1RT2A

Crystal structure of hiv-1 reverse transcriptase complexed with tnk-651
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 145
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt2A05
3NBPA 4CIEA 5KI6A 2FLNA 2YKNA 1NKCA 1D8YA 1Y97A 1RYSA 1RBRA 1S1VB 2IM2A 1MU2B 3OYLA 4KV8B 4KHSA 5J2QB 4FS1A 1ASVA 1LAVA 5EWGA 5CYQA 4ED2A 3GIIA 3DLGA 3DYAB 4NRTA 2G8WA 4ZP8A 1S0NA 1TKTA 1C1CB 4KBIA 4DQPA 3IS9B 1W9HA 5FDLA 1TKZB 1L3UA 4MKBA 2HNZA 3OYDA 2C22A 1TL3A 4R5PB 4FJLA 1GOAA 2QK9A 4J2AA 2YV0X 1MU2A 3VQ8A 4I7FA 3DLBA 5J2QA 4XPEA 2W7PA 4TLRA 3O3HA 1DLOB 3ZSZA 1ITGA 4B9TA 5KFEA 2WONB 3KJVA 2HHTA 1T05B 4ZPAA 5KFOA 4DFKA 5HBMA 4LSNA 1IKVB 1F21A 4IG3A 2HB5A 3DOLA 3S3OA 3QEVA 1YT3A 5KFCA 2UVWA 2DY4A 1TL3B 3DI6B 4R5PA 4EP4A 1WSHA 3OL9A 1T8EA 3N6LA 3QERA 2DPIA 3AO1A 3LP2B 4EYHB 3CFOA 2B5JB 3CJ5A 4DU1A 2VG7A 3ZT3A 3QO9B 3QIPA 1L3VA 3KIOA 4FLYA 5KG0A 4KHYA 1BIUA 2IGIA 3V6DA 1T05A 1C2PA 4RNMA 4CJUA 4ED6A 4IDKB 4ZP7A 2V4QA 3G6VA 1JLBA 1VSIA 2G8VA 3V6JA 4FLZA 3QGHA 2WOMA 2KTQA 3RMDA 4MK8A 4IFYA 4JV2A 2BGGA 3QO9A 3TR8A 3AO4A 3IG1A 5DG9A 4N56A 4DLGA 1VRTB 2XY8A 2B6AB 5KT2A 1JX4A 3NHGA 4DTUA 4WFXA 4GMJB 4BDYA 5DG7A 2P5GA 4RW8B 1S9GB 5KGWA 1JXEA 2KFNA 3JSMB 4JV1A 3KK1A 4KFBB 4FLVA 4CEQA 1HQEB 3QNNA 3SQ2A 1FK9B 5KT3A 3GIMA 3TAPA 4WXOA 1ZBFA 2F8TA 3MEGB 1RTJA 3SQ1A 3IG1B 4J2BA 3LAKA 3PR5B 4J9PA 3PUFA 4Y1DA 4IH5A 3DLHA 5KFZA 4CGGA 2IS3A 4K8XA 1LWFB 4WFYA 2R8IA 2FBXA 3HPGA 3L3UA 4M94A 5C42B 3AO3A 4K4TA 2X6NA 3I0RB 3TI0A 4DSIA 3KK1B 3EYZA 3TWHA 2E9RX 1WAJA 3KMQA 3C6UA 2OPPB 4K4SA 1HQEA 1SL2A 1C0MA 3WNEA 2HVIA 1XR5A 4CEOA 3U3GA 4F4ZA 3SUNA 1LWEA 3NL0A 2XGQA 5HLFB 1C0UA 2W42A 2Z1IA 4GW6A 2Q3SA 1CZBA 1GX5A 1RT1B 4CGJA 3SCXA 4ED7A 4LSLA 5JUMA 2JEGA 4DSJA 5CYMB 4ZP9A 4B9LA 1A5VA 3MR6A 5CY4A 4KO0B 2IM1A 3H5UA 5F8LA 5L1LA 1VRUA 1EETB 3VQCA 5KFGA 3SQ0A 3P1GA 4HUFA 4E7HA 5KFDA 1JL1A 5KG5A 4KHQA 2FVCA 5KFPA 4AHUA 4AHVA 1G15A 2F8EX 2ZD1B 3NAHA 1VSLA 4TYAA 4QWCA 1TKXA 2R2TA 3OHBA 1JLCA 2D3UA 1O1WA 5HP1A 3SI6A 4ZPBA 4ELVA 5KGXA 3RWUA 4O3NA 2VG6A 1RT4A 4FCYA 3BSAA 2BQRA 2ILZA 3QGIA 3I8DA 3F9KA 5KFYA 2OPQA 1S9FA 4F4WA 3GV7B 1YTAA 3V1OA 1QE1A 4DTSA 4B9VA 4IFVA 1S4FA 3FFIA 3ITHA 5DLFA 4RW9A 3DLRA 4URQU 4G3IA 3T5HA 1HARA 1HNVB 4FJNA 3OYGA 1JLCB 3SZ2A 2D0AA 4EP5A 4DL7A 2IC3B 2CKWA 4PA1A 1CXUA 3ULDA 5KT4A 2JEJA 1Z26A 2OYQA 4CHYA 1WNEA 1W0HA 3AA5X 5JS1A 4C8MA 1RT3A 3M8QA 2OPQB 3RR7A 3H2LA 1QE1B 1TK5A 3GV5B 1JLFA 3ASMA 3ISNC 3KLHA 4M41A 4B8AB 4K50A 1VSEA 3VQ9A 4RW9B 2O4IA 1ASWA 2CJQA 2GIQA 1RA6A 4EO8A 4M3TA 4CJEA 5L9XA 2E6LA 4RNOA 3D28A 4BWMA 3SFUA 4CEAA 3GIJA 5JS2A 2XGPA 1RAJA 2BQUA 1RTIB 2GV9A 4B9NA 3QEWA 1EKEA 5FROA 4ELUA 2D3ZA 5DG8A 4CEDA 4N76A 1TL1A 2JC0A 3M8QB 4KI4A 3KOAA 1BCOA 4FLWA 4I2QA 2HNYB 2JC1A 3C95A 3KLEB 2J6SA 1S6PB 4NLUA 2D7SA 4DU3A 1JXBA 4IG3B 1UOCA 3IN5A 4ZVEA 4KB1A 4WYLA 1LW2A 4QPXA 3CFPA 4CJ3A 3H59A 3CYMA 1WN7A 5KG1A 1QAIA 2E4LA 3SI8A 4C8OA 4Y2CA 1RBTA 4I2QB 1NK4A 4Z4CA 3KNAA 3KLEA 3NCIA 4ID5A 3KD5E 1BHLA 4MK7A 4IR9A 4EO6A 3AVLA 2ATQA 3PX0A 1NKEA 4O55A 1IKXB 5KFIA 2BE2B 4IH7A 4ED1A 2F96A 3NGZA 2HHQA 4DL4A 1TAUA 3VQ4A 4KHWA 5KG2A 1VSKA 4IH6A 2XO7A 4R8UA 1JLGB 3Q8QB 2AQ4A 4KHRA 4O3SA 3ZSVA 1VRTA 4BACA 4CJFA 5F9LA 5HROA 2LSNA 4Q44A 4CE9A 1Z25A 4ECSA 2IM3A 4RW8A 3ZSQA 3QLHA 2FBYA 1N5YB 3LP1A 3DLGB 3DYAA 4FK0A 1LWCB 1QTMA 3V1QA 3MEEA 4K4VA 1WLJA 2AJQA 1VK0A 3L2UA 4RW4A 5KFAA 3IS9A 2UVVA 2KW4A 3RB3A 4RNFA 1RDRA 3EZUA 3T5LA 3OSNA 3ZCMA 4ECTA 3PX4A 1XHXA 4JS5A 1SH2A 3K59A 2HNDB 4Z4HA 3PX6A 4DTOA 3BDPA 3QETA 2YNGB 4ZTFA 3H4DA 3KK3A 3FRZA 4EBEA 3LP1B 2IBKA 4F3OA 4XIUA 3S9HA 1HMVB 3AVIA 4KTQA 3K5NA 2HAIA 4F4XA 3L2VA 5J2MB 4CHPA 1D5AA 1X1PA 3G0ZA 4OLAA 3Q8PB 3A2FA 4KB7A 4AHRA 2G8IA 3U6FA 3RAQA 2ZQBA 1S1WA 3WNGA 3H4BA 3LP2A 3NH1A 3M8RA 4CF2A 3HO1A 2YNGA 5HLFA 3RTVA 2OZSA 3QIPB 3O4NA 3IRXB 1SKRA 1KSPA 5HRPA 1RDDA 3NFAA 1VSFA 2PY5A 4CFBA 4PWDB 3V6DB 4PUOB 4Q5VA 4ZPDA 3KD1E 4ED8A 3LANA 1JLBB 2IA6A 3MFIA 1A5WA 2V0NA 1N56A 5C24B 4CGHA 1S9EA 1XI1A 3LWMA 4W5RA 2X74A 1HYZA 3SUQA 4Q0BB 4FBUA 1NOZA 2W7OA 1I3AA 4CJ4A 3HK2A 4IBNA 5EWFA 3AVBA 4CHZA 5HRNA 4FJ8A 1RT5B 1T03B 4DMNA 4QW8A 2FBVA 4E1MA 4DL5A 3AO5A 4H4OA 2JEFA 3AA3A 1RT4B 4JRQA 5KFTA 2WB4A 2DFEA 4FZZA 3JSMA 4YR0A 1S9EB 2W9CB 4KFBA 3N6MA 4C8LA 3V9SA 4CJQA 1B9FA 2QKKA 4RUCA 4FJHA 4Y2AA 1C6VA 3GILA 4Z0UA 3BQ2A 3HJFA 4E19A 3FFIB 4CF0A 2OA8A 4CJWA 3M8SA 2J6TA 1T03A 1CLQA 1BI4A 1KFDA 4DL3A 2ZE2B 4KKOA 1UAXA 3NF9A 2JGUA 4FJMA 4MKAA 3T1AA 4EBCA 5DQHA 4OGEA 4CESA 4ZVHA 3QZ8A 3DRSB 3ICLA 4RNHA 2X6SA 1JLFB 4GC6A 1U04A 4DSFA 4ZPCA 3TABA 2VA3A 3SYZA 3L2QA 2OPRA 1RDBA 2HHUA 3VQSA 1Q9YA 3OLBA 2WK4A 3SV4A 1X9WA 2DFHA 4CECA 4Z4IA 1RTIA 5F8HA 5E41A 3SPZA 3NGDA 1HPZA 4E7LA 4Z4GA 2FVPA 1XR6A 5KFJA 1K6YA 4E7JA 3QEPA 4LSLB 3B6OA 3DRSA 2IMWP 2R8HA 3HVRA 1NJWA 3MFHA 5L1JA 3BSOA 4DTPA 2YKMB 1WAFA 3KLFA 1SH0A 2FBTA 1C1BA 3VQ5A 5KFXA 2OPRB 4B3OB 2D41A 4JUZA 2XC9A 3HM9A 3RMCA 1LW2B 2F8SA 1IKWB 3ZT0A 4O3PA 1KHVA 2C28A 1QSSA 3PO5A 1WNSA 4NLYA 4N47A 3OYMA 3UQSA 4TY8B 3K5OA 4IRCA 4OL8A 5HP1B 3CDWA 4Z4FA 1S1XB 5C25A 4QWDA 3NH0A 4CJKA 4FYDA 3B6PA 3KK2A 1IKXA 3TARA 4KPYA 4AH9A 3SNNA 3THVA 4M3WA 3V4IB 4Y34A 3ITHB 1KHWA 2PYLA 3H40A 3V81A 4JLHA 1HNVA 3WNHA 4CGIA 1HYVA 4FLUA 1RTDA 5J2PA 4OKJA 3BGRB 4OJRA 2FVSA 3N6NA 3AVGA 5HROB 4ZVGA 4K4WA 4LQ3A 1BQNB 3KK2B 5KFVA 5F8JA 4OKEA 3NDKA 3MEEB 2WONA 3FQLA 2E9ZA 1TV6A 1N6QA 2I1RA 1IKVA 1SUQA 3T19A 1X9SA 3DOLB 3RRHA 1KVAA 3OSPA 1RT7B 4WE1B 4I9LA 2KZMA 4TQRA 5J2PB 4EZ6A 4CF8A 1U49A 4J9MA 1LV5A 2BRKA 1S6QA 4URSA 3HL8A 3KLGB 4AHSA 1U09A 4WFZA 1SH3A 4FJGA 3VA0A 3DM2B 2IDOA 5DK5A 2FJWA 1B9DA 3KK3B 1ZBLA 2ITGA 1XR7A 1Q8IA 4I2PB 2AGPA 3CM6A 1N6QB 3CJ2A 4Z4EA 4TY9A 1TKDA 3PV8A 4QWBA 5KFMA 5KFBA 4IDKA 3QYYA 4ECVA 1D0EA 1NHUA 3I5BA 3ZSOA 1FKPA 4RW6B 1QSLA 3LAMA 3L8BA 2BQ3A 4IQXA 3DOKA 4KHUA 2RPIA 3DMJB 2XY6A 3DM2A 2RF2B 4CEEA 1DTTA 1UWBB 3D45A 5I3UB 1KCFA 4DTJA 3C6TA 4Q45A 4TN2A 2ATLA 1X9MA 4CJSA 4ID5B 3UPFA 1KVCA 4PWDA 2FVRA 3SPYA 3AVNA 4PUOA 3OYKA 2HWHA 4WZMA 2XCPA 3KKSA 4L8RB 1B92A 1FKPB 3VN5A 4PQUA 2EC0A 1L3TA 4Q0BA 4C8NA 2D0CA 4R8UB 2R8KA 4NLSA 3ZT1A 3MECB 3PW5A 2RF2A 4CERA 3V6HA 5KTQA 4NCAA 4DU4A 5I3UA 3PW0A 1R0AA 3VQPA 3LALA 1QQCA 2R8JA 3CJ3A 4W5QA 4H4OB 5C42A 1TAQA 3LP3A 3SJJA 3OYAA 2VWKA 2W9CA 4DQIA 3S3NA 4CHOA 4RW4B 3MR3A 4K4UA 2BDPA 4Q8FA 2QKBA 3ZSRA 5HRSA 3JYTA 1WSGA 1U47A 4UQGA 3NE6A 1WSEA 1C0TA 1HYSA 1BGXT 4KB0A 3VA3A 2HNDA 5KFKA 4NYFA 1BI4B 3MAQA 3OS2A 3TANA 3MXMA 1TK0A 2ZE2A 4J9QA 3OJUA 1JLQB 3NAIA 4HKQA 2B43A 3MR2A 4CJLA 2O4GA 3ZSXA 3CO9A 4MIAA 3KLIB 3TAGA 2DPJA 2XI3A 1JLEB 2BANA 2Y1IA 4KAZA 2YNIB 2E6MA 3RB6A 3HP9A 4FK4A 4O4GB 2W8LA 1HYSB 1EETA 3GV8B 1S10A 4NRUA 2B4JA 3PZPA 2Z1HA 3L3VA 3T5KA 5DMRA 4CHNA 5DQGA 1KLMA 4H4MA 3BSCA 4FLXA 2A1RA 3GYNA 3PHEA 4DTRA 1C1AA 3KLIA 3O4QA 1SKSA 4Y1CA 4URGA 2G8FA 3CJ4A 1JLEA 3OVNA 4O3QA 2EHGA 3T3FA 3DRRA 3G6XA 1K1QA 2YNFB 2YNIA 3UDLA 5C24A 4B9MA 4NLDA 3OYNA 2YKMA 3CWJA 4DQSA 4KTZA 2ASDA 5J2NA 1C1BB 1NJYA 4B3OA 5KRTA 1VSMA 3TQ1A 3E51A 4DFJA 4KHNA 5KT5A 4BDZA 4H4MB 4XPCA 5EUHA 1S1TB 3KHGA 2IM0A 4E7KA 4QCLA 4HCCA 4M3XA 3HXMA 1EP4A 4ZTJA 2IC3A 3MXJA 4RW7A 3RB0A 3RB4A 4J9NA 3KHLA 2EX3A 3V9XA 1NK9A 5EWEA 1GOCA 4I9QA 5I42B 3C94A 4HVJA 1NHVA 4ZHRB 1RT3B 4J2EA 1Z4UA 2XCAA 1HQUB 3OHAA 4O3RA 1RBUA 1XHZA 2GIRA 4ZP6A 1CXQA 3CJ0A 4TQSA 4F2RA 3O3FA 4DLEA 3PR4A 2AWZA 4AILC 4NLXA 4J9LA 1KFSA 3CQ8A 1NK8A 2PZSA 4KKOB 3ZT2A 2UVUA 5D3GA 4CGFA 4YFUA 1EX4A 4OPJA 4WYWA 4J9SA 3QINA 3OL6A 4KV8A 1BQNA 3RBDA 4IG0B 2HNYA 3NKYA 4HCBA 1FXXA 1RDAA 5K14B 4LY7A 1HQUA 3GQCA 2HHSA 1TP7A 2DFFA 4RG8A 5KFUA 4CEZA 1T3NA 4OPKA 1S6PA 4Y3CA 4FZYA 2KFZA 4IR1A 3EZ5A 1WSIA 3KLVA 2HMIB 1N4LA 2HNZB 4NCBA 3D0PA 1RTHA 2HHWA 1J9AA 5SWMA 3OY9A 2YHBA 4DSLA 3M9NB 4RZRA 3MEDA 5D3GB 3VQDA 3H5YA 3QEIA 4NLWA 1HPZB 4DS4A 2DTUA 4CJVA 4DL2A 2OH2A 3DDKA 4RU9A 2FJXA 4B9UA 4IG0A 4CK1A 4DTNA 1ZBHA 3KJVB 2C2EA 5KG4A 1REVA 3DRPB 2HMIA 3HKWA 2ASLA 5KFNA 4DG1A 2Z1JA 4BWJA 3V9ZA 3MF5A 1IKWA 4RW6A 2W9BA 3H98A 2D0BA 4G1QB 1NJXA 3MEDB 1WSJA 3DOKB 4NZ0A 3OYBA 4TY8A 4MH8A 5J1EB 1JLGA 4J2DA 2VG7B 3L2RA 3SQ4A 1J54A 3BJYA 2P1JA 3MTKA 4DEZA 1U48A 4NLRA 1DTTB 1UWBA 4Q43A 4CFDA 1GX6A 3OLAA 2RN2A 2XHBA 4C8KA 5KT7A 3BQ1A 4K8ZA 1CZ9A 3IAYA 3AVMA 3V9WA 3QLHB 4KTWA 5EU7A 1N5YA 2W8KA 3DLKB 1ZBUA 3AO2A 3CFRA 3V4IA 4PQUB 4DL6A 4F4YA 5JXSA 2WOMB 2WHOA 5J1EA 3SFGA 3AVKA 3BGRA 3U3YA 3HHKA 1RDCA 3OS1A 4KRFA 1R0AB 1QHTA 3AVCA 3I0SA 3VQ6A 4NLGA 5F8IA 4LQ9A 4B08A 1XC9A 1DTQA 4J9RA 3PJXA 4QW9A 2AX1A 3OJSA 5DGBA 1TV6B 2OZMA 3H5SA 1D9DA 3EY1A 4O44A 4HHTA 1RT7A 4WE1A 2G8UA 2HWIA 4M3RA 1HRHA 2R2SA 1L3SA 1C0TB 2AU0A 3TAFA 4U7CA 2FJVA 1BL3A 3KLGA 3LZIA 4CJTA 3I0SB 3K2PA 4NCGB 4ED3A 2YNHB 4DQRA 1U45A 1DTQB 3I5AA 3ISND 4FS2A 4CJ5A 5KFQA 4KI6A 3I0RA 4HTUA 4I2PA 2BANB 1SL0A 3C6UB 3QIOA 4Q8EA 3HVTA 4M3UA 2JEIA 4DFPA 1J5OB 3KTQA 1RILA 2KQ2A 4ZMMA 3RAXA 2ASJA 3KKRA 2I5JB 4OGCA 4FJJA 2IAJA 3D5MA 4KE5A 1VSDA 3P83D 3PVXA 2JLEA 3SV3A 1LWEB 4HUGA 4YR3A 3HVAA 1K1SA 3DMJA 1C0UB 3LPUA 3SUPA 4FXDA 4EBDA 4FZXC 5DQIA 1SKWA 3C6TB 3TVKA 3TAMB 4DTMA 4FW2A 1RBVA 1RT1A 3BR9A 3CIZA 4O0IA 4NLOA 3PW4A 3ZSYA 3M9MB 1FKOA 5KFSA 2YNFA 4ED0A 1YVUA 4FJKA 1NK0A 4FM2A 4CIGA 1VRUB 3LPTA 1ASUA 2GUIA 1W25A 1JLAB 4CJRA 1IO2A 1S1UA 3IGNA 3OYCA 3S3MA 4E1NA 5F9NA 3CDEA 2OPSB 1KLNA 4CHQA 3EPIA 1EP4B 4CK3A 1RT6B 4RW7B 2VG6B 1FKOB 4HUEA 2Y1JA 1XWLA 4KSEB 3AVJA 5L1IA 2O5DA 1RCHA 4BE2A 5EDWA 1ZBIA 1BCMA 2C2RA 1BISA 1VSJA 1OS5A 3FQKA 5T7BA 4DTXA 5FRNA 4O0JA 3OYIA 4ELTA 4JS4A 2FLLA 1TKTB 4CEBA 3JYTB 4YR2A 4W5TA 3PW2A 1S1UB 3E01A 4IOBA 1TKZA 1YVFA 1S5JA 4CIFA 1S0MA 3NGYA 2RDJA 4WZQA 3V1RA 1BQMB 3AVFA 2ETJA 4W5OA 1JLQA 3HYFA 5KT6A 3QGGA 4AHCA 4N41A 1SV5A 4H54A 4OLBA 3OS0A 2GC8A 1U4BA 4EYIB 4MQ3A 3AV9A 4M95A 4NLQA 5CZ1A 5K14A 3KMSA 3KLHB 3OL8A 2P5OA 1IKYB 3RMBA 2WCXA 5HBMB 4YNQA 1IM4A 4NLPA 2QXFA 3LWLA 3CVKA 4HYKA 1NOYA 1BQMA 1KLMB 2E9TA 4DQQA 3AA4A 2C2DA 2B5JA 1SV5B 2R2UA 1D1UA 2YHAA 3KHHA 2VA2A 2IOCA 3K5LA 5HRRA 3CDUA 1S97A 4FM1A 4ZVFA 4RUAA 3LZJA 1S1XA 2ALZA 4QOZB 4JV0A 3PY8A 4CGDA 5C25B 2AGOA 1LW0A 1ZYQA 4E7IA 1IKYA 5T14A 1NK7A 4YQWA 4O3OA 3K5MA 5KFLA 1REVB 3DRPA 2BR0A 3L2WA 4BE1A 3H08A 1YTUA 4MIBA 4FLTA 4FBTA 1NK6A 3GIKA 1S48A 4F3TA 5DGAA 3RBEA 4ECYA 4G1QA 1RBSA 5KG3A 4ID1A 5SZTA 3QZ7A 3V81B 1BIZA 4IFYB 1S1TA 3VQAA 4GC7A 1RTDB 2WTFA 2P51A 4X2BA 2G8KA 2G8HA 2YKNB 4KAIA 1S0OA 1JXLA 1NNDA 1T94A 4NLVA 2B6AA 2BRLA 3EPGA 1LW0B 5KG6A 4IRKA 5I42A 2R7YA 4ZHRA 1S9GA 2V9WA 4YP3A 3V9UA 1NK5A 5CYQB 1HNIA 1NJZA 4MK9A 4NYNA 2HHXA 1TQLA 1C1CA 3RMAA 3FDSA 3UIQA 2QE5A 4BDPA 2HVHA 3BQ0A 5KG7A 1SUQB 4EEYA 4FJ9A 1HJRA 4LD0A 4LH5A 2HHVA 1ZTWA 5F8GA 4K4YA 3K57A 4LH4A 4NYZA 2XY5A 1UA1A 3FSIA 3NMAA 2IJNA 1N48A 1S6QB 1KVBA 2VWJA 3VQQA 4DFMA 2R2RA 3OYFA 4E0DA 1TK8A 1L5UA 4I7FB 1LWFA 5KFWA 2NUBA 3M8PB 1MMLA 4K4XA 1HNIB 1DLOA 5L1KA 1LWCA 4M3ZA 3PO4A 1CSJA 2D5RA 4IKFA 3OYJA 4DSKA 3KHRA 3T5JA 3CM5A 2OPPA 4LSNB 2IJFA 2RKIB 4J9KA 3QIDA 4O44B 4K4ZA 1RT2A 3DLEB 4QWAA 3VQBA 1RTHB 1IG9A 1QUVA 3DI6A 3NAEA 5KRSA 1SL1A 4KHMA 4FVMA 5KFHA 4FK2A 4FW1A 2YNHA 4WXWA 3M8PA 2A1SA 2HW3A 2UVRA 4F50A 1UA0A 3BREA 1TGOA 1RYRA 1HMVA 1EXQA 1T7PA 2XI2A 2WRMA 2W9AA 3QEXA 2RKIA 4DF4A 3HVTB 5J2MA 1RT2B 3DLEA 2AGQA 5CYMA 1J5OA 4DG1B 4KO0A 2IAJB 3NF7A 2W9BB 1S1WB 4TYBA 4DS5A 2X78A 4CF1A 3G10A 3NF6A 3TAEA 3MR5A 3MECA 4FM0A 2ILYA 3NF8A 5FRMA 1ZETA 3IRXA 1TKXB 4AHTA 4O5BA 1I39A 3HPHA 3OL7A 4M42A 4R0EA 3TAQA 4DWIA 4FJ7A 4CF9A 4FJIA 2XRIA 4QWEA 1JIHA 3AA2A 3DLKA 3OYEA 1JL2A 4ECRA 4EZ9A 4W5NA 4BE0A 2QV6A 2PYJA 4F2SA 3Q8SB 4ICLA 4MFBA 1LAWA 1A5XA 4KREA 1FK9A 4H8KA 4M45A 1RNHA 4IFVB 3MEGA 3V6KA 1GOBA 1RTJB 5KFRA 1TVRB 2FLPA 1Q9XA 4N5SA 1RA7A 2GBZA 1RT5A 2OPSA 1I6JA 3RRGA 3VQEA 4CJPA 3HT3A 2RDIA 3UR0A 1RT6A 1QS4A 3MXIA 4NLTA 3AVAA 1WSFA 3WNFA 3PW7A 4F4KA 5F8NA 3O3GA 4TSXA 4ICLB 4MFBB 4M3YA 3SUOA 3RR8A 2VG5B 1JKHB 1ZTTA 1QAJA 1TVRA 3E01B 2J6UA 4O4GA 4PY5A 4FJXA 3HVWA 3NH2A 4CFAA 2R8GA 4CK2A 4NCGA 1KRPA 3H5XA 2AX0A 2UUTA 3F73A 4E89A 3VQ7A 3G6YA 1QSYA 4XO0A 4ECUA 3LP0A 4RNNA 3HP6A 3HSTB 1TL1B 3DRRB 5KFFA 3AVHA 1NKBA 5F8MA 4CEFA 3ALYA 4ECWA 3CG7A 2I5JA 2VG5A 4E3SA 1JKHA 3QNOA 3G86A 1J53A 4ECZA 5J2NB 4YMEA 4B8CA 2UUWA 3ZSWA 4TXSA 4GVMA 5DLGA 4JRPA 2ZD1A 1IH7A 3LDSA 5C5JA 4OVLA 4IRDA 3TAMA 3NBPB 3LP0B 2XY7A 4OKKA 4ECQA 2FC0A 4B9SA 2Z1GA 4O4RA 2XWYA 3Q8RB 4DSEA 1S1VA 4ECXA 2V4RA 3K58A 4CCHA 4U6PA 3BSNA 1D9FA 3KLFB 3PJWA 5CZ2A 2KZZA 1S49A 3IGVA 2ZKUA 4IKAA 2BE2A 3NGIA 4QAGA 1VSHA 4F8RA 1JLAA 4FJ5A 1KTQA 3HPOA 2FVQA 3ZT4A 3OYHA 5FDLB 3M9OB 4J9OA 4DF8A 4CFCA 3I5CA 3QESA 3P5JA
chains in the Genus database with same CATH superfamily
1EHWA 2MEWA 1D8YA 1Y97A 2BKOA 3CMES 3N28A 4P2MA 1S1VB 4CT9A 1DRZA 4B17A 4CBWA 2O3DA 3RBXA 1FNMA 2HLTA 2NREA 4X66K 1LAVA 1ASVA 2F4VK 1RWKB 2M9KA 1S5ZA 4NXNJ 3P5TL 1X4EA 3BO3A 1C1CB 3ENQA 4KBIA 5LMUK 3TX0A 2O66A 3EKUA 1TKZB 2MKYA 3MGJA 4MKBA 3OYDA 1PGZA 1TL3A 4R5PB 3I4PA 3ZZRA 4OHWA 2MY8A 2RVJA 2E66A 4OZ0A 1S7IA 4J2AA 3IO1A 2V5HG 2HURA 4W90B 1MU2A 3PKYA 1OPIA 2PMWA 3NG8A 5J2QA 4XPEA 1VQNS 4FSVA 3ZSZA 3L9ZA 3R3TA 3RGIA 2JDJA 1TYQA 4H03B 2OI2A 3KJVA 5GAGP 5KFOA 2L41A 5HBMA 4LSNA 1F60B 2VPZB 3A8JA 4DV2K 1F21A 2EBEA 1YT3A 2F3JA 2KXHA 4EP4A 4OIXA 2N7YA 2IDEA 4C23A 3RYLA 3QERA 1U0HA 4QR0A 3CFOA 2B5JB 1WBDA 2J9EA 4UOCA 5ETRA 1FDAA 3QO9B 4MTPA 4FLYA 1SKUB 2GO8A 2AMCB 3JTNA 1T9YA 4C1NI 4CJUA 3E3XA 2CVEA 2A3JA 4I67A 4ZP7A 4DUTA 3V6JA 2VYPA 4FLZA 4OJ3A 2WOMA 1QVGM 2X7IA 3CHWA 4KHPK 2MQ8A 4IFYA 4ZKAA 3PIPQ 3WX8A 1K73T 5HQMA 2DYAA 3O9SA 4CLKA 2WVEA 1R31A 1VRTB 4PXBA 2L9NA 2XLIA 4IOAL 3X1LB 2C2OB 3ENVA 4IOXA 2ZJRL 4BDYA 3LGNA 1Q79A 2QA4S 4CZHA 5DG7A 2OO4A 1RXOB 2A0FB 2NUHA 1FF2A 3VGMA 1ZAWA 2LDYA 3MM6B 4GVBB 1MN7A 1NZAA 1HQEB 3CF5L 1FK9B 1ZBFA 4K42A 3OTDA 2F8TA 3MEGB 1YDLA 3SQ1A 2QWQA 3IXQA 3IG1B 3KWIA 3PUFA 1XTZA 4IH5A 3DLHA 4JK8A 1TL7A 1LK7A 3EX7B 4K8XA 5F0UA 1NHKL 3HPGA 4M94A 4YDUA 3VMFB 4NI2A 2VZ9A 4GKKF 4JN4A 4OHXA 1SVDA 2E9RX 1WAJA 3IFRA 3GIRA 2O8BB 3V5RA 2JLFA 4YUDA 3SUNA 3EE9A 1U8WA 3AGRA 2P9LB 3B8HA 2W42A 2V68A 3O9TA 4KY3A 3CETA 3J80Y 2Q3SA 1CZBA 4GW6A 2PMZD 1RT1B 3SCXA 1S79A 3TYTA 2YKQA 2M4MA 3LOUA 1M5SA 4B9QA 4HH1A 2KB2A 4G1PA 4KO0B 2LYVA 5GAHU 2ZVSA 3MCSA 3HHLB 5L1LA 4H4KA 3MCPA 3DGPB 3P1GA 4A48A 1U6BA 4AHUA 2I7NA 2GGPA 1G15A 1VSLA 1XERA 1UZDA 3CXCM 5HMXA 3QBXA 4YHHJ 3UN3A 1O1WA 2LQ9A 1B0VA 5HP1A 3SI6A 2CGKA 3QMQA 4ZPBA 4FNIA 1YZ7A 2QLWA 2KG0A 4FCYA 3VGVA 5EXWA 2AYEA 3BSAA 1KAZA 3HZEA 4JV5F 3DLJA 5EX5A 1BE4A 1K47A 3ZNJ1 5JJBA 2WUSA 4OX8A 1W97L 3LO3A 1S9FA 4ZIVA 3PFEA 3GV7B 4DUZF 1YTAA 2NXJA 1QE1A 1BA1A 4ZVPB 1S4FA 1WEXA 3TEGA 2DGSA 4LR8A 3K0SA 3DLRA 3DU6A 4NZ6A 1T44A 3SZ2A 1Q86T 5D4PA 4CD3A 3GONA 1UTAA 2DEJA 4NWBA 4PRFA 1Z26A 3HHDA 2OYQA 3THWA 4JKGA 2KT5A 1V3RA 1WNEA 3HSZA 4OPHA 1RT3A 2JFDA 1WORA 4DV6F 5E0OA 3DXKA 4CIOA 2EG2A 4LSZB 3GV5B 2Q66A 2FF6A 2O8EB 1VK8A 2AZ1A 1VSEA 3A5LC 2P9KA 2GIQA 1R0CB 1D9AA 3CC2N 2QSWA 2DNOA 2ZWOA 2E6LA 3HD2A 3Q22A 2VJVA 5FROA 4LF8F 1XC3A 3RU0A 4FLWA 3BDEA 3WC0A 3C95A 2VL1A 2RRBA 1SJRA 2J6SA 3O4WA 2IBOA 3L7OA 4BRIA 4NLUA 5JVHL 3GL1A 1UOCA 3IN5A 1EKSA 3HKZD 4WYLA 2MSTA 4JI1J 3H59A 1PYSB 1IR1A 1YX2A 3CCRS 1WN7A 1QAIA 4XDDA 1XBWA 4C8OA 4Y2CA 1GT8A 3GJTB 1FTCA 1V5IB 4DUZJ 3KLEA 4ID5A 3NGTA 2P6SA 2AD9A 1TMMA 4EO6A 1U8SA 1NKEA 1MDUB 4IH7A 3FVYA 2HHHK 3QFWA 3WXJA 4ITSA 2HHQA 3VQ4A 5KG2A 3K5PA 4IH6A 1BOTO 3H20A 2QLXA 3VF6A 2EBGA 4IJAA 1EZZB 3FCWA 4K0KF 1KXPA 4IYQA 3WC2A 2FXUA 1VRTA 2MDAA 2ZM6J 1KD1O 4PQAA 5F0WA 1G3OA 4ECSA 1XMBA 4CO4A 1NG9A 3QLHA 2HWTA 3LP1A 2ACYA 1S22A 1RHMB 4NLCA 3V1QA 4UY8O 3C6AA 4CLUA 1S12A 5D4LA 1G7CB 3RB3A 4RNFA 2QA4G 3HZGA 4ZLJA 3PX4A 1VQ7S 3N9UC 5LXYA 3AJ2A 4LUBA 4Z4HA 3C6HA 1YJ9N 5K5MA 2VPWB 2YBVA 3DRYA 2E1RA 1HMVB 5AR0A 4KTQA 1N32K 3FKBA 5J2MB 1VBKA 4XAKA 4E8UA 1D5AA 3Q8PB 3SCKE 2G8IA 4X84A 3VR1A 3GE9A 3UCZP 4B3SJ 1M0SA 1S1WA 1SI9A 1X5OA 2E5IA 3HO1A 2UYTA 5HLFA 2OZSA 3W66A 4LR9A 1VLOA 2DH9A 4OV1A 1N8RT 3IRXB 1KSPA 2P9UA 3W1YC 2C3YA 3TTCA 2FZKB 2Z57B 4IOCL 3V6DB 2A3ZA 2IVOA 4Q5VA 4HWIA 3FBEA 4ED8A 2GS8A 4WP9A 1A5WA 2V0NA 1N56A 5C24B 1KNZA 1XI1A 2MLXA 4WU2A 3LWMA 4JAXA 2DXEA 4W5RA 1WHYA 5CABA 1SJQA 4QBUA 4FBUA 2W2PP 3BBCA 1DQ9A 4P7VA 1I3AA 3A4TA 2H3GX 3VOVA 3VV2B 4CJ4A 1RP5A 2QWOA 3EJMA 1BA0A 4BR4A 4DMNA 1NSKL 4QW8A 4QQBA 3VHQA 2BE9B 2Z0GA 3MM7A 4H4OA 3AA3A 1RT4B 2XSJA 5KFTA 2WB4A 1EO1A 3U8XA 1S9EB 4KFBA 4CJQA 2XZTB 1MWYA 5IS2A 4Z0UA 3MMVA 3BQ2A 4EMDA 4E19A 1PJ5A 3G87A 2GVZB 2OA8A 2VFSA 4JKCA 1QVFR 1BI4A 3HI0A 2PDAA 4DL3A 1UAXA 3M1VB 1BHNA 3CCTA 3RG6A 1U7LA 4EGLA 4C9DA 4JKGB 4GNIA 4PG7A 4DR3J 4ZVHA 2K3KA 3DRSB 4OZLA 3PYEA 2ZHBA 4RNHA 2X6SA 3PKMA 1JLFB 3H45C 4DSFA 3TABA 2VA3A 4ZCIA 2NZ4A 3U1NA 2OPRA 1RDBA 3R7NB 1HI0P 1HBUB 1Q53A 2LDIA 3VQSA 1PAEX 3FCHA 4X4OA 1Q9YA 1W2BM 2V94A 1U1PA 4P74A 2E7WA 4CI0B 4CECA 3D1OA 1Q8BA 3SPZA 1HPZA 2HEKA 5KFJA 1VQLN 1K6YA 1YG0A 3MX2A 3QEPA 2AJ0A 3MFHA 2X1GA 5L1JA 2PD1A 4DTPA 1PBAA 3ZTRA 2PEBA 1VQMS 1T6DA 4BY9C 1C1BA 1LNQA 1N33J 2XC9A 1IKWB 2HGMA 3ZT0A 4O3PA 1KHVA 3Q8UA 2C28A 1WNSA 2CDRB 4NLYA 2ZKTA 4P71A 1EQMA 3K5OA 3HHLC 4TY8B 4BG9A 2CYYA 4YY3K 1XN9A 2OFGX 3LH2S 1WC3A 5HP1B 4N8NA 3CF5Q 4Z4FA 1GMWA 3Q2TC 5AQMA 1S1XB 3PJ9A 5C25A 2QLBB 3Q89A 2YHYA 5L8RC 4KH4A 4PXEA 3KK2A 3Q0AA 3TARA 4KPYA 4AH9A 4ZPVR 1WACA 2YTCA 2G0JA 2Z2ZA 3WXIA 1E6VB 1P1LA 3H40A 1XMOJ 2ROGA 1RGVA 4OKJA 4OJRA 3A0IX 2HGNA 4J9UE 5GAGU 4ZVGA 4CLSA 1HR0F 4UOHA 4LQ3A 2DGQA 1EKRA 3DXKB 4J8FA 5G0RA 2AF6A 1TV6A 1URNA 3JAMU 4WTYA 2JZ5A 5IWAF 2GV1A 3OSPA 1RT7B 4WE1B 4PEOA 3VZIA 2P9EA 4FWPA 5J2PB 1XUPO 2KDOA 3SLCA 4BC9A 1U49A 1P6TA 4J9MA 5DZ7A 4ZVQB 4F3MA 3HL8A 3KLGB 4AHSA 2UXBK 3ETOA 3VA0A 2GUPA 5A8KB 3T6JA 3K89A 2CNKB 4DDFA 5DK5A 1QAXA 1B9DA 2DNPA 1ZBLA 5BR8J 2CGLA 2DIUA 1R89A 1Q8IA 1N5QA 4FYXB 3TU5A 4FPBA 4F26A 4JV5K 5KFMA 1VBZA 4ECVA 1I51B 2ASMA 4QIGA 2HRUA 2HS3A 3I5BA 3P8BB 1HL6A 1HKBA 3CTRA 2CDQA 2CQ4A 4IQXA 3DOKA 3IWLA 3T1YF 2R7SA 1FRJA 3GFHA 2APOA 1RU2A 2AV5A 3DM2A 2OUGA 2RF2B 4CEEA 3MCAB 4KRWA 3D45A 4OV6A 1KCFA 4TN2A 3BYRA 1X9MA 4CJSA 3UPFA 1KVCA 3TOQA 3SPYA 3AVNA 3AODA 3F0NA 2B8QA 2HWHA 3IP0A 2XCPA 3TTDA 5F3TA 4LIWA 1ZC6A 1Q1KA 2VU5A 3FBBA 4RKUC 3WQTA 1WOSA 2OTLN 2EC0A 2DNYA 4I6WA 4R8UB 2PA8D 2J4RA 3IR5B 2H4WB 5HAOA 4X65K 3C8YA 1JMTA 5KTQA 1RB0A 4NCAA 4DU4A 2EXUA 1LXJA 1N5SA 4Y6IA 3VQPA 1QJHA 2D0PA 2R8JA 3CJ3A 4W5QA 2VHGA 5C42A 3FR0A 1TAQA 4JI8J 1Q0NA 4O8UA 1FE4A 3I33A 2G0CA 3AOCA 2KHOA 2QA1A 4ZOSA 5ETTA 3Q7CA 3VA3A 5LOQA 5KFKA 2G1HA 3MXMA 5ETMA 2RSQA 3VF0B 2MPUA 1TK0A 2ZE2A 3OJUA 1X4DA 3TZXA 3MR2A 1YRUA 2O4GA 4CJLA 3A3PB 2A2DA 4P72A 3O1WA 2DPJA 2V2VA 3KG1A 2BANA 3B4MA 3O2IA 3POTB 1DARA 4PYAA 5D6GA 3O44A 3US5A 2KXFA 5BPMA 3MM8A 2YNIB 2KYXA 4H0XB 3RB6A 2V8VA 3HHLA 2IRUA 1WKKA 5J1NA 4KGKA 4N8OA 3MMBA 1HYSB 1U2RA 1EETA 4QZVB 1S10A 3PZPA 2Z1HA 1PJ7A 2I38A 5IQQA 1DFDA 4YB7A 4FLXA 2ZM6F 1VBYA 2E1YA 2LCWA 4NZ7A 3W3SA 5GAEU 3KLIA 3O4QA 3IBCB 3CJ4A 2QC3A 4O3QA 3OXLA 3MOJB 3HSCA 1KR4A 3FZHA 3NGSA 1DGKN 1CJUA 3F41A 1VBXA 3Q83A 1NJYA 1VDHA 4MYUA 3UR3C 4XK8C 5KRTA 3FNNA 1NGAA 4LF7K 3J81O 4KHNA 5KT5A 4H4MB 4QPTA 1YIJN 2F5GA 2B56A 3QWUA 4L3KA 2W6LA 5GVQA 4KGZB 3KUGA 3EM1A 3LGHA 1WF2A 4RW7A 2NRHA 4JYAF 4K2XA 3RB0A 4DCPB 2EX3A 1VJWA 1NK9A 3C94A 3TSPA 4FWMA 3JTOA 1H98A 2XCAA 3M8WA 1NGCA 3FZKA 3KDNA 4ZP6A 1CXQA 3CJ0A 4TQSA 1CEZA 2V2QA 2B51A 1WB9A 4DLEA 3TA0A 3HHEA 4NXNK 4J9LA 1NK8A 3CQ8A 4RBTA 1NDKA 3QJPA 1EX4A 4Q2LA 4UTGA 2E1ZA 1NEEA 3IAM9 3RBDA 4HCBA 4LY7A 2COLA 5D15A 1LXNA 3L4BC 5AQJA 2V2KA 2KFZA 4FZYA 1QVGR 1WSIA 2XS2A 2HMIB 2ZBQA 4USWA 5AQNA 5LL6Z 2F63A 5LSRA 2F7VA 2YHBA 4DSLA 1VGYA 4RZRA 5D3GB 5AXNA 3QEIA 4NLWA 1HPZB 3TRGA 1BQXA 4Y2KA 2HFZA 2OH2A 1NGGA 2FJXA 1I3OB 3IBWA 2LA6A 1RHJB 4I1TA 1ZBHA 4M5LA 3DRPB 3OTOK 3DC2A 2ASLA 4IJNA 4FWSA 3MF5A 1IKWA 1HWKA 3QFHA 4G1QB 3EWGA 1DJ0A 1FJGK 3R2DJ 1SS6A 3DOKB 3OYBA 5J1EB 3U02A 4J2DA 2VG7B 3L2RA 3SQ4A 4ILGB 3MTKA 2AJ2A 1DTTB 1UWBA 5CQGA 2KKZA 1FO1A 2NXNA 4J7CA 2XLJA 3UD4P 2PE8A 3IAYA 2GQCA 3V9WA 3UVJB 2VGMA 3UDVA 3QLHB 3MEKA 2D9OA 2XMJA 2W8KA 5JVHQ 2NZTA 4HLBA 1W7WA 3AO2A 2HHHJ 3VCDA 4M5MA 2RE2A 3SFGA 3AVKA 3ZTSA 1U1RA 3U3YA 4G6VB 3OS1A 2FZCB 2HYIB 3RAMA 4DI6A 1HPMA 3SDEB 1QHTA 3ZO7A 1ZA1B 1WBBA 3WXMB 3I0SA 4NLGA 4B08A 4J9RA 3PJXA 2ZH8A 4ISGA 2AX1A 3OJSA 2UXCK 4H0VB 5DGBA 1AFIA 1VQ8S 3BPSP 2HK3A 5G0RB 1XMQF 3CJ8A 2QL7B 4K59A 2F4VF 2Y8WA 2DNHA 4QR2A 3BP8A 4HHTA 3EGNA 1RT7A 4WE1A 2G8UA 4M5HA 4M3RA 1OYEA 4BVOA 3I82A 4ZIWA 4DV6J 4DKWA 4NL5A 4BC4A 1ZBTA 2FJVA 2JWLA 1BL3A 1WC6A 3KLGA 3PHTA 2XWXA 4NCGB 4ED3A 1U45A 2WW8A 1TUUA 2Z2MA 4FS2A 2P9UB 1MROA 4KI6A 3I0RA 3JQMA 4I4BA 2BANB 4USJC 3POTA 4OI1A 4USIA 1J5OB 4CLFA 4OGCA 2MQQA 2I5JB 4FJJA 4DX7A 3D5MA 2Y8YA 1WELA 4CZCA 3P83D 3CCUN 4ZPTR 2NXCA 4R0JA 3EVOA 2ZJQQ 1C0UB 3AA9A 3SUPA 4CP5A 4FXDA 4EBDA 4NE9C 4DTMA 4FW2A 4CZLA 2HVEA 4F0HA 4I56A 3CIZA 3FBFA 3PW4A 4X4QA 5KFSA 2ZH6A 4A8OA 4CYUA 2YNFA 2YQ3A 3BGOP 1YVUA 3Q23A 1V9OA 1HWLA 4ATNA 3LPTA 1JQGA 4LIRA 2QYGA 2GMHA 3QNWB 3R9LA 1FCAA 3FZBA 1JLAB 2CH6A 1SIWB 2YQ0A 3IGNA 3OXFA 5AQOA 2LMIA 1B70B 2E29A 2KN4A 2U1AA 2NQPA 1NNEA 4Z7YA 3PIOQ 2VF3A 1VCTA 1QY7A 4RW7B 2Y1JA 1FKOB 3CD5A 4KSEB 4H5RA 2Z2YB 3FSXA 4K0KJ 3M2UA 3CB4A 9ATCB 5HMZA 4ELTA 1N34J 2FLLA 4JS4A 4I6AA 5CHCB 3I56S 1S1UB 3CPEA 1S5JA 3IR7B 4CIFA 1FX2A 2W2NP 1S0MA 3NGYA 4WZQA 2KRBA 1LKZA 2B9XA 2MZTA 1YJWN 3AVFA 1N5VA 2ETJA 2MZSA 3B4DA 2LQ8A 3N4QA 3AQPA 3QGGA 4N41A 3C3LA 4IEIA 1SV5A 4H54A 3AV9A 4M95A 5AJ3F 5CZ1A 3SCLE 4QIVA 2IFXA 5D4NA 2P5OA 3HMJG 1IKYB 1H1VA 2R42A 4GKKJ 2OD6A 1IM4A 1KQSM 4NLPA 4ZCKA 2QXFA 4E2FB 3LWLA 1BWEA 1BQMA 5D0EA 2ZC4A 2YH0A 1R8BA 1KLMB 1VHIA 4DR5K 5BPLA 1PC5A 3VAMA 2E9TA 1Q5VA 2B7CB 1NGIA 2B5JA 2Y0SD 4I69A 2YHAA 2IOCA 3CDUA 3RW7A 1S97A 3IM9A 2OTJS 4UY85 2ALZA 4JV0A 1YHQS 4PKIA 5IZHA 2BM1A 4DV5J 4E7IA 5T14A 4YQWA 3HSDA 3OW2M 3DRPA 4K41A 4C4WA 3H08A 1XNQK 7FDRA 3S6EA 8ATCB 2QEXS 2KL8A 1E6VA 3RBEA 2K1RA 4XH4A 4ID1A 3QZ7A 1X9JA 4IFYB 2G8KA 3GSIA 3ULHA 1NBEB 3GCXP 2QIFA 2B6AA 1EJ7L 5IC4B 2QWNA 1LW0B 2R7XA 4M1KA 1S9GA 4YP3A 4OYWA 2AEFA 3MPDA 5IM0B 1KKHA 1NK5A 2QTDA 5CYQB 5D0RA 2J7KA 3BF1A 4CH7A 3FZMA 5LJ3Y 3S41A 4NYNA 2HHXA 2BZ2A 1C1CA 1U2CA 3FDSA 3UI3A 2Q6BA 2F9DA 2NS1B 2OKQA 5H9FK 1GEHA 4EEYA 3ZEUA 1A9NB 2I0XA 4X4PA 3FSIA 3GWCA 2IJNA 1SJFA 1KAYA 2DR5A 2VBWA 4ES1A 5KFWA 4IOAQ 4K4XA 1GTHA 2QMUB 5L1KA 1LWCA 1VRQC 4M3ZA 3PO4A 4IKFA 4LRAA 3HX9A 1SJ1A 2OPPA 2DRAA 3BGUA 3QIDA 4WU3A 4FOIA 4K4ZA 3DLEB 1RLCL 4ZDNA 3J80U 4L73A 4OHYA 3UKUB 5AZJB 1SL1A 4FVMA 5KFHA 2P9IB 3QB0A 3D0IE 4FK2A 4FW1A 5M1FA 3CCVN 5GIOA 1O51A 4FVCA 3CCLS 2GX9A 2UVRA 3CCQS 1UA0A 3BREA 1MROB 1TGOA 3AJDA 3CCQN 3WEEB 1HFEL 4R25A 1NMEB 1HJOA 2RKIA 3E8OA 2GHWA 1ZM2A 2N4DA 2NLXA 4KO0A 3P3DA 3R97A 2JJ4D 4L75A 5B0DA 7AT1B 1EWQA 4CF1A 2V8HA 3TAEA 3PACA 3MR5A 3MECA 4FM0A 1SJ3P 2M7SA 1ZETA 3CMAS 3HPHA 1I39A 4O5BA 4N77A 2FHKA 2E5LJ 3P5BP 5IV3A 2ZH7A 4WWSA 1ITPA 3UVJA 2XRIA 3AA2A 4CYUB 4CH1A 1TTHB 5HI7A 3ZZPA 4PG6A 4LRFA 1JL2A 4EZ9A 4W5NA 2RH3A 5MLCQ 3Q8SB 2Y3YA 2IJRA 1VFJA 3L09A 3LM9A 4KREA 1FK9A 1YTYA 3MEGA 3TJ8A 3A8YA 1TVRB 2CQCA 1U26A 4CLYA 3AOAA 1KONA 2OMOA 2GBZA 4DV1J 1RT5A 3D2FB 1I6JA 5L9NA 5GAGI 1R59O 1KEKA 3UR0A 1RT6A 1QS4A 4FKXA 3AVAA 3WNFA 3T1YK 1HLWA 4DUYK 4P2XA 5L38A 2J9DA 2H5JB 4ICLB 4MFBB 2MQLA 2R7TA 3ENBA 5AQQA 5ITHA 1HBNB 5D78A 2XQCA 1JKHB 3CD7A 4A5AA 1ZTTA 2QL5B 4PR6A 2MQPA 2Z2LA 2O8FA 3HVWA 2YWKA 3NH2A 2RE1A 1CJTB 3UD3P 4NCGA 3G9CA 2BTFA 2CNLB 4B02A 4AT1B 3HFVA 3F73A 2IA0A 3D6FB 3CI5A 3KG4A 1J5EF 3CD6S 3HP6A 2UXBJ 4CNYA 3JB9k 5KFFA 2MSSA 2FC8A 1NKBA 3CCSS 5F8MA 4ECWA 1T9TA 2MKIA 2I5JA 2A10A 4E3SA 3QNOA 3E9LA 5HATA 3NNAA 4M7XA 1X3MA 3QSIA 2X1AA 2UUWA 2LKZA 2ZBIA 4TXSA 2BA9A 5DLGA 3ENOA 3ZSWA 1IH7A 3LDSA 4OVLA 4IRDA 3VGTA 3NBPB 4NXMJ 2WSEC 4DV6K 2ZOGA 1RWOB 1RAHB 2QG9B 4O4RA 2XO6A 1N34K 4ECXA 3RBZA 4OI2A 1QTNB 1N88A 2ZGYA 5CCMA 3SSRA 3NGIA 4QAGA 5A2QU 3WIVA 2R4FA 3PEJA 5LJVA 2MHNA 4X65J 3CC7N 4P75A 1YITN 2F1FA 4DF8A 4CFCA 2WFBA 3I5CA 1BWVA 3FJ2A 4TU7A 2YKNA 4HT5A 1NSQA 3HF5A 3OVSA 1RYSA 1WG1A 1RBRA 3ATUA 3UFCX 2MQOA 1MU2B 3BYPA 4CLPA 3OYLA 4KV8B 1WHXA 1OIAA 2RHKA 2R7OA 5J2QB 2DBBA 5EWGA 5CYQA 3WIUA 3AJ1A 4DXLA 1S0NA 1TKTA 1Q86O 4H0TB 4DV4J 4DQPA 5IFMA 3IS9B 1W9HA 3MPVA 3R6LB 1NGDA 1TR0A 3CC4N 1KWMA 4K2JA 3I31A 2DNRA 1WI6A 4LF4K 4F02A 1FRKA 3PFOA 3D6TB 3QAEA 2YV0X 5HQ8A 1N8RO 4PPDA 1K9MT 2ACMA 4WFAQ 1SC6A 4I7FA 3VQ8A 3O6WA 2IPOB 4TLRA 5LXRA 1DLOB 3UDEA 5IWAK 1ITGA 4B9TA 1CJKA 5KFEA 4ISEA 5B0EA 1RK8A 2CIMA 2DNMA 2QMWA 1IKVB 1VHFA 2YJEA 2HB5A 3DOLA 2DITA 2C3MA 2HFUA 1OQ6A 3AO1A 4ID8A 4DR3K 5LMNF 4DU1A 2VG7A 3CJ9A 4LMZA 1UVMA 2LXUA 3KIOA 3UN2A 1AUDA 3OVAA 4CZJA 5KG0A 3GG4A 1O5JA 2W2QP 2BBEA 4NXNF 3V6DA 1T05A 1C2PA 4JI4J 1PCAA 3G6VA 1VSIA 5AT1B 4YS2A 1BU6O 1O0PA 3QGHA 3MM6A 4FN5A 1VQPS 2HBMA 2KTQA 4RU2A 4BG8A 5EOYA 2FJDB 2VV5A 1U2VA 3TR8A 1T0TV 3NNCA 4OX7A 4N56A 4DLGA 4USTA 2XY8A 2B6AB 4C0BA 2P9GA 2VQEJ 4FOEA 1JX4A 5B0AA 3NHGA 4GKJK 4WFXA 2P5GA 1S9GB 4I0WA 1JXEA 3D4JA 3LA0A 1S0VA 2KFNA 5A8RA 4WFNL 4KFBB 2VC0A 4N7TA 4USHA 4CEQA 2AYGA 3QNNA 2F7TA 5KT3A 1EQYA 1YJ9S 3ZTOA 5IT9U 4OYOA 4ZN1A 3N5BA 4J2BA 1KTVA 4J9PA 1N33K 2OMLA 1GMWD 2GHPA 5KFZA 3D3CJ 2FBXA 3G96A 3AO3A 1U25A 3DDIA 2OEMA 2QO3A 2RAQA 3I0RB 3S7RA 4PABA 3KK1B 5K20B 3FLCO 2ZVIA 3C6UA 2OPPB 4MAKA 1SL2A 1C0MA 1EWRA 1M1KO 2YCHA 1R0BG 4DV4K 2HVIA 1XR5A 3NWGA 4OZ2A 2HHHF 3PYDA 3MUVP 3CJKB 3D0GE 5AZJA 4NLBA 2XGQA 5HLFB 2HFNA 4JI4F 4LBIA 2Z1IA 2ASYA 1YI2S 5IT9Y 4DR7F 2OLWA 3CE8A 3P38A 4CGJA 5DDPC 4OHVA 2GWJA 5HMWA 5JUMA 3NGKA 3B6BA 4ZP9A 1A5VA 3H5UA 5F8LA 4DX6A 2D4WA 2FHJD 3VQCA 2KG1A 1JJ2M 3R5GA 4KHQA 2FVCA 5KFPA 2Q3PA 4WCEQ 4WQ4C 4TYAA 2GELA 2ZHOA 3FZFA 4DU8A 1CULB 1JLCA 3GU0A 1OH7A 3QRQA 2LEAA 4FKYA 4WFBQ 1KBRA 3RWUA 1JNZB 4K5RA 1RT4A 4LF7F 4E98A 3F9KA 5KFYA 2OPQA 3W65A 1Y5LB 2Q0RA 4B3RK 4KC5A 1FKAF 2RU9A 3W9HA 4G3IA 4P2SA 2AW0A 4FJNA 2QT7A 3W62A 2J8SA 2X1BA 4LBPA 2D0AA 4EP5A 2YHWA 3R7SB 2CKWA 1CXUA 4YORA 4CHYA 3PRDA 5HJYA 1VQ7N 2R7UA 1W0HA 3AA5X 3NGUA 5JS1A 4WF9L 5H1SV 4CO1A 4J37A 2C2NA 2H65B 3D2WA 1TK5A 5GMKa 1JLFA 2Q31A 2DH8A 1YBUA 3VPZA 4K50A 1APSA 3VQ9A 4RW9B 2O4IA 3M6WA 1HNXJ 2FHJA 4CJEA 2H51B 2M5YA 4BWMA 2E5JA 3SFUA 4CEAA 5JS2A 3DXMB 4B9NA 2GV9A 2WVFA 3PLAA 5DG8A 4DN0A 3M8QB 4KI4A 3KOAA 5CXTA 1BCOA 1S3XA 4I2QA 2OD4A 2DJWA 3OQ2A 4AM6A 1BMQB 4Z7CA 4AM7A 3CEDA 4EK2A 4EIAA 3F56A 3MI7X 4ZVEA 3K7RA 2HBZB 4KB1A 4Y2MA 1VC6A 1ZBSA 4CJ3A 1AW0A 1U0SA 1G4CA 2MZQA 2FIUA 5H9EJ 5H9FJ 2BE7D 2YX7A 1KC8O 4LRCA 1WOQA 1DZ5A 2YX6A 1XNQF 2YPYA 3KNAA 4RBUA 3SQGA 1JJ2R 4IR9A 4ZPWR 5GAHP 5AQVA 1B3TA 3PX0A 2C42A 3OFGA 4O55A 5KFIA 2CA9A 4ED1A 2F96A 3A5NC 4DL4A 1SJ4P 4KHWA 2XO7A 4R8UA 2OFHX 1JLGB 1X4CA 3Q8QB 3TPQA 2E8AA 3AB2B 1F9FA 3S8SA 5F0XA 3ZSVA 4CJFA 4IQMA 2BJEA 2GIFA 1YJ7A 5I4MA 2CWXA 3ZSQA 1S99A 2V67A 1GMUA 2FBYA 1N5YB 4U8YA 2RIJA 1OYDA 4YB5A 5T7LA 1LOTB 4NEZA 8AT1B 1VK0A 2NRVA 3L2UA 5KFAA 2UVVA 3IS9A 1N36F 1Q78A 1T3OA 4RLEA 1B4SA 2G2ZA 4QIWD 1JJ4A 2LQ5A 1S76D 2EK1A 4FL9A 4DV4F 5AQGA 2HNDB 3PX6A 4DTOA 5I3PA 2GW8A 1RQ0A 2IBKA 3IR6B 2XHWA 3AVIA 3K5NA 4CZGA 3MD1A 5BR8K 3MM8B 3A2FA 4JI2J 4AHRA 5K9FA 3RAQA 1WWHA 4M5GA 3J7ZO 1F9EB 3H4BA 3EZOA 3NH1A 2YKPA 2Y0BB 4FF1A 4BR2A 2JH3A 1P1TA 3RTVA 4M63C 1FJCA 5JLFA 1SKRA 3NFAA 1VSFA 3W5ZA 2CQBA 1SC3B 3RZAA 3W2VA 1H74A 2MXYA 2CG8A 3KD1E 1NGJA 1JLBB 2HQDA 4CQ1A 1IWAA 3GPAA 1S9EA 1WUUA 1NMDA 4DL0C 4OFZA 1UJ5A 4O8KA 3J7ZT 3CCRN 2GVZA 1N54B 3V2UC 5EWFA 4QS8A 3O80A 2PBDA 1CULA 4MLHA 2RILA 2V34A 2QW9A 3AO5A 4B1VA 1S7HA 3VVTA 3VGKA 2DFEA 1CG2A 4FZZA 2HFVA 4U7UK 1FEEA 4C8LA 2D0OA 2NNWA 1B9FA 1GNKA 2QKKA 4RUCA 1C6VA 3HZ6A 5KPRA 3HJFA 3G82A 1F2HA 3VTIA 3ISZA 5LMNJ 4ILLA 1T03A 2N3LA 1KFDA 4M63A 2F9TA 2ZE2B 4KKOA 4OI3A 3NF9A 1RGIA 4A2BA 4DCHA 1NDLA 2HFOA 2WSFC 4OX6A 2P9SA 2QFJA 4B3SF 1C4AA 2GWKA 1Y00A 3FFKB 1U04A 4ZPCA 2CQGA 2BJ8A 4DR6F 5AE3A 2V4JB 1NPPA 4UOGA 3DXMA 2DFHA 3VGUA 5F8HA 5E41A 2AYMA 4Z4GA 2L08A 2FVPA 2JSXA 4E7JA 3DLLL 1ZH5A 2DR9A 4DB3A 3HVRA 2CQ0A 3OHRA 4NYPA 2UXDK 1KC8T 3VETA 4A47A 1WAFA 5BYSA 1SH0A 1Q7YT 3J7AN 3BO2A 4A62A 5KOWA 3I32A 4JUZA 2E2PA 3RMCA 1LW2B 3C19A 3MWBA 4JI3F 3QFUA 3OYMA 3LDQA 4XDCA 3EGWB 3J7AP 4CO3A 3HFKA 2AZ3A 4OL8A 3ZFVA 4QOTA 4U8VA 1H3DA 2UUBF 2GHVC 1GAOA 2ZJPQ 4NASA 3B54A 4CJKA 4FYDA 2DO4A 3W5YA 3PDNA 1EX8A 4KBOA 3U9ZA 2DTJA 3DRXA 1IKXA 3ID6A 2E5LF 2AP1A 2PFFB 2VPYB 4K8RA 3IDHA 4Y34A 1AA1B 1VQ9N 5GAEI 4A8WA 1HNVA 3WNHA 1HYVA 2FSJA 3CCES 1UVJA 1RTDA 5J2PA 2PFUA 4WK3A 2VONA 4WQ4A 3N6NA 3DAWA 4C11A 4BQLA 4DR4J 3WXKA 3C16B 1U1OA 1QHAA 4RL1A 2D69A 2LEPA 1RAAB 2XM3A 1GLJO 4OKEA 3FQLA 1N6QA 4K25A 3U7JA 1SUQA 2IVYA 1X9SA 3VEWA 2D1KA 3DOLB 1KVAA 3PNIA 3H42A 2Q1NA 3BY5A 4TQRA 3MTJA 2W6KA 1LV5A 2BRKA 4Z37A 1S6QA 1ZXOA 2AKWB 1TUYA 3MN5A 3O9UA 1U09A 1SH3A 4YOVA 1WG5A 2OJ3A 2FJWA 3KK3B 4JV5J 3F44A 3KJFB 1XR7A 1W26A 2QGFB 2JRSA 3CM6A 4Z4EA 1TKDA 5AQKA 3PV8A 2UXDF 1RTZA 5KFBA 2L9DA 2HOEA 1ZPWX 4HACA 3ZSOA 2CPIA 1H0HB 1G6BA 3J7YU 5AZIB 1GLLO 3SMPA 5C10A 2IVFB 3LAMA 3L8BA 2UUAJ 3WZ0A 3I4HX 1ZPVA 1FDNA 3JS9A 3DGVA 1WHVA 4RCHA 2IMOA 2XY6A 3THTA 1DTTA 1UWBB 4B3RJ 1FJGF 4Q45A 2ATLA 2LQBA 1PILA 4PWDA 2HPUA 4GV9A 4UT4A 2QA2A 5A6PA 2D9PA 2QSFA 4L8RB 1B92A 4HTLA 3VN5A 2HQGA 4DR1F 4GVBA 1L3TA 1PKUA 5D0HA 2E5GA 1NAQA 2HGLA 2YWGA 4NLSA 5HSPA 2XMVA 3PW5A 4FF3A 2NRTA 4BRLA 4CERA 3V6HA 5I3UA 2YQ1A 1HUXA 4FVUA 1UAWA 2P6TA 1QZ5A 5A0YA 1QQCA 2A1BA 1TFWA 1KAXA 3SQOP 3SCJE 1REGX 2J8AA 2O1PA 4MJKA 1JB0C 3EUNA 1HNWJ 3LP3A 3QMLA 3OYAA 5THWA 4DQIA 2H5EA 3H0PA 2H1YA 2KKHA 4YN3B 4BC2A 3QFPA 3R27A 2D3O1 3JYTA 4ZLLA 5EX3A 3F9MA 3VF2A 4JI5K 5G4DA 2OTJN 3M30A 4YY3J 4UQGA 3MX5A 3VENA 2VODA 1UEKA 4MLEA 1HYSA 1BGXT 3QQCD 4IFEA 4KB0A 2HNDA 2GEMA 3MAQA 4Q7AA 3TANA 4JI3K 1JLQB 3NAIA 4HKQA 2ZDOA 1OKJA 3HJVA 3CO9A 2HSEB 3KLIB 1DHMA 2MGZA 4OLOA 1JLEB 4QS7A 4KAZA 5F2RA 3VEYA 2E6MA 3T9NA 2IDLA 1FERA 3DGPA 4NRUA 3L3VA 1VQ6N 3T5KA 4CHNA 1KLMA 2ERRA 4H4MA 3TW0A 3TO8A 4DTRA 2QWMA 3HLUA 4PZVA 5ETOA 4Y1CA 2G8FA 4GKJJ 5L39A 4GO5X 1GH8A 3T3FA 3G6XA 1Z2LA 2UU9K 2BVZA 3L4QA 3FCVA 1FRMA 4X4UA 2YNFB 4B9MA 4RUBA 2ZNZA 2OSRA 4OYXA 3OYNA 4YOXA 2KHCA 5J2NA 1YXQA 1R6VA 5D77A 3TQ1A 4PCQA 2V8DA 2W40A 5EUHA 3I56N 3DJCA 4P10A 2EKYA 4QCLA 2BOAA 4M3XA 3O9QA 1M5VC 4J9NA 1CC7A 3KHLA 5EWEA 5I42B 4JI4K 1NHVA 1RAIB 1WEZA 1RT3B 4J2EA 1Z4UA 3M2UB 1CC8A 1R27B 1RBUA 3OHAA 4O3RA 3MPUB 1XHZA 3BGLA 1F5CA 2GIRA 5HOOA 3O3FA 2DRBA 2P2CB 3ULEB 4AILC 4ILRA 1BC6A 1PSDA 2PZSA 4KKOB 3ZT2A 3DWLA 3IA0A 4CRJA 5D3GA 4CGFA 2J7UA 2K7KA 1BQNA 2EFPA 1HHQA 4DHYA 4H5TA 5FD1A 4PG8A 2HHSA 1TP7A 2DFFA 1LFWA 3G25A 1T3NA 4OPKA 3A1YG 2XS5A 3QT5A 2ZUAA 1HW8A 5T41A 4DR7J 3ZC4A 3BUZB 2V4JA 3CCUS 3OY9A 3UD5A 3I9V9 3M9NB 3MEDA 3VQDA 4OX9K 3Q8VA 3H5YA 4JKFA 4P6QA 2K7JA 3O8WA 3SCIE 3DDKA 4A8XA 4RU9A 4CK1A 1ATNA 3W9IA 2X1FA 3SQGB 2C2EA 2XYGB 2C3UA 2M88A 1Y3KA 4NA1A 3UDCA 2IYIA 4DZ6A 1Q18A 2HKEA 2DIVA 2HF3A 2PT0A 2OIHA 5AQLA 3M6GA 3CPWM 4MH8A 1JLGA 2ZBCA 1HNXF 3BJYA 4DEZA 4Q43A 1GX6A 4EUVA 4GVLA 3OLAA 2RN2A 3SDEA 2QWRA 3BQ1A 2CADA 5EN1A 3NY0A 1YJUA 4KT0C 5LT5A 3KK7A 3QWPA 4MT1A 1ZBUA 3V4IA 4ZS6A 3U1MA 3PIOL 5BRHA 2BJ3A 5EVZA 3WUHA 1WC5A 2EW9A 2LXFA 4PG4A 4AFFA 1VQOS 3OTOF 4A5BA 3M5RA 1E4FT 3HHKA 1GLBG 2OTLS 1OWXA 3H3NO 4NPOA 2ZOMA 3AVCA 4J5OA 3ZZTA 2J0XA 3VQ6A 2HZVA 4FNHA 1XC9A 2J0QD 2KJVA 1YJNN 1Y3JA 3CSKA 1ZS6A 2UZAA 2UU9F 3CERA 1NWKA 4UUXA 2NSBA 1FVSA 3AY0A 3H5SA 4BRHA 1D9DA 3EY1A 1UFWA 4I68A 3RJMB 4DV0F 2JHEA 3GOIA 5E26A 3MK6A 1EAYC 3ZNUA 2U2FA 2E44A 2AU0A 4XH1A 1T11A 1NXIA 2QWLA 2XS7A 3KYLA 4CJTA 3THXB 2GQ2A 2R7WA 1DTQB 3I5AA 4CJ5A 4ETXA 4HTUA 3O1BA 4I2PA 1SL0A 4WQ5A 2GAGC 5TKWA 1VK3A 1RCOB 3HVTA 4M3UA 3T1YJ 5TKYA 4DFPA 3KTQA 4ZMMA 3RAXA 2O8CB 5L46A 1VSDA 1VQYA 3PVXA 1CQMA 4DV1K 2PN6A 4WFNQ 3MMJA 3D6RA 4JBCA 2PIIA 3SV3A 1LWEB 4YR3A 3DMJA 3LF0A 4DUYF 3TEHB 3EO3A 1VQKN 4CLZA 4FZXC 5DQIA 1SKWA 5LMNK 4M5DB 3TVKA 4DCOB 1ZM4A 4CD1A 3BR9A 1WOOA 2CFXA 4I6MA 2HSTA 2G13A 1CLFA 4DV2F 1VQ6S 1AB8A 1PJ6A 2ZBPA 2SXLA 3TTFA 1KOOA 1ASUA 2GUIA 1W25A 3AD9C 1NB7A 1S1UA 2V2ZA 4LJMA 3OYCA 1NSPA 5GAHI 4CHQA 5M1KA 3C66A 1EP4B 4C3LA 4RWWA 1RT6B 3M1VA 2VG6B 4DPUA 3R5AA 1XWLA 2VJUA 3AVJA 2O5DA 1IJJA 4LRDA 3D6HB 5F1XA 3EZWA 1OS5A 2X3GA 4V19X 1RLDA 1KQSR 1BDGA 3TSUA 1TKTB 3JYTB 1QDUB 4W5TA 1HNWF 5AFUA 3A8KA 2OELA 1Z6RA 2YWEA 1VQ8N 3KG0A 1JLQA 1Q8LA 4AHCA 2LLZA 3GG0A 4OLBA 2GC8A 1VIXA 1U4BA 4MQ3A 2DO0A 3H7HB 5K14A 3CDBA 1BO5O 2AA4A 1CJKB 1Y10A 5ADZA 4PL8A 5C15A 3OL8A 4K43A 2QL9B 3EKSA 3SJHA 4CLLA 4AXIA 2YJFA 5JMNA 3AY9A 3CVKA 4HYKA 3CDAA 2QX0A 1EQ0A 2K1RB 4K5SA 3UCGA 1Z05A 1D1UA 3D66A 1X8DA 4ZVFA 2R7QA 1WD6A 3CMAN 1S1XA 1N0VC 2O8DB 3VAIA 3PY8A 5C25B 4ES2A 2AGOA 1YJVA 3JTPA 1ZYQA 1P27B 4BE1A 5KFLA 2BR0A 5IM0A 5IC6B 3GIKA 4L76A 4F3TA 2QYCA 4ECYA 5SZTA 4L3NA 1BIZA 4PG5A 5BREA 4X2BA 4ZJOA 2YKNB 1S0OA 1JXLA 1MWQA 3UCUP 1T94A 3AXMA 1WSRA 5KG6A 5FLXU 5I42A 3R3LA 2R7YA 4ZHRA 4LVOP 3C0BA 2AJ4A 2J9CA 1NJZA 4MK9A 4F0KA 2DCLA 4QU7A 2IIHA 2BM0A 1WOPA 2QE5A 3TSQA 4BDPA 5IQ6A 3BQ0A 5KG7A 1SUQB 4LD0A 1UPPA 4A8FA 4LH5A 3D2EA 5F8GA 4NYZA 1UA1A 1N48A 4U67Q 1OPZA 2DXDA 2R2RA 2FB0A 1B64A 4I7FB 1MMLA 3CW2C 1HNIB 1NRKA 1DLOA 1I94J 3OVBA 2L48A 2FGOA 4DSKA 4LF5K 2ITMA 3M6XA 4O44B 4CT8A 3T69A 4QWAA 2NZCA 4F9OA 1RTHB 1HWIA 3I87A 1XMQJ 2LQJA 3SXLA 3KJQB 4BR7A 1ULRA 5H1SQ 4DHVA 3RW6A 5EY4A 3MMCA 3GFYA 2A1SA 1QQOA 1RYRA 4Z94A 3CO0P 1R8HA 1H7WA 6FDRA 5AXKA 3PRBA 2JWKA 3HVTB 3R1LA 1RT2B 2VUGA 4TU8A 2IAJB 3Q7BA 3NF7A 2W9BB 4NA3A 3R5JB 4LFAF 1CJVB 2ZWPA 3F2KA 1TL4A 2UXDJ 1RJJA 3G10A 1YITS 1Q4RA 3NF6A 2CXEA 2AJ1A 1NMNA 4L6V3 3NF8A 4W98A 1Z1ZA 2E1MC 1TKXB 4RWXA 4YOTA 3TX8A 1NSAA 3W7BA 4MDBA 4DR1K 2Q2RA 4FJ7A 2IRXA 4HR2A 1PYOB 4CF9A 3CC2S 3CPWR 4QWEA 3R8EA 4ANEA 4F2SA 4ICLA 4MFBA 1YUWA 2RQMA 3Q2SC 2ASOA 2OCEA 2VFRA 3UKRA 3ZTPA 2A18A 1V6HA 3V6KA 1RTJB 2XULA 1JXVA 3AHPA 3QRPA 1RA7A 1TUVA 1M1HA 2ZC3A 1T02A 5AQSA 4H5WA 3KXDA 3M6UA 2W24A 3GYXB 4NLTA 3W61A 5GADU 4RPFA 3L3CA 1IBKF 2GJIA 1JK9B 4IO9L 1VMBA 2CQDA 1Y5IB 2ZJRQ 1CS4A 5E3RA 3C2PA 2NYIA 1IBLK 1UZHA 5RUBA 2J6UA 4PY5A 4GV3A 2B4UA 2R8GA 1N34F 4CK2A 4K0KK 1KRPA 3G6YA 1YK9A 4BC3A 3VAGA 4KJIA 4XO0A 3LP0A 4RNNA 1RAGB 1TL1B 2CZ4A 3MAHA 3AVHA 3ILIA 3UE2A 3QSYB 2UUAF 2V7YA 1CJUB 1BUPA 4I64A 4WF9Q 3CG7A 2VG5A 3ZZZA 3G86A 1J53A 3HI9A 1OQ3A 5J2NB 4JKHA 4DOZA 5ETKA 2DGTA 4YMEA 1NJIT 2CPZA 2CQPA 2KRRA 3R6MA 4GVMA 2ZD1A 3CCMS 2MYFA 5CZXA 1RABB 2XY7A 4OKKA 2FC0A 4B9SA 2Z1GA 2GTDA 1SZ2A 3Q8RB 4DSEA 3ZX2A 2A40A 4JI0F 1S1VA 2V4RA 3LM2A 4CCHA 4RJVA 4U6PA 2VOOA 3KLFB 2ZKUA 4IKAA 1VSHA 1FE0A 4ALZA 2QMXA 4KH1B 4FJ5A 4JI2K 4LF5F 2QN6B 1YZ6A 4X4RA 2RMLA 2RS8A 3I55S 3M9OB 1E6YA 3P5JA 4MIWA 1RHUB 1VOMA 4CNZA 3ZYYX 5KAKA 2IM2A 2QEXN 2VDIA 3AAQA 4ED2A 3GIIA 3DLGA 3DYAB 4NRTA 3MURP 1X0FA 4ZP8A 1KVKA 1A7GE 5FDLA 4CTAA 1L3UA 3NEKA 1NU0A 3RSEA 4ZA1A 4FJLA 4ZJLA 1GOAA 1DEJA 1Y5NB 4HHHA 1UJ4A 4DR2K 1UVNA 3DNCA 1KN6A 2VKZG 3DLBA 2W01A 3Q86A 3SEOA 2P5VA 2WONB 1IJEB 2HHTA 1T05B 4ZPAA 1HNZJ 3A5OC 1VQ9S 2WVCA 2E2NA 4CZKA 3S3OA 3QEVA 1ZM3A 1VQ5S 4G65A 2DY4A 1TL3B 3DI6B 4R5PA 1WSHA 3DOMA 4GKJF 2AEMA 3KNGA 5M1PA 3N6LA 3KUEA 4A59A 4EYHB 1LOUA 1IBMF 1XQIA 3IWXA 2DGUA 2YWFA 4YDXA 4C2MA 3W2VB 4RNMA 1VS3A 1NH8A 4ED6A 4IDKB 4PHTX 2V4QA 1Q81T 3PXGa 1JLBA 2G8VA 1WG4A 1K73O 1VJQA 5CYJA 2F4FA 4CJ7A 2Y9HA 4WFBL 5LSLA 1S59A 1XEZA 3TR5A 1H72C 1X4GA 4JV2A 2BGGA 3QO9A 1OY6A 1FX4A 3IG1A 5DG9A 5KT2A 2RRAA 4DTUA 1WC1A 4GMJB 5KGWA 5BN8A 1OMSA 4G9ZA 4C98A 4D3HA 3HM8A 3KK1A 3M8ZA 3NOCA 4MKVA 4ZCMA 4Y2IA 4BQZA 1RWNB 3SQ2A 4KR0B 3TAPA 4WXOA 5IT4A 3UKRB 1RTJA 4NXMK 3AA8A 3D7SB 5FLXO 3LPEA 2UP1A 3BM7A 5ELZA 2GA7A 3R6GB 3L3UA 4YHHF 2ZBRA 1AFJA 5DZ6A 3C14A 4K4TA 2ZGZA 3FE1A 5HANA 3TI0A 5E7OB 3LW5C 2Q43A 4DSIA 4ILMA 1QZ6A 3TWHA 4U96A 4K4SA 3KHYA 2O67A 4YB1P 5LMUJ 2YH1A 4OI0A 4BRKA 5FLXY 3CCJS 3U3GA 4F4ZA 4OI4A 1M1GA 1RWPB 2B4PA 1TL7B 2HS4A 1LWEA 4CI6A 3NL0A 3QJJA 3M05A 1C0UA 3QAUA 4Y28C 5E33A 1HKCA 3MCOA 2YX1A 1GX5A 2HBYB 4TVAB 1X4BA 3PSIA 2JEGA 4CO0A 1WTFA 3PG9A 4B9LA 5CY4A 2IM1A 2KM8B 1DKGD 1R8PA 2FZGB 1VIOA 2FTRA 3SQ0A 1UVLA 1VQON 1KVJA 2EFVA 4E7HA 5KFDA 1JL1A 4DV0J 3EGZA 4AHVA 2P9LA 2ZD1B 3NAHA 4ZVOB 1TKXA 1ZOTA 3H2UB 2CPEA 2R2TA 1NGEA 3OHBA 1MMNA 2ZH9A 1TFYA 3UE5A 4ELVA 1WEYA 2ROEA 2MLZA 5KGXA 4RO0A 1HI8A 3NOGA 2F8HA 4OZJA 2ILZA 3QGIA 3I8DA 3KUHA 2EFOA 5AQWA 5IXUA 2MQMA 4F4WA 2K3IA 4HTIA 3MWPA 1ILYA 4ZK7M 5FJ4A 2V50A 4B9VA 4IFVA 1OSCA 3G82B 3DU5A 3FC9A 3W8GA 5C2FA 3ITHA 2PSZA 5DLFA 4RW9A 2POKA 4KHPJ 4JI7J 4URQU 1FFWB 3WX4A 3T5HA 1YJTA 1HNVB 1NU4A 5E3CA 2E1PA 4ZVRB 4DL7A 1FT8A 2IC3B 1WUAA 5GIPA 4PA1A 5B0FA 3ULDA 5KT4A 2JEJA 3G8TA 1NGHA 3M7VA 1QQNA 3M8QA 2J9DE 4CLTA 1GTEA 3A5MC 3KZBA 3RR7A 5A2QY 1CS4B 4H0PA 2OP5A 1QE1B 2FUG9 1PIEA 3ISNC 2EWSA 4A57A 4B8AB 1V4SA 5KQ8A 2XMUA 1OSDA 2CJQA 3K0JA 2NRRA 4EO8A 4PKDB 1FWLA 3CJ7A 4F4AA 2YHXA 4RNOA 3D28A 3JSBA 4HI1A 1PG5B 4M5NA 2BQUA 1FA0A 3QEWA 3SMZA 3A12A 1EKEA 3BO4A 2D3ZA 4GV6A 2BXJA 4CEDA 3MAAA 1TL1A 5A2QO 2PA3A 5DM7L 2HNYB 2JC1A 5FPMA 2CJYB 2Q36A 3KLEB 1VR6A 1IBCB 2GVDA 5AE1A 3PYFA 3TP2A 1DQ8A 2B4VA 3GFXA 4DU3A 1JXBA 2P9KB 4IG3B 3OR1A 2V9KA 3L95X 3JQKA 1LW2A 3BKTA 1F2GA 4X66J 4O23A 5D8HB 2E4LA 4IDHA 3EXCX 2EFGA 4USUA 2MKSA 4Z4CA 2VFTA 2VGNA 2KVQE 3NCIA 3KD5E 1BHLA 3KWGA 3GTYX 4QIFA 4MK7A 4OMFG 4CO5A 2ATQA 4BGAA 1T9XA 2I7PA 1IKXB 3FUYA 3AAWB 1VQ4N 1YF5L 3BPDA 3BH7B 4L72B 1MNEA 5AQRA 2XYHB 2AQ4A 3WT0A 1OO0B 3R8YA 1IQZA 4KHRA 2E88A 5AXMA 2OGUA 4BACA 3OBIA 4C11B 5DS7A 5BR8F 5HROA 2LSNA 4Q44A 3C16A 4RW8A 5CE3A 3CCLN 2R7RA 1K0VA 1TZ0A 3I8BA 3M8YA 3N0VA 1UWAA 3DLGB 3DYAA 4FK0A 1LWCB 1VQSA 2G1DA 4WQ5C 1QTMA 3OFEA 1WLJA 2ABYA 2KW4A 1N33F 3EVMA 3EZUA 3ENWA 5FPEA 4ECTA 5GADI 4JS5A 3HRGA 1EARA 3VAJA 3L7PA 3BDPA 2H9ZA 4Y00A 3QETA 1ZZFA 1NM2A 1X5TA 3LDLA 2QWPA 4JI0J 3KK3A 3B8AX 4WKYA 4F3OA 1IUJA 3QATA 4XIUA 3S9HA 3MPYA 2CRLA 3TVYA 3LDPA 3IUCA 3L2VA 1VQLS 1TL5A 4OLAA 1VQMN 2GAHC 1GLDG 3U6FA 1LQ9A 4C97A 3LP2A 4HTJA 4CF2A 6FD1A 2YNGA 5CAAA 4BRDA 3QIPB 1YJWS 3A8EA 1RDDA 4C3MA 3H25A 1YSJA 4CFBA 4PWDB 3O5TB 2J0WA 5GAEP 2BJ7A 2RNEA 3LANA 2IA6A 1VI7A 2ADBA 3GJRB 2L3MA 4FYVB 3HD1A 4BR0A 4P9SA 1NOZA 2GCFA 2DGXA 4DV7F 5LY3A 4FF2A 2C1EB 1RAOA 4IBNA 5C2GA 4AE5A 3OW2R 4LFAJ 3AVBA 1OVQA 4CHZA 1H73A 4FJ8A 4JB8B 1RT5B 3D2FA 1T03B 4WPAA 2FBVA 2K06A 2CPHA 4ILHA 1GLEG 3QJLA 2M3DA 3JSMA 1HNZF 1ICEB 4QYRA 2VQFF 3V9SA 4JNEA 4FJHA 2CG4A 5AE2A 2C2MB 2L9WA 3M30B 4CF0A 1ESVA 4CJWA 2V63A 4JI6F 2O8FB 2JLGA 4UF4A 3CULA 1C0FA 1CLQA 5JVGQ 3VERA 3RRKA 3M32A 5CA5A 2JGUA 3D1HA 4MKAA 3T1AA 2E7XA 3KDOA 4M8LA 5DQHA 4CESA 3A13A 1UW4A 2LP4A 1GFWB 4BCAA 2H3EB 3N4PA 4U9RA 1BD6A 1UEUA 3SYZA 2J76E 2HHUA 3OLBA 2WK4A 4Z4IA 2VBXA 4NX9A 5HJXA 2HQ3A 1XR6A 2DNKA 1HW9A 4B3MJ 1FESA 2VFVA 2KVIA 3B6OA 3DRSA 2LU1A 4DV3J 4JD2B 5HN0A 3BSOA 3M1FA 2YKMB 2WBMA 3QICA 3KLFA 2FBTA 2OPRB 4B3OB 4CVNE 3LPYA 3HM9A 5EX0A 1HBUA 3W2WA 3PO5A 3WBZA 3UQSA 4IRCA 3J7A1 4J90A 3GR1A 4UW2A 2F65A 2EC2A 2FPHX 2J0SD 1NGBA 1J2VA 2HG4A 1U1QA 4QWDA 4JI3J 5KPTA 3QDKA 3NH0A 3R5DA 5GMEA 1MA9B 3LUYA 3B6PA 1RKIA 1ZAVA 1DQAA 3SNNA 2R3VA 3EDRB 3J80O 4M3WA 3V4IB 2GFFA 3W8PA 3ITHB 1KHWA 2PYLA 4WP3A 1YLXA 4CTAB 3O9RA 3V81A 4CGIA 3ULEA 4JI5J 2AP6A 3BN4A 4X64F 3AGKA 4OYPA 4AD6A 3C7NB 5HROB 1YVNA 3C65A 1X4AA 3BEGB 1F3VA 1BQNB 3KK2B 1FWPA 5IWAJ 2V6AA 5F8JA 3NDKA 3MEEB 3MR7A 2WONA 2N4CA 3TJ9A 2E9ZA 3O1LA 3NXZA 3CJRA 4L3QA 1IKVA 4PPZA 2NR0A 1G2EA 3RRHA 4DR2F 2KZMA 5BR9A 4CF8A 5AQTA 3ILOA 5AZIA 2GMJA 4LF9J 4URSA 5JICA 2CJAA 2Q6CA 3ATVA 2HZAA 2XNQA 2Y1RI 4BLGA 2CPFA 5GINA 3DM2B 2ATCB 2DHGA 2KM8C 3ZLJA 3E9OA 2DPNA 5BN9A 4I2PB 2AGPA 4CWBA 3PEHA 3J7YP 3QYYA 2UUAK 2ZF5O 4WYBA 2CZVC 2R9LA 1Y11A 2O8CA 3MOZA 1NHUA 3A8IA 4RW6B 4IEEA 3ADAC 1QSLA 5M1OA 1FJ7A 4FWQA 5AQHA 1S6UA 2BQ3A 3K2YA 2DXFA 2HBKA 4KHUA 1B99A 4EFHA 2RPIA 4BREA 3DMJB 3HBTA 4LC9B 5K8NA 5I3UB 2BUNA 3C6TA 2V8PA 4HL9A 2HQIA 5A0YB 3M3ZA 3T1HK 3L7UA 2FVRA 1HNXK 4OQJA 2BUPA 2KT2A 5ETQA 4WZMA 3KKSA 3KJNB 4KHPF 5D4OA 1HD0A 5A8RB 1FKPB 4WKRA 3R2CJ 4C8NA 4WIIA 2D0CA 5HL7L 3M4XA 3ZT1A 3W9JA 2VD3A 3PW0A 2JOQA 5CZVA 3LALA 1PAUB 3VVUA 2RB7A 4DR4K 3OBYA 3ONQA 2E2OA 3NS6A 2C2ZB 2FJBB 3BZCA 3S1TA 2CQ2A 3OD2A 2YXLA 4F67A 2W9CA 3S3NA 4RW4B 2BDPA 4K4UA 1S77D 4DCJB 2JFKA 5JVGL 4Q8FA 2QKBA 5HRSA 1VAZA 3ID8A 3MN6A 1O13A 3VEOA 2VWBA 3NE6A 3CC7S 1WSEA 1Q82O 4A8QA 1F6TA 3OTCA 4NYFA 3OS2A 3EGVA 3THXA 3AFGA 1WTBA 3D7EO 4J9QA 1RU1A 3H90A 1M5PC 4MIAA 3TAGA 3OPKA 2HBRB 2CUYA 2XI3A 3O5BA 2FLOA 3CJSA 2PO4A 3NMRA 5AQUA 2ZH5A 1IXKA 3HP9A 4FK4A 4O4GB 4FPAA 4H5NA 3CIPA 3U9DA 3I9ZA 4BRNA 3EICA 2MJNA 2B9EA 2VQFK 1C1AA 2FJEB 2HQFA 1G1XA 3JAMY 1KQFB