1RT2A

Crystal structure of hiv-1 reverse transcriptase complexed with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 145
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt2A05
1UAXA 5F8JA 3OYLA 4NCGA 3ZSVA 5KFXA 1TAUA 1HNVA 1U49A 1JLGA 4LQ3A 2J6UA 1X9WA 1CZBA 1R0AA 5CZ1A 1DTTA 2WRMA 4PQUB 1QAJA 3LALA 1QSYA 2ZD1B 3AVHA 5F8MA 4O3SA 3VQ7A 3MECA 3QEWA 1B92A 1HQEA 5J2MB 4K4ZA 5KFJA 2GV9A 3VQDA 3RRHA 3NL0A 1KRPA 5J2PB 2IAJB 3PW4A 3H2LA 3MR2A 1Z26A 3H4DA 3K57A 4CF9A 4EBEA 4W5TA 4I9QA 4RU9A 3HHKA 4J9NA 1ZBFA 4C8NA 3BQ0A 1J53A 4F50A 3OS0A 4CESA 1HNVB 1JLGB 3PW2A 4Z4CA 4LY7A 5KTQA 1NJYA 1DTTB 3BDPA 2XWYA 1WSEA 3TAEA 3QINA 2XI3A 1LW2A 3L2UA 3EYZA 5F8IA 2WK4A 5HROA 4GVMA 3V9ZA 4TY9A 2UVWA 2DFHA 3OYIA 2OH2A 3LANA 5KFEA 3MECB 1SL0A 1HQEB 1RTIA 3AO3A 4ZVHA 3T5JA 2XHBA 1S49A 1NK8A 3ITHA 2HHVA 3CFRA 5EWGA 2RN2A 4O5BA 2HWHA 2CKWA 5L1KA 4F3OA 4DLEA 3SFUA 3GQCA 3F73A 2HVIA 3I5BA 4B9SA 4J2AA 3EPIA 3IN5A 3MF5A 4CEFA 4CEZA 5L1LA 4M3RA 5HROB 4M95A 5JUMA 2E6LA 2W9CA 4ID1A 4E1NA 1IKYA 4RW9B 3NFAA 1RTIB 4F4WA 3QERA 1A5WA 3KLGA 4IRCA 1N56A 1ASVA 4EEYA 5J1EA 3T5KA 5DK5A 4DSIA 4LSLA 2GC8A 3IS9A 3OYEA 4EO8A 3GV5B 3NCIA 4IRDA 2B43A 3SYZA 2G8UA 3LAMA 2YNHA 1VSMA 1UOCA 3MEEA 3CYMA 4RNFA 4ZPCA 4DU4A 3CDEA 4FLYA 4XPEA 3KLIA 2OPPA 3IRXA 3HPGA 2D0BA 2ZE2A 4WXOA 3KK3A 1TL3A 4KO0A 1W0HA 4DQRA 2W9CB 4FJNA 3BSNA 1IKYB 1CZ9A 3RB3A 4DF8A 1BIZA 3QGGA 4DQIA 1HPZB 4Y34A 3KLGB 2YKNA 5KG7A 3TR8A 4CEOA 3OS1A 4J2BA 3L8BA 1K1SA 1UWBA 2DFFA 1NJWA 3ZSOA 1TP7A 5J1EB 4LSLB 4K4WA 3SJJA 1KFDA 1S1VA 3NGYA 3IS9B 3TAFA 3OYFA 4F4KA 4KHWA 5L1IA 4FS1A 2X74A 3ZT2A 3MR6A 3MEEB 2PZSA 4B8CA 3KLFA 3KK1A 1U09A 4KB0A 2D0CA 5DLFA 1QAIA 3SV4A 2BGGA 3KLIB 4OKKA 2IM1A 3IRXB 2ZE2B 3B6PA 2YV0X 3KK3B 1TL3B 1GX5A 3NGDA 5C5JA 2G8WA 3KHGA 1VSDA 3TVKA 4CGDA 2OA8A 1NHUA 2D3ZA 3CDUA 3M9MB 1UWBB 3SQ2A 3V1RA 3NE6A 4HUGA 1NK4A 4DSEA 2I5JA 2XCPA 4E19A 2E9TA 4CHOA 4ED2A 2IDOA 1KVAA 3THVA 5KFRA 3C94A 5KG4A 4MIAA 4B3OA 2KZMA 2RDJA 3BR9A 1ZETA 3KLFB 3KK1B 3QESA 4O44A 4DTMA 4DSJA 4QWEA 1SKRA 3DRPA 4B9MA 1S6QA 3VQEA 3S9HA 1U45A 3DRRA 1S5JA 4OGEA 4ECVA 1C0MA 1JX4A 1BI4A 3AVNA 3OSNA 4CF0A 1NK6A 4Q5VA 1RCHA 4ZPBA 5KG6A 1YTAA 4FJKA 3TWHA 2FVQA 3RBEA 4HTUA 3HKWA 1F21A 2I5JB 1WSIA 1NNDA 3HVWA 1JLBA 2G8IA 5C24A 2E4LA 5KFVA 1U48A 3LPUA 4KAIA 4B3OB 4MKBA 3HJFA 2PYLA 2O5DA 4Y3CA 5KT3A 4O44B 1FKOB 3PW0A 2EHGA 1JXBA 3DRPB 2BQ3A 3DRRB 3HVAA 2YHBA 5KFBA 4K8XA 5CYMA 3OYCA 5J2NB 4FJJA 1N5YA 3P83D 1JLFA 4I2PA 1TGOA 3OHAA 1Z4UA 1ZBUA 1RNHA 3HL8A 1VSIA 2IM2A 3JSMA 1MU2B 5SWMA 4FS2A 3Q8RB 3H08A 4KSEB 1BHLA 4ED8A 3S3NA 1JLBB 3C6UA 4JV0A 5C24B 4RW4A 3DLBA 4FJHA 1HMVA 3LP1A 4RG8A 1XHXA 2GIQA 3I5CA 4ECWA 3TI0A 4CGIA 4PA1A 4M45A 4OVLA 3SQ0A 4DL7A 4KRFA 5DQIA 1OS5A 4DMNA 4IFVA 5KFIA 2HHQA 3SI8A 3TABA 4QWCA 5CYMB 4DEZA 3BSCA 2R2RA 4DS5A 1N5YB 5JXSA 3U6FA 1JLFB 3RR7A 4I2PB 3QNOA 5KFAA 3WNGA 4ECTA 2HAIA 3JSMB 2RPIA 1S97A 4Z4HA 5KFHA 3AV9A 1IH7A 4RW4B 4N41A 5KT7A 3OYNA 3LP1B 3AA2A 4EYHB 4FK2A 4NLPA 3VQCA 3DLGA 4EZ6A 3NDKA 2B5JA 4AH9A 2R8GA 1Z25A 4WFXA 3SQ4A 3BGRA 2R8IA 3N6LA 4EYIB 4FW1A 3H40A 3UIQA 2KZZA 3VQ6A 1CSJA 3H5YA 4BE0A 1W9HA 4IFVB 3FDSA 3EZUA 1NK9A 2VA2A 5KG0A 2GUIA 4CEEA 4LH4A 3L3UA 4Q45A 3V6DA 1X9SA 3CFPA 4E0DA 3T19A 5SZTA 3NBPA 1Y97A 5KG3A 3OLBA 3ALYA 4LQ9A 2XY5A 2C2RA 3I0SA 4QWBA 5D3GA 4KHRA 3DLGB 2FVRA 1TQLA 1KCFA 3QIDA 2B5JB 2XI2A 3BGRB 4JV2A 1SUQA 5K14A 2A1RA 3FSIA 4FJMA 2WOMA 1WLJA 4EBDA 2EX3A 1KLMA 1VK0A 5CZ2A 2XY7A 3L2RA 1UA0A 4CFDA 1TAQA 3O4QA 3V6DB 4XPCA 1S1TB 1X9MA 4X2BA 4KTQA 1S0OA 4IH6A 3LP3A 4ELTA 5CYQA 1HYZA 3NBPB 5EU7A 3VA3A 3LP2B 2ZKUA 4DQSA 4CJWA 3FFIB 3K5OA 4NCAA 3I0SB 4H54A 1JL1A 5D3GB 3WNHA 4FZXC 2KFNA 3CM6A 5HBMB 3ZCMA 1SUQB 5K14B 3U3YA 4C8MA 4IH7A 4CJ5A 1KVCA 1VSJA 3JYTA 4MIBA 2WOMB 3C95A 1XC9A 1ZBIA 4CE9A 2IM3A 3AVAA 3VQ8A 4O3OA 2BQRA 3RAQA 3OHBA 2HHWA 1QE1A 4HCBA 4W5QA 2XO7A 3RBDA 4O4GA 3K5LA 1NKEA 2P5OA 1QSSA 4CHPA 2Y1IA 1RBTA 4MK9A 2FBVA 5CYQB 3EZ5A 3K5NA 4K4TA 3PJWA 2B4JA 2W42A 4FK0A 3PZPA 4DTOA 3ZSXA 3OYBA 3ZT0A 1TL1A 3K59A 5HRNA 3P1GA 3MFHA 3DLRA 3V1QA 4CJEA 3JYTB 4DTPA 4OLBA 1C6VA 3GIIA 3DI6A 4LD0A 4BACA 1BCOA 3LDSA 1QE1B 4DL6A 1T3NA 5J2MA 4O4GB 3GILA 1WSFA 2F8EX 4F4YA 4HYKA 5KRTA 3G10A 3OL7A 5KFGA 3H4BA 4DQPA 4KB1A 4DQQA 4G1QA 4L8RB 4NLYA 1W25A 1EKEA 3PX0A 3SPYA 1RT2A 1WN7A 4M3TA 1TL1B 4ED6A 1NK5A 1YT3A 1D9FA 2D5RA 5J2QA 3PX6A 4K4YA 1DTQB 1RT3A 3OL9A 3DI6B 4KI6A 4M42A 3AA4A 3AO5A 4CHQA 4OGCA 3G0ZA 4YMEA 5HRRA 3UPFA 3V4IA 4R8UA 3NHGA 4RNNA 4ELUA 4MH8A 4DFMA 4CJTA 4NLXA 4G1QB 4AILC 4FLXA 4BDZA 1RT2B 1K6YA 3KHRA 2PYJA 2Z1JA 2QKBA 2G8FA 4NCBA 4NLUA 1C0UA 5J2QB 1UA1A 5DG8A 4FBUA 1GX6A 5DMRA 2ASDA 1RT3B 3DOKA 2HWIA 5KFZA 5I3UA 3V1OA 4DSKA 1CXUA 2FVSA 4TN2A 1LV5A 4KHSA 4HVJA 4CJPA 1IM4A 4RUCA 3V4IB 4RW9A 3OL6A 4O55A 4R8UB 1WSHA 1SH0A 2HB5A 3D45A 2AU0A 3PW5A 3CJ5A 1TK8A 3SZ2A 3L2QA 2IS3A 4N47A 4KPYA 3TAGA 4CJ4A 3TAQA 4O3PA 5FRMA 3M9NB 1C0UB 4Q0BB 5DG9A 4ZPAA 4DL3A 1TKDA 4CK3A 4IDKA 3NH2A 4IG0A 4CIEA 1YVFA 3Q8QB 3BQ2A 2ZQBA 1U04A 4K4SA 1REVA 3DOKB 1WAFA 2VG5A 5I3UB 5KFCA 3QLHA 3KHLA 5KFFA 1IG9A 2Z1GA 4BWJA 3DOLA 4GC7A 4CHZA 4CIGA 1NJXA 1KLNA 2FBTA 3AVJA 4Q8FA 3VN5A 1HPZA 4ED3A 4YR0A 3KKSA 4FLTA 3CIZA 1D5AA 3ZSWA 2Z1IA 3HO1A 4WYWA 1RYSA 1RT5A 4CEBA 3RRGA 3I5AA 1Q9YA 3NGIA 1X1PA 4E1MA 1XR5A 3NF9A 2V4RA 4IDKB 2ETJA 4IG0B 1QQCA 4E7LA 2Y1JA 4K4XA 4FYDA 3AA3A 1REVB 2JEFA 2VG5B 3MFIA 3D0PA 3A2FA 3QLHB 2DFEA 5KT5A 1TKZA 4GMJB 4KBIA 4FM1A 3IG1B 3DOLB 3CG7A 4ECQA 5HLFA 1C2PA 4TQSA 2IGIA 4FLZA 2OYQA 5JS2A 5EWEA 3BQ1A 3VA0A 4M3XA 4KHYA 2C2DA 2HHXA 1JLQA 4J9RA 1HJRA 1EETA 5F9LA 1RBRA 4CEDA 2O4GA 2WTFA 1RT5B 1S9GA 1ASWA 3LPTA 4FJXA 3QYYA 4QCLA 5KGWA 2BANA 4MKAA 1C1BA 2VA3A 1C1AA 2G8VA 3LZJA 4JLHA 1XHZA 2BDPA 4O4RA 4N5SA 4Y2AA 4HUEA 1TKZB 2C28A 3AVMA 2W8KA 4ED0A 5KI6A 3VQAA 1ASUA 2QKKA 3SUPA 2X6SA 2FJXA 4ZMMA 5HLFB 2JC1A 4YFUA 4OPJA 4EZ9A 4IKAA 5DLGA 3L2WA 3DMJA 4FLUA 1JLQB 4ZVGA 3ZSZA 1EETB 4J9SA 2ILYA 3ASMA 4KI4A 1WAJA 1S9GB 4K4UA 2BANB 2VWKA 1C1BB 4NRTA 2FJVA 3DLHA 2IJNA 4J9MA 2F96A 3LZIA 1FKOA 4KREA 4WE1A 2ATLA 2W9BA 4EP4A 2LSNA 2JEGA 2IOCA 1RTJA 1LWFA 4J9PA 4F2RA 4DS4A 3AVGA 4JRPA 1SKSA 2JEJA 5L1JA 4AHCA 5J2NA 3PX4A 3DMJB 4ECSA 1ITGA 4RW6B 4KB7A 4Q8EA 1MU2A 2GBZA 1VRUA 4CEQA 4WFYA 1B9DA 4K50A 1NKBA 4FVMA 2E9RX 3KLVA 4KTZA 4WE1B 1BGXT 4DTSA 4IQXA 2W9BB 3LP0A 4Y1DA 3HK2A 3AVLA 3BSOA 1D9DA 3CWJA 1RILA 1XR6A 1RTJB 3MEGA 1LWFB 3OYAA 1GOAA 3TARA 3ZSRA 1HARA 2XY6A 1LW0A 5T7BA 2AQ4A 3VQ9A 2ATQA 2FBXA 3D5MA 2BQUA 5F8GA 3VQQA 5KFSA 1VRUB 4CJFA 4E7JA 1LAWA 4M3YA 2HW3A 3G6XA 5KFPA 4B8AB 4ICLA 4QW8A 1G15A 3DLEB 5FRNA 3ZSYA 3LP0B 2HMIA 1A5VA 4ECUA 3DYAA 1KTQA 2VG6A 3MEGB 2G8HA 4LH5A 4BE1A 4YP3A 1LW0B 1QS4A 4CIFA 2YKMA 5EWFA 2ILZA 3VQ5A 1L3SA 1WSJA 3NF8A 1SH2A 5I42A 4DTJA 1S10A 3RMDA 3AVFA 2FC0A 1BIUA 4DFKA 4B9NA 1U4BA 3V6KA 3PVXA 3EPGA 3OVNA 1TVRA 2D7SA 4JUZA 4E89A 4ICLB 3BSAA 1LWCA 3GV8B 3TANA 1MMLA 3KIOA 1KVBA 3SUQA 2HMIB 3DYAB 5DGBA 3SCXA 4J9QA 4M3UA 4TLRA 1TKTA 4FJ5A 2VG6B 3Q8SB 3RTVA 1XI1A 3NH0A 5KRSA 2AX1A 1DLOA 3WNFA 2YKMB 3G6YA 4WYLA 3D28A 3AVCA 2R2SA 5JS1A 2JGUA 5I42B 1FKPA 2Q3SA 4FXDA 1S1TA 2HNDA 2UVRA 4NLOA 4CFCA 5F8LA 2AX0A 3FRZA 2OPSA 5F9NA 3KNAA 4CGJA 3LP2A 1TVRB 3DRSA 3FFIA 3SPZA 2AGPA 4BE2A 2KQ2A 4DTXA 1LWCB 1QSLA 3TAPA 1WNSA 4FJGA 4DSFA 5HBMA 3SNNA 2KFZA 4CHNA 4XIUA 4CJRA 1YVUA 1TKTB 3OYMA 1ZYQA 1D0EA 2FBYA 2UUWA 3NF7A 3NAIA 4Z4IA 2HHTA 3V9SA 4IOBA 2W7PA 5F8HA 1DLOB 5KG1A 2BRLA 1JL2A 4IKFA 3RB4A 4MFBA 4E7IA 1IKXB 3GIMA 1FKPB 2OPQA 3E51A 4FJIA 2HNDB 2PY5A 4ED1A 1SV5A 4NLSA 4PY5A 4K4VA 3RMAA 4NYFA 2OPSB 4WFZA 2W9AA 2P5GA 3DRSB 1VSKA 3CJ0A 4DTRA 3H5UA 3SI6A 2XCAA 3IAYA 2XGPA 3KHHA 3ZT3A 3KLHA 3RR8A 1RTDA 4QW9A 4Q44A 1NOZA 1BQMA 4ZP9A 4RUAA 1S0MA 4IR9A 1N6QA 3RB6A 4J2DA 5KFLA 4OJRA 1S1XA 3NH1A 3MEDA 1RDAA 4MFBB 2OPQB 3GIJA 1NJZA 4MK7A 1SV5B 4URQU 4RZRA 4OLAA 4NYZA 3OYGA 3KMSA 2RDIA 3AO1A 3CDWA 1TKXB 3QIOA 3T1AA 4RNMA 2P1JA 2RF2A 3DDKA 4W5NA 3V9WA 1KHWA 3L2VA 4WXWA 1JKHB 1HYSA 3O3HA 1JLCB 1EP4A 3KLHB 4IR1A 3H98A 1DTQA 5F8NA 4ECXA 4TYAA 1RTDB 3QO9A 5DGAA 3V9UA 1BQMB 2IMWP 4PUOA 1KHVA 1N6QB 4DFPA 3N6NA 4DLGA 4C8LA 1LAVA 4XO0A 1S1XB 3MEDB 3HXMA 4NLDA 3AO2A 5DG7A 3K5MA 4F2SA 5KT6A 5KFYA 4RNOA 4W5OA 3NMAA 3UR0A 1NOYA 1BL3A 1SL2A 2RF2B 1QTMA 3QNNA 3PUFA 1T8EA 4RW8A 4N56A 1HYSB 3O4NA 4FM0A 5L9XA 1EP4B 4OKEA 4TSXA 5HRPA 3CVKA 3QGIA 3T5LA 3OYJA 2XGQA 4IH5A 3OL8A 4CECA 3QO9B 2HVHA 4DTNA 3NKYA 1Q8IA 4PUOB 3V6JA 4CJQA 3PO5A 3UQSA 1EX4A 4I7FA 1RDDA 4ZPDA 1L5UA 4QWDA 4B9TA 4C8KA 4O3QA 4CFBA 3QIPA 3N6MA 1J54A 5KFKA 3WNEA 4DU3A 2BR0A 1HQUA 2C2EA 1TV6A 1K1QA 1XR7A 4I2QA 2DPJA 4E7KA 2NUBA 4Z4FA 2WB4A 4YR3A 2ITGA 4DL4A 2BE2B 4RW8B 1T05B 1ZBLA 4Q0BA 4DWIA 4HCCA 2R8KA 4OKJA 3KK2A 1SH3A 2OZMA 3V6HA 4I7FB 2HNYA 4H4MA 2W7OA 1T94A 1ZTTA 4Y2CA 3QEXA 3ZSQA 4CJ3A 3QIPB 4NCGB 4C8OA 4O0IA 3PV8A 1SL1A 2VWJA 1HQUB 2OPRA 1TV6B 5KG5A 1R0AB 4FZYA 3SFGA 2HHUA 3QEPA 4I2QB 3LWMA 4NYNA 3FQLA 2V9WA 5KFOA 3CQ8A 1BQNA 3GIKA 4EO6A 3EY1A 4DL5A 4WZQA 3KMQA 4EBCA 1FK9A 4YQWA 4KHUA 4QOZB 4F3TA 1VSHA 5KGXA 3K58A 3NAHA 4Z4GA 4AHSA 4CJVA 2CJQA 3KK2B 1ZBHA 1JLEA 4ZVFA 1HYVA 3BREA 3IG1A 4IG3A 4FBTA 2HNYB 4H4MB 2Z1HA 1JXLA 3NGZA 4CK2A 3PY8A 4FJ8A 2J6TA 3ZT4A 2JEIA 5FROA 1VRTA 2RKIA 2YNGA 2OPRB 4CF2A 3QGHA 2D41A 1J9AA 3PR5B 3AVIA 5E41A 3PHEA 3QETA 3QEVA 1LW2B 3F9KA 4FLVA 1TK5A 3CJ3A 1NKCA 1BQNB 4K8ZA 3H5XA 1S9FA 5KFWA 4ECRA 1FK9B 2I1RA 1FXXA 4HUFA 1WSGA 2G8KA 4JS5A 1KFSA 3ITHB 3PR4A 2P51A 3MAQA 3MXJA 1JLEB 4R5PA 3CJ4A 3OY9A 4ZHRA 1SKWA 4IG3B 1TK0A 5C42A 5C25A 3L3VA 3PJXA 4ZVEA 3O3GA 4FJ7A 4ZTFA 1VRTB 2RKIB 2YNGB 4O3NA 4B08A 4OL8A 4YR2A 5DQGA 3NAEA 1RDBA 3S3MA 4KV8A 5KT2A 3RB0A 4M3WA 4KHQA 2HNZA 3B6OA 1JXEA 3KD5E 3ISNC 4CEAA 4E7HA 3V9XA 1T03A 3HSTB 1S48A 4CGHA 1BISA 5DQHA 2QK9A 1RA6A 4NLRA 4M3ZA 4R5PB 3ICLA 4NLVA 3LAKA 2YNHB 4ZHRB 4FCYA 1RT6A 5C42B 1VSEA 2WONA 4N76A 5C25B 2V0NA 4BWMA 4B9UA 4UQGA 4RW6A 3AO4A 2UUTA 3MXMA 4NLTA 3LWLA 4E3SA 2OPPB 4CF1A 1QHTA 3KJVA 1S1WA 4KO0B 3GV7B 4KV8B 2FLNA 3T3FA 2E6MA 2HNZB 4IRKA 4KHNA 3DM2A 2IC3A 2FJWA 4W5RA 2YNFA 2YKNB 4J9KA 3M8RA 1T03B 3TAMA 3PO4A 2EC0A 1EXQA 1S1VB 2KTQA 3HVTA 2UVVA 3SUNA 3I0RA 4AHUA 5KFUA 1RT6B 3QZ7A 2WONB 4JS4A 1NK0A 2FVCA 1S6PA 4F4XA 1QUVA 4DU1A 2YNIA 3GYNA 4URGA 4CFAA 4DF4A 1YTUA 2UVUA 3KJVB 2AJQA 1S1WB 1D8YA 4F8RA 4ELVA 2JC0A 1L3TA 4BDYA 4KKOA 1RDCA 4NLQA 2HHSA 3DM2B 2IC3B 4LSNA 3DLKA 2YNFB 2X78A 5KFTA 2JLEA 3TAMB 3DLEA 4QWAA 1I39A 1ZTWA 3M8PA 1N4LA 3CFOA 2GIRA 3HVTB 4QPXA 3I0RB 4OPKA 4R0EA 4KE5A 3OSPA 3OYHA 3NF6A 3OS2A 3HPOA 5EDWA 1I6JA 3K2PA 1CXQA 4J9OA 2WHOA 1S6PB 3C6TA 1S1UA 4FZZA 2YNIB 5KT4A 4FLWA 2ALZA 1CLQA 1S6QB 5KFDA 4Z0UA 1NHVA 4EP5A 1S9EA 4KKOB 2F8TA 3M8SA 4LSNB 4NRUA 3DLKB 4MK8A 1BI4B 1VSFA 3CM5A 4ZP6A 2IBKA 4FW2A 3OLAA 3AVBA 1U47A 3RAXA 3M8PB 2XRIA 3KOAA 4DFJA 4O0JA 4MQ3A 1B9FA 4TQRA 1RT4A 2DPIA 3MR5A 4FK4A 4Q43A 4DTUA 2AWZA 2C22A 3C6TB 1NK7A 1S1UB 5CY4A 2R8HA 3AVKA 1N48A 1HRHA 3RMBA 5T14A 4ZP7A 3OJSA 3ISND 4CJSA 4KHMA 2D0AA 2IM0A 4CJUA 1S9EB 3E01A 4CF8A 1JLAA 4U7CA 3H5SA 3QZ8A 1HNIA 4KTWA 3VQ4A 4Y1CA 3BJYA 3U3GA 3C6UB 4TXSA 3QEIA 4RW7A 5HRSA 1BCMA 2VG7A 3H59A 1RT4B 1HMVB 1L3VA 4URSA 3O3FA 4JV1A 2J6SA 4CJLA 4DL2A 1IKXA 4IFYA 3OJUA 1IKWA 1C1CA 1O1WA 2R8JA 2WCXA 4B9VA 3KTQA 2DY4A 3E01B 1JLAB 1LWEA 2FLLA 3HP6A 3MXIA 3OYDA 2D3UA 1HNIB 1WNEA 3VQPA 2W8LA 3AA5X 3IGVA 3CJ2A 4AHTA 2IJFA 4CERA 1RDRA 4TY8A 2A1SA 3SV3A 1C0TA 4RW7B 2VG7B 4WZMA 2KW4A 2B6AA 3KLEA 3MTKA 4PWDA 1T7PA 3HT3A 1RYRA 5KFQA 4J9LA 3G6VA 3OYKA 4CJKA 4KFBA 2R2UA 1D1UA 4NLWA 4HKQA 4IFYB 3ULDA 1IKWB 3IGNA 1C1CB 1RBSA 2AGQA 1RT1A 1JIHA 4NZ0A 3HYFA 4M41A 4YNQA 4FJ9A 1TKXA 4DG1A 4G3IA 3TQ1A 1LWEB 1RT7A 1Q9XA 1JKHA 4M94A 2V4QA 1JLCA 1RA7A 2QE5A 3HP9A 4TY8B 2ASLA 1C0TB 1KSPA 4FJLA 1IO2A 3SUOA 3T5HA 5EUHA 4ZP8A 3I8DA 1J5OA 2B6AB 3V81A 3KLEB 4PWDB 2DTUA 4TYBA 3KKRA 1S4FA 4KFBB 2YHAA 4JRQA 4H4OA 4CGGA 1GOCA 2ASJA 1RT1B 3P5JA 2AGOA 3VQSA 4FM2A 2XY8A 3ZT1A 3G86A 2XC9A 1RTHA 5FDLA 4DG1B 3PW7A 1KLMB 3RWUA 4CK1A 1RT7B 2FLPA 2IA6A 2QXFA 3M9OB 4HHTA 2F8SA 4I9LA 1VSLA 4O3RA 5HP1A 2O4IA 4DSLA 2OZSA 4J2EA 2FVPA 4AHRA 3KD1E 4ECYA 4CGFA 3S3OA 3M8QA 3UDLA 4RNHA 2QV6A 2E9ZA 4ZTJA 5KFNA 1J5OB 5KFMA 5KG2A 3V81B 1IKVA 4NLGA 4CHYA 4ED7A 3SQ1A 4ID5A 4U6PA 4H4OB 3HM9A 2BRKA 1GOBA 3HVRA 3RMCA 4PQUA 4B9LA 1RTHB 5FDLB 1XWLA 4F4ZA 2ZD1A 2R7YA 1RAJA 4H8KA 4KAZA 3HPHA 4GC6A 1I3AA 2R2TA 2BE2A 5HP1B 1RBUA 1T05A 3MR3A 4CCHA 4AHVA 5J2PA 2IAJA 3CO9A 3FQKA 4ECZA 2X6NA 1L3UA 4GW6A 3M8QB 1A5XA 3VQBA 1S0NA 4BDPA 4IBNA 1IKVB 1RBVA 4Z4EA 4ID5B 3Q8PB 4QAGA
chains in the Genus database with same CATH superfamily
3VAKA 1UAXA 1PILA 4NCGA 2E44A 1U49A 4B3SJ 4LQ3A 3R3LA 4PQUB 3MM7B 1QAJA 3RSEB 1XMOK 5JLHA 5F8MA 1H72C 2HWTA 4RWTA 3MECA 1HQEA 2G1HA 3TUZC 4FDFA 3FRYA 3VQDA 3RRHA 3NS7B 4LF7F 4YUDA 2ZHOA 2P9SB 1BE4A 2JFDA 4HACB 1ZBFA 2VQFF 4F50A 1KP6A 1TL7B 3MOZA 1YJRA 2LA4A 1JLGB 4TVAB 5LSRA 5D4NA 2XWYA 3TAEA 3CQXA 2OKQA 3EYZA 4F7VA 1WOSA 4FP9A 2DFHA 2OH2A 3S01A 5KFEA 2ZBPA 4WU2A 1RTIA 1IR0A 3H90A 3GG4A 5JMVA 1RAOA 4IEEA 2Q1LA 1K8AO 2HQDA 3G6ES 2HHVA 1Y0HA 2FDNA 3VAJA 5EWGA 3CIPA 4O5BA 3FK4A 5F3ZA 1PKUA 2V5HG 4WKYA 3GQCA 5BN9A 2HVIA 4B9SA 1YJTA 3BV8A 3VGKA 1S79A 2GGPB 4J2AA 2DRBA 3EPIA 2DK2A 2ACYA 2V9KA 3LW5C 1RISA 4ZPWR 1PAUB 4BRPA 3KWGA 4CEZA 2J9EA 5HROB 3ZZTA 4ID1A 4P9SA 1RCXB 2P9IB 1NSPA 3E3XA 4F4WA 3DN9A 2AJ1A 4DDFA 3R9LA 4Y2KA 4EEYA 4JHDA 2FB0A 2C3YA 3H1VX 2VIHA 2KG1A 3GV5B 3NCIA 2HLTA 4IRDA 3SYZA 3Q23A 3MEEA 3BPSP 5L8RC 1SJRA 1TTHB 3GFZA 4BR0A 3CIMA 4MT1A 2XS5A 4PWWA 1WSRA 2D74B 3HPGA 2FZGB 2D0BA 1YQHA 4FJNA 5CABA 2DYAA 1IKYB 2NXEA 4X64F 4DV7J 2HBQB 1TYQB 1BLUA 1BIZA 4FWOA 1VIOA 5JICA 4LJMA 3KLGB 2YKNA 4J2BA 1JJHA 3L8BA 1Q4RA 2HQCA 1JCEA 3I4HX 2XG8A 5D77A 4LSLB 4K4WA 5AQLA 3NGYA 2VICA 3OYFA 1VQ5S 2ZWOA 4M5DB 5L1IA 4FS1A 4IZ9A 3ZT2A 4FWSA 4DUZK 2F9TA 1C0GA 2KHOA 1OY6A 2KJWA 3MMCB 3IRXB 2ZE2B 2ZJPL 1TL3B 3DGVA 1AUDA 1OYDA 2E5HA 3SK3A 5A6PA 3PJ9A 1VSDA 1GT8A 2OA8A 2D3ZA 1VQ7S 5HQMA 3D2EA 3VOVA 2V69A 2NREA 4Z94A 4WU3A 3EO3A 3NE6A 4DSEA 4HUGA 2QWOA 4OZLA 3OBIA 3GLJA 2IDOA 3GSDA 1BA1A 5KG4A 4MIAA 3CCQS 4B3OA 2KZMA 3BR9A 2KRRA 3TR5A 4DV2J 4CD1A 4Z7YA 3JQMA 4QZVB 4DSJA 3AGKA 5FPEA 1SKRA 1WI6A 1UEKA 4KJIA 1U45A 5D4PA 3VQEA 2IVNA 1S5JA 4OGEA 1J5EJ 3POTB 2C42A 2V68A 1BI4A 3AVNA 1GMWA 3I6PA 1JQGA 3KKFA 4ZPBA 3M2RB 3AAWB 2FVQA 3IKMA 2HGLA 5C24A 2E4LA 2C2NA 2WVFA 1X31C 1VHIA 5KT3A 4O44B 1FKOB 3NNAA 3VGVA 4LBIA 3AD7C 4PABA 2XMWA 3DRPB 4FWNA 3WUHA 3DRRB 2IFXA 2OTLS 2M88A 1DQ9A 5KFBA 1BD6A 3LTOA 3UN3A 4JI7F 1U8SA 2XS2A 1RNHA 2GHPA 3HL8A 5DS7A 3JSMA 1VQKN 3Q8RB 3H08A 4JV5K 4K0KF 3QJPA 2KT5A 5GINA 3BBCA 2FYXA 2GIQA 4MDAA 4AXJA 3OTOJ 3TI0A 1YSJA 3S8SA 1RJJA 4QR2A 3EUNA 2HGNA 4UQTA 2WB1D 4OVLA 3G4SS 4DL7A 4KRFA 4DCHA 4OQJA 4OX6A 2HHQA 1BMQB 1KAXA 1IBKK 5CYMB 3HULA 4GVEA 3QNOA 4ECTA 2E5LK 1HBNA 2DY1A 5RUBA 4EUVA 2CG4A 2V2KA 5KFHA 3EL2A 2H1YA 3D0IE 4PHTX 4FYYB 3SSSA 3J80O 3CGIA 3AODA 4AH9A 3AFGA 3SCJE 3T6BA 2R8IA 3N6LA 4CH0S 3EE9A 3UIQA 1GXTA 3IR5B 5AQWA 3H5YA 4BE0A 3ENQA 1W9HA 3FDSA 2Z2YB 5KG0A 4CEEA 1OWXA 2B56A 2RIJA 3RW6A 4OYXA 2DNNA 2KXHA 3G9CA 1WWHA 4V19J 3UD4P 3P39A 1W26A 1X9SA 2GA7A 4XAKA 4ZVRB 4ALZA 3T19A 1JMTA 4GY2B 1V4TA 1F9FA 1IBLF 2RSQA 2KLAA 3G87A 5D3GA 4KHRA 2LA6A 2XI2A 5M2UA 4USKA 3MDFA 4MKVA 1WLJA 1F5BA 3WEEB 1YWXA 1J6ZA 1B0TA 1SQEA 5CZ2A 2XY7A 3WDOA 4L3NA 1SAZA 2V4JB 4J90A 4WCEQ 3MAHA 2PDAA 3GFXA 2IVYA 4KTQA 1S0OA 5KQ8A 3NBPB 5AQGA 1HNXJ 3W63A 2ALYB 1T9WA 3WXJA 2APOA 3VTHA 3VGMA 2KFNA 2YQ1A 3VEZA 3B4MA 3GL1A 1SUQB 2CAJA 3ZCMA 5H1SV 1JNZB 3SBTA 4YOYA 4MIBA 3ZZOA 1J27A 3TZYA 3IA0A 1RU2A 2IM3A 3TA0A 1G1XA 5K8MA 1QZ5A 2HRTA 2OCEA 1NMEB 4HCBA 1W2BR 1YJVA 2G1DA 2C2MB 4PKHA 2ZH6A 4GO7X 3CTRA 3ADAC 1B4SA 2H4YB 2R7SA 1NKEA 2P5OA 4DXLA 1QSSA 3OFFA 4CHPA 1NB2A 4FVUA 4H0VB 2FBVA 5CYQB 4HEA9 2JZ5A 3EZ5A 3K5NA 1ZS6A 3K8WA 3PJWA 1VRQC 2LLZA 3AH6A 2EWSA 3OYBA 1UPPA 5HRNA 1RSCA 4NEYA 4CJEA 2RVJA 4DTPA 1FDAA 3H2VE 4CI0B 3IWXA 1BCOA 5A76A 1EB0A 2KU7A 4ZLLA 3N28A 5J2MA 4RO0A 1SC3B 1WSFA 1RKJA 3OL7A 2NSCA 4KB1A 3MX5A 4G1QA 4XTTA 4L8RB 2LDIA 3TTFA 3PX0A 1WN7A 3TTDA 4M3TA 1FRLA 5CQGA 4UT4A 4ED6A 1NK5A 2UXDF 1D9FA 1UFWA 1OSDA 2CIMA 2YX6A 5E3CA 4JI6K 3J7ZO 3DI6B 1Q86T 2J7UA 4HTJA 1TFWA 4ZJLA 4DR3J 4QYZJ 3IWNC 4YMEA 5HRRA 3JS9A 2P9LA 1FWLA 4R8UA 4YHHJ 1N33F 3KG1A 4DFMA 4JI4J 1RAGB 2OJ3A 4RKUC 3IXQA 4FKYA 5HK4A 1Y5LB 1RT2B 4LRDA 4EHUA 1SJ4P 4NLCA 1R0CB 4IWVA 2QKBA 2G8FA 2CH5A 3NVKA 4NCBA 3CC7N 4JI1K 4NLUA 3Q8YA 5J2QB 2CDQA 2ASDA 1RT3B 1EQYA 1XJWB 2ZOMA 3R5DA 4DSKA 2FVSA 3OR1A 3CCMS 1SH0A 3D45A 1WDDA 3N01A 3THYB 2AU0A 2PIIA 2AD9A 3TQEA 1R7IA 5LL6Z 2FIUA 4PKGA 5AZIB 2A40A 3M9NB 1UJ6A 3NH2A 1YVFA 1C4AA 5LJ5Y 3BQ2A 2ZQBA 1U04A 4K4SA 2M2BA 4ID8A 3KDNA 5I3UB 4OZ3A 5KFFA 1M90T 2Z1GA 3CCVN 4BWJA 4CI6A 2IJRA 3DOLA 4GC7A 2VJVA 2OAUA 4LREA 3AVJA 2LEBA 4Q8FA 2DKOB 2ZH4A 5GADI 4A2BA 1HPZA 4ED3A 4YR0A 3CIZA 1D5AA 3ZSWA 1HI8A 4L73A 1EQMA 4WYWA 1Q78A 1RT5A 3O9RA 3I5AA 4LRCA 3NGIA 3QBWA 1KOHA 1XR5A 4FNHA 2NLWA 3NF9A 2V4RA 4IDKB 4ZLJA 4CO1A 4XEIA 4IOAL 2Y1JA 4K4XA 4BCAA 3AA3A 3MFIA 4FPBA 4N7TA 3B78A 3M8WA 5GAGI 3MN6A 2GQQA 4ECQA 5HLFA 3SAFA 4CO0A 2OYQA 5JS2A 3ISZA 2DT9A 2F63A 3UVJA 4KHYA 2XM3A 1JLQA 1KN6A 4J9RA 1MWKA 1EETA 4V19X 1CJKB 2Q66A 3UE2A 3LPTA 2GVDA 4FJXA 3W2VA 5KGWA 3UKRA 4LFBJ 1ZBTA 4FPIA 2VA3A 3HOTA 3VF2A 2G8VA 2UXBJ 1H0HB 2G0JA 2QWNA 4OHZA 4Y2AA 4QIFA 1TKZB 4C11B 5KI6A 3OR2B 4MKYA 2QKKA 2B9EA 1HBMB 3LGHA 4NXMK 4YFUA 3ZNUA 4EZ9A 2V7ZA 3ZSZA 1H74A 1NGAA 3ASMA 3M8YA 3DU5A 4K4UA 2EVZA 2BANB 3BGOP 3GJTB 4H5RA 1PJ5A 4CZCA 3TRGA 2IJNA 1TMMA 1X5PA 2F96A 2Q2RA 2RQMA 4A8QA 1P90A 2GCFA 4ANCA 1H6KX 2F9DA 4UTGA 4LFCJ 1K44A 4A5BA 4CO4A 4DQ8A 2JEJA 2ZZMA 1P6TA 2OI2A 3VGSA 1F5AA 1VQ6S 2R9LA 1XMBA 2GJ2A 1MA9B 1R31A 5AE2A 2RQCA 4P52A 3J81U 3J8AA 4R79A 1YJNS 4F25A 1T9VA 1NHKL 2UV8A 5BXIA 4KTZA 1ACMB 2W9BB 2CGJA 3HK2A 3C15B 1NPKA 1HI1A 4EAHD 1XR6A 1RTJB 3MEGA 1LWFB 3TARA 1HUXA 6AT1B 3W0LA 2XY6A 3GCWP 2QL7B 2V8HA 2OHDA 3OXFA 2CNKB 4USVA 1QAXA 3B8HA 3T41A 2BQUA 4ZDNA 5F8GA 3VAIA 5M1QA 1X4CA 1SJ1A 2HW3A 3PRVA 1LAWA 5FPMA 1DARA 3T1HF 1YVNA 2KL8A 3MCNA 1Q81T 4L3QA 2DH7A 4HDHA 2UUAK 2HRYA 3GR1A 3L9ZA 4I6MA 2UUCK 1VQSA 3ZSYA 1A5VA 4ECUA 1CQMA 5B0EA 1KTQA 4NXNF 3W8PA 2G8HA 4LH5A 2W2QP 4DV1J 5LMNJ 1QS4A 2CGLA 1NBEB 3IBCB 5C15A 1EHWA 4CZIA 5I42A 3CSKA 2WFBA 2FF3B 3MPVA 2ZH5A 4KH5A 1CULA 1WC5A 4B1ZA 1EJ7L 3V6KA 3R3TA 5B0FA 1A6LA 2GQ2A 4KR0B 4E89A 3SAHA 5CD4A 1MMLA 5AZJA 1KVBA 3SUQA 1S59A 3SCXA 2Q6BA 2CPEA 3J81O 4M3UA 3D1HA 2VG6B 1V3ZA 1NGIA 3CCUN 3BZKA 2AX1A 4PG7A 3M8ZA 3OPKA 1DLOA 3CCRN 3D28A 4IEIA 3AVCA 4HTLA 1KVKA 3T69A 1FRXA 1FKPA 2Q3SA 2DIUA 4WJBA 4CFCA 4RX6A 3AGRA 5BYQA 2V52B 3DRSA 3FFIA 3S7RA 3VGTA 3ENOA 1XNRK 2ZZTA 3DDIA 2FJBB 4Q2LA 4DSFA 4XIUA 5A8RB 1AYEA 1TKTB 5GMEA 1ZYQA 3NF7A 1UETA 3FCVA 3V9SA 5IWAK 4WIQA 2NUUG 2H5IB 3CCJN 1JL2A 4CH7A 3KHYA 4MFBA 4E7IA 1IKXB 4JI0J 2B7CB 2KXFA 3NP5A 2HNDB 4NLSA 3N4PA 5DDOC 2MKHA 2MQLA 2CWXA 2OPSB 2P9PB 2W9AA 4K43A 1U1PA 1VSKA 1RKIA 3K8VA 3SI6A 1SCJB 1PBUA 5A2QO 3KJNB 3H3NO 4BS2A 4I6WA 1V5VA 4ZP9A 1HR0K 1S0MA 3GE1A 1ICEB 5BR9A 4IR9A 4IDHA 4DPOA 4WFNL 2K2PA 4ZVTB 3NH1A 1V6HA 4MLEA 4BR2A 3GIJA 3KDOA 1NJZA 4URQU 4RZRA 4N8NA 4NYZA 3I87A 3KMSA 1IQZA 2RDIA 3AO1A 3QIOA 2JLFA 2PEHA 1BU6O 1SIZA 2PN6A 3SQOP 3L2VA 5E3PA 2KI2A 1EP4A 3O3LA 3GSIA 1DTQA 1DJ0A 1RTDB 4K5RA 3QDKA 3V9UA 4YB5A 4ZA1A 1R89A 4ITSA 1Q8BA 3GCXP 4C8LA 4M5MA 1CZAN 3EMTA 2BJ1A 4F2SA 1E6YB 2D4WA 1W7WA 5K9FA 3BO2A 2EFQA 3BF3A 1BL3A 1SL2A 2RF2B 1UL3A 1QTMA 3VALA 2IVOA 2B9YA 2ASYA 1HYSB 4UW2A 4Y6IA 2ASOA 4FM0A 1Q7YO 5L9XA 5IT4A 3QGPA 1KC8T 4OKEA 2B4OA 3OYJA 2XGQA 1NU0A 4G1PA 3KJQB 3QAEA 4DV6K 2V8PA 4LF4K 2O8FA 2A6AA 4I7FA 5AXLA 2ZHAA 4B3RK 4BVOA 1ZA2B 4OI3A 5A0YB 5HJYA 4F0MA 2VOOA 2C2EA 1TV6A 3W9IA 1BWEA 2H5JB 3JS6A 3JTOA 5D4LA 4YR3A 1WG1A 2HQIA 4X62F 4JKCA 4YN3B 2MQNA 3G96A 4HCCA 2PFFB 2QGFB 4X66K 4BRGA 3NGUA 2GQCA 1Y4ZB 1W2IA 2OZMA 3V6HA 5AQFA 2HNYA 4X4QA 3QEXA 2W2OP 3GP9A 4CJ3A 3QIPB 4C8OA 3BGLA 4O0IA 3PV8A 3MI7X 2ADCA 4H5NA 4GVBB 1HQUB 4FZYA 2ZWHA 2MQOA 3SFGA 1WELA 2HHUA 3LWMA 1FT8A 2V9WA 3CQ8A 1U8WA 1BQNA 3R6LB 4EO6A 1IUJA 4NL5A 4EBCA 2DCLA 2RUSA 2ZJRL 1NRKA 5AQRA 1IN0A 4F3TA 5K8OA 2ZM6J 5I3QA 4CJVA 1JLEA 2DGSA 4A61A 3BREA 3EJMA 5JVHQ 4QJVA 1AZSA 4I1TA 4IG3A 4FBTA 2MLYA 4X4NA 3ENVA 3NGZA 2J6TA 2B9XA 2YNGA 5ADXH 1Z6RA 3QGHA 3CCZA 3CCLS 4CLYA 2HMPA 1ZOTA 3F9KA 2ZH9A 3H5XA 4KRWA 2YPYA 5D15A 2VFRA 1FK9B 3JXOA 3QATA 1H2UX 2MJNA 2YJEA 3MM9B 5IT9U 1KFSA 2FLOA 1KXPA 3PR4A 2HHPA 2P51A 3MAQA 3TWZA 5IM0B 1UVNA 3R7BB 4R5PA 3CJ4A 2ZH8A 3OY9A 3MPDA 3QBCA 1PBAA 1SKWA 4DR6K 3J7ZT 1TK0A 1K8KB 5C25A 3DRXA 3PJXA 3O3GA 5F2RA 2V67A 3CCSN 4U67L 2RKIB 1WOPA 5BJRA 4B08A 3FCWA 1MN7A 4YS2A 3NAEA 3THWA 1YITN 1SXLA 4FYVB 3RB0A 4G65A 4M3WA 4KHQA 1JXEA 3V5RA 2E5GA 2PE8A 3W9HA 3ISNC 2G0IA 2ROEA 4CEAA 1VLYA 4E7HA 4WFBQ 1A7GE 1S48A 3WXIA 1R3NA 4MO4A 2CPHA 3IR7B 3CHWA 2D0OA 1HBUB 4X4PA 3MPWA 2UXCK 3MEKA 3EXYA 1RT6A 3EGVA 2WONA 4N76A 1HWIA 1RK8A 5LJVA 1SJQA 4QIEA 4BWMA 4OJHA 3ZXWA 4CLKA 2IRUA 4UQGA 3AO4A 1X60A 4LBPA 1YJ9S 3HI0A 1U1NA 1CJVB 1S1WA 4U8YA 2E6MA 4ES2A 3WHIA 3AARA 4KHNA 3DM2A 2IC3A 2FJWA 2FJAB 5FD1A 5LL6d 4X65J 1LFPA 2P8IA 2DNMA 2HQGA 3NNCA 4WFAQ 5BRFA 4ZCLA 4ZVOB 1S1VB 4LF6J 3LDPA 2KTQA 3SUNA 3I0RA 4M5HA 4A8KA 3BS9A 3BY5A 2BVZA 3UKUB 4OJ1A 2QO3A 2JJ4D 4F4XA 4AL7A 4A62A 5AQSA 2NRTA 4B3MF 2P9CA 4AE5A 3KJVB 2WC9A 2PT0A 3O8MA 5AQOA 4MAKA 3MWPA 4BDYA 1RDCA 5BR8F 1I5OB 3T1YJ 2HHSA 2HQFA 3CMEN 3J7A1 1NNEA 1AB8A 3LPEA 3TAMB 1GAOA 1P8GA 2HFNA 3DLEA 2P9UA 1ZTWA 3KVGA 5AJ3F 5K20B 2HGMA 4BQZA 2GIRA 3OQ2A 2MLXA 5JJBA 4DV2K 3D2WA 3OS2A 3HPOA 3WQPA 3C19A 4J9OA 2WHOA 1S6PB 3HD1A 5JVGL 3HFZB 1WKKA 5HSPA 1J5EK 5KPTA 3LF0A 2R7QA 5B8HA 1O13A 3GBTA 2YHWA 3M8SA 4NRUA 4MK8A 1VSFA 3CM5A 3AXKA 2L9WA 1U47A 4KIAA 3AHPA 3M8PB 1I94F 1NO8A 4DFJA 4GV3A 2ZGZA 2R7WA 2JH3A 4TQRA 4CTAA 4NLBA 2DPIA 1IJJA 1XIQA 1DZ5A 1TU0B 2AWZA 4Z7CA 2C22A 3C6TB 4OJGA 4WYBA 1FFSB 5CY4A 2R8HA 1OJ4A 3AVKA 1GH8A 2OGUA 2RD5C 4DU7A 3IRWP 4ZP7A 5IC4B 4CJUA 2IM0A 1S9EB 1Q5YA 5M1OA 3H5SA 3QZ8A 1HNIA 2CPDA 3VQ4A 2NS1B 4ATNA 5HMZA 4JI8J 4Y1CA 3SBGA 3C14A 3G8QA 3TP2A 3EDRB 4P6QA 1OQ3A 3QEIA 4RU2A 4RW7A 4BGAA 2VG7A 1BCMA 1RT4B 5D0GA 3BZCA 5DDQC 2RE2A 1RWPB 4CJLA 2MSTA 3EXCX 3Q89A 2KM8C 1ZAXA 1OY8A 2HPUA 5BN8A 3A0IX 2MZSA 3ZETA 4QR0A 4M63C 4B9VA 3LPYA 4I4BA 4PEOA 1S12A 2FLLA 3FUYA 3HP6A 3OYDA 2D3UA 3LA0A 4DV3J 3CNQP 1VCTA 4AHTA 3HZEA 4BRMA 2O8BB 2IJFA 1JNRB 2IYGA 3Q24A 4JKBA 4TY8A 3O6WA 5M2RA 3SV3A 3KLEA 4PWDA 3HT3A 1RYRA 5IFMA 4CJKA 4NYOA 4KFBA 2R2UA 4CP5A 3P31A 5DM6L 4HKQA 4ERDA 2NR0A 1RBSA 2AGQA 1JIHA 1KQFB 4NZ0A 2VASA 4FJ9A 3D6FB 2WVBA 1TKXA 4DG1A 4CZHA 1WD6A 2RQ4A 4LF5F 1Q9XA 1D8ZA 4BGBA 3T9NA 1B99A 1ZM4A 1DY3A 2V4QA 1HBOA 5IOLA 2NLXA 5HL7Q 2ASLA 4FJLA 3O2IA 1IO2A 1XNQK 4ZP8A 2B6AB 5HVHA 1ZPWX 1GMWD 5T7LA 2XSJA 2P9KB 3HHLA 2VPWB 4X64J 1S4FA 1VC6A 4JRQA 4CGGA 2DGWA 4NZ6A 1S77D 3OXLA 4LR8A 5KAKA 4FWQA 3P5JA 2AGOA 2C1EB 3NOCA 3NRBA 4HTIA 4MO5A 1RT7B 2FLPA 2F8SA 4I9LA 5HAOA 2QA4G 3FZBA 2QYCA 2LDYA 2E5IA 3O9TA 1OVQA 2W1BA 2FVPA 3S3OA 1HNXK 3ET6A 3PG9A 2QV6A 1X4HA 1WB9A 3VCDA 2E9ZA 5FJ4A 5KFMA 5KG2A 3V81B 4CO5A 4FL9A 3HFVA 4CHYA 4ED7A 2P9NA 3UDCA 2BRKA 1GOBA 1HKGA 3HM8A 2ZNYA 4LFAF 2Y0BB 3ILIA 1GMVA 1N5TA 2JRSA 5FDLB 5C7PA 4F4ZA 1WC1A 2R7YA 4H8KA 1XMOJ 5HJXA 3CETA 1RBUA 4B02A 2OO4A 3D6RA 5J2PA 2IAJA 3CO9A 3FQKA 4U7BA 2XO6A 1DFDA 3U9ZA 1WKJA 2YQ3A 2FSJA 3HZGA 4IBNA 1F6TA 1IKVB 1HFEL 2CNOB 4LRFA 4DV4F 3ZC4A 4ID5B 1FHTA 1U1OA 4QAGA 1M0SA 3ZSVA 5KFXA 3IDHA 1R0AA 1DTTA 2WRMA 2H9ZA 3L09A 3X3UA 2EC2A 1QSYA 2CQ2A 2ZD1B 3IWLA 2QMUB 3VQ7A 1GMUA 1RQ0A 2M3DA 3PW4A 2Y9HA 1WKLA 4BG8A 2RNEA 3H4DA 4EBEA 4W5TA 4I9QA 3D0GE 1HWKA 4RU9A 4FPAA 4H03B 3QQCD 3R6GB 4J9NA 3VGLA 3BQ0A 2NRZA 1J53A 3D67A 3TU5A 4BC3A 4EFHA 1ZH5A 1HD1A 4JI7J 1VQKS 3HFKA 4NI2A 3PW2A 1MDUB 4FOEA 1VQ4S 2XI3A 1LW2A 3L2UA 5F8IA 2WK4A 3V9ZA 4GVMA 4TY9A 2UVWA 4YHHK 2O1PA 3I8BA 3MECB 1ZZFA 5LM7E 1HQEB 1NDCA 3L7PA 4YDDB 1NK8A 3ITHA 2H4WB 2RN2A 3R27A 1SBRA 2HWHA 1MWYA 4DZ6A 4IO9L 5L1KA 5E5NA 1UEVA 4F3OA 3SFUA 4A8OA 2HK3A 3DC2A 4I6AA 3F73A 3EGNA 2DGUA 4J8FA 5KPRA 4CEFA 5L1LA 2E6LA 2W9CA 3QFPA 4UZCA 1NSKL 2LYVA 3CC2S 1RTIB 4ZKAA 2X1GA 4OYBA 2CQDA 1FE4A 4IRCA 3K0JA 2J4RA 4DPWA 1ASVA 1HLUA 5J1EA 3T5KA 4DSIA 4HT7A 3I32A 2GC8A 3H25A 3IS9A 3EM1A 2B43A 3LAMA 3PEHA 3VHQA 1UOCA 1CQNA 4RNFA 4DU4A 2KG0A 4X4RA 1WC4A 1YF5L 3DAWA 3HTVA 2OPPA 1GLDG 1WC6A 3KK3A 4KO0A 3A3NB 1IBLJ 2DNOA 4DF8A 4HH1A 4DV0F 1P8ZA 3ATUA 4BRNA 4AQYF 2DR7A 3CJTA 4CRJA 4Y34A 2E1MC 1UWBA 1NJWA 2DFFA 2CZ9A 3ZSOA 1TP7A 4JHDB 1VFJA 3CD6N 1FRHA 4OX7A 3CPWM 4KHWA 2ZH2A 3MR6A 1QQMA 1N0UA 3MEEB 5E7OB 2E88A 4YDUC 2HFSA 3IM9A 3KK1A 1N36K 2D0CA 5DLFA 5K5MA 4OKKA 1MROA 2K7JA 1RHUB 2YV0X 4WWSA 2DEIA 1S76D 2DEJA 4DX5A 2BE9B 3WX4A 2G8WA 3A5LC 4C3MA 1NHUA 3PDNA 2A41A 3V1RA 1NK4A 2I5JA 4FZVA 4A8SA 3R1HA 4ED2A 1KVAA 5KFRA 4AYBD 4KH1B 2YKOA 2Q36A 2RDJA 2CADA 1ZETA 4BRDA 3NGSA 4QWEA 2C3OA 3NS6A 4XH1A 4B9MA 1MLAA 1S6QA 2L41A 1NDKA 4H0PA 5J1NA 1LEOA 2CVEA 4BC4A 2HFVA 3OSNA 4CF0A 1UJ5A 4Y2IA 4Q5VA 3D2EB 1YTAA 4FJKA 3RBEA 2KH9A 4HTUA 3HKWA 1WSIA 4OYMA 1WOQA 1JLBA 1N34F 4GO5X 3LPUA 5LMUK 2L3MA 1E3MA 4B3OB 2I7NA 2O5DA 1RDUA 4LFCK 3PW0A 3ILOA 5A8WA 1OQ6A 3TX0A 4DUYF 2BQ3A 4RBUA 3O5BA 2YI1A 3OYCA 4BRCA 4FJJA 3E2EA 1JLFA 1BUXA 3OHAA 4LC9B 2FZCB 1VSIA 1KQGB 1MU2B 3BZQA 2E5LJ 1Q16B 1B0VA 1LFWA 3S3NA 5FLXU 1ATRA 4JV0A 5C24B 2CQGA 3DLBA 3TZXA 3PM9A 4RG8A 2VH7A 4QQBA 1M5VC 1N33J 3FLCO 1RXOB 4PA1A 1R59O 2DHHA 3C16A 1OS5A 4FO0A 4PPDA 1FFWB 2AKWB 3SI8A 4LF9K 3Q7BA 3EGWB 3GJSB 1VQYA 3CC7S 3WNGA 4KHPF 2NXUA 3C46A 3PYFA 2KVQE 3JSMB 4M63A 5BYRA 4Z4HA 3U1NA 1PYSB 1KNZA 4A8XA 3AV9A 2F7TA 5I4MA 3VF4A 5KT7A 2B9WA 1VBYA 4GKJF 2QLBB 2RQKA 2X1BA 3DLGA 3H0PA 3MXHP 2E1CA 4IJAA 1Z25A 3NNHA 4WFXA 2OEMA 2A3JA 5BRDA 4OI0A 3WC0A 1X0PA 2QSFA 3CJ9A 3KWMA 3H40A 2KZZA 4ILJA 1OKJA 4B3TF 1JXVA 4BVPA 4OIXA 4AM7A 1HHTP 2LEPA 4BY9C 1O6XA 4C7QA 3L3UA 1HBNB 4Q45A 3CC4S 1JJ2R 1F2HA 4E0DA 3CFPA 1GLLO 2OFGX 2QWLA 1CC8A 4JI5K 2MMYA 3CCVS 4ZIVA 1Y97A 3CULA 1H7WA 3ALYA 2C2RA 3TTCA 3I0SA 1K47A 4XDCA 1TQLA 3QIDA 4JV2A 5K14A 5E26A 3FSIA 4ZJOA 3QT7A 2UU9K 2O67A 4EBDA 1HKBA 4UY8T 3NMRA 1GK8A 1FNMA 1KLMA 4F0HA 1FERA 2HVEA 3HF5A 3EX7B 1UA0A 3L2RA 7FD1A 1X4BA 3O4QA 3FR0A 1ZBSA 4XPCA 2C3MA 1S1TB 4X2BA 5L38A 4UOFA 4ELTA 1N0VC 3BKUA 3PIOQ 4DQSA 5CYJA 5AFUA 4NCAA 5D3GB 2V51B 1X7VA 1W7AA 2FPHX 4LUBA 3LGNA 1NMNA 5HBMB 1HIYA 1LXJA 4C8MA 4C1NI 1XC9A 2GX8A 4ANEA 2DIVA 2HHWA 3RBDA 4ED4A 5HVFA 2J0XA 4PYDA 4D3GA 5LJ3Y 3HSJA 1FRIA 4YB7A 1KD1T 4FK0A 3PZPA 1NGDA 3ZT0A 1TL1A 3K59A 4DR1F 5GAHU 4WKRA 4GKKF 3DLRA 4A46A 2G2YA 1RE1B 4OLBA 3GIIA 3MM7A 4JI6J 3LDSA 2IMOA 4A4JA 5DETA 2N3OA 2EWHA 1T3NA 5LSLA 3GILA 4F4YA 3I31A 3G10A 3H4BA 4DQQA 4NLYA 3CXCR 1YGYA 2H65B 5ETSA 2E1AA 2CNNB 3A3PB 2OLWA 2XMTA 3MPUB 3M3ZA 2QWMA 2D5RA 4PYAA 2W4CA 4JI1J 3OL9A 1VQON 1IJEB 1S4EA 1HPMA 4KI6A 1URRA 1VJQA 1NGBA 3G0ZA 2KDOA 4AL5A 1T9TA 3V4IA 4MH8A 2X1FA 3MMBA 4NLXA 2XQCA 4G1QB 3DXBA 4P2MA 1SPBP 2N7CA 1K6YA 2ZBRA 1VBXA 2Z1JA 1Q5VA 1C0UA 5GAHP 1IQTA 1BOTO 3DOKA 1YJWN 4JI2F 1S99A 4TN2A 4KHSA 2JVRA 1WACA 4I6YA 1IM4A 2P9LB 2KVIA 1UVKA 4RUCA 2HHHF 3OL6A 4R8UB 3JAMO 1V5IB 1WSHA 2HB5A 3CJKA 3PW5A 3LDLA 3C7NA 1KR4A 4TU8A 2IS3A 4N47A 2PC6A 2Z30B 1UJ4A 4CJ4A 1CLFA 3VR1A 5FRMA 4Q0BB 4ZPAA 1TKDA 4CK3A 3O1LA 4FWRA 2CPZA 1REVA 1OH6A 2VG5A 5E0OA 2AYBA 4Z2XA 2YWKA 1HNWF 4C97A 1Y11A 1IG9A 3OFHA 2HURA 2R7RA 3UDEA 5A2QY 4CIGA 3D1QA 4QS8A 3VN5A 2LCWA 3I55N 3BP8A 2JX2A 1FKAF 1RYSA 2FXUA 4ILMA 3I33A 4CEBA 2CRLA 1S22A 1Q9YA 1VIXA 4E1MA 3DXMA 3CCRS 1VQ9N 2QLJB 1FRMA 3F9MA 1TUVA 2VPXB 1ZC6A 2ZJPQ 1F3FA 3HJVA 2CXEA 1DRZA 3PSFA 4GMJB 2BJEA 3TPQA 4KBIA 4FM1A 3DOLB 4NYPA 4YDUA 1C2PA 4TQSA 2IGIA 1FI4A 3VA0A 4M3XA 1F5CA 1VQLN 3VVUA 2XULA 4Y65A 5F9LA 1RBRA 4CEDA 2GTDA 1RT5B 2EW9A 4QCLA 3QYYA 3KFWX 3CMAN 3CCJS 4H5VA 1R27B 1C1AA 2HYIB 1NZ8A 4NWBA 3LZJA 5MAOA 1KAYA 3MK6A 1CS4A 4O4RA 2IA0A 4HUEA 3B82A 4OHYA 1YTYA 3EE8A 3TW0A 3LUYA 3JTPA 4ED0A 4C0HA 4USWA 2FJXA 5HLFB 2QWRA 4A59A 3HX9A 4IKAA 4KGMA 3UVJB 5D4OA 1JLQB 1EETB 3M2RA 2ILYA 3BH6B 2QL5B 3F56A 3M1FA 2KT3A 2GVDB 5M1PA 3W2VB 3I96A 4OI4A 3UKRB 2DO4A 2FJVA 1ZM9A 5G0RA 4E98A 2NRWA 5L39A 1JWWA 1FKOA 5AQTA 4WE1A 2ZJQL 4CYUA 1GNKA 1IVZA 2LSNA 2Z4PA 3UE5A 1NPRA 3AVGA 1SKSA 2FTRA 2EFOA 2RU9A 3PX4A 1CEZA 2ZITA 3O9QA 2Q79A 4B3SF 1ITGA 3JTNA 2MGZA 4JKAA 2R4FA 4PXEA 2GO8A 1VRUA 2IBOA 4ZVUB 3W61A 1B9DA 4QIGA 4X65K 1NKBA 2E9RX 3KLVA 3VENA 4OZ1A 4IQXA 4JK8A 4LF6K 3LP0A 2UUAJ 4Y1DA 2QTWA 3IM8A 4LF8F 3DOMA 3CWJA 5DO2A 1GOAA 4M5NA 3ZSRA 4A5AA 5ETMA 2K1RB 4O5FA 4PG8A 1LW0A 4RTFD 2QIFA 5T7BA 1KKHA 1DKGD 2M5YA 2FBXA 2XEXA 4M7YA 3BPDA 2F4VK 5GIPA 2OD4A 4RLEA 2VQEK 3DDNA 4I56A 1K9MO 2LQJA 5ETVA 3M1VA 3DLJA 3T1YK 4L75A 4CJFA 2XWXA 2NCKL 2VGMA 2MKKA 1KWMA 2HSTA 1B64A 3MEGB 2J7WA 4DR5K 3QT8A 4BE1A 3UNYA 1W2BM 4NZ7A 4YP3A 5ELZA 2MZTA 4U7UD 5AR0A 1WSJA 3RMDA 1M1GA 3AVFA 3GYGA 5ADZA 3BB5A 2AYEA 3FSXA 4DFKA 5M2PA 3G71S 5EX0A 5BPLA 3EPGA 1TVRA 1KVIA 3BSAA 1LWCA 4KH4A 3WT0A 1GLCG 4I6MB 1SC1B 3DCAA 3IUCA 3W3DA 2CJYB 3U02A 2DITA 2CQ4A 4TLRA 2FJDB 3FFKB 3WEEA 3NWGA 1FEHA 3RTVA 3QJJA 1YHQN 3UN5A 3NH0A 5KRSA 3UNGC 4LF7K 2YH1A 3H3OB 2I0XA 3OW2R 2H51B 3MCOA 5I42B 2ZBCA 4FXDA 4KH6A 1CULB 1VYAA 3EICA 4HHHA 3HLUA 2VQFK 2D9PA 3WC2A 3GMGA 2MZ1A 4BE2A 2YHXA 4DV7F 4DTXA 1SI9A 1QSLA 2Y8YA 3R2DJ 4RCHA 4FJGA 1EKSA 5AZJB 1RHMB 1YBAA 1X5SA 1U6BA 4CJRA 1PYOB 3OHRA 1YVUA 1D0EA 4NE9C 3ZLJA 1HNZF 4Z4IA 3UI3A 2J8AA 4K25A 1E6VA 1HR0J 1DLOB 5KG1A 2ABYA 1XBWA 4IKFA 4QR1A 4LMZA 5BYSA 5AE3A 3GIMA 1FKPB 2OPQA 3MN5A 3E51A 3SJHA 2PY5A 1SV5A 4RWXA 4PY5A 4K4VA 5D0EA 5H9FK 1YZ6A 2ZNZA 1U1MA 3EKSA 2AEFA 3DRSB 3CJ0A 4DTRA 3AOBA 3BEXA 2WBMA 3IAYA 4BC7A 3D0HE 3MMJA 5GAGP 5MLCV 2B8PA 2XMAA 1VQ7N 3W3SA 2Z57B 5EN1A 4RUAA 1Y5NB 3HSDA 3W64A 3OTCA 3IBWA 4J2DA 2J8SA 4CM2A 5DDRC 3CCQN 3QT6A 4MFBB 2BW2A 2YBVA 2FY1A 4OLAA 1ZXOA 1Q82O 3T1AA 4DPUA 3BO3A 4W5NA 5DJBA 4P73A 1KHWA 1PYTA 3A8JA 4ENOA 4HT5A 2DGQA 4IR1A 2DH8A 2CGKA 4ECXA 4ZVPB 4F9OA 3W8GA 3E9LA 3J7Z5 3R8EA 4PUOA 1KHVA 1N5SA 4X64K 2EBEA 3AA8A 2RRNA 4DV6J 4LF4J 4CLZA 3HXMA 3THXB 1Q53A 4B3RJ 5KT6A 5KFYA 2I6WA 4S0MA 2ERRA 3TOQA 4FYXB 2OTLN 3PUFA 3O4NA 3IO1A 1TL4A 1FVSA 2A2DA 4DR2F 1EP4B 3CVKA 2J7KA 3HHDA 3T5LA 4IH5A 3OL8A 4JKEA 3TSPA 4BC2A 2VGNA 3ENWA 2A1BA 4B3MJ 2QA2A 5ITHA 3AB2B 1EX4A 2LEAA 4ZPDA 3GONA 3CMES 2BJ7A 4C8KA 3OTOF 3M5RA 1T95A 3WNEA 1ILYA 3DLLQ 3CCWA 4DR4F 3G8SA 4I2QA 2DPJA 3C8YA 1WF0A 2F3JA 1QM9A 1GLFO 1BO5O 2WB4A 4DL4A 2BE2B 5E84A 4CZJA 2LP4A 1ZBLA 3CQYA 4DWIA 4PWUA 2IDEA 3DFEA 4A47A 2QX0A 4BG9A 3KK2A 1Y10A 2ZF5O 3MX2A 4G1IA 2O8FB 2E2PA 2RRBA 4I7FB 5GVQA 3FEZA 3W5ZA 1ZTTA 4QIWD 1YK9A 3Q83A 3DJCA 3QAUA 1XUPO 2OPRA 1VLOA 1Y3KA 1TV6B 2CH6A 2WVEA 5AQXA 4OYPA 3EZWA 5KFOA 4AF1A 2I9SA 4X84A 1BDGA 3AD8C 1NGCA 4X4TA 3EY1A 3MMVA 4DL5A 1S72N 2O8DA 3NEKA 2E1RA 2IDLA 4IOCQ 5C2DA 1VSHA 4WIIA 3OTEA 3NAHA 4AHSA 3A5MC 3O9UA 4ZVFA 4BROA 3IR6B 2HNYB 2CQHA 4LR7A 1JXLA 4JI7K 4CLTA 4DR6J 4CK2A 3PY8A 4FJ8A 1P1TA 1VRTA 2XYHB 4K0KK 1NLVA 3AVIA 3QETA 5E41A 3QEVA 2GJIA 2V50A 4ZJQA 5BRHA 3CJ3A 3HHLD 1NKCA 1EAYC 1BQNB 4K8ZA 4ECRA 1U02A 5J1PA 3CPEA 3A13A 4U9RA 2DNGA 4FVCA 5GIOA 3OTBA 3UB5A 1U1QA 3IAM9 2NRXA 4M5GA 1JLEB 1QAYA 3UCGA 3GJRB 4CD3A 1FDDA 3J7YU 4ZHRA 4IG3B 4CM0A 5C42A 1WUUA 2UXCJ 3RBZA 5JVHL 3L3VA 5D6GA 4FJ7A 4M8LA 3FC9A 2CJ9A 2VJUA 2C3PA 2YNGB 2W2PP 3Q7CA 3S6EA 4OL8A 4H5TA 1YJ7A 2VPZB 3UR3C 3LDNA 2OTJS 4KV8A 3TA2A 2GW8A 2JFKA 3T9ZA 4F67A 3KD5E 1T6DA 4B9QA 3V9XA 1T03A 4CGHA 1BISA 1IV0A 5GAEU 1RA6A 4NLRA 4M3ZA 4R5PB 2DHXA 2NZTA 3GG0A 4NLVA 4AD6A 3LAKA 3M6XA 2YNHB 3OV7A 2ROPA 5C25B 2UYTA 1NH8A 1FJ7A 2UUTA 3MXMA 4F4AA 4E3SA 4FXWA 4DCPB 3THWB 1IBLK 3R2CJ 3GV7B 3T3FA 1XQSC 2FLNA 4LRAA 3QRQA 3BGFA 5D0RA 4OI2A 2YNFA 1NPPA 4DN9A 3M8RA 5DZ6A 3KZBA 3HRGA 4WFBL 3HDSA 2EC0A 1EXQA 4WTOB 2VB6A 2B3TB 2UVVA 3D54A 4AHUA 3J7YP 1RT6B 3N4QA 1AROP 2WONB 2CA9A 3PTWA 4RBVA 2FVCA 4PPZA 1Q7LB 5EHHA 3MD1A 1YTUA 1YIJS 2UVUA 1D3WA 3MMAA 4NPOA 1U2VA 3PLAA 1S1WB 4DR3F 2NRHA 1D8YA 4F8RA 2MB0B 4KKOA 1BXNA 1TELA 4NLQA 3RJMB 2YWEA 2WBRA 1DBDA 3DM2B 2IC3B 3DXKA 4WP9A 1T9UA 4JI4F 1Y64A 4I0WA 2JLEA 2DGTA 2LVWA 3K89A 2HBZB 3IMQJ 3EGZA 3R9PA 1N4LA 3CFOA 5GAEP 3I0RB 4WFAL 4R0EA 4KE5A 3OYHA 3NF6A 3PFEA 3K2PA 2VV5A 3ILLA 4FZZA 4K8RA 2ZVIA 4FLWA 1S7IA 4ETZA 5CCLA 1CLQA 3GG1A 5HVGA 1NHVA 4NB4A 3AA9A 3CCMN 3E1YA 5AQHA 4FW2A 3OLAA 4FYWB 4L6V3 2RS2A 2Y0SD 1RAIB 1FDBA 2CPXA 4OYZA 3NCRA 2EFVA 2XZDB 3MR5A 5BPMA 1RWVB 2KFYA 2J9DA 1WSVA 1NK7A 4F0KA 1HRHA 1D4XA 5ETNA 5JLFA 2MLZA 2ZOFA 4UOGA 3OJSA 1NJIO 3ISND 4CJSA 2VDIA 2UXDK 1FA0A 1JLAA 4U7CA 2ASPA 3D66A 4MJKA 2LECA 4ZK7M 3C6UB 4CTAB 1HMVB 1L3VA 2BBEA 1N33K 3P4UB 1U25A 1HHSA 3VAFA 2AHOB 2Q6CA 4DL2A 1NDLA 1IKXA 4IFYA 1QVFR 3R5AA 1FDNA 4C0OC 1TUGB 1O1WA 4OJ3A 4CBWA 2WCXA 5B7WA 4C0BA 3VEYA 4IQMA 3MN7A 1VISA 3MDQA 1MW7A 1HNIB 2W8LA 3CJ2A 1T02A 2RUGA 4GV6A 2N82B 1WC3A 4JAXA 3FBFA 1RDRA 3C14B 4OYOA 4BLGA 3M2VA 1SS6A 3LM9A 2A1SA 1T11A 4USUA 3FVYA 4FF3A 4RW7B 2VG7B 1WG4A 4CLPA 1XNQJ 5DRKA 2GFFA 5KFQA 4J9LA 3OYKA 2UXBF 1D1UA 3NXZA 1F0XA 3ULDA 4FNIA 3ZETB 3I4PA 3RVCA 3HYFA 4M41A 1KEKA 2AYGA 1VQNS 2EG1A 4G3IA 2LQ5A 3N4WA 3D7EO 2YVSA 2P2CB 3NGRA 1K0TA 1IR2A 3D3CJ 2FSKA 4TY8B 3T5HA 5EUHA 3O1WA 3KLEB 4BC5A 4PWDB 4OZJA 4BRIA 2O8EA 4DV0J 2OELA 3NOGA 4AQYJ 4KFBB 4H4OA 1GOCA 4DPXA 2XTJP 5K8PA 3O5TB 3M4XA 2QSWA 1EWRA 3CD6S 3VQSA 4EWTA 3ZT1A 4DG1B 4TLQA 5AXKA 2IA6A 3M9OB 4HHTA 2RE1A 1M1KO 2KKHA 3VWSA 2BABA 4EU0A 5HP1A 4QYRA 1EWQA 1HBOB 1VQ6N 2OZSA 4J2EA 3KD1E 4ECYA 3N5FA 3M8QA 4GV9A 2E1PA 2GMJA 5KFNA 5HL7L 2HS4A 5T7LB 3TEHB 2XSJB 3HHLB 3TX8A 2QA4S 4DHVA 1YJNN 1TR0A 2AJ2A 3NMUA 2XS7A 1TUUA 1XWLA 3TO8A 4GC6A 3VEXA 3EVMA 4CCHA 2R7OA 1L3UA 3L7OA 3ET6B 1JCFA 1RAHB 3K9JA 3FKBA 2E1YA 1WTBA 5HMYA 2P9NB 1RBVA 2HG4A 2N4CA 2H3EB 4R0JA 1WHYA 1YZ7A 1DQ8A 1K73O 1HNVA 3SDEA 2J0SD 2YTCA 2J6UA 1RGIA 4GMKA 2ZEJA 1CZBA 5CZ1A 2QYGA 3W62A 4DV1F 3AVHA 3P49B 1JCGA 4OX8A 5LMNF 4O3SA 3QEWA 3BBFA 1XMQF 4QU7A 1IBMF 2V2QA 5BREA 5KFJA 1WHXA 2GV9A 5J2PB 2IAJB 2F8HA 4MTPA 3R5GA 4P2SA 2F5GA 1Y9OA 5LJWA 2P9EA 1FXDA 3OS0A 2HF3A 1FCAA 2V2ZA 1U24A 2GZOA 3ULHA 4Z4CA 4DR7F 3CJCA 1NJYA 4LY7A 1DTTB 4HR2A 2W25A 3QINA 2A3ZA 2ZKTA 2XMJA 2PO4A 3AO3A 4ZVHA 1UW4A 3MM9A 1RBLA 1S49A 4H0YB 3CFRA 1ZZNA 1FXRA 3P5TL 1R6YA 4KGVB 4O8KA 3RRKA 4DLEA 2DNLA 4U67Q 2IVMA 3O80A 3I5BA 1K8KA 4JKDA 1U2FA 4Y0FA 4QOTA 4K59A 2HIYA 4NI2B 3WZ0A 3EEQA 1S0VA 2MKCA 4P10A 1YBUA 1PJ6A 4PXBA 5AXMA 2BJDA 2NPFA 2D9OA 1LXNA 3BGUA 1T3OA 4M3RA 4M95A 3T1HK 2WZ1A 4E1NA 3KYLA 4RW9B 4KY3A 3NFAA 1FNOA 4GKJJ 4DV5F 4USJC 1A5WA 5C2CA 2G13A 4JI0F 2MXYA 1N56A 4NXNK 3MCPA 3F44A 5DK5A 2JHEA 2LQ9A 1VOMA 3OYEA 3MM8A 4K7QA 2G8UA 3B6BA 9RUBA 4CLSA 3G8TA 4BRKA 2RB7A 3CYMA 4DN0A 3P96A 3JXUA 3CDEA 4FLYA 1UKUA 1XTZA 4OV6A 1N36J 3KLIA 1R8CA 3D7SB 3W5XA 1OY9A 2M52A 1CJVA 2DNQA 2DGXA 3KG4A 4DQRA 1W0HA 2W9CB 3BSNA 3UD5A 2HQ3A 1IWAA 2J9CA 1CZ9A 5HOOA 3CJRA 3EWGA 2CUYA 3QGGA 3DKDA 3TR8A 3OS1A 4CEOA 3EE3A 2PSZA 3UCUP 4USIA 5J1EB 3ZTPA 1KFDA 1S1VA 3A3OB 3IS9B 4IO1A 3H45C 2X74A 1YLXA 4PAAA 2HEKA 1OVYA 3KLFA 1FJGF 1U09A 1WUAA 2A0FB 1RADB 2FGOA 2BGGA 4I68A 1KVJA 2BH1A 2G2OA 2E2NA 3KK3B 2BUNA 3QWPA 2WW8A 3SCIE 3NGDA 5A6WA 3A5OC 5CCMA 3H42A 2MQMA 2Q1NA 3CDUA 1M1HA 1UWBB 1YAGA 3PSIA 2XCPA 4E19A 2E9TA 1K8AT 2FC8A 5AFUH 2QN6B 3THVA 3C94A 2AJFE 3M30A 5ETKA 2FHMA 2CJXB 1SZ2A 2BTFA 4MYTA 4LF1A 5LMUJ 3KK1B 5JVGQ 2K7KA 3F0NA 4UY85 1MROB 3OVAA 1QQOA 2RS8A 1C0MA 3L95X 3QJLA 4CIOA 1JX4A 4DR1J 2BJ3A 1NK6A 2PMWA 3OD2A 3TWHA 2I5JB 1BWFO 3JAMY 3MUMP 3G82A 5KFVA 2X3GA 4KAIA 1VQMN 2PFDA 1VK3A 1RWUA 4Y3CA 2PI4A 2EHGA 1JXBA 5ETPA 3VAMA 2AW0A 3HHEA 3HVAA 3GOIA 4K8XA 5J2NB 1N5YA 3P83D 4LF9J 4I2PA 4E1JA 4X4SA 3UD3P 1ZBUA 1RHJB 2PFUA 3QFUA 2ZH7A 1N5QA 5SWMA 3FCHA 1XERA 5AQZA 2O8CA 4ED8A 4IYQA 3QMQA 1JLBB 2G0CA 4RW4A 2GEMA 4FJHA 3LP1A 4JI3F 4ECWA 4Y2MA 4C3KA 2ZM6F 2G2ZA 2KXNB 1S5ZA 4M45A 4A8YA 4IFVA 4TKTA 1N5VA 1C0FA 5KFIA 3TABA 4V19S 4QWCA 1WG5A 4DEZA 2V8GA 3U6FA 1VQPS 1JLFB 3RR7A 1YRUA 3U1LA 1N32F 3BUZB 2HAIA 4EIAA 2BV3A 4DZDA 1S97A 3CI5A 1HQ2A 3VVTA 1UVJA 4JI2J 3CCLN 3HKZD 4CZGA 3OYNA 1EIYB 4JI5J 3AA2A 4EYHB 3KK7A 4ZCIA 4KQZA 4NLPA 2HHHJ 3VQCA 4DX7A 2MKIA 2B5JA 2R8GA 1RWMB 5H9EJ 3BGRA 1T3VA 4PQAA 4EYIB 3C16B 5E3AA 5B0AA 1CSJA 2FHJD 4BC9A 2JLGA 2UU9J 2LXUA 3JSYA 4X62K 3M6GA 2YWHA 3O44A 2KM8B 3CT9A 2JVOA 4U96A 4F36A 3V6DA 1RZMA 2ZDOA 5F1XA 2E29A 2MYFA 2J5AA 1ZAWA 2GNKA 2HAFA 1FVQA 5SZTA 1HNWJ 2OMOA 5KG3A 2ZH1A 1B7FA 4QWBA 3DLGB 2FVRA 3OUYA 1Q86O 1WORA 3FJ2A 2A1RA 4FJMA 2AV5A 2WOMA 3H8YA 3DWLA 2VPYB 3ZEUA 1N8RO 1J2VA 1XN9A 4JYAF 2EX3A 4O8UA 4MLHA 2HFOA 1ITPA 5AQPA 1VK0A 1VQ9S 3MN9A 4EGLA 2AT1B 2GELA 2Y8WA 3HMJG 1ZAVA 3C2PA 4DU8A 1QVGR 4PCQA 4IH6A 3LP3A 2QEXS 5EU7A 3VA3A 3LP2B 2ZKUA 3FZHA 4JKHA 2Q31A 1WBBA 3I0SB 4H54A 2OANA 4FZXC 2FD2A 4H4KC 5K14B 1VQLS 1UFLA 3BN4A 4IH7A 2H48B 3QBXA 1VSJA 3JYTA 3C95A 3H2UB 4O3OA 2VD3A 3RAQA 3OHBA 4FWKA 1TL5A 1QE1A 3CMAS 4W5QA 2XO7A 1V3SA 3W2WA 4O4GA 3IMXA 4RL1A 4ILHA 3K5LA 2EI5A 1QUPA 2XZTB 2DRDA 2BX6A 1RBTA 5F3TA 5L9NA 5M1NA 3HI9A 4BRFA 2BA9A 2B4JA 2W42A 3CERA 3PYGA 1HWLA 3P1GA 3U9DA 3MFHA 3GYXB 3D2FA 3V1QA 1M90O 2ZWPA 1C6VA 1RBOB 3C3LA 4BACA 2MKYA 3DU6A 3LL3A 3KUGA 2B4PA 1BA0A 4YB6A 4X4OA 1Z2ZA 1QTNB 2F8EX 4HYKA 5KRTA 4WF9Q 2D1KA 2ZGYA 1VI7A 1W25A 3SMSA 3SPYA 4K41A 3F2KA 1NSAA 1X5TA 2NPIA 1TL1B 1X3MA 1AT1B 3VEVA 1YT3A 1QQNA 5FIIA 1JB0C 3ID6A 3AJ2A 4JD2A 1H1VA 3DGPA 3NVMA 3MGJA 3AA4A 3AO5A 2IVFB 4OGCA 3VZHA 2XNRA 1VGYA 3G2XA 2NQPA 2VFVA 1U0HA 4MMOA 3NHGA 2UUBF 2ZBQA 4ELUA 4Z37A 4OX9F 4B1WB 2NXNA 3AT1B 4IO9Q 4CJTA 3ELHA 4LF8J 2D3O1 4FLXA 4BDZA 4C3LA 3H20A 2PYJA 3K9KA 1OPIA 1UA1A 4JI8F 5DG8A 4FBUA 4B3MK 1GX6A 5DMRA 3VESA 1NG9A 4A8FA 2KKZA 5BR8K 1Y5IB 1LV5A 4HVJA 4CT9A 3V4IB 2F4FA 4CZFA 4Q7AA 5AJ3K 1KOOA 3CJ5A 3MMBB 1M1KT 3ZYYX 3IBFB 3TZZA 1NSQA 3TAGA 1TUYA 1GLJO 1XC3A 3CCES 4KPCA 4O3PA 4DV3F 2Z58B 1C0UB 5DG9A 2EPIA 4DL3A 4IG0A 4HHJA 3DOKB 1PAEX 5KPZA 3DNCA 5KFCA 1FD2A 3QLHA 5AQKA 4NEZA 4PL8A 4JK9A 3B54A 1NJXA 2YH0A 1F2GA 3ILJA 2XLKA 1H3DA 3CJKB 5LT5A 4BRQA 1I94K 4FLTA 4ANDA 4PL7A 2Z1IA 2AEJA 3C7NB 4NA1A 4BHQA 2MQPA 1YHQS 2EEYA 3P6YC 2CPJA 2ZUGA 2ETJA 5B08A 1WI8A 2VF3A 1QQCA 4E7LA 3TEGA 1ZA1B 4HHUA 4FYDA 1REVB 2VG5B 3D0PA 3ZX3A 3A2FA 2DFEA 4UF4A 1K73T 4UUXA 2W4PA 1WDTA 3IG1B 4FWMA 4RR5A 5CZXA 5C2GA 1PO6A 1DAXA 3ULEA 4FLZA 5EWEA 2O3DA 3BQ1A 2HVZA 2V7YA 4OHVA 2C2DA 2HHXA 1ULRA 4V1Ak 3R7NB 1Q81O 2O4GA 2IRXA 4JKGB 1S9GA 2DNZA 1HNZJ 1SQFA 1C1BA 4JB8B 3DXMB 2GJFA 3M6UA 4DOZA 4JLHA 5F41A 2BDPA 3QT5A 2OSQA 4DPTA 4N5SA 3KNGA 3HT0A 1GXLA 2C28A 2W8KA 3VQAA 4HL9A 3H46O 1UWAA 5I9EB 4BR7A 2JC1A 2IRYA 4OPJA 4RBTA 5DLGA 3DMJA 3LDQA 3EDQB 4J9SA 1IWGA 1Q79A 1HKAA 3GJQB 2ITMA 3W7BA 4KI4A 1WAJA 3DHWC 3CB4A 4NRTA 3DLHA 1XMOF 3NGKA 3CDAA 3TYTA 2MQQA 3LZIA 1RU1A 2BKPA 4KREA 2ZOGA 1CS4B 4EP4A 2JEGA 1E4GT 4J9PA 4LF5K 4DS4A 4WK1A 3KXDA 2MPUA 1JJ2M 5IT9O 3ENBA 4ECSA 3J80U 2B0GA 4RW6B 3ZX0A 3W9JA 1MU2A 4JK7A 1O51A 2F4VJ 4ZIWA 2VQEJ 2GBZA 4CWBA 3AJ1A 2CQCA 3A8IA 1QD1A 1FJEB 5G0RB 4WFYA 1U1KA 3R8YA 1BQXA 4FVMA 3I9V9 4WE1B 2PAVA 4DTSA 3AVLA 4CYUB 1HLWA 3BSOA 1D9DA 4M5LA 1HARA 2C2KB 3WIUA 3LM2A 2AEMA 5A8KA 5GAHI 2M4MA 4KGKA 2R7VA 4ER8A 3VQ9A 2ATQA 4DR5J 3KWIA 3O08A 3D5MA 4DR2J 5D78A 1S6OA 1FW6A 2EK6A 2L9DA 1VQ4N 3GIRA 3FSYA 2MGZB 3VQQA 5KFSA 2LXFA 4XDDA 1VRUB 3BN7A 4E7JA 4M3YA 2W7AA 3G6XA 2VHGA 1WEZA 4ICLA 1URNA 1REGX 4LFAK 2FQQB 1G15A 5FRNA 3LP0B 2HMIA 4CDIA 3DYAA 3DOMB 4DR4J 4OV1A 1EARA 1H7XA 1LW0B 2VC1A 3HD2A 1RLCL 3I9ZA 4CIFA 2YKMA 4DUTA 3UFCX 1NEEA 5EWFA 3VQ5A 1KQSR 3NF8A 1SH2A 1LKZA 4DTJA 4LF7J 5E3RA 2QWQA 3VV2B 1BIUA 3M1VB 1U4BA 3MD3A 3UN2A 3PVXA 3OVNA 3K17A 4DV4K 2F9JA 1AW0A 4JUZA 2IHR1 3GV8B 2VQFJ 2E7XA 3CC2N 3TANA 3KIOA 3EZOA 1MNEA 5DGBA 2L08A 5ETLA 3OFGA 4J9QA 4P2FA 4FJ5A 1SQGA 3Q8SB 2Q3PA 1XI1A 1YUWA 1SJFA 4OPAA 1S72S 1MMNA 3SQGA 4OZ0A 3WNFA 1U1LA 4ZS6A 3G6YA 4CZEA 4WYLA 1WEYA 4E2FB 2R2SA 5JS1A 4ILRA 4DUZF 4RUHA 3CXCM 1S1TA 1X4EA 4OHXA 4QS7A 4P72A 2AX0A 3MAAA 3FRZA 2VCPA 3KNAA 4CGJA 1KC8O 1TVRB 5H9FJ 3SPZA 2AGPA 4YOWA 4PXCA 1UVLA 3BKTA 2HFUA 1LWCB 2P6SA 3TAPA 3OTDA 4ZN1A 3QFHA 5HBMA 3GE9A 2KFZA 4Y0WA 3SNNA 2PD1A 3JB9k 4QPTA 1YKWA 1V3RA 3OYMA 3GPAA 1FFGB 2FBYA 2MQ8A 3NAIA 1F60B 3D1OA 1VJWA 1O0PA 5AQJA 4IOBA 2W7PA 5F8HA 1RDWX 2BM1A 4H4KA 2BRLA 4C23A 4YY3K 3FEYB 3RB4A 2HZVA 4P75A 3O4WA 2BKOA 4FJIA 4ED1A 1DHMA 3R