUI A;  3O80 A;  4CHZ A;  2HVH A;  3SPY A;  2NRH A;  3DLG A;  3TR8 A;  4W5O A;  2HW3 A;  3HM8 A;  2FF6 A;  1ZBH A;  3THX A;  2P9I B;  1VRT A;  5CYQ A;  3NVK A;  1NGF A;  1W9H A;  2WOM A;  2W41 A;  2HHV A;  2W42 A;  2CH5 A;  3TAF A;  2KZZ A;  4FW2 A;  4H5N A;  3KIO A;  3IDH A;  4WFA L;  4JKH A;  2V51 B;  2UYT A;  2A3Z A;  4B1W B;  4HHT A;  4BR7 A;  4Y1D A;  2GEL A;  1NJI O;  2IIR A;  4RTF D;  4DG1 A;  2AA4 A;  2IVP A;  4Q0B A;  4DMN A;  3D2E B;  1CZ9 A;  3T7Z A;  1BOT O;  4DU4 A;  4K8Z A;  2QKB A;  1BO5 O;  3O1W A;  4BC3 A;  1NKE A;  4PKI A;  4CZH A;  2ZGZ A;  1U04 A;  4CZG A;  4HTU A;  4LF5 K;  5EX5 A;  4RW8 A;  2QKK A;  1YVN A;  1NG9 A;  5KI6 A;  4DSL A;  4CZJ A;  1ZBS A;  1GLJ O;  4KHU A;  4CD1 A;  3VQC A;  1BCM A;  2W40 A;  4IWV A;  4YOU A;  2YHB A;  4BRN A;  3OYJ A;  3EO3 A;  3OS1 A;  3ZEU A;  3OYN A;  1XMO K;  5H1S Q;  4CJ5 A;  3L2V A;  3DLB A;  2ASM A;  3MN6 A;  3CCJ N;  2O4G A;  3RSE B;  2XHB A;  4B3S K;  1JLG A;  2OPQ A;  1X3M A;  4DV2 K;  1NJX A;  3VQD A;  2BTF A;  4OKE A;  2EHG A;  1RTJ A;  2VG5 A;  3CPE A;  3VEW A;  4B1X B;  2P9N A;  4ISE A;  2P9L A;  3LM2 A;  1C1A A;  3MEG A;  3P4I A;  4A62 A;  1OH5 A;  4CES A;  4DV6 K;  4JKD A;  4JI5 K;  4JRQ A;  3HRG A;  2ITG A;  3AAP A;  4I2P A;  4ZTF A;  4FM1 A;  3SAF A;  5HRP A;  4FM0 A;  2EWS A;  3NCI A;  3LZJ A;  3DXM A;  1EP4 A;  1NKC A;  3THV A;  4JI0 K;  1ASU A;  1NBW A;  1ATN A;  3C94 A;  4CHP A;  3NGY A;  3DM2 A;  3SAH A;  5C42 A;  3L3V A;  1K8A O;  5BRF A;  4JAX A;  4E19 A;  2Z1H A;  4JS4 A;  3IAY A;  4ICL A;  1QTM A;  3H1Q A;  4E7H A;  3CCR N;  4KTW A;  4DQR A;  5KPT A;  2ZM6 K;  4C8L A;  3V9S A;  3NF7 A;  4MQ3 A;  1GOA A;  2W6L A;  3T1A A;  3IS9 A;  5C2D A;  5GIP A;  3GG4 A;  4I9Q A;  3TAR A;  2O8C B;  2KFN A;  2RN2 A;  3HP6 A;  1RT3 A;  2BUP A;  4KHP K;  3NAE A;  1X1P A;  4RW9 A;  4EHT A;  4KTZ A;  4J2B A;  4H4M A;  4UQG A;  3SI6 A;  1NGD A;  4O8K A;  1S9G A;  4BQZ A;  1JL1 A;  4AHR A;  3PSF A;  5LL6 Z;  4XEI A;  2DFE A;  4GV6 A;  4O0J A;  1NU0 A;  1X9W A;  4LD0 A;  4LFB K;  3VPZ A;  1D9F A;  3AA4 A;  1D4X A;  4KHS A;  3ASM A;  4BRD A;  2FSN A;  4BDY A;  4FJM A;  4E1N A;  2UXD K;  1BA0 A;  3TAE A;  1TKD A;  1V4T A;  1N8R O;  4CGG A;  2VGN A;  1RBR A;  4IOA L;  3SLC A;  2D0B A;  4CIF A;  4M42 A;  2QW9 A;  3HYF A;  1JLF A;  1SS6 A;  4NLB A;  3AVM A;  1L5U A;  3SUN A;  3G4S N;  3FZK A;  5C10 A;  4K43 A;  2ZJP L;  1YIJ N;  2G8U A;  3K9J A;  5DM6 L;  3A5O C;  1ZBU A;  4DSJ A;  3HTV A;  3VMF B;  3NGI A;  3IMX A;  5FRO A;  4FOE A;  4JK7 A;  2G8H A;  1HNV A;  1XC9 A;  4JI7 K;  2P9L B;  4ILG B;  1WSF A;  3FLC O;  1BL3 A;  3PIP L;  1NMN A;  1HQE A;  1XWL A;  4I2Q A;  3OBW A;  4WFB L;  3PX6 A;  4CJV A;  3AO2 A;  1ZXO A;  3SUQ A;  1UOC A;  1IBK K;  1XUP O;  3I0R A;  1GOB A;  1FKP A;  1XC3 A;  4BRG A;  1NMD A;  3ATV A;  4Z4G A;  4H0O A;  1VQN N;  4DFP A;  4N76 A;  1CXU A;  1J54 A;  1S6P A;  3QML A;  4CF2 A;  5TKW A;  2GV9 A;  4GV9 A;  2Y1I A;  1RTI A;  3CQY A;  4DTM A;  2Q3S A;  1RFQ A;  4XIU A;  4KB0 A;  5AZJ A;  2QWR A;  4C1N K;  2VWB A;  4Y1C A;  3KK3 A;  4QCL A;  4YDU A;  3CCE N;  4Z4H A;  4JK8 A;  3BGR A;  3OYI A;  3ISN C;  3SJH A;  4Q5V A;  3K59 A;  3AY9 A;  3F73 A;  1YTU A;  3MEE A;  1YHQ N;  4CEA A;  4DQ8 A;  3VQ7 A;  3ZSO A;  4EIA A;  1NWK A;  2FF3 B;  5C25 A;  2Y1J A;  3U4L A;  1NGG A;  5AQK A;  5D3G A;  4YDU C;  3AGK A;  1YXQ A;  4YOX A;  5FRN A;  4FWP A;  2Q2R A;  3AVA A;  3HSC A;  5GAG P;  2V52 B;  2Q0U A;  4DR5 K;  3HPG A;  3VQ8 A;  3S3M A;  3WQT A;  4DUY K;  4LFA K;  2HST A;  2UXC K;  2VQE K;  4BRL A;  1IV0 A;  4BR4 A;  4B8C A;  4H8K A;  2FXU A;  3LL3 A;  3WNF A;  1ZBI A;  4DV1 K;  5CE3 A;  2FBX A;  1P8Z A;  3MXI A;  4EAH D;  1S1U A;  1TL1 A;  3CJB A;  1FK9 A;  4WF9 L;  4CZK A;  4O44 A;  4CCH A;  3LPU A;  4HCB A;  2PAV A;  2KLA A;  5C15 A;  1TUU A;  1JCG A;  2PY5 A;  3P39 A;  3SBT A;  2QEX N;  2HHX A;  2O8F A;  4NCA A;  1C1C A;  1S1T A;  1HKG A;  1VQO N;  4JI2 K;  4BQL A;  3V9Z A;  2OPP A;  3MMV A;  3CCM N;  4M63 C;  3U6F A;  3K57 A;  1KVC A;  5J2N A;  3OA9 A;  1MDU B;  3VQQ A;  2QWO A;  3V9X A;  1IBM K;  1KSP A;  4OX9 K;  1WUA A;  1T05 A;  3RTV A;  3B6O A;  1S1W A;  1VSF A;  1ESV A;  3O8M A;  3O08 A;  3DOL A;  4DQI A;  4LY7 A;  1VSL A;  1EXQ A;  1HQU A;  2A6A A;  3VF2 A;  4BR5 A;  2F9W A;  3H45 C;  4KH4 A;  2P9K B;  1NKB A;  1SUQ A;  3A8Y A;  5JVH L;  4BE1 A;  1HNW K;  3I8D A;  3M6G A;  4BC5 A;  1L3S A;  1U2V B;  2X78 A;  4BVP A;  4CEE A;  3B6P A;  5KRS A;  3KLI A;  2IVN A;  3O3H A;  3OYB A;  4ELV A;  1TKT A;  5M1N A;  3LDS A;  1MU2 A;  4YNQ A;  5DM7 L;  4CJP A;  1VHX A;  1W7A A;  4CEC A;  1Q82 O;  1NOZ A;  2NRV A;  3HBT A;  1GLA G;  4FJX A;  4DQP A;  4YY3 K;  4JKA A;  3Q7B A;  1SKR A;  3PO5 A;  1VSJ A;  4ZTJ A;  3FGU A;  2E1Z A;  2P9U B;  2A41 A;  4FOI A;  4M3U A;  2VG6 A;  3K5M A;  1VQ4 N;  2HVI A;  3THY A;  3K5L A;  4FZY A;  2GWK A;  1REV A;  1JLB A;  2NLX A;  1BQM A;  3O9R A;  4CEQ A;  1C0T A;  2FBY A;  1E4F T;  5TKY A;  4YOV A;  1S1V A;  1NJY A;  4DQS A;  4E3S A;  4AHS A;  4B1Y B;  2HHH K;  3D2F A;  3FR0 A;  2D0A A;  3L4I A;  4PKH A;  3QEX A;  3VET A;  3BDP A;  4AHC A;  1D9D A;  3HL8 A;  2XRI A;  3AO3 A;  4B1V A;  2IGI A;  2FLO A;  1NGI A;  4DTN A;  4AIL C;  3NF9 A;  4WCE L;  3AVL A;  3C65 A;  4EZ9 A;  5KQ8 A;  2O8B A;  1HJR A;  1TUY A;  2GTD A;  4FWS A;  1ATS A;  3ZSY A;  1FXX A;  4I6M B;  1JLQ A;  3UKR B;  3ZX3 A;  1NK6 A;  1WBD A;  3CF5 L;  3QEP A;  3RRG A;  1WAJ A;  2E5L K;  4FJK A;  2HBL A;  1UAX A;  1LWF A;  4B9N A;  1RIL A;  3EY1 A;  4FLW A;  2JLE A;  2PFU A;  5GAD P;  3LWM A;  3M8R A;  3F2K A;  3MCP A;  3AVN A;  5E26 A;  1KLM A;  2KHO A;  3ZT4 A;  3CJ7 A;  1T44 A;  3LAM A;  2D0O A;  4JKB A;  3OS0 A;  4FJ8 A;  2F96 A;  1BIS A;  4DS4 A;  3FZM A;  4HVJ A;  4MLH A;  3ZT2 A;  1T6C A;  2ATQ A;  4F2S A;  3OYG A;  1VQL N;  5EXW A;  2GBZ A;  1IKX A;  4YOY A;  1BUP A;  4X62 K;  4QS7 A;  2GX9 A;  4MO4 A;  4PHT X;  4EHU A;  3CFP A;  1RCH A;  1EX4 A;  4AHU A;  3OY9 A;  3SV4 A;  4BVO A;  1KFS A;  3MED A;  4KPY A;  4DLG A;  3RWU A;  4O8U A;  3QIC A;  1VRU A;  3O6W A;  5FPM A;  5AFU H;  1JL2 A;  5KPZ A;  4FZX C;  3CQX A;  1B92 A;  3OHR A;  3RRH A;  2RHK A;  3SQ2 A;  3WNH A;  4KB1 A;  1EWQ A;  4JI3 K;  3LAN A;  1IBL K;  1ASW A;  3LDL A;  1MWM A;  4KKO A;  4BWM A;  4M45 A;  1W2B M;  4CD3 A;  2WBN A;  1DEJ A;  5CZ2 A;  2QTD A;  4RW4 A;  2XY8 A;  3OYM A;  2OAN A;  1RGI A;  4A61 A;  3OJS A;  4BRF A;  3AA3 A;  3VEX A;  5LY3 A;  3SAG A;  4MFB A;  4H0P A;  1J6Z A;  1EET A;  1U48 A;  1NK0 A;  4CZF A;  4B9U A;  4WQ5 A;  3QEV A;  3KLH A;  4FLT A;  5SWM A;  3T3F A;  4KTQ A;  3WXL A;  4M3Y A;  4DTP A;  5C12 A;  4M7X A;  1KAY A;  2W6K A;  3LAL A;  4YOT A;  2HHQ A;  1SQK A;  2YKN A;  3R6M A;  1YIT N;  4B9L A;  1DTQ A;  1S3X A;  3O3G A;  3LDP A;  1WSG A;  3D2F B;  4WQ5 C;  3ZX0 A;  4YFU A;  1SZ2 A;  4FVM A;  5M1O A;  1Y64 A;  4CBU A;  3WXK A;  3QNO A;  5AQU A;  2O8B B;  4BGA A;  1ZBL A;  5AQZ A;  1X3N A;  4CZM A;  4CHN A;  5AQV A;  3PSI A;  3NF8 A;  1HYZ A;  2A42 A;  5J2P A;  3SCX A;  4MLE A;  3H3O B;  1YVU A;  3VTI A;  1OH7 A;  2QWP A;  1HMV A;  3LAK A;  1LWC A;  2F8S A;  1JCE A;  1KRP A;  4FXD A;  4H0Y B;  2PYJ A;  3CI5 A;  4IOX A;  1TYQ B;  4OGE A;  2YNH A;  3QDK A;  1VQ8 N;  4BG8 A;  2OZS A;  2QWL A;  5CY4 A;  4G9Z A;  3VTH A;  1A5X A;  3GDQ A;  2DTU A;  1HLU A;  3KK7 A;  3WXM B;  3O9U A;  4CK1 A;  1QHT A;  2ETJ A;  3M8S A;  4KRE A;  2X6S A;  4BRA A;  2FC0 A;  3AVK A;  1Q18 A;  2FBV A;  5AQQ A;  1WSH A;  4BRI A;  1TKZ A;  1VSD A;  2WFB A;  3LP1 A;  1LW2 A;  3TAB A;  4WE1 A;  4CED A;  1I3A A;  4AM7 A;  3CJA A;  4FLX A;  4NCG A;  4E0D A;  1Z05 A;  4NO7 A;  1BIU A;  5JS2 A;  5KGW A;  5BPL A;  4OLA A;  1X9S A;  3A2F A;  1KFD A;  1QQM A;  1NGH A;  5FLX O;  1TGO A;  4IKF A;  3P31 A;  3S41 A;  1GOC A;  3OYF A;  2UU9 K;  1U45 A;  1KLN A;  1C1B A;  2HBJ A;  5AQS A;  3MCA B;  1GLC G;  1L3U A;  3NHG A;  3ZT0 A;  3C7N A;  3VF4 A;  3DXK A;  1IKW A;  1TAQ A;  4CFB A;  4MDA A;  3AO4 A;  1ASV A;  3MEC A;  4N47 A;  3T69 A;  1U49 A;  2J4R A;  1O1W A;  1VAZ A;  3DI6 A;  3ZCM A;  3V4I A;  5JS1 A;  4NYF A;  3C6U A;  2G8W A;  4M3X A;  3J7Z O;  3VGK A;  3DJC A;  2E2Q A;  2UXB K;  4DSK A;  2YJF A;  2CGJ A;  3VOV A;  3CCL N;  1QSS A;  4KHW A;  4IXC A;  2IS3 A;  2FSK A;  4WFN L;  4Y0W A;  1OVY A;  3TTD A;  4CBX A;  1C0G A;  3D6R A;  4X64 K;  3SNN A;  1Z6R A;  3FZH A;  3CC4 N;  2E2P A;  4IDH A;  4DV7 K;  4CEF A;  4CIE A;  3H3N O;  2O8E A;  4CF8 A;  1GLF O;  2ASO A;  2E6M A;  3KK2 A;  2YI1 A;  2OPS A;  3ID8 A;  3LDO A;  1KC8 O;  3CQ8 A;  3VQB A;  3QB0 A;  1E4G T;  2WTU A;  4ISF A;  5E84 A;  2XY7 A;  1JJ2 M;  4E1M A;  5AQI A;  4PWD A;  4IFY A;  2KFZ A;  4AH9 A;  1HPM A;  3EE9 A;  2HNY A;  4C1N I;  3L2Q A;  3WNG A;  3JSM A;  4CER A;  1VQK N;  1Q9X A;  3NGZ A;  1VQ7 N;  5FRM A;  3MAQ A;  2YJE A;  1BA1 A;  1C0M A;  3AGR A;  3L0Q A;  1K8K A;  3OYD A;  1F21 A;  4WYB A;  2WON A;  3TSQ A;  3QBW A; 
#chains in the Genus database with same CATH homology
 5C25 A;  3AV9 A;  2P5G A;  1YTA A;  4CJT A;  5D3G A;  5EU7 A;  2E4L A;  4IG3 A;  4BE0 A;  4NCB A;  1U4B A;  5FRN A;  3AVA A;  4CHQ A;  1CZB A;  4N56 A;  4B9T A;  4FZZ A;  2IAJ A;  3OJU A;  1A5W A;  4GW6 A;  4FJL A;  1UWB A;  3NH1 A;  1I39 A;  4KAZ A;  3HPG A;  3VQ8 A;  2BDP A;  3S3M A;  4C8K A;  3D0P A;  3D45 A;  4Z4I A;  2P5O A;  3DRS A;  4CJW A;  1HPZ A;  3V1R A;  4FW1 A;  4JLH A;  4B8C A;  3S9H A;  1QQC A;  4H8K A;  3DYA A;  1KVA A;  4E89 A;  2DFH A;  4FLV A;  4ELU A;  4IDK A;  2OZM A;  4DFK A;  3L2R A;  2HND A;  2KW4 A;  3WNF A;  3DLE A;  4M3W A;  1R0A A;  1ZBI A;  4OKK A;  2FBX A;  3HPH A;  4CGF A;  3MXI A;  2VWJ A;  1Z26 A;  1NK7 A;  1JLE A;  4FJ5 A;  1JXB A;  1S1U A;  1TL1 A;  3PUF A;  3OVN A;  1FK9 A;  3PV8 A;  3UIQ A;  4O44 A;  4CCH A;  3LPU A;  3V81 A;  5HRR A;  4HCB A;  3L3U A;  3SJJ A;  3VQ5 A;  3MXM A;  4B9V A;  4K8X A;  2PY5 A;  4PQU A;  1L3V A;  4IG0 A;  2HHX A;  3V6D A;  4NCA A;  3VA3 A;  1C1C A;  3CG7 A;  1Z25 A;  1S1T A;  3NF6 A;  3ULD A;  4E7J A;  3L2W A;  1NOY A;  4KHQ A;  4CJS A;  3V9Z A;  4DTO A;  2YNG A;  2OPP A;  1NK5 A;  4I9L A;  3U6F A;  4Z4F A;  3K57 A;  1J9A A;  4OGC A;  1KVC A;  5J2N A;  3NFA A;  1SL0 A;  1JLA A;  3VQQ A;  2E6L A;  3V9X A;  1KSP A;  4KI4 A;  3QET A;  1T05 A;  4J2D A;  4FM2 A;  3HJF A;  3RTV A;  1HRH A;  3B6O A;  3ZSQ A;  1U47 A;  2RPI A;  1S1W A;  4LH4 A;  3IG1 A;  4F4K A;  1VSF A;  3LP3 A;  3H08 A;  4EP5 A;  2BE2 A;  3DOL A;  4DQI A;  4LY7 A;  1VSL A;  4DQQ A;  1J53 A;  1EXQ A;  3HP9 A;  1HQU A;  3HXM A;  4DFJ A;  1Y97 A;  4KRF A;  2YNF A;  3OS2 A;  2A1R A;  5K14 A;  4JS5 A;  2Z1I A;  3TAG A;  1X9M A;  1TKX A;  1NKB A;  2D0C A;  1SUQ A;  4FK4 A;  3JYT A;  4BE1 A;  1TK8 A;  4NYN A;  1RDA A;  3L2U A;  3NDK A;  3I8D A;  4H4O A;  3CFO A;  1TVR A;  4ID1 A;  3HM9 A;  1L3S A;  4CHY A;  3K2P A;  4L8R B;  2X78 A;  4CEE A;  2RKI A;  4CJR A;  4OPK A;  3B6P A;  1IKV A;  5KRS A;  3KLI A;  4FJ9 A;  3MXJ A;  4O4G A;  3O3H A;  3OYB A;  4ELV A;  1TKT A;  4EP4 A;  4N41 A;  4CEZ A;  3LDS A;  3DMJ A;  4DU3 A;  5J2Q A;  1NK9 A;  4CFA A;  3VQ4 A;  3TI0 A;  4B3O A;  3M8Q A;  1MU2 A;  3LZI A;  4YNQ A;  3S3O A;  1NJW A;  1BI4 B;  3ZSR A;  4KFB A;  4CJP A;  5HP1 A;  1BIZ A;  1SV5 A;  4DTU A;  3AVB A;  1J5O A;  1RT7 A;  4CEC A;  1NOZ A;  4ZHR A;  1WNS A;  2ZE2 A;  4Z0U A;  4FCY A;  4E7K A;  3ZSZ A;  4HUE A;  3SQ4 A;  4FJN A;  3KLF A;  4F8R A;  4FJX A;  4CF9 A;  4DQP A;  2O4I A;  3O4Q A;  1SKR A;  1LV5 A;  1WSI A;  3OYA A;  4CE9 A;  1VSJ A;  4ZTJ A;  2PYL A;  3PO5 A;  3KD5 E;  2BGG A;  4M3Z A;  5FDL A;  1RT4 A;  4CJE A;  3CFR A;  3U3G A;  3CM5 A;  4M3U A;  4M3T A;  1QSL A;  2VG6 A;  2X6N A;  4CF0 A;  2OPR A;  4CK3 A;  5DK5 A;  3K5M A;  3TWH A;  3AVJ A;  3AVG A;  5I3U A;  3HVR A;  2HVI A;  3K5L A;  4DWI A;  3AO1 A;  3HST B;  3PX4 A;  4FZY A;  1KTQ A;  1CXQ A;  1XI1 A;  1IO2 A;  4F3T A;  2YKM A;  2IC3 A;  1REV A;  1KVB A;  3WNE A;  3LP2 A;  1JLB A;  1JKH A;  4R5P A;  4KI6 A;  1BQM A;  4CEQ A;  4CJK A;  3U3Y A;  1C0T A;  2FBY A;  3I0S A;  1TL3 A;  3KLE A;  2NUB A;  2YNI A;  3KTQ A;  3EYZ A;  3DLK A;  1S1V A;  4CJF A;  1NJY A;  4DQS A;  3S3N A;  4QOZ B;  4DS5 A;  4F2R A;  4E3S A;  2X74 A;  4AHS A;  4CGH A;  3DLH A;  4DF4 A;  2D0A A;  3VQP A;  3QEX A;  4CEB A;  3BDP A;  4OLB A;  4AHC A;  3NH2 A;  3NBP A;  1D9D A;  4LSL A;  3EZ5 A;  3HL8 A;  3VA0 A;  2XRI A;  3ZT3 A;  3AO3 A;  4PUO A;  2F8T A;  2IGI A;  1JLC A;  4DTN A;  1C0U A;  4PA1 A;  3NF9 A;  5DMR A;  4AIL C;  3LPT A;  3RMC A;  1SL2 A;  3AVL A;  4EZ9 A;  4FJH A;  3ZSV A;  3PY8 A;  3DRR A;  4QAG A;  5SZT A;  4M41 A;  1KCF A;  1HJR A;  4CFD A;  3QEW A;  3HVT A;  4GMJ B;  4C8N A;  4HUF A;  1RT1 A;  3T19 A;  1UA0 A;  3ZSY A;  1FXX A;  4G1Q A;  1JLQ A;  1NK6 A;  4ELT A;  2HNZ A;  3QEP A;  3RRG A;  1WAJ A;  2B6A A;  4RW7 A;  2AJQ A;  4CF1 A;  4FJK A;  5J1E A;  3KD1 E;  1UAX A;  2GUI A;  1LWF A;  3IRX A;  4B9N A;  1RIL A;  4CHZ A;  2HVH A;  1D8Y A;  1VSI A;  3EY1 A;  3ALY A;  4FLW A;  3SPY A;  3FFI A;  3DLG A;  3QLH A;  2JLE A;  4O0I A;  3TR8 A;  4N5S A;  4W5O A;  3SUP A;  2HW3 A;  3LWM A;  3M8R A;  4HUG A;  1XHX A;  3AVN A;  1KLM A;  3ZT4 A;  3AA2 A;  1ZBH A;  2QXF A;  3HPO A;  3LAM A;  1VRT A;  3OS0 A;  4FJ8 A;  2F96 A;  4LH5 A;  5CYQ A;  1S5J A;  2OYQ A;  1W9H A;  2WOM A;  2HHW A;  1BIS A;  4DS4 A;  4HVJ A;  2HHV A;  2W42 A;  1QE1 A;  4FLZ A;  3ZT2 A;  3QNN A;  2VG7 A;  4FLY A;  2ATQ A;  3TAF A;  2KZZ A;  3HT3 A;  3SYZ A;  4GVM A;  4FW2 A;  3TAQ A;  4F2S A;  3KIO A;  3OYG A;  2HHT A;  4LSN A;  2GBZ A;  1IKX A;  1SKW A;  1B9D A;  3K5N A;  1ITG A;  4HHT A;  3CFP A;  4Y1D A;  5KTQ A;  2HHS A;  2LSN A;  2EX3 A;  1RCH A;  4IFV A;  1EX4 A;  1G15 A;  4AHU A;  3OY9 A;  3SV4 A;  4DG1 A;  1KFS A;  3MED A;  1VSM A;  5C24 A;  4KPY A;  4Q0B A;  4DLG A;  4DMN A;  1WLJ A;  3RWU A;  1CZ9 A;  2Z1J A;  4W5N A;  4KO0 A;  3G10 A;  1VRU A;  4DU4 A;  1JL2 A;  4K8Z A;  1LWE A;  4FZX C;  2QKB A;  1B92 A;  1IKY A;  4AHT A;  1NKE A;  3RRH A;  3SQ2 A;  4FJ7 A;  1U04 A;  3WNH A;  4KB1 A;  3O4N A;  4HTU A;  4DTX A;  4B9M A;  3LAN A;  3ZSW A;  1ASW A;  3CM6 A;  4RW8 A;  2QKK A;  5E41 A;  4CHO A;  4KKO A;  4BWM A;  5KI6 A;  1EKE A;  3KLG A;  1BHL A;  4M45 A;  1VSH A;  2G8V A;  2D5R A;  4DSL A;  4KHU A;  3VQC A;  1BCM A;  1RT2 A;  1S1X A;  2YHB A;  4CGD A;  4CGI A;  3OYJ A;  3QIP A;  4J2E A;  5CZ2 A;  4OJR A;  4DU1 A;  1QSY A;  4OVL A;  4RW4 A;  3OS1 A;  3OYH A;  3OYN A;  4Z4C A;  4KHY A;  2XY8 A;  2IDO A;  3OYM A;  4F3O A;  3QEI A;  2G8K A;  4CJL A;  4CJ5 A;  3OJS A;  3L2V A;  3DLB A;  3AA3 A;  5T7B A;  2IOC A;  1ZBF A;  4MFB A;  4DFM A;  2O4G A;  5HRN A;  2XHB A;  1SKS A;  1VSE A;  1EET A;  1JLG A;  2OPQ A;  3KJV A;  1U48 A;  3ZT1 A;  1SL1 A;  1NK0 A;  1NJX A;  1S9E A;  2JGU A;  3C95 A;  4OKE A;  3VQD A;  2HMI A;  4B9U A;  2EHG A;  1RTJ A;  2VG5 A;  3KLH A;  3QEV A;  3V9W A;  1N5Y A;  4FLT A;  5SWM A;  4B8A B;  2HB5 A;  3P83 D;  1C1A A;  3MEG A;  3T3F A;  4KTQ A;  4CES A;  4JRQ A;  2ITG A;  4I2P A;  4ZTF A;  4KV8 A;  5KRT A;  4EZ6 A;  4DTP A;  4M3Y A;  4O55 A;  4FM1 A;  1T8E A;  2P1J A;  2OA8 A;  3LAL A;  5HRP A;  4FM0 A;  2HHQ A;  2YKN A;  4CJU A;  3NCI A;  1BGX T;  1RNH A;  3LZJ A;  4Z4E A;  1EP4 A;  1NKC A;  1WSJ A;  4CFC A;  4B9L A;  1DTQ A;  3DRP A;  1RT5 A;  3G0Z A;  3O3G A;  3THV A;  1N6Q A;  1WSG A;  4I7F A;  1ASU A;  4C8M A;  2QK9 A;  3C94 A;  4YFU A;  1NK8 A;  4CHP A;  1K6Y A;  4RG8 A;  1TAU A;  3NGY A;  1JXE A;  1TV6 A;  3DM2 A;  1RBU A;  2P51 A;  3NE6 A;  3SV3 A;  4BDP A;  3DOK A;  4FVM A;  4IBN A;  5C42 A;  1ZYQ A;  1DLO A;  1RBT A;  3L3V A;  3QNO A;  4E19 A;  2G8F A;  2Z1H A;  4JS4 A;  3IAY A;  4ICL A;  4DSE A;  1ZBL A;  4CHN A;  1QTM A;  2KZM A;  4O5B A;  3NF8 A;  2A1S A;  5KGX A;  1HYZ A;  4E7H A;  5J2P A;  2KTQ A;  3K5O A;  3PX0 A;  4KTW A;  4DQR A;  3SCX A;  1XHZ A;  1RDB A;  2DFF A;  1YVU A;  1IG9 A;  1RBV A;  1HMV A;  3LAK A;  4C8L A;  1LWC A;  1B9F A;  3NF7 A;  4MQ3 A;  1A5V A;  3V9S A;  3C6T A;  3VQA A;  1KRP A;  4BE2 A;  2F8S A;  4FXD A;  4DSF A;  1T03 A;  2PYJ A;  1BCO A;  1GOA A;  2YNH A;  4OGE A;  1IH7 A;  1VK0 A;  3L8B A;  3T1A A;  1C6V A;  2RF2 A;  3IS9 A;  4CJQ A;  4I9Q A;  3TAR A;  3E01 A;  3ZSO A;  2OZS A;  2KFN A;  3ZSX A;  2KQ2 A;  2RN2 A;  4CIG A;  3HP6 A;  4DTS A;  5CY4 A;  1RT3 A;  1A5X A;  3CYM A;  5HLF A;  2DTU A;  3RMB A;  3NAE A;  5HBM A;  1X1P A;  3DLR A;  4RW9 A;  4CK1 A;  3O3F A;  3AVH A;  1QHT A;  2ETJ A;  4KTZ A;  3M8S A;  4KRE A;  4CGJ A;  4J2B A;  2X6S A;  4W5R A;  2R7Y A;  2FC0 A;  4H4M A;  4DF8 A;  3AVK A;  4UQG A;  3SI6 A;  4B9S A;  2FBV A;  3F9K A;  1WSH A;  2G8I A;  4E7I A;  1Q8I A;  1S9G A;  1RT6 A;  1JL1 A;  4AHR A;  3SPZ A;  1TKZ A;  4DTJ A;  2DFE A;  4RW6 A;  1VSD A;  3LP1 A;  4O0J A;  3PO4 A;  1LW2 A;  3TAB A;  1X9W A;  4LD0 A;  2HHU A;  1D9F A;  4WE1 A;  3QIO A;  4CED A;  1I3A A;  3AA4 A;  3KK1 A;  4FLX A;  4NCG A;  4FLU A;  3SQ1 A;  3ASM A;  1HYV A;  4KHS A;  3OYL A;  4E0D A;  4BDY A;  3OYK A;  1BIU A;  5JS2 A;  5KGW A;  1NJZ A;  4E1N A;  4CK2 A;  4FJM A;  4KHN A;  4OLA A;  1X9S A;  1BQN A;  3TAE A;  3A2F A;  1KFD A;  3P1G A;  1TKD A;  1NK4 A;  4DSI A;  4CGG A;  3NH0 A;  3V1Q A;  1HYS A;  3AVI A;  1TGO A;  2YV0 X;  3KKR A;  4IKF A;  4TSX A;  4CJ4 A;  2PZS A;  1GOC A;  1CLQ A;  3OYF A;  1RBR A;  2DY4 A;  4FK0 A;  1D5A A;  1LAW A;  1U45 A;  4FYD A;  1KLN A;  2XY6 A;  1C1B A;  1WN7 A;  3LP0 A;  2D0B A;  4CIF A;  4M42 A;  3OYE A;  2B4J A;  3HYF A;  1JLF A;  3QO9 A;  3RR8 A;  1L3U A;  3NHG A;  3ZT0 A;  3AVM A;  5J2M A;  1L3T A;  1L5U A;  5HRS A;  1RDC A;  3SUN A;  1IKW A;  1TAQ A;  1WSE A;  1RBS A;  4CFB A;  3AO4 A;  1ASV A;  3MEC A;  3K58 A;  4N47 A;  1U49 A;  4OKJ A;  4M3R A;  1TK0 A;  2G8U A;  1O1W A;  2BAN A;  2XY5 A;  5I42 A;  1ZBU A;  4DSJ A;  3DI6 A;  3ZCM A;  1W0H A;  3V4I A;  5JS1 A;  3VQE A;  4NYF A;  3AVC A;  3C6U A;  3OYC A;  2YHA A;  3NGI A;  3TAM A;  2VWK A;  2G8W A;  4FJJ A;  4M3X A;  1UA1 A;  5FRO A;  1RDD A;  3VQ6 A;  2G8H A;  3RR7 A;  4BWJ A;  1HNV A;  3V1O A;  1XC9 A;  4DSK A;  1WSF A;  1BL3 A;  1HQE A;  4E7L A;  4FJI A;  1HNI A;  1TK5 A;  3HK2 A;  1XWL A;  4I2Q A;  3VN5 A;  4AHV A;  1QSS A;  4W5Q A;  3PX6 A;  3AO5 A;  4KHW A;  4CJV A;  3AO2 A;  4B08 A;  2IS3 A;  3SUQ A;  4DLE A;  4BDZ A;  4JRP A;  1UOC A;  3RMD A;  2B5J A;  1QS4 A;  3HO1 A;  3AVF A;  3I0R A;  1GOB A;  2Z1G A;  2I5J A;  1Q9Y A;  1FKP A;  3SNN A;  4DTR A;  3ITH A;  1RTH A;  4Z4G A;  4W5T A;  2ZQB A;  3QES A;  4DFP A;  4J2A A;  4CEF A;  1LAV A;  4PY5 A;  4CIE A;  3LWL A;  4N76 A;  1CXU A;  4CF8 A;  3QER A;  1J54 A;  1S6P A;  4CF2 A;  2FBT A;  2E6M A;  3KK2 A;  1BI4 A;  2GV9 A;  2OPS A;  3P5J A;  2Y1I A;  3CQ8 A;  1RTI A;  1VSK A;  3VQB A;  3SUO A;  4DTM A;  2XY7 A;  4PWD A;  4E1M A;  2Q3S A;  4IFY A;  4XIU A;  2XO7 A;  4AH9 A;  1S6Q A;  4OPJ A;  3TAN A;  1FKO A;  2HNY A;  4KB0 A;  2KFZ A;  3L2Q A;  4Y1C A;  3AA5 X;  3WNG A;  3KK3 A;  3JSM A;  3QIN A;  4CER A;  4QCL A;  5CYM A;  1DTT A;  4Z4H A;  1Q9X A;  3VQ9 A;  3BGR A;  1LW0 A;  3OYI A;  3ISN C;  1RTD A;  1YT3 A;  3NGZ A;  5FRM A;  3MAQ A;  5CZ1 A;  4BAC A;  4ID5 A;  4FJG A;  4Q5V A;  3K59 A;  5HRO A;  4C8O A;  1C0M A;  3SQ0 A;  3M8P A;  1T7P A;  2ZD1 A;  3KKS A;  4CEO A;  3F73 A;  3V9U A;  3TAP A;  4HCC A;  4FK2 A;  1YTU A;  3MEE A;  3OYD A;  4CJ3 A;  1F21 A;  3SZ2 A;  4CEA A;  2WON A;  1WAF A;  3VQ7 A;  3RMA A;  2Y1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...