4AHRA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
153
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 59
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahrA00
4CF8A 1VSIA 4LSNA 4G1QA 4OGCA 3ZT2A 4FJIA 4KV8A 2G8KA 1S9EA 4KTWA 3V1QA 3VQ8A 4DTJA 3OJUA 3ZT0A 5HRNA 3QEVA 2PYJA 1QSLA 2HVIA 1JLBA 3LDSA 1SV5A 3DMJA 1J54A 4IDKA 4CJPA 4M3XA 3SUPA 1ZYQA 3RMDA 1YTAA 4F2RA 3C6TA 1RDCA 3VA0A 2F8TA 4M3UA 4MQ3A 1SKRA 4FK2A 3V9SA 2YNFA 4CEDA 1EETA 3ZSXA 1S1WA 2HNZA 5E41A 3KD1E 1RTDA 3QIOA 1RBTA 2LSNA 1BIZA 3SV3A 3B6PA 4C8NA 1WNSA 3DYAA 4AILC 1WSIA 2OPQA 3K5NA 2F96A 4CIEA 2YNIA 3KK2A 3L2VA 1FKOA 1NK4A 1KRPA 2RPIA 1NJZA 1T7PA 4RW8A 4F4KA 1TK5A 4AHTA 5C24A 1ITGA 2KQ2A 4E19A 3S3NA 1CXQA 3IS9A 4FLTA 1KTQA 1QHTA 3KIOA 3RMCA 1HYZA 1ZBHA 4E89A 4DTNA 4CFCA 4LSLA 1LW2A 4KI4A 5I3UA 3K2PA 3AO3A 3JYTA 4H8KA 3VQ5A 3NH2A 4W5NA 1RBVA 4W5OA 4E7LA 3SQ4A 3L8BA 4IG3A 4NYFA 1TL3A 5JS2A 4OPKA 4CK2A 3QNNA 3D45A 4BDYA 3RWUA 2ZE2A 2X78A 3V1OA 3OYIA 2A1RA 4FJMA 2G8WA 1JL2A 4F8RA 3OYGA 5JS1A 1XC9A 2HHTA 4FW1A 3VQ9A 1JXEA 4CE9A 5KRSA 3AO4A 2XY7A 2OZSA 3O3FA 4DTUA 4KHYA 4IBNA 4CHOA 1TK0A 1SKWA 2BGGA 2BE2A 2VWJA 4Y1DA 1BCMA 4CJRA 3QESA 3HO1A 3LALA 4KHWA 2B6AA 1KLMA 1C0TA 3NGIA 1KFDA 3DM2A 3I0RA 3I0SA 1U4BA 2DY4A 4IG0A 3P1GA 5J2QA 4AHUA 4DFJA 2G8VA 2XHBA 1DTTA 1CLQA 4PY5A 2EX3A 3DLKA 2E4LA 3DLGA 1RT2A 4CERA 2O4IA 3RTVA 4Z4HA 4W5QA 3HXMA 3LAMA 4E1NA 5EU7A 1JKHA 1RDDA 2B5JA 2X6NA 3AVJA 3VQQA 4CGIA 3OS0A 3AVFA 4CF0A 4FM2A 2DFHA 4CK3A 4RW4A 3MEEA 4F2SA 1QE1A 4OVLA 2ITGA 4DSEA 5KGWA 3NFAA 3HT3A 4CFAA 3EY1A 1N5YA 4CJUA 4BACA 1VK0A 5CYMA 4M3RA 3OYNA 1VSKA 1Q9XA 1JLEA 4YFUA 4DTRA 2ZD1A 2IGIA 1QS4A 3PUFA 3DRRA 3WNGA 1HJRA 4B8CA 4NCBA 1KVCA 4QCLA 1S6QA 2BDPA 4DQQA 1ASVA 3AVLA 4I2PA 4B9NA 1RCHA 4I2QA 4Q0BA 1DLOA 1BHLA 4DTSA 4DFKA 1BI4B 3C94A 1X1PA 4AHSA 3I8DA 3MAQA 4DTXA 2P1JA 3TARA 1NKEA 1VSLA 3ZSYA 3L3UA 1S1UA 4CGJA 4FXDA 3CM6A 4RW7A 4DFMA 4CFBA 4DS5A 3AA3A 3DI6A 3QIPA 4DQPA 3T19A 3OYJA 4K8ZA 4NCGA 3K5LA 4KTZA 1FKPA 4KPYA 4L8RB 3THVA 4M3ZA 1WN7A 3S9HA 5C42A 1BQNA 4CF2A 3NH1A 3AVHA 1IKXA 3NAEA 3PX0A 3NF8A 5CYQA 4GW6A 1F21A 3O4QA 2IDOA 4WE1A 3OYKA 3SQ0A 3L2WA 4FLWA 3JSMA 1NOYA 4ZTFA 1IKWA 2YKMA 3HPHA 4FW2A 1VSMA 4NYNA 1BL3A 3WNEA 3TABA 3QETA 5HROA 1NK9A 1RT1A 2HMIA 4I9QA 4KTQA 2YKNA 4OGEA 4R5PA 3B6OA 3L2QA 1U04A 3KLFA 3F73A 4CF1A 4HCCA 4N56A 3PX6A 4NCAA 5D3GA 3OVNA 4FLXA 3KJVA 3KK3A 4KHSA 2G8IA 1KLNA 4EP4A 2PZSA 3DRPA 2Z1GA 2RF2A 3C95A 1C1CA 3OYDA 5J2PA 2XY8A 4M41A 1WSHA 3KKSA 4DQIA 4PUOA 5FROA 3F9KA 3ITHA 3TAFA 4CJWA 1T05A 4J2AA 2HHSA 1Q8IA 3RMBA 1JLCA 5I42A 3ZSVA 4B9UA 3LP3A 4ID5A 3SPZA 4CJ5A 4CJLA 3U6FA 1UA0A 1KSPA 2G8HA 1BCOA 1VSEA 2B4JA 4TSXA 3O3HA 3O3GA 4E7HA 4EZ9A 3TAEA 2Y1IA 4PQUA 5J2MA 1REVA 1TKTA 1GOCA 2NUBA 4CGFA 4FJJA 4FZZA 1HRHA 1U45A 3K58A 4LD0A 2IC3A 3MEGA 3SV4A 4IFVA 2HHWA 3QNOA 3LZJA 2P5GA 4CFDA 1S5JA 1TKZA 4FZYA 3HP6A 3PO5A 2OPSA 4W5TA 4OLBA 2Z1JA 1EP4A 3CG7A 4FLUA 3IG1A 1NK5A 3AVNA 3ZT1A 3V81A 1RNHA 3RR7A 4Z4IA 4FJGA 3WNHA 4CJFA 2FBYA 1C1BA 5KGXA 5KTQA 4C8LA 3DLBA 3SZ2A 1ASWA 3QEPA 3V9UA 3ZSQA 1ZBIA 4E0DA 3TR8A 1WSJA 4DU1A 1X9WA 4W5RA 3OS2A 1SL1A 3AO5A 2RN2A 4O4GA 1CZ9A 1J5OA 4FLVA 3M8PA 1T8EA 1SL2A 2HHVA 2HNYA 3OYCA 3KLIA 4DSJA 1S9GA 3NE6A 3E01A 1KVAA 5HBMA 1NJYA 4DSLA 3AV9A 3HPOA 2GV9A 1VSFA 3RRHA 3VQCA 4M3TA 4CJ4A 4RG8A 1C1AA 3V4IA 3T1AA 4DG1A 3V6DA 3TWHA 4DTMA 1WAFA 2D5RA 1GOAA 4KKOA 3NGYA 4CESA 2IOCA 1S6PA 2YNGA 3DOLA 3TI0A 4J2DA 1NJWA 2ATQA 4CJTA 2Z1HA 1U47A 1RDAA 3SUQA 4BE1A 4CGDA 4E1MA 4DQRA 3QLHA 2GBZA 2XY6A 5CZ2A 1RTIA 3AO2A 4FLZA 4DTOA 4FJKA 1QSSA 4FYDA 4DQSA 3VQBA 2P5OA 4KHNA 2QKBA 4RW6A 1RTJA 4OKEA 5HRRA 3KLHA 3CFRA 1NK8A 1U48A 1L3UA 1HYVA 3QINA 1D9FA 1HQUA 3QO9A 4IKFA 4E7KA 1ZBLA 2E6MA 1VSJA 4DU4A 3HVTA 1HQEA 2HB5A 4Z0UA 1VRUA 4ZHRA 4HUEA 1D9DA 3G0ZA 1YTUA 1EKEA 2GUIA 2WOMA 4PA1A 4DTPA 3IRXA 3TAPA 4FJ9A 4ELTA 1BI4A 1JL1A 4OLAA 4CEOA 1VSHA 3OYBA 3LZIA 5HRPA 3MXIA 1WLJA 3LWMA 1TAUA 3LP1A 3VN5A 3SUNA 3U3GA 5FDLA 2R7YA 3PX4A 2D0BA 3OYLA 1X9SA 4HVJA 4JRPA 2KW4A 2QKKA 3DOKA 1CZBA 5DK5A 2X74A 3SYZA 3MXMA 1IG9A 4DLEA 4CEAA 3VA3A 3NH0A 1NK0A 2HHUA 4JRQA 1C0UA 3OY9A 1O1WA 3D0PA 3NF6A 3KTQA 1WAJA 1BQMA 4KHUA 4KRFA 1A5WA 3MXJA 5K14A 4KB1A 5C25A 1RTHA 3LAKA 4CHYA 3OYEA 3AVKA 3M8SA 4F3OA 5J2NA 3UIQA 4FJ8A 4MFBA 2FBTA 2VG6A 4AHVA 5KRTA 4FM1A 1L3TA 4FCYA 4HCBA 3HYFA 4LH5A 5CY4A 2XY5A 5SWMA 1KCFA 1S1TA 1JLQA 2DFEA 4FK0A 4O44A 3CM5A 1G15A 2VWKA 4E7IA 1VSDA 4Z4FA 4Y1CA 3MECA 4CHQA 1W0HA 1TV6A 3TANA 3WNFA 4FJXA 1L5UA 4F3TA 2YHBA 2IAJA 2PYLA 3SJJA 4KAZA 1SL0A 2RKIA 4CJSA 1LAVA 2E6LA 4DSKA 3HK2A 3V1RA 1FK9A 1TVRA 2ETJA 4XIUA 4N47A 3QERA 3VQ4A 4CJQA 5SZTA 4CJEA 1SKSA 4LY7A 1WSGA 4CIFA 1FXXA 3OJSA 5HLFA 1LWFA 4AHCA 4CIGA 3DLRA 3KKRA 3M8QA 3CFOA 2OYQA 2F8SA 1R0AA 4HUFA 2DFFA 2FBVA 4CJ3A 4DSFA 1BIUA 4CEFA 1TGOA 4Z4CA 2D0AA 1MU2A 3U3YA 1EX4A 1QQCA 4O0IA 4DMNA 3SNNA 1K6YA 1RT7A 2ZQBA 1A5VA 1J9AA 4CK1A 1XHZA 5KI6A 1U49A 4B9VA 1HNVA 4CGGA 4CJVA 4N41A 1S1XA 4YNQA 2Q3SA 3FFIA 4B3OA 4IFYA 2IS3A 3KLGA 1RDBA 3HSTB 3HP9A 3ZSWA 2KFNA 1QSYA 1HPZA 1LWCA 1LW0A 1VRTA 2KFZA 3NGZA 1UWBA 1WSEA 4AH9A 1LWEA 1NKBA 1J53A 1GOBA 1Z26A 5DMRA 3LWLA 4DLGA 3C6UA 4O0JA 4ICLA 4Q5VA 2YV0X 3NCIA 2DTUA 1KFSA 3L2RA 3ULDA 4N76A 1ASUA 2JLEA 3O4NA 4ZTJA 4BDPA 1RT4A 3OYAA 1JLGA 4B9SA 3IAYA 4Z4EA 3ALYA 3DRSA 5FRMA 3H08A 2OPPA 3AA4A 3VQPA 1XI1A 4DSIA 2OZMA 1B92A 1RBRA 2A1SA 2KZZA 1S1VA 1RT6A 4BWJA 3V9XA 3QEXA 3LPTA 1RT5A 3L3VA 5HRSA 4BWMA 3OS1A 3SCXA 3K5OA 3NBPA 3K57A 1NJXA 4JS5A 3CYMA 3TAGA 2YHAA 1IH7A 1WSFA 1TK8A 3VQ6A 3ZT3A 3HPGA 3SI6A 4K8XA 3KK1A 2FC0A 4CF9A 1B9FA 1LAWA 3VQEA 3DLEA 3OYFA 1Q9YA 2QXFA 3K59A 3MEDA 2FBXA 4ID1A 4J2EA 4C8OA 1D8YA 2D0CA 3NHGA 4M42A 3LANA 2OA8A 3QEWA 4DU3A 1HYSA 4KFBA 2HVHA 4B8AB 2KZMA 4Z4GA 4CGHA 2O4GA 3VQDA 3AVCA 1LV5A 1HNIA 3A2FA 4OKJA 2W42A 1IKYA 1L3SA 2XRIA 4O55A 3AA5X 3TAQA 3AA2A 1RBSA 4OPJA 3QEIA 2QK9A 3HVRA 1L3VA 1JLFA 1IO2A 1I39A 3BGRA 1YT3A 3LP2A 3RMAA 4QOZB 2P51A 3EYZA 3NF7A 4DF8A 1NK7A 3RR8A 4DS4A 3G10A 3TAMA 4FJ7A 4M45A 2HHXA 4RW9A 1B9DA 4J2BA 3ZSRA 1C0MA 1Z25A 4CEQA 4FZXC 2BANA 2HHQA 4FJHA 1UA1A 1W9HA 1I3AA 3M8RA 4AHRA 4CEZA 3HL8A 4I7FA 3AVBA 4CHPA 1YVUA 4M3WA 3ASMA 4ELVA 4PWDA 4FVMA 3HM9A 2YNHA 1RBUA 4DFPA 4KHQA 4JLHA 4H4OA 4HUGA 3HJFA 4GVMA 3KLEA 1NK6A 3RRGA 4BDZA 1IKVA 3AVAA 3ZSOA 2JGUA 4I9LA 2I5JA 1TKDA 3DLHA 1UOCA 1N6QA 4FJNA 2Z1IA 4KI6A 4O5BA 4CHNA 4FJLA 4GMJB 4C8KA 3LP0A 4KB0A 3K5MA 1EXQA 3OYMA 2XO7A 4ELUA 2KTQA 4EP5A 5T7BA 2G8FA 4FK4A 4CECA 3SQ2A 1CXUA 1UAXA 3ZT4A 4KREA 3SQ1A 3AVMA 4B9LA 2VG7A 2OPRA 3NDKA 3KD5E 4B08A 1BGXT 3ZCMA 4CHZA 4M3YA 2HW3A 2VG5A 1TL1A 4CEBA 5HP1A 3V9ZA 1JLAA 1XWLA 2WONA 3P83D 3L2UA 2X6SA 3T3FA 3P5JA 4QAGA 4DF4A 4DWIA 3BDPA 3SPYA 3AO1A 1SUQA 4HHTA 1Y97A 1X9MA 3VQ7A 5CZ1A 3CFPA 2AJQA 3ZSZA 3PV8A 1T03A 1QTMA 1NKCA 4BE2A 4HTUA 1NOZA 4CCHA 4E7JA 4OJRA 3V9WA 4LH4A 3VQAA 1JXBA 4OKKA 4BE0A 4N5SA 3OYHA 3PY8A 4CEEA 4CJKA 1A5XA 4H4MA 4E3SA 2G8UA 3NF9A 5FRNA 4JS4A 5J1EA 3S3MA 2PY5A 2HNDA 1D5AA 4B9MA 4KO0A 1KVBA 1RILA 3AVIA 1C6VA 2Y1JA 3PO4A 1XHXA 3AVGA 3LPUA 4FJ5A 4EZ6A 3EZ5A 4UQGA 4FLYA 1ZBFA 1BISA 3SUOA 1HMVA 1DTQA 4C8MA 1TAQA 3CQ8A 4FM0A 4B9TA 1TKXA 1RT3A 3ISNC 3S3OA 1ZBUA 2EHGA
chains in the Genus database with same CATH superfamily
4OGCA 3TU5A 2J4RA 4FJIA 2G8KA 4GKJK 4DTJA 4DR7K 5HRNA 2PYJA 3VF2A 3IUCA 1HKCA 3LDSA 3VEYA 4IOAL 4F2RA 3C6TA 4BRDA 2VQEK 2F8TA 4FK2A 4B3RK 3ZSXA 4DR4K 5E41A 4B1VA 3QIOA 1RBTA 4A59A 1T44A 4C8NA 1ZC6A 3DYAA 2PFUA 5M1QA 5CE3A 1KRPA 2RPIA 2QWOA 1TK5A 1ITGA 3DWLA 4E19A 1T6DA 2NRZA 4LSLA 4CBWA 5I3UA 3AO3A 1RBVA 4BR5A 4IG3A 3WT0A 5JS2A 1TL3A 1Q81O 3QNNA 3D45A 3RWUA 3V1OA 3OYIA 4F8RA 3CJ9A 4CZIA 4CE9A 2OZSA 3CD6N 4CW7B 4IBNA 3BEXA 2BGGA 3QESA 4Y1DA 1BCMA 3LALA 2B6AA 1KLMA 4B1ZA 5AQTA 3NGIA 1KFDA 3CQXA 3G4SN 3I0RA 4DR6K 2DY4A 4BG8A 3P1GA 1YITN 3TSUA 1DTTA 2EX3A 3DLKA 4NLBA 4CERA 1KC8O 4QS7A 3D7EO 4W5QA 1E4GT 3AVJA 3OS0A 4CZEA 4F2SA 1QE1A 2ITGA 3ENHA 3VEXA 4BACA 4YFUA 4A2BA 2ZD1A 5BRDA 4B8CA 2E5LK 3T7ZA 4I2QA 3A5MC 1DLOA 4DFKA 3E1YA 3I8DA 2P1JA 5KPZA 5M1FA 5GAGP 4NO7A 2ZJPL 4DFMA 3NVKA 1TYQB 3E9OA 4DQPA 4JV5K 1MWKA 5C42A 4CF2A 3J8AA 2CGLA 3AVHA 3NH1A 3GL1A 3NF8A 5CYQA 3PX0A 1XQSC 1ILYA 2W40A 1DGKN 2P9PB 3DLLL 1NOYA 4GV6A 3TABA 3WNEA 4KTQA 1RT1A 4FWLA 1ATRA 3KLFA 4N56A 3VETA 4KHSA 3J7AP 4I6MB 4JKFA 3RSEB 1GLLO 2QTDA 3MN5A 5FROA 4PUOA 2E88A 3SPZA 4CJ5A 3GE1A 2Q0UA 2B4JA 4TSXA 3O3HA 1FW6A 3H3OB 4BC5A 1XUPO 1S72N 1REVA 1GOCA 3VESA 4FJJA 1HRHA 1NLVA 1TKZA 4FZYA 2D1KA 3HP6A 3PO5A 1EP4A 3CG7A 4FLUA 3ZT1A 3V81A 1RNHA 4Z4IA 2EWSA 3ENOA 3ZEUB 1C1BA 1VQON 3SZ2A 1V4SA 1ASWA 1Z05A 4HTLA 4WYBA 3ZSQA 4F9OA 4W5RA 3GBTA 5M1OA 1SL1A 4JI5K 1SL2A 3C6HA 3NE6A 4IOXA 1W7AA 4JI8K 2O8EB 5AQXA 1BG3A 1WB9A 4YORA 4DTMA 1WAFA 2D5RA 5GIPA 2NRRA 3NGYA 4J2DA 3TI0A 1NJWA 3U9ZA 2RHKA 3T1YK 1QHAA 3H3NO 1RDAA 2DPNA 4E1MA 4DQRA 2GBZA 3KHYA 1QSSA 4FYDA 4JEPA 2P5OA 3THWB 1HYVA 4DQ8A 3CMAN 4IKFA 1YXQA 1VSJA 1HQEA 4ZHRA 1YTUA 1EKEA 3KZBA 4FJ9A 1JL1A 3M6GA 4OLAA 3HSCA 4CEOA 4WCEL 1J5EK 1WLJA 3LWMA 1X3MA 5AZIA 2R7YA 4DR1K 1XMOK 3DAWA 2QKKA 5AQHA 4FOIA 4B1WB 3SYZA 3MXMA 4DLEA 1C0UA 2ZF5O 3KTQA 4A62A 1YJNN 3MX5A 4KB1A 5C25A 4B3TK 4NB4A 1L3TA 2F9WA 5KRTA 1K8AO 3HYFA 2XY5A 5SWMA 3QB0A 4YDUA 2QI2A 3CM5A 4E7IA 1NGDA 5F2RA 4Y1CA 2FSNA 2NNWA 1W0HA 5KQ8A 4BREA 3SJJA 4KAZA 1LAVA 4NXNK 4B1UB 3VQ4A 4CJQA 4LY7A 4CD3A 3OJSA 4BG9A 4B3MK 3SMPA 4AHCA 1QVGM 4FPAA 3KKRA 2GUPA 3I8BA 4JI4K 1BIUA 1NGJA 5M1KA 1KAXA 1MU2A 3H45C 1QQCA 2NRTA 4DMNA 4H0VB 3SNNA 4CK1A 2ZQBA 1A5VA 1KAYA 3BF1A 2P9PA 4YNQA 5C10A 2IS3A 4R79A 3FE1A 1RDBA 3CHWA 4BRAA 3ZSWA 1QSYA 1UWBA 4AH9A 3MN6A 4DLGA 3WUHA 3C6UA 4Q5VA 4ICLA 3NCIA 1YJWN 1KFSA 3L2RA 2JLEA 3CC4N 4ZTJA 1RT4A 3ID8A 3Q7BA 3DRSA 5AQUA 2OPPA 2KKZA 3UE5A 1XI1A 4JI3K 2KZZA 4BWJA 3V9XA 3QEXA 4ILGB 3LPTA 3OS1A 2BUPA 1NJXA 3BZCA 3O8MA 3CYMA 2WTUA 1IH7A 2YHAA 1WSFA 5EY4A 1NNEA 4KHPK 1S3XA 2P9NB 4K8XA 1HNWK 2FC0A 1LAWA 3VQEA 3FZMA 3DLEA 4J2EA 2A40A 4A5BA 5FPNA 3QEWA 2NRWA 4H0PA 5DM7L 2HVHA 4BC2A 4B8AB 3DJCA 4JK8A 4Z4GA 5HOOA 1LV5A 4O55A 3AA2A 4JKAA 3QEIA 1IO2A 3LP2A 4JYAK 3NMUA 3J7ZO 4DF8A 4H0OA 3G10A 4M45A 4RW9A 4BRCA 1B9DA 4J2BA 1C0FA 3MCAB 1UA1A 4AHRA 1QVFM 3HL8A 3AVBA 4AF1A 4PWDA 4KHQA 4CZHA 2A41A 2E2NA 4GVMA 3KLEA 1K9MO 3RRGA 3NVMA 3AVAA 2I5JA 4FWNA 1N6QA 4FJNA 3QMLA 4O5BA 4BR2A 4C8KA 4ELUA 4CI6A 4FK4A 4CECA 4LF6K 5JLHA 3ZT4A 4M3YA 3ZCMA 3JXUA 4E1JA 4JKCA 1YI2N 3L2UA 3T3FA 4PHTX 3A8YA 3VQ7A 3DXKA 5CZ1A 3CFPA 1OH8A 3PV8A 3SLCA 4BE2A 1NKCA 4HTUA 4CCHA 5AQGA 2HBJA 3V9WA 1JXBA 4BE0A 2GEMA 4CEEA 2G8UA 3NF9A 3MK6A 3UKRB 4JS4A 5J1EA 1HR0K 2PBDA 2PY5A 2HNDA 4CZGA 1TUUA 4ILHA 3WXJA 3CJBA 3QBWA 1KQSM 3AVGA 1VQ7N 3LPUA 4KH6A 3U4LA 1BISA 4H03B 1TAQA 5C2FA 4DKWA 1HPMA 1TKXA 3ISNC 2EHGA 3R8EA 4YOWA 1VSIA 4G1QA 3ZT2A 2ZWHA 3R1XA 2P9NA 4BVOA 3ZT0A 3QEVA 1QSLA 1J6ZA 1JLBA 3QFUA 3I33A 1SV5A 1K8KB 3OTOK 4DUYK 4BGAA 5AQSA 5KPTA 1YTAA 2HF3A 1RDCA 3V9SA 1S1WA 3TSPA 1BIZA 3SV3A 4YOVA 4AILC 3P39A 1WSIA 3LM9A 3PSIA 3LDNA 5IWAK 2QWPA 3SK3A 4CVNE 5M1PA 4AHTA 2UUAK 3S3NA 1CXQA 4JKEA 4FLTA 4BGBA 1QHTA 1HYZA 3OW2M 3GOIA 4WQ4A 4H8KA 3O5BA 4E7LA 1GLBG 1NGAA 3L8BA 2OCEA 1YVNA 4C23A 3EEQA 4CK2A 2ZE2A 2X78A 3ZYYX 4FJMA 2GWKA 5JS1A 3CCVN 2Q1NA 4FW1A 4C1NI 3ZEUA 3JAMO 4RCHA 1JJ2M 5C15A 1ZXOA 3WEEB 3O9UA 4CHOA 1SKWA 4CJRA 3HO1A 4KHWA 4MDBA 4FVUA 1C0TA 1VQKN 1KXPA 3T1HK 4IG0A 3C6AA 5J2QA 2XHBA 3CCMN 1CLQA 2E4LA 2O4IA 1KD1O 1Q7YO 2G8WA 4AM7A 4E1NA 1RDDA 2B5JA 3GG4A 3VQQA 2QW9A 2V51B 4DSEA 4DCHA 2A42A 4CFAA 3EY1A 1N5YA 3QDKA 1VK0A 1VSKA 4DTRA 3PLAA 1QS4A 4QCLA 2BDPA 3MCPA 4IO9L 1ASVA 4I2PA 1BHLA 5CHIA 1NKEA 4CGJA 1VQ5N 3CM6A 4RW7A 3MN7A 4DS5A 3AA3A 3DI6A 2P9LA 3QIPA 3T19A 3OYJA 5AQPA 4M3ZA 1FKPA 4KPYA 3S9HA 4BR7A 5ADXH 4GW6A 3OYKA 3SQ0A 3L2WA 1V4TA 2YKMA 3E66A 3H1VX 2HMIA 3QETA 5GIOA 4OGEA 4R5PA 3L2QA 1U04A 1NGEA 4CF1A 4NCAA 3KJVA 3DRPA 2Z1GA 1SAZA 2RF2A 2BTFA 3C95A 4M41A 4DQIA 4J2AA 1NMNA 3FZKA 4KH5A 4U67L 4B9UA 4JK7A 4ID5A 1UA0A 3U6FA 1KSPA 4BROA 1BCOA 1YF5L 1VSEA 1X3NA 4JI2K 3O3GA 4E7HA 4EZ9A 4DV7K 1SZ2A 2Y1IA 4IO8A 1TKTA 4BC3A 4XH1A 1S22A 3BF3A 3OBYA 3K58A 4K43A 4AQYK 1S5JA 4PL7A 2GELA 2WFBA 1VQLN 3EKSA 2OPSA 4OLBA 2OTLN 1NK5A 3IG1A 3RR7A 3FZHA 5KGXA 2CH5A 5F1XA 5KTQA 2UXCK 3V9UA 3VGMA 1BO5O 4DU1A 2O8BB 2RN2A 1QQNA 1RDWX 1CZ9A 2P9LB 4FLVA 4NLCA 2HHVA 2HNYA 4MDAA 2GX9A 3E01A 1NJYA 1JCFA 5HBMA 2GV9A 1VSFA 3RRHA 4CJ4A 2IIRA 4RG8A 3ZX3A 3V6DA 3TWHA 4JNEA 2HF4A 1GOAA 4KKOA 2IOCA 1S6PA 2YNGA 3DOLA 3U8XA 4BR9A 3HOSA 3SUQA 5LL6Z 4BE1A 2E8AA 2HBMA 5CZ2A 1RTIA 3AO2A 4FLZA 4DTOA 5LJWA 3VGKA 2ZGZA 4A57A 2FSKA 4KHNA 3FLCO 2QKBA 3EE8A 4OKEA 1U48A 1L3UA 3HM8A 2JWLA 1D9FA 1HQUA 4E7KA 4OO1J 1ZBLA 4DU4A 3HVTA 2HB5A 5BR8K 1NGBA 3G0ZA 2GUIA 2ASOA 4PA1A 3IRXA 4FWQA 3TAPA 4DV2K 1EO1A 4ELTA 3A5LC 3LP1A 3SUNA 4IEIA 1HJOA 4HVJA 1NJIO 1U2VA 4BR0A 4FWSA 1U2VB 4FWMA 3D0PA 3NF6A 4DUZK 1WAJA 1BQMA 1GLJO 3EL2A 5K14A 1YAGA 2P9UA 3LDLA 3LAKA 4CHYA 1HUXA 3M8SA 4FJ8A 5J2NA 3UIQA 4AHVA 2FBTA 2VYPA 4GY2B 4LH5A 1S1TA 2D4WA 4DV0K 4O44A 3P38A 1G15A 1VSDA 3RSEA 4ISGA 1M90O 3MX2A 5AQLA 3TANA 3WNFA 1L5UA 4F3TA 2YHBA 2IAJA 3LM2A 4DV5K 2RKIA 4M7YA 5AQYA 1FK9A 1TVRA 3L0QA 3OHRA 4CJEA 5KPRA 3ENBA 3CFOA 2I7NA 2F8SA 4CJ3A 2FBVA 2E2OA 1XC3A 1IV0A 3O1BA 1TUYA 1XHZA 5KI6A 4N41A 1HNVA 4CJVA 5JMVA 5GADP 4B3OA 1BU6O 4M63C 3KLGA 1NGGA 4FWOA 3IDHA 1LW0A 3D2FA 5FLXO 2O8CA 3DXMB 1LWEA 1BUPA 2DTUA 1VHXA 4BRGA 1NU0A 1ASUA 3IFRA 2VGNA 4YOXA 2I7PA 3ALYA 3CPWM 5AQNA 5FRMA 4BC4A 2UU9K 2OZMA 4JHDA 2A1SA 4JD2A 3M1FA 1EWQA 1RT6A 1RT5A 5HRSA 4BWMA 3NBPA 4DR5K 3TAGA 1Y64A 4CF9A 3K9KA 1B9FA 2D0PA 2ZJQL 2UXBK 3OYFA 1Q9YA 4H0YB 3MEDA 2FBXA 4A5AA 1OKJA 2D0CA 5LMUK 4M42A 1RGIA 1HYSA 3KWGA 4KFBA 4AM6A 4FWKA 2YHWA 5I9EB 2O4GA 3VQDA 3HI0A 3A2FA 3MWTA 1IKYA 1QQOA 1RBSA 4OPJA 2QK9A 2JWKA 1JLFA 1I39A 2GWJA 3EYZA 1NK7A 3RR8A 3TAMA 5IT9O 1Z25A 4FZXC 3N4PA 2IVOA 3M8RA 4CEZA 4I7FA 1VQ6N 4CHPA 1YVUA 3VF4A 4M3WA 2UUCK 2YI1A 3ASMA 4GV9A 4FVMA 3CERA 1RBUA 4DFPA 4JLHA 4JKGA 3VERA 1IKVA 1K73O 4I9LA 3KWIA 1UOCA 3R6MA 3D2EB 4FPBA 4FJLA 1HKGA 3LP0A 4KB0A 3K5MA 3OYMA 3SQ2A 3AVMA 4B9LA 3KD5E 3THXB 4B08A 3R9PA 2HW3A 1N36K 1TL1A 4CEBA 2FF6A 4MO4A 3W0LA 1GLDG 5JICA 4DF4A 4DWIA 1N34K 4H0XB 3OBWA 1SUQA 4HHTA 3ZSZA 1T03A 1IJJA 4E7JA 3VQAA 3LDQA 4N5SA 4CJKA 2NRXA 1IBLK 4B9MA 3AVIA 4BRLA 4CBUA 3BZKA 2AA4A 1XHXA 1HKBA 3ZX2A 3WXLA 3OA9A 4UQGA 4FLYA 3CCLN 1HMVA 4FM0A 1RT3A 1ZBUA 3O1WA 4CF8A 3CCQN 2P9KB 4IEEA 3V1QA 3LL3A 3TPQA 3I56N 1N32K 3DMJA 1GLCG 4IDKA 4CJPA 4BRMA 3RMDA 4G9ZA 2OANA 4QS9A 4MQ3A 4CEDA 5GAHP 3KD1E 4EAHD 2QEXN 1Q18A 4GKKK 2LSNA 4O5FA 3BY5A 4WQ4C 1QQMA 3DXMA 4CIEA 2YNIA 3KK2A 3L2VA 1T7PA 4RW8A 4F4KA 2KQ2A 3KIOA 1ZBHA 1OH7A 4E89A 4KI4A 3NH2A 3A5NC 4W5OA 4YY3K 2WBNA 3O80A 3CJ1A 1NBWA 1VQPN 2CH6A 4NYFA 3ZETA 5BN8A 3UB5A 4UY8O 5TKWA 2A1RA 1JL2A 1XC9A 3O6WA 2HHTA 2FSJA 1RDUA 5KRSA 2XY7A 5B8HA 3O3FA 2VGMA 4DTUA 4BRNA 2ASMA 1TK0A 3I0SA 1U4BA 2V52B 5AR0A 4AHUA 2YHXA 4DFJA 2G8VA 3LAMA 5EU7A 1JKHA 2NRHA 2RE2A 3AVFA 5AQOA 4CF0A 4X64K 4FM2A 2DFHA 1Q82O 4RW4A 4CZLA 5KGWA 3NFAA 1D4XA 4CZJA 3HT3A 4BRHA 4YOUA 5FPDA 4CJUA 1E3MA 5CYMA 4M3RA 2Q0RA 1Q9XA 1JLEA 4FWPA 4YOTA 3PUFA 3DRRA 3WNGA 1HJRA 5GAEP 1S6QA 1HX1A 4RTFD 4DQQA 1VAZA 3AVLA 4B9NA 1RCHA 3K9JA 4Q0BA 4DTSA 4JKGB 1BI4B 3MAQA 1X1PA 4AHSA 4DTXA 3TARA 2QXLA 2KHOA 1HNZK 3VENA 5HL7L 1NGFA 4H5VA 4BRIA 3VMFB 4CFBA 5BRFA 1C0GA 2P9IB 4JK9A 4A61A 4KTZA 4K25A 3THVA 4B9QA 2FLOA 1WN7A 1BQNA 1N8RO 1IKXA 4WE1A 2IDOA 3JSMA 4FW2A 4NYNA 5HROA 4XEIA 1BL3A 3O9SA 1SS6A 3B6OA 3F73A 4HCCA 1QZ5A 5LMNK 5D3GA 1JCGA 3OVNA 2G8IA 3BUZB 1KLNA 4EP4A 2PZSA 4H5WA 5J2PA 3OYDA 1HLUA 2XY8A 3KKSA 3VGLA 1EQYA 4BRFA 3ITHA 3TAFA 3UKUB 1T05A 3RMBA 5I42A 3EZWA 2VQFK 2G8HA 3D2FB 2QWQA 4JKDA 4FO0A 2QWNA 3TAEA 4WF9L 5J2MA 2NUBA 1NG9A 4CGFA 2IC3A 3MEGA 5A2QO 3TSQA 2HHWA 3QNOA 2NZTA 2P5GA 4EHTA 5ADXA 2KLAA 4ILJA 3CJAA 2Z1JA 3AVNA 4LFBK 4FJGA 3WNHA 4CJFA 2FBYA 3QEPA 4E0DA 3TR8A 3AO5A 4O4GA 1J5OA 1IBKK 3M8PA 1T8EA 4DSJA 3RVCA 1S9GA 2HOEA 3ZX0A 1JCEA 1ESVA 1WBBA 1KVAA 3MN9A 3AV9A 4DSLA 3VQCA 4IOCL 4M3TA 4JAXA 3T1AA 1NWKA 4DG1A 1O13A 4CESA 3ULEB 5KQDA 1U47A 2PAVA 2XY6A 1YJ9N 4PL8A 3F9MA 2F4VK 4EFHA 3CCRN 4DQSA 3L6QA 4CZKA 1LCUA 4RW6A 1RTJA 3CFRA 1NK8A 4BRQA 3SAFA 3QINA 3G71N 1TYQA 4JI6K 1D9DA 1VRUA 1BA1A 3J80O 1BI4A 4OPHA 1VQ9N 1Z6RA 3LZIA 2NRVA 1BDGA 3OYLA 4IJNA 5C12A 2KW4A 1GLAG 3DOKA 2ITMA 2X74A 2HHUA 3VA3A 3NH0A 1XMQK 2A3ZA 3OY9A 4LF9K 3C7NB 3VEVA 4KRFA 3HRGA 2A5XA 4IZ9A 2W41A 3MMVA 3B8AX 3OYEA 3M5RA 2VG6A 1BWFO 3SAGA 4FM1A 1DKGD 4HCBA 1KCFA 2WC9A 4JI1K 4WQ5C 1T6CA 4FK0A 5MLCQ 2E20A 4LFCK 2VWKA 3BP8A 4Z4FA 4BR4A 3HOTA 1CZAN 1IG8A 5DM6L 2PYLA 1SL0A 2E6LA 3CIPA 3HK2A 3CXCM 5AQRA 3V1RA 3AARA 3O08A 4N47A 5SZTA 1WSGA 1FXXA 5HLFA 1LWFA 4CIGA 1W97L 3M8QA 3AGRA 2AP1A 4HUFA 2DFFA 4DSFA 4CEFA 1TGOA 2D0AA 4PKHA 1EX4A 3H46O 4PKGA 5AQMA 3THYB 3CI5A 1K6YA 1RT7A 1J9AA 4B9VA 5BN9A 2YCHA 4CGGA 4K42A 2Q3SA 3FFIA 3K0SA 3HSTB 3HP9A 2KFNA 1HPZA 2Q97A 2KFZA 3TTDA 3NGZA 1ATNA 2O8FB 2O8CB 2O8FA 1NKBA 1XNRK 4O0JA 3GDQA 1OVQA 3KVGA 4N76A 4FOEA 2P9SB 4BDPA 3OYAA 3AA4A 3WXKA 2ZJRL 5AFUA 1S1VA 4JHDB 2BH1A 3VTHA 3L3VA 3K5OA 3K57A 4JS5A 1IBMK 4OX9K 3VEOA 3ZT3A 3SI6A 3HPGA 3ZLJA 1N33K 5C0YA 4B1YB 3K59A 4C8OA 3LANA 2Q31A 4MO5A 2OA8A 3J7YP 2KZMA 2O8EA 4CGHA 3MWPA 1L3SA 2XRIA 3O9RA 2E2PA 5AQQA 1YT3A 4H5NA 4O8UA 4QOZB 2P51A 4FJ7A 4BQLA 2FF3B 2QWMA 3WXMB 3FFKB 3ZSRA 4FJHA 3VEWA 3UKRA 5M1NA 4ELVA 4A2AA 5BR9A 3HM9A 4H0TB 1P90A 2JGUA 4YDUC 1TKDA 3DLHA 3L4QA 1OVYA 4KI6A 2D0OA 3D2EA 4GMJB 1Q86O 1EXQA 2KTQA 4K0KK 5AZJA 5T7BA 4XH4A 1I94K 3QFPA 1UAXA 4KREA 3SQ1A 3HJFA 2OPRA 3IKMA 2P9KA 2VG5A 5HP1A 3V9ZA 2CGJA 3TTCA 2WONA 3AAQA 2X6SA 4QAGA 3SPYA 4GVEA 2AJQA 2OTJN 2GTDA 1NGHA 4PKIA 3HZ6A 5F0XA 4OKKA 3OYHA 3PY8A 1BA0A 1A5XA 4H4MA 3PSFA 5FPEA 1D5AA 4KO0A 2Y1JA 1RILA 1C6VA 4WQ5A 3VTIA 5LJVA 4FJ5A 3EZ5A 1BOTO 3SUOA 3CJCA 4WFNL 4NXMK 4X62K 4LSNA 2QWRA 3CCUN 4KV8A 5AQFA 1S9EA 4KTWA 3SBGA 4X66K 3VQ8A 3OJUA 2HVIA 3PIOL 1J54A 3E9PA 4M3XA 3SUPA 1ZYQA 1SQKA 4OPAA 3VA0A 4M3UA 1SKRA 2YNFA 1EETA 4DV6K 3ID6A 2HNZA 4DR3K 1RTDA 4LF4K 3CCJN 4MLEA 3B6PA 1WNSA 2OPQA 2FXUA 3L4IA 5BREA 2F96A 3K5NA 1NK4A 1FKOA 1NJZA 5C24A 2F7TA 2V7YA 1RFQA 3AY9A 3IS9A 3UKUA 1KTQA 3RMCA 4DTNA 2P9SA 3D6RA 4CFCA 1LW2A 2YX6A 3K2PA 3JYTA 3VQ5A 1MDUB 4W5NA 3SQ4A 4LF7K 4B3SK 3ATUA 4OPKA 5AQWA 1WBDA 4BDYA 3CPEA 1R59O 2YJEA 1NGCA 3OYGA 3VQ9A 5BRHA 1JXEA 3AO4A 5AQVA 1VQNN 1MA9B 2O8DA 4KHYA 2F9TA 2QM1A 2BE2A 2VWJA 3R3LA 2O8BA 3PIPL 3DM2A 3W3DA 4PY5A 2Q2RA 3DLGA 1RT2A 4M7XA 3SJHA 3RTVA 3H6EA 3MDQA 4Z4HA 4H5RA 3HXMA 5AQZA 5JVHL 2X6NA 4CGIA 4GV3A 1LOTB 4CK3A 3MEEA 4OVLA 4ISEA 5JLFA 3OYNA 4IDHA 3CJ7A 4XH5A 2IGIA 4NCBA 1KVCA 3JS6A 1VQMN 4KH4A 3LDOA 3C94A 4DR2K 3AGKA 4BY9C 1VSLA 5AQJA 3L3UA 3ZSYA 1S1UA 4FXDA 3FZLA 1YIJN 4BRPA 4K8ZA 4NCGA 3K5LA 3WEEA 4L8RB 3THWA 3O9TA 3LDPA 3NAEA 1F21A 3O4QA 3CQYA 4FLWA 3VEZA 4ZTFA 1IKWA 2E1ZA 3HPHA 1VSMA 4I9QA 1NK9A 2YKNA 5JVGL 4JKHA 4JI0K 3PX6A 2VWBA 3CC2N 3KK7A 4FLXA 2IVPA 3KK3A 3HTVA 2ZM6K 1C1CA 1WSHA 1MWMA 2HHSA 3F9KA 4FSVA 4CJWA 1Q8IA 1GLFO 1JLCA 4KBOA 3ZSVA 3LP3A 4CJLA 5BPNA 5LY3A 5E84A 2UYTA 3CCEN 4PQUA 5BPLA 4RWTA 4FZZA 4BRKA 1U45A 2CGKA 4LD0A 3SV4A 4IFVA 2W6LA 3T69A 3LZJA 3H1QA 4CFDA 4DHYA 4W5TA 2H3GX 3C65A 1VQ4N 3ZETB 3SMSA 4C8LA 4BVPA 3DLBA 3VPZA 4BQZA 4YOYA 1ZBIA 4JI7K 1WSJA 3G25A 4U7BA 1X9WA 3THYA 3OS2A 5AZIB 4LFAK 3CETA 3OYCA 3KLIA 3F5TA 5EVZA 5CR4A 3HPOA 1ATSA 1C1AA 3S41A 3V4IA 3P4IA 5AQIA 4B1XB 2YHYA 4CZFA 4ISFA 3G6EN 2W6KA 5C2DA 2ATQA 3VF6A 4CJTA 3C7NA 2QWLA 2Z1HA 4CD1A 3HBTA 4CGDA 3QLHA 4FJKA 4IFEA 1WUAA 3VQBA 2VCPA 2YJFA 3EO3A 4JD2B 4IWVA 3A0IX 5HRRA 3KLHA 3QICA 4EHUA 3QO9A 5TKYA 1DT9A 2E6MA 3THXA 1FJGK 4HUEA 4Z0UA 3SBTA 2WOMA 5EOYA 4DTPA 5AZJB 3E9LA 1VSHA 5ELZA 3OYBA 5H1SQ 3ATVA 5HRPA 3MXIA 1TAUA 3VN5A 3U3GA 2E1YA 5FDLA 4DV3K 2D0BA 3PX4A 3Q7CA 1X9SA 4JRPA 1CZBA 5DK5A 5AJ3K 1IG9A 4CEAA 1NK0A 4JRQA 1YUWA 1O1WA 1QZ6A 4KHUA 1A5WA 3MXJA 1RTHA 1P8ZA 4F3OA 3AVKA 3EE9A 5BPMA 4MFBA 2IVNA 4HWIA 4FCYA 3N4QA 4JN4A 5CY4A 1JLQA 2DFEA 1NM1A 4IJAA 3O4WA 1NMDA 4O8KA 2ZGYA 3MECA 4CHQA 1TV6A 4GNIA 4FJXA 3CC7N 3SAHA 2O8DB 4CJSA 1W2BM 3CMEN 3I55N 4DSKA 2ETJA 4MLHA 4XIUA 3QERA 1SKSA 1T3VA 3EN9A 4CIFA 3J81O 3DLRA 2OYQA 1R0AA 2UXDK 4CJ7A 4Z4CA 4LC9B 4V19S 3U3YA 4Z94A 3WQTA 4O0IA 1U49A 1KAZA 1S1XA 2E2QA 4DB3A 4IFYA 1OH5A 1LWCA 1VRTA 2HBLA 2HBKA 1WSEA 2P9UB 1J53A 1GOBA 1Z26A 5DMRA 3LWLA 2YV0X 5FPMA 3ULDA 3O4NA 3DXKB 4B9SA 1JLGA 3IAYA 1GLEG 4Z4EA 3H08A 1YHQN 3VQPA 4DSIA 1B92A 3AAPA 4Y0WA 1RBRA 4FL9A 5GINA 1WOQA 2QA4N 3VOVA 4LF8K 3SCXA 1TK8A 3P31A 3VQ6A 1HNXK 3KK1A 3FZFA 2P9IA 4DV1K 2QXFA 4ID1A 3WXIA 1D8YA 3NHGA 2A6AA 4DU3A 3QBXA 3AVCA 4I6MA 1HNIA 5E26A 4OKJA 2W42A 3TAQA 3AA5X 3HVRA 1L3VA 3RMAA 3BGRA 3WQUA 1DEJA 5EXWA 1OH6A 3NF7A 4DS4A 5AFUH 4EIAA 2HHXA 4DV4K 4CZMA 2NLXA 1C0MA 4CEQA 2BANA 2HHQA 1W9HA 2HMPA 1I3AA 3IMXA 2YNHA 4CBXA 4QS8A 4H4OA 4L3QA 4HUGA 3CF5L 3FR0A 1E4FT 3M3ZA 2WUSA 2UUBK 1NK6A 4BDZA 4FWRA 3ZSOA 1M1KO 4LF5K 1VQ8N 2Z1IA 4CHNA 1U6ZA 2XO7A 1K8KA 1NGIA 4EP5A 2G8FA 3U9DA 1CXUA 2HHHK 2V7ZA 2VG7A 3NDKA 1BGXT 3A5OC 3TTFA 4CHZA 3O9QA 1G99A 1JLAA 1EWRA 1XWLA 3P83D 1X9JA 3P5JA 4JKBA 3BDPA 3AO1A 1Y97A 1X9MA 1QTMA 4YHHK 1NOZA 4X65K 4OJRA 1XNQK 3C0BA 4LH4A 4H5TA 4K41A 5EX5A 4WFBL 3ULEA 4E3SA 5FRNA 3S3MA 1KVBA 3FGUA 3PO4A 5AQKA 4EZ6A 1H1VA 1ZBFA 4B9TA 4C8MA 1DTQA 3F2KA 2ASPA 3CQ8A 1ZBSA 2HSTA 3CCSN 3EKUA 2Q36A 4IXCA 4J8FA 3S3OA 4C1NK 4WFAL
chains in the Genus database with same CATH topology
4CF8A 1VSIA 4LSNA 4G1QA 4OGCA 3ZT2A 4FJIA 4KV8A 2G8KA 1S9EA 4KTWA 3V1QA 3VQ8A 4DTJA 3OJUA 3ZT0A 5HRNA 3QEVA 2PYJA 1QSLA 2HVIA 1JLBA 3LDSA 1SV5A 3DMJA 1J54A 4IDKA 4CJPA 4M3XA 3SUPA 1ZYQA 3RMDA 1YTAA 4F2RA 3C6TA 1RDCA 3VA0A 2F8TA 4M3UA 4MQ3A 1SKRA 4FK2A 3V9SA 2YNFA 4CEDA 1EETA 3ZSXA 1S1WA 2HNZA 5E41A 3KD1E 1RTDA 3QIOA 1RBTA 2LSNA 1BIZA 3SV3A 3B6PA 4C8NA 1WNSA 3DYAA 4AILC 1WSIA 2OPQA 3K5NA 2F96A 4CIEA 2YNIA 3KK2A 3L2VA 1FKOA 1NK4A 1KRPA 2RPIA 1NJZA 1T7PA 4RW8A 4F4KA 1TK5A 4AHTA 5C24A 1ITGA 2KQ2A 4E19A 3S3NA 1CXQA 3IS9A 4FLTA 1KTQA 1QHTA 3KIOA 3RMCA 1HYZA 1ZBHA 4E89A 4DTNA 4CFCA 4LSLA 1LW2A 4KI4A 5I3UA 3K2PA 3AO3A 3JYTA 4H8KA 3VQ5A 3NH2A 4W5NA 1RBVA 4W5OA 4E7LA 3SQ4A 3L8BA 4IG3A 4NYFA 1TL3A 5JS2A 4OPKA 4CK2A 3QNNA 3D45A 4BDYA 3RWUA 2ZE2A 2X78A 3V1OA 3OYIA 2A1RA 4FJMA 2G8WA 1JL2A 4F8RA 3OYGA 5JS1A 1XC9A 2HHTA 4FW1A 3VQ9A 1JXEA 4CE9A 5KRSA 3AO4A 2XY7A 2OZSA 3O3FA 4DTUA 4KHYA 4IBNA 4CHOA 1TK0A 1SKWA 2BGGA 2BE2A 2VWJA 4Y1DA 1BCMA 4CJRA 3QESA 3HO1A 3LALA 4KHWA 2B6AA 1KLMA 1C0TA 3NGIA 1KFDA 3DM2A 3I0RA 3I0SA 1U4BA 2DY4A 4IG0A 3P1GA 5J2QA 4AHUA 4DFJA 2G8VA 2XHBA 1DTTA 1CLQA 4PY5A 2EX3A 3DLKA 2E4LA 3DLGA 1RT2A 4CERA 2O4IA 3RTVA 4Z4HA 4W5QA 3HXMA 3LAMA 4E1NA 5EU7A 1JKHA 1RDDA 2B5JA 2X6NA 3AVJA 3VQQA 4CGIA 3OS0A 3AVFA 4CF0A 4FM2A 2DFHA 4CK3A 4RW4A 3MEEA 4F2SA 1QE1A 4OVLA 2ITGA 4DSEA 5KGWA 3NFAA 3HT3A 4CFAA 3EY1A 1N5YA 4CJUA 4BACA 1VK0A 5CYMA 4M3RA 3OYNA 1VSKA 1Q9XA 1JLEA 4YFUA 4DTRA 2ZD1A 2IGIA 1QS4A 3PUFA 3DRRA 3WNGA 1HJRA 4B8CA 4NCBA 1KVCA 4QCLA 1S6QA 2BDPA 4DQQA 1ASVA 3AVLA 4I2PA 4B9NA 1RCHA 4I2QA 4Q0BA 1DLOA 1BHLA 4DTSA 4DFKA 1BI4B 3C94A 1X1PA 4AHSA 3I8DA 3MAQA 4DTXA 2P1JA 3TARA 1NKEA 1VSLA 3ZSYA 3L3UA 1S1UA 4CGJA 4FXDA 3CM6A 4RW7A 4DFMA 4CFBA 4DS5A 3AA3A 3DI6A 3QIPA 4DQPA 3T19A 3OYJA 4K8ZA 4NCGA 3K5LA 4KTZA 1FKPA 4KPYA 4L8RB 3THVA 4M3ZA 1WN7A 3S9HA 5C42A 1BQNA 4CF2A 3NH1A 3AVHA 1IKXA 3NAEA 3PX0A 3NF8A 5CYQA 4GW6A 1F21A 3O4QA 2IDOA 4WE1A 3OYKA 3SQ0A 3L2WA 4FLWA 3JSMA 1NOYA 4ZTFA 1IKWA 2YKMA 3HPHA 4FW2A 1VSMA 4NYNA 1BL3A 3WNEA 3TABA 3QETA 5HROA 1NK9A 1RT1A 2HMIA 4I9QA 4KTQA 2YKNA 4OGEA 4R5PA 3B6OA 3L2QA 1U04A 3KLFA 3F73A 4CF1A 4HCCA 4N56A 3PX6A 4NCAA 5D3GA 3OVNA 4FLXA 3KJVA 3KK3A 4KHSA 2G8IA 1KLNA 4EP4A 2PZSA 3DRPA 2Z1GA 2RF2A 3C95A 1C1CA 3OYDA 5J2PA 2XY8A 4M41A 1WSHA 3KKSA 4DQIA 4PUOA 5FROA 3F9KA 3ITHA 3TAFA 4CJWA 1T05A 4J2AA 2HHSA 1Q8IA 3RMBA 1JLCA 5I42A 3ZSVA 4B9UA 3LP3A 4ID5A 3SPZA 4CJ5A 4CJLA 3U6FA 1UA0A 1KSPA 2G8HA 1BCOA 1VSEA 2B4JA 4TSXA 3O3HA 3O3GA 4E7HA 4EZ9A 3TAEA 2Y1IA 4PQUA 5J2MA 1REVA 1TKTA 1GOCA 2NUBA 4CGFA 4FJJA 4FZZA 1HRHA 1U45A 3K58A 4LD0A 2IC3A 3MEGA 3SV4A 4IFVA 2HHWA 3QNOA 3LZJA 2P5GA 4CFDA 1S5JA 1TKZA 4FZYA 3HP6A 3PO5A 2OPSA 4W5TA 4OLBA 2Z1JA 1EP4A 3CG7A 4FLUA 3IG1A 1NK5A 3AVNA 3ZT1A 3V81A 1RNHA 3RR7A 4Z4IA 4FJGA 3WNHA 4CJFA 2FBYA 1C1BA 5KGXA 5KTQA 4C8LA 3DLBA 3SZ2A 1ASWA 3QEPA 3V9UA 3ZSQA 1ZBIA 4E0DA 3TR8A 1WSJA 4DU1A 1X9WA 4W5RA 3OS2A 1SL1A 3AO5A 2RN2A 4O4GA 1CZ9A 1J5OA 4FLVA 3M8PA 1T8EA 1SL2A 2HHVA 2HNYA 3OYCA 3KLIA 4DSJA 1S9GA 3NE6A 3E01A 1KVAA 5HBMA 1NJYA 4DSLA 3AV9A 3HPOA 2GV9A 1VSFA 3RRHA 3VQCA 4M3TA 4CJ4A 4RG8A 1C1AA 3V4IA 3T1AA 4DG1A 3V6DA 3TWHA 4DTMA 1WAFA 2D5RA 1GOAA 4KKOA 3NGYA 4CESA 2IOCA 1S6PA 2YNGA 3DOLA 3TI0A 4J2DA 1NJWA 2ATQA 4CJTA 2Z1HA 1U47A 1RDAA 3SUQA 4BE1A 4CGDA 4E1MA 4DQRA 3QLHA 2GBZA 2XY6A 5CZ2A 1RTIA 3AO2A 4FLZA 4DTOA 4FJKA 1QSSA 4FYDA 4DQSA 3VQBA 2P5OA 4KHNA 2QKBA 4RW6A 1RTJA 4OKEA 5HRRA 3KLHA 3CFRA 1NK8A 1U48A 1L3UA 1HYVA 3QINA 1D9FA 1HQUA 3QO9A 4IKFA 4E7KA 1ZBLA 2E6MA 1VSJA 4DU4A 3HVTA 1HQEA 2HB5A 4Z0UA 1VRUA 4ZHRA 4HUEA 1D9DA 3G0ZA 1YTUA 1EKEA 2GUIA 2WOMA 4PA1A 4DTPA 3IRXA 3TAPA 4FJ9A 4ELTA 1BI4A 1JL1A 4OLAA 4CEOA 1VSHA 3OYBA 3LZIA 5HRPA 3MXIA 1WLJA 3LWMA 1TAUA 3LP1A 3VN5A 3SUNA 3U3GA 5FDLA 2R7YA 3PX4A 2D0BA 3OYLA 1X9SA 4HVJA 4JRPA 2KW4A 2QKKA 3DOKA 1CZBA 5DK5A 2X74A 3SYZA 3MXMA 1IG9A 4DLEA 4CEAA 3VA3A 3NH0A 1NK0A 2HHUA 4JRQA 1C0UA 3OY9A 1O1WA 3D0PA 3NF6A 3KTQA 1WAJA 1BQMA 4KHUA 4KRFA 1A5WA 3MXJA 5K14A 4KB1A 5C25A 1RTHA 3LAKA 4CHYA 3OYEA 3AVKA 3M8SA 4F3OA 5J2NA 3UIQA 4FJ8A 4MFBA 2FBTA 2VG6A 4AHVA 5KRTA 4FM1A 1L3TA 4FCYA 4HCBA 3HYFA 4LH5A 5CY4A 2XY5A 5SWMA 1KCFA 1S1TA 1JLQA 2DFEA 4FK0A 4O44A 3CM5A 1G15A 2VWKA 4E7IA 1VSDA 4Z4FA 4Y1CA 3MECA 4CHQA 1W0HA 1TV6A 3TANA 3WNFA 4FJXA 1L5UA 4F3TA 2YHBA 2IAJA 2PYLA 3SJJA 4KAZA 1SL0A 2RKIA 4CJSA 1LAVA 2E6LA 4DSKA 3HK2A 3V1RA 1FK9A 1TVRA 2ETJA 4XIUA 4N47A 3QERA 3VQ4A 4CJQA 5SZTA 4CJEA 1SKSA 4LY7A 1WSGA 4CIFA 1FXXA 3OJSA 5HLFA 1LWFA 4AHCA 4CIGA 3DLRA 3KKRA 3M8QA 3CFOA 2OYQA 2F8SA 1R0AA 4HUFA 2DFFA 2FBVA 4CJ3A 4DSFA 1BIUA 4CEFA 1TGOA 4Z4CA 2D0AA 1MU2A 3U3YA 1EX4A 1QQCA 4O0IA 4DMNA 3SNNA 1K6YA 1RT7A 2ZQBA 1A5VA 1J9AA 4CK1A 1XHZA 5KI6A 1U49A 4B9VA 1HNVA 4CGGA 4CJVA 4N41A 1S1XA 4YNQA 2Q3SA 3FFIA 4B3OA 4IFYA 2IS3A 3KLGA 1RDBA 3HSTB 3HP9A 3ZSWA 2KFNA 1QSYA 1HPZA 1LWCA 1LW0A 1VRTA 2KFZA 3NGZA 1UWBA 1WSEA 4AH9A 1LWEA 1NKBA 1J53A 1GOBA 1Z26A 5DMRA 3LWLA 4DLGA 3C6UA 4O0JA 4ICLA 4Q5VA 2YV0X 3NCIA 2DTUA 1KFSA 3L2RA 3ULDA 4N76A 1ASUA 2JLEA 3O4NA 4ZTJA 4BDPA 1RT4A 3OYAA 1JLGA 4B9SA 3IAYA 4Z4EA 3ALYA 3DRSA 5FRMA 3H08A 2OPPA 3AA4A 3VQPA 1XI1A 4DSIA 2OZMA 1B92A 1RBRA 2A1SA 2KZZA 1S1VA 1RT6A 4BWJA 3V9XA 3QEXA 3LPTA 1RT5A 3L3VA 5HRSA 4BWMA 3OS1A 3SCXA 3K5OA 3NBPA 3K57A 1NJXA 4JS5A 3CYMA 3TAGA 2YHAA 1IH7A 1WSFA 1TK8A 3VQ6A 3ZT3A 3HPGA 3SI6A 4K8XA 3KK1A 2FC0A 4CF9A 1B9FA 1LAWA 3VQEA 3DLEA 3OYFA 1Q9YA 2QXFA 3K59A 3MEDA 2FBXA 4ID1A 4J2EA 4C8OA 1D8YA 2D0CA 3NHGA 4M42A 3LANA 2OA8A 3QEWA 4DU3A 1HYSA 4KFBA 2HVHA 4B8AB 2KZMA 4Z4GA 4CGHA 2O4GA 3VQDA 3AVCA 1LV5A 1HNIA 3A2FA 4OKJA 2W42A 1IKYA 1L3SA 2XRIA 4O55A 3AA5X 3TAQA 3AA2A 1RBSA 4OPJA 3QEIA 2QK9A 3HVRA 1L3VA 1JLFA 1IO2A 1I39A 3BGRA 1YT3A 3LP2A 3RMAA 4QOZB 2P51A 3EYZA 3NF7A 4DF8A 1NK7A 3RR8A 4DS4A 3G10A 3TAMA 4FJ7A 4M45A 2HHXA 4RW9A 1B9DA 4J2BA 3ZSRA 1C0MA 1Z25A 4CEQA 4FZXC 2BANA 2HHQA 4FJHA 1UA1A 1W9HA 1I3AA 3M8RA 4AHRA 4CEZA 3HL8A 4I7FA 3AVBA 4CHPA 1YVUA 4M3WA 3ASMA 4ELVA 4PWDA 4FVMA 3HM9A 2YNHA 1RBUA 4DFPA 4KHQA 4JLHA 4H4OA 4HUGA 3HJFA 4GVMA 3KLEA 1NK6A 3RRGA 4BDZA 1IKVA 3AVAA 3ZSOA 2JGUA 4I9LA 2I5JA 1TKDA 3DLHA 1UOCA 1N6QA 4FJNA 2Z1IA 4KI6A 4O5BA 4CHNA 4FJLA 4GMJB 4C8KA 3LP0A 4KB0A 3K5MA 1EXQA 3OYMA 2XO7A 4ELUA 2KTQA 4EP5A 5T7BA 2G8FA 4FK4A 4CECA 3SQ2A 1CXUA 1UAXA 3ZT4A 4KREA 3SQ1A 3AVMA 4B9LA 2VG7A 2OPRA 3NDKA 3KD5E 4B08A 1BGXT 3ZCMA 4CHZA 4M3YA 2HW3A 2VG5A 1TL1A 4CEBA 5HP1A 3V9ZA 1JLAA 1XWLA 2WONA 3P83D 3L2UA 2X6SA 3T3FA 3P5JA 4QAGA 4DF4A 4DWIA 3BDPA 3SPYA 3AO1A 1SUQA 4HHTA 1Y97A 1X9MA 3VQ7A 5CZ1A 3CFPA 2AJQA 3ZSZA 3PV8A 1T03A 1QTMA 1NKCA 4BE2A 4HTUA 1NOZA 4CCHA 4E7JA 4OJRA 3V9WA 4LH4A 3VQAA 1JXBA 4OKKA 4BE0A 4N5SA 3OYHA 3PY8A 4CEEA 4CJKA 1A5XA 4H4MA 4E3SA 2G8UA 3NF9A 5FRNA 4JS4A 5J1EA 3S3MA 2PY5A 2HNDA 1D5AA 4B9MA 4KO0A 1KVBA 1RILA 3AVIA 1C6VA 2Y1JA 3PO4A 1XHXA 3AVGA 3LPUA 4FJ5A 4EZ6A 3EZ5A 4UQGA 4FLYA 1ZBFA 1BISA 3SUOA 1HMVA 1DTQA 4C8MA 1TAQA 3CQ8A 4FM0A 4B9TA 1TKXA 1RT3A 3ISNC 3S3OA 1ZBUA 2EHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CF8 A;  1VSI A;  4LSN A;  4G1Q A;  4OGC A;  3ZT2 A;  4FJI A;  4KV8 A;  2G8K A;  1S9E A;  4KTW A;  3V1Q A;  3VQ8 A;  4DTJ A;  3OJU A;  3ZT0 A;  5HRN A;  3QEV A;  2PYJ A;  1QSL A;  2HVI A;  1JLB A;  3LDS A;  1SV5 A;  3DMJ A;  1J54 A;  4IDK A;  4CJP A;  4M3X A;  3SUP A;  1ZYQ A;  3RMD A;  1YTA A;  4F2R A;  3C6T A;  1RDC A;  3VA0 A;  2F8T A;  4M3U A;  4MQ3 A;  1SKR A;  4FK2 A;  3V9S A;  2YNF A;  4CED A;  1EET A;  3ZSX A;  1S1W A;  2HNZ A;  5E41 A;  3KD1 E;  1RTD A;  3QIO A;  1RBT A;  2LSN A;  1BIZ A;  3SV3 A;  3B6P A;  4C8N A;  1WNS A;  3DYA A;  4AIL C;  1WSI A;  2OPQ A;  3K5N A;  2F96 A;  4CIE A;  2YNI A;  3KK2 A;  3L2V A;  1FKO A;  1NK4 A;  1KRP A;  2RPI A;  1NJZ A;  1T7P A;  4RW8 A;  4F4K A;  1TK5 A;  4AHT A;  5C24 A;  1ITG A;  2KQ2 A;  4E19 A;  3S3N A;  1CXQ A;  3IS9 A;  4FLT A;  1KTQ A;  1QHT A;  3KIO A;  3RMC A;  1HYZ A;  1ZBH A;  4E89 A;  4DTN A;  4CFC A;  4LSL A;  1LW2 A;  4KI4 A;  5I3U A;  3K2P A;  3AO3 A;  3JYT A;  4H8K A;  3VQ5 A;  3NH2 A;  4W5N A;  1RBV A;  4W5O A;  4E7L A;  3SQ4 A;  3L8B A;  4IG3 A;  4NYF A;  1TL3 A;  5JS2 A;  4OPK A;  4CK2 A;  3QNN A;  3D45 A;  4BDY A;  3RWU A;  2ZE2 A;  2X78 A;  3V1O A;  3OYI A;  2A1R A;  4FJM A;  2G8W A;  1JL2 A;  4F8R A;  3OYG A;  5JS1 A;  1XC9 A;  2HHT A;  4FW1 A;  3VQ9 A;  1JXE A;  4CE9 A;  5KRS A;  3AO4 A;  2XY7 A;  2OZS A;  3O3F A;  4DTU A;  4KHY A;  4IBN A;  4CHO A;  1TK0 A;  1SKW A;  2BGG A;  2BE2 A;  2VWJ A;  4Y1D A;  1BCM A;  4CJR A;  3QES A;  3HO1 A;  3LAL A;  4KHW A;  2B6A A;  1KLM A;  1C0T A;  3NGI A;  1KFD A;  3DM2 A;  3I0R A;  3I0S A;  1U4B A;  2DY4 A;  4IG0 A;  3P1G A;  5J2Q A;  4AHU A;  4DFJ A;  2G8V A;  2XHB A;  1DTT A;  1CLQ A;  4PY5 A;  2EX3 A;  3DLK A;  2E4L A;  3DLG A;  1RT2 A;  4CER A;  2O4I A;  3RTV A;  4Z4H A;  4W5Q A;  3HXM A;  3LAM A;  4E1N A;  5EU7 A;  1JKH A;  1RDD A;  2B5J A;  2X6N A;  3AVJ A;  3VQQ A;  4CGI A;  3OS0 A;  3AVF A;  4CF0 A;  4FM2 A;  2DFH A;  4CK3 A;  4RW4 A;  3MEE A;  4F2S A;  1QE1 A;  4OVL A;  2ITG A;  4DSE A;  5KGW A;  3NFA A;  3HT3 A;  4CFA A;  3EY1 A;  1N5Y A;  4CJU A;  4BAC A;  1VK0 A;  5CYM A;  4M3R A;  3OYN A;  1VSK A;  1Q9X A;  1JLE A;  4YFU A;  4DTR A;  2ZD1 A;  2IGI A;  1QS4 A;  3PUF A;  3DRR A;  3WNG A;  1HJR A;  4B8C A;  4NCB A;  1KVC A;  4QCL A;  1S6Q A;  2BDP A;  4DQQ A;  1ASV A;  3AVL A;  4I2P A;  4B9N A;  1RCH A;  4I2Q A;  4Q0B A;  1DLO A;  1BHL A;  4DTS A;  4DFK A;  1BI4 B;  3C94 A;  1X1P A;  4AHS A;  3I8D A;  3MAQ A;  4DTX A;  2P1J A;  3TAR A;  1NKE A;  1VSL A;  3ZSY A;  3L3U A;  1S1U A;  4CGJ A;  4FXD A;  3CM6 A;  4RW7 A;  4DFM A;  4CFB A;  4DS5 A;  3AA3 A;  3DI6 A;  3QIP A;  4DQP A;  3T19 A;  3OYJ A;  4K8Z A;  4NCG A;  3K5L A;  4KTZ A;  1FKP A;  4KPY A;  4L8R B;  3THV A;  4M3Z A;  1WN7 A;  3S9H A;  5C42 A;  1BQN A;  4CF2 A;  3NH1 A;  3AVH A;  1IKX A;  3NAE A;  3PX0 A;  3NF8 A;  5CYQ A;  4GW6 A;  1F21 A;  3O4Q A;  2IDO A;  4WE1 A;  3OYK A;  3SQ0 A;  3L2W A;  4FLW A;  3JSM A;  1NOY A;  4ZTF A;  1IKW A;  2YKM A;  3HPH A;  4FW2 A;  1VSM A;  4NYN A;  1BL3 A;  3WNE A;  3TAB A;  3QET A;  5HRO A;  1NK9 A;  1RT1 A;  2HMI A;  4I9Q A;  4KTQ A;  2YKN A;  4OGE A;  4R5P A;  3B6O A;  3L2Q A;  1U04 A;  3KLF A;  3F73 A;  4CF1 A;  4HCC A;  4N56 A;  3PX6 A;  4NCA A;  5D3G A;  3OVN A;  4FLX A;  3KJV A;  3KK3 A;  4KHS A;  2G8I A;  1KLN A;  4EP4 A;  2PZS A;  3DRP A;  2Z1G A;  2RF2 A;  3C95 A;  1C1C A;  3OYD A;  5J2P A;  2XY8 A;  4M41 A;  1WSH A;  3KKS A;  4DQI A;  4PUO A;  5FRO A;  3F9K A;  3ITH A;  3TAF A;  4CJW A;  1T05 A;  4J2A A;  2HHS A;  1Q8I A;  3RMB A;  1JLC A;  5I42 A;  3ZSV A;  4B9U A;  3LP3 A;  4ID5 A;  3SPZ A;  4CJ5 A;  4CJL A;  3U6F A;  1UA0 A;  1KSP A;  2G8H A;  1BCO A;  1VSE A;  2B4J A;  4TSX A;  3O3H A;  3O3G A;  4E7H A;  4EZ9 A;  3TAE A;  2Y1I A;  4PQU A;  5J2M A;  1REV A;  1TKT A;  1GOC A;  2NUB A;  4CGF A;  4FJJ A;  4FZZ A;  1HRH A;  1U45 A;  3K58 A;  4LD0 A;  2IC3 A;  3MEG A;  3SV4 A;  4IFV A;  2HHW A;  3QNO A;  3LZJ A;  2P5G A;  4CFD A;  1S5J A;  1TKZ A;  4FZY A;  3HP6 A;  3PO5 A;  2OPS A;  4W5T A;  4OLB A;  2Z1J A;  1EP4 A;  3CG7 A;  4FLU A;  3IG1 A;  1NK5 A;  3AVN A;  3ZT1 A;  3V81 A;  1RNH A;  3RR7 A;  4Z4I A;  4FJG A;  3WNH A;  4CJF A;  2FBY A;  1C1B A;  5KGX A;  5KTQ A;  4C8L A;  3DLB A;  3SZ2 A;  1ASW A;  3QEP A;  3V9U A;  3ZSQ A;  1ZBI A;  4E0D A;  3TR8 A;  1WSJ A;  4DU1 A;  1X9W A;  4W5R A;  3OS2 A;  1SL1 A;  3AO5 A;  2RN2 A;  4O4G A;  1CZ9 A;  1J5O A;  4FLV A;  3M8P A;  1T8E A;  1SL2 A;  2HHV A;  2HNY A;  3OYC A;  3KLI A;  4DSJ A;  1S9G A;  3NE6 A;  3E01 A;  1KVA A;  5HBM A;  1NJY A;  4DSL A;  3AV9 A;  3HPO A;  2GV9 A;  1VSF A;  3RRH A;  3VQC A;  4M3T A;  4CJ4 A;  4RG8 A;  1C1A A;  3V4I A;  3T1A A;  4DG1 A;  3V6D A;  3TWH A;  4DTM A;  1WAF A;  2D5R A;  1GOA A;  4KKO A;  3NGY A;  4CES A;  2IOC A;  1S6P A;  2YNG A;  3DOL A;  3TI0 A;  4J2D A;  1NJW A;  2ATQ A;  4CJT A;  2Z1H A;  1U47 A;  1RDA A;  3SUQ A;  4BE1 A;  4CGD A;  4E1M A;  4DQR A;  3QLH A;  2GBZ A;  2XY6 A;  5CZ2 A;  1RTI A;  3AO2 A;  4FLZ A;  4DTO A;  4FJK A;  1QSS A;  4FYD A;  4DQS A;  3VQB A;  2P5O A;  4KHN A;  2QKB A;  4RW6 A;  1RTJ A;  4OKE A;  5HRR A;  3KLH A;  3CFR A;  1NK8 A;  1U48 A;  1L3U A;  1HYV A;  3QIN A;  1D9F A;  1HQU A;  3QO9 A;  4IKF A;  4E7K A;  1ZBL A;  2E6M A;  1VSJ A;  4DU4 A;  3HVT A;  1HQE A;  2HB5 A;  4Z0U A;  1VRU A;  4ZHR A;  4HUE A;  1D9D A;  3G0Z A;  1YTU A;  1EKE A;  2GUI A;  2WOM A;  4PA1 A;  4DTP A;  3IRX A;  3TAP A;  4FJ9 A;  4ELT A;  1BI4 A;  1JL1 A;  4OLA A;  4CEO A;  1VSH A;  3OYB A;  3LZI A;  5HRP A;  3MXI A;  1WLJ A;  3LWM A;  1TAU A;  3LP1 A;  3VN5 A;  3SUN A;  3U3G A;  5FDL A;  2R7Y A;  3PX4 A;  2D0B A;  3OYL A;  1X9S A;  4HVJ A;  4JRP A;  2KW4 A;  2QKK A;  3DOK A;  1CZB A;  5DK5 A;  2X74 A;  3SYZ A;  3MXM A;  1IG9 A;  4DLE A;  4CEA A;  3VA3 A;  3NH0 A;  1NK0 A;  2HHU A;  4JRQ A;  1C0U A;  3OY9 A;  1O1W A;  3D0P A;  3NF6 A;  3KTQ A;  1WAJ A;  1BQM A;  4KHU A;  4KRF A;  1A5W A;  3MXJ A;  5K14 A;  4KB1 A;  5C25 A;  1RTH A;  3LAK A;  4CHY A;  3OYE A;  3AVK A;  3M8S A;  4F3O A;  5J2N A;  3UIQ A;  4FJ8 A;  4MFB A;  2FBT A;  2VG6 A;  4AHV A;  5KRT A;  4FM1 A;  1L3T A;  4FCY A;  4HCB A;  3HYF A;  4LH5 A;  5CY4 A;  2XY5 A;  5SWM A;  1KCF A;  1S1T A;  1JLQ A;  2DFE A;  4FK0 A;  4O44 A;  3CM5 A;  1G15 A;  2VWK A;  4E7I A;  1VSD A;  4Z4F A;  4Y1C A;  3MEC A;  4CHQ A;  1W0H A;  1TV6 A;  3TAN A;  3WNF A;  4FJX A;  1L5U A;  4F3T A;  2YHB A;  2IAJ A;  2PYL A;  3SJJ A;  4KAZ A;  1SL0 A;  2RKI A;  4CJS A;  1LAV A;  2E6L A;  4DSK A;  3HK2 A;  3V1R A;  1FK9 A;  1TVR A;  2ETJ A;  4XIU A;  4N47 A;  3QER A;  3VQ4 A;  4CJQ A;  5SZT A;  4CJE A;  1SKS A;  4LY7 A;  1WSG A;  4CIF A;  1FXX A;  3OJS A;  5HLF A;  1LWF A;  4AHC A;  4CIG A;  3DLR A;  3KKR A;  3M8Q A;  3CFO A;  2OYQ A;  2F8S A;  1R0A A;  4HUF A;  2DFF A;  2FBV A;  4CJ3 A;  4DSF A;  1BIU A;  4CEF A;  1TGO A;  4Z4C A;  2D0A A;  1MU2 A;  3U3Y A;  1EX4 A;  1QQC A;  4O0I A;  4DMN A;  3SNN A;  1K6Y A;  1RT7 A;  2ZQB A;  1A5V A;  1J9A A;  4CK1 A;  1XHZ A;  5KI6 A;  1U49 A;  4B9V A;  1HNV A;  4CGG A;  4CJV A;  4N41 A;  1S1X A;  4YNQ A;  2Q3S A;  3FFI A;  4B3O A;  4IFY A;  2IS3 A;  3KLG A;  1RDB A;  3HST B;  3HP9 A;  3ZSW A;  2KFN A;  1QSY A;  1HPZ A;  1LWC A;  1LW0 A;  1VRT A;  2KFZ A;  3NGZ A;  1UWB A;  1WSE A;  4AH9 A;  1LWE A;  1NKB A;  1J53 A;  1GOB A;  1Z26 A;  5DMR A;  3LWL A;  4DLG A;  3C6U A;  4O0J A;  4ICL A;  4Q5V A;  2YV0 X;  3NCI A;  2DTU A;  1KFS A;  3L2R A;  3ULD A;  4N76 A;  1ASU A;  2JLE A;  3O4N A;  4ZTJ A;  4BDP A;  1RT4 A;  3OYA A;  1JLG A;  4B9S A;  3IAY A;  4Z4E A;  3ALY A;  3DRS A;  5FRM A;  3H08 A;  2OPP A;  3AA4 A;  3VQP A;  1XI1 A;  4DSI A;  2OZM A;  1B92 A;  1RBR A;  2A1S A;  2KZZ A;  1S1V A;  1RT6 A;  4BWJ A;  3V9X A;  3QEX A;  3LPT A;  1RT5 A;  3L3V A;  5HRS A;  4BWM A;  3OS1 A;  3SCX A;  3K5O A;  3NBP A;  3K57 A;  1NJX A;  4JS5 A;  3CYM A;  3TAG A;  2YHA A;  1IH7 A;  1WSF A;  1TK8 A;  3VQ6 A;  3ZT3 A;  3HPG A;  3SI6 A;  4K8X A;  3KK1 A;  2FC0 A;  4CF9 A;  1B9F A;  1LAW A;  3VQE A;  3DLE A;  3OYF A;  1Q9Y A;  2QXF A;  3K59 A;  3MED A;  2FBX A;  4ID1 A;  4J2E A;  4C8O A;  1D8Y A;  2D0C A;  3NHG A;  4M42 A;  3LAN A;  2OA8 A;  3QEW A;  4DU3 A;  1HYS A;  4KFB A;  2HVH A;  4B8A B;  2KZM A;  4Z4G A;  4CGH A;  2O4G A;  3VQD A;  3AVC A;  1LV5 A;  1HNI A;  3A2F A;  4OKJ A;  2W42 A;  1IKY A;  1L3S A;  2XRI A;  4O55 A;  3AA5 X;  3TAQ A;  3AA2 A;  1RBS A;  4OPJ A;  3QEI A;  2QK9 A;  3HVR A;  1L3V A;  1JLF A;  1IO2 A;  1I39 A;  3BGR A;  1YT3 A;  3LP2 A;  3RMA A;  4QOZ B;  2P51 A;  3EYZ A;  3NF7 A;  4DF8 A;  1NK7 A;  3RR8 A;  4DS4 A;  3G10 A;  3TAM A;  4FJ7 A;  4M45 A;  2HHX A;  4RW9 A;  1B9D A;  4J2B A;  3ZSR A;  1C0M A;  1Z25 A;  4CEQ A;  4FZX C;  2BAN A;  2HHQ A;  4FJH A;  1UA1 A;  1W9H A;  1I3A A;  3M8R A;  4AHR A;  4CEZ A;  3HL8 A;  4I7F A;  3AVB A;  4CHP A;  1YVU A;  4M3W A;  3ASM A;  4ELV A;  4PWD A;  4FVM A;  3HM9 A;  2YNH A;  1RBU A;  4DFP A;  4KHQ A;  4JLH A;  4H4O A;  4HUG A;  3HJF A;  4GVM A;  3KLE A;  1NK6 A;  3RRG A;  4BDZ A;  1IKV A;  3AVA A;  3ZSO A;  2JGU A;  4I9L A;  2I5J A;  1TKD A;  3DLH A;  1UOC A;  1N6Q A;  4FJN A;  2Z1I A;  4KI6 A;  4O5B A;  4CHN A;  4FJL A;  4GMJ B;  4C8K A;  3LP0 A;  4KB0 A;  3K5M A;  1EXQ A;  3OYM A;  2XO7 A;  4ELU A;  2KTQ A;  4EP5 A;  5T7B A;  2G8F A;  4FK4 A;  4CEC A;  3SQ2 A;  1CXU A;  1UAX A;  3ZT4 A;  4KRE A;  3SQ1 A;  3AVM A;  4B9L A;  2VG7 A;  2OPR A;  3NDK A;  3KD5 E;  4B08 A;  1BGX T;  3ZCM A;  4CHZ A;  4M3Y A;  2HW3 A;  2VG5 A;  1TL1 A;  4CEB A;  5HP1 A;  3V9Z A;  1JLA A;  1XWL A;  2WON A;  3P83 D;  3L2U A;  2X6S A;  3T3F A;  3P5J A;  4QAG A;  4DF4 A;  4DWI A;  3BDP A;  3SPY A;  3AO1 A;  1SUQ A;  4HHT A;  1Y97 A;  1X9M A;  3VQ7 A;  5CZ1 A;  3CFP A;  2AJQ A;  3ZSZ A;  3PV8 A;  1T03 A;  1QTM A;  1NKC A;  4BE2 A;  4HTU A;  1NOZ A;  4CCH A;  4E7J A;  4OJR A;  3V9W A;  4LH4 A;  3VQA A;  1JXB A;  4OKK A;  4BE0 A;  4N5S A;  3OYH A;  3PY8 A;  4CEE A;  4CJK A;  1A5X A;  4H4M A;  4E3S A;  2G8U A;  3NF9 A;  5FRN A;  4JS4 A;  5J1E A;  3S3M A;  2PY5 A;  2HND A;  1D5A A;  4B9M A;  4KO0 A;  1KVB A;  1RIL A;  3AVI A;  1C6V A;  2Y1J A;  3PO4 A;  1XHX A;  3AVG A;  3LPU A;  4FJ5 A;  4EZ6 A;  3EZ5 A;  4UQG A;  4FLY A;  1ZBF A;  1BIS A;  3SUO A;  1HMV A;  1DTQ A;  4C8M A;  1TAQ A;  3CQ8 A;  4FM0 A;  4B9T A;  1TKX A;  1RT3 A;  3ISN C;  3S3O A;  1ZBU A;  2EHG A; 
#chains in the Genus database with same CATH topology
 4OGC A;  3TU5 A;  2J4R A;  4FJI A;  2G8K A;  4GKJ K;  4DTJ A;  4DR7 K;  5HRN A;  2PYJ A;  3VF2 A;  3IUC A;  1HKC A;  3LDS A;  3VEY A;  4IOA L;  4F2R A;  3C6T A;  4BRD A;  2VQE K;  2F8T A;  4FK2 A;  4B3R K;  3ZSX A;  4DR4 K;  5E41 A;  4B1V A;  3QIO A;  1RBT A;  4A59 A;  1T44 A;  4C8N A;  1ZC6 A;  3DYA A;  2PFU A;  5M1Q A;  5CE3 A;  1KRP A;  2RPI A;  2QWO A;  1TK5 A;  1ITG A;  3DWL A;  4E19 A;  1T6D A;  2NRZ A;  4LSL A;  4CBW A;  5I3U A;  3AO3 A;  1RBV A;  4BR5 A;  4IG3 A;  3WT0 A;  5JS2 A;  1TL3 A;  1Q81 O;  3QNN A;  3D45 A;  3RWU A;  3V1O A;  3OYI A;  4F8R A;  3CJ9 A;  4CZI A;  4CE9 A;  2OZS A;  3CD6 N;  4CW7 B;  4IBN A;  3BEX A;  2BGG A;  3QES A;  4Y1D A;  1BCM A;  3LAL A;  2B6A A;  1KLM A;  4B1Z A;  5AQT A;  3NGI A;  1KFD A;  3CQX A;  3G4S N;  3I0R A;  4DR6 K;  2DY4 A;  4BG8 A;  3P1G A;  1YIT N;  3TSU A;  1DTT A;  2EX3 A;  3DLK A;  4NLB A;  4CER A;  1KC8 O;  4QS7 A;  3D7E O;  4W5Q A;  1E4G T;  3AVJ A;  3OS0 A;  4CZE A;  4F2S A;  1QE1 A;  2ITG A;  3ENH A;  3VEX A;  4BAC A;  4YFU A;  4A2B A;  2ZD1 A;  5BRD A;  4B8C A;  2E5L K;  3T7Z A;  4I2Q A;  3A5M C;  1DLO A;  4DFK A;  3E1Y A;  3I8D A;  2P1J A;  5KPZ A;  5M1F A;  5GAG P;  4NO7 A;  2ZJP L;  4DFM A;  3NVK A;  1TYQ B;  3E9O A;  4DQP A;  4JV5 K;  1MWK A;  5C42 A;  4CF2 A;  3J8A A;  2CGL A;  3AVH A;  3NH1 A;  3GL1 A;  3NF8 A;  5CYQ A;  3PX0 A;  1XQS C;  1ILY A;  2W40 A;  1DGK N;  2P9P B;  3DLL L;  1NOY A;  4GV6 A;  3TAB A;  3WNE A;  4KTQ A;  1RT1 A;  4FWL A;  1ATR A;  3KLF A;  4N56 A;  3VET A;  4KHS A;  3J7A P;  4I6M B;  4JKF A;  3RSE B;  1GLL O;  2QTD A;  3MN5 A;  5FRO A;  4PUO A;  2E88 A;  3SPZ A;  4CJ5 A;  3GE1 A;  2Q0U A;  2B4J A;  4TSX A;  3O3H A;  1FW6 A;  3H3O B;  4BC5 A;  1XUP O;  1S72 N;  1REV A;  1GOC A;  3VES A;  4FJJ A;  1HRH A;  1NLV A;  1TKZ A;  4FZY A;  2D1K A;  3HP6 A;  3PO5 A;  1EP4 A;  3CG7 A;  4FLU A;  3ZT1 A;  3V81 A;  1RNH A;  4Z4I A;  2EWS A;  3ENO A;  3ZEU B;  1C1B A;  1VQO N;  3SZ2 A;  1V4S A;  1ASW A;  1Z05 A;  4HTL A;  4WYB A;  3ZSQ A;  4F9O A;  4W5R A;  3GBT A;  5M1O A;  1SL1 A;  4JI5 K;  1SL2 A;  3C6H A;  3NE6 A;  4IOX A;  1W7A A;  4JI8 K;  2O8E B;  5AQX A;  1BG3 A;  1WB9 A;  4YOR A;  4DTM A;  1WAF A;  2D5R A;  5GIP A;  2NRR A;  3NGY A;  4J2D A;  3TI0 A;  1NJW A;  3U9Z A;  2RHK A;  3T1Y K;  1QHA A;  3H3N O;  1RDA A;  2DPN A;  4E1M A;  4DQR A;  2GBZ A;  3KHY A;  1QSS A;  4FYD A;  4JEP A;  2P5O A;  3THW B;  1HYV A;  4DQ8 A;  3CMA N;  4IKF A;  1YXQ A;  1VSJ A;  1HQE A;  4ZHR A;  1YTU A;  1EKE A;  3KZB A;  4FJ9 A;  1JL1 A;  3M6G A;  4OLA A;  3HSC A;  4CEO A;  4WCE L;  1J5E K;  1WLJ A;  3LWM A;  1X3M A;  5AZI A;  2R7Y A;  4DR1 K;  1XMO K;  3DAW A;  2QKK A;  5AQH A;  4FOI A;  4B1W B;  3SYZ A;  3MXM A;  4DLE A;  1C0U A;  2ZF5 O;  3KTQ A;  4A62 A;  1YJN N;  3MX5 A;  4KB1 A;  5C25 A;  4B3T K;  4NB4 A;  1L3T A;  2F9W A;  5KRT A;  1K8A O;  3HYF A;  2XY5 A;  5SWM A;  3QB0 A;  4YDU A;  2QI2 A;  3CM5 A;  4E7I A;  1NGD A;  5F2R A;  4Y1C A;  2FSN A;  2NNW A;  1W0H A;  5KQ8 A;  4BRE A;  3SJJ A;  4KAZ A;  1LAV A;  4NXN K;  4B1U B;  3VQ4 A;  4CJQ A;  4LY7 A;  4CD3 A;  3OJS A;  4BG9 A;  4B3M K;  3SMP A;  4AHC A;  1QVG M;  4FPA A;  3KKR A;  2GUP A;  3I8B A;  4JI4 K;  1BIU A;  1NGJ A;  5M1K A;  1KAX A;  1MU2 A;  3H45 C;  1QQC A;  2NRT A;  4DMN A;  4H0V B;  3SNN A;  4CK1 A;  2ZQB A;  1A5V A;  1KAY A;  3BF1 A;  2P9P A;  4YNQ A;  5C10 A;  2IS3 A;  4R79 A;  3FE1 A;  1RDB A;  3CHW A;  4BRA A;  3ZSW A;  1QSY A;  1UWB A;  4AH9 A;  3MN6 A;  4DLG A;  3WUH A;  3C6U A;  4Q5V A;  4ICL A;  3NCI A;  1YJW N;  1KFS A;  3L2R A;  2JLE A;  3CC4 N;  4ZTJ A;  1RT4 A;  3ID8 A;  3Q7B A;  3DRS A;  5AQU A;  2OPP A;  2KKZ A;  3UE5 A;  1XI1 A;  4JI3 K;  2KZZ A;  4BWJ A;  3V9X A;  3QEX A;  4ILG B;  3LPT A;  3OS1 A;  2BUP A;  1NJX A;  3BZC A;  3O8M A;  3CYM A;  2WTU A;  1IH7 A;  2YHA A;  1WSF A;  5EY4 A;  1NNE A;  4KHP K;  1S3X A;  2P9N B;  4K8X A;  1HNW K;  2FC0 A;  1LAW A;  3VQE A;  3FZM A;  3DLE A;  4J2E A;  2A40 A;  4A5B A;  5FPN A;  3QEW A;  2NRW A;  4H0P A;  5DM7 L;  2HVH A;  4BC2 A;  4B8A B;  3DJC A;  4JK8 A;  4Z4G A;  5HOO A;  1LV5 A;  4O55 A;  3AA2 A;  4JKA A;  3QEI A;  1IO2 A;  3LP2 A;  4JYA K;  3NMU A;  3J7Z O;  4DF8 A;  4H0O A;  3G10 A;  4M45 A;  4RW9 A;  4BRC A;  1B9D A;  4J2B A;  1C0F A;  3MCA B;  1UA1 A;  4AHR A;  1QVF M;  3HL8 A;  3AVB A;  4AF1 A;  4PWD A;  4KHQ A;  4CZH A;  2A41 A;  2E2N A;  4GVM A;  3KLE A;  1K9M O;  3RRG A;  3NVM A;  3AVA A;  2I5J A;  4FWN A;  1N6Q A;  4FJN A;  3QML A;  4O5B A;  4BR2 A;  4C8K A;  4ELU A;  4CI6 A;  4FK4 A;  4CEC A;  4LF6 K;  5JLH A;  3ZT4 A;  4M3Y A;  3ZCM A;  3JXU A;  4E1J A;  4JKC A;  1YI2 N;  3L2U A;  3T3F A;  4PHT X;  3A8Y A;  3VQ7 A;  3DXK A;  5CZ1 A;  3CFP A;  1OH8 A;  3PV8 A;  3SLC A;  4BE2 A;  1NKC A;  4HTU A;  4CCH A;  5AQG A;  2HBJ A;  3V9W A;  1JXB A;  4BE0 A;  2GEM A;  4CEE A;  2G8U A;  3NF9 A;  3MK6 A;  3UKR B;  4JS4 A;  5J1E A;  1HR0 K;  2PBD A;  2PY5 A;  2HND A;  4CZG A;  1TUU A;  4ILH A;  3WXJ A;  3CJB A;  3QBW A;  1KQS M;  3AVG A;  1VQ7 N;  3LPU A;  4KH6 A;  3U4L A;  1BIS A;  4H03 B;  1TAQ A;  5C2F A;  4DKW A;  1HPM A;  1TKX A;  3ISN C;  2EHG A;  3R8E A;  4YOW A;  1VSI A;  4G1Q A;  3ZT2 A;  2ZWH A;  3R1X A;  2P9N A;  4BVO A;  3ZT0 A;  3QEV A;  1QSL A;  1J6Z A;  1JLB A;  3QFU A;  3I33 A;  1SV5 A;  1K8K B;  3OTO K;  4DUY K;  4BGA A;  5AQS A;  5KPT A;  1YTA A;  2HF3 A;  1RDC A;  3V9S A;  1S1W A;  3TSP A;  1BIZ A;  3SV3 A;  4YOV A;  4AIL C;  3P39 A;  1WSI A;  3LM9 A;  3PSI A;  3LDN A;  5IWA K;  2QWP A;  3SK3 A;  4CVN E;  5M1P A;  4AHT A;  2UUA K;  3S3N A;  1CXQ A;  4JKE A;  4FLT A;  4BGB A;  1QHT A;  1HYZ A;  3OW2 M;  3GOI A;  4WQ4 A;  4H8K A;  3O5B A;  4E7L A;  1GLB G;  1NGA A;  3L8B A;  2OCE A;  1YVN A;  4C23 A;  3EEQ A;  4CK2 A;  2ZE2 A;  2X78 A;  3ZYY X;  4FJM A;  2GWK A;  5JS1 A;  3CCV N;  2Q1N A;  4FW1 A;  4C1N I;  3ZEU A;  3JAM O;  4RCH A;  1JJ2 M;  5C15 A;  1ZXO A;  3WEE B;  3O9U A;  4CHO A;  1SKW A;  4CJR A;  3HO1 A;  4KHW A;  4MDB A;  4FVU A;  1C0T A;  1VQK N;  1KXP A;  3T1H K;  4IG0 A;  3C6A A;  5J2Q A;  2XHB A;  3CCM N;  1CLQ A;  2E4L A;  2O4I A;  1KD1 O;  1Q7Y O;  2G8W A;  4AM7 A;  4E1N A;  1RDD A;  2B5J A;  3GG4 A;  3VQQ A;  2QW9 A;  2V51 B;  4DSE A;  4DCH A;  2A42 A;  4CFA A;  3EY1 A;  1N5Y A;  3QDK A;  1VK0 A;  1VSK A;  4DTR A;  3PLA A;  1QS4 A;  4QCL A;  2BDP A;  3MCP A;  4IO9 L;  1ASV A;  4I2P A;  1BHL A;  5CHI A;  1NKE A;  4CGJ A;  1VQ5 N;  3CM6 A;  4RW7 A;  3MN7 A;  4DS5 A;  3AA3 A;  3DI6 A;  2P9L A;  3QIP A;  3T19 A;  3OYJ A;  5AQP A;  4M3Z A;  1FKP A;  4KPY A;  3S9H A;  4BR7 A;  5ADX H;  4GW6 A;  3OYK A;  3SQ0 A;  3L2W A;  1V4T A;  2YKM A;  3E66 A;  3H1V X;  2HMI A;  3QET A;  5GIO A;  4OGE A;  4R5P A;  3L2Q A;  1U04 A;  1NGE A;  4CF1 A;  4NCA A;  3KJV A;  3DRP A;  2Z1G A;  1SAZ A;  2RF2 A;  2BTF A;  3C95 A;  4M41 A;  4DQI A;  4J2A A;  1NMN A;  3FZK A;  4KH5 A;  4U67 L;  4B9U A;  4JK7 A;  4ID5 A;  1UA0 A;  3U6F A;  1KSP A;  4BRO A;  1BCO A;  1YF5 L;  1VSE A;  1X3N A;  4JI2 K;  3O3G A;  4E7H A;  4EZ9 A;  4DV7 K;  1SZ2 A;  2Y1I A;  4IO8 A;  1TKT A;  4BC3 A;  4XH1 A;  1S22 A;  3BF3 A;  3OBY A;  3K58 A;  4K43 A;  4AQY K;  1S5J A;  4PL7 A;  2GEL A;  2WFB A;  1VQL N;  3EKS A;  2OPS A;  4OLB A;  2OTL N;  1NK5 A;  3IG1 A;  3RR7 A;  3FZH A;  5KGX A;  2CH5 A;  5F1X A;  5KTQ A;  2UXC K;  3V9U A;  3VGM A;  1BO5 O;  4DU1 A;  2O8B B;  2RN2 A;  1QQN A;  1RDW X;  1CZ9 A;  2P9L B;  4FLV A;  4NLC A;  2HHV A;  2HNY A;  4MDA A;  2GX9 A;  3E01 A;  1NJY A;  1JCF A;  5HBM A;  2GV9 A;  1VSF A;  3RRH A;  4CJ4 A;  2IIR A;  4RG8 A;  3ZX3 A;  3V6D A;  3TWH A;  4JNE A;  2HF4 A;  1GOA A;  4KKO A;  2IOC A;  1S6P A;  2YNG A;  3DOL A;  3U8X A;  4BR9 A;  3HOS A;  3SUQ A;  5LL6 Z;  4BE1 A;  2E8A A;  2HBM A;  5CZ2 A;  1RTI A;  3AO2 A;  4FLZ A;  4DTO A;  5LJW A;  3VGK A;  2ZGZ A;  4A57 A;  2FSK A;  4KHN A;  3FLC O;  2QKB A;  3EE8 A;  4OKE A;  1U48 A;  1L3U A;  3HM8 A;  2JWL A;  1D9F A;  1HQU A;  4E7K A;  4OO1 J;  1ZBL A;  4DU4 A;  3HVT A;  2HB5 A;  5BR8 K;  1NGB A;  3G0Z A;  2GUI A;  2ASO A;  4PA1 A;  3IRX A;  4FWQ A;  3TAP A;  4DV2 K;  1EO1 A;  4ELT A;  3A5L C;  3LP1 A;  3SUN A;  4IEI A;  1HJO A;  4HVJ A;  1NJI O;  1U2V A;  4BR0 A;  4FWS A;  1U2V B;  4FWM A;  3D0P A;  3NF6 A;  4DUZ K;  1WAJ A;  1BQM A;  1GLJ O;  3EL2 A;  5K14 A;  1YAG A;  2P9U A;  3LDL A;  3LAK A;  4CHY A;  1HUX A;  3M8S A;  4FJ8 A;  5J2N A;  3UIQ A;  4AHV A;  2FBT A;  2VYP A;  4GY2 B;  4LH5 A;  1S1T A;  2D4W A;  4DV0 K;  4O44 A;  3P38 A;  1G15 A;  1VSD A;  3RSE A;  4ISG A;  1M90 O;  3MX2 A;  5AQL A;  3TAN A;  3WNF A;  1L5U A;  4F3T A;  2YHB A;  2IAJ A;  3LM2 A;  4DV5 K;  2RKI A;  4M7Y A;  5AQY A;  1FK9 A;  1TVR A;  3L0Q A;  3OHR A;  4CJE A;  5KPR A;  3ENB A;  3CFO A;  2I7N A;  2F8S A;  4CJ3 A;  2FBV A;  2E2O A;  1XC3 A;  1IV0 A;  3O1B A;  1TUY A;  1XHZ A;  5KI6 A;  4N41 A;  1HNV A;  4CJV A;  5JMV A;  5GAD P;  4B3O A;  1BU6 O;  4M63 C;  3KLG A;  1NGG A;  4FWO A;  3IDH A;  1LW0 A;  3D2F A;  5FLX O;  2O8C A;  3DXM B;  1LWE A;  1BUP A;  2DTU A;  1VHX A;  4BRG A;  1NU0 A;  1ASU A;  3IFR A;  2VGN A;  4YOX A;  2I7P A;  3ALY A;  3CPW M;  5AQN A;  5FRM A;  4BC4 A;  2UU9 K;  2OZM A;  4JHD A;  2A1S A;  4JD2 A;  3M1F A;  1EWQ A;  1RT6 A;  1RT5 A;  5HRS A;  4BWM A;  3NBP A;  4DR5 K;  3TAG A;  1Y64 A;  4CF9 A;  3K9K A;  1B9F A;  2D0P A;  2ZJQ L;  2UXB K;  3OYF A;  1Q9Y A;  4H0Y B;  3MED A;  2FBX A;  4A5A A;  1OKJ A;  2D0C A;  5LMU K;  4M42 A;  1RGI A;  1HYS A;  3KWG A;  4KFB A;  4AM6 A;  4FWK A;  2YHW A;  5I9E B;  2O4G A;  3VQD A;  3HI0 A;  3A2F A;  3MWT A;  1IKY A;  1QQO A;  1RBS A;  4OPJ A;  2QK9 A;  2JWK A;  1JLF A;  1I39 A;  2GWJ A;  3EYZ A;  1NK7 A;  3RR8 A;  3TAM A;  5IT9 O;  1Z25 A;  4FZX C;  3N4P A;  2IVO A;  3M8R A;  4CEZ A;  4I7F A;  1VQ6 N;  4CHP A;  1YVU A;  3VF4 A;  4M3W A;  2UUC K;  2YI1 A;  3ASM A;  4GV9 A;  4FVM A;  3CER A;  1RBU A;  4DFP A;  4JLH A;  4JKG A;  3VER A;  1IKV A;  1K73 O;  4I9L A;  3KWI A;  1UOC A;  3R6M A;  3D2E B;  4FPB A;  4FJL A;  1HKG A;  3LP0 A;  4KB0 A;  3K5M A;  3OYM A;  3SQ2 A;  3AVM A;  4B9L A;  3KD5 E;  3THX B;  4B08 A;  3R9P A;  2HW3 A;  1N36 K;  1TL1 A;  4CEB A;  2FF6 A;  4MO4 A;  3W0L A;  1GLD G;  5JIC A;  4DF4 A;  4DWI A;  1N34 K;  4H0X B;  3OBW A;  1SUQ A;  4HHT A;  3ZSZ A;  1T03 A;  1IJJ A;  4E7J A;  3VQA A;  3LDQ A;  4N5S A;  4CJK A;  2NRX A;  1IBL K;  4B9M A;  3AVI A;  4BRL A;  4CBU A;  3BZK A;  2AA4 A;  1XHX A;  1HKB A;  3ZX2 A;  3WXL A;  3OA9 A;  4UQG A;  4FLY A;  3CCL N;  1HMV A;  4FM0 A;  1RT3 A;  1ZBU A;  3O1W A;  4CF8 A;  3CCQ N;  2P9K B;  4IEE A;  3V1Q A;  3LL3 A;  3TPQ A;  3I56 N;  1N32 K;  3DMJ A;  1GLC G;  4IDK A;  4CJP A;  4BRM A;  3RMD A;  4G9Z A;  2OAN A;  4QS9 A;  4MQ3 A;  4CED A;  5GAH P;  3KD1 E;  4EAH D;  2QEX N;  1Q18 A;  4GKK K;  2LSN A;  4O5F A;  3BY5 A;  4WQ4 C;  1QQM A;  3DXM A;  4CIE A;  2YNI A;  3KK2 A;  3L2V A;  1T7P A;  4RW8 A;  4F4K A;  2KQ2 A;  3KIO A;  1ZBH A;  1OH7 A;  4E89 A;  4KI4 A;  3NH2 A;  3A5N C;  4W5O A;  4YY3 K;  2WBN A;  3O80 A;  3CJ1 A;  1NBW A;  1VQP N;  2CH6 A;  4NYF A;  3ZET A;  5BN8 A;  3UB5 A;  4UY8 O;  5TKW A;  2A1R A;  1JL2 A;  1XC9 A;  3O6W A;  2HHT A;  2FSJ A;  1RDU A;  5KRS A;  2XY7 A;  5B8H A;  3O3F A;  2VGM A;  4DTU A;  4BRN A;  2ASM A;  1TK0 A;  3I0S A;  1U4B A;  2V52 B;  5AR0 A;  4AHU A;  2YHX A;  4DFJ A;  2G8V A;  3LAM A;  5EU7 A;  1JKH A;  2NRH A;  2RE2 A;  3AVF A;  5AQO A;  4CF0 A;  4X64 K;  4FM2 A;  2DFH A;  1Q82 O;  4RW4 A;  4CZL A;  5KGW A;  3NFA A;  1D4X A;  4CZJ A;  3HT3 A;  4BRH A;  4YOU A;  5FPD A;  4CJU A;  1E3M A;  5CYM A;  4M3R A;  2Q0R A;  1Q9X A;  1JLE A;  4FWP A;  4YOT A;  3PUF A;  3DRR A;  3WNG A;  1HJR A;  5GAE P;  1S6Q A;  1HX1 A;  4RTF D;  4DQQ A;  1VAZ A;  3AVL A;  4B9N A;  1RCH A;  3K9J A;  4Q0B A;  4DTS A;  4JKG B;  1BI4 B;  3MAQ A;  1X1P A;  4AHS A;  4DTX A;  3TAR A;  2QXL A;  2KHO A;  1HNZ K;  3VEN A;  5HL7 L;  1NGF A;  4H5V A;  4BRI A;  3VMF B;  4CFB A;  5BRF A;  1C0G A;  2P9I B;  4JK9 A;  4A61 A;  4KTZ A;  4K25 A;  3THV A;  4B9Q A;  2FLO A;  1WN7 A;  1BQN A;  1N8R O;  1IKX A;  4WE1 A;  2IDO A;  3JSM A;  4FW2 A;  4NYN A;  5HRO A;  4XEI A;  1BL3 A;  3O9S A;  1SS6 A;  3B6O A;  3F73 A;  4HCC A;  1QZ5 A;  5LMN K;  5D3G A;  1JCG A;  3OVN A;  2G8I A;  3BUZ B;  1KLN A;  4EP4 A;  2PZS A;  4H5W A;  5J2P A;  3OYD A;  1HLU A;  2XY8 A;  3KKS A;  3VGL A;  1EQY A;  4BRF A;  3ITH A;  3TAF A;  3UKU B;  1T05 A;  3RMB A;  5I42 A;  3EZW A;  2VQF K;  2G8H A;  3D2F B;  2QWQ A;  4JKD A;  4FO0 A;  2QWN A;  3TAE A;  4WF9 L;  5J2M A;  2NUB A;  1NG9 A;  4CGF A;  2IC3 A;  3MEG A;  5A2Q O;  3TSQ A;  2HHW A;  3QNO A;  2NZT A;  2P5G A;  4EHT A;  5ADX A;  2KLA A;  4ILJ A;  3CJA A;  2Z1J A;  3AVN A;  4LFB K;  4FJG A;  3WNH A;  4CJF A;  2FBY A;  3QEP A;  4E0D A;  3TR8 A;  3AO5 A;  4O4G A;  1J5O A;  1IBK K;  3M8P A;  1T8E A;  4DSJ A;  3RVC A;  1S9G A;  2HOE A;  3ZX0 A;  1JCE A;  1ESV A;  1WBB A;  1KVA A;  3MN9 A;  3AV9 A;  4DSL A;  3VQC A;  4IOC L;  4M3T A;  4JAX A;  3T1A A;  1NWK A;  4DG1 A;  1O13 A;  4CES A;  3ULE B;  5KQD A;  1U47 A;  2PAV A;  2XY6 A;  1YJ9 N;  4PL8 A;  3F9M A;  2F4V K;  4EFH A;  3CCR N;  4DQS A;  3L6Q A;  4CZK A;  1LCU A;  4RW6 A;  1RTJ A;  3CFR A;  1NK8 A;  4BRQ A;  3SAF A;  3QIN A;  3G71 N;  1TYQ A;  4JI6 K;  1D9D A;  1VRU A;  1BA1 A;  3J80 O;  1BI4 A;  4OPH A;  1VQ9 N;  1Z6R A;  3LZI A;  2NRV A;  1BDG A;  3OYL A;  4IJN A;  5C12 A;  2KW4 A;  1GLA G;  3DOK A;  2ITM A;  2X74 A;  2HHU A;  3VA3 A;  3NH0 A;  1XMQ K;  2A3Z A;  3OY9 A;  4LF9 K;  3C7N B;  3VEV A;  4KRF A;  3HRG A;  2A5X A;  4IZ9 A;  2W41 A;  3MMV A;  3B8A X;  3OYE A;  3M5R A;  2VG6 A;  1BWF O;  3SAG A;  4FM1 A;  1DKG D;  4HCB A;  1KCF A;  2WC9 A;  4JI1 K;  4WQ5 C;  1T6C A;  4FK0 A;  5MLC Q;  2E20 A;  4LFC K;  2VWK A;  3BP8 A;  4Z4F A;  4BR4 A;  3HOT A;  1CZA N;  1IG8 A;  5DM6 L;  2PYL A;  1SL0 A;  2E6L A;  3CIP A;  3HK2 A;  3CXC M;  5AQR A;  3V1R A;  3AAR A;  3O08 A;  4N47 A;  5SZT A;  1WSG A;  1FXX A;  5HLF A;  1LWF A;  4CIG A;  1W97 L;  3M8Q A;  3AGR A;  2AP1 A;  4HUF A;  2DFF A;  4DSF A;  4CEF A;  1TGO A;  2D0A A;  4PKH A;  1EX4 A;  3H46 O;  4PKG A;  5AQM A;  3THY B;  3CI5 A;  1K6Y A;  1RT7 A;  1J9A A;  4B9V A;  5BN9 A;  2YCH A;  4CGG A;  4K42 A;  2Q3S A;  3FFI A;  3K0S A;  3HST B;  3HP9 A;  2KFN A;  1HPZ A;  2Q97 A;  2KFZ A;  3TTD A;  3NGZ A;  1ATN A;  2O8F B;  2O8C B;  2O8F A;  1NKB A;  1XNR K;  4O0J A;  3GDQ A;  1OVQ A;  3KVG A;  4N76 A;  4FOE A;  2P9S B;  4BDP A;  3OYA A;  3AA4 A;  3WXK A;  2ZJR L;  5AFU A;  1S1V A;  4JHD B;  2BH1 A;  3VTH A;  3L3V A;  3K5O A;  3K57 A;  4JS5 A;  1IBM K;  4OX9 K;  3VEO A;  3ZT3 A;  3SI6 A;  3HPG A;  3ZLJ A;  1N33 K;  5C0Y A;  4B1Y B;  3K59 A;  4C8O A;  3LAN A;  2Q31 A;  4MO5 A;  2OA8 A;  3J7Y P;  2KZM A;  2O8E A;  4CGH A;  3MWP A;  1L3S A;  2XRI A;  3O9R A;  2E2P A;  5AQQ A;  1YT3 A;  4H5N A;  4O8U A;  4QOZ B;  2P51 A;  4FJ7 A;  4BQL A;  2FF3 B;  2QWM A;  3WXM B;  3FFK B;  3ZSR A;  4FJH A;  3VEW A;  3UKR A;  5M1N A;  4ELV A;  4A2A A;  5BR9 A;  3HM9 A;  4H0T B;  1P90 A;  2JGU A;  4YDU C;  1TKD A;  3DLH A;  3L4Q A;  1OVY A;  4KI6 A;  2D0O A;  3D2E A;  4GMJ B;  1Q86 O;  1EXQ A;  2KTQ A;  4K0K K;  5AZJ A;  5T7B A;  4XH4 A;  1I94 K;  3QFP A;  1UAX A;  4KRE A;  3SQ1 A;  3HJF A;  2OPR A;  3IKM A;  2P9K A;  2VG5 A;  5HP1 A;  3V9Z A;  2CGJ A;  3TTC A;  2WON A;  3AAQ A;  2X6S A;  4QAG A;  3SPY A;  4GVE A;  2AJQ A;  2OTJ N;  2GTD A;  1NGH A;  4PKI A;  3HZ6 A;  5F0X A;  4OKK A;  3OYH A;  3PY8 A;  1BA0 A;  1A5X A;  4H4M A;  3PSF A;  5FPE A;  1D5A A;  4KO0 A;  2Y1J A;  1RIL A;  1C6V A;  4WQ5 A;  3VTI A;  5LJV A;  4FJ5 A;  3EZ5 A;  1BOT O;  3SUO A;  3CJC A;  4WFN L;  4NXM K;  4X62 K;  4LSN A;  2QWR A;  3CCU N;  4KV8 A;  5AQF A;  1S9E A;  4KTW A;  3SBG A;  4X66 K;  3VQ8 A;  3OJU A;  2HVI A;  3PIO L;  1J54 A;  3E9P A;  4M3X A;  3SUP A;  1ZYQ A;  1SQK A;  4OPA A;  3VA0 A;  4M3U A;  1SKR A;  2YNF A;  1EET A;  4DV6 K;  3ID6 A;  2HNZ A;  4DR3 K;  1RTD A;  4LF4 K;  3CCJ N;  4MLE A;  3B6P A;  1WNS A;  2OPQ A;  2FXU A;  3L4I A;  5BRE A;  2F96 A;  3K5N A;  1NK4 A;  1FKO A;  1NJZ A;  5C24 A;  2F7T A;  2V7Y A;  1RFQ A;  3AY9 A;  3IS9 A;  3UKU A;  1KTQ A;  3RMC A;  4DTN A;  2P9S A;  3D6R A;  4CFC A;  1LW2 A;  2YX6 A;  3K2P A;  3JYT A;  3VQ5 A;  1MDU B;  4W5N A;  3SQ4 A;  4LF7 K;  4B3S K;  3ATU A;  4OPK A;  5AQW A;  1WBD A;  4BDY A;  3CPE A;  1R59 O;  2YJE A;  1NGC A;  3OYG A;  3VQ9 A;  5BRH A;  1JXE A;  3AO4 A;  5AQV A;  1VQN N;  1MA9 B;  2O8D A;  4KHY A;  2F9T A;  2QM1 A;  2BE2 A;  2VWJ A;  3R3L A;  2O8B A;  3PIP L;  3DM2 A;  3W3D A;  4PY5 A;  2Q2R A;  3DLG A;  1RT2 A;  4M7X A;  3SJH A;  3RTV A;  3H6E A;  3MDQ A;  4Z4H A;  4H5R A;  3HXM A;  5AQZ A;  5JVH L;  2X6N A;  4CGI A;  4GV3 A;  1LOT B;  4CK3 A;  3MEE A;  4OVL A;  4ISE A;  5JLF A;  3OYN A;  4IDH A;  3CJ7 A;  4XH5 A;  2IGI A;  4NCB A;  1KVC A;  3JS6 A;  1VQM N;  4KH4 A;  3LDO A;  3C94 A;  4DR2 K;  3AGK A;  4BY9 C;  1VSL A;  5AQJ A;  3L3U A;  3ZSY A;  1S1U A;  4FXD A;  3FZL A;  1YIJ N;  4BRP A;  4K8Z A;  4NCG A;  3K5L A;  3WEE A;  4L8R B;  3THW A;  3O9T A;  3LDP A;  3NAE A;  1F21 A;  3O4Q A;  3CQY A;  4FLW A;  3VEZ A;  4ZTF A;  1IKW A;  2E1Z A;  3HPH A;  1VSM A;  4I9Q A;  1NK9 A;  2YKN A;  5JVG L;  4JKH A;  4JI0 K;  3PX6 A;  2VWB A;  3CC2 N;  3KK7 A;  4FLX A;  2IVP A;  3KK3 A;  3HTV A;  2ZM6 K;  1C1C A;  1WSH A;  1MWM A;  2HHS A;  3F9K A;  4FSV A;  4CJW A;  1Q8I A;  1GLF O;  1JLC A;  4KBO A;  3ZSV A;  3LP3 A;  4CJL A;  5BPN A;  5LY3 A;  5E84 A;  2UYT A;  3CCE N;  4PQU A;  5BPL A;  4RWT A;  4FZZ A;  4BRK A;  1U45 A;  2CGK A;  4LD0 A;  3SV4 A;  4IFV A;  2W6L A;  3T69 A;  3LZJ A;  3H1Q A;  4CFD A;  4DHY A;  4W5T A;  2H3G X;  3C65 A;  1VQ4 N;  3ZET B;  3SMS A;  4C8L A;  4BVP A;  3DLB A;  3VPZ A;  4BQZ A;  4YOY A;  1ZBI A;  4JI7 K;  1WSJ A;  3G25 A;  4U7B A;  1X9W A;  3THY A;  3OS2 A;  5AZI B;  4LFA K;  3CET A;  3OYC A;  3KLI A;  3F5T A;  5EVZ A;  5CR4 A;  3HPO A;  1ATS A;  1C1A A;  3S41 A;  3V4I A;  3P4I A;  5AQI A;  4B1X B;  2YHY A;  4CZF A;  4ISF A;  3G6E N;  2W6K A;  5C2D A;  2ATQ A;  3VF6 A;  4CJT A;  3C7N A;  2QWL A;  2Z1H A;  4CD1 A;  3HBT A;  4CGD A;  3QLH A;  4FJK A;  4IFE A;  1WUA A;  3VQB A;  2VCP A;  2YJF A;  3EO3 A;  4JD2 B;  4IWV A;  3A0I X;  5HRR A;  3KLH A;  3QIC A;  4EHU A;  3QO9 A;  5TKY A;  1DT9 A;  2E6M A;  3THX A;  1FJG K;  4HUE A;  4Z0U A;  3SBT A;  2WOM A;  5EOY A;  4DTP A;  5AZJ B;  3E9L A;  1VSH A;  5ELZ A;  3OYB A;  5H1S Q;  3ATV A;  5HRP A;  3MXI A;  1TAU A;  3VN5 A;  3U3G A;  2E1Y A;  5FDL A;  4DV3 K;  2D0B A;  3PX4 A;  3Q7C A;  1X9S A;  4JRP A;  1CZB A;  5DK5 A;  5AJ3 K;  1IG9 A;  4CEA A;  1NK0 A;  4JRQ A;  1YUW A;  1O1W A;  1QZ6 A;  4KHU A;  1A5W A;  3MXJ A;  1RTH A;  1P8Z A;  4F3O A;  3AVK A;  3EE9 A;  5BPM A;  4MFB A;  2IVN A;  4HWI A;  4FCY A;  3N4Q A;  4JN4 A;  5CY4 A;  1JLQ A;  2DFE A;  1NM1 A;  4IJA A;  3O4W A;  1NMD A;  4O8K A;  2ZGY A;  3MEC A;  4CHQ A;  1TV6 A;  4GNI A;  4FJX A;  3CC7 N;  3SAH A;  2O8D B;  4CJS A;  1W2B M;  3CME N;  3I55 N;  4DSK A;  2ETJ A;  4MLH A;  4XIU A;  3QER A;  1SKS A;  1T3V A;  3EN9 A;  4CIF A;  3J81 O;  3DLR A;  2OYQ A;  1R0A A;  2UXD K;  4CJ7 A;  4Z4C A;  4LC9 B;  4V19 S;  3U3Y A;  4Z94 A;  3WQT A;  4O0I A;  1U49 A;  1KAZ A;  1S1X A;  2E2Q A;  4DB3 A;  4IFY A;  1OH5 A;  1LWC A;  1VRT A;  2HBL A;  2HBK A;  1WSE A;  2P9U B;  1J53 A;  1GOB A;  1Z26 A;  5DMR A;  3LWL A;  2YV0 X;  5FPM A;  3ULD A;  3O4N A;  3DXK B;  4B9S A;  1JLG A;  3IAY A;  1GLE G;  4Z4E A;  3H08 A;  1YHQ N;  3VQP A;  4DSI A;  1B92 A;  3AAP A;  4Y0W A;  1RBR A;  4FL9 A;  5GIN A;  1WOQ A;  2QA4 N;  3VOV A;  4LF8 K;  3SCX A;  1TK8 A;  3P31 A;  3VQ6 A;  1HNX K;  3KK1 A;  3FZF A;  2P9I A;  4DV1 K;  2QXF A;  4ID1 A;  3WXI A;  1D8Y A;  3NHG A;  2A6A A;  4DU3 A;  3QBX A;  3AVC A;  4I6M A;  1HNI A;  5E26 A;  4OKJ A;  2W42 A;  3TAQ A;  3AA5 X;  3HVR A;  1L3V A;  3RMA A;  3BGR A;  3WQU A;  1DEJ A;  5EXW A;  1OH6 A;  3NF7 A;  4DS4 A;  5AFU H;  4EIA A;  2HHX A;  4DV4 K;  4CZM A;  2NLX A;  1C0M A;  4CEQ A;  2BAN A;  2HHQ A;  1W9H A;  2HMP A;  1I3A A;  3IMX A;  2YNH A;  4CBX A;  4QS8 A;  4H4O A;  4L3Q A;  4HUG A;  3CF5 L;  3FR0 A;  1E4F T;  3M3Z A;  2WUS A;  2UUB K;  1NK6 A;  4BDZ A;  4FWR A;  3ZSO A;  1M1K O;  4LF5 K;  1VQ8 N;  2Z1I A;  4CHN A;  1U6Z A;  2XO7 A;  1K8K A;  1NGI A;  4EP5 A;  2G8F A;  3U9D A;  1CXU A;  2HHH K;  2V7Z A;  2VG7 A;  3NDK A;  1BGX T;  3A5O C;  3TTF A;  4CHZ A;  3O9Q A;  1G99 A;  1JLA A;  1EWR A;  1XWL A;  3P83 D;  1X9J A;  3P5J A;  4JKB A;  3BDP A;  3AO1 A;  1Y97 A;  1X9M A;  1QTM A;  4YHH K;  1NOZ A;  4X65 K;  4OJR A;  1XNQ K;  3C0B A;  4LH4 A;  4H5T A;  4K41 A;  5EX5 A;  4WFB L;  3ULE A;  4E3S A;  5FRN A;  3S3M A;  1KVB A;  3FGU A;  3PO4 A;  5AQK A;  4EZ6 A;  1H1V A;  1ZBF A;  4B9T A;  4C8M A;  1DTQ A;  3F2K A;  2ASP A;  3CQ8 A;  1ZBS A;  2HST A;  3CCS N;  3EKU A;  2Q36 A;  4IXC A;  4J8F A;  3S3O A;  4C1N K;  4WFA L; 
#chains in the Genus database with same CATH homology
 4CF8 A;  1VSI A;  4LSN A;  4G1Q A;  4OGC A;  3ZT2 A;  4FJI A;  4KV8 A;  2G8K A;  1S9E A;  4KTW A;  3V1Q A;  3VQ8 A;  4DTJ A;  3OJU A;  3ZT0 A;  5HRN A;  3QEV A;  2PYJ A;  1QSL A;  2HVI A;  1JLB A;  3LDS A;  1SV5 A;  3DMJ A;  1J54 A;  4IDK A;  4CJP A;  4M3X A;  3SUP A;  1ZYQ A;  3RMD A;  1YTA A;  4F2R A;  3C6T A;  1RDC A;  3VA0 A;  2F8T A;  4M3U A;  4MQ3 A;  1SKR A;  4FK2 A;  3V9S A;  2YNF A;  4CED A;  1EET A;  3ZSX A;  1S1W A;  2HNZ A;  5E41 A;  3KD1 E;  1RTD A;  3QIO A;  1RBT A;  2LSN A;  1BIZ A;  3SV3 A;  3B6P A;  4C8N A;  1WNS A;  3DYA A;  4AIL C;  1WSI A;  2OPQ A;  3K5N A;  2F96 A;  4CIE A;  2YNI A;  3KK2 A;  3L2V A;  1FKO A;  1NK4 A;  1KRP A;  2RPI A;  1NJZ A;  1T7P A;  4RW8 A;  4F4K A;  1TK5 A;  4AHT A;  5C24 A;  1ITG A;  2KQ2 A;  4E19 A;  3S3N A;  1CXQ A;  3IS9 A;  4FLT A;  1KTQ A;  1QHT A;  3KIO A;  3RMC A;  1HYZ A;  1ZBH A;  4E89 A;  4DTN A;  4CFC A;  4LSL A;  1LW2 A;  4KI4 A;  5I3U A;  3K2P A;  3AO3 A;  3JYT A;  4H8K A;  3VQ5 A;  3NH2 A;  4W5N A;  1RBV A;  4W5O A;  4E7L A;  3SQ4 A;  3L8B A;  4IG3 A;  4NYF A;  1TL3 A;  5JS2 A;  4OPK A;  4CK2 A;  3QNN A;  3D45 A;  4BDY A;  3RWU A;  2ZE2 A;  2X78 A;  3V1O A;  3OYI A;  2A1R A;  4FJM A;  2G8W A;  1JL2 A;  4F8R A;  3OYG A;  5JS1 A;  1XC9 A;  2HHT A;  4FW1 A;  3VQ9 A;  1JXE A;  4CE9 A;  5KRS A;  3AO4 A;  2XY7 A;  2OZS A;  3O3F A;  4DTU A;  4KHY A;  4IBN A;  4CHO A;  1TK0 A;  1SKW A;  2BGG A;  2BE2 A;  2VWJ A;  4Y1D A;  1BCM A;  4CJR A;  3QES A;  3HO1 A;  3LAL A;  4KHW A;  2B6A A;  1KLM A;  1C0T A;  3NGI A;  1KFD A;  3DM2 A;  3I0R A;  3I0S A;  1U4B A;  2DY4 A;  4IG0 A;  3P1G A;  5J2Q A;  4AHU A;  4DFJ A;  2G8V A;  2XHB A;  1DTT A;  1CLQ A;  4PY5 A;  2EX3 A;  3DLK A;  2E4L A;  3DLG A;  1RT2 A;  4CER A;  2O4I A;  3RTV A;  4Z4H A;  4W5Q A;  3HXM A;  3LAM A;  4E1N A;  5EU7 A;  1JKH A;  1RDD A;  2B5J A;  2X6N A;  3AVJ A;  3VQQ A;  4CGI A;  3OS0 A;  3AVF A;  4CF0 A;  4FM2 A;  2DFH A;  4CK3 A;  4RW4 A;  3MEE A;  4F2S A;  1QE1 A;  4OVL A;  2ITG A;  4DSE A;  5KGW A;  3NFA A;  3HT3 A;  4CFA A;  3EY1 A;  1N5Y A;  4CJU A;  4BAC A;  1VK0 A;  5CYM A;  4M3R A;  3OYN A;  1VSK A;  1Q9X A;  1JLE A;  4YFU A;  4DTR A;  2ZD1 A;  2IGI A;  1QS4 A;  3PUF A;  3DRR A;  3WNG A;  1HJR A;  4B8C A;  4NCB A;  1KVC A;  4QCL A;  1S6Q A;  2BDP A;  4DQQ A;  1ASV A;  3AVL A;  4I2P A;  4B9N A;  1RCH A;  4I2Q A;  4Q0B A;  1DLO A;  1BHL A;  4DTS A;  4DFK A;  1BI4 B;  3C94 A;  1X1P A;  4AHS A;  3I8D A;  3MAQ A;  4DTX A;  2P1J A;  3TAR A;  1NKE A;  1VSL A;  3ZSY A;  3L3U A;  1S1U A;  4CGJ A;  4FXD A;  3CM6 A;  4RW7 A;  4DFM A;  4CFB A;  4DS5 A;  3AA3 A;  3DI6 A;  3QIP A;  4DQP A;  3T19 A;  3OYJ A;  4K8Z A;  4NCG A;  3K5L A;  4KTZ A;  1FKP A;  4KPY A;  4L8R B;  3THV A;  4M3Z A;  1WN7 A;  3S9H A;  5C42 A;  1BQN A;  4CF2 A;  3NH1 A;  3AVH A;  1IKX A;  3NAE A;  3PX0 A;  3NF8 A;  5CYQ A;  4GW6 A;  1F21 A;  3O4Q A;  2IDO A;  4WE1 A;  3OYK A;  3SQ0 A;  3L2W A;  4FLW A;  3JSM A;  1NOY A;  4ZTF A;  1IKW A;  2YKM A;  3HPH A;  4FW2 A;  1VSM A;  4NYN A;  1BL3 A;  3WNE A;  3TAB A;  3QET A;  5HRO A;  1NK9 A;  1RT1 A;  2HMI A;  4I9Q A;  4KTQ A;  2YKN A;  4OGE A;  4R5P A;  3B6O A;  3L2Q A;  1U04 A;  3KLF A;  3F73 A;  4CF1 A;  4HCC A;  4N56 A;  3PX6 A;  4NCA A;  5D3G A;  3OVN A;  4FLX A;  3KJV A;  3KK3 A;  4KHS A;  2G8I A;  1KLN A;  4EP4 A;  2PZS A;  3DRP A;  2Z1G A;  2RF2 A;  3C95 A;  1C1C A;  3OYD A;  5J2P A;  2XY8 A;  4M41 A;  1WSH A;  3KKS A;  4DQI A;  4PUO A;  5FRO A;  3F9K A;  3ITH A;  3TAF A;  4CJW A;  1T05 A;  4J2A A;  2HHS A;  1Q8I A;  3RMB A;  1JLC A;  5I42 A;  3ZSV A;  4B9U A;  3LP3 A;  4ID5 A;  3SPZ A;  4CJ5 A;  4CJL A;  3U6F A;  1UA0 A;  1KSP A;  2G8H A;  1BCO A;  1VSE A;  2B4J A;  4TSX A;  3O3H A;  3O3G A;  4E7H A;  4EZ9 A;  3TAE A;  2Y1I A;  4PQU A;  5J2M A;  1REV A;  1TKT A;  1GOC A;  2NUB A;  4CGF A;  4FJJ A;  4FZZ A;  1HRH A;  1U45 A;  3K58 A;  4LD0 A;  2IC3 A;  3MEG A;  3SV4 A;  4IFV A;  2HHW A;  3QNO A;  3LZJ A;  2P5G A;  4CFD A;  1S5J A;  1TKZ A;  4FZY A;  3HP6 A;  3PO5 A;  2OPS A;  4W5T A;  4OLB A;  2Z1J A;  1EP4 A;  3CG7 A;  4FLU A;  3IG1 A;  1NK5 A;  3AVN A;  3ZT1 A;  3V81 A;  1RNH A;  3RR7 A;  4Z4I A;  4FJG A;  3WNH A;  4CJF A;  2FBY A;  1C1B A;  5KGX A;  5KTQ A;  4C8L A;  3DLB A;  3SZ2 A;  1ASW A;  3QEP A;  3V9U A;  3ZSQ A;  1ZBI A;  4E0D A;  3TR8 A;  1WSJ A;  4DU1 A;  1X9W A;  4W5R A;  3OS2 A;  1SL1 A;  3AO5 A;  2RN2 A;  4O4G A;  1CZ9 A;  1J5O A;  4FLV A;  3M8P A;  1T8E A;  1SL2 A;  2HHV A;  2HNY A;  3OYC A;  3KLI A;  4DSJ A;  1S9G A;  3NE6 A;  3E01 A;  1KVA A;  5HBM A;  1NJY A;  4DSL A;  3AV9 A;  3HPO A;  2GV9 A;  1VSF A;  3RRH A;  3VQC A;  4M3T A;  4CJ4 A;  4RG8 A;  1C1A A;  3V4I A;  3T1A A;  4DG1 A;  3V6D A;  3TWH A;  4DTM A;  1WAF A;  2D5R A;  1GOA A;  4KKO A;  3NGY A;  4CES A;  2IOC A;  1S6P A;  2YNG A;  3DOL A;  3TI0 A;  4J2D A;  1NJW A;  2ATQ A;  4CJT A;  2Z1H A;  1U47 A;  1RDA A;  3SUQ A;  4BE1 A;  4CGD A;  4E1M A;  4DQR A;  3QLH A;  2GBZ A;  2XY6 A;  5CZ2 A;  1RTI A;  3AO2 A;  4FLZ A;  4DTO A;  4FJK A;  1QSS A;  4FYD A;  4DQS A;  3VQB A;  2P5O A;  4KHN A;  2QKB A;  4RW6 A;  1RTJ A;  4OKE A;  5HRR A;  3KLH A;  3CFR A;  1NK8 A;  1U48 A;  1L3U A;  1HYV A;  3QIN A;  1D9F A;  1HQU A;  3QO9 A;  4IKF A;  4E7K A;  1ZBL A;  2E6M A;  1VSJ A;  4DU4 A;  3HVT A;  1HQE A;  2HB5 A;  4Z0U A;  1VRU A;  4ZHR A;  4HUE A;  1D9D A;  3G0Z A;  1YTU A;  1EKE A;  2GUI A;  2WOM A;  4PA1 A;  4DTP A;  3IRX A;  3TAP A;  4FJ9 A;  4ELT A;  1BI4 A;  1JL1 A;  4OLA A;  4CEO A;  1VSH A;  3OYB A;  3LZI A;  5HRP A;  3MXI A;  1WLJ A;  3LWM A;  1TAU A;  3LP1 A;  3VN5 A;  3SUN A;  3U3G A;  5FDL A;  2R7Y A;  3PX4 A;  2D0B A;  3OYL A;  1X9S A;  4HVJ A;  4JRP A;  2KW4 A;  2QKK A;  3DOK A;  1CZB A;  5DK5 A;  2X74 A;  3SYZ A;  3MXM A;  1IG9 A;  4DLE A;  4CEA A;  3VA3 A;  3NH0 A;  1NK0 A;  2HHU A;  4JRQ A;  1C0U A;  3OY9 A;  1O1W A;  3D0P A;  3NF6 A;  3KTQ A;  1WAJ A;  1BQM A;  4KHU A;  4KRF A;  1A5W A;  3MXJ A;  5K14 A;  4KB1 A;  5C25 A;  1RTH A;  3LAK A;  4CHY A;  3OYE A;  3AVK A;  3M8S A;  4F3O A;  5J2N A;  3UIQ A;  4FJ8 A;  4MFB A;  2FBT A;  2VG6 A;  4AHV A;  5KRT A;  4FM1 A;  1L3T A;  4FCY A;  4HCB A;  3HYF A;  4LH5 A;  5CY4 A;  2XY5 A;  5SWM A;  1KCF A;  1S1T A;  1JLQ A;  2DFE A;  4FK0 A;  4O44 A;  3CM5 A;  1G15 A;  2VWK A;  4E7I A;  1VSD A;  4Z4F A;  4Y1C A;  3MEC A;  4CHQ A;  1W0H A;  1TV6 A;  3TAN A;  3WNF A;  4FJX A;  1L5U A;  4F3T A;  2YHB A;  2IAJ A;  2PYL A;  3SJJ A;  4KAZ A;  1SL0 A;  2RKI A;  4CJS A;  1LAV A;  2E6L A;  4DSK A;  3HK2 A;  3V1R A;  1FK9 A;  1TVR A;  2ETJ A;  4XIU A;  4N47 A;  3QER A;  3VQ4 A;  4CJQ A;  5SZT A;  4CJE A;  1SKS A;  4LY7 A;  1WSG A;  4CIF A;  1FXX A;  3OJS A;  5HLF A;  1LWF A;  4AHC A;  4CIG A;  3DLR A;  3KKR A;  3M8Q A;  3CFO A;  2OYQ A;  2F8S A;  1R0A A;  4HUF A;  2DFF A;  2FBV A;  4CJ3 A;  4DSF A;  1BIU A;  4CEF A;  1TGO A;  4Z4C A;  2D0A A;  1MU2 A;  3U3Y A;  1EX4 A;  1QQC A;  4O0I A;  4DMN A;  3SNN A;  1K6Y A;  1RT7 A;  2ZQB A;  1A5V A;  1J9A A;  4CK1 A;  1XHZ A;  5KI6 A;  1U49 A;  4B9V A;  1HNV A;  4CGG A;  4CJV A;  4N41 A;  1S1X A;  4YNQ A;  2Q3S A;  3FFI A;  4B3O A;  4IFY A;  2IS3 A;  3KLG A;  1RDB A;  3HST B;  3HP9 A;  3ZSW A;  2KFN A;  1QSY A;  1HPZ A;  1LWC A;  1LW0 A;  1VRT A;  2KFZ A;  3NGZ A;  1UWB A;  1WSE A;  4AH9 A;  1LWE A;  1NKB A;  1J53 A;  1GOB A;  1Z26 A;  5DMR A;  3LWL A;  4DLG A;  3C6U A;  4O0J A;  4ICL A;  4Q5V A;  2YV0 X;  3NCI A;  2DTU A;  1KFS A;  3L2R A;  3ULD A;  4N76 A;  1ASU A;  2JLE A;  3O4N A;  4ZTJ A;  4BDP A;  1RT4 A;  3OYA A;  1JLG A;  4B9S A;  3IAY A;  4Z4E A;  3ALY A;  3DRS A;  5FRM A;  3H08 A;  2OPP A;  3AA4 A;  3VQP A;  1XI1 A;  4DSI A;  2OZM A;  1B92 A;  1RBR A;  2A1S A;  2KZZ A;  1S1V A;  1RT6 A;  4BWJ A;  3V9X A;  3QEX A;  3LPT A;  1RT5 A;  3L3V A;  5HRS A;  4BWM A;  3OS1 A;  3SCX A;  3K5O A;  3NBP A;  3K57 A;  1NJX A;  4JS5 A;  3CYM A;  3TAG A;  2YHA A;  1IH7 A;  1WSF A;  1TK8 A;  3VQ6 A;  3ZT3 A;  3HPG A;  3SI6 A;  4K8X A;  3KK1 A;  2FC0 A;  4CF9 A;  1B9F A;  1LAW A;  3VQE A;  3DLE A;  3OYF A;  1Q9Y A;  2QXF A;  3K59 A;  3MED A;  2FBX A;  4ID1 A;  4J2E A;  4C8O A;  1D8Y A;  2D0C A;  3NHG A;  4M42 A;  3LAN A;  2OA8 A;  3QEW A;  4DU3 A;  1HYS A;  4KFB A;  2HVH A;  4B8A B;  2KZM A;  4Z4G A;  4CGH A;  2O4G A;  3VQD A;  3AVC A;  1LV5 A;  1HNI A;  3A2F A;  4OKJ A;  2W42 A;  1IKY A;  1L3S A;  2XRI A;  4O55 A;  3AA5 X;  3TAQ A;  3AA2 A;  1RBS A;  4OPJ A;  3QEI A;  2QK9 A;  3HVR A;  1L3V A;  1JLF A;  1IO2 A;  1I39 A;  3BGR A;  1YT3 A;  3LP2 A;  3RMA A;  4QOZ B;  2P51 A;  3EYZ A;  3NF7 A;  4DF8 A;  1NK7 A;  3RR8 A;  4DS4 A;  3G10 A;  3TAM A;  4FJ7 A;  4M45 A;  2HHX A;  4RW9 A;  1B9D A;  4J2B A;  3ZSR A;  1C0M A;  1Z25 A;  4CEQ A;  4FZX C;  2BAN A;  2HHQ A;  4FJH A;  1UA1 A;  1W9H A;  1I3A A;  3M8R A;  4AHR A;  4CEZ A;  3HL8 A;  4I7F A;  3AVB A;  4CHP A;  1YVU A;  4M3W A;  3ASM A;  4ELV A;  4PWD A;  4FVM A;  3HM9 A;  2YNH A;  1RBU A;  4DFP A;  4KHQ A;  4JLH A;  4H4O A;  4HUG A;  3HJF A;  4GVM A;  3KLE A;  1NK6 A;  3RRG A;  4BDZ A;  1IKV A;  3AVA A;  3ZSO A;  2JGU A;  4I9L A;  2I5J A;  1TKD A;  3DLH A;  1UOC A;  1N6Q A;  4FJN A;  2Z1I A;  4KI6 A;  4O5B A;  4CHN A;  4FJL A;  4GMJ B;  4C8K A;  3LP0 A;  4KB0 A;  3K5M A;  1EXQ A;  3OYM A;  2XO7 A;  4ELU A;  2KTQ A;  4EP5 A;  5T7B A;  2G8F A;  4FK4 A;  4CEC A;  3SQ2 A;  1CXU A;  1UAX A;  3ZT4 A;  4KRE A;  3SQ1 A;  3AVM A;  4B9L A;  2VG7 A;  2OPR A;  3NDK A;  3KD5 E;  4B08 A;  1BGX T;  3ZCM A;  4CHZ A;  4M3Y A;  2HW3 A;  2VG5 A;  1TL1 A;  4CEB A;  5HP1 A;  3V9Z A;  1JLA A;  1XWL A;  2WON A;  3P83 D;  3L2U A;  2X6S A;  3T3F A;  3P5J A;  4QAG A;  4DF4 A;  4DWI A;  3BDP A;  3SPY A;  3AO1 A;  1SUQ A;  4HHT A;  1Y97 A;  1X9M A;  3VQ7 A;  5CZ1 A;  3CFP A;  2AJQ A;  3ZSZ A;  3PV8 A;  1T03 A;  1QTM A;  1NKC A;  4BE2 A;  4HTU A;  1NOZ A;  4CCH A;  4E7J A;  4OJR A;  3V9W A;  4LH4 A;  3VQA A;  1JXB A;  4OKK A;  4BE0 A;  4N5S A;  3OYH A;  3PY8 A;  4CEE A;  4CJK A;  1A5X A;  4H4M A;  4E3S A;  2G8U A;  3NF9 A;  5FRN A;  4JS4 A;  5J1E A;  3S3M A;  2PY5 A;  2HND A;  1D5A A;  4B9M A;  4KO0 A;  1KVB A;  1RIL A;  3AVI A;  1C6V A;  2Y1J A;  3PO4 A;  1XHX A;  3AVG A;  3LPU A;  4FJ5 A;  4EZ6 A;  3EZ5 A;  4UQG A;  4FLY A;  1ZBF A;  1BIS A;  3SUO A;  1HMV A;  1DTQ A;  4C8M A;  1TAQ A;  3CQ8 A;  4FM0 A;  4B9T A;  1TKX A;  1RT3 A;  3ISN C;  3S3O A;  1ZBU A;  2EHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...