1RDCA

Crystal structures of ribonuclease hi active site mutants from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTNSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Crystal structures of ribonuclease HI active site mutants from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 42
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rdcA00
1LWFA 1MU2A 2HMIA 3ULDA 4QOZB 1JLQA 1S9GA 3AVKA 2IDOA 2QXFA 4FM1A 4KHSA 2YNHA 4CJKA 4JRPA 2B6AA 1YTUA 1ZBFA 5KRTA 1YT3A 3TR8A 3ZSZA 4FM0A 5KGXA 1XHXA 4CEEA 1QTMA 3CG7A 4YNQA 1NJYA 3WNEA 4F2RA 3ISNC 3CFPA 4K8ZA 4M3XA 1HRHA 3SPZA 1S6PA 3DLGA 3CYMA 4B9VA 3HVTA 2F8TA 2XRIA 4NYFA 3JYTA 4FLZA 1KRPA 3QNOA 5HROA 1TKZA 2Z1GA 3KTQA 4NYNA 3VA3A 1NK6A 4Z4FA 1JLEA 1N5YA 2YNIA 2AJQA 4DTUA 1WSHA 2EX3A 5FROA 4J2EA 2HHUA 1VRTA 2RN2A 3CM6A 4E7HA 3KD1E 3AA2A 1RT6A 1HYSA 1VRUA 5SZTA 3K58A 3D0PA 1S1WA 1IKYA 1NOYA 1Q9XA 4FJ7A 4DSLA 3G10A 4KTZA 4OKJA 3OS0A 3RWUA 1FKPA 1D5AA 4Z4IA 3HJFA 4B9NA 3K59A 2E4LA 3I0RA 4AILC 1KFSA 4RW9A 3V9SA 3ZCMA 1TK5A 2FBVA 4E0DA 2HHSA 4OPKA 4W5RA 1JLBA 1ZBHA 4EZ9A 3AVBA 1JKHA 2WONA 3NGZA 3KLHA 3K57A 3L2RA 3RMCA 4KB0A 4CE9A 3NHGA 3OYCA 1SL0A 1RTJA 4I7FA 4F4KA 2KTQA 4ICLA 1DTQA 3MECA 1LW0A 4DTSA 4B08A 1UA0A 4DG1A 2I5JA 1U47A 4ZTJA 1L3SA 3CQ8A 4DMNA 1SV5A 3VN5A 3DMJA 4FJMA 4Y1CA 3C95A 4CK1A 3KLFA 2KFNA 4OKKA 1HPZA 4HUEA 4J2BA 1BIZA 3SJJA 4M3WA 5FRNA 1RILA 1JLCA 4CESA 1KLNA 3BGRA 3OYIA 1QSLA 5FDLA 3AO1A 1HNVA 3HP9A 4DQRA 3RRHA 1WSGA 1VSJA 2B5JA 2Z1HA 4CIGA 4ZHRA 3KLEA 1NK8A 2RF2A 1RT2A 4KTWA 1BI4A 2FBYA 3EY1A 4E7JA 3TAFA 2LSNA 3OS1A 4CEOA 3V1RA 4CJWA 3RRGA 1IG9A 3FFIA 5J2QA 4B3OA 1WLJA 1RBSA 1BGXT 2YHAA 3AVAA 4C8OA 1UOCA 3DLEA 3G0ZA 1SUQA 3TWHA 4AHVA 3NFAA 3I0SA 2OPSA 3LWMA 4EP4A 4E1NA 2YHBA 3VQEA 3SYZA 1J54A 2HHXA 3WNFA 1SKSA 3V1OA 2OZMA 4M3TA 3KKRA 3M8RA 3LWLA 1RNHA 2HNYA 4KTQA 3NF8A 1BCMA 4N41A 4LSLA 4LD0A 4DQIA 4CFCA 1Y97A 3QINA 1NKCA 2G8IA 2D0CA 4OPJA 3H08A 5HRRA 3L8BA 1Q9YA 3AA3A 3IG1A 4OLAA 4E89A 4FZYA 1RDDA 4CK2A 3F9KA 5I42A 1XI1A 5KI6A 3AVCA 4KRFA 2RPIA 3KLGA 4FCYA 2HB5A 1LWEA 4C8LA 2A1SA 3LDSA 4EZ6A 1S1UA 3DI6A 3ZT1A 1X9WA 3SUNA 4J2AA 4KHNA 1KVAA 1S5JA 1J9AA 3DLHA 1WN7A 4CGFA 5KTQA 4M3UA 1LV5A 3KKSA 3VQ7A 3IRXA 3K5NA 5CY4A 1VSHA 1RTIA 1TGOA 3EYZA 4BDYA 2OPRA 3JSMA 4CCHA 2Y1IA 5KGWA 5CYMA 4B9LA 1SL1A 4NCBA 3HK2A 3IS9A 2E6MA 4QAGA 3V1QA 3NH1A 3HO1A 4CGIA 3O3FA 1C1AA 1RDCA 1L3TA 4B9UA 4HCBA 2KZMA 1ITGA 3LP1A 1VSLA 4KV8A 1S1XA 3NGYA 4AHUA 1CZBA 1BI4B 3HYFA 1QSSA 2YKNA 3LP3A 3O4QA 3L3UA 3OY9A 2YNGA 3OYKA 4CIFA 1SL2A 3CM5A 2QKKA 4DTMA 3MXMA 4E7KA 2P5OA 4KHQA 3DM2A 2BGGA 4UQGA 4CIEA 4DS4A 4CGGA 3TI0A 1TL1A 1NKEA 3VQ9A 4CJEA 4R5PA 4N47A 2B4JA 5EU7A 1IKXA 3AVGA 3HPGA 4AHTA 4CF0A 5D3GA 1ASWA 1CZ9A 4BACA 3DRSA 4BDZA 2XY7A 4DS5A 1ZBLA 1VSEA 4C8MA 3SI6A 4CHNA 2G8KA 2YV0X 3OS2A 4B9SA 2EHGA 3AO4A 4IFVA 3D45A 4LY7A 4H8KA 4C8KA 3P1GA 4FXDA 2XY5A 5I3UA 3LP0A 1L3VA 3KD5E 1JLFA 3MEGA 4CEAA 4FJ5A 3VQ6A 1BQNA 3S3MA 2HHTA 5K14A 4E1MA 3OYJA 1JLAA 2DFEA 1HQEA 4CHOA 3L2VA 4DFJA 4BE2A 1UAXA 3DLBA 4CJ5A 3OYNA 4FZZA 3HL8A 1EKEA 4CHZA 1LWCA 4YFUA 3KK1A 2G8WA 3NDKA 4ZTFA 2G8VA 1A5XA 3ITHA 1D9FA 4DTOA 4PWDA 1CXQA 1UWBA 1NOZA 3IAYA 3VQ8A 3T1AA 2VWJA 4DSJA 4CF8A 4FW2A 4I9LA 5J1EA 3OYBA 3HVRA 3F73A 4DF4A 1RT1A 4CHQA 1QHTA 1DTTA 1T05A 1BIUA 2IOCA 3O3HA 3OYLA 4KREA 2BE2A 1EX4A 4PY5A 1RDBA 1YTAA 4DLEA 3QIOA 4J2DA 3AVLA 3MEDA 5JS2A 3K5OA 1CLQA 4F3TA 3AV9A 3NF7A 3OJUA 1QSYA 4FJXA 4CEFA 2HHWA 2XY8A 2OA8A 2F8SA 2DFFA 4CJ4A 3ZT4A 2IS3A 4KHWA 5DMRA 1VK0A 3SCXA 3TAQA 3WNHA 2VG7A 3U3YA 4FJHA 1ZBUA 5E41A 1HJRA 1FKOA 2ATQA 1NK4A 1BL3A 2VG6A 2OPQA 3VQAA 4CGDA 1U04A 1S1VA 2P1JA 4WE1A 4HVJA 3PX4A 1NK7A 3ALYA 4DU3A 4OKEA 1S6QA 3VQQA 3MEEA 4DLGA 4DSFA 4DF8A 3PX0A 3SUPA 3ZT3A 1I3AA 4PUOA 1EXQA 1JXBA 3SQ0A 1XHZA 3HXMA 5FRMA 4CJSA 4OVLA 3PV8A 1U49A 4RW7A 3C6TA 2E6LA 4CJQA 3K5LA 1X1PA 3C94A 1Q8IA 3RTVA 1RTHA 3SNNA 4CF9A 2R7YA 4DTNA 1JLGA 1XC9A 2GV9A 4KI6A 3K5MA 1RT3A 3DRRA 4GW6A 2D0BA 4M41A 1O1WA 4KFBA 2D5RA 3V6DA 1VSKA 1T03A 3V9XA 4BE0A 3QO9A 2D0AA 4I2PA 5SWMA 1U48A 4OJRA 3U6FA 3SQ1A 1GOCA 2P51A 3V81A 4M3ZA 4DFPA 1I39A 4KI4A 2IAJA 1RBTA 3K2PA 4KAZA 2Q3SA 3SV4A 1NKBA 3I8DA 1RBVA 3AA4A 4E19A 3L2UA 1T8EA 3SV3A 4FLTA 4DQSA 3P5JA 4AHCA 4ELVA 1KFDA 4M42A 2HVIA 1Z25A 4BE1A 1C0MA 4DSEA 3NH0A 4DWIA 3NCIA 4CF1A 3L2QA 5J2MA 1B92A 4FLVA 1NJXA 4QCLA 4CJFA 2OYQA 4TSXA 4PA1A 5J2PA 2Z1JA 2HVHA 3RMBA 2ETJA 2X6SA 4Q0BA 3O4NA 4FK2A 1WAFA 1RBRA 5HBMA 1RT4A 4IFYA 5C24A 2O4GA 3DLRA 1CXUA 3L3VA 4IG0A 3V9UA 3S9HA 4CFBA 1FK9A 4E7IA 1NK0A 4G1QA 4CEBA 2OPPA 3ZSYA 4JRQA 3NE6A 3OYDA 4B9MA 1K6YA 4MQ3A 4W5TA 4FM2A 3RR7A 3PY8A 1TKXA 3M8PA 1C0UA 1RT7A 4FJLA 2HHQA 3AVFA 2KQ2A 3OVNA 2ZE2A 4CERA 3LZIA 3QEPA 1UA1A 3NBPA 3NH2A 2Z1IA 3QERA 1RTDA 2X78A 3SQ4A 4CFDA 4FK0A 1BCOA 4LH4A 2VG5A 3VA0A 1B9FA 3E01A 2GBZA 3VQ4A 1NJWA 3SPYA 5HRSA 2F96A 4EP5A 4N56A 4LH5A 3WNGA 2GUIA 1BISA 1TK8A 1D9DA 1FXXA 2FBXA 1C0TA 1LW2A 3KIOA 4FVMA 1X9SA 4NCAA 4CHYA 1WSEA 3QEVA 4DSKA 1B9DA 4IBNA 3ZSXA 1ASUA 1EP4A 3AVMA 3ZT2A 4CHPA 1NJZA 4ID1A 3A2FA 2VWKA 1VSMA 4IDKA 4M45A 4CJTA 4W5OA 3KK3A 4HUGA 3OJSA 3T19A 3PX6A 3C6UA 4CJLA 3TANA 1RBUA 1HYVA 1JL1A 2JGUA 1XWLA 4LSNA 4HHTA 4KHYA 2IC3A 1RCHA 4NCGA 1U4BA 4AH9A 2ZD1A 2ITGA 1S9EA 2YKMA 4N5SA 4FJIA 3O3GA 4ELUA 4BWMA 4DU4A 1J53A 2KW4A 4I9QA 1SKWA 2XHBA 4B8AB 2RKIA 3QEIA 4KKOA 4DU1A 3V4IA 1GOAA 1NK5A 4BDPA 5HP1A 5JS1A 1REVA 3AVJA 3ASMA 3ZSVA 1HNIA 2QKBA 1BHLA 3EZ5A 1QS4A 1R0AA 4CJ3A 2KFZA 1EETA 4CEQA 4HUFA 3S3OA 4DQQA 4Z0UA 4JLHA 3NGIA 4W5NA 1G15A 3DOKA 4BWJA 4KPYA 3PO4A 1L5UA 3OYEA 2Y1JA 3OYGA 1KSPA 4FLUA 1WAJA 4OLBA 4DFMA 3M8QA 2W42A 4FK4A 3VQDA 1HQUA 4Y1DA 4CK3A 3TAEA 1IKVA 3L2WA 4OGEA 3PUFA 4DQPA 4O5BA 2X74A 3KJVA 4GVMA 2DFHA 3LANA 4CJUA 4CF2A 4K8XA 1LAVA 4RW6A 4HTUA 3CFOA 4IG3A 3AO5A 4H4OA 1SKRA 3QETA 1L3UA 3LP2A 4HCCA 3MXJA 5T7BA 4M3YA 1WSIA 3HPOA 3RMDA 3UIQA 2XO7A 2BDPA 4AHSA 4ID5A 3M8SA 3HT3A 1ZYQA 3V9ZA 3SUQA 1QQCA 3QEWA 3KK2A 3SUOA 2G8FA 3ZSOA 4FJ9A 1TV6A 3LALA 2HNZA 1KTQA 3OYHA 5HRNA 3NAEA 2PY5A 4O0IA 3B6PA 5KRSA 4DTPA 1W9HA 1WSJA 1U45A 4N76A 4FJJA 4E3SA 1JXEA 1DLOA 1NK9A 1X9MA 2G8UA 2FBTA 4IKFA 3AVIA 2DTUA 4Z4CA 3QLHA 3OYAA 3HSTB 3QNNA 5HRPA 4RG8A 2O4IA 1YVUA 4O4GA 4FLYA 1VSFA 3TARA 4KO0A 1WSFA 2PZSA 3QIPA 1BQMA 5CZ2A 4FLXA 1N6QA 1TAUA 5DK5A 1VSIA 1TL3A 2JLEA 1D8YA 5C25A 4ELTA 3ZSRA 2IGIA 4DFKA 3AVHA 4DTRA 1TK0A 4JS5A 2HW3A 2X6NA 4FW1A 4CJVA 1GOBA 4O44A 3SZ2A 3MXIA 3LPUA 4L8RB 2DY4A 1KLMA 1IO2A 3DRPA 2HNDA 4DTXA 2KZZA 3HM9A 3RMAA 3TAPA 3VQ5A 5CZ1A 3SQ2A 4F2SA 4FYDA 2HHVA 2OZSA 1TAQA 3P83D 4RW8A 2G8HA 3THVA 3B6OA 3AO2A 4CGJA 1LAWA 4FJNA 4CECA 3AVNA 2A1RA 4CJPA 1ASVA 2BANA 4RW4A 2PYJA 4FLWA 4O55A 3ZSQA 3TAGA 4FJKA 2PYLA 1S1TA 4B8CA 4F3OA 5J2NA 3U3GA 2NUBA 1WNSA 4KHUA 4B9TA 3AO3A 1KVCA 4FJGA 1C6VA 4DTJA 3S3NA 3BDPA 3TABA 3PO5A 4AHRA 1IH7A 4E7LA 4Q5VA 2FC0A 4MFBA 1TKDA 1KVBA 3V9WA 4DSIA 3AA5X 3NF6A 3VQBA 3TAMA 4CEDA 4Z4EA 3LPTA 4CJRA 2QK9A 3KLIA 1A5WA 3NF9A 4I2QA 4Z4HA 3HPHA 4H4MA 5HLFA 3LZJA 3QESA 3CFRA 4OGCA 1HYZA 2XY6A 4FJ8A 4F8RA 4C8NA 1Z26A 3DOLA 3ZT0A 4CEZA 3LAKA 1W0HA 4O0JA 4CFAA 3HP6A 3MAQA 1TKTA 1TVRA 3OYMA 2WOMA 1RT5A 3VQCA 3VQPA 4Z4GA 5CYQA 3RR8A 2YNFA 3DYAA 4CGHA 3QEXA 1C1CA 1VSDA 4M3RA 4FZXC 1A5VA 3ZSWA 4XIUA 1ZBIA 4GMJB 1RDAA 3DLKA 5C42A 4KB1A 2ZQBA 4W5QA 1QE1A 3LAMA 4JS4A 2P5GA 1C1BA 3T3FA 4PQUA 1IKWA 1J5OA 3OYFA 1F21A 1KCFA 1T7PA 1JL2A 1HMVA
chains in the Genus database with same CATH superfamily
3ULEB 3LDLA 1JLQA 3TSPA 4U67L 2YNHA 2B6AA 1RGIA 1YT3A 5KGXA 1XHXA 4CEEA 3CG7A 3P4IA 2P9KB 1ATRA 4QS7A 3CFPA 2UXBK 4M7YA 4M3XA 1KC8O 3SPZA 4O5FA 1YIJN 3DLGA 3VMFB 5LMUK 1M1KO 4JKBA 4FLZA 4ISEA 3KTQA 4NYNA 1JLEA 4O8UA 4BVPA 1T3VA 1VRTA 4CD3A 3KD1E 4IOCL 1BDGA 1HYSA 3H45C 3GBTA 3K9JA 3RWUA 3HJFA 4FPBA 2E4LA 4BC4A 4AILC 2P9IB 2HHSA 3ZCMA 2FBVA 2O8FB 3AAPA 3NGZA 3RMCA 4CE9A 4H0PA 4I7FA 4ICLA 4QS9A 4Y0WA 4GKJK 1U47A 1MWMA 4ZTJA 3VTIA 3CCUN 1NGIA 4Y1CA 3KLFA 4OKKA 5C2DA 1BIZA 4CESA 3TSQA 3CC4N 2CGLA 5FDLA 3HP9A 3Q7CA 1WSGA 2B5JA 2Z1HA 4WFAL 3KLEA 4KTWA 2FBYA 1XUPO 3V1RA 3OHRA 4FPAA 1WLJA 1RBSA 3AVAA 4DKWA 3G25A 3DLEA 4AHVA 5GAGP 5TKWA 4BRNA 3LWMA 2V7ZA 3MWTA 2YHBA 3O1BA 3M6GA 4M63C 4CZMA 2HHXA 1GLFO 1SKSA 4A59A 1IBKK 2HNYA 3NF8A 1BCMA 4LSLA 3D2FA 1Y97A 3IDHA 4OPJA 5BPNA 3AA3A 3IG1A 4GVEA 4IDHA 2Q31A 3AVCA 2RPIA 5E26A 2A1SA 4OPHA 1X9WA 2O8EA 5JLFA 2CGKA 4CGFA 3VQ7A 3CCMN 5CY4A 1VSHA 1RTIA 2OPRA 2WFBA 2Y1IA 3VEZA 1SL1A 4NCBA 3FZLA 3IS9A 3MCPA 1NWKA 1WUAA 4RTFD 3K0SA 2KZMA 3U4LA 4CBWA 1S1XA 3NGYA 4AHUA 1CZBA 3HYFA 4NO7A 3O4QA 3THXA 1SL2A 2QKKA 4E7KA 2P5OA 3DM2A 2HF3A 3FR0A 1C0GA 4JD2A 4BR4A 1NKEA 1FJGK 3VQ9A 4R5PA 4N47A 1IKXA 3O6WA 4CHNA 2G8KA 2YV0X 1EWRA 3D45A 4C8KA 3P1GA 3LP0A 4JKDA 1JLFA 1SAZA 3H3OB 4FJ5A 1BQNA 4GV6A 3D2FB 4CHOA 4EHUA 1UAXA 4CJ5A 3OYNA 4OO1J 1EKEA 4B1YB 2G8VA 4LFCK 4YOUA 3A5MC 1HJOA 1CXQA 2O8EB 4YOTA 3HVRA 1T05A 1RT1A 2GTDA 1QHTA 4CHQA 3OYLA 4KREA 4PY5A 3MEDA 3K5OA 4F3TA 4JKAA 3N4QA 3NF7A 3OJUA 3AY9A 4CEFA 1FW6A 4CZGA 2F8SA 2DFFA 3L6QA 2IS3A 3WT0A 3WNHA 3U3YA 5C0YA 1ZBUA 1HJRA 4WCEL 2VG6A 1NK4A 3VQAA 4CGDA 1YJ9N 3THXB 4H0TB 1MA9B 4JD2B 4X64K 1JXBA 5C10A 4CJSA 4OVLA 1GLDG 3PV8A 4RW7A 1NGGA 2E6LA 4CJQA 1VQKN 3C94A 3EN9A 2HHHK 1JJ2M 3SBGA 2R7YA 2GV9A 2O8CA 4MO5A 3DRRA 4M41A 2YCHA 3WXMB 2O8BA 1Q18A 3E9LA 3MK6A 2D0AA 4I2PA 5SWMA 4PKGA 1T6DA 2P51A 4DFPA 2Q2RA 1NU0A 3H1VX 5BR9A 4ISFA 4E1JA 3SV3A 4DQSA 5AR0A 3VEYA 2AP1A 3QICA 3R1XA 4FLVA 3RMBA 2ETJA 1GLLO 5JICA 2I7PA 4IFYA 3CCRN 4M7XA 1CXUA 1E4FT 5EX5A 4H5TA 1VHXA 4CFBA 3OBYA 4JRQA 2OPPA 4CI6A 3OYDA 3PY8A 3HM8A 2HHQA 3OVNA 2ZE2A 4CERA 5FRNA 5EXWA 3QERA 2HBMA 1BCOA 3J8AA 4LH4A 4EIAA 5AQXA 2E5LK 2GBZA 3QB0A 3IUCA 4EP5A 5HRSA 4FO0A 4N56A 3WNGA 2O8CB 1BISA 2QM1A 3O80A 1S22A 1LW2A 4DR3K 4NCAA 3L4QA 2O8BB 4A57A 4BRIA 3A0IX 1IJJA 3ZSXA 1ASUA 1EP4A 2E1ZA 3ZT2A 2VWKA 4IDKA 3QMLA 4M45A 4HUGA 3TTDA 3TANA 1XQSC 4BVOA 2JGUA 1JL1A 5AQNA 1IBLK 1RCHA 1U4BA 4AH9A 1SS6A 3E9PA 5AQSA 1S9EA 4AF1A 4DU4A 1J53A 4GKKK 3MX2A 2RKIA 3QEIA 1NK5A 1GOAA 1HNIA 4CZEA 3EZ5A 4CJ3A 4IEIA 4DQQA 4JLHA 1X3MA 3NGIA 4W5NA 4ILJA 5GINA 1L5UA 2Y1JA 3O1WA 4FK4A 1HQUA 1BWFO 3TAEA 1N36K 1IV0A 4GVMA 3LANA 4DV4K 1LAVA 4RW6A 2V7YA 4H4OA 2QWLA 3LP2A 4DR7K 4HCCA 1E3MA 2XO7A 4ID5A 3M8SA 3WUHA 1MDUB 3V9ZA 1QQCA 4JK8A 3SUOA 1TV6A 2HNZA 3NAEA 2Q97A 4DTPA 1P90A 1W9HA 1WSJA 2HSTA 4E3SA 4B1XB 1DLOA 2UXDK 2HBKA 2G8UA 3AVIA 2D4WA 3NMUA 2ZF5O 3CERA 3QLHA 4WQ5C 3OYAA 4LF7K 4IZ9A 3J7ZO 2O4IA 3PSFA 4FLYA 4KO0A 5ELZA 4BY9C 5DK5A 1TAUA 2JLEA 5C25A 2P9NA 3M1FA 5A2QO 4DFKA 2IIRA 3G6EN 2X6NA 3MXIA 4CJVA 1GOBA 3SZ2A 4L8RB 1BO5O 3LPUA 4JKEA 1KLMA 3DRPA 4AM6A 2HNDA 3CCEN 1BA1A 3RMAA 3TAPA 3SQ2A 3D2EA 5BPLA 4EFHA 4PHTX 3A5NC 3OW2M 4CECA 4CJPA 4RW4A 3TAGA 1S1TA 4B8CA 4F3OA 1X9JA 4YHHK 4B3MK 4B3SK 5AQJA 3U3GA 4B1UB 1C6VA 4KH4A 4DTJA 3PO5A 4JK9A 4AHRA 1TYQA 1KVBA 3AA5X 3VQBA 4JI4K 5BN9A 5M1NA 4Z4HA 1ATSA 3HPHA 1NGJA 3E66A 4BRFA 4C8NA 1Z26A 3DOLA 4CEZA 1C0FA 3OYMA 2Q0RA 2YNFA 1DKGD 3DYAA 1C1CA 4FZXC 4XIUA 3ZSWA 1ZBSA 1ZBIA 4GMJB 2F4VK 4DB3A 4W5QA 1QE1A 3LAMA 4JS4A 3C0BA 1C1BA 1X3NA 1J5OA 3OYFA 2OTJN 2ASMA 4MLEA 1S9GA 2IDOA 4KHSA 2FF6A 1ZBFA 5AQZA 4FM0A 1QTMA 3CPWM 1NJYA 3WNEA 3D2EB 3ISNC 3SMPA 3T1HK 1S6PA 4B9VA 2XRIA 4NYFA 4BC2A 4JHDA 4BROA 1KRPA 3QNOA 1TKZA 4Z4FA 1N5YA 2Q36A 2YNIA 3T1YK 4DTUA 1WSHA 5FROA 3EZWA 4XH4A 3AA2A 1RT6A 2IVPA 1TYQB 1VRUA 3ZX0A 3K58A 4MDBA 1S1WA 3D0PA 1NOYA 3G10A 1D5AA 3DWLA 3I0RA 4RW9A 1ZBHA 3AVBA 4KB0A 1N34K 1NGAA 1Z6RA 2CGJA 3NHGA 1SL0A 5AQYA 3SMSA 3WXJA 3MECA 2CH6A 1UA0A 2I5JA 3C6HA 4DMNA 5C12A 3U9DA 1VQ8N 4FJMA 3VN5A 1LCUA 3C95A 2CH5A 3TSUA 3O08A 4BG8A 4HUEA 1M90O 4M3WA 3KVGA 1JLCA 3CF5L 5F1XA 1QSLA 2WTUA 3J7AP 1HNVA 5B8HA 4DQRA 3VEXA 3RRHA 1QVGM 1VSJA 3EKUA 1EQYA 1HPMA 1O13A 1BI4A 4E7JA 3TAFA 2QA4N 5BREA 3GOIA 3RVCA 1HKCA 5AZIA 3UKUA 1OVQA 1T6CA 2AA4A 3AGRA 4JAXA 4JHDB 4GV9A 1SUQA 3NFAA 2ASPA 1MWKA 3FZKA 3SYZA 4V19S 4M3TA 4JNEA 3KKRA 3P31A 4LD0A 2G8IA 1ESVA 4CFCA 3H08A 4B1VA 4OLAA 4BGBA 5KI6A 4JI2K 3KLGA 4EZ6A 1K8KA 3FZMA 3GL1A 4DUZK 3SUNA 4MO4A 1J9AA 3DLHA 2E2PA 1WN7A 3WXLA 1LV5A 3KKSA 3IRXA 3K5NA 3OBWA 1BA0A 5H1SQ 1IG8A 5KGWA 3DXKA 4B9LA 4BRQA 2F7TA 4KBOA 3V1QA 3R6MA 3NH1A 5FLXO 4B9UA 1C1AA 1L3TA 3LP1A 1OVYA 5IT9O 1BI4B 2YNGA 3T69A 4CIFA 3MXMA 3CJCA 4DS4A 3TI0A 5AZIB 4JKGA 4CJEA 2YHYA 4A61A 3THWA 3HPGA 4CF0A 4FL9A 2UUAK 1CZ9A 4BDZA 3DRSA 4DS5A 1ZBLA 4C8MA 2NRVA 4B9SA 1J6ZA 4IFVA 1L3VA 5FPMA 3KD5E 4CEAA 3VQ6A 2HHTA 3S3MA 4E1MA 1YXQA 3DLBA 4FZZA 1Q81O 1A5XA 3JS6A 4H0XB 4BRLA 4RWTA 4JI3K 3O4WA 4WQ5A 1QZ5A 1BG3A 3D7EO 3T1AA 4I9LA 5J1EA 3CJBA 2I7NA 1RDBA 4LFAK 2QWNA 3T7ZA 5CR4A 1CLQA 3AV9A 3ZEUB 1W2BM 4CJ4A 5DMRA 3SCXA 2VG7A 2UUCK 3J81O 2OPQA 3VTHA 1YAGA 4IOXA 1NK7A 3ALYA 5HL7L 2QWQA 4DLGA 2BTFA 3ZT3A 3THWB 1I3AA 3HXMA 2A40A 2GWKA 1RTHA 4CF9A 2KLAA 1RT3A 3ENOA 4GW6A 2E2NA 1O1WA 3V6DA 4OPAA 1VSKA 1T03A 4BE0A 4CZLA 3RSEA 3VPZA 1GOCA 3V81A 4KH6A 3CPEA 4IO9L 1RBTA 3J80O 3K2PA 1XMOK 4KAZA 2Q3SA 3VOVA 1NKBA 1RBVA 3L2UA 4FLTA 3PIPL 1Z25A 4K42A 1C0MA 1VQ7N 3A5LC 3MX5A 3MMVA 3NCIA 5CE3A 4GY2B 5J2MA 4WFNL 1DEJA 4LF4K 2OYQA 3O9RA 4PKHA 5KQDA 3CHWA 2Z1JA 4QS8A 3O4NA 1WAFA 1RT4A 5C24A 2GUPA 2QXLA 5JVGL 3SAGA 5E84A 2IVOA 3V9UA 5FPNA 3S9HA 4E7IA 3ZSYA 3FZHA 1K6YA 4FM2A 3FFKB 4FWRA 1TKXA 1RT7A 3QFPA 3AVFA 3DXMA 3VGLA 5AQVA 4JI5K 1UA1A 3NBPA 4FK0A 2Z1IA 3C7NA 4YOYA 2X78A 3BY5A 5AQKA 2VG5A 3VA0A 1P8ZA 3O9UA 3VQ4A 1NJWA 3H1QA 1J5EK 3AARA 4EAHD 1TK8A 1FXXA 2FBXA 2FLOA 4BQZA 3KIOA 4FVMA 3VEOA 3H6EA 1TUYA 3QEVA 4DSKA 1B9DA 4IBNA 4CHPA 3RSEB 3HK2A 2YHXA 1VSMA 4CJTA 3KK3A 3QFUA 3T19A 3PX6A 1RBUA 1HYVA 5DM6L 4FOIA 4NCGA 1KAYA 2P9UA 3A8YA 2YKMA 5BR8K 3ZETA 4IFEA 5JMVA 2KW4A 5M1FA 5AQIA 3V4IA 4PL7A 1RFQA 5HP1A 4LF6K 3AVJA 3ZSVA 1R0AA 3O5BA 4CEQA 4HUFA 3S3OA 1G15A 3DAWA 4FLUA 4DFMA 3M8QA 4BRMA 4CK3A 5C15A 1IKVA 2X74A 2VQFK 4CJUA 2DFHA 4CF2A 3DXMB 4HTUA 2VQEK 2ZWHA 3BF3A 4BRKA 3C7NB 3ZYYX 1SKRA 3QETA 3O9QA 4M3YA 1WSIA 3HTVA 1ZYQA 3HT3A 4WYBA 1HLUA 4FOEA 5LJWA 2E8AA 2E2QA 5AQTA 1NBWA 1GLBG 1BU6O 1V4SA 4O0IA 2ZJRL 3SK3A 2VGMA 5KRSA 5AQGA 3LDOA 2FBTA 5I9EB 4Z4CA 2P9UB 1VQ4N 3FE1A 3TARA 4KHPK 1BQMA 3VF6A 2PAVA 1N6QA 2UUBK 1VSIA 3C65A 3ZSRA 2IGIA 3AVHA 5LL6Z 4JS5A 4FW1A 2ZGZA 4O44A 2OTLN 4MDAA 4DTXA 4FYDA 4F2SA 4RW8A 2G8HA 3THVA 4H0OA 3P39A 5AQQA 3ATUA 4IJNA 1ASVA 1G99A 4O8KA 3ZSQA 4NXMK 5TKYA 5IWAK 3O9SA 3S3NA 3BDPA 4Q5VA 4MFBA 3V9WA 3J7YP 3TAMA 4PL8A 3UKRA 4H5RA 2QK9A 3KLIA 4I2QA 1N32K 3QESA 3CFRA 2H3GX 1HYZA 2XY6A 3KHYA 3CD6N 3ZT0A 3LAKA 3HP6A 2QTDA 4B1WB 1TKTA 1TVRA 2WOMA 4Z4GA 5EOYA 4BRDA 4IXCA 3WQTA 3QEXA 4M3RA 1A5VA 2P9LA 3R9PA 1RDAA 3DLKA 5C42A 4KB1A 4ISGA 2JWLA 1T44A 2P5GA 2NRRA 3ID6A 3L4IA 1KCFA 4NLCA 2BUPA 2NNWA 4BR2A 2HMIA 3HZ6A 4HTLA 2QXFA 4FM1A 3CCLN 4JRPA 2GELA 5KRTA 3TR8A 3ZSZA 3UE5A 4YNQA 1DT9A 1KAXA 4F2RA 1HRHA 2FF3B 3CYMA 2F8TA 3JYTA 2UYTA 2Z1GA 1NK6A 4J2EA 2EX3A 4XH1A 2HHUA 3CM6A 4E7HA 2QI2A 4BC5A 2HMPA 1GLCG 5SZTA 1IKYA 1Q9XA 4FJ7A 3QDKA 4KTZA 3OS0A 5ADXH 4DSLA 1FKPA 3UKRB 3K59A 4A5AA 1YUWA 4C1NI 2F9TA 1KFSA 4E0DA 1TK5A 4OPKA 4W5RA 1JKHA 5AQRA 3K57A 4NXNK 3KK7A 4X62K 3SAHA 2KTQA 2WC9A 2ZM6K 4XH5A 4DTSA 4B08A 3EKSA 2W6KA 3TPQA 2HF4A 1L3SA 2J4RA 4BR0A 3DMJA 5FPEA 2KFNA 4CK1A 1HPZA 4RCHA 3SJJA 1KLNA 3BGRA 3AO1A 1S72N 5M1KA 4CIGA 2ASOA 4ZHRA 1RT2A 2UXCK 3IMXA 3FFIA 4C23A 4B3OA 2W41A 1QQMA 1BGXT 2YHAA 5LMNK 1UOCA 3G0ZA 4FWOA 4LF9K 3EL2A 3BP8A 1I94K 3I56N 1J54A 3WNFA 3V1OA 2OZMA 3LWLA 1RNHA 3CC7N 4KTQA 4N41A 4DR2K 4DQIA 1NKCA 2D0CA 3BF1A 5HRRA 1Q9YA 1ZC6A 4E89A 3SJHA 2YJFA 4YOXA 1RDDA 3F9KA 1QQOA 5I42A 2YX6A 1XI1A 4KRFA 1NGBA 2HB5A 3VF2A 3HOTA 4J2AA 3IFRA 4KHNA 5CHIA 1S5JA 5KTQA 3CMAN 1TGOA 2DPNA 4IEEA 5M1PA 3EYZA 3VEWA 3JSMA 2V52B 2QW9A 4AM7A 5AQWA 1JCGA 4QAGA 3HO1A 4CZIA 4BRPA 4CGIA 3O3FA 1RDCA 1ITGA 1VSLA 4KV8A 4NLBA 1YF5L 3I55N 2YKNA 3OY9A 2ZJPL 3OYKA 4WQ4C 4CZFA 2P9NB 4KHQA 1YHQN 2KHOA 3ZX3A 4BRCA 4UQGA 4CIEA 4JV5K 2B4JA 3A5OC 5D3GA 3CXCM 1ASWA 2XY7A 4BACA 1OH6A 4H0YB 2EHGA 4H8KA 4FXDA 4CJ7A 3C6AA 4K41A 5AQHA 3TU5A 1VQ6N 3OYJA 2DFEA 1HQEA 3L2VA 4DFJA 1LWCA 4YFUA 2W6LA 2W40A 2GWJA 1D9FA 1NGDA 3PLAA 5ADXA 5GIPA 1XNQK 3EE9A 4ILGB 1OH7A 1JCEA 1NOZA 3HBTA 4IWVA 3IAYA 3VQ8A 4DSJA 4CF8A 4FW2A 3OYBA 4DF4A 3HRGA 1DTTA 3EEQA 2IOCA 2ZGYA 3O3HA 1EX4A 3AVLA 3SAFA 3VGKA 3VESA 1HUXA 3ATVA 1CZAN 2XY8A 2OA8A 4DCHA 4EHTA 1VK0A 2GX9A 4F9OA 3TAQA 5GAEP 4BR9A 4YORA 3NVKA 1FKOA 2ATQA 2WBNA 4YDUC 1BL3A 3I8BA 2P1JA 4JK7A 4HVJA 3U9ZA 3PX4A 2YJEA 4OKEA 1S6QA 4CZHA 4DF8A 1HKBA 2A5XA 3SUPA 4PUOA 1EXQA 1NGHA 4H5NA 2FSKA 2EWSA 4FWMA 4JI8K 3LL3A 3K5LA 1X1PA 3K5MA 1W97L 4AQYK 4KFBA 2D5RA 1NLVA 3QO9A 3SQ1A 4LF8K 5BRDA 4DR1K 4FWQA 1I39A 2PFUA 3CQYA 3ULEA 4ILHA 4E19A 3K9KA 1T8EA 3M5RA 4ELVA 3P5JA 4K25A 4AHCA 1KFDA 2HVIA 1QVFM 4CBUA 4DWIA 3L2QA 3M3ZA 1LOTB 3WQUA 4CJFA 4TSXA 5AQLA 3E9OA 2HVHA 2PBDA 4FWNA 2X6SA 4OX9K 5GAHP 5HBMA 2O4GA 4YOWA 2QWMA 2JWKA 3BZCA 4IG0A 1WBBA 4BRAA 1FK9A 4B9MA 1NJIO 1KD1O 4MQ3A 4W5TA 4BQLA 1C0UA 2KQ2A 1HNZK 3LZIA 4A2BA 3QEPA 1B9FA 1RDWX 3E01A 3SPYA 3UKUB 4BREA 4JI6K 4LH5A 2BH1A 1D9DA 1C0TA 1X9SA 1HX1A 2YHWA 2V51B 3A2FA 4W5OA 4LF5K 3OJSA 1BOTO 4HWIA 4HHTA 4KHYA 1HNWK 3FGUA 3QBWA 4X65K 2ZD1A 2ITGA 4FJIA 4ELUA 2XHBA 1K8KB 4KKOA 4CW7B 4DU1A 4BDPA 3CIPA 5JS1A 1REVA 2QKBA 1QS4A 3MN6A 3UB5A 4Z0UA 4KPYA 3PO4A 4LC9B 4B3TK 4CD1A 4CZJA 3OYGA 3CQXA 3MN7A 5BRFA 4OLBA 3DXKB 2W42A 1Y64A 3ID8A 1HNXK 3L2WA 4DQPA 3PUFA 1VQ5N 3KJVA 5KQ8A 3KWIA 1YJWN 4C1NK 2F9WA 4IG3A 1VQLN 5M1QA 2HOEA 4DV6K 1L3UA 5FPDA 2QWOA 3HPOA 3RMDA 3UIQA 2BDPA 4NB4A 1K73O 3F5TA 4JKGB 3SUQA 3QEWA 3KK2A 2G8FA 3MCAB 1RDUA 1WOQA 3LALA 2IVNA 2NLXA 2PY5A 3B6PA 2WUSA 4J8FA 4FJJA 2DTUA 4IKFA 1GLEG 3GDQA 4RG8A 4R79A 3KWGA 3Q7BA 4BC3A 1E4GT 4DUYK 4BRHA 2PZSA 3QIPA 5CZ2A 1XNRK 4ELTA 4DTRA 3PSIA 5JLHA 2DY4A 2Q0UA 1IO2A 2KZZA 3S41A 4UY8O 4JKCA 3CJAA 2HHVA 4A5BA 4WQ4A 3B6OA 2A1RA 2QWPA 3AVNA 3THYA 1EWQA 2BANA 2E88A 2PYJA 4FLWA 5JVHL 3R8EA 2NUBA 1WNSA 4B9TA 3AO3A 5AFUH 1KVCA 4FJGA 1VQ9N 4E7LA 2FC0A 4CEDA 2A42A 5AQOA 3KZBA 4H4MA 2Q1NA 5HLFA 3LZJA 4OGCA 1U6ZA 2RHKA 1W0HA 4O0JA 4CFAA 1YVNA 3MAQA 5CYQA 1IBMK 5AZJA 1WB9A 3RR8A 4FVUA 4CGHA 3FZFA 2ZQBA 5EVZA 2VYPA 3T3FA 3MWPA 1HMVA 1LWFA 1MU2A 3ULDA 4QOZB 1N8RO 3AVKA 1ILYA 1ATNA 2E1YA 4CBXA 4CJKA 1YTUA 4JYAK 4CVNE 4YDUA 3BUZB 4K8ZA 3HVTA 3THYB 2E20A 2E2OA 2QEXN 3OA9A 5HROA 2O8DA 3VA3A 2AJQA 1YITN 2FSJA 1S3XA 2RN2A 2P9SA 3DLLL 3F2KA 3GE1A 4DR4K 2VGNA 4JEPA 4OKJA 4Z4IA 3IKMA 2A3ZA 5F0XA 3OTOK 4B9NA 3EE8A 3V9SA 1JLBA 4EZ9A 2NRZA 2WONA 1SZ2A 3KLHA 3TTFA 3L2RA 1XMQK 5LY3A 3OYCA 4F4KA 1RTJA 3P38A 3BZKA 3CJ9A 2HBJA 3VETA 1DTQA 4DV5K 1LW0A 5AZJB 4DG1A 4H03B 3CQ8A 4BR7A 1SV5A 4J2BA 5HOOA 3VF4A 1RILA 2FXUA 4FWLA 3OYIA 4H5WA 1NK8A 2RF2A 3EY1A 3ZETB 2LSNA 3OS1A 4CEOA 4CJWA 3RRGA 1IG9A 4GV3A 5J2QA 4I6MA 4K0KK 4C8OA 2O8DB 3TWHA 3I0SA 2OPSA 3DJCA 3CJ1A 4E1NA 4EP4A 4KH5A 4H0VB 3VQEA 3JAMO 2P9SB 4H5VA 3CCQN 3VENA 4X66K 3M8RA 3FLCO 3QINA 2ZJQL 2OCEA 2NRHA 3L8BA 5AFUA 3LDPA 1K8AO 4IJAA 4YY3K 4FZYA 4CK2A 4LFBK 4FCYA 4Z94A 3MDQA 1LWEA 4C8LA 3ENBA 3LDSA 1S1UA 3DI6A 3ZT1A 3CI5A 1KVAA 3E1YA 4DV0K 4DR6K 4M3UA 3VERA 1VAZA 4BDYA 1YJNN 4CCHA 3ENHA 5CYMA 5EY4A 2YI1A 2E6MA 5DM7L 2QWRA 3AGKA 2NZTA 4HCBA 4JKFA 1Z05A 3H46O 4WF9L 1QSSA 3LP3A 3L3UA 3LM2A 4JI7K 1SQKA 3CM5A 4DTMA 3JXUA 2BGGA 4CGGA 1TL1A 4I6MB 5EU7A 5BPMA 3AVGA 4AHTA 1R59O 3CCJN 1VSEA 3SI6A 3OS2A 3AO4A 4LY7A 3LM9A 4CZKA 3TTCA 2XY5A 5KPTA 1TUUA 5I3UA 3MEGA 4FWKA 5K14A 1JLAA 4JN4A 4BE2A 4B1ZA 1NGEA 1K9MO 1HR0K 3HL8A 4BR5A 4CHZA 4PKIA 3KK1A 2KKZA 2G8WA 3NDKA 4ZTFA 4BGAA 3ITHA 4DTOA 4PWDA 1OH8A 1UWBA 2VWJA 3F73A 4DV7K 1BUPA 4DV1K 1XC3A 1BIUA 2UU9K 1GLAG 2BE2A 2GEMA 1YTAA 4DLEA 1VQON 3QIOA 1KQSM 4L3QA 4J2DA 5JS2A 4B9QA 3W3DA 4DV2K 2ITMA 1QSYA 4FJXA 2P9LB 2A41A 2HHWA 5AQFA 3ZT4A 4KHWA 3F9MA 4FJHA 5E41A 1NNEA 1U04A 1S1VA 4WE1A 1NMDA 3O9TA 5BRHA 4DU3A 3O8MA 5KPRA 3VQQA 5C2FA 3MEEA 4DSFA 3ZX2A 3PX0A 1XHZA 3SQ0A 5FRMA 2NRWA 5F2RA 3R3LA 1U49A 3C6TA 3RTVA 3SNNA 1Q8IA 4FSVA 4DTNA 4KI6A 1XC9A 1JLGA 4U7BA 2D0BA 5AQMA 3HI0A 1NMNA 2VWBA 3V9XA 1NG9A 1U48A 4OJRA 3U6FA 4M3ZA 2NRXA 5AJ3K 1W7AA 4KI4A 3B8AX 2IAJA 2D1KA 3SV4A 2A6AA 3I8DA 5BN8A 3AA4A 4M42A 3WXIA 4BE1A 4DSEA 4K43A 1DGKN 3NH0A 1GLJO 4CF1A 1Q82O 3VGMA 4DR5K 3I33A 1B92A 4DV3K 1NJXA 4QCLA 4PA1A 3MN5A 5J2PA 4JI0K 1Q7YO 4Q0BA 4JI1K 4FK2A 5GIOA 1RBRA 1VQNN 3CCSN 3DLRA 3N4PA 2OANA 3L3VA 5KPZA 1U2VA 4B3RK 1D4XA 1NK0A 4G1QA 4CEBA 3NE6A 3RR7A 1EO1A 3M8PA 4FJLA 3CMEN 3SLCA 1RTDA 1YI2N 3NH2A 3SQ4A 4CFDA 1ZXOA 3G4SN 2D0OA 5AQUA 2FSNA 3CETA 2F96A 3CJ7A 2GUIA 2P9PA 3LDQA 3ZLJA 4CHYA 1WSEA 1V4TA 1VQMN 3AVMA 3MN9A 1NJZA 4ID1A 4BG9A 3C6UA 4CJLA 4LSNA 1XWLA 1KAZA 2IC3A 3L0QA 1H1VA 4N5SA 3O3GA 4BWMA 3H3NO 4DQ8A 4I9QA 1SKWA 4B8AB 4IOAL 4G9ZA 3ASMA 1QZ6A 1BHLA 1VQPN 2KFZA 1EETA 3DOKA 4BWJA 3WEEA 3OYEA 1KSPA 1WAJA 3VQDA 1U2VB 4Y1DA 1QHAA 1HKGA 4OGEA 4O5BA 4K8XA 1KXPA 1JCFA 3BEXA 3CFOA 3AO5A 3EO3A 3WXKA 4YOVA 3QBXA 3MXJA 5T7BA 4JKHA 4AHSA 4A2AA 3ZSOA 2P9PB 4FJ9A 3OYHA 1KTQA 3CC2N 5HRNA 2VCPA 5M1OA 3CCVN 1U45A 4N76A 2D0PA 1JXEA 1NK9A 1X9MA 4FWPA 3HSTB 3QNNA 5HRPA 3SBTA 1OH5A 3AAQA 1YVUA 3NVMA 5GADP 4O4GA 1VSFA 1NGFA 1WSFA 4XEIA 4FLXA 1TL3A 1D8YA 5LJVA 1NGCA 2HW3A 4FWSA 2HBLA 5AQPA 3HM9A 3VQ5A 5CZ1A 2P9KA 4WFBL 2OZSA 4MLHA 3WEEB 3G71N 1TAQA 2NRTA 3P83D 1NM1A 4CGJA 3AO2A 1LAWA 4FJNA 4IO8A 3VEVA 1OKJA 4O55A 3HSCA 5MLCQ 4FJKA 2PYLA 4BRGA 3LDNA 5J2NA 4KHUA 1Q86O 3TABA 1IH7A 1TKDA 4DSIA 3NF6A 4Z4EA 3LPTA 4CJRA 3D6RA 2P9IA 3PIOL 1A5WA 3NF9A 2O8FA 4FJ8A 4F8RA 4DHYA 3GG4A 1QQNA 1RT5A 3U8XA 3VQPA 3VQCA 4A62A 2RE2A 1VSDA 3ZEUA 1N33K 3W0LA 4GNIA 3HOSA 4PQUA 1IKWA 1F21A 1TK0A 1T7PA 1JL2A 1WBDA
chains in the Genus database with same CATH topology
1LWFA 1MU2A 2HMIA 3ULDA 4QOZB 1JLQA 1S9GA 3AVKA 2IDOA 2QXFA 4FM1A 4KHSA 2YNHA 4CJKA 4JRPA 2B6AA 1YTUA 1ZBFA 5KRTA 1YT3A 3TR8A 3ZSZA 4FM0A 5KGXA 1XHXA 4CEEA 1QTMA 3CG7A 4YNQA 1NJYA 3WNEA 4F2RA 3ISNC 3CFPA 4K8ZA 4M3XA 1HRHA 3SPZA 1S6PA 3DLGA 3CYMA 4B9VA 3HVTA 2F8TA 2XRIA 4NYFA 3JYTA 4FLZA 1KRPA 3QNOA 5HROA 1TKZA 2Z1GA 3KTQA 4NYNA 3VA3A 1NK6A 4Z4FA 1JLEA 1N5YA 2YNIA 2AJQA 4DTUA 1WSHA 2EX3A 5FROA 4J2EA 2HHUA 1VRTA 2RN2A 3CM6A 4E7HA 3KD1E 3AA2A 1RT6A 1HYSA 1VRUA 5SZTA 3K58A 3D0PA 1S1WA 1IKYA 1NOYA 1Q9XA 4FJ7A 4DSLA 3G10A 4KTZA 4OKJA 3OS0A 3RWUA 1FKPA 1D5AA 4Z4IA 3HJFA 4B9NA 3K59A 2E4LA 3I0RA 4AILC 1KFSA 4RW9A 3V9SA 3ZCMA 1TK5A 2FBVA 4E0DA 2HHSA 4OPKA 4W5RA 1JLBA 1ZBHA 4EZ9A 3AVBA 1JKHA 2WONA 3NGZA 3KLHA 3K57A 3L2RA 3RMCA 4KB0A 4CE9A 3NHGA 3OYCA 1SL0A 1RTJA 4I7FA 4F4KA 2KTQA 4ICLA 1DTQA 3MECA 1LW0A 4DTSA 4B08A 1UA0A 4DG1A 2I5JA 1U47A 4ZTJA 1L3SA 3CQ8A 4DMNA 1SV5A 3VN5A 3DMJA 4FJMA 4Y1CA 3C95A 4CK1A 3KLFA 2KFNA 4OKKA 1HPZA 4HUEA 4J2BA 1BIZA 3SJJA 4M3WA 5FRNA 1RILA 1JLCA 4CESA 1KLNA 3BGRA 3OYIA 1QSLA 5FDLA 3AO1A 1HNVA 3HP9A 4DQRA 3RRHA 1WSGA 1VSJA 2B5JA 2Z1HA 4CIGA 4ZHRA 3KLEA 1NK8A 2RF2A 1RT2A 4KTWA 1BI4A 2FBYA 3EY1A 4E7JA 3TAFA 2LSNA 3OS1A 4CEOA 3V1RA 4CJWA 3RRGA 1IG9A 3FFIA 5J2QA 4B3OA 1WLJA 1RBSA 1BGXT 2YHAA 3AVAA 4C8OA 1UOCA 3DLEA 3G0ZA 1SUQA 3TWHA 4AHVA 3NFAA 3I0SA 2OPSA 3LWMA 4EP4A 4E1NA 2YHBA 3VQEA 3SYZA 1J54A 2HHXA 3WNFA 1SKSA 3V1OA 2OZMA 4M3TA 3KKRA 3M8RA 3LWLA 1RNHA 2HNYA 4KTQA 3NF8A 1BCMA 4N41A 4LSLA 4LD0A 4DQIA 4CFCA 1Y97A 3QINA 1NKCA 2G8IA 2D0CA 4OPJA 3H08A 5HRRA 3L8BA 1Q9YA 3AA3A 3IG1A 4OLAA 4E89A 4FZYA 1RDDA 4CK2A 3F9KA 5I42A 1XI1A 5KI6A 3AVCA 4KRFA 2RPIA 3KLGA 4FCYA 2HB5A 1LWEA 4C8LA 2A1SA 3LDSA 4EZ6A 1S1UA 3DI6A 3ZT1A 1X9WA 3SUNA 4J2AA 4KHNA 1KVAA 1S5JA 1J9AA 3DLHA 1WN7A 4CGFA 5KTQA 4M3UA 1LV5A 3KKSA 3VQ7A 3IRXA 3K5NA 5CY4A 1VSHA 1RTIA 1TGOA 3EYZA 4BDYA 2OPRA 3JSMA 4CCHA 2Y1IA 5KGWA 5CYMA 4B9LA 1SL1A 4NCBA 3HK2A 3IS9A 2E6MA 4QAGA 3V1QA 3NH1A 3HO1A 4CGIA 3O3FA 1C1AA 1RDCA 1L3TA 4B9UA 4HCBA 2KZMA 1ITGA 3LP1A 1VSLA 4KV8A 1S1XA 3NGYA 4AHUA 1CZBA 1BI4B 3HYFA 1QSSA 2YKNA 3LP3A 3O4QA 3L3UA 3OY9A 2YNGA 3OYKA 4CIFA 1SL2A 3CM5A 2QKKA 4DTMA 3MXMA 4E7KA 2P5OA 4KHQA 3DM2A 2BGGA 4UQGA 4CIEA 4DS4A 4CGGA 3TI0A 1TL1A 1NKEA 3VQ9A 4CJEA 4R5PA 4N47A 2B4JA 5EU7A 1IKXA 3AVGA 3HPGA 4AHTA 4CF0A 5D3GA 1ASWA 1CZ9A 4BACA 3DRSA 4BDZA 2XY7A 4DS5A 1ZBLA 1VSEA 4C8MA 3SI6A 4CHNA 2G8KA 2YV0X 3OS2A 4B9SA 2EHGA 3AO4A 4IFVA 3D45A 4LY7A 4H8KA 4C8KA 3P1GA 4FXDA 2XY5A 5I3UA 3LP0A 1L3VA 3KD5E 1JLFA 3MEGA 4CEAA 4FJ5A 3VQ6A 1BQNA 3S3MA 2HHTA 5K14A 4E1MA 3OYJA 1JLAA 2DFEA 1HQEA 4CHOA 3L2VA 4DFJA 4BE2A 1UAXA 3DLBA 4CJ5A 3OYNA 4FZZA 3HL8A 1EKEA 4CHZA 1LWCA 4YFUA 3KK1A 2G8WA 3NDKA 4ZTFA 2G8VA 1A5XA 3ITHA 1D9FA 4DTOA 4PWDA 1CXQA 1UWBA 1NOZA 3IAYA 3VQ8A 3T1AA 2VWJA 4DSJA 4CF8A 4FW2A 4I9LA 5J1EA 3OYBA 3HVRA 3F73A 4DF4A 1RT1A 4CHQA 1QHTA 1DTTA 1T05A 1BIUA 2IOCA 3O3HA 3OYLA 4KREA 2BE2A 1EX4A 4PY5A 1RDBA 1YTAA 4DLEA 3QIOA 4J2DA 3AVLA 3MEDA 5JS2A 3K5OA 1CLQA 4F3TA 3AV9A 3NF7A 3OJUA 1QSYA 4FJXA 4CEFA 2HHWA 2XY8A 2OA8A 2F8SA 2DFFA 4CJ4A 3ZT4A 2IS3A 4KHWA 5DMRA 1VK0A 3SCXA 3TAQA 3WNHA 2VG7A 3U3YA 4FJHA 1ZBUA 5E41A 1HJRA 1FKOA 2ATQA 1NK4A 1BL3A 2VG6A 2OPQA 3VQAA 4CGDA 1U04A 1S1VA 2P1JA 4WE1A 4HVJA 3PX4A 1NK7A 3ALYA 4DU3A 4OKEA 1S6QA 3VQQA 3MEEA 4DLGA 4DSFA 4DF8A 3PX0A 3SUPA 3ZT3A 1I3AA 4PUOA 1EXQA 1JXBA 3SQ0A 1XHZA 3HXMA 5FRMA 4CJSA 4OVLA 3PV8A 1U49A 4RW7A 3C6TA 2E6LA 4CJQA 3K5LA 1X1PA 3C94A 1Q8IA 3RTVA 1RTHA 3SNNA 4CF9A 2R7YA 4DTNA 1JLGA 1XC9A 2GV9A 4KI6A 3K5MA 1RT3A 3DRRA 4GW6A 2D0BA 4M41A 1O1WA 4KFBA 2D5RA 3V6DA 1VSKA 1T03A 3V9XA 4BE0A 3QO9A 2D0AA 4I2PA 5SWMA 1U48A 4OJRA 3U6FA 3SQ1A 1GOCA 2P51A 3V81A 4M3ZA 4DFPA 1I39A 4KI4A 2IAJA 1RBTA 3K2PA 4KAZA 2Q3SA 3SV4A 1NKBA 3I8DA 1RBVA 3AA4A 4E19A 3L2UA 1T8EA 3SV3A 4FLTA 4DQSA 3P5JA 4AHCA 4ELVA 1KFDA 4M42A 2HVIA 1Z25A 4BE1A 1C0MA 4DSEA 3NH0A 4DWIA 3NCIA 4CF1A 3L2QA 5J2MA 1B92A 4FLVA 1NJXA 4QCLA 4CJFA 2OYQA 4TSXA 4PA1A 5J2PA 2Z1JA 2HVHA 3RMBA 2ETJA 2X6SA 4Q0BA 3O4NA 4FK2A 1WAFA 1RBRA 5HBMA 1RT4A 4IFYA 5C24A 2O4GA 3DLRA 1CXUA 3L3VA 4IG0A 3V9UA 3S9HA 4CFBA 1FK9A 4E7IA 1NK0A 4G1QA 4CEBA 2OPPA 3ZSYA 4JRQA 3NE6A 3OYDA 4B9MA 1K6YA 4MQ3A 4W5TA 4FM2A 3RR7A 3PY8A 1TKXA 3M8PA 1C0UA 1RT7A 4FJLA 2HHQA 3AVFA 2KQ2A 3OVNA 2ZE2A 4CERA 3LZIA 3QEPA 1UA1A 3NBPA 3NH2A 2Z1IA 3QERA 1RTDA 2X78A 3SQ4A 4CFDA 4FK0A 1BCOA 4LH4A 2VG5A 3VA0A 1B9FA 3E01A 2GBZA 3VQ4A 1NJWA 3SPYA 5HRSA 2F96A 4EP5A 4N56A 4LH5A 3WNGA 2GUIA 1BISA 1TK8A 1D9DA 1FXXA 2FBXA 1C0TA 1LW2A 3KIOA 4FVMA 1X9SA 4NCAA 4CHYA 1WSEA 3QEVA 4DSKA 1B9DA 4IBNA 3ZSXA 1ASUA 1EP4A 3AVMA 3ZT2A 4CHPA 1NJZA 4ID1A 3A2FA 2VWKA 1VSMA 4IDKA 4M45A 4CJTA 4W5OA 3KK3A 4HUGA 3OJSA 3T19A 3PX6A 3C6UA 4CJLA 3TANA 1RBUA 1HYVA 1JL1A 2JGUA 1XWLA 4LSNA 4HHTA 4KHYA 2IC3A 1RCHA 4NCGA 1U4BA 4AH9A 2ZD1A 2ITGA 1S9EA 2YKMA 4N5SA 4FJIA 3O3GA 4ELUA 4BWMA 4DU4A 1J53A 2KW4A 4I9QA 1SKWA 2XHBA 4B8AB 2RKIA 3QEIA 4KKOA 4DU1A 3V4IA 1GOAA 1NK5A 4BDPA 5HP1A 5JS1A 1REVA 3AVJA 3ASMA 3ZSVA 1HNIA 2QKBA 1BHLA 3EZ5A 1QS4A 1R0AA 4CJ3A 2KFZA 1EETA 4CEQA 4HUFA 3S3OA 4DQQA 4Z0UA 4JLHA 3NGIA 4W5NA 1G15A 3DOKA 4BWJA 4KPYA 3PO4A 1L5UA 3OYEA 2Y1JA 3OYGA 1KSPA 4FLUA 1WAJA 4OLBA 4DFMA 3M8QA 2W42A 4FK4A 3VQDA 1HQUA 4Y1DA 4CK3A 3TAEA 1IKVA 3L2WA 4OGEA 3PUFA 4DQPA 4O5BA 2X74A 3KJVA 4GVMA 2DFHA 3LANA 4CJUA 4CF2A 4K8XA 1LAVA 4RW6A 4HTUA 3CFOA 4IG3A 3AO5A 4H4OA 1SKRA 3QETA 1L3UA 3LP2A 4HCCA 3MXJA 5T7BA 4M3YA 1WSIA 3HPOA 3RMDA 3UIQA 2XO7A 2BDPA 4AHSA 4ID5A 3M8SA 3HT3A 1ZYQA 3V9ZA 3SUQA 1QQCA 3QEWA 3KK2A 3SUOA 2G8FA 3ZSOA 4FJ9A 1TV6A 3LALA 2HNZA 1KTQA 3OYHA 5HRNA 3NAEA 2PY5A 4O0IA 3B6PA 5KRSA 4DTPA 1W9HA 1WSJA 1U45A 4N76A 4FJJA 4E3SA 1JXEA 1DLOA 1NK9A 1X9MA 2G8UA 2FBTA 4IKFA 3AVIA 2DTUA 4Z4CA 3QLHA 3OYAA 3HSTB 3QNNA 5HRPA 4RG8A 2O4IA 1YVUA 4O4GA 4FLYA 1VSFA 3TARA 4KO0A 1WSFA 2PZSA 3QIPA 1BQMA 5CZ2A 4FLXA 1N6QA 1TAUA 5DK5A 1VSIA 1TL3A 2JLEA 1D8YA 5C25A 4ELTA 3ZSRA 2IGIA 4DFKA 3AVHA 4DTRA 1TK0A 4JS5A 2HW3A 2X6NA 4FW1A 4CJVA 1GOBA 4O44A 3SZ2A 3MXIA 3LPUA 4L8RB 2DY4A 1KLMA 1IO2A 3DRPA 2HNDA 4DTXA 2KZZA 3HM9A 3RMAA 3TAPA 3VQ5A 5CZ1A 3SQ2A 4F2SA 4FYDA 2HHVA 2OZSA 1TAQA 3P83D 4RW8A 2G8HA 3THVA 3B6OA 3AO2A 4CGJA 1LAWA 4FJNA 4CECA 3AVNA 2A1RA 4CJPA 1ASVA 2BANA 4RW4A 2PYJA 4FLWA 4O55A 3ZSQA 3TAGA 4FJKA 2PYLA 1S1TA 4B8CA 4F3OA 5J2NA 3U3GA 2NUBA 1WNSA 4KHUA 4B9TA 3AO3A 1KVCA 4FJGA 1C6VA 4DTJA 3S3NA 3BDPA 3TABA 3PO5A 4AHRA 1IH7A 4E7LA 4Q5VA 2FC0A 4MFBA 1TKDA 1KVBA 3V9WA 4DSIA 3AA5X 3NF6A 3VQBA 3TAMA 4CEDA 4Z4EA 3LPTA 4CJRA 2QK9A 3KLIA 1A5WA 3NF9A 4I2QA 4Z4HA 3HPHA 4H4MA 5HLFA 3LZJA 3QESA 3CFRA 4OGCA 1HYZA 2XY6A 4FJ8A 4F8RA 4C8NA 1Z26A 3DOLA 3ZT0A 4CEZA 3LAKA 1W0HA 4O0JA 4CFAA 3HP6A 3MAQA 1TKTA 1TVRA 3OYMA 2WOMA 1RT5A 3VQCA 3VQPA 4Z4GA 5CYQA 3RR8A 2YNFA 3DYAA 4CGHA 3QEXA 1C1CA 1VSDA 4M3RA 4FZXC 1A5VA 3ZSWA 4XIUA 1ZBIA 4GMJB 1RDAA 3DLKA 5C42A 4KB1A 2ZQBA 4W5QA 1QE1A 3LAMA 4JS4A 2P5GA 1C1BA 3T3FA 4PQUA 1IKWA 1J5OA 3OYFA 1F21A 1KCFA 1T7PA 1JL2A 1HMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWF A;  1MU2 A;  2HMI A;  3ULD A;  4QOZ B;  1JLQ A;  1S9G A;  3AVK A;  2IDO A;  2QXF A;  4FM1 A;  4KHS A;  2YNH A;  4CJK A;  4JRP A;  2B6A A;  1YTU A;  1ZBF A;  5KRT A;  1YT3 A;  3TR8 A;  3ZSZ A;  4FM0 A;  5KGX A;  1XHX A;  4CEE A;  1QTM A;  3CG7 A;  4YNQ A;  1NJY A;  3WNE A;  4F2R A;  3ISN C;  3CFP A;  4K8Z A;  4M3X A;  1HRH A;  3SPZ A;  1S6P A;  3DLG A;  3CYM A;  4B9V A;  3HVT A;  2F8T A;  2XRI A;  4NYF A;  3JYT A;  4FLZ A;  1KRP A;  3QNO A;  5HRO A;  1TKZ A;  2Z1G A;  3KTQ A;  4NYN A;  3VA3 A;  1NK6 A;  4Z4F A;  1JLE A;  1N5Y A;  2YNI A;  2AJQ A;  4DTU A;  1WSH A;  2EX3 A;  5FRO A;  4J2E A;  2HHU A;  1VRT A;  2RN2 A;  3CM6 A;  4E7H A;  3KD1 E;  3AA2 A;  1RT6 A;  1HYS A;  1VRU A;  5SZT A;  3K58 A;  3D0P A;  1S1W A;  1IKY A;  1NOY A;  1Q9X A;  4FJ7 A;  4DSL A;  3G10 A;  4KTZ A;  4OKJ A;  3OS0 A;  3RWU A;  1FKP A;  1D5A A;  4Z4I A;  3HJF A;  4B9N A;  3K59 A;  2E4L A;  3I0R A;  4AIL C;  1KFS A;  4RW9 A;  3V9S A;  3ZCM A;  1TK5 A;  2FBV A;  4E0D A;  2HHS A;  4OPK A;  4W5R A;  1JLB A;  1ZBH A;  4EZ9 A;  3AVB A;  1JKH A;  2WON A;  3NGZ A;  3KLH A;  3K57 A;  3L2R A;  3RMC A;  4KB0 A;  4CE9 A;  3NHG A;  3OYC A;  1SL0 A;  1RTJ A;  4I7F A;  4F4K A;  2KTQ A;  4ICL A;  1DTQ A;  3MEC A;  1LW0 A;  4DTS A;  4B08 A;  1UA0 A;  4DG1 A;  2I5J A;  1U47 A;  4ZTJ A;  1L3S A;  3CQ8 A;  4DMN A;  1SV5 A;  3VN5 A;  3DMJ A;  4FJM A;  4Y1C A;  3C95 A;  4CK1 A;  3KLF A;  2KFN A;  4OKK A;  1HPZ A;  4HUE A;  4J2B A;  1BIZ A;  3SJJ A;  4M3W A;  5FRN A;  1RIL A;  1JLC A;  4CES A;  1KLN A;  3BGR A;  3OYI A;  1QSL A;  5FDL A;  3AO1 A;  1HNV A;  3HP9 A;  4DQR A;  3RRH A;  1WSG A;  1VSJ A;  2B5J A;  2Z1H A;  4CIG A;  4ZHR A;  3KLE A;  1NK8 A;  2RF2 A;  1RT2 A;  4KTW A;  1BI4 A;  2FBY A;  3EY1 A;  4E7J A;  3TAF A;  2LSN A;  3OS1 A;  4CEO A;  3V1R A;  4CJW A;  3RRG A;  1IG9 A;  3FFI A;  5J2Q A;  4B3O A;  1WLJ A;  1RBS A;  1BGX T;  2YHA A;  3AVA A;  4C8O A;  1UOC A;  3DLE A;  3G0Z A;  1SUQ A;  3TWH A;  4AHV A;  3NFA A;  3I0S A;  2OPS A;  3LWM A;  4EP4 A;  4E1N A;  2YHB A;  3VQE A;  3SYZ A;  1J54 A;  2HHX A;  3WNF A;  1SKS A;  3V1O A;  2OZM A;  4M3T A;  3KKR A;  3M8R A;  3LWL A;  1RNH A;  2HNY A;  4KTQ A;  3NF8 A;  1BCM A;  4N41 A;  4LSL A;  4LD0 A;  4DQI A;  4CFC A;  1Y97 A;  3QIN A;  1NKC A;  2G8I A;  2D0C A;  4OPJ A;  3H08 A;  5HRR A;  3L8B A;  1Q9Y A;  3AA3 A;  3IG1 A;  4OLA A;  4E89 A;  4FZY A;  1RDD A;  4CK2 A;  3F9K A;  5I42 A;  1XI1 A;  5KI6 A;  3AVC A;  4KRF A;  2RPI A;  3KLG A;  4FCY A;  2HB5 A;  1LWE A;  4C8L A;  2A1S A;  3LDS A;  4EZ6 A;  1S1U A;  3DI6 A;  3ZT1 A;  1X9W A;  3SUN A;  4J2A A;  4KHN A;  1KVA A;  1S5J A;  1J9A A;  3DLH A;  1WN7 A;  4CGF A;  5KTQ A;  4M3U A;  1LV5 A;  3KKS A;  3VQ7 A;  3IRX A;  3K5N A;  5CY4 A;  1VSH A;  1RTI A;  1TGO A;  3EYZ A;  4BDY A;  2OPR A;  3JSM A;  4CCH A;  2Y1I A;  5KGW A;  5CYM A;  4B9L A;  1SL1 A;  4NCB A;  3HK2 A;  3IS9 A;  2E6M A;  4QAG A;  3V1Q A;  3NH1 A;  3HO1 A;  4CGI A;  3O3F A;  1C1A A;  1RDC A;  1L3T A;  4B9U A;  4HCB A;  2KZM A;  1ITG A;  3LP1 A;  1VSL A;  4KV8 A;  1S1X A;  3NGY A;  4AHU A;  1CZB A;  1BI4 B;  3HYF A;  1QSS A;  2YKN A;  3LP3 A;  3O4Q A;  3L3U A;  3OY9 A;  2YNG A;  3OYK A;  4CIF A;  1SL2 A;  3CM5 A;  2QKK A;  4DTM A;  3MXM A;  4E7K A;  2P5O A;  4KHQ A;  3DM2 A;  2BGG A;  4UQG A;  4CIE A;  4DS4 A;  4CGG A;  3TI0 A;  1TL1 A;  1NKE A;  3VQ9 A;  4CJE A;  4R5P A;  4N47 A;  2B4J A;  5EU7 A;  1IKX A;  3AVG A;  3HPG A;  4AHT A;  4CF0 A;  5D3G A;  1ASW A;  1CZ9 A;  4BAC A;  3DRS A;  4BDZ A;  2XY7 A;  4DS5 A;  1ZBL A;  1VSE A;  4C8M A;  3SI6 A;  4CHN A;  2G8K A;  2YV0 X;  3OS2 A;  4B9S A;  2EHG A;  3AO4 A;  4IFV A;  3D45 A;  4LY7 A;  4H8K A;  4C8K A;  3P1G A;  4FXD A;  2XY5 A;  5I3U A;  3LP0 A;  1L3V A;  3KD5 E;  1JLF A;  3MEG A;  4CEA A;  4FJ5 A;  3VQ6 A;  1BQN A;  3S3M A;  2HHT A;  5K14 A;  4E1M A;  3OYJ A;  1JLA A;  2DFE A;  1HQE A;  4CHO A;  3L2V A;  4DFJ A;  4BE2 A;  1UAX A;  3DLB A;  4CJ5 A;  3OYN A;  4FZZ A;  3HL8 A;  1EKE A;  4CHZ A;  1LWC A;  4YFU A;  3KK1 A;  2G8W A;  3NDK A;  4ZTF A;  2G8V A;  1A5X A;  3ITH A;  1D9F A;  4DTO A;  4PWD A;  1CXQ A;  1UWB A;  1NOZ A;  3IAY A;  3VQ8 A;  3T1A A;  2VWJ A;  4DSJ A;  4CF8 A;  4FW2 A;  4I9L A;  5J1E A;  3OYB A;  3HVR A;  3F73 A;  4DF4 A;  1RT1 A;  4CHQ A;  1QHT A;  1DTT A;  1T05 A;  1BIU A;  2IOC A;  3O3H A;  3OYL A;  4KRE A;  2BE2 A;  1EX4 A;  4PY5 A;  1RDB A;  1YTA A;  4DLE A;  3QIO A;  4J2D A;  3AVL A;  3MED A;  5JS2 A;  3K5O A;  1CLQ A;  4F3T A;  3AV9 A;  3NF7 A;  3OJU A;  1QSY A;  4FJX A;  4CEF A;  2HHW A;  2XY8 A;  2OA8 A;  2F8S A;  2DFF A;  4CJ4 A;  3ZT4 A;  2IS3 A;  4KHW A;  5DMR A;  1VK0 A;  3SCX A;  3TAQ A;  3WNH A;  2VG7 A;  3U3Y A;  4FJH A;  1ZBU A;  5E41 A;  1HJR A;  1FKO A;  2ATQ A;  1NK4 A;  1BL3 A;  2VG6 A;  2OPQ A;  3VQA A;  4CGD A;  1U04 A;  1S1V A;  2P1J A;  4WE1 A;  4HVJ A;  3PX4 A;  1NK7 A;  3ALY A;  4DU3 A;  4OKE A;  1S6Q A;  3VQQ A;  3MEE A;  4DLG A;  4DSF A;  4DF8 A;  3PX0 A;  3SUP A;  3ZT3 A;  1I3A A;  4PUO A;  1EXQ A;  1JXB A;  3SQ0 A;  1XHZ A;  3HXM A;  5FRM A;  4CJS A;  4OVL A;  3PV8 A;  1U49 A;  4RW7 A;  3C6T A;  2E6L A;  4CJQ A;  3K5L A;  1X1P A;  3C94 A;  1Q8I A;  3RTV A;  1RTH A;  3SNN A;  4CF9 A;  2R7Y A;  4DTN A;  1JLG A;  1XC9 A;  2GV9 A;  4KI6 A;  3K5M A;  1RT3 A;  3DRR A;  4GW6 A;  2D0B A;  4M41 A;  1O1W A;  4KFB A;  2D5R A;  3V6D A;  1VSK A;  1T03 A;  3V9X A;  4BE0 A;  3QO9 A;  2D0A A;  4I2P A;  5SWM A;  1U48 A;  4OJR A;  3U6F A;  3SQ1 A;  1GOC A;  2P51 A;  3V81 A;  4M3Z A;  4DFP A;  1I39 A;  4KI4 A;  2IAJ A;  1RBT A;  3K2P A;  4KAZ A;  2Q3S A;  3SV4 A;  1NKB A;  3I8D A;  1RBV A;  3AA4 A;  4E19 A;  3L2U A;  1T8E A;  3SV3 A;  4FLT A;  4DQS A;  3P5J A;  4AHC A;  4ELV A;  1KFD A;  4M42 A;  2HVI A;  1Z25 A;  4BE1 A;  1C0M A;  4DSE A;  3NH0 A;  4DWI A;  3NCI A;  4CF1 A;  3L2Q A;  5J2M A;  1B92 A;  4FLV A;  1NJX A;  4QCL A;  4CJF A;  2OYQ A;  4TSX A;  4PA1 A;  5J2P A;  2Z1J A;  2HVH A;  3RMB A;  2ETJ A;  2X6S A;  4Q0B A;  3O4N A;  4FK2 A;  1WAF A;  1RBR A;  5HBM A;  1RT4 A;  4IFY A;  5C24 A;  2O4G A;  3DLR A;  1CXU A;  3L3V A;  4IG0 A;  3V9U A;  3S9H A;  4CFB A;  1FK9 A;  4E7I A;  1NK0 A;  4G1Q A;  4CEB A;  2OPP A;  3ZSY A;  4JRQ A;  3NE6 A;  3OYD A;  4B9M A;  1K6Y A;  4MQ3 A;  4W5T A;  4FM2 A;  3RR7 A;  3PY8 A;  1TKX A;  3M8P A;  1C0U A;  1RT7 A;  4FJL A;  2HHQ A;  3AVF A;  2KQ2 A;  3OVN A;  2ZE2 A;  4CER A;  3LZI A;  3QEP A;  1UA1 A;  3NBP A;  3NH2 A;  2Z1I A;  3QER A;  1RTD A;  2X78 A;  3SQ4 A;  4CFD A;  4FK0 A;  1BCO A;  4LH4 A;  2VG5 A;  3VA0 A;  1B9F A;  3E01 A;  2GBZ A;  3VQ4 A;  1NJW A;  3SPY A;  5HRS A;  2F96 A;  4EP5 A;  4N56 A;  4LH5 A;  3WNG A;  2GUI A;  1BIS A;  1TK8 A;  1D9D A;  1FXX A;  2FBX A;  1C0T A;  1LW2 A;  3KIO A;  4FVM A;  1X9S A;  4NCA A;  4CHY A;  1WSE A;  3QEV A;  4DSK A;  1B9D A;  4IBN A;  3ZSX A;  1ASU A;  1EP4 A;  3AVM A;  3ZT2 A;  4CHP A;  1NJZ A;  4ID1 A;  3A2F A;  2VWK A;  1VSM A;  4IDK A;  4M45 A;  4CJT A;  4W5O A;  3KK3 A;  4HUG A;  3OJS A;  3T19 A;  3PX6 A;  3C6U A;  4CJL A;  3TAN A;  1RBU A;  1HYV A;  1JL1 A;  2JGU A;  1XWL A;  4LSN A;  4HHT A;  4KHY A;  2IC3 A;  1RCH A;  4NCG A;  1U4B A;  4AH9 A;  2ZD1 A;  2ITG A;  1S9E A;  2YKM A;  4N5S A;  4FJI A;  3O3G A;  4ELU A;  4BWM A;  4DU4 A;  1J53 A;  2KW4 A;  4I9Q A;  1SKW A;  2XHB A;  4B8A B;  2RKI A;  3QEI A;  4KKO A;  4DU1 A;  3V4I A;  1GOA A;  1NK5 A;  4BDP A;  5HP1 A;  5JS1 A;  1REV A;  3AVJ A;  3ASM A;  3ZSV A;  1HNI A;  2QKB A;  1BHL A;  3EZ5 A;  1QS4 A;  1R0A A;  4CJ3 A;  2KFZ A;  1EET A;  4CEQ A;  4HUF A;  3S3O A;  4DQQ A;  4Z0U A;  4JLH A;  3NGI A;  4W5N A;  1G15 A;  3DOK A;  4BWJ A;  4KPY A;  3PO4 A;  1L5U A;  3OYE A;  2Y1J A;  3OYG A;  1KSP A;  4FLU A;  1WAJ A;  4OLB A;  4DFM A;  3M8Q A;  2W42 A;  4FK4 A;  3VQD A;  1HQU A;  4Y1D A;  4CK3 A;  3TAE A;  1IKV A;  3L2W A;  4OGE A;  3PUF A;  4DQP A;  4O5B A;  2X74 A;  3KJV A;  4GVM A;  2DFH A;  3LAN A;  4CJU A;  4CF2 A;  4K8X A;  1LAV A;  4RW6 A;  4HTU A;  3CFO A;  4IG3 A;  3AO5 A;  4H4O A;  1SKR A;  3QET A;  1L3U A;  3LP2 A;  4HCC A;  3MXJ A;  5T7B A;  4M3Y A;  1WSI A;  3HPO A;  3RMD A;  3UIQ A;  2XO7 A;  2BDP A;  4AHS A;  4ID5 A;  3M8S A;  3HT3 A;  1ZYQ A;  3V9Z A;  3SUQ A;  1QQC A;  3QEW A;  3KK2 A;  3SUO A;  2G8F A;  3ZSO A;  4FJ9 A;  1TV6 A;  3LAL A;  2HNZ A;  1KTQ A;  3OYH A;  5HRN A;  3NAE A;  2PY5 A;  4O0I A;  3B6P A;  5KRS A;  4DTP A;  1W9H A;  1WSJ A;  1U45 A;  4N76 A;  4FJJ A;  4E3S A;  1JXE A;  1DLO A;  1NK9 A;  1X9M A;  2G8U A;  2FBT A;  4IKF A;  3AVI A;  2DTU A;  4Z4C A;  3QLH A;  3OYA A;  3HST B;  3QNN A;  5HRP A;  4RG8 A;  2O4I A;  1YVU A;  4O4G A;  4FLY A;  1VSF A;  3TAR A;  4KO0 A;  1WSF A;  2PZS A;  3QIP A;  1BQM A;  5CZ2 A;  4FLX A;  1N6Q A;  1TAU A;  5DK5 A;  1VSI A;  1TL3 A;  2JLE A;  1D8Y A;  5C25 A;  4ELT A;  3ZSR A;  2IGI A;  4DFK A;  3AVH A;  4DTR A;  1TK0 A;  4JS5 A;  2HW3 A;  2X6N A;  4FW1 A;  4CJV A;  1GOB A;  4O44 A;  3SZ2 A;  3MXI A;  3LPU A;  4L8R B;  2DY4 A;  1KLM A;  1IO2 A;  3DRP A;  2HND A;  4DTX A;  2KZZ A;  3HM9 A;  3RMA A;  3TAP A;  3VQ5 A;  5CZ1 A;  3SQ2 A;  4F2S A;  4FYD A;  2HHV A;  2OZS A;  1TAQ A;  3P83 D;  4RW8 A;  2G8H A;  3THV A;  3B6O A;  3AO2 A;  4CGJ A;  1LAW A;  4FJN A;  4CEC A;  3AVN A;  2A1R A;  4CJP A;  1ASV A;  2BAN A;  4RW4 A;  2PYJ A;  4FLW A;  4O55 A;  3ZSQ A;  3TAG A;  4FJK A;  2PYL A;  1S1T A;  4B8C A;  4F3O A;  5J2N A;  3U3G A;  2NUB A;  1WNS A;  4KHU A;  4B9T A;  3AO3 A;  1KVC A;  4FJG A;  1C6V A;  4DTJ A;  3S3N A;  3BDP A;  3TAB A;  3PO5 A;  4AHR A;  1IH7 A;  4E7L A;  4Q5V A;  2FC0 A;  4MFB A;  1TKD A;  1KVB A;  3V9W A;  4DSI A;  3AA5 X;  3NF6 A;  3VQB A;  3TAM A;  4CED A;  4Z4E A;  3LPT A;  4CJR A;  2QK9 A;  3KLI A;  1A5W A;  3NF9 A;  4I2Q A;  4Z4H A;  3HPH A;  4H4M A;  5HLF A;  3LZJ A;  3QES A;  3CFR A;  4OGC A;  1HYZ A;  2XY6 A;  4FJ8 A;  4F8R A;  4C8N A;  1Z26 A;  3DOL A;  3ZT0 A;  4CEZ A;  3LAK A;  1W0H A;  4O0J A;  4CFA A;  3HP6 A;  3MAQ A;  1TKT A;  1TVR A;  3OYM A;  2WOM A;  1RT5 A;  3VQC A;  3VQP A;  4Z4G A;  5CYQ A;  3RR8 A;  2YNF A;  3DYA A;  4CGH A;  3QEX A;  1C1C A;  1VSD A;  4M3R A;  4FZX C;  1A5V A;  3ZSW A;  4XIU A;  1ZBI A;  4GMJ B;  1RDA A;  3DLK A;  5C42 A;  4KB1 A;  2ZQB A;  4W5Q A;  1QE1 A;  3LAM A;  4JS4 A;  2P5G A;  1C1B A;  3T3F A;  4PQU A;  1IKW A;  1J5O A;  3OYF A;  1F21 A;  1KCF A;  1T7P A;  1JL2 A;  1HMV A; 
#chains in the Genus database with same CATH topology
 3ULE B;  3LDL A;  1JLQ A;  3TSP A;  4U67 L;  2YNH A;  2B6A A;  1RGI A;  1YT3 A;  5KGX A;  1XHX A;  4CEE A;  3CG7 A;  3P4I A;  2P9K B;  1ATR A;  4QS7 A;  3CFP A;  2UXB K;  4M7Y A;  4M3X A;  1KC8 O;  3SPZ A;  4O5F A;  1YIJ N;  3DLG A;  3VMF B;  5LMU K;  1M1K O;  4JKB A;  4FLZ A;  4ISE A;  3KTQ A;  4NYN A;  1JLE A;  4O8U A;  4BVP A;  1T3V A;  1VRT A;  4CD3 A;  3KD1 E;  4IOC L;  1BDG A;  1HYS A;  3H45 C;  3GBT A;  3K9J A;  3RWU A;  3HJF A;  4FPB A;  2E4L A;  4BC4 A;  4AIL C;  2P9I B;  2HHS A;  3ZCM A;  2FBV A;  2O8F B;  3AAP A;  3NGZ A;  3RMC A;  4CE9 A;  4H0P A;  4I7F A;  4ICL A;  4QS9 A;  4Y0W A;  4GKJ K;  1U47 A;  1MWM A;  4ZTJ A;  3VTI A;  3CCU N;  1NGI A;  4Y1C A;  3KLF A;  4OKK A;  5C2D A;  1BIZ A;  4CES A;  3TSQ A;  3CC4 N;  2CGL A;  5FDL A;  3HP9 A;  3Q7C A;  1WSG A;  2B5J A;  2Z1H A;  4WFA L;  3KLE A;  4KTW A;  2FBY A;  1XUP O;  3V1R A;  3OHR A;  4FPA A;  1WLJ A;  1RBS A;  3AVA A;  4DKW A;  3G25 A;  3DLE A;  4AHV A;  5GAG P;  5TKW A;  4BRN A;  3LWM A;  2V7Z A;  3MWT A;  2YHB A;  3O1B A;  3M6G A;  4M63 C;  4CZM A;  2HHX A;  1GLF O;  1SKS A;  4A59 A;  1IBK K;  2HNY A;  3NF8 A;  1BCM A;  4LSL A;  3D2F A;  1Y97 A;  3IDH A;  4OPJ A;  5BPN A;  3AA3 A;  3IG1 A;  4GVE A;  4IDH A;  2Q31 A;  3AVC A;  2RPI A;  5E26 A;  2A1S A;  4OPH A;  1X9W A;  2O8E A;  5JLF A;  2CGK A;  4CGF A;  3VQ7 A;  3CCM N;  5CY4 A;  1VSH A;  1RTI A;  2OPR A;  2WFB A;  2Y1I A;  3VEZ A;  1SL1 A;  4NCB A;  3FZL A;  3IS9 A;  3MCP A;  1NWK A;  1WUA A;  4RTF D;  3K0S A;  2KZM A;  3U4L A;  4CBW A;  1S1X A;  3NGY A;  4AHU A;  1CZB A;  3HYF A;  4NO7 A;  3O4Q A;  3THX A;  1SL2 A;  2QKK A;  4E7K A;  2P5O A;  3DM2 A;  2HF3 A;  3FR0 A;  1C0G A;  4JD2 A;  4BR4 A;  1NKE A;  1FJG K;  3VQ9 A;  4R5P A;  4N47 A;  1IKX A;  3O6W A;  4CHN A;  2G8K A;  2YV0 X;  1EWR A;  3D45 A;  4C8K A;  3P1G A;  3LP0 A;  4JKD A;  1JLF A;  1SAZ A;  3H3O B;  4FJ5 A;  1BQN A;  4GV6 A;  3D2F B;  4CHO A;  4EHU A;  1UAX A;  4CJ5 A;  3OYN A;  4OO1 J;  1EKE A;  4B1Y B;  2G8V A;  4LFC K;  4YOU A;  3A5M C;  1HJO A;  1CXQ A;  2O8E B;  4YOT A;  3HVR A;  1T05 A;  1RT1 A;  2GTD A;  1QHT A;  4CHQ A;  3OYL A;  4KRE A;  4PY5 A;  3MED A;  3K5O A;  4F3T A;  4JKA A;  3N4Q A;  3NF7 A;  3OJU A;  3AY9 A;  4CEF A;  1FW6 A;  4CZG A;  2F8S A;  2DFF A;  3L6Q A;  2IS3 A;  3WT0 A;  3WNH A;  3U3Y A;  5C0Y A;  1ZBU A;  1HJR A;  4WCE L;  2VG6 A;  1NK4 A;  3VQA A;  4CGD A;  1YJ9 N;  3THX B;  4H0T B;  1MA9 B;  4JD2 B;  4X64 K;  1JXB A;  5C10 A;  4CJS A;  4OVL A;  1GLD G;  3PV8 A;  4RW7 A;  1NGG A;  2E6L A;  4CJQ A;  1VQK N;  3C94 A;  3EN9 A;  2HHH K;  1JJ2 M;  3SBG A;  2R7Y A;  2GV9 A;  2O8C A;  4MO5 A;  3DRR A;  4M41 A;  2YCH A;  3WXM B;  2O8B A;  1Q18 A;  3E9L A;  3MK6 A;  2D0A A;  4I2P A;  5SWM A;  4PKG A;  1T6D A;  2P51 A;  4DFP A;  2Q2R A;  1NU0 A;  3H1V X;  5BR9 A;  4ISF A;  4E1J A;  3SV3 A;  4DQS A;  5AR0 A;  3VEY A;  2AP1 A;  3QIC A;  3R1X A;  4FLV A;  3RMB A;  2ETJ A;  1GLL O;  5JIC A;  2I7P A;  4IFY A;  3CCR N;  4M7X A;  1CXU A;  1E4F T;  5EX5 A;  4H5T A;  1VHX A;  4CFB A;  3OBY A;  4JRQ A;  2OPP A;  4CI6 A;  3OYD A;  3PY8 A;  3HM8 A;  2HHQ A;  3OVN A;  2ZE2 A;  4CER A;  5FRN A;  5EXW A;  3QER A;  2HBM A;  1BCO A;  3J8A A;  4LH4 A;  4EIA A;  5AQX A;  2E5L K;  2GBZ A;  3QB0 A;  3IUC A;  4EP5 A;  5HRS A;  4FO0 A;  4N56 A;  3WNG A;  2O8C B;  1BIS A;  2QM1 A;  3O80 A;  1S22 A;  1LW2 A;  4DR3 K;  4NCA A;  3L4Q A;  2O8B B;  4A57 A;  4BRI A;  3A0I X;  1IJJ A;  3ZSX A;  1ASU A;  1EP4 A;  2E1Z A;  3ZT2 A;  2VWK A;  4IDK A;  3QML A;  4M45 A;  4HUG A;  3TTD A;  3TAN A;  1XQS C;  4BVO A;  2JGU A;  1JL1 A;  5AQN A;  1IBL K;  1RCH A;  1U4B A;  4AH9 A;  1SS6 A;  3E9P A;  5AQS A;  1S9E A;  4AF1 A;  4DU4 A;  1J53 A;  4GKK K;  3MX2 A;  2RKI A;  3QEI A;  1NK5 A;  1GOA A;  1HNI A;  4CZE A;  3EZ5 A;  4CJ3 A;  4IEI A;  4DQQ A;  4JLH A;  1X3M A;  3NGI A;  4W5N A;  4ILJ A;  5GIN A;  1L5U A;  2Y1J A;  3O1W A;  4FK4 A;  1HQU A;  1BWF O;  3TAE A;  1N36 K;  1IV0 A;  4GVM A;  3LAN A;  4DV4 K;  1LAV A;  4RW6 A;  2V7Y A;  4H4O A;  2QWL A;  3LP2 A;  4DR7 K;  4HCC A;  1E3M A;  2XO7 A;  4ID5 A;  3M8S A;  3WUH A;  1MDU B;  3V9Z A;  1QQC A;  4JK8 A;  3SUO A;  1TV6 A;  2HNZ A;  3NAE A;  2Q97 A;  4DTP A;  1P90 A;  1W9H A;  1WSJ A;  2HST A;  4E3S A;  4B1X B;  1DLO A;  2UXD K;  2HBK A;  2G8U A;  3AVI A;  2D4W A;  3NMU A;  2ZF5 O;  3CER A;  3QLH A;  4WQ5 C;  3OYA A;  4LF7 K;  4IZ9 A;  3J7Z O;  2O4I A;  3PSF A;  4FLY A;  4KO0 A;  5ELZ A;  4BY9 C;  5DK5 A;  1TAU A;  2JLE A;  5C25 A;  2P9N A;  3M1F A;  5A2Q O;  4DFK A;  2IIR A;  3G6E N;  2X6N A;  3MXI A;  4CJV A;  1GOB A;  3SZ2 A;  4L8R B;  1BO5 O;  3LPU A;  4JKE A;  1KLM A;  3DRP A;  4AM6 A;  2HND A;  3CCE N;  1BA1 A;  3RMA A;  3TAP A;  3SQ2 A;  3D2E A;  5BPL A;  4EFH A;  4PHT X;  3A5N C;  3OW2 M;  4CEC A;  4CJP A;  4RW4 A;  3TAG A;  1S1T A;  4B8C A;  4F3O A;  1X9J A;  4YHH K;  4B3M K;  4B3S K;  5AQJ A;  3U3G A;  4B1U B;  1C6V A;  4KH4 A;  4DTJ A;  3PO5 A;  4JK9 A;  4AHR A;  1TYQ A;  1KVB A;  3AA5 X;  3VQB A;  4JI4 K;  5BN9 A;  5M1N A;  4Z4H A;  1ATS A;  3HPH A;  1NGJ A;  3E66 A;  4BRF A;  4C8N A;  1Z26 A;  3DOL A;  4CEZ A;  1C0F A;  3OYM A;  2Q0R A;  2YNF A;  1DKG D;  3DYA A;  1C1C A;  4FZX C;  4XIU A;  3ZSW A;  1ZBS A;  1ZBI A;  4GMJ B;  2F4V K;  4DB3 A;  4W5Q A;  1QE1 A;  3LAM A;  4JS4 A;  3C0B A;  1C1B A;  1X3N A;  1J5O A;  3OYF A;  2OTJ N;  2ASM A;  4MLE A;  1S9G A;  2IDO A;  4KHS A;  2FF6 A;  1ZBF A;  5AQZ A;  4FM0 A;  1QTM A;  3CPW M;  1NJY A;  3WNE A;  3D2E B;  3ISN C;  3SMP A;  3T1H K;  1S6P A;  4B9V A;  2XRI A;  4NYF A;  4BC2 A;  4JHD A;  4BRO A;  1KRP A;  3QNO A;  1TKZ A;  4Z4F A;  1N5Y A;  2Q36 A;  2YNI A;  3T1Y K;  4DTU A;  1WSH A;  5FRO A;  3EZW A;  4XH4 A;  3AA2 A;  1RT6 A;  2IVP A;  1TYQ B;  1VRU A;  3ZX0 A;  3K58 A;  4MDB A;  1S1W A;  3D0P A;  1NOY A;  3G10 A;  1D5A A;  3DWL A;  3I0R A;  4RW9 A;  1ZBH A;  3AVB A;  4KB0 A;  1N34 K;  1NGA A;  1Z6R A;  2CGJ A;  3NHG A;  1SL0 A;  5AQY A;  3SMS A;  3WXJ A;  3MEC A;  2CH6 A;  1UA0 A;  2I5J A;  3C6H A;  4DMN A;  5C12 A;  3U9D A;  1VQ8 N;  4FJM A;  3VN5 A;  1LCU A;  3C95 A;  2CH5 A;  3TSU A;  3O08 A;  4BG8 A;  4HUE A;  1M90 O;  4M3W A;  3KVG A;  1JLC A;  3CF5 L;  5F1X A;  1QSL A;  2WTU A;  3J7A P;  1HNV A;  5B8H A;  4DQR A;  3VEX A;  3RRH A;  1QVG M;  1VSJ A;  3EKU A;  1EQY A;  1HPM A;  1O13 A;  1BI4 A;  4E7J A;  3TAF A;  2QA4 N;  5BRE A;  3GOI A;  3RVC A;  1HKC A;  5AZI A;  3UKU A;  1OVQ A;  1T6C A;  2AA4 A;  3AGR A;  4JAX A;  4JHD B;  4GV9 A;  1SUQ A;  3NFA A;  2ASP A;  1MWK A;  3FZK A;  3SYZ A;  4V19 S;  4M3T A;  4JNE A;  3KKR A;  3P31 A;  4LD0 A;  2G8I A;  1ESV A;  4CFC A;  3H08 A;  4B1V A;  4OLA A;  4BGB A;  5KI6 A;  4JI2 K;  3KLG A;  4EZ6 A;  1K8K A;  3FZM A;  3GL1 A;  4DUZ K;  3SUN A;  4MO4 A;  1J9A A;  3DLH A;  2E2P A;  1WN7 A;  3WXL A;  1LV5 A;  3KKS A;  3IRX A;  3K5N A;  3OBW A;  1BA0 A;  5H1S Q;  1IG8 A;  5KGW A;  3DXK A;  4B9L A;  4BRQ A;  2F7T A;  4KBO A;  3V1Q A;  3R6M A;  3NH1 A;  5FLX O;  4B9U A;  1C1A A;  1L3T A;  3LP1 A;  1OVY A;  5IT9 O;  1BI4 B;  2YNG A;  3T69 A;  4CIF A;  3MXM A;  3CJC A;  4DS4 A;  3TI0 A;  5AZI B;  4JKG A;  4CJE A;  2YHY A;  4A61 A;  3THW A;  3HPG A;  4CF0 A;  4FL9 A;  2UUA K;  1CZ9 A;  4BDZ A;  3DRS A;  4DS5 A;  1ZBL A;  4C8M A;  2NRV A;  4B9S A;  1J6Z A;  4IFV A;  1L3V A;  5FPM A;  3KD5 E;  4CEA A;  3VQ6 A;  2HHT A;  3S3M A;  4E1M A;  1YXQ A;  3DLB A;  4FZZ A;  1Q81 O;  1A5X A;  3JS6 A;  4H0X B;  4BRL A;  4RWT A;  4JI3 K;  3O4W A;  4WQ5 A;  1QZ5 A;  1BG3 A;  3D7E O;  3T1A A;  4I9L A;  5J1E A;  3CJB A;  2I7N A;  1RDB A;  4LFA K;  2QWN A;  3T7Z A;  5CR4 A;  1CLQ A;  3AV9 A;  3ZEU B;  1W2B M;  4CJ4 A;  5DMR A;  3SCX A;  2VG7 A;  2UUC K;  3J81 O;  2OPQ A;  3VTH A;  1YAG A;  4IOX A;  1NK7 A;  3ALY A;  5HL7 L;  2QWQ A;  4DLG A;  2BTF A;  3ZT3 A;  3THW B;  1I3A A;  3HXM A;  2A40 A;  2GWK A;  1RTH A;  4CF9 A;  2KLA A;  1RT3 A;  3ENO A;  4GW6 A;  2E2N A;  1O1W A;  3V6D A;  4OPA A;  1VSK A;  1T03 A;  4BE0 A;  4CZL A;  3RSE A;  3VPZ A;  1GOC A;  3V81 A;  4KH6 A;  3CPE A;  4IO9 L;  1RBT A;  3J80 O;  3K2P A;  1XMO K;  4KAZ A;  2Q3S A;  3VOV A;  1NKB A;  1RBV A;  3L2U A;  4FLT A;  3PIP L;  1Z25 A;  4K42 A;  1C0M A;  1VQ7 N;  3A5L C;  3MX5 A;  3MMV A;  3NCI A;  5CE3 A;  4GY2 B;  5J2M A;  4WFN L;  1DEJ A;  4LF4 K;  2OYQ A;  3O9R A;  4PKH A;  5KQD A;  3CHW A;  2Z1J A;  4QS8 A;  3O4N A;  1WAF A;  1RT4 A;  5C24 A;  2GUP A;  2QXL A;  5JVG L;  3SAG A;  5E84 A;  2IVO A;  3V9U A;  5FPN A;  3S9H A;  4E7I A;  3ZSY A;  3FZH A;  1K6Y A;  4FM2 A;  3FFK B;  4FWR A;  1TKX A;  1RT7 A;  3QFP A;  3AVF A;  3DXM A;  3VGL A;  5AQV A;  4JI5 K;  1UA1 A;  3NBP A;  4FK0 A;  2Z1I A;  3C7N A;  4YOY A;  2X78 A;  3BY5 A;  5AQK A;  2VG5 A;  3VA0 A;  1P8Z A;  3O9U A;  3VQ4 A;  1NJW A;  3H1Q A;  1J5E K;  3AAR A;  4EAH D;  1TK8 A;  1FXX A;  2FBX A;  2FLO A;  4BQZ A;  3KIO A;  4FVM A;  3VEO A;  3H6E A;  1TUY A;  3QEV A;  4DSK A;  1B9D A;  4IBN A;  4CHP A;  3RSE B;  3HK2 A;  2YHX A;  1VSM A;  4CJT A;  3KK3 A;  3QFU A;  3T19 A;  3PX6 A;  1RBU A;  1HYV A;  5DM6 L;  4FOI A;  4NCG A;  1KAY A;  2P9U A;  3A8Y A;  2YKM A;  5BR8 K;  3ZET A;  4IFE A;  5JMV A;  2KW4 A;  5M1F A;  5AQI A;  3V4I A;  4PL7 A;  1RFQ A;  5HP1 A;  4LF6 K;  3AVJ A;  3ZSV A;  1R0A A;  3O5B A;  4CEQ A;  4HUF A;  3S3O A;  1G15 A;  3DAW A;  4FLU A;  4DFM A;  3M8Q A;  4BRM A;  4CK3 A;  5C15 A;  1IKV A;  2X74 A;  2VQF K;  4CJU A;  2DFH A;  4CF2 A;  3DXM B;  4HTU A;  2VQE K;  2ZWH A;  3BF3 A;  4BRK A;  3C7N B;  3ZYY X;  1SKR A;  3QET A;  3O9Q A;  4M3Y A;  1WSI A;  3HTV A;  1ZYQ A;  3HT3 A;  4WYB A;  1HLU A;  4FOE A;  5LJW A;  2E8A A;  2E2Q A;  5AQT A;  1NBW A;  1GLB G;  1BU6 O;  1V4S A;  4O0I A;  2ZJR L;  3SK3 A;  2VGM A;  5KRS A;  5AQG A;  3LDO A;  2FBT A;  5I9E B;  4Z4C A;  2P9U B;  1VQ4 N;  3FE1 A;  3TAR A;  4KHP K;  1BQM A;  3VF6 A;  2PAV A;  1N6Q A;  2UUB K;  1VSI A;  3C65 A;  3ZSR A;  2IGI A;  3AVH A;  5LL6 Z;  4JS5 A;  4FW1 A;  2ZGZ A;  4O44 A;  2OTL N;  4MDA A;  4DTX A;  4FYD A;  4F2S A;  4RW8 A;  2G8H A;  3THV A;  4H0O A;  3P39 A;  5AQQ A;  3ATU A;  4IJN A;  1ASV A;  1G99 A;  4O8K A;  3ZSQ A;  4NXM K;  5TKY A;  5IWA K;  3O9S A;  3S3N A;  3BDP A;  4Q5V A;  4MFB A;  3V9W A;  3J7Y P;  3TAM A;  4PL8 A;  3UKR A;  4H5R A;  2QK9 A;  3KLI A;  4I2Q A;  1N32 K;  3QES A;  3CFR A;  2H3G X;  1HYZ A;  2XY6 A;  3KHY A;  3CD6 N;  3ZT0 A;  3LAK A;  3HP6 A;  2QTD A;  4B1W B;  1TKT A;  1TVR A;  2WOM A;  4Z4G A;  5EOY A;  4BRD A;  4IXC A;  3WQT A;  3QEX A;  4M3R A;  1A5V A;  2P9L A;  3R9P A;  1RDA A;  3DLK A;  5C42 A;  4KB1 A;  4ISG A;  2JWL A;  1T44 A;  2P5G A;  2NRR A;  3ID6 A;  3L4I A;  1KCF A;  4NLC A;  2BUP A;  2NNW A;  4BR2 A;  2HMI A;  3HZ6 A;  4HTL A;  2QXF A;  4FM1 A;  3CCL N;  4JRP A;  2GEL A;  5KRT A;  3TR8 A;  3ZSZ A;  3UE5 A;  4YNQ A;  1DT9 A;  1KAX A;  4F2R A;  1HRH A;  2FF3 B;  3CYM A;  2F8T A;  3JYT A;  2UYT A;  2Z1G A;  1NK6 A;  4J2E A;  2EX3 A;  4XH1 A;  2HHU A;  3CM6 A;  4E7H A;  2QI2 A;  4BC5 A;  2HMP A;  1GLC G;  5SZT A;  1IKY A;  1Q9X A;  4FJ7 A;  3QDK A;  4KTZ A;  3OS0 A;  5ADX H;  4DSL A;  1FKP A;  3UKR B;  3K59 A;  4A5A A;  1YUW A;  4C1N I;  2F9T A;  1KFS A;  4E0D A;  1TK5 A;  4OPK A;  4W5R A;  1JKH A;  5AQR A;  3K57 A;  4NXN K;  3KK7 A;  4X62 K;  3SAH A;  2KTQ A;  2WC9 A;  2ZM6 K;  4XH5 A;  4DTS A;  4B08 A;  3EKS A;  2W6K A;  3TPQ A;  2HF4 A;  1L3S A;  2J4R A;  4BR0 A;  3DMJ A;  5FPE A;  2KFN A;  4CK1 A;  1HPZ A;  4RCH A;  3SJJ A;  1KLN A;  3BGR A;  3AO1 A;  1S72 N;  5M1K A;  4CIG A;  2ASO A;  4ZHR A;  1RT2 A;  2UXC K;  3IMX A;  3FFI A;  4C23 A;  4B3O A;  2W41 A;  1QQM A;  1BGX T;  2YHA A;  5LMN K;  1UOC A;  3G0Z A;  4FWO A;  4LF9 K;  3EL2 A;  3BP8 A;  1I94 K;  3I56 N;  1J54 A;  3WNF A;  3V1O A;  2OZM A;  3LWL A;  1RNH A;  3CC7 N;  4KTQ A;  4N41 A;  4DR2 K;  4DQI A;  1NKC A;  2D0C A;  3BF1 A;  5HRR A;  1Q9Y A;  1ZC6 A;  4E89 A;  3SJH A;  2YJF A;  4YOX A;  1RDD A;  3F9K A;  1QQO A;  5I42 A;  2YX6 A;  1XI1 A;  4KRF A;  1NGB A;  2HB5 A;  3VF2 A;  3HOT A;  4J2A A;  3IFR A;  4KHN A;  5CHI A;  1S5J A;  5KTQ A;  3CMA N;  1TGO A;  2DPN A;  4IEE A;  5M1P A;  3EYZ A;  3VEW A;  3JSM A;  2V52 B;  2QW9 A;  4AM7 A;  5AQW A;  1JCG A;  4QAG A;  3HO1 A;  4CZI A;  4BRP A;  4CGI A;  3O3F A;  1RDC A;  1ITG A;  1VSL A;  4KV8 A;  4NLB A;  1YF5 L;  3I55 N;  2YKN A;  3OY9 A;  2ZJP L;  3OYK A;  4WQ4 C;  4CZF A;  2P9N B;  4KHQ A;  1YHQ N;  2KHO A;  3ZX3 A;  4BRC A;  4UQG A;  4CIE A;  4JV5 K;  2B4J A;  3A5O C;  5D3G A;  3CXC M;  1ASW A;  2XY7 A;  4BAC A;  1OH6 A;  4H0Y B;  2EHG A;  4H8K A;  4FXD A;  4CJ7 A;  3C6A A;  4K41 A;  5AQH A;  3TU5 A;  1VQ6 N;  3OYJ A;  2DFE A;  1HQE A;  3L2V A;  4DFJ A;  1LWC A;  4YFU A;  2W6L A;  2W40 A;  2GWJ A;  1D9F A;  1NGD A;  3PLA A;  5ADX A;  5GIP A;  1XNQ K;  3EE9 A;  4ILG B;  1OH7 A;  1JCE A;  1NOZ A;  3HBT A;  4IWV A;  3IAY A;  3VQ8 A;  4DSJ A;  4CF8 A;  4FW2 A;  3OYB A;  4DF4 A;  3HRG A;  1DTT A;  3EEQ A;  2IOC A;  2ZGY A;  3O3H A;  1EX4 A;  3AVL A;  3SAF A;  3VGK A;  3VES A;  1HUX A;  3ATV A;  1CZA N;  2XY8 A;  2OA8 A;  4DCH A;  4EHT A;  1VK0 A;  2GX9 A;  4F9O A;  3TAQ A;  5GAE P;  4BR9 A;  4YOR A;  3NVK A;  1FKO A;  2ATQ A;  2WBN A;  4YDU C;  1BL3 A;  3I8B A;  2P1J A;  4JK7 A;  4HVJ A;  3U9Z A;  3PX4 A;  2YJE A;  4OKE A;  1S6Q A;  4CZH A;  4DF8 A;  1HKB A;  2A5X A;  3SUP A;  4PUO A;  1EXQ A;  1NGH A;  4H5N A;  2FSK A;  2EWS A;  4FWM A;  4JI8 K;  3LL3 A;  3K5L A;  1X1P A;  3K5M A;  1W97 L;  4AQY K;  4KFB A;  2D5R A;  1NLV A;  3QO9 A;  3SQ1 A;  4LF8 K;  5BRD A;  4DR1 K;  4FWQ A;  1I39 A;  2PFU A;  3CQY A;  3ULE A;  4ILH A;  4E19 A;  3K9K A;  1T8E A;  3M5R A;  4ELV A;  3P5J A;  4K25 A;  4AHC A;  1KFD A;  2HVI A;  1QVF M;  4CBU A;  4DWI A;  3L2Q A;  3M3Z A;  1LOT B;  3WQU A;  4CJF A;  4TSX A;  5AQL A;  3E9O A;  2HVH A;  2PBD A;  4FWN A;  2X6S A;  4OX9 K;  5GAH P;  5HBM A;  2O4G A;  4YOW A;  2QWM A;  2JWK A;  3BZC A;  4IG0 A;  1WBB A;  4BRA A;  1FK9 A;  4B9M A;  1NJI O;  1KD1 O;  4MQ3 A;  4W5T A;  4BQL A;  1C0U A;  2KQ2 A;  1HNZ K;  3LZI A;  4A2B A;  3QEP A;  1B9F A;  1RDW X;  3E01 A;  3SPY A;  3UKU B;  4BRE A;  4JI6 K;  4LH5 A;  2BH1 A;  1D9D A;  1C0T A;  1X9S A;  1HX1 A;  2YHW A;  2V51 B;  3A2F A;  4W5O A;  4LF5 K;  3OJS A;  1BOT O;  4HWI A;  4HHT A;  4KHY A;  1HNW K;  3FGU A;  3QBW A;  4X65 K;  2ZD1 A;  2ITG A;  4FJI A;  4ELU A;  2XHB A;  1K8K B;  4KKO A;  4CW7 B;  4DU1 A;  4BDP A;  3CIP A;  5JS1 A;  1REV A;  2QKB A;  1QS4 A;  3MN6 A;  3UB5 A;  4Z0U A;  4KPY A;  3PO4 A;  4LC9 B;  4B3T K;  4CD1 A;  4CZJ A;  3OYG A;  3CQX A;  3MN7 A;  5BRF A;  4OLB A;  3DXK B;  2W42 A;  1Y64 A;  3ID8 A;  1HNX K;  3L2W A;  4DQP A;  3PUF A;  1VQ5 N;  3KJV A;  5KQ8 A;  3KWI A;  1YJW N;  4C1N K;  2F9W A;  4IG3 A;  1VQL N;  5M1Q A;  2HOE A;  4DV6 K;  1L3U A;  5FPD A;  2QWO A;  3HPO A;  3RMD A;  3UIQ A;  2BDP A;  4NB4 A;  1K73 O;  3F5T A;  4JKG B;  3SUQ A;  3QEW A;  3KK2 A;  2G8F A;  3MCA B;  1RDU A;  1WOQ A;  3LAL A;  2IVN A;  2NLX A;  2PY5 A;  3B6P A;  2WUS A;  4J8F A;  4FJJ A;  2DTU A;  4IKF A;  1GLE G;  3GDQ A;  4RG8 A;  4R79 A;  3KWG A;  3Q7B A;  4BC3 A;  1E4G T;  4DUY K;  4BRH A;  2PZS A;  3QIP A;  5CZ2 A;  1XNR K;  4ELT A;  4DTR A;  3PSI A;  5JLH A;  2DY4 A;  2Q0U A;  1IO2 A;  2KZZ A;  3S41 A;  4UY8 O;  4JKC A;  3CJA A;  2HHV A;  4A5B A;  4WQ4 A;  3B6O A;  2A1R A;  2QWP A;  3AVN A;  3THY A;  1EWQ A;  2BAN A;  2E88 A;  2PYJ A;  4FLW A;  5JVH L;  3R8E A;  2NUB A;  1WNS A;  4B9T A;  3AO3 A;  5AFU H;  1KVC A;  4FJG A;  1VQ9 N;  4E7L A;  2FC0 A;  4CED A;  2A42 A;  5AQO A;  3KZB A;  4H4M A;  2Q1N A;  5HLF A;  3LZJ A;  4OGC A;  1U6Z A;  2RHK A;  1W0H A;  4O0J A;  4CFA A;  1YVN A;  3MAQ A;  5CYQ A;  1IBM K;  5AZJ A;  1WB9 A;  3RR8 A;  4FVU A;  4CGH A;  3FZF A;  2ZQB A;  5EVZ A;  2VYP A;  3T3F A;  3MWP A;  1HMV A;  1LWF A;  1MU2 A;  3ULD A;  4QOZ B;  1N8R O;  3AVK A;  1ILY A;  1ATN A;  2E1Y A;  4CBX A;  4CJK A;  1YTU A;  4JYA K;  4CVN E;  4YDU A;  3BUZ B;  4K8Z A;  3HVT A;  3THY B;  2E20 A;  2E2O A;  2QEX N;  3OA9 A;  5HRO A;  2O8D A;  3VA3 A;  2AJQ A;  1YIT N;  2FSJ A;  1S3X A;  2RN2 A;  2P9S A;  3DLL L;  3F2K A;  3GE1 A;  4DR4 K;  2VGN A;  4JEP A;  4OKJ A;  4Z4I A;  3IKM A;  2A3Z A;  5F0X A;  3OTO K;  4B9N A;  3EE8 A;  3V9S A;  1JLB A;  4EZ9 A;  2NRZ A;  2WON A;  1SZ2 A;  3KLH A;  3TTF A;  3L2R A;  1XMQ K;  5LY3 A;  3OYC A;  4F4K A;  1RTJ A;  3P38 A;  3BZK A;  3CJ9 A;  2HBJ A;  3VET A;  1DTQ A;  4DV5 K;  1LW0 A;  5AZJ B;  4DG1 A;  4H03 B;  3CQ8 A;  4BR7 A;  1SV5 A;  4J2B A;  5HOO A;  3VF4 A;  1RIL A;  2FXU A;  4FWL A;  3OYI A;  4H5W A;  1NK8 A;  2RF2 A;  3EY1 A;  3ZET B;  2LSN A;  3OS1 A;  4CEO A;  4CJW A;  3RRG A;  1IG9 A;  4GV3 A;  5J2Q A;  4I6M A;  4K0K K;  4C8O A;  2O8D B;  3TWH A;  3I0S A;  2OPS A;  3DJC A;  3CJ1 A;  4E1N A;  4EP4 A;  4KH5 A;  4H0V B;  3VQE A;  3JAM O;  2P9S B;  4H5V A;  3CCQ N;  3VEN A;  4X66 K;  3M8R A;  3FLC O;  3QIN A;  2ZJQ L;  2OCE A;  2NRH A;  3L8B A;  5AFU A;  3LDP A;  1K8A O;  4IJA A;  4YY3 K;  4FZY A;  4CK2 A;  4LFB K;  4FCY A;  4Z94 A;  3MDQ A;  1LWE A;  4C8L A;  3ENB A;  3LDS A;  1S1U A;  3DI6 A;  3ZT1 A;  3CI5 A;  1KVA A;  3E1Y A;  4DV0 K;  4DR6 K;  4M3U A;  3VER A;  1VAZ A;  4BDY A;  1YJN N;  4CCH A;  3ENH A;  5CYM A;  5EY4 A;  2YI1 A;  2E6M A;  5DM7 L;  2QWR A;  3AGK A;  2NZT A;  4HCB A;  4JKF A;  1Z05 A;  3H46 O;  4WF9 L;  1QSS A;  3LP3 A;  3L3U A;  3LM2 A;  4JI7 K;  1SQK A;  3CM5 A;  4DTM A;  3JXU A;  2BGG A;  4CGG A;  1TL1 A;  4I6M B;  5EU7 A;  5BPM A;  3AVG A;  4AHT A;  1R59 O;  3CCJ N;  1VSE A;  3SI6 A;  3OS2 A;  3AO4 A;  4LY7 A;  3LM9 A;  4CZK A;  3TTC A;  2XY5 A;  5KPT A;  1TUU A;  5I3U A;  3MEG A;  4FWK A;  5K14 A;  1JLA A;  4JN4 A;  4BE2 A;  4B1Z A;  1NGE A;  1K9M O;  1HR0 K;  3HL8 A;  4BR5 A;  4CHZ A;  4PKI A;  3KK1 A;  2KKZ A;  2G8W A;  3NDK A;  4ZTF A;  4BGA A;  3ITH A;  4DTO A;  4PWD A;  1OH8 A;  1UWB A;  2VWJ A;  3F73 A;  4DV7 K;  1BUP A;  4DV1 K;  1XC3 A;  1BIU A;  2UU9 K;  1GLA G;  2BE2 A;  2GEM A;  1YTA A;  4DLE A;  1VQO N;  3QIO A;  1KQS M;  4L3Q A;  4J2D A;  5JS2 A;  4B9Q A;  3W3D A;  4DV2 K;  2ITM A;  1QSY A;  4FJX A;  2P9L B;  2A41 A;  2HHW A;  5AQF A;  3ZT4 A;  4KHW A;  3F9M A;  4FJH A;  5E41 A;  1NNE A;  1U04 A;  1S1V A;  4WE1 A;  1NMD A;  3O9T A;  5BRH A;  4DU3 A;  3O8M A;  5KPR A;  3VQQ A;  5C2F A;  3MEE A;  4DSF A;  3ZX2 A;  3PX0 A;  1XHZ A;  3SQ0 A;  5FRM A;  2NRW A;  5F2R A;  3R3L A;  1U49 A;  3C6T A;  3RTV A;  3SNN A;  1Q8I A;  4FSV A;  4DTN A;  4KI6 A;  1XC9 A;  1JLG A;  4U7B A;  2D0B A;  5AQM A;  3HI0 A;  1NMN A;  2VWB A;  3V9X A;  1NG9 A;  1U48 A;  4OJR A;  3U6F A;  4M3Z A;  2NRX A;  5AJ3 K;  1W7A A;  4KI4 A;  3B8A X;  2IAJ A;  2D1K A;  3SV4 A;  2A6A A;  3I8D A;  5BN8 A;  3AA4 A;  4M42 A;  3WXI A;  4BE1 A;  4DSE A;  4K43 A;  1DGK N;  3NH0 A;  1GLJ O;  4CF1 A;  1Q82 O;  3VGM A;  4DR5 K;  3I33 A;  1B92 A;  4DV3 K;  1NJX A;  4QCL A;  4PA1 A;  3MN5 A;  5J2P A;  4JI0 K;  1Q7Y O;  4Q0B A;  4JI1 K;  4FK2 A;  5GIO A;  1RBR A;  1VQN N;  3CCS N;  3DLR A;  3N4P A;  2OAN A;  3L3V A;  5KPZ A;  1U2V A;  4B3R K;  1D4X A;  1NK0 A;  4G1Q A;  4CEB A;  3NE6 A;  3RR7 A;  1EO1 A;  3M8P A;  4FJL A;  3CME N;  3SLC A;  1RTD A;  1YI2 N;  3NH2 A;  3SQ4 A;  4CFD A;  1ZXO A;  3G4S N;  2D0O A;  5AQU A;  2FSN A;  3CET A;  2F96 A;  3CJ7 A;  2GUI A;  2P9P A;  3LDQ A;  3ZLJ A;  4CHY A;  1WSE A;  1V4T A;  1VQM N;  3AVM A;  3MN9 A;  1NJZ A;  4ID1 A;  4BG9 A;  3C6U A;  4CJL A;  4LSN A;  1XWL A;  1KAZ A;  2IC3 A;  3L0Q A;  1H1V A;  4N5S A;  3O3G A;  4BWM A;  3H3N O;  4DQ8 A;  4I9Q A;  1SKW A;  4B8A B;  4IOA L;  4G9Z A;  3ASM A;  1QZ6 A;  1BHL A;  1VQP N;  2KFZ A;  1EET A;  3DOK A;  4BWJ A;  3WEE A;  3OYE A;  1KSP A;  1WAJ A;  3VQD A;  1U2V B;  4Y1D A;  1QHA A;  1HKG A;  4OGE A;  4O5B A;  4K8X A;  1KXP A;  1JCF A;  3BEX A;  3CFO A;  3AO5 A;  3EO3 A;  3WXK A;  4YOV A;  3QBX A;  3MXJ A;  5T7B A;  4JKH A;  4AHS A;  4A2A A;  3ZSO A;  2P9P B;  4FJ9 A;  3OYH A;  1KTQ A;  3CC2 N;  5HRN A;  2VCP A;  5M1O A;  3CCV N;  1U45 A;  4N76 A;  2D0P A;  1JXE A;  1NK9 A;  1X9M A;  4FWP A;  3HST B;  3QNN A;  5HRP A;  3SBT A;  1OH5 A;  3AAQ A;  1YVU A;  3NVM A;  5GAD P;  4O4G A;  1VSF A;  1NGF A;  1WSF A;  4XEI A;  4FLX A;  1TL3 A;  1D8Y A;  5LJV A;  1NGC A;  2HW3 A;  4FWS A;  2HBL A;  5AQP A;  3HM9 A;  3VQ5 A;  5CZ1 A;  2P9K A;  4WFB L;  2OZS A;  4MLH A;  3WEE B;  3G71 N;  1TAQ A;  2NRT A;  3P83 D;  1NM1 A;  4CGJ A;  3AO2 A;  1LAW A;  4FJN A;  4IO8 A;  3VEV A;  1OKJ A;  4O55 A;  3HSC A;  5MLC Q;  4FJK A;  2PYL A;  4BRG A;  3LDN A;  5J2N A;  4KHU A;  1Q86 O;  3TAB A;  1IH7 A;  1TKD A;  4DSI A;  3NF6 A;  4Z4E A;  3LPT A;  4CJR A;  3D6R A;  2P9I A;  3PIO L;  1A5W A;  3NF9 A;  2O8F A;  4FJ8 A;  4F8R A;  4DHY A;  3GG4 A;  1QQN A;  1RT5 A;  3U8X A;  3VQP A;  3VQC A;  4A62 A;  2RE2 A;  1VSD A;  3ZEU A;  1N33 K;  3W0L A;  4GNI A;  3HOS A;  4PQU A;  1IKW A;  1F21 A;  1TK0 A;  1T7P A;  1JL2 A;  1WBD A; 
#chains in the Genus database with same CATH homology
 1LWF A;  1MU2 A;  2HMI A;  3ULD A;  4QOZ B;  1JLQ A;  1S9G A;  3AVK A;  2IDO A;  2QXF A;  4FM1 A;  4KHS A;  2YNH A;  4CJK A;  4JRP A;  2B6A A;  1YTU A;  1ZBF A;  5KRT A;  1YT3 A;  3TR8 A;  3ZSZ A;  4FM0 A;  5KGX A;  1XHX A;  4CEE A;  1QTM A;  3CG7 A;  4YNQ A;  1NJY A;  3WNE A;  4F2R A;  3ISN C;  3CFP A;  4K8Z A;  4M3X A;  1HRH A;  3SPZ A;  1S6P A;  3DLG A;  3CYM A;  4B9V A;  3HVT A;  2F8T A;  2XRI A;  4NYF A;  3JYT A;  4FLZ A;  1KRP A;  3QNO A;  5HRO A;  1TKZ A;  2Z1G A;  3KTQ A;  4NYN A;  3VA3 A;  1NK6 A;  4Z4F A;  1JLE A;  1N5Y A;  2YNI A;  2AJQ A;  4DTU A;  1WSH A;  2EX3 A;  5FRO A;  4J2E A;  2HHU A;  1VRT A;  2RN2 A;  3CM6 A;  4E7H A;  3KD1 E;  3AA2 A;  1RT6 A;  1HYS A;  1VRU A;  5SZT A;  3K58 A;  3D0P A;  1S1W A;  1IKY A;  1NOY A;  1Q9X A;  4FJ7 A;  4DSL A;  3G10 A;  4KTZ A;  4OKJ A;  3OS0 A;  3RWU A;  1FKP A;  1D5A A;  4Z4I A;  3HJF A;  4B9N A;  3K59 A;  2E4L A;  3I0R A;  4AIL C;  1KFS A;  4RW9 A;  3V9S A;  3ZCM A;  1TK5 A;  2FBV A;  4E0D A;  2HHS A;  4OPK A;  4W5R A;  1JLB A;  1ZBH A;  4EZ9 A;  3AVB A;  1JKH A;  2WON A;  3NGZ A;  3KLH A;  3K57 A;  3L2R A;  3RMC A;  4KB0 A;  4CE9 A;  3NHG A;  3OYC A;  1SL0 A;  1RTJ A;  4I7F A;  4F4K A;  2KTQ A;  4ICL A;  1DTQ A;  3MEC A;  1LW0 A;  4DTS A;  4B08 A;  1UA0 A;  4DG1 A;  2I5J A;  1U47 A;  4ZTJ A;  1L3S A;  3CQ8 A;  4DMN A;  1SV5 A;  3VN5 A;  3DMJ A;  4FJM A;  4Y1C A;  3C95 A;  4CK1 A;  3KLF A;  2KFN A;  4OKK A;  1HPZ A;  4HUE A;  4J2B A;  1BIZ A;  3SJJ A;  4M3W A;  5FRN A;  1RIL A;  1JLC A;  4CES A;  1KLN A;  3BGR A;  3OYI A;  1QSL A;  5FDL A;  3AO1 A;  1HNV A;  3HP9 A;  4DQR A;  3RRH A;  1WSG A;  1VSJ A;  2B5J A;  2Z1H A;  4CIG A;  4ZHR A;  3KLE A;  1NK8 A;  2RF2 A;  1RT2 A;  4KTW A;  1BI4 A;  2FBY A;  3EY1 A;  4E7J A;  3TAF A;  2LSN A;  3OS1 A;  4CEO A;  3V1R A;  4CJW A;  3RRG A;  1IG9 A;  3FFI A;  5J2Q A;  4B3O A;  1WLJ A;  1RBS A;  1BGX T;  2YHA A;  3AVA A;  4C8O A;  1UOC A;  3DLE A;  3G0Z A;  1SUQ A;  3TWH A;  4AHV A;  3NFA A;  3I0S A;  2OPS A;  3LWM A;  4EP4 A;  4E1N A;  2YHB A;  3VQE A;  3SYZ A;  1J54 A;  2HHX A;  3WNF A;  1SKS A;  3V1O A;  2OZM A;  4M3T A;  3KKR A;  3M8R A;  3LWL A;  1RNH A;  2HNY A;  4KTQ A;  3NF8 A;  1BCM A;  4N41 A;  4LSL A;  4LD0 A;  4DQI A;  4CFC A;  1Y97 A;  3QIN A;  1NKC A;  2G8I A;  2D0C A;  4OPJ A;  3H08 A;  5HRR A;  3L8B A;  1Q9Y A;  3AA3 A;  3IG1 A;  4OLA A;  4E89 A;  4FZY A;  1RDD A;  4CK2 A;  3F9K A;  5I42 A;  1XI1 A;  5KI6 A;  3AVC A;  4KRF A;  2RPI A;  3KLG A;  4FCY A;  2HB5 A;  1LWE A;  4C8L A;  2A1S A;  3LDS A;  4EZ6 A;  1S1U A;  3DI6 A;  3ZT1 A;  1X9W A;  3SUN A;  4J2A A;  4KHN A;  1KVA A;  1S5J A;  1J9A A;  3DLH A;  1WN7 A;  4CGF A;  5KTQ A;  4M3U A;  1LV5 A;  3KKS A;  3VQ7 A;  3IRX A;  3K5N A;  5CY4 A;  1VSH A;  1RTI A;  1TGO A;  3EYZ A;  4BDY A;  2OPR A;  3JSM A;  4CCH A;  2Y1I A;  5KGW A;  5CYM A;  4B9L A;  1SL1 A;  4NCB A;  3HK2 A;  3IS9 A;  2E6M A;  4QAG A;  3V1Q A;  3NH1 A;  3HO1 A;  4CGI A;  3O3F A;  1C1A A;  1RDC A;  1L3T A;  4B9U A;  4HCB A;  2KZM A;  1ITG A;  3LP1 A;  1VSL A;  4KV8 A;  1S1X A;  3NGY A;  4AHU A;  1CZB A;  1BI4 B;  3HYF A;  1QSS A;  2YKN A;  3LP3 A;  3O4Q A;  3L3U A;  3OY9 A;  2YNG A;  3OYK A;  4CIF A;  1SL2 A;  3CM5 A;  2QKK A;  4DTM A;  3MXM A;  4E7K A;  2P5O A;  4KHQ A;  3DM2 A;  2BGG A;  4UQG A;  4CIE A;  4DS4 A;  4CGG A;  3TI0 A;  1TL1 A;  1NKE A;  3VQ9 A;  4CJE A;  4R5P A;  4N47 A;  2B4J A;  5EU7 A;  1IKX A;  3AVG A;  3HPG A;  4AHT A;  4CF0 A;  5D3G A;  1ASW A;  1CZ9 A;  4BAC A;  3DRS A;  4BDZ A;  2XY7 A;  4DS5 A;  1ZBL A;  1VSE A;  4C8M A;  3SI6 A;  4CHN A;  2G8K A;  2YV0 X;  3OS2 A;  4B9S A;  2EHG A;  3AO4 A;  4IFV A;  3D45 A;  4LY7 A;  4H8K A;  4C8K A;  3P1G A;  4FXD A;  2XY5 A;  5I3U A;  3LP0 A;  1L3V A;  3KD5 E;  1JLF A;  3MEG A;  4CEA A;  4FJ5 A;  3VQ6 A;  1BQN A;  3S3M A;  2HHT A;  5K14 A;  4E1M A;  3OYJ A;  1JLA A;  2DFE A;  1HQE A;  4CHO A;  3L2V A;  4DFJ A;  4BE2 A;  1UAX A;  3DLB A;  4CJ5 A;  3OYN A;  4FZZ A;  3HL8 A;  1EKE A;  4CHZ A;  1LWC A;  4YFU A;  3KK1 A;  2G8W A;  3NDK A;  4ZTF A;  2G8V A;  1A5X A;  3ITH A;  1D9F A;  4DTO A;  4PWD A;  1CXQ A;  1UWB A;  1NOZ A;  3IAY A;  3VQ8 A;  3T1A A;  2VWJ A;  4DSJ A;  4CF8 A;  4FW2 A;  4I9L A;  5J1E A;  3OYB A;  3HVR A;  3F73 A;  4DF4 A;  1RT1 A;  4CHQ A;  1QHT A;  1DTT A;  1T05 A;  1BIU A;  2IOC A;  3O3H A;  3OYL A;  4KRE A;  2BE2 A;  1EX4 A;  4PY5 A;  1RDB A;  1YTA A;  4DLE A;  3QIO A;  4J2D A;  3AVL A;  3MED A;  5JS2 A;  3K5O A;  1CLQ A;  4F3T A;  3AV9 A;  3NF7 A;  3OJU A;  1QSY A;  4FJX A;  4CEF A;  2HHW A;  2XY8 A;  2OA8 A;  2F8S A;  2DFF A;  4CJ4 A;  3ZT4 A;  2IS3 A;  4KHW A;  5DMR A;  1VK0 A;  3SCX A;  3TAQ A;  3WNH A;  2VG7 A;  3U3Y A;  4FJH A;  1ZBU A;  5E41 A;  1HJR A;  1FKO A;  2ATQ A;  1NK4 A;  1BL3 A;  2VG6 A;  2OPQ A;  3VQA A;  4CGD A;  1U04 A;  1S1V A;  2P1J A;  4WE1 A;  4HVJ A;  3PX4 A;  1NK7 A;  3ALY A;  4DU3 A;  4OKE A;  1S6Q A;  3VQQ A;  3MEE A;  4DLG A;  4DSF A;  4DF8 A;  3PX0 A;  3SUP A;  3ZT3 A;  1I3A A;  4PUO A;  1EXQ A;  1JXB A;  3SQ0 A;  1XHZ A;  3HXM A;  5FRM A;  4CJS A;  4OVL A;  3PV8 A;  1U49 A;  4RW7 A;  3C6T A;  2E6L A;  4CJQ A;  3K5L A;  1X1P A;  3C94 A;  1Q8I A;  3RTV A;  1RTH A;  3SNN A;  4CF9 A;  2R7Y A;  4DTN A;  1JLG A;  1XC9 A;  2GV9 A;  4KI6 A;  3K5M A;  1RT3 A;  3DRR A;  4GW6 A;  2D0B A;  4M41 A;  1O1W A;  4KFB A;  2D5R A;  3V6D A;  1VSK A;  1T03 A;  3V9X A;  4BE0 A;  3QO9 A;  2D0A A;  4I2P A;  5SWM A;  1U48 A;  4OJR A;  3U6F A;  3SQ1 A;  1GOC A;  2P51 A;  3V81 A;  4M3Z A;  4DFP A;  1I39 A;  4KI4 A;  2IAJ A;  1RBT A;  3K2P A;  4KAZ A;  2Q3S A;  3SV4 A;  1NKB A;  3I8D A;  1RBV A;  3AA4 A;  4E19 A;  3L2U A;  1T8E A;  3SV3 A;  4FLT A;  4DQS A;  3P5J A;  4AHC A;  4ELV A;  1KFD A;  4M42 A;  2HVI A;  1Z25 A;  4BE1 A;  1C0M A;  4DSE A;  3NH0 A;  4DWI A;  3NCI A;  4CF1 A;  3L2Q A;  5J2M A;  1B92 A;  4FLV A;  1NJX A;  4QCL A;  4CJF A;  2OYQ A;  4TSX A;  4PA1 A;  5J2P A;  2Z1J A;  2HVH A;  3RMB A;  2ETJ A;  2X6S A;  4Q0B A;  3O4N A;  4FK2 A;  1WAF A;  1RBR A;  5HBM A;  1RT4 A;  4IFY A;  5C24 A;  2O4G A;  3DLR A;  1CXU A;  3L3V A;  4IG0 A;  3V9U A;  3S9H A;  4CFB A;  1FK9 A;  4E7I A;  1NK0 A;  4G1Q A;  4CEB A;  2OPP A;  3ZSY A;  4JRQ A;  3NE6 A;  3OYD A;  4B9M A;  1K6Y A;  4MQ3 A;  4W5T A;  4FM2 A;  3RR7 A;  3PY8 A;  1TKX A;  3M8P A;  1C0U A;  1RT7 A;  4FJL A;  2HHQ A;  3AVF A;  2KQ2 A;  3OVN A;  2ZE2 A;  4CER A;  3LZI A;  3QEP A;  1UA1 A;  3NBP A;  3NH2 A;  2Z1I A;  3QER A;  1RTD A;  2X78 A;  3SQ4 A;  4CFD A;  4FK0 A;  1BCO A;  4LH4 A;  2VG5 A;  3VA0 A;  1B9F A;  3E01 A;  2GBZ A;  3VQ4 A;  1NJW A;  3SPY A;  5HRS A;  2F96 A;  4EP5 A;  4N56 A;  4LH5 A;  3WNG A;  2GUI A;  1BIS A;  1TK8 A;  1D9D A;  1FXX A;  2FBX A;  1C0T A;  1LW2 A;  3KIO A;  4FVM A;  1X9S A;  4NCA A;  4CHY A;  1WSE A;  3QEV A;  4DSK A;  1B9D A;  4IBN A;  3ZSX A;  1ASU A;  1EP4 A;  3AVM A;  3ZT2 A;  4CHP A;  1NJZ A;  4ID1 A;  3A2F A;  2VWK A;  1VSM A;  4IDK A;  4M45 A;  4CJT A;  4W5O A;  3KK3 A;  4HUG A;  3OJS A;  3T19 A;  3PX6 A;  3C6U A;  4CJL A;  3TAN A;  1RBU A;  1HYV A;  1JL1 A;  2JGU A;  1XWL A;  4LSN A;  4HHT A;  4KHY A;  2IC3 A;  1RCH A;  4NCG A;  1U4B A;  4AH9 A;  2ZD1 A;  2ITG A;  1S9E A;  2YKM A;  4N5S A;  4FJI A;  3O3G A;  4ELU A;  4BWM A;  4DU4 A;  1J53 A;  2KW4 A;  4I9Q A;  1SKW A;  2XHB A;  4B8A B;  2RKI A;  3QEI A;  4KKO A;  4DU1 A;  3V4I A;  1GOA A;  1NK5 A;  4BDP A;  5HP1 A;  5JS1 A;  1REV A;  3AVJ A;  3ASM A;  3ZSV A;  1HNI A;  2QKB A;  1BHL A;  3EZ5 A;  1QS4 A;  1R0A A;  4CJ3 A;  2KFZ A;  1EET A;  4CEQ A;  4HUF A;  3S3O A;  4DQQ A;  4Z0U A;  4JLH A;  3NGI A;  4W5N A;  1G15 A;  3DOK A;  4BWJ A;  4KPY A;  3PO4 A;  1L5U A;  3OYE A;  2Y1J A;  3OYG A;  1KSP A;  4FLU A;  1WAJ A;  4OLB A;  4DFM A;  3M8Q A;  2W42 A;  4FK4 A;  3VQD A;  1HQU A;  4Y1D A;  4CK3 A;  3TAE A;  1IKV A;  3L2W A;  4OGE A;  3PUF A;  4DQP A;  4O5B A;  2X74 A;  3KJV A;  4GVM A;  2DFH A;  3LAN A;  4CJU A;  4CF2 A;  4K8X A;  1LAV A;  4RW6 A;  4HTU A;  3CFO A;  4IG3 A;  3AO5 A;  4H4O A;  1SKR A;  3QET A;  1L3U A;  3LP2 A;  4HCC A;  3MXJ A;  5T7B A;  4M3Y A;  1WSI A;  3HPO A;  3RMD A;  3UIQ A;  2XO7 A;  2BDP A;  4AHS A;  4ID5 A;  3M8S A;  3HT3 A;  1ZYQ A;  3V9Z A;  3SUQ A;  1QQC A;  3QEW A;  3KK2 A;  3SUO A;  2G8F A;  3ZSO A;  4FJ9 A;  1TV6 A;  3LAL A;  2HNZ A;  1KTQ A;  3OYH A;  5HRN A;  3NAE A;  2PY5 A;  4O0I A;  3B6P A;  5KRS A;  4DTP A;  1W9H A;  1WSJ A;  1U45 A;  4N76 A;  4FJJ A;  4E3S A;  1JXE A;  1DLO A;  1NK9 A;  1X9M A;  2G8U A;  2FBT A;  4IKF A;  3AVI A;  2DTU A;  4Z4C A;  3QLH A;  3OYA A;  3HST B;  3QNN A;  5HRP A;  4RG8 A;  2O4I A;  1YVU A;  4O4G A;  4FLY A;  1VSF A;  3TAR A;  4KO0 A;  1WSF A;  2PZS A;  3QIP A;  1BQM A;  5CZ2 A;  4FLX A;  1N6Q A;  1TAU A;  5DK5 A;  1VSI A;  1TL3 A;  2JLE A;  1D8Y A;  5C25 A;  4ELT A;  3ZSR A;  2IGI A;  4DFK A;  3AVH A;  4DTR A;  1TK0 A;  4JS5 A;  2HW3 A;  2X6N A;  4FW1 A;  4CJV A;  1GOB A;  4O44 A;  3SZ2 A;  3MXI A;  3LPU A;  4L8R B;  2DY4 A;  1KLM A;  1IO2 A;  3DRP A;  2HND A;  4DTX A;  2KZZ A;  3HM9 A;  3RMA A;  3TAP A;  3VQ5 A;  5CZ1 A;  3SQ2 A;  4F2S A;  4FYD A;  2HHV A;  2OZS A;  1TAQ A;  3P83 D;  4RW8 A;  2G8H A;  3THV A;  3B6O A;  3AO2 A;  4CGJ A;  1LAW A;  4FJN A;  4CEC A;  3AVN A;  2A1R A;  4CJP A;  1ASV A;  2BAN A;  4RW4 A;  2PYJ A;  4FLW A;  4O55 A;  3ZSQ A;  3TAG A;  4FJK A;  2PYL A;  1S1T A;  4B8C A;  4F3O A;  5J2N A;  3U3G A;  2NUB A;  1WNS A;  4KHU A;  4B9T A;  3AO3 A;  1KVC A;  4FJG A;  1C6V A;  4DTJ A;  3S3N A;  3BDP A;  3TAB A;  3PO5 A;  4AHR A;  1IH7 A;  4E7L A;  4Q5V A;  2FC0 A;  4MFB A;  1TKD A;  1KVB A;  3V9W A;  4DSI A;  3AA5 X;  3NF6 A;  3VQB A;  3TAM A;  4CED A;  4Z4E A;  3LPT A;  4CJR A;  2QK9 A;  3KLI A;  1A5W A;  3NF9 A;  4I2Q A;  4Z4H A;  3HPH A;  4H4M A;  5HLF A;  3LZJ A;  3QES A;  3CFR A;  4OGC A;  1HYZ A;  2XY6 A;  4FJ8 A;  4F8R A;  4C8N A;  1Z26 A;  3DOL A;  3ZT0 A;  4CEZ A;  3LAK A;  1W0H A;  4O0J A;  4CFA A;  3HP6 A;  3MAQ A;  1TKT A;  1TVR A;  3OYM A;  2WOM A;  1RT5 A;  3VQC A;  3VQP A;  4Z4G A;  5CYQ A;  3RR8 A;  2YNF A;  3DYA A;  4CGH A;  3QEX A;  1C1C A;  1VSD A;  4M3R A;  4FZX C;  1A5V A;  3ZSW A;  4XIU A;  1ZBI A;  4GMJ B;  1RDA A;  3DLK A;  5C42 A;  4KB1 A;  2ZQB A;  4W5Q A;  1QE1 A;  3LAM A;  4JS4 A;  2P5G A;  1C1B A;  3T3F A;  4PQU A;  1IKW A;  1J5O A;  3OYF A;  1F21 A;  1KCF A;  1T7P A;  1JL2 A;  1HMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...