3ZSRA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsrA00
3M8RA 1SL2A 1SV5A 3KKSA 4E89A 4OKJA 3KK2A 1QHTA 4AH9A 4IG0A 3AA4A 3TAGA 2YHBA 2F8TA 4OGEA 3ZSRA 3H08A 3U3YA 1XHXA 2RF2A 3S9HA 3BDPA 4FK0A 2P1JA 2IS3A 3HPGA 4HUGA 2XY7A 3LPTA 2QXFA 1NK4A 1EKEA 3AVFA 3AVAA 1TAQA 1VSDA 3VA3A 2XO7A 4ELUA 4M41A 3SUNA 3ZSOA 4KB0A 4M42A 4ICLA 1RTJA 4PQUA 1RDAA 1WAFA 3LP2A 4DQIA 2VWKA 1EETA 3MEGA 4CE9A 3AO2A 1RBRA 3V9XA 4KB1A 3O3GA 1RILA 1RT7A 3NF7A 3WNFA 3ZT2A 4KTQA 5FROA 2KTQA 1X9MA 3ZSYA 4CGHA 4ZHRA 3THVA 1TKDA 3L2VA 3LZJA 5K14A 4FLYA 4KTZA 3F9KA 4FVMA 1FKOA 4FZYA 3LALA 4CEQA 3ASMA 3L2UA 4KHUA 1TKTA 2RPIA 1RT3A 1RDBA 3LPUA 3DLHA 3NFAA 2BDPA 4O0IA 3LAKA 4RW8A 3RTVA 4AHCA 5I3UA 4DG1A 2KFNA 1RTDA 3K57A 2Z1HA 2HVHA 3VQEA 4O55A 3V9SA 5J1EA 1ZBHA 2HHUA 3AO1A 4KHQA 1IO2A 3O4NA 3AO3A 5T7BA 3O3HA 4DTOA 4R5PA 2YNFA 3KLIA 3SV3A 2VG6A 2G8KA 4FJ5A 4CGGA 2E6MA 3QNOA 4CJ3A 3D0PA 3V6DA 2VG5A 1FXXA 3V9WA 4N47A 1QSYA 1L3SA 2O4GA 2YNHA 4ID1A 4CIGA 1C6VA 3HXMA 1SL1A 4F2RA 4FJIA 3L3UA 4FJKA 4C8OA 3HPHA 3LDSA 3PO5A 1JLAA 1G15A 2HHSA 1C1BA 4LH5A 3D45A 4OLAA 3OYGA 3V1RA 5HRRA 1CZBA 3SYZA 1FKPA 4YFUA 3KJVA 1ASVA 1J9AA 4RW9A 3V4IA 2Q3SA 4HCCA 2BANA 4GW6A 3NH2A 2HHTA 3SQ1A 4EZ9A 4M3UA 2PY5A 3TAEA 2BGGA 3OYEA 1L5UA 4FYDA 1R0AA 3KD5E 1QQCA 2I5JA 4KV8A 3SCXA 3AA2A 2KZZA 1RBTA 5KRTA 5DMRA 2IC3A 4DQQA 3RMAA 3HJFA 5I42A 3OYFA 4I9QA 1S1WA 3RRHA 1WNSA 4W5QA 1Q9XA 1RTIA 1UWBA 3AVHA 4FLWA 4J2EA 4CJUA 3B6PA 3B6OA 5J2MA 5SWMA 1KCFA 4FJHA 1NK8A 1RCHA 2XRIA 5D3GA 4CEDA 3AV9A 2YKMA 2VWJA 1X1PA 2DFEA 4NCGA 1U47A 1D9DA 4Z4FA 3EZ5A 3RMBA 4ID5A 1I39A 2A1SA 3QEIA 2RN2A 4KREA 2DFFA 3DM2A 3OYCA 4DSEA 4HUFA 3HL8A 3CQ8A 4OJRA 5J2PA 3AVJA 1DTQA 4FJGA 4E0DA 4I7FA 1WSFA 4OVLA 4N5SA 3AA3A 4BE0A 3VN5A 3SPZA 3RR8A 1BISA 4TSXA 4PWDA 4BDPA 3AVBA 4CESA 2EHGA 4DSKA 1NJXA 2OPQA 4CEFA 4EZ6A 4CK1A 3G10A 2O4IA 4BWMA 2HW3A 1WSGA 4CHZA 4CJ4A 4OPKA 2ZE2A 3RRGA 1C0MA 4DTXA 4F8RA 3ZSQA 4UQGA 4O4GA 1SKWA 4FK4A 3HO1A 1JXBA 1IH7A 2X6NA 4CFBA 2DFHA 1ZBLA 4DMNA 1X9WA 1VSFA 2G8WA 4XIUA 4B9SA 4Z4IA 1HJRA 1TAUA 4LD0A 2OYQA 3K5OA 4DFPA 3CG7A 4Q0BA 3KLEA 2FBVA 4DSLA 4CJKA 1QTMA 3MEDA 4E7IA 4B8CA 2P5GA 2IOCA 1IKWA 4C8NA 4QOZB 4KFBA 1BQMA 3C6TA 2HHQA 2GBZA 3ITHA 4AHRA 1VSMA 4IBNA 4CJEA 1N6QA 3ZT3A 3KKRA 1RBSA 2XY6A 4CFCA 1XWLA 4IFVA 4FM2A 2OPPA 4GMJB 3TARA 1UA0A 2G8HA 4KPYA 4FW1A 1Y97A 4Z0UA 1LAVA 5HRPA 1KVCA 2HNZA 4YNQA 3SQ4A 2IDOA 3NGZA 4CF1A 2GV9A 3QIOA 2IAJA 3T3FA 4KRFA 3LWMA 3AVLA 4Z4CA 4E7JA 1VSHA 4DTUA 5EU7A 4I2PA 3MAQA 4DTNA 3PX6A 1JLCA 3DLGA 1DTTA 3DOKA 3CYMA 4KKOA 2RKIA 3DRSA 1U04A 2WOMA 3OYJA 4NYFA 3ZSVA 1N5YA 1BGXT 4FJ7A 3VQ4A 3WNGA 1Z25A 3MEEA 4FLZA 1NJZA 4RW4A 3LZIA 5CZ1A 4J2DA 1WSJA 4C8LA 4CGDA 4GVMA 1BIUA 3TI0A 4Z4GA 2HHVA 2D0CA 3CM6A 3OJSA 1S9EA 4AILC 1YTAA 1LWCA 1QSLA 1EX4A 2IGIA 3VQ8A 4CF2A 3HK2A 1QE1A 3NCIA 3OVNA 3NF6A 3K59A 1YVUA 4CJLA 1LV5A 1KVBA 2FC0A 3AVCA 3NBPA 3V1OA 3QLHA 4CJFA 1REVA 1XI1A 1U48A 1NKCA 2FBYA 2P51A 1D9FA 2XHBA 3ZSZA 1ZYQA 2HVIA 1S1VA 1VRTA 4BACA 4AHUA 1NK6A 1L3UA 1RTHA 3HYFA 2HMIA 1RT2A 2A1RA 2KW4A 3VQCA 4JRPA 3AVKA 4FM0A 4DU4A 4DQRA 3DYAA 4CK3A 3L2WA 2G8UA 4RW6A 3NGIA 1C1AA 1NK9A 4FJXA 3BGRA 5HP1A 1NKEA 4FCYA 4FLXA 1A5VA 3LWLA 1RBUA 3CFPA 4DS4A 4CCHA 1BQNA 3F73A 3OYKA 3C95A 3DLBA 3LP0A 1TKZA 4FLUA 4BE1A 1KTQA 2G8IA 4CHNA 5KGXA 1A5WA 1DLOA 3QEWA 2Z1GA 2NUBA 3HP6A 4CF0A 3K5MA 1NKBA 3PV8A 1KFSA 1ZBIA 3V9UA 3PUFA 3PX4A 1BL3A 4DWIA 1HPZA 2FBXA 1TVRA 3CFOA 3P5JA 5CY4A 4LSNA 2Z1JA 1TK0A 1ZBFA 3O3FA 4Y1DA 1JLGA 3EY1A 4H8KA 4DQSA 4F2SA 4CEOA 1LW2A 2KQ2A 4AHVA 2HNYA 4H4MA 2ETJA 3KK1A 5FDLA 3NH1A 1S1TA 3C94A 3DOLA 1Z26A 2B6AA 3LANA 3O4QA 1VSEA 4CGFA 4E19A 2OPSA 3DRRA 4E7KA 4K8ZA 4M3ZA 4FZZA 2Y1IA 4EP5A 3HT3A 3VQ6A 3DLKA 4FJ9A 1HQUA 2YHAA 2DTUA 5C24A 1GOAA 2YNIA 1LAWA 4CEAA 5HROA 3IRXA 1VSJA 1J5OA 3VQQA 4L8RB 4OPJA 4KHWA 4QAGA 4FJLA 3AVMA 4I2QA 1UAXA 5JS2A 4CERA 3SUOA 3ZT0A 3CM5A 1HNIA 1LW0A 3AO4A 2X6SA 4CJPA 3KTQA 1CZ9A 1NOYA 2QKKA 1RDDA 3LP3A 3QEPA 1MU2A 3PO4A 4FLTA 5J2NA 3WNHA 4DF4A 4ELTA 2ATQA 5DK5A 4LSLA 4BWJA 5HBMA 4FZXC 4N41A 3MXIA 3HVRA 5J2QA 4KI4A 3I0RA 3LP1A 4M3RA 3V9ZA 4JS4A 4KAZA 3TR8A 1UA1A 2P5OA 4LH4A 3NH0A 3DLRA 3VQAA 1L3TA 4FJJA 4NYNA 1BCMA 2Z1IA 2E4LA 3K5NA 1WN7A 3NE6A 5KI6A 1C1CA 2GUIA 5KRSA 1NK7A 1SKRA 4Q5VA 4Z4EA 4CHYA 1I3AA 3OYMA 3HM9A 3DI6A 3KLGA 4DFJA 3ZCMA 4B3OA 2YNGA 4JS5A 3WNEA 3QNNA 4W5OA 1C0UA 4DS5A 4CHQA 2FBTA 4DU3A 4DSIA 5KGWA 1VSKA 3SI6A 5E41A 1T03A 3ZT4A 1JLQA 2OZMA 1S1XA 4PUOA 4OGCA 3ISNC 3QIPA 3JYTA 2HHXA 2VG7A 4AHTA 2PZSA 3IG1A 1WSIA 1SKSA 4KHNA 4E1MA 3HSTB 1NJYA 4K8XA 2WONA 5HRSA 1HRHA 3QESA 1JL2A 1WSHA 1CLQA 2EX3A 4CJVA 3KLFA 2XY8A 1SL0A 1TL1A 4CGIA 1S6QA 2B5JA 3T1AA 3E01A 2D0BA 4J2AA 3HPOA 1HQEA 1ITGA 4E7HA 3RMDA 4ELVA 4KO0A 3RWUA 3VA0A 4HHTA 3TABA 1VK0A 5FRNA 1CXUA 3L3VA 3G0ZA 3SQ0A 5FRMA 3M8PA 1TV6A 4CEEA 4EP4A 3OYHA 4ZTFA 2OPRA 4CFDA 1IKVA 1VSLA 4B08A 1S5JA 2BE2A 1T8EA 4CGJA 4ZTJA 1A5XA 3AVGA 3MXMA 1L3VA 1JKHA 3AVNA 3P1GA 5KTQA 4B9LA 2X74A 4M3TA 4RW7A 1XC9A 1IKYA 2OA8A 4CJSA 4JRQA 3A2FA 1BI4B 5CYMA 4FJMA 4BDYA 2YV0X 1S1UA 1KVAA 1RT5A 1TK8A 4FJNA 4O44A 4CHOA 1JLEA 4HVJA 3OYIA 1U4BA 1YTUA 1RT6A 3TWHA 3UIQA 1JLBA 2HB5A 3SUPA 3SJJA 3M8QA 4Z4HA 4WE1A 3JSMA 1TK5A 4KHSA 1UOCA 3V1QA 4HTUA 4E1NA 3VQ7A 2ZD1A 3KIOA 1QSSA 3NF9A 1RDCA 1HNVA 3AVIA 4MFBA 3DLEA 5C25A 1RT4A 3OS2A 3VQPA 4KI6A 1HYZA 4PY5A 4QCLA 3VQDA 3NF8A 3OY9A 4C8KA 3OS0A 1T7PA 4G1QA 3EYZA 4W5TA 3L8BA 4C8MA 4E3SA 1J54A 2X78A 5SZTA 1KFDA 2HNDA 1LWFA 3DMJA 4HUEA 3IS9A 1TGOA 4O5BA 4N56A 3OYAA 4DSJA 3NHGA 4F4KA 3TAFA 4CIFA 4KTWA 4AHSA 4M45A 4NCAA 1B9FA 5JS1A 3SV4A 1EXQA 2HHWA 3C6UA 1U45A 4MQ3A 3QETA 1GOBA 1LWEA 1B92A 4OLBA 2JLEA 4CF9A 3OYNA 1NK5A 2DY4A 3SPYA 4W5RA 3IAYA 4DFKA 3U6FA 4IKFA 4OKKA 4DTMA 4DTPA 3ZT1A 4IG3A 4B9MA 1K6YA 4FLVA 3VQ9A 1C0TA 4DLGA 4F3TA 1U49A 3RMCA 4B9TA 3SNNA 3NDKA 3MECA 1BHLA 1JLFA 4FJ8A 4I9LA 1T05A 1Q8IA 4F3OA 3TAPA 3I8DA 1ASWA 3CFRA 1S6PA 3L2RA 1Q9YA 4H4OA 4CHPA 2G8FA 2PYLA 4B9VA 4W5NA 3NAEA 1KSPA 1B9DA 1KLMA 2Y1JA 2E6LA 4DTSA 4B9NA 1SUQA 3S3MA 1WAJA 3KLHA 1X9SA 3K2PA 2PYJA 1RNHA 1NOZA 1S9GA 3AO5A 3I0SA 3P83D 3U3GA 1JXEA 3OS1A 3ALYA 5HRNA 4DFMA 1W9HA 4CJTA 4M3WA 3PY8A 4B9UA 3KD1E 1F21A 2R7YA 1ZBUA 5CYQA 3M8SA 4FM1A 3ULDA 4E7LA 1IG9A 3VQBA 1VSIA 1QS4A 3FFIA 1KRPA 1JL1A 3OJUA 1BCOA 1XHZA 1VRUA 3SZ2A 3T19A 1ASUA 1BI4A 3HVTA 3DRPA 4IDKA 3VQ5A 3ZSXA 4B8AB 3SQ2A 2KZMA 1RBVA 1IKXA 4PA1A 4IFYA 4CJWA 3QEVA 1TKXA 1HYSA 2F8SA 2JGUA 2G8VA 1YT3A 4CEBA 3OYDA 1W0HA 3LAMA 4FXDA 2W42A 4KHYA 4FW2A 4O0JA 2F96A 4HCBA 2AJQA 1FK9A 3QINA 4DTRA 2OZSA 3TAMA 1RT1A 4JLHA 4BDZA 2D5RA 4CFAA 4M3YA 4DF8A 3HP9A 3MXJA 3TAQA 3TANA 1GOCA 1HMVA 3AA5X 4DLEA 1HYVA 4DU1A 3V81A 1NJWA 4DQPA 2LSNA 4CJQA 3OYLA 3PX0A 1WSEA 4DTJA 1D5AA 2B4JA 4CIEA 3K5LA 4DSFA 2XY5A 4M3XA 5C42A 2QKBA 1KLNA 3RR7A 2ZQBA 3S3NA 3L2QA 4RG8A 4BE2A 3KK3A 4OKEA 3OYBA 2KFZA 4CF8A 4CK2A 3K58A 4N76A 1WLJA 2ITGA 4CJRA 1NK0A 1BIZA 5CZ2A 3S3OA 5HLFA 4J2BA 4CJ5A 1D8YA 3ZSWA 3QEXA 4LY7A 3QERA 1J53A 4CEZA 3SUQA 4FK2A 3QO9A 1O1WA 1CXQA 1EP4A 4Y1CA 2YKNA 4CECA 2D0AA 2QK9A 1TL3A 3NGYA 4NCBA
chains in the Genus database with same CATH superfamily
3M8RA 3KKSA 4E89A 3VF6A 2O8DB 2GX9A 1QHTA 3TAGA 4M7YA 2HHHK 1XHXA 5AQXA 4FK0A 3C6AA 2IS3A 3HPGA 5M1FA 3FE1A 3LPTA 3K9JA 4FOIA 4GKJK 4ELUA 2A6AA 4PQUA 5C2DA 1IG8A 1WAFA 5C2FA 1EQYA 3LDPA 4BC2A 1X9MA 4CGHA 1TYQA 5BRHA 5K14A 4XH5A 1FKOA 2P9KA 4JKEA 3ENOA 4FZYA 4KHUA 2E2OA 2QM1A 4FO0A 4RW8A 2P9PB 4AHCA 2KFNA 3K57A 4IEEA 4IWVA 3AO1A 3O4NA 4BR7A 3DXMA 3O9RA 3KLIA 4CGGA 2IVNA 3VTIA 4FWLA 4CJ3A 4LF7K 3V9WA 4N47A 2YNHA 4CIGA 3HXMA 3HRGA 4FJKA 3J7ZO 2GTDA 1QQMA 1JLAA 4LH5A 5AZIA 2D4WA 4PKGA 1ASVA 4A2BA 4WFBL 2BANA 4IO8A 4CZMA 3FGUA 3NH2A 2HHTA 2QWMA 4K42A 2PY5A 3TAEA 4R79A 3OYEA 4FYDA 4EHTA 1QQCA 1KQSM 3AA2A 1RBTA 4RCHA 5GAEP 3HJFA 5I42A 3OYFA 1S1WA 4CZKA 1RTIA 1HX1A 4CZJA 4J2EA 3B6PA 1NK8A 5JMVA 2VWJA 4NLCA 3RMBA 1JJ2M 1WBBA 4JYAK 3HL8A 4JI5K 4OJRA 4BE0A 1YI2N 3AA3A 4C23A 1TUYA 3AVBA 4BWMA 1WSGA 3PSIA 3QDKA 1N32K 3CXCM 5AZIB 3EKSA 3VEWA 4FK4A 1JXBA 1IH7A 4K41A 4FJHA 1ZBLA 1HJRA 4MO4A 4LD0A 3K5OA 4Q0BA 2H3GX 3KLEA 2FBVA 4B8CA 4QOZB 4C8NA 3VETA 1BQMA 3R6MA 1VSMA 5IT9O 2XY6A 5H1SQ 1XWLA 4IFVA 4FM2A 2OPPA 4GMJB 3TARA 1Y97A 5HRPA 4YNQA 4IO9L 3GE1A 4MLEA 1NWKA 3LWMA 4E7JA 4NCBA 5EU7A 3PX6A 2P9LA 3R9PA 2FF3B 4GV6A 3OYJA 4BVOA 5ELZA 3LZIA 4C8LA 1YF5L 2F4VK 4GVMA 4AM6A 4YY3K 1WUAA 4J8FA 1LWCA 1EX4A 1GLJO 4CF2A 1BA0A 2E1ZA 1QE1A 4GNIA 2E1YA 2DTUA 4B3MK 2FC0A 1SZ2A 1WOQA 2P51A 3K0SA 3E9PA 1NGBA 3VMFB 3VQCA 3AVKA 4FM0A 3F9MA 4DQRA 1C1AA 1XUPO 4DUZK 4BQLA 1A5VA 4FLXA 4CCHA 3AGKA 4FLUA 1CZAN 4KHPK 1HKBA 2YX6A 5KGXA 1A5WA 1DLOA 4M63C 3HP6A 2ITMA 4CF0A 3K5MA 3PUFA 3VOVA 4O8UA 3P5JA 3MCAB 2Z1JA 5AFUH 3O3FA 4FWMA 4H8KA 5C15A 1QZ5A 4CW7B 5LY3A 4DR4K 2HNYA 4AM7A 3KK1A 4JI3K 3LANA 2A3ZA 4E19A 2Y1IA 4EP5A 2IVOA 4BRCA 3CCRN 1KC8O 4CEAA 3IRXA 3VQQA 1NMDA 4BC5A 4FJLA 1UAXA 4JK8A 1S72N 4YOVA 3A5LC 5BPLA 4U67L 1CZ9A 2QKKA 5AQVA 3LP3A 3QEPA 1MU2A 3PO4A 1I94K 3MCPA 4LSLA 1QZ6A 5HBMA 5EY4A 2UXBK 3CCEN 2CH6A 4MO5A 5GIOA 5J2QA 4DUYK 4KI4A 3I0RA 3LP1A 4M3RA 4AF1A 5GAGP 2P5OA 4LH4A 1L3TA 4FJJA 1Q9XA 1KAZA 1WN7A 2VGMA 5KI6A 2GUIA 1SKRA 1NK7A 4Z4EA 4RWTA 3WNEA 3QNNA 4DS5A 2FBTA 2HBKA 1N33K 3SAFA 3QFPA 4YOXA 1HLUA 5F0XA 3VEZA 2PZSA 4AHTA 1IV0A 3IG1A 1WSIA 3E9LA 4GKKK 3HSTB 1NJYA 1OVYA 3P39A 4K8XA 3CPEA 1WSHA 1CLQA 4CJVA 3KLFA 1SL0A 1S6QA 4BRKA 2B5JA 3E01A 4J2AA 3ZX0A 3P38A 5FRNA 1CXUA 3L3VA 3G0ZA 5FRMA 3M8PA 3TPQA 5HOOA 4YOTA 4EP4A 3OYHA 4CFDA 1VSLA 1S5JA 3A5MC 4CGJA 3O5BA 1A5XA 3O8MA 4JKHA 1JKHA 3AVNA 4M3TA 3MWTA 4RW7A 2OA8A 4CJSA 1NGIA 4JRQA 3WXJA 1K73O 2YJFA 3H1VX 1S1UA 1RT5A 2W6LA 4CHOA 1U4BA 3TWHA 2UU9K 3JSMA 3VQ7A 3KIOA 1VAZA 4BRHA 3DLEA 3KWGA 4KI6A 3WQUA 1HYZA 2NLXA 4B3SK 2WUSA 3OS0A 1XQSC 4W5TA 1YAGA 4KBOA 4C8MA 1J54A 4HUEA 4YOUA 3IS9A 1TGOA 2F7TA 3OYAA 4DSJA 3AAPA 3NHGA 4F4KA 4NCAA 1B9FA 3LDOA 2OTJN 1E4GT 2P9IA 2P9SA 1Q81O 4OLBA 2E88A 2JLEA 2BUPA 2UYTA 4W5RA 4CZHA 5E84A 4OKKA 4K0KK 4IG3A 4H5TA 3VQ9A 1C0TA 4O5FA 4DLGA 4F3TA 5AQTA 3RMCA 4B9TA 4BGBA 1GLBG 2ZGYA 1Q8IA 3TAPA 2E2NA 1Q9YA 4FPAA 4B1YB 3NAEA 1KSPA 2Y1JA 4DTSA 4B9NA 1WAJA 3ULEA 1JXEA 5HRNA 2OTLN 1IBLK 1W9HA 2D0PA 3PY8A 2V52B 2R7YA 1ZBUA 3M8SA 1KRPA 3VQBA 1VSIA 1QS4A 4JAXA 4BRLA 2A5XA 1VRUA 1GLEG 2HHXA 3DRPA 3VQ5A 1YJNN 3CJBA 4CJWA 1HYSA 3O1WA 3OYDA 4FXDA 3RSEA 2P9IB 1BWFO 4FW2A 4ISEA 3ID8A 5HL7L 1BU6O 4DTRA 2OZSA 1RT1A 4IOCL 2QWPA 3VENA 4M3YA 3HP9A 3MXJA 4FL9A 4DV0K 2D0OA 1NJWA 4ILHA 3OYLA 4DTJA 3K5LA 4JI1K 4BGAA 2XY5A 5C42A 2YI1A 2NRHA 2ZQBA 3S3NA 3MN9A 3KK3A 4OKEA 4CK2A 5ADXH 1WLJA 2ITGA 1BIZA 4J2BA 3ZSWA 3QEXA 3SUQA 4JN4A 5FPMA 1O1WA 1EP4A 3IUCA 4IOAL 1TL3A 1SL2A 1BDGA 4OKJA 3KK2A 1NG9A 2ZWHA 2UUCK 2F8TA 3H08A 3S9HA 4BRIA 2QXFA 1NK4A 1HPMA 3ZSOA 4BR0A 3WXIA 4CE9A 3V9XA 4JEPA 1RILA 3Q7BA 3WNFA 3ZSYA 3HOSA 3CCLN 4DR6K 2F9WA 4ZHRA 4FLYA 4JI6K 5JVHL 4CEQA 3ASMA 3DWLA 3DLHA 1YJWN 4O0IA 3LAKA 5I3UA 3F5TA 1T6CA 2HVHA 3VQEA 5J1EA 1ZBHA 2HHUA 3BEXA 5T7BA 4DTOA 4JKCA 2YNFA 2VG6A 4FJ5A 4JKGA 1QSYA 3O9QA 1SL1A 4F2RA 4FJIA 4C8OA 1G15A 1GLFO 1C1BA 3D45A 3OYGA 3V1RA 3O9TA 5LMNK 4YFUA 3KJVA 3UKRA 1N36K 1ATSA 2Q3SA 4IJNA 2PBDA 5FPEA 3SQ1A 4EZ9A 1W2BM 1O13A 4OX9K 1K8KA 4LFCK 1HKCA 4KV8A 2KZZA 3I33A 4BRNA 2ASPA 1WNSA 4W5QA 2QWRA 5AQOA 1QVFM 5J2MA 3TU5A 5D3GA 3WXLA 2XRIA 3AV9A 4B1UB 4X64K 2DFEA 1EWRA 4DKWA 1SS6A 2ZGZA 4ID5A 2RN2A 3DM2A 4H03B 3OYCA 4HUFA 3CQ8A 1M90O 5J2PA 1DTQA 4H5NA 4JKGB 4N5SA 3CC4N 1BISA 4TSXA 4DV3K 4CEFA 1MWMA 3CCJN 2O4IA 2HW3A 4CHZA 2ASMA 3MN7A 4OPKA 1RDWX 2ZE2A 4F8RA 4MDAA 1FJGK 1E4FT 3M6GA 4O4GA 3M1FA 2X6NA 3UKRB 2G8WA 1X9WA 2DFHA 4DMNA 2OANA 1TAUA 4ILJA 1JCEA 4DSLA 3MEDA 1K8KB 1IKWA 2AA4A 2HHQA 4AHRA 4BG9A 2E8AA 4BR9A 4KPYA 4DV6K 3C65A 5GINA 1LAVA 3SQ4A 1KVCA 4CF1A 2HBLA 2J4RA 3T3FA 4KRFA 4DTNA 3SJHA 1JLCA 3DLGA 1DTTA 3DOKA 3DLLL 4NYFA 3ZSVA 4FJ7A 3VQ4A 3L4QA 4NLBA 3WNGA 4A57A 4FLZA 4LF6K 5CZ1A 5M1QA 1Q7YO 5LL6Z 4CGDA 4Z4GA 2I7NA 1NGHA 3NCIA 3NF6A 4CJLA 1KVBA 3NBPA 3QLHA 3BY5A 2CH5A 2XHBA 1ZYQA 2F9TA 3FFKB 1VRTA 3HSCA 1RTHA 3HYFA 2A1RA 4FPBA 3CMEN 4V19S 3AARA 2KW4A 1T44A 2GWKA 2Q0UA 1ZC6A 3NGIA 1NK9A 4FJXA 3BGRA 3OA9A 4FCYA 4BRPA 4DS4A 3F73A 1YIJN 2VGNA 4A61A 2ZJPL 4BE1A 1FW6A 4PL7A 1KTQA 3J7AP 1N8RO 4PHTX 3PV8A 1KAYA 3PX4A 3THYB 2FSKA 1VQ8N 4DWIA 1HPZA 5M1PA 3P31A 1TK0A 1ZBFA 5BR8K 1JLGA 1VQ6N 3MWPA 2KQ2A 4AHVA 2ETJA 1S22A 4HVJA 3SBTA 1NNEA 1Z26A 2B6AA 2OPSA 3CC2N 4FZZA 4BR2A 1YHQN 1VQ5N 2ZJQL 2E2PA 5AQYA 4A59A 4QS9A 3F2KA 3I8BA 4BR4A 2CGKA 4I2QA 2EWSA 5JS2A 1XMQK 3SUOA 3SK3A 1SQKA 2WTUA 2X6SA 3OBWA 3D2FA 2Q0RA 5J2NA 4O8KA 4B1WB 4H0OA 3CI5A 4JS4A 3TR8A 3NH0A 3AY9A 1BCMA 3K5NA 3OYMA 3DI6A 3KLGA 5JICA 2NRVA 1C0UA 3VF2A 4DSIA 2E20A 2FSJA 4A62A 2NRTA 1NGJA 1M1KO 4LFBK 1DKGD 2A40A 2OZMA 1RFQA 1S1XA 3ISNC 2VG7A 4XEIA 3WQTA 3NVMA 2JWKA 1BUPA 3EE8A 2CGJA 2WONA 3J8AA 3MN6A 3ATVA 5DM7L 1C0GA 4CGIA 3CQYA 1NGGA 3T1AA 5AR0A 5AQNA 2W6KA 4E7HA 2D1KA 4IZ9A 3ATUA 1VK0A 2Q31A 3SQ0A 3D2FB 4CEEA 4FWRA 1T8EA 4LFAK 5AQWA 3AVGA 3MXMA 1JCFA 3C0BA 1XC9A 4JV5K 3BF3A 1HNXK 5LJVA 1BI4B 2YV0X 1KVAA 4G9ZA 5TKWA 1JCGA 1YTUA 1RT6A 3M8QA 4Z4HA 3D7EO 1TK5A 4KHSA 1UOCA 1X3MA 4E1NA 3CHWA 3NF9A 4B3RK 3OS2A 4PY5A 4QCLA 3VQDA 1VHXA 2YHXA 3L0QA 3NF8A 3OY9A 4GV9A 4YORA 1BO5O 3WEEB 4C1NI 4JI8K 1YXQA 4A5BA 1LWFA 1G99A 3VGKA 4N56A 2V51B 4H5WA 4KTWA 1EXQA 2HHWA 1NMNA 3THWA 5CHIA 1HJOA 3UKUB 3JXUA 5KPTA 3QICA 3HM8A 3SPYA 2HBMA 2GWJA 3U6FA 4IKFA 3ZT1A 4B9MA 3BF1A 4FLVA 3T1YK 3SNNA 4DV7K 1RDUA 4I9LA 1ESVA 1T05A 1SAZA 1U6ZA 3L2RA 3O9UA 4B9VA 4W5NA 2Q36A 2O8CA 1KLMA 3T1HK 3KLHA 1X9SA 3KHYA 3MMVA 2WBNA 4DHYA 1YVNA 1S9GA 3U3GA 2FF6A 4JK9A 4I6MB 3ALYA 1Y64A 4M3WA 5BR9A 3J80O 3ULDA 3KWIA 4E7LA 1IG9A 1V4TA 3FFIA 4A2AA 1JL1A 2FLOA 1BCOA 3OJUA 1XHZA 3T19A 1ASUA 3HVTA 3ZSXA 4B8AB 4DV2K 3SQ2A 1KD1O 4PA1A 1MDUB 5EVZA 2F8SA 4WF9L 1W0HA 3THWB 1X3NA 3HBTA 2RE2A 2F96A 1NLVA 4BVPA 2AJQA 4NXMK 1XC3A 3TAMA 4CFAA 4B3TK 1GOCA 3AA5X 3ZX3A 1D4XA 4CIEA 3CC7N 3SLCA 3L2QA 4RG8A 2O8CB 3K58A 4LF8K 1NK0A 3DJCA 1NGCA 5HLFA 4LY7A 3QERA 4FK2A 4CEZA 2W40A 3VTHA 4CD1A 3QO9A 4DR2K 2YKNA 1ITGA 4DU4A 3AA4A 4L3QA 4JKAA 3ZSRA 2RF2A 3BDPA 1OH5A 2P1JA 2BTFA 2XY7A 5EX5A 4HUGA 1TAQA 1VSDA 2XO7A 1P8ZA 4M41A 4KB0A 4HTLA 4M42A 4ICLA 1RTJA 1RDAA 4CBUA 1EETA 3AO2A 1RBRA 5MLCQ 3O3GA 1RT7A 3ZT2A 1C0FA 1MA9B 5BPNA 3L2VA 3F9KA 3I56N 4FVMA 3IFRA 3LALA 4BR5A 3L2UA 1TKTA 2RPIA 2BDPA 2A41A 4DG1A 5C0YA 5IWAK 1RTDA 4H0YB 1V4SA 2VYPA 1BOTO 4CD3A 4R5PA 1P90A 4BRGA 3O08A 3U8XA 3QNOA 3C6HA 3V6DA 1L3SA 3W3DA 1C6VA 3RVCA 3FR0A 5F2RA 3LDSA 4GV3A 3ZETB 1ZXOA 4OLAA 4FWPA 4QS7A 1CZBA 4B1VA 2QTDA 1FKPA 4B9QA 3SYZA 3T69A 3V4IA 4HCCA 2GEMA 4GW6A 4M3UA 5A2QO 4DV5K 4IDHA 2PAVA 3GOIA 5AQPA 3H3NO 5KRTA 4IJAA 2IC3A 4NXNK 4DQQA 3RMAA 3RRHA 1UWBA 5SWMA 1KCFA 4CBWA 4CEDA 3LL3A 5AQUA 4NCGA 2ZF5O 1U47A 1D9DA 3M5RA 2ZM6K 3EZ5A 3EE9A 2A1SA 3G25A 3QEIA 2DFFA 4CZIA 3CJ9A 4DSEA 4DCHA 3AGRA 4E0DA 4DV4K 4I7FA 3KVGA 4BDPA 5AFUA 3CJ7A 3MDQA 2EHGA 5C10A 2NRRA 1HNWK 3RRGA 4DTXA 4BREA 3ZSQA 3TSPA 4UQGA 4CFBA 4XIUA 3GBTA 3VF4A 1VQON 4E7IA 2P5GA 2IOCA 1Z05A 3ITHA 4IBNA 1N6QA 3JS6A 1VQKN 1RBSA 4WFNL 4CFCA 4FW1A 4FJGA 5BN8A 2HNZA 3NGZA 2GV9A 4Z4CA 4DTUA 1VSHA 2ASOA 2FSNA 4I2PA 2QWNA 3MAQA 3CYMA 3U9ZA 2GELA 3DRSA 1S3XA 4X65K 1U04A 2WOMA 1BGXT 3MEEA 5KPRA 4J2DA 3CMAN 4E1JA 3THXA 3ZEUA 3TI0A 1XNQK 4JHDA 1K8AO 3OJSA 4AILC 1QSLA 3VQ8A 2QXLA 3K59A 3OVNA 1YVUA 3AVCA 3SAGA 3UIQA 4CJFA 5AQHA 1GLCG 1D9FA 2HVIA 4IFEA 4BACA 1NK6A 1E3MA 5AZJA 4U7BA 2O8FB 4JRPA 3DYAA 3VERA 4LF5K 1KAXA 2KLAA 5HP1A 3G6EN 3LWLA 1Q18A 3CFPA 3BZKA 2QI2A 3OYKA 3C95A 3LP0A 1TKZA 1HUXA 2W41A 3HI0A 2G8IA 3QEWA 1Q86O 2NUBA 4LC9B 1KFSA 3V9UA 4KH6A 2FBXA 4LSNA 3KK7A 3HOTA 4DR3K 4Y1DA 3CIPA 4DQSA 1VQ9N 4CEOA 1LW2A 1RGIA 3THXB 3ZEUB 1S1TA 3DOLA 3O4QA 4K8ZA 4M3ZA 4JHDB 3LM9A 5BN9A 4FJ9A 1HQUA 5C24A 1GOAA 1HR0K 1LAWA 4FWKA 5HROA 1Q82O 3GL1A 1VSJA 2IVPA 4KHWA 4L8RB 4ISGA 4DQ8A 3OTOK 3AVMA 5AQGA 3CM5A 1HNIA 5CR4A 3TSQA 5AZJB 4CJPA 3KTQA 1NOYA 1RDDA 1NU0A 2QWOA 4FLTA 3MN5A 3WNHA 4BWJA 3I55N 4FZXC 4N41A 3UB5A 4FWOA 4FWQA 2UXCK 5AQKA 3DLRA 3VQAA 3JAMO 3NE6A 2E4LA 5KRSA 1C1CA 4K43A 4CZLA 4JS5A 4IEIA 3R3LA 4CHQA 4DU3A 2I7PA 2UXDK 4OPHA 1VSKA 1OKJA 3SI6A 3PLAA 5E41A 3ZYYX 3O80A 1T03A 3H3OB 2JWLA 3Q7CA 4XH1A 3AAQA 4OGCA 4GY2B 5AQQA 3SMSA 4KHNA 1QHAA 3QFUA 5M1NA 2OCEA 4HWIA 5HRSA 1HRHA 2EX3A 2XY8A 4CVNE 1TL1A 3LDNA 1VQLN 3R8EA 3THYA 3HPOA 1HQEA 4EFHA 4Z94A 3RMDA 4KO0A 3RWUA 5AQSA 4ZTFA 2OPRA 1YUWA 3UE5A 4ZTJA 1L3VA 3FZHA 3P1GA 5KTQA 2X74A 1VQ4N 5I9EB 1IKYA 2QEXN 3A2FA 5CYMA 2YHWA 3G71N 4BDYA 3HTVA 3R1XA 3J7YP 3OYIA 2PFUA 1JLBA 2HB5A 4WE1A 2QWLA 4FWSA 3V1QA 1QSSA 3VGLA 1BG3A 1RDCA 1HNVA 3AVIA 3CCVN 4MFBA 1HKGA 3VQPA 5ADXA 4C8KA 1T7PA 4G1QA 2WFBA 3EYZA 1T6DA 3L8BA 4E3SA 2X78A 4IXCA 3ZLJA 3CQXA 4EIAA 2HNDA 3DMJA 4O5BA 3CETA 5F1XA 4PKIA 3KZBA 3TAFA 2AP1A 5BREA 4YDUC 3SV4A 3IDHA 3CF5L 1U45A 5AQMA 4MQ3A 3QETA 1GOBA 3FZLA 2P9NB 4H5VA 4CF9A 3OYNA 1NK5A 2DY4A 3IAYA 4DFKA 1TUUA 4DTPA 2HMPA 1K6YA 4WYBA 4JI2K 3MECA 1BHLA 3CCUN 4FJ8A 3U4LA 1VQPN 4F3OA 1ASWA 1T3VA 1WB9A 4H4OA 4CHPA 2PYLA 1B9DA 2E6LA 3S3MA 1VQNN 4JKDA 4WQ4C 1NOZA 3AO5A 3P83D 1YJ9N 1IJJA 2NRXA 4CJTA 1QVGM 1TYQB 1BA1A 3EN9A 1F21A 2P9KB 1MWKA 4FM1A 5TKYA 4OPAA 2NNWA 2CGLA 3SZ2A 1BI4A 2BH1A 2YJEA 3TTFA 3NVKA 1RBVA 4IFYA 3QEVA 2JGUA 5AQLA 1YT3A 2G8VA 5E26A 4X66K 1IBKK 4HCBA 3DXMB 3QINA 2DPNA 4JK7A 2D5RA 4BRAA 1NM1A 4DF8A 2HSTA 3WEEA 1NGAA 1HMVA 3V81A 1HYVA 3OHRA 4WQ5C 2LSNA 4CJQA 3PX0A 3CCMN 1W97L 1WSEA 5CE3A 4JD2A 4M3XA 1KLNA 3SBGA 4BE2A 4LF9K 2KFZA 3L6QA 4CF8A 4CJRA 3UKUA 3S3OA 1D8YA 1LCUA 4BRDA 3QBXA 3EEQA 1CXQA 3MK6A 4Y1CA 4CECA 2QK9A 5AQZA 4WCEL 1SV5A 3B8AX 3MX2A 1Z6RA 5BRFA 4H5RA 3MX5A 4AH9A 3CJCA 4IG0A 2YHBA 4RTFD 4OGEA 3U3YA 3CPWM 2O8EA 1EKEA 3AVFA 3AVAA 3VA3A 3SUNA 2UUBK 4YHHK 3N4QA 4DQIA 3LP2A 2VWKA 3MEGA 3OBYA 4KB1A 4YDUA 1GLDG 4I6MA 3NF7A 2KTQA 4KTQA 5FROA 3THVA 1TKDA 3LZJA 4KTZA 5FLXO 3D2EA 4AQYK 3VESA 4EAHD 4YOYA 1KXPA 4FSVA 1RT3A 1RDBA 3BUZB 3LPUA 4JD2B 3NFAA 1R59O 3RTVA 1LOTB 4KH4A 4Y0WA 3ENHA 1QQOA 2Z1HA 5AQFA 4CI6A 3CJAA 4O55A 3V9SA 4KHQA 1IO2A 3AO3A 3S41A 3O3HA 4DB3A 3SV3A 2G8KA 4JI4K 4K25A 4PKHA 2E6MA 1J6ZA 2HF4A 3D0PA 2VG5A 2UUAK 1FXXA 4WQ4A 2GUPA 2O4GA 4ID1A 3L3UA 4MLHA 3HPHA 5AQJA 3PO5A 2HHSA 1NGEA 4H0TB 5HRRA 2O8EB 2P9LB 1J9AA 4RW9A 3E66A 1YITN 2E2QA 3O1BA 2BGGA 2WC9A 1L5UA 2IIRA 3WT0A 3FZKA 5JVGL 4DR1K 1R0AA 3KD5E 2QW9A 2I5JA 3SCXA 4FVUA 3D2EB 5DMRA 4I9QA 4BRFA 3IKMA 3AVHA 4FLWA 3CJ1A 3B6OA 4CJUA 2YHYA 1RCHA 2YKMA 1X1PA 3DXKA 3K9KA 3SMPA 5JLHA 1VQMN 4WQ5A 3CERA 4Z4FA 4LF4K 1I39A 4KREA 4ILGB 1U2VA 4CBXA 3AVJA 2RHKA 4OVLA 1WSFA 3SPZA 3VN5A 1DEJA 4PWDA 5EOYA 4CESA 4DSKA 1NJXA 2OPQA 4EZ6A 4CK1A 3G10A 4BQZA 4CJ4A 3FLCO 2E5LK 1C0MA 4CZEA 4NB4A 1SKWA 2O8BA 3HO1A 4B9SA 3E1YA 5B8HA 3QB0A 1NGDA 1VSFA 4Z4IA 4CZFA 2OYQA 4DFPA 3CG7A 5C12A 4CJKA 1QTMA 4QS8A 2Q2RA 4YOWA 4H0VB 4MDBA 4KFBA 3C6TA 2GBZA 4IOXA 4CJEA 4F9OA 3IMXA 3ZT3A 3KKRA 3WXKA 2P9UA 2NRZA 1UA0A 2G8HA 4Z0UA 2IDOA 4BY9C 5KQDA 3QIOA 5DM6L 2IAJA 3ZETA 3QMLA 3AVLA 3DXKB 5GIPA 4KKOA 2RKIA 2NRWA 1N5YA 3J81O 4M7XA 1Z25A 2V7ZA 1NJZA 1U2VB 4RW4A 1WSJA 3P4IA 3BP8A 4BC3A 1BIUA 4JI7K 2HHVA 1X9JA 3EZWA 2D0CA 3CM6A 2KKZA 1S9EA 1YTAA 5FPDA 2IGIA 4WFAL 3HK2A 1LV5A 3VGMA 3RR8A 1DT9A 3V1OA 1XI1A 4JKBA 1U48A 1NKCA 1REVA 2VQEK 2FBYA 2O8BB 3ZSZA 1S1VA 2HMIA 4AHUA 1L3UA 1RT2A 2VWBA 5GAHP 2G8UA 4CK3A 3GG4A 4H0XB 3L2WA 4RW6A 2HF3A 1NKEA 1RBUA 3VEVA 1BQNA 3T7ZA 3DLBA 2P9UB 3VEOA 5AJ3K 1VQ7N 4CHNA 2ZJRL 1NKBA 2Z1GA 1ZBIA 3H6EA 3ENBA 3LM2A 1BL3A 1TVRA 3CFOA 5CY4A 3HZ6A 3TTDA 3ID6A 3EY1A 4F2SA 1IBMK 4H4MA 5FDLA 3NH1A 3C94A 1H1VA 4CGFA 4E7KA 1VSEA 3DRRA 1GLLO 1OH8A 3HT3A 3VQ6A 3DLKA 2YHAA 3DAWA 4A5AA 2YNIA 4BROA 5BPMA 4BRMA 1J5OA 4OPJA 4QAGA 4JKFA 3EKUA 4CERA 3ZT0A 3AO4A 1LW0A 3TSUA 1NJIO 1XNRK 4DF4A 4JI0K 4ELTA 2ATQA 5DK5A 2VQFK 3GDQA 3MXIA 3HVRA 3A8YA 1OVQA 3V9ZA 4KAZA 1UA1A 1J5EK 4NYNA 2Z1IA 4FWNA 4Q5VA 1NGFA 4CHYA 1I3AA 3HM9A 2A42A 4DFJA 3ZCMA 4B3OA 2YNGA 2P9SB 2HBJA 4W5OA 3VPZA 4DR5K 5KGWA 3LDQA 2O8FA 4BRQA 3H45C 1JLQA 3ZT4A 5EXWA 4PUOA 3C7NA 3QIPA 5LJWA 3JYTA 1WBDA 3E9OA 3CCQN 1SKSA 3D6RA 4PL8A 4E1MA 3O9SA 3O6WA 1ILYA 1NBWA 3QESA 1JL2A 3NMUA 3CD6N 4H0PA 2NZTA 2D0BA 2QA4N 3ULEB 2QWQA 2VCPA 4ELVA 5M1OA 1W7AA 3VA0A 4HHTA 3TABA 1TV6A 1IKVA 4B1ZA 4B08A 2BE2A 3TTCA 3O4WA 3H1QA 4B9LA 4JNEA 3CCSN 4UY8O 3LDLA 3PSFA 4FJMA 4DR7K 4FOEA 1TK8A 3M3ZA 4O44A 4FJNA 1JLEA 4CJ7A 3G4SN 5M1KA 4DV1K 2Q1NA 3SUPA 3SJJA 3RSEB 3PIPL 4BG8A 4HTUA 2ZD1A 1DGKN 1EWQA 5C25A 1RT4A 5LMUK 1OH6A 3A5NC 4EHUA 3VEYA 4BC4A 1QQNA 2YCHA 3C7NB 1K9MO 1HNZK 5SZTA 2V7YA 1KFDA 1N34K 3A5OC 4X62K 4CIFA 4AHSA 4M45A 4C1NK 5JS1A 4CZGA 3C6UA 1LWEA 1B92A 2FXUA 4XH4A 4DTMA 3H46O 1U49A 3NDKA 3SAHA 4OO1J 1JLFA 5JLFA 3I8DA 3CFRA 1S6PA 2G8FA 3A0IX 1SUQA 1EO1A 3K2PA 3PIOL 3L4IA 2PYJA 1RNHA 3WUHA 5GADP 3W0LA 3I0SA 4KH5A 3OS1A 4DFMA 4GVEA 5FPNA 3N4PA 4B9UA 3KD1E 2O8DA 5CYQA 5AQIA 3EL2A 1GLAG 4IDKA 3FZMA 2KZMA 1ATRA 3OW2M 1IKXA 3WXMB 1TKXA 4CEBA 3LAMA 2W42A 5KQ8A 1XMOK 4KHYA 4O0JA 3FZFA 1FK9A 1ATNA 4JLHA 4BDZA 3ZX2A 3TAQA 5AQRA 5BRDA 4DU1A 3TANA 4DQPA 4DLEA 2KHOA 4B1XB 4ISFA 3BZCA 3EO3A 1D5AA 2B4JA 4DSFA 2QKBA 3RR7A 2Q97A 3U9DA 1ZBSA 2P9PA 3OYBA 2HOEA 3QBWA 4N76A 5CZ2A 4CJ5A 2P9NA 4NO7A 1J53A 3VEXA 1OH7A 5KPZA 2D0AA 3NGYA
chains in the Genus database with same CATH topology
3M8RA 1SL2A 1SV5A 3KKSA 4E89A 4OKJA 3KK2A 1QHTA 4AH9A 4IG0A 3AA4A 3TAGA 2YHBA 2F8TA 4OGEA 3ZSRA 3H08A 3U3YA 1XHXA 2RF2A 3S9HA 3BDPA 4FK0A 2P1JA 2IS3A 3HPGA 4HUGA 2XY7A 3LPTA 2QXFA 1NK4A 1EKEA 3AVFA 3AVAA 1TAQA 1VSDA 3VA3A 2XO7A 4ELUA 4M41A 3SUNA 3ZSOA 4KB0A 4M42A 4ICLA 1RTJA 4PQUA 1RDAA 1WAFA 3LP2A 4DQIA 2VWKA 1EETA 3MEGA 4CE9A 3AO2A 1RBRA 3V9XA 4KB1A 3O3GA 1RILA 1RT7A 3NF7A 3WNFA 3ZT2A 4KTQA 5FROA 2KTQA 1X9MA 3ZSYA 4CGHA 4ZHRA 3THVA 1TKDA 3L2VA 3LZJA 5K14A 4FLYA 4KTZA 3F9KA 4FVMA 1FKOA 4FZYA 3LALA 4CEQA 3ASMA 3L2UA 4KHUA 1TKTA 2RPIA 1RT3A 1RDBA 3LPUA 3DLHA 3NFAA 2BDPA 4O0IA 3LAKA 4RW8A 3RTVA 4AHCA 5I3UA 4DG1A 2KFNA 1RTDA 3K57A 2Z1HA 2HVHA 3VQEA 4O55A 3V9SA 5J1EA 1ZBHA 2HHUA 3AO1A 4KHQA 1IO2A 3O4NA 3AO3A 5T7BA 3O3HA 4DTOA 4R5PA 2YNFA 3KLIA 3SV3A 2VG6A 2G8KA 4FJ5A 4CGGA 2E6MA 3QNOA 4CJ3A 3D0PA 3V6DA 2VG5A 1FXXA 3V9WA 4N47A 1QSYA 1L3SA 2O4GA 2YNHA 4ID1A 4CIGA 1C6VA 3HXMA 1SL1A 4F2RA 4FJIA 3L3UA 4FJKA 4C8OA 3HPHA 3LDSA 3PO5A 1JLAA 1G15A 2HHSA 1C1BA 4LH5A 3D45A 4OLAA 3OYGA 3V1RA 5HRRA 1CZBA 3SYZA 1FKPA 4YFUA 3KJVA 1ASVA 1J9AA 4RW9A 3V4IA 2Q3SA 4HCCA 2BANA 4GW6A 3NH2A 2HHTA 3SQ1A 4EZ9A 4M3UA 2PY5A 3TAEA 2BGGA 3OYEA 1L5UA 4FYDA 1R0AA 3KD5E 1QQCA 2I5JA 4KV8A 3SCXA 3AA2A 2KZZA 1RBTA 5KRTA 5DMRA 2IC3A 4DQQA 3RMAA 3HJFA 5I42A 3OYFA 4I9QA 1S1WA 3RRHA 1WNSA 4W5QA 1Q9XA 1RTIA 1UWBA 3AVHA 4FLWA 4J2EA 4CJUA 3B6PA 3B6OA 5J2MA 5SWMA 1KCFA 4FJHA 1NK8A 1RCHA 2XRIA 5D3GA 4CEDA 3AV9A 2YKMA 2VWJA 1X1PA 2DFEA 4NCGA 1U47A 1D9DA 4Z4FA 3EZ5A 3RMBA 4ID5A 1I39A 2A1SA 3QEIA 2RN2A 4KREA 2DFFA 3DM2A 3OYCA 4DSEA 4HUFA 3HL8A 3CQ8A 4OJRA 5J2PA 3AVJA 1DTQA 4FJGA 4E0DA 4I7FA 1WSFA 4OVLA 4N5SA 3AA3A 4BE0A 3VN5A 3SPZA 3RR8A 1BISA 4TSXA 4PWDA 4BDPA 3AVBA 4CESA 2EHGA 4DSKA 1NJXA 2OPQA 4CEFA 4EZ6A 4CK1A 3G10A 2O4IA 4BWMA 2HW3A 1WSGA 4CHZA 4CJ4A 4OPKA 2ZE2A 3RRGA 1C0MA 4DTXA 4F8RA 3ZSQA 4UQGA 4O4GA 1SKWA 4FK4A 3HO1A 1JXBA 1IH7A 2X6NA 4CFBA 2DFHA 1ZBLA 4DMNA 1X9WA 1VSFA 2G8WA 4XIUA 4B9SA 4Z4IA 1HJRA 1TAUA 4LD0A 2OYQA 3K5OA 4DFPA 3CG7A 4Q0BA 3KLEA 2FBVA 4DSLA 4CJKA 1QTMA 3MEDA 4E7IA 4B8CA 2P5GA 2IOCA 1IKWA 4C8NA 4QOZB 4KFBA 1BQMA 3C6TA 2HHQA 2GBZA 3ITHA 4AHRA 1VSMA 4IBNA 4CJEA 1N6QA 3ZT3A 3KKRA 1RBSA 2XY6A 4CFCA 1XWLA 4IFVA 4FM2A 2OPPA 4GMJB 3TARA 1UA0A 2G8HA 4KPYA 4FW1A 1Y97A 4Z0UA 1LAVA 5HRPA 1KVCA 2HNZA 4YNQA 3SQ4A 2IDOA 3NGZA 4CF1A 2GV9A 3QIOA 2IAJA 3T3FA 4KRFA 3LWMA 3AVLA 4Z4CA 4E7JA 1VSHA 4DTUA 5EU7A 4I2PA 3MAQA 4DTNA 3PX6A 1JLCA 3DLGA 1DTTA 3DOKA 3CYMA 4KKOA 2RKIA 3DRSA 1U04A 2WOMA 3OYJA 4NYFA 3ZSVA 1N5YA 1BGXT 4FJ7A 3VQ4A 3WNGA 1Z25A 3MEEA 4FLZA 1NJZA 4RW4A 3LZIA 5CZ1A 4J2DA 1WSJA 4C8LA 4CGDA 4GVMA 1BIUA 3TI0A 4Z4GA 2HHVA 2D0CA 3CM6A 3OJSA 1S9EA 4AILC 1YTAA 1LWCA 1QSLA 1EX4A 2IGIA 3VQ8A 4CF2A 3HK2A 1QE1A 3NCIA 3OVNA 3NF6A 3K59A 1YVUA 4CJLA 1LV5A 1KVBA 2FC0A 3AVCA 3NBPA 3V1OA 3QLHA 4CJFA 1REVA 1XI1A 1U48A 1NKCA 2FBYA 2P51A 1D9FA 2XHBA 3ZSZA 1ZYQA 2HVIA 1S1VA 1VRTA 4BACA 4AHUA 1NK6A 1L3UA 1RTHA 3HYFA 2HMIA 1RT2A 2A1RA 2KW4A 3VQCA 4JRPA 3AVKA 4FM0A 4DU4A 4DQRA 3DYAA 4CK3A 3L2WA 2G8UA 4RW6A 3NGIA 1C1AA 1NK9A 4FJXA 3BGRA 5HP1A 1NKEA 4FCYA 4FLXA 1A5VA 3LWLA 1RBUA 3CFPA 4DS4A 4CCHA 1BQNA 3F73A 3OYKA 3C95A 3DLBA 3LP0A 1TKZA 4FLUA 4BE1A 1KTQA 2G8IA 4CHNA 5KGXA 1A5WA 1DLOA 3QEWA 2Z1GA 2NUBA 3HP6A 4CF0A 3K5MA 1NKBA 3PV8A 1KFSA 1ZBIA 3V9UA 3PUFA 3PX4A 1BL3A 4DWIA 1HPZA 2FBXA 1TVRA 3CFOA 3P5JA 5CY4A 4LSNA 2Z1JA 1TK0A 1ZBFA 3O3FA 4Y1DA 1JLGA 3EY1A 4H8KA 4DQSA 4F2SA 4CEOA 1LW2A 2KQ2A 4AHVA 2HNYA 4H4MA 2ETJA 3KK1A 5FDLA 3NH1A 1S1TA 3C94A 3DOLA 1Z26A 2B6AA 3LANA 3O4QA 1VSEA 4CGFA 4E19A 2OPSA 3DRRA 4E7KA 4K8ZA 4M3ZA 4FZZA 2Y1IA 4EP5A 3HT3A 3VQ6A 3DLKA 4FJ9A 1HQUA 2YHAA 2DTUA 5C24A 1GOAA 2YNIA 1LAWA 4CEAA 5HROA 3IRXA 1VSJA 1J5OA 3VQQA 4L8RB 4OPJA 4KHWA 4QAGA 4FJLA 3AVMA 4I2QA 1UAXA 5JS2A 4CERA 3SUOA 3ZT0A 3CM5A 1HNIA 1LW0A 3AO4A 2X6SA 4CJPA 3KTQA 1CZ9A 1NOYA 2QKKA 1RDDA 3LP3A 3QEPA 1MU2A 3PO4A 4FLTA 5J2NA 3WNHA 4DF4A 4ELTA 2ATQA 5DK5A 4LSLA 4BWJA 5HBMA 4FZXC 4N41A 3MXIA 3HVRA 5J2QA 4KI4A 3I0RA 3LP1A 4M3RA 3V9ZA 4JS4A 4KAZA 3TR8A 1UA1A 2P5OA 4LH4A 3NH0A 3DLRA 3VQAA 1L3TA 4FJJA 4NYNA 1BCMA 2Z1IA 2E4LA 3K5NA 1WN7A 3NE6A 5KI6A 1C1CA 2GUIA 5KRSA 1NK7A 1SKRA 4Q5VA 4Z4EA 4CHYA 1I3AA 3OYMA 3HM9A 3DI6A 3KLGA 4DFJA 3ZCMA 4B3OA 2YNGA 4JS5A 3WNEA 3QNNA 4W5OA 1C0UA 4DS5A 4CHQA 2FBTA 4DU3A 4DSIA 5KGWA 1VSKA 3SI6A 5E41A 1T03A 3ZT4A 1JLQA 2OZMA 1S1XA 4PUOA 4OGCA 3ISNC 3QIPA 3JYTA 2HHXA 2VG7A 4AHTA 2PZSA 3IG1A 1WSIA 1SKSA 4KHNA 4E1MA 3HSTB 1NJYA 4K8XA 2WONA 5HRSA 1HRHA 3QESA 1JL2A 1WSHA 1CLQA 2EX3A 4CJVA 3KLFA 2XY8A 1SL0A 1TL1A 4CGIA 1S6QA 2B5JA 3T1AA 3E01A 2D0BA 4J2AA 3HPOA 1HQEA 1ITGA 4E7HA 3RMDA 4ELVA 4KO0A 3RWUA 3VA0A 4HHTA 3TABA 1VK0A 5FRNA 1CXUA 3L3VA 3G0ZA 3SQ0A 5FRMA 3M8PA 1TV6A 4CEEA 4EP4A 3OYHA 4ZTFA 2OPRA 4CFDA 1IKVA 1VSLA 4B08A 1S5JA 2BE2A 1T8EA 4CGJA 4ZTJA 1A5XA 3AVGA 3MXMA 1L3VA 1JKHA 3AVNA 3P1GA 5KTQA 4B9LA 2X74A 4M3TA 4RW7A 1XC9A 1IKYA 2OA8A 4CJSA 4JRQA 3A2FA 1BI4B 5CYMA 4FJMA 4BDYA 2YV0X 1S1UA 1KVAA 1RT5A 1TK8A 4FJNA 4O44A 4CHOA 1JLEA 4HVJA 3OYIA 1U4BA 1YTUA 1RT6A 3TWHA 3UIQA 1JLBA 2HB5A 3SUPA 3SJJA 3M8QA 4Z4HA 4WE1A 3JSMA 1TK5A 4KHSA 1UOCA 3V1QA 4HTUA 4E1NA 3VQ7A 2ZD1A 3KIOA 1QSSA 3NF9A 1RDCA 1HNVA 3AVIA 4MFBA 3DLEA 5C25A 1RT4A 3OS2A 3VQPA 4KI6A 1HYZA 4PY5A 4QCLA 3VQDA 3NF8A 3OY9A 4C8KA 3OS0A 1T7PA 4G1QA 3EYZA 4W5TA 3L8BA 4C8MA 4E3SA 1J54A 2X78A 5SZTA 1KFDA 2HNDA 1LWFA 3DMJA 4HUEA 3IS9A 1TGOA 4O5BA 4N56A 3OYAA 4DSJA 3NHGA 4F4KA 3TAFA 4CIFA 4KTWA 4AHSA 4M45A 4NCAA 1B9FA 5JS1A 3SV4A 1EXQA 2HHWA 3C6UA 1U45A 4MQ3A 3QETA 1GOBA 1LWEA 1B92A 4OLBA 2JLEA 4CF9A 3OYNA 1NK5A 2DY4A 3SPYA 4W5RA 3IAYA 4DFKA 3U6FA 4IKFA 4OKKA 4DTMA 4DTPA 3ZT1A 4IG3A 4B9MA 1K6YA 4FLVA 3VQ9A 1C0TA 4DLGA 4F3TA 1U49A 3RMCA 4B9TA 3SNNA 3NDKA 3MECA 1BHLA 1JLFA 4FJ8A 4I9LA 1T05A 1Q8IA 4F3OA 3TAPA 3I8DA 1ASWA 3CFRA 1S6PA 3L2RA 1Q9YA 4H4OA 4CHPA 2G8FA 2PYLA 4B9VA 4W5NA 3NAEA 1KSPA 1B9DA 1KLMA 2Y1JA 2E6LA 4DTSA 4B9NA 1SUQA 3S3MA 1WAJA 3KLHA 1X9SA 3K2PA 2PYJA 1RNHA 1NOZA 1S9GA 3AO5A 3I0SA 3P83D 3U3GA 1JXEA 3OS1A 3ALYA 5HRNA 4DFMA 1W9HA 4CJTA 4M3WA 3PY8A 4B9UA 3KD1E 1F21A 2R7YA 1ZBUA 5CYQA 3M8SA 4FM1A 3ULDA 4E7LA 1IG9A 3VQBA 1VSIA 1QS4A 3FFIA 1KRPA 1JL1A 3OJUA 1BCOA 1XHZA 1VRUA 3SZ2A 3T19A 1ASUA 1BI4A 3HVTA 3DRPA 4IDKA 3VQ5A 3ZSXA 4B8AB 3SQ2A 2KZMA 1RBVA 1IKXA 4PA1A 4IFYA 4CJWA 3QEVA 1TKXA 1HYSA 2F8SA 2JGUA 2G8VA 1YT3A 4CEBA 3OYDA 1W0HA 3LAMA 4FXDA 2W42A 4KHYA 4FW2A 4O0JA 2F96A 4HCBA 2AJQA 1FK9A 3QINA 4DTRA 2OZSA 3TAMA 1RT1A 4JLHA 4BDZA 2D5RA 4CFAA 4M3YA 4DF8A 3HP9A 3MXJA 3TAQA 3TANA 1GOCA 1HMVA 3AA5X 4DLEA 1HYVA 4DU1A 3V81A 1NJWA 4DQPA 2LSNA 4CJQA 3OYLA 3PX0A 1WSEA 4DTJA 1D5AA 2B4JA 4CIEA 3K5LA 4DSFA 2XY5A 4M3XA 5C42A 2QKBA 1KLNA 3RR7A 2ZQBA 3S3NA 3L2QA 4RG8A 4BE2A 3KK3A 4OKEA 3OYBA 2KFZA 4CF8A 4CK2A 3K58A 4N76A 1WLJA 2ITGA 4CJRA 1NK0A 1BIZA 5CZ2A 3S3OA 5HLFA 4J2BA 4CJ5A 1D8YA 3ZSWA 3QEXA 4LY7A 3QERA 1J53A 4CEZA 3SUQA 4FK2A 3QO9A 1O1WA 1CXQA 1EP4A 4Y1CA 2YKNA 4CECA 2D0AA 2QK9A 1TL3A 3NGYA 4NCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8R A;  1SL2 A;  1SV5 A;  3KKS A;  4E89 A;  4OKJ A;  3KK2 A;  1QHT A;  4AH9 A;  4IG0 A;  3AA4 A;  3TAG A;  2YHB A;  2F8T A;  4OGE A;  3ZSR A;  3H08 A;  3U3Y A;  1XHX A;  2RF2 A;  3S9H A;  3BDP A;  4FK0 A;  2P1J A;  2IS3 A;  3HPG A;  4HUG A;  2XY7 A;  3LPT A;  2QXF A;  1NK4 A;  1EKE A;  3AVF A;  3AVA A;  1TAQ A;  1VSD A;  3VA3 A;  2XO7 A;  4ELU A;  4M41 A;  3SUN A;  3ZSO A;  4KB0 A;  4M42 A;  4ICL A;  1RTJ A;  4PQU A;  1RDA A;  1WAF A;  3LP2 A;  4DQI A;  2VWK A;  1EET A;  3MEG A;  4CE9 A;  3AO2 A;  1RBR A;  3V9X A;  4KB1 A;  3O3G A;  1RIL A;  1RT7 A;  3NF7 A;  3WNF A;  3ZT2 A;  4KTQ A;  5FRO A;  2KTQ A;  1X9M A;  3ZSY A;  4CGH A;  4ZHR A;  3THV A;  1TKD A;  3L2V A;  3LZJ A;  5K14 A;  4FLY A;  4KTZ A;  3F9K A;  4FVM A;  1FKO A;  4FZY A;  3LAL A;  4CEQ A;  3ASM A;  3L2U A;  4KHU A;  1TKT A;  2RPI A;  1RT3 A;  1RDB A;  3LPU A;  3DLH A;  3NFA A;  2BDP A;  4O0I A;  3LAK A;  4RW8 A;  3RTV A;  4AHC A;  5I3U A;  4DG1 A;  2KFN A;  1RTD A;  3K57 A;  2Z1H A;  2HVH A;  3VQE A;  4O55 A;  3V9S A;  5J1E A;  1ZBH A;  2HHU A;  3AO1 A;  4KHQ A;  1IO2 A;  3O4N A;  3AO3 A;  5T7B A;  3O3H A;  4DTO A;  4R5P A;  2YNF A;  3KLI A;  3SV3 A;  2VG6 A;  2G8K A;  4FJ5 A;  4CGG A;  2E6M A;  3QNO A;  4CJ3 A;  3D0P A;  3V6D A;  2VG5 A;  1FXX A;  3V9W A;  4N47 A;  1QSY A;  1L3S A;  2O4G A;  2YNH A;  4ID1 A;  4CIG A;  1C6V A;  3HXM A;  1SL1 A;  4F2R A;  4FJI A;  3L3U A;  4FJK A;  4C8O A;  3HPH A;  3LDS A;  3PO5 A;  1JLA A;  1G15 A;  2HHS A;  1C1B A;  4LH5 A;  3D45 A;  4OLA A;  3OYG A;  3V1R A;  5HRR A;  1CZB A;  3SYZ A;  1FKP A;  4YFU A;  3KJV A;  1ASV A;  1J9A A;  4RW9 A;  3V4I A;  2Q3S A;  4HCC A;  2BAN A;  4GW6 A;  3NH2 A;  2HHT A;  3SQ1 A;  4EZ9 A;  4M3U A;  2PY5 A;  3TAE A;  2BGG A;  3OYE A;  1L5U A;  4FYD A;  1R0A A;  3KD5 E;  1QQC A;  2I5J A;  4KV8 A;  3SCX A;  3AA2 A;  2KZZ A;  1RBT A;  5KRT A;  5DMR A;  2IC3 A;  4DQQ A;  3RMA A;  3HJF A;  5I42 A;  3OYF A;  4I9Q A;  1S1W A;  3RRH A;  1WNS A;  4W5Q A;  1Q9X A;  1RTI A;  1UWB A;  3AVH A;  4FLW A;  4J2E A;  4CJU A;  3B6P A;  3B6O A;  5J2M A;  5SWM A;  1KCF A;  4FJH A;  1NK8 A;  1RCH A;  2XRI A;  5D3G A;  4CED A;  3AV9 A;  2YKM A;  2VWJ A;  1X1P A;  2DFE A;  4NCG A;  1U47 A;  1D9D A;  4Z4F A;  3EZ5 A;  3RMB A;  4ID5 A;  1I39 A;  2A1S A;  3QEI A;  2RN2 A;  4KRE A;  2DFF A;  3DM2 A;  3OYC A;  4DSE A;  4HUF A;  3HL8 A;  3CQ8 A;  4OJR A;  5J2P A;  3AVJ A;  1DTQ A;  4FJG A;  4E0D A;  4I7F A;  1WSF A;  4OVL A;  4N5S A;  3AA3 A;  4BE0 A;  3VN5 A;  3SPZ A;  3RR8 A;  1BIS A;  4TSX A;  4PWD A;  4BDP A;  3AVB A;  4CES A;  2EHG A;  4DSK A;  1NJX A;  2OPQ A;  4CEF A;  4EZ6 A;  4CK1 A;  3G10 A;  2O4I A;  4BWM A;  2HW3 A;  1WSG A;  4CHZ A;  4CJ4 A;  4OPK A;  2ZE2 A;  3RRG A;  1C0M A;  4DTX A;  4F8R A;  3ZSQ A;  4UQG A;  4O4G A;  1SKW A;  4FK4 A;  3HO1 A;  1JXB A;  1IH7 A;  2X6N A;  4CFB A;  2DFH A;  1ZBL A;  4DMN A;  1X9W A;  1VSF A;  2G8W A;  4XIU A;  4B9S A;  4Z4I A;  1HJR A;  1TAU A;  4LD0 A;  2OYQ A;  3K5O A;  4DFP A;  3CG7 A;  4Q0B A;  3KLE A;  2FBV A;  4DSL A;  4CJK A;  1QTM A;  3MED A;  4E7I A;  4B8C A;  2P5G A;  2IOC A;  1IKW A;  4C8N A;  4QOZ B;  4KFB A;  1BQM A;  3C6T A;  2HHQ A;  2GBZ A;  3ITH A;  4AHR A;  1VSM A;  4IBN A;  4CJE A;  1N6Q A;  3ZT3 A;  3KKR A;  1RBS A;  2XY6 A;  4CFC A;  1XWL A;  4IFV A;  4FM2 A;  2OPP A;  4GMJ B;  3TAR A;  1UA0 A;  2G8H A;  4KPY A;  4FW1 A;  1Y97 A;  4Z0U A;  1LAV A;  5HRP A;  1KVC A;  2HNZ A;  4YNQ A;  3SQ4 A;  2IDO A;  3NGZ A;  4CF1 A;  2GV9 A;  3QIO A;  2IAJ A;  3T3F A;  4KRF A;  3LWM A;  3AVL A;  4Z4C A;  4E7J A;  1VSH A;  4DTU A;  5EU7 A;  4I2P A;  3MAQ A;  4DTN A;  3PX6 A;  1JLC A;  3DLG A;  1DTT A;  3DOK A;  3CYM A;  4KKO A;  2RKI A;  3DRS A;  1U04 A;  2WOM A;  3OYJ A;  4NYF A;  3ZSV A;  1N5Y A;  1BGX T;  4FJ7 A;  3VQ4 A;  3WNG A;  1Z25 A;  3MEE A;  4FLZ A;  1NJZ A;  4RW4 A;  3LZI A;  5CZ1 A;  4J2D A;  1WSJ A;  4C8L A;  4CGD A;  4GVM A;  1BIU A;  3TI0 A;  4Z4G A;  2HHV A;  2D0C A;  3CM6 A;  3OJS A;  1S9E A;  4AIL C;  1YTA A;  1LWC A;  1QSL A;  1EX4 A;  2IGI A;  3VQ8 A;  4CF2 A;  3HK2 A;  1QE1 A;  3NCI A;  3OVN A;  3NF6 A;  3K59 A;  1YVU A;  4CJL A;  1LV5 A;  1KVB A;  2FC0 A;  3AVC A;  3NBP A;  3V1O A;  3QLH A;  4CJF A;  1REV A;  1XI1 A;  1U48 A;  1NKC A;  2FBY A;  2P51 A;  1D9F A;  2XHB A;  3ZSZ A;  1ZYQ A;  2HVI A;  1S1V A;  1VRT A;  4BAC A;  4AHU A;  1NK6 A;  1L3U A;  1RTH A;  3HYF A;  2HMI A;  1RT2 A;  2A1R A;  2KW4 A;  3VQC A;  4JRP A;  3AVK A;  4FM0 A;  4DU4 A;  4DQR A;  3DYA A;  4CK3 A;  3L2W A;  2G8U A;  4RW6 A;  3NGI A;  1C1A A;  1NK9 A;  4FJX A;  3BGR A;  5HP1 A;  1NKE A;  4FCY A;  4FLX A;  1A5V A;  3LWL A;  1RBU A;  3CFP A;  4DS4 A;  4CCH A;  1BQN A;  3F73 A;  3OYK A;  3C95 A;  3DLB A;  3LP0 A;  1TKZ A;  4FLU A;  4BE1 A;  1KTQ A;  2G8I A;  4CHN A;  5KGX A;  1A5W A;  1DLO A;  3QEW A;  2Z1G A;  2NUB A;  3HP6 A;  4CF0 A;  3K5M A;  1NKB A;  3PV8 A;  1KFS A;  1ZBI A;  3V9U A;  3PUF A;  3PX4 A;  1BL3 A;  4DWI A;  1HPZ A;  2FBX A;  1TVR A;  3CFO A;  3P5J A;  5CY4 A;  4LSN A;  2Z1J A;  1TK0 A;  1ZBF A;  3O3F A;  4Y1D A;  1JLG A;  3EY1 A;  4H8K A;  4DQS A;  4F2S A;  4CEO A;  1LW2 A;  2KQ2 A;  4AHV A;  2HNY A;  4H4M A;  2ETJ A;  3KK1 A;  5FDL A;  3NH1 A;  1S1T A;  3C94 A;  3DOL A;  1Z26 A;  2B6A A;  3LAN A;  3O4Q A;  1VSE A;  4CGF A;  4E19 A;  2OPS A;  3DRR A;  4E7K A;  4K8Z A;  4M3Z A;  4FZZ A;  2Y1I A;  4EP5 A;  3HT3 A;  3VQ6 A;  3DLK A;  4FJ9 A;  1HQU A;  2YHA A;  2DTU A;  5C24 A;  1GOA A;  2YNI A;  1LAW A;  4CEA A;  5HRO A;  3IRX A;  1VSJ A;  1J5O A;  3VQQ A;  4L8R B;  4OPJ A;  4KHW A;  4QAG A;  4FJL A;  3AVM A;  4I2Q A;  1UAX A;  5JS2 A;  4CER A;  3SUO A;  3ZT0 A;  3CM5 A;  1HNI A;  1LW0 A;  3AO4 A;  2X6S A;  4CJP A;  3KTQ A;  1CZ9 A;  1NOY A;  2QKK A;  1RDD A;  3LP3 A;  3QEP A;  1MU2 A;  3PO4 A;  4FLT A;  5J2N A;  3WNH A;  4DF4 A;  4ELT A;  2ATQ A;  5DK5 A;  4LSL A;  4BWJ A;  5HBM A;  4FZX C;  4N41 A;  3MXI A;  3HVR A;  5J2Q A;  4KI4 A;  3I0R A;  3LP1 A;  4M3R A;  3V9Z A;  4JS4 A;  4KAZ A;  3TR8 A;  1UA1 A;  2P5O A;  4LH4 A;  3NH0 A;  3DLR A;  3VQA A;  1L3T A;  4FJJ A;  4NYN A;  1BCM A;  2Z1I A;  2E4L A;  3K5N A;  1WN7 A;  3NE6 A;  5KI6 A;  1C1C A;  2GUI A;  5KRS A;  1NK7 A;  1SKR A;  4Q5V A;  4Z4E A;  4CHY A;  1I3A A;  3OYM A;  3HM9 A;  3DI6 A;  3KLG A;  4DFJ A;  3ZCM A;  4B3O A;  2YNG A;  4JS5 A;  3WNE A;  3QNN A;  4W5O A;  1C0U A;  4DS5 A;  4CHQ A;  2FBT A;  4DU3 A;  4DSI A;  5KGW A;  1VSK A;  3SI6 A;  5E41 A;  1T03 A;  3ZT4 A;  1JLQ A;  2OZM A;  1S1X A;  4PUO A;  4OGC A;  3ISN C;  3QIP A;  3JYT A;  2HHX A;  2VG7 A;  4AHT A;  2PZS A;  3IG1 A;  1WSI A;  1SKS A;  4KHN A;  4E1M A;  3HST B;  1NJY A;  4K8X A;  2WON A;  5HRS A;  1HRH A;  3QES A;  1JL2 A;  1WSH A;  1CLQ A;  2EX3 A;  4CJV A;  3KLF A;  2XY8 A;  1SL0 A;  1TL1 A;  4CGI A;  1S6Q A;  2B5J A;  3T1A A;  3E01 A;  2D0B A;  4J2A A;  3HPO A;  1HQE A;  1ITG A;  4E7H A;  3RMD A;  4ELV A;  4KO0 A;  3RWU A;  3VA0 A;  4HHT A;  3TAB A;  1VK0 A;  5FRN A;  1CXU A;  3L3V A;  3G0Z A;  3SQ0 A;  5FRM A;  3M8P A;  1TV6 A;  4CEE A;  4EP4 A;  3OYH A;  4ZTF A;  2OPR A;  4CFD A;  1IKV A;  1VSL A;  4B08 A;  1S5J A;  2BE2 A;  1T8E A;  4CGJ A;  4ZTJ A;  1A5X A;  3AVG A;  3MXM A;  1L3V A;  1JKH A;  3AVN A;  3P1G A;  5KTQ A;  4B9L A;  2X74 A;  4M3T A;  4RW7 A;  1XC9 A;  1IKY A;  2OA8 A;  4CJS A;  4JRQ A;  3A2F A;  1BI4 B;  5CYM A;  4FJM A;  4BDY A;  2YV0 X;  1S1U A;  1KVA A;  1RT5 A;  1TK8 A;  4FJN A;  4O44 A;  4CHO A;  1JLE A;  4HVJ A;  3OYI A;  1U4B A;  1YTU A;  1RT6 A;  3TWH A;  3UIQ A;  1JLB A;  2HB5 A;  3SUP A;  3SJJ A;  3M8Q A;  4Z4H A;  4WE1 A;  3JSM A;  1TK5 A;  4KHS A;  1UOC A;  3V1Q A;  4HTU A;  4E1N A;  3VQ7 A;  2ZD1 A;  3KIO A;  1QSS A;  3NF9 A;  1RDC A;  1HNV A;  3AVI A;  4MFB A;  3DLE A;  5C25 A;  1RT4 A;  3OS2 A;  3VQP A;  4KI6 A;  1HYZ A;  4PY5 A;  4QCL A;  3VQD A;  3NF8 A;  3OY9 A;  4C8K A;  3OS0 A;  1T7P A;  4G1Q A;  3EYZ A;  4W5T A;  3L8B A;  4C8M A;  4E3S A;  1J54 A;  2X78 A;  5SZT A;  1KFD A;  2HND A;  1LWF A;  3DMJ A;  4HUE A;  3IS9 A;  1TGO A;  4O5B A;  4N56 A;  3OYA A;  4DSJ A;  3NHG A;  4F4K A;  3TAF A;  4CIF A;  4KTW A;  4AHS A;  4M45 A;  4NCA A;  1B9F A;  5JS1 A;  3SV4 A;  1EXQ A;  2HHW A;  3C6U A;  1U45 A;  4MQ3 A;  3QET A;  1GOB A;  1LWE A;  1B92 A;  4OLB A;  2JLE A;  4CF9 A;  3OYN A;  1NK5 A;  2DY4 A;  3SPY A;  4W5R A;  3IAY A;  4DFK A;  3U6F A;  4IKF A;  4OKK A;  4DTM A;  4DTP A;  3ZT1 A;  4IG3 A;  4B9M A;  1K6Y A;  4FLV A;  3VQ9 A;  1C0T A;  4DLG A;  4F3T A;  1U49 A;  3RMC A;  4B9T A;  3SNN A;  3NDK A;  3MEC A;  1BHL A;  1JLF A;  4FJ8 A;  4I9L A;  1T05 A;  1Q8I A;  4F3O A;  3TAP A;  3I8D A;  1ASW A;  3CFR A;  1S6P A;  3L2R A;  1Q9Y A;  4H4O A;  4CHP A;  2G8F A;  2PYL A;  4B9V A;  4W5N A;  3NAE A;  1KSP A;  1B9D A;  1KLM A;  2Y1J A;  2E6L A;  4DTS A;  4B9N A;  1SUQ A;  3S3M A;  1WAJ A;  3KLH A;  1X9S A;  3K2P A;  2PYJ A;  1RNH A;  1NOZ A;  1S9G A;  3AO5 A;  3I0S A;  3P83 D;  3U3G A;  1JXE A;  3OS1 A;  3ALY A;  5HRN A;  4DFM A;  1W9H A;  4CJT A;  4M3W A;  3PY8 A;  4B9U A;  3KD1 E;  1F21 A;  2R7Y A;  1ZBU A;  5CYQ A;  3M8S A;  4FM1 A;  3ULD A;  4E7L A;  1IG9 A;  3VQB A;  1VSI A;  1QS4 A;  3FFI A;  1KRP A;  1JL1 A;  3OJU A;  1BCO A;  1XHZ A;  1VRU A;  3SZ2 A;  3T19 A;  1ASU A;  1BI4 A;  3HVT A;  3DRP A;  4IDK A;  3VQ5 A;  3ZSX A;  4B8A B;  3SQ2 A;  2KZM A;  1RBV A;  1IKX A;  4PA1 A;  4IFY A;  4CJW A;  3QEV A;  1TKX A;  1HYS A;  2F8S A;  2JGU A;  2G8V A;  1YT3 A;  4CEB A;  3OYD A;  1W0H A;  3LAM A;  4FXD A;  2W42 A;  4KHY A;  4FW2 A;  4O0J A;  2F96 A;  4HCB A;  2AJQ A;  1FK9 A;  3QIN A;  4DTR A;  2OZS A;  3TAM A;  1RT1 A;  4JLH A;  4BDZ A;  2D5R A;  4CFA A;  4M3Y A;  4DF8 A;  3HP9 A;  3MXJ A;  3TAQ A;  3TAN A;  1GOC A;  1HMV A;  3AA5 X;  4DLE A;  1HYV A;  4DU1 A;  3V81 A;  1NJW A;  4DQP A;  2LSN A;  4CJQ A;  3OYL A;  3PX0 A;  1WSE A;  4DTJ A;  1D5A A;  2B4J A;  4CIE A;  3K5L A;  4DSF A;  2XY5 A;  4M3X A;  5C42 A;  2QKB A;  1KLN A;  3RR7 A;  2ZQB A;  3S3N A;  3L2Q A;  4RG8 A;  4BE2 A;  3KK3 A;  4OKE A;  3OYB A;  2KFZ A;  4CF8 A;  4CK2 A;  3K58 A;  4N76 A;  1WLJ A;  2ITG A;  4CJR A;  1NK0 A;  1BIZ A;  5CZ2 A;  3S3O A;  5HLF A;  4J2B A;  4CJ5 A;  1D8Y A;  3ZSW A;  3QEX A;  4LY7 A;  3QER A;  1J53 A;  4CEZ A;  3SUQ A;  4FK2 A;  3QO9 A;  1O1W A;  1CXQ A;  1EP4 A;  4Y1C A;  2YKN A;  4CEC A;  2D0A A;  2QK9 A;  1TL3 A;  3NGY A;  4NCB A; 
#chains in the Genus database with same CATH topology
 3M8R A;  3KKS A;  4E89 A;  3VF6 A;  2O8D B;  2GX9 A;  1QHT A;  3TAG A;  4M7Y A;  2HHH K;  1XHX A;  5AQX A;  4FK0 A;  3C6A A;  2IS3 A;  3HPG A;  5M1F A;  3FE1 A;  3LPT A;  3K9J A;  4FOI A;  4GKJ K;  4ELU A;  2A6A A;  4PQU A;  5C2D A;  1IG8 A;  1WAF A;  5C2F A;  1EQY A;  3LDP A;  4BC2 A;  1X9M A;  4CGH A;  1TYQ A;  5BRH A;  5K14 A;  4XH5 A;  1FKO A;  2P9K A;  4JKE A;  3ENO A;  4FZY A;  4KHU A;  2E2O A;  2QM1 A;  4FO0 A;  4RW8 A;  2P9P B;  4AHC A;  2KFN A;  3K57 A;  4IEE A;  4IWV A;  3AO1 A;  3O4N A;  4BR7 A;  3DXM A;  3O9R A;  3KLI A;  4CGG A;  2IVN A;  3VTI A;  4FWL A;  4CJ3 A;  4LF7 K;  3V9W A;  4N47 A;  2YNH A;  4CIG A;  3HXM A;  3HRG A;  4FJK A;  3J7Z O;  2GTD A;  1QQM A;  1JLA A;  4LH5 A;  5AZI A;  2D4W A;  4PKG A;  1ASV A;  4A2B A;  4WFB L;  2BAN A;  4IO8 A;  4CZM A;  3FGU A;  3NH2 A;  2HHT A;  2QWM A;  4K42 A;  2PY5 A;  3TAE A;  4R79 A;  3OYE A;  4FYD A;  4EHT A;  1QQC A;  1KQS M;  3AA2 A;  1RBT A;  4RCH A;  5GAE P;  3HJF A;  5I42 A;  3OYF A;  1S1W A;  4CZK A;  1RTI A;  1HX1 A;  4CZJ A;  4J2E A;  3B6P A;  1NK8 A;  5JMV A;  2VWJ A;  4NLC A;  3RMB A;  1JJ2 M;  1WBB A;  4JYA K;  3HL8 A;  4JI5 K;  4OJR A;  4BE0 A;  1YI2 N;  3AA3 A;  4C23 A;  1TUY A;  3AVB A;  4BWM A;  1WSG A;  3PSI A;  3QDK A;  1N32 K;  3CXC M;  5AZI B;  3EKS A;  3VEW A;  4FK4 A;  1JXB A;  1IH7 A;  4K41 A;  4FJH A;  1ZBL A;  1HJR A;  4MO4 A;  4LD0 A;  3K5O A;  4Q0B A;  2H3G X;  3KLE A;  2FBV A;  4B8C A;  4QOZ B;  4C8N A;  3VET A;  1BQM A;  3R6M A;  1VSM A;  5IT9 O;  2XY6 A;  5H1S Q;  1XWL A;  4IFV A;  4FM2 A;  2OPP A;  4GMJ B;  3TAR A;  1Y97 A;  5HRP A;  4YNQ A;  4IO9 L;  3GE1 A;  4MLE A;  1NWK A;  3LWM A;  4E7J A;  4NCB A;  5EU7 A;  3PX6 A;  2P9L A;  3R9P A;  2FF3 B;  4GV6 A;  3OYJ A;  4BVO A;  5ELZ A;  3LZI A;  4C8L A;  1YF5 L;  2F4V K;  4GVM A;  4AM6 A;  4YY3 K;  1WUA A;  4J8F A;  1LWC A;  1EX4 A;  1GLJ O;  4CF2 A;  1BA0 A;  2E1Z A;  1QE1 A;  4GNI A;  2E1Y A;  2DTU A;  4B3M K;  2FC0 A;  1SZ2 A;  1WOQ A;  2P51 A;  3K0S A;  3E9P A;  1NGB A;  3VMF B;  3VQC A;  3AVK A;  4FM0 A;  3F9M A;  4DQR A;  1C1A A;  1XUP O;  4DUZ K;  4BQL A;  1A5V A;  4FLX A;  4CCH A;  3AGK A;  4FLU A;  1CZA N;  4KHP K;  1HKB A;  2YX6 A;  5KGX A;  1A5W A;  1DLO A;  4M63 C;  3HP6 A;  2ITM A;  4CF0 A;  3K5M A;  3PUF A;  3VOV A;  4O8U A;  3P5J A;  3MCA B;  2Z1J A;  5AFU H;  3O3F A;  4FWM A;  4H8K A;  5C15 A;  1QZ5 A;  4CW7 B;  5LY3 A;  4DR4 K;  2HNY A;  4AM7 A;  3KK1 A;  4JI3 K;  3LAN A;  2A3Z A;  4E19 A;  2Y1I A;  4EP5 A;  2IVO A;  4BRC A;  3CCR N;  1KC8 O;  4CEA A;  3IRX A;  3VQQ A;  1NMD A;  4BC5 A;  4FJL A;  1UAX A;  4JK8 A;  1S72 N;  4YOV A;  3A5L C;  5BPL A;  4U67 L;  1CZ9 A;  2QKK A;  5AQV A;  3LP3 A;  3QEP A;  1MU2 A;  3PO4 A;  1I94 K;  3MCP A;  4LSL A;  1QZ6 A;  5HBM A;  5EY4 A;  2UXB K;  3CCE N;  2CH6 A;  4MO5 A;  5GIO A;  5J2Q A;  4DUY K;  4KI4 A;  3I0R A;  3LP1 A;  4M3R A;  4AF1 A;  5GAG P;  2P5O A;  4LH4 A;  1L3T A;  4FJJ A;  1Q9X A;  1KAZ A;  1WN7 A;  2VGM A;  5KI6 A;  2GUI A;  1SKR A;  1NK7 A;  4Z4E A;  4RWT A;  3WNE A;  3QNN A;  4DS5 A;  2FBT A;  2HBK A;  1N33 K;  3SAF A;  3QFP A;  4YOX A;  1HLU A;  5F0X A;  3VEZ A;  2PZS A;  4AHT A;  1IV0 A;  3IG1 A;  1WSI A;  3E9L A;  4GKK K;  3HST B;  1NJY A;  1OVY A;  3P39 A;  4K8X A;  3CPE A;  1WSH A;  1CLQ A;  4CJV A;  3KLF A;  1SL0 A;  1S6Q A;  4BRK A;  2B5J A;  3E01 A;  4J2A A;  3ZX0 A;  3P38 A;  5FRN A;  1CXU A;  3L3V A;  3G0Z A;  5FRM A;  3M8P A;  3TPQ A;  5HOO A;  4YOT A;  4EP4 A;  3OYH A;  4CFD A;  1VSL A;  1S5J A;  3A5M C;  4CGJ A;  3O5B A;  1A5X A;  3O8M A;  4JKH A;  1JKH A;  3AVN A;  4M3T A;  3MWT A;  4RW7 A;  2OA8 A;  4CJS A;  1NGI A;  4JRQ A;  3WXJ A;  1K73 O;  2YJF A;  3H1V X;  1S1U A;  1RT5 A;  2W6L A;  4CHO A;  1U4B A;  3TWH A;  2UU9 K;  3JSM A;  3VQ7 A;  3KIO A;  1VAZ A;  4BRH A;  3DLE A;  3KWG A;  4KI6 A;  3WQU A;  1HYZ A;  2NLX A;  4B3S K;  2WUS A;  3OS0 A;  1XQS C;  4W5T A;  1YAG A;  4KBO A;  4C8M A;  1J54 A;  4HUE A;  4YOU A;  3IS9 A;  1TGO A;  2F7T A;  3OYA A;  4DSJ A;  3AAP A;  3NHG A;  4F4K A;  4NCA A;  1B9F A;  3LDO A;  2OTJ N;  1E4G T;  2P9I A;  2P9S A;  1Q81 O;  4OLB A;  2E88 A;  2JLE A;  2BUP A;  2UYT A;  4W5R A;  4CZH A;  5E84 A;  4OKK A;  4K0K K;  4IG3 A;  4H5T A;  3VQ9 A;  1C0T A;  4O5F A;  4DLG A;  4F3T A;  5AQT A;  3RMC A;  4B9T A;  4BGB A;  1GLB G;  2ZGY A;  1Q8I A;  3TAP A;  2E2N A;  1Q9Y A;  4FPA A;  4B1Y B;  3NAE A;  1KSP A;  2Y1J A;  4DTS A;  4B9N A;  1WAJ A;  3ULE A;  1JXE A;  5HRN A;  2OTL N;  1IBL K;  1W9H A;  2D0P A;  3PY8 A;  2V52 B;  2R7Y A;  1ZBU A;  3M8S A;  1KRP A;  3VQB A;  1VSI A;  1QS4 A;  4JAX A;  4BRL A;  2A5X A;  1VRU A;  1GLE G;  2HHX A;  3DRP A;  3VQ5 A;  1YJN N;  3CJB A;  4CJW A;  1HYS A;  3O1W A;  3OYD A;  4FXD A;  3RSE A;  2P9I B;  1BWF O;  4FW2 A;  4ISE A;  3ID8 A;  5HL7 L;  1BU6 O;  4DTR A;  2OZS A;  1RT1 A;  4IOC L;  2QWP A;  3VEN A;  4M3Y A;  3HP9 A;  3MXJ A;  4FL9 A;  4DV0 K;  2D0O A;  1NJW A;  4ILH A;  3OYL A;  4DTJ A;  3K5L A;  4JI1 K;  4BGA A;  2XY5 A;  5C42 A;  2YI1 A;  2NRH A;  2ZQB A;  3S3N A;  3MN9 A;  3KK3 A;  4OKE A;  4CK2 A;  5ADX H;  1WLJ A;  2ITG A;  1BIZ A;  4J2B A;  3ZSW A;  3QEX A;  3SUQ A;  4JN4 A;  5FPM A;  1O1W A;  1EP4 A;  3IUC A;  4IOA L;  1TL3 A;  1SL2 A;  1BDG A;  4OKJ A;  3KK2 A;  1NG9 A;  2ZWH A;  2UUC K;  2F8T A;  3H08 A;  3S9H A;  4BRI A;  2QXF A;  1NK4 A;  1HPM A;  3ZSO A;  4BR0 A;  3WXI A;  4CE9 A;  3V9X A;  4JEP A;  1RIL A;  3Q7B A;  3WNF A;  3ZSY A;  3HOS A;  3CCL N;  4DR6 K;  2F9W A;  4ZHR A;  4FLY A;  4JI6 K;  5JVH L;  4CEQ A;  3ASM A;  3DWL A;  3DLH A;  1YJW N;  4O0I A;  3LAK A;  5I3U A;  3F5T A;  1T6C A;  2HVH A;  3VQE A;  5J1E A;  1ZBH A;  2HHU A;  3BEX A;  5T7B A;  4DTO A;  4JKC A;  2YNF A;  2VG6 A;  4FJ5 A;  4JKG A;  1QSY A;  3O9Q A;  1SL1 A;  4F2R A;  4FJI A;  4C8O A;  1G15 A;  1GLF O;  1C1B A;  3D45 A;  3OYG A;  3V1R A;  3O9T A;  5LMN K;  4YFU A;  3KJV A;  3UKR A;  1N36 K;  1ATS A;  2Q3S A;  4IJN A;  2PBD A;  5FPE A;  3SQ1 A;  4EZ9 A;  1W2B M;  1O13 A;  4OX9 K;  1K8K A;  4LFC K;  1HKC A;  4KV8 A;  2KZZ A;  3I33 A;  4BRN A;  2ASP A;  1WNS A;  4W5Q A;  2QWR A;  5AQO A;  1QVF M;  5J2M A;  3TU5 A;  5D3G A;  3WXL A;  2XRI A;  3AV9 A;  4B1U B;  4X64 K;  2DFE A;  1EWR A;  4DKW A;  1SS6 A;  2ZGZ A;  4ID5 A;  2RN2 A;  3DM2 A;  4H03 B;  3OYC A;  4HUF A;  3CQ8 A;  1M90 O;  5J2P A;  1DTQ A;  4H5N A;  4JKG B;  4N5S A;  3CC4 N;  1BIS A;  4TSX A;  4DV3 K;  4CEF A;  1MWM A;  3CCJ N;  2O4I A;  2HW3 A;  4CHZ A;  2ASM A;  3MN7 A;  4OPK A;  1RDW X;  2ZE2 A;  4F8R A;  4MDA A;  1FJG K;  1E4F T;  3M6G A;  4O4G A;  3M1F A;  2X6N A;  3UKR B;  2G8W A;  1X9W A;  2DFH A;  4DMN A;  2OAN A;  1TAU A;  4ILJ A;  1JCE A;  4DSL A;  3MED A;  1K8K B;  1IKW A;  2AA4 A;  2HHQ A;  4AHR A;  4BG9 A;  2E8A A;  4BR9 A;  4KPY A;  4DV6 K;  3C65 A;  5GIN A;  1LAV A;  3SQ4 A;  1KVC A;  4CF1 A;  2HBL A;  2J4R A;  3T3F A;  4KRF A;  4DTN A;  3SJH A;  1JLC A;  3DLG A;  1DTT A;  3DOK A;  3DLL L;  4NYF A;  3ZSV A;  4FJ7 A;  3VQ4 A;  3L4Q A;  4NLB A;  3WNG A;  4A57 A;  4FLZ A;  4LF6 K;  5CZ1 A;  5M1Q A;  1Q7Y O;  5LL6 Z;  4CGD A;  4Z4G A;  2I7N A;  1NGH A;  3NCI A;  3NF6 A;  4CJL A;  1KVB A;  3NBP A;  3QLH A;  3BY5 A;  2CH5 A;  2XHB A;  1ZYQ A;  2F9T A;  3FFK B;  1VRT A;  3HSC A;  1RTH A;  3HYF A;  2A1R A;  4FPB A;  3CME N;  4V19 S;  3AAR A;  2KW4 A;  1T44 A;  2GWK A;  2Q0U A;  1ZC6 A;  3NGI A;  1NK9 A;  4FJX A;  3BGR A;  3OA9 A;  4FCY A;  4BRP A;  4DS4 A;  3F73 A;  1YIJ N;  2VGN A;  4A61 A;  2ZJP L;  4BE1 A;  1FW6 A;  4PL7 A;  1KTQ A;  3J7A P;  1N8R O;  4PHT X;  3PV8 A;  1KAY A;  3PX4 A;  3THY B;  2FSK A;  1VQ8 N;  4DWI A;  1HPZ A;  5M1P A;  3P31 A;  1TK0 A;  1ZBF A;  5BR8 K;  1JLG A;  1VQ6 N;  3MWP A;  2KQ2 A;  4AHV A;  2ETJ A;  1S22 A;  4HVJ A;  3SBT A;  1NNE A;  1Z26 A;  2B6A A;  2OPS A;  3CC2 N;  4FZZ A;  4BR2 A;  1YHQ N;  1VQ5 N;  2ZJQ L;  2E2P A;  5AQY A;  4A59 A;  4QS9 A;  3F2K A;  3I8B A;  4BR4 A;  2CGK A;  4I2Q A;  2EWS A;  5JS2 A;  1XMQ K;  3SUO A;  3SK3 A;  1SQK A;  2WTU A;  2X6S A;  3OBW A;  3D2F A;  2Q0R A;  5J2N A;  4O8K A;  4B1W B;  4H0O A;  3CI5 A;  4JS4 A;  3TR8 A;  3NH0 A;  3AY9 A;  1BCM A;  3K5N A;  3OYM A;  3DI6 A;  3KLG A;  5JIC A;  2NRV A;  1C0U A;  3VF2 A;  4DSI A;  2E20 A;  2FSJ A;  4A62 A;  2NRT A;  1NGJ A;  1M1K O;  4LFB K;  1DKG D;  2A40 A;  2OZM A;  1RFQ A;  1S1X A;  3ISN C;  2VG7 A;  4XEI A;  3WQT A;  3NVM A;  2JWK A;  1BUP A;  3EE8 A;  2CGJ A;  2WON A;  3J8A A;  3MN6 A;  3ATV A;  5DM7 L;  1C0G A;  4CGI A;  3CQY A;  1NGG A;  3T1A A;  5AR0 A;  5AQN A;  2W6K A;  4E7H A;  2D1K A;  4IZ9 A;  3ATU A;  1VK0 A;  2Q31 A;  3SQ0 A;  3D2F B;  4CEE A;  4FWR A;  1T8E A;  4LFA K;  5AQW A;  3AVG A;  3MXM A;  1JCF A;  3C0B A;  1XC9 A;  4JV5 K;  3BF3 A;  1HNX K;  5LJV A;  1BI4 B;  2YV0 X;  1KVA A;  4G9Z A;  5TKW A;  1JCG A;  1YTU A;  1RT6 A;  3M8Q A;  4Z4H A;  3D7E O;  1TK5 A;  4KHS A;  1UOC A;  1X3M A;  4E1N A;  3CHW A;  3NF9 A;  4B3R K;  3OS2 A;  4PY5 A;  4QCL A;  3VQD A;  1VHX A;  2YHX A;  3L0Q A;  3NF8 A;  3OY9 A;  4GV9 A;  4YOR A;  1BO5 O;  3WEE B;  4C1N I;  4JI8 K;  1YXQ A;  4A5B A;  1LWF A;  1G99 A;  3VGK A;  4N56 A;  2V51 B;  4H5W A;  4KTW A;  1EXQ A;  2HHW A;  1NMN A;  3THW A;  5CHI A;  1HJO A;  3UKU B;  3JXU A;  5KPT A;  3QIC A;  3HM8 A;  3SPY A;  2HBM A;  2GWJ A;  3U6F A;  4IKF A;  3ZT1 A;  4B9M A;  3BF1 A;  4FLV A;  3T1Y K;  3SNN A;  4DV7 K;  1RDU A;  4I9L A;  1ESV A;  1T05 A;  1SAZ A;  1U6Z A;  3L2R A;  3O9U A;  4B9V A;  4W5N A;  2Q36 A;  2O8C A;  1KLM A;  3T1H K;  3KLH A;  1X9S A;  3KHY A;  3MMV A;  2WBN A;  4DHY A;  1YVN A;  1S9G A;  3U3G A;  2FF6 A;  4JK9 A;  4I6M B;  3ALY A;  1Y64 A;  4M3W A;  5BR9 A;  3J80 O;  3ULD A;  3KWI A;  4E7L A;  1IG9 A;  1V4T A;  3FFI A;  4A2A A;  1JL1 A;  2FLO A;  1BCO A;  3OJU A;  1XHZ A;  3T19 A;  1ASU A;  3HVT A;  3ZSX A;  4B8A B;  4DV2 K;  3SQ2 A;  1KD1 O;  4PA1 A;  1MDU B;  5EVZ A;  2F8S A;  4WF9 L;  1W0H A;  3THW B;  1X3N A;  3HBT A;  2RE2 A;  2F96 A;  1NLV A;  4BVP A;  2AJQ A;  4NXM K;  1XC3 A;  3TAM A;  4CFA A;  4B3T K;  1GOC A;  3AA5 X;  3ZX3 A;  1D4X A;  4CIE A;  3CC7 N;  3SLC A;  3L2Q A;  4RG8 A;  2O8C B;  3K58 A;  4LF8 K;  1NK0 A;  3DJC A;  1NGC A;  5HLF A;  4LY7 A;  3QER A;  4FK2 A;  4CEZ A;  2W40 A;  3VTH A;  4CD1 A;  3QO9 A;  4DR2 K;  2YKN A;  1ITG A;  4DU4 A;  3AA4 A;  4L3Q A;  4JKA A;  3ZSR A;  2RF2 A;  3BDP A;  1OH5 A;  2P1J A;  2BTF A;  2XY7 A;  5EX5 A;  4HUG A;  1TAQ A;  1VSD A;  2XO7 A;  1P8Z A;  4M41 A;  4KB0 A;  4HTL A;  4M42 A;  4ICL A;  1RTJ A;  1RDA A;  4CBU A;  1EET A;  3AO2 A;  1RBR A;  5MLC Q;  3O3G A;  1RT7 A;  3ZT2 A;  1C0F A;  1MA9 B;  5BPN A;  3L2V A;  3F9K A;  3I56 N;  4FVM A;  3IFR A;  3LAL A;  4BR5 A;  3L2U A;  1TKT A;  2RPI A;  2BDP A;  2A41 A;  4DG1 A;  5C0Y A;  5IWA K;  1RTD A;  4H0Y B;  1V4S A;  2VYP A;  1BOT O;  4CD3 A;  4R5P A;  1P90 A;  4BRG A;  3O08 A;  3U8X A;  3QNO A;  3C6H A;  3V6D A;  1L3S A;  3W3D A;  1C6V A;  3RVC A;  3FR0 A;  5F2R A;  3LDS A;  4GV3 A;  3ZET B;  1ZXO A;  4OLA A;  4FWP A;  4QS7 A;  1CZB A;  4B1V A;  2QTD A;  1FKP A;  4B9Q A;  3SYZ A;  3T69 A;  3V4I A;  4HCC A;  2GEM A;  4GW6 A;  4M3U A;  5A2Q O;  4DV5 K;  4IDH A;  2PAV A;  3GOI A;  5AQP A;  3H3N O;  5KRT A;  4IJA A;  2IC3 A;  4NXN K;  4DQQ A;  3RMA A;  3RRH A;  1UWB A;  5SWM A;  1KCF A;  4CBW A;  4CED A;  3LL3 A;  5AQU A;  4NCG A;  2ZF5 O;  1U47 A;  1D9D A;  3M5R A;  2ZM6 K;  3EZ5 A;  3EE9 A;  2A1S A;  3G25 A;  3QEI A;  2DFF A;  4CZI A;  3CJ9 A;  4DSE A;  4DCH A;  3AGR A;  4E0D A;  4DV4 K;  4I7F A;  3KVG A;  4BDP A;  5AFU A;  3CJ7 A;  3MDQ A;  2EHG A;  5C10 A;  2NRR A;  1HNW K;  3RRG A;  4DTX A;  4BRE A;  3ZSQ A;  3TSP A;  4UQG A;  4CFB A;  4XIU A;  3GBT A;  3VF4 A;  1VQO N;  4E7I A;  2P5G A;  2IOC A;  1Z05 A;  3ITH A;  4IBN A;  1N6Q A;  3JS6 A;  1VQK N;  1RBS A;  4WFN L;  4CFC A;  4FW1 A;  4FJG A;  5BN8 A;  2HNZ A;  3NGZ A;  2GV9 A;  4Z4C A;  4DTU A;  1VSH A;  2ASO A;  2FSN A;  4I2P A;  2QWN A;  3MAQ A;  3CYM A;  3U9Z A;  2GEL A;  3DRS A;  1S3X A;  4X65 K;  1U04 A;  2WOM A;  1BGX T;  3MEE A;  5KPR A;  4J2D A;  3CMA N;  4E1J A;  3THX A;  3ZEU A;  3TI0 A;  1XNQ K;  4JHD A;  1K8A O;  3OJS A;  4AIL C;  1QSL A;  3VQ8 A;  2QXL A;  3K59 A;  3OVN A;  1YVU A;  3AVC A;  3SAG A;  3UIQ A;  4CJF A;  5AQH A;  1GLC G;  1D9F A;  2HVI A;  4IFE A;  4BAC A;  1NK6 A;  1E3M A;  5AZJ A;  4U7B A;  2O8F B;  4JRP A;  3DYA A;  3VER A;  4LF5 K;  1KAX A;  2KLA A;  5HP1 A;  3G6E N;  3LWL A;  1Q18 A;  3CFP A;  3BZK A;  2QI2 A;  3OYK A;  3C95 A;  3LP0 A;  1TKZ A;  1HUX A;  2W41 A;  3HI0 A;  2G8I A;  3QEW A;  1Q86 O;  2NUB A;  4LC9 B;  1KFS A;  3V9U A;  4KH6 A;  2FBX A;  4LSN A;  3KK7 A;  3HOT A;  4DR3 K;  4Y1D A;  3CIP A;  4DQS A;  1VQ9 N;  4CEO A;  1LW2 A;  1RGI A;  3THX B;  3ZEU B;  1S1T A;  3DOL A;  3O4Q A;  4K8Z A;  4M3Z A;  4JHD B;  3LM9 A;  5BN9 A;  4FJ9 A;  1HQU A;  5C24 A;  1GOA A;  1HR0 K;  1LAW A;  4FWK A;  5HRO A;  1Q82 O;  3GL1 A;  1VSJ A;  2IVP A;  4KHW A;  4L8R B;  4ISG A;  4DQ8 A;  3OTO K;  3AVM A;  5AQG A;  3CM5 A;  1HNI A;  5CR4 A;  3TSQ A;  5AZJ B;  4CJP A;  3KTQ A;  1NOY A;  1RDD A;  1NU0 A;  2QWO A;  4FLT A;  3MN5 A;  3WNH A;  4BWJ A;  3I55 N;  4FZX C;  4N41 A;  3UB5 A;  4FWO A;  4FWQ A;  2UXC K;  5AQK A;  3DLR A;  3VQA A;  3JAM O;  3NE6 A;  2E4L A;  5KRS A;  1C1C A;  4K43 A;  4CZL A;  4JS5 A;  4IEI A;  3R3L A;  4CHQ A;  4DU3 A;  2I7P A;  2UXD K;  4OPH A;  1VSK A;  1OKJ A;  3SI6 A;  3PLA A;  5E41 A;  3ZYY X;  3O80 A;  1T03 A;  3H3O B;  2JWL A;  3Q7C A;  4XH1 A;  3AAQ A;  4OGC A;  4GY2 B;  5AQQ A;  3SMS A;  4KHN A;  1QHA A;  3QFU A;  5M1N A;  2OCE A;  4HWI A;  5HRS A;  1HRH A;  2EX3 A;  2XY8 A;  4CVN E;  1TL1 A;  3LDN A;  1VQL N;  3R8E A;  3THY A;  3HPO A;  1HQE A;  4EFH A;  4Z94 A;  3RMD A;  4KO0 A;  3RWU A;  5AQS A;  4ZTF A;  2OPR A;  1YUW A;  3UE5 A;  4ZTJ A;  1L3V A;  3FZH A;  3P1G A;  5KTQ A;  2X74 A;  1VQ4 N;  5I9E B;  1IKY A;  2QEX N;  3A2F A;  5CYM A;  2YHW A;  3G71 N;  4BDY A;  3HTV A;  3R1X A;  3J7Y P;  3OYI A;  2PFU A;  1JLB A;  2HB5 A;  4WE1 A;  2QWL A;  4FWS A;  3V1Q A;  1QSS A;  3VGL A;  1BG3 A;  1RDC A;  1HNV A;  3AVI A;  3CCV N;  4MFB A;  1HKG A;  3VQP A;  5ADX A;  4C8K A;  1T7P A;  4G1Q A;  2WFB A;  3EYZ A;  1T6D A;  3L8B A;  4E3S A;  2X78 A;  4IXC A;  3ZLJ A;  3CQX A;  4EIA A;  2HND A;  3DMJ A;  4O5B A;  3CET A;  5F1X A;  4PKI A;  3KZB A;  3TAF A;  2AP1 A;  5BRE A;  4YDU C;  3SV4 A;  3IDH A;  3CF5 L;  1U45 A;  5AQM A;  4MQ3 A;  3QET A;  1GOB A;  3FZL A;  2P9N B;  4H5V A;  4CF9 A;  3OYN A;  1NK5 A;  2DY4 A;  3IAY A;  4DFK A;  1TUU A;  4DTP A;  2HMP A;  1K6Y A;  4WYB A;  4JI2 K;  3MEC A;  1BHL A;  3CCU N;  4FJ8 A;  3U4L A;  1VQP N;  4F3O A;  1ASW A;  1T3V A;  1WB9 A;  4H4O A;  4CHP A;  2PYL A;  1B9D A;  2E6L A;  3S3M A;  1VQN N;  4JKD A;  4WQ4 C;  1NOZ A;  3AO5 A;  3P83 D;  1YJ9 N;  1IJJ A;  2NRX A;  4CJT A;  1QVG M;  1TYQ B;  1BA1 A;  3EN9 A;  1F21 A;  2P9K B;  1MWK A;  4FM1 A;  5TKY A;  4OPA A;  2NNW A;  2CGL A;  3SZ2 A;  1BI4 A;  2BH1 A;  2YJE A;  3TTF A;  3NVK A;  1RBV A;  4IFY A;  3QEV A;  2JGU A;  5AQL A;  1YT3 A;  2G8V A;  5E26 A;  4X66 K;  1IBK K;  4HCB A;  3DXM B;  3QIN A;  2DPN A;  4JK7 A;  2D5R A;  4BRA A;  1NM1 A;  4DF8 A;  2HST A;  3WEE A;  1NGA A;  1HMV A;  3V81 A;  1HYV A;  3OHR A;  4WQ5 C;  2LSN A;  4CJQ A;  3PX0 A;  3CCM N;  1W97 L;  1WSE A;  5CE3 A;  4JD2 A;  4M3X A;  1KLN A;  3SBG A;  4BE2 A;  4LF9 K;  2KFZ A;  3L6Q A;  4CF8 A;  4CJR A;  3UKU A;  3S3O A;  1D8Y A;  1LCU A;  4BRD A;  3QBX A;  3EEQ A;  1CXQ A;  3MK6 A;  4Y1C A;  4CEC A;  2QK9 A;  5AQZ A;  4WCE L;  1SV5 A;  3B8A X;  3MX2 A;  1Z6R A;  5BRF A;  4H5R A;  3MX5 A;  4AH9 A;  3CJC A;  4IG0 A;  2YHB A;  4RTF D;  4OGE A;  3U3Y A;  3CPW M;  2O8E A;  1EKE A;  3AVF A;  3AVA A;  3VA3 A;  3SUN A;  2UUB K;  4YHH K;  3N4Q A;  4DQI A;  3LP2 A;  2VWK A;  3MEG A;  3OBY A;  4KB1 A;  4YDU A;  1GLD G;  4I6M A;  3NF7 A;  2KTQ A;  4KTQ A;  5FRO A;  3THV A;  1TKD A;  3LZJ A;  4KTZ A;  5FLX O;  3D2E A;  4AQY K;  3VES A;  4EAH D;  4YOY A;  1KXP A;  4FSV A;  1RT3 A;  1RDB A;  3BUZ B;  3LPU A;  4JD2 B;  3NFA A;  1R59 O;  3RTV A;  1LOT B;  4KH4 A;  4Y0W A;  3ENH A;  1QQO A;  2Z1H A;  5AQF A;  4CI6 A;  3CJA A;  4O55 A;  3V9S A;  4KHQ A;  1IO2 A;  3AO3 A;  3S41 A;  3O3H A;  4DB3 A;  3SV3 A;  2G8K A;  4JI4 K;  4K25 A;  4PKH A;  2E6M A;  1J6Z A;  2HF4 A;  3D0P A;  2VG5 A;  2UUA K;  1FXX A;  4WQ4 A;  2GUP A;  2O4G A;  4ID1 A;  3L3U A;  4MLH A;  3HPH A;  5AQJ A;  3PO5 A;  2HHS A;  1NGE A;  4H0T B;  5HRR A;  2O8E B;  2P9L B;  1J9A A;  4RW9 A;  3E66 A;  1YIT N;  2E2Q A;  3O1B A;  2BGG A;  2WC9 A;  1L5U A;  2IIR A;  3WT0 A;  3FZK A;  5JVG L;  4DR1 K;  1R0A A;  3KD5 E;  2QW9 A;  2I5J A;  3SCX A;  4FVU A;  3D2E B;  5DMR A;  4I9Q A;  4BRF A;  3IKM A;  3AVH A;  4FLW A;  3CJ1 A;  3B6O A;  4CJU A;  2YHY A;  1RCH A;  2YKM A;  1X1P A;  3DXK A;  3K9K A;  3SMP A;  5JLH A;  1VQM N;  4WQ5 A;  3CER A;  4Z4F A;  4LF4 K;  1I39 A;  4KRE A;  4ILG B;  1U2V A;  4CBX A;  3AVJ A;  2RHK A;  4OVL A;  1WSF A;  3SPZ A;  3VN5 A;  1DEJ A;  4PWD A;  5EOY A;  4CES A;  4DSK A;  1NJX A;  2OPQ A;  4EZ6 A;  4CK1 A;  3G10 A;  4BQZ A;  4CJ4 A;  3FLC O;  2E5L K;  1C0M A;  4CZE A;  4NB4 A;  1SKW A;  2O8B A;  3HO1 A;  4B9S A;  3E1Y A;  5B8H A;  3QB0 A;  1NGD A;  1VSF A;  4Z4I A;  4CZF A;  2OYQ A;  4DFP A;  3CG7 A;  5C12 A;  4CJK A;  1QTM A;  4QS8 A;  2Q2R A;  4YOW A;  4H0V B;  4MDB A;  4KFB A;  3C6T A;  2GBZ A;  4IOX A;  4CJE A;  4F9O A;  3IMX A;  3ZT3 A;  3KKR A;  3WXK A;  2P9U A;  2NRZ A;  1UA0 A;  2G8H A;  4Z0U A;  2IDO A;  4BY9 C;  5KQD A;  3QIO A;  5DM6 L;  2IAJ A;  3ZET A;  3QML A;  3AVL A;  3DXK B;  5GIP A;  4KKO A;  2RKI A;  2NRW A;  1N5Y A;  3J81 O;  4M7X A;  1Z25 A;  2V7Z A;  1NJZ A;  1U2V B;  4RW4 A;  1WSJ A;  3P4I A;  3BP8 A;  4BC3 A;  1BIU A;  4JI7 K;  2HHV A;  1X9J A;  3EZW A;  2D0C A;  3CM6 A;  2KKZ A;  1S9E A;  1YTA A;  5FPD A;  2IGI A;  4WFA L;  3HK2 A;  1LV5 A;  3VGM A;  3RR8 A;  1DT9 A;  3V1O A;  1XI1 A;  4JKB A;  1U48 A;  1NKC A;  1REV A;  2VQE K;  2FBY A;  2O8B B;  3ZSZ A;  1S1V A;  2HMI A;  4AHU A;  1L3U A;  1RT2 A;  2VWB A;  5GAH P;  2G8U A;  4CK3 A;  3GG4 A;  4H0X B;  3L2W A;  4RW6 A;  2HF3 A;  1NKE A;  1RBU A;  3VEV A;  1BQN A;  3T7Z A;  3DLB A;  2P9U B;  3VEO A;  5AJ3 K;  1VQ7 N;  4CHN A;  2ZJR L;  1NKB A;  2Z1G A;  1ZBI A;  3H6E A;  3ENB A;  3LM2 A;  1BL3 A;  1TVR A;  3CFO A;  5CY4 A;  3HZ6 A;  3TTD A;  3ID6 A;  3EY1 A;  4F2S A;  1IBM K;  4H4M A;  5FDL A;  3NH1 A;  3C94 A;  1H1V A;  4CGF A;  4E7K A;  1VSE A;  3DRR A;  1GLL O;  1OH8 A;  3HT3 A;  3VQ6 A;  3DLK A;  2YHA A;  3DAW A;  4A5A A;  2YNI A;  4BRO A;  5BPM A;  4BRM A;  1J5O A;  4OPJ A;  4QAG A;  4JKF A;  3EKU A;  4CER A;  3ZT0 A;  3AO4 A;  1LW0 A;  3TSU A;  1NJI O;  1XNR K;  4DF4 A;  4JI0 K;  4ELT A;  2ATQ A;  5DK5 A;  2VQF K;  3GDQ A;  3MXI A;  3HVR A;  3A8Y A;  1OVQ A;  3V9Z A;  4KAZ A;  1UA1 A;  1J5E K;  4NYN A;  2Z1I A;  4FWN A;  4Q5V A;  1NGF A;  4CHY A;  1I3A A;  3HM9 A;  2A42 A;  4DFJ A;  3ZCM A;  4B3O A;  2YNG A;  2P9S B;  2HBJ A;  4W5O A;  3VPZ A;  4DR5 K;  5KGW A;  3LDQ A;  2O8F A;  4BRQ A;  3H45 C;  1JLQ A;  3ZT4 A;  5EXW A;  4PUO A;  3C7N A;  3QIP A;  5LJW A;  3JYT A;  1WBD A;  3E9O A;  3CCQ N;  1SKS A;  3D6R A;  4PL8 A;  4E1M A;  3O9S A;  3O6W A;  1ILY A;  1NBW A;  3QES A;  1JL2 A;  3NMU A;  3CD6 N;  4H0P A;  2NZT A;  2D0B A;  2QA4 N;  3ULE B;  2QWQ A;  2VCP A;  4ELV A;  5M1O A;  1W7A A;  3VA0 A;  4HHT A;  3TAB A;  1TV6 A;  1IKV A;  4B1Z A;  4B08 A;  2BE2 A;  3TTC A;  3O4W A;  3H1Q A;  4B9L A;  4JNE A;  3CCS N;  4UY8 O;  3LDL A;  3PSF A;  4FJM A;  4DR7 K;  4FOE A;  1TK8 A;  3M3Z A;  4O44 A;  4FJN A;  1JLE A;  4CJ7 A;  3G4S N;  5M1K A;  4DV1 K;  2Q1N A;  3SUP A;  3SJJ A;  3RSE B;  3PIP L;  4BG8 A;  4HTU A;  2ZD1 A;  1DGK N;  1EWQ A;  5C25 A;  1RT4 A;  5LMU K;  1OH6 A;  3A5N C;  4EHU A;  3VEY A;  4BC4 A;  1QQN A;  2YCH A;  3C7N B;  1K9M O;  1HNZ K;  5SZT A;  2V7Y A;  1KFD A;  1N34 K;  3A5O C;  4X62 K;  4CIF A;  4AHS A;  4M45 A;  4C1N K;  5JS1 A;  4CZG A;  3C6U A;  1LWE A;  1B92 A;  2FXU A;  4XH4 A;  4DTM A;  3H46 O;  1U49 A;  3NDK A;  3SAH A;  4OO1 J;  1JLF A;  5JLF A;  3I8D A;  3CFR A;  1S6P A;  2G8F A;  3A0I X;  1SUQ A;  1EO1 A;  3K2P A;  3PIO L;  3L4I A;  2PYJ A;  1RNH A;  3WUH A;  5GAD P;  3W0L A;  3I0S A;  4KH5 A;  3OS1 A;  4DFM A;  4GVE A;  5FPN A;  3N4P A;  4B9U A;  3KD1 E;  2O8D A;  5CYQ A;  5AQI A;  3EL2 A;  1GLA G;  4IDK A;  3FZM A;  2KZM A;  1ATR A;  3OW2 M;  1IKX A;  3WXM B;  1TKX A;  4CEB A;  3LAM A;  2W42 A;  5KQ8 A;  1XMO K;  4KHY A;  4O0J A;  3FZF A;  1FK9 A;  1ATN A;  4JLH A;  4BDZ A;  3ZX2 A;  3TAQ A;  5AQR A;  5BRD A;  4DU1 A;  3TAN A;  4DQP A;  4DLE A;  2KHO A;  4B1X B;  4ISF A;  3BZC A;  3EO3 A;  1D5A A;  2B4J A;  4DSF A;  2QKB A;  3RR7 A;  2Q97 A;  3U9D A;  1ZBS A;  2P9P A;  3OYB A;  2HOE A;  3QBW A;  4N76 A;  5CZ2 A;  4CJ5 A;  2P9N A;  4NO7 A;  1J53 A;  3VEX A;  1OH7 A;  5KPZ A;  2D0A A;  3NGY A; 
#chains in the Genus database with same CATH homology
 3M8R A;  1SL2 A;  1SV5 A;  3KKS A;  4E89 A;  4OKJ A;  3KK2 A;  1QHT A;  4AH9 A;  4IG0 A;  3AA4 A;  3TAG A;  2YHB A;  2F8T A;  4OGE A;  3ZSR A;  3H08 A;  3U3Y A;  1XHX A;  2RF2 A;  3S9H A;  3BDP A;  4FK0 A;  2P1J A;  2IS3 A;  3HPG A;  4HUG A;  2XY7 A;  3LPT A;  2QXF A;  1NK4 A;  1EKE A;  3AVF A;  3AVA A;  1TAQ A;  1VSD A;  3VA3 A;  2XO7 A;  4ELU A;  4M41 A;  3SUN A;  3ZSO A;  4KB0 A;  4M42 A;  4ICL A;  1RTJ A;  4PQU A;  1RDA A;  1WAF A;  3LP2 A;  4DQI A;  2VWK A;  1EET A;  3MEG A;  4CE9 A;  3AO2 A;  1RBR A;  3V9X A;  4KB1 A;  3O3G A;  1RIL A;  1RT7 A;  3NF7 A;  3WNF A;  3ZT2 A;  4KTQ A;  5FRO A;  2KTQ A;  1X9M A;  3ZSY A;  4CGH A;  4ZHR A;  3THV A;  1TKD A;  3L2V A;  3LZJ A;  5K14 A;  4FLY A;  4KTZ A;  3F9K A;  4FVM A;  1FKO A;  4FZY A;  3LAL A;  4CEQ A;  3ASM A;  3L2U A;  4KHU A;  1TKT A;  2RPI A;  1RT3 A;  1RDB A;  3LPU A;  3DLH A;  3NFA A;  2BDP A;  4O0I A;  3LAK A;  4RW8 A;  3RTV A;  4AHC A;  5I3U A;  4DG1 A;  2KFN A;  1RTD A;  3K57 A;  2Z1H A;  2HVH A;  3VQE A;  4O55 A;  3V9S A;  5J1E A;  1ZBH A;  2HHU A;  3AO1 A;  4KHQ A;  1IO2 A;  3O4N A;  3AO3 A;  5T7B A;  3O3H A;  4DTO A;  4R5P A;  2YNF A;  3KLI A;  3SV3 A;  2VG6 A;  2G8K A;  4FJ5 A;  4CGG A;  2E6M A;  3QNO A;  4CJ3 A;  3D0P A;  3V6D A;  2VG5 A;  1FXX A;  3V9W A;  4N47 A;  1QSY A;  1L3S A;  2O4G A;  2YNH A;  4ID1 A;  4CIG A;  1C6V A;  3HXM A;  1SL1 A;  4F2R A;  4FJI A;  3L3U A;  4FJK A;  4C8O A;  3HPH A;  3LDS A;  3PO5 A;  1JLA A;  1G15 A;  2HHS A;  1C1B A;  4LH5 A;  3D45 A;  4OLA A;  3OYG A;  3V1R A;  5HRR A;  1CZB A;  3SYZ A;  1FKP A;  4YFU A;  3KJV A;  1ASV A;  1J9A A;  4RW9 A;  3V4I A;  2Q3S A;  4HCC A;  2BAN A;  4GW6 A;  3NH2 A;  2HHT A;  3SQ1 A;  4EZ9 A;  4M3U A;  2PY5 A;  3TAE A;  2BGG A;  3OYE A;  1L5U A;  4FYD A;  1R0A A;  3KD5 E;  1QQC A;  2I5J A;  4KV8 A;  3SCX A;  3AA2 A;  2KZZ A;  1RBT A;  5KRT A;  5DMR A;  2IC3 A;  4DQQ A;  3RMA A;  3HJF A;  5I42 A;  3OYF A;  4I9Q A;  1S1W A;  3RRH A;  1WNS A;  4W5Q A;  1Q9X A;  1RTI A;  1UWB A;  3AVH A;  4FLW A;  4J2E A;  4CJU A;  3B6P A;  3B6O A;  5J2M A;  5SWM A;  1KCF A;  4FJH A;  1NK8 A;  1RCH A;  2XRI A;  5D3G A;  4CED A;  3AV9 A;  2YKM A;  2VWJ A;  1X1P A;  2DFE A;  4NCG A;  1U47 A;  1D9D A;  4Z4F A;  3EZ5 A;  3RMB A;  4ID5 A;  1I39 A;  2A1S A;  3QEI A;  2RN2 A;  4KRE A;  2DFF A;  3DM2 A;  3OYC A;  4DSE A;  4HUF A;  3HL8 A;  3CQ8 A;  4OJR A;  5J2P A;  3AVJ A;  1DTQ A;  4FJG A;  4E0D A;  4I7F A;  1WSF A;  4OVL A;  4N5S A;  3AA3 A;  4BE0 A;  3VN5 A;  3SPZ A;  3RR8 A;  1BIS A;  4TSX A;  4PWD A;  4BDP A;  3AVB A;  4CES A;  2EHG A;  4DSK A;  1NJX A;  2OPQ A;  4CEF A;  4EZ6 A;  4CK1 A;  3G10 A;  2O4I A;  4BWM A;  2HW3 A;  1WSG A;  4CHZ A;  4CJ4 A;  4OPK A;  2ZE2 A;  3RRG A;  1C0M A;  4DTX A;  4F8R A;  3ZSQ A;  4UQG A;  4O4G A;  1SKW A;  4FK4 A;  3HO1 A;  1JXB A;  1IH7 A;  2X6N A;  4CFB A;  2DFH A;  1ZBL A;  4DMN A;  1X9W A;  1VSF A;  2G8W A;  4XIU A;  4B9S A;  4Z4I A;  1HJR A;  1TAU A;  4LD0 A;  2OYQ A;  3K5O A;  4DFP A;  3CG7 A;  4Q0B A;  3KLE A;  2FBV A;  4DSL A;  4CJK A;  1QTM A;  3MED A;  4E7I A;  4B8C A;  2P5G A;  2IOC A;  1IKW A;  4C8N A;  4QOZ B;  4KFB A;  1BQM A;  3C6T A;  2HHQ A;  2GBZ A;  3ITH A;  4AHR A;  1VSM A;  4IBN A;  4CJE A;  1N6Q A;  3ZT3 A;  3KKR A;  1RBS A;  2XY6 A;  4CFC A;  1XWL A;  4IFV A;  4FM2 A;  2OPP A;  4GMJ B;  3TAR A;  1UA0 A;  2G8H A;  4KPY A;  4FW1 A;  1Y97 A;  4Z0U A;  1LAV A;  5HRP A;  1KVC A;  2HNZ A;  4YNQ A;  3SQ4 A;  2IDO A;  3NGZ A;  4CF1 A;  2GV9 A;  3QIO A;  2IAJ A;  3T3F A;  4KRF A;  3LWM A;  3AVL A;  4Z4C A;  4E7J A;  1VSH A;  4DTU A;  5EU7 A;  4I2P A;  3MAQ A;  4DTN A;  3PX6 A;  1JLC A;  3DLG A;  1DTT A;  3DOK A;  3CYM A;  4KKO A;  2RKI A;  3DRS A;  1U04 A;  2WOM A;  3OYJ A;  4NYF A;  3ZSV A;  1N5Y A;  1BGX T;  4FJ7 A;  3VQ4 A;  3WNG A;  1Z25 A;  3MEE A;  4FLZ A;  1NJZ A;  4RW4 A;  3LZI A;  5CZ1 A;  4J2D A;  1WSJ A;  4C8L A;  4CGD A;  4GVM A;  1BIU A;  3TI0 A;  4Z4G A;  2HHV A;  2D0C A;  3CM6 A;  3OJS A;  1S9E A;  4AIL C;  1YTA A;  1LWC A;  1QSL A;  1EX4 A;  2IGI A;  3VQ8 A;  4CF2 A;  3HK2 A;  1QE1 A;  3NCI A;  3OVN A;  3NF6 A;  3K59 A;  1YVU A;  4CJL A;  1LV5 A;  1KVB A;  2FC0 A;  3AVC A;  3NBP A;  3V1O A;  3QLH A;  4CJF A;  1REV A;  1XI1 A;  1U48 A;  1NKC A;  2FBY A;  2P51 A;  1D9F A;  2XHB A;  3ZSZ A;  1ZYQ A;  2HVI A;  1S1V A;  1VRT A;  4BAC A;  4AHU A;  1NK6 A;  1L3U A;  1RTH A;  3HYF A;  2HMI A;  1RT2 A;  2A1R A;  2KW4 A;  3VQC A;  4JRP A;  3AVK A;  4FM0 A;  4DU4 A;  4DQR A;  3DYA A;  4CK3 A;  3L2W A;  2G8U A;  4RW6 A;  3NGI A;  1C1A A;  1NK9 A;  4FJX A;  3BGR A;  5HP1 A;  1NKE A;  4FCY A;  4FLX A;  1A5V A;  3LWL A;  1RBU A;  3CFP A;  4DS4 A;  4CCH A;  1BQN A;  3F73 A;  3OYK A;  3C95 A;  3DLB A;  3LP0 A;  1TKZ A;  4FLU A;  4BE1 A;  1KTQ A;  2G8I A;  4CHN A;  5KGX A;  1A5W A;  1DLO A;  3QEW A;  2Z1G A;  2NUB A;  3HP6 A;  4CF0 A;  3K5M A;  1NKB A;  3PV8 A;  1KFS A;  1ZBI A;  3V9U A;  3PUF A;  3PX4 A;  1BL3 A;  4DWI A;  1HPZ A;  2FBX A;  1TVR A;  3CFO A;  3P5J A;  5CY4 A;  4LSN A;  2Z1J A;  1TK0 A;  1ZBF A;  3O3F A;  4Y1D A;  1JLG A;  3EY1 A;  4H8K A;  4DQS A;  4F2S A;  4CEO A;  1LW2 A;  2KQ2 A;  4AHV A;  2HNY A;  4H4M A;  2ETJ A;  3KK1 A;  5FDL A;  3NH1 A;  1S1T A;  3C94 A;  3DOL A;  1Z26 A;  2B6A A;  3LAN A;  3O4Q A;  1VSE A;  4CGF A;  4E19 A;  2OPS A;  3DRR A;  4E7K A;  4K8Z A;  4M3Z A;  4FZZ A;  2Y1I A;  4EP5 A;  3HT3 A;  3VQ6 A;  3DLK A;  4FJ9 A;  1HQU A;  2YHA A;  2DTU A;  5C24 A;  1GOA A;  2YNI A;  1LAW A;  4CEA A;  5HRO A;  3IRX A;  1VSJ A;  1J5O A;  3VQQ A;  4L8R B;  4OPJ A;  4KHW A;  4QAG A;  4FJL A;  3AVM A;  4I2Q A;  1UAX A;  5JS2 A;  4CER A;  3SUO A;  3ZT0 A;  3CM5 A;  1HNI A;  1LW0 A;  3AO4 A;  2X6S A;  4CJP A;  3KTQ A;  1CZ9 A;  1NOY A;  2QKK A;  1RDD A;  3LP3 A;  3QEP A;  1MU2 A;  3PO4 A;  4FLT A;  5J2N A;  3WNH A;  4DF4 A;  4ELT A;  2ATQ A;  5DK5 A;  4LSL A;  4BWJ A;  5HBM A;  4FZX C;  4N41 A;  3MXI A;  3HVR A;  5J2Q A;  4KI4 A;  3I0R A;  3LP1 A;  4M3R A;  3V9Z A;  4JS4 A;  4KAZ A;  3TR8 A;  1UA1 A;  2P5O A;  4LH4 A;  3NH0 A;  3DLR A;  3VQA A;  1L3T A;  4FJJ A;  4NYN A;  1BCM A;  2Z1I A;  2E4L A;  3K5N A;  1WN7 A;  3NE6 A;  5KI6 A;  1C1C A;  2GUI A;  5KRS A;  1NK7 A;  1SKR A;  4Q5V A;  4Z4E A;  4CHY A;  1I3A A;  3OYM A;  3HM9 A;  3DI6 A;  3KLG A;  4DFJ A;  3ZCM A;  4B3O A;  2YNG A;  4JS5 A;  3WNE A;  3QNN A;  4W5O A;  1C0U A;  4DS5 A;  4CHQ A;  2FBT A;  4DU3 A;  4DSI A;  5KGW A;  1VSK A;  3SI6 A;  5E41 A;  1T03 A;  3ZT4 A;  1JLQ A;  2OZM A;  1S1X A;  4PUO A;  4OGC A;  3ISN C;  3QIP A;  3JYT A;  2HHX A;  2VG7 A;  4AHT A;  2PZS A;  3IG1 A;  1WSI A;  1SKS A;  4KHN A;  4E1M A;  3HST B;  1NJY A;  4K8X A;  2WON A;  5HRS A;  1HRH A;  3QES A;  1JL2 A;  1WSH A;  1CLQ A;  2EX3 A;  4CJV A;  3KLF A;  2XY8 A;  1SL0 A;  1TL1 A;  4CGI A;  1S6Q A;  2B5J A;  3T1A A;  3E01 A;  2D0B A;  4J2A A;  3HPO A;  1HQE A;  1ITG A;  4E7H A;  3RMD A;  4ELV A;  4KO0 A;  3RWU A;  3VA0 A;  4HHT A;  3TAB A;  1VK0 A;  5FRN A;  1CXU A;  3L3V A;  3G0Z A;  3SQ0 A;  5FRM A;  3M8P A;  1TV6 A;  4CEE A;  4EP4 A;  3OYH A;  4ZTF A;  2OPR A;  4CFD A;  1IKV A;  1VSL A;  4B08 A;  1S5J A;  2BE2 A;  1T8E A;  4CGJ A;  4ZTJ A;  1A5X A;  3AVG A;  3MXM A;  1L3V A;  1JKH A;  3AVN A;  3P1G A;  5KTQ A;  4B9L A;  2X74 A;  4M3T A;  4RW7 A;  1XC9 A;  1IKY A;  2OA8 A;  4CJS A;  4JRQ A;  3A2F A;  1BI4 B;  5CYM A;  4FJM A;  4BDY A;  2YV0 X;  1S1U A;  1KVA A;  1RT5 A;  1TK8 A;  4FJN A;  4O44 A;  4CHO A;  1JLE A;  4HVJ A;  3OYI A;  1U4B A;  1YTU A;  1RT6 A;  3TWH A;  3UIQ A;  1JLB A;  2HB5 A;  3SUP A;  3SJJ A;  3M8Q A;  4Z4H A;  4WE1 A;  3JSM A;  1TK5 A;  4KHS A;  1UOC A;  3V1Q A;  4HTU A;  4E1N A;  3VQ7 A;  2ZD1 A;  3KIO A;  1QSS A;  3NF9 A;  1RDC A;  1HNV A;  3AVI A;  4MFB A;  3DLE A;  5C25 A;  1RT4 A;  3OS2 A;  3VQP A;  4KI6 A;  1HYZ A;  4PY5 A;  4QCL A;  3VQD A;  3NF8 A;  3OY9 A;  4C8K A;  3OS0 A;  1T7P A;  4G1Q A;  3EYZ A;  4W5T A;  3L8B A;  4C8M A;  4E3S A;  1J54 A;  2X78 A;  5SZT A;  1KFD A;  2HND A;  1LWF A;  3DMJ A;  4HUE A;  3IS9 A;  1TGO A;  4O5B A;  4N56 A;  3OYA A;  4DSJ A;  3NHG A;  4F4K A;  3TAF A;  4CIF A;  4KTW A;  4AHS A;  4M45 A;  4NCA A;  1B9F A;  5JS1 A;  3SV4 A;  1EXQ A;  2HHW A;  3C6U A;  1U45 A;  4MQ3 A;  3QET A;  1GOB A;  1LWE A;  1B92 A;  4OLB A;  2JLE A;  4CF9 A;  3OYN A;  1NK5 A;  2DY4 A;  3SPY A;  4W5R A;  3IAY A;  4DFK A;  3U6F A;  4IKF A;  4OKK A;  4DTM A;  4DTP A;  3ZT1 A;  4IG3 A;  4B9M A;  1K6Y A;  4FLV A;  3VQ9 A;  1C0T A;  4DLG A;  4F3T A;  1U49 A;  3RMC A;  4B9T A;  3SNN A;  3NDK A;  3MEC A;  1BHL A;  1JLF A;  4FJ8 A;  4I9L A;  1T05 A;  1Q8I A;  4F3O A;  3TAP A;  3I8D A;  1ASW A;  3CFR A;  1S6P A;  3L2R A;  1Q9Y A;  4H4O A;  4CHP A;  2G8F A;  2PYL A;  4B9V A;  4W5N A;  3NAE A;  1KSP A;  1B9D A;  1KLM A;  2Y1J A;  2E6L A;  4DTS A;  4B9N A;  1SUQ A;  3S3M A;  1WAJ A;  3KLH A;  1X9S A;  3K2P A;  2PYJ A;  1RNH A;  1NOZ A;  1S9G A;  3AO5 A;  3I0S A;  3P83 D;  3U3G A;  1JXE A;  3OS1 A;  3ALY A;  5HRN A;  4DFM A;  1W9H A;  4CJT A;  4M3W A;  3PY8 A;  4B9U A;  3KD1 E;  1F21 A;  2R7Y A;  1ZBU A;  5CYQ A;  3M8S A;  4FM1 A;  3ULD A;  4E7L A;  1IG9 A;  3VQB A;  1VSI A;  1QS4 A;  3FFI A;  1KRP A;  1JL1 A;  3OJU A;  1BCO A;  1XHZ A;  1VRU A;  3SZ2 A;  3T19 A;  1ASU A;  1BI4 A;  3HVT A;  3DRP A;  4IDK A;  3VQ5 A;  3ZSX A;  4B8A B;  3SQ2 A;  2KZM A;  1RBV A;  1IKX A;  4PA1 A;  4IFY A;  4CJW A;  3QEV A;  1TKX A;  1HYS A;  2F8S A;  2JGU A;  2G8V A;  1YT3 A;  4CEB A;  3OYD A;  1W0H A;  3LAM A;  4FXD A;  2W42 A;  4KHY A;  4FW2 A;  4O0J A;  2F96 A;  4HCB A;  2AJQ A;  1FK9 A;  3QIN A;  4DTR A;  2OZS A;  3TAM A;  1RT1 A;  4JLH A;  4BDZ A;  2D5R A;  4CFA A;  4M3Y A;  4DF8 A;  3HP9 A;  3MXJ A;  3TAQ A;  3TAN A;  1GOC A;  1HMV A;  3AA5 X;  4DLE A;  1HYV A;  4DU1 A;  3V81 A;  1NJW A;  4DQP A;  2LSN A;  4CJQ A;  3OYL A;  3PX0 A;  1WSE A;  4DTJ A;  1D5A A;  2B4J A;  4CIE A;  3K5L A;  4DSF A;  2XY5 A;  4M3X A;  5C42 A;  2QKB A;  1KLN A;  3RR7 A;  2ZQB A;  3S3N A;  3L2Q A;  4RG8 A;  4BE2 A;  3KK3 A;  4OKE A;  3OYB A;  2KFZ A;  4CF8 A;  4CK2 A;  3K58 A;  4N76 A;  1WLJ A;  2ITG A;  4CJR A;  1NK0 A;  1BIZ A;  5CZ2 A;  3S3O A;  5HLF A;  4J2B A;  4CJ5 A;  1D8Y A;  3ZSW A;  3QEX A;  4LY7 A;  3QER A;  1J53 A;  4CEZ A;  3SUQ A;  4FK2 A;  3QO9 A;  1O1W A;  1CXQ A;  1EP4 A;  4Y1C A;  2YKN A;  4CEC A;  2D0A A;  2QK9 A;  1TL3 A;  3NGY A;  4NCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...