3ZSRA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsrA00
5KI6A 3DOKA 4GW6A 2F8SA 2ITGA 4I2PA 3OS1A 2HHXA 1I39A 4C8MA 3RMCA 4B08A 1XC9A 3M8RA 1S1TA 3LAMA 1BHLA 4CJEA 3LAKA 4CEDA 3PX4A 1RBRA 1SL1A 2G8KA 3V4IA 4I9QA 3VQEA 4CJWA 1KFDA 3OYMA 1X9WA 4RW6A 1HNVA 4DSFA 4DSKA 4FJJA 4IG0A 3SZ2A 5J1EA 1HQEA 2QXFA 1NJZA 1BI4A 4PUOA 4KB1A 3O3FA 3SCXA 1ASVA 1S1WA 3OJSA 5J2NA 4N76A 3MXMA 1GOCA 1L5UA 3VQ5A 1RDBA 2DFEA 3L2UA 1RBUA 3OY9A 3DOLA 3HVRA 3IAYA 3O4NA 1WLJA 2W42A 3DRRA 2P1JA 3AVHA 1TKTA 4OPKA 4CFBA 2FBXA 3L3VA 3QEXA 1TK8A 1RBVA 5HBMA 1BL3A 3HVTA 3ZT4A 1NK5A 1EKEA 3C6TA 4OJRA 4DWIA 5J2MA 3DM2A 1TK0A 3NCIA 3U6FA 1BCMA 4OKJA 3QETA 1LAWA 3U3GA 3KJVA 4OPJA 4KHSA 4H4MA 4F2RA 4UQGA 4KPYA 4NCGA 4AH9A 4J2EA 3RMAA 3NH0A 3RR7A 1F21A 4FYDA 1QSSA 4FW2A 3OYHA 3OYCA 2ZD1A 3DLRA 1A5VA 4MFBA 4CJKA 1NOYA 4KAZA 4B9NA 3HPHA 4I7FA 1XI1A 3HM9A 4M3YA 5HP1A 3MEDA 4CF0A 1Q9XA 5JS1A 3LWLA 4IBNA 4KHUA 2IAJA 3WNGA 1RTIA 2HNDA 4FJKA 3NAEA 2HHQA 4CK3A 3OYDA 3KK1A 3L2QA 4KI4A 4DFKA 3NGIA 4E0DA 1KVBA 2F8TA 3QERA 3CM6A 3CFRA 3SI6A 1RTJA 4M45A 1B9FA 4BDZA 4LH4A 3QNOA 1NK9A 1Q8IA 3RWUA 1HJRA 1W9HA 4E1NA 2XRIA 3DLKA 1ITGA 4KHWA 1BIZA 2VG6A 3VQPA 3OYLA 1RDCA 3VA3A 4CEOA 3TR8A 2VG5A 3RTVA 1WSIA 2P51A 1EETA 5K14A 4JRQA 1S1UA 3OYBA 4MQ3A 2EHGA 3KLEA 1NJWA 4DTMA 1BCOA 3TABA 2NUBA 3DRSA 4OKKA 3O3GA 4Z0UA 4I9LA 4CIEA 4CJUA 1IG9A 5D3GA 4AHTA 1JXBA 1FKPA 3RRHA 3I0RA 3F73A 3QNNA 1WSHA 4JS5A 4LD0A 5DMRA 1NKEA 4CHNA 2IS3A 3K57A 5FRNA 1BGXT 3EY1A 1KVAA 4CFCA 2OPRA 1X9SA 3VN5A 2FBVA 4FXDA 4RW7A 4CHZA 3OYJA 1SKRA 1WSFA 5J2PA 2HHSA 1L3VA 4B9UA 1ZBLA 1IKYA 2Z1JA 3S3NA 4IFVA 2VWKA 1CZ9A 2FC0A 2X6SA 4DQSA 4CEAA 1BQNA 3SQ4A 1U4BA 1RDDA 3AVCA 4M42A 1JLCA 1TVRA 1SL0A 3NH2A 2OPSA 1TKDA 4M3ZA 1ZBHA 1NK6A 3MAQA 3NFAA 2E6MA 1Q9YA 3MECA 1S9GA 3QIPA 4BDYA 4PY5A 1QE1A 3CFOA 1D9DA 4CESA 2IC3A 3ASMA 2XY5A 4W5NA 4E7HA 3V6DA 3QINA 1LW0A 1TKXA 2FBTA 4CHYA 4DF8A 5CZ1A 3AO1A 3K5MA 3MXIA 3AO2A 4KV8A 3V9WA 4F2SA 4B9SA 4OLBA 4HVJA 5J2QA 3HYFA 3VQDA 2X78A 3SQ1A 3NF9A 2F96A 3KKRA 4EZ9A 1CXQA 1RT7A 3K5NA 4OKEA 3T3FA 3VQ4A 3QEIA 3SUNA 1JL1A 4FLYA 4DFMA 4C8NA 4FJ7A 4XIUA 4LSNA 2YKMA 1QS4A 3S3OA 1L3UA 2DFFA 4KFBA 4FJ5A 4DSEA 1SKSA 3AVIA 3LP0A 1TL1A 3V1QA 2HB5A 3MEGA 4YNQA 4AHVA 2XY6A 1N6QA 3OYEA 2IOCA 3QO9A 4H8KA 4CGGA 3L2WA 3ITHA 1VSJA 3OVNA 3EZ5A 3TANA 4CIFA 5I42A 3QEWA 4C8LA 3C94A 1IKVA 5FDLA 1TAQA 1U47A 3SPYA 4R5PA 4O0JA 2HHWA 4CGHA 4DTUA 2BDPA 4CF8A 2PZSA 2KW4A 1ASUA 2O4GA 5CY4A 1FXXA 5SWMA 4FK0A 2JLEA 4L8RB 3V9ZA 5KGWA 2D0BA 1RT1A 3WNEA 4FZXC 1S9EA 4CEZA 1L3SA 4BWJA 1RT3A 4RW9A 3LDSA 3SV4A 4F3TA 3VQ8A 1QTMA 4CJFA 1S1XA 3AA3A 4AHSA 2B4JA 1NK7A 1UA0A 1VSFA 1KLMA 3SQ0A 2P5GA 3V9XA 4AILC 3VQAA 2VWJA 1BISA 5EU7A 4CJTA 4YFUA 4W5TA 1KRPA 1XWLA 4NYFA 3NDKA 3G10A 4FCYA 4DQQA 4DQRA 3BDPA 3HJFA 4IFYA 1WSJA 4F3OA 4EP5A 1CLQA 4ZTJA 4BE0A 2B5JA 4CEQA 4RW4A 1TV6A 2RN2A 1J9AA 1DTTA 3C95A 2X6NA 1YTAA 3L3UA 2WOMA 3OYIA 4JLHA 3A2FA 3DLEA 1ZBIA 1LW2A 1UOCA 3HSTB 4FK2A 4N5SA 2AJQA 3KKSA 4B3OA 3HP9A 3O3HA 2R7YA 2HMIA 4DSJA 2Q3SA 4FZYA 4KTQA 3M8SA 1CZBA 3PX6A 4J2AA 1T7PA 3LALA 4DU1A 2IGIA 2G8WA 4CCHA 4FJMA 3TARA 4FJHA 4M3WA 4DG1A 1VSEA 3IS9A 1NJXA 4CGIA 2ZE2A 3G0ZA 3MEEA 3KK2A 3H08A 1SKWA 4E1MA 3KD5E 4FK4A 5HROA 3HPGA 4O5BA 2X74A 4W5OA 4HCBA 1J5OA 2YNGA 3VQQA 3PO4A 4HCCA 5C24A 3ZSWA 4OGCA 3NE6A 4C8OA 1EXQA 1HMVA 1S6QA 3SUPA 3U3YA 4FJ8A 3QESA 4FZZA 2G8FA 1J54A 2BE2A 1KVCA 1HYZA 3M8QA 4E89A 1TKZA 4K8ZA 4B9VA 5HRRA 2IDOA 2XHBA 4B9MA 3DRPA 2Z1IA 2E4LA 4M41A 3AO3A 3QIOA 5CZ2A 3V9SA 4DF4A 2G8HA 3P1GA 2GUIA 4IDKA 3ISNC 3B6OA 3DI6A 2DFHA 2D0AA 3RMBA 4Z4GA 4DTJA 1IKWA 4ZTFA 1A5XA 3DLHA 3B6PA 4B8AB 1D8YA 4M3RA 3OYFA 3S9HA 2OA8A 1WAFA 4ELTA 4J2DA 3SPZA 3O4QA 1L3TA 5DK5A 4O0IA 3RMDA 2YHBA 1JL2A 1REVA 4CF9A 5C42A 4FJXA 4BE1A 2ZQBA 4KRFA 4CGFA 3MXJA 5CYMA 1LAVA 2LSNA 3NF8A 3IRXA 3L2VA 2HHUA 1JKHA 1ZBFA 1VSHA 3D0PA 3TI0A 3AVLA 3LP3A 1X9MA 3AVGA 4E7IA 4QOZB 1RCHA 4CK1A 5E41A 3SV3A 3K58A 3LPTA 1C0UA 1WN7A 4AHCA 4DLEA 1RILA 1JLGA 3ZCMA 3OJUA 1B92A 2G8VA 1O1WA 1Z26A 2D0CA 4G1QA 3VQ9A 4DTXA 3TAQA 4OLAA 3HPOA 1S5JA 3TAMA 1U45A 4ELUA 2HHVA 4Z4CA 2KZZA 3OS2A 4KB0A 3JYTA 2OZSA 3TWHA 3C6UA 1C1AA 1XHXA 3K2PA 4B9TA 2P5OA 2RKIA 4OGEA 4CHQA 4DFPA 1WSGA 4O44A 4DSIA 1G15A 1C0TA 1RTHA 1W0HA 3KLGA 4CHPA 3FFIA 1T8EA 2D5RA 4B8CA 1VK0A 4HUGA 3P5JA 4CJPA 1D5AA 1LWCA 4DLGA 4CJ5A 4BACA 5I3UA 4NCAA 4M3XA 1NK4A 4Q5VA 1T05A 4DTRA 4DFJA 3K5LA 2YNFA 1IKXA 2HHTA 4M3TA 3CQ8A 1WNSA 4M3UA 3AVNA 3HT3A 1RNHA 3KLHA 1DTQA 4CFDA 4FLWA 1KLNA 4PA1A 4CJ3A 4DQIA 1RT6A 3NGZA 3VA0A 1C0MA 4FLVA 2Y1IA 4KKOA 2OPQA 1BI4B 1SUQA 4E19A 1JLQA 5KTQA 2O4IA 1K6YA 1VSLA 3AVMA 4B9LA 3AA2A 3AA4A 3DLBA 4CE9A 4HHTA 4DTNA 1HRHA 3HP6A 4Y1DA 3AO5A 4FLTA 4QCLA 2YV0X 2XO7A 2RF2A 2KFZA 4NYNA 3I0SA 1YVUA 4CECA 2HVIA 1EX4A 4Q0BA 3CG7A 2ETJA 4N41A 3E01A 4CK2A 1UA1A 4GVMA 4HUEA 1HQUA 1R0AA 3AVBA 4CJRA 1NK8A 3QEVA 4PQUA 4ID1A 3OS0A 2HVHA 4FJIA 3KD1E 3ZSZA 4O55A 5JS2A 3LZJA 3V1OA 5FRMA 2Z1GA 3QLHA 1U48A 1BIUA 5KGXA 3LANA 3V9UA 1U04A 1HPZA 3AVJA 3ZSVA 2PYJA 3SUOA 4LY7A 2KFNA 1IO2A 4CHOA 3NHGA 3TAGA 1N5YA 4DTOA 3BGRA 3EYZA 3SUQA 4AHUA 1TGOA 1VRUA 3SQ2A 3ZSQA 4EZ6A 3I8DA 2G8IA 3HK2A 1QQCA 1KSPA 4CF1A 2GV9A 1RT5A 3AVKA 4CF2A 4BDPA 1BQMA 4IKFA 2DY4A 1HYVA 4EP4A 1WSEA 3DMJA 4ID5A 4ZHRA 1VSDA 2XY8A 4NCBA 1MU2A 1NK0A 3DYAA 2FBYA 4GMJB 4LH5A 1T03A 1QSLA 1J53A 3TAEA 3OYAA 3HL8A 1JXEA 1S1VA 2B6AA 2EX3A 1X1PA 4KREA 2DTUA 2YNIA 3QEPA 1WAJA 1FKOA 2KQ2A 3VQ6A 4LSLA 5T7BA 5SZTA 3SJJA 1KCFA 2JGUA 3AVFA 3LWMA 3WNFA 4W5RA 1SL2A 3PY8A 3LPUA 2Y1JA 4FJLA 1C6VA 3UIQA 4E7LA 2E6LA 2KZMA 1RBTA 1JLBA 3ZSOA 1ZYQA 3NBPA 5CYQA 3IG1A 2VG7A 4ELVA 3RRGA 1C1BA 3AVAA 3VQCA 1TK5A 3ULDA 4FW1A 1NJYA 3KTQA 4OVLA 2ATQA 4FLUA 4JS4A 2GBZA 2OZMA 1JLEA 3HO1A 1S6PA 1ASWA 1UWBA 1KFSA 3D45A 1DLOA 4Y1CA 4Z4FA 4E3SA 5FROA 4Z4EA 3CM5A 1LWFA 2WONA 1RT2A 1JLFA 2QK9A 3V1RA 2QKKA 4FJGA 3M8PA 4FLXA 4RW8A 4DS4A 1VSKA 2A1SA 3ZT0A 1LV5A 4DQPA 1VSMA 3RR8A 3NF7A 4HTUA 1CXUA 1GOAA 1GOBA 3NF6A 4DMNA 2HW3A 2HNYA 3ALYA 4DSLA 4J2BA 2I5JA 4WE1A 3HXMA 3VQBA 4DTPA 4DTSA 3SNNA 4KHYA 3ZSRA 4BWMA 1NKCA 5KRTA 3T19A 1RTDA 2OPPA 3KIOA 4FVMA 2HNZA 3NGYA 4FM2A 1HYSA 3KLIA 2BGGA 4N56A 4E7JA 3AV9A 3PV8A 4QAGA 1Y97A 4KTWA 3ZSYA 3PUFA 5HRPA 1B9DA 2Z1HA 1SV5A 4KO0A 4RG8A 1I3AA 1YT3A 4CJVA 3V81A 1XHZA 3LZIA 2YHAA 4CEEA 3P83D 4FLZA 2XY7A 3TAPA 4W5QA 4KHQA 3T1AA 5HLFA 4FJ9A 4F4KA 3AO4A 3OYNA 4CIGA 1FK9A 1TL3A 4CFAA 4F8RA 3DLGA 1EP4A 2BANA 4H4OA 3PX0A 1NKBA 2PYLA 4E7KA 4K8XA 1QHTA 1RBSA 4KTZA 4BE2A 4DS5A 1C1CA 1VRTA 4CGJA 4CJQA 2OYQA 4Z4IA 4HUFA 1HNIA 1U49A 3LP2A 1VSIA 3CYMA 3VQ7A 3TAFA 4CERA 2A1RA 4ICLA 2PY5A 5HRNA 3PO5A 3KLFA 1LWEA 4FJNA 5C25A 3ZSXA 4CEFA 4CGDA 3OYGA 3S3MA 1JLAA 4AHRA 3L2RA 3KK3A 4O4GA 4CJ4A 2YKNA 4CEBA 4Z4HA 4FM1A 4DU4A 1QSYA 3F9KA 3CFPA 1RDAA 2RPIA 3LP1A 1UAXA 4CJSA 3ZT2A 3SYZA 2YNHA 5HRSA 3NH1A 1ZBUA 4C8KA 4I2QA 3WNHA 3ZT3A 5KRSA 3L8BA 2G8UA 4DU3A 4TSXA 3OYKA 4N47A 1KTQA 3ZT1A 3THVA 4KI6A 1IH7A 3JSMA 1RT4A 3K59A 3AA5X 4PWDA 4KHNA 4JRPA 2KTQA 2QKBA 3K5OA 4FM0A 4CJLA 1Z25A 1D9FA 1TAUA 4IG3A 1YTUA 1A5WA 1NOZA
chains in the Genus database with same CATH superfamily
3DOKA 3THYB 1BHLA 3PX4A 2PBDA 1GLLO 1NMNA 3VQEA 5AZIB 1X9WA 3WXIA 4DSKA 1HNVA 3THXB 1NJZA 1BI4A 4JKHA 4LF7K 4WCEL 5B8HA 4BRGA 3L2UA 4GV6A 1RBUA 3HVRA 2W42A 3DRRA 2P1JA 1BU6O 1TK8A 5HBMA 2P9NA 1YXQA 1NK5A 3C6TA 4JNEA 2D0PA 3M1FA 3HOTA 3QETA 1LAWA 1QZ6A 3KJVA 3DXMA 1QHAA 4ISFA 1F21A 1IG8A 4FW2A 3UE5A 3P38A 3OYHA 1U2VA 5IT9O 1A5VA 2FSJA 4GV9A 5LMUK 2V52B 3HM9A 4DV7K 4M3YA 4CF0A 4IBNA 4BG8A 2HHQA 2E2PA 2HNDA 4BGBA 2KHOA 4CK3A 4KI4A 4DFKA 4A2AA 3WQTA 3QERA 2F8TA 1ATRA 4IEEA 4M45A 4BDZA 1SS6A 2WFBA 3DLKA 2VGNA 3CCRN 1BIZA 5EX5A 1RDCA 3VA3A 2CGKA 1KAXA 3TR8A 3SAGA 1WSIA 1RDWX 4MQ3A 4CZHA 2QA4N 3O3GA 4OKKA 1YI2N 1FKPA 1NGGA 1WSHA 1GLJO 2IS3A 5AQLA 1BGXT 5ELZA 1X9SA 5FPMA 3VN5A 3OYJA 1L3VA 3S3NA 2Q0RA 1U4BA 4DQSA 4M42A 3AVCA 1SL0A 4B9QA 2UXCK 2QEXN 2E6MA 4V19S 3QFPA 4DR3K 4J8FA 2GX9A 2V7YA 2IC3A 3DAWA 3QINA 1LW0A 3CQXA 5LMNK 4JN4A 3A5NC 3HYFA 3VQDA 4DV1K 4OKEA 5AZJA 3T3FA 4CZFA 4FJ7A 4FLYA 4NO7A 4C8NA 4LSNA 2YKMA 4CJ7A 3MCPA 4FJ5A 1SQKA 4YNQA 2HB5A 4IO8A 3QO9A 4X66K 4JHDA 4CZKA 4F9OA 4CIFA 4NB4A 3TTCA 5I42A 4C8LA 3NMUA 5KQ8A 1TAQA 4R5PA 3ULEA 3FFKB 1ZC6A 4BRAA 2PZSA 3PSFA 1YUWA 3R6MA 5FPDA 2O4GA 4FK0A 3MX2A 3V9ZA 5KGWA 4MLEA 2O8DA 2EWSA 1RT1A 3WNEA 4BRCA 3K9KA 4OPAA 3I56N 4RW9A 3SV4A 3F9MA 1QTMA 1NK7A 1VAZA 4YOXA 1QQMA 3VETA 5FLXO 3NDKA 2HHVA 4DQRA 3EKUA 2P9LB 2RE2A 4F3OA 3D2EB 3PLAA 2WC9A 4ZTJA 1KQSM 2P9KB 1TV6A 3CCJN 2AP1A 2X6NA 2WOMA 3ENOA 3OYIA 3CCSN 1ZBIA 1MDUB 4FK2A 4NLBA 2PFUA 3U9ZA 4CZMA 3O8MA 2QWOA 3O3HA 2R7YA 4J2AA 5AQUA 4M3WA 4FJHA 5LJWA 1SKWA 3O9SA 1KAYA 2E8AA 4E1MA 5DM7L 1E4FT 3L4QA 3HPGA 4X64K 3QBXA 4HCBA 1WBDA 2YNGA 3ZSWA 2ASPA 1S6QA 3U3YA 1RFQA 3FZMA 2NZTA 2BE2A 1HYZA 4E89A 2ZGZA 3KK7A 4ILHA 2XHBA 2Z1IA 4M41A 3AO3A 5ADXA 3IMXA 4DF4A 2GUIA 3B6OA 2DFHA 4DTJA 3VEYA 4H5NA 4B3MK 3B6PA 5CR4A 1WAFA 4C23A 4O0IA 2YHBA 3KVGA 4FJXA 4K42A 1NG9A 1ZBFA 1VSHA 3AVLA 3CJCA 2ASMA 3L6QA 5E41A 3SV3A 1S72N 5KPTA 3LPTA 4DLEA 4AHCA 3SMSA 1RILA 1LCUA 1W97L 3ZCMA 4FWSA 3TSQA 1Z26A 2A6AA 4DTXA 3TAQA 3TAMA 2KZZA 1Z05A 3GDQA 3C6UA 5EY4A 2A42A 4IJNA 2RKIA 2VYPA 3EZWA 4O44A 4DSIA 1G15A 1M1KO 1W0HA 4BC5A 3VF4A 3WXLA 3P5JA 4FWPA 4DLGA 4PKHA 4CJ5A 4K43A 2IVPA 4BACA 3MCAB 3O6WA 4BR0A 4MO4A 1WNSA 2VWBA 2FSKA 2J4RA 1RNHA 3SJHA 4CFDA 4FLWA 4DR6K 4H5WA 4DQIA 3H3NO 3A8YA 3HOSA 4FSVA 4E19A 1JLQA 2O4IA 1K6YA 4DTNA 3DJCA 1HRHA 3VEWA 5GIOA 4FLTA 4GV3A 2KFZA 2GELA 2D1KA 2CGLA 2ETJA 3CG7A 3E01A 1UA1A 1Q81O 2RHKA 2P9IA 4ID1A 3THWA 3ZSZA 3LZJA 1R59O 3V1OA 3CXCM 3BP8A 3Q7CA 3KHYA 2VQFK 3ATVA 1IO2A 4CHOA 3NHGA 3TAGA 4YOTA 3G6EN 3SQ2A 1VRUA 2G8IA 4EZ6A 3D7EO 1QQCA 3HZ6A 1KSPA 1T44A 2GUPA 3OTOK 1RT5A 3BF1A 2Q97A 1BQMA 4IKFA 1MWMA 3CI5A 3DMJA 3T7ZA 2O8BA 2QXLA 1NK0A 4GMJB 2FBYA 1QSLA 3TAEA 3BY5A 3QEPA 4B3SK 1GLCG 3MN7A 3LPUA 2Y1JA 4FJLA 1C6VA 3UIQA 2E6LA 4PL7A 3R8EA 2VG7A 3O4WA 1C1BA 3AVAA 3VQCA 1VQ6N 2QWRA 4OPHA 4WQ4A 4JS4A 2GBZA 4IFEA 3HO1A 1KFSA 1NBWA 3M3ZA 3T1YK 3E9OA 3LM2A 4FJGA 4FLXA 3DWLA 3LDLA 3ZT0A 1LV5A 1VSMA 1ATNA 1GOAA 2ASOA 1N32K 1OKJA 4DSLA 5JVGL 3R9PA 5ADXH 1JJ2M 3VQBA 4H5TA 1NKCA 3T19A 1N8RO 4CZEA 5JLFA 2HNZA 5AQJA 3KLIA 1JCGA 3H45C 1HJOA 3H1VX 4KO0A 5GAHP 4WFNL 2CGJA 1YT3A 3WXKA 2XY7A 3VEVA 1X9JA 4GNIA 4JKGA 3OYNA 4CIGA 1FK9A 3UKRB 1HKCA 3DLGA 2P9UB 1EP4A 4IOXA 1NKBA 3G71N 3CJBA 1RBSA 4IEIA 4BE2A 1XMOK 2F7TA 3LDQA 1KD1O 1HNIA 5GAGP 1VSIA 4BRMA 4ICLA 3LM9A 3JAMO 4FJNA 3ZSXA 1O13A 4CEFA 3OYGA 3PSIA 2UUCK 1JLAA 4O4GA 1NGCA 2JWKA 1QSYA 2RPIA 5JLHA 4CJSA 3ZT2A 3SYZA 4YY3K 4AM7A 5HRSA 4I2QA 3WNHA 4DU3A 3OYKA 1RT4A 3AA5X 3ZETA 4PWDA 2KTQA 3I33A 3K5OA 4FM0A 1D9FA 3CC7N 1KAZA 2KLAA 1NOZA 4MO5A 4BRNA 4DKWA 4GW6A 4BREA 3OS1A 3RMCA 4MDBA 3J7ZO 3M8RA 4CJEA 1RBRA 2A5XA 3MDQA 3VESA 4CJWA 1KFDA 3K9JA 3CCQN 2O8CA 4PUOA 3O3FA 1HKBA 2YX6A 3OJSA 5J2NA 3MXMA 1L5UA 2DFEA 3OY9A 1VQ5N 3O4NA 1WLJA 3H6EA 1TKTA 4XH4A 4OPKA 4QS7A 1N33K 3ZT4A 1KC8O 1Q82O 1EKEA 4JKAA 4GKKK 5J2MA 3DM2A 4IZ9A 4YDUA 4OPJA 4F2RA 4UQGA 4B3TK 2E1ZA 5C0YA 3NH0A 5E84A 4EIAA 3RR7A 4FYDA 1U6ZA 1OVYA 4I6MA 1QSSA 3N4QA 3OYCA 2ZD1A 1NOYA 4MFBA 4KAZA 2W41A 1W7AA 1EO1A 3O08A 4DV3K 3GBTA 3MEDA 5HP1A 3LWLA 4KHUA 4LC9B 3WNGA 3NAEA 3OYDA 4GKJK 1X3NA 3NGIA 2PAVA 2HSTA 1VQ8N 1B9FA 3QNOA 1NK9A 2E88A 1HJRA 1Q86O 1GLDG 4U67L 4LF9K 3T69A 3O9UA 5A2QO 4JI1K 5BREA 4JRQA 1ZXOA 3KLEA 3TABA 4DV6K 3DRSA 4I9LA 4AHTA 5LJVA 1JCEA 4YOUA 3RRHA 3QNNA 4WQ4C 3C65A 3K57A 3J7YP 3EY1A 2P9SB 4FXDA 2ZGYA 4CHZA 5MLCQ 1SKRA 1WSFA 5J2PA 2HHSA 3ZX0A 1IKYA 3D2FA 5BRDA 2FC0A 2X6SA 4X65K 4AM6A 3H3OB 2W6KA 4L3QA 3ZYYX 1NMDA 1S9GA 3QIPA 3I55N 1NGAA 2P9PA 4CW7B 2FLOA 4M7YA 4K0KK 1K8AO 5CZ1A 3AO1A 3AO2A 3V9WA 4F2SA 4HVJA 1RGIA 2X78A 3NF9A 2VGMA 5AQPA 1CXQA 1RT7A 3K5NA 4NXNK 1YVNA 5LL6Z 3K0SA 3QEIA 4DFMA 4HWIA 1YHQN 1P8ZA 3O1BA 3S3OA 3JS6A 1TL1A 1Q9XA 3EE9A 2XY6A 4AHVA 2IOCA 4H8KA 1NM1A 3OVNA 4UY8O 3QEWA 1XNQK 3FGUA 3R1XA 4O0JA 2BDPA 5BPNA 4CF8A 4DQ8A 2KW4A 2NRRA 1FXXA 5SWMA 5BRFA 2D0BA 1L3SA 3U8XA 3JXUA 1K8KA 1KLMA 3VF6A 3V9XA 4AILC 2ZWHA 2VWJA 3GL1A 1KRPA 4CJTA 4YFUA 4NYFA 5C12A 5CHIA 4DQQA 3BDPA 3IFRA 3C7NB 1WSJA 1QZ5A 1SZ2A 1C0GA 5AQOA 1J9AA 2RN2A 1DTTA 1YTAA 5TKYA 4DR1K 4WF9L 3A2FA 1UOCA 1LW2A 3HSTB 3RSEA 1GLAG 3M6GA 4N5SA 3CCEN 3SBTA 4OX9K 3MN9A 1VQPN 3KKSA 4B3OA 3HP9A 1GLBG 2V51B 5FPNA 3THYA 4DSJA 4FZYA 3M8SA 4DU1A 3TARA 5AZIA 1VSEA 3AY9A 1D4XA 4CGIA 3THXA 4FK4A 4BR5A 4O5BA 2X74A 4W5OA 4LF4K 4PHTX 5C24A 2A41A 1TKZA 4YDUC 4K8ZA 1P90A 5HRRA 2IDOA 1IBKK 4K41A 4B9MA 2E2OA 3A5LC 4CBWA 1NLVA 4IDKA 4H03B 3A0IX 3DI6A 3IUCA 2D0AA 3RMBA 1A5XA 3DLHA 3CJ1A 1OH8A 1D8YA 4WFBL 3C6AA 4KH4A 3O4QA 2UYTA 1JL2A 3RVCA 4CF9A 5C42A 5M1NA 4BE1A 2ZQBA 4DV5K 3ENBA 3P31A 2LSNA 3BZKA 3CCMN 3D0PA 1RCHA 1C0UA 2HF4A 4XH1A 3QB0A 1MWKA 2YI1A 4CZJA 1B92A 2G8VA 1O1WA 3VQ9A 4OLAA 3HPOA 2OCEA 3OS2A 4KB0A 3TWHA 1C1AA 4B9TA 3WUHA 3O9RA 4A2BA 4DFPA 4BY9C 1BA1A 3ZX2A 1C0TA 1RTHA 2D5RA 4CJPA 2E5LK 3HM8A 4AQYK 1E3MA 1NK4A 4Q5VA 1TYQB 1IKXA 3CQ8A 3P39A 4GY2B 3HT3A 3WEEB 3U4LA 4PA1A 4H5RA 4H0YB 4JI6K 3NGZA 3VA0A 1C0MA 4FLVA 2OPQA 2ZJPL 5KTQA 1VSLA 3AVMA 5FPEA 3AA4A 3DLBA 4HHTA 1N36K 3HP6A 4FPBA 3AO5A 3MMVA 2YV0X 4NYNA 2HVIA 1YVUA 4JI0K 1EX4A 1QQNA 4CK2A 4ISGA 1FJGK 1R0AA 3FR0A 3HBTA 4FJIA 1VQLN 2NRWA 1BIUA 1TUYA 3V9UA 1U04A 4G9ZA 3AVJA 2PYJA 2KFNA 4JI4K 4A62A 3CD6N 3TTFA 3ZSQA 2CH5A 2GV9A 3AVKA 4IOCL 1HYVA 1WSEA 1MU2A 3MWPA 2NRXA 3C6HA 4JEPA 4EHUA 3OYAA 3HSCA 1X1PA 4YOVA 2DTUA 1FKOA 2KQ2A 3FZLA 2P9LA 3CJAA 2JGUA 3D2EA 3AVFA 3LWMA 4W5RA 2P9KA 2W40A 4E7LA 3VMFB 1RBTA 3UKUB 4ILGB 5CYQA 2Q1NA 3IG1A 2ZJRL 4ELVA 3AAQA 3SAFA 1TK5A 1Y64A 3ULDA 1NGBA 2HHHK 3KTQA 2ATQA 1VQ9N 2FF3B 1JLEA 1S6PA 2GEMA 3BZCA 3GOIA 3D45A 4JD2B 3CHWA 3CM5A 1LWFA 2WONA 1WBBA 3CCUN 2D0OA 4BROA 3CC4N 2QKKA 1VSKA 4BR9A 3NF7A 1CXUA 3WT0A 3ALYA 4H0XB 3G25A 4WE1A 3HXMA 2Q36A 2H3GX 5KRTA 4FVMA 3NGYA 1BG3A 3AV9A 3PV8A 4QAGA 4KTWA 3PUFA 5HRPA 1B9DA 2Z1HA 3A5MC 1SV5A 4RG8A 1YITN 2YHAA 4CEEA 3TAPA 1NGEA 4FOEA 4W5QA 3IKMA 3T1AA 5HLFA 4F4KA 3AO4A 4CFAA 4JK8A 1T3VA 2BANA 3VEXA 1U49A 1VQ7N 3TAFA 5AQGA 5AQYA 2A1RA 4JI7K 1LWEA 5C25A 4CGDA 3S3MA 3KK3A 4CEBA 4DU4A 3MWTA 3CFPA 1RDAA 3LP1A 3J81O 2QI2A 1BA0A 1ZBUA 4TSXA 4N47A 1KTQA 3ZT1A 4E1JA 4WQ5A 4JRPA 4JI5K 4DR4K 1Z25A 4X62K 4IDHA 2F8SA 4I2PA 2HHXA 4C8MA 4B08A 1S1TA 3LAMA 3LAKA 4CEDA 4Z94A 2G8KA 4H0OA 4I9QA 3V4IA 3MN6A 3OYMA 1MA9B 1W2BM 4FJJA 4JKFA 2QXFA 1HNXK 1S1WA 4N76A 3OHRA 5AQRA 4BVPA 4XEIA 4CFBA 3HVTA 4DWIA 5C15A 1BDGA 4OKJA 2UUAK 4KHSA 1TUUA 4KPYA 4DV4K 4NCGA 4J2EA 1G99A 4FVUA 4Y0WA 1HPMA 3DLRA 3GG4A 3HPHA 5JS1A 5AFUA 4LFAK 4FJKA 2Q2RA 3L2QA 1VQNN 4E0DA 3CM6A 3CFRA 3SI6A 4LH4A 3OBYA 1Q8IA 1W9HA 2XRIA 1ITGA 4KHWA 2O8EB 2VG6A 3OYLA 4B1WB 1KXPA 4YHHK 4B1UB 4DR5K 2VG5A 3RTVA 1EETA 5K14A 3OYBA 5M1OA 4O8UA 1NJWA 1BCOA 2NUBA 4ISEA 4CJUA 2WUSA 1IG9A 5AQIA 5KQDA 3F73A 4JS5A 5DMRA 3CETA 4CHNA 1NU0A 1V4TA 3J7AP 4KHPK 3ZEUB 3VEOA 4DR7K 3F5TA 2FBVA 4DCHA 5GIPA 4B3RK 1ZBLA 3O1WA 4IFVA 1CZ9A 3SQ4A 1VQON 1TVRA 1ZBHA 3NH2A 1TKDA 3NFAA 4BRPA 5BN8A 4HTLA 4PY5A 1QE1A 5GINA 1HNWK 3CFOA 3Q7BA 2XY5A 3N4PA 4W5NA 4E7HA 3V6DA 1TKXA 2FBTA 4QS8A 4CHYA 4DF8A 3K5MA 3MXIA 4KV8A 4OLBA 4B9SA 2F96A 3KKRA 4EZ9A 1JL1A 1QS4A 2YHXA 3DXKB 1L3UA 4RCHA 4DSEA 3AVIA 3LP0A 3V1QA 3MEGA 3WXJA 3OYEA 3M5RA 3L2WA 3KWGA 1VSJA 3C94A 3UKRA 2P9UA 1U47A 2NRHA 3IDHA 4DTUA 2WBNA 4CI6A 3W3DA 2ZF5O 1ASUA 1JCFA 2FSNA 1ILYA 4FZXC 4CEZA 1RT3A 3LDSA 3VQ8A 1YJWN 4CJFA 4AHSA 2B4JA 1UA0A 1VSFA 2P5GA 3FZFA 3A5OC 1BUPA 4FL9A 5EU7A 4BC2A 4WQ5C 2E1YA 4EP5A 4O8KA 1DGKN 3VPZA 3ZX3A 3AGKA 3DLEA 4BRLA 3EO3A 1HLUA 4PKGA 3QICA 2HMIA 2Q3SA 1CZBA 1X3MA 1T7PA 3LALA 4CCHA 4FJMA 3E9PA 4DG1A 3PIOL 3T1HK 1NJXA 4KBOA 2ZE2A 3MEEA 3H08A 3SBGA 2UXBK 1J5OA 4OGCA 5AQTA 3QESA 4FZZA 1J54A 3M8QA 2HF3A 2HBKA 4B9VA 2QWQA 3DRPA 3VTIA 4BC3A 2GWJA 4GVEA 5AFUH 2QTDA 1IKWA 4B8AB 4M3RA 1IBMK 3S9HA 2OA8A 4J2DA 3SPZA 4NXMK 3RMDA 1REVA 5BRHA 4CGFA 1LAVA 2NRTA 5IWAK 3NF8A 3IRXA 3L2VA 3TI0A 3LP3A 2GTDA 3AVGA 4E7IA 2O8FB 1NGHA 4CK1A 3E9LA 1WN7A 3L4IA 1NWKA 3OA9A 1CZAN 4FWLA 2D0CA 4G1QA 1S5JA 1U45A 3S41A 3K2PA 5BPLA 2P5OA 5BN9A 4BVOA 1WSGA 4CZLA 3KLGA 1T8EA 2Q31A 1VK0A 2VQEK 4HUGA 1D5AA 1LWCA 2P9SA 4M63C 5F1XA 3TSPA 3U9DA 3SLCA 5I3UA 4NCAA 1T05A 3HTVA 2E20A 4PKIA 4DFJA 3K5LA 5AQKA 3LDOA 4M3TA 3PIPL 1K9MO 4BR4A 4M3UA 3AVNA 4JI8K 2OANA 4B1YB 1J5EK 1EQYA 2QM1A 4CJ3A 1RT6A 3CQYA 1E4GT 4KKOA 5GADP 1BI4B 2QW9A 4JYAK 1SUQA 4B9LA 5KPZA 3SK3A 5AQWA 3MN5A 3QDKA 4CE9A 4WFAL 3CIPA 3O9TA 4Y1DA 2XO7A 2RF2A 3I0SA 4CECA 4DV2K 2P9NB 1T6CA 2UUBK 4FWMA 1HQUA 3AVBA 4CJRA 1NK8A 4RWTA 3QEVA 2QWMA 3OS0A 1OH5A 3VGMA 1VQMN 3KD1E 2HVHA 5JS2A 3DXMB 3QLHA 1HX1A 1HPZA 4C1NK 3ZSVA 1U2VB 3SUOA 4LY7A 4OO1J 2HBLA 1YJ9N 4DTOA 3SUQA 4AHUA 1TGOA 5CE3A 4R79A 3CF5L 4CF2A 2IVNA 4JK9A 2XY8A 3BF3A 4CD1A 1ATSA 1V4SA 1J53A 4JK7A 1JXEA 2EX3A 4YORA 4H5VA 1WAJA 5JVHL 3SMPA 4LSLA 5T7BA 5SZTA 5LY3A 3C7NA 3SJJA 1KCFA 1SL2A 5F0XA 3CERA 4BR7A 1NGFA 2KZMA 1ZYQA 3WQUA 4RTFD 4JI2K 1DKGD 2OZMA 4DR2K 1UWBA 1OVQA 5C10A 3VEZA 4Y1CA 4Z4FA 5E26A 5FROA 4JKEA 1JLFA 2QK9A 3V1RA 2A40A 3M8PA 2A1SA 4DQPA 3H46O 3RR8A 4HTUA 3AGRA 1GOBA 4BRFA 4IJAA 3SAHA 4DMNA 5BR9A 4WYBA 5AQNA 3VTHA 2I5JA 4J2BA 4DTPA 4KHYA 3SNNA 3ZSRA 5M1FA 3KIOA 3ENHA 1HYSA 3C0BA 2BGGA 4E7JA 4BRHA 3CCLN 5AZJB 3V81A 4JKCA 2QWNA 3LZIA 3P83D 5AQZA 3W0LA 1K73O 4KHQA 1M90O 4IO9L 4FJ9A 4JAXA 4JHDB 1TL3A 2NLXA 1XQSC 3I8BA 1BWFO 4H4OA 3PX0A 3CPEA 3ULEB 4E7KA 1NJIO 2PYLA 1S22A 1QHTA 4K8XA 4KTZA 4CGJA 4CJQA 4Z4IA 1VHXA 1WOQA 3LP2A 3VQ7A 3CYMA 4CERA 2YCHA 3MK6A 2PY5A 4DB3A 2O8DB 3PO5A 1FW6A 3HRGA 4U7BA 2GWKA 4AHRA 4FWRA 4CJ4A 4Z4HA 4IOAL 2YNHA 1Z6RA 4C8KA 5KRSA 3BEXA 3ID8A 3THVA 4KI6A 1IH7A 5KPRA 4KHNA 5JMVA 1XC3A 2W6LA 1TAUA 3TU5A 4IG3A 1YTUA 1TYQA 3R3LA 1A5WA 4LF6K 5KI6A 1VQ4N 4EAHD 2ITGA 1YJNN 1I39A 1XC9A 3VGKA 3WEEA 1SL1A 3KWIA 3QMLA 4M7XA 4RW6A 4DSFA 4IG0A 3SZ2A 5J1EA 1HQEA 4YOWA 3TPQA 3SCXA 4KB1A 3LDPA 1ASVA 3MX5A 1GOCA 3VQ5A 1RDBA 3KZBA 1OH6A 3DOLA 3IAYA 4PL8A 3AVHA 3QEXA 2FBXA 3L3VA 2YJFA 1RBVA 1BL3A 4OJRA 2VCPA 1TK0A 3NCIA 3U6FA 1BCMA 4BC4A 3U3GA 4H4MA 4A5AA 4YOYA 4BG9A 4AH9A 2BTFA 3RMAA 3O9QA 3FE1A 4CJKA 2F9WA 4B9NA 4KH6A 4I7FA 1XI1A 3E66A 3EEQA 2IAJA 1RTIA 4ILJA 3KK1A 2CH6A 1KVBA 1RTJA 3RWUA 2NNWA 4E1NA 3F2KA 4FOIA 3VQPA 4CEOA 5F2RA 5AQQA 2P51A 1S1UA 2EHGA 4JV5K 4DTMA 1DT9A 4Z0UA 1QVGM 4CIEA 3J80O 5D3GA 2IVOA 1JXBA 3UKUA 3I0RA 4LD0A 1NKEA 3VENA 5FRNA 1KVAA 4CFCA 2OPRA 4FO0A 4RW7A 4BQLA 4JD2A 2D4WA 3WXMB 4B9UA 2Z1JA 2VWKA 5M1PA 4CEAA 1BQNA 5AQVA 1RDDA 4M3ZA 1JLCA 2OPSA 1NK6A 3MAQA 2BH1A 1Q9YA 3MECA 4BDYA 5C2FA 1IJJA 1D9DA 4CESA 3ASMA 4DHYA 4A5BA 3ID6A 1WUAA 4K25A 5AQFA 4IWVA 1HUXA 5GAEP 4JKBA 5J2QA 3SQ1A 1T6DA 3SUNA 3VQ4A 1OH7A 2P9IB 4MDAA 4XIUA 3THWB 2DFFA 4KFBA 1SKSA 4EFHA 1N6QA 5AQXA 2Q0UA 4CGGA 1S3XA 2I7NA 3ITHA 3OBWA 3O80A 3EZ5A 3TANA 3NVKA 5AQSA 1IKVA 5FDLA 3SPYA 2HHWA 4CGHA 5TKWA 2OTJN 1Q7YO 4CVNE 5CY4A 4DUZK 4CD3A 2JLEA 3TTDA 4L8RB 1S9EA 4BWJA 2O8BB 4F3TA 1S1XA 3AA3A 5AQHA 3SQ0A 4H0TB 5C2DA 1BISA 4W5TA 1XWLA 4FCYA 3G10A 3HJFA 4IFYA 3FZHA 3UB5A 4IXCA 1CLQA 3NVMA 4CZIA 4BE0A 2B5JA 4CEQA 3BUZB 3VF2A 4RW4A 3C95A 1EWRA 3L3UA 4JLHA 2JWLA 2A3ZA 1IBLK 3CMEN 2AJQA 4KTQA 3PX6A 2G8WA 2IGIA 3P4IA 1I94K 2ZM6K 2I7PA 3IS9A 1IV0A 3QBWA 4O5FA 3KK2A 3G0ZA 5M1KA 3KD5E 5HROA 1SAZA 3OW2M 3VQQA 3PO4A 2ITMA 4HCCA 4EHTA 3NE6A 4C8OA 1EXQA 1HMVA 3SUPA 4FJ8A 2G8FA 1KVCA 2F9TA 4FWQA 5AJ3K 2E4LA 4LFCK 3QIOA 5CZ2A 3V9SA 2G8HA 3P1GA 4BRKA 3ISNC 4C1NI 4Z4GA 1YIJN 4ZTFA 3TSUA 3OYFA 4LF5K 3E1YA 3LDNA 4ELTA 1L3TA 5DK5A 5EVZA 4JKGB 1BOTO 4QS9A 4CZGA 4KRFA 3MXJA 5CYMA 2NRVA 2YHYA 4MLHA 2HHUA 3L0QA 1JKHA 3CPWM 1X9MA 4FWOA 4QOZB 1LOTB 3K58A 4LFBK 4DUYK 2O8EA 2AA4A 1JLGA 4XH5A 3OJUA 1NGJA 5M1QA 2HMPA 4ELUA 2KKZA 3CC2N 4Z4CA 3JYTA 2OZSA 3CMAN 1XHXA 4LF8K 4CHQA 4OGEA 1NNEA 3VOVA 3ATUA 1XMQK 4CHPA 3FFIA 3EL2A 4BGAA 4B8CA 3ZEUA 4JI3K 3ZETB 4BRQA 5DM6L 3H1QA 2IIRA 2HBMA 3O5BA 5JICA 4M3XA 4DTRA 3DLLL 2YNFA 2HHTA 3G4SN 3KLHA 1DTQA 1KLNA 2NRZA 2Y1IA 2O8CB 3EN9A 4H0VB 1XUPO 3AA2A 4QCLA 2UU9K 1QVFM 3FZKA 5EXWA 5I9EB 1ZBSA 4Q0BA 4N41A 4B1XB 4GVMA 4HUEA 4B1VA 2FXUA 5AQMA 4PQUA 2QWLA 3DXKA 4O55A 1N34K 5FRMA 1QQOA 2Z1GA 4BRDA 1U48A 1EWQA 5KGXA 3CJ9A 3LANA 4H0PA 4I6MB 3GE1A 3CJ7A 4FWNA 2DPNA 1ESVA 1N5YA 3BGRA 5BR8K 3EYZA 3HK2A 1H1VA 3I8DA 4CF1A 1RDUA 3QFUA 4BDPA 2DY4A 4EP4A 4ZHRA 4ID5A 2UXDK 1VSDA 4NCBA 2V7ZA 3AARA 1GLEG 4JKDA 3DYAA 4LH5A 1T03A 3J8AA 5AR0A 4BQZA 3HL8A 1S1VA 2B6AA 4KREA 1NGIA 2YNIA 3VQ6A 3WNFA 3PY8A 5BPMA 4FWKA 1HNZK 1Q18A 3ZSOA 1JLBA 3NBPA 1BO5O 4NLCA 5HOOA 3RRGA 1C0FA 2YJEA 4FW1A 1NJYA 4OVLA 4FLUA 4B1ZA 1ASWA 5EOYA 1DLOA 4E3SA 3D2FB 4Z4EA 3B8AX 1DEJA 1RT2A 3ZLJA 4RW8A 4DS4A 2WTUA 4CBXA 2OTLN 2E2QA 3NF6A 2HW3A 2HNYA 2P9PB 3EE8A 4DTSA 4BRIA 2QWPA 3EKSA 4BWMA 2ZJQL 1RTDA 2OPPA 4FM2A 1YAGA 4N56A 2YHWA 4A57A 1Y97A 3VGLA 3ZSYA 3AAPA 1I3AA 4CJVA 1XHZA 4FLZA 1VQKN 1XNRK 3D6RA 3LL3A 4F8RA 2O8FA 4DS5A 1C1CA 1VRTA 2OYQA 4A59A 4HUFA 4DV0K 5HRNA 2E2NA 4KH5A 3KLFA 1YF5L 1HR0K 2HBJA 3FLCO 3CCVN 3L2RA 4A61A 1K8KB 2YKNA 4FM1A 1J6ZA 1NGDA 3F9KA 1UAXA 3HI0A 3NH1A 2BUPA 1HKGA 4FPAA 3ZT3A 3L8BA 2G8UA 2FF6A 3JSMA 4AF1A 3K59A 3VERA 2QKBA 4CJLA 2HOEA 3RSEB 4CBUA 5HL7L 2F4VK 1WB9A 4BR2A 3VQAA 5H1SQ 1GLFO
chains in the Genus database with same CATH topology
5KI6A 3DOKA 4GW6A 2F8SA 2ITGA 4I2PA 3OS1A 2HHXA 1I39A 4C8MA 3RMCA 4B08A 1XC9A 3M8RA 1S1TA 3LAMA 1BHLA 4CJEA 3LAKA 4CEDA 3PX4A 1RBRA 1SL1A 2G8KA 3V4IA 4I9QA 3VQEA 4CJWA 1KFDA 3OYMA 1X9WA 4RW6A 1HNVA 4DSFA 4DSKA 4FJJA 4IG0A 3SZ2A 5J1EA 1HQEA 2QXFA 1NJZA 1BI4A 4PUOA 4KB1A 3O3FA 3SCXA 1ASVA 1S1WA 3OJSA 5J2NA 4N76A 3MXMA 1GOCA 1L5UA 3VQ5A 1RDBA 2DFEA 3L2UA 1RBUA 3OY9A 3DOLA 3HVRA 3IAYA 3O4NA 1WLJA 2W42A 3DRRA 2P1JA 3AVHA 1TKTA 4OPKA 4CFBA 2FBXA 3L3VA 3QEXA 1TK8A 1RBVA 5HBMA 1BL3A 3HVTA 3ZT4A 1NK5A 1EKEA 3C6TA 4OJRA 4DWIA 5J2MA 3DM2A 1TK0A 3NCIA 3U6FA 1BCMA 4OKJA 3QETA 1LAWA 3U3GA 3KJVA 4OPJA 4KHSA 4H4MA 4F2RA 4UQGA 4KPYA 4NCGA 4AH9A 4J2EA 3RMAA 3NH0A 3RR7A 1F21A 4FYDA 1QSSA 4FW2A 3OYHA 3OYCA 2ZD1A 3DLRA 1A5VA 4MFBA 4CJKA 1NOYA 4KAZA 4B9NA 3HPHA 4I7FA 1XI1A 3HM9A 4M3YA 5HP1A 3MEDA 4CF0A 1Q9XA 5JS1A 3LWLA 4IBNA 4KHUA 2IAJA 3WNGA 1RTIA 2HNDA 4FJKA 3NAEA 2HHQA 4CK3A 3OYDA 3KK1A 3L2QA 4KI4A 4DFKA 3NGIA 4E0DA 1KVBA 2F8TA 3QERA 3CM6A 3CFRA 3SI6A 1RTJA 4M45A 1B9FA 4BDZA 4LH4A 3QNOA 1NK9A 1Q8IA 3RWUA 1HJRA 1W9HA 4E1NA 2XRIA 3DLKA 1ITGA 4KHWA 1BIZA 2VG6A 3VQPA 3OYLA 1RDCA 3VA3A 4CEOA 3TR8A 2VG5A 3RTVA 1WSIA 2P51A 1EETA 5K14A 4JRQA 1S1UA 3OYBA 4MQ3A 2EHGA 3KLEA 1NJWA 4DTMA 1BCOA 3TABA 2NUBA 3DRSA 4OKKA 3O3GA 4Z0UA 4I9LA 4CIEA 4CJUA 1IG9A 5D3GA 4AHTA 1JXBA 1FKPA 3RRHA 3I0RA 3F73A 3QNNA 1WSHA 4JS5A 4LD0A 5DMRA 1NKEA 4CHNA 2IS3A 3K57A 5FRNA 1BGXT 3EY1A 1KVAA 4CFCA 2OPRA 1X9SA 3VN5A 2FBVA 4FXDA 4RW7A 4CHZA 3OYJA 1SKRA 1WSFA 5J2PA 2HHSA 1L3VA 4B9UA 1ZBLA 1IKYA 2Z1JA 3S3NA 4IFVA 2VWKA 1CZ9A 2FC0A 2X6SA 4DQSA 4CEAA 1BQNA 3SQ4A 1U4BA 1RDDA 3AVCA 4M42A 1JLCA 1TVRA 1SL0A 3NH2A 2OPSA 1TKDA 4M3ZA 1ZBHA 1NK6A 3MAQA 3NFAA 2E6MA 1Q9YA 3MECA 1S9GA 3QIPA 4BDYA 4PY5A 1QE1A 3CFOA 1D9DA 4CESA 2IC3A 3ASMA 2XY5A 4W5NA 4E7HA 3V6DA 3QINA 1LW0A 1TKXA 2FBTA 4CHYA 4DF8A 5CZ1A 3AO1A 3K5MA 3MXIA 3AO2A 4KV8A 3V9WA 4F2SA 4B9SA 4OLBA 4HVJA 5J2QA 3HYFA 3VQDA 2X78A 3SQ1A 3NF9A 2F96A 3KKRA 4EZ9A 1CXQA 1RT7A 3K5NA 4OKEA 3T3FA 3VQ4A 3QEIA 3SUNA 1JL1A 4FLYA 4DFMA 4C8NA 4FJ7A 4XIUA 4LSNA 2YKMA 1QS4A 3S3OA 1L3UA 2DFFA 4KFBA 4FJ5A 4DSEA 1SKSA 3AVIA 3LP0A 1TL1A 3V1QA 2HB5A 3MEGA 4YNQA 4AHVA 2XY6A 1N6QA 3OYEA 2IOCA 3QO9A 4H8KA 4CGGA 3L2WA 3ITHA 1VSJA 3OVNA 3EZ5A 3TANA 4CIFA 5I42A 3QEWA 4C8LA 3C94A 1IKVA 5FDLA 1TAQA 1U47A 3SPYA 4R5PA 4O0JA 2HHWA 4CGHA 4DTUA 2BDPA 4CF8A 2PZSA 2KW4A 1ASUA 2O4GA 5CY4A 1FXXA 5SWMA 4FK0A 2JLEA 4L8RB 3V9ZA 5KGWA 2D0BA 1RT1A 3WNEA 4FZXC 1S9EA 4CEZA 1L3SA 4BWJA 1RT3A 4RW9A 3LDSA 3SV4A 4F3TA 3VQ8A 1QTMA 4CJFA 1S1XA 3AA3A 4AHSA 2B4JA 1NK7A 1UA0A 1VSFA 1KLMA 3SQ0A 2P5GA 3V9XA 4AILC 3VQAA 2VWJA 1BISA 5EU7A 4CJTA 4YFUA 4W5TA 1KRPA 1XWLA 4NYFA 3NDKA 3G10A 4FCYA 4DQQA 4DQRA 3BDPA 3HJFA 4IFYA 1WSJA 4F3OA 4EP5A 1CLQA 4ZTJA 4BE0A 2B5JA 4CEQA 4RW4A 1TV6A 2RN2A 1J9AA 1DTTA 3C95A 2X6NA 1YTAA 3L3UA 2WOMA 3OYIA 4JLHA 3A2FA 3DLEA 1ZBIA 1LW2A 1UOCA 3HSTB 4FK2A 4N5SA 2AJQA 3KKSA 4B3OA 3HP9A 3O3HA 2R7YA 2HMIA 4DSJA 2Q3SA 4FZYA 4KTQA 3M8SA 1CZBA 3PX6A 4J2AA 1T7PA 3LALA 4DU1A 2IGIA 2G8WA 4CCHA 4FJMA 3TARA 4FJHA 4M3WA 4DG1A 1VSEA 3IS9A 1NJXA 4CGIA 2ZE2A 3G0ZA 3MEEA 3KK2A 3H08A 1SKWA 4E1MA 3KD5E 4FK4A 5HROA 3HPGA 4O5BA 2X74A 4W5OA 4HCBA 1J5OA 2YNGA 3VQQA 3PO4A 4HCCA 5C24A 3ZSWA 4OGCA 3NE6A 4C8OA 1EXQA 1HMVA 1S6QA 3SUPA 3U3YA 4FJ8A 3QESA 4FZZA 2G8FA 1J54A 2BE2A 1KVCA 1HYZA 3M8QA 4E89A 1TKZA 4K8ZA 4B9VA 5HRRA 2IDOA 2XHBA 4B9MA 3DRPA 2Z1IA 2E4LA 4M41A 3AO3A 3QIOA 5CZ2A 3V9SA 4DF4A 2G8HA 3P1GA 2GUIA 4IDKA 3ISNC 3B6OA 3DI6A 2DFHA 2D0AA 3RMBA 4Z4GA 4DTJA 1IKWA 4ZTFA 1A5XA 3DLHA 3B6PA 4B8AB 1D8YA 4M3RA 3OYFA 3S9HA 2OA8A 1WAFA 4ELTA 4J2DA 3SPZA 3O4QA 1L3TA 5DK5A 4O0IA 3RMDA 2YHBA 1JL2A 1REVA 4CF9A 5C42A 4FJXA 4BE1A 2ZQBA 4KRFA 4CGFA 3MXJA 5CYMA 1LAVA 2LSNA 3NF8A 3IRXA 3L2VA 2HHUA 1JKHA 1ZBFA 1VSHA 3D0PA 3TI0A 3AVLA 3LP3A 1X9MA 3AVGA 4E7IA 4QOZB 1RCHA 4CK1A 5E41A 3SV3A 3K58A 3LPTA 1C0UA 1WN7A 4AHCA 4DLEA 1RILA 1JLGA 3ZCMA 3OJUA 1B92A 2G8VA 1O1WA 1Z26A 2D0CA 4G1QA 3VQ9A 4DTXA 3TAQA 4OLAA 3HPOA 1S5JA 3TAMA 1U45A 4ELUA 2HHVA 4Z4CA 2KZZA 3OS2A 4KB0A 3JYTA 2OZSA 3TWHA 3C6UA 1C1AA 1XHXA 3K2PA 4B9TA 2P5OA 2RKIA 4OGEA 4CHQA 4DFPA 1WSGA 4O44A 4DSIA 1G15A 1C0TA 1RTHA 1W0HA 3KLGA 4CHPA 3FFIA 1T8EA 2D5RA 4B8CA 1VK0A 4HUGA 3P5JA 4CJPA 1D5AA 1LWCA 4DLGA 4CJ5A 4BACA 5I3UA 4NCAA 4M3XA 1NK4A 4Q5VA 1T05A 4DTRA 4DFJA 3K5LA 2YNFA 1IKXA 2HHTA 4M3TA 3CQ8A 1WNSA 4M3UA 3AVNA 3HT3A 1RNHA 3KLHA 1DTQA 4CFDA 4FLWA 1KLNA 4PA1A 4CJ3A 4DQIA 1RT6A 3NGZA 3VA0A 1C0MA 4FLVA 2Y1IA 4KKOA 2OPQA 1BI4B 1SUQA 4E19A 1JLQA 5KTQA 2O4IA 1K6YA 1VSLA 3AVMA 4B9LA 3AA2A 3AA4A 3DLBA 4CE9A 4HHTA 4DTNA 1HRHA 3HP6A 4Y1DA 3AO5A 4FLTA 4QCLA 2YV0X 2XO7A 2RF2A 2KFZA 4NYNA 3I0SA 1YVUA 4CECA 2HVIA 1EX4A 4Q0BA 3CG7A 2ETJA 4N41A 3E01A 4CK2A 1UA1A 4GVMA 4HUEA 1HQUA 1R0AA 3AVBA 4CJRA 1NK8A 3QEVA 4PQUA 4ID1A 3OS0A 2HVHA 4FJIA 3KD1E 3ZSZA 4O55A 5JS2A 3LZJA 3V1OA 5FRMA 2Z1GA 3QLHA 1U48A 1BIUA 5KGXA 3LANA 3V9UA 1U04A 1HPZA 3AVJA 3ZSVA 2PYJA 3SUOA 4LY7A 2KFNA 1IO2A 4CHOA 3NHGA 3TAGA 1N5YA 4DTOA 3BGRA 3EYZA 3SUQA 4AHUA 1TGOA 1VRUA 3SQ2A 3ZSQA 4EZ6A 3I8DA 2G8IA 3HK2A 1QQCA 1KSPA 4CF1A 2GV9A 1RT5A 3AVKA 4CF2A 4BDPA 1BQMA 4IKFA 2DY4A 1HYVA 4EP4A 1WSEA 3DMJA 4ID5A 4ZHRA 1VSDA 2XY8A 4NCBA 1MU2A 1NK0A 3DYAA 2FBYA 4GMJB 4LH5A 1T03A 1QSLA 1J53A 3TAEA 3OYAA 3HL8A 1JXEA 1S1VA 2B6AA 2EX3A 1X1PA 4KREA 2DTUA 2YNIA 3QEPA 1WAJA 1FKOA 2KQ2A 3VQ6A 4LSLA 5T7BA 5SZTA 3SJJA 1KCFA 2JGUA 3AVFA 3LWMA 3WNFA 4W5RA 1SL2A 3PY8A 3LPUA 2Y1JA 4FJLA 1C6VA 3UIQA 4E7LA 2E6LA 2KZMA 1RBTA 1JLBA 3ZSOA 1ZYQA 3NBPA 5CYQA 3IG1A 2VG7A 4ELVA 3RRGA 1C1BA 3AVAA 3VQCA 1TK5A 3ULDA 4FW1A 1NJYA 3KTQA 4OVLA 2ATQA 4FLUA 4JS4A 2GBZA 2OZMA 1JLEA 3HO1A 1S6PA 1ASWA 1UWBA 1KFSA 3D45A 1DLOA 4Y1CA 4Z4FA 4E3SA 5FROA 4Z4EA 3CM5A 1LWFA 2WONA 1RT2A 1JLFA 2QK9A 3V1RA 2QKKA 4FJGA 3M8PA 4FLXA 4RW8A 4DS4A 1VSKA 2A1SA 3ZT0A 1LV5A 4DQPA 1VSMA 3RR8A 3NF7A 4HTUA 1CXUA 1GOAA 1GOBA 3NF6A 4DMNA 2HW3A 2HNYA 3ALYA 4DSLA 4J2BA 2I5JA 4WE1A 3HXMA 3VQBA 4DTPA 4DTSA 3SNNA 4KHYA 3ZSRA 4BWMA 1NKCA 5KRTA 3T19A 1RTDA 2OPPA 3KIOA 4FVMA 2HNZA 3NGYA 4FM2A 1HYSA 3KLIA 2BGGA 4N56A 4E7JA 3AV9A 3PV8A 4QAGA 1Y97A 4KTWA 3ZSYA 3PUFA 5HRPA 1B9DA 2Z1HA 1SV5A 4KO0A 4RG8A 1I3AA 1YT3A 4CJVA 3V81A 1XHZA 3LZIA 2YHAA 4CEEA 3P83D 4FLZA 2XY7A 3TAPA 4W5QA 4KHQA 3T1AA 5HLFA 4FJ9A 4F4KA 3AO4A 3OYNA 4CIGA 1FK9A 1TL3A 4CFAA 4F8RA 3DLGA 1EP4A 2BANA 4H4OA 3PX0A 1NKBA 2PYLA 4E7KA 4K8XA 1QHTA 1RBSA 4KTZA 4BE2A 4DS5A 1C1CA 1VRTA 4CGJA 4CJQA 2OYQA 4Z4IA 4HUFA 1HNIA 1U49A 3LP2A 1VSIA 3CYMA 3VQ7A 3TAFA 4CERA 2A1RA 4ICLA 2PY5A 5HRNA 3PO5A 3KLFA 1LWEA 4FJNA 5C25A 3ZSXA 4CEFA 4CGDA 3OYGA 3S3MA 1JLAA 4AHRA 3L2RA 3KK3A 4O4GA 4CJ4A 2YKNA 4CEBA 4Z4HA 4FM1A 4DU4A 1QSYA 3F9KA 3CFPA 1RDAA 2RPIA 3LP1A 1UAXA 4CJSA 3ZT2A 3SYZA 2YNHA 5HRSA 3NH1A 1ZBUA 4C8KA 4I2QA 3WNHA 3ZT3A 5KRSA 3L8BA 2G8UA 4DU3A 4TSXA 3OYKA 4N47A 1KTQA 3ZT1A 3THVA 4KI6A 1IH7A 3JSMA 1RT4A 3K59A 3AA5X 4PWDA 4KHNA 4JRPA 2KTQA 2QKBA 3K5OA 4FM0A 4CJLA 1Z25A 1D9FA 1TAUA 4IG3A 1YTUA 1A5WA 1NOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KI6 A;  3DOK A;  4GW6 A;  2F8S A;  2ITG A;  4I2P A;  3OS1 A;  2HHX A;  1I39 A;  4C8M A;  3RMC A;  4B08 A;  1XC9 A;  3M8R A;  1S1T A;  3LAM A;  1BHL A;  4CJE A;  3LAK A;  4CED A;  3PX4 A;  1RBR A;  1SL1 A;  2G8K A;  3V4I A;  4I9Q A;  3VQE A;  4CJW A;  1KFD A;  3OYM A;  1X9W A;  4RW6 A;  1HNV A;  4DSF A;  4DSK A;  4FJJ A;  4IG0 A;  3SZ2 A;  5J1E A;  1HQE A;  2QXF A;  1NJZ A;  1BI4 A;  4PUO A;  4KB1 A;  3O3F A;  3SCX A;  1ASV A;  1S1W A;  3OJS A;  5J2N A;  4N76 A;  3MXM A;  1GOC A;  1L5U A;  3VQ5 A;  1RDB A;  2DFE A;  3L2U A;  1RBU A;  3OY9 A;  3DOL A;  3HVR A;  3IAY A;  3O4N A;  1WLJ A;  2W42 A;  3DRR A;  2P1J A;  3AVH A;  1TKT A;  4OPK A;  4CFB A;  2FBX A;  3L3V A;  3QEX A;  1TK8 A;  1RBV A;  5HBM A;  1BL3 A;  3HVT A;  3ZT4 A;  1NK5 A;  1EKE A;  3C6T A;  4OJR A;  4DWI A;  5J2M A;  3DM2 A;  1TK0 A;  3NCI A;  3U6F A;  1BCM A;  4OKJ A;  3QET A;  1LAW A;  3U3G A;  3KJV A;  4OPJ A;  4KHS A;  4H4M A;  4F2R A;  4UQG A;  4KPY A;  4NCG A;  4AH9 A;  4J2E A;  3RMA A;  3NH0 A;  3RR7 A;  1F21 A;  4FYD A;  1QSS A;  4FW2 A;  3OYH A;  3OYC A;  2ZD1 A;  3DLR A;  1A5V A;  4MFB A;  4CJK A;  1NOY A;  4KAZ A;  4B9N A;  3HPH A;  4I7F A;  1XI1 A;  3HM9 A;  4M3Y A;  5HP1 A;  3MED A;  4CF0 A;  1Q9X A;  5JS1 A;  3LWL A;  4IBN A;  4KHU A;  2IAJ A;  3WNG A;  1RTI A;  2HND A;  4FJK A;  3NAE A;  2HHQ A;  4CK3 A;  3OYD A;  3KK1 A;  3L2Q A;  4KI4 A;  4DFK A;  3NGI A;  4E0D A;  1KVB A;  2F8T A;  3QER A;  3CM6 A;  3CFR A;  3SI6 A;  1RTJ A;  4M45 A;  1B9F A;  4BDZ A;  4LH4 A;  3QNO A;  1NK9 A;  1Q8I A;  3RWU A;  1HJR A;  1W9H A;  4E1N A;  2XRI A;  3DLK A;  1ITG A;  4KHW A;  1BIZ A;  2VG6 A;  3VQP A;  3OYL A;  1RDC A;  3VA3 A;  4CEO A;  3TR8 A;  2VG5 A;  3RTV A;  1WSI A;  2P51 A;  1EET A;  5K14 A;  4JRQ A;  1S1U A;  3OYB A;  4MQ3 A;  2EHG A;  3KLE A;  1NJW A;  4DTM A;  1BCO A;  3TAB A;  2NUB A;  3DRS A;  4OKK A;  3O3G A;  4Z0U A;  4I9L A;  4CIE A;  4CJU A;  1IG9 A;  5D3G A;  4AHT A;  1JXB A;  1FKP A;  3RRH A;  3I0R A;  3F73 A;  3QNN A;  1WSH A;  4JS5 A;  4LD0 A;  5DMR A;  1NKE A;  4CHN A;  2IS3 A;  3K57 A;  5FRN A;  1BGX T;  3EY1 A;  1KVA A;  4CFC A;  2OPR A;  1X9S A;  3VN5 A;  2FBV A;  4FXD A;  4RW7 A;  4CHZ A;  3OYJ A;  1SKR A;  1WSF A;  5J2P A;  2HHS A;  1L3V A;  4B9U A;  1ZBL A;  1IKY A;  2Z1J A;  3S3N A;  4IFV A;  2VWK A;  1CZ9 A;  2FC0 A;  2X6S A;  4DQS A;  4CEA A;  1BQN A;  3SQ4 A;  1U4B A;  1RDD A;  3AVC A;  4M42 A;  1JLC A;  1TVR A;  1SL0 A;  3NH2 A;  2OPS A;  1TKD A;  4M3Z A;  1ZBH A;  1NK6 A;  3MAQ A;  3NFA A;  2E6M A;  1Q9Y A;  3MEC A;  1S9G A;  3QIP A;  4BDY A;  4PY5 A;  1QE1 A;  3CFO A;  1D9D A;  4CES A;  2IC3 A;  3ASM A;  2XY5 A;  4W5N A;  4E7H A;  3V6D A;  3QIN A;  1LW0 A;  1TKX A;  2FBT A;  4CHY A;  4DF8 A;  5CZ1 A;  3AO1 A;  3K5M A;  3MXI A;  3AO2 A;  4KV8 A;  3V9W A;  4F2S A;  4B9S A;  4OLB A;  4HVJ A;  5J2Q A;  3HYF A;  3VQD A;  2X78 A;  3SQ1 A;  3NF9 A;  2F96 A;  3KKR A;  4EZ9 A;  1CXQ A;  1RT7 A;  3K5N A;  4OKE A;  3T3F A;  3VQ4 A;  3QEI A;  3SUN A;  1JL1 A;  4FLY A;  4DFM A;  4C8N A;  4FJ7 A;  4XIU A;  4LSN A;  2YKM A;  1QS4 A;  3S3O A;  1L3U A;  2DFF A;  4KFB A;  4FJ5 A;  4DSE A;  1SKS A;  3AVI A;  3LP0 A;  1TL1 A;  3V1Q A;  2HB5 A;  3MEG A;  4YNQ A;  4AHV A;  2XY6 A;  1N6Q A;  3OYE A;  2IOC A;  3QO9 A;  4H8K A;  4CGG A;  3L2W A;  3ITH A;  1VSJ A;  3OVN A;  3EZ5 A;  3TAN A;  4CIF A;  5I42 A;  3QEW A;  4C8L A;  3C94 A;  1IKV A;  5FDL A;  1TAQ A;  1U47 A;  3SPY A;  4R5P A;  4O0J A;  2HHW A;  4CGH A;  4DTU A;  2BDP A;  4CF8 A;  2PZS A;  2KW4 A;  1ASU A;  2O4G A;  5CY4 A;  1FXX A;  5SWM A;  4FK0 A;  2JLE A;  4L8R B;  3V9Z A;  5KGW A;  2D0B A;  1RT1 A;  3WNE A;  4FZX C;  1S9E A;  4CEZ A;  1L3S A;  4BWJ A;  1RT3 A;  4RW9 A;  3LDS A;  3SV4 A;  4F3T A;  3VQ8 A;  1QTM A;  4CJF A;  1S1X A;  3AA3 A;  4AHS A;  2B4J A;  1NK7 A;  1UA0 A;  1VSF A;  1KLM A;  3SQ0 A;  2P5G A;  3V9X A;  4AIL C;  3VQA A;  2VWJ A;  1BIS A;  5EU7 A;  4CJT A;  4YFU A;  4W5T A;  1KRP A;  1XWL A;  4NYF A;  3NDK A;  3G10 A;  4FCY A;  4DQQ A;  4DQR A;  3BDP A;  3HJF A;  4IFY A;  1WSJ A;  4F3O A;  4EP5 A;  1CLQ A;  4ZTJ A;  4BE0 A;  2B5J A;  4CEQ A;  4RW4 A;  1TV6 A;  2RN2 A;  1J9A A;  1DTT A;  3C95 A;  2X6N A;  1YTA A;  3L3U A;  2WOM A;  3OYI A;  4JLH A;  3A2F A;  3DLE A;  1ZBI A;  1LW2 A;  1UOC A;  3HST B;  4FK2 A;  4N5S A;  2AJQ A;  3KKS A;  4B3O A;  3HP9 A;  3O3H A;  2R7Y A;  2HMI A;  4DSJ A;  2Q3S A;  4FZY A;  4KTQ A;  3M8S A;  1CZB A;  3PX6 A;  4J2A A;  1T7P A;  3LAL A;  4DU1 A;  2IGI A;  2G8W A;  4CCH A;  4FJM A;  3TAR A;  4FJH A;  4M3W A;  4DG1 A;  1VSE A;  3IS9 A;  1NJX A;  4CGI A;  2ZE2 A;  3G0Z A;  3MEE A;  3KK2 A;  3H08 A;  1SKW A;  4E1M A;  3KD5 E;  4FK4 A;  5HRO A;  3HPG A;  4O5B A;  2X74 A;  4W5O A;  4HCB A;  1J5O A;  2YNG A;  3VQQ A;  3PO4 A;  4HCC A;  5C24 A;  3ZSW A;  4OGC A;  3NE6 A;  4C8O A;  1EXQ A;  1HMV A;  1S6Q A;  3SUP A;  3U3Y A;  4FJ8 A;  3QES A;  4FZZ A;  2G8F A;  1J54 A;  2BE2 A;  1KVC A;  1HYZ A;  3M8Q A;  4E89 A;  1TKZ A;  4K8Z A;  4B9V A;  5HRR A;  2IDO A;  2XHB A;  4B9M A;  3DRP A;  2Z1I A;  2E4L A;  4M41 A;  3AO3 A;  3QIO A;  5CZ2 A;  3V9S A;  4DF4 A;  2G8H A;  3P1G A;  2GUI A;  4IDK A;  3ISN C;  3B6O A;  3DI6 A;  2DFH A;  2D0A A;  3RMB A;  4Z4G A;  4DTJ A;  1IKW A;  4ZTF A;  1A5X A;  3DLH A;  3B6P A;  4B8A B;  1D8Y A;  4M3R A;  3OYF A;  3S9H A;  2OA8 A;  1WAF A;  4ELT A;  4J2D A;  3SPZ A;  3O4Q A;  1L3T A;  5DK5 A;  4O0I A;  3RMD A;  2YHB A;  1JL2 A;  1REV A;  4CF9 A;  5C42 A;  4FJX A;  4BE1 A;  2ZQB A;  4KRF A;  4CGF A;  3MXJ A;  5CYM A;  1LAV A;  2LSN A;  3NF8 A;  3IRX A;  3L2V A;  2HHU A;  1JKH A;  1ZBF A;  1VSH A;  3D0P A;  3TI0 A;  3AVL A;  3LP3 A;  1X9M A;  3AVG A;  4E7I A;  4QOZ B;  1RCH A;  4CK1 A;  5E41 A;  3SV3 A;  3K58 A;  3LPT A;  1C0U A;  1WN7 A;  4AHC A;  4DLE A;  1RIL A;  1JLG A;  3ZCM A;  3OJU A;  1B92 A;  2G8V A;  1O1W A;  1Z26 A;  2D0C A;  4G1Q A;  3VQ9 A;  4DTX A;  3TAQ A;  4OLA A;  3HPO A;  1S5J A;  3TAM A;  1U45 A;  4ELU A;  2HHV A;  4Z4C A;  2KZZ A;  3OS2 A;  4KB0 A;  3JYT A;  2OZS A;  3TWH A;  3C6U A;  1C1A A;  1XHX A;  3K2P A;  4B9T A;  2P5O A;  2RKI A;  4OGE A;  4CHQ A;  4DFP A;  1WSG A;  4O44 A;  4DSI A;  1G15 A;  1C0T A;  1RTH A;  1W0H A;  3KLG A;  4CHP A;  3FFI A;  1T8E A;  2D5R A;  4B8C A;  1VK0 A;  4HUG A;  3P5J A;  4CJP A;  1D5A A;  1LWC A;  4DLG A;  4CJ5 A;  4BAC A;  5I3U A;  4NCA A;  4M3X A;  1NK4 A;  4Q5V A;  1T05 A;  4DTR A;  4DFJ A;  3K5L A;  2YNF A;  1IKX A;  2HHT A;  4M3T A;  3CQ8 A;  1WNS A;  4M3U A;  3AVN A;  3HT3 A;  1RNH A;  3KLH A;  1DTQ A;  4CFD A;  4FLW A;  1KLN A;  4PA1 A;  4CJ3 A;  4DQI A;  1RT6 A;  3NGZ A;  3VA0 A;  1C0M A;  4FLV A;  2Y1I A;  4KKO A;  2OPQ A;  1BI4 B;  1SUQ A;  4E19 A;  1JLQ A;  5KTQ A;  2O4I A;  1K6Y A;  1VSL A;  3AVM A;  4B9L A;  3AA2 A;  3AA4 A;  3DLB A;  4CE9 A;  4HHT A;  4DTN A;  1HRH A;  3HP6 A;  4Y1D A;  3AO5 A;  4FLT A;  4QCL A;  2YV0 X;  2XO7 A;  2RF2 A;  2KFZ A;  4NYN A;  3I0S A;  1YVU A;  4CEC A;  2HVI A;  1EX4 A;  4Q0B A;  3CG7 A;  2ETJ A;  4N41 A;  3E01 A;  4CK2 A;  1UA1 A;  4GVM A;  4HUE A;  1HQU A;  1R0A A;  3AVB A;  4CJR A;  1NK8 A;  3QEV A;  4PQU A;  4ID1 A;  3OS0 A;  2HVH A;  4FJI A;  3KD1 E;  3ZSZ A;  4O55 A;  5JS2 A;  3LZJ A;  3V1O A;  5FRM A;  2Z1G A;  3QLH A;  1U48 A;  1BIU A;  5KGX A;  3LAN A;  3V9U A;  1U04 A;  1HPZ A;  3AVJ A;  3ZSV A;  2PYJ A;  3SUO A;  4LY7 A;  2KFN A;  1IO2 A;  4CHO A;  3NHG A;  3TAG A;  1N5Y A;  4DTO A;  3BGR A;  3EYZ A;  3SUQ A;  4AHU A;  1TGO A;  1VRU A;  3SQ2 A;  3ZSQ A;  4EZ6 A;  3I8D A;  2G8I A;  3HK2 A;  1QQC A;  1KSP A;  4CF1 A;  2GV9 A;  1RT5 A;  3AVK A;  4CF2 A;  4BDP A;  1BQM A;  4IKF A;  2DY4 A;  1HYV A;  4EP4 A;  1WSE A;  3DMJ A;  4ID5 A;  4ZHR A;  1VSD A;  2XY8 A;  4NCB A;  1MU2 A;  1NK0 A;  3DYA A;  2FBY A;  4GMJ B;  4LH5 A;  1T03 A;  1QSL A;  1J53 A;  3TAE A;  3OYA A;  3HL8 A;  1JXE A;  1S1V A;  2B6A A;  2EX3 A;  1X1P A;  4KRE A;  2DTU A;  2YNI A;  3QEP A;  1WAJ A;  1FKO A;  2KQ2 A;  3VQ6 A;  4LSL A;  5T7B A;  5SZT A;  3SJJ A;  1KCF A;  2JGU A;  3AVF A;  3LWM A;  3WNF A;  4W5R A;  1SL2 A;  3PY8 A;  3LPU A;  2Y1J A;  4FJL A;  1C6V A;  3UIQ A;  4E7L A;  2E6L A;  2KZM A;  1RBT A;  1JLB A;  3ZSO A;  1ZYQ A;  3NBP A;  5CYQ A;  3IG1 A;  2VG7 A;  4ELV A;  3RRG A;  1C1B A;  3AVA A;  3VQC A;  1TK5 A;  3ULD A;  4FW1 A;  1NJY A;  3KTQ A;  4OVL A;  2ATQ A;  4FLU A;  4JS4 A;  2GBZ A;  2OZM A;  1JLE A;  3HO1 A;  1S6P A;  1ASW A;  1UWB A;  1KFS A;  3D45 A;  1DLO A;  4Y1C A;  4Z4F A;  4E3S A;  5FRO A;  4Z4E A;  3CM5 A;  1LWF A;  2WON A;  1RT2 A;  1JLF A;  2QK9 A;  3V1R A;  2QKK A;  4FJG A;  3M8P A;  4FLX A;  4RW8 A;  4DS4 A;  1VSK A;  2A1S A;  3ZT0 A;  1LV5 A;  4DQP A;  1VSM A;  3RR8 A;  3NF7 A;  4HTU A;  1CXU A;  1GOA A;  1GOB A;  3NF6 A;  4DMN A;  2HW3 A;  2HNY A;  3ALY A;  4DSL A;  4J2B A;  2I5J A;  4WE1 A;  3HXM A;  3VQB A;  4DTP A;  4DTS A;  3SNN A;  4KHY A;  3ZSR A;  4BWM A;  1NKC A;  5KRT A;  3T19 A;  1RTD A;  2OPP A;  3KIO A;  4FVM A;  2HNZ A;  3NGY A;  4FM2 A;  1HYS A;  3KLI A;  2BGG A;  4N56 A;  4E7J A;  3AV9 A;  3PV8 A;  4QAG A;  1Y97 A;  4KTW A;  3ZSY A;  3PUF A;  5HRP A;  1B9D A;  2Z1H A;  1SV5 A;  4KO0 A;  4RG8 A;  1I3A A;  1YT3 A;  4CJV A;  3V81 A;  1XHZ A;  3LZI A;  2YHA A;  4CEE A;  3P83 D;  4FLZ A;  2XY7 A;  3TAP A;  4W5Q A;  4KHQ A;  3T1A A;  5HLF A;  4FJ9 A;  4F4K A;  3AO4 A;  3OYN A;  4CIG A;  1FK9 A;  1TL3 A;  4CFA A;  4F8R A;  3DLG A;  1EP4 A;  2BAN A;  4H4O A;  3PX0 A;  1NKB A;  2PYL A;  4E7K A;  4K8X A;  1QHT A;  1RBS A;  4KTZ A;  4BE2 A;  4DS5 A;  1C1C A;  1VRT A;  4CGJ A;  4CJQ A;  2OYQ A;  4Z4I A;  4HUF A;  1HNI A;  1U49 A;  3LP2 A;  1VSI A;  3CYM A;  3VQ7 A;  3TAF A;  4CER A;  2A1R A;  4ICL A;  2PY5 A;  5HRN A;  3PO5 A;  3KLF A;  1LWE A;  4FJN A;  5C25 A;  3ZSX A;  4CEF A;  4CGD A;  3OYG A;  3S3M A;  1JLA A;  4AHR A;  3L2R A;  3KK3 A;  4O4G A;  4CJ4 A;  2YKN A;  4CEB A;  4Z4H A;  4FM1 A;  4DU4 A;  1QSY A;  3F9K A;  3CFP A;  1RDA A;  2RPI A;  3LP1 A;  1UAX A;  4CJS A;  3ZT2 A;  3SYZ A;  2YNH A;  5HRS A;  3NH1 A;  1ZBU A;  4C8K A;  4I2Q A;  3WNH A;  3ZT3 A;  5KRS A;  3L8B A;  2G8U A;  4DU3 A;  4TSX A;  3OYK A;  4N47 A;  1KTQ A;  3ZT1 A;  3THV A;  4KI6 A;  1IH7 A;  3JSM A;  1RT4 A;  3K59 A;  3AA5 X;  4PWD A;  4KHN A;  4JRP A;  2KTQ A;  2QKB A;  3K5O A;  4FM0 A;  4CJL A;  1Z25 A;  1D9F A;  1TAU A;  4IG3 A;  1YTU A;  1A5W A;  1NOZ A; 
#chains in the Genus database with same CATH topology
 3DOK A;  3THY B;  1BHL A;  3PX4 A;  2PBD A;  1GLL O;  1NMN A;  3VQE A;  5AZI B;  1X9W A;  3WXI A;  4DSK A;  1HNV A;  3THX B;  1NJZ A;  1BI4 A;  4JKH A;  4LF7 K;  4WCE L;  5B8H A;  4BRG A;  3L2U A;  4GV6 A;  1RBU A;  3HVR A;  2W42 A;  3DRR A;  2P1J A;  1BU6 O;  1TK8 A;  5HBM A;  2P9N A;  1YXQ A;  1NK5 A;  3C6T A;  4JNE A;  2D0P A;  3M1F A;  3HOT A;  3QET A;  1LAW A;  1QZ6 A;  3KJV A;  3DXM A;  1QHA A;  4ISF A;  1F21 A;  1IG8 A;  4FW2 A;  3UE5 A;  3P38 A;  3OYH A;  1U2V A;  5IT9 O;  1A5V A;  2FSJ A;  4GV9 A;  5LMU K;  2V52 B;  3HM9 A;  4DV7 K;  4M3Y A;  4CF0 A;  4IBN A;  4BG8 A;  2HHQ A;  2E2P A;  2HND A;  4BGB A;  2KHO A;  4CK3 A;  4KI4 A;  4DFK A;  4A2A A;  3WQT A;  3QER A;  2F8T A;  1ATR A;  4IEE A;  4M45 A;  4BDZ A;  1SS6 A;  2WFB A;  3DLK A;  2VGN A;  3CCR N;  1BIZ A;  5EX5 A;  1RDC A;  3VA3 A;  2CGK A;  1KAX A;  3TR8 A;  3SAG A;  1WSI A;  1RDW X;  4MQ3 A;  4CZH A;  2QA4 N;  3O3G A;  4OKK A;  1YI2 N;  1FKP A;  1NGG A;  1WSH A;  1GLJ O;  2IS3 A;  5AQL A;  1BGX T;  5ELZ A;  1X9S A;  5FPM A;  3VN5 A;  3OYJ A;  1L3V A;  3S3N A;  2Q0R A;  1U4B A;  4DQS A;  4M42 A;  3AVC A;  1SL0 A;  4B9Q A;  2UXC K;  2QEX N;  2E6M A;  4V19 S;  3QFP A;  4DR3 K;  4J8F A;  2GX9 A;  2V7Y A;  2IC3 A;  3DAW A;  3QIN A;  1LW0 A;  3CQX A;  5LMN K;  4JN4 A;  3A5N C;  3HYF A;  3VQD A;  4DV1 K;  4OKE A;  5AZJ A;  3T3F A;  4CZF A;  4FJ7 A;  4FLY A;  4NO7 A;  4C8N A;  4LSN A;  2YKM A;  4CJ7 A;  3MCP A;  4FJ5 A;  1SQK A;  4YNQ A;  2HB5 A;  4IO8 A;  3QO9 A;  4X66 K;  4JHD A;  4CZK A;  4F9O A;  4CIF A;  4NB4 A;  3TTC A;  5I42 A;  4C8L A;  3NMU A;  5KQ8 A;  1TAQ A;  4R5P A;  3ULE A;  3FFK B;  1ZC6 A;  4BRA A;  2PZS A;  3PSF A;  1YUW A;  3R6M A;  5FPD A;  2O4G A;  4FK0 A;  3MX2 A;  3V9Z A;  5KGW A;  4MLE A;  2O8D A;  2EWS A;  1RT1 A;  3WNE A;  4BRC A;  3K9K A;  4OPA A;  3I56 N;  4RW9 A;  3SV4 A;  3F9M A;  1QTM A;  1NK7 A;  1VAZ A;  4YOX A;  1QQM A;  3VET A;  5FLX O;  3NDK A;  2HHV A;  4DQR A;  3EKU A;  2P9L B;  2RE2 A;  4F3O A;  3D2E B;  3PLA A;  2WC9 A;  4ZTJ A;  1KQS M;  2P9K B;  1TV6 A;  3CCJ N;  2AP1 A;  2X6N A;  2WOM A;  3ENO A;  3OYI A;  3CCS N;  1ZBI A;  1MDU B;  4FK2 A;  4NLB A;  2PFU A;  3U9Z A;  4CZM A;  3O8M A;  2QWO A;  3O3H A;  2R7Y A;  4J2A A;  5AQU A;  4M3W A;  4FJH A;  5LJW A;  1SKW A;  3O9S A;  1KAY A;  2E8A A;  4E1M A;  5DM7 L;  1E4F T;  3L4Q A;  3HPG A;  4X64 K;  3QBX A;  4HCB A;  1WBD A;  2YNG A;  3ZSW A;  2ASP A;  1S6Q A;  3U3Y A;  1RFQ A;  3FZM A;  2NZT A;  2BE2 A;  1HYZ A;  4E89 A;  2ZGZ A;  3KK7 A;  4ILH A;  2XHB A;  2Z1I A;  4M41 A;  3AO3 A;  5ADX A;  3IMX A;  4DF4 A;  2GUI A;  3B6O A;  2DFH A;  4DTJ A;  3VEY A;  4H5N A;  4B3M K;  3B6P A;  5CR4 A;  1WAF A;  4C23 A;  4O0I A;  2YHB A;  3KVG A;  4FJX A;  4K42 A;  1NG9 A;  1ZBF A;  1VSH A;  3AVL A;  3CJC A;  2ASM A;  3L6Q A;  5E41 A;  3SV3 A;  1S72 N;  5KPT A;  3LPT A;  4DLE A;  4AHC A;  3SMS A;  1RIL A;  1LCU A;  1W97 L;  3ZCM A;  4FWS A;  3TSQ A;  1Z26 A;  2A6A A;  4DTX A;  3TAQ A;  3TAM A;  2KZZ A;  1Z05 A;  3GDQ A;  3C6U A;  5EY4 A;  2A42 A;  4IJN A;  2RKI A;  2VYP A;  3EZW A;  4O44 A;  4DSI A;  1G15 A;  1M1K O;  1W0H A;  4BC5 A;  3VF4 A;  3WXL A;  3P5J A;  4FWP A;  4DLG A;  4PKH A;  4CJ5 A;  4K43 A;  2IVP A;  4BAC A;  3MCA B;  3O6W A;  4BR0 A;  4MO4 A;  1WNS A;  2VWB A;  2FSK A;  2J4R A;  1RNH A;  3SJH A;  4CFD A;  4FLW A;  4DR6 K;  4H5W A;  4DQI A;  3H3N O;  3A8Y A;  3HOS A;  4FSV A;  4E19 A;  1JLQ A;  2O4I A;  1K6Y A;  4DTN A;  3DJC A;  1HRH A;  3VEW A;  5GIO A;  4FLT A;  4GV3 A;  2KFZ A;  2GEL A;  2D1K A;  2CGL A;  2ETJ A;  3CG7 A;  3E01 A;  1UA1 A;  1Q81 O;  2RHK A;  2P9I A;  4ID1 A;  3THW A;  3ZSZ A;  3LZJ A;  1R59 O;  3V1O A;  3CXC M;  3BP8 A;  3Q7C A;  3KHY A;  2VQF K;  3ATV A;  1IO2 A;  4CHO A;  3NHG A;  3TAG A;  4YOT A;  3G6E N;  3SQ2 A;  1VRU A;  2G8I A;  4EZ6 A;  3D7E O;  1QQC A;  3HZ6 A;  1KSP A;  1T44 A;  2GUP A;  3OTO K;  1RT5 A;  3BF1 A;  2Q97 A;  1BQM A;  4IKF A;  1MWM A;  3CI5 A;  3DMJ A;  3T7Z A;  2O8B A;  2QXL A;  1NK0 A;  4GMJ B;  2FBY A;  1QSL A;  3TAE A;  3BY5 A;  3QEP A;  4B3S K;  1GLC G;  3MN7 A;  3LPU A;  2Y1J A;  4FJL A;  1C6V A;  3UIQ A;  2E6L A;  4PL7 A;  3R8E A;  2VG7 A;  3O4W A;  1C1B A;  3AVA A;  3VQC A;  1VQ6 N;  2QWR A;  4OPH A;  4WQ4 A;  4JS4 A;  2GBZ A;  4IFE A;  3HO1 A;  1KFS A;  1NBW A;  3M3Z A;  3T1Y K;  3E9O A;  3LM2 A;  4FJG A;  4FLX A;  3DWL A;  3LDL A;  3ZT0 A;  1LV5 A;  1VSM A;  1ATN A;  1GOA A;  2ASO A;  1N32 K;  1OKJ A;  4DSL A;  5JVG L;  3R9P A;  5ADX H;  1JJ2 M;  3VQB A;  4H5T A;  1NKC A;  3T19 A;  1N8R O;  4CZE A;  5JLF A;  2HNZ A;  5AQJ A;  3KLI A;  1JCG A;  3H45 C;  1HJO A;  3H1V X;  4KO0 A;  5GAH P;  4WFN L;  2CGJ A;  1YT3 A;  3WXK A;  2XY7 A;  3VEV A;  1X9J A;  4GNI A;  4JKG A;  3OYN A;  4CIG A;  1FK9 A;  3UKR B;  1HKC A;  3DLG A;  2P9U B;  1EP4 A;  4IOX A;  1NKB A;  3G71 N;  3CJB A;  1RBS A;  4IEI A;  4BE2 A;  1XMO K;  2F7T A;  3LDQ A;  1KD1 O;  1HNI A;  5GAG P;  1VSI A;  4BRM A;  4ICL A;  3LM9 A;  3JAM O;  4FJN A;  3ZSX A;  1O13 A;  4CEF A;  3OYG A;  3PSI A;  2UUC K;  1JLA A;  4O4G A;  1NGC A;  2JWK A;  1QSY A;  2RPI A;  5JLH A;  4CJS A;  3ZT2 A;  3SYZ A;  4YY3 K;  4AM7 A;  5HRS A;  4I2Q A;  3WNH A;  4DU3 A;  3OYK A;  1RT4 A;  3AA5 X;  3ZET A;  4PWD A;  2KTQ A;  3I33 A;  3K5O A;  4FM0 A;  1D9F A;  3CC7 N;  1KAZ A;  2KLA A;  1NOZ A;  4MO5 A;  4BRN A;  4DKW A;  4GW6 A;  4BRE A;  3OS1 A;  3RMC A;  4MDB A;  3J7Z O;  3M8R A;  4CJE A;  1RBR A;  2A5X A;  3MDQ A;  3VES A;  4CJW A;  1KFD A;  3K9J A;  3CCQ N;  2O8C A;  4PUO A;  3O3F A;  1HKB A;  2YX6 A;  3OJS A;  5J2N A;  3MXM A;  1L5U A;  2DFE A;  3OY9 A;  1VQ5 N;  3O4N A;  1WLJ A;  3H6E A;  1TKT A;  4XH4 A;  4OPK A;  4QS7 A;  1N33 K;  3ZT4 A;  1KC8 O;  1Q82 O;  1EKE A;  4JKA A;  4GKK K;  5J2M A;  3DM2 A;  4IZ9 A;  4YDU A;  4OPJ A;  4F2R A;  4UQG A;  4B3T K;  2E1Z A;  5C0Y A;  3NH0 A;  5E84 A;  4EIA A;  3RR7 A;  4FYD A;  1U6Z A;  1OVY A;  4I6M A;  1QSS A;  3N4Q A;  3OYC A;  2ZD1 A;  1NOY A;  4MFB A;  4KAZ A;  2W41 A;  1W7A A;  1EO1 A;  3O08 A;  4DV3 K;  3GBT A;  3MED A;  5HP1 A;  3LWL A;  4KHU A;  4LC9 B;  3WNG A;  3NAE A;  3OYD A;  4GKJ K;  1X3N A;  3NGI A;  2PAV A;  2HST A;  1VQ8 N;  1B9F A;  3QNO A;  1NK9 A;  2E88 A;  1HJR A;  1Q86 O;  1GLD G;  4U67 L;  4LF9 K;  3T69 A;  3O9U A;  5A2Q O;  4JI1 K;  5BRE A;  4JRQ A;  1ZXO A;  3KLE A;  3TAB A;  4DV6 K;  3DRS A;  4I9L A;  4AHT A;  5LJV A;  1JCE A;  4YOU A;  3RRH A;  3QNN A;  4WQ4 C;  3C65 A;  3K57 A;  3J7Y P;  3EY1 A;  2P9S B;  4FXD A;  2ZGY A;  4CHZ A;  5MLC Q;  1SKR A;  1WSF A;  5J2P A;  2HHS A;  3ZX0 A;  1IKY A;  3D2F A;  5BRD A;  2FC0 A;  2X6S A;  4X65 K;  4AM6 A;  3H3O B;  2W6K A;  4L3Q A;  3ZYY X;  1NMD A;  1S9G A;  3QIP A;  3I55 N;  1NGA A;  2P9P A;  4CW7 B;  2FLO A;  4M7Y A;  4K0K K;  1K8A O;  5CZ1 A;  3AO1 A;  3AO2 A;  3V9W A;  4F2S A;  4HVJ A;  1RGI A;  2X78 A;  3NF9 A;  2VGM A;  5AQP A;  1CXQ A;  1RT7 A;  3K5N A;  4NXN K;  1YVN A;  5LL6 Z;  3K0S A;  3QEI A;  4DFM A;  4HWI A;  1YHQ N;  1P8Z A;  3O1B A;  3S3O A;  3JS6 A;  1TL1 A;  1Q9X A;  3EE9 A;  2XY6 A;  4AHV A;  2IOC A;  4H8K A;  1NM1 A;  3OVN A;  4UY8 O;  3QEW A;  1XNQ K;  3FGU A;  3R1X A;  4O0J A;  2BDP A;  5BPN A;  4CF8 A;  4DQ8 A;  2KW4 A;  2NRR A;  1FXX A;  5SWM A;  5BRF A;  2D0B A;  1L3S A;  3U8X A;  3JXU A;  1K8K A;  1KLM A;  3VF6 A;  3V9X A;  4AIL C;  2ZWH A;  2VWJ A;  3GL1 A;  1KRP A;  4CJT A;  4YFU A;  4NYF A;  5C12 A;  5CHI A;  4DQQ A;  3BDP A;  3IFR A;  3C7N B;  1WSJ A;  1QZ5 A;  1SZ2 A;  1C0G A;  5AQO A;  1J9A A;  2RN2 A;  1DTT A;  1YTA A;  5TKY A;  4DR1 K;  4WF9 L;  3A2F A;  1UOC A;  1LW2 A;  3HST B;  3RSE A;  1GLA G;  3M6G A;  4N5S A;  3CCE N;  3SBT A;  4OX9 K;  3MN9 A;  1VQP N;  3KKS A;  4B3O A;  3HP9 A;  1GLB G;  2V51 B;  5FPN A;  3THY A;  4DSJ A;  4FZY A;  3M8S A;  4DU1 A;  3TAR A;  5AZI A;  1VSE A;  3AY9 A;  1D4X A;  4CGI A;  3THX A;  4FK4 A;  4BR5 A;  4O5B A;  2X74 A;  4W5O A;  4LF4 K;  4PHT X;  5C24 A;  2A41 A;  1TKZ A;  4YDU C;  4K8Z A;  1P90 A;  5HRR A;  2IDO A;  1IBK K;  4K41 A;  4B9M A;  2E2O A;  3A5L C;  4CBW A;  1NLV A;  4IDK A;  4H03 B;  3A0I X;  3DI6 A;  3IUC A;  2D0A A;  3RMB A;  1A5X A;  3DLH A;  3CJ1 A;  1OH8 A;  1D8Y A;  4WFB L;  3C6A A;  4KH4 A;  3O4Q A;  2UYT A;  1JL2 A;  3RVC A;  4CF9 A;  5C42 A;  5M1N A;  4BE1 A;  2ZQB A;  4DV5 K;  3ENB A;  3P31 A;  2LSN A;  3BZK A;  3CCM N;  3D0P A;  1RCH A;  1C0U A;  2HF4 A;  4XH1 A;  3QB0 A;  1MWK A;  2YI1 A;  4CZJ A;  1B92 A;  2G8V A;  1O1W A;  3VQ9 A;  4OLA A;  3HPO A;  2OCE A;  3OS2 A;  4KB0 A;  3TWH A;  1C1A A;  4B9T A;  3WUH A;  3O9R A;  4A2B A;  4DFP A;  4BY9 C;  1BA1 A;  3ZX2 A;  1C0T A;  1RTH A;  2D5R A;  4CJP A;  2E5L K;  3HM8 A;  4AQY K;  1E3M A;  1NK4 A;  4Q5V A;  1TYQ B;  1IKX A;  3CQ8 A;  3P39 A;  4GY2 B;  3HT3 A;  3WEE B;  3U4L A;  4PA1 A;  4H5R A;  4H0Y B;  4JI6 K;  3NGZ A;  3VA0 A;  1C0M A;  4FLV A;  2OPQ A;  2ZJP L;  5KTQ A;  1VSL A;  3AVM A;  5FPE A;  3AA4 A;  3DLB A;  4HHT A;  1N36 K;  3HP6 A;  4FPB A;  3AO5 A;  3MMV A;  2YV0 X;  4NYN A;  2HVI A;  1YVU A;  4JI0 K;  1EX4 A;  1QQN A;  4CK2 A;  4ISG A;  1FJG K;  1R0A A;  3FR0 A;  3HBT A;  4FJI A;  1VQL N;  2NRW A;  1BIU A;  1TUY A;  3V9U A;  1U04 A;  4G9Z A;  3AVJ A;  2PYJ A;  2KFN A;  4JI4 K;  4A62 A;  3CD6 N;  3TTF A;  3ZSQ A;  2CH5 A;  2GV9 A;  3AVK A;  4IOC L;  1HYV A;  1WSE A;  1MU2 A;  3MWP A;  2NRX A;  3C6H A;  4JEP A;  4EHU A;  3OYA A;  3HSC A;  1X1P A;  4YOV A;  2DTU A;  1FKO A;  2KQ2 A;  3FZL A;  2P9L A;  3CJA A;  2JGU A;  3D2E A;  3AVF A;  3LWM A;  4W5R A;  2P9K A;  2W40 A;  4E7L A;  3VMF B;  1RBT A;  3UKU B;  4ILG B;  5CYQ A;  2Q1N A;  3IG1 A;  2ZJR L;  4ELV A;  3AAQ A;  3SAF A;  1TK5 A;  1Y64 A;  3ULD A;  1NGB A;  2HHH K;  3KTQ A;  2ATQ A;  1VQ9 N;  2FF3 B;  1JLE A;  1S6P A;  2GEM A;  3BZC A;  3GOI A;  3D45 A;  4JD2 B;  3CHW A;  3CM5 A;  1LWF A;  2WON A;  1WBB A;  3CCU N;  2D0O A;  4BRO A;  3CC4 N;  2QKK A;  1VSK A;  4BR9 A;  3NF7 A;  1CXU A;  3WT0 A;  3ALY A;  4H0X B;  3G25 A;  4WE1 A;  3HXM A;  2Q36 A;  2H3G X;  5KRT A;  4FVM A;  3NGY A;  1BG3 A;  3AV9 A;  3PV8 A;  4QAG A;  4KTW A;  3PUF A;  5HRP A;  1B9D A;  2Z1H A;  3A5M C;  1SV5 A;  4RG8 A;  1YIT N;  2YHA A;  4CEE A;  3TAP A;  1NGE A;  4FOE A;  4W5Q A;  3IKM A;  3T1A A;  5HLF A;  4F4K A;  3AO4 A;  4CFA A;  4JK8 A;  1T3V A;  2BAN A;  3VEX A;  1U49 A;  1VQ7 N;  3TAF A;  5AQG A;  5AQY A;  2A1R A;  4JI7 K;  1LWE A;  5C25 A;  4CGD A;  3S3M A;  3KK3 A;  4CEB A;  4DU4 A;  3MWT A;  3CFP A;  1RDA A;  3LP1 A;  3J81 O;  2QI2 A;  1BA0 A;  1ZBU A;  4TSX A;  4N47 A;  1KTQ A;  3ZT1 A;  4E1J A;  4WQ5 A;  4JRP A;  4JI5 K;  4DR4 K;  1Z25 A;  4X62 K;  4IDH A;  2F8S A;  4I2P A;  2HHX A;  4C8M A;  4B08 A;  1S1T A;  3LAM A;  3LAK A;  4CED A;  4Z94 A;  2G8K A;  4H0O A;  4I9Q A;  3V4I A;  3MN6 A;  3OYM A;  1MA9 B;  1W2B M;  4FJJ A;  4JKF A;  2QXF A;  1HNX K;  1S1W A;  4N76 A;  3OHR A;  5AQR A;  4BVP A;  4XEI A;  4CFB A;  3HVT A;  4DWI A;  5C15 A;  1BDG A;  4OKJ A;  2UUA K;  4KHS A;  1TUU A;  4KPY A;  4DV4 K;  4NCG A;  4J2E A;  1G99 A;  4FVU A;  4Y0W A;  1HPM A;  3DLR A;  3GG4 A;  3HPH A;  5JS1 A;  5AFU A;  4LFA K;  4FJK A;  2Q2R A;  3L2Q A;  1VQN N;  4E0D A;  3CM6 A;  3CFR A;  3SI6 A;  4LH4 A;  3OBY A;  1Q8I A;  1W9H A;  2XRI A;  1ITG A;  4KHW A;  2O8E B;  2VG6 A;  3OYL A;  4B1W B;  1KXP A;  4YHH K;  4B1U B;  4DR5 K;  2VG5 A;  3RTV A;  1EET A;  5K14 A;  3OYB A;  5M1O A;  4O8U A;  1NJW A;  1BCO A;  2NUB A;  4ISE A;  4CJU A;  2WUS A;  1IG9 A;  5AQI A;  5KQD A;  3F73 A;  4JS5 A;  5DMR A;  3CET A;  4CHN A;  1NU0 A;  1V4T A;  3J7A P;  4KHP K;  3ZEU B;  3VEO A;  4DR7 K;  3F5T A;  2FBV A;  4DCH A;  5GIP A;  4B3R K;  1ZBL A;  3O1W A;  4IFV A;  1CZ9 A;  3SQ4 A;  1VQO N;  1TVR A;  1ZBH A;  3NH2 A;  1TKD A;  3NFA A;  4BRP A;  5BN8 A;  4HTL A;  4PY5 A;  1QE1 A;  5GIN A;  1HNW K;  3CFO A;  3Q7B A;  2XY5 A;  3N4P A;  4W5N A;  4E7H A;  3V6D A;  1TKX A;  2FBT A;  4QS8 A;  4CHY A;  4DF8 A;  3K5M A;  3MXI A;  4KV8 A;  4OLB A;  4B9S A;  2F96 A;  3KKR A;  4EZ9 A;  1JL1 A;  1QS4 A;  2YHX A;  3DXK B;  1L3U A;  4RCH A;  4DSE A;  3AVI A;  3LP0 A;  3V1Q A;  3MEG A;  3WXJ A;  3OYE A;  3M5R A;  3L2W A;  3KWG A;  1VSJ A;  3C94 A;  3UKR A;  2P9U A;  1U47 A;  2NRH A;  3IDH A;  4DTU A;  2WBN A;  4CI6 A;  3W3D A;  2ZF5 O;  1ASU A;  1JCF A;  2FSN A;  1ILY A;  4FZX C;  4CEZ A;  1RT3 A;  3LDS A;  3VQ8 A;  1YJW N;  4CJF A;  4AHS A;  2B4J A;  1UA0 A;  1VSF A;  2P5G A;  3FZF A;  3A5O C;  1BUP A;  4FL9 A;  5EU7 A;  4BC2 A;  4WQ5 C;  2E1Y A;  4EP5 A;  4O8K A;  1DGK N;  3VPZ A;  3ZX3 A;  3AGK A;  3DLE A;  4BRL A;  3EO3 A;  1HLU A;  4PKG A;  3QIC A;  2HMI A;  2Q3S A;  1CZB A;  1X3M A;  1T7P A;  3LAL A;  4CCH A;  4FJM A;  3E9P A;  4DG1 A;  3PIO L;  3T1H K;  1NJX A;  4KBO A;  2ZE2 A;  3MEE A;  3H08 A;  3SBG A;  2UXB K;  1J5O A;  4OGC A;  5AQT A;  3QES A;  4FZZ A;  1J54 A;  3M8Q A;  2HF3 A;  2HBK A;  4B9V A;  2QWQ A;  3DRP A;  3VTI A;  4BC3 A;  2GWJ A;  4GVE A;  5AFU H;  2QTD A;  1IKW A;  4B8A B;  4M3R A;  1IBM K;  3S9H A;  2OA8 A;  4J2D A;  3SPZ A;  4NXM K;  3RMD A;  1REV A;  5BRH A;  4CGF A;  1LAV A;  2NRT A;  5IWA K;  3NF8 A;  3IRX A;  3L2V A;  3TI0 A;  3LP3 A;  2GTD A;  3AVG A;  4E7I A;  2O8F B;  1NGH A;  4CK1 A;  3E9L A;  1WN7 A;  3L4I A;  1NWK A;  3OA9 A;  1CZA N;  4FWL A;  2D0C A;  4G1Q A;  1S5J A;  1U45 A;  3S41 A;  3K2P A;  5BPL A;  2P5O A;  5BN9 A;  4BVO A;  1WSG A;  4CZL A;  3KLG A;  1T8E A;  2Q31 A;  1VK0 A;  2VQE K;  4HUG A;  1D5A A;  1LWC A;  2P9S A;  4M63 C;  5F1X A;  3TSP A;  3U9D A;  3SLC A;  5I3U A;  4NCA A;  1T05 A;  3HTV A;  2E20 A;  4PKI A;  4DFJ A;  3K5L A;  5AQK A;  3LDO A;  4M3T A;  3PIP L;  1K9M O;  4BR4 A;  4M3U A;  3AVN A;  4JI8 K;  2OAN A;  4B1Y B;  1J5E K;  1EQY A;  2QM1 A;  4CJ3 A;  1RT6 A;  3CQY A;  1E4G T;  4KKO A;  5GAD P;  1BI4 B;  2QW9 A;  4JYA K;  1SUQ A;  4B9L A;  5KPZ A;  3SK3 A;  5AQW A;  3MN5 A;  3QDK A;  4CE9 A;  4WFA L;  3CIP A;  3O9T A;  4Y1D A;  2XO7 A;  2RF2 A;  3I0S A;  4CEC A;  4DV2 K;  2P9N B;  1T6C A;  2UUB K;  4FWM A;  1HQU A;  3AVB A;  4CJR A;  1NK8 A;  4RWT A;  3QEV A;  2QWM A;  3OS0 A;  1OH5 A;  3VGM A;  1VQM N;  3KD1 E;  2HVH A;  5JS2 A;  3DXM B;  3QLH A;  1HX1 A;  1HPZ A;  4C1N K;  3ZSV A;  1U2V B;  3SUO A;  4LY7 A;  4OO1 J;  2HBL A;  1YJ9 N;  4DTO A;  3SUQ A;  4AHU A;  1TGO A;  5CE3 A;  4R79 A;  3CF5 L;  4CF2 A;  2IVN A;  4JK9 A;  2XY8 A;  3BF3 A;  4CD1 A;  1ATS A;  1V4S A;  1J53 A;  4JK7 A;  1JXE A;  2EX3 A;  4YOR A;  4H5V A;  1WAJ A;  5JVH L;  3SMP A;  4LSL A;  5T7B A;  5SZT A;  5LY3 A;  3C7N A;  3SJJ A;  1KCF A;  1SL2 A;  5F0X A;  3CER A;  4BR7 A;  1NGF A;  2KZM A;  1ZYQ A;  3WQU A;  4RTF D;  4JI2 K;  1DKG D;  2OZM A;  4DR2 K;  1UWB A;  1OVQ A;  5C10 A;  3VEZ A;  4Y1C A;  4Z4F A;  5E26 A;  5FRO A;  4JKE A;  1JLF A;  2QK9 A;  3V1R A;  2A40 A;  3M8P A;  2A1S A;  4DQP A;  3H46 O;  3RR8 A;  4HTU A;  3AGR A;  1GOB A;  4BRF A;  4IJA A;  3SAH A;  4DMN A;  5BR9 A;  4WYB A;  5AQN A;  3VTH A;  2I5J A;  4J2B A;  4DTP A;  4KHY A;  3SNN A;  3ZSR A;  5M1F A;  3KIO A;  3ENH A;  1HYS A;  3C0B A;  2BGG A;  4E7J A;  4BRH A;  3CCL N;  5AZJ B;  3V81 A;  4JKC A;  2QWN A;  3LZI A;  3P83 D;  5AQZ A;  3W0L A;  1K73 O;  4KHQ A;  1M90 O;  4IO9 L;  4FJ9 A;  4JAX A;  4JHD B;  1TL3 A;  2NLX A;  1XQS C;  3I8B A;  1BWF O;  4H4O A;  3PX0 A;  3CPE A;  3ULE B;  4E7K A;  1NJI O;  2PYL A;  1S22 A;  1QHT A;  4K8X A;  4KTZ A;  4CGJ A;  4CJQ A;  4Z4I A;  1VHX A;  1WOQ A;  3LP2 A;  3VQ7 A;  3CYM A;  4CER A;  2YCH A;  3MK6 A;  2PY5 A;  4DB3 A;  2O8D B;  3PO5 A;  1FW6 A;  3HRG A;  4U7B A;  2GWK A;  4AHR A;  4FWR A;  4CJ4 A;  4Z4H A;  4IOA L;  2YNH A;  1Z6R A;  4C8K A;  5KRS A;  3BEX A;  3ID8 A;  3THV A;  4KI6 A;  1IH7 A;  5KPR A;  4KHN A;  5JMV A;  1XC3 A;  2W6L A;  1TAU A;  3TU5 A;  4IG3 A;  1YTU A;  1TYQ A;  3R3L A;  1A5W A;  4LF6 K;  5KI6 A;  1VQ4 N;  4EAH D;  2ITG A;  1YJN N;  1I39 A;  1XC9 A;  3VGK A;  3WEE A;  1SL1 A;  3KWI A;  3QML A;  4M7X A;  4RW6 A;  4DSF A;  4IG0 A;  3SZ2 A;  5J1E A;  1HQE A;  4YOW A;  3TPQ A;  3SCX A;  4KB1 A;  3LDP A;  1ASV A;  3MX5 A;  1GOC A;  3VQ5 A;  1RDB A;  3KZB A;  1OH6 A;  3DOL A;  3IAY A;  4PL8 A;  3AVH A;  3QEX A;  2FBX A;  3L3V A;  2YJF A;  1RBV A;  1BL3 A;  4OJR A;  2VCP A;  1TK0 A;  3NCI A;  3U6F A;  1BCM A;  4BC4 A;  3U3G A;  4H4M A;  4A5A A;  4YOY A;  4BG9 A;  4AH9 A;  2BTF A;  3RMA A;  3O9Q A;  3FE1 A;  4CJK A;  2F9W A;  4B9N A;  4KH6 A;  4I7F A;  1XI1 A;  3E66 A;  3EEQ A;  2IAJ A;  1RTI A;  4ILJ A;  3KK1 A;  2CH6 A;  1KVB A;  1RTJ A;  3RWU A;  2NNW A;  4E1N A;  3F2K A;  4FOI A;  3VQP A;  4CEO A;  5F2R A;  5AQQ A;  2P51 A;  1S1U A;  2EHG A;  4JV5 K;  4DTM A;  1DT9 A;  4Z0U A;  1QVG M;  4CIE A;  3J80 O;  5D3G A;  2IVO A;  1JXB A;  3UKU A;  3I0R A;  4LD0 A;  1NKE A;  3VEN A;  5FRN A;  1KVA A;  4CFC A;  2OPR A;  4FO0 A;  4RW7 A;  4BQL A;  4JD2 A;  2D4W A;  3WXM B;  4B9U A;  2Z1J A;  2VWK A;  5M1P A;  4CEA A;  1BQN A;  5AQV A;  1RDD A;  4M3Z A;  1JLC A;  2OPS A;  1NK6 A;  3MAQ A;  2BH1 A;  1Q9Y A;  3MEC A;  4BDY A;  5C2F A;  1IJJ A;  1D9D A;  4CES A;  3ASM A;  4DHY A;  4A5B A;  3ID6 A;  1WUA A;  4K25 A;  5AQF A;  4IWV A;  1HUX A;  5GAE P;  4JKB A;  5J2Q A;  3SQ1 A;  1T6D A;  3SUN A;  3VQ4 A;  1OH7 A;  2P9I B;  4MDA A;  4XIU A;  3THW B;  2DFF A;  4KFB A;  1SKS A;  4EFH A;  1N6Q A;  5AQX A;  2Q0U A;  4CGG A;  1S3X A;  2I7N A;  3ITH A;  3OBW A;  3O80 A;  3EZ5 A;  3TAN A;  3NVK A;  5AQS A;  1IKV A;  5FDL A;  3SPY A;  2HHW A;  4CGH A;  5TKW A;  2OTJ N;  1Q7Y O;  4CVN E;  5CY4 A;  4DUZ K;  4CD3 A;  2JLE A;  3TTD A;  4L8R B;  1S9E A;  4BWJ A;  2O8B B;  4F3T A;  1S1X A;  3AA3 A;  5AQH A;  3SQ0 A;  4H0T B;  5C2D A;  1BIS A;  4W5T A;  1XWL A;  4FCY A;  3G10 A;  3HJF A;  4IFY A;  3FZH A;  3UB5 A;  4IXC A;  1CLQ A;  3NVM A;  4CZI A;  4BE0 A;  2B5J A;  4CEQ A;  3BUZ B;  3VF2 A;  4RW4 A;  3C95 A;  1EWR A;  3L3U A;  4JLH A;  2JWL A;  2A3Z A;  1IBL K;  3CME N;  2AJQ A;  4KTQ A;  3PX6 A;  2G8W A;  2IGI A;  3P4I A;  1I94 K;  2ZM6 K;  2I7P A;  3IS9 A;  1IV0 A;  3QBW A;  4O5F A;  3KK2 A;  3G0Z A;  5M1K A;  3KD5 E;  5HRO A;  1SAZ A;  3OW2 M;  3VQQ A;  3PO4 A;  2ITM A;  4HCC A;  4EHT A;  3NE6 A;  4C8O A;  1EXQ A;  1HMV A;  3SUP A;  4FJ8 A;  2G8F A;  1KVC A;  2F9T A;  4FWQ A;  5AJ3 K;  2E4L A;  4LFC K;  3QIO A;  5CZ2 A;  3V9S A;  2G8H A;  3P1G A;  4BRK A;  3ISN C;  4C1N I;  4Z4G A;  1YIJ N;  4ZTF A;  3TSU A;  3OYF A;  4LF5 K;  3E1Y A;  3LDN A;  4ELT A;  1L3T A;  5DK5 A;  5EVZ A;  4JKG B;  1BOT O;  4QS9 A;  4CZG A;  4KRF A;  3MXJ A;  5CYM A;  2NRV A;  2YHY A;  4MLH A;  2HHU A;  3L0Q A;  1JKH A;  3CPW M;  1X9M A;  4FWO A;  4QOZ B;  1LOT B;  3K58 A;  4LFB K;  4DUY K;  2O8E A;  2AA4 A;  1JLG A;  4XH5 A;  3OJU A;  1NGJ A;  5M1Q A;  2HMP A;  4ELU A;  2KKZ A;  3CC2 N;  4Z4C A;  3JYT A;  2OZS A;  3CMA N;  1XHX A;  4LF8 K;  4CHQ A;  4OGE A;  1NNE A;  3VOV A;  3ATU A;  1XMQ K;  4CHP A;  3FFI A;  3EL2 A;  4BGA A;  4B8C A;  3ZEU A;  4JI3 K;  3ZET B;  4BRQ A;  5DM6 L;  3H1Q A;  2IIR A;  2HBM A;  3O5B A;  5JIC A;  4M3X A;  4DTR A;  3DLL L;  2YNF A;  2HHT A;  3G4S N;  3KLH A;  1DTQ A;  1KLN A;  2NRZ A;  2Y1I A;  2O8C B;  3EN9 A;  4H0V B;  1XUP O;  3AA2 A;  4QCL A;  2UU9 K;  1QVF M;  3FZK A;  5EXW A;  5I9E B;  1ZBS A;  4Q0B A;  4N41 A;  4B1X B;  4GVM A;  4HUE A;  4B1V A;  2FXU A;  5AQM A;  4PQU A;  2QWL A;  3DXK A;  4O55 A;  1N34 K;  5FRM A;  1QQO A;  2Z1G A;  4BRD A;  1U48 A;  1EWQ A;  5KGX A;  3CJ9 A;  3LAN A;  4H0P A;  4I6M B;  3GE1 A;  3CJ7 A;  4FWN A;  2DPN A;  1ESV A;  1N5Y A;  3BGR A;  5BR8 K;  3EYZ A;  3HK2 A;  1H1V A;  3I8D A;  4CF1 A;  1RDU A;  3QFU A;  4BDP A;  2DY4 A;  4EP4 A;  4ZHR A;  4ID5 A;  2UXD K;  1VSD A;  4NCB A;  2V7Z A;  3AAR A;  1GLE G;  4JKD A;  3DYA A;  4LH5 A;  1T03 A;  3J8A A;  5AR0 A;  4BQZ A;  3HL8 A;  1S1V A;  2B6A A;  4KRE A;  1NGI A;  2YNI A;  3VQ6 A;  3WNF A;  3PY8 A;  5BPM A;  4FWK A;  1HNZ K;  1Q18 A;  3ZSO A;  1JLB A;  3NBP A;  1BO5 O;  4NLC A;  5HOO A;  3RRG A;  1C0F A;  2YJE A;  4FW1 A;  1NJY A;  4OVL A;  4FLU A;  4B1Z A;  1ASW A;  5EOY A;  1DLO A;  4E3S A;  3D2F B;  4Z4E A;  3B8A X;  1DEJ A;  1RT2 A;  3ZLJ A;  4RW8 A;  4DS4 A;  2WTU A;  4CBX A;  2OTL N;  2E2Q A;  3NF6 A;  2HW3 A;  2HNY A;  2P9P B;  3EE8 A;  4DTS A;  4BRI A;  2QWP A;  3EKS A;  4BWM A;  2ZJQ L;  1RTD A;  2OPP A;  4FM2 A;  1YAG A;  4N56 A;  2YHW A;  4A57 A;  1Y97 A;  3VGL A;  3ZSY A;  3AAP A;  1I3A A;  4CJV A;  1XHZ A;  4FLZ A;  1VQK N;  1XNR K;  3D6R A;  3LL3 A;  4F8R A;  2O8F A;  4DS5 A;  1C1C A;  1VRT A;  2OYQ A;  4A59 A;  4HUF A;  4DV0 K;  5HRN A;  2E2N A;  4KH5 A;  3KLF A;  1YF5 L;  1HR0 K;  2HBJ A;  3FLC O;  3CCV N;  3L2R A;  4A61 A;  1K8K B;  2YKN A;  4FM1 A;  1J6Z A;  1NGD A;  3F9K A;  1UAX A;  3HI0 A;  3NH1 A;  2BUP A;  1HKG A;  4FPA A;  3ZT3 A;  3L8B A;  2G8U A;  2FF6 A;  3JSM A;  4AF1 A;  3K59 A;  3VER A;  2QKB A;  4CJL A;  2HOE A;  3RSE B;  4CBU A;  5HL7 L;  2F4V K;  1WB9 A;  4BR2 A;  3VQA A;  5H1S Q;  1GLF O; 
#chains in the Genus database with same CATH homology
 5KI6 A;  3DOK A;  4GW6 A;  2F8S A;  2ITG A;  4I2P A;  3OS1 A;  2HHX A;  1I39 A;  4C8M A;  3RMC A;  4B08 A;  1XC9 A;  3M8R A;  1S1T A;  3LAM A;  1BHL A;  4CJE A;  3LAK A;  4CED A;  3PX4 A;  1RBR A;  1SL1 A;  2G8K A;  3V4I A;  4I9Q A;  3VQE A;  4CJW A;  1KFD A;  3OYM A;  1X9W A;  4RW6 A;  1HNV A;  4DSF A;  4DSK A;  4FJJ A;  4IG0 A;  3SZ2 A;  5J1E A;  1HQE A;  2QXF A;  1NJZ A;  1BI4 A;  4PUO A;  4KB1 A;  3O3F A;  3SCX A;  1ASV A;  1S1W A;  3OJS A;  5J2N A;  4N76 A;  3MXM A;  1GOC A;  1L5U A;  3VQ5 A;  1RDB A;  2DFE A;  3L2U A;  1RBU A;  3OY9 A;  3DOL A;  3HVR A;  3IAY A;  3O4N A;  1WLJ A;  2W42 A;  3DRR A;  2P1J A;  3AVH A;  1TKT A;  4OPK A;  4CFB A;  2FBX A;  3L3V A;  3QEX A;  1TK8 A;  1RBV A;  5HBM A;  1BL3 A;  3HVT A;  3ZT4 A;  1NK5 A;  1EKE A;  3C6T A;  4OJR A;  4DWI A;  5J2M A;  3DM2 A;  1TK0 A;  3NCI A;  3U6F A;  1BCM A;  4OKJ A;  3QET A;  1LAW A;  3U3G A;  3KJV A;  4OPJ A;  4KHS A;  4H4M A;  4F2R A;  4UQG A;  4KPY A;  4NCG A;  4AH9 A;  4J2E A;  3RMA A;  3NH0 A;  3RR7 A;  1F21 A;  4FYD A;  1QSS A;  4FW2 A;  3OYH A;  3OYC A;  2ZD1 A;  3DLR A;  1A5V A;  4MFB A;  4CJK A;  1NOY A;  4KAZ A;  4B9N A;  3HPH A;  4I7F A;  1XI1 A;  3HM9 A;  4M3Y A;  5HP1 A;  3MED A;  4CF0 A;  1Q9X A;  5JS1 A;  3LWL A;  4IBN A;  4KHU A;  2IAJ A;  3WNG A;  1RTI A;  2HND A;  4FJK A;  3NAE A;  2HHQ A;  4CK3 A;  3OYD A;  3KK1 A;  3L2Q A;  4KI4 A;  4DFK A;  3NGI A;  4E0D A;  1KVB A;  2F8T A;  3QER A;  3CM6 A;  3CFR A;  3SI6 A;  1RTJ A;  4M45 A;  1B9F A;  4BDZ A;  4LH4 A;  3QNO A;  1NK9 A;  1Q8I A;  3RWU A;  1HJR A;  1W9H A;  4E1N A;  2XRI A;  3DLK A;  1ITG A;  4KHW A;  1BIZ A;  2VG6 A;  3VQP A;  3OYL A;  1RDC A;  3VA3 A;  4CEO A;  3TR8 A;  2VG5 A;  3RTV A;  1WSI A;  2P51 A;  1EET A;  5K14 A;  4JRQ A;  1S1U A;  3OYB A;  4MQ3 A;  2EHG A;  3KLE A;  1NJW A;  4DTM A;  1BCO A;  3TAB A;  2NUB A;  3DRS A;  4OKK A;  3O3G A;  4Z0U A;  4I9L A;  4CIE A;  4CJU A;  1IG9 A;  5D3G A;  4AHT A;  1JXB A;  1FKP A;  3RRH A;  3I0R A;  3F73 A;  3QNN A;  1WSH A;  4JS5 A;  4LD0 A;  5DMR A;  1NKE A;  4CHN A;  2IS3 A;  3K57 A;  5FRN A;  1BGX T;  3EY1 A;  1KVA A;  4CFC A;  2OPR A;  1X9S A;  3VN5 A;  2FBV A;  4FXD A;  4RW7 A;  4CHZ A;  3OYJ A;  1SKR A;  1WSF A;  5J2P A;  2HHS A;  1L3V A;  4B9U A;  1ZBL A;  1IKY A;  2Z1J A;  3S3N A;  4IFV A;  2VWK A;  1CZ9 A;  2FC0 A;  2X6S A;  4DQS A;  4CEA A;  1BQN A;  3SQ4 A;  1U4B A;  1RDD A;  3AVC A;  4M42 A;  1JLC A;  1TVR A;  1SL0 A;  3NH2 A;  2OPS A;  1TKD A;  4M3Z A;  1ZBH A;  1NK6 A;  3MAQ A;  3NFA A;  2E6M A;  1Q9Y A;  3MEC A;  1S9G A;  3QIP A;  4BDY A;  4PY5 A;  1QE1 A;  3CFO A;  1D9D A;  4CES A;  2IC3 A;  3ASM A;  2XY5 A;  4W5N A;  4E7H A;  3V6D A;  3QIN A;  1LW0 A;  1TKX A;  2FBT A;  4CHY A;  4DF8 A;  5CZ1 A;  3AO1 A;  3K5M A;  3MXI A;  3AO2 A;  4KV8 A;  3V9W A;  4F2S A;  4B9S A;  4OLB A;  4HVJ A;  5J2Q A;  3HYF A;  3VQD A;  2X78 A;  3SQ1 A;  3NF9 A;  2F96 A;  3KKR A;  4EZ9 A;  1CXQ A;  1RT7 A;  3K5N A;  4OKE A;  3T3F A;  3VQ4 A;  3QEI A;  3SUN A;  1JL1 A;  4FLY A;  4DFM A;  4C8N A;  4FJ7 A;  4XIU A;  4LSN A;  2YKM A;  1QS4 A;  3S3O A;  1L3U A;  2DFF A;  4KFB A;  4FJ5 A;  4DSE A;  1SKS A;  3AVI A;  3LP0 A;  1TL1 A;  3V1Q A;  2HB5 A;  3MEG A;  4YNQ A;  4AHV A;  2XY6 A;  1N6Q A;  3OYE A;  2IOC A;  3QO9 A;  4H8K A;  4CGG A;  3L2W A;  3ITH A;  1VSJ A;  3OVN A;  3EZ5 A;  3TAN A;  4CIF A;  5I42 A;  3QEW A;  4C8L A;  3C94 A;  1IKV A;  5FDL A;  1TAQ A;  1U47 A;  3SPY A;  4R5P A;  4O0J A;  2HHW A;  4CGH A;  4DTU A;  2BDP A;  4CF8 A;  2PZS A;  2KW4 A;  1ASU A;  2O4G A;  5CY4 A;  1FXX A;  5SWM A;  4FK0 A;  2JLE A;  4L8R B;  3V9Z A;  5KGW A;  2D0B A;  1RT1 A;  3WNE A;  4FZX C;  1S9E A;  4CEZ A;  1L3S A;  4BWJ A;  1RT3 A;  4RW9 A;  3LDS A;  3SV4 A;  4F3T A;  3VQ8 A;  1QTM A;  4CJF A;  1S1X A;  3AA3 A;  4AHS A;  2B4J A;  1NK7 A;  1UA0 A;  1VSF A;  1KLM A;  3SQ0 A;  2P5G A;  3V9X A;  4AIL C;  3VQA A;  2VWJ A;  1BIS A;  5EU7 A;  4CJT A;  4YFU A;  4W5T A;  1KRP A;  1XWL A;  4NYF A;  3NDK A;  3G10 A;  4FCY A;  4DQQ A;  4DQR A;  3BDP A;  3HJF A;  4IFY A;  1WSJ A;  4F3O A;  4EP5 A;  1CLQ A;  4ZTJ A;  4BE0 A;  2B5J A;  4CEQ A;  4RW4 A;  1TV6 A;  2RN2 A;  1J9A A;  1DTT A;  3C95 A;  2X6N A;  1YTA A;  3L3U A;  2WOM A;  3OYI A;  4JLH A;  3A2F A;  3DLE A;  1ZBI A;  1LW2 A;  1UOC A;  3HST B;  4FK2 A;  4N5S A;  2AJQ A;  3KKS A;  4B3O A;  3HP9 A;  3O3H A;  2R7Y A;  2HMI A;  4DSJ A;  2Q3S A;  4FZY A;  4KTQ A;  3M8S A;  1CZB A;  3PX6 A;  4J2A A;  1T7P A;  3LAL A;  4DU1 A;  2IGI A;  2G8W A;  4CCH A;  4FJM A;  3TAR A;  4FJH A;  4M3W A;  4DG1 A;  1VSE A;  3IS9 A;  1NJX A;  4CGI A;  2ZE2 A;  3G0Z A;  3MEE A;  3KK2 A;  3H08 A;  1SKW A;  4E1M A;  3KD5 E;  4FK4 A;  5HRO A;  3HPG A;  4O5B A;  2X74 A;  4W5O A;  4HCB A;  1J5O A;  2YNG A;  3VQQ A;  3PO4 A;  4HCC A;  5C24 A;  3ZSW A;  4OGC A;  3NE6 A;  4C8O A;  1EXQ A;  1HMV A;  1S6Q A;  3SUP A;  3U3Y A;  4FJ8 A;  3QES A;  4FZZ A;  2G8F A;  1J54 A;  2BE2 A;  1KVC A;  1HYZ A;  3M8Q A;  4E89 A;  1TKZ A;  4K8Z A;  4B9V A;  5HRR A;  2IDO A;  2XHB A;  4B9M A;  3DRP A;  2Z1I A;  2E4L A;  4M41 A;  3AO3 A;  3QIO A;  5CZ2 A;  3V9S A;  4DF4 A;  2G8H A;  3P1G A;  2GUI A;  4IDK A;  3ISN C;  3B6O A;  3DI6 A;  2DFH A;  2D0A A;  3RMB A;  4Z4G A;  4DTJ A;  1IKW A;  4ZTF A;  1A5X A;  3DLH A;  3B6P A;  4B8A B;  1D8Y A;  4M3R A;  3OYF A;  3S9H A;  2OA8 A;  1WAF A;  4ELT A;  4J2D A;  3SPZ A;  3O4Q A;  1L3T A;  5DK5 A;  4O0I A;  3RMD A;  2YHB A;  1JL2 A;  1REV A;  4CF9 A;  5C42 A;  4FJX A;  4BE1 A;  2ZQB A;  4KRF A;  4CGF A;  3MXJ A;  5CYM A;  1LAV A;  2LSN A;  3NF8 A;  3IRX A;  3L2V A;  2HHU A;  1JKH A;  1ZBF A;  1VSH A;  3D0P A;  3TI0 A;  3AVL A;  3LP3 A;  1X9M A;  3AVG A;  4E7I A;  4QOZ B;  1RCH A;  4CK1 A;  5E41 A;  3SV3 A;  3K58 A;  3LPT A;  1C0U A;  1WN7 A;  4AHC A;  4DLE A;  1RIL A;  1JLG A;  3ZCM A;  3OJU A;  1B92 A;  2G8V A;  1O1W A;  1Z26 A;  2D0C A;  4G1Q A;  3VQ9 A;  4DTX A;  3TAQ A;  4OLA A;  3HPO A;  1S5J A;  3TAM A;  1U45 A;  4ELU A;  2HHV A;  4Z4C A;  2KZZ A;  3OS2 A;  4KB0 A;  3JYT A;  2OZS A;  3TWH A;  3C6U A;  1C1A A;  1XHX A;  3K2P A;  4B9T A;  2P5O A;  2RKI A;  4OGE A;  4CHQ A;  4DFP A;  1WSG A;  4O44 A;  4DSI A;  1G15 A;  1C0T A;  1RTH A;  1W0H A;  3KLG A;  4CHP A;  3FFI A;  1T8E A;  2D5R A;  4B8C A;  1VK0 A;  4HUG A;  3P5J A;  4CJP A;  1D5A A;  1LWC A;  4DLG A;  4CJ5 A;  4BAC A;  5I3U A;  4NCA A;  4M3X A;  1NK4 A;  4Q5V A;  1T05 A;  4DTR A;  4DFJ A;  3K5L A;  2YNF A;  1IKX A;  2HHT A;  4M3T A;  3CQ8 A;  1WNS A;  4M3U A;  3AVN A;  3HT3 A;  1RNH A;  3KLH A;  1DTQ A;  4CFD A;  4FLW A;  1KLN A;  4PA1 A;  4CJ3 A;  4DQI A;  1RT6 A;  3NGZ A;  3VA0 A;  1C0M A;  4FLV A;  2Y1I A;  4KKO A;  2OPQ A;  1BI4 B;  1SUQ A;  4E19 A;  1JLQ A;  5KTQ A;  2O4I A;  1K6Y A;  1VSL A;  3AVM A;  4B9L A;  3AA2 A;  3AA4 A;  3DLB A;  4CE9 A;  4HHT A;  4DTN A;  1HRH A;  3HP6 A;  4Y1D A;  3AO5 A;  4FLT A;  4QCL A;  2YV0 X;  2XO7 A;  2RF2 A;  2KFZ A;  4NYN A;  3I0S A;  1YVU A;  4CEC A;  2HVI A;  1EX4 A;  4Q0B A;  3CG7 A;  2ETJ A;  4N41 A;  3E01 A;  4CK2 A;  1UA1 A;  4GVM A;  4HUE A;  1HQU A;  1R0A A;  3AVB A;  4CJR A;  1NK8 A;  3QEV A;  4PQU A;  4ID1 A;  3OS0 A;  2HVH A;  4FJI A;  3KD1 E;  3ZSZ A;  4O55 A;  5JS2 A;  3LZJ A;  3V1O A;  5FRM A;  2Z1G A;  3QLH A;  1U48 A;  1BIU A;  5KGX A;  3LAN A;  3V9U A;  1U04 A;  1HPZ A;  3AVJ A;  3ZSV A;  2PYJ A;  3SUO A;  4LY7 A;  2KFN A;  1IO2 A;  4CHO A;  3NHG A;  3TAG A;  1N5Y A;  4DTO A;  3BGR A;  3EYZ A;  3SUQ A;  4AHU A;  1TGO A;  1VRU A;  3SQ2 A;  3ZSQ A;  4EZ6 A;  3I8D A;  2G8I A;  3HK2 A;  1QQC A;  1KSP A;  4CF1 A;  2GV9 A;  1RT5 A;  3AVK A;  4CF2 A;  4BDP A;  1BQM A;  4IKF A;  2DY4 A;  1HYV A;  4EP4 A;  1WSE A;  3DMJ A;  4ID5 A;  4ZHR A;  1VSD A;  2XY8 A;  4NCB A;  1MU2 A;  1NK0 A;  3DYA A;  2FBY A;  4GMJ B;  4LH5 A;  1T03 A;  1QSL A;  1J53 A;  3TAE A;  3OYA A;  3HL8 A;  1JXE A;  1S1V A;  2B6A A;  2EX3 A;  1X1P A;  4KRE A;  2DTU A;  2YNI A;  3QEP A;  1WAJ A;  1FKO A;  2KQ2 A;  3VQ6 A;  4LSL A;  5T7B A;  5SZT A;  3SJJ A;  1KCF A;  2JGU A;  3AVF A;  3LWM A;  3WNF A;  4W5R A;  1SL2 A;  3PY8 A;  3LPU A;  2Y1J A;  4FJL A;  1C6V A;  3UIQ A;  4E7L A;  2E6L A;  2KZM A;  1RBT A;  1JLB A;  3ZSO A;  1ZYQ A;  3NBP A;  5CYQ A;  3IG1 A;  2VG7 A;  4ELV A;  3RRG A;  1C1B A;  3AVA A;  3VQC A;  1TK5 A;  3ULD A;  4FW1 A;  1NJY A;  3KTQ A;  4OVL A;  2ATQ A;  4FLU A;  4JS4 A;  2GBZ A;  2OZM A;  1JLE A;  3HO1 A;  1S6P A;  1ASW A;  1UWB A;  1KFS A;  3D45 A;  1DLO A;  4Y1C A;  4Z4F A;  4E3S A;  5FRO A;  4Z4E A;  3CM5 A;  1LWF A;  2WON A;  1RT2 A;  1JLF A;  2QK9 A;  3V1R A;  2QKK A;  4FJG A;  3M8P A;  4FLX A;  4RW8 A;  4DS4 A;  1VSK A;  2A1S A;  3ZT0 A;  1LV5 A;  4DQP A;  1VSM A;  3RR8 A;  3NF7 A;  4HTU A;  1CXU A;  1GOA A;  1GOB A;  3NF6 A;  4DMN A;  2HW3 A;  2HNY A;  3ALY A;  4DSL A;  4J2B A;  2I5J A;  4WE1 A;  3HXM A;  3VQB A;  4DTP A;  4DTS A;  3SNN A;  4KHY A;  3ZSR A;  4BWM A;  1NKC A;  5KRT A;  3T19 A;  1RTD A;  2OPP A;  3KIO A;  4FVM A;  2HNZ A;  3NGY A;  4FM2 A;  1HYS A;  3KLI A;  2BGG A;  4N56 A;  4E7J A;  3AV9 A;  3PV8 A;  4QAG A;  1Y97 A;  4KTW A;  3ZSY A;  3PUF A;  5HRP A;  1B9D A;  2Z1H A;  1SV5 A;  4KO0 A;  4RG8 A;  1I3A A;  1YT3 A;  4CJV A;  3V81 A;  1XHZ A;  3LZI A;  2YHA A;  4CEE A;  3P83 D;  4FLZ A;  2XY7 A;  3TAP A;  4W5Q A;  4KHQ A;  3T1A A;  5HLF A;  4FJ9 A;  4F4K A;  3AO4 A;  3OYN A;  4CIG A;  1FK9 A;  1TL3 A;  4CFA A;  4F8R A;  3DLG A;  1EP4 A;  2BAN A;  4H4O A;  3PX0 A;  1NKB A;  2PYL A;  4E7K A;  4K8X A;  1QHT A;  1RBS A;  4KTZ A;  4BE2 A;  4DS5 A;  1C1C A;  1VRT A;  4CGJ A;  4CJQ A;  2OYQ A;  4Z4I A;  4HUF A;  1HNI A;  1U49 A;  3LP2 A;  1VSI A;  3CYM A;  3VQ7 A;  3TAF A;  4CER A;  2A1R A;  4ICL A;  2PY5 A;  5HRN A;  3PO5 A;  3KLF A;  1LWE A;  4FJN A;  5C25 A;  3ZSX A;  4CEF A;  4CGD A;  3OYG A;  3S3M A;  1JLA A;  4AHR A;  3L2R A;  3KK3 A;  4O4G A;  4CJ4 A;  2YKN A;  4CEB A;  4Z4H A;  4FM1 A;  4DU4 A;  1QSY A;  3F9K A;  3CFP A;  1RDA A;  2RPI A;  3LP1 A;  1UAX A;  4CJS A;  3ZT2 A;  3SYZ A;  2YNH A;  5HRS A;  3NH1 A;  1ZBU A;  4C8K A;  4I2Q A;  3WNH A;  3ZT3 A;  5KRS A;  3L8B A;  2G8U A;  4DU3 A;  4TSX A;  3OYK A;  4N47 A;  1KTQ A;  3ZT1 A;  3THV A;  4KI6 A;  1IH7 A;  3JSM A;  1RT4 A;  3K59 A;  3AA5 X;  4PWD A;  4KHN A;  4JRP A;  2KTQ A;  2QKB A;  3K5O A;  4FM0 A;  4CJL A;  1Z25 A;  1D9F A;  1TAU A;  4IG3 A;  1YTU A;  1A5W A;  1NOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...