3ZSRA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsrA00
4DLGA 1IH7A 3TAFA 4PY5A 2Y1JA 1FK9A 2KFZA 4DF8A 1JL2A 1WAFA 2YKMA 1RT5A 1JLCA 3NF9A 4Y1CA 2WOMA 4DTXA 3MEDA 4DSEA 4Z4CA 3DOLA 3AVLA 3NFAA 1A5VA 1EP4A 4FW2A 3OYAA 4DU1A 3AVMA 3NE6A 5HRRA 1S9EA 4DTOA 5C24A 3T19A 3THVA 4N41A 1RBSA 1BL3A 3LWLA 3RR7A 4CJKA 1SL1A 4C8NA 2YHBA 3LP1A 4CEFA 3O3HA 2G8VA 4W5OA 3O3FA 3IAYA 3O3GA 1XHXA 1QE1A 4FJKA 1HRHA 4CIGA 1TKTA 4DU4A 4GVMA 3QNOA 4CJSA 1RTJA 4E7IA 4Z4GA 3LAMA 4NYNA 1Z26A 4RG8A 1KVBA 4CHQA 3TAGA 1NJYA 1VSDA 4OKKA 1KRPA 4OVLA 2X6NA 1SL0A 3OYGA 1VK0A 3TAMA 3OYCA 4B9MA 4CERA 3SQ2A 4M3UA 3V1OA 1C1CA 3SUOA 3SI6A 4KO0A 4O44A 2YNIA 3AVBA 4CGJA 5SZTA 3C94A 5EU7A 4Q0BA 3HXMA 4CEBA 1TL3A 4FK4A 4KHWA 1UAXA 3OYJA 1ZBIA 4TSXA 2YNFA 3VQBA 1S1VA 3ZCMA 1HJRA 2JGUA 1WSEA 4DSLA 1RT4A 4DF4A 4CHOA 4CHZA 4CEQA 3A2FA 3HM9A 4FCYA 3DLBA 1CZBA 1CXUA 4LSLA 4KB1A 2I5JA 2G8KA 4IKFA 1QTMA 4FZYA 1WN7A 4QAGA 2D5RA 1F21A 3O4NA 4CJ3A 2P5GA 3DYAA 1RT6A 3OJUA 2RN2A 4F3OA 3S3OA 1JLBA 5KI6A 3RMDA 4EZ9A 1O1WA 4DTNA 1GOBA 1B9FA 4FLZA 3HVTA 4FLTA 1ZYQA 2HHTA 4FLXA 3V4IA 3PX4A 3VN5A 3V9SA 2A1SA 4K8ZA 3LAKA 4CECA 2G8UA 1IKVA 1RTIA 1U4BA 2YNGA 1S1XA 1VRUA 3MEGA 1X9WA 4PWDA 1BIUA 2HVIA 5HBMA 4OLAA 3LZIA 3UIQA 2RPIA 1JLFA 3QEVA 2JLEA 4F2RA 4AILC 4KB0A 3HPHA 3OYLA 4FM0A 1ITGA 4CJVA 1I39A 1S9GA 3SYZA 3JSMA 3L2RA 1KFDA 4IBNA 4RW6A 4CJWA 3L2UA 4F2SA 2DY4A 3SCXA 4CF9A 4W5RA 1RILA 1HPZA 2FC0A 1J9AA 1NK0A 2KZZA 2OA8A 3IRXA 2PY5A 3V9XA 2QK9A 1C1BA 2HHQA 4AHUA 1CXQA 4XIUA 3OY9A 3C6TA 4N47A 3VQ7A 1NJWA 4I2PA 4EP5A 3KJVA 3K59A 4BACA 1HNVA 3I0RA 3RMCA 1VSEA 3LWMA 4JS5A 3ISNC 1KVAA 5J2NA 1NK4A 3NF6A 4HCBA 1ZBHA 5D3GA 2RF2A 2YHAA 4B08A 4E3SA 3NCIA 3AVIA 1VSFA 4OGCA 5JS1A 1VSLA 3KIOA 4YFUA 1JLQA 2FBXA 4O4GA 3S9HA 3DLKA 3MECA 3AO2A 2XO7A 4ZTFA 4CJTA 3K58A 1RBUA 3BGRA 4KHQA 4B8CA 1I3AA 3ASMA 1TV6A 3ZSQA 4FXDA 1TKXA 3ZSWA 3V9UA 4OKJA 5DMRA 4CESA 3KLEA 5HP1A 2ZE2A 1TK5A 4ELVA 3K57A 1FXXA 3G0ZA 3DRRA 3LANA 3MXJA 4DQIA 1FKOA 4CHYA 4B8AB 3HP6A 4N5SA 5C42A 2PYJA 1VSJA 3ZT2A 4CFBA 3U3YA 3HYFA 1TK8A 3OS2A 4PA1A 4CEOA 4B9VA 4DTMA 1ZBFA 1Y97A 2FBVA 1JL1A 3DLEA 3MEEA 1LW2A 3TR8A 4AHCA 3V81A 2O4IA 4DSFA 4KRFA 2HHXA 2HHUA 2D0AA 1S1TA 2WONA 2XY5A 4BE1A 1RDBA 3OYNA 1T05A 4E0DA 2XY6A 2QKKA 4DSJA 1L3TA 3HO1A 4Z4HA 4DMNA 1CLQA 4CF0A 1C1AA 4B3OA 4Z0UA 1RTDA 1YTAA 3LPTA 4NCBA 1JLEA 4CEDA 1C0TA 3QIPA 4I2QA 3VQQA 1NK7A 4FJXA 4DS4A 4BDYA 3T3FA 3QLHA 4RW9A 2YV0X 3CM5A 2BDPA 3QETA 1NK5A 3MAQA 3SZ2A 1D8YA 4DQRA 1VSKA 3OS1A 4CEZA 3VA0A 4CK1A 2Z1GA 3D0PA 4GMJB 3VA3A 3AVGA 3QNNA 1HYZA 1SKRA 3DI6A 2ZD1A 3SUQA 1L3SA 3ZSYA 4MQ3A 4CK2A 3TABA 3AA5X 1X9MA 2OPRA 3QEXA 3KK1A 4OKEA 1R0AA 2OYQA 1EETA 1LWCA 1RT2A 5SWMA 3CM6A 1LWEA 4M3ZA 1D5AA 4IG3A 4HCCA 3DOKA 3F9KA 5CYMA 3AV9A 1XHZA 4BE2A 4FJNA 1RCHA 4CJLA 3OYFA 1VSMA 1U49A 3TARA 3U3GA 3TAQA 4KKOA 5J2MA 3CYMA 3B6OA 2Z1IA 4CJPA 4K8XA 1J54A 2EHGA 1YTUA 4DSKA 4FZXC 4OGEA 4C8OA 3OYMA 1X9SA 3RR8A 1JXBA 3HL8A 4PUOA 4E1MA 2B4JA 2IGIA 2XY8A 1BI4A 4CF8A 5FDLA 1L3VA 4FJLA 4Q5VA 4I9QA 4CGDA 2HHWA 4RW8A 4DQQA 1W0HA 4AHRA 4CGFA 4DTUA 3NDKA 4KFBA 2Y1IA 3PX6A 4ELUA 2VG6A 2R7YA 4BWMA 2YKNA 1RTHA 3CFOA 4FJMA 3DMJA 4KPYA 4M3RA 4CGGA 4DFKA 3DRSA 3QEWA 1EXQA 1NK6A 1BCMA 4FK0A 4OPJA 1X1PA 3S3NA 4AH9A 2DFEA 1TAQA 1VSIA 1BQMA 2LSNA 2B6AA 4DTPA 2BANA 1HYVA 1ZBUA 4HHTA 4FK2A 5KRSA 2Z1JA 4AHTA 5FROA 3KLGA 3K5NA 2F96A 3EZ5A 4E7JA 3TAPA 3KD1E 4M3WA 5J2QA 4HUGA 3WNGA 4ICLA 3QEPA 1HNIA 3T1AA 1NK8A 3E01A 2KTQA 3V1RA 4AHSA 5K14A 3V9ZA 3NGIA 1LWFA 1XI1A 2BE2A 3HSTB 4O55A 1TVRA 3CFRA 1MU2A 2D0CA 3MXMA 3P1GA 3CG7A 3SNNA 4KHYA 1UWBA 4FW1A 1B92A 1BISA 3DLHA 1IG9A 3G10A 1BI4B 3SQ0A 3LP3A 1Q9YA 1DLOA 1U45A 1VRTA 1Q9XA 4KREA 4CFCA 1RT1A 1DTTA 1KLNA 4N56A 3V9WA 2HMIA 3C95A 4M42A 4Z4FA 3AA4A 4B9UA 3NHGA 1GOAA 4JS4A 2IS3A 4CF2A 4B9SA 4KI4A 1TGOA 4DWIA 4CCHA 3OVNA 1B9DA 4AHVA 4E7KA 4L8RB 1QSLA 3RRHA 1SUQA 1KVCA 3VQ9A 1EKEA 1D9DA 3OYEA 1U04A 3EYZA 4PQUA 3OYBA 2DFFA 1BHLA 3FFIA 3VQAA 4HTUA 4E7HA 4DTRA 2Q3SA 4OLBA 1ASUA 2VG7A 4DQSA 1BGXT 3NH2A 2IC3A 4E19A 4BWJA 1NOZA 3SPYA 5CZ2A 4FJ7A 3RMAA 2GBZA 4C8LA 4M3YA 3L2VA 4JLHA 3K5OA 3VQEA 4J2EA 3PY8A 3QO9A 1JKHA 4YNQA 2XY7A 5I3UA 3PUFA 4KHNA 4CEAA 4KI6A 4M3XA 4BDZA 3VQ4A 4CJUA 1NKBA 1D9FA 3VQ6A 4IFYA 3NF8A 4CIEA 2VWJA 1SL2A 1UA1A 5KGXA 4E89A 2IAJA 1UA0A 4J2AA 1CZ9A 2ETJA 4RW4A 2DFHA 3V6DA 1HYSA 4UQGA 1QQCA 1WNSA 1WSIA 1Z25A 4C8MA 3AVAA 3K5LA 3NH0A 1IKWA 1JLAA 3AVNA 4DU3A 2X6SA 3LZJA 1Q8IA 4JRQA 3SQ4A 4FJJA 3AVHA 4KTQA 2B5JA 1RDDA 3KKRA 2ITGA 3ZT4A 4FJ5A 4Y1DA 2DTUA 4B9TA 2VG5A 4O0JA 3KK3A 4HVJA 4FLYA 3AO1A 1LV5A 4DSIA 3ITHA 3M8PA 2HNZA 4CFAA 4O0IA 3I0SA 2KZMA 1WSGA 1A5WA 1TKDA 3L8BA 2F8SA 4J2DA 4J2BA 3ZSZA 4DTJA 2HB5A 3HPOA 4C8KA 2PYLA 4KAZA 1L5UA 1S6PA 2EX3A 4GW6A 1T8EA 2X74A 3LP2A 3ZSXA 4FYDA 1WAJA 2PZSA 1C0MA 2NUBA 3AO5A 2XHBA 3SUNA 1RBVA 4E1NA 3L3UA 3OYHA 3PV8A 3P83D 3ULDA 2G8HA 1NKCA 4DFMA 3AVCA 1NKEA 5C25A 5E41A 4CK3A 1G15A 4H4OA 2OZSA 2HNDA 4ELTA 3M8SA 2BGGA 1RDCA 4DLEA 4OPKA 5KGWA 3VQ5A 3QINA 4CHNA 2W42A 1U47A 1ASVA 3K5MA 4ZHRA 1HQUA 5I42A 3KTQA 4CJEA 3K2PA 3RMBA 1RT3A 2A1RA 1DTQA 4FM2A 3QIOA 4FJ8A 3DLRA 5J2PA 3P5JA 4CGIA 3HP9A 1J5OA 3TWHA 2RKIA 3PX0A 3TI0A 4F3TA 4IDKA 1C0UA 2OPSA 4FVMA 5KRTA 4NCGA 2G8WA 1HQEA 3PO5A 4M41A 3HPGA 3LPUA 3ZSRA 4DS5A 2G8IA 1BCOA 3ZT3A 1WSJA 1WSFA 1N6QA 1WLJA 5JS2A 3KLIA 4O5BA 5HRPA 1YT3A 4F8RA 1LAVA 5CYQA 1VSHA 1RNHA 4CJ4A 1QS4A 2P1JA 4M3TA 2XRIA 3NBPA 3SQ1A 1REVA 4H8KA 3WNEA 1YVUA 1N5YA 4QOZB 1EX4A 3NGZA 3ZSVA 3TAEA 1W9HA 3AA2A 4LH5A 3SV4A 3KD5E 3B6PA 3D45A 1S6QA 3AO4A 4CJFA 3OS0A 2HNYA 3KKSA 1BQNA 1RDAA 3OYDA 2HW3A 4EZ6A 4CIFA 1RBRA 3S3MA 1XC9A 4W5TA 3PO4A 4CFDA 1FKPA 3WNFA 3O4QA 3EY1A 1NJXA 4MFBA 3ALYA 2P5OA 4KTZA 2IDOA 3BDPA 4BDPA 4KTWA 2F8TA 3JYTA 4H4MA 3AVKA 3LDSA 4B9LA 1J53A 1ZBLA 4DQPA 2Z1HA 4FLWA 4FLVA 2G8FA 1KLMA 1K6YA 1RT7A 3NF7A 4NCAA 4CJRA 4DG1A 4W5NA 5FRNA 5T7BA 4RW7A 3AVFA 1SV5A 5J1EA 3HJFA 1KTQA 3CFPA 4Z4EA 1IKXA 4QCLA 3KLHA 4HUEA 4FM1A 3U6FA 3AVJA 4DFPA 4KV8A 3IS9A 1IKYA 4NYFA 3L2WA 2QXFA 5DK5A 2E6LA 2ZQBA 2QKBA 3SV3A 1QSSA 4LD0A 3I8DA 4DTSA 1JLGA 1HMVA 1KFSA 3DM2A 4KHSA 1SKWA 3KK2A 3NH1A 2E4LA 2OPPA 4CJQA 3WNHA 4I9LA 3SUPA 4CGHA 2YNHA 3AA3A 4CE9A 1GOCA 3QERA 3ZSOA 1S5JA 3OYKA 3F73A 4FJIA 3LP0A 3NGYA 3MXIA 1LAWA 2D0BA 1KSPA 3ZT0A 1ASWA 1UOCA 2OPQA 3VQ8A 3RTVA 4FJGA 5FRMA 3SPZA 2HVHA 4CJ5A 3NAEA 1RBTA 2O4GA 3CQ8A 4E7LA 3LALA 4I7FA 2KFNA 1T03A 1C6VA 4FLUA 1TAUA 1NK9A 3KLFA 3OYIA 3L2QA 4JRPA 5HROA 1S1WA 1U48A 1NOYA 4FJ9A 4G1QA 3QEIA 2HHVA 1KCFA 3C6UA 4KHUA 3H08A 3M8QA 2ATQA 4ID1A 4IFVA 2E6MA 4N76A 1JXEA 1A5XA 4CHPA 3RRGA 1TK0A 3HVRA 4OJRA 4M45A 1S1UA 3VQPA 1L3UA 4EP4A 4FZZA 4Z4IA 2AJQA 3VQCA 1TKZA 4BE0A 3DRPA 2VWKA 4B9NA 3IG1A 4IG0A 5KTQA 4CF1A 3QESA 2GV9A 3L3VA 4WE1A 4R5PA 4HUFA 2HHSA 1TL1A 5CZ1A 4ID5A 3TANA 2OZMA 1IO2A 1WSHA 2FBYA 2KQ2A 3DLGA 1QSYA 2IOCA 1T7PA 3AO3A 4ZTJA 4CEEA 4LH4A 5HRNA 1LW0A 2P51A 3V1QA 5HRSA 4DFJA 1QHTA 1SKSA 5HLFA 3HT3A 3SJJA 3OJSA 3HK2A 2KW4A 4LY7A 2X78A 4FJHA 3VQDA 2FBTA 4F4KA 1NJZA 3RWUA 1BIZA 3M8RA 1XWLA 3ZT1A 4W5QA 5CY4A 4LSNA 2GUIA
chains in the Genus database with same CATH superfamily
1IH7A 4PY5A 3R9PA 5EX5A 3MDQA 3NF9A 4Y1CA 4CZIA 4DTXA 1EP4A 4B1VA 1NGFA 3RR7A 5AQPA 2YHBA 3LP1A 3ULEA 3IAYA 1XHXA 4CIGA 4GVMA 3QNOA 4CJSA 1RTJA 4Z4GA 3LAMA 2NRVA 4RG8A 1KVBA 2QXLA 5M1QA 3OYGA 3V1OA 5IT9O 3DWLA 4JI6K 4J8FA 3AVBA 4BGAA 5SZTA 5EU7A 2ZF5O 2UU9K 1TL3A 4QS9A 4KHWA 4IOAL 2P9LB 2JGUA 1WSEA 4QS7A 4WFBL 3OBWA 4DSLA 4XH1A 4CHOA 4CHZA 3DLBA 3CC2N 1CZBA 3U8XA 3EEQA 4H5TA 4KB1A 4BROA 2E88A 3LL3A 4QAGA 2D5RA 2NZTA 4CJ3A 4MO4A 5KPRA 3OJUA 4CJ7A 1JLBA 4BRMA 1BOTO 3PX4A 4JNEA 3V9SA 2VGMA 4MLHA 4YOWA 1IBMK 1BA1A 1VRUA 4BRPA 3UKUB 2E1YA 5AQRA 1NGIA 4F2RA 3QEVA 2JLEA 1GLFO 3MMVA 1S9GA 1YF5L 2YHWA 1KFDA 4IBNA 4RW6A 1K9MO 2NNWA 1J9AA 2PY5A 2KHOA 1C1BA 4FWKA 3C6TA 3CQYA 1RFQA 3VTHA 3KJVA 3DLLL 3ISNC 5J2NA 4GVEA 5D3GA 2YHAA 4JK7A 3M5RA 4CZFA 4B1WB 3AVIA 1SZ2A 1VSFA 5AQKA 5JS1A 1VSLA 5AFUH 4DV5K 3DLKA 1LCUA 3AO2A 1ILYA 3CJ7A 3CCJN 3GBTA 1RBUA 2Q1NA 5AZIA 1VQ4N 4FXDA 1TKXA 3V9UA 2O8CA 4OKJA 3K57A 1WBBA 3AARA 4DQIA 3HP6A 5F2RA 5C42A 2PYJA 3U3YA 4H0YB 3OS2A 3ZETB 3TR8A 1LW2A 3CHWA 2XY5A 3OYNA 3VGLA 4OO1J 3HO1A 4Z4HA 1GLLO 2WFBA 1RTDA 4NCBA 3CMEN 1C0TA 3VQQA 3H1VX 4GKJK 2H3GX 3CM5A 2D1KA 1NK5A 3SZ2A 3QB0A 4DQRA 4CEZA 4MDBA 4GV9A 2Z1GA 4NXNK 4B1ZA 1HYZA 3C7NB 1L3SA 1QVGM 3CCUN 1TYQA 4LF9K 3CM6A 1LWEA 3CI5A 1D5AA 4HCCA 4YOYA 2JWLA 4FJNA 4CJLA 1N32K 3THYA 2BUPA 3B6OA 4CJPA 1YTUA 2EHGA 3WQTA 4FZXC 2OTJN 4BRCA 4E1MA 2B4JA 4I9QA 2XY8A 1BI4A 5AQUA 5FDLA 3L6QA 5LL6Z 4CF8A 1L3VA 1U6ZA 2Q31A 4RW8A 1W0HA 5AQVA 1IBLK 4KFBA 4PKGA 2VG6A 2R7YA 1RTHA 1RDWX 4M3RA 1BCMA 1VSIA 2B6AA 2CGLA 1HYVA 4NXMK 2CGJA 4KH5A 2QWLA 3TAPA 4M3WA 3QEPA 4ILJA 4BR2A 3H3OB 3V9ZA 5K14A 3ZEUB 3HSTB 1NMDA 4O8KA 2O8FA 3MXMA 2E2PA 3CQXA 4FW1A 3SMPA 3I55N 1T6DA 2RHKA 3KWIA 1U45A 1VRTA 3O9TA 4KREA 3QBWA 3V9WA 2P9SB 1N34K 3AA4A 3NHGA 4JS4A 1TGOA 4CZHA 1B9DA 4AHVA 3K9JA 4E7KA 1D9DA 3MX2A 4BR0A 2OCEA 3EYZA 4PQUA 3OYBA 2DFFA 3FFIA 3ZX3A 4E19A 4BWJA 1NOZA 5CZ2A 2I7NA 3RMAA 2GBZA 5BRHA 4M3YA 1FJGK 3K5OA 4CBWA 1JKHA 3MX5A 2XY7A 4CEAA 4FWMA 4OPHA 1NKBA 1D9FA 2QTDA 5CHIA 1UA1A 2ETJA 4A5AA 5A2QO 3V6DA 3FZMA 1JLAA 4DV6K 4DU3A 2X6SA 1Q8IA 3SLCA 2UXBK 3BF3A 3P4IA 2ITGA 4FJ5A 2YHYA 3PIOL 1XQSC 5AQTA 4O0JA 3O1WA 4BQLA 4O0IA 4LF7K 1A5WA 2F8SA 4KBOA 4J2DA 4DTJA 2PYLA 5AZIB 1BA0A 5ADXH 1C0MA 2NUBA 1JCFA 5HL7L 1RBVA 4E1NA 1EWQA 3F2KA 3P83D 4HWIA 4G9ZA 1G15A 1E4FT 4DQ8A 4H0PA 3ZX0A 3CETA 4GY2B 4DV0K 4CHNA 2W42A 4JYAK 1HQUA 4JHDA 4DKWA 2HBJA 3CJ1A 4CJEA 1VQ7N 1J5OA 2NLXA 2E2QA 3PX0A 5AQGA 4CI6A 5GINA 3PO5A 4CW7B 3O5BA 1WSJA 3TTFA 3LDOA 1WLJA 3O9UA 1LAVA 5CYQA 1HNXK 3SQ1A 4H8KA 1YVUA 5IWAK 1YVNA 1EX4A 1W9HA 1S6QA 4CJFA 3B8AX 4JKAA 3OS0A 1MDUB 4BQZA 3J7YP 3THYB 4YHHK 2HW3A 1NGHA 4CIFA 1RBRA 3RSEB 1RDUA 1FKPA 5FPNA 3O4QA 1NJXA 4CD1A 1X3MA 5GAGP 3BDPA 4BRHA 4BDPA 4BRLA 2F8TA 4H4MA 4FLWA 4DG1A 4W5NA 5T7BA 4RW7A 4LF4K 3UE5A 3HJFA 4H0VB 3CFPA 3O08A 4DB3A 4JAXA 3T1HK 3U6FA 3QMLA 4KV8A 3IS9A 3L2WA 2QKBA 2E6LA 2ZQBA 1NU0A 4PL7A 3I8DA 4DTSA 1HMVA 4KHSA 1DGKN 3NH1A 1T6CA 2YNHA 3AA3A 4CE9A 2FLOA 2O8DB 2WTUA 3NGYA 3MXIA 4A57A 2D0BA 3U9DA 3SAGA 4O5FA 5LJWA 1KSPA 2O8BA 3O8MA 4X62K 3RTVA 1JCGA 3VETA 4CJ5A 1RBTA 4I7FA 2KFNA 3L4QA 5F0XA 4AQYK 3P31A 2UUBK 5HROA 3Q7BA 3E9PA 4G1QA 3C6UA 2W40A 4KHUA 2ATQA 2E6MA 4ISGA 4CHPA 4B1YB 4M45A 1S1UA 3AY9A 4B9NA 3WXMB 3IG1A 4IG0A 4CF1A 3QESA 4WE1A 3DAWA 5CZ1A 3PLAA 3WT0A 3C6HA 1QSYA 5JMVA 3G4SN 4MLEA 3QDKA 3J81O 2ZWHA 3SJJA 2X78A 3LDLA 1NJZA 2W41A 5DM7L 1QZ5A 4DF8A 1JL2A 3VTIA 2WOMA 3MEDA 2A41A 3DOLA 4DU1A 4WQ5A 3T19A 1RBSA 1NGDA 4BY9C 4C8NA 2IVPA 4CEFA 4W5OA 1VQ6N 3EE8A 3G6EN 4FJKA 1X9JA 3MWTA 4E7IA 4BC2A 4NYNA 4CHQA 1VQ9N 4C23A 1KRPA 4OVLA 4LF5K 1VK0A 1C1CA 3CCEN 3CCRN 1NM1A 4KO0A 4CGJA 5EY4A 3OW2M 1GLEG 3GL1A 4DR5K 3HXMA 5AQFA 2CH5A 2QWQA 4H0TB 3O9RA 3VPZA 1NGJA 2VWBA 4CBXA 1S1VA 1NMNA 1HJRA 1RT4A 4FCYA 4CEQA 3J8AA 5LMUK 4LSLA 2I5JA 4QS8A 1QTMA 4FZYA 3WXJA 1F21A 3O4NA 4YOVA 4YORA 2F9WA 3SAHA 3S3OA 3QFPA 1W7AA 4RWTA 1GOBA 4FLXA 4CECA 1YIJN 1IKVA 3MEGA 5AQXA 1GLCG 3UIQA 2RPIA 1JLFA 4AILC 5AQOA 3OYLA 1GLAG 2GX9A 4CJVA 3SYZA 3A5OC 3D7EO 3L2RA 4KH6A 2F9TA 3VEOA 4W5RA 2FC0A 3CC7N 2OA8A 3V9XA 2QK9A 4NB4A 2HHQA 4AHUA 3WQUA 2Q97A 3VQ7A 3KZBA 1NJWA 4I2PA 4EP5A 3K59A 4BACA 4JKDA 1KVAA 1NK4A 1ZBHA 4B08A 4E3SA 4YFUA 1HKCA 1S22A 3MECA 2XO7A 4ZTFA 4JV5K 4B8CA 1XC3A 2NRHA 3C7NA 3KLEA 4KHPK 4U67L 1T44A 3ZT2A 3BZKA 4LFBK 1TK8A 4A2BA 4PA1A 3QBXA 4BRFA 4DTMA 4B9VA 1Y97A 3DLEA 4AHCA 4IDHA 4WQ4C 1VQNN 2HHXA 4E0DA 4DSJA 1L3TA 1O13A 4DMNA 4FWSA 4CF0A 5GIOA 4BVOA 1YITN 4MDAA 4Z0UA 1JLEA 4I2QA 4BDYA 3T3FA 4RW9A 5C12A 2NRTA 4DR3K 1D8YA 3OS1A 3I8BA 3VEYA 1YUWA 3AVGA 1V4SA 1SKRA 3EZWA 4YOXA 2ZD1A 3BZCA 2W6KA 3TABA 4NLBA 1X9MA 4OKEA 5CE3A 1RT2A 5SWMA 4IG3A 3F9KA 1XHZA 3AV9A 5M1KA 4BE2A 3OYFA 1VSMA 1V4TA 3ZEUA 3U3GA 4JI2K 3TAQA 2ITMA 4K8XA 4OGEA 4PUOA 3HL8A 5C0YA 3VF2A 5F1XA 4NO7A 4AHRA 4CVNE 2Y1IA 2P9SA 1OH7A 1WUAA 3HSCA 2AA4A 1I94K 2GWJA 2IVNA 3CFOA 4FJMA 3DMJA 4DFKA 4M7YA 1NK6A 4FK0A 2HBKA 3S3NA 2LSNA 4DTPA 2BANA 4HHTA 5M1PA 4E7JA 3EZ5A 1QQOA 4HUGA 1N8RO 3K0SA 2ZGYA 2KTQA 1LWFA 4YDUC 2D0CA 4KHYA 3FLCO 3TSQA 3VOVA 1B92A 3CCQN 3DLHA 1BDGA 1IG9A 5M1NA 4CFCA 4FL9A 3P39A 4N56A 4K41A 3SAFA 2HMIA 4B9UA 2IS3A 4B9SA 4DWIA 4L8RB 2OANA 1QSLA 4BRQA 3VQ9A 1EKEA 2J4RA 4IOCL 3W0LA 4DTRA 2Q3SA 2ZM6K 3SPYA 3P38A 5BREA 3CCMN 3PY8A 4YNQA 4JD2B 1XMOK 2Q0RA 4KHNA 5C10A 4CJUA 4GV6A 3FZLA 4J2AA 1UA0A 2YCHA 5AQNA 3FGUA 1IJJA 5JLFA 1VQ8N 3H1QA 4BRKA 1QQCA 3LDNA 4C8MA 3QICA 1Q18A 3NH0A 3UB5A 2PFUA 3GG4A 3LZJA 1M1KO 2A3ZA 2B5JA 1RDDA 3CF5L 4R79A 4Y1DA 3E9OA 4DV2K 2YHXA 2VG5A 3EKSA 3AO1A 3Q7CA 2A6AA 4ILGB 3LM9A 2P9IB 3I0SA 1J5EK 1WSGA 5KPZA 4FWQA 3U4LA 3L8BA 3ZSZA 3HPOA 1K8AO 1L5UA 1S6PA 4GW6A 1T8EA 4H03B 1WAJA 3GDQA 3VEXA 2XHBA 2W6LA 1KAYA 3PV8A 3LM2A 5E41A 4CK3A 4H4OA 3CCVN 1YHQN 2OZSA 1RDCA 4F9OA 1U47A 3K5MA 4ZHRA 5B8HA 1ATRA 3RVCA 1WOQA 3SMSA 3RSEA 1DTQA 4FM2A 3CPWM 1HNWK 3CJAA 3ZYYX 4YOUA 4F3TA 2AP1A 2OPSA 5KRTA 2G8WA 2QWMA 1X3NA 4M41A 3ZSRA 2G8IA 3ZT3A 3H3NO 3CPEA 5BPLA 1N6QA 5HRPA 4LFAK 1VSHA 2HBLA 2XRIA 3NBPA 1REVA 3CJBA 1N5YA 4CZJA 3SV4A 2O8DA 4DR1K 1DEJA 1BQNA 1R59O 1QQNA 1NGEA 4JKGB 3OYDA 5AQMA 5M1OA 3PO4A 4MFBA 3ALYA 3VEVA 4WF9L 3LDSA 2QA4N 1BG3A 4ISEA 4FLVA 2G8FA 4NCAA 2YI1A 2VQEK 1IKXA 1Z05A 4DR7K 3MCAB 3SV3A 1VQPN 1KFSA 4BVPA 2OPPA 3LDQA 4I9LA 5C2FA 3ZSOA 1H1VA 2ASMA 5GAEP 3THXB 4Z94A 1LAWA 3MK6A 4BC4A 1ATSA 4BR7A 1UOCA 2HVHA 4B3SK 2P9PB 3LALA 1T03A 1C6VA 4DR2K 4FLUA 1NK9A 3J80O 4M7XA 3L2QA 3WXKA 3EKUA 1NOYA 1KCFA 3M8QA 3E66A 3BEXA 1TK0A 2AJQA 1L3UA 3VQCA 4BE0A 2GELA 1NGAA 4HUFA 3ZLJA 1TL1A 2ASOA 1IO2A 1WSHA 3DLGA 2OZMA 4CEEA 4LH4A 5HRNA 1OVQA 5HOOA 4A2AA 5HRSA 1SKSA 5HLFA 3HK2A 2KW4A 2QEXN 2UYTA 4FJHA 5AR0A 3OHRA 2FBTA 5BN9A 3ATUA 1NLVA 1E4GT 1XWLA 3ZT1A 4IJNA 1KAZA 5CY4A 4LSNA 2GUIA 1RGIA 3TAFA 2Y1JA 2KFZA 1WAFA 2YKMA 1RT5A 1JLCA 2FSKA 3G71N 4DSEA 1YXQA 4Z4CA 3NFAA 3IUCA 4FW2A 3AVMA 4N41A 5HRRA 4DTOA 3THVA 1BL3A 3LWLA 1SL1A 2V51B 3O3HA 3O3FA 3A8YA 1J6ZA 1QE1A 5JICA 1TKTA 3R3LA 4DU4A 4JI3K 3L0QA 3PIPL 3AAPA 1VSDA 2E20A 2X6NA 4FPBA 1SL0A 4B9MA 3TAMA 3OYCA 3SQ2A 4DUZK 4CZGA 3SI6A 4O44A 1DKGD 3C94A 4PKHA 4BC5A 4BREA 4CEBA 3M3ZA 4FVUA 1ZBIA 3VQBA 2ZJQL 4CZLA 4X66K 5I9EB 3HM9A 2FSNA 4IOXA 3ENBA 2VQFK 2G8KA 1WN7A 1VQLN 5BR8K 2P5GA 3DYAA 1RT6A 2RN2A 4F3OA 3RMDA 4EZ9A 1O1WA 4DTNA 4FLZA 3HVTA 2HHTA 1ZYQA 2P9KA 1W97L 2VCPA 3MN9A 2A1SA 2HF4A 4LFCK 4BRGA 1RTIA 4FOIA 3AAQA 1X9WA 1BIUA 5HBMA 3LZIA 4JI1K 5TKWA 1VAZA 1HR0K 4FM0A 1ITGA 1I39A 3JSMA 1VQ5N 4CJWA 3L2UA 2HSTA 4F2SA 1RILA 1HPZA 3MWPA 1OKJA 3IRXA 1CXQA 4XIUA 3OY9A 5AQWA 3CD6N 1HNVA 1VSEA 3LWMA 4JS5A 2F7TA 5TKYA 4GKKK 2RF2A 1Z6RA 4A62A 3NCIA 4OGCA 3KIOA 2FBXA 4O4GA 1S3XA 4CJTA 1XUPO 3K58A 3VGKA 3A5NC 3ASMA 1TV6A 3ZSQA 4CESA 1TK5A 5HP1A 2ZE2A 1FXXA 1GLJO 3MXJA 3WEEA 1FKOA 4B8AB 1VSJA 3IDHA 1ZBFA 3MEEA 3V81A 2O4IA 4DSFA 2HHUA 1S1TA 1RDBA 1T05A 2QKKA 1YJWN 1CLQA 1C1AA 4B3TK 4FSVA 1YTAA 3LPTA 1U2VB 1NK7A 4FJXA 5AZJB 5C15A 2BDPA 3MAQA 4BR9A 1VSKA 3T7ZA 3VA0A 4CK1A 3ZX2A 4GMJB 3VA3A 3R8EA 3UKRB 5H1SQ 5AQJA 3AA5X 3CC4N 3WXLA 2IVOA 4DV7K 3KK1A 4PHTX 2HBMA 4XH5A 4WCEL 1LWCA 4M3ZA 1HLUA 5CYMA 1YJ9N 1RCHA 2I7PA 4JEPA 3TARA 3HBTA 2Z1IA 4JKFA 2NRRA 4AM6A 4DSKA 4C8OA 2QM1A 4CGDA 3W3DA 4DQQA 3VF4A 4CGFA 3PX6A 3F9MA 4CZMA 5AFUA 4BWMA 2YKNA 5AJ3K 4KPYA 4CGGA 4WFAL 3QEWA 1EXQA 3CERA 4AH9A 3DXKB 1BQMA 4UY8O 4QCLA 2Z1JA 3KD1E 2F96A 2D0OA 5M1FA 3WNGA 4ICLA 1XMQK 3T1AA 3V1RA 4AHSA 4WQ4A 2QI2A 4JD2A 3CFRA 1S72N 1EQYA 1MU2A 3BUZB 3CG7A 3SNNA 1UWBA 1E3MA 1NG9A 2ASPA 3G10A 1Q9YA 3LP3A 1DLOA 2Q2RA 1Q9XA 1RT1A 1DTTA 2GWKA 3MCPA 5C2DA 4K0KK 3C95A 3HM8A 4WQ5C 4CF2A 4KI4A 4CCHA 3OVNA 3RRHA 1SUQA 2KKZA 1BHLA 4OLBA 4EFHA 2NRXA 2P9IA 1BGXT 2NRZA 2P9KB 3L2VA 4JLHA 3VQEA 1Q82O 1M90O 3PUFA 3N4QA 4IZ9A 3D2EB 3SBGA 1ZBSA 2VYPA 3VQ4A 4H5WA 4IFYA 1SL2A 4X65K 3I56N 5KGXA 2IAJA 5FPDA 3NMUA 1NGBA 3NVMA 4RW4A 4C1NI 1HYSA 1WNSA 1WSIA 1C0FA 1Z25A 1IKWA 2EWSA 3AVNA 4FJJA 3SQ4A 4JRQA 1WB9A 1CZAN 3AVHA 2ZJPL 4KTQA 3KKRA 2DTUA 4B9TA 5EOYA 4I6MB 3KK3A 2NRWA 4FLYA 3ITHA 3M8PA 2HNZA 4CFAA 4AF1A 1ATNA 5EXWA 4E1JA 1TKDA 5BPMA 2PAVA 4J2BA 4CBUA 4C8KA 2HB5A 2X74A 3LP2A 3PSIA 2D4WA 3CXCM 2GUPA 3WEEB 4BC3A 1EO1A 2HMPA 3AO5A 4YDUA 2DPNA 1K8KB 1VHXA 3O9SA 1NNEA 2IIRA 3L3UA 2G8HA 1NKCA 4DFMA 4X64K 3A5LC 5JVHL 4ELTA 3M8SA 2A42A 2BGGA 3TTCA 2FXUA 3T69A 4OPKA 4DLEA 2CGKA 1ASVA 2YJEA 4JKGA 3VF6A 3C65A 5E26A 2UXDK 4IO8A 1RT3A 3QIOA 3VEWA 4FJ8A 3DLRA 2UUCK 3P5JA 4CGIA 3TWHA 4H0OA 3AGKA 3TI0A 4H5VA 4IDKA 1C0UA 4FVMA 1QQMA 2E2NA 2GTDA 1HUXA 3J7AP 5GIPA 3HPGA 3LPUA 5BPNA 1BCOA 5FLXO 3J7ZO 4BR4A 2HF3A 3KLIA 1BO5O 2FF3B 3TPQA 4F8RA 1RNHA 4CJ4A 1QS4A 2P1JA 3G25A 3HZ6A 3WNEA 3NGZA 3ZSVA 3AA2A 4YOTA 5DM6L 3KKSA 3THXA 3AGRA 4A59A 1YI2N 4XH4A 3S3MA 5LMNK 2P5OA 3C6AA 2IDOA 4KTZA 5BN8A 2P9PA 3JYTA 3AVKA 4FPAA 4JN4A 1J53A 1ZBLA 4DQPA 5EVZA 1KLMA 2QWRA 5FRNA 3AVFA 4RCHA 5J1EA 4Z4EA 1XNRK 3KVGA 2Q0UA 3KLHA 4HUEA 4FM1A 4KH4A 4DFPA 2OTLN 3A5MC 4IJAA 1IKYA 4NYFA 2E5LK 2QXFA 5DK5A 1QSSA 4LD0A 5ADXA 5KQDA 3DM2A 4DV3K 1SKWA 3KK2A 3D6RA 3SUPA 1NBWA 4CGHA 1TUYA 3QERA 1S5JA 3F73A 3GE1A 3I33A 1BUPA 3FZKA 3LP0A 4CZEA 3BP8A 4FWRA 2Q36A 1HX1A 4C1NK 3THWA 2WUSA 3ZT0A 2OPQA 3N4PA 4FJGA 3SPZA 3H6EA 2JWKA 1OH5A 2O4GA 5GADP 1TAUA 2UXCK 3OYIA 1S1WA 4FJ9A 3QEIA 1Q7YO 2HHVA 2GEMA 3HTVA 3H08A 4MO5A 4ID1A 4N76A 3RRGA 3HVRA 3VQPA 3A0IX 4U7BA 3EO3A 3ENOA 3VESA 3TSPA 3DRPA 5ELZA 2GV9A 3L3VA 4R5PA 4JI5K 2FBYA 2KQ2A 3AO3A 3L4IA 3V1QA 4DFJA 2P9NA 3O80A 3LDPA 3M1FA 4LY7A 3ID8A 2O8EB 3VQDA 1BIZA 1FW6A 4AM7A 3TU5A 2KLAA 4W5QA 3MN7A 4DV4K 4DLGA 1FK9A 4NLCA 4GNIA 4B9QA 3OYAA 3AVLA 1A5VA 1C0GA 3NE6A 1S9EA 2P9UB 3BF1A 5C24A 4CJKA 2YJFA 5JLHA 2G8VA 2FSJA 3O3GA 1HRHA 3JS6A 3DXMB 3TAGA 1NJYA 1Z26A 4OKKA 5AQIA 4PL8A 4CERA 3IKMA 4M3UA 3SUOA 4HTLA 2YNIA 4Q0BA 3M6GA 3CCLN 2E2OA 4FK4A 1UAXA 3OYJA 4TSXA 2YNFA 3ZCMA 4JK8A 4DF4A 1WBDA 4BRNA 3A2FA 4EHUA 3SBTA 5KQ8A 1CXUA 1Q86O 3OBYA 4IKFA 3HOSA 3ULEB 4BG8A 3HOTA 4BRAA 5KI6A 4ISFA 4JKEA 1B9FA 4FLTA 1YJNN 5GAHP 3V4IA 3VN5A 2QWOA 4K8ZA 1QZ6A 3LAKA 2G8UA 3S41A 1U4BA 5AQLA 2YNGA 1S1XA 3EN9A 4PWDA 2HVIA 4OLAA 2HOEA 4FO0A 3VMFB 4CD3A 4KB0A 3HPHA 4XEIA 2DY4A 5CR4A 3SCXA 4CF9A 1NK0A 2QWPA 2KZZA 1NGCA 4N47A 4FWNA 3I0RA 3RMCA 3ATVA 1U2VA 3NF6A 5AZJA 4HCBA 1IG8A 2A5XA 1JLQA 3S9HA 2CH6A 3MN5A 4DR4K 4KHQA 3BGRA 1I3AA 4JI8K 3ZSWA 5DMRA 4ELVA 3UKRA 5E84A 3G0ZA 1QHAA 3DRRA 3LANA 4B1XB 3KK7A 4A61A 4CHYA 4N5SA 4CFBA 3HYFA 1KD1O 1Y64A 4CEOA 2FBVA 1JL1A 4K25A 4KRFA 2D0AA 2WONA 4BE1A 1BU6O 4JK9A 2XY6A 4M63C 3THWB 1OH8A 4B3OA 3VGMA 4CEDA 3QIPA 4DS4A 2V7YA 3QLHA 2YV0X 3QETA 4FWOA 3FZHA 3ID6A 3D0PA 3QNNA 3FE1A 1XNQK 3OTOK 3VERA 2O8CB 3DI6A 3SUQA 4RTFD 3WXIA 3ZSYA 4MQ3A 3IFRA 4CK2A 2OPRA 3QEXA 3DXKA 4H5NA 1R0AA 4IWVA 2OYQA 1HJOA 1EETA 3DOKA 1TUUA 1SQKA 5FPMA 2P9NB 4WYBA 1U49A 2QWNA 2WC9A 3FFKB 4KKOA 5J2MA 3CYMA 3E9LA 1J54A 1KXPA 3OYMA 1X9SA 3RR8A 1JXBA 3OA9A 3GOIA 3QFUA 2IGIA 4FJLA 4Q5VA 2HHWA 2ZGZA 1W2BM 4DTUA 3NDKA 4ELUA 1GLDG 1KC8O 2E1ZA 3HI0A 3DRSA 1SS6A 2RE2A 4WFNL 1BWFO 3D2FA 4OPJA 1X1PA 2DFEA 1TAQA 4L3QA 4OPAA 1TYQB 4JKCA 1ZBUA 1KQSM 4FK2A 5KRSA 1HPMA 4AHTA 5FROA 3KLGA 3K5NA 2V52B 1N33K 5J2QA 1NK8A 1HNIA 1IV0A 3E01A 3MN6A 3NGIA 1XI1A 2BE2A 4O55A 1TVRA 3H46O 5AQSA 1KAXA 3D2EA 3P1GA 2D0PA 2HHHK 1BISA 5JVGL 5FPEA 3SK3A 1BI4B 3SQ0A 2FF6A 4B3RK 4H5RA 1KLNA 4M42A 1Q81O 4Z4FA 4IEIA 1GOAA 4K42A 1KVCA 4BG9A 4IEEA 3OYEA 1U04A 3IMXA 4O8UA 4B1UB 4I6MA 4E7HA 4HTUA 3VQAA 5AQQA 4DV1K 1ASUA 2VG7A 2VGNA 3VEZA 4DQSA 3NH2A 2IC3A 4FJ7A 4C8LA 4J2EA 3QO9A 5I3UA 4KI6A 1MWMA 4M3XA 3VENA 4DCHA 4BDZA 2O8FB 4JKHA 3VQ6A 4DR6K 2VWJA 3NF8A 1MA9B 3BY5A 4CIEA 3KWGA 5LY3A 1NJIO 1VQMN 1N36K 3F5TA 4E89A 1K8KA 1CZ9A 1SAZA 2DFHA 3CJ9A 4UQGA 3NVKA 3HRGA 2BTFA 3AVAA 3O4WA 3WUHA 3K5LA 5BRFA 1HNZK 3SJHA 5BRDA 3ZT4A 1QVFM 5LJVA 1ZXOA 2PBDA 3R1XA 4HVJA 4DSIA 1LV5A 1T3VA 2KZMA 4KAZA 2EX3A 1G99A 3ZSXA 4FYDA 2PZSA 1D4XA 3SUNA 3O9QA 4FWLA 3OYHA 4BGBA 4EAHD 3ULDA 3AVCA 1NKEA 5C25A 4IXCA 4OX9K 2P9LA 2HNDA 2A40A 3TTDA 3R6MA 3JXUA 5KGWA 3VQ5A 3QINA 5I42A 5MLCQ 3FZFA 1JCEA 3KTQA 3K2PA 4LC9B 3RMBA 2A1RA 4JKBA 5J2PA 3HP9A 4EHTA 2RKIA 1VQON 2F4VK 1NGGA 1OVYA 4FWPA 4NCGA 1HQEA 4FOEA 1K73O 4DS5A 3FR0A 4LF6K 1WSFA 5JS2A 1ESVA 4O5BA 4IFEA 3UKUA 1YT3A 4M3TA 1JJ2M 4QOZB 3TAEA 4LH5A 3CIPA 3KD5E 3B6PA 3D45A 5AQYA 3AO4A 3H45C 2HNYA 3O6WA 2E8AA 1MWKA 1RDAA 4JHDB 4EZ6A 3JAMO 5BR9A 1XC9A 3CJCA 4W5TA 4CFDA 3WNFA 1HKGA 3EY1A 5KPTA 4BRDA 1LOTB 4DUYK 4KTWA 4YY3K 3C0BA 4B9LA 3O1BA 1P90A 2Z1HA 4JI4K 1RT7A 1K6YA 1DT9A 3KHYA 3NF7A 4EIAA 4CJRA 2BH1A 1SV5A 1KTQA 3ENHA 1YAGA 4K43A 3D2FB 3AVJA 1P8ZA 4JI7K 1VQKN 5AQHA 2V7ZA 1JLGA 3U9ZA 2E4LA 4CJQA 3WNHA 1GOCA 4IO9L 3ZETA 3OYKA 3CMAN 4FJIA 2YX6A 4ILHA 2UUAK 3TSUA 4BR5A 1ASWA 3VQ8A 4CZKA 4B3MK 5FRMA 4BRIA 2O8EA 3CCSN 3NAEA 4LF8K 4E7LA 3CQ8A 1HKBA 1OH6A 3KLFA 2WBNA 4JRPA 1U48A 4JI0K 2QW9A 1NWKA 4GV3A 3T1YK 1EWRA 4IFVA 2P9UA 1JXEA 1A5XA 4OJRA 3PSFA 4FZZA 4V19S 4EP4A 4Z4IA 3EL2A 4A5BA 4PKIA 1TKZA 1ZC6A 2VWKA 4DHYA 5KTQA 3DXMA 2HHSA 4ID5A 3TANA 1T7PA 3K9KA 2IOCA 4Y0WA 4ZTJA 1LW0A 2P51A 1QHTA 2O8BB 3HT3A 3OJSA 1IBKK 3EE9A 5AQZA 4F4KA 1GLBG 2ZJRL 3RWUA 3M8RA 3DJCA 3E1YA 4H0XB
chains in the Genus database with same CATH topology
4DLGA 1IH7A 3TAFA 4PY5A 2Y1JA 1FK9A 2KFZA 4DF8A 1JL2A 1WAFA 2YKMA 1RT5A 1JLCA 3NF9A 4Y1CA 2WOMA 4DTXA 3MEDA 4DSEA 4Z4CA 3DOLA 3AVLA 3NFAA 1A5VA 1EP4A 4FW2A 3OYAA 4DU1A 3AVMA 3NE6A 5HRRA 1S9EA 4DTOA 5C24A 3T19A 3THVA 4N41A 1RBSA 1BL3A 3LWLA 3RR7A 4CJKA 1SL1A 4C8NA 2YHBA 3LP1A 4CEFA 3O3HA 2G8VA 4W5OA 3O3FA 3IAYA 3O3GA 1XHXA 1QE1A 4FJKA 1HRHA 4CIGA 1TKTA 4DU4A 4GVMA 3QNOA 4CJSA 1RTJA 4E7IA 4Z4GA 3LAMA 4NYNA 1Z26A 4RG8A 1KVBA 4CHQA 3TAGA 1NJYA 1VSDA 4OKKA 1KRPA 4OVLA 2X6NA 1SL0A 3OYGA 1VK0A 3TAMA 3OYCA 4B9MA 4CERA 3SQ2A 4M3UA 3V1OA 1C1CA 3SUOA 3SI6A 4KO0A 4O44A 2YNIA 3AVBA 4CGJA 5SZTA 3C94A 5EU7A 4Q0BA 3HXMA 4CEBA 1TL3A 4FK4A 4KHWA 1UAXA 3OYJA 1ZBIA 4TSXA 2YNFA 3VQBA 1S1VA 3ZCMA 1HJRA 2JGUA 1WSEA 4DSLA 1RT4A 4DF4A 4CHOA 4CHZA 4CEQA 3A2FA 3HM9A 4FCYA 3DLBA 1CZBA 1CXUA 4LSLA 4KB1A 2I5JA 2G8KA 4IKFA 1QTMA 4FZYA 1WN7A 4QAGA 2D5RA 1F21A 3O4NA 4CJ3A 2P5GA 3DYAA 1RT6A 3OJUA 2RN2A 4F3OA 3S3OA 1JLBA 5KI6A 3RMDA 4EZ9A 1O1WA 4DTNA 1GOBA 1B9FA 4FLZA 3HVTA 4FLTA 1ZYQA 2HHTA 4FLXA 3V4IA 3PX4A 3VN5A 3V9SA 2A1SA 4K8ZA 3LAKA 4CECA 2G8UA 1IKVA 1RTIA 1U4BA 2YNGA 1S1XA 1VRUA 3MEGA 1X9WA 4PWDA 1BIUA 2HVIA 5HBMA 4OLAA 3LZIA 3UIQA 2RPIA 1JLFA 3QEVA 2JLEA 4F2RA 4AILC 4KB0A 3HPHA 3OYLA 4FM0A 1ITGA 4CJVA 1I39A 1S9GA 3SYZA 3JSMA 3L2RA 1KFDA 4IBNA 4RW6A 4CJWA 3L2UA 4F2SA 2DY4A 3SCXA 4CF9A 4W5RA 1RILA 1HPZA 2FC0A 1J9AA 1NK0A 2KZZA 2OA8A 3IRXA 2PY5A 3V9XA 2QK9A 1C1BA 2HHQA 4AHUA 1CXQA 4XIUA 3OY9A 3C6TA 4N47A 3VQ7A 1NJWA 4I2PA 4EP5A 3KJVA 3K59A 4BACA 1HNVA 3I0RA 3RMCA 1VSEA 3LWMA 4JS5A 3ISNC 1KVAA 5J2NA 1NK4A 3NF6A 4HCBA 1ZBHA 5D3GA 2RF2A 2YHAA 4B08A 4E3SA 3NCIA 3AVIA 1VSFA 4OGCA 5JS1A 1VSLA 3KIOA 4YFUA 1JLQA 2FBXA 4O4GA 3S9HA 3DLKA 3MECA 3AO2A 2XO7A 4ZTFA 4CJTA 3K58A 1RBUA 3BGRA 4KHQA 4B8CA 1I3AA 3ASMA 1TV6A 3ZSQA 4FXDA 1TKXA 3ZSWA 3V9UA 4OKJA 5DMRA 4CESA 3KLEA 5HP1A 2ZE2A 1TK5A 4ELVA 3K57A 1FXXA 3G0ZA 3DRRA 3LANA 3MXJA 4DQIA 1FKOA 4CHYA 4B8AB 3HP6A 4N5SA 5C42A 2PYJA 1VSJA 3ZT2A 4CFBA 3U3YA 3HYFA 1TK8A 3OS2A 4PA1A 4CEOA 4B9VA 4DTMA 1ZBFA 1Y97A 2FBVA 1JL1A 3DLEA 3MEEA 1LW2A 3TR8A 4AHCA 3V81A 2O4IA 4DSFA 4KRFA 2HHXA 2HHUA 2D0AA 1S1TA 2WONA 2XY5A 4BE1A 1RDBA 3OYNA 1T05A 4E0DA 2XY6A 2QKKA 4DSJA 1L3TA 3HO1A 4Z4HA 4DMNA 1CLQA 4CF0A 1C1AA 4B3OA 4Z0UA 1RTDA 1YTAA 3LPTA 4NCBA 1JLEA 4CEDA 1C0TA 3QIPA 4I2QA 3VQQA 1NK7A 4FJXA 4DS4A 4BDYA 3T3FA 3QLHA 4RW9A 2YV0X 3CM5A 2BDPA 3QETA 1NK5A 3MAQA 3SZ2A 1D8YA 4DQRA 1VSKA 3OS1A 4CEZA 3VA0A 4CK1A 2Z1GA 3D0PA 4GMJB 3VA3A 3AVGA 3QNNA 1HYZA 1SKRA 3DI6A 2ZD1A 3SUQA 1L3SA 3ZSYA 4MQ3A 4CK2A 3TABA 3AA5X 1X9MA 2OPRA 3QEXA 3KK1A 4OKEA 1R0AA 2OYQA 1EETA 1LWCA 1RT2A 5SWMA 3CM6A 1LWEA 4M3ZA 1D5AA 4IG3A 4HCCA 3DOKA 3F9KA 5CYMA 3AV9A 1XHZA 4BE2A 4FJNA 1RCHA 4CJLA 3OYFA 1VSMA 1U49A 3TARA 3U3GA 3TAQA 4KKOA 5J2MA 3CYMA 3B6OA 2Z1IA 4CJPA 4K8XA 1J54A 2EHGA 1YTUA 4DSKA 4FZXC 4OGEA 4C8OA 3OYMA 1X9SA 3RR8A 1JXBA 3HL8A 4PUOA 4E1MA 2B4JA 2IGIA 2XY8A 1BI4A 4CF8A 5FDLA 1L3VA 4FJLA 4Q5VA 4I9QA 4CGDA 2HHWA 4RW8A 4DQQA 1W0HA 4AHRA 4CGFA 4DTUA 3NDKA 4KFBA 2Y1IA 3PX6A 4ELUA 2VG6A 2R7YA 4BWMA 2YKNA 1RTHA 3CFOA 4FJMA 3DMJA 4KPYA 4M3RA 4CGGA 4DFKA 3DRSA 3QEWA 1EXQA 1NK6A 1BCMA 4FK0A 4OPJA 1X1PA 3S3NA 4AH9A 2DFEA 1TAQA 1VSIA 1BQMA 2LSNA 2B6AA 4DTPA 2BANA 1HYVA 1ZBUA 4HHTA 4FK2A 5KRSA 2Z1JA 4AHTA 5FROA 3KLGA 3K5NA 2F96A 3EZ5A 4E7JA 3TAPA 3KD1E 4M3WA 5J2QA 4HUGA 3WNGA 4ICLA 3QEPA 1HNIA 3T1AA 1NK8A 3E01A 2KTQA 3V1RA 4AHSA 5K14A 3V9ZA 3NGIA 1LWFA 1XI1A 2BE2A 3HSTB 4O55A 1TVRA 3CFRA 1MU2A 2D0CA 3MXMA 3P1GA 3CG7A 3SNNA 4KHYA 1UWBA 4FW1A 1B92A 1BISA 3DLHA 1IG9A 3G10A 1BI4B 3SQ0A 3LP3A 1Q9YA 1DLOA 1U45A 1VRTA 1Q9XA 4KREA 4CFCA 1RT1A 1DTTA 1KLNA 4N56A 3V9WA 2HMIA 3C95A 4M42A 4Z4FA 3AA4A 4B9UA 3NHGA 1GOAA 4JS4A 2IS3A 4CF2A 4B9SA 4KI4A 1TGOA 4DWIA 4CCHA 3OVNA 1B9DA 4AHVA 4E7KA 4L8RB 1QSLA 3RRHA 1SUQA 1KVCA 3VQ9A 1EKEA 1D9DA 3OYEA 1U04A 3EYZA 4PQUA 3OYBA 2DFFA 1BHLA 3FFIA 3VQAA 4HTUA 4E7HA 4DTRA 2Q3SA 4OLBA 1ASUA 2VG7A 4DQSA 1BGXT 3NH2A 2IC3A 4E19A 4BWJA 1NOZA 3SPYA 5CZ2A 4FJ7A 3RMAA 2GBZA 4C8LA 4M3YA 3L2VA 4JLHA 3K5OA 3VQEA 4J2EA 3PY8A 3QO9A 1JKHA 4YNQA 2XY7A 5I3UA 3PUFA 4KHNA 4CEAA 4KI6A 4M3XA 4BDZA 3VQ4A 4CJUA 1NKBA 1D9FA 3VQ6A 4IFYA 3NF8A 4CIEA 2VWJA 1SL2A 1UA1A 5KGXA 4E89A 2IAJA 1UA0A 4J2AA 1CZ9A 2ETJA 4RW4A 2DFHA 3V6DA 1HYSA 4UQGA 1QQCA 1WNSA 1WSIA 1Z25A 4C8MA 3AVAA 3K5LA 3NH0A 1IKWA 1JLAA 3AVNA 4DU3A 2X6SA 3LZJA 1Q8IA 4JRQA 3SQ4A 4FJJA 3AVHA 4KTQA 2B5JA 1RDDA 3KKRA 2ITGA 3ZT4A 4FJ5A 4Y1DA 2DTUA 4B9TA 2VG5A 4O0JA 3KK3A 4HVJA 4FLYA 3AO1A 1LV5A 4DSIA 3ITHA 3M8PA 2HNZA 4CFAA 4O0IA 3I0SA 2KZMA 1WSGA 1A5WA 1TKDA 3L8BA 2F8SA 4J2DA 4J2BA 3ZSZA 4DTJA 2HB5A 3HPOA 4C8KA 2PYLA 4KAZA 1L5UA 1S6PA 2EX3A 4GW6A 1T8EA 2X74A 3LP2A 3ZSXA 4FYDA 1WAJA 2PZSA 1C0MA 2NUBA 3AO5A 2XHBA 3SUNA 1RBVA 4E1NA 3L3UA 3OYHA 3PV8A 3P83D 3ULDA 2G8HA 1NKCA 4DFMA 3AVCA 1NKEA 5C25A 5E41A 4CK3A 1G15A 4H4OA 2OZSA 2HNDA 4ELTA 3M8SA 2BGGA 1RDCA 4DLEA 4OPKA 5KGWA 3VQ5A 3QINA 4CHNA 2W42A 1U47A 1ASVA 3K5MA 4ZHRA 1HQUA 5I42A 3KTQA 4CJEA 3K2PA 3RMBA 1RT3A 2A1RA 1DTQA 4FM2A 3QIOA 4FJ8A 3DLRA 5J2PA 3P5JA 4CGIA 3HP9A 1J5OA 3TWHA 2RKIA 3PX0A 3TI0A 4F3TA 4IDKA 1C0UA 2OPSA 4FVMA 5KRTA 4NCGA 2G8WA 1HQEA 3PO5A 4M41A 3HPGA 3LPUA 3ZSRA 4DS5A 2G8IA 1BCOA 3ZT3A 1WSJA 1WSFA 1N6QA 1WLJA 5JS2A 3KLIA 4O5BA 5HRPA 1YT3A 4F8RA 1LAVA 5CYQA 1VSHA 1RNHA 4CJ4A 1QS4A 2P1JA 4M3TA 2XRIA 3NBPA 3SQ1A 1REVA 4H8KA 3WNEA 1YVUA 1N5YA 4QOZB 1EX4A 3NGZA 3ZSVA 3TAEA 1W9HA 3AA2A 4LH5A 3SV4A 3KD5E 3B6PA 3D45A 1S6QA 3AO4A 4CJFA 3OS0A 2HNYA 3KKSA 1BQNA 1RDAA 3OYDA 2HW3A 4EZ6A 4CIFA 1RBRA 3S3MA 1XC9A 4W5TA 3PO4A 4CFDA 1FKPA 3WNFA 3O4QA 3EY1A 1NJXA 4MFBA 3ALYA 2P5OA 4KTZA 2IDOA 3BDPA 4BDPA 4KTWA 2F8TA 3JYTA 4H4MA 3AVKA 3LDSA 4B9LA 1J53A 1ZBLA 4DQPA 2Z1HA 4FLWA 4FLVA 2G8FA 1KLMA 1K6YA 1RT7A 3NF7A 4NCAA 4CJRA 4DG1A 4W5NA 5FRNA 5T7BA 4RW7A 3AVFA 1SV5A 5J1EA 3HJFA 1KTQA 3CFPA 4Z4EA 1IKXA 4QCLA 3KLHA 4HUEA 4FM1A 3U6FA 3AVJA 4DFPA 4KV8A 3IS9A 1IKYA 4NYFA 3L2WA 2QXFA 5DK5A 2E6LA 2ZQBA 2QKBA 3SV3A 1QSSA 4LD0A 3I8DA 4DTSA 1JLGA 1HMVA 1KFSA 3DM2A 4KHSA 1SKWA 3KK2A 3NH1A 2E4LA 2OPPA 4CJQA 3WNHA 4I9LA 3SUPA 4CGHA 2YNHA 3AA3A 4CE9A 1GOCA 3QERA 3ZSOA 1S5JA 3OYKA 3F73A 4FJIA 3LP0A 3NGYA 3MXIA 1LAWA 2D0BA 1KSPA 3ZT0A 1ASWA 1UOCA 2OPQA 3VQ8A 3RTVA 4FJGA 5FRMA 3SPZA 2HVHA 4CJ5A 3NAEA 1RBTA 2O4GA 3CQ8A 4E7LA 3LALA 4I7FA 2KFNA 1T03A 1C6VA 4FLUA 1TAUA 1NK9A 3KLFA 3OYIA 3L2QA 4JRPA 5HROA 1S1WA 1U48A 1NOYA 4FJ9A 4G1QA 3QEIA 2HHVA 1KCFA 3C6UA 4KHUA 3H08A 3M8QA 2ATQA 4ID1A 4IFVA 2E6MA 4N76A 1JXEA 1A5XA 4CHPA 3RRGA 1TK0A 3HVRA 4OJRA 4M45A 1S1UA 3VQPA 1L3UA 4EP4A 4FZZA 4Z4IA 2AJQA 3VQCA 1TKZA 4BE0A 3DRPA 2VWKA 4B9NA 3IG1A 4IG0A 5KTQA 4CF1A 3QESA 2GV9A 3L3VA 4WE1A 4R5PA 4HUFA 2HHSA 1TL1A 5CZ1A 4ID5A 3TANA 2OZMA 1IO2A 1WSHA 2FBYA 2KQ2A 3DLGA 1QSYA 2IOCA 1T7PA 3AO3A 4ZTJA 4CEEA 4LH4A 5HRNA 1LW0A 2P51A 3V1QA 5HRSA 4DFJA 1QHTA 1SKSA 5HLFA 3HT3A 3SJJA 3OJSA 3HK2A 2KW4A 4LY7A 2X78A 4FJHA 3VQDA 2FBTA 4F4KA 1NJZA 3RWUA 1BIZA 3M8RA 1XWLA 3ZT1A 4W5QA 5CY4A 4LSNA 2GUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DLG A;  1IH7 A;  3TAF A;  4PY5 A;  2Y1J A;  1FK9 A;  2KFZ A;  4DF8 A;  1JL2 A;  1WAF A;  2YKM A;  1RT5 A;  1JLC A;  3NF9 A;  4Y1C A;  2WOM A;  4DTX A;  3MED A;  4DSE A;  4Z4C A;  3DOL A;  3AVL A;  3NFA A;  1A5V A;  1EP4 A;  4FW2 A;  3OYA A;  4DU1 A;  3AVM A;  3NE6 A;  5HRR A;  1S9E A;  4DTO A;  5C24 A;  3T19 A;  3THV A;  4N41 A;  1RBS A;  1BL3 A;  3LWL A;  3RR7 A;  4CJK A;  1SL1 A;  4C8N A;  2YHB A;  3LP1 A;  4CEF A;  3O3H A;  2G8V A;  4W5O A;  3O3F A;  3IAY A;  3O3G A;  1XHX A;  1QE1 A;  4FJK A;  1HRH A;  4CIG A;  1TKT A;  4DU4 A;  4GVM A;  3QNO A;  4CJS A;  1RTJ A;  4E7I A;  4Z4G A;  3LAM A;  4NYN A;  1Z26 A;  4RG8 A;  1KVB A;  4CHQ A;  3TAG A;  1NJY A;  1VSD A;  4OKK A;  1KRP A;  4OVL A;  2X6N A;  1SL0 A;  3OYG A;  1VK0 A;  3TAM A;  3OYC A;  4B9M A;  4CER A;  3SQ2 A;  4M3U A;  3V1O A;  1C1C A;  3SUO A;  3SI6 A;  4KO0 A;  4O44 A;  2YNI A;  3AVB A;  4CGJ A;  5SZT A;  3C94 A;  5EU7 A;  4Q0B A;  3HXM A;  4CEB A;  1TL3 A;  4FK4 A;  4KHW A;  1UAX A;  3OYJ A;  1ZBI A;  4TSX A;  2YNF A;  3VQB A;  1S1V A;  3ZCM A;  1HJR A;  2JGU A;  1WSE A;  4DSL A;  1RT4 A;  4DF4 A;  4CHO A;  4CHZ A;  4CEQ A;  3A2F A;  3HM9 A;  4FCY A;  3DLB A;  1CZB A;  1CXU A;  4LSL A;  4KB1 A;  2I5J A;  2G8K A;  4IKF A;  1QTM A;  4FZY A;  1WN7 A;  4QAG A;  2D5R A;  1F21 A;  3O4N A;  4CJ3 A;  2P5G A;  3DYA A;  1RT6 A;  3OJU A;  2RN2 A;  4F3O A;  3S3O A;  1JLB A;  5KI6 A;  3RMD A;  4EZ9 A;  1O1W A;  4DTN A;  1GOB A;  1B9F A;  4FLZ A;  3HVT A;  4FLT A;  1ZYQ A;  2HHT A;  4FLX A;  3V4I A;  3PX4 A;  3VN5 A;  3V9S A;  2A1S A;  4K8Z A;  3LAK A;  4CEC A;  2G8U A;  1IKV A;  1RTI A;  1U4B A;  2YNG A;  1S1X A;  1VRU A;  3MEG A;  1X9W A;  4PWD A;  1BIU A;  2HVI A;  5HBM A;  4OLA A;  3LZI A;  3UIQ A;  2RPI A;  1JLF A;  3QEV A;  2JLE A;  4F2R A;  4AIL C;  4KB0 A;  3HPH A;  3OYL A;  4FM0 A;  1ITG A;  4CJV A;  1I39 A;  1S9G A;  3SYZ A;  3JSM A;  3L2R A;  1KFD A;  4IBN A;  4RW6 A;  4CJW A;  3L2U A;  4F2S A;  2DY4 A;  3SCX A;  4CF9 A;  4W5R A;  1RIL A;  1HPZ A;  2FC0 A;  1J9A A;  1NK0 A;  2KZZ A;  2OA8 A;  3IRX A;  2PY5 A;  3V9X A;  2QK9 A;  1C1B A;  2HHQ A;  4AHU A;  1CXQ A;  4XIU A;  3OY9 A;  3C6T A;  4N47 A;  3VQ7 A;  1NJW A;  4I2P A;  4EP5 A;  3KJV A;  3K59 A;  4BAC A;  1HNV A;  3I0R A;  3RMC A;  1VSE A;  3LWM A;  4JS5 A;  3ISN C;  1KVA A;  5J2N A;  1NK4 A;  3NF6 A;  4HCB A;  1ZBH A;  5D3G A;  2RF2 A;  2YHA A;  4B08 A;  4E3S A;  3NCI A;  3AVI A;  1VSF A;  4OGC A;  5JS1 A;  1VSL A;  3KIO A;  4YFU A;  1JLQ A;  2FBX A;  4O4G A;  3S9H A;  3DLK A;  3MEC A;  3AO2 A;  2XO7 A;  4ZTF A;  4CJT A;  3K58 A;  1RBU A;  3BGR A;  4KHQ A;  4B8C A;  1I3A A;  3ASM A;  1TV6 A;  3ZSQ A;  4FXD A;  1TKX A;  3ZSW A;  3V9U A;  4OKJ A;  5DMR A;  4CES A;  3KLE A;  5HP1 A;  2ZE2 A;  1TK5 A;  4ELV A;  3K57 A;  1FXX A;  3G0Z A;  3DRR A;  3LAN A;  3MXJ A;  4DQI A;  1FKO A;  4CHY A;  4B8A B;  3HP6 A;  4N5S A;  5C42 A;  2PYJ A;  1VSJ A;  3ZT2 A;  4CFB A;  3U3Y A;  3HYF A;  1TK8 A;  3OS2 A;  4PA1 A;  4CEO A;  4B9V A;  4DTM A;  1ZBF A;  1Y97 A;  2FBV A;  1JL1 A;  3DLE A;  3MEE A;  1LW2 A;  3TR8 A;  4AHC A;  3V81 A;  2O4I A;  4DSF A;  4KRF A;  2HHX A;  2HHU A;  2D0A A;  1S1T A;  2WON A;  2XY5 A;  4BE1 A;  1RDB A;  3OYN A;  1T05 A;  4E0D A;  2XY6 A;  2QKK A;  4DSJ A;  1L3T A;  3HO1 A;  4Z4H A;  4DMN A;  1CLQ A;  4CF0 A;  1C1A A;  4B3O A;  4Z0U A;  1RTD A;  1YTA A;  3LPT A;  4NCB A;  1JLE A;  4CED A;  1C0T A;  3QIP A;  4I2Q A;  3VQQ A;  1NK7 A;  4FJX A;  4DS4 A;  4BDY A;  3T3F A;  3QLH A;  4RW9 A;  2YV0 X;  3CM5 A;  2BDP A;  3QET A;  1NK5 A;  3MAQ A;  3SZ2 A;  1D8Y A;  4DQR A;  1VSK A;  3OS1 A;  4CEZ A;  3VA0 A;  4CK1 A;  2Z1G A;  3D0P A;  4GMJ B;  3VA3 A;  3AVG A;  3QNN A;  1HYZ A;  1SKR A;  3DI6 A;  2ZD1 A;  3SUQ A;  1L3S A;  3ZSY A;  4MQ3 A;  4CK2 A;  3TAB A;  3AA5 X;  1X9M A;  2OPR A;  3QEX A;  3KK1 A;  4OKE A;  1R0A A;  2OYQ A;  1EET A;  1LWC A;  1RT2 A;  5SWM A;  3CM6 A;  1LWE A;  4M3Z A;  1D5A A;  4IG3 A;  4HCC A;  3DOK A;  3F9K A;  5CYM A;  3AV9 A;  1XHZ A;  4BE2 A;  4FJN A;  1RCH A;  4CJL A;  3OYF A;  1VSM A;  1U49 A;  3TAR A;  3U3G A;  3TAQ A;  4KKO A;  5J2M A;  3CYM A;  3B6O A;  2Z1I A;  4CJP A;  4K8X A;  1J54 A;  2EHG A;  1YTU A;  4DSK A;  4FZX C;  4OGE A;  4C8O A;  3OYM A;  1X9S A;  3RR8 A;  1JXB A;  3HL8 A;  4PUO A;  4E1M A;  2B4J A;  2IGI A;  2XY8 A;  1BI4 A;  4CF8 A;  5FDL A;  1L3V A;  4FJL A;  4Q5V A;  4I9Q A;  4CGD A;  2HHW A;  4RW8 A;  4DQQ A;  1W0H A;  4AHR A;  4CGF A;  4DTU A;  3NDK A;  4KFB A;  2Y1I A;  3PX6 A;  4ELU A;  2VG6 A;  2R7Y A;  4BWM A;  2YKN A;  1RTH A;  3CFO A;  4FJM A;  3DMJ A;  4KPY A;  4M3R A;  4CGG A;  4DFK A;  3DRS A;  3QEW A;  1EXQ A;  1NK6 A;  1BCM A;  4FK0 A;  4OPJ A;  1X1P A;  3S3N A;  4AH9 A;  2DFE A;  1TAQ A;  1VSI A;  1BQM A;  2LSN A;  2B6A A;  4DTP A;  2BAN A;  1HYV A;  1ZBU A;  4HHT A;  4FK2 A;  5KRS A;  2Z1J A;  4AHT A;  5FRO A;  3KLG A;  3K5N A;  2F96 A;  3EZ5 A;  4E7J A;  3TAP A;  3KD1 E;  4M3W A;  5J2Q A;  4HUG A;  3WNG A;  4ICL A;  3QEP A;  1HNI A;  3T1A A;  1NK8 A;  3E01 A;  2KTQ A;  3V1R A;  4AHS A;  5K14 A;  3V9Z A;  3NGI A;  1LWF A;  1XI1 A;  2BE2 A;  3HST B;  4O55 A;  1TVR A;  3CFR A;  1MU2 A;  2D0C A;  3MXM A;  3P1G A;  3CG7 A;  3SNN A;  4KHY A;  1UWB A;  4FW1 A;  1B92 A;  1BIS A;  3DLH A;  1IG9 A;  3G10 A;  1BI4 B;  3SQ0 A;  3LP3 A;  1Q9Y A;  1DLO A;  1U45 A;  1VRT A;  1Q9X A;  4KRE A;  4CFC A;  1RT1 A;  1DTT A;  1KLN A;  4N56 A;  3V9W A;  2HMI A;  3C95 A;  4M42 A;  4Z4F A;  3AA4 A;  4B9U A;  3NHG A;  1GOA A;  4JS4 A;  2IS3 A;  4CF2 A;  4B9S A;  4KI4 A;  1TGO A;  4DWI A;  4CCH A;  3OVN A;  1B9D A;  4AHV A;  4E7K A;  4L8R B;  1QSL A;  3RRH A;  1SUQ A;  1KVC A;  3VQ9 A;  1EKE A;  1D9D A;  3OYE A;  1U04 A;  3EYZ A;  4PQU A;  3OYB A;  2DFF A;  1BHL A;  3FFI A;  3VQA A;  4HTU A;  4E7H A;  4DTR A;  2Q3S A;  4OLB A;  1ASU A;  2VG7 A;  4DQS A;  1BGX T;  3NH2 A;  2IC3 A;  4E19 A;  4BWJ A;  1NOZ A;  3SPY A;  5CZ2 A;  4FJ7 A;  3RMA A;  2GBZ A;  4C8L A;  4M3Y A;  3L2V A;  4JLH A;  3K5O A;  3VQE A;  4J2E A;  3PY8 A;  3QO9 A;  1JKH A;  4YNQ A;  2XY7 A;  5I3U A;  3PUF A;  4KHN A;  4CEA A;  4KI6 A;  4M3X A;  4BDZ A;  3VQ4 A;  4CJU A;  1NKB A;  1D9F A;  3VQ6 A;  4IFY A;  3NF8 A;  4CIE A;  2VWJ A;  1SL2 A;  1UA1 A;  5KGX A;  4E89 A;  2IAJ A;  1UA0 A;  4J2A A;  1CZ9 A;  2ETJ A;  4RW4 A;  2DFH A;  3V6D A;  1HYS A;  4UQG A;  1QQC A;  1WNS A;  1WSI A;  1Z25 A;  4C8M A;  3AVA A;  3K5L A;  3NH0 A;  1IKW A;  1JLA A;  3AVN A;  4DU3 A;  2X6S A;  3LZJ A;  1Q8I A;  4JRQ A;  3SQ4 A;  4FJJ A;  3AVH A;  4KTQ A;  2B5J A;  1RDD A;  3KKR A;  2ITG A;  3ZT4 A;  4FJ5 A;  4Y1D A;  2DTU A;  4B9T A;  2VG5 A;  4O0J A;  3KK3 A;  4HVJ A;  4FLY A;  3AO1 A;  1LV5 A;  4DSI A;  3ITH A;  3M8P A;  2HNZ A;  4CFA A;  4O0I A;  3I0S A;  2KZM A;  1WSG A;  1A5W A;  1TKD A;  3L8B A;  2F8S A;  4J2D A;  4J2B A;  3ZSZ A;  4DTJ A;  2HB5 A;  3HPO A;  4C8K A;  2PYL A;  4KAZ A;  1L5U A;  1S6P A;  2EX3 A;  4GW6 A;  1T8E A;  2X74 A;  3LP2 A;  3ZSX A;  4FYD A;  1WAJ A;  2PZS A;  1C0M A;  2NUB A;  3AO5 A;  2XHB A;  3SUN A;  1RBV A;  4E1N A;  3L3U A;  3OYH A;  3PV8 A;  3P83 D;  3ULD A;  2G8H A;  1NKC A;  4DFM A;  3AVC A;  1NKE A;  5C25 A;  5E41 A;  4CK3 A;  1G15 A;  4H4O A;  2OZS A;  2HND A;  4ELT A;  3M8S A;  2BGG A;  1RDC A;  4DLE A;  4OPK A;  5KGW A;  3VQ5 A;  3QIN A;  4CHN A;  2W42 A;  1U47 A;  1ASV A;  3K5M A;  4ZHR A;  1HQU A;  5I42 A;  3KTQ A;  4CJE A;  3K2P A;  3RMB A;  1RT3 A;  2A1R A;  1DTQ A;  4FM2 A;  3QIO A;  4FJ8 A;  3DLR A;  5J2P A;  3P5J A;  4CGI A;  3HP9 A;  1J5O A;  3TWH A;  2RKI A;  3PX0 A;  3TI0 A;  4F3T A;  4IDK A;  1C0U A;  2OPS A;  4FVM A;  5KRT A;  4NCG A;  2G8W A;  1HQE A;  3PO5 A;  4M41 A;  3HPG A;  3LPU A;  3ZSR A;  4DS5 A;  2G8I A;  1BCO A;  3ZT3 A;  1WSJ A;  1WSF A;  1N6Q A;  1WLJ A;  5JS2 A;  3KLI A;  4O5B A;  5HRP A;  1YT3 A;  4F8R A;  1LAV A;  5CYQ A;  1VSH A;  1RNH A;  4CJ4 A;  1QS4 A;  2P1J A;  4M3T A;  2XRI A;  3NBP A;  3SQ1 A;  1REV A;  4H8K A;  3WNE A;  1YVU A;  1N5Y A;  4QOZ B;  1EX4 A;  3NGZ A;  3ZSV A;  3TAE A;  1W9H A;  3AA2 A;  4LH5 A;  3SV4 A;  3KD5 E;  3B6P A;  3D45 A;  1S6Q A;  3AO4 A;  4CJF A;  3OS0 A;  2HNY A;  3KKS A;  1BQN A;  1RDA A;  3OYD A;  2HW3 A;  4EZ6 A;  4CIF A;  1RBR A;  3S3M A;  1XC9 A;  4W5T A;  3PO4 A;  4CFD A;  1FKP A;  3WNF A;  3O4Q A;  3EY1 A;  1NJX A;  4MFB A;  3ALY A;  2P5O A;  4KTZ A;  2IDO A;  3BDP A;  4BDP A;  4KTW A;  2F8T A;  3JYT A;  4H4M A;  3AVK A;  3LDS A;  4B9L A;  1J53 A;  1ZBL A;  4DQP A;  2Z1H A;  4FLW A;  4FLV A;  2G8F A;  1KLM A;  1K6Y A;  1RT7 A;  3NF7 A;  4NCA A;  4CJR A;  4DG1 A;  4W5N A;  5FRN A;  5T7B A;  4RW7 A;  3AVF A;  1SV5 A;  5J1E A;  3HJF A;  1KTQ A;  3CFP A;  4Z4E A;  1IKX A;  4QCL A;  3KLH A;  4HUE A;  4FM1 A;  3U6F A;  3AVJ A;  4DFP A;  4KV8 A;  3IS9 A;  1IKY A;  4NYF A;  3L2W A;  2QXF A;  5DK5 A;  2E6L A;  2ZQB A;  2QKB A;  3SV3 A;  1QSS A;  4LD0 A;  3I8D A;  4DTS A;  1JLG A;  1HMV A;  1KFS A;  3DM2 A;  4KHS A;  1SKW A;  3KK2 A;  3NH1 A;  2E4L A;  2OPP A;  4CJQ A;  3WNH A;  4I9L A;  3SUP A;  4CGH A;  2YNH A;  3AA3 A;  4CE9 A;  1GOC A;  3QER A;  3ZSO A;  1S5J A;  3OYK A;  3F73 A;  4FJI A;  3LP0 A;  3NGY A;  3MXI A;  1LAW A;  2D0B A;  1KSP A;  3ZT0 A;  1ASW A;  1UOC A;  2OPQ A;  3VQ8 A;  3RTV A;  4FJG A;  5FRM A;  3SPZ A;  2HVH A;  4CJ5 A;  3NAE A;  1RBT A;  2O4G A;  3CQ8 A;  4E7L A;  3LAL A;  4I7F A;  2KFN A;  1T03 A;  1C6V A;  4FLU A;  1TAU A;  1NK9 A;  3KLF A;  3OYI A;  3L2Q A;  4JRP A;  5HRO A;  1S1W A;  1U48 A;  1NOY A;  4FJ9 A;  4G1Q A;  3QEI A;  2HHV A;  1KCF A;  3C6U A;  4KHU A;  3H08 A;  3M8Q A;  2ATQ A;  4ID1 A;  4IFV A;  2E6M A;  4N76 A;  1JXE A;  1A5X A;  4CHP A;  3RRG A;  1TK0 A;  3HVR A;  4OJR A;  4M45 A;  1S1U A;  3VQP A;  1L3U A;  4EP4 A;  4FZZ A;  4Z4I A;  2AJQ A;  3VQC A;  1TKZ A;  4BE0 A;  3DRP A;  2VWK A;  4B9N A;  3IG1 A;  4IG0 A;  5KTQ A;  4CF1 A;  3QES A;  2GV9 A;  3L3V A;  4WE1 A;  4R5P A;  4HUF A;  2HHS A;  1TL1 A;  5CZ1 A;  4ID5 A;  3TAN A;  2OZM A;  1IO2 A;  1WSH A;  2FBY A;  2KQ2 A;  3DLG A;  1QSY A;  2IOC A;  1T7P A;  3AO3 A;  4ZTJ A;  4CEE A;  4LH4 A;  5HRN A;  1LW0 A;  2P51 A;  3V1Q A;  5HRS A;  4DFJ A;  1QHT A;  1SKS A;  5HLF A;  3HT3 A;  3SJJ A;  3OJS A;  3HK2 A;  2KW4 A;  4LY7 A;  2X78 A;  4FJH A;  3VQD A;  2FBT A;  4F4K A;  1NJZ A;  3RWU A;  1BIZ A;  3M8R A;  1XWL A;  3ZT1 A;  4W5Q A;  5CY4 A;  4LSN A;  2GUI A; 
#chains in the Genus database with same CATH topology
 1IH7 A;  4PY5 A;  3R9P A;  5EX5 A;  3MDQ A;  3NF9 A;  4Y1C A;  4CZI A;  4DTX A;  1EP4 A;  4B1V A;  1NGF A;  3RR7 A;  5AQP A;  2YHB A;  3LP1 A;  3ULE A;  3IAY A;  1XHX A;  4CIG A;  4GVM A;  3QNO A;  4CJS A;  1RTJ A;  4Z4G A;  3LAM A;  2NRV A;  4RG8 A;  1KVB A;  2QXL A;  5M1Q A;  3OYG A;  3V1O A;  5IT9 O;  3DWL A;  4JI6 K;  4J8F A;  3AVB A;  4BGA A;  5SZT A;  5EU7 A;  2ZF5 O;  2UU9 K;  1TL3 A;  4QS9 A;  4KHW A;  4IOA L;  2P9L B;  2JGU A;  1WSE A;  4QS7 A;  4WFB L;  3OBW A;  4DSL A;  4XH1 A;  4CHO A;  4CHZ A;  3DLB A;  3CC2 N;  1CZB A;  3U8X A;  3EEQ A;  4H5T A;  4KB1 A;  4BRO A;  2E88 A;  3LL3 A;  4QAG A;  2D5R A;  2NZT A;  4CJ3 A;  4MO4 A;  5KPR A;  3OJU A;  4CJ7 A;  1JLB A;  4BRM A;  1BOT O;  3PX4 A;  4JNE A;  3V9S A;  2VGM A;  4MLH A;  4YOW A;  1IBM K;  1BA1 A;  1VRU A;  4BRP A;  3UKU B;  2E1Y A;  5AQR A;  1NGI A;  4F2R A;  3QEV A;  2JLE A;  1GLF O;  3MMV A;  1S9G A;  1YF5 L;  2YHW A;  1KFD A;  4IBN A;  4RW6 A;  1K9M O;  2NNW A;  1J9A A;  2PY5 A;  2KHO A;  1C1B A;  4FWK A;  3C6T A;  3CQY A;  1RFQ A;  3VTH A;  3KJV A;  3DLL L;  3ISN C;  5J2N A;  4GVE A;  5D3G A;  2YHA A;  4JK7 A;  3M5R A;  4CZF A;  4B1W B;  3AVI A;  1SZ2 A;  1VSF A;  5AQK A;  5JS1 A;  1VSL A;  5AFU H;  4DV5 K;  3DLK A;  1LCU A;  3AO2 A;  1ILY A;  3CJ7 A;  3CCJ N;  3GBT A;  1RBU A;  2Q1N A;  5AZI A;  1VQ4 N;  4FXD A;  1TKX A;  3V9U A;  2O8C A;  4OKJ A;  3K57 A;  1WBB A;  3AAR A;  4DQI A;  3HP6 A;  5F2R A;  5C42 A;  2PYJ A;  3U3Y A;  4H0Y B;  3OS2 A;  3ZET B;  3TR8 A;  1LW2 A;  3CHW A;  2XY5 A;  3OYN A;  3VGL A;  4OO1 J;  3HO1 A;  4Z4H A;  1GLL O;  2WFB A;  1RTD A;  4NCB A;  3CME N;  1C0T A;  3VQQ A;  3H1V X;  4GKJ K;  2H3G X;  3CM5 A;  2D1K A;  1NK5 A;  3SZ2 A;  3QB0 A;  4DQR A;  4CEZ A;  4MDB A;  4GV9 A;  2Z1G A;  4NXN K;  4B1Z A;  1HYZ A;  3C7N B;  1L3S A;  1QVG M;  3CCU N;  1TYQ A;  4LF9 K;  3CM6 A;  1LWE A;  3CI5 A;  1D5A A;  4HCC A;  4YOY A;  2JWL A;  4FJN A;  4CJL A;  1N32 K;  3THY A;  2BUP A;  3B6O A;  4CJP A;  1YTU A;  2EHG A;  3WQT A;  4FZX C;  2OTJ N;  4BRC A;  4E1M A;  2B4J A;  4I9Q A;  2XY8 A;  1BI4 A;  5AQU A;  5FDL A;  3L6Q A;  5LL6 Z;  4CF8 A;  1L3V A;  1U6Z A;  2Q31 A;  4RW8 A;  1W0H A;  5AQV A;  1IBL K;  4KFB A;  4PKG A;  2VG6 A;  2R7Y A;  1RTH A;  1RDW X;  4M3R A;  1BCM A;  1VSI A;  2B6A A;  2CGL A;  1HYV A;  4NXM K;  2CGJ A;  4KH5 A;  2QWL A;  3TAP A;  4M3W A;  3QEP A;  4ILJ A;  4BR2 A;  3H3O B;  3V9Z A;  5K14 A;  3ZEU B;  3HST B;  1NMD A;  4O8K A;  2O8F A;  3MXM A;  2E2P A;  3CQX A;  4FW1 A;  3SMP A;  3I55 N;  1T6D A;  2RHK A;  3KWI A;  1U45 A;  1VRT A;  3O9T A;  4KRE A;  3QBW A;  3V9W A;  2P9S B;  1N34 K;  3AA4 A;  3NHG A;  4JS4 A;  1TGO A;  4CZH A;  1B9D A;  4AHV A;  3K9J A;  4E7K A;  1D9D A;  3MX2 A;  4BR0 A;  2OCE A;  3EYZ A;  4PQU A;  3OYB A;  2DFF A;  3FFI A;  3ZX3 A;  4E19 A;  4BWJ A;  1NOZ A;  5CZ2 A;  2I7N A;  3RMA A;  2GBZ A;  5BRH A;  4M3Y A;  1FJG K;  3K5O A;  4CBW A;  1JKH A;  3MX5 A;  2XY7 A;  4CEA A;  4FWM A;  4OPH A;  1NKB A;  1D9F A;  2QTD A;  5CHI A;  1UA1 A;  2ETJ A;  4A5A A;  5A2Q O;  3V6D A;  3FZM A;  1JLA A;  4DV6 K;  4DU3 A;  2X6S A;  1Q8I A;  3SLC A;  2UXB K;  3BF3 A;  3P4I A;  2ITG A;  4FJ5 A;  2YHY A;  3PIO L;  1XQS C;  5AQT A;  4O0J A;  3O1W A;  4BQL A;  4O0I A;  4LF7 K;  1A5W A;  2F8S A;  4KBO A;  4J2D A;  4DTJ A;  2PYL A;  5AZI B;  1BA0 A;  5ADX H;  1C0M A;  2NUB A;  1JCF A;  5HL7 L;  1RBV A;  4E1N A;  1EWQ A;  3F2K A;  3P83 D;  4HWI A;  4G9Z A;  1G15 A;  1E4F T;  4DQ8 A;  4H0P A;  3ZX0 A;  3CET A;  4GY2 B;  4DV0 K;  4CHN A;  2W42 A;  4JYA K;  1HQU A;  4JHD A;  4DKW A;  2HBJ A;  3CJ1 A;  4CJE A;  1VQ7 N;  1J5O A;  2NLX A;  2E2Q A;  3PX0 A;  5AQG A;  4CI6 A;  5GIN A;  3PO5 A;  4CW7 B;  3O5B A;  1WSJ A;  3TTF A;  3LDO A;  1WLJ A;  3O9U A;  1LAV A;  5CYQ A;  1HNX K;  3SQ1 A;  4H8K A;  1YVU A;  5IWA K;  1YVN A;  1EX4 A;  1W9H A;  1S6Q A;  4CJF A;  3B8A X;  4JKA A;  3OS0 A;  1MDU B;  4BQZ A;  3J7Y P;  3THY B;  4YHH K;  2HW3 A;  1NGH A;  4CIF A;  1RBR A;  3RSE B;  1RDU A;  1FKP A;  5FPN A;  3O4Q A;  1NJX A;  4CD1 A;  1X3M A;  5GAG P;  3BDP A;  4BRH A;  4BDP A;  4BRL A;  2F8T A;  4H4M A;  4FLW A;  4DG1 A;  4W5N A;  5T7B A;  4RW7 A;  4LF4 K;  3UE5 A;  3HJF A;  4H0V B;  3CFP A;  3O08 A;  4DB3 A;  4JAX A;  3T1H K;  3U6F A;  3QML A;  4KV8 A;  3IS9 A;  3L2W A;  2QKB A;  2E6L A;  2ZQB A;  1NU0 A;  4PL7 A;  3I8D A;  4DTS A;  1HMV A;  4KHS A;  1DGK N;  3NH1 A;  1T6C A;  2YNH A;  3AA3 A;  4CE9 A;  2FLO A;  2O8D B;  2WTU A;  3NGY A;  3MXI A;  4A57 A;  2D0B A;  3U9D A;  3SAG A;  4O5F A;  5LJW A;  1KSP A;  2O8B A;  3O8M A;  4X62 K;  3RTV A;  1JCG A;  3VET A;  4CJ5 A;  1RBT A;  4I7F A;  2KFN A;  3L4Q A;  5F0X A;  4AQY K;  3P31 A;  2UUB K;  5HRO A;  3Q7B A;  3E9P A;  4G1Q A;  3C6U A;  2W40 A;  4KHU A;  2ATQ A;  2E6M A;  4ISG A;  4CHP A;  4B1Y B;  4M45 A;  1S1U A;  3AY9 A;  4B9N A;  3WXM B;  3IG1 A;  4IG0 A;  4CF1 A;  3QES A;  4WE1 A;  3DAW A;  5CZ1 A;  3PLA A;  3WT0 A;  3C6H A;  1QSY A;  5JMV A;  3G4S N;  4MLE A;  3QDK A;  3J81 O;  2ZWH A;  3SJJ A;  2X78 A;  3LDL A;  1NJZ A;  2W41 A;  5DM7 L;  1QZ5 A;  4DF8 A;  1JL2 A;  3VTI A;  2WOM A;  3MED A;  2A41 A;  3DOL A;  4DU1 A;  4WQ5 A;  3T19 A;  1RBS A;  1NGD A;  4BY9 C;  4C8N A;  2IVP A;  4CEF A;  4W5O A;  1VQ6 N;  3EE8 A;  3G6E N;  4FJK A;  1X9J A;  3MWT A;  4E7I A;  4BC2 A;  4NYN A;  4CHQ A;  1VQ9 N;  4C23 A;  1KRP A;  4OVL A;  4LF5 K;  1VK0 A;  1C1C A;  3CCE N;  3CCR N;  1NM1 A;  4KO0 A;  4CGJ A;  5EY4 A;  3OW2 M;  1GLE G;  3GL1 A;  4DR5 K;  3HXM A;  5AQF A;  2CH5 A;  2QWQ A;  4H0T B;  3O9R A;  3VPZ A;  1NGJ A;  2VWB A;  4CBX A;  1S1V A;  1NMN A;  1HJR A;  1RT4 A;  4FCY A;  4CEQ A;  3J8A A;  5LMU K;  4LSL A;  2I5J A;  4QS8 A;  1QTM A;  4FZY A;  3WXJ A;  1F21 A;  3O4N A;  4YOV A;  4YOR A;  2F9W A;  3SAH A;  3S3O A;  3QFP A;  1W7A A;  4RWT A;  1GOB A;  4FLX A;  4CEC A;  1YIJ N;  1IKV A;  3MEG A;  5AQX A;  1GLC G;  3UIQ A;  2RPI A;  1JLF A;  4AIL C;  5AQO A;  3OYL A;  1GLA G;  2GX9 A;  4CJV A;  3SYZ A;  3A5O C;  3D7E O;  3L2R A;  4KH6 A;  2F9T A;  3VEO A;  4W5R A;  2FC0 A;  3CC7 N;  2OA8 A;  3V9X A;  2QK9 A;  4NB4 A;  2HHQ A;  4AHU A;  3WQU A;  2Q97 A;  3VQ7 A;  3KZB A;  1NJW A;  4I2P A;  4EP5 A;  3K59 A;  4BAC A;  4JKD A;  1KVA A;  1NK4 A;  1ZBH A;  4B08 A;  4E3S A;  4YFU A;  1HKC A;  1S22 A;  3MEC A;  2XO7 A;  4ZTF A;  4JV5 K;  4B8C A;  1XC3 A;  2NRH A;  3C7N A;  3KLE A;  4KHP K;  4U67 L;  1T44 A;  3ZT2 A;  3BZK A;  4LFB K;  1TK8 A;  4A2B A;  4PA1 A;  3QBX A;  4BRF A;  4DTM A;  4B9V A;  1Y97 A;  3DLE A;  4AHC A;  4IDH A;  4WQ4 C;  1VQN N;  2HHX A;  4E0D A;  4DSJ A;  1L3T A;  1O13 A;  4DMN A;  4FWS A;  4CF0 A;  5GIO A;  4BVO A;  1YIT N;  4MDA A;  4Z0U A;  1JLE A;  4I2Q A;  4BDY A;  3T3F A;  4RW9 A;  5C12 A;  2NRT A;  4DR3 K;  1D8Y A;  3OS1 A;  3I8B A;  3VEY A;  1YUW A;  3AVG A;  1V4S A;  1SKR A;  3EZW A;  4YOX A;  2ZD1 A;  3BZC A;  2W6K A;  3TAB A;  4NLB A;  1X9M A;  4OKE A;  5CE3 A;  1RT2 A;  5SWM A;  4IG3 A;  3F9K A;  1XHZ A;  3AV9 A;  5M1K A;  4BE2 A;  3OYF A;  1VSM A;  1V4T A;  3ZEU A;  3U3G A;  4JI2 K;  3TAQ A;  2ITM A;  4K8X A;  4OGE A;  4PUO A;  3HL8 A;  5C0Y A;  3VF2 A;  5F1X A;  4NO7 A;  4AHR A;  4CVN E;  2Y1I A;  2P9S A;  1OH7 A;  1WUA A;  3HSC A;  2AA4 A;  1I94 K;  2GWJ A;  2IVN A;  3CFO A;  4FJM A;  3DMJ A;  4DFK A;  4M7Y A;  1NK6 A;  4FK0 A;  2HBK A;  3S3N A;  2LSN A;  4DTP A;  2BAN A;  4HHT A;  5M1P A;  4E7J A;  3EZ5 A;  1QQO A;  4HUG A;  1N8R O;  3K0S A;  2ZGY A;  2KTQ A;  1LWF A;  4YDU C;  2D0C A;  4KHY A;  3FLC O;  3TSQ A;  3VOV A;  1B92 A;  3CCQ N;  3DLH A;  1BDG A;  1IG9 A;  5M1N A;  4CFC A;  4FL9 A;  3P39 A;  4N56 A;  4K41 A;  3SAF A;  2HMI A;  4B9U A;  2IS3 A;  4B9S A;  4DWI A;  4L8R B;  2OAN A;  1QSL A;  4BRQ A;  3VQ9 A;  1EKE A;  2J4R A;  4IOC L;  3W0L A;  4DTR A;  2Q3S A;  2ZM6 K;  3SPY A;  3P38 A;  5BRE A;  3CCM N;  3PY8 A;  4YNQ A;  4JD2 B;  1XMO K;  2Q0R A;  4KHN A;  5C10 A;  4CJU A;  4GV6 A;  3FZL A;  4J2A A;  1UA0 A;  2YCH A;  5AQN A;  3FGU A;  1IJJ A;  5JLF A;  1VQ8 N;  3H1Q A;  4BRK A;  1QQC A;  3LDN A;  4C8M A;  3QIC A;  1Q18 A;  3NH0 A;  3UB5 A;  2PFU A;  3GG4 A;  3LZJ A;  1M1K O;  2A3Z A;  2B5J A;  1RDD A;  3CF5 L;  4R79 A;  4Y1D A;  3E9O A;  4DV2 K;  2YHX A;  2VG5 A;  3EKS A;  3AO1 A;  3Q7C A;  2A6A A;  4ILG B;  3LM9 A;  2P9I B;  3I0S A;  1J5E K;  1WSG A;  5KPZ A;  4FWQ A;  3U4L A;  3L8B A;  3ZSZ A;  3HPO A;  1K8A O;  1L5U A;  1S6P A;  4GW6 A;  1T8E A;  4H03 B;  1WAJ A;  3GDQ A;  3VEX A;  2XHB A;  2W6L A;  1KAY A;  3PV8 A;  3LM2 A;  5E41 A;  4CK3 A;  4H4O A;  3CCV N;  1YHQ N;  2OZS A;  1RDC A;  4F9O A;  1U47 A;  3K5M A;  4ZHR A;  5B8H A;  1ATR A;  3RVC A;  1WOQ A;  3SMS A;  3RSE A;  1DTQ A;  4FM2 A;  3CPW M;  1HNW K;  3CJA A;  3ZYY X;  4YOU A;  4F3T A;  2AP1 A;  2OPS A;  5KRT A;  2G8W A;  2QWM A;  1X3N A;  4M41 A;  3ZSR A;  2G8I A;  3ZT3 A;  3H3N O;  3CPE A;  5BPL A;  1N6Q A;  5HRP A;  4LFA K;  1VSH A;  2HBL A;  2XRI A;  3NBP A;  1REV A;  3CJB A;  1N5Y A;  4CZJ A;  3SV4 A;  2O8D A;  4DR1 K;  1DEJ A;  1BQN A;  1R59 O;  1QQN A;  1NGE A;  4JKG B;  3OYD A;  5AQM A;  5M1O A;  3PO4 A;  4MFB A;  3ALY A;  3VEV A;  4WF9 L;  3LDS A;  2QA4 N;  1BG3 A;  4ISE A;  4FLV A;  2G8F A;  4NCA A;  2YI1 A;  2VQE K;  1IKX A;  1Z05 A;  4DR7 K;  3MCA B;  3SV3 A;  1VQP N;  1KFS A;  4BVP A;  2OPP A;  3LDQ A;  4I9L A;  5C2F A;  3ZSO A;  1H1V A;  2ASM A;  5GAE P;  3THX B;  4Z94 A;  1LAW A;  3MK6 A;  4BC4 A;  1ATS A;  4BR7 A;  1UOC A;  2HVH A;  4B3S K;  2P9P B;  3LAL A;  1T03 A;  1C6V A;  4DR2 K;  4FLU A;  1NK9 A;  3J80 O;  4M7X A;  3L2Q A;  3WXK A;  3EKU A;  1NOY A;  1KCF A;  3M8Q A;  3E66 A;  3BEX A;  1TK0 A;  2AJQ A;  1L3U A;  3VQC A;  4BE0 A;  2GEL A;  1NGA A;  4HUF A;  3ZLJ A;  1TL1 A;  2ASO A;  1IO2 A;  1WSH A;  3DLG A;  2OZM A;  4CEE A;  4LH4 A;  5HRN A;  1OVQ A;  5HOO A;  4A2A A;  5HRS A;  1SKS A;  5HLF A;  3HK2 A;  2KW4 A;  2QEX N;  2UYT A;  4FJH A;  5AR0 A;  3OHR A;  2FBT A;  5BN9 A;  3ATU A;  1NLV A;  1E4G T;  1XWL A;  3ZT1 A;  4IJN A;  1KAZ A;  5CY4 A;  4LSN A;  2GUI A;  1RGI A;  3TAF A;  2Y1J A;  2KFZ A;  1WAF A;  2YKM A;  1RT5 A;  1JLC A;  2FSK A;  3G71 N;  4DSE A;  1YXQ A;  4Z4C A;  3NFA A;  3IUC A;  4FW2 A;  3AVM A;  4N41 A;  5HRR A;  4DTO A;  3THV A;  1BL3 A;  3LWL A;  1SL1 A;  2V51 B;  3O3H A;  3O3F A;  3A8Y A;  1J6Z A;  1QE1 A;  5JIC A;  1TKT A;  3R3L A;  4DU4 A;  4JI3 K;  3L0Q A;  3PIP L;  3AAP A;  1VSD A;  2E20 A;  2X6N A;  4FPB A;  1SL0 A;  4B9M A;  3TAM A;  3OYC A;  3SQ2 A;  4DUZ K;  4CZG A;  3SI6 A;  4O44 A;  1DKG D;  3C94 A;  4PKH A;  4BC5 A;  4BRE A;  4CEB A;  3M3Z A;  4FVU A;  1ZBI A;  3VQB A;  2ZJQ L;  4CZL A;  4X66 K;  5I9E B;  3HM9 A;  2FSN A;  4IOX A;  3ENB A;  2VQF K;  2G8K A;  1WN7 A;  1VQL N;  5BR8 K;  2P5G A;  3DYA A;  1RT6 A;  2RN2 A;  4F3O A;  3RMD A;  4EZ9 A;  1O1W A;  4DTN A;  4FLZ A;  3HVT A;  2HHT A;  1ZYQ A;  2P9K A;  1W97 L;  2VCP A;  3MN9 A;  2A1S A;  2HF4 A;  4LFC K;  4BRG A;  1RTI A;  4FOI A;  3AAQ A;  1X9W A;  1BIU A;  5HBM A;  3LZI A;  4JI1 K;  5TKW A;  1VAZ A;  1HR0 K;  4FM0 A;  1ITG A;  1I39 A;  3JSM A;  1VQ5 N;  4CJW A;  3L2U A;  2HST A;  4F2S A;  1RIL A;  1HPZ A;  3MWP A;  1OKJ A;  3IRX A;  1CXQ A;  4XIU A;  3OY9 A;  5AQW A;  3CD6 N;  1HNV A;  1VSE A;  3LWM A;  4JS5 A;  2F7T A;  5TKY A;  4GKK K;  2RF2 A;  1Z6R A;  4A62 A;  3NCI A;  4OGC A;  3KIO A;  2FBX A;  4O4G A;  1S3X A;  4CJT A;  1XUP O;  3K58 A;  3VGK A;  3A5N C;  3ASM A;  1TV6 A;  3ZSQ A;  4CES A;  1TK5 A;  5HP1 A;  2ZE2 A;  1FXX A;  1GLJ O;  3MXJ A;  3WEE A;  1FKO A;  4B8A B;  1VSJ A;  3IDH A;  1ZBF A;  3MEE A;  3V81 A;  2O4I A;  4DSF A;  2HHU A;  1S1T A;  1RDB A;  1T05 A;  2QKK A;  1YJW N;  1CLQ A;  1C1A A;  4B3T K;  4FSV A;  1YTA A;  3LPT A;  1U2V B;  1NK7 A;  4FJX A;  5AZJ B;  5C15 A;  2BDP A;  3MAQ A;  4BR9 A;  1VSK A;  3T7Z A;  3VA0 A;  4CK1 A;  3ZX2 A;  4GMJ B;  3VA3 A;  3R8E A;  3UKR B;  5H1S Q;  5AQJ A;  3AA5 X;  3CC4 N;  3WXL A;  2IVO A;  4DV7 K;  3KK1 A;  4PHT X;  2HBM A;  4XH5 A;  4WCE L;  1LWC A;  4M3Z A;  1HLU A;  5CYM A;  1YJ9 N;  1RCH A;  2I7P A;  4JEP A;  3TAR A;  3HBT A;  2Z1I A;  4JKF A;  2NRR A;  4AM6 A;  4DSK A;  4C8O A;  2QM1 A;  4CGD A;  3W3D A;  4DQQ A;  3VF4 A;  4CGF A;  3PX6 A;  3F9M A;  4CZM A;  5AFU A;  4BWM A;  2YKN A;  5AJ3 K;  4KPY A;  4CGG A;  4WFA L;  3QEW A;  1EXQ A;  3CER A;  4AH9 A;  3DXK B;  1BQM A;  4UY8 O;  4QCL A;  2Z1J A;  3KD1 E;  2F96 A;  2D0O A;  5M1F A;  3WNG A;  4ICL A;  1XMQ K;  3T1A A;  3V1R A;  4AHS A;  4WQ4 A;  2QI2 A;  4JD2 A;  3CFR A;  1S72 N;  1EQY A;  1MU2 A;  3BUZ B;  3CG7 A;  3SNN A;  1UWB A;  1E3M A;  1NG9 A;  2ASP A;  3G10 A;  1Q9Y A;  3LP3 A;  1DLO A;  2Q2R A;  1Q9X A;  1RT1 A;  1DTT A;  2GWK A;  3MCP A;  5C2D A;  4K0K K;  3C95 A;  3HM8 A;  4WQ5 C;  4CF2 A;  4KI4 A;  4CCH A;  3OVN A;  3RRH A;  1SUQ A;  2KKZ A;  1BHL A;  4OLB A;  4EFH A;  2NRX A;  2P9I A;  1BGX T;  2NRZ A;  2P9K B;  3L2V A;  4JLH A;  3VQE A;  1Q82 O;  1M90 O;  3PUF A;  3N4Q A;  4IZ9 A;  3D2E B;  3SBG A;  1ZBS A;  2VYP A;  3VQ4 A;  4H5W A;  4IFY A;  1SL2 A;  4X65 K;  3I56 N;  5KGX A;  2IAJ A;  5FPD A;  3NMU A;  1NGB A;  3NVM A;  4RW4 A;  4C1N I;  1HYS A;  1WNS A;  1WSI A;  1C0F A;  1Z25 A;  1IKW A;  2EWS A;  3AVN A;  4FJJ A;  3SQ4 A;  4JRQ A;  1WB9 A;  1CZA N;  3AVH A;  2ZJP L;  4KTQ A;  3KKR A;  2DTU A;  4B9T A;  5EOY A;  4I6M B;  3KK3 A;  2NRW A;  4FLY A;  3ITH A;  3M8P A;  2HNZ A;  4CFA A;  4AF1 A;  1ATN A;  5EXW A;  4E1J A;  1TKD A;  5BPM A;  2PAV A;  4J2B A;  4CBU A;  4C8K A;  2HB5 A;  2X74 A;  3LP2 A;  3PSI A;  2D4W A;  3CXC M;  2GUP A;  3WEE B;  4BC3 A;  1EO1 A;  2HMP A;  3AO5 A;  4YDU A;  2DPN A;  1K8K B;  1VHX A;  3O9S A;  1NNE A;  2IIR A;  3L3U A;  2G8H A;  1NKC A;  4DFM A;  4X64 K;  3A5L C;  5JVH L;  4ELT A;  3M8S A;  2A42 A;  2BGG A;  3TTC A;  2FXU A;  3T69 A;  4OPK A;  4DLE A;  2CGK A;  1ASV A;  2YJE A;  4JKG A;  3VF6 A;  3C65 A;  5E26 A;  2UXD K;  4IO8 A;  1RT3 A;  3QIO A;  3VEW A;  4FJ8 A;  3DLR A;  2UUC K;  3P5J A;  4CGI A;  3TWH A;  4H0O A;  3AGK A;  3TI0 A;  4H5V A;  4IDK A;  1C0U A;  4FVM A;  1QQM A;  2E2N A;  2GTD A;  1HUX A;  3J7A P;  5GIP A;  3HPG A;  3LPU A;  5BPN A;  1BCO A;  5FLX O;  3J7Z O;  4BR4 A;  2HF3 A;  3KLI A;  1BO5 O;  2FF3 B;  3TPQ A;  4F8R A;  1RNH A;  4CJ4 A;  1QS4 A;  2P1J A;  3G25 A;  3HZ6 A;  3WNE A;  3NGZ A;  3ZSV A;  3AA2 A;  4YOT A;  5DM6 L;  3KKS A;  3THX A;  3AGR A;  4A59 A;  1YI2 N;  4XH4 A;  3S3M A;  5LMN K;  2P5O A;  3C6A A;  2IDO A;  4KTZ A;  5BN8 A;  2P9P A;  3JYT A;  3AVK A;  4FPA A;  4JN4 A;  1J53 A;  1ZBL A;  4DQP A;  5EVZ A;  1KLM A;  2QWR A;  5FRN A;  3AVF A;  4RCH A;  5J1E A;  4Z4E A;  1XNR K;  3KVG A;  2Q0U A;  3KLH A;  4HUE A;  4FM1 A;  4KH4 A;  4DFP A;  2OTL N;  3A5M C;  4IJA A;  1IKY A;  4NYF A;  2E5L K;  2QXF A;  5DK5 A;  1QSS A;  4LD0 A;  5ADX A;  5KQD A;  3DM2 A;  4DV3 K;  1SKW A;  3KK2 A;  3D6R A;  3SUP A;  1NBW A;  4CGH A;  1TUY A;  3QER A;  1S5J A;  3F73 A;  3GE1 A;  3I33 A;  1BUP A;  3FZK A;  3LP0 A;  4CZE A;  3BP8 A;  4FWR A;  2Q36 A;  1HX1 A;  4C1N K;  3THW A;  2WUS A;  3ZT0 A;  2OPQ A;  3N4P A;  4FJG A;  3SPZ A;  3H6E A;  2JWK A;  1OH5 A;  2O4G A;  5GAD P;  1TAU A;  2UXC K;  3OYI A;  1S1W A;  4FJ9 A;  3QEI A;  1Q7Y O;  2HHV A;  2GEM A;  3HTV A;  3H08 A;  4MO5 A;  4ID1 A;  4N76 A;  3RRG A;  3HVR A;  3VQP A;  3A0I X;  4U7B A;  3EO3 A;  3ENO A;  3VES A;  3TSP A;  3DRP A;  5ELZ A;  2GV9 A;  3L3V A;  4R5P A;  4JI5 K;  2FBY A;  2KQ2 A;  3AO3 A;  3L4I A;  3V1Q A;  4DFJ A;  2P9N A;  3O80 A;  3LDP A;  3M1F A;  4LY7 A;  3ID8 A;  2O8E B;  3VQD A;  1BIZ A;  1FW6 A;  4AM7 A;  3TU5 A;  2KLA A;  4W5Q A;  3MN7 A;  4DV4 K;  4DLG A;  1FK9 A;  4NLC A;  4GNI A;  4B9Q A;  3OYA A;  3AVL A;  1A5V A;  1C0G A;  3NE6 A;  1S9E A;  2P9U B;  3BF1 A;  5C24 A;  4CJK A;  2YJF A;  5JLH A;  2G8V A;  2FSJ A;  3O3G A;  1HRH A;  3JS6 A;  3DXM B;  3TAG A;  1NJY A;  1Z26 A;  4OKK A;  5AQI A;  4PL8 A;  4CER A;  3IKM A;  4M3U A;  3SUO A;  4HTL A;  2YNI A;  4Q0B A;  3M6G A;  3CCL N;  2E2O A;  4FK4 A;  1UAX A;  3OYJ A;  4TSX A;  2YNF A;  3ZCM A;  4JK8 A;  4DF4 A;  1WBD A;  4BRN A;  3A2F A;  4EHU A;  3SBT A;  5KQ8 A;  1CXU A;  1Q86 O;  3OBY A;  4IKF A;  3HOS A;  3ULE B;  4BG8 A;  3HOT A;  4BRA A;  5KI6 A;  4ISF A;  4JKE A;  1B9F A;  4FLT A;  1YJN N;  5GAH P;  3V4I A;  3VN5 A;  2QWO A;  4K8Z A;  1QZ6 A;  3LAK A;  2G8U A;  3S41 A;  1U4B A;  5AQL A;  2YNG A;  1S1X A;  3EN9 A;  4PWD A;  2HVI A;  4OLA A;  2HOE A;  4FO0 A;  3VMF B;  4CD3 A;  4KB0 A;  3HPH A;  4XEI A;  2DY4 A;  5CR4 A;  3SCX A;  4CF9 A;  1NK0 A;  2QWP A;  2KZZ A;  1NGC A;  4N47 A;  4FWN A;  3I0R A;  3RMC A;  3ATV A;  1U2V A;  3NF6 A;  5AZJ A;  4HCB A;  1IG8 A;  2A5X A;  1JLQ A;  3S9H A;  2CH6 A;  3MN5 A;  4DR4 K;  4KHQ A;  3BGR A;  1I3A A;  4JI8 K;  3ZSW A;  5DMR A;  4ELV A;  3UKR A;  5E84 A;  3G0Z A;  1QHA A;  3DRR A;  3LAN A;  4B1X B;  3KK7 A;  4A61 A;  4CHY A;  4N5S A;  4CFB A;  3HYF A;  1KD1 O;  1Y64 A;  4CEO A;  2FBV A;  1JL1 A;  4K25 A;  4KRF A;  2D0A A;  2WON A;  4BE1 A;  1BU6 O;  4JK9 A;  2XY6 A;  4M63 C;  3THW B;  1OH8 A;  4B3O A;  3VGM A;  4CED A;  3QIP A;  4DS4 A;  2V7Y A;  3QLH A;  2YV0 X;  3QET A;  4FWO A;  3FZH A;  3ID6 A;  3D0P A;  3QNN A;  3FE1 A;  1XNQ K;  3OTO K;  3VER A;  2O8C B;  3DI6 A;  3SUQ A;  4RTF D;  3WXI A;  3ZSY A;  4MQ3 A;  3IFR A;  4CK2 A;  2OPR A;  3QEX A;  3DXK A;  4H5N A;  1R0A A;  4IWV A;  2OYQ A;  1HJO A;  1EET A;  3DOK A;  1TUU A;  1SQK A;  5FPM A;  2P9N B;  4WYB A;  1U49 A;  2QWN A;  2WC9 A;  3FFK B;  4KKO A;  5J2M A;  3CYM A;  3E9L A;  1J54 A;  1KXP A;  3OYM A;  1X9S A;  3RR8 A;  1JXB A;  3OA9 A;  3GOI A;  3QFU A;  2IGI A;  4FJL A;  4Q5V A;  2HHW A;  2ZGZ A;  1W2B M;  4DTU A;  3NDK A;  4ELU A;  1GLD G;  1KC8 O;  2E1Z A;  3HI0 A;  3DRS A;  1SS6 A;  2RE2 A;  4WFN L;  1BWF O;  3D2F A;  4OPJ A;  1X1P A;  2DFE A;  1TAQ A;  4L3Q A;  4OPA A;  1TYQ B;  4JKC A;  1ZBU A;  1KQS M;  4FK2 A;  5KRS A;  1HPM A;  4AHT A;  5FRO A;  3KLG A;  3K5N A;  2V52 B;  1N33 K;  5J2Q A;  1NK8 A;  1HNI A;  1IV0 A;  3E01 A;  3MN6 A;  3NGI A;  1XI1 A;  2BE2 A;  4O55 A;  1TVR A;  3H46 O;  5AQS A;  1KAX A;  3D2E A;  3P1G A;  2D0P A;  2HHH K;  1BIS A;  5JVG L;  5FPE A;  3SK3 A;  1BI4 B;  3SQ0 A;  2FF6 A;  4B3R K;  4H5R A;  1KLN A;  4M42 A;  1Q81 O;  4Z4F A;  4IEI A;  1GOA A;  4K42 A;  1KVC A;  4BG9 A;  4IEE A;  3OYE A;  1U04 A;  3IMX A;  4O8U A;  4B1U B;  4I6M A;  4E7H A;  4HTU A;  3VQA A;  5AQQ A;  4DV1 K;  1ASU A;  2VG7 A;  2VGN A;  3VEZ A;  4DQS A;  3NH2 A;  2IC3 A;  4FJ7 A;  4C8L A;  4J2E A;  3QO9 A;  5I3U A;  4KI6 A;  1MWM A;  4M3X A;  3VEN A;  4DCH A;  4BDZ A;  2O8F B;  4JKH A;  3VQ6 A;  4DR6 K;  2VWJ A;  3NF8 A;  1MA9 B;  3BY5 A;  4CIE A;  3KWG A;  5LY3 A;  1NJI O;  1VQM N;  1N36 K;  3F5T A;  4E89 A;  1K8K A;  1CZ9 A;  1SAZ A;  2DFH A;  3CJ9 A;  4UQG A;  3NVK A;  3HRG A;  2BTF A;  3AVA A;  3O4W A;  3WUH A;  3K5L A;  5BRF A;  1HNZ K;  3SJH A;  5BRD A;  3ZT4 A;  1QVF M;  5LJV A;  1ZXO A;  2PBD A;  3R1X A;  4HVJ A;  4DSI A;  1LV5 A;  1T3V A;  2KZM A;  4KAZ A;  2EX3 A;  1G99 A;  3ZSX A;  4FYD A;  2PZS A;  1D4X A;  3SUN A;  3O9Q A;  4FWL A;  3OYH A;  4BGB A;  4EAH D;  3ULD A;  3AVC A;  1NKE A;  5C25 A;  4IXC A;  4OX9 K;  2P9L A;  2HND A;  2A40 A;  3TTD A;  3R6M A;  3JXU A;  5KGW A;  3VQ5 A;  3QIN A;  5I42 A;  5MLC Q;  3FZF A;  1JCE A;  3KTQ A;  3K2P A;  4LC9 B;  3RMB A;  2A1R A;  4JKB A;  5J2P A;  3HP9 A;  4EHT A;  2RKI A;  1VQO N;  2F4V K;  1NGG A;  1OVY A;  4FWP A;  4NCG A;  1HQE A;  4FOE A;  1K73 O;  4DS5 A;  3FR0 A;  4LF6 K;  1WSF A;  5JS2 A;  1ESV A;  4O5B A;  4IFE A;  3UKU A;  1YT3 A;  4M3T A;  1JJ2 M;  4QOZ B;  3TAE A;  4LH5 A;  3CIP A;  3KD5 E;  3B6P A;  3D45 A;  5AQY A;  3AO4 A;  3H45 C;  2HNY A;  3O6W A;  2E8A A;  1MWK A;  1RDA A;  4JHD B;  4EZ6 A;  3JAM O;  5BR9 A;  1XC9 A;  3CJC A;  4W5T A;  4CFD A;  3WNF A;  1HKG A;  3EY1 A;  5KPT A;  4BRD A;  1LOT B;  4DUY K;  4KTW A;  4YY3 K;  3C0B A;  4B9L A;  3O1B A;  1P90 A;  2Z1H A;  4JI4 K;  1RT7 A;  1K6Y A;  1DT9 A;  3KHY A;  3NF7 A;  4EIA A;  4CJR A;  2BH1 A;  1SV5 A;  1KTQ A;  3ENH A;  1YAG A;  4K43 A;  3D2F B;  3AVJ A;  1P8Z A;  4JI7 K;  1VQK N;  5AQH A;  2V7Z A;  1JLG A;  3U9Z A;  2E4L A;  4CJQ A;  3WNH A;  1GOC A;  4IO9 L;  3ZET A;  3OYK A;  3CMA N;  4FJI A;  2YX6 A;  4ILH A;  2UUA K;  3TSU A;  4BR5 A;  1ASW A;  3VQ8 A;  4CZK A;  4B3M K;  5FRM A;  4BRI A;  2O8E A;  3CCS N;  3NAE A;  4LF8 K;  4E7L A;  3CQ8 A;  1HKB A;  1OH6 A;  3KLF A;  2WBN A;  4JRP A;  1U48 A;  4JI0 K;  2QW9 A;  1NWK A;  4GV3 A;  3T1Y K;  1EWR A;  4IFV A;  2P9U A;  1JXE A;  1A5X A;  4OJR A;  3PSF A;  4FZZ A;  4V19 S;  4EP4 A;  4Z4I A;  3EL2 A;  4A5B A;  4PKI A;  1TKZ A;  1ZC6 A;  2VWK A;  4DHY A;  5KTQ A;  3DXM A;  2HHS A;  4ID5 A;  3TAN A;  1T7P A;  3K9K A;  2IOC A;  4Y0W A;  4ZTJ A;  1LW0 A;  2P51 A;  1QHT A;  2O8B B;  3HT3 A;  3OJS A;  1IBK K;  3EE9 A;  5AQZ A;  4F4K A;  1GLB G;  2ZJR L;  3RWU A;  3M8R A;  3DJC A;  3E1Y A;  4H0X B; 
#chains in the Genus database with same CATH homology
 4DLG A;  1IH7 A;  3TAF A;  4PY5 A;  2Y1J A;  1FK9 A;  2KFZ A;  4DF8 A;  1JL2 A;  1WAF A;  2YKM A;  1RT5 A;  1JLC A;  3NF9 A;  4Y1C A;  2WOM A;  4DTX A;  3MED A;  4DSE A;  4Z4C A;  3DOL A;  3AVL A;  3NFA A;  1A5V A;  1EP4 A;  4FW2 A;  3OYA A;  4DU1 A;  3AVM A;  3NE6 A;  5HRR A;  1S9E A;  4DTO A;  5C24 A;  3T19 A;  3THV A;  4N41 A;  1RBS A;  1BL3 A;  3LWL A;  3RR7 A;  4CJK A;  1SL1 A;  4C8N A;  2YHB A;  3LP1 A;  4CEF A;  3O3H A;  2G8V A;  4W5O A;  3O3F A;  3IAY A;  3O3G A;  1XHX A;  1QE1 A;  4FJK A;  1HRH A;  4CIG A;  1TKT A;  4DU4 A;  4GVM A;  3QNO A;  4CJS A;  1RTJ A;  4E7I A;  4Z4G A;  3LAM A;  4NYN A;  1Z26 A;  4RG8 A;  1KVB A;  4CHQ A;  3TAG A;  1NJY A;  1VSD A;  4OKK A;  1KRP A;  4OVL A;  2X6N A;  1SL0 A;  3OYG A;  1VK0 A;  3TAM A;  3OYC A;  4B9M A;  4CER A;  3SQ2 A;  4M3U A;  3V1O A;  1C1C A;  3SUO A;  3SI6 A;  4KO0 A;  4O44 A;  2YNI A;  3AVB A;  4CGJ A;  5SZT A;  3C94 A;  5EU7 A;  4Q0B A;  3HXM A;  4CEB A;  1TL3 A;  4FK4 A;  4KHW A;  1UAX A;  3OYJ A;  1ZBI A;  4TSX A;  2YNF A;  3VQB A;  1S1V A;  3ZCM A;  1HJR A;  2JGU A;  1WSE A;  4DSL A;  1RT4 A;  4DF4 A;  4CHO A;  4CHZ A;  4CEQ A;  3A2F A;  3HM9 A;  4FCY A;  3DLB A;  1CZB A;  1CXU A;  4LSL A;  4KB1 A;  2I5J A;  2G8K A;  4IKF A;  1QTM A;  4FZY A;  1WN7 A;  4QAG A;  2D5R A;  1F21 A;  3O4N A;  4CJ3 A;  2P5G A;  3DYA A;  1RT6 A;  3OJU A;  2RN2 A;  4F3O A;  3S3O A;  1JLB A;  5KI6 A;  3RMD A;  4EZ9 A;  1O1W A;  4DTN A;  1GOB A;  1B9F A;  4FLZ A;  3HVT A;  4FLT A;  1ZYQ A;  2HHT A;  4FLX A;  3V4I A;  3PX4 A;  3VN5 A;  3V9S A;  2A1S A;  4K8Z A;  3LAK A;  4CEC A;  2G8U A;  1IKV A;  1RTI A;  1U4B A;  2YNG A;  1S1X A;  1VRU A;  3MEG A;  1X9W A;  4PWD A;  1BIU A;  2HVI A;  5HBM A;  4OLA A;  3LZI A;  3UIQ A;  2RPI A;  1JLF A;  3QEV A;  2JLE A;  4F2R A;  4AIL C;  4KB0 A;  3HPH A;  3OYL A;  4FM0 A;  1ITG A;  4CJV A;  1I39 A;  1S9G A;  3SYZ A;  3JSM A;  3L2R A;  1KFD A;  4IBN A;  4RW6 A;  4CJW A;  3L2U A;  4F2S A;  2DY4 A;  3SCX A;  4CF9 A;  4W5R A;  1RIL A;  1HPZ A;  2FC0 A;  1J9A A;  1NK0 A;  2KZZ A;  2OA8 A;  3IRX A;  2PY5 A;  3V9X A;  2QK9 A;  1C1B A;  2HHQ A;  4AHU A;  1CXQ A;  4XIU A;  3OY9 A;  3C6T A;  4N47 A;  3VQ7 A;  1NJW A;  4I2P A;  4EP5 A;  3KJV A;  3K59 A;  4BAC A;  1HNV A;  3I0R A;  3RMC A;  1VSE A;  3LWM A;  4JS5 A;  3ISN C;  1KVA A;  5J2N A;  1NK4 A;  3NF6 A;  4HCB A;  1ZBH A;  5D3G A;  2RF2 A;  2YHA A;  4B08 A;  4E3S A;  3NCI A;  3AVI A;  1VSF A;  4OGC A;  5JS1 A;  1VSL A;  3KIO A;  4YFU A;  1JLQ A;  2FBX A;  4O4G A;  3S9H A;  3DLK A;  3MEC A;  3AO2 A;  2XO7 A;  4ZTF A;  4CJT A;  3K58 A;  1RBU A;  3BGR A;  4KHQ A;  4B8C A;  1I3A A;  3ASM A;  1TV6 A;  3ZSQ A;  4FXD A;  1TKX A;  3ZSW A;  3V9U A;  4OKJ A;  5DMR A;  4CES A;  3KLE A;  5HP1 A;  2ZE2 A;  1TK5 A;  4ELV A;  3K57 A;  1FXX A;  3G0Z A;  3DRR A;  3LAN A;  3MXJ A;  4DQI A;  1FKO A;  4CHY A;  4B8A B;  3HP6 A;  4N5S A;  5C42 A;  2PYJ A;  1VSJ A;  3ZT2 A;  4CFB A;  3U3Y A;  3HYF A;  1TK8 A;  3OS2 A;  4PA1 A;  4CEO A;  4B9V A;  4DTM A;  1ZBF A;  1Y97 A;  2FBV A;  1JL1 A;  3DLE A;  3MEE A;  1LW2 A;  3TR8 A;  4AHC A;  3V81 A;  2O4I A;  4DSF A;  4KRF A;  2HHX A;  2HHU A;  2D0A A;  1S1T A;  2WON A;  2XY5 A;  4BE1 A;  1RDB A;  3OYN A;  1T05 A;  4E0D A;  2XY6 A;  2QKK A;  4DSJ A;  1L3T A;  3HO1 A;  4Z4H A;  4DMN A;  1CLQ A;  4CF0 A;  1C1A A;  4B3O A;  4Z0U A;  1RTD A;  1YTA A;  3LPT A;  4NCB A;  1JLE A;  4CED A;  1C0T A;  3QIP A;  4I2Q A;  3VQQ A;  1NK7 A;  4FJX A;  4DS4 A;  4BDY A;  3T3F A;  3QLH A;  4RW9 A;  2YV0 X;  3CM5 A;  2BDP A;  3QET A;  1NK5 A;  3MAQ A;  3SZ2 A;  1D8Y A;  4DQR A;  1VSK A;  3OS1 A;  4CEZ A;  3VA0 A;  4CK1 A;  2Z1G A;  3D0P A;  4GMJ B;  3VA3 A;  3AVG A;  3QNN A;  1HYZ A;  1SKR A;  3DI6 A;  2ZD1 A;  3SUQ A;  1L3S A;  3ZSY A;  4MQ3 A;  4CK2 A;  3TAB A;  3AA5 X;  1X9M A;  2OPR A;  3QEX A;  3KK1 A;  4OKE A;  1R0A A;  2OYQ A;  1EET A;  1LWC A;  1RT2 A;  5SWM A;  3CM6 A;  1LWE A;  4M3Z A;  1D5A A;  4IG3 A;  4HCC A;  3DOK A;  3F9K A;  5CYM A;  3AV9 A;  1XHZ A;  4BE2 A;  4FJN A;  1RCH A;  4CJL A;  3OYF A;  1VSM A;  1U49 A;  3TAR A;  3U3G A;  3TAQ A;  4KKO A;  5J2M A;  3CYM A;  3B6O A;  2Z1I A;  4CJP A;  4K8X A;  1J54 A;  2EHG A;  1YTU A;  4DSK A;  4FZX C;  4OGE A;  4C8O A;  3OYM A;  1X9S A;  3RR8 A;  1JXB A;  3HL8 A;  4PUO A;  4E1M A;  2B4J A;  2IGI A;  2XY8 A;  1BI4 A;  4CF8 A;  5FDL A;  1L3V A;  4FJL A;  4Q5V A;  4I9Q A;  4CGD A;  2HHW A;  4RW8 A;  4DQQ A;  1W0H A;  4AHR A;  4CGF A;  4DTU A;  3NDK A;  4KFB A;  2Y1I A;  3PX6 A;  4ELU A;  2VG6 A;  2R7Y A;  4BWM A;  2YKN A;  1RTH A;  3CFO A;  4FJM A;  3DMJ A;  4KPY A;  4M3R A;  4CGG A;  4DFK A;  3DRS A;  3QEW A;  1EXQ A;  1NK6 A;  1BCM A;  4FK0 A;  4OPJ A;  1X1P A;  3S3N A;  4AH9 A;  2DFE A;  1TAQ A;  1VSI A;  1BQM A;  2LSN A;  2B6A A;  4DTP A;  2BAN A;  1HYV A;  1ZBU A;  4HHT A;  4FK2 A;  5KRS A;  2Z1J A;  4AHT A;  5FRO A;  3KLG A;  3K5N A;  2F96 A;  3EZ5 A;  4E7J A;  3TAP A;  3KD1 E;  4M3W A;  5J2Q A;  4HUG A;  3WNG A;  4ICL A;  3QEP A;  1HNI A;  3T1A A;  1NK8 A;  3E01 A;  2KTQ A;  3V1R A;  4AHS A;  5K14 A;  3V9Z A;  3NGI A;  1LWF A;  1XI1 A;  2BE2 A;  3HST B;  4O55 A;  1TVR A;  3CFR A;  1MU2 A;  2D0C A;  3MXM A;  3P1G A;  3CG7 A;  3SNN A;  4KHY A;  1UWB A;  4FW1 A;  1B92 A;  1BIS A;  3DLH A;  1IG9 A;  3G10 A;  1BI4 B;  3SQ0 A;  3LP3 A;  1Q9Y A;  1DLO A;  1U45 A;  1VRT A;  1Q9X A;  4KRE A;  4CFC A;  1RT1 A;  1DTT A;  1KLN A;  4N56 A;  3V9W A;  2HMI A;  3C95 A;  4M42 A;  4Z4F A;  3AA4 A;  4B9U A;  3NHG A;  1GOA A;  4JS4 A;  2IS3 A;  4CF2 A;  4B9S A;  4KI4 A;  1TGO A;  4DWI A;  4CCH A;  3OVN A;  1B9D A;  4AHV A;  4E7K A;  4L8R B;  1QSL A;  3RRH A;  1SUQ A;  1KVC A;  3VQ9 A;  1EKE A;  1D9D A;  3OYE A;  1U04 A;  3EYZ A;  4PQU A;  3OYB A;  2DFF A;  1BHL A;  3FFI A;  3VQA A;  4HTU A;  4E7H A;  4DTR A;  2Q3S A;  4OLB A;  1ASU A;  2VG7 A;  4DQS A;  1BGX T;  3NH2 A;  2IC3 A;  4E19 A;  4BWJ A;  1NOZ A;  3SPY A;  5CZ2 A;  4FJ7 A;  3RMA A;  2GBZ A;  4C8L A;  4M3Y A;  3L2V A;  4JLH A;  3K5O A;  3VQE A;  4J2E A;  3PY8 A;  3QO9 A;  1JKH A;  4YNQ A;  2XY7 A;  5I3U A;  3PUF A;  4KHN A;  4CEA A;  4KI6 A;  4M3X A;  4BDZ A;  3VQ4 A;  4CJU A;  1NKB A;  1D9F A;  3VQ6 A;  4IFY A;  3NF8 A;  4CIE A;  2VWJ A;  1SL2 A;  1UA1 A;  5KGX A;  4E89 A;  2IAJ A;  1UA0 A;  4J2A A;  1CZ9 A;  2ETJ A;  4RW4 A;  2DFH A;  3V6D A;  1HYS A;  4UQG A;  1QQC A;  1WNS A;  1WSI A;  1Z25 A;  4C8M A;  3AVA A;  3K5L A;  3NH0 A;  1IKW A;  1JLA A;  3AVN A;  4DU3 A;  2X6S A;  3LZJ A;  1Q8I A;  4JRQ A;  3SQ4 A;  4FJJ A;  3AVH A;  4KTQ A;  2B5J A;  1RDD A;  3KKR A;  2ITG A;  3ZT4 A;  4FJ5 A;  4Y1D A;  2DTU A;  4B9T A;  2VG5 A;  4O0J A;  3KK3 A;  4HVJ A;  4FLY A;  3AO1 A;  1LV5 A;  4DSI A;  3ITH A;  3M8P A;  2HNZ A;  4CFA A;  4O0I A;  3I0S A;  2KZM A;  1WSG A;  1A5W A;  1TKD A;  3L8B A;  2F8S A;  4J2D A;  4J2B A;  3ZSZ A;  4DTJ A;  2HB5 A;  3HPO A;  4C8K A;  2PYL A;  4KAZ A;  1L5U A;  1S6P A;  2EX3 A;  4GW6 A;  1T8E A;  2X74 A;  3LP2 A;  3ZSX A;  4FYD A;  1WAJ A;  2PZS A;  1C0M A;  2NUB A;  3AO5 A;  2XHB A;  3SUN A;  1RBV A;  4E1N A;  3L3U A;  3OYH A;  3PV8 A;  3P83 D;  3ULD A;  2G8H A;  1NKC A;  4DFM A;  3AVC A;  1NKE A;  5C25 A;  5E41 A;  4CK3 A;  1G15 A;  4H4O A;  2OZS A;  2HND A;  4ELT A;  3M8S A;  2BGG A;  1RDC A;  4DLE A;  4OPK A;  5KGW A;  3VQ5 A;  3QIN A;  4CHN A;  2W42 A;  1U47 A;  1ASV A;  3K5M A;  4ZHR A;  1HQU A;  5I42 A;  3KTQ A;  4CJE A;  3K2P A;  3RMB A;  1RT3 A;  2A1R A;  1DTQ A;  4FM2 A;  3QIO A;  4FJ8 A;  3DLR A;  5J2P A;  3P5J A;  4CGI A;  3HP9 A;  1J5O A;  3TWH A;  2RKI A;  3PX0 A;  3TI0 A;  4F3T A;  4IDK A;  1C0U A;  2OPS A;  4FVM A;  5KRT A;  4NCG A;  2G8W A;  1HQE A;  3PO5 A;  4M41 A;  3HPG A;  3LPU A;  3ZSR A;  4DS5 A;  2G8I A;  1BCO A;  3ZT3 A;  1WSJ A;  1WSF A;  1N6Q A;  1WLJ A;  5JS2 A;  3KLI A;  4O5B A;  5HRP A;  1YT3 A;  4F8R A;  1LAV A;  5CYQ A;  1VSH A;  1RNH A;  4CJ4 A;  1QS4 A;  2P1J A;  4M3T A;  2XRI A;  3NBP A;  3SQ1 A;  1REV A;  4H8K A;  3WNE A;  1YVU A;  1N5Y A;  4QOZ B;  1EX4 A;  3NGZ A;  3ZSV A;  3TAE A;  1W9H A;  3AA2 A;  4LH5 A;  3SV4 A;  3KD5 E;  3B6P A;  3D45 A;  1S6Q A;  3AO4 A;  4CJF A;  3OS0 A;  2HNY A;  3KKS A;  1BQN A;  1RDA A;  3OYD A;  2HW3 A;  4EZ6 A;  4CIF A;  1RBR A;  3S3M A;  1XC9 A;  4W5T A;  3PO4 A;  4CFD A;  1FKP A;  3WNF A;  3O4Q A;  3EY1 A;  1NJX A;  4MFB A;  3ALY A;  2P5O A;  4KTZ A;  2IDO A;  3BDP A;  4BDP A;  4KTW A;  2F8T A;  3JYT A;  4H4M A;  3AVK A;  3LDS A;  4B9L A;  1J53 A;  1ZBL A;  4DQP A;  2Z1H A;  4FLW A;  4FLV A;  2G8F A;  1KLM A;  1K6Y A;  1RT7 A;  3NF7 A;  4NCA A;  4CJR A;  4DG1 A;  4W5N A;  5FRN A;  5T7B A;  4RW7 A;  3AVF A;  1SV5 A;  5J1E A;  3HJF A;  1KTQ A;  3CFP A;  4Z4E A;  1IKX A;  4QCL A;  3KLH A;  4HUE A;  4FM1 A;  3U6F A;  3AVJ A;  4DFP A;  4KV8 A;  3IS9 A;  1IKY A;  4NYF A;  3L2W A;  2QXF A;  5DK5 A;  2E6L A;  2ZQB A;  2QKB A;  3SV3 A;  1QSS A;  4LD0 A;  3I8D A;  4DTS A;  1JLG A;  1HMV A;  1KFS A;  3DM2 A;  4KHS A;  1SKW A;  3KK2 A;  3NH1 A;  2E4L A;  2OPP A;  4CJQ A;  3WNH A;  4I9L A;  3SUP A;  4CGH A;  2YNH A;  3AA3 A;  4CE9 A;  1GOC A;  3QER A;  3ZSO A;  1S5J A;  3OYK A;  3F73 A;  4FJI A;  3LP0 A;  3NGY A;  3MXI A;  1LAW A;  2D0B A;  1KSP A;  3ZT0 A;  1ASW A;  1UOC A;  2OPQ A;  3VQ8 A;  3RTV A;  4FJG A;  5FRM A;  3SPZ A;  2HVH A;  4CJ5 A;  3NAE A;  1RBT A;  2O4G A;  3CQ8 A;  4E7L A;  3LAL A;  4I7F A;  2KFN A;  1T03 A;  1C6V A;  4FLU A;  1TAU A;  1NK9 A;  3KLF A;  3OYI A;  3L2Q A;  4JRP A;  5HRO A;  1S1W A;  1U48 A;  1NOY A;  4FJ9 A;  4G1Q A;  3QEI A;  2HHV A;  1KCF A;  3C6U A;  4KHU A;  3H08 A;  3M8Q A;  2ATQ A;  4ID1 A;  4IFV A;  2E6M A;  4N76 A;  1JXE A;  1A5X A;  4CHP A;  3RRG A;  1TK0 A;  3HVR A;  4OJR A;  4M45 A;  1S1U A;  3VQP A;  1L3U A;  4EP4 A;  4FZZ A;  4Z4I A;  2AJQ A;  3VQC A;  1TKZ A;  4BE0 A;  3DRP A;  2VWK A;  4B9N A;  3IG1 A;  4IG0 A;  5KTQ A;  4CF1 A;  3QES A;  2GV9 A;  3L3V A;  4WE1 A;  4R5P A;  4HUF A;  2HHS A;  1TL1 A;  5CZ1 A;  4ID5 A;  3TAN A;  2OZM A;  1IO2 A;  1WSH A;  2FBY A;  2KQ2 A;  3DLG A;  1QSY A;  2IOC A;  1T7P A;  3AO3 A;  4ZTJ A;  4CEE A;  4LH4 A;  5HRN A;  1LW0 A;  2P51 A;  3V1Q A;  5HRS A;  4DFJ A;  1QHT A;  1SKS A;  5HLF A;  3HT3 A;  3SJJ A;  3OJS A;  3HK2 A;  2KW4 A;  4LY7 A;  2X78 A;  4FJH A;  3VQD A;  2FBT A;  4F4K A;  1NJZ A;  3RWU A;  1BIZ A;  3M8R A;  1XWL A;  3ZT1 A;  4W5Q A;  5CY4 A;  4LSN A;  2GUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...