2F9WA

Structure of the type iii coaa from pseudomonas aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
249
Chain Sequence
b'SMILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQALPVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWLALVAAHHLAKKACLVIDLGTAVTSDLVAADGVHLGGYICPGMTLMRSQLRTHTRRIRYDDAEARRALASLQPGQATAEAVERGCLLMLRGFVREQYAMACELLGPDCEIFLTGGDAELVRDELAGARIMPDLVFVGLALACPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate Kinase
publication title Prokaryotic Type II and Type III Pantothenate Kinases: The Same Monomer Fold Creates Dimers with Distinct Catalytic Properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 70
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA02
3O5BA 3D2FA 2E2NA 1HKGA 4B1XB 1YAGA 2Q31A 1J6ZA 2GTDA 3VOVA 5AQXA 5AQTA 3WEEB 4IZ9A 5AQUA 4H0TB 3H1QA 3HBTA 2IIRA 3AAPA 4DHYA 1KAXA 2YJFA 3ID8A 3VGMA 3ZX3A 5JMVA 1KXPA 5AR0A 3VESA 5AQNA 3LM2A 3DAWA 1SQKA 1TUUA 4FWSA 3CI5A 2I7PA 1GLFO 2PAVA 4BR0A 3EL2A 1LCUA 3MCPA 3VEOA 5KQDA 2QWNA 3O4WA 5BR9A 5I9EB 2I7NA 2V51B 2P9UA 1NGGA 3SMPA 3HSCA 3M1FA 4ISFA 4BC2A 2E1ZA 5AQMA 3WXJA 3A5NC 3BF1A 3L4IA 1BO5O 4H5TA 2V52B 2NRHA 4CI6A 4CZLA 4Z94A 5AQJA 3VEZA 3ZEUA 1K8KA 3LDPA 3U4LA 3VEVA 4FSVA 5BPNA 2Q1NA 4A2AA 4E1JA 3BP8A 1Y64A 4BC4A 4IJAA 4BVOA 4XEIA 4XH1A 1BG3A 4YDUC 1DKGD 4BGBA 3UKUA 2E20A 2FF3B 3D7EO 3CJCA 2HMPA 3CIPA 3QBXA 4AM7A 1D4XA 3MN9A 4EIAA 1MA9B 4BRGA 2A41A 3C7NA 2QWRA 1NGCA 1GLDG 1TYQB 3MN7A 3ZETA 3ULEB 2GWKA 3I33A 4EHTA 1OKJA 4JD2A 4O8KA 5AQGA 2QWLA 4BRPA 4F9OA 3M3ZA 4CBWA 4H03B 3U9DA 1NGHA 2E8AA 4K42A 2CGJA 3O08A 1BU6O 2ZWHA 4H5VA 3DXKA 4BRNA 5LJWA 4CZIA 5F0XA 4WQ4C 2FF6A 3D2EA 4L3QA 3FFKB 1QHAA 4FWOA 2A5XA 1EQYA 2Q0UA 2GELA 5EOYA 5EVZA 2P9SB 5ADXA 4JN4A 1NGDA 1NGBA 3BUZB 4M7XA 2CH5A 4BRFA 2W40A 4NB4A 2ASOA 1TUYA 4MLHA 3H45C 1RFQA 2VWBA 3R6MA 3FZFA 1ATSA 4FWNA 3H46O 4C23A 1H1VA 4Y0WA 3VF4A 2YHXA 5FPDA 3O1BA 2P9UB 2IVOA 2P9IB 4BR5A 4XH4A 4YDUA 2BUPA 2QWPA 4FWPA 5BN8A 1KAYA 1T6DA 3BF3A 5BRDA 1NBWA 3H3OB 4EFHA 3ZEUB 1ZXOA 5BREA 4CZFA 2NZTA 4B1UB 5AZIA 4JHDA 3UB5A 1NGAA 3HM8A 4A2BA 4I6MA 4WQ5C 1NGJA 3EN9A 3QFUA 5BN9A 2KHOA 4BR2A 4GNIA 1U2VA 1MWMA 3B8AX 4FO0A 3CJAA 4PL7A 4RTFD 5AQZA 3WXKA 2J4RA 2WUSA 3ENHA 3VENA 1NLVA 1BDGA 3O1WA 3C7NB 4LC9B 2P9KA 4H0YB 1HJOA 1Q18A 3DXMA 1YVNA 4WQ4A 3TPQA 2E1YA 3ENOA 3EO3A 4CZGA 4MLEA 5BPLA 2Q2RA 2QXLA 3EKSA 1T6CA 2FXUA 5BRHA 2YHWA 3VPZA 3ATVA 4EHUA 5AQHA 3GG4A 4BQLA 2ASMA 3CQXA 4BRDA 1ZBSA 1QZ5A 2P9LB 3FE1A 5AQYA 3DXKB 3SMSA 3VF2A 2YJEA 4IXCA 4BC5A 2FSNA 3QMLA 1NM1A 2E2PA 4PL8A 1P8ZA 2NLXA 5AZJB 1XC3A 2IVNA 1BWFO 1S3XA 4BRIA 4IO8A 2AP1A 5AQPA 1XQSC 3MK6A 4FWRA 1X3MA 4HWIA 1LOTB 3ATUA 4H0XB 1C0GA 3F9MA 3KZBA 4H5WA 4WQ5A 1DEJA 1GLEG 3L6QA 3LDQA 4PKGA 2P9NA 4H0VB 4BGAA 1MWKA 1GLAG 2CGLA 1GLLO 2HF3A 3RSEA 4BRAA 3LDLA 3W0LA 4A62A 3VEWA 3A5LC 4DQ8A 4MO5A 3UKRB 3TU5A 4FPAA 3ZX0A 2ZF5O 3WEEA 2YHYA 4FWMA 4CZMA 5FPNA 3D2FB 3M6GA 4I6MB 2VYPA 3CETA 4J8FA 5E26A 2QWOA 5AQQA 3SJHA 5FPMA 1SAZA 3KVGA 5JICA 3CJ7A 3QB0A 3ZX2A 3CQYA 4FPBA 4H5NA 1NMDA 3WQUA 3QBWA 2D1KA 1KAZA 1HUXA 4FOIA 1HX1A 5JLHA 2E2QA 2P9PA 2CGKA 1XUPO 3R9PA 4CD1A 1IJJA 4BR4A 4FL9A 3FZHA 5AQOA 3A8YA 3L0QA 3VERA 2CH6A 2HOEA 2OANA 3P4IA 1ATRA 2FLOA 3GBTA 4XH5A 5KPRA 3KHYA 3VEYA 4QS7A 2F9TA 2YCHA 4CJ7A 1V4SA 2A3ZA 3SK3A 3FZMA 1JCGA 3AY9A 4DCHA 3J8AA 1K8KB 1QQOA 3QICA 5AQWA 5F1XA 1R59O 3A5MC 2FSKA 3EZWA 1E4GT 1IG8A 1QZ6A 4B1VA 4BG9A 3WUHA 5LJVA 2QWQA 3GOIA 1YUWA 5AQRA 2YI1A 2GWJA 1NGEA 3UE5A 1NWKA 1GLJO 3UKUB 4A61A 4B1ZA 1HKBA 1TYQA 4B9QA 1ESVA 3ULEA 4GY2B 3W3DA 4BRHA 5AQKA 1SZ2A 3JS6A 3U9ZA 4PKIA 4ISEA 3VF6A 2E2OA 2HF4A 5AQIA 4BVPA 2Q0RA 3AARA 5KQ8A 3ZETB 3S41A 3RSEB 2FSJA 5E84A 5TKYA 1S22A 3A5OC 3IDHA 4JD2B 2DPNA 1X9JA 3GL1A 2PBDA 5ELZA 1DGKN 1JCFA 3HTVA 1BOTO 3MMVA 2AA4A 4JNEA 4ISGA 3CJBA 4CZKA 3FLCO 4BG8A 2QW9A 4KBOA 2P9SA 3LDNA 3D2EB 4O5FA 4CZEA 4EAHD 5FPEA 4AM6A 4CBXA 3WQTA 4HTLA 3QDKA 2Q97A 4B1WB 3IMXA 3MDQA 3U8XA 4M7YA 5B8HA 3JXUA 4IJNA 4BR7A 4BREA 2P9PB 5AQSA 2P9IA 3GDQA 5KPTA 1CZAN 4BC3A 5LY3A 2ASPA 3LL3A 3FR0A 3GE1A 3IUCA 2IVPA 4BRCA 3O8MA 1JCEA 4B1YB 3I8BA 1E4FT 4FWKA 2D0PA 2GUPA 4H5RA 4RCHA 4QS9A 4FOEA 5F2RA 3MN5A 4RWTA 4BRKA 1ZC6A 4FWQA 1RGIA 4BRMA 3FZLA 1QQMA 5AZIB 2Q36A 2A42A 1MDUB 3DJCA 4JHDB 4BROA 1Z6RA 4CBUA 3IFRA 3FZKA 1QQNA 3WXLA 3FGUA 1U2VB 3VEXA 5JLFA 2QWMA 3H3NO 2ZGZA 4IWVA 4BRLA 2V7ZA 1GLCG 1WUAA 5AQFA 1NGFA 1HLUA 2P9KB 3DXMB 5EX5A 3AAQA 2GEMA 1BA1A 1G99A 4FWLA 5KPZA 4NO7A 4H0OA 4WYBA 2P9LA 2ZGYA 3EKUA 2QM1A 5BRFA 3O80A 4CZHA 2F9WA 1NGIA 2EWSA 1V4TA 3QFPA 1U6ZA 3R8EA 3CERA 3VGKA 3CJ1A 1GLBG 3VETA 4CZJA 5AZJA 1WOQA 4DB3A 3WXIA 5EXWA 3C0BA 5CE3A 3CJ9A 4PKHA 3H1VX 3HI0A 4K25A 2ITMA 2D4WA 3HZ6A 3LM9A 2E88A 3CHWA 5AQLA 4BQZA 4JAXA 3DWLA 5BPMA 4QS8A 1BA0A 2H3GX 4K41A 3WT0A 2D0OA 4CD3A 5EY4A 2A6AA 2BTFA 5AFUA 2W41A 3H6EA 5ADXH 1ATNA 4BRQA 4BR9A 2VCPA 3G25A 1C0FA 1YXQA 1X3NA 1Z05A 3LDOA 4MO4A 3VGLA 1RDWX 3SLCA 3MN6A 2V7YA 4H0PA 2UYTA 1HPMA 3OHRA 1BUPA 3A0IX 5AQVA 3O6WA 5AFUH 4K43A 2P9NB 3UKRA 1HKCA 1T44A 4M63C 3BEXA 2A40A
chains in the Genus database with same CATH superfamily
4A5AA 4CJKA 1M1KO 4B1XB 3MXMA 3VQEA 3VOVA 4DUZK 1C0TA 1XNQK 4IZ9A 1G15A 3OYEA 1S9EA 4DHYA 3ID8A 3VGMA 4FJIA 4EZ9A 3K59A 3TTCA 3AGRA 3DOKA 3AO5A 1SQKA 2PY5A 4ZHRA 4C8OA 1IBKK 4F4KA 1GLFO 2PAVA 4BR0A 1XC9A 1I3AA 4IDKA 5BR9A 2I7NA 2V51B 2YKMA 5KRSA 4LF8K 3M1FA 1UA1A 4KKOA 1SS6A 4H5TA 3HO1A 2NRHA 4CI6A 3VQ7A 5KRTA 5AQJA 4DF8A 4LSLA 1F21A 2O8DB 2A1SA 4DU4A 1BIUA 3V1QA 4BC4A 2OZMA 1BG3A 3CCVN 4KHWA 2FF3B 3CJCA 1JLGA 2KW4A 3CIPA 3QBXA 4CFBA 4FK2A 1WBDA 4EIAA 1YTUA 4LSNA 4DWIA 1N32K 1I39A 1IBLK 1I94K 3QLHA 4J2BA 3KK2A 1ILYA 3ULEB 5M1QA 2Y1JA 4DV0K 4N56A 3MECA 3C95A 2X6NA 5J1EA 4O8KA 5AQGA 2QWLA 3ZYYX 4CJWA 3ZSVA 4Z4CA 4H03B 3G71N 3JAMO 1KCFA 4W5RA 4K42A 3K9JA 4GV9A 3O08A 3K0SA 2KFZA 4H5VA 2ZWHA 4B9VA 1A5WA 1BGXT 1VQKN 2FBYA 2P5GA 1RDCA 1QVFM 4CF1A 4FWOA 1SKSA 3WXMB 5SZTA 3KWGA 2Q0UA 5J2QA 5EVZA 4F2SA 2P9SB 4OJRA 4EP4A 1NGBA 4M7XA 4BRFA 2CH5A 1Q9YA 2ASOA 5J2MA 4DSIA 1RFQA 3FZFA 3ASMA 3BY5A 1IV0A 1B9DA 3H46O 4C23A 2DFFA 4Y0WA 3IKMA 4QOZB 3MWTA 1C0UA 4DFJA 1QE1A 1X9WA 4BR5A 2P9IB 4CJ4A 4OLBA 2BUPA 1RTJA 1VRUA 4O4GA 4FWPA 4BACA 2JGUA 1S1TA 3H3OB 1LAVA 1WB9A 5BREA 4Z4IA 3L4QA 3QERA 5AZIA 2XO7A 4DQSA 1NGAA 4C1NI 4I6MA 3O9UA 3PO4A 2F4VK 2KHOA 4B9NA 1MWMA 3N4PA 4FO0A 4PL7A 4RTFD 3DLKA 2WUSA 2IC3A 3F73A 3LAMA 3OS0A 4LC9B 4GVMA 1RTIA 2R7YA 4YNQA 2ZJQL 4FJJA 4AHSA 2HHUA 1RBTA 4DSJA 4WQ4A 1J9AA 5HOOA 2O8EB 1S5JA 2W42A 3U3GA 4C8KA 4NXNK 3EKSA 3PV8A 2FBVA 5FLXO 4A57A 4EHUA 3L8BA 3G4SN 2ASMA 3AGKA 3SPZA 2UXCK 1SL0A 1J53A 4RW8A 4CJVA 1L3UA 3SBGA 2YJEA 2B6AA 1C1AA 5HRNA 1J5OA 3K57A 1P8ZA 2NLXA 1EKEA 3VMFB 3E9PA 2IVNA 3LDSA 1JKHA 3IG1A 3E01A 1S3XA 1WLJA 4CJRA 1NJIO 4E0DA 3J7AP 2QXFA 3KJVA 2AP1A 1N34K 2Z1JA 3EE8A 5I42A 3AA3A 4HWIA 4C8MA 1LOTB 1Q82O 3RVCA 3KZBA 4H5WA 1DEJA 4CF8A 4DV4K 5CYQA 4PKGA 4H0VB 4BGAA 2X6SA 3OTOK 4OKEA 3RMBA 5C42A 4JI2K 3QEVA 4DQPA 3T1YK 3UKRB 3ZX0A 1RDAA 4CEFA 5IWAK 2NRZA 3M6GA 4I6MB 3CETA 4H8KA 4KHQA 1SAZA 3QB0A 4FLUA 1OVQA 4N41A 5M1KA 5JS1A 1NMDA 4ID5A 3DLGA 1IO2A 3TAQA 3O9QA 1KAZA 3NBPA 4M42A 2FBXA 1IJJA 4KHSA 4Z4FA 2VQEK 4FL9A 1Z25A 3THVA 4W5OA 3A8YA 2NNWA 5JS2A 2F96A 3S9HA 4K8XA 4X66K 1VQ4N 1ATRA 3GBTA 4IG3A 3VEYA 2NRTA 4DSLA 3RRGA 2F9TA 2A3ZA 5GAHP 1KC8O 3FZMA 3KLFA 3SV3A 1JCGA 4DCHA 4CK2A 1HYZA 3A5MC 4GKJK 4BE1A 5LJVA 4CFCA 5HRPA 4IKFA 2KTQA 4A59A 3UE5A 1NGEA 1GLJO 3UKUB 3C6UA 4WCEL 1QQCA 3C6TA 2XY5A 4HHTA 4Z4EA 1SZ2A 1C0MA 4CEEA 5KTQA 2OPQA 4JKBA 4F3OA 4BVPA 3CD6N 1LWEA 4DF4A 3CCJN 4F3TA 2KKZA 4X64K 2FSJA 5TKYA 4OKJA 5HROA 1X9JA 3RMDA 3R3LA 4CEBA 3HTVA 2WBNA 1BOTO 3MMVA 4DTNA 4JNEA 2FBTA 3VTIA 3FLCO 1XNRK 2E6MA 4FLXA 1ZBHA 1TL3A 2DFEA 2WFBA 3T1AA 5C24A 4EAHD 1HQUA 4NXMK 3QDKA 3HOSA 2Q97A 3LP3A 3M8RA 2UUAK 2F8SA 3MDQA 1VQ7N 4DSKA 5TKWA 4GW6A 2Y1IA 4CK3A 4BR7A 1NK0A 1X9MA 5AQSA 1RNHA 1YJ9N 5LY3A 4IOXA 4CJ3A 4DR1K 3I0RA 1VSMA 1LWCA 4B1YB 3TARA 4JRPA 4CEAA 3OBYA 4FJ5A 3SQ4A 3PX4A 3I8DA 4IEEA 1VQLN 4KI6A 4RWTA 4BRMA 1JLFA 3FZLA 1T05A 3DJCA 4JHDB 4FZYA 3KLHA 1QQNA 3WXLA 1L3VA 4Q0BA 2KQ2A 4YOUA 4W5QA 3VEXA 4WFBL 4IWVA 3E9OA 2V7ZA 3I0SA 1WUAA 1X1PA 3O3HA 5AQFA 1NGFA 4OO1J 1MU2A 3DXMB 4CHZA 3U6FA 1WSJA 1G99A 4FWLA 4I9LA 1W0HA 4NO7A 4C8NA 2ZGYA 3EKUA 4E19A 2QM1A 2JWKA 4W5NA 3THWA 3R8EA 1U6ZA 3CERA 3SPYA 4CZJA 1CXUA 4CJFA 5AZJA 5EXWA 3C0BA 4K25A 1QVGM 3THYA 3HZ6A 3CHWA 5AQLA 5C2DA 5BPMA 1BA0A 2H3GX 4K41A 3SAFA 3C65A 4W5TA 3HXMA 3DRRA 3TTDA 2W41A 5ADXH 3VA0A 4BR9A 2VCPA 3HVTA 1RDWX 1HNIA 4H0PA 3ID6A 2UYTA 3PSFA 4LFAK 4NCGA 3U3YA 4DTJA 1VQ5N 1BUPA 3HP6A 1ASWA 1LV5A 3BEXA 1Z26A 1RBRA 4CERA 4NCBA 3G10A 1HKGA 1YF5L 4CJLA 1J6ZA 2YNIA 4CF2A 4U67L 5DM6L 3TABA 2KZMA 3NGYA 3CFRA 3H08A 1OH7A 1VAZA 2IIRA 3NHGA 1KXPA 5GADP 5AQNA 5EU7A 3LM2A 1JLQA 3DAWA 2E6LA 1N33K 1XWLA 1TUUA 3VQ6A 3P83D 4FWSA 2XY7A 3ITHA 3BZKA 4JS4A 3DMJA 3EL2A 1TKZA 4B3MK 1X9SA 3SUPA 3ZSOA 5KQDA 3O4WA 3ZT4A 5I9EB 2D5RA 2P9UA 1NGGA 4BC2A 5DM7L 3A5NC 3BF1A 1OH8A 4G9ZA 1JLAA 3NH1A 3L4IA 1NG9A 3AVCA 3CM5A 4CZLA 1XMQK 4DQRA 3THWB 4E89A 3ZEUA 3MEGA 2RPIA 3U4LA 2QEXN 5BPNA 4CJQA 3SAGA 3FFIA 1JJ2M 3L3UA 4A2AA 1S9GA 4CGHA 3QIOA 5KGXA 4E1JA 3BP8A 3SYZA 1WSGA 4BVOA 3DLLL 4XH1A 3VQ9A 3D7EO 3O9RA 3T19A 5T7BA 2A41A 2Z1IA 2QWRA 4YHHK 3MN7A 1NJYA 2GWKA 4KFBA 3O9TA 1HYSA 3DLBA 3AVKA 3ZSXA 4BRPA 3M3ZA 1NK5A 3NFAA 4PUOA 4MDAA 4B9LA 1BU6O 3RMAA 3DXKA 5F0XA 4CECA 4WQ4C 2FF6A 3D2EA 3FFKB 3KLEA 2O8BB 2W6LA 2A5XA 1RBSA 1Y97A 3AA5X 3RWUA 2GELA 3BUZB 4CEDA 2W40A 1RT7A 3N4QA 1C1BA 1TUYA 4MLHA 2VWBA 4CHNA 4JI5K 2NRWA 3V9ZA 2YHXA 2WONA 1NJZA 1S6PA 3O1BA 2P9UB 4IG0A 3TAFA 1S72N 5BN8A 1KAYA 4IDHA 3PO5A 1NBWA 2OPRA 4Z0UA 4E3SA 3ZEUB 1ZXOA 1L5UA 4JI8K 2UXBK 3UB5A 3L2UA 4DR5K 3HM8A 1NGJA 1JLBA 1S1XA 4FZZA 4BR2A 2XRIA 3OVNA 3Q7CA 3B8AX 4IO9L 5FROA 1NU0A 1VSHA 1KVBA 1NLVA 3O1WA 3KLGA 4H0YB 3SUQA 1EO1A 1YVNA 3OYJA 2E1YA 3ENOA 3L2RA 1YHQN 3RTVA 1VQ9N 2HBKA 1TKTA 1RT5A 2YNHA 2HHSA 1Q86O 3VPZA 3O4QA 4DLGA 5AQHA 3BGRA 4BRDA 4DR3K 3B6PA 2P9LB 4CW7B 2GV9A 5AQYA 3DXKB 4FM1A 4IXCA 4BC5A 4K0KK 5CZ2A 3QMLA 1REVA 5HL7L 2E2PA 3AVFA 2HHQA 4PL8A 1O1WA 4FZXC 1T3VA 3AVBA 4CESA 4E7HA 3SV4A 4BRIA 1TAUA 5AQPA 1JXBA 4FWRA 1X3MA 3NDKA 1OVYA 4QAGA 4FJ8A 1C1CA 4H0XB 4KHPK 2X78A 4OGCA 1HPZA 4JK9A 2P9NA 5HBMA 3HVRA 3Q7BA 2CGLA 3OYAA 5J2NA 1KD1O 1YVUA 1KLMA 4OGEA 4N76A 1TK8A 3WEEA 4NLCA 2YHYA 4XIUA 4FWMA 1OH6A 3V9WA 1IKWA 4HUGA 5FPNA 4AQYK 3ZSRA 2ETJA 4J8FA 5E26A 4DTUA 5AQQA 3V1RA 3A2FA 4JYAK 2NRRA 4A5BA 3NE6A 1ZBLA 5FPMA 1KVCA 3CJ7A 1RBUA 3MX5A 4CF0A 4CJTA 3CQYA 1IBMK 3VQDA 1ZBUA 1B92A 4F8RA 1WSIA 2D1KA 1NKBA 4B3RK 4FVUA 1HX1A 5JLHA 2E2QA 3VQCA 2CGKA 1YJNN 1JXEA 1XMOK 4Y1DA 1QSYA 2YHAA 4BR4A 3RMCA 3FZHA 3TTFA 3MX2A 4J2DA 1YI2N 4CGFA 3VERA 3AVAA 2HHXA 2FLOA 3SUOA 4QS7A 1U4BA 1W97L 4CJ7A 4JI1K 4LF7K 3J8AA 2O8CA 1R59O 2FSKA 4JKGA 3PUFA 5C25A 2OYQA 4BG9A 3WUHA 4HVJA 1YUWA 2YI1A 3S3MA 4AHTA 2GWJA 2I5JA 2ITGA 1VSLA 4CGDA 4A61A 1KRPA 4KPYA 3HOTA 1HKBA 1RDDA 1TYQA 4B9QA 4CJ5A 2ZJRL 3CF5L 4GY2B 3W3DA 3AVHA 1RDBA 2HHHK 4PY5A 1CLQA 2E2OA 1U04A 2D0CA 5AQIA 4HTUA 4L8RB 2Q0RA 3ISNC 3AARA 5KQ8A 3DLEA 3OS2A 3DI6A 1FXXA 2A1RA 5GIPA 3S41A 4BWJA 1S22A 1K9MO 5M1FA 4R5PA 1KTQA 1NK6A 1ZBFA 2PBDA 2G8UA 1SL2A 2YNGA 3CJBA 2RE2A 3HL8A 1Q7YO 1FKOA 2XY6A 1CZBA 3O3GA 4KHUA 1CZ9A 4KBOA 3HYFA 3HM9A 1IKYA 4CIEA 4CBXA 4N47A 2O8FA 4B1WB 4M7YA 4YOYA 4I2QA 3WNGA 2YHBA 4IJNA 2G8VA 3VN5A 2RHKA 3CCUN 4FCYA 4CGIA 3AO4A 3GDQA 4ICLA 3QNOA 3AVLA 4PWDA 4N5SA 2IVPA 4O5BA 4BRCA 3PX6A 3WNEA 1E4FT 4KO0A 2D0PA 2GUPA 4H5RA 3M8QA 3LWLA 4FOEA 5F2RA 4DSFA 1Q9XA 4ELVA 1ZC6A 4FWQA 4FM0A 1VSKA 4CGJA 1QQMA 5AZIB 5FRNA 3ZSQA 4JKGB 3ZT1A 2B5JA 5CR4A 4CBUA 3IFRA 1ASVA 3FZKA 3LP1A 4OX9K 1EP4A 3TR8A 5JLFA 4I7FA 3H3NO 2ZGZA 4BRLA 1N36K 1T8EA 1EWQA 3LP2A 1LW2A 1BISA 1EETA 5EX5A 1NMNA 2G8KA 5E41A 2GEMA 3EE9A 4I2PA 3TSPA 1NKEA 1M90O 5KPZA 4WYBA 4KB1A 5GIOA 3CCLN 3O80A 2UXDK 3CJ1A 1GLBG 3VETA 4R79A 3LPUA 3CJ9A 3H1VX 3HI0A 2ITMA 3K5LA 5CZ1A 4LF9K 3THXA 2E88A 2HB5A 2Z1GA 2DTUA 2D0OA 1VSIA 1CXQA 4FLVA 1VK0A 5MLCQ 4C8LA 3OYLA 1ATNA 3EZ5A 1C0FA 1YXQA 1X3NA 4MO4A 3MN6A 4DTPA 1UA0A 4X65K 3IRXA 1QSSA 3EY1A 3MWPA 3KKRA 3A0IX 2HHTA 3C6HA 4LH5A 4K43A 1HKCA 1T44A 4M63C 3LALA 4H4OA 1UAXA 2HW3A 1WN7A 2A40A 3O5BA 3D2FA 2E2NA 2OCEA 4DV6K 4M41A 1L3TA 1YAGA 2Q31A 1TKXA 1RT2A 2GTDA 4KTZA 5AQXA 4WF9L 4JK8A 4H0TB 3H1QA 5AJ3K 4JRQA 3HBTA 5M1OA 3AAPA 2YJFA 4CCHA 5JMVA 1HYVA 3AO1A 3VESA 3OW2M 4TSXA 3CI5A 1JL1A 2HHWA 2I7PA 4DSEA 3F2KA 3PX0A 3VEOA 3MCPA 4CGGA 2VWJA 1RT4A 3CMAN 4CEQA 2QWNA 3SMPA 1NJXA 3HSCA 3OYBA 1K73O 3HPOA 2E1ZA 3WXJA 1DTTA 4E1NA 4UY8O 3OYKA 4Z94A 1N6QA 3DLRA 3VEZA 3DYAA 1K8KA 3LDPA 2QI2A 4FSVA 3V81A 3D0PA 3WNHA 2Q1NA 4B9MA 3SI6A 4IJAA 1DKGD 2PFUA 5C2FA 3AVGA 1D4XA 3MN9A 4JI0K 5CYMA 2QTDA 5C15A 4B8CA 2YV0X 1SUQA 1NGCA 2FC0A 2GX9A 3ZETA 3CPWM 4PA1A 4AILC 1RDUA 1JLCA 1S6QA 1WNSA 2YKNA 1TV6A 4JD2A 4RW9A 3WNFA 2UUBK 1VSDA 3MEDA 4JKEA 4F9OA 4B3SK 1J54A 4IEIA 1HJRA 1HRHA 1NK4A 4AHVA 1D9DA 4FJ7A 5H1SQ 3J80O 4GV6A 5LL6Z 4L3QA 3DRSA 3IS9A 4JLHA 1ITGA 5I3UA 1EX4A 4H4MA 1WSFA 5EOYA 1NGDA 1LWFA 5D3GA 3HJFA 2VWKA 1UWBA 3DM2A 3NF9A 5SWMA 1IG9A 3CQ8A 1H1VA 3VF4A 2XY8A 3UIQA 4FLYA 4KH5A 2IVOA 4YDUA 2VG5A 3VQ4A 4FK4A 2QWPA 3SJJA 4GKKK 3CMEN 3HP9A 3NH2A 5BRDA 1HNXK 4CZFA 1KFSA 2NZTA 4B1UB 4IFVA 1EXQA 3KIOA 4DQQA 4MFBA 4FJMA 1D5AA 3CG7A 5BN9A 4DTMA 2P51A 3SQ2A 1U2VA 4FW1A 4JI7K 4AHUA 2AJQA 2J4RA 3ENHA 4CEZA 4DV2K 1RCHA 2PYLA 1TAQA 2P9KA 4LY7A 1Q18A 1BIZA 4ZTJA 3S3NA 4LF5K 4CZGA 4MLEA 5BPLA 4CHOA 4CHYA 2Q2RA 2QXLA 1T6CA 4E7KA 4LD0A 5BRHA 3OJUA 3MXIA 3RRHA 1SKWA 1HMVA 3GG4A 4KH4A 4BQLA 4Z4GA 1WBBA 1QZ5A 3FE1A 3SMSA 4PQUA 1VRTA 4DTXA 1NM1A 3G0ZA 2HVHA 4E1MA 3ZT0A 2IGIA 5AZJB 3NGZA 4B3TK 4DV5K 4RG8A 4IO8A 3THYB 4JI6K 2F7TA 4LFBK 1ASUA 3MK6A 1C0GA 4CK1A 3SQ1A 4WQ5A 1GLEG 3LDQA 4DR2K 1FJGK 3OA9A 3CXCM 5FDLA 2ZD1A 4BDYA 1GLLO 2HF3A 3RSEA 1VQNN 4MDBA 3E66A 3W0LA 4A62A 1J5EK 4O8UA 4QCLA 1QHTA 1IKVA 4DQ8A 1B9FA 3TAGA 3S3OA 2VG7A 4FPAA 3CCRN 1ZYQA 4B8AB 2VG6A 3OYIA 2OTLN 3VQPA 2QWOA 3SJHA 2LSNA 5BR8K 3JSMA 5JICA 4GMJB 1U48A 3CYMA 3ZX2A 4DMNA 3TSUA 4FPBA 4H5NA 4B08A 4YOXA 1VQ6N 1BCMA 3WQUA 1U45A 3C6AA 3TAPA 4FOIA 3V4IA 2P9PA 3MAQA 3LZIA 3KLIA 4CD1A 1HR0K 5AQOA 5GAEP 4FLZA 2HBMA 3L0QA 2BANA 4E7LA 2Z1HA 2O8DA 4XH5A 3KHYA 4DFKA 4M3WA 4DV7K 3HK2A 3SK3A 3P39A 1XI1A 3NVKA 3ZSWA 4YOTA 3QICA 4CE9A 2QKKA 1XHZA 1K6YA 1QZ6A 1IG8A 2QWQA 4DU1A 4NYNA 2HNZA 1K8AO 1NWKA 4WFNL 4B1ZA 3NVMA 3AVIA 4BE2A 2E4LA 3ULEA 4BRHA 3JS6A 3U9ZA 3O4NA 4J2EA 4PKIA 2WTUA 3K5OA 4HCCA 3VQQA 3OYGA 5LMUK 1TK0A 3L2WA 3AA4A 3KKSA 3RSEB 5E84A 2RN2A 3SUNA 3K2PA 3GL1A 5ELZA 2QK9A 1DGKN 1JCFA 1WAFA 5LMNK 1VHXA 4CZKA 3D6RA 4BWMA 2QW9A 2HNYA 4JKDA 3QEWA 1QTMA 4AF1A 1NOYA 2GUIA 3VA3A 2P9SA 4B9SA 4KHNA 3O3FA 3LDNA 3D2EB 4CZEA 1KSPA 4JKAA 1BHLA 4OKKA 4AM6A 5FPEA 4HTLA 3C94A 4YFUA 3U8XA 5A2QO 4KRFA 1FKPA 4JI4K 4BREA 2P9PB 2P9IA 3P31A 3NH0A 4DU3A 3K58A 3AO2A 4Z4HA 5HLFA 4M3XA 3PIPL 5C0YA 3HSTB 3LL3A 3FR0A 3ZLJA 1SL1A 3GE1A 3IUCA 3J81O 3O8MA 1JCEA 1RILA 4FM2A 5IT9O 3I8BA 1S1VA 3ZT3A 4FWKA 2E5LK 2ZE2A 4QS9A 3PLAA 2VQFK 3MN5A 3D45A 4BRKA 2G8FA 1RGIA 4EZ6A 2HSTA 5C10A 4BROA 3OYCA 4CFAA 5KI6A 4AHCA 1Q8IA 3QETA 2O4IA 3T1HK 3QEXA 3FGUA 4AH9A 2P1JA 4AHRA 1HQEA 4CF9A 2OPPA 4FJNA 1VSEA 2QWMA 3SBTA 4FK0A 2O8EA 4KV8A 1HLUA 1EWRA 3QIPA 1DLOA 3L2QA 4ILJA 3KTQA 3AAQA 4LFCK 1TGOA 1NOZA 3K9KA 1LW0A 1BA1A 4M3UA 3TANA 4FLWA 4CEOA 1DT9A 4IFYA 5BRFA 3LAKA 4CZHA 2PYJA 1NGIA 1V4TA 4DR6K 3OYFA 1RT1A 4JKHA 1BQNA 3LZJA 3KK1A 1WOQA 3WXIA 4X62K 3HPHA 1D9FA 3LM9A 4BQZA 3OYNA 4DKWA 2JWLA 4QS8A 3J7ZO 3LPTA 4YOWA 2QKBA 2VGMA 5JVGL 4IOCL 1BI4A 1WSEA 3OJSA 3I55N 1HNWK 3LDOA 3VGLA 5M1NA 2NRXA 4M3YA 2HNDA 2B4JA 3SQ0A 2V7YA 1HPMA 3SCXA 3CC7N 4FJXA 1ZBIA 3RR8A 4ILHA 4CHQA 3O6WA 5AFUH 3R1XA 2P9NB 3UKRA 3G6EN 1SKRA 4ILGB 5CHIA 3AVNA 4LH4A 3PY8A 1JL2A 1QSLA 1RT6A 3TWHA 5AQTA 3WEEB 5AQUA 1D8YA 1KAXA 1VSJA 1WAJA 2YNFA 1A5VA 3AO3A 3ZX3A 5DK5A 5AR0A 3NMUA 4ID1A 2IOCA 4U7BA 3AVMA 4FJ9A 4FYDA 1LAWA 1LCUA 3JYTA 4BE0A 2HMIA 4FXDA 4ISFA 5AQMA 4CVNE 5DMRA 3PSIA 1OH5A 4OPKA 1NK9A 4LF4K 1BO5O 2V52B 2Q3SA 1KQSM 4M3RA 4HCBA 3LP0A 3AV9A 1NKCA 3VEVA 4FJHA 3MCAB 1Y64A 4CJPA 3CCSN 4XEIA 3VQ8A 4YDUC 2O8CB 4Q5VA 4BGBA 4JI3K 3UKUA 2IAJA 2E20A 3NAEA 3OS1A 2HMPA 4AM7A 3IAYA 3QINA 1BI4B 1MA9B 4DR4K 2BGGA 4BRGA 2ZM6K 3V9XA 2JLEA 3C7NA 3SAHA 3ZSYA 1GLDG 1TYQB 3ULDA 2HBLA 3VQBA 2KFNA 3I33A 4EHTA 1OKJA 4FJLA 1FK9A 4CBWA 3CCEN 3U9DA 1NGHA 2E8AA 4IBNA 4DTSA 4JEPA 2CGJA 4DTOA 2O4GA 4BRNA 5LJWA 4CZIA 5JVHL 4E7IA 2BH1A 3K5NA 4DQIA 1QHAA 1QS4A 4JS5A 2ATQA 4O44A 1EQYA 2QA4N 2NRVA 5ADXA 3B6OA 4JN4A 4NB4A 3H45C 4DUYK 5CY4A 1S1UA 3R6MA 2O8FB 1ATSA 4FWNA 3V9SA 5FPDA 1YIJN 3E9LA 1SV5A 3P5JA 4F2RA 2KZZA 3BZCA 3E1YA 4XH4A 3J7YP 3NF7A 1FW6A 4CJSA 5KGWA 4CJUA 1T6DA 3BF3A 1DTQA 3PIOL 2WC9A 1L3SA 4EFHA 3QEPA 3DLHA 1T03A 3LANA 4JHDA 5M1PA 2G8IA 4KH6A 3QESA 4ELTA 4KREA 4A2BA 4WQ5C 3EN9A 1U47A 4M45A 4GVEA 3QFUA 3MXJA 2DY4A 1IKXA 2BE2A 4GNIA 4DS5A 4KI4A 4Y1CA 3CJAA 2G8HA 4B9TA 1E3MA 5AQZA 4BDZA 4JV5K 3WXKA 3VENA 4E7JA 1BDGA 3TI0A 3C7NB 4PHTX 2P5OA 1W7AA 1HJOA 3DXMA 3SZ2A 4K8ZA 4JKFA 3HT3A 4JK7A 3CCQN 3HPGA 3TPQA 2KLAA 4HUFA 1VQMN 3EO3A 4OLAA 4WE1A 1YJWN 1NK8A 2FXUA 2YHWA 3ATVA 3CPEA 4RW7A 3TSQA 3L2VA 3NF8A 1S1WA 3CQXA 2W6KA 1ZBSA 2HHVA 2YX6A 3VF2A 2IDOA 3OYDA 4FVMA 1T7PA 2VGNA 2FSNA 3KWIA 3VTHA 4LF6K 5FRMA 2OPSA 1O13A 1XC3A 1BWFO 4M3TA 3OYHA 1TK5A 2PZSA 3F9KA 4DTRA 3THXB 1XQSC 4J2AA 2HVIA 2GBZA 3ATUA 4M3ZA 3F9MA 3OYMA 1WSHA 3L6QA 1GOBA 1RBVA 1VQPN 4BY9C 1MWKA 1GLAG 4BRAA 2WOMA 3LDLA 4DFMA 1NNEA 3VEWA 3A5LC 1RTHA 4MO5A 3TU5A 2ZF5O 2ZQBA 4IFEA 4KAZA 4CZMA 1BCOA 3D2FB 2XHBA 2VYPA 2HBJA 3KVGA 4KHYA 4DG1A 3M5RA 1NJWA 3TAMA 4DV1K 4ELUA 3MEEA 2EHGA 2OTJN 3T7ZA 1NK7A 3KD1E 3QBWA 1W9HA 1N8RO 1HUXA 4O0IA 3NCIA 4NLBA 1P90A 3KK3A 3AA2A 4CFDA 3CM6A 1XUPO 2D0AA 3R9PA 3OY9A 3O9SA 3F5TA 1GOCA 2CH6A 1BQMA 2HOEA 4OPHA 2OANA 1TVRA 3P4IA 4CIGA 2UU9K 5KPRA 1HNVA 1GOAA 3OBWA 4DFPA 1R0AA 2OA8A 1VQ8N 2YCHA 3ENBA 5J2PA 2OZSA 1V4SA 4KTWA 2F8TA 3AY9A 3ZCMA 1K8KB 1QQOA 5AQWA 5F1XA 4KTQA 4DLEA 1C6VA 3EZWA 4ZTFA 1E4GT 4B1VA 3QNNA 5HRSA 3GOIA 5HRRA 5AQRA 1BL3A 4JKCA 1ESVA 2D0BA 4G1QA 2BDPA 5AQKA 4ISEA 3VF6A 3P1GA 2HF4A 4YORA 3ZSZA 1N5YA 4DS4A 3ZETB 1KFDA 4DR7K 3HRGA 3KK7A 3A5OC 4O0JA 3IDHA 3K5MA 4JD2B 3EYZA 1HNZK 4FJKA 1RT3A 2DPNA 4FW2A 1YTAA 3ALYA 2AA4A 2IS3A 4ISGA 4BG8A 4B3OA 4DV3K 2O8BA 1U49A 4IOAL 2ZJPL 3BDPA 4O5FA 1TKDA 3KD5E 3CFPA 4OVLA 3WQTA 4WFAL 3IMXA 4EP5A 5B8HA 1UOCA 3JXUA 4NCAA 5KPTA 1CZAN 4BC3A 3P38A 2ASPA 4MQ3A 1XHXA 3QEIA 1JLEA 3DRPA 3M8PA 4YY3K 4I9QA 4C1NK 5K14A 5HP1A 3T69A 4FJGA 4YOVA 4RCHA 3EEQA 4V19S 2G8WA 1TL1A 4FLTA 1KLNA 4NYFA 2EX3A 2Q36A 2A42A 1MDUB 4CJEA 5GINA 1Z6RA 3V9UA 3AVJA 1KVAA 3NGIA 1VSFA 2DFHA 3L3VA 3LWMA 3V6DA 4B9UA 1Q81O 1U2VB 4BDPA 2RKIA 3NF6A 3T3FA 1GLCG 1IH7A 2P9KB 2RF2A 4HUEA 4KB0A 4UQGA 3SNNA 5C12A 4RW4A 4H0OA 2P9LA 4OPAA 2NUBA 3CFOA 1YT3A 2F9WA 2EWSA 3QFPA 1VQON 3VGKA 3ZT2A 3CC2N 4CHPA 4GV3A 4DB3A 5CE3A 1A5XA 4PKHA 3I56N 2D4WA 4RW6A 1RTDA 4JAXA 3DWLA 4O55A 3WT0A 3CCMN 4CD3A 3RR7A 5EY4A 2X74A 2A6AA 2BTFA 5AFUA 3H6EA 4BRQA 3G25A 3DOLA 3CC4N 1Z05A 3SLCA 3VQAA 3QO9A 3M8SA 3OHRA 4OPJA 1W2BM 2UUCK 3V1OA 1YITN 5AQVA 4CIFA 3VQ5A 3TAEA 5GAGP
chains in the Genus database with same CATH topology
3O5BA 3D2FA 2E2NA 4A5AA 1HKGA 1M1KO 1YF5L 4B1XB 1YAGA 2Q31A 1J6ZA 2GTDA 4U67L 5DM6L 3VOVA 5AQXA 4WF9L 4JK8A 5AQTA 3WEEB 4IZ9A 5AQUA 4H0TB 3H1QA 3HBTA 5M1OA 1VAZA 2IIRA 3AAPA 4DHYA 1KAXA 2YJFA 3ID8A 3VGMA 3ZX3A 5JMVA 1KXPA 5AR0A 5GADP 3VESA 5AQNA 3NMUA 3LM2A 3TTCA 3OW2M 3AGRA 3DAWA 1SQKA 1TUUA 4FWSA 3CI5A 4U7BA 2I7PA 1GLFO 2PAVA 4BR0A 3F2KA 3EL2A 1LCUA 3MCPA 3VEOA 5KQDA 3CMAN 2QWNA 3O4WA 5BR9A 5I9EB 2I7NA 2V51B 2P9UA 1NGGA 3SMPA 1K73O 3HSCA 3M1FA 4ISFA 4BC2A 2E1ZA 5DM7L 5AQMA 3WXJA 3A5NC 3BF1A 4G9ZA 4UY8O 3L4IA 1BO5O 1SS6A 4H5TA 2V52B 2NRHA 4CI6A 4CZLA 4Z94A 5AQJA 3VEZA 1KQSM 3ZEUA 1K8KA 3LDPA 2QI2A 3U4LA 2QEXN 3VEVA 4FSVA 5BPNA 3SAGA 1JJ2M 2Q1NA 4A2AA 3MCAB 4E1JA 3BP8A 1Y64A 4BC4A 4IJAA 4BVOA 3DLLL 4XEIA 4XH1A 1BG3A 4YDUC 1DKGD 3CCSN 4BGBA 3CCVN 3UKUA 2PFUA 2E20A 2FF3B 5C2FA 3D7EO 3CJCA 2HMPA 3CIPA 3O9RA 3QBXA 4AM7A 1D4XA 3MN9A 4EIAA 1MA9B 2QTDA 4BRGA 5C15A 2A41A 3C7NA 2QWRA 3SAHA 1NGCA 1GLDG 2GX9A 1TYQB 1ILYA 3MN7A 3ZETA 3ULEB 3CPWM 2GWKA 5M1QA 1RDUA 2HBLA 3O9TA 3I33A 4EHTA 1OKJA 4JD2A 4O8KA 5AQGA 2QWLA 4BRPA 3ZYYX 4JKEA 4F9OA 3M3ZA 4CBWA 4H03B 3G71N 3CCEN 3U9DA 1NGHA 2E8AA 4MDAA 4K42A 3K9JA 4GV9A 4JEPA 2CGJA 4IEIA 3O08A 1BU6O 2ZWHA 4H5VA 3DXKA 4BRNA 5LJWA 4CZIA 5F0XA 5JVHL 1VQKN 5H1SQ 2BH1A 4WQ4C 4GV6A 2FF6A 3D2EA 4L3QA 1QVFM 3FFKB 1QHAA 4FWOA 2A5XA 1EQYA 3WXMB 2QA4N 3KWGA 2Q0UA 2GELA 2NRVA 5EOYA 2P9SB 5EVZA 5ADXA 4JN4A 1NGDA 1NGBA 3BUZB 4M7XA 2CH5A 4BRFA 2W40A 3N4QA 4NB4A 2ASOA 1TUYA 4MLHA 3H45C 1RFQA 2VWBA 3R6MA 3FZFA 1ATSA 4FWNA 3H46O 4C23A 1H1VA 2NRWA 3IKMA 4Y0WA 2YHXA 3VF4A 5FPDA 1YIJN 3MWTA 3E9LA 3O1BA 2P9UB 4KH5A 2IVOA 2P9IB 4BR5A 3E1YA 4XH4A 4YDUA 2BUPA 2QWPA 1S72N 4FWPA 5BN8A 1KAYA 1T6DA 3BF3A 3CMEN 3PIOL 2WC9A 4IDHA 5BRDA 1NBWA 3H3OB 4EFHA 3ZEUB 1ZXOA 5BREA 3L4QA 4CZFA 2NZTA 4B1UB 5AZIA 4JHDA 3UB5A 5M1PA 1NGAA 4KH6A 4C1NI 3HM8A 4A2BA 4I6MA 4WQ5C 1NGJA 3EN9A 3O9UA 4GVEA 3QFUA 5BN9A 2KHOA 4BR2A 4GNIA 3Q7CA 1U2VA 1MWMA 3B8AX 3N4PA 4FO0A 4IO9L 3CJAA 4PL7A 4RTFD 5AQZA 3WXKA 2J4RA 2WUSA 3ENHA 3VENA 1NLVA 1BDGA 3O1WA 3C7NB 4PHTX 4LC9B 2P9KA 4H0YB 2ZJQL 1HJOA 1Q18A 3DXMA 4JKFA 1EO1A 1YVNA 4JK7A 3CCQN 4WQ4A 3TPQA 2KLAA 2E1YA 1VQMN 3ENOA 3EO3A 1YHQN 1VQ9N 5HOOA 4CZGA 2HBKA 1YJWN 4MLEA 5BPLA 2Q2RA 2QXLA 3EKSA 1T6CA 2FXUA 4A57A 5BRHA 1Q86O 2YHWA 3VPZA 3ATVA 3CPEA 4EHUA 5AQHA 3TSQA 4KH4A 3GG4A 4BQLA 3G4SN 2ASMA 3AGKA 3CQXA 4BRDA 1ZBSA 1QZ5A 2P9LB 3SBGA 2YX6A 3FE1A 3DXKB 5AQYA 3SMSA 3VF2A 2YJEA 4IXCA 4BC5A 2VGNA 2FSNA 3KWIA 3QMLA 3VTHA 1NM1A 5HL7L 2E2PA 4PL8A 1P8ZA 1O13A 2NLXA 3VMFB 3E9PA 1T3VA 1XC3A 2IVNA 5AZJB 1BWFO 1S3XA 4BRIA 1NJIO 4IO8A 2AP1A 5AQPA 1XQSC 2F7TA 3EE8A 3MK6A 4FWRA 1X3MA 4HWIA 1OVYA 1LOTB 3ATUA 4H0XB 1C0GA 1Q82O 3RVCA 3F9MA 3KZBA 4H5WA 4WQ5A 4JK9A 1DEJA 1GLEG 3L6QA 3LDQA 4PKGA 2P9NA 4H0VB 4BGAA 3OA9A 3CXCM 1VQPN 4BY9C 1MWKA 3Q7BA 1GLAG 2CGLA 1GLLO 2HF3A 3RSEA 4BRAA 1KD1O 4MDBA 1VQNN 3LDLA 3E66A 3W0LA 4A62A 4O8UA 3VEWA 3A5LC 4DQ8A 4MO5A 3UKRB 3TU5A 4FPAA 3ZX0A 2ZF5O 3CCRN 3WEEA 4NLCA 4IFEA 2YHYA 2NRZA 4FWMA 4CZMA 5FPNA 3D2FB 3M6GA 4I6MB 2VYPA 3CETA 2HBJA 4J8FA 5E26A 2QWOA 2OTLN 5AQQA 3SJHA 2NRRA 4A5BA 5FPMA 1SAZA 3KVGA 5JICA 3CJ7A 3M5RA 3QB0A 3MX5A 3ZX2A 3CQYA 3TSUA 4FPBA 4H5NA 4YOXA 5M1KA 1VQ6N 2OTJN 1NMDA 3WQUA 3T7ZA 3C6AA 3QBWA 2D1KA 3O9QA 1KAZA 1N8RO 1HUXA 4FOIA 4FVUA 1HX1A 4NLBA 1P90A 5JLHA 2E2QA 2P9PA 2CGKA 1YJNN 1XUPO 3R9PA 4CD1A 1IJJA 4BR4A 4FL9A 3FZHA 5AQOA 3MX2A 3O9SA 3TTFA 3A8YA 5GAEP 2HBMA 2NNWA 3L0QA 3F5TA 1YI2N 3VERA 2CH6A 2HOEA 4OPHA 2OANA 1VQ4N 3P4IA 1ATRA 2FLOA 3GBTA 4XH5A 5KPRA 3KHYA 3VEYA 3OBWA 2NRTA 4QS7A 1VQ8N 2F9TA 2YCHA 1W97L 3ENBA 4CJ7A 1V4SA 2A3ZA 3SK3A 3P39A 3FZMA 5GAHP 1KC8O 3NVKA 1JCGA 3AY9A 4YOTA 4DCHA 3J8AA 1K8KB 1QQOA 3QICA 5AQWA 5F1XA 1R59O 3A5MC 2FSKA 3EZWA 4JKGA 1E4GT 1IG8A 1QZ6A 4B1VA 4BG9A 3WUHA 5LJVA 2QWQA 3GOIA 1YUWA 5AQRA 2YI1A 4A59A 4JKCA 2GWJA 1NGEA 3UE5A 1NWKA 4WFNL 1K8AO 1GLJO 3UKUB 4A61A 3NVMA 4B1ZA 4WCEL 1HKBA 1TYQA 4B9QA 3HOTA 1ESVA 3ULEA 2ZJRL 3CF5L 4GY2B 3W3DA 4BRHA 5AQKA 1SZ2A 3JS6A 3U9ZA 4PKIA 4ISEA 3VF6A 2E2OA 2HF4A 4JKBA 5AQIA 4BVPA 3CD6N 4YORA 2Q0RA 3AARA 5KQ8A 3ZETB 3CCJN 5GIPA 3S41A 2KKZA 3HRGA 2FSJA 5E84A 5TKYA 3RSEB 3KK7A 1S22A 3A5OC 3IDHA 1K9MO 4JD2B 5M1FA 2DPNA 1X9JA 3GL1A 2PBDA 3R3LA 5ELZA 1DGKN 1JCFA 2WBNA 3HTVA 1BOTO 3MMVA 2AA4A 4JNEA 4ISGA 3CJBA 3VTIA 4CZKA 3D6RA 3FLCO 4BG8A 2RE2A 2QW9A 4JKDA 1Q7YO 4IOAL 4AF1A 2WFBA 2ZJPL 4KBOA 2P9SA 3LDNA 3D2EB 4O5FA 4CZEA 4EAHD 4JKAA 5FPEA 4AM6A 4CBXA 3WQTA 4HTLA 3QDKA 3HOSA 2Q97A 4WFAL 4B1WB 3IMXA 3MDQA 3U8XA 4M7YA 5B8HA 1VQ7N 4YOYA 5TKWA 3JXUA 4IJNA 4BR7A 4BREA 2P9PB 5AQSA 2P9IA 2RHKA 3P31A 3CCUN 3GDQA 5KPTA 1CZAN 1YJ9N 4BC3A 5LY3A 3P38A 3PIPL 5C0YA 2ASPA 3LL3A 4IOXA 3FR0A 3GE1A 3IUCA 2IVPA 4BRCA 3O8MA 1JCEA 4B1YB 4C1NK 3I8BA 1E4FT 4FWKA 3T69A 3OBYA 4YOVA 2D0PA 2GUPA 4H5RA 4RCHA 4QS9A 4FOEA 5F2RA 3PLAA 4IEEA 1VQLN 3MN5A 4RWTA 4BRKA 1ZC6A 4FWQA 1RGIA 4BRMA 3FZLA 1QQMA 2HSTA 5AZIB 5C10A 2Q36A 2A42A 1MDUB 3DJCA 4JHDB 4JKGB 4BROA 5GINA 1Z6RA 5CR4A 4CBUA 3IFRA 3FZKA 1QQNA 3WXLA 3FGUA 1Q81O 1U2VB 4YOUA 3VEXA 4WFBL 5JLFA 2QWMA 3H3NO 2ZGZA 4IWVA 3SBTA 3E9OA 4BRLA 2V7ZA 1GLCG 1WUAA 5AQFA 1NGFA 4OO1J 1HLUA 2P9KB 3DXMB 5EX5A 4ILJA 3AAQA 3K9KA 2GEMA 1BA1A 1G99A 3EE9A 4FWLA 3TSPA 1M90O 5C12A 5KPZA 4NO7A 4H0OA 4WYBA 2P9LA 1DT9A 2ZGYA 3EKUA 4OPAA 5GIOA 2QM1A 3CCLN 2JWKA 5BRFA 3O80A 4CZHA 2F9WA 1NGIA 2EWSA 1V4TA 3QFPA 1U6ZA 3R8EA 3CERA 1VQON 3VGKA 3CJ1A 1GLBG 4JKHA 3VETA 4CZJA 4R79A 3CC2N 5AZJA 1WOQA 4DB3A 3WXIA 4GV3A 5EXWA 3C0BA 5CE3A 3CJ9A 4PKHA 3H1VX 3HI0A 4K25A 2ITMA 3I56N 1QVGM 2D4WA 3HZ6A 3LM9A 2E88A 3CHWA 5AQLA 4BQZA 4JAXA 5C2DA 3DWLA 2JWLA 4DKWA 4QS8A 1BA0A 2H3GX 4K41A 3WT0A 5BPMA 2D0OA 3C65A 3SAFA 4YOWA 3J7ZO 2VGMA 3CCMN 4CD3A 5JVGL 5EY4A 4IOCL 3TTDA 2A6AA 2BTFA 5AFUA 5MLCQ 2W41A 3H6EA 5ADXH 1ATNA 5CHIA 4BRQA 4BR9A 2VCPA 3G25A 3I55N 1C0FA 3CC4N 1YXQA 1X3NA 1Z05A 3LDOA 4MO4A 3VGLA 1RDWX 5M1NA 2NRXA 3MN6A 3SLCA 2V7YA 4H0PA 3ID6A 2UYTA 1HPMA 3OHRA 3CC7N 1W2BM 3MWPA 1VQ5N 1YITN 1BUPA 3A0IX 4ILHA 5AQVA 3O6WA 5AFUH 3C6HA 3R1XA 4K43A 2P9NB 3UKRA 1HKCA 3G6EN 1T44A 4ILGB 4M63C 3BEXA 5GAGP 2A40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5B A;  3D2F A;  2E2N A;  1HKG A;  4B1X B;  1YAG A;  2Q31 A;  1J6Z A;  2GTD A;  3VOV A;  5AQX A;  5AQT A;  3WEE B;  4IZ9 A;  5AQU A;  4H0T B;  3H1Q A;  3HBT A;  2IIR A;  3AAP A;  4DHY A;  1KAX A;  2YJF A;  3ID8 A;  3VGM A;  3ZX3 A;  5JMV A;  1KXP A;  5AR0 A;  3VES A;  5AQN A;  3LM2 A;  3DAW A;  1SQK A;  1TUU A;  4FWS A;  3CI5 A;  2I7P A;  1GLF O;  2PAV A;  4BR0 A;  3EL2 A;  1LCU A;  3MCP A;  3VEO A;  5KQD A;  2QWN A;  3O4W A;  5BR9 A;  5I9E B;  2I7N A;  2V51 B;  2P9U A;  1NGG A;  3SMP A;  3HSC A;  3M1F A;  4ISF A;  4BC2 A;  2E1Z A;  5AQM A;  3WXJ A;  3A5N C;  3BF1 A;  3L4I A;  1BO5 O;  4H5T A;  2V52 B;  2NRH A;  4CI6 A;  4CZL A;  4Z94 A;  5AQJ A;  3VEZ A;  3ZEU A;  1K8K A;  3LDP A;  3U4L A;  3VEV A;  4FSV A;  5BPN A;  2Q1N A;  4A2A A;  4E1J A;  3BP8 A;  1Y64 A;  4BC4 A;  4IJA A;  4BVO A;  4XEI A;  4XH1 A;  1BG3 A;  4YDU C;  1DKG D;  4BGB A;  3UKU A;  2E20 A;  2FF3 B;  3D7E O;  3CJC A;  2HMP A;  3CIP A;  3QBX A;  4AM7 A;  1D4X A;  3MN9 A;  4EIA A;  1MA9 B;  4BRG A;  2A41 A;  3C7N A;  2QWR A;  1NGC A;  1GLD G;  1TYQ B;  3MN7 A;  3ZET A;  3ULE B;  2GWK A;  3I33 A;  4EHT A;  1OKJ A;  4JD2 A;  4O8K A;  5AQG A;  2QWL A;  4BRP A;  4F9O A;  3M3Z A;  4CBW A;  4H03 B;  3U9D A;  1NGH A;  2E8A A;  4K42 A;  2CGJ A;  3O08 A;  1BU6 O;  2ZWH A;  4H5V A;  3DXK A;  4BRN A;  5LJW A;  4CZI A;  5F0X A;  4WQ4 C;  2FF6 A;  3D2E A;  4L3Q A;  3FFK B;  1QHA A;  4FWO A;  2A5X A;  1EQY A;  2Q0U A;  2GEL A;  5EOY A;  5EVZ A;  2P9S B;  5ADX A;  4JN4 A;  1NGD A;  1NGB A;  3BUZ B;  4M7X A;  2CH5 A;  4BRF A;  2W40 A;  4NB4 A;  2ASO A;  1TUY A;  4MLH A;  3H45 C;  1RFQ A;  2VWB A;  3R6M A;  3FZF A;  1ATS A;  4FWN A;  3H46 O;  4C23 A;  1H1V A;  4Y0W A;  3VF4 A;  2YHX A;  5FPD A;  3O1B A;  2P9U B;  2IVO A;  2P9I B;  4BR5 A;  4XH4 A;  4YDU A;  2BUP A;  2QWP A;  4FWP A;  5BN8 A;  1KAY A;  1T6D A;  3BF3 A;  5BRD A;  1NBW A;  3H3O B;  4EFH A;  3ZEU B;  1ZXO A;  5BRE A;  4CZF A;  2NZT A;  4B1U B;  5AZI A;  4JHD A;  3UB5 A;  1NGA A;  3HM8 A;  4A2B A;  4I6M A;  4WQ5 C;  1NGJ A;  3EN9 A;  3QFU A;  5BN9 A;  2KHO A;  4BR2 A;  4GNI A;  1U2V A;  1MWM A;  3B8A X;  4FO0 A;  3CJA A;  4PL7 A;  4RTF D;  5AQZ A;  3WXK A;  2J4R A;  2WUS A;  3ENH A;  3VEN A;  1NLV A;  1BDG A;  3O1W A;  3C7N B;  4LC9 B;  2P9K A;  4H0Y B;  1HJO A;  1Q18 A;  3DXM A;  1YVN A;  4WQ4 A;  3TPQ A;  2E1Y A;  3ENO A;  3EO3 A;  4CZG A;  4MLE A;  5BPL A;  2Q2R A;  2QXL A;  3EKS A;  1T6C A;  2FXU A;  5BRH A;  2YHW A;  3VPZ A;  3ATV A;  4EHU A;  5AQH A;  3GG4 A;  4BQL A;  2ASM A;  3CQX A;  4BRD A;  1ZBS A;  1QZ5 A;  2P9L B;  3FE1 A;  5AQY A;  3DXK B;  3SMS A;  3VF2 A;  2YJE A;  4IXC A;  4BC5 A;  2FSN A;  3QML A;  1NM1 A;  2E2P A;  4PL8 A;  1P8Z A;  2NLX A;  5AZJ B;  1XC3 A;  2IVN A;  1BWF O;  1S3X A;  4BRI A;  4IO8 A;  2AP1 A;  5AQP A;  1XQS C;  3MK6 A;  4FWR A;  1X3M A;  4HWI A;  1LOT B;  3ATU A;  4H0X B;  1C0G A;  3F9M A;  3KZB A;  4H5W A;  4WQ5 A;  1DEJ A;  1GLE G;  3L6Q A;  3LDQ A;  4PKG A;  2P9N A;  4H0V B;  4BGA A;  1MWK A;  1GLA G;  2CGL A;  1GLL O;  2HF3 A;  3RSE A;  4BRA A;  3LDL A;  3W0L A;  4A62 A;  3VEW A;  3A5L C;  4DQ8 A;  4MO5 A;  3UKR B;  3TU5 A;  4FPA A;  3ZX0 A;  2ZF5 O;  3WEE A;  2YHY A;  4FWM A;  4CZM A;  5FPN A;  3D2F B;  3M6G A;  4I6M B;  2VYP A;  3CET A;  4J8F A;  5E26 A;  2QWO A;  5AQQ A;  3SJH A;  5FPM A;  1SAZ A;  3KVG A;  5JIC A;  3CJ7 A;  3QB0 A;  3ZX2 A;  3CQY A;  4FPB A;  4H5N A;  1NMD A;  3WQU A;  3QBW A;  2D1K A;  1KAZ A;  1HUX A;  4FOI A;  1HX1 A;  5JLH A;  2E2Q A;  2P9P A;  2CGK A;  1XUP O;  3R9P A;  4CD1 A;  1IJJ A;  4BR4 A;  4FL9 A;  3FZH A;  5AQO A;  3A8Y A;  3L0Q A;  3VER A;  2CH6 A;  2HOE A;  2OAN A;  3P4I A;  1ATR A;  2FLO A;  3GBT A;  4XH5 A;  5KPR A;  3KHY A;  3VEY A;  4QS7 A;  2F9T A;  2YCH A;  4CJ7 A;  1V4S A;  2A3Z A;  3SK3 A;  3FZM A;  1JCG A;  3AY9 A;  4DCH A;  3J8A A;  1K8K B;  1QQO A;  3QIC A;  5AQW A;  5F1X A;  1R59 O;  3A5M C;  2FSK A;  3EZW A;  1E4G T;  1IG8 A;  1QZ6 A;  4B1V A;  4BG9 A;  3WUH A;  5LJV A;  2QWQ A;  3GOI A;  1YUW A;  5AQR A;  2YI1 A;  2GWJ A;  1NGE A;  3UE5 A;  1NWK A;  1GLJ O;  3UKU B;  4A61 A;  4B1Z A;  1HKB A;  1TYQ A;  4B9Q A;  1ESV A;  3ULE A;  4GY2 B;  3W3D A;  4BRH A;  5AQK A;  1SZ2 A;  3JS6 A;  3U9Z A;  4PKI A;  4ISE A;  3VF6 A;  2E2O A;  2HF4 A;  5AQI A;  4BVP A;  2Q0R A;  3AAR A;  5KQ8 A;  3ZET B;  3S41 A;  3RSE B;  2FSJ A;  5E84 A;  5TKY A;  1S22 A;  3A5O C;  3IDH A;  4JD2 B;  2DPN A;  1X9J A;  3GL1 A;  2PBD A;  5ELZ A;  1DGK N;  1JCF A;  3HTV A;  1BOT O;  3MMV A;  2AA4 A;  4JNE A;  4ISG A;  3CJB A;  4CZK A;  3FLC O;  4BG8 A;  2QW9 A;  4KBO A;  2P9S A;  3LDN A;  3D2E B;  4O5F A;  4CZE A;  4EAH D;  5FPE A;  4AM6 A;  4CBX A;  3WQT A;  4HTL A;  3QDK A;  2Q97 A;  4B1W B;  3IMX A;  3MDQ A;  3U8X A;  4M7Y A;  5B8H A;  3JXU A;  4IJN A;  4BR7 A;  4BRE A;  2P9P B;  5AQS A;  2P9I A;  3GDQ A;  5KPT A;  1CZA N;  4BC3 A;  5LY3 A;  2ASP A;  3LL3 A;  3FR0 A;  3GE1 A;  3IUC A;  2IVP A;  4BRC A;  3O8M A;  1JCE A;  4B1Y B;  3I8B A;  1E4F T;  4FWK A;  2D0P A;  2GUP A;  4H5R A;  4RCH A;  4QS9 A;  4FOE A;  5F2R A;  3MN5 A;  4RWT A;  4BRK A;  1ZC6 A;  4FWQ A;  1RGI A;  4BRM A;  3FZL A;  1QQM A;  5AZI B;  2Q36 A;  2A42 A;  1MDU B;  3DJC A;  4JHD B;  4BRO A;  1Z6R A;  4CBU A;  3IFR A;  3FZK A;  1QQN A;  3WXL A;  3FGU A;  1U2V B;  3VEX A;  5JLF A;  2QWM A;  3H3N O;  2ZGZ A;  4IWV A;  4BRL A;  2V7Z A;  1GLC G;  1WUA A;  5AQF A;  1NGF A;  1HLU A;  2P9K B;  3DXM B;  5EX5 A;  3AAQ A;  2GEM A;  1BA1 A;  1G99 A;  4FWL A;  5KPZ A;  4NO7 A;  4H0O A;  4WYB A;  2P9L A;  2ZGY A;  3EKU A;  2QM1 A;  5BRF A;  3O80 A;  4CZH A;  2F9W A;  1NGI A;  2EWS A;  1V4T A;  3QFP A;  1U6Z A;  3R8E A;  3CER A;  3VGK A;  3CJ1 A;  1GLB G;  3VET A;  4CZJ A;  5AZJ A;  1WOQ A;  4DB3 A;  3WXI A;  5EXW A;  3C0B A;  5CE3 A;  3CJ9 A;  4PKH A;  3H1V X;  3HI0 A;  4K25 A;  2ITM A;  2D4W A;  3HZ6 A;  3LM9 A;  2E88 A;  3CHW A;  5AQL A;  4BQZ A;  4JAX A;  3DWL A;  5BPM A;  4QS8 A;  1BA0 A;  2H3G X;  4K41 A;  3WT0 A;  2D0O A;  4CD3 A;  5EY4 A;  2A6A A;  2BTF A;  5AFU A;  2W41 A;  3H6E A;  5ADX H;  1ATN A;  4BRQ A;  4BR9 A;  2VCP A;  3G25 A;  1C0F A;  1YXQ A;  1X3N A;  1Z05 A;  3LDO A;  4MO4 A;  3VGL A;  1RDW X;  3SLC A;  3MN6 A;  2V7Y A;  4H0P A;  2UYT A;  1HPM A;  3OHR A;  1BUP A;  3A0I X;  5AQV A;  3O6W A;  5AFU H;  4K43 A;  2P9N B;  3UKR A;  1HKC A;  1T44 A;  4M63 C;  3BEX A;  2A40 A; 
#chains in the Genus database with same CATH topology
 4A5A A;  4CJK A;  1M1K O;  4B1X B;  3MXM A;  3VQE A;  3VOV A;  4DUZ K;  1C0T A;  1XNQ K;  4IZ9 A;  1G15 A;  3OYE A;  1S9E A;  4DHY A;  3ID8 A;  3VGM A;  4FJI A;  4EZ9 A;  3K59 A;  3TTC A;  3AGR A;  3DOK A;  3AO5 A;  1SQK A;  2PY5 A;  4ZHR A;  4C8O A;  1IBK K;  4F4K A;  1GLF O;  2PAV A;  4BR0 A;  1XC9 A;  1I3A A;  4IDK A;  5BR9 A;  2I7N A;  2V51 B;  2YKM A;  5KRS A;  4LF8 K;  3M1F A;  1UA1 A;  4KKO A;  1SS6 A;  4H5T A;  3HO1 A;  2NRH A;  4CI6 A;  3VQ7 A;  5KRT A;  5AQJ A;  4DF8 A;  4LSL A;  1F21 A;  2O8D B;  2A1S A;  4DU4 A;  1BIU A;  3V1Q A;  4BC4 A;  2OZM A;  1BG3 A;  3CCV N;  4KHW A;  2FF3 B;  3CJC A;  1JLG A;  2KW4 A;  3CIP A;  3QBX A;  4CFB A;  4FK2 A;  1WBD A;  4EIA A;  1YTU A;  4LSN A;  4DWI A;  1N32 K;  1I39 A;  1IBL K;  1I94 K;  3QLH A;  4J2B A;  3KK2 A;  1ILY A;  3ULE B;  5M1Q A;  2Y1J A;  4DV0 K;  4N56 A;  3MEC A;  3C95 A;  2X6N A;  5J1E A;  4O8K A;  5AQG A;  2QWL A;  3ZYY X;  4CJW A;  3ZSV A;  4Z4C A;  4H03 B;  3G71 N;  3JAM O;  1KCF A;  4W5R A;  4K42 A;  3K9J A;  4GV9 A;  3O08 A;  3K0S A;  2KFZ A;  4H5V A;  2ZWH A;  4B9V A;  1A5W A;  1BGX T;  1VQK N;  2FBY A;  2P5G A;  1RDC A;  1QVF M;  4CF1 A;  4FWO A;  1SKS A;  3WXM B;  5SZT A;  3KWG A;  2Q0U A;  5J2Q A;  5EVZ A;  4F2S A;  2P9S B;  4OJR A;  4EP4 A;  1NGB A;  4M7X A;  4BRF A;  2CH5 A;  1Q9Y A;  2ASO A;  5J2M A;  4DSI A;  1RFQ A;  3FZF A;  3ASM A;  3BY5 A;  1IV0 A;  1B9D A;  3H46 O;  4C23 A;  2DFF A;  4Y0W A;  3IKM A;  4QOZ B;  3MWT A;  1C0U A;  4DFJ A;  1QE1 A;  1X9W A;  4BR5 A;  2P9I B;  4CJ4 A;  4OLB A;  2BUP A;  1RTJ A;  1VRU A;  4O4G A;  4FWP A;  4BAC A;  2JGU A;  1S1T A;  3H3O B;  1LAV A;  1WB9 A;  5BRE A;  4Z4I A;  3L4Q A;  3QER A;  5AZI A;  2XO7 A;  4DQS A;  1NGA A;  4C1N I;  4I6M A;  3O9U A;  3PO4 A;  2F4V K;  2KHO A;  4B9N A;  1MWM A;  3N4P A;  4FO0 A;  4PL7 A;  4RTF D;  3DLK A;  2WUS A;  2IC3 A;  3F73 A;  3LAM A;  3OS0 A;  4LC9 B;  4GVM A;  1RTI A;  2R7Y A;  4YNQ A;  2ZJQ L;  4FJJ A;  4AHS A;  2HHU A;  1RBT A;  4DSJ A;  4WQ4 A;  1J9A A;  5HOO A;  2O8E B;  1S5J A;  2W42 A;  3U3G A;  4C8K A;  4NXN K;  3EKS A;  3PV8 A;  2FBV A;  5FLX O;  4A57 A;  4EHU A;  3L8B A;  3G4S N;  2ASM A;  3AGK A;  3SPZ A;  2UXC K;  1SL0 A;  1J53 A;  4RW8 A;  4CJV A;  1L3U A;  3SBG A;  2YJE A;  2B6A A;  1C1A A;  5HRN A;  1J5O A;  3K57 A;  1P8Z A;  2NLX A;  1EKE A;  3VMF B;  3E9P A;  2IVN A;  3LDS A;  1JKH A;  3IG1 A;  3E01 A;  1S3X A;  1WLJ A;  4CJR A;  1NJI O;  4E0D A;  3J7A P;  2QXF A;  3KJV A;  2AP1 A;  1N34 K;  2Z1J A;  3EE8 A;  5I42 A;  3AA3 A;  4HWI A;  4C8M A;  1LOT B;  1Q82 O;  3RVC A;  3KZB A;  4H5W A;  1DEJ A;  4CF8 A;  4DV4 K;  5CYQ A;  4PKG A;  4H0V B;  4BGA A;  2X6S A;  3OTO K;  4OKE A;  3RMB A;  5C42 A;  4JI2 K;  3QEV A;  4DQP A;  3T1Y K;  3UKR B;  3ZX0 A;  1RDA A;  4CEF A;  5IWA K;  2NRZ A;  3M6G A;  4I6M B;  3CET A;  4H8K A;  4KHQ A;  1SAZ A;  3QB0 A;  4FLU A;  1OVQ A;  4N41 A;  5M1K A;  5JS1 A;  1NMD A;  4ID5 A;  3DLG A;  1IO2 A;  3TAQ A;  3O9Q A;  1KAZ A;  3NBP A;  4M42 A;  2FBX A;  1IJJ A;  4KHS A;  4Z4F A;  2VQE K;  4FL9 A;  1Z25 A;  3THV A;  4W5O A;  3A8Y A;  2NNW A;  5JS2 A;  2F96 A;  3S9H A;  4K8X A;  4X66 K;  1VQ4 N;  1ATR A;  3GBT A;  4IG3 A;  3VEY A;  2NRT A;  4DSL A;  3RRG A;  2F9T A;  2A3Z A;  5GAH P;  1KC8 O;  3FZM A;  3KLF A;  3SV3 A;  1JCG A;  4DCH A;  4CK2 A;  1HYZ A;  3A5M C;  4GKJ K;  4BE1 A;  5LJV A;  4CFC A;  5HRP A;  4IKF A;  2KTQ A;  4A59 A;  3UE5 A;  1NGE A;  1GLJ O;  3UKU B;  3C6U A;  4WCE L;  1QQC A;  3C6T A;  2XY5 A;  4HHT A;  4Z4E A;  1SZ2 A;  1C0M A;  4CEE A;  5KTQ A;  2OPQ A;  4JKB A;  4F3O A;  4BVP A;  3CD6 N;  1LWE A;  4DF4 A;  3CCJ N;  4F3T A;  2KKZ A;  4X64 K;  2FSJ A;  5TKY A;  4OKJ A;  5HRO A;  1X9J A;  3RMD A;  3R3L A;  4CEB A;  3HTV A;  2WBN A;  1BOT O;  3MMV A;  4DTN A;  4JNE A;  2FBT A;  3VTI A;  3FLC O;  1XNR K;  2E6M A;  4FLX A;  1ZBH A;  1TL3 A;  2DFE A;  2WFB A;  3T1A A;  5C24 A;  4EAH D;  1HQU A;  4NXM K;  3QDK A;  3HOS A;  2Q97 A;  3LP3 A;  3M8R A;  2UUA K;  2F8S A;  3MDQ A;  1VQ7 N;  4DSK A;  5TKW A;  4GW6 A;  2Y1I A;  4CK3 A;  4BR7 A;  1NK0 A;  1X9M A;  5AQS A;  1RNH A;  1YJ9 N;  5LY3 A;  4IOX A;  4CJ3 A;  4DR1 K;  3I0R A;  1VSM A;  1LWC A;  4B1Y B;  3TAR A;  4JRP A;  4CEA A;  3OBY A;  4FJ5 A;  3SQ4 A;  3PX4 A;  3I8D A;  4IEE A;  1VQL N;  4KI6 A;  4RWT A;  4BRM A;  1JLF A;  3FZL A;  1T05 A;  3DJC A;  4JHD B;  4FZY A;  3KLH A;  1QQN A;  3WXL A;  1L3V A;  4Q0B A;  2KQ2 A;  4YOU A;  4W5Q A;  3VEX A;  4WFB L;  4IWV A;  3E9O A;  2V7Z A;  3I0S A;  1WUA A;  1X1P A;  3O3H A;  5AQF A;  1NGF A;  4OO1 J;  1MU2 A;  3DXM B;  4CHZ A;  3U6F A;  1WSJ A;  1G99 A;  4FWL A;  4I9L A;  1W0H A;  4NO7 A;  4C8N A;  2ZGY A;  3EKU A;  4E19 A;  2QM1 A;  2JWK A;  4W5N A;  3THW A;  3R8E A;  1U6Z A;  3CER A;  3SPY A;  4CZJ A;  1CXU A;  4CJF A;  5AZJ A;  5EXW A;  3C0B A;  4K25 A;  1QVG M;  3THY A;  3HZ6 A;  3CHW A;  5AQL A;  5C2D A;  5BPM A;  1BA0 A;  2H3G X;  4K41 A;  3SAF A;  3C65 A;  4W5T A;  3HXM A;  3DRR A;  3TTD A;  2W41 A;  5ADX H;  3VA0 A;  4BR9 A;  2VCP A;  3HVT A;  1RDW X;  1HNI A;  4H0P A;  3ID6 A;  2UYT A;  3PSF A;  4LFA K;  4NCG A;  3U3Y A;  4DTJ A;  1VQ5 N;  1BUP A;  3HP6 A;  1ASW A;  1LV5 A;  3BEX A;  1Z26 A;  1RBR A;  4CER A;  4NCB A;  3G10 A;  1HKG A;  1YF5 L;  4CJL A;  1J6Z A;  2YNI A;  4CF2 A;  4U67 L;  5DM6 L;  3TAB A;  2KZM A;  3NGY A;  3CFR A;  3H08 A;  1OH7 A;  1VAZ A;  2IIR A;  3NHG A;  1KXP A;  5GAD P;  5AQN A;  5EU7 A;  3LM2 A;  1JLQ A;  3DAW A;  2E6L A;  1N33 K;  1XWL A;  1TUU A;  3VQ6 A;  3P83 D;  4FWS A;  2XY7 A;  3ITH A;  3BZK A;  4JS4 A;  3DMJ A;  3EL2 A;  1TKZ A;  4B3M K;  1X9S A;  3SUP A;  3ZSO A;  5KQD A;  3O4W A;  3ZT4 A;  5I9E B;  2D5R A;  2P9U A;  1NGG A;  4BC2 A;  5DM7 L;  3A5N C;  3BF1 A;  1OH8 A;  4G9Z A;  1JLA A;  3NH1 A;  3L4I A;  1NG9 A;  3AVC A;  3CM5 A;  4CZL A;  1XMQ K;  4DQR A;  3THW B;  4E89 A;  3ZEU A;  3MEG A;  2RPI A;  3U4L A;  2QEX N;  5BPN A;  4CJQ A;  3SAG A;  3FFI A;  1JJ2 M;  3L3U A;  4A2A A;  1S9G A;  4CGH A;  3QIO A;  5KGX A;  4E1J A;  3BP8 A;  3SYZ A;  1WSG A;  4BVO A;  3DLL L;  4XH1 A;  3VQ9 A;  3D7E O;  3O9R A;  3T19 A;  5T7B A;  2A41 A;  2Z1I A;  2QWR A;  4YHH K;  3MN7 A;  1NJY A;  2GWK A;  4KFB A;  3O9T A;  1HYS A;  3DLB A;  3AVK A;  3ZSX A;  4BRP A;  3M3Z A;  1NK5 A;  3NFA A;  4PUO A;  4MDA A;  4B9L A;  1BU6 O;  3RMA A;  3DXK A;  5F0X A;  4CEC A;  4WQ4 C;  2FF6 A;  3D2E A;  3FFK B;  3KLE A;  2O8B B;  2W6L A;  2A5X A;  1RBS A;  1Y97 A;  3AA5 X;  3RWU A;  2GEL A;  3BUZ B;  4CED A;  2W40 A;  1RT7 A;  3N4Q A;  1C1B A;  1TUY A;  4MLH A;  2VWB A;  4CHN A;  4JI5 K;  2NRW A;  3V9Z A;  2YHX A;  2WON A;  1NJZ A;  1S6P A;  3O1B A;  2P9U B;  4IG0 A;  3TAF A;  1S72 N;  5BN8 A;  1KAY A;  4IDH A;  3PO5 A;  1NBW A;  2OPR A;  4Z0U A;  4E3S A;  3ZEU B;  1ZXO A;  1L5U A;  4JI8 K;  2UXB K;  3UB5 A;  3L2U A;  4DR5 K;  3HM8 A;  1NGJ A;  1JLB A;  1S1X A;  4FZZ A;  4BR2 A;  2XRI A;  3OVN A;  3Q7C A;  3B8A X;  4IO9 L;  5FRO A;  1NU0 A;  1VSH A;  1KVB A;  1NLV A;  3O1W A;  3KLG A;  4H0Y B;  3SUQ A;  1EO1 A;  1YVN A;  3OYJ A;  2E1Y A;  3ENO A;  3L2R A;  1YHQ N;  3RTV A;  1VQ9 N;  2HBK A;  1TKT A;  1RT5 A;  2YNH A;  2HHS A;  1Q86 O;  3VPZ A;  3O4Q A;  4DLG A;  5AQH A;  3BGR A;  4BRD A;  4DR3 K;  3B6P A;  2P9L B;  4CW7 B;  2GV9 A;  5AQY A;  3DXK B;  4FM1 A;  4IXC A;  4BC5 A;  4K0K K;  5CZ2 A;  3QML A;  1REV A;  5HL7 L;  2E2P A;  3AVF A;  2HHQ A;  4PL8 A;  1O1W A;  4FZX C;  1T3V A;  3AVB A;  4CES A;  4E7H A;  3SV4 A;  4BRI A;  1TAU A;  5AQP A;  1JXB A;  4FWR A;  1X3M A;  3NDK A;  1OVY A;  4QAG A;  4FJ8 A;  1C1C A;  4H0X B;  4KHP K;  2X78 A;  4OGC A;  1HPZ A;  4JK9 A;  2P9N A;  5HBM A;  3HVR A;  3Q7B A;  2CGL A;  3OYA A;  5J2N A;  1KD1 O;  1YVU A;  1KLM A;  4OGE A;  4N76 A;  1TK8 A;  3WEE A;  4NLC A;  2YHY A;  4XIU A;  4FWM A;  1OH6 A;  3V9W A;  1IKW A;  4HUG A;  5FPN A;  4AQY K;  3ZSR A;  2ETJ A;  4J8F A;  5E26 A;  4DTU A;  5AQQ A;  3V1R A;  3A2F A;  4JYA K;  2NRR A;  4A5B A;  3NE6 A;  1ZBL A;  5FPM A;  1KVC A;  3CJ7 A;  1RBU A;  3MX5 A;  4CF0 A;  4CJT A;  3CQY A;  1IBM K;  3VQD A;  1ZBU A;  1B92 A;  4F8R A;  1WSI A;  2D1K A;  1NKB A;  4B3R K;  4FVU A;  1HX1 A;  5JLH A;  2E2Q A;  3VQC A;  2CGK A;  1YJN N;  1JXE A;  1XMO K;  4Y1D A;  1QSY A;  2YHA A;  4BR4 A;  3RMC A;  3FZH A;  3TTF A;  3MX2 A;  4J2D A;  1YI2 N;  4CGF A;  3VER A;  3AVA A;  2HHX A;  2FLO A;  3SUO A;  4QS7 A;  1U4B A;  1W97 L;  4CJ7 A;  4JI1 K;  4LF7 K;  3J8A A;  2O8C A;  1R59 O;  2FSK A;  4JKG A;  3PUF A;  5C25 A;  2OYQ A;  4BG9 A;  3WUH A;  4HVJ A;  1YUW A;  2YI1 A;  3S3M A;  4AHT A;  2GWJ A;  2I5J A;  2ITG A;  1VSL A;  4CGD A;  4A61 A;  1KRP A;  4KPY A;  3HOT A;  1HKB A;  1RDD A;  1TYQ A;  4B9Q A;  4CJ5 A;  2ZJR L;  3CF5 L;  4GY2 B;  3W3D A;  3AVH A;  1RDB A;  2HHH K;  4PY5 A;  1CLQ A;  2E2O A;  1U04 A;  2D0C A;  5AQI A;  4HTU A;  4L8R B;  2Q0R A;  3ISN C;  3AAR A;  5KQ8 A;  3DLE A;  3OS2 A;  3DI6 A;  1FXX A;  2A1R A;  5GIP A;  3S41 A;  4BWJ A;  1S22 A;  1K9M O;  5M1F A;  4R5P A;  1KTQ A;  1NK6 A;  1ZBF A;  2PBD A;  2G8U A;  1SL2 A;  2YNG A;  3CJB A;  2RE2 A;  3HL8 A;  1Q7Y O;  1FKO A;  2XY6 A;  1CZB A;  3O3G A;  4KHU A;  1CZ9 A;  4KBO A;  3HYF A;  3HM9 A;  1IKY A;  4CIE A;  4CBX A;  4N47 A;  2O8F A;  4B1W B;  4M7Y A;  4YOY A;  4I2Q A;  3WNG A;  2YHB A;  4IJN A;  2G8V A;  3VN5 A;  2RHK A;  3CCU N;  4FCY A;  4CGI A;  3AO4 A;  3GDQ A;  4ICL A;  3QNO A;  3AVL A;  4PWD A;  4N5S A;  2IVP A;  4O5B A;  4BRC A;  3PX6 A;  3WNE A;  1E4F T;  4KO0 A;  2D0P A;  2GUP A;  4H5R A;  3M8Q A;  3LWL A;  4FOE A;  5F2R A;  4DSF A;  1Q9X A;  4ELV A;  1ZC6 A;  4FWQ A;  4FM0 A;  1VSK A;  4CGJ A;  1QQM A;  5AZI B;  5FRN A;  3ZSQ A;  4JKG B;  3ZT1 A;  2B5J A;  5CR4 A;  4CBU A;  3IFR A;  1ASV A;  3FZK A;  3LP1 A;  4OX9 K;  1EP4 A;  3TR8 A;  5JLF A;  4I7F A;  3H3N O;  2ZGZ A;  4BRL A;  1N36 K;  1T8E A;  1EWQ A;  3LP2 A;  1LW2 A;  1BIS A;  1EET A;  5EX5 A;  1NMN A;  2G8K A;  5E41 A;  2GEM A;  3EE9 A;  4I2P A;  3TSP A;  1NKE A;  1M90 O;  5KPZ A;  4WYB A;  4KB1 A;  5GIO A;  3CCL N;  3O80 A;  2UXD K;  3CJ1 A;  1GLB G;  3VET A;  4R79 A;  3LPU A;  3CJ9 A;  3H1V X;  3HI0 A;  2ITM A;  3K5L A;  5CZ1 A;  4LF9 K;  3THX A;  2E88 A;  2HB5 A;  2Z1G A;  2DTU A;  2D0O A;  1VSI A;  1CXQ A;  4FLV A;  1VK0 A;  5MLC Q;  4C8L A;  3OYL A;  1ATN A;  3EZ5 A;  1C0F A;  1YXQ A;  1X3N A;  4MO4 A;  3MN6 A;  4DTP A;  1UA0 A;  4X65 K;  3IRX A;  1QSS A;  3EY1 A;  3MWP A;  3KKR A;  3A0I X;  2HHT A;  3C6H A;  4LH5 A;  4K43 A;  1HKC A;  1T44 A;  4M63 C;  3LAL A;  4H4O A;  1UAX A;  2HW3 A;  1WN7 A;  2A40 A;  3O5B A;  3D2F A;  2E2N A;  2OCE A;  4DV6 K;  4M41 A;  1L3T A;  1YAG A;  2Q31 A;  1TKX A;  1RT2 A;  2GTD A;  4KTZ A;  5AQX A;  4WF9 L;  4JK8 A;  4H0T B;  3H1Q A;  5AJ3 K;  4JRQ A;  3HBT A;  5M1O A;  3AAP A;  2YJF A;  4CCH A;  5JMV A;  1HYV A;  3AO1 A;  3VES A;  3OW2 M;  4TSX A;  3CI5 A;  1JL1 A;  2HHW A;  2I7P A;  4DSE A;  3F2K A;  3PX0 A;  3VEO A;  3MCP A;  4CGG A;  2VWJ A;  1RT4 A;  3CMA N;  4CEQ A;  2QWN A;  3SMP A;  1NJX A;  3HSC A;  3OYB A;  1K73 O;  3HPO A;  2E1Z A;  3WXJ A;  1DTT A;  4E1N A;  4UY8 O;  3OYK A;  4Z94 A;  1N6Q A;  3DLR A;  3VEZ A;  3DYA A;  1K8K A;  3LDP A;  2QI2 A;  4FSV A;  3V81 A;  3D0P A;  3WNH A;  2Q1N A;  4B9M A;  3SI6 A;  4IJA A;  1DKG D;  2PFU A;  5C2F A;  3AVG A;  1D4X A;  3MN9 A;  4JI0 K;  5CYM A;  2QTD A;  5C15 A;  4B8C A;  2YV0 X;  1SUQ A;  1NGC A;  2FC0 A;  2GX9 A;  3ZET A;  3CPW M;  4PA1 A;  4AIL C;  1RDU A;  1JLC A;  1S6Q A;  1WNS A;  2YKN A;  1TV6 A;  4JD2 A;  4RW9 A;  3WNF A;  2UUB K;  1VSD A;  3MED A;  4JKE A;  4F9O A;  4B3S K;  1J54 A;  4IEI A;  1HJR A;  1HRH A;  1NK4 A;  4AHV A;  1D9D A;  4FJ7 A;  5H1S Q;  3J80 O;  4GV6 A;  5LL6 Z;  4L3Q A;  3DRS A;  3IS9 A;  4JLH A;  1ITG A;  5I3U A;  1EX4 A;  4H4M A;  1WSF A;  5EOY A;  1NGD A;  1LWF A;  5D3G A;  3HJF A;  2VWK A;  1UWB A;  3DM2 A;  3NF9 A;  5SWM A;  1IG9 A;  3CQ8 A;  1H1V A;  3VF4 A;  2XY8 A;  3UIQ A;  4FLY A;  4KH5 A;  2IVO A;  4YDU A;  2VG5 A;  3VQ4 A;  4FK4 A;  2QWP A;  3SJJ A;  4GKK K;  3CME N;  3HP9 A;  3NH2 A;  5BRD A;  1HNX K;  4CZF A;  1KFS A;  2NZT A;  4B1U B;  4IFV A;  1EXQ A;  3KIO A;  4DQQ A;  4MFB A;  4FJM A;  1D5A A;  3CG7 A;  5BN9 A;  4DTM A;  2P51 A;  3SQ2 A;  1U2V A;  4FW1 A;  4JI7 K;  4AHU A;  2AJQ A;  2J4R A;  3ENH A;  4CEZ A;  4DV2 K;  1RCH A;  2PYL A;  1TAQ A;  2P9K A;  4LY7 A;  1Q18 A;  1BIZ A;  4ZTJ A;  3S3N A;  4LF5 K;  4CZG A;  4MLE A;  5BPL A;  4CHO A;  4CHY A;  2Q2R A;  2QXL A;  1T6C A;  4E7K A;  4LD0 A;  5BRH A;  3OJU A;  3MXI A;  3RRH A;  1SKW A;  1HMV A;  3GG4 A;  4KH4 A;  4BQL A;  4Z4G A;  1WBB A;  1QZ5 A;  3FE1 A;  3SMS A;  4PQU A;  1VRT A;  4DTX A;  1NM1 A;  3G0Z A;  2HVH A;  4E1M A;  3ZT0 A;  2IGI A;  5AZJ B;  3NGZ A;  4B3T K;  4DV5 K;  4RG8 A;  4IO8 A;  3THY B;  4JI6 K;  2F7T A;  4LFB K;  1ASU A;  3MK6 A;  1C0G A;  4CK1 A;  3SQ1 A;  4WQ5 A;  1GLE G;  3LDQ A;  4DR2 K;  1FJG K;  3OA9 A;  3CXC M;  5FDL A;  2ZD1 A;  4BDY A;  1GLL O;  2HF3 A;  3RSE A;  1VQN N;  4MDB A;  3E66 A;  3W0L A;  4A62 A;  1J5E K;  4O8U A;  4QCL A;  1QHT A;  1IKV A;  4DQ8 A;  1B9F A;  3TAG A;  3S3O A;  2VG7 A;  4FPA A;  3CCR N;  1ZYQ A;  4B8A B;  2VG6 A;  3OYI A;  2OTL N;  3VQP A;  2QWO A;  3SJH A;  2LSN A;  5BR8 K;  3JSM A;  5JIC A;  4GMJ B;  1U48 A;  3CYM A;  3ZX2 A;  4DMN A;  3TSU A;  4FPB A;  4H5N A;  4B08 A;  4YOX A;  1VQ6 N;  1BCM A;  3WQU A;  1U45 A;  3C6A A;  3TAP A;  4FOI A;  3V4I A;  2P9P A;  3MAQ A;  3LZI A;  3KLI A;  4CD1 A;  1HR0 K;  5AQO A;  5GAE P;  4FLZ A;  2HBM A;  3L0Q A;  2BAN A;  4E7L A;  2Z1H A;  2O8D A;  4XH5 A;  3KHY A;  4DFK A;  4M3W A;  4DV7 K;  3HK2 A;  3SK3 A;  3P39 A;  1XI1 A;  3NVK A;  3ZSW A;  4YOT A;  3QIC A;  4CE9 A;  2QKK A;  1XHZ A;  1K6Y A;  1QZ6 A;  1IG8 A;  2QWQ A;  4DU1 A;  4NYN A;  2HNZ A;  1K8A O;  1NWK A;  4WFN L;  4B1Z A;  3NVM A;  3AVI A;  4BE2 A;  2E4L A;  3ULE A;  4BRH A;  3JS6 A;  3U9Z A;  3O4N A;  4J2E A;  4PKI A;  2WTU A;  3K5O A;  4HCC A;  3VQQ A;  3OYG A;  5LMU K;  1TK0 A;  3L2W A;  3AA4 A;  3KKS A;  3RSE B;  5E84 A;  2RN2 A;  3SUN A;  3K2P A;  3GL1 A;  5ELZ A;  2QK9 A;  1DGK N;  1JCF A;  1WAF A;  5LMN K;  1VHX A;  4CZK A;  3D6R A;  4BWM A;  2QW9 A;  2HNY A;  4JKD A;  3QEW A;  1QTM A;  4AF1 A;  1NOY A;  2GUI A;  3VA3 A;  2P9S A;  4B9S A;  4KHN A;  3O3F A;  3LDN A;  3D2E B;  4CZE A;  1KSP A;  4JKA A;  1BHL A;  4OKK A;  4AM6 A;  5FPE A;  4HTL A;  3C94 A;  4YFU A;  3U8X A;  5A2Q O;  4KRF A;  1FKP A;  4JI4 K;  4BRE A;  2P9P B;  2P9I A;  3P31 A;  3NH0 A;  4DU3 A;  3K58 A;  3AO2 A;  4Z4H A;  5HLF A;  4M3X A;  3PIP L;  5C0Y A;  3HST B;  3LL3 A;  3FR0 A;  3ZLJ A;  1SL1 A;  3GE1 A;  3IUC A;  3J81 O;  3O8M A;  1JCE A;  1RIL A;  4FM2 A;  5IT9 O;  3I8B A;  1S1V A;  3ZT3 A;  4FWK A;  2E5L K;  2ZE2 A;  4QS9 A;  3PLA A;  2VQF K;  3MN5 A;  3D45 A;  4BRK A;  2G8F A;  1RGI A;  4EZ6 A;  2HST A;  5C10 A;  4BRO A;  3OYC A;  4CFA A;  5KI6 A;  4AHC A;  1Q8I A;  3QET A;  2O4I A;  3T1H K;  3QEX A;  3FGU A;  4AH9 A;  2P1J A;  4AHR A;  1HQE A;  4CF9 A;  2OPP A;  4FJN A;  1VSE A;  2QWM A;  3SBT A;  4FK0 A;  2O8E A;  4KV8 A;  1HLU A;  1EWR A;  3QIP A;  1DLO A;  3L2Q A;  4ILJ A;  3KTQ A;  3AAQ A;  4LFC K;  1TGO A;  1NOZ A;  3K9K A;  1LW0 A;  1BA1 A;  4M3U A;  3TAN A;  4FLW A;  4CEO A;  1DT9 A;  4IFY A;  5BRF A;  3LAK A;  4CZH A;  2PYJ A;  1NGI A;  1V4T A;  4DR6 K;  3OYF A;  1RT1 A;  4JKH A;  1BQN A;  3LZJ A;  3KK1 A;  1WOQ A;  3WXI A;  4X62 K;  3HPH A;  1D9F A;  3LM9 A;  4BQZ A;  3OYN A;  4DKW A;  2JWL A;  4QS8 A;  3J7Z O;  3LPT A;  4YOW A;  2QKB A;  2VGM A;  5JVG L;  4IOC L;  1BI4 A;  1WSE A;  3OJS A;  3I55 N;  1HNW K;  3LDO A;  3VGL A;  5M1N A;  2NRX A;  4M3Y A;  2HND A;  2B4J A;  3SQ0 A;  2V7Y A;  1HPM A;  3SCX A;  3CC7 N;  4FJX A;  1ZBI A;  3RR8 A;  4ILH A;  4CHQ A;  3O6W A;  5AFU H;  3R1X A;  2P9N B;  3UKR A;  3G6E N;  1SKR A;  4ILG B;  5CHI A;  3AVN A;  4LH4 A;  3PY8 A;  1JL2 A;  1QSL A;  1RT6 A;  3TWH A;  5AQT A;  3WEE B;  5AQU A;  1D8Y A;  1KAX A;  1VSJ A;  1WAJ A;  2YNF A;  1A5V A;  3AO3 A;  3ZX3 A;  5DK5 A;  5AR0 A;  3NMU A;  4ID1 A;  2IOC A;  4U7B A;  3AVM A;  4FJ9 A;  4FYD A;  1LAW A;  1LCU A;  3JYT A;  4BE0 A;  2HMI A;  4FXD A;  4ISF A;  5AQM A;  4CVN E;  5DMR A;  3PSI A;  1OH5 A;  4OPK A;  1NK9 A;  4LF4 K;  1BO5 O;  2V52 B;  2Q3S A;  1KQS M;  4M3R A;  4HCB A;  3LP0 A;  3AV9 A;  1NKC A;  3VEV A;  4FJH A;  3MCA B;  1Y64 A;  4CJP A;  3CCS N;  4XEI A;  3VQ8 A;  4YDU C;  2O8C B;  4Q5V A;  4BGB A;  4JI3 K;  3UKU A;  2IAJ A;  2E20 A;  3NAE A;  3OS1 A;  2HMP A;  4AM7 A;  3IAY A;  3QIN A;  1BI4 B;  1MA9 B;  4DR4 K;  2BGG A;  4BRG A;  2ZM6 K;  3V9X A;  2JLE A;  3C7N A;  3SAH A;  3ZSY A;  1GLD G;  1TYQ B;  3ULD A;  2HBL A;  3VQB A;  2KFN A;  3I33 A;  4EHT A;  1OKJ A;  4FJL A;  1FK9 A;  4CBW A;  3CCE N;  3U9D A;  1NGH A;  2E8A A;  4IBN A;  4DTS A;  4JEP A;  2CGJ A;  4DTO A;  2O4G A;  4BRN A;  5LJW A;  4CZI A;  5JVH L;  4E7I A;  2BH1 A;  3K5N A;  4DQI A;  1QHA A;  1QS4 A;  4JS5 A;  2ATQ A;  4O44 A;  1EQY A;  2QA4 N;  2NRV A;  5ADX A;  3B6O A;  4JN4 A;  4NB4 A;  3H45 C;  4DUY K;  5CY4 A;  1S1U A;  3R6M A;  2O8F B;  1ATS A;  4FWN A;  3V9S A;  5FPD A;  1YIJ N;  3E9L A;  1SV5 A;  3P5J A;  4F2R A;  2KZZ A;  3BZC A;  3E1Y A;  4XH4 A;  3J7Y P;  3NF7 A;  1FW6 A;  4CJS A;  5KGW A;  4CJU A;  1T6D A;  3BF3 A;  1DTQ A;  3PIO L;  2WC9 A;  1L3S A;  4EFH A;  3QEP A;  3DLH A;  1T03 A;  3LAN A;  4JHD A;  5M1P A;  2G8I A;  4KH6 A;  3QES A;  4ELT A;  4KRE A;  4A2B A;  4WQ5 C;  3EN9 A;  1U47 A;  4M45 A;  4GVE A;  3QFU A;  3MXJ A;  2DY4 A;  1IKX A;  2BE2 A;  4GNI A;  4DS5 A;  4KI4 A;  4Y1C A;  3CJA A;  2G8H A;  4B9T A;  1E3M A;  5AQZ A;  4BDZ A;  4JV5 K;  3WXK A;  3VEN A;  4E7J A;  1BDG A;  3TI0 A;  3C7N B;  4PHT X;  2P5O A;  1W7A A;  1HJO A;  3DXM A;  3SZ2 A;  4K8Z A;  4JKF A;  3HT3 A;  4JK7 A;  3CCQ N;  3HPG A;  3TPQ A;  2KLA A;  4HUF A;  1VQM N;  3EO3 A;  4OLA A;  4WE1 A;  1YJW N;  1NK8 A;  2FXU A;  2YHW A;  3ATV A;  3CPE A;  4RW7 A;  3TSQ A;  3L2V A;  3NF8 A;  1S1W A;  3CQX A;  2W6K A;  1ZBS A;  2HHV A;  2YX6 A;  3VF2 A;  2IDO A;  3OYD A;  4FVM A;  1T7P A;  2VGN A;  2FSN A;  3KWI A;  3VTH A;  4LF6 K;  5FRM A;  2OPS A;  1O13 A;  1XC3 A;  1BWF O;  4M3T A;  3OYH A;  1TK5 A;  2PZS A;  3F9K A;  4DTR A;  3THX B;  1XQS C;  4J2A A;  2HVI A;  2GBZ A;  3ATU A;  4M3Z A;  3F9M A;  3OYM A;  1WSH A;  3L6Q A;  1GOB A;  1RBV A;  1VQP N;  4BY9 C;  1MWK A;  1GLA G;  4BRA A;  2WOM A;  3LDL A;  4DFM A;  1NNE A;  3VEW A;  3A5L C;  1RTH A;  4MO5 A;  3TU5 A;  2ZF5 O;  2ZQB A;  4IFE A;  4KAZ A;  4CZM A;  1BCO A;  3D2F B;  2XHB A;  2VYP A;  2HBJ A;  3KVG A;  4KHY A;  4DG1 A;  3M5R A;  1NJW A;  3TAM A;  4DV1 K;  4ELU A;  3MEE A;  2EHG A;  2OTJ N;  3T7Z A;  1NK7 A;  3KD1 E;  3QBW A;  1W9H A;  1N8R O;  1HUX A;  4O0I A;  3NCI A;  4NLB A;  1P90 A;  3KK3 A;  3AA2 A;  4CFD A;  3CM6 A;  1XUP O;  2D0A A;  3R9P A;  3OY9 A;  3O9S A;  3F5T A;  1GOC A;  2CH6 A;  1BQM A;  2HOE A;  4OPH A;  2OAN A;  1TVR A;  3P4I A;  4CIG A;  2UU9 K;  5KPR A;  1HNV A;  1GOA A;  3OBW A;  4DFP A;  1R0A A;  2OA8 A;  1VQ8 N;  2YCH A;  3ENB A;  5J2P A;  2OZS A;  1V4S A;  4KTW A;  2F8T A;  3AY9 A;  3ZCM A;  1K8K B;  1QQO A;  5AQW A;  5F1X A;  4KTQ A;  4DLE A;  1C6V A;  3EZW A;  4ZTF A;  1E4G T;  4B1V A;  3QNN A;  5HRS A;  3GOI A;  5HRR A;  5AQR A;  1BL3 A;  4JKC A;  1ESV A;  2D0B A;  4G1Q A;  2BDP A;  5AQK A;  4ISE A;  3VF6 A;  3P1G A;  2HF4 A;  4YOR A;  3ZSZ A;  1N5Y A;  4DS4 A;  3ZET B;  1KFD A;  4DR7 K;  3HRG A;  3KK7 A;  3A5O C;  4O0J A;  3IDH A;  3K5M A;  4JD2 B;  3EYZ A;  1HNZ K;  4FJK A;  1RT3 A;  2DPN A;  4FW2 A;  1YTA A;  3ALY A;  2AA4 A;  2IS3 A;  4ISG A;  4BG8 A;  4B3O A;  4DV3 K;  2O8B A;  1U49 A;  4IOA L;  2ZJP L;  3BDP A;  4O5F A;  1TKD A;  3KD5 E;  3CFP A;  4OVL A;  3WQT A;  4WFA L;  3IMX A;  4EP5 A;  5B8H A;  1UOC A;  3JXU A;  4NCA A;  5KPT A;  1CZA N;  4BC3 A;  3P38 A;  2ASP A;  4MQ3 A;  1XHX A;  3QEI A;  1JLE A;  3DRP A;  3M8P A;  4YY3 K;  4I9Q A;  4C1N K;  5K14 A;  5HP1 A;  3T69 A;  4FJG A;  4YOV A;  4RCH A;  3EEQ A;  4V19 S;  2G8W A;  1TL1 A;  4FLT A;  1KLN A;  4NYF A;  2EX3 A;  2Q36 A;  2A42 A;  1MDU B;  4CJE A;  5GIN A;  1Z6R A;  3V9U A;  3AVJ A;  1KVA A;  3NGI A;  1VSF A;  2DFH A;  3L3V A;  3LWM A;  3V6D A;  4B9U A;  1Q81 O;  1U2V B;  4BDP A;  2RKI A;  3NF6 A;  3T3F A;  1GLC G;  1IH7 A;  2P9K B;  2RF2 A;  4HUE A;  4KB0 A;  4UQG A;  3SNN A;  5C12 A;  4RW4 A;  4H0O A;  2P9L A;  4OPA A;  2NUB A;  3CFO A;  1YT3 A;  2F9W A;  2EWS A;  3QFP A;  1VQO N;  3VGK A;  3ZT2 A;  3CC2 N;  4CHP A;  4GV3 A;  4DB3 A;  5CE3 A;  1A5X A;  4PKH A;  3I56 N;  2D4W A;  4RW6 A;  1RTD A;  4JAX A;  3DWL A;  4O55 A;  3WT0 A;  3CCM N;  4CD3 A;  3RR7 A;  5EY4 A;  2X74 A;  2A6A A;  2BTF A;  5AFU A;  3H6E A;  4BRQ A;  3G25 A;  3DOL A;  3CC4 N;  1Z05 A;  3SLC A;  3VQA A;  3QO9 A;  3M8S A;  3OHR A;  4OPJ A;  1W2B M;  2UUC K;  3V1O A;  1YIT N;  5AQV A;  4CIF A;  3VQ5 A;  3TAE A;  5GAG P; 
#chains in the Genus database with same CATH homology
 3O5B A;  3D2F A;  2E2N A;  4A5A A;  1HKG A;  1M1K O;  1YF5 L;  4B1X B;  1YAG A;  2Q31 A;  1J6Z A;  2GTD A;  4U67 L;  5DM6 L;  3VOV A;  5AQX A;  4WF9 L;  4JK8 A;  5AQT A;  3WEE B;  4IZ9 A;  5AQU A;  4H0T B;  3H1Q A;  3HBT A;  5M1O A;  1VAZ A;  2IIR A;  3AAP A;  4DHY A;  1KAX A;  2YJF A;  3ID8 A;  3VGM A;  3ZX3 A;  5JMV A;  1KXP A;  5AR0 A;  5GAD P;  3VES A;  5AQN A;  3NMU A;  3LM2 A;  3TTC A;  3OW2 M;  3AGR A;  3DAW A;  1SQK A;  1TUU A;  4FWS A;  3CI5 A;  4U7B A;  2I7P A;  1GLF O;  2PAV A;  4BR0 A;  3F2K A;  3EL2 A;  1LCU A;  3MCP A;  3VEO A;  5KQD A;  3CMA N;  2QWN A;  3O4W A;  5BR9 A;  5I9E B;  2I7N A;  2V51 B;  2P9U A;  1NGG A;  3SMP A;  1K73 O;  3HSC A;  3M1F A;  4ISF A;  4BC2 A;  2E1Z A;  5DM7 L;  5AQM A;  3WXJ A;  3A5N C;  3BF1 A;  4G9Z A;  4UY8 O;  3L4I A;  1BO5 O;  1SS6 A;  4H5T A;  2V52 B;  2NRH A;  4CI6 A;  4CZL A;  4Z94 A;  5AQJ A;  3VEZ A;  1KQS M;  3ZEU A;  1K8K A;  3LDP A;  2QI2 A;  3U4L A;  2QEX N;  3VEV A;  4FSV A;  5BPN A;  3SAG A;  1JJ2 M;  2Q1N A;  4A2A A;  3MCA B;  4E1J A;  3BP8 A;  1Y64 A;  4BC4 A;  4IJA A;  4BVO A;  3DLL L;  4XEI A;  4XH1 A;  1BG3 A;  4YDU C;  1DKG D;  3CCS N;  4BGB A;  3CCV N;  3UKU A;  2PFU A;  2E20 A;  2FF3 B;  5C2F A;  3D7E O;  3CJC A;  2HMP A;  3CIP A;  3O9R A;  3QBX A;  4AM7 A;  1D4X A;  3MN9 A;  4EIA A;  1MA9 B;  2QTD A;  4BRG A;  5C15 A;  2A41 A;  3C7N A;  2QWR A;  3SAH A;  1NGC A;  1GLD G;  2GX9 A;  1TYQ B;  1ILY A;  3MN7 A;  3ZET A;  3ULE B;  3CPW M;  2GWK A;  5M1Q A;  1RDU A;  2HBL A;  3O9T A;  3I33 A;  4EHT A;  1OKJ A;  4JD2 A;  4O8K A;  5AQG A;  2QWL A;  4BRP A;  3ZYY X;  4JKE A;  4F9O A;  3M3Z A;  4CBW A;  4H03 B;  3G71 N;  3CCE N;  3U9D A;  1NGH A;  2E8A A;  4MDA A;  4K42 A;  3K9J A;  4GV9 A;  4JEP A;  2CGJ A;  4IEI A;  3O08 A;  1BU6 O;  2ZWH A;  4H5V A;  3DXK A;  4BRN A;  5LJW A;  4CZI A;  5F0X A;  5JVH L;  1VQK N;  5H1S Q;  2BH1 A;  4WQ4 C;  4GV6 A;  2FF6 A;  3D2E A;  4L3Q A;  1QVF M;  3FFK B;  1QHA A;  4FWO A;  2A5X A;  1EQY A;  3WXM B;  2QA4 N;  3KWG A;  2Q0U A;  2GEL A;  2NRV A;  5EOY A;  2P9S B;  5EVZ A;  5ADX A;  4JN4 A;  1NGD A;  1NGB A;  3BUZ B;  4M7X A;  2CH5 A;  4BRF A;  2W40 A;  3N4Q A;  4NB4 A;  2ASO A;  1TUY A;  4MLH A;  3H45 C;  1RFQ A;  2VWB A;  3R6M A;  3FZF A;  1ATS A;  4FWN A;  3H46 O;  4C23 A;  1H1V A;  2NRW A;  3IKM A;  4Y0W A;  2YHX A;  3VF4 A;  5FPD A;  1YIJ N;  3MWT A;  3E9L A;  3O1B A;  2P9U B;  4KH5 A;  2IVO A;  2P9I B;  4BR5 A;  3E1Y A;  4XH4 A;  4YDU A;  2BUP A;  2QWP A;  1S72 N;  4FWP A;  5BN8 A;  1KAY A;  1T6D A;  3BF3 A;  3CME N;  3PIO L;  2WC9 A;  4IDH A;  5BRD A;  1NBW A;  3H3O B;  4EFH A;  3ZEU B;  1ZXO A;  5BRE A;  3L4Q A;  4CZF A;  2NZT A;  4B1U B;  5AZI A;  4JHD A;  3UB5 A;  5M1P A;  1NGA A;  4KH6 A;  4C1N I;  3HM8 A;  4A2B A;  4I6M A;  4WQ5 C;  1NGJ A;  3EN9 A;  3O9U A;  4GVE A;  3QFU A;  5BN9 A;  2KHO A;  4BR2 A;  4GNI A;  3Q7C A;  1U2V A;  1MWM A;  3B8A X;  3N4P A;  4FO0 A;  4IO9 L;  3CJA A;  4PL7 A;  4RTF D;  5AQZ A;  3WXK A;  2J4R A;  2WUS A;  3ENH A;  3VEN A;  1NLV A;  1BDG A;  3O1W A;  3C7N B;  4PHT X;  4LC9 B;  2P9K A;  4H0Y B;  2ZJQ L;  1HJO A;  1Q18 A;  3DXM A;  4JKF A;  1EO1 A;  1YVN A;  4JK7 A;  3CCQ N;  4WQ4 A;  3TPQ A;  2KLA A;  2E1Y A;  1VQM N;  3ENO A;  3EO3 A;  1YHQ N;  1VQ9 N;  5HOO A;  4CZG A;  2HBK A;  1YJW N;  4MLE A;  5BPL A;  2Q2R A;  2QXL A;  3EKS A;  1T6C A;  2FXU A;  4A57 A;  5BRH A;  1Q86 O;  2YHW A;  3VPZ A;  3ATV A;  3CPE A;  4EHU A;  5AQH A;  3TSQ A;  4KH4 A;  3GG4 A;  4BQL A;  3G4S N;  2ASM A;  3AGK A;  3CQX A;  4BRD A;  1ZBS A;  1QZ5 A;  2P9L B;  3SBG A;  2YX6 A;  3FE1 A;  3DXK B;  5AQY A;  3SMS A;  3VF2 A;  2YJE A;  4IXC A;  4BC5 A;  2VGN A;  2FSN A;  3KWI A;  3QML A;  3VTH A;  1NM1 A;  5HL7 L;  2E2P A;  4PL8 A;  1P8Z A;  1O13 A;  2NLX A;  3VMF B;  3E9P A;  1T3V A;  1XC3 A;  2IVN A;  5AZJ B;  1BWF O;  1S3X A;  4BRI A;  1NJI O;  4IO8 A;  2AP1 A;  5AQP A;  1XQS C;  2F7T A;  3EE8 A;  3MK6 A;  4FWR A;  1X3M A;  4HWI A;  1OVY A;  1LOT B;  3ATU A;  4H0X B;  1C0G A;  1Q82 O;  3RVC A;  3F9M A;  3KZB A;  4H5W A;  4WQ5 A;  4JK9 A;  1DEJ A;  1GLE G;  3L6Q A;  3LDQ A;  4PKG A;  2P9N A;  4H0V B;  4BGA A;  3OA9 A;  3CXC M;  1VQP N;  4BY9 C;  1MWK A;  3Q7B A;  1GLA G;  2CGL A;  1GLL O;  2HF3 A;  3RSE A;  4BRA A;  1KD1 O;  4MDB A;  1VQN N;  3LDL A;  3E66 A;  3W0L A;  4A62 A;  4O8U A;  3VEW A;  3A5L C;  4DQ8 A;  4MO5 A;  3UKR B;  3TU5 A;  4FPA A;  3ZX0 A;  2ZF5 O;  3CCR N;  3WEE A;  4NLC A;  4IFE A;  2YHY A;  2NRZ A;  4FWM A;  4CZM A;  5FPN A;  3D2F B;  3M6G A;  4I6M B;  2VYP A;  3CET A;  2HBJ A;  4J8F A;  5E26 A;  2QWO A;  2OTL N;  5AQQ A;  3SJH A;  2NRR A;  4A5B A;  5FPM A;  1SAZ A;  3KVG A;  5JIC A;  3CJ7 A;  3M5R A;  3QB0 A;  3MX5 A;  3ZX2 A;  3CQY A;  3TSU A;  4FPB A;  4H5N A;  4YOX A;  5M1K A;  1VQ6 N;  2OTJ N;  1NMD A;  3WQU A;  3T7Z A;  3C6A A;  3QBW A;  2D1K A;  3O9Q A;  1KAZ A;  1N8R O;  1HUX A;  4FOI A;  4FVU A;  1HX1 A;  4NLB A;  1P90 A;  5JLH A;  2E2Q A;  2P9P A;  2CGK A;  1YJN N;  1XUP O;  3R9P A;  4CD1 A;  1IJJ A;  4BR4 A;  4FL9 A;  3FZH A;  5AQO A;  3MX2 A;  3O9S A;  3TTF A;  3A8Y A;  5GAE P;  2HBM A;  2NNW A;  3L0Q A;  3F5T A;  1YI2 N;  3VER A;  2CH6 A;  2HOE A;  4OPH A;  2OAN A;  1VQ4 N;  3P4I A;  1ATR A;  2FLO A;  3GBT A;  4XH5 A;  5KPR A;  3KHY A;  3VEY A;  3OBW A;  2NRT A;  4QS7 A;  1VQ8 N;  2F9T A;  2YCH A;  1W97 L;  3ENB A;  4CJ7 A;  1V4S A;  2A3Z A;  3SK3 A;  3P39 A;  3FZM A;  5GAH P;  1KC8 O;  3NVK A;  1JCG A;  3AY9 A;  4YOT A;  4DCH A;  3J8A A;  1K8K B;  1QQO A;  3QIC A;  5AQW A;  5F1X A;  1R59 O;  3A5M C;  2FSK A;  3EZW A;  4JKG A;  1E4G T;  1IG8 A;  1QZ6 A;  4B1V A;  4BG9 A;  3WUH A;  5LJV A;  2QWQ A;  3GOI A;  1YUW A;  5AQR A;  2YI1 A;  4A59 A;  4JKC A;  2GWJ A;  1NGE A;  3UE5 A;  1NWK A;  4WFN L;  1K8A O;  1GLJ O;  3UKU B;  4A61 A;  3NVM A;  4B1Z A;  4WCE L;  1HKB A;  1TYQ A;  4B9Q A;  3HOT A;  1ESV A;  3ULE A;  2ZJR L;  3CF5 L;  4GY2 B;  3W3D A;  4BRH A;  5AQK A;  1SZ2 A;  3JS6 A;  3U9Z A;  4PKI A;  4ISE A;  3VF6 A;  2E2O A;  2HF4 A;  4JKB A;  5AQI A;  4BVP A;  3CD6 N;  4YOR A;  2Q0R A;  3AAR A;  5KQ8 A;  3ZET B;  3CCJ N;  5GIP A;  3S41 A;  2KKZ A;  3HRG A;  2FSJ A;  5E84 A;  5TKY A;  3RSE B;  3KK7 A;  1S22 A;  3A5O C;  3IDH A;  1K9M O;  4JD2 B;  5M1F A;  2DPN A;  1X9J A;  3GL1 A;  2PBD A;  3R3L A;  5ELZ A;  1DGK N;  1JCF A;  2WBN A;  3HTV A;  1BOT O;  3MMV A;  2AA4 A;  4JNE A;  4ISG A;  3CJB A;  3VTI A;  4CZK A;  3D6R A;  3FLC O;  4BG8 A;  2RE2 A;  2QW9 A;  4JKD A;  1Q7Y O;  4IOA L;  4AF1 A;  2WFB A;  2ZJP L;  4KBO A;  2P9S A;  3LDN A;  3D2E B;  4O5F A;  4CZE A;  4EAH D;  4JKA A;  5FPE A;  4AM6 A;  4CBX A;  3WQT A;  4HTL A;  3QDK A;  3HOS A;  2Q97 A;  4WFA L;  4B1W B;  3IMX A;  3MDQ A;  3U8X A;  4M7Y A;  5B8H A;  1VQ7 N;  4YOY A;  5TKW A;  3JXU A;  4IJN A;  4BR7 A;  4BRE A;  2P9P B;  5AQS A;  2P9I A;  2RHK A;  3P31 A;  3CCU N;  3GDQ A;  5KPT A;  1CZA N;  1YJ9 N;  4BC3 A;  5LY3 A;  3P38 A;  3PIP L;  5C0Y A;  2ASP A;  3LL3 A;  4IOX A;  3FR0 A;  3GE1 A;  3IUC A;  2IVP A;  4BRC A;  3O8M A;  1JCE A;  4B1Y B;  4C1N K;  3I8B A;  1E4F T;  4FWK A;  3T69 A;  3OBY A;  4YOV A;  2D0P A;  2GUP A;  4H5R A;  4RCH A;  4QS9 A;  4FOE A;  5F2R A;  3PLA A;  4IEE A;  1VQL N;  3MN5 A;  4RWT A;  4BRK A;  1ZC6 A;  4FWQ A;  1RGI A;  4BRM A;  3FZL A;  1QQM A;  2HST A;  5AZI B;  5C10 A;  2Q36 A;  2A42 A;  1MDU B;  3DJC A;  4JHD B;  4JKG B;  4BRO A;  5GIN A;  1Z6R A;  5CR4 A;  4CBU A;  3IFR A;  3FZK A;  1QQN A;  3WXL A;  3FGU A;  1Q81 O;  1U2V B;  4YOU A;  3VEX A;  4WFB L;  5JLF A;  2QWM A;  3H3N O;  2ZGZ A;  4IWV A;  3SBT A;  3E9O A;  4BRL A;  2V7Z A;  1GLC G;  1WUA A;  5AQF A;  1NGF A;  4OO1 J;  1HLU A;  2P9K B;  3DXM B;  5EX5 A;  4ILJ A;  3AAQ A;  3K9K A;  2GEM A;  1BA1 A;  1G99 A;  3EE9 A;  4FWL A;  3TSP A;  1M90 O;  5C12 A;  5KPZ A;  4NO7 A;  4H0O A;  4WYB A;  2P9L A;  1DT9 A;  2ZGY A;  3EKU A;  4OPA A;  5GIO A;  2QM1 A;  3CCL N;  2JWK A;  5BRF A;  3O80 A;  4CZH A;  2F9W A;  1NGI A;  2EWS A;  1V4T A;  3QFP A;  1U6Z A;  3R8E A;  3CER A;  1VQO N;  3VGK A;  3CJ1 A;  1GLB G;  4JKH A;  3VET A;  4CZJ A;  4R79 A;  3CC2 N;  5AZJ A;  1WOQ A;  4DB3 A;  3WXI A;  4GV3 A;  5EXW A;  3C0B A;  5CE3 A;  3CJ9 A;  4PKH A;  3H1V X;  3HI0 A;  4K25 A;  2ITM A;  3I56 N;  1QVG M;  2D4W A;  3HZ6 A;  3LM9 A;  2E88 A;  3CHW A;  5AQL A;  4BQZ A;  4JAX A;  5C2D A;  3DWL A;  2JWL A;  4DKW A;  4QS8 A;  1BA0 A;  2H3G X;  4K41 A;  3WT0 A;  5BPM A;  2D0O A;  3C65 A;  3SAF A;  4YOW A;  3J7Z O;  2VGM A;  3CCM N;  4CD3 A;  5JVG L;  5EY4 A;  4IOC L;  3TTD A;  2A6A A;  2BTF A;  5AFU A;  5MLC Q;  2W41 A;  3H6E A;  5ADX H;  1ATN A;  5CHI A;  4BRQ A;  4BR9 A;  2VCP A;  3G25 A;  3I55 N;  1C0F A;  3CC4 N;  1YXQ A;  1X3N A;  1Z05 A;  3LDO A;  4MO4 A;  3VGL A;  1RDW X;  5M1N A;  2NRX A;  3MN6 A;  3SLC A;  2V7Y A;  4H0P A;  3ID6 A;  2UYT A;  1HPM A;  3OHR A;  3CC7 N;  1W2B M;  3MWP A;  1VQ5 N;  1YIT N;  1BUP A;  3A0I X;  4ILH A;  5AQV A;  3O6W A;  5AFU H;  3C6H A;  3R1X A;  4K43 A;  2P9N B;  3UKR A;  1HKC A;  3G6E N;  1T44 A;  4ILG B;  4M63 C;  3BEX A;  5GAG P;  2A40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...