2F9WA

Structure of the type iii coaa from pseudomonas aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
249
Chain Sequence
b'SMILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQALPVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWLALVAAHHLAKKACLVIDLGTAVTSDLVAADGVHLGGYICPGMTLMRSQLRTHTRRIRYDDAEARRALASLQPGQATAEAVERGCLLMLRGFVREQYAMACELLGPDCEIFLTGGDAELVRDELAGARIMPDLVFVGLALACPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate Kinase
publication title Prokaryotic Type II and Type III Pantothenate Kinases: The Same Monomer Fold Creates Dimers with Distinct Catalytic Properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 70
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA02
4BR0A 4FWRA 4FWSA 3VEXA 2IVNA 4PL8A 5AQWA 1YUWA 3CJAA 3DXMB 3VESA 2E20A 1E4GT 1ATNA 2W41A 5AR0A 2QW9A 3ULEB 3ATVA 3D2EA 3ZX3A 3QBWA 1X3NA 3B8AX 4O5FA 1Z6RA 3VETA 4EHUA 4EIAA 2GUPA 3SMSA 3DAWA 3MDQA 2VYPA 3JS6A 4JHDB 1T6DA 2QXLA 1KAYA 4L3QA 2HMPA 1ATSA 2YHYA 5AQLA 3D2FB 4MLHA 1WOQA 5TKYA 2E2OA 4CBUA 3WXKA 2YCHA 3EZWA 3LDPA 5E84A 4DCHA 3QFPA 1GLLO 1TYQA 1XQSC 3CQYA 3JXUA 3R9PA 4DHYA 1KXPA 1OKJA 1K8KA 4IXCA 2A41A 3I33A 2CH6A 1D4XA 1GLEG 1C0GA 3H46O 5E26A 3WEEB 3A0IX 4B1VA 4H5RA 1KAZA 4BRIA 2Q97A 1NGHA 1NGFA 3BEXA 3LDNA 3W3DA 4QS9A 3VPZA 4EAHD 1MWMA 3ID8A 4H0PA 3LDLA 2P9UA 4A61A 4BRPA 1RDWX 4CJ7A 4B1XB 1IJJA 3CERA 1EQYA 4H0XB 2GEMA 2A42A 3C7NB 3ZETB 3U9ZA 2E88A 4K41A 3VEVA 3HSCA 2QWQA 1QQNA 2E8AA 1T6CA 2P9PB 4A2AA 3SMPA 5F1XA 3SK3A 2P9IA 3BP8A 3UKRB 1NGAA 3MN5A 1BOTO 1S3XA 4BRQA 2PAVA 3L6QA 4XH1A 1X3MA 5I9EB 5BREA 1BWFO 3QMLA 4CZGA 2CGKA 5BPLA 4BVPA 4MO4A 4Y0WA 3U9DA 2VCPA 2BUPA 1ZXOA 5AQIA 2QWNA 4FPBA 4M7YA 3EL2A 5KQ8A 2ZGZA 1DEJA 3ZX0A 1NGGA 4FWQA 3FFKB 3MMVA 1HUXA 3O8MA 4FPAA 3QFUA 1DGKN 5LY3A 3ZEUA 2P9PA 3WQTA 1JCEA 4YDUC 4FWNA 2A3ZA 2EWSA 4H0OA 3VGMA 1BO5O 3MN9A 5AQGA 4NO7A 1Q18A 2NLXA 5EOYA 5BRHA 3O1BA 4JD2B 2P9NB 1QQOA 4BC4A 1NGBA 1HX1A 4IZ9A 3AARA 1BA1A 4FOIA 2ZF5O 3LDOA 3O80A 3WXLA 4MO5A 3EKUA 4WQ5C 2E1ZA 2P9LB 3HTVA 3M3ZA 4PKIA 3KZBA 4BRFA 3VEZA 5BN9A 4ISEA 3CI5A 3I8BA 3EKSA 5EXWA 5ELZA 4B1YB 2Q31A 1SZ2A 2FSKA 1GLAG 3LM2A 2FF3B 1U6ZA 3HZ6A 4IJNA 1RGIA 3CQXA 3DXKB 4HTLA 1E4FT 3CJ7A 3QICA 2FXUA 4BRCA 1BU6O 3WUHA 2P9KA 2YJEA 4H03B 5FPNA 5LJWA 4H0VB 1NM1A 3A8YA 3DXMA 3DWLA 1C0FA 5BR9A 3ULEA 3VENA 2I7NA 4I6MB 2CGJA 3H1VX 2NZTA 4XEIA 3RSEB 3U8XA 4RCHA 1JCGA 1GLDG 1HPMA 5JICA 5AQPA 5AQOA 2ITMA 1ZBSA 2E2QA 4FOEA 4JHDA 4DB3A 1YXQA 4YDUA 3FZMA 3CIPA 4JN4A 2A5XA 5AZIB 1LOTB 4CZKA 1S22A 3LM9A 4MLEA 3D2FA 3G25A 3W0LA 2GWJA 3VGLA 3GDQA 4O8KA 4AM6A 4IWVA 4BGBA 3UKUB 5EVZA 4JAXA 2A40A 5AQTA 3FGUA 2E2PA 4EHTA 4B1WB 4WQ5A 3MCPA 3WEEA 4H0YB 5AQSA 2V7ZA 5B8HA 1HLUA 5FPDA 2ASPA 3RSEA 3D7EO 1HKCA 2QM1A 3AY9A 3WT0A 3KVGA 2GTDA 4BC3A 2IVOA 3H6EA 3QB0A 1U2VB 4FO0A 4ISGA 5AQVA 2QWLA 2FSNA 2WUSA 2HOEA 1NWKA 2QWOA 4BRMA 5AZJB 4BVOA 1BA0A 1J6ZA 2W40A 3A5NC 5JLHA 4A2BA 2QWPA 3L4IA 2ZWHA 3F9MA 1T44A 2ASOA 3IFRA 3C7NA 4EFHA 3ZETA 4BRNA 3CJBA 3LL3A 1X9JA 4PKHA 3FZLA 4K43A 3IMXA 1QHAA 2KHOA 3ENHA 3CETA 2CGLA 2NRHA 3P4IA 5EX5A 3UKRA 4FL9A 4WQ4C 3O4WA 1ESVA 4BGAA 4FWPA 2I7PA 5KQDA 1ZC6A 2YHXA 2E2NA 2Q0RA 3D2EB 4J8FA 1QZ6A 3WXJA 2Q2RA 3MN6A 4A62A 3VEOA 3VOVA 3M6GA 1NGDA 4BROA 3IUCA 4F9OA 1P8ZA 1G99A 1U2VA 5AQFA 5FPEA 5BPNA 4B1ZA 5F2RA 3EN9A 2HF4A 5BN8A 1NGCA 4RWTA 5AQYA 3WQUA 3FR0A 3QBXA 4CZIA 5AZJA 2F9WA 2GELA 2QWRA 4IO8A 1CZAN 1R59O 2V52B 4BR5A 2UYTA 3CJCA 3WXIA 3BUZB 4K25A 4BR7A 1XC3A 4B9QA 1Z05A 1BG3A 2CH5A 3H45C 1TYQB 5LJVA 4BR2A 4CD3A 2V7YA 5JMVA 1K8KB 3KHYA 2ASMA 1HKGA 1V4TA 4JD2A 1JCFA 1DKGD 2P9NA 3FZHA 5AQJA 3VF6A 5AQXA 4BC5A 2FSJA 4BRAA 1QQMA 2D1KA 1NBWA 4BR9A 1MDUB 2IVPA 1SQKA 4Z94A 2OANA 4CZHA 2HF3A 3A5MC 5AFUA 1YAGA 3FZFA 2P9LA 1V4SA 1RFQA 4CZMA 2F9TA 3VGKA 3A5OC 1H1VA 4AM7A 3VEWA 4CZLA 2P9UB 5AQKA 4ISFA 4M63C 4BRKA 3GBTA 3U4LA 3GL1A 1GLBG 1QZ5A 1WUAA 2AA4A 2BTFA 3OHRA 4H5VA 3A5LC 2V51B 3VF4A 5CE3A 3DXKA 5ADXA 5AFUH 2YHWA 3QDKA 3TPQA 3AAPA 5BRFA 3R8EA 4CZJA 3BF1A 2P9IB 5KPZA 4WQ4A 3SLCA 2J4RA 3UE5A 2D4WA 4QS7A 5AQQA 4B1UB 1GLFO 2GWKA 4PKGA 4FSVA 2IIRA 2Q1NA 2DPNA 4M7XA 3VF2A 4CBXA 5KPTA 4JNEA 2AP1A 1GLCG 1KAXA 1SAZA 3O6WA 1NMDA 2FLOA 1BDGA 4WYBA 5ADXH 3O5BA 3TU5A 5AQHA 3GG4A 4K42A 2YI1A 3CJ1A 4QS8A 2H3GX 5AQRA 1TUYA 4I6MA 4BG9A 4BQZA 4CZEA 3GOIA 3R6MA 1NGJA 3HI0A 1MWKA 4XH4A 3ENOA 2D0OA 4DQ8A 2PBDA 1LCUA 4HWIA 4NB4A 1HKBA 5KPRA 3ZEUB 4BREA 1YVNA 3H3OB 4BR4A 5EY4A 3L0QA 4PL7A 1NGIA 4FWLA 5AZIA 3EO3A 3DJCA 1GLJO 3O1WA 2P9SB 3HM8A 4CZFA 3M1FA 4FWKA 4GNIA 4RTFD 2ZGYA 3UKUA 1MA9B 4CI6A 3C0BA 4GY2B 4H5NA 2QWMA 2YJFA 3MN7A 5AQUA 1HJOA 3MK6A 4IJAA 5AQZA 3FLCO 2FF6A 2VWBA 1TUUA 4BRGA 3FZKA 5JLFA 1NLVA 3ATUA 4BC2A 1Y64A 2E1YA 3FE1A 3J8AA 3S41A 3VEYA 3ZX2A 5BRDA 4H5TA 1ATRA 3HBTA 4FWOA 4BRDA 5AQMA 2A6AA 4CD1A 4XH5A 4BRHA 4LC9B 5BPMA 3CHWA 3SJHA 4H5WA 1BUPA 4H0TB 3UB5A 1NGEA 2Q0UA 3LDQA 3BF3A 4C23A 3O08A 1IG8A 5AQNA 4FWMA 4BRLA 5F0XA 3CJ9A 5FPMA 3H3NO 3H1QA 4E1JA 4CBWA 3GE1A 2D0PA 2P9SA 3AAQA 2Q36A 3VERA 1XUPO 3IDHA 2P9KB 4BQLA 4BG8A 4KBOA
chains in the Genus database with same CATH superfamily
2YV0X 4FWRA 3VEXA 2IVNA 3QINA 1OH8A 4CJSA 2E20A 1E4GT 3OBWA 1ATNA 4CJQA 4DQIA 3HPGA 5C24A 1JLAA 3DLHA 3U6FA 1X3NA 2O4IA 4O5FA 1TK8A 4O0JA 2PZSA 4KHQA 1NG9A 1Z25A 3ZYYX 4Z0UA 4M41A 2B5JA 3SMSA 4FK0A 1JL2A 3MDQA 3JS6A 1U48A 4JHDB 4KH5A 4JRPA 3H08A 3RRGA 2YHYA 5CR4A 3D2FB 2HSTA 3D6RA 2HHTA 3ZSXA 3ZSWA 1GLLO 1S9GA 4DHYA 4TSXA 2Y1JA 4JI8K 1KXPA 3I33A 1Y97A 1QSSA 1C0GA 1Q81O 4JRQA 3H46O 1EETA 1S1VA 3A0IX 1O1WA 4FZXC 2NNWA 3O4NA 3TSUA 3ZSRA 4E89A 4KTWA 4QS9A 3DRSA 1MWMA 5I3UA 3LDLA 4BRPA 4KB0A 4B1XB 3CERA 4H0XB 3C7NB 3ZETB 3U9ZA 4DU3A 1C0TA 5KTQA 4KI4A 2E8AA 1T6CA 4A2AA 1YIJN 3SMPA 3VQPA 4FJLA 3UKRB 3BP8A 3DLEA 1NGAA 3RMBA 3MN5A 2HW3A 1RBSA 1BOTO 4B9TA 3M8QA 3LWMA 1RT4A 1IBLK 4DR5K 5SZTA 1VSKA 3OS1A 4KTZA 3T19A 3OTOK 1K8AO 1BWFO 3HRGA 3QMLA 2JWLA 1KVCA 4BVPA 3SQ1A 4KFBA 4Y0WA 3U9DA 3KLGA 3THVA 2QWNA 4M7YA 5K14A 3EL2A 4BDPA 5HLFA 5JVHL 1HUXA 3SBGA 1TV6A 4X64K 1DGKN 3SV4A 1B92A 3CQ8A 4DSFA 3WQTA 1HR0K 3SYZA 2EWSA 1HNWK 1Q18A 2NLXA 5EOYA 2Z1JA 3AA5X 4AHSA 1RT5A 2BANA 1QQOA 3AA3A 3LWLA 2HHSA 2ZF5O 4LF5K 3PY8A 3TSPA 4WQ5C 3KLIA 2E1ZA 4KTQA 3M3ZA 4BRFA 3KZBA 1CZBA 4B1YB 2FSKA 3VQ7A 2O4GA 1HNXK 2BGGA 3JAMO 4NCBA 4X65K 3THYA 4ELVA 4DTMA 3J7AP 3NBPA 1HYVA 3ENBA 3KLFA 1RT2A 1YITN 3QICA 4CJ4A 3MWPA 2WBNA 2LSNA 2FXUA 4BRCA 3TAEA 2VGNA 1BU6O 4YHHK 3AVGA 3CM5A 1NK9A 5KRTA 4ILHA 1XNRK 3CCEN 3KLEA 4H0VB 2IAJA 3A8YA 4CFBA 2KKZA 4YY3K 4NCGA 4Z4CA 4YNQA 1FW6A 1XC9A 3J80O 4LF8K 3K57A 5BR9A 3VENA 3D45A 1ZBHA 3THXB 3EYZA 4I6MB 4FZZA 2ZD1A 4JS4A 3LP3A 2GV9A 1XHXA 3V9WA 3ZSYA 4RCHA 1REVA 5AQPA 4L8RB 4FOEA 3ZSVA 4F2SA 3MX5A 4DB3A 1MU2A 1YI2N 1IBMK 1YXQA 3LAMA 3CIPA 3SCXA 5AZIB 4FLZA 4MLEA 4C8MA 4DG1A 3PUFA 1VQ9N 4FK2A 4AM6A 4Z4HA 3V4IA 4IDKA 5EVZA 4U7BA 3SJJA 4RW6A 3S3NA 3HM9A 5GAEP 3WEEA 5AQSA 2VQEK 1OH7A 2V7ZA 4M3ZA 3RSEA 3D7EO 4QCLA 3QESA 3AVFA 3WT0A 2GTDA 3KKSA 3OYIA 3HP6A 2KZMA 2QWOA 4KKOA 1S6QA 4BRMA 4BVOA 1HPZA 1WN7A 4DV0K 2W40A 4A2BA 3O9SA 3F9MA 2ASOA 1OVYA 4A59A 3THWA 1YTAA 1Q8IA 2HBMA 4PHTX 2XY7A 1RILA 3I56N 4OPJA 3TTFA 2KTQA 4OKEA 4NYFA 5EX5A 1L3TA 4BGAA 4O4GA 2YKNA 3AVNA 4FJ5A 3WXJA 2Q2RA 3VQ6A 1UWBA 3VOVA 1WLJA 1NGDA 3HO1A 1G99A 1U2VA 5JS1A 3OYJA 3CC4N 4B1ZA 4WF9L 1IKYA 3K5LA 3AA4A 1YJWN 3O3GA 5AZJA 3DRPA 1NK4A 1E3MA 1RTHA 3OYHA 3AVBA 1RDBA 3MWTA 5FLXO 4BR7A 3E9OA 4DR4K 2KLAA 4J2DA 4LD0A 2V7YA 5JMVA 2XY5A 5LL6Z 3K0SA 1B9DA 1JCFA 2G8UA 1DKGD 4F4KA 1W97L 5AQJA 2O8FA 3C65A 4N76A 5AQXA 3PIOL 3CM6A 3KK3A 4DTRA 4LSLA 3TR8A 2D1KA 1SQKA 4JI4K 4B9NA 1N8RO 4Z94A 3CC2N 4CZHA 4KHYA 1YHQN 1TK0A 1K73O 1ASUA 3A5OC 4M3WA 2W6LA 4HCCA 4ISFA 3LDSA 3L4QA 1QZ5A 2BTFA 3VQ4A 3A5LC 3KWIA 4B9UA 3CCJN 3VF4A 3TPQA 3AAPA 3VQ8A 2Z1IA 4CK2A 3R8EA 5KPZA 3VA0A 3J81O 1LAVA 2D4WA 4CIFA 2GX9A 5AQQA 3L2UA 1IKVA 3VF2A 5KPTA 1KVBA 4UQGA 2FLOA 3GG4A 4IOXA 2YI1A 3CJ1A 5KGXA 2H3GX 4B3SK 4ICLA 3O9UA 1TUYA 3SAGA 4KH4A 1UA1A 1SV5A 3ZT1A 3ENOA 2PBDA 4NB4A 4CEFA 4MQ3A 3OYNA 3RTVA 4N47A 4E7JA 3H3OB 3OJUA 2OTJN 1BQNA 3AVMA 3MXMA 1U49A 3HJFA 5DMRA 3DJCA 3CCQN 3O1WA 4LSNA 4CZFA 3HM8A 2UXDK 3K5NA 3VTIA 1NJYA 1SL0A 4FLXA 3KIOA 4RTFD 1RT3A 1TAQA 4HUGA 4DF8A 4GW6A 4I7FA 4GY2B 1Q7YO 2YJFA 3MN7A 2VWBA 3L8BA 4K8XA 4DTPA 4JV5K 3ATUA 3ULDA 1Y64A 3VEYA 3HBTA 3M5RA 4FWOA 4CD1A 4QOZB 4W5OA 3HPOA 2OPPA 3Q7CA 2O8DB 3CHWA 3SJHA 4H0TB 2F7TA 3HT3A 3CFRA 3THYB 5FPMA 1BQMA 3VQDA 3PO4A 4KAZA 5M1OA 1L3UA 4G1QA 5BR8K 3G4SN 4FXDA 1RBUA 1XWLA 3C6HA 4FWSA 3EE8A 4CJVA 3VESA 3TAPA 2EHGA 2W41A 4DV7K 1C0UA 5AR0A 3ATVA 3D2EA 3CCUN 1QVGM 3NF8A 1NK6A 3QNOA 1RDAA 3CCSN 4J2BA 3ID6A 1YJNN 2EX3A 3DLGA 2QXLA 1KAYA 2P1JA 1WOQA 1WSIA 3RR8A 5FDLA 1RDDA 4DCHA 2P51A 3QFPA 2NRTA 1VSDA 1XQSC 2E6MA 3R9PA 3PSIA 3NH1A 4OPHA 4IXCA 1K8KA 2A41A 1GLEG 2XY6A 1I39A 1CZ9A 3WEEB 4CW7B 3LAKA 5GINA 3MXIA 4B1VA 1TVRA 1ITGA 3ZSQA 2JLEA 4RW4A 5HL7L 4DSLA 2Q97A 1KFDA 1HYSA 1KVAA 5I42A 3OY9A 4CJKA 3ZT4A 3ID8A 4H0PA 3VQ9A 3P38A 4HTUA 4CJ7A 4CGDA 5JVGL 2E88A 3THWB 4B9VA 2HHQA 3SQ2A 2GBZA 1IV0A 4RG8A 1LV5A 1HNIA 4JS5A 5CZ2A 1NKCA 2OPSA 3LPTA 4DFMA 1HNZK 3RMAA 4CFCA 2BDPA 4XH1A 1KTQA 1X3MA 3KJVA 4WFBL 5H1SQ 3DLRA 5HP1A 4MO4A 1RCHA 4JI5K 3CD6N 3MEGA 5HRPA 4Q5VA 4FM2A 4OKKA 5AQIA 4JK9A 5MLCQ 1JLCA 1ZBUA 1A5WA 5KQ8A 2ITGA 3N4PA 1YT3A 1IKWA 2XO7A 3ZSOA 3HPHA 2A1SA 4I9QA 3AGKA 5LY3A 2VQFK 3ZEUA 2P9PA 4ELUA 1C1BA 4CERA 2DFEA 2A3ZA 4H0OA 1BO5O 4NO7A 4JKDA 1JLGA 4KH6A 1BL3A 3O1BA 1NJXA 3KLHA 1LWCA 4CEEA 1C6VA 2XHBA 2O8FB 3AVAA 5DK5A 4IZ9A 1HYZA 2NRZA 4GMJB 3LDOA 3LPUA 2NRVA 2NRWA 3WXLA 1VRTA 2X6NA 1ZBIA 1C1AA 3SUNA 3S9HA 4CEOA 2OTLN 3VEZA 4IBNA 2HNZA 3M8RA 4ID1A 1TL1A 4CJEA 3TTDA 4JKBA 1YF5L 3EKSA 5EXWA 5ELZA 5GADP 3DOKA 1SZ2A 3DRRA 3LM2A 1IO2A 4DV2K 3HZ6A 1RGIA 2OA8A 4CGFA 4W5TA 1VQ8N 1P90A 1KCFA 3CJ7A 2KQ2A 4B08A 4KRFA 5J2QA 1UA0A 2ZJQL 5J2PA 5LJWA 3TARA 4AHUA 3QERA 1VK0A 2HB5A 5HRSA 4B3TK 3DWLA 3V9XA 5CHIA 4DQQA 1EP4A 2I7NA 3O9RA 3K5MA 3CC7N 1JCGA 3CMAN 2QKBA 4JI3K 4CCHA 5JICA 3F9KA 1NKEA 3S3OA 4B8AB 1N34K 4YDUA 2XRIA 3C95A 4DQRA 2HVIA 4JN4A 4JKFA 1VQ7N 4KHNA 1TL3A 1S1WA 4CJLA 1S22A 5SWMA 1SKSA 3G25A 2F8TA 1VQNN 2GWJA 2X6SA 3GDQA 4O8KA 1OVQA 1RTJA 2O8EA 1RT6A 2A40A 3FGUA 4EHTA 4B1WB 3MCPA 4DSEA 1T8EA 3IG1A 1HKCA 1N32K 1TAUA 4BC3A 1KSPA 4OPAA 1VSMA 2QWLA 4IO9L 1TKDA 1BA0A 2OPRA 3DLBA 4JI7K 1XNQK 2QWPA 2ZWHA 1T44A 3IFRA 4AILC 3LL3A 5GAGP 3BDPA 1A5XA 4V19S 3ZT2A 4DS5A 1R0AA 3CXCM 3AO4A 4YOUA 4OGCA 4BWJA 3ZT3A 4C8OA 4B8CA 5C15A 1ESVA 4YOXA 2YHXA 2OZSA 2Q0RA 3D2EB 4J8FA 3KTQA 1GOBA 3ZCMA 4E3SA 1RBRA 3M6GA 3G0ZA 5AQFA 3L2QA 2XY8A 4JKAA 3EN9A 2P5OA 2HF4A 4RWTA 3WQUA 2OZMA 3QBXA 2OPQA 3NVKA 3HP9A 2F9WA 2B6AA 1WSFA 4IO8A 3VN5A 1CZAN 2V52B 2F8SA 3CJCA 3WXIA 3I8DA 1NK0A 3TSQA 2CH5A 4FW1A 4ID5A 2IOCA 2BE2A 4YOYA 4BR2A 1K8KB 3LP1A 3TWHA 4J2AA 5GIPA 3O9QA 4FJ8A 2E4LA 3NH2A 4RW8A 1IBKK 5KRSA 3VF6A 2Q3SA 1KRPA 1LW0A 2FSJA 2RN2A 1QQMA 1XI1A 4CE9A 1MDUB 2HBLA 4N56A 4E7KA 1S9EA 2WTUA 4OJRA 5AFUA 4M3UA 4NLBA 5J2NA 1V4SA 2DFFA 3PV8A 4CZMA 4CJUA 3JSMA 4NCAA 4BRKA 2HMIA 1LWEA 2YNHA 4DR1K 2V51B 4AHCA 5IT9O 3VQCA 4HVJA 4CJRA 1FKPA 4WQ4A 2UXCK 3K9KA 1X9MA 3DMJA 2YX6A 3OYLA 1T05A 4FSVA 4CGJA 2IIRA 2DPNA 4M7XA 4CBXA 4C8LA 4IFYA 4LF7K 5A2QO 2R7YA 2PYJA 4WYBA 2UUCK 4CGHA 5AQHA 3C94A 4DTJA 1WBBA 5AQRA 3HK2A 4KREA 4CZEA 1NGJA 4DSIA 3HI0A 3T1YK 4CGIA 2D0OA 3OS2A 2NRXA 4HWIA 4CK3A 4FJ9A 3G10A 3ZEUB 4FVMA 3Q7BA 5EY4A 1YTUA 3NGYA 2QTDA 3EO3A 1GLJO 2P9SB 2DY4A 4CEAA 4C8NA 4BE2A 4MDAA 1M1KO 1MA9B 1VSHA 1RBVA 4CI6A 1EWRA 3QIPA 3QEVA 4R5PA 1CXQA 3MK6A 4IJAA 1W2BM 2WONA 4JKCA 4BRGA 4YOVA 3B6PA 3R3LA 1NLVA 1SS6A 2E1YA 3LP0A 3S41A 4DV1K 5BRDA 4H5TA 1ATRA 3M8SA 4BRDA 1IKXA 2A6AA 3SPYA 4BRHA 2HNDA 2F96A 1K9MO 1RDCA 3F2KA 4DKWA 4H5WA 1VAZA 1IG8A 5AQNA 4LFAK 3AO5A 5F0XA 1NKBA 4N41A 4AQYK 1BI4A 4JKHA 2HBKA 4CBWA 2VG7A 1QHTA 2UUAK 1VSIA 3NF7A 1KFSA 4BQLA 4LF9K 4KBOA 4DSJA 4OX9K 4BR0A 3CCMN 5JS2A 4O55A 1NJIO 4PL8A 1YUWA 2KW4A 3CJAA 2HHWA 4M45A 1VQON 4BWMA 3OVNA 1WB9A 3OYAA 1QSLA 2VG6A 3B8AX 3RVCA 2FBXA 3U3YA 4EHUA 2ZQBA 3L2VA 4FK4A 1S1UA 3E9LA 2G8WA 2GUPA 3DAWA 4CVNE 2VYPA 4F8RA 1T6DA 2HMPA 4MLHA 3PO5A 3WXKA 2YCHA 3LDPA 1HMVA 1DTQA 1Z26A 3SUOA 1DTTA 1TYQA 1YJ9N 3CCVN 3AVJA 4IKFA 1NOYA 5EU7A 1S5JA 5CYQA 4IEIA 2PFUA 3OBYA 2RE2A 2IC3A 5E26A 4W5NA 3P5JA 4LH5A 1HQUA 4AF1A 4C8KA 5M1FA 4WFAL 3I55N 2FBVA 3MEEA 5CY4A 1NGHA 4JEPA 3SQ0A 2ZM6K 2D0BA 3VPZA 3IAYA 4EAHD 4LF4K 4DQPA 3KK1A 1VQ6N 3PIPL 1RDUA 4FW2A 1IJJA 1GOAA 1EQYA 2A42A 4E1NA 1C0MA 4K41A 3VEVA 4GV6A 4DFPA 2QWQA 3VQEA 3WNEA 1QQNA 3TAGA 1BCOA 1WSHA 3SK3A 3K2PA 2P9IA 1OH6A 1VQ4N 2BH1A 4EP4A 5HRNA 1WBDA 3U3GA 1VQMN 1DLOA 2ETJA 4FLUA 2PAVA 3TTCA 3L6QA 3T69A 1YVUA 3V6DA 5I9EB 5C25A 5BREA 4IFEA 5BPLA 4CZGA 2CGKA 4ZTFA 4FJ7A 4DV4K 4R79A 1T3VA 2BUPA 1ZXOA 2QXFA 3VQ5A 1DEJA 3NMUA 3ZX0A 3MMVA 3NHGA 1TKXA 4B9MA 2VGMA 3CFPA 4LFBK 3QFUA 2FC0A 5M1KA 1LAWA 4IOAL 1D5AA 4YDUC 1GOCA 1O13A 3CCRN 2QEXN 1VSEA 3AA2A 4BC4A 3A2FA 4BDZA 5M1QA 4F3OA 4DFKA 4A5AA 1WNSA 1BA1A 4FOIA 4RW7A 2IS3A 2RF2A 4CJ3A 3T1HK 4EZ6A 3ZT0A 2YHAA 4JK8A 1S1XA 3EKUA 1TKZA 2WC9A 4MO5A 5GIOA 3HTVA 3PX0A 5BN9A 1NJWA 1HQEA 1X1PA 3VQBA 3ZLJA 3CI5A 4DTSA 3I8BA 3RMDA 4ELTA 1Q82O 4X62K 4F3TA 1VQPN 3DLLL 3BGRA 3C6TA 4HTLA 1EWQA 2HHUA 4MDBA 3F5TA 3RMCA 4CEBA 3WUHA 4DLEA 3WNFA 2P9KA 4E7HA 5T7BA 4Q0BA 2PY5A 3SI6A 3QETA 3DXMA 4HUFA 4FVUA 1C0FA 3V1RA 3ULEA 2G8IA 1UOCA 1HRHA 2CGJA 4W5QA 3RSEB 3DYAA 3U8XA 4DWIA 1GLDG 1RNHA 1HPMA 3WXMB 4G9ZA 4PY5A 5AQOA 2O8CA 4KPYA 3QIOA 4H4OA 4GV9A 3CPWM 1NK5A 3SUPA 2A5XA 4CZKA 1LOTB 4O8UA 3SPZA 3O3HA 3MAQA 3RRHA 1LW2A 4N5SA 2Z1HA 4PWDA 4IWVA 3FFIA 4C1NK 1ASVA 4YOTA 3HL8A 2VWJA 4I2PA 3VQAA 1VSLA 2YHBA 5B8HA 1HLUA 5FPDA 2ASPA 3NH0A 3LZIA 3KVGA 2D5RA 2IVOA 1U2VB 4ISGA 5AQVA 1K6YA 2YKMA 1CXUA 4XIUA 2FSNA 2WUSA 4KV8A 2HOEA 1NWKA 3CFOA 3NF6A 1J5EK 5AZJB 4DS4A 4O5BA 1J6ZA 4M42A 3A5NC 4CHNA 4FJGA 4EFHA 3HOTA 4BRNA 3CJBA 4JKEA 4PKHA 4K43A 1D9DA 1TKTA 3V1QA 3ENHA 2CGLA 2NRHA 3MXJA 4OPKA 1SUQA 5M1PA 4CJTA 1X9SA 4WQ4C 3O4WA 1U04A 4OLBA 4FWPA 2I7PA 3SZ2A 5GAHP 5C42A 1QZ6A 3B6OA 3MN6A 4KHPK 2IDOA 1QQCA 3OYKA 3D0PA 4BROA 4I2QA 4F9OA 5FPEA 5BPNA 3LANA 1M90O 1FJGK 5F2RA 5BN8A 1NGCA 5AQYA 3OYFA 3FR0A 1CLQA 4LH4A 4DTUA 4BR5A 4KO0A 2UYTA 4BY9C 3BUZB 3TAMA 1N33K 1XC3A 4B9QA 3PX6A 1B9FA 1Z05A 4M3YA 4AH9A 3H45C 3K9JA 1TYQB 1ILYA 4YOWA 3MECA 1X9WA 3AV9A 4UY8O 2ASMA 3I0RA 4JD2A 5J1EA 2P9NA 3CPEA 3FZHA 3NE6A 1J54A 2X74A 1ZBLA 1L5UA 4BC5A 5C2DA 2VWKA 1NBWA 4BR9A 2IVPA 4O44A 3CCLN 2ZJRL 5FRMA 3DM2A 3L3VA 3QO9A 1YAGA 4LFCK 2P9LA 1RFQA 3MX2A 2F9TA 3ISNC 4AM7A 1H1VA 4CZLA 3IKMA 4AHRA 1ZYQA 1TK5A 4M63C 3OYEA 1ASWA 4DU1A 4CIEA 3NGIA 1WUAA 3OHRA 4H5VA 3TABA 3E9PA 3KK2A 5CE3A 3OYGA 3DXKA 5ADXA 4DTNA 5AFUH 3ZSZA 3NDKA 5BRFA 1WSJA 4NLCA 3MEDA 3BF1A 2P9IB 4JI0K 3QEIA 1NMNA 1T03A 4DUZK 1OH5A 2J4RA 3UE5A 4QS7A 4FM1A 1TGOA 4PKGA 1G15A 2OCEA 3DI6A 1RT1A 4JNEA 2AP1A 3V9SA 1GLCG 1NJZA 3O6WA 4CEQA 3BY5A 3LP2A 3TU5A 4OO1J 1KD1O 4QS8A 3OA9A 2QK9A 3SNNA 1XMOK 1QE1A 1W0HA 3R6MA 1S6PA 3K58A 1KQSM 4OLAA 2HHVA 1MWKA 3L2WA 3NFAA 4C1NI 4DQ8A 3AO3A 4GKKK 4CHZA 1HKBA 5DM7L 4E1MA 5KPRA 4BREA 3CMEN 1QVFM 4BR4A 3L0QA 4PL7A 5HOOA 1NGIA 3F73A 4DU4A 5HBMA 4DTOA 4HHTA 4DR6K 3SUQA 1U45A 4CHOA 4NXMK 3M1FA 1C1CA 2HBJA 2ZGYA 3UKUA 4CJPA 3C0BA 2QWMA 4LF6K 5AQUA 3E66A 3T1AA 2O8BA 1TUUA 2G8FA 3QEWA 3ALYA 3P31A 4BC2A 3J8AA 4CJWA 3P83D 3NGZA 5AQMA 4XH5A 5BPMA 1BUPA 1KLMA 1NOZA 3EE9A 3K5OA 4C23A 4FWMA 4CFDA 3HSTB 2YNGA 3CJ9A 3H3NO 1I94K 3H1QA 4U67L 4E1JA 4FLTA 3QNNA 3VA3A 3AAQA 3V1OA 1XUPO 1IH7A 2P9KB 3OYDA 3VTHA 3N4QA 4B9LA 5AQWA 3NCIA 3DXMB 5C2FA 3NVMA 3O3FA 4CF9A 1L3SA 4CFAA 4CJFA 1NK7A 2QW9A 3ULEB 3O9TA 3ZX3A 3QBWA 4YORA 4FJHA 4K8ZA 3I0SA 1Z6RA 2KZZA 4FYDA 4H4MA 4LY7A 4CHPA 3P1GA 3VETA 3V9UA 2O8DA 4EIAA 4DQSA 5C12A 3KK7A 2G8VA 2O8CB 2D0AA 4JKGA 1VHXA 4L3QA 3CF5L 1ATSA 4M3RA 5AQLA 4CEZA 4OVLA 5TKYA 2E2OA 4CBUA 4CESA 3EZWA 5E84A 3CQYA 2GUIA 1WSEA 3JXUA 4FJNA 1OKJA 3RR7A 4DV5K 1WSGA 2CH6A 4CF8A 1D4XA 1SL2A 5E41A 2HHXA 1FXXA 4DR7K 4CK1A 4H5RA 1ZBFA 1KAZA 4BRIA 1S1TA 4IG3A 2VG5A 1NGFA 4WCEL 3BEXA 3LDNA 3W3DA 5AJ3K 4FJMA 1VQKN 4KB1A 3T7ZA 4FJJA 1NNEA 4E0DA 2P9UA 4A61A 4KHSA 4GKJK 1RDWX 4KHWA 2GEMA 2W6KA 3AO1A 4JK7A 1IG9A 3OJSA 5FRNA 3HSCA 5M1NA 4ZTJA 1EXQA 2P9PB 3R1XA 5F1XA 3C6UA 3MCAB 1S72N 3ASMA 1WAFA 1S3XA 4BRQA 4E7LA 4IFVA 3AGRA 4CGGA 4DV3K 3DLKA 4GVEA 5D3GA 4JYAK 3QEPA 3AVIA 3OYMA 3KD1E 3SQ4A 4HCBA 2JWKA 2KFNA 4DFJA 1JKHA 1JLFA 2VCPA 2I5JA 3BZCA 1D8YA 1XHZA 4FPBA 4CIGA 4A57A 2G8KA 2ZGZA 4E19A 1NGGA 4FWQA 3FFKB 4WE1A 2X78A 3SAHA 3O8MA 4Z4IA 4FPAA 4IG0A 3PSFA 1JCEA 4FWNA 3VGMA 2WOMA 3MN9A 5AQGA 3AVKA 5BRHA 4DUYK 4JD2B 4W5RA 2P9NB 2RKIA 5KI6A 1NGBA 4AHTA 4FLVA 1HX1A 3KKRA 1D9FA 2ATQA 5CYMA 3AARA 3NF9A 3O80A 1LWFA 1SL1A 1N6QA 4FZYA 1DT9A 1T7PA 3ITHA 1L3VA 3SV3A 2UU9K 4DTXA 1QSYA 2P9LB 4PKIA 2UXBK 4ISEA 4DR3K 1VSJA 4FLYA 3LALA 3QEXA 2Q31A 1GLAG 3L3UA 2F4VK 2FF3B 1EKEA 1U6ZA 5J2MA 4BDYA 4IJNA 3CQXA 4ZHRA 3E1YA 3DXKB 1KLNA 3V81A 3RWUA 1E4FT 4PQUA 4M3TA 4BE0A 2RPIA 2G8HA 2YJEA 1JL1A 4H03B 5FPNA 1JLEA 1BIUA 1NM1A 5LMUK 2O8EB 4Y1CA 4FCYA 4EZ9A 2E6LA 2FBTA 4O0IA 2P5GA 4K0KK 3H1VX 4B9SA 2WFBA 1SKRA 2NZTA 4XEIA 3HVRA 1JJ2M 4FJKA 1BCMA 2YNFA 3T3FA 2ITMA 3J7ZO 1ZBSA 2E2QA 4JHDA 1I3AA 3J7YP 4DLGA 3FZMA 4Z4EA 2YNIA 3LM9A 3D2FA 3SAFA 2QI2A 3QLHA 2NUBA 4CECA 3W0LA 4Y1DA 3VGLA 4BGBA 3UKUB 3NAEA 3HXMA 2NRRA 1BISA 4JAXA 2A1RA 3EEQA 1U47A 4Z4FA 1RTDA 3OYBA 3HYFA 5AQTA 2E2PA 2O8BB 4WQ5A 4CJ5A 4H0YB 4IDHA 5C0YA 4H8KA 2ZE2A 2QM1A 3AY9A 3TAQA 4B3MK 2ZJPL 3H6EA 3QB0A 4YFUA 3K59A 4FO0A 1SKWA 1FK9A 4A5BA 4AHVA 4BE1A 2PYLA 5JLHA 3L4IA 3E01A 1VSFA 3PX4A 3C7NA 3ZETA 4DF4A 1X9JA 4KHUA 3FZLA 3IMXA 1QHAA 4QAGA 2HHHK 2KHOA 1HJRA 3CETA 4MFBA 3P4IA 3UKRA 1FKOA 4FL9A 2QA4N 4IEEA 4CEDA 5KQDA 3HOSA 1QTMA 1J53A 1NU0A 1ZC6A 2E2NA 1BGXT 3UIQA 1NK8A 4A62A 3VEOA 4HUEA 3CYMA 3S3MA 4DSKA 4NXNK 2KFZA 4EP5A 3LZJA 3IUCA 1EO1A 1P8ZA 3AVCA 1N5YA 2AJQA 4X66K 3EZ5A 1Q86O 4CZIA 3TANA 2B4JA 2GELA 2QWRA 4JI2K 4JKGB 1N36K 1Q9YA 1R59O 3M8PA 3EY1A 5LMNK 3O4QA 4FM0A 1RBTA 4K25A 4NYNA 5FROA 1BG3A 3G6EN 4BACA 4GVMA 5CZ1A 5LJVA 5DM6L 4CD3A 3TI0A 1JXEA 3KHYA 1V4TA 1HKGA 4FJIA 3WNGA 4OGEA 5C10A 1U4BA 4CF0A 3OW2M 4BRAA 4JLHA 4OKJA 2OANA 4PA1A 2HF3A 4E7IA 1VQ5N 3A5MC 2UUBK 3FZFA 4B3RK 3VGKA 3V9ZA 3VEWA 4IOCL 2P9UB 1KC8O 5AQKA 1VQLN 1WAJA 1F21A 3IRXA 3GBTA 3U4LA 3GL1A 3PLAA 1GLBG 2AA4A 1JLBA 4ILJA 3JYTA 4J2EA 2YHWA 3QDKA 3SBTA 4CHQA 1XMQK 3P39A 4CZJA 2HVHA 2IGIA 1EX4A 2E5LK 3SLCA 1QS4A 4I9LA 2OYQA 2Z1GA 1A5VA 1JLQA 4B1UB 1GLFO 2GWKA 4CF1A 4FLWA 2Q1NA 3OYCA 3AVHA 1VRUA 1KAXA 1SAZA 2QKKA 2W42A 1NMDA 1BDGA 5ADXH 2DTUA 3O5BA 1J9AA 4K42A 4KI6A 5HRRA 4JI1K 3THXA 3AO2A 3WNHA 4I6MA 4BG9A 4BQZA 3GOIA 5KGWA 4CHYA 4F2RA 4DV6K 4B3OA 4ILGB 1BHLA 5IWAK 4FJXA 4XH4A 3TAFA 1J5OA 1LCUA 3OS0A 1Q9XA 4GV3A 2HNYA 2Y1IA 1YVNA 4WFNL 3G71N 3VMFB 1BI4B 4FWLA 1W9HA 5AZIA 2JGUA 3IS9A 3KD5E 4FWKA 4CF2A 4GNIA 3L2RA 4DMNA 1BIZA 4RW9A 2RHKA 4H5NA 3BZKA 1HJOA 3CG7A 5AQZA 3FLCO 2FF6A 3FZKA 3DOLA 5JLFA 2DFHA 4M3XA 3FE1A 3VQQA 3ZX2A 5HROA 2D0CA 3KWGA 4LC9B 5TKWA 3UB5A 1NGEA 2Q0UA 3LDQA 1RTIA 3BF3A 3HVTA 3O08A 2FBYA 4BRLA 4Z4GA 3AVLA 1JXBA 1UAXA 4JI6K 3GE1A 2D0PA 2P9SA 1RT7A 2Q36A 1HNVA 3VERA 3C6AA 4DR2K 1W7AA 3IDHA 4PUOA 4BG8A
chains in the Genus database with same CATH topology
3C6HA 3VTHA 4BR0A 3CCMN 3N4QA 4FWRA 4FWSA 3VEXA 2IVNA 1NJIO 3EE8A 4PL8A 1YUWA 3CJAA 3DXMB 5AQWA 3VESA 2E20A 5C2FA 1E4GT 3NVMA 1ATNA 3OBWA 2W41A 1VQON 5AR0A 2QW9A 3ULEB 3ATVA 3D2EA 3O9TA 3ZX3A 3QBWA 4YORA 1X3NA 3B8AX 4O5FA 3RVCA 1Z6RA 3CCUN 1QVGM 3VETA 4EHUA 3CCSN 4EIAA 3ID6A 3ZYYX 3E9LA 5C12A 1YJNN 2GUPA 3SMSA 3KK7A 3DAWA 3MDQA 2VYPA 3JS6A 4JHDB 1T6DA 2QXLA 4KH5A 4JKGA 1KAYA 4L3QA 3CF5L 2HMPA 1ATSA 2YHYA 5AQLA 5CR4A 3D2FB 2HSTA 4MLHA 1WOQA 5TKYA 2E2OA 4CBUA 3WXKA 2YCHA 3EZWA 3LDPA 3D6RA 5E84A 4DCHA 3QFPA 2NRTA 1GLLO 1TYQA 1XQSC 3CQYA 3JXUA 1YJ9N 3R9PA 4DHYA 3CCVN 4OPHA 1KXPA 1OKJA 1K8KA 4IXCA 2A41A 3I33A 2CH6A 1D4XA 2PFUA 1GLEG 1C0GA 3OBYA 4IEIA 2RE2A 1Q81O 3H46O 5E26A 3WEEB 5GINA 3A0IX 4AF1A 4B1VA 4H5RA 5M1FA 4WFAL 3I55N 1KAZA 4BRIA 5HL7L 2NNWA 2Q97A 1NGHA 4JEPA 3TSUA 4WCEL 1NGFA 3BEXA 3LDNA 3W3DA 4QS9A 3VPZA 1VQKN 3T7ZA 4EAHD 1MWMA 3ID8A 4H0PA 3LDLA 2P9UA 4A61A 4BRPA 3P38A 3PIPL 1VQ6N 1RDUA 1RDWX 4CJ7A 4B1XB 1IJJA 3CERA 1EQYA 4H0XB 2GEMA 2A42A 3C7NB 4JK7A 3ZETB 5JVGL 3U9ZA 2E88A 4K41A 3VEVA 3HSCA 4GV6A 2QWQA 5M1NA 1QQNA 2E8AA 1T6CA 2P9PB 4A2AA 3SMPA 1YIJN 3R1XA 5F1XA 1VQ4N 3MCAB 3SK3A 2P9IA 3BP8A 3UKRB 1S72N 2BH1A 1NGAA 3MN5A 1VQMN 1BOTO 1S3XA 4BRQA 2PAVA 3AGRA 3TTCA 3L6QA 4XH1A 1X3MA 4GVEA 4WFBL 3T69A 5I9EB 5BREA 1K8AO 1BWFO 3HRGA 3QMLA 4IFEA 2CGKA 4CZGA 5BPLA 5H1SQ 2JWKA 2JWLA 4BVPA 4R79A 4MO4A 4Y0WA 3U9DA 3CD6N 2VCPA 2BUPA 1T3VA 1ZXOA 5AQIA 4JK9A 2QWNA 5MLCQ 4FPBA 4M7YA 4A57A 3EL2A 5KQ8A 2ZGZA 1DEJA 3N4PA 3NMUA 3ZX0A 1NGGA 4FWQA 3FFKB 3MMVA 5JVHL 3SAHA 1HUXA 3O8MA 3SBGA 2VGMA 4FPAA 3AGKA 3QFUA 1DGKN 5LY3A 5M1KA 3ZEUA 4IOAL 2P9PA 3WQTA 1JCEA 4YDUC 4FWNA 2A3ZA 2EWSA 4H0OA 3VGMA 1BO5O 3MN9A 5AQGA 4NO7A 1Q18A 2NLXA 4JKDA 4KH6A 5EOYA 5BRHA 3O1BA 4JD2B 1O13A 3CCRN 2QEXN 2P9NB 1QQOA 4BC4A 1NGBA 1HX1A 5M1QA 4A5AA 4IZ9A 3AARA 1BA1A 4FOIA 2NRZA 2ZF5O 3LDOA 3O80A 2NRVA 2NRWA 1DT9A 3WXLA 4JK8A 3EKUA 4MO5A 2WC9A 4WQ5C 3TSPA 5GIOA 2E1ZA 2P9LB 3HTVA 3M3ZA 4PKIA 3KZBA 4BRFA 3VEZA 2OTLN 1QVFM 5BN9A 4ISEA 3CI5A 3TTDA 4JKBA 1YF5L 3I8BA 3EKSA 5EXWA 5ELZA 4B1YB 5GADP 2Q31A 1SZ2A 2FSKA 1GLAG 1Q82O 3LM2A 2FF3B 1VQPN 1U6ZA 3DLLL 3HZ6A 4IJNA 1RGIA 3CQXA 3E1YA 3DXKB 4HTLA 4MDBA 3F5TA 1VQ8N 1P90A 1E4FT 3ENBA 3CJ7A 1YITN 3QICA 3MWPA 2WBNA 2FXUA 4BRCA 2VGNA 1BU6O 3WUHA 2P9KA 2YJEA 4H03B 5FPNA 2ZJQL 4ILHA 5LJWA 3CCEN 4H0VB 1NM1A 3A8YA 2KKZA 3DXMA 3DWLA 4FVUA 1C0FA 5BR9A 3ULEA 5CHIA 3VENA 2I7NA 3O9RA 4I6MB 2CGJA 3H1VX 2WFBA 2NZTA 4XEIA 3RSEB 3U8XA 3CC7N 1JJ2M 4RCHA 1JCGA 1GLDG 3CMAN 1HPMA 3WXMB 5JICA 4G9ZA 5AQPA 5AQOA 2ITMA 3J7ZO 1ZBSA 2E2QA 4FOEA 4JHDA 3MX5A 4DB3A 1YI2N 1YXQA 4YDUA 3FZMA 3CIPA 4JN4A 4GV9A 3CPWM 4JKFA 2A5XA 5AZIB 1LOTB 4CZKA 1VQ7N 4O8UA 1S22A 3LM9A 4MLEA 3D2FA 3SAFA 3G25A 2QI2A 1VQ9N 3W0LA 1VQNN 2GWJA 3VGLA 3GDQA 4O8KA 4AM6A 4IWVA 4BGBA 3UKUB 2NRRA 4C1NK 5EVZA 4JAXA 4YOTA 4U7BA 2A40A 5AQTA 3FGUA 2E2PA 4EHTA 4B1WB 4WQ5A 3MCPA 5GAEP 3WEEA 4H0YB 5AQSA 2V7ZA 5B8HA 4IDHA 5C0YA 1HLUA 5FPDA 2ASPA 3RSEA 3D7EO 1HKCA 2QM1A 3AY9A 3WT0A 3KVGA 2GTDA 4BC3A 2ZJPL 2IVOA 3H6EA 3QB0A 4OPAA 1U2VB 4FO0A 4ISGA 5AQVA 2QWLA 2FSNA 4IO9L 2WUSA 2HOEA 1NWKA 2QWOA 4A5BA 4BRMA 5AZJB 4BVOA 1BA0A 1J6ZA 2W40A 3A5NC 5JLHA 4A2BA 2QWPA 3O9SA 3L4IA 2ZWHA 3F9MA 1T44A 2ASOA 3IFRA 3C7NA 4EFHA 1OVYA 3HOTA 3ZETA 4BRNA 3CJBA 4JKEA 3LL3A 5GAGP 4A59A 1X9JA 4PKHA 3FZLA 4K43A 3IMXA 1QHAA 2HBMA 2KHOA 4PHTX 3ENHA 3I56N 3CETA 2CGLA 2NRHA 3TTFA 3CXCM 4YOUA 5M1PA 3P4IA 5EX5A 3UKRA 4FL9A 5C15A 2QA4N 4WQ4C 3O4WA 1ESVA 4IEEA 4FWPA 2I7PA 4BGAA 5KQDA 3HOSA 4YOXA 1ZC6A 2YHXA 2E2NA 2Q0RA 3D2EB 4J8FA 5GAHP 1QZ6A 3WXJA 2Q2RA 3MN6A 4A62A 3VEOA 3VOVA 3M6GA 1NGDA 4BROA 3IUCA 4F9OA 1P8ZA 1G99A 1EO1A 1U2VA 5AQFA 5FPEA 3CC4N 4JKAA 5BPNA 1M90O 4B1ZA 5F2RA 3EN9A 4WF9L 2HF4A 5BN8A 1NGCA 4RWTA 5AQYA 3WQUA 1YJWN 1Q86O 3FR0A 3QBXA 4CZIA 5AZJA 3NVKA 2F9WA 2GELA 2QWRA 4IO8A 4JKGB 1CZAN 3MWTA 1R59O 2V52B 4BR5A 2UYTA 4BY9C 3CJCA 3WXIA 3BUZB 4K25A 4BR7A 3E9OA 1XC3A 3TSQA 4B9QA 1Z05A 1BG3A 2CH5A 3G6EN 2KLAA 3H45C 3K9JA 1TYQB 1ILYA 4YOWA 4YOYA 5LJVA 4BR2A 5DM6L 4CD3A 2V7YA 5JMVA 1K8KB 3KHYA 4UY8O 2ASMA 1HKGA 1V4TA 4JD2A 5GIPA 3O9QA 1JCFA 5C10A 1DKGD 2P9NA 3CPEA 1W97L 3FZHA 5AQJA 3VF6A 3C65A 5AQXA 3PIOL 4BC5A 5C2DA 2FSJA 3OW2M 4BRAA 1QQMA 2D1KA 1NBWA 4BR9A 1MDUB 2IVPA 1SQKA 2HBLA 3CCLN 1N8RO 4Z94A 2ZJRL 2OANA 4CZHA 3CC2N 2HF3A 1VQ5N 3A5MC 5AFUA 1YHQN 1YAGA 2P9LA 3FZFA 4NLBA 1K73O 1V4SA 1RFQA 3MX2A 4CZMA 2F9TA 3VGKA 3A5OC 1H1VA 4AM7A 3VEWA 4CZLA 4IOCL 2P9UB 3IKMA 1KC8O 5AQKA 1VQLN 4ISFA 4M63C 4BRKA 3GBTA 3U4LA 3GL1A 3PLAA 1GLBG 3L4QA 1QZ5A 1WUAA 2AA4A 2BTFA 3OHRA 4H5VA 4ILJA 3A5LC 3KWIA 3E9PA 3CCJN 2V51B 3VF4A 5CE3A 3DXKA 5ADXA 5AFUH 2YHWA 3QDKA 3TPQA 3AAPA 5BRFA 3SBTA 4NLCA 3P39A 3R8EA 4CZJA 3BF1A 2P9IB 5KPZA 4WQ4A 3SLCA 2J4RA 3UE5A 2D4WA 3K9KA 2GX9A 4QS7A 5AQQA 2YX6A 4B1UB 1GLFO 2GWKA 4PKGA 4FSVA 2IIRA 2Q1NA 2DPNA 4M7XA 3VF2A 4CBXA 5KPTA 4JNEA 2AP1A 1GLCG 1KAXA 1SAZA 3O6WA 1NMDA 2FLOA 1BDGA 4WYBA 5ADXH 3O5BA 3TU5A 5AQHA 3GG4A 4IOXA 4K42A 2YI1A 4OO1J 3CJ1A 4QS8A 2H3GX 1KD1O 3OA9A 3O9UA 5AQRA 1TUYA 4I6MA 4BG9A 4BQZA 4CZEA 3GOIA 3R6MA 4KH4A 3SAGA 1KQSM 1NGJA 3HI0A 1MWKA 4ILGB 4C1NI 4XH4A 3ENOA 2D0OA 4DQ8A 2NRXA 2PBDA 1LCUA 4HWIA 4NB4A 4GV3A 1HKBA 5DM7L 5KPRA 3ZEUB 4BREA 3CMEN 1YVNA 3H3OB 4BR4A 3Q7BA 5EY4A 3L0QA 4WFNL 3VMFB 4PL7A 5HOOA 1NGIA 3G71N 2OTJN 4FWLA 5AZIA 2QTDA 3EO3A 3DJCA 3CCQN 1GLJO 3O1WA 2P9SB 3HM8A 4CZFA 3VTIA 3M1FA 4FWKA 2HBJA 4GNIA 4RTFD 2ZGYA 4MDAA 3UKUA 1M1KO 1MA9B 2RHKA 4CI6A 3C0BA 4GY2B 4H5NA 2QWMA 1Q7YO 2YJFA 3MN7A 5AQUA 1HJOA 3E66A 3MK6A 4IJAA 5AQZA 3FLCO 1W2BM 2FF6A 2VWBA 1TUUA 4JKCA 4BRGA 4YOVA 3FZKA 3R3LA 5JLFA 1NLVA 3ATUA 3P31A 4BC2A 1SS6A 1Y64A 2E1YA 3FE1A 3J8AA 3S41A 3VEYA 3ZX2A 5BRDA 4H5TA 1ATRA 3HBTA 3M5RA 4FWOA 4BRDA 5AQMA 2A6AA 4CD1A 4XH5A 4BRHA 3KWGA 4LC9B 1K9MO 3Q7CA 5BPMA 3F2KA 4DKWA 5TKWA 3CHWA 3SJHA 4H5WA 1BUPA 1VAZA 2F7TA 4H0TB 1NGEA 2Q0UA 3LDQA 3BF3A 3EE9A 3UB5A 3O08A 1IG8A 5AQNA 4C23A 4FWMA 4BRLA 5F0XA 3CJ9A 5FPMA 3H3NO 3H1QA 4U67L 4JKHA 4E1JA 2HBKA 4CBWA 3GE1A 2D0PA 2P9SA 5M1OA 3AAQA 2Q36A 3VERA 1XUPO 3G4SN 3C6AA 3IDHA 2P9KB 4BQLA 4BG8A 4KBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BR0 A;  4FWR A;  4FWS A;  3VEX A;  2IVN A;  4PL8 A;  5AQW A;  1YUW A;  3CJA A;  3DXM B;  3VES A;  2E20 A;  1E4G T;  1ATN A;  2W41 A;  5AR0 A;  2QW9 A;  3ULE B;  3ATV A;  3D2E A;  3ZX3 A;  3QBW A;  1X3N A;  3B8A X;  4O5F A;  1Z6R A;  3VET A;  4EHU A;  4EIA A;  2GUP A;  3SMS A;  3DAW A;  3MDQ A;  2VYP A;  3JS6 A;  4JHD B;  1T6D A;  2QXL A;  1KAY A;  4L3Q A;  2HMP A;  1ATS A;  2YHY A;  5AQL A;  3D2F B;  4MLH A;  1WOQ A;  5TKY A;  2E2O A;  4CBU A;  3WXK A;  2YCH A;  3EZW A;  3LDP A;  5E84 A;  4DCH A;  3QFP A;  1GLL O;  1TYQ A;  1XQS C;  3CQY A;  3JXU A;  3R9P A;  4DHY A;  1KXP A;  1OKJ A;  1K8K A;  4IXC A;  2A41 A;  3I33 A;  2CH6 A;  1D4X A;  1GLE G;  1C0G A;  3H46 O;  5E26 A;  3WEE B;  3A0I X;  4B1V A;  4H5R A;  1KAZ A;  4BRI A;  2Q97 A;  1NGH A;  1NGF A;  3BEX A;  3LDN A;  3W3D A;  4QS9 A;  3VPZ A;  4EAH D;  1MWM A;  3ID8 A;  4H0P A;  3LDL A;  2P9U A;  4A61 A;  4BRP A;  1RDW X;  4CJ7 A;  4B1X B;  1IJJ A;  3CER A;  1EQY A;  4H0X B;  2GEM A;  2A42 A;  3C7N B;  3ZET B;  3U9Z A;  2E88 A;  4K41 A;  3VEV A;  3HSC A;  2QWQ A;  1QQN A;  2E8A A;  1T6C A;  2P9P B;  4A2A A;  3SMP A;  5F1X A;  3SK3 A;  2P9I A;  3BP8 A;  3UKR B;  1NGA A;  3MN5 A;  1BOT O;  1S3X A;  4BRQ A;  2PAV A;  3L6Q A;  4XH1 A;  1X3M A;  5I9E B;  5BRE A;  1BWF O;  3QML A;  4CZG A;  2CGK A;  5BPL A;  4BVP A;  4MO4 A;  4Y0W A;  3U9D A;  2VCP A;  2BUP A;  1ZXO A;  5AQI A;  2QWN A;  4FPB A;  4M7Y A;  3EL2 A;  5KQ8 A;  2ZGZ A;  1DEJ A;  3ZX0 A;  1NGG A;  4FWQ A;  3FFK B;  3MMV A;  1HUX A;  3O8M A;  4FPA A;  3QFU A;  1DGK N;  5LY3 A;  3ZEU A;  2P9P A;  3WQT A;  1JCE A;  4YDU C;  4FWN A;  2A3Z A;  2EWS A;  4H0O A;  3VGM A;  1BO5 O;  3MN9 A;  5AQG A;  4NO7 A;  1Q18 A;  2NLX A;  5EOY A;  5BRH A;  3O1B A;  4JD2 B;  2P9N B;  1QQO A;  4BC4 A;  1NGB A;  1HX1 A;  4IZ9 A;  3AAR A;  1BA1 A;  4FOI A;  2ZF5 O;  3LDO A;  3O80 A;  3WXL A;  4MO5 A;  3EKU A;  4WQ5 C;  2E1Z A;  2P9L B;  3HTV A;  3M3Z A;  4PKI A;  3KZB A;  4BRF A;  3VEZ A;  5BN9 A;  4ISE A;  3CI5 A;  3I8B A;  3EKS A;  5EXW A;  5ELZ A;  4B1Y B;  2Q31 A;  1SZ2 A;  2FSK A;  1GLA G;  3LM2 A;  2FF3 B;  1U6Z A;  3HZ6 A;  4IJN A;  1RGI A;  3CQX A;  3DXK B;  4HTL A;  1E4F T;  3CJ7 A;  3QIC A;  2FXU A;  4BRC A;  1BU6 O;  3WUH A;  2P9K A;  2YJE A;  4H03 B;  5FPN A;  5LJW A;  4H0V B;  1NM1 A;  3A8Y A;  3DXM A;  3DWL A;  1C0F A;  5BR9 A;  3ULE A;  3VEN A;  2I7N A;  4I6M B;  2CGJ A;  3H1V X;  2NZT A;  4XEI A;  3RSE B;  3U8X A;  4RCH A;  1JCG A;  1GLD G;  1HPM A;  5JIC A;  5AQP A;  5AQO A;  2ITM A;  1ZBS A;  2E2Q A;  4FOE A;  4JHD A;  4DB3 A;  1YXQ A;  4YDU A;  3FZM A;  3CIP A;  4JN4 A;  2A5X A;  5AZI B;  1LOT B;  4CZK A;  1S22 A;  3LM9 A;  4MLE A;  3D2F A;  3G25 A;  3W0L A;  2GWJ A;  3VGL A;  3GDQ A;  4O8K A;  4AM6 A;  4IWV A;  4BGB A;  3UKU B;  5EVZ A;  4JAX A;  2A40 A;  5AQT A;  3FGU A;  2E2P A;  4EHT A;  4B1W B;  4WQ5 A;  3MCP A;  3WEE A;  4H0Y B;  5AQS A;  2V7Z A;  5B8H A;  1HLU A;  5FPD A;  2ASP A;  3RSE A;  3D7E O;  1HKC A;  2QM1 A;  3AY9 A;  3WT0 A;  3KVG A;  2GTD A;  4BC3 A;  2IVO A;  3H6E A;  3QB0 A;  1U2V B;  4FO0 A;  4ISG A;  5AQV A;  2QWL A;  2FSN A;  2WUS A;  2HOE A;  1NWK A;  2QWO A;  4BRM A;  5AZJ B;  4BVO A;  1BA0 A;  1J6Z A;  2W40 A;  3A5N C;  5JLH A;  4A2B A;  2QWP A;  3L4I A;  2ZWH A;  3F9M A;  1T44 A;  2ASO A;  3IFR A;  3C7N A;  4EFH A;  3ZET A;  4BRN A;  3CJB A;  3LL3 A;  1X9J A;  4PKH A;  3FZL A;  4K43 A;  3IMX A;  1QHA A;  2KHO A;  3ENH A;  3CET A;  2CGL A;  2NRH A;  3P4I A;  5EX5 A;  3UKR A;  4FL9 A;  4WQ4 C;  3O4W A;  1ESV A;  4BGA A;  4FWP A;  2I7P A;  5KQD A;  1ZC6 A;  2YHX A;  2E2N A;  2Q0R A;  3D2E B;  4J8F A;  1QZ6 A;  3WXJ A;  2Q2R A;  3MN6 A;  4A62 A;  3VEO A;  3VOV A;  3M6G A;  1NGD A;  4BRO A;  3IUC A;  4F9O A;  1P8Z A;  1G99 A;  1U2V A;  5AQF A;  5FPE A;  5BPN A;  4B1Z A;  5F2R A;  3EN9 A;  2HF4 A;  5BN8 A;  1NGC A;  4RWT A;  5AQY A;  3WQU A;  3FR0 A;  3QBX A;  4CZI A;  5AZJ A;  2F9W A;  2GEL A;  2QWR A;  4IO8 A;  1CZA N;  1R59 O;  2V52 B;  4BR5 A;  2UYT A;  3CJC A;  3WXI A;  3BUZ B;  4K25 A;  4BR7 A;  1XC3 A;  4B9Q A;  1Z05 A;  1BG3 A;  2CH5 A;  3H45 C;  1TYQ B;  5LJV A;  4BR2 A;  4CD3 A;  2V7Y A;  5JMV A;  1K8K B;  3KHY A;  2ASM A;  1HKG A;  1V4T A;  4JD2 A;  1JCF A;  1DKG D;  2P9N A;  3FZH A;  5AQJ A;  3VF6 A;  5AQX A;  4BC5 A;  2FSJ A;  4BRA A;  1QQM A;  2D1K A;  1NBW A;  4BR9 A;  1MDU B;  2IVP A;  1SQK A;  4Z94 A;  2OAN A;  4CZH A;  2HF3 A;  3A5M C;  5AFU A;  1YAG A;  3FZF A;  2P9L A;  1V4S A;  1RFQ A;  4CZM A;  2F9T A;  3VGK A;  3A5O C;  1H1V A;  4AM7 A;  3VEW A;  4CZL A;  2P9U B;  5AQK A;  4ISF A;  4M63 C;  4BRK A;  3GBT A;  3U4L A;  3GL1 A;  1GLB G;  1QZ5 A;  1WUA A;  2AA4 A;  2BTF A;  3OHR A;  4H5V A;  3A5L C;  2V51 B;  3VF4 A;  5CE3 A;  3DXK A;  5ADX A;  5AFU H;  2YHW A;  3QDK A;  3TPQ A;  3AAP A;  5BRF A;  3R8E A;  4CZJ A;  3BF1 A;  2P9I B;  5KPZ A;  4WQ4 A;  3SLC A;  2J4R A;  3UE5 A;  2D4W A;  4QS7 A;  5AQQ A;  4B1U B;  1GLF O;  2GWK A;  4PKG A;  4FSV A;  2IIR A;  2Q1N A;  2DPN A;  4M7X A;  3VF2 A;  4CBX A;  5KPT A;  4JNE A;  2AP1 A;  1GLC G;  1KAX A;  1SAZ A;  3O6W A;  1NMD A;  2FLO A;  1BDG A;  4WYB A;  5ADX H;  3O5B A;  3TU5 A;  5AQH A;  3GG4 A;  4K42 A;  2YI1 A;  3CJ1 A;  4QS8 A;  2H3G X;  5AQR A;  1TUY A;  4I6M A;  4BG9 A;  4BQZ A;  4CZE A;  3GOI A;  3R6M A;  1NGJ A;  3HI0 A;  1MWK A;  4XH4 A;  3ENO A;  2D0O A;  4DQ8 A;  2PBD A;  1LCU A;  4HWI A;  4NB4 A;  1HKB A;  5KPR A;  3ZEU B;  4BRE A;  1YVN A;  3H3O B;  4BR4 A;  5EY4 A;  3L0Q A;  4PL7 A;  1NGI A;  4FWL A;  5AZI A;  3EO3 A;  3DJC A;  1GLJ O;  3O1W A;  2P9S B;  3HM8 A;  4CZF A;  3M1F A;  4FWK A;  4GNI A;  4RTF D;  2ZGY A;  3UKU A;  1MA9 B;  4CI6 A;  3C0B A;  4GY2 B;  4H5N A;  2QWM A;  2YJF A;  3MN7 A;  5AQU A;  1HJO A;  3MK6 A;  4IJA A;  5AQZ A;  3FLC O;  2FF6 A;  2VWB A;  1TUU A;  4BRG A;  3FZK A;  5JLF A;  1NLV A;  3ATU A;  4BC2 A;  1Y64 A;  2E1Y A;  3FE1 A;  3J8A A;  3S41 A;  3VEY A;  3ZX2 A;  5BRD A;  4H5T A;  1ATR A;  3HBT A;  4FWO A;  4BRD A;  5AQM A;  2A6A A;  4CD1 A;  4XH5 A;  4BRH A;  4LC9 B;  5BPM A;  3CHW A;  3SJH A;  4H5W A;  1BUP A;  4H0T B;  3UB5 A;  1NGE A;  2Q0U A;  3LDQ A;  3BF3 A;  4C23 A;  3O08 A;  1IG8 A;  5AQN A;  4FWM A;  4BRL A;  5F0X A;  3CJ9 A;  5FPM A;  3H3N O;  3H1Q A;  4E1J A;  4CBW A;  3GE1 A;  2D0P A;  2P9S A;  3AAQ A;  2Q36 A;  3VER A;  1XUP O;  3IDH A;  2P9K B;  4BQL A;  4BG8 A;  4KBO A; 
#chains in the Genus database with same CATH topology
 2YV0 X;  4FWR A;  3VEX A;  2IVN A;  3QIN A;  1OH8 A;  4CJS A;  2E20 A;  1E4G T;  3OBW A;  1ATN A;  4CJQ A;  4DQI A;  3HPG A;  5C24 A;  1JLA A;  3DLH A;  3U6F A;  1X3N A;  2O4I A;  4O5F A;  1TK8 A;  4O0J A;  2PZS A;  4KHQ A;  1NG9 A;  1Z25 A;  3ZYY X;  4Z0U A;  4M41 A;  2B5J A;  3SMS A;  4FK0 A;  1JL2 A;  3MDQ A;  3JS6 A;  1U48 A;  4JHD B;  4KH5 A;  4JRP A;  3H08 A;  3RRG A;  2YHY A;  5CR4 A;  3D2F B;  2HST A;  3D6R A;  2HHT A;  3ZSX A;  3ZSW A;  1GLL O;  1S9G A;  4DHY A;  4TSX A;  2Y1J A;  4JI8 K;  1KXP A;  3I33 A;  1Y97 A;  1QSS A;  1C0G A;  1Q81 O;  4JRQ A;  3H46 O;  1EET A;  1S1V A;  3A0I X;  1O1W A;  4FZX C;  2NNW A;  3O4N A;  3TSU A;  3ZSR A;  4E89 A;  4KTW A;  4QS9 A;  3DRS A;  1MWM A;  5I3U A;  3LDL A;  4BRP A;  4KB0 A;  4B1X B;  3CER A;  4H0X B;  3C7N B;  3ZET B;  3U9Z A;  4DU3 A;  1C0T A;  5KTQ A;  4KI4 A;  2E8A A;  1T6C A;  4A2A A;  1YIJ N;  3SMP A;  3VQP A;  4FJL A;  3UKR B;  3BP8 A;  3DLE A;  1NGA A;  3RMB A;  3MN5 A;  2HW3 A;  1RBS A;  1BOT O;  4B9T A;  3M8Q A;  3LWM A;  1RT4 A;  1IBL K;  4DR5 K;  5SZT A;  1VSK A;  3OS1 A;  4KTZ A;  3T19 A;  3OTO K;  1K8A O;  1BWF O;  3HRG A;  3QML A;  2JWL A;  1KVC A;  4BVP A;  3SQ1 A;  4KFB A;  4Y0W A;  3U9D A;  3KLG A;  3THV A;  2QWN A;  4M7Y A;  5K14 A;  3EL2 A;  4BDP A;  5HLF A;  5JVH L;  1HUX A;  3SBG A;  1TV6 A;  4X64 K;  1DGK N;  3SV4 A;  1B92 A;  3CQ8 A;  4DSF A;  3WQT A;  1HR0 K;  3SYZ A;  2EWS A;  1HNW K;  1Q18 A;  2NLX A;  5EOY A;  2Z1J A;  3AA5 X;  4AHS A;  1RT5 A;  2BAN A;  1QQO A;  3AA3 A;  3LWL A;  2HHS A;  2ZF5 O;  4LF5 K;  3PY8 A;  3TSP A;  4WQ5 C;  3KLI A;  2E1Z A;  4KTQ A;  3M3Z A;  4BRF A;  3KZB A;  1CZB A;  4B1Y B;  2FSK A;  3VQ7 A;  2O4G A;  1HNX K;  2BGG A;  3JAM O;  4NCB A;  4X65 K;  3THY A;  4ELV A;  4DTM A;  3J7A P;  3NBP A;  1HYV A;  3ENB A;  3KLF A;  1RT2 A;  1YIT N;  3QIC A;  4CJ4 A;  3MWP A;  2WBN A;  2LSN A;  2FXU A;  4BRC A;  3TAE A;  2VGN A;  1BU6 O;  4YHH K;  3AVG A;  3CM5 A;  1NK9 A;  5KRT A;  4ILH A;  1XNR K;  3CCE N;  3KLE A;  4H0V B;  2IAJ A;  3A8Y A;  4CFB A;  2KKZ A;  4YY3 K;  4NCG A;  4Z4C A;  4YNQ A;  1FW6 A;  1XC9 A;  3J80 O;  4LF8 K;  3K57 A;  5BR9 A;  3VEN A;  3D45 A;  1ZBH A;  3THX B;  3EYZ A;  4I6M B;  4FZZ A;  2ZD1 A;  4JS4 A;  3LP3 A;  2GV9 A;  1XHX A;  3V9W A;  3ZSY A;  4RCH A;  1REV A;  5AQP A;  4L8R B;  4FOE A;  3ZSV A;  4F2S A;  3MX5 A;  4DB3 A;  1MU2 A;  1YI2 N;  1IBM K;  1YXQ A;  3LAM A;  3CIP A;  3SCX A;  5AZI B;  4FLZ A;  4MLE A;  4C8M A;  4DG1 A;  3PUF A;  1VQ9 N;  4FK2 A;  4AM6 A;  4Z4H A;  3V4I A;  4IDK A;  5EVZ A;  4U7B A;  3SJJ A;  4RW6 A;  3S3N A;  3HM9 A;  5GAE P;  3WEE A;  5AQS A;  2VQE K;  1OH7 A;  2V7Z A;  4M3Z A;  3RSE A;  3D7E O;  4QCL A;  3QES A;  3AVF A;  3WT0 A;  2GTD A;  3KKS A;  3OYI A;  3HP6 A;  2KZM A;  2QWO A;  4KKO A;  1S6Q A;  4BRM A;  4BVO A;  1HPZ A;  1WN7 A;  4DV0 K;  2W40 A;  4A2B A;  3O9S A;  3F9M A;  2ASO A;  1OVY A;  4A59 A;  3THW A;  1YTA A;  1Q8I A;  2HBM A;  4PHT X;  2XY7 A;  1RIL A;  3I56 N;  4OPJ A;  3TTF A;  2KTQ A;  4OKE A;  4NYF A;  5EX5 A;  1L3T A;  4BGA A;  4O4G A;  2YKN A;  3AVN A;  4FJ5 A;  3WXJ A;  2Q2R A;  3VQ6 A;  1UWB A;  3VOV A;  1WLJ A;  1NGD A;  3HO1 A;  1G99 A;  1U2V A;  5JS1 A;  3OYJ A;  3CC4 N;  4B1Z A;  4WF9 L;  1IKY A;  3K5L A;  3AA4 A;  1YJW N;  3O3G A;  5AZJ A;  3DRP A;  1NK4 A;  1E3M A;  1RTH A;  3OYH A;  3AVB A;  1RDB A;  3MWT A;  5FLX O;  4BR7 A;  3E9O A;  4DR4 K;  2KLA A;  4J2D A;  4LD0 A;  2V7Y A;  5JMV A;  2XY5 A;  5LL6 Z;  3K0S A;  1B9D A;  1JCF A;  2G8U A;  1DKG D;  4F4K A;  1W97 L;  5AQJ A;  2O8F A;  3C65 A;  4N76 A;  5AQX A;  3PIO L;  3CM6 A;  3KK3 A;  4DTR A;  4LSL A;  3TR8 A;  2D1K A;  1SQK A;  4JI4 K;  4B9N A;  1N8R O;  4Z94 A;  3CC2 N;  4CZH A;  4KHY A;  1YHQ N;  1TK0 A;  1K73 O;  1ASU A;  3A5O C;  4M3W A;  2W6L A;  4HCC A;  4ISF A;  3LDS A;  3L4Q A;  1QZ5 A;  2BTF A;  3VQ4 A;  3A5L C;  3KWI A;  4B9U A;  3CCJ N;  3VF4 A;  3TPQ A;  3AAP A;  3VQ8 A;  2Z1I A;  4CK2 A;  3R8E A;  5KPZ A;  3VA0 A;  3J81 O;  1LAV A;  2D4W A;  4CIF A;  2GX9 A;  5AQQ A;  3L2U A;  1IKV A;  3VF2 A;  5KPT A;  1KVB A;  4UQG A;  2FLO A;  3GG4 A;  4IOX A;  2YI1 A;  3CJ1 A;  5KGX A;  2H3G X;  4B3S K;  4ICL A;  3O9U A;  1TUY A;  3SAG A;  4KH4 A;  1UA1 A;  1SV5 A;  3ZT1 A;  3ENO A;  2PBD A;  4NB4 A;  4CEF A;  4MQ3 A;  3OYN A;  3RTV A;  4N47 A;  4E7J A;  3H3O B;  3OJU A;  2OTJ N;  1BQN A;  3AVM A;  3MXM A;  1U49 A;  3HJF A;  5DMR A;  3DJC A;  3CCQ N;  3O1W A;  4LSN A;  4CZF A;  3HM8 A;  2UXD K;  3K5N A;  3VTI A;  1NJY A;  1SL0 A;  4FLX A;  3KIO A;  4RTF D;  1RT3 A;  1TAQ A;  4HUG A;  4DF8 A;  4GW6 A;  4I7F A;  4GY2 B;  1Q7Y O;  2YJF A;  3MN7 A;  2VWB A;  3L8B A;  4K8X A;  4DTP A;  4JV5 K;  3ATU A;  3ULD A;  1Y64 A;  3VEY A;  3HBT A;  3M5R A;  4FWO A;  4CD1 A;  4QOZ B;  4W5O A;  3HPO A;  2OPP A;  3Q7C A;  2O8D B;  3CHW A;  3SJH A;  4H0T B;  2F7T A;  3HT3 A;  3CFR A;  3THY B;  5FPM A;  1BQM A;  3VQD A;  3PO4 A;  4KAZ A;  5M1O A;  1L3U A;  4G1Q A;  5BR8 K;  3G4S N;  4FXD A;  1RBU A;  1XWL A;  3C6H A;  4FWS A;  3EE8 A;  4CJV A;  3VES A;  3TAP A;  2EHG A;  2W41 A;  4DV7 K;  1C0U A;  5AR0 A;  3ATV A;  3D2E A;  3CCU N;  1QVG M;  3NF8 A;  1NK6 A;  3QNO A;  1RDA A;  3CCS N;  4J2B A;  3ID6 A;  1YJN N;  2EX3 A;  3DLG A;  2QXL A;  1KAY A;  2P1J A;  1WOQ A;  1WSI A;  3RR8 A;  5FDL A;  1RDD A;  4DCH A;  2P51 A;  3QFP A;  2NRT A;  1VSD A;  1XQS C;  2E6M A;  3R9P A;  3PSI A;  3NH1 A;  4OPH A;  4IXC A;  1K8K A;  2A41 A;  1GLE G;  2XY6 A;  1I39 A;  1CZ9 A;  3WEE B;  4CW7 B;  3LAK A;  5GIN A;  3MXI A;  4B1V A;  1TVR A;  1ITG A;  3ZSQ A;  2JLE A;  4RW4 A;  5HL7 L;  4DSL A;  2Q97 A;  1KFD A;  1HYS A;  1KVA A;  5I42 A;  3OY9 A;  4CJK A;  3ZT4 A;  3ID8 A;  4H0P A;  3VQ9 A;  3P38 A;  4HTU A;  4CJ7 A;  4CGD A;  5JVG L;  2E88 A;  3THW B;  4B9V A;  2HHQ A;  3SQ2 A;  2GBZ A;  1IV0 A;  4RG8 A;  1LV5 A;  1HNI A;  4JS5 A;  5CZ2 A;  1NKC A;  2OPS A;  3LPT A;  4DFM A;  1HNZ K;  3RMA A;  4CFC A;  2BDP A;  4XH1 A;  1KTQ A;  1X3M A;  3KJV A;  4WFB L;  5H1S Q;  3DLR A;  5HP1 A;  4MO4 A;  1RCH A;  4JI5 K;  3CD6 N;  3MEG A;  5HRP A;  4Q5V A;  4FM2 A;  4OKK A;  5AQI A;  4JK9 A;  5MLC Q;  1JLC A;  1ZBU A;  1A5W A;  5KQ8 A;  2ITG A;  3N4P A;  1YT3 A;  1IKW A;  2XO7 A;  3ZSO A;  3HPH A;  2A1S A;  4I9Q A;  3AGK A;  5LY3 A;  2VQF K;  3ZEU A;  2P9P A;  4ELU A;  1C1B A;  4CER A;  2DFE A;  2A3Z A;  4H0O A;  1BO5 O;  4NO7 A;  4JKD A;  1JLG A;  4KH6 A;  1BL3 A;  3O1B A;  1NJX A;  3KLH A;  1LWC A;  4CEE A;  1C6V A;  2XHB A;  2O8F B;  3AVA A;  5DK5 A;  4IZ9 A;  1HYZ A;  2NRZ A;  4GMJ B;  3LDO A;  3LPU A;  2NRV A;  2NRW A;  3WXL A;  1VRT A;  2X6N A;  1ZBI A;  1C1A A;  3SUN A;  3S9H A;  4CEO A;  2OTL N;  3VEZ A;  4IBN A;  2HNZ A;  3M8R A;  4ID1 A;  1TL1 A;  4CJE A;  3TTD A;  4JKB A;  1YF5 L;  3EKS A;  5EXW A;  5ELZ A;  5GAD P;  3DOK A;  1SZ2 A;  3DRR A;  3LM2 A;  1IO2 A;  4DV2 K;  3HZ6 A;  1RGI A;  2OA8 A;  4CGF A;  4W5T A;  1VQ8 N;  1P90 A;  1KCF A;  3CJ7 A;  2KQ2 A;  4B08 A;  4KRF A;  5J2Q A;  1UA0 A;  2ZJQ L;  5J2P A;  5LJW A;  3TAR A;  4AHU A;  3QER A;  1VK0 A;  2HB5 A;  5HRS A;  4B3T K;  3DWL A;  3V9X A;  5CHI A;  4DQQ A;  1EP4 A;  2I7N A;  3O9R A;  3K5M A;  3CC7 N;  1JCG A;  3CMA N;  2QKB A;  4JI3 K;  4CCH A;  5JIC A;  3F9K A;  1NKE A;  3S3O A;  4B8A B;  1N34 K;  4YDU A;  2XRI A;  3C95 A;  4DQR A;  2HVI A;  4JN4 A;  4JKF A;  1VQ7 N;  4KHN A;  1TL3 A;  1S1W A;  4CJL A;  1S22 A;  5SWM A;  1SKS A;  3G25 A;  2F8T A;  1VQN N;  2GWJ A;  2X6S A;  3GDQ A;  4O8K A;  1OVQ A;  1RTJ A;  2O8E A;  1RT6 A;  2A40 A;  3FGU A;  4EHT A;  4B1W B;  3MCP A;  4DSE A;  1T8E A;  3IG1 A;  1HKC A;  1N32 K;  1TAU A;  4BC3 A;  1KSP A;  4OPA A;  1VSM A;  2QWL A;  4IO9 L;  1TKD A;  1BA0 A;  2OPR A;  3DLB A;  4JI7 K;  1XNQ K;  2QWP A;  2ZWH A;  1T44 A;  3IFR A;  4AIL C;  3LL3 A;  5GAG P;  3BDP A;  1A5X A;  4V19 S;  3ZT2 A;  4DS5 A;  1R0A A;  3CXC M;  3AO4 A;  4YOU A;  4OGC A;  4BWJ A;  3ZT3 A;  4C8O A;  4B8C A;  5C15 A;  1ESV A;  4YOX A;  2YHX A;  2OZS A;  2Q0R A;  3D2E B;  4J8F A;  3KTQ A;  1GOB A;  3ZCM A;  4E3S A;  1RBR A;  3M6G A;  3G0Z A;  5AQF A;  3L2Q A;  2XY8 A;  4JKA A;  3EN9 A;  2P5O A;  2HF4 A;  4RWT A;  3WQU A;  2OZM A;  3QBX A;  2OPQ A;  3NVK A;  3HP9 A;  2F9W A;  2B6A A;  1WSF A;  4IO8 A;  3VN5 A;  1CZA N;  2V52 B;  2F8S A;  3CJC A;  3WXI A;  3I8D A;  1NK0 A;  3TSQ A;  2CH5 A;  4FW1 A;  4ID5 A;  2IOC A;  2BE2 A;  4YOY A;  4BR2 A;  1K8K B;  3LP1 A;  3TWH A;  4J2A A;  5GIP A;  3O9Q A;  4FJ8 A;  2E4L A;  3NH2 A;  4RW8 A;  1IBK K;  5KRS A;  3VF6 A;  2Q3S A;  1KRP A;  1LW0 A;  2FSJ A;  2RN2 A;  1QQM A;  1XI1 A;  4CE9 A;  1MDU B;  2HBL A;  4N56 A;  4E7K A;  1S9E A;  2WTU A;  4OJR A;  5AFU A;  4M3U A;  4NLB A;  5J2N A;  1V4S A;  2DFF A;  3PV8 A;  4CZM A;  4CJU A;  3JSM A;  4NCA A;  4BRK A;  2HMI A;  1LWE A;  2YNH A;  4DR1 K;  2V51 B;  4AHC A;  5IT9 O;  3VQC A;  4HVJ A;  4CJR A;  1FKP A;  4WQ4 A;  2UXC K;  3K9K A;  1X9M A;  3DMJ A;  2YX6 A;  3OYL A;  1T05 A;  4FSV A;  4CGJ A;  2IIR A;  2DPN A;  4M7X A;  4CBX A;  4C8L A;  4IFY A;  4LF7 K;  5A2Q O;  2R7Y A;  2PYJ A;  4WYB A;  2UUC K;  4CGH A;  5AQH A;  3C94 A;  4DTJ A;  1WBB A;  5AQR A;  3HK2 A;  4KRE A;  4CZE A;  1NGJ A;  4DSI A;  3HI0 A;  3T1Y K;  4CGI A;  2D0O A;  3OS2 A;  2NRX A;  4HWI A;  4CK3 A;  4FJ9 A;  3G10 A;  3ZEU B;  4FVM A;  3Q7B A;  5EY4 A;  1YTU A;  3NGY A;  2QTD A;  3EO3 A;  1GLJ O;  2P9S B;  2DY4 A;  4CEA A;  4C8N A;  4BE2 A;  4MDA A;  1M1K O;  1MA9 B;  1VSH A;  1RBV A;  4CI6 A;  1EWR A;  3QIP A;  3QEV A;  4R5P A;  1CXQ A;  3MK6 A;  4IJA A;  1W2B M;  2WON A;  4JKC A;  4BRG A;  4YOV A;  3B6P A;  3R3L A;  1NLV A;  1SS6 A;  2E1Y A;  3LP0 A;  3S41 A;  4DV1 K;  5BRD A;  4H5T A;  1ATR A;  3M8S A;  4BRD A;  1IKX A;  2A6A A;  3SPY A;  4BRH A;  2HND A;  2F96 A;  1K9M O;  1RDC A;  3F2K A;  4DKW A;  4H5W A;  1VAZ A;  1IG8 A;  5AQN A;  4LFA K;  3AO5 A;  5F0X A;  1NKB A;  4N41 A;  4AQY K;  1BI4 A;  4JKH A;  2HBK A;  4CBW A;  2VG7 A;  1QHT A;  2UUA K;  1VSI A;  3NF7 A;  1KFS A;  4BQL A;  4LF9 K;  4KBO A;  4DSJ A;  4OX9 K;  4BR0 A;  3CCM N;  5JS2 A;  4O55 A;  1NJI O;  4PL8 A;  1YUW A;  2KW4 A;  3CJA A;  2HHW A;  4M45 A;  1VQO N;  4BWM A;  3OVN A;  1WB9 A;  3OYA A;  1QSL A;  2VG6 A;  3B8A X;  3RVC A;  2FBX A;  3U3Y A;  4EHU A;  2ZQB A;  3L2V A;  4FK4 A;  1S1U A;  3E9L A;  2G8W A;  2GUP A;  3DAW A;  4CVN E;  2VYP A;  4F8R A;  1T6D A;  2HMP A;  4MLH A;  3PO5 A;  3WXK A;  2YCH A;  3LDP A;  1HMV A;  1DTQ A;  1Z26 A;  3SUO A;  1DTT A;  1TYQ A;  1YJ9 N;  3CCV N;  3AVJ A;  4IKF A;  1NOY A;  5EU7 A;  1S5J A;  5CYQ A;  4IEI A;  2PFU A;  3OBY A;  2RE2 A;  2IC3 A;  5E26 A;  4W5N A;  3P5J A;  4LH5 A;  1HQU A;  4AF1 A;  4C8K A;  5M1F A;  4WFA L;  3I55 N;  2FBV A;  3MEE A;  5CY4 A;  1NGH A;  4JEP A;  3SQ0 A;  2ZM6 K;  2D0B A;  3VPZ A;  3IAY A;  4EAH D;  4LF4 K;  4DQP A;  3KK1 A;  1VQ6 N;  3PIP L;  1RDU A;  4FW2 A;  1IJJ A;  1GOA A;  1EQY A;  2A42 A;  4E1N A;  1C0M A;  4K41 A;  3VEV A;  4GV6 A;  4DFP A;  2QWQ A;  3VQE A;  3WNE A;  1QQN A;  3TAG A;  1BCO A;  1WSH A;  3SK3 A;  3K2P A;  2P9I A;  1OH6 A;  1VQ4 N;  2BH1 A;  4EP4 A;  5HRN A;  1WBD A;  3U3G A;  1VQM N;  1DLO A;  2ETJ A;  4FLU A;  2PAV A;  3TTC A;  3L6Q A;  3T69 A;  1YVU A;  3V6D A;  5I9E B;  5C25 A;  5BRE A;  4IFE A;  5BPL A;  4CZG A;  2CGK A;  4ZTF A;  4FJ7 A;  4DV4 K;  4R79 A;  1T3V A;  2BUP A;  1ZXO A;  2QXF A;  3VQ5 A;  1DEJ A;  3NMU A;  3ZX0 A;  3MMV A;  3NHG A;  1TKX A;  4B9M A;  2VGM A;  3CFP A;  4LFB K;  3QFU A;  2FC0 A;  5M1K A;  1LAW A;  4IOA L;  1D5A A;  4YDU C;  1GOC A;  1O13 A;  3CCR N;  2QEX N;  1VSE A;  3AA2 A;  4BC4 A;  3A2F A;  4BDZ A;  5M1Q A;  4F3O A;  4DFK A;  4A5A A;  1WNS A;  1BA1 A;  4FOI A;  4RW7 A;  2IS3 A;  2RF2 A;  4CJ3 A;  3T1H K;  4EZ6 A;  3ZT0 A;  2YHA A;  4JK8 A;  1S1X A;  3EKU A;  1TKZ A;  2WC9 A;  4MO5 A;  5GIO A;  3HTV A;  3PX0 A;  5BN9 A;  1NJW A;  1HQE A;  1X1P A;  3VQB A;  3ZLJ A;  3CI5 A;  4DTS A;  3I8B A;  3RMD A;  4ELT A;  1Q82 O;  4X62 K;  4F3T A;  1VQP N;  3DLL L;  3BGR A;  3C6T A;  4HTL A;  1EWQ A;  2HHU A;  4MDB A;  3F5T A;  3RMC A;  4CEB A;  3WUH A;  4DLE A;  3WNF A;  2P9K A;  4E7H A;  5T7B A;  4Q0B A;  2PY5 A;  3SI6 A;  3QET A;  3DXM A;  4HUF A;  4FVU A;  1C0F A;  3V1R A;  3ULE A;  2G8I A;  1UOC A;  1HRH A;  2CGJ A;  4W5Q A;  3RSE B;  3DYA A;  3U8X A;  4DWI A;  1GLD G;  1RNH A;  1HPM A;  3WXM B;  4G9Z A;  4PY5 A;  5AQO A;  2O8C A;  4KPY A;  3QIO A;  4H4O A;  4GV9 A;  3CPW M;  1NK5 A;  3SUP A;  2A5X A;  4CZK A;  1LOT B;  4O8U A;  3SPZ A;  3O3H A;  3MAQ A;  3RRH A;  1LW2 A;  4N5S A;  2Z1H A;  4PWD A;  4IWV A;  3FFI A;  4C1N K;  1ASV A;  4YOT A;  3HL8 A;  2VWJ A;  4I2P A;  3VQA A;  1VSL A;  2YHB A;  5B8H A;  1HLU A;  5FPD A;  2ASP A;  3NH0 A;  3LZI A;  3KVG A;  2D5R A;  2IVO A;  1U2V B;  4ISG A;  5AQV A;  1K6Y A;  2YKM A;  1CXU A;  4XIU A;  2FSN A;  2WUS A;  4KV8 A;  2HOE A;  1NWK A;  3CFO A;  3NF6 A;  1J5E K;  5AZJ B;  4DS4 A;  4O5B A;  1J6Z A;  4M42 A;  3A5N C;  4CHN A;  4FJG A;  4EFH A;  3HOT A;  4BRN A;  3CJB A;  4JKE A;  4PKH A;  4K43 A;  1D9D A;  1TKT A;  3V1Q A;  3ENH A;  2CGL A;  2NRH A;  3MXJ A;  4OPK A;  1SUQ A;  5M1P A;  4CJT A;  1X9S A;  4WQ4 C;  3O4W A;  1U04 A;  4OLB A;  4FWP A;  2I7P A;  3SZ2 A;  5GAH P;  5C42 A;  1QZ6 A;  3B6O A;  3MN6 A;  4KHP K;  2IDO A;  1QQC A;  3OYK A;  3D0P A;  4BRO A;  4I2Q A;  4F9O A;  5FPE A;  5BPN A;  3LAN A;  1M90 O;  1FJG K;  5F2R A;  5BN8 A;  1NGC A;  5AQY A;  3OYF A;  3FR0 A;  1CLQ A;  4LH4 A;  4DTU A;  4BR5 A;  4KO0 A;  2UYT A;  4BY9 C;  3BUZ B;  3TAM A;  1N33 K;  1XC3 A;  4B9Q A;  3PX6 A;  1B9F A;  1Z05 A;  4M3Y A;  4AH9 A;  3H45 C;  3K9J A;  1TYQ B;  1ILY A;  4YOW A;  3MEC A;  1X9W A;  3AV9 A;  4UY8 O;  2ASM A;  3I0R A;  4JD2 A;  5J1E A;  2P9N A;  3CPE A;  3FZH A;  3NE6 A;  1J54 A;  2X74 A;  1ZBL A;  1L5U A;  4BC5 A;  5C2D A;  2VWK A;  1NBW A;  4BR9 A;  2IVP A;  4O44 A;  3CCL N;  2ZJR L;  5FRM A;  3DM2 A;  3L3V A;  3QO9 A;  1YAG A;  4LFC K;  2P9L A;  1RFQ A;  3MX2 A;  2F9T A;  3ISN C;  4AM7 A;  1H1V A;  4CZL A;  3IKM A;  4AHR A;  1ZYQ A;  1TK5 A;  4M63 C;  3OYE A;  1ASW A;  4DU1 A;  4CIE A;  3NGI A;  1WUA A;  3OHR A;  4H5V A;  3TAB A;  3E9P A;  3KK2 A;  5CE3 A;  3OYG A;  3DXK A;  5ADX A;  4DTN A;  5AFU H;  3ZSZ A;  3NDK A;  5BRF A;  1WSJ A;  4NLC A;  3MED A;  3BF1 A;  2P9I B;  4JI0 K;  3QEI A;  1NMN A;  1T03 A;  4DUZ K;  1OH5 A;  2J4R A;  3UE5 A;  4QS7 A;  4FM1 A;  1TGO A;  4PKG A;  1G15 A;  2OCE A;  3DI6 A;  1RT1 A;  4JNE A;  2AP1 A;  3V9S A;  1GLC G;  1NJZ A;  3O6W A;  4CEQ A;  3BY5 A;  3LP2 A;  3TU5 A;  4OO1 J;  1KD1 O;  4QS8 A;  3OA9 A;  2QK9 A;  3SNN A;  1XMO K;  1QE1 A;  1W0H A;  3R6M A;  1S6P A;  3K58 A;  1KQS M;  4OLA A;  2HHV A;  1MWK A;  3L2W A;  3NFA A;  4C1N I;  4DQ8 A;  3AO3 A;  4GKK K;  4CHZ A;  1HKB A;  5DM7 L;  4E1M A;  5KPR A;  4BRE A;  3CME N;  1QVF M;  4BR4 A;  3L0Q A;  4PL7 A;  5HOO A;  1NGI A;  3F73 A;  4DU4 A;  5HBM A;  4DTO A;  4HHT A;  4DR6 K;  3SUQ A;  1U45 A;  4CHO A;  4NXM K;  3M1F A;  1C1C A;  2HBJ A;  2ZGY A;  3UKU A;  4CJP A;  3C0B A;  2QWM A;  4LF6 K;  5AQU A;  3E66 A;  3T1A A;  2O8B A;  1TUU A;  2G8F A;  3QEW A;  3ALY A;  3P31 A;  4BC2 A;  3J8A A;  4CJW A;  3P83 D;  3NGZ A;  5AQM A;  4XH5 A;  5BPM A;  1BUP A;  1KLM A;  1NOZ A;  3EE9 A;  3K5O A;  4C23 A;  4FWM A;  4CFD A;  3HST B;  2YNG A;  3CJ9 A;  3H3N O;  1I94 K;  3H1Q A;  4U67 L;  4E1J A;  4FLT A;  3QNN A;  3VA3 A;  3AAQ A;  3V1O A;  1XUP O;  1IH7 A;  2P9K B;  3OYD A;  3VTH A;  3N4Q A;  4B9L A;  5AQW A;  3NCI A;  3DXM B;  5C2F A;  3NVM A;  3O3F A;  4CF9 A;  1L3S A;  4CFA A;  4CJF A;  1NK7 A;  2QW9 A;  3ULE B;  3O9T A;  3ZX3 A;  3QBW A;  4YOR A;  4FJH A;  4K8Z A;  3I0S A;  1Z6R A;  2KZZ A;  4FYD A;  4H4M A;  4LY7 A;  4CHP A;  3P1G A;  3VET A;  3V9U A;  2O8D A;  4EIA A;  4DQS A;  5C12 A;  3KK7 A;  2G8V A;  2O8C B;  2D0A A;  4JKG A;  1VHX A;  4L3Q A;  3CF5 L;  1ATS A;  4M3R A;  5AQL A;  4CEZ A;  4OVL A;  5TKY A;  2E2O A;  4CBU A;  4CES A;  3EZW A;  5E84 A;  3CQY A;  2GUI A;  1WSE A;  3JXU A;  4FJN A;  1OKJ A;  3RR7 A;  4DV5 K;  1WSG A;  2CH6 A;  4CF8 A;  1D4X A;  1SL2 A;  5E41 A;  2HHX A;  1FXX A;  4DR7 K;  4CK1 A;  4H5R A;  1ZBF A;  1KAZ A;  4BRI A;  1S1T A;  4IG3 A;  2VG5 A;  1NGF A;  4WCE L;  3BEX A;  3LDN A;  3W3D A;  5AJ3 K;  4FJM A;  1VQK N;  4KB1 A;  3T7Z A;  4FJJ A;  1NNE A;  4E0D A;  2P9U A;  4A61 A;  4KHS A;  4GKJ K;  1RDW X;  4KHW A;  2GEM A;  2W6K A;  3AO1 A;  4JK7 A;  1IG9 A;  3OJS A;  5FRN A;  3HSC A;  5M1N A;  4ZTJ A;  1EXQ A;  2P9P B;  3R1X A;  5F1X A;  3C6U A;  3MCA B;  1S72 N;  3ASM A;  1WAF A;  1S3X A;  4BRQ A;  4E7L A;  4IFV A;  3AGR A;  4CGG A;  4DV3 K;  3DLK A;  4GVE A;  5D3G A;  4JYA K;  3QEP A;  3AVI A;  3OYM A;  3KD1 E;  3SQ4 A;  4HCB A;  2JWK A;  2KFN A;  4DFJ A;  1JKH A;  1JLF A;  2VCP A;  2I5J A;  3BZC A;  1D8Y A;  1XHZ A;  4FPB A;  4CIG A;  4A57 A;  2G8K A;  2ZGZ A;  4E19 A;  1NGG A;  4FWQ A;  3FFK B;  4WE1 A;  2X78 A;  3SAH A;  3O8M A;  4Z4I A;  4FPA A;  4IG0 A;  3PSF A;  1JCE A;  4FWN A;  3VGM A;  2WOM A;  3MN9 A;  5AQG A;  3AVK A;  5BRH A;  4DUY K;  4JD2 B;  4W5R A;  2P9N B;  2RKI A;  5KI6 A;  1NGB A;  4AHT A;  4FLV A;  1HX1 A;  3KKR A;  1D9F A;  2ATQ A;  5CYM A;  3AAR A;  3NF9 A;  3O80 A;  1LWF A;  1SL1 A;  1N6Q A;  4FZY A;  1DT9 A;  1T7P A;  3ITH A;  1L3V A;  3SV3 A;  2UU9 K;  4DTX A;  1QSY A;  2P9L B;  4PKI A;  2UXB K;  4ISE A;  4DR3 K;  1VSJ A;  4FLY A;  3LAL A;  3QEX A;  2Q31 A;  1GLA G;  3L3U A;  2F4V K;  2FF3 B;  1EKE A;  1U6Z A;  5J2M A;  4BDY A;  4IJN A;  3CQX A;  4ZHR A;  3E1Y A;  3DXK B;  1KLN A;  3V81 A;  3RWU A;  1E4F T;  4PQU A;  4M3T A;  4BE0 A;  2RPI A;  2G8H A;  2YJE A;  1JL1 A;  4H03 B;  5FPN A;  1JLE A;  1BIU A;  1NM1 A;  5LMU K;  2O8E B;  4Y1C A;  4FCY A;  4EZ9 A;  2E6L A;  2FBT A;  4O0I A;  2P5G A;  4K0K K;  3H1V X;  4B9S A;  2WFB A;  1SKR A;  2NZT A;  4XEI A;  3HVR A;  1JJ2 M;  4FJK A;  1BCM A;  2YNF A;  3T3F A;  2ITM A;  3J7Z O;  1ZBS A;  2E2Q A;  4JHD A;  1I3A A;  3J7Y P;  4DLG A;  3FZM A;  4Z4E A;  2YNI A;  3LM9 A;  3D2F A;  3SAF A;  2QI2 A;  3QLH A;  2NUB A;  4CEC A;  3W0L A;  4Y1D A;  3VGL A;  4BGB A;  3UKU B;  3NAE A;  3HXM A;  2NRR A;  1BIS A;  4JAX A;  2A1R A;  3EEQ A;  1U47 A;  4Z4F A;  1RTD A;  3OYB A;  3HYF A;  5AQT A;  2E2P A;  2O8B B;  4WQ5 A;  4CJ5 A;  4H0Y B;  4IDH A;  5C0Y A;  4H8K A;  2ZE2 A;  2QM1 A;  3AY9 A;  3TAQ A;  4B3M K;  2ZJP L;  3H6E A;  3QB0 A;  4YFU A;  3K59 A;  4FO0 A;  1SKW A;  1FK9 A;  4A5B A;  4AHV A;  4BE1 A;  2PYL A;  5JLH A;  3L4I A;  3E01 A;  1VSF A;  3PX4 A;  3C7N A;  3ZET A;  4DF4 A;  1X9J A;  4KHU A;  3FZL A;  3IMX A;  1QHA A;  4QAG A;  2HHH K;  2KHO A;  1HJR A;  3CET A;  4MFB A;  3P4I A;  3UKR A;  1FKO A;  4FL9 A;  2QA4 N;  4IEE A;  4CED A;  5KQD A;  3HOS A;  1QTM A;  1J53 A;  1NU0 A;  1ZC6 A;  2E2N A;  1BGX T;  3UIQ A;  1NK8 A;  4A62 A;  3VEO A;  4HUE A;  3CYM A;  3S3M A;  4DSK A;  4NXN K;  2KFZ A;  4EP5 A;  3LZJ A;  3IUC A;  1EO1 A;  1P8Z A;  3AVC A;  1N5Y A;  2AJQ A;  4X66 K;  3EZ5 A;  1Q86 O;  4CZI A;  3TAN A;  2B4J A;  2GEL A;  2QWR A;  4JI2 K;  4JKG B;  1N36 K;  1Q9Y A;  1R59 O;  3M8P A;  3EY1 A;  5LMN K;  3O4Q A;  4FM0 A;  1RBT A;  4K25 A;  4NYN A;  5FRO A;  1BG3 A;  3G6E N;  4BAC A;  4GVM A;  5CZ1 A;  5LJV A;  5DM6 L;  4CD3 A;  3TI0 A;  1JXE A;  3KHY A;  1V4T A;  1HKG A;  4FJI A;  3WNG A;  4OGE A;  5C10 A;  1U4B A;  4CF0 A;  3OW2 M;  4BRA A;  4JLH A;  4OKJ A;  2OAN A;  4PA1 A;  2HF3 A;  4E7I A;  1VQ5 N;  3A5M C;  2UUB K;  3FZF A;  4B3R K;  3VGK A;  3V9Z A;  3VEW A;  4IOC L;  2P9U B;  1KC8 O;  5AQK A;  1VQL N;  1WAJ A;  1F21 A;  3IRX A;  3GBT A;  3U4L A;  3GL1 A;  3PLA A;  1GLB G;  2AA4 A;  1JLB A;  4ILJ A;  3JYT A;  4J2E A;  2YHW A;  3QDK A;  3SBT A;  4CHQ A;  1XMQ K;  3P39 A;  4CZJ A;  2HVH A;  2IGI A;  1EX4 A;  2E5L K;  3SLC A;  1QS4 A;  4I9L A;  2OYQ A;  2Z1G A;  1A5V A;  1JLQ A;  4B1U B;  1GLF O;  2GWK A;  4CF1 A;  4FLW A;  2Q1N A;  3OYC A;  3AVH A;  1VRU A;  1KAX A;  1SAZ A;  2QKK A;  2W42 A;  1NMD A;  1BDG A;  5ADX H;  2DTU A;  3O5B A;  1J9A A;  4K42 A;  4KI6 A;  5HRR A;  4JI1 K;  3THX A;  3AO2 A;  3WNH A;  4I6M A;  4BG9 A;  4BQZ A;  3GOI A;  5KGW A;  4CHY A;  4F2R A;  4DV6 K;  4B3O A;  4ILG B;  1BHL A;  5IWA K;  4FJX A;  4XH4 A;  3TAF A;  1J5O A;  1LCU A;  3OS0 A;  1Q9X A;  4GV3 A;  2HNY A;  2Y1I A;  1YVN A;  4WFN L;  3G71 N;  3VMF B;  1BI4 B;  4FWL A;  1W9H A;  5AZI A;  2JGU A;  3IS9 A;  3KD5 E;  4FWK A;  4CF2 A;  4GNI A;  3L2R A;  4DMN A;  1BIZ A;  4RW9 A;  2RHK A;  4H5N A;  3BZK A;  1HJO A;  3CG7 A;  5AQZ A;  3FLC O;  2FF6 A;  3FZK A;  3DOL A;  5JLF A;  2DFH A;  4M3X A;  3FE1 A;  3VQQ A;  3ZX2 A;  5HRO A;  2D0C A;  3KWG A;  4LC9 B;  5TKW A;  3UB5 A;  1NGE A;  2Q0U A;  3LDQ A;  1RTI A;  3BF3 A;  3HVT A;  3O08 A;  2FBY A;  4BRL A;  4Z4G A;  3AVL A;  1JXB A;  1UAX A;  4JI6 K;  3GE1 A;  2D0P A;  2P9S A;  1RT7 A;  2Q36 A;  1HNV A;  3VER A;  3C6A A;  4DR2 K;  1W7A A;  3IDH A;  4PUO A;  4BG8 A; 
#chains in the Genus database with same CATH homology
 3C6H A;  3VTH A;  4BR0 A;  3CCM N;  3N4Q A;  4FWR A;  4FWS A;  3VEX A;  2IVN A;  1NJI O;  3EE8 A;  4PL8 A;  1YUW A;  3CJA A;  3DXM B;  5AQW A;  3VES A;  2E20 A;  5C2F A;  1E4G T;  3NVM A;  1ATN A;  3OBW A;  2W41 A;  1VQO N;  5AR0 A;  2QW9 A;  3ULE B;  3ATV A;  3D2E A;  3O9T A;  3ZX3 A;  3QBW A;  4YOR A;  1X3N A;  3B8A X;  4O5F A;  3RVC A;  1Z6R A;  3CCU N;  1QVG M;  3VET A;  4EHU A;  3CCS N;  4EIA A;  3ID6 A;  3ZYY X;  3E9L A;  5C12 A;  1YJN N;  2GUP A;  3SMS A;  3KK7 A;  3DAW A;  3MDQ A;  2VYP A;  3JS6 A;  4JHD B;  1T6D A;  2QXL A;  4KH5 A;  4JKG A;  1KAY A;  4L3Q A;  3CF5 L;  2HMP A;  1ATS A;  2YHY A;  5AQL A;  5CR4 A;  3D2F B;  2HST A;  4MLH A;  1WOQ A;  5TKY A;  2E2O A;  4CBU A;  3WXK A;  2YCH A;  3EZW A;  3LDP A;  3D6R A;  5E84 A;  4DCH A;  3QFP A;  2NRT A;  1GLL O;  1TYQ A;  1XQS C;  3CQY A;  3JXU A;  1YJ9 N;  3R9P A;  4DHY A;  3CCV N;  4OPH A;  1KXP A;  1OKJ A;  1K8K A;  4IXC A;  2A41 A;  3I33 A;  2CH6 A;  1D4X A;  2PFU A;  1GLE G;  1C0G A;  3OBY A;  4IEI A;  2RE2 A;  1Q81 O;  3H46 O;  5E26 A;  3WEE B;  5GIN A;  3A0I X;  4AF1 A;  4B1V A;  4H5R A;  5M1F A;  4WFA L;  3I55 N;  1KAZ A;  4BRI A;  5HL7 L;  2NNW A;  2Q97 A;  1NGH A;  4JEP A;  3TSU A;  4WCE L;  1NGF A;  3BEX A;  3LDN A;  3W3D A;  4QS9 A;  3VPZ A;  1VQK N;  3T7Z A;  4EAH D;  1MWM A;  3ID8 A;  4H0P A;  3LDL A;  2P9U A;  4A61 A;  4BRP A;  3P38 A;  3PIP L;  1VQ6 N;  1RDU A;  1RDW X;  4CJ7 A;  4B1X B;  1IJJ A;  3CER A;  1EQY A;  4H0X B;  2GEM A;  2A42 A;  3C7N B;  4JK7 A;  3ZET B;  5JVG L;  3U9Z A;  2E88 A;  4K41 A;  3VEV A;  3HSC A;  4GV6 A;  2QWQ A;  5M1N A;  1QQN A;  2E8A A;  1T6C A;  2P9P B;  4A2A A;  3SMP A;  1YIJ N;  3R1X A;  5F1X A;  1VQ4 N;  3MCA B;  3SK3 A;  2P9I A;  3BP8 A;  3UKR B;  1S72 N;  2BH1 A;  1NGA A;  3MN5 A;  1VQM N;  1BOT O;  1S3X A;  4BRQ A;  2PAV A;  3AGR A;  3TTC A;  3L6Q A;  4XH1 A;  1X3M A;  4GVE A;  4WFB L;  3T69 A;  5I9E B;  5BRE A;  1K8A O;  1BWF O;  3HRG A;  3QML A;  4IFE A;  2CGK A;  4CZG A;  5BPL A;  5H1S Q;  2JWK A;  2JWL A;  4BVP A;  4R79 A;  4MO4 A;  4Y0W A;  3U9D A;  3CD6 N;  2VCP A;  2BUP A;  1T3V A;  1ZXO A;  5AQI A;  4JK9 A;  2QWN A;  5MLC Q;  4FPB A;  4M7Y A;  4A57 A;  3EL2 A;  5KQ8 A;  2ZGZ A;  1DEJ A;  3N4P A;  3NMU A;  3ZX0 A;  1NGG A;  4FWQ A;  3FFK B;  3MMV A;  5JVH L;  3SAH A;  1HUX A;  3O8M A;  3SBG A;  2VGM A;  4FPA A;  3AGK A;  3QFU A;  1DGK N;  5LY3 A;  5M1K A;  3ZEU A;  4IOA L;  2P9P A;  3WQT A;  1JCE A;  4YDU C;  4FWN A;  2A3Z A;  2EWS A;  4H0O A;  3VGM A;  1BO5 O;  3MN9 A;  5AQG A;  4NO7 A;  1Q18 A;  2NLX A;  4JKD A;  4KH6 A;  5EOY A;  5BRH A;  3O1B A;  4JD2 B;  1O13 A;  3CCR N;  2QEX N;  2P9N B;  1QQO A;  4BC4 A;  1NGB A;  1HX1 A;  5M1Q A;  4A5A A;  4IZ9 A;  3AAR A;  1BA1 A;  4FOI A;  2NRZ A;  2ZF5 O;  3LDO A;  3O80 A;  2NRV A;  2NRW A;  1DT9 A;  3WXL A;  4JK8 A;  3EKU A;  4MO5 A;  2WC9 A;  4WQ5 C;  3TSP A;  5GIO A;  2E1Z A;  2P9L B;  3HTV A;  3M3Z A;  4PKI A;  3KZB A;  4BRF A;  3VEZ A;  2OTL N;  1QVF M;  5BN9 A;  4ISE A;  3CI5 A;  3TTD A;  4JKB A;  1YF5 L;  3I8B A;  3EKS A;  5EXW A;  5ELZ A;  4B1Y B;  5GAD P;  2Q31 A;  1SZ2 A;  2FSK A;  1GLA G;  1Q82 O;  3LM2 A;  2FF3 B;  1VQP N;  1U6Z A;  3DLL L;  3HZ6 A;  4IJN A;  1RGI A;  3CQX A;  3E1Y A;  3DXK B;  4HTL A;  4MDB A;  3F5T A;  1VQ8 N;  1P90 A;  1E4F T;  3ENB A;  3CJ7 A;  1YIT N;  3QIC A;  3MWP A;  2WBN A;  2FXU A;  4BRC A;  2VGN A;  1BU6 O;  3WUH A;  2P9K A;  2YJE A;  4H03 B;  5FPN A;  2ZJQ L;  4ILH A;  5LJW A;  3CCE N;  4H0V B;  1NM1 A;  3A8Y A;  2KKZ A;  3DXM A;  3DWL A;  4FVU A;  1C0F A;  5BR9 A;  3ULE A;  5CHI A;  3VEN A;  2I7N A;  3O9R A;  4I6M B;  2CGJ A;  3H1V X;  2WFB A;  2NZT A;  4XEI A;  3RSE B;  3U8X A;  3CC7 N;  1JJ2 M;  4RCH A;  1JCG A;  1GLD G;  3CMA N;  1HPM A;  3WXM B;  5JIC A;  4G9Z A;  5AQP A;  5AQO A;  2ITM A;  3J7Z O;  1ZBS A;  2E2Q A;  4FOE A;  4JHD A;  3MX5 A;  4DB3 A;  1YI2 N;  1YXQ A;  4YDU A;  3FZM A;  3CIP A;  4JN4 A;  4GV9 A;  3CPW M;  4JKF A;  2A5X A;  5AZI B;  1LOT B;  4CZK A;  1VQ7 N;  4O8U A;  1S22 A;  3LM9 A;  4MLE A;  3D2F A;  3SAF A;  3G25 A;  2QI2 A;  1VQ9 N;  3W0L A;  1VQN N;  2GWJ A;  3VGL A;  3GDQ A;  4O8K A;  4AM6 A;  4IWV A;  4BGB A;  3UKU B;  2NRR A;  4C1N K;  5EVZ A;  4JAX A;  4YOT A;  4U7B A;  2A40 A;  5AQT A;  3FGU A;  2E2P A;  4EHT A;  4B1W B;  4WQ5 A;  3MCP A;  5GAE P;  3WEE A;  4H0Y B;  5AQS A;  2V7Z A;  5B8H A;  4IDH A;  5C0Y A;  1HLU A;  5FPD A;  2ASP A;  3RSE A;  3D7E O;  1HKC A;  2QM1 A;  3AY9 A;  3WT0 A;  3KVG A;  2GTD A;  4BC3 A;  2ZJP L;  2IVO A;  3H6E A;  3QB0 A;  4OPA A;  1U2V B;  4FO0 A;  4ISG A;  5AQV A;  2QWL A;  2FSN A;  4IO9 L;  2WUS A;  2HOE A;  1NWK A;  2QWO A;  4A5B A;  4BRM A;  5AZJ B;  4BVO A;  1BA0 A;  1J6Z A;  2W40 A;  3A5N C;  5JLH A;  4A2B A;  2QWP A;  3O9S A;  3L4I A;  2ZWH A;  3F9M A;  1T44 A;  2ASO A;  3IFR A;  3C7N A;  4EFH A;  1OVY A;  3HOT A;  3ZET A;  4BRN A;  3CJB A;  4JKE A;  3LL3 A;  5GAG P;  4A59 A;  1X9J A;  4PKH A;  3FZL A;  4K43 A;  3IMX A;  1QHA A;  2HBM A;  2KHO A;  4PHT X;  3ENH A;  3I56 N;  3CET A;  2CGL A;  2NRH A;  3TTF A;  3CXC M;  4YOU A;  5M1P A;  3P4I A;  5EX5 A;  3UKR A;  4FL9 A;  5C15 A;  2QA4 N;  4WQ4 C;  3O4W A;  1ESV A;  4IEE A;  4FWP A;  2I7P A;  4BGA A;  5KQD A;  3HOS A;  4YOX A;  1ZC6 A;  2YHX A;  2E2N A;  2Q0R A;  3D2E B;  4J8F A;  5GAH P;  1QZ6 A;  3WXJ A;  2Q2R A;  3MN6 A;  4A62 A;  3VEO A;  3VOV A;  3M6G A;  1NGD A;  4BRO A;  3IUC A;  4F9O A;  1P8Z A;  1G99 A;  1EO1 A;  1U2V A;  5AQF A;  5FPE A;  3CC4 N;  4JKA A;  5BPN A;  1M90 O;  4B1Z A;  5F2R A;  3EN9 A;  4WF9 L;  2HF4 A;  5BN8 A;  1NGC A;  4RWT A;  5AQY A;  3WQU A;  1YJW N;  1Q86 O;  3FR0 A;  3QBX A;  4CZI A;  5AZJ A;  3NVK A;  2F9W A;  2GEL A;  2QWR A;  4IO8 A;  4JKG B;  1CZA N;  3MWT A;  1R59 O;  2V52 B;  4BR5 A;  2UYT A;  4BY9 C;  3CJC A;  3WXI A;  3BUZ B;  4K25 A;  4BR7 A;  3E9O A;  1XC3 A;  3TSQ A;  4B9Q A;  1Z05 A;  1BG3 A;  2CH5 A;  3G6E N;  2KLA A;  3H45 C;  3K9J A;  1TYQ B;  1ILY A;  4YOW A;  4YOY A;  5LJV A;  4BR2 A;  5DM6 L;  4CD3 A;  2V7Y A;  5JMV A;  1K8K B;  3KHY A;  4UY8 O;  2ASM A;  1HKG A;  1V4T A;  4JD2 A;  5GIP A;  3O9Q A;  1JCF A;  5C10 A;  1DKG D;  2P9N A;  3CPE A;  1W97 L;  3FZH A;  5AQJ A;  3VF6 A;  3C65 A;  5AQX A;  3PIO L;  4BC5 A;  5C2D A;  2FSJ A;  3OW2 M;  4BRA A;  1QQM A;  2D1K A;  1NBW A;  4BR9 A;  1MDU B;  2IVP A;  1SQK A;  2HBL A;  3CCL N;  1N8R O;  4Z94 A;  2ZJR L;  2OAN A;  4CZH A;  3CC2 N;  2HF3 A;  1VQ5 N;  3A5M C;  5AFU A;  1YHQ N;  1YAG A;  2P9L A;  3FZF A;  4NLB A;  1K73 O;  1V4S A;  1RFQ A;  3MX2 A;  4CZM A;  2F9T A;  3VGK A;  3A5O C;  1H1V A;  4AM7 A;  3VEW A;  4CZL A;  4IOC L;  2P9U B;  3IKM A;  1KC8 O;  5AQK A;  1VQL N;  4ISF A;  4M63 C;  4BRK A;  3GBT A;  3U4L A;  3GL1 A;  3PLA A;  1GLB G;  3L4Q A;  1QZ5 A;  1WUA A;  2AA4 A;  2BTF A;  3OHR A;  4H5V A;  4ILJ A;  3A5L C;  3KWI A;  3E9P A;  3CCJ N;  2V51 B;  3VF4 A;  5CE3 A;  3DXK A;  5ADX A;  5AFU H;  2YHW A;  3QDK A;  3TPQ A;  3AAP A;  5BRF A;  3SBT A;  4NLC A;  3P39 A;  3R8E A;  4CZJ A;  3BF1 A;  2P9I B;  5KPZ A;  4WQ4 A;  3SLC A;  2J4R A;  3UE5 A;  2D4W A;  3K9K A;  2GX9 A;  4QS7 A;  5AQQ A;  2YX6 A;  4B1U B;  1GLF O;  2GWK A;  4PKG A;  4FSV A;  2IIR A;  2Q1N A;  2DPN A;  4M7X A;  3VF2 A;  4CBX A;  5KPT A;  4JNE A;  2AP1 A;  1GLC G;  1KAX A;  1SAZ A;  3O6W A;  1NMD A;  2FLO A;  1BDG A;  4WYB A;  5ADX H;  3O5B A;  3TU5 A;  5AQH A;  3GG4 A;  4IOX A;  4K42 A;  2YI1 A;  4OO1 J;  3CJ1 A;  4QS8 A;  2H3G X;  1KD1 O;  3OA9 A;  3O9U A;  5AQR A;  1TUY A;  4I6M A;  4BG9 A;  4BQZ A;  4CZE A;  3GOI A;  3R6M A;  4KH4 A;  3SAG A;  1KQS M;  1NGJ A;  3HI0 A;  1MWK A;  4ILG B;  4C1N I;  4XH4 A;  3ENO A;  2D0O A;  4DQ8 A;  2NRX A;  2PBD A;  1LCU A;  4HWI A;  4NB4 A;  4GV3 A;  1HKB A;  5DM7 L;  5KPR A;  3ZEU B;  4BRE A;  3CME N;  1YVN A;  3H3O B;  4BR4 A;  3Q7B A;  5EY4 A;  3L0Q A;  4WFN L;  3VMF B;  4PL7 A;  5HOO A;  1NGI A;  3G71 N;  2OTJ N;  4FWL A;  5AZI A;  2QTD A;  3EO3 A;  3DJC A;  3CCQ N;  1GLJ O;  3O1W A;  2P9S B;  3HM8 A;  4CZF A;  3VTI A;  3M1F A;  4FWK A;  2HBJ A;  4GNI A;  4RTF D;  2ZGY A;  4MDA A;  3UKU A;  1M1K O;  1MA9 B;  2RHK A;  4CI6 A;  3C0B A;  4GY2 B;  4H5N A;  2QWM A;  1Q7Y O;  2YJF A;  3MN7 A;  5AQU A;  1HJO A;  3E66 A;  3MK6 A;  4IJA A;  5AQZ A;  3FLC O;  1W2B M;  2FF6 A;  2VWB A;  1TUU A;  4JKC A;  4BRG A;  4YOV A;  3FZK A;  3R3L A;  5JLF A;  1NLV A;  3ATU A;  3P31 A;  4BC2 A;  1SS6 A;  1Y64 A;  2E1Y A;  3FE1 A;  3J8A A;  3S41 A;  3VEY A;  3ZX2 A;  5BRD A;  4H5T A;  1ATR A;  3HBT A;  3M5R A;  4FWO A;  4BRD A;  5AQM A;  2A6A A;  4CD1 A;  4XH5 A;  4BRH A;  3KWG A;  4LC9 B;  1K9M O;  3Q7C A;  5BPM A;  3F2K A;  4DKW A;  5TKW A;  3CHW A;  3SJH A;  4H5W A;  1BUP A;  1VAZ A;  2F7T A;  4H0T B;  1NGE A;  2Q0U A;  3LDQ A;  3BF3 A;  3EE9 A;  3UB5 A;  3O08 A;  1IG8 A;  5AQN A;  4C23 A;  4FWM A;  4BRL A;  5F0X A;  3CJ9 A;  5FPM A;  3H3N O;  3H1Q A;  4U67 L;  4JKH A;  4E1J A;  2HBK A;  4CBW A;  3GE1 A;  2D0P A;  2P9S A;  5M1O A;  3AAQ A;  2Q36 A;  3VER A;  1XUP O;  3G4S N;  3C6A A;  3IDH A;  2P9K B;  4BQL A;  4BG8 A;  4KBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...