2F9WA

Structure of the type iii coaa from pseudomonas aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
249
Chain Sequence
SMILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQALPVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWLALVAAHHLAKKACLVIDLGTAVTSDLVAADGVHLGGYICPGMTLMRSQLRTHTRRIRYDDAEARRALASLQPGQATAEAVERGCLLMLRGFVREQYAMACELLGPDCEIFLTGGDAELVRDELAGARIMPDLVFVGLALACPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prokaryotic Type II and Type III Pantothenate Kinases: The Same Monomer Fold Creates Dimers with Distinct Catalytic Properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Pantothenate Kinase
total genus 70
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA02
4B1UB 1RGIA 4H0TB 1QHAA 2QWNA 5BPMA 4BR5A 2Q0RA 4AM7A 3EKSA 1JCGA 3O6WA 3S41A 3GOIA 4XH1A 4NB4A 3QDKA 3D2FB 2E2PA 4MO4A 1SZ2A 2FF3B 2P9IA 4BRDA 4B1VA 5ADXA 1RDWX 3R9PA 4A61A 1MWKA 4RCHA 3HM8A 4I6MA 1E4GT 3L0QA 3LM2A 2P9NA 2QM1A 4HWIA 1GLDG 4H0OA 5BRFA 1BA1A 2BUPA 2YHXA 2P9NB 4CD1A 1T44A 1GLAG 5ELZA 3CQYA 1KXPA 1WOQA 2CH5A 3CERA 1DEJA 4BGAA 4BRFA 3O1WA 1OKJA 5AQPA 4KBOA 4FWMA 3ZEUB 3HTVA 1JCFA 4BR9A 1ZBSA 3DWLA 3FE1A 4B1XB 4BGBA 1HKCA 4WQ4A 1BOTO 3WQUA 1X3MA 5F1XA 4M63C 2WUSA 4NO7A 2A5XA 2D0OA 4ISFA 5E26A 2FLOA 2Q97A 3M6GA 2FF6A 3FZKA 1CZAN 1T6CA 2A41A 2QWRA 3GL1A 2FXUA 1DGKN 5AQHA 5I9EB 4BREA 1C0FA 3CQXA 1GLLO 3QFUA 1HPMA 1HX1A 4FWRA 4FOIA 5KPRA 4DHYA 1P8ZA 1Y64A 5TKYA 3U9ZA 1YVNA 1LOTB 3QICA 2AP1A 2NRHA 4H0XB 5AQNA 3VOVA 3D2FA 1T6DA 1YAGA 1Q18A 1V4TA 2E1ZA 4JNEA 3DAWA 4BVPA 2ITMA 1TYQA 3VEXA 3AAQA 2OANA 2QWQA 3EN9A 4PKHA 3CJ1A 2QWLA 4H0YB 2IIRA 3I33A 1D4XA 1HUXA 3QBXA 4BRQA 3I8BA 4H0PA 4QS8A 2W41A 1K8KA 4CZEA 3O80A 2V52B 3FLCO 3WXIA 1BDGA 4BROA 4EHTA 3FZLA 4EAHD 3HSCA 1MA9B 3U8XA 4AM6A 1NGBA 1QZ6A 3C7NA 1G99A 2E20A 3LDNA 5AZJB 2HOEA 2PAVA 4H5VA 1C0GA 4FO0A 1E4FT 3WXJA 4M7YA 4IJNA 2QW9A 4CZJA 2GTDA 4BVOA 3O08A 3KVGA 3R6MA 3FFKB 4JHDB 2A3ZA 1R59O 4BC4A 2CGLA 1XC3A 4BC5A 5ADXH 4BG9A 4C23A 5BRDA 2ZF5O 4L3QA 2ASMA 4BG8A 4K42A 4FWKA 3BEXA 3VESA 3FZFA 1MWMA 3MK6A 1QZ5A 4EHUA 1V4SA 3M1FA 4QS9A 1BG3A 4MLHA 3VETA 4BQZA 4WYBA 5AQMA 5JLFA 3LM9A 4BRMA 3U9DA 1U6ZA 1NGGA 3D2EA 4BRIA 4CBUA 5KPZA 3FR0A 4MO5A 1QQNA 3UKRB 3ZX2A 2D1KA 2D0PA 2F9WA 3LDPA 1GLJO 3VEYA 3A5OC 5AQZA 3CI5A 3IMXA 3ZX3A 5AQIA 2Q1NA 2CH6A 1RFQA 4ISEA 1YUWA 2P9SA 2W40A 3ATVA 4IZ9A 5EX5A 3VF6A 3D7EO 4WQ4C 1ZXOA 3CJ9A 3SK3A 5BRHA 2YHWA 2GELA 2QWOA 1GLBG 2I7NA 3L6QA 4IWVA 4Z94A 4H5RA 1HKBA 3RSEB 5E84A 1GLCG 2HF3A 2V7ZA 4QS7A 2NLXA 4CZHA 1NBWA 1K8KB 5AQKA 2P9PA 3ZETA 3M3ZA 3LDOA 3MDQA 2YHYA 4BRNA 3F9MA 3KZBA 4RWTA 3CJ7A 2P9SB 4CBXA 4BR7A 5AQLA 1IG8A 2GUPA 1X3NA 4H5TA 4WQ5A 4B9QA 3CJCA 5AQTA 4O5FA 3G25A 4FOEA 5AQFA 3QB0A 3W0LA 4BRCA 4H5WA 4XH4A 1BA0A 4BC3A 3ENOA 1BO5O 5AQXA 4BR4A 5LY3A 3BP8A 4H0VB 1JCEA 3JXUA 4WQ5C 2ZWHA 3KHYA 2ASPA 3GDQA 1ATRA 4MLEA 4H03B 4GNIA 4B1WB 4BRAA 4HTLA 4H5NA 4YDUA 4CZIA 3QFPA 5KQDA 3AARA 2FSNA 1U2VB 4FWPA 3VEOA 5BN9A 1WUAA 3FZMA 3GBTA 5AFUH 3IUCA 4PL8A 2IVPA 3ZX0A 4J8FA 4PKIA 4BRGA 2E88A 1NGEA 2YI1A 2YJFA 4FL9A 4PKGA 5EOYA 5JMVA 4Y0WA 3GE1A 2V51B 3B8AX 2Q36A 1GLEG 2NZTA 5BPLA 3GG4A 5AQYA 3CHWA 4JD2A 3SMPA 1ESVA 1NM1A 3EL2A 5LJVA 3WUHA 2VYPA 5AQWA 5F2RA 3HBTA 2VWBA 5AR0A 3H1QA 2BTFA 1Z6RA 2P9IB 4FWQA 3VF2A 2Q0UA 1BUPA 4K43A 4DB3A 4BRPA 1NGCA 2YJEA 5F0XA 4JN4A 2D4WA 1ATSA 1KAZA 3O5BA 1TUYA 3VEZA 5BPNA 2E2QA 3H1VX 3WT0A 3AY9A 2ZGZA 3MN5A 4EIAA 2F9TA 4BR0A 1XQSC 3H3NO 2Q31A 4CJ7A 5JLHA 3BF1A 1SAZA 3A5MC 4FWSA 4JAXA 4DCHA 3WXKA 2V7YA 3EO3A 4O8KA 5B8HA 3VEWA 2QWPA 1HKGA 4FWLA 4IXCA 3VPZA 2E1YA 3HI0A 5BREA 1KAYA 3O8MA 1NMDA 2KHOA 5FPDA 2E8AA 5AQJA 3ZEUA 3DJCA 3LDLA 3A5NC 4A2AA 1NGFA 1DKGD 3DXMA 4FWNA 2FSJA 2P9LA 4K41A 1NGAA 3MN7A 4JD2B 5BN8A 1SQKA 3LL3A 4FPAA 4CZKA 2E2OA 5AQOA 5FPMA 4CZLA 5BR9A 4DQ8A 1X9JA 2IVNA 3FZHA 1ATNA 1LCUA 5KQ8A 3VF4A 4I6MB 2A42A 3ATUA 2DPNA 2QWMA 4BRKA 3L4IA 3UKUA 1IJJA 1J6ZA 3UE5A 1U2VA 1H1VA 1S3XA 4FPBA 1QQMA 1HJOA 2CGKA 4XEIA 1MDUB 4BRHA 4A62A 2HMPA 5AFUA 3WEEB 2FSKA 3ZETB 5EXWA 2P9PB 2VCPA 3VERA 5LJWA 3O4WA 5CE3A 4RTFD 3H45C 2YCHA 3QBWA 4PL7A 1KAXA 5AQSA 4BQLA 4CZFA 2P9UB 3ULEA 2ASOA 1NLVA 5AQGA 1NWKA 2P9KA 2ZGYA 3CJAA 3VENA 1NGHA 3P4IA 5JICA 4B1ZA 2EWSA 3H3OB 3VGKA 3DXKB 2P9KB 4A2BA 4BR2A 3C0BA 5FPEA 3EKUA 3UKRA 3MMVA 2QXLA 3MN9A 5EY4A 3QMLA 3RSEA 2Q2RA 2CGJA 2UYTA 1XUPO 5AZIB 2GEMA 4M7XA 2AA4A 3ENHA 2E2NA 3A5LC 3WEEA 4IO8A 5AQVA 4ISGA 4EFHA 1GLFO 4FSVA 4CBWA 3CETA 4CI6A 2HF4A 2A6AA 3A0IX 3O1BA 4E1JA 4IJAA 1BWFO 1NGJA 2PBDA 3UKUB 3FGUA 2IVOA 2GWKA 3BF3A 3A8YA 3D2EB 4F9OA 1NGDA 3TPQA 3H46O 3CJBA 3BUZB 3J8AA 1EQYA 3ID8A 2J4RA 5AZJA 3WQTA 1YXQA 4BRLA 5AZIA 1BU6O 3LDQA 2P9LB 1HLUA 1NGIA 3CIPA 3DXMB 4FWOA 4GY2B 3AAPA 3IDHA 3MCPA 3SMSA 3OHRA 1S22A 3VGMA 3DXKA 3MN6A 3W3DA 2H3GX 3H6EA 4JHDA 3WXLA 4CD3A 2GWJA 5AQRA 3VGLA 4B1YB 4XH5A 2I7PA 1TYQB 3JS6A 3HZ6A 1QQOA 4K25A 1Z05A 4LC9B 3TU5A 3VEVA 5KPTA 5EVZA 3U4LA 3ULEB 2A40A 3SLCA 5FPNA 2P9UA 5AQQA 3C7NB 1TUUA 3IFRA 5AQUA 3SJHA 4BC2A 4CZGA 3EZWA 1ZC6A 3R8EA 4CZMA 3UB5A 4YDUC
chains in the Genus database with same CATH superfamily
4AHUA 4YHHK 1QHAA 2QXFA 3O4NA 1NK5A 3QNNA 4A5AA 4BR5A 2WFBA 2Q0RA 3VQ8A 2Z1JA 1NK7A 1IKYA 4AM7A 3TAEA 2QTDA 5J2NA 3EE8A 3D2FB 2E2PA 3LAMA 4BWMA 1SZ2A 4PWDA 2P9IA 4BRDA 2QA4N 1VSHA 4WE1A 5GADP 1GOCA 4CF0A 4A61A 1MWKA 4I6MA 1T3VA 3ZT0A 1E4GT 3L0QA 3I0RA 4B3MK 1UWBA 3WXMB 1GLDG 3CG7A 1T44A 2NRWA 2YKMA 5ELZA 2O4GA 2CH5A 4BGAA 1QVGM 4IDHA 4BRFA 2UXBK 4GVMA 4KBOA 3HTVA 3EZ5A 3FE1A 4AF1A 2BGGA 4W5NA 4LD0A 4JKCA 3J7YP 4DSJA 2YNHA 4W5OA 2OPQA 4NO7A 2WUSA 4YORA 4DR7K 2FLOA 2FF6A 3FZKA 3TAFA 1T6CA 3T69A 2XY5A 3ULDA 1G15A 3GL1A 4JI6K 1DGKN 5AQHA 5I9EB 4BREA 4CJ3A 1C0FA 4Y1CA 1BCMA 3V81A 4FOIA 4DHYA 1Y64A 4NXMK 2YNFA 3CFPA 2UUBK 1JKHA 2NRHA 4H0XB 2W6LA 1WAJA 1LV5A 3VOVA 4JNEA 1YAGA 2EHGA 4KKOA 3AAQA 2OANA 4IOAL 3CJ1A 1NOZA 1S1XA 4DLGA 1SL0A 3QBXA 4JI4K 4BRQA 1ZBUA 3AA5X 2YKNA 1K8KA 1S1TA 4B8CA 3O80A 4BROA 3FLCO 4EAHD 4LH5A 3KK3A 3U8XA 1NK9A 1NGBA 3T19A 3OYDA 4IFVA 4Z4FA 5AZJB 2PAVA 3NGZA 3KK1A 4FO0A 1TK5A 1D9FA 4CJLA 3LP3A 3M5RA 4JI8K 4KHPK 2QW9A 3AVFA 1NJWA 4CZJA 1QQCA 3LANA 4YFUA 5ADXH 5C15A 3OYFA 3AVAA 2NRXA 4M3WA 2RHKA 2O8EA 5KGWA 3TI0A 4BG8A 4CJ4A 1RNHA 3THVA 1NK8A 3BEXA 4E7LA 1ZYQA 4FJ8A 3ZSYA 1MWMA 4KH4A 5C42A 3AVGA 1QZ5A 4B9VA 2GX9A 3V1RA 4J2BA 2FBVA 2X6SA 3M1FA 1BG3A 3VETA 4BQZA 5AQMA 1KLMA 3LM9A 3QEVA 1U6ZA 5A2QO 3DM2A 1NKEA 3K58A 5CZ1A 4M45A 3KD5E 4DTMA 2D1KA 3LDPA 3C95A 4KI6A 3FFIA 5AQZA 3IMXA 3DLEA 3CCSN 5M1OA 3VTIA 2CH6A 4ISEA 1YUWA 4JKEA 1YJNN 2FC0A 1WBDA 1VQ5N 5EX5A 2KLAA 3OJSA 4ZTJA 1Z25A 1UAXA 2GELA 2QWOA 1GLBG 3CMAN 1OH8A 4B3SK 4H5RA 1FK9A 4BE2A 2NLXA 2D0AA 4C8MA 2P9PA 3ZETA 3M3ZA 3VQ4A 4BRNA 4CJTA 1RDBA 3KZBA 4RWTA 2KKZA 3RWUA 3ZSWA 4I9LA 4CBXA 4BR7A 2NNWA 1IG8A 4BACA 3ZT3A 3PLAA 4GKJK 3CJCA 4O5FA 4X65K 1OH7A 5C24A 5JS2A 4XH4A 4BC3A 1BO5O 4FLYA 5GIPA 3C6TA 3BP8A 1S1UA 3JXUA 3OS1A 3ASMA 2ASPA 3GDQA 3SQ1A 3SAFA 4IBNA 4H03B 3P1GA 2O8DA 4B1WB 4EZ9A 3THYB 5KQDA 2JLEA 1YHQN 1IBKK 2KTQA 4CGHA 2LSNA 4DV6K 3IUCA 4DV3K 1U48A 4J8FA 2WTUA 1NJIO 3KWIA 4O4GA 4FL9A 3NHGA 3ID6A 5JMVA 4Y0WA 3GE1A 2V51B 1B92A 2VQEK 1XHZA 1W9HA 4ID1A 5BPLA 2IS3A 4JKGA 3GG4A 1L3SA 1VQMN 4FZXC 2VYPA 3HRGA 5AQWA 4W5TA 4KAZA 2AJQA 3RRHA 3HBTA 3NH0A 1WSHA 3H1QA 1BIZA 4FWQA 1VSMA 3CM6A 1LAVA 2Q0UA 3KWGA 4DB3A 2YJEA 5F0XA 2NRVA 4JN4A 4CF9A 3O5BA 1TUYA 1CZBA 3DLGA 3H1VX 3WT0A 2Q3SA 4JRPA 4BR0A 1JJ2M 1N5YA 3H3NO 1SAZA 2HSTA 4CJWA 4M41A 3BY5A 2HHXA 2QWPA 1HYVA 3ZCMA 4FWLA 3VPZA 2E1YA 2Z1HA 1XNQK 1NMDA 2KHOA 3ZEUA 1WSJA 3V6DA 3DI6A 1IKXA 5LMNK 1LW0A 3HSTB 1LW2A 3A5NC 5D3GA 1NGFA 3THXA 1DKGD 3OYKA 4CGJA 4ZTFA 2P9LA 4K41A 3CMEN 1NGAA 4BDPA 3B6OA 4JD2B 5BN8A 2E2OA 4CZLA 4DQ8A 3WNFA 3VQPA 3FZHA 4DV4K 1EWQA 3L8BA 3CPWM 4C1NK 2A42A 4QCLA 4BRKA 4Q0BA 1Z26A 2KZZA 4FXDA 3E1YA 4FJXA 4OGEA 1EWRA 1JLGA 4DR6K 1N34K 4XEIA 1MDUB 2VG5A 1ITGA 1VSIA 1RILA 1VQLN 2HMPA 1TKXA 3WEEB 3VERA 1FXXA 4O8UA 4JEPA 4N41A 3L2UA 3QBWA 1BQMA 3HP6A 3EYZA 3VMFB 4CZFA 3PV8A 2VGMA 1NLVA 1BCOA 4CGFA 1NWKA 3SBGA 2G8FA 4Z0UA 1EP4A 4E1NA 3KLGA 4BDZA 4B1ZA 4DR3K 1NJYA 4JYAK 3H3OB 1NJXA 2O8CB 1EKEA 4CF8A 2FBYA 5FPEA 3EKUA 3UKRA 2Y1JA 4QAGA 1KQSM 1JL2A 4DQRA 2QXLA 3MN9A 3OVNA 4CHQA 1Y97A 3OJUA 2ZM6K 3QMLA 2F4VK 2YNGA 3UIQA 5HRNA 3RSEA 3ZSXA 1XUPO 5AZIB 1VQPN 1RBSA 2E2NA 4WCEL 3K9JA 3WEEA 5AQVA 1YITN 1S72N 4IEEA 1I94K 3NF9A 3HK2A 1RTIA 1GLFO 5H1SQ 4CBWA 4NLBA 4CI6A 1WSEA 1SV5A 2HF4A 5HOOA 2OTJN 1JLEA 1LWFA 3U3YA 3I56N 4UY8O 3CYMA 1QVFM 3BF3A 4YNQA 1L3UA 1QS4A 1NGDA 3H46O 1HYSA 3ID8A 3MEGA 1Q9XA 3WQTA 4OJRA 4B9MA 3SAHA 4FJNA 4DV1K 3C65A 2PZSA 4LF5K 2P9LB 3B6PA 4RW4A 3LZJA 4HUFA 4I2PA 1O13A 4FWOA 4FK2A 4A57A 4WFAL 2FBTA 4AHSA 3LWMA 3CCJN 4E7JA 1J5OA 1TL3A 1KVAA 5AQRA 2ATQA 4XH5A 1HNXK 3JS6A 3QERA 2XRIA 3HZ6A 2HBMA 1S9GA 4ZHRA 3TU5A 3KLEA 3U4LA 3DLLL 4ILHA 3SLCA 5FPNA 3C7NB 3AVIA 3VQQA 4LF6K 5AQUA 4BC2A 1TKDA 2G8UA 2HNDA 2HHTA 3SPYA 3SUPA 3D0PA 3UB5A 4OPJA 5BPMA 3C94A 3A2FA 2P51A 1NKBA 3VQCA 2BDPA 4C1NI 2A1RA 1KLNA 4MO4A 2QK9A 3H08A 1T03A 1IBLK 4CFAA 2EX3A 4YOTA 2G8HA 2D0CA 1K9MO 4DU1A 4FLVA 3OBYA 4CERA 1ASWA 2P9NA 2ZJRL 2HHHK 3HJFA 1D8YA 2BUPA 3G71N 4DTUA 3OTOK 1S5JA 1Q82O 4KHQA 1RT2A 3SUNA 1U4BA 5GINA 2F8SA 1JCFA 3LZIA 2P5GA 1ZBSA 1HNZK 2HHSA 1BOTO 1BQNA 3T7ZA 3TTFA 5C2DA 2QKBA 5F1XA 3L2WA 1S9EA 2D0OA 4ISFA 5E26A 5M1FA 3O9QA 3K5NA 4O0IA 1BI4A 1WLJA 1XC9A 1GLLO 4JK7A 1HPMA 1HX1A 4FWRA 3SQ4A 5TKYA 3U9ZA 1YVNA 1NJZA 3QICA 4KO0A 1WAFA 4L8RB 3L2QA 1RBUA 3KK2A 4Z4IA 5AQNA 4H4MA 3PO4A 2E1ZA 1TK0A 3DAWA 4BVPA 3J81O 4J2AA 1U45A 4X64K 1TYQA 3VEXA 3AVHA 3P31A 2QWQA 1VHXA 3VQEA 2I5JA 2GBZA 2QWLA 2IIRA 3I33A 4MFBA 1HUXA 3LALA 2G8VA 4CZEA 4EHTA 3VA0A 4WFNL 4B9SA 3C7NA 1G99A 4DQIA 3QNOA 2RF2A 1TK8A 4LFAK 5EU7A 4CGDA 3VQ6A 1VSJA 4BE0A 4IJNA 4KHUA 3HOTA 3SUOA 4CJ5A 2B6AA 4OO1J 2GTDA 3M8SA 4B08A 1ZBLA 4CHPA 3FFKB 1M90O 1O1WA 2GUIA 1R59O 4BC4A 2CGLA 4H4OA 3NBPA 3LWLA 4BG9A 5BRDA 3OYCA 1YJ9N 2G8IA 3S3NA 4YOUA 4FWKA 3FZFA 1OH5A 3RMCA 2UUAK 4AHRA 4GV9A 4CK3A 3P5JA 3QIPA 4FZZA 1OVQA 4EHUA 1X9SA 2NRRA 4QS9A 4MLHA 1EETA 4JI1K 4WYBA 3HT3A 4OGCA 1KFDA 4BRMA 4BRIA 4CBUA 5E41A 3AV9A 2E5LK 1SKSA 4N47A 3O3HA 1GLJO 4CHZA 1IH7A 1IBMK 3CI5A 2XO7A 2P9SA 1VQ4N 1BHLA 3D7EO 4WQ4C 4KPYA 3SK3A 2YHWA 3NMUA 3VQAA 3L6QA 2I7NA 3AO4A 4B8AB 4ICLA 3QINA 2HHWA 2WBNA 3RSEB 5E84A 4DTOA 2HF3A 2V7ZA 3SPZA 1NBWA 1K8KB 3O9UA 2ZJPL 1HQUA 3F9MA 5CR4A 3TWHA 4RW7A 2OZSA 1WSFA 1R0AA 1UA0A 4CK1A 2GUPA 3AO5A 1X3NA 4HUEA 1IKVA 4FOEA 3AO2A 5AQFA 3W0LA 4BRCA 4H5WA 3MX5A 1J9AA 3DOLA 4FJ5A 5LY3A 2HNYA 2XHBA 1NOYA 2IOCA 4H0VB 2KQ2A 4WQ5C 3V1OA 2O4IA 4CK2A 4MLEA 3AGRA 4DQSA 3N4QA 2RN2A 3QESA 5HLFA 2HB5A 2F7TA 2IC3A 4GNIA 3DLBA 4HTLA 4FJ9A 3AARA 1ZBHA 2YHAA 4IO9L 5BN9A 1WUAA 1RDCA 3FZMA 5AFUH 4FK4A 2OPPA 4PQUA 4PL8A 3SV4A 1RDAA 2XY7A 3IKMA 4KH5A 4PKIA 4BRGA 2E88A 4CEQA 5EOYA 4A5BA 4GKKK 4CECA 3B8AX 3L3VA 3AGKA 2NZTA 5DM7L 3DRRA 3CHWA 2UXCK 4JD2A 3MWTA 4M3TA 3SMPA 2VG6A 1ESVA 5LJVA 1WB9A 4DV0K 3WUHA 3HO1A 3O9RA 1N32K 4O0JA 2BTFA 1SKWA 2P9IB 1KD1O 4IG0A 1HNIA 1YT3A 3TAQA 4KB0A 3TARA 2JWLA 4BRPA 1NGCA 3TAPA 3NGIA 1QE1A 1XI1A 1J53A 4WF9L 1I39A 5BPNA 1BIUA 1U49A 2ZGZA 3N4PA 2W6KA 1IV0A 3OBWA 4FM0A 2HBJA 1JLCA 4CHYA 1XQSC 5JVHL 4CEAA 5JLHA 4JAXA 1NMNA 4DMNA 2V7YA 1RBVA 4O8KA 4E1MA 4CJRA 1TGOA 4JS5A 3CCQN 4IXCA 1Q86O 3HI0A 1KAYA 4FZYA 5AQJA 1Q81O 2KFZA 4JKFA 1YF5L 4IFEA 1GOAA 4A2AA 4FWNA 2FSJA 3TTCA 4HUGA 4FW2A 4CFDA 3MN7A 1FW6A 4DWIA 3LL3A 4FPAA 4MQ3A 5FPMA 1RT6A 1X9JA 1ATNA 3NFAA 1LCUA 4IOXA 1N36K 1VK0A 4NCAA 4CEFA 1YTAA 1EX4A 3CFRA 1IJJA 2ZQBA 1H1VA 1QQMA 3THYA 2HHVA 4DF8A 5M1KA 3KLFA 4JS4A 4DFJA 4G9ZA 2O8DB 1QTMA 5CYQA 3HVRA 4A62A 4DTXA 5LJWA 3QEIA 4DR1K 4XIUA 2YCHA 2HVHA 1KAXA 3E66A 1HNWK 4BQLA 2P9UB 1CZ9A 3ULEA 2X78A 3AVNA 3EE9A 1J54A 2ZGYA 1NGHA 1C0TA 5JICA 1SUQA 4F8RA 1RBRA 1RTHA 1KVCA 4FLWA 3OYBA 2P9KB 1VRTA 4B3OA 1TL1A 2HMIA 2DTUA 3C0BA 3PUFA 3PY8A 3PO5A 3O9TA 4GMJB 2Q2RA 2UYTA 3AO1A 1MU2A 2GEMA 3LP0A 4IO8A 4I2QA 2UU9K 2XY6A 3CETA 3O1BA 1BWFO 1NGJA 2PBDA 4CJEA 2KZMA 3UKUB 4CJKA 3U3GA 1FKPA 1KC8O 2GWKA 4KH6A 4HCCA 2YNIA 3A8YA 4UQGA 3TPQA 1XHXA 3AA3A 1SL2A 4DLEA 2DFFA 2Z1IA 3PIPL 4JI7K 4YOVA 3CIPA 3DXMB 3T1YK 4KREA 3SMSA 3W3DA 4CD3A 4J2EA 4F2SA 4HVJA 2KW4A 1TYQB 3CD6N 3AVCA 1QQOA 4LY7A 5K14A 1Z05A 4LC9B 1A5WA 3VEVA 5EVZA 2OCEA 5KTQA 1TAUA 3ULEB 2A40A 2F8TA 2P9UA 1W2BM 4NXNK 3VQDA 3IFRA 3WNEA 3CC7N 4U7BA 3EZWA 2HBKA 4IOCL 2OPSA 1BI4B 1N6QA 1D9DA 4B1UB 1RGIA 4H0TB 4KHSA 2DFEA 3MX2A 3EKSA 3QEXA 3LDSA 1N8RO 3S41A 5I42A 3VQ9A 4NB4A 3QDKA 3OS2A 4LH4A 4NCGA 2HNZA 1REVA 2QEXN 1SKRA 3VA3A 3I8DA 4C8OA 1RDWX 4CCHA 3F73A 1RTDA 3F2KA 4RCHA 5HL7L 5TKWA 1RBTA 3LM2A 3C6HA 3LPUA 4Y1DA 4C8KA 4H0OA 3K5OA 1BA1A 2P9NB 4CD1A 1RT4A 1GLAG 3CQYA 3CPEA 1KXPA 1WOQA 3NH2A 1DEJA 3MXJA 3V9XA 1OKJA 3CCVN 3VQ7A 4BR9A 1HJRA 3V4IA 3RR8A 1X1PA 4WQ4A 4JKBA 4M63C 3G0ZA 3SQ2A 2Q97A 3QETA 1CZAN 2A41A 4C8LA 4FJKA 2XY8A 3QFUA 4ID5A 5KPRA 1CXUA 2E6MA 1LOTB 1S1WA 1XNRK 1X9WA 2WOMA 4RW6A 4HTUA 4JI0K 3D2FA 3RR7A 5SWMA 4E3SA 4FVMA 5JVGL 4YOWA 3CFOA 1NKCA 2F96A 1B9FA 3I8BA 1YIJN 4DKWA 4QS8A 2W41A 3WNGA 1LWEA 1BDGA 3R3LA 5FDLA 2JWKA 3HSCA 4CEOA 3OYIA 1VQ8N 4Z4HA 1QZ6A 1WNSA 2VQFK 3T1HK 2E20A 5DK5A 4FJJA 2VG7A 3F9KA 4PUOA 4H5VA 3E01A 4DV2K 3O3GA 3TTDA 3O08A 3KVGA 3R6MA 4JHDB 3OA9A 4BC5A 3DLHA 1XC3A 5BR8K 1EO1A 3O9SA 5KRTA 4C23A 2QKKA 5DMRA 1KFSA 2ASMA 2E4LA 1C1CA 3M8PA 3MWPA 3VESA 1XWLA 4FJMA 5FRNA 5MLCQ 3MK6A 4KHYA 5IT9O 3SNNA 1XMOK 4CJPA 1J5EK 4GW6A 3RMAA 1RT1A 2HBLA 3U9DA 3HYFA 3FR0A 4DFMA 1QQNA 1SS6A 3M8QA 3UKRB 3ZX2A 1ZBIA 2O8CA 2F9WA 3VEYA 3A5OC 5FRMA 4OVLA 3IAYA 4FJIA 2Q1NA 3OYJA 1RFQA 3ZSQA 2O8FA 4M3UA 2W40A 3ATVA 1RTJA 3Q7BA 3VF6A 5I3UA 1ZXOA 3CJ9A 2O8BA 4YOXA 4DTJA 3IG1A 4M3RA 3BGRA 5CYMA 4IWVA 4K0KK 4AQYK 4FYDA 4LSNA 3TAMA 3KIOA 5C0YA 3LDOA 3DLRA 2P9SB 4LF9K 5AQLA 3CC4N 3T3FA 5AQTA 3G25A 2ITGA 4WFBL 3QB0A 4FLUA 5KI6A 3OY9A 1BA0A 3E9PA 3ENOA 4BY9C 2NRTA 2Z1GA 5AQXA 3NGYA 2PFUA 4FCYA 4J2DA 5T7BA 3RMBA 1YTUA 3LP1A 1RT3A 1ATRA 3KKRA 4H5NA 4YDUA 3QFPA 1KRPA 1VQ7N 2FSNA 1U2VB 3DYAA 4FWPA 4A59A 3VEOA 4X66K 1TVRA 2IVPA 3OYHA 3ZX0A 3IRXA 4R5PA 3CCRN 2YI1A 1RDDA 4BE1A 4JK8A 4PKGA 4Z4CA 1X9MA 1P90A 4I7FA 5M1PA 5IWAK 5AQYA 1DLOA 3EY1A 3PX4A 2QI2A 1RCHA 3BZKA 4CGGA 4CIEA 1YVUA 3KLHA 1TKZA 4LFBK 5F2RA 4DQPA 5AR0A 5GIOA 1Z6RA 3VF2A 2D0BA 4FLTA 3CC2N 1D5AA 3THWB 3QLHA 4MDAA 2P5OA 3O3FA 3VEZA 3TANA 2E2QA 1QSSA 4CF2A 3AY9A 3P38A 1K8AO 3CQ8A 3V9UA 4HCBA 4JKGB 4CJ7A 3CF5L 3QEPA 3S3MA 3JSMA 3BF1A 3A5MC 4FWSA 4F4KA 3C6UA 4DCHA 4JV5K 3WXKA 5B8HA 4CJUA 4FJ7A 1TKTA 4NYFA 3ZT1A 4EP5A 5BREA 4KHNA 5FPDA 3VN5A 3DJCA 3HPHA 3AVJA 4F2RA 1VRUA 4H8KA 3SQ0A 1SQKA 1S6PA 5AQOA 3T1AA 2IVNA 1UOCA 5KQ8A 3VF4A 4M3ZA 1XMQK 3ATUA 2DPNA 4CJVA 1YJWN 4ELTA 2D5RA 3G10A 1N33K 4OLBA 3L4IA 4CHOA 1J6ZA 4B9UA 4O44A 1JLFA 3UE5A 5CHIA 4IDKA 4DUYK 3HPOA 2IDOA 1HJOA 4KI4A 1WSGA 5C2FA 4KV8A 2JGUA 3JYTA 1NU0A 1QSLA 3LAKA 5J1EA 5JS1A 3E9LA 3ZETB 1VSFA 2P9PB 1I3AA 5CZ2A 3O4WA 4RTFD 3SV3A 4W5QA 4CJFA 5FROA 4R79A 5SZTA 5AQSA 3AVBA 3OW2M 2ZD1A 2ASOA 4DV7K 1Q7YO 5AQGA 3VENA 4RW9A 3P4IA 3ZYYX 4M3YA 3OYAA 2EWSA 3HOSA 2RKIA 3F5TA 2DY4A 1KVBA 3VGKA 4A2BA 4BR2A 4AHTA 1DT9A 4DSKA 2OPRA 4CFCA 3ZSZA 2CGJA 1FKOA 4E89A 2AA4A 3CCMN 3KLIA 3CCLN 3DOKA 4JI5K 3OYMA 3A5LC 3C6AA 4K8ZA 1HQEA 4U67L 1W0HA 4W5RA 3EEQA 4IEIA 3HXMA 4GVEA 4DUZK 4DR2K 3P83D 1FJGK 4EFHA 1JXEA 4FSVA 4CEEA 4X62K 4DR4K 2A6AA 3A0IX 3AA4A 4IJAA 4DQQA 1WSIA 5C12A 1A5XA 3SI6A 4FLXA 2G8WA 3D2EB 4F9OA 3SCXA 4CFBA 3CJBA 3BUZB 3J8AA 5HP1A 5AZJA 1YXQA 3KTQA 1K73O 3CCUN 1ZBFA 4BRLA 5AZIA 2PYJA 3LDQA 3AAPA 3IDHA 3D45A 3MCPA 3OHRA 1S22A 2NUBA 4DSEA 3VGMA 3MN6A 3H6EA 4DFPA 1KCFA 4B1YB 2GWJA 3VGLA 2I7PA 2KFNA 4OKKA 1GOBA 4K25A 1HPZA 5KPTA 2P1JA 3CM5A 1QSYA 4JI2K 2X6NA 5CY4A 4KFBA 5AQQA 3AVMA 4AH9A 3KJVA 3RMDA 4PA1A 3SJHA 1BGXT 4EP4A 4DTSA 1T05A 4QOZB 3TR8A 4AM6A 1ILYA 5DM6L 2QWNA 3ZT2A 4DSIA 4TSXA 2IGIA 1VAZA 4LF7K 2OA8A 1JCGA 3O6WA 3KD1E 1JLQA 3GOIA 4XH1A 3THWA 1B9DA 3P39A 4DTPA 3L3UA 1NK0A 4CJQA 2FF3B 4OPAA 1C0UA 3HM9A 4B1VA 5ADXA 3SAGA 3R9PA 4AILC 2A1SA 4LSLA 3HM8A 5C10A 1IKWA 3SJJA 1U04A 1W7AA 2X74A 4JKAA 2QM1A 4HWIA 4DV5K 2FBXA 2R7YA 5BRFA 3KKSA 2YHXA 5HRPA 3RTVA 3CERA 4DS5A 3VQBA 1NG9A 3THXB 4DSLA 3O1WA 5AQPA 2Y1IA 3CCEN 4B9LA 1C0MA 4FWMA 3ZEUB 3DWLA 3J7ZO 3OYLA 4B1XB 4BGBA 1HKCA 4E7KA 3J7AP 3AVLA 3WQUA 2HW3A 1X3MA 1C6VA 2A5XA 3LP2A 3M6GA 3M8RA 2B4JA 1S1VA 4ILJA 4M42A 2QWRA 3WNHA 1VSEA 2FXUA 4DTNA 1BL3A 3CQXA 3K57A 4CEDA 1P8ZA 1RDUA 3PX0A 3V9ZA 2YX6A 2AP1A 5C25A 2PY5A 1T6DA 1Q18A 1V4TA 4BWJA 2ITMA 2YHBA 4DU4A 4PKHA 3EN9A 1NK4A 4CVNE 4H0YB 1TV6A 1D4XA 4ELUA 3MEEA 3DMJA 1RT5A 3NF6A 4OKJA 4FJHA 4H0PA 4FVUA 2ETJA 2V52B 5KGXA 3WXIA 3FZLA 1MA9B 3LDNA 3BDPA 2HOEA 3NF7A 3V9WA 1C0GA 4CF1A 4GV6A 3V9SA 1HMVA 1E4FT 2O8FB 5LL6Z 3WXJA 4E7HA 4M7YA 3ZSOA 2VWJA 3ENBA 1HNVA 4BVOA 1JLBA 5J2MA 4KHWA 3K2PA 2A3ZA 3TAGA 4OPHA 2VGNA 2IAJA 2ZF5O 4L3QA 1DTQA 4K42A 4V19S 1E3MA 4F3OA 3NCIA 3NF8A 3BZCA 2RPIA 5J2QA 1Q9YA 1V4SA 4DR5K 2HVIA 4CESA 4DS4A 5JLFA 2UUCK 1NGGA 3D2EA 4IFYA 3MECA 4N56A 5KPZA 2WONA 4MO5A 4FM1A 5AJ3K 2D0PA 1VQKN 1A5VA 4DU3A 4DFKA 3ALYA 3ZX3A 4E19A 3SYZA 5AQIA 4Z4EA 1T8EA 3MCAB 3TABA 4IZ9A 4DTRA 5BRHA 4Q5VA 3DRSA 2E6LA 1TAQA 4Z94A 3NH1A 1HKBA 1GLCG 3D6RA 4QS7A 4CZHA 5AQKA 1LAWA 1HRHA 3ITHA 1KSPA 3MDQA 5M1QA 1Q8IA 2YHYA 1EXQA 1C1AA 4BDYA 3CJ7A 2YV0X 3O4QA 3K0SA 4H5TA 4WQ5A 4B9QA 4JRQA 1NK6A 4KRFA 5HRRA 3MAQA 4BR4A 1WBBA 3HP9A 3ZSRA 4DG1A 3DRPA 1JCEA 2ZWHA 1HYZA 3KHYA 3TSQA 1DTTA 4OLAA 4BRAA 4FW1A 4CZIA 2O8EB 3I0SA 2G8KA 1RT7A 4LFCK 4CEZA 3GBTA 4MDBA 3RVCA 3OYNA 5J2PA 2W42A 1NGEA 2YJFA 4RG8A 3ZT4A 4NCBA 2Q36A 4PY5A 4FJLA 1GLEG 3QO9A 1YI2N 5HBMA 3G6EN 1NM1A 3EL2A 2B5JA 3LPTA 2VWBA 4AHCA 4EZ6A 4OPKA 3IS9A 1CLQA 1BUPA 4K43A 5GAGP 4JKDA 4CIFA 5LMUK 4FJGA 2D4WA 1ATSA 1KAZA 4FM2A 4O5BA 3HVTA 3JAMO 2ZE2A 4PHTX 1HR0K 4FK0A 4IKFA 3MN5A 4EIAA 3L2RA 2F9TA 3CXCM 4N5SA 5GAHP 2BH1A 2Q31A 3S9HA 1VSDA 4KTWA 4K8XA 3HPGA 3QEWA 4NLCA 3EO3A 3PX6A 3VEWA 3L2VA 3K5LA 3Q7CA 3TSUA 1HKGA 4O55A 4I9QA 5M1NA 4Z4GA 3O8MA 4E0DA 2E8AA 3NAEA 4OKEA 2OTLN 3LDLA 3ISNC 3VQ5A 3AA2A 3SUQA 1F21A 1U47A 1K6YA 3DXMA 1NNEA 1VQNN 1VQ6N 3PSIA 4OX9K 4CZKA 5BR9A 3HL8A 1LWCA 1T7PA 1VQ9N 3TSPA 1L5UA 4I6MB 2BE2A 2QWMA 4HHTA 1JXBA 3UKUA 3PIOL 2VWKA 3AO3A 1U2VA 4LF4K 1S3XA 4FPBA 3OS0A 4AHVA 3AVKA 2CGKA 2OYQA 4BRHA 3L4QA 4ELVA 4KTZA 5AFUA 2FSKA 1S6QA 2GV9A 4DF4A 1L3VA 2HHQA 5EXWA 2VCPA 4LF8K 3NE6A 1VSLA 5GAEP 4KB1A 4F3TA 5CE3A 4NYNA 5FLXO 3H45C 3V1QA 4PL7A 4B9TA 1CXQA 3K59A 3RRGA 4FLZA 2P9KA 3MEDA 3CJAA 3MXIA 1IO2A 5KRSA 2OZMA 4C8NA 3G4SN 3DXKB 3E9OA 1M1KO 3SZ2A 4B9NA 3OYEA 2WC9A 3MMVA 2HHUA 3KK7A 4CW7B 5EY4A 3J80O 2UXDK 1BISA 2DFHA 3OYGA 3ZSVA 3I55N 4RW8A 4CJSA 4CHNA 3DLKA 3PSFA 4M7XA 3ENHA 3K9KA 1WN7A 3NVMA 4G1QA 2ZJQL 4YY3K 1L3TA 2BANA 2O8BB 4CE9A 3K5MA 1ASVA 4ISGA 4DSFA 1JLAA 4B3TK 4M3XA 4E1JA 2NRZA 1W97L 1ASUA 3QIOA 4GV3A 4JLHA 1IG9A 4JK9A 3FGUA 2IVOA 4CEBA 4CGIA 4JKHA 1KTQA 2RE2A 3NDKA 1EQYA 2J4RA 5HROA 3NVKA 2PYLA 1BU6O 4JI3K 3S3OA 1HLUA 1NGIA 1VQON 4IG3A 4GY2B 4YOYA 3VTHA 1SL1A 3DXKA 3WXLA 2H3GX 3R1XA 4JHDA 3SBTA 1OVYA 4CIGA 5HRSA 1OH6A 4KTQA 1VSKA 4N76A 1UA1A 3U6FA 1TUUA 3MXMA 1JL1A 1QHTA 1C1BA 3ZLJA 4ILGB 4E7IA 4CZGA 1ZC6A 3R8EA 4B3RK 4CZMA 4YDUC
chains in the Genus database with same CATH topology
4B1UB 1RGIA 1ILYA 4H0TB 5DM6L 1QHAA 2QWNA 5BPMA 4A5AA 4BR5A 3MX2A 2WFBA 2Q0RA 1VAZA 4AM7A 3EKSA 1JCGA 3O6WA 1N8RO 3S41A 2QTDA 3GOIA 4XH1A 4NB4A 3QDKA 3EE8A 3D2FB 3P39A 2E2PA 4C1NI 4MO4A 1SZ2A 2FF3B 2QEXN 2P9IA 4BRDA 2QA4N 4OPAA 4B1VA 5ADXA 1RDWX 3SAGA 5GADP 3R9PA 4A61A 1MWKA 3F2KA 4RCHA 4YOTA 3HM8A 4I6MA 5C10A 5HL7L 1T3VA 1K9MO 1E4GT 3L0QA 5TKWA 3OBYA 3LM2A 3C6HA 2P9NA 4JKAA 2ZJRL 2QM1A 4HWIA 3WXMB 1GLDG 4H0OA 5BRFA 1BA1A 2BUPA 2YHXA 2P9NB 4CD1A 3G71N 1T44A 1GLAG 2NRWA 5ELZA 3CQYA 3CPEA 1KXPA 1WOQA 2CH5A 3CERA 1DEJA 4BGAA 1Q82O 1QVGM 4IDHA 4BRFA 3O1WA 1OKJA 5AQPA 3CCEN 5GINA 4KBOA 4FWMA 3CCVN 3ZEUB 3HTVA 1JCFA 4BR9A 1ZBSA 3DWLA 3FE1A 4AF1A 3J7ZO 4B1XB 4BGBA 1HKCA 4JKCA 4WQ4A 1BOTO 3WQUA 3TTFA 3T7ZA 1X3MA 5C2DA 4JKBA 5F1XA 4M63C 2WUSA 4NO7A 4YORA 2A5XA 2D0OA 4ISFA 5E26A 2FLOA 2Q97A 3M6GA 2FF6A 3FZKA 5M1FA 3O9QA 1CZAN 1T6CA 2A41A 4ILJA 2QWRA 3T69A 3GL1A 2FXUA 1DGKN 5AQHA 5I9EB 4BREA 1C0FA 3CQXA 1GLLO 4JK7A 3QFUA 1HPMA 1HX1A 4FWRA 4FOIA 5KPRA 4DHYA 1P8ZA 1Y64A 1RDUA 5TKYA 3U9ZA 1YVNA 1LOTB 3QICA 2YX6A 2AP1A 2NRHA 4H0XB 5AQNA 3VOVA 3D2FA 1T6DA 1YAGA 1Q18A 1V4TA 2E1ZA 4JNEA 3DAWA 4BVPA 2ITMA 1TYQA 3VEXA 3AAQA 2OANA 2QWQA 3EN9A 3P31A 4PKHA 5JVGL 4IOAL 3CJ1A 2QWLA 4YOWA 4H0YB 2IIRA 3I33A 1D4XA 1HUXA 3QBXA 4BRQA 3I8BA 1YIJN 4H0PA 4QS8A 4DKWA 2W41A 1K8KA 4FVUA 4CZEA 3O80A 2V52B 3FLCO 3WXIA 1BDGA 4BROA 3R3LA 3FZLA 4EHTA 4EAHD 4WFNL 2JWKA 3HSCA 1MA9B 3U8XA 4AM6A 1NGBA 1VQ8N 1QZ6A 3C7NA 1G99A 2E20A 3LDNA 5AZJB 2HOEA 2PAVA 4H5VA 1C0GA 4FO0A 4GV6A 1E4FT 3WXJA 3M5RA 4M7YA 4IJNA 2QW9A 3ENBA 3HOTA 4OO1J 4CZJA 2GTDA 4BVOA 3TTDA 3O08A 3KVGA 3R6MA 3FFKB 4JHDB 3OA9A 1M90O 2A3ZA 1R59O 4BC4A 2CGLA 1XC3A 4BC5A 5ADXH 5C15A 4OPHA 2VGNA 3O9SA 2NRXA 1EO1A 4BG9A 2RHKA 4C23A 5BRDA 2ZF5O 1YJ9N 4L3QA 2ASMA 4BG8A 4K42A 4YOUA 4FWKA 3BEXA 3MWPA 3VESA 3FZFA 1MWMA 4KH4A 5MLCQ 4GV9A 3MK6A 1QZ5A 2GX9A 4EHUA 1V4SA 2NRRA 3M1FA 4QS9A 1BG3A 4MLHA 3VETA 4BQZA 4WYBA 5AQMA 5JLFA 3LM9A 4BRMA 2HBLA 3U9DA 1U6ZA 1NGGA 3D2EA 4BRIA 4CBUA 5KPZA 3FR0A 4MO5A 1QQNA 1SS6A 3UKRB 3ZX2A 2D1KA 2D0PA 1VQKN 2F9WA 3LDPA 1GLJO 3VEYA 3A5OC 5AQZA 3CI5A 3IMXA 3ZX3A 5AQIA 3CCSN 2Q1NA 5M1OA 3VTIA 2CH6A 1RFQA 4ISEA 1YUWA 4JKEA 3MCAB 1YJNN 1VQ5N 2P9SA 2W40A 1VQ4N 3ATVA 4IZ9A 5EX5A 2KLAA 3Q7BA 3D7EO 4WQ4C 3VF6A 1ZXOA 3CJ9A 3SK3A 5BRHA 4YOXA 2YHWA 3NMUA 2GELA 2QWOA 1GLBG 2I7NA 3L6QA 3CMAN 4IWVA 4Z94A 4H5RA 1HKBA 2WBNA 5E84A 3RSEB 1GLCG 2HF3A 3D6RA 2V7ZA 2NLXA 4QS7A 4CZHA 1NBWA 1K8KB 5AQKA 5C0YA 2P9PA 3O9UA 3ZETA 2ZJPL 3M3ZA 3LDOA 3MDQA 5M1QA 2YHYA 4BRNA 3F9MA 3KZBA 4RWTA 5CR4A 2KKZA 3CJ7A 2P9SB 4CBXA 4BR7A 5AQLA 2NNWA 1IG8A 3CC4N 2GUPA 1X3NA 3PLAA 4H5TA 4WQ5A 4B9QA 3CJCA 5AQTA 4O5FA 3G25A 4FOEA 4WFBL 5AQFA 3QB0A 3W0LA 4BRCA 4H5WA 3MX5A 1BA0A 4XH4A 4BC3A 3E9PA 1BO5O 3ENOA 2NRTA 5AQXA 4BY9C 4BR4A 5GIPA 5LY3A 2PFUA 3BP8A 4H0VB 1JCEA 3JXUA 4WQ5C 2ZWHA 3KHYA 2ASPA 3GDQA 1ATRA 4MLEA 3AGRA 3TSQA 3N4QA 3SAFA 4H03B 2F7TA 4GNIA 4B1WB 4BRAA 4HTLA 4H5NA 4YDUA 4CZIA 3QFPA 1VQ7N 5KQDA 3AARA 2FSNA 1U2VB 4A59A 4FWPA 4IO9L 3VEOA 1YHQN 5BN9A 1WUAA 3FZMA 3GBTA 5AFUH 3IUCA 4PL8A 2IVPA 4MDBA 3ZX0A 4J8FA 1NJIO 3KWIA 3IKMA 4KH5A 4PKIA 3RVCA 4BRGA 3CCRN 2E88A 1NGEA 2YI1A 2YJFA 4FL9A 4JK8A 3ID6A 4PKGA 5EOYA 4A5BA 4Y0WA 5JMVA 3GE1A 2V51B 3B8AX 2Q36A 3AGKA 1GLEG 1P90A 2NZTA 5BPLA 5DM7L 1YI2N 4JKGA 3GG4A 5M1PA 5AQYA 3CHWA 2QI2A 4JD2A 1VQMN 3MWTA 3G6EN 3SMPA 1ESVA 1NM1A 3EL2A 5LJVA 3WUHA 2VYPA 3O9RA 3HRGA 5AQWA 5F2RA 3HBTA 2VWBA 5AR0A 3H1QA 2BTFA 5GIOA 1Z6RA 2P9IB 4FWQA 3VF2A 1KD1O 3CC2N 2Q0UA 1BUPA 4K43A 5GAGP 4JKDA 3KWGA 2JWLA 4DB3A 4BRPA 1NGCA 4MDAA 2YJEA 5F0XA 2NRVA 4JN4A 2D4WA 1ATSA 4WF9L 1KAZA 3O5BA 1TUYA 3VEZA 5BPNA 2E2QA 3H1VX 4PHTX 3WT0A 3AY9A 3P38A 1K8AO 2ZGZA 3MN5A 3N4PA 4EIAA 2F9TA 3OBWA 2HBJA 3CXCM 4BR0A 1JJ2M 1XQSC 5GAHP 2BH1A 3H3NO 2Q31A 4JKGB 4CJ7A 3CF5L 5JLHA 3BF1A 1SAZA 3A5MC 4FWSA 4JAXA 2HSTA 4DCHA 3WXKA 4NLCA 2V7YA 3EO3A 4O8KA 5B8HA 3VEWA 2QWPA 3CCQN 3Q7CA 3TSUA 1HKGA 4FWLA 4IXCA 3VPZA 5M1NA 2E1YA 3HI0A 5BREA 1Q86O 1KAYA 3O8MA 1NMDA 2KHOA 5FPDA 2E8AA 5AQJA 3ZEUA 1Q81O 4JKFA 1YF5L 3DJCA 3LDLA 4IFEA 2OTLN 3A5NC 4A2AA 1NGFA 1DKGD 3DXMA 4FWNA 2FSJA 3TTCA 2P9LA 4K41A 3CMEN 1NGAA 3MN7A 1VQNN 4JD2B 5BN8A 1VQ6N 1SQKA 3LL3A 4FPAA 4CZKA 2E2OA 5AQOA 5FPMA 4CZLA 5BR9A 4DQ8A 1X9JA 2IVNA 3FZHA 1VQ9N 1ATNA 3TSPA 1LCUA 4IOXA 5KQ8A 3VF4A 4I6MB 3CPWM 4C1NK 2A42A 3ATUA 2DPNA 2QWMA 1YJWN 4BRKA 3L4IA 3UKUA 1IJJA 1J6ZA 3PIOL 3UE5A 5CHIA 1U2VA 3E1YA 1H1VA 1S3XA 4FPBA 1QQMA 1HJOA 5M1KA 5C2FA 2CGKA 4XEIA 1MDUB 4BRHA 3L4QA 4G9ZA 4A62A 1VQLN 2HMPA 5AFUA 3WEEB 2FSKA 3E9LA 3ZETB 5EXWA 2P9PB 2VCPA 3VERA 5LJWA 3O4WA 4O8UA 4JEPA 5GAEP 5CE3A 4RTFD 3H45C 2YCHA 3QBWA 4PL7A 4R79A 1KAXA 3E66A 5AQSA 3OW2M 4BQLA 3VMFB 2P9UB 4CZFA 3ULEA 2ASOA 2VGMA 1NLVA 1Q7YO 3EE9A 5AQGA 1NWKA 2P9KA 2ZGYA 3CJAA 3SBGA 3VENA 1NGHA 3P4IA 5JICA 3ZYYX 4B1ZA 2EWSA 3HOSA 3H3OB 3F5TA 3VGKA 3G4SN 3DXKB 2P9KB 3E9OA 4A2BA 4BR2A 1M1KO 3C0BA 5FPEA 3EKUA 3UKRA 2WC9A 1DT9A 1KQSM 3MMVA 2QXLA 3MN9A 3KK7A 3O9TA 5EY4A 3QMLA 3RSEA 2Q2RA 3I55N 2CGJA 2UYTA 1XUPO 5AZIB 1VQPN 2GEMA 4M7XA 2AA4A 3ENHA 3K9KA 3CCMN 3NVMA 2ZJQL 3CCLN 2E2NA 4WCEL 3A5LC 3K9JA 3C6AA 3WEEA 4IO8A 4U67L 5AQVA 1YITN 1S72N 4IEEA 4IEIA 4GVEA 4ISGA 4EFHA 5JVHL 1GLFO 5H1SQ 4FSVA 4CBWA 4NLBA 3CETA 4CI6A 2HF4A 5HOOA 2A6AA 3A0IX 3O1BA 4E1JA 4IJAA 2OTJN 2NRZA 1BWFO 1W97L 1NGJA 5C12A 2PBDA 3I56N 4GV3A 4UY8O 3UKUB 4JK9A 3FGUA 2IVOA 1QVFM 1KC8O 2GWKA 4JKHA 3BF3A 4KH6A 3A8YA 3D2EB 2RE2A 4F9OA 1NGDA 3TPQA 3H46O 3CJBA 3BUZB 3J8AA 1EQYA 3ID8A 2J4RA 5AZJA 3WQTA 1YXQA 1K73O 3SAHA 3CCUN 4BRLA 3NVKA 3C65A 3PIPL 5AZIA 1BU6O 4YOVA 3LDQA 2P9LB 1HLUA 1NGIA 3CIPA 3DXMB 1VQON 1O13A 4FWOA 4GY2B 4YOYA 3VTHA 3AAPA 3IDHA 4A57A 3MCPA 3SMSA 3OHRA 4WFAL 1S22A 3CCJN 3VGMA 3DXKA 3MN6A 3W3DA 2H3GX 3H6EA 3R1XA 4JHDA 3WXLA 4CD3A 2GWJA 5AQRA 3VGLA 4B1YB 4XH5A 2I7PA 1TYQB 3JS6A 3CD6N 3HZ6A 3SBTA 2HBMA 1QQOA 1OVYA 4K25A 1Z05A 4LC9B 3TU5A 3VEVA 5KPTA 5EVZA 3U4LA 3DLLL 4ILHA 2A40A 3ULEB 3SLCA 5FPNA 2P9UA 1W2BM 5AQQA 3C7NB 1TUUA 3IFRA 4ILGB 5AQUA 3SJHA 4BC2A 3CC7N 4CZGA 4U7BA 3EZWA 1ZC6A 2HBKA 3R8EA 4IOCL 4CZMA 3UB5A 4YDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1U B;  1RGI A;  4H0T B;  1QHA A;  2QWN A;  5BPM A;  4BR5 A;  2Q0R A;  4AM7 A;  3EKS A;  1JCG A;  3O6W A;  3S41 A;  3GOI A;  4XH1 A;  4NB4 A;  3QDK A;  3D2F B;  2E2P A;  4MO4 A;  1SZ2 A;  2FF3 B;  2P9I A;  4BRD A;  4B1V A;  5ADX A;  1RDW X;  3R9P A;  4A61 A;  1MWK A;  4RCH A;  3HM8 A;  4I6M A;  1E4G T;  3L0Q A;  3LM2 A;  2P9N A;  2QM1 A;  4HWI A;  1GLD G;  4H0O A;  5BRF A;  1BA1 A;  2BUP A;  2YHX A;  2P9N B;  4CD1 A;  1T44 A;  1GLA G;  5ELZ A;  3CQY A;  1KXP A;  1WOQ A;  2CH5 A;  3CER A;  1DEJ A;  4BGA A;  4BRF A;  3O1W A;  1OKJ A;  5AQP A;  4KBO A;  4FWM A;  3ZEU B;  3HTV A;  1JCF A;  4BR9 A;  1ZBS A;  3DWL A;  3FE1 A;  4B1X B;  4BGB A;  1HKC A;  4WQ4 A;  1BOT O;  3WQU A;  1X3M A;  5F1X A;  4M63 C;  2WUS A;  4NO7 A;  2A5X A;  2D0O A;  4ISF A;  5E26 A;  2FLO A;  2Q97 A;  3M6G A;  2FF6 A;  3FZK A;  1CZA N;  1T6C A;  2A41 A;  2QWR A;  3GL1 A;  2FXU A;  1DGK N;  5AQH A;  5I9E B;  4BRE A;  1C0F A;  3CQX A;  1GLL O;  3QFU A;  1HPM A;  1HX1 A;  4FWR A;  4FOI A;  5KPR A;  4DHY A;  1P8Z A;  1Y64 A;  5TKY A;  3U9Z A;  1YVN A;  1LOT B;  3QIC A;  2AP1 A;  2NRH A;  4H0X B;  5AQN A;  3VOV A;  3D2F A;  1T6D A;  1YAG A;  1Q18 A;  1V4T A;  2E1Z A;  4JNE A;  3DAW A;  4BVP A;  2ITM A;  1TYQ A;  3VEX A;  3AAQ A;  2OAN A;  2QWQ A;  3EN9 A;  4PKH A;  3CJ1 A;  2QWL A;  4H0Y B;  2IIR A;  3I33 A;  1D4X A;  1HUX A;  3QBX A;  4BRQ A;  3I8B A;  4H0P A;  4QS8 A;  2W41 A;  1K8K A;  4CZE A;  3O80 A;  2V52 B;  3FLC O;  3WXI A;  1BDG A;  4BRO A;  4EHT A;  3FZL A;  4EAH D;  3HSC A;  1MA9 B;  3U8X A;  4AM6 A;  1NGB A;  1QZ6 A;  3C7N A;  1G99 A;  2E20 A;  3LDN A;  5AZJ B;  2HOE A;  2PAV A;  4H5V A;  1C0G A;  4FO0 A;  1E4F T;  3WXJ A;  4M7Y A;  4IJN A;  2QW9 A;  4CZJ A;  2GTD A;  4BVO A;  3O08 A;  3KVG A;  3R6M A;  3FFK B;  4JHD B;  2A3Z A;  1R59 O;  4BC4 A;  2CGL A;  1XC3 A;  4BC5 A;  5ADX H;  4BG9 A;  4C23 A;  5BRD A;  2ZF5 O;  4L3Q A;  2ASM A;  4BG8 A;  4K42 A;  4FWK A;  3BEX A;  3VES A;  3FZF A;  1MWM A;  3MK6 A;  1QZ5 A;  4EHU A;  1V4S A;  3M1F A;  4QS9 A;  1BG3 A;  4MLH A;  3VET A;  4BQZ A;  4WYB A;  5AQM A;  5JLF A;  3LM9 A;  4BRM A;  3U9D A;  1U6Z A;  1NGG A;  3D2E A;  4BRI A;  4CBU A;  5KPZ A;  3FR0 A;  4MO5 A;  1QQN A;  3UKR B;  3ZX2 A;  2D1K A;  2D0P A;  2F9W A;  3LDP A;  1GLJ O;  3VEY A;  3A5O C;  5AQZ A;  3CI5 A;  3IMX A;  3ZX3 A;  5AQI A;  2Q1N A;  2CH6 A;  1RFQ A;  4ISE A;  1YUW A;  2P9S A;  2W40 A;  3ATV A;  4IZ9 A;  5EX5 A;  3VF6 A;  3D7E O;  4WQ4 C;  1ZXO A;  3CJ9 A;  3SK3 A;  5BRH A;  2YHW A;  2GEL A;  2QWO A;  1GLB G;  2I7N A;  3L6Q A;  4IWV A;  4Z94 A;  4H5R A;  1HKB A;  3RSE B;  5E84 A;  1GLC G;  2HF3 A;  2V7Z A;  4QS7 A;  2NLX A;  4CZH A;  1NBW A;  1K8K B;  5AQK A;  2P9P A;  3ZET A;  3M3Z A;  3LDO A;  3MDQ A;  2YHY A;  4BRN A;  3F9M A;  3KZB A;  4RWT A;  3CJ7 A;  2P9S B;  4CBX A;  4BR7 A;  5AQL A;  1IG8 A;  2GUP A;  1X3N A;  4H5T A;  4WQ5 A;  4B9Q A;  3CJC A;  5AQT A;  4O5F A;  3G25 A;  4FOE A;  5AQF A;  3QB0 A;  3W0L A;  4BRC A;  4H5W A;  4XH4 A;  1BA0 A;  4BC3 A;  3ENO A;  1BO5 O;  5AQX A;  4BR4 A;  5LY3 A;  3BP8 A;  4H0V B;  1JCE A;  3JXU A;  4WQ5 C;  2ZWH A;  3KHY A;  2ASP A;  3GDQ A;  1ATR A;  4MLE A;  4H03 B;  4GNI A;  4B1W B;  4BRA A;  4HTL A;  4H5N A;  4YDU A;  4CZI A;  3QFP A;  5KQD A;  3AAR A;  2FSN A;  1U2V B;  4FWP A;  3VEO A;  5BN9 A;  1WUA A;  3FZM A;  3GBT A;  5AFU H;  3IUC A;  4PL8 A;  2IVP A;  3ZX0 A;  4J8F A;  4PKI A;  4BRG A;  2E88 A;  1NGE A;  2YI1 A;  2YJF A;  4FL9 A;  4PKG A;  5EOY A;  5JMV A;  4Y0W A;  3GE1 A;  2V51 B;  3B8A X;  2Q36 A;  1GLE G;  2NZT A;  5BPL A;  3GG4 A;  5AQY A;  3CHW A;  4JD2 A;  3SMP A;  1ESV A;  1NM1 A;  3EL2 A;  5LJV A;  3WUH A;  2VYP A;  5AQW A;  5F2R A;  3HBT A;  2VWB A;  5AR0 A;  3H1Q A;  2BTF A;  1Z6R A;  2P9I B;  4FWQ A;  3VF2 A;  2Q0U A;  1BUP A;  4K43 A;  4DB3 A;  4BRP A;  1NGC A;  2YJE A;  5F0X A;  4JN4 A;  2D4W A;  1ATS A;  1KAZ A;  3O5B A;  1TUY A;  3VEZ A;  5BPN A;  2E2Q A;  3H1V X;  3WT0 A;  3AY9 A;  2ZGZ A;  3MN5 A;  4EIA A;  2F9T A;  4BR0 A;  1XQS C;  3H3N O;  2Q31 A;  4CJ7 A;  5JLH A;  3BF1 A;  1SAZ A;  3A5M C;  4FWS A;  4JAX A;  4DCH A;  3WXK A;  2V7Y A;  3EO3 A;  4O8K A;  5B8H A;  3VEW A;  2QWP A;  1HKG A;  4FWL A;  4IXC A;  3VPZ A;  2E1Y A;  3HI0 A;  5BRE A;  1KAY A;  3O8M A;  1NMD A;  2KHO A;  5FPD A;  2E8A A;  5AQJ A;  3ZEU A;  3DJC A;  3LDL A;  3A5N C;  4A2A A;  1NGF A;  1DKG D;  3DXM A;  4FWN A;  2FSJ A;  2P9L A;  4K41 A;  1NGA A;  3MN7 A;  4JD2 B;  5BN8 A;  1SQK A;  3LL3 A;  4FPA A;  4CZK A;  2E2O A;  5AQO A;  5FPM A;  4CZL A;  5BR9 A;  4DQ8 A;  1X9J A;  2IVN A;  3FZH A;  1ATN A;  1LCU A;  5KQ8 A;  3VF4 A;  4I6M B;  2A42 A;  3ATU A;  2DPN A;  2QWM A;  4BRK A;  3L4I A;  3UKU A;  1IJJ A;  1J6Z A;  3UE5 A;  1U2V A;  1H1V A;  1S3X A;  4FPB A;  1QQM A;  1HJO A;  2CGK A;  4XEI A;  1MDU B;  4BRH A;  4A62 A;  2HMP A;  5AFU A;  3WEE B;  2FSK A;  3ZET B;  5EXW A;  2P9P B;  2VCP A;  3VER A;  5LJW A;  3O4W A;  5CE3 A;  4RTF D;  3H45 C;  2YCH A;  3QBW A;  4PL7 A;  1KAX A;  5AQS A;  4BQL A;  4CZF A;  2P9U B;  3ULE A;  2ASO A;  1NLV A;  5AQG A;  1NWK A;  2P9K A;  2ZGY A;  3CJA A;  3VEN A;  1NGH A;  3P4I A;  5JIC A;  4B1Z A;  2EWS A;  3H3O B;  3VGK A;  3DXK B;  2P9K B;  4A2B A;  4BR2 A;  3C0B A;  5FPE A;  3EKU A;  3UKR A;  3MMV A;  2QXL A;  3MN9 A;  5EY4 A;  3QML A;  3RSE A;  2Q2R A;  2CGJ A;  2UYT A;  1XUP O;  5AZI B;  2GEM A;  4M7X A;  2AA4 A;  3ENH A;  2E2N A;  3A5L C;  3WEE A;  4IO8 A;  5AQV A;  4ISG A;  4EFH A;  1GLF O;  4FSV A;  4CBW A;  3CET A;  4CI6 A;  2HF4 A;  2A6A A;  3A0I X;  3O1B A;  4E1J A;  4IJA A;  1BWF O;  1NGJ A;  2PBD A;  3UKU B;  3FGU A;  2IVO A;  2GWK A;  3BF3 A;  3A8Y A;  3D2E B;  4F9O A;  1NGD A;  3TPQ A;  3H46 O;  3CJB A;  3BUZ B;  3J8A A;  1EQY A;  3ID8 A;  2J4R A;  5AZJ A;  3WQT A;  1YXQ A;  4BRL A;  5AZI A;  1BU6 O;  3LDQ A;  2P9L B;  1HLU A;  1NGI A;  3CIP A;  3DXM B;  4FWO A;  4GY2 B;  3AAP A;  3IDH A;  3MCP A;  3SMS A;  3OHR A;  1S22 A;  3VGM A;  3DXK A;  3MN6 A;  3W3D A;  2H3G X;  3H6E A;  4JHD A;  3WXL A;  4CD3 A;  2GWJ A;  5AQR A;  3VGL A;  4B1Y B;  4XH5 A;  2I7P A;  1TYQ B;  3JS6 A;  3HZ6 A;  1QQO A;  4K25 A;  1Z05 A;  4LC9 B;  3TU5 A;  3VEV A;  5KPT A;  5EVZ A;  3U4L A;  3ULE B;  2A40 A;  3SLC A;  5FPN A;  2P9U A;  5AQQ A;  3C7N B;  1TUU A;  3IFR A;  5AQU A;  3SJH A;  4BC2 A;  4CZG A;  3EZW A;  1ZC6 A;  3R8E A;  4CZM A;  3UB5 A;  4YDU C; 
#chains in the Genus database with same CATH topology
 4AHU A;  4YHH K;  1QHA A;  2QXF A;  3O4N A;  1NK5 A;  3QNN A;  4A5A A;  4BR5 A;  2WFB A;  2Q0R A;  3VQ8 A;  2Z1J A;  1NK7 A;  1IKY A;  4AM7 A;  3TAE A;  2QTD A;  5J2N A;  3EE8 A;  3D2F B;  2E2P A;  3LAM A;  4BWM A;  1SZ2 A;  4PWD A;  2P9I A;  4BRD A;  2QA4 N;  1VSH A;  4WE1 A;  5GAD P;  1GOC A;  4CF0 A;  4A61 A;  1MWK A;  4I6M A;  1T3V A;  3ZT0 A;  1E4G T;  3L0Q A;  3I0R A;  4B3M K;  1UWB A;  3WXM B;  1GLD G;  3CG7 A;  1T44 A;  2NRW A;  2YKM A;  5ELZ A;  2O4G A;  2CH5 A;  4BGA A;  1QVG M;  4IDH A;  4BRF A;  2UXB K;  4GVM A;  4KBO A;  3HTV A;  3EZ5 A;  3FE1 A;  4AF1 A;  2BGG A;  4W5N A;  4LD0 A;  4JKC A;  3J7Y P;  4DSJ A;  2YNH A;  4W5O A;  2OPQ A;  4NO7 A;  2WUS A;  4YOR A;  4DR7 K;  2FLO A;  2FF6 A;  3FZK A;  3TAF A;  1T6C A;  3T69 A;  2XY5 A;  3ULD A;  1G15 A;  3GL1 A;  4JI6 K;  1DGK N;  5AQH A;  5I9E B;  4BRE A;  4CJ3 A;  1C0F A;  4Y1C A;  1BCM A;  3V81 A;  4FOI A;  4DHY A;  1Y64 A;  4NXM K;  2YNF A;  3CFP A;  2UUB K;  1JKH A;  2NRH A;  4H0X B;  2W6L A;  1WAJ A;  1LV5 A;  3VOV A;  4JNE A;  1YAG A;  2EHG A;  4KKO A;  3AAQ A;  2OAN A;  4IOA L;  3CJ1 A;  1NOZ A;  1S1X A;  4DLG A;  1SL0 A;  3QBX A;  4JI4 K;  4BRQ A;  1ZBU A;  3AA5 X;  2YKN A;  1K8K A;  1S1T A;  4B8C A;  3O80 A;  4BRO A;  3FLC O;  4EAH D;  4LH5 A;  3KK3 A;  3U8X A;  1NK9 A;  1NGB A;  3T19 A;  3OYD A;  4IFV A;  4Z4F A;  5AZJ B;  2PAV A;  3NGZ A;  3KK1 A;  4FO0 A;  1TK5 A;  1D9F A;  4CJL A;  3LP3 A;  3M5R A;  4JI8 K;  4KHP K;  2QW9 A;  3AVF A;  1NJW A;  4CZJ A;  1QQC A;  3LAN A;  4YFU A;  5ADX H;  5C15 A;  3OYF A;  3AVA A;  2NRX A;  4M3W A;  2RHK A;  2O8E A;  5KGW A;  3TI0 A;  4BG8 A;  4CJ4 A;  1RNH A;  3THV A;  1NK8 A;  3BEX A;  4E7L A;  1ZYQ A;  4FJ8 A;  3ZSY A;  1MWM A;  4KH4 A;  5C42 A;  3AVG A;  1QZ5 A;  4B9V A;  2GX9 A;  3V1R A;  4J2B A;  2FBV A;  2X6S A;  3M1F A;  1BG3 A;  3VET A;  4BQZ A;  5AQM A;  1KLM A;  3LM9 A;  3QEV A;  1U6Z A;  5A2Q O;  3DM2 A;  1NKE A;  3K58 A;  5CZ1 A;  4M45 A;  3KD5 E;  4DTM A;  2D1K A;  3LDP A;  3C95 A;  4KI6 A;  3FFI A;  5AQZ A;  3IMX A;  3DLE A;  3CCS N;  5M1O A;  3VTI A;  2CH6 A;  4ISE A;  1YUW A;  4JKE A;  1YJN N;  2FC0 A;  1WBD A;  1VQ5 N;  5EX5 A;  2KLA A;  3OJS A;  4ZTJ A;  1Z25 A;  1UAX A;  2GEL A;  2QWO A;  1GLB G;  3CMA N;  1OH8 A;  4B3S K;  4H5R A;  1FK9 A;  4BE2 A;  2NLX A;  2D0A A;  4C8M A;  2P9P A;  3ZET A;  3M3Z A;  3VQ4 A;  4BRN A;  4CJT A;  1RDB A;  3KZB A;  4RWT A;  2KKZ A;  3RWU A;  3ZSW A;  4I9L A;  4CBX A;  4BR7 A;  2NNW A;  1IG8 A;  4BAC A;  3ZT3 A;  3PLA A;  4GKJ K;  3CJC A;  4O5F A;  4X65 K;  1OH7 A;  5C24 A;  5JS2 A;  4XH4 A;  4BC3 A;  1BO5 O;  4FLY A;  5GIP A;  3C6T A;  3BP8 A;  1S1U A;  3JXU A;  3OS1 A;  3ASM A;  2ASP A;  3GDQ A;  3SQ1 A;  3SAF A;  4IBN A;  4H03 B;  3P1G A;  2O8D A;  4B1W B;  4EZ9 A;  3THY B;  5KQD A;  2JLE A;  1YHQ N;  1IBK K;  2KTQ A;  4CGH A;  2LSN A;  4DV6 K;  3IUC A;  4DV3 K;  1U48 A;  4J8F A;  2WTU A;  1NJI O;  3KWI A;  4O4G A;  4FL9 A;  3NHG A;  3ID6 A;  5JMV A;  4Y0W A;  3GE1 A;  2V51 B;  1B92 A;  2VQE K;  1XHZ A;  1W9H A;  4ID1 A;  5BPL A;  2IS3 A;  4JKG A;  3GG4 A;  1L3S A;  1VQM N;  4FZX C;  2VYP A;  3HRG A;  5AQW A;  4W5T A;  4KAZ A;  2AJQ A;  3RRH A;  3HBT A;  3NH0 A;  1WSH A;  3H1Q A;  1BIZ A;  4FWQ A;  1VSM A;  3CM6 A;  1LAV A;  2Q0U A;  3KWG A;  4DB3 A;  2YJE A;  5F0X A;  2NRV A;  4JN4 A;  4CF9 A;  3O5B A;  1TUY A;  1CZB A;  3DLG A;  3H1V X;  3WT0 A;  2Q3S A;  4JRP A;  4BR0 A;  1JJ2 M;  1N5Y A;  3H3N O;  1SAZ A;  2HST A;  4CJW A;  4M41 A;  3BY5 A;  2HHX A;  2QWP A;  1HYV A;  3ZCM A;  4FWL A;  3VPZ A;  2E1Y A;  2Z1H A;  1XNQ K;  1NMD A;  2KHO A;  3ZEU A;  1WSJ A;  3V6D A;  3DI6 A;  1IKX A;  5LMN K;  1LW0 A;  3HST B;  1LW2 A;  3A5N C;  5D3G A;  1NGF A;  3THX A;  1DKG D;  3OYK A;  4CGJ A;  4ZTF A;  2P9L A;  4K41 A;  3CME N;  1NGA A;  4BDP A;  3B6O A;  4JD2 B;  5BN8 A;  2E2O A;  4CZL A;  4DQ8 A;  3WNF A;  3VQP A;  3FZH A;  4DV4 K;  1EWQ A;  3L8B A;  3CPW M;  4C1N K;  2A42 A;  4QCL A;  4BRK A;  4Q0B A;  1Z26 A;  2KZZ A;  4FXD A;  3E1Y A;  4FJX A;  4OGE A;  1EWR A;  1JLG A;  4DR6 K;  1N34 K;  4XEI A;  1MDU B;  2VG5 A;  1ITG A;  1VSI A;  1RIL A;  1VQL N;  2HMP A;  1TKX A;  3WEE B;  3VER A;  1FXX A;  4O8U A;  4JEP A;  4N41 A;  3L2U A;  3QBW A;  1BQM A;  3HP6 A;  3EYZ A;  3VMF B;  4CZF A;  3PV8 A;  2VGM A;  1NLV A;  1BCO A;  4CGF A;  1NWK A;  3SBG A;  2G8F A;  4Z0U A;  1EP4 A;  4E1N A;  3KLG A;  4BDZ A;  4B1Z A;  4DR3 K;  1NJY A;  4JYA K;  3H3O B;  1NJX A;  2O8C B;  1EKE A;  4CF8 A;  2FBY A;  5FPE A;  3EKU A;  3UKR A;  2Y1J A;  4QAG A;  1KQS M;  1JL2 A;  4DQR A;  2QXL A;  3MN9 A;  3OVN A;  4CHQ A;  1Y97 A;  3OJU A;  2ZM6 K;  3QML A;  2F4V K;  2YNG A;  3UIQ A;  5HRN A;  3RSE A;  3ZSX A;  1XUP O;  5AZI B;  1VQP N;  1RBS A;  2E2N A;  4WCE L;  3K9J A;  3WEE A;  5AQV A;  1YIT N;  1S72 N;  4IEE A;  1I94 K;  3NF9 A;  3HK2 A;  1RTI A;  1GLF O;  5H1S Q;  4CBW A;  4NLB A;  4CI6 A;  1WSE A;  1SV5 A;  2HF4 A;  5HOO A;  2OTJ N;  1JLE A;  1LWF A;  3U3Y A;  3I56 N;  4UY8 O;  3CYM A;  1QVF M;  3BF3 A;  4YNQ A;  1L3U A;  1QS4 A;  1NGD A;  3H46 O;  1HYS A;  3ID8 A;  3MEG A;  1Q9X A;  3WQT A;  4OJR A;  4B9M A;  3SAH A;  4FJN A;  4DV1 K;  3C65 A;  2PZS A;  4LF5 K;  2P9L B;  3B6P A;  4RW4 A;  3LZJ A;  4HUF A;  4I2P A;  1O13 A;  4FWO A;  4FK2 A;  4A57 A;  4WFA L;  2FBT A;  4AHS A;  3LWM A;  3CCJ N;  4E7J A;  1J5O A;  1TL3 A;  1KVA A;  5AQR A;  2ATQ A;  4XH5 A;  1HNX K;  3JS6 A;  3QER A;  2XRI A;  3HZ6 A;  2HBM A;  1S9G A;  4ZHR A;  3TU5 A;  3KLE A;  3U4L A;  3DLL L;  4ILH A;  3SLC A;  5FPN A;  3C7N B;  3AVI A;  3VQQ A;  4LF6 K;  5AQU A;  4BC2 A;  1TKD A;  2G8U A;  2HND A;  2HHT A;  3SPY A;  3SUP A;  3D0P A;  3UB5 A;  4OPJ A;  5BPM A;  3C94 A;  3A2F A;  2P51 A;  1NKB A;  3VQC A;  2BDP A;  4C1N I;  2A1R A;  1KLN A;  4MO4 A;  2QK9 A;  3H08 A;  1T03 A;  1IBL K;  4CFA A;  2EX3 A;  4YOT A;  2G8H A;  2D0C A;  1K9M O;  4DU1 A;  4FLV A;  3OBY A;  4CER A;  1ASW A;  2P9N A;  2ZJR L;  2HHH K;  3HJF A;  1D8Y A;  2BUP A;  3G71 N;  4DTU A;  3OTO K;  1S5J A;  1Q82 O;  4KHQ A;  1RT2 A;  3SUN A;  1U4B A;  5GIN A;  2F8S A;  1JCF A;  3LZI A;  2P5G A;  1ZBS A;  1HNZ K;  2HHS A;  1BOT O;  1BQN A;  3T7Z A;  3TTF A;  5C2D A;  2QKB A;  5F1X A;  3L2W A;  1S9E A;  2D0O A;  4ISF A;  5E26 A;  5M1F A;  3O9Q A;  3K5N A;  4O0I A;  1BI4 A;  1WLJ A;  1XC9 A;  1GLL O;  4JK7 A;  1HPM A;  1HX1 A;  4FWR A;  3SQ4 A;  5TKY A;  3U9Z A;  1YVN A;  1NJZ A;  3QIC A;  4KO0 A;  1WAF A;  4L8R B;  3L2Q A;  1RBU A;  3KK2 A;  4Z4I A;  5AQN A;  4H4M A;  3PO4 A;  2E1Z A;  1TK0 A;  3DAW A;  4BVP A;  3J81 O;  4J2A A;  1U45 A;  4X64 K;  1TYQ A;  3VEX A;  3AVH A;  3P31 A;  2QWQ A;  1VHX A;  3VQE A;  2I5J A;  2GBZ A;  2QWL A;  2IIR A;  3I33 A;  4MFB A;  1HUX A;  3LAL A;  2G8V A;  4CZE A;  4EHT A;  3VA0 A;  4WFN L;  4B9S A;  3C7N A;  1G99 A;  4DQI A;  3QNO A;  2RF2 A;  1TK8 A;  4LFA K;  5EU7 A;  4CGD A;  3VQ6 A;  1VSJ A;  4BE0 A;  4IJN A;  4KHU A;  3HOT A;  3SUO A;  4CJ5 A;  2B6A A;  4OO1 J;  2GTD A;  3M8S A;  4B08 A;  1ZBL A;  4CHP A;  3FFK B;  1M90 O;  1O1W A;  2GUI A;  1R59 O;  4BC4 A;  2CGL A;  4H4O A;  3NBP A;  3LWL A;  4BG9 A;  5BRD A;  3OYC A;  1YJ9 N;  2G8I A;  3S3N A;  4YOU A;  4FWK A;  3FZF A;  1OH5 A;  3RMC A;  2UUA K;  4AHR A;  4GV9 A;  4CK3 A;  3P5J A;  3QIP A;  4FZZ A;  1OVQ A;  4EHU A;  1X9S A;  2NRR A;  4QS9 A;  4MLH A;  1EET A;  4JI1 K;  4WYB A;  3HT3 A;  4OGC A;  1KFD A;  4BRM A;  4BRI A;  4CBU A;  5E41 A;  3AV9 A;  2E5L K;  1SKS A;  4N47 A;  3O3H A;  1GLJ O;  4CHZ A;  1IH7 A;  1IBM K;  3CI5 A;  2XO7 A;  2P9S A;  1VQ4 N;  1BHL A;  3D7E O;  4WQ4 C;  4KPY A;  3SK3 A;  2YHW A;  3NMU A;  3VQA A;  3L6Q A;  2I7N A;  3AO4 A;  4B8A B;  4ICL A;  3QIN A;  2HHW A;  2WBN A;  3RSE B;  5E84 A;  4DTO A;  2HF3 A;  2V7Z A;  3SPZ A;  1NBW A;  1K8K B;  3O9U A;  2ZJP L;  1HQU A;  3F9M A;  5CR4 A;  3TWH A;  4RW7 A;  2OZS A;  1WSF A;  1R0A A;  1UA0 A;  4CK1 A;  2GUP A;  3AO5 A;  1X3N A;  4HUE A;  1IKV A;  4FOE A;  3AO2 A;  5AQF A;  3W0L A;  4BRC A;  4H5W A;  3MX5 A;  1J9A A;  3DOL A;  4FJ5 A;  5LY3 A;  2HNY A;  2XHB A;  1NOY A;  2IOC A;  4H0V B;  2KQ2 A;  4WQ5 C;  3V1O A;  2O4I A;  4CK2 A;  4MLE A;  3AGR A;  4DQS A;  3N4Q A;  2RN2 A;  3QES A;  5HLF A;  2HB5 A;  2F7T A;  2IC3 A;  4GNI A;  3DLB A;  4HTL A;  4FJ9 A;  3AAR A;  1ZBH A;  2YHA A;  4IO9 L;  5BN9 A;  1WUA A;  1RDC A;  3FZM A;  5AFU H;  4FK4 A;  2OPP A;  4PQU A;  4PL8 A;  3SV4 A;  1RDA A;  2XY7 A;  3IKM A;  4KH5 A;  4PKI A;  4BRG A;  2E88 A;  4CEQ A;  5EOY A;  4A5B A;  4GKK K;  4CEC A;  3B8A X;  3L3V A;  3AGK A;  2NZT A;  5DM7 L;  3DRR A;  3CHW A;  2UXC K;  4JD2 A;  3MWT A;  4M3T A;  3SMP A;  2VG6 A;  1ESV A;  5LJV A;  1WB9 A;  4DV0 K;  3WUH A;  3HO1 A;  3O9R A;  1N32 K;  4O0J A;  2BTF A;  1SKW A;  2P9I B;  1KD1 O;  4IG0 A;  1HNI A;  1YT3 A;  3TAQ A;  4KB0 A;  3TAR A;  2JWL A;  4BRP A;  1NGC A;  3TAP A;  3NGI A;  1QE1 A;  1XI1 A;  1J53 A;  4WF9 L;  1I39 A;  5BPN A;  1BIU A;  1U49 A;  2ZGZ A;  3N4P A;  2W6K A;  1IV0 A;  3OBW A;  4FM0 A;  2HBJ A;  1JLC A;  4CHY A;  1XQS C;  5JVH L;  4CEA A;  5JLH A;  4JAX A;  1NMN A;  4DMN A;  2V7Y A;  1RBV A;  4O8K A;  4E1M A;  4CJR A;  1TGO A;  4JS5 A;  3CCQ N;  4IXC A;  1Q86 O;  3HI0 A;  1KAY A;  4FZY A;  5AQJ A;  1Q81 O;  2KFZ A;  4JKF A;  1YF5 L;  4IFE A;  1GOA A;  4A2A A;  4FWN A;  2FSJ A;  3TTC A;  4HUG A;  4FW2 A;  4CFD A;  3MN7 A;  1FW6 A;  4DWI A;  3LL3 A;  4FPA A;  4MQ3 A;  5FPM A;  1RT6 A;  1X9J A;  1ATN A;  3NFA A;  1LCU A;  4IOX A;  1N36 K;  1VK0 A;  4NCA A;  4CEF A;  1YTA A;  1EX4 A;  3CFR A;  1IJJ A;  2ZQB A;  1H1V A;  1QQM A;  3THY A;  2HHV A;  4DF8 A;  5M1K A;  3KLF A;  4JS4 A;  4DFJ A;  4G9Z A;  2O8D B;  1QTM A;  5CYQ A;  3HVR A;  4A62 A;  4DTX A;  5LJW A;  3QEI A;  4DR1 K;  4XIU A;  2YCH A;  2HVH A;  1KAX A;  3E66 A;  1HNW K;  4BQL A;  2P9U B;  1CZ9 A;  3ULE A;  2X78 A;  3AVN A;  3EE9 A;  1J54 A;  2ZGY A;  1NGH A;  1C0T A;  5JIC A;  1SUQ A;  4F8R A;  1RBR A;  1RTH A;  1KVC A;  4FLW A;  3OYB A;  2P9K B;  1VRT A;  4B3O A;  1TL1 A;  2HMI A;  2DTU A;  3C0B A;  3PUF A;  3PY8 A;  3PO5 A;  3O9T A;  4GMJ B;  2Q2R A;  2UYT A;  3AO1 A;  1MU2 A;  2GEM A;  3LP0 A;  4IO8 A;  4I2Q A;  2UU9 K;  2XY6 A;  3CET A;  3O1B A;  1BWF O;  1NGJ A;  2PBD A;  4CJE A;  2KZM A;  3UKU B;  4CJK A;  3U3G A;  1FKP A;  1KC8 O;  2GWK A;  4KH6 A;  4HCC A;  2YNI A;  3A8Y A;  4UQG A;  3TPQ A;  1XHX A;  3AA3 A;  1SL2 A;  4DLE A;  2DFF A;  2Z1I A;  3PIP L;  4JI7 K;  4YOV A;  3CIP A;  3DXM B;  3T1Y K;  4KRE A;  3SMS A;  3W3D A;  4CD3 A;  4J2E A;  4F2S A;  4HVJ A;  2KW4 A;  1TYQ B;  3CD6 N;  3AVC A;  1QQO A;  4LY7 A;  5K14 A;  1Z05 A;  4LC9 B;  1A5W A;  3VEV A;  5EVZ A;  2OCE A;  5KTQ A;  1TAU A;  3ULE B;  2A40 A;  2F8T A;  2P9U A;  1W2B M;  4NXN K;  3VQD A;  3IFR A;  3WNE A;  3CC7 N;  4U7B A;  3EZW A;  2HBK A;  4IOC L;  2OPS A;  1BI4 B;  1N6Q A;  1D9D A;  4B1U B;  1RGI A;  4H0T B;  4KHS A;  2DFE A;  3MX2 A;  3EKS A;  3QEX A;  3LDS A;  1N8R O;  3S41 A;  5I42 A;  3VQ9 A;  4NB4 A;  3QDK A;  3OS2 A;  4LH4 A;  4NCG A;  2HNZ A;  1REV A;  2QEX N;  1SKR A;  3VA3 A;  3I8D A;  4C8O A;  1RDW X;  4CCH A;  3F73 A;  1RTD A;  3F2K A;  4RCH A;  5HL7 L;  5TKW A;  1RBT A;  3LM2 A;  3C6H A;  3LPU A;  4Y1D A;  4C8K A;  4H0O A;  3K5O A;  1BA1 A;  2P9N B;  4CD1 A;  1RT4 A;  1GLA G;  3CQY A;  3CPE A;  1KXP A;  1WOQ A;  3NH2 A;  1DEJ A;  3MXJ A;  3V9X A;  1OKJ A;  3CCV N;  3VQ7 A;  4BR9 A;  1HJR A;  3V4I A;  3RR8 A;  1X1P A;  4WQ4 A;  4JKB A;  4M63 C;  3G0Z A;  3SQ2 A;  2Q97 A;  3QET A;  1CZA N;  2A41 A;  4C8L A;  4FJK A;  2XY8 A;  3QFU A;  4ID5 A;  5KPR A;  1CXU A;  2E6M A;  1LOT B;  1S1W A;  1XNR K;  1X9W A;  2WOM A;  4RW6 A;  4HTU A;  4JI0 K;  3D2F A;  3RR7 A;  5SWM A;  4E3S A;  4FVM A;  5JVG L;  4YOW A;  3CFO A;  1NKC A;  2F96 A;  1B9F A;  3I8B A;  1YIJ N;  4DKW A;  4QS8 A;  2W41 A;  3WNG A;  1LWE A;  1BDG A;  3R3L A;  5FDL A;  2JWK A;  3HSC A;  4CEO A;  3OYI A;  1VQ8 N;  4Z4H A;  1QZ6 A;  1WNS A;  2VQF K;  3T1H K;  2E20 A;  5DK5 A;  4FJJ A;  2VG7 A;  3F9K A;  4PUO A;  4H5V A;  3E01 A;  4DV2 K;  3O3G A;  3TTD A;  3O08 A;  3KVG A;  3R6M A;  4JHD B;  3OA9 A;  4BC5 A;  3DLH A;  1XC3 A;  5BR8 K;  1EO1 A;  3O9S A;  5KRT A;  4C23 A;  2QKK A;  5DMR A;  1KFS A;  2ASM A;  2E4L A;  1C1C A;  3M8P A;  3MWP A;  3VES A;  1XWL A;  4FJM A;  5FRN A;  5MLC Q;  3MK6 A;  4KHY A;  5IT9 O;  3SNN A;  1XMO K;  4CJP A;  1J5E K;  4GW6 A;  3RMA A;  1RT1 A;  2HBL A;  3U9D A;  3HYF A;  3FR0 A;  4DFM A;  1QQN A;  1SS6 A;  3M8Q A;  3UKR B;  3ZX2 A;  1ZBI A;  2O8C A;  2F9W A;  3VEY A;  3A5O C;  5FRM A;  4OVL A;  3IAY A;  4FJI A;  2Q1N A;  3OYJ A;  1RFQ A;  3ZSQ A;  2O8F A;  4M3U A;  2W40 A;  3ATV A;  1RTJ A;  3Q7B A;  3VF6 A;  5I3U A;  1ZXO A;  3CJ9 A;  2O8B A;  4YOX A;  4DTJ A;  3IG1 A;  4M3R A;  3BGR A;  5CYM A;  4IWV A;  4K0K K;  4AQY K;  4FYD A;  4LSN A;  3TAM A;  3KIO A;  5C0Y A;  3LDO A;  3DLR A;  2P9S B;  4LF9 K;  5AQL A;  3CC4 N;  3T3F A;  5AQT A;  3G25 A;  2ITG A;  4WFB L;  3QB0 A;  4FLU A;  5KI6 A;  3OY9 A;  1BA0 A;  3E9P A;  3ENO A;  4BY9 C;  2NRT A;  2Z1G A;  5AQX A;  3NGY A;  2PFU A;  4FCY A;  4J2D A;  5T7B A;  3RMB A;  1YTU A;  3LP1 A;  1RT3 A;  1ATR A;  3KKR A;  4H5N A;  4YDU A;  3QFP A;  1KRP A;  1VQ7 N;  2FSN A;  1U2V B;  3DYA A;  4FWP A;  4A59 A;  3VEO A;  4X66 K;  1TVR A;  2IVP A;  3OYH A;  3ZX0 A;  3IRX A;  4R5P A;  3CCR N;  2YI1 A;  1RDD A;  4BE1 A;  4JK8 A;  4PKG A;  4Z4C A;  1X9M A;  1P90 A;  4I7F A;  5M1P A;  5IWA K;  5AQY A;  1DLO A;  3EY1 A;  3PX4 A;  2QI2 A;  1RCH A;  3BZK A;  4CGG A;  4CIE A;  1YVU A;  3KLH A;  1TKZ A;  4LFB K;  5F2R A;  4DQP A;  5AR0 A;  5GIO A;  1Z6R A;  3VF2 A;  2D0B A;  4FLT A;  3CC2 N;  1D5A A;  3THW B;  3QLH A;  4MDA A;  2P5O A;  3O3F A;  3VEZ A;  3TAN A;  2E2Q A;  1QSS A;  4CF2 A;  3AY9 A;  3P38 A;  1K8A O;  3CQ8 A;  3V9U A;  4HCB A;  4JKG B;  4CJ7 A;  3CF5 L;  3QEP A;  3S3M A;  3JSM A;  3BF1 A;  3A5M C;  4FWS A;  4F4K A;  3C6U A;  4DCH A;  4JV5 K;  3WXK A;  5B8H A;  4CJU A;  4FJ7 A;  1TKT A;  4NYF A;  3ZT1 A;  4EP5 A;  5BRE A;  4KHN A;  5FPD A;  3VN5 A;  3DJC A;  3HPH A;  3AVJ A;  4F2R A;  1VRU A;  4H8K A;  3SQ0 A;  1SQK A;  1S6P A;  5AQO A;  3T1A A;  2IVN A;  1UOC A;  5KQ8 A;  3VF4 A;  4M3Z A;  1XMQ K;  3ATU A;  2DPN A;  4CJV A;  1YJW N;  4ELT A;  2D5R A;  3G10 A;  1N33 K;  4OLB A;  3L4I A;  4CHO A;  1J6Z A;  4B9U A;  4O44 A;  1JLF A;  3UE5 A;  5CHI A;  4IDK A;  4DUY K;  3HPO A;  2IDO A;  1HJO A;  4KI4 A;  1WSG A;  5C2F A;  4KV8 A;  2JGU A;  3JYT A;  1NU0 A;  1QSL A;  3LAK A;  5J1E A;  5JS1 A;  3E9L A;  3ZET B;  1VSF A;  2P9P B;  1I3A A;  5CZ2 A;  3O4W A;  4RTF D;  3SV3 A;  4W5Q A;  4CJF A;  5FRO A;  4R79 A;  5SZT A;  5AQS A;  3AVB A;  3OW2 M;  2ZD1 A;  2ASO A;  4DV7 K;  1Q7Y O;  5AQG A;  3VEN A;  4RW9 A;  3P4I A;  3ZYY X;  4M3Y A;  3OYA A;  2EWS A;  3HOS A;  2RKI A;  3F5T A;  2DY4 A;  1KVB A;  3VGK A;  4A2B A;  4BR2 A;  4AHT A;  1DT9 A;  4DSK A;  2OPR A;  4CFC A;  3ZSZ A;  2CGJ A;  1FKO A;  4E89 A;  2AA4 A;  3CCM N;  3KLI A;  3CCL N;  3DOK A;  4JI5 K;  3OYM A;  3A5L C;  3C6A A;  4K8Z A;  1HQE A;  4U67 L;  1W0H A;  4W5R A;  3EEQ A;  4IEI A;  3HXM A;  4GVE A;  4DUZ K;  4DR2 K;  3P83 D;  1FJG K;  4EFH A;  1JXE A;  4FSV A;  4CEE A;  4X62 K;  4DR4 K;  2A6A A;  3A0I X;  3AA4 A;  4IJA A;  4DQQ A;  1WSI A;  5C12 A;  1A5X A;  3SI6 A;  4FLX A;  2G8W A;  3D2E B;  4F9O A;  3SCX A;  4CFB A;  3CJB A;  3BUZ B;  3J8A A;  5HP1 A;  5AZJ A;  1YXQ A;  3KTQ A;  1K73 O;  3CCU N;  1ZBF A;  4BRL A;  5AZI A;  2PYJ A;  3LDQ A;  3AAP A;  3IDH A;  3D45 A;  3MCP A;  3OHR A;  1S22 A;  2NUB A;  4DSE A;  3VGM A;  3MN6 A;  3H6E A;  4DFP A;  1KCF A;  4B1Y B;  2GWJ A;  3VGL A;  2I7P A;  2KFN A;  4OKK A;  1GOB A;  4K25 A;  1HPZ A;  5KPT A;  2P1J A;  3CM5 A;  1QSY A;  4JI2 K;  2X6N A;  5CY4 A;  4KFB A;  5AQQ A;  3AVM A;  4AH9 A;  3KJV A;  3RMD A;  4PA1 A;  3SJH A;  1BGX T;  4EP4 A;  4DTS A;  1T05 A;  4QOZ B;  3TR8 A;  4AM6 A;  1ILY A;  5DM6 L;  2QWN A;  3ZT2 A;  4DSI A;  4TSX A;  2IGI A;  1VAZ A;  4LF7 K;  2OA8 A;  1JCG A;  3O6W A;  3KD1 E;  1JLQ A;  3GOI A;  4XH1 A;  3THW A;  1B9D A;  3P39 A;  4DTP A;  3L3U A;  1NK0 A;  4CJQ A;  2FF3 B;  4OPA A;  1C0U A;  3HM9 A;  4B1V A;  5ADX A;  3SAG A;  3R9P A;  4AIL C;  2A1S A;  4LSL A;  3HM8 A;  5C10 A;  1IKW A;  3SJJ A;  1U04 A;  1W7A A;  2X74 A;  4JKA A;  2QM1 A;  4HWI A;  4DV5 K;  2FBX A;  2R7Y A;  5BRF A;  3KKS A;  2YHX A;  5HRP A;  3RTV A;  3CER A;  4DS5 A;  3VQB A;  1NG9 A;  3THX B;  4DSL A;  3O1W A;  5AQP A;  2Y1I A;  3CCE N;  4B9L A;  1C0M A;  4FWM A;  3ZEU B;  3DWL A;  3J7Z O;  3OYL A;  4B1X B;  4BGB A;  1HKC A;  4E7K A;  3J7A P;  3AVL A;  3WQU A;  2HW3 A;  1X3M A;  1C6V A;  2A5X A;  3LP2 A;  3M6G A;  3M8R A;  2B4J A;  1S1V A;  4ILJ A;  4M42 A;  2QWR A;  3WNH A;  1VSE A;  2FXU A;  4DTN A;  1BL3 A;  3CQX A;  3K57 A;  4CED A;  1P8Z A;  1RDU A;  3PX0 A;  3V9Z A;  2YX6 A;  2AP1 A;  5C25 A;  2PY5 A;  1T6D A;  1Q18 A;  1V4T A;  4BWJ A;  2ITM A;  2YHB A;  4DU4 A;  4PKH A;  3EN9 A;  1NK4 A;  4CVN E;  4H0Y B;  1TV6 A;  1D4X A;  4ELU A;  3MEE A;  3DMJ A;  1RT5 A;  3NF6 A;  4OKJ A;  4FJH A;  4H0P A;  4FVU A;  2ETJ A;  2V52 B;  5KGX A;  3WXI A;  3FZL A;  1MA9 B;  3LDN A;  3BDP A;  2HOE A;  3NF7 A;  3V9W A;  1C0G A;  4CF1 A;  4GV6 A;  3V9S A;  1HMV A;  1E4F T;  2O8F B;  5LL6 Z;  3WXJ A;  4E7H A;  4M7Y A;  3ZSO A;  2VWJ A;  3ENB A;  1HNV A;  4BVO A;  1JLB A;  5J2M A;  4KHW A;  3K2P A;  2A3Z A;  3TAG A;  4OPH A;  2VGN A;  2IAJ A;  2ZF5 O;  4L3Q A;  1DTQ A;  4K42 A;  4V19 S;  1E3M A;  4F3O A;  3NCI A;  3NF8 A;  3BZC A;  2RPI A;  5J2Q A;  1Q9Y A;  1V4S A;  4DR5 K;  2HVI A;  4CES A;  4DS4 A;  5JLF A;  2UUC K;  1NGG A;  3D2E A;  4IFY A;  3MEC A;  4N56 A;  5KPZ A;  2WON A;  4MO5 A;  4FM1 A;  5AJ3 K;  2D0P A;  1VQK N;  1A5V A;  4DU3 A;  4DFK A;  3ALY A;  3ZX3 A;  4E19 A;  3SYZ A;  5AQI A;  4Z4E A;  1T8E A;  3MCA B;  3TAB A;  4IZ9 A;  4DTR A;  5BRH A;  4Q5V A;  3DRS A;  2E6L A;  1TAQ A;  4Z94 A;  3NH1 A;  1HKB A;  1GLC G;  3D6R A;  4QS7 A;  4CZH A;  5AQK A;  1LAW A;  1HRH A;  3ITH A;  1KSP A;  3MDQ A;  5M1Q A;  1Q8I A;  2YHY A;  1EXQ A;  1C1A A;  4BDY A;  3CJ7 A;  2YV0 X;  3O4Q A;  3K0S A;  4H5T A;  4WQ5 A;  4B9Q A;  4JRQ A;  1NK6 A;  4KRF A;  5HRR A;  3MAQ A;  4BR4 A;  1WBB A;  3HP9 A;  3ZSR A;  4DG1 A;  3DRP A;  1JCE A;  2ZWH A;  1HYZ A;  3KHY A;  3TSQ A;  1DTT A;  4OLA A;  4BRA A;  4FW1 A;  4CZI A;  2O8E B;  3I0S A;  2G8K A;  1RT7 A;  4LFC K;  4CEZ A;  3GBT A;  4MDB A;  3RVC A;  3OYN A;  5J2P A;  2W42 A;  1NGE A;  2YJF A;  4RG8 A;  3ZT4 A;  4NCB A;  2Q36 A;  4PY5 A;  4FJL A;  1GLE G;  3QO9 A;  1YI2 N;  5HBM A;  3G6E N;  1NM1 A;  3EL2 A;  2B5J A;  3LPT A;  2VWB A;  4AHC A;  4EZ6 A;  4OPK A;  3IS9 A;  1CLQ A;  1BUP A;  4K43 A;  5GAG P;  4JKD A;  4CIF A;  5LMU K;  4FJG A;  2D4W A;  1ATS A;  1KAZ A;  4FM2 A;  4O5B A;  3HVT A;  3JAM O;  2ZE2 A;  4PHT X;  1HR0 K;  4FK0 A;  4IKF A;  3MN5 A;  4EIA A;  3L2R A;  2F9T A;  3CXC M;  4N5S A;  5GAH P;  2BH1 A;  2Q31 A;  3S9H A;  1VSD A;  4KTW A;  4K8X A;  3HPG A;  3QEW A;  4NLC A;  3EO3 A;  3PX6 A;  3VEW A;  3L2V A;  3K5L A;  3Q7C A;  3TSU A;  1HKG A;  4O55 A;  4I9Q A;  5M1N A;  4Z4G A;  3O8M A;  4E0D A;  2E8A A;  3NAE A;  4OKE A;  2OTL N;  3LDL A;  3ISN C;  3VQ5 A;  3AA2 A;  3SUQ A;  1F21 A;  1U47 A;  1K6Y A;  3DXM A;  1NNE A;  1VQN N;  1VQ6 N;  3PSI A;  4OX9 K;  4CZK A;  5BR9 A;  3HL8 A;  1LWC A;  1T7P A;  1VQ9 N;  3TSP A;  1L5U A;  4I6M B;  2BE2 A;  2QWM A;  4HHT A;  1JXB A;  3UKU A;  3PIO L;  2VWK A;  3AO3 A;  1U2V A;  4LF4 K;  1S3X A;  4FPB A;  3OS0 A;  4AHV A;  3AVK A;  2CGK A;  2OYQ A;  4BRH A;  3L4Q A;  4ELV A;  4KTZ A;  5AFU A;  2FSK A;  1S6Q A;  2GV9 A;  4DF4 A;  1L3V A;  2HHQ A;  5EXW A;  2VCP A;  4LF8 K;  3NE6 A;  1VSL A;  5GAE P;  4KB1 A;  4F3T A;  5CE3 A;  4NYN A;  5FLX O;  3H45 C;  3V1Q A;  4PL7 A;  4B9T A;  1CXQ A;  3K59 A;  3RRG A;  4FLZ A;  2P9K A;  3MED A;  3CJA A;  3MXI A;  1IO2 A;  5KRS A;  2OZM A;  4C8N A;  3G4S N;  3DXK B;  3E9O A;  1M1K O;  3SZ2 A;  4B9N A;  3OYE A;  2WC9 A;  3MMV A;  2HHU A;  3KK7 A;  4CW7 B;  5EY4 A;  3J80 O;  2UXD K;  1BIS A;  2DFH A;  3OYG A;  3ZSV A;  3I55 N;  4RW8 A;  4CJS A;  4CHN A;  3DLK A;  3PSF A;  4M7X A;  3ENH A;  3K9K A;  1WN7 A;  3NVM A;  4G1Q A;  2ZJQ L;  4YY3 K;  1L3T A;  2BAN A;  2O8B B;  4CE9 A;  3K5M A;  1ASV A;  4ISG A;  4DSF A;  1JLA A;  4B3T K;  4M3X A;  4E1J A;  2NRZ A;  1W97 L;  1ASU A;  3QIO A;  4GV3 A;  4JLH A;  1IG9 A;  4JK9 A;  3FGU A;  2IVO A;  4CEB A;  4CGI A;  4JKH A;  1KTQ A;  2RE2 A;  3NDK A;  1EQY A;  2J4R A;  5HRO A;  3NVK A;  2PYL A;  1BU6 O;  4JI3 K;  3S3O A;  1HLU A;  1NGI A;  1VQO N;  4IG3 A;  4GY2 B;  4YOY A;  3VTH A;  1SL1 A;  3DXK A;  3WXL A;  2H3G X;  3R1X A;  4JHD A;  3SBT A;  1OVY A;  4CIG A;  5HRS A;  1OH6 A;  4KTQ A;  1VSK A;  4N76 A;  1UA1 A;  3U6F A;  1TUU A;  3MXM A;  1JL1 A;  1QHT A;  1C1B A;  3ZLJ A;  4ILG B;  4E7I A;  4CZG A;  1ZC6 A;  3R8E A;  4B3R K;  4CZM A;  4YDU C; 
#chains in the Genus database with same CATH homology
 4B1U B;  1RGI A;  1ILY A;  4H0T B;  5DM6 L;  1QHA A;  2QWN A;  5BPM A;  4A5A A;  4BR5 A;  3MX2 A;  2WFB A;  2Q0R A;  1VAZ A;  4AM7 A;  3EKS A;  1JCG A;  3O6W A;  1N8R O;  3S41 A;  2QTD A;  3GOI A;  4XH1 A;  4NB4 A;  3QDK A;  3EE8 A;  3D2F B;  3P39 A;  2E2P A;  4C1N I;  4MO4 A;  1SZ2 A;  2FF3 B;  2QEX N;  2P9I A;  4BRD A;  2QA4 N;  4OPA A;  4B1V A;  5ADX A;  1RDW X;  3SAG A;  5GAD P;  3R9P A;  4A61 A;  1MWK A;  3F2K A;  4RCH A;  4YOT A;  3HM8 A;  4I6M A;  5C10 A;  5HL7 L;  1T3V A;  1K9M O;  1E4G T;  3L0Q A;  5TKW A;  3OBY A;  3LM2 A;  3C6H A;  2P9N A;  4JKA A;  2ZJR L;  2QM1 A;  4HWI A;  3WXM B;  1GLD G;  4H0O A;  5BRF A;  1BA1 A;  2BUP A;  2YHX A;  2P9N B;  4CD1 A;  3G71 N;  1T44 A;  1GLA G;  2NRW A;  5ELZ A;  3CQY A;  3CPE A;  1KXP A;  1WOQ A;  2CH5 A;  3CER A;  1DEJ A;  4BGA A;  1Q82 O;  1QVG M;  4IDH A;  4BRF A;  3O1W A;  1OKJ A;  5AQP A;  3CCE N;  5GIN A;  4KBO A;  4FWM A;  3CCV N;  3ZEU B;  3HTV A;  1JCF A;  4BR9 A;  1ZBS A;  3DWL A;  3FE1 A;  4AF1 A;  3J7Z O;  4B1X B;  4BGB A;  1HKC A;  4JKC A;  4WQ4 A;  1BOT O;  3WQU A;  3TTF A;  3T7Z A;  1X3M A;  5C2D A;  4JKB A;  5F1X A;  4M63 C;  2WUS A;  4NO7 A;  4YOR A;  2A5X A;  2D0O A;  4ISF A;  5E26 A;  2FLO A;  2Q97 A;  3M6G A;  2FF6 A;  3FZK A;  5M1F A;  3O9Q A;  1CZA N;  1T6C A;  2A41 A;  4ILJ A;  2QWR A;  3T69 A;  3GL1 A;  2FXU A;  1DGK N;  5AQH A;  5I9E B;  4BRE A;  1C0F A;  3CQX A;  1GLL O;  4JK7 A;  3QFU A;  1HPM A;  1HX1 A;  4FWR A;  4FOI A;  5KPR A;  4DHY A;  1P8Z A;  1Y64 A;  1RDU A;  5TKY A;  3U9Z A;  1YVN A;  1LOT B;  3QIC A;  2YX6 A;  2AP1 A;  2NRH A;  4H0X B;  5AQN A;  3VOV A;  3D2F A;  1T6D A;  1YAG A;  1Q18 A;  1V4T A;  2E1Z A;  4JNE A;  3DAW A;  4BVP A;  2ITM A;  1TYQ A;  3VEX A;  3AAQ A;  2OAN A;  2QWQ A;  3EN9 A;  3P31 A;  4PKH A;  5JVG L;  4IOA L;  3CJ1 A;  2QWL A;  4YOW A;  4H0Y B;  2IIR A;  3I33 A;  1D4X A;  1HUX A;  3QBX A;  4BRQ A;  3I8B A;  1YIJ N;  4H0P A;  4QS8 A;  4DKW A;  2W41 A;  1K8K A;  4FVU A;  4CZE A;  3O80 A;  2V52 B;  3FLC O;  3WXI A;  1BDG A;  4BRO A;  3R3L A;  3FZL A;  4EHT A;  4EAH D;  4WFN L;  2JWK A;  3HSC A;  1MA9 B;  3U8X A;  4AM6 A;  1NGB A;  1VQ8 N;  1QZ6 A;  3C7N A;  1G99 A;  2E20 A;  3LDN A;  5AZJ B;  2HOE A;  2PAV A;  4H5V A;  1C0G A;  4FO0 A;  4GV6 A;  1E4F T;  3WXJ A;  3M5R A;  4M7Y A;  4IJN A;  2QW9 A;  3ENB A;  3HOT A;  4OO1 J;  4CZJ A;  2GTD A;  4BVO A;  3TTD A;  3O08 A;  3KVG A;  3R6M A;  3FFK B;  4JHD B;  3OA9 A;  1M90 O;  2A3Z A;  1R59 O;  4BC4 A;  2CGL A;  1XC3 A;  4BC5 A;  5ADX H;  5C15 A;  4OPH A;  2VGN A;  3O9S A;  2NRX A;  1EO1 A;  4BG9 A;  2RHK A;  4C23 A;  5BRD A;  2ZF5 O;  1YJ9 N;  4L3Q A;  2ASM A;  4BG8 A;  4K42 A;  4YOU A;  4FWK A;  3BEX A;  3MWP A;  3VES A;  3FZF A;  1MWM A;  4KH4 A;  5MLC Q;  4GV9 A;  3MK6 A;  1QZ5 A;  2GX9 A;  4EHU A;  1V4S A;  2NRR A;  3M1F A;  4QS9 A;  1BG3 A;  4MLH A;  3VET A;  4BQZ A;  4WYB A;  5AQM A;  5JLF A;  3LM9 A;  4BRM A;  2HBL A;  3U9D A;  1U6Z A;  1NGG A;  3D2E A;  4BRI A;  4CBU A;  5KPZ A;  3FR0 A;  4MO5 A;  1QQN A;  1SS6 A;  3UKR B;  3ZX2 A;  2D1K A;  2D0P A;  1VQK N;  2F9W A;  3LDP A;  1GLJ O;  3VEY A;  3A5O C;  5AQZ A;  3CI5 A;  3IMX A;  3ZX3 A;  5AQI A;  3CCS N;  2Q1N A;  5M1O A;  3VTI A;  2CH6 A;  1RFQ A;  4ISE A;  1YUW A;  4JKE A;  3MCA B;  1YJN N;  1VQ5 N;  2P9S A;  2W40 A;  1VQ4 N;  3ATV A;  4IZ9 A;  5EX5 A;  2KLA A;  3Q7B A;  3D7E O;  4WQ4 C;  3VF6 A;  1ZXO A;  3CJ9 A;  3SK3 A;  5BRH A;  4YOX A;  2YHW A;  3NMU A;  2GEL A;  2QWO A;  1GLB G;  2I7N A;  3L6Q A;  3CMA N;  4IWV A;  4Z94 A;  4H5R A;  1HKB A;  2WBN A;  5E84 A;  3RSE B;  1GLC G;  2HF3 A;  3D6R A;  2V7Z A;  2NLX A;  4QS7 A;  4CZH A;  1NBW A;  1K8K B;  5AQK A;  5C0Y A;  2P9P A;  3O9U A;  3ZET A;  2ZJP L;  3M3Z A;  3LDO A;  3MDQ A;  5M1Q A;  2YHY A;  4BRN A;  3F9M A;  3KZB A;  4RWT A;  5CR4 A;  2KKZ A;  3CJ7 A;  2P9S B;  4CBX A;  4BR7 A;  5AQL A;  2NNW A;  1IG8 A;  3CC4 N;  2GUP A;  1X3N A;  3PLA A;  4H5T A;  4WQ5 A;  4B9Q A;  3CJC A;  5AQT A;  4O5F A;  3G25 A;  4FOE A;  4WFB L;  5AQF A;  3QB0 A;  3W0L A;  4BRC A;  4H5W A;  3MX5 A;  1BA0 A;  4XH4 A;  4BC3 A;  3E9P A;  1BO5 O;  3ENO A;  2NRT A;  5AQX A;  4BY9 C;  4BR4 A;  5GIP A;  5LY3 A;  2PFU A;  3BP8 A;  4H0V B;  1JCE A;  3JXU A;  4WQ5 C;  2ZWH A;  3KHY A;  2ASP A;  3GDQ A;  1ATR A;  4MLE A;  3AGR A;  3TSQ A;  3N4Q A;  3SAF A;  4H03 B;  2F7T A;  4GNI A;  4B1W B;  4BRA A;  4HTL A;  4H5N A;  4YDU A;  4CZI A;  3QFP A;  1VQ7 N;  5KQD A;  3AAR A;  2FSN A;  1U2V B;  4A59 A;  4FWP A;  4IO9 L;  3VEO A;  1YHQ N;  5BN9 A;  1WUA A;  3FZM A;  3GBT A;  5AFU H;  3IUC A;  4PL8 A;  2IVP A;  4MDB A;  3ZX0 A;  4J8F A;  1NJI O;  3KWI A;  3IKM A;  4KH5 A;  4PKI A;  3RVC A;  4BRG A;  3CCR N;  2E88 A;  1NGE A;  2YI1 A;  2YJF A;  4FL9 A;  4JK8 A;  3ID6 A;  4PKG A;  5EOY A;  4A5B A;  4Y0W A;  5JMV A;  3GE1 A;  2V51 B;  3B8A X;  2Q36 A;  3AGK A;  1GLE G;  1P90 A;  2NZT A;  5BPL A;  5DM7 L;  1YI2 N;  4JKG A;  3GG4 A;  5M1P A;  5AQY A;  3CHW A;  2QI2 A;  4JD2 A;  1VQM N;  3MWT A;  3G6E N;  3SMP A;  1ESV A;  1NM1 A;  3EL2 A;  5LJV A;  3WUH A;  2VYP A;  3O9R A;  3HRG A;  5AQW A;  5F2R A;  3HBT A;  2VWB A;  5AR0 A;  3H1Q A;  2BTF A;  5GIO A;  1Z6R A;  2P9I B;  4FWQ A;  3VF2 A;  1KD1 O;  3CC2 N;  2Q0U A;  1BUP A;  4K43 A;  5GAG P;  4JKD A;  3KWG A;  2JWL A;  4DB3 A;  4BRP A;  1NGC A;  4MDA A;  2YJE A;  5F0X A;  2NRV A;  4JN4 A;  2D4W A;  1ATS A;  4WF9 L;  1KAZ A;  3O5B A;  1TUY A;  3VEZ A;  5BPN A;  2E2Q A;  3H1V X;  4PHT X;  3WT0 A;  3AY9 A;  3P38 A;  1K8A O;  2ZGZ A;  3MN5 A;  3N4P A;  4EIA A;  2F9T A;  3OBW A;  2HBJ A;  3CXC M;  4BR0 A;  1JJ2 M;  1XQS C;  5GAH P;  2BH1 A;  3H3N O;  2Q31 A;  4JKG B;  4CJ7 A;  3CF5 L;  5JLH A;  3BF1 A;  1SAZ A;  3A5M C;  4FWS A;  4JAX A;  2HST A;  4DCH A;  3WXK A;  4NLC A;  2V7Y A;  3EO3 A;  4O8K A;  5B8H A;  3VEW A;  2QWP A;  3CCQ N;  3Q7C A;  3TSU A;  1HKG A;  4FWL A;  4IXC A;  3VPZ A;  5M1N A;  2E1Y A;  3HI0 A;  5BRE A;  1Q86 O;  1KAY A;  3O8M A;  1NMD A;  2KHO A;  5FPD A;  2E8A A;  5AQJ A;  3ZEU A;  1Q81 O;  4JKF A;  1YF5 L;  3DJC A;  3LDL A;  4IFE A;  2OTL N;  3A5N C;  4A2A A;  1NGF A;  1DKG D;  3DXM A;  4FWN A;  2FSJ A;  3TTC A;  2P9L A;  4K41 A;  3CME N;  1NGA A;  3MN7 A;  1VQN N;  4JD2 B;  5BN8 A;  1VQ6 N;  1SQK A;  3LL3 A;  4FPA A;  4CZK A;  2E2O A;  5AQO A;  5FPM A;  4CZL A;  5BR9 A;  4DQ8 A;  1X9J A;  2IVN A;  3FZH A;  1VQ9 N;  1ATN A;  3TSP A;  1LCU A;  4IOX A;  5KQ8 A;  3VF4 A;  4I6M B;  3CPW M;  4C1N K;  2A42 A;  3ATU A;  2DPN A;  2QWM A;  1YJW N;  4BRK A;  3L4I A;  3UKU A;  1IJJ A;  1J6Z A;  3PIO L;  3UE5 A;  5CHI A;  1U2V A;  3E1Y A;  1H1V A;  1S3X A;  4FPB A;  1QQM A;  1HJO A;  5M1K A;  5C2F A;  2CGK A;  4XEI A;  1MDU B;  4BRH A;  3L4Q A;  4G9Z A;  4A62 A;  1VQL N;  2HMP A;  5AFU A;  3WEE B;  2FSK A;  3E9L A;  3ZET B;  5EXW A;  2P9P B;  2VCP A;  3VER A;  5LJW A;  3O4W A;  4O8U A;  4JEP A;  5GAE P;  5CE3 A;  4RTF D;  3H45 C;  2YCH A;  3QBW A;  4PL7 A;  4R79 A;  1KAX A;  3E66 A;  5AQS A;  3OW2 M;  4BQL A;  3VMF B;  2P9U B;  4CZF A;  3ULE A;  2ASO A;  2VGM A;  1NLV A;  1Q7Y O;  3EE9 A;  5AQG A;  1NWK A;  2P9K A;  2ZGY A;  3CJA A;  3SBG A;  3VEN A;  1NGH A;  3P4I A;  5JIC A;  3ZYY X;  4B1Z A;  2EWS A;  3HOS A;  3H3O B;  3F5T A;  3VGK A;  3G4S N;  3DXK B;  2P9K B;  3E9O A;  4A2B A;  4BR2 A;  1M1K O;  3C0B A;  5FPE A;  3EKU A;  3UKR A;  2WC9 A;  1DT9 A;  1KQS M;  3MMV A;  2QXL A;  3MN9 A;  3KK7 A;  3O9T A;  5EY4 A;  3QML A;  3RSE A;  2Q2R A;  3I55 N;  2CGJ A;  2UYT A;  1XUP O;  5AZI B;  1VQP N;  2GEM A;  4M7X A;  2AA4 A;  3ENH A;  3K9K A;  3CCM N;  3NVM A;  2ZJQ L;  3CCL N;  2E2N A;  4WCE L;  3A5L C;  3K9J A;  3C6A A;  3WEE A;  4IO8 A;  4U67 L;  5AQV A;  1YIT N;  1S72 N;  4IEE A;  4IEI A;  4GVE A;  4ISG A;  4EFH A;  5JVH L;  1GLF O;  5H1S Q;  4FSV A;  4CBW A;  4NLB A;  3CET A;  4CI6 A;  2HF4 A;  5HOO A;  2A6A A;  3A0I X;  3O1B A;  4E1J A;  4IJA A;  2OTJ N;  2NRZ A;  1BWF O;  1W97 L;  1NGJ A;  5C12 A;  2PBD A;  3I56 N;  4GV3 A;  4UY8 O;  3UKU B;  4JK9 A;  3FGU A;  2IVO A;  1QVF M;  1KC8 O;  2GWK A;  4JKH A;  3BF3 A;  4KH6 A;  3A8Y A;  3D2E B;  2RE2 A;  4F9O A;  1NGD A;  3TPQ A;  3H46 O;  3CJB A;  3BUZ B;  3J8A A;  1EQY A;  3ID8 A;  2J4R A;  5AZJ A;  3WQT A;  1YXQ A;  1K73 O;  3SAH A;  3CCU N;  4BRL A;  3NVK A;  3C65 A;  3PIP L;  5AZI A;  1BU6 O;  4YOV A;  3LDQ A;  2P9L B;  1HLU A;  1NGI A;  3CIP A;  3DXM B;  1VQO N;  1O13 A;  4FWO A;  4GY2 B;  4YOY A;  3VTH A;  3AAP A;  3IDH A;  4A57 A;  3MCP A;  3SMS A;  3OHR A;  4WFA L;  1S22 A;  3CCJ N;  3VGM A;  3DXK A;  3MN6 A;  3W3D A;  2H3G X;  3H6E A;  3R1X A;  4JHD A;  3WXL A;  4CD3 A;  2GWJ A;  5AQR A;  3VGL A;  4B1Y B;  4XH5 A;  2I7P A;  1TYQ B;  3JS6 A;  3CD6 N;  3HZ6 A;  3SBT A;  2HBM A;  1QQO A;  1OVY A;  4K25 A;  1Z05 A;  4LC9 B;  3TU5 A;  3VEV A;  5KPT A;  5EVZ A;  3U4L A;  3DLL L;  4ILH A;  2A40 A;  3ULE B;  3SLC A;  5FPN A;  2P9U A;  1W2B M;  5AQQ A;  3C7N B;  1TUU A;  3IFR A;  4ILG B;  5AQU A;  3SJH A;  4BC2 A;  3CC7 N;  4CZG A;  4U7B A;  3EZW A;  1ZC6 A;  2HBK A;  3R8E A;  4IOC L;  4CZM A;  3UB5 A;  4YDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...