1RDCA

Crystal structures of ribonuclease hi active site mutants from escherichia coli
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
155
structure length
155
Chain Sequence
b'MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTNSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Crystal structures of ribonuclease HI active site mutants from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 42
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rdcA00
3TWHA 2YNIA 3L2RA 3S3MA 4FK4A 3QEXA 5SZTA 2HHXA 5E41A 4KTWA 4CEOA 1QS4A 2G8KA 4FJ7A 4IFVA 2YNFA 2X6SA 4CF1A 3NCIA 4Q0BA 4KB1A 4AILC 5C42A 3OJUA 2O4IA 1SL0A 3KK1A 4K8XA 1CZBA 4CK1A 1Y97A 5I3UA 2A1RA 3ZT3A 1UWBA 1IKYA 4N56A 4M3XA 4CGHA 4DSJA 3PX0A 4CEQA 3AO1A 5HP1A 3NF8A 3M8SA 3MXMA 3HL8A 2VG6A 3EYZA 4F8RA 4IKFA 4B3OA 3AO3A 1EP4A 1XWLA 3V9XA 1RT2A 4CJWA 1KFSA 4HUGA 3V1OA 1LWFA 2EX3A 4ZTJA 5HBMA 3HPHA 4I7FA 4Q5VA 3K58A 3SUPA 5C25A 1C1CA 1U4BA 2I5JA 2LSNA 1C1BA 1VSIA 3LAKA 3LP1A 4FXDA 3H08A 2XRIA 1WSGA 3SJJA 1UA0A 1T03A 4CE9A 3UIQA 4FJ8A 4KHWA 4DLGA 3QNOA 3VQ7A 3I0RA 3KJVA 4KREA 2Y1IA 1ZBHA 4DTSA 1VK0A 4H4MA 4G1QA 4RG8A 4DS5A 1U04A 2AJQA 3AVBA 4ID5A 4O55A 3AVKA 4B08A 4JS4A 4FJJA 4O0JA 3QO9A 3AVHA 5C24A 1XHXA 3M8RA 3MECA 4E3SA 1L3SA 1RNHA 1A5VA 4L8RB 4OPJA 3HK2A 4CEDA 1CLQA 4KRFA 4CF2A 3C95A 1HYZA 3DLRA 4DFKA 3AVCA 3KLEA 4F2RA 4E7HA 1LAWA 4B9VA 3DRPA 2PZSA 4KTQA 3P83D 3SUOA 2F8SA 4BE0A 2BDPA 2G8WA 1KLMA 1BIZA 4IDKA 1B92A 3LPUA 4M42A 1ZYQA 1J9AA 1GOAA 4CJTA 1YTAA 4CIEA 2YKNA 5KRTA 5J2QA 3DLKA 1L3VA 4FJMA 1BCMA 1JXBA 3T19A 2ZE2A 4FLXA 2VWKA 2EHGA 2FBXA 4M41A 3TAMA 2KFNA 4CF0A 1UAXA 4PUOA 1S1VA 1BGXT 2X78A 2PY5A 3OYEA 3L8BA 4CFAA 3V9SA 4B9TA 4Z4EA 4AHTA 1KRPA 1BI4B 2GUIA 3NH2A 2OPQA 4DFMA 3L2UA 3VA3A 3AVGA 4FZXC 1SUQA 1NKBA 1KLNA 1HYSA 2KZZA 3K2PA 1T05A 1IG9A 4W5NA 3BGRA 2XY6A 4Z4CA 4JS5A 1XHZA 3NAEA 4AHUA 3QNNA 1BQNA 3DM2A 3RMCA 3LPTA 3OVNA 5KGWA 1J5OA 4B9NA 1Z25A 4B9MA 4E7LA 4EP5A 3LP3A 4B8AB 3OJSA 2GV9A 4I9LA 2WONA 2OA8A 3P1GA 1MU2A 2IC3A 3CFOA 2P5GA 3ZCMA 4DMNA 1LV5A 1SKWA 2XY8A 4AH9A 3SCXA 2HHUA 1JL2A 4RW7A 3ZT1A 2YKMA 3ZT4A 2WOMA 1RBSA 4CIFA 4FJ9A 4CJQA 3JYTA 2XY5A 3PV8A 3D0PA 1QSYA 5CZ2A 5CZ1A 4K8ZA 4QOZB 3TANA 3HYFA 1IH7A 5HRRA 2FBVA 3OYBA 1HYVA 3QIPA 1TKDA 3DYAA 4J2DA 1VSDA 4CESA 3ZSQA 4W5QA 3PUFA 3KD1E 1IKXA 4DQSA 3HP9A 4FLTA 1N6QA 4KO0A 3DLBA 3KD5E 1S9EA 3F9KA 5J2NA 4CCHA 3CYMA 3A2FA 4Y1CA 4CECA 4CJ3A 1K6YA 3KKSA 4E1MA 2KW4A 3RMDA 3LANA 3SPZA 3E01A 2XO7A 2HMIA 1FXXA 3ASMA 1TV6A 1WSEA 4AHVA 1TAQA 3VA0A 2YV0X 3VQAA 5HRNA 2KZMA 5KI6A 5T7BA 1NOYA 1L3TA 4MQ3A 2Z1JA 4CJPA 4TSXA 1S1UA 2B5JA 4M45A 1U49A 1FKOA 4DSEA 2ETJA 2PYJA 3RMBA 4KHNA 3DRSA 4CK2A 3NE6A 1TKXA 2ITGA 2KQ2A 4PQUA 2PYLA 1HNVA 3SQ0A 3IG1A 1NKEA 1NJYA 4H4OA 4O5BA 1B9DA 1VSJA 4HCBA 3LP2A 2DTUA 3B6PA 4CJRA 5FROA 3ZSXA 1JLQA 3MXJA 1ZBIA 3SUQA 3HJFA 3AVAA 4E1NA 5HROA 4CHZA 1NJZA 4HCCA 1C0UA 4FM0A 3ULDA 3KLFA 3KKRA 3NH0A 3TAFA 1WAJA 1VSMA 2YHAA 4CJVA 3S3OA 4I2QA 4OVLA 3WNEA 2FC0A 2A1SA 3OYIA 4CEEA 1EKEA 3L2WA 3AV9A 4I2PA 4NCAA 3S3NA 2QKBA 3OYJA 1A5WA 3AA5X 2G8UA 3WNGA 4F2SA 2HNYA 5K14A 1BI4A 1TK5A 3RTVA 3SI6A 1NOZA 4FM1A 1JLFA 2HB5A 4DTOA 4DTXA 3DLEA 4YNQA 1D9FA 1VRTA 1WSHA 3DRRA 1HQEA 3RRHA 1LW0A 4DTRA 5KTQA 4FCYA 3OYMA 1VSFA 3VQ9A 3F73A 3V81A 2P51A 4KKOA 3MEEA 1TVRA 1RBUA 2OYQA 3TAQA 2D0BA 4O44A 4B9LA 1HRHA 4DQPA 4CHYA 4BDZA 1RTJA 1JKHA 3K5LA 1WAFA 3V1QA 2G8HA 4LD0A 4Y1DA 5FDLA 1Q8IA 3CG7A 4AHRA 3QINA 3AVJA 4B9SA 4CK3A 2IOCA 3LALA 5FRMA 2F8TA 3LAMA 3QEWA 1TK0A 4AHSA 3CM6A 1RTHA 1RTDA 3TR8A 4DTMA 4C8KA 2YNGA 3T1AA 1C1AA 4LSLA 4OPKA 1RDDA 4EZ6A 1U48A 3SPYA 1S9GA 4CJSA 3V9WA 1IO2A 4OGEA 1S6QA 4FJXA 2Q3SA 3SV3A 4C8LA 1QSLA 3V9ZA 1QTMA 4OKEA 1ZBUA 3ZSWA 4FJLA 2GBZA 1RT7A 5JS2A 2W42A 1KTQA 3LP0A 2IGIA 2VG5A 3WNHA 3I0SA 3V4IA 4H8KA 4FLUA 3S9HA 2BANA 2IS3A 3O3HA 2BE2A 4EP4A 4OKKA 4E89A 1NK7A 4B8CA 4DLEA 3LDSA 2DFFA 4DQQA 2Y1JA 3K5OA 5CYQA 2HVHA 2HHSA 3RWUA 5J2PA 1HQUA 2YHBA 4CFDA 3I8DA 4MFBA 5HLFA 4DSLA 4FW1A 1RCHA 3VQ6A 4DF8A 2RPIA 3NHGA 3QETA 4LSNA 2X6NA 4C8MA 1VRUA 3CQ8A 1RBTA 1S1WA 4IFYA 4RW9A 3KLGA 3SQ1A 1KSPA 1BQMA 1HJRA 4IG0A 3VQDA 4FM2A 1QSSA 3RR8A 2QK9A 4DQRA 1FK9A 5JS1A 2HHQA 3KIOA 1RT3A 1S6PA 1JXEA 3OY9A 3LZJA 4NYFA 2QXFA 1NK0A 4RW4A 2X74A 2Z1HA 3G0ZA 2ZD1A 4CGJA 3QIOA 2XY7A 2P5OA 3HSTB 4NYNA 1NK8A 4F4KA 4C8NA 1DTTA 3T3FA 3KLHA 4E0DA 1QQCA 4HVJA 2DFHA 4CHPA 2OPSA 4HUEA 4PA1A 1WSFA 1N5YA 3TAPA 2ZQBA 3AO2A 3EZ5A 1VSHA 1JL1A 2OPRA 4KTZA 2OZMA 4AHCA 2FBTA 4OKJA 1EETA 4CEFA 1Q9XA 1VSLA 2IAJA 5SWMA 3TAGA 4DWIA 4N41A 4CFCA 3ITHA 4CEBA 3IRXA 2Z1GA 4M3RA 3ZSVA 3QEVA 1LW2A 4FW2A 1TL1A 1XC9A 1NK4A 1BIUA 2HNDA 3DLHA 3RR7A 3HPOA 2B6AA 3EY1A 3MXIA 1SL2A 4CIGA 4HUFA 4KHYA 4PWDA 4OLAA 1D8YA 1WSJA 2G8VA 4FJ5A 1A5XA 4DG1A 4JRPA 2HHVA 4Z4FA 1JLAA 2JLEA 3ZSOA 1BISA 5HRPA 1NK5A 4C8OA 3U3YA 2B4JA 2E6MA 3PX4A 3THVA 1TK8A 1IKVA 1SKSA 4Z4GA 3OYAA 4HTUA 1J53A 4J2BA 4DU1A 4DTNA 1LWEA 4GVMA 4CHQA 2RKIA 3U6FA 3K57A 1L5UA 4EZ9A 3DI6A 3HP6A 5FRNA 1TKTA 2E4LA 3HPGA 1JLGA 4ZHRA 1XI1A 4NCBA 4DTJA 1X1PA 1C0MA 1C0TA 3NFAA 4E7KA 1HMVA 3PO5A 1S1XA 1LAVA 4BDPA 2HVIA 4O0IA 1RT5A 4ELTA 3RRGA 1F21A 1C6VA 1RILA 1WSIA 4HHTA 1ITGA 4CJKA 4J2AA 1J54A 3VQCA 4FK0A 4FK2A 5D3GA 5HRSA 2D5RA 3P5JA 1TGOA 4JRQA 4W5OA 3SNNA 3NGYA 4DQIA 1ZBFA 2G8IA 3ISNC 4CJFA 3NF7A 4LH5A 4F3TA 2DFEA 4CHOA 3ZSYA 3OYCA 3HT3A 1EX4A 3AO5A 4KAZA 4XIUA 1DTQA 5EU7A 1T8EA 4CEZA 3VQQA 1QHTA 4GMJB 4OGCA 4CJUA 5J2MA 1JLEA 3O4QA 3VQEA 1RDBA 3NH1A 3OYFA 4CF8A 1QE1A 4B9UA 3KLIA 3O3GA 3WNFA 3SQ4A 1RDAA 3HVRA 3V9UA 2DY4A 4FJKA 4DSKA 3C6UA 5I42A 1WNSA 3NGIA 3ZT0A 2KFZA 4LH4A 4BACA 1W0HA 4M3YA 1RBRA 1HPZA 3JSMA 3HO1A 3NF9A 4J2EA 1NK6A 3AA4A 1Q9YA 2QKKA 5CY4A 4FJHA 2VG7A 1HNIA 3L3VA 3KTQA 1REVA 3DOKA 3FFIA 3BDPA 3O4NA 1YT3A 2F96A 1ZBLA 3QEIA 1YVUA 3V1RA 4Z0UA 4CJ4A 5CYMA 1KVCA 3M8QA 3IS9A 3KK2A 1TAUA 1BHLA 4NCGA 2RN2A 3DMJA 1VSEA 3G10A 3OYHA 4CJLA 3RMAA 1RT6A 4WE1A 1S5JA 4CFBA 4OJRA 2NUBA 4W5RA 3HM9A 3K59A 1GOBA 3OYNA 4OLBA 2HHTA 3LWLA 3AA2A 4BE2A 2OZSA 4KHSA 4DSFA 1KFDA 3PO4A 3MAQA 1X9WA 3LWMA 4FVMA 4R5PA 2BGGA 1JLBA 2O4GA 3DOLA 4YFUA 4ID1A 4KPYA 3ALYA 3AVNA 4KI6A 4KI4A 4N76A 4Z4IA 1WLJA 2ATQA 3L2QA 4BDYA 2G8FA 1CZ9A 1RBVA 3NGZA 3AVMA 3CFPA 1S1TA 1WN7A 5J1EA 1U45A 4CEAA 4UQGA 3MEGA 4KB0A 1G15A 1SV5A 4ELUA 2E6LA 3SZ2A 3AVIA 3DLGA 4RW6A 4CGDA 3OYGA 5KGXA 3SV4A 4DU3A 3QEPA 3TI0A 4M3UA 3PY8A 4Z4HA 4DF4A 3QERA 4FLWA 3TARA 4F3OA 4LY7A 1I3AA 4CHNA 1X9MA 4CGIA 4FZZA 4FYDA 2KTQA 3QESA 3L3UA 3QLHA 4I9QA 1D9DA 4FZYA 1RDCA 3B6OA 4N5SA 3TABA 4O4GA 3AA3A 3C6TA 1KCFA 4E7JA 2D0CA 2HW3A 3SUNA 3OS0A 1UA1A 1NJXA 3MEDA 4BWMA 1I39A 3D45A 4CERA 1VSKA 4CGFA 3SQ2A 3NF6A 5DK5A 4FLZA 2OPPA 4IBNA 4BWJA 3O3FA 1O1WA 1Z26A 4CF9A 3LZIA 4BE1A 1NKCA 4KHUA 1T7PA 4M3TA 4DTUA 3OYDA 4DTPA 2Z1IA 3V6DA 1SL1A 4M3WA 2P1JA 4CGGA 1B9FA 3C94A 3U3GA 3VN5A 1SKRA 1L3UA 3VQBA 5KRSA 1U47A 4FJNA 3K5MA 3AVFA 1KVAA 3ZSZA 4W5TA 1CXUA 1BL3A 4ICLA 3VQ8A 1NJWA 4RW8A 4ZTFA 2JGUA 4N47A 3SYZA 4FLVA 3VQPA 4DFJA 4PY5A 3ZSRA 4KV8A 3NDKA 4DSIA 1UOCA 3OS1A 4KHQA 3K5NA 4CJ5A 1IKWA 4FJGA 3AVLA 4FJIA 1JLCA 1W9HA 3KK3A 2R7YA 3HVTA 1X9SA 3AO4A 4DS4A 4IG3A 4KFBA 4FLYA 3PX6A 3VQ4A 1KVBA 1BCOA 1RT4A 1ASUA 1RT1A 3CM5A 3HXMA 1TL3A 3M8PA 3NBPA 1EXQA 1CXQA 2FBYA 4CJEA 3OS2A 3CFRA 4DFPA 4M3ZA 4QCLA 1ASVA 4GW6A 3ZT2A 3L2VA 1NK9A 1GOCA 1D5AA 2IDOA 2HHWA 2D0AA 1LWCA 4JLHA 1DLOA 2HNZA 4E19A 5DMRA 2YNHA 3TAEA 1YTUA 4ELVA 1FKPA 4QAGA 1RTIA 3VQ5A 2VWJA 1ASWA 4E7IA 4DU4A 2XHBA 1TKZA 2RF2A 1R0AA 3IAYA 3OYLA 3OYKA
chains in the Genus database with same CATH superfamily
2ASOA 3U9ZA 3N4PA 4CEOA 1QS4A 2X6SA 4Q0BA 1K8AO 4H0PA 3FR0A 5AQKA 5C42A 2Q97A 4OPHA 2VWBA 3KHYA 4K8XA 1CZBA 4CK1A 3ZT3A 1QQMA 5FPNA 5C12A 4DR6K 2PFUA 4DSJA 4YOTA 3EYZA 4B3OA 1XWLA 1KFSA 3V1OA 4ZTJA 5HBMA 2GUPA 2ZJPL 1MWKA 1C1CA 2LSNA 3LP1A 3ZX3A 1VSIA 5EOYA 4FXDA 1T03A 1WSGA 1NGEA 3OBWA 4KHWA 2O8BB 3QNOA 2Y1IA 2HF4A 4DTSA 5EVZA 3AVBA 4B08A 3O8MA 3AVHA 2W40A 1XHXA 3M8RA 4FL9A 1QQOA 3MWTA 4KRFA 3C95A 3VOVA 4F2RA 4MLEA 4JI0K 2PZSA 3SUOA 2ZGYA 3DXMB 1BO5O 5BPLA 1J9AA 1YTAA 5J2QA 1L3VA 1SS6A 3W3DA 1K8KA 4FLXA 3VEYA 3CXCM 3TAMA 1UAXA 4NXNK 1S1VA 1NM1A 1YUWA 3ATVA 4Z4EA 4CFAA 4AHTA 1BI4B 5JLFA 3NH2A 3L2UA 1KLNA 3KK7A 3BGRA 2XY6A 4F3TA 3QNNA 1HNWK 3LPTA 4B9NA 4NLBA 4IOAL 4B8AB 1MU2A 1NNEA 1Q86O 3D2FB 4DMNA 4CBWA 4AH9A 5AFUH 2WOMA 5M1OA 3JYTA 4K43A 4V19S 1QSYA 3B8AX 1KQSM 4QOZB 2F9TA 3HYFA 1IH7A 1KD1O 5HRRA 2FBVA 1HYVA 1TKDA 2IVNA 4YOWA 4BC4A 3IUCA 3KD1E 4DQSA 2W41A 4H5TA 4FLTA 2BUPA 5BR8K 5J2NA 4Y1CA 4CECA 3RMDA 4CJ3A 2KW4A 2XO7A 2HMIA 1WSEA 1TAQA 2QWRA 4DV6K 5KI6A 4YOXA 2Z1JA 4CJPA 4TSXA 2B5JA 4M45A 2PYJA 3DRSA 3IG1A 4O5BA 2IIRA 4HCBA 2FXUA 3ZSXA 5JVHL 3AVAA 4E1NA 5HROA 4CHZA 4HCCA 1BU6O 3NH0A 1WAJA 3DXKB 2FC0A 4KH6A 3L2WA 1YJNN 3R1XA 2E1ZA 4LFCK 3OYJA 1A5WA 4H0YB 3RTVA 3SI6A 1NOZA 3BY5A 3QMLA 1MDUB 1E4GT 1LOTB 1HJOA 5KTQA 2D0OA 1VSFA 4KKOA 3S41A 3MEEA 1RBUA 2IVOA 4CBXA 4B1UB 2NRTA 3SMSA 4FWNA 4H0TB 5BN8A 4JK7A 4BDZA 3K5LA 3CG7A 5LL6Z 4B9SA 1LCUA 2IOCA 4CK3A 2HBMA 3QEWA 4IFEA 1RTHA 1RTDA 3T1AA 1C1AA 4LSLA 4A5BA 3CJAA 4OPKA 3NMUA 4EZ6A 3LDPA 1S9GA 3TU5A 1IO2A 4OGEA 2E2OA 2Q3SA 3SV3A 4BQZA 2GBZA 3KWIA 4IO9L 1KTQA 3LP0A 1N36K 3S9HA 4YY3K 3O3HA 4EP4A 4DLEA 4DQQA 2Y1JA 3E9OA 3K5OA 3TSQA 4CD3A 4JKDA 3RWUA 4MFBA 3ID6A 3VQ6A 2X6NA 1S1WA 4RW9A 3KLGA 4FM2A 4IG0A 4BGBA 3SAHA 4DQRA 4JI8K 1XNQK 3FZKA 1FK9A 2E2NA 4LF9K 1S6PA 1JXEA 3OY9A 2P9UB 4JNEA 4YHHK 4CGJA 3QIOA 4LC9B 2XY7A 4F4KA 4WFAL 4HUEA 4JKAA 4CZGA 3TAPA 2OZMA 1JL1A 2OPRA 3MK6A 2FBTA 1EETA 4CEFA 1NGAA 4DWIA 3CHWA 3ITHA 3IRXA 2Z1GA 2P9IB 1TL1A 3I56N 1BIUA 1OH8A 3RR7A 1VAZA 4O5FA 1SL2A 4CIGA 4IOXA 3CI5A 4X66K 1Q82O 1A5XA 4JRPA 4BR7A 4Z4FA 2I7PA 3THWB 3EL2A 4C8OA 3U3YA 3MN6A 2B4JA 3THVA 1SKSA 5M1FA 5TKYA 5M1NA 3K57A 4WQ4A 3HPGA 3MMVA 4B1YB 4ZHRA 1C0MA 3NFAA 3UE5A 5GAEP 1HMVA 5AZIB 3PO5A 5C2FA 4BDPA 4LF7K 1F21A 4H0OA 4J2AA 5HRSA 2HHHK 2D5RA 3EN9A 3NGYA 3SNNA 2E5LK 1RGIA 3ID8A 4CJFA 2P9KB 3GBTA 3NF7A 4IEEA 3U4LA 1I94K 4KAZA 3HT3A 1NJIO 5EU7A 4CEZA 1QHTA 4CJUA 4DR3K 1NGJA 3O4QA 1RDBA 5KPRA 3CC4N 3SQ4A 1RDAA 4DSKA 5I42A 4WYBA 5F2RA 3ZT0A 2KFZA 4LH4A 4M3YA 3P38A 5CY4A 4NB4A 4H5WA 1YT3A 2F96A 3V1RA 4YOUA 5CYMA 3HOSA 2YHXA 4FWPA 1BHLA 2RN2A 5M1PA 1VSEA 4CJLA 3KWGA 4NO7A 4OJRA 2HHTA 4BRIA 4KHSA 4DSFA 1DEJA 2GWKA 4XH1A 1TYQB 3THYA 4YFUA 4XH5A 5LJWA 2ATQA 3CMAN 2G8FA 1RBVA 3AVMA 4UQGA 3MEGA 1G15A 4ELUA 3H45C 2W6KA 3OYGA 3BF1A 3TI0A 4F3OA 3QERA 4A2AA 1I3AA 1X9MA 4CGIA 4FYDA 1D9DA 4O4GA 1KCFA 4E7JA 3OS0A 1VQMN 4U7BA 1VSKA 2UUBK 3UKUA 1VQLN 4KHUA 3O3FA 4BE1A 4CF9A 1NKCA 4K25A 1T7PA 2V52B 4DTPA 3EEQA 2Z1IA 3WT0A 4CD1A 3CCJN 3V6DA 1SL1A 4M3WA 1HUXA 3CCSN 4RWTA 1L3UA 2O8DB 1CXUA 3VQ8A 3L0QA 4RW8A 4ZTFA 5AQVA 3CJ7A 3SYZA 4FLVA 4DFJA 2HBLA 1UOCA 1M1KO 3THYB 3K5NA 4CJ5A 5JICA 4FVUA 3ZLJA 1YJ9N 3HVTA 1X9SA 2QA4N 2GTDA 2ZWHA 4IG3A 3OTOK 3VQ4A 1KVBA 4PL8A 3CM5A 3VTIA 3SV4A 3CFRA 1EXQA 3O6WA 4QCLA 3OS2A 4BC2A 1Z05A 1X9JA 4DFPA 4JI1K 1HKGA 4GW6A 4JK8A 2HHWA 3J7YP 4JLHA 4E19A 2YNHA 1O13A 4E7IA 1R0AA 5BPMA 3IAYA 2WTUA 3OYLA 3TWHA 2YNIA 4JI7K 4FK4A 4DR5K 3QEXA 4E1JA 2WBNA 4IFVA 2YNFA 4CF1A 3C6AA 4KB1A 4MO5A 1IV0A 3CERA 1SAZA 1NWKA 4K41A 3OJUA 2O4IA 1XMOK 1TUUA 4BR4A 5BRHA 1UWBA 4N56A 1JJ2M 3AO1A 3M8SA 2PBDA 3VEZA 3MXMA 3HL8A 3O9RA 5AQNA 4IKFA 3V9XA 2F9WA 3T1HK 4I7FA 1FW6A 3VENA 5DM6L 3K58A 3SUPA 1MA9B 4A2BA 5GADP 3M6GA 3H08A 2XRIA 5AJ3K 4CE9A 4DKWA 2A6AA 4FJ8A 4BR9A 3KJVA 1ZBHA 2QWLA 1IBMK 4MO4A 3TSPA 4G1QA 1NGCA 5IWAK 4JS4A 5AQLA 1T3VA 4FJJA 5C24A 5FPDA 5AQZA 1NGHA 1L3SA 1RNHA 1A5VA 3LDNA 4L8RB 5GINA 4OPJA 1TUYA 4FWLA 3CC2N 1CLQA 2O8FA 4CF2A 2QI2A 3BP8A 4XH4A 3DLRA 3KZBA 5AZJA 3N4QA 4WCEL 4E7HA 3DRPA 1NGGA 1IJJA 4KTQA 3P83D 2F8SA 1HNZK 1KLMA 3SBTA 4PL7A 3D2EB 2E88A 4CJTA 1XUPO 3DLKA 4FJMA 3F9MA 1C0FA 1BCMA 4IEIA 3T19A 2WUSA 3EZWA 4M41A 1BGXT 3ENHA 4DFMA 3AVGA 2KZZA 1SUQA 1NKBA 3H46O 4AM7A 1T05A 1WB9A 4W5NA 4Z4CA 4AHUA 1BWFO 2Q2RA 4B9MA 4IOCL 4A62A 3OJSA 4I9LA 3O80A 2HOEA 3P1GA 2P5GA 4MLHA 1LV5A 2XY8A 5KQ8A 3SCXA 1JL2A 4RW7A 3ZT1A 3ZT4A 2H3GX 4ILHA 4FJ9A 1DT9A 2XY5A 4DV0K 3PV8A 5KQDA 4K8ZA 3K9KA 4BVPA 2E2PA 2EWSA 2OCEA 3DYAA 5AQOA 3PUFA 1VQKN 3TTFA 3T69A 5HL7L 3THXB 3DLBA 3KD5E 1S9EA 3HZ6A 5JMVA 4JV5K 3RR8A 3KKSA 3E01A 5AQJA 2A41A 4AHVA 3VA0A 5T7BA 2GELA 1NGFA 1NOYA 3QFUA 2RHKA 1U49A 4DSEA 3VERA 4WFBL 4PQUA 1HNVA 3DXMA 3SQ0A 2YHWA 4GV6A 4H4OA 2GEMA 3LP2A 3WQUA 1JLQA 1ZBIA 4IZ9A 3HJFA 3AGRA 1NJZA 2NLXA 1C0UA 4DR1K 3ULDA 5M1KA 3TAFA 3S3OA 4C23A 4CEEA 3OHRA 3AV9A 4I2PA 4NCAA 2QKBA 2O8EB 3AA5X 3WNGA 1D4XA 4OX9K 1BI4A 1TK5A 3DLLL 3RRHA 1LW0A 1WOQA 4FWRA 4DTRA 4FCYA 3L6QA 3OYMA 3VQ9A 2NRRA 1S72N 3ZETA 4A57A 4BRFA 1OVQA 5AQTA 1Q18A 1HRHA 3D2FA 4BY9C 5BR9A 5F0XA 4DQPA 4CHYA 1RTJA 4HTLA 3JAMO 5FDLA 1Q8IA 4G9ZA 3QINA 3VGMA 4JKCA 4FOEA 5FRMA 1ZXOA 3LAMA 3SAFA 2PAVA 2E2QA 1ZBSA 1U48A 3T1YK 1S6QA 4C8LA 1QSLA 1ZBUA 3ZSWA 3MX5A 4FJLA 1BUPA 2O8CB 1RT7A 2W42A 3V4IA 3MWPA 3WNHA 3I0SA 4H8KA 4JKFA 3O9TA 3CCRN 1NK7A 4OKKA 4KH4A 4B8CA 2F4VK 5CYQA 4B3MK 2HHSA 1HQUA 2YHBA 4CFDA 5HLFA 4DF8A 3NHGA 4B1WB 3CQ8A 1RBTA 1RDUA 3DAWA 4DV4K 1KSPA 1BQMA 3VQDA 1QSSA 2GWJA 1HX1A 2VGNA 2IVPA 4BQLA 2HHQA 3BEXA 1RT3A 1GLDG 3DXKA 3LZJA 2Z1HA 3ZETB 2ZD1A 3CJBA 3T3FA 3KLHA 4ISFA 4HVJA 4CHPA 1K73O 1WSFA 3CJ1A 1OH7A 1MWMA 3AO2A 1VSHA 4KTZA 1E3MA 4JD2A 5SWMA 3ZX2A 4CZFA 3TAGA 4CFCA 3ZSVA 3U9DA 4FW2A 3FZLA 3OA9A 1NK4A 4YDUA 1J5EK 3R3LA 1RFQA 4HUFA 1N34K 5AQQA 2HHVA 2JLEA 5ADXH 1BISA 5HRPA 2E20A 1NK5A 2D1KA 1EWQA 2FF6A 2OTLN 4Z4GA 4LF5K 5C10A 4HTUA 1J53A 4IJNA 1U2VB 4DU1A 2BTFA 2P9PB 3DI6A 4GKJK 1JLGA 4NCBA 4BRLA 5LJVA 4E7KA 3RRGA 4DV1K 1C6VA 5CE3A 4FK2A 4CJKA 4DCHA 2A42A 2G8IA 4DQIA 5BREA 3ISNC 4DUZK 4LH5A 2DFEA 1KAYA 4CHOA 3ZSYA 1YITN 3ZYYX 1T8EA 3VQQA 4JD2B 4HWIA 4KBOA 5J2MA 4BRPA 3J7ZO 3KLIA 3O3GA 3V9UA 2DY4A 4FJKA 4JHDB 4GVEA 3LM9A 2P9UA 4WQ5A 5CHIA 4CZLA 1RBRA 4PKGA 1SZ2A 2QKKA 4FJHA 5CR4A 1J6ZA 2VG7A 3UKRB 3F2KA 3DOKA 3FFIA 3CPWM 4Z0UA 4CJ4A 4OPAA 1KVCA 3MCPA 3M8QA 3KK2A 2P9IA 3OYHA 1RT6A 4CFBA 1S5JA 4W5RA 3HM9A 4KHNA 1GOBA 2E8AA 4YORA 3UB5A 4IJAA 3SBGA 1E4FT 2D0PA 4BE2A 3PO4A 1KFDA 2OZSA 3QICA 5HOOA 4FVMA 3T7ZA 2QTDA 4ID1A 3THWA 3ALYA 3A8YA 1WLJA 1GLJO 4FPAA 2JWLA 1S1TA 1WN7A 4O8UA 3CJCA 1JCFA 2P9LB 1KXPA 2QW9A 2ZJRL 5KGXA 4FWKA 4M3UA 1YF5L 3LM2A 5AQUA 3QLHA 3H6EA 3VEOA 4N5SA 3AA3A 5AZIA 2HW3A 2Q0RA 4DV2K 3SUNA 1ATNA 3D45A 4AM6A 4CGFA 3SQ2A 1YHQN 5DK5A 4IBNA 4BWJA 1Z26A 4M3TA 2P9KA 1KAXA 4WFNL 2WC9A 3CCMN 1SKRA 3VN5A 5KRSA 3AVFA 3ZSZA 2JGUA 2QWOA 3EKSA 4J8FA 3ZSRA 3QBWA 4FWOA 4DSIA 2HMPA 4WQ4C 3O08A 1JLCA 3KK3A 1OH6A 3CC7N 3QDKA 3AO4A 2ZM6K 3LDLA 4DS4A 3PX6A 2ASPA 3FFKB 1RT4A 1BCOA 3M8PA 1CXQA 2FBYA 3AY9A 5BPNA 4I6MA 5M1QA 3ULEB 3ZT2A 1DGKN 1GOCA 1Q81O 2D0AA 1LWCA 2HNZA 1TYQA 1FKPA 4BR0A 4CZMA 2VWJA 2NRZA 1TKZA 3OYKA 3S3MA 3L2RA 2HHXA 4H5VA 2V7ZA 2CGJA 2G8KA 5EXWA 4AILC 3RSEA 2HBKA 4YOYA 2QEXN 5I3UA 1Y97A 1IKYA 4M7YA 4BRGA 1C0GA 4CGHA 3PX0A 5HP1A 3NF8A 3VEXA 2VG6A 4L3QA 1VQ5N 1VHXA 3AO3A 3VF2A 1RT2A 4HUGA 1LWFA 2EX3A 3HPHA 3HOTA 5C25A 5A2QO 2O8DA 1VQ6N 4O8KA 4CBUA 1C1BA 4BRNA 2Q1NA 4KH5A 4EHTA 3DJCA 4B1ZA 3OW2M 5C0YA 3VQ7A 1IBKK 3E9PA 2NRVA 2KKZA 4BGAA 4H5NA 4JKGB 4I6MB 3NVMA 1VK0A 2AJQA 4RG8A 4ID5A 3AVKA 4O0JA 5F1XA 5B8HA 4IWVA 4CZJA 1YVNA 5AQIA 3PLAA 3HK2A 3WQTA 3M3ZA 1HYZA 3CMEN 4DFKA 3AVCA 4JYAK 1EO1A 3CF5L 1LAWA 4B9VA 2BDPA 2Q0UA 3GE1A 3WXJA 5IT9O 1BIZA 3M1FA 3RSEB 4B1XB 4M42A 4CIEA 2YKNA 3LDQA 5FPMA 4CJ7A 2ZE2A 2VWKA 2EHGA 2FBXA 3Q7BA 4CF0A 3OYEA 3L8BA 2FSJA 3V9SA 1M90O 1KRPA 4A61A 1YXQA 4FZXC 1HYSA 4MDBA 3FLCO 3ENBA 4BRCA 4JS5A 1XHZA 3NAEA 4FWSA 3DM2A 3RMCA 3G25A 1J5OA 4DUYK 4E7LA 3LP3A 2QM1A 2GV9A 2WONA 2NRWA 2IC3A 4B3SK 3CFOA 2VYPA 4Z94A 2HHUA 2YKMA 1RBSA 4LFAK 4CJQA 1T6DA 3ZEUB 1QQNA 4JK9A 3SAGA 3TANA 3E9LA 4PKIA 5I9EB 3OYBA 3QIPA 2YJFA 1IKXA 3HP9A 4CZIA 1N6QA 4KO0A 1KAZA 3O9QA 4CCHA 3CYMA 3A2FA 5GAHP 3SK3A 3SPZA 2I7NA 1FXXA 3ASMA 1TV6A 1ATSA 4K0KK 4CZHA 2KZMA 3GOIA 3O1BA 4MQ3A 1DKGD 1S1UA 1FKOA 2PYLA 1NJYA 2DTUA 4CJRA 5FROA 3O9UA 3W0LA 3MXJA 3D2EA 1HKBA 3A5NC 4GKKK 2ZJQL 4M63C 4JKHA 4CJVA 4B9QA 2ZF5O 1T6CA 4I2QA 3OYIA 5LMUK 1EKEA 5AQWA 3S3NA 5TKWA 3JS6A 2NNWA 4BRDA 2HNYA 3WEEB 1W2BM 2HB5A 3DLEA 1D9FA 1WSHA 3DRRA 2WFBA 2P51A 5JLHA 1TVRA 4RTFD 1Z6RA 3G4SN 2D0BA 4O44A 2P9SB 4XEIA 1HKCA 2G8HA 1JKHA 4LD0A 4AHRA 4X65K 4LF8K 3AVJA 5C15A 4H03B 3LALA 4AHSA 3CM6A 4CZKA 3TR8A 4C8KA 2YNGA 1V4SA 1NGDA 4A59A 5AR0A 1JCGA 3E66A 2QWMA 3SPYA 4FJXA 3THXA 3HTVA 1QTMA 1ZC6A 4OKEA 2E1YA 3CPEA 4QS7A 1YIJN 3MDQA 1NU0A 5JS2A 2VG5A 4FLUA 2BANA 3G71N 3IFRA 2BE2A 4DHYA 3LDSA 2Q36A 5EX5A 5AFUA 2HVHA 3ENOA 3R8EA 4FW1A 1RCHA 2RPIA 3QETA 1X3NA 4LSNA 1BA1A 4IFYA 1VQPN 2QK9A 5BRDA 3I55N 4IXCA 2FF3B 1T44A 4CW7B 5GAGP 4H5RA 3KIOA 4C1NI 1NK0A 2X74A 3G0ZA 2YI1A 3HSTB 4NYNA 1NK8A 2O8EA 1DTTA 4E0DA 3PSFA 1QQCA 1W7AA 2OPSA 4PA1A 2ZQBA 4JKEA 4OKJA 4EAHD 1Q9XA 3MN9A 1VSLA 2AA4A 1NGIA 3QFPA 4M3RA 5FLXO 4JKBA 4JEPA 2HNDA 3DLHA 1GLBG 3MXIA 4JI2K 1GLEG 3TTDA 4PWDA 4GY2B 1WSJA 2G8VA 4FJ5A 4CI6A 4DG1A 3ZSOA 3O9SA 3QB0A 4ILJA 4JI3K 2VCPA 3HM8A 2E6MA 3PX4A 3O1WA 1IKVA 3C7NB 2ITMA 2V7YA 1LWEA 4GVMA 4CHQA 2RKIA 5JVGL 4DTNA 3U6FA 4EZ9A 1TKTA 3TTCA 1WBDA 3VESA 4DTJA 1X1PA 1C0TA 2DPNA 5LY3A 3F5TA 1S3XA 2O8CA 1S1XA 3JXUA 1LAVA 4B3RK 2HVIA 1RT5A 4ELTA 1RILA 1WSIA 2P9NB 4HHTA 1ITGA 3Q7CA 1J54A 5D3GA 4U67L 3P5JA 1TGOA 4W5OA 1ZBFA 4QS8A 3D7EO 3OYCA 3H1VX 4DV5K 4XIUA 3WXIA 4OGCA 3VQEA 1VQ8N 2VQEK 3VEWA 4B9UA 1QE1A 3GL1A 5E26A 3C6UA 1P90A 1WNSA 4DQ8A 2F7TA 4A5AA 4BACA 2YCHA 4FOIA 1HPZA 4PKHA 3AA4A 5MLCQ 1Q9YA 1NBWA 4H0XB 4OO1J 3KTQA 1H1VA 4UY8O 4PHTX 3O4NA 1FJGK 1QVGM 1S22A 3DMJA 4DV7K 3RMAA 4WE1A 3VPZA 3OYNA 4OLBA 3LWLA 1GLAG 5AQMA 4BRQA 3MAQA 2UUCK 1X9WA 3LWMA 2CGLA 2BGGA 1JLBA 4KI4A 3AVNA 4KI6A 4Z4IA 3TSUA 4BDYA 1BG3A 4FWQA 3NGZA 5J1EA 1U45A 4CEAA 1U2VA 3E1YA 4KB0A 2E6LA 2P9PA 1XMQK 4AQYK 4Z4HA 3TARA 3C65A 4LY7A 4CHNA 2KTQA 3AAQA 3L3UA 5AQPA 4I9QA 3TABA 3C6TA 2HBJA 2D0CA 1NMDA 1NJXA 2CGKA 4BWMA 4CERA 4FLZA 1W97L 3BF3A 1O1WA 3LZIA 4YDUC 4DTUA 1B9FA 3PIPL 3AAPA 3H3OB 1WUAA 4W5TA 2RE2A 1BL3A 4ICLA 3MN7A 4JHDA 4X62K 4N47A 4IDHA 3VQPA 2UUAK 4BR5A 3PIOL 3NDKA 1XQSC 2QWNA 4KHQA 3BUZB 3UKRA 3K0SA 4FJGA 3AVLA 4FJIA 1W9HA 3LDOA 4LF6K 2R7YA 1NGBA 1GLLO 4FLYA 3A5LC 1RT1A 1ESVA 5AQGA 3HXMA 3OBYA 2Q31A 1NK9A 1D5AA 3ATUA 3R6MA 1DLOA 1YTUA 1K8KB 3AARA 3U8XA 2XHBA 5KPZA 3VF4A 4BVOA 1ILYA 5SZTA 5E41A 4KTWA 2P9LA 4WQ5C 4FJ7A 3NCIA 3AGKA 3BZKA 1SL0A 3KK1A 1XNRK 2A1RA 2KHOA 4M3XA 4CEQA 4F8RA 1EP4A 4CJWA 1G99A 4Q5VA 3WXKA 3CCLN 4BRMA 3FZHA 3K9JA 3VGKA 1GLFO 3MN5A 1U4BA 2I5JA 3EO3A 3LAKA 1OKJA 2ASMA 3SJJA 1UA0A 3UIQA 1XC3A 4DLGA 1N32K 3I0RA 1R59O 4KREA 4R79A 4H4MA 4DS5A 1U04A 4O55A 3QO9A 4BG9A 1EQYA 3MECA 3J81O 4E3SA 1VQNN 3FGUA 4CEDA 2QXLA 3KLEA 3TPQA 4BE0A 2G8WA 2QWQA 4KHPK 3ULEA 4IDKA 1B92A 3LPUA 4BREA 1ZYQA 1GOAA 5KRTA 4GV9A 5AQFA 1JXBA 1Q7YO 3EE8A 1HR0K 4EFHA 2KFNA 3I8BA 4PUOA 2X78A 2PY5A 3C6HA 4B9TA 3H3NO 3J7AP 2GUIA 2OPQA 3VA3A 3CETA 3K2PA 4BC3A 2W6LA 3L4QA 1IG9A 1BQNA 3OVNA 5KGWA 4ILGB 1Z25A 4DB3A 2CH5A 3CCVN 1Y64A 3MX2A 4EP5A 4JI5K 2OA8A 3SJHA 1QHAA 4GNIA 3HBTA 3ZCMA 1SKWA 3LL3A 4JI4K 3EE9A 4CIFA 4FWMA 1YAGA 2UXCK 3D0PA 5CZ2A 5CZ1A 2UYTA 3VTHA 5AQYA 4J2DA 1VSDA 4CESA 3ZSQA 4W5QA 4JKGA 4DR7K 2OANA 1OH5A 3F9KA 3VEVA 3NVKA 4N41A 1K6YA 4E1MA 3LANA 2YX6A 2V51B 2YV0X 3VQAA 5HRNA 1L3TA 3SMPA 3GG4A 2ETJA 3L4IA 3RMBA 4CK2A 3NE6A 1TKXA 2ITGA 2KQ2A 3CCEN 1NKEA 1B9DA 1VSJA 2UU9K 3B6PA 3M5RA 2FSKA 3SUQA 1N33K 4FM0A 3KLFA 3KKRA 3VF6A 1K9MO 4C1NK 1VSMA 2A5XA 2YHAA 3QBXA 1YJWN 4OVLA 3WNEA 2A1SA 2OTJN 1CZAN 1BDGA 5AQSA 2G8UA 4CZEA 4H0VB 3A5OC 4F2SA 1VQON 5K14A 4B1VA 3WUHA 3KVGA 1YI2N 3EKUA 4FM1A 1JLFA 4DTOA 4BROA 3J8AA 4YNQA 4DTXA 1VRTA 1HQEA 4DR2K 3F73A 3V81A 4B3TK 4NLCA 2OYQA 1NLVA 3TAQA 4B9LA 1WAFA 3V1QA 5E84A 3CIPA 4Y1DA 1BA0A 5AQXA 3ZEUA 1HPMA 2F8TA 1TK0A 1VQ4N 5C2DA 4DTMA 1RDDA 3VETA 4CJSA 3V9WA 3IMXA 4DV3K 3FE1A 3V9ZA 3A5MC 2HF3A 4M7XA 1SQKA 4JN4A 5KPTA 2IGIA 3GDQA 5AQHA 2IS3A 4QS9A 1QZ6A 3FZMA 1OVYA 4E89A 3P4IA 3P31A 2DFFA 5H1SQ 4F9OA 5J2PA 4DSLA 3I8DA 5GIOA 4C8MA 3SQ1A 1VRUA 1HJRA 3R9PA 4EHUA 5JS1A 4MDAA 4IO8A 4NYFA 3SLCA 2QXFA 1IBLK 4RW4A 3A0IX 4DR4K 2HSTA 2P5OA 2GX9A 4C8NA 2DFHA 3WXMB 2AP1A 4ELVA 1N5YA 3WEEA 2YJEA 3EZ5A 4AHCA 1QZ5A 2IAJA 2FSNA 4CEBA 1N8RO 3QEVA 3MCAB 4NXMK 1LW2A 1XC9A 1NG9A 1HNXK 3HPOA 2B6AA 3EY1A 1BOTO 1ATRA 3CCUN 2P9SA 4KHYA 1D8YA 5LMNK 4OLAA 3IDHA 4YOVA 3O5BA 3C0BA 1JLAA 1TK8A 1IG8A 3OYAA 5GIPA 4J2BA 4EIAA 4FO0A 1L5UA 2BH1A 4BG8A 5FRNA 3HP6A 2KLAA 4X64K 5DM7L 2UXBK 2E4LA 1XI1A 4CVNE 3BZCA 2QWPA 3HRGA 1HLUA 4BRAA 4O0IA 2D4WA 3VQCA 4FK0A 3UKUB 3HSCA 4JRQA 5BRFA 4ISGA 3CCQN 3FZFA 1EX4A 3AO5A 1DTQA 3CQYA 1JCEA 2NRXA 4GMJB 5BN9A 4LFBK 1JLEA 3NH1A 2VQFK 1U6ZA 2YHYA 3OYFA 4CF8A 3WNFA 3HVRA 3NGIA 4LF4K 1W0HA 3HO1A 3I33A 3JSMA 3NF9A 4J2EA 2JWKA 1NK6A 1QVFM 1HNIA 3L3VA 3J80O 1EWRA 1REVA 2J4RA 3BDPA 1ZBLA 3IKMA 3QEIA 1YVUA 2A3ZA 2CH6A 2ZGZA 4BR2A 2NRHA 3IS9A 1TAUA 4NCGA 3VGLA 3G10A 4RCHA 2FLOA 3H1QA 1KC8O 2NUBA 3K59A 3AA2A 3CD6N 4R5PA 2O4GA 5ELZA 3DOLA 4KPYA 1V4TA 4N76A 3L2QA 3CJ9A 1CZ9A 3CQXA 4GV3A 4ISEA 3CFPA 3C7NA 1SV5A 3SZ2A 3HI0A 3AVIA 3DLGA 4RW6A 4CGDA 4DU3A 3QEPA 1VQ9N 3PY8A 4DF4A 4FLWA 4FZZA 4JAXA 3QESA 4FZYA 1RDCA 3B6OA 4BC5A 1WBBA 5EY4A 1UA1A 1RDWX 3MEDA 2UXDK 1I39A 2P9NA 3D6RA 3NF6A 2OPPA 4JI6K 3G6EN 5ADXA 3OYDA 4FSVA 2P1JA 4CGGA 3C94A 3U3GA 4FJNA 3VQBA 3DWLA 1U47A 3K5MA 4AF1A 1KVAA 5FPEA 1NMNA 1NJWA 3WXLA 3ZX0A 1VQ7N 4Y0WA 4BRKA 3O4WA 4PY5A 5AQRA 4KV8A 2A40A 1GLCG 3OS1A 1IKWA 3VMFB 2O8FB 2VGMA 5AZJB 2NZTA 4KFBA 2O8BA 1ASUA 1TL3A 3NBPA 4CJEA 4M3ZA 3PSIA 1X3MA 1ASVA 3L2VA 4FPBA 1P8ZA 2IDOA 4K42A 4WF9L 4BRHA 5DMRA 3TAEA 4QAGA 1RTIA 3VQ5A 3RVCA 1ASWA 3P39A 4DU4A 2RF2A
chains in the Genus database with same CATH topology
3TWHA 2YNIA 3L2RA 3S3MA 4FK4A 3QEXA 5SZTA 2HHXA 5E41A 4KTWA 4CEOA 1QS4A 2G8KA 4FJ7A 4IFVA 2YNFA 2X6SA 4CF1A 3NCIA 4Q0BA 4KB1A 4AILC 5C42A 3OJUA 2O4IA 1SL0A 3KK1A 4K8XA 1CZBA 4CK1A 1Y97A 5I3UA 2A1RA 3ZT3A 1UWBA 1IKYA 4N56A 4M3XA 4CGHA 4DSJA 3PX0A 4CEQA 3AO1A 5HP1A 3NF8A 3M8SA 3MXMA 3HL8A 2VG6A 3EYZA 4F8RA 4IKFA 4B3OA 3AO3A 1EP4A 1XWLA 3V9XA 1RT2A 4CJWA 1KFSA 4HUGA 3V1OA 1LWFA 2EX3A 4ZTJA 5HBMA 3HPHA 4I7FA 4Q5VA 3K58A 3SUPA 5C25A 1C1CA 1U4BA 2I5JA 2LSNA 1C1BA 1VSIA 3LAKA 3LP1A 4FXDA 3H08A 2XRIA 1WSGA 3SJJA 1UA0A 1T03A 4CE9A 3UIQA 4FJ8A 4KHWA 4DLGA 3QNOA 3VQ7A 3I0RA 3KJVA 4KREA 2Y1IA 1ZBHA 4DTSA 1VK0A 4H4MA 4G1QA 4RG8A 4DS5A 1U04A 2AJQA 3AVBA 4ID5A 4O55A 3AVKA 4B08A 4JS4A 4FJJA 4O0JA 3QO9A 3AVHA 5C24A 1XHXA 3M8RA 3MECA 4E3SA 1L3SA 1RNHA 1A5VA 4L8RB 4OPJA 3HK2A 4CEDA 1CLQA 4KRFA 4CF2A 3C95A 1HYZA 3DLRA 4DFKA 3AVCA 3KLEA 4F2RA 4E7HA 1LAWA 4B9VA 3DRPA 2PZSA 4KTQA 3P83D 3SUOA 2F8SA 4BE0A 2BDPA 2G8WA 1KLMA 1BIZA 4IDKA 1B92A 3LPUA 4M42A 1ZYQA 1J9AA 1GOAA 4CJTA 1YTAA 4CIEA 2YKNA 5KRTA 5J2QA 3DLKA 1L3VA 4FJMA 1BCMA 1JXBA 3T19A 2ZE2A 4FLXA 2VWKA 2EHGA 2FBXA 4M41A 3TAMA 2KFNA 4CF0A 1UAXA 4PUOA 1S1VA 1BGXT 2X78A 2PY5A 3OYEA 3L8BA 4CFAA 3V9SA 4B9TA 4Z4EA 4AHTA 1KRPA 1BI4B 2GUIA 3NH2A 2OPQA 4DFMA 3L2UA 3VA3A 3AVGA 4FZXC 1SUQA 1NKBA 1KLNA 1HYSA 2KZZA 3K2PA 1T05A 1IG9A 4W5NA 3BGRA 2XY6A 4Z4CA 4JS5A 1XHZA 3NAEA 4AHUA 3QNNA 1BQNA 3DM2A 3RMCA 3LPTA 3OVNA 5KGWA 1J5OA 4B9NA 1Z25A 4B9MA 4E7LA 4EP5A 3LP3A 4B8AB 3OJSA 2GV9A 4I9LA 2WONA 2OA8A 3P1GA 1MU2A 2IC3A 3CFOA 2P5GA 3ZCMA 4DMNA 1LV5A 1SKWA 2XY8A 4AH9A 3SCXA 2HHUA 1JL2A 4RW7A 3ZT1A 2YKMA 3ZT4A 2WOMA 1RBSA 4CIFA 4FJ9A 4CJQA 3JYTA 2XY5A 3PV8A 3D0PA 1QSYA 5CZ2A 5CZ1A 4K8ZA 4QOZB 3TANA 3HYFA 1IH7A 5HRRA 2FBVA 3OYBA 1HYVA 3QIPA 1TKDA 3DYAA 4J2DA 1VSDA 4CESA 3ZSQA 4W5QA 3PUFA 3KD1E 1IKXA 4DQSA 3HP9A 4FLTA 1N6QA 4KO0A 3DLBA 3KD5E 1S9EA 3F9KA 5J2NA 4CCHA 3CYMA 3A2FA 4Y1CA 4CECA 4CJ3A 1K6YA 3KKSA 4E1MA 2KW4A 3RMDA 3LANA 3SPZA 3E01A 2XO7A 2HMIA 1FXXA 3ASMA 1TV6A 1WSEA 4AHVA 1TAQA 3VA0A 2YV0X 3VQAA 5HRNA 2KZMA 5KI6A 5T7BA 1NOYA 1L3TA 4MQ3A 2Z1JA 4CJPA 4TSXA 1S1UA 2B5JA 4M45A 1U49A 1FKOA 4DSEA 2ETJA 2PYJA 3RMBA 4KHNA 3DRSA 4CK2A 3NE6A 1TKXA 2ITGA 2KQ2A 4PQUA 2PYLA 1HNVA 3SQ0A 3IG1A 1NKEA 1NJYA 4H4OA 4O5BA 1B9DA 1VSJA 4HCBA 3LP2A 2DTUA 3B6PA 4CJRA 5FROA 3ZSXA 1JLQA 3MXJA 1ZBIA 3SUQA 3HJFA 3AVAA 4E1NA 5HROA 4CHZA 1NJZA 4HCCA 1C0UA 4FM0A 3ULDA 3KLFA 3KKRA 3NH0A 3TAFA 1WAJA 1VSMA 2YHAA 4CJVA 3S3OA 4I2QA 4OVLA 3WNEA 2FC0A 2A1SA 3OYIA 4CEEA 1EKEA 3L2WA 3AV9A 4I2PA 4NCAA 3S3NA 2QKBA 3OYJA 1A5WA 3AA5X 2G8UA 3WNGA 4F2SA 2HNYA 5K14A 1BI4A 1TK5A 3RTVA 3SI6A 1NOZA 4FM1A 1JLFA 2HB5A 4DTOA 4DTXA 3DLEA 4YNQA 1D9FA 1VRTA 1WSHA 3DRRA 1HQEA 3RRHA 1LW0A 4DTRA 5KTQA 4FCYA 3OYMA 1VSFA 3VQ9A 3F73A 3V81A 2P51A 4KKOA 3MEEA 1TVRA 1RBUA 2OYQA 3TAQA 2D0BA 4O44A 4B9LA 1HRHA 4DQPA 4CHYA 4BDZA 1RTJA 1JKHA 3K5LA 1WAFA 3V1QA 2G8HA 4LD0A 4Y1DA 5FDLA 1Q8IA 3CG7A 4AHRA 3QINA 3AVJA 4B9SA 4CK3A 2IOCA 3LALA 5FRMA 2F8TA 3LAMA 3QEWA 1TK0A 4AHSA 3CM6A 1RTHA 1RTDA 3TR8A 4DTMA 4C8KA 2YNGA 3T1AA 1C1AA 4LSLA 4OPKA 1RDDA 4EZ6A 1U48A 3SPYA 1S9GA 4CJSA 3V9WA 1IO2A 4OGEA 1S6QA 4FJXA 2Q3SA 3SV3A 4C8LA 1QSLA 3V9ZA 1QTMA 4OKEA 1ZBUA 3ZSWA 4FJLA 2GBZA 1RT7A 5JS2A 2W42A 1KTQA 3LP0A 2IGIA 2VG5A 3WNHA 3I0SA 3V4IA 4H8KA 4FLUA 3S9HA 2BANA 2IS3A 3O3HA 2BE2A 4EP4A 4OKKA 4E89A 1NK7A 4B8CA 4DLEA 3LDSA 2DFFA 4DQQA 2Y1JA 3K5OA 5CYQA 2HVHA 2HHSA 3RWUA 5J2PA 1HQUA 2YHBA 4CFDA 3I8DA 4MFBA 5HLFA 4DSLA 4FW1A 1RCHA 3VQ6A 4DF8A 2RPIA 3NHGA 3QETA 4LSNA 2X6NA 4C8MA 1VRUA 3CQ8A 1RBTA 1S1WA 4IFYA 4RW9A 3KLGA 3SQ1A 1KSPA 1BQMA 1HJRA 4IG0A 3VQDA 4FM2A 1QSSA 3RR8A 2QK9A 4DQRA 1FK9A 5JS1A 2HHQA 3KIOA 1RT3A 1S6PA 1JXEA 3OY9A 3LZJA 4NYFA 2QXFA 1NK0A 4RW4A 2X74A 2Z1HA 3G0ZA 2ZD1A 4CGJA 3QIOA 2XY7A 2P5OA 3HSTB 4NYNA 1NK8A 4F4KA 4C8NA 1DTTA 3T3FA 3KLHA 4E0DA 1QQCA 4HVJA 2DFHA 4CHPA 2OPSA 4HUEA 4PA1A 1WSFA 1N5YA 3TAPA 2ZQBA 3AO2A 3EZ5A 1VSHA 1JL1A 2OPRA 4KTZA 2OZMA 4AHCA 2FBTA 4OKJA 1EETA 4CEFA 1Q9XA 1VSLA 2IAJA 5SWMA 3TAGA 4DWIA 4N41A 4CFCA 3ITHA 4CEBA 3IRXA 2Z1GA 4M3RA 3ZSVA 3QEVA 1LW2A 4FW2A 1TL1A 1XC9A 1NK4A 1BIUA 2HNDA 3DLHA 3RR7A 3HPOA 2B6AA 3EY1A 3MXIA 1SL2A 4CIGA 4HUFA 4KHYA 4PWDA 4OLAA 1D8YA 1WSJA 2G8VA 4FJ5A 1A5XA 4DG1A 4JRPA 2HHVA 4Z4FA 1JLAA 2JLEA 3ZSOA 1BISA 5HRPA 1NK5A 4C8OA 3U3YA 2B4JA 2E6MA 3PX4A 3THVA 1TK8A 1IKVA 1SKSA 4Z4GA 3OYAA 4HTUA 1J53A 4J2BA 4DU1A 4DTNA 1LWEA 4GVMA 4CHQA 2RKIA 3U6FA 3K57A 1L5UA 4EZ9A 3DI6A 3HP6A 5FRNA 1TKTA 2E4LA 3HPGA 1JLGA 4ZHRA 1XI1A 4NCBA 4DTJA 1X1PA 1C0MA 1C0TA 3NFAA 4E7KA 1HMVA 3PO5A 1S1XA 1LAVA 4BDPA 2HVIA 4O0IA 1RT5A 4ELTA 3RRGA 1F21A 1C6VA 1RILA 1WSIA 4HHTA 1ITGA 4CJKA 4J2AA 1J54A 3VQCA 4FK0A 4FK2A 5D3GA 5HRSA 2D5RA 3P5JA 1TGOA 4JRQA 4W5OA 3SNNA 3NGYA 4DQIA 1ZBFA 2G8IA 3ISNC 4CJFA 3NF7A 4LH5A 4F3TA 2DFEA 4CHOA 3ZSYA 3OYCA 3HT3A 1EX4A 3AO5A 4KAZA 4XIUA 1DTQA 5EU7A 1T8EA 4CEZA 3VQQA 1QHTA 4GMJB 4OGCA 4CJUA 5J2MA 1JLEA 3O4QA 3VQEA 1RDBA 3NH1A 3OYFA 4CF8A 1QE1A 4B9UA 3KLIA 3O3GA 3WNFA 3SQ4A 1RDAA 3HVRA 3V9UA 2DY4A 4FJKA 4DSKA 3C6UA 5I42A 1WNSA 3NGIA 3ZT0A 2KFZA 4LH4A 4BACA 1W0HA 4M3YA 1RBRA 1HPZA 3JSMA 3HO1A 3NF9A 4J2EA 1NK6A 3AA4A 1Q9YA 2QKKA 5CY4A 4FJHA 2VG7A 1HNIA 3L3VA 3KTQA 1REVA 3DOKA 3FFIA 3BDPA 3O4NA 1YT3A 2F96A 1ZBLA 3QEIA 1YVUA 3V1RA 4Z0UA 4CJ4A 5CYMA 1KVCA 3M8QA 3IS9A 3KK2A 1TAUA 1BHLA 4NCGA 2RN2A 3DMJA 1VSEA 3G10A 3OYHA 4CJLA 3RMAA 1RT6A 4WE1A 1S5JA 4CFBA 4OJRA 2NUBA 4W5RA 3HM9A 3K59A 1GOBA 3OYNA 4OLBA 2HHTA 3LWLA 3AA2A 4BE2A 2OZSA 4KHSA 4DSFA 1KFDA 3PO4A 3MAQA 1X9WA 3LWMA 4FVMA 4R5PA 2BGGA 1JLBA 2O4GA 3DOLA 4YFUA 4ID1A 4KPYA 3ALYA 3AVNA 4KI6A 4KI4A 4N76A 4Z4IA 1WLJA 2ATQA 3L2QA 4BDYA 2G8FA 1CZ9A 1RBVA 3NGZA 3AVMA 3CFPA 1S1TA 1WN7A 5J1EA 1U45A 4CEAA 4UQGA 3MEGA 4KB0A 1G15A 1SV5A 4ELUA 2E6LA 3SZ2A 3AVIA 3DLGA 4RW6A 4CGDA 3OYGA 5KGXA 3SV4A 4DU3A 3QEPA 3TI0A 4M3UA 3PY8A 4Z4HA 4DF4A 3QERA 4FLWA 3TARA 4F3OA 4LY7A 1I3AA 4CHNA 1X9MA 4CGIA 4FZZA 4FYDA 2KTQA 3QESA 3L3UA 3QLHA 4I9QA 1D9DA 4FZYA 1RDCA 3B6OA 4N5SA 3TABA 4O4GA 3AA3A 3C6TA 1KCFA 4E7JA 2D0CA 2HW3A 3SUNA 3OS0A 1UA1A 1NJXA 3MEDA 4BWMA 1I39A 3D45A 4CERA 1VSKA 4CGFA 3SQ2A 3NF6A 5DK5A 4FLZA 2OPPA 4IBNA 4BWJA 3O3FA 1O1WA 1Z26A 4CF9A 3LZIA 4BE1A 1NKCA 4KHUA 1T7PA 4M3TA 4DTUA 3OYDA 4DTPA 2Z1IA 3V6DA 1SL1A 4M3WA 2P1JA 4CGGA 1B9FA 3C94A 3U3GA 3VN5A 1SKRA 1L3UA 3VQBA 5KRSA 1U47A 4FJNA 3K5MA 3AVFA 1KVAA 3ZSZA 4W5TA 1CXUA 1BL3A 4ICLA 3VQ8A 1NJWA 4RW8A 4ZTFA 2JGUA 4N47A 3SYZA 4FLVA 3VQPA 4DFJA 4PY5A 3ZSRA 4KV8A 3NDKA 4DSIA 1UOCA 3OS1A 4KHQA 3K5NA 4CJ5A 1IKWA 4FJGA 3AVLA 4FJIA 1JLCA 1W9HA 3KK3A 2R7YA 3HVTA 1X9SA 3AO4A 4DS4A 4IG3A 4KFBA 4FLYA 3PX6A 3VQ4A 1KVBA 1BCOA 1RT4A 1ASUA 1RT1A 3CM5A 3HXMA 1TL3A 3M8PA 3NBPA 1EXQA 1CXQA 2FBYA 4CJEA 3OS2A 3CFRA 4DFPA 4M3ZA 4QCLA 1ASVA 4GW6A 3ZT2A 3L2VA 1NK9A 1GOCA 1D5AA 2IDOA 2HHWA 2D0AA 1LWCA 4JLHA 1DLOA 2HNZA 4E19A 5DMRA 2YNHA 3TAEA 1YTUA 4ELVA 1FKPA 4QAGA 1RTIA 3VQ5A 2VWJA 1ASWA 4E7IA 4DU4A 2XHBA 1TKZA 2RF2A 1R0AA 3IAYA 3OYLA 3OYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWH A;  2YNI A;  3L2R A;  3S3M A;  4FK4 A;  3QEX A;  5SZT A;  2HHX A;  5E41 A;  4KTW A;  4CEO A;  1QS4 A;  2G8K A;  4FJ7 A;  4IFV A;  2YNF A;  2X6S A;  4CF1 A;  3NCI A;  4Q0B A;  4KB1 A;  4AIL C;  5C42 A;  3OJU A;  2O4I A;  1SL0 A;  3KK1 A;  4K8X A;  1CZB A;  4CK1 A;  1Y97 A;  5I3U A;  2A1R A;  3ZT3 A;  1UWB A;  1IKY A;  4N56 A;  4M3X A;  4CGH A;  4DSJ A;  3PX0 A;  4CEQ A;  3AO1 A;  5HP1 A;  3NF8 A;  3M8S A;  3MXM A;  3HL8 A;  2VG6 A;  3EYZ A;  4F8R A;  4IKF A;  4B3O A;  3AO3 A;  1EP4 A;  1XWL A;  3V9X A;  1RT2 A;  4CJW A;  1KFS A;  4HUG A;  3V1O A;  1LWF A;  2EX3 A;  4ZTJ A;  5HBM A;  3HPH A;  4I7F A;  4Q5V A;  3K58 A;  3SUP A;  5C25 A;  1C1C A;  1U4B A;  2I5J A;  2LSN A;  1C1B A;  1VSI A;  3LAK A;  3LP1 A;  4FXD A;  3H08 A;  2XRI A;  1WSG A;  3SJJ A;  1UA0 A;  1T03 A;  4CE9 A;  3UIQ A;  4FJ8 A;  4KHW A;  4DLG A;  3QNO A;  3VQ7 A;  3I0R A;  3KJV A;  4KRE A;  2Y1I A;  1ZBH A;  4DTS A;  1VK0 A;  4H4M A;  4G1Q A;  4RG8 A;  4DS5 A;  1U04 A;  2AJQ A;  3AVB A;  4ID5 A;  4O55 A;  3AVK A;  4B08 A;  4JS4 A;  4FJJ A;  4O0J A;  3QO9 A;  3AVH A;  5C24 A;  1XHX A;  3M8R A;  3MEC A;  4E3S A;  1L3S A;  1RNH A;  1A5V A;  4L8R B;  4OPJ A;  3HK2 A;  4CED A;  1CLQ A;  4KRF A;  4CF2 A;  3C95 A;  1HYZ A;  3DLR A;  4DFK A;  3AVC A;  3KLE A;  4F2R A;  4E7H A;  1LAW A;  4B9V A;  3DRP A;  2PZS A;  4KTQ A;  3P83 D;  3SUO A;  2F8S A;  4BE0 A;  2BDP A;  2G8W A;  1KLM A;  1BIZ A;  4IDK A;  1B92 A;  3LPU A;  4M42 A;  1ZYQ A;  1J9A A;  1GOA A;  4CJT A;  1YTA A;  4CIE A;  2YKN A;  5KRT A;  5J2Q A;  3DLK A;  1L3V A;  4FJM A;  1BCM A;  1JXB A;  3T19 A;  2ZE2 A;  4FLX A;  2VWK A;  2EHG A;  2FBX A;  4M41 A;  3TAM A;  2KFN A;  4CF0 A;  1UAX A;  4PUO A;  1S1V A;  1BGX T;  2X78 A;  2PY5 A;  3OYE A;  3L8B A;  4CFA A;  3V9S A;  4B9T A;  4Z4E A;  4AHT A;  1KRP A;  1BI4 B;  2GUI A;  3NH2 A;  2OPQ A;  4DFM A;  3L2U A;  3VA3 A;  3AVG A;  4FZX C;  1SUQ A;  1NKB A;  1KLN A;  1HYS A;  2KZZ A;  3K2P A;  1T05 A;  1IG9 A;  4W5N A;  3BGR A;  2XY6 A;  4Z4C A;  4JS5 A;  1XHZ A;  3NAE A;  4AHU A;  3QNN A;  1BQN A;  3DM2 A;  3RMC A;  3LPT A;  3OVN A;  5KGW A;  1J5O A;  4B9N A;  1Z25 A;  4B9M A;  4E7L A;  4EP5 A;  3LP3 A;  4B8A B;  3OJS A;  2GV9 A;  4I9L A;  2WON A;  2OA8 A;  3P1G A;  1MU2 A;  2IC3 A;  3CFO A;  2P5G A;  3ZCM A;  4DMN A;  1LV5 A;  1SKW A;  2XY8 A;  4AH9 A;  3SCX A;  2HHU A;  1JL2 A;  4RW7 A;  3ZT1 A;  2YKM A;  3ZT4 A;  2WOM A;  1RBS A;  4CIF A;  4FJ9 A;  4CJQ A;  3JYT A;  2XY5 A;  3PV8 A;  3D0P A;  1QSY A;  5CZ2 A;  5CZ1 A;  4K8Z A;  4QOZ B;  3TAN A;  3HYF A;  1IH7 A;  5HRR A;  2FBV A;  3OYB A;  1HYV A;  3QIP A;  1TKD A;  3DYA A;  4J2D A;  1VSD A;  4CES A;  3ZSQ A;  4W5Q A;  3PUF A;  3KD1 E;  1IKX A;  4DQS A;  3HP9 A;  4FLT A;  1N6Q A;  4KO0 A;  3DLB A;  3KD5 E;  1S9E A;  3F9K A;  5J2N A;  4CCH A;  3CYM A;  3A2F A;  4Y1C A;  4CEC A;  4CJ3 A;  1K6Y A;  3KKS A;  4E1M A;  2KW4 A;  3RMD A;  3LAN A;  3SPZ A;  3E01 A;  2XO7 A;  2HMI A;  1FXX A;  3ASM A;  1TV6 A;  1WSE A;  4AHV A;  1TAQ A;  3VA0 A;  2YV0 X;  3VQA A;  5HRN A;  2KZM A;  5KI6 A;  5T7B A;  1NOY A;  1L3T A;  4MQ3 A;  2Z1J A;  4CJP A;  4TSX A;  1S1U A;  2B5J A;  4M45 A;  1U49 A;  1FKO A;  4DSE A;  2ETJ A;  2PYJ A;  3RMB A;  4KHN A;  3DRS A;  4CK2 A;  3NE6 A;  1TKX A;  2ITG A;  2KQ2 A;  4PQU A;  2PYL A;  1HNV A;  3SQ0 A;  3IG1 A;  1NKE A;  1NJY A;  4H4O A;  4O5B A;  1B9D A;  1VSJ A;  4HCB A;  3LP2 A;  2DTU A;  3B6P A;  4CJR A;  5FRO A;  3ZSX A;  1JLQ A;  3MXJ A;  1ZBI A;  3SUQ A;  3HJF A;  3AVA A;  4E1N A;  5HRO A;  4CHZ A;  1NJZ A;  4HCC A;  1C0U A;  4FM0 A;  3ULD A;  3KLF A;  3KKR A;  3NH0 A;  3TAF A;  1WAJ A;  1VSM A;  2YHA A;  4CJV A;  3S3O A;  4I2Q A;  4OVL A;  3WNE A;  2FC0 A;  2A1S A;  3OYI A;  4CEE A;  1EKE A;  3L2W A;  3AV9 A;  4I2P A;  4NCA A;  3S3N A;  2QKB A;  3OYJ A;  1A5W A;  3AA5 X;  2G8U A;  3WNG A;  4F2S A;  2HNY A;  5K14 A;  1BI4 A;  1TK5 A;  3RTV A;  3SI6 A;  1NOZ A;  4FM1 A;  1JLF A;  2HB5 A;  4DTO A;  4DTX A;  3DLE A;  4YNQ A;  1D9F A;  1VRT A;  1WSH A;  3DRR A;  1HQE A;  3RRH A;  1LW0 A;  4DTR A;  5KTQ A;  4FCY A;  3OYM A;  1VSF A;  3VQ9 A;  3F73 A;  3V81 A;  2P51 A;  4KKO A;  3MEE A;  1TVR A;  1RBU A;  2OYQ A;  3TAQ A;  2D0B A;  4O44 A;  4B9L A;  1HRH A;  4DQP A;  4CHY A;  4BDZ A;  1RTJ A;  1JKH A;  3K5L A;  1WAF A;  3V1Q A;  2G8H A;  4LD0 A;  4Y1D A;  5FDL A;  1Q8I A;  3CG7 A;  4AHR A;  3QIN A;  3AVJ A;  4B9S A;  4CK3 A;  2IOC A;  3LAL A;  5FRM A;  2F8T A;  3LAM A;  3QEW A;  1TK0 A;  4AHS A;  3CM6 A;  1RTH A;  1RTD A;  3TR8 A;  4DTM A;  4C8K A;  2YNG A;  3T1A A;  1C1A A;  4LSL A;  4OPK A;  1RDD A;  4EZ6 A;  1U48 A;  3SPY A;  1S9G A;  4CJS A;  3V9W A;  1IO2 A;  4OGE A;  1S6Q A;  4FJX A;  2Q3S A;  3SV3 A;  4C8L A;  1QSL A;  3V9Z A;  1QTM A;  4OKE A;  1ZBU A;  3ZSW A;  4FJL A;  2GBZ A;  1RT7 A;  5JS2 A;  2W42 A;  1KTQ A;  3LP0 A;  2IGI A;  2VG5 A;  3WNH A;  3I0S A;  3V4I A;  4H8K A;  4FLU A;  3S9H A;  2BAN A;  2IS3 A;  3O3H A;  2BE2 A;  4EP4 A;  4OKK A;  4E89 A;  1NK7 A;  4B8C A;  4DLE A;  3LDS A;  2DFF A;  4DQQ A;  2Y1J A;  3K5O A;  5CYQ A;  2HVH A;  2HHS A;  3RWU A;  5J2P A;  1HQU A;  2YHB A;  4CFD A;  3I8D A;  4MFB A;  5HLF A;  4DSL A;  4FW1 A;  1RCH A;  3VQ6 A;  4DF8 A;  2RPI A;  3NHG A;  3QET A;  4LSN A;  2X6N A;  4C8M A;  1VRU A;  3CQ8 A;  1RBT A;  1S1W A;  4IFY A;  4RW9 A;  3KLG A;  3SQ1 A;  1KSP A;  1BQM A;  1HJR A;  4IG0 A;  3VQD A;  4FM2 A;  1QSS A;  3RR8 A;  2QK9 A;  4DQR A;  1FK9 A;  5JS1 A;  2HHQ A;  3KIO A;  1RT3 A;  1S6P A;  1JXE A;  3OY9 A;  3LZJ A;  4NYF A;  2QXF A;  1NK0 A;  4RW4 A;  2X74 A;  2Z1H A;  3G0Z A;  2ZD1 A;  4CGJ A;  3QIO A;  2XY7 A;  2P5O A;  3HST B;  4NYN A;  1NK8 A;  4F4K A;  4C8N A;  1DTT A;  3T3F A;  3KLH A;  4E0D A;  1QQC A;  4HVJ A;  2DFH A;  4CHP A;  2OPS A;  4HUE A;  4PA1 A;  1WSF A;  1N5Y A;  3TAP A;  2ZQB A;  3AO2 A;  3EZ5 A;  1VSH A;  1JL1 A;  2OPR A;  4KTZ A;  2OZM A;  4AHC A;  2FBT A;  4OKJ A;  1EET A;  4CEF A;  1Q9X A;  1VSL A;  2IAJ A;  5SWM A;  3TAG A;  4DWI A;  4N41 A;  4CFC A;  3ITH A;  4CEB A;  3IRX A;  2Z1G A;  4M3R A;  3ZSV A;  3QEV A;  1LW2 A;  4FW2 A;  1TL1 A;  1XC9 A;  1NK4 A;  1BIU A;  2HND A;  3DLH A;  3RR7 A;  3HPO A;  2B6A A;  3EY1 A;  3MXI A;  1SL2 A;  4CIG A;  4HUF A;  4KHY A;  4PWD A;  4OLA A;  1D8Y A;  1WSJ A;  2G8V A;  4FJ5 A;  1A5X A;  4DG1 A;  4JRP A;  2HHV A;  4Z4F A;  1JLA A;  2JLE A;  3ZSO A;  1BIS A;  5HRP A;  1NK5 A;  4C8O A;  3U3Y A;  2B4J A;  2E6M A;  3PX4 A;  3THV A;  1TK8 A;  1IKV A;  1SKS A;  4Z4G A;  3OYA A;  4HTU A;  1J53 A;  4J2B A;  4DU1 A;  4DTN A;  1LWE A;  4GVM A;  4CHQ A;  2RKI A;  3U6F A;  3K57 A;  1L5U A;  4EZ9 A;  3DI6 A;  3HP6 A;  5FRN A;  1TKT A;  2E4L A;  3HPG A;  1JLG A;  4ZHR A;  1XI1 A;  4NCB A;  4DTJ A;  1X1P A;  1C0M A;  1C0T A;  3NFA A;  4E7K A;  1HMV A;  3PO5 A;  1S1X A;  1LAV A;  4BDP A;  2HVI A;  4O0I A;  1RT5 A;  4ELT A;  3RRG A;  1F21 A;  1C6V A;  1RIL A;  1WSI A;  4HHT A;  1ITG A;  4CJK A;  4J2A A;  1J54 A;  3VQC A;  4FK0 A;  4FK2 A;  5D3G A;  5HRS A;  2D5R A;  3P5J A;  1TGO A;  4JRQ A;  4W5O A;  3SNN A;  3NGY A;  4DQI A;  1ZBF A;  2G8I A;  3ISN C;  4CJF A;  3NF7 A;  4LH5 A;  4F3T A;  2DFE A;  4CHO A;  3ZSY A;  3OYC A;  3HT3 A;  1EX4 A;  3AO5 A;  4KAZ A;  4XIU A;  1DTQ A;  5EU7 A;  1T8E A;  4CEZ A;  3VQQ A;  1QHT A;  4GMJ B;  4OGC A;  4CJU A;  5J2M A;  1JLE A;  3O4Q A;  3VQE A;  1RDB A;  3NH1 A;  3OYF A;  4CF8 A;  1QE1 A;  4B9U A;  3KLI A;  3O3G A;  3WNF A;  3SQ4 A;  1RDA A;  3HVR A;  3V9U A;  2DY4 A;  4FJK A;  4DSK A;  3C6U A;  5I42 A;  1WNS A;  3NGI A;  3ZT0 A;  2KFZ A;  4LH4 A;  4BAC A;  1W0H A;  4M3Y A;  1RBR A;  1HPZ A;  3JSM A;  3HO1 A;  3NF9 A;  4J2E A;  1NK6 A;  3AA4 A;  1Q9Y A;  2QKK A;  5CY4 A;  4FJH A;  2VG7 A;  1HNI A;  3L3V A;  3KTQ A;  1REV A;  3DOK A;  3FFI A;  3BDP A;  3O4N A;  1YT3 A;  2F96 A;  1ZBL A;  3QEI A;  1YVU A;  3V1R A;  4Z0U A;  4CJ4 A;  5CYM A;  1KVC A;  3M8Q A;  3IS9 A;  3KK2 A;  1TAU A;  1BHL A;  4NCG A;  2RN2 A;  3DMJ A;  1VSE A;  3G10 A;  3OYH A;  4CJL A;  3RMA A;  1RT6 A;  4WE1 A;  1S5J A;  4CFB A;  4OJR A;  2NUB A;  4W5R A;  3HM9 A;  3K59 A;  1GOB A;  3OYN A;  4OLB A;  2HHT A;  3LWL A;  3AA2 A;  4BE2 A;  2OZS A;  4KHS A;  4DSF A;  1KFD A;  3PO4 A;  3MAQ A;  1X9W A;  3LWM A;  4FVM A;  4R5P A;  2BGG A;  1JLB A;  2O4G A;  3DOL A;  4YFU A;  4ID1 A;  4KPY A;  3ALY A;  3AVN A;  4KI6 A;  4KI4 A;  4N76 A;  4Z4I A;  1WLJ A;  2ATQ A;  3L2Q A;  4BDY A;  2G8F A;  1CZ9 A;  1RBV A;  3NGZ A;  3AVM A;  3CFP A;  1S1T A;  1WN7 A;  5J1E A;  1U45 A;  4CEA A;  4UQG A;  3MEG A;  4KB0 A;  1G15 A;  1SV5 A;  4ELU A;  2E6L A;  3SZ2 A;  3AVI A;  3DLG A;  4RW6 A;  4CGD A;  3OYG A;  5KGX A;  3SV4 A;  4DU3 A;  3QEP A;  3TI0 A;  4M3U A;  3PY8 A;  4Z4H A;  4DF4 A;  3QER A;  4FLW A;  3TAR A;  4F3O A;  4LY7 A;  1I3A A;  4CHN A;  1X9M A;  4CGI A;  4FZZ A;  4FYD A;  2KTQ A;  3QES A;  3L3U A;  3QLH A;  4I9Q A;  1D9D A;  4FZY A;  1RDC A;  3B6O A;  4N5S A;  3TAB A;  4O4G A;  3AA3 A;  3C6T A;  1KCF A;  4E7J A;  2D0C A;  2HW3 A;  3SUN A;  3OS0 A;  1UA1 A;  1NJX A;  3MED A;  4BWM A;  1I39 A;  3D45 A;  4CER A;  1VSK A;  4CGF A;  3SQ2 A;  3NF6 A;  5DK5 A;  4FLZ A;  2OPP A;  4IBN A;  4BWJ A;  3O3F A;  1O1W A;  1Z26 A;  4CF9 A;  3LZI A;  4BE1 A;  1NKC A;  4KHU A;  1T7P A;  4M3T A;  4DTU A;  3OYD A;  4DTP A;  2Z1I A;  3V6D A;  1SL1 A;  4M3W A;  2P1J A;  4CGG A;  1B9F A;  3C94 A;  3U3G A;  3VN5 A;  1SKR A;  1L3U A;  3VQB A;  5KRS A;  1U47 A;  4FJN A;  3K5M A;  3AVF A;  1KVA A;  3ZSZ A;  4W5T A;  1CXU A;  1BL3 A;  4ICL A;  3VQ8 A;  1NJW A;  4RW8 A;  4ZTF A;  2JGU A;  4N47 A;  3SYZ A;  4FLV A;  3VQP A;  4DFJ A;  4PY5 A;  3ZSR A;  4KV8 A;  3NDK A;  4DSI A;  1UOC A;  3OS1 A;  4KHQ A;  3K5N A;  4CJ5 A;  1IKW A;  4FJG A;  3AVL A;  4FJI A;  1JLC A;  1W9H A;  3KK3 A;  2R7Y A;  3HVT A;  1X9S A;  3AO4 A;  4DS4 A;  4IG3 A;  4KFB A;  4FLY A;  3PX6 A;  3VQ4 A;  1KVB A;  1BCO A;  1RT4 A;  1ASU A;  1RT1 A;  3CM5 A;  3HXM A;  1TL3 A;  3M8P A;  3NBP A;  1EXQ A;  1CXQ A;  2FBY A;  4CJE A;  3OS2 A;  3CFR A;  4DFP A;  4M3Z A;  4QCL A;  1ASV A;  4GW6 A;  3ZT2 A;  3L2V A;  1NK9 A;  1GOC A;  1D5A A;  2IDO A;  2HHW A;  2D0A A;  1LWC A;  4JLH A;  1DLO A;  2HNZ A;  4E19 A;  5DMR A;  2YNH A;  3TAE A;  1YTU A;  4ELV A;  1FKP A;  4QAG A;  1RTI A;  3VQ5 A;  2VWJ A;  1ASW A;  4E7I A;  4DU4 A;  2XHB A;  1TKZ A;  2RF2 A;  1R0A A;  3IAY A;  3OYL A;  3OYK A; 
#chains in the Genus database with same CATH topology
 2ASO A;  3U9Z A;  3N4P A;  4CEO A;  1QS4 A;  2X6S A;  4Q0B A;  1K8A O;  4H0P A;  3FR0 A;  5AQK A;  5C42 A;  2Q97 A;  4OPH A;  2VWB A;  3KHY A;  4K8X A;  1CZB A;  4CK1 A;  3ZT3 A;  1QQM A;  5FPN A;  5C12 A;  4DR6 K;  2PFU A;  4DSJ A;  4YOT A;  3EYZ A;  4B3O A;  1XWL A;  1KFS A;  3V1O A;  4ZTJ A;  5HBM A;  2GUP A;  2ZJP L;  1MWK A;  1C1C A;  2LSN A;  3LP1 A;  3ZX3 A;  1VSI A;  5EOY A;  4FXD A;  1T03 A;  1WSG A;  1NGE A;  3OBW A;  4KHW A;  2O8B B;  3QNO A;  2Y1I A;  2HF4 A;  4DTS A;  5EVZ A;  3AVB A;  4B08 A;  3O8M A;  3AVH A;  2W40 A;  1XHX A;  3M8R A;  4FL9 A;  1QQO A;  3MWT A;  4KRF A;  3C95 A;  3VOV A;  4F2R A;  4MLE A;  4JI0 K;  2PZS A;  3SUO A;  2ZGY A;  3DXM B;  1BO5 O;  5BPL A;  1J9A A;  1YTA A;  5J2Q A;  1L3V A;  1SS6 A;  3W3D A;  1K8K A;  4FLX A;  3VEY A;  3CXC M;  3TAM A;  1UAX A;  4NXN K;  1S1V A;  1NM1 A;  1YUW A;  3ATV A;  4Z4E A;  4CFA A;  4AHT A;  1BI4 B;  5JLF A;  3NH2 A;  3L2U A;  1KLN A;  3KK7 A;  3BGR A;  2XY6 A;  4F3T A;  3QNN A;  1HNW K;  3LPT A;  4B9N A;  4NLB A;  4IOA L;  4B8A B;  1MU2 A;  1NNE A;  1Q86 O;  3D2F B;  4DMN A;  4CBW A;  4AH9 A;  5AFU H;  2WOM A;  5M1O A;  3JYT A;  4K43 A;  4V19 S;  1QSY A;  3B8A X;  1KQS M;  4QOZ B;  2F9T A;  3HYF A;  1IH7 A;  1KD1 O;  5HRR A;  2FBV A;  1HYV A;  1TKD A;  2IVN A;  4YOW A;  4BC4 A;  3IUC A;  3KD1 E;  4DQS A;  2W41 A;  4H5T A;  4FLT A;  2BUP A;  5BR8 K;  5J2N A;  4Y1C A;  4CEC A;  3RMD A;  4CJ3 A;  2KW4 A;  2XO7 A;  2HMI A;  1WSE A;  1TAQ A;  2QWR A;  4DV6 K;  5KI6 A;  4YOX A;  2Z1J A;  4CJP A;  4TSX A;  2B5J A;  4M45 A;  2PYJ A;  3DRS A;  3IG1 A;  4O5B A;  2IIR A;  4HCB A;  2FXU A;  3ZSX A;  5JVH L;  3AVA A;  4E1N A;  5HRO A;  4CHZ A;  4HCC A;  1BU6 O;  3NH0 A;  1WAJ A;  3DXK B;  2FC0 A;  4KH6 A;  3L2W A;  1YJN N;  3R1X A;  2E1Z A;  4LFC K;  3OYJ A;  1A5W A;  4H0Y B;  3RTV A;  3SI6 A;  1NOZ A;  3BY5 A;  3QML A;  1MDU B;  1E4G T;  1LOT B;  1HJO A;  5KTQ A;  2D0O A;  1VSF A;  4KKO A;  3S41 A;  3MEE A;  1RBU A;  2IVO A;  4CBX A;  4B1U B;  2NRT A;  3SMS A;  4FWN A;  4H0T B;  5BN8 A;  4JK7 A;  4BDZ A;  3K5L A;  3CG7 A;  5LL6 Z;  4B9S A;  1LCU A;  2IOC A;  4CK3 A;  2HBM A;  3QEW A;  4IFE A;  1RTH A;  1RTD A;  3T1A A;  1C1A A;  4LSL A;  4A5B A;  3CJA A;  4OPK A;  3NMU A;  4EZ6 A;  3LDP A;  1S9G A;  3TU5 A;  1IO2 A;  4OGE A;  2E2O A;  2Q3S A;  3SV3 A;  4BQZ A;  2GBZ A;  3KWI A;  4IO9 L;  1KTQ A;  3LP0 A;  1N36 K;  3S9H A;  4YY3 K;  3O3H A;  4EP4 A;  4DLE A;  4DQQ A;  2Y1J A;  3E9O A;  3K5O A;  3TSQ A;  4CD3 A;  4JKD A;  3RWU A;  4MFB A;  3ID6 A;  3VQ6 A;  2X6N A;  1S1W A;  4RW9 A;  3KLG A;  4FM2 A;  4IG0 A;  4BGB A;  3SAH A;  4DQR A;  4JI8 K;  1XNQ K;  3FZK A;  1FK9 A;  2E2N A;  4LF9 K;  1S6P A;  1JXE A;  3OY9 A;  2P9U B;  4JNE A;  4YHH K;  4CGJ A;  3QIO A;  4LC9 B;  2XY7 A;  4F4K A;  4WFA L;  4HUE A;  4JKA A;  4CZG A;  3TAP A;  2OZM A;  1JL1 A;  2OPR A;  3MK6 A;  2FBT A;  1EET A;  4CEF A;  1NGA A;  4DWI A;  3CHW A;  3ITH A;  3IRX A;  2Z1G A;  2P9I B;  1TL1 A;  3I56 N;  1BIU A;  1OH8 A;  3RR7 A;  1VAZ A;  4O5F A;  1SL2 A;  4CIG A;  4IOX A;  3CI5 A;  4X66 K;  1Q82 O;  1A5X A;  4JRP A;  4BR7 A;  4Z4F A;  2I7P A;  3THW B;  3EL2 A;  4C8O A;  3U3Y A;  3MN6 A;  2B4J A;  3THV A;  1SKS A;  5M1F A;  5TKY A;  5M1N A;  3K57 A;  4WQ4 A;  3HPG A;  3MMV A;  4B1Y B;  4ZHR A;  1C0M A;  3NFA A;  3UE5 A;  5GAE P;  1HMV A;  5AZI B;  3PO5 A;  5C2F A;  4BDP A;  4LF7 K;  1F21 A;  4H0O A;  4J2A A;  5HRS A;  2HHH K;  2D5R A;  3EN9 A;  3NGY A;  3SNN A;  2E5L K;  1RGI A;  3ID8 A;  4CJF A;  2P9K B;  3GBT A;  3NF7 A;  4IEE A;  3U4L A;  1I94 K;  4KAZ A;  3HT3 A;  1NJI O;  5EU7 A;  4CEZ A;  1QHT A;  4CJU A;  4DR3 K;  1NGJ A;  3O4Q A;  1RDB A;  5KPR A;  3CC4 N;  3SQ4 A;  1RDA A;  4DSK A;  5I42 A;  4WYB A;  5F2R A;  3ZT0 A;  2KFZ A;  4LH4 A;  4M3Y A;  3P38 A;  5CY4 A;  4NB4 A;  4H5W A;  1YT3 A;  2F96 A;  3V1R A;  4YOU A;  5CYM A;  3HOS A;  2YHX A;  4FWP A;  1BHL A;  2RN2 A;  5M1P A;  1VSE A;  4CJL A;  3KWG A;  4NO7 A;  4OJR A;  2HHT A;  4BRI A;  4KHS A;  4DSF A;  1DEJ A;  2GWK A;  4XH1 A;  1TYQ B;  3THY A;  4YFU A;  4XH5 A;  5LJW A;  2ATQ A;  3CMA N;  2G8F A;  1RBV A;  3AVM A;  4UQG A;  3MEG A;  1G15 A;  4ELU A;  3H45 C;  2W6K A;  3OYG A;  3BF1 A;  3TI0 A;  4F3O A;  3QER A;  4A2A A;  1I3A A;  1X9M A;  4CGI A;  4FYD A;  1D9D A;  4O4G A;  1KCF A;  4E7J A;  3OS0 A;  1VQM N;  4U7B A;  1VSK A;  2UUB K;  3UKU A;  1VQL N;  4KHU A;  3O3F A;  4BE1 A;  4CF9 A;  1NKC A;  4K25 A;  1T7P A;  2V52 B;  4DTP A;  3EEQ A;  2Z1I A;  3WT0 A;  4CD1 A;  3CCJ N;  3V6D A;  1SL1 A;  4M3W A;  1HUX A;  3CCS N;  4RWT A;  1L3U A;  2O8D B;  1CXU A;  3VQ8 A;  3L0Q A;  4RW8 A;  4ZTF A;  5AQV A;  3CJ7 A;  3SYZ A;  4FLV A;  4DFJ A;  2HBL A;  1UOC A;  1M1K O;  3THY B;  3K5N A;  4CJ5 A;  5JIC A;  4FVU A;  3ZLJ A;  1YJ9 N;  3HVT A;  1X9S A;  2QA4 N;  2GTD A;  2ZWH A;  4IG3 A;  3OTO K;  3VQ4 A;  1KVB A;  4PL8 A;  3CM5 A;  3VTI A;  3SV4 A;  3CFR A;  1EXQ A;  3O6W A;  4QCL A;  3OS2 A;  4BC2 A;  1Z05 A;  1X9J A;  4DFP A;  4JI1 K;  1HKG A;  4GW6 A;  4JK8 A;  2HHW A;  3J7Y P;  4JLH A;  4E19 A;  2YNH A;  1O13 A;  4E7I A;  1R0A A;  5BPM A;  3IAY A;  2WTU A;  3OYL A;  3TWH A;  2YNI A;  4JI7 K;  4FK4 A;  4DR5 K;  3QEX A;  4E1J A;  2WBN A;  4IFV A;  2YNF A;  4CF1 A;  3C6A A;  4KB1 A;  4MO5 A;  1IV0 A;  3CER A;  1SAZ A;  1NWK A;  4K41 A;  3OJU A;  2O4I A;  1XMO K;  1TUU A;  4BR4 A;  5BRH A;  1UWB A;  4N56 A;  1JJ2 M;  3AO1 A;  3M8S A;  2PBD A;  3VEZ A;  3MXM A;  3HL8 A;  3O9R A;  5AQN A;  4IKF A;  3V9X A;  2F9W A;  3T1H K;  4I7F A;  1FW6 A;  3VEN A;  5DM6 L;  3K58 A;  3SUP A;  1MA9 B;  4A2B A;  5GAD P;  3M6G A;  3H08 A;  2XRI A;  5AJ3 K;  4CE9 A;  4DKW A;  2A6A A;  4FJ8 A;  4BR9 A;  3KJV A;  1ZBH A;  2QWL A;  1IBM K;  4MO4 A;  3TSP A;  4G1Q A;  1NGC A;  5IWA K;  4JS4 A;  5AQL A;  1T3V A;  4FJJ A;  5C24 A;  5FPD A;  5AQZ A;  1NGH A;  1L3S A;  1RNH A;  1A5V A;  3LDN A;  4L8R B;  5GIN A;  4OPJ A;  1TUY A;  4FWL A;  3CC2 N;  1CLQ A;  2O8F A;  4CF2 A;  2QI2 A;  3BP8 A;  4XH4 A;  3DLR A;  3KZB A;  5AZJ A;  3N4Q A;  4WCE L;  4E7H A;  3DRP A;  1NGG A;  1IJJ A;  4KTQ A;  3P83 D;  2F8S A;  1HNZ K;  1KLM A;  3SBT A;  4PL7 A;  3D2E B;  2E88 A;  4CJT A;  1XUP O;  3DLK A;  4FJM A;  3F9M A;  1C0F A;  1BCM A;  4IEI A;  3T19 A;  2WUS A;  3EZW A;  4M41 A;  1BGX T;  3ENH A;  4DFM A;  3AVG A;  2KZZ A;  1SUQ A;  1NKB A;  3H46 O;  4AM7 A;  1T05 A;  1WB9 A;  4W5N A;  4Z4C A;  4AHU A;  1BWF O;  2Q2R A;  4B9M A;  4IOC L;  4A62 A;  3OJS A;  4I9L A;  3O80 A;  2HOE A;  3P1G A;  2P5G A;  4MLH A;  1LV5 A;  2XY8 A;  5KQ8 A;  3SCX A;  1JL2 A;  4RW7 A;  3ZT1 A;  3ZT4 A;  2H3G X;  4ILH A;  4FJ9 A;  1DT9 A;  2XY5 A;  4DV0 K;  3PV8 A;  5KQD A;  4K8Z A;  3K9K A;  4BVP A;  2E2P A;  2EWS A;  2OCE A;  3DYA A;  5AQO A;  3PUF A;  1VQK N;  3TTF A;  3T69 A;  5HL7 L;  3THX B;  3DLB A;  3KD5 E;  1S9E A;  3HZ6 A;  5JMV A;  4JV5 K;  3RR8 A;  3KKS A;  3E01 A;  5AQJ A;  2A41 A;  4AHV A;  3VA0 A;  5T7B A;  2GEL A;  1NGF A;  1NOY A;  3QFU A;  2RHK A;  1U49 A;  4DSE A;  3VER A;  4WFB L;  4PQU A;  1HNV A;  3DXM A;  3SQ0 A;  2YHW A;  4GV6 A;  4H4O A;  2GEM A;  3LP2 A;  3WQU A;  1JLQ A;  1ZBI A;  4IZ9 A;  3HJF A;  3AGR A;  1NJZ A;  2NLX A;  1C0U A;  4DR1 K;  3ULD A;  5M1K A;  3TAF A;  3S3O A;  4C23 A;  4CEE A;  3OHR A;  3AV9 A;  4I2P A;  4NCA A;  2QKB A;  2O8E B;  3AA5 X;  3WNG A;  1D4X A;  4OX9 K;  1BI4 A;  1TK5 A;  3DLL L;  3RRH A;  1LW0 A;  1WOQ A;  4FWR A;  4DTR A;  4FCY A;  3L6Q A;  3OYM A;  3VQ9 A;  2NRR A;  1S72 N;  3ZET A;  4A57 A;  4BRF A;  1OVQ A;  5AQT A;  1Q18 A;  1HRH A;  3D2F A;  4BY9 C;  5BR9 A;  5F0X A;  4DQP A;  4CHY A;  1RTJ A;  4HTL A;  3JAM O;  5FDL A;  1Q8I A;  4G9Z A;  3QIN A;  3VGM A;  4JKC A;  4FOE A;  5FRM A;  1ZXO A;  3LAM A;  3SAF A;  2PAV A;  2E2Q A;  1ZBS A;  1U48 A;  3T1Y K;  1S6Q A;  4C8L A;  1QSL A;  1ZBU A;  3ZSW A;  3MX5 A;  4FJL A;  1BUP A;  2O8C B;  1RT7 A;  2W42 A;  3V4I A;  3MWP A;  3WNH A;  3I0S A;  4H8K A;  4JKF A;  3O9T A;  3CCR N;  1NK7 A;  4OKK A;  4KH4 A;  4B8C A;  2F4V K;  5CYQ A;  4B3M K;  2HHS A;  1HQU A;  2YHB A;  4CFD A;  5HLF A;  4DF8 A;  3NHG A;  4B1W B;  3CQ8 A;  1RBT A;  1RDU A;  3DAW A;  4DV4 K;  1KSP A;  1BQM A;  3VQD A;  1QSS A;  2GWJ A;  1HX1 A;  2VGN A;  2IVP A;  4BQL A;  2HHQ A;  3BEX A;  1RT3 A;  1GLD G;  3DXK A;  3LZJ A;  2Z1H A;  3ZET B;  2ZD1 A;  3CJB A;  3T3F A;  3KLH A;  4ISF A;  4HVJ A;  4CHP A;  1K73 O;  1WSF A;  3CJ1 A;  1OH7 A;  1MWM A;  3AO2 A;  1VSH A;  4KTZ A;  1E3M A;  4JD2 A;  5SWM A;  3ZX2 A;  4CZF A;  3TAG A;  4CFC A;  3ZSV A;  3U9D A;  4FW2 A;  3FZL A;  3OA9 A;  1NK4 A;  4YDU A;  1J5E K;  3R3L A;  1RFQ A;  4HUF A;  1N34 K;  5AQQ A;  2HHV A;  2JLE A;  5ADX H;  1BIS A;  5HRP A;  2E20 A;  1NK5 A;  2D1K A;  1EWQ A;  2FF6 A;  2OTL N;  4Z4G A;  4LF5 K;  5C10 A;  4HTU A;  1J53 A;  4IJN A;  1U2V B;  4DU1 A;  2BTF A;  2P9P B;  3DI6 A;  4GKJ K;  1JLG A;  4NCB A;  4BRL A;  5LJV A;  4E7K A;  3RRG A;  4DV1 K;  1C6V A;  5CE3 A;  4FK2 A;  4CJK A;  4DCH A;  2A42 A;  2G8I A;  4DQI A;  5BRE A;  3ISN C;  4DUZ K;  4LH5 A;  2DFE A;  1KAY A;  4CHO A;  3ZSY A;  1YIT N;  3ZYY X;  1T8E A;  3VQQ A;  4JD2 B;  4HWI A;  4KBO A;  5J2M A;  4BRP A;  3J7Z O;  3KLI A;  3O3G A;  3V9U A;  2DY4 A;  4FJK A;  4JHD B;  4GVE A;  3LM9 A;  2P9U A;  4WQ5 A;  5CHI A;  4CZL A;  1RBR A;  4PKG A;  1SZ2 A;  2QKK A;  4FJH A;  5CR4 A;  1J6Z A;  2VG7 A;  3UKR B;  3F2K A;  3DOK A;  3FFI A;  3CPW M;  4Z0U A;  4CJ4 A;  4OPA A;  1KVC A;  3MCP A;  3M8Q A;  3KK2 A;  2P9I A;  3OYH A;  1RT6 A;  4CFB A;  1S5J A;  4W5R A;  3HM9 A;  4KHN A;  1GOB A;  2E8A A;  4YOR A;  3UB5 A;  4IJA A;  3SBG A;  1E4F T;  2D0P A;  4BE2 A;  3PO4 A;  1KFD A;  2OZS A;  3QIC A;  5HOO A;  4FVM A;  3T7Z A;  2QTD A;  4ID1 A;  3THW A;  3ALY A;  3A8Y A;  1WLJ A;  1GLJ O;  4FPA A;  2JWL A;  1S1T A;  1WN7 A;  4O8U A;  3CJC A;  1JCF A;  2P9L B;  1KXP A;  2QW9 A;  2ZJR L;  5KGX A;  4FWK A;  4M3U A;  1YF5 L;  3LM2 A;  5AQU A;  3QLH A;  3H6E A;  3VEO A;  4N5S A;  3AA3 A;  5AZI A;  2HW3 A;  2Q0R A;  4DV2 K;  3SUN A;  1ATN A;  3D45 A;  4AM6 A;  4CGF A;  3SQ2 A;  1YHQ N;  5DK5 A;  4IBN A;  4BWJ A;  1Z26 A;  4M3T A;  2P9K A;  1KAX A;  4WFN L;  2WC9 A;  3CCM N;  1SKR A;  3VN5 A;  5KRS A;  3AVF A;  3ZSZ A;  2JGU A;  2QWO A;  3EKS A;  4J8F A;  3ZSR A;  3QBW A;  4FWO A;  4DSI A;  2HMP A;  4WQ4 C;  3O08 A;  1JLC A;  3KK3 A;  1OH6 A;  3CC7 N;  3QDK A;  3AO4 A;  2ZM6 K;  3LDL A;  4DS4 A;  3PX6 A;  2ASP A;  3FFK B;  1RT4 A;  1BCO A;  3M8P A;  1CXQ A;  2FBY A;  3AY9 A;  5BPN A;  4I6M A;  5M1Q A;  3ULE B;  3ZT2 A;  1DGK N;  1GOC A;  1Q81 O;  2D0A A;  1LWC A;  2HNZ A;  1TYQ A;  1FKP A;  4BR0 A;  4CZM A;  2VWJ A;  2NRZ A;  1TKZ A;  3OYK A;  3S3M A;  3L2R A;  2HHX A;  4H5V A;  2V7Z A;  2CGJ A;  2G8K A;  5EXW A;  4AIL C;  3RSE A;  2HBK A;  4YOY A;  2QEX N;  5I3U A;  1Y97 A;  1IKY A;  4M7Y A;  4BRG A;  1C0G A;  4CGH A;  3PX0 A;  5HP1 A;  3NF8 A;  3VEX A;  2VG6 A;  4L3Q A;  1VQ5 N;  1VHX A;  3AO3 A;  3VF2 A;  1RT2 A;  4HUG A;  1LWF A;  2EX3 A;  3HPH A;  3HOT A;  5C25 A;  5A2Q O;  2O8D A;  1VQ6 N;  4O8K A;  4CBU A;  1C1B A;  4BRN A;  2Q1N A;  4KH5 A;  4EHT A;  3DJC A;  4B1Z A;  3OW2 M;  5C0Y A;  3VQ7 A;  1IBK K;  3E9P A;  2NRV A;  2KKZ A;  4BGA A;  4H5N A;  4JKG B;  4I6M B;  3NVM A;  1VK0 A;  2AJQ A;  4RG8 A;  4ID5 A;  3AVK A;  4O0J A;  5F1X A;  5B8H A;  4IWV A;  4CZJ A;  1YVN A;  5AQI A;  3PLA A;  3HK2 A;  3WQT A;  3M3Z A;  1HYZ A;  3CME N;  4DFK A;  3AVC A;  4JYA K;  1EO1 A;  3CF5 L;  1LAW A;  4B9V A;  2BDP A;  2Q0U A;  3GE1 A;  3WXJ A;  5IT9 O;  1BIZ A;  3M1F A;  3RSE B;  4B1X B;  4M42 A;  4CIE A;  2YKN A;  3LDQ A;  5FPM A;  4CJ7 A;  2ZE2 A;  2VWK A;  2EHG A;  2FBX A;  3Q7B A;  4CF0 A;  3OYE A;  3L8B A;  2FSJ A;  3V9S A;  1M90 O;  1KRP A;  4A61 A;  1YXQ A;  4FZX C;  1HYS A;  4MDB A;  3FLC O;  3ENB A;  4BRC A;  4JS5 A;  1XHZ A;  3NAE A;  4FWS A;  3DM2 A;  3RMC A;  3G25 A;  1J5O A;  4DUY K;  4E7L A;  3LP3 A;  2QM1 A;  2GV9 A;  2WON A;  2NRW A;  2IC3 A;  4B3S K;  3CFO A;  2VYP A;  4Z94 A;  2HHU A;  2YKM A;  1RBS A;  4LFA K;  4CJQ A;  1T6D A;  3ZEU B;  1QQN A;  4JK9 A;  3SAG A;  3TAN A;  3E9L A;  4PKI A;  5I9E B;  3OYB A;  3QIP A;  2YJF A;  1IKX A;  3HP9 A;  4CZI A;  1N6Q A;  4KO0 A;  1KAZ A;  3O9Q A;  4CCH A;  3CYM A;  3A2F A;  5GAH P;  3SK3 A;  3SPZ A;  2I7N A;  1FXX A;  3ASM A;  1TV6 A;  1ATS A;  4K0K K;  4CZH A;  2KZM A;  3GOI A;  3O1B A;  4MQ3 A;  1DKG D;  1S1U A;  1FKO A;  2PYL A;  1NJY A;  2DTU A;  4CJR A;  5FRO A;  3O9U A;  3W0L A;  3MXJ A;  3D2E A;  1HKB A;  3A5N C;  4GKK K;  2ZJQ L;  4M63 C;  4JKH A;  4CJV A;  4B9Q A;  2ZF5 O;  1T6C A;  4I2Q A;  3OYI A;  5LMU K;  1EKE A;  5AQW A;  3S3N A;  5TKW A;  3JS6 A;  2NNW A;  4BRD A;  2HNY A;  3WEE B;  1W2B M;  2HB5 A;  3DLE A;  1D9F A;  1WSH A;  3DRR A;  2WFB A;  2P51 A;  5JLH A;  1TVR A;  4RTF D;  1Z6R A;  3G4S N;  2D0B A;  4O44 A;  2P9S B;  4XEI A;  1HKC A;  2G8H A;  1JKH A;  4LD0 A;  4AHR A;  4X65 K;  4LF8 K;  3AVJ A;  5C15 A;  4H03 B;  3LAL A;  4AHS A;  3CM6 A;  4CZK A;  3TR8 A;  4C8K A;  2YNG A;  1V4S A;  1NGD A;  4A59 A;  5AR0 A;  1JCG A;  3E66 A;  2QWM A;  3SPY A;  4FJX A;  3THX A;  3HTV A;  1QTM A;  1ZC6 A;  4OKE A;  2E1Y A;  3CPE A;  4QS7 A;  1YIJ N;  3MDQ A;  1NU0 A;  5JS2 A;  2VG5 A;  4FLU A;  2BAN A;  3G71 N;  3IFR A;  2BE2 A;  4DHY A;  3LDS A;  2Q36 A;  5EX5 A;  5AFU A;  2HVH A;  3ENO A;  3R8E A;  4FW1 A;  1RCH A;  2RPI A;  3QET A;  1X3N A;  4LSN A;  1BA1 A;  4IFY A;  1VQP N;  2QK9 A;  5BRD A;  3I55 N;  4IXC A;  2FF3 B;  1T44 A;  4CW7 B;  5GAG P;  4H5R A;  3KIO A;  4C1N I;  1NK0 A;  2X74 A;  3G0Z A;  2YI1 A;  3HST B;  4NYN A;  1NK8 A;  2O8E A;  1DTT A;  4E0D A;  3PSF A;  1QQC A;  1W7A A;  2OPS A;  4PA1 A;  2ZQB A;  4JKE A;  4OKJ A;  4EAH D;  1Q9X A;  3MN9 A;  1VSL A;  2AA4 A;  1NGI A;  3QFP A;  4M3R A;  5FLX O;  4JKB A;  4JEP A;  2HND A;  3DLH A;  1GLB G;  3MXI A;  4JI2 K;  1GLE G;  3TTD A;  4PWD A;  4GY2 B;  1WSJ A;  2G8V A;  4FJ5 A;  4CI6 A;  4DG1 A;  3ZSO A;  3O9S A;  3QB0 A;  4ILJ A;  4JI3 K;  2VCP A;  3HM8 A;  2E6M A;  3PX4 A;  3O1W A;  1IKV A;  3C7N B;  2ITM A;  2V7Y A;  1LWE A;  4GVM A;  4CHQ A;  2RKI A;  5JVG L;  4DTN A;  3U6F A;  4EZ9 A;  1TKT A;  3TTC A;  1WBD A;  3VES A;  4DTJ A;  1X1P A;  1C0T A;  2DPN A;  5LY3 A;  3F5T A;  1S3X A;  2O8C A;  1S1X A;  3JXU A;  1LAV A;  4B3R K;  2HVI A;  1RT5 A;  4ELT A;  1RIL A;  1WSI A;  2P9N B;  4HHT A;  1ITG A;  3Q7C A;  1J54 A;  5D3G A;  4U67 L;  3P5J A;  1TGO A;  4W5O A;  1ZBF A;  4QS8 A;  3D7E O;  3OYC A;  3H1V X;  4DV5 K;  4XIU A;  3WXI A;  4OGC A;  3VQE A;  1VQ8 N;  2VQE K;  3VEW A;  4B9U A;  1QE1 A;  3GL1 A;  5E26 A;  3C6U A;  1P90 A;  1WNS A;  4DQ8 A;  2F7T A;  4A5A A;  4BAC A;  2YCH A;  4FOI A;  1HPZ A;  4PKH A;  3AA4 A;  5MLC Q;  1Q9Y A;  1NBW A;  4H0X B;  4OO1 J;  3KTQ A;  1H1V A;  4UY8 O;  4PHT X;  3O4N A;  1FJG K;  1QVG M;  1S22 A;  3DMJ A;  4DV7 K;  3RMA A;  4WE1 A;  3VPZ A;  3OYN A;  4OLB A;  3LWL A;  1GLA G;  5AQM A;  4BRQ A;  3MAQ A;  2UUC K;  1X9W A;  3LWM A;  2CGL A;  2BGG A;  1JLB A;  4KI4 A;  3AVN A;  4KI6 A;  4Z4I A;  3TSU A;  4BDY A;  1BG3 A;  4FWQ A;  3NGZ A;  5J1E A;  1U45 A;  4CEA A;  1U2V A;  3E1Y A;  4KB0 A;  2E6L A;  2P9P A;  1XMQ K;  4AQY K;  4Z4H A;  3TAR A;  3C65 A;  4LY7 A;  4CHN A;  2KTQ A;  3AAQ A;  3L3U A;  5AQP A;  4I9Q A;  3TAB A;  3C6T A;  2HBJ A;  2D0C A;  1NMD A;  1NJX A;  2CGK A;  4BWM A;  4CER A;  4FLZ A;  1W97 L;  3BF3 A;  1O1W A;  3LZI A;  4YDU C;  4DTU A;  1B9F A;  3PIP L;  3AAP A;  3H3O B;  1WUA A;  4W5T A;  2RE2 A;  1BL3 A;  4ICL A;  3MN7 A;  4JHD A;  4X62 K;  4N47 A;  4IDH A;  3VQP A;  2UUA K;  4BR5 A;  3PIO L;  3NDK A;  1XQS C;  2QWN A;  4KHQ A;  3BUZ B;  3UKR A;  3K0S A;  4FJG A;  3AVL A;  4FJI A;  1W9H A;  3LDO A;  4LF6 K;  2R7Y A;  1NGB A;  1GLL O;  4FLY A;  3A5L C;  1RT1 A;  1ESV A;  5AQG A;  3HXM A;  3OBY A;  2Q31 A;  1NK9 A;  1D5A A;  3ATU A;  3R6M A;  1DLO A;  1YTU A;  1K8K B;  3AAR A;  3U8X A;  2XHB A;  5KPZ A;  3VF4 A;  4BVO A;  1ILY A;  5SZT A;  5E41 A;  4KTW A;  2P9L A;  4WQ5 C;  4FJ7 A;  3NCI A;  3AGK A;  3BZK A;  1SL0 A;  3KK1 A;  1XNR K;  2A1R A;  2KHO A;  4M3X A;  4CEQ A;  4F8R A;  1EP4 A;  4CJW A;  1G99 A;  4Q5V A;  3WXK A;  3CCL N;  4BRM A;  3FZH A;  3K9J A;  3VGK A;  1GLF O;  3MN5 A;  1U4B A;  2I5J A;  3EO3 A;  3LAK A;  1OKJ A;  2ASM A;  3SJJ A;  1UA0 A;  3UIQ A;  1XC3 A;  4DLG A;  1N32 K;  3I0R A;  1R59 O;  4KRE A;  4R79 A;  4H4M A;  4DS5 A;  1U04 A;  4O55 A;  3QO9 A;  4BG9 A;  1EQY A;  3MEC A;  3J81 O;  4E3S A;  1VQN N;  3FGU A;  4CED A;  2QXL A;  3KLE A;  3TPQ A;  4BE0 A;  2G8W A;  2QWQ A;  4KHP K;  3ULE A;  4IDK A;  1B92 A;  3LPU A;  4BRE A;  1ZYQ A;  1GOA A;  5KRT A;  4GV9 A;  5AQF A;  1JXB A;  1Q7Y O;  3EE8 A;  1HR0 K;  4EFH A;  2KFN A;  3I8B A;  4PUO A;  2X78 A;  2PY5 A;  3C6H A;  4B9T A;  3H3N O;  3J7A P;  2GUI A;  2OPQ A;  3VA3 A;  3CET A;  3K2P A;  4BC3 A;  2W6L A;  3L4Q A;  1IG9 A;  1BQN A;  3OVN A;  5KGW A;  4ILG B;  1Z25 A;  4DB3 A;  2CH5 A;  3CCV N;  1Y64 A;  3MX2 A;  4EP5 A;  4JI5 K;  2OA8 A;  3SJH A;  1QHA A;  4GNI A;  3HBT A;  3ZCM A;  1SKW A;  3LL3 A;  4JI4 K;  3EE9 A;  4CIF A;  4FWM A;  1YAG A;  2UXC K;  3D0P A;  5CZ2 A;  5CZ1 A;  2UYT A;  3VTH A;  5AQY A;  4J2D A;  1VSD A;  4CES A;  3ZSQ A;  4W5Q A;  4JKG A;  4DR7 K;  2OAN A;  1OH5 A;  3F9K A;  3VEV A;  3NVK A;  4N41 A;  1K6Y A;  4E1M A;  3LAN A;  2YX6 A;  2V51 B;  2YV0 X;  3VQA A;  5HRN A;  1L3T A;  3SMP A;  3GG4 A;  2ETJ A;  3L4I A;  3RMB A;  4CK2 A;  3NE6 A;  1TKX A;  2ITG A;  2KQ2 A;  3CCE N;  1NKE A;  1B9D A;  1VSJ A;  2UU9 K;  3B6P A;  3M5R A;  2FSK A;  3SUQ A;  1N33 K;  4FM0 A;  3KLF A;  3KKR A;  3VF6 A;  1K9M O;  4C1N K;  1VSM A;  2A5X A;  2YHA A;  3QBX A;  1YJW N;  4OVL A;  3WNE A;  2A1S A;  2OTJ N;  1CZA N;  1BDG A;  5AQS A;  2G8U A;  4CZE A;  4H0V B;  3A5O C;  4F2S A;  1VQO N;  5K14 A;  4B1V A;  3WUH A;  3KVG A;  1YI2 N;  3EKU A;  4FM1 A;  1JLF A;  4DTO A;  4BRO A;  3J8A A;  4YNQ A;  4DTX A;  1VRT A;  1HQE A;  4DR2 K;  3F73 A;  3V81 A;  4B3T K;  4NLC A;  2OYQ A;  1NLV A;  3TAQ A;  4B9L A;  1WAF A;  3V1Q A;  5E84 A;  3CIP A;  4Y1D A;  1BA0 A;  5AQX A;  3ZEU A;  1HPM A;  2F8T A;  1TK0 A;  1VQ4 N;  5C2D A;  4DTM A;  1RDD A;  3VET A;  4CJS A;  3V9W A;  3IMX A;  4DV3 K;  3FE1 A;  3V9Z A;  3A5M C;  2HF3 A;  4M7X A;  1SQK A;  4JN4 A;  5KPT A;  2IGI A;  3GDQ A;  5AQH A;  2IS3 A;  4QS9 A;  1QZ6 A;  3FZM A;  1OVY A;  4E89 A;  3P4I A;  3P31 A;  2DFF A;  5H1S Q;  4F9O A;  5J2P A;  4DSL A;  3I8D A;  5GIO A;  4C8M A;  3SQ1 A;  1VRU A;  1HJR A;  3R9P A;  4EHU A;  5JS1 A;  4MDA A;  4IO8 A;  4NYF A;  3SLC A;  2QXF A;  1IBL K;  4RW4 A;  3A0I X;  4DR4 K;  2HST A;  2P5O A;  2GX9 A;  4C8N A;  2DFH A;  3WXM B;  2AP1 A;  4ELV A;  1N5Y A;  3WEE A;  2YJE A;  3EZ5 A;  4AHC A;  1QZ5 A;  2IAJ A;  2FSN A;  4CEB A;  1N8R O;  3QEV A;  3MCA B;  4NXM K;  1LW2 A;  1XC9 A;  1NG9 A;  1HNX K;  3HPO A;  2B6A A;  3EY1 A;  1BOT O;  1ATR A;  3CCU N;  2P9S A;  4KHY A;  1D8Y A;  5LMN K;  4OLA A;  3IDH A;  4YOV A;  3O5B A;  3C0B A;  1JLA A;  1TK8 A;  1IG8 A;  3OYA A;  5GIP A;  4J2B A;  4EIA A;  4FO0 A;  1L5U A;  2BH1 A;  4BG8 A;  5FRN A;  3HP6 A;  2KLA A;  4X64 K;  5DM7 L;  2UXB K;  2E4L A;  1XI1 A;  4CVN E;  3BZC A;  2QWP A;  3HRG A;  1HLU A;  4BRA A;  4O0I A;  2D4W A;  3VQC A;  4FK0 A;  3UKU B;  3HSC A;  4JRQ A;  5BRF A;  4ISG A;  3CCQ N;  3FZF A;  1EX4 A;  3AO5 A;  1DTQ A;  3CQY A;  1JCE A;  2NRX A;  4GMJ B;  5BN9 A;  4LFB K;  1JLE A;  3NH1 A;  2VQF K;  1U6Z A;  2YHY A;  3OYF A;  4CF8 A;  3WNF A;  3HVR A;  3NGI A;  4LF4 K;  1W0H A;  3HO1 A;  3I33 A;  3JSM A;  3NF9 A;  4J2E A;  2JWK A;  1NK6 A;  1QVF M;  1HNI A;  3L3V A;  3J80 O;  1EWR A;  1REV A;  2J4R A;  3BDP A;  1ZBL A;  3IKM A;  3QEI A;  1YVU A;  2A3Z A;  2CH6 A;  2ZGZ A;  4BR2 A;  2NRH A;  3IS9 A;  1TAU A;  4NCG A;  3VGL A;  3G10 A;  4RCH A;  2FLO A;  3H1Q A;  1KC8 O;  2NUB A;  3K59 A;  3AA2 A;  3CD6 N;  4R5P A;  2O4G A;  5ELZ A;  3DOL A;  4KPY A;  1V4T A;  4N76 A;  3L2Q A;  3CJ9 A;  1CZ9 A;  3CQX A;  4GV3 A;  4ISE A;  3CFP A;  3C7N A;  1SV5 A;  3SZ2 A;  3HI0 A;  3AVI A;  3DLG A;  4RW6 A;  4CGD A;  4DU3 A;  3QEP A;  1VQ9 N;  3PY8 A;  4DF4 A;  4FLW A;  4FZZ A;  4JAX A;  3QES A;  4FZY A;  1RDC A;  3B6O A;  4BC5 A;  1WBB A;  5EY4 A;  1UA1 A;  1RDW X;  3MED A;  2UXD K;  1I39 A;  2P9N A;  3D6R A;  3NF6 A;  2OPP A;  4JI6 K;  3G6E N;  5ADX A;  3OYD A;  4FSV A;  2P1J A;  4CGG A;  3C94 A;  3U3G A;  4FJN A;  3VQB A;  3DWL A;  1U47 A;  3K5M A;  4AF1 A;  1KVA A;  5FPE A;  1NMN A;  1NJW A;  3WXL A;  3ZX0 A;  1VQ7 N;  4Y0W A;  4BRK A;  3O4W A;  4PY5 A;  5AQR A;  4KV8 A;  2A40 A;  1GLC G;  3OS1 A;  1IKW A;  3VMF B;  2O8F B;  2VGM A;  5AZJ B;  2NZT A;  4KFB A;  2O8B A;  1ASU A;  1TL3 A;  3NBP A;  4CJE A;  4M3Z A;  3PSI A;  1X3M A;  1ASV A;  3L2V A;  4FPB A;  1P8Z A;  2IDO A;  4K42 A;  4WF9 L;  4BRH A;  5DMR A;  3TAE A;  4QAG A;  1RTI A;  3VQ5 A;  3RVC A;  1ASW A;  3P39 A;  4DU4 A;  2RF2 A; 
#chains in the Genus database with same CATH homology
 3TWH A;  2YNI A;  3L2R A;  3S3M A;  4FK4 A;  3QEX A;  5SZT A;  2HHX A;  5E41 A;  4KTW A;  4CEO A;  1QS4 A;  2G8K A;  4FJ7 A;  4IFV A;  2YNF A;  2X6S A;  4CF1 A;  3NCI A;  4Q0B A;  4KB1 A;  4AIL C;  5C42 A;  3OJU A;  2O4I A;  1SL0 A;  3KK1 A;  4K8X A;  1CZB A;  4CK1 A;  1Y97 A;  5I3U A;  2A1R A;  3ZT3 A;  1UWB A;  1IKY A;  4N56 A;  4M3X A;  4CGH A;  4DSJ A;  3PX0 A;  4CEQ A;  3AO1 A;  5HP1 A;  3NF8 A;  3M8S A;  3MXM A;  3HL8 A;  2VG6 A;  3EYZ A;  4F8R A;  4IKF A;  4B3O A;  3AO3 A;  1EP4 A;  1XWL A;  3V9X A;  1RT2 A;  4CJW A;  1KFS A;  4HUG A;  3V1O A;  1LWF A;  2EX3 A;  4ZTJ A;  5HBM A;  3HPH A;  4I7F A;  4Q5V A;  3K58 A;  3SUP A;  5C25 A;  1C1C A;  1U4B A;  2I5J A;  2LSN A;  1C1B A;  1VSI A;  3LAK A;  3LP1 A;  4FXD A;  3H08 A;  2XRI A;  1WSG A;  3SJJ A;  1UA0 A;  1T03 A;  4CE9 A;  3UIQ A;  4FJ8 A;  4KHW A;  4DLG A;  3QNO A;  3VQ7 A;  3I0R A;  3KJV A;  4KRE A;  2Y1I A;  1ZBH A;  4DTS A;  1VK0 A;  4H4M A;  4G1Q A;  4RG8 A;  4DS5 A;  1U04 A;  2AJQ A;  3AVB A;  4ID5 A;  4O55 A;  3AVK A;  4B08 A;  4JS4 A;  4FJJ A;  4O0J A;  3QO9 A;  3AVH A;  5C24 A;  1XHX A;  3M8R A;  3MEC A;  4E3S A;  1L3S A;  1RNH A;  1A5V A;  4L8R B;  4OPJ A;  3HK2 A;  4CED A;  1CLQ A;  4KRF A;  4CF2 A;  3C95 A;  1HYZ A;  3DLR A;  4DFK A;  3AVC A;  3KLE A;  4F2R A;  4E7H A;  1LAW A;  4B9V A;  3DRP A;  2PZS A;  4KTQ A;  3P83 D;  3SUO A;  2F8S A;  4BE0 A;  2BDP A;  2G8W A;  1KLM A;  1BIZ A;  4IDK A;  1B92 A;  3LPU A;  4M42 A;  1ZYQ A;  1J9A A;  1GOA A;  4CJT A;  1YTA A;  4CIE A;  2YKN A;  5KRT A;  5J2Q A;  3DLK A;  1L3V A;  4FJM A;  1BCM A;  1JXB A;  3T19 A;  2ZE2 A;  4FLX A;  2VWK A;  2EHG A;  2FBX A;  4M41 A;  3TAM A;  2KFN A;  4CF0 A;  1UAX A;  4PUO A;  1S1V A;  1BGX T;  2X78 A;  2PY5 A;  3OYE A;  3L8B A;  4CFA A;  3V9S A;  4B9T A;  4Z4E A;  4AHT A;  1KRP A;  1BI4 B;  2GUI A;  3NH2 A;  2OPQ A;  4DFM A;  3L2U A;  3VA3 A;  3AVG A;  4FZX C;  1SUQ A;  1NKB A;  1KLN A;  1HYS A;  2KZZ A;  3K2P A;  1T05 A;  1IG9 A;  4W5N A;  3BGR A;  2XY6 A;  4Z4C A;  4JS5 A;  1XHZ A;  3NAE A;  4AHU A;  3QNN A;  1BQN A;  3DM2 A;  3RMC A;  3LPT A;  3OVN A;  5KGW A;  1J5O A;  4B9N A;  1Z25 A;  4B9M A;  4E7L A;  4EP5 A;  3LP3 A;  4B8A B;  3OJS A;  2GV9 A;  4I9L A;  2WON A;  2OA8 A;  3P1G A;  1MU2 A;  2IC3 A;  3CFO A;  2P5G A;  3ZCM A;  4DMN A;  1LV5 A;  1SKW A;  2XY8 A;  4AH9 A;  3SCX A;  2HHU A;  1JL2 A;  4RW7 A;  3ZT1 A;  2YKM A;  3ZT4 A;  2WOM A;  1RBS A;  4CIF A;  4FJ9 A;  4CJQ A;  3JYT A;  2XY5 A;  3PV8 A;  3D0P A;  1QSY A;  5CZ2 A;  5CZ1 A;  4K8Z A;  4QOZ B;  3TAN A;  3HYF A;  1IH7 A;  5HRR A;  2FBV A;  3OYB A;  1HYV A;  3QIP A;  1TKD A;  3DYA A;  4J2D A;  1VSD A;  4CES A;  3ZSQ A;  4W5Q A;  3PUF A;  3KD1 E;  1IKX A;  4DQS A;  3HP9 A;  4FLT A;  1N6Q A;  4KO0 A;  3DLB A;  3KD5 E;  1S9E A;  3F9K A;  5J2N A;  4CCH A;  3CYM A;  3A2F A;  4Y1C A;  4CEC A;  4CJ3 A;  1K6Y A;  3KKS A;  4E1M A;  2KW4 A;  3RMD A;  3LAN A;  3SPZ A;  3E01 A;  2XO7 A;  2HMI A;  1FXX A;  3ASM A;  1TV6 A;  1WSE A;  4AHV A;  1TAQ A;  3VA0 A;  2YV0 X;  3VQA A;  5HRN A;  2KZM A;  5KI6 A;  5T7B A;  1NOY A;  1L3T A;  4MQ3 A;  2Z1J A;  4CJP A;  4TSX A;  1S1U A;  2B5J A;  4M45 A;  1U49 A;  1FKO A;  4DSE A;  2ETJ A;  2PYJ A;  3RMB A;  4KHN A;  3DRS A;  4CK2 A;  3NE6 A;  1TKX A;  2ITG A;  2KQ2 A;  4PQU A;  2PYL A;  1HNV A;  3SQ0 A;  3IG1 A;  1NKE A;  1NJY A;  4H4O A;  4O5B A;  1B9D A;  1VSJ A;  4HCB A;  3LP2 A;  2DTU A;  3B6P A;  4CJR A;  5FRO A;  3ZSX A;  1JLQ A;  3MXJ A;  1ZBI A;  3SUQ A;  3HJF A;  3AVA A;  4E1N A;  5HRO A;  4CHZ A;  1NJZ A;  4HCC A;  1C0U A;  4FM0 A;  3ULD A;  3KLF A;  3KKR A;  3NH0 A;  3TAF A;  1WAJ A;  1VSM A;  2YHA A;  4CJV A;  3S3O A;  4I2Q A;  4OVL A;  3WNE A;  2FC0 A;  2A1S A;  3OYI A;  4CEE A;  1EKE A;  3L2W A;  3AV9 A;  4I2P A;  4NCA A;  3S3N A;  2QKB A;  3OYJ A;  1A5W A;  3AA5 X;  2G8U A;  3WNG A;  4F2S A;  2HNY A;  5K14 A;  1BI4 A;  1TK5 A;  3RTV A;  3SI6 A;  1NOZ A;  4FM1 A;  1JLF A;  2HB5 A;  4DTO A;  4DTX A;  3DLE A;  4YNQ A;  1D9F A;  1VRT A;  1WSH A;  3DRR A;  1HQE A;  3RRH A;  1LW0 A;  4DTR A;  5KTQ A;  4FCY A;  3OYM A;  1VSF A;  3VQ9 A;  3F73 A;  3V81 A;  2P51 A;  4KKO A;  3MEE A;  1TVR A;  1RBU A;  2OYQ A;  3TAQ A;  2D0B A;  4O44 A;  4B9L A;  1HRH A;  4DQP A;  4CHY A;  4BDZ A;  1RTJ A;  1JKH A;  3K5L A;  1WAF A;  3V1Q A;  2G8H A;  4LD0 A;  4Y1D A;  5FDL A;  1Q8I A;  3CG7 A;  4AHR A;  3QIN A;  3AVJ A;  4B9S A;  4CK3 A;  2IOC A;  3LAL A;  5FRM A;  2F8T A;  3LAM A;  3QEW A;  1TK0 A;  4AHS A;  3CM6 A;  1RTH A;  1RTD A;  3TR8 A;  4DTM A;  4C8K A;  2YNG A;  3T1A A;  1C1A A;  4LSL A;  4OPK A;  1RDD A;  4EZ6 A;  1U48 A;  3SPY A;  1S9G A;  4CJS A;  3V9W A;  1IO2 A;  4OGE A;  1S6Q A;  4FJX A;  2Q3S A;  3SV3 A;  4C8L A;  1QSL A;  3V9Z A;  1QTM A;  4OKE A;  1ZBU A;  3ZSW A;  4FJL A;  2GBZ A;  1RT7 A;  5JS2 A;  2W42 A;  1KTQ A;  3LP0 A;  2IGI A;  2VG5 A;  3WNH A;  3I0S A;  3V4I A;  4H8K A;  4FLU A;  3S9H A;  2BAN A;  2IS3 A;  3O3H A;  2BE2 A;  4EP4 A;  4OKK A;  4E89 A;  1NK7 A;  4B8C A;  4DLE A;  3LDS A;  2DFF A;  4DQQ A;  2Y1J A;  3K5O A;  5CYQ A;  2HVH A;  2HHS A;  3RWU A;  5J2P A;  1HQU A;  2YHB A;  4CFD A;  3I8D A;  4MFB A;  5HLF A;  4DSL A;  4FW1 A;  1RCH A;  3VQ6 A;  4DF8 A;  2RPI A;  3NHG A;  3QET A;  4LSN A;  2X6N A;  4C8M A;  1VRU A;  3CQ8 A;  1RBT A;  1S1W A;  4IFY A;  4RW9 A;  3KLG A;  3SQ1 A;  1KSP A;  1BQM A;  1HJR A;  4IG0 A;  3VQD A;  4FM2 A;  1QSS A;  3RR8 A;  2QK9 A;  4DQR A;  1FK9 A;  5JS1 A;  2HHQ A;  3KIO A;  1RT3 A;  1S6P A;  1JXE A;  3OY9 A;  3LZJ A;  4NYF A;  2QXF A;  1NK0 A;  4RW4 A;  2X74 A;  2Z1H A;  3G0Z A;  2ZD1 A;  4CGJ A;  3QIO A;  2XY7 A;  2P5O A;  3HST B;  4NYN A;  1NK8 A;  4F4K A;  4C8N A;  1DTT A;  3T3F A;  3KLH A;  4E0D A;  1QQC A;  4HVJ A;  2DFH A;  4CHP A;  2OPS A;  4HUE A;  4PA1 A;  1WSF A;  1N5Y A;  3TAP A;  2ZQB A;  3AO2 A;  3EZ5 A;  1VSH A;  1JL1 A;  2OPR A;  4KTZ A;  2OZM A;  4AHC A;  2FBT A;  4OKJ A;  1EET A;  4CEF A;  1Q9X A;  1VSL A;  2IAJ A;  5SWM A;  3TAG A;  4DWI A;  4N41 A;  4CFC A;  3ITH A;  4CEB A;  3IRX A;  2Z1G A;  4M3R A;  3ZSV A;  3QEV A;  1LW2 A;  4FW2 A;  1TL1 A;  1XC9 A;  1NK4 A;  1BIU A;  2HND A;  3DLH A;  3RR7 A;  3HPO A;  2B6A A;  3EY1 A;  3MXI A;  1SL2 A;  4CIG A;  4HUF A;  4KHY A;  4PWD A;  4OLA A;  1D8Y A;  1WSJ A;  2G8V A;  4FJ5 A;  1A5X A;  4DG1 A;  4JRP A;  2HHV A;  4Z4F A;  1JLA A;  2JLE A;  3ZSO A;  1BIS A;  5HRP A;  1NK5 A;  4C8O A;  3U3Y A;  2B4J A;  2E6M A;  3PX4 A;  3THV A;  1TK8 A;  1IKV A;  1SKS A;  4Z4G A;  3OYA A;  4HTU A;  1J53 A;  4J2B A;  4DU1 A;  4DTN A;  1LWE A;  4GVM A;  4CHQ A;  2RKI A;  3U6F A;  3K57 A;  1L5U A;  4EZ9 A;  3DI6 A;  3HP6 A;  5FRN A;  1TKT A;  2E4L A;  3HPG A;  1JLG A;  4ZHR A;  1XI1 A;  4NCB A;  4DTJ A;  1X1P A;  1C0M A;  1C0T A;  3NFA A;  4E7K A;  1HMV A;  3PO5 A;  1S1X A;  1LAV A;  4BDP A;  2HVI A;  4O0I A;  1RT5 A;  4ELT A;  3RRG A;  1F21 A;  1C6V A;  1RIL A;  1WSI A;  4HHT A;  1ITG A;  4CJK A;  4J2A A;  1J54 A;  3VQC A;  4FK0 A;  4FK2 A;  5D3G A;  5HRS A;  2D5R A;  3P5J A;  1TGO A;  4JRQ A;  4W5O A;  3SNN A;  3NGY A;  4DQI A;  1ZBF A;  2G8I A;  3ISN C;  4CJF A;  3NF7 A;  4LH5 A;  4F3T A;  2DFE A;  4CHO A;  3ZSY A;  3OYC A;  3HT3 A;  1EX4 A;  3AO5 A;  4KAZ A;  4XIU A;  1DTQ A;  5EU7 A;  1T8E A;  4CEZ A;  3VQQ A;  1QHT A;  4GMJ B;  4OGC A;  4CJU A;  5J2M A;  1JLE A;  3O4Q A;  3VQE A;  1RDB A;  3NH1 A;  3OYF A;  4CF8 A;  1QE1 A;  4B9U A;  3KLI A;  3O3G A;  3WNF A;  3SQ4 A;  1RDA A;  3HVR A;  3V9U A;  2DY4 A;  4FJK A;  4DSK A;  3C6U A;  5I42 A;  1WNS A;  3NGI A;  3ZT0 A;  2KFZ A;  4LH4 A;  4BAC A;  1W0H A;  4M3Y A;  1RBR A;  1HPZ A;  3JSM A;  3HO1 A;  3NF9 A;  4J2E A;  1NK6 A;  3AA4 A;  1Q9Y A;  2QKK A;  5CY4 A;  4FJH A;  2VG7 A;  1HNI A;  3L3V A;  3KTQ A;  1REV A;  3DOK A;  3FFI A;  3BDP A;  3O4N A;  1YT3 A;  2F96 A;  1ZBL A;  3QEI A;  1YVU A;  3V1R A;  4Z0U A;  4CJ4 A;  5CYM A;  1KVC A;  3M8Q A;  3IS9 A;  3KK2 A;  1TAU A;  1BHL A;  4NCG A;  2RN2 A;  3DMJ A;  1VSE A;  3G10 A;  3OYH A;  4CJL A;  3RMA A;  1RT6 A;  4WE1 A;  1S5J A;  4CFB A;  4OJR A;  2NUB A;  4W5R A;  3HM9 A;  3K59 A;  1GOB A;  3OYN A;  4OLB A;  2HHT A;  3LWL A;  3AA2 A;  4BE2 A;  2OZS A;  4KHS A;  4DSF A;  1KFD A;  3PO4 A;  3MAQ A;  1X9W A;  3LWM A;  4FVM A;  4R5P A;  2BGG A;  1JLB A;  2O4G A;  3DOL A;  4YFU A;  4ID1 A;  4KPY A;  3ALY A;  3AVN A;  4KI6 A;  4KI4 A;  4N76 A;  4Z4I A;  1WLJ A;  2ATQ A;  3L2Q A;  4BDY A;  2G8F A;  1CZ9 A;  1RBV A;  3NGZ A;  3AVM A;  3CFP A;  1S1T A;  1WN7 A;  5J1E A;  1U45 A;  4CEA A;  4UQG A;  3MEG A;  4KB0 A;  1G15 A;  1SV5 A;  4ELU A;  2E6L A;  3SZ2 A;  3AVI A;  3DLG A;  4RW6 A;  4CGD A;  3OYG A;  5KGX A;  3SV4 A;  4DU3 A;  3QEP A;  3TI0 A;  4M3U A;  3PY8 A;  4Z4H A;  4DF4 A;  3QER A;  4FLW A;  3TAR A;  4F3O A;  4LY7 A;  1I3A A;  4CHN A;  1X9M A;  4CGI A;  4FZZ A;  4FYD A;  2KTQ A;  3QES A;  3L3U A;  3QLH A;  4I9Q A;  1D9D A;  4FZY A;  1RDC A;  3B6O A;  4N5S A;  3TAB A;  4O4G A;  3AA3 A;  3C6T A;  1KCF A;  4E7J A;  2D0C A;  2HW3 A;  3SUN A;  3OS0 A;  1UA1 A;  1NJX A;  3MED A;  4BWM A;  1I39 A;  3D45 A;  4CER A;  1VSK A;  4CGF A;  3SQ2 A;  3NF6 A;  5DK5 A;  4FLZ A;  2OPP A;  4IBN A;  4BWJ A;  3O3F A;  1O1W A;  1Z26 A;  4CF9 A;  3LZI A;  4BE1 A;  1NKC A;  4KHU A;  1T7P A;  4M3T A;  4DTU A;  3OYD A;  4DTP A;  2Z1I A;  3V6D A;  1SL1 A;  4M3W A;  2P1J A;  4CGG A;  1B9F A;  3C94 A;  3U3G A;  3VN5 A;  1SKR A;  1L3U A;  3VQB A;  5KRS A;  1U47 A;  4FJN A;  3K5M A;  3AVF A;  1KVA A;  3ZSZ A;  4W5T A;  1CXU A;  1BL3 A;  4ICL A;  3VQ8 A;  1NJW A;  4RW8 A;  4ZTF A;  2JGU A;  4N47 A;  3SYZ A;  4FLV A;  3VQP A;  4DFJ A;  4PY5 A;  3ZSR A;  4KV8 A;  3NDK A;  4DSI A;  1UOC A;  3OS1 A;  4KHQ A;  3K5N A;  4CJ5 A;  1IKW A;  4FJG A;  3AVL A;  4FJI A;  1JLC A;  1W9H A;  3KK3 A;  2R7Y A;  3HVT A;  1X9S A;  3AO4 A;  4DS4 A;  4IG3 A;  4KFB A;  4FLY A;  3PX6 A;  3VQ4 A;  1KVB A;  1BCO A;  1RT4 A;  1ASU A;  1RT1 A;  3CM5 A;  3HXM A;  1TL3 A;  3M8P A;  3NBP A;  1EXQ A;  1CXQ A;  2FBY A;  4CJE A;  3OS2 A;  3CFR A;  4DFP A;  4M3Z A;  4QCL A;  1ASV A;  4GW6 A;  3ZT2 A;  3L2V A;  1NK9 A;  1GOC A;  1D5A A;  2IDO A;  2HHW A;  2D0A A;  1LWC A;  4JLH A;  1DLO A;  2HNZ A;  4E19 A;  5DMR A;  2YNH A;  3TAE A;  1YTU A;  4ELV A;  1FKP A;  4QAG A;  1RTI A;  3VQ5 A;  2VWJ A;  1ASW A;  4E7I A;  4DU4 A;  2XHB A;  1TKZ A;  2RF2 A;  1R0A A;  3IAY A;  3OYL A;  3OYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...