1RT2A

Crystal structure of hiv-1 reverse transcriptase complexed with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 145
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt2A05
1S1TB 3MECB 1KVBA 3K57A 3V9XA 2V4QA 4ZP8A 1S1UB 2R2RA 3CFOA 4FLYA 3U3YA 4FJJA 1VK0A 3HSTB 3RAXA 2YNIB 4KI4A 2QK9A 3M9NB 3TAMA 1DLOB 3LZIA 4ED1A 2WTFA 1VRUA 5HP1B 5K14B 3QGHA 2E9RX 3SYZA 3MEEA 4DMNA 4PUOA 4NYFA 4BWMA 5EU7A 3S3OA 1J5OB 2R8JA 4J2DA 2KW4A 3CJ0A 4Z4GA 4F4XA 2G8UA 3GIMA 2GIRA 5C5JA 3AV9A 2IMWP 3TAEA 4IQXA 1BHLA 3QEPA 5CZ1A 4CJUA 1TVRA 4DG1A 5KT4A 3HO1A 3OYJA 1GOAA 1QSYA 1Z26A 5F8HA 2ILZA 4RNMA 1C2PA 1JIHA 2YHBA 4QWBA 4IOBA 1S4FA 3IRXB 3ZSOA 1KHVA 1O1WA 4MIAA 4O3OA 5KFEA 2XY6A 1SUQB 4ID5A 3VQSA 1BI4B 3ICLA 1J54A 4DFPA 3ISNC 3IG1B 2XC9A 2UVRA 4ZVFA 3PVXA 3DOLA 4LQ9A 4NLRA 3V6HA 1ZYQA 1NK9A 1RTDA 5DMRA 5C25A 4FK0A 5KTQA 5J2MA 1YTAA 3AA5X 2YKMA 3LPTA 5DLFA 4DL5A 1DTQA 5KG4A 4IFVB 2RKIA 1Y97A 3VQDA 4KRFA 1LW2A 4J9NA 1RTHB 3V1RA 1C1BA 3TABA 3BQ2A 1I39A 3VQCA 4H4OB 3NF7A 3EZUA 4GMJB 5KRSA 4DL7A 3SI6A 1C1CA 1EX4A 1XR6A 1HYSA 4ZVHA 5DGBA 2C2RA 3NAHA 1QQCA 2B6AA 1S9GB 1S1WB 3C6TB 4J9RA 2X6NA 2Q3SA 5KG2A 5FRNA 3AVLA 1D9FA 3MEGA 3T3FA 3EPGA 3E01B 5HBMB 5T14A 1W9HA 2HMIA 4TY9A 1RA6A 4IH6A 3K58A 4KREA 3TAGA 1R0AB 4EBCA 4BE2A 2OZSA 3OJSA 4PWDA 1UWBB 2ILYA 2HB5A 4CGJA 2BGGA 5DG7A 4YMEA 3HPOA 5SZTA 4FLWA 4E7JA 2ZE2B 5L9XA 4GC7A 4F2RA 3RWUA 3D28A 4O4GA 3SPZA 4NCBA 4HHTA 3VQ4A 4CFCA 5CYQA 4LSNB 4CHPA 2VG5B 2BRKA 4X2BA 5KFTA 2V0NA 3L2WA 1L5UA 2YNHA 4CJKA 5K14A 4TQSA 3TAFA 3N6LA 4W5TA 3QIOA 1S1VB 4DTJA 3RB4A 5CYMB 2IM0A 3BGRA 1J9AA 1A5XA 3V6DB 3NGDA 3H4DA 1T05A 1WNEA 1RBUA 4ECXA 3BDPA 1BIZA 2XY5A 4PQUB 4DSJA 2KZMA 3DI6B 3RB6A 2FBXA 4IKAA 3L2UA 3DLEA 2W9BB 4FK4A 3OS1A 1I6JA 3QERA 2HNZB 3DYAB 5HRPA 1IKYB 4FZXC 4ZPCA 3JYTB 3V6JA 5KFCA 4K4XA 2DFFA 3MEDA 2I5JB 4KAIA 4CJRA 1SKWA 3HT3A 3OYCA 4NCAA 3TWHA 2V9WA 1N6QA 1IG9A 3MR5A 4NLQA 4CEOA 3BQ0A 4FXDA 2HWHA 4IRCA 3ITHA 3MXMA 4NCGB 3H40A 5KGWA 4K4TA 3SUOA 3P5JA 1RTIB 3DM2B 2FVQA 4FCYA 4RW6A 2F8SA 4KV8B 3PHEA 3OYGA 4CFAA 2XGQA 4DTSA 4F2SA 3F9KA 1SKSA 4XPCA 4QWEA 4DFMA 5KG6A 3QEXA 2J6SA 1IO2A 2IJNA 5F8MA 3GIIA 3VQQA 5SWMA 1JLGA 2KZZA 2HNYB 2D7SA 1EP4A 2XY7A 2HWIA 1TKZB 1D8YA 2RPIA 1DTQB 4CJSA 4ZPAA 5KT2A 2X6SA 4NLSA 3TAQA 1N48A 3CYMA 1X9WA 2BANB 3JSMB 4K50A 4KHNA 3Q8PB 4MK7A 4HKQA 5J2QB 4PA1A 3OSNA 1NOYA 3NH0A 3KHGA 4KHUA 3IGNA 3TR8A 3MECA 4JRPA 2B6AB 4MIBA 4Y1CA 4M45A 3TVKA 5KFDA 3VQ5A 1HJRA 3L2RA 4IH7A 1N56A 3I0SA 3V9UA 4KPYA 4RUCA 3HXMA 2GC8A 3BJYA 2W8LA 1DLOA 5KFIA 1VRUB 2B43A 4QW9A 1S49A 1VSDA 1JKHB 3ULDA 5I3UB 5L1KA 1NJXA 5KFFA 1JX4A 1S6PB 2YNGA 1QE1A 1FKOA 4RW4B 3QO9B 3G6VA 4R5PA 3BREA 2E6MA 3TAMB 1K6YA 4W5NA 3RBEA 2FBTA 4DQPA 1YTUA 4ZP9A 3VQ6A 3DMJA 4GC6A 2JC0A 4Y3CA 3QNOA 5D3GB 4TYAA 4O3RA 4Z0UA 1SH0A 3SJJA 3LPUA 1GX6A 4KKOB 3OYEA 3KHRA 1NOZA 1JLBB 3TI0A 2HHQA 4K4VA 3QIPB 4EYHB 1XHZA 1T05B 3H59A 4R8UA 3K5OA 3PX6A 4KHWA 2Z1HA 4O0JA 2FLLA 4ECZA 1S1XA 1N5YB 2QE5A 3ZT4A 1EETA 4CK1A 4C8KA 1XHXA 3CO9A 4N41A 2FJWA 4FW2A 1BCOA 4XO0A 4URSA 4DQRA 3B6OA 4QAGA 1A5WA 3MEDB 2JGUA 1FKPA 4J9OA 4AHVA 3KD5E 3MF5A 4PUOB 4ZTJA 1QHTA 1S0NA 1ZBIA 4FJMA 5JS1A 3P83D 4ECVA 2YHAA 1NHUA 3GV8B 4NCGA 4K8ZA 1HNIB 4FZYA 1RT5B 4F50A 4BDPA 4E7IA 4HCBA 2KFNA 3ZSYA 1S9GA 1LWCA 3C6TA 1QTMA 1WSHA 3TARA 2AJQA 4G1QA 2B5JB 3PW0A 3QESA 3AVMA 4E7HA 1N4LA 2DFHA 1JLGB 5C24B 1RTHA 4DU3A 4NLTA 2JLEA 4FJ9A 5KT5A 4NRTA 4DQIA 4K4SA 4CHOA 4J2EA 3KLVA 1SV5A 1EKEA 2P51A 1T8EA 3KOAA 4N47A 3M8PB 4H4MB 4CFBA 2UVWA 4Q43A 5KFHA 4FJNA 2FC0A 3OYFA 4CJLA 3HVTA 3DOLB 2VA2A 1KVCA 1U04A 4DTPA 3OYIA 5HP1A 5HRSA 4LSLA 4HVJA 4CJ3A 3CQ8A 1JL2A 3SUNA 4H54A 4KHRA 4DU1A 3D5MA 2YNHB 3C95A 1UWBA 4F4KA 1RAJA 4LD0A 3DOKA 4CIEA 5HLFA 4CJWA 4ICLA 5HROA 3GIJA 2UUTA 1GOBA 5JUMA 4QOZB 4J9QA 4KO0A 4MKBA 4FJKA 1WSGA 5CYQB 4RW4A 4CE9A 1REVB 4R5PB 4DG1B 3GILA 4KB0A 4QWAA 4O3PA 4CGGA 4MFBA 3KK3B 1IKWB 4EZ6A 3OLAA 3O3HA 3MXJA 4CGDA 1RT6B 3DMJB 3UIQA 2AGPA 1QSSA 3OYLA 3HJFA 4L8RB 1OS5A 2ZD1A 5KFWA 3PV8A 4TLRA 3BGRB 1KCFA 3V6DA 1FXXA 3AVIA 1L3TA 2G8KA 1JLFA 4I7FA 3PW5A 1VRTB 3SPYA 2UUWA 4CERA 4ID5B 2B4JA 4OKJA 3AVCA 5KFMA 3D0PA 3DLRA 3CFPA 1C0UB 3L8BA 4FLZA 4KAZA 3V6KA 4OLBA 4MKAA 1LW0A 4IH5A 5KRTA 2XWYA 3LP0B 4BACA 1TKXB 3DYAA 4I9QA 4NLGA 3DRPA 4F8RA 4J9MA 4RZRA 1RTIA 4N56A 3I8DA 1BL3A 2O4IA 1HPZB 3OYNA 1QUVA 3MEEB 4DL2A 2X78A 3M9MB 1IKXB 4KHSA 2Y1IA 4HUEA 2JEIA 2HNYA 3WNFA 2WHOA 4MH8A 5EWEA 3LWMA 3DLGA 5EDWA 3IAYA 3ZSQA 4O4RA 1TV6B 1JLCB 4KFBB 4CEBA 3B6PA 4LY7A 2IAJA 3NKYA 2QV6A 1SUQA 2ZQBA 3RMCA 4DSKA 3QLHB 2BQUA 3BR9A 1TGOA 4O3QA 1HQUB 3RMDA 4I2PB 2HNDA 2IM3A 3HP6A 3K5NA 1RA7A 4DS5A 3PX4A 4O5BA 2G8HA 1HARA 1UAXA 1NJWA 3NF9A 1NK8A 3PJXA 1JXEA 5F8LA 2VWJA 4DSLA 1RTDB 4J2BA 5KFXA 2FBVA 5F9LA 4M41A 2R2SA 2OYQA 2HHTA 4CEZA 3H08A 3E51A 3S3NA 4H8KA 3OJUA 3IRXA 4ELVA 2D3UA 2WONA 4F3TA 4OGEA 2ALZA 1JLQB 3ZT1A 5JS2A 2R8HA 3NH1A 3KLEA 4EBDA 2IM2A 4M42A 4FS2A 3AVJA 3V9ZA 4F4YA 2G8IA 2CKWA 2HW3A 3SI8A 5E41A 3HVRA 1S9EB 1S1WA 4R0EA 2KTQA 4M3YA 1L3UA 1RT2A 2HMIB 4K4UA 4CK2A 4N76A 1BQNA 4Q0BA 1ASVA 1DTTA 3QIDA 4ED3A 4B9VA 4IRKA 4ZMMA 2IS3A 4H4OA 2E9TA 2YKNA 4JRQA 4C8MA 4KSEB 3RAQA 4QWDA 1QSLA 3CVKA 4RNNA 4E7KA 4M3UA 1TL3A 4CGIA 5KFAA 3QEVA 5KFZA 3G10A 1K1QA 2HHVA 2D41A 3KK2A 5KFBA 5CZ2A 3H2LA 3A2FA 3AA4A 1VSHA 4XPEA 3PZPA 3ZSRA 3I0RA 1WN7A 3SQ1A 1S6QB 1RNHA 4DTMA 2FVRA 4OLAA 3QZ8A 2YV0X 1TK0A 1S1VA 4O55A 1KLMA 3V1OA 4R8UB 3TAPA 4AHUA 4C8LA 4ED7A 3G86A 1T3NA 2I1RA 3KLIB 1X9MA 3K5MA 3OL6A 3KLFA 1LW0B 3QYYA 1C0MA 3AVBA 4JV1A 1YT3A 3MTKA 2IJFA 4AILC 4OPJA 2W42A 3KLHA 3O3FA 3QNNA 5F8IA 3NAEA 4J9SA 1NNDA 3SQ2A 3V1QA 4O0IA 4CECA 4G1QB 4B9SA 3HL8A 1IKXA 5F8NA 1ZTTA 3NGYA 3K59A 3DLBA 2AWZA 4GVMA 2D5RA 2I5JA 5J2QA 4PQUA 3DLGB 1CXUA 3M8QA 3IS9B 4FW1A 1HMVB 1JLCA 4KFBA 3NHGA 3NGZA 1RT5A 3VQ9A 4OKEA 4FM2A 1VSLA 1TL1B 2XY8A 4CJPA 3ITHB 3D45A 1L3VA 3QLHA 2VG7B 3N6MA 4I2QB 5KGXA 2HNDB 2JC1A 2OPQB 5J2MB 3NFAA 4EZ9A 1YVUA 2V4RA 3L3VA 1BIUA 2IC3B 4CJ4A 3ZSXA 3LP3A 3KMQA 3THVA 1LV5A 1NKEA 5I3UA 1LAVA 4NLUA 1C1BB 4CJEA 3SUPA 3CG7A 4DWIA 3PUFA 3DOKB 5J2PA 1C1CB 1RT4B 4HUFA 3DM2A 2DFEA 2FJVA 1XR5A 3QGIA 4QPXA 2F8TA 5EWGA 1S48A 1HQEB 5KFNA 4BE1A 1U09A 4AHCA 4CF2A 1MMLA 1RBSA 2DY4A 1TK8A 2Z1IA 3HHKA 3KK3A 4Q45A 3OL8A 4KBIA 5HLFB 2PZSA 1IKWA 3PW7A 4KTWA 3VN5A 4PWDB 5KG1A 2A1SA 4GW6A 1JLEA 1IM4A 3SV4A 4LQ3A 3QIPA 2PYJA 1JKHA 2RDJA 2W7PA 1YVFA 4RU9A 3G6YA 1WAJA 2D0BA 4ZHRA 3U6FA 2AU0A 4DU4A 1S6PA 1VSMA 5DQHA 2XGPA 2HHUA 1WSIA 4URGA 3H5XA 3LZJA 1FKOB 1RYSA 3Q8SB 3SQ0A 4WE1A 2JEFA 3LP0A 1ZTWA 4J2AA 1RT6A 1RT7A 4DL4A 3RMAA 1C6VA 1Q9YA 4CJQA 4AHTA 1T94A 4KTQA 3LALA 1X1PA 4ZPDA 4BDZA 4ID1A 3DRSA 4WFXA 4M94A 2GBZA 2W9AA 4FS1A 4W5QA 4W5RA 2E4LA 2OH2A 1C0UA 1ASWA 1IKVA 4DEZA 3M8RA 5KFOA 3NF8A 4IG0A 2EX3A 1HYVA 3H5UA 1TKXA 2OPPB 4RNOA 4M3WA 1LWFB 4NYZA 5KFPA 3KLIA 4O44B 4OGCA 3LANA 1REVA 1D1UA 5D3GA 4ED6A 3KLHB 1UA0A 4DSIA 1KVAA 2OPSA 2IOCA 3GV7B 1CLQA 1C0TA 4JS4A 1WSJA 3UQSA 3RMBA 2AX1A 3H4BA 2VG6B 2Y1JA 1NK4A 3LP2B 2ASDA 1KFSA 5F9NA 3NBPB 5FRMA 1SV5B 1JLFB 3PO5A 2UVVA 3GQCA 1CSJA 2UVUA 4M3ZA 3DRRB 4E7LA 4ECTA 3RRHA 3IS9A 3FQLA 4CJTA 4F4WA 1RDBA 5FDLA 3ASMA 4LH4A 2R8KA 1S0MA 4JV2A 3O4NA 4FLVA 3DLKB 2Z1JA 3HVTB 1BGXT 3F73A 4DTXA 5KFRA 4WXOA 4IDKB 5I42B 3RB0A 3KK1A 4NLVA 4YFUA 1U4BA 3MXIA 1ZETA 1S9EA 2OZMA 1BISA 4FJ5A 3I5BA 2HHWA 2R7YA 3UPFA 1VSIA 4FYDA 4RW8A 4ICLB 3PX0A 4CCHA 5HROB 1TAUA 1KLNA 1S0OA 5C24A 3CJ3A 1DTTB 3KLEB 1Z25A 3V9SA 3I5AA 3OYMA 5J1EA 5KFKA 1RT4A 2EC0A 2IAJB 3HYFA 1MU2A 2E6LA 4RW9A 1VSJA 4B3OB 2KQ2A 3NDKA 1TQLA 3QEIA 2B5JA 3ZSVA 3OL7A 4G3IA 2D3ZA 3KK2B 3DDKA 4CESA 3BSAA 3KJVB 4PY5A 1JLEB 3CDEA 4ZPBA 1ZBFA 3AVHA 1RDDA 1SH2A 2YNGB 2CJQA 2XO7A 1SL2A 4H4MA 3LP1B 4LH5A 2JEGA 1TP7A 4QCLA 1LAWA 1EXQA 4CHYA 4CF0A 3G0ZA 3CWJA 1KTQA 2OPRB 2HAIA 4M3RA 1S1UA 3DLHA 1UA1A 1RT1B 2VWKA 3C6UB 1RT7B 3VQEA 4Y34A 4ED8A 3N6NA 4FBUA 1X9SA 3EZ5A 1CZBA 4Z4FA 1BQNB 4Q0BB 2G8VA 2D0AA 4KO0B 2IGIA 1TV6A 4U6PA 3NMAA 2R8GA 1LWEA 3OLBA 1W25A 1VRTA 2RF2A 4CF8A 3H5SA 3QZ7A 3VQPA 3SFGA 2OPPA 1S1XB 1NHVA 1N5YA 4CEAA 3LWLA 1S9FA 2WCXA 3ZT2A 4CIFA 4FK2A 1T03A 3CIZA 2C2EA 3RRGA 3GYNA 4W5OA 1S97A 2O5DA 1HPZA 4CEQA 2G8WA 4IG3A 1GX5A 3KKSA 2X74A 1JLQA 2WOMB 1BCMA 3O3GA 5HRNA 3RB3A 1S6QA 1L3SA 1RT3B 4WYLA 4CK3A 3FSIA 1HRHA 4M95A 1KLMB 1TL1A 2AQ4A 3AVFA 4CHZA 3LAMA 2P1JA 4NLWA 4FLTA 4Z4HA 1BQMA 5C42B 2F8EX 4M3XA 4C8NA 2W9CB 5KFUA 4I2PA 4IDKA 4NYNA 2WRMA 4HYKA 2EHGA 2E9ZA 1CZ9A 3WNEA 4TY8B 4CHNA 4EP4A 4FJLA 2HHXA 2GIQA 1NKCA 4Z4EA 2ATLA 4FJHA 1HNVA 3V81A 3M8PA 4DTRA 4UQGA 1HQUA 1WNSA 3OYAA 3T5HA 5J1EB 1FK9A 5KT7A 1G15A 1ZBHA 3L2QA 4CHQA 2OPQA 1D5AA 4B8AB 4KI6A 1TKTB 4DFKA 2IC3A 4FJ8A 1R0AA 5KG5A 4MK8A 3SUQA 3PR5B 1XWLA 2J6UA 4ZVGA 1KFDA 4CEEA 4YR0A 4IR9A 2D0CA 5FROA 4N5SA 1U47A 5F8GA 4YNQA 1NJYA 4WYWA 3OYHA 2BDPA 2ZE2A 4CFDA 1SL1A 1HQEA 1RT2B 3BSOA 3PY8A 3CJ4A 3CM5A 4Q44A 1J53A 1ZBLA 3KHLA 3HPHA 3OYDA 5DG8A 2LSNA 1JXBA 2OPSB 3NF6A 3S3MA 2NUBA 2YKNB 1J5OA 4K4YA 1IKVB 4DSEA 4IRDA 2Z1GA 2IM1A 1TK5A 1RDCA 4BWJA 5KFGA 3KLGB 4YR3A 2RDIA 3HKWA 2HHSA 1A5VA 4NLPA 1NJZA 4ZP6A 4DS4A 3VA3A 3SCXA 4ZHRB 1B9DA 4CGHA 4WFYA 4AH9A 3RR8A 2FLPA 2YNFA 4HTUA 3DLEB 3KLFB 4FJGA 2ASJA 4WE1B 2YNIA 1XC9A 2FJXA 2HVIA 2BR0A 3K2PA 4YP3A 5J2NB 3KK1B 4ECSA 3NH2A 3GIKA 4ED2A 4CIGA 2P5GA 2R2UA 2YKMB 3DRSB 3EPIA 4B9NA 4B9MA 4ECUA 4U7CA 3AA2A 5KG0A 1W0HA 4FM0A 3AVAA 3ZT3A 1SKRA 4IG0B 4JLHA 3M8QB 3C94A 4IFYB 2FVPA 1RCHA 4J9PA 1LWFA 2FVSA 4ELTA 4DF4A 3VQ8A 1KSPA 5F8JA 1TVRB 1WAFA 4I2QA 4RNFA 3MEGB 3SFUA 4RW8B 3T1AA 3QETA 4FJ7A 1VSEA 4DTUA 1B9FA 1JLAA 3CDUA 3WNGA 5KT3A 3Q8QB 3LP2A 3PW4A 2ASLA 3RTVA 4RNHA 1WSFA 3FQKA 5L1JA 2AX0A 2RN2A 4DF8A 1RBVA 1Q8IA 3BSCA 2VG7A 4FBTA 4HUGA 5FDLB 1Q9XA 3S9HA 4DFJA 4ZP7A 3HP9A 3VQ7A 3NAIA 3O4QA 4LSNA 4DLEA 3IGVA 3ZSWA 4KTZA 3EY1A 2FVCA 5HRRA 4TN2A 4ZVEA 3IN5A 1WLJA 5J2PB 3T5KA 2RKIB 5T7BA 4KHQA 1QAJA 3MAQA 3NGIA 1LW2B 3CDWA 4B8CA 2R2TA 4K4WA 3L2VA 3KKRA 4CEFA 1XR7A 1TL3B 5L1LA 4DQQA 4FVMA 4KB7A 4WXWA 3T19A 3DI6A 4DTOA 1MU2B 1RTJB 3I5CA 3T5JA 4IKFA 3NL0A 2W9BA 5DLGA 3E01A 5HBMA 3AO5A 3CJ5A 1K1SA 3I0RB 4K4ZA 2WK4A 1T03B 3MFHA 4FLXA 3ZCMA 3NBPA 1D0EA 2AGOA 3KJVA 2BE2B 2WB4A 3WNHA 3TANA 1T7PA 2OA8A 1BI4A 2WOMA 3KLGA 3VQBA 1QS4A 5DK5A 4Y2CA 4CJFA 3PR4A 3SV3A 4ECWA 3VQAA 2ATQA 3HVAA 4KB1A 4TXSA 3KHHA 1UOCA 2ETJA 1CXQA 1IKYA 3U3GA 1B92A 3NCIA 2W8KA 2GV9A 3JYTA 4O44A 1RDRA 4MQ3A 5C42A 4RW7A 2VG5A 5KG3A 3SNNA 4Z4IA 2W7OA 1VSKA 4E1MA 4XIUA 3AVNA 4OPKA 3FFIB 5KI6A 4Y1DA 1C0TB 4E1NA 4YR2A 3OHBA 3AO2A 2AGQA 2G8FA 3MR2A 1NK5A 3V4IB 1HMVA 5L1IA 4JS5A 1I3AA 2BQ3A 4ZTFA 4NLXA 4YQWA 4F4ZA 2ZKUA 1BQMB 3HVWA 4RW9B 1NK7A 4URQU 4AHSA 3PO4A 1RBTA 4ECQA 4RG8A 2DPJA 3ZSZA 3MR6A 5DQIA 3IG1A 2P5OA 3DLKA 3H5YA 3H98A 3NE6A 1EP4B 3SQ4A 4EBEA 4M3TA 2JEJA 2VG6A 4DL3A 4DL6A 4TY8A 1Z4UA 1SH3A 2C28A 1VSFA 1NKBA 4Y2AA 4RUAA 4IFVA 3DRRA 2IDOA 2O4GA 4NLOA 4IG3B 3LDSA 4DSFA 1U49A 5EWFA 2PYLA 3KTQA 3AVKA 3L3UA 2IBKA 2C2DA 2KFZA 2BRLA 4NRUA 3AVGA 3TQ1A 3UR0A 4WZMA 5KFVA 4K8XA 2DTUA 3KMSA 2R8IA 3QEWA 3QINA 3HK2A 3KNAA 4WFZA 3BSNA 1RILA 3CM6A 4J9KA 4FLUA 1SL0A 4ED0A 4MK9A 4C8OA 4Q5VA 1S1TA 1HYSB 1U48A 1QE1B 4B9UA 1GOCA 1HNVB 4Q8FA 3OS2A 4KHYA 1QAIA 2QKBA 1S10A 2FBYA 5KT6A 2XCAA 2ITGA 5KFSA 3FRZA 4NLYA 4IBNA 3T5LA 4TQRA 5KG7A 1RTJA 3MFIA 2BQRA 3HPGA 4Z4CA 1EETB 1TKDA 4E3SA 1IH7A 3OYKA 3I0SB 4DTNA 4ELUA 3ALYA 3C6UA 3RR7A 1U45A 4QW8A 2XCPA 2ZD1B 5J2NA 3FDSA 1RT3A 4DQSA 4CEDA 3LP1A 4O3SA 1S5JA 4I7FB 2VA3A 2BE2A 3P1GA 4CJVA 4DLGA 5CYMA 1FKPB 3OSPA 4OL8A 4OVLA 1LWEB 2OPRA 4OJRA 3CJ2A 4O4GB 4ECRA 1ZBUA 5KFYA 3AA3A 3MR3A 1RT1A 5DG9A 4E89A 1NK0A 3PW2A 2DPIA 4E19A 4NLDA 4IFYA 1HYZA 2PY5A 1HNIA 4B9TA 3DRPB 1WSEA 1D9DA 1C1AA 2HVHA 4ECYA 1TKZA 4RW7B 3OY9A 3OS0A 2C22A 2QKKA 3K5LA 3VA0A 3Q8RB 3FFIA 1NK6A 4KKOA 4CJ5A 4Q8EA 3EYZA 3PJWA 3SZ2A 1KRPA 2RF2B 3V81B 2F96A 3V4IA 4B08A 1JLBA 4B9LA 4FJIA 2XI3A 1JXLA 1N6QB 1ASUA 4OKKA 4KE5A 2XI2A 3UDLA 4EO6A 3AO1A 2FLNA 4BE0A 3OHAA 5KFQA 3OL9A 2HNZA 1LWCB 3G6XA 3LAKA 3M9OB 5C25B 5I42A 1TAQA 4F3OA 2YNFB 2IA6A 1F21A 4RW6B 4J9LA 5KFJA 3HM9A 1RYRA 3V9WA 1TKTA 3BQ1A 3OVNA 5EUHA 4EO8A 2W9CA 1KHWA 4HCCA 4LSLB 3M8SA 3GV5B 5DGAA 3AO4A 2XRIA 4FM1A 1JL1A 2WONB 5JXSA 2QXFA 4BDYA 4I9LA 3ZT0A 4CF1A 3KIOA 2A1RA 2J6TA 3JSMA 3ISND 3QO9A 1ITGA 4EEYA 4KV8A 4NZ0A 4B3OA 3KD1E 4TSXA 3RBDA 4E0DA 3OYBA 1FK9B 4EP5A 3CFRA 3AO3A 4MFBB 1RDAA 4O3NA 4WZQA 4AHRA 4FJXA 1RBRA 3QGGA 4IR1A 2GUIA 2XHBA 4EYIB 2BANA 4TYBA 4JUZA 5DQGA 4CGFA 4FZZA 1XI1A 5KFLA 4JV0A 1JLAB 5CY4A 4CF9A 4KHMA 4QWCA
chains in the Genus database with same CATH superfamily
1KQGB 1KVBA 4GNIA 3K57A 4X62J 2V4QA 3NNAA 4YDUC 3JXOA 2R2RA 3CFOA 4K0KK 3U3YA 3DHXA 2HKEA 3H2UB 3P3DA 4ED1A 4JKHA 5JMVA 2RHSB 3CCUN 4DMNA 2PA8D 4B1ZA 3EDRB 1PYOB 3OTCA 4NYFA 2IVFB 1J5OB 3ENBA 3WX4A 4J2DA 2CNNB 2KM8B 3MM9A 3GIMA 2VU5A 5C5JA 3AV9A 4KHPF 1CJUB 3IWXA 3QEPA 1ZZNA 1SZ2A 2DO0A 4DR7K 3H8YA 2K1RB 3D6TB 4JI8K 4KHPK 5KT4A 3OYJA 3SAGA 4DMZA 3B8HA 2OUGA 2ILZA 1GH8A 1BLUA 2NYIA 5KPTA 4NZ6A 2CZ9A 3LDLA 4DV4J 3T1YF 1U1KA 1O6XA 2YJFA 4ZVSB 1AUSL 2BBEA 2LP4A 3MD3A 2OP5A 1KHVA 4B9QA 4BC3A 2VC1A 1YHQS 1O1WA 2XY6A 5E0OA 1AFJA 1BI4B 1J54A 3QDKA 1QVFR 1ZOTA 2XC9A 5KPRA 5HATA 3PVXA 3CE8A 4LQ9A 3V6HA 3HSJA 1V4SA 4GRSA 3UB5A 2I6WA 5J2MA 3UW1A 5DLFA 3IBWA 3CCUS 4IFVB 4CZHA 1WBBA 3O9UA 1VBKA 3GL1A 3T69A 4KRFA 5HQLA 1SB6A 1YG0A 1XMQK 1FJCA 3EVOA 5E3CA 3V1RA 2HZAA 1C1BA 3TABA 3VQCA 2O1PA 3NF7A 4GMJB 4DL7A 3HRGA 1XR6A 1HYSA 3I82A 3OR1B 4X4OA 4QYZK 4M5KA 5BN9A 4JI6K 2V7YA 2VONA 1S1WB 2Q6CA 5A6WA 3WDOA 4LF4J 2I7NA 3SAHA 5FRNA 3MEGA 3T3FA 3EPGA 2HGLA 5T14A 2HMIA 1EWRA 3TOQA 4OHVA 2WVEA 5E3QA 4ZJLA 4AM7A 2FGOA 1OQ6A 1UJ6A 3BF1A 1QLNA 4LIRA 3OJSA 1Q81O 3P4IA 2GVDB 3CC4S 4PWDA 1UWBB 4ETXA 2NRTA 1V5IB 2ILYA 2KJVA 1WB9A 3O6WA 4E7JA 4DX7A 5L9XA 4DV6J 5F3ZA 3VQ4A 4O5FA 5KFTA 3L2WA 3ZO7A 2YNHA 3J80U 3ONQA 3TTDA 3FZMA 3N6LA 5AE1A 3QIOA 1S1VB 4MIWA 2QWQA 3WXJA 2IM0A 4CLPA 2KB2A 1BA1A 1J9AA 1U6ZA 1W2BR 3NGDA 1WNEA 4JB8B 1RBUA 4ECXA 1VC0A 2DNZA 4ZVRB 2J0SD 2XY5A 5BPNA 4PQUB 2OI2A 4DSJA 1IBMJ 3L2UA 2WSFC 1PILA 4N8OA 3R1LA 1CEZA 1BOTO 1UL3A 3VERA 4K25A 4FZXC 3R7BB 2YPZA 4FVCA 4KJIA 4K5SA 5CXTA 2I5JB 3G6ES 2EFNA 1SKWA 5IS2A 2BMBA 4NCAA 1MWQA 4PAAA 1IG9A 1VOMA 5AR0A 2DYAA 3ITHA 4NCGB 4K4TA 4DV5F 3DM2B 3FMWA 5AQGA 1KOHA 4KV8B 3CHWA 3NGRA 3C6AA 4BHQA 2XGQA 4F2SA 4C98A 4DHYA 3P5TL 4DFMA 5KG6A 2RDDA 4DV4K 1UW4A 1S59A 1PC4A 4WCEL 2ZJRL 2IJNA 1JLGA 2HNYB 2X3GA 2D7SA 2XY7A 2AEMA 4F67A 4CTAA 2A18A 2E7XA 1QJHA 4CJSA 4F25A 4ZPAA 5KT2A 1X9WA 4OV1A 1YI2S 3JSMB 4K50A 4MK7A 4JI4F 3O5BA 3CCTA 3M1VB 4KHUA 4NYPA 4KH4A 3MGJA 3IGNA 3TR8A 3CIPA 4JRPA 3EEQA 3A5OC 4Y1CA 3UKRA 4ILGB 2OTJN 1RWPB 1F5AA 1T02A 1HJRA 3G87A 4USJC 3B4MA 3V9UA 2Q0UA 4KPYA 4RUCA 4NXMJ 1UCNA 3HXMA 3BJYA 2NXNA 5KFIA 1X7VA 4U67Q 4QW9A 1SC6A 1R8AA 2I9SA 2MY8A 1WUUA 1RSCA 4MKVA 1NJXA 2R7TA 5KFFA 2PEBA 1X4DA 4KH1B 3CCJS 4X62K 5IT9Y 3WQUA 4CW7B 3SCJE 5M1NA 1QE1A 1JCFA 3QO9B 4GVEA 3BREA 2E6MA 3HZGA 1Q79A 4RWXA 2EFVA 1YTUA 2CVIA 2MEWA 3J81O 4CLSA 1U2VA 5TKYA 3D3CJ 1RWKB 1NOZA 5AQOA 4LC9B 1JLBB 1LFWA 2KYXA 4K4VA 5F2RA 2PMHA 3IAM9 1FKAF 4JHDA 1T05B 3H59A 4K7QA 4DCHA 1Y9OA 4BQZA 3Q8UA 4O0JA 3HULA 2HPUA 5CD4H 1H6KX 4C8KA 3CO9A 4N41A 3KVGA 2FYXA 1RP5A 3BN7A 4URSA 3C2PA 1XJWB 2Q31A 2HURA 4ISFA 2N82B 1A5WA 2KRBA 2XMJA 3W5XA 1U25A 4ZTJA 4LF2A 1QHTA 1S0NA 4JI6J 2W2PP 4FJMA 2DNQA 2CA9A 3P83D 3U9DA 3RG6A 4NCGA 4A57A 5DM6L 4ZVPB 2CPJA 2KFNA 3H20A 3ZSYA 2M70A 3L4BC 1LWCA 3WQPA 1TYQA 3C6TA 2GNKA 4M5IA 3MCMA 2B5JB 3PW0A 5D77A 3D7EO 3E8OA 2MKSA 3Q8YA 3ENHA 1X5PA 1LXJA 1RTHA 4DU3A 3FBEA 1RAAB 2O8BB 4FJ9A 4M63A 4NRTA 3ULEB 1OJ4A 4J2EA 2MQOA 1EKEA 3L7UA 5IQ6A 2ZH6A 1YJVA 3M8PB 1A0OB 1YRXA 3UNYA 4H4MB 4LFCF 1BUXA 4BGBA 2XSFA 2ACYA 4CJLA 2VBYA 1KVCA 3D1HA 5D4NA 3WT0A 1RWVB 4CJ3A 2QWLA 4USMA 2YKOA 4H54A 2DH9A 4CIEA 5HLFA 4PKDB 4Z2XA 2CQDA 4IO9L 4FKYA 2VPWB 3WZ0A 1OSCA 5D0GA 2RE1A 4PHTX 1WSGA 4CVNE 3UDEA 1REVB 4QR0A 4DG1B 4FVUA 1JJ2M 2LEPA 2R7VA 3OLAA 3NMRA 4OHYA 3WIVA 1RT6B 4PG7A 2AGPA 4UOFA 4L8RB 1OS5A 2ZD1A 2DT9A 4M5LA 1JLFA 4DV6F 2B4JA 4OKJA 1HNXF 1IBMF 3CFPA 3L8BA 1N54B 4P74A 1ZC6A 4DPWA 4IH5A 5CYJA 4FWLA 4I9QA 2VJUA 4NLGA 4J8FA 5F0WA 5B0CA 4F8RA 3ZZZA 4LF9F 1RAHB 1RTIA 1NJIT 4N56A 4FWKA 3I8DA 1HPZB 4L3NA 1DKGD 4DL2A 4OYOA 3M9MB 2X78A 3HHNB 3J7AP 2Y1IA 4HUEA 4PQAA 1K0VA 2MXYA 2JX2A 4MH8A 5EWEA 3LWMA 2V8DA 3TP2A 4PXDA 2F4VF 2OAUA 3B6PA 4C8YA 2IAJA 3AQPA 3QMQA 3OFHA 4DSKA 1YTYA 2DEJA 2BQUA 4NB4A 3RMCA 4B1VA 4O3QA 2RNEA 3W9JA 3PRVA 2HNDA 3E2EA 3HP6A 3SBMA 3KXDA 2E2NA 3LOUA 4O5BA 1HARA 1UAXA 2OO4A 3PJXA 1JXEA 4C0BA 3CD0A 1VQNN 3W2VA 1ZM9A 2BM0A 3N5FA 2OYQA 3NP5A 2HHTA 3H08A 3E51A 4I6MA 4LSZB 1NSQA 2HS4A 3OJUA 3M2VA 4ZCKA 4ZPVR 2FIUA 1AW0A 4K2JA 3ZT1A 1J5EK 2B9WA 1WTBA 5JS2A 2OTJS 4EBDA 2IM2A 5H1SQ 3V9ZA 3QGPA 4CD3A 2ROEA 3FSXA 3PYDA 2OFGX 3HVRA 2RQCA 4GV3A 3NXZA 4JD2A 5A8RB 4K4UA 2ZHBA 4CK2A 4N76A 4P72A 2LA6A 4B9VA 1ZA2B 1E4GT 2DXFA 2E9TA 4C8MA 1NSKL 2HS0A 2CAJA 4L75A 3O80A 1ELOA 5GAHI 4CGIA 4OJHA 2HZVA 3VALA 3WUHA 2ZVIA 5MLCQ 2MTLA 2V4JA 5KFZA 1K1QA 1XQIA 2D41A 2IPOB 5ETVA 4WKYA 3H2LA 1TFYA 4M1KA 1IR1A 4NXNJ 3DDNA 3QBWA 4UOGA 1U1LA 3I0RA 5HVHA 1U1NA 1XEZA 3SQ1A 1S6QB 1RNHA 4OLAA 1FNOA 3EVMA 4JHDB 1RB0A 1KLMA 1UETA 3MPYA 3TAPA 2DNHA 1QAXA 4WBFA 4C8LA 1JCEA 1C4CA 4FYXB 1MMDA 4DUZJ 1IWGA 1T3NA 4USWA 1X9MA 3OL6A 3KLFA 5D0HA 1C0MA 1FRJA 1YT3A 1TMJA 2IJFA 2YPYA 1EAYC 3PXGa 3KLHA 3EICA 4GKKK 5F8IA 4J9SA 4FWNA 3ZZOA 5IC4B 4O0IA 4LF4F 4G1QB 2H51B 1ZXOA 3HL8A 4Y0WA 1IKXA 2Z2MA 2WBMA 1U26A 2RT3A 3FR0A 2XMAA 4DV6K 5J2QA 4PQUA 3KJFB 1CXUA 4UOCA 4MDBA 2VQFF 3N9UC 4MKYA 3TEGA 2QI2A 1UMJA 4QS9A 1RT5A 3NWRA 1KN6A 3V2UC 4FM2A 3QAUA 4OZ5A 3QLHA 2QMXA 2VG7B 2GEMA 4I2QB 3GE1A 2QWPA 3L9ZA 2OPQB 4YHHF 4EZ9A 5BN8A 2V4RA 4F4AA 4FPAA 4BBYA 2IC3B 4CJ4A 2ERRA 4K5RA 4F7VA 1LAVA 4X64F 1C1BB 1RI7A 3THXB 4DWIA 3CG7A 1JJHA 3DOKB 3T1HF 2B9YA 2BOAA 1C1CB 4BRCA 3DM2A 4GVBA 3QGIA 1G1XA 1HNWK 1P8ZA 1CG2A 2BUPA 5K8OA 2VFTA 3MPWA 1NU0A 5KFNA 4BE1A 4AHCA 5AQWA 3VEYA 4D3HA 4CF2A 2CPDA 1TK8A 3S8SA 4N8NA 2OFHX 2XM3A 1IKWA 3JS6A 1QVGR 2SXLA 3VN5A 1TFWA 4F0MA 4PWDB 4OIXA 5KG1A 1JLEA 2YX6A 4PXCA 1VCTA 3AODA 2ZBPA 3P5BP 5DDRC 2VOOA 1DBDA 1JKHA 3U1MA 3AJDA 1YVFA 4RU9A 3H1VX 1SCJB 4AQYF 2D0PA 2XS2A 2J4RA 1VQLN 2HHUA 1TL7A 2GS8A 1VQ7N 5DM7L 4B3RF 2RILA 2YH1A 2JEFA 3LP0A 3NCPA 1HR0F 1IVZA 1TZ0A 4BRAA 2DR8A 3RMAA 1C6VA 4KC5A 4GKKF 1X1PA 4BDZA 3AY9A 4IOAQ 3DRSA 4X4RA 5AQJA 4M94A 3DNCA 2P9NA 3D1OA 4FS1A 4JI5F 4W5RA 1GT8A 2E4LA 2OH2A 1C0UA 2XYHB 3O3LA 3BPDA 3QICA 4DEZA 4O23A 3M8RA 5KFOA 3H5UA 2LEBA 4RNOA 2MZ1A 3Q83A 4NYZA 2ZGYA 3FSYA 3MHYA 3BO2A 4USIA 1REVA 1YIJS 5D3GA 1KVAA 1P9YA 3QNWB 1H2VZ 4RPFA 3EKUA 4QOTA 4DJBA 4X4UA 1MA9B 2AX1A 1M90T 5EVZA 2Y1JA 2ASDA 4K0KJ 2YX4A 3ET6A 3C19A 1JLFB 1YIJN 3PO5A 2UVVA 4B3TJ 4E7LA 3RRHA 3O9SA 3ZZTA 4PRFA 3I31A 4E8UA 3K5PA 2MGZA 4LH4A 3I4HX 3DLKB 1QZ5A 1HWLA 3BKTA 1VK3A 1BGXT 4TNOA 5GMKa 3FKBA 5C2GA 3VAIA 5LXYA 2GMHA 4FJ5A 1VSIA 1NG9A 1Q5VA 4ZS6A 4FYDA 3KG1A 3MCSA 3PX0A 4CCHA 2RRNA 3ZLJA 5C24A 2D1CA 2P9GA 3CJ3A 1WSVA 1T9YA 4XDCA 5H1SV 1S76D 2KHOA 1VIOA 5KFKA 3DHWC 2AJ4A 2EC0A 3GYXB 4FWSA 4CLZA 5CZVA 5AXKA 4H0PA 3HYFA 2E6LA 3WXLA 1Q95G 4PABA 3HSZA 3NDKA 3H3NO 1TQLA 2B5JA 2YY3A 2GTDA 4HDGA 2B56A 5DDQC 5FLXU 1DZ5A 4V19J 2V2QA 1BG3A 2YVSA 2CVEA 1YBUA 2ZFHA 4OLOA 4ZPBA 2GAHC 3CC4N 2XO7A 5F1XA 4B3MF 4LH5A 4C1NI 2FHJD 5E7OB 3CWJA 5KAKA 2OPRB 2VF3A 4M3RA 1NJIO 5IT4A 1UA1A 1FRKA 4LT6A 2KM8C 1XC3A 2PGCA 3ENQA 5FPMA 4M7XA 1HD0A 1YGYA 4FBUA 3MM5B 2JOQA 1X9SA 3KHYA 4HLBA 4Q0BB 4C11B 1M5PC 5K8MA 4HI1A 2IGIA 2QYCA 5AQXA 1SIWB 1LWEA 3NS6A 5I4MA 5LXRA 4ZCMA 3GR1A 3E9PA 3HT0A 3LO3A 3MCNA 3BPSP 3HD2A 2QMUB 3NCQA 1N5YA 1CJUA 3MN7A 4BY9C 2O8DB 1ZH5A 3FCWA 2XZDB 2O8CB 4CIFA 4FK2A 3TYTA 3GYNA 2ASMA 2QM1A 1X4CA 1OSDA 4FSVA 4W5OA 3BUZB 1HPZA 4CEQA 3ZTQA 1GNKA 2X74A 4JI0F 4OI3A 2EFQA 1RT3B 3AY0A 4BRQA 3QRRA 2AQ4A 2CPFA 3NGUA 4CH1A 4GKJF 2DRAA 1CJKB 2KXFA 1SBRA 3NEKA 1Z1ZA 4IDKA 4KGVB 5ETKA 4A59A 3THYB 2KHDA 4JI2F 1NSPA 4YHHK 1CZ9A 4TY8B 5JVGQ 1GLDG 3CJBA 4EP4A 2HFZA 2HHXA 4FJLA 4P2MA 3R6GB 3LW5C 4HACA 5AZJB 2CGLA 3CJQA 1WNSA 3A13A 1VYAA 3DXSX 2DITA 3CTRA 2JL9A 4DUTA 1RHJB 4CHQA 5DRKA 1DRZA 4KI6A 3I9ZA 3KYLA 1VC5A 4WCEQ 2VBXA 4H4KA 1R0AA 2VB6A 2PMZD 2M88A 4MK8A 1FERA 2PT0A 3CPEA 2OGUA 3VF6A 2M4MA 2FY8A 4ZVGA 4CEEA 4IZ9A 1YK9A 1XQSC 5M2UA 4U8YA 2ZE2A 2X1AA 5HSPA 3PY8A 2OCEA 4DV1K 1ZBLA 3KHLA 5LT5A 3FZHA 1EARA 3ETOA 3OYDA 5DG8A 1YJRA 3S3MA 3Q86A 4OO1J 3C7NA 3EO3A 4K4YA 1S4EA 1VQNS 4DSEA 2AYMA 2RHKA 2V67A 3VAGA 4NLPA 5AQFA 3GOIA 3J81Y 5LMNJ 3PIOL 4F04B 1IR0A 3VHQA 4WFYA 6FDRA 1DQAA 5LM7E 2ZUGA 4HTUA 4FJGA 4OYPA 2ASJA 1DJ0A 4WE1B 1XC9A 4LF7K 4H03B 3I56N 1WC3A 2BR0A 2W2QP 5J2NB 4MDAA 3KK1B 4LBPA 3PM9A 4CIGA 2R2UA 5CA5A 1XMBA 2YKMB 4OX9K 4DV7K 2QA4N 2CZVC 2CNKB 4ECUA 4U7CA 5DM6Q 4OZ3A 4QIEA 3A8YA 2GWKA 2L9NA 4A61A 1K9MO 1BD6A 2B8PA 3QJJA 4JLHA 4ZVUB 4DOZA 3DXMB 1FE0A 4DPTA 4OZJA 5B08A 3VGKA 2FVSA 2DXEA 3FC9A 3VAHA 2NRHA 3VQ8A 1KSPA 3BN4A 4EWTA 1WAFA 1RHQB 2QYGA 1AYEA 2HRYA 4JKGB 4FJ7A 4DTUA 3WNGA 4YOVA 1I94J 2J0XA 3PW4A 1OYDA 4RNHA 5L1JA 2AX0A 3UI3A 2G1DA 4DF8A 1RBVA 3CCLS 3BSCA 4FBTA 2CPXA 2HQGA 3S9HA 2DR9A 3I55S 3GZ7A 4U96A 4KPCA 4DLEA 1BWFO 4Z7YA 3ZSWA 3VGVA 3AT1B 2LEAA 4TN2A 4HDHA 1WLJA 3G25A 3JQJA 2XLIA 1HW9A 5T7LB 3NGIA 3CDWA 3OA9A 2R2TA 4K4WA 1S72S 4CH0S 2LXFA 2WTUA 2A42A 1QQOA 2BJDA 3FGUA 4LVNP 3EN9A 2F9WA 3VEWA 1OVQA 2RB7A 4AFFA 2W9BA 4FXVA 4RUBA 3E01A 4YUDA 2D74B 3CJ5A 3VEXA 4K4ZA 2G2ZA 3MFHA 3PYFA 1D0EA 2DCUB 1SIZA 4OZ1A 2G2OA 2P9NB 1IWAA 1T9WA 4A8XA 2WOMA 1HWIA 4F0KA 5ETOA 1LXNA 5DK5A 4Y2CA 1GMUA 4CJFA 3CJSA 3UKUB 3T6BA 2KI2A 3CD5A 2ATQA 1NPRA 1OYEA 4TXSA 1IKYA 5EHHA 2IDLA 2P9SA 3U3GA 1MNEA 3R5AA 4QIFA 3W64A 4R79A 3NCIA 1I5OB 2W8KA 1J2VA 4LREA 3J80Y 1T9VA 4O44A 3TJ8A 3OFFA 1GTHA 3W65A 3SNNA 4BVPA 2W7OA 2DNNA 2D9PA 3O9QA 4E1MA 4OPKA 5H9EJ 2HBJA 3A8KA 3W60A 5EOYA 2QA4G 3MR2A 1NK5A 2YHXA 2HFOA 4ES3A 3MWBA 5L1IA 3Q22A 4DU8A 2Z2ZA 2I8EA 1HFEL 4DCOB 4LF6J 3QRPA 1V4TA 4L6V3 1MWMA 4AE5A 4HHJA 2CIMA 3ZSZA 3THPA 3GIRA 3NE6A 4B02A 3R7NB 1MDUB 4EBEA 3T1YJ 2EBGA 3ZEUB 3THXA 1NGCA 4IFVA 3DRRA 1G2EA 2O4GA 4A8SA 3LDSA 4DSFA 2AZ1A 1J5EF 5EWFA 4B3SF 4EFAC 3KWIA 2LVWA 1KBRA 3BH6B 3G6EN 2C2DA 1S7HA 2KFZA 1FXRA 5JVHL 3N4PA 1Q18A 1LEOA 4QU7A 3TQ1A 5LMUF 3J7AN 2X51A 4A48A 1N34F 2DIVA 5IT9O 1MLAA 5BYRA 4OHWA 5KFVA 2HLUA 2GV1A 2R8IA 3QEWA 3KNAA 2M5YA 4WFZA 3BSNA 3CM6A 2AJFE 4X4NA 1S77D 2V9KA 5T7LA 3SBTA 2O8FA 2ZH5A 2X1GA 5AQHA 1XBWA 1VQ9S 5C2CA 2M8DB 1K0TA 2XCAA 3BR8A 1C0GA 4IBNA 3OUYA 3T5LA 2O01C 3MFIA 2R7SA 3R6MA 1IN0A 1ZPVA 4LF9K 1EETB 3IWLA 4ELUA 4DTNA 3RR7A 1W7AA 1U45A 4DN0A 2YWFA 1S0VA 2ZD1B 2NPIA 2IHR1 4DQSA 4CEDA 4O3SA 1PYSB 2XG8A 2VA3A 4DLGA 3P1GA 4CJVA 5CYMA 2QO3A 4GY2B 4OVLA 2X1FA 4OJRA 4ECRA 2MQLA 1NK0A 4WJBA 3O5TB 2HYIB 5AQLA 4IFYA 1HYZA 3MWTA 1U7LA 4DR7J 4NMXA 3CCRN 2WC9A 3CXCR 1RCOB 4XH1A 2WAQD 2QKKA 5HMYA 4F0HA 1YBAA 2DNOA 4PEOA 1SI9A 4KKOA 4Q8EA 1YF5L 2FZKB 2ATCB 2LKZA 4JI8F 3SZ2A 5AQNA 2YKPA 3M1VA 4B08A 1JLBA 2FSNA 4CD1A 4BQLA 1ILYA 3PACA 1G7CB 2ZITA 3CMES 4OKKA 2XI2A 5K5MA 4L73A 3G6XA 5C25B 3FMBA 5D4OA 5AQSA 1F21A 3AA9A 2OHDA 2QGFB 2GCFA 2UUBK 4PR6A 1Y3JA 3BYRA 1WTFA 5G0RA 1WACA 4A5AA 2GFFA 3ATUA 3KWMA 1JL1A 3ZTSA 5A0YB 2QXFA 4UZBA 2OELA 4LRDA 3ZT0A 4CF1A 4TLQA 2J6TA 2UUBJ 2C2MB 3QT8A 1SQKA 1U1QA 4M5GA 4NZ0A 4B3OA 3D1QA 3SCKE 3GDQA 4ILHA 3RBDA 2R7OA 3TPQA 3OYBA 2LQJA 2NZTA 3HZEA 3CFRA 2WBNA 3AO3A 5E2QA 2GMLA 4MFBB 2AIRB 4AHRA 1XTZA 2GUIA 4RLEA 4EYIB 4TYBA 3OTOF 2FHKA 1TR0A 4JUZA 3ZC4A 3DGPB 1XI1A 1YJWS 4DBQA 4ER8A 4PPDA 1S1TB 4NYOA 3VESA 3PFEA 4CO4A 3VAJA 4ZP8A 4JI3J 2AA4A 3HSTB 3RAXA 2YNIB 2QK9A 2IFXA 2GQCA 3AOAA 5BRDA 3M9NB 2ZJPQ 2DHGA 1N34K 1HPMA 2WBRA 2H54B 5K14B 2E9RX 3MEEA 2NPFA 2DY1A 3GJQB 2GO9A 1HBMB 3P45B 3ENWA 3S3OA 3C14B 2C2OB 4LFBF 2KW4A 5BPMA 2GA7A 1V5VA 5IWAK 3AB2B 3O6QA 5JLHA 2CNOB 2RJZA 2D3O1 5CZ1A 4CJUA 3CCSN 3N79A 1QVFM 4DUYF 3IFRA 3TZWA 1P27B 3Q7BA 3EDQB 5F8HA 4U7BA 4RNMA 5GINA 3GBTA 5C2FA 4IOBA 2BM1A 2VKRA 5HJYA 2EFOA 4JI3F 3D2EA 1SUQB 4ID5A 3IAS9 2YX1A 1YJNN 1WC6A 4QS7A 1P6TA 2AHOB 2Z30B 5GAGU 3IG1B 3HHLB 2Z56B 1X5TA 3DOLA 1F2HA 1WBDA 1NK9A 1RTDA 5C25A 4FK0A 2YKMA 4FPBA 4M5NA 2MKKA 3EE9A 2OSQA 4DUYK 3LDQA 2RKIA 4A8KA 2F3JA 2PC6A 1VQKN 1Y97A 4HACB 4S0MA 1LW2A 2E1MC 1X31C 1RTHB 1FD2A 2Q3PA 2ZBIA 4OV6A 4H4OB 2HBLA 3EZUA 1C1CA 1N32J 4OZLA 3TX8A 4ZVHA 3PKYA 3HTVA 1B7YB 4NOHA 4J9RA 2X6NA 4OX7A 2E88A 3MCAB 3AVLA 1D9FA 2LYVA 1K8KA 1X4EA 1W9HA 1RA6A 4OJ3A 3KG4A 1WELA 3J7Z5 3K58A 1R0AB 4BC5A 2F9JA 4BE2A 2OZSA 4P2SA 1BY9A 2VFSA 1FVQA 1FFGB 2YXLA 3IO1A 4CGJA 2BGGA 2Y0BB 3NOCA 2ITMA 1CC8A 3KUEA 2ZE2B 3RWUA 3D28A 4O4GA 3MXHP 3SPZA 4NCBA 4HHTA 3IR5B 4Y2KA 5CYQA 4LSNB 3O44A 2XQCA 4X2BA 3QSIA 5HAOA 1U24A 2CG8A 1WKLA 3PNIA 2YJEA 2PMWA 1RACB 2W6LA 5K14A 2HWTA 1N52B 2DHHA 1TU0B 4W5TA 3OTOK 1D9AA 3C65A 2B7BB 4KH6A 2MY7A 1A5XA 2BUNA 2HBKA 3NS5A 3D6MB 4PPZA 4JKAA 4Q2LA 4UF4A 2ZDPA 4K43A 3DLEA 1VQ7S 3ZFVA 3ZX3A 1KQSR 1NXIA 4LJMA 4B3MJ 2H5JB 1X9JA 3QERA 1N8RO 3DYAB 5HRPA 2ZEJA 4OFZA 3LM9A 3GYGA 2HQCA 3JYTB 3V6JA 4CI6A 2AYBA 3EMTA 2YWEA 2E5HA 3U1NA 2DKOB 4CJRA 2JSXA 1KD1T 1FWLA 3QWUA 1N6QA 1DFDA 4CEOA 1VQ6S 4FXDA 2HWHA 2HRTA 4CP5A 1VDHA 5ADXH 2VDIA 4LFCK 5LSLA 1T0TV 5IFMA 4RW6A 2F8SA 2VFVA 4CFAA 1JB0C 3FE1A 1XNQK 3W5YA 1VFJA 3GIIA 3VQQA 2KZZA 2EVZA 4BREA 1EP4A 1TKZB 1D8YA 4XK8C 4DPXA 3TAQA 4NLSA 1RAIB 2UUBF 2W2NP 2BANB 3Q8PB 3CCMN 4HKQA 1N33K 1W26A 2LQBA 5J2QB 2OKQA 3OSNA 2Z57B 2UP1A 4BR9A 3NH0A 1SJ4P 2UUCK 2A2DA 3MECA 4YDXA 3EGWB 1VQKS 4M45A 4C2MA 2XYGB 1N56A 3K2YA 1TELA 5C0YA 2GC8A 1VQLS 2B43A 4EAHD 3CCQS 2RRBA 3BDEA 3UD5A 1VSDA 3AD8C 2DNMA 1QHAA 2AJ1A 1EO1A 5AQRA 3J7A1 2Q0RA 2HGNA 2GQQA 2CQBA 1Q7YT 1FKOA 2IVNA 2EG1A 3KNGA 3BKUA 5M1QA 2J9EA 5IC6B 2MKIA 1K6YA 4K59A 2FBTA 2IVYA 4DQPA 2GHWA 4ZP9A 2WSCC 1X0PA 2RHQB 1RBOB 2JC0A 3MCPA 3J81j 2V8PA 2B4OA 4EI2A 5JICA 1HBMA 4Z0UA 3SJJA 4KKOB 3D2WA 3WXMB 4QR1A 1IJFB 4DZ6A 4FKXA 3VENA 4JK7A 1K73O 1BU6O 4C3LA 4R8UA 3K5OA 3JTPA 5A6PA 2Z1HA 1XNRF 1WWHA 2FLLA 3CDBA 4ZJOA 1RWMB 3ZT4A 2FF6A 4CK1A 3FEZA 1IBKK 1XHXA 2ADBA 1QM9A 2FJWA 1WI6A 4FW2A 1BCOA 3QFUA 4XO0A 4F02A 1HKBA 4DQRA 3B6OA 3OBYA 2J7WA 1HI1A 1FKPA 2YH0A 4EK2A 4YOEA 1HI8A 2GMJA 2GQ2A 4DR4K 5JS1A 3DRXA 2ZC4A 4E7IA 3CJ7A 3KUHA 3TARA 3MAAA 4OHXA 2NSBA 3QESA 3IRWP 4X64J 3AVMA 2CQHA 4E7HA 1N4LA 1N36F 1V6HA 2MLYA 3MZIA 5L8RC 5DM7Q 2G1HA 4EGLA 2JLEA 5KT5A 4DQIA 2AV5A 4CHOA 4RX6A 3UVJA 2KHCA 1SV5A 1WI8A 4HHHA 3BP8A 4M5DA 1FRMA 4RTFD 1OH8A 4CFBA 2QEXS 1YITS 2FC0A 4JN4A 5E33A 5FPEA 2R7XA 3DOLB 1WHXA 4CBWA 5HP1A 5HRSA 3F2KA 2QA1A 4LSLA 4HVJA 3I33A 1ACMB 7FDRA 3CQ8A 2KT3A 4DU1A 3CERA 4PKGA 1BDGA 4LF6F 2MKJA 2KXNB 5HROA 1NBEB 2ROPA 5JUMA 1NGFA 3M2UB 3NG8A 2LQ5A 3U27A 4BCAA 5L46A 3DCAA 2V2VA 4FJKA 4LFAK 5CYQB 4RW4A 4CE9A 2YQ3A 3GILA 1CLFA 2M3DA 3CCES 1EQMA 1GLEG 3D66A 1IKWB 4EZ6A 2C3PA 1MROB 3MXJA 3UIQA 3HJFA 4TLRA 3V6DA 1FXXA 1KAYA 3AVIA 2G8KA 3GB0A 4I7FA 4GVLA 3SPYA 1PJ7A 2UUWA 4CERA 1C0UB 4CM2A 3BO4A 4MKAA 5GAHU 1LW0A 5KRTA 2GELA 3DYAA 4X66F 2KJWA 4RZRA 2WB1D 1BL3A 2HBRB 2P9UB 1SKUB 2O4IA 5AJ3F 5ETSA 3OYNA 1QUVA 3MEEB 4ZA1A 5BR8J 1YZ6A 3T1HJ 3VGMA 1JCGA 2F40A 3IA0A 4AXIA 1RHMB 1PAEX 2JWNA 2JEIA 5TKWA 3SSQA 4A8WA 2CH6A 1WKJA 2ZH4A 2HFNA 4OI4A 5HJXA 1B7FA 4CEBA 3CCVN 3QBCA 4PZVA 2QV6A 3QLHB 3VTIA 3F0NA 3SCLE 2VKZG 1JQGA 2IM3A 3CCJN 4AT1B 2VDHA 4PXBA 3CJ1A 3PX4A 2VOPA 2VWJA 2MLXA 2FBVA 2DXDA 2R2SA 4Y65A 4CT8A 4DR5F 5A8KA 2BE9B 1AXQA 4ELVA 2WONA 1D8ZA 4N77A 1Q8LA 5ITHA 3WHIA 4X4SA 3NH1A 2V8VA 3AVJA 4OYIA 1BUPA 2W2MP 1HQ2A 2CKWA 3SI8A 1HBOA 2HHHF 4R0EA 3VZHA 4M3YA 3MDQA 4ZN1A 5CQGA 2HMIB 3DGPA 3NGSA 4IRKA 4ZMMA 2IS3A 4J90A 3NVMA 4H4OA 2DHSA 4NXNF 3UD4P 2Q1LA 3MUVP 4KSEB 1W7WA 3AXMA 2CDQA 3CW2C 3G4SN 3BO3A 1UAWA 3M2RA 1VQMN 4CDIA 3R2DJ 1VQ8S 5JJBA 4HTLA 1VQON 2F65A 2GHVC 3TJAA 3EXCX 5CZXA 1OPZA 4FOIA 2J8SA 3G10A 1NWKA 2BXJA 5M2RA 4LRAA 5KFBA 3AA4A 3MWPA 1VSHA 4XPEA 1IBCB 2GJIA 2AJ2A 4B3MK 4DB3A 4PG8A 3K9JA 2YV0X 1TK0A 1H72C 4O55A 3V1OA 2WW8A 3US5A 3H46O 2BKOA 3TA2A 3BZCA 2I1RA 2UU9J 3K5MA 3QMLA 1LW0B 4M8LA 1NM1A 4AILC 4OPJA 2W42A 4QJVA 2P9SB 2RE2A 4WFAQ 4OI2A 3LF0A 5DETA 2P9UA 1N32K 4Y6IA 2XLJA 1HBNB 3TZXA 3DLLL 3DLBA 1N32F 4JI2K 4DR5J 2AWZA 2D5RA 2I5JA 3BBCA 3IS9B 2MZRA 4LF5J 3NHGA 3HCXA 3G8TA 2B9EA 1H7XA 4OKEA 3VQ9A 1R8CA 8RUCA 2MKHA 1VSLA 1TL1B 4CJPA 3MM8A 3VEZA 1L3VA 3FEXB 1R0BG 4B1XB 1UFKA 2HNDB 2OD4A 2JC1A 5J2MB 5CHCB 1NH8A 1YVUA 3L3VA 1OH6A 2HZCA 1R8HA 3LPEA 2VIHA 2HQFA 1BC6A 5LMUK 5G4DA 1SC3B 3A5LC 4NLUA 3PUFA 4RCHA 2MZQA 2FJDB 2KFYA 3I32A 1RT4B 1TUWA 2JFDA 4EIAA 2QZ8A 4IO9Q 3NNHA 3ZETA 2VC0A 1FX2A 5EWGA 5IT0A 2GZOA 2XO6A 1UJ5A 1NPPA 3FBBA 4HHUA 3H1QA 3KDOA 1VLOA 1RBSA 3M6VA 2FPHX 3HSCA 2ROGA 2Z1IA 2L9DA 3HHKA 4Y0FA 5BJRA 3OL8A 5HLFB 2PZSA 1B0TA 3JQKA 4KTWA 4WFNL 4I0WA 2HEKA 2QWOA 3SV4A 1WEZA 3QIPA 2PYJA 2VQEK 3HFZB 2RDJA 3JSBA 2ZBQA 3G6YA 4DR1J 3I8BA 1Y10A 2F1FA 2E2OA 4ZIVA 4WFNQ 4M63C 3N01A 4URGA 3H5XA 1FCAA 4V19S 2AKWB 3SMSA 2H4WB 4DL4A 1FDNA 4CJQA 4AHTA 2DNPA 1T94A 3LALA 4ZPDA 5HMXA 2DVIA 4WFXA 3U7JA 2PBDA 2W9AA 4C7QA 4WTYA 4IDHA 1WUAA 3D67A 2P2CB 2MQPA 3I55N 1IKVA 3UKUA 3ZZUA 2EEYA 3CQYA 2EX3A 2OPPB 2YKQA 5GAGP 1RFQA 2DY9A 3EVWA 3MCOA 5KFPA 3C46A 3LANA 4J91A 1KWMA 3CULA 2OPSA 1FJEB 4LUBA 1N34J 2VG6B 4ANCA 3LP2B 2E20A 1VBYA 1KFSA 2UU9F 3FZKA 3NBPB 4PG4A 3MN5A 1VC6A 4DUZF 4BVOA 1SV5B 2HAFA 4BRFA 1RWWB 3DRRB 4ECTA 3TTCA 3IS9A 2A41A 4F4WA 3TQEA 1HKGA 1RDBA 4YOWA 3ZNJ1 4C3KA 2J0QD 2L3MA 1M5KC 1GLBG 5KFRA 4WXOA 1SQGA 2XB2D 3CEDA 4U8VA 4H5VA 3MXIA 2P9IA 2HHWA 3BEGB 3BGFA 3UPFA 2G4BA 2CJKA 4L3QA 4ICLB 5HROB 1TAUA 1S0OA 3I56S 3U1LA 1I1GA 5LY3A 3LM2A 3I5AA 5J1EA 2Y0SD 2IAJB 1B70B 5GIOA 1MU2A 4B3OB 2KQ2A 4X4PA 3MK6A 2V7ZA 5B8HA 1PSDA 1X60A 2V4JB 2KRRA 4G3IA 1GLLO 4I56A 4FF4A 4CESA 3BSAA 3CD7A 2E44A 2U2FA 2FZCB 1ZS6A 2VFRA 3AVHA 4FYWB 3M2RB 1RDDA 1SH2A 2CJQA 3OFGA 4H4MA 3LP1B 1WG4A 2JEGA 2HK3A 1LAWA 2KH9A 4HR2A 4D3GA 1WF2A 1EXQA 4CHYA 3HHLC 4O0NA 1OH7A 3TA0A 2NNWA 4CF0A 3G0ZA 4KY3A 4YB1P 1FWPA 3G71S 1BO5O 4JD2B 1RT7B 1CULB 4ED8A 4CLKA 2HQ3A 4OPAA 3RU0A 1B4SA 3Q0AA 2GWJA 1TV6A 2LECA 1SS6A 4OYAA 1OMSA 4MYUA 3PIOQ 1W25A 2RF2A 1F6TA 3H5SA 3QZ7A 4HH1A 3VQPA 1S1XB 1NHVA 1XN9A 2ZJQQ 4I64A 3LWLA 2N7CA 2P9LB 3ZT2A 2D4WA 3GTYX 4P2XA 3CIZA 2C2EA 3RRGA 2D69A 2MQ8A 1RLDA 9ATCB 2A6MA 2J7UA 4K2XA 3VOVA 4PWUA 1JLQA 3M4XA 4PYAA 5HRNA 2FJAB 1S6QA 2W40A 4CK3A 3FSIA 3E3XA 1EKRA 2FUG9 1TL1A 1OY8A 1U0HB 2EKYA 3RGIA 4UUWA 2P1JA 4P71A 1B0VA 3TSUA 1WHYA 4BRLA 4KT0C 4FLTA 1BQMA 5C42B 2P9EA 4M3XA 2A5XA 3H42A 2W9CB 5LL6d 4A2AA 3TUIC 2B3TB 1FEHA 2WRMA 4ILLA 4LF6K 2EHGA 1CJVB 2E9ZA 5LSOA 2BJ3A 3CGIA 1W2IA 1LK5A 2E5GA 4LF4K 3K89A 2ZJPL 1WDTA 1HNVA 1R6YA 4KH0B 2ZH8A 3V81A 3M8PA 1H7WA 1IQZA 3JB9k 3T5HA 4BC4A 2AYEA 1FK9A 1NLVA 2E1AA 1N5SA 4N7TA 3P6YC 1NGEA 2A40A 2MJUA 1M5SA 4O8KA 2E1RA 4P75A 2W24A 1TKTB 5L39A 4FJ8A 4MT1A 4CRJA 3SMZA 1XWLA 1R43A 3N0VA 4GMKA 5ETTA 4YR0A 2D0CA 1X5OA 3OFEA 2E5JA 4N5SA 1J27A 2IJRA 2WZ1A 1U47A 2CUYA 4Q7AA 1VI7A 5AXLA 1ICEB 4CFDA 3QAEA 1RT2B 3CJ4A 4P7VA 3W1YC 1IBLK 1J53A 2RD5C 4HL9A 1U2CA 3NF6A 2NUBA 4ZVOB 2HLTA 2M52A 1J5OA 1IKVB 3OXFA 2IM1A 2HFUA 3VVTA 1VR6A 2IA0A 1RDCA 2DJWA 5KFGA 4J9UE 3HKWA 1A5VA 1RGVA 1NJZA 1TUVA 4ZP6A 4YHHJ 1K47A 3BBFA 3LUYA 5B7WA 1IJJA 1ITPA 2NXJA 4ZHRB 1B9DA 2Q66A 4AH9A 1FXLA 4NE9C 3RR8A 3PCOB 1YQHA 1R8PA 3KLFB 2QL5B 3TJ9A 4UZCA 4E2FB 2YNIA 3N28A 3GG1A 1HBUA 2FJXA 3M30A 4OX9F 1Z05A 4YP3A 2XMKA 1T6DA 1H1VA 2NQPA 3NH2A 3GIKA 1JXVA 2P5GA 4B9NA 3CI5A 3CMAS 2EG2A 2XNRA 1F3VA 5KG0A 3AVAA 2LXIA 5BXIA 3C94A 2FVPA 1VHXA 5GVQA 4KH5A 5AQTA 1RHRB 2BX6A 1UFLA 4L72B 3OVBA 2P6TA 3PYGA 3MM8B 4B17A 5F8JA 4I4BA 3AAQA 4RNFA 3MEGB 3SFUA 3T1AA 1SVDA 2VH7A 5HL7Q 3M2VB 1CJVA 3CC2S 1VSEA 4GKKJ 3CDUA 3DDIA 2ACMA 3Q8QB 3LP2A 5A2QU 4OX8A 4ZKAA 3OTBA 3CD6S 2VG7A 2L41A 3CJ9A 4WP8A 5FDLB 4P2FA 2N7YA 1EX8A 5HO4A 4DFJA 5D78A 4ZP7A 4JYAJ 3T9NA 5KPZA 1L3KA 1N36J 3NAIA 3Q7CA 3PHTA 2RQKA 2B4PA 4NLBA 5IWAJ 3EY1A 2RUGA 4ED5A 3TO8A 4X66K 1NSAA 3C14A 2KN4A 2YX7A 4JYAK 4CO5A 2V8HA 2COLA 3TX0A 2F8HA 1AZSB 3BYPA 5L1LA 1RWUA 4JI0K 3THWA 4BRHA 4WXWA 2G0CA 3VGTA 5AXMA 3ELHA 4DV7J 1MU2B 1RTJB 5IWAF 4EU0A 1IBMK 1YSJA 2RMLA 5HBMA 3MMCA 5F3TA 4YN3B 2E66A 3KKFA 2WK4A 1T03B 1KDNA 4QIVA 3ZCMA 1WEXA 3JXUA 3KJVA 3MPDA 3B54A 2IDEA 1T7PA 1BI4A 3CB4A 4B1WB 1X4FA 3BZKA 5RUBA 1QS4A 4JI7J 4ECWA 4AL5A 1F2GA 2X1BA 3CC7N 2H3GX 3RUBL 4PCQA 4LRFA 3TSQA 2DEIA 1RDRA 5C42A 5KG3A 3MN6A 3VGUA 4GV9A 4DV5K 2KDOA 1C0TB 3MX2A 5B0EA 4TKTA 4YR2A 1XNQJ 1CS4B 2AGQA 2V2ZA 2FZGB 3EWGA 3UD3P 3DOMA 2M2BA 5IM0B 1I3AA 1NGJA 2BQ3A 1XMQF 3IMQJ 1SJFA 4AHSA 2E8AA 1FXDA 4FZVA 1F0XA 3MR6A 2P5OA 3DLKA 1VQPS 1PJ6A 3A4TA 5HK4A 1EP4B 3SQ4A 3NMUA 2JEJA 4DL3A 2PA3A 4DL6A 4TY8A 2QW9A 1SH3A 4WQ5C 5GAEU 3CNQP 1NKBA 4Y2AA 2IDOA 4NLOA 4IG3B 2Q2RA 3MTJA 2R9LA 1U49A 4WQ4A 2N4CA 1YJ7A 2KU7A 2PYLA 3Q23A 4IOCQ 1VK8A 4OHZA 3KTQA 2ZH3A 1LK7A 4DX5A 4NRUA 3AVGA 2HHHK 3I87A 3PG9A 4DI6A 1GXLA 2PN6A 2FQQB 4WZMA 4PKIA 2K2PA 2NZ4A 3WC2A 3KMSA 2BVZA 3TUPA 3OXLA 5E3RA 3SIPB 4J9KA 1NGGA 1SL0A 4ED0A 4MK9A 4C8OA 1U48A 1AROP 1GOCA 3W0LA 2CPHA 5A2QY 4Q8FA 4K42A 3OS2A 1UEKA 1QAIA 2QKBA 2FBYA 2ZBRA 2IRYA 4NLYA 3F44A 4TQRA 1I51B 1ULRA 1NHKL 2NS1B 1RTJA 4MTPA 4Z4CA 1WC5A 4E3SA 1IH7A 2DD8S 3C6UA 1HKAA 4QBUA 4RBVA 5GMEA 2ZF5O 4QIWD 4KRWA 4ILRA 2VV5A 1FKPB 2WSEC 2UXBJ 3AAWB 1VQ5N 2OPRA 3CJ2A 4XEIA 3OV7A 4E89A 3OPKA 2R7QA 2VGMA 1ZPWX 3FZLA 2QTWA 3DRPB 2IVPA 5SUHA 1T6CA 1C1AA 3CF5Q 2HVHA 5AQZA 3HJVA 4CWBA 1H2TZ 4HT5A 3F5TA 2P9LA 1YBTA 2OMLA 1TKZA 4RW7B 3OY9A 3OS0A 3CCLN 3TZZA 3FZFA 3VMFB 3FFIA 1E4FT 1KRPA 3EYZA 3B4DA 2RF2B 2ZDOA 3ENOA 4DR5K 3V4IA 2QL9B 3LGMA 4B9LA 1B0PA 4FJIA 1N6QB 4EO6A 3SQGA 4ZITA 3OHAA 1J5EJ 5KFQA 2HNZA 3J7YU 5I42A 3GR0A 1RXOB 1TAQA 2FF3B 5A8WA 2AT1B 2IA6A 1NGAA 1RWXB 1M5OC 3KFWX 3V9WA 1I94F 1WHWA 5EUHA 1PCAA 2W9CA 3O08A 1N36K 4LSLB 3CJCA 5DGAA 3CCSS 1Q8BA 1PGZA 4CT9A 1XK8A 5JXSA 1YITN 5K9FA 1A7GE 1U0HA 3DLLQ 4OYXA 1Q82T 3ISND 1ITGA 4KV8A 3MMVA 4LRBA 2GVZA 4U95A 2UXBF 3KD1E 3MMJA 2YHWA 2HVEA 3QJLA 4F3MA 4CI0B 3RSEA 4YOYA 2HF3A 1U2VB 3GMGA 1RBRA 2W4DA 1NGDA 1NDPA 4LF1A 2B9XA 3V5RA 5CCLA 1KC8T 5DQGA 5CABA 2PFUA 4CGFA 4FZZA 4WKRA 2UUCF 3D0GE 2KKZA 4KHMA 2KT5A 4QWCA 5AZIB 1BQXA 2APOA 4JI5J 1B99A 2BKPA 2ADCA 4FLYA 2HVZA 4AYBD 4DV0F 4FJJA 1VK0A 4MJKA 4KI4A 1BA0A 2L48A 1PYTA 3GLJA 2WTFA 5HP1B 4CLYA 4I69A 5GADU 2QN6B 4EFHA 3SYZA 2F7TA 1VQ5S 1QAYA 1N5VA 4PUOA 4NI2A 2E2PA 2YWKA 4BWMA 4BR7A 3CCEN 2R8JA 3CJ0A 4F4XA 2G8UA 3SMPA 2IMWP 1MWYA 2VQFK 3MPUB 4IQXA 1KR4A 1BHLA 2VCPA 1UVMA 2HHPA 1N0UA 1TVRA 1TL5A 4DG1A 1IM6A 2F4VK 2CQ4A 1GOAA 2H5IB 3LH2S 3CCVS 1ZM3A 2FGCA 1C2PA 1JIHA 2YHBA 4UOHA 4B1YB 4QWBA 4LF7J 3ID6A 1S4FA 3O1BA 1T9UA 4J9VA 3ZSOA 1FNMA 2E1ZA 4O3OA 5KFEA 3VQSA 1PO6A 1KKHA 3ICLA 3QB0A 3D68A 4DFPA 3IR7B 3IMXA 3W2WB 3KJNB 4ZVFA 3NGKA 4NLRA 1ZYQA 5BPLA 5DMRA 1XNQF 1WF1A 2KT2A 1YTAA 3TW0A 4DL5A 3R27A 4JI1F 1DTQA 2ASYA 3GPAA 5KG4A 4Y28C 2QC3A 3LDNA 3BY5A 4DL0C 1R31A 3WIUA 1PBUA 1I39A 5KRSA 4P6QA 2W1BA 1C4AA 1QUPA 1RHKB 5DGBA 3NAHA 2QLBB 4QR2A 3R9PA 3C6TB 2Q3SA 2RUSA 5ETMA 2QWMA 2VL1A 5HBMB 3MMCB 3VETA 2WVCA 4LBHA 5L9NA 1HWUA 1BMQB 3WXKA 5LOQA 4L3KA 4KREA 3EZOA 1HR0J 4IJAA 1EB0A 5AE2A 2FXUA 2J7KA 3ZEUA 4BROA 1R0CB 2GX8A 2EXUA 3GFXA 2H48B 5DG7A 4LFBK 4NASA 3FVYA 4X65F 5SZTA 1GFWB 4FLWA 1AZSA 2RVJA 1CQMA 3TUZC 3RZAA 1UZHA 4CFCA 3MR7A 2VG5B 3G71N 2BRKA 3C15B 1L5UA 2V0NA 4CJKA 5F0UA 3RW7A 4UW2A 2NLXA 1G99A 4IYQA 4DTJA 5AQMA 2CJAA 1AT1B 1XIQA 4AL7A 3BGRA 1NLKL 2QIFA 5IM0A 1W2BM 3QT6A 2HQIA 3I6PA 1T05A 4JI3K 1BIZA 1WJ9A 5KQDA 1LOUA 1R7IA 3MM6A 3DI6B 3RB6A 4IKAA 1UFWA 4YS2A 1XNRK 4LR8A 2HNZB 3EXYA 2LFVA 1IKYB 3MOZA 2HOEA 1YI2N 2HVDA 2FTRA 4ZPCA 5KFCA 3AOCA 3T1YK 1HWKA 3MI7X 2AMCB 3G8SA 4KAIA 3HT3A 3OYCA 5M1PA 3TWHA 4DQ8A 2V9WA 3RYLA 3MR5A 3NLCA 3PEHA 4IJNA 3MXMA 5KGWA 1QQMA 4FWQA 3SUOA 2UU9K 3F56A 3P5JA 1RTIB 1NMEB 1M1KT 4A8FA 1J6ZA 4G65A 1UEVA 3QT5A 3MAAB 4WFBL 3F9KA 3IBCB 4XPCA 3QEXA 3PJ9A 5F8MA 2HWIA 1F60B 1F9HA 3MX5A 1N48A 2HSEB 1HBNA 3FJ2A 4KHNA 2ZWPA 3BS9A 2QL7B 3KHGA 3BEXA 4DCJB 4V19X 2EK1A 5CCMA 4RU2A 2B6AB 2I0XA 3VQ5A 2MHEA 3L2RA 1NM2A 4IH7A 2P9PA 3PFOA 3A3NB 2MKYA 1O13A 1RU1A 2P9KA 1DLOA 1TUYA 4C48A 3VVUA 2JHEA 4RL1A 1G4CA 3ULDA 2MQMA 4NA1A 2W4CA 5L1KA 1XNRJ 1JX4A 4DV1F 1S6PB 3SDEB 1WC4A 2V52B 1Y11A 2FJEB 2R4FA 4RW4B 1QD1A 2E5LF 1YHQN 2JH3A 4R5PA 2EBEA 4FWMA 2ABYA 2HQDA 4W5NA 3RBEA 1P8GA 2JVRA 1O0PA 3P49B 3VQ6A 4GC6A 1VQMS 3TWZA 4Y3CA 3QNOA 1IV0A 5D3GB 4O3RA 2NR0A 1SH0A 2PFDA 3LPUA 3EGNA 5A76A 3W66A 1KC8O 4FWPA 1VQPN 3P4UB 2YQ0A 4H5NA 2V69A 3IR6B 2D1KA 4A46A 2B4UA 4KHWA 4ECZA 4DR1F 2VD3A 1N5YB 1EETA 3CC2N 7AT1B 2ZH7A 3VR1A 3HKZD 3KK7A 2QFIA 1URRA 3DXBA 4USTA 5U47A 4BR5A 2LDIA 3ET6B 2YWHA 4XAKA 4J9OA 3R3TA 3K7RA 4OYMA 4AHVA 1UVKA 2ZM6F 3KD5E 1YJTA 1HJOA 3RBZA 1ZBIA 3R8EA 2GVZB 4ECVA 2YHAA 2MLZA 1NHUA 3GV8B 4K8ZA 1HNIB 5E5NA 4FZYA 5IZHA 4ZPTR 4BDPA 3EJMA 3PKMA 4DR6J 1S9GA 3SEOA 3W7BA 4AL6A 1QTMA 1WSHA 2AJQA 2FC8A 4G1QA 4CZKA 2IY5B 2BJ7A 4ZIWA 1WOOA 1HHSA 3BZQA 5DS7A 5CD4A 1PC5A 2MMYA 2V51B 2MQNA 4B3SJ 5FLXY 4K8RA 4K4SA 3OR1A 2KYZA 2IRXA 1FEEA 3HFVA 1QDUB 3ZNUA 2JRSA 4N47A 2DNGA 2XEXA 4ITSA 3I4PA 2UVWA 4EHUA 4ETZA 4Q43A 4FJNA 1UEUA 1HI0P 1T3OA 4LF5F 3HVTA 2QJ3A 2VA2A 1P1TA 3OYIA 4H0YB 5A8RA 4LBIA 4HTJA 1JL2A 3IC1A 3B82A 3D5MA 3WC0A 1UWBA 3C95A 4F4KA 4DDFA 1RAJA 2G13A 1NO8A 4CJWA 1XMQJ 3CCMS 2Q79A 1GOBA 2HFSA 1SAZA 2IMOA 2ZZTA 4QOZB 2ZWHA 2CWXA 4J9QA 4KO0A 2CJ9A 4BGAA 5FLXO 4H0XB 1RLCL 2Q43A 4MKBA 4ED4A 3WEEB 1APSA 1S99A 1T9XA 2HS3A 4R5PB 4KB0A 4QWAA 4O3PA 4MFBA 2DIUA 3KK3B 1ZA1B 4I6WA 2RU9A 1GLJO 3DMJB 3OYLA 3N5BA 2C3YA 5KFWA 5GAEI 2JJ4D 2VICA 3BGRB 1KCFA 2NLWA 3CJ8A 3G4SS 1HA1A 1L3TA 1UPPA 4EUVA 1Q81T 1BHNA 3BH7B 1RAOA 3MM6B 1TMMA 3D0PA 3DLRA 2QT7A 4FLZA 4KAZA 3V6KA 4OLBA 2D9OA 3TEHB 3VTHA 2XWYA 4BACA 3EE8A 4JI4J 4UT4A 3LTOA 3LDPA 2ZGZA 3H3OB 3UNGC 3SJHA 3D7SB 4PKHA 1G3OA 2CQGA 4KHSA 1KEKA 2XMVA 4WF9Q 3WNFA 2WHOA 5HN0A 3NCRA 1OVYA 3DLGA 5EDWA 3ZSQA 1XERA 1HUXA 4BG9A 1NPKA 1TV6B 3AB4B 3I9V9 1VQ9N 1DURA 2QWRA 3A5MC 5M1KA 2HSTA 1RBLA 2DH8A 1SUQA 1OWXA 3BR9A 2EFGA 4WQ4C 2CPEA 3K5NA 1RA7A 2NCKL 3ZZYA 5D0RA 5B0AA 5ADZA 1UP1A 5GADI 4LF8J 3DRYA 3HI0A 1FDBA 5F8LA 4J2BA 1RTDB 4M41A 5LJ3Y 1LNQA 2E7WA 1WC1A 1CZAN 3SSSA 4CEZA 5AXNA 3K8WA 4OZ2A 4F3TA 3DAWA 5GAGI 3T9ZA 4OGEA 1LOTB 3OR2B 1A9NB 4FXWA 2ALZA 1JLQB 4GVBB 2BACA 3SAFA 2R8HA 3WXIA 2RU3A 4M42A 4FS2A 5BYSA 1QQNA 2CQ0A 3TTFA 2G8IA 4A8YA 5FPDA 9RUBA 5E41A 3M6GA 1S9EB 5BREA 1S1WA 1PJ5A 2P9KB 4ALZA 2KTQA 4PL7A 1L3UA 2VODA 1WSRA 4Q0BA 2M7SA 4C11A 1KOOA 3FRYA 3T41A 3QIDA 4CTAB 3BKFA 2YKNA 4JRQA 1SC4B 3CJAA 1UVLA 1U1OA 3RAQA 4FPRA 5AZJA 4RUHA 1QSLA 3ENAA 3CVKA 4RNNA 4E7KA 1TL3A 3FBCA 5GMDA 5KFAA 3QEVA 2CFXA 2AW0A 4A8MP 2HHVA 5CZ2A 3A2FA 5J1PA 3MURP 3MMAA 4IEEA 3M30B 2R7UA 2ZNZA 1DGKN 3HMJG 3P8BB 2FVRA 4XH4A 2XTJP 2QMWA 4AHUA 2VPXB 4ED7A 3G86A 1SXLA 2D0OA 3QYYA 4WWSA 3AVBA 4JV1A 4JBCA 2K1RA 3MTKA 3C15A 4YOTA 2PFFB 1M1GA 5THWA 4FN5A 2BOPA 2CYYA 2H9ZA 3TSPA 3THYA 2HBMA 2QEXN 3A0IX 1Z2ZA 3ZTPA 3V1QA 2ALYB 4OI0A 2VQEJ 2HBYB 1VHFA 5F8NA 1ZTTA 4USUA 5MLCV 3NGYA 3K59A 1X8DA 3MOJB 4ZVTB 2N3LA 4CLUA 3DLGB 1SQFA 3GE9A 3M8QA 4FW1A 1N0VC 3QWPA 3CCRS 1JLCA 4KFBA 3NGZA 3HHLA 4BRDA 2G0IA 4Y2MA 4L74A 3ITHB 2AYGA 4JI1J 4NEZA 4A4JA 5KGXA 3R7SB 3NFAA 1RGIA 4LF7F 1BIUA 2LA4A 5AQYA 4YORA 3ZSXA 1T44A 3LDOA 2IIRA 3THVA 3AARA 5I3UA 2E1PA 2HK2A 3GWCA 3LGHA 2M8HA 4GKJK 2L9WA 5BR8F 2HBQB 5J2PA 1YAGA 1XMOK 4HUFA 2DFEA 3L7PA 3PIPQ 3POTA 2F8TA 3DGVA 2DNKA 2Z8QA 2F4VJ 3GFZA 3SBGA 1HQEB 4DR4F 4JI8J 2W6KA 2DO4A 1U09A 1BE4A 3ZX0A 1DY3A 1ZAXA 4JI4K 2UV8G 4LF5K 3R5DA 2DY4A 4X64K 3QPIA 2YI1A 3KK3A 2J9DE 4KBIA 2HG4A 4BC9A 3U02A 3PW7A 3L6QA 3H6EA 4P73A 1FDAA 2HBZB 8ATCB 4CO2A 3HOTA 4UUXA 3OD2A 1Y4ZB 4LQ3A 3DU5A 2CQ2A 2O8EB 4IO1A 2PEHA 4IOCL 1WAJA 3A8IA 2D0BA 4ZHRA 2I38A 4YOXA 2V34A 3BV8A 4W4MA 1S6PA 1P9QC 1VSMA 2Y3YA 1WSIA 3LZJA 1FKOB 2P9PB 4WE1A 3OVSA 3HSDA 3C3LA 1Q9YA 4EMDA 4KTQA 2KG0A 2XYPB 4M7YA 2HMPA 4QIGA 4CH7A 2VPYB 4JK8A 1NU4A 5D4PA 3O2IA 4W5QA 3NVKA 3RVCA 4CBXA 1ASWA 3LQVA 3MMBA 3M2UA 4KQZA 2DB1A 1TKXA 4RJVA 4IOAL 4JKEA 5I3QA 3IBFB 4WU2A 3Q8VA 4IOXA 4F9OA 2DGOA 3VWSA 4OGCA 4GKJJ 3EX7B 1D1UA 2FD2A 4CO1A 2PD1A 5D0EA 4A62A 4ED6A 5C7PA 1UA0A 2IOCA 1CLQA 3GV7B 2O66A 2CXEA 1WSJA 3RMBA 4DUZK 2IYIA 4DR2J 4RO0A 1Q86O 2V5HG 1NK4A 4HI2A 3MEKA 3RBXA 5F9NA 1WHVA