1RDCA

Crystal structures of ribonuclease hi active site mutants from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTNSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
publication title Crystal structures of ribonuclease HI active site mutants from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
total genus 42
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rdcA00
3VQ9A 4I2QA 1VK0A 4OVLA 4KO0A 1TL1A 2YNFA 4EP4A 4W5TA 3NHGA 1L3SA 1VSLA 1D9DA 3SV4A 4FJMA 1Z25A 3OVNA 3OYBA 3RMDA 1YTAA 3DOKA 4F3TA 2DFHA 4DF8A 5KTQA 1Q9YA 4BDZA 3QIPA 4C8LA 4BE0A 4PY5A 3AVGA 3TAEA 1B92A 2HNZA 3K58A 3OYGA 3RMBA 4WE1A 4C8NA 3K59A 4LD0A 2XY8A 3AO1A 4AHVA 1GOBA 3ZSZA 3NH2A 2HHQA 3I0RA 4AHUA 2P5OA 3RTVA 1FK9A 1RTDA 4KHWA 3P1GA 1LV5A 4KB0A 2B4JA 2YV0X 3KK2A 3QERA 3SUNA 2OPSA 3NF7A 1WSEA 2IGIA 3OS1A 3KLHA 1SL1A 3LPTA 4IDKA 3EY1A 4DTSA 3KD1E 3RMAA 3LAKA 3OYDA 4EZ9A 3NF9A 5C25A 4DSJA 3VQBA 1ITGA 4DTXA 2Q3SA 1JXEA 4CK3A 5I3UA 1Z26A 4ZTJA 3O4NA 3OYFA 4ID1A 1W9HA 4GMJB 2QKKA 1C0TA 1JLFA 1X1PA 4FW2A 5J2QA 1SL2A 3RR7A 3VQCA 1REVA 1RDAA 3BDPA 1BCMA 3TWHA 3RRGA 4OKEA 3QEPA 1EX4A 2HW3A 1JLBA 3LWMA 3H08A 3RMCA 4M3XA 4DLGA 4CFBA 4BACA 3SJJA 3S3MA 4ELUA 3NGZA 3C6UA 4IG0A 4B9LA 5SWMA 3O3FA 3S9HA 2DTUA 3KTQA 3VQPA 1LWEA 3IS9A 4DFKA 4RW4A 3QINA 2HVHA 5CY4A 3L2QA 1D5AA 3O3HA 3S3OA 4JS4A 1TKDA 4CGIA 3DRRA 5J2NA 3AVHA 4NCAA 4IFVA 1L3UA 2RPIA 3L2RA 2E6LA 1C1AA 4CF9A 3VQ5A 2FBVA 3ZSYA 5K14A 3IRXA 3HPOA 4DTOA 2GV9A 4CEFA 3SV3A 2A1SA 3WNFA 1IKYA 3WNEA 3HVTA 3KIOA 4JRQA 5J1EA 2X74A 3VQDA 3THVA 3B6OA 1C1BA 4CFDA 1Q8IA 5CZ2A 3AO3A 2X78A 5FDLA 3ZCMA 3LAMA 4QCLA 1WSHA 3SNNA 1JLEA 1TK8A 1U04A 3HM9A 4DQPA 1A5VA 1TKTA 3ASMA 1WSGA 2YKNA 1RT4A 4B9TA 4RW9A 2HNYA 3HPGA 4PA1A 4CIFA 3F9KA 1QS4A 4E3SA 4DSFA 4HUFA 4FM2A 4B9NA 4NCGA 4W5QA 3NH1A 3HSTB 1TAUA 3C6TA 1NK4A 3SUOA 3MXIA 3AA4A 4CEDA 4KTQA 2ETJA 1ZBLA 3EYZA 3LP3A 3QEIA 1NK7A 3VQQA 5DMRA 4CESA 1S1WA 3K5OA 3SUQA 2G8IA 1LAVA 1B9FA 2VG6A 4DQSA 1BCOA 3DLBA 1VSKA 3TAGA 4CHNA 2FC0A 3AVAA 4O0IA 4DLEA 3ALYA 3KK3A 3NGIA 3K2PA 4DQQA 1SKRA 2QXFA 3DOLA 3ZT4A 1LWCA 2HHUA 3L3UA 3MXMA 4M3UA 4CGJA 3LWLA 1MU2A 2R7YA 3FFIA 4HUEA 1S1UA 4FJKA 1GOCA 2HHWA 1C0UA 1S1XA 4FLXA 4OPJA 4W5OA 3DLKA 2I5JA 1RT2A 5J2MA 2E4LA 3TAQA 3L8BA 2X6NA 4DSIA 1CZBA 2IC3A 3OYLA 4FK0A 4OKJA 3HT3A 4OJRA 4IG3A 1NOZA 2HHXA 2HVIA 1HYZA 2FBXA 4HVJA 4CJVA 1VSIA 2WOMA 3HL8A 4CJRA 1KRPA 3AA3A 3LP0A 4FLZA 2IDOA 4LY7A 3ZSRA 3KLGA 4KHUA 1WAFA 2IS3A 3AVJA 4RW7A 4LSLA 3V9UA 3LANA 4Z0UA 1VSDA 2D0AA 2ZQBA 3CQ8A 4M3WA 2XY5A 4DTNA 1TV6A 1NJWA 4CHPA 3ZT0A 1QSLA 3DLGA 2JLEA 4CHZA 3I8DA 3OYJA 1U45A 1RT6A 1BIZA 1O1WA 1TKXA 5KGWA 4DWIA 4M3YA 1HQEA 3OS2A 3MECA 1S9EA 4CJ5A 3EZ5A 1Q9XA 2PY5A 2BDPA 3V1RA 4E89A 4I7FA 1L3VA 4UQGA 1WSFA 2YNGA 4F4KA 1U47A 4CECA 4OLAA 4F2SA 4DTUA 2YHAA 4CHYA 1SKWA 3ITHA 3RWUA 2YHBA 2FBTA 3AVKA 4CJEA 1T8EA 4Z4CA 1JXBA 1C0MA 4DFMA 3K5LA 5T7BA 3TR8A 3ZT3A 4E19A 4E7IA 1L3TA 2ZE2A 1IKVA 3MXJA 1DTTA 3VQ8A 3OYEA 4Q5VA 4E7LA 3TANA 1N6QA 3B6PA 4FK4A 1IO2A 1IKXA 1J9AA 4E7HA 3QIOA 4CJQA 3SQ2A 3PX0A 5JS2A 1IG9A 4Z4HA 3OYCA 3SI6A 1SKSA 3CM6A 4FLYA 3T19A 2G8VA 1ZBUA 4CEBA 3L2VA 4CERA 3QNOA 4J2AA 3NF8A 5HRSA 2QK9A 1HYSA 4OPKA 2W42A 4RW6A 2G8WA 4KREA 3PV8A 3DRSA 3AVFA 3OYIA 1VSEA 4E1NA 3L2WA 4CJ4A 1B9DA 1WLJA 1QHTA 4H4OA 2D0CA 3G0ZA 4J2BA 4CF2A 3V81A 4KHNA 2VG5A 2KFNA 1KLNA 3G10A 4HHTA 3DMJA 4B08A 3KJVA 1WNSA 3PX4A 1FKOA 4BE2A 4GVMA 3OY9A 3K5NA 2GBZA 1VSFA 4CE9A 1TK0A 1RBVA 2VWJA 2G8HA 2Y1JA 2NUBA 4G1QA 3VQ7A 4KRFA 4N47A 4B8AB 4M41A 1EKEA 4HCBA 3JYTA 3ZSOA 2B5JA 3ZT2A 3K57A 3RR8A 4FZZA 2KZMA 4RW8A 4DSKA 3RRHA 4CF8A 5C24A 2IOCA 3K5MA 1UA0A 1XI1A 4DTMA 3NGYA 3HYFA 4LH4A 4BWJA 1RBUA 1BGXT 4NYNA 1L5UA 2YNIA 4FLTA 2KZZA 2Z1HA 5HRNA 3SUPA 4FXDA 3DLEA 4KI6A 5HROA 2KQ2A 5J2PA 4DU3A 3ZSXA 2A1RA 4F2RA 3CG7A 4YNQA 1KFSA 3L3VA 3KKRA 3NF6A 3VQ4A 3V4IA 3DYAA 1JLCA 4IKFA 4M3TA 4RG8A 1TGOA 3AVBA 1RBSA 4M3RA 3HXMA 4KPYA 2IAJA 3AVNA 4TSXA 3NFAA 3TAMA 1U48A 2DFFA 2ZD1A 3U3GA 3DLRA 3TAFA 2PZSA 4EZ6A 4DTPA 4PQUA 1RTHA 4FLWA 2HHSA 5FRMA 1XHZA 3D0PA 1KVCA 4DSLA 3C94A 2EX3A 4W5RA 2BE2A 3BGRA 3QETA 4OLBA 4Z4EA 4DSEA 1FXXA 3CYMA 4FM1A 1EETA 4CIGA 4AH9A 1BQNA 2KW4A 2P51A 3ZT1A 5HRRA 1RILA 2O4GA 3OYAA 4FCYA 4KFBA 4CCHA 3SQ0A 1D8YA 4CFCA 1EXQA 4CJ3A 1XC9A 4CEQA 1T03A 1BL3A 1QQCA 5HP1A 2YNHA 1D9FA 2OZMA 4FJHA 3V9XA 4J2EA 1G15A 3HO1A 4CFAA 1JLGA 2XHBA 4DU4A 4FJ9A 2HHVA 3AVCA 4E7KA 5EU7A 4C8OA 1RCHA 1HQUA 4CGDA 3AV9A 1NKBA 4PWDA 4BE1A 3CM5A 2AJQA 1UOCA 1QE1A 4XIUA 4DQIA 1QTMA 1BI4A 3MEDA 4ZHRA 1ASWA 1F21A 1S1TA 4FVMA 3AO2A 1WSIA 4ID5A 4AHCA 2O4IA 2VWKA 1S1VA 3SYZA 4DQRA 4KAZA 2DFEA 2G8UA 3QLHA 4JLHA 2HMIA 3HVRA 1KLMA 4FJ8A 1SL0A 4ICLA 4Z4FA 1NJYA 3HP9A 4I2PA 2RN2A 5I42A 4CHOA 3OS0A 1T05A 2FBYA 1YTUA 1NKCA 4FJGA 1DTQA 1ZYQA 4FK2A 1KFDA 4KTWA 1JLAA 4BDYA 1RT7A 4BWMA 3V9ZA 1NK8A 4FJXA 3OYHA 3ULDA 1ZBIA 2YKMA 1NJXA 4CJKA 1WSJA 2HB5A 5DK5A 2D0BA 2G8FA 4OKKA 3DM2A 5FROA 4M45A 4Z4IA 4B9MA 3M8RA 3V1QA 4AHRA 4DMNA 4CIEA 2KFZA 1UAXA 5FRNA 1NKEA 4I9QA 5KRSA 4EP5A 4Q0BA 2P1JA 1U49A 4W5NA 3SPYA 1UA1A 4CEEA 3OYKA 4DTJA 4C8MA 1U4BA 1S5JA 1X9SA 4FM0A 4KHYA 4CJSA 4ZTFA 1RTJA 4KV8A 4CK2A 3L2UA 3CFPA 3KLIA 3AO5A 4FJNA 4CJWA 2XRIA 1XHXA 3SQ1A 5JS1A 2F8TA 4F8RA 4FJIA 2BGGA 3I0SA 1CXQA 4DS4A 1NOYA 3V1OA 3DLHA 1KCFA 1RDBA 1HYVA 1RBTA 3AO4A 1BISA 3SQ4A 4CEZA 3ISNC 4FW1A 3NE6A 1X9MA 1KSPA 4Y1DA 4CJFA 2QKBA 4B9SA 1NJZA 4N76A 4FYDA 1GOAA 4AHTA 3V9SA 3T1AA 4CJLA 2RF2A 1KVBA 1I3AA 4CEAA 2RKIA 3D45A 3WNGA 1SUQA 5SZTA 4KB1A 3M8PA 2X6SA 3HP6A 3F73A 1C1CA 3E01A 5CYQA 1EP4A 3CFRA 4QOZB 3TAPA 1X9WA 1BIUA 4Z4GA 1RT3A 4B3OA 1YVUA 4KHSA 3CFOA 5KI6A 3JSMA 5E41A 1IKWA 4ELTA 3OJSA 4FJJA 3LPUA 3DI6A 4LSNA 3AA5X 2OA8A 3ZSWA 3KKSA 2OPQA 1TVRA 3O3GA 3KLFA 1KTQA 3AVLA 2OYQA 4QAGA 4K8XA 1DLOA 3VN5A 4CGGA 3TI0A 4L8RB 3VQ6A 3AA2A 1J5OA 1VRUA 4NCBA 4KHQA 4OGEA 1LWFA 2D5RA 4PUOA 3OYNA 1T7PA 1RTIA 1C6VA 3PX6A 3KK1A 1BQMA 3LZJA 4KI4A 3AVMA 4CJUA 3KLEA 4CHQA 2HNDA 2Z1JA 4E7JA 4DS5A 2G8KA 3U6FA 1VRTA 4ELVA 4CF1A 3P5JA 4JRPA 1IH7A 1I39A 4FZXC 4FJLA 1NK5A 1RNHA 1FKPA 3SCXA 4HTUA 1SV5A 2VG7A 1JL1A 4N5SA 1VSHA 1Y97A 2F96A 3LP2A 3QEVA 2P5GA 3KD5E 4LH5A 3QESA 4FJ5A 2XO7A 4CGFA 3NCIA 4FJ7A 2GUIA 3IAYA 1UWBA 4KTZA 4MFBA 3LZIA 1TK5A 1VSJA 1K6YA 1HNIA 2BANA 2JGUA 4DU1A 1TAQA 3LDSA 1BHLA 1VSMA 1RDDA 2WONA 2PYLA 1XWLA 1J54A 5KRTA 2F8SA 3PUFA 1RDCA 4B9VA 4FLUA 4B8CA 1N5YA 3S3NA 2LSNA 1HRHA 3OJUA 4CF0A 1NK0A 2XY6A 3DRPA 4N41A 4KKOA 4O44A 4K8ZA 2KTQA 4FZYA 4J2DA 1W0HA 4H8KA 4CEOA 4IFYA 3VA3A 5HBMA 1JL2A 1LW2A 2OPPA 3QNNA 5HLFA 3WNHA 4HCCA 3HK2A 4M42A 4O4GA 4GW6A 4AHSA 2ATQA 4O5BA 3V9WA 1NK9A 3VA0A 2XY7A 3TARA 1CXUA 1TL3A 2HHTA 3PO4A 2EHGA 1BI4B 5CYMA 2PYJA 1A5WA 1ASUA 2Z1GA 1LW0A 5C42A 4E1MA 3MAQA 4DTRA 1S6PA 1WN7A 1ZBFA 3ZSQA 3V6DA 4CGHA 2OPRA 4CK1A 4F3OA 3U3YA 1RBRA 3P83D 1HPZA 5HRPA 3QEWA 4O0JA 1ASVA 4NYFA 3C95A 1ZBHA 4IBNA 3HPHA 1TKZA 5CZ1A 1QSYA 1RT1A 3HJFA 1CZ9A 1YT3A 3QO9A 4MQ3A 4H4MA 4I9LA 3TABA 1HMVA 3MEGA 3SPZA 1NK6A 4AILC 3MEEA 3ZSVA 4C8KA 3LALA 3OYMA 1QSSA 2E6MA 4DFJA 3VQEA 1KVAA 4E0DA 1A5XA 1LAWA 1JKHA 3NBPA 1RT5A 1JLQA 4DF4A 4OGCA 1WAJA 2B6AA 4HUGA 4FLVA 4N56A 3QEXA 1CLQA 3NAEA 4CJPA 4R5PA 1J53A 3O4QA 4B9UA 3AVIA 2DY4A 4DG1A 1R0AA 3M8SA 2ITGA 5D3GA 3LP1A 3A2FA 3M8QA 3VQAA 5KGXA 4Y1CA 4CJTA 2OZSA 4M3ZA 1HNVA 3PO5A 4YFUA 4BDPA 3UIQA 4JS5A 4O55A 3SZ2A 2Z1IA 3NDKA 1S6QA 3T3FA 1S9GA 4DFPA 3IG1A 1HJRA 2Y1IA 3PY8A 3NH0A
chains in the Genus database with same CATH superfamily
1NGDA 5B8HA 1TL1A 4DB3A 3SV4A 4F3TA 3G4SN 1X9JA 2GELA 2OTLN 4IXCA 4V19S 4PY5A 3K58A 3RMBA 4BRAA 2XY8A 3AO1A 2QTDA 4OX9K 2GTDA 3EN9A 4JHDB 3NH2A 3UKRB 5EY4A 4WQ4C 1IV0A 3VMFB 2YV0X 2VGMA 1NLVA 4EFHA 1WSEA 3O4WA 3QFPA 3KLHA 3LPTA 4YY3K 4CZHA 5IWAK 2PFUA 1N34K 4BREA 3Q7BA 4GVEA 4DTXA 2PBDA 5C12A 2P9IB 3OYFA 3KK7A 4WQ4A 1E3MA 4FW2A 4BR7A 2P9PA 1WBBA 3RRGA 1KC8O 1NGFA 4GV6A 5M1OA 1OH6A 4YOYA 4CFBA 3IUCA 1VQ6N 4JKGA 5KPRA 4GV3A 2V7YA 5SWMA 4XH4A 3IS9A 4GY2B 1OVQA 5CY4A 3L2QA 1D5AA 5C2FA 4CGIA 4EHTA 4JI5K 2E1YA 2ZM6K 4CF9A 2FBVA 3HPOA 5K14A 3SV3A 3WNEA 1ZBLA 4DV3K 3VQDA 3THVA 3B6OA 2CGJA 2KLAA 5JMVA 4F9OA 3LAMA 4PL7A 1TK8A 2QWNA 1U04A 4WFAL 1A5VA 3ZX3A 1TKTA 3ASMA 4PHTX 2YKNA 4WQ5C 3CCLN 2QWQA 3LL3A 3G6EN 4E3SA 4HUFA 1NBWA 5FPMA 2E20A 3SUOA 3DXKA 1GLLO 1NGJA 4KTQA 4FWOA 4FWSA 3EYZA 3QEIA 4WF9L 4CBWA 4FVUA 1BCOA 3TAGA 3D2FB 2FC0A 3AVAA 2UXDK 3ALYA 3ENHA 4DQQA 3BF3A 2D4WA 1LWCA 4QS7A 3J80O 3SLCA 4M3UA 3FFIA 3CQYA 5CR4A 4YDUC 1C0UA 4BRKA 3PSIA 1T6DA 4OPJA 3RSEA 2A3ZA 2ITMA 3CMAN 2X6NA 4CBXA 4OKJA 3HT3A 1NOZA 1T44A 1HYZA 1U2VA 2WOMA 3CJBA 5CE3A 4CJRA 3AA3A 4YDUA 3L6QA 4LSLA 4Z0UA 3T69A 3CQ8A 1W2BM 3DLGA 4L3QA 4JKHA 3VESA 1RT6A 5KGWA 2E2NA 4DWIA 1Q9XA 4MLEA 4K41A 3M6GA 4BR4A 4FL9A 4DTUA 4JKFA 3RWUA 2YHBA 3AVKA 1T8EA 4Z4CA 4A5AA 3K5LA 2O8DA 4R79A 1L3TA 2GWJA 3EO3A 1DTTA 4JKEA 3DLLL 5JICA 4FK4A 1IO2A 5F2RA 1J9AA 4CJQA 3PX0A 1YVNA 2VGNA 1SS6A 1BUPA 1SKSA 4YOTA 3QNOA 4J2AA 3NF8A 4RW6A 3AVFA 2FF6A 1VSEA 3L2WA 1WLJA 4CF2A 5E26A 2QEXN 1H1VA 1NU0A 2HOEA 2KFNA 3DMJA 3KJVA 3OY9A 3HI0A 3D2EB 3K9KA 4CE9A 3K5NA 2HHHK 3VQ7A 4DUZK 4KRFA 1T3VA 4HCBA 3ZT2A 5AQSA 4FZZA 3LDNA 4CF8A 1UA0A 1GLAG 4BWJA 1GLJO 4FLTA 4JK9A 3ZX2A 5HRNA 2D0OA 3F5TA 2E2OA 4DR3K 1NGEA 1IBKK 1WOQA 4DU3A 4F2RA 2VYPA 3V4IA 4IKFA 2A5XA 3J7YP 3TAMA 2DFFA 3U3GA 1QVFM 4EZ6A 2HHSA 2ZJRL 4FSVA 3ZETA 3QETA 4Z4EA 1FXXA 1HPMA 3CYMA 3R9PA 1EETA 4FM1A 1V4SA 2KW4A 2P51A 3OYAA 1NNEA 1RDWX 2P5GA 4CFCA 1T03A 1G15A 4FJ9A 4DU4A 5EU7A 1RCHA 3AV9A 4BE1A 1S1TA 1F21A 4FVMA 2VWKA 2DFEA 2E1ZA 3SAGA 3QLHA 2HSTA 1SL0A 3O9QA 4ICLA 3H1VX 5C0YA 2UU9K 3A0IX 1T05A 2QA4N 1KFDA 1RT7A 4RCHA 2YKMA 5FROA 1XNRK 2HBLA 5C2DA 2ZF5O 4DMNA 4CIEA 3BEXA 4EP5A 3HOTA 2A6AA 3AAQA 4DV4K 2P9UB 1U4BA 1X9SA 3ZEUB 1XC3A 3KLIA 2XRIA 1XHXA 1VHXA 4FJIA 2OANA 3I0SA 4DS4A 1NOYA 3V1OA 3UKUB 4DV2K 2QWLA 1HYVA 4JKDA 3ISNC 4FW1A 4I6MA 4CW7B 1KSPA 4JI6K 4Y1DA 4CJFA 2QKBA 4B9SA 4N76A 5AQXA 2RF2A 1KVBA 3WNGA 2YCHA 4BRQA 3M8PA 1C1CA 3J7AP 1N32K 3OBYA 1RT3A 2Q0RA 4KHSA 3VF6A 4WFNL 3CFOA 3FGUA 3DI6A 3AA5X 3ZSWA 4CZKA 4BRIA 1TVRA 3TSUA 3AVLA 2OYQA 4K8XA 4L8RB 2Q0UA 4PUOA 3OYNA 2D1KA 4JI8K 3T1YK 3PX6A 2GX9A 3KLEA 4CHQA 1HNZK 3ULEA 2CH5A 4BY9C 3GDQA 4CF1A 1NM1A 1I39A 1P8ZA 4FJLA 5ELZA 3CJ7A 1FJGK 1JL1A 2ZJPL 2F96A 3LP2A 3P39A 5AQNA 4FJ5A 4FJ7A 2GUIA 1UWBA 4KTZA 4MFBA 3ZX0A 4WCEL 1TK5A 1VSJA 1HNIA 3WEEB 3LDSA 1G99A 3UB5A 3DXMB 3DAWA 1XWLA 1J54A 5KRTA 4IO9L 1RDCA 5GIPA 4FLUA 3VGLA 2O8EA 4JKBA 3OJUA 3KVGA 4CF0A 3DRPA 4J2DA 4FWRA 4B3RK 4HCCA 1ZBSA 3PIPL 3I55N 3VEVA 1WBDA 2QI2A 3PO4A 3P4IA 5CYMA 3H3OB 4GV9A 3MAQA 1ZBFA 3V6DA 2RE2A 2OPRA 3O1WA 4MO5A 4CK1A 3U3YA 3P83D 3O9TA 5HRPA 3QEWA 4NYFA 3OHRA 5CZ1A 5EXWA 3HJFA 4MQ3A 4I9LA 3SPZA 2P9NB 4H03B 4DFJA 3GE1A 1KVAA 4E0DA 1A5XA 3G25A 1JKHA 3NVMA 1RT5A 3TU5A 4MDBA 4JKAA 1CLQA 4HUGA 4N56A 1TUUA 3TTDA 4CJPA 4BC2A 3MK6A 4KH6A 4XEIA 1P90A 1QHAA 3VQAA 4JEPA 2Q36A 4C23A 4Y1CA 2YI1A 4M3ZA 3PO5A 5AQMA 3O80A 2BH1A 5AQOA 4CI6A 2W6LA 3T3FA 4DFPA 3IG1A 5HOOA 4NXMK 5LJWA 5FPDA 4OVLA 1L3SA 4EP4A 1GLBG 3AY9A 1VSLA 5AQJA 5M1PA 1Z25A 5AJ3K 2O8FA 3DOKA 5KTQA 1QQMA 3P38A 1Q18A 5AQVA 1WUAA 2YHXA 4YORA 3CPWM 4WE1A 5MLCQ 3K59A 4LD0A 2HHQA 3C7NA 2P5OA 2V7ZA 1K8AO 5IT9O 4KHWA 4CZFA 2B4JA 3QERA 3NF7A 1SL1A 4JI0K 1HKBA 5AZIB 4EZ9A 4DR7K 2F4VK 3VQBA 5I3UA 4ZTJA 3O4NA 5TKWA 5AZJA 1C0TA 1JLFA 1X1PA 5J2QA 1SL2A 5AQLA 3TWHA 4OKEA 4KH4A 2HW3A 1JLBA 3LWMA 3H08A 5AQWA 4A62A 2KKZA 2GWKA 3OBWA 4ELUA 3NGZA 4K0KK 5JVHL 3O9RA 2NRVA 3KTQA 1JCGA 1QVGM 1NMDA 2VWBA 4IEEA 3WT0A 1TKDA 4NCAA 5GIOA 1L3UA 2RPIA 4BVPA 3VQ5A 3ZSYA 3IRXA 2A1SA 3KIOA 4U7BA 2X74A 1C1BA 4CFDA 5FDLA 3ZCMA 1MWMA 1WSHA 1YF5L 4FOEA 3C6AA 4MO4A 2IIRA 1RT4A 3H6EA 4RW9A 2HNYA 2FXUA 3HPGA 4CIFA 2ZGZA 3O6WA 4NCGA 3NH1A 3HSTB 3MXIA 3AA4A 4BRDA 5GADP 3D6RA 3LP3A 2BTFA 3MN6A 5DMRA 2VQEK 2G8IA 3SUQA 1W97L 1LAVA 1B9FA 4DQSA 5H1SQ 4O0IA 5KPZA 5EX5A 2I7NA 3DOLA 5AR0A 2HHUA 2FSJA 3QBXA 4A59A 4CGJA 1MU2A 1D4XA 4X62K 3THXB 4HUEA 3VEWA 3RSEB 4JKCA 1M90O 3DLKA 2E4LA 3TAQA 1Z05A 1YJNN 2Q2RA 2IC3A 4PKIA 1J6ZA 3OYLA 2UYTA 4QS9A 4OJRA 2HVIA 4CJVA 2IDOA 3V9UA 5BR8K 2AP1A 3HRGA 3JS6A 4CHPA 1QSLA 2JLEA 4CHZA 5C10A 1U45A 4M3YA 3OS2A 3FZFA 1S9EA 3EZ5A 5BR9A 1WB9A 3V1RA 3F2KA 4E89A 1WSFA 3AGRA 2NRWA 5AQTA 4CECA 4E1JA 4JN4A 1SKWA 2Q31A 5BREA 3K0SA 1DKGD 2FBTA 1C0MA 3QFUA 3NVKA 2P9LB 2ZE2A 3OYEA 3TANA 3B6PA 2QWPA 3BZCA 3QIOA 1E4FT 5JS2A 4Z4HA 2WUSA 3CM6A 4FLYA 3QB0A 3MDQA 5BRFA 4KREA 3PV8A 3OYIA 1BWFO 3ID8A 4CJ4A 4IOCL 2E5LK 4J2BA 2P9SA 4KHNA 4BGAA 2VG5A 2AA4A 3R1XA 3G10A 4HHTA 1WNSA 1FKOA 4IFEA 4BE2A 1RBVA 1C0GA 2Y1JA 5C15A 3CJ1A 1EKEA 3JYTA 4BG8A 3K57A 3EKSA 2E2PA 4RW8A 4DSKA 5C24A 3K5MA 1NGCA 1JJ2M 1Z6RA 3HYFA 1RBUA 3KWGA 1L5UA 3SUPA 4O8KA 5HROA 5LMNK 5M1QA 2WBNA 4IOAL 4DV7K 1YI2N 1TGOA 4GKKK 5GAHP 2IAJA 3AVNA 4OPHA 3TAFA 4FLWA 3THYA 1KVCA 5DM7L 1BA1A 4DSLA 3C94A 2BE2A 3LDQA 4U67L 4KFBA 4CJ3A 1EXQA 1BL3A 4BRHA 2OZMA 1NG9A 3U9ZA 2HHVA 1JLGA 3BY5A 2XHBA 4JI7K 3AVCA 4E7KA 3CM5A 4FPAA 4DQIA 1QE1A 3NMUA 2AJQA 1ASWA 3OW2M 3C65A 3SYZA 1S1VA 4KAZA 2G8UA 4A57A 4DQ8A 4FJ8A 2IVNA 3LM9A 3QBWA 4I2PA 3OS0A 4NB4A 2FBYA 1NKCA 3CF5L 1JLAA 1NK8A 4FJXA 3CCQN 3ULDA 1NJXA 2D0BA 3UE5A 4IJNA 4NLCA 3VGMA 1UAXA 3LDOA 4I9QA 5KRSA 2Q97A 5AQIA 4BC4A 1U49A 4W5NA 4PKGA 3SPYA 5M1KA 4CEEA 3OYKA 4DTJA 4KHYA 1QZ6A 4CK2A 2A41A 3L2UA 3CFPA 1OVYA 4F8RA 2BGGA 4HWIA 1CXQA 3SQ4A 3NE6A 4LF6K 4FYDA 4CD1A 3V9SA 5SZTA 5AQFA 3QDKA 4XH1A 5CYQA 4H5RA 1EP4A 3CFRA 4YOVA 4Z4GA 4B3OA 1YVUA 5KI6A 1IKWA 3UKRA 3VERA 2OPQA 3O3GA 3KLFA 1KTQA 3FE1A 3CCVN 4QAGA 3HO1A 4KHQA 3TI0A 1ZXOA 1VRUA 4NCBA 2GEMA 1YITN 3HOSA 1LWFA 3WXIA 2D5RA 1YXQA 1RTIA 1C6VA 3LZJA 2QW9A 1NGGA 2Z1JA 1U6ZA 3U6FA 4FZXC 1NK5A 1KQSM 4G9ZA 4HTUA 3G71N 3QEVA 5KQDA 3KD5E 4LH5A 1TUYA 2FSNA 2JWLA 3A5LC 4CGFA 4DV6K 3LZIA 2JGUA 1TAQA 2FSKA 1X3MA 1RDDA 3M3ZA 3PUFA 2F9WA 4BQLA 3VEZA 3F9MA 4KKOA 2A42A 4O44A 4K8ZA 1EWRA 4FZYA 2KTQA 3CD6N 5HBMA 1W7AA 2OPPA 3QNNA 4FWNA 3V9WA 5LY3A 1NK9A 3SMSA 5LJVA 4JYAK 1CXUA 3LDLA 2EHGA 2HF3A 3MN9A 1BI4B 1ASUA 5C42A 4DTRA 1S6PA 4CGHA 1GLFO 4UY8O 1HPZA 4H0PA 1ASVA 4B1UB 1ZBHA 4IBNA 1TKZA 1RT1A 3ENBA 1CZ9A 3D2FA 4H4MA 1HMVA 4AILC 1Q81O 4C8KA 3OYMA 4JV5K 2NRXA 2QWRA 3VQEA 2WC9A 1K73O 1JLQA 4DF4A 4KHPK 1WAJA 2B6AA 3E1YA 3NAEA 4R5PA 4FWPA 3O4QA 3QICA 3IDHA 4B9UA 2DY4A 4DG1A 2UXCK 4A2BA 2ITGA 5D3GA 3LP1A 3A2FA 3S41A 1S22A 4CD3A 5KGXA 4B1YB 1HNVA 1Y64A 3THWA 4X64K 3VTHA 4QS8A 3UIQA 3SZ2A 4O55A 2Z1IA 3TSQA 3ZLJA 1QQOA 4CZIA 3PLAA 3PY8A 4LF9K 2QXLA 4I2QA 4W5TA 2YNFA 3NHGA 3E9LA 4FJMA 2YHWA 3RMDA 1YTAA 4PL8A 1Q9YA 4B3TK 2P9KB 4XH5A 2UUAK 1B92A 2HNZA 5CHIA 3OYGA 4JD2B 4C8NA 4AHVA 1GOBA 3ZSZA 4AHUA 3RTVA 4C1NK 3P1GA 4KB0A 1SAZA 3MX2A 2OPSA 1VQON 1HKCA 3OS1A 4IDKA 2NRHA 3EY1A 3CCUN 4DTSA 4CJ7A 5AQKA 3RMAA 3LAKA 3OYDA 3NF9A 1ITGA 2HF4A 4AM6A 4H0OA 1JXEA 1Z26A 4DR6K 3TTFA 1OKJA 1ZC6A 2A40A 2ZGYA 1REVA 4BROA 1RDAA 3BDPA 1BCMA 5DM6L 3QEPA 4K43A 1EX4A 1IBMK 4M3XA 1MWKA 3SJJA 4KH5A 5BRHA 2BUPA 1HJOA 3C6UA 4IG0A 4B9LA 3S9HA 2DTUA 3VQPA 1LWEA 4DFKA 2PAVA 3QINA 3S3OA 3D2EA 4OO1J 5J2NA 2W40A 3AVHA 4IFVA 4Y0WA 3MN7A 3WNFA 3HVTA 4JRQA 1Q8IA 5CZ2A 4AM7A 2X78A 1OH8A 3SNNA 3QMLA 4DQPA 1VAZA 4B9TA 3WXLA 4PA1A 1SZ2A 3AGKA 1QS4A 4BC5A 4DSFA 3EE8A 2IVOA 4B9NA 4FWLA 1TAUA 4BR2A 4CEDA 1XUPO 2ETJA 4A2AA 2EWSA 1NK7A 4CESA 1S1WA 3IMXA 3K5OA 2VG6A 3U4LA 3VF2A 4BRFA 4CHNA 4B3MK 3KK3A 3NGIA 3VF4A 3ZT4A 3L3UA 3MXMA 2DPNA 1YUWA 5AQZA 2HHWA 4FLXA 4W5OA 2I5JA 4H0VB 4DR5K 4BC3A 4A61A 4FK0A 3TPQA 1VQLN 1Q82O 2FBXA 4HVJA 5ADXA 3LP0A 3U8XA 3ZSRA 4LY7A 4PKHA 1WAFA 2IS3A 3AVJA 3FZHA 1NJIO 4M3WA 4KBOA 4DTNA 2XY5A 1TV6A 1NJWA 3ZT0A 4IDHA 4A5BA 2W6KA 3Q7CA 3OYJA 5BN8A 1O1WA 4ISGA 2YJFA 2BDPA 2P9UA 3HBTA 1J5EK 1L3VA 2YNGA 3ZEUA 1BU6O 2HMPA 3GG4A 1U47A 4ILJA 3KZBA 4X65K 5F1XA 2YHAA 4CHYA 3ITHA 3KHYA 1JXBA 2WTUA 4DFMA 3BP8A 2CH6A 3ATVA 3O08A 5T7BA 1HR0K 3TR8A 4E19A 1IKVA 3VQ8A 4E7LA 1N6QA 4BGBA 1VQKN 3CCRN 4E7HA 3SI6A 3GBTA 2P9PB 1DT9A 3MMVA 1ZBUA 1HYSA 4CERA 2QK9A 2KHOA 4OPKA 2G8WA 1QQNA 4E1NA 5ADXH 2P9SB 1B9DA 4H4OA 1QHTA 1ESVA 3G0ZA 4JKGB 1K8KA 4DV5K 3V81A 3VEOA 4B08A 3PX4A 4GVMA 4EHUA 3OA9A 1TK0A 1VSFA 2G8HA 2VWJA 2VQFK 2NUBA 4M7YA 4M41A 3ZSOA 4CVNE 2KZMA 3RR8A 4DCHA 5FPEA 1BA0A 3RRHA 1RFQA 2J4RA 1XI1A 2E8AA 3CCEN 4LH4A 3HTVA 4NYNA 1XMQK 5AFUA 1HNXK 2YNIA 2KZZA 2F9TA 4JI3K 4YOWA 4ILGB 5M1NA 4FXDA 3DLEA 4BRMA 1VQ5N 3MWTA 3L3VA 3NF6A 3DYAA 3CI5A 3AVBA 1RBSA 4M3RA 3WEEA 3DXKB 3HXMA 4TSXA 3NFAA 1U48A 1KAXA 3N4PA 3DLRA 2PZSA 4PQUA 1XNQK 3O9UA 4BRLA 2NNWA 2EX3A 4DSEA 4CIGA 1BQNA 3CCJN 3VEYA 2O4GA 4H5TA 4FO0A 3SQ0A 1D8YA 3A5OC 4CEQA 5GAGP 2O8CA 3V9XA 4NLBA 4CFAA 4AQYK 2ASMA 4M7XA 4PWDA 4XIUA 1QTMA 3MEDA 3AO2A 3LDPA 4AHCA 2O4IA 4YOUA 4JLHA 4IJAA 1N33K 1KLMA 5AFUH 1NJYA 3L4IA 1U2VB 5I42A 4CHOA 1YHQN 1DTQA 3BF1A 1ZYQA 4BWMA 2P9NA 3OYHA 3KWIA 1ZBIA 1WSJA 4OKKA 3DM2A 4IWVA 4B9MA 3V1QA 2GUPA 2KFZA 3VPZA 5FRNA 1NKEA 1ATSA 1UA1A 5FLXO 4FM0A 4CJSA 4ZTFA 4AF1A 2ASOA 1RTJA 4FJNA 5JS1A 5KPTA 2F8TA 4NO7A 5FPNA 3MCPA 2F7TA 1RBTA 1X9MA 4CEZA 2O8DB 3R8EA 5BRDA 2IVPA 1NJZA 3T1AA 3C6HA 4DKWA 3LM2A 4CEAA 3D45A 4KB1A 2ASPA 3VGKA 5BPLA 4LF4K 3CHWA 3E01A 4QOZB 1X9WA 1TYQA 2O8BA 4ELTA 3OJSA 3MCAB 3LPUA 1XQSC 3KKSA 4OPAA 1N8RO 3VENA 3EEQA 4CGGA 1J5OA 5AZIA 4BR0A 3WUHA 1T7PA 3MWPA 3KK1A 1BQMA 5AQQA 3ATUA 2HNDA 4E7JA 2G8KA 1VRTA 2HBKA 3CJAA 4ISEA 3SBGA 3H3NO 3SCXA 1SV5A 2VG7A 4N5SA 4BRGA 3I33A 1DGKN 3QESA 1VQ4N 3NCIA 3IAYA 4B1WB 1MDUB 3R6MA 1BHLA 3H46O 2F8SA 4B9VA 3WXMB 4B8CA 4JK7A 3T7ZA 3ZETB 2XY6A 4N41A 3H1QA 3CCSN 2NZTA 3HSCA 4CEOA 5F0XA 3VA3A 2UUBK 1JL2A 4DR4K 3WNHA 3VOVA 3HK2A 4O4GA 4GW6A 1X3NA 3R3LA 3VA0A 3TARA 1TL3A 2PYJA 1A5WA 2Z1GA 1LW0A 4E1MA 3OTOK 3ZSQA 3O1BA 1O13A 3HPHA 4WQ5A 1QSYA 1YT3A 3TABA 4BR5A 3MEEA 3ZSVA 5HL7L 4HTLA 1QSSA 2E6MA 1KAYA 3E66A 1LAWA 2RHKA 4CBUA 3NBPA 3CCMN 5JLHA 4OGCA 4FLVA 3THXA 1Q7YO 3DJCA 1R0AA 3FR0A 3M8SA 1IBLK 5AQPA 4MDAA 3U9DA 4LC9B 3THWB 4CJTA 2OZSA 1VQ7N 3EL2A 3CQXA 1RDUA 3VEXA 3NDKA 4H5NA 4CZLA 2Y1IA 1HKGA 3GOIA 4I6MB 4J8FA 4BG9A 3VQ9A 1VK0A 4YHHK 4KO0A 1D9DA 3OVNA 3OYBA 1N36K 2DFHA 3J7ZO 4DF8A 4BDZA 3QIPA 4C8LA 4BE0A 3AVGA 3TAEA 4O8UA 2V52B 2NLXA 2Q1NA 3I0RA 1FK9A 4JHDA 1RTDA 2YX6A 1LV5A 3KK2A 3SUNA 4LF8K 2UXBK 3TTCA 4JNEA 1VQMN 2IGIA 3SJHA 4YOXA 3MN5A 3KD1E 5LMUK 2E2QA 5C25A 1JCFA 4DSJA 2P9LA 3FZMA 2Q3SA 4CK3A 4ID1A 1W9HA 4GMJB 3ULEB 2P9IA 2QKKA 3RR7A 1VQ8N 3VQCA 1S72N 4WYBA 4H0TB 3N4QA 2ZJQL 4FOIA 2HBMA 3A8YA 1IJJA 1HLUA 3RMCA 4DLGA 3S3MA 4BACA 4BRPA 4B1XB 2FLOA 3O3FA 2HVHA 4RW4A 5AQYA 5I9EB 1YIJN 3O3HA 2NRTA 3CETA 4JS4A 3C0BA 3O5BA 3DRRA 3CXCM 2V51B 3L2RA 2E6LA 1C1AA 2O8EB 4DTOA 4LF7K 2GV9A 4CEFA 4IEIA 1IKYA 5J1EA 4GNIA 3AO3A 4QCLA 4EIAA 1JLEA 4CZGA 3SK3A 3HM9A 1WSGA 1HUXA 3F9KA 3M5RA 4FM2A 3FZLA 4W5QA 1M1KO 3C6TA 1NK4A 4CZMA 3WQTA 3VQQA 2D0PA 3DLBA 1VSKA 3HM8A 4DLEA 1NGBA 4H0YB 3K2PA 1SKRA 2QXFA 4BRNA 3CPEA 3LWLA 1NGIA 3BUZB 2R7YA 4DR2K 4NXNK 1S1UA 3I8BA 1GOCA 4FJKA 4H5WA 4MLHA 1S1XA 3BZKA 5J2MA 1RT2A 3MX5A 3SBTA 4X66K 1OH7A 3PIOL 3L8BA 4DSIA 1CZBA 1SQKA 4K42A 3VTIA 5KQ8A 3EE9A 4IG3A 2HHXA 1NMNA 1VSIA 3HL8A 1KRPA 1VQNN 4FLZA 3RVCA 3KLGA 4LFAK 4KHUA 4RW7A 1EO1A 3LANA 1VSDA 2D0AA 2ZQBA 2H3GX 2O8FB 1MA9B 3I8DA 1NWKA 3JAMO 1BIZA 1TKXA 5JLFA 1HQEA 4JI4K 3MECA 3L4QA 4CJ5A 2PY5A 4I7FA 4UQGA 3C7NB 2CGKA 4F4KA 4OLAA 4IO8A 4F2SA 1RGIA 4CJEA 3EKUA 2W41A 3J81O 1V4TA 3ZT3A 4DV1K 4CZJA 4E7IA 3MXJA 4Q5VA 2YHYA 5AZJB 1IKXA 3SQ2A 1Q86O 3GL1A 4DHYA 1IG9A 3OYCA 3T19A 2G8VA 3L2VA 4CEBA 5HRSA 3WXKA 3E9PA 2W42A 3SAHA 3DRSA 4C1NI 1KXPA 1K8KB 2D0CA 4LFBK 2I7PA 3SMPA 3ZYYX 1KLNA 4O5FA 4EAHD 3SAFA 3EZWA 2GBZA 5BPNA 4G1QA 3AAPA 4N47A 4B8AB 1BO5O 2VCPA 2B5JA 4WFBL 4CZEA 4ISFA 2IOCA 2UUCK 3ID6A 3NGYA 4DTMA 1KD1O 1BGXT 2JWKA 2Z1HA 5A2QO 5AQHA 2QWMA 5M1FA 4KI6A 2KQ2A 1GLEG 5J2PA 5E84A 5AQUA 1E4GT 5TKYA 3ZSXA 2A1RA 3CG7A 1XMOK 4YNQA 1KFSA 3KKRA 3VQ4A 4M3TA 1JLCA 3DWLA 4RG8A 4KPYA 5EVZA 2ZD1A 1R59O 1ATNA 4DTPA 1RTHA 1IG8A 4H5VA 5FRMA 1XHZA 3D0PA 4FWQA 3CERA 4W5RA 3HZ6A 3BGRA 4OLBA 3B8AX 3H45C 1YJ9N 2WFBA 2NRZA 3T1HK 1QZ5A 4RTFD 5AQGA 4AH9A 3IFRA 5LL6Z 3ZT1A 5HRRA 1RILA 4FCYA 1OH5A 4CCHA 2O8CB 3D7EO 1XC9A 1QQCA 4FJHA 5HP1A 2YNHA 1D9FA 4J2EA 3AARA 2HBJA 4C8OA 1EWQA 1HQUA 4CGDA 1NKBA 1VQ9N 1UOCA 1BI4A 4ZHRA 4ID5A 1WSIA 4DQRA 2HMIA 3HVRA 1DEJA 3I56N 4JAXA 4Z4FA 4JI1K 1I94K 3HP9A 2RN2A 1YTUA 3CJCA 1C0FA 4FJGA 5EOYA 4FK2A 4KTWA 4BDYA 3V9ZA 4CJKA 5DK5A 2HB5A 2G8FA 5GAEP 4M45A 3A5NC 4Z4IA 3M8RA 4AHRA 3CC7N 3ENOA 4JI2K 1FW6A 2E88A 1GLCG 4Q0BA 2P1JA 1NGHA 4C8MA 4JK8A 1S5JA 2OTJN 4B9QA 4BRCA 4DR1K 4KV8A 1BG3A 3AO5A 4CJWA 3SQ1A 1YAGA 3DLHA 1KCFA 4B1ZA 1RDBA 3AO4A 1BISA 3UKUA 1GOAA 4AHTA 1T6CA 4CJLA 4BR9A 1I3AA 2RKIA 3FLCO 1SUQA 3CJ9A 2P9KA 2X6SA 3HP6A 3F73A 4Z94A 1TYQB 3TAPA 4JD2A 2O8BB 3J8AA 1ILYA 1BIUA 1CZAN 3JSMA 5E41A 2OCEA 3JXUA 4FJJA 1KAZA 2CGLA 4LSNA 2OA8A 1DLOA 2ZWHA 3VN5A 4LF5K 3VQ6A 3AA2A 4IZ9A 3O9SA 4OGEA 4DUYK 2FF3B 3L0QA 4KI4A 4H0XB 3AVMA 4CJUA 4IOXA 3CC4N 4DS5A 3FZKA 3CMEN 4ELVA 4JRPA 3P5JA 3O8MA 1IH7A 4B1VA 1RNHA 1FKPA 1JCEA 4DV0K 3VETA 3E9OA 1VSHA 1Y97A 3FFKB 5AQRA 4B3SK 4FPBA 2XO7A 3IKMA 5GINA 3WXJA 3CC2N 1K6YA 2BANA 4DU1A 1S3XA 1VSMA 2WONA 5JVGL 2PYLA 3W3DA 3DXMA 3THYB 1N5YA 3S3NA 2LSNA 3TSPA 1HRHA 1K9MO 2QM1A 4K25A 1NK0A 4BQZA 1W0HA 1BOTO 4H8KA 4IFYA 1LW2A 4FWMA 2QWOA 5HLFA 3CIPA 4M42A 1GLDG 4AHSA 2ATQA 4O5BA 3WQUA 2XY7A 4RWTA 2HHTA 1NGAA 1WN7A 1LOTB 4F3OA 1HX1A 1RBRA 2YJEA 4O0JA 3C95A 1VQPN 4M63C 3QO9A 1LCUA 3W0LA 3PSFA 3MEGA 1NK6A 4BVOA 3LALA 3A5MC 3M1FA 3P31A 4GKJK 1YJWN 1EQYA 3QEXA 3K9JA 1HNWK 5BPMA 1J53A 3AVIA 3M8QA 1ATRA 4ILHA 4LFCK 4YFUA 4BDPA 2NRRA 4JS5A 1S6QA 1BDGA 5BN9A 1S9GA 4FWKA 1HJRA 3NH0A
chains in the Genus database with same CATH topology
3VQ9A 4I2QA 1VK0A 4OVLA 4KO0A 1TL1A 2YNFA 4EP4A 4W5TA 3NHGA 1L3SA 1VSLA 1D9DA 3SV4A 4FJMA 1Z25A 3OVNA 3OYBA 3RMDA 1YTAA 3DOKA 4F3TA 2DFHA 4DF8A 5KTQA 1Q9YA 4BDZA 3QIPA 4C8LA 4BE0A 4PY5A 3AVGA 3TAEA 1B92A 2HNZA 3K58A 3OYGA 3RMBA 4WE1A 4C8NA 3K59A 4LD0A 2XY8A 3AO1A 4AHVA 1GOBA 3ZSZA 3NH2A 2HHQA 3I0RA 4AHUA 2P5OA 3RTVA 1FK9A 1RTDA 4KHWA 3P1GA 1LV5A 4KB0A 2B4JA 2YV0X 3KK2A 3QERA 3SUNA 2OPSA 3NF7A 1WSEA 2IGIA 3OS1A 3KLHA 1SL1A 3LPTA 4IDKA 3EY1A 4DTSA 3KD1E 3RMAA 3LAKA 3OYDA 4EZ9A 3NF9A 5C25A 4DSJA 3VQBA 1ITGA 4DTXA 2Q3SA 1JXEA 4CK3A 5I3UA 1Z26A 4ZTJA 3O4NA 3OYFA 4ID1A 1W9HA 4GMJB 2QKKA 1C0TA 1JLFA 1X1PA 4FW2A 5J2QA 1SL2A 3RR7A 3VQCA 1REVA 1RDAA 3BDPA 1BCMA 3TWHA 3RRGA 4OKEA 3QEPA 1EX4A 2HW3A 1JLBA 3LWMA 3H08A 3RMCA 4M3XA 4DLGA 4CFBA 4BACA 3SJJA 3S3MA 4ELUA 3NGZA 3C6UA 4IG0A 4B9LA 5SWMA 3O3FA 3S9HA 2DTUA 3KTQA 3VQPA 1LWEA 3IS9A 4DFKA 4RW4A 3QINA 2HVHA 5CY4A 3L2QA 1D5AA 3O3HA 3S3OA 4JS4A 1TKDA 4CGIA 3DRRA 5J2NA 3AVHA 4NCAA 4IFVA 1L3UA 2RPIA 3L2RA 2E6LA 1C1AA 4CF9A 3VQ5A 2FBVA 3ZSYA 5K14A 3IRXA 3HPOA 4DTOA 2GV9A 4CEFA 3SV3A 2A1SA 3WNFA 1IKYA 3WNEA 3HVTA 3KIOA 4JRQA 5J1EA 2X74A 3VQDA 3THVA 3B6OA 1C1BA 4CFDA 1Q8IA 5CZ2A 3AO3A 2X78A 5FDLA 3ZCMA 3LAMA 4QCLA 1WSHA 3SNNA 1JLEA 1TK8A 1U04A 3HM9A 4DQPA 1A5VA 1TKTA 3ASMA 1WSGA 2YKNA 1RT4A 4B9TA 4RW9A 2HNYA 3HPGA 4PA1A 4CIFA 3F9KA 1QS4A 4E3SA 4DSFA 4HUFA 4FM2A 4B9NA 4NCGA 4W5QA 3NH1A 3HSTB 1TAUA 3C6TA 1NK4A 3SUOA 3MXIA 3AA4A 4CEDA 4KTQA 2ETJA 1ZBLA 3EYZA 3LP3A 3QEIA 1NK7A 3VQQA 5DMRA 4CESA 1S1WA 3K5OA 3SUQA 2G8IA 1LAVA 1B9FA 2VG6A 4DQSA 1BCOA 3DLBA 1VSKA 3TAGA 4CHNA 2FC0A 3AVAA 4O0IA 4DLEA 3ALYA 3KK3A 3NGIA 3K2PA 4DQQA 1SKRA 2QXFA 3DOLA 3ZT4A 1LWCA 2HHUA 3L3UA 3MXMA 4M3UA 4CGJA 3LWLA 1MU2A 2R7YA 3FFIA 4HUEA 1S1UA 4FJKA 1GOCA 2HHWA 1C0UA 1S1XA 4FLXA 4OPJA 4W5OA 3DLKA 2I5JA 1RT2A 5J2MA 2E4LA 3TAQA 3L8BA 2X6NA 4DSIA 1CZBA 2IC3A 3OYLA 4FK0A 4OKJA 3HT3A 4OJRA 4IG3A 1NOZA 2HHXA 2HVIA 1HYZA 2FBXA 4HVJA 4CJVA 1VSIA 2WOMA 3HL8A 4CJRA 1KRPA 3AA3A 3LP0A 4FLZA 2IDOA 4LY7A 3ZSRA 3KLGA 4KHUA 1WAFA 2IS3A 3AVJA 4RW7A 4LSLA 3V9UA 3LANA 4Z0UA 1VSDA 2D0AA 2ZQBA 3CQ8A 4M3WA 2XY5A 4DTNA 1TV6A 1NJWA 4CHPA 3ZT0A 1QSLA 3DLGA 2JLEA 4CHZA 3I8DA 3OYJA 1U45A 1RT6A 1BIZA 1O1WA 1TKXA 5KGWA 4DWIA 4M3YA 1HQEA 3OS2A 3MECA 1S9EA 4CJ5A 3EZ5A 1Q9XA 2PY5A 2BDPA 3V1RA 4E89A 4I7FA 1L3VA 4UQGA 1WSFA 2YNGA 4F4KA 1U47A 4CECA 4OLAA 4F2SA 4DTUA 2YHAA 4CHYA 1SKWA 3ITHA 3RWUA 2YHBA 2FBTA 3AVKA 4CJEA 1T8EA 4Z4CA 1JXBA 1C0MA 4DFMA 3K5LA 5T7BA 3TR8A 3ZT3A 4E19A 4E7IA 1L3TA 2ZE2A 1IKVA 3MXJA 1DTTA 3VQ8A 3OYEA 4Q5VA 4E7LA 3TANA 1N6QA 3B6PA 4FK4A 1IO2A 1IKXA 1J9AA 4E7HA 3QIOA 4CJQA 3SQ2A 3PX0A 5JS2A 1IG9A 4Z4HA 3OYCA 3SI6A 1SKSA 3CM6A 4FLYA 3T19A 2G8VA 1ZBUA 4CEBA 3L2VA 4CERA 3QNOA 4J2AA 3NF8A 5HRSA 2QK9A 1HYSA 4OPKA 2W42A 4RW6A 2G8WA 4KREA 3PV8A 3DRSA 3AVFA 3OYIA 1VSEA 4E1NA 3L2WA 4CJ4A 1B9DA 1WLJA 1QHTA 4H4OA 2D0CA 3G0ZA 4J2BA 4CF2A 3V81A 4KHNA 2VG5A 2KFNA 1KLNA 3G10A 4HHTA 3DMJA 4B08A 3KJVA 1WNSA 3PX4A 1FKOA 4BE2A 4GVMA 3OY9A 3K5NA 2GBZA 1VSFA 4CE9A 1TK0A 1RBVA 2VWJA 2G8HA 2Y1JA 2NUBA 4G1QA 3VQ7A 4KRFA 4N47A 4B8AB 4M41A 1EKEA 4HCBA 3JYTA 3ZSOA 2B5JA 3ZT2A 3K57A 3RR8A 4FZZA 2KZMA 4RW8A 4DSKA 3RRHA 4CF8A 5C24A 2IOCA 3K5MA 1UA0A 1XI1A 4DTMA 3NGYA 3HYFA 4LH4A 4BWJA 1RBUA 1BGXT 4NYNA 1L5UA 2YNIA 4FLTA 2KZZA 2Z1HA 5HRNA 3SUPA 4FXDA 3DLEA 4KI6A 5HROA 2KQ2A 5J2PA 4DU3A 3ZSXA 2A1RA 4F2RA 3CG7A 4YNQA 1KFSA 3L3VA 3KKRA 3NF6A 3VQ4A 3V4IA 3DYAA 1JLCA 4IKFA 4M3TA 4RG8A 1TGOA 3AVBA 1RBSA 4M3RA 3HXMA 4KPYA 2IAJA 3AVNA 4TSXA 3NFAA 3TAMA 1U48A 2DFFA 2ZD1A 3U3GA 3DLRA 3TAFA 2PZSA 4EZ6A 4DTPA 4PQUA 1RTHA 4FLWA 2HHSA 5FRMA 1XHZA 3D0PA 1KVCA 4DSLA 3C94A 2EX3A 4W5RA 2BE2A 3BGRA 3QETA 4OLBA 4Z4EA 4DSEA 1FXXA 3CYMA 4FM1A 1EETA 4CIGA 4AH9A 1BQNA 2KW4A 2P51A 3ZT1A 5HRRA 1RILA 2O4GA 3OYAA 4FCYA 4KFBA 4CCHA 3SQ0A 1D8YA 4CFCA 1EXQA 4CJ3A 1XC9A 4CEQA 1T03A 1BL3A 1QQCA 5HP1A 2YNHA 1D9FA 2OZMA 4FJHA 3V9XA 4J2EA 1G15A 3HO1A 4CFAA 1JLGA 2XHBA 4DU4A 4FJ9A 2HHVA 3AVCA 4E7KA 5EU7A 4C8OA 1RCHA 1HQUA 4CGDA 3AV9A 1NKBA 4PWDA 4BE1A 3CM5A 2AJQA 1UOCA 1QE1A 4XIUA 4DQIA 1QTMA 1BI4A 3MEDA 4ZHRA 1ASWA 1F21A 1S1TA 4FVMA 3AO2A 1WSIA 4ID5A 4AHCA 2O4IA 2VWKA 1S1VA 3SYZA 4DQRA 4KAZA 2DFEA 2G8UA 3QLHA 4JLHA 2HMIA 3HVRA 1KLMA 4FJ8A 1SL0A 4ICLA 4Z4FA 1NJYA 3HP9A 4I2PA 2RN2A 5I42A 4CHOA 3OS0A 1T05A 2FBYA 1YTUA 1NKCA 4FJGA 1DTQA 1ZYQA 4FK2A 1KFDA 4KTWA 1JLAA 4BDYA 1RT7A 4BWMA 3V9ZA 1NK8A 4FJXA 3OYHA 3ULDA 1ZBIA 2YKMA 1NJXA 4CJKA 1WSJA 2HB5A 5DK5A 2D0BA 2G8FA 4OKKA 3DM2A 5FROA 4M45A 4Z4IA 4B9MA 3M8RA 3V1QA 4AHRA 4DMNA 4CIEA 2KFZA 1UAXA 5FRNA 1NKEA 4I9QA 5KRSA 4EP5A 4Q0BA 2P1JA 1U49A 4W5NA 3SPYA 1UA1A 4CEEA 3OYKA 4DTJA 4C8MA 1U4BA 1S5JA 1X9SA 4FM0A 4KHYA 4CJSA 4ZTFA 1RTJA 4KV8A 4CK2A 3L2UA 3CFPA 3KLIA 3AO5A 4FJNA 4CJWA 2XRIA 1XHXA 3SQ1A 5JS1A 2F8TA 4F8RA 4FJIA 2BGGA 3I0SA 1CXQA 4DS4A 1NOYA 3V1OA 3DLHA 1KCFA 1RDBA 1HYVA 1RBTA 3AO4A 1BISA 3SQ4A 4CEZA 3ISNC 4FW1A 3NE6A 1X9MA 1KSPA 4Y1DA 4CJFA 2QKBA 4B9SA 1NJZA 4N76A 4FYDA 1GOAA 4AHTA 3V9SA 3T1AA 4CJLA 2RF2A 1KVBA 1I3AA 4CEAA 2RKIA 3D45A 3WNGA 1SUQA 5SZTA 4KB1A 3M8PA 2X6SA 3HP6A 3F73A 1C1CA 3E01A 5CYQA 1EP4A 3CFRA 4QOZB 3TAPA 1X9WA 1BIUA 4Z4GA 1RT3A 4B3OA 1YVUA 4KHSA 3CFOA 5KI6A 3JSMA 5E41A 1IKWA 4ELTA 3OJSA 4FJJA 3LPUA 3DI6A 4LSNA 3AA5X 2OA8A 3ZSWA 3KKSA 2OPQA 1TVRA 3O3GA 3KLFA 1KTQA 3AVLA 2OYQA 4QAGA 4K8XA 1DLOA 3VN5A 4CGGA 3TI0A 4L8RB 3VQ6A 3AA2A 1J5OA 1VRUA 4NCBA 4KHQA 4OGEA 1LWFA 2D5RA 4PUOA 3OYNA 1T7PA 1RTIA 1C6VA 3PX6A 3KK1A 1BQMA 3LZJA 4KI4A 3AVMA 4CJUA 3KLEA 4CHQA 2HNDA 2Z1JA 4E7JA 4DS5A 2G8KA 3U6FA 1VRTA 4ELVA 4CF1A 3P5JA 4JRPA 1IH7A 1I39A 4FZXC 4FJLA 1NK5A 1RNHA 1FKPA 3SCXA 4HTUA 1SV5A 2VG7A 1JL1A 4N5SA 1VSHA 1Y97A 2F96A 3LP2A 3QEVA 2P5GA 3KD5E 4LH5A 3QESA 4FJ5A 2XO7A 4CGFA 3NCIA 4FJ7A 2GUIA 3IAYA 1UWBA 4KTZA 4MFBA 3LZIA 1TK5A 1VSJA 1K6YA 1HNIA 2BANA 2JGUA 4DU1A 1TAQA 3LDSA 1BHLA 1VSMA 1RDDA 2WONA 2PYLA 1XWLA 1J54A 5KRTA 2F8SA 3PUFA 1RDCA 4B9VA 4FLUA 4B8CA 1N5YA 3S3NA 2LSNA 1HRHA 3OJUA 4CF0A 1NK0A 2XY6A 3DRPA 4N41A 4KKOA 4O44A 4K8ZA 2KTQA 4FZYA 4J2DA 1W0HA 4H8KA 4CEOA 4IFYA 3VA3A 5HBMA 1JL2A 1LW2A 2OPPA 3QNNA 5HLFA 3WNHA 4HCCA 3HK2A 4M42A 4O4GA 4GW6A 4AHSA 2ATQA 4O5BA 3V9WA 1NK9A 3VA0A 2XY7A 3TARA 1CXUA 1TL3A 2HHTA 3PO4A 2EHGA 1BI4B 5CYMA 2PYJA 1A5WA 1ASUA 2Z1GA 1LW0A 5C42A 4E1MA 3MAQA 4DTRA 1S6PA 1WN7A 1ZBFA 3ZSQA 3V6DA 4CGHA 2OPRA 4CK1A 4F3OA 3U3YA 1RBRA 3P83D 1HPZA 5HRPA 3QEWA 4O0JA 1ASVA 4NYFA 3C95A 1ZBHA 4IBNA 3HPHA 1TKZA 5CZ1A 1QSYA 1RT1A 3HJFA 1CZ9A 1YT3A 3QO9A 4MQ3A 4H4MA 4I9LA 3TABA 1HMVA 3MEGA 3SPZA 1NK6A 4AILC 3MEEA 3ZSVA 4C8KA 3LALA 3OYMA 1QSSA 2E6MA 4DFJA 3VQEA 1KVAA 4E0DA 1A5XA 1LAWA 1JKHA 3NBPA 1RT5A 1JLQA 4DF4A 4OGCA 1WAJA 2B6AA 4HUGA 4FLVA 4N56A 3QEXA 1CLQA 3NAEA 4CJPA 4R5PA 1J53A 3O4QA 4B9UA 3AVIA 2DY4A 4DG1A 1R0AA 3M8SA 2ITGA 5D3GA 3LP1A 3A2FA 3M8QA 3VQAA 5KGXA 4Y1CA 4CJTA 2OZSA 4M3ZA 1HNVA 3PO5A 4YFUA 4BDPA 3UIQA 4JS5A 4O55A 3SZ2A 2Z1IA 3NDKA 1S6QA 3T3FA 1S9GA 4DFPA 3IG1A 1HJRA 2Y1IA 3PY8A 3NH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ9 A;  4I2Q A;  1VK0 A;  4OVL A;  4KO0 A;  1TL1 A;  2YNF A;  4EP4 A;  4W5T A;  3NHG A;  1L3S A;  1VSL A;  1D9D A;  3SV4 A;  4FJM A;  1Z25 A;  3OVN A;  3OYB A;  3RMD A;  1YTA A;  3DOK A;  4F3T A;  2DFH A;  4DF8 A;  5KTQ A;  1Q9Y A;  4BDZ A;  3QIP A;  4C8L A;  4BE0 A;  4PY5 A;  3AVG A;  3TAE A;  1B92 A;  2HNZ A;  3K58 A;  3OYG A;  3RMB A;  4WE1 A;  4C8N A;  3K59 A;  4LD0 A;  2XY8 A;  3AO1 A;  4AHV A;  1GOB A;  3ZSZ A;  3NH2 A;  2HHQ A;  3I0R A;  4AHU A;  2P5O A;  3RTV A;  1FK9 A;  1RTD A;  4KHW A;  3P1G A;  1LV5 A;  4KB0 A;  2B4J A;  2YV0 X;  3KK2 A;  3QER A;  3SUN A;  2OPS A;  3NF7 A;  1WSE A;  2IGI A;  3OS1 A;  3KLH A;  1SL1 A;  3LPT A;  4IDK A;  3EY1 A;  4DTS A;  3KD1 E;  3RMA A;  3LAK A;  3OYD A;  4EZ9 A;  3NF9 A;  5C25 A;  4DSJ A;  3VQB A;  1ITG A;  4DTX A;  2Q3S A;  1JXE A;  4CK3 A;  5I3U A;  1Z26 A;  4ZTJ A;  3O4N A;  3OYF A;  4ID1 A;  1W9H A;  4GMJ B;  2QKK A;  1C0T A;  1JLF A;  1X1P A;  4FW2 A;  5J2Q A;  1SL2 A;  3RR7 A;  3VQC A;  1REV A;  1RDA A;  3BDP A;  1BCM A;  3TWH A;  3RRG A;  4OKE A;  3QEP A;  1EX4 A;  2HW3 A;  1JLB A;  3LWM A;  3H08 A;  3RMC A;  4M3X A;  4DLG A;  4CFB A;  4BAC A;  3SJJ A;  3S3M A;  4ELU A;  3NGZ A;  3C6U A;  4IG0 A;  4B9L A;  5SWM A;  3O3F A;  3S9H A;  2DTU A;  3KTQ A;  3VQP A;  1LWE A;  3IS9 A;  4DFK A;  4RW4 A;  3QIN A;  2HVH A;  5CY4 A;  3L2Q A;  1D5A A;  3O3H A;  3S3O A;  4JS4 A;  1TKD A;  4CGI A;  3DRR A;  5J2N A;  3AVH A;  4NCA A;  4IFV A;  1L3U A;  2RPI A;  3L2R A;  2E6L A;  1C1A A;  4CF9 A;  3VQ5 A;  2FBV A;  3ZSY A;  5K14 A;  3IRX A;  3HPO A;  4DTO A;  2GV9 A;  4CEF A;  3SV3 A;  2A1S A;  3WNF A;  1IKY A;  3WNE A;  3HVT A;  3KIO A;  4JRQ A;  5J1E A;  2X74 A;  3VQD A;  3THV A;  3B6O A;  1C1B A;  4CFD A;  1Q8I A;  5CZ2 A;  3AO3 A;  2X78 A;  5FDL A;  3ZCM A;  3LAM A;  4QCL A;  1WSH A;  3SNN A;  1JLE A;  1TK8 A;  1U04 A;  3HM9 A;  4DQP A;  1A5V A;  1TKT A;  3ASM A;  1WSG A;  2YKN A;  1RT4 A;  4B9T A;  4RW9 A;  2HNY A;  3HPG A;  4PA1 A;  4CIF A;  3F9K A;  1QS4 A;  4E3S A;  4DSF A;  4HUF A;  4FM2 A;  4B9N A;  4NCG A;  4W5Q A;  3NH1 A;  3HST B;  1TAU A;  3C6T A;  1NK4 A;  3SUO A;  3MXI A;  3AA4 A;  4CED A;  4KTQ A;  2ETJ A;  1ZBL A;  3EYZ A;  3LP3 A;  3QEI A;  1NK7 A;  3VQQ A;  5DMR A;  4CES A;  1S1W A;  3K5O A;  3SUQ A;  2G8I A;  1LAV A;  1B9F A;  2VG6 A;  4DQS A;  1BCO A;  3DLB A;  1VSK A;  3TAG A;  4CHN A;  2FC0 A;  3AVA A;  4O0I A;  4DLE A;  3ALY A;  3KK3 A;  3NGI A;  3K2P A;  4DQQ A;  1SKR A;  2QXF A;  3DOL A;  3ZT4 A;  1LWC A;  2HHU A;  3L3U A;  3MXM A;  4M3U A;  4CGJ A;  3LWL A;  1MU2 A;  2R7Y A;  3FFI A;  4HUE A;  1S1U A;  4FJK A;  1GOC A;  2HHW A;  1C0U A;  1S1X A;  4FLX A;  4OPJ A;  4W5O A;  3DLK A;  2I5J A;  1RT2 A;  5J2M A;  2E4L A;  3TAQ A;  3L8B A;  2X6N A;  4DSI A;  1CZB A;  2IC3 A;  3OYL A;  4FK0 A;  4OKJ A;  3HT3 A;  4OJR A;  4IG3 A;  1NOZ A;  2HHX A;  2HVI A;  1HYZ A;  2FBX A;  4HVJ A;  4CJV A;  1VSI A;  2WOM A;  3HL8 A;  4CJR A;  1KRP A;  3AA3 A;  3LP0 A;  4FLZ A;  2IDO A;  4LY7 A;  3ZSR A;  3KLG A;  4KHU A;  1WAF A;  2IS3 A;  3AVJ A;  4RW7 A;  4LSL A;  3V9U A;  3LAN A;  4Z0U A;  1VSD A;  2D0A A;  2ZQB A;  3CQ8 A;  4M3W A;  2XY5 A;  4DTN A;  1TV6 A;  1NJW A;  4CHP A;  3ZT0 A;  1QSL A;  3DLG A;  2JLE A;  4CHZ A;  3I8D A;  3OYJ A;  1U45 A;  1RT6 A;  1BIZ A;  1O1W A;  1TKX A;  5KGW A;  4DWI A;  4M3Y A;  1HQE A;  3OS2 A;  3MEC A;  1S9E A;  4CJ5 A;  3EZ5 A;  1Q9X A;  2PY5 A;  2BDP A;  3V1R A;  4E89 A;  4I7F A;  1L3V A;  4UQG A;  1WSF A;  2YNG A;  4F4K A;  1U47 A;  4CEC A;  4OLA A;  4F2S A;  4DTU A;  2YHA A;  4CHY A;  1SKW A;  3ITH A;  3RWU A;  2YHB A;  2FBT A;  3AVK A;  4CJE A;  1T8E A;  4Z4C A;  1JXB A;  1C0M A;  4DFM A;  3K5L A;  5T7B A;  3TR8 A;  3ZT3 A;  4E19 A;  4E7I A;  1L3T A;  2ZE2 A;  1IKV A;  3MXJ A;  1DTT A;  3VQ8 A;  3OYE A;  4Q5V A;  4E7L A;  3TAN A;  1N6Q A;  3B6P A;  4FK4 A;  1IO2 A;  1IKX A;  1J9A A;  4E7H A;  3QIO A;  4CJQ A;  3SQ2 A;  3PX0 A;  5JS2 A;  1IG9 A;  4Z4H A;  3OYC A;  3SI6 A;  1SKS A;  3CM6 A;  4FLY A;  3T19 A;  2G8V A;  1ZBU A;  4CEB A;  3L2V A;  4CER A;  3QNO A;  4J2A A;  3NF8 A;  5HRS A;  2QK9 A;  1HYS A;  4OPK A;  2W42 A;  4RW6 A;  2G8W A;  4KRE A;  3PV8 A;  3DRS A;  3AVF A;  3OYI A;  1VSE A;  4E1N A;  3L2W A;  4CJ4 A;  1B9D A;  1WLJ A;  1QHT A;  4H4O A;  2D0C A;  3G0Z A;  4J2B A;  4CF2 A;  3V81 A;  4KHN A;  2VG5 A;  2KFN A;  1KLN A;  3G10 A;  4HHT A;  3DMJ A;  4B08 A;  3KJV A;  1WNS A;  3PX4 A;  1FKO A;  4BE2 A;  4GVM A;  3OY9 A;  3K5N A;  2GBZ A;  1VSF A;  4CE9 A;  1TK0 A;  1RBV A;  2VWJ A;  2G8H A;  2Y1J A;  2NUB A;  4G1Q A;  3VQ7 A;  4KRF A;  4N47 A;  4B8A B;  4M41 A;  1EKE A;  4HCB A;  3JYT A;  3ZSO A;  2B5J A;  3ZT2 A;  3K57 A;  3RR8 A;  4FZZ A;  2KZM A;  4RW8 A;  4DSK A;  3RRH A;  4CF8 A;  5C24 A;  2IOC A;  3K5M A;  1UA0 A;  1XI1 A;  4DTM A;  3NGY A;  3HYF A;  4LH4 A;  4BWJ A;  1RBU A;  1BGX T;  4NYN A;  1L5U A;  2YNI A;  4FLT A;  2KZZ A;  2Z1H A;  5HRN A;  3SUP A;  4FXD A;  3DLE A;  4KI6 A;  5HRO A;  2KQ2 A;  5J2P A;  4DU3 A;  3ZSX A;  2A1R A;  4F2R A;  3CG7 A;  4YNQ A;  1KFS A;  3L3V A;  3KKR A;  3NF6 A;  3VQ4 A;  3V4I A;  3DYA A;  1JLC A;  4IKF A;  4M3T A;  4RG8 A;  1TGO A;  3AVB A;  1RBS A;  4M3R A;  3HXM A;  4KPY A;  2IAJ A;  3AVN A;  4TSX A;  3NFA A;  3TAM A;  1U48 A;  2DFF A;  2ZD1 A;  3U3G A;  3DLR A;  3TAF A;  2PZS A;  4EZ6 A;  4DTP A;  4PQU A;  1RTH A;  4FLW A;  2HHS A;  5FRM A;  1XHZ A;  3D0P A;  1KVC A;  4DSL A;  3C94 A;  2EX3 A;  4W5R A;  2BE2 A;  3BGR A;  3QET A;  4OLB A;  4Z4E A;  4DSE A;  1FXX A;  3CYM A;  4FM1 A;  1EET A;  4CIG A;  4AH9 A;  1BQN A;  2KW4 A;  2P51 A;  3ZT1 A;  5HRR A;  1RIL A;  2O4G A;  3OYA A;  4FCY A;  4KFB A;  4CCH A;  3SQ0 A;  1D8Y A;  4CFC A;  1EXQ A;  4CJ3 A;  1XC9 A;  4CEQ A;  1T03 A;  1BL3 A;  1QQC A;  5HP1 A;  2YNH A;  1D9F A;  2OZM A;  4FJH A;  3V9X A;  4J2E A;  1G15 A;  3HO1 A;  4CFA A;  1JLG A;  2XHB A;  4DU4 A;  4FJ9 A;  2HHV A;  3AVC A;  4E7K A;  5EU7 A;  4C8O A;  1RCH A;  1HQU A;  4CGD A;  3AV9 A;  1NKB A;  4PWD A;  4BE1 A;  3CM5 A;  2AJQ A;  1UOC A;  1QE1 A;  4XIU A;  4DQI A;  1QTM A;  1BI4 A;  3MED A;  4ZHR A;  1ASW A;  1F21 A;  1S1T A;  4FVM A;  3AO2 A;  1WSI A;  4ID5 A;  4AHC A;  2O4I A;  2VWK A;  1S1V A;  3SYZ A;  4DQR A;  4KAZ A;  2DFE A;  2G8U A;  3QLH A;  4JLH A;  2HMI A;  3HVR A;  1KLM A;  4FJ8 A;  1SL0 A;  4ICL A;  4Z4F A;  1NJY A;  3HP9 A;  4I2P A;  2RN2 A;  5I42 A;  4CHO A;  3OS0 A;  1T05 A;  2FBY A;  1YTU A;  1NKC A;  4FJG A;  1DTQ A;  1ZYQ A;  4FK2 A;  1KFD A;  4KTW A;  1JLA A;  4BDY A;  1RT7 A;  4BWM A;  3V9Z A;  1NK8 A;  4FJX A;  3OYH A;  3ULD A;  1ZBI A;  2YKM A;  1NJX A;  4CJK A;  1WSJ A;  2HB5 A;  5DK5 A;  2D0B A;  2G8F A;  4OKK A;  3DM2 A;  5FRO A;  4M45 A;  4Z4I A;  4B9M A;  3M8R A;  3V1Q A;  4AHR A;  4DMN A;  4CIE A;  2KFZ A;  1UAX A;  5FRN A;  1NKE A;  4I9Q A;  5KRS A;  4EP5 A;  4Q0B A;  2P1J A;  1U49 A;  4W5N A;  3SPY A;  1UA1 A;  4CEE A;  3OYK A;  4DTJ A;  4C8M A;  1U4B A;  1S5J A;  1X9S A;  4FM0 A;  4KHY A;  4CJS A;  4ZTF A;  1RTJ A;  4KV8 A;  4CK2 A;  3L2U A;  3CFP A;  3KLI A;  3AO5 A;  4FJN A;  4CJW A;  2XRI A;  1XHX A;  3SQ1 A;  5JS1 A;  2F8T A;  4F8R A;  4FJI A;  2BGG A;  3I0S A;  1CXQ A;  4DS4 A;  1NOY A;  3V1O A;  3DLH A;  1KCF A;  1RDB A;  1HYV A;  1RBT A;  3AO4 A;  1BIS A;  3SQ4 A;  4CEZ A;  3ISN C;  4FW1 A;  3NE6 A;  1X9M A;  1KSP A;  4Y1D A;  4CJF A;  2QKB A;  4B9S A;  1NJZ A;  4N76 A;  4FYD A;  1GOA A;  4AHT A;  3V9S A;  3T1A A;  4CJL A;  2RF2 A;  1KVB A;  1I3A A;  4CEA A;  2RKI A;  3D45 A;  3WNG A;  1SUQ A;  5SZT A;  4KB1 A;  3M8P A;  2X6S A;  3HP6 A;  3F73 A;  1C1C A;  3E01 A;  5CYQ A;  1EP4 A;  3CFR A;  4QOZ B;  3TAP A;  1X9W A;  1BIU A;  4Z4G A;  1RT3 A;  4B3O A;  1YVU A;  4KHS A;  3CFO A;  5KI6 A;  3JSM A;  5E41 A;  1IKW A;  4ELT A;  3OJS A;  4FJJ A;  3LPU A;  3DI6 A;  4LSN A;  3AA5 X;  2OA8 A;  3ZSW A;  3KKS A;  2OPQ A;  1TVR A;  3O3G A;  3KLF A;  1KTQ A;  3AVL A;  2OYQ A;  4QAG A;  4K8X A;  1DLO A;  3VN5 A;  4CGG A;  3TI0 A;  4L8R B;  3VQ6 A;  3AA2 A;  1J5O A;  1VRU A;  4NCB A;  4KHQ A;  4OGE A;  1LWF A;  2D5R A;  4PUO A;  3OYN A;  1T7P A;  1RTI A;  1C6V A;  3PX6 A;  3KK1 A;  1BQM A;  3LZJ A;  4KI4 A;  3AVM A;  4CJU A;  3KLE A;  4CHQ A;  2HND A;  2Z1J A;  4E7J A;  4DS5 A;  2G8K A;  3U6F A;  1VRT A;  4ELV A;  4CF1 A;  3P5J A;  4JRP A;  1IH7 A;  1I39 A;  4FZX C;  4FJL A;  1NK5 A;  1RNH A;  1FKP A;  3SCX A;  4HTU A;  1SV5 A;  2VG7 A;  1JL1 A;  4N5S A;  1VSH A;  1Y97 A;  2F96 A;  3LP2 A;  3QEV A;  2P5G A;  3KD5 E;  4LH5 A;  3QES A;  4FJ5 A;  2XO7 A;  4CGF A;  3NCI A;  4FJ7 A;  2GUI A;  3IAY A;  1UWB A;  4KTZ A;  4MFB A;  3LZI A;  1TK5 A;  1VSJ A;  1K6Y A;  1HNI A;  2BAN A;  2JGU A;  4DU1 A;  1TAQ A;  3LDS A;  1BHL A;  1VSM A;  1RDD A;  2WON A;  2PYL A;  1XWL A;  1J54 A;  5KRT A;  2F8S A;  3PUF A;  1RDC A;  4B9V A;  4FLU A;  4B8C A;  1N5Y A;  3S3N A;  2LSN A;  1HRH A;  3OJU A;  4CF0 A;  1NK0 A;  2XY6 A;  3DRP A;  4N41 A;  4KKO A;  4O44 A;  4K8Z A;  2KTQ A;  4FZY A;  4J2D A;  1W0H A;  4H8K A;  4CEO A;  4IFY A;  3VA3 A;  5HBM A;  1JL2 A;  1LW2 A;  2OPP A;  3QNN A;  5HLF A;  3WNH A;  4HCC A;  3HK2 A;  4M42 A;  4O4G A;  4GW6 A;  4AHS A;  2ATQ A;  4O5B A;  3V9W A;  1NK9 A;  3VA0 A;  2XY7 A;  3TAR A;  1CXU A;  1TL3 A;  2HHT A;  3PO4 A;  2EHG A;  1BI4 B;  5CYM A;  2PYJ A;  1A5W A;  1ASU A;  2Z1G A;  1LW0 A;  5C42 A;  4E1M A;  3MAQ A;  4DTR A;  1S6P A;  1WN7 A;  1ZBF A;  3ZSQ A;  3V6D A;  4CGH A;  2OPR A;  4CK1 A;  4F3O A;  3U3Y A;  1RBR A;  3P83 D;  1HPZ A;  5HRP A;  3QEW A;  4O0J A;  1ASV A;  4NYF A;  3C95 A;  1ZBH A;  4IBN A;  3HPH A;  1TKZ A;  5CZ1 A;  1QSY A;  1RT1 A;  3HJF A;  1CZ9 A;  1YT3 A;  3QO9 A;  4MQ3 A;  4H4M A;  4I9L A;  3TAB A;  1HMV A;  3MEG A;  3SPZ A;  1NK6 A;  4AIL C;  3MEE A;  3ZSV A;  4C8K A;  3LAL A;  3OYM A;  1QSS A;  2E6M A;  4DFJ A;  3VQE A;  1KVA A;  4E0D A;  1A5X A;  1LAW A;  1JKH A;  3NBP A;  1RT5 A;  1JLQ A;  4DF4 A;  4OGC A;  1WAJ A;  2B6A A;  4HUG A;  4FLV A;  4N56 A;  3QEX A;  1CLQ A;  3NAE A;  4CJP A;  4R5P A;  1J53 A;  3O4Q A;  4B9U A;  3AVI A;  2DY4 A;  4DG1 A;  1R0A A;  3M8S A;  2ITG A;  5D3G A;  3LP1 A;  3A2F A;  3M8Q A;  3VQA A;  5KGX A;  4Y1C A;  4CJT A;  2OZS A;  4M3Z A;  1HNV A;  3PO5 A;  4YFU A;  4BDP A;  3UIQ A;  4JS5 A;  4O55 A;  3SZ2 A;  2Z1I A;  3NDK A;  1S6Q A;  3T3F A;  1S9G A;  4DFP A;  3IG1 A;  1HJR A;  2Y1I A;  3PY8 A;  3NH0 A; 
#chains in the Genus database with same CATH topology
 1NGD A;  5B8H A;  1TL1 A;  4DB3 A;  3SV4 A;  4F3T A;  3G4S N;  1X9J A;  2GEL A;  2OTL N;  4IXC A;  4V19 S;  4PY5 A;  3K58 A;  3RMB A;  4BRA A;  2XY8 A;  3AO1 A;  2QTD A;  4OX9 K;  2GTD A;  3EN9 A;  4JHD B;  3NH2 A;  3UKR B;  5EY4 A;  4WQ4 C;  1IV0 A;  3VMF B;  2YV0 X;  2VGM A;  1NLV A;  4EFH A;  1WSE A;  3O4W A;  3QFP A;  3KLH A;  3LPT A;  4YY3 K;  4CZH A;  5IWA K;  2PFU A;  1N34 K;  4BRE A;  3Q7B A;  4GVE A;  4DTX A;  2PBD A;  5C12 A;  2P9I B;  3OYF A;  3KK7 A;  4WQ4 A;  1E3M A;  4FW2 A;  4BR7 A;  2P9P A;  1WBB A;  3RRG A;  1KC8 O;  1NGF A;  4GV6 A;  5M1O A;  1OH6 A;  4YOY A;  4CFB A;  3IUC A;  1VQ6 N;  4JKG A;  5KPR A;  4GV3 A;  2V7Y A;  5SWM A;  4XH4 A;  3IS9 A;  4GY2 B;  1OVQ A;  5CY4 A;  3L2Q A;  1D5A A;  5C2F A;  4CGI A;  4EHT A;  4JI5 K;  2E1Y A;  2ZM6 K;  4CF9 A;  2FBV A;  3HPO A;  5K14 A;  3SV3 A;  3WNE A;  1ZBL A;  4DV3 K;  3VQD A;  3THV A;  3B6O A;  2CGJ A;  2KLA A;  5JMV A;  4F9O A;  3LAM A;  4PL7 A;  1TK8 A;  2QWN A;  1U04 A;  4WFA L;  1A5V A;  3ZX3 A;  1TKT A;  3ASM A;  4PHT X;  2YKN A;  4WQ5 C;  3CCL N;  2QWQ A;  3LL3 A;  3G6E N;  4E3S A;  4HUF A;  1NBW A;  5FPM A;  2E20 A;  3SUO A;  3DXK A;  1GLL O;  1NGJ A;  4KTQ A;  4FWO A;  4FWS A;  3EYZ A;  3QEI A;  4WF9 L;  4CBW A;  4FVU A;  1BCO A;  3TAG A;  3D2F B;  2FC0 A;  3AVA A;  2UXD K;  3ALY A;  3ENH A;  4DQQ A;  3BF3 A;  2D4W A;  1LWC A;  4QS7 A;  3J80 O;  3SLC A;  4M3U A;  3FFI A;  3CQY A;  5CR4 A;  4YDU C;  1C0U A;  4BRK A;  3PSI A;  1T6D A;  4OPJ A;  3RSE A;  2A3Z A;  2ITM A;  3CMA N;  2X6N A;  4CBX A;  4OKJ A;  3HT3 A;  1NOZ A;  1T44 A;  1HYZ A;  1U2V A;  2WOM A;  3CJB A;  5CE3 A;  4CJR A;  3AA3 A;  4YDU A;  3L6Q A;  4LSL A;  4Z0U A;  3T69 A;  3CQ8 A;  1W2B M;  3DLG A;  4L3Q A;  4JKH A;  3VES A;  1RT6 A;  5KGW A;  2E2N A;  4DWI A;  1Q9X A;  4MLE A;  4K41 A;  3M6G A;  4BR4 A;  4FL9 A;  4DTU A;  4JKF A;  3RWU A;  2YHB A;  3AVK A;  1T8E A;  4Z4C A;  4A5A A;  3K5L A;  2O8D A;  4R79 A;  1L3T A;  2GWJ A;  3EO3 A;  1DTT A;  4JKE A;  3DLL L;  5JIC A;  4FK4 A;  1IO2 A;  5F2R A;  1J9A A;  4CJQ A;  3PX0 A;  1YVN A;  2VGN A;  1SS6 A;  1BUP A;  1SKS A;  4YOT A;  3QNO A;  4J2A A;  3NF8 A;  4RW6 A;  3AVF A;  2FF6 A;  1VSE A;  3L2W A;  1WLJ A;  4CF2 A;  5E26 A;  2QEX N;  1H1V A;  1NU0 A;  2HOE A;  2KFN A;  3DMJ A;  3KJV A;  3OY9 A;  3HI0 A;  3D2E B;  3K9K A;  4CE9 A;  3K5N A;  2HHH K;  3VQ7 A;  4DUZ K;  4KRF A;  1T3V A;  4HCB A;  3ZT2 A;  5AQS A;  4FZZ A;  3LDN A;  4CF8 A;  1UA0 A;  1GLA G;  4BWJ A;  1GLJ O;  4FLT A;  4JK9 A;  3ZX2 A;  5HRN A;  2D0O A;  3F5T A;  2E2O A;  4DR3 K;  1NGE A;  1IBK K;  1WOQ A;  4DU3 A;  4F2R A;  2VYP A;  3V4I A;  4IKF A;  2A5X A;  3J7Y P;  3TAM A;  2DFF A;  3U3G A;  1QVF M;  4EZ6 A;  2HHS A;  2ZJR L;  4FSV A;  3ZET A;  3QET A;  4Z4E A;  1FXX A;  1HPM A;  3CYM A;  3R9P A;  1EET A;  4FM1 A;  1V4S A;  2KW4 A;  2P51 A;  3OYA A;  1NNE A;  1RDW X;  2P5G A;  4CFC A;  1T03 A;  1G15 A;  4FJ9 A;  4DU4 A;  5EU7 A;  1RCH A;  3AV9 A;  4BE1 A;  1S1T A;  1F21 A;  4FVM A;  2VWK A;  2DFE A;  2E1Z A;  3SAG A;  3QLH A;  2HST A;  1SL0 A;  3O9Q A;  4ICL A;  3H1V X;  5C0Y A;  2UU9 K;  3A0I X;  1T05 A;  2QA4 N;  1KFD A;  1RT7 A;  4RCH A;  2YKM A;  5FRO A;  1XNR K;  2HBL A;  5C2D A;  2ZF5 O;  4DMN A;  4CIE A;  3BEX A;  4EP5 A;  3HOT A;  2A6A A;  3AAQ A;  4DV4 K;  2P9U B;  1U4B A;  1X9S A;  3ZEU B;  1XC3 A;  3KLI A;  2XRI A;  1XHX A;  1VHX A;  4FJI A;  2OAN A;  3I0S A;  4DS4 A;  1NOY A;  3V1O A;  3UKU B;  4DV2 K;  2QWL A;  1HYV A;  4JKD A;  3ISN C;  4FW1 A;  4I6M A;  4CW7 B;  1KSP A;  4JI6 K;  4Y1D A;  4CJF A;  2QKB A;  4B9S A;  4N76 A;  5AQX A;  2RF2 A;  1KVB A;  3WNG A;  2YCH A;  4BRQ A;  3M8P A;  1C1C A;  3J7A P;  1N32 K;  3OBY A;  1RT3 A;  2Q0R A;  4KHS A;  3VF6 A;  4WFN L;  3CFO A;  3FGU A;  3DI6 A;  3AA5 X;  3ZSW A;  4CZK A;  4BRI A;  1TVR A;  3TSU A;  3AVL A;  2OYQ A;  4K8X A;  4L8R B;  2Q0U A;  4PUO A;  3OYN A;  2D1K A;  4JI8 K;  3T1Y K;  3PX6 A;  2GX9 A;  3KLE A;  4CHQ A;  1HNZ K;  3ULE A;  2CH5 A;  4BY9 C;  3GDQ A;  4CF1 A;  1NM1 A;  1I39 A;  1P8Z A;  4FJL A;  5ELZ A;  3CJ7 A;  1FJG K;  1JL1 A;  2ZJP L;  2F96 A;  3LP2 A;  3P39 A;  5AQN A;  4FJ5 A;  4FJ7 A;  2GUI A;  1UWB A;  4KTZ A;  4MFB A;  3ZX0 A;  4WCE L;  1TK5 A;  1VSJ A;  1HNI A;  3WEE B;  3LDS A;  1G99 A;  3UB5 A;  3DXM B;  3DAW A;  1XWL A;  1J54 A;  5KRT A;  4IO9 L;  1RDC A;  5GIP A;  4FLU A;  3VGL A;  2O8E A;  4JKB A;  3OJU A;  3KVG A;  4CF0 A;  3DRP A;  4J2D A;  4FWR A;  4B3R K;  4HCC A;  1ZBS A;  3PIP L;  3I55 N;  3VEV A;  1WBD A;  2QI2 A;  3PO4 A;  3P4I A;  5CYM A;  3H3O B;  4GV9 A;  3MAQ A;  1ZBF A;  3V6D A;  2RE2 A;  2OPR A;  3O1W A;  4MO5 A;  4CK1 A;  3U3Y A;  3P83 D;  3O9T A;  5HRP A;  3QEW A;  4NYF A;  3OHR A;  5CZ1 A;  5EXW A;  3HJF A;  4MQ3 A;  4I9L A;  3SPZ A;  2P9N B;  4H03 B;  4DFJ A;  3GE1 A;  1KVA A;  4E0D A;  1A5X A;  3G25 A;  1JKH A;  3NVM A;  1RT5 A;  3TU5 A;  4MDB A;  4JKA A;  1CLQ A;  4HUG A;  4N56 A;  1TUU A;  3TTD A;  4CJP A;  4BC2 A;  3MK6 A;  4KH6 A;  4XEI A;  1P90 A;  1QHA A;  3VQA A;  4JEP A;  2Q36 A;  4C23 A;  4Y1C A;  2YI1 A;  4M3Z A;  3PO5 A;  5AQM A;  3O80 A;  2BH1 A;  5AQO A;  4CI6 A;  2W6L A;  3T3F A;  4DFP A;  3IG1 A;  5HOO A;  4NXM K;  5LJW A;  5FPD A;  4OVL A;  1L3S A;  4EP4 A;  1GLB G;  3AY9 A;  1VSL A;  5AQJ A;  5M1P A;  1Z25 A;  5AJ3 K;  2O8F A;  3DOK A;  5KTQ A;  1QQM A;  3P38 A;  1Q18 A;  5AQV A;  1WUA A;  2YHX A;  4YOR A;  3CPW M;  4WE1 A;  5MLC Q;  3K59 A;  4LD0 A;  2HHQ A;  3C7N A;  2P5O A;  2V7Z A;  1K8A O;  5IT9 O;  4KHW A;  4CZF A;  2B4J A;  3QER A;  3NF7 A;  1SL1 A;  4JI0 K;  1HKB A;  5AZI B;  4EZ9 A;  4DR7 K;  2F4V K;  3VQB A;  5I3U A;  4ZTJ A;  3O4N A;  5TKW A;  5AZJ A;  1C0T A;  1JLF A;  1X1P A;  5J2Q A;  1SL2 A;  5AQL A;  3TWH A;  4OKE A;  4KH4 A;  2HW3 A;  1JLB A;  3LWM A;  3H08 A;  5AQW A;  4A62 A;  2KKZ A;  2GWK A;  3OBW A;  4ELU A;  3NGZ A;  4K0K K;  5JVH L;  3O9R A;  2NRV A;  3KTQ A;  1JCG A;  1QVG M;  1NMD A;  2VWB A;  4IEE A;  3WT0 A;  1TKD A;  4NCA A;  5GIO A;  1L3U A;  2RPI A;  4BVP A;  3VQ5 A;  3ZSY A;  3IRX A;  2A1S A;  3KIO A;  4U7B A;  2X74 A;  1C1B A;  4CFD A;  5FDL A;  3ZCM A;  1MWM A;  1WSH A;  1YF5 L;  4FOE A;  3C6A A;  4MO4 A;  2IIR A;  1RT4 A;  3H6E A;  4RW9 A;  2HNY A;  2FXU A;  3HPG A;  4CIF A;  2ZGZ A;  3O6W A;  4NCG A;  3NH1 A;  3HST B;  3MXI A;  3AA4 A;  4BRD A;  5GAD P;  3D6R A;  3LP3 A;  2BTF A;  3MN6 A;  5DMR A;  2VQE K;  2G8I A;  3SUQ A;  1W97 L;  1LAV A;  1B9F A;  4DQS A;  5H1S Q;  4O0I A;  5KPZ A;  5EX5 A;  2I7N A;  3DOL A;  5AR0 A;  2HHU A;  2FSJ A;  3QBX A;  4A59 A;  4CGJ A;  1MU2 A;  1D4X A;  4X62 K;  3THX B;  4HUE A;  3VEW A;  3RSE B;  4JKC A;  1M90 O;  3DLK A;  2E4L A;  3TAQ A;  1Z05 A;  1YJN N;  2Q2R A;  2IC3 A;  4PKI A;  1J6Z A;  3OYL A;  2UYT A;  4QS9 A;  4OJR A;  2HVI A;  4CJV A;  2IDO A;  3V9U A;  5BR8 K;  2AP1 A;  3HRG A;  3JS6 A;  4CHP A;  1QSL A;  2JLE A;  4CHZ A;  5C10 A;  1U45 A;  4M3Y A;  3OS2 A;  3FZF A;  1S9E A;  3EZ5 A;  5BR9 A;  1WB9 A;  3V1R A;  3F2K A;  4E89 A;  1WSF A;  3AGR A;  2NRW A;  5AQT A;  4CEC A;  4E1J A;  4JN4 A;  1SKW A;  2Q31 A;  5BRE A;  3K0S A;  1DKG D;  2FBT A;  1C0M A;  3QFU A;  3NVK A;  2P9L B;  2ZE2 A;  3OYE A;  3TAN A;  3B6P A;  2QWP A;  3BZC A;  3QIO A;  1E4F T;  5JS2 A;  4Z4H A;  2WUS A;  3CM6 A;  4FLY A;  3QB0 A;  3MDQ A;  5BRF A;  4KRE A;  3PV8 A;  3OYI A;  1BWF O;  3ID8 A;  4CJ4 A;  4IOC L;  2E5L K;  4J2B A;  2P9S A;  4KHN A;  4BGA A;  2VG5 A;  2AA4 A;  3R1X A;  3G10 A;  4HHT A;  1WNS A;  1FKO A;  4IFE A;  4BE2 A;  1RBV A;  1C0G A;  2Y1J A;  5C15 A;  3CJ1 A;  1EKE A;  3JYT A;  4BG8 A;  3K57 A;  3EKS A;  2E2P A;  4RW8 A;  4DSK A;  5C24 A;  3K5M A;  1NGC A;  1JJ2 M;  1Z6R A;  3HYF A;  1RBU A;  3KWG A;  1L5U A;  3SUP A;  4O8K A;  5HRO A;  5LMN K;  5M1Q A;  2WBN A;  4IOA L;  4DV7 K;  1YI2 N;  1TGO A;  4GKK K;  5GAH P;  2IAJ A;  3AVN A;  4OPH A;  3TAF A;  4FLW A;  3THY A;  1KVC A;  5DM7 L;  1BA1 A;  4DSL A;  3C94 A;  2BE2 A;  3LDQ A;  4U67 L;  4KFB A;  4CJ3 A;  1EXQ A;  1BL3 A;  4BRH A;  2OZM A;  1NG9 A;  3U9Z A;  2HHV A;  1JLG A;  3BY5 A;  2XHB A;  4JI7 K;  3AVC A;  4E7K A;  3CM5 A;  4FPA A;  4DQI A;  1QE1 A;  3NMU A;  2AJQ A;  1ASW A;  3OW2 M;  3C65 A;  3SYZ A;  1S1V A;  4KAZ A;  2G8U A;  4A57 A;  4DQ8 A;  4FJ8 A;  2IVN A;  3LM9 A;  3QBW A;  4I2P A;  3OS0 A;  4NB4 A;  2FBY A;  1NKC A;  3CF5 L;  1JLA A;  1NK8 A;  4FJX A;  3CCQ N;  3ULD A;  1NJX A;  2D0B A;  3UE5 A;  4IJN A;  4NLC A;  3VGM A;  1UAX A;  3LDO A;  4I9Q A;  5KRS A;  2Q97 A;  5AQI A;  4BC4 A;  1U49 A;  4W5N A;  4PKG A;  3SPY A;  5M1K A;  4CEE A;  3OYK A;  4DTJ A;  4KHY A;  1QZ6 A;  4CK2 A;  2A41 A;  3L2U A;  3CFP A;  1OVY A;  4F8R A;  2BGG A;  4HWI A;  1CXQ A;  3SQ4 A;  3NE6 A;  4LF6 K;  4FYD A;  4CD1 A;  3V9S A;  5SZT A;  5AQF A;  3QDK A;  4XH1 A;  5CYQ A;  4H5R A;  1EP4 A;  3CFR A;  4YOV A;  4Z4G A;  4B3O A;  1YVU A;  5KI6 A;  1IKW A;  3UKR A;  3VER A;  2OPQ A;  3O3G A;  3KLF A;  1KTQ A;  3FE1 A;  3CCV N;  4QAG A;  3HO1 A;  4KHQ A;  3TI0 A;  1ZXO A;  1VRU A;  4NCB A;  2GEM A;  1YIT N;  3HOS A;  1LWF A;  3WXI A;  2D5R A;  1YXQ A;  1RTI A;  1C6V A;  3LZJ A;  2QW9 A;  1NGG A;  2Z1J A;  1U6Z A;  3U6F A;  4FZX C;  1NK5 A;  1KQS M;  4G9Z A;  4HTU A;  3G71 N;  3QEV A;  5KQD A;  3KD5 E;  4LH5 A;  1TUY A;  2FSN A;  2JWL A;  3A5L C;  4CGF A;  4DV6 K;  3LZI A;  2JGU A;  1TAQ A;  2FSK A;  1X3M A;  1RDD A;  3M3Z A;  3PUF A;  2F9W A;  4BQL A;  3VEZ A;  3F9M A;  4KKO A;  2A42 A;  4O44 A;  4K8Z A;  1EWR A;  4FZY A;  2KTQ A;  3CD6 N;  5HBM A;  1W7A A;  2OPP A;  3QNN A;  4FWN A;  3V9W A;  5LY3 A;  1NK9 A;  3SMS A;  5LJV A;  4JYA K;  1CXU A;  3LDL A;  2EHG A;  2HF3 A;  3MN9 A;  1BI4 B;  1ASU A;  5C42 A;  4DTR A;  1S6P A;  4CGH A;  1GLF O;  4UY8 O;  1HPZ A;  4H0P A;  1ASV A;  4B1U B;  1ZBH A;  4IBN A;  1TKZ A;  1RT1 A;  3ENB A;  1CZ9 A;  3D2F A;  4H4M A;  1HMV A;  4AIL C;  1Q81 O;  4C8K A;  3OYM A;  4JV5 K;  2NRX A;  2QWR A;  3VQE A;  2WC9 A;  1K73 O;  1JLQ A;  4DF4 A;  4KHP K;  1WAJ A;  2B6A A;  3E1Y A;  3NAE A;  4R5P A;  4FWP A;  3O4Q A;  3QIC A;  3IDH A;  4B9U A;  2DY4 A;  4DG1 A;  2UXC K;  4A2B A;  2ITG A;  5D3G A;  3LP1 A;  3A2F A;  3S41 A;  1S22 A;  4CD3 A;  5KGX A;  4B1Y B;  1HNV A;  1Y64 A;  3THW A;  4X64 K;  3VTH A;  4QS8 A;  3UIQ A;  3SZ2 A;  4O55 A;  2Z1I A;  3TSQ A;  3ZLJ A;  1QQO A;  4CZI A;  3PLA A;  3PY8 A;  4LF9 K;  2QXL A;  4I2Q A;  4W5T A;  2YNF A;  3NHG A;  3E9L A;  4FJM A;  2YHW A;  3RMD A;  1YTA A;  4PL8 A;  1Q9Y A;  4B3T K;  2P9K B;  4XH5 A;  2UUA K;  1B92 A;  2HNZ A;  5CHI A;  3OYG A;  4JD2 B;  4C8N A;  4AHV A;  1GOB A;  3ZSZ A;  4AHU A;  3RTV A;  4C1N K;  3P1G A;  4KB0 A;  1SAZ A;  3MX2 A;  2OPS A;  1VQO N;  1HKC A;  3OS1 A;  4IDK A;  2NRH A;  3EY1 A;  3CCU N;  4DTS A;  4CJ7 A;  5AQK A;  3RMA A;  3LAK A;  3OYD A;  3NF9 A;  1ITG A;  2HF4 A;  4AM6 A;  4H0O A;  1JXE A;  1Z26 A;  4DR6 K;  3TTF A;  1OKJ A;  1ZC6 A;  2A40 A;  2ZGY A;  1REV A;  4BRO A;  1RDA A;  3BDP A;  1BCM A;  5DM6 L;  3QEP A;  4K43 A;  1EX4 A;  1IBM K;  4M3X A;  1MWK A;  3SJJ A;  4KH5 A;  5BRH A;  2BUP A;  1HJO A;  3C6U A;  4IG0 A;  4B9L A;  3S9H A;  2DTU A;  3VQP A;  1LWE A;  4DFK A;  2PAV A;  3QIN A;  3S3O A;  3D2E A;  4OO1 J;  5J2N A;  2W40 A;  3AVH A;  4IFV A;  4Y0W A;  3MN7 A;  3WNF A;  3HVT A;  4JRQ A;  1Q8I A;  5CZ2 A;  4AM7 A;  2X78 A;  1OH8 A;  3SNN A;  3QML A;  4DQP A;  1VAZ A;  4B9T A;  3WXL A;  4PA1 A;  1SZ2 A;  3AGK A;  1QS4 A;  4BC5 A;  4DSF A;  3EE8 A;  2IVO A;  4B9N A;  4FWL A;  1TAU A;  4BR2 A;  4CED A;  1XUP O;  2ETJ A;  4A2A A;  2EWS A;  1NK7 A;  4CES A;  1S1W A;  3IMX A;  3K5O A;  2VG6 A;  3U4L A;  3VF2 A;  4BRF A;  4CHN A;  4B3M K;  3KK3 A;  3NGI A;  3VF4 A;  3ZT4 A;  3L3U A;  3MXM A;  2DPN A;  1YUW A;  5AQZ A;  2HHW A;  4FLX A;  4W5O A;  2I5J A;  4H0V B;  4DR5 K;  4BC3 A;  4A61 A;  4FK0 A;  3TPQ A;  1VQL N;  1Q82 O;  2FBX A;  4HVJ A;  5ADX A;  3LP0 A;  3U8X A;  3ZSR A;  4LY7 A;  4PKH A;  1WAF A;  2IS3 A;  3AVJ A;  3FZH A;  1NJI O;  4M3W A;  4KBO A;  4DTN A;  2XY5 A;  1TV6 A;  1NJW A;  3ZT0 A;  4IDH A;  4A5B A;  2W6K A;  3Q7C A;  3OYJ A;  5BN8 A;  1O1W A;  4ISG A;  2YJF A;  2BDP A;  2P9U A;  3HBT A;  1J5E K;  1L3V A;  2YNG A;  3ZEU A;  1BU6 O;  2HMP A;  3GG4 A;  1U47 A;  4ILJ A;  3KZB A;  4X65 K;  5F1X A;  2YHA A;  4CHY A;  3ITH A;  3KHY A;  1JXB A;  2WTU A;  4DFM A;  3BP8 A;  2CH6 A;  3ATV A;  3O08 A;  5T7B A;  1HR0 K;  3TR8 A;  4E19 A;  1IKV A;  3VQ8 A;  4E7L A;  1N6Q A;  4BGB A;  1VQK N;  3CCR N;  4E7H A;  3SI6 A;  3GBT A;  2P9P B;  1DT9 A;  3MMV A;  1ZBU A;  1HYS A;  4CER A;  2QK9 A;  2KHO A;  4OPK A;  2G8W A;  1QQN A;  4E1N A;  5ADX H;  2P9S B;  1B9D A;  4H4O A;  1QHT A;  1ESV A;  3G0Z A;  4JKG B;  1K8K A;  4DV5 K;  3V81 A;  3VEO A;  4B08 A;  3PX4 A;  4GVM A;  4EHU A;  3OA9 A;  1TK0 A;  1VSF A;  2G8H A;  2VWJ A;  2VQF K;  2NUB A;  4M7Y A;  4M41 A;  3ZSO A;  4CVN E;  2KZM A;  3RR8 A;  4DCH A;  5FPE A;  1BA0 A;  3RRH A;  1RFQ A;  2J4R A;  1XI1 A;  2E8A A;  3CCE N;  4LH4 A;  3HTV A;  4NYN A;  1XMQ K;  5AFU A;  1HNX K;  2YNI A;  2KZZ A;  2F9T A;  4JI3 K;  4YOW A;  4ILG B;  5M1N A;  4FXD A;  3DLE A;  4BRM A;  1VQ5 N;  3MWT A;  3L3V A;  3NF6 A;  3DYA A;  3CI5 A;  3AVB A;  1RBS A;  4M3R A;  3WEE A;  3DXK B;  3HXM A;  4TSX A;  3NFA A;  1U48 A;  1KAX A;  3N4P A;  3DLR A;  2PZS A;  4PQU A;  1XNQ K;  3O9U A;  4BRL A;  2NNW A;  2EX3 A;  4DSE A;  4CIG A;  1BQN A;  3CCJ N;  3VEY A;  2O4G A;  4H5T A;  4FO0 A;  3SQ0 A;  1D8Y A;  3A5O C;  4CEQ A;  5GAG P;  2O8C A;  3V9X A;  4NLB A;  4CFA A;  4AQY K;  2ASM A;  4M7X A;  4PWD A;  4XIU A;  1QTM A;  3MED A;  3AO2 A;  3LDP A;  4AHC A;  2O4I A;  4YOU A;  4JLH A;  4IJA A;  1N33 K;  1KLM A;  5AFU H;  1NJY A;  3L4I A;  1U2V B;  5I42 A;  4CHO A;  1YHQ N;  1DTQ A;  3BF1 A;  1ZYQ A;  4BWM A;  2P9N A;  3OYH A;  3KWI A;  1ZBI A;  1WSJ A;  4OKK A;  3DM2 A;  4IWV A;  4B9M A;  3V1Q A;  2GUP A;  2KFZ A;  3VPZ A;  5FRN A;  1NKE A;  1ATS A;  1UA1 A;  5FLX O;  4FM0 A;  4CJS A;  4ZTF A;  4AF1 A;  2ASO A;  1RTJ A;  4FJN A;  5JS1 A;  5KPT A;  2F8T A;  4NO7 A;  5FPN A;  3MCP A;  2F7T A;  1RBT A;  1X9M A;  4CEZ A;  2O8D B;  3R8E A;  5BRD A;  2IVP A;  1NJZ A;  3T1A A;  3C6H A;  4DKW A;  3LM2 A;  4CEA A;  3D45 A;  4KB1 A;  2ASP A;  3VGK A;  5BPL A;  4LF4 K;  3CHW A;  3E01 A;  4QOZ B;  1X9W A;  1TYQ A;  2O8B A;  4ELT A;  3OJS A;  3MCA B;  3LPU A;  1XQS C;  3KKS A;  4OPA A;  1N8R O;  3VEN A;  3EEQ A;  4CGG A;  1J5O A;  5AZI A;  4BR0 A;  3WUH A;  1T7P A;  3MWP A;  3KK1 A;  1BQM A;  5AQQ A;  3ATU A;  2HND A;  4E7J A;  2G8K A;  1VRT A;  2HBK A;  3CJA A;  4ISE A;  3SBG A;  3H3N O;  3SCX A;  1SV5 A;  2VG7 A;  4N5S A;  4BRG A;  3I33 A;  1DGK N;  3QES A;  1VQ4 N;  3NCI A;  3IAY A;  4B1W B;  1MDU B;  3R6M A;  1BHL A;  3H46 O;  2F8S A;  4B9V A;  3WXM B;  4B8C A;  4JK7 A;  3T7Z A;  3ZET B;  2XY6 A;  4N41 A;  3H1Q A;  3CCS N;  2NZT A;  3HSC A;  4CEO A;  5F0X A;  3VA3 A;  2UUB K;  1JL2 A;  4DR4 K;  3WNH A;  3VOV A;  3HK2 A;  4O4G A;  4GW6 A;  1X3N A;  3R3L A;  3VA0 A;  3TAR A;  1TL3 A;  2PYJ A;  1A5W A;  2Z1G A;  1LW0 A;  4E1M A;  3OTO K;  3ZSQ A;  3O1B A;  1O13 A;  3HPH A;  4WQ5 A;  1QSY A;  1YT3 A;  3TAB A;  4BR5 A;  3MEE A;  3ZSV A;  5HL7 L;  4HTL A;  1QSS A;  2E6M A;  1KAY A;  3E66 A;  1LAW A;  2RHK A;  4CBU A;  3NBP A;  3CCM N;  5JLH A;  4OGC A;  4FLV A;  3THX A;  1Q7Y O;  3DJC A;  1R0A A;  3FR0 A;  3M8S A;  1IBL K;  5AQP A;  4MDA A;  3U9D A;  4LC9 B;  3THW B;  4CJT A;  2OZS A;  1VQ7 N;  3EL2 A;  3CQX A;  1RDU A;  3VEX A;  3NDK A;  4H5N A;  4CZL A;  2Y1I A;  1HKG A;  3GOI A;  4I6M B;  4J8F A;  4BG9 A;  3VQ9 A;  1VK0 A;  4YHH K;  4KO0 A;  1D9D A;  3OVN A;  3OYB A;  1N36 K;  2DFH A;  3J7Z O;  4DF8 A;  4BDZ A;  3QIP A;  4C8L A;  4BE0 A;  3AVG A;  3TAE A;  4O8U A;  2V52 B;  2NLX A;  2Q1N A;  3I0R A;  1FK9 A;  4JHD A;  1RTD A;  2YX6 A;  1LV5 A;  3KK2 A;  3SUN A;  4LF8 K;  2UXB K;  3TTC A;  4JNE A;  1VQM N;  2IGI A;  3SJH A;  4YOX A;  3MN5 A;  3KD1 E;  5LMU K;  2E2Q A;  5C25 A;  1JCF A;  4DSJ A;  2P9L A;  3FZM A;  2Q3S A;  4CK3 A;  4ID1 A;  1W9H A;  4GMJ B;  3ULE B;  2P9I A;  2QKK A;  3RR7 A;  1VQ8 N;  3VQC A;  1S72 N;  4WYB A;  4H0T B;  3N4Q A;  2ZJQ L;  4FOI A;  2HBM A;  3A8Y A;  1IJJ A;  1HLU A;  3RMC A;  4DLG A;  3S3M A;  4BAC A;  4BRP A;  4B1X B;  2FLO A;  3O3F A;  2HVH A;  4RW4 A;  5AQY A;  5I9E B;  1YIJ N;  3O3H A;  2NRT A;  3CET A;  4JS4 A;  3C0B A;  3O5B A;  3DRR A;  3CXC M;  2V51 B;  3L2R A;  2E6L A;  1C1A A;  2O8E B;  4DTO A;  4LF7 K;  2GV9 A;  4CEF A;  4IEI A;  1IKY A;  5J1E A;  4GNI A;  3AO3 A;  4QCL A;  4EIA A;  1JLE A;  4CZG A;  3SK3 A;  3HM9 A;  1WSG A;  1HUX A;  3F9K A;  3M5R A;  4FM2 A;  3FZL A;  4W5Q A;  1M1K O;  3C6T A;  1NK4 A;  4CZM A;  3WQT A;  3VQQ A;  2D0P A;  3DLB A;  1VSK A;  3HM8 A;  4DLE A;  1NGB A;  4H0Y B;  3K2P A;  1SKR A;  2QXF A;  4BRN A;  3CPE A;  3LWL A;  1NGI A;  3BUZ B;  2R7Y A;  4DR2 K;  4NXN K;  1S1U A;  3I8B A;  1GOC A;  4FJK A;  4H5W A;  4MLH A;  1S1X A;  3BZK A;  5J2M A;  1RT2 A;  3MX5 A;  3SBT A;  4X66 K;  1OH7 A;  3PIO L;  3L8B A;  4DSI A;  1CZB A;  1SQK A;  4K42 A;  3VTI A;  5KQ8 A;  3EE9 A;  4IG3 A;  2HHX A;  1NMN A;  1VSI A;  3HL8 A;  1KRP A;  1VQN N;  4FLZ A;  3RVC A;  3KLG A;  4LFA K;  4KHU A;  4RW7 A;  1EO1 A;  3LAN A;  1VSD A;  2D0A A;  2ZQB A;  2H3G X;  2O8F B;  1MA9 B;  3I8D A;  1NWK A;  3JAM O;  1BIZ A;  1TKX A;  5JLF A;  1HQE A;  4JI4 K;  3MEC A;  3L4Q A;  4CJ5 A;  2PY5 A;  4I7F A;  4UQG A;  3C7N B;  2CGK A;  4F4K A;  4OLA A;  4IO8 A;  4F2S A;  1RGI A;  4CJE A;  3EKU A;  2W41 A;  3J81 O;  1V4T A;  3ZT3 A;  4DV1 K;  4CZJ A;  4E7I A;  3MXJ A;  4Q5V A;  2YHY A;  5AZJ B;  1IKX A;  3SQ2 A;  1Q86 O;  3GL1 A;  4DHY A;  1IG9 A;  3OYC A;  3T19 A;  2G8V A;  3L2V A;  4CEB A;  5HRS A;  3WXK A;  3E9P A;  2W42 A;  3SAH A;  3DRS A;  4C1N I;  1KXP A;  1K8K B;  2D0C A;  4LFB K;  2I7P A;  3SMP A;  3ZYY X;  1KLN A;  4O5F A;  4EAH D;  3SAF A;  3EZW A;  2GBZ A;  5BPN A;  4G1Q A;  3AAP A;  4N47 A;  4B8A B;  1BO5 O;  2VCP A;  2B5J A;  4WFB L;  4CZE A;  4ISF A;  2IOC A;  2UUC K;  3ID6 A;  3NGY A;  4DTM A;  1KD1 O;  1BGX T;  2JWK A;  2Z1H A;  5A2Q O;  5AQH A;  2QWM A;  5M1F A;  4KI6 A;  2KQ2 A;  1GLE G;  5J2P A;  5E84 A;  5AQU A;  1E4G T;  5TKY A;  3ZSX A;  2A1R A;  3CG7 A;  1XMO K;  4YNQ A;  1KFS A;  3KKR A;  3VQ4 A;  4M3T A;  1JLC A;  3DWL A;  4RG8 A;  4KPY A;  5EVZ A;  2ZD1 A;  1R59 O;  1ATN A;  4DTP A;  1RTH A;  1IG8 A;  4H5V A;  5FRM A;  1XHZ A;  3D0P A;  4FWQ A;  3CER A;  4W5R A;  3HZ6 A;  3BGR A;  4OLB A;  3B8A X;  3H45 C;  1YJ9 N;  2WFB A;  2NRZ A;  3T1H K;  1QZ5 A;  4RTF D;  5AQG A;  4AH9 A;  3IFR A;  5LL6 Z;  3ZT1 A;  5HRR A;  1RIL A;  4FCY A;  1OH5 A;  4CCH A;  2O8C B;  3D7E O;  1XC9 A;  1QQC A;  4FJH A;  5HP1 A;  2YNH A;  1D9F A;  4J2E A;  3AAR A;  2HBJ A;  4C8O A;  1EWQ A;  1HQU A;  4CGD A;  1NKB A;  1VQ9 N;  1UOC A;  1BI4 A;  4ZHR A;  4ID5 A;  1WSI A;  4DQR A;  2HMI A;  3HVR A;  1DEJ A;  3I56 N;  4JAX A;  4Z4F A;  4JI1 K;  1I94 K;  3HP9 A;  2RN2 A;  1YTU A;  3CJC A;  1C0F A;  4FJG A;  5EOY A;  4FK2 A;  4KTW A;  4BDY A;  3V9Z A;  4CJK A;  5DK5 A;  2HB5 A;  2G8F A;  5GAE P;  4M45 A;  3A5N C;  4Z4I A;  3M8R A;  4AHR A;  3CC7 N;  3ENO A;  4JI2 K;  1FW6 A;  2E88 A;  1GLC G;  4Q0B A;  2P1J A;  1NGH A;  4C8M A;  4JK8 A;  1S5J A;  2OTJ N;  4B9Q A;  4BRC A;  4DR1 K;  4KV8 A;  1BG3 A;  3AO5 A;  4CJW A;  3SQ1 A;  1YAG A;  3DLH A;  1KCF A;  4B1Z A;  1RDB A;  3AO4 A;  1BIS A;  3UKU A;  1GOA A;  4AHT A;  1T6C A;  4CJL A;  4BR9 A;  1I3A A;  2RKI A;  3FLC O;  1SUQ A;  3CJ9 A;  2P9K A;  2X6S A;  3HP6 A;  3F73 A;  4Z94 A;  1TYQ B;  3TAP A;  4JD2 A;  2O8B B;  3J8A A;  1ILY A;  1BIU A;  1CZA N;  3JSM A;  5E41 A;  2OCE A;  3JXU A;  4FJJ A;  1KAZ A;  2CGL A;  4LSN A;  2OA8 A;  1DLO A;  2ZWH A;  3VN5 A;  4LF5 K;  3VQ6 A;  3AA2 A;  4IZ9 A;  3O9S A;  4OGE A;  4DUY K;  2FF3 B;  3L0Q A;  4KI4 A;  4H0X B;  3AVM A;  4CJU A;  4IOX A;  3CC4 N;  4DS5 A;  3FZK A;  3CME N;  4ELV A;  4JRP A;  3P5J A;  3O8M A;  1IH7 A;  4B1V A;  1RNH A;  1FKP A;  1JCE A;  4DV0 K;  3VET A;  3E9O A;  1VSH A;  1Y97 A;  3FFK B;  5AQR A;  4B3S K;  4FPB A;  2XO7 A;  3IKM A;  5GIN A;  3WXJ A;  3CC2 N;  1K6Y A;  2BAN A;  4DU1 A;  1S3X A;  1VSM A;  2WON A;  5JVG L;  2PYL A;  3W3D A;  3DXM A;  3THY B;  1N5Y A;  3S3N A;  2LSN A;  3TSP A;  1HRH A;  1K9M O;  2QM1 A;  4K25 A;  1NK0 A;  4BQZ A;  1W0H A;  1BOT O;  4H8K A;  4IFY A;  1LW2 A;  4FWM A;  2QWO A;  5HLF A;  3CIP A;  4M42 A;  1GLD G;  4AHS A;  2ATQ A;  4O5B A;  3WQU A;  2XY7 A;  4RWT A;  2HHT A;  1NGA A;  1WN7 A;  1LOT B;  4F3O A;  1HX1 A;  1RBR A;  2YJE A;  4O0J A;  3C95 A;  1VQP N;  4M63 C;  3QO9 A;  1LCU A;  3W0L A;  3PSF A;  3MEG A;  1NK6 A;  4BVO A;  3LAL A;  3A5M C;  3M1F A;  3P31 A;  4GKJ K;  1YJW N;  1EQY A;  3QEX A;  3K9J A;  1HNW K;  5BPM A;  1J53 A;  3AVI A;  3M8Q A;  1ATR A;  4ILH A;  4LFC K;  4YFU A;  4BDP A;  2NRR A;  4JS5 A;  1S6Q A;  1BDG A;  5BN9 A;  1S9G A;  4FWK A;  1HJR A;  3NH0 A; 
#chains in the Genus database with same CATH homology
 3VQ9 A;  4I2Q A;  1VK0 A;  4OVL A;  4KO0 A;  1TL1 A;  2YNF A;  4EP4 A;  4W5T A;  3NHG A;  1L3S A;  1VSL A;  1D9D A;  3SV4 A;  4FJM A;  1Z25 A;  3OVN A;  3OYB A;  3RMD A;  1YTA A;  3DOK A;  4F3T A;  2DFH A;  4DF8 A;  5KTQ A;  1Q9Y A;  4BDZ A;  3QIP A;  4C8L A;  4BE0 A;  4PY5 A;  3AVG A;  3TAE A;  1B92 A;  2HNZ A;  3K58 A;  3OYG A;  3RMB A;  4WE1 A;  4C8N A;  3K59 A;  4LD0 A;  2XY8 A;  3AO1 A;  4AHV A;  1GOB A;  3ZSZ A;  3NH2 A;  2HHQ A;  3I0R A;  4AHU A;  2P5O A;  3RTV A;  1FK9 A;  1RTD A;  4KHW A;  3P1G A;  1LV5 A;  4KB0 A;  2B4J A;  2YV0 X;  3KK2 A;  3QER A;  3SUN A;  2OPS A;  3NF7 A;  1WSE A;  2IGI A;  3OS1 A;  3KLH A;  1SL1 A;  3LPT A;  4IDK A;  3EY1 A;  4DTS A;  3KD1 E;  3RMA A;  3LAK A;  3OYD A;  4EZ9 A;  3NF9 A;  5C25 A;  4DSJ A;  3VQB A;  1ITG A;  4DTX A;  2Q3S A;  1JXE A;  4CK3 A;  5I3U A;  1Z26 A;  4ZTJ A;  3O4N A;  3OYF A;  4ID1 A;  1W9H A;  4GMJ B;  2QKK A;  1C0T A;  1JLF A;  1X1P A;  4FW2 A;  5J2Q A;  1SL2 A;  3RR7 A;  3VQC A;  1REV A;  1RDA A;  3BDP A;  1BCM A;  3TWH A;  3RRG A;  4OKE A;  3QEP A;  1EX4 A;  2HW3 A;  1JLB A;  3LWM A;  3H08 A;  3RMC A;  4M3X A;  4DLG A;  4CFB A;  4BAC A;  3SJJ A;  3S3M A;  4ELU A;  3NGZ A;  3C6U A;  4IG0 A;  4B9L A;  5SWM A;  3O3F A;  3S9H A;  2DTU A;  3KTQ A;  3VQP A;  1LWE A;  3IS9 A;  4DFK A;  4RW4 A;  3QIN A;  2HVH A;  5CY4 A;  3L2Q A;  1D5A A;  3O3H A;  3S3O A;  4JS4 A;  1TKD A;  4CGI A;  3DRR A;  5J2N A;  3AVH A;  4NCA A;  4IFV A;  1L3U A;  2RPI A;  3L2R A;  2E6L A;  1C1A A;  4CF9 A;  3VQ5 A;  2FBV A;  3ZSY A;  5K14 A;  3IRX A;  3HPO A;  4DTO A;  2GV9 A;  4CEF A;  3SV3 A;  2A1S A;  3WNF A;  1IKY A;  3WNE A;  3HVT A;  3KIO A;  4JRQ A;  5J1E A;  2X74 A;  3VQD A;  3THV A;  3B6O A;  1C1B A;  4CFD A;  1Q8I A;  5CZ2 A;  3AO3 A;  2X78 A;  5FDL A;  3ZCM A;  3LAM A;  4QCL A;  1WSH A;  3SNN A;  1JLE A;  1TK8 A;  1U04 A;  3HM9 A;  4DQP A;  1A5V A;  1TKT A;  3ASM A;  1WSG A;  2YKN A;  1RT4 A;  4B9T A;  4RW9 A;  2HNY A;  3HPG A;  4PA1 A;  4CIF A;  3F9K A;  1QS4 A;  4E3S A;  4DSF A;  4HUF A;  4FM2 A;  4B9N A;  4NCG A;  4W5Q A;  3NH1 A;  3HST B;  1TAU A;  3C6T A;  1NK4 A;  3SUO A;  3MXI A;  3AA4 A;  4CED A;  4KTQ A;  2ETJ A;  1ZBL A;  3EYZ A;  3LP3 A;  3QEI A;  1NK7 A;  3VQQ A;  5DMR A;  4CES A;  1S1W A;  3K5O A;  3SUQ A;  2G8I A;  1LAV A;  1B9F A;  2VG6 A;  4DQS A;  1BCO A;  3DLB A;  1VSK A;  3TAG A;  4CHN A;  2FC0 A;  3AVA A;  4O0I A;  4DLE A;  3ALY A;  3KK3 A;  3NGI A;  3K2P A;  4DQQ A;  1SKR A;  2QXF A;  3DOL A;  3ZT4 A;  1LWC A;  2HHU A;  3L3U A;  3MXM A;  4M3U A;  4CGJ A;  3LWL A;  1MU2 A;  2R7Y A;  3FFI A;  4HUE A;  1S1U A;  4FJK A;  1GOC A;  2HHW A;  1C0U A;  1S1X A;  4FLX A;  4OPJ A;  4W5O A;  3DLK A;  2I5J A;  1RT2 A;  5J2M A;  2E4L A;  3TAQ A;  3L8B A;  2X6N A;  4DSI A;  1CZB A;  2IC3 A;  3OYL A;  4FK0 A;  4OKJ A;  3HT3 A;  4OJR A;  4IG3 A;  1NOZ A;  2HHX A;  2HVI A;  1HYZ A;  2FBX A;  4HVJ A;  4CJV A;  1VSI A;  2WOM A;  3HL8 A;  4CJR A;  1KRP A;  3AA3 A;  3LP0 A;  4FLZ A;  2IDO A;  4LY7 A;  3ZSR A;  3KLG A;  4KHU A;  1WAF A;  2IS3 A;  3AVJ A;  4RW7 A;  4LSL A;  3V9U A;  3LAN A;  4Z0U A;  1VSD A;  2D0A A;  2ZQB A;  3CQ8 A;  4M3W A;  2XY5 A;  4DTN A;  1TV6 A;  1NJW A;  4CHP A;  3ZT0 A;  1QSL A;  3DLG A;  2JLE A;  4CHZ A;  3I8D A;  3OYJ A;  1U45 A;  1RT6 A;  1BIZ A;  1O1W A;  1TKX A;  5KGW A;  4DWI A;  4M3Y A;  1HQE A;  3OS2 A;  3MEC A;  1S9E A;  4CJ5 A;  3EZ5 A;  1Q9X A;  2PY5 A;  2BDP A;  3V1R A;  4E89 A;  4I7F A;  1L3V A;  4UQG A;  1WSF A;  2YNG A;  4F4K A;  1U47 A;  4CEC A;  4OLA A;  4F2S A;  4DTU A;  2YHA A;  4CHY A;  1SKW A;  3ITH A;  3RWU A;  2YHB A;  2FBT A;  3AVK A;  4CJE A;  1T8E A;  4Z4C A;  1JXB A;  1C0M A;  4DFM A;  3K5L A;  5T7B A;  3TR8 A;  3ZT3 A;  4E19 A;  4E7I A;  1L3T A;  2ZE2 A;  1IKV A;  3MXJ A;  1DTT A;  3VQ8 A;  3OYE A;  4Q5V A;  4E7L A;  3TAN A;  1N6Q A;  3B6P A;  4FK4 A;  1IO2 A;  1IKX A;  1J9A A;  4E7H A;  3QIO A;  4CJQ A;  3SQ2 A;  3PX0 A;  5JS2 A;  1IG9 A;  4Z4H A;  3OYC A;  3SI6 A;  1SKS A;  3CM6 A;  4FLY A;  3T19 A;  2G8V A;  1ZBU A;  4CEB A;  3L2V A;  4CER A;  3QNO A;  4J2A A;  3NF8 A;  5HRS A;  2QK9 A;  1HYS A;  4OPK A;  2W42 A;  4RW6 A;  2G8W A;  4KRE A;  3PV8 A;  3DRS A;  3AVF A;  3OYI A;  1VSE A;  4E1N A;  3L2W A;  4CJ4 A;  1B9D A;  1WLJ A;  1QHT A;  4H4O A;  2D0C A;  3G0Z A;  4J2B A;  4CF2 A;  3V81 A;  4KHN A;  2VG5 A;  2KFN A;  1KLN A;  3G10 A;  4HHT A;  3DMJ A;  4B08 A;  3KJV A;  1WNS A;  3PX4 A;  1FKO A;  4BE2 A;  4GVM A;  3OY9 A;  3K5N A;  2GBZ A;  1VSF A;  4CE9 A;  1TK0 A;  1RBV A;  2VWJ A;  2G8H A;  2Y1J A;  2NUB A;  4G1Q A;  3VQ7 A;  4KRF A;  4N47 A;  4B8A B;  4M41 A;  1EKE A;  4HCB A;  3JYT A;  3ZSO A;  2B5J A;  3ZT2 A;  3K57 A;  3RR8 A;  4FZZ A;  2KZM A;  4RW8 A;  4DSK A;  3RRH A;  4CF8 A;  5C24 A;  2IOC A;  3K5M A;  1UA0 A;  1XI1 A;  4DTM A;  3NGY A;  3HYF A;  4LH4 A;  4BWJ A;  1RBU A;  1BGX T;  4NYN A;  1L5U A;  2YNI A;  4FLT A;  2KZZ A;  2Z1H A;  5HRN A;  3SUP A;  4FXD A;  3DLE A;  4KI6 A;  5HRO A;  2KQ2 A;  5J2P A;  4DU3 A;  3ZSX A;  2A1R A;  4F2R A;  3CG7 A;  4YNQ A;  1KFS A;  3L3V A;  3KKR A;  3NF6 A;  3VQ4 A;  3V4I A;  3DYA A;  1JLC A;  4IKF A;  4M3T A;  4RG8 A;  1TGO A;  3AVB A;  1RBS A;  4M3R A;  3HXM A;  4KPY A;  2IAJ A;  3AVN A;  4TSX A;  3NFA A;  3TAM A;  1U48 A;  2DFF A;  2ZD1 A;  3U3G A;  3DLR A;  3TAF A;  2PZS A;  4EZ6 A;  4DTP A;  4PQU A;  1RTH A;  4FLW A;  2HHS A;  5FRM A;  1XHZ A;  3D0P A;  1KVC A;  4DSL A;  3C94 A;  2EX3 A;  4W5R A;  2BE2 A;  3BGR A;  3QET A;  4OLB A;  4Z4E A;  4DSE A;  1FXX A;  3CYM A;  4FM1 A;  1EET A;  4CIG A;  4AH9 A;  1BQN A;  2KW4 A;  2P51 A;  3ZT1 A;  5HRR A;  1RIL A;  2O4G A;  3OYA A;  4FCY A;  4KFB A;  4CCH A;  3SQ0 A;  1D8Y A;  4CFC A;  1EXQ A;  4CJ3 A;  1XC9 A;  4CEQ A;  1T03 A;  1BL3 A;  1QQC A;  5HP1 A;  2YNH A;  1D9F A;  2OZM A;  4FJH A;  3V9X A;  4J2E A;  1G15 A;  3HO1 A;  4CFA A;  1JLG A;  2XHB A;  4DU4 A;  4FJ9 A;  2HHV A;  3AVC A;  4E7K A;  5EU7 A;  4C8O A;  1RCH A;  1HQU A;  4CGD A;  3AV9 A;  1NKB A;  4PWD A;  4BE1 A;  3CM5 A;  2AJQ A;  1UOC A;  1QE1 A;  4XIU A;  4DQI A;  1QTM A;  1BI4 A;  3MED A;  4ZHR A;  1ASW A;  1F21 A;  1S1T A;  4FVM A;  3AO2 A;  1WSI A;  4ID5 A;  4AHC A;  2O4I A;  2VWK A;  1S1V A;  3SYZ A;  4DQR A;  4KAZ A;  2DFE A;  2G8U A;  3QLH A;  4JLH A;  2HMI A;  3HVR A;  1KLM A;  4FJ8 A;  1SL0 A;  4ICL A;  4Z4F A;  1NJY A;  3HP9 A;  4I2P A;  2RN2 A;  5I42 A;  4CHO A;  3OS0 A;  1T05 A;  2FBY A;  1YTU A;  1NKC A;  4FJG A;  1DTQ A;  1ZYQ A;  4FK2 A;  1KFD A;  4KTW A;  1JLA A;  4BDY A;  1RT7 A;  4BWM A;  3V9Z A;  1NK8 A;  4FJX A;  3OYH A;  3ULD A;  1ZBI A;  2YKM A;  1NJX A;  4CJK A;  1WSJ A;  2HB5 A;  5DK5 A;  2D0B A;  2G8F A;  4OKK A;  3DM2 A;  5FRO A;  4M45 A;  4Z4I A;  4B9M A;  3M8R A;  3V1Q A;  4AHR A;  4DMN A;  4CIE A;  2KFZ A;  1UAX A;  5FRN A;  1NKE A;  4I9Q A;  5KRS A;  4EP5 A;  4Q0B A;  2P1J A;  1U49 A;  4W5N A;  3SPY A;  1UA1 A;  4CEE A;  3OYK A;  4DTJ A;  4C8M A;  1U4B A;  1S5J A;  1X9S A;  4FM0 A;  4KHY A;  4CJS A;  4ZTF A;  1RTJ A;  4KV8 A;  4CK2 A;  3L2U A;  3CFP A;  3KLI A;  3AO5 A;  4FJN A;  4CJW A;  2XRI A;  1XHX A;  3SQ1 A;  5JS1 A;  2F8T A;  4F8R A;  4FJI A;  2BGG A;  3I0S A;  1CXQ A;  4DS4 A;  1NOY A;  3V1O A;  3DLH A;  1KCF A;  1RDB A;  1HYV A;  1RBT A;  3AO4 A;  1BIS A;  3SQ4 A;  4CEZ A;  3ISN C;  4FW1 A;  3NE6 A;  1X9M A;  1KSP A;  4Y1D A;  4CJF A;  2QKB A;  4B9S A;  1NJZ A;  4N76 A;  4FYD A;  1GOA A;  4AHT A;  3V9S A;  3T1A A;  4CJL A;  2RF2 A;  1KVB A;  1I3A A;  4CEA A;  2RKI A;  3D45 A;  3WNG A;  1SUQ A;  5SZT A;  4KB1 A;  3M8P A;  2X6S A;  3HP6 A;  3F73 A;  1C1C A;  3E01 A;  5CYQ A;  1EP4 A;  3CFR A;  4QOZ B;  3TAP A;  1X9W A;  1BIU A;  4Z4G A;  1RT3 A;  4B3O A;  1YVU A;  4KHS A;  3CFO A;  5KI6 A;  3JSM A;  5E41 A;  1IKW A;  4ELT A;  3OJS A;  4FJJ A;  3LPU A;  3DI6 A;  4LSN A;  3AA5 X;  2OA8 A;  3ZSW A;  3KKS A;  2OPQ A;  1TVR A;  3O3G A;  3KLF A;  1KTQ A;  3AVL A;  2OYQ A;  4QAG A;  4K8X A;  1DLO A;  3VN5 A;  4CGG A;  3TI0 A;  4L8R B;  3VQ6 A;  3AA2 A;  1J5O A;  1VRU A;  4NCB A;  4KHQ A;  4OGE A;  1LWF A;  2D5R A;  4PUO A;  3OYN A;  1T7P A;  1RTI A;  1C6V A;  3PX6 A;  3KK1 A;  1BQM A;  3LZJ A;  4KI4 A;  3AVM A;  4CJU A;  3KLE A;  4CHQ A;  2HND A;  2Z1J A;  4E7J A;  4DS5 A;  2G8K A;  3U6F A;  1VRT A;  4ELV A;  4CF1 A;  3P5J A;  4JRP A;  1IH7 A;  1I39 A;  4FZX C;  4FJL A;  1NK5 A;  1RNH A;  1FKP A;  3SCX A;  4HTU A;  1SV5 A;  2VG7 A;  1JL1 A;  4N5S A;  1VSH A;  1Y97 A;  2F96 A;  3LP2 A;  3QEV A;  2P5G A;  3KD5 E;  4LH5 A;  3QES A;  4FJ5 A;  2XO7 A;  4CGF A;  3NCI A;  4FJ7 A;  2GUI A;  3IAY A;  1UWB A;  4KTZ A;  4MFB A;  3LZI A;  1TK5 A;  1VSJ A;  1K6Y A;  1HNI A;  2BAN A;  2JGU A;  4DU1 A;  1TAQ A;  3LDS A;  1BHL A;  1VSM A;  1RDD A;  2WON A;  2PYL A;  1XWL A;  1J54 A;  5KRT A;  2F8S A;  3PUF A;  1RDC A;  4B9V A;  4FLU A;  4B8C A;  1N5Y A;  3S3N A;  2LSN A;  1HRH A;  3OJU A;  4CF0 A;  1NK0 A;  2XY6 A;  3DRP A;  4N41 A;  4KKO A;  4O44 A;  4K8Z A;  2KTQ A;  4FZY A;  4J2D A;  1W0H A;  4H8K A;  4CEO A;  4IFY A;  3VA3 A;  5HBM A;  1JL2 A;  1LW2 A;  2OPP A;  3QNN A;  5HLF A;  3WNH A;  4HCC A;  3HK2 A;  4M42 A;  4O4G A;  4GW6 A;  4AHS A;  2ATQ A;  4O5B A;  3V9W A;  1NK9 A;  3VA0 A;  2XY7 A;  3TAR A;  1CXU A;  1TL3 A;  2HHT A;  3PO4 A;  2EHG A;  1BI4 B;  5CYM A;  2PYJ A;  1A5W A;  1ASU A;  2Z1G A;  1LW0 A;  5C42 A;  4E1M A;  3MAQ A;  4DTR A;  1S6P A;  1WN7 A;  1ZBF A;  3ZSQ A;  3V6D A;  4CGH A;  2OPR A;  4CK1 A;  4F3O A;  3U3Y A;  1RBR A;  3P83 D;  1HPZ A;  5HRP A;  3QEW A;  4O0J A;  1ASV A;  4NYF A;  3C95 A;  1ZBH A;  4IBN A;  3HPH A;  1TKZ A;  5CZ1 A;  1QSY A;  1RT1 A;  3HJF A;  1CZ9 A;  1YT3 A;  3QO9 A;  4MQ3 A;  4H4M A;  4I9L A;  3TAB A;  1HMV A;  3MEG A;  3SPZ A;  1NK6 A;  4AIL C;  3MEE A;  3ZSV A;  4C8K A;  3LAL A;  3OYM A;  1QSS A;  2E6M A;  4DFJ A;  3VQE A;  1KVA A;  4E0D A;  1A5X A;  1LAW A;  1JKH A;  3NBP A;  1RT5 A;  1JLQ A;  4DF4 A;  4OGC A;  1WAJ A;  2B6A A;  4HUG A;  4FLV A;  4N56 A;  3QEX A;  1CLQ A;  3NAE A;  4CJP A;  4R5P A;  1J53 A;  3O4Q A;  4B9U A;  3AVI A;  2DY4 A;  4DG1 A;  1R0A A;  3M8S A;  2ITG A;  5D3G A;  3LP1 A;  3A2F A;  3M8Q A;  3VQA A;  5KGX A;  4Y1C A;  4CJT A;  2OZS A;  4M3Z A;  1HNV A;  3PO5 A;  4YFU A;  4BDP A;  3UIQ A;  4JS5 A;  4O55 A;  3SZ2 A;  2Z1I A;  3NDK A;  1S6Q A;  3T3F A;  1S9G A;  4DFP A;  3IG1 A;  1HJR A;  2Y1I A;  3PY8 A;  3NH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...