1RT2A

Crystal structure of hiv-1 reverse transcriptase complexed with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
543
structure length
542
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 145
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt2A05
3PUFA 5C25B 1MMLA 2BQ3A 4KI6A 3MAQA 4R8UA 3HPOA 3HVRA 4FLVA 1X9MA 2JGUA 1C0TB 3NH1A 4FZZA 4ELUA 1JL2A 1XR6A 4QW8A 5D3GB 4AILC 3PX4A 1S6PA 5KFUA 4J9QA 2ZD1B 3MEGA 1VSIA 3ISNC 2VG6A 5J2MA 4K4WA 1TAUA 1ZBHA 5KFYA 4KHYA 3ULDA 3GV7B 4DQRA 4CF9A 5KT5A 4DSIA 3GIJA 3OYBA 1KHWA 3CDUA 1HNIB 3AVIA 2Y1IA 2HHSA 3OYLA 3DYAA 2BR0A 2B5JA 1ZYQA 2BANA 4O0IA 5HROA 3BQ2A 4QWAA 3SUNA 2JLEA 3K58A 5F9LA 4DTOA 4ICLA 3M9MB 2WRMA 3EPGA 1VSLA 3WNGA 1RT4A 1WN7A 4O5BA 2OPSB 4CK2A 2XO7A 2HHVA 4FVMA 2AGQA 1HARA 4IQXA 3KNAA 3V9XA 1D8YA 4CEFA 4F2RA 4FJLA 1S1UB 2D7SA 2FVCA 1RTIA 4RW9A 3VQSA 5DQIA 4LSLA 2ZE2A 3LP2B 1IKWA 3O4NA 3Q8QB 4J9SA 2IDOA 3HPHA 3ZT4A 4AHCA 2HHXA 3Q8PB 4FJIA 3H08A 4ED3A 3SQ4A 1S9EA 5JS2A 4B9UA 2X6SA 3QO9A 3DLRA 4G1QB 3HP9A 1OS5A 2W8KA 2RN2A 5KFTA 2XCPA 1JIHA 1HPZB 4NLXA 4CJWA 4CEOA 3MR3A 3M8SA 4JS4A 1S0OA 4LH5A 3PW0A 3AVBA 4WFZA 3KD1E 4NLYA 3QIPA 4BE1A 4IBNA 5J2PA 3VQCA 4RW8B 1NOYA 5HRRA 1C1AA 4U7CA 4CJPA 3KLFA 1JLAB 4B3OB 4I2QB 2YV0X 3NGYA 4OVLA 2BQRA 1HQUB 5C5JA 2RPIA 3KK2A 1JLQA 2OPPB 1UA1A 4NLWA 1NOZA 1CLQA 4LQ3A 1QAJA 1RILA 1SUQB 3M9NB 4F4KA 1BIZA 4NLTA 4B9LA 4O4GB 1LWFA 2IM1A 4B08A 3GQCA 3K5NA 2F96A 2C2RA 1HNVA 3CJ3A 4NCGA 3DOLB 3GILA 1S0MA 2BQUA 4DWIA 4FXDA 4DEZA 3L2UA 1JLBB 4NCBA 4CIGA 4K4VA 1J5OA 1RT1B 3LP0B 4O44B 1TP7A 4H4MB 1I39A 4CGDA 2R8KA 4DLEA 3RRGA 5K14B 2ASJA 4C8MA 4W5OA 3E01A 5KFCA 3MXIA 2FBYA 4OJRA 2YNHB 3JYTA 3QGHA 3OLAA 2KQ2A 1K1QA 3HKWA 4DLGA 1ZBUA 3BDPA 1SH2A 3VN5A 1GX6A 3WNFA 3L8BA 2O4GA 4FJHA 4URGA 1U49A 4Q44A 1T7PA 3PR5B 4ECUA 3NGDA 4KHRA 4DFPA 3OS2A 1RTDB 4ECZA 1RT5A 4I2PB 5DLFA 5DGAA 4CGHA 2AX0A 3G0ZA 1D5AA 1N56A 4N76A 4DSLA 3LALA 4K8XA 5F8NA 4ZP7A 1XR7A 1YVUA 3L2QA 1U47A 2YNIB 2WONA 4RW6B 3MEDA 1TK5A 5KFHA 3KLVA 4ELVA 2J6SA 3ISND 1RTJB 3V6DB 3MXMA 4Q0BA 3TANA 2VG7B 4OL8A 2VG5A 1EETB 3DI6A 3HJFA 4NYFA 3RR7A 3VQ4A 1HQEA 3ZCMA 4G3IA 2AWZA 1A5VA 2C28A 4BACA 1RBVA 2IGIA 5J2QB 4DSEA 1D1UA 1RAJA 4DSFA 1ASUA 1EP4B 5JUMA 3DRSA 4O3RA 4IDKA 4ZVGA 3PX6A 2KW4A 3U3GA 4Q45A 4H8KA 3OSNA 4KREA 5KFOA 3IS9A 4ZHRB 2FJWA 3SUQA 1FKPA 4Y34A 1NJZA 1RCHA 1KLMA 5EUHA 3V81A 4CF1A 5KFVA 4B9VA 4HVJA 1HMVA 5HRSA 1YVFA 1T05A 3DLKA 4ED8A 4YR3A 2D0AA 4EBEA 2R2UA 1WAFA 1VSEA 3BJYA 1SV5B 3GV8B 4DG1B 4DF8A 3RMDA 2JEIA 3DRPA 4QWDA 1KFSA 1FKOA 3QLHA 2J6TA 1IO2A 5HLFB 5KFSA 4CGGA 1VRUA 3ZT2A 3NF7A 3PO4A 3V6KA 4IFYB 2YNFA 4EZ6A 4E1MA 4EZ9A 3I0SA 3AA3A 3CO9A 4NRTA 5KG5A 4O3PA 3ZSYA 4K4YA 4NLUA 4OKEA 4TYAA 5CYQA 3AO1A 4GW6A 5KFGA 1D0EA 4FJ5A 4KO0B 1NK7A 2DY4A 1S48A 4AHVA 4WYWA 2FBXA 3S3OA 3ZSXA 4CJVA 2G8VA 3HVAA 2F8EX 1TKDA 1FK9B 4J9KA 3KMQA 4CHYA 3SI6A 3TABA 2Z1IA 4KHSA 2XI3A 3HVWA 1RDCA 3KMSA 5KFWA 1B9DA 2ITGA 3ITHA 2O4IA 2A1SA 3C95A 4DQSA 3F73A 1IKVB 5EU7A 1LAWA 1WLJA 3L2RA 3FQKA 4JV1A 1S1TB 3QEVA 2EC0A 4J9LA 3KJVB 1C2PA 4FJ9A 2W9CA 2D0BA 4UQGA 4IG0B 4CJEA 2AGOA 2FLLA 3O3HA 1WSIA 1VSDA 1C1CB 4RW7B 3FRZA 1S1XB 3K59A 1NK9A 5J1EB 3KLEB 4Q8EA 4DS4A 4XPCA 4RNOA 3S3MA 4I7FA 1VRTB 3T3FA 3CDWA 1XI1A 3NE6A 1S9GA 1FXXA 3THVA 1U48A 4Z4CA 1JLEB 2OZSA 1I6JA 2YKMA 4CF0A 3M9OB 4B9TA 1TVRB 2PYLA 1RTHB 3L2WA 2DFFA 1S0NA 2V4RA 3AO5A 3GIKA 3KLHA 4DFMA 2F8SA 3H5UA 5KG4A 2W8LA 3ZSRA 3SUOA 1GX5A 2WOMB 1L3UA 4ZP9A 2I5JB 5CYMB 5F8HA 3OHAA 1S9FA 3FFIA 3VQDA 2HHUA 2HNDB 5JXSA 4AHRA 4MFBB 4CJKA 4Y2AA 2IBKA 1NK4A 1IKYA 2EX3A 3HPGA 3P1GA 1TKZB 4CGIA 1HJRA 3VQ6A 3AVJA 4CECA 4N5SA 1RA7A 4WFYA 5DQHA 3IGVA 5EWFA 3UR0A 4LSNB 3H2LA 5D3GA 2GUIA 4XPEA 4BDZA 4W5NA 1WSHA 2XY6A 3BSNA 2FJVA 3QINA 1Z26A 4MQ3A 4F4XA 4KHMA 3DLEB 2FLPA 2ZD1A 4NLOA 3SFUA 3GIIA 3MTKA 2VA3A 3ZT3A 4CEEA 3SQ2A 2PYJA 4CGJA 4BDYA 3GV5B 4CF2A 3O4QA 4AHTA 4FLZA 1R0AB 4FLXA 4DTRA 2BRLA 4CHNA 4HKQA 1HNIA 3AVCA 1IKXB 4FYDA 1VSHA 1BQNB 4JRQA 1WSJA 3OYNA 2EHGA 2UUTA 4OGEA 2PZSA 3HSTB 3I0RB 2FVRA 1TAQA 3BGRA 4FZYA 2DFHA 2YKNB 4FLWA 3PY8A 3IRXA 5I42B 5L1JA 1LV5A 4FJGA 4F4YA 2IC3B 3LAMA 3VA0A 2OYQA 3EYZA 1EXQA 3TAMA 4CIEA 3MFIA 2UVWA 3G6YA 4YP3A 2Z1GA 2HNYB 4RW4B 2DPIA 3NL0A 3SJJA 3KHLA 3OL8A 2LSNA 4FJNA 2XC9A 3DRRA 4WE1B 4JUZA 3OY9A 1ZTTA 2V4QA 2E9TA 4WZQA 3QEIA 3OYDA 4YQWA 5F8LA 4CHOA 1N4LA 1SKRA 4ECXA 4KKOA 4FM1A 4G1QA 1CXUA 4FK2A 3DM2B 3KHHA 2VWJA 1HPZA 1QE1B 3HL8A 1G15A 5KFKA 4YMEA 3QNNA 3QNOA 3CIZA 4DMNA 4Z0UA 1UA0A 3VQ9A 3OHBA 4YR0A 1S1WB 3IG1A 2D5RA 2FLNA 3MEEA 3LAKA 3JSMB 3G6VA 3AO4A 1QTMA 5DLGA 4F3TA 1JLAA 4B3OA 4FM2A 4I2QA 4HHTA 2GIRA 2A1RA 1SKWA 5HBMB 1HQUA 3NAIA 1TQLA 4O0JA 2FJXA 2KZZA 1S6QB 2W9BB 1WNEA 1SUQA 4J9MA 4HTUA 3TAGA 4H4OA 3PW4A 2O5DA 4K50A 4O4GA 4CFBA 2ILYA 4ZPDA 4B9NA 4Z4FA 4PQUA 4E0DA 3DOLA 1YTAA 3O3FA 1Y97A 1QQCA 3S3NA 1UWBB 3BQ0A 3V9WA 2C22A 5KFFA 3QETA 2ETJA 1JKHA 1QSLA 3LP0A 3AA5X 2G8IA 2DPJA 1RBSA 2VA2A 4Q5VA 4KSEB 4FW1A 3LZIA 4DL5A 4BE2A 4RZRA 5HRNA 3MECB 4HYKA 2GC8A 2YNHA 1TL1A 3BREA 2WCXA 5HP1B 1RA6A 2NUBA 4C8KA 1NJWA 2IM2A 4ZVHA 4OKJA 2QXFA 5L9XA 4PA1A 2ATQA 4CJ4A 4ECWA 2OPRB 4DQQA 3SQ0A 4KI4A 2E9RX 1RTDA 4E3SA 2IMWP 4I2PA 3C6UB 4IOBA 3CDEA 5KG7A 4K4TA 4CFDA 5DQGA 3DLGA 1J54A 3LWMA 1BQMA 3QEWA 1RT3A 1KSPA 4JLHA 4E7JA 5KFEA 3VQ8A 3CFRA 4FBTA 4O4RA 3OL6A 3V1QA 3T19A 4RW6A 3CYMA 4ECVA 2QKKA 4TSXA 3HHKA 3V6DA 3QIDA 2KFZA 5T14A 3MR6A 2R2RA 3MR5A 4KHWA 4B9MA 1EETA 3OS0A 3AVAA 2QK9A 1RDRA 2XY7A 4PUOA 5KFDA 4RUAA 3MEGB 4QAGA 3SFGA 4KB1A 5J2MB 2IA6A 4IH5A 4J9PA 4M95A 2F8TA 1DLOB 5L1IA 3LPUA 1RT6A 1EP4A 3V6HA 2R8IA 3SZ2A 2AQ4A 4W5RA 4QPXA 2IM3A 4CEDA 1BI4B 4R5PB 4TLRA 3ALYA 3OYHA 4URSA 4ZHRA 3QZ7A 3DYAB 2B5JB 1KRPA 2BANB 1RBUA 5HROB 4N56A 4FLTA 4ZP6A 2XY8A 5DMRA 1ITGA 2IAJB 4CK3A 1NKCA 3AA4A 4FJXA 5JS1A 1JXEA 1GOBA 1RDDA 1SV5A 3LWLA 4DL7A 3AVKA 1ZBFA 4DG1A 2FVPA 3KTQA 1K6YA 3TARA 2G8WA 1W9HA 2HHTA 1RBTA 5HLFA 3PVXA 4YNQA 1IKWB 1QSYA 4AHSA 4IFYA 3AO2A 5KFMA 4RNFA 3VA3A 3GYNA 4IH6A 4E7HA 1SL0A 4Y1CA 4EYHB 4CJUA 1S9EB 3RBEA 4RG8A 1VSJA 3TAQA 4KO0A 3QO9B 4EBDA 4PWDB 2W7PA 2HMIA 3KHGA 3SCXA 3NKYA 2OA8A 3S9HA 2JEFA 3U6FA 4WZMA 1NK8A 1FK9A 2YNGB 5KFJA 4QCLA 3QIPB 4KAIA 4R0EA 4B9SA 1Z4UA 1KVCA 1WSEA 1S1TA 3KK2B 3SPYA 3L2VA 3G10A 3AVGA 2XHBA 3OYCA 4IG0A 3LANA 4CIFA 3AVMA 3PO5A 3TWHA 4ZPAA 1LWFB 2YHAA 1HYVA 1C1CA 2P5OA 2B6AB 3QYYA 4MIAA 4B8AB 4RW7A 1S1XA 5KG2A 2BDPA 4NCGB 4ZP8A 5J1EA 3KLEA 3EY1A 4Z4HA 3ASMA 1VRTA 5E41A 4CJ3A 3KHRA 2HWIA 2BE2A 1J53A 2BRKA 3K5LA 4IRDA 1JLEA 3V4IB 4NZ0A 5FDLB 1RTHA 4M45A 1U04A 3JYTB 3H5SA 4ED7A 3CJ4A 2KZMA 4IG3B 2B4JA 4TQSA 4OGCA 1S49A 4WXWA 2WOMA 3CJ2A 4MK9A 3TAPA 2I5JA 3K5OA 3V9SA 3H59A 2UVUA 1T03B 4FJJA 4E7LA 3L3VA 2HNDA 2ASDA 4RU9A 2AGPA 4IRCA 4FCYA 2FBTA 1RT5B 1UAXA 2B43A 4ED0A 3OYEA 4BE0A 1NK0A 5FRMA 4ELTA 4NLDA 3VQAA 1C1BA 4M3ZA 2CKWA 4FJ7A 2OPQB 5F8MA 4FBUA 1TK8A 1CXQA 4KB0A 3ZSOA 2WONB 3DOKA 4J9OA 2W42A 4CF8A 2AJQA 5DGBA 3MEDB 4L8RB 2R7YA 4MK7A 3CFOA 4GVMA 3PHEA 4ID1A 4LSNA 4F4ZA 5FRNA 2RF2B 4FW2A 2R2TA 4CESA 2VG5B 1LAVA 4URQU 3V1RA 4KAZA 3Q8RB 4ZTFA 1LWEB 4KV8A 3EZUA 5F8GA 3TVKA 3QIOA 1HQEB 3KLIB 1W0HA 2ALZA 1XHXA 1HRHA 2VWKA 4DSKA 3ZSQA 4WYLA 5C24A 4DL2A 1NNDA 2C2DA 3KK1B 1SKSA 3G86A 1TKXA 3CM6A 2P1JA 1MU2B 4DU3A 4IR1A 3IS9B 4DTJA 1REVB 3KK3B 1IM4A 3LP1A 1FKPB 2RKIB 3I0RA 1RBRA 4NYZA 4NLGA 2YKNA 1KLMB 4CEZA 3M8PB 3HM9A 2G8UA 2FVQA 3SV3A 1S1VB 5I42A 3DLKB 3FSIA 1Q9YA 4TXSA 4B8CA 3NFAA 4DSJA 5KFPA 4C8OA 4GMJB 2HNYA 4RW4A 3DDKA 4QWBA 1N6QB 1TKTB 5KFQA 5EDWA 1IH7A 3PW2A 1ASWA 3HVTA 3KLGB 1HYSA 2G8KA 1VRUB 1J9AA 3KKSA 2IS3A 2IM0A 4TY8B 2HAIA 1JLCB 5C25A 4RNHA 4RUCA 1TL3B 1DTQB 5C42B 4M94A 2E9ZA 1CZBA 3VQEA 3LZJA 3SQ1A 1C0TA 2D41A 1B92A 3QGGA 4EBCA 1B9FA 4EEYA 3DM2A 1NJXA 3D0PA 3NH0A 3BQ1A 1S5JA 5KG0A 4KTQA 1S1WA 4BDPA 2CJQA 1KFDA 3NF8A 4EYIB 3LP3A 4HUFA 1LW0B 1LWCB 5FROA 4IFVB 1DTTB 2GV9A 3ZSVA 4DS5A 1VK0A 3OYKA 5I3UB 4HCCA 5HBMA 4QWCA 1C0UB 5KGWA 3NMAA 3OLBA 2IJNA 2W9BA 4NLSA 3AV9A 2JEGA 3FQLA 3T5KA 1RDAA 4NYNA 4NRUA 5DG8A 4CE9A 3T5HA 3AO3A 1JLFB 4M3TA 4FK0A 3ICLA 2X78A 3SYZA 1BL3A 1JLGB 5DG7A 4XIUA 1KCFA 2XY5A 2OPSA 3CJ5A 4FS1A 2YHBA 2V9WA 2GBZA 3RRHA 1N5YB 2JEJA 2OZMA 4ID5B 4XO0A 2AU0A 3AVFA 3PW5A 1L3TA 1S9GB 4ED1A 4FJKA 3H5XA 1ASVA 1S1UA 3MECA 3WNEA 3C6TB 2W7OA 3LP2A 4EO6A 4NLVA 3B6OA 5J2NB 5HP1A 4E7KA 3KLHB 3PV8A 4DTMA 4ECQA 3RMAA 4J2DA 1WNSA 1RT2B 4ZVFA 4DTUA 2QV6A 5F8IA 4Q43A 1VSMA 4AH9A 4PY5A 4WXOA 3OS1A 3PX0A 1BGXT 3CVKA 1QAIA 3FFIB 4ECSA 4CERA 3OSPA 3RWUA 2BGGA 1D9DA 4ZVEA 5DK5A 4CJFA 1KVAA 1IG9A 3AVHA 4QW9A 4J2AA 2AX1A 3HXMA 2HNZB 3KD5E 1L5UA 3OYFA 1L3SA 3I5AA 1RYRA 1X9WA 4RW8A 4C8NA 1JXBA 2JC1A 3SV4A 4Z4EA 4CHQA 4N47A 4OLAA 1GOAA 2ATLA 4KFBB 1ZTWA 1NHVA 1VSKA 4DFJA 2Q3SA 2I1RA 4F8RA 5DG9A 3NDKA 4J9NA 2OPPA 4FZXC 4C8LA 4OPJA 2D3ZA 3UQSA 1KTQA 4I9LA 3H4DA 1I3AA 1ZBLA 1DLOA 2QE5A 1RNHA 4W5QA 3NBPB 5KT4A 3OL9A 2ASLA 4ED6A 2WHOA 3TR8A 1BI4A 4CFAA 4R5PA 5HRPA 2PY5A 1ZBIA 1RT7B 3NCIA 3LPTA 2Z1HA 3DMJB 3OJUA 1JLBA 2G8HA 1RDBA 1RT1A 1TV6B 4O44A 5CZ1A 3OYGA 4H4MA 4Y3CA 3RB4A 3BGRB 4QWEA 5K14A 2HW3A 2IAJA 5CY4A 4DFKA 3IRXB 1LW2B 3OYAA 4HUEA 3TAEA 3RR8A 5KT6A 3OJSA 3SUPA 3TAMB 4EP5A 4N41A 2HWHA 1U45A 4Y1DA 4K4UA 4Z4GA 4CK1A 3M8QB 3O3GA 3V1OA 3SI8A 4NLQA 3BSAA 3DRRB 2OH2A 1GOCA 4CFCA 2KTQA 3CM5A 3NH2A 2ZQBA 4TY9A 3BSCA 1A5WA 2HVIA 4ED2A 5T7BA 3D45A 3ZT1A 1KVBA 4DU1A 2FVSA 2YNIA 4TN2A 3MF5A 4R8UB 4KKOB 4IRKA 4PWDA 3TQ1A 3RBDA 1EX4A 4M3YA 2C2EA 2HHQA 2P51A 1RTJA 3VQBA 5KT3A 1BCMA 2VG7A 1Q9XA 2YNGA 4O3QA 1D9FA 2HVHA 3T1AA 4J9RA 4EO8A 5KGXA 1S6PB 1S10A 3AVNA 1W25A 3IG1B 3T5LA 1SL2A 4E19A 4K4SA 2UVRA 3MEEB 2VG6B 4F2SA 3QESA 5L1LA 2X74A 5J2QA 4LQ9A 3VQQA 3EPIA 5KTQA 3PJXA 4FM0A 3RMBA 4FJMA 3MFHA 1JL1A 4IKFA 3OYJA 3NAHA 2RDJA 1Q8IA 3I5CA 1JXLA 4JRPA 3RAXA 4OKKA 4H4OB 4K8ZA 3RB3A 3VQ7A 1TK0A 3HT3A 2Z1JA 2B6AA 1Z25A 2E6LA 4PQUB 4ICLB 4QOZB 3V9UA 1RT4B 4IH7A 3V6JA 4FJ8A 3IN5A 3NGZA 2WK4A 4CJSA 3LDSA 1C6VA 1BISA 3CWJA 3AA2A 3AVLA 1JKHB 4Z4IA 4MKBA 3GIMA 4ECTA 3HO1A 3N6NA 5KFLA 5KFBA 1RTIB 4RW9B 3V4IA 5FDLA 2WB4A 4LSLB 2ZE2B 1ZETA 4CEBA 3OYMA 1TL1B 1A5XA 3OL7A 2DFEA 4IG3A 2D3UA 2J6UA 4RNMA 3D5MA 3B6PA 3M8RA 4IKAA 1QS4A 3HK2A 1T03A 1SH3A 2XI2A 3CG7A 4CEAA 3VQ5A 1QSSA 3EZ5A 4I9QA 4K4ZA 5KFZA 4CJTA 3DLGB 1BQMB 1RT3B 3OYIA 4KE5A 4OPKA 3G6XA 4MK8A 3RTVA 1XWLA 4NLPA 2OPQA 1JX4A 4FK4A 1IKYB 4KB7A 2JC0A 3FDSA 4O3SA 2FC0A 4LH4A 2FBVA 3MXJA 5F9NA 5J2PB 4M41A 1IKVA 4OLBA 4DTPA 2XGQA 4YR2A 1NHUA 4Y2CA 3KLFB 3NAEA 1S4FA 4IR9A 2RF2A 3V9ZA 1JLQB 3KJVA 3A2FA 4J2BA 4KTWA 3SPZA 1LWEA 3N6MA 4PUOB 3KLIA 3T5JA 4F50A 4CJQA 4JV0A 1BHLA 1BIUA 3RB0A 4DL4A 1S97A 2R2SA 1RT6B 1HNVB 5L1KA 3KK1A 3CFPA 5KFRA 3WNHA 1MU2A 1REVA 3UDLA 3KK3A 3DLHA 2IOCA 2RKIA 1J5OB 3HYFA 5KG3A 4CCHA 3M8PA 4FS2A 4JS5A 4O55A 1S1VA 3C94A 3E01B 3SNNA 1TVRA 2XGPA 3I8DA 3PW7A 4E89A 2G8FA 4DL6A 4CJRA 4AHUA 2HB5A 4BWJA 4F4WA 3L3UA 3N6LA 3NHGA 4DL3A 1N6QA 4KPYA 1HYZA 4O3NA 1TKTA 5CYMA 5EWEA 5SWMA 3DLBA 1NK6A 1RYSA 2XWYA 3PJWA 3KLGA 4CGFA 4CJ5A 4MFBA 3P83D 4TY8A 5KFXA 4ECYA 4MIBA 2D0CA 4DF4A 1JLCA 3PZPA 1SH0A 1TL3A 1DTQA 5C42A 2XCAA 4CEQA 2Y1JA 1TKZA 4X2BA 3KKRA 4U6PA 3PR4A 3ZT0A 1O1WA 3E51A 1SL1A 2HMIB 3D28A 5KFAA 5F8JA 1WAJA 3RMCA 4Q0BB 3HP6A 1T8EA 3QEXA 2R8HA 1L3VA 2P5GA 3DI6B 3RAQA 1N48A 3DLEA 5SZTA 3TI0A 2DTUA 1LW0A 4GC7A 1WSGA 4KHNA 1LWCA 3K5MA 4IFVA 1NKBA 5KI6A 1DTTA 1XHZA 3IGNA 5I3UA 4ZPCA 3NF9A 1R0AA 1C0UA 3DRSB 4IDKB 1U09A 4DQIA 4HUGA 2HHWA 4LD0A 2QKBA 1IKXA 3KIOA 4FLUA 1BQNA 4TYBA 4DU4A 1JLFA 4Q8FA 3BR9A 3ZSZA 2IJFA 1XR5A 4BWMA 3V81B 3CJ0A 1VSFA 1U4BA 1HMVB 1JLGA 1KLNA 1T05B 3KOAA 3P5JA 2IC3A 1BCOA 4TQRA 1N5YA 4NCAA 4HCBA 4ID5A 2BE2B 2XRIA 2ZKUA 3CQ8A 4ZMMA 5EWGA 4H54A 4CHZA 3H5YA 3DRPB 1QUVA 3K57A 1FKOB 3C6TA 1EKEA 3QLHB 1X9SA 2KFNA 1C0MA 2R8GA 4YFUA 4F3OA 4WE1A 4K4XA 5J2NA 3QGIA 5KFNA 4LY7A 4M3UA 2YNFB 3Q8SB 2UUWA 1RT2A 3I0SB 1K1SA 3I5BA 3IAYA 4E1NA 3H40A 2X6NA 4DTXA 5CYQB 3OVNA 4M3RA 3UPFA 1WSFA 1QE1A 2W9AA 3QEPA 4M3WA 3MR2A 4MH8A 5KT7A 5KG6A 1C1BB 3F9KA 4KHUA 1F21A 2HNZA 4MKAA 3DOKB 3UIQA 1KHVA 1CZ9A 3JSMA 4ECRA 5KRTA 3ITHB 2V0NA 3ZSWA 4DQPA 1NK5A 2R8JA 4KHQA 4KFBA 3VQPA 3H4BA 4GC6A 3QERA 4O3OA 1X1PA 1S6QA 2ILZA 3K2PA 5KRSA 4DTNA 2W9CB 4FLYA 4KV8B 5KG1A 4E7IA 4RNNA 4KBIA 1TGOA 4KTZA 5CZ2A 1YTUA 1XC9A 3NBPA 5C24B 3NF6A 4M3XA 1UOCA 1TKXB 1RT7A 2GIQA 1NJYA 4J2EA 4M42A 1UWBA 3DMJA 1T94A 4I7FB 2E4LA 4NLRA 1TV6A 3LP1B 3U3YA 2E6MA 5KFIA 4ZTJA 4DTSA 2YKMB 1LW2A 4KRFA 1CSJA 4JV2A 4ZPBA 3RB6A 2UVVA 3QZ8A 1YT3A 4CHPA 2RDIA 4W5TA 2OPRA 2WTFA 3BSOA 3M8QA 5KT2A 3H98A 1T3NA 4EP4A 3HVTB 1QHTA 4CJLA 1HYSB 3NGIA 3TAFA 3C6UA 1NKEA 4WFXA
chains in the Genus database with same CATH superfamily
5C25B 4FF4A 3CCZA 3G4SN 2MQMA 3W62A 3Q8UA 2BQ3A 1Q16B 2GZOA 2EI5A 2Y0BB 4FLVA 2CZ9A 3OVSA 2WVBA 4YY3J 3R5JB 4ELUA 1GLEG 1FTCA 2DR5A 5EX3A 4QW8A 3AQPA 2DNRA 2EFPA 2ZZMA 4J9QA 2ZD1B 2Y9HA 2VG6A 1NB2A 1LXJA 1Y4ZB 3ULDA 5KT5A 1IBCB 5G0RB 3C2PA 2Z2MA 4DSIA 2ZHBA 3GIJA 2KXHA 1V5IB 5I3PA 3F5TA 1N88A 4JI0F 3TUPA 1FJEB 1EJ7L 3C15A 3IXQA 3DYAA 3HZEA 2BR0A 3GIRA 1ZYQA 2BANA 1C4CA 1VQMN 1LOUA 4QWAA 3SUNA 2JLEA 3MAAB 4RBUA 2WRMA 1DQ9A 1NMNA 1X31C 4CK2A 4JI6K 3D54A 2OHDA 2YPYA 3B4DA 3W61A 2RRNA 2AP1A 4BR4A 1M90T 1HBUB 1KKHA 4DUZJ 2HZVA 1S1UB 1RTIA 3VQSA 4YN3B 4LSLA 2DHGA 2MLXA 3O4NA 4J9SA 2IDOA 3HPHA 2WBRA 1O5JA 2KKHA 3ZT4A 1DARA 4FJIA 2VFRA 3SQ4A 3RW7A 1E3MA 4OHWA 2M4MA 3DLRA 3N5BA 2HBLA 4C3KA 3HP9A 1OS5A 2W8KA 2CGLA 4YORA 1JIHA 2HG4A 1HPZB 2P9UA 1IJJA 3MR3A 1S0OA 2KYZA 3CB4A 2DR8A 2E1PA 3FRYA 4WFZA 3KD1E 2E7XA 3R27A 1KWMA 4BE1A 4IBNA 1PIEA 4YDDB 3KLFA 3M1FA 4I2QB 5AE1A 4LVNP 4X62F 2EG1A 2RPIA 3X1LB 3JB9k 1REGX 4LF6K 3M9NB 4NLTA 2N3OA 4B9LA 4M7XA 2IM1A 2R7SA 4B08A 1WEZA 3PSFA 3SBMA 3QBCA 1Y11A 3CJ3A 3DOLB 1ZC6A 3KUGA 1QQOA 3CJ1A 1TYQB 1JLBB 5HMWA 2P6TA 4NCBA 4H4MB 2RQMA 2M7SA 4E8UA 2H4YB 3BGFA 1CQMA 2JFKA 4C8MA 2CQHA 1M90O 3E01A 3Q86A 4OJRA 2OFGX 3JYTA 2NXNA 4ALZA 3M8YA 4DLGA 1HUXA 4UOHA 1GX6A 2ASOA 2FHMA 3PR5B 4ECUA 4ECZA 1RT5A 4I2PB 5DLFA 3G0ZA 3F56A 1MG7A 4DSLA 3LALA 3UD3P 3POTA 3H0PA 4BBYA 1U47A 1YVUA 3J8AA 1NU0A 2WONA 4DX8H 3QQCD 1YJ7A 2VHGA 4RW6B 1TUWA 1HA1A 1WBDA 4ES1A 4RJVA 1KC8T 4K8RA 4U8YA 4IO1A 3TW0A 1RTJB 3V6DB 1RBAA 3IAS9 3MXMA 1PSDA 4Q0BA 4OL8A 4BRDA 1OY6A 4LFBF 3SQOP 1HQEA 1VHIA 1FD2A 2QYCA 3ZCMA 4G3IA 3KYLA 1A5VA 4BACA 2IGIA 2J9DA 5J2QB 4DSEA 1D1UA 1ASUA 1NSQA 3DRSA 4O3RA 2HEKA 2A0FB 4Q45A 3C7NA 5KFOA 1FRJA 3PYEA 1DRZA 4DR3K 3ZNJ1 4L72B 1NGGA 3O8WA 1RCHA 3ID6A 3V81A 2XSJA 2ZBIA 4O8KA 4HVJA 1HMVA 3BP8A 3IBFB 1YVFA 1R89A 2ACMA 2GJFA 2D0AA 4ENOA 4YOXA 1IJFB 4I64A 2FHKA 2UV8A 3GV8B 4DG1B 4DF8A 3DRPA 1KFSA 3DCAA 3UN5A 5GAEP 4EHUA 1EHWA 5C7PA 3TO8A 3PO4A 4K43A 1OY9A 1Z2LA 1MWYA 4EZ6A 1LCUA 3AAQA 3NNHA 1K0VA 5KG5A 4O3PA 4P7VA 4K4YA 4NLUA 2IDEA 2DH7A 5CYQA 3AO1A 4WP9A 3VGTA 4KO0B 5AQHA 2DY4A 1GTEA 1S48A 3S3OA 1URRA 2QWNA 4CTAB 4A8XA 1KC8O 1JNZB 1TKDA 4J9KA 3HTVA 4ZLJA 2Z1IA 2O8EA 2OEMA 3MUTP 2HIQA 2MZSA 2E2NA 2DNMA 1IKVB 1RBOB 3AFGA 3CJTA 3QEVA 4J9LA 5K20B 1VBYA 3KJVB 3LDNA 2D0BA 4N77A 1GLBG 3R9PA 3WXMB 1XERA 5AQGA 3EMTA 2IJRA 4NA2A 3OTOK 2OTLN 2Z0GA 2RNEA 4RW7B 1S1XB 1NH7A 4AE5A 1NK9A 4Q8EA 1RJJA 5AQRA 3S3MA 5BR8K 3T3FA 4A46A 4Y0FA 4MKYA 1TL7A 3SDEB 2VFTA 1PYTA 3NE6A 1HNWJ 1YBTA 3WBZA 3C16A 3EGWB 4GRSA 3OTDA 2OZSA 1I6JA 2YKMA 2NRWA 3M9OB 2PYLA 3CJBA 1YJWS 1TUVA 2Q3PA 2HQIA 2YTCA 3GIKA 3KLHA 1BDGA 3AO5A 4ILHA 1NMDA 4DFMA 3SMZA 2Q31A 3H5UA 5KG4A 3E2EA 2W8LA 3JS9A 3ZSRA 1FXDA 5JLHA 1GX5A 5CYMB 2IYIA 2E2PA 3J81U 2KU7A 3FFIA 5JXSA 3PHTA 4CJKA 2D1CA 3UE5A 4JK9A 1U26A 4CZFA 5CZXA 4CI6A 2J7UA 3P1GA 4C0OC 4N5SA 4PKGA 2DNZA 4WFYA 5E26A 3ILOA 4M5NA 4JKCA 2QFIA 5EWFA 4F25A 1VQNS 2W41A 4FF2A 4OZJA 4GVBB 3H2LA 2AEFA 3CD5A 1YJUA 3BSNA 2V68A 4CLLA 3LTOA 4MQ3A 4F4XA 2J0WA 2FLPA 2ZD1A 2LA6A 4PXDA 3SFUA 3GIIA 5AQQA 3SXLA 2RVJA 4LRFA 3IBCB 4FZVA 1YX2A 4CGJA 1BHNA 1HNZJ 3IDHA 1G3OA 3MCAB 5G0RA 4FLXA 2QGFB 2BRLA 1VS3A 2YHYA 3W8GA 2D0PA 1CJTA 3FMBA 3AVCA 4FYDA 3J7ZT 4C7QA 2HQDA 3CCRS 2FUG9 5LMNF 2EHGA 3NEKA 3OYNA 2UUTA 1FCAA 3VGVA 3HSTB 1TTHB 2DFHA 3A12A 1M1KT 3RGIA 3IRXA 1WHVA 5L1JA 1CULA 4FJGA 4F4YA 3D6FB 1N5SA 3O2IA 3LAMA 5JVGL 1RHKB 1EXQA 2WVFA 1BA0A 2DCUB 2FB0A 4CIEA 2J8AA 2Z1GA 1HW9A 3AOAA 2HBYB 3SJJA 1PBAA 3M8WA 1HBUA 2F65A 2CGKA 1SC1B 4ZCMA 3OL8A 1AFIA 4XDDA 2V4QA 2B56A 3TEGA 5F8LA 4Y00A 1N4LA 4QR1A 4GNIA 1VJWA 3GFXA 4OQJA 1CXUA 1HPZA 1QE1B 4YMEA 3QNOA 4Z0UA 1UA0A 3W66A 3G71S 3VQ9A 2UZAA 1MROB 5AZIA 1S3XA 3OHBA 4YR0A 2AYGA 1S1WB 4LIRA 3QFHA 3NRBA 3RJMB 4LUBA 3G6VA 4X4OA 4AD6A 2B3TB 4F3QA 1WC3A 4I2QA 4C2MA 1TQLA 4DR6J 5K8MA 2PN6A 4DUZK 1IXKA 5B0BA 1WNEA 2MHEA 2OGUA 6AT1B 5E3QA 1U1KA 2UUAJ 3J7ZO 5AQFA 1M5OC 3H7HB 3PIOL 3V4MA 4IOCQ 5E33A 1M1KO 3DOLA 2HFNA 5HL7L 1YTAA 1Y97A 5HQ8A 2MEWA 2ETJA 1VQ7S 4W90B 3EKSA 2OTJS 1WDTA 3MM6B 3BREA 4RWTA 4DCPB 5HP1B 1RA6A 2NUBA 1K8KB 2IM2A 1ESVA 2QXFA 4PG4A 4HWIA 2CH6A 2I38A 2OPRB 4DR7F 9ATCB 2BW2A 3VF2A 2E9RX 3MDFA 1F3FA 4I2PA 1J6ZA 3TTFA 3C6UB 2BKPA 1J54A 4JLHA 1RP5A 5KFEA 3F2KA 3W3SA 2FD2A 2C2NA 4RW6A 4DUYF 3HHKA 2VB6A 3V6DA 3QIDA 1RU1A 3MR6A 4KHWA 3HI9A 1KQSR 5KFDA 5AZJB 3VETA 4QAGA 2PEBA 1FFSB 4J9PA 4M95A 1DLOB 3V6HA 3PRBA 2RILA 1U2RA 2AQ4A 3FGUA 3VGKA 3CCTA 2YJFA 2B7CB 1U1QA 2ZM6K 4TLRA 3ALYA 2VBWA 1ZM4A 1OVQA 4UZBA 4JI1F 2R7UA 4K25A 2B5JB 4BS2A 2E5JA 1Q79A 5HROB 2RSQA 4N56A 4FLTA 2FHJD 4ZP6A 5C10A 2ZUAA 4HI1A 1ITGA 3BH7B 1RABB 3DGPB 1F1BB 2JL9A 3AVKA 1ZBFA 5M2UA 4DG1A 2ASPA 3VVUA 3KTQA 5GAHP 4F26A 2YI1A 3MX2A 1RWUA 4LF1A 3TU5A 4HDGA 3MD1A 3TX0A 2KH9A 1CJKB 4RNFA 3ZC4A 3WEEB 2NPIA 4BR5A 1VCTA 3GYNA 4IH6A 4E7HA 4CJUA 2XHWA 2NR0A 3TAQA 4KO0A 4DL0C 3O6WA 3DAWA 4CTAA 3SCXA 2OA8A 1K8AO 3GE9A 4L3QA 3D9BA 3EUNA 3VAKA 2OO4A 1NK8A 2K7KA 2HQ3A 4NWBA 4QCLA 2JLFA 4LFAF 2M3DA 4KAIA 2GX9A 2F9JA 2L3MA 4P9SA 4B3TJ 4BRMA 4B9SA 5ADXA 2Y8YA 1VQKN 2Z58B 3QB0A 2YWKA 5T41A 2YX6A 3JXOA 4B1ZA 4M5JA 3AVGA 3LANA 4CNZA 3AVMA 4BC3A 2YHAA 2IMOA 1YDLA 1VQ5S 3QYYA 3CUNA 1PO6A 4RW7A 1DY3A 1S1XA 2DD8S 3ZZ0A 2BDPA 4M8LA 4ZP8A 2DISA 4A5BA 1XMQJ 1VQLN 3I55S 1JJ4A 3KHRA 2BE2A 3EVWA 3SDEA 3K5LA 2XULA 4CT8A 4CBXA 3BPDA 4H5TA 4FYWB 3V4IB 3KNGA 5C15A 4B3SF 3HBTA 3MAHA 3ZX2A 2DVIA 3MURP 1RAFB 5A0YB 3FZFA 3CJ4A 5JLFA 4IG3B 4GKKF 3I82A 4TQSA 4OGCA 2G1HA 4WXWA 3EWGA 3MN7A 2RMLA 4MT1A 4MK9A 3K5OA 3V9SA 1T03B 4H0PA 3R3TA 4BROA 3L3VA 2ASDA 4NXMJ 4IRCA 1WUAA 2FBTA 3OYEA 3FZLA 3GMGA 3S8SA 1FA0A 5CYJA 2GMLA 3HHLB 4M3ZA 2CKWA 3M2VA 2L9NA 4ETZA 1FRLA 5GVQA 5AT1B 2AJQA 2MY7A 4L8RB 3OR2B 3PHEA 4B3MJ 4F4ZA 1FEEA 4GVBA 4UY85 3N0VA 1HNWK 4X66F 4DCHA 3H6EA 2RF2B 1X4FA 4FW2A 2AZ1A 2VG5B 1VQOS 1OIAA 5ETRA 5HAOA 4OJ3A 4ZTFA 3CJQA 2NRRA 1GQEA 1N32F 4UOCA 2YWGA 4MKVA 1XHXA 1DT9A 5A76A 1N36J 3FEXB 4WYLA 5C24A 5DDQC 4DL2A 3NS5A 4FO0A 3GJQB 2BOPA 1WACA 2F5GA 5DDOC 2EK1A 1MU2B 4IR1A 5DM6L 1JJCB 5E2QA 2XMMA 1IM4A 1FKPB 3EXCX 3DHXA 2J4RA 1U2VB 3NVMA 2FZCB 1HR0K 2FZKB 4PKIA 3W0LA 4TXSA 1CLFA 2IVPA 2QA4S 1FWKA 3H45C 4C11B 1VQ4S 2J0QD 1IN0A 2ZVIA 3DDKA 4QWBA 1HKAA 3VEWA 4BC4A 1R8BA 3PW2A 4A8OA 3HVTA 3KLGB 3VCDA 2GWKA 3WUHA 2D74B 4DU8A 4E1JA 2IM0A 4EFAC 2HAIA 1O51A 1HNZK 1H73A 1TL3B 1DTQB 2LU1A 4M94A 4OI4A 1OVYA 2KRBA 2PT0A 3NCRA 1PAEX 1FFWB 3QGGA 4EEYA 1NJXA 4P52A 4QR0A 5KOXA 2UXCF 3TP2A 2NRTA 3BQ1A 8AT1B 1S5JA 1MROA 2XZDB 1S1WA 4M63C 2CJQA 3NF8A 4S0MA 3OFEA 4LF7F 4RUBA 1DTTB 1WUUA 4DS5A 2LMIA 4HCCA 2QO3A 5EN1A 2IPOB 1BWEA 4A61A 4A48A 4DMZA 2O8BA 4NRUA 4H4KC 4CE9A 4PXEA 3VGSA 3AO3A 3ICLA 1VBKA 4OX7A 2NRVA 4ZCIA 2W2QP 3KJNB 1U6ZA 2HZAA 3BY5A 2W1BA 3MMCB 2H9ZA 3T7ZA 1LXNA 4CIOA 4FS1A 2YH1A 3CC2S 5M2RA 3HHLC 4NZ7A 5IM0B 4XO0A 2AHOB 2DB1A 3AVFA 3SIPB 4A8QA 3KHYA 2XB2D 4BR2A 4DBQA 4FJKA 3QFWA 4U7UD 5J2NB 2DIUA 5HP1A 4E7KA 1K8KA 3NOGA 3SCLE 1RT2B 4JK7A 4Q43A 4AH9A 3KXDA 4PY5A 1ZM2A 5IT9O 3OS1A 4DR6K 3ZLJA 4DV7J 1B7YB 1Q8KA 4C0HA 3OSPA 3BS9A 2BGGA 1D9DA 2UUAK 1KVAA 1IG9A 4J2AA 2I6WA 3HXMA 4JKDA 3ZX0A 1T9TA 5E5NA 1L3SA 3I5AA 2V4JA 2MKHA 2AF6A 1NJIT 3HLUA 3TVYA 3O6QA 4CHQA 4N47A 5GAHI 4KFBB 1ZTWA 1VSKA 3ZETB 2Q3SA 4F8RA 3H1QA 2XMUA 2Z56B 2VC0A 2DTJA 1KTQA 2VBXA 2OIHA 3MI7X 3H4DA 1I3AA 1DLOA 2YWEA 4W5QA 1T44A 4TLQA 1AFJA 2WHOA 2N3LA 3TR8A 5AQXA 1CG2A 2CXEA 4FPIA 4EK2A 3NCIA 3AJ1A 2FZGB 3R5DA 1YJ9S 3DMJB 3P4IA 2E7WA 1BG3A 1TV6B 4Y3CA 4KH0B 8RUCA 4QWEA 5K14A 2QMUB 1KBRA 1YJNS 4OFZA 5CY4A 4X4QA 1VQ9S 1NGAA 3OYAA 2VD3A 2HFUA 3IM9A 1RGVA 3RR8A 1Q5VA 3GJRB 1EARA 1MNEA 3TAMB 4EP5A 4Y1DA 4LFCF 2ZH7A 4CK1A 2HBZB 4IOAL 1GLJO 3BSAA 3DRRB 1HBMB 2RRAA 2KTQA 1GOCA 3CM5A 4CFCA 2RHQB 1R59O 3I96A 2QG9B 3JXUA 1CJKA 1A5WA 1HI1A 3AJDA 2ZH2A 3WEEA 2VDIA 3D45A 1WG5A 3GB0A 2ASMA 4NI2A 2E5GA 2O1PA 2XO6A 1KXPA 2HHQA 4PHTX 1PAUB 5GINA 1XNQK 1NJIO 3VQBA 2LQJA 2OI2A 2VG7A 3WIVA 2ROGA 4EO8A 2QL7B 1S10A 2QX0A 1B64A 1OQ6A 3OR1B 3SMSA 4BC7A 4F2SA 3D67A 4CLSA 2JLGA 5JMVA 5AQOA 5KTQA 1U0HB 4FM0A 4FJMA 5GIPA 2EG2A 5DETA 3PIPQ 2P9EA 4WWSA 2ABYA 3JTNA 3CJ9A 4CYUA 4AL6A 4RPFA 3H90A 3UKUB 4Z7YA 2E6LA 4KHPF 1XQSC 4ZVUB 1RT4B 3NGZA 2WK4A 2UUBF 3LDSA 2DGTA 1BISA 2ZZTA 4Z4IA 4MKBA 3KFWX 2J0XA 4K7QA 2Z2LA 2VBYA 4BRNA 3CHWA 4B17A 3U4LA 1I5OB 3V4IA 4BRLA 3NWGA 3OL7A 2DFEA 4KY3A 4IG3A 3ILJA 4B3TK 4DV2F 3FUYA 2OSRA 4I0WA 4WQ5A 4IKAA 3HK2A 1T03A 1U2FA 2XI2A 1H98A 2JX2A 1H2UX 3GZ7A 1QSSA 3HRGA 1NGHA 4ZIVA 3OYIA 3RTVA 4MK8A 4NLCA 2ZH8A 2B7BB 3AXMA 2RHSB 2DEIA 3I4HX 1S6UA 1KAXA 2C3PA 2FC0A 4NASA 3DDIA 2FBVA 3MXJA 5F9NA 3OBYA 1XMQK 4M41A 2XGQA 4U67Q 4Y2CA 3NAEA 1S4FA 1WF0A 3WC0A 2RF2A 1RKJA 4KC5A 4H03B 3VERA 2QWOA 4JNEA 3A2FA 4J2BA 3DU6A 1YRTA 4LBPA 2OLWA 4PUOB 3T5JA 1KD1O 3U8XA 1BHLA 1WBBA 5LJ5Y 4DL4A 1S97A 3R2CJ 1RT6B 4C1NK 1HNVB 4ILRA 3BBCA 3PKYA 4CO0A 2B4OA 1MU2A 3CC4N 4NXMK 3UDLA 1EKRA 3BBBA 4WF9L 2A6MA 2FJDB 3FSXA 2YKPA 3PCOB 4O55A 3CCMS 4BGBA 4ILMA 2QLWA 4CW7B 3AD7C 3SNNA 1FEHA 5M1QA 1Y5IB 3I8DA 2QLJB 3VF6A 4E89A 2G8FA 4OI2A 1IBLJ 2H3GX 2HB5A 1HL6A 1OH6A 4C11A 4YDUA 4BWJA 3KG0A 3L3UA 1YIJN 1D09B 3D1QA 1RLCL 4L3NA 2VODA 3NHGA 4DHVA 3ZTRA 2NUHA 1C0GA 2LVWA 2B4PA 3KLGA 3GFYA 4KBOA 5E3AA 1ATRA 1Q18A 4MIBA 4DF4A 1TL3A 1DTQA 3VF4A 2XCAA 1SQEA 1TKZA 5MLCV 4H0VB 3THPA 3VV2B 2KDOA 5IQQA 3OD2A 2YQ3A 2KG0A 1O1WA 3LO3A 4JI2F 3K0JA 2DEJA 3RVCA 4PPZA 2BKOA 1NZAA 1OO0B 5KFAA 4OPAA 4O0NA 1ZPVA 1KN6A 3D7SB 3RMCA 2RB7A 1N0UA 2BJDA 3W64A 1S76D 5SZTA 2O3DA 4GC7A 1WSGA 3KZBA 2WSEC 3K5MA 4X4RA 1DTTA 2YX4A 1Y5NB 1XHZA 3IGNA 3MPWA 4L74A 2MPUA 1H7WA 4ZPCA 1R0AA 3H8YA 1U09A 3TJAA 2HHWA 3ZXWA 1RWXB 4FLUA 1NPKA 4HH1A 3CMAS 3ZSZA 4I6AA 3UDEA 2LCWA 5M1PA 1CS4B 4EU0A 1VSFA 3BF3A 3KOAA 3MMCA 2IA0A 4WK3A 1XJWB 3P5JA 1BCOA 3W1YC 2CQBA 2WW8A 4ISFA 4QIWD 5IM0A 1FO1A 2GFFA 4HCBA 2EPIA 2CYYA 4EGLA 4FPRA 3N4WA 3G4SS 1M5KC 1QUVA 3A8EA 1FKOB 1NSAA 5J2NA 5KFNA 3TPQA 4LY7A 3Q8SB 1RT2A 2VJVA 3GJTB 1HLUA 3OUYB 4E1NA 3ULEA 3HFVA 4DTXA 1VJQA 4KH1B 2E5LF 3UPFA 4CO5A 4CDIA 3M32A 4I56A 1WSFA 2HPUA 5CD4A 2UXBF 5KQ8A 3MR2A 5KT7A 2EWHA 3NVKA 3ZZTA 4QIVA 1C1BB 4EHTA 2NS1B 2NZCA 1G1XA 5ETLA 3DOKB 3FBCA 2DBBA 2BJ3A 4ILJA 3J80O 4ECRA 1FRHA 1FD8A 1HBNB 3J7YP 2Y0SD 3L95X 4J9UE 1VQMS 1NK5A 4KFBA 3TA1A 3J80Y 3ZETA 4K5RA 2AMCB 4GC6A 3MR7A 3ENQA 2VASA 4DR4J 3AA9A 4FXWA 4BRIA 4KV8B 4FLYA 4HTJA 4KBIA 2QZ8A 1RKIA 3C66A 2ZNZA 4O8UA 3TR5A 4YHHF 1TKXB 1X4CA 1NJYA 5D77A 4I1TA 4DV7K 2C2MB 2YWWA 4OX9J 5IWAJ 5IT4A 3DMJA 5B0GA 4I7FB 5H1SV 1TV6A 4RU2A 1V6HA 2JZ5A 2WVCA 2DNOA 5EX0A 2UXDF 4FYVB 1BUXA 4KRFA 2C2OB 1CSJA 4ZPBA 2UVVA 4H5VA 2AYMA 4A8WA 4XH1A 2DHAA 1Q7YT 4QS7A 5C2CA 4ZIWA 2WTFA 3BSOA 3H98A 3CJRA 4EP4A 3FNNA 3GG4A 1QHTA 4CJLA 1IR1A 1HBMA 4FN5A 1K9MT 3TAFA 3G8QA 1NKEA 2NZ4A 4F0MA 4CLPA 3R5BA 3EXYA 3PUFA 3VWSA 4OYWA 1E6YA 1OH8A 3MAQA 3HPOA 3HVRA 1X9MA 1C0TB 5IT0A 1NPRA 5LMNJ 3CERA 2I7NA 4FZZA 3MM7B 3G2XA 2WSFC 3M6UA 3MDQA 5KFUA 3NCQA 1TUUA 2UU9K 3OR1A 5J2MA 1YUWA 1TAUA 1F9FA 1S79A 3K9KA 4KHYA 3GV7B 4DQRA 1U0HA 3LW5C 5ETVA 1LK5A 1AT1B 3PEHA 3FC9A 2GHWA 4DV6F 2U1AA 4KGZB 3AVIA 2Y1IA 2YX1A 3HFZB 3D7EO 3KG1A 4O0IA 2R7QA 1T9WA 5IFMA 3UKUA 3RBXA 2ZHAA 3DFEA 1RT4A 3B78A 1M5SA 3PACA 3LL3A 1ZA1B 4O5BA 2XBPA 4LC9B 4CD3A 1VC0A 2ZOGA 4DCJB 4A57A 5HANA 3HULA 3LDQA 1UEUA 5K8OA 2FVCA 1Q7YO 1UFWA 3LP2B 1IKWA 1W2BR 3Q8QB 2HLUA 1K9MO 4OLOA 2RUGA 1P27B 1SJFA 5A8RB 3QGPA 2GNKA 2CJKA 3J81O 3LUYA 1S9EA 3NGRA 2PI4A 2O8CA 4ZLNA 3QO9A 2AEMA 3RU0A 4C48A 2RAQA 5CCMA 3C3LA 5KFTA 3BR8A 3J81Y 1B3TA 1RWNB 2A41A 3I87A 2CJAA 4LH5A 1EX8A 3PW0A 2VF3A 4MO5A 5BYRA 4U7UK 1IM6A 2OEKA 3Q7CA 5AXKA 3QIPA 4JYAJ 5HJXA 1KQSM 1NOYA 5B0DA 4U7CA 3I56N 3QRRA 1XNRF 3FEZA 5ETNA 2YV0X 3NCPA 2KRRA 3MGJA 3J81j 3ENVA 3KK2A 3NS7B 5ETQA 2OPPB 1UA1A 3CCVN 1NOZA 2RH3A 3E9OA 4LQ3A 3JQMA 1M5VC 3N01A 3MWBA 3K5NA 1HNVA 5M2PA 4LRAA 4X65F 4NCGA 3GILA 1S0MA 1A6LA 3GYGA 1N34J 4FXDA 1Y0HA 3SEOA 4G6VB 3C14A 5HMXA 2DGQA 4IYQA 4PEOA 4K4VA 1I39A 3QSIA 2KLAA 3CMEN 4DLEA 4GY2B 2ASJA 2XZTB 4CZJA 3HKZD 2FBYA 3D6RA 2MQNA 2K3IA 3QGHA 5L8RC 4DUYJ 2FY8A 2KQ2A 2P9SA 3RSEB 4JI3J 3VESA 1SH2A 4KH5A 4A8MP 1P8ZA 2NQPA 2HKEA 2QA2A 1GK8A 2FGOA 3QICA 2UV8G 3HOSA 1FFGB 3BB5A 1XR7A 2U2FA 4CP5A 1HKGA 2YNIB 4PQAA 1TK5A 2G13A 2LQBA 3KLVA 4HLBA 2J6SA 4JHDA 2OTLS 3TANA 2EFOA 5JVHQ 1EETB 2BOAA 3HJFA 2ZDOA 1RI7A 2E44A 1PILA 3ENHA 3VQ4A 1QY7A 1IBLK 1RE1B 3ADAC 1PJ6A 2HGNA 1Y9OA 5KOWA 2VOPA 1EP4B 5JUMA 3MPUB 1IBMJ 3Q2TC 3H20A 1HIYA 1G6BA 5CH7B 1APSA 3IS9A 4ZHRB 4BR9A 3SUQA 5BYQA 2B8PA 3U9DA 2RE2A 4DR1J 2QSFA 1RHQB 1CS4A 1S99A 2CPXA 5KFVA 1WDDA 3QDKA 4ED8A 4YR3A 3IMXA 4EBEA 2R2UA 3BJYA 3D1HA 3EE3A 4NA3A 4LRCA 2JEIA 1X3MA 4WP3A 4OYOA 5DZ6A 1FKOA 1WG1A 5KFSA 4CGGA 4WCEQ 1VRUA 1G99A 4IFYB 4CLYA 4LFAJ 1JJHA 4M5GA 1VK8A 4EZ9A 4NPOA 3CO9A 1N52B 2IVNA 1RWWB 4OKEA 4FJ5A 3QT8A 3THYB 2GX8A 2FBXA 4ZDNA 2V2QA 3CQXA 2HBQB 4CO4A 5AQKA 2GV1A 1G7CB 2CFXA 2PFDA 3HVWA 3PIPL 4ISGA 2A42A 2XMVA 4XAKA 1B9DA 2ZEJA 1HBNA 2O4IA 2A1SA 2PD1A 3F73A 5F1XA 1FKAF 1H7XA 2RU9A 3DLLQ 2UYTA 4GKJF 4AXIA 3OBWA 1PCAA 5B0CA 2V52B 1WKKA 5AE3A 5LMUF 2EC0A 4JV5K 4IDHA 4CJEA 2AGOA 1NWKA 1V4SA 1YGYA 4PKHA 1LKZA 4C4WA 2VPYB 1OWXA 2WVEA 5J1EB 3KLEB 2Q36A 4RNOA 3UD4P 3TZXA 4I7FA 2QXLA 3CDWA 3T9NA 4RWXA 2XMAA 1S9GA 1FXXA 1EO1A 2KXFA 1JLEB 2R4FA 2G4BA 1TVRB 1YWXA 1S0NA 2HHHF 2V4RA 2NRXA 2IIRA 4DJBA 3K89A 3EGNA 2LLZA 3C0BA 3MUVP 5AXLA 5GMKa 3CGIA 4DI6A 4DV1J 4DR4K 2HHUA 3VQDA 4MFBB 1N32J 4I4BA 1WSVA 4JI7F 1J5EF 3BZQA 4U67L 3PYDA 2B9EA 4CGIA 1HJRA 3VQ6A 3AVJA 4CECA 2VWBA 5DQHA 2B9XA 3IGVA 3K8WA 3W5ZA 4OX9K 5IWAK 2E1AA 1CJVB 4A8FA 4UT4A 7FDRA 2HMPA 1SJ3P 2YKQA 1WSHA 4LVOP 2FJVA 1Z26A 4R25A 4KHMA 3DLEB 2FYXA 3TZZA 1IJEB 3GOIA 4G9ZA 1MMNA 3ZEUB 4BDYA 2B0GA 4CF2A 2Q0RA 3O4QA 3QPIA 4DTRA 4CHNA 3ENOA 3DLJA 1VSHA 3MCPA 2HBRB 3VZHA 3VEVA 2FVRA 1TAQA 3BGRA 4NL5A 1XIQA 3VZIA 4UW2A 2VQFF 2G9OA 2CA9A 2OP5A 2N4DA 2OYQA 5LMNK 1A7GE 2UUCJ 1GLCG 2UVWA 2P9LB 2HFOA 2BH1A 4PXBA 4RW4B 6FDRA 2MKIA 4FKYA 3AB2B 5HVFA 3G82B 2LSNA 1W7AA 1JJ2R 3MN6A 3OY9A 1ZAWA 4CLUA 3OYDA 4CLZA 2B9YA 4YQWA 4IO9Q 1SKRA 4ECXA 3MUMP 3L0QA 4JKBA 3R2DJ 1FJGJ 2KT5A 4ZVQB 1G15A 4XK8C 2VQEJ 4HTLA 3WQPA 4AUKA 1FDNA 5J1PA 3IG1A 3H46O 4QYZJ 4ZCLA 4C8YA 2FLNA 5CXTA 3JSMB 5M1NA 2KO1A 3FR0A 2LXUA 4DV0J 3AO4A 2CIMA 2ZUGA 5DLGA 4F3TA 3A5LC 3AXKA 5CABA 4QQBA 3TUJC 3DXSX 1WI6A 1TL5A 4J37A 5LXRA 5DO2A 3BKFA 1S6QB 3A3PB 2VOOA 3L09A 4JI6F 3TTCA 4H4OA 3R1HA 2O5DA 4K50A 5D0EA 3QJLA 4XH5A 5EVZA 1VQSA 1SZ2A 3ILIA 2DRDA 4B9NA 4Z4FA 3KWIA 2GGPB 4PQUA 3EE9A 2MLYA 4E0DA 1SJRA 1HWIA 1QQCA 2DNGA 3S3NA 3V9WA 5KFFA 3NGSA 1JKHA 3M6VA 1QSLA 1ZM9A 1RBSA 2VA2A 4DL5A 1SVDA 4RZRA 2F4FA 1QD1A 4HYKA 3CF5Q 1I94F 1TL1A 4JYAK 1VAZA 1NJWA 4OKJA 2P9CA 2ATQA 3H2VE 2XYHB 4B1VA 5IV4A 4ECWA 1RLDA 1VC6A 4TNOA 4DQQA 1NGBA 2IFXA 3M30A 3BZKA 1OMSA 5LSOA 1RXOB 4WQ4C 4E3SA 2VYPA 4X4UA 4OJ1A 4WFNL 3PYFA 1BQMA 2GELA 1RT3A 2F4VJ 2J7WA 1VQKS 2XLIA 1Q86T 4FBTA 3OL6A 1X5PA 3UB5A 3V1QA 1YLXA 4LF6F 3CO0P 1N34K 4IEIA 2QKKA 2CQ4A 5EGYA 1GMVA 2V8PA 4ANEA 2R2RA 3MR5A 3R6LB 3BKUA 1VBXA 2CADA 1EETA 1TU0B 4TVAB 4JI8K 2MKSA 1PG5B 2QK9A 2C1EB 3WX4A 1VQLS 3SFGA 4DUYK 2IA6A 1N8RT 3MX5A 4U95A 4OI6A 4OZLA 4JI3K 4FWQA 5L1IA 2WFBA 5BYSA 1BO5O 1EP4A 4PYDA 4I68A 4W5RA 2MSSA 4CEDA 2P9GA 2A2CA 3EN9A 1VYAA 4URSA 4ZHRA 2GIFA 2DGXA 3DYAB 2Z2ZA 2Z30B 2BANB 1YI2S 4HI2A 4DKWA 5GAEU 3BN4A 3B8HA 2IRXA 5DMRA 3C6HA 1VMBA 1U6FA 1IQTA 3AA4A 4FJXA 2KFYA 4TU9A 1QDUB 3CPWR 1GOBA 2NPFA 1QJHA 2FVPA 2V51B 5AQPA 4F36A 3TARA 1W9HA 2RJZA 3PVXA 2XWXA 2CVIA 1QSYA 4AHSA 3CCEN 4IFYA 4U96A 3FGVA 2JSXA 1G2EA 5AQJA 2BJ1A 2V8DA 1IWGA 1SL0A 1V9OA 4Y1CA 1MA9B 1IBMK 2VZ9A 4AM7A 4RG8A 1BU6O 1Q86O 4PWDB 2LQ9A 2W7PA 3THYA 3TA0A 2ZGYA 1FXLA 2HMIA 4C6AA 3S9HA 3E3XA 2P9UB 5D78A 4DR1K 2YNGB 3MEKA 2XLJA 5KFJA 4ZJQA 2NXUA 3MWPA 3LDPA 4FOIA 4RBVA 1WSRA 1RACB 4DR3F 3WXKA 3MCNA 3HF5A 4USHA 1N8RO 1Z4UA 1U8WA 4KGKA 5B0AA 3L2VA 2HFZA 1WC1A 4P2FA 4HT5A 1R31A 3OYCA 3DN9A 2LU2A 2WW4A 1S59A 4CIFA 3L7UA 3TWHA 4X4NA 4ZPAA 2QC3A 1BLUA 1WF2A 3U7JA 4CT9A 4H0OA 4B8AB 5H9EJ 5J1EA 3KLEA 3EY1A 4Z4HA 2DR7A 1B70B 4CH7A 3G6EN 2HWIA 2K3KA 1J53A 2H5JB 3K7RA 3NWRA 1JLEA 1AXQA 5FDLB 1VOMA 2E29A 1U04A 3JYTB 2IRYA 4OZ3A 2CZ4A 1QVFR 1J2VA 2GHPA 2B4JA 3HCXA 2F3JA 2HBMA 1PGZA 4PCQA 4ZCKA 5E0OA 1R3NA 3E9LA 2H1YA 2LKZA 2F7VA 3ZZYA 2RT3A 2AGPA 1HWJA 2EBGA 3AGRA 3AODA 4FCYA 1RT5B 3KUHA 1KQKA 4L6V3 4ED0A 1NK0A 4BE0A 3S6EA 5FRMA 4ELTA 4BG9A 3POTB 1RHMB 3VQAA 2MYFA 2OPQB 1TK8A 1VFJA 3UW1A 3ZSOA 2WONB 2HLTA 1WOQA 2W42A 4DR5F 3W2WA 5DGBA 3NG8A 1BMQB 2R7YA 3CFOA 1V3SA 3NP5A 3IO1A 1OSDA 5FRNA 3OTOF 1H6KX 2FDNA 2CPHA 3NMRA 4OI1A 2F9TA 3V1RA 1EIYB 3Q8RB 4ED5A 1HWKA 3X3UA 1LWEB 3EZUA 3FBFA 3QIOA 1HQEB 1CZAN 5BR8F 1W0HA 2E5IA 2WC9A 5T7LA 3ZEUA 3TSPA 2VWKA 1S7IA 3Q83A 3QATA 4KGVB 1SKSA 1URNA 3G86A 3CM6A 4YOWA 4DV1K 4JI5J 1HKBA 3C7NB 1T9YA 4DV3F 4USWA 3TOQA 1N32K 3KK3B 1DBDA 3LP1A 1NGJA 1UWAA 1RBRA 3VAFA 3ATUA 4CEZA 3M8PB 2G8UA 3SV3A 1S1VB 2A1BA 3K5PA 1DZ5A 1Q9YA 2CQ0A 3R7NB 5KFPA 2CPYA 2MMYA 4RW4A 4B3RJ 1N6QB 3W63A 1TKTB 3G82A 3FMWA 4CZLA 1FE4A 3V2UC 3O08A 1KVJA 3IBWA 1J9AA 2EKNA 3KKSA 2KVIA 2IS3A 2QEXN 1WJ9A 2HQFA 4RWWA 4AF1A 4RUCA 3DXKA 5C42B 2EW9A 5AR0A 4DUTA 4KH4A 5JVHL 1KQGB 2CNLB 3PRDA 2D41A 1NCLA 1B92A 3CTRA 3IC1A 2BVZA 3M8ZA 1U6BA 1XUPO 2ZJPQ 4L3KA 4BDPA 4ANDA 1KFDA 2JJ4D 2I7PA 4EYIB 1LW0B 5E3PA 2ADBA 2RQKA 4IFVB 2UUCK 1VK0A 3CD7A 5I3UB 3ZX3A 2BJ7A 2GHVC 1C0UB 4U9RA 5KGWA 4HACA 2NZTA 1HNXK 3OLBA 1FWPA 4NLSA 3AV9A 5F41A 3T5KA 1RDAA 4NYNA 5DG8A 1JLFB 5AE2A 1NHKL 1X5SA 4FF3A 2X78A 3HZGA 2XS5A 2GGPA 4R0JA 1JLGB 2XNQA 4XIUA 1YAGA 3ET6B 3P96A 4L76A 4NEZA 3FCHA 2E5LJ 1KCFA 4BQLA 2OPSA 3VMFB 2YHBA 2GBZA 3RRHA 1FJGK 1H0HB 2JEJA 2OZMA 1SBRA 2UXBJ 2CQ1A 2PA8D 2RHKA 3IWNC 2VQEK 1L3TA 1YSJA 5HI7A 3FKBA 3C16B 4ED1A 3H5XA 3BV8A 3K9JA 3CD6N 1BUPA 4RCHA 4QYZK 1XMOJ 1V3RA 1QUPA 3KLHB 2CPJA 2EBEA 5BRFA 4DV0K 2A5XA 4DTUA 2MKKA 4P7TA 2HOEA 2OMLA 1UJ6A 3ENAA 1QAIA 3R6MA 3FFIB 4CERA 1KTVA 1UJ4A 4MDBA 4CJFA 3N4PA 4YOUA 4V19X 5FLXY 4J91A 4W4MA 4DUZF 4YHHJ 4B1UB 1Q53A 5MAOA 1RYRA 3OQ2A 2MSTA 2ACYA 4RW8A 5EXWA 1H1VA 2MXYA 4OLAA 2EC2A 1HHTP 3GSIA 3NDKA 2W24A 2C42A 3GFZA 3FLCO 1GMWA 4EIAA 5AQIA 3R9LA 1E6VB 4I9LA 2BACA 2FTRA 1PBUA 3H1VX 3C65A 4FKXA 1GXLA 3ZTOA 3NBPB 5KT4A 2D9OA 1ZBIA 5GIOA 3LPTA 1CJTB 2GQCA 2Z1HA 9RUBA 4ERDA 5GAHU 1RT1A 4O44A 3WDOA 5B7WA 3HDSA 3RB4A 3GCXP 2F4VK 1NEEA 2PGCA 2HW3A 2QMXA 1FRXA 3IRXB 1VIOA 1CULB 2FSKA 3OJSA 1HQ2A 4ZVTB 2XM3A 1W2BM 4Z4GA 1A9NB 1AROP 3L4BC 5DM7Q 5ELZA 3O3GA 3V1OA 2MTLA 1FNOA 1AB8A 3BSCA 5DJBA 4ED2A 2R7WA 2KHCA 5T7BA 1YK9A 4A62A 4DCOB 2XLKA 5FIIA 2FVSA 3PM9A 3MF5A 3P4UB 2E1MC 4R8UB 4PWDA 3TQ1A 1YJTA 1WD6A 2P51A 5BJRA 3BF1A 4Y65A 4ZLPA 1BCMA 2AW0A 1TMMA 2WZ1A 3P8BB 2YNGA 2HVHA 3CJ7A 4J9RA 2ZM6F 5KGXA 1S6PB 2P2CB 3L7OA 1L3KA 5AZIB 3VAIA 2F9WA 3CC4S 2UVRA 5GMEA 3F41A 3MXHP 3VQTA 3H3NO 2CNKB 3RMBA 2QA4G 2DH9A 3MFHA 1JL1A 1PJ5A 3VGLA 1D9AA 3OYJA 2RDJA 3QRPA 4CVNE 3VPZA 1W26A 1Q8IA 4W98A 4JRPA 5G4DA 4OKKA 4WJBA 3HHLD 3RB3A 5AQVA 2BKNA 3AJ2A 1YIJS 1TK0A 2DHXA 1QTNB 2CG4A 4PG5A 4V19S 1Z25A 3CQYA 4IXCA 3D3BJ 4K2JA 3SAHA 3Q2SC 4KGMA 3V9UA 4FJ8A 1LK7A 5BRHA 2HURA 4CO1A 4NXNJ 3RBZA 4CJSA 4JAXA 2W40A 2JH3A 2LXFA 4PG8A 4DR2F 4IO9L 3TYTA 4U8VA 2DGWA 2ZHOA 3FZHA 2H4WB 4RW9B 5FDLA 1RAAB 2WB4A 1S6OA 4CEBA 2ZE2B 1ZETA 3OYMA 1Z2ZA 5I4MA 1P6TA 4UUWA 3TSUA 5AQMA 1H72C 1IQZA 2ZH1A 2D3UA 2VU5A 3MPDA 4RNMA 4LR8A 3GSDA 1YVNA 3M8RA 4BRPA 4YB7A 3TSQA 1KAYA 1UCNA 2DJWA 3THWA 4OYMA 2GTDA 4YOTA 1ZXOA 3TJ9A 1XN9A 5E3CA 2V2KA 1S57A 4KE5A 3G6XA 4DV5J 1XWLA 1RSCA 2OPQA 1JX4A 5H9EK 3DU5A 3EDRB 4P10A 4BRFA 4BG8A 5J2PB 4OLBA 4DTPA 5B08A 4M5LA 4YR2A 2ZBRA 4A2AA 3BYPA 3QMLA 1YHQN 2GJIA 5FD1A 3O1LA 2E1YA 3V9ZA 4M5IA 3SPZA 2K2PA 2AYBA 1LWEA 2HS3A 3TUIC 3O9RA 4JV0A 3ZYYX 3RUBL 1NM2A 3RB0A 1NNEA 4UY8T 2R2SA 2CQPA 1UVNA 2V8VA 5KFRA 3WNHA 1PC4A 2F7TA 4OO1J 1VR6A 4HR2A 3KK3A 3DLHA 2IOCA 4PG7A 2C3YA 1J5OB 3TJ8A 1NGCA 1U1NA 2YXLA 5RUBA 3M8PA 4FS2A 1S1VA 2YPZA 3PEJA 1CC8A 3QBXA 2XGPA 3PW7A 1RZMA 3CXCR 3L3CA 4DL6A 1RTZA 4CJRA 1NGEA 4DB3A 1IBKJ 3B6BA 2WTUA 2AV5A 4WIQA 4F4WA 2PA3A 1N6QA 1HYZA 1TKTA 5SWMA 1RYSA 3PJWA 4CGFA 4CJ5A 1FDAA 1R27B 4NMXA 1Q8BA 1X60A 5D15A 4BRCA 3M7VA 3M2UB 5C42A 4X2BA 1X4GA 3KKRA 2MQOA 4U6PA 3ZT0A 3E51A 5MLCQ 4JI5K 2DH8A 3UI3A 1DJ0A 3D28A 4JEPA 3IA0A 1JCFA 3C19A 3BUZB 1HJOA 2EFQA 2YWHA 1FHTA 5ITHA 1T8EA 4DPTA 2R8HA 2VDHA 2M9KA 4AYBD 1AW0A 1N48A 5AJ3K 2RD5C 3T1HJ 1LW0A 4KHNA 4IFVA 3IRWP 1NKBA 5I3UA 4UY8O 3ETOA 3NF9A 1C0UA 4B3RK 1HR0F 5SUHA 4IDKB 3EZOA 2NSBA 3HT0A 4M7YA 4LD0A 2QKBA 1IKXA 3FCVA 3D0HE 3KIOA 5GAGP 1BQNA 3WXLA 3Q8YA 2J9CA 1JLFA 2BV3A 1F6TA 4Y2IA 3B8AX 2E66A 2IJFA 3RYLA 2KT3A 1U4BA 1JLGA 1KLNA 3ET6A 2CVEA 2HFVA 2IC3A 1C4AA 1U1RA 4TQRA 2DNHA 1PYSB 3GG1A 4FSVA 2BZ2A 2R7XA 5GADI 1HNZF 2BE2B 1T9UA 3UVJB 3CQ8A 3US5A 3T41A 3K57A 3QLHB 2HVZA 2KFNA 1C0MA 2R8GA 1I51B 4WE1A 3PLAA 3W5YA 2YNFB 1K47A 3I5BA 3LQVA 3H40A 2YVSA 5L39A 3N9UC 3OVNA 1UP1A 2GW8A 1IVZA 5LMUJ 2PSZA 4LF4J 4MYUA 4OYXA 1B7FA 3M4XA 3ZZPA 1KVKA 3GPAA 2W9AA 4M3WA 5D4LA 5KG6A 3M2VB 4WFAQ 1J27A 3UIQA 1M1GA 1HBOA 3ITHB 3SJHA 4FVUA 2V0NA 2M88A 2J9DE 3QERA 1ILYA 4O3OA 3HHNB 2ILZA 4DTNA 1SJQA 2GAHC 5KG1A 1XMOK 1E6VA 2ASYA 2CQCA 2DKOB 1TGOA 2KN4A 3MWTA 1XC9A 5K8NA 3NBPA 5C24B 2OANA 3NF6A 2DIVA 2IVYA 1Y7PA 4I6YA 1DHMA 3I9V9 4M42A 1UWBA 3EGZA 1ITPA 3MCSA 4NLRA 2D3OR 5KFIA 5H1SQ 3O5TB 2QTWA 2MKYA 1MN9A 4LJMA 2AJ4A 4X4PA 5M1KA 5D0GA 4JV2A 5HJYA 2UUAF 4YY3K 2AKWB 1BOTO 3BYRA 5BXIA 4W5TA 1JJ2M 3NNAA 3UKRB 3Q0AA 1SIWB 4MO4A 1VQ6N 3HVTB 2MGZA 3I8BA 4WFXA 1IKYB 3I56S 4QIGA 2QFJA 1VQ4N 2PIIA 4KI6A 3CCWA 3CCVS 4R8UA 5D4OA 4ZVSB 3HSCA 1EZZB 3NH1A 4PPDA 4BREA 5AQTA 1JL2A 2QWLA 4M1KA 5D3GB 4GO7X 4AILC 2E1ZA 3PX4A 1S6PA 3EGVA 2N7YA 3MEGA 2A3ZA 3ISNC 4CNYA 4K4WA 1ZBHA 1UKUA 5KFYA 2CNNB 2BUNA 4CF9A 3CMES 4ES2A 4DV4J 3OYBA 1KHWA 4WBFA 1HNIB 2L08A 2O8BB 2HHSA 4FWNA 1XQIA 3OT9A 4C98A 3D0GE 3JSBA 3M9MB 3A1YG 1VSLA 1NPPA 2QSWA 1WN7A 3AAPA 4JI4J 4OX8A 4OV6A 4XH4A 3ZTQA 3NMUA 4FVMA 2AGQA 1HARA 1TELA 3T69A 3V9XA 2DXEA 1D8YA 2YH0A 5DDPC 4F2RA 2DXDA 4LF9J 2E8AA 2D7SA 4RW9A 5A2QO 2ATCB 3AY9A 2ZE2A 4OHVA 1XMBA 4M5HA 1XNQF 1OJ4A 2A10A 4KRWA 5A2QY 3T1YF 1YXQA 4AHCA 5KPZA 2HHXA 5A6WA 2VKRA 1B4SA 5JS2A 4B9UA 1KAZA 2X6SA 1UETA 1RHUB 1Q0NA 2CWKA 3T6JA 3KUEA 4H0TB 2XCPA 1Y64A 2QA1A 4NLXA 3GL1A 4CJWA 3M8SA 4DPYA 3T9ZA 4HVZA 4Z7CA 3DHWC 3SSSA 4I6WA 4NXNK 2V4JB 2YKOA 3J7AN 5J2PA 1H2VZ 2DRAA 3VQCA 5HRRA 1C1AA 5HN0A 2E1CA 4CJPA 1JLAB 2BTFA 4B3OB 3BM7A 3U1LA 1MSWD 2ZJRQ 4OVLA 2DT9A 2CDQA 2BQRA 3LF0A 1ACMB 1FRKA 3EM1A 1G4CA 2DNNA 2LA4A 3GFHA 1CLQA 1I94J 1QAJA 3FZMA 3HM8A 2VIHA 1BIZA 2QW9A 4ANCA 4O4GB 1LWFA 1NM1A 4IJAA 1Q81T 3UCGA 3CCSN 3LA0A 1RQ0A 2JVOA 3MTJA 1KEKA 5BPLA 3PNIA 2PDAA 4UF4A 3P5BP 4CBUA 4DEZA 3L2UA 3KJQB 4P74A 4B3TF 1J5OA 4CGDA 2R8KA 4DV5K 4P75A 3RRGA 5K14B 1KNZA 2HQCA 1S72N 3BO2A 2FC9A 4W5OA 2QT7A 3CPWM 4N8NA 3VTHA 4LF6J 1IG8A 3HKWA 3GDQA 1ZBUA 3BDPA 3VN5A 2W7AA 3WNFA 5HQMA 1BWFO 1DGKN 3L8BA 4FJHA 1BQXA 4PKDB 3L4QA 5LJ3Y 5GAGI 4Q44A 1T7PA 3TEHB 1VBZA 1RTDB 2EKYA 2VKZG 1N56A 2MB0B 3M2UA 2WAQD 4K8XA 4ZP7A 4XTTA 3CJ8A 1NU4A 3UNYA 4NI2B 4LIWA 3GR0A 3N28A 1QHAA 5IZHA 3MEDA 1YF5L 4JKHA 3PTWA 1NDLA 4ELVA 4CO3A 2ZH4A 2DITA 2VG7B 4K59A 1LNQA 2OSQA 3IP0A 1BY9A 4NXMF 2R7VA 3SCKE 2AWZA 3VENA 1RBVA 5EOYA 1IBKK 3DWLA 2CQIA 2XNRA 4IDKA 1Q81O 3VEOA 2KW4A 4QIFA 5F0UA 2NREA 4KREA 4DN9A 1XK8A 1YBUA 3HFKA 4JD2B 4CYUB 2AEJA 4GO5X 4Y34A 1NJZA 1MDUB 1NZ8A 1KLMA 5EUHA 4CF1A 1FW6A 4B9VA 2EEYA 1HI0P 1R6VA 5HRSA 3DLKA 5DM7L 2BUPA 3VHQA 1VSEA 4AXJA 3UVJA 2MZJA 4IUFA 2C2ZB 2KVQE 4QWDA 4GV6A 3QLHA 2J6TA 1UMJA 1QVFM 3JAMU 3QFPA 3T1HK 3BPSP 4WU3A 3ZT2A 2VPWB 2IYGA 4USTA 2YNFA 4EFHA 4LF5F 3AA3A 4NRTA 2BE9B 2AZ3A 4CZEA 2BX6A 4ZA1A 4GW6A 5KFGA 4JBCA 4ZPTR 3J7YU 4DN0A 2CPDA 4AHVA 4WYWA 3Q22A 2G8VA 2B4UA 1VRQC 5IC4B 4F02A 2ZZNA 2IHR1 3O9SA 2CPEA 4BRAA 1QZ5A 3KMQA 3LGHA 3TABA 4FWKA 2KJVA 4KR0B 5F3ZA 2XI3A 1RDCA 3CCUN 3KMSA 5KFWA 2XS7A 1QVGR 3ITHA 2EXUA 1T3OA 1OPZA 3C95A 2RRBA 2FJAB 3DXMA 2QLXA 3BBFA 1LAWA 1RU2A 2YBVA 3DJCA 2YY3A 5AQLA 3PSIA 2NXEA 4JV1A 4FJ9A 2HS4A 4UQGA 3HD1A 5ETMA 3G87A 4IG0B 1WSIA 2AJ2A 2CQGA 2XTJP 1Q8LA 3MOJB 1VSDA 3IKMA 2NNWA 3K59A 4LF4K 4FDFA 4DS4A 4XPCA 1YZ6A 5CZVA 2W25A 1VRTB 2LP4A 1KOHA 5F0XA 1VQ8S 4A47A 2HF3A 4C8ZA 3ZZUA 4B9TA 3CCQN 2G2OA 1RTHB 2DFFA 4DR5J 1FRMA 1YRXA 4BVOA 4WYBA 3W2VB 4X4SA 3OTOJ 2PEHA 3SUOA 4CM0A 1L3UA 3UKRA 5LJVA 2I5JB 1ZA2B 5F8HA 4LF8J 3OHAA 1S9FA 2GVDB 3A3NB 4AHRA 2WBMA 1HKCA 3M3ZA 1NK4A 1IKYA 3PRVA 2A18A 2EX3A 2JFDA 2YCHA 1FWLA 1TKZB 4OPHA 1RA7A 3O1WA 1WHXA 1N33F 4DV3J 5GMDA 4CZCA 1UJ5A 3F9MA 1EQYA 2E2QA 1Y3JA 3W9IA 4HHJA 5D3GA 2GUIA 4XPEA 3FJ2A 4W5NA 2DY9A 1HWLA 2XY6A 2ZF5O 4OYAA 3QINA 3U27A 3VEYA 2DNQA 2GJ2A 2QI2A 2ZDPA 1Q7LB 5BPMA 4YOVA 1UFLA 3M6GA 2VA3A 2ZC4A 1FX4A 1V4TA 4NA1A 3CEDA 4USVA 1R0AB 3DRXA 1WELA 1HNIA 3VEZA 3AQOA 1QQMA 3P45B 1WSJA 2V2VA 4WQ5C 3A13A 4FZYA 3PY8A 5I42B 4GMKA 2ZC3A 2ZWOA 1RDUA 4O5FA 3G6YA 3WQUA 1XC3A 3H3OB 2HNYB 2CDRB 3NL0A 2DPIA 1Q78A 1SCJB 2WSCC 1NDCA 4BRGA 2X3GA 4CRJA 3KHLA 1RAEB 5CAAA 2QYGA 3DDNA 4JUZA 4BY9C 1ZTTA 4WZQA 2E9TA 3QEIA 3L7PA 5HSPA 4C0BA 4BQZA 5C12A 1SJ1A 4CQ1A 4DV4K 3ULEB 2ADCA 2ZWHA 2MJUA 4YS2A 4KKOA 1SB6A 2HRUA 2UU9F 4DHYA 4FK2A 1C0FA 3T6BA 3M32B 1U1LA 5IT9Y 3QNNA 4ZOSA 4DMNA 4HHHA 1RAGB 3FZBA 4X64J 4JI4K 5HMZA 2D5RA 2NRHA 3MEEA 3LAKA 3QRQA 1QTMA 1R8CA 4CD1A 1JLAA 4B3OA 1RWVB 1SKWA 4USKA 5HBMB 4O0JA 5BPNA 4LF9K 1YBAA 4YDUC 2MKCA 2NLXA 4HTUA 3TAGA 3PW4A 3LOUA 3CMQA 4O4GA 4CFBA 3KVGA 4OZNA 3O3FA 1B0VA 3CCES 4Y28C 4OMFG 5CD4H 1EQ0A 2V2ZA 2G8IA 4Q5VA 4KSEB 4FW1A 3LZIA 5HRNA 4F9OA 1RHRB 2GC8A 2WCXA 2IY5B 3D4JA 2XYPB 4C8KA 3UFCX 2ERRA 4LR7A 4UUXA 5L9XA 4WFAL 1NBWA 3CSKA 1W97L 4QIEA 4KI4A 4PR6A 1I94K 1RTDA 2N4CA 4IOBA 5KG7A 4K4TA 4CFDA 3DLGA 3LWMA 1KSPA 2BE7D 5TKWA 2QWPA 3Q24A 1E6YB 4E7JA 1JNRB 3VQ8A 5K8PA 1DQAA 2V7YA 3CFRA 2GAGC 4HL9A 4O4RA 3PDNA 3T19A 4JI0J 3CYMA 3OXLA 4TSXA 3AY0A 2KFZA 4ETXA 3N4QA 4QZVB 1HLWA 3UO0A 5L38A 1HD1A 5DDRC 3QBWA 3MMBB 4WTOB 1RBLA 4DDFA 3OS0A 3AVAA 1RDRA 3ZO7A 2XY7A 1BA1A 1P9QC 2H51B 3VVTA 3G6ES 5J2MB 3EEQA 3IWLA 4IH5A 2HF4A 1TUYA 3BO4A 2R8IA 4FNHA 4WPAA 3SZ2A 3RW6A 1RWOB 4QPXA 1BI4B 4R5PB 4F0KA 3OYHA 4C23A 4JD2A 2ZOMA 1KRPA 1RBUA 3NLCA 1SAZA 2XY8A 3J7A1 5FPEA 2IAJB 3JS6A 3W3DA 1NKCA 3I33A 2CG8A 1P1TA 5DM6Q 3DKDA 3EVOA 3ZZOA 3W7BA 2DR6A 1U25A 3LWLA 4DL7A 4JN4A 1E4GT 1K6YA 4NYPA 2G8WA 2ZM6J 2NSCA 1RBTA 4CWBA 2KYXA 4YNQA 1IKWB 2CAJA 2D3O1 2ZWPA 2RQCA 2MQLA 4WFBQ 4F3MA 5KFMA 4IOXA 4QJVA 1N5QA 4EYHB 2MHNA 4X62J 2KG1A 4CLFA 1S9EB 2O8CB 1VSJA 1R8AA 3QO9B 3CJAA 4B02A 3J80U 1IBLF 3NKYA 4ZN3A 1Z05A 2XQCA 7FD1A 3U6FA 4WZMA 2VBZA 1IR2A 1UW9A 6FD1A 2WB1D 4YOEA 2X1AA 1LOTB 4X4TA 4IFEA 3QIPB 2G2ZA 3FCWA 4R0EA 2X51A 4DR2J 3TWZA 3D2EB 2PFUA 2P9PA 1YRUA 1KVCA 5AQUA 1WSEA 3R6GB 4E2FB 1Q4RA 4NOHA 4IOCL 3KK2B 3MOZA 3G10A 3D66A 2XHBA 4IG0A 1X5OA 2FXUA 2EWSA 2CPFA 1HYVA 2P5OA 2B6AB 4DX6A 4LREA 2QLBB 4MIAA 4NCGB 3ASMA 4OZ2A 3AGKA 1NRKA 1VRTA 4A4JA 2AP6A 2QEXS 3C14B 4BRQA 4K0KF 3NXZA 4JOUA 3CXCM 2O01C 4DZ6A 5IV3A 4CZIA 2D4WA 4IRDA 1MLAA 1SKUB 1RTHA 4M45A 2E5HA 2GS8A 2P9IA 3H5SA 2P9SB 1B99A 3KG4A 3A0IX 3THXB 3W2VA 4ED7A 4B3MK 2CJXB 2HSEB 1S49A 1NB7A 1CBKA 1GH8A 2I5JA 1NSKL 3H59A 3OW2R 2UVUA 4FJJA 4LFBJ 2GVDA 3S41A 5ADZA 3VAJA 4DOZA 1ZH5A 1QAYA 1HX1A 1UAXA 2B43A 1ZBSA 1O13A 5A8WB 1VI7A 3MM5A 1GLAG 1N36K 2G0CA 2BEFA 2ZJRL 3R97A 4FBUA 4KB0A 1CXQA 3A8JA 4J9OA 4JV5F 2LDIA 4CLWA 4CF8A 4QS8A 3EKUA 2MZTA 4JHDB 2KT2A 2R2TA 2Q43A 4CESA 2BBEA 2POKA 5F8GA 3TVKA 1VQPS 3KLIB 4NZ6A 4WKYA 4DR5K 3NNCA 3VAMA 1BD6A 3TZWA 2KB2A 3SBTA 1WEXA 2FF6A 2D0OA 2HK2A 3KK1B 3J7AP 3CD6S 5CHCB 3HZ6A 4LF8K 4RBTA 4DU3A 3IS9B 4DTJA 1REVB 5L46A 1HW8A 5B0FA