2F9WA

Structure of the type iii coaa from pseudomonas aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
249
Chain Sequence
SMILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQALPVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWLALVAAHHLAKKACLVIDLGTAVTSDLVAADGVHLGGYICPGMTLMRSQLRTHTRRIRYDDAEARRALASLQPGQATAEAVERGCLLMLRGFVREQYAMACELLGPDCEIFLTGGDAELVRDELAGARIMPDLVFVGLALACPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prokaryotic Type II and Type III Pantothenate Kinases: The Same Monomer Fold Creates Dimers with Distinct Catalytic Properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Pantothenate Kinase
total genus 70
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA02
3CIPA 4PKHA 2A5XA 2FF6A 2P9KB 3L6QA 1JCEA 3P4IA 3CETA 2ASMA 5LJVA 3LDPA 3EO3A 4IJAA 3VEVA 1HX1A 5AQJA 3H1QA 4EIAA 2QWLA 2GWKA 4Y0WA 4B1WB 3U4LA 1OKJA 4J8FA 3LDQA 3CJ7A 3W3DA 1GLEG 4E1JA 3VGMA 3QMLA 3H1VX 3GL1A 1X9JA 3DWLA 4BC2A 5KPZA 4MLHA 3ENOA 5E26A 5AQYA 4FWSA 2D4WA 5JLFA 2D0PA 1CZAN 1NGDA 1TYQA 2V52B 4H5TA 2Q36A 4M63C 3QFUA 2YHWA 3HTVA 3O6WA 2ZF5O 2OANA 3BF3A 3C7NB 3KZBA 4BR0A 1IJJA 4FPBA 3AARA 3VEOA 3IUCA 4BC4A 2PAVA 1ZXOA 4BRKA 4B1UB 4FWRA 5AFUA 4BC3A 3ATUA 3R6MA 3OHRA 5B8HA 3CJBA 5CE3A 4H0VB 3ZEUA 4FWNA 1RFQA 2BTFA 1D4XA 2P9UA 4CBUA 3A0IX 2Q97A 5ELZA 2YJEA 2NZTA 2GELA 1BOTO 4JNEA 3FLCO 5TKYA 4LC9B 1SAZA 3ZETB 3DXMB 4I6MB 2CGJA 5AZJB 3U9ZA 2A42A 1P8ZA 3FE1A 4H0TB 2QW9A 3FZMA 3EKUA 2F9WA 1SZ2A 3AAQA 1NGHA 1WUAA 1U2VB 4DHYA 3R8EA 1QHAA 4JN4A 5FPNA 2H3GX 1K8KB 4BRHA 1NGIA 2E88A 2FXUA 4FO0A 2YHYA 4FPAA 3QFPA 1NMDA 4JHDB 5AZIA 4QS7A 1LOTB 3UKRA 1HLUA 3O5BA 1KAZA 4WQ5A 2P9SA 1U6ZA 4KBOA 2WUSA 4M7YA 2QWRA 5ADXA 4BVPA 4BROA 4CZJA 3FZHA 4FWQA 4CD3A 1Z6RA 1NM1A 2QWPA 4BRQA 1T6CA 3ENHA 1NWKA 4BRCA 2ZGZA 4A61A 5AQXA 1YAGA 5JICA 5AQVA 3AY9A 1BWFO 3A8YA 3MK6A 4FWKA 4JD2A 2E1YA 5AZIB 1HPMA 3KHYA 4CD1A 2P9SB 3FZFA 1MWMA 1LCUA 2EWSA 4BR7A 3C7NA 4BG8A 4Z94A 2E2OA 2QXLA 5EXWA 4XH1A 4L3QA 4RWTA 4BGAA 2VCPA 2I7NA 4K43A 4CZFA 1HJOA 3D2FB 1E4FT 3VGKA 2IVPA 2ASOA 5ADXH 5JMVA 2DPNA 3A5NC 4BRFA 5BPNA 1NGFA 1H1VA 3ULEB 4EFHA 5KPRA 3MN5A 3IDHA 4BC5A 3LL3A 2Q1NA 1ESVA 3QB0A 5AQZA 5F2RA 5KQ8A 5EX5A 2D1KA 3CI5A 3S41A 2NRHA 3EN9A 4IZ9A 3LDLA 3GE1A 5AQPA 2FLOA 5FPEA 4FSVA 3D7EO 2Q0UA 1EQYA 3CJAA 4H5NA 2J4RA 4CI6A 1XC3A 3QICA 1QZ6A 3QBWA 3U9DA 4BRIA 5AZJA 5AR0A 4DB3A 2Q31A 2P9UB 1NLVA 4BREA 1HUXA 4WYBA 1GLJO 4BRAA 4BGBA 1T44A 5AQMA 3J8AA 3DXMA 3O80A 3LDNA 3F9MA 3LDOA 5AQGA 4AM6A 1NGJA 4YDUC 4H0OA 1NGBA 1BO5O 3IFRA 5FPDA 5AQSA 3HZ6A 3H46O 3MMVA 1S3XA 2BUPA 3UKRB 5JLHA 5FPMA 2I7PA 3SK3A 3WQTA 5AQNA 2P9IB 4FWOA 1C0GA 1IG8A 2P9NB 2D0OA 1QQNA 5E84A 1S22A 3WEEB 2ASPA 5AQLA 2ITMA 4NB4A 3BP8A 1YVNA 3DAWA 4B1VA 3H3NO 2ZWHA 4BQZA 2YCHA 2PBDA 4DQ8A 4M7XA 1HKGA 3CQYA 2W40A 1K8KA 1T6DA 5I9EB 2VWBA 5AQQA 3FFKB 1C0FA 2E2PA 1BA0A 5BPLA 4FWPA 4DCHA 4H5RA 4EAHD 3HI0A 4NO7A 1DGKN 4ISGA 4CZGA 1G99A 2FSJA 1GLLO 1Q18A 3TPQA 1R59O 2E1ZA 5AQUA 5AQKA 3BEXA 1RDWX 3CJ9A 4AM7A 3UKUA 3VETA 3JS6A 1YXQA 1XUPO 3VEYA 3VGLA 4B9QA 2FSKA 3L4IA 4MO5A 1V4SA 3ATVA 3WUHA 4O8KA 4C23A 5AQHA 3O8MA 2FF3B 2P9KA 2V7ZA 5KPTA 2E2NA 2Q2RA 3H3OB 3M3ZA 3LM9A 1NGEA 3B8AX 4ISFA 4K41A 4QS8A 4B1ZA 2P9IA 4IJNA 3BUZB 4GNIA 3SMSA 3IMXA 4CZHA 3O1BA 4EHUA 4CZKA 2F9TA 5AQTA 2YHXA 3ZX3A 3VENA 3MDQA 2P9LB 3EKSA 1TUYA 3DJCA 3JXUA 3WXLA 4CZLA 3VPZA 3DXKA 1BA1A 1GLCG 3H45C 3ZX2A 5BR9A 4BRDA 1J6ZA 2E8AA 3CERA 4IO8A 1KXPA 3SMPA 3WXKA 3C0BA 2Q0RA 3MN6A 4XEIA 2AP1A 4BRPA 3I8BA 1GLDG 2E20A 1BG3A 4CZIA 4A2AA 4YDUA 5EVZA 3O1WA 5AFUH 3MCPA 3VEXA 3WT0A 2AA4A 4HTLA 3A5MC 2YJFA 4CBWA 3EZWA 3GG4A 2GEMA 4H0XB 4A2BA 3WXIA 4PL8A 1ATRA 4BRNA 4BRGA 4PL7A 3MN7A 4BR9A 3HM8A 4QS9A 2P9PB 3R9PA 4FOIA 1KAYA 1X3MA 3VEZA 1ZBSA 3TU5A 4H0YB 3VF6A 3ZEUB 3FGUA 2CGKA 1HKCA 5AQRA 4O5FA 1NGAA 3O4WA 1HKBA 4JAXA 3FR0A 3GOIA 4JD2B 5BRDA 3VOVA 5AQFA 3HSCA 2W41A 2GUPA 3HBTA 1ATNA 4XH5A 4WQ4C 1BU6O 4BVOA 3FZKA 3MN9A 3ZX0A 2GWJA 1E4GT 1GLBG 5LY3A 1GLFO 1QZ5A 2VYPA 3ZETA 1NGGA 3M1FA 2FSNA 1KAXA 1JCFA 2V51B 3RSEA 3KVGA 1V4TA 4ISEA 4FWMA 3DXKB 3VESA 5BPMA 3UB5A 5EY4A 4FL9A 1Z05A 4H03B 1WOQA 4B1XB 2NLXA 2P9LA 3A5LC 4B1YB 2HMPA 4BQLA 3O08A 4K42A 3WXJA 5F0XA 1NBWA 3VF2A 3W0LA 4BR2A 2A41A 5BREA 1MWKA 4EHTA 4PKGA 4RCHA 2QM1A 3VEWA 1QQMA 1YUWA 1Y64A 3GDQA 3QDKA 4BR4A 2UYTA 4WQ5C 4IWVA 2E2QA 4MO4A 3UKUB 4H5WA 3CHWA 2HOEA 4BRMA 1ATSA 2A6AA 1DKGD 2P9PA 2GTDA 3UE5A 3H6EA 3WEEA 4F9OA 1U2VA 1BDGA 4PKIA 2P9NA 4RTFD 5AQOA 3LM2A 3L0QA 4WQ4A 1X3NA 3CJCA 4CBXA 3VF4A 4BG9A 1DEJA 4FOEA 2IVNA 2QWMA 3GBTA 4MLEA 2QWQA 2QWNA 4CJ7A 5BRHA 4I6MA 4FWLA 4HWIA 1RGIA 5F1XA 5AQIA 3U8XA 3CQXA 4CZMA 1GLAG 3D2EA 4XH4A 2CH6A 5BRFA 3AAPA 1TUUA 3SJHA 2HF3A 3A5OC 3D2EB 2A3ZA 5BN9A 4A62A 4CZEA 4BR5A 2QWOA 1MDUB 3ULEA 1TYQB 2YI1A 3BF1A 2KHOA 1SQKA 4JHDA 3G25A 5EOYA 2A40A 2V7YA 3D2FA 4K25A 2CGLA 3WQUA 1JCGA 3I33A 3QBXA 4GY2B 3M6GA 2ZGYA 1NGCA 5KQDA 3CJ1A 4H0PA 1ZC6A 5AQWA 3EL2A 3SLCA 1QQOA 5LJWA 4IXCA 4BRLA 3VERA 1MA9B 1BUPA 3RSEB 5BN8A 4H5VA 3FZLA 2IIRA 1XQSC 2CH5A 3ID8A 2HF4A 2IVOA
chains in the Genus database with same CATH superfamily
4PKHA 2A5XA 3RR7A 4ILGB 3QEXA 2EX3A 3VEVA 2HHXA 4JI0K 5AQJA 4TSXA 3F2KA 3AA2A 1HQEA 4H4MA 2RKIA 3Q7BA 4W5OA 2UXDK 1J54A 4ID1A 3W3DA 1GLEG 3VGMA 4KTWA 3H1VX 3I8DA 4DU3A 1S1TA 3AVIA 4BC2A 1IKXA 5KPZA 4MLHA 3ENOA 5JLFA 5KI6A 4E1MA 4E19A 5C2FA 1NGDA 1TYQA 1IKYA 3DLBA 4DLGA 4H5TA 3OYFA 3PX6A 3HTVA 5C24A 3B6OA 4B3OA 2OANA 3VQ8A 4DSKA 4E7HA 4BR0A 1IJJA 2PAVA 4OKEA 4LFAK 1BI4B 5AFUA 4BC3A 2RPIA 3OHRA 1IG9A 4WFAL 5B8HA 5CE3A 1VSMA 3ZEUA 4OKKA 1D4XA 1S9EA 3ZSZA 4KHPK 2NRXA 3IKMA 2Q97A 4C8OA 4DSFA 3AVMA 5HP1A 4KO0A 4KHWA 5GADP 2WONA 4FZYA 3ZETB 3DXMB 4JI3K 4K8XA 4C1NI 4CFAA 3VA3A 3TR8A 2HBLA 1S1VA 3U9ZA 1P8ZA 4H0TB 4HHTA 3FZMA 4X65K 1SZ2A 4FVMA 3AAQA 4A5AA 1C1CA 4B08A 3UIQA 1VSEA 1U2VB 3LP0A 3J80O 3C94A 1Q9XA 2VQFK 5FPNA 2E88A 2FXUA 2O8FB 3CFPA 2FBTA 2WFBA 4M3RA 1VQ7N 2YHYA 1NMDA 5AZIA 1NK8A 3V1QA 1FKOA 4BDZA 4JKCA 4WQ5A 4KBOA 3NGYA 2QWRA 4DSIA 1I94K 3KK1A 1NM1A 1T6CA 3RMCA 5DM7L 3QINA 3T69A 3F5TA 3IS9A 1G15A 5AQVA 4OPHA 2JGUA 2OZMA 1NJXA 3VQ4A 2P9SB 1NOZA 4FLXA 1LCUA 2G8FA 4JI5K 4GMJB 5EXWA 5M1NA 4RWTA 4FK0A 4CZFA 3SQ4A 1E4FT 3VGKA 2G8UA 2ASOA 1TKZA 4DV0K 1NK0A 2RHKA 5KPRA 4BC5A 4DV5K 5KQ8A 1IV0A 1C0MA 4NYNA 5EX5A 4CEBA 3HRGA 4YOYA 2QA4N 4IZ9A 3K5NA 4DG1A 2FLOA 1Z26A 1JLGA 3BZCA 1EQYA 3L8BA 3QICA 4BDYA 2HHWA 3DOKA 5M1FA 2XY7A 3U9DA 1A5WA 4B9TA 4DF4A 5AR0A 2O8DB 2P9UB 3CMAN 4BREA 4BRAA 1NK6A 3MEDA 2HBJA 2G8VA 4WCEL 3P1GA 3O80A 5TKWA 3PY8A 4N47A 2E6MA 3U6FA 3CFOA 3LDOA 1NGJA 3V1OA 2UU9K 4YDUC 1BO5O 2HHSA 3VTIA 1IKVA 1S3XA 1M90O 1WSEA 5JLHA 2Z1HA 4J2DA 2DY4A 3LPTA 4OLBA 5AQNA 4FWOA 3K57A 5E84A 1S22A 3KWIA 1NU0A 5BR8K 4FLYA 3PO4A 2O8EA 4B1VA 1IKWA 2ZWHA 1C1AA 5KRTA 3CQYA 4ELTA 4ZTFA 1T6DA 3NBPA 5AQQA 5GAEP 2E2PA 1TAUA 4DCHA 4EAHD 5J1EA 3HI0A 4JKEA 4B8CA 2FSJA 3Q7CA 2HNYA 3EY1A 3THYB 1VQON 3NCIA 3K59A 4CK1A 3SUNA 3BEXA 4WFBL 2A1SA 4DV4K 1XUPO 4B9QA 3LDSA 1V4SA 2P9KA 1CZBA 3H3OB 3LANA 4JKAA 3B8AX 4QOZB 4ISFA 1DLOA 4BDPA 4GNIA 3HOTA 3SMSA 1JXEA 4CZKA 2F9TA 5AQTA 3OYGA 4E7KA 4CECA 3IRXA 4CEOA 2G8IA 3O4NA 3ZSWA 2BDPA 1IH7A 3SV3A 4Q0BA 1BA1A 1GLCG 3G4SN 5BR9A 3VA0A 3CERA 3WNGA 3JSMA 4DS4A 4IO8A 3WXKA 2UUBK 3L3UA 5FRMA 1SV5A 2Q0RA 3MN6A 2HHQA 5KGXA 1HR0K 3L2RA 3CCSN 4A2AA 4YDUA 3O1WA 5AFUH 4DQQA 3MCPA 4J2BA 4EZ9A 1RT1A 2AA4A 1WN7A 3EZWA 2GEMA 4A2BA 4GKKK 1ASWA 3ITHA 3HP9A 4PL7A 2YNGA 3O3FA 3G10A 3HM8A 4DFJA 1KAYA 1X3MA 3VEZA 2Q3SA 3TSPA 4YOVA 3CCQN 3SAFA 2CGKA 4O5FA 1OVYA 1HQUA 1QTMA 4RW4A 1QS4A 3SAHA 2XRIA 4CJQA 1QSSA 4FJXA 4DTXA 4OGCA 3M5RA 2E5LK 3SPYA 5C42A 1ATNA 4WQ4C 1CXUA 3FZKA 5JS1A 1VSKA 3TANA 1RDUA 3L2UA 1QQCA 3CXCM 5C2DA 1NGGA 2FSNA 2O8BA 2HHVA 3DMJA 1TL3A 4FJIA 4FWMA 2HSTA 4B8AB 3UB5A 4CIEA 4C8LA 4FL9A 5I42A 5SZTA 3CCRN 1Z05A 3RRHA 4GV6A 2HB5A 3K9JA 2VG5A 3QETA 4B1YB 1EO1A 4BR2A 5BREA 1ILYA 4M3ZA 4EHTA 3C95A 3VEWA 3V4IA 1Y64A 3NH1A 1VRUA 4IFVA 4DTJA 1BI4A 4WQ5C 3BDPA 4AILC 3MX2A 3I55N 4CIGA 2WC9A 1RDCA 4MO4A 3CHWA 3VQDA 3MEEA 2HOEA 4JK8A 2G8KA 4RTFD 2ZQBA 3HT3A 1Q81O 5C0YA 3L0QA 3HPGA 2HHTA 3T3FA 1T8EA 2QTDA 4CIFA 4DSLA 2QWNA 3DI6A 4FWLA 1RGIA 4IO9L 1KD1O 4DQPA 3CQXA 2KLAA 4XH4A 2W6KA 3C65A 4JLHA 3KJVA 3OJSA 4KB1A 2A3ZA 2IOCA 1MDUB 3E9PA 3ENBA 3BF1A 2PY5A 5EOYA 2A40A 1ASVA 2CGLA 1JCGA 3ALYA 4DV7K 3I33A 4B9VA 4GY2B 2ZGYA 3MCAB 5KQDA 3M8SA 2XHBA 4N41A 1EXQA 3C6HA 3AVCA 3RSEB 4DV3K 4F2SA 5AQXA 3CIPA 3P83D 2KZZA 1TGOA 2FF6A 4WE1A 2P9KB 3KK7A 2ZJPL 2ASMA 4IDHA 5LJVA 1NG9A 3LDPA 3EO3A 1O13A 2OTLN 3H1QA 3U4LA 4NCGA 4FJ5A 5FROA 1HNZK 4CK2A 1YITN 2D4WA 4FJNA 3AVGA 3TTDA 2OPPA 1Q9YA 3TAEA 4YNQA 4M63C 3QFUA 3HM9A 3O6WA 3ISNC 4CF2A 3CCVN 3E66A 1DTQA 2KFZA 2ZF5O 3OS2A 3LWLA 3ZSQA 3QLHA 3AARA 4E1NA 4BC4A 3DLHA 1HYSA 4BRKA 4N56A 3O9UA 4B1UB 4FWRA 3ATUA 3N4PA 3R6MA 1B9DA 4MDAA 3I0RA 4H0VB 1OH5A 3VMFB 3SNNA 4FWNA 4PQUA 1VSHA 5HBMA 4CBUA 4NYFA 5ELZA 4FCYA 3CPEA 1YTUA 1C0UA 1S1XA 3QERA 2GELA 3KLIA 4LY7A 3NH0A 1BIUA 4LF4K 5TKYA 1KFSA 4I6MB 4DTNA 1LV5A 3SJJA 2CGJA 5AZJB 4R5PA 3CC2N 4DR6K 3S3MA 1NGHA 5HRPA 1WUAA 4AQYK 4DHYA 2ZJQL 4JN4A 3PIPL 4FLUA 1N6QA 4BRHA 1C6VA 4BE1A 3HVTA 1YI2N 2ITGA 4OVLA 1KLMA 5EU7A 1VQ9N 3L4QA 4QS7A 1K6YA 1HLUA 1B92A 4X62K 5HRSA 3T7ZA 4M7YA 4Z0UA 4CERA 2E6LA 3HJFA 2QWPA 4MDBA 1NWKA 2UXCK 4BRCA 4C8NA 3OYNA 4OO1J 4M3XA 2LSNA 4DU4A 1X1PA 3MK6A 1LWEA 3O9RA 1TKDA 4CD1A 4JI2K 3OYJA 3TAFA 4CJSA 4BR7A 4F3OA 1VQ4N 3C7NA 4AHVA 4CJVA 3OBYA 4IOXA 4XH1A 3ZYYX 2HNZA 2F8TA 3M8RA 4BGAA 1NK5A 2VCPA 3QESA 3QEWA 3SI6A 4PWDA 4CHYA 3NAEA 3ZSYA 5ADXH 2DPNA 3A5NC 3KD5E 5BPNA 1NGFA 4KHNA 1H1VA 3CC7N 1D5AA 3MN5A 3KIOA 1BISA 1RILA 1ESVA 3QB0A 2QEXN 4ILHA 4BWMA 5JVHL 4FJHA 2NRHA 3LDLA 3GE1A 2OPQA 4FSVA 3V9SA 1VSLA 5SWMA 2NRTA 4CI6A 4CJKA 3ASMA 2VQEK 4HCBA 3WNHA 3THXA 2YHAA 3QBWA 3LZIA 2OPRA 5AZJA 4JK9A 3OYDA 4YOXA 2Z1GA 1HUXA 4WYBA 5FLXO 3DLGA 1FW6A 4ELUA 4OPAA 2Y1JA 1KCFA 1S6QA 3DXMA 1UA0A 1UAXA 4AM6A 3EZ5A 3PO5A 3P5JA 4Z4FA 4NXMK 1NGBA 3PIOL 3HZ6A 3MMVA 2Y1IA 2FBVA 4Z4IA 4B3MK 3CQ8A 1TK5A 2DFEA 3SBGA 2P9IB 2VWKA 1C0GA 1IG8A 2GUIA 2D0OA 4BWJA 2OYQA 4KH4A 3WEEB 5AQLA 5C25A 1FK9A 5C12A 4E89A 1MU2A 1HKGA 1WSJA 1K8KA 4HCCA 2VWBA 3RRGA 4DQIA 3FFKB 1C0FA 3LAKA 4CHPA 4F8RA 5K14A 3OYKA 1DGKN 4ISGA 3SUQA 3AVFA 5HOOA 3J7ZO 1Q18A 4O44A 3L2VA 2ZM6K 3TPQA 1LAVA 3A2FA 3KWGA 1RTDA 1RDWX 3SQ1A 3CJ9A 1WAJA 1HNVA 3UKUA 1NK9A 3VEYA 1VQNN 2NRVA 2FSKA 3L4IA 4MO5A 3ATVA 5M1KA 2HNDA 1ZBFA 2FF3B 5KPTA 1NNEA 4LF5K 3SV4A 1N36K 4OPKA 1NGEA 4ELVA 1DTTA 4KREA 3NE6A 4PY5A 3DLRA 2YHXA 3VN5A 4CJRA 1EKEA 3NHGA 3CC4N 3NVKA 2QI2A 1TUYA 4KRFA 1JXBA 3WXLA 3ZSOA 3DXKA 3H45C 3ZX2A 1TL1A 4BRDA 4BE2A 1J6ZA 1UA1A 1KXPA 3SMPA 3OVNA 1VQMN 2VGNA 4BRPA 4DLEA 1Q86O 1J5OA 1GLDG 1W7AA 1BG3A 2NNWA 2VGMA 4CZIA 3NGZA 3TAQA 3OYAA 3EE9A 1KSPA 3AA3A 2FC0A 4CBWA 3CM5A 3GG4A 1BHLA 2B4JA 4PL8A 4DV2K 1UOCA 4MQ3A 1VQKN 1E3MA 4BY9C 4BR9A 3K0SA 3NMUA 3E9LA 4PUOA 1ZBSA 4H0YB 4JI6K 3VF6A 3CF5L 5CY4A 1RT7A 5AQRA 3VTHA 5M1OA 2O8BB 1W0HA 3FR0A 2F96A 4AHCA 3HSCA 3RMBA 4XH5A 1VHXA 4JV5K 5JVGL 4M3YA 3MN9A 5AJ3K 4R79A 3CCEN 1E4GT 3IG1A 2WBNA 4YFUA 5LY3A 1GLFO 2IC3A 3ZETA 3SUPA 4CEZA 4CGFA 4U7BA 3D6RA 2UUCK 1ZBHA 4FLVA 4ILJA 1RDAA 3DXKB 1NJZA 1U47A 3VQCA 5EY4A 1WAFA 5IWAK 4H03B 1ITGA 3OYCA 2O8DA 1WOQA 2NLXA 1KC8O 4DFKA 3OW2M 3CCJN 2P5GA 1BL3A 4BQLA 3O08A 3W0LA 4PA1A 3VQ9A 2I5JA 4PKGA 2GV9A 2QM1A 4KFBA 1QQMA 1YUWA 3AO4A 3R3LA 3TTFA 3LZJA 1NK7A 2UXBK 4IWVA 1VSJA 4H5WA 4CESA 4A57A 3V1RA 1DKGD 3SQ0A 4F9OA 5AQOA 2P9NA 4C8KA 2KTQA 4WQ4A 3AA5X 1D9DA 3VF4A 4JKDA 2YNHA 1DEJA 4FOEA 3OYMA 3DLLL 3NF8A 3O4QA 3T1HK 3KKRA 3GBTA 3ZT2A 1BQMA 4M41A 4FJKA 5AQIA 3PUFA 4JI8K 3U8XA 3SBTA 4X66K 4KTZA 4W5TA 1T3VA 1TUUA 3EYZA 1W9HA 3SYZA 2HVIA 3A5OC 4JS5A 2QWOA 2KFNA 4K8ZA 2O8CA 4IEIA 4IBNA 1SQKA 4K25A 3D2FA 3SCXA 3O3HA 3QBXA 3M6GA 3P39A 1RCHA 1ZC6A 1WSIA 3SLCA 1QQOA 4Z4GA 4BRLA 4B3SK 1YVUA 3TWHA 3FZLA 1XQSC 3SJHA 5LMNK 3QNNA 2O4IA 1HPZA 1NOYA 1RBVA 4CF0A 5LL6Z 4Z4CA 3L6QA 3P4IA 1JCEA 3BZKA 1WSGA 4IJAA 2YKNA 2NRWA 4EIAA 4HTUA 4Y0WA 4CHQA 1OH7A 4YOUA 2IGIA 4CHZA 3TSQA 1NK4A 1LWCA 1VSIA 4CGHA 4E1JA 4M3WA 3QMLA 3GL1A 1X9JA 3DWLA 1YJ9N 3VQAA 1W97L 5E26A 1JLQA 2O4GA 2D0PA 3C6UA 4YOTA 4H8KA 3SAGA 2YKMA 3QEVA 2ETJA 2BGGA 4E7JA 1S1WA 3PLAA 1NJWA 3V81A 5I3UA 4JKGB 3U3YA 3IUCA 4Y1CA 5DK5A 4KHUA 4IFYA 4LH4A 4FJ8A 3JAMO 4CF1A 4E3SA 4NCBA 2X78A 3PSIA 1U4BA 1RFQA 1GOAA 3VQEA 3G71N 2P9UA 2KKZA 4RG8A 3RWUA 2YJEA 1S5JA 4W5QA 3CM6A 4DTMA 1K9MO 1CXQA 4LC9B 2XY5A 1HJRA 2A42A 3FE1A 2QW9A 2E4LA 1VK0A 3EKUA 1DT9A 2F9WA 4DF8A 1RT6A 4ZTJA 1JKHA 3L2QA 3HXMA 3WNFA 2HVHA 3PSFA 4CCHA 1W2BM 2OZSA 5CHIA 4JRPA 3QIOA 2B5JA 1QE1A 1RBUA 2PZSA 1RBSA 4FO0A 4E7IA 3HVRA 4RW8A 4FPAA 2PYJA 3QFPA 4CEQA 4JHDB 4IEEA 3UKRA 3CCLN 3K5LA 3MAQA 2P9SA 1U6ZA 2WUSA 4AH9A 1WSFA 4FZXC 5ADXA 4CZJA 4FWQA 1Z6RA 4BRQA 1IBMK 3ENHA 4C8MA 1XMQK 1S9GA 2ZGZA 4A61A 1TVRA 2YHBA 5JICA 1Q7YO 2HBKA 3AVBA 3AY9A 1BWFO 4FWKA 3ZSVA 4NCAA 4JD2A 4DV6K 1KVBA 5AZIB 4OLAA 3G0ZA 3FZFA 4LH5A 1MWMA 4Z94A 4AHTA 3AVAA 4L3QA 2FBXA 4GVEA 4CF8A 2I7NA 4K43A 4NLBA 4DR1K 1HJOA 1NKBA 4CGDA 4LD0A 5JMVA 2GX9A 4BRFA 3E01A 3ULEB 4EFHA 1X9WA 3IDHA 1D8YA 3AO3A 3LL3A 3MXIA 4V19S 2Q1NA 5AQZA 1WLJA 3S41A 2D1KA 1TAQA 3CI5A 3EN9A 3QEPA 5AQPA 4LF7K 4H5NA 3QO9A 2HMIA 1KLNA 1XC3A 1QZ6A 3ZT4A 2Q31A 4LFBK 4O55A 1CLQA 1NLVA 1RBRA 1FKPA 3AO5A 1T44A 1JLBA 3T1AA 4FZZA 3J8AA 4GV9A 3LP2A 2QXFA 3V9XA 2AJQA 3OA9A 4CJ5A 4CJWA 4CF9A 4H0OA 2BANA 3IFRA 5FPDA 4DS5A 3H46O 4DMNA 1EWQA 3DRSA 2QKBA 4W5RA 1U45A 3UKRB 5FPMA 2I7PA 1YTAA 5DMRA 3SK3A 1RTHA 3VQBA 3WQTA 2ASPA 4QCLA 1HRHA 3WXMB 4CW7B 4CEAA 4IFEA 1T7PA 3DAWA 2NRRA 3H3NO 2OPSA 2YCHA 4DQ8A 4M7XA 1TK8A 2VWJA 2ZD1A 3HO1A 5I9EB 4B9MA 2X6SA 4KHYA 5T7BA 1J53A 1JJ2M 1VAZA 4FWPA 4HVJA 3OY9A 5HL7L 1SKSA 4O5BA 1G99A 1GLLO 1LW2A 1WSHA 3P31A 2E1ZA 3LAMA 1QVFM 3IAYA 4AM7A 1RT4A 3ZT0A 4IDKA 4FM1A 4B3RK 4FJGA 3WUHA 4C23A 1NJIO 4M42A 3VQQA 4M3UA 3DRRA 4CJPA 4I7FA 4IKFA 2Q2RA 3BY5A 3M3ZA 1A5VA 3LM9A 3PX0A 4B1ZA 2P9IA 4QAGA 3BUZB 4GW6A 4CZHA 3O1BA 1JL1A 4LF8K 4DQSA 5DM6L 3ZX3A 1N34K 3MDQA 4DSJA 3EKSA 2JLEA 3KLHA 1RT5A 3DLEA 1QSLA 4J2AA 4CFDA 1BIZA 4CZLA 3VQPA 3O9QA 3V9ZA 4EZ6A 1BGXT 1ZBIA 2E8AA 3I0SA 3K2PA 3ZCMA 2AP1A 3I8BA 4DTOA 3M8QA 1OH8A 4CEEA 4DR7K 5EVZA 1WB9A 4Y1DA 3VEXA 4HTLA 3A5MC 3VQ5A 5M1QA 4PHTX 4H0XB 4U67L 3WXIA 4LF9K 1RDDA 1N8RO 2EHGA 3KLEA 3AO1A 4JI4K 2RE2A 3MECA 1NMNA 2P9PB 4HUFA 1VQ5N 3KTQA 3ZEUB 3KLFA 3FGUA 4Q5VA 1HKCA 1NGAA 3O4WA 1HKBA 4JAXA 3GOIA 4JD2B 4DTRA 3J7YP 5BRDA 3VOVA 4FJLA 5AQFA 1QHTA 2P5OA 1BU6O 4BVOA 1HMVA 3THWA 4M3TA 3CCMN 4MFBA 5E41A 4CJUA 4KAZA 4CJ4A 1KTQA 1QVGM 1GLBG 4KH6A 4IOCL 5GIPA 3HK2A 1KAXA 3NVMA 2V51B 1GOCA 3F73A 4F4KA 4OKJA 3RSEA 3NDKA 4ISEA 3VESA 3TTCA 5BPMA 4BE0A 1HYVA 3O9TA 2ATQA 4B1XB 3A5LC 3MXMA 3DYAA 5KTQA 2A1RA 2HMPA 1JLFA 4L8RB 2F4VK 3WXJA 1NBWA 3VF2A 1KVAA 2A41A 3CYMA 4YHHK 4JK7A 5C15A 2UUAK 2ZJRL 4FXDA 4G9ZA 4BR4A 2UYTA 4CGGA 3R1XA 1SL2A 2F7TA 1SKWA 5C10A 4CEFA 1NKEA 4JYAK 4A59A 3UKUB 4EP4A 1K73O 1ATSA 2A6AA 2XY8A 2P9PA 4UQGA 5J2NA 3LM2A 4AHSA 2HW3A 3RTVA 1X3NA 4IG3A 3CJCA 4YORA 3CCUN 4O0IA 4BG9A 1S1UA 4KV8A 3ZT3A 1X9SA 4CJ7A 4FJ9A 5BRHA 4I6MA 4CVNE 4CJFA 4HWIA 3PV8A 2IAJA 1HNIA 3CG7A 1NJYA 4CZMA 1GLAG 3D2EA 1F21A 1JL2A 5KRSA 1L3TA 3AVLA 4GV3A 2HF3A 3LWMA 3C6TA 3KD1E 4A62A 4B9LA 2XY6A 1P90A 4OX9K 4W5NA 5KGWA 3ULEA 4CK3A 4B3TK 1S6PA 4FJJA 4HUEA 2O8FA 2O8EB 1ASUA 1BQNA 2X74A 1N32K 2IDOA 3NFAA 3DOLA 3WQUA 4OGEA 4FW2A 3P38A 4H4OA 4G1QA 4JI7K 1TKTA 3EEQA 3CJ1A 3OYLA 4H0PA 4DQRA 3EL2A 4FM0A 4I9QA 4Z4EA 4DR4K 3VERA 4BACA 1RTIA 5BN8A 2IS3A 3TAPA 2BH1A 2CH5A 3ID8A 2HF4A 4YOWA 1TV6A 4DTSA 4LFCK 4KH5A 3CMEN 3CETA 3D45A 1WBDA 4Z4HA 3E1YA 1ZBLA 1SS6A 1HX1A 3OS0A 5J2QA 1JLEA 2QWLA 1KFDA 2GWKA 5CYMA 1VSDA 4B1WB 3J7AP 1OKJA 2HHUA 4CHOA 5GAHP 1FXXA 4J8FA 3LDQA 2W6LA 1RDBA 4CJ3A 1WBBA 3CJ7A 3AVHA 1HNWK 2O8CB 5HROA 2Z1JA 2HHHK 5AQYA 4FWSA 1XMOK 1CZAN 2D0BA 2V52B 1M1KO 4FK4A 1OH6A 2Q36A 2VG7A 5CYQA 1S72N 2YHWA 4RW6A 3LP3A 3BF3A 3C7NB 3KZBA 4KHQA 4FPBA 3VEOA 3J81O 1ZXOA 1TK0A 4ICLA 3OS1A 1XI1A 3HPOA 2P1JA 2Z1IA 3CJBA 1NKCA 1YT3A 4E0DA 3MEGA 4FLWA 1L3VA 2PFUA 2BTFA 3ZT1A 4JKFA 1BCMA 5FDLA 1UWBA 3A0IX 3U3GA 3G6EN 2NZTA 3OYEA 1BOTO 4JNEA 3TAMA 4F3TA 2DFHA 4WFNL 3FLCO 1SAZA 5LMUK 5CR4A 1Q82O 5M1PA 3SPZA 3AVJA 1L5UA 3ZLJA 2OTJN 3T19A 2P51A 4IG0A 1HNXK 3SQ2A 3R8EA 1EX4A 1QHAA 3L2WA 2H3GX 4WF9L 4GVMA 1K8KB 1U04A 5CZ2A 1NGIA 3K5MA 3MX5A 4JI1K 3HYFA 1C0TA 1IBKK 3O3GA 3NF9A 1LOTB 1N5YA 3CFRA 3S9HA 3O5BA 1KAZA 5H1SQ 4XIUA 1YF5L 4O0JA 4BVPA 4BROA 3F9KA 3FZHA 4CD3A 1EETA 3QNOA 1KRPA 4I2PA 3THVA 1YAGA 4FVUA 4NLCA 5IT9O 3A8YA 4B9NA 4UY8O 4CJTA 2E1YA 1HPMA 3KK2A 3KHYA 4X64K 5GINA 3OBWA 4DUYK 2EWSA 2D5RA 1XC9A 1VSFA 4BG8A 4DTPA 2E2OA 2QXLA 1YJWN 4LSNA 1YHQN 3EE8A 3LPUA 1QSYA 4CE9A 3D2FB 2YX6A 3TAGA 1WNSA 3TABA 3K58A 4NXNK 2IVPA 2NUBA 4JEPA 2W42A 1T05A 3BGRA 4AHRA 1YIJN 4DUZK 2WOMA 1JLCA 4RW9A 2OA8A 3O9SA 5F2RA 2KQ2A 3OJUA 4DR2K 5FPEA 3RVCA 3D7EO 2Q0UA 3RMDA 1O1WA 3CJAA 1GOBA 2J4RA 3K5OA 4YY3K 1VRTA 2F8SA 1VQLN 4BRIA 1R0AA 4DB3A 4ZHRA 2DFFA 4FK2A 1GLJO 2RF2A 4BGBA 3NGIA 1K8AO 3V6DA 3RMAA 4JS4A 1BCOA 5AQMA 4A5BA 4O8UA 2JWKA 3LDNA 3F9MA 5AQGA 3TARA 1T03A 4DR3K 4FLTA 1EWRA 5AQSA 4CHNA 2BUPA 1L3SA 1IO2A 5J2PA 1RT2A 1LWFA 2P9NB 1QQNA 2ITMA 4NB4A 4CJEA 4KHSA 3BP8A 3NF7A 1YVNA 2XO7A 3T1YK 4BQZA 4LF6K 1Q8IA 4AF1A 2PBDA 3D0PA 3DRPA 1TKXA 2W40A 2D0CA 4CFCA 3K9KA 1BA0A 5BPLA 1RNHA 4H5RA 1KVCA 3AGRA 3KK3A 4NO7A 4CZGA 4DV1K 4J2EA 3DM2A 3TI0A 1CZ9A 2FBYA 1R59O 5HRRA 5AQUA 5A2QO 3HPHA 3HSTB 5AQKA 5J2MA 4JKGA 5MLCQ 3CPWM 3RR8A 3C6AA 3QEIA 5GAGP 3CD6N 4KB0A 1J5EK 3VETA 1L3UA 3JS6A 1YXQA 1LAWA 5GIOA 3VGLA 4DR5K 4AHUA 1Y97A 4JKHA 2G8HA 3JYTA 4LSLA 4O8KA 5AQHA 3O8MA 2V7ZA 2BE2A 3THYA 3VQ6A 2E2NA 1EP4A 4DKWA 4QS8A 4K41A 4IJNA 3IMXA 5CZ1A 4EHUA 3OYHA 3VENA 2YNIA 1XNQK 2P9LB 3DJCA 1VQ8N 4FJMA 4FJ7A 3JXUA 3ZSRA 3VPZA 3ZSXA 2R7YA 5FRNA 1IBLK 2QKKA 3WNEA 4DWIA 4CGIA 3AVKA 3C0BA 4XEIA 4DSEA 3AGKA 1RT3A 2E20A 5JS2A 1FJGK 3ULDA 1ZYQA 1C1BA 2YNFA 3WT0A 4F2RA 4CJLA 4DTUA 4C1NK 2YJFA 2RN2A 3SUOA 4RW7A 2KW4A 4I2QA 4DFMA 1ATRA 4BRNA 4BRGA 3MN7A 2HBMA 4QS9A 3H08A 1XNRK 1OVQA 4JKBA 4JRQA 3R9PA 4E7LA 4FOIA 3S3NA 3TU5A 4OJRA 3SZ2A 1J9AA 1XHXA 1VQ6N 5HRNA 2JWLA 3AV9A 4IOAL 2VG6A 2W41A 2GUPA 3HBTA 3LP1A 4HUGA 3E9OA 3I56N 3ZX0A 1SKRA 4N76A 2X6NA 3AVNA 3HP6A 2GWJA 4M45A 2YV0X 4O4GA 4KI6A 1RBTA 3THWB 1QZ5A 1XWLA 2VYPA 3M1FA 4N5SA 1JCFA 1XHZA 3NF6A 1X9MA 3KVGA 1V4TA 1SL1A 2G8WA 3MXJA 3FFIA 3MWTA 3V9WA 3HL8A 1VQPN 2NRZA 2P9LA 3LALA 3TSUA 4FW1A 5D3GA 2OCEA 4B9SA 4K42A 5F0XA 4OPJA 1SL0A 1MWKA 3L3VA 4K0KK 1ZBUA 4RCHA 1I3AA 1RTJA 4DFPA 1U48A 4KTQA 3GDQA 3QDKA 4I9LA 3M8PA 4FYDA 2B6AA 4KKOA 2QK9A 2ZE2A 2E2QA 3AA4A 4BRMA 1B9FA 2GTDA 3H6EA 3UE5A 3WEEA 1U2VA 3V9UA 1BDGA 4PKIA 2D0AA 1D9FA 4CBXA 1JLAA 2IVNA 2QWMA 3DLKA 4CFBA 1HYZA 4MLEA 2QWQA 2GBZA 5F1XA 3S3OA 2PYLA 4FLZA 3VQ7A 3OYIA 3B6PA 4FM2A 2CH6A 5BRFA 3AAPA 1YJNN 3QIPA 3ID6A 3D2EB 3HOSA 4KI4A 4ID5A 5BN9A 4CZEA 4CGJA 1I39A 4BR5A 5HLFA 3OTOK 1LW0A 1TYQB 1N33K 3THXB 2YI1A 2KHOA 1REVA 4JHDA 3G25A 2DTUA 2WTUA 2V7YA 3AO2A 1KQSM 1U49A 4EP5A 1Z25A 1NGCA 3KLGA 3PX4A 4B9UA 3MWPA 5AQWA 4GKJK 3N4QA 4CEDA 3KKSA 5LJWA 4KPYA 4IXCA 3OYBA 3NH2A 1MA9B 1BUPA 1A5XA 4DU1A 2KZMA 4H5VA 1SUQA 2IIRA 2IVOA
chains in the Genus database with same CATH topology
3CIPA 4PKHA 2A5XA 4KH5A 3CMEN 2FF6A 2P9KB 3L6QA 1JCEA 3KK7A 3CETA 3P4IA 4ILGB 2ZJPL 2ASMA 4IDHA 5LJVA 3E1YA 3LDPA 3EO3A 4IJAA 1SS6A 3VEVA 1HX1A 1O13A 2NRWA 5AQJA 2OTLN 3H1QA 4EIAA 2QWLA 2GWKA 4Y0WA 4B1WB 3F2KA 3U4LA 1OKJA 4YOUA 5GAHP 4J8FA 3Q7BA 3LDQA 3TSQA 3CJ7A 3W3DA 1GLEG 4E1JA 3VGMA 3QMLA 3H1VX 3GL1A 1X9JA 1YITN 3DWLA 4BC2A 5KPZA 1YJ9N 4MLHA 3ENOA 1W97L 5E26A 4FWSA 2D4WA 5AQYA 5JLFA 2D0PA 5C2FA 1CZAN 4YOTA 1NGDA 3TTDA 1TYQA 2V52B 1M1KO 3SAGA 4H5TA 2Q36A 4M63C 3QFUA 2YHWA 3HTVA 1S72N 3O6WA 3CCVN 3E66A 2ZF5O 2OANA 3BF3A 3C7NB 3KZBA 4BR0A 3PLAA 1IJJA 4JKGB 4FPBA 3AARA 3VEOA 3IUCA 4BC4A 2PAVA 1ZXOA 4BRKA 3O9UA 4B1UB 4FWRA 5AFUA 4BC3A 3ATUA 3N4PA 3R6MA 4MDAA 3OHRA 4WFAL 5B8HA 3CJBA 5CE3A 4H0VB 3VMFB 3ZEUA 4FWNA 1RFQA 2PFUA 2BTFA 4JKFA 1D4XA 3G71N 2P9UA 2KKZA 2NRXA 4CBUA 3A0IX 3IKMA 2Q97A 5ELZA 2YJEA 3G6EN 3CPEA 2NZTA 5GADP 2GELA 1K9MO 1BOTO 4JNEA 4WFNL 3FLCO 5TKYA 4LC9B 1SAZA 3ZETB 3DXMB 4I6MB 5CR4A 4C1NI 2CGJA 1Q82O 5M1PA 5AZJB 2HBLA 3U9ZA 2A42A 1P8ZA 3FE1A 4H0TB 2QW9A 3EKUA 3FZMA 3CC2N 1DT9A 2F9WA 1SZ2A 2OTJN 3AAQA 4A5AA 1NGHA 1WUAA 1U2VB 1W2BM 4DHYA 2ZJQL 3R8EA 5CHIA 1QHAA 4JN4A 3PIPL 5FPNA 2H3GX 4WF9L 4YOWA 1K8KB 4BRHA 1NGIA 2E88A 2FXUA 3MX5A 1YI2N 2WFBA 4FO0A 1VQ7N 2YHYA 4FPAA 3QFPA 1VQ9N 1NMDA 4JHDB 3L4QA 4IEEA 4QS7A 5AZIA 1LOTB 3UKRA 1HLUA 3CCLN 3O5BA 1KAZA 5H1SQ 4JKCA 4WQ5A 2P9SA 1U6ZA 4KBOA 2WUSA 4M7YA 2QWRA 3T7ZA 1YF5L 5ADXA 4BVPA 4BROA 4CZJA 3FZHA 4FWQA 4CD3A 1Z6RA 1NM1A 2QWPA 4BRQA 4MDBA 1T6CA 3ENHA 5DM7L 1NWKA 4BRCA 3T69A 2ZGZA 3F5TA 4OO1J 4A61A 5AQXA 4FVUA 1YAGA 5JICA 4NLCA 5AQVA 1Q7YO 4OPHA 2HBKA 3AY9A 1BWFO 3A8YA 3MK6A 4FWKA 4UY8O 4JD2A 2E1YA 5AZIB 1HPMA 3KHYA 3O9RA 5GINA 3OBWA 4CD1A 2P9SB 3FZFA 1MWMA 1LCUA 2EWSA 4BR7A 1VQ4N 3C7NA 4BG8A 4Z94A 2E2OA 2QXLA 5EXWA 1YJWN 3OBYA 4IOXA 4XH1A 4L3QA 5M1NA 3ZYYX 1YHQN 3EE8A 4RWTA 4GVEA 4BGAA 2VCPA 2I7NA 4K43A 4NLBA 4CZFA 1HJOA 3D2FB 2YX6A 1E4FT 3VGKA 2IVPA 2ASOA 4JEPA 2GX9A 2DPNA 3A5NC 4BRFA 5ADXH 5JMVA 5BPNA 1NGFA 1H1VA 3ULEB 4EFHA 1YIJN 2RHKA 3MN5A 5KPRA 3CC7N 3IDHA 4BC5A 3LL3A 2QEXN 2Q1NA 1ESVA 3QB0A 5AQZA 3O9SA 4ILHA 5F2RA 5KQ8A 5EX5A 2D1KA 3CI5A 3S41A 3HRGA 5JVHL 2NRHA 4YOYA 2QA4N 3EN9A 4IZ9A 3LDLA 3GE1A 5AQPA 2FLOA 5FPEA 3RVCA 4FSVA 3D7EO 2Q0UA 1EQYA 3CJAA 4H5NA 2NRTA 2J4RA 4CI6A 1XC3A 3QICA 5M1FA 1QZ6A 3QBWA 3U9DA 1VQLN 4BRIA 5AZJA 4JK9A 5AR0A 4DB3A 2Q31A 4YOXA 2P9UB 3CMAN 1NLVA 4BREA 1HUXA 4WYBA 1GLJO 4BRAA 4BGBA 1K8AO 2HBJA 1T44A 4OPAA 5AQMA 4WCEL 3J8AA 4A5BA 3DXMA 3O80A 4O8UA 5TKWA 2JWKA 4GV9A 3LDNA 3F9MA 3LDOA 5AQGA 4AM6A 1NGJA 3OA9A 4YDUC 4H0OA 1NGBA 1BO5O 3IFRA 3PIOL 5FPDA 5AQSA 3HZ6A 3H46O 3VTIA 3MMVA 1S3XA 1M90O 2BUPA 3UKRB 5JLHA 5FPMA 2I7PA 3SK3A 3WQTA 5AQNA 2P9IB 3SBGA 4FWOA 1C0GA 1IG8A 2P9NB 2D0OA 1QQNA 5E84A 1S22A 3KWIA 4KH4A 2ASPA 5AQLA 3WEEB 2ITMA 4NB4A 3BP8A 3WXMB 1YVNA 4IFEA 3DAWA 5C12A 4B1VA 2NRRA 2ZWHA 3H3NO 4BQZA 2YCHA 4AF1A 2PBDA 4DQ8A 4M7XA 1HKGA 3CQYA 2W40A 1K8KA 1T6DA 5I9EB 2VWBA 3K9KA 5AQQA 5GAEP 1JJ2M 3FFKB 1C0FA 2E2PA 1BA0A 1VAZA 5BPLA 4FWPA 4DCHA 4H5RA 4EAHD 3AGRA 3HI0A 4NO7A 4JKEA 5HL7L 1DGKN 4ISGA 4CZGA 1G99A 2FSJA 1GLLO 5HOOA 3J7ZO 1Q18A 3Q7CA 3P31A 3TPQA 1R59O 1VQON 2E1ZA 5AQUA 5AQKA 3KWGA 4JKGA 5MLCQ 3CPWM 3C6AA 3BEXA 1QVFM 5GAGP 3CD6N 1RDWX 3CJ9A 4AM7A 4WFBL 3UKUA 3VETA 3JS6A 1YXQA 5GIOA 1XUPO 3VEYA 3VGLA 4B9QA 1VQNN 2NRVA 4JKHA 2FSKA 3L4IA 4MO5A 1V4SA 3ATVA 3WUHA 4O8KA 4C23A 5M1KA 1NJIO 5AQHA 3O8MA 2FF3B 2P9KA 2V7ZA 5KPTA 2E2NA 2Q2RA 3H3OB 4DKWA 3M3ZA 4JKAA 3LM9A 1NGEA 3B8AX 4ISFA 4K41A 4QS8A 4B1ZA 2P9IA 4IJNA 3BUZB 4GNIA 3HOTA 3SMSA 3IMXA 4CZHA 3O1BA 4EHUA 4CZKA 2F9TA 5AQTA 2YHXA 5DM6L 3ZX3A 3VENA 3CC4N 3MDQA 3NVKA 2P9LB 3EKSA 2QI2A 1TUYA 3DJCA 1VQ8N 3JXUA 3WXLA 4CZLA 3VPZA 3DXKA 1BA1A 1GLCG 3H45C 3O9QA 3ZX2A 3G4SN 5BR9A 4BRDA 1J6ZA 2E8AA 3CERA 4IO8A 1KXPA 3SMPA 3WXKA 3C0BA 2Q0RA 3MN6A 4XEIA 1VQMN 2AP1A 2VGNA 4BRPA 1Q86O 3AGKA 3I8BA 1GLDG 2E20A 1BG3A 2NNWA 2VGMA 4CZIA 4A2AA 3CCSN 4YDUA 3EE9A 5EVZA 3O1WA 5AFUH 3MCPA 3VEXA 3WT0A 2AA4A 4HTLA 4C1NK 3A5MC 2YJFA 4CBWA 3EZWA 3GG4A 5M1QA 2GEMA 4PHTX 4H0XB 4A2BA 4U67L 3WXIA 4PL8A 1ATRA 1N8RO 1VQKN 4BRNA 4BRGA 4PL7A 3MN7A 2RE2A 2HBMA 3HM8A 4QS9A 4BR9A 4BY9C 2P9PB 4JKBA 3NMUA 3R9PA 3E9LA 4FOIA 1KAYA 1X3MA 3VEZA 1ZBSA 3TU5A 3TSPA 4H0YB 4YOVA 3CCQN 1VQ5N 3VF6A 3ZEUB 3FGUA 3SAFA 3CF5L 2CGKA 1HKCA 5AQRA 3VTHA 4O5FA 1NGAA 1OVYA 1VQ6N 5M1OA 2JWLA 3O4WA 1HKBA 4JAXA 3FR0A 4IOAL 3GOIA 4JD2B 3SAHA 5BRDA 3VOVA 5AQFA 3HSCA 2W41A 3M5RA 2GUPA 3HBTA 1ATNA 4XH5A 4WQ4C 1BU6O 3E9OA 4BVOA 3FZKA 5JVGL 3MN9A 3I56N 3ZX0A 4R79A 3CCMN 3CCEN 1RDUA 2GWJA 1E4GT 1QVGM 2WBNA 3CXCM 1GLBG 4KH6A 5LY3A 5C2DA 4IOCL 1GLFO 1QZ5A 2VYPA 3ZETA 1NGGA 3M1FA 2FSNA 5GIPA 1KAXA 3NVMA 1JCFA 2V51B 4U7BA 3D6RA 3RSEA 3KVGA 1V4TA 4ISEA 4ILJA 4FWMA 3DXKB 3TTCA 3VESA 5BPMA 3MWTA 2HSTA 3UB5A 5EY4A 4FL9A 1VQPN 3O9TA 3CCRN 1Z05A 2NRZA 4H03B 4GV6A 1WOQA 4B1XB 2NLXA 2P9LA 3A5LC 1KC8O 3TSUA 3OW2M 3CCJN 3K9JA 4B1YB 2HMPA 4BQLA 1EO1A 3O08A 4K42A 3WXJA 5F0XA 1NBWA 3VF2A 3W0LA 4BR2A 2A41A 5BREA 1MWKA 1ILYA 4JK7A 5C15A 2ZJRL 4EHTA 4PKGA 4RCHA 2QM1A 3VEWA 1QQMA 1YUWA 1Y64A 3GDQA 3QDKA 3R3LA 3TTFA 2UYTA 4BR4A 3R1XA 4G9ZA 2F7TA 4WQ5C 3MX2A 4IWVA 5C10A 3I55N 2WC9A 4A59A 2E2QA 4MO4A 3UKUB 4H5WA 3CHWA 1K73O 4A57A 2HOEA 4JK8A 4BRMA 1ATSA 2A6AA 1DKGD 2P9PA 2GTDA 3UE5A 3H6EA 3WEEA 4F9OA 1U2VA 1BDGA 4PKIA 2P9NA 4RTFD 5AQOA 1Q81O 3LM2A 5C0YA 3L0QA 4WQ4A 1X3NA 4YORA 3CJCA 4CBXA 3VF4A 3CCUN 4JKDA 4BG9A 1DEJA 4FOEA 2IVNA 3DLLL 2QTDA 2QWMA 3GBTA 4MLEA 2QWQA 2QWNA 4CJ7A 5BRHA 4I6MA 4FWLA 4HWIA 1RGIA 5F1XA 5AQIA 4IO9L 1KD1O 3U8XA 3CQXA 4CZMA 1GLAG 3D2EA 3SBTA 2KLAA 4XH4A 3C65A 1T3VA 2CH6A 3AAPA 5BRFA 1TUUA 1YJNN 3SJHA 4GV3A 3ID6A 2HF3A 3A5OC 3D2EB 3HOSA 2A3ZA 5BN9A 4A62A 4CZEA 4BR5A 1P90A 2QWOA 1MDUB 3E9PA 3ENBA 1TYQB 3ULEA 4IEIA 2YI1A 3BF1A 2KHOA 1SQKA 4JHDA 3G25A 5EOYA 2A40A 2V7YA 3D2FA 4K25A 2CGLA 3WQUA 1KQSM 1JCGA 3I33A 3QBXA 3P38A 4GY2B 3M6GA 2ZGYA 3MCAB 1NGCA 3P39A 5KQDA 3CJ1A 3MWPA 4H0PA 1ZC6A 5AQWA 3EL2A 3N4QA 1QQOA 3SLCA 5LJWA 4IXCA 4BRLA 3C6HA 3VERA 1MA9B 1BUPA 3RSEB 5BN8A 4H5VA 3FZLA 2IIRA 1XQSC 2BH1A 2CH5A 3ID8A 2HF4A 2IVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIP A;  4PKH A;  2A5X A;  2FF6 A;  2P9K B;  3L6Q A;  1JCE A;  3P4I A;  3CET A;  2ASM A;  5LJV A;  3LDP A;  3EO3 A;  4IJA A;  3VEV A;  1HX1 A;  5AQJ A;  3H1Q A;  4EIA A;  2QWL A;  2GWK A;  4Y0W A;  4B1W B;  3U4L A;  1OKJ A;  4J8F A;  3LDQ A;  3CJ7 A;  3W3D A;  1GLE G;  4E1J A;  3VGM A;  3QML A;  3H1V X;  3GL1 A;  1X9J A;  3DWL A;  4BC2 A;  5KPZ A;  4MLH A;  3ENO A;  5E26 A;  5AQY A;  4FWS A;  2D4W A;  5JLF A;  2D0P A;  1CZA N;  1NGD A;  1TYQ A;  2V52 B;  4H5T A;  2Q36 A;  4M63 C;  3QFU A;  2YHW A;  3HTV A;  3O6W A;  2ZF5 O;  2OAN A;  3BF3 A;  3C7N B;  3KZB A;  4BR0 A;  1IJJ A;  4FPB A;  3AAR A;  3VEO A;  3IUC A;  4BC4 A;  2PAV A;  1ZXO A;  4BRK A;  4B1U B;  4FWR A;  5AFU A;  4BC3 A;  3ATU A;  3R6M A;  3OHR A;  5B8H A;  3CJB A;  5CE3 A;  4H0V B;  3ZEU A;  4FWN A;  1RFQ A;  2BTF A;  1D4X A;  2P9U A;  4CBU A;  3A0I X;  2Q97 A;  5ELZ A;  2YJE A;  2NZT A;  2GEL A;  1BOT O;  4JNE A;  3FLC O;  5TKY A;  4LC9 B;  1SAZ A;  3ZET B;  3DXM B;  4I6M B;  2CGJ A;  5AZJ B;  3U9Z A;  2A42 A;  1P8Z A;  3FE1 A;  4H0T B;  2QW9 A;  3FZM A;  3EKU A;  2F9W A;  1SZ2 A;  3AAQ A;  1NGH A;  1WUA A;  1U2V B;  4DHY A;  3R8E A;  1QHA A;  4JN4 A;  5FPN A;  2H3G X;  1K8K B;  4BRH A;  1NGI A;  2E88 A;  2FXU A;  4FO0 A;  2YHY A;  4FPA A;  3QFP A;  1NMD A;  4JHD B;  5AZI A;  4QS7 A;  1LOT B;  3UKR A;  1HLU A;  3O5B A;  1KAZ A;  4WQ5 A;  2P9S A;  1U6Z A;  4KBO A;  2WUS A;  4M7Y A;  2QWR A;  5ADX A;  4BVP A;  4BRO A;  4CZJ A;  3FZH A;  4FWQ A;  4CD3 A;  1Z6R A;  1NM1 A;  2QWP A;  4BRQ A;  1T6C A;  3ENH A;  1NWK A;  4BRC A;  2ZGZ A;  4A61 A;  5AQX A;  1YAG A;  5JIC A;  5AQV A;  3AY9 A;  1BWF O;  3A8Y A;  3MK6 A;  4FWK A;  4JD2 A;  2E1Y A;  5AZI B;  1HPM A;  3KHY A;  4CD1 A;  2P9S B;  3FZF A;  1MWM A;  1LCU A;  2EWS A;  4BR7 A;  3C7N A;  4BG8 A;  4Z94 A;  2E2O A;  2QXL A;  5EXW A;  4XH1 A;  4L3Q A;  4RWT A;  4BGA A;  2VCP A;  2I7N A;  4K43 A;  4CZF A;  1HJO A;  3D2F B;  1E4F T;  3VGK A;  2IVP A;  2ASO A;  5ADX H;  5JMV A;  2DPN A;  3A5N C;  4BRF A;  5BPN A;  1NGF A;  1H1V A;  3ULE B;  4EFH A;  5KPR A;  3MN5 A;  3IDH A;  4BC5 A;  3LL3 A;  2Q1N A;  1ESV A;  3QB0 A;  5AQZ A;  5F2R A;  5KQ8 A;  5EX5 A;  2D1K A;  3CI5 A;  3S41 A;  2NRH A;  3EN9 A;  4IZ9 A;  3LDL A;  3GE1 A;  5AQP A;  2FLO A;  5FPE A;  4FSV A;  3D7E O;  2Q0U A;  1EQY A;  3CJA A;  4H5N A;  2J4R A;  4CI6 A;  1XC3 A;  3QIC A;  1QZ6 A;  3QBW A;  3U9D A;  4BRI A;  5AZJ A;  5AR0 A;  4DB3 A;  2Q31 A;  2P9U B;  1NLV A;  4BRE A;  1HUX A;  4WYB A;  1GLJ O;  4BRA A;  4BGB A;  1T44 A;  5AQM A;  3J8A A;  3DXM A;  3O80 A;  3LDN A;  3F9M A;  3LDO A;  5AQG A;  4AM6 A;  1NGJ A;  4YDU C;  4H0O A;  1NGB A;  1BO5 O;  3IFR A;  5FPD A;  5AQS A;  3HZ6 A;  3H46 O;  3MMV A;  1S3X A;  2BUP A;  3UKR B;  5JLH A;  5FPM A;  2I7P A;  3SK3 A;  3WQT A;  5AQN A;  2P9I B;  4FWO A;  1C0G A;  1IG8 A;  2P9N B;  2D0O A;  1QQN A;  5E84 A;  1S22 A;  3WEE B;  2ASP A;  5AQL A;  2ITM A;  4NB4 A;  3BP8 A;  1YVN A;  3DAW A;  4B1V A;  3H3N O;  2ZWH A;  4BQZ A;  2YCH A;  2PBD A;  4DQ8 A;  4M7X A;  1HKG A;  3CQY A;  2W40 A;  1K8K A;  1T6D A;  5I9E B;  2VWB A;  5AQQ A;  3FFK B;  1C0F A;  2E2P A;  1BA0 A;  5BPL A;  4FWP A;  4DCH A;  4H5R A;  4EAH D;  3HI0 A;  4NO7 A;  1DGK N;  4ISG A;  4CZG A;  1G99 A;  2FSJ A;  1GLL O;  1Q18 A;  3TPQ A;  1R59 O;  2E1Z A;  5AQU A;  5AQK A;  3BEX A;  1RDW X;  3CJ9 A;  4AM7 A;  3UKU A;  3VET A;  3JS6 A;  1YXQ A;  1XUP O;  3VEY A;  3VGL A;  4B9Q A;  2FSK A;  3L4I A;  4MO5 A;  1V4S A;  3ATV A;  3WUH A;  4O8K A;  4C23 A;  5AQH A;  3O8M A;  2FF3 B;  2P9K A;  2V7Z A;  5KPT A;  2E2N A;  2Q2R A;  3H3O B;  3M3Z A;  3LM9 A;  1NGE A;  3B8A X;  4ISF A;  4K41 A;  4QS8 A;  4B1Z A;  2P9I A;  4IJN A;  3BUZ B;  4GNI A;  3SMS A;  3IMX A;  4CZH A;  3O1B A;  4EHU A;  4CZK A;  2F9T A;  5AQT A;  2YHX A;  3ZX3 A;  3VEN A;  3MDQ A;  2P9L B;  3EKS A;  1TUY A;  3DJC A;  3JXU A;  3WXL A;  4CZL A;  3VPZ A;  3DXK A;  1BA1 A;  1GLC G;  3H45 C;  3ZX2 A;  5BR9 A;  4BRD A;  1J6Z A;  2E8A A;  3CER A;  4IO8 A;  1KXP A;  3SMP A;  3WXK A;  3C0B A;  2Q0R A;  3MN6 A;  4XEI A;  2AP1 A;  4BRP A;  3I8B A;  1GLD G;  2E20 A;  1BG3 A;  4CZI A;  4A2A A;  4YDU A;  5EVZ A;  3O1W A;  5AFU H;  3MCP A;  3VEX A;  3WT0 A;  2AA4 A;  4HTL A;  3A5M C;  2YJF A;  4CBW A;  3EZW A;  3GG4 A;  2GEM A;  4H0X B;  4A2B A;  3WXI A;  4PL8 A;  1ATR A;  4BRN A;  4BRG A;  4PL7 A;  3MN7 A;  4BR9 A;  3HM8 A;  4QS9 A;  2P9P B;  3R9P A;  4FOI A;  1KAY A;  1X3M A;  3VEZ A;  1ZBS A;  3TU5 A;  4H0Y B;  3VF6 A;  3ZEU B;  3FGU A;  2CGK A;  1HKC A;  5AQR A;  4O5F A;  1NGA A;  3O4W A;  1HKB A;  4JAX A;  3FR0 A;  3GOI A;  4JD2 B;  5BRD A;  3VOV A;  5AQF A;  3HSC A;  2W41 A;  2GUP A;  3HBT A;  1ATN A;  4XH5 A;  4WQ4 C;  1BU6 O;  4BVO A;  3FZK A;  3MN9 A;  3ZX0 A;  2GWJ A;  1E4G T;  1GLB G;  5LY3 A;  1GLF O;  1QZ5 A;  2VYP A;  3ZET A;  1NGG A;  3M1F A;  2FSN A;  1KAX A;  1JCF A;  2V51 B;  3RSE A;  3KVG A;  1V4T A;  4ISE A;  4FWM A;  3DXK B;  3VES A;  5BPM A;  3UB5 A;  5EY4 A;  4FL9 A;  1Z05 A;  4H03 B;  1WOQ A;  4B1X B;  2NLX A;  2P9L A;  3A5L C;  4B1Y B;  2HMP A;  4BQL A;  3O08 A;  4K42 A;  3WXJ A;  5F0X A;  1NBW A;  3VF2 A;  3W0L A;  4BR2 A;  2A41 A;  5BRE A;  1MWK A;  4EHT A;  4PKG A;  4RCH A;  2QM1 A;  3VEW A;  1QQM A;  1YUW A;  1Y64 A;  3GDQ A;  3QDK A;  4BR4 A;  2UYT A;  4WQ5 C;  4IWV A;  2E2Q A;  4MO4 A;  3UKU B;  4H5W A;  3CHW A;  2HOE A;  4BRM A;  1ATS A;  2A6A A;  1DKG D;  2P9P A;  2GTD A;  3UE5 A;  3H6E A;  3WEE A;  4F9O A;  1U2V A;  1BDG A;  4PKI A;  2P9N A;  4RTF D;  5AQO A;  3LM2 A;  3L0Q A;  4WQ4 A;  1X3N A;  3CJC A;  4CBX A;  3VF4 A;  4BG9 A;  1DEJ A;  4FOE A;  2IVN A;  2QWM A;  3GBT A;  4MLE A;  2QWQ A;  2QWN A;  4CJ7 A;  5BRH A;  4I6M A;  4FWL A;  4HWI A;  1RGI A;  5F1X A;  5AQI A;  3U8X A;  3CQX A;  4CZM A;  1GLA G;  3D2E A;  4XH4 A;  2CH6 A;  5BRF A;  3AAP A;  1TUU A;  3SJH A;  2HF3 A;  3A5O C;  3D2E B;  2A3Z A;  5BN9 A;  4A62 A;  4CZE A;  4BR5 A;  2QWO A;  1MDU B;  3ULE A;  1TYQ B;  2YI1 A;  3BF1 A;  2KHO A;  1SQK A;  4JHD A;  3G25 A;  5EOY A;  2A40 A;  2V7Y A;  3D2F A;  4K25 A;  2CGL A;  3WQU A;  1JCG A;  3I33 A;  3QBX A;  4GY2 B;  3M6G A;  2ZGY A;  1NGC A;  5KQD A;  3CJ1 A;  4H0P A;  1ZC6 A;  5AQW A;  3EL2 A;  3SLC A;  1QQO A;  5LJW A;  4IXC A;  4BRL A;  3VER A;  1MA9 B;  1BUP A;  3RSE B;  5BN8 A;  4H5V A;  3FZL A;  2IIR A;  1XQS C;  2CH5 A;  3ID8 A;  2HF4 A;  2IVO A; 
#chains in the Genus database with same CATH topology
 4PKH A;  2A5X A;  3RR7 A;  4ILG B;  3QEX A;  2EX3 A;  3VEV A;  2HHX A;  4JI0 K;  5AQJ A;  4TSX A;  3F2K A;  3AA2 A;  1HQE A;  4H4M A;  2RKI A;  3Q7B A;  4W5O A;  2UXD K;  1J54 A;  4ID1 A;  3W3D A;  1GLE G;  3VGM A;  4KTW A;  3H1V X;  3I8D A;  4DU3 A;  1S1T A;  3AVI A;  4BC2 A;  1IKX A;  5KPZ A;  4MLH A;  3ENO A;  5JLF A;  5KI6 A;  4E1M A;  4E19 A;  5C2F A;  1NGD A;  1TYQ A;  1IKY A;  3DLB A;  4DLG A;  4H5T A;  3OYF A;  3PX6 A;  3HTV A;  5C24 A;  3B6O A;  4B3O A;  2OAN A;  3VQ8 A;  4DSK A;  4E7H A;  4BR0 A;  1IJJ A;  2PAV A;  4OKE A;  4LFA K;  1BI4 B;  5AFU A;  4BC3 A;  2RPI A;  3OHR A;  1IG9 A;  4WFA L;  5B8H A;  5CE3 A;  1VSM A;  3ZEU A;  4OKK A;  1D4X A;  1S9E A;  3ZSZ A;  4KHP K;  2NRX A;  3IKM A;  2Q97 A;  4C8O A;  4DSF A;  3AVM A;  5HP1 A;  4KO0 A;  4KHW A;  5GAD P;  2WON A;  4FZY A;  3ZET B;  3DXM B;  4JI3 K;  4K8X A;  4C1N I;  4CFA A;  3VA3 A;  3TR8 A;  2HBL A;  1S1V A;  3U9Z A;  1P8Z A;  4H0T B;  4HHT A;  3FZM A;  4X65 K;  1SZ2 A;  4FVM A;  3AAQ A;  4A5A A;  1C1C A;  4B08 A;  3UIQ A;  1VSE A;  1U2V B;  3LP0 A;  3J80 O;  3C94 A;  1Q9X A;  2VQF K;  5FPN A;  2E88 A;  2FXU A;  2O8F B;  3CFP A;  2FBT A;  2WFB A;  4M3R A;  1VQ7 N;  2YHY A;  1NMD A;  5AZI A;  1NK8 A;  3V1Q A;  1FKO A;  4BDZ A;  4JKC A;  4WQ5 A;  4KBO A;  3NGY A;  2QWR A;  4DSI A;  1I94 K;  3KK1 A;  1NM1 A;  1T6C A;  3RMC A;  5DM7 L;  3QIN A;  3T69 A;  3F5T A;  3IS9 A;  1G15 A;  5AQV A;  4OPH A;  2JGU A;  2OZM A;  1NJX A;  3VQ4 A;  2P9S B;  1NOZ A;  4FLX A;  1LCU A;  2G8F A;  4JI5 K;  4GMJ B;  5EXW A;  5M1N A;  4RWT A;  4FK0 A;  4CZF A;  3SQ4 A;  1E4F T;  3VGK A;  2G8U A;  2ASO A;  1TKZ A;  4DV0 K;  1NK0 A;  2RHK A;  5KPR A;  4BC5 A;  4DV5 K;  5KQ8 A;  1IV0 A;  1C0M A;  4NYN A;  5EX5 A;  4CEB A;  3HRG A;  4YOY A;  2QA4 N;  4IZ9 A;  3K5N A;  4DG1 A;  2FLO A;  1Z26 A;  1JLG A;  3BZC A;  1EQY A;  3L8B A;  3QIC A;  4BDY A;  2HHW A;  3DOK A;  5M1F A;  2XY7 A;  3U9D A;  1A5W A;  4B9T A;  4DF4 A;  5AR0 A;  2O8D B;  2P9U B;  3CMA N;  4BRE A;  4BRA A;  1NK6 A;  3MED A;  2HBJ A;  2G8V A;  4WCE L;  3P1G A;  3O80 A;  5TKW A;  3PY8 A;  4N47 A;  2E6M A;  3U6F A;  3CFO A;  3LDO A;  1NGJ A;  3V1O A;  2UU9 K;  4YDU C;  1BO5 O;  2HHS A;  3VTI A;  1IKV A;  1S3X A;  1M90 O;  1WSE A;  5JLH A;  2Z1H A;  4J2D A;  2DY4 A;  3LPT A;  4OLB A;  5AQN A;  4FWO A;  3K57 A;  5E84 A;  1S22 A;  3KWI A;  1NU0 A;  5BR8 K;  4FLY A;  3PO4 A;  2O8E A;  4B1V A;  1IKW A;  2ZWH A;  1C1A A;  5KRT A;  3CQY A;  4ELT A;  4ZTF A;  1T6D A;  3NBP A;  5AQQ A;  5GAE P;  2E2P A;  1TAU A;  4DCH A;  4EAH D;  5J1E A;  3HI0 A;  4JKE A;  4B8C A;  2FSJ A;  3Q7C A;  2HNY A;  3EY1 A;  3THY B;  1VQO N;  3NCI A;  3K59 A;  4CK1 A;  3SUN A;  3BEX A;  4WFB L;  2A1S A;  4DV4 K;  1XUP O;  4B9Q A;  3LDS A;  1V4S A;  2P9K A;  1CZB A;  3H3O B;  3LAN A;  4JKA A;  3B8A X;  4QOZ B;  4ISF A;  1DLO A;  4BDP A;  4GNI A;  3HOT A;  3SMS A;  1JXE A;  4CZK A;  2F9T A;  5AQT A;  3OYG A;  4E7K A;  4CEC A;  3IRX A;  4CEO A;  2G8I A;  3O4N A;  3ZSW A;  2BDP A;  1IH7 A;  3SV3 A;  4Q0B A;  1BA1 A;  1GLC G;  3G4S N;  5BR9 A;  3VA0 A;  3CER A;  3WNG A;  3JSM A;  4DS4 A;  4IO8 A;  3WXK A;  2UUB K;  3L3U A;  5FRM A;  1SV5 A;  2Q0R A;  3MN6 A;  2HHQ A;  5KGX A;  1HR0 K;  3L2R A;  3CCS N;  4A2A A;  4YDU A;  3O1W A;  5AFU H;  4DQQ A;  3MCP A;  4J2B A;  4EZ9 A;  1RT1 A;  2AA4 A;  1WN7 A;  3EZW A;  2GEM A;  4A2B A;  4GKK K;  1ASW A;  3ITH A;  3HP9 A;  4PL7 A;  2YNG A;  3O3F A;  3G10 A;  3HM8 A;  4DFJ A;  1KAY A;  1X3M A;  3VEZ A;  2Q3S A;  3TSP A;  4YOV A;  3CCQ N;  3SAF A;  2CGK A;  4O5F A;  1OVY A;  1HQU A;  1QTM A;  4RW4 A;  1QS4 A;  3SAH A;  2XRI A;  4CJQ A;  1QSS A;  4FJX A;  4DTX A;  4OGC A;  3M5R A;  2E5L K;  3SPY A;  5C42 A;  1ATN A;  4WQ4 C;  1CXU A;  3FZK A;  5JS1 A;  1VSK A;  3TAN A;  1RDU A;  3L2U A;  1QQC A;  3CXC M;  5C2D A;  1NGG A;  2FSN A;  2O8B A;  2HHV A;  3DMJ A;  1TL3 A;  4FJI A;  4FWM A;  2HST A;  4B8A B;  3UB5 A;  4CIE A;  4C8L A;  4FL9 A;  5I42 A;  5SZT A;  3CCR N;  1Z05 A;  3RRH A;  4GV6 A;  2HB5 A;  3K9J A;  2VG5 A;  3QET A;  4B1Y B;  1EO1 A;  4BR2 A;  5BRE A;  1ILY A;  4M3Z A;  4EHT A;  3C95 A;  3VEW A;  3V4I A;  1Y64 A;  3NH1 A;  1VRU A;  4IFV A;  4DTJ A;  1BI4 A;  4WQ5 C;  3BDP A;  4AIL C;  3MX2 A;  3I55 N;  4CIG A;  2WC9 A;  1RDC A;  4MO4 A;  3CHW A;  3VQD A;  3MEE A;  2HOE A;  4JK8 A;  2G8K A;  4RTF D;  2ZQB A;  3HT3 A;  1Q81 O;  5C0Y A;  3L0Q A;  3HPG A;  2HHT A;  3T3F A;  1T8E A;  2QTD A;  4CIF A;  4DSL A;  2QWN A;  3DI6 A;  4FWL A;  1RGI A;  4IO9 L;  1KD1 O;  4DQP A;  3CQX A;  2KLA A;  4XH4 A;  2W6K A;  3C65 A;  4JLH A;  3KJV A;  3OJS A;  4KB1 A;  2A3Z A;  2IOC A;  1MDU B;  3E9P A;  3ENB A;  3BF1 A;  2PY5 A;  5EOY A;  2A40 A;  1ASV A;  2CGL A;  1JCG A;  3ALY A;  4DV7 K;  3I33 A;  4B9V A;  4GY2 B;  2ZGY A;  3MCA B;  5KQD A;  3M8S A;  2XHB A;  4N41 A;  1EXQ A;  3C6H A;  3AVC A;  3RSE B;  4DV3 K;  4F2S A;  5AQX A;  3CIP A;  3P83 D;  2KZZ A;  1TGO A;  2FF6 A;  4WE1 A;  2P9K B;  3KK7 A;  2ZJP L;  2ASM A;  4IDH A;  5LJV A;  1NG9 A;  3LDP A;  3EO3 A;  1O13 A;  2OTL N;  3H1Q A;  3U4L A;  4NCG A;  4FJ5 A;  5FRO A;  1HNZ K;  4CK2 A;  1YIT N;  2D4W A;  4FJN A;  3AVG A;  3TTD A;  2OPP A;  1Q9Y A;  3TAE A;  4YNQ A;  4M63 C;  3QFU A;  3HM9 A;  3O6W A;  3ISN C;  4CF2 A;  3CCV N;  3E66 A;  1DTQ A;  2KFZ A;  2ZF5 O;  3OS2 A;  3LWL A;  3ZSQ A;  3QLH A;  3AAR A;  4E1N A;  4BC4 A;  3DLH A;  1HYS A;  4BRK A;  4N56 A;  3O9U A;  4B1U B;  4FWR A;  3ATU A;  3N4P A;  3R6M A;  1B9D A;  4MDA A;  3I0R A;  4H0V B;  1OH5 A;  3VMF B;  3SNN A;  4FWN A;  4PQU A;  1VSH A;  5HBM A;  4CBU A;  4NYF A;  5ELZ A;  4FCY A;  3CPE A;  1YTU A;  1C0U A;  1S1X A;  3QER A;  2GEL A;  3KLI A;  4LY7 A;  3NH0 A;  1BIU A;  4LF4 K;  5TKY A;  1KFS A;  4I6M B;  4DTN A;  1LV5 A;  3SJJ A;  2CGJ A;  5AZJ B;  4R5P A;  3CC2 N;  4DR6 K;  3S3M A;  1NGH A;  5HRP A;  1WUA A;  4AQY K;  4DHY A;  2ZJQ L;  4JN4 A;  3PIP L;  4FLU A;  1N6Q A;  4BRH A;  1C6V A;  4BE1 A;  3HVT A;  1YI2 N;  2ITG A;  4OVL A;  1KLM A;  5EU7 A;  1VQ9 N;  3L4Q A;  4QS7 A;  1K6Y A;  1HLU A;  1B92 A;  4X62 K;  5HRS A;  3T7Z A;  4M7Y A;  4Z0U A;  4CER A;  2E6L A;  3HJF A;  2QWP A;  4MDB A;  1NWK A;  2UXC K;  4BRC A;  4C8N A;  3OYN A;  4OO1 J;  4M3X A;  2LSN A;  4DU4 A;  1X1P A;  3MK6 A;  1LWE A;  3O9R A;  1TKD A;  4CD1 A;  4JI2 K;  3OYJ A;  3TAF A;  4CJS A;  4BR7 A;  4F3O A;  1VQ4 N;  3C7N A;  4AHV A;  4CJV A;  3OBY A;  4IOX A;  4XH1 A;  3ZYY X;  2HNZ A;  2F8T A;  3M8R A;  4BGA A;  1NK5 A;  2VCP A;  3QES A;  3QEW A;  3SI6 A;  4PWD A;  4CHY A;  3NAE A;  3ZSY A;  5ADX H;  2DPN A;  3A5N C;  3KD5 E;  5BPN A;  1NGF A;  4KHN A;  1H1V A;  3CC7 N;  1D5A A;  3MN5 A;  3KIO A;  1BIS A;  1RIL A;  1ESV A;  3QB0 A;  2QEX N;  4ILH A;  4BWM A;  5JVH L;  4FJH A;  2NRH A;  3LDL A;  3GE1 A;  2OPQ A;  4FSV A;  3V9S A;  1VSL A;  5SWM A;  2NRT A;  4CI6 A;  4CJK A;  3ASM A;  2VQE K;  4HCB A;  3WNH A;  3THX A;  2YHA A;  3QBW A;  3LZI A;  2OPR A;  5AZJ A;  4JK9 A;  3OYD A;  4YOX A;  2Z1G A;  1HUX A;  4WYB A;  5FLX O;  3DLG A;  1FW6 A;  4ELU A;  4OPA A;  2Y1J A;  1KCF A;  1S6Q A;  3DXM A;  1UA0 A;  1UAX A;  4AM6 A;  3EZ5 A;  3PO5 A;  3P5J A;  4Z4F A;  4NXM K;  1NGB A;  3PIO L;  3HZ6 A;  3MMV A;  2Y1I A;  2FBV A;  4Z4I A;  4B3M K;  3CQ8 A;  1TK5 A;  2DFE A;  3SBG A;  2P9I B;  2VWK A;  1C0G A;  1IG8 A;  2GUI A;  2D0O A;  4BWJ A;  2OYQ A;  4KH4 A;  3WEE B;  5AQL A;  5C25 A;  1FK9 A;  5C12 A;  4E89 A;  1MU2 A;  1HKG A;  1WSJ A;  1K8K A;  4HCC A;  2VWB A;  3RRG A;  4DQI A;  3FFK B;  1C0F A;  3LAK A;  4CHP A;  4F8R A;  5K14 A;  3OYK A;  1DGK N;  4ISG A;  3SUQ A;  3AVF A;  5HOO A;  3J7Z O;  1Q18 A;  4O44 A;  3L2V A;  2ZM6 K;  3TPQ A;  1LAV A;  3A2F A;  3KWG A;  1RTD A;  1RDW X;  3SQ1 A;  3CJ9 A;  1WAJ A;  1HNV A;  3UKU A;  1NK9 A;  3VEY A;  1VQN N;  2NRV A;  2FSK A;  3L4I A;  4MO5 A;  3ATV A;  5M1K A;  2HND A;  1ZBF A;  2FF3 B;  5KPT A;  1NNE A;  4LF5 K;  3SV4 A;  1N36 K;  4OPK A;  1NGE A;  4ELV A;  1DTT A;  4KRE A;  3NE6 A;  4PY5 A;  3DLR A;  2YHX A;  3VN5 A;  4CJR A;  1EKE A;  3NHG A;  3CC4 N;  3NVK A;  2QI2 A;  1TUY A;  4KRF A;  1JXB A;  3WXL A;  3ZSO A;  3DXK A;  3H45 C;  3ZX2 A;  1TL1 A;  4BRD A;  4BE2 A;  1J6Z A;  1UA1 A;  1KXP A;  3SMP A;  3OVN A;  1VQM N;  2VGN A;  4BRP A;  4DLE A;  1Q86 O;  1J5O A;  1GLD G;  1W7A A;  1BG3 A;  2NNW A;  2VGM A;  4CZI A;  3NGZ A;  3TAQ A;  3OYA A;  3EE9 A;  1KSP A;  3AA3 A;  2FC0 A;  4CBW A;  3CM5 A;  3GG4 A;  1BHL A;  2B4J A;  4PL8 A;  4DV2 K;  1UOC A;  4MQ3 A;  1VQK N;  1E3M A;  4BY9 C;  4BR9 A;  3K0S A;  3NMU A;  3E9L A;  4PUO A;  1ZBS A;  4H0Y B;  4JI6 K;  3VF6 A;  3CF5 L;  5CY4 A;  1RT7 A;  5AQR A;  3VTH A;  5M1O A;  2O8B B;  1W0H A;  3FR0 A;  2F96 A;  4AHC A;  3HSC A;  3RMB A;  4XH5 A;  1VHX A;  4JV5 K;  5JVG L;  4M3Y A;  3MN9 A;  5AJ3 K;  4R79 A;  3CCE N;  1E4G T;  3IG1 A;  2WBN A;  4YFU A;  5LY3 A;  1GLF O;  2IC3 A;  3ZET A;  3SUP A;  4CEZ A;  4CGF A;  4U7B A;  3D6R A;  2UUC K;  1ZBH A;  4FLV A;  4ILJ A;  1RDA A;  3DXK B;  1NJZ A;  1U47 A;  3VQC A;  5EY4 A;  1WAF A;  5IWA K;  4H03 B;  1ITG A;  3OYC A;  2O8D A;  1WOQ A;  2NLX A;  1KC8 O;  4DFK A;  3OW2 M;  3CCJ N;  2P5G A;  1BL3 A;  4BQL A;  3O08 A;  3W0L A;  4PA1 A;  3VQ9 A;  2I5J A;  4PKG A;  2GV9 A;  2QM1 A;  4KFB A;  1QQM A;  1YUW A;  3AO4 A;  3R3L A;  3TTF A;  3LZJ A;  1NK7 A;  2UXB K;  4IWV A;  1VSJ A;  4H5W A;  4CES A;  4A57 A;  3V1R A;  1DKG D;  3SQ0 A;  4F9O A;  5AQO A;  2P9N A;  4C8K A;  2KTQ A;  4WQ4 A;  3AA5 X;  1D9D A;  3VF4 A;  4JKD A;  2YNH A;  1DEJ A;  4FOE A;  3OYM A;  3DLL L;  3NF8 A;  3O4Q A;  3T1H K;  3KKR A;  3GBT A;  3ZT2 A;  1BQM A;  4M41 A;  4FJK A;  5AQI A;  3PUF A;  4JI8 K;  3U8X A;  3SBT A;  4X66 K;  4KTZ A;  4W5T A;  1T3V A;  1TUU A;  3EYZ A;  1W9H A;  3SYZ A;  2HVI A;  3A5O C;  4JS5 A;  2QWO A;  2KFN A;  4K8Z A;  2O8C A;  4IEI A;  4IBN A;  1SQK A;  4K25 A;  3D2F A;  3SCX A;  3O3H A;  3QBX A;  3M6G A;  3P39 A;  1RCH A;  1ZC6 A;  1WSI A;  3SLC A;  1QQO A;  4Z4G A;  4BRL A;  4B3S K;  1YVU A;  3TWH A;  3FZL A;  1XQS C;  3SJH A;  5LMN K;  3QNN A;  2O4I A;  1HPZ A;  1NOY A;  1RBV A;  4CF0 A;  5LL6 Z;  4Z4C A;  3L6Q A;  3P4I A;  1JCE A;  3BZK A;  1WSG A;  4IJA A;  2YKN A;  2NRW A;  4EIA A;  4HTU A;  4Y0W A;  4CHQ A;  1OH7 A;  4YOU A;  2IGI A;  4CHZ A;  3TSQ A;  1NK4 A;  1LWC A;  1VSI A;  4CGH A;  4E1J A;  4M3W A;  3QML A;  3GL1 A;  1X9J A;  3DWL A;  1YJ9 N;  3VQA A;  1W97 L;  5E26 A;  1JLQ A;  2O4G A;  2D0P A;  3C6U A;  4YOT A;  4H8K A;  3SAG A;  2YKM A;  3QEV A;  2ETJ A;  2BGG A;  4E7J A;  1S1W A;  3PLA A;  1NJW A;  3V81 A;  5I3U A;  4JKG B;  3U3Y A;  3IUC A;  4Y1C A;  5DK5 A;  4KHU A;  4IFY A;  4LH4 A;  4FJ8 A;  3JAM O;  4CF1 A;  4E3S A;  4NCB A;  2X78 A;  3PSI A;  1U4B A;  1RFQ A;  1GOA A;  3VQE A;  3G71 N;  2P9U A;  2KKZ A;  4RG8 A;  3RWU A;  2YJE A;  1S5J A;  4W5Q A;  3CM6 A;  4DTM A;  1K9M O;  1CXQ A;  4LC9 B;  2XY5 A;  1HJR A;  2A42 A;  3FE1 A;  2QW9 A;  2E4L A;  1VK0 A;  3EKU A;  1DT9 A;  2F9W A;  4DF8 A;  1RT6 A;  4ZTJ A;  1JKH A;  3L2Q A;  3HXM A;  3WNF A;  2HVH A;  3PSF A;  4CCH A;  1W2B M;  2OZS A;  5CHI A;  4JRP A;  3QIO A;  2B5J A;  1QE1 A;  1RBU A;  2PZS A;  1RBS A;  4FO0 A;  4E7I A;  3HVR A;  4RW8 A;  4FPA A;  2PYJ A;  3QFP A;  4CEQ A;  4JHD B;  4IEE A;  3UKR A;  3CCL N;  3K5L A;  3MAQ A;  2P9S A;  1U6Z A;  2WUS A;  4AH9 A;  1WSF A;  4FZX C;  5ADX A;  4CZJ A;  4FWQ A;  1Z6R A;  4BRQ A;  1IBM K;  3ENH A;  4C8M A;  1XMQ K;  1S9G A;  2ZGZ A;  4A61 A;  1TVR A;  2YHB A;  5JIC A;  1Q7Y O;  2HBK A;  3AVB A;  3AY9 A;  1BWF O;  4FWK A;  3ZSV A;  4NCA A;  4JD2 A;  4DV6 K;  1KVB A;  5AZI B;  4OLA A;  3G0Z A;  3FZF A;  4LH5 A;  1MWM A;  4Z94 A;  4AHT A;  3AVA A;  4L3Q A;  2FBX A;  4GVE A;  4CF8 A;  2I7N A;  4K43 A;  4NLB A;  4DR1 K;  1HJO A;  1NKB A;  4CGD A;  4LD0 A;  5JMV A;  2GX9 A;  4BRF A;  3E01 A;  3ULE B;  4EFH A;  1X9W A;  3IDH A;  1D8Y A;  3AO3 A;  3LL3 A;  3MXI A;  4V19 S;  2Q1N A;  5AQZ A;  1WLJ A;  3S41 A;  2D1K A;  1TAQ A;  3CI5 A;  3EN9 A;  3QEP A;  5AQP A;  4LF7 K;  4H5N A;  3QO9 A;  2HMI A;  1KLN A;  1XC3 A;  1QZ6 A;  3ZT4 A;  2Q31 A;  4LFB K;  4O55 A;  1CLQ A;  1NLV A;  1RBR A;  1FKP A;  3AO5 A;  1T44 A;  1JLB A;  3T1A A;  4FZZ A;  3J8A A;  4GV9 A;  3LP2 A;  2QXF A;  3V9X A;  2AJQ A;  3OA9 A;  4CJ5 A;  4CJW A;  4CF9 A;  4H0O A;  2BAN A;  3IFR A;  5FPD A;  4DS5 A;  3H46 O;  4DMN A;  1EWQ A;  3DRS A;  2QKB A;  4W5R A;  1U45 A;  3UKR B;  5FPM A;  2I7P A;  1YTA A;  5DMR A;  3SK3 A;  1RTH A;  3VQB A;  3WQT A;  2ASP A;  4QCL A;  1HRH A;  3WXM B;  4CW7 B;  4CEA A;  4IFE A;  1T7P A;  3DAW A;  2NRR A;  3H3N O;  2OPS A;  2YCH A;  4DQ8 A;  4M7X A;  1TK8 A;  2VWJ A;  2ZD1 A;  3HO1 A;  5I9E B;  4B9M A;  2X6S A;  4KHY A;  5T7B A;  1J53 A;  1JJ2 M;  1VAZ A;  4FWP A;  4HVJ A;  3OY9 A;  5HL7 L;  1SKS A;  4O5B A;  1G99 A;  1GLL O;  1LW2 A;  1WSH A;  3P31 A;  2E1Z A;  3LAM A;  1QVF M;  3IAY A;  4AM7 A;  1RT4 A;  3ZT0 A;  4IDK A;  4FM1 A;  4B3R K;  4FJG A;  3WUH A;  4C23 A;  1NJI O;  4M42 A;  3VQQ A;  4M3U A;  3DRR A;  4CJP A;  4I7F A;  4IKF A;  2Q2R A;  3BY5 A;  3M3Z A;  1A5V A;  3LM9 A;  3PX0 A;  4B1Z A;  2P9I A;  4QAG A;  3BUZ B;  4GW6 A;  4CZH A;  3O1B A;  1JL1 A;  4LF8 K;  4DQS A;  5DM6 L;  3ZX3 A;  1N34 K;  3MDQ A;  4DSJ A;  3EKS A;  2JLE A;  3KLH A;  1RT5 A;  3DLE A;  1QSL A;  4J2A A;  4CFD A;  1BIZ A;  4CZL A;  3VQP A;  3O9Q A;  3V9Z A;  4EZ6 A;  1BGX T;  1ZBI A;  2E8A A;  3I0S A;  3K2P A;  3ZCM A;  2AP1 A;  3I8B A;  4DTO A;  3M8Q A;  1OH8 A;  4CEE A;  4DR7 K;  5EVZ A;  1WB9 A;  4Y1D A;  3VEX A;  4HTL A;  3A5M C;  3VQ5 A;  5M1Q A;  4PHT X;  4H0X B;  4U67 L;  3WXI A;  4LF9 K;  1RDD A;  1N8R O;  2EHG A;  3KLE A;  3AO1 A;  4JI4 K;  2RE2 A;  3MEC A;  1NMN A;  2P9P B;  4HUF A;  1VQ5 N;  3KTQ A;  3ZEU B;  3KLF A;  3FGU A;  4Q5V A;  1HKC A;  1NGA A;  3O4W A;  1HKB A;  4JAX A;  3GOI A;  4JD2 B;  4DTR A;  3J7Y P;  5BRD A;  3VOV A;  4FJL A;  5AQF A;  1QHT A;  2P5O A;  1BU6 O;  4BVO A;  1HMV A;  3THW A;  4M3T A;  3CCM N;  4MFB A;  5E41 A;  4CJU A;  4KAZ A;  4CJ4 A;  1KTQ A;  1QVG M;  1GLB G;  4KH6 A;  4IOC L;  5GIP A;  3HK2 A;  1KAX A;  3NVM A;  2V51 B;  1GOC A;  3F73 A;  4F4K A;  4OKJ A;  3RSE A;  3NDK A;  4ISE A;  3VES A;  3TTC A;  5BPM A;  4BE0 A;  1HYV A;  3O9T A;  2ATQ A;  4B1X B;  3A5L C;  3MXM A;  3DYA A;  5KTQ A;  2A1R A;  2HMP A;  1JLF A;  4L8R B;  2F4V K;  3WXJ A;  1NBW A;  3VF2 A;  1KVA A;  2A41 A;  3CYM A;  4YHH K;  4JK7 A;  5C15 A;  2UUA K;  2ZJR L;  4FXD A;  4G9Z A;  4BR4 A;  2UYT A;  4CGG A;  3R1X A;  1SL2 A;  2F7T A;  1SKW A;  5C10 A;  4CEF A;  1NKE A;  4JYA K;  4A59 A;  3UKU B;  4EP4 A;  1K73 O;  1ATS A;  2A6A A;  2XY8 A;  2P9P A;  4UQG A;  5J2N A;  3LM2 A;  4AHS A;  2HW3 A;  3RTV A;  1X3N A;  4IG3 A;  3CJC A;  4YOR A;  3CCU N;  4O0I A;  4BG9 A;  1S1U A;  4KV8 A;  3ZT3 A;  1X9S A;  4CJ7 A;  4FJ9 A;  5BRH A;  4I6M A;  4CVN E;  4CJF A;  4HWI A;  3PV8 A;  2IAJ A;  1HNI A;  3CG7 A;  1NJY A;  4CZM A;  1GLA G;  3D2E A;  1F21 A;  1JL2 A;  5KRS A;  1L3T A;  3AVL A;  4GV3 A;  2HF3 A;  3LWM A;  3C6T A;  3KD1 E;  4A62 A;  4B9L A;  2XY6 A;  1P90 A;  4OX9 K;  4W5N A;  5KGW A;  3ULE A;  4CK3 A;  4B3T K;  1S6P A;  4FJJ A;  4HUE A;  2O8F A;  2O8E B;  1ASU A;  1BQN A;  2X74 A;  1N32 K;  2IDO A;  3NFA A;  3DOL A;  3WQU A;  4OGE A;  4FW2 A;  3P38 A;  4H4O A;  4G1Q A;  4JI7 K;  1TKT A;  3EEQ A;  3CJ1 A;  3OYL A;  4H0P A;  4DQR A;  3EL2 A;  4FM0 A;  4I9Q A;  4Z4E A;  4DR4 K;  3VER A;  4BAC A;  1RTI A;  5BN8 A;  2IS3 A;  3TAP A;  2BH1 A;  2CH5 A;  3ID8 A;  2HF4 A;  4YOW A;  1TV6 A;  4DTS A;  4LFC K;  4KH5 A;  3CME N;  3CET A;  3D45 A;  1WBD A;  4Z4H A;  3E1Y A;  1ZBL A;  1SS6 A;  1HX1 A;  3OS0 A;  5J2Q A;  1JLE A;  2QWL A;  1KFD A;  2GWK A;  5CYM A;  1VSD A;  4B1W B;  3J7A P;  1OKJ A;  2HHU A;  4CHO A;  5GAH P;  1FXX A;  4J8F A;  3LDQ A;  2W6L A;  1RDB A;  4CJ3 A;  1WBB A;  3CJ7 A;  3AVH A;  1HNW K;  2O8C B;  5HRO A;  2Z1J A;  2HHH K;  5AQY A;  4FWS A;  1XMO K;  1CZA N;  2D0B A;  2V52 B;  1M1K O;  4FK4 A;  1OH6 A;  2Q36 A;  2VG7 A;  5CYQ A;  1S72 N;  2YHW A;  4RW6 A;  3LP3 A;  3BF3 A;  3C7N B;  3KZB A;  4KHQ A;  4FPB A;  3VEO A;  3J81 O;  1ZXO A;  1TK0 A;  4ICL A;  3OS1 A;  1XI1 A;  3HPO A;  2P1J A;  2Z1I A;  3CJB A;  1NKC A;  1YT3 A;  4E0D A;  3MEG A;  4FLW A;  1L3V A;  2PFU A;  2BTF A;  3ZT1 A;  4JKF A;  1BCM A;  5FDL A;  1UWB A;  3A0I X;  3U3G A;  3G6E N;  2NZT A;  3OYE A;  1BOT O;  4JNE A;  3TAM A;  4F3T A;  2DFH A;  4WFN L;  3FLC O;  1SAZ A;  5LMU K;  5CR4 A;  1Q82 O;  5M1P A;  3SPZ A;  3AVJ A;  1L5U A;  3ZLJ A;  2OTJ N;  3T19 A;  2P51 A;  4IG0 A;  1HNX K;  3SQ2 A;  3R8E A;  1EX4 A;  1QHA A;  3L2W A;  2H3G X;  4WF9 L;  4GVM A;  1K8K B;  1U04 A;  5CZ2 A;  1NGI A;  3K5M A;  3MX5 A;  4JI1 K;  3HYF A;  1C0T A;  1IBK K;  3O3G A;  3NF9 A;  1LOT B;  1N5Y A;  3CFR A;  3S9H A;  3O5B A;  1KAZ A;  5H1S Q;  4XIU A;  1YF5 L;  4O0J A;  4BVP A;  4BRO A;  3F9K A;  3FZH A;  4CD3 A;  1EET A;  3QNO A;  1KRP A;  4I2P A;  3THV A;  1YAG A;  4FVU A;  4NLC A;  5IT9 O;  3A8Y A;  4B9N A;  4UY8 O;  4CJT A;  2E1Y A;  1HPM A;  3KK2 A;  3KHY A;  4X64 K;  5GIN A;  3OBW A;  4DUY K;  2EWS A;  2D5R A;  1XC9 A;  1VSF A;  4BG8 A;  4DTP A;  2E2O A;  2QXL A;  1YJW N;  4LSN A;  1YHQ N;  3EE8 A;  3LPU A;  1QSY A;  4CE9 A;  3D2F B;  2YX6 A;  3TAG A;  1WNS A;  3TAB A;  3K58 A;  4NXN K;  2IVP A;  2NUB A;  4JEP A;  2W42 A;  1T05 A;  3BGR A;  4AHR A;  1YIJ N;  4DUZ K;  2WOM A;  1JLC A;  4RW9 A;  2OA8 A;  3O9S A;  5F2R A;  2KQ2 A;  3OJU A;  4DR2 K;  5FPE A;  3RVC A;  3D7E O;  2Q0U A;  3RMD A;  1O1W A;  3CJA A;  1GOB A;  2J4R A;  3K5O A;  4YY3 K;  1VRT A;  2F8S A;  1VQL N;  4BRI A;  1R0A A;  4DB3 A;  4ZHR A;  2DFF A;  4FK2 A;  1GLJ O;  2RF2 A;  4BGB A;  3NGI A;  1K8A O;  3V6D A;  3RMA A;  4JS4 A;  1BCO A;  5AQM A;  4A5B A;  4O8U A;  2JWK A;  3LDN A;  3F9M A;  5AQG A;  3TAR A;  1T03 A;  4DR3 K;  4FLT A;  1EWR A;  5AQS A;  4CHN A;  2BUP A;  1L3S A;  1IO2 A;  5J2P A;  1RT2 A;  1LWF A;  2P9N B;  1QQN A;  2ITM A;  4NB4 A;  4CJE A;  4KHS A;  3BP8 A;  3NF7 A;  1YVN A;  2XO7 A;  3T1Y K;  4BQZ A;  4LF6 K;  1Q8I A;  4AF1 A;  2PBD A;  3D0P A;  3DRP A;  1TKX A;  2W40 A;  2D0C A;  4CFC A;  3K9K A;  1BA0 A;  5BPL A;  1RNH A;  4H5R A;  1KVC A;  3AGR A;  3KK3 A;  4NO7 A;  4CZG A;  4DV1 K;  4J2E A;  3DM2 A;  3TI0 A;  1CZ9 A;  2FBY A;  1R59 O;  5HRR A;  5AQU A;  5A2Q O;  3HPH A;  3HST B;  5AQK A;  5J2M A;  4JKG A;  5MLC Q;  3CPW M;  3RR8 A;  3C6A A;  3QEI A;  5GAG P;  3CD6 N;  4KB0 A;  1J5E K;  3VET A;  1L3U A;  3JS6 A;  1YXQ A;  1LAW A;  5GIO A;  3VGL A;  4DR5 K;  4AHU A;  1Y97 A;  4JKH A;  2G8H A;  3JYT A;  4LSL A;  4O8K A;  5AQH A;  3O8M A;  2V7Z A;  2BE2 A;  3THY A;  3VQ6 A;  2E2N A;  1EP4 A;  4DKW A;  4QS8 A;  4K41 A;  4IJN A;  3IMX A;  5CZ1 A;  4EHU A;  3OYH A;  3VEN A;  2YNI A;  1XNQ K;  2P9L B;  3DJC A;  1VQ8 N;  4FJM A;  4FJ7 A;  3JXU A;  3ZSR A;  3VPZ A;  3ZSX A;  2R7Y A;  5FRN A;  1IBL K;  2QKK A;  3WNE A;  4DWI A;  4CGI A;  3AVK A;  3C0B A;  4XEI A;  4DSE A;  3AGK A;  1RT3 A;  2E20 A;  5JS2 A;  1FJG K;  3ULD A;  1ZYQ A;  1C1B A;  2YNF A;  3WT0 A;  4F2R A;  4CJL A;  4DTU A;  4C1N K;  2YJF A;  2RN2 A;  3SUO A;  4RW7 A;  2KW4 A;  4I2Q A;  4DFM A;  1ATR A;  4BRN A;  4BRG A;  3MN7 A;  2HBM A;  4QS9 A;  3H08 A;  1XNR K;  1OVQ A;  4JKB A;  4JRQ A;  3R9P A;  4E7L A;  4FOI A;  3S3N A;  3TU5 A;  4OJR A;  3SZ2 A;  1J9A A;  1XHX A;  1VQ6 N;  5HRN A;  2JWL A;  3AV9 A;  4IOA L;  2VG6 A;  2W41 A;  2GUP A;  3HBT A;  3LP1 A;  4HUG A;  3E9O A;  3I56 N;  3ZX0 A;  1SKR A;  4N76 A;  2X6N A;  3AVN A;  3HP6 A;  2GWJ A;  4M45 A;  2YV0 X;  4O4G A;  4KI6 A;  1RBT A;  3THW B;  1QZ5 A;  1XWL A;  2VYP A;  3M1F A;  4N5S A;  1JCF A;  1XHZ A;  3NF6 A;  1X9M A;  3KVG A;  1V4T A;  1SL1 A;  2G8W A;  3MXJ A;  3FFI A;  3MWT A;  3V9W A;  3HL8 A;  1VQP N;  2NRZ A;  2P9L A;  3LAL A;  3TSU A;  4FW1 A;  5D3G A;  2OCE A;  4B9S A;  4K42 A;  5F0X A;  4OPJ A;  1SL0 A;  1MWK A;  3L3V A;  4K0K K;  1ZBU A;  4RCH A;  1I3A A;  1RTJ A;  4DFP A;  1U48 A;  4KTQ A;  3GDQ A;  3QDK A;  4I9L A;  3M8P A;  4FYD A;  2B6A A;  4KKO A;  2QK9 A;  2ZE2 A;  2E2Q A;  3AA4 A;  4BRM A;  1B9F A;  2GTD A;  3H6E A;  3UE5 A;  3WEE A;  1U2V A;  3V9U A;  1BDG A;  4PKI A;  2D0A A;  1D9F A;  4CBX A;  1JLA A;  2IVN A;  2QWM A;  3DLK A;  4CFB A;  1HYZ A;  4MLE A;  2QWQ A;  2GBZ A;  5F1X A;  3S3O A;  2PYL A;  4FLZ A;  3VQ7 A;  3OYI A;  3B6P A;  4FM2 A;  2CH6 A;  5BRF A;  3AAP A;  1YJN N;  3QIP A;  3ID6 A;  3D2E B;  3HOS A;  4KI4 A;  4ID5 A;  5BN9 A;  4CZE A;  4CGJ A;  1I39 A;  4BR5 A;  5HLF A;  3OTO K;  1LW0 A;  1TYQ B;  1N33 K;  3THX B;  2YI1 A;  2KHO A;  1REV A;  4JHD A;  3G25 A;  2DTU A;  2WTU A;  2V7Y A;  3AO2 A;  1KQS M;  1U49 A;  4EP5 A;  1Z25 A;  1NGC A;  3KLG A;  3PX4 A;  4B9U A;  3MWP A;  5AQW A;  4GKJ K;  3N4Q A;  4CED A;  3KKS A;  5LJW A;  4KPY A;  4IXC A;  3OYB A;  3NH2 A;  1MA9 B;  1BUP A;  1A5X A;  4DU1 A;  2KZM A;  4H5V A;  1SUQ A;  2IIR A;  2IVO A; 
#chains in the Genus database with same CATH homology
 3CIP A;  4PKH A;  2A5X A;  4KH5 A;  3CME N;  2FF6 A;  2P9K B;  3L6Q A;  1JCE A;  3KK7 A;  3CET A;  3P4I A;  4ILG B;  2ZJP L;  2ASM A;  4IDH A;  5LJV A;  3E1Y A;  3LDP A;  3EO3 A;  4IJA A;  1SS6 A;  3VEV A;  1HX1 A;  1O13 A;  2NRW A;  5AQJ A;  2OTL N;  3H1Q A;  4EIA A;  2QWL A;  2GWK A;  4Y0W A;  4B1W B;  3F2K A;  3U4L A;  1OKJ A;  4YOU A;  5GAH P;  4J8F A;  3Q7B A;  3LDQ A;  3TSQ A;  3CJ7 A;  3W3D A;  1GLE G;  4E1J A;  3VGM A;  3QML A;  3H1V X;  3GL1 A;  1X9J A;  1YIT N;  3DWL A;  4BC2 A;  5KPZ A;  1YJ9 N;  4MLH A;  3ENO A;  1W97 L;  5E26 A;  4FWS A;  2D4W A;  5AQY A;  5JLF A;  2D0P A;  5C2F A;  1CZA N;  4YOT A;  1NGD A;  3TTD A;  1TYQ A;  2V52 B;  1M1K O;  3SAG A;  4H5T A;  2Q36 A;  4M63 C;  3QFU A;  2YHW A;  3HTV A;  1S72 N;  3O6W A;  3CCV N;  3E66 A;  2ZF5 O;  2OAN A;  3BF3 A;  3C7N B;  3KZB A;  4BR0 A;  3PLA A;  1IJJ A;  4JKG B;  4FPB A;  3AAR A;  3VEO A;  3IUC A;  4BC4 A;  2PAV A;  1ZXO A;  4BRK A;  3O9U A;  4B1U B;  4FWR A;  5AFU A;  4BC3 A;  3ATU A;  3N4P A;  3R6M A;  4MDA A;  3OHR A;  4WFA L;  5B8H A;  3CJB A;  5CE3 A;  4H0V B;  3VMF B;  3ZEU A;  4FWN A;  1RFQ A;  2PFU A;  2BTF A;  4JKF A;  1D4X A;  3G71 N;  2P9U A;  2KKZ A;  2NRX A;  4CBU A;  3A0I X;  3IKM A;  2Q97 A;  5ELZ A;  2YJE A;  3G6E N;  3CPE A;  2NZT A;  5GAD P;  2GEL A;  1K9M O;  1BOT O;  4JNE A;  4WFN L;  3FLC O;  5TKY A;  4LC9 B;  1SAZ A;  3ZET B;  3DXM B;  4I6M B;  5CR4 A;  4C1N I;  2CGJ A;  1Q82 O;  5M1P A;  5AZJ B;  2HBL A;  3U9Z A;  2A42 A;  1P8Z A;  3FE1 A;  4H0T B;  2QW9 A;  3EKU A;  3FZM A;  3CC2 N;  1DT9 A;  2F9W A;  1SZ2 A;  2OTJ N;  3AAQ A;  4A5A A;  1NGH A;  1WUA A;  1U2V B;  1W2B M;  4DHY A;  2ZJQ L;  3R8E A;  5CHI A;  1QHA A;  4JN4 A;  3PIP L;  5FPN A;  2H3G X;  4WF9 L;  4YOW A;  1K8K B;  4BRH A;  1NGI A;  2E88 A;  2FXU A;  3MX5 A;  1YI2 N;  2WFB A;  4FO0 A;  1VQ7 N;  2YHY A;  4FPA A;  3QFP A;  1VQ9 N;  1NMD A;  4JHD B;  3L4Q A;  4IEE A;  4QS7 A;  5AZI A;  1LOT B;  3UKR A;  1HLU A;  3CCL N;  3O5B A;  1KAZ A;  5H1S Q;  4JKC A;  4WQ5 A;  2P9S A;  1U6Z A;  4KBO A;  2WUS A;  4M7Y A;  2QWR A;  3T7Z A;  1YF5 L;  5ADX A;  4BVP A;  4BRO A;  4CZJ A;  3FZH A;  4FWQ A;  4CD3 A;  1Z6R A;  1NM1 A;  2QWP A;  4BRQ A;  4MDB A;  1T6C A;  3ENH A;  5DM7 L;  1NWK A;  4BRC A;  3T69 A;  2ZGZ A;  3F5T A;  4OO1 J;  4A61 A;  5AQX A;  4FVU A;  1YAG A;  5JIC A;  4NLC A;  5AQV A;  1Q7Y O;  4OPH A;  2HBK A;  3AY9 A;  1BWF O;  3A8Y A;  3MK6 A;  4FWK A;  4UY8 O;  4JD2 A;  2E1Y A;  5AZI B;  1HPM A;  3KHY A;  3O9R A;  5GIN A;  3OBW A;  4CD1 A;  2P9S B;  3FZF A;  1MWM A;  1LCU A;  2EWS A;  4BR7 A;  1VQ4 N;  3C7N A;  4BG8 A;  4Z94 A;  2E2O A;  2QXL A;  5EXW A;  1YJW N;  3OBY A;  4IOX A;  4XH1 A;  4L3Q A;  5M1N A;  3ZYY X;  1YHQ N;  3EE8 A;  4RWT A;  4GVE A;  4BGA A;  2VCP A;  2I7N A;  4K43 A;  4NLB A;  4CZF A;  1HJO A;  3D2F B;  2YX6 A;  1E4F T;  3VGK A;  2IVP A;  2ASO A;  4JEP A;  2GX9 A;  2DPN A;  3A5N C;  4BRF A;  5ADX H;  5JMV A;  5BPN A;  1NGF A;  1H1V A;  3ULE B;  4EFH A;  1YIJ N;  2RHK A;  3MN5 A;  5KPR A;  3CC7 N;  3IDH A;  4BC5 A;  3LL3 A;  2QEX N;  2Q1N A;  1ESV A;  3QB0 A;  5AQZ A;  3O9S A;  4ILH A;  5F2R A;  5KQ8 A;  5EX5 A;  2D1K A;  3CI5 A;  3S41 A;  3HRG A;  5JVH L;  2NRH A;  4YOY A;  2QA4 N;  3EN9 A;  4IZ9 A;  3LDL A;  3GE1 A;  5AQP A;  2FLO A;  5FPE A;  3RVC A;  4FSV A;  3D7E O;  2Q0U A;  1EQY A;  3CJA A;  4H5N A;  2NRT A;  2J4R A;  4CI6 A;  1XC3 A;  3QIC A;  5M1F A;  1QZ6 A;  3QBW A;  3U9D A;  1VQL N;  4BRI A;  5AZJ A;  4JK9 A;  5AR0 A;  4DB3 A;  2Q31 A;  4YOX A;  2P9U B;  3CMA N;  1NLV A;  4BRE A;  1HUX A;  4WYB A;  1GLJ O;  4BRA A;  4BGB A;  1K8A O;  2HBJ A;  1T44 A;  4OPA A;  5AQM A;  4WCE L;  3J8A A;  4A5B A;  3DXM A;  3O80 A;  4O8U A;  5TKW A;  2JWK A;  4GV9 A;  3LDN A;  3F9M A;  3LDO A;  5AQG A;  4AM6 A;  1NGJ A;  3OA9 A;  4YDU C;  4H0O A;  1NGB A;  1BO5 O;  3IFR A;  3PIO L;  5FPD A;  5AQS A;  3HZ6 A;  3H46 O;  3VTI A;  3MMV A;  1S3X A;  1M90 O;  2BUP A;  3UKR B;  5JLH A;  5FPM A;  2I7P A;  3SK3 A;  3WQT A;  5AQN A;  2P9I B;  3SBG A;  4FWO A;  1C0G A;  1IG8 A;  2P9N B;  2D0O A;  1QQN A;  5E84 A;  1S22 A;  3KWI A;  4KH4 A;  2ASP A;  5AQL A;  3WEE B;  2ITM A;  4NB4 A;  3BP8 A;  3WXM B;  1YVN A;  4IFE A;  3DAW A;  5C12 A;  4B1V A;  2NRR A;  2ZWH A;  3H3N O;  4BQZ A;  2YCH A;  4AF1 A;  2PBD A;  4DQ8 A;  4M7X A;  1HKG A;  3CQY A;  2W40 A;  1K8K A;  1T6D A;  5I9E B;  2VWB A;  3K9K A;  5AQQ A;  5GAE P;  1JJ2 M;  3FFK B;  1C0F A;  2E2P A;  1BA0 A;  1VAZ A;  5BPL A;  4FWP A;  4DCH A;  4H5R A;  4EAH D;  3AGR A;  3HI0 A;  4NO7 A;  4JKE A;  5HL7 L;  1DGK N;  4ISG A;  4CZG A;  1G99 A;  2FSJ A;  1GLL O;  5HOO A;  3J7Z O;  1Q18 A;  3Q7C A;  3P31 A;  3TPQ A;  1R59 O;  1VQO N;  2E1Z A;  5AQU A;  5AQK A;  3KWG A;  4JKG A;  5MLC Q;  3CPW M;  3C6A A;  3BEX A;  1QVF M;  5GAG P;  3CD6 N;  1RDW X;  3CJ9 A;  4AM7 A;  4WFB L;  3UKU A;  3VET A;  3JS6 A;  1YXQ A;  5GIO A;  1XUP O;  3VEY A;  3VGL A;  4B9Q A;  1VQN N;  2NRV A;  4JKH A;  2FSK A;  3L4I A;  4MO5 A;  1V4S A;  3ATV A;  3WUH A;  4O8K A;  4C23 A;  5M1K A;  1NJI O;  5AQH A;  3O8M A;  2FF3 B;  2P9K A;  2V7Z A;  5KPT A;  2E2N A;  2Q2R A;  3H3O B;  4DKW A;  3M3Z A;  4JKA A;  3LM9 A;  1NGE A;  3B8A X;  4ISF A;  4K41 A;  4QS8 A;  4B1Z A;  2P9I A;  4IJN A;  3BUZ B;  4GNI A;  3HOT A;  3SMS A;  3IMX A;  4CZH A;  3O1B A;  4EHU A;  4CZK A;  2F9T A;  5AQT A;  2YHX A;  5DM6 L;  3ZX3 A;  3VEN A;  3CC4 N;  3MDQ A;  3NVK A;  2P9L B;  3EKS A;  2QI2 A;  1TUY A;  3DJC A;  1VQ8 N;  3JXU A;  3WXL A;  4CZL A;  3VPZ A;  3DXK A;  1BA1 A;  1GLC G;  3H45 C;  3O9Q A;  3ZX2 A;  3G4S N;  5BR9 A;  4BRD A;  1J6Z A;  2E8A A;  3CER A;  4IO8 A;  1KXP A;  3SMP A;  3WXK A;  3C0B A;  2Q0R A;  3MN6 A;  4XEI A;  1VQM N;  2AP1 A;  2VGN A;  4BRP A;  1Q86 O;  3AGK A;  3I8B A;  1GLD G;  2E20 A;  1BG3 A;  2NNW A;  2VGM A;  4CZI A;  4A2A A;  3CCS N;  4YDU A;  3EE9 A;  5EVZ A;  3O1W A;  5AFU H;  3MCP A;  3VEX A;  3WT0 A;  2AA4 A;  4HTL A;  4C1N K;  3A5M C;  2YJF A;  4CBW A;  3EZW A;  3GG4 A;  5M1Q A;  2GEM A;  4PHT X;  4H0X B;  4A2B A;  4U67 L;  3WXI A;  4PL8 A;  1ATR A;  1N8R O;  1VQK N;  4BRN A;  4BRG A;  4PL7 A;  3MN7 A;  2RE2 A;  2HBM A;  3HM8 A;  4QS9 A;  4BR9 A;  4BY9 C;  2P9P B;  4JKB A;  3NMU A;  3R9P A;  3E9L A;  4FOI A;  1KAY A;  1X3M A;  3VEZ A;  1ZBS A;  3TU5 A;  3TSP A;  4H0Y B;  4YOV A;  3CCQ N;  1VQ5 N;  3VF6 A;  3ZEU B;  3FGU A;  3SAF A;  3CF5 L;  2CGK A;  1HKC A;  5AQR A;  3VTH A;  4O5F A;  1NGA A;  1OVY A;  1VQ6 N;  5M1O A;  2JWL A;  3O4W A;  1HKB A;  4JAX A;  3FR0 A;  4IOA L;  3GOI A;  4JD2 B;  3SAH A;  5BRD A;  3VOV A;  5AQF A;  3HSC A;  2W41 A;  3M5R A;  2GUP A;  3HBT A;  1ATN A;  4XH5 A;  4WQ4 C;  1BU6 O;  3E9O A;  4BVO A;  3FZK A;  5JVG L;  3MN9 A;  3I56 N;  3ZX0 A;  4R79 A;  3CCM N;  3CCE N;  1RDU A;  2GWJ A;  1E4G T;  1QVG M;  2WBN A;  3CXC M;  1GLB G;  4KH6 A;  5LY3 A;  5C2D A;  4IOC L;  1GLF O;  1QZ5 A;  2VYP A;  3ZET A;  1NGG A;  3M1F A;  2FSN A;  5GIP A;  1KAX A;  3NVM A;  1JCF A;  2V51 B;  4U7B A;  3D6R A;  3RSE A;  3KVG A;  1V4T A;  4ISE A;  4ILJ A;  4FWM A;  3DXK B;  3TTC A;  3VES A;  5BPM A;  3MWT A;  2HST A;  3UB5 A;  5EY4 A;  4FL9 A;  1VQP N;  3O9T A;  3CCR N;  1Z05 A;  2NRZ A;  4H03 B;  4GV6 A;  1WOQ A;  4B1X B;  2NLX A;  2P9L A;  3A5L C;  1KC8 O;  3TSU A;  3OW2 M;  3CCJ N;  3K9J A;  4B1Y B;  2HMP A;  4BQL A;  1EO1 A;  3O08 A;  4K42 A;  3WXJ A;  5F0X A;  1NBW A;  3VF2 A;  3W0L A;  4BR2 A;  2A41 A;  5BRE A;  1MWK A;  1ILY A;  4JK7 A;  5C15 A;  2ZJR L;  4EHT A;  4PKG A;  4RCH A;  2QM1 A;  3VEW A;  1QQM A;  1YUW A;  1Y64 A;  3GDQ A;  3QDK A;  3R3L A;  3TTF A;  2UYT A;  4BR4 A;  3R1X A;  4G9Z A;  2F7T A;  4WQ5 C;  3MX2 A;  4IWV A;  5C10 A;  3I55 N;  2WC9 A;  4A59 A;  2E2Q A;  4MO4 A;  3UKU B;  4H5W A;  3CHW A;  1K73 O;  4A57 A;  2HOE A;  4JK8 A;  4BRM A;  1ATS A;  2A6A A;  1DKG D;  2P9P A;  2GTD A;  3UE5 A;  3H6E A;  3WEE A;  4F9O A;  1U2V A;  1BDG A;  4PKI A;  2P9N A;  4RTF D;  5AQO A;  1Q81 O;  3LM2 A;  5C0Y A;  3L0Q A;  4WQ4 A;  1X3N A;  4YOR A;  3CJC A;  4CBX A;  3VF4 A;  3CCU N;  4JKD A;  4BG9 A;  1DEJ A;  4FOE A;  2IVN A;  3DLL L;  2QTD A;  2QWM A;  3GBT A;  4MLE A;  2QWQ A;  2QWN A;  4CJ7 A;  5BRH A;  4I6M A;  4FWL A;  4HWI A;  1RGI A;  5F1X A;  5AQI A;  4IO9 L;  1KD1 O;  3U8X A;  3CQX A;  4CZM A;  1GLA G;  3D2E A;  3SBT A;  2KLA A;  4XH4 A;  3C65 A;  1T3V A;  2CH6 A;  3AAP A;  5BRF A;  1TUU A;  1YJN N;  3SJH A;  4GV3 A;  3ID6 A;  2HF3 A;  3A5O C;  3D2E B;  3HOS A;  2A3Z A;  5BN9 A;  4A62 A;  4CZE A;  4BR5 A;  1P90 A;  2QWO A;  1MDU B;  3E9P A;  3ENB A;  1TYQ B;  3ULE A;  4IEI A;  2YI1 A;  3BF1 A;  2KHO A;  1SQK A;  4JHD A;  3G25 A;  5EOY A;  2A40 A;  2V7Y A;  3D2F A;  4K25 A;  2CGL A;  3WQU A;  1KQS M;  1JCG A;  3I33 A;  3QBX A;  3P38 A;  4GY2 B;  3M6G A;  2ZGY A;  3MCA B;  1NGC A;  3P39 A;  5KQD A;  3CJ1 A;  3MWP A;  4H0P A;  1ZC6 A;  5AQW A;  3EL2 A;  3N4Q A;  1QQO A;  3SLC A;  5LJW A;  4IXC A;  4BRL A;  3C6H A;  3VER A;  1MA9 B;  1BUP A;  3RSE B;  5BN8 A;  4H5V A;  3FZL A;  2IIR A;  1XQS C;  2BH1 A;  2CH5 A;  3ID8 A;  2HF4 A;  2IVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...