3ZSRA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsrA00
4I9QA 4MFBA 2RN2A 3C95A 5JS1A 1NOZA 1QSYA 4I2QA 4FLTA 4O0JA 1U4BA 2A1RA 2ZE2A 3LP3A 1IKVA 1LW0A 4CF2A 1LWEA 3BDPA 3OS2A 1S1WA 2DFHA 3LAMA 4I7FA 4HUEA 2OA8A 3BGRA 4B9UA 3WNFA 3PO5A 2OZMA 4W5NA 2YV0X 1RBSA 2KZZA 3ZSZA 4N47A 1BGXT 2XY5A 5C24A 5CY4A 4CHNA 2HHUA 3TAEA 1EXQA 4E1MA 2GBZA 2IOCA 3AA3A 1TV6A 3V81A 1U45A 4JLHA 1Z25A 3AVGA 3ASMA 2Z1HA 4DFPA 1JLQA 3HYFA 4FCYA 4IFYA 4B9TA 3VA0A 4HVJA 4CJEA 1BHLA 1LWCA 1TK5A 1RTJA 4AHRA 3CFPA 1QTMA 3UIQA 4PY5A 1A5WA 1JLCA 4CJVA 3V6DA 4B9LA 1VSEA 3IS9A 4KB1A 2X6NA 4DU1A 4DQIA 1VSJA 3U3GA 3O4NA 3OYDA 3LP0A 3D0PA 3CQ8A 1SKWA 4B9NA 3VQBA 1RT7A 1B9FA 3OYEA 1ASVA 4QCLA 1TK0A 1RBTA 1ZYQA 3SPZA 4LSLA 4F2RA 2E6MA 4CJTA 4ICLA 4FLYA 1Q9XA 3AVBA 4DSKA 1KCFA 3DMJA 3M8QA 4FLVA 3SUOA 3ZCMA 4J2EA 4M3WA 3L2UA 4DFMA 1C6VA 2FBTA 3K59A 3KKRA 4HTUA 3PY8A 4KTZA 2DFFA 3L3UA 1L5UA 2QKKA 3SCXA 3OY9A 1NKBA 4BACA 2BANA 2FBXA 2X6SA 1NK0A 3TAFA 4HCBA 2JLEA 1NK7A 4O0IA 3OYFA 5FDLA 1JXBA 1RCHA 5HBMA 5K14A 3AO2A 3NF9A 3V9UA 2HNZA 4CF9A 4PWDA 3KKSA 1ZBLA 2HNDA 1JL2A 3SQ0A 1L3VA 3HL8A 1DTQA 1WNSA 3CYMA 3EY1A 1RDBA 3QETA 1WAJA 2QXFA 1HYZA 1LAVA 1BCOA 4CJSA 3SPYA 4FLUA 5HLFA 1T05A 1C0MA 4KV8A 1LW2A 3TARA 2I5JA 3MECA 3OVNA 4FYDA 3OJUA 1ZBFA 4KKOA 3RRGA 4CIGA 1O1WA 3HVRA 3CM5A 4CEAA 3KTQA 4DWIA 1CXUA 1XHXA 4DLEA 1NJWA 5FROA 4H4MA 1RTDA 3DRPA 1KFSA 3AA2A 2IC3A 4KTWA 3RMBA 1FK9A 1HRHA 2AJQA 2VG6A 4GMJB 4DQRA 4KI4A 4CIEA 4Y1DA 3NH2A 4C8OA 3RRHA 3NHGA 4JRQA 1RDAA 3B6OA 4NYFA 1HJRA 1RTIA 4OKEA 2HHVA 5CZ2A 2QK9A 3NFAA 4KHNA 3DLGA 1NK5A 3TAGA 4W5TA 1S5JA 1GOCA 3DRRA 1S1TA 1B9DA 3AVLA 4CJ4A 5KTQA 3HT3A 2XHBA 4FJ7A 4QOZB 4DU4A 2G8WA 4DTRA 1RILA 3A2FA 3NH1A 4ELTA 2VG5A 2KTQA 4CEZA 2YNHA 4M3RA 4E19A 4CJFA 1U48A 4JS5A 3OS1A 3KD5E 3LPTA 3VQ8A 3WNEA 2F8TA 4ID1A 3KK2A 4BWJA 1MU2A 4CHZA 2E6LA 4Z4EA 2D0AA 2HW3A 2Z1IA 1ASUA 1S1VA 4BDZA 3TI0A 5DMRA 4BWMA 4CK3A 4C8KA 4W5QA 3OYHA 4FJMA 4LSNA 1B92A 4FXDA 4RW9A 3VQ4A 1TVRA 4FZXC 1D8YA 2YHAA 5HRPA 4ELUA 4FJIA 4DTNA 2KW4A 4HHTA 3RR8A 4CFDA 3ZSWA 3SQ1A 4KHYA 1J53A 4C8MA 3SQ2A 1SUQA 3D45A 4DQSA 3ZSXA 1A5VA 3AO1A 4FZYA 2OPPA 5T7BA 2XO7A 1VSLA 4Z4IA 2RF2A 1IKYA 3RMAA 3MEDA 1SV5A 4FW1A 3I0RA 5C42A 1KFDA 1WSJA 4PA1A 3SJJA 4J2BA 2XRIA 3F73A 4KREA 4DFJA 4FJ9A 1WAFA 1SL1A 1KVAA 2FBVA 2DFEA 4M3YA 1KVCA 3AV9A 1C1BA 5HRRA 3AVMA 4CJQA 4ZTJA 4FM1A 2OPSA 3JYTA 1JLFA 3IG1A 4F2SA 3AA4A 4B8CA 4CF0A 3EYZA 3TWHA 3HM9A 4PUOA 3P5JA 4M3ZA 2G8IA 3DLEA 4KHQA 4Q0BA 3LAKA 1BQNA 1RNHA 4EZ9A 1YT3A 5KI6A 1C0TA 3IAYA 1QQCA 3AVNA 4FK2A 4E1NA 2PZSA 3OYAA 4DTPA 3OYLA 4CESA 1JL1A 1IO2A 3AO3A 2YKMA 4Z4CA 3O3HA 1RT5A 3LPUA 4CGIA 3S3NA 3OJSA 3ZSRA 2PYJA 3C6TA 1SL2A 5I42A 4H4OA 3ZT4A 4CGJA 4JRPA 3QNOA 2IGIA 4LH4A 1WSEA 1JLEA 4B9VA 2X74A 3HXMA 2BGGA 3MAQA 4CHOA 2OPRA 5I3UA 1LWFA 1T03A 1KVBA 4BDPA 4EZ6A 4HCCA 2IS3A 3MXIA 3AO4A 5FRNA 4F3OA 2YKNA 5KGXA 4CEQA 5CYMA 2Z1GA 1UA0A 1TKXA 4LY7A 3OS0A 4KHSA 3VN5A 2X78A 3T19A 4CEBA 1Z26A 4OVLA 4NCGA 4B8AB 4CJPA 4CEEA 1WSHA 2B4JA 1FKOA 2VWJA 4CF1A 1R0AA 3H08A 2XY7A 4KPYA 4B9SA 1FKPA 1WSIA 1SKSA 2PYLA 4KHWA 3AVHA 4O55A 1HYSA 1VRUA 1UOCA 2YNFA 4DLGA 4FJLA 4E3SA 3M8PA 3QEIA 3V4IA 4KB0A 3SUQA 3DI6A 4LH5A 3NGYA 4DMNA 4FM2A 1QHTA 2WOMA 2B5JA 3VQ9A 4CFCA 3G10A 2FC0A 1D9FA 1WSGA 4Z4HA 1F21A 4FJGA 3HK2A 3KIOA 3P1GA 3M8RA 1KSPA 1TL1A 3LP2A 1NK4A 1C1CA 1BISA 1RT1A 3AO5A 4B08A 4N41A 5J2MA 4CF8A 3V9WA 2ZQBA 1X1PA 3VQ5A 1TAUA 5D3GA 3HPGA 1EKEA 1KRPA 1U04A 4OKJA 1HNVA 4CGDA 3V9ZA 1ZBIA 4DS4A 1KLNA 4BE2A 3HJFA 3PX4A 4W5OA 5J1EA 4I9LA 3VQQA 3HO1A 3HSTB 4FJNA 3DYAA 4DF8A 1HMVA 3VQCA 3OYIA 4M3TA 4CJKA 1XHZA 4HUGA 4AHTA 4DS5A 3C6UA 3C94A 4CEDA 3S3MA 2RKIA 3DM2A 4EP4A 4KTQA 4FZZA 5CZ1A 3VQ7A 4AH9A 4BDYA 1BQMA 4CHQA 1I3AA 3LDSA 1WSFA 4DSFA 2YHBA 4FJ8A 4CJWA 4CIFA 4BE1A 1X9MA 3ISNC 1JLGA 1U47A 4NCAA 3KD1E 2DY4A 5FRMA 4CE9A 4CCHA 3LALA 3DLBA 4IBNA 4CFBA 3OYMA 3L2WA 4NYNA 3PV8A 1RDDA 2G8KA 3ALYA 4CHPA 1CZ9A 1CLQA 1VK0A 3NH0A 3NGIA 4I2PA 3ZSVA 1NJXA 1TKZA 2O4IA 1HQEA 4DU3A 2YNGA 5HRSA 3TAPA 3NE6A 2W42A 4CECA 4E7HA 2G8FA 3VQDA 3K5NA 2LSNA 3CM6A 3QINA 2HHQA 4H8KA 1VSFA 3FFIA 3O4QA 2KFZA 4ID5A 4DTUA 3TANA 3KK1A 3HVTA 1QS4A 4OJRA 4OGEA 2GV9A 4BE0A 3SZ2A 3NAEA 3NF7A 3ZT0A 4JS4A 3U6FA 3V1QA 3QNNA 3TAQA 4FK0A 3MXJA 4Q5VA 3PX6A 1NOYA 1L3SA 4C8NA 5SWMA 1ZBHA 4CK1A 1C0UA 1LAWA 1RBRA 3AA5X 3DLRA 3QIOA 1SL0A 1GOBA 1FXXA 4K8ZA 2DTUA 3RMCA 1X9WA 1NKEA 1JXEA 1VSHA 3KLHA 4CGHA 4CGFA 1RT2A 1TKTA 1SKRA 1GOAA 3MEGA 4ZHRA 1YTUA 3U3YA 4DFKA 1NKCA 1N5YA 1EP4A 3V1RA 3DRSA 2P5OA 3K58A 4DQQA 4GW6A 1DLOA 1CZBA 5J2QA 4E7JA 3RMDA 3VQ6A 3OYJA 1NJYA 1QSSA 4J2DA 4L8RB 3OYNA 2HHTA 1NK9A 3SV4A 1D9DA 3T1AA 4M45A 1TGOA 2D5RA 4KI6A 4M41A 3KLGA 3K5MA 1VRTA 3RTVA 2XY6A 5SZTA 4KO0A 3L8BA 1J5OA 1T7PA 1BI4B 2HNYA 2WONA 1T8EA 3ZSYA 3AVAA 3DOKA 4OPJA 1QSLA 4CEOA 3NGZA 1S9GA 3K57A 4IDKA 3QEWA 1BIZA 3RR7A 1BI4A 4CJ5A 3SI6A 2OZSA 3SQ4A 3OYCA 3L2RA 2HHSA 1YTAA 3F9KA 1IKXA 2IAJA 3MXMA 1W9HA 4C8LA 4R5PA 5KGWA 3O3FA 1QE1A 4Y1CA 4Z4GA 1TAQA 2KZMA 4E7LA 3VA3A 3WNGA 3L2VA 1LV5A 3NDKA 4O44A 1JLAA 1ZBUA 4F3TA 3SYZA 4DSLA 1J9AA 1CXQA 4DSEA 4KAZA 2OPQA 4RG8A 1RT4A 4QAGA 2R7YA 1EETA 4ZTFA 1RTHA 1TKDA 2GUIA 3AVFA 4OGCA 1HNIA 1I39A 3ZSOA 4CK2A 3SUPA 1L3UA 1N6QA 1S9EA 4CFAA 4DTJA 2G8HA 4FK4A 1D5AA 3G0ZA 1ASWA 1HQUA 2P51A 4RW4A 4DSJA 4B3OA 2P1JA 2D0CA 3CFOA 4KHUA 4DTXA 4O5BA 3LP1A 4FJXA 4FVMA 1IH7A 3I0SA 2O4GA 3HPHA 3LWMA 2ITGA 4DTSA 3SUNA 3KLIA 1NJZA 5DK5A 3LANA 4WE1A 5J2PA 3K5OA 5KRTA 3EZ5A 4M3UA 4E0DA 3ZT3A 2FBYA 1XC9A 4K8XA 3NF6A 3ZT2A 3OYGA 4DTMA 4NCBA 1Q8IA 1S6QA 1K6YA 3HPOA 3V9XA 1VSKA 3RWUA 2VG7A 1IG9A 1S6PA 4RW8A 2QKBA 2KQ2A 3THVA 4CGGA 3SNNA 4DG1A 4FJHA 3HP9A 3E01A 2G8UA 4B9MA 3K2PA 3DLKA 4FW2A 3JSMA 4HUFA 2F8SA 3QLHA 1S1XA 1ITGA 1JLBA 1S1UA 4DF4A 2BDPA 2NUBA 3HP6A 3OYBA 4IFVA 4CEFA 3S3OA 4Z4FA 3V9SA 4CJRA 1U49A 3MEEA 4MQ3A 1RBUA 4E89A 3L2QA 1KLMA 3KLEA 3K5LA 5HP1A 3AVCA 3WNHA 4E7IA 1DTTA 3S9HA 2A1SA 4LD0A 2HMIA 4GVMA 2EX3A 1X9SA 4KRFA 5J2NA 1RT3A 3QERA 5E41A 1XI1A 3KJVA 2ETJA 4F8RA 3TR8A 2HHWA 3TAMA 3AVIA 3AVKA 1G15A 4Z0UA 2EHGA 1W0HA 4AILC 2ZD1A 3M8SA 2KFNA 3IRXA 2HB5A 1HYVA 4IKFA 2HVIA 1TK8A 3VQEA 4CERA 1RDCA 3KLFA 3ULDA 3LZJA 3PO4A 3CG7A 3O3GA 4FM0A 2IDOA 3VQAA 2XY8A 3PUFA 1BIUA 4AHSA 5HROA 1A5XA 1BL3A 4M42A 2HVHA 5JS2A 4FJKA 3L3VA 4ELVA 3ZT1A 4CJ3A 3I8DA 1RBVA 4YFUA 2Q3SA 5EU7A 1REVA 5KRSA 4W5RA 4OLBA 3P83D 1YVUA 4FLXA 4DSIA 4M3XA 3KK3A 2VWKA 3LWLA 3DOLA 4N76A 2Y1IA 4EP5A 4N56A 4XIUA 2G8VA 3DLHA 3NBPA 1NK6A 2ATQA 4FLZA 4OPKA 3T3FA 3QESA 4FLWA 1RT6A 4FJ5A 4J2AA 2YNIA 4E7KA 1UA1A 1UAXA 3TABA 2JGUA 2D0BA 4FJJA 4KFBA 1UWBA 4OLAA 1EX4A 4AHCA 3QEVA 5C25A 4CJLA 4N5SA 1VSIA 3NCIA 3QEXA 1JKHA 5CYQA 3NF8A 3OYKA 4CJUA 2RPIA 1NK8A 4AHUA 2B6AA 3LZIA 4DQPA 2OYQA 4RW7A 2P5GA 3VQPA 3QO9A 2F96A 4CHYA 1C1AA 4IG0A 1WLJA 1KTQA 2Y1JA 4IG3A 4DTOA 1Q9YA 2Z1JA 1IKWA 1BCMA 3B6PA 3ITHA 3V1OA 3AVJA 2PY5A 4F4KA 1HPZA 4UQGA 4O4GA 3CFRA 2HHXA 4YNQA 3QEPA 1XWLA 1J54A 1WN7A 4G1QA 1VSDA 4AHVA 1TL3A 1Y97A 3SV3A 1L3TA 4PQUA 3ZSQA 3PX0A 3QIPA 2BE2A 4OKKA 2E4LA 1VSMA 5HRNA 4RW6A 4TSXA
chains in the Genus database with same CATH superfamily
2W41A 1NOZA 2ZF5O 3VESA 4A59A 4FVUA 1LW0A 2ASPA 2V52B 4HUEA 3P38A 3WNFA 1RBSA 3KVGA 1XNRK 2V7ZA 5AQNA 2VGNA 1YJ9N 5CY4A 3M5RA 2HHUA 1EXQA 2IOCA 3QBWA 4JLHA 1Z25A 3AVGA 4LF4K 4B9TA 1TK5A 4AHRA 4U67L 4PY5A 1A5WA 1JLCA 3V6DA 3LDNA 4K25A 2X6NA 3O4NA 3PIPL 3FGUA 3FZKA 3A5NC 4GNIA 3IFRA 3OYEA 1ASVA 3R3LA 2O8EB 2P9PB 4JKBA 1RBTA 2E6MA 4JAXA 3CCVN 4J2EA 3DMJA 3HZ6A 2FBTA 4PKGA 3K59A 2BUPA 1NKBA 2FBXA 3T69A 1BUPA 1U2VB 2E20A 3ENOA 3G6EN 1NK7A 5FDLA 5K14A 3AO2A 4CF9A 3ZX3A 3KHYA 1JL2A 4H0OA 2NZTA 4GV6A 3MN7A 1VQON 1DTQA 1RDBA 3DAWA 2QXFA 5ELZA 1HYZA 4CJSA 1BCOA 1T05A 4KBOA 1O13A 3EL2A 3HRGA 4KV8A 4FYDA 3THWA 1VQ8N 1IV0A 4FWOA 4YOUA 2P9SB 4JKCA 5AZJB 5FROA 4H4MA 4O5FA 3AA2A 4CZHA 4KH6A 1SAZA 1FK9A 1HRHA 2AJQA 4BROA 2YHWA 4CIEA 4JI2K 1SS6A 1Q86O 3IKMA 2AA4A 4BR4A 1HJRA 4OKEA 1JCFA 2QK9A 4KHNA 2KHOA 1TYQB 1U2VA 4JKDA 1YI2N 5KTQA 4YOYA 1OH6A 2XHBA 1RFQA 4DTRA 1RILA 2FF6A 4E19A 1U48A 3GOIA 3OS1A 3LPTA 3VQ8A 1YAGA 4ID1A 5C10A 4CHZA 2E6LA 1EO1A 2QW9A 3EKUA 1QZ6A 1ASUA 1S1VA 4CK3A 3N4QA 4RW9A 1TVRA 1T6CA 4YOVA 4ELUA 5I9EB 4DTNA 3RR8A 4BQLA 4KHYA 3B8AX 4IOAL 2A40A 1K8KA 2RF2A 3OW2M 3MEDA 3RMAA 2PAVA 1KFDA 1K8KB 3F73A 4DFJA 4FJ9A 3FFKB 3WXIA 5CHIA 3CC7N 2DFEA 3O8MA 4JKFA 4M3YA 3O08A 1C1BA 4ZTJA 2GTDA 4FM1A 4GKKK 2FXUA 3JYTA 1I94K 4F2SA 5AR0A 3C6AA 3EYZA 3TWHA 3P5JA 4M3ZA 4KHQA 4EZ9A 1RNHA 3D6RA 3EEQA 1OH8A 1C0TA 2QXLA 4E1NA 1NBWA 1KD1O 3J8AA 4CESA 4JKGA 4G9ZA 1RT5A 2W40A 3WXJA 3C6TA 3VTHA 5I42A 1D4XA 4H4OA 4H0VB 2WBNA 4MDBA 2BGGA 4C23A 2OPRA 5M1OA 1DEJA 1GLLO 5FRNA 3MN9A 3VPZA 4F3OA 4CEQA 2E88A 1TKXA 4F9OA 3VN5A 3T19A 1Z26A 4OVLA 4NCGA 4CEEA 1WSHA 4H0YB 2VWJA 1YVNA 4DV3K 4KPYA 1WB9A 1WSIA 4IZ9A 2PYLA 5AQLA 4LF6K 4O55A 4CBUA 4X66K 1VRUA 3AY9A 3KWGA 4FJLA 5BPNA 4FOIA 3VQ9A 3G10A 1D9FA 4B1ZA 4BR2A 3M8RA 1VQ4N 1NGJA 1NK4A 4IFEA 1RT1A 2YI1A 1VQ7N 4N41A 2KLAA 3VQ5A 2A5XA 3V9ZA 4CGDA 4DUZK 1DKGD 4JI0K 4BE2A 3E9OA 5C2FA 3PX4A 5M1NA 3VQQA 3HSTB 4DF8A 1BDGA 2NLXA 4DS5A 2OTJN 5BR8K 3S3MA 3DM2A 4EP4A 4KTQA 1HLUA 3VQ7A 4MDAA 4NXNK 1J6ZA 4CJWA 1JLGA 3KD1E 2DY4A 1C0GA 4BRGA 3LALA 4NO7A 4CI6A 1HNXK 3L2WA 4CZKA 3CHWA 1RDDA 1CLQA 1VK0A 4XH4A 3ZSVA 2FSNA 3CJAA 1TKZA 4IDHA 3NE6A 5GADP 1NLVA 1HPMA 3BP8A 4JEPA 2KFZA 2AP1A 1P90A 4JK8A 3KK1A 1QS4A 4OGEA 3LDQA 3NAEA 3ZT0A 3CMEN 2O8BA 3TAQA 3PSIA 3FZFA 3MXJA 5GAGP 4Q5VA 3I55N 4CK1A 4K8ZA 1RBRA 3QIOA 2CGKA 2DTUA 3BZKA 1C0FA 1S72N 4Y0WA 1TKTA 3NMUA 3TTFA 1EP4A 3DRSA 1QHAA 3K58A 4DQQA 2JWKA 1CZBA 2ZJRL 4E7JA 3VQ6A 4J2DA 4MLHA 4B1XB 2HF3A 4M41A 5KQDA 2XY6A 4CBWA 4KO0A 2O8BB 3K9JA 3DOKA 1S9GA 3AAPA 3RR7A 1BI4A 1YHQN 2HHSA 3F9KA 2IAJA 3CF5L 4BR0A 1LV5A 1JLAA 4F3TA 4DSLA 3LL3A 2YCHA 1EETA 2R7YA 1RTHA 1N6QA 1TUUA 4DTJA 4CD1A 1HQUA 4B3OA 3VF2A 2D0CA 4DR3K 4FJXA 1NGEA 1IH7A 2RE2A 3HPHA 3LWMA 4DTSA 3SUNA 2QWNA 1XC9A 3JAMO 3THXB 3V9XA 5IT9O 1VSKA 4H03B 3THVA 3SNNA 4FJHA 5M1KA 3JSMA 3CETA 4DV5K 1S1XA 3K9KA 2NUBA 3HP6A 3OYBA 4IFVA 4CEFA 5HL7L 3S3OA 2A41A 4M7YA 3MEEA 3KLEA 4OPAA 3RSEA 4E7IA 3S9HA 3SBTA 4FPBA 2P9SA 1X9SA 1RT3A 2VCPA 2ETJA 3TAMA 3VEZA 3AVIA 1G15A 4IJNA 4AILC 3T1YK 2NRRA 3FLCO 2ZD1A 3M8SA 3AAQA 4IKFA 2HVIA 3LZJA 1E4GT 1NGHA 3O3GA 3BY5A 2XY8A 1BIUA 4AHSA 3PLAA 3SK3A 5CR4A 3L3VA 3K0SA 3CQYA 3J7YP 4OLBA 3P83D 4M3XA 3D2FB 2Y1IA 4RWTA 4WQ5A 2G8VA 1HX1A 1SQKA 3SJHA 3DLHA 4LFBK 4K43A 4OPKA 1M90O 4J2AA 2YNIA 3BUZB 4IOXA 4FJJA 1BA1A 1VSIA 3E9LA 3NF8A 2QM1A 1H1VA 3WQTA 1KTQA 2I7NA 3B6PA 3V1OA 3WQUA 1HPZA 2E2NA 3QDKA 4O4GA 3QFPA 1J54A 2Q36A 5C12A 3QIPA 4RW6A 4FWKA 4I9QA 3C95A 1QSYA 3A5LC 3EE8A 2A1RA 1HUXA 5BRDA 4DR4K 3G71N 3C65A 1LWEA 4M7XA 2HMPA 3G4SN 2D0OA 4B9UA 3VEYA 1IBLK 3PO5A 2OZMA 2YV0X 1W2BM 3MK6A 3ZSZA 4UY8O 4GKJK 1BGXT 2XY5A 5GIOA 4KH5A 3O80A 3TSPA 3TAEA 4E1MA 3AA3A 2DPNA 5F1XA 1JLQA 1YITN 2UUCK 4HVJA 1BHLA 1JCGA 1LWCA 1QTMA 3HOTA 3UIQA 3IS9A 5JLHA 4DU1A 4WCEL 2A6AA 4DQIA 1SKWA 5EX5A 3D0PA 3VQBA 1RT7A 2Q1NA 1N36K 3VTIA 3HI0A 1ZYQA 4F2RA 4B1YB 4EHUA 5ADXA 4DSKA 1KCFA 3M8QA 3ZCMA 5E26A 2DFFA 1L5UA 1ATSA 2UXBK 3SCXA 3OY9A 2WFBA 2BANA 5IWAK 2F9WA 4YHHK 4CZEA 4HCBA 1WUAA 3MDQA 3NF9A 3V9UA 1RGIA 3SQ0A 1R59O 3CJ9A 3HL8A 1VQKN 4JKGB 1WAJA 5GAEP 4FLUA 4ISGA 4HWIA 3TARA 3OVNA 3D2EA 4BR5A 2Q31A 3RRGA 4CIGA 4DV2K 1RTDA 3DRPA 4AM7A 2IC3A 5BPLA 4NLCA 2QEXN 4DQRA 5AQWA 1DGKN 4A2AA 4AQYK 3O9QA 1RTIA 3CIPA 2YHYA 2NNWA 1NK5A 1S5JA 3DRRA 1S1TA 1B9DA 4CJ4A 4FJ7A 4YY3K 3HT3A 1OH7A 3MWTA 2HBKA 3A2FA 3NH1A 4ELTA 5LMNK 4CEZA 4CJFA 2F8TA 3R6MA 3WNEA 4B3TK 3QMLA 3KK2A 4BWJA 3CCMN 2D0AA 4YDUA 4BDZA 3AGKA 4BWMA 4W5QA 3OYHA 1N32K 2QWPA 1BU6O 2UXDK 5FPMA 4H5TA 4FZXC 1D8YA 2YHAA 3KWIA 1OVYA 5FPNA 4EHTA 2KW4A 4FWPA 3ZSWA 5BRHA 4A5AA 3IDHA 3CD6N 4C8MA 4BR9A 4ISFA 5AQTA 1NGIA 3D45A 1TYQA 3AGRA 3ZSXA 4FZYA 3H46O 3KZBA 1IKYA 1NJIO 2IVPA 3SJJA 5C42A 1VQ6N 2FSJA 4WYBA 3RSEB 1NGGA 3QICA 1G99A 2Q0RA 1HKGA 5LY3A 3IG1A 3SAFA 4B8CA 4CF0A 1VHXA 5AQOA 3CPEA 3DLEA 3LAKA 1BQNA 3O9SA 2YX6A 3ID6A 4EAHD 3UE5A 3IAYA 1QQCA 3UKUB 3LDPA 3FR0A 4H0PA 1EQYA 4CGIA 3OJSA 1KQSM 1SL2A 3WXLA 3ZT4A 4CGJA 4LH4A 1GLJO 4JNEA 4B9VA 3OA9A 5AQVA 3HXMA 5I3UA 1LWFA 4BDPA 2QWMA 4EZ6A 2IS3A 3MXIA 5KGXA 5AQXA 1ILYA 4LY7A 4AM6A 1N33K 2X78A 4CFDA 4CJPA 2B4JA 2NRTA 4CF1A 3SMPA 2XY7A 3CCUN 1NWKA 1Y64A 3QB0A 4I6MB 4KHWA 2P9LB 1KAZA 4I6MA 2YNFA 4DLGA 3M8PA 4KB0A 3SUQA 3DI6A 5TKYA 4JN4A 1QHTA 1K9MO 2VWBA 4MO5A 3UKUA 1MDUB 3KIOA 3P1GA 3C7NB 4U7BA 1TL1A 3LP2A 4BRDA 3AO5A 3CC2N 4JI4K 3TTDA 3HPGA 4EIAA 1EKEA 1HKCA 1MWMA 4OKJA 2OCEA 1V4SA 1ZBIA 3HJFA 2BH1A 4PL8A 1BO5O 4BRPA 5J1EA 1QQOA 1OKJA 4DV7K 4BRHA 4FJNA 1HMVA 1VQMN 1Q7YO 4M3TA 1IJJA 1KXPA 3C6UA 3C94A 1BG3A 5CZ1A 4AH9A 2PBDA 1GLCG 2YHBA 3O6WA 4BE1A 3A0IX 4JD2A 4NCAA 5FPEA 5AQMA 5FLXO 4X64K 1BOTO 4B3MK 3ALYA 4IJAA 4CHPA 1CZ9A 4DR6K 1E4FT 2P9NB 4DCHA 1NJXA 3WUHA 4DU3A 5MLCQ 3CM6A 3QINA 5AQYA 4YORA 1VSFA 3FFIA 4BC3A 3TANA 3HVTA 4BE0A 2GV9A 3NF7A 3U6FA 4FK0A 3OBWA 4BC4A 3PX6A 2P9KB 4C8NA 1ZBHA 1LAWA 2E8AA 3AA5X 1GOBA 3DXKA 1X9WA 1MA9B 1JXEA 2UYTA 1TUYA 1BWFO 4V19S 4CGHA 4XH1A 3D2FA 1SKRA 2HBMA 1YTUA 3U3YA 5JICA 3V1RA 2WTUA 2CH5A 2HHTA 3OYJA 1P8ZA 4JHDB 3EN9A 3SV4A 4JI8K 1TGOA 3K5MA 3G25A 3MX5A 5SZTA 3L8BA 1J5OA 2HNYA 1T8EA 1N8RO 4WFAL 3QEWA 1BIZA 1T44A 3SI6A 2OZSA 2O8FA 5KPRA 1IKXA 4C8LA 1W9HA 4K0KK 4R5PA 2GEMA 5KGWA 3O3FA 1GLEG 1TAQA 4E7LA 3WNGA 3CERA 4DSEA 1CXQA 1X3NA 4ZTFA 2GUIA 4BQZA 3AVFA 3ZSOA 4CK2A 3THXA 2CGJA 1VQPN 1S9EA 3JS6A 3VERA 4CFAA 1D5AA 3G0ZA 1ASWA 2P51A 2KKZA 3CMAN 4FVMA 1RDWX 4WF9L 5J2PA 3K5OA 2ASOA 5KRTA 4NCBA 4IEEA 1Q8IA 3HPOA 2VG7A 1IG9A 1S6PA 2QTDA 4DUYK 3K2PA 3MCPA 4FW2A 2F8SA 5AQIA 1ITGA 3H45C 4IEIA 2P9UB 4Z4FA 3V9SA 1ZXOA 4CJRA 3N4PA 5HP1A 3ZYYX 4YDUC 3AVCA 4BRKA 4LD0A 2HMIA 1S22A 2EWSA 1Z05A 4KRFA 5J2NA 3QERA 3WEEB 4A61A 2F7TA 3FZLA 3ZEUB 3ID8A 4Z0UA 3CXCM 2EHGA 2QI2A 2O8DA 3ZEUA 3PIOL 1TK8A 4CERA 3KLFA 3ULDA 3PO4A 4FM0A 2IDOA 5HROA 1HR0K 1NMNA 1BL3A 3A5OC 2WUSA 4ELVA 1RBVA 4YFUA 2Q3SA 5EU7A 4W5RA 3C6HA 1YVUA 2VWKA 2FF3B 4EP5A 2ATQA 5H1SQ 5AQPA 4B3RK 3T3FA 4FLWA 1RT6A 1YF5L 1UAXA 2A3ZA 4KFBA 4CVNE 4OLAA 5JVGL 1QVFM 5C25A 4N5SA 3NCIA 4DR5K 4CJUA 2B6AA 3IMXA 2P5GA 4CHYA 4FWQA 4IG0A 1WLJA 2CH6A 3NVMA 2Z1JA 1IKWA 1BCMA 3D7EO 5AZJA 5AQZA 1XWLA 3SAHA 4YOXA 3RVCA 1Q82O 4H0TB 1VSMA 5HRNA 5BREA 5LJWA 5BN8A 1M1KO 3CJCA 4FLTA 5DM6L 3LP3A 2UUBK 1IKVA 4JKAA 4M63C 4JI1K 2DFHA 4I7FA 3LAMA 2OA8A 4FL9A 4BREA 3T7ZA 4W5NA 2HBJA 2KZZA 1YXQA 4N47A 2NRXA 5C24A 4CHNA 4JI5K 5AQKA 1QQMA 2GBZA 1TV6A 3V81A 4A57A 3ASMA 3BEXA 4IFYA 4CJEA 1RTJA 3QFUA 4DR2K 4B9LA 4KB1A 3EO3A 4IWVA 1VSJA 3U3GA 3LP0A 3CQ8A 4B9NA 1IG8A 2ZJQL 4QCLA 1TK0A 4DR1K 4LSLA 1Q9XA 3AVBA 1XNQK 2O8EA 3SUOA 2IVOA 4K41A 4M3WA 3L2UA 4DFMA 1C6VA 3KKRA 5E84A 3PY8A 4KTZA 2H3GX 3L3UA 1X3MA 4BACA 2X6SA 1NK0A 4ILGB 3TAFA 3J7AP 4CZLA 3S41A 4O0IA 3OYFA 1RCHA 3LM9A 2HNZA 3KKSA 5JLFA 1ZBLA 4CBXA 3VGLA 1L3VA 4JI7K 2P9NA 3CYMA 3QETA 1LAVA 3SPYA 5HLFA 5KQ8A 3A5MC 1LW2A 2YJEA 3MECA 5AQGA 3OJUA 3ULEB 1ZBFA 1NM1A 1O1WA 3HVRA 3O1WA 3KTQA 4DWIA 1CXUA 1GLBG 4DLEA 1NJWA 1KFSA 1K73O 1DT9A 4OX9K 4KTWA 2NRZA 4H5WA 4GMJB 4DV6K 1NGFA 3RRHA 4IXCA 1RDAA 1ESVA 2GWJA 3MX2A 2VQFK 3VEWA 1HNZK 5CZ2A 3DLGA 3TSUA 4PL7A 3CPWM 3JXUA 4W5TA 1GOCA 3E66A 4QOZB 3TTCA 3LDOA 4DU4A 2G8WA 4JS5A 3KD5E 2ZM6K 4BC5A 1MU2A 3CCRN 4Z4EA 5A2QO 2HW3A 3TI0A 5DMRA 4C8KA 4LSNA 2GELA 1B92A 3VQ4A 3ZETA 3PSFA 4Z94A 5HRPA 3EE9A 3ZX0A 1EWRA 4RTFD 1NGAA 1SUQA 4DQSA 3MWPA 1W7AA 2OPPA 1RDUA 3A8YA 5T7BA 3WT0A 4Z4IA 1SV5A 3I0RA 4PA1A 4J2BA 2XRIA 3SBGA 3CC4N 1WAFA 1SL1A 1KVAA 2E5LK 3GL1A 3HOSA 3UKRA 4BVPA 1JCEA 4DHYA 3I8BA 1Q18A 3AA4A 3HM9A 1FW6A 2G8IA 4Q0BA 4MLEA 2WC9A 4BRLA 1YT3A 3MN5A 5KI6A 4DTPA 3OYLA 3AO3A 2YKMA 4BVOA 4Z4CA 3LPUA 3S3NA 3QNOA 4DV4K 1WSEA 1V4TA 1JLEA 2X74A 5AQFA 2Q97A 4HCCA 4LFCK 2Z1GA 3VETA 4KHSA 4B8AB 4O8UA 1FKOA 2YHXA 2IVNA 1R0AA 3H08A 4FWLA 3DXMA 1SKSA 3W0LA 3AVHA 3L6QA 3LM2A 2GUPA 1HYSA 3SMSA 5AQUA 4DQ8A 3MMVA 4E3SA 3V4IA 3L4IA 4QS7A 1EWQA 1NMDA 3U9ZA 5ADXH 3NGYA 4DMNA 1WOQA 4CFCA 2B5JA 2WOMA 4FWMA 3F9MA 3VMFB 1WSGA 4Z4HA 1F21A 4FJGA 3HK2A 1C1CA 1BISA 4B08A 4H5VA 5AQQA 3SLCA 4CF8A 2NRWA 3VF4A 1TAUA 5D3GA 3VF6A 1U04A 3F5TA 3DXMB 2NRVA 4BG8A 4W5OA 5AQRA 3W3DA 4MO4A 3THYA 3QBXA 3DYAA 3OYIA 3FE1A 4CJKA 1XHZA 3FZMA 4HUGA 4AHTA 4CEDA 3ATVA 3M3ZA 4FWRA 4JV5K 1BQMA 1I3AA 2ASMA 4WQ5C 1WSFA 4DSFA 4C1NI 4K42A 4C1NK 3ISNC 4BRIA 4IBNA 3OYMA 4NYNA 4JK9A 2G8KA 3NH0A 3NGIA 1XMQK 4I2PA 3ATUA 2YNGA 5HRSA 3TAPA 3HM8A 2RHKA 5F2RA 1YIJN 4E7HA 3VQDA 3K5NA 2LSNA 1VQLN 3F2KA 3O4QA 4WQ4C 4ID5A 4DTUA 4H0XB 3SZ2A 4NXMK 4JS4A 2ZWHA 3V1QA 3QNNA 4RCHA 4CZIA 5SWMA 1VAZA 2UU9K 1SL0A 4O8KA 4IO9L 2V7YA 4IO8A 3U9DA 2E1ZA 3MEGA 4ZHRA 4DFKA 1XQSC 4GW6A 4QS9A 1LCUA 2JWLA 2P9LA 3RMDA 4L8RB 3OYNA 1NK9A 4DKWA 1D9DA 3T1AA 2F9TA 2D5RA 3KK7A 4KI6A 5AFUH 1VRTA 4LC9B 3J81O 2W6LA 3FZHA 5C2DA 2ZGZA 1BI4B 4A5BA 3VEXA 1QSLA 5B8HA 3NGZA 2HBLA 3HTVA 4IDKA 4X62K 4WFNL 4CJ5A 3SQ4A 3OYCA 3BF3A 3MXMA 4BC2A 4Z4GA 5AJ3K 1YJNN 2OTLN 3H1VX 1J9AA 4KAZA 4RG8A 1RT4A 5BPMA 4KI4A 5M1QA 4OGCA 1HNIA 2CGLA 4ILJA 4FOEA 1OH5A 1L3UA 4FK4A 1HNWK 4DSJA 3O5BA 3CFOA 4KHUA 4DTXA 4O5BA 4YOTA 1E3MA 2O4GA 2P9KA 2ITGA 1NJZA 5DK5A 3LANA 4BGBA 1WBDA 5F0XA 4GV9A 3EZ5A 4H5NA 1VQNN 3ZT3A 2FBYA 4K8XA 3ZT2A 2O8DB 2D1KA 1K6YA 3CCSN 3GG4A 3C0BA 3CJ7A 3H3OB 2BTFA 4RW8A 2QKBA 3WEEA 4JI3K 4DG1A 3HP9A 3E01A 2G8UA 4B9MA 1JLBA 2NRHA 4DF4A 2UXCK 4YOWA 4MQ3A 4E89A 1KLMA 3K5LA 1LOTB 5M1FA 3WNHA 2W6KA 4GVMA 2EX3A 3R8EA 5GINA 3J80O 3HSCA 5E41A 1XUPO 3OHRA 2FSKA 3KJVA 3AVKA 3CCQN 1NU0A 3VEVA 4LF7K 3P39A 2KFNA 3IRXA 1HYVA 1IBMK 1RDCA 3EKSA 1WBBA 3VQAA 3PUFA 4M42A 2HVHA 4JKHA 3THWB 4FLXA 4CD3A 4DSIA 3KK3A 3LWLA 3DOLA 4N76A 3NBPA 1NK6A 4FLZA 3QESA 1UA1A 4E7KA 3R1XA 3LDLA 2D0BA 3ENBA 1EX4A 4AHCA 2A42A 3L4QA 3QEXA 4JK7A 1JKHA 5CYQA 3OYKA 2RPIA 1NK8A 4AHUA 3VEOA 4PHTX 3LZIA 2OYQA 4DQPA 3VQPA 3QO9A 2F96A 3CCLN 1C1AA 1IBKK 3M6GA 2Y1JA 4DTOA 2E1YA 1SZ2A 5LL6Z 1GLDG 4YNQA 3QEPA 4G1QA 1WN7A 2HOEA 3SV3A 4PQUA 3ZSQA 2HSTA 3PX0A 4OKKA 3OTOK 1MWKA 2E4LA 3GBTA 2ZJPL 2BDPA 4MFBA 2RN2A 5JS1A 3TU5A 4I2QA 4O0JA 1U4BA 2ZE2A 4CF2A 3BDPA 2E2PA 1S1WA 3OS2A 3BGRA 4PKIA 1ATNA 1KC8O 5C0YA 4NLBA 2O8CB 4CW7B 4GV3A 2OANA 4H5RA 3ENHA 1U45A 1U6ZA 4DFPA 2Z1HA 3BF1A 3HYFA 2GWKA 4FCYA 3VA0A 3BZCA 4BRQA 3CFPA 2ZGYA 4CJVA 1VSEA 4B9QA 4A2BA 3OYDA 3GDQA 4L3QA 1B9FA 4AF1A 3SPZA 4FLYA 4CJTA 4ICLA 5AFUA 4HTUA 1KAXA 3CJ1A 5EOYA 2QKKA 1X9JA 2JLEA 1JXBA 5HBMA 3VGMA 4PWDA 4FWSA 2HNDA 4CZMA 3ZLJA 1WNSA 3EY1A 3O1BA 2Q0UA 2QWRA 3TSQA 2VGMA 1C0MA 2I5JA 4KKOA 3CM5A 4JI6K 4CEAA 1XHXA 3DLLL 3UKRB 3RMBA 3DJCA 2VG6A 3AARA 1XC3A 4Y1DA 3NH2A 2F4VK 4C8OA 2FLOA 1S3XA 3NHGA 4JRQA 4JKEA 3B6OA 4NYFA 3I33A 2HHVA 4XH5A 3H6EA 3NFAA 4GVEA 3TAGA 3AVLA 2J4RA 1JJ2M 3O4WA 2VG5A 3EZWA 3D2EB 2YNHA 4M3RA 2KTQA 3UB5A 4A62A 4BRMA 2HF4A 2Z1IA 1Z6RA 5DM7L 4FJMA 4NB4A 1HKBA 4FXDA 2VQEK 3SAGA 2D0PA 4FJIA 4HHTA 3SQ1A 1J53A 4CZGA 3SQ2A 1A5VA 3AO1A 2XO7A 1VSLA 3OBYA 5M1PA 5AZIB 2QWLA 1ZBSA 1Q81O 3M1FA 4FW1A 1WSJA 4KREA 1QZ5A 4HTLA 2P9PA 2FBVA 4FPAA 2I7PA 1KVCA 3AV9A 5HRRA 3AVMA 4CJQA 4B1VA 2Q2RA 2OPSA 1JLFA 4X65K 3TPQA 4PUOA 2UUAK 3VENA 5EY4A 4LF9K 4FK2A 3AVNA 1GLFO 1YUWA 2PZSA 3OYAA 1JL1A 1IO2A 5C15A 3P31A 3O3HA 3ZSRA 2PYJA 5TKWA 3WXMB 4JRPA 3I56N 2IGIA 3MAQA 4CHOA 1T03A 1KVBA 1NNEA 3AO4A 2YKNA 5CYMA 1UA0A 3OS0A 2O8CA 4KHPK 4CEBA 4FLVA 1Q9YA 4XEIA 4DR7K 4B9SA 1FKPA 1N34K 2YJFA 1GLAG 3CCEN 1UOCA 5AQSA 3QEIA 4FSVA 3U4LA 2P9UA 4LH5A 4FM2A 1NGCA 5JVHL 2FC0A 3HBTA 4CZFA 4ILHA 1KSPA 5J2MA 3V9WA 2QA4N 2ZQBA 1X1PA 3ULEA 4GY2B 3J7ZO 1KRPA 1HNVA 3CI5A 4ISEA 5JMVA 5LMUK 3MCAB 3CJBA 4DS4A 1KLNA 2O8FB 3HO1A 4I9LA 4R79A 4FWNA 4BGAA 3VQCA 4BRFA 3Q7CA 1T3VA 2RKIA 3H1QA 4DB3A 4FZZA 1NGBA 4BDYA 4CHQA 1HJOA 3LDSA 4FJ8A 4CIFA 1X9MA 1VQ5N 1U47A 3Q7BA 4B3SK 5FRMA 4CE9A 3H3NO 4CCHA 3DLBA 4BY9C 4CFBA 3VOVA 3PV8A 5EXWA 3O9UA 4OPHA 4BR7A 2O4IA 1HQEA 5GAHP 1VQ9N 4J8FA 2W42A 4JHDA 4CECA 2G8FA 2HHQA 4H8KA 1QQNA 4OJRA 3CCJN 4DV0K 1YJWN 1OVQA 1NOYA 1L3SA 4JYAK 3NVKA 1C0UA 4WQ4A 3DLRA 3T1HK 1FXXA 3RMCA 1NKEA 5FPDA 4CZJA 1VSHA 3VGKA 3KLHA 3DXKB 1RT2A 3MN6A 2E2QA 2ITMA 1GOAA 4CGFA 1N5YA 1NKCA 2E2OA 2P5OA 4JD2B 1DLOA 1FJGK 5J2QA 1NJYA 2QWQA 1QSSA 4M45A 3KLGA 3RTVA 1T7PA 2WONA 3ZSYA 3AVAA 4OPJA 4CEOA 3K57A 5KPTA 5BRFA 3L2RA 1YTAA 5GIPA 1QE1A 4Y1CA 2KZMA 3VA3A 3L2VA 3NDKA 4O44A 1NG9A 1ZBUA 4IOCL 3SYZA 3GE1A 2OPQA 2PFUA 4QAGA 1TKDA 4B1UB 1I39A 2G8HA 3SUPA 4RW4A 2P1JA 3LP1A 3ZX2A 3I0SA 3KLIA 4WE1A 5AQJA 5LJVA 2HHHK 5HOOA 4M3UA 4E0DA 1QVGM 4FO0A 3NF6A 3OYGA 4DTMA 1S6QA 3RWUA 2KQ2A 4E1JA 4CGGA 3IUCA 3DLKA 3E9PA 4HUFA 3QLHA 1S1UA 5KPZA 5BN9A 2QWOA 3O9TA 5AQHA 4BRAA 1U49A 4BG9A 1RBUA 1ATRA 3L2QA 3P4IA 3R9PA 1DTTA 2A1SA 4WFBL 1XI1A 1W97L 3CQXA 5AZIA 4F8RA 2HHWA 3TR8A 1XMOK 3C7NA 1T6DA 1W0HA 4LF5K 2HB5A 1CZAN 3L0QA 1NGDA 5EVZA 3VQEA 1BA0A 4DV1K 3CG7A 2D4WA 3O9RA 2P9IB 1A5XA 5JS2A 4FJKA 3ZT1A 2P9IA 4OO1J 4CJ3A 3I8DA 5KRSA 1REVA 3ZETB 5CE3A 3DWLA 5BR9A 4QS8A 4N56A 1ZC6A 4EFHA 4XIUA 1KAYA 3E1YA 4FJ5A 3WXKA 3TABA 2JGUA 1J5EK 1UWBA 4B1WB 2IIRA 3QEVA 4CJLA 4RW7A 2VYPA 2GX9A 2V51B 4IG3A 4BRNA 4LFAK 4LF8K 3ITHA 3U8XA 3THYB 3AVJA 2PY5A 4F4KA 4BRCA 4UQGA 4PKHA 2HHXA 4KH4A 3CFRA 4CJ7A 1VSDA 4AHVA 1TL3A 1Y97A 1L3TA 2BE2A 1K8AO 4TSXA
chains in the Genus database with same CATH topology
4I9QA 4MFBA 2RN2A 3C95A 5JS1A 1NOZA 1QSYA 4I2QA 4FLTA 4O0JA 1U4BA 2A1RA 2ZE2A 3LP3A 1IKVA 1LW0A 4CF2A 1LWEA 3BDPA 3OS2A 1S1WA 2DFHA 3LAMA 4I7FA 4HUEA 2OA8A 3BGRA 4B9UA 3WNFA 3PO5A 2OZMA 4W5NA 2YV0X 1RBSA 2KZZA 3ZSZA 4N47A 1BGXT 2XY5A 5C24A 5CY4A 4CHNA 2HHUA 3TAEA 1EXQA 4E1MA 2GBZA 2IOCA 3AA3A 1TV6A 3V81A 1U45A 4JLHA 1Z25A 3AVGA 3ASMA 2Z1HA 4DFPA 1JLQA 3HYFA 4FCYA 4IFYA 4B9TA 3VA0A 4HVJA 4CJEA 1BHLA 1LWCA 1TK5A 1RTJA 4AHRA 3CFPA 1QTMA 3UIQA 4PY5A 1A5WA 1JLCA 4CJVA 3V6DA 4B9LA 1VSEA 3IS9A 4KB1A 2X6NA 4DU1A 4DQIA 1VSJA 3U3GA 3O4NA 3OYDA 3LP0A 3D0PA 3CQ8A 1SKWA 4B9NA 3VQBA 1RT7A 1B9FA 3OYEA 1ASVA 4QCLA 1TK0A 1RBTA 1ZYQA 3SPZA 4LSLA 4F2RA 2E6MA 4CJTA 4ICLA 4FLYA 1Q9XA 3AVBA 4DSKA 1KCFA 3DMJA 3M8QA 4FLVA 3SUOA 3ZCMA 4J2EA 4M3WA 3L2UA 4DFMA 1C6VA 2FBTA 3K59A 3KKRA 4HTUA 3PY8A 4KTZA 2DFFA 3L3UA 1L5UA 2QKKA 3SCXA 3OY9A 1NKBA 4BACA 2BANA 2FBXA 2X6SA 1NK0A 3TAFA 4HCBA 2JLEA 1NK7A 4O0IA 3OYFA 5FDLA 1JXBA 1RCHA 5HBMA 5K14A 3AO2A 3NF9A 3V9UA 2HNZA 4CF9A 4PWDA 3KKSA 1ZBLA 2HNDA 1JL2A 3SQ0A 1L3VA 3HL8A 1DTQA 1WNSA 3CYMA 3EY1A 1RDBA 3QETA 1WAJA 2QXFA 1HYZA 1LAVA 1BCOA 4CJSA 3SPYA 4FLUA 5HLFA 1T05A 1C0MA 4KV8A 1LW2A 3TARA 2I5JA 3MECA 3OVNA 4FYDA 3OJUA 1ZBFA 4KKOA 3RRGA 4CIGA 1O1WA 3HVRA 3CM5A 4CEAA 3KTQA 4DWIA 1CXUA 1XHXA 4DLEA 1NJWA 5FROA 4H4MA 1RTDA 3DRPA 1KFSA 3AA2A 2IC3A 4KTWA 3RMBA 1FK9A 1HRHA 2AJQA 2VG6A 4GMJB 4DQRA 4KI4A 4CIEA 4Y1DA 3NH2A 4C8OA 3RRHA 3NHGA 4JRQA 1RDAA 3B6OA 4NYFA 1HJRA 1RTIA 4OKEA 2HHVA 5CZ2A 2QK9A 3NFAA 4KHNA 3DLGA 1NK5A 3TAGA 4W5TA 1S5JA 1GOCA 3DRRA 1S1TA 1B9DA 3AVLA 4CJ4A 5KTQA 3HT3A 2XHBA 4FJ7A 4QOZB 4DU4A 2G8WA 4DTRA 1RILA 3A2FA 3NH1A 4ELTA 2VG5A 2KTQA 4CEZA 2YNHA 4M3RA 4E19A 4CJFA 1U48A 4JS5A 3OS1A 3KD5E 3LPTA 3VQ8A 3WNEA 2F8TA 4ID1A 3KK2A 4BWJA 1MU2A 4CHZA 2E6LA 4Z4EA 2D0AA 2HW3A 2Z1IA 1ASUA 1S1VA 4BDZA 3TI0A 5DMRA 4BWMA 4CK3A 4C8KA 4W5QA 3OYHA 4FJMA 4LSNA 1B92A 4FXDA 4RW9A 3VQ4A 1TVRA 4FZXC 1D8YA 2YHAA 5HRPA 4ELUA 4FJIA 4DTNA 2KW4A 4HHTA 3RR8A 4CFDA 3ZSWA 3SQ1A 4KHYA 1J53A 4C8MA 3SQ2A 1SUQA 3D45A 4DQSA 3ZSXA 1A5VA 3AO1A 4FZYA 2OPPA 5T7BA 2XO7A 1VSLA 4Z4IA 2RF2A 1IKYA 3RMAA 3MEDA 1SV5A 4FW1A 3I0RA 5C42A 1KFDA 1WSJA 4PA1A 3SJJA 4J2BA 2XRIA 3F73A 4KREA 4DFJA 4FJ9A 1WAFA 1SL1A 1KVAA 2FBVA 2DFEA 4M3YA 1KVCA 3AV9A 1C1BA 5HRRA 3AVMA 4CJQA 4ZTJA 4FM1A 2OPSA 3JYTA 1JLFA 3IG1A 4F2SA 3AA4A 4B8CA 4CF0A 3EYZA 3TWHA 3HM9A 4PUOA 3P5JA 4M3ZA 2G8IA 3DLEA 4KHQA 4Q0BA 3LAKA 1BQNA 1RNHA 4EZ9A 1YT3A 5KI6A 1C0TA 3IAYA 1QQCA 3AVNA 4FK2A 4E1NA 2PZSA 3OYAA 4DTPA 3OYLA 4CESA 1JL1A 1IO2A 3AO3A 2YKMA 4Z4CA 3O3HA 1RT5A 3LPUA 4CGIA 3S3NA 3OJSA 3ZSRA 2PYJA 3C6TA 1SL2A 5I42A 4H4OA 3ZT4A 4CGJA 4JRPA 3QNOA 2IGIA 4LH4A 1WSEA 1JLEA 4B9VA 2X74A 3HXMA 2BGGA 3MAQA 4CHOA 2OPRA 5I3UA 1LWFA 1T03A 1KVBA 4BDPA 4EZ6A 4HCCA 2IS3A 3MXIA 3AO4A 5FRNA 4F3OA 2YKNA 5KGXA 4CEQA 5CYMA 2Z1GA 1UA0A 1TKXA 4LY7A 3OS0A 4KHSA 3VN5A 2X78A 3T19A 4CEBA 1Z26A 4OVLA 4NCGA 4B8AB 4CJPA 4CEEA 1WSHA 2B4JA 1FKOA 2VWJA 4CF1A 1R0AA 3H08A 2XY7A 4KPYA 4B9SA 1FKPA 1WSIA 1SKSA 2PYLA 4KHWA 3AVHA 4O55A 1HYSA 1VRUA 1UOCA 2YNFA 4DLGA 4FJLA 4E3SA 3M8PA 3QEIA 3V4IA 4KB0A 3SUQA 3DI6A 4LH5A 3NGYA 4DMNA 4FM2A 1QHTA 2WOMA 2B5JA 3VQ9A 4CFCA 3G10A 2FC0A 1D9FA 1WSGA 4Z4HA 1F21A 4FJGA 3HK2A 3KIOA 3P1GA 3M8RA 1KSPA 1TL1A 3LP2A 1NK4A 1C1CA 1BISA 1RT1A 3AO5A 4B08A 4N41A 5J2MA 4CF8A 3V9WA 2ZQBA 1X1PA 3VQ5A 1TAUA 5D3GA 3HPGA 1EKEA 1KRPA 1U04A 4OKJA 1HNVA 4CGDA 3V9ZA 1ZBIA 4DS4A 1KLNA 4BE2A 3HJFA 3PX4A 4W5OA 5J1EA 4I9LA 3VQQA 3HO1A 3HSTB 4FJNA 3DYAA 4DF8A 1HMVA 3VQCA 3OYIA 4M3TA 4CJKA 1XHZA 4HUGA 4AHTA 4DS5A 3C6UA 3C94A 4CEDA 3S3MA 2RKIA 3DM2A 4EP4A 4KTQA 4FZZA 5CZ1A 3VQ7A 4AH9A 4BDYA 1BQMA 4CHQA 1I3AA 3LDSA 1WSFA 4DSFA 2YHBA 4FJ8A 4CJWA 4CIFA 4BE1A 1X9MA 3ISNC 1JLGA 1U47A 4NCAA 3KD1E 2DY4A 5FRMA 4CE9A 4CCHA 3LALA 3DLBA 4IBNA 4CFBA 3OYMA 3L2WA 4NYNA 3PV8A 1RDDA 2G8KA 3ALYA 4CHPA 1CZ9A 1CLQA 1VK0A 3NH0A 3NGIA 4I2PA 3ZSVA 1NJXA 1TKZA 2O4IA 1HQEA 4DU3A 2YNGA 5HRSA 3TAPA 3NE6A 2W42A 4CECA 4E7HA 2G8FA 3VQDA 3K5NA 2LSNA 3CM6A 3QINA 2HHQA 4H8KA 1VSFA 3FFIA 3O4QA 2KFZA 4ID5A 4DTUA 3TANA 3KK1A 3HVTA 1QS4A 4OJRA 4OGEA 2GV9A 4BE0A 3SZ2A 3NAEA 3NF7A 3ZT0A 4JS4A 3U6FA 3V1QA 3QNNA 3TAQA 4FK0A 3MXJA 4Q5VA 3PX6A 1NOYA 1L3SA 4C8NA 5SWMA 1ZBHA 4CK1A 1C0UA 1LAWA 1RBRA 3AA5X 3DLRA 3QIOA 1SL0A 1GOBA 1FXXA 4K8ZA 2DTUA 3RMCA 1X9WA 1NKEA 1JXEA 1VSHA 3KLHA 4CGHA 4CGFA 1RT2A 1TKTA 1SKRA 1GOAA 3MEGA 4ZHRA 1YTUA 3U3YA 4DFKA 1NKCA 1N5YA 1EP4A 3V1RA 3DRSA 2P5OA 3K58A 4DQQA 4GW6A 1DLOA 1CZBA 5J2QA 4E7JA 3RMDA 3VQ6A 3OYJA 1NJYA 1QSSA 4J2DA 4L8RB 3OYNA 2HHTA 1NK9A 3SV4A 1D9DA 3T1AA 4M45A 1TGOA 2D5RA 4KI6A 4M41A 3KLGA 3K5MA 1VRTA 3RTVA 2XY6A 5SZTA 4KO0A 3L8BA 1J5OA 1T7PA 1BI4B 2HNYA 2WONA 1T8EA 3ZSYA 3AVAA 3DOKA 4OPJA 1QSLA 4CEOA 3NGZA 1S9GA 3K57A 4IDKA 3QEWA 1BIZA 3RR7A 1BI4A 4CJ5A 3SI6A 2OZSA 3SQ4A 3OYCA 3L2RA 2HHSA 1YTAA 3F9KA 1IKXA 2IAJA 3MXMA 1W9HA 4C8LA 4R5PA 5KGWA 3O3FA 1QE1A 4Y1CA 4Z4GA 1TAQA 2KZMA 4E7LA 3VA3A 3WNGA 3L2VA 1LV5A 3NDKA 4O44A 1JLAA 1ZBUA 4F3TA 3SYZA 4DSLA 1J9AA 1CXQA 4DSEA 4KAZA 2OPQA 4RG8A 1RT4A 4QAGA 2R7YA 1EETA 4ZTFA 1RTHA 1TKDA 2GUIA 3AVFA 4OGCA 1HNIA 1I39A 3ZSOA 4CK2A 3SUPA 1L3UA 1N6QA 1S9EA 4CFAA 4DTJA 2G8HA 4FK4A 1D5AA 3G0ZA 1ASWA 1HQUA 2P51A 4RW4A 4DSJA 4B3OA 2P1JA 2D0CA 3CFOA 4KHUA 4DTXA 4O5BA 3LP1A 4FJXA 4FVMA 1IH7A 3I0SA 2O4GA 3HPHA 3LWMA 2ITGA 4DTSA 3SUNA 3KLIA 1NJZA 5DK5A 3LANA 4WE1A 5J2PA 3K5OA 5KRTA 3EZ5A 4M3UA 4E0DA 3ZT3A 2FBYA 1XC9A 4K8XA 3NF6A 3ZT2A 3OYGA 4DTMA 4NCBA 1Q8IA 1S6QA 1K6YA 3HPOA 3V9XA 1VSKA 3RWUA 2VG7A 1IG9A 1S6PA 4RW8A 2QKBA 2KQ2A 3THVA 4CGGA 3SNNA 4DG1A 4FJHA 3HP9A 3E01A 2G8UA 4B9MA 3K2PA 3DLKA 4FW2A 3JSMA 4HUFA 2F8SA 3QLHA 1S1XA 1ITGA 1JLBA 1S1UA 4DF4A 2BDPA 2NUBA 3HP6A 3OYBA 4IFVA 4CEFA 3S3OA 4Z4FA 3V9SA 4CJRA 1U49A 3MEEA 4MQ3A 1RBUA 4E89A 3L2QA 1KLMA 3KLEA 3K5LA 5HP1A 3AVCA 3WNHA 4E7IA 1DTTA 3S9HA 2A1SA 4LD0A 2HMIA 4GVMA 2EX3A 1X9SA 4KRFA 5J2NA 1RT3A 3QERA 5E41A 1XI1A 3KJVA 2ETJA 4F8RA 3TR8A 2HHWA 3TAMA 3AVIA 3AVKA 1G15A 4Z0UA 2EHGA 1W0HA 4AILC 2ZD1A 3M8SA 2KFNA 3IRXA 2HB5A 1HYVA 4IKFA 2HVIA 1TK8A 3VQEA 4CERA 1RDCA 3KLFA 3ULDA 3LZJA 3PO4A 3CG7A 3O3GA 4FM0A 2IDOA 3VQAA 2XY8A 3PUFA 1BIUA 4AHSA 5HROA 1A5XA 1BL3A 4M42A 2HVHA 5JS2A 4FJKA 3L3VA 4ELVA 3ZT1A 4CJ3A 3I8DA 1RBVA 4YFUA 2Q3SA 5EU7A 1REVA 5KRSA 4W5RA 4OLBA 3P83D 1YVUA 4FLXA 4DSIA 4M3XA 3KK3A 2VWKA 3LWLA 3DOLA 4N76A 2Y1IA 4EP5A 4N56A 4XIUA 2G8VA 3DLHA 3NBPA 1NK6A 2ATQA 4FLZA 4OPKA 3T3FA 3QESA 4FLWA 1RT6A 4FJ5A 4J2AA 2YNIA 4E7KA 1UA1A 1UAXA 3TABA 2JGUA 2D0BA 4FJJA 4KFBA 1UWBA 4OLAA 1EX4A 4AHCA 3QEVA 5C25A 4CJLA 4N5SA 1VSIA 3NCIA 3QEXA 1JKHA 5CYQA 3NF8A 3OYKA 4CJUA 2RPIA 1NK8A 4AHUA 2B6AA 3LZIA 4DQPA 2OYQA 4RW7A 2P5GA 3VQPA 3QO9A 2F96A 4CHYA 1C1AA 4IG0A 1WLJA 1KTQA 2Y1JA 4IG3A 4DTOA 1Q9YA 2Z1JA 1IKWA 1BCMA 3B6PA 3ITHA 3V1OA 3AVJA 2PY5A 4F4KA 1HPZA 4UQGA 4O4GA 3CFRA 2HHXA 4YNQA 3QEPA 1XWLA 1J54A 1WN7A 4G1QA 1VSDA 4AHVA 1TL3A 1Y97A 3SV3A 1L3TA 4PQUA 3ZSQA 3PX0A 3QIPA 2BE2A 4OKKA 2E4LA 1VSMA 5HRNA 4RW6A 4TSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I9Q A;  4MFB A;  2RN2 A;  3C95 A;  5JS1 A;  1NOZ A;  1QSY A;  4I2Q A;  4FLT A;  4O0J A;  1U4B A;  2A1R A;  2ZE2 A;  3LP3 A;  1IKV A;  1LW0 A;  4CF2 A;  1LWE A;  3BDP A;  3OS2 A;  1S1W A;  2DFH A;  3LAM A;  4I7F A;  4HUE A;  2OA8 A;  3BGR A;  4B9U A;  3WNF A;  3PO5 A;  2OZM A;  4W5N A;  2YV0 X;  1RBS A;  2KZZ A;  3ZSZ A;  4N47 A;  1BGX T;  2XY5 A;  5C24 A;  5CY4 A;  4CHN A;  2HHU A;  3TAE A;  1EXQ A;  4E1M A;  2GBZ A;  2IOC A;  3AA3 A;  1TV6 A;  3V81 A;  1U45 A;  4JLH A;  1Z25 A;  3AVG A;  3ASM A;  2Z1H A;  4DFP A;  1JLQ A;  3HYF A;  4FCY A;  4IFY A;  4B9T A;  3VA0 A;  4HVJ A;  4CJE A;  1BHL A;  1LWC A;  1TK5 A;  1RTJ A;  4AHR A;  3CFP A;  1QTM A;  3UIQ A;  4PY5 A;  1A5W A;  1JLC A;  4CJV A;  3V6D A;  4B9L A;  1VSE A;  3IS9 A;  4KB1 A;  2X6N A;  4DU1 A;  4DQI A;  1VSJ A;  3U3G A;  3O4N A;  3OYD A;  3LP0 A;  3D0P A;  3CQ8 A;  1SKW A;  4B9N A;  3VQB A;  1RT7 A;  1B9F A;  3OYE A;  1ASV A;  4QCL A;  1TK0 A;  1RBT A;  1ZYQ A;  3SPZ A;  4LSL A;  4F2R A;  2E6M A;  4CJT A;  4ICL A;  4FLY A;  1Q9X A;  3AVB A;  4DSK A;  1KCF A;  3DMJ A;  3M8Q A;  4FLV A;  3SUO A;  3ZCM A;  4J2E A;  4M3W A;  3L2U A;  4DFM A;  1C6V A;  2FBT A;  3K59 A;  3KKR A;  4HTU A;  3PY8 A;  4KTZ A;  2DFF A;  3L3U A;  1L5U A;  2QKK A;  3SCX A;  3OY9 A;  1NKB A;  4BAC A;  2BAN A;  2FBX A;  2X6S A;  1NK0 A;  3TAF A;  4HCB A;  2JLE A;  1NK7 A;  4O0I A;  3OYF A;  5FDL A;  1JXB A;  1RCH A;  5HBM A;  5K14 A;  3AO2 A;  3NF9 A;  3V9U A;  2HNZ A;  4CF9 A;  4PWD A;  3KKS A;  1ZBL A;  2HND A;  1JL2 A;  3SQ0 A;  1L3V A;  3HL8 A;  1DTQ A;  1WNS A;  3CYM A;  3EY1 A;  1RDB A;  3QET A;  1WAJ A;  2QXF A;  1HYZ A;  1LAV A;  1BCO A;  4CJS A;  3SPY A;  4FLU A;  5HLF A;  1T05 A;  1C0M A;  4KV8 A;  1LW2 A;  3TAR A;  2I5J A;  3MEC A;  3OVN A;  4FYD A;  3OJU A;  1ZBF A;  4KKO A;  3RRG A;  4CIG A;  1O1W A;  3HVR A;  3CM5 A;  4CEA A;  3KTQ A;  4DWI A;  1CXU A;  1XHX A;  4DLE A;  1NJW A;  5FRO A;  4H4M A;  1RTD A;  3DRP A;  1KFS A;  3AA2 A;  2IC3 A;  4KTW A;  3RMB A;  1FK9 A;  1HRH A;  2AJQ A;  2VG6 A;  4GMJ B;  4DQR A;  4KI4 A;  4CIE A;  4Y1D A;  3NH2 A;  4C8O A;  3RRH A;  3NHG A;  4JRQ A;  1RDA A;  3B6O A;  4NYF A;  1HJR A;  1RTI A;  4OKE A;  2HHV A;  5CZ2 A;  2QK9 A;  3NFA A;  4KHN A;  3DLG A;  1NK5 A;  3TAG A;  4W5T A;  1S5J A;  1GOC A;  3DRR A;  1S1T A;  1B9D A;  3AVL A;  4CJ4 A;  5KTQ A;  3HT3 A;  2XHB A;  4FJ7 A;  4QOZ B;  4DU4 A;  2G8W A;  4DTR A;  1RIL A;  3A2F A;  3NH1 A;  4ELT A;  2VG5 A;  2KTQ A;  4CEZ A;  2YNH A;  4M3R A;  4E19 A;  4CJF A;  1U48 A;  4JS5 A;  3OS1 A;  3KD5 E;  3LPT A;  3VQ8 A;  3WNE A;  2F8T A;  4ID1 A;  3KK2 A;  4BWJ A;  1MU2 A;  4CHZ A;  2E6L A;  4Z4E A;  2D0A A;  2HW3 A;  2Z1I A;  1ASU A;  1S1V A;  4BDZ A;  3TI0 A;  5DMR A;  4BWM A;  4CK3 A;  4C8K A;  4W5Q A;  3OYH A;  4FJM A;  4LSN A;  1B92 A;  4FXD A;  4RW9 A;  3VQ4 A;  1TVR A;  4FZX C;  1D8Y A;  2YHA A;  5HRP A;  4ELU A;  4FJI A;  4DTN A;  2KW4 A;  4HHT A;  3RR8 A;  4CFD A;  3ZSW A;  3SQ1 A;  4KHY A;  1J53 A;  4C8M A;  3SQ2 A;  1SUQ A;  3D45 A;  4DQS A;  3ZSX A;  1A5V A;  3AO1 A;  4FZY A;  2OPP A;  5T7B A;  2XO7 A;  1VSL A;  4Z4I A;  2RF2 A;  1IKY A;  3RMA A;  3MED A;  1SV5 A;  4FW1 A;  3I0R A;  5C42 A;  1KFD A;  1WSJ A;  4PA1 A;  3SJJ A;  4J2B A;  2XRI A;  3F73 A;  4KRE A;  4DFJ A;  4FJ9 A;  1WAF A;  1SL1 A;  1KVA A;  2FBV A;  2DFE A;  4M3Y A;  1KVC A;  3AV9 A;  1C1B A;  5HRR A;  3AVM A;  4CJQ A;  4ZTJ A;  4FM1 A;  2OPS A;  3JYT A;  1JLF A;  3IG1 A;  4F2S A;  3AA4 A;  4B8C A;  4CF0 A;  3EYZ A;  3TWH A;  3HM9 A;  4PUO A;  3P5J A;  4M3Z A;  2G8I A;  3DLE A;  4KHQ A;  4Q0B A;  3LAK A;  1BQN A;  1RNH A;  4EZ9 A;  1YT3 A;  5KI6 A;  1C0T A;  3IAY A;  1QQC A;  3AVN A;  4FK2 A;  4E1N A;  2PZS A;  3OYA A;  4DTP A;  3OYL A;  4CES A;  1JL1 A;  1IO2 A;  3AO3 A;  2YKM A;  4Z4C A;  3O3H A;  1RT5 A;  3LPU A;  4CGI A;  3S3N A;  3OJS A;  3ZSR A;  2PYJ A;  3C6T A;  1SL2 A;  5I42 A;  4H4O A;  3ZT4 A;  4CGJ A;  4JRP A;  3QNO A;  2IGI A;  4LH4 A;  1WSE A;  1JLE A;  4B9V A;  2X74 A;  3HXM A;  2BGG A;  3MAQ A;  4CHO A;  2OPR A;  5I3U A;  1LWF A;  1T03 A;  1KVB A;  4BDP A;  4EZ6 A;  4HCC A;  2IS3 A;  3MXI A;  3AO4 A;  5FRN A;  4F3O A;  2YKN A;  5KGX A;  4CEQ A;  5CYM A;  2Z1G A;  1UA0 A;  1TKX A;  4LY7 A;  3OS0 A;  4KHS A;  3VN5 A;  2X78 A;  3T19 A;  4CEB A;  1Z26 A;  4OVL A;  4NCG A;  4B8A B;  4CJP A;  4CEE A;  1WSH A;  2B4J A;  1FKO A;  2VWJ A;  4CF1 A;  1R0A A;  3H08 A;  2XY7 A;  4KPY A;  4B9S A;  1FKP A;  1WSI A;  1SKS A;  2PYL A;  4KHW A;  3AVH A;  4O55 A;  1HYS A;  1VRU A;  1UOC A;  2YNF A;  4DLG A;  4FJL A;  4E3S A;  3M8P A;  3QEI A;  3V4I A;  4KB0 A;  3SUQ A;  3DI6 A;  4LH5 A;  3NGY A;  4DMN A;  4FM2 A;  1QHT A;  2WOM A;  2B5J A;  3VQ9 A;  4CFC A;  3G10 A;  2FC0 A;  1D9F A;  1WSG A;  4Z4H A;  1F21 A;  4FJG A;  3HK2 A;  3KIO A;  3P1G A;  3M8R A;  1KSP A;  1TL1 A;  3LP2 A;  1NK4 A;  1C1C A;  1BIS A;  1RT1 A;  3AO5 A;  4B08 A;  4N41 A;  5J2M A;  4CF8 A;  3V9W A;  2ZQB A;  1X1P A;  3VQ5 A;  1TAU A;  5D3G A;  3HPG A;  1EKE A;  1KRP A;  1U04 A;  4OKJ A;  1HNV A;  4CGD A;  3V9Z A;  1ZBI A;  4DS4 A;  1KLN A;  4BE2 A;  3HJF A;  3PX4 A;  4W5O A;  5J1E A;  4I9L A;  3VQQ A;  3HO1 A;  3HST B;  4FJN A;  3DYA A;  4DF8 A;  1HMV A;  3VQC A;  3OYI A;  4M3T A;  4CJK A;  1XHZ A;  4HUG A;  4AHT A;  4DS5 A;  3C6U A;  3C94 A;  4CED A;  3S3M A;  2RKI A;  3DM2 A;  4EP4 A;  4KTQ A;  4FZZ A;  5CZ1 A;  3VQ7 A;  4AH9 A;  4BDY A;  1BQM A;  4CHQ A;  1I3A A;  3LDS A;  1WSF A;  4DSF A;  2YHB A;  4FJ8 A;  4CJW A;  4CIF A;  4BE1 A;  1X9M A;  3ISN C;  1JLG A;  1U47 A;  4NCA A;  3KD1 E;  2DY4 A;  5FRM A;  4CE9 A;  4CCH A;  3LAL A;  3DLB A;  4IBN A;  4CFB A;  3OYM A;  3L2W A;  4NYN A;  3PV8 A;  1RDD A;  2G8K A;  3ALY A;  4CHP A;  1CZ9 A;  1CLQ A;  1VK0 A;  3NH0 A;  3NGI A;  4I2P A;  3ZSV A;  1NJX A;  1TKZ A;  2O4I A;  1HQE A;  4DU3 A;  2YNG A;  5HRS A;  3TAP A;  3NE6 A;  2W42 A;  4CEC A;  4E7H A;  2G8F A;  3VQD A;  3K5N A;  2LSN A;  3CM6 A;  3QIN A;  2HHQ A;  4H8K A;  1VSF A;  3FFI A;  3O4Q A;  2KFZ A;  4ID5 A;  4DTU A;  3TAN A;  3KK1 A;  3HVT A;  1QS4 A;  4OJR A;  4OGE A;  2GV9 A;  4BE0 A;  3SZ2 A;  3NAE A;  3NF7 A;  3ZT0 A;  4JS4 A;  3U6F A;  3V1Q A;  3QNN A;  3TAQ A;  4FK0 A;  3MXJ A;  4Q5V A;  3PX6 A;  1NOY A;  1L3S A;  4C8N A;  5SWM A;  1ZBH A;  4CK1 A;  1C0U A;  1LAW A;  1RBR A;  3AA5 X;  3DLR A;  3QIO A;  1SL0 A;  1GOB A;  1FXX A;  4K8Z A;  2DTU A;  3RMC A;  1X9W A;  1NKE A;  1JXE A;  1VSH A;  3KLH A;  4CGH A;  4CGF A;  1RT2 A;  1TKT A;  1SKR A;  1GOA A;  3MEG A;  4ZHR A;  1YTU A;  3U3Y A;  4DFK A;  1NKC A;  1N5Y A;  1EP4 A;  3V1R A;  3DRS A;  2P5O A;  3K58 A;  4DQQ A;  4GW6 A;  1DLO A;  1CZB A;  5J2Q A;  4E7J A;  3RMD A;  3VQ6 A;  3OYJ A;  1NJY A;  1QSS A;  4J2D A;  4L8R B;  3OYN A;  2HHT A;  1NK9 A;  3SV4 A;  1D9D A;  3T1A A;  4M45 A;  1TGO A;  2D5R A;  4KI6 A;  4M41 A;  3KLG A;  3K5M A;  1VRT A;  3RTV A;  2XY6 A;  5SZT A;  4KO0 A;  3L8B A;  1J5O A;  1T7P A;  1BI4 B;  2HNY A;  2WON A;  1T8E A;  3ZSY A;  3AVA A;  3DOK A;  4OPJ A;  1QSL A;  4CEO A;  3NGZ A;  1S9G A;  3K57 A;  4IDK A;  3QEW A;  1BIZ A;  3RR7 A;  1BI4 A;  4CJ5 A;  3SI6 A;  2OZS A;  3SQ4 A;  3OYC A;  3L2R A;  2HHS A;  1YTA A;  3F9K A;  1IKX A;  2IAJ A;  3MXM A;  1W9H A;  4C8L A;  4R5P A;  5KGW A;  3O3F A;  1QE1 A;  4Y1C A;  4Z4G A;  1TAQ A;  2KZM A;  4E7L A;  3VA3 A;  3WNG A;  3L2V A;  1LV5 A;  3NDK A;  4O44 A;  1JLA A;  1ZBU A;  4F3T A;  3SYZ A;  4DSL A;  1J9A A;  1CXQ A;  4DSE A;  4KAZ A;  2OPQ A;  4RG8 A;  1RT4 A;  4QAG A;  2R7Y A;  1EET A;  4ZTF A;  1RTH A;  1TKD A;  2GUI A;  3AVF A;  4OGC A;  1HNI A;  1I39 A;  3ZSO A;  4CK2 A;  3SUP A;  1L3U A;  1N6Q A;  1S9E A;  4CFA A;  4DTJ A;  2G8H A;  4FK4 A;  1D5A A;  3G0Z A;  1ASW A;  1HQU A;  2P51 A;  4RW4 A;  4DSJ A;  4B3O A;  2P1J A;  2D0C A;  3CFO A;  4KHU A;  4DTX A;  4O5B A;  3LP1 A;  4FJX A;  4FVM A;  1IH7 A;  3I0S A;  2O4G A;  3HPH A;  3LWM A;  2ITG A;  4DTS A;  3SUN A;  3KLI A;  1NJZ A;  5DK5 A;  3LAN A;  4WE1 A;  5J2P A;  3K5O A;  5KRT A;  3EZ5 A;  4M3U A;  4E0D A;  3ZT3 A;  2FBY A;  1XC9 A;  4K8X A;  3NF6 A;  3ZT2 A;  3OYG A;  4DTM A;  4NCB A;  1Q8I A;  1S6Q A;  1K6Y A;  3HPO A;  3V9X A;  1VSK A;  3RWU A;  2VG7 A;  1IG9 A;  1S6P A;  4RW8 A;  2QKB A;  2KQ2 A;  3THV A;  4CGG A;  3SNN A;  4DG1 A;  4FJH A;  3HP9 A;  3E01 A;  2G8U A;  4B9M A;  3K2P A;  3DLK A;  4FW2 A;  3JSM A;  4HUF A;  2F8S A;  3QLH A;  1S1X A;  1ITG A;  1JLB A;  1S1U A;  4DF4 A;  2BDP A;  2NUB A;  3HP6 A;  3OYB A;  4IFV A;  4CEF A;  3S3O A;  4Z4F A;  3V9S A;  4CJR A;  1U49 A;  3MEE A;  4MQ3 A;  1RBU A;  4E89 A;  3L2Q A;  1KLM A;  3KLE A;  3K5L A;  5HP1 A;  3AVC A;  3WNH A;  4E7I A;  1DTT A;  3S9H A;  2A1S A;  4LD0 A;  2HMI A;  4GVM A;  2EX3 A;  1X9S A;  4KRF A;  5J2N A;  1RT3 A;  3QER A;  5E41 A;  1XI1 A;  3KJV A;  2ETJ A;  4F8R A;  3TR8 A;  2HHW A;  3TAM A;  3AVI A;  3AVK A;  1G15 A;  4Z0U A;  2EHG A;  1W0H A;  4AIL C;  2ZD1 A;  3M8S A;  2KFN A;  3IRX A;  2HB5 A;  1HYV A;  4IKF A;  2HVI A;  1TK8 A;  3VQE A;  4CER A;  1RDC A;  3KLF A;  3ULD A;  3LZJ A;  3PO4 A;  3CG7 A;  3O3G A;  4FM0 A;  2IDO A;  3VQA A;  2XY8 A;  3PUF A;  1BIU A;  4AHS A;  5HRO A;  1A5X A;  1BL3 A;  4M42 A;  2HVH A;  5JS2 A;  4FJK A;  3L3V A;  4ELV A;  3ZT1 A;  4CJ3 A;  3I8D A;  1RBV A;  4YFU A;  2Q3S A;  5EU7 A;  1REV A;  5KRS A;  4W5R A;  4OLB A;  3P83 D;  1YVU A;  4FLX A;  4DSI A;  4M3X A;  3KK3 A;  2VWK A;  3LWL A;  3DOL A;  4N76 A;  2Y1I A;  4EP5 A;  4N56 A;  4XIU A;  2G8V A;  3DLH A;  3NBP A;  1NK6 A;  2ATQ A;  4FLZ A;  4OPK A;  3T3F A;  3QES A;  4FLW A;  1RT6 A;  4FJ5 A;  4J2A A;  2YNI A;  4E7K A;  1UA1 A;  1UAX A;  3TAB A;  2JGU A;  2D0B A;  4FJJ A;  4KFB A;  1UWB A;  4OLA A;  1EX4 A;  4AHC A;  3QEV A;  5C25 A;  4CJL A;  4N5S A;  1VSI A;  3NCI A;  3QEX A;  1JKH A;  5CYQ A;  3NF8 A;  3OYK A;  4CJU A;  2RPI A;  1NK8 A;  4AHU A;  2B6A A;  3LZI A;  4DQP A;  2OYQ A;  4RW7 A;  2P5G A;  3VQP A;  3QO9 A;  2F96 A;  4CHY A;  1C1A A;  4IG0 A;  1WLJ A;  1KTQ A;  2Y1J A;  4IG3 A;  4DTO A;  1Q9Y A;  2Z1J A;  1IKW A;  1BCM A;  3B6P A;  3ITH A;  3V1O A;  3AVJ A;  2PY5 A;  4F4K A;  1HPZ A;  4UQG A;  4O4G A;  3CFR A;  2HHX A;  4YNQ A;  3QEP A;  1XWL A;  1J54 A;  1WN7 A;  4G1Q A;  1VSD A;  4AHV A;  1TL3 A;  1Y97 A;  3SV3 A;  1L3T A;  4PQU A;  3ZSQ A;  3PX0 A;  3QIP A;  2BE2 A;  4OKK A;  2E4L A;  1VSM A;  5HRN A;  4RW6 A;  4TSX A; 
#chains in the Genus database with same CATH topology
 2W41 A;  1NOZ A;  2ZF5 O;  3VES A;  4A59 A;  4FVU A;  1LW0 A;  2ASP A;  2V52 B;  4HUE A;  3P38 A;  3WNF A;  1RBS A;  3KVG A;  1XNR K;  2V7Z A;  5AQN A;  2VGN A;  1YJ9 N;  5CY4 A;  3M5R A;  2HHU A;  1EXQ A;  2IOC A;  3QBW A;  4JLH A;  1Z25 A;  3AVG A;  4LF4 K;  4B9T A;  1TK5 A;  4AHR A;  4U67 L;  4PY5 A;  1A5W A;  1JLC A;  3V6D A;  3LDN A;  4K25 A;  2X6N A;  3O4N A;  3PIP L;  3FGU A;  3FZK A;  3A5N C;  4GNI A;  3IFR A;  3OYE A;  1ASV A;  3R3L A;  2O8E B;  2P9P B;  4JKB A;  1RBT A;  2E6M A;  4JAX A;  3CCV N;  4J2E A;  3DMJ A;  3HZ6 A;  2FBT A;  4PKG A;  3K59 A;  2BUP A;  1NKB A;  2FBX A;  3T69 A;  1BUP A;  1U2V B;  2E20 A;  3ENO A;  3G6E N;  1NK7 A;  5FDL A;  5K14 A;  3AO2 A;  4CF9 A;  3ZX3 A;  3KHY A;  1JL2 A;  4H0O A;  2NZT A;  4GV6 A;  3MN7 A;  1VQO N;  1DTQ A;  1RDB A;  3DAW A;  2QXF A;  5ELZ A;  1HYZ A;  4CJS A;  1BCO A;  1T05 A;  4KBO A;  1O13 A;  3EL2 A;  3HRG A;  4KV8 A;  4FYD A;  3THW A;  1VQ8 N;  1IV0 A;  4FWO A;  4YOU A;  2P9S B;  4JKC A;  5AZJ B;  5FRO A;  4H4M A;  4O5F A;  3AA2 A;  4CZH A;  4KH6 A;  1SAZ A;  1FK9 A;  1HRH A;  2AJQ A;  4BRO A;  2YHW A;  4CIE A;  4JI2 K;  1SS6 A;  1Q86 O;  3IKM A;  2AA4 A;  4BR4 A;  1HJR A;  4OKE A;  1JCF A;  2QK9 A;  4KHN A;  2KHO A;  1TYQ B;  1U2V A;  4JKD A;  1YI2 N;  5KTQ A;  4YOY A;  1OH6 A;  2XHB A;  1RFQ A;  4DTR A;  1RIL A;  2FF6 A;  4E19 A;  1U48 A;  3GOI A;  3OS1 A;  3LPT A;  3VQ8 A;  1YAG A;  4ID1 A;  5C10 A;  4CHZ A;  2E6L A;  1EO1 A;  2QW9 A;  3EKU A;  1QZ6 A;  1ASU A;  1S1V A;  4CK3 A;  3N4Q A;  4RW9 A;  1TVR A;  1T6C A;  4YOV A;  4ELU A;  5I9E B;  4DTN A;  3RR8 A;  4BQL A;  4KHY A;  3B8A X;  4IOA L;  2A40 A;  1K8K A;  2RF2 A;  3OW2 M;  3MED A;  3RMA A;  2PAV A;  1KFD A;  1K8K B;  3F73 A;  4DFJ A;  4FJ9 A;  3FFK B;  3WXI A;  5CHI A;  3CC7 N;  2DFE A;  3O8M A;  4JKF A;  4M3Y A;  3O08 A;  1C1B A;  4ZTJ A;  2GTD A;  4FM1 A;  4GKK K;  2FXU A;  3JYT A;  1I94 K;  4F2S A;  5AR0 A;  3C6A A;  3EYZ A;  3TWH A;  3P5J A;  4M3Z A;  4KHQ A;  4EZ9 A;  1RNH A;  3D6R A;  3EEQ A;  1OH8 A;  1C0T A;  2QXL A;  4E1N A;  1NBW A;  1KD1 O;  3J8A A;  4CES A;  4JKG A;  4G9Z A;  1RT5 A;  2W40 A;  3WXJ A;  3C6T A;  3VTH A;  5I42 A;  1D4X A;  4H4O A;  4H0V B;  2WBN A;  4MDB A;  2BGG A;  4C23 A;  2OPR A;  5M1O A;  1DEJ A;  1GLL O;  5FRN A;  3MN9 A;  3VPZ A;  4F3O A;  4CEQ A;  2E88 A;  1TKX A;  4F9O A;  3VN5 A;  3T19 A;  1Z26 A;  4OVL A;  4NCG A;  4CEE A;  1WSH A;  4H0Y B;  2VWJ A;  1YVN A;  4DV3 K;  4KPY A;  1WB9 A;  1WSI A;  4IZ9 A;  2PYL A;  5AQL A;  4LF6 K;  4O55 A;  4CBU A;  4X66 K;  1VRU A;  3AY9 A;  3KWG A;  4FJL A;  5BPN A;  4FOI A;  3VQ9 A;  3G10 A;  1D9F A;  4B1Z A;  4BR2 A;  3M8R A;  1VQ4 N;  1NGJ A;  1NK4 A;  4IFE A;  1RT1 A;  2YI1 A;  1VQ7 N;  4N41 A;  2KLA A;  3VQ5 A;  2A5X A;  3V9Z A;  4CGD A;  4DUZ K;  1DKG D;  4JI0 K;  4BE2 A;  3E9O A;  5C2F A;  3PX4 A;  5M1N A;  3VQQ A;  3HST B;  4DF8 A;  1BDG A;  2NLX A;  4DS5 A;  2OTJ N;  5BR8 K;  3S3M A;  3DM2 A;  4EP4 A;  4KTQ A;  1HLU A;  3VQ7 A;  4MDA A;  4NXN K;  1J6Z A;  4CJW A;  1JLG A;  3KD1 E;  2DY4 A;  1C0G A;  4BRG A;  3LAL A;  4NO7 A;  4CI6 A;  1HNX K;  3L2W A;  4CZK A;  3CHW A;  1RDD A;  1CLQ A;  1VK0 A;  4XH4 A;  3ZSV A;  2FSN A;  3CJA A;  1TKZ A;  4IDH A;  3NE6 A;  5GAD P;  1NLV A;  1HPM A;  3BP8 A;  4JEP A;  2KFZ A;  2AP1 A;  1P90 A;  4JK8 A;  3KK1 A;  1QS4 A;  4OGE A;  3LDQ A;  3NAE A;  3ZT0 A;  3CME N;  2O8B A;  3TAQ A;  3PSI A;  3FZF A;  3MXJ A;  5GAG P;  4Q5V A;  3I55 N;  4CK1 A;  4K8Z A;  1RBR A;  3QIO A;  2CGK A;  2DTU A;  3BZK A;  1C0F A;  1S72 N;  4Y0W A;  1TKT A;  3NMU A;  3TTF A;  1EP4 A;  3DRS A;  1QHA A;  3K58 A;  4DQQ A;  2JWK A;  1CZB A;  2ZJR L;  4E7J A;  3VQ6 A;  4J2D A;  4MLH A;  4B1X B;  2HF3 A;  4M41 A;  5KQD A;  2XY6 A;  4CBW A;  4KO0 A;  2O8B B;  3K9J A;  3DOK A;  1S9G A;  3AAP A;  3RR7 A;  1BI4 A;  1YHQ N;  2HHS A;  3F9K A;  2IAJ A;  3CF5 L;  4BR0 A;  1LV5 A;  1JLA A;  4F3T A;  4DSL A;  3LL3 A;  2YCH A;  1EET A;  2R7Y A;  1RTH A;  1N6Q A;  1TUU A;  4DTJ A;  4CD1 A;  1HQU A;  4B3O A;  3VF2 A;  2D0C A;  4DR3 K;  4FJX A;  1NGE A;  1IH7 A;  2RE2 A;  3HPH A;  3LWM A;  4DTS A;  3SUN A;  2QWN A;  1XC9 A;  3JAM O;  3THX B;  3V9X A;  5IT9 O;  1VSK A;  4H03 B;  3THV A;  3SNN A;  4FJH A;  5M1K A;  3JSM A;  3CET A;  4DV5 K;  1S1X A;  3K9K A;  2NUB A;  3HP6 A;  3OYB A;  4IFV A;  4CEF A;  5HL7 L;  3S3O A;  2A41 A;  4M7Y A;  3MEE A;  3KLE A;  4OPA A;  3RSE A;  4E7I A;  3S9H A;  3SBT A;  4FPB A;  2P9S A;  1X9S A;  1RT3 A;  2VCP A;  2ETJ A;  3TAM A;  3VEZ A;  3AVI A;  1G15 A;  4IJN A;  4AIL C;  3T1Y K;  2NRR A;  3FLC O;  2ZD1 A;  3M8S A;  3AAQ A;  4IKF A;  2HVI A;  3LZJ A;  1E4G T;  1NGH A;  3O3G A;  3BY5 A;  2XY8 A;  1BIU A;  4AHS A;  3PLA A;  3SK3 A;  5CR4 A;  3L3V A;  3K0S A;  3CQY A;  3J7Y P;  4OLB A;  3P83 D;  4M3X A;  3D2F B;  2Y1I A;  4RWT A;  4WQ5 A;  2G8V A;  1HX1 A;  1SQK A;  3SJH A;  3DLH A;  4LFB K;  4K43 A;  4OPK A;  1M90 O;  4J2A A;  2YNI A;  3BUZ B;  4IOX A;  4FJJ A;  1BA1 A;  1VSI A;  3E9L A;  3NF8 A;  2QM1 A;  1H1V A;  3WQT A;  1KTQ A;  2I7N A;  3B6P A;  3V1O A;  3WQU A;  1HPZ A;  2E2N A;  3QDK A;  4O4G A;  3QFP A;  1J54 A;  2Q36 A;  5C12 A;  3QIP A;  4RW6 A;  4FWK A;  4I9Q A;  3C95 A;  1QSY A;  3A5L C;  3EE8 A;  2A1R A;  1HUX A;  5BRD A;  4DR4 K;  3G71 N;  3C65 A;  1LWE A;  4M7X A;  2HMP A;  3G4S N;  2D0O A;  4B9U A;  3VEY A;  1IBL K;  3PO5 A;  2OZM A;  2YV0 X;  1W2B M;  3MK6 A;  3ZSZ A;  4UY8 O;  4GKJ K;  1BGX T;  2XY5 A;  5GIO A;  4KH5 A;  3O80 A;  3TSP A;  3TAE A;  4E1M A;  3AA3 A;  2DPN A;  5F1X A;  1JLQ A;  1YIT N;  2UUC K;  4HVJ A;  1BHL A;  1JCG A;  1LWC A;  1QTM A;  3HOT A;  3UIQ A;  3IS9 A;  5JLH A;  4DU1 A;  4WCE L;  2A6A A;  4DQI A;  1SKW A;  5EX5 A;  3D0P A;  3VQB A;  1RT7 A;  2Q1N A;  1N36 K;  3VTI A;  3HI0 A;  1ZYQ A;  4F2R A;  4B1Y B;  4EHU A;  5ADX A;  4DSK A;  1KCF A;  3M8Q A;  3ZCM A;  5E26 A;  2DFF A;  1L5U A;  1ATS A;  2UXB K;  3SCX A;  3OY9 A;  2WFB A;  2BAN A;  5IWA K;  2F9W A;  4YHH K;  4CZE A;  4HCB A;  1WUA A;  3MDQ A;  3NF9 A;  3V9U A;  1RGI A;  3SQ0 A;  1R59 O;  3CJ9 A;  3HL8 A;  1VQK N;  4JKG B;  1WAJ A;  5GAE P;  4FLU A;  4ISG A;  4HWI A;  3TAR A;  3OVN A;  3D2E A;  4BR5 A;  2Q31 A;  3RRG A;  4CIG A;  4DV2 K;  1RTD A;  3DRP A;  4AM7 A;  2IC3 A;  5BPL A;  4NLC A;  2QEX N;  4DQR A;  5AQW A;  1DGK N;  4A2A A;  4AQY K;  3O9Q A;  1RTI A;  3CIP A;  2YHY A;  2NNW A;  1NK5 A;  1S5J A;  3DRR A;  1S1T A;  1B9D A;  4CJ4 A;  4FJ7 A;  4YY3 K;  3HT3 A;  1OH7 A;  3MWT A;  2HBK A;  3A2F A;  3NH1 A;  4ELT A;  5LMN K;  4CEZ A;  4CJF A;  2F8T A;  3R6M A;  3WNE A;  4B3T K;  3QML A;  3KK2 A;  4BWJ A;  3CCM N;  2D0A A;  4YDU A;  4BDZ A;  3AGK A;  4BWM A;  4W5Q A;  3OYH A;  1N32 K;  2QWP A;  1BU6 O;  2UXD K;  5FPM A;  4H5T A;  4FZX C;  1D8Y A;  2YHA A;  3KWI A;  1OVY A;  5FPN A;  4EHT A;  2KW4 A;  4FWP A;  3ZSW A;  5BRH A;  4A5A A;  3IDH A;  3CD6 N;  4C8M A;  4BR9 A;  4ISF A;  5AQT A;  1NGI A;  3D45 A;  1TYQ A;  3AGR A;  3ZSX A;  4FZY A;  3H46 O;  3KZB A;  1IKY A;  1NJI O;  2IVP A;  3SJJ A;  5C42 A;  1VQ6 N;  2FSJ A;  4WYB A;  3RSE B;  1NGG A;  3QIC A;  1G99 A;  2Q0R A;  1HKG A;  5LY3 A;  3IG1 A;  3SAF A;  4B8C A;  4CF0 A;  1VHX A;  5AQO A;  3CPE A;  3DLE A;  3LAK A;  1BQN A;  3O9S A;  2YX6 A;  3ID6 A;  4EAH D;  3UE5 A;  3IAY A;  1QQC A;  3UKU B;  3LDP A;  3FR0 A;  4H0P A;  1EQY A;  4CGI A;  3OJS A;  1KQS M;  1SL2 A;  3WXL A;  3ZT4 A;  4CGJ A;  4LH4 A;  1GLJ O;  4JNE A;  4B9V A;  3OA9 A;  5AQV A;  3HXM A;  5I3U A;  1LWF A;  4BDP A;  2QWM A;  4EZ6 A;  2IS3 A;  3MXI A;  5KGX A;  5AQX A;  1ILY A;  4LY7 A;  4AM6 A;  1N33 K;  2X78 A;  4CFD A;  4CJP A;  2B4J A;  2NRT A;  4CF1 A;  3SMP A;  2XY7 A;  3CCU N;  1NWK A;  1Y64 A;  3QB0 A;  4I6M B;  4KHW A;  2P9L B;  1KAZ A;  4I6M A;  2YNF A;  4DLG A;  3M8P A;  4KB0 A;  3SUQ A;  3DI6 A;  5TKY A;  4JN4 A;  1QHT A;  1K9M O;  2VWB A;  4MO5 A;  3UKU A;  1MDU B;  3KIO A;  3P1G A;  3C7N B;  4U7B A;  1TL1 A;  3LP2 A;  4BRD A;  3AO5 A;  3CC2 N;  4JI4 K;  3TTD A;  3HPG A;  4EIA A;  1EKE A;  1HKC A;  1MWM A;  4OKJ A;  2OCE A;  1V4S A;  1ZBI A;  3HJF A;  2BH1 A;  4PL8 A;  1BO5 O;  4BRP A;  5J1E A;  1QQO A;  1OKJ A;  4DV7 K;  4BRH A;  4FJN A;  1HMV A;  1VQM N;  1Q7Y O;  4M3T A;  1IJJ A;  1KXP A;  3C6U A;  3C94 A;  1BG3 A;  5CZ1 A;  4AH9 A;  2PBD A;  1GLC G;  2YHB A;  3O6W A;  4BE1 A;  3A0I X;  4JD2 A;  4NCA A;  5FPE A;  5AQM A;  5FLX O;  4X64 K;  1BOT O;  4B3M K;  3ALY A;  4IJA A;  4CHP A;  1CZ9 A;  4DR6 K;  1E4F T;  2P9N B;  4DCH A;  1NJX A;  3WUH A;  4DU3 A;  5MLC Q;  3CM6 A;  3QIN A;  5AQY A;  4YOR A;  1VSF A;  3FFI A;  4BC3 A;  3TAN A;  3HVT A;  4BE0 A;  2GV9 A;  3NF7 A;  3U6F A;  4FK0 A;  3OBW A;  4BC4 A;  3PX6 A;  2P9K B;  4C8N A;  1ZBH A;  1LAW A;  2E8A A;  3AA5 X;  1GOB A;  3DXK A;  1X9W A;  1MA9 B;  1JXE A;  2UYT A;  1TUY A;  1BWF O;  4V19 S;  4CGH A;  4XH1 A;  3D2F A;  1SKR A;  2HBM A;  1YTU A;  3U3Y A;  5JIC A;  3V1R A;  2WTU A;  2CH5 A;  2HHT A;  3OYJ A;  1P8Z A;  4JHD B;  3EN9 A;  3SV4 A;  4JI8 K;  1TGO A;  3K5M A;  3G25 A;  3MX5 A;  5SZT A;  3L8B A;  1J5O A;  2HNY A;  1T8E A;  1N8R O;  4WFA L;  3QEW A;  1BIZ A;  1T44 A;  3SI6 A;  2OZS A;  2O8F A;  5KPR A;  1IKX A;  4C8L A;  1W9H A;  4K0K K;  4R5P A;  2GEM A;  5KGW A;  3O3F A;  1GLE G;  1TAQ A;  4E7L A;  3WNG A;  3CER A;  4DSE A;  1CXQ A;  1X3N A;  4ZTF A;  2GUI A;  4BQZ A;  3AVF A;  3ZSO A;  4CK2 A;  3THX A;  2CGJ A;  1VQP N;  1S9E A;  3JS6 A;  3VER A;  4CFA A;  1D5A A;  3G0Z A;  1ASW A;  2P51 A;  2KKZ A;  3CMA N;  4FVM A;  1RDW X;  4WF9 L;  5J2P A;  3K5O A;  2ASO A;  5KRT A;  4NCB A;  4IEE A;  1Q8I A;  3HPO A;  2VG7 A;  1IG9 A;  1S6P A;  2QTD A;  4DUY K;  3K2P A;  3MCP A;  4FW2 A;  2F8S A;  5AQI A;  1ITG A;  3H45 C;  4IEI A;  2P9U B;  4Z4F A;  3V9S A;  1ZXO A;  4CJR A;  3N4P A;  5HP1 A;  3ZYY X;  4YDU C;  3AVC A;  4BRK A;  4LD0 A;  2HMI A;  1S22 A;  2EWS A;  1Z05 A;  4KRF A;  5J2N A;  3QER A;  3WEE B;  4A61 A;  2F7T A;  3FZL A;  3ZEU B;  3ID8 A;  4Z0U A;  3CXC M;  2EHG A;  2QI2 A;  2O8D A;  3ZEU A;  3PIO L;  1TK8 A;  4CER A;  3KLF A;  3ULD A;  3PO4 A;  4FM0 A;  2IDO A;  5HRO A;  1HR0 K;  1NMN A;  1BL3 A;  3A5O C;  2WUS A;  4ELV A;  1RBV A;  4YFU A;  2Q3S A;  5EU7 A;  4W5R A;  3C6H A;  1YVU A;  2VWK A;  2FF3 B;  4EP5 A;  2ATQ A;  5H1S Q;  5AQP A;  4B3R K;  3T3F A;  4FLW A;  1RT6 A;  1YF5 L;  1UAX A;  2A3Z A;  4KFB A;  4CVN E;  4OLA A;  5JVG L;  1QVF M;  5C25 A;  4N5S A;  3NCI A;  4DR5 K;  4CJU A;  2B6A A;  3IMX A;  2P5G A;  4CHY A;  4FWQ A;  4IG0 A;  1WLJ A;  2CH6 A;  3NVM A;  2Z1J A;  1IKW A;  1BCM A;  3D7E O;  5AZJ A;  5AQZ A;  1XWL A;  3SAH A;  4YOX A;  3RVC A;  1Q82 O;  4H0T B;  1VSM A;  5HRN A;  5BRE A;  5LJW A;  5BN8 A;  1M1K O;  3CJC A;  4FLT A;  5DM6 L;  3LP3 A;  2UUB K;  1IKV A;  4JKA A;  4M63 C;  4JI1 K;  2DFH A;  4I7F A;  3LAM A;  2OA8 A;  4FL9 A;  4BRE A;  3T7Z A;  4W5N A;  2HBJ A;  2KZZ A;  1YXQ A;  4N47 A;  2NRX A;  5C24 A;  4CHN A;  4JI5 K;  5AQK A;  1QQM A;  2GBZ A;  1TV6 A;  3V81 A;  4A57 A;  3ASM A;  3BEX A;  4IFY A;  4CJE A;  1RTJ A;  3QFU A;  4DR2 K;  4B9L A;  4KB1 A;  3EO3 A;  4IWV A;  1VSJ A;  3U3G A;  3LP0 A;  3CQ8 A;  4B9N A;  1IG8 A;  2ZJQ L;  4QCL A;  1TK0 A;  4DR1 K;  4LSL A;  1Q9X A;  3AVB A;  1XNQ K;  2O8E A;  3SUO A;  2IVO A;  4K41 A;  4M3W A;  3L2U A;  4DFM A;  1C6V A;  3KKR A;  5E84 A;  3PY8 A;  4KTZ A;  2H3G X;  3L3U A;  1X3M A;  4BAC A;  2X6S A;  1NK0 A;  4ILG B;  3TAF A;  3J7A P;  4CZL A;  3S41 A;  4O0I A;  3OYF A;  1RCH A;  3LM9 A;  2HNZ A;  3KKS A;  5JLF A;  1ZBL A;  4CBX A;  3VGL A;  1L3V A;  4JI7 K;  2P9N A;  3CYM A;  3QET A;  1LAV A;  3SPY A;  5HLF A;  5KQ8 A;  3A5M C;  1LW2 A;  2YJE A;  3MEC A;  5AQG A;  3OJU A;  3ULE B;  1ZBF A;  1NM1 A;  1O1W A;  3HVR A;  3O1W A;  3KTQ A;  4DWI A;  1CXU A;  1GLB G;  4DLE A;  1NJW A;  1KFS A;  1K73 O;  1DT9 A;  4OX9 K;  4KTW A;  2NRZ A;  4H5W A;  4GMJ B;  4DV6 K;  1NGF A;  3RRH A;  4IXC A;  1RDA A;  1ESV A;  2GWJ A;  3MX2 A;  2VQF K;  3VEW A;  1HNZ K;  5CZ2 A;  3DLG A;  3TSU A;  4PL7 A;  3CPW M;  3JXU A;  4W5T A;  1GOC A;  3E66 A;  4QOZ B;  3TTC A;  3LDO A;  4DU4 A;  2G8W A;  4JS5 A;  3KD5 E;  2ZM6 K;  4BC5 A;  1MU2 A;  3CCR N;  4Z4E A;  5A2Q O;  2HW3 A;  3TI0 A;  5DMR A;  4C8K A;  4LSN A;  2GEL A;  1B92 A;  3VQ4 A;  3ZET A;  3PSF A;  4Z94 A;  5HRP A;  3EE9 A;  3ZX0 A;  1EWR A;  4RTF D;  1NGA A;  1SUQ A;  4DQS A;  3MWP A;  1W7A A;  2OPP A;  1RDU A;  3A8Y A;  5T7B A;  3WT0 A;  4Z4I A;  1SV5 A;  3I0R A;  4PA1 A;  4J2B A;  2XRI A;  3SBG A;  3CC4 N;  1WAF A;  1SL1 A;  1KVA A;  2E5L K;  3GL1 A;  3HOS A;  3UKR A;  4BVP A;  1JCE A;  4DHY A;  3I8B A;  1Q18 A;  3AA4 A;  3HM9 A;  1FW6 A;  2G8I A;  4Q0B A;  4MLE A;  2WC9 A;  4BRL A;  1YT3 A;  3MN5 A;  5KI6 A;  4DTP A;  3OYL A;  3AO3 A;  2YKM A;  4BVO A;  4Z4C A;  3LPU A;  3S3N A;  3QNO A;  4DV4 K;  1WSE A;  1V4T A;  1JLE A;  2X74 A;  5AQF A;  2Q97 A;  4HCC A;  4LFC K;  2Z1G A;  3VET A;  4KHS A;  4B8A B;  4O8U A;  1FKO A;  2YHX A;  2IVN A;  1R0A A;  3H08 A;  4FWL A;  3DXM A;  1SKS A;  3W0L A;  3AVH A;  3L6Q A;  3LM2 A;  2GUP A;  1HYS A;  3SMS A;  5AQU A;  4DQ8 A;  3MMV A;  4E3S A;  3V4I A;  3L4I A;  4QS7 A;  1EWQ A;  1NMD A;  3U9Z A;  5ADX H;  3NGY A;  4DMN A;  1WOQ A;  4CFC A;  2B5J A;  2WOM A;  4FWM A;  3F9M A;  3VMF B;  1WSG A;  4Z4H A;  1F21 A;  4FJG A;  3HK2 A;  1C1C A;  1BIS A;  4B08 A;  4H5V A;  5AQQ A;  3SLC A;  4CF8 A;  2NRW A;  3VF4 A;  1TAU A;  5D3G A;  3VF6 A;  1U04 A;  3F5T A;  3DXM B;  2NRV A;  4BG8 A;  4W5O A;  5AQR A;  3W3D A;  4MO4 A;  3THY A;  3QBX A;  3DYA A;  3OYI A;  3FE1 A;  4CJK A;  1XHZ A;  3FZM A;  4HUG A;  4AHT A;  4CED A;  3ATV A;  3M3Z A;  4FWR A;  4JV5 K;  1BQM A;  1I3A A;  2ASM A;  4WQ5 C;  1WSF A;  4DSF A;  4C1N I;  4K42 A;  4C1N K;  3ISN C;  4BRI A;  4IBN A;  3OYM A;  4NYN A;  4JK9 A;  2G8K A;  3NH0 A;  3NGI A;  1XMQ K;  4I2P A;  3ATU A;  2YNG A;  5HRS A;  3TAP A;  3HM8 A;  2RHK A;  5F2R A;  1YIJ N;  4E7H A;  3VQD A;  3K5N A;  2LSN A;  1VQL N;  3F2K A;  3O4Q A;  4WQ4 C;  4ID5 A;  4DTU A;  4H0X B;  3SZ2 A;  4NXM K;  4JS4 A;  2ZWH A;  3V1Q A;  3QNN A;  4RCH A;  4CZI A;  5SWM A;  1VAZ A;  2UU9 K;  1SL0 A;  4O8K A;  4IO9 L;  2V7Y A;  4IO8 A;  3U9D A;  2E1Z A;  3MEG A;  4ZHR A;  4DFK A;  1XQS C;  4GW6 A;  4QS9 A;  1LCU A;  2JWL A;  2P9L A;  3RMD A;  4L8R B;  3OYN A;  1NK9 A;  4DKW A;  1D9D A;  3T1A A;  2F9T A;  2D5R A;  3KK7 A;  4KI6 A;  5AFU H;  1VRT A;  4LC9 B;  3J81 O;  2W6L A;  3FZH A;  5C2D A;  2ZGZ A;  1BI4 B;  4A5B A;  3VEX A;  1QSL A;  5B8H A;  3NGZ A;  2HBL A;  3HTV A;  4IDK A;  4X62 K;  4WFN L;  4CJ5 A;  3SQ4 A;  3OYC A;  3BF3 A;  3MXM A;  4BC2 A;  4Z4G A;  5AJ3 K;  1YJN N;  2OTL N;  3H1V X;  1J9A A;  4KAZ A;  4RG8 A;  1RT4 A;  5BPM A;  4KI4 A;  5M1Q A;  4OGC A;  1HNI A;  2CGL A;  4ILJ A;  4FOE A;  1OH5 A;  1L3U A;  4FK4 A;  1HNW K;  4DSJ A;  3O5B A;  3CFO A;  4KHU A;  4DTX A;  4O5B A;  4YOT A;  1E3M A;  2O4G A;  2P9K A;  2ITG A;  1NJZ A;  5DK5 A;  3LAN A;  4BGB A;  1WBD A;  5F0X A;  4GV9 A;  3EZ5 A;  4H5N A;  1VQN N;  3ZT3 A;  2FBY A;  4K8X A;  3ZT2 A;  2O8D B;  2D1K A;  1K6Y A;  3CCS N;  3GG4 A;  3C0B A;  3CJ7 A;  3H3O B;  2BTF A;  4RW8 A;  2QKB A;  3WEE A;  4JI3 K;  4DG1 A;  3HP9 A;  3E01 A;  2G8U A;  4B9M A;  1JLB A;  2NRH A;  4DF4 A;  2UXC K;  4YOW A;  4MQ3 A;  4E89 A;  1KLM A;  3K5L A;  1LOT B;  5M1F A;  3WNH A;  2W6K A;  4GVM A;  2EX3 A;  3R8E A;  5GIN A;  3J80 O;  3HSC A;  5E41 A;  1XUP O;  3OHR A;  2FSK A;  3KJV A;  3AVK A;  3CCQ N;  1NU0 A;  3VEV A;  4LF7 K;  3P39 A;  2KFN A;  3IRX A;  1HYV A;  1IBM K;  1RDC A;  3EKS A;  1WBB A;  3VQA A;  3PUF A;  4M42 A;  2HVH A;  4JKH A;  3THW B;  4FLX A;  4CD3 A;  4DSI A;  3KK3 A;  3LWL A;  3DOL A;  4N76 A;  3NBP A;  1NK6 A;  4FLZ A;  3QES A;  1UA1 A;  4E7K A;  3R1X A;  3LDL A;  2D0B A;  3ENB A;  1EX4 A;  4AHC A;  2A42 A;  3L4Q A;  3QEX A;  4JK7 A;  1JKH A;  5CYQ A;  3OYK A;  2RPI A;  1NK8 A;  4AHU A;  3VEO A;  4PHT X;  3LZI A;  2OYQ A;  4DQP A;  3VQP A;  3QO9 A;  2F96 A;  3CCL N;  1C1A A;  1IBK K;  3M6G A;  2Y1J A;  4DTO A;  2E1Y A;  1SZ2 A;  5LL6 Z;  1GLD G;  4YNQ A;  3QEP A;  4G1Q A;  1WN7 A;  2HOE A;  3SV3 A;  4PQU A;  3ZSQ A;  2HST A;  3PX0 A;  4OKK A;  3OTO K;  1MWK A;  2E4L A;  3GBT A;  2ZJP L;  2BDP A;  4MFB A;  2RN2 A;  5JS1 A;  3TU5 A;  4I2Q A;  4O0J A;  1U4B A;  2ZE2 A;  4CF2 A;  3BDP A;  2E2P A;  1S1W A;  3OS2 A;  3BGR A;  4PKI A;  1ATN A;  1KC8 O;  5C0Y A;  4NLB A;  2O8C B;  4CW7 B;  4GV3 A;  2OAN A;  4H5R A;  3ENH A;  1U45 A;  1U6Z A;  4DFP A;  2Z1H A;  3BF1 A;  3HYF A;  2GWK A;  4FCY A;  3VA0 A;  3BZC A;  4BRQ A;  3CFP A;  2ZGY A;  4CJV A;  1VSE A;  4B9Q A;  4A2B A;  3OYD A;  3GDQ A;  4L3Q A;  1B9F A;  4AF1 A;  3SPZ A;  4FLY A;  4CJT A;  4ICL A;  5AFU A;  4HTU A;  1KAX A;  3CJ1 A;  5EOY A;  2QKK A;  1X9J A;  2JLE A;  1JXB A;  5HBM A;  3VGM A;  4PWD A;  4FWS A;  2HND A;  4CZM A;  3ZLJ A;  1WNS A;  3EY1 A;  3O1B A;  2Q0U A;  2QWR A;  3TSQ A;  2VGM A;  1C0M A;  2I5J A;  4KKO A;  3CM5 A;  4JI6 K;  4CEA A;  1XHX A;  3DLL L;  3UKR B;  3RMB A;  3DJC A;  2VG6 A;  3AAR A;  1XC3 A;  4Y1D A;  3NH2 A;  2F4V K;  4C8O A;  2FLO A;  1S3X A;  3NHG A;  4JRQ A;  4JKE A;  3B6O A;  4NYF A;  3I33 A;  2HHV A;  4XH5 A;  3H6E A;  3NFA A;  4GVE A;  3TAG A;  3AVL A;  2J4R A;  1JJ2 M;  3O4W A;  2VG5 A;  3EZW A;  3D2E B;  2YNH A;  4M3R A;  2KTQ A;  3UB5 A;  4A62 A;  4BRM A;  2HF4 A;  2Z1I A;  1Z6R A;  5DM7 L;  4FJM A;  4NB4 A;  1HKB A;  4FXD A;  2VQE K;  3SAG A;  2D0P A;  4FJI A;  4HHT A;  3SQ1 A;  1J53 A;  4CZG A;  3SQ2 A;  1A5V A;  3AO1 A;  2XO7 A;  1VSL A;  3OBY A;  5M1P A;  5AZI B;  2QWL A;  1ZBS A;  1Q81 O;  3M1F A;  4FW1 A;  1WSJ A;  4KRE A;  1QZ5 A;  4HTL A;  2P9P A;  2FBV A;  4FPA A;  2I7P A;  1KVC A;  3AV9 A;  5HRR A;  3AVM A;  4CJQ A;  4B1V A;  2Q2R A;  2OPS A;  1JLF A;  4X65 K;  3TPQ A;  4PUO A;  2UUA K;  3VEN A;  5EY4 A;  4LF9 K;  4FK2 A;  3AVN A;  1GLF O;  1YUW A;  2PZS A;  3OYA A;  1JL1 A;  1IO2 A;  5C15 A;  3P31 A;  3O3H A;  3ZSR A;  2PYJ A;  5TKW A;  3WXM B;  4JRP A;  3I56 N;  2IGI A;  3MAQ A;  4CHO A;  1T03 A;  1KVB A;  1NNE A;  3AO4 A;  2YKN A;  5CYM A;  1UA0 A;  3OS0 A;  2O8C A;  4KHP K;  4CEB A;  4FLV A;  1Q9Y A;  4XEI A;  4DR7 K;  4B9S A;  1FKP A;  1N34 K;  2YJF A;  1GLA G;  3CCE N;  1UOC A;  5AQS A;  3QEI A;  4FSV A;  3U4L A;  2P9U A;  4LH5 A;  4FM2 A;  1NGC A;  5JVH L;  2FC0 A;  3HBT A;  4CZF A;  4ILH A;  1KSP A;  5J2M A;  3V9W A;  2QA4 N;  2ZQB A;  1X1P A;  3ULE A;  4GY2 B;  3J7Z O;  1KRP A;  1HNV A;  3CI5 A;  4ISE A;  5JMV A;  5LMU K;  3MCA B;  3CJB A;  4DS4 A;  1KLN A;  2O8F B;  3HO1 A;  4I9L A;  4R79 A;  4FWN A;  4BGA A;  3VQC A;  4BRF A;  3Q7C A;  1T3V A;  2RKI A;  3H1Q A;  4DB3 A;  4FZZ A;  1NGB A;  4BDY A;  4CHQ A;  1HJO A;  3LDS A;  4FJ8 A;  4CIF A;  1X9M A;  1VQ5 N;  1U47 A;  3Q7B A;  4B3S K;  5FRM A;  4CE9 A;  3H3N O;  4CCH A;  3DLB A;  4BY9 C;  4CFB A;  3VOV A;  3PV8 A;  5EXW A;  3O9U A;  4OPH A;  4BR7 A;  2O4I A;  1HQE A;  5GAH P;  1VQ9 N;  4J8F A;  2W42 A;  4JHD A;  4CEC A;  2G8F A;  2HHQ A;  4H8K A;  1QQN A;  4OJR A;  3CCJ N;  4DV0 K;  1YJW N;  1OVQ A;  1NOY A;  1L3S A;  4JYA K;  3NVK A;  1C0U A;  4WQ4 A;  3DLR A;  3T1H K;  1FXX A;  3RMC A;  1NKE A;  5FPD A;  4CZJ A;  1VSH A;  3VGK A;  3KLH A;  3DXK B;  1RT2 A;  3MN6 A;  2E2Q A;  2ITM A;  1GOA A;  4CGF A;  1N5Y A;  1NKC A;  2E2O A;  2P5O A;  4JD2 B;  1DLO A;  1FJG K;  5J2Q A;  1NJY A;  2QWQ A;  1QSS A;  4M45 A;  3KLG A;  3RTV A;  1T7P A;  2WON A;  3ZSY A;  3AVA A;  4OPJ A;  4CEO A;  3K57 A;  5KPT A;  5BRF A;  3L2R A;  1YTA A;  5GIP A;  1QE1 A;  4Y1C A;  2KZM A;  3VA3 A;  3L2V A;  3NDK A;  4O44 A;  1NG9 A;  1ZBU A;  4IOC L;  3SYZ A;  3GE1 A;  2OPQ A;  2PFU A;  4QAG A;  1TKD A;  4B1U B;  1I39 A;  2G8H A;  3SUP A;  4RW4 A;  2P1J A;  3LP1 A;  3ZX2 A;  3I0S A;  3KLI A;  4WE1 A;  5AQJ A;  5LJV A;  2HHH K;  5HOO A;  4M3U A;  4E0D A;  1QVG M;  4FO0 A;  3NF6 A;  3OYG A;  4DTM A;  1S6Q A;  3RWU A;  2KQ2 A;  4E1J A;  4CGG A;  3IUC A;  3DLK A;  3E9P A;  4HUF A;  3QLH A;  1S1U A;  5KPZ A;  5BN9 A;  2QWO A;  3O9T A;  5AQH A;  4BRA A;  1U49 A;  4BG9 A;  1RBU A;  1ATR A;  3L2Q A;  3P4I A;  3R9P A;  1DTT A;  2A1S A;  4WFB L;  1XI1 A;  1W97 L;  3CQX A;  5AZI A;  4F8R A;  2HHW A;  3TR8 A;  1XMO K;  3C7N A;  1T6D A;  1W0H A;  4LF5 K;  2HB5 A;  1CZA N;  3L0Q A;  1NGD A;  5EVZ A;  3VQE A;  1BA0 A;  4DV1 K;  3CG7 A;  2D4W A;  3O9R A;  2P9I B;  1A5X A;  5JS2 A;  4FJK A;  3ZT1 A;  2P9I A;  4OO1 J;  4CJ3 A;  3I8D A;  5KRS A;  1REV A;  3ZET B;  5CE3 A;  3DWL A;  5BR9 A;  4QS8 A;  4N56 A;  1ZC6 A;  4EFH A;  4XIU A;  1KAY A;  3E1Y A;  4FJ5 A;  3WXK A;  3TAB A;  2JGU A;  1J5E K;  1UWB A;  4B1W B;  2IIR A;  3QEV A;  4CJL A;  4RW7 A;  2VYP A;  2GX9 A;  2V51 B;  4IG3 A;  4BRN A;  4LFA K;  4LF8 K;  3ITH A;  3U8X A;  3THY B;  3AVJ A;  2PY5 A;  4F4K A;  4BRC A;  4UQG A;  4PKH A;  2HHX A;  4KH4 A;  3CFR A;  4CJ7 A;  1VSD A;  4AHV A;  1TL3 A;  1Y97 A;  1L3T A;  2BE2 A;  1K8A O;  4TSX A; 
#chains in the Genus database with same CATH homology
 4I9Q A;  4MFB A;  2RN2 A;  3C95 A;  5JS1 A;  1NOZ A;  1QSY A;  4I2Q A;  4FLT A;  4O0J A;  1U4B A;  2A1R A;  2ZE2 A;  3LP3 A;  1IKV A;  1LW0 A;  4CF2 A;  1LWE A;  3BDP A;  3OS2 A;  1S1W A;  2DFH A;  3LAM A;  4I7F A;  4HUE A;  2OA8 A;  3BGR A;  4B9U A;  3WNF A;  3PO5 A;  2OZM A;  4W5N A;  2YV0 X;  1RBS A;  2KZZ A;  3ZSZ A;  4N47 A;  1BGX T;  2XY5 A;  5C24 A;  5CY4 A;  4CHN A;  2HHU A;  3TAE A;  1EXQ A;  4E1M A;  2GBZ A;  2IOC A;  3AA3 A;  1TV6 A;  3V81 A;  1U45 A;  4JLH A;  1Z25 A;  3AVG A;  3ASM A;  2Z1H A;  4DFP A;  1JLQ A;  3HYF A;  4FCY A;  4IFY A;  4B9T A;  3VA0 A;  4HVJ A;  4CJE A;  1BHL A;  1LWC A;  1TK5 A;  1RTJ A;  4AHR A;  3CFP A;  1QTM A;  3UIQ A;  4PY5 A;  1A5W A;  1JLC A;  4CJV A;  3V6D A;  4B9L A;  1VSE A;  3IS9 A;  4KB1 A;  2X6N A;  4DU1 A;  4DQI A;  1VSJ A;  3U3G A;  3O4N A;  3OYD A;  3LP0 A;  3D0P A;  3CQ8 A;  1SKW A;  4B9N A;  3VQB A;  1RT7 A;  1B9F A;  3OYE A;  1ASV A;  4QCL A;  1TK0 A;  1RBT A;  1ZYQ A;  3SPZ A;  4LSL A;  4F2R A;  2E6M A;  4CJT A;  4ICL A;  4FLY A;  1Q9X A;  3AVB A;  4DSK A;  1KCF A;  3DMJ A;  3M8Q A;  4FLV A;  3SUO A;  3ZCM A;  4J2E A;  4M3W A;  3L2U A;  4DFM A;  1C6V A;  2FBT A;  3K59 A;  3KKR A;  4HTU A;  3PY8 A;  4KTZ A;  2DFF A;  3L3U A;  1L5U A;  2QKK A;  3SCX A;  3OY9 A;  1NKB A;  4BAC A;  2BAN A;  2FBX A;  2X6S A;  1NK0 A;  3TAF A;  4HCB A;  2JLE A;  1NK7 A;  4O0I A;  3OYF A;  5FDL A;  1JXB A;  1RCH A;  5HBM A;  5K14 A;  3AO2 A;  3NF9 A;  3V9U A;  2HNZ A;  4CF9 A;  4PWD A;  3KKS A;  1ZBL A;  2HND A;  1JL2 A;  3SQ0 A;  1L3V A;  3HL8 A;  1DTQ A;  1WNS A;  3CYM A;  3EY1 A;  1RDB A;  3QET A;  1WAJ A;  2QXF A;  1HYZ A;  1LAV A;  1BCO A;  4CJS A;  3SPY A;  4FLU A;  5HLF A;  1T05 A;  1C0M A;  4KV8 A;  1LW2 A;  3TAR A;  2I5J A;  3MEC A;  3OVN A;  4FYD A;  3OJU A;  1ZBF A;  4KKO A;  3RRG A;  4CIG A;  1O1W A;  3HVR A;  3CM5 A;  4CEA A;  3KTQ A;  4DWI A;  1CXU A;  1XHX A;  4DLE A;  1NJW A;  5FRO A;  4H4M A;  1RTD A;  3DRP A;  1KFS A;  3AA2 A;  2IC3 A;  4KTW A;  3RMB A;  1FK9 A;  1HRH A;  2AJQ A;  2VG6 A;  4GMJ B;  4DQR A;  4KI4 A;  4CIE A;  4Y1D A;  3NH2 A;  4C8O A;  3RRH A;  3NHG A;  4JRQ A;  1RDA A;  3B6O A;  4NYF A;  1HJR A;  1RTI A;  4OKE A;  2HHV A;  5CZ2 A;  2QK9 A;  3NFA A;  4KHN A;  3DLG A;  1NK5 A;  3TAG A;  4W5T A;  1S5J A;  1GOC A;  3DRR A;  1S1T A;  1B9D A;  3AVL A;  4CJ4 A;  5KTQ A;  3HT3 A;  2XHB A;  4FJ7 A;  4QOZ B;  4DU4 A;  2G8W A;  4DTR A;  1RIL A;  3A2F A;  3NH1 A;  4ELT A;  2VG5 A;  2KTQ A;  4CEZ A;  2YNH A;  4M3R A;  4E19 A;  4CJF A;  1U48 A;  4JS5 A;  3OS1 A;  3KD5 E;  3LPT A;  3VQ8 A;  3WNE A;  2F8T A;  4ID1 A;  3KK2 A;  4BWJ A;  1MU2 A;  4CHZ A;  2E6L A;  4Z4E A;  2D0A A;  2HW3 A;  2Z1I A;  1ASU A;  1S1V A;  4BDZ A;  3TI0 A;  5DMR A;  4BWM A;  4CK3 A;  4C8K A;  4W5Q A;  3OYH A;  4FJM A;  4LSN A;  1B92 A;  4FXD A;  4RW9 A;  3VQ4 A;  1TVR A;  4FZX C;  1D8Y A;  2YHA A;  5HRP A;  4ELU A;  4FJI A;  4DTN A;  2KW4 A;  4HHT A;  3RR8 A;  4CFD A;  3ZSW A;  3SQ1 A;  4KHY A;  1J53 A;  4C8M A;  3SQ2 A;  1SUQ A;  3D45 A;  4DQS A;  3ZSX A;  1A5V A;  3AO1 A;  4FZY A;  2OPP A;  5T7B A;  2XO7 A;  1VSL A;  4Z4I A;  2RF2 A;  1IKY A;  3RMA A;  3MED A;  1SV5 A;  4FW1 A;  3I0R A;  5C42 A;  1KFD A;  1WSJ A;  4PA1 A;  3SJJ A;  4J2B A;  2XRI A;  3F73 A;  4KRE A;  4DFJ A;  4FJ9 A;  1WAF A;  1SL1 A;  1KVA A;  2FBV A;  2DFE A;  4M3Y A;  1KVC A;  3AV9 A;  1C1B A;  5HRR A;  3AVM A;  4CJQ A;  4ZTJ A;  4FM1 A;  2OPS A;  3JYT A;  1JLF A;  3IG1 A;  4F2S A;  3AA4 A;  4B8C A;  4CF0 A;  3EYZ A;  3TWH A;  3HM9 A;  4PUO A;  3P5J A;  4M3Z A;  2G8I A;  3DLE A;  4KHQ A;  4Q0B A;  3LAK A;  1BQN A;  1RNH A;  4EZ9 A;  1YT3 A;  5KI6 A;  1C0T A;  3IAY A;  1QQC A;  3AVN A;  4FK2 A;  4E1N A;  2PZS A;  3OYA A;  4DTP A;  3OYL A;  4CES A;  1JL1 A;  1IO2 A;  3AO3 A;  2YKM A;  4Z4C A;  3O3H A;  1RT5 A;  3LPU A;  4CGI A;  3S3N A;  3OJS A;  3ZSR A;  2PYJ A;  3C6T A;  1SL2 A;  5I42 A;  4H4O A;  3ZT4 A;  4CGJ A;  4JRP A;  3QNO A;  2IGI A;  4LH4 A;  1WSE A;  1JLE A;  4B9V A;  2X74 A;  3HXM A;  2BGG A;  3MAQ A;  4CHO A;  2OPR A;  5I3U A;  1LWF A;  1T03 A;  1KVB A;  4BDP A;  4EZ6 A;  4HCC A;  2IS3 A;  3MXI A;  3AO4 A;  5FRN A;  4F3O A;  2YKN A;  5KGX A;  4CEQ A;  5CYM A;  2Z1G A;  1UA0 A;  1TKX A;  4LY7 A;  3OS0 A;  4KHS A;  3VN5 A;  2X78 A;  3T19 A;  4CEB A;  1Z26 A;  4OVL A;  4NCG A;  4B8A B;  4CJP A;  4CEE A;  1WSH A;  2B4J A;  1FKO A;  2VWJ A;  4CF1 A;  1R0A A;  3H08 A;  2XY7 A;  4KPY A;  4B9S A;  1FKP A;  1WSI A;  1SKS A;  2PYL A;  4KHW A;  3AVH A;  4O55 A;  1HYS A;  1VRU A;  1UOC A;  2YNF A;  4DLG A;  4FJL A;  4E3S A;  3M8P A;  3QEI A;  3V4I A;  4KB0 A;  3SUQ A;  3DI6 A;  4LH5 A;  3NGY A;  4DMN A;  4FM2 A;  1QHT A;  2WOM A;  2B5J A;  3VQ9 A;  4CFC A;  3G10 A;  2FC0 A;  1D9F A;  1WSG A;  4Z4H A;  1F21 A;  4FJG A;  3HK2 A;  3KIO A;  3P1G A;  3M8R A;  1KSP A;  1TL1 A;  3LP2 A;  1NK4 A;  1C1C A;  1BIS A;  1RT1 A;  3AO5 A;  4B08 A;  4N41 A;  5J2M A;  4CF8 A;  3V9W A;  2ZQB A;  1X1P A;  3VQ5 A;  1TAU A;  5D3G A;  3HPG A;  1EKE A;  1KRP A;  1U04 A;  4OKJ A;  1HNV A;  4CGD A;  3V9Z A;  1ZBI A;  4DS4 A;  1KLN A;  4BE2 A;  3HJF A;  3PX4 A;  4W5O A;  5J1E A;  4I9L A;  3VQQ A;  3HO1 A;  3HST B;  4FJN A;  3DYA A;  4DF8 A;  1HMV A;  3VQC A;  3OYI A;  4M3T A;  4CJK A;  1XHZ A;  4HUG A;  4AHT A;  4DS5 A;  3C6U A;  3C94 A;  4CED A;  3S3M A;  2RKI A;  3DM2 A;  4EP4 A;  4KTQ A;  4FZZ A;  5CZ1 A;  3VQ7 A;  4AH9 A;  4BDY A;  1BQM A;  4CHQ A;  1I3A A;  3LDS A;  1WSF A;  4DSF A;  2YHB A;  4FJ8 A;  4CJW A;  4CIF A;  4BE1 A;  1X9M A;  3ISN C;  1JLG A;  1U47 A;  4NCA A;  3KD1 E;  2DY4 A;  5FRM A;  4CE9 A;  4CCH A;  3LAL A;  3DLB A;  4IBN A;  4CFB A;  3OYM A;  3L2W A;  4NYN A;  3PV8 A;  1RDD A;  2G8K A;  3ALY A;  4CHP A;  1CZ9 A;  1CLQ A;  1VK0 A;  3NH0 A;  3NGI A;  4I2P A;  3ZSV A;  1NJX A;  1TKZ A;  2O4I A;  1HQE A;  4DU3 A;  2YNG A;  5HRS A;  3TAP A;  3NE6 A;  2W42 A;  4CEC A;  4E7H A;  2G8F A;  3VQD A;  3K5N A;  2LSN A;  3CM6 A;  3QIN A;  2HHQ A;  4H8K A;  1VSF A;  3FFI A;  3O4Q A;  2KFZ A;  4ID5 A;  4DTU A;  3TAN A;  3KK1 A;  3HVT A;  1QS4 A;  4OJR A;  4OGE A;  2GV9 A;  4BE0 A;  3SZ2 A;  3NAE A;  3NF7 A;  3ZT0 A;  4JS4 A;  3U6F A;  3V1Q A;  3QNN A;  3TAQ A;  4FK0 A;  3MXJ A;  4Q5V A;  3PX6 A;  1NOY A;  1L3S A;  4C8N A;  5SWM A;  1ZBH A;  4CK1 A;  1C0U A;  1LAW A;  1RBR A;  3AA5 X;  3DLR A;  3QIO A;  1SL0 A;  1GOB A;  1FXX A;  4K8Z A;  2DTU A;  3RMC A;  1X9W A;  1NKE A;  1JXE A;  1VSH A;  3KLH A;  4CGH A;  4CGF A;  1RT2 A;  1TKT A;  1SKR A;  1GOA A;  3MEG A;  4ZHR A;  1YTU A;  3U3Y A;  4DFK A;  1NKC A;  1N5Y A;  1EP4 A;  3V1R A;  3DRS A;  2P5O A;  3K58 A;  4DQQ A;  4GW6 A;  1DLO A;  1CZB A;  5J2Q A;  4E7J A;  3RMD A;  3VQ6 A;  3OYJ A;  1NJY A;  1QSS A;  4J2D A;  4L8R B;  3OYN A;  2HHT A;  1NK9 A;  3SV4 A;  1D9D A;  3T1A A;  4M45 A;  1TGO A;  2D5R A;  4KI6 A;  4M41 A;  3KLG A;  3K5M A;  1VRT A;  3RTV A;  2XY6 A;  5SZT A;  4KO0 A;  3L8B A;  1J5O A;  1T7P A;  1BI4 B;  2HNY A;  2WON A;  1T8E A;  3ZSY A;  3AVA A;  3DOK A;  4OPJ A;  1QSL A;  4CEO A;  3NGZ A;  1S9G A;  3K57 A;  4IDK A;  3QEW A;  1BIZ A;  3RR7 A;  1BI4 A;  4CJ5 A;  3SI6 A;  2OZS A;  3SQ4 A;  3OYC A;  3L2R A;  2HHS A;  1YTA A;  3F9K A;  1IKX A;  2IAJ A;  3MXM A;  1W9H A;  4C8L A;  4R5P A;  5KGW A;  3O3F A;  1QE1 A;  4Y1C A;  4Z4G A;  1TAQ A;  2KZM A;  4E7L A;  3VA3 A;  3WNG A;  3L2V A;  1LV5 A;  3NDK A;  4O44 A;  1JLA A;  1ZBU A;  4F3T A;  3SYZ A;  4DSL A;  1J9A A;  1CXQ A;  4DSE A;  4KAZ A;  2OPQ A;  4RG8 A;  1RT4 A;  4QAG A;  2R7Y A;  1EET A;  4ZTF A;  1RTH A;  1TKD A;  2GUI A;  3AVF A;  4OGC A;  1HNI A;  1I39 A;  3ZSO A;  4CK2 A;  3SUP A;  1L3U A;  1N6Q A;  1S9E A;  4CFA A;  4DTJ A;  2G8H A;  4FK4 A;  1D5A A;  3G0Z A;  1ASW A;  1HQU A;  2P51 A;  4RW4 A;  4DSJ A;  4B3O A;  2P1J A;  2D0C A;  3CFO A;  4KHU A;  4DTX A;  4O5B A;  3LP1 A;  4FJX A;  4FVM A;  1IH7 A;  3I0S A;  2O4G A;  3HPH A;  3LWM A;  2ITG A;  4DTS A;  3SUN A;  3KLI A;  1NJZ A;  5DK5 A;  3LAN A;  4WE1 A;  5J2P A;  3K5O A;  5KRT A;  3EZ5 A;  4M3U A;  4E0D A;  3ZT3 A;  2FBY A;  1XC9 A;  4K8X A;  3NF6 A;  3ZT2 A;  3OYG A;  4DTM A;  4NCB A;  1Q8I A;  1S6Q A;  1K6Y A;  3HPO A;  3V9X A;  1VSK A;  3RWU A;  2VG7 A;  1IG9 A;  1S6P A;  4RW8 A;  2QKB A;  2KQ2 A;  3THV A;  4CGG A;  3SNN A;  4DG1 A;  4FJH A;  3HP9 A;  3E01 A;  2G8U A;  4B9M A;  3K2P A;  3DLK A;  4FW2 A;  3JSM A;  4HUF A;  2F8S A;  3QLH A;  1S1X A;  1ITG A;  1JLB A;  1S1U A;  4DF4 A;  2BDP A;  2NUB A;  3HP6 A;  3OYB A;  4IFV A;  4CEF A;  3S3O A;  4Z4F A;  3V9S A;  4CJR A;  1U49 A;  3MEE A;  4MQ3 A;  1RBU A;  4E89 A;  3L2Q A;  1KLM A;  3KLE A;  3K5L A;  5HP1 A;  3AVC A;  3WNH A;  4E7I A;  1DTT A;  3S9H A;  2A1S A;  4LD0 A;  2HMI A;  4GVM A;  2EX3 A;  1X9S A;  4KRF A;  5J2N A;  1RT3 A;  3QER A;  5E41 A;  1XI1 A;  3KJV A;  2ETJ A;  4F8R A;  3TR8 A;  2HHW A;  3TAM A;  3AVI A;  3AVK A;  1G15 A;  4Z0U A;  2EHG A;  1W0H A;  4AIL C;  2ZD1 A;  3M8S A;  2KFN A;  3IRX A;  2HB5 A;  1HYV A;  4IKF A;  2HVI A;  1TK8 A;  3VQE A;  4CER A;  1RDC A;  3KLF A;  3ULD A;  3LZJ A;  3PO4 A;  3CG7 A;  3O3G A;  4FM0 A;  2IDO A;  3VQA A;  2XY8 A;  3PUF A;  1BIU A;  4AHS A;  5HRO A;  1A5X A;  1BL3 A;  4M42 A;  2HVH A;  5JS2 A;  4FJK A;  3L3V A;  4ELV A;  3ZT1 A;  4CJ3 A;  3I8D A;  1RBV A;  4YFU A;  2Q3S A;  5EU7 A;  1REV A;  5KRS A;  4W5R A;  4OLB A;  3P83 D;  1YVU A;  4FLX A;  4DSI A;  4M3X A;  3KK3 A;  2VWK A;  3LWL A;  3DOL A;  4N76 A;  2Y1I A;  4EP5 A;  4N56 A;  4XIU A;  2G8V A;  3DLH A;  3NBP A;  1NK6 A;  2ATQ A;  4FLZ A;  4OPK A;  3T3F A;  3QES A;  4FLW A;  1RT6 A;  4FJ5 A;  4J2A A;  2YNI A;  4E7K A;  1UA1 A;  1UAX A;  3TAB A;  2JGU A;  2D0B A;  4FJJ A;  4KFB A;  1UWB A;  4OLA A;  1EX4 A;  4AHC A;  3QEV A;  5C25 A;  4CJL A;  4N5S A;  1VSI A;  3NCI A;  3QEX A;  1JKH A;  5CYQ A;  3NF8 A;  3OYK A;  4CJU A;  2RPI A;  1NK8 A;  4AHU A;  2B6A A;  3LZI A;  4DQP A;  2OYQ A;  4RW7 A;  2P5G A;  3VQP A;  3QO9 A;  2F96 A;  4CHY A;  1C1A A;  4IG0 A;  1WLJ A;  1KTQ A;  2Y1J A;  4IG3 A;  4DTO A;  1Q9Y A;  2Z1J A;  1IKW A;  1BCM A;  3B6P A;  3ITH A;  3V1O A;  3AVJ A;  2PY5 A;  4F4K A;  1HPZ A;  4UQG A;  4O4G A;  3CFR A;  2HHX A;  4YNQ A;  3QEP A;  1XWL A;  1J54 A;  1WN7 A;  4G1Q A;  1VSD A;  4AHV A;  1TL3 A;  1Y97 A;  3SV3 A;  1L3T A;  4PQU A;  3ZSQ A;  3PX0 A;  3QIP A;  2BE2 A;  4OKK A;  2E4L A;  1VSM A;  5HRN A;  4RW6 A;  4TSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...