2F9WA

Structure of the type iii coaa from pseudomonas aeruginosa
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
249
structure length
249
Chain Sequence
SMILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQALPVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWLALVAAHHLAKKACLVIDLGTAVTSDLVAADGVHLGGYICPGMTLMRSQLRTHTRRIRYDDAEARRALASLQPGQATAEAVERGCLLMLRGFVREQYAMACELLGPDCEIFLTGGDAELVRDELAGARIMPDLVFVGLALACPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pantothenate Kinase
publication title Prokaryotic Type II and Type III Pantothenate Kinases: The Same Monomer Fold Creates Dimers with Distinct Catalytic Properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 70
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2f9wA02
3RSEB 3C0BA 2VYPA 5KPTA 5BN9A 3EKSA 3H3OB 3S41A 3A0IX 2FF6A 4M7XA 2QWOA 2A3ZA 2AA4A 3VETA 4K41A 2E2PA 2QXLA 4BC2A 1LCUA 3J8AA 3L6QA 3WQTA 4CBWA 3UB5A 4BC4A 1KXPA 5AR0A 4RWTA 1NLVA 2ZWHA 3A8YA 3D2FB 3GL1A 4RCHA 2FXUA 4MO4A 1WUAA 4A61A 5AQOA 1GLFO 5AQHA 3VF6A 2Q36A 3VEVA 4EHUA 3MN5A 1GLAG 1S22A 4BRCA 4NO7A 1DGKN 2GWKA 2CGKA 1BG3A 4DB3A 1U2VA 3ULEA 1MWKA 2E1YA 3FFKB 2HF3A 4K43A 4HTLA 4MO5A 2UYTA 4BVPA 1XUPO 2CGJA 3R6MA 4FWLA 2ZF5O 3FR0A 3KVGA 3HZ6A 3F9MA 3BF1A 3H1VX 5AQZA 2YCHA 3CERA 3WT0A 3AY9A 3LDQA 1NGFA 5AQKA 3H45C 1X3NA 2Q31A 5BR9A 5F2RA 3W3DA 3VGLA 3VERA 2W40A 3HSCA 2D0OA 5AZJA 4BR4A 2H3GX 4FWKA 4F9OA 1XQSC 3O80A 4Y0WA 3WXIA 3ENHA 3L4IA 4H0OA 1NBWA 4K25A 2D4WA 4BREA 3MN9A 5B8HA 3U9ZA 1DEJA 1ZC6A 2NLXA 4H5TA 2IIRA 2NZTA 3O1WA 1JCEA 2P9KA 3VEWA 1NGCA 4M7YA 4PL8A 2F9TA 5BPMA 3ID8A 1C0FA 2E1ZA 2P9PA 4IJNA 2ITMA 1Y64A 2P9IB 2BTFA 3R8EA 1BA1A 2QWMA 1HPMA 4JD2A 3GDQA 4CZFA 5AQNA 3WEEA 4B1ZA 2YI1A 3VEOA 4XEIA 2GUPA 2E2NA 4FWRA 2YHXA 3QB0A 2ASOA 4DCHA 1Z6RA 4KBOA 1CZAN 1GLBG 1SZ2A 1HX1A 3BUZB 3H6EA 3MN6A 1LOTB 3CI5A 1KAYA 5F0XA 3HI0A 3EN9A 4H5WA 3A5OC 5ADXA 3LDOA 4BRPA 3WXKA 4JHDA 1NGBA 1TUYA 3LM9A 4H0VB 4H0XB 3C7NA 3CJAA 4BRAA 3O5BA 1RGIA 1U2VB 4H5NA 3H3NO 2E20A 3FZKA 2CH6A 3CJCA 3I33A 2Q0UA 3HBTA 4I6MA 4L3QA 5AQWA 4BRIA 5AZIA 1SQKA 5EXWA 2GTDA 5AFUH 5BPNA 2E88A 4NB4A 3ZX3A 3LDPA 4CI6A 1JCGA 3OHRA 5AQQA 4JNEA 4BROA 3SJHA 2IVNA 4HWIA 3VESA 4BR7A 4DQ8A 3O1BA 4H0PA 5AZJB 4BR0A 3UE5A 4C23A 1RFQA 2E2QA 4FOEA 4BC5A 4FOIA 3O6WA 3DWLA 4FWQA 5JICA 2ZGZA 3I8BA 3WQUA 3A5NC 3UKUA 4BRKA 2QWRA 4BGBA 3DXMA 4H5VA 1HKBA 2P9KB 4H0TB 3D2EB 1KAXA 3IMXA 3WXJA 3VEYA 3IFRA 3M1FA 5AQLA 2P9PB 3EZWA 1YUWA 5FPDA 3QBXA 3MMVA 2P9SA 2P9LA 4IZ9A 1V4SA 3FZMA 3HM8A 4B1UB 4QS8A 4XH5A 5AQVA 3VPZA 3D7EO 2V51B 2KHOA 1Q18A 1GLJO 3A5LC 1BA0A 5ELZA 1U6ZA 1V4TA 2Q0RA 4EAHD 1GLEG 2I7NA 1BU6O 1MWMA 3UKRB 4CZIA 3WUHA 5AQXA 1NGEA 3ZX0A 1TUUA 3FGUA 1T6DA 4LC9B 2HF4A 3R9PA 4BVOA 1NGHA 2GWJA 1NM1A 3SK3A 5KQ8A 1ATNA 2I7PA 4FWOA 4JHDB 1SAZA 2A5XA 3GG4A 2P9NB 3C7NB 5AQJA 5EVZA 5AQYA 3FE1A 3CHWA 1J6ZA 2ASMA 2PAVA 2Q1NA 5FPMA 2D0PA 3SMPA 3CQYA 4EFHA 4FSVA 3LM2A 2A6AA 4E1JA 5AQUA 3G25A 2FSJA 4CD1A 2CH5A 4BRHA 5AZIB 3ZEUA 3AARA 2QWLA 3FLCO 3RSEA 2VWBA 1NWKA 3QMLA 3A5MC 4CBXA 3TPQA 1X9JA 1GLDG 2A41A 5EX5A 3M6GA 4XH1A 3VEXA 4A2AA 1HKGA 4AM7A 5FPNA 3O4WA 2Q97A 3QFPA 3DXKA 4BQZA 5EY4A 2V7ZA 3LDLA 4PKHA 1NGAA 4WQ5A 3EO3A 3JXUA 3BEXA 3UKUB 4B1YB 3DXMB 4CZLA 4B1WB 3P4IA 3CETA 5LJWA 4GNIA 3TU5A 1E4GT 4IXCA 3QFUA 1QQOA 1NGGA 3VEZA 1H1VA 4IO8A 3O8MA 4BRLA 4BC3A 3VF2A 5LY3A 5I9EB 3SLCA 4BRQA 3ULEB 4Z94A 2P9LB 3IDHA 4K42A 3FZLA 4H5RA 4A62A 1YXQA 4BRGA 4CJ7A 1MA9B 1T6CA 3VGMA 4YDUA 2VCPA 3LL3A 1S3XA 2A42A 5AFUA 4FPBA 4ISFA 4IWVA 4BR2A 4BRFA 5AQMA 3VENA 3FZFA 2FF3B 4FO0A 1MDUB 3CQXA 3DJCA 1GLCG 2P9UA 3DAWA 4BRMA 1IG8A 5AQFA 4BRNA 1ATRA 5AQRA 2YJFA 3MCPA 1KAZA 5JMVA 2J4RA 4B1XB 1EQYA 1DKGD 4BG8A 4EIAA 4BRDA 4PKIA 3EKUA 2BUPA 1HLUA 2QM1A 3GOIA 4FWMA 4ISGA 3VOVA 3ZEUB 5E26A 4CD3A 1G99A 3VGKA 3U4LA 3KZBA 4PL7A 4BGAA 1E4FT 2YHYA 3EL2A 5AQTA 5LJVA 4CBUA 1X3MA 4MLEA 1Z05A 4JD2B 1YAGA 2NRHA 1HJOA 1K8KA 3WEEB 4EHTA 4H03B 5KPZA 3M3ZA 5AQIA 2Q2RA 3KHYA 2IVPA 1TYQA 3ZETA 3U8XA 2D1KA 3DXKB 3CJ9A 5BREA 3MDQA 4FWPA 3AAPA 4CZMA 3SMSA 3O08A 1WOQA 3VF4A 4H0YB 4B9QA 2HMPA 2FSKA 2ZGYA 3CIPA 3MN7A 3GBTA 3H1QA 5KPRA 4WQ5C 4M63C 2E2OA 3QDKA 1QQNA 1RDWX 5F1XA 3ATVA 5BRDA 3BP8A 1NMDA 2PBDA 5JLFA 1JCFA 2GEMA 4CZKA 1OKJA 1QZ5A 4I6MB 2YJEA 1D4XA 1HKCA 2IVOA 1XC3A 3ENOA 4CZEA 2OANA 2QWQA 5BPLA 1QQMA 5CE3A 4CZJA 1IJJA 3WXLA 2V52B 4YDUC 2FLOA 5KQDA 2AP1A 5EOYA 4ISEA 3QICA 4DHYA 4WQ4C 4RTFD 3B8AX 3JS6A 3AAQA 2P9UB 5BRFA 5AQGA 3D2FA 4QS9A 1ATSA 3D2EA 3HTVA 4PKGA 4J8FA 4CZHA 1QZ6A 4O5FA 3CJBA 3GE1A 4B1VA 4BR9A 1NGIA 4O8KA 1R59O 1GLLO 1ESVA 1BDGA 3QBWA 1C0GA 4FWSA 2A40A 3ATUA 4BG9A 4BQLA 4AM6A 4MLHA 1BWFO 2P9SB 1BUPA 1P8ZA 2QWNA 1K8KB 1YVNA 3UKRA 4XH4A 1TYQB 2QW9A 4IJAA 3ZETB 5ADXH 3U9DA 2F9WA 3L0QA 4FL9A 4WYBA 5TKYA 3W0LA 4WQ4A 4A2BA 3LDNA 1ZBSA 4QS7A 1ZXOA 2P9NA 5BRHA 3MK6A 4FWNA 2V7YA 5E84A 3CJ1A 3IUCA 5AQSA 4JN4A 2E8AA 3FZHA 1HUXA 4FPAA 1QHAA 4CZGA 2W41A 1NGJA 1T44A 4BR5A 1BOTO 4GY2B 4JAXA 3ZX2A 5JLHA 1NGDA 3H46O 2HOEA 2GELA 2DPNA 2P9IA 5AQPA 3CJ7A 2ASPA 3BF3A 2FSNA 2CGLA 1BO5O 5BN8A 2EWSA 5FPEA 2QWPA 2WUSA 2YHWA
chains in the Genus database with same CATH superfamily
3NDKA 3S41A 3SYZA 3VETA 4K41A 2QXLA 4BC2A 3L2QA 3TABA 2B6AA 3LZJA 3SPZA 4IBNA 2DFEA 1T7PA 3V1OA 2UXDK 3D2FB 2ZJQL 2OA8A 4YOYA 5GAGP 1DGKN 4J2DA 3OYMA 5GIOA 1MWKA 3QETA 2E1YA 4K43A 2RHKA 4BVPA 4FW2A 4FWLA 1RCHA 2O8FB 4XIUA 1S1UA 3FR0A 3R3LA 3KVGA 1EKEA 4OKEA 4F3TA 1XNQK 4DTRA 1FJGK 3OYCA 4KPYA 3W3DA 3SQ4A 2WTUA 2W40A 3CD6N 3QIPA 3K2PA 3HPHA 5AZJA 4FWKA 4F9OA 1VSIA 3VQ5A 4Y0WA 4ELUA 1EXQA 4H0OA 3TTFA 3BGRA 2HHSA 4CJLA 4ZTJA 5CZ1A 3RRHA 2HVHA 4PL8A 1WBBA 3CMEN 4E1NA 3M8QA 3V9WA 2NRRA 3PX6A 3R8EA 3RTVA 4IG0A 1I3AA 1JLAA 3AVIA 4QCLA 2QWMA 3OYKA 5K14A 3LAKA 4FM2A 4IDKA 3P39A 2GUPA 2E2NA 1NK0A 2YHXA 4DCHA 4Z4CA 1CZAN 2VG7A 5M1OA 3S3MA 4PHTX 4OJRA 1LOTB 4OGEA 3AVHA 3L2VA 3A5OC 3WNGA 3RRGA 1OH8A 3WXKA 4NCAA 1U4BA 1U2VB 2GV9A 3FZKA 1HQEA 3AGRA 5BR8K 1LW2A 1NK4A 2ITGA 3CJCA 4BWMA 3HBTA 4I6MA 4E7IA 4CW7B 1VQ7N 1B92A 4BRIA 5AZIA 1SQKA 4EP4A 3LWMA 1L3UA 2GTDA 4FLWA 3IAYA 2KQ2A 4NB4A 3CCQN 3ENBA 1VQNN 1JCGA 3OHRA 3M8RA 3KJVA 1SKWA 2IVNA 4HWIA 3CCSN 5C0YA 3THWA 4B8AB 3I8DA 5HRNA 4YOUA 3OBYA 4BR0A 4CEEA 4CHZA 4JI5K 4DTXA 4IFYA 4BC5A 3QNNA 4C8LA 3ALYA 3M5RA 3M8PA 5A2QO 4KI6A 5JICA 3K5NA 3ISNC 3WQUA 3A5NC 3UKUA 2QWRA 3DXMA 4FZYA 4H0TB 1YHQN 3L3VA 2VWKA 3D2EB 3TWHA 5EU7A 3NF6A 4LFBK 3IFRA 2YKNA 5AQLA 2P9PB 2RPIA 1YUWA 4AHSA 3QBXA 4YNQA 3TAGA 5JVHL 2OYQA 3DMJA 3FZMA 3VTIA 2IGIA 4B1UB 5AQVA 3VPZA 4JKGB 4E19A 2E6MA 5C24A 3HM9A 5ELZA 4EAHD 1LWFA 1BU6O 1EETA 3WNHA 4FLVA 4ILJA 3ZX0A 3FGUA 4BVOA 2QXFA 3R9PA 2GWJA 3V9ZA 3PSFA 4FWOA 4JHDB 4CJTA 3GG4A 1WSFA 3VQBA 4DSLA 4JI0K 1JLQA 3K5MA 4BE2A 3K5OA 2PAVA 1OH7A 4FJMA 3SMPA 4DTNA 3CQYA 1GOAA 2Z1JA 3TSUA 1RBRA 3VQDA 4FSVA 1RDBA 3BDPA 1JL1A 1VQ4N 4FZZA 1K73O 3WNEA 1NKBA 4DSJA 3SQ0A 4BRHA 4CEAA 4LFAK 3FLCO 2VWBA 3AO1A 4CBXA 2VG5A 1ZBLA 1GLDG 5EX5A 3M6GA 1U45A 4DLGA 2BH1A 4XH1A 3VEXA 4A2AA 1HKGA 5FPNA 3C65A 2F7TA 3HT3A 4WE1A 1K6YA 4BQZA 3CC4N 1VQ8N 3EYZA 4DFJA 3TTDA 1JLBA 4W5QA 3AV9A 3VQQA 3BEXA 4B1YB 1VSDA 3AVMA 4CZLA 5LJWA 3AO4A 4IXCA 3OVNA 1H1VA 4IO8A 2HHUA 3E1YA 3J80O 3O8MA 1YI2N 3KLEA 3ZLJA 2VG6A 3VQ9A 4CF8A 5LY3A 4MFBA 5I9EB 3SLCA 4Z4IA 4HUGA 2P9LB 4K42A 4A62A 3FZLA 4CJFA 2NRVA 3NVKA 1FKOA 1QSLA 1YXQA 1HR0K 4CJ7A 1T6CA 3VGMA 4CJKA 3VQ4A 4KAZA 3ZSVA 4OGCA 1Q9YA 4KFBA 4FPBA 4ISFA 4PA1A 5SWMA 1WBDA 4DR6K 1T8EA 4BR2A 4BRFA 2FC0A 4KH4A 3FZFA 4FO0A 1KVBA 5JVGL 4JLHA 4QOZB 4FJIA 1LW0A 3S9HA 4OPJA 4FLTA 5AQRA 3MCPA 1BQNA 4CEFA 1KAZA 4DV3K 4KREA 3OYJA 4O44A 5FRNA 4KO0A 4B1XB 4CFDA 4Y1DA 1BISA 3KWGA 2HNZA 4FM1A 3GOIA 4CD3A 3KK7A 3CCRN 4DQQA 4UY8O 1KFDA 4PL7A 1QQCA 2YHYA 5LJVA 1X3MA 4MLEA 2JLEA 5HBMA 2NRHA 1K8KA 4PUOA 5KPZA 5AQIA 3V9UA 2Q2RA 5J1EA 3KHYA 3VQ7A 4FK4A 4B3TK 3U8XA 4C8NA 1JKHA 5BREA 3NF8A 4KRFA 1X9MA 3PUFA 4YHHK 4B9QA 5J2MA 4FCYA 4LH5A 3GBTA 3O9RA 3NF9A 2YV0X 3CF5L 1D8YA 4PQUA 4WQ5C 1U47A 3RMAA 2E2OA 1NJYA 3QDKA 3I0SA 4DFPA 4DU1A 4C8KA 2IC3A 3SUOA 4KHUA 4F4KA 3Q7CA 1I39A 4CZKA 4I6MB 1EO1A 2KTQA 4LY7A 3HL8A 4CF0A 4KHNA 5J2QA 2WONA 1WSIA 1C6VA 1VQ5N 4DR2K 2YNHA 1BIZA 4AHVA 3WXLA 4YDUC 1RT1A 3SAGA 1IKVA 1WN7A 2FBTA 3B8AX 1IBLK 2P9UB 5AQGA 3D2FA 4U67L 4CZHA 3CJBA 4EP5A 5M1PA 3LP0A 3TTCA 5JS1A 1X9WA 1R59O 3CXCM 1ESVA 1BDGA 2A40A 1VQPN 4OKKA 1YF5L 4MLHA 1BGXT 1BHLA 2O8FA 3KLHA 1Q82O 4JYAK 3PO4A 4XH4A 4YORA 4CIFA 4WYBA 3LP3A 2YNIA 2YX6A 4OLAA 4E7KA 4LF9K 1ZBSA 4MDBA 5GINA 1NMNA 4AHCA 3MK6A 2V7YA 1HNXK 4DTJA 3TAPA 1HYSA 2E8AA 3AVKA 1HUXA 1LWCA 3BY5A 4CZGA 3MWPA 3MEDA 2UUCK 1T44A 5JLHA 3AA3A 3DLBA 1YT3A 1WAJA 4DFKA 1NG9A 2OPPA 2CGLA 5M1NA 1IV0A 5HOOA 1SKRA 2EWSA 4JKAA 4DR3K 4DTPA 2D0CA 2YHWA 2QK9A 4CFBA 1NKEA 1X9SA 4CEOA 1NK9A 1EWQA 5BN9A 3A0IX 5HLFA 3OTOK 1W2BM 4M7XA 4W5TA 3V9XA 3J8AA 4CBWA 4E1MA 4UQGA 2DY4A 1RT7A 1YJWN 4K8ZA 1KXPA 3T7ZA 3A8YA 3OY9A 1A5WA 5AQHA 2Q36A 3D6RA 4EHUA 1GLAG 3V6DA 4DB3A 1BG3A 1U2VA 3SQ2A 3O9TA 4AH9A 4CEBA 4HTLA 3TAEA 5E41A 1XUPO 3R6MA 3OS1A 4FZXC 4DV7K 5J2PA 4DSIA 1TL3A 4Q5VA 2G8IA 4DSKA 3CERA 2F8TA 4IOXA 1L3SA 3F2KA 1YITN 5AQKA 3NMUA 1NJZA 3H45C 1X3NA 2Q31A 4JI2K 1NK8A 3VERA 4Z4HA 4CF9A 3NVMA 3P31A 2H3GX 5FLXO 3KLGA 3O80A 1QVFM 2KZMA 3L4IA 4LSNA 1NBWA 2D4WA 5B8HA 2XO7A 4O8UA 4E7LA 3MXMA 3L4QA 2NZTA 3DOKA 3O1WA 3KLIA 2VQEK 1IO2A 1TK0A 4B08A 2WBNA 4CGFA 1C0FA 2FBYA 5MLCQ 3M8SA 2P9PA 3ZSRA 3NF7A 2BTFA 1JLFA 1DTTA 1UOCA 3TAMA 2FBVA 4CZFA 3WEEA 1S1VA 1IBMK 3ZT2A 2OPSA 1U49A 3QB0A 2ASOA 3BUZB 4B9MA 4DU4A 3CI5A 1KAYA 5F0XA 5DMRA 2QKBA 1N33K 2EHGA 5ADXA 4IFEA 1RTHA 3LDOA 2KFZA 3PO5A 4JHDA 1NGBA 3LM9A 4H0VB 4CJPA 4DTSA 4C8MA 1RGIA 3TR8A 3HVRA 4H4MA 3PSIA 2E20A 4IFVA 3TARA 3AVJA 4GKKK 3OA9A 3PY8A 2HBKA 5C2FA 1T05A 3ZX3A 3LDPA 5AQQA 4JNEA 4RW9A 4BROA 3CC2N 2GX9A 1BCOA 4DQ8A 1UA0A 3CCUN 1QS4A 3VQ6A 2YNGA 5I3UA 3PX4A 3QERA 3O6WA 1FK9A 1HRHA 2ATQA 4FWQA 2A1SA 4OO1J 2ZGZA 3K58A 4OKJA 4BGBA 4CHOA 4X65K 3EY1A 2UXBK 4H5VA 1HKBA 2P9KB 4EZ9A 1KAXA 2QKKA 1EP4A 3AO3A 2NUBA 3LANA 3ZSQA 2G8KA 1RBTA 4KHYA 3O9QA 1LAVA 4JKDA 3VQEA 3I56N 3AVBA 4A5AA 3C6TA 1FXXA 5CY4A 4M3ZA 2P9LA 5KGWA 1XMOK 2Z1GA 1A5VA 4I2QA 3D7EO 3V9SA 4CHYA 2KLAA 3CM6A 3V4IA 5SZTA 1Q18A 3A5LC 2QA4N 1OVQA 1NK6A 1MU2A 1S9EA 2I7NA 4CZIA 2G8HA 4CJWA 1W97L 4DUYK 3THYB 1VSFA 3OYLA 1NGHA 5KQ8A 4N5SA 3NH1A 5KI6A 4K8XA 2BGGA 2JWLA 1SAZA 1YJ9N 2ZJPL 3C7NB 1HPZA 2Q1NA 3EE8A 4EFHA 1WSHA 5C10A 2NRWA 1KVCA 1QVGM 3N4QA 3HPGA 3AVCA 3ZSYA 1C0MA 1RTJA 3G25A 4E1JA 2FSJA 4CD1A 4KHWA 4W5OA 4ELVA 1JXBA 3AARA 4CIGA 1CXUA 3U3YA 4A57A 3QMLA 3A5MC 1B9FA 1WLJA 4NYNA 2P51A 1X1PA 3QIOA 4AHUA 3IKMA 2EX3A 5KTQA 3O4WA 3QFPA 3HVTA 4K0KK 3L3UA 4BY9C 1P90A 2V7ZA 1VQON 1NGAA 2B5JA 4I9LA 3JXUA 3T3FA 2AJQA 4DQRA 4B1WB 1RBSA 3QFUA 1NGGA 4EZ6A 2ZJRL 4BC3A 4KHPK 4O0JA 4JI8K 4Z4GA 4LF8K 4H5RA 3QESA 2XY7A 1MA9B 3SBTA 1E3MA 2VCPA 4HUEA 4WFAL 4AHRA 1S3XA 5AFUA 4AQYK 3QEVA 3LP2A 3R1XA 3THVA 2HVIA 3P5JA 4CGJA 3NGYA 1BQMA 1GLCG 2P9UA 4BRMA 4JRQA 4BRNA 2YJFA 3SV4A 3I55N 2VGMA 1TGOA 3L2WA 1DKGD 4EIAA 3ZEUB 4JI6K 4FWMA 3VOVA 5E26A 3ZYYX 1G99A 3MX2A 3O4QA 5GIPA 4E7JA 4CK2A 3ZCMA 2NRTA 1JLGA 4C1NI 1HJOA 3WEEB 2VWJA 3M3ZA 3LWLA 4CJ3A 2IVPA 5HRSA 4CEDA 3DXKB 4M3UA 3SMSA 2D0AA 4WF9L 3VF4A 3AA2A 4H0YB 2OPQA 2FSKA 3CCMN 1Z26A 3MN7A 4KKOA 4CJQA 4CGGA 2ZQBA 2Y1JA 2ZE2A 1CLQA 2RF2A 1QHTA 3CFRA 4YFUA 4DR5K 1NOZA 5F1XA 3ATVA 3NGZA 1WAFA 1NMDA 4RW7A 2F96A 2X6NA 2PBDA 4JS4A 1QZ5A 1HYVA 2IAJA 4DWIA 1RT2A 4DR4K 4LH4A 3AVAA 3DRSA 1XC3A 4CZEA 4OPKA 1QQMA 2ZD1A 1L5UA 1D9FA 3CCJN 2V52B 5M1FA 1KRPA 3AA4A 2FLOA 2YHBA 4CJRA 4FLZA 5EOYA 3TI0A 2UUAK 4DHYA 4WQ4C 4CHNA 4RTFD 3VQPA 1S1TA 2ZM6K 4QS9A 3NH0A 4B8CA 3HTVA 4ID1A 4KB1A 4J8FA 1VRUA 1QZ6A 4JS5A 2O4GA 3KK2A 3D45A 2R7YA 4X66K 3NH2A 5C42A 4O8KA 3SJJA 4CJSA 1GLLO 5CZ2A 2PFUA 2YHAA 4FWSA 1C0GA 1YIJN 1KLMA 2O8DB 3SZ2A 5AJ3K 3KWIA 3SCXA 4DLEA 1BWFO 1VHXA 2UUBK 5C2DA 3PIPL 2QWNA 1QE1A 5HROA 4M3WA 3UKRA 1KVAA 1C0TA 3ZETB 5ADXH 3L0QA 3BZCA 3N4PA 3WXMB 4IEIA 5TKYA 4WQ4A 4IG3A 4Y1CA 4CE9A 2P9NA 4FLXA 1FKPA 5E84A 4E0DA 4WFNL 3DLHA 2Q3SA 1C1AA 4JN4A 3I0RA 3A2FA 4FPAA 1Q8IA 3FFIA 3OYEA 3EEQA 1BOTO 1ZBFA 1O13A 4GY2B 4LF7K 4JAXA 1OH6A 4Q0BA 2X78A 1RILA 1N5YA 3OBWA 4Z4FA 4NLBA 1RDCA 2FSNA 2OTJN 5BN8A 4WCEL 3MEGA 4DF8A 5FPEA 2E88A 2WUSA 3C0BA 2VYPA 3C6AA 5KPTA 1NNEA 1WSJA 3KLFA 4G9ZA 4CEQA 4JKBA 1XWLA 2QWOA 1YJNN 2A3ZA 2AA4A 1IKYA 2E2PA 1LCUA 3E9PA 3L6QA 1HYZA 3ZSXA 1Q9XA 4BC4A 3IS9A 4RWTA 2ZWHA 1L3TA 4JEPA 1J5EK 5TKWA 4MO4A 1WUAA 3DM2A 1GLFO 5AQOA 4BRCA 1S22A 4NO7A 5C15A 2BDPA 2GWKA 1RT3A 3UIQA 2YNFA 3HXMA 1W7AA 3HJFA 2UYTA 2CGJA 4YOTA 4FJXA 2ZF5O 2W42A 4CHQA 4B3SK 3H1VX 5AQZA 2YCHA 4CJVA 3ZSZA 2HHQA 1LWEA 3AY9A 3LDQA 3T1YK 4JI3K 3OYIA 5F2RA 3VGLA 4M3XA 4N41A 4B9TA 4CECA 2F8SA 4BR4A 2E5LK 3T1AA 1S1WA 2P5OA 3ENHA 4FVUA 3CFOA 4KI4A 4BREA 3MXIA 3MN9A 2O4IA 4RG8A 3SAHA 1DEJA 1ZC6A 2NLXA 2IIRA 3VQCA 2P9KA 4M7YA 1J54A 2WOMA 4J2EA 2F9TA 5BPMA 3E9OA 3RR8A 3HO1A 1Y64A 2P9IB 2OZSA 1RT4A 1BA1A 1HPMA 4DU3A 3KKRA 3GDQA 5JS2A 3HOSA 2Y1IA 2YI1A 4H8KA 1J5OA 1VSJA 4XEIA 2ETJA 5M1KA 3C6HA 4FWRA 4W5NA 3BZKA 2NRZA 3J7ZO 1GLBG 5J2NA 1HNIA 1SZ2A 1HX1A 3H6EA 3K57A 4IO9L 5HRPA 4FJNA 1ASUA 3THYA 1VRTA 4RW4A 4BRPA 3G0ZA 1SL2A 1TUYA 1GOBA 4H0XB 3WNFA 3C7NA 3CJAA 4FM0A 4HTUA 4BRAA 3G4SN 3ID6A 4O55A 3QEXA 3DI6A 2HBJA 4AHTA 1ZBUA 3RVCA 3LPUA 3I33A 4OPAA 4X64K 4L3QA 3NGIA 5AQWA 1S72N 5EXWA 4KV8A 4ICLA 5AFUH 1W0HA 5BPNA 1ASVA 3S3OA 1UAXA 4JK9A 4CI6A 4M3YA 4E3SA 3VESA 1Z25A 4B9VA 3MWTA 3O1BA 4FJ8A 1KLNA 3UE5A 4C23A 2E2QA 3MEEA 4FOEA 1SKSA 1IKWA 1C0UA 3OYFA 3I8BA 4DUZK 1TKTA 2RKIA 1HQUA 3CG7A 3DLEA 1K9MO 2X74A 3IMXA 3WXJA 3U3GA 3RMDA 4FVMA 3EZWA 4DS5A 2DFFA 2QEXN 5FPDA 3T19A 1V4SA 3HM8A 4XH5A 1K8AO 1ILYA 1QSYA 3C6UA 4YY3K 2V51B 3VMFB 3K5LA 4DR1K 3CYMA 1QSSA 2Q0RA 1GLEG 1B9DA 5DM7L 4N47A 3SPYA 4A59A 1YVUA 3UKRB 3ZSOA 4FJ9A 3ZT3A 3J7AP 5CR4A 4LC9B 1NM1A 3SK3A 1ATNA 4DV5K 3U6FA 4F8RA 2P9NB 1YTAA 5EVZA 3CHWA 3LPTA 5FRMA 2OPRA 1S6PA 1OVYA 3MECA 5AQUA 3RMCA 1ITGA 3CMAN 3ZEUA 4CJ4A 3CPWM 4FJJA 1S5JA 2QWLA 5HRRA 4DR7K 3RSEA 1LV5A 3J81O 1W9HA 4O0IA 4B3MK 4DF4A 3TPQA 1S1XA 3LALA 2A41A 4O4GA 4AM7A 3SV3A 3DXKA 1QTMA 3MX5A 5EY4A 4IDHA 1KFSA 4JV5K 3NFAA 1RT6A 5CYQA 3SUPA 3RR7A 1E4GT 3AA5X 4N56A 4W5RA 2HHWA 1QQOA 4CGHA 1NJXA 2P1JA 4DTOA 4HCCA 1ZBIA 4DV4K 1GOCA 1VSMA 3QLHA 1DLOA 3F9KA 4FJKA 4GKJK 4YOXA 4BRQA 4FLYA 5KRSA 3IDHA 4HVJA 1VK0A 1BIUA 1TK8A 3LL3A 2WFBA 4CCHA 1DTQA 5AQMA 1JXEA 4G1QA 3VENA 4JK7A 2FF3B 3KD1E 1MDUB 1N8RO 2BANA 1XI1A 4DV1K 3DJCA 3DAWA 4NYFA 3C94A 5AQFA 1ATRA 4ILHA 3OS0A 4H4OA 5C25A 1UWBA 1S6QA 3KKSA 3T69A 1EQYA 2O8CA 1U48A 4PKIA 2BUPA 4ISGA 3OYAA 2O8BB 1KC8O 2LSNA 1SL1A 3VGKA 3U4LA 4J2BA 2O8DA 4JI7K 3K59A 3OW2M 1E4FT 5AQTA 3MCAB 3SUQA 1YAGA 3MXJA 3CCLN 1VAZA 3SBGA 4EHTA 4DQPA 4KHSA 3ZETA 2D1KA 3LZIA 3CJ9A 3K0SA 3MDQA 4FWPA 2G8FA 4CZMA 1WOQA 3MAQA 4GVMA 3CIPA 4HUFA 1NKCA 4NCGA 3SQ1A 1TV6A 3P1GA 3QINA 5KPRA 2HHXA 5T7BA 5H1SQ 4M63C 4CJUA 1C1CA 4CJEA 1RDWX 3O4NA 2DTUA 3AVFA 5BRDA 3BP8A 3G71N 4KB0A 4KTWA 3KK1A 2O8EA 3DLKA 1XMQK 3QEIA 3E66A 2GEMA 3LP1A 1HKCA 3AO2A 4DQIA 3F5TA 4WFBL 4FK2A 3ENOA 4E7HA 2OANA 5BPLA 1HMVA 1REVA 2HSTA 1IJJA 4DKWA 4HHTA 4ISEA 5FDLA 5GAEP 3HRGA 3JS6A 3ZSWA 1A5XA 4FJ7A 1RT5A 5BRFA 1ATSA 4PKGA 2X6SA 3ASMA 1NU0A 1J53A 1M1KO 2FBXA 3THXB 1NGIA 2JWKA 4JK8A 3QBWA 4CESA 4BQLA 4FJLA 5DM6L 2UXCK 2KW4A 3S3NA 3CM5A 1YVNA 1TYQB 2QW9A 4GW6A 1T3VA 2F9WA 3HP9A 4R5PA 1F21A 4B9LA 1XC9A 4B9UA 3LDNA 4QS7A 1Q7YO 5BRHA 4DG1A 3IUCA 2WC9A 3HK2A 4IEEA 4CF2A 4I7FA 1WNSA 3FZHA 2XY8A 3NE6A 1J9AA 4BR5A 3B6PA 4GV3A 3ZX2A 2E4LA 1NGDA 1TKXA 3H46O 1R0AA 2HOEA 1SS6A 4L8RB 1CZ9A 3DLGA 2DPNA 4DV2K 4IKFA 1SV5A 3QEWA 2P9IA 5LL6Z 1IBKK 1D9DA 3V1RA 4M42A 4DTUA 4CK3A 3RSEB 2PYLA 5D3GA 3ITHA 3EKSA 4MQ3A 3VA0A 3H3OB 2FF6A 2PY5A 4M45A 4ZTFA 2NNWA 1I94K 4KH5A 3WQTA 4I9QA 3UB5A 2PZSA 4DMNA 5AR0A 1NLVA 1SUQA 2G8VA 3GL1A 4CJ5A 4RCHA 2FXUA 4HCBA 4A61A 3VF6A 3VEVA 4YOVA 3L2RA 3MN5A 1NJWA 1VSEA 2CGKA 4E89A 2P5GA 4CFAA 2DFHA 4BWJA 3ULEA 3HYFA 3FFKB 4LF6K 2Z1IA 2HF3A 1O1WA 4MO5A 3E9LA 1M90O 3DLRA 4DV0K 3HZ6A 3F9MA 3BF1A 4X62K 3JYTA 3AVGA 1L3VA 3WT0A 1TK5A 1NGFA 2XHBA 4ZHRA 5BR9A 3DOLA 5LMNK 1WSEA 3HSCA 2D0OA 2GUIA 3Q7BA 1S9GA 1XQSC 3WXIA 3JSMA 3VQAA 2IOCA 1JL2A 4K25A 1VQLN 4IOCL 3U9ZA 3OYDA 4H5TA 4KH6A 4N76A 1JCEA 3VEWA 4V19S 1NGCA 2RE2A 1HNVA 3ID8A 3JAMO 1NOYA 2E1ZA 4IJNA 2ITMA 3RWUA 1NK5A 2O8CB 4CEZA 4JD2A 4PY5A 1BI4B 1ZYQA 5AQNA 4B1ZA 3VN5A 4DS4A 3VEOA 4DV6K 1HNZK 4FW1A 1Z6RA 4KBOA 2QI2A 3OYHA 4BDYA 3DLLL 1TKDA 3MN6A 4CK1A 3TSPA 3HI0A 3EN9A 3HP6A 4H5WA 1ASWA 5LMUK 2HW3A 4ILGB 3TAFA 1WSGA 3KTQA 2HHTA 4CGDA 3TAQA 4B3RK 2HBMA 2IS3A 3D0PA 4MDAA 4KTZA 4JKHA 3CQ8A 4DSEA 2D0BA 3O5BA 1D5AA 5IWAK 4H5NA 1VQMN 3TSQA 3H3NO 2CH6A 1VQ9N 1VQ6N 2Q0UA 3F73A 4R79A 1TVRA 4B9NA 4KTQA 4F2SA 2A1RA 1KQSM 2O8EB 1RBVA 4JI4K 1CZBA 4DSFA 3J7YP 3SJHA 1N36K 5IT9O 3CPEA 4BR7A 4DFMA 3ZT0A 1Q86O 3H08A 4QAGA 4J2AA 4H0PA 5AZJB 3SNNA 1RTDA 1RFQA 4JKEA 4FJ5A 2F4VK 1C1BA 3OYGA 2W6KA 4I2PA 4FOIA 3DWLA 4LF5K 4A5BA 4BRKA 4JRPA 4NXMK 4IOAL 3VEYA 4B3OA 3B6OA 1Q81O 2HB5A 3M1FA 3MMVA 3OYBA 1WB9A 1KD1O 1N6QA 2I5JA 2P9SA 4IZ9A 4C1NK 1U04A 3NCIA 4QS8A 3RMBA 4CGIA 3CC7N 1FW6A 1RNHA 2XRIA 2KHOA 1DT9A 1KTQA 1GLJO 3O3GA 1BA0A 4OPHA 4BDPA 1U6ZA 1V4TA 2G8UA 1MWMA 5CHIA 3WUHA 5AQXA 3ULDA 1NGEA 1TUUA 2NRXA 1XHZA 4BE1A 1T6DA 2HF4A 3IG1A 4LSLA 4CVNE 3DRRA 5HP1A 2I7PA 3DRPA 2A5XA 4FJHA 2B4JA 1TAUA 5AQJA 1ZBHA 1YTUA 4OX9K 5AQYA 3FE1A 1J6ZA 2ASMA 5FPMA 5C12A 2D0PA 4CF1A 3OYNA 2QTDA 3LM2A 2A6AA 1VSHA 1KCFA 2CH5A 3EZ5A 5AZIB 2O8BA 4PWDA 1RDUA 1HNWK 4JKCA 1NWKA 1XHXA 1Y97A 1X9JA 4NLCA 3OJSA 3CCVN 4FK0A 3SAFA 3O3FA 2BE2A 3THWB 3CFPA 1RTIA 2VGNA 4NCBA 4C8OA 2Q97A 4GMJB 2OTLN 3AGKA 3LDLA 4PKHA 5CYMA 2KZZA 1JLEA 4WQ5A 3ZT1A 3EO3A 1UA1A 3UKUB 3DXMB 1TAQA 3C95A 3P4IA 3CETA 4GV6A 4GNIA 3TU5A 3L2UA 3P83D 3TANA 3VEZA 3PLAA 3EE9A 1OH5A 4OLBA 3OJUA 4DQSA 4BRLA 3HSTB 3DYAA 3KD5E 3VF2A 3ZT4A 2RN2A 3P38A 3ULEB 4OVLA 4Z94A 4JKFA 1NK7A 3V1QA 4Z4EA 4BRGA 1CXQA 3NHGA 1VQKN 1N32K 1RDDA 2HHHK 4YDUA 4F3OA 4DTMA 3K9JA 2A42A 1XNRK 4IWVA 4U7BA 4RW8A 4M41A 5GADP 5FROA 4NXNK 3O3HA 3CQXA 2GBZA 3AO5A 1T03A 3QEPA 2D5RA 4ELTA 1IG8A 3SUNA 4BACA 3AVLA 5JMVA 4O5BA 4FJGA 2J4RA 3L8BA 2PYJA 4BG8A 3QNOA 4BRDA 3OS2A 2KFNA 3EKUA 2QM1A 1HLUA 3LAMA 4RW6A 4YOWA 3THXA 2HMIA 2HBLA 3KK3A 3KZBA 3AVNA 4BGAA 3EL2A 1JLCA 4CBUA 4ID5A 1Z05A 4JD2B 4LD0A 2UU9K 4Z0UA 3CCEN 1BCMA 4FLUA 4FYDA 4H03B 2KKZA 4CFCA 1TYQA 3NAEA 3AAPA 1VSKA 4FXDA 3O08A 4M3RA 3KIOA 2HMPA 1G15A 2ZGYA 4B9SA 3H1QA 4F2RA 4JI1K 3PX0A 4M3TA 2YKMA 1QQNA 1IH7A 5HL7L 4BE0A 3LDSA 1EX4A 3VA3A 5JLFA 5KRTA 1JCFA 1NJIO 1OKJA 1RDAA 2YJEA 1D4XA 2IVOA 3NBPA 1LAWA 2QWQA 5CE3A 4CZJA 3G6EN 1SL0A 2W6LA 5KQDA 2AP1A 2JGUA 1TL1A 1TKZA 3QICA 2HHVA 3QO9A 4LF4K 3AAQA 3PV8A 4BDZA 3D2EA 2OZMA 4O5FA 3VQ8A 3IRXA 3O9SA 2G8WA 3GE1A 3PIOL 4B1VA 4CHPA 3E01A 1HJRA 4BR9A 3HPOA 1VSLA 2XY6A 1JJ2M 5I42A 1KSPA 3VTHA 5GAHP 2E6LA 4JKGA 2HNDA 3ATUA 4BG9A 4AM6A 4LFCK 1N34K 2P9SB 3O9UA 1EWRA 1BUPA 1P8ZA 1K8KB 4CIEA 4IJAA 4TSXA 3U9DA 2Z1HA 4FL9A 3T1HK 2XY5A 3G10A 4GVEA 3W0LA 4A2BA 4KHQA 4AF1A 1ZXOA 2VQFK 4FWNA 3CJ1A 5AQSA 1QHAA 2W41A 1NGJA 1RBUA 4AILC 5KGXA 3SI6A 5DK5A 2GELA 5AQPA 3K9KA 2OCEA 3CJ7A 2ASPA 3V81A 3BF3A 5M1QA 1BO5O 1IG9A 4GV9A 1IKXA 2HNYA 2IDOA 1BL3A 1BI4A 2QWPA 3HOTA 4CERA
chains in the Genus database with same CATH topology
3RSEB 3C0BA 2VYPA 3C6AA 5KPTA 4G9ZA 5BN9A 3EKSA 3H3OB 3S41A 3A0IX 2FF6A 4JKBA 1W2BM 4M7XA 2QWOA 1YJNN 2A3ZA 2AA4A 3VETA 2NNWA 4K41A 2E2PA 2QXLA 4BC2A 1LCUA 3E9PA 3J8AA 3L6QA 4KH5A 3WQTA 4CBWA 3UB5A 4BC4A 1YJWN 1KXPA 5AR0A 3T7ZA 1NLVA 4RWTA 2ZWHA 4JEPA 3A8YA 3D2FB 3GL1A 4RCHA 5TKWA 2FXUA 4MO4A 1WUAA 4A61A 5AQOA 1GLFO 5AQHA 3VF6A 2Q36A 3VEVA 3D6RA 4EHUA 4YOYA 3MN5A 1GLAG 1S22A 4BRCA 4NO7A 1DGKN 5GAGP 5C15A 2GWKA 2CGKA 1BG3A 4DB3A 1U2VA 5GIOA 3ULEA 1MWKA 2E1YA 3FFKB 2HF3A 3O9TA 4K43A 4HTLA 2RHKA 4MO5A 2UYTA 4BVPA 1XUPO 2CGJA 3R6MA 4FWLA 4YOTA 3E9LA 1M90O 2ZF5O 3FR0A 3R3LA 3KVGA 3HZ6A 3F9MA 3BF1A 3H1VX 5AQZA 2YCHA 3CERA 3WT0A 4IOXA 3F2KA 1YITN 3AY9A 3LDQA 1NGFA 5AQKA 3NMUA 3H45C 1X3NA 2Q31A 5BR9A 5F2RA 3W3DA 3VGLA 3VERA 2W40A 3CD6N 3HSCA 3NVMA 2D0OA 3P31A 5AZJA 4BR4A 3Q7BA 2H3GX 4FWKA 4F9OA 1XQSC 3O80A 4Y0WA 3WXIA 1QVFM 3ENHA 3L4IA 4H0OA 3TTFA 4FVUA 1NBWA 4K25A 2D4WA 4BREA 3MN9A 5B8HA 4IOCL 1VQLN 3U9ZA 3SAHA 1DEJA 1ZC6A 2NLXA 4H5TA 4O8UA 2IIRA 4KH6A 3L4QA 2NZTA 3O1WA 1JCEA 2P9KA 3VEWA 1NGCA 4M7YA 4PL8A 2RE2A 2F9TA 5BPMA 3E9OA 3ID8A 3CMEN 2WBNA 1C0FA 5MLCQ 2E1ZA 2P9PA 4IJNA 2ITMA 1Y64A 2P9IB 2BTFA 2NRRA 3R8EA 1BA1A 2QWMA 1HPMA 4JD2A 3HOSA 3GDQA 4CZFA 5AQNA 3WEEA 4B1ZA 2YI1A 3VEOA 4XEIA 3P39A 5M1KA 2GUPA 3C6HA 2E2NA 4FWRA 2YHXA 3QB0A 2ASOA 4DCHA 1Z6RA 4KBOA 1CZAN 5M1OA 2NRZA 2QI2A 1GLBG 3J7ZO 3DLLL 1SZ2A 1HX1A 3BUZB 3H6EA 3MN6A 4PHTX 1LOTB 3CI5A 4IO9L 3TSPA 1KAYA 5F0XA 3HI0A 3EN9A 4H5WA 3A5OC 5ADXA 4IFEA 4ILGB 3HOTA 3LDOA 4BRPA 3WXKA 4JHDA 2HBMA 1NGBA 1TUYA 3LM9A 4H0VB 2ZJQL 4H0XB 3C7NA 3CJAA 4MDAA 4BRAA 4JKHA 3ID6A 3G4SN 3O5BA 1RGIA 2HBJA 3RVCA 1U2VB 4H5NA 1VQMN 3H3NO 2E20A 3FZKA 3TSQA 2CH6A 3AGRA 3CJCA 1VQ9N 3I33A 4OPAA 1VQ6N 2Q0UA 3HBTA 4I6MA 4R79A 1VQ7N 4L3QA 5AQWA 4BRIA 5AZIA 1S72N 1SQKA 5EXWA 2GTDA 1KQSM 5AFUH 3OA9A 5BPNA 2HBKA 2E88A 4JK9A 4NB4A 3CCQN 5C2FA 3ENBA 3ZX3A 3LDPA 4CI6A 1JCGA 3OHRA 1VQNN 5AQQA 4JNEA 4BROA 3SJHA 2IVNA 4HWIA 3CCSN 5C0YA 3CC2N 2GX9A 3CPEA 3VESA 4BR7A 3MWTA 1Q86O 4DQ8A 3O1BA 3CCUN 4YOUA 3OBYA 4H0PA 5AZJB 4BR0A 3UE5A 4C23A 1RFQA 2E2QA 4JKEA 4FOEA 4BC5A 4FOIA 3O6WA 3M5RA 3DWLA 4FWQA 5JICA 4OO1J 4A5BA 2ZGZA 3I8BA 3WQUA 3A5NC 3UKUA 4BRKA 2QWRA 4BGBA 3DXMA 4IOAL 4H5VA 1HKBA 2P9KB 4H0TB 1YHQN 3D2EB 1K9MO 1KAXA 3IMXA 3WXJA 3VEYA 3IFRA 1Q81O 3M1FA 5AQLA 2P9PB 3EZWA 1YUWA 2QEXN 3O9QA 5FPDA 3QBXA 4JKDA 3I56N 3MMVA 4A5AA 1KD1O 2P9SA 5JVHL 2P9LA 4IZ9A 4C1NK 1V4SA 3FZMA 3HM8A 3VTIA 4B1UB 4QS8A 4XH5A 4JKGB 5AQVA 3VPZA 1K8AO 3CC7N 1ILYA 3D7EO 2KLAA 2V51B 2KHOA 1DT9A 1GLJO 1Q18A 3A5LC 3VMFB 2QA4N 1BA0A 4OPHA 5ELZA 1U6ZA 1V4TA 2Q0RA 4EAHD 1GLEG 2I7NA 5DM7L 1BU6O 1MWMA 3UKRB 4A59A 4CZIA 5CHIA 3WUHA 1W97L 5AQXA 1NGEA 4ILJA 3ZX0A 1TUUA 2NRXA 5CR4A 3FGUA 1T6DA 4LC9B 2HF4A 3R9PA 4BVOA 1NGHA 2GWJA 1NM1A 3SK3A 5KQ8A 1ATNA 2I7PA 2JWLA 4FWOA 4JHDB 1SAZA 2A5XA 3GG4A 1YJ9N 2ZJPL 2P9NB 3C7NB 5AQJA 5EVZA 5AQYA 3FE1A 3CHWA 2Q1NA 1J6ZA 2ASMA 2PAVA 3EE8A 5FPMA 5C12A 2D0PA 3SMPA 3CQYA 4EFHA 2QTDA 5C10A 3TSUA 1OVYA 2NRWA 4FSVA 1QVGM 3LM2A 3N4QA 2A6AA 1VQ4N 4E1JA 5AQUA 3G25A 1K73O 2FSJA 4CD1A 2CH5A 4BRHA 3CMAN 5AZIB 3ZEUA 3CPWM 3AARA 1RDUA 2QWLA 3FLCO 3RSEA 2VWBA 4JKCA 1NWKA 4A57A 3QMLA 3A5MC 4CBXA 3TPQA 1X9JA 4NLCA 4YOWA 3CCVN 1GLDG 3SAFA 2A41A 5EX5A 3M6GA 2BH1A 4XH1A 3VEXA 4A2AA 1HKGA 2VGNA 3IKMA 3C65A 5FPNA 2F7TA 4AM7A 3O4WA 2Q97A 3QFPA 3DXKA 4BQZA 3MX5A 3CC4N 4BY9C 5EY4A 4IDHA 1VQ8N 1P90A 2V7ZA 4CD3A 1VQON 3TTDA 3AGKA 3LDLA 4PKHA 2OTLN 1NGAA 4WQ5A 3EO3A 3JXUA 3BEXA 3UKUB 4B1YB 3DXMB 4CZLA 4B1WB 3P4IA 3CETA 5LJWA 4GV6A 4GNIA 3TU5A 1E4GT 4IXCA 3QFUA 1QQOA 1NGGA 3VEZA 1H1VA 3EE9A 4IO8A 3PLAA 3E1YA 3O8MA 4BRLA 2ZJRL 1YI2N 4BC3A 3VF2A 5LY3A 5I9EB 3SLCA 3P38A 4BRQA 4YOXA 3ULEB 4Z94A 2P9LB 4JKFA 3IDHA 4K42A 3FZLA 4H5RA 2NRVA 4A62A 3NVKA 1YXQA 4BRGA 4CJ7A 1VQKN 1MA9B 1T6CA 3VGMA 3SBTA 4YDUA 2VCPA 3LL3A 4WFAL 2WFBA 3K9JA 1S3XA 2A42A 5AFUA 4FPBA 4ISFA 4IWVA 4U7BA 3R1XA 4BR2A 4BRFA 5AQMA 4KH4A 3VENA 3FZFA 4JK7A 2FF3B 4FO0A 5GADP 1MDUB 5JVGL 1N8RO 3CQXA 3DJCA 1GLCG 2P9UA 3DAWA 4BRMA 1IG8A 5AQFA 4BRNA 1ATRA 4ILHA 2YJFA 3MCPA 5AQRA 1KAZA 5JMVA 2J4RA 3I55N 2VGMA 4B1XB 3T69A 1EQYA 1DKGD 4BG8A 4EIAA 3KWGA 4BRDA 4PKIA 3EKUA 2BUPA 1HLUA 2QM1A 3GOIA 3KK7A 4FWMA 4ISGA 3VOVA 5E26A 3ZEUB 3ZYYX 3CCRN 1KC8O 1G99A 2HBLA 3MX2A 3VGKA 3U4LA 5GIPA 4UY8O 3KZBA 4PL7A 3OW2M 4BGAA 1E4FT 2YHYA 3EL2A 5AQTA 5LJVA 3MCAB 4CBUA 1X3MA 4MLEA 1Z05A 2NRTA 4JD2B 1YAGA 4C1NI 3CCEN 3CCLN 2NRHA 1HJOA 1K8KA 1VAZA 3SBGA 3WEEB 4EHTA 4H03B 5KPZA 3M3ZA 5AQIA 2KKZA 2Q2RA 3KHYA 2IVPA 1TYQA 3ZETA 3U8XA 2D1KA 3DXKB 3CJ9A 5BREA 3MDQA 4FWPA 3AAPA 4CZMA 3SMSA 3O08A 1WOQA 4WF9L 3VF4A 4H0YB 4B9QA 2HMPA 2FSKA 3CCMN 2ZGYA 3CIPA 3MN7A 3GBTA 3H1QA 3O9RA 3CF5L 5KPRA 5H1SQ 4WQ5C 4M63C 2E2OA 3QDKA 1QQNA 1RDWX 5F1XA 3ATVA 5BRDA 3BP8A 5HL7L 3G71N 1NMDA 2PBDA 5JLFA 3Q7CA 1JCFA 2GEMA 3E66A 4CZKA 1NJIO 1OKJA 1QZ5A 4I6MB 2YJEA 1EO1A 1D4XA 1HKCA 2IVOA 3F5TA 4WFBL 1VQ5N 1XC3A 3ENOA 4CZEA 2OANA 2QWQA 5BPLA 1QQMA 5CE3A 4CZJA 3G6EN 2HSTA 1IJJA 3WXLA 2V52B 5M1FA 3CCJN 4YDUC 2FLOA 4DKWA 5KQDA 2AP1A 5EOYA 4ISEA 3QICA 4DHYA 3SAGA 4WQ4C 4RTFD 5GAEP 3B8AX 3HRGA 3JS6A 3AAQA 2P9UB 5BRFA 5AQGA 3D2FA 4QS9A 4U67L 1ATSA 3D2EA 3HTVA 4PKGA 4J8FA 4CZHA 1QZ6A 4O5FA 4YOVA 3O9SA 3CJBA 5M1PA 3GE1A 3PIOL 4B1VA 3TTCA 1M1KO 4BR9A 1NGIA 2JWKA 4O8KA 1R59O 1GLLO 1ESVA 2PFUA 4JK8A 3CXCM 1JJ2M 1BDGA 3QBWA 1C0GA 4FWSA 2A40A 3VTHA 4JKGA 5GAHP 1VQPN 1YIJN 3ATUA 4BG9A 4BQLA 1YF5L 4MLHA 4AM6A 3KWIA 5DM6L 1BWFO 2P9SB 3O9UA 5C2DA 3PIPL 1BUPA 1P8ZA 2QWNA 1K8KB 1Q82O 1YVNA 3UKRA 4XH4A 1TYQB 2QW9A 4IJAA 3ZETB 5ADXH 1T3VA 2F9WA 3L0QA 4YORA 3U9DA 4FL9A 4WYBA 3N4PA 2YX6A 4GVEA 3WXMB 4IEIA 5TKYA 3W0LA 4WQ4A 4A2BA 3LDNA 1ZBSA 4AF1A 4MDBA 1ZXOA 4QS7A 5GINA 1Q7YO 2P9NA 5BRHA 3MK6A 4FWNA 2V7YA 5E84A 3CJ1A 4WFNL 3IUCA 5AQSA 2WC9A 4JN4A 4IEEA 2E8AA 3FZHA 1HUXA 4FPAA 1QHAA 4CZGA 2W41A 3MWPA 1NGJA 1T44A 4BR5A 1BOTO 4GY2B 1O13A 4GV3A 4JAXA 3ZX2A 5JLHA 1NGDA 3H46O 2HOEA 1SS6A 2GELA 3OBWA 2DPNA 2P9IA 3K9KA 5AQPA 3CJ7A 2ASPA 4NLBA 3BF3A 2FSNA 2CGLA 1BO5O 5M1QA 5BN8A 5M1NA 5HOOA 2EWSA 4WCEL 4GV9A 2OTJN 4JKAA 5FPEA 2QWPA 2WUSA 2YHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RSE B;  3C0B A;  2VYP A;  5KPT A;  5BN9 A;  3EKS A;  3H3O B;  3S41 A;  3A0I X;  2FF6 A;  4M7X A;  2QWO A;  2A3Z A;  2AA4 A;  3VET A;  4K41 A;  2E2P A;  2QXL A;  4BC2 A;  1LCU A;  3J8A A;  3L6Q A;  3WQT A;  4CBW A;  3UB5 A;  4BC4 A;  1KXP A;  5AR0 A;  4RWT A;  1NLV A;  2ZWH A;  3A8Y A;  3D2F B;  3GL1 A;  4RCH A;  2FXU A;  4MO4 A;  1WUA A;  4A61 A;  5AQO A;  1GLF O;  5AQH A;  3VF6 A;  2Q36 A;  3VEV A;  4EHU A;  3MN5 A;  1GLA G;  1S22 A;  4BRC A;  4NO7 A;  1DGK N;  2GWK A;  2CGK A;  1BG3 A;  4DB3 A;  1U2V A;  3ULE A;  1MWK A;  2E1Y A;  3FFK B;  2HF3 A;  4K43 A;  4HTL A;  4MO5 A;  2UYT A;  4BVP A;  1XUP O;  2CGJ A;  3R6M A;  4FWL A;  2ZF5 O;  3FR0 A;  3KVG A;  3HZ6 A;  3F9M A;  3BF1 A;  3H1V X;  5AQZ A;  2YCH A;  3CER A;  3WT0 A;  3AY9 A;  3LDQ A;  1NGF A;  5AQK A;  3H45 C;  1X3N A;  2Q31 A;  5BR9 A;  5F2R A;  3W3D A;  3VGL A;  3VER A;  2W40 A;  3HSC A;  2D0O A;  5AZJ A;  4BR4 A;  2H3G X;  4FWK A;  4F9O A;  1XQS C;  3O80 A;  4Y0W A;  3WXI A;  3ENH A;  3L4I A;  4H0O A;  1NBW A;  4K25 A;  2D4W A;  4BRE A;  3MN9 A;  5B8H A;  3U9Z A;  1DEJ A;  1ZC6 A;  2NLX A;  4H5T A;  2IIR A;  2NZT A;  3O1W A;  1JCE A;  2P9K A;  3VEW A;  1NGC A;  4M7Y A;  4PL8 A;  2F9T A;  5BPM A;  3ID8 A;  1C0F A;  2E1Z A;  2P9P A;  4IJN A;  2ITM A;  1Y64 A;  2P9I B;  2BTF A;  3R8E A;  1BA1 A;  2QWM A;  1HPM A;  4JD2 A;  3GDQ A;  4CZF A;  5AQN A;  3WEE A;  4B1Z A;  2YI1 A;  3VEO A;  4XEI A;  2GUP A;  2E2N A;  4FWR A;  2YHX A;  3QB0 A;  2ASO A;  4DCH A;  1Z6R A;  4KBO A;  1CZA N;  1GLB G;  1SZ2 A;  1HX1 A;  3BUZ B;  3H6E A;  3MN6 A;  1LOT B;  3CI5 A;  1KAY A;  5F0X A;  3HI0 A;  3EN9 A;  4H5W A;  3A5O C;  5ADX A;  3LDO A;  4BRP A;  3WXK A;  4JHD A;  1NGB A;  1TUY A;  3LM9 A;  4H0V B;  4H0X B;  3C7N A;  3CJA A;  4BRA A;  3O5B A;  1RGI A;  1U2V B;  4H5N A;  3H3N O;  2E20 A;  3FZK A;  2CH6 A;  3CJC A;  3I33 A;  2Q0U A;  3HBT A;  4I6M A;  4L3Q A;  5AQW A;  4BRI A;  5AZI A;  1SQK A;  5EXW A;  2GTD A;  5AFU H;  5BPN A;  2E88 A;  4NB4 A;  3ZX3 A;  3LDP A;  4CI6 A;  1JCG A;  3OHR A;  5AQQ A;  4JNE A;  4BRO A;  3SJH A;  2IVN A;  4HWI A;  3VES A;  4BR7 A;  4DQ8 A;  3O1B A;  4H0P A;  5AZJ B;  4BR0 A;  3UE5 A;  4C23 A;  1RFQ A;  2E2Q A;  4FOE A;  4BC5 A;  4FOI A;  3O6W A;  3DWL A;  4FWQ A;  5JIC A;  2ZGZ A;  3I8B A;  3WQU A;  3A5N C;  3UKU A;  4BRK A;  2QWR A;  4BGB A;  3DXM A;  4H5V A;  1HKB A;  2P9K B;  4H0T B;  3D2E B;  1KAX A;  3IMX A;  3WXJ A;  3VEY A;  3IFR A;  3M1F A;  5AQL A;  2P9P B;  3EZW A;  1YUW A;  5FPD A;  3QBX A;  3MMV A;  2P9S A;  2P9L A;  4IZ9 A;  1V4S A;  3FZM A;  3HM8 A;  4B1U B;  4QS8 A;  4XH5 A;  5AQV A;  3VPZ A;  3D7E O;  2V51 B;  2KHO A;  1Q18 A;  1GLJ O;  3A5L C;  1BA0 A;  5ELZ A;  1U6Z A;  1V4T A;  2Q0R A;  4EAH D;  1GLE G;  2I7N A;  1BU6 O;  1MWM A;  3UKR B;  4CZI A;  3WUH A;  5AQX A;  1NGE A;  3ZX0 A;  1TUU A;  3FGU A;  1T6D A;  4LC9 B;  2HF4 A;  3R9P A;  4BVO A;  1NGH A;  2GWJ A;  1NM1 A;  3SK3 A;  5KQ8 A;  1ATN A;  2I7P A;  4FWO A;  4JHD B;  1SAZ A;  2A5X A;  3GG4 A;  2P9N B;  3C7N B;  5AQJ A;  5EVZ A;  5AQY A;  3FE1 A;  3CHW A;  1J6Z A;  2ASM A;  2PAV A;  2Q1N A;  5FPM A;  2D0P A;  3SMP A;  3CQY A;  4EFH A;  4FSV A;  3LM2 A;  2A6A A;  4E1J A;  5AQU A;  3G25 A;  2FSJ A;  4CD1 A;  2CH5 A;  4BRH A;  5AZI B;  3ZEU A;  3AAR A;  2QWL A;  3FLC O;  3RSE A;  2VWB A;  1NWK A;  3QML A;  3A5M C;  4CBX A;  3TPQ A;  1X9J A;  1GLD G;  2A41 A;  5EX5 A;  3M6G A;  4XH1 A;  3VEX A;  4A2A A;  1HKG A;  4AM7 A;  5FPN A;  3O4W A;  2Q97 A;  3QFP A;  3DXK A;  4BQZ A;  5EY4 A;  2V7Z A;  3LDL A;  4PKH A;  1NGA A;  4WQ5 A;  3EO3 A;  3JXU A;  3BEX A;  3UKU B;  4B1Y B;  3DXM B;  4CZL A;  4B1W B;  3P4I A;  3CET A;  5LJW A;  4GNI A;  3TU5 A;  1E4G T;  4IXC A;  3QFU A;  1QQO A;  1NGG A;  3VEZ A;  1H1V A;  4IO8 A;  3O8M A;  4BRL A;  4BC3 A;  3VF2 A;  5LY3 A;  5I9E B;  3SLC A;  4BRQ A;  3ULE B;  4Z94 A;  2P9L B;  3IDH A;  4K42 A;  3FZL A;  4H5R A;  4A62 A;  1YXQ A;  4BRG A;  4CJ7 A;  1MA9 B;  1T6C A;  3VGM A;  4YDU A;  2VCP A;  3LL3 A;  1S3X A;  2A42 A;  5AFU A;  4FPB A;  4ISF A;  4IWV A;  4BR2 A;  4BRF A;  5AQM A;  3VEN A;  3FZF A;  2FF3 B;  4FO0 A;  1MDU B;  3CQX A;  3DJC A;  1GLC G;  2P9U A;  3DAW A;  4BRM A;  1IG8 A;  5AQF A;  4BRN A;  1ATR A;  5AQR A;  2YJF A;  3MCP A;  1KAZ A;  5JMV A;  2J4R A;  4B1X B;  1EQY A;  1DKG D;  4BG8 A;  4EIA A;  4BRD A;  4PKI A;  3EKU A;  2BUP A;  1HLU A;  2QM1 A;  3GOI A;  4FWM A;  4ISG A;  3VOV A;  3ZEU B;  5E26 A;  4CD3 A;  1G99 A;  3VGK A;  3U4L A;  3KZB A;  4PL7 A;  4BGA A;  1E4F T;  2YHY A;  3EL2 A;  5AQT A;  5LJV A;  4CBU A;  1X3M A;  4MLE A;  1Z05 A;  4JD2 B;  1YAG A;  2NRH A;  1HJO A;  1K8K A;  3WEE B;  4EHT A;  4H03 B;  5KPZ A;  3M3Z A;  5AQI A;  2Q2R A;  3KHY A;  2IVP A;  1TYQ A;  3ZET A;  3U8X A;  2D1K A;  3DXK B;  3CJ9 A;  5BRE A;  3MDQ A;  4FWP A;  3AAP A;  4CZM A;  3SMS A;  3O08 A;  1WOQ A;  3VF4 A;  4H0Y B;  4B9Q A;  2HMP A;  2FSK A;  2ZGY A;  3CIP A;  3MN7 A;  3GBT A;  3H1Q A;  5KPR A;  4WQ5 C;  4M63 C;  2E2O A;  3QDK A;  1QQN A;  1RDW X;  5F1X A;  3ATV A;  5BRD A;  3BP8 A;  1NMD A;  2PBD A;  5JLF A;  1JCF A;  2GEM A;  4CZK A;  1OKJ A;  1QZ5 A;  4I6M B;  2YJE A;  1D4X A;  1HKC A;  2IVO A;  1XC3 A;  3ENO A;  4CZE A;  2OAN A;  2QWQ A;  5BPL A;  1QQM A;  5CE3 A;  4CZJ A;  1IJJ A;  3WXL A;  2V52 B;  4YDU C;  2FLO A;  5KQD A;  2AP1 A;  5EOY A;  4ISE A;  3QIC A;  4DHY A;  4WQ4 C;  4RTF D;  3B8A X;  3JS6 A;  3AAQ A;  2P9U B;  5BRF A;  5AQG A;  3D2F A;  4QS9 A;  1ATS A;  3D2E A;  3HTV A;  4PKG A;  4J8F A;  4CZH A;  1QZ6 A;  4O5F A;  3CJB A;  3GE1 A;  4B1V A;  4BR9 A;  1NGI A;  4O8K A;  1R59 O;  1GLL O;  1ESV A;  1BDG A;  3QBW A;  1C0G A;  4FWS A;  2A40 A;  3ATU A;  4BG9 A;  4BQL A;  4AM6 A;  4MLH A;  1BWF O;  2P9S B;  1BUP A;  1P8Z A;  2QWN A;  1K8K B;  1YVN A;  3UKR A;  4XH4 A;  1TYQ B;  2QW9 A;  4IJA A;  3ZET B;  5ADX H;  3U9D A;  2F9W A;  3L0Q A;  4FL9 A;  4WYB A;  5TKY A;  3W0L A;  4WQ4 A;  4A2B A;  3LDN A;  1ZBS A;  4QS7 A;  1ZXO A;  2P9N A;  5BRH A;  3MK6 A;  4FWN A;  2V7Y A;  5E84 A;  3CJ1 A;  3IUC A;  5AQS A;  4JN4 A;  2E8A A;  3FZH A;  1HUX A;  4FPA A;  1QHA A;  4CZG A;  2W41 A;  1NGJ A;  1T44 A;  4BR5 A;  1BOT O;  4GY2 B;  4JAX A;  3ZX2 A;  5JLH A;  1NGD A;  3H46 O;  2HOE A;  2GEL A;  2DPN A;  2P9I A;  5AQP A;  3CJ7 A;  2ASP A;  3BF3 A;  2FSN A;  2CGL A;  1BO5 O;  5BN8 A;  2EWS A;  5FPE A;  2QWP A;  2WUS A;  2YHW A; 
#chains in the Genus database with same CATH topology
 3NDK A;  3S41 A;  3SYZ A;  3VET A;  4K41 A;  2QXL A;  4BC2 A;  3L2Q A;  3TAB A;  2B6A A;  3LZJ A;  3SPZ A;  4IBN A;  2DFE A;  1T7P A;  3V1O A;  2UXD K;  3D2F B;  2ZJQ L;  2OA8 A;  4YOY A;  5GAG P;  1DGK N;  4J2D A;  3OYM A;  5GIO A;  1MWK A;  3QET A;  2E1Y A;  4K43 A;  2RHK A;  4BVP A;  4FW2 A;  4FWL A;  1RCH A;  2O8F B;  4XIU A;  1S1U A;  3FR0 A;  3R3L A;  3KVG A;  1EKE A;  4OKE A;  4F3T A;  1XNQ K;  4DTR A;  1FJG K;  3OYC A;  4KPY A;  3W3D A;  3SQ4 A;  2WTU A;  2W40 A;  3CD6 N;  3QIP A;  3K2P A;  3HPH A;  5AZJ A;  4FWK A;  4F9O A;  1VSI A;  3VQ5 A;  4Y0W A;  4ELU A;  1EXQ A;  4H0O A;  3TTF A;  3BGR A;  2HHS A;  4CJL A;  4ZTJ A;  5CZ1 A;  3RRH A;  2HVH A;  4PL8 A;  1WBB A;  3CME N;  4E1N A;  3M8Q A;  3V9W A;  2NRR A;  3PX6 A;  3R8E A;  3RTV A;  4IG0 A;  1I3A A;  1JLA A;  3AVI A;  4QCL A;  2QWM A;  3OYK A;  5K14 A;  3LAK A;  4FM2 A;  4IDK A;  3P39 A;  2GUP A;  2E2N A;  1NK0 A;  2YHX A;  4DCH A;  4Z4C A;  1CZA N;  2VG7 A;  5M1O A;  3S3M A;  4PHT X;  4OJR A;  1LOT B;  4OGE A;  3AVH A;  3L2V A;  3A5O C;  3WNG A;  3RRG A;  1OH8 A;  3WXK A;  4NCA A;  1U4B A;  1U2V B;  2GV9 A;  3FZK A;  1HQE A;  3AGR A;  5BR8 K;  1LW2 A;  1NK4 A;  2ITG A;  3CJC A;  4BWM A;  3HBT A;  4I6M A;  4E7I A;  4CW7 B;  1VQ7 N;  1B92 A;  4BRI A;  5AZI A;  1SQK A;  4EP4 A;  3LWM A;  1L3U A;  2GTD A;  4FLW A;  3IAY A;  2KQ2 A;  4NB4 A;  3CCQ N;  3ENB A;  1VQN N;  1JCG A;  3OHR A;  3M8R A;  3KJV A;  1SKW A;  2IVN A;  4HWI A;  3CCS N;  5C0Y A;  3THW A;  4B8A B;  3I8D A;  5HRN A;  4YOU A;  3OBY A;  4BR0 A;  4CEE A;  4CHZ A;  4JI5 K;  4DTX A;  4IFY A;  4BC5 A;  3QNN A;  4C8L A;  3ALY A;  3M5R A;  3M8P A;  5A2Q O;  4KI6 A;  5JIC A;  3K5N A;  3ISN C;  3WQU A;  3A5N C;  3UKU A;  2QWR A;  3DXM A;  4FZY A;  4H0T B;  1YHQ N;  3L3V A;  2VWK A;  3D2E B;  3TWH A;  5EU7 A;  3NF6 A;  4LFB K;  3IFR A;  2YKN A;  5AQL A;  2P9P B;  2RPI A;  1YUW A;  4AHS A;  3QBX A;  4YNQ A;  3TAG A;  5JVH L;  2OYQ A;  3DMJ A;  3FZM A;  3VTI A;  2IGI A;  4B1U B;  5AQV A;  3VPZ A;  4JKG B;  4E19 A;  2E6M A;  5C24 A;  3HM9 A;  5ELZ A;  4EAH D;  1LWF A;  1BU6 O;  1EET A;  3WNH A;  4FLV A;  4ILJ A;  3ZX0 A;  3FGU A;  4BVO A;  2QXF A;  3R9P A;  2GWJ A;  3V9Z A;  3PSF A;  4FWO A;  4JHD B;  4CJT A;  3GG4 A;  1WSF A;  3VQB A;  4DSL A;  4JI0 K;  1JLQ A;  3K5M A;  4BE2 A;  3K5O A;  2PAV A;  1OH7 A;  4FJM A;  3SMP A;  4DTN A;  3CQY A;  1GOA A;  2Z1J A;  3TSU A;  1RBR A;  3VQD A;  4FSV A;  1RDB A;  3BDP A;  1JL1 A;  1VQ4 N;  4FZZ A;  1K73 O;  3WNE A;  1NKB A;  4DSJ A;  3SQ0 A;  4BRH A;  4CEA A;  4LFA K;  3FLC O;  2VWB A;  3AO1 A;  4CBX A;  2VG5 A;  1ZBL A;  1GLD G;  5EX5 A;  3M6G A;  1U45 A;  4DLG A;  2BH1 A;  4XH1 A;  3VEX A;  4A2A A;  1HKG A;  5FPN A;  3C65 A;  2F7T A;  3HT3 A;  4WE1 A;  1K6Y A;  4BQZ A;  3CC4 N;  1VQ8 N;  3EYZ A;  4DFJ A;  3TTD A;  1JLB A;  4W5Q A;  3AV9 A;  3VQQ A;  3BEX A;  4B1Y B;  1VSD A;  3AVM A;  4CZL A;  5LJW A;  3AO4 A;  4IXC A;  3OVN A;  1H1V A;  4IO8 A;  2HHU A;  3E1Y A;  3J80 O;  3O8M A;  1YI2 N;  3KLE A;  3ZLJ A;  2VG6 A;  3VQ9 A;  4CF8 A;  5LY3 A;  4MFB A;  5I9E B;  3SLC A;  4Z4I A;  4HUG A;  2P9L B;  4K42 A;  4A62 A;  3FZL A;  4CJF A;  2NRV A;  3NVK A;  1FKO A;  1QSL A;  1YXQ A;  1HR0 K;  4CJ7 A;  1T6C A;  3VGM A;  4CJK A;  3VQ4 A;  4KAZ A;  3ZSV A;  4OGC A;  1Q9Y A;  4KFB A;  4FPB A;  4ISF A;  4PA1 A;  5SWM A;  1WBD A;  4DR6 K;  1T8E A;  4BR2 A;  4BRF A;  2FC0 A;  4KH4 A;  3FZF A;  4FO0 A;  1KVB A;  5JVG L;  4JLH A;  4QOZ B;  4FJI A;  1LW0 A;  3S9H A;  4OPJ A;  4FLT A;  5AQR A;  3MCP A;  1BQN A;  4CEF A;  1KAZ A;  4DV3 K;  4KRE A;  3OYJ A;  4O44 A;  5FRN A;  4KO0 A;  4B1X B;  4CFD A;  4Y1D A;  1BIS A;  3KWG A;  2HNZ A;  4FM1 A;  3GOI A;  4CD3 A;  3KK7 A;  3CCR N;  4DQQ A;  4UY8 O;  1KFD A;  4PL7 A;  1QQC A;  2YHY A;  5LJV A;  1X3M A;  4MLE A;  2JLE A;  5HBM A;  2NRH A;  1K8K A;  4PUO A;  5KPZ A;  5AQI A;  3V9U A;  2Q2R A;  5J1E A;  3KHY A;  3VQ7 A;  4FK4 A;  4B3T K;  3U8X A;  4C8N A;  1JKH A;  5BRE A;  3NF8 A;  4KRF A;  1X9M A;  3PUF A;  4YHH K;  4B9Q A;  5J2M A;  4FCY A;  4LH5 A;  3GBT A;  3O9R A;  3NF9 A;  2YV0 X;  3CF5 L;  1D8Y A;  4PQU A;  4WQ5 C;  1U47 A;  3RMA A;  2E2O A;  1NJY A;  3QDK A;  3I0S A;  4DFP A;  4DU1 A;  4C8K A;  2IC3 A;  3SUO A;  4KHU A;  4F4K A;  3Q7C A;  1I39 A;  4CZK A;  4I6M B;  1EO1 A;  2KTQ A;  4LY7 A;  3HL8 A;  4CF0 A;  4KHN A;  5J2Q A;  2WON A;  1WSI A;  1C6V A;  1VQ5 N;  4DR2 K;  2YNH A;  1BIZ A;  4AHV A;  3WXL A;  4YDU C;  1RT1 A;  3SAG A;  1IKV A;  1WN7 A;  2FBT A;  3B8A X;  1IBL K;  2P9U B;  5AQG A;  3D2F A;  4U67 L;  4CZH A;  3CJB A;  4EP5 A;  5M1P A;  3LP0 A;  3TTC A;  5JS1 A;  1X9W A;  1R59 O;  3CXC M;  1ESV A;  1BDG A;  2A40 A;  1VQP N;  4OKK A;  1YF5 L;  4MLH A;  1BGX T;  1BHL A;  2O8F A;  3KLH A;  1Q82 O;  4JYA K;  3PO4 A;  4XH4 A;  4YOR A;  4CIF A;  4WYB A;  3LP3 A;  2YNI A;  2YX6 A;  4OLA A;  4E7K A;  4LF9 K;  1ZBS A;  4MDB A;  5GIN A;  1NMN A;  4AHC A;  3MK6 A;  2V7Y A;  1HNX K;  4DTJ A;  3TAP A;  1HYS A;  2E8A A;  3AVK A;  1HUX A;  1LWC A;  3BY5 A;  4CZG A;  3MWP A;  3MED A;  2UUC K;  1T44 A;  5JLH A;  3AA3 A;  3DLB A;  1YT3 A;  1WAJ A;  4DFK A;  1NG9 A;  2OPP A;  2CGL A;  5M1N A;  1IV0 A;  5HOO A;  1SKR A;  2EWS A;  4JKA A;  4DR3 K;  4DTP A;  2D0C A;  2YHW A;  2QK9 A;  4CFB A;  1NKE A;  1X9S A;  4CEO A;  1NK9 A;  1EWQ A;  5BN9 A;  3A0I X;  5HLF A;  3OTO K;  1W2B M;  4M7X A;  4W5T A;  3V9X A;  3J8A A;  4CBW A;  4E1M A;  4UQG A;  2DY4 A;  1RT7 A;  1YJW N;  4K8Z A;  1KXP A;  3T7Z A;  3A8Y A;  3OY9 A;  1A5W A;  5AQH A;  2Q36 A;  3D6R A;  4EHU A;  1GLA G;  3V6D A;  4DB3 A;  1BG3 A;  1U2V A;  3SQ2 A;  3O9T A;  4AH9 A;  4CEB A;  4HTL A;  3TAE A;  5E41 A;  1XUP O;  3R6M A;  3OS1 A;  4FZX C;  4DV7 K;  5J2P A;  4DSI A;  1TL3 A;  4Q5V A;  2G8I A;  4DSK A;  3CER A;  2F8T A;  4IOX A;  1L3S A;  3F2K A;  1YIT N;  5AQK A;  3NMU A;  1NJZ A;  3H45 C;  1X3N A;  2Q31 A;  4JI2 K;  1NK8 A;  3VER A;  4Z4H A;  4CF9 A;  3NVM A;  3P31 A;  2H3G X;  5FLX O;  3KLG A;  3O80 A;  1QVF M;  2KZM A;  3L4I A;  4LSN A;  1NBW A;  2D4W A;  5B8H A;  2XO7 A;  4O8U A;  4E7L A;  3MXM A;  3L4Q A;  2NZT A;  3DOK A;  3O1W A;  3KLI A;  2VQE K;  1IO2 A;  1TK0 A;  4B08 A;  2WBN A;  4CGF A;  1C0F A;  2FBY A;  5MLC Q;  3M8S A;  2P9P A;  3ZSR A;  3NF7 A;  2BTF A;  1JLF A;  1DTT A;  1UOC A;  3TAM A;  2FBV A;  4CZF A;  3WEE A;  1S1V A;  1IBM K;  3ZT2 A;  2OPS A;  1U49 A;  3QB0 A;  2ASO A;  3BUZ B;  4B9M A;  4DU4 A;  3CI5 A;  1KAY A;  5F0X A;  5DMR A;  2QKB A;  1N33 K;  2EHG A;  5ADX A;  4IFE A;  1RTH A;  3LDO A;  2KFZ A;  3PO5 A;  4JHD A;  1NGB A;  3LM9 A;  4H0V B;  4CJP A;  4DTS A;  4C8M A;  1RGI A;  3TR8 A;  3HVR A;  4H4M A;  3PSI A;  2E20 A;  4IFV A;  3TAR A;  3AVJ A;  4GKK K;  3OA9 A;  3PY8 A;  2HBK A;  5C2F A;  1T05 A;  3ZX3 A;  3LDP A;  5AQQ A;  4JNE A;  4RW9 A;  4BRO A;  3CC2 N;  2GX9 A;  1BCO A;  4DQ8 A;  1UA0 A;  3CCU N;  1QS4 A;  3VQ6 A;  2YNG A;  5I3U A;  3PX4 A;  3QER A;  3O6W A;  1FK9 A;  1HRH A;  2ATQ A;  4FWQ A;  2A1S A;  4OO1 J;  2ZGZ A;  3K58 A;  4OKJ A;  4BGB A;  4CHO A;  4X65 K;  3EY1 A;  2UXB K;  4H5V A;  1HKB A;  2P9K B;  4EZ9 A;  1KAX A;  2QKK A;  1EP4 A;  3AO3 A;  2NUB A;  3LAN A;  3ZSQ A;  2G8K A;  1RBT A;  4KHY A;  3O9Q A;  1LAV A;  4JKD A;  3VQE A;  3I56 N;  3AVB A;  4A5A A;  3C6T A;  1FXX A;  5CY4 A;  4M3Z A;  2P9L A;  5KGW A;  1XMO K;  2Z1G A;  1A5V A;  4I2Q A;  3D7E O;  3V9S A;  4CHY A;  2KLA A;  3CM6 A;  3V4I A;  5SZT A;  1Q18 A;  3A5L C;  2QA4 N;  1OVQ A;  1NK6 A;  1MU2 A;  1S9E A;  2I7N A;  4CZI A;  2G8H A;  4CJW A;  1W97 L;  4DUY K;  3THY B;  1VSF A;  3OYL A;  1NGH A;  5KQ8 A;  4N5S A;  3NH1 A;  5KI6 A;  4K8X A;  2BGG A;  2JWL A;  1SAZ A;  1YJ9 N;  2ZJP L;  3C7N B;  1HPZ A;  2Q1N A;  3EE8 A;  4EFH A;  1WSH A;  5C10 A;  2NRW A;  1KVC A;  1QVG M;  3N4Q A;  3HPG A;  3AVC A;  3ZSY A;  1C0M A;  1RTJ A;  3G25 A;  4E1J A;  2FSJ A;  4CD1 A;  4KHW A;  4W5O A;  4ELV A;  1JXB A;  3AAR A;  4CIG A;  1CXU A;  3U3Y A;  4A57 A;  3QML A;  3A5M C;  1B9F A;  1WLJ A;  4NYN A;  2P51 A;  1X1P A;  3QIO A;  4AHU A;  3IKM A;  2EX3 A;  5KTQ A;  3O4W A;  3QFP A;  3HVT A;  4K0K K;  3L3U A;  4BY9 C;  1P90 A;  2V7Z A;  1VQO N;  1NGA A;  2B5J A;  4I9L A;  3JXU A;  3T3F A;  2AJQ A;  4DQR A;  4B1W B;  1RBS A;  3QFU A;  1NGG A;  4EZ6 A;  2ZJR L;  4BC3 A;  4KHP K;  4O0J A;  4JI8 K;  4Z4G A;  4LF8 K;  4H5R A;  3QES A;  2XY7 A;  1MA9 B;  3SBT A;  1E3M A;  2VCP A;  4HUE A;  4WFA L;  4AHR A;  1S3X A;  5AFU A;  4AQY K;  3QEV A;  3LP2 A;  3R1X A;  3THV A;  2HVI A;  3P5J A;  4CGJ A;  3NGY A;  1BQM A;  1GLC G;  2P9U A;  4BRM A;  4JRQ A;  4BRN A;  2YJF A;  3SV4 A;  3I55 N;  2VGM A;  1TGO A;  3L2W A;  1DKG D;  4EIA A;  3ZEU B;  4JI6 K;  4FWM A;  3VOV A;  5E26 A;  3ZYY X;  1G99 A;  3MX2 A;  3O4Q A;  5GIP A;  4E7J A;  4CK2 A;  3ZCM A;  2NRT A;  1JLG A;  4C1N I;  1HJO A;  3WEE B;  2VWJ A;  3M3Z A;  3LWL A;  4CJ3 A;  2IVP A;  5HRS A;  4CED A;  3DXK B;  4M3U A;  3SMS A;  2D0A A;  4WF9 L;  3VF4 A;  3AA2 A;  4H0Y B;  2OPQ A;  2FSK A;  3CCM N;  1Z26 A;  3MN7 A;  4KKO A;  4CJQ A;  4CGG A;  2ZQB A;  2Y1J A;  2ZE2 A;  1CLQ A;  2RF2 A;  1QHT A;  3CFR A;  4YFU A;  4DR5 K;  1NOZ A;  5F1X A;  3ATV A;  3NGZ A;  1WAF A;  1NMD A;  4RW7 A;  2F96 A;  2X6N A;  2PBD A;  4JS4 A;  1QZ5 A;  1HYV A;  2IAJ A;  4DWI A;  1RT2 A;  4DR4 K;  4LH4 A;  3AVA A;  3DRS A;  1XC3 A;  4CZE A;  4OPK A;  1QQM A;  2ZD1 A;  1L5U A;  1D9F A;  3CCJ N;  2V52 B;  5M1F A;  1KRP A;  3AA4 A;  2FLO A;  2YHB A;  4CJR A;  4FLZ A;  5EOY A;  3TI0 A;  2UUA K;  4DHY A;  4WQ4 C;  4CHN A;  4RTF D;  3VQP A;  1S1T A;  2ZM6 K;  4QS9 A;  3NH0 A;  4B8C A;  3HTV A;  4ID1 A;  4KB1 A;  4J8F A;  1VRU A;  1QZ6 A;  4JS5 A;  2O4G A;  3KK2 A;  3D45 A;  2R7Y A;  4X66 K;  3NH2 A;  5C42 A;  4O8K A;  3SJJ A;  4CJS A;  1GLL O;  5CZ2 A;  2PFU A;  2YHA A;  4FWS A;  1C0G A;  1YIJ N;  1KLM A;  2O8D B;  3SZ2 A;  5AJ3 K;  3KWI A;  3SCX A;  4DLE A;  1BWF O;  1VHX A;  2UUB K;  5C2D A;  3PIP L;  2QWN A;  1QE1 A;  5HRO A;  4M3W A;  3UKR A;  1KVA A;  1C0T A;  3ZET B;  5ADX H;  3L0Q A;  3BZC A;  3N4P A;  3WXM B;  4IEI A;  5TKY A;  4WQ4 A;  4IG3 A;  4Y1C A;  4CE9 A;  2P9N A;  4FLX A;  1FKP A;  5E84 A;  4E0D A;  4WFN L;  3DLH A;  2Q3S A;  1C1A A;  4JN4 A;  3I0R A;  3A2F A;  4FPA A;  1Q8I A;  3FFI A;  3OYE A;  3EEQ A;  1BOT O;  1ZBF A;  1O13 A;  4GY2 B;  4LF7 K;  4JAX A;  1OH6 A;  4Q0B A;  2X78 A;  1RIL A;  1N5Y A;  3OBW A;  4Z4F A;  4NLB A;  1RDC A;  2FSN A;  2OTJ N;  5BN8 A;  4WCE L;  3MEG A;  4DF8 A;  5FPE A;  2E88 A;  2WUS A;  3C0B A;  2VYP A;  3C6A A;  5KPT A;  1NNE A;  1WSJ A;  3KLF A;  4G9Z A;  4CEQ A;  4JKB A;  1XWL A;  2QWO A;  1YJN N;  2A3Z A;  2AA4 A;  1IKY A;  2E2P A;  1LCU A;  3E9P A;  3L6Q A;  1HYZ A;  3ZSX A;  1Q9X A;  4BC4 A;  3IS9 A;  4RWT A;  2ZWH A;  1L3T A;  4JEP A;  1J5E K;  5TKW A;  4MO4 A;  1WUA A;  3DM2 A;  1GLF O;  5AQO A;  4BRC A;  1S22 A;  4NO7 A;  5C15 A;  2BDP A;  2GWK A;  1RT3 A;  3UIQ A;  2YNF A;  3HXM A;  1W7A A;  3HJF A;  2UYT A;  2CGJ A;  4YOT A;  4FJX A;  2ZF5 O;  2W42 A;  4CHQ A;  4B3S K;  3H1V X;  5AQZ A;  2YCH A;  4CJV A;  3ZSZ A;  2HHQ A;  1LWE A;  3AY9 A;  3LDQ A;  3T1Y K;  4JI3 K;  3OYI A;  5F2R A;  3VGL A;  4M3X A;  4N41 A;  4B9T A;  4CEC A;  2F8S A;  4BR4 A;  2E5L K;  3T1A A;  1S1W A;  2P5O A;  3ENH A;  4FVU A;  3CFO A;  4KI4 A;  4BRE A;  3MXI A;  3MN9 A;  2O4I A;  4RG8 A;  3SAH A;  1DEJ A;  1ZC6 A;  2NLX A;  2IIR A;  3VQC A;  2P9K A;  4M7Y A;  1J54 A;  2WOM A;  4J2E A;  2F9T A;  5BPM A;  3E9O A;  3RR8 A;  3HO1 A;  1Y64 A;  2P9I B;  2OZS A;  1RT4 A;  1BA1 A;  1HPM A;  4DU3 A;  3KKR A;  3GDQ A;  5JS2 A;  3HOS A;  2Y1I A;  2YI1 A;  4H8K A;  1J5O A;  1VSJ A;  4XEI A;  2ETJ A;  5M1K A;  3C6H A;  4FWR A;  4W5N A;  3BZK A;  2NRZ A;  3J7Z O;  1GLB G;  5J2N A;  1HNI A;  1SZ2 A;  1HX1 A;  3H6E A;  3K57 A;  4IO9 L;  5HRP A;  4FJN A;  1ASU A;  3THY A;  1VRT A;  4RW4 A;  4BRP A;  3G0Z A;  1SL2 A;  1TUY A;  1GOB A;  4H0X B;  3WNF A;  3C7N A;  3CJA A;  4FM0 A;  4HTU A;  4BRA A;  3G4S N;  3ID6 A;  4O55 A;  3QEX A;  3DI6 A;  2HBJ A;  4AHT A;  1ZBU A;  3RVC A;  3LPU A;  3I33 A;  4OPA A;  4X64 K;  4L3Q A;  3NGI A;  5AQW A;  1S72 N;  5EXW A;  4KV8 A;  4ICL A;  5AFU H;  1W0H A;  5BPN A;  1ASV A;  3S3O A;  1UAX A;  4JK9 A;  4CI6 A;  4M3Y A;  4E3S A;  3VES A;  1Z25 A;  4B9V A;  3MWT A;  3O1B A;  4FJ8 A;  1KLN A;  3UE5 A;  4C23 A;  2E2Q A;  3MEE A;  4FOE A;  1SKS A;  1IKW A;  1C0U A;  3OYF A;  3I8B A;  4DUZ K;  1TKT A;  2RKI A;  1HQU A;  3CG7 A;  3DLE A;  1K9M O;  2X74 A;  3IMX A;  3WXJ A;  3U3G A;  3RMD A;  4FVM A;  3EZW A;  4DS5 A;  2DFF A;  2QEX N;  5FPD A;  3T19 A;  1V4S A;  3HM8 A;  4XH5 A;  1K8A O;  1ILY A;  1QSY A;  3C6U A;  4YY3 K;  2V51 B;  3VMF B;  3K5L A;  4DR1 K;  3CYM A;  1QSS A;  2Q0R A;  1GLE G;  1B9D A;  5DM7 L;  4N47 A;  3SPY A;  4A59 A;  1YVU A;  3UKR B;  3ZSO A;  4FJ9 A;  3ZT3 A;  3J7A P;  5CR4 A;  4LC9 B;  1NM1 A;  3SK3 A;  1ATN A;  4DV5 K;  3U6F A;  4F8R A;  2P9N B;  1YTA A;  5EVZ A;  3CHW A;  3LPT A;  5FRM A;  2OPR A;  1S6P A;  1OVY A;  3MEC A;  5AQU A;  3RMC A;  1ITG A;  3CMA N;  3ZEU A;  4CJ4 A;  3CPW M;  4FJJ A;  1S5J A;  2QWL A;  5HRR A;  4DR7 K;  3RSE A;  1LV5 A;  3J81 O;  1W9H A;  4O0I A;  4B3M K;  4DF4 A;  3TPQ A;  1S1X A;  3LAL A;  2A41 A;  4O4G A;  4AM7 A;  3SV3 A;  3DXK A;  1QTM A;  3MX5 A;  5EY4 A;  4IDH A;  1KFS A;  4JV5 K;  3NFA A;  1RT6 A;  5CYQ A;  3SUP A;  3RR7 A;  1E4G T;  3AA5 X;  4N56 A;  4W5R A;  2HHW A;  1QQO A;  4CGH A;  1NJX A;  2P1J A;  4DTO A;  4HCC A;  1ZBI A;  4DV4 K;  1GOC A;  1VSM A;  3QLH A;  1DLO A;  3F9K A;  4FJK A;  4GKJ K;  4YOX A;  4BRQ A;  4FLY A;  5KRS A;  3IDH A;  4HVJ A;  1VK0 A;  1BIU A;  1TK8 A;  3LL3 A;  2WFB A;  4CCH A;  1DTQ A;  5AQM A;  1JXE A;  4G1Q A;  3VEN A;  4JK7 A;  2FF3 B;  3KD1 E;  1MDU B;  1N8R O;  2BAN A;  1XI1 A;  4DV1 K;  3DJC A;  3DAW A;  4NYF A;  3C94 A;  5AQF A;  1ATR A;  4ILH A;  3OS0 A;  4H4O A;  5C25 A;  1UWB A;  1S6Q A;  3KKS A;  3T69 A;  1EQY A;  2O8C A;  1U48 A;  4PKI A;  2BUP A;  4ISG A;  3OYA A;  2O8B B;  1KC8 O;  2LSN A;  1SL1 A;  3VGK A;  3U4L A;  4J2B A;  2O8D A;  4JI7 K;  3K59 A;  3OW2 M;  1E4F T;  5AQT A;  3MCA B;  3SUQ A;  1YAG A;  3MXJ A;  3CCL N;  1VAZ A;  3SBG A;  4EHT A;  4DQP A;  4KHS A;  3ZET A;  2D1K A;  3LZI A;  3CJ9 A;  3K0S A;  3MDQ A;  4FWP A;  2G8F A;  4CZM A;  1WOQ A;  3MAQ A;  4GVM A;  3CIP A;  4HUF A;  1NKC A;  4NCG A;  3SQ1 A;  1TV6 A;  3P1G A;  3QIN A;  5KPR A;  2HHX A;  5T7B A;  5H1S Q;  4M63 C;  4CJU A;  1C1C A;  4CJE A;  1RDW X;  3O4N A;  2DTU A;  3AVF A;  5BRD A;  3BP8 A;  3G71 N;  4KB0 A;  4KTW A;  3KK1 A;  2O8E A;  3DLK A;  1XMQ K;  3QEI A;  3E66 A;  2GEM A;  3LP1 A;  1HKC A;  3AO2 A;  4DQI A;  3F5T A;  4WFB L;  4FK2 A;  3ENO A;  4E7H A;  2OAN A;  5BPL A;  1HMV A;  1REV A;  2HST A;  1IJJ A;  4DKW A;  4HHT A;  4ISE A;  5FDL A;  5GAE P;  3HRG A;  3JS6 A;  3ZSW A;  1A5X A;  4FJ7 A;  1RT5 A;  5BRF A;  1ATS A;  4PKG A;  2X6S A;  3ASM A;  1NU0 A;  1J53 A;  1M1K O;  2FBX A;  3THX B;  1NGI A;  2JWK A;  4JK8 A;  3QBW A;  4CES A;  4BQL A;  4FJL A;  5DM6 L;  2UXC K;  2KW4 A;  3S3N A;  3CM5 A;  1YVN A;  1TYQ B;  2QW9 A;  4GW6 A;  1T3V A;  2F9W A;  3HP9 A;  4R5P A;  1F21 A;  4B9L A;  1XC9 A;  4B9U A;  3LDN A;  4QS7 A;  1Q7Y O;  5BRH A;  4DG1 A;  3IUC A;  2WC9 A;  3HK2 A;  4IEE A;  4CF2 A;  4I7F A;  1WNS A;  3FZH A;  2XY8 A;  3NE6 A;  1J9A A;  4BR5 A;  3B6P A;  4GV3 A;  3ZX2 A;  2E4L A;  1NGD A;  1TKX A;  3H46 O;  1R0A A;  2HOE A;  1SS6 A;  4L8R B;  1CZ9 A;  3DLG A;  2DPN A;  4DV2 K;  4IKF A;  1SV5 A;  3QEW A;  2P9I A;  5LL6 Z;  1IBK K;  1D9D A;  3V1R A;  4M42 A;  4DTU A;  4CK3 A;  3RSE B;  2PYL A;  5D3G A;  3ITH A;  3EKS A;  4MQ3 A;  3VA0 A;  3H3O B;  2FF6 A;  2PY5 A;  4M45 A;  4ZTF A;  2NNW A;  1I94 K;  4KH5 A;  3WQT A;  4I9Q A;  3UB5 A;  2PZS A;  4DMN A;  5AR0 A;  1NLV A;  1SUQ A;  2G8V A;  3GL1 A;  4CJ5 A;  4RCH A;  2FXU A;  4HCB A;  4A61 A;  3VF6 A;  3VEV A;  4YOV A;  3L2R A;  3MN5 A;  1NJW A;  1VSE A;  2CGK A;  4E89 A;  2P5G A;  4CFA A;  2DFH A;  4BWJ A;  3ULE A;  3HYF A;  3FFK B;  4LF6 K;  2Z1I A;  2HF3 A;  1O1W A;  4MO5 A;  3E9L A;  1M90 O;  3DLR A;  4DV0 K;  3HZ6 A;  3F9M A;  3BF1 A;  4X62 K;  3JYT A;  3AVG A;  1L3V A;  3WT0 A;  1TK5 A;  1NGF A;  2XHB A;  4ZHR A;  5BR9 A;  3DOL A;  5LMN K;  1WSE A;  3HSC A;  2D0O A;  2GUI A;  3Q7B A;  1S9G A;  1XQS C;  3WXI A;  3JSM A;  3VQA A;  2IOC A;  1JL2 A;  4K25 A;  1VQL N;  4IOC L;  3U9Z A;  3OYD A;  4H5T A;  4KH6 A;  4N76 A;  1JCE A;  3VEW A;  4V19 S;  1NGC A;  2RE2 A;  1HNV A;  3ID8 A;  3JAM O;  1NOY A;  2E1Z A;  4IJN A;  2ITM A;  3RWU A;  1NK5 A;  2O8C B;  4CEZ A;  4JD2 A;  4PY5 A;  1BI4 B;  1ZYQ A;  5AQN A;  4B1Z A;  3VN5 A;  4DS4 A;  3VEO A;  4DV6 K;  1HNZ K;  4FW1 A;  1Z6R A;  4KBO A;  2QI2 A;  3OYH A;  4BDY A;  3DLL L;  1TKD A;  3MN6 A;  4CK1 A;  3TSP A;  3HI0 A;  3EN9 A;  3HP6 A;  4H5W A;  1ASW A;  5LMU K;  2HW3 A;  4ILG B;  3TAF A;  1WSG A;  3KTQ A;  2HHT A;  4CGD A;  3TAQ A;  4B3R K;  2HBM A;  2IS3 A;  3D0P A;  4MDA A;  4KTZ A;  4JKH A;  3CQ8 A;  4DSE A;  2D0B A;  3O5B A;  1D5A A;  5IWA K;  4H5N A;  1VQM N;  3TSQ A;  3H3N O;  2CH6 A;  1VQ9 N;  1VQ6 N;  2Q0U A;  3F73 A;  4R79 A;  1TVR A;  4B9N A;  4KTQ A;  4F2S A;  2A1R A;  1KQS M;  2O8E B;  1RBV A;  4JI4 K;  1CZB A;  4DSF A;  3J7Y P;  3SJH A;  1N36 K;  5IT9 O;  3CPE A;  4BR7 A;  4DFM A;  3ZT0 A;  1Q86 O;  3H08 A;  4QAG A;  4J2A A;  4H0P A;  5AZJ B;  3SNN A;  1RTD A;  1RFQ A;  4JKE A;  4FJ5 A;  2F4V K;  1C1B A;  3OYG A;  2W6K A;  4I2P A;  4FOI A;  3DWL A;  4LF5 K;  4A5B A;  4BRK A;  4JRP A;  4NXM K;  4IOA L;  3VEY A;  4B3O A;  3B6O A;  1Q81 O;  2HB5 A;  3M1F A;  3MMV A;  3OYB A;  1WB9 A;  1KD1 O;  1N6Q A;  2I5J A;  2P9S A;  4IZ9 A;  4C1N K;  1U04 A;  3NCI A;  4QS8 A;  3RMB A;  4CGI A;  3CC7 N;  1FW6 A;  1RNH A;  2XRI A;  2KHO A;  1DT9 A;  1KTQ A;  1GLJ O;  3O3G A;  1BA0 A;  4OPH A;  4BDP A;  1U6Z A;  1V4T A;  2G8U A;  1MWM A;  5CHI A;  3WUH A;  5AQX A;  3ULD A;  1NGE A;  1TUU A;  2NRX A;  1XHZ A;  4BE1 A;  1T6D A;  2HF4 A;  3IG1 A;  4LSL A;  4CVN E;  3DRR A;  5HP1 A;  2I7P A;  3DRP A;  2A5X A;  4FJH A;  2B4J A;  1TAU A;  5AQJ A;  1ZBH A;  1YTU A;  4OX9 K;  5AQY A;  3FE1 A;  1J6Z A;  2ASM A;  5FPM A;  5C12 A;  2D0P A;  4CF1 A;  3OYN A;  2QTD A;  3LM2 A;  2A6A A;  1VSH A;  1KCF A;  2CH5 A;  3EZ5 A;  5AZI B;  2O8B A;  4PWD A;  1RDU A;  1HNW K;  4JKC A;  1NWK A;  1XHX A;  1Y97 A;  1X9J A;  4NLC A;  3OJS A;  3CCV N;  4FK0 A;  3SAF A;  3O3F A;  2BE2 A;  3THW B;  3CFP A;  1RTI A;  2VGN A;  4NCB A;  4C8O A;  2Q97 A;  4GMJ B;  2OTL N;  3AGK A;  3LDL A;  4PKH A;  5CYM A;  2KZZ A;  1JLE A;  4WQ5 A;  3ZT1 A;  3EO3 A;  1UA1 A;  3UKU B;  3DXM B;  1TAQ A;  3C95 A;  3P4I A;  3CET A;  4GV6 A;  4GNI A;  3TU5 A;  3L2U A;  3P83 D;  3TAN A;  3VEZ A;  3PLA A;  3EE9 A;  1OH5 A;  4OLB A;  3OJU A;  4DQS A;  4BRL A;  3HST B;  3DYA A;  3KD5 E;  3VF2 A;  3ZT4 A;  2RN2 A;  3P38 A;  3ULE B;  4OVL A;  4Z94 A;  4JKF A;  1NK7 A;  3V1Q A;  4Z4E A;  4BRG A;  1CXQ A;  3NHG A;  1VQK N;  1N32 K;  1RDD A;  2HHH K;  4YDU A;  4F3O A;  4DTM A;  3K9J A;  2A42 A;  1XNR K;  4IWV A;  4U7B A;  4RW8 A;  4M41 A;  5GAD P;  5FRO A;  4NXN K;  3O3H A;  3CQX A;  2GBZ A;  3AO5 A;  1T03 A;  3QEP A;  2D5R A;  4ELT A;  1IG8 A;  3SUN A;  4BAC A;  3AVL A;  5JMV A;  4O5B A;  4FJG A;  2J4R A;  3L8B A;  2PYJ A;  4BG8 A;  3QNO A;  4BRD A;  3OS2 A;  2KFN A;  3EKU A;  2QM1 A;  1HLU A;  3LAM A;  4RW6 A;  4YOW A;  3THX A;  2HMI A;  2HBL A;  3KK3 A;  3KZB A;  3AVN A;  4BGA A;  3EL2 A;  1JLC A;  4CBU A;  4ID5 A;  1Z05 A;  4JD2 B;  4LD0 A;  2UU9 K;  4Z0U A;  3CCE N;  1BCM A;  4FLU A;  4FYD A;  4H03 B;  2KKZ A;  4CFC A;  1TYQ A;  3NAE A;  3AAP A;  1VSK A;  4FXD A;  3O08 A;  4M3R A;  3KIO A;  2HMP A;  1G15 A;  2ZGY A;  4B9S A;  3H1Q A;  4F2R A;  4JI1 K;  3PX0 A;  4M3T A;  2YKM A;  1QQN A;  1IH7 A;  5HL7 L;  4BE0 A;  3LDS A;  1EX4 A;  3VA3 A;  5JLF A;  5KRT A;  1JCF A;  1NJI O;  1OKJ A;  1RDA A;  2YJE A;  1D4X A;  2IVO A;  3NBP A;  1LAW A;  2QWQ A;  5CE3 A;  4CZJ A;  3G6E N;  1SL0 A;  2W6L A;  5KQD A;  2AP1 A;  2JGU A;  1TL1 A;  1TKZ A;  3QIC A;  2HHV A;  3QO9 A;  4LF4 K;  3AAQ A;  3PV8 A;  4BDZ A;  3D2E A;  2OZM A;  4O5F A;  3VQ8 A;  3IRX A;  3O9S A;  2G8W A;  3GE1 A;  3PIO L;  4B1V A;  4CHP A;  3E01 A;  1HJR A;  4BR9 A;  3HPO A;  1VSL A;  2XY6 A;  1JJ2 M;  5I42 A;  1KSP A;  3VTH A;  5GAH P;  2E6L A;  4JKG A;  2HND A;  3ATU A;  4BG9 A;  4AM6 A;  4LFC K;  1N34 K;  2P9S B;  3O9U A;  1EWR A;  1BUP A;  1P8Z A;  1K8K B;  4CIE A;  4IJA A;  4TSX A;  3U9D A;  2Z1H A;  4FL9 A;  3T1H K;  2XY5 A;  3G10 A;  4GVE A;  3W0L A;  4A2B A;  4KHQ A;  4AF1 A;  1ZXO A;  2VQF K;  4FWN A;  3CJ1 A;  5AQS A;  1QHA A;  2W41 A;  1NGJ A;  1RBU A;  4AIL C;  5KGX A;  3SI6 A;  5DK5 A;  2GEL A;  5AQP A;  3K9K A;  2OCE A;  3CJ7 A;  2ASP A;  3V81 A;  3BF3 A;  5M1Q A;  1BO5 O;  1IG9 A;  4GV9 A;  1IKX A;  2HNY A;  2IDO A;  1BL3 A;  1BI4 A;  2QWP A;  3HOT A;  4CER A; 
#chains in the Genus database with same CATH homology
 3RSE B;  3C0B A;  2VYP A;  3C6A A;  5KPT A;  4G9Z A;  5BN9 A;  3EKS A;  3H3O B;  3S41 A;  3A0I X;  2FF6 A;  4JKB A;  1W2B M;  4M7X A;  2QWO A;  1YJN N;  2A3Z A;  2AA4 A;  3VET A;  2NNW A;  4K41 A;  2E2P A;  2QXL A;  4BC2 A;  1LCU A;  3E9P A;  3J8A A;  3L6Q A;  4KH5 A;  3WQT A;  4CBW A;  3UB5 A;  4BC4 A;  1YJW N;  1KXP A;  5AR0 A;  3T7Z A;  1NLV A;  4RWT A;  2ZWH A;  4JEP A;  3A8Y A;  3D2F B;  3GL1 A;  4RCH A;  5TKW A;  2FXU A;  4MO4 A;  1WUA A;  4A61 A;  5AQO A;  1GLF O;  5AQH A;  3VF6 A;  2Q36 A;  3VEV A;  3D6R A;  4EHU A;  4YOY A;  3MN5 A;  1GLA G;  1S22 A;  4BRC A;  4NO7 A;  1DGK N;  5GAG P;  5C15 A;  2GWK A;  2CGK A;  1BG3 A;  4DB3 A;  1U2V A;  5GIO A;  3ULE A;  1MWK A;  2E1Y A;  3FFK B;  2HF3 A;  3O9T A;  4K43 A;  4HTL A;  2RHK A;  4MO5 A;  2UYT A;  4BVP A;  1XUP O;  2CGJ A;  3R6M A;  4FWL A;  4YOT A;  3E9L A;  1M90 O;  2ZF5 O;  3FR0 A;  3R3L A;  3KVG A;  3HZ6 A;  3F9M A;  3BF1 A;  3H1V X;  5AQZ A;  2YCH A;  3CER A;  3WT0 A;  4IOX A;  3F2K A;  1YIT N;  3AY9 A;  3LDQ A;  1NGF A;  5AQK A;  3NMU A;  3H45 C;  1X3N A;  2Q31 A;  5BR9 A;  5F2R A;  3W3D A;  3VGL A;  3VER A;  2W40 A;  3CD6 N;  3HSC A;  3NVM A;  2D0O A;  3P31 A;  5AZJ A;  4BR4 A;  3Q7B A;  2H3G X;  4FWK A;  4F9O A;  1XQS C;  3O80 A;  4Y0W A;  3WXI A;  1QVF M;  3ENH A;  3L4I A;  4H0O A;  3TTF A;  4FVU A;  1NBW A;  4K25 A;  2D4W A;  4BRE A;  3MN9 A;  5B8H A;  4IOC L;  1VQL N;  3U9Z A;  3SAH A;  1DEJ A;  1ZC6 A;  2NLX A;  4H5T A;  4O8U A;  2IIR A;  4KH6 A;  3L4Q A;  2NZT A;  3O1W A;  1JCE A;  2P9K A;  3VEW A;  1NGC A;  4M7Y A;  4PL8 A;  2RE2 A;  2F9T A;  5BPM A;  3E9O A;  3ID8 A;  3CME N;  2WBN A;  1C0F A;  5MLC Q;  2E1Z A;  2P9P A;  4IJN A;  2ITM A;  1Y64 A;  2P9I B;  2BTF A;  2NRR A;  3R8E A;  1BA1 A;  2QWM A;  1HPM A;  4JD2 A;  3HOS A;  3GDQ A;  4CZF A;  5AQN A;  3WEE A;  4B1Z A;  2YI1 A;  3VEO A;  4XEI A;  3P39 A;  5M1K A;  2GUP A;  3C6H A;  2E2N A;  4FWR A;  2YHX A;  3QB0 A;  2ASO A;  4DCH A;  1Z6R A;  4KBO A;  1CZA N;  5M1O A;  2NRZ A;  2QI2 A;  1GLB G;  3J7Z O;  3DLL L;  1SZ2 A;  1HX1 A;  3BUZ B;  3H6E A;  3MN6 A;  4PHT X;  1LOT B;  3CI5 A;  4IO9 L;  3TSP A;  1KAY A;  5F0X A;  3HI0 A;  3EN9 A;  4H5W A;  3A5O C;  5ADX A;  4IFE A;  4ILG B;  3HOT A;  3LDO A;  4BRP A;  3WXK A;  4JHD A;  2HBM A;  1NGB A;  1TUY A;  3LM9 A;  4H0V B;  2ZJQ L;  4H0X B;  3C7N A;  3CJA A;  4MDA A;  4BRA A;  4JKH A;  3ID6 A;  3G4S N;  3O5B A;  1RGI A;  2HBJ A;  3RVC A;  1U2V B;  4H5N A;  1VQM N;  3H3N O;  2E20 A;  3FZK A;  3TSQ A;  2CH6 A;  3AGR A;  3CJC A;  1VQ9 N;  3I33 A;  4OPA A;  1VQ6 N;  2Q0U A;  3HBT A;  4I6M A;  4R79 A;  1VQ7 N;  4L3Q A;  5AQW A;  4BRI A;  5AZI A;  1S72 N;  1SQK A;  5EXW A;  2GTD A;  1KQS M;  5AFU H;  3OA9 A;  5BPN A;  2HBK A;  2E88 A;  4JK9 A;  4NB4 A;  3CCQ N;  5C2F A;  3ENB A;  3ZX3 A;  3LDP A;  4CI6 A;  1JCG A;  3OHR A;  1VQN N;  5AQQ A;  4JNE A;  4BRO A;  3SJH A;  2IVN A;  4HWI A;  3CCS N;  5C0Y A;  3CC2 N;  2GX9 A;  3CPE A;  3VES A;  4BR7 A;  3MWT A;  1Q86 O;  4DQ8 A;  3O1B A;  3CCU N;  4YOU A;  3OBY A;  4H0P A;  5AZJ B;  4BR0 A;  3UE5 A;  4C23 A;  1RFQ A;  2E2Q A;  4JKE A;  4FOE A;  4BC5 A;  4FOI A;  3O6W A;  3M5R A;  3DWL A;  4FWQ A;  5JIC A;  4OO1 J;  4A5B A;  2ZGZ A;  3I8B A;  3WQU A;  3A5N C;  3UKU A;  4BRK A;  2QWR A;  4BGB A;  3DXM A;  4IOA L;  4H5V A;  1HKB A;  2P9K B;  4H0T B;  1YHQ N;  3D2E B;  1K9M O;  1KAX A;  3IMX A;  3WXJ A;  3VEY A;  3IFR A;  1Q81 O;  3M1F A;  5AQL A;  2P9P B;  3EZW A;  1YUW A;  2QEX N;  3O9Q A;  5FPD A;  3QBX A;  4JKD A;  3I56 N;  3MMV A;  4A5A A;  1KD1 O;  2P9S A;  5JVH L;  2P9L A;  4IZ9 A;  4C1N K;  1V4S A;  3FZM A;  3HM8 A;  3VTI A;  4B1U B;  4QS8 A;  4XH5 A;  4JKG B;  5AQV A;  3VPZ A;  1K8A O;  3CC7 N;  1ILY A;  3D7E O;  2KLA A;  2V51 B;  2KHO A;  1DT9 A;  1GLJ O;  1Q18 A;  3A5L C;  3VMF B;  2QA4 N;  1BA0 A;  4OPH A;  5ELZ A;  1U6Z A;  1V4T A;  2Q0R A;  4EAH D;  1GLE G;  2I7N A;  5DM7 L;  1BU6 O;  1MWM A;  3UKR B;  4A59 A;  4CZI A;  5CHI A;  3WUH A;  1W97 L;  5AQX A;  1NGE A;  4ILJ A;  3ZX0 A;  1TUU A;  2NRX A;  5CR4 A;  3FGU A;  1T6D A;  4LC9 B;  2HF4 A;  3R9P A;  4BVO A;  1NGH A;  2GWJ A;  1NM1 A;  3SK3 A;  5KQ8 A;  1ATN A;  2I7P A;  2JWL A;  4FWO A;  4JHD B;  1SAZ A;  2A5X A;  3GG4 A;  1YJ9 N;  2ZJP L;  2P9N B;  3C7N B;  5AQJ A;  5EVZ A;  5AQY A;  3FE1 A;  3CHW A;  2Q1N A;  1J6Z A;  2ASM A;  2PAV A;  3EE8 A;  5FPM A;  5C12 A;  2D0P A;  3SMP A;  3CQY A;  4EFH A;  2QTD A;  5C10 A;  3TSU A;  1OVY A;  2NRW A;  4FSV A;  1QVG M;  3LM2 A;  3N4Q A;  2A6A A;  1VQ4 N;  4E1J A;  5AQU A;  3G25 A;  1K73 O;  2FSJ A;  4CD1 A;  2CH5 A;  4BRH A;  3CMA N;  5AZI B;  3ZEU A;  3CPW M;  3AAR A;  1RDU A;  2QWL A;  3FLC O;  3RSE A;  2VWB A;  4JKC A;  1NWK A;  4A57 A;  3QML A;  3A5M C;  4CBX A;  3TPQ A;  1X9J A;  4NLC A;  4YOW A;  3CCV N;  1GLD G;  3SAF A;  2A41 A;  5EX5 A;  3M6G A;  2BH1 A;  4XH1 A;  3VEX A;  4A2A A;  1HKG A;  2VGN A;  3IKM A;  3C65 A;  5FPN A;  2F7T A;  4AM7 A;  3O4W A;  2Q97 A;  3QFP A;  3DXK A;  4BQZ A;  3MX5 A;  3CC4 N;  4BY9 C;  5EY4 A;  4IDH A;  1VQ8 N;  1P90 A;  2V7Z A;  4CD3 A;  1VQO N;  3TTD A;  3AGK A;  3LDL A;  4PKH A;  2OTL N;  1NGA A;  4WQ5 A;  3EO3 A;  3JXU A;  3BEX A;  3UKU B;  4B1Y B;  3DXM B;  4CZL A;  4B1W B;  3P4I A;  3CET A;  5LJW A;  4GV6 A;  4GNI A;  3TU5 A;  1E4G T;  4IXC A;  3QFU A;  1QQO A;  1NGG A;  3VEZ A;  1H1V A;  3EE9 A;  4IO8 A;  3PLA A;  3E1Y A;  3O8M A;  4BRL A;  2ZJR L;  1YI2 N;  4BC3 A;  3VF2 A;  5LY3 A;  5I9E B;  3SLC A;  3P38 A;  4BRQ A;  4YOX A;  3ULE B;  4Z94 A;  2P9L B;  4JKF A;  3IDH A;  4K42 A;  3FZL A;  4H5R A;  2NRV A;  4A62 A;  3NVK A;  1YXQ A;  4BRG A;  4CJ7 A;  1VQK N;  1MA9 B;  1T6C A;  3VGM A;  3SBT A;  4YDU A;  2VCP A;  3LL3 A;  4WFA L;  2WFB A;  3K9J A;  1S3X A;  2A42 A;  5AFU A;  4FPB A;  4ISF A;  4IWV A;  4U7B A;  3R1X A;  4BR2 A;  4BRF A;  5AQM A;  4KH4 A;  3VEN A;  3FZF A;  4JK7 A;  2FF3 B;  4FO0 A;  5GAD P;  1MDU B;  5JVG L;  1N8R O;  3CQX A;  3DJC A;  1GLC G;  2P9U A;  3DAW A;  4BRM A;  1IG8 A;  5AQF A;  4BRN A;  1ATR A;  4ILH A;  2YJF A;  3MCP A;  5AQR A;  1KAZ A;  5JMV A;  2J4R A;  3I55 N;  2VGM A;  4B1X B;  3T69 A;  1EQY A;  1DKG D;  4BG8 A;  4EIA A;  3KWG A;  4BRD A;  4PKI A;  3EKU A;  2BUP A;  1HLU A;  2QM1 A;  3GOI A;  3KK7 A;  4FWM A;  4ISG A;  3VOV A;  5E26 A;  3ZEU B;  3ZYY X;  3CCR N;  1KC8 O;  1G99 A;  2HBL A;  3MX2 A;  3VGK A;  3U4L A;  5GIP A;  4UY8 O;  3KZB A;  4PL7 A;  3OW2 M;  4BGA A;  1E4F T;  2YHY A;  3EL2 A;  5AQT A;  5LJV A;  3MCA B;  4CBU A;  1X3M A;  4MLE A;  1Z05 A;  2NRT A;  4JD2 B;  1YAG A;  4C1N I;  3CCE N;  3CCL N;  2NRH A;  1HJO A;  1K8K A;  1VAZ A;  3SBG A;  3WEE B;  4EHT A;  4H03 B;  5KPZ A;  3M3Z A;  5AQI A;  2KKZ A;  2Q2R A;  3KHY A;  2IVP A;  1TYQ A;  3ZET A;  3U8X A;  2D1K A;  3DXK B;  3CJ9 A;  5BRE A;  3MDQ A;  4FWP A;  3AAP A;  4CZM A;  3SMS A;  3O08 A;  1WOQ A;  4WF9 L;  3VF4 A;  4H0Y B;  4B9Q A;  2HMP A;  2FSK A;  3CCM N;  2ZGY A;  3CIP A;  3MN7 A;  3GBT A;  3H1Q A;  3O9R A;  3CF5 L;  5KPR A;  5H1S Q;  4WQ5 C;  4M63 C;  2E2O A;  3QDK A;  1QQN A;  1RDW X;  5F1X A;  3ATV A;  5BRD A;  3BP8 A;  5HL7 L;  3G71 N;  1NMD A;  2PBD A;  5JLF A;  3Q7C A;  1JCF A;  2GEM A;  3E66 A;  4CZK A;  1NJI O;  1OKJ A;  1QZ5 A;  4I6M B;  2YJE A;  1EO1 A;  1D4X A;  1HKC A;  2IVO A;  3F5T A;  4WFB L;  1VQ5 N;  1XC3 A;  3ENO A;  4CZE A;  2OAN A;  2QWQ A;  5BPL A;  1QQM A;  5CE3 A;  4CZJ A;  3G6E N;  2HST A;  1IJJ A;  3WXL A;  2V52 B;  5M1F A;  3CCJ N;  4YDU C;  2FLO A;  4DKW A;  5KQD A;  2AP1 A;  5EOY A;  4ISE A;  3QIC A;  4DHY A;  3SAG A;  4WQ4 C;  4RTF D;  5GAE P;  3B8A X;  3HRG A;  3JS6 A;  3AAQ A;  2P9U B;  5BRF A;  5AQG A;  3D2F A;  4QS9 A;  4U67 L;  1ATS A;  3D2E A;  3HTV A;  4PKG A;  4J8F A;  4CZH A;  1QZ6 A;  4O5F A;  4YOV A;  3O9S A;  3CJB A;  5M1P A;  3GE1 A;  3PIO L;  4B1V A;  3TTC A;  1M1K O;  4BR9 A;  1NGI A;  2JWK A;  4O8K A;  1R59 O;  1GLL O;  1ESV A;  2PFU A;  4JK8 A;  3CXC M;  1JJ2 M;  1BDG A;  3QBW A;  1C0G A;  4FWS A;  2A40 A;  3VTH A;  4JKG A;  5GAH P;  1VQP N;  1YIJ N;  3ATU A;  4BG9 A;  4BQL A;  1YF5 L;  4MLH A;  4AM6 A;  3KWI A;  5DM6 L;  1BWF O;  2P9S B;  3O9U A;  5C2D A;  3PIP L;  1BUP A;  1P8Z A;  2QWN A;  1K8K B;  1Q82 O;  1YVN A;  3UKR A;  4XH4 A;  1TYQ B;  2QW9 A;  4IJA A;  3ZET B;  5ADX H;  1T3V A;  2F9W A;  3L0Q A;  4YOR A;  3U9D A;  4FL9 A;  4WYB A;  3N4P A;  2YX6 A;  4GVE A;  3WXM B;  4IEI A;  5TKY A;  3W0L A;  4WQ4 A;  4A2B A;  3LDN A;  1ZBS A;  4AF1 A;  4MDB A;  1ZXO A;  4QS7 A;  5GIN A;  1Q7Y O;  2P9N A;  5BRH A;  3MK6 A;  4FWN A;  2V7Y A;  5E84 A;  3CJ1 A;  4WFN L;  3IUC A;  5AQS A;  2WC9 A;  4JN4 A;  4IEE A;  2E8A A;  3FZH A;  1HUX A;  4FPA A;  1QHA A;  4CZG A;  2W41 A;  3MWP A;  1NGJ A;  1T44 A;  4BR5 A;  1BOT O;  4GY2 B;  1O13 A;  4GV3 A;  4JAX A;  3ZX2 A;  5JLH A;  1NGD A;  3H46 O;  2HOE A;  1SS6 A;  2GEL A;  3OBW A;  2DPN A;  2P9I A;  3K9K A;  5AQP A;  3CJ7 A;  2ASP A;  4NLB A;  3BF3 A;  2FSN A;  2CGL A;  1BO5 O;  5M1Q A;  5BN8 A;  5M1N A;  5HOO A;  2EWS A;  4WCE L;  4GV9 A;  2OTJ N;  4JKA A;  5FPE A;  2QWP A;  2WUS A;  2YHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...