2F9WA

Structure of the type iii coaa from pseudomonas aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
249
Chain Sequence
SMILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQALPVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWLALVAAHHLAKKACLVIDLGTAVTSDLVAADGVHLGGYICPGMTLMRSQLRTHTRRIRYDDAEARRALASLQPGQATAEAVERGCLLMLRGFVREQYAMACELLGPDCEIFLTGGDAELVRDELAGARIMPDLVFVGLALACPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate Kinase
publication title Prokaryotic Type II and Type III Pantothenate Kinases: The Same Monomer Fold Creates Dimers with Distinct Catalytic Properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 70
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA02
3LDQA 3O1BA 5AQYA 3LM2A 4CJ7A 4Y0WA 4B1UB 3H1QA 4JD2A 2ASPA 2NLXA 4CZMA 3CJ7A 3VESA 4BRLA 1Z6RA 3VEWA 2CGLA 5AQSA 2HMPA 2GTDA 3FZLA 1S22A 4H0XB 2F9TA 4FWOA 5AQXA 1WUAA 4M63C 5AFUA 5AQOA 4IJNA 2FF3B 1HLUA 1YVNA 3UKUA 2A40A 4JN4A 4JAXA 1MWMA 4ISGA 1ZC6A 1HX1A 3WT0A 3WQUA 3U4LA 2YHXA 4ISEA 3CJAA 3FGUA 2CH6A 4FWMA 3HZ6A 3O1WA 3JXUA 2P9NB 1NGBA 2E20A 3MCPA 2P9PB 4H5VA 3EO3A 4FWSA 2Q0RA 1U6ZA 1BG3A 1KAYA 4ISFA 1Q18A 4DCHA 3ZX0A 3MK6A 5ELZA 3L0QA 1DGKN 3AY9A 4PKHA 3H6EA 3R8EA 5KPRA 2NZTA 1SZ2A 2E2QA 4BQZA 2AP1A 3CJ9A 3IFRA 1E4GT 2BUPA 3LDNA 3SMSA 1QHAA 2P9UA 3R6MA 4K25A 4BR4A 4FWPA 4BR7A 2E8AA 5AZIA 3S41A 3I33A 4BGBA 3IUCA 5F0XA 5BRDA 3C0BA 4CD1A 3DJCA 3WEEA 3O6WA 1HJOA 3CJ1A 4PL7A 1JCGA 4NB4A 3KZBA 1QQOA 3ATUA 3VF6A 1OKJA 3IMXA 4HWIA 3VENA 2ZGYA 2Q1NA 2F9WA 2QWQA 3EN9A 1ZBSA 2P9SB 3FZKA 4B1ZA 1KXPA 1KAXA 3TU5A 5BR9A 1K8KB 3B8AX 2FXUA 1HUXA 3AAQA 5TKYA 4WQ4A 2GEMA 4A2AA 3MDQA 4BRHA 2CGKA 2D1KA 4BRAA 3BUZB 3JS6A 4I6MB 5E26A 5FPMA 2E2NA 2PBDA 4FPAA 4CD3A 3U9ZA 3IDHA 4MO5A 3QICA 5E84A 3QFPA 3ZX2A 3A5OC 5BPMA 5KPZA 4A62A 4BC3A 1TUYA 3DXKB 3MN6A 2Q0UA 2VWBA 2QWLA 5LJVA 2A6AA 3M1FA 2P9LB 3SK3A 3EL2A 5JLHA 2ZWHA 3FE1A 1ATSA 4MO4A 5B8HA 3M3ZA 4K41A 3D7EO 2ZGZA 2WUSA 4IXCA 3M6GA 2AA4A 4BR5A 1Z05A 3BP8A 4KBOA 4XEIA 3DXMA 2QW9A 5AQWA 4BRGA 4L3QA 5EVZA 1NWKA 4HTLA 3DXMB 3D2EA 5EY4A 2YCHA 1X3NA 4H03B 3F9MA 1BO5O 4BC5A 4XH4A 3A5MC 1RGIA 4EHTA 1Y64A 4GNIA 4H0PA 1ZXOA 5KPTA 1T6DA 5ADXH 4JD2B 3VGMA 3H1VX 4M7XA 4FOIA 4CZGA 1NGJA 1NMDA 1TYQA 4BR2A 4BVPA 3KHYA 1R59O 5LJWA 3ULEA 3ENHA 3P4IA 4BC4A 3VEZA 4MLEA 3CI5A 3BEXA 1DEJA 3UKUB 5F2RA 3GL1A 4IZ9A 5CE3A 2YHWA 4BRIA 3CJBA 3QMLA 4BGAA 3HTVA 2A42A 4A2BA 2V52B 3CIPA 3D2FA 3VEYA 4DHYA 3GG4A 2P9IA 3FR0A 3GOIA 2P9KA 3FZHA 3VERA 3WXLA 3QFUA 2Q36A 2P9KB 3A5LC 4XH5A 3U8XA 4B1YB 5KQDA 4FWKA 2KHOA 3O08A 4FOEA 1YXQA 4PKGA 5FPDA 3O5BA 4EAHD 1QQMA 1G99A 3C7NA 1D4XA 4FL9A 1MDUB 2ZF5O 3DWLA 1GLDG 2P9UB 5AQRA 3LM9A 5AZIB 2FSNA 1TUUA 5AQTA 3L6QA 3HSCA 4QS9A 2A5XA 3VGLA 1IG8A 1NGEA 3WEEB 1NGCA 5AQIA 5LY3A 1H1VA 1ATRA 3ID8A 4BG9A 4F9OA 4AM7A 5JLFA 3OHRA 3I8BA 3A5NC 3EZWA 4DQ8A 4AM6A 4A61A 1QZ5A 1GLEG 3HM8A 2Q97A 4BRFA 3VGKA 2E2OA 3LL3A 1E4FT 3BF3A 2I7PA 5AQUA 2GWJA 1U2VA 2OANA 4YDUC 2A41A 2QWNA 1BU6O 4O8KA 4JNEA 3FZFA 5AQNA 1J6ZA 1NLVA 4E1JA 4BRQA 5JMVA 1NBWA 4FWQA 1S3XA 3QB0A 4CZHA 3VEOA 4CZEA 2V7ZA 1RDWX 1HKBA 1WOQA 5FPEA 4PL8A 5AQKA 3RSEA 3GE1A 4BR9A 2CH5A 2GELA 2V7YA 3HBTA 5EXWA 3CHWA 3VOVA 5AQVA 2H3GX 2I7NA 2VYPA 5AQHA 5AQGA 1YUWA 4IJAA 3O8MA 2QWPA 3ENOA 2W40A 4EIAA 1GLCG 3UB5A 3H3OB 3MMVA 4JHDA 3ATVA 1IJJA 3D2EB 4FWNA 4QS7A 3ZEUA 4CI6A 3ZETA 3U9DA 3WQTA 1DKGD 4CZFA 4H0YB 2E1YA 5BPLA 3H3NO 4JHDB 4H5NA 2E2PA 2YI1A 2YJFA 3UKRA 3L4IA 1NGAA 1HKGA 2FSJA 4CZLA 4WQ5C 1QZ6A 3UKRB 4BRPA 4BG8A 3LDPA 4MLHA 4B9QA 3MN7A 3W0LA 5AQJA 4BR0A 3VEVA 1TYQB 2V51B 3J8AA 4H5RA 5AQQA 4BQLA 2IVPA 4H0TB 4IWVA 3ULEB 1T44A 1YAGA 3EKSA 3VF4A 1GLFO 2QM1A 1BOTO 4B1XB 4EFHA 2CGJA 3LDLA 1GLLO 3H45C 1CZAN 1NM1A 3BF1A 4K42A 4WYBA 4CBXA 2D0PA 3CQXA 2GUPA 3TPQA 2BTFA 5AR0A 3D2FB 4BROA 1SQKA 3QBXA 2P9IB 3FLCO 1T6CA 1NGDA 3GBTA 1MWKA 3LDOA 3SMPA 4XH1A 2D0OA 5BN8A 3CETA 1BWFO 3VF2A 4BREA 4C23A 1V4SA 4FPBA 2P9NA 3MN5A 2P9PA 1X9JA 3DAWA 5AFUH 4H5WA 5BRHA 1RFQA 1XC3A 3W3DA 1C0GA 4BC2A 1GLJO 2GWKA 3WUHA 3QDKA 1MA9B 2ITMA 3C7NB 3WXIA 1GLAG 4IO8A 2QWRA 4RTFD 2YJEA 4BRMA 2A3ZA 1BUPA 1NGHA 3R9PA 4YDUA 4BVOA 4NO7A 2Q31A 1X3MA 4BRNA 3G25A 4FSVA 5AQPA 5AQZA 3HI0A 4LC9B 2PAVA 5KQ8A 5AQMA 5EX5A 1ATNA 5AQLA 1XQSC 1HKCA 1NGIA 2IVNA 2QWMA 2W41A 2HF4A 2HF3A 2NRHA 5BPNA 4CBWA 3FZMA 3CJCA 2VCPA 4PKIA 3O80A 2YHYA 5BREA 5F1XA 1BA0A 4EHUA 5BRFA 3A0IX 2P9SA 4B1VA 1U2VB 2E1ZA 4M7YA 3AARA 1K8KA 2QWOA 4K43A 4FWLA 2FSKA 5JICA 3VPZA 3WXJA 1C0FA 2E88A 2FF6A 3A8YA 4J8FA 4H5TA 4RWTA 1LOTB 2ASOA 3SJHA 2J4RA 3MN9A 1JCFA 3VETA 4FWRA 3CERA 3VEXA 4CZIA 4I6MA 2Q2RA 4O5FA 2IVOA 4H0VB 4WQ5A 5AQFA 2D4WA 3FFKB 4B1WB 4RCHA 1QQNA 4FO0A 3RSEB 4GY2B 1NGFA 3DXKA 4BRCA 3EKUA 3KVGA 1LCUA 5ADXA 1XUPO 5BN9A 2P9LA 3ZX3A 2DPNA 2UYTA 5FPNA 2ASMA 3GDQA 4DB3A 4BRKA 1EQYA 2QXLA 3CQYA 3H46O 5EOYA 3O4WA 1KAZA 1V4TA 1NGGA 3AAPA 3ZEUB 4CBUA 1JCEA 2FLOA 3ZETB 1P8ZA 4WQ4C 1SAZA 1BDGA 4CZKA 3SLCA 3QBWA 4CZJA 3UE5A 5AZJA 4QS8A 1ESVA 4Z94A 1HPMA 1GLBG 4H0OA 2IIRA 4BRDA 2EWSA 5I9EB 5AZJB 3WXKA 2HOEA 1BA1A
chains in the Genus database with same CATH superfamily
2JWLA 4GVMA 4FW1A 4CJTA 3TI0A 4KB1A 4CJ7A 2YNGA 4JS4A 3IRXA 1HR0K 4BRLA 3QEIA 3VEWA 2QXFA 5AQSA 4LH5A 4B8AB 1S22A 1BCOA 4W5OA 1XWLA 4DUZK 4M63C 3BGRA 1FJGK 5AQOA 4KI4A 3KKRA 3ITHA 1YVNA 2Z1IA 4Z4EA 5DM6L 1HX1A 2X6SA 3JYTA 4WF9L 2CH6A 3HZ6A 5M1QA 3J7ZO 4CEOA 3KLIA 4CJEA 5M1KA 2BGGA 2HVIA 2BE2A 1FK9A 2OYQA 5ELZA 1RT6A 3H6EA 4JV5K 5KPRA 1TGOA 1E3MA 1SZ2A 1HRHA 4ELTA 3IFRA 3RMDA 4ZHRA 4DR5K 3SUPA 4FJKA 1RBSA 4BR4A 5C25A 1Q7YO 4BR7A 3O9RA 2ATQA 3HSTB 3I33A 4BGBA 3AA3A 3IUCA 1M90O 3I0RA 3C0BA 4CD1A 1K73O 4OPHA 4YOVA 3VF6A 1BHLA 4DR3K 4CHPA 4J2AA 2QWQA 3OYLA 3EN9A 3O4QA 1N8RO 1B9FA 1VQ5N 1KXPA 3TU5A 3G4SN 3T19A 2HBMA 4FLZA 1HUXA 1RILA 2GEMA 2CGKA 1NK5A 2D1KA 4BRAA 4CHOA 1VSDA 5E26A 3NH0A 3OY9A 1U48A 3O3FA 4CJWA 3NH2A 3I8DA 3MCAB 3U9ZA 5BPMA 2HHXA 4M3XA 4NXMK 3NDKA 3CD6N 4C8LA 4BC3A 3MN6A 4KFBA 2Q0UA 5LJVA 5CYQA 3HL8A 2WFBA 3M1FA 1IBKK 2ZWHA 3LWMA 1ATSA 4JKDA 1NKEA 4W5NA 3QEWA 4K41A 4IOCL 1WNSA 3D7EO 4N76A 2WUSA 4IXCA 1UA0A 1SUQA 3L2UA 4DWIA 4JI5K 1Z05A 3DXMA 4FLXA 3DRSA 4X65K 5EY4A 2YCHA 4JK9A 1VQ6N 1RBRA 4GNIA 3VA0A 2O8CB 3HJFA 4E89A 3HM9A 2D0CA 5AJ3K 3LANA 2G8UA 4JD2B 3MWTA 3OTOK 3RVCA 4CZGA 3CMEN 1NMDA 4JI1K 5CYMA 4BR2A 4BVPA 1FW6A 2UU9K 3OW2M 1R59O 5GAHP 1C6VA 1NOZA 3S3MA 2O8FB 3SAGA 1S5JA 4LF5K 2W6KA 1NK8A 1HNZK 3CI5A 3UKUB 4FM2A 4ID1A 1KSPA 5F2RA 4RG8A 2YHWA 4BRIA 4TSXA 4BGAA 5KTQA 4AF1A 5FDLA 4Z4GA 4FLWA 4A2BA 2V52B 4DHYA 1P90A 2P9IA 4DMNA 5GINA 2P9KA 2QKBA 3KKSA 3ASMA 2Q36A 4CHQA 3MXIA 1VK0A 3AVKA 4IO9L 3A5LC 2QI2A 3HT3A 2ZQBA 4O44A 1JL1A 4CJFA 3SV4A 4CF0A 4DR1K 4BACA 4CJ4A 3O4NA 4Y1CA 3R1XA 4RW6A 4IFEA 3KD1E 3C7NA 3AVHA 2ZF5O 3HK2A 1J5EK 4M3YA 1GLDG 2P9UB 2UUBK 4YY3K 1BQNA 5AZIB 2VGMA 2YNFA 1HYSA 3R3LA 3DOLA 3WXMB 4YFUA 3E9LA 3MWPA 4GV3A 3WEEB 1NGCA 3CPWM 1WAFA 4WFBL 4F9OA 4DSKA 3CCMN 3SPYA 3OHRA 3I55N 3F9KA 1SL0A 1S1WA 2XHBA 3IS9A 2Q97A 5EU7A 3VGKA 3CFRA 4HUGA 3RTVA 2I7PA 1U2VA 4YDUC 2A41A 3TAPA 5AQNA 3CMAN 1NLVA 4XIUA 1NBWA 4FWQA 5HROA 3CCSN 1HYVA 4DR7K 5GIOA 2E4LA 4FLVA 1WOQA 4IDKA 4BR9A 4CJQA 2O8DB 4GKKK 4KAZA 3OS0A 2I5JA 2WBNA 3M8SA 2HBJA 1BGXT 2I7NA 2VYPA 3OYIA 4HUFA 4FJNA 4LD0A 4DTOA 2W40A 2P5GA 1GLCG 3UB5A 3ZCMA 4JHDA 3D2EB 4FWNA 4CI6A 1KVCA 3WQTA 2E1YA 3TTFA 4H5NA 1L3TA 2YJFA 4KHYA 3LP3A 1S6PA 1HKGA 2FSJA 2YV0X 4WQ5C 4FJ8A 3NF7A 5JS1A 1TL3A 2JLEA 3MN7A 3W0LA 4BR0A 3QERA 3THYA 2V51B 4OO1J 1Z26A 3LP2A 1KLMA 3DRRA 1T44A 3OYKA 2HHSA 1Y97A 4EFHA 2PYJA 3BZKA 1BISA 4NXNK 3L2QA 4K42A 5J2MA 4WYBA 1WAJA 4JKHA 3DLLL 3D2FB 1SQKA 3TARA 1RTIA 4F3OA 4C8NA 1T6CA 1YTAA 2IC3A 1YJWN 3GBTA 4IOXA 3ZSVA 5C12A 4LFCK 1NG9A 5C0YA 2D0OA 1KCFA 1YF5L 1VRTA 5BN8A 4CJKA 1BWFO 4Z4CA 1S6QA 1D5AA 4R5PA 1W0HA 4FPBA 3TSUA 2JWKA 1DLOA 4QOZB 2OPSA 3DAWA 3KWGA 1RBUA 4H5WA 3W3DA 5D3GA 1ILYA 4PUOA 3SCXA 2ZJPL 4BWMA 3WXIA 4RW9A 3LPTA 1TAUA 2GBZA 3L2VA 4FXDA 2GX9A 4IO8A 2QWRA 4OVLA 3V1OA 5K14A 1BUPA 1DTQA 4FLYA 4BRNA 5AQPA 3SUOA 3OYMA 5AQMA 4O0JA 1NGIA 3O3GA 3BY5A 1VQKN 4BDYA 3M5RA 2YHBA 3VQAA 3LZIA 4OKKA 3OYFA 1KD1O 2YKMA 2HNDA 3B6OA 1L3VA 3DRPA 3O80A 4HTUA 3A0IX 2P9SA 4KHQA 4F8RA 1BI4A 2FBYA 3AARA 3T3FA 4DSFA 2FF6A 1CZBA 3O9UA 4X66K 2ASOA 3NHGA 1BCMA 2J4RA 2KFNA 5FLXO 3K5MA 4H0VB 5AQFA 3C6HA 2QK9A 3KLGA 2XO7A 4RCHA 3RSEB 4JRQA 4GY2B 1TV6A 4DQPA 5BN9A 2P9LA 1VHXA 2NNWA 4W5RA 2XY7A 3KK3A 3DI6A 4DTXA 3CQYA 3H46O 2VQFK 3V9XA 4H4OA 2E6LA 1V4TA 1OVQA 4CBUA 1JCEA 3OJUA 3QEVA 1SAZA 3AO4A 2BH1A 1ESVA 5AZJA 3THWB 1WLJA 4K8XA 5CHIA 1UA1A 4BRDA 2P51A 3AVFA 4CIGA 3VTIA 3CM6A 1YT3A 4F2RA 3E9OA 1BA1A 3LDQA 2VG5A 4CK1A 4DTPA 1VQ8N 4PA1A 1JLGA 1EXQA 3LZJA 2ASPA 4CZMA 2X78A 3NMUA 2CGLA 3CC2N 3RMBA 3FZLA 3VQ6A 3MX2A 5AQXA 1WUAA 3NBPA 3KLHA 1VSIA 3C95A 1HLUA 1W97L 1IH7A 2A40A 4JN4A 4ISGA 1L5UA 5HRSA 3G0ZA 1KFSA 3CCEN 4DFPA 2IDOA 3WQUA 4FJ7A 4ISEA 3CJAA 3O9TA 4FK4A 4DQQA 4FWMA 4O55A 3JXUA 4PY5A 3MCPA 4CEDA 4KHSA 1U6ZA 4GKJK 1KAYA 4JI3K 4ELVA 4LF6K 3AGKA 3TANA 1L3UA 1DGKN 4LFBK 3AY9A 4DUYK 2E2QA 4FJLA 3P31A 3K9JA 3CJ9A 4CGGA 4NYNA 4DFJA 2VG7A 3M8PA 3R6MA 4KHWA 4FK2A 5KRTA 4AQYK 2YX6A 2E8AA 3KLFA 2UUAK 1NJIO 2WOMA 4I9QA 3WNEA 2PY5A 1OH8A 5BRDA 3AVAA 3OVNA 4NCAA 4CESA 3KZBA 2KLAA 1QQOA 3ATUA 3IMXA 4HWIA 3VENA 1ZYQA 3HYFA 1CZ9A 3FFIA 4B1ZA 1TKTA 5BR9A 5HBMA 1VSFA 4JK8A 2EX3A 3VQ5A 2HHQA 3U3YA 4KH6A 1U45A 1Z25A 4DF8A 4WQ4A 3MDQA 4BRHA 1YVUA 1XMOK 4DS5A 2NRRA 3HPHA 3JS6A 4I6MB 1BIZA 4FPAA 4CD3A 2ITGA 1Q9XA 3QICA 5E84A 3RWUA 4AHTA 4DG1A 5KPZA 4A62A 3Q7BA 4E3SA 1NKBA 3K2PA 3RR7A 4R79A 1JL2A 4YORA 1U4BA 4MO4A 4Z4HA 1X1PA 2ZGZA 1WSGA 3M6GA 3VQPA 3TAQA 3CC4N 4BR5A 3ZT3A 3SQ1A 3PO4A 4CGDA 5MLCQ 3L8BA 3DXMB 1QS4A 1X3NA 3NH1A 2HHHK 3HPOA 1RGIA 4YHHK 4H0PA 3EEQA 3DLKA 5KPTA 1T6DA 5ADXH 4M7XA 1XNRK 4CCHA 1TYQA 1A5WA 1O13A 5JVHL 1DTTA 3KHYA 1ZBUA 3ULEA 4BC4A 4WFAL 1NJYA 3BZCA 3G6EN 4M3RA 4FJHA 4CFAA 3KJVA 2DFFA 3CJBA 3Q7CA 4FM1A 3SQ4A 3ZSYA 3SBGA 4JI2K 2HHTA 3VEYA 5SZTA 3VERA 3THXA 2P9KB 3VQ8A 3SAFA 4XH5A 3U8XA 2ZJQL 4FWKA 5CR4A 3O08A 4FOEA 1YXQA 2PZSA 4DV0K 4PKGA 4LSLA 1QTMA 3O5BA 4DV3K 4KI6A 3WNGA 1QQMA 3K57A 3RRGA 4FL9A 4JKBA 4NCBA 3DWLA 3G10A 3ZT0A 3ZT2A 2FSNA 5C15A 1TUUA 3HSCA 2F8SA 2FBVA 4DLGA 2QKKA 3OYEA 3THVA 1NJZA 1XI1A 1Q81O 4JKGB 4Q0BA 1W2BM 3DOKA 3F2KA 5AQIA 3NAEA 3DLHA 1H1VA 1ATRA 3OYJA 4F2SA 1RTDA 4BG9A 4OJRA 4AM7A 3P1GA 3EZWA 4DQ8A 4KO0A 1NJWA 2NRWA 1C0TA 3LL3A 1YI2N 1E4FT 1HYZA 5AQUA 4DQIA 2GWJA 5HLFA 3I0SA 4O8KA 3AGRA 3KIOA 4JNEA 4WFNL 4FYDA 2JGUA 4E1JA 4YOWA 4BRQA 4JS5A 2WTUA 4OLAA 3C6UA 4CZHA 5IWAK 4E1NA 3SYZA 3HPGA 3LP0A 5FPEA 3QO9A 4E19A 4PL8A 2AJQA 2E5LK 3GE1A 2CH5A 2V7YA 1VQNN 5EXWA 4YOUA 3OBYA 2H3GX 3BDPA 3E9PA 1YUWA 4CJSA 3O8MA 2QWPA 1N5YA 1IKWA 4EIAA 3V9SA 1YIJN 3ZEUA 3ZSWA 4CZFA 3ZETA 4H0YB 5BPLA 3H3NO 4JHDB 2VG6A 4DU1A 3CCVN 4M3UA 2DTUA 4IG0A 1VQLN 1KVBA 2KW4A 1Q8IA 3LDPA 4DSJA 3N4PA 4E1MA 4MLHA 4JKFA 4ZTFA 4CF1A 4NLCA 2IVPA 5DMRA 4IWVA 1WSIA 4FZYA 3TR8A 4U67L 3EKSA 2O8BA 4B1XB 2ZD1A 1NM1A 2LSNA 4F4KA 3BF1A 1X9WA 4E7HA 3CQXA 2GUPA 3TTCA 3ZT4A 4CK3A 3RMAA 2BTFA 5AR0A 1SKSA 4L8RB 1TAQA 3QBXA 2HHWA 1RDCA 3WNFA 4DLEA 1WBDA 3K59A 1B92A 3V9ZA 3KK2A 5AFUH 1EKEA 1RFQA 1XC3A 3L3UA 1HJRA 4BC2A 3QDKA 1MA9B 2ITMA 1GLAG 5HRPA 2G8WA 2RE2A 4RTFD 4B9VA 1N33K 2YJEA 4BRMA 2A3ZA 2G8KA 4IG3A 4RW7A 2OTJN 4OGEA 4H8KA 4CERA 3TABA 2Q31A 1X3MA 4CJLA 1WSFA 4WE1A 5GADP 3ZSZA 4K0KK 5EX5A 1ATNA 4DFMA 4DTMA 3PO5A 4FJ5A 4JKEA 4A59A 4LF9K 5J2QA 1XQSC 1HKCA 3PLAA 4X62K 2HF3A 3FZMA 2QEXN 3SQ2A 4IKFA 2HW3A 3DLEA 1HNVA 5BRFA 5JS2A 4B1VA 2E1ZA 4M7YA 2HMIA 2QWOA 4FWLA 2FSKA 3WXJA 2E88A 4J8FA 4GV9A 4DSIA 4DQRA 3IG1A 4K8ZA 1JCFA 3VETA 4CZIA 3TTDA 4OPKA 5GAEP 3K5OA 2NRXA 3FFKB 3K0SA 1KLNA 3PX6A 1JLCA 3NGZA 3HP6A 4JI7K 2WC9A 2D5RA 2UYTA 4DTJA 4O5BA 3QEPA 1EO1A 3GDQA 4DB3A 3MXJA 1EQYA 3L2WA 1OH5A 2OZMA 5EOYA 4B9LA 1IKXA 2WONA 4CGFA 2G8HA 5SWMA 2F4VK 1P8ZA 4WQ4C 1X9SA 3EE9A 4CF8A 4HCCA 4OKJA 3SLCA 4CZJA 4KH4A 1VSLA 4OPJA 4H0OA 2EHGA 2EWSA 5AZJB 2RHKA 1ZBFA 1ZBLA 1VQMN 1K8AO 4B3MK 4B3TK 2O8CA 2D0BA 4FJJA 3O1BA 4BWJA 5AQYA 3LM2A 4DU4A 2IGIA 4Y0WA 1EX4A 4B1UB 3H1QA 5LMNK 2PYLA 4JD2A 2NLXA 3CJ7A 1IG9A 1YHQN 3VESA 1Z6RA 3PSFA 4A5AA 4UY8O 2GTDA 1JLBA 4H0XB 2F9TA 4FWOA 4Q5VA 2O8FA 2VWJA 3SZ2A 3KK1A 2FF3B 1WN7A 5KI6A 3UKUA 4GV6A 1N32K 1Q82O 3WT0A 5HL7L 3FGUA 3O1WA 5I3UA 2KQ2A 2P5OA 2P9NB 5C42A 1C1BA 2P9PB 3QINA 3EO3A 2Q0RA 3NVMA 2OA8A 1BG3A 4FJ9A 4M3ZA 4DCHA 2RN2A 2XRIA 1DT9A 3L0QA 3ZSRA 3KD5E 4PKHA 3R8EA 4BQZA 3CCQN 4OLBA 1X9MA 1E4GT 2BUPA 1UAXA 2IS3A 3LDNA 1NKCA 4DTNA 1WBBA 1U49A 2OTLN 4Z0UA 2P9UA 2KTQA 4K25A 1IBLK 4GMJB 4FWPA 4CEAA 5AZIA 3LAKA 4DV6K 1YTUA 5F0XA 1RBVA 1D8YA 3DJCA 5T7BA 4JI8K 3WEEA 3MAQA 4CHNA 3O6WA 3MEGA 3CJ1A 1LAVA 1T05A 1JCGA 4IEIA 5M1PA 1NJXA 1QHTA 4FVMA 4AHSA 3SAHA 3CF5L 4FK0A 1OKJA 4ZTJA 1S1XA 2Q1NA 4CIFA 5J1EA 1ZBSA 3FZKA 3SPZA 1J54A 1TL1A 1KAXA 1S1VA 1K8KB 3QIPA 3AVJA 1EWRA 2O8EB 2FBTA 3AVLA 3BUZB 1J53A 1T3VA 1SL1A 2E2NA 2NUBA 1RDDA 1IKYA 4CE9A 4MO5A 4CW7B 3ZX2A 3QETA 4H4MA 1OH6A 1I94K 3RR8A 4FJIA 4FVUA 4JI0K 1QQCA 1TUYA 3DXKB 4OPAA 3TSPA 2A6AA 3P39A 3SK3A 5J2NA 2VWKA 1B9DA 3FE1A 2O8DA 5B8HA 1RDUA 3M3ZA 3DLRA 3O3HA 3V9WA 3QEXA 4DV4K 3BP8A 3AVNA 4XEIA 2QW9A 4CHYA 3NFAA 5AQWA 3SBTA 4BRGA 5KRSA 4NYFA 3I56N 2HNYA 4L3QA 4CGIA 1NK4A 1NWKA 4HTLA 1T03A 3D2EA 3F5TA 2YNIA 5M1NA 3L2RA 1OH7A 4XH4A 3A5MC 4EHTA 4G9ZA 1ASWA 4FM0A 3OJSA 1LWCA 4DTRA 3H1VX 4FOIA 1VQ7N 1NGJA 3LALA 4BDZA 2ZM6K 4J2EA 5LJWA 3PSIA 3ENHA 3P4IA 4JKAA 1VAZA 5M1OA 4BE2A 2OZSA 4RW4A 3EE8A 3VEZA 1CLQA 3ZSXA 1RDBA 4IZ9A 5CE3A 4AILC 3HTVA 3PX0A 3CQ8A 3D2FA 4GVEA 4A57A 1S72N 3VTHA 3FR0A 4DF4A 4QAGA 2UUCK 4B9UA 3QFUA 4CGHA 2Y1JA 1I3AA 1C0MA 4B1YB 4FCYA 2XY5A 2KHOA 4CEBA 1KVAA 4M3WA 3U6FA 1K6YA 4KTWA 3CYMA 1KTQA 3P5JA 1RTHA 4JYAK 5AQRA 3LM9A 3IAYA 1J9AA 1TK8A 2UXBK 5AQTA 1YITN 4QS9A 2Z1JA 2A5XA 1NGEA 5CY4A 1FKOA 4DSEA 1HQUA 1L3SA 1O1WA 2NRTA 3ID8A 1K9MO 1W9HA 3TWHA 3A5NC 1NOYA 2QTDA 4DFKA 1GOAA 3CXCM 4A61A 3MECA 1QZ5A 1T7PA 4CGJA 3HM8A 5FRMA 4CEQA 1VSMA 1JLAA 4BRFA 1HNXK 5HRNA 2Q3SA 3H08A 4E7LA 3BF3A 1I39A 2OANA 2QWNA 1BU6O 3FZFA 3D6RA 1VSKA 4CJ3A 5JMVA 1JLQA 4PQUA 3OYHA 4ILJA 2W42A 1RDWX 4AHUA 4B9MA 4DV5K 5AQKA 3RSEA 2GELA 3HBTA 5J2PA 3VOVA 1LV5A 4KRFA 1XHZA 5AQHA 4KKOA 5AQGA 1KC8O 3PUFA 1YJNN 1NK0A 1EWQA 4J2DA 1BL3A 3MEDA 3LAMA 3MMVA 3ATVA 1IJJA 5HRRA 1VSJA 3LP1A 4O8UA 3U9DA 3TAGA 2E2PA 2IOCA 4FJXA 3UKRA 3L4IA 3AVIA 1NGAA 3THWA 4CZLA 1QZ6A 4BRPA 4BG8A 2KZZA 1MU2A 4O0IA 3E1YA 4B9QA 3B6PA 4BQLA 1ZBHA 4DS4A 3P83D 1EP4A 3AVCA 3V1RA 1D9DA 3OYDA 1YAGA 2Z1GA 1CXQA 3VF4A 4CEFA 1GLFO 2QM1A 4C1NK 3S3NA 3LDLA 1RT1A 2B6AA 1GLLO 3VQ7A 2O8BB 4FLTA 3K5NA 1CZAN 1KFDA 2YNHA 4JEPA 4DV7K 3TPQA 1RT2A 4BROA 4B3OA 2P9IB 3HVTA 3FLCO 5KGXA 1MWKA 3SMPA 3MEEA 4MQ3A 3VF2A 2B4JA 4BREA 1VQ4N 2HHVA 1RBTA 4W5QA 4JKCA 3LDSA 1NK6A 3OYGA 3MN5A 1X9JA 2F96A 4LSNA 4B08A 2OPRA 3CG7A 5BRHA 1F21A 1GLJO 2GWKA 3WUHA 3C7NB 1RT7A 4E0DA 1TKZA 3ISNC 1T8EA 2G8FA 1NNEA 1R0AA 3S3OA 1KQSM 3RMCA 3OYNA 3CCUN 1LWFA 1RDAA 4NO7A 4B9SA 3G25A 1WSHA 4FJGA 5AQZA 4LC9B 2PAVA 5M1FA 5AQLA 1NK9A 2IVNA 5C10A 4Z4IA 2HF4A 4LY7A 2NRHA 5BPNA 3T69A 4CBWA 2F8TA 1GOBA 1RNHA 1KRPA 2OPQA 2VCPA 4KV8A 1IV0A 5F1XA 1BA0A 4E7KA 2HVHA 4EHUA 3CCJN 1JKHA 1U2VB 3TAFA 4K43A 3AVMA 4JI6K 3VQQA 1TK0A 1C0FA 4DQSA 4EP5A 3A8YA 3DLBA 4H5TA 4CFDA 4RWTA 1QE1A 3SJHA 3MN9A 4FWRA 3CERA 4I6MA 2Q2RA 4IFYA 4O5FA 3KK7A 1XNQK 4ILGB 1LW2A 1HNIA 3EZ5A 2D4WA 3D0PA 4DTUA 4OGCA 5FROA 4B1WB 1QQNA 4FO0A 1S9EA 1NGFA 1SV5A 3HO1A 4BRCA 3EKUA 3KVGA 1U47A 4AHVA 2DPNA 5FPNA 3KWIA 3HRGA 4FLUA 3O9SA 2QXLA 1XMQK 3AA5X 3O4WA 1KAZA 4BE1A 3OYCA 1VSEA 1NGGA 4DR4K 4I9LA 2FLOA 3AVGA 1BIUA 3AV9A 4CZKA 3QBWA 5KGWA 4KH5A 3UE5A 4Z94A 4IFVA 1TVRA 4CJ5A 1GLBG 4C8KA 2IIRA 2KZMA 5GIPA 3AO3A 2HOEA 3J81O 2UXDK 3THYB 4CJVA 1SL2A 4CHZA 3VMFB 3QLHA 4CF2A 1JJ2M 4ID5A 4W5TA 1QSSA 3LPUA 5HOOA 2HMPA 4DV1K 1G15A 2HSTA 2UXCK 1HPZA 2FBXA 3TSQA 5AFUA 3C6TA 4IJNA 1SKWA 1C1CA 2A1RA 3PV8A 1UOCA 4E7JA 2BDPA 3OYAA 3HOTA 3E01A 1MWMA 4JAXA 1ZC6A 1RTJA 2YHXA 3U4LA 5JVGL 1IKVA 2NRVA 5C2DA 2E6MA 1NGBA 2E20A 5DK5A 4H5VA 4FWSA 2F7TA 3ZYYX 3AO2A 4M3TA 4ISFA 1Q18A 1S9GA 3ZX0A 3MK6A 3TAEA 2NZTA 4UQGA 4OX9K 2AP1A 3OS2A 2QA4N 2GV9A 4IDHA 3SMSA 1QHAA 4HCBA 3EY1A 2OPPA 1CXUA 4DKWA 3T1HK 3K58A 3S41A 1ITGA 1LWEA 3AVBA 3D45A 4CVNE 1UWBA 3VQCA 4JKGA 4KHUA 1WB9A 3PX4A 4ICLA 1HJOA 4PL7A 2P1JA 2RKIA 4NB4A 1QSYA 2HBLA 2YKNA 3VQBA 4X64K 4J2BA 4B9NA 1NMNA 2ZGYA 2F9WA 3P38A 2P9SB 4C8OA 3QNOA 1RT3A 1BI4B 3B8AX 1U04A 2FXUA 3AAQA 5TKYA 4BE0A 4E7IA 4LF7K 4A2AA 3QNNA 4GW6A 4HVJA 5FPMA 2PBDA 4BDPA 4CJRA 3IDHA 3QFPA 3A5OC 5E41A 4KREA 2VWBA 2QWLA 3ZSQA 4DR2K 4YNQA 5JLHA 2P9LB 3VQ9A 3EL2A 3OYBA 2YHAA 4KHPK 4CF9A 1FXXA 3A2FA 3T1YK 3HXMA 3CFOA 1JXEA 1JXBA 3C94A 5LL6Z 2AA4A 3SQ0A 4FZXC 4KBOA 4ELUA 5CZ2A 2XY8A 3UIQA 5EVZA 3E66A 4CJPA 2KFZA 5C24A 4IOAL 5GAGP 4H03B 3F9MA 2DY4A 1BO5O 3M8RA 2FC0A 4BC5A 4I2QA 1Y64A 2ETJA 3VQEA 4HHTA 4DSLA 1ZXOA 1NK7A 4N41A 3MX5A 2Z1HA 3V9UA 3VGMA 4CFCA 2HNZA 3C65A 4LF4K 2DFEA 4CJUA 4U7BA 3T1AA 4PHTX 2Y1IA 2KKZA 3JSMA 4ILHA 4MLEA 3SJJA 3BEXA 1DEJA 3C6AA 1IBMK 4CECA 2VQEK 2HBKA 1XC9A 3VQDA 3GL1A 3ENBA 3QMLA 3ZT1A 4KPYA 2A42A 3CIPA 4KTQA 3GG4A 5HP1A 2ZE2A 4CIEA 3GOIA 3FZHA 3WXLA 1N34K 4MDAA 3DYAA 5C2FA 5KQDA 1A5XA 4MFBA 3M8QA 4EP4A 1BQMA 4B3SK 5H1SQ 4B8CA 2OCEA 4C1NI 5FPDA 3CFPA 1QVFM 4M41A 4EAHD 4CEEA 1G99A 5A2QO 1D4XA 1M1KO 1MDUB 3L4QA 1LW0A 3NF9A 1C0UA 1WSEA 2BANA 2G8IA 1WSJA 3OS1A 5CZ1A 1XHXA 3L6QA 3ID6A 1YJ9N 4M42A 3K5LA 4G1QA 3ZSOA 4YOTA 4NCGA 3VGLA 1JLFA 1IG8A 2W6LA 3IKMA 5LY3A 4HUEA 4EZ9A 3NF6A 3AO5A 5JLFA 3I8BA 2NRZA 4AM6A 3J7AP 1D9FA 1HQEA 3NF8A 1GLEG 3WNHA 1REVA 2HB5A 4MDBA 4AHRA 1SS6A 4PWDA 2E2OA 1N36K 3RRHA 1HNWK 4I7FA 3AA2A 1J6ZA 3OBWA 3PIOL 5DM7L 1S3XA 4WCEL 3QB0A 3L3VA 3VEOA 4CZEA 2V7ZA 1S1TA 1HKBA 3V81A 2X6NA 2O4IA 3CHWA 5AQVA 2R7YA 4RW8A 4IJAA 3ENOA 3QESA 1ZBIA 1GOCA 3H3OB 3S9HA 3OA9A 4QS7A 3HVRA 1VRUA 2PFUA 1DKGD 2YI1A 1SKRA 3K9KA 5I42A 3UKRB 4KTZA 3HP9A 3U3GA 5AQJA 5BR8K 3VEVA 1TYQB 3J8AA 4LF8K 4H5RA 5AQQA 3NCIA 4IEEA 4JRPA 3V4IA 4H0TB 1RCHA 3NGIA 3ULEB 4YOYA 3DM2A 1OVYA 1BOTO 2CGJA 4N47A 2HHUA 4C8MA 1TKXA 2RF2A 2X74A 3J80O 4DU3A 4QCLA 3H45C 1VQ9N 4FJMA 4IBNA 4CBXA 2D0PA 3DLGA 1VQPN 4DV2K 4LFAK 1C1AA 4BY9C 3ULDA 3SNNA 1JLEA 3CC7N 3CM5A 1NGDA 3LDOA 5FRNA 4XH1A 3THXB 4AH9A 3KLEA 3CETA 4B3RK 4C23A 4KHNA 1V4SA 2P9NA 1A5VA 3AO1A 3SUQA 3KTQA 1IO2A 2P9PA 3O9QA 3N4QA 2XY6A 1ASVA 4A5BA 1C0GA 4FW2A 2G8VA 4N56A 1QVGM 2GUIA 3VA3A 4AHCA 1NU0A 1RT4A 1W7AA 4KB0A 3V1QA 1NGHA 3NVKA 3R9PA 4YDUA 3T7ZA 4BVOA 1J5OA 4N5SA 4FSVA 3TAMA 2B5JA 3ALYA 3HI0A 5KQ8A 1ASUA 4O4GA 3MXMA 4DTSA 3EYZA 2QWMA 2W41A 4JK7A 3VN5A 1HMVA 4JLHA 3DMJA 4CEZA 3CJCA 2O4GA 4LH4A 4DR6K 1VSHA 4PKIA 2YHYA 4NLBA 3AA4A 4CK2A 5BREA 4OKEA 4Z4FA 1K8KA 5LMUK 5JICA 2VGNA 3VPZA 2D0AA 4EZ6A 3F73A 1LOTB 2O8EA 3PIPL 1N6QA 2A1SA 3VEXA 1S1UA 2IVOA 3G71N 3CCLN 4JI4K 4WQ5A 1FKPA 1EETA 2RPIA 4B9TA 3CCRN 5TKWA 1RT5A 3JAMO 4CFBA 3HOSA 3DXKA 2ZJRL 4M45A 1LCUA 5ADXA 1XUPO 3CPEA 5IT9O 3ZX3A 4I2PA 2ASMA 4V19S 4F3TA 2IAJA 4BRKA 4FZZA 1Q86O 3NE6A 3LWLA 3VQ4A 3PY8A 3AAPA 3ZEUB 1QSLA 3J7YP 3ZETB 1BDGA 3V6DA 4QS8A 3SV3A 1LAWA 1HPMA 1Q9YA 2DFHA 1VQON 3QIOA 3SUNA 5I9EB 3SI6A 4Y1DA 1TK5A 3NGYA 1TKDA 3ZLJA 3WXKA 4YOXA
chains in the Genus database with same CATH topology
3LDQA 2JWLA 3O1BA 1VQ8N 3VMFB 1JJ2M 5AQYA 3LM2A 4CJ7A 4Y0WA 4B1UB 3H1QA 4JD2A 2ASPA 2NLXA 4CZMA 3CJ7A 1YHQN 3VESA 4BRLA 1Z6RA 3VEWA 3NMUA 2CGLA 3CC2N 5AQSA 5HOOA 2HMPA 4A5AA 4UY8O 2HSTA 2GTDA 3FZLA 1S22A 4H0XB 2F9TA 3MX2A 4FWOA 5AQXA 1WUAA 4M63C 3TSQA 5AFUA 5AQOA 4IJNA 2FF3B 1HLUA 1W97L 1YVNA 3UKUA 2A40A 4JN4A 3HOTA 4JAXA 1MWMA 4ISGA 4GV6A 1ZC6A 1Q82O 3CCEN 5DM6L 1HX1A 3WT0A 3WQUA 3U4LA 2YHXA 4ISEA 5HL7L 3CJAA 3FGUA 4WF9L 5JVGL 2CH6A 3O9TA 4FWMA 3HZ6A 3O1WA 5M1QA 2NRVA 5C2DA 3JXUA 2P9NB 3J7ZO 1NGBA 2E20A 3MCPA 2P9PB 4H5VA 3EO3A 4FWSA 2Q0RA 1U6ZA 3NVMA 2F7TA 5M1KA 1BG3A 1KAYA 3ZYYX 4ISFA 3AGKA 1Q18A 4DCHA 3ZX0A 3MK6A 5ELZA 1DT9A 1DGKN 3L0QA 3AY9A 4PKHA 3H6EA 3R8EA 5KPRA 2NZTA 1SZ2A 2E2QA 4BQZA 3CCQN 3P31A 2AP1A 3CJ9A 3IFRA 3K9JA 2QA4N 1E4GT 2BUPA 3LDNA 4IDHA 3SMSA 1QHAA 2OTLN 2P9UA 3R6MA 4K25A 4BR4A 4DKWA 4FWPA 1Q7YO 2YX6A 2E8AA 3O9RA 4BR7A 5AZIA 1NJIO 3S41A 3I33A 4BGBA 1M90O 3IUCA 5F0XA 5BRDA 3C0BA 4CD1A 3DJCA 1K73O 4JKGA 3WEEA 4OPHA 3O6WA 1HJOA 3CJ1A 4PL7A 4YOVA 1JCGA 4IEIA 5M1PA 4NB4A 3KZBA 3SAHA 2KLAA 3CF5L 1QQOA 2HBLA 3ATUA 1OKJA 3VF6A 3IMXA 4HWIA 3VENA 2ZGYA 2Q1NA 2F9WA 2QWQA 3EN9A 3P38A 1N8RO 1ZBSA 2P9SB 3FZKA 4B1ZA 1VQ5N 1KXPA 1KAXA 3TU5A 5BR9A 1K8KB 4JK8A 3B8AX 3G4SN 2HBMA 2FXUA 1HUXA 3AAQA 4KH6A 5TKYA 4WQ4A 2GEMA 4A2AA 3MDQA 4BRHA 2CGKA 2D1KA 4BRAA 2NRRA 3BUZB 3JS6A 4I6MB 1T3VA 5E26A 5FPMA 2E2NA 2PBDA 4FPAA 4CD3A 3MCAB 3U9ZA 3IDHA 4MO5A 3QICA 5E84A 3QFPA 3ZX2A 3A5OC 5BPMA 3CD6N 4FVUA 5KPZA 4A62A 4BC3A 1TUYA 3DXKB 3MN6A 3Q7BA 2Q0UA 2VWBA 2QWLA 4OPAA 3TSPA 5LJVA 2A6AA 2WFBA 2P9LB 3M1FA 3EL2A 3P39A 3SK3A 4YORA 4R79A 5JLHA 2ZWHA 3FE1A 1ATSA 4JKDA 4MO4A 5B8HA 1RDUA 3M3ZA 4K41A 4IOCL 3D7EO 2ZGZA 2WUSA 4IXCA 3M6GA 3CC4N 2AA4A 4BR5A 1Z05A 3BP8A 4KBOA 4XEIA 3DXMA 2QW9A 5MLCQ 5AQWA 3SBTA 4BRGA 3I56N 4L3QA 5EVZA 1NWKA 3E66A 4HTLA 3DXMB 3D2EA 5EY4A 3F5TA 2YCHA 1X3NA 4JK9A 4H03B 3F9MA 5GAGP 5M1NA 1VQ6N 1BO5O 4IOAL 4BC5A 4XH4A 3A5MC 1RGIA 4EHTA 1Y64A 4GNIA 4G9ZA 4H0PA 1ZXOA 5KPTA 1T6DA 3MX5A 5ADXH 4JD2B 3VGMA 3H1VX 4M7XA 3MWTA 4FOIA 3RVCA 4CZGA 1VQ7N 3CMEN 1NGJA 1NMDA 1TYQA 3C65A 4BR2A 1O13A 4BVPA 5JVHL 3OW2M 3KHYA 1R59O 4U7BA 5GAHP 5LJWA 4PHTX 3ULEA 2KKZA 3SAGA 3ENHA 3P4IA 4JKAA 1VAZA 5M1OA 4BC4A 3EE8A 3VEZA 4ILHA 3CI5A 4MLEA 3BEXA 1DEJA 4WFAL 3G6EN 3C6AA 3UKUB 2HBKA 5F2RA 3GL1A 4IZ9A 5CE3A 2YHWA 4BRIA 3CJBA 3ENBA 3Q7CA 3QMLA 4BGAA 4AF1A 3HTVA 3SBGA 2A42A 4A2BA 2V52B 3CIPA 3D2FA 4GVEA 3VEYA 4A57A 3GG4A 4DHYA 1S72N 3VTHA 1P90A 2P9IA 3FR0A 3GOIA 2P9KA 3FZHA 3VERA 5GINA 3WXLA 3QFUA 2Q36A 4MDAA 2P9KB 4IO9L 3A5LC 2QI2A 3SAFA 4XH5A 3U8XA 4B1YB 5C2FA 5KQDA 2ZJQL 4FWKA 5CR4A 2KHOA 3O08A 4FOEA 1YXQA 5H1SQ 4PKGA 3R1XA 4C1NI 5FPDA 1QVFM 3O5BA 4EAHD 1QQMA 4IFEA 1G99A 3C7NA 1D4XA 4FL9A 1M1KO 1MDUB 3L4QA 2ZF5O 4JKBA 3DWLA 1GLDG 2P9UB 5AQRA 3LM9A 5AZIB 2VGMA 2FSNA 3R3LA 5C15A 1TUUA 5AQTA 3L6QA 1YJ9N 3ID6A 3HSCA 4QS9A 3WXMB 1YITN 3E9LA 3MWPA 4YOTA 2A5XA 3VGLA 4GV3A 1IG8A 4JKGB 1NGEA 3WEEB 1W2BM 1Q81O 1NGCA 3F2KA 3IKMA 5AQIA 5LY3A 1H1VA 3CPWM 1ATRA 4WFBL 2NRTA 3ID8A 1K9MO 4BG9A 4F9OA 4AM7A 3CCMN 5JLFA 3OHRA 3I8BA 3A5NC 3EZWA 2QTDA 2NRZA 4AM6A 4DQ8A 3I55N 3CXCM 4A61A 1QZ5A 1GLEG 3HM8A 2NRWA 2Q97A 4MDBA 4BRFA 1SS6A 3VGKA 2E2OA 3LL3A 1YI2N 1E4FT 3BF3A 2I7PA 5AQUA 2GWJA 1U2VA 2OANA 4YDUC 2A41A 2QWNA 1BU6O 4O8KA 3AGRA 4JNEA 3FZFA 5AQNA 3D6RA 4WFNL 1J6ZA 1NLVA 3OBWA 3CMAN 4E1JA 4YOWA 4BRQA 5JMVA 1NBWA 5DM7L 4FWQA 1S3XA 4CI6A 4WCEL 3PIOL 3CCSN 4ILJA 3QB0A 4CZHA 3VEOA 4CZEA 2V7ZA 5GIOA 1RDWX 1HKBA 1WOQA 5FPEA 4PL8A 5AQKA 3RSEA 3GE1A 4BR9A 2CH5A 2GELA 2V7YA 3HBTA 5EXWA 3CHWA 3VOVA 4YOUA 1VQNN 2WBNA 5AQVA 3OBYA 2HBJA 2H3GX 2I7NA 2VYPA 5AQHA 5AQGA 3E9PA 1YUWA 4IJAA 1KC8O 3O8MA 2QWPA 3ENOA 1YJNN 2W40A 4EIAA 1GLCG 3UB5A 3H3OB 1YIJN 3MMVA 4JHDA 3ATVA 1IJJA 3D2EB 3OA9A 4FWNA 4QS7A 2PFUA 3ZETA 4O8UA 3U9DA 1DKGD 3WQTA 4H0YB 4CZFA 2E1YA 3TTFA 3H3NO 4JHDB 5BPLA 4H5NA 2E2PA 2YI1A 2YJFA 3UKRA 3L4IA 3CCVN 1NGAA 1HKGA 2FSJA 4CZLA 1VQLN 3K9KA 4WQ5C 1QZ6A 3UKRB 4BRPA 4BG8A 3LDPA 3N4PA 3E1YA 4MLHA 4B9QA 4JKFA 3MN7A 3W0LA 5AQJA 4BR0A 3VEVA 1TYQB 2V51B 3J8AA 4H5RA 5AQQA 4BQLA 4NLCA 4OO1J 4IEEA 2IVPA 4H0TB 4IWVA 3ULEB 1T44A 1YAGA 4YOYA 4U67L 3EKSA 3VF4A 1OVYA 1GLFO 2QM1A 4C1NK 1BOTO 4B1XB 4EFHA 2CGJA 3LDLA 1GLLO 3H45C 1VQ9N 1CZAN 1NM1A 3BF1A 4K42A 4WYBA 4CBXA 2D0PA 3CQXA 2GUPA 4JEPA 3TTCA 1VQPN 3TPQA 2BTFA 4JKHA 3D2FB 5AR0A 1SQKA 4BROA 3DLLL 3QBXA 4BY9C 2P9IB 3FLCO 3CC7N 1T6CA 1YJWN 1NGDA 3GBTA 4IOXA 1MWKA 3LDOA 3SMPA 5C12A 4XH1A 5C0YA 2D0OA 1YF5L 5BN8A 3CETA 1BWFO 3VF2A 4BREA 1VQ4N 4C23A 1V4SA 4FPBA 2P9NA 4JKCA 3TSUA 2JWKA 3MN5A 2P9PA 1X9JA 3DAWA 3O9QA 3N4QA 5AFUH 3KWGA 4H5WA 4A5BA 5BRHA 1RFQA 1XC3A 3W3DA 1C0GA 1ILYA 4BC2A 1GLJO 2GWKA 3WUHA 3QDKA 2ZJPL 1MA9B 2ITMA 3C7NB 3WXIA 1QVGM 1GLAG 2GX9A 4IO8A 2QWRA 1KQSM 2RE2A 4RTFD 2YJEA 4BRMA 2A3ZA 1BUPA 1NGHA 2OTJN 3CCUN 3NVKA 3R9PA 4YDUA 3T7ZA 4BVOA 4NO7A 2Q31A 1X3MA 4BRNA 3G25A 4FSVA 5AQPA 5GADP 5AQZA 3HI0A 4LC9B 2PAVA 5KQ8A 5AQMA 5EX5A 1ATNA 5M1FA 5AQLA 4JKEA 4A59A 1XQSC 1HKCA 1NGIA 2IVNA 3ZEUA 5C10A 1VQKN 3PLAA 2QWMA 2W41A 4JK7A 2HF4A 2HF3A 2NRHA 5BPNA 3M5RA 3T69A 4CBWA 3FZMA 2QEXN 3CJCA 1KD1O 2VCPA 4PKIA 3O80A 2YHYA 4NLBA 5BREA 5F1XA 1BA0A 4YOXA 4EHUA 5BRFA 3A0IX 2P9SA 4B1VA 3CCJN 1U2VB 2E1ZA 4M7YA 3AARA 1K8KA 2QWOA 4K43A 2VGNA 2FSKA 4FWLA 5JICA 3VPZA 3WXJA 1C0FA 2E88A 2FF6A 3A8YA 4J8FA 4GV9A 3O9UA 4H5TA 4RWTA 1LOTB 2ASOA 3SJHA 2J4RA 3PIPL 3MN9A 1JCFA 3VETA 4FWRA 3CERA 3VEXA 4CZIA 4I6MA 2Q2RA 4O5FA 2IVOA 3KK7A 3TTDA 3G71N 4H0VB 3CCLN 4WQ5A 5AQFA 5GAEP 4ILGB 3CCRN 5TKWA 2NRXA 3C6HA 2D4WA 3FFKB 4B1WB 4RCHA 1QQNA 4FO0A 3RSEB 3HOSA 4GY2B 1NGFA 3DXKA 4BRCA 2ZJRL 3EKUA 3KVGA 1LCUA 5ADXA 1XUPO 2WC9A 3CPEA 2P9LA 5BN9A 3ZX3A 2DPNA 2UYTA 2NNWA 5FPNA 2ASMA 3GDQA 4DB3A 1EO1A 3KWIA 4BRKA 3HRGA 1EQYA 2QXLA 3CQYA 3H46O 3O9SA 5EOYA 1Q86O 3O4WA 1KAZA 1V4TA 1NGGA 3AAPA 3ZEUB 4CBUA 1JCEA 2FLOA 3ZETB 1P8ZA 4WQ4C 1SAZA 1BDGA 3EE9A 4CZKA 3SLCA 3QBWA 4CZJA 4KH5A 3UE5A 5AZJA 2BH1A 1ESVA 4QS8A 1HPMA 4Z94A 4KH4A 5CHIA 1GLBG 4H0OA 1VQON 2IIRA 4BRDA 2EWSA 5I9EB 5AZJB 2RHKA 5GIPA 3WXKA 1VQMN 3VTIA 1K8AO 2HOEA 3E9OA 1BA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDQ A;  3O1B A;  5AQY A;  3LM2 A;  4CJ7 A;  4Y0W A;  4B1U B;  3H1Q A;  4JD2 A;  2ASP A;  2NLX A;  4CZM A;  3CJ7 A;  3VES A;  4BRL A;  1Z6R A;  3VEW A;  2CGL A;  5AQS A;  2HMP A;  2GTD A;  3FZL A;  1S22 A;  4H0X B;  2F9T A;  4FWO A;  5AQX A;  1WUA A;  4M63 C;  5AFU A;  5AQO A;  4IJN A;  2FF3 B;  1HLU A;  1YVN A;  3UKU A;  2A40 A;  4JN4 A;  4JAX A;  1MWM A;  4ISG A;  1ZC6 A;  1HX1 A;  3WT0 A;  3WQU A;  3U4L A;  2YHX A;  4ISE A;  3CJA A;  3FGU A;  2CH6 A;  4FWM A;  3HZ6 A;  3O1W A;  3JXU A;  2P9N B;  1NGB A;  2E20 A;  3MCP A;  2P9P B;  4H5V A;  3EO3 A;  4FWS A;  2Q0R A;  1U6Z A;  1BG3 A;  1KAY A;  4ISF A;  1Q18 A;  4DCH A;  3ZX0 A;  3MK6 A;  5ELZ A;  3L0Q A;  1DGK N;  3AY9 A;  4PKH A;  3H6E A;  3R8E A;  5KPR A;  2NZT A;  1SZ2 A;  2E2Q A;  4BQZ A;  2AP1 A;  3CJ9 A;  3IFR A;  1E4G T;  2BUP A;  3LDN A;  3SMS A;  1QHA A;  2P9U A;  3R6M A;  4K25 A;  4BR4 A;  4FWP A;  4BR7 A;  2E8A A;  5AZI A;  3S41 A;  3I33 A;  4BGB A;  3IUC A;  5F0X A;  5BRD A;  3C0B A;  4CD1 A;  3DJC A;  3WEE A;  3O6W A;  1HJO A;  3CJ1 A;  4PL7 A;  1JCG A;  4NB4 A;  3KZB A;  1QQO A;  3ATU A;  3VF6 A;  1OKJ A;  3IMX A;  4HWI A;  3VEN A;  2ZGY A;  2Q1N A;  2F9W A;  2QWQ A;  3EN9 A;  1ZBS A;  2P9S B;  3FZK A;  4B1Z A;  1KXP A;  1KAX A;  3TU5 A;  5BR9 A;  1K8K B;  3B8A X;  2FXU A;  1HUX A;  3AAQ A;  5TKY A;  4WQ4 A;  2GEM A;  4A2A A;  3MDQ A;  4BRH A;  2CGK A;  2D1K A;  4BRA A;  3BUZ B;  3JS6 A;  4I6M B;  5E26 A;  5FPM A;  2E2N A;  2PBD A;  4FPA A;  4CD3 A;  3U9Z A;  3IDH A;  4MO5 A;  3QIC A;  5E84 A;  3QFP A;  3ZX2 A;  3A5O C;  5BPM A;  5KPZ A;  4A62 A;  4BC3 A;  1TUY A;  3DXK B;  3MN6 A;  2Q0U A;  2VWB A;  2QWL A;  5LJV A;  2A6A A;  3M1F A;  2P9L B;  3SK3 A;  3EL2 A;  5JLH A;  2ZWH A;  3FE1 A;  1ATS A;  4MO4 A;  5B8H A;  3M3Z A;  4K41 A;  3D7E O;  2ZGZ A;  2WUS A;  4IXC A;  3M6G A;  2AA4 A;  4BR5 A;  1Z05 A;  3BP8 A;  4KBO A;  4XEI A;  3DXM A;  2QW9 A;  5AQW A;  4BRG A;  4L3Q A;  5EVZ A;  1NWK A;  4HTL A;  3DXM B;  3D2E A;  5EY4 A;  2YCH A;  1X3N A;  4H03 B;  3F9M A;  1BO5 O;  4BC5 A;  4XH4 A;  3A5M C;  1RGI A;  4EHT A;  1Y64 A;  4GNI A;  4H0P A;  1ZXO A;  5KPT A;  1T6D A;  5ADX H;  4JD2 B;  3VGM A;  3H1V X;  4M7X A;  4FOI A;  4CZG A;  1NGJ A;  1NMD A;  1TYQ A;  4BR2 A;  4BVP A;  3KHY A;  1R59 O;  5LJW A;  3ULE A;  3ENH A;  3P4I A;  4BC4 A;  3VEZ A;  4MLE A;  3CI5 A;  3BEX A;  1DEJ A;  3UKU B;  5F2R A;  3GL1 A;  4IZ9 A;  5CE3 A;  2YHW A;  4BRI A;  3CJB A;  3QML A;  4BGA A;  3HTV A;  2A42 A;  4A2B A;  2V52 B;  3CIP A;  3D2F A;  3VEY A;  4DHY A;  3GG4 A;  2P9I A;  3FR0 A;  3GOI A;  2P9K A;  3FZH A;  3VER A;  3WXL A;  3QFU A;  2Q36 A;  2P9K B;  3A5L C;  4XH5 A;  3U8X A;  4B1Y B;  5KQD A;  4FWK A;  2KHO A;  3O08 A;  4FOE A;  1YXQ A;  4PKG A;  5FPD A;  3O5B A;  4EAH D;  1QQM A;  1G99 A;  3C7N A;  1D4X A;  4FL9 A;  1MDU B;  2ZF5 O;  3DWL A;  1GLD G;  2P9U B;  5AQR A;  3LM9 A;  5AZI B;  2FSN A;  1TUU A;  5AQT A;  3L6Q A;  3HSC A;  4QS9 A;  2A5X A;  3VGL A;  1IG8 A;  1NGE A;  3WEE B;  1NGC A;  5AQI A;  5LY3 A;  1H1V A;  1ATR A;  3ID8 A;  4BG9 A;  4F9O A;  4AM7 A;  5JLF A;  3OHR A;  3I8B A;  3A5N C;  3EZW A;  4DQ8 A;  4AM6 A;  4A61 A;  1QZ5 A;  1GLE G;  3HM8 A;  2Q97 A;  4BRF A;  3VGK A;  2E2O A;  3LL3 A;  1E4F T;  3BF3 A;  2I7P A;  5AQU A;  2GWJ A;  1U2V A;  2OAN A;  4YDU C;  2A41 A;  2QWN A;  1BU6 O;  4O8K A;  4JNE A;  3FZF A;  5AQN A;  1J6Z A;  1NLV A;  4E1J A;  4BRQ A;  5JMV A;  1NBW A;  4FWQ A;  1S3X A;  3QB0 A;  4CZH A;  3VEO A;  4CZE A;  2V7Z A;  1RDW X;  1HKB A;  1WOQ A;  5FPE A;  4PL8 A;  5AQK A;  3RSE A;  3GE1 A;  4BR9 A;  2CH5 A;  2GEL A;  2V7Y A;  3HBT A;  5EXW A;  3CHW A;  3VOV A;  5AQV A;  2H3G X;  2I7N A;  2VYP A;  5AQH A;  5AQG A;  1YUW A;  4IJA A;  3O8M A;  2QWP A;  3ENO A;  2W40 A;  4EIA A;  1GLC G;  3UB5 A;  3H3O B;  3MMV A;  4JHD A;  3ATV A;  1IJJ A;  3D2E B;  4FWN A;  4QS7 A;  3ZEU A;  4CI6 A;  3ZET A;  3U9D A;  3WQT A;  1DKG D;  4CZF A;  4H0Y B;  2E1Y A;  5BPL A;  3H3N O;  4JHD B;  4H5N A;  2E2P A;  2YI1 A;  2YJF A;  3UKR A;  3L4I A;  1NGA A;  1HKG A;  2FSJ A;  4CZL A;  4WQ5 C;  1QZ6 A;  3UKR B;  4BRP A;  4BG8 A;  3LDP A;  4MLH A;  4B9Q A;  3MN7 A;  3W0L A;  5AQJ A;  4BR0 A;  3VEV A;  1TYQ B;  2V51 B;  3J8A A;  4H5R A;  5AQQ A;  4BQL A;  2IVP A;  4H0T B;  4IWV A;  3ULE B;  1T44 A;  1YAG A;  3EKS A;  3VF4 A;  1GLF O;  2QM1 A;  1BOT O;  4B1X B;  4EFH A;  2CGJ A;  3LDL A;  1GLL O;  3H45 C;  1CZA N;  1NM1 A;  3BF1 A;  4K42 A;  4WYB A;  4CBX A;  2D0P A;  3CQX A;  2GUP A;  3TPQ A;  2BTF A;  5AR0 A;  3D2F B;  4BRO A;  1SQK A;  3QBX A;  2P9I B;  3FLC O;  1T6C A;  1NGD A;  3GBT A;  1MWK A;  3LDO A;  3SMP A;  4XH1 A;  2D0O A;  5BN8 A;  3CET A;  1BWF O;  3VF2 A;  4BRE A;  4C23 A;  1V4S A;  4FPB A;  2P9N A;  3MN5 A;  2P9P A;  1X9J A;  3DAW A;  5AFU H;  4H5W A;  5BRH A;  1RFQ A;  1XC3 A;  3W3D A;  1C0G A;  4BC2 A;  1GLJ O;  2GWK A;  3WUH A;  3QDK A;  1MA9 B;  2ITM A;  3C7N B;  3WXI A;  1GLA G;  4IO8 A;  2QWR A;  4RTF D;  2YJE A;  4BRM A;  2A3Z A;  1BUP A;  1NGH A;  3R9P A;  4YDU A;  4BVO A;  4NO7 A;  2Q31 A;  1X3M A;  4BRN A;  3G25 A;  4FSV A;  5AQP A;  5AQZ A;  3HI0 A;  4LC9 B;  2PAV A;  5KQ8 A;  5AQM A;  5EX5 A;  1ATN A;  5AQL A;  1XQS C;  1HKC A;  1NGI A;  2IVN A;  2QWM A;  2W41 A;  2HF4 A;  2HF3 A;  2NRH A;  5BPN A;  4CBW A;  3FZM A;  3CJC A;  2VCP A;  4PKI A;  3O80 A;  2YHY A;  5BRE A;  5F1X A;  1BA0 A;  4EHU A;  5BRF A;  3A0I X;  2P9S A;  4B1V A;  1U2V B;  2E1Z A;  4M7Y A;  3AAR A;  1K8K A;  2QWO A;  4K43 A;  4FWL A;  2FSK A;  5JIC A;  3VPZ A;  3WXJ A;  1C0F A;  2E88 A;  2FF6 A;  3A8Y A;  4J8F A;  4H5T A;  4RWT A;  1LOT B;  2ASO A;  3SJH A;  2J4R A;  3MN9 A;  1JCF A;  3VET A;  4FWR A;  3CER A;  3VEX A;  4CZI A;  4I6M A;  2Q2R A;  4O5F A;  2IVO A;  4H0V B;  4WQ5 A;  5AQF A;  2D4W A;  3FFK B;  4B1W B;  4RCH A;  1QQN A;  4FO0 A;  3RSE B;  4GY2 B;  1NGF A;  3DXK A;  4BRC A;  3EKU A;  3KVG A;  1LCU A;  5ADX A;  1XUP O;  5BN9 A;  2P9L A;  3ZX3 A;  2DPN A;  2UYT A;  5FPN A;  2ASM A;  3GDQ A;  4DB3 A;  4BRK A;  1EQY A;  2QXL A;  3CQY A;  3H46 O;  5EOY A;  3O4W A;  1KAZ A;  1V4T A;  1NGG A;  3AAP A;  3ZEU B;  4CBU A;  1JCE A;  2FLO A;  3ZET B;  1P8Z A;  4WQ4 C;  1SAZ A;  1BDG A;  4CZK A;  3SLC A;  3QBW A;  4CZJ A;  3UE5 A;  5AZJ A;  4QS8 A;  1ESV A;  4Z94 A;  1HPM A;  1GLB G;  4H0O A;  2IIR A;  4BRD A;  2EWS A;  5I9E B;  5AZJ B;  3WXK A;  2HOE A;  1BA1 A; 
#chains in the Genus database with same CATH topology
 2JWL A;  4GVM A;  4FW1 A;  4CJT A;  3TI0 A;  4KB1 A;  4CJ7 A;  2YNG A;  4JS4 A;  3IRX A;  1HR0 K;  4BRL A;  3QEI A;  3VEW A;  2QXF A;  5AQS A;  4LH5 A;  4B8A B;  1S22 A;  1BCO A;  4W5O A;  1XWL A;  4DUZ K;  4M63 C;  3BGR A;  1FJG K;  5AQO A;  4KI4 A;  3KKR A;  3ITH A;  1YVN A;  2Z1I A;  4Z4E A;  5DM6 L;  1HX1 A;  2X6S A;  3JYT A;  4WF9 L;  2CH6 A;  3HZ6 A;  5M1Q A;  3J7Z O;  4CEO A;  3KLI A;  4CJE A;  5M1K A;  2BGG A;  2HVI A;  2BE2 A;  1FK9 A;  2OYQ A;  5ELZ A;  1RT6 A;  3H6E A;  4JV5 K;  5KPR A;  1TGO A;  1E3M A;  1SZ2 A;  1HRH A;  4ELT A;  3IFR A;  3RMD A;  4ZHR A;  4DR5 K;  3SUP A;  4FJK A;  1RBS A;  4BR4 A;  5C25 A;  1Q7Y O;  4BR7 A;  3O9R A;  2ATQ A;  3HST B;  3I33 A;  4BGB A;  3AA3 A;  3IUC A;  1M90 O;  3I0R A;  3C0B A;  4CD1 A;  1K73 O;  4OPH A;  4YOV A;  3VF6 A;  1BHL A;  4DR3 K;  4CHP A;  4J2A A;  2QWQ A;  3OYL A;  3EN9 A;  3O4Q A;  1N8R O;  1B9F A;  1VQ5 N;  1KXP A;  3TU5 A;  3G4S N;  3T19 A;  2HBM A;  4FLZ A;  1HUX A;  1RIL A;  2GEM A;  2CGK A;  1NK5 A;  2D1K A;  4BRA A;  4CHO A;  1VSD A;  5E26 A;  3NH0 A;  3OY9 A;  1U48 A;  3O3F A;  4CJW A;  3NH2 A;  3I8D A;  3MCA B;  3U9Z A;  5BPM A;  2HHX A;  4M3X A;  4NXM K;  3NDK A;  3CD6 N;  4C8L A;  4BC3 A;  3MN6 A;  4KFB A;  2Q0U A;  5LJV A;  5CYQ A;  3HL8 A;  2WFB A;  3M1F A;  1IBK K;  2ZWH A;  3LWM A;  1ATS A;  4JKD A;  1NKE A;  4W5N A;  3QEW A;  4K41 A;  4IOC L;  1WNS A;  3D7E O;  4N76 A;  2WUS A;  4IXC A;  1UA0 A;  1SUQ A;  3L2U A;  4DWI A;  4JI5 K;  1Z05 A;  3DXM A;  4FLX A;  3DRS A;  4X65 K;  5EY4 A;  2YCH A;  4JK9 A;  1VQ6 N;  1RBR A;  4GNI A;  3VA0 A;  2O8C B;  3HJF A;  4E89 A;  3HM9 A;  2D0C A;  5AJ3 K;  3LAN A;  2G8U A;  4JD2 B;  3MWT A;  3OTO K;  3RVC A;  4CZG A;  3CME N;  1NMD A;  4JI1 K;  5CYM A;  4BR2 A;  4BVP A;  1FW6 A;  2UU9 K;  3OW2 M;  1R59 O;  5GAH P;  1C6V A;  1NOZ A;  3S3M A;  2O8F B;  3SAG A;  1S5J A;  4LF5 K;  2W6K A;  1NK8 A;  1HNZ K;  3CI5 A;  3UKU B;  4FM2 A;  4ID1 A;  1KSP A;  5F2R A;  4RG8 A;  2YHW A;  4BRI A;  4TSX A;  4BGA A;  5KTQ A;  4AF1 A;  5FDL A;  4Z4G A;  4FLW A;  4A2B A;  2V52 B;  4DHY A;  1P90 A;  2P9I A;  4DMN A;  5GIN A;  2P9K A;  2QKB A;  3KKS A;  3ASM A;  2Q36 A;  4CHQ A;  3MXI A;  1VK0 A;  3AVK A;  4IO9 L;  3A5L C;  2QI2 A;  3HT3 A;  2ZQB A;  4O44 A;  1JL1 A;  4CJF A;  3SV4 A;  4CF0 A;  4DR1 K;  4BAC A;  4CJ4 A;  3O4N A;  4Y1C A;  3R1X A;  4RW6 A;  4IFE A;  3KD1 E;  3C7N A;  3AVH A;  2ZF5 O;  3HK2 A;  1J5E K;  4M3Y A;  1GLD G;  2P9U B;  2UUB K;  4YY3 K;  1BQN A;  5AZI B;  2VGM A;  2YNF A;  1HYS A;  3R3L A;  3DOL A;  3WXM B;  4YFU A;  3E9L A;  3MWP A;  4GV3 A;  3WEE B;  1NGC A;  3CPW M;  1WAF A;  4WFB L;  4F9O A;  4DSK A;  3CCM N;  3SPY A;  3OHR A;  3I55 N;  3F9K A;  1SL0 A;  1S1W A;  2XHB A;  3IS9 A;  2Q97 A;  5EU7 A;  3VGK A;  3CFR A;  4HUG A;  3RTV A;  2I7P A;  1U2V A;  4YDU C;  2A41 A;  3TAP A;  5AQN A;  3CMA N;  1NLV A;  4XIU A;  1NBW A;  4FWQ A;  5HRO A;  3CCS N;  1HYV A;  4DR7 K;  5GIO A;  2E4L A;  4FLV A;  1WOQ A;  4IDK A;  4BR9 A;  4CJQ A;  2O8D B;  4GKK K;  4KAZ A;  3OS0 A;  2I5J A;  2WBN A;  3M8S A;  2HBJ A;  1BGX T;  2I7N A;  2VYP A;  3OYI A;  4HUF A;  4FJN A;  4LD0 A;  4DTO A;  2W40 A;  2P5G A;  1GLC G;  3UB5 A;  3ZCM A;  4JHD A;  3D2E B;  4FWN A;  4CI6 A;  1KVC A;  3WQT A;  2E1Y A;  3TTF A;  4H5N A;  1L3T A;  2YJF A;  4KHY A;  3LP3 A;  1S6P A;  1HKG A;  2FSJ A;  2YV0 X;  4WQ5 C;  4FJ8 A;  3NF7 A;  5JS1 A;  1TL3 A;  2JLE A;  3MN7 A;  3W0L A;  4BR0 A;  3QER A;  3THY A;  2V51 B;  4OO1 J;  1Z26 A;  3LP2 A;  1KLM A;  3DRR A;  1T44 A;  3OYK A;  2HHS A;  1Y97 A;  4EFH A;  2PYJ A;  3BZK A;  1BIS A;  4NXN K;  3L2Q A;  4K42 A;  5J2M A;  4WYB A;  1WAJ A;  4JKH A;  3DLL L;  3D2F B;  1SQK A;  3TAR A;  1RTI A;  4F3O A;  4C8N A;  1T6C A;  1YTA A;  2IC3 A;  1YJW N;  3GBT A;  4IOX A;  3ZSV A;  5C12 A;  4LFC K;  1NG9 A;  5C0Y A;  2D0O A;  1KCF A;  1YF5 L;  1VRT A;  5BN8 A;  4CJK A;  1BWF O;  4Z4C A;  1S6Q A;  1D5A A;  4R5P A;  1W0H A;  4FPB A;  3TSU A;  2JWK A;  1DLO A;  4QOZ B;  2OPS A;  3DAW A;  3KWG A;  1RBU A;  4H5W A;  3W3D A;  5D3G A;  1ILY A;  4PUO A;  3SCX A;  2ZJP L;  4BWM A;  3WXI A;  4RW9 A;  3LPT A;  1TAU A;  2GBZ A;  3L2V A;  4FXD A;  2GX9 A;  4IO8 A;  2QWR A;  4OVL A;  3V1O A;  5K14 A;  1BUP A;  1DTQ A;  4FLY A;  4BRN A;  5AQP A;  3SUO A;  3OYM A;  5AQM A;  4O0J A;  1NGI A;  3O3G A;  3BY5 A;  1VQK N;  4BDY A;  3M5R A;  2YHB A;  3VQA A;  3LZI A;  4OKK A;  3OYF A;  1KD1 O;  2YKM A;  2HND A;  3B6O A;  1L3V A;  3DRP A;  3O80 A;  4HTU A;  3A0I X;  2P9S A;  4KHQ A;  4F8R A;  1BI4 A;  2FBY A;  3AAR A;  3T3F A;  4DSF A;  2FF6 A;  1CZB A;  3O9U A;  4X66 K;  2ASO A;  3NHG A;  1BCM A;  2J4R A;  2KFN A;  5FLX O;  3K5M A;  4H0V B;  5AQF A;  3C6H A;  2QK9 A;  3KLG A;  2XO7 A;  4RCH A;  3RSE B;  4JRQ A;  4GY2 B;  1TV6 A;  4DQP A;  5BN9 A;  2P9L A;  1VHX A;  2NNW A;  4W5R A;  2XY7 A;  3KK3 A;  3DI6 A;  4DTX A;  3CQY A;  3H46 O;  2VQF K;  3V9X A;  4H4O A;  2E6L A;  1V4T A;  1OVQ A;  4CBU A;  1JCE A;  3OJU A;  3QEV A;  1SAZ A;  3AO4 A;  2BH1 A;  1ESV A;  5AZJ A;  3THW B;  1WLJ A;  4K8X A;  5CHI A;  1UA1 A;  4BRD A;  2P51 A;  3AVF A;  4CIG A;  3VTI A;  3CM6 A;  1YT3 A;  4F2R A;  3E9O A;  1BA1 A;  3LDQ A;  2VG5 A;  4CK1 A;  4DTP A;  1VQ8 N;  4PA1 A;  1JLG A;  1EXQ A;  3LZJ A;  2ASP A;  4CZM A;  2X78 A;  3NMU A;  2CGL A;  3CC2 N;  3RMB A;  3FZL A;  3VQ6 A;  3MX2 A;  5AQX A;  1WUA A;  3NBP A;  3KLH A;  1VSI A;  3C95 A;  1HLU A;  1W97 L;  1IH7 A;  2A40 A;  4JN4 A;  4ISG A;  1L5U A;  5HRS A;  3G0Z A;  1KFS A;  3CCE N;  4DFP A;  2IDO A;  3WQU A;  4FJ7 A;  4ISE A;  3CJA A;  3O9T A;  4FK4 A;  4DQQ A;  4FWM A;  4O55 A;  3JXU A;  4PY5 A;  3MCP A;  4CED A;  4KHS A;  1U6Z A;  4GKJ K;  1KAY A;  4JI3 K;  4ELV A;  4LF6 K;  3AGK A;  3TAN A;  1L3U A;  1DGK N;  4LFB K;  3AY9 A;  4DUY K;  2E2Q A;  4FJL A;  3P31 A;  3K9J A;  3CJ9 A;  4CGG A;  4NYN A;  4DFJ A;  2VG7 A;  3M8P A;  3R6M A;  4KHW A;  4FK2 A;  5KRT A;  4AQY K;  2YX6 A;  2E8A A;  3KLF A;  2UUA K;  1NJI O;  2WOM A;  4I9Q A;  3WNE A;  2PY5 A;  1OH8 A;  5BRD A;  3AVA A;  3OVN A;  4NCA A;  4CES A;  3KZB A;  2KLA A;  1QQO A;  3ATU A;  3IMX A;  4HWI A;  3VEN A;  1ZYQ A;  3HYF A;  1CZ9 A;  3FFI A;  4B1Z A;  1TKT A;  5BR9 A;  5HBM A;  1VSF A;  4JK8 A;  2EX3 A;  3VQ5 A;  2HHQ A;  3U3Y A;  4KH6 A;  1U45 A;  1Z25 A;  4DF8 A;  4WQ4 A;  3MDQ A;  4BRH A;  1YVU A;  1XMO K;  4DS5 A;  2NRR A;  3HPH A;  3JS6 A;  4I6M B;  1BIZ A;  4FPA A;  4CD3 A;  2ITG A;  1Q9X A;  3QIC A;  5E84 A;  3RWU A;  4AHT A;  4DG1 A;  5KPZ A;  4A62 A;  3Q7B A;  4E3S A;  1NKB A;  3K2P A;  3RR7 A;  4R79 A;  1JL2 A;  4YOR A;  1U4B A;  4MO4 A;  4Z4H A;  1X1P A;  2ZGZ A;  1WSG A;  3M6G A;  3VQP A;  3TAQ A;  3CC4 N;  4BR5 A;  3ZT3 A;  3SQ1 A;  3PO4 A;  4CGD A;  5MLC Q;  3L8B A;  3DXM B;  1QS4 A;  1X3N A;  3NH1 A;  2HHH K;  3HPO A;  1RGI A;  4YHH K;  4H0P A;  3EEQ A;  3DLK A;  5KPT A;  1T6D A;  5ADX H;  4M7X A;  1XNR K;  4CCH A;  1TYQ A;  1A5W A;  1O13 A;  5JVH L;  1DTT A;  3KHY A;  1ZBU A;  3ULE A;  4BC4 A;  4WFA L;  1NJY A;  3BZC A;  3G6E N;  4M3R A;  4FJH A;  4CFA A;  3KJV A;  2DFF A;  3CJB A;  3Q7C A;  4FM1 A;  3SQ4 A;  3ZSY A;  3SBG A;  4JI2 K;  2HHT A;  3VEY A;  5SZT A;  3VER A;  3THX A;  2P9K B;  3VQ8 A;  3SAF A;  4XH5 A;  3U8X A;  2ZJQ L;  4FWK A;  5CR4 A;  3O08 A;  4FOE A;  1YXQ A;  2PZS A;  4DV0 K;  4PKG A;  4LSL A;  1QTM A;  3O5B A;  4DV3 K;  4KI6 A;  3WNG A;  1QQM A;  3K57 A;  3RRG A;  4FL9 A;  4JKB A;  4NCB A;  3DWL A;  3G10 A;  3ZT0 A;  3ZT2 A;  2FSN A;  5C15 A;  1TUU A;  3HSC A;  2F8S A;  2FBV A;  4DLG A;  2QKK A;  3OYE A;  3THV A;  1NJZ A;  1XI1 A;  1Q81 O;  4JKG B;  4Q0B A;  1W2B M;  3DOK A;  3F2K A;  5AQI A;  3NAE A;  3DLH A;  1H1V A;  1ATR A;  3OYJ A;  4F2S A;  1RTD A;  4BG9 A;  4OJR A;  4AM7 A;  3P1G A;  3EZW A;  4DQ8 A;  4KO0 A;  1NJW A;  2NRW A;  1C0T A;  3LL3 A;  1YI2 N;  1E4F T;  1HYZ A;  5AQU A;  4DQI A;  2GWJ A;  5HLF A;  3I0S A;  4O8K A;  3AGR A;  3KIO A;  4JNE A;  4WFN L;  4FYD A;  2JGU A;  4E1J A;  4YOW A;  4BRQ A;  4JS5 A;  2WTU A;  4OLA A;  3C6U A;  4CZH A;  5IWA K;  4E1N A;  3SYZ A;  3HPG A;  3LP0 A;  5FPE A;  3QO9 A;  4E19 A;  4PL8 A;  2AJQ A;  2E5L K;  3GE1 A;  2CH5 A;  2V7Y A;  1VQN N;  5EXW A;  4YOU A;  3OBY A;  2H3G X;  3BDP A;  3E9P A;  1YUW A;  4CJS A;  3O8M A;  2QWP A;  1N5Y A;  1IKW A;  4EIA A;  3V9S A;  1YIJ N;  3ZEU A;  3ZSW A;  4CZF A;  3ZET A;  4H0Y B;  5BPL A;  3H3N O;  4JHD B;  2VG6 A;  4DU1 A;  3CCV N;  4M3U A;  2DTU A;  4IG0 A;  1VQL N;  1KVB A;  2KW4 A;  1Q8I A;  3LDP A;  4DSJ A;  3N4P A;  4E1M A;  4MLH A;  4JKF A;  4ZTF A;  4CF1 A;  4NLC A;  2IVP A;  5DMR A;  4IWV A;  1WSI A;  4FZY A;  3TR8 A;  4U67 L;  3EKS A;  2O8B A;  4B1X B;  2ZD1 A;  1NM1 A;  2LSN A;  4F4K A;  3BF1 A;  1X9W A;  4E7H A;  3CQX A;  2GUP A;  3TTC A;  3ZT4 A;  4CK3 A;  3RMA A;  2BTF A;  5AR0 A;  1SKS A;  4L8R B;  1TAQ A;  3QBX A;  2HHW A;  1RDC A;  3WNF A;  4DLE A;  1WBD A;  3K59 A;  1B92 A;  3V9Z A;  3KK2 A;  5AFU H;  1EKE A;  1RFQ A;  1XC3 A;  3L3U A;  1HJR A;  4BC2 A;  3QDK A;  1MA9 B;  2ITM A;  1GLA G;  5HRP A;  2G8W A;  2RE2 A;  4RTF D;  4B9V A;  1N33 K;  2YJE A;  4BRM A;  2A3Z A;  2G8K A;  4IG3 A;  4RW7 A;  2OTJ N;  4OGE A;  4H8K A;  4CER A;  3TAB A;  2Q31 A;  1X3M A;  4CJL A;  1WSF A;  4WE1 A;  5GAD P;  3ZSZ A;  4K0K K;  5EX5 A;  1ATN A;  4DFM A;  4DTM A;  3PO5 A;  4FJ5 A;  4JKE A;  4A59 A;  4LF9 K;  5J2Q A;  1XQS C;  1HKC A;  3PLA A;  4X62 K;  2HF3 A;  3FZM A;  2QEX N;  3SQ2 A;  4IKF A;  2HW3 A;  3DLE A;  1HNV A;  5BRF A;  5JS2 A;  4B1V A;  2E1Z A;  4M7Y A;  2HMI A;  2QWO A;  4FWL A;  2FSK A;  3WXJ A;  2E88 A;  4J8F A;  4GV9 A;  4DSI A;  4DQR A;  3IG1 A;  4K8Z A;  1JCF A;  3VET A;  4CZI A;  3TTD A;  4OPK A;  5GAE P;  3K5O A;  2NRX A;  3FFK B;  3K0S A;  1KLN A;  3PX6 A;  1JLC A;  3NGZ A;  3HP6 A;  4JI7 K;  2WC9 A;  2D5R A;  2UYT A;  4DTJ A;  4O5B A;  3QEP A;  1EO1 A;  3GDQ A;  4DB3 A;  3MXJ A;  1EQY A;  3L2W A;  1OH5 A;  2OZM A;  5EOY A;  4B9L A;  1IKX A;  2WON A;  4CGF A;  2G8H A;  5SWM A;  2F4V K;  1P8Z A;  4WQ4 C;  1X9S A;  3EE9 A;  4CF8 A;  4HCC A;  4OKJ A;  3SLC A;  4CZJ A;  4KH4 A;  1VSL A;  4OPJ A;  4H0O A;  2EHG A;  2EWS A;  5AZJ B;  2RHK A;  1ZBF A;  1ZBL A;  1VQM N;  1K8A O;  4B3M K;  4B3T K;  2O8C A;  2D0B A;  4FJJ A;  3O1B A;  4BWJ A;  5AQY A;  3LM2 A;  4DU4 A;  2IGI A;  4Y0W A;  1EX4 A;  4B1U B;  3H1Q A;  5LMN K;  2PYL A;  4JD2 A;  2NLX A;  3CJ7 A;  1IG9 A;  1YHQ N;  3VES A;  1Z6R A;  3PSF A;  4A5A A;  4UY8 O;  2GTD A;  1JLB A;  4H0X B;  2F9T A;  4FWO A;  4Q5V A;  2O8F A;  2VWJ A;  3SZ2 A;  3KK1 A;  2FF3 B;  1WN7 A;  5KI6 A;  3UKU A;  4GV6 A;  1N32 K;  1Q82 O;  3WT0 A;  5HL7 L;  3FGU A;  3O1W A;  5I3U A;  2KQ2 A;  2P5O A;  2P9N B;  5C42 A;  1C1B A;  2P9P B;  3QIN A;  3EO3 A;  2Q0R A;  3NVM A;  2OA8 A;  1BG3 A;  4FJ9 A;  4M3Z A;  4DCH A;  2RN2 A;  2XRI A;  1DT9 A;  3L0Q A;  3ZSR A;  3KD5 E;  4PKH A;  3R8E A;  4BQZ A;  3CCQ N;  4OLB A;  1X9M A;  1E4G T;  2BUP A;  1UAX A;  2IS3 A;  3LDN A;  1NKC A;  4DTN A;  1WBB A;  1U49 A;  2OTL N;  4Z0U A;  2P9U A;  2KTQ A;  4K25 A;  1IBL K;  4GMJ B;  4FWP A;  4CEA A;  5AZI A;  3LAK A;  4DV6 K;  1YTU A;  5F0X A;  1RBV A;  1D8Y A;  3DJC A;  5T7B A;  4JI8 K;  3WEE A;  3MAQ A;  4CHN A;  3O6W A;  3MEG A;  3CJ1 A;  1LAV A;  1T05 A;  1JCG A;  4IEI A;  5M1P A;  1NJX A;  1QHT A;  4FVM A;  4AHS A;  3SAH A;  3CF5 L;  4FK0 A;  1OKJ A;  4ZTJ A;  1S1X A;  2Q1N A;  4CIF A;  5J1E A;  1ZBS A;  3FZK A;  3SPZ A;  1J54 A;  1TL1 A;  1KAX A;  1S1V A;  1K8K B;  3QIP A;  3AVJ A;  1EWR A;  2O8E B;  2FBT A;  3AVL A;  3BUZ B;  1J53 A;  1T3V A;  1SL1 A;  2E2N A;  2NUB A;  1RDD A;  1IKY A;  4CE9 A;  4MO5 A;  4CW7 B;  3ZX2 A;  3QET A;  4H4M A;  1OH6 A;  1I94 K;  3RR8 A;  4FJI A;  4FVU A;  4JI0 K;  1QQC A;  1TUY A;  3DXK B;  4OPA A;  3TSP A;  2A6A A;  3P39 A;  3SK3 A;  5J2N A;  2VWK A;  1B9D A;  3FE1 A;  2O8D A;  5B8H A;  1RDU A;  3M3Z A;  3DLR A;  3O3H A;  3V9W A;  3QEX A;  4DV4 K;  3BP8 A;  3AVN A;  4XEI A;  2QW9 A;  4CHY A;  3NFA A;  5AQW A;  3SBT A;  4BRG A;  5KRS A;  4NYF A;  3I56 N;  2HNY A;  4L3Q A;  4CGI A;  1NK4 A;  1NWK A;  4HTL A;  1T03 A;  3D2E A;  3F5T A;  2YNI A;  5M1N A;  3L2R A;  1OH7 A;  4XH4 A;  3A5M C;  4EHT A;  4G9Z A;  1ASW A;  4FM0 A;  3OJS A;  1LWC A;  4DTR A;  3H1V X;  4FOI A;  1VQ7 N;  1NGJ A;  3LAL A;  4BDZ A;  2ZM6 K;  4J2E A;  5LJW A;  3PSI A;  3ENH A;  3P4I A;  4JKA A;  1VAZ A;  5M1O A;  4BE2 A;  2OZS A;  4RW4 A;  3EE8 A;  3VEZ A;  1CLQ A;  3ZSX A;  1RDB A;  4IZ9 A;  5CE3 A;  4AIL C;  3HTV A;  3PX0 A;  3CQ8 A;  3D2F A;  4GVE A;  4A57 A;  1S72 N;  3VTH A;  3FR0 A;  4DF4 A;  4QAG A;  2UUC K;  4B9U A;  3QFU A;  4CGH A;  2Y1J A;  1I3A A;  1C0M A;  4B1Y B;  4FCY A;  2XY5 A;  2KHO A;  4CEB A;  1KVA A;  4M3W A;  3U6F A;  1K6Y A;  4KTW A;  3CYM A;  1KTQ A;  3P5J A;  1RTH A;  4JYA K;  5AQR A;  3LM9 A;  3IAY A;  1J9A A;  1TK8 A;  2UXB K;  5AQT A;  1YIT N;  4QS9 A;  2Z1J A;  2A5X A;  1NGE A;  5CY4 A;  1FKO A;  4DSE A;  1HQU A;  1L3S A;  1O1W A;  2NRT A;  3ID8 A;  1K9M O;  1W9H A;  3TWH A;  3A5N C;  1NOY A;  2QTD A;  4DFK A;  1GOA A;  3CXC M;  4A61 A;  3MEC A;  1QZ5 A;  1T7P A;  4CGJ A;  3HM8 A;  5FRM A;  4CEQ A;  1VSM A;  1JLA A;  4BRF A;  1HNX K;  5HRN A;  2Q3S A;  3H08 A;  4E7L A;  3BF3 A;  1I39 A;  2OAN A;  2QWN A;  1BU6 O;  3FZF A;  3D6R A;  1VSK A;  4CJ3 A;  5JMV A;  1JLQ A;  4PQU A;  3OYH A;  4ILJ A;  2W42 A;  1RDW X;  4AHU A;  4B9M A;  4DV5 K;  5AQK A;  3RSE A;  2GEL A;  3HBT A;  5J2P A;  3VOV A;  1LV5 A;  4KRF A;  1XHZ A;  5AQH A;  4KKO A;  5AQG A;  1KC8 O;  3PUF A;  1YJN N;  1NK0 A;  1EWQ A;  4J2D A;  1BL3 A;  3MED A;  3LAM A;  3MMV A;  3ATV A;  1IJJ A;  5HRR A;  1VSJ A;  3LP1 A;  4O8U A;  3U9D A;  3TAG A;  2E2P A;  2IOC A;  4FJX A;  3UKR A;  3L4I A;  3AVI A;  1NGA A;  3THW A;  4CZL A;  1QZ6 A;  4BRP A;  4BG8 A;  2KZZ A;  1MU2 A;  4O0I A;  3E1Y A;  4B9Q A;  3B6P A;  4BQL A;  1ZBH A;  4DS4 A;  3P83 D;  1EP4 A;  3AVC A;  3V1R A;  1D9D A;  3OYD A;  1YAG A;  2Z1G A;  1CXQ A;  3VF4 A;  4CEF A;  1GLF O;  2QM1 A;  4C1N K;  3S3N A;  3LDL A;  1RT1 A;  2B6A A;  1GLL O;  3VQ7 A;  2O8B B;  4FLT A;  3K5N A;  1CZA N;  1KFD A;  2YNH A;  4JEP A;  4DV7 K;  3TPQ A;  1RT2 A;  4BRO A;  4B3O A;  2P9I B;  3HVT A;  3FLC O;  5KGX A;  1MWK A;  3SMP A;  3MEE A;  4MQ3 A;  3VF2 A;  2B4J A;  4BRE A;  1VQ4 N;  2HHV A;  1RBT A;  4W5Q A;  4JKC A;  3LDS A;  1NK6 A;  3OYG A;  3MN5 A;  1X9J A;  2F96 A;  4LSN A;  4B08 A;  2OPR A;  3CG7 A;  5BRH A;  1F21 A;  1GLJ O;  2GWK A;  3WUH A;  3C7N B;  1RT7 A;  4E0D A;  1TKZ A;  3ISN C;  1T8E A;  2G8F A;  1NNE A;  1R0A A;  3S3O A;  1KQS M;  3RMC A;  3OYN A;  3CCU N;  1LWF A;  1RDA A;  4NO7 A;  4B9S A;  3G25 A;  1WSH A;  4FJG A;  5AQZ A;  4LC9 B;  2PAV A;  5M1F A;  5AQL A;  1NK9 A;  2IVN A;  5C10 A;  4Z4I A;  2HF4 A;  4LY7 A;  2NRH A;  5BPN A;  3T69 A;  4CBW A;  2F8T A;  1GOB A;  1RNH A;  1KRP A;  2OPQ A;  2VCP A;  4KV8 A;  1IV0 A;  5F1X A;  1BA0 A;  4E7K A;  2HVH A;  4EHU A;  3CCJ N;  1JKH A;  1U2V B;  3TAF A;  4K43 A;  3AVM A;  4JI6 K;  3VQQ A;  1TK0 A;  1C0F A;  4DQS A;  4EP5 A;  3A8Y A;  3DLB A;  4H5T A;  4CFD A;  4RWT A;  1QE1 A;  3SJH A;  3MN9 A;  4FWR A;  3CER A;  4I6M A;  2Q2R A;  4IFY A;  4O5F A;  3KK7 A;  1XNQ K;  4ILG B;  1LW2 A;  1HNI A;  3EZ5 A;  2D4W A;  3D0P A;  4DTU A;  4OGC A;  5FRO A;  4B1W B;  1QQN A;  4FO0 A;  1S9E A;  1NGF A;  1SV5 A;  3HO1 A;  4BRC A;  3EKU A;  3KVG A;  1U47 A;  4AHV A;  2DPN A;  5FPN A;  3KWI A;  3HRG A;  4FLU A;  3O9S A;  2QXL A;  1XMQ K;  3AA5 X;  3O4W A;  1KAZ A;  4BE1 A;  3OYC A;  1VSE A;  1NGG A;  4DR4 K;  4I9L A;  2FLO A;  3AVG A;  1BIU A;  3AV9 A;  4CZK A;  3QBW A;  5KGW A;  4KH5 A;  3UE5 A;  4Z94 A;  4IFV A;  1TVR A;  4CJ5 A;  1GLB G;  4C8K A;  2IIR A;  2KZM A;  5GIP A;  3AO3 A;  2HOE A;  3J81 O;  2UXD K;  3THY B;  4CJV A;  1SL2 A;  4CHZ A;  3VMF B;  3QLH A;  4CF2 A;  1JJ2 M;  4ID5 A;  4W5T A;  1QSS A;  3LPU A;  5HOO A;  2HMP A;  4DV1 K;  1G15 A;  2HST A;  2UXC K;  1HPZ A;  2FBX A;  3TSQ A;  5AFU A;  3C6T A;  4IJN A;  1SKW A;  1C1C A;  2A1R A;  3PV8 A;  1UOC A;  4E7J A;  2BDP A;  3OYA A;  3HOT A;  3E01 A;  1MWM A;  4JAX A;  1ZC6 A;  1RTJ A;  2YHX A;  3U4L A;  5JVG L;  1IKV A;  2NRV A;  5C2D A;  2E6M A;  1NGB A;  2E20 A;  5DK5 A;  4H5V A;  4FWS A;  2F7T A;  3ZYY X;  3AO2 A;  4M3T A;  4ISF A;  1Q18 A;  1S9G A;  3ZX0 A;  3MK6 A;  3TAE A;  2NZT A;  4UQG A;  4OX9 K;  2AP1 A;  3OS2 A;  2QA4 N;  2GV9 A;  4IDH A;  3SMS A;  1QHA A;  4HCB A;  3EY1 A;  2OPP A;  1CXU A;  4DKW A;  3T1H K;  3K58 A;  3S41 A;  1ITG A;  1LWE A;  3AVB A;  3D45 A;  4CVN E;  1UWB A;  3VQC A;  4JKG A;  4KHU A;  1WB9 A;  3PX4 A;  4ICL A;  1HJO A;  4PL7 A;  2P1J A;  2RKI A;  4NB4 A;  1QSY A;  2HBL A;  2YKN A;  3VQB A;  4X64 K;  4J2B A;  4B9N A;  1NMN A;  2ZGY A;  2F9W A;  3P38 A;  2P9S B;  4C8O A;  3QNO A;  1RT3 A;  1BI4 B;  3B8A X;  1U04 A;  2FXU A;  3AAQ A;  5TKY A;  4BE0 A;  4E7I A;  4LF7 K;  4A2A A;  3QNN A;  4GW6 A;  4HVJ A;  5FPM A;  2PBD A;  4BDP A;  4CJR A;  3IDH A;  3QFP A;  3A5O C;  5E41 A;  4KRE A;  2VWB A;  2QWL A;  3ZSQ A;  4DR2 K;  4YNQ A;  5JLH A;  2P9L B;  3VQ9 A;  3EL2 A;  3OYB A;  2YHA A;  4KHP K;  4CF9 A;  1FXX A;  3A2F A;  3T1Y K;  3HXM A;  3CFO A;  1JXE A;  1JXB A;  3C94 A;  5LL6 Z;  2AA4 A;  3SQ0 A;  4FZX C;  4KBO A;  4ELU A;  5CZ2 A;  2XY8 A;  3UIQ A;  5EVZ A;  3E66 A;  4CJP A;  2KFZ A;  5C24 A;  4IOA L;  5GAG P;  4H03 B;  3F9M A;  2DY4 A;  1BO5 O;  3M8R A;  2FC0 A;  4BC5 A;  4I2Q A;  1Y64 A;  2ETJ A;  3VQE A;  4HHT A;  4DSL A;  1ZXO A;  1NK7 A;  4N41 A;  3MX5 A;  2Z1H A;  3V9U A;  3VGM A;  4CFC A;  2HNZ A;  3C65 A;  4LF4 K;  2DFE A;  4CJU A;  4U7B A;  3T1A A;  4PHT X;  2Y1I A;  2KKZ A;  3JSM A;  4ILH A;  4MLE A;  3SJJ A;  3BEX A;  1DEJ A;  3C6A A;  1IBM K;  4CEC A;  2VQE K;  2HBK A;  1XC9 A;  3VQD A;  3GL1 A;  3ENB A;  3QML A;  3ZT1 A;  4KPY A;  2A42 A;  3CIP A;  4KTQ A;  3GG4 A;  5HP1 A;  2ZE2 A;  4CIE A;  3GOI A;  3FZH A;  3WXL A;  1N34 K;  4MDA A;  3DYA A;  5C2F A;  5KQD A;  1A5X A;  4MFB A;  3M8Q A;  4EP4 A;  1BQM A;  4B3S K;  5H1S Q;  4B8C A;  2OCE A;  4C1N I;  5FPD A;  3CFP A;  1QVF M;  4M41 A;  4EAH D;  4CEE A;  1G99 A;  5A2Q O;  1D4X A;  1M1K O;  1MDU B;  3L4Q A;  1LW0 A;  3NF9 A;  1C0U A;  1WSE A;  2BAN A;  2G8I A;  1WSJ A;  3OS1 A;  5CZ1 A;  1XHX A;  3L6Q A;  3ID6 A;  1YJ9 N;  4M42 A;  3K5L A;  4G1Q A;  3ZSO A;  4YOT A;  4NCG A;  3VGL A;  1JLF A;  1IG8 A;  2W6L A;  3IKM A;  5LY3 A;  4HUE A;  4EZ9 A;  3NF6 A;  3AO5 A;  5JLF A;  3I8B A;  2NRZ A;  4AM6 A;  3J7A P;  1D9F A;  1HQE A;  3NF8 A;  1GLE G;  3WNH A;  1REV A;  2HB5 A;  4MDB A;  4AHR A;  1SS6 A;  4PWD A;  2E2O A;  1N36 K;  3RRH A;  1HNW K;  4I7F A;  3AA2 A;  1J6Z A;  3OBW A;  3PIO L;  5DM7 L;  1S3X A;  4WCE L;  3QB0 A;  3L3V A;  3VEO A;  4CZE A;  2V7Z A;  1S1T A;  1HKB A;  3V81 A;  2X6N A;  2O4I A;  3CHW A;  5AQV A;  2R7Y A;  4RW8 A;  4IJA A;  3ENO A;  3QES A;  1ZBI A;  1GOC A;  3H3O B;  3S9H A;  3OA9 A;  4QS7 A;  3HVR A;  1VRU A;  2PFU A;  1DKG D;  2YI1 A;  1SKR A;  3K9K A;  5I42 A;  3UKR B;  4KTZ A;  3HP9 A;  3U3G A;  5AQJ A;  5BR8 K;  3VEV A;  1TYQ B;  3J8A A;  4LF8 K;  4H5R A;  5AQQ A;  3NCI A;  4IEE A;  4JRP A;  3V4I A;  4H0T B;  1RCH A;  3NGI A;  3ULE B;  4YOY A;  3DM2 A;  1OVY A;  1BOT O;  2CGJ A;  4N47 A;  2HHU A;  4C8M A;  1TKX A;  2RF2 A;  2X74 A;  3J80 O;  4DU3 A;  4QCL A;  3H45 C;  1VQ9 N;  4FJM A;  4IBN A;  4CBX A;  2D0P A;  3DLG A;  1VQP N;  4DV2 K;  4LFA K;  1C1A A;  4BY9 C;  3ULD A;  3SNN A;  1JLE A;  3CC7 N;  3CM5 A;  1NGD A;  3LDO A;  5FRN A;  4XH1 A;  3THX B;  4AH9 A;  3KLE A;  3CET A;  4B3R K;  4C23 A;  4KHN A;  1V4S A;  2P9N A;  1A5V A;  3AO1 A;  3SUQ A;  3KTQ A;  1IO2 A;  2P9P A;  3O9Q A;  3N4Q A;  2XY6 A;  1ASV A;  4A5B A;  1C0G A;  4FW2 A;  2G8V A;  4N56 A;  1QVG M;  2GUI A;  3VA3 A;  4AHC A;  1NU0 A;  1RT4 A;  1W7A A;  4KB0 A;  3V1Q A;  1NGH A;  3NVK A;  3R9P A;  4YDU A;  3T7Z A;  4BVO A;  1J5O A;  4N5S A;  4FSV A;  3TAM A;  2B5J A;  3ALY A;  3HI0 A;  5KQ8 A;  1ASU A;  4O4G A;  3MXM A;  4DTS A;  3EYZ A;  2QWM A;  2W41 A;  4JK7 A;  3VN5 A;  1HMV A;  4JLH A;  3DMJ A;  4CEZ A;  3CJC A;  2O4G A;  4LH4 A;  4DR6 K;  1VSH A;  4PKI A;  2YHY A;  4NLB A;  3AA4 A;  4CK2 A;  5BRE A;  4OKE A;  4Z4F A;  1K8K A;  5LMU K;  5JIC A;  2VGN A;  3VPZ A;  2D0A A;  4EZ6 A;  3F73 A;  1LOT B;  2O8E A;  3PIP L;  1N6Q A;  2A1S A;  3VEX A;  1S1U A;  2IVO A;  3G71 N;  3CCL N;  4JI4 K;  4WQ5 A;  1FKP A;  1EET A;  2RPI A;  4B9T A;  3CCR N;  5TKW A;  1RT5 A;  3JAM O;  4CFB A;  3HOS A;  3DXK A;  2ZJR L;  4M45 A;  1LCU A;  5ADX A;  1XUP O;  3CPE A;  5IT9 O;  3ZX3 A;  4I2P A;  2ASM A;  4V19 S;  4F3T A;  2IAJ A;  4BRK A;  4FZZ A;  1Q86 O;  3NE6 A;  3LWL A;  3VQ4 A;  3PY8 A;  3AAP A;  3ZEU B;  1QSL A;  3J7Y P;  3ZET B;  1BDG A;  3V6D A;  4QS8 A;  3SV3 A;  1LAW A;  1HPM A;  1Q9Y A;  2DFH A;  1VQO N;  3QIO A;  3SUN A;  5I9E B;  3SI6 A;  4Y1D A;  1TK5 A;  3NGY A;  1TKD A;  3ZLJ A;  3WXK A;  4YOX A; 
#chains in the Genus database with same CATH homology
 3LDQ A;  2JWL A;  3O1B A;  1VQ8 N;  3VMF B;  1JJ2 M;  5AQY A;  3LM2 A;  4CJ7 A;  4Y0W A;  4B1U B;  3H1Q A;  4JD2 A;  2ASP A;  2NLX A;  4CZM A;  3CJ7 A;  1YHQ N;  3VES A;  4BRL A;  1Z6R A;  3VEW A;  3NMU A;  2CGL A;  3CC2 N;  5AQS A;  5HOO A;  2HMP A;  4A5A A;  4UY8 O;  2HST A;  2GTD A;  3FZL A;  1S22 A;  4H0X B;  2F9T A;  3MX2 A;  4FWO A;  5AQX A;  1WUA A;  4M63 C;  3TSQ A;  5AFU A;  5AQO A;  4IJN A;  2FF3 B;  1HLU A;  1W97 L;  1YVN A;  3UKU A;  2A40 A;  4JN4 A;  3HOT A;  4JAX A;  1MWM A;  4ISG A;  4GV6 A;  1ZC6 A;  1Q82 O;  3CCE N;  5DM6 L;  1HX1 A;  3WT0 A;  3WQU A;  3U4L A;  2YHX A;  4ISE A;  5HL7 L;  3CJA A;  3FGU A;  4WF9 L;  5JVG L;  2CH6 A;  3O9T A;  4FWM A;  3HZ6 A;  3O1W A;  5M1Q A;  2NRV A;  5C2D A;  3JXU A;  2P9N B;  3J7Z O;  1NGB A;  2E20 A;  3MCP A;  2P9P B;  4H5V A;  3EO3 A;  4FWS A;  2Q0R A;  1U6Z A;  3NVM A;  2F7T A;  5M1K A;  1BG3 A;  1KAY A;  3ZYY X;  4ISF A;  3AGK A;  1Q18 A;  4DCH A;  3ZX0 A;  3MK6 A;  5ELZ A;  1DT9 A;  1DGK N;  3L0Q A;  3AY9 A;  4PKH A;  3H6E A;  3R8E A;  5KPR A;  2NZT A;  1SZ2 A;  2E2Q A;  4BQZ A;  3CCQ N;  3P31 A;  2AP1 A;  3CJ9 A;  3IFR A;  3K9J A;  2QA4 N;  1E4G T;  2BUP A;  3LDN A;  4IDH A;  3SMS A;  1QHA A;  2OTL N;  2P9U A;  3R6M A;  4K25 A;  4BR4 A;  4DKW A;  4FWP A;  1Q7Y O;  2YX6 A;  2E8A A;  3O9R A;  4BR7 A;  5AZI A;  1NJI O;  3S41 A;  3I33 A;  4BGB A;  1M90 O;  3IUC A;  5F0X A;  5BRD A;  3C0B A;  4CD1 A;  3DJC A;  1K73 O;  4JKG A;  3WEE A;  4OPH A;  3O6W A;  1HJO A;  3CJ1 A;  4PL7 A;  4YOV A;  1JCG A;  4IEI A;  5M1P A;  4NB4 A;  3KZB A;  3SAH A;  2KLA A;  3CF5 L;  1QQO A;  2HBL A;  3ATU A;  1OKJ A;  3VF6 A;  3IMX A;  4HWI A;  3VEN A;  2ZGY A;  2Q1N A;  2F9W A;  2QWQ A;  3EN9 A;  3P38 A;  1N8R O;  1ZBS A;  2P9S B;  3FZK A;  4B1Z A;  1VQ5 N;  1KXP A;  1KAX A;  3TU5 A;  5BR9 A;  1K8K B;  4JK8 A;  3B8A X;  3G4S N;  2HBM A;  2FXU A;  1HUX A;  3AAQ A;  4KH6 A;  5TKY A;  4WQ4 A;  2GEM A;  4A2A A;  3MDQ A;  4BRH A;  2CGK A;  2D1K A;  4BRA A;  2NRR A;  3BUZ B;  3JS6 A;  4I6M B;  1T3V A;  5E26 A;  5FPM A;  2E2N A;  2PBD A;  4FPA A;  4CD3 A;  3MCA B;  3U9Z A;  3IDH A;  4MO5 A;  3QIC A;  5E84 A;  3QFP A;  3ZX2 A;  3A5O C;  5BPM A;  3CD6 N;  4FVU A;  5KPZ A;  4A62 A;  4BC3 A;  1TUY A;  3DXK B;  3MN6 A;  3Q7B A;  2Q0U A;  2VWB A;  2QWL A;  4OPA A;  3TSP A;  5LJV A;  2A6A A;  2WFB A;  2P9L B;  3M1F A;  3EL2 A;  3P39 A;  3SK3 A;  4YOR A;  4R79 A;  5JLH A;  2ZWH A;  3FE1 A;  1ATS A;  4JKD A;  4MO4 A;  5B8H A;  1RDU A;  3M3Z A;  4K41 A;  4IOC L;  3D7E O;  2ZGZ A;  2WUS A;  4IXC A;  3M6G A;  3CC4 N;  2AA4 A;  4BR5 A;  1Z05 A;  3BP8 A;  4KBO A;  4XEI A;  3DXM A;  2QW9 A;  5MLC Q;  5AQW A;  3SBT A;  4BRG A;  3I56 N;  4L3Q A;  5EVZ A;  1NWK A;  3E66 A;  4HTL A;  3DXM B;  3D2E A;  5EY4 A;  3F5T A;  2YCH A;  1X3N A;  4JK9 A;  4H03 B;  3F9M A;  5GAG P;  5M1N A;  1VQ6 N;  1BO5 O;  4IOA L;  4BC5 A;  4XH4 A;  3A5M C;  1RGI A;  4EHT A;  1Y64 A;  4GNI A;  4G9Z A;  4H0P A;  1ZXO A;  5KPT A;  1T6D A;  3MX5 A;  5ADX H;  4JD2 B;  3VGM A;  3H1V X;  4M7X A;  3MWT A;  4FOI A;  3RVC A;  4CZG A;  1VQ7 N;  3CME N;  1NGJ A;  1NMD A;  1TYQ A;  3C65 A;  4BR2 A;  1O13 A;  4BVP A;  5JVH L;  3OW2 M;  3KHY A;  1R59 O;  4U7B A;  5GAH P;  5LJW A;  4PHT X;  3ULE A;  2KKZ A;  3SAG A;  3ENH A;  3P4I A;  4JKA A;  1VAZ A;  5M1O A;  4BC4 A;  3EE8 A;  3VEZ A;  4ILH A;  3CI5 A;  4MLE A;  3BEX A;  1DEJ A;  4WFA L;  3G6E N;  3C6A A;  3UKU B;  2HBK A;  5F2R A;  3GL1 A;  4IZ9 A;  5CE3 A;  2YHW A;  4BRI A;  3CJB A;  3ENB A;  3Q7C A;  3QML A;  4BGA A;  4AF1 A;  3HTV A;  3SBG A;  2A42 A;  4A2B A;  2V52 B;  3CIP A;  3D2F A;  4GVE A;  3VEY A;  4A57 A;  3GG4 A;  4DHY A;  1S72 N;  3VTH A;  1P90 A;  2P9I A;  3FR0 A;  3GOI A;  2P9K A;  3FZH A;  3VER A;  5GIN A;  3WXL A;  3QFU A;  2Q36 A;  4MDA A;  2P9K B;  4IO9 L;  3A5L C;  2QI2 A;  3SAF A;  4XH5 A;  3U8X A;  4B1Y B;  5C2F A;  5KQD A;  2ZJQ L;  4FWK A;  5CR4 A;  2KHO A;  3O08 A;  4FOE A;  1YXQ A;  5H1S Q;  4PKG A;  3R1X A;  4C1N I;  5FPD A;  1QVF M;  3O5B A;  4EAH D;  1QQM A;  4IFE A;  1G99 A;  3C7N A;  1D4X A;  4FL9 A;  1M1K O;  1MDU B;  3L4Q A;  2ZF5 O;  4JKB A;  3DWL A;  1GLD G;  2P9U B;  5AQR A;  3LM9 A;  5AZI B;  2VGM A;  2FSN A;  3R3L A;  5C15 A;  1TUU A;  5AQT A;  3L6Q A;  1YJ9 N;  3ID6 A;  3HSC A;  4QS9 A;  3WXM B;  1YIT N;  3E9L A;  3MWP A;  4YOT A;  2A5X A;  3VGL A;  4GV3 A;  1IG8 A;  4JKG B;  1NGE A;  3WEE B;  1W2B M;  1Q81 O;  1NGC A;  3F2K A;  3IKM A;  5AQI A;  5LY3 A;  1H1V A;  3CPW M;  1ATR A;  4WFB L;  2NRT A;  3ID8 A;  1K9M O;  4BG9 A;  4F9O A;  4AM7 A;  3CCM N;  5JLF A;  3OHR A;  3I8B A;  3A5N C;  3EZW A;  2QTD A;  2NRZ A;  4AM6 A;  4DQ8 A;  3I55 N;  3CXC M;  4A61 A;  1QZ5 A;  1GLE G;  3HM8 A;  2NRW A;  2Q97 A;  4MDB A;  4BRF A;  1SS6 A;  3VGK A;  2E2O A;  3LL3 A;  1YI2 N;  1E4F T;  3BF3 A;  2I7P A;  5AQU A;  2GWJ A;  1U2V A;  2OAN A;  4YDU C;  2A41 A;  2QWN A;  1BU6 O;  4O8K A;  3AGR A;  4JNE A;  3FZF A;  5AQN A;  3D6R A;  4WFN L;  1J6Z A;  1NLV A;  3OBW A;  3CMA N;  4E1J A;  4YOW A;  4BRQ A;  5JMV A;  1NBW A;  5DM7 L;  4FWQ A;  1S3X A;  4CI6 A;  4WCE L;  3PIO L;  3CCS N;  4ILJ A;  3QB0 A;  4CZH A;  3VEO A;  4CZE A;  2V7Z A;  5GIO A;  1RDW X;  1HKB A;  1WOQ A;  5FPE A;  4PL8 A;  5AQK A;  3RSE A;  3GE1 A;  4BR9 A;  2CH5 A;  2GEL A;  2V7Y A;  3HBT A;  5EXW A;  3CHW A;  3VOV A;  4YOU A;  1VQN N;  2WBN A;  5AQV A;  3OBY A;  2HBJ A;  2H3G X;  2I7N A;  2VYP A;  5AQH A;  5AQG A;  3E9P A;  1YUW A;  4IJA A;  1KC8 O;  3O8M A;  2QWP A;  3ENO A;  1YJN N;  2W40 A;  4EIA A;  1GLC G;  3UB5 A;  3H3O B;  1YIJ N;  3MMV A;  4JHD A;  3ATV A;  1IJJ A;  3D2E B;  3OA9 A;  4FWN A;  4QS7 A;  2PFU A;  3ZET A;  4O8U A;  3U9D A;  1DKG D;  3WQT A;  4H0Y B;  4CZF A;  2E1Y A;  3TTF A;  3H3N O;  4JHD B;  5BPL A;  4H5N A;  2E2P A;  2YI1 A;  2YJF A;  3UKR A;  3L4I A;  3CCV N;  1NGA A;  1HKG A;  2FSJ A;  4CZL A;  1VQL N;  3K9K A;  4WQ5 C;  1QZ6 A;  3UKR B;  4BRP A;  4BG8 A;  3LDP A;  3N4P A;  3E1Y A;  4MLH A;  4B9Q A;  4JKF A;  3MN7 A;  3W0L A;  5AQJ A;  4BR0 A;  3VEV A;  1TYQ B;  2V51 B;  3J8A A;  4H5R A;  5AQQ A;  4BQL A;  4NLC A;  4OO1 J;  4IEE A;  2IVP A;  4H0T B;  4IWV A;  3ULE B;  1T44 A;  1YAG A;  4YOY A;  4U67 L;  3EKS A;  3VF4 A;  1OVY A;  1GLF O;  2QM1 A;  4C1N K;  1BOT O;  4B1X B;  4EFH A;  2CGJ A;  3LDL A;  1GLL O;  3H45 C;  1VQ9 N;  1CZA N;  1NM1 A;  3BF1 A;  4K42 A;  4WYB A;  4CBX A;  2D0P A;  3CQX A;  2GUP A;  4JEP A;  3TTC A;  1VQP N;  3TPQ A;  2BTF A;  4JKH A;  3D2F B;  5AR0 A;  1SQK A;  4BRO A;  3DLL L;  3QBX A;  4BY9 C;  2P9I B;  3FLC O;  3CC7 N;  1T6C A;  1YJW N;  1NGD A;  3GBT A;  4IOX A;  1MWK A;  3LDO A;  3SMP A;  5C12 A;  4XH1 A;  5C0Y A;  2D0O A;  1YF5 L;  5BN8 A;  3CET A;  1BWF O;  3VF2 A;  4BRE A;  1VQ4 N;  4C23 A;  1V4S A;  4FPB A;  2P9N A;  4JKC A;  3TSU A;  2JWK A;  3MN5 A;  2P9P A;  1X9J A;  3DAW A;  3O9Q A;  3N4Q A;  5AFU H;  3KWG A;  4H5W A;  4A5B A;  5BRH A;  1RFQ A;  1XC3 A;  3W3D A;  1C0G A;  1ILY A;  4BC2 A;  1GLJ O;  2GWK A;  3WUH A;  3QDK A;  2ZJP L;  1MA9 B;  2ITM A;  3C7N B;  3WXI A;  1QVG M;  1GLA G;  2GX9 A;  4IO8 A;  2QWR A;  1KQS M;  2RE2 A;  4RTF D;  2YJE A;  4BRM A;  2A3Z A;  1BUP A;  1NGH A;  2OTJ N;  3CCU N;  3NVK A;  3R9P A;  4YDU A;  3T7Z A;  4BVO A;  4NO7 A;  2Q31 A;  1X3M A;  4BRN A;  3G25 A;  4FSV A;  5AQP A;  5GAD P;  5AQZ A;  3HI0 A;  4LC9 B;  2PAV A;  5KQ8 A;  5AQM A;  5EX5 A;  1ATN A;  5M1F A;  5AQL A;  4JKE A;  4A59 A;  1XQS C;  1HKC A;  1NGI A;  2IVN A;  3ZEU A;  5C10 A;  1VQK N;  3PLA A;  2QWM A;  2W41 A;  4JK7 A;  2HF4 A;  2HF3 A;  2NRH A;  5BPN A;  3M5R A;  3T69 A;  4CBW A;  3FZM A;  2QEX N;  3CJC A;  1KD1 O;  2VCP A;  4PKI A;  3O80 A;  2YHY A;  4NLB A;  5BRE A;  5F1X A;  1BA0 A;  4YOX A;  4EHU A;  5BRF A;  3A0I X;  2P9S A;  4B1V A;  3CCJ N;  1U2V B;  2E1Z A;  4M7Y A;  3AAR A;  1K8K A;  2QWO A;  4K43 A;  2VGN A;  2FSK A;  4FWL A;  5JIC A;  3VPZ A;  3WXJ A;  1C0F A;  2E88 A;  2FF6 A;  3A8Y A;  4J8F A;  4GV9 A;  3O9U A;  4H5T A;  4RWT A;  1LOT B;  2ASO A;  3SJH A;  2J4R A;  3PIP L;  3MN9 A;  1JCF A;  3VET A;  4FWR A;  3CER A;  3VEX A;  4CZI A;  4I6M A;  2Q2R A;  4O5F A;  2IVO A;  3KK7 A;  3TTD A;  3G71 N;  4H0V B;  3CCL N;  4WQ5 A;  5AQF A;  5GAE P;  4ILG B;  3CCR N;  5TKW A;  2NRX A;  3C6H A;  2D4W A;  3FFK B;  4B1W B;  4RCH A;  1QQN A;  4FO0 A;  3RSE B;  3HOS A;  4GY2 B;  1NGF A;  3DXK A;  4BRC A;  2ZJR L;  3EKU A;  3KVG A;  1LCU A;  5ADX A;  1XUP O;  2WC9 A;  3CPE A;  2P9L A;  5BN9 A;  3ZX3 A;  2DPN A;  2UYT A;  2NNW A;  5FPN A;  2ASM A;  3GDQ A;  4DB3 A;  1EO1 A;  3KWI A;  4BRK A;  3HRG A;  1EQY A;  2QXL A;  3CQY A;  3H46 O;  3O9S A;  5EOY A;  1Q86 O;  3O4W A;  1KAZ A;  1V4T A;  1NGG A;  3AAP A;  3ZEU B;  4CBU A;  1JCE A;  2FLO A;  3ZET B;  1P8Z A;  4WQ4 C;  1SAZ A;  1BDG A;  3EE9 A;  4CZK A;  3SLC A;  3QBW A;  4CZJ A;  4KH5 A;  3UE5 A;  5AZJ A;  2BH1 A;  1ESV A;  4QS8 A;  1HPM A;  4Z94 A;  4KH4 A;  5CHI A;  1GLB G;  4H0O A;  1VQO N;  2IIR A;  4BRD A;  2EWS A;  5I9E B;  5AZJ B;  2RHK A;  5GIP A;  3WXK A;  1VQM N;  3VTI A;  1K8A O;  2HOE A;  3E9O A;  1BA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...