1RT2A

Crystal structure of hiv-1 reverse transcriptase complexed with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 145
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt2A05
2IOCA 5JUMA 4M45A 3KLIA 2XC9A 3U3GA 3DOKA 4IG0B 3NH1A 3QINA 3HYFA 2OPPA 1RYRA 5EDWA 3QEVA 1L3SA 3AO4A 2E9RX 4DTUA 3CG7A 1N5YB 3OSPA 1IKYB 2ASJA 1LWEB 4E7JA 2WRMA 1NK4A 4ECRA 1X9SA 1N6QA 3DLBA 5KFLA 4DQSA 4B9LA 3LP0A 4RW8B 2AX0A 4FK0A 3OYFA 2XY7A 1IKVA 2VG6A 4WXOA 3H5UA 3HXMA 1IO2A 2XWYA 2X6NA 4DSEA 3MXIA 3GV5B 2BANA 3RR8A 3Q8RB 3OYIA 2B6AA 2HHXA 1TAQA 3DLHA 1LW0B 2XGQA 5KT6A 2GV9A 4XPCA 3CWJA 2GIRA 3SQ0A 1U47A 3QESA 4XO0A 4ECUA 1XHXA 3DRPB 1IKWA 1N56A 1RT5A 3BQ2A 1XHZA 1FKOB 2ZD1B 4ZTFA 2AQ4A 3U3YA 1NJXA 3PY8A 4RW6B 4YR0A 1EKEA 4FJLA 5CYQB 1NKBA 2HMIA 5DQHA 4CK3A 1C0MA 4OVLA 3TAGA 2VWJA 3RMDA 4JV2A 4RW9A 3K5LA 4NLDA 1VSIA 4HCCA 3DLKA 4DTPA 2HB5A 1TQLA 2DY4A 3HP6A 4ELTA 2KW4A 1EP4A 3LZJA 1WAJA 4HHTA 5F8LA 3DLRA 5EU7A 1A5XA 1Q9XA 3B6OA 2Q3SA 1CSJA 3AV9A 4IR9A 4M3YA 4ELVA 4CGDA 2B5JB 2Z1GA 3L3VA 1SUQB 3VQ8A 3LPTA 3KD5E 2PY5A 2FLNA 1ZBHA 3PV8A 4MK7A 4PY5A 1XR7A 2BQ3A 1RT6A 3M8QB 1S1UB 5DGBA 4IDKA 3KLEB 1UWBB 1TKTB 5EUHA 4LH5A 1JXEA 2F8SA 2O4IA 4NYZA 4CIGA 5L1LA 4CE9A 4ECTA 4FM2A 3DOLA 2HHUA 3DYAA 1HQUA 1C0TB 4DTSA 5SWMA 1LAVA 2G8VA 1NK9A 4ED2A 3UR0A 4DEZA 1NK5A 1R0AB 5C25B 2W7PA 4Z4CA 3OYBA 1QSYA 4BWJA 1U45A 5KTQA 4NCAA 3G0ZA 3ISND 1RA6A 3H5YA 3H5XA 4B3OB 2HNZB 2RN2A 4CJRA 4JRPA 4ED7A 4O5BA 4CHZA 5KFFA 1HQEA 1HJRA 4R0EA 4RNHA 2HVHA 1RTJB 4IBNA 3M8SA 5J2QA 3PW4A 3OYJA 4TY8A 4E7IA 2BQRA 4H4OB 3PX0A 1RTIA 3HT3A 2D3UA 1YVFA 4ZPDA 2HVIA 4H4MA 1S10A 1KHVA 4CGFA 4G1QB 5I3UA 2XI2A 4URSA 3GYNA 4CEQA 4DSIA 4ECSA 4CJFA 4NLUA 2G8FA 3N6NA 4WXWA 5F9NA 3L2VA 1S5JA 1HRHA 1QE1A 4JV0A 4BACA 4FS1A 4FM1A 3QIDA 4M95A 3GQCA 3H59A 2GUIA 3PW0A 4J2AA 3KOAA 3ASMA 4J9QA 5KFIA 1VSKA 1S0MA 2J6TA 1TKXB 2WONA 3E51A 4KHUA 1I39A 1LAWA 1SH0A 2C2RA 3TR8A 1A5WA 2D5RA 5EWFA 4KAIA 4Y3CA 4DU4A 4ZTJA 1BQMA 1KTQA 4KO0B 1SV5B 3V9XA 3IN5A 4CJLA 4FBTA 3AVHA 1C1AA 4ZP7A 1Q9YA 5KG6A 3OS0A 4KBIA 3OYHA 2E6LA 2DFHA 4CJQA 3TANA 4LSLB 1HPZB 5F8GA 5KFAA 1ZBUA 1SKWA 3DLGA 3QO9B 4FJIA 2IMWP 1HARA 5CY4A 2RKIB 4J2EA 4O3OA 1VRUA 4TN2A 3HVTA 3KTQA 2IM3A 2HHQA 4CECA 3CDWA 3MEEA 1TV6B 3OYCA 4ELUA 1B9FA 2WHOA 5I42A 3V6DB 1Z25A 3CYMA 1KVCA 5L1KA 4OKKA 4TQSA 2HHTA 2AWZA 5KG1A 1LV5A 2KFZA 5J1EA 2IJFA 1WLJA 2BRLA 4K4XA 3ITHB 4JUZA 4F3OA 3QETA 5KFTA 3RRHA 2FVCA 3FRZA 4O4GB 4NLVA 5KGXA 1JLAA 4KTWA 1HYZA 3O3HA 1HNVA 1RTDA 4CGJA 2OPSA 3K59A 2ZE2A 3C6TB 4O4RA 4M3RA 1DLOA 4B9VA 4W5RA 3AVKA 4CJ4A 2R7YA 2DTUA 4B08A 3MECB 4WFYA 2AGPA 5KFXA 4IKAA 2XHBA 4FW1A 3IG1B 1J5OA 2HAIA 3NAHA 4FJJA 1F21A 3NH0A 4M41A 1RBRA 5DG8A 1WSGA 1QHTA 4Z4FA 4DFJA 3GIIA 3ZSVA 5HRNA 3AVGA 2R8JA 1C6VA 1SKRA 3HM9A 2OPRB 3KK2A 4B9MA 4ZPAA 4R5PA 1BIZA 1S0NA 2OPQA 1CZ9A 4CEZA 1VSJA 5FRNA 3QEWA 4GW6A 3RAQA 4X2BA 1NJZA 2CKWA 1LWFA 4JS4A 1UA0A 4U7CA 5HP1B 4FJHA 3HJFA 4I9LA 3K2PA 4RU9A 3TI0A 3IRXA 1VSLA 2YHBA 2BE2A 4IFVA 1TKZB 2ASLA 4AHCA 4O3RA 4AHRA 4KTQA 1IG9A 4FJ8A 2B43A 4ICLB 3NDKA 3KK3B 3HP9A 1VRTB 3M8PB 3I5CA 4I2QB 3V9UA 3OL6A 3K57A 5KG0A 4EBEA 4F3TA 4CF2A 4DQIA 1HNIB 1JL2A 3H40A 1IKXB 1JLCA 1QSLA 4FJ7A 1NNDA 1RT3A 1S9GA 3I8DA 3AA5X 2VG5B 3AVLA 1VK0A 3SUOA 2ILZA 2HNYB 1S1VB 5J2MA 4U6PA 4N5SA 3CJ0A 4KHWA 1S1TB 2FVSA 3DMJB 3QGIA 3VQ4A 3NCIA 1C1CB 1CLQA 4ZPCA 4WE1B 3AVAA 1DTQA 2QXFA 2ALZA 3JSMB 3LP1B 4FLYA 4DL6A 1SL0A 2UVUA 4LSNB 4IR1A 4Q8FA 1N4LA 2F8TA 4ECZA 3OS2A 4KRFA 3IS9B 1YTAA 3V9SA 3V1RA 4DL7A 4CFAA 3O3FA 4IFYA 5KT2A 1I3AA 5KFQA 5HROB 3DLEB 4PA1A 1NK6A 3NGZA 3TAFA 4NZ0A 4N56A 4F2RA 1FK9A 3KJVB 3MR6A 3SYZA 1VSEA 1Z4UA 4Q0BB 4NLYA 3CJ2A 2YNHB 5KT5A 2E9ZA 3VA3A 2BRKA 3C6UA 4FS2A 2IC3B 4HUEA 4W5OA 4DL4A 3WNGA 1A5VA 5FRMA 1JKHB 5KFPA 3LAMA 1C1BB 3NMAA 2ILYA 5DG7A 4MQ3A 1J9AA 2BDPA 1LW2B 3FFIB 3ZT4A 3QIPA 4WYWA 3LWLA 1XI1A 5KT7A 3MR5A 4OPJA 1T05A 4K4SA 2WOMA 1S97A 1JXLA 1RT1A 1Y97A 3S9HA 3KMSA 4NRUA 1J54A 2YNFB 2AJQA 3V6HA 4B9TA 1BHLA 2A1RA 3U6FA 4N47A 4FVMA 1FKPB 2QV6A 4PQUA 3KLFA 4N41A 2IJNA 1WSFA 4CJKA 1JLBA 5D3GB 2YKMA 3OHAA 4KFBA 3T19A 3AVMA 4NLGA 2JEGA 4J9MA 3SCXA 2R2UA 3OJSA 4I7FB 4I2PB 4RW7B 1ZBIA 5DLGA 4DL5A 4C8OA 3RB4A 3DRRB 1RT7B 3KHHA 2KFNA 3CO9A 4KKOA 5KG7A 4WYLA 5KFDA 1EETA 2J6UA 4RNOA 2D0BA 4PUOA 2IBKA 4F8RA 2I5JA 4Y1DA 1RTHB 4URQU 3VN5A 5KGWA 1YVUA 3MR3A 2X6SA 5C42B 5JXSA 3V4IA 3AO3A 4ED3A 4K8XA 1XWLA 3VQPA 3VQ6A 2OPPB 4CEDA 3L2UA 3T5HA 1NHUA 2RDJA 3CJ5A 3CM6A 4FJNA 4GVMA 3SUNA 4DG1A 3CDUA 3LANA 1S48A 4JS5A 2QKKA 5DQGA 4M3ZA 3Q8PB 3MEDB 1N5YA 4FW2A 3LP0B 4LQ3A 3QZ8A 4FXDA 1IKVB 4H54A 4Z4EA 2VG6B 1TK0A 3TABA 2ASDA 4Z4HA 5HRPA 1RT4A 4BE2A 4O0IA 2BANB 1XR5A 4KHNA 2FBVA 4FJGA 2DFEA 2WCXA 3M9OB 2DFFA 3KLGA 1YTUA 1ASUA 4RNFA 2ITGA 4Y2AA 1SL1A 1IKWB 4OLAA 1RT5B 2IAJB 4NLSA 2UVVA 4DS5A 2HMIB 4CHNA 1SL2A 4EEYA 3OYDA 4CFBA 1FKOA 1QQCA 4G3IA 4RW9B 4W5QA 4CHYA 1N48A 2XO7A 3DLKB 5J2PA 5CZ2A 4C8LA 2JLEA 3TAMB 4QWCA 1BI4A 4FM0A 3K58A 4ZVEA 3V6KA 5HRSA 4HUFA 1EP4B 5EWEA 4ED0A 4FK2A 3VQ5A 1G15A 4CJUA 3NE6A 3BJYA 2BGGA 1KVBA 1EX4A 4DQRA 3PX6A 1REVA 4AHUA 2R8GA 4DQQA 3KD1E 4JLHA 3FQLA 5T7BA 1QAIA 1TL1A 5KRTA 3PO4A 3GIJA 4CHPA 4E7KA 4DTRA 3PJXA 1KVAA 4CF8A 4IDKB 3OY9A 3NBPA 2CJQA 4J9PA 4ECQA 2GC8A 3RTVA 2P5GA 3M8QA 3NL0A 4E3SA 1BQNA 1S1UA 4HCBA 3KLEA 1JLEA 3Q8SB 3DYAB 1HQUB 2G8WA 3BDPA 2QK9A 1KCFA 5FDLA 1TVRA 3QNNA 4FZZA 3OSNA 1NOYA 3TWHA 4LQ9A 1GX5A 4FLVA 3V81A 1MU2B 2KZMA 4NLPA 1BCMA 4MKBA 2PYLA 1WSHA 4JV1A 3SV4A 5F8HA 4IOBA 3LAKA 4CHOA 1R0AA 3OYAA 4MFBA 2W8KA 3RRGA 2XY6A 2W7OA 1HYSA 4TQRA 1C0UA 1JLQA 2R8IA 1W0HA 1NK0A 4PWDA 4TSXA 3K5MA 3DM2B 3HPHA 4RUAA 4ZP6A 2IM0A 2HNDA 2Y1JA 1IM4A 3ZT3A 1EXQA 1SH3A 5KI6A 5KFSA 3PZPA 1TGOA 2F8EX 5J2QB 1T94A 4DFKA 4TY8B 2FBYA 1RTIB 2D0AA 1RTJA 2O4GA 4GC6A 3LWMA 3VQ9A 4EBDA 4H4MB 2ZQBA 2V4QA 4H4OA 5DK5A 3HHKA 5I3UB 2XI3A 4CHQA 4TLRA 3LP2B 3VQAA 3BQ1A 4EYHB 2KQ2A 5DMRA 3SFGA 4EYIB 4BDZA 1QE1B 2D3ZA 4DF8A 2YV0X 2YKNA 3QEXA 2WK4A 3CQ8A 2YNGA 1RBUA 1NKEA 4NLTA 4IG3A 3CJ4A 4CJ3A 2WONB 1D1UA 4QWDA 2IS3A 2AU0A 5K14A 4RNNA 4OKJA 3HSTB 2IA6A 3G10A 1TKXA 3BSNA 3KIOA 1KHWA 4HYKA 2G8IA 3AVNA 2X78A 4O3SA 3Q8QB 5DQIA 3FQKA 2VA2A 4QPXA 3GIKA 4RG8A 3KHGA 3PO5A 4O44B 4J2BA 1U49A 4KO0A 2Z1JA 4M42A 4C8NA 1GX6A 3S3MA 3MR2A 2P5OA 4MIAA 1U4BA 4ECVA 4DQPA 2E9TA 3PW2A 4Q45A 3EPGA 2VG7B 3ZSZA 1HPZA 5KRSA 3HVTB 3ISNC 4NLWA 3T5LA 4HUGA 3AVJA 4E0DA 5KFGA 3FSIA 3THVA 3SPYA 2ETJA 2OA8A 1HMVB 2R2SA 1NKCA 3E01A 1L3TA 4QWBA 2R8KA 3QZ7A 4CCHA 2O5DA 4CIEA 2WB4A 3SPZA 2C2DA 4W5NA 4FLUA 1JLGA 3EZ5A 3HVAA 3S3NA 3K5NA 3OHBA 3V6DA 4OGEA 5J1EB 1K1QA 5L9XA 3OYKA 1WNEA 1JLAB 5KFKA 3NF7A 3ITHA 3BSCA 3AO1A 1HNVB 4FCYA 1RTDB 2OPSB 5KFOA 4DFMA 2ZE2B 4O4GA 3RMCA 2C2EA 3MF5A 1DLOB 3M9MB 4MKAA 4F4KA 3TAQA 3NGYA 4FZXC 5C24A 2UUTA 1CXUA 4OGCA 1VSMA 2FJXA 3RB3A 1WAFA 3VQDA 3F73A 2G8KA 3SNNA 1TL3B 4FLTA 4R8UA 1JXBA 2UVWA 4O3NA 1Q8IA 4MK9A 4NLXA 3TARA 4IKFA 1WSEA 5F8IA 4UQGA 1WSJA 3H4DA 1S6PA 1TKDA 3ZSQA 3KK2B 4R5PB 1DTTA 1QS4A 2OPQB 4Q43A 4ED8A 2OPRA 1LWFB 5KFCA 2YHAA 3QLHB 3DDKA 3MTKA 1XC9A 4K50A 1KLMA 3IRXB 4O3PA 2EC0A 1T8EA 2BE2B 2HW3A 4GC7A 4DLEA 3ZT1A 5KT3A 3QGHA 4DSJA 2R2TA 1QSSA 1VSHA 2DPIA 3GILA 3QEIA 2RF2B 3BREA 1BIUA 1S1WA 3H2LA 2YNIA 3M8PA 4CERA 1TK5A 1JLCB 3O3GA 2RPIA 2V0NA 3M9NB 3RR7A 4CESA 3AVIA 1S9GB 1IKXA 3I0SA 1IH7A 3HK2A 4EP4A 2D7SA 5J2MB 4J9OA 4CEFA 3B6PA 5J2NA 2FVPA 4KHMA 3QERA 1DTQB 1QUVA 1NHVA 3VA0A 1D0EA 2HHVA 2D41A 3KHRA 5KFWA 3T3FA 4WFZA 3OYLA 4CIFA 2IDOA 4DU3A 1S1XA 3AO2A 4LSNA 5HLFA 3FDSA 3GIMA 3KMQA 3V6JA 5CYMA 3F9KA 4KREA 1FK9B 3P83D 3G86A 4IRDA 2FC0A 3CFPA 3ICLA 2I1RA 4LD0A 2FLLA 4ECYA 3KJVA 4LH4A 4NCGA 3OYEA 3MEGA 2KTQA 3C6UB 4ZPBA 3KK1A 4Q0BA 1JLFB 4GMJB 2HHSA 1GOAA 3I0RA 3AVCA 5HBMA 3DI6B 1B92A 3LDSA 3SQ1A 4CFCA 4EZ6A 4M3XA 3JYTA 2LSNA 1I6JA 4FYDA 4QCLA 1JKHA 3SV3A 2W9BA 2C22A 3SZ2A 1LWCB 4NRTA 4DS4A 3ZSRA 5EWGA 4YFUA 1TAUA 1S6QB 1RDAA 4ID5A 3MFIA 4ZHRB 4EP5A 2HWIA 1T05B 2G8UA 1T03A 1UAXA 3AVFA 3HVRA 5KFJA 1RT1B 1TK8A 2FVRA 2X74A 3LPUA 3LZIA 4CGGA 4J9LA 4E7LA 4M3WA 1L5UA 3BQ0A 3TAPA 1VSFA 1WSIA 3KLHB 1C2PA 2FJWA 4I9QA 4KV8A 2J6SA 3TQ1A 1JLBB 2W9CA 2YNFA 4DTXA 4KFBB 2RDIA 2JGUA 5KFUA 4ZVGA 4KTZA 4RW4B 3BGRA 1RT2A 2GIQA 4M3UA 2UUWA 4CEAA 3LP3A 4HKQA 5L1IA 5DGAA 4YQWA 4YNQA 3DRSA 4KKOB 4DTOA 2A1SA 1S0OA 1EETB 4B9NA 1S9EA 1BL3A 4PUOB 5E41A 4BE1A 2I5JB 3KLIB 1RDDA 4CK1A 2JC1A 3DOKB 3L2RA 3V4IB 1QAJA 3V9ZA 1KRPA 3OLBA 4DFPA 4KHYA 4MIBA 3ZSWA 4ZVHA 3G6YA 5C42A 4IG0A 1RBTA 4C8KA 1SH2A 1HYVA 1VSDA 3CIZA 4H8KA 3SQ2A 4F4XA 4DG1B 3ZT2A 1UOCA 4TYAA 1N6QB 4FLWA 1ZYQA 4E89A 2FLPA 1IKYA 3C95A 4ZVFA 2AX1A 4ECWA 3IGNA 1LWEA 1D9FA 2OZSA 4QOZB 2B4JA 3NF8A 3HVWA 4RW8A 5JS2A 3MEDA 4KSEB 1RT4B 2B6AB 4O55A 4CEOA 3SUPA 5KFVA 4IQXA 3RMAA 4IRKA 4FLXA 1ZETA 3N6MA 3NHGA 3KKRA 5F8JA 3KLGB 4CJVA 1LW0A 2W42A 1JIHA 4F2SA 4YMEA 1YT3A 2QE5A 4CK2A 3HKWA 4E1MA 3NAEA 3DRPA 3PW7A 3KKSA 2JEIA 3O4NA 1X1PA 2ZD1A 3HL8A 4C8MA 2PZSA 4RW6A 5F8NA 4DSKA 4TYBA 5CYQA 2IAJA 1U04A 1U09A 4Z0UA 3BSOA 3G6XA 2EHGA 5KG5A 3QEPA 2GBZA 4ID1A 3H98A 4YR3A 5J2PB 4BE0A 4F50A 2C28A 4J2DA 1BI4B 3SJJA 2IGIA 5F9LA 5KFBA 3RWUA 2E4LA 3VQQA 4TXSA 3A2FA 4CFDA 3TAMA 4CJ5A 1B9DA 4FJ9A 5T14A 3L2WA 4N76A 4IH6A 3C94A 3T5KA 2Z1IA 4KPYA 1RT6B 2IM1A 1REVB 4CEBA 3S3OA 3WNEA 2B5JA 1S4FA 1TL1B 4TY9A 1SUQA 1QTMA 3AO5A 3NGDA 3NBPB 4RZRA 4NLRA 4AHVA 3DOLB 1NK8A 3IAYA 1UWBA 1SKSA 1TKTA 1BQNB 1O1WA 3NF9A 2ATLA 1JLEB 5KT4A 4E1NA 1ZBFA 3UQSA 3HPGA 3CJ3A 5FDLB 1TVRB 4YR2A 2R2RA 1C0TA 3K5OA 3V81B 4CF1A 4KAZA 3L3UA 4XPEA 4B9SA 4KI4A 4ZP8A 5C25A 5KFYA 1MU2A 3ZT0A 1RBSA 4CGHA 4MFBB 1NJYA 3KNAA 4WZMA 1HYSB 2XGPA 1C0UB 5KFRA 1JLQB 4QWEA 1HQEB 5KFZA 4RNMA 4PWDB 3H4BA 4M3TA 1OS5A 4B3OA 2HNZA 2QKBA 2HNDB 2FVQA 3PJWA 4FJ5A 3MFHA 2W9AA 4FK4A 3CM5A 3GV7B 3DM2A 2JEJA 1MMLA 4K4UA 3IGVA 3VQSA 4DWIA 3OL9A 2FBXA 3UDLA 2VWKA 3L8BA 4Q44A 1RAJA 3I5AA 2IM2A 4YP3A 4KB1A 3AVBA 3QYYA 1WNSA 1NOZA 2F96A 3I5BA 1S49A 1TP7A 4EZ9A 4G1QA 4ZP9A 3PUFA 2BR0A 3LP2A 4DL2A 2YKNB 4QW8A 3AA2A 3P1GA 2YNGB 3SQ4A 1CXQA 4WFXA 3HPOA 3SUQA 3M8RA 4DU1A 4IG3B 3UPFA 1UA1A 4K4TA 5K14B 2UVRA 5KFHA 1RILA 4F4YA 1BQMB 4K8ZA 4KI6A 5KFNA 3SI8A 4NLQA 3AA4A 1RDRA 4B9UA 4KHRA 3EY1A 4XIUA 2P51A 1S9FA 4OPKA 1SV5A 5C5JA 4DTNA 3BSAA 2AGOA 4IRCA 3RMBA 3DLGB 3ZSYA 3HO1A 4CF9A 2Y1IA 4O44A 4Z4GA 4DSFA 4Y1CA 4BDYA 4LSLA 1VRUB 1ITGA 4Y2CA 5F8MA 3QO9A 4ECXA 2DPJA 2ATQA 1XR6A 2NUBA 3CFRA 2RKIA 1ZBLA 3MEEB 1RDBA 3RB0A 2XCPA 5I42B 4DSLA 3E01B 1RYSA 2VG7A 3OL7A 1X9WA 4Q8EA 3OYNA 1TV6A 1K1SA 4QAGA 4F4ZA 2OZMA 2W8LA 4L8RB 1HMVA 3NF6A 5CZ1A 3BR9A 4B8AB 5KG4A 2EX3A 1JLGB 4O3QA 4BDPA 3SI6A 1W9HA 3CFOA 4EO8A 5JS1A 1J53A 1ASVA 1JX4A 3D45A 4OKEA 3SFUA 2V4RA 3PR4A 3VQEA 4Y34A 5KFMA 2R8HA 3V9WA 1W25A 2WTFA 4WZQA 4NLOA 3UIQA 5C24B 4Q5VA 3C6TA 1D9DA 4CJWA 4B8CA 5HRRA 3OS1A 4CJEA 1ASWA 1Z26A 1J5OB 4FLZA 2JC0A 3MAQA 3D0PA 2XY8A 3MECA 5KG3A 3RBDA 2OH2A 4R8UB 2P1JA 4ZMMA 1T7PA 3IG1A 3NFAA 1BISA 1FXXA 4Z4IA 4CGIA 4HTUA 1TL3A 2ZKUA 4KB7A 3NAIA 4MK8A 2XCAA 3EYZA 3WNFA 4CF0A 2D0CA 1L3UA 4K4YA 1S6PB 1BGXT 4ED6A 4DLGA 1T3NA 1KSPA 1CZBA 3GV8B 1DTTB 4F4WA 3VQBA 4DTJA 3NKYA 3KLVA 3OVNA 4IFVB 3RAXA 1KLMB 3PVXA 3VQCA 3EZUA 3WNHA 5HP1A 3OLAA 4CJTA 1WN7A 1BCOA 4NYFA 1U48A 4AILC 3QLHA 1TKZA 3NH2A 4ICLA 3PW5A 3KK3A 1K6YA 3PX4A 1L3VA 4ED1A 1VRTA 4FZYA 4I2QA 1RDCA 4KB0A 1S1WB 2YNIB 4DF4A 4DMNA 3OL8A 3TAEA 1HNIA 4AHSA 1RT3B 2RF2A 3LALA 4AHTA 3KHLA 3ULDA 4K4VA 1D8YA 3P5JA 4KE5A 5KG2A 1X9MA 3I0SB 4CEEA 2VG5A 5J2NB 2V9WA 4K4WA 2HNYA 1S1VA 4CJSA 4IH5A 1S1TA 3DMJA 2FBTA 2HWHA 1C1CA 3PHEA 4WE1A 4EBCA 3T1AA 4MH8A 5KFEA 4J9SA 2VA3A 3JSMA 2JEFA 3LP1A 3N6LA 4IFYB 3CDEA 1RA7A 4FBUA 1KFDA 3G6VA 2OYQA 4E7HA 1S1XB 3IS9A 5HLFB 5CYMB 5HROA 3DLEA 4OL8A 3CVKA 4M94A 4W5TA 1GOBA 2KZZA 1RBVA 4DTMA 1KLNA 2PYJA 2Z1HA 4NCGB 3MEGB 3V1OA 4CJPA 4QWAA 1RNHA 2YNHA 3KK1B 4OLBA 1GOCA 3H08A 2G8HA 3RB6A 2IC3A 3I0RB 4NCBA 3OJUA 2AGQA 2FJVA 5FROA 5HBMB 2BQUA 3RBEA 1JLFA 3JYTB 4QW9A 1RCHA 4FJMA 1C1BA 2W9BB 3OYGA 4JRQA 3QIPB 3NGIA 3DI6A 4K4ZA 3ZSXA 5SZTA 3VQ7A 2WOMB 4ID5B 3T5JA 1LW2A 4KHQA 3FFIA 1T03B 4E19A 1LWCA 3PR5B 1JL1A 3MXJA 5DLFA 1S6QA 1NK7A 4OJRA 4ZHRA 3V1QA 4PQUB 3KLFB 3H5SA 4J9KA 3ZCMA 4RUCA 2YKMB 4KV8B 2W9CB 1FKPA 1ZTTA 3AA3A 2HHWA 3ALYA 3OYMA 3L2QA 4IH7A 5L1JA 1KFSA 3KLHA 5D3GA 3QGGA 1NJWA 2E6MA 3D28A 3TVKA 3BGRB 1RT2B 4I7FA 3QIOA 4I2PA 4RW7A 4URGA 2XY5A 4RW4A 3DRSB 3ZSOA 4FJKA 3DRRA 1RT7A 3D5MA 4NYNA 1ZTWA 1S9EB 4HVJA 3EPIA 5DG9A 4FJXA 4EO6A 1D5AA 3O4QA 4KHSA 4DL3A 3QNOA 4J9NA 4LY7A 4BWMA 4J9RA 3MXMA 4O0JA 4AH9A 1RTHA 2XRIA
chains in the Genus database with same CATH superfamily
4WKRA 1CJVA 1U24A 3CD5A 3GJTB 4IG0B 2AJ2A 3QINA 3HYFA 4OI2A 1VQ6S 5LXRA 3AO4A 4DUZK 2E9RX 4DTUA 3CG7A 2ASJA 1LWEB 3ATUA 2QYGA 4DPTA 2QLJB 2BEFA 4ECRA 3G8QA 4YY3K 4FK0A 4USIA 3OYFA 4CLKA 1IKVA 3C7NB 4LF6J 1S3XA 3MXIA 4JI4F 2J7KA 3BGOP 3MAAB 3RR8A 3PRBA 2HHXA 1TAQA 3GP9A 3UR3C 5EX3A 4ZPTR 2GV9A 3O9UA 4NWBA 2ZBQA 1UAWA 3QESA 4XO0A 4ILJA 4IOCL 3BQ2A 2HKEA 2N4CA 1XHZA 1EKSA 2AQ4A 4YOXA 2F8HA 1VK8A 1NSPA 3K17A 2ZH1A 2M9KA 3ID6A 1SKUB 3SBTA 1WDDA 3HRGA 1Y5NB 1BWEA 2VWJA 3R1LA 3RMDA 4DUYJ 4RW9A 4A8QA 2B9XA 4DTPA 4C8ZA 5AQIA 5TKYA 2HB5A 3R3LA 1RAAB 2JVRA 1I94F 1RWWB 2YJFA 3GWCA 5F8LA 1A5XA 1Q9XA 1MNEA 4PG4A 2C3UA 1ATNA 2HGMA 1JB0C 2HQ3A 4KHPF 4GKJJ 3N01A 5IT4A 2B5JB 2X1AA 1KBRA 4DR7F 3KD5E 3FGVA 5KPTA 2PY5A 4GO7X 3D3CJ 1XR7A 2GHWA 1RZMA 4DQ8A 3KLEB 5K8PA 3HLUA 2O4IA 4CIGA 5F2RA 4CE9A 2JH3A 4ECTA 4OJGA 1UWAA 2HHUA 3DYAA 1HQUA 4DTSA 5SWMA 2G8VA 2IRUA 4ED2A 1XMBA 3UR0A 2M8HA 2BUNA 2V8GA 1RDUA 3THXA 3AD9C 1DKGD 1QSYA 1NCLA 5CH7B 3M2RB 4NCAA 3A1YG 1N52B 2M3DA 3G8SA 1FRHA 3W65A 4DJBA 4B3OB 1VRQC 4GVLA 3EVWA 4O5BA 2KT2A 3DXMA 1IN0A 3GCXP 1VQ9S 1IR1A 2XMJA 1APSA 1AA1B 3M5RA 4RNHA 2HVHA 3MI7X 4IBNA 2KXFA 4I6AA 4KC5A 3M8SA 3PW4A 4ZITA 4LF5K 1JJCB 2BQRA 3OFFA 2W2OP 2JSXA 1UFWA 1YWXA 1RWOB 1GQEA 2HFVA 2ZH2A 1Y10A 4H4MA 1S10A 3ZFVA 4A61A 4CGFA 3HZ6A 2D9PA 2KVQE 4URSA 4JI1K 1IBKK 1ILYA 3AY9A 1Y5IB 2I38A 4ECSA 2XG8A 3N6NA 4FS1A 4BRDA 3D9BA 4ZCKA 1FHTA 3H1VX 4J2AA 4ZVUB 3G6ES 4J9QA 4OO1J 1S0MA 3WZ0A 1WHXA 1F2HA 2NCKL 3SSQA 2C1EB 2C2RA 1CVJA 3TR8A 2HWTA 1S0VA 4DV0F 2D5RA 2N7CA 3EM1A 4ZK7M 2XB2D 2DK2A 1V4SA 1C0GA 4U7UK 5IT9Y 3PIOQ 2P9LB 3EICA 4KPCA 3HX9A 1M90T 1WC4A 1BQMA 4H0XB 3V9XA 3HCXA 2P9GA 2DGWA 3L4IA 3M32B 4CJLA 1X9JA 1BA0A 4ZP7A 1C1AA 4EFHA 2EFVA 2OTJS 4BC3A 2PIIA 3DU5A 4CDIA 1A7GE 4ALZA 4LRCA 5C12A 2E6LA 2YWWA 1TELA 2X1FA 1HARA 3NGSA 2VGNA 1VQOS 1EHWA 1JCFA 5IM0B 4C4WA 4TU8A 2HHQA 3IO1A 3C0BA 3CDWA 4O5FA 2UUCK 2Q36A 3TX8A 5I42A 1YJ9S 3DGPB 2AWZA 3MUVP 4DV6F 5KG1A 4EUVA 2BOAA 1WLJA 3ITHB 5JVHQ 4F3OA 3CXCR 3ZYYX 3QETA 4CLWA 1WC6A 4BRCA 3KYLA 4PL7A 2GX9A 3O3HA 4FXWA 2ZOMA 1RKIA 2DEIA 2QA2A 3C6TB 1YDLA 2H5IB 1DLOA 3H42A 4KH1B 4W5RA 3D3BJ 3OFEA 3MEKA 2R7YA 4JI8K 3FSXA 4JI6J 3IG1B 4G65A 2HAIA 4FJJA 1RE1B 1RBRA 3T6BA 1NHKL 5CCLA 2YX7A 1JWWA 4Z4FA 5AQPA 4HDGA 4K8RA 3K0SA 2R8JA 2HRUA 3C6AA 3CCEN 3M8WA 1WF2A 2OPRB 3KK2A 3KHYA 3VEWA 2HLTA 4CEZA 5FRNA 4AM6A 3MM9A 1DRZA 3NVMA 3HHLA 4HLBA 2GMJA 4I9LA 1EWQA 3R7SB 4A59A 1VSLA 3AQPA 4DR4J 4UY85 3VVUA 2ASLA 4AHRA 4FJ8A 1GMVA 4NLBA 4ICLB 3I5CA 2YVSA 4BQZA 3OL6A 1T0TV 1WF1A 1X3MA 4F3TA 4IJNA 3FRYA 1RFQA 1HNIB 1UJ4A 1PC5A 1PCAA 1V5VA 2BJ1A 1QZ5A 4I0WA 1JLCA 3LGHA 3CQYA 3M3ZA 4FJ7A 3W64A 1NNDA 5GMEA 4JKGA 2P9KB 5E2QA 3SUOA 2R9LA 1S59A 4FNHA 1VBZA 3DMJB 4IO1A 3VQ4A 3NCIA 4ZPCA 1DTQA 2QXFA 4MYTA 3LP1B 4FLYA 4DXLA 3D2FB 2WAQD 2P9CA 3M6UA 3IS9B 5FPDA 4JI3F 2E5IA 4CFAA 2DITA 2ACMA 1I3AA 5HROB 2GX8A 3R7NB 1MMDA 5M2UA 4B3SK 4R0JA 1X4CA 4JYAK 2HS3A 3VZIA 1CC8A 4USUA 1CJTA 3H8YA 1VSEA 2HBLA 5BRDA 5K20B 4NLYA 1YHQS 2YNHB 2PMWA 4U96A 2E9ZA 3VA3A 4KIAA 4C23A 4HUEA 3ATVA 5ITHA 3WNGA 4LF9J 1LFWA 3OBYA 3O8WA 1RTZA 2ATCB 2F63A 4BRAA 4M5LA 5ELZA 2IBOA 2CPFA 2ILYA 5DG7A 4MQ3A 4B17A 3GSIA 4WYWA 3VHQA 3MR5A 4K4SA 1S97A 5B0CA 3CC4N 1Y97A 5BPLA 1WHWA 3HF5A 3KMSA 4CT9A 3A12A 1BWVA 4X4VA 4NO7A 5I4MA 2BV3A 4N47A 1FKPB 4EK2A 4QZVB 2IJNA 1WSFA 4CJKA 1OSDA 1OQ6A 1VQ5S 3ZO7A 4KFBA 3T19A 3SCXA 2JEGA 3DAWA 3OJSA 2YX4A 4AL6A 4DI6A 3T7ZA 2DT9A 1ZBIA 5HVFA 3I96A 4J5OA 4C8OA 1YK9A 1GTEA 3RB4A 2E88A 4X62F 4PWWA 1RT7B 3VEOA 3KHHA 3ET6A 2KFNA 4IFEA 1F3FA 1Y0HA 3UNGC 4WYLA 5KFDA 3QNWB 4RNOA 4PUOA 1SJ4P 4BRGA 2OEJA 4IOCQ 2N3OA 5C42B 1CJVB 1QJHA 4K8XA 2FSKA 1XWLA 5IWAK 1BOTO 5H9EJ 2J7WA 1NHUA 2PC6A 4FJNA 4QIWD 2D1CA 1U1PA 3K89A 3CXCM 1ZH5A 4YORA 3FZLA 4I64A 2EXUA 4ZVRB 1Q53A 5DM7Q 2HF4A 1LFPA 3HFKA 4KGVB 1S48A 3DXSX 4FSVA 3MEDB 4JKEA 1N5YA 2XZDB 4DX6A 4LQ3A 4CW7B 4GKJK 4K0KF 2Y1RI 5DZ7A 1IKVB 2ZH7A 3ADAC 2P9UB 4WCEQ 5HRPA 2LXUA 2YWHA 2HK3A 3UFCX 1YZ7A 2DHHA 4KHNA 2XYHB 2BW7A 2WCXA 3GU0A 2R42A 3U27A 1NPRA 2XMWA 2ITGA 1OH8A 4OLAA 1PG5B 2B8PA 1PBAA 2I6WA 2BX6A 1GLJO 3OYDA 3G82A 4RW9B 4W5QA 1HNZJ 1YXQA 2GVDB 1N33J 4GV3A 2QA4G 1M1GA 2RDDA 1BI4A 4DR3F 4ZVEA 3WQUA 5EWEA 4F0KA 4CZLA 1X7VA 2KHCA 2DH8A 4UUXA 4FP9A 1TFWA 1KVBA 2DKOB 3RAMA 3E8OA 2MDAA 3CW2C 1IQZA 2PO4A 5T7BA 1SC6A 2ADBA 3PO4A 2BMBA 4CHPA 3OY9A 2PEBA 4JI7F 3A8KA 1HBOA 3UKUA 2VH7A 3RTVA 2QLBB 2ZBCA 1X8DA 4H03B 1BQNA 2DPNA 4HCBA 4OJ3A 3BS9A 2D3O1 3O9RA 5A8WA 3Q8SB 3DYAB 1HQUB 3BDPA 1KCFA 2NXCA 5FDLA 1TVRA 4FZZA 2DR8A 3HOSA 9ATCB 2P5VA 3J7YU 4ZPWR 3V81A 3MHYA 3DOMA 3THXB 3NCPA 2PYLA 1VQ8S 3LAKA 3PFOA 3OYAA 3GG4A 1AT1B 1BHNA 3RRGA 1QM9A 2XY6A 4P6QA 3LTOA 1HYSA 2E1YA 1C0UA 3I87A 3MUTP 4TSXA 3HPHA 3DXMB 3GE9A 4X64F 5HMYA 3CJ8A 4RBVA 1IM4A 2DHXA 1EXQA 4ZIVA 1NGBA 5B0DA 5KI6A 5KFSA 2NRWA 1U6BA 4LFBF 1VC0A 1U6FA 4I6WA 3FZ2A 1VGYA 2DNPA 2ZFHA 2D0AA 3ILLA 1U1KA 4GC6A 1YJ7A 1HWLA 4H4MB 2VFSA 2YWFA 2ZQBA 2Q43A 3HHKA 1R8CA 3LP2B 3VQAA 2F9WA 2ZHOA 1BUXA 3F2KA 2YV0X 3QEXA 4CLPA 2L9WA 2AP1A 4IG3A 1N5TA 2VWBA 2IS3A 2AU0A 3VAHA 2WUSA 4RNNA 1R31A 1TKXA 3BSNA 4M63A 3AVNA 3P3DA 2V4JA 2J8SA 3I31A 2KXHA 2QM1A 1U49A 4F7VA 1VOMA 2H48B 3SBGA 3ZZRA 3S3MA 2YTCA 4JI6K 2C2OB 2M0GB 4I4BA 2E9TA 2AD9A 4Q45A 2ZJRL 1D3WA 3T5LA 1GLAG 5AR0A 2ASMA 5I9EB 3J7Z5 4PRFA 2R2SA 2KO1A 4F25A 1L3TA 5CZXA 4QWBA 1A6LA 1AZSB 2YKPA 4DV2J 3CIMA 3SPZA 2ZM6F 1JLGA 3MM8A 3K5NA 4BGBA 4CZJA 3V6DA 1F1BB 1K1QA 5DS7A 1T6DA 2PMHA 4USWA 2V8VA 3OYKA 1IR0A 2FLOA 5KFKA 3EO3A 2HLUA 3NF7A 3EE8A 4DFMA 5KFOA 2DR5A 3RMCA 2C2EA 3J81j 4JKDA 1DLOB 3NGYA 3L4BC 3R6MA 3CJ7A 4OGCA 3KJNB 3GTYX 3RB3A 3CCRN 3CCSN 1RBOB 2BKNA 3SNNA 1TL3B 3EKUA 1PC4A 3C19A 1RI7A 4BLGA 1Q8IA 4QR1A 4MK9A 2PDAA 2DNHA 3ULEA 5AQMA 1WSEA 4UQGA 4WU3A 5HSPA 2KM8B 4L6V3 1S6PA 1HD1A 2VFRA 3KK2B 3N28A 1DTTA 1QS4A 1FVQA 4LRFA 2OD4A 1XEZA 3SCLE 3MM9B 3QMQA 3MTKA 3HHLB 1KVJA 1PYSB 1T8EA 2HW3A 4GMKA 5KT3A 2BE7D 2ZH9A 2MZJA 4K5SA 4DX5A 3QEIA 4FL9A 1MSWD 3FMBA 2FZGB 1VC6A 4J37A 3THTA 1XNRF 1BIUA 2CAJA 4CERA 5A2QU 1VQ4S 1JLCB 3N4WA 2V0NA 4L3QA 3CB4A 3M9NB 1KQSM 4ZN1A 4CESA 1IV0A 4JKGB 1IKXA 3I0SA 3HK2A 2D7SA 2MZSA 4IO9L 1YZ6A 4J9OA 2V69A 1Y3KA 4X4OA 3JAMU 3OW2R 1DTQB 4HHJA 2A18A 3GG1A 1D0EA 5KFWA 3M6XA 3HDSA 1BY9A 2MHEA 4V1Ak 4CD3A 1Y64A 1NO8A 1S1XA 3TA2A 2Z2YB 3KMQA 3FDSA 1TUYA 2IRYA 1KDNA 1OKJA 1R89A 2V2KA 2CQIA 2M88A 1CJTB 2ZGYA 3CFPA 1FDBA 2HGNA 3BKUA 1SJQA 4LD0A 4X84A 2MKSA 2AKWB 1NUEA 4NCGA 3AAPA 3KK1A 1JLFB 3AVCA 4BR9A 4OYPA 2NR0A 5BXIA 1RB0A 2VC1A 4FXVA 3AH6A 4M3XA 3JYTA 2Q0RA 2R7TA 3PKYA 4QCLA 4CO4A 2W9BA 2E5LJ 1LWCB 3I8BA 5EWGA 4OX6A 1WOQA 1TAUA 4PKGA 3CJSA 4MTPA 1W97L 2V7YA 1YQHA 1T03A 2L48A 2D69A 1RHQB 1UEKA 3CDAA 5AT1B 2AEMA 1P6TA 1TK8A 3RYLA 3LZIA 4YDXA 3VGVA 4E7LA 4M3WA 1L5UA 3Q23A 1YJWN 1VSFA 1QLNA 2MQMA 3KLHB 3MPYA 1W2BR 4L74A 4BRLA 4R79A 2W9CA 5ADXA 4FWOA 3MD1A 4KFBB 3PSIA 5M2PA 5FLXU 2VQFJ 2KG1A 3LDNA 1ROFA 4RWXA 2KG0A 4BG8A 1SI9A 2UUWA 2HRTA 2O8EA 4LF2A 3F56A 3GJRB 4YQWA 3ET6B 2CYYA 3PFEA 3DRSA 2P9IA 4DTOA 1T11A 1BL3A 2VJVA 4PUOB 4IJAA 3N9UC 4OZ0A 1ICEB 1UFLA 5AQOA 3FEYB 1FNXH 1HIYA 4YHHJ 4NOHA 3PM9A 1QAJA 1FJEB 3OLBA 1GMUA 1HNZK 1N33K 4ANCA 5JJBA 2VPZB 1VSDA 1LXJA 1WSRA 3LF0A 3MD3A 4F4AA 1SPBP 2HQDA 4TYAA 3UDCA 1N6QB 5IC4B 3QJPA 1ZYQA 3NNAA 3Q22A 2A1BA 3IGNA 3BBFA 2OZSA 2NXUA 3E3XA 2B4OA 4ZA1A 3WIUA 2MEWA 2NXNA 4LREA 3IFEA 4IQXA 2RQCA 4WU2A 3AGRA 3E66A 4XEIA 1K0VA 3GPAA 1JIHA 1G1XA 3HBTA 3CULA 3HKWA 4E1MA 3PW7A 2UXBF 1IBLF 3KKSA 1X1PA 3J8AA 4C8MA 1RAIB 4M5HA 1Y11A 2OEKA 2MLYA 1U04A 4Z0UA 3BSOA 3G6XA 3QEPA 1IWAA 4JI0F 2GBZA 3VGSA 3VAFA 4BE0A 4F50A 2PMZD 2C28A 2QA4S 4QYRA 2CZ9A 4A8YA 1BI4B 2F1FA 2IGIA 4CI0B 2E44A 2E4LA 4MKVA 3R5CA 4CJ5A 4FJ9A 3T41A 3ENWA 4IH6A 3C94A 4CYUB 2QL5B 2E1CA 5B8HA 1KS2A 4CEBA 4LFAF 3R9PA 3JQMA 1KC8O 2KHDA 3KUGA 1QTMA 3MMBA 2CQCA 3C16A 2OD6A 3W2VA 3D1OA 3TW0A 1HBOB 5HI7A 3UKUB 4NLRA 4BRQA 3IAYA 3DHWC 4C6AA 5CD4A 1TKTA 1BQNB 3H2VE 1O1WA 3Q8YA 2ATLA 2R7XA 4BRPA 5A8WB 4E1NA 1ZBFA 5FDLB 1TVRB 3E2EA 4OZ1A 1YBTA 5GVQA 4YR2A 2R2RA 1WBBA 3K5OA 3V81B 4U8VA 4BS2A 1CQMA 3L6QA 4KAZA 3DOMB 4B9SA 3UWTA 5HL7L 1UMJA 3MDQA 4KI4A 5BR8J 4ZCIA 5C25A 2QL9B 1G2EA 1RXOB 4NXMJ 1TL5A 2NZCA 1H7XA 3A3OB 3ZT0A 2XO6A 1XIQA 1ZPVA 4QJVA 1FWKA 1HYSB 1C0UB 2W4DA 1HQEB 5KFZA 4RNMA 4A46A 2QKBA 3R5DA 2VODA 3UD3P 4GY2B 1TTHB 4FJ5A 2H9ZA 3MFHA 2W9AA 3FK4A 3CM5A 1VQLN 2JEJA 1MMLA 2POKA 3QT8A 1OWXA 2VB6A 2LCWA 4DWIA 1BG3A 3SMSA 2OEMA 1XJWB 4Q44A 1RAJA 1DJ0A 2CWXA 1U8SA 2UXCJ 3H2UB 3I32A 4A8WA 1UPMB 3QYYA 3QDKA 2ZJRQ 1WNSA 2MZQA 1VIOA 2X3DA 4H5RA 2F96A 3F5TA 2F4VF 1TP7A 2LFVA 4ZP9A 4EU0A 1B99A 3PUFA 2YQ1A 4A62A 4J9VA 2BR0A 4JKAA 2GHVC 4DV2K 1XK8A 1HWUA 2C3MA 4DL2A 3EL2A 1TL4A 3SQ4A 3HPOA 2LA4A 3SUQA 1YGYA 4IG3B 2J0SD 3MCOA 4QS8A 4OYIA 4K4TA 2CPEA 2GQCA 2GMLA 1CJKA 5KFHA 4FYYB 4F4YA 2LQ5A 4K8ZA 4OPHA 4DV4J 3SI8A 3S01A 3AA4A 2GGPA 5H9FK 4KHRA 3EY1A 5CAAA 2P51A 4H0YB 2AGOA 4JK8A 2MB0B 3GFYA 1CULB 3R6GB 1R43A 4PEOA 2MLXA 4LSLA 1VRUB 3D0HE 4ECXA 1NGJA 4NA2A 2F7VA 3MEEB 1RDBA 3RB0A 2NS1B 3I4PA 1KR4A 3T1YJ 4DMZA 2VG7A 3OTCA 1FERA 4Q8EA 3TJ8A 1P27B 3P8BB 4F4ZA 1VQYA 3CMAS 1HMVA 3VR1A 3D7SB 1JLGB 2EX3A 3MM8B 2RSQA 1FKAF 4FDFA 1RBLA 2CUYA 1J53A 2GS8A 3CJTA 2ACYA 4Z2XA 1RACB 5BRHA 4Y34A 5KFMA 4GRSA 3V9WA 4DHYA 2PFFB 1W25A 2WTFA 4CLYA 1VR6A 1S72S 3OPKA 4NEYA 1D9DA 3KG0A 2KM8C 4CJWA 2FY8A 1XMOJ 2XMVA 4B8CA 1ZOTA 2P6TA 3OS1A 2WSFC 4P7VA 4DCJB 2FF6A 3R1XA 2VUGA 3CF5L 3RBDA 2OH2A 1N8RO 4IO9Q 2QYCA 4ZMMA 4DPUA 4M5JA 4Z4IA 3HHLC 2BVZA 4HTUA 4MK8A 4DDFA 1LOUA 2XCAA 3EYZA 3W63A 3DNCA 5AQJA 1K8KA 2D0CA 4K4YA 2PA8D 1S6PB 1BGXT 2D74B 3CC2S 4ED6A 4YB5A 4DLGA 1JCGA 2IVYA 4C11A 3GV8B 4LF4F 1DTTB 4USTA 2OKQA 4X4RA 4DTJA 3EE3A 4QYZJ 2Z4PA 1H72C 4PKDB 3MDFA 5B08A 3VQCA 1TUVA 3M2VA 4JI5F 3S41A 5HP1A 3G71N 4ETXA 3QLHA 4AL7A 3TUIC 4CH1A 4DV1J 4B3MJ 5LL6Z 1VRTA 3KWGA 3QRQA 2CQ3A 1H98A 5DZ6A 1NSQA 4HR2A 1CZAN 1XTZA 4DMNA 1D4XA 1RT3B 4A5BA 3LDQA 3KHLA 3MK6A 1N36K 4DOZA 1D8YA 3P5JA 1OMSA 1X9MA 3I0SB 2QX0A 1O6XA 2RMLA 3GB0A 1HNWF 3FE1A 2V9WA 1RAGB 3ZX3A 1S1TA 2FBTA 2HWHA 1ZXOA 1C1CA 3T1HF 3PHEA 1NEEA 4MH8A 3IR6B 4CBUA 1KFDA 1YBUA 2Y0SD 2MQLA 2O01C 1S1XB 4ZVSB 5U47A 4ZLNA 2ZOFA 1HBMA 4DCOB 2O3DA 2KVIA 3VCDA 2VQFK 1MN7A 4LR8A 4J8FA 4W5TA 4DBQA 1NU4A 4DTMA 2OAUA 2Y1LB 3TYTA 2DO0A 4NCGB 4X66F 2QEXN 4CZMA 4QWAA 4CZFA 3KK1B 3H08A 4AQYF 2UUAJ 2BZ2A 2FJVA 5FROA 3S7RA 3RBEA 3WXMB 4YHHK 3JYTB 4QW9A 1RCHA 1NNEA 4FJMA 2W9BB 3OYGA 4JRQA 3QIPB 5E0OA 1FRLA 2PFUA 1P9YA 1QQMA 2WOMB 1VQ9N 3DCAA 3FFIA 1T03B 3PIPQ 5DETA 2FC9A 2J9DA 1JL1A 1IUJA 5K9FA 3MM7A 5LJVA 1MN9A 4RUHA 4OJRA 4WYBA 3KLFB 3J80U 3H5SA 3KFWX 4J9KA 2YXLA 5AJ3F 3LGMA 4OZNA 2W9CB 1B7YB 2K06A 2HHWA 3BB5A 3CCUN 2RIJA 2YI1A 3OYMA 5L1JA 1KFSA 1NJWA 4USMA 1E6VA 4H0TB 4I7FA 1HFEL 3QIOA 1R59O 4RW7A 2O8EB 2X7IA 2XY5A 2D1KA 3DRSB 2P9IB 2GCFA 1PJ6A 2YPYA 1ZTWA 4HVJA 4DPOA 3AOBA 1U6ZA 4EO6A 2H1YA 2QWLA 4DL3A 3K0JA 4MT1A 1RTHA 4YOEA 1URNA 1QY7A 1WG5A 5JUMA 4GKKJ 1IBCB 1HR0K 4Y00A 1WUUA 2OPPA 3ZZTA 1RYRA 5EDWA 4JOUA 3QEVA 4B3RF 5JVGL 1HLUA 1L3SA 5D8HB 1A9NB 2VBZA 2I8EA 2WBNA 3DLBA 5KFLA 1VQON 4PWUA 2PFDA 4XH1A 5A2QY 4DV7F 4WXOA 3HXMA 2BXJA 2X6NA 1DBDA 3OYIA 4JV5J 1R7IA 2MQOA 4I6MA 1YJ9N 2VQEJ 2B4VA 3JAMY 3W9JA 2FUG9 5I3PA 1IKWA 2WVDA 1N56A 3WC2A 1NJXA 2J8AA 1EKEA 4HACB 4OVLA 1QZ6A 5BR8K 1AFIA 1U2CA 1KC8T 2MSSA 4JV2A 3ISZA 1VSIA 1KWMA 1VFJA 2MXYA 2DY4A 3TPQA 4CM0A 3JTNA 1B7FA 3L7UA 2HIYA 1MLAA 5EU7A 3B6OA 2Q3SA 4XDDA 4LF7J 4ELVA 4ILGB 5AZIA 3NNHA 3L3VA 3VQ8A 1T3VA 2FJBB 3MMBB 1ZBHA 2EPIA 3W2VB 1SC1B 1TKTB 1Y5LB 3DDNA 2E1PA 2F8SA 3KWMA 1M5KC 2Q3PA 5L1LA 4C2MA 3LPYA 1UVJA 2QN6B 2FF3B 3QFUA 3AT1B 2HPUA 2MGZA 1RHMB 4B3TJ 1F5CA 1NK9A 2XNRA 4FNIA 1NK5A 4P52A 3CJBA 5C25B 2W7PA 4Z4CA 2HVEA 3PKMA 2IDEA 1YJNS 1EWRA 2A6MA 3VF6A 5KTQA 2D3OR 5FLXY 4A8SA 1FNMA 5EOYA 1NDPA 4DV4K 3L0QA 2A6AA 4R0EA 2D0OA 2WZ1A 1UJ6A 2E1AA 1UEUA 1W7WA 2F9JA 2NXEA 3BEXA 5J2QA 2A5XA 2JLGA 4H4OB 5AXLA 1OPZA 2GA7A 2RD5C 1TUUA 1KHVA 3NOGA 3I9ZA 3GYNA 4CEQA 5BR9A 2VGMA 5LJ3Y 3T1YK 4CJFA 5MLCQ 4UY8O 2CA9A 3EXYA 1S5JA 2HBKA 1JXVA 1QE1A 4BACA 4M95A 2XYGB 1NSKL 3Q8UA 3H59A 2GUIA 3KOAA 2CPXA 3ASMA 5KFIA 4OI6A 1XQSC 2V68A 2J6TA 1CJKB 1SH0A 1VBYA 2B4PA 2AA4A 2OUGA 3HD1A 3I9V9 3K2YA 3OQ2A 4PCQA 2GGPB 2PE8A 4Y3CA 3M1FA 4DU4A 4K2XA 4Y2KA 4ZTJA 3GJQB 1KTQA 4KO0B 2B4UA 2VONA 2RHKA 2W01A 4DR2J 3AVHA 3R2DJ 1XMOK 1Q9YA 2GV1A 3OS0A 5B7WA 5L9NA 1B0PA 5BYSA 3N0VA 4HTLA 2WSCC 3OYHA 4LSLB 2AIRB 3CF5Q 1HPZB 5F8GA 1ZBUA 1FEHA 4FJIA 4AXIA 3W1YC 4LF8F 2DH7A 5CY4A 4O3OA 2NRXA 3FUYA 2NUUG 3PSFA 2F65A 4LIRA 2CQBA 3CERA 3QSYB 5M1FA 1JJHA 4CVNE 3CCMS 3NCRA 3MPDA 3MR7A 1RU1A 2CH6A 4LF6F 4Y0WA 4DU7A 3G9CA 1LV5A 5J1EA 1N8RT 1HNXF 2BRLA 2G1DA 4UQTA 3RRHA 4O4GB 4NLVA 4BHQA 1JLAA 2YJEA 2DXFA 3L3CA 4DV1K 4B3MK 1HYZA 3TJAA 2YCHA 1Q4RA 2M7SA 3SAGA 3POTA 3HOTA 4M3RA 5E84A 4B9VA 1RISA 4DUYF 3C14A 4B08A 1BQXA 2AGPA 4IKAA 5M1PA 2XHBA 5AQVA 4JI4J 4ZKAA 3IRWP 4ES3A 3CCTA 1HWKA 3CEDA 3NH0A 3H7HB 1HI8A 4M41A 2BJ7A 3TUZC 4ISFA 4M7YA 3THWA 4A2BA 1K8KB 1QHTA 5A8KA 3AVGA 4C11B 2R7UA 1C6VA 4J9UE 4BVPA 3E1YA 4J7CA 1S5ZA 8ATCB 2ZH4A 1R0BG 1BIZA 3NS7B 2A3JA 1S0NA 2OPQA 1CZ9A 5AQSA 4JN4A 3QEWA 4GW6A 4N77A 1LWFA 3LQVA 4U7CA 5HP1B 4FJHA 3VWSA 1C0FA 2FDNA 2BE2A 4IFVA 2G4BA 1DAXA 4AHCA 5LOQA 4BRMA 5ETNA 1VQPS 1VRTB 4P73A 1PSDA 3C6HA 2DNGA 4DN0A 1NGFA 2ZJQL 4KHPJ 2HYIB 1E4GT 4DR7J 1UW4A 1YBAA 4OI1A 1P8ZA 2ZDPA 5A2QO 3FBEA 5DDRC 4WTOB 1VK0A 3TR5A 5J2MA 2KH9A 1S1TB 1C1CB 2OJ3A 2ALZA 1EO1A 4DL6A 4IR1A 4LSNB 1QVGM 3VEYA 1WKJA 1N4LA 4ECZA 3V9SA 3V1RA 1HBMB 4IFYA 2DR7A 3A5NC 5KFQA 3I55N 4AD6A 1NK6A 1VAZA 3P5TL 1J5EF 2G9OA 3TAFA 2ZHBA 1FK9A 3KJVB 2YWEA 1HX1A 3J7YP 3TTFA 4IZ9A 1ELOA 1MA9B 4F36A 2BRKA 3SCIE 4WFBL 1YI2S 1VQ8N 1SC3B 2FHMA 2ZGZA 5FRMA 3HFVA 1FDAA 1F9HA 2V8PA 3NMAA 5E5NA 4LVNP 4RR5A 4GKKK 3Q2SC 1J9AA 3ONQA 1FFSB 3FFIB 3SCKE 3ZT4A 1XI1A 5KT7A 1IVZA 4AFFA 4OPJA 1T05A 3RW7A 3D66A 4GVEA 4IQMA 2EEYA 2IA0A 2QIFA 2P9SA 4OV1A 2YNFB 1MROA 3GBTA 3V6HA 5JMNA 1GLBG 1BHLA 1Q8LA 4FKYA 4FVMA 2BACA 5MAOA 1FDNA 5BPMA 1JLBA 1E6VB 4U8YA 2XZWA 3AVMA 4NLGA 4J9MA 2R2UA 4I7FB 4RW7B 5B0BA 1NGEA 5GADI 2OCEA 1N32J 3MMAA 4FWSA 4JV5K 2N7YA 2VQEK 1BLUA 1Z2LA 2QTWA 1KAYA 1EETA 6AT1B 2J6UA 2GW8A 4F8RA 2RAQA 1TL7A 2F40A 4Y1DA 1RTHB 2XLIA 4FOIA 3MR3A 3H90A 2VL1A 2G2OA 1U1QA 2FXUA 4ED3A 3R8EA 1UL3A 3VQPA 3NGUA 2E1MC 1U1OA 2OPPB 1WOPA 2KN4A 4CEDA 1RHKB 2RU3A 2RDJA 4DG1A 1ZA1B 3LANA 2LU2A 2V7ZA 3GJSB 3CTRA 1NPPA 2PN6A 3BYPA 2VC0A 4JS5A 2QKKA 3EVOA 4M3ZA 2APOA 1QVFR 4D3GA 3QZ8A 4LF7K 4R25A 2VBWA 4Z4EA 1TK0A 4DV6J 3TABA 2QRRA 4Z4HA 4O0IA 3HHNB 4QQBA 3W0LA 1S99A 4HTIA 3ENVA 4XDCA 2ERRA 2HFZA 4I6MB 3AD7C 3QRPA 1SL1A 1IKWB 2IAJB 4NLSA 2FHJD 4B3TK 1R3NA 2IRXA 4DS5A 4CHNA 5BJRA 4OHVA 2LEBA 3P6YC 1QQCA 4LR9A 4G3IA 4DR4F 3RSEA 3TZXA 3OV7A 4JKFA 5CZ2A 2CNNB 4RUBA 4BRNA 2JLEA 3TAMB 2BH1A 1AROP 5E26A 3V6KA 4LRBA 4ED0A 1K9MO 3EGVA 3UCGA 1YRXA 3LGNA 3NE6A 3WUHA 4DUZJ 1EX4A 2FSJA 5AZIB 3PX6A 3FCVA 2XMAA 1Q1KA 3KD1E 2KYZA 1QAIA 5KRTA 2CJBA 2RRBA 2IVNA 3PJXA 1KVAA 2CJQA 5IQ6A 4OHYA 3HI9A 2DY9A 2GC8A 3UN3A 4XTTA 2PI5A 1NDKA 3KLEA 2V51B 3Q8VA 4X4SA 5D0RA 2MGZB 3OSNA 1U25A 3CPWR 3J80Y 2E8AA 2ZDOA 1GX5A 3H46O 5A6PA 2IVOA 3OVAA 4NLPA 1W26A 3AFGA 1BCMA 1U0HB 4X65F 3RUBL 3SV4A 2HRYA 4IOBA 2RQ4A 5C2CA 2MKHA 2KT3A 2DH9A 2W8KA 2W7OA 4TQRA 1JLQA 2NZ4A 2R8IA 1NK0A 3M2RA 5M1OA 4C0BA 2FQQB 3K5MA 3DM2B 4A48A 2C2NA 4LF9F 4PKHA 4RUAA 2HNDA 4X4UA 4B1UB 4MKYA 4UY8T 3ZT3A 1SH3A 1IBMF 3FFKB 1V5IB 3PZPA 4DR2K 5A0YB 1W2IA 3DXBA 5J2QB 1UVNA 4DFKA 3MCNA 4D3HA 2FBYA 4DPXA 3UCUP 3LWMA 3VQ9A 4EBDA 2J7UA 4Y2IA 3TWZA 1MWZA 1NBEB 2CH5A 1DEJA 2XI3A 4TLRA 3FVYA 1EZZB 3BQ1A 8AT1B 5JLHA 1ZBSA 2FJEB 4EYIB 2MQ8A 4BDZA 1QE1B 1B0TA 2D3ZA 5KPRA 3KUEA 4WP8A 3O4WA 2VDHA 2MHNA 5KPZA 3ZZOA 3HTVA 4BY9C 4NLTA 1FCAA 3HHLD 3MPUB 1X4GA 2I7PA 2QO3A 4QWDA 2VCPA 5THWA 2PI4A 2AEJA 5E3CA 4L73A 2GFFA 1RADB 1URRA 2BW2A 1V3ZA 3KIOA 3GYXB 4F0MA 3RBXA 4O3SA 2B56A 2CQGA 2DR9A 2VA2A 1U2VB 4QPXA 4X4QA 4DCHA 3TSUA 4Y2MA 1EIYB 2FPHX 2P9LA 4O44B 1SB6A 5AFUA 4J2BA 4M42A 2AYBA 1SS6A 3GLJA 3MR2A 2HFUA 4MIAA 4JI4K 2YHXA 1QQOA 4X62J 2F7TA 3LA0A 3NS5A 3EPGA 5LJ5Y 5KRSA 1X31C 3ISNC 4NLWA 3AVJA 3EUNA 1EKRA 3THVA 1NKCA 3MMJA 1P1TA 5IM0A 1QQNA 2R8KA 1CEZA 4HVZA 4CIEA 1QVFM 3B54A 3EZ5A 3S3NA 4OGEA 5J1EB 2H4WB 2OSRA 1AUSL 3DGPA 3UN5A 5AQRA 4MO4A 3K5PA 1WDTA 5ETPA 2JFKA 1JLAB 1E3MA 2AJ4A 3EWGA 1I94K 2BM0A 4HL9A 3ITHA 3BSCA 1MDUB 1TU0B 2DEJA 2NZTA 3MF5A 1VLYA 5C24A 4KHPK 4K0KJ 3WX8A 2ZBRA 4DR7K 3UW1A 2C3PA 3C14B 3LDPA 1VSMA 3VQDA 5B0FA 1IXKA 2IVMA 3ZTQA 2VD3A 1JXBA 3JTOA 4NLXA 2JRSA 3CJKA 1O5JA 4USJC 1TYQB 3TARA 3THWB 4IKFA 1XNQF 3UKRA 3EEQA 1M5PC 5IS2A 2K1RA 3CCQN 1H6KX 4NPOA 4FWRA 4BGAA 1TR0A 2OPQB 2HEKA 3GIRA 3S8SA 2OPRA 1LWFB 3A8YA 3E9LA 3A5OC 1KLMA 2EC0A 4ZLJA 2BE2B 3QWPA 1T02A 4PHTX 3QGHA 2GVZA 3BUZB 3VPZA 3OR2A 1VSHA 2DPIA 4B1ZA 3GILA 3X1LB 2NLWA 3BREA 3AXMA 4CBWA 1GMWA 2RS2A 4H0OA 4ZLPA 3HT0A 3IWNC 5BREA 1TK5A 2LKZA 3O3GA 2RPIA 2F9DA 2HZVA 4ZN3A 1YUWA 4MIWA 1IH7A 4EP4A 5J2MB 4C9DA 1ATRA 4CEFA 4JI7J 2A40A 4FF3A 3ZZZA 4CO3A 2QG9B 1NHVA 2HQGA 3B78A 4K7QA 2CQDA 2D41A 1NZ8A 1FE0A 2XHWA 1S6UA 3HI0A 3OYLA 1RBAA 2CGLA 5HLFA 4I69A 3RW6A 3V6JA 3LUYA 3F9KA 3EZOA 4KREA 2ALYB 3C66A 2Q2RA 1FK9B 1S7IA 1WD6A 4B1VA 2UYTA 2I1RA 2VKRA 4DV0K 1HHTP 4RWTA 2JZ5A 4X64J 4GMJB 2HBQB 3BGUA 3O6QA 3X3UA 3D67A 4O23A 5HBMA 4LFBJ 3DI6B 4YB6A 5GADP 3SQ1A 4CFCA 3DRXA 4EZ6A 1IJJA 2LSNA 2FSNA 4DS4A 3O80A 3W8PA 4KGKA 1S6QB 2ZZMA 4EP5A 4ID5A 2HWIA 1T05B 1RJJA 1H38A 3HVRA 1K0TA 2FVRA 2P9SB 2X74A 3LPUA 1MROB 1WI6A 2CFXA 3LW5C 1C2PA 4KV8A 3TQ1A 1JLBB 3AY0A 3IC1A 4DTXA 4BC9A 2DIVA 3FKBA 1VI7A 4DV6K 4RW4B 4BREA 4OYMA 4CEAA 4B3SJ 3LP3A 5L1IA 2SXLA 4JYAJ 4IEEA 5DGAA 1WHYA 3KKFA 1X3NA 1Y9OA 2DD8S 3P5BP 2DXEA 1PO6A 2A1SA 1S0OA 1EETB 2PAVA 5E41A 1TL7B 4Y28C 4NA3A 2EK1A 3U8XA 3AD8C 4J90A 3KLIB 3OR1B 2ITMA 1G7CB 4OJ1A 3AB4B 3DOKB 3CD0A 2BJ8A 3L95X 3BDEA 3WXIA 4F3MA 3ZSWA 1KD1O 3L7OA 3LM9A 5BN9A 5C42A 1RBTA 2EC2A 1NGGA 1P9QC 2QLWA 2OTLN 2GIFA 4ZDNA 1ESVA 4DG1B 2EKYA 4ZVTB 2HVDA 3FGUA 4CLUA 4XH4A 2JX2A 3J81O 5ETOA 4ECWA 2AX1A 4ZVFA 2XULA 4QOZB 3W66A 5RUBA 1CPZA 1MWMA 1VQKN 2ZM6J 3HVWA 2E5GA 4RW8A 3CCES 5JS2A 3MEDA 4KSEB 2B6AB 4O55A 1FD8A 2HFSA 4QOTA 3SUPA 5LMNF 3THPA 5KFVA 2HHPA 2P9UA 1ZETA 5F8JA 1SJRA 1FX4A 4CJVA 1LW0A 1K9MT 1SJ3P 1R6VA 2QE5A 4P2SA 4TVAB 4CK2A 1UVIA 4ETZA 3O4NA 2WB1D 2B7CB 4RW6A 5HQLA 4N7TA 5F8NA 5CYQA 4ILHA 2Z58B 4PXCA 5CR4A 4HWIA 2FHKA 2UXDF 3CPEA 2DY1A 4WFAL 3RSEB 3H98A 2BE9B 3VMFB 5IWAJ 4M5MA 4DX8H 4DX7A 2GVDA 2QGFB 3TO8A 1UVMA 1BUPA 3M2UB 4JI3K 5T14A 4MMOA 4N76A 1UPPA 1G3OA 1YAGA 5DM7L 2Z1IA 1F5BA 3EE9A 1RT6B 3R5BA 3O5BA 3S3OA 1X4BA 1S4FA 3MCPA 1Q5YA 1RHJB 3AO5A 3KNGA 3CC2N 1FESA 2Q6CA 4RZRA 1KAZA 4WCEL 2XS7A 3DOLB 4H5WA 1UWBA 1SKSA 2NPIA 4NASA 2DGSA 2QLXA 2ZBIA 2G2ZA 1XNRJ 3CJ3A 3IXQA 4W98A 3FLCO 1UFKA 3MGJA 1NWKA 2A2CA 3L3UA 4XPEA 4BR7A 4ZP8A 4RPFA 2L9DA 2GMHA 2FB0A 5KFYA 4OQJA 2E7XA 5HMWA 2UZAA 5ETSA 1RBSA 5AQLA 3QICA 4KH4A 3TRGA 4BRFA 1JLQB 4QWEA 2KRBA 3QPIA 3WXKA 2DYAA 4LFCF 2NYIA 1T44A 2IIHA 2JWLA 3P39A 4OYWA 2HNDB 2FVQA 1DURA 1O13A 4BC2A 4FK4A 3CC4S 3GV7B 3BPSP 2E5LF 2DHSA 4XAKA 1WEYA 1S77D 3OL9A 2FBXA 4JHDA 3VV2B 4KRWA 3C15B 3W60A 4C3KA 4X62K 4KB1A 4DZ6A 4P2XA 3WHIA 4EZ9A 1NBWA 3BKTA 4OFZA 1IJEB 3LP2A 1RAOA 2QWOA 3UE2A 4BC5A 2C2KB 4LVOP 3AA2A 2FHJA 3RJMB 3ZEUA 1U1RA 2Y0BB 5GAEI 4LIWA 2P9NA 4QIEA 2NRRA 3TZZA 2B8QA 4NI2A 3TVZA 4NLQA 2CQ1A 4B9UA 2AV5A 4XIUA 4K59A 5LJWA 1BC6A 4OPKA 4DTNA 4A2AA 1YRUA 4K0KK 2VHGA 2W24A 3QFPA 4WK1A 2UU9F 2B7BB 5HQMA 3DLGB 1REGX 4CF9A 2Y1IA 1SJ1A 4DSFA 1AFJA 1HBNA 1Z2ZA 1RQ0A 3CJ9A 1ITGA 5F8MA 3QO9A 2MSTA 2DPJA 2ATQA 1XR6A 1VJQA 5HATA 4F04B 1RLDA 2I9SA 1N34F 2O66A 1TV6A 1K1SA 4QAGA 5GMDA 4L8RB 1HJOA 4A4JA 2QWQA 4O3QA 1Q78A 1AZSA 4EFAC 1W9HA 2CQ0A 3FZFA 4YDUA 2JL9A 5JS1A 1ASVA 1JX4A 2ABYA 4DN9A 2ZWPA 4OKEA 3SFUA 4DR3K 5A76A 3PR4A 3VQEA 4JK7A 5H1SQ 4BRKA 2D9OA 3UIQA 3VALA 5C24B 2KXNB 3BR8A 3CCVN 3K7RA 4UZCA 4CJEA 1ASWA 1MW7A 1Z26A 1J5OB 4FLZA 5HMXA 5HAOA 3HM8A 2XY8A 3MECA 1O51A 3KZBA 4JI7K 1WWHA 2P2CB 3OFHA 2YH0A 3CD6S 3CJKB 4BR0A 3A8JA 4CGIA 1HHQA 2RHQB 1TL3A 4KB7A 2Q1NA 3IM9A 3UKRB 3WNFA 3BBCA 2LQ9A 3CC7N 2UXBJ 2K1RB 1IBLJ 3D1HA 1CZBA 3HKZD 4F4WA 3VQBA 3CCJN 1NB7A 2Q97A 3NKYA 5DRKA 1YITN 3KLVA 3OVNA 3FBBA 4JI0J 1KLMB 3EMTA 1GT8A 2E1RA 3NLCA 3WNHA 4ZOSA 2Q31A 4NYFA 2LEAA 1U48A 4E98A 2CDQA 5DDQC 2GVZB 3OR2B 3MN7A 3PYFA 3PX4A 4X64K 6FDRA 1WBDA 4FZYA 4I2QA 1RDCA 4KB0A 3CQXA 3G8TA 4DF4A 3SAHA 3TAEA 4LFBK 4NB4A 4N8NA 2EFQA 5CE3A 2WVFA 1JCEA 4NXMF 5KAKA 4HEA9 4W92B 4P74A 4CEEA 4F0HA 2J9DE 2RUSA 4UF4A 4Y0FA 4MLEA 4ZS6A 4J9SA 3JSMA 1ZM3A 3N6LA 3WIVA 3BBBA 4FBUA 3G6VA 2W25A 5E3RA 2OYQA 6FD1A 5HLFB 2CDRB 1K47A 4QS9A 2NUHA 4BC4A 3CJ1A 2UXCF 4OL8A 1O8BA 3Q7BA 3BGFA 4LRDA 4M94A 1DARA 3ENOA 2ZH6A 3NY0A 1HBUA 4PYAA 3SSSA 1F5AA 4LF1A 3BZQA 1R8BA 1VLOA 3RB6A 4RJVA 4NCBA 3R97A 3OJUA 5TKWA 5HBMB 2BQUA 1IG8A 3OVSA 1JLFA 4OLOA 2CVIA 2LQBA 1C1BA 3Q83A 5SZTA 4K4ZA 2MQQA 1M1HA 5AE2A 4ID5B 1LW2A 1LWCA 3FJ2A 4FYWB 1QAXA 2V8DA 1VQNN 1OVYA 1NK7A 2F4VJ 3DLLL 4PQUB 1OY8A 1FX2A 2R3VA 2QWRA 2YKMB 4KV8B 3AA3A 4OPAA 2EK6A 1ZC6A 1GNKA 2ZM6K 3KLHA 5D3GA 5AQFA 2E6MA 3TVKA 1Q18A 1KD1T 3TU5A 2V9KA 4I2PA 3AAQA 2DIUA 3DRRA 2FGOA 5ETKA 3J7AP 3EPIA 1B64A 1D5AA 1A0OB 2NNWA 2RT3A 5AXNA 1HWJA 4O0JA 3ZC4A 1ZAXA 5HMZA 2IOCA 1EX8A 3HJVA 3IAM9 2XC9A 3DRYA 3U3GA 4WFAQ 1LK5A 4BROA 2ASOA 2MJNA 3U1NA 3CCRS 2VFTA 2OI2A 4DR6F 2XLKA 1NH8A 3OSPA 4XH5A 2BABA 1ACMB 2FIUA 1RP5A 4FWMA 1N6QA 3CHWA 1AUDA 3LP0A 1S22A 4PG6A 2YKOA 1AXQA 4RW8B 2GNKA 1WSVA 1VBXA 4CI6A 2XWYA 4K5RA 4DSEA 2VKZG 2UUBF 4KQZA 2BANA 3I4HX 2CIMA 3Q8RB 2OELA 3CCMN 4OYXA 3DLHA 3QBCA 4LSZB 1LW0B 2NLXA 5KT6A 3SQ0A 2GIRA 3ZLJA 3VVTA 3VETA 1ZAVA 1XNRK 4OYBA 2DNKA 3V4MA 2NQPA 4ECUA 3JTPA 5KQ8A 3VEVA 1XHXA 1WC0A 1S76D 4B9QA 3CCWA 1CJUB 1FKOB 4ZTFA 1UP1A 1X60A 3PY8A 4RW6B 2X3GA 5IT9O 4FJLA 5CYQB 1NKBA 2QWPA 1C0MA 3SLCA 3U1LA 2EBGA 1EB0A 3TAGA 3Q0AA 2HG4A 2HFOA 1B70B 4WQ4A 3K5LA 1XN9A 4CH7A 3O1LA 4HCCA 3QFHA 2JLFA 3TVYA 3TX0A 1TQLA 2N82B 2V63A 4ELTA 2KW4A 1EP4A 3VAMA 4CZEA 4HHTA 2UP1A 4PQAA 4LF4J 2WW4A 1CSJA 3AV9A 4IR9A 4OZ2A 2XSJB 2OFHX 3M6GA 4M3YA 2CGKA 2HZCA 5C7PA 1WUAA 8RUCA 1DY3A 4CGDA 1GLCG 3UD5A 4CYUA 4UT4A 2FLNA 3QBXA 4MK7A 3BPDA 3N5FA 2BQ3A 3M8QB 1S1UB 1BXNA 5A6WA 5DGBA 1UWBB 5EUHA 1JXEA 2VASA 5J1NA 4AE5A 1VQMN 1FJGF 3N79A 3W2WA 3P38A 1VHXA 2QJ3A 2Z2ZA 3RVCA 4FKXA 3NXZA 1LAVA 3K9JA 1U26A 2AJFE 5L46A 3QAUA 1FNOA 1SQFA 4DEZA 1R0AB 1VQPN 1KQSR 1YJTA 4BWJA 1HNWJ 1LWXA 5HO4A 1N5VA 3UB5A 2ZUAA 5ETVA 2KB2A 1MMNA 4OLPA 5F0XA 3G0ZA 3ISND 1RA6A 2EW9A 3T1HJ 4ISEA 1HD0A 3H5XA 2CNLB 4JKCA 4CJRA 4JRPA 3G4SN 3JSYA 5KFFA 1HQEA 2DNNA 1X5OA 1M1KO 2XEXA 1V6HA 1HJRA 3VESA 5GAEP 2NREA 3IWLA 2CJKA 1YJWS 4JHDB 1RTJB 3TP2A 3OYJA 3O1WA 4E7IA 5LL6d 4CLTA 3PX0A 1RTIA 5JMVA 1EARA 3AQOA 3HT3A 2D3UA 1YVFA 1G99A 5H1SV 4X66J 4AQYJ 2Y9HA 2XI2A 3IBWA 3B4MA 3AA8A 4NLUA 2G8FA 2CGJA 1X4DA 1JJ2R 5F9NA 1OIAA 4JV0A 2P8IA 3ZEUB 1CS4A 2P9NB 3PW0A 1ZAWA 4FF2A 1VSKA 1Z1ZA 1B4SA 1UTAA 4NI2B 4EHTA 1I39A 1LAWA 3ZZPA 1OYDA 4DPYA 1A5WA 4FVUA 2E7VA 4V19J 5EWFA 3SAFA 1YRTA 5AJ3J 1DT9A 5BPNA 1QHAA 3VAKA 1T9VA 1WC5A 2CJYB 3CDBA 1RUSA 1UZHA 2VZ9A 4FBTA 2E2NA 2ROGA 4FWKA 5KG6A 1H73A 5GAHI 3R5JB 4KBIA 4OX8A 2PEHA 2Z57B 1HBNB 1AW0A 3DGVA 2DFHA 4CJQA 1CULA 1I5OB 5KFAA 1SKWA 5C10A 3QO9B 1ZBTA 4J2EA 1XBWA 3H0PA 1VRUA 4TN2A 3KTQA 2W4PA 2IM3A 4CH0S 2UXBK 4CECA 1IBLK 3MEEA 1TV6B 4ELUA 2VDIA 1OYEA 2WHOA 1NH7A 4H4KA 1Z25A 3CYMA 5L1KA 4PAAA 3FC9A 2CQPA 1PJ7A 4JI0K 2HHTA 3D2EA 3TSQA 2PA3A 4JUZA 2L08A 4B3RJ 1QD1A 3FRZA 3GOIA 4KTWA 4NL5A 5AQXA 4OMFG 5AQUA 1HNVA 4CGJA 2OPSA 3VTHA 3K59A 5H9FJ 4IUFA 4I68A 3U02A 4LFAK 4H5TA 4LJMA 3W3DA 5CHCB 2O8DB 4DV7J 1RK8A 1HI0P 3MECB 1XMQF 1MWQA 4WFYA 5KFXA 3PLAA 3JS9A 3NAHA 1WACA 1F21A 3BF3A 5DG8A 2CPZA 2IMOA 2E5HA 3GIIA 3GE1A 5HRNA 2MTLA 2LMIA 1SKRA 3HM9A 3G25A 4JAXA 4B9MA 1FXLA 3IAS9 1NG9A 4R5PA 1VSJA 3IR7B 1NJZA 2CKWA 4JS4A 3HJFA 3GR0A 3QAEA 3K2PA 4RU9A 2YHBA 4C1NK 1X5PA 2EWHA 4WK3A 3NVKA 4OX9F 4O3RA 3C8YA 1IG9A 2OANA 3DDIA 3HP9A 3M8PB 1KONA 4I2QB 1RWMB 3OTOF 4DV5F 4EBEA 4CF2A 1JL2A 4LBPA 2X1BA 2F9TA 4KYZA 1GLFO 5F1XA 1VQLS 3ILOA 3B8HA 1RT3A 1IJFB 2ROEA 3I8DA 3AA5X 4U6PA 3CJ0A 4KHWA 2FVSA 3QGIA 2ZVSA 7FDRA 1CLQA 2F4VK 2W6LA 3AVAA 2HQIA 3DLLQ 3JSMB 4RBTA 2G0JA 1SL0A 3A3PB 2C2MB 4Q8FA 3P49B 3ZETA 3LDLA 2RILA 5ETRA 4KRFA 1UEVA 3QWUA 3JXUA 1YTAA 3O3FA 4G9ZA 1H0HB 4Y65A 4PA1A 3NGZA 3D6HB 2W2NP 4YOTA 1KAXA 5ADXH 4NZ0A 1R27B 4F2RA 4KR0B 3J7A1 3SYZA 2RE2A 1HBUB 4Q0BB 5GMKa 2W41A 5KT5A 1YIJS 2ASPA 1SXLA 5GIOA 1RWVB 3C6UA 4FS2A 1NGDA 3EJMA 3UD4P 2CPJA 4DL4A 2E7WA 5KOXA 2XNQA 4Z7YA 3TEHB 1JKHB 3ZXWA 2FJDB 5D4NA 5LMUF 4OYOA 1C4AA 1C1BB 4Z37A 4C0HA 1JJ2M 3TUJC 1ULRA 5ETLA 4P9SA 3OD2A 1LW2B 1WB9A 1N36J 3QIPA 1U0SA 5M1QA 2Z30B 2WOMA 4CLFA 1JXLA 1BD6A 1J54A 4UOCA 4C98A 3KDOA 3ZZUA 2YHWA 2VIHA 3KLFA 2BTFA 2GJFA 4BG9A 1NB2A 5D3GB 4CTAB 2VFUA 4ANDA 4OI4A 3OHAA 3W5XA 1HLWA 4I2PB 5DLGA 3BY5A 1WTFA 4JI2F 1I1GA 3DRRB 1P8GA 5EXWA 4DR5F 4B1WB 4DR1F 4KKOA 3PRVA 5KG7A 3SDEA 3MWBA 2I5JA 5BYQA 4URQU 2DCLA 3H6EA 5KGWA 1KOHA 2ZZNA 2XQCA 2X6SA 3BN7A 3AO3A 2H65B 3MTJA 2DGUA 3LOUA 3C3LA 2AZ1A 4LF8J 1GK8A 3EKSA 3PIPL 2V34A 3CJ5A 5ETQA 2O1PA 3AA9A 1H7WA 3GDQA 2R7OA 1U1MA 3AGKA 3LM2A 4LF4K 1HKAA 2HBMA 4FW2A 3LP0B 2B9WA 4LMZA 4LBHA 1VISA 4FXDA 4LR7A 3H20A 2MKIA 4JI5K 2RS8A 1LXNA 5EGYA 1RT4A 1HNXJ 2KT5A 2BANB 3MCAB 4OX7A 1G6BA 4FJGA 3I56N 4NXNF 4UZBA 2R7QA 2ZVIA 1I51B 3KLGA 3G71S 2QSWA 1HUXA 3SIPB 5CD4H 2WVBA 2HBJA 2JVOA 4Y2AA 5GAGU 3SBMA 2R4FA 1SL2A 2CNKB 4NA1A 2K8GA 5C0YA 1PIEA 4E1JA 4HACA 1HNWK 4CHYA 2HOEA 2XO7A 1HA1A 2WFBA 3T1HK 1WELA 3H45C 2QA1A 1HR0J 4QWCA 3W9HA 3K58A 4HUFA 1EP4B 3VQ5A 1N54B 2P9PA 3PYDA 2L41A 4PPDA 2ZKTA 2ZWHA 4EMDA 4ZJQA 3WXLA 5D4PA 1H1VA 1ZPWX 4ZVQB 5T41A 2R8GA 5ETTA 4DQQA 3FQLA 1UVKA 4G6VB 2YWKA 3HMJG 3GIJA 2V50A 2KJVA 5CQGA 4X66K 4ECQA 1S12A 3S6EA 4AQYK 4E3SA 1X0FA 3W2WB 1F2GA 4C3MA 1JLEA 5HN0A 4B02A 2G8WA 2QK9A 1M1KT 2QEXS 1NOYA 3TWHA 2H5JB 4FLVA 1MU2B 2KZMA 2HK2A 4EHUA 1F3VA 2YQ0A 4UOGA 3IBFB 4MKBA 3NGRA 3WXJA 4CHOA 4HT7A 1Q0NA 3PCOB 1W0HA 4PWDA 1Y3JA 5GADU 4YUDA 5AJ3K 4ZP6A 2IM0A 3IP0A 2BKOA 3KK7A 1TGOA 5I3QA 5E3QA 1J5EJ 4HI1A 1SVDA 2G1HA 1T94A 3CCUS 1RTIB 3BYRA 2HHHF 2O4GA 3EZWA 2CQ2A 2K7JA 3IM8A 5F3ZA 5D0EA 4NMXA 1FVSA 1KQFB 5A8RA 3VOVA 4H4OA 3QRRA 2HF3A 4EYHB 1ZM9A 4OHZA 2KQ2A 5GAHP 5DMRA 1T9XA 2Y8YA 3GFHA 3M1VA 5AQZA 3P4IA 2HS0A 3MPVA 3A5LC 4EIAA 2N3LA 4K42A 2YKNA 3CQ8A 1CS4B 4FWLA 2J0XA 2YNGA 4TU7A 3B4DA 4OI3A 1RBUA 3UE5A 1H2UX 1N32F 4KGMA 3K9KA 2AP6A 5AQTA 4KBOA 3PACA 3H1QA 1X5TA 4B3RK 3O3LA 3UDEA 3ENQA 2IA6A 2KFYA 3G10A 2KL8A 1KHWA 3F44A 2X78A 5DQIA 3FQKA 2GUPA 3KHGA 4DB3A 5HJYA 1RABB 2IHR1 4DV7K 4KO0A 1S79A 3SK3A 2RQMA 2Z1JA 2P5OA 1F0XA 4KGZB 1U4BA 3DXKA 4ECVA 5F41A 3SEOA 2X51A 4YB1P 2V2VA 3M7VA 2KHOA 4YDUC 1HPZA 4E0DA 4C97A 4FO0A 2KKHA 3SPYA 3SMPA 4DV3F 3E01A 4MDBA 3QZ7A 3PNIA 2BJEA 1RWNB 3U9DA 4M5KA 2WB4A 4FLUA 2MZRA 3HVAA 3D2EB 3CMEN 2VBXA 1WNEA 2LEPA 1JQGA 3ELHA 3AO1A 1HNVB 2LA6A 2OMLA 5ADZA 2OPSB 4O4GA 2W7AA 3ETOA 4CO0A 4B1YB 1PAEX 4F4KA 3TAQA 3BH6B 1CXUA 3CJCA 3N4PA 4H0VB 3HSCA 3O9SA 1VQ6N 2AJ1A 4FVCA 3F73A 2FJXA 1X4EA 3B6BA 2MQPA 2C3YA 2IVFB 3ENAA 2G8KA 4R8UA 4M5DA 3VEXA 2CG8A 4O3NA 3PDNA 3D54A 2PD1A 1VQ7S 1RHUB 2GAHC 4M5IA 1Q81O 1FFWB 2KU7A 4YDDB 1ZA2B 4DUZF 5E33A 1WSJA 3H4DA 2J9CA 3GR1A 4CNYA 1TKDA 3ZSQA 4R5PB 4Q43A 1WOOA 2AHOB 1HW9A 4ED8A 4F02A 4P71A 4YY3F 3DDKA 1XC9A 4K50A 4ED4A 4O3PA 1S7HA 4USHA 1U2FA 4DSJA 2L3MA 1QSSA 2R2TA 1RU2A 4EWTA 1RKJA 2O8CA 2RF2B 2Q6BA 4U7UD 2YNIA 2CVEA 2XZTB 1XC3A 4PR6A 4QU6A 3RR7A 3AVIA 1N5SA 1SIZA 5C2GA 2FHOB 3KWIA 3B6PA 5J2NA 2FVPA 5KQDA 1S4EA 1KQKA 3D6MB