4AHRA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
153
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 59
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahrA00
1ZBFA 3WNEA 3OYNA 4W5NA 3AVNA 4J2DA 1C1AA 2KFZA 3TI0A 3T3FA 1TK8A 4I2QA 3V9XA 1HYZA 1B92A 1TK0A 4M3RA 1NK7A 1KFSA 3AO5A 2YKMA 1NJXA 1HYSA 2I5JA 5C24A 3CFOA 3AA2A 4KV8A 3AO3A 4CGGA 4E7KA 4ZHRA 4DTOA 1IO2A 3SCXA 2HHVA 1A5WA 1YTAA 2ETJA 2YNFA 1HJRA 1KTQA 4C8NA 3LZIA 4W5OA 1XC9A 3M8PA 2IAJA 1N5YA 1QTMA 4FK4A 4HCBA 4Z4FA 3K5LA 5SWMA 2G8UA 1EP4A 1TAUA 3EYZA 4WE1A 3OY9A 5HRPA 5KRSA 3LP3A 3SQ2A 5HP1A 3FFIA 5HRNA 3TWHA 2VG5A 3OYEA 4DF8A 5CYMA 2FC0A 3RMDA 4KB1A 2FBXA 2EX3A 4CEEA 2GUIA 4I9LA 3MEEA 1HNVA 2HB5A 3KKRA 1VSJA 1YT3A 1VSMA 3G10A 2Y1JA 1KVAA 5FROA 1WSHA 4KFBA 4CIEA 2IGIA 4B9MA 2HHTA 3QIPA 4B9VA 4BACA 3DLHA 3U6FA 1SKWA 3NE6A 4AHRA 4L8RB 2KQ2A 2GBZA 2HHXA 4F4KA 4N47A 3VQCA 4B9TA 1BHLA 3KJVA 3HVRA 2P5GA 4ZTJA 1QS4A 4JLHA 1FKPA 3DRSA 3SUNA 2OPPA 3CFRA 1NK8A 4LH4A 3DLBA 3EY1A 4FJ8A 4CEBA 3I0RA 4FZXC 1C0MA 3DLKA 3NFAA 1VSIA 3HVTA 2X78A 3QINA 3KK2A 4DQRA 1T05A 3V9SA 4H4OA 4O55A 4KTQA 2X6SA 4CK2A 3D45A 3HK2A 3AVBA 1Y97A 3L3UA 4OPJA 2B4JA 1S9GA 3T1AA 2XO7A 3RRHA 3KK1A 3ISNC 3VQEA 4AHCA 4DLEA 1Q9YA 4BDZA 3MXJA 4AHUA 5J2MA 4B9NA 4CGJA 3DOKA 3S3NA 4F3TA 3CM5A 1CLQA 4B8CA 3HO1A 4OGEA 3CG7A 3HPHA 3LZJA 1HMVA 1HRHA 3SPZA 1S6PA 1TVRA 4OKEA 4PA1A 1RTDA 4FLVA 2RF2A 3LP0A 3AVGA 4FYDA 4YNQA 1WSJA 3OYGA 3AA4A 3QEPA 4OPKA 4ICLA 4FJIA 5D3GA 2HHQA 4EZ6A 3AVKA 3O3HA 3KD5E 1L3SA 3V81A 3K59A 3PX4A 2QKBA 5CYQA 2XHBA 3TANA 2OZMA 3JSMA 1KVCA 2VWJA 3M8RA 4KRFA 3NH1A 4CJSA 4FW1A 3AO4A 2HVHA 1L3TA 4CJWA 4JS4A 4ELVA 4KI6A 4M45A 4CJVA 4E89A 4KI4A 1TK5A 1GOCA 1S5JA 3AVAA 2F96A 3DOLA 4DQPA 1EXQA 4FJJA 3KLIA 3AA3A 4BDYA 1S9EA 3HL8A 4DU3A 1D9FA 3LALA 3VN5A 5K14A 1U45A 4FJKA 3ZSYA 4CEOA 3TAQA 5J2NA 1XI1A 3P83D 3QESA 3M8QA 1QSLA 3EZ5A 4M3XA 2ZQBA 2HNZA 1I39A 1ASUA 3SQ1A 1JXEA 1HQUA 3NF7A 4HTUA 4LSLA 4H4MA 2G8HA 3V4IA 3F9KA 4IG3A 3AV9A 3V6DA 3S3MA 1DTQA 3HP9A 3M8SA 4Z4CA 3L2RA 5J1EA 1RBUA 4FLUA 2Q3SA 4DQSA 1LW0A 2X6NA 1D5AA 4ID1A 3CYMA 4RW4A 2A1RA 1RDBA 3ZSRA 3HXMA 4DQIA 4QCLA 1QE1A 2FBTA 3AVHA 4C8LA 1W0HA 4DLGA 3DLEA 1N6QA 4HUEA 3C6TA 3VQQA 3O3FA 1NKCA 1QSYA 4HCCA 1EETA 3KK3A 3RR8A 3SNNA 1VSFA 1JLFA 3E01A 4FZZA 1T7PA 2JGUA 3VQ8A 1JLQA 2ITGA 3L2UA 4KKOA 1VSHA 1ZBLA 4EP5A 4UQGA 1JLBA 3VQ6A 3NAEA 3NH2A 2QXFA 5KI6A 4OVLA 1U47A 4CF0A 3OYDA 4DTXA 3OYFA 4Q5VA 1U04A 3TAEA 1LAVA 4AHVA 1W9HA 4Y1DA 1ZBIA 1U48A 4FJGA 4CJQA 2QK9A 4FJHA 1Z26A 1RT1A 1T8EA 2P5OA 3ZT0A 3HPGA 2NUBA 4F8RA 4FW2A 4O4GA 1BI4A 2E4LA 1REVA 2ZD1A 4LH5A 3RWUA 4IBNA 4MQ3A 5HLFA 4CEAA 1YTUA 1KSPA 3AVLA 4EZ9A 2XY5A 4DTMA 4O44A 2F8TA 4IKFA 4F2SA 4M3YA 3HT3A 4FCYA 4DSIA 3U3GA 1CZBA 3TAPA 3TAMA 3B6PA 4C8MA 4DTNA 1ZYQA 4DTRA 4CF2A 4Q0BA 4CIFA 2OYQA 3C94A 3WNHA 1S1WA 4FM0A 4TSXA 4CGDA 4CHNA 4ELTA 4KAZA 4FJ5A 3BGRA 1XWLA 1NK0A 3L8BA 3OYHA 4K8ZA 1K6YA 4LSNA 3VQPA 4CFBA 3F73A 2QKKA 4M3ZA 1LAWA 2D0BA 3ITHA 4CJKA 3LDSA 4JRQA 3S3OA 4M3WA 4OLAA 1NKBA 3ZT4A 4E7HA 5CZ2A 3LPTA 2O4GA 2P51A 3OVNA 2OPSA 4J2BA 1DTTA 3KTQA 3S9HA 1JXBA 3ZSWA 3V1OA 1NK6A 3TARA 2YHAA 4CHQA 4CHYA 2PYJA 4E1NA 3V9WA 1WLJA 2P1JA 2WONA 1MU2A 4CJ5A 5C25A 3OS2A 4FJXA 3QEVA 4PQUA 2GV9A 2Z1IA 4DTSA 1RT4A 3ULDA 2PZSA 4ELUA 4DTJA 5KGXA 4FJ9A 3V9UA 2DFFA 4XIUA 3NGYA 4BWMA 1BGXT 4FXDA 1JLEA 1QHTA 3HYFA 2OZSA 3UIQA 3NF9A 1VSEA 4RG8A 4CE9A 3OYKA 1BL3A 2D0CA 3SPYA 1C6VA 3P1GA 4LY7A 4CHZA 4W5TA 3HP6A 4EP4A 4I9QA 3KIOA 4DSFA 2VWKA 4CIGA 2HNDA 4FK0A 4RW6A 2IOCA 4M41A 4KTWA 5CY4A 1SL0A 2G8VA 2OPRA 2A1SA 1VRTA 3OS0A 3QETA 3MXIA 4CJ3A 1Q8IA 1NKEA 4CERA 1FK9A 3QNNA 4M3TA 2FBYA 3O4QA 1IKVA 1BQNA 4CCHA 1C0UA 2D5RA 4C8KA 2R7YA 4BE1A 3QLHA 4DSEA 4JRPA 3LWLA 1LWCA 1FXXA 1SUQA 1JL2A 3ZT2A 2G8KA 4FJNA 5JS2A 4CGIA 4W5QA 2XY8A 4QAGA 4Z0UA 4PWDA 3KKSA 5FDLA 1IKWA 1SKSA 1A5VA 4OLBA 1NK5A 1X1PA 3PUFA 4AH9A 4CJPA 1VK0A 3MXMA 2HHWA 1SL1A 1WAFA 3NDKA 4CGHA 1IG9A 4N41A 1XHXA 1Z25A 1ITGA 1G15A 1BI4B 1D9DA 1TKZA 1B9DA 1WSEA 2IDOA 4FLZA 4GVMA 1IH7A 2PY5A 3QEWA 3VQBA 4FK2A 5I42A 4NYFA 4NYNA 3ZT3A 4QOZB 3OJSA 3JYTA 4FJMA 2IC3A 5J2PA 4FZYA 3PX0A 2VG7A 4GW6A 4FM1A 4CFAA 1KRPA 1VSDA 3LAMA 1C1BA 4C8OA 1LW2A 3NF6A 4B8AB 3OYIA 4YFUA 1TL1A 4DS4A 4BE2A 4E7IA 4ZTFA 3QEXA 2YNGA 1QSSA 3MEGA 1CXQA 4G1QA 3L2WA 4CECA 4DS5A 4E3SA 1SL2A 4CJTA 2RKIA 2KFNA 4B9UA 1RCHA 3A2FA 1BIZA 3WNGA 4DFMA 1EX4A 2OA8A 2PYLA 2BGGA 4CEFA 3K58A 3CM6A 3QO9A 3PV8A 5FRNA 3NGIA 4MFBA 1RILA 2E6LA 1A5XA 3AVFA 3HSTB 3VQ4A 3ZSXA 1HYVA 1O1WA 1IKYA 1RBTA 1DLOA 3I8DA 4B9LA 5FRMA 2FBVA 3LWMA 4CF9A 1RBVA 3VA3A 2Y1IA 3SUPA 1D8YA 3RRGA 4K8XA 1BISA 1UWBA 2YKNA 2YHBA 3I0SA 3KLFA 1NK4A 4M42A 3DM2A 1SV5A 3LP2A 5EU7A 5C42A 4KHUA 4Z4IA 3IRXA 4CEDA 2LSNA 3CQ8A 5KRTA 1BQMA 1RTJA 4E19A 1XHZA 1TKDA 5HROA 1ZBHA 3TAFA 1TAQA 1WSFA 2E6MA 3VQAA 4E0DA 2RN2A 2F8SA 3RMAA 1TKTA 3K5NA 2KZZA 1NOYA 1RDAA 3QERA 4KHSA 2B6AA 4IDKA 3OJUA 3SZ2A 4KHYA 1RT5A 3AVIA 3DI6A 3DLGA 3KLGA 2ATQA 4KO0A 4LD0A 4FM2A 4DTUA 3KLEA 1JL1A 3DRPA 4IFYA 3QNOA 4Z4GA 3IG1A 3SJJA 1NK9A 2KW4A 1F21A 3AVCA 2AJQA 3ASMA 3VQ9A 3T19A 4BWJA 4DG1A 4CFDA 3VQDA 3NCIA 3BDPA 1WAJA 1C1CA 1NJWA 4DSJA 3H08A 4CFCA 3OYCA 4FVMA 1VSKA 4DU4A 3AO2A 1CZ9A 4DU1A 4CHOA 3OYAA 4AILC 3L3VA 3PY8A 3OYBA 4FJLA 4KREA 3P5JA 4CESA 4CJUA 4CEZA 3K57A 4DTPA 1T03A 2YV0X 5HBMA 4Y1CA 1S1TA 4F3OA 3C6UA 1KLMA 1HNIA 2BE2A 3SI6A 4KHQA 1EKEA 1RBRA 1KFDA 2JLEA 4CJEA 2YNHA 2HW3A 3LP1A 2BANA 1S6QA 4DMNA 4CK3A 1ZBUA 4NCAA 4B9SA 1UAXA 2O4IA 3O4NA 3AVJA 3RR7A 1B9FA 1RTHA 1RDCA 3RMBA 1U49A 4BDPA 4IFVA 2HHSA 3C95A 4FLXA 3DYAA 3KLHA 3TABA 4DWIA 2XY6A 3LANA 4IG0A 2HMIA 1HPZA 3LPUA 1JLAA 4N56A 3OS1A 1CXUA 1RT6A 5KTQA 4HVJA 3SV3A 3SUQA 2Z1HA 3D0PA 1TKXA 1QQCA 4OGCA 4FLTA 1WN7A 2EHGA 4DQQA 4KHNA 4Z4HA 1IKXA 4E1MA 4PY5A 3OYMA 4DFKA 3WNFA 4NCBA 4PUOA 4J2EA 4AHSA 1BIUA 1S1XA 4E7JA 4DF4A 4N5SA 4GMJB 2BDPA 3HPOA 1TGOA 4RW7A 3AA5X 4JS5A 5DMRA 4CF1A 3ALYA 1KVBA 2YNIA 3NH0A 3MAQA 3V1QA 5KGWA 4HUGA 1VRUA 5DK5A 1ASWA 3K5OA 1LV5A 1NOZA 3G0ZA 4CHPA 1S1VA 3MECA 4O0JA 2DFEA 2OPQA 4OJRA 1JKHA 1L3UA 3DLRA 5E41A 1RT2A 2DY4A 3VQ5A 3RTVA 1LWEA 1WNSA 4RW8A 1SKRA 3K2PA 1J5OA 4J2AA 1I3AA 4DFJA 4O5BA 5HRSA 1LWFA 1RNHA 3ZT1A 1ASVA 1WSGA 1JLGA 4FLWA 3AVMA 4OKKA 1HQEA 1X9WA 4DSKA 1RDDA 4Z4EA 3DMJA 3TAGA 4CJLA 3U3YA 3NBPA 4KHWA 2DFHA 3ZSZA 2G8FA 4CF8A 3NGZA 5J2QA 1J53A 4B08A 4ID5A 3ZSQA 2KZMA 2W42A 2HHUA 3IS9A 2IS3A 3DRRA 4O0IA 1RT7A 5SZTA 4W5RA 3KD1E 2HVIA 1TV6A 3K5MA 3SV4A 4CJ4A 3LAKA 4N76A 4DFPA 3HJFA 4FLYA 3L2VA 3HM9A 2XRIA 3NHGA 1RBSA 2B5JA 2Z1GA 1X9MA 2G8IA 4CJFA 2ZE2A 3PX6A 1S1UA 1TL3A 1R0AA 3ZSVA 1L3VA 1U4BA 1VSLA 4I7FA 2X74A 4B3OA 3V1RA 3SYZA 1NJZA 3SUOA 4H8KA 3MEDA 5CZ1A 3RMCA 3THVA 4RW9A 1FKOA 2Z1JA 2VG6A 1GOAA 3AO1A 3VQ7A 3CFPA 4DSLA 1J54A 4I2PA 4CJRA 5JS1A 2WOMA 1BCMA 3QEIA 2XY7A 4AHTA 2DTUA 1J9AA 4E7LA 3IAYA 3NF8A 4FJ7A 1WSIA 4HUFA 1KLNA 4BE0A 3ZCMA 1BCOA 3PO4A 3SQ4A 4NCGA 4KTZA 1GOBA 4OKJA 4CGFA 4R5PA 1X9SA 4CK1A 3O3GA 1UOCA 5T7BA 2G8WA 3QIOA 3PO5A 4KB0A 3OYJA 3VA0A 2D0AA 1NJYA 3OYLA 1RT3A 2RPIA 1L5UA 3TR8A 1JLCA 4KPYA 3V9ZA 1C0TA 3SQ0A 1UA0A 1RTIA 4M3UA 1Q9XA 4HHTA 3ZSOA 3B6OA 2KTQA 1UA1A 4F2RA 3L2QA 5HRRA 5I3UA 4CEQA 1YVUA 1KCFA 2HNYA
chains in the Genus database with same CATH superfamily
3Q7CA 2WBNA 2ASMA 3T3FA 1TK8A 1HYZA 4CZEA 1TK0A 4M3RA 1KFSA 1ZXOA 4E7KA 4WQ5A 5JLFA 4CGGA 1YXQA 4QS8A 3SJHA 4GV9A 4C8NA 1XC9A 1HJRA 1W2BM 4FK4A 3D7EO 4Z4FA 3K5LA 1EP4A 4LF9K 3EYZA 2E2PA 5KRSA 4G9ZA 4L3QA 4O8UA 4GVEA 5BPLA 5LMNK 1NGJA 1SS6A 3A5OC 3MWPA 3O9QA 2HB5A 1KC8O 2V51B 1IV0A 1WSHA 4CIEA 2P9LB 2IGIA 3QIPA 3U6FA 4BRPA 4DR4K 2P5GA 4LH4A 4JI1K 3NFAA 1VSIA 3KK2A 4KTQA 2NRWA 3D2EA 3HK2A 3D45A 4YHHK 3AVBA 1S9GA 4LFAK 1S22A 1TYQA 3KK1A 3MXJA 4B9NA 4EHUA 3JAMO 4CGJA 3CM5A 1HMVA 1HRHA 4JKBA 1RTDA 4DV4K 2RF2A 3LP0A 3AVGA 3O1BA 3CJBA 2HHQA 4YOVA 1JCFA 3GOIA 2QWPA 3A5MC 3D6RA 2XHBA 3TANA 4BRCA 1KVCA 2NRTA 3IFRA 4KRFA 3NH1A 4CJSA 3AO4A 2HVHA 1L3TA 4CJWA 4IJAA 4JS4A 1TK5A 3A8YA 3HL8A 1D9FA 1U45A 1Y64A 2ZGZA 3I56N 3TAQA 1XI1A 3QESA 1T6DA 1ASUA 4HTUA 4JI5K 4IOXA 2QWMA 3PSFA 3P31A 4CZIA 1DTQA 3J8AA 3HP9A 4Z4CA 2KFNA 4I9QA 4KHWA 2A1RA 4RW4A 2D4WA 3HXMA 2FBTA 1K9MO 1W0HA 3C6TA 3VQQA 3O3FA 1NKCA 4FO0A 3QICA 4GKJK 5LJWA 4CBXA 1E3MA 1VSHA 1C0FA 1VQ5N 4EP5A 3JS6A 2QXFA 2Q36A 4OVLA 4CF0A 3OYDA 2FLOA 1U04A 1IJJA 1W9HA 5M1QA 1ZBIA 3NMUA 1T8EA 4F8RA 2P9PB 3EL2A 1BI4A 1REVA 1DT9A 2YHYA 4IBNA 4MQ3A 4CEAA 1KSPA 4FWKA 5A2QO 3C6AA 3MN6A 2J4RA 4IKFA 4M3YA 3HT3A 1K73O 3MN7A 1U2VA 4DSIA 1CZBA 1YUWA 4C8MA 3VETA 4DTNA 1Z05A 4Q0BA 1W97L 4ELTA 1NK0A 1K6YA 4LSNA 5AZJB 3I55N 2QWRA 4E7HA 5BPNA 2O4GA 2GTDA 3FFKB 1DTTA 3KTQA 1NK6A 3V1OA 3VPZA 4E1NA 2WONA 3OS2A 1MU2A 4PQUA 3BEXA 2Z1IA 2PZSA 1RT4A 4FJ9A 4H5NA 1YIJN 4H0TB 5AQJA 1BGXT 2IVOA 2VQFK 4H03B 3WQTA 5AQHA 1BL3A 3OA9A 2D0CA 1EWRA 3P1GA 4JKGA 3HP6A 2F4VK 3KIOA 1VAZA 3PLAA 2HNDA 4RW6A 1VRTA 4CJ3A 5F1XA 1NKEA 4CERA 2O8CB 4NXMK 1BQNA 4O8KA 2D5RA 1QQMA 4JRPA 1LWCA 1FXXA 4FJNA 3TPQA 3EE9A 3PIOL 1IKWA 4OLBA 4FPBA 1RDWX 1WAFA 2PFUA 4CGHA 4DV1K 4FWQA 2IDOA 4JI0K 4FLZA 4GVMA 3VQBA 1QHAA 3JYTA 4FJMA 2IC3A 3O4WA 2E2OA 4GW6A 3KK7A 4CFAA 4FM1A 1KRPA 4BRNA 1C1BA 3CJ1A 3NF6A 4DR6K 3WT0A 4PL7A 4ISGA 3SK3A 3E9PA 4G1QA 2HBKA 4CECA 1SL2A 4CJTA 5M1FA 1RCHA 1BIZA 2P9IA 4DFMA 1EX4A 4JI2K 3G71N 3QO9A 4MFBA 3HSTB 3VQ4A 4J8FA 1HYVA 2FBVA 1RBVA 3VA3A 4JD2B 1BISA 5C12A 3KLFA 4M42A 3I0SA 3NVMA 3CQYA 3DM2A 3CCQN 5GINA 5C42A 4CEDA 5HROA 2A6AA 1SQKA 1TAQA 4E0DA 2Q0RA 4FOEA 1TKTA 3CMAN 3ZX3A 3QERA 3ZYYX 5BR9A 2B6AA 3SZ2A 1RT5A 3AVIA 3DLGA 4JN4A 1VQ9N 4PL8A 4DTUA 4LFBK 4IFYA 1Z6RA 3LDLA 3SJJA 2KW4A 3VQ9A 4BWJA 4DG1A 4A5BA 1WAJA 5FPEA 4DSJA 3ZEUB 2YX6A 3THXA 4FVMA 1VSKA 3AO2A 1OH6A 4JK9A 4A5AA 4AILC 3CD6N 3OYBA 3B8AX 4CJUA 3K57A 2AP1A 2YV0X 1S1TA 3N4PA 4JKEA 2JLEA 3BZCA 2YNHA 2BANA 4CK3A 4NCAA 4NO7A 2VCPA 3TSQA 4B9SA 3O4NA 3AVJA 3RR7A 1VQ7N 3R3LA 1B9FA 3CF5L 2O8DB 4DWIA 3SBGA 2JWKA 2HMIA 2FXUA 3LPUA 1JLAA 4GY2B 1CXUA 5KTQA 4FSVA 4KHNA 1VHXA 4H5TA 4E1MA 4DFKA 4BRIA 4BRHA 1BIUA 3FLCO 1NMNA 4DF4A 4N5SA 1RDUA 4BRDA 5AQRA 4RW7A 4JS5A 5DMRA 3SLCA 4KBOA 3V1QA 5DK5A 4FWMA 1VQ6N 1S1VA 4OJRA 3H3NO 4WQ4C 3SMPA 4BC2A 2DY4A 1J5OA 1SKRA 3VGKA 1I3AA 4B9QA 1QVFM 3WEEB 1RNHA 3ZT1A 1WSGA 4B1YB 1JLGA 2O8FB 1HQEA 3WUHA 2IVPA 2P9UB 4Z4EA 3DMJA 4JI6K 3CCSN 3NBPA 3ZSZA 3PSIA 2W42A 3IS9A 2BUPA 3DRRA 4O0IA 4DCHA 4FWOA 3SV4A 4EIAA 2Z1GA 2G8IA 4CJFA 2ZJRL 3PX6A 1HNZK 2E2NA 1R0AA 4JHDA 2D1KA 3P4IA 3SUOA 3MEDA 5CZ1A 3THVA 4RW9A 3QB0A 4B1ZA 3VQ7A 3CFPA 5JMVA 2CGKA 3ID6A 4B1VA 4FJ7A 1NGGA 1KLNA 4BE0A 3ZCMA 3PO4A 4OKJA 4CGFA 4R5PA 3VEWA 3O3GA 3PO5A 3AARA 3OYJA 3L6QA 1NJYA 3OYLA 1H1VA 1NGAA 3SQ0A 1UA0A 4NB4A 4C23A 1UA1A 1HX1A 3E1YA 4BR0A 4F2RA 1YVUA 2HNYA 3ZSVA 3OYNA 5AQPA 4W5NA 3AVNA 1C1AA 3SMSA 2KFZA 4BRLA 5JVGL 3ZLJA 3G6EN 3RSEA 3V9XA 1NK7A 2YKMA 2I5JA 4LFCK 2HF4A 3AA2A 3AO3A 4KV8A 4ZHRA 3SCXA 1N5YA 1QTMA 3M8PA 2E8AA 5SWMA 3Q7BA 3OY9A 4NLCA 5HRPA 3UKUA 5HP1A 2PAVA 2NZTA 3OYEA 4FWRA 2FC0A 3RMDA 2EX3A 3KKRA 2HMPA 1VSJA 1YT3A 2Y1JA 1KVAA 5FROA 4BROA 4B9MA 4KFBA 4BACA 3NE6A 1EO1A 3WQUA 1BHLA 3VERA 4B9TA 1QS4A 3SUNA 4FJ8A 2YHWA 4DB3A 1C0MA 2WFBA 2X78A 1NU0A 4DQRA 4JI7K 4O55A 1Y97A 4DR2K 1DKGD 4DHYA 1XNRK 3RRHA 1S3XA 4AHCA 1W7AA 4H0PA 4OGEA 2RE2A 5BN9A 3LZJA 4Y0WA 1HR0K 1S6PA 3BF3A 4PA1A 1VQ8N 3W3DA 1HPMA 4FYDA 4YNQA 4OPKA 4ICLA 4U7BA 2E5LK 3AVKA 1T3VA 3V81A 3E9LA 3K59A 2YHXA 5CYQA 4DR5K 2VWJA 3M8RA 4FW1A 3THWA 1JJ2M 4M45A 4KI4A 4WFBL 1S5JA 3AVAA 4DQPA 4BRAA 3VN5A 5K14A 4FJKA 2ASPA 1QSLA 4M3XA 2ZQBA 3SQ1A 3NF7A 3M1FA 4LSLA 3C0BA 4H4MA 2G8HA 1U2VB 4LF7K 4IG3A 5HOOA 3HRGA 1IBLK 1SZ2A 3M8SA 3L2RA 4DV5K 3UE5A 4N76A 4JK7A 1LW0A 2X6NA 1D5AA 3TTDA 1RDBA 4FWNA 1QE1A 3AVHA 4C8LA 3FZFA 4DLGA 3DLEA 1N6QA 1QSYA 3CQXA 1EETA 3RR8A 3SNNA 2A40A 4FZZA 1T7PA 4UY8O 2JGUA 3I8BA 2ITGA 4KKOA 4XH5A 1NGHA 3H1QA 4RCHA 2QA4N 3VQ6A 3SAHA 4H5VA 3OYFA 2P9SB 2ZGYA 1U48A 1RT1A 5AFUA 2P5OA 2ZD1A 4LH5A 5HLFA 2Q1NA 4EZ9A 3GBTA 5C2DA 2XY5A 4DTMA 3ULEA 2F8TA 2YCHA 3TAPA 3TAMA 1GLCG 2E2QA 4H5RA 1ZYQA 3NVKA 5DM6L 3C94A 4IEIA 4FJ5A 2QWQA 3P39A 1XWLA 4CFBA 2QKKA 3ITHA 2D0BA 4CJKA 2HBJA 3S3OA 4M3WA 2EWSA 3ZT4A 3ID8A 5CZ2A 3OVNA 5AFUH 3DJCA 4CHQA 1ATNA 5GIPA 2PYJA 2VQEK 4X64K 4FJXA 4DTSA 3ULDA 2QWLA 4ELUA 3DXKB 4DTJA 1Q18A 5C10A 3V9UA 4BWMA 2UXDK 4FXDA 3HYFA 2OZSA 1VSEA 4BRGA 1U6ZA 5ADXA 3SPYA 1C6VA 4W5TA 5AQUA 3CCMN 4DSFA 2IOCA 1SL0A 2OPRA 5F0XA 3OS0A 1YAGA 1Q8IA 5FPDA 4DV6K 3QNNA 5CHIA 4M3TA 3O4QA 1IKVA 4CCHA 4FWLA 4BE1A 3H46O 3ZT2A 4AM7A 5JS2A 4CGIA 4W5QA 4BGAA 3BF1A 3MCAB 1SKSA 1A5VA 1X1PA 4AH9A 4CJPA 3MXMA 1VK0A 3S41A 5BREA 1IBMK 3SAGA 3GE1A 1XHXA 3THYA 1G15A 1D9DA 1HLUA 4BGBA 2IVNA 5ADXH 3QFUA 3QEWA 2W41A 4FK2A 4NYFA 4NYNA 3ZT3A 3OJSA 5AQTA 5GADP 4FZYA 1N33K 4IZ9A 2QI2A 3A5NC 3DWLA 3LAMA 1IG8A 5H1SQ 3D2FA 1TL1A 4BE2A 4E7IA 3CCEN 1QSSA 3MEGA 3CCUN 1CXQA 2OTLN 4E3SA 4DV2K 3O9RA 2OA8A 1KAZA 1NG9A 4IOAL 4CEFA 1FJGK 2UU9K 1NGEA 3ZSXA 1RBTA 1IKYA 1D8YA 3BY5A 1UWBA 2YHBA 5EU7A 4Z4IA 4KHUA 3CQ8A 5KRTA 2I7PA 1GLJO 1TKDA 3CJ7A 4BG8A 1HNWK 5AZIB 4BR2A 3TAFA 5TKWA 3VQAA 3GDQA 5AQMA 2CH5A 2F8SA 3RMAA 2KZZA 3VGMA 4H0YB 4KHSA 2Q97A 1VQ4N 3HOTA 3DI6A 1WBBA 4CW7B 3KLGA 4KO0A 1JL1A 3DRPA 3QNOA 4B1UB 3DLLL 4M7YA 3BDPA 3NCIA 4B1XB 4CFDA 2ZM6K 3H3OB 1EWQA 1CZ9A 3DXMA 2NRXA 4DU1A 4YORA 4BC3A 4KREA 3CHWA 3P5JA 4CESA 5AQFA 4DTPA 4IDHA 5HBMA 4ISFA 4WCEL 1JCGA 3CC7N 2GWKA 3C6UA 3SI6A 1HNIA 2BE2A 2NRZA 4KHQA 1EKEA 4CJEA 4ILJA 3LP1A 4A57A 2VWBA 2QM1A 2O4IA 1RDCA 2YJEA 3RMBA 1U49A 4BDPA 4H0VB 4LF5K 3KLHA 3TABA 2XY6A 3LANA 1GLDG 4IG0A 3LM2A 1HPZA 1RT6A 1VQON 3H6EA 3SUQA 2Z1HA 4EHTA 1TKXA 4OGCA 4DQQA 1WN7A 3J7YP 4PY5A 3OYMA 5JVHL 4NCBA 4M63C 4B3SK 1MWMA 4E7JA 3HPOA 5GAHP 5AQGA 3AA5X 4CF1A 1ATSA 3MAQA 5KGWA 4K0KK 4HUGA 4IXCA 2D0OA 1LV5A 1NOZA 1VQPN 3G0ZA 4XEIA 4CHPA 1WB9A 4O0JA 2OPQA 2KKZA 5BR8K 1RT2A 4J2AA 3K2PA 1VQMN 4ISEA 4IO9L 3T69A 5CE3A 4DUZK 3O9UA 1SAZA 3H45C 4I6MB 3VOVA 1R59O 3ZX0A 3CETA 4CJLA 5KPZA 4XH1A 3UKRB 4A62A 3NGZA 5J2QA 5AQVA 3EEQA 1RT7A 2HVIA 3K5MA 2A5XA 4DFPA 3HM9A 2O8BA 1S1UA 1TL3A 3CCVN 2P9LA 3CC4N 3V1RA 1XQSC 3T1YK 1VQKN 1WOQA 4BRKA 3AO1A 4CJRA 4E7LA 3IAYA 3NF8A 1T44A 3K9JA 4K25A 2VGNA 1K8AO 2ZF5O 4BG9A 3C7NB 3SQ4A 1X9SA 1UOCA 3LL3A 5T7BA 2G8WA 4EAHD 3VF4A 4MDAA 1L5UA 1JLCA 3VEZA 3VMFB 1N8RO 4OPHA 3U9DA 1Q9XA 2ZJQL 2NNWA 5AQSA 1N32K 3ZSOA 4CJ7A 3L2QA 5I3UA 1KCFA 1ZBFA 3WNEA 1BG3A 2Q31A 1XC3A 2UYTA 4I2QA 4BVPA 1B92A 3AO5A 3FZHA 5FPMA 1QQOA 1NBWA 3CFOA 2HHVA 1NGBA 1XUPO 4DTOA 2ETJA 2YNFA 1KTQA 3LZIA 2OYQA 4W5OA 5IT9O 3GG4A 4FWPA 4CBUA 2NRRA 3R9PA 2UUBK 3LP3A 3SQ2A 5HRNA 2VG5A 4DF8A 4GKKK 5CYMA 4YOTA 4KB1A 2FBXA 4CEEA 4IOCL 2GUIA 3K0SA 5AQXA 3G10A 4BRFA 4OX9K 3F5TA 4JKDA 2HHTA 2VGMA 1VQLN 1SKWA 4L8RB 4AHRA 2KQ2A 4F4KA 4ZTJA 1HUXA 4JLHA 1X9JA 1FKPA 3DRSA 2OPPA 3CFRA 3FZMA 4B3MK 4JKCA 3EY1A 2O8EB 3I0RA 2FF3B 3DLKA 3QINA 1T05A 4FZXC 4CD3A 3V9SA 2B4JA 3K9KA 1Q9YA 4BDZA 4AHUA 4F3TA 3DOKA 3S3NA 1CLQA 2P9PA 2WC9A 3U9ZA 3SPZA 1YHQN 1QZ5A 2ITMA 4FLVA 2HOEA 2V7YA 3OYGA 4CVNE 5D3GA 2A3ZA 3IDHA 4EZ6A 3KD5E 3J7AP 5E84A 2P9KA 5ELZA 4JKFA 2OZMA 3JSMA 3M5RA 4FVUA 2E88A 4PKHA 4CJVA 3TTCA 3U4LA 4IEEA 2F96A 3DOLA 4WF9L 1KQSM 2QWOA 1EXQA 3AA3A 4BDYA 4KH4A 1S9EA 3LALA 4YOWA 4LC9B 4CEOA 4JK8A 5GIOA 3P83D 3M8QA 1RGIA 2HNZA 4DR7K 1I39A 4IO8A 4JEPA 1JXEA 1HQUA 4NXNK 3ENBA 3F9KA 3AV9A 4YOYA 5LY3A 3KWIA 3S3MA 5J1EA 5FPNA 5I9EB 2Q3SA 4DQSA 4ID1A 1HJOA 3CYMA 1YVNA 3O8MA 3ZSRA 4HUEA 4HCCA 5AQLA 2Q0UA 3KK3A 2ZWHA 3KWGA 1JLFA 3F2KA 2KHOA 1JLQA 3L2UA 3VF6A 2WTUA 2O8CA 1ZBLA 2CGJA 1MA9B 2ZJPL 3ENOA 3FR0A 3NAEA 3NH2A 5KI6A 3G4SN 3D2EB 3O6WA 4CBWA 1P8ZA 4C1NK 4Q5VA 4IJNA 4AHVA 4CJQA 1BOTO 1TYQB 4FJHA 1Z26A 3ZETA 3HBTA 4CZHA 3VEVA 3AGKA 4FW2A 4O4GA 5AJ3K 3AVLA 1N36K 2Q2RA 3I33A 4M7XA 4FCYA 1HNXK 3U3GA 2D0PA 3B6PA 3BZKA 4DTRA 4CF2A 3WNHA 4TSXA 4CGDA 1N34K 4KHPK 3OYHA 4K8ZA 3VQPA 3MMVA 3F73A 4M3ZA 1LAWA 3LDSA 4JRQA 5EVZA 4A59A 3E66A 1CZAN 1J5EK 3EZWA 3S9HA 1JXBA 3ZSWA 4JKAA 4JD2A 4WFAL 3FZLA 4CHYA 3V9WA 1WLJA 2A42A 2CGLA 4CJ5A 3CERA 4Z94A 3HZ6A 3A0IX 1QVGM 5KGXA 4R79A 3CC2N 3UIQA 3VF2A 4CE9A 3OYKA 3OHRA 4LY7A 4CHZA 5LMUK 1OH8A 4CZLA 4CIGA 4FK0A 4KTWA 5CY4A 2A1SA 3QETA 1FK9A 3VEYA 2FBYA 3ZEUA 5B8HA 5C0YA 1WUAA 3BUZB 5FLXO 5BRHA 4DSEA 3ATUA 1SUQA 2G8KA 2XY8A 4QAGA 4Z0UA 3SAFA 1X3MA 1GLLO 3PUFA 2PBDA 2HHWA 4GNIA 5JLHA 1LOTB 1ITGA 1BI4B 3MCPA 1TKZA 3CPWM 1B9DA 1WSEA 1BUPA 4JV5K 1IH7A 2PY5A 4QOZB 2HBMA 1QZ6A 1YJWN 3MN5A 5J2PA 1BWFO 1LW2A 4B8AB 4WQ5C 4YFUA 4MDBA 4IWVA 3QEXA 4ZTFA 5AQOA 3WXLA 2GWJA 3QBWA 4OO1J 1KXPA 5CR4A 3K58A 3CM6A 3PV8A 5FRNA 5M1KA 1RILA 4CK2A 1A5XA 5LJVA 3I8DA 1O1WA 3SUPA 4CF9A 4K8XA 4LF8K 4DV3K 3TSPA 2YKNA 3VENA 1M1KO 3LP2A 1BQMA 1RTJA 4E19A 1XHZA 5MLCQ 4HTLA 1TUYA 1WSFA 2E6MA 1V4SA 2O8FA 2P9UA 1C0GA 1RDAA 4MO4A 4QS7A 1YJ9N 4JKGB 3CJ9A 4IDKA 3OJUA 5M1OA 3IUCA 4JAXA 2ATQA 4LD0A 4FM2A 3A5LC 4GV6A 5KQDA 3IG1A 1F21A 3CCRN 3AVCA 2AJQA 1NGDA 3VQDA 1NJWA 4YDUA 4BC5A 4U67L 1OH5A 4CHOA 2AA4A 2FF6A 2GELA 3L3VA 2P9NA 4CEZA 3R8EA 3E9OA 4F3OA 4DKWA 5C15A 2JWLA 1S6QA 1UAXA 1BO5O 4B3RK 1RTHA 3EN9A 4PHTX 4FLXA 2QW9A 3R6MA 3ENHA 4HVJA 3SV3A 2O8BB 1K8KA 4FLTA 3AY9A 5KPRA 1IKXA 1NLVA 4IFEA 4PUOA 3CIPA 1P90A 1KD1O 3J7ZO 4GMJB 2BDPA 5E26A 2P9IB 1TGOA 3ALYA 5AQZA 1BA1A 2YNIA 3NH0A 3L4QA 1VRUA 1DEJA 1ASWA 3K5OA 3MECA 1L3UA 3DLRA 4EFHA 3MWTA 1LWEA 3M3ZA 3QBXA 4CZJA 4O5BA 4LF4K 2UUCK 1ASVA 4OKKA 3U3YA 2G8FA 4CF8A 1TUUA 4YOXA 1NGCA 4YOUA 4B08A 2KZMA 3IKMA 4AM6A 4CZGA 2HHUA 3KD1E 4W5RA 4FPAA 1TV6A 4CJ4A 4BR4A 3LAKA 3HJFA 4FLYA 3OTOK 2XRIA 3KHYA 2FSJA 3C65A 3THXB 1D4XA 1X9MA 2ZE2A 3CI5A 1L3VA 2CH6A 1U4BA 2X74A 3O9TA 3SYZA 1NJZA 4BQZA 4H8KA 3RMCA 1FKOA 2Z1JA 1NM1A 2VG6A 4DSLA 5JS1A 1GLAG 1J54A 3TTFA 3U8XA 3QEIA 1BCMA 1OKJA 1J9AA 1ESVA 3P38A 3AAPA 3QDKA 4HUFA 3VEOA 5AQWA 3MK6A 3T7ZA 2V52B 3MX5A 4NCGA 3VESA 4KTZA 1GOBA 4BRMA 4CK1A 4CD1A 3HI0A 3VA0A 2D0AA 5BRDA 3LDOA 4RTFD 4KPYA 1C0TA 1RTIA 4M3UA 2KLAA 2KTQA 5HRRA 5TKYA 4J2DA 3TI0A 1NNEA 3LDNA 2HHHK 4PKGA 1NJXA 1HYSA 4XH4A 5C24A 4H0OA 3WXJA 1O13A 5M1PA 4JYAK 3O80A 1MDUB 1IO2A 1A5WA 1YTAA 2IAJA 3EO3A 4HCBA 2G8UA 1TAUA 2NLXA 3AAQA 4WE1A 5GAEP 1OVYA 1QQNA 3FFIA 3GL1A 3TWHA 2P9KB 3CCLN 1ZC6A 4I9LA 3MEEA 1HNVA 1VSMA 4WYBA 4JHDB 3HM8A 4DR3K 2OTJN 4MLEA 1Q7YO 3CCJN 4B9VA 1Q82O 4BQLA 3DLHA 1BDGA 2GBZA 2HHXA 4N47A 3VQCA 1GLBG 3KJVA 3HVRA 2UXBK 2FSNA 1NK8A 4FWSA 3DLBA 3VGLA 4CEBA 1VQNN 3HVTA 3O5BA 3N4QA 4H4OA 2X6SA 4PKIA 4B1WB 3L3UA 3SBTA 4OPJA 2QWNA 3KVGA 3UB5A 2P9SA 3T1AA 2XO7A 4DR1K 3ISNC 3VQEA 4DLEA 5J2MA 4JKHA 4B8CA 3HO1A 3CG7A 2H3GX 3HPHA 4DQ8A 1TVRA 4OKEA 2A41A 2WUSA 3J80O 1S72N 4E1JA 1GLEG 4BR9A 1WSJA 3QEPA 3AA4A 4FJIA 2QXLA 3OW2M 3O3HA 1L3SA 2GUPA 3PX4A 2QKBA 3RSEB 3H1VX 4ELVA 4KI6A 2RHKA 4E89A 3ZETB 4C1NI 4X66K 1GOCA 5M1NA 3LDPA 4FJJA 3KLIA 4DU3A 3ZSYA 5J2NA 3FE1A 1DGKN 4BREA 3EZ5A 4ILHA 5BPMA 3UKUB 3RVCA 3V4IA 3DXKA 3V6DA 4BY9C 3O9SA 1RBUA 4FLUA 3L0QA 4DQIA 4QCLA 3M6GA 3OBWA 2YJFA 1HKCA 2F9TA 1KAXA 1ILYA 4K41A 5EOYA 4JI3K 4BR7A 2W6KA 1VSFA 3WXKA 3E01A 1KAYA 3VQ8A 2NRHA 3MN9A 4AF1A 4UQGA 1JLBA 1RFQA 4BVOA 1U47A 1I94K 2QEXN 4DTXA 3TAEA 1LAVA 4F9OA 4Y1DA 4FJGA 1LCUA 1J6ZA 2QK9A 5KPTA 3ZT0A 3HPGA 2NUBA 1NMDA 1X3NA 2E4LA 3MDQA 3RWUA 1YTUA 2V7ZA 2HF3A 4O44A 2IIRA 1GLFO 4F2SA 4BRQA 3MX2A 5BN8A 4RWTA 4CIFA 3FGUA 4FM0A 3KZBA 1S1WA 4KAZA 4CHNA 3BGRA 3L4IA 3L8BA 1NJIO 3THWB 4OLAA 1NKBA 3LPTA 2P51A 5AR0A 4KH5A 2OPSA 3VTHA 4J2BA 4CI6A 2W6LA 3TARA 2YHAA 2P1JA 3HTVA 5C25A 1XMOK 2UUAK 3QEVA 2DPNA 2GV9A 2VYPA 2DFFA 3IMXA 2HSTA 3NGYA 5AZIA 2W40A 4XIUA 1JLEA 1QHTA 3NF9A 5JICA 4RG8A 4EP4A 2BH1A 2HBLA 2VWKA 3JXUA 2F7TA 4M41A 3DAWA 2G8VA 4X62K 2E1ZA 3MXIA 2E20A 3TU5A 1C0UA 5C2FA 4C8KA 1V4TA 3WXIA 3EKUA 2R7YA 3QLHA 5GAGP 5AQNA 3LWLA 1JL2A 1M90O 2OCEA 4PWDA 3ATVA 3KKSA 5FDLA 3R1XA 5AZJA 1NK5A 4JI4K 1SL1A 3NDKA 4DV0K 1IG9A 4BC4A 4N41A 1Z25A 1HKGA 2GX9A 2GEMA 5I42A 3ULEB 1T6CA 4K43A 3EKSA 3PX0A 4A61A 2VG7A 3G25A 1VSDA 1JCEA 4C8OA 3OYIA 2QTDA 4DS4A 2P9NB 1Q86O 4H0XB 2YNGA 4WQ4A 3HOSA 3L2WA 4DS5A 2RKIA 4CZMA 1E4GT 4HWIA 3A2FA 3OBYA 3WNGA 2PYLA 4B9UA 2BGGA 2E1YA 3CJCA 3NGIA 2E6LA 3AVFA 4B9LA 1DLOA 5FRMA 3LWMA 2Y1IA 3RRGA 4LF6K 1NK4A 3O08A 2UXCK 1SV5A 3EE8A 3IRXA 2LSNA 1K8KB 4CZFA 3LM9A 4YY3K 1BA0A 3CXCM 1ZBHA 3TSUA 2RN2A 3K5NA 4I6MA 1NOYA 3UKRA 4KHYA 1XNQK 1OH7A 2NRVA 5AQKA 3KLEA 4DUYK 4Z4GA 3PIPL 1NK9A 5EXWA 3BP8A 3ASMA 3T19A 4X65K 4DV7K 1C1CA 3H08A 1OVQA 1NWKA 4CFCA 4JNEA 3OYCA 4DU4A 5LL6Z 3OYAA 2BTFA 3PY8A 3CMEN 4FJLA 3O1WA 1T03A 4Y1CA 3W0LA 1KLMA 1RBRA 1KFDA 3HSCA 1BU6O 1MWKA 4DMNA 1IBKK 1YJNN 2HW3A 1HKBA 1ZBUA 3THYB 5EX5A 4ILGB 4IFVA 2HHSA 3C95A 3DYAA 3OS1A 4N56A 3C7NA 5F2RA 5HL7L 1FW6A 4MLHA 2F9WA 4JI8K 3D0PA 1QQCA 2EHGA 4Z4HA 1EQYA 3D2FB 3WNFA 4J2EA 4AHSA 1ZBSA 1S1XA 1Q81O 1E4FT 4FOIA 3WXMB 3QFPA 1KVBA 2ASOA 2YI1A 3T1HK 3CJAA 3J81O 2DFEA 1JKHA 5E41A 3AGRA 3VQ5A 3VTIA 3RTVA 1WNSA 4RW8A 4DFJA 5AQQA 5HRSA 1LWFA 5EY4A 4FLWA 3AVMA 1X9WA 4DSKA 1RDDA 1ATRA 1G99A 4O5FA 3TAGA 4OPAA 2DFHA 2O8DA 1YF5L 3C6HA 3LDQA 4ID5A 4FL9A 3ZSQA 5BRFA 3ZX2A 2IS3A 3FZKA 5SZTA 3F9MA 3L2VA 3NHGA 1RBSA 2B5JA 3DXMB 5DM7L 4MO5A 2FSKA 3QMLA 1NGFA 1VSLA 4I7FA 4B3OA 5AQYA 4CZKA 4BR5A 2I7NA 1GOAA 5KQ8A 4I2PA 1WBDA 2WOMA 4YDUC 2XY7A 4AHTA 2DTUA 2O8EA 1WSIA 4A2BA 4B3TK 4AQYK 1BCOA 4V19S 3CPEA 4H5WA 3VEXA 4NLBA 5AQIA 4QS9A 4A2AA 3QIOA 1XMQK 4KB0A 3WEEA 5IWAK 1RT3A 2RPIA 3TR8A 4KH6A 3V9ZA 4WFNL 4HHTA 2OANA 3B6OA 1YITN 4GV3A 1YI2N 4CEQA 1NGIA 4K42A 1J53A
chains in the Genus database with same CATH topology
1ZBFA 3WNEA 3OYNA 4W5NA 3AVNA 4J2DA 1C1AA 2KFZA 3TI0A 3T3FA 1TK8A 4I2QA 3V9XA 1HYZA 1B92A 1TK0A 4M3RA 1NK7A 1KFSA 3AO5A 2YKMA 1NJXA 1HYSA 2I5JA 5C24A 3CFOA 3AA2A 4KV8A 3AO3A 4CGGA 4E7KA 4ZHRA 4DTOA 1IO2A 3SCXA 2HHVA 1A5WA 1YTAA 2ETJA 2YNFA 1HJRA 1KTQA 4C8NA 3LZIA 4W5OA 1XC9A 3M8PA 2IAJA 1N5YA 1QTMA 4FK4A 4HCBA 4Z4FA 3K5LA 5SWMA 2G8UA 1EP4A 1TAUA 3EYZA 4WE1A 3OY9A 5HRPA 5KRSA 3LP3A 3SQ2A 5HP1A 3FFIA 5HRNA 3TWHA 2VG5A 3OYEA 4DF8A 5CYMA 2FC0A 3RMDA 4KB1A 2FBXA 2EX3A 4CEEA 2GUIA 4I9LA 3MEEA 1HNVA 2HB5A 3KKRA 1VSJA 1YT3A 1VSMA 3G10A 2Y1JA 1KVAA 5FROA 1WSHA 4KFBA 4CIEA 2IGIA 4B9MA 2HHTA 3QIPA 4B9VA 4BACA 3DLHA 3U6FA 1SKWA 3NE6A 4AHRA 4L8RB 2KQ2A 2GBZA 2HHXA 4F4KA 4N47A 3VQCA 4B9TA 1BHLA 3KJVA 3HVRA 2P5GA 4ZTJA 1QS4A 4JLHA 1FKPA 3DRSA 3SUNA 2OPPA 3CFRA 1NK8A 4LH4A 3DLBA 3EY1A 4FJ8A 4CEBA 3I0RA 4FZXC 1C0MA 3DLKA 3NFAA 1VSIA 3HVTA 2X78A 3QINA 3KK2A 4DQRA 1T05A 3V9SA 4H4OA 4O55A 4KTQA 2X6SA 4CK2A 3D45A 3HK2A 3AVBA 1Y97A 3L3UA 4OPJA 2B4JA 1S9GA 3T1AA 2XO7A 3RRHA 3KK1A 3ISNC 3VQEA 4AHCA 4DLEA 1Q9YA 4BDZA 3MXJA 4AHUA 5J2MA 4B9NA 4CGJA 3DOKA 3S3NA 4F3TA 3CM5A 1CLQA 4B8CA 3HO1A 4OGEA 3CG7A 3HPHA 3LZJA 1HMVA 1HRHA 3SPZA 1S6PA 1TVRA 4OKEA 4PA1A 1RTDA 4FLVA 2RF2A 3LP0A 3AVGA 4FYDA 4YNQA 1WSJA 3OYGA 3AA4A 3QEPA 4OPKA 4ICLA 4FJIA 5D3GA 2HHQA 4EZ6A 3AVKA 3O3HA 3KD5E 1L3SA 3V81A 3K59A 3PX4A 2QKBA 5CYQA 2XHBA 3TANA 2OZMA 3JSMA 1KVCA 2VWJA 3M8RA 4KRFA 3NH1A 4CJSA 4FW1A 3AO4A 2HVHA 1L3TA 4CJWA 4JS4A 4ELVA 4KI6A 4M45A 4CJVA 4E89A 4KI4A 1TK5A 1GOCA 1S5JA 3AVAA 2F96A 3DOLA 4DQPA 1EXQA 4FJJA 3KLIA 3AA3A 4BDYA 1S9EA 3HL8A 4DU3A 1D9FA 3LALA 3VN5A 5K14A 1U45A 4FJKA 3ZSYA 4CEOA 3TAQA 5J2NA 1XI1A 3P83D 3QESA 3M8QA 1QSLA 3EZ5A 4M3XA 2ZQBA 2HNZA 1I39A 1ASUA 3SQ1A 1JXEA 1HQUA 3NF7A 4HTUA 4LSLA 4H4MA 2G8HA 3V4IA 3F9KA 4IG3A 3AV9A 3V6DA 3S3MA 1DTQA 3HP9A 3M8SA 4Z4CA 3L2RA 5J1EA 1RBUA 4FLUA 2Q3SA 4DQSA 1LW0A 2X6NA 1D5AA 4ID1A 3CYMA 4RW4A 2A1RA 1RDBA 3ZSRA 3HXMA 4DQIA 4QCLA 1QE1A 2FBTA 3AVHA 4C8LA 1W0HA 4DLGA 3DLEA 1N6QA 4HUEA 3C6TA 3VQQA 3O3FA 1NKCA 1QSYA 4HCCA 1EETA 3KK3A 3RR8A 3SNNA 1VSFA 1JLFA 3E01A 4FZZA 1T7PA 2JGUA 3VQ8A 1JLQA 2ITGA 3L2UA 4KKOA 1VSHA 1ZBLA 4EP5A 4UQGA 1JLBA 3VQ6A 3NAEA 3NH2A 2QXFA 5KI6A 4OVLA 1U47A 4CF0A 3OYDA 4DTXA 3OYFA 4Q5VA 1U04A 3TAEA 1LAVA 4AHVA 1W9HA 4Y1DA 1ZBIA 1U48A 4FJGA 4CJQA 2QK9A 4FJHA 1Z26A 1RT1A 1T8EA 2P5OA 3ZT0A 3HPGA 2NUBA 4F8RA 4FW2A 4O4GA 1BI4A 2E4LA 1REVA 2ZD1A 4LH5A 3RWUA 4IBNA 4MQ3A 5HLFA 4CEAA 1YTUA 1KSPA 3AVLA 4EZ9A 2XY5A 4DTMA 4O44A 2F8TA 4IKFA 4F2SA 4M3YA 3HT3A 4FCYA 4DSIA 3U3GA 1CZBA 3TAPA 3TAMA 3B6PA 4C8MA 4DTNA 1ZYQA 4DTRA 4CF2A 4Q0BA 4CIFA 2OYQA 3C94A 3WNHA 1S1WA 4FM0A 4TSXA 4CGDA 4CHNA 4ELTA 4KAZA 4FJ5A 3BGRA 1XWLA 1NK0A 3L8BA 3OYHA 4K8ZA 1K6YA 4LSNA 3VQPA 4CFBA 3F73A 2QKKA 4M3ZA 1LAWA 2D0BA 3ITHA 4CJKA 3LDSA 4JRQA 3S3OA 4M3WA 4OLAA 1NKBA 3ZT4A 4E7HA 5CZ2A 3LPTA 2O4GA 2P51A 3OVNA 2OPSA 4J2BA 1DTTA 3KTQA 3S9HA 1JXBA 3ZSWA 3V1OA 1NK6A 3TARA 2YHAA 4CHQA 4CHYA 2PYJA 4E1NA 3V9WA 1WLJA 2P1JA 2WONA 1MU2A 4CJ5A 5C25A 3OS2A 4FJXA 3QEVA 4PQUA 2GV9A 2Z1IA 4DTSA 1RT4A 3ULDA 2PZSA 4ELUA 4DTJA 5KGXA 4FJ9A 3V9UA 2DFFA 4XIUA 3NGYA 4BWMA 1BGXT 4FXDA 1JLEA 1QHTA 3HYFA 2OZSA 3UIQA 3NF9A 1VSEA 4RG8A 4CE9A 3OYKA 1BL3A 2D0CA 3SPYA 1C6VA 3P1GA 4LY7A 4CHZA 4W5TA 3HP6A 4EP4A 4I9QA 3KIOA 4DSFA 2VWKA 4CIGA 2HNDA 4FK0A 4RW6A 2IOCA 4M41A 4KTWA 5CY4A 1SL0A 2G8VA 2OPRA 2A1SA 1VRTA 3OS0A 3QETA 3MXIA 4CJ3A 1Q8IA 1NKEA 4CERA 1FK9A 3QNNA 4M3TA 2FBYA 3O4QA 1IKVA 1BQNA 4CCHA 1C0UA 2D5RA 4C8KA 2R7YA 4BE1A 3QLHA 4DSEA 4JRPA 3LWLA 1LWCA 1FXXA 1SUQA 1JL2A 3ZT2A 2G8KA 4FJNA 5JS2A 4CGIA 4W5QA 2XY8A 4QAGA 4Z0UA 4PWDA 3KKSA 5FDLA 1IKWA 1SKSA 1A5VA 4OLBA 1NK5A 1X1PA 3PUFA 4AH9A 4CJPA 1VK0A 3MXMA 2HHWA 1SL1A 1WAFA 3NDKA 4CGHA 1IG9A 4N41A 1XHXA 1Z25A 1ITGA 1G15A 1BI4B 1D9DA 1TKZA 1B9DA 1WSEA 2IDOA 4FLZA 4GVMA 1IH7A 2PY5A 3QEWA 3VQBA 4FK2A 5I42A 4NYFA 4NYNA 3ZT3A 4QOZB 3OJSA 3JYTA 4FJMA 2IC3A 5J2PA 4FZYA 3PX0A 2VG7A 4GW6A 4FM1A 4CFAA 1KRPA 1VSDA 3LAMA 1C1BA 4C8OA 1LW2A 3NF6A 4B8AB 3OYIA 4YFUA 1TL1A 4DS4A 4BE2A 4E7IA 4ZTFA 3QEXA 2YNGA 1QSSA 3MEGA 1CXQA 4G1QA 3L2WA 4CECA 4DS5A 4E3SA 1SL2A 4CJTA 2RKIA 2KFNA 4B9UA 1RCHA 3A2FA 1BIZA 3WNGA 4DFMA 1EX4A 2OA8A 2PYLA 2BGGA 4CEFA 3K58A 3CM6A 3QO9A 3PV8A 5FRNA 3NGIA 4MFBA 1RILA 2E6LA 1A5XA 3AVFA 3HSTB 3VQ4A 3ZSXA 1HYVA 1O1WA 1IKYA 1RBTA 1DLOA 3I8DA 4B9LA 5FRMA 2FBVA 3LWMA 4CF9A 1RBVA 3VA3A 2Y1IA 3SUPA 1D8YA 3RRGA 4K8XA 1BISA 1UWBA 2YKNA 2YHBA 3I0SA 3KLFA 1NK4A 4M42A 3DM2A 1SV5A 3LP2A 5EU7A 5C42A 4KHUA 4Z4IA 3IRXA 4CEDA 2LSNA 3CQ8A 5KRTA 1BQMA 1RTJA 4E19A 1XHZA 1TKDA 5HROA 1ZBHA 3TAFA 1TAQA 1WSFA 2E6MA 3VQAA 4E0DA 2RN2A 2F8SA 3RMAA 1TKTA 3K5NA 2KZZA 1NOYA 1RDAA 3QERA 4KHSA 2B6AA 4IDKA 3OJUA 3SZ2A 4KHYA 1RT5A 3AVIA 3DI6A 3DLGA 3KLGA 2ATQA 4KO0A 4LD0A 4FM2A 4DTUA 3KLEA 1JL1A 3DRPA 4IFYA 3QNOA 4Z4GA 3IG1A 3SJJA 1NK9A 2KW4A 1F21A 3AVCA 2AJQA 3ASMA 3VQ9A 3T19A 4BWJA 4DG1A 4CFDA 3VQDA 3NCIA 3BDPA 1WAJA 1C1CA 1NJWA 4DSJA 3H08A 4CFCA 3OYCA 4FVMA 1VSKA 4DU4A 3AO2A 1CZ9A 4DU1A 4CHOA 3OYAA 4AILC 3L3VA 3PY8A 3OYBA 4FJLA 4KREA 3P5JA 4CESA 4CJUA 4CEZA 3K57A 4DTPA 1T03A 2YV0X 5HBMA 4Y1CA 1S1TA 4F3OA 3C6UA 1KLMA 1HNIA 2BE2A 3SI6A 4KHQA 1EKEA 1RBRA 1KFDA 2JLEA 4CJEA 2YNHA 2HW3A 3LP1A 2BANA 1S6QA 4DMNA 4CK3A 1ZBUA 4NCAA 4B9SA 1UAXA 2O4IA 3O4NA 3AVJA 3RR7A 1B9FA 1RTHA 1RDCA 3RMBA 1U49A 4BDPA 4IFVA 2HHSA 3C95A 4FLXA 3DYAA 3KLHA 3TABA 4DWIA 2XY6A 3LANA 4IG0A 2HMIA 1HPZA 3LPUA 1JLAA 4N56A 3OS1A 1CXUA 1RT6A 5KTQA 4HVJA 3SV3A 3SUQA 2Z1HA 3D0PA 1TKXA 1QQCA 4OGCA 4FLTA 1WN7A 2EHGA 4DQQA 4KHNA 4Z4HA 1IKXA 4E1MA 4PY5A 3OYMA 4DFKA 3WNFA 4NCBA 4PUOA 4J2EA 4AHSA 1BIUA 1S1XA 4E7JA 4DF4A 4N5SA 4GMJB 2BDPA 3HPOA 1TGOA 4RW7A 3AA5X 4JS5A 5DMRA 4CF1A 3ALYA 1KVBA 2YNIA 3NH0A 3MAQA 3V1QA 5KGWA 4HUGA 1VRUA 5DK5A 1ASWA 3K5OA 1LV5A 1NOZA 3G0ZA 4CHPA 1S1VA 3MECA 4O0JA 2DFEA 2OPQA 4OJRA 1JKHA 1L3UA 3DLRA 5E41A 1RT2A 2DY4A 3VQ5A 3RTVA 1LWEA 1WNSA 4RW8A 1SKRA 3K2PA 1J5OA 4J2AA 1I3AA 4DFJA 4O5BA 5HRSA 1LWFA 1RNHA 3ZT1A 1ASVA 1WSGA 1JLGA 4FLWA 3AVMA 4OKKA 1HQEA 1X9WA 4DSKA 1RDDA 4Z4EA 3DMJA 3TAGA 4CJLA 3U3YA 3NBPA 4KHWA 2DFHA 3ZSZA 2G8FA 4CF8A 3NGZA 5J2QA 1J53A 4B08A 4ID5A 3ZSQA 2KZMA 2W42A 2HHUA 3IS9A 2IS3A 3DRRA 4O0IA 1RT7A 5SZTA 4W5RA 3KD1E 2HVIA 1TV6A 3K5MA 3SV4A 4CJ4A 3LAKA 4N76A 4DFPA 3HJFA 4FLYA 3L2VA 3HM9A 2XRIA 3NHGA 1RBSA 2B5JA 2Z1GA 1X9MA 2G8IA 4CJFA 2ZE2A 3PX6A 1S1UA 1TL3A 1R0AA 3ZSVA 1L3VA 1U4BA 1VSLA 4I7FA 2X74A 4B3OA 3V1RA 3SYZA 1NJZA 3SUOA 4H8KA 3MEDA 5CZ1A 3RMCA 3THVA 4RW9A 1FKOA 2Z1JA 2VG6A 1GOAA 3AO1A 3VQ7A 3CFPA 4DSLA 1J54A 4I2PA 4CJRA 5JS1A 2WOMA 1BCMA 3QEIA 2XY7A 4AHTA 2DTUA 1J9AA 4E7LA 3IAYA 3NF8A 4FJ7A 1WSIA 4HUFA 1KLNA 4BE0A 3ZCMA 1BCOA 3PO4A 3SQ4A 4NCGA 4KTZA 1GOBA 4OKJA 4CGFA 4R5PA 1X9SA 4CK1A 3O3GA 1UOCA 5T7BA 2G8WA 3QIOA 3PO5A 4KB0A 3OYJA 3VA0A 2D0AA 1NJYA 3OYLA 1RT3A 2RPIA 1L5UA 3TR8A 1JLCA 4KPYA 3V9ZA 1C0TA 3SQ0A 1UA0A 1RTIA 4M3UA 1Q9XA 4HHTA 3ZSOA 3B6OA 2KTQA 1UA1A 4F2RA 3L2QA 5HRRA 5I3UA 4CEQA 1YVUA 1KCFA 2HNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBF A;  3WNE A;  3OYN A;  4W5N A;  3AVN A;  4J2D A;  1C1A A;  2KFZ A;  3TI0 A;  3T3F A;  1TK8 A;  4I2Q A;  3V9X A;  1HYZ A;  1B92 A;  1TK0 A;  4M3R A;  1NK7 A;  1KFS A;  3AO5 A;  2YKM A;  1NJX A;  1HYS A;  2I5J A;  5C24 A;  3CFO A;  3AA2 A;  4KV8 A;  3AO3 A;  4CGG A;  4E7K A;  4ZHR A;  4DTO A;  1IO2 A;  3SCX A;  2HHV A;  1A5W A;  1YTA A;  2ETJ A;  2YNF A;  1HJR A;  1KTQ A;  4C8N A;  3LZI A;  4W5O A;  1XC9 A;  3M8P A;  2IAJ A;  1N5Y A;  1QTM A;  4FK4 A;  4HCB A;  4Z4F A;  3K5L A;  5SWM A;  2G8U A;  1EP4 A;  1TAU A;  3EYZ A;  4WE1 A;  3OY9 A;  5HRP A;  5KRS A;  3LP3 A;  3SQ2 A;  5HP1 A;  3FFI A;  5HRN A;  3TWH A;  2VG5 A;  3OYE A;  4DF8 A;  5CYM A;  2FC0 A;  3RMD A;  4KB1 A;  2FBX A;  2EX3 A;  4CEE A;  2GUI A;  4I9L A;  3MEE A;  1HNV A;  2HB5 A;  3KKR A;  1VSJ A;  1YT3 A;  1VSM A;  3G10 A;  2Y1J A;  1KVA A;  5FRO A;  1WSH A;  4KFB A;  4CIE A;  2IGI A;  4B9M A;  2HHT A;  3QIP A;  4B9V A;  4BAC A;  3DLH A;  3U6F A;  1SKW A;  3NE6 A;  4AHR A;  4L8R B;  2KQ2 A;  2GBZ A;  2HHX A;  4F4K A;  4N47 A;  3VQC A;  4B9T A;  1BHL A;  3KJV A;  3HVR A;  2P5G A;  4ZTJ A;  1QS4 A;  4JLH A;  1FKP A;  3DRS A;  3SUN A;  2OPP A;  3CFR A;  1NK8 A;  4LH4 A;  3DLB A;  3EY1 A;  4FJ8 A;  4CEB A;  3I0R A;  4FZX C;  1C0M A;  3DLK A;  3NFA A;  1VSI A;  3HVT A;  2X78 A;  3QIN A;  3KK2 A;  4DQR A;  1T05 A;  3V9S A;  4H4O A;  4O55 A;  4KTQ A;  2X6S A;  4CK2 A;  3D45 A;  3HK2 A;  3AVB A;  1Y97 A;  3L3U A;  4OPJ A;  2B4J A;  1S9G A;  3T1A A;  2XO7 A;  3RRH A;  3KK1 A;  3ISN C;  3VQE A;  4AHC A;  4DLE A;  1Q9Y A;  4BDZ A;  3MXJ A;  4AHU A;  5J2M A;  4B9N A;  4CGJ A;  3DOK A;  3S3N A;  4F3T A;  3CM5 A;  1CLQ A;  4B8C A;  3HO1 A;  4OGE A;  3CG7 A;  3HPH A;  3LZJ A;  1HMV A;  1HRH A;  3SPZ A;  1S6P A;  1TVR A;  4OKE A;  4PA1 A;  1RTD A;  4FLV A;  2RF2 A;  3LP0 A;  3AVG A;  4FYD A;  4YNQ A;  1WSJ A;  3OYG A;  3AA4 A;  3QEP A;  4OPK A;  4ICL A;  4FJI A;  5D3G A;  2HHQ A;  4EZ6 A;  3AVK A;  3O3H A;  3KD5 E;  1L3S A;  3V81 A;  3K59 A;  3PX4 A;  2QKB A;  5CYQ A;  2XHB A;  3TAN A;  2OZM A;  3JSM A;  1KVC A;  2VWJ A;  3M8R A;  4KRF A;  3NH1 A;  4CJS A;  4FW1 A;  3AO4 A;  2HVH A;  1L3T A;  4CJW A;  4JS4 A;  4ELV A;  4KI6 A;  4M45 A;  4CJV A;  4E89 A;  4KI4 A;  1TK5 A;  1GOC A;  1S5J A;  3AVA A;  2F96 A;  3DOL A;  4DQP A;  1EXQ A;  4FJJ A;  3KLI A;  3AA3 A;  4BDY A;  1S9E A;  3HL8 A;  4DU3 A;  1D9F A;  3LAL A;  3VN5 A;  5K14 A;  1U45 A;  4FJK A;  3ZSY A;  4CEO A;  3TAQ A;  5J2N A;  1XI1 A;  3P83 D;  3QES A;  3M8Q A;  1QSL A;  3EZ5 A;  4M3X A;  2ZQB A;  2HNZ A;  1I39 A;  1ASU A;  3SQ1 A;  1JXE A;  1HQU A;  3NF7 A;  4HTU A;  4LSL A;  4H4M A;  2G8H A;  3V4I A;  3F9K A;  4IG3 A;  3AV9 A;  3V6D A;  3S3M A;  1DTQ A;  3HP9 A;  3M8S A;  4Z4C A;  3L2R A;  5J1E A;  1RBU A;  4FLU A;  2Q3S A;  4DQS A;  1LW0 A;  2X6N A;  1D5A A;  4ID1 A;  3CYM A;  4RW4 A;  2A1R A;  1RDB A;  3ZSR A;  3HXM A;  4DQI A;  4QCL A;  1QE1 A;  2FBT A;  3AVH A;  4C8L A;  1W0H A;  4DLG A;  3DLE A;  1N6Q A;  4HUE A;  3C6T A;  3VQQ A;  3O3F A;  1NKC A;  1QSY A;  4HCC A;  1EET A;  3KK3 A;  3RR8 A;  3SNN A;  1VSF A;  1JLF A;  3E01 A;  4FZZ A;  1T7P A;  2JGU A;  3VQ8 A;  1JLQ A;  2ITG A;  3L2U A;  4KKO A;  1VSH A;  1ZBL A;  4EP5 A;  4UQG A;  1JLB A;  3VQ6 A;  3NAE A;  3NH2 A;  2QXF A;  5KI6 A;  4OVL A;  1U47 A;  4CF0 A;  3OYD A;  4DTX A;  3OYF A;  4Q5V A;  1U04 A;  3TAE A;  1LAV A;  4AHV A;  1W9H A;  4Y1D A;  1ZBI A;  1U48 A;  4FJG A;  4CJQ A;  2QK9 A;  4FJH A;  1Z26 A;  1RT1 A;  1T8E A;  2P5O A;  3ZT0 A;  3HPG A;  2NUB A;  4F8R A;  4FW2 A;  4O4G A;  1BI4 A;  2E4L A;  1REV A;  2ZD1 A;  4LH5 A;  3RWU A;  4IBN A;  4MQ3 A;  5HLF A;  4CEA A;  1YTU A;  1KSP A;  3AVL A;  4EZ9 A;  2XY5 A;  4DTM A;  4O44 A;  2F8T A;  4IKF A;  4F2S A;  4M3Y A;  3HT3 A;  4FCY A;  4DSI A;  3U3G A;  1CZB A;  3TAP A;  3TAM A;  3B6P A;  4C8M A;  4DTN A;  1ZYQ A;  4DTR A;  4CF2 A;  4Q0B A;  4CIF A;  2OYQ A;  3C94 A;  3WNH A;  1S1W A;  4FM0 A;  4TSX A;  4CGD A;  4CHN A;  4ELT A;  4KAZ A;  4FJ5 A;  3BGR A;  1XWL A;  1NK0 A;  3L8B A;  3OYH A;  4K8Z A;  1K6Y A;  4LSN A;  3VQP A;  4CFB A;  3F73 A;  2QKK A;  4M3Z A;  1LAW A;  2D0B A;  3ITH A;  4CJK A;  3LDS A;  4JRQ A;  3S3O A;  4M3W A;  4OLA A;  1NKB A;  3ZT4 A;  4E7H A;  5CZ2 A;  3LPT A;  2O4G A;  2P51 A;  3OVN A;  2OPS A;  4J2B A;  1DTT A;  3KTQ A;  3S9H A;  1JXB A;  3ZSW A;  3V1O A;  1NK6 A;  3TAR A;  2YHA A;  4CHQ A;  4CHY A;  2PYJ A;  4E1N A;  3V9W A;  1WLJ A;  2P1J A;  2WON A;  1MU2 A;  4CJ5 A;  5C25 A;  3OS2 A;  4FJX A;  3QEV A;  4PQU A;  2GV9 A;  2Z1I A;  4DTS A;  1RT4 A;  3ULD A;  2PZS A;  4ELU A;  4DTJ A;  5KGX A;  4FJ9 A;  3V9U A;  2DFF A;  4XIU A;  3NGY A;  4BWM A;  1BGX T;  4FXD A;  1JLE A;  1QHT A;  3HYF A;  2OZS A;  3UIQ A;  3NF9 A;  1VSE A;  4RG8 A;  4CE9 A;  3OYK A;  1BL3 A;  2D0C A;  3SPY A;  1C6V A;  3P1G A;  4LY7 A;  4CHZ A;  4W5T A;  3HP6 A;  4EP4 A;  4I9Q A;  3KIO A;  4DSF A;  2VWK A;  4CIG A;  2HND A;  4FK0 A;  4RW6 A;  2IOC A;  4M41 A;  4KTW A;  5CY4 A;  1SL0 A;  2G8V A;  2OPR A;  2A1S A;  1VRT A;  3OS0 A;  3QET A;  3MXI A;  4CJ3 A;  1Q8I A;  1NKE A;  4CER A;  1FK9 A;  3QNN A;  4M3T A;  2FBY A;  3O4Q A;  1IKV A;  1BQN A;  4CCH A;  1C0U A;  2D5R A;  4C8K A;  2R7Y A;  4BE1 A;  3QLH A;  4DSE A;  4JRP A;  3LWL A;  1LWC A;  1FXX A;  1SUQ A;  1JL2 A;  3ZT2 A;  2G8K A;  4FJN A;  5JS2 A;  4CGI A;  4W5Q A;  2XY8 A;  4QAG A;  4Z0U A;  4PWD A;  3KKS A;  5FDL A;  1IKW A;  1SKS A;  1A5V A;  4OLB A;  1NK5 A;  1X1P A;  3PUF A;  4AH9 A;  4CJP A;  1VK0 A;  3MXM A;  2HHW A;  1SL1 A;  1WAF A;  3NDK A;  4CGH A;  1IG9 A;  4N41 A;  1XHX A;  1Z25 A;  1ITG A;  1G15 A;  1BI4 B;  1D9D A;  1TKZ A;  1B9D A;  1WSE A;  2IDO A;  4FLZ A;  4GVM A;  1IH7 A;  2PY5 A;  3QEW A;  3VQB A;  4FK2 A;  5I42 A;  4NYF A;  4NYN A;  3ZT3 A;  4QOZ B;  3OJS A;  3JYT A;  4FJM A;  2IC3 A;  5J2P A;  4FZY A;  3PX0 A;  2VG7 A;  4GW6 A;  4FM1 A;  4CFA A;  1KRP A;  1VSD A;  3LAM A;  1C1B A;  4C8O A;  1LW2 A;  3NF6 A;  4B8A B;  3OYI A;  4YFU A;  1TL1 A;  4DS4 A;  4BE2 A;  4E7I A;  4ZTF A;  3QEX A;  2YNG A;  1QSS A;  3MEG A;  1CXQ A;  4G1Q A;  3L2W A;  4CEC A;  4DS5 A;  4E3S A;  1SL2 A;  4CJT A;  2RKI A;  2KFN A;  4B9U A;  1RCH A;  3A2F A;  1BIZ A;  3WNG A;  4DFM A;  1EX4 A;  2OA8 A;  2PYL A;  2BGG A;  4CEF A;  3K58 A;  3CM6 A;  3QO9 A;  3PV8 A;  5FRN A;  3NGI A;  4MFB A;  1RIL A;  2E6L A;  1A5X A;  3AVF A;  3HST B;  3VQ4 A;  3ZSX A;  1HYV A;  1O1W A;  1IKY A;  1RBT A;  1DLO A;  3I8D A;  4B9L A;  5FRM A;  2FBV A;  3LWM A;  4CF9 A;  1RBV A;  3VA3 A;  2Y1I A;  3SUP A;  1D8Y A;  3RRG A;  4K8X A;  1BIS A;  1UWB A;  2YKN A;  2YHB A;  3I0S A;  3KLF A;  1NK4 A;  4M42 A;  3DM2 A;  1SV5 A;  3LP2 A;  5EU7 A;  5C42 A;  4KHU A;  4Z4I A;  3IRX A;  4CED A;  2LSN A;  3CQ8 A;  5KRT A;  1BQM A;  1RTJ A;  4E19 A;  1XHZ A;  1TKD A;  5HRO A;  1ZBH A;  3TAF A;  1TAQ A;  1WSF A;  2E6M A;  3VQA A;  4E0D A;  2RN2 A;  2F8S A;  3RMA A;  1TKT A;  3K5N A;  2KZZ A;  1NOY A;  1RDA A;  3QER A;  4KHS A;  2B6A A;  4IDK A;  3OJU A;  3SZ2 A;  4KHY A;  1RT5 A;  3AVI A;  3DI6 A;  3DLG A;  3KLG A;  2ATQ A;  4KO0 A;  4LD0 A;  4FM2 A;  4DTU A;  3KLE A;  1JL1 A;  3DRP A;  4IFY A;  3QNO A;  4Z4G A;  3IG1 A;  3SJJ A;  1NK9 A;  2KW4 A;  1F21 A;  3AVC A;  2AJQ A;  3ASM A;  3VQ9 A;  3T19 A;  4BWJ A;  4DG1 A;  4CFD A;  3VQD A;  3NCI A;  3BDP A;  1WAJ A;  1C1C A;  1NJW A;  4DSJ A;  3H08 A;  4CFC A;  3OYC A;  4FVM A;  1VSK A;  4DU4 A;  3AO2 A;  1CZ9 A;  4DU1 A;  4CHO A;  3OYA A;  4AIL C;  3L3V A;  3PY8 A;  3OYB A;  4FJL A;  4KRE A;  3P5J A;  4CES A;  4CJU A;  4CEZ A;  3K57 A;  4DTP A;  1T03 A;  2YV0 X;  5HBM A;  4Y1C A;  1S1T A;  4F3O A;  3C6U A;  1KLM A;  1HNI A;  2BE2 A;  3SI6 A;  4KHQ A;  1EKE A;  1RBR A;  1KFD A;  2JLE A;  4CJE A;  2YNH A;  2HW3 A;  3LP1 A;  2BAN A;  1S6Q A;  4DMN A;  4CK3 A;  1ZBU A;  4NCA A;  4B9S A;  1UAX A;  2O4I A;  3O4N A;  3AVJ A;  3RR7 A;  1B9F A;  1RTH A;  1RDC A;  3RMB A;  1U49 A;  4BDP A;  4IFV A;  2HHS A;  3C95 A;  4FLX A;  3DYA A;  3KLH A;  3TAB A;  4DWI A;  2XY6 A;  3LAN A;  4IG0 A;  2HMI A;  1HPZ A;  3LPU A;  1JLA A;  4N56 A;  3OS1 A;  1CXU A;  1RT6 A;  5KTQ A;  4HVJ A;  3SV3 A;  3SUQ A;  2Z1H A;  3D0P A;  1TKX A;  1QQC A;  4OGC A;  4FLT A;  1WN7 A;  2EHG A;  4DQQ A;  4KHN A;  4Z4H A;  1IKX A;  4E1M A;  4PY5 A;  3OYM A;  4DFK A;  3WNF A;  4NCB A;  4PUO A;  4J2E A;  4AHS A;  1BIU A;  1S1X A;  4E7J A;  4DF4 A;  4N5S A;  4GMJ B;  2BDP A;  3HPO A;  1TGO A;  4RW7 A;  3AA5 X;  4JS5 A;  5DMR A;  4CF1 A;  3ALY A;  1KVB A;  2YNI A;  3NH0 A;  3MAQ A;  3V1Q A;  5KGW A;  4HUG A;  1VRU A;  5DK5 A;  1ASW A;  3K5O A;  1LV5 A;  1NOZ A;  3G0Z A;  4CHP A;  1S1V A;  3MEC A;  4O0J A;  2DFE A;  2OPQ A;  4OJR A;  1JKH A;  1L3U A;  3DLR A;  5E41 A;  1RT2 A;  2DY4 A;  3VQ5 A;  3RTV A;  1LWE A;  1WNS A;  4RW8 A;  1SKR A;  3K2P A;  1J5O A;  4J2A A;  1I3A A;  4DFJ A;  4O5B A;  5HRS A;  1LWF A;  1RNH A;  3ZT1 A;  1ASV A;  1WSG A;  1JLG A;  4FLW A;  3AVM A;  4OKK A;  1HQE A;  1X9W A;  4DSK A;  1RDD A;  4Z4E A;  3DMJ A;  3TAG A;  4CJL A;  3U3Y A;  3NBP A;  4KHW A;  2DFH A;  3ZSZ A;  2G8F A;  4CF8 A;  3NGZ A;  5J2Q A;  1J53 A;  4B08 A;  4ID5 A;  3ZSQ A;  2KZM A;  2W42 A;  2HHU A;  3IS9 A;  2IS3 A;  3DRR A;  4O0I A;  1RT7 A;  5SZT A;  4W5R A;  3KD1 E;  2HVI A;  1TV6 A;  3K5M A;  3SV4 A;  4CJ4 A;  3LAK A;  4N76 A;  4DFP A;  3HJF A;  4FLY A;  3L2V A;  3HM9 A;  2XRI A;  3NHG A;  1RBS A;  2B5J A;  2Z1G A;  1X9M A;  2G8I A;  4CJF A;  2ZE2 A;  3PX6 A;  1S1U A;  1TL3 A;  1R0A A;  3ZSV A;  1L3V A;  1U4B A;  1VSL A;  4I7F A;  2X74 A;  4B3O A;  3V1R A;  3SYZ A;  1NJZ A;  3SUO A;  4H8K A;  3MED A;  5CZ1 A;  3RMC A;  3THV A;  4RW9 A;  1FKO A;  2Z1J A;  2VG6 A;  1GOA A;  3AO1 A;  3VQ7 A;  3CFP A;  4DSL A;  1J54 A;  4I2P A;  4CJR A;  5JS1 A;  2WOM A;  1BCM A;  3QEI A;  2XY7 A;  4AHT A;  2DTU A;  1J9A A;  4E7L A;  3IAY A;  3NF8 A;  4FJ7 A;  1WSI A;  4HUF A;  1KLN A;  4BE0 A;  3ZCM A;  1BCO A;  3PO4 A;  3SQ4 A;  4NCG A;  4KTZ A;  1GOB A;  4OKJ A;  4CGF A;  4R5P A;  1X9S A;  4CK1 A;  3O3G A;  1UOC A;  5T7B A;  2G8W A;  3QIO A;  3PO5 A;  4KB0 A;  3OYJ A;  3VA0 A;  2D0A A;  1NJY A;  3OYL A;  1RT3 A;  2RPI A;  1L5U A;  3TR8 A;  1JLC A;  4KPY A;  3V9Z A;  1C0T A;  3SQ0 A;  1UA0 A;  1RTI A;  4M3U A;  1Q9X A;  4HHT A;  3ZSO A;  3B6O A;  2KTQ A;  1UA1 A;  4F2R A;  3L2Q A;  5HRR A;  5I3U A;  4CEQ A;  1YVU A;  1KCF A;  2HNY A; 
#chains in the Genus database with same CATH topology
 3Q7C A;  2WBN A;  2ASM A;  3T3F A;  1TK8 A;  1HYZ A;  4CZE A;  1TK0 A;  4M3R A;  1KFS A;  1ZXO A;  4E7K A;  4WQ5 A;  5JLF A;  4CGG A;  1YXQ A;  4QS8 A;  3SJH A;  4GV9 A;  4C8N A;  1XC9 A;  1HJR A;  1W2B M;  4FK4 A;  3D7E O;  4Z4F A;  3K5L A;  1EP4 A;  4LF9 K;  3EYZ A;  2E2P A;  5KRS A;  4G9Z A;  4L3Q A;  4O8U A;  4GVE A;  5BPL A;  5LMN K;  1NGJ A;  1SS6 A;  3A5O C;  3MWP A;  3O9Q A;  2HB5 A;  1KC8 O;  2V51 B;  1IV0 A;  1WSH A;  4CIE A;  2P9L B;  2IGI A;  3QIP A;  3U6F A;  4BRP A;  4DR4 K;  2P5G A;  4LH4 A;  4JI1 K;  3NFA A;  1VSI A;  3KK2 A;  4KTQ A;  2NRW A;  3D2E A;  3HK2 A;  3D45 A;  4YHH K;  3AVB A;  1S9G A;  4LFA K;  1S22 A;  1TYQ A;  3KK1 A;  3MXJ A;  4B9N A;  4EHU A;  3JAM O;  4CGJ A;  3CM5 A;  1HMV A;  1HRH A;  4JKB A;  1RTD A;  4DV4 K;  2RF2 A;  3LP0 A;  3AVG A;  3O1B A;  3CJB A;  2HHQ A;  4YOV A;  1JCF A;  3GOI A;  2QWP A;  3A5M C;  3D6R A;  2XHB A;  3TAN A;  4BRC A;  1KVC A;  2NRT A;  3IFR A;  4KRF A;  3NH1 A;  4CJS A;  3AO4 A;  2HVH A;  1L3T A;  4CJW A;  4IJA A;  4JS4 A;  1TK5 A;  3A8Y A;  3HL8 A;  1D9F A;  1U45 A;  1Y64 A;  2ZGZ A;  3I56 N;  3TAQ A;  1XI1 A;  3QES A;  1T6D A;  1ASU A;  4HTU A;  4JI5 K;  4IOX A;  2QWM A;  3PSF A;  3P31 A;  4CZI A;  1DTQ A;  3J8A A;  3HP9 A;  4Z4C A;  2KFN A;  4I9Q A;  4KHW A;  2A1R A;  4RW4 A;  2D4W A;  3HXM A;  2FBT A;  1K9M O;  1W0H A;  3C6T A;  3VQQ A;  3O3F A;  1NKC A;  4FO0 A;  3QIC A;  4GKJ K;  5LJW A;  4CBX A;  1E3M A;  1VSH A;  1C0F A;  1VQ5 N;  4EP5 A;  3JS6 A;  2QXF A;  2Q36 A;  4OVL A;  4CF0 A;  3OYD A;  2FLO A;  1U04 A;  1IJJ A;  1W9H A;  5M1Q A;  1ZBI A;  3NMU A;  1T8E A;  4F8R A;  2P9P B;  3EL2 A;  1BI4 A;  1REV A;  1DT9 A;  2YHY A;  4IBN A;  4MQ3 A;  4CEA A;  1KSP A;  4FWK A;  5A2Q O;  3C6A A;  3MN6 A;  2J4R A;  4IKF A;  4M3Y A;  3HT3 A;  1K73 O;  3MN7 A;  1U2V A;  4DSI A;  1CZB A;  1YUW A;  4C8M A;  3VET A;  4DTN A;  1Z05 A;  4Q0B A;  1W97 L;  4ELT A;  1NK0 A;  1K6Y A;  4LSN A;  5AZJ B;  3I55 N;  2QWR A;  4E7H A;  5BPN A;  2O4G A;  2GTD A;  3FFK B;  1DTT A;  3KTQ A;  1NK6 A;  3V1O A;  3VPZ A;  4E1N A;  2WON A;  3OS2 A;  1MU2 A;  4PQU A;  3BEX A;  2Z1I A;  2PZS A;  1RT4 A;  4FJ9 A;  4H5N A;  1YIJ N;  4H0T B;  5AQJ A;  1BGX T;  2IVO A;  2VQF K;  4H03 B;  3WQT A;  5AQH A;  1BL3 A;  3OA9 A;  2D0C A;  1EWR A;  3P1G A;  4JKG A;  3HP6 A;  2F4V K;  3KIO A;  1VAZ A;  3PLA A;  2HND A;  4RW6 A;  1VRT A;  4CJ3 A;  5F1X A;  1NKE A;  4CER A;  2O8C B;  4NXM K;  1BQN A;  4O8K A;  2D5R A;  1QQM A;  4JRP A;  1LWC A;  1FXX A;  4FJN A;  3TPQ A;  3EE9 A;  3PIO L;  1IKW A;  4OLB A;  4FPB A;  1RDW X;  1WAF A;  2PFU A;  4CGH A;  4DV1 K;  4FWQ A;  2IDO A;  4JI0 K;  4FLZ A;  4GVM A;  3VQB A;  1QHA A;  3JYT A;  4FJM A;  2IC3 A;  3O4W A;  2E2O A;  4GW6 A;  3KK7 A;  4CFA A;  4FM1 A;  1KRP A;  4BRN A;  1C1B A;  3CJ1 A;  3NF6 A;  4DR6 K;  3WT0 A;  4PL7 A;  4ISG A;  3SK3 A;  3E9P A;  4G1Q A;  2HBK A;  4CEC A;  1SL2 A;  4CJT A;  5M1F A;  1RCH A;  1BIZ A;  2P9I A;  4DFM A;  1EX4 A;  4JI2 K;  3G71 N;  3QO9 A;  4MFB A;  3HST B;  3VQ4 A;  4J8F A;  1HYV A;  2FBV A;  1RBV A;  3VA3 A;  4JD2 B;  1BIS A;  5C12 A;  3KLF A;  4M42 A;  3I0S A;  3NVM A;  3CQY A;  3DM2 A;  3CCQ N;  5GIN A;  5C42 A;  4CED A;  5HRO A;  2A6A A;  1SQK A;  1TAQ A;  4E0D A;  2Q0R A;  4FOE A;  1TKT A;  3CMA N;  3ZX3 A;  3QER A;  3ZYY X;  5BR9 A;  2B6A A;  3SZ2 A;  1RT5 A;  3AVI A;  3DLG A;  4JN4 A;  1VQ9 N;  4PL8 A;  4DTU A;  4LFB K;  4IFY A;  1Z6R A;  3LDL A;  3SJJ A;  2KW4 A;  3VQ9 A;  4BWJ A;  4DG1 A;  4A5B A;  1WAJ A;  5FPE A;  4DSJ A;  3ZEU B;  2YX6 A;  3THX A;  4FVM A;  1VSK A;  3AO2 A;  1OH6 A;  4JK9 A;  4A5A A;  4AIL C;  3CD6 N;  3OYB A;  3B8A X;  4CJU A;  3K57 A;  2AP1 A;  2YV0 X;  1S1T A;  3N4P A;  4JKE A;  2JLE A;  3BZC A;  2YNH A;  2BAN A;  4CK3 A;  4NCA A;  4NO7 A;  2VCP A;  3TSQ A;  4B9S A;  3O4N A;  3AVJ A;  3RR7 A;  1VQ7 N;  3R3L A;  1B9F A;  3CF5 L;  2O8D B;  4DWI A;  3SBG A;  2JWK A;  2HMI A;  2FXU A;  3LPU A;  1JLA A;  4GY2 B;  1CXU A;  5KTQ A;  4FSV A;  4KHN A;  1VHX A;  4H5T A;  4E1M A;  4DFK A;  4BRI A;  4BRH A;  1BIU A;  3FLC O;  1NMN A;  4DF4 A;  4N5S A;  1RDU A;  4BRD A;  5AQR A;  4RW7 A;  4JS5 A;  5DMR A;  3SLC A;  4KBO A;  3V1Q A;  5DK5 A;  4FWM A;  1VQ6 N;  1S1V A;  4OJR A;  3H3N O;  4WQ4 C;  3SMP A;  4BC2 A;  2DY4 A;  1J5O A;  1SKR A;  3VGK A;  1I3A A;  4B9Q A;  1QVF M;  3WEE B;  1RNH A;  3ZT1 A;  1WSG A;  4B1Y B;  1JLG A;  2O8F B;  1HQE A;  3WUH A;  2IVP A;  2P9U B;  4Z4E A;  3DMJ A;  4JI6 K;  3CCS N;  3NBP A;  3ZSZ A;  3PSI A;  2W42 A;  3IS9 A;  2BUP A;  3DRR A;  4O0I A;  4DCH A;  4FWO A;  3SV4 A;  4EIA A;  2Z1G A;  2G8I A;  4CJF A;  2ZJR L;  3PX6 A;  1HNZ K;  2E2N A;  1R0A A;  4JHD A;  2D1K A;  3P4I A;  3SUO A;  3MED A;  5CZ1 A;  3THV A;  4RW9 A;  3QB0 A;  4B1Z A;  3VQ7 A;  3CFP A;  5JMV A;  2CGK A;  3ID6 A;  4B1V A;  4FJ7 A;  1NGG A;  1KLN A;  4BE0 A;  3ZCM A;  3PO4 A;  4OKJ A;  4CGF A;  4R5P A;  3VEW A;  3O3G A;  3PO5 A;  3AAR A;  3OYJ A;  3L6Q A;  1NJY A;  3OYL A;  1H1V A;  1NGA A;  3SQ0 A;  1UA0 A;  4NB4 A;  4C23 A;  1UA1 A;  1HX1 A;  3E1Y A;  4BR0 A;  4F2R A;  1YVU A;  2HNY A;  3ZSV A;  3OYN A;  5AQP A;  4W5N A;  3AVN A;  1C1A A;  3SMS A;  2KFZ A;  4BRL A;  5JVG L;  3ZLJ A;  3G6E N;  3RSE A;  3V9X A;  1NK7 A;  2YKM A;  2I5J A;  4LFC K;  2HF4 A;  3AA2 A;  3AO3 A;  4KV8 A;  4ZHR A;  3SCX A;  1N5Y A;  1QTM A;  3M8P A;  2E8A A;  5SWM A;  3Q7B A;  3OY9 A;  4NLC A;  5HRP A;  3UKU A;  5HP1 A;  2PAV A;  2NZT A;  3OYE A;  4FWR A;  2FC0 A;  3RMD A;  2EX3 A;  3KKR A;  2HMP A;  1VSJ A;  1YT3 A;  2Y1J A;  1KVA A;  5FRO A;  4BRO A;  4B9M A;  4KFB A;  4BAC A;  3NE6 A;  1EO1 A;  3WQU A;  1BHL A;  3VER A;  4B9T A;  1QS4 A;  3SUN A;  4FJ8 A;  2YHW A;  4DB3 A;  1C0M A;  2WFB A;  2X78 A;  1NU0 A;  4DQR A;  4JI7 K;  4O55 A;  1Y97 A;  4DR2 K;  1DKG D;  4DHY A;  1XNR K;  3RRH A;  1S3X A;  4AHC A;  1W7A A;  4H0P A;  4OGE A;  2RE2 A;  5BN9 A;  3LZJ A;  4Y0W A;  1HR0 K;  1S6P A;  3BF3 A;  4PA1 A;  1VQ8 N;  3W3D A;  1HPM A;  4FYD A;  4YNQ A;  4OPK A;  4ICL A;  4U7B A;  2E5L K;  3AVK A;  1T3V A;  3V81 A;  3E9L A;  3K59 A;  2YHX A;  5CYQ A;  4DR5 K;  2VWJ A;  3M8R A;  4FW1 A;  3THW A;  1JJ2 M;  4M45 A;  4KI4 A;  4WFB L;  1S5J A;  3AVA A;  4DQP A;  4BRA A;  3VN5 A;  5K14 A;  4FJK A;  2ASP A;  1QSL A;  4M3X A;  2ZQB A;  3SQ1 A;  3NF7 A;  3M1F A;  4LSL A;  3C0B A;  4H4M A;  2G8H A;  1U2V B;  4LF7 K;  4IG3 A;  5HOO A;  3HRG A;  1IBL K;  1SZ2 A;  3M8S A;  3L2R A;  4DV5 K;  3UE5 A;  4N76 A;  4JK7 A;  1LW0 A;  2X6N A;  1D5A A;  3TTD A;  1RDB A;  4FWN A;  1QE1 A;  3AVH A;  4C8L A;  3FZF A;  4DLG A;  3DLE A;  1N6Q A;  1QSY A;  3CQX A;  1EET A;  3RR8 A;  3SNN A;  2A40 A;  4FZZ A;  1T7P A;  4UY8 O;  2JGU A;  3I8B A;  2ITG A;  4KKO A;  4XH5 A;  1NGH A;  3H1Q A;  4RCH A;  2QA4 N;  3VQ6 A;  3SAH A;  4H5V A;  3OYF A;  2P9S B;  2ZGY A;  1U48 A;  1RT1 A;  5AFU A;  2P5O A;  2ZD1 A;  4LH5 A;  5HLF A;  2Q1N A;  4EZ9 A;  3GBT A;  5C2D A;  2XY5 A;  4DTM A;  3ULE A;  2F8T A;  2YCH A;  3TAP A;  3TAM A;  1GLC G;  2E2Q A;  4H5R A;  1ZYQ A;  3NVK A;  5DM6 L;  3C94 A;  4IEI A;  4FJ5 A;  2QWQ A;  3P39 A;  1XWL A;  4CFB A;  2QKK A;  3ITH A;  2D0B A;  4CJK A;  2HBJ A;  3S3O A;  4M3W A;  2EWS A;  3ZT4 A;  3ID8 A;  5CZ2 A;  3OVN A;  5AFU H;  3DJC A;  4CHQ A;  1ATN A;  5GIP A;  2PYJ A;  2VQE K;  4X64 K;  4FJX A;  4DTS A;  3ULD A;  2QWL A;  4ELU A;  3DXK B;  4DTJ A;  1Q18 A;  5C10 A;  3V9U A;  4BWM A;  2UXD K;  4FXD A;  3HYF A;  2OZS A;  1VSE A;  4BRG A;  1U6Z A;  5ADX A;  3SPY A;  1C6V A;  4W5T A;  5AQU A;  3CCM N;  4DSF A;  2IOC A;  1SL0 A;  2OPR A;  5F0X A;  3OS0 A;  1YAG A;  1Q8I A;  5FPD A;  4DV6 K;  3QNN A;  5CHI A;  4M3T A;  3O4Q A;  1IKV A;  4CCH A;  4FWL A;  4BE1 A;  3H46 O;  3ZT2 A;  4AM7 A;  5JS2 A;  4CGI A;  4W5Q A;  4BGA A;  3BF1 A;  3MCA B;  1SKS A;  1A5V A;  1X1P A;  4AH9 A;  4CJP A;  3MXM A;  1VK0 A;  3S41 A;  5BRE A;  1IBM K;  3SAG A;  3GE1 A;  1XHX A;  3THY A;  1G15 A;  1D9D A;  1HLU A;  4BGB A;  2IVN A;  5ADX H;  3QFU A;  3QEW A;  2W41 A;  4FK2 A;  4NYF A;  4NYN A;  3ZT3 A;  3OJS A;  5AQT A;  5GAD P;  4FZY A;  1N33 K;  4IZ9 A;  2QI2 A;  3A5N C;  3DWL A;  3LAM A;  1IG8 A;  5H1S Q;  3D2F A;  1TL1 A;  4BE2 A;  4E7I A;  3CCE N;  1QSS A;  3MEG A;  3CCU N;  1CXQ A;  2OTL N;  4E3S A;  4DV2 K;  3O9R A;  2OA8 A;  1KAZ A;  1NG9 A;  4IOA L;  4CEF A;  1FJG K;  2UU9 K;  1NGE A;  3ZSX A;  1RBT A;  1IKY A;  1D8Y A;  3BY5 A;  1UWB A;  2YHB A;  5EU7 A;  4Z4I A;  4KHU A;  3CQ8 A;  5KRT A;  2I7P A;  1GLJ O;  1TKD A;  3CJ7 A;  4BG8 A;  1HNW K;  5AZI B;  4BR2 A;  3TAF A;  5TKW A;  3VQA A;  3GDQ A;  5AQM A;  2CH5 A;  2F8S A;  3RMA A;  2KZZ A;  3VGM A;  4H0Y B;  4KHS A;  2Q97 A;  1VQ4 N;  3HOT A;  3DI6 A;  1WBB A;  4CW7 B;  3KLG A;  4KO0 A;  1JL1 A;  3DRP A;  3QNO A;  4B1U B;  3DLL L;  4M7Y A;  3BDP A;  3NCI A;  4B1X B;  4CFD A;  2ZM6 K;  3H3O B;  1EWQ A;  1CZ9 A;  3DXM A;  2NRX A;  4DU1 A;  4YOR A;  4BC3 A;  4KRE A;  3CHW A;  3P5J A;  4CES A;  5AQF A;  4DTP A;  4IDH A;  5HBM A;  4ISF A;  4WCE L;  1JCG A;  3CC7 N;  2GWK A;  3C6U A;  3SI6 A;  1HNI A;  2BE2 A;  2NRZ A;  4KHQ A;  1EKE A;  4CJE A;  4ILJ A;  3LP1 A;  4A57 A;  2VWB A;  2QM1 A;  2O4I A;  1RDC A;  2YJE A;  3RMB A;  1U49 A;  4BDP A;  4H0V B;  4LF5 K;  3KLH A;  3TAB A;  2XY6 A;  3LAN A;  1GLD G;  4IG0 A;  3LM2 A;  1HPZ A;  1RT6 A;  1VQO N;  3H6E A;  3SUQ A;  2Z1H A;  4EHT A;  1TKX A;  4OGC A;  4DQQ A;  1WN7 A;  3J7Y P;  4PY5 A;  3OYM A;  5JVH L;  4NCB A;  4M63 C;  4B3S K;  1MWM A;  4E7J A;  3HPO A;  5GAH P;  5AQG A;  3AA5 X;  4CF1 A;  1ATS A;  3MAQ A;  5KGW A;  4K0K K;  4HUG A;  4IXC A;  2D0O A;  1LV5 A;  1NOZ A;  1VQP N;  3G0Z A;  4XEI A;  4CHP A;  1WB9 A;  4O0J A;  2OPQ A;  2KKZ A;  5BR8 K;  1RT2 A;  4J2A A;  3K2P A;  1VQM N;  4ISE A;  4IO9 L;  3T69 A;  5CE3 A;  4DUZ K;  3O9U A;  1SAZ A;  3H45 C;  4I6M B;  3VOV A;  1R59 O;  3ZX0 A;  3CET A;  4CJL A;  5KPZ A;  4XH1 A;  3UKR B;  4A62 A;  3NGZ A;  5J2Q A;  5AQV A;  3EEQ A;  1RT7 A;  2HVI A;  3K5M A;  2A5X A;  4DFP A;  3HM9 A;  2O8B A;  1S1U A;  1TL3 A;  3CCV N;  2P9L A;  3CC4 N;  3V1R A;  1XQS C;  3T1Y K;  1VQK N;  1WOQ A;  4BRK A;  3AO1 A;  4CJR A;  4E7L A;  3IAY A;  3NF8 A;  1T44 A;  3K9J A;  4K25 A;  2VGN A;  1K8A O;  2ZF5 O;  4BG9 A;  3C7N B;  3SQ4 A;  1X9S A;  1UOC A;  3LL3 A;  5T7B A;  2G8W A;  4EAH D;  3VF4 A;  4MDA A;  1L5U A;  1JLC A;  3VEZ A;  3VMF B;  1N8R O;  4OPH A;  3U9D A;  1Q9X A;  2ZJQ L;  2NNW A;  5AQS A;  1N32 K;  3ZSO A;  4CJ7 A;  3L2Q A;  5I3U A;  1KCF A;  1ZBF A;  3WNE A;  1BG3 A;  2Q31 A;  1XC3 A;  2UYT A;  4I2Q A;  4BVP A;  1B92 A;  3AO5 A;  3FZH A;  5FPM A;  1QQO A;  1NBW A;  3CFO A;  2HHV A;  1NGB A;  1XUP O;  4DTO A;  2ETJ A;  2YNF A;  1KTQ A;  3LZI A;  2OYQ A;  4W5O A;  5IT9 O;  3GG4 A;  4FWP A;  4CBU A;  2NRR A;  3R9P A;  2UUB K;  3LP3 A;  3SQ2 A;  5HRN A;  2VG5 A;  4DF8 A;  4GKK K;  5CYM A;  4YOT A;  4KB1 A;  2FBX A;  4CEE A;  4IOC L;  2GUI A;  3K0S A;  5AQX A;  3G10 A;  4BRF A;  4OX9 K;  3F5T A;  4JKD A;  2HHT A;  2VGM A;  1VQL N;  1SKW A;  4L8R B;  4AHR A;  2KQ2 A;  4F4K A;  4ZTJ A;  1HUX A;  4JLH A;  1X9J A;  1FKP A;  3DRS A;  2OPP A;  3CFR A;  3FZM A;  4B3M K;  4JKC A;  3EY1 A;  2O8E B;  3I0R A;  2FF3 B;  3DLK A;  3QIN A;  1T05 A;  4FZX C;  4CD3 A;  3V9S A;  2B4J A;  3K9K A;  1Q9Y A;  4BDZ A;  4AHU A;  4F3T A;  3DOK A;  3S3N A;  1CLQ A;  2P9P A;  2WC9 A;  3U9Z A;  3SPZ A;  1YHQ N;  1QZ5 A;  2ITM A;  4FLV A;  2HOE A;  2V7Y A;  3OYG A;  4CVN E;  5D3G A;  2A3Z A;  3IDH A;  4EZ6 A;  3KD5 E;  3J7A P;  5E84 A;  2P9K A;  5ELZ A;  4JKF A;  2OZM A;  3JSM A;  3M5R A;  4FVU A;  2E88 A;  4PKH A;  4CJV A;  3TTC A;  3U4L A;  4IEE A;  2F96 A;  3DOL A;  4WF9 L;  1KQS M;  2QWO A;  1EXQ A;  3AA3 A;  4BDY A;  4KH4 A;  1S9E A;  3LAL A;  4YOW A;  4LC9 B;  4CEO A;  4JK8 A;  5GIO A;  3P83 D;  3M8Q A;  1RGI A;  2HNZ A;  4DR7 K;  1I39 A;  4IO8 A;  4JEP A;  1JXE A;  1HQU A;  4NXN K;  3ENB A;  3F9K A;  3AV9 A;  4YOY A;  5LY3 A;  3KWI A;  3S3M A;  5J1E A;  5FPN A;  5I9E B;  2Q3S A;  4DQS A;  4ID1 A;  1HJO A;  3CYM A;  1YVN A;  3O8M A;  3ZSR A;  4HUE A;  4HCC A;  5AQL A;  2Q0U A;  3KK3 A;  2ZWH A;  3KWG A;  1JLF A;  3F2K A;  2KHO A;  1JLQ A;  3L2U A;  3VF6 A;  2WTU A;  2O8C A;  1ZBL A;  2CGJ A;  1MA9 B;  2ZJP L;  3ENO A;  3FR0 A;  3NAE A;  3NH2 A;  5KI6 A;  3G4S N;  3D2E B;  3O6W A;  4CBW A;  1P8Z A;  4C1N K;  4Q5V A;  4IJN A;  4AHV A;  4CJQ A;  1BOT O;  1TYQ B;  4FJH A;  1Z26 A;  3ZET A;  3HBT A;  4CZH A;  3VEV A;  3AGK A;  4FW2 A;  4O4G A;  5AJ3 K;  3AVL A;  1N36 K;  2Q2R A;  3I33 A;  4M7X A;  4FCY A;  1HNX K;  3U3G A;  2D0P A;  3B6P A;  3BZK A;  4DTR A;  4CF2 A;  3WNH A;  4TSX A;  4CGD A;  1N34 K;  4KHP K;  3OYH A;  4K8Z A;  3VQP A;  3MMV A;  3F73 A;  4M3Z A;  1LAW A;  3LDS A;  4JRQ A;  5EVZ A;  4A59 A;  3E66 A;  1CZA N;  1J5E K;  3EZW A;  3S9H A;  1JXB A;  3ZSW A;  4JKA A;  4JD2 A;  4WFA L;  3FZL A;  4CHY A;  3V9W A;  1WLJ A;  2A42 A;  2CGL A;  4CJ5 A;  3CER A;  4Z94 A;  3HZ6 A;  3A0I X;  1QVG M;  5KGX A;  4R79 A;  3CC2 N;  3UIQ A;  3VF2 A;  4CE9 A;  3OYK A;  3OHR A;  4LY7 A;  4CHZ A;  5LMU K;  1OH8 A;  4CZL A;  4CIG A;  4FK0 A;  4KTW A;  5CY4 A;  2A1S A;  3QET A;  1FK9 A;  3VEY A;  2FBY A;  3ZEU A;  5B8H A;  5C0Y A;  1WUA A;  3BUZ B;  5FLX O;  5BRH A;  4DSE A;  3ATU A;  1SUQ A;  2G8K A;  2XY8 A;  4QAG A;  4Z0U A;  3SAF A;  1X3M A;  1GLL O;  3PUF A;  2PBD A;  2HHW A;  4GNI A;  5JLH A;  1LOT B;  1ITG A;  1BI4 B;  3MCP A;  1TKZ A;  3CPW M;  1B9D A;  1WSE A;  1BUP A;  4JV5 K;  1IH7 A;  2PY5 A;  4QOZ B;  2HBM A;  1QZ6 A;  1YJW N;  3MN5 A;  5J2P A;  1BWF O;  1LW2 A;  4B8A B;  4WQ5 C;  4YFU A;  4MDB A;  4IWV A;  3QEX A;  4ZTF A;  5AQO A;  3WXL A;  2GWJ A;  3QBW A;  4OO1 J;  1KXP A;  5CR4 A;  3K58 A;  3CM6 A;  3PV8 A;  5FRN A;  5M1K A;  1RIL A;  4CK2 A;  1A5X A;  5LJV A;  3I8D A;  1O1W A;  3SUP A;  4CF9 A;  4K8X A;  4LF8 K;  4DV3 K;  3TSP A;  2YKN A;  3VEN A;  1M1K O;  3LP2 A;  1BQM A;  1RTJ A;  4E19 A;  1XHZ A;  5MLC Q;  4HTL A;  1TUY A;  1WSF A;  2E6M A;  1V4S A;  2O8F A;  2P9U A;  1C0G A;  1RDA A;  4MO4 A;  4QS7 A;  1YJ9 N;  4JKG B;  3CJ9 A;  4IDK A;  3OJU A;  5M1O A;  3IUC A;  4JAX A;  2ATQ A;  4LD0 A;  4FM2 A;  3A5L C;  4GV6 A;  5KQD A;  3IG1 A;  1F21 A;  3CCR N;  3AVC A;  2AJQ A;  1NGD A;  3VQD A;  1NJW A;  4YDU A;  4BC5 A;  4U67 L;  1OH5 A;  4CHO A;  2AA4 A;  2FF6 A;  2GEL A;  3L3V A;  2P9N A;  4CEZ A;  3R8E A;  3E9O A;  4F3O A;  4DKW A;  5C15 A;  2JWL A;  1S6Q A;  1UAX A;  1BO5 O;  4B3R K;  1RTH A;  3EN9 A;  4PHT X;  4FLX A;  2QW9 A;  3R6M A;  3ENH A;  4HVJ A;  3SV3 A;  2O8B B;  1K8K A;  4FLT A;  3AY9 A;  5KPR A;  1IKX A;  1NLV A;  4IFE A;  4PUO A;  3CIP A;  1P90 A;  1KD1 O;  3J7Z O;  4GMJ B;  2BDP A;  5E26 A;  2P9I B;  1TGO A;  3ALY A;  5AQZ A;  1BA1 A;  2YNI A;  3NH0 A;  3L4Q A;  1VRU A;  1DEJ A;  1ASW A;  3K5O A;  3MEC A;  1L3U A;  3DLR A;  4EFH A;  3MWT A;  1LWE A;  3M3Z A;  3QBX A;  4CZJ A;  4O5B A;  4LF4 K;  2UUC K;  1ASV A;  4OKK A;  3U3Y A;  2G8F A;  4CF8 A;  1TUU A;  4YOX A;  1NGC A;  4YOU A;  4B08 A;  2KZM A;  3IKM A;  4AM6 A;  4CZG A;  2HHU A;  3KD1 E;  4W5R A;  4FPA A;  1TV6 A;  4CJ4 A;  4BR4 A;  3LAK A;  3HJF A;  4FLY A;  3OTO K;  2XRI A;  3KHY A;  2FSJ A;  3C65 A;  3THX B;  1D4X A;  1X9M A;  2ZE2 A;  3CI5 A;  1L3V A;  2CH6 A;  1U4B A;  2X74 A;  3O9T A;  3SYZ A;  1NJZ A;  4BQZ A;  4H8K A;  3RMC A;  1FKO A;  2Z1J A;  1NM1 A;  2VG6 A;  4DSL A;  5JS1 A;  1GLA G;  1J54 A;  3TTF A;  3U8X A;  3QEI A;  1BCM A;  1OKJ A;  1J9A A;  1ESV A;  3P38 A;  3AAP A;  3QDK A;  4HUF A;  3VEO A;  5AQW A;  3MK6 A;  3T7Z A;  2V52 B;  3MX5 A;  4NCG A;  3VES A;  4KTZ A;  1GOB A;  4BRM A;  4CK1 A;  4CD1 A;  3HI0 A;  3VA0 A;  2D0A A;  5BRD A;  3LDO A;  4RTF D;  4KPY A;  1C0T A;  1RTI A;  4M3U A;  2KLA A;  2KTQ A;  5HRR A;  5TKY A;  4J2D A;  3TI0 A;  1NNE A;  3LDN A;  2HHH K;  4PKG A;  1NJX A;  1HYS A;  4XH4 A;  5C24 A;  4H0O A;  3WXJ A;  1O13 A;  5M1P A;  4JYA K;  3O80 A;  1MDU B;  1IO2 A;  1A5W A;  1YTA A;  2IAJ A;  3EO3 A;  4HCB A;  2G8U A;  1TAU A;  2NLX A;  3AAQ A;  4WE1 A;  5GAE P;  1OVY A;  1QQN A;  3FFI A;  3GL1 A;  3TWH A;  2P9K B;  3CCL N;  1ZC6 A;  4I9L A;  3MEE A;  1HNV A;  1VSM A;  4WYB A;  4JHD B;  3HM8 A;  4DR3 K;  2OTJ N;  4MLE A;  1Q7Y O;  3CCJ N;  4B9V A;  1Q82 O;  4BQL A;  3DLH A;  1BDG A;  2GBZ A;  2HHX A;  4N47 A;  3VQC A;  1GLB G;  3KJV A;  3HVR A;  2UXB K;  2FSN A;  1NK8 A;  4FWS A;  3DLB A;  3VGL A;  4CEB A;  1VQN N;  3HVT A;  3O5B A;  3N4Q A;  4H4O A;  2X6S A;  4PKI A;  4B1W B;  3L3U A;  3SBT A;  4OPJ A;  2QWN A;  3KVG A;  3UB5 A;  2P9S A;  3T1A A;  2XO7 A;  4DR1 K;  3ISN C;  3VQE A;  4DLE A;  5J2M A;  4JKH A;  4B8C A;  3HO1 A;  3CG7 A;  2H3G X;  3HPH A;  4DQ8 A;  1TVR A;  4OKE A;  2A41 A;  2WUS A;  3J80 O;  1S72 N;  4E1J A;  1GLE G;  4BR9 A;  1WSJ A;  3QEP A;  3AA4 A;  4FJI A;  2QXL A;  3OW2 M;  3O3H A;  1L3S A;  2GUP A;  3PX4 A;  2QKB A;  3RSE B;  3H1V X;  4ELV A;  4KI6 A;  2RHK A;  4E89 A;  3ZET B;  4C1N I;  4X66 K;  1GOC A;  5M1N A;  3LDP A;  4FJJ A;  3KLI A;  4DU3 A;  3ZSY A;  5J2N A;  3FE1 A;  1DGK N;  4BRE A;  3EZ5 A;  4ILH A;  5BPM A;  3UKU B;  3RVC A;  3V4I A;  3DXK A;  3V6D A;  4BY9 C;  3O9S A;  1RBU A;  4FLU A;  3L0Q A;  4DQI A;  4QCL A;  3M6G A;  3OBW A;  2YJF A;  1HKC A;  2F9T A;  1KAX A;  1ILY A;  4K41 A;  5EOY A;  4JI3 K;  4BR7 A;  2W6K A;  1VSF A;  3WXK A;  3E01 A;  1KAY A;  3VQ8 A;  2NRH A;  3MN9 A;  4AF1 A;  4UQG A;  1JLB A;  1RFQ A;  4BVO A;  1U47 A;  1I94 K;  2QEX N;  4DTX A;  3TAE A;  1LAV A;  4F9O A;  4Y1D A;  4FJG A;  1LCU A;  1J6Z A;  2QK9 A;  5KPT A;  3ZT0 A;  3HPG A;  2NUB A;  1NMD A;  1X3N A;  2E4L A;  3MDQ A;  3RWU A;  1YTU A;  2V7Z A;  2HF3 A;  4O44 A;  2IIR A;  1GLF O;  4F2S A;  4BRQ A;  3MX2 A;  5BN8 A;  4RWT A;  4CIF A;  3FGU A;  4FM0 A;  3KZB A;  1S1W A;  4KAZ A;  4CHN A;  3BGR A;  3L4I A;  3L8B A;  1NJI O;  3THW B;  4OLA A;  1NKB A;  3LPT A;  2P51 A;  5AR0 A;  4KH5 A;  2OPS A;  3VTH A;  4J2B A;  4CI6 A;  2W6L A;  3TAR A;  2YHA A;  2P1J A;  3HTV A;  5C25 A;  1XMO K;  2UUA K;  3QEV A;  2DPN A;  2GV9 A;  2VYP A;  2DFF A;  3IMX A;  2HST A;  3NGY A;  5AZI A;  2W40 A;  4XIU A;  1JLE A;  1QHT A;  3NF9 A;  5JIC A;  4RG8 A;  4EP4 A;  2BH1 A;  2HBL A;  2VWK A;  3JXU A;  2F7T A;  4M41 A;  3DAW A;  2G8V A;  4X62 K;  2E1Z A;  3MXI A;  2E20 A;  3TU5 A;  1C0U A;  5C2F A;  4C8K A;  1V4T A;  3WXI A;  3EKU A;  2R7Y A;  3QLH A;  5GAG P;  5AQN A;  3LWL A;  1JL2 A;  1M90 O;  2OCE A;  4PWD A;  3ATV A;  3KKS A;  5FDL A;  3R1X A;  5AZJ A;  1NK5 A;  4JI4 K;  1SL1 A;  3NDK A;  4DV0 K;  1IG9 A;  4BC4 A;  4N41 A;  1Z25 A;  1HKG A;  2GX9 A;  2GEM A;  5I42 A;  3ULE B;  1T6C A;  4K43 A;  3EKS A;  3PX0 A;  4A61 A;  2VG7 A;  3G25 A;  1VSD A;  1JCE A;  4C8O A;  3OYI A;  2QTD A;  4DS4 A;  2P9N B;  1Q86 O;  4H0X B;  2YNG A;  4WQ4 A;  3HOS A;  3L2W A;  4DS5 A;  2RKI A;  4CZM A;  1E4G T;  4HWI A;  3A2F A;  3OBY A;  3WNG A;  2PYL A;  4B9U A;  2BGG A;  2E1Y A;  3CJC A;  3NGI A;  2E6L A;  3AVF A;  4B9L A;  1DLO A;  5FRM A;  3LWM A;  2Y1I A;  3RRG A;  4LF6 K;  1NK4 A;  3O08 A;  2UXC K;  1SV5 A;  3EE8 A;  3IRX A;  2LSN A;  1K8K B;  4CZF A;  3LM9 A;  4YY3 K;  1BA0 A;  3CXC M;  1ZBH A;  3TSU A;  2RN2 A;  3K5N A;  4I6M A;  1NOY A;  3UKR A;  4KHY A;  1XNQ K;  1OH7 A;  2NRV A;  5AQK A;  3KLE A;  4DUY K;  4Z4G A;  3PIP L;  1NK9 A;  5EXW A;  3BP8 A;  3ASM A;  3T19 A;  4X65 K;  4DV7 K;  1C1C A;  3H08 A;  1OVQ A;  1NWK A;  4CFC A;  4JNE A;  3OYC A;  4DU4 A;  5LL6 Z;  3OYA A;  2BTF A;  3PY8 A;  3CME N;  4FJL A;  3O1W A;  1T03 A;  4Y1C A;  3W0L A;  1KLM A;  1RBR A;  1KFD A;  3HSC A;  1BU6 O;  1MWK A;  4DMN A;  1IBK K;  1YJN N;  2HW3 A;  1HKB A;  1ZBU A;  3THY B;  5EX5 A;  4ILG B;  4IFV A;  2HHS A;  3C95 A;  3DYA A;  3OS1 A;  4N56 A;  3C7N A;  5F2R A;  5HL7 L;  1FW6 A;  4MLH A;  2F9W A;  4JI8 K;  3D0P A;  1QQC A;  2EHG A;  4Z4H A;  1EQY A;  3D2F B;  3WNF A;  4J2E A;  4AHS A;  1ZBS A;  1S1X A;  1Q81 O;  1E4F T;  4FOI A;  3WXM B;  3QFP A;  1KVB A;  2ASO A;  2YI1 A;  3T1H K;  3CJA A;  3J81 O;  2DFE A;  1JKH A;  5E41 A;  3AGR A;  3VQ5 A;  3VTI A;  3RTV A;  1WNS A;  4RW8 A;  4DFJ A;  5AQQ A;  5HRS A;  1LWF A;  5EY4 A;  4FLW A;  3AVM A;  1X9W A;  4DSK A;  1RDD A;  1ATR A;  1G99 A;  4O5F A;  3TAG A;  4OPA A;  2DFH A;  2O8D A;  1YF5 L;  3C6H A;  3LDQ A;  4ID5 A;  4FL9 A;  3ZSQ A;  5BRF A;  3ZX2 A;  2IS3 A;  3FZK A;  5SZT A;  3F9M A;  3L2V A;  3NHG A;  1RBS A;  2B5J A;  3DXM B;  5DM7 L;  4MO5 A;  2FSK A;  3QML A;  1NGF A;  1VSL A;  4I7F A;  4B3O A;  5AQY A;  4CZK A;  4BR5 A;  2I7N A;  1GOA A;  5KQ8 A;  4I2P A;  1WBD A;  2WOM A;  4YDU C;  2XY7 A;  4AHT A;  2DTU A;  2O8E A;  1WSI A;  4A2B A;  4B3T K;  4AQY K;  1BCO A;  4V19 S;  3CPE A;  4H5W A;  3VEX A;  4NLB A;  5AQI A;  4QS9 A;  4A2A A;  3QIO A;  1XMQ K;  4KB0 A;  3WEE A;  5IWA K;  1RT3 A;  2RPI A;  3TR8 A;  4KH6 A;  3V9Z A;  4WFN L;  4HHT A;  2OAN A;  3B6O A;  1YIT N;  4GV3 A;  1YI2 N;  4CEQ A;  1NGI A;  4K42 A;  1J53 A; 
#chains in the Genus database with same CATH homology
 1ZBF A;  3WNE A;  3OYN A;  4W5N A;  3AVN A;  4J2D A;  1C1A A;  2KFZ A;  3TI0 A;  3T3F A;  1TK8 A;  4I2Q A;  3V9X A;  1HYZ A;  1B92 A;  1TK0 A;  4M3R A;  1NK7 A;  1KFS A;  3AO5 A;  2YKM A;  1NJX A;  1HYS A;  2I5J A;  5C24 A;  3CFO A;  3AA2 A;  4KV8 A;  3AO3 A;  4CGG A;  4E7K A;  4ZHR A;  4DTO A;  1IO2 A;  3SCX A;  2HHV A;  1A5W A;  1YTA A;  2ETJ A;  2YNF A;  1HJR A;  1KTQ A;  4C8N A;  3LZI A;  4W5O A;  1XC9 A;  3M8P A;  2IAJ A;  1N5Y A;  1QTM A;  4FK4 A;  4HCB A;  4Z4F A;  3K5L A;  5SWM A;  2G8U A;  1EP4 A;  1TAU A;  3EYZ A;  4WE1 A;  3OY9 A;  5HRP A;  5KRS A;  3LP3 A;  3SQ2 A;  5HP1 A;  3FFI A;  5HRN A;  3TWH A;  2VG5 A;  3OYE A;  4DF8 A;  5CYM A;  2FC0 A;  3RMD A;  4KB1 A;  2FBX A;  2EX3 A;  4CEE A;  2GUI A;  4I9L A;  3MEE A;  1HNV A;  2HB5 A;  3KKR A;  1VSJ A;  1YT3 A;  1VSM A;  3G10 A;  2Y1J A;  1KVA A;  5FRO A;  1WSH A;  4KFB A;  4CIE A;  2IGI A;  4B9M A;  2HHT A;  3QIP A;  4B9V A;  4BAC A;  3DLH A;  3U6F A;  1SKW A;  3NE6 A;  4AHR A;  4L8R B;  2KQ2 A;  2GBZ A;  2HHX A;  4F4K A;  4N47 A;  3VQC A;  4B9T A;  1BHL A;  3KJV A;  3HVR A;  2P5G A;  4ZTJ A;  1QS4 A;  4JLH A;  1FKP A;  3DRS A;  3SUN A;  2OPP A;  3CFR A;  1NK8 A;  4LH4 A;  3DLB A;  3EY1 A;  4FJ8 A;  4CEB A;  3I0R A;  4FZX C;  1C0M A;  3DLK A;  3NFA A;  1VSI A;  3HVT A;  2X78 A;  3QIN A;  3KK2 A;  4DQR A;  1T05 A;  3V9S A;  4H4O A;  4O55 A;  4KTQ A;  2X6S A;  4CK2 A;  3D45 A;  3HK2 A;  3AVB A;  1Y97 A;  3L3U A;  4OPJ A;  2B4J A;  1S9G A;  3T1A A;  2XO7 A;  3RRH A;  3KK1 A;  3ISN C;  3VQE A;  4AHC A;  4DLE A;  1Q9Y A;  4BDZ A;  3MXJ A;  4AHU A;  5J2M A;  4B9N A;  4CGJ A;  3DOK A;  3S3N A;  4F3T A;  3CM5 A;  1CLQ A;  4B8C A;  3HO1 A;  4OGE A;  3CG7 A;  3HPH A;  3LZJ A;  1HMV A;  1HRH A;  3SPZ A;  1S6P A;  1TVR A;  4OKE A;  4PA1 A;  1RTD A;  4FLV A;  2RF2 A;  3LP0 A;  3AVG A;  4FYD A;  4YNQ A;  1WSJ A;  3OYG A;  3AA4 A;  3QEP A;  4OPK A;  4ICL A;  4FJI A;  5D3G A;  2HHQ A;  4EZ6 A;  3AVK A;  3O3H A;  3KD5 E;  1L3S A;  3V81 A;  3K59 A;  3PX4 A;  2QKB A;  5CYQ A;  2XHB A;  3TAN A;  2OZM A;  3JSM A;  1KVC A;  2VWJ A;  3M8R A;  4KRF A;  3NH1 A;  4CJS A;  4FW1 A;  3AO4 A;  2HVH A;  1L3T A;  4CJW A;  4JS4 A;  4ELV A;  4KI6 A;  4M45 A;  4CJV A;  4E89 A;  4KI4 A;  1TK5 A;  1GOC A;  1S5J A;  3AVA A;  2F96 A;  3DOL A;  4DQP A;  1EXQ A;  4FJJ A;  3KLI A;  3AA3 A;  4BDY A;  1S9E A;  3HL8 A;  4DU3 A;  1D9F A;  3LAL A;  3VN5 A;  5K14 A;  1U45 A;  4FJK A;  3ZSY A;  4CEO A;  3TAQ A;  5J2N A;  1XI1 A;  3P83 D;  3QES A;  3M8Q A;  1QSL A;  3EZ5 A;  4M3X A;  2ZQB A;  2HNZ A;  1I39 A;  1ASU A;  3SQ1 A;  1JXE A;  1HQU A;  3NF7 A;  4HTU A;  4LSL A;  4H4M A;  2G8H A;  3V4I A;  3F9K A;  4IG3 A;  3AV9 A;  3V6D A;  3S3M A;  1DTQ A;  3HP9 A;  3M8S A;  4Z4C A;  3L2R A;  5J1E A;  1RBU A;  4FLU A;  2Q3S A;  4DQS A;  1LW0 A;  2X6N A;  1D5A A;  4ID1 A;  3CYM A;  4RW4 A;  2A1R A;  1RDB A;  3ZSR A;  3HXM A;  4DQI A;  4QCL A;  1QE1 A;  2FBT A;  3AVH A;  4C8L A;  1W0H A;  4DLG A;  3DLE A;  1N6Q A;  4HUE A;  3C6T A;  3VQQ A;  3O3F A;  1NKC A;  1QSY A;  4HCC A;  1EET A;  3KK3 A;  3RR8 A;  3SNN A;  1VSF A;  1JLF A;  3E01 A;  4FZZ A;  1T7P A;  2JGU A;  3VQ8 A;  1JLQ A;  2ITG A;  3L2U A;  4KKO A;  1VSH A;  1ZBL A;  4EP5 A;  4UQG A;  1JLB A;  3VQ6 A;  3NAE A;  3NH2 A;  2QXF A;  5KI6 A;  4OVL A;  1U47 A;  4CF0 A;  3OYD A;  4DTX A;  3OYF A;  4Q5V A;  1U04 A;  3TAE A;  1LAV A;  4AHV A;  1W9H A;  4Y1D A;  1ZBI A;  1U48 A;  4FJG A;  4CJQ A;  2QK9 A;  4FJH A;  1Z26 A;  1RT1 A;  1T8E A;  2P5O A;  3ZT0 A;  3HPG A;  2NUB A;  4F8R A;  4FW2 A;  4O4G A;  1BI4 A;  2E4L A;  1REV A;  2ZD1 A;  4LH5 A;  3RWU A;  4IBN A;  4MQ3 A;  5HLF A;  4CEA A;  1YTU A;  1KSP A;  3AVL A;  4EZ9 A;  2XY5 A;  4DTM A;  4O44 A;  2F8T A;  4IKF A;  4F2S A;  4M3Y A;  3HT3 A;  4FCY A;  4DSI A;  3U3G A;  1CZB A;  3TAP A;  3TAM A;  3B6P A;  4C8M A;  4DTN A;  1ZYQ A;  4DTR A;  4CF2 A;  4Q0B A;  4CIF A;  2OYQ A;  3C94 A;  3WNH A;  1S1W A;  4FM0 A;  4TSX A;  4CGD A;  4CHN A;  4ELT A;  4KAZ A;  4FJ5 A;  3BGR A;  1XWL A;  1NK0 A;  3L8B A;  3OYH A;  4K8Z A;  1K6Y A;  4LSN A;  3VQP A;  4CFB A;  3F73 A;  2QKK A;  4M3Z A;  1LAW A;  2D0B A;  3ITH A;  4CJK A;  3LDS A;  4JRQ A;  3S3O A;  4M3W A;  4OLA A;  1NKB A;  3ZT4 A;  4E7H A;  5CZ2 A;  3LPT A;  2O4G A;  2P51 A;  3OVN A;  2OPS A;  4J2B A;  1DTT A;  3KTQ A;  3S9H A;  1JXB A;  3ZSW A;  3V1O A;  1NK6 A;  3TAR A;  2YHA A;  4CHQ A;  4CHY A;  2PYJ A;  4E1N A;  3V9W A;  1WLJ A;  2P1J A;  2WON A;  1MU2 A;  4CJ5 A;  5C25 A;  3OS2 A;  4FJX A;  3QEV A;  4PQU A;  2GV9 A;  2Z1I A;  4DTS A;  1RT4 A;  3ULD A;  2PZS A;  4ELU A;  4DTJ A;  5KGX A;  4FJ9 A;  3V9U A;  2DFF A;  4XIU A;  3NGY A;  4BWM A;  1BGX T;  4FXD A;  1JLE A;  1QHT A;  3HYF A;  2OZS A;  3UIQ A;  3NF9 A;  1VSE A;  4RG8 A;  4CE9 A;  3OYK A;  1BL3 A;  2D0C A;  3SPY A;  1C6V A;  3P1G A;  4LY7 A;  4CHZ A;  4W5T A;  3HP6 A;  4EP4 A;  4I9Q A;  3KIO A;  4DSF A;  2VWK A;  4CIG A;  2HND A;  4FK0 A;  4RW6 A;  2IOC A;  4M41 A;  4KTW A;  5CY4 A;  1SL0 A;  2G8V A;  2OPR A;  2A1S A;  1VRT A;  3OS0 A;  3QET A;  3MXI A;  4CJ3 A;  1Q8I A;  1NKE A;  4CER A;  1FK9 A;  3QNN A;  4M3T A;  2FBY A;  3O4Q A;  1IKV A;  1BQN A;  4CCH A;  1C0U A;  2D5R A;  4C8K A;  2R7Y A;  4BE1 A;  3QLH A;  4DSE A;  4JRP A;  3LWL A;  1LWC A;  1FXX A;  1SUQ A;  1JL2 A;  3ZT2 A;  2G8K A;  4FJN A;  5JS2 A;  4CGI A;  4W5Q A;  2XY8 A;  4QAG A;  4Z0U A;  4PWD A;  3KKS A;  5FDL A;  1IKW A;  1SKS A;  1A5V A;  4OLB A;  1NK5 A;  1X1P A;  3PUF A;  4AH9 A;  4CJP A;  1VK0 A;  3MXM A;  2HHW A;  1SL1 A;  1WAF A;  3NDK A;  4CGH A;  1IG9 A;  4N41 A;  1XHX A;  1Z25 A;  1ITG A;  1G15 A;  1BI4 B;  1D9D A;  1TKZ A;  1B9D A;  1WSE A;  2IDO A;  4FLZ A;  4GVM A;  1IH7 A;  2PY5 A;  3QEW A;  3VQB A;  4FK2 A;  5I42 A;  4NYF A;  4NYN A;  3ZT3 A;  4QOZ B;  3OJS A;  3JYT A;  4FJM A;  2IC3 A;  5J2P A;  4FZY A;  3PX0 A;  2VG7 A;  4GW6 A;  4FM1 A;  4CFA A;  1KRP A;  1VSD A;  3LAM A;  1C1B A;  4C8O A;  1LW2 A;  3NF6 A;  4B8A B;  3OYI A;  4YFU A;  1TL1 A;  4DS4 A;  4BE2 A;  4E7I A;  4ZTF A;  3QEX A;  2YNG A;  1QSS A;  3MEG A;  1CXQ A;  4G1Q A;  3L2W A;  4CEC A;  4DS5 A;  4E3S A;  1SL2 A;  4CJT A;  2RKI A;  2KFN A;  4B9U A;  1RCH A;  3A2F A;  1BIZ A;  3WNG A;  4DFM A;  1EX4 A;  2OA8 A;  2PYL A;  2BGG A;  4CEF A;  3K58 A;  3CM6 A;  3QO9 A;  3PV8 A;  5FRN A;  3NGI A;  4MFB A;  1RIL A;  2E6L A;  1A5X A;  3AVF A;  3HST B;  3VQ4 A;  3ZSX A;  1HYV A;  1O1W A;  1IKY A;  1RBT A;  1DLO A;  3I8D A;  4B9L A;  5FRM A;  2FBV A;  3LWM A;  4CF9 A;  1RBV A;  3VA3 A;  2Y1I A;  3SUP A;  1D8Y A;  3RRG A;  4K8X A;  1BIS A;  1UWB A;  2YKN A;  2YHB A;  3I0S A;  3KLF A;  1NK4 A;  4M42 A;  3DM2 A;  1SV5 A;  3LP2 A;  5EU7 A;  5C42 A;  4KHU A;  4Z4I A;  3IRX A;  4CED A;  2LSN A;  3CQ8 A;  5KRT A;  1BQM A;  1RTJ A;  4E19 A;  1XHZ A;  1TKD A;  5HRO A;  1ZBH A;  3TAF A;  1TAQ A;  1WSF A;  2E6M A;  3VQA A;  4E0D A;  2RN2 A;  2F8S A;  3RMA A;  1TKT A;  3K5N A;  2KZZ A;  1NOY A;  1RDA A;  3QER A;  4KHS A;  2B6A A;  4IDK A;  3OJU A;  3SZ2 A;  4KHY A;  1RT5 A;  3AVI A;  3DI6 A;  3DLG A;  3KLG A;  2ATQ A;  4KO0 A;  4LD0 A;  4FM2 A;  4DTU A;  3KLE A;  1JL1 A;  3DRP A;  4IFY A;  3QNO A;  4Z4G A;  3IG1 A;  3SJJ A;  1NK9 A;  2KW4 A;  1F21 A;  3AVC A;  2AJQ A;  3ASM A;  3VQ9 A;  3T19 A;  4BWJ A;  4DG1 A;  4CFD A;  3VQD A;  3NCI A;  3BDP A;  1WAJ A;  1C1C A;  1NJW A;  4DSJ A;  3H08 A;  4CFC A;  3OYC A;  4FVM A;  1VSK A;  4DU4 A;  3AO2 A;  1CZ9 A;  4DU1 A;  4CHO A;  3OYA A;  4AIL C;  3L3V A;  3PY8 A;  3OYB A;  4FJL A;  4KRE A;  3P5J A;  4CES A;  4CJU A;  4CEZ A;  3K57 A;  4DTP A;  1T03 A;  2YV0 X;  5HBM A;  4Y1C A;  1S1T A;  4F3O A;  3C6U A;  1KLM A;  1HNI A;  2BE2 A;  3SI6 A;  4KHQ A;  1EKE A;  1RBR A;  1KFD A;  2JLE A;  4CJE A;  2YNH A;  2HW3 A;  3LP1 A;  2BAN A;  1S6Q A;  4DMN A;  4CK3 A;  1ZBU A;  4NCA A;  4B9S A;  1UAX A;  2O4I A;  3O4N A;  3AVJ A;  3RR7 A;  1B9F A;  1RTH A;  1RDC A;  3RMB A;  1U49 A;  4BDP A;  4IFV A;  2HHS A;  3C95 A;  4FLX A;  3DYA A;  3KLH A;  3TAB A;  4DWI A;  2XY6 A;  3LAN A;  4IG0 A;  2HMI A;  1HPZ A;  3LPU A;  1JLA A;  4N56 A;  3OS1 A;  1CXU A;  1RT6 A;  5KTQ A;  4HVJ A;  3SV3 A;  3SUQ A;  2Z1H A;  3D0P A;  1TKX A;  1QQC A;  4OGC A;  4FLT A;  1WN7 A;  2EHG A;  4DQQ A;  4KHN A;  4Z4H A;  1IKX A;  4E1M A;  4PY5 A;  3OYM A;  4DFK A;  3WNF A;  4NCB A;  4PUO A;  4J2E A;  4AHS A;  1BIU A;  1S1X A;  4E7J A;  4DF4 A;  4N5S A;  4GMJ B;  2BDP A;  3HPO A;  1TGO A;  4RW7 A;  3AA5 X;  4JS5 A;  5DMR A;  4CF1 A;  3ALY A;  1KVB A;  2YNI A;  3NH0 A;  3MAQ A;  3V1Q A;  5KGW A;  4HUG A;  1VRU A;  5DK5 A;  1ASW A;  3K5O A;  1LV5 A;  1NOZ A;  3G0Z A;  4CHP A;  1S1V A;  3MEC A;  4O0J A;  2DFE A;  2OPQ A;  4OJR A;  1JKH A;  1L3U A;  3DLR A;  5E41 A;  1RT2 A;  2DY4 A;  3VQ5 A;  3RTV A;  1LWE A;  1WNS A;  4RW8 A;  1SKR A;  3K2P A;  1J5O A;  4J2A A;  1I3A A;  4DFJ A;  4O5B A;  5HRS A;  1LWF A;  1RNH A;  3ZT1 A;  1ASV A;  1WSG A;  1JLG A;  4FLW A;  3AVM A;  4OKK A;  1HQE A;  1X9W A;  4DSK A;  1RDD A;  4Z4E A;  3DMJ A;  3TAG A;  4CJL A;  3U3Y A;  3NBP A;  4KHW A;  2DFH A;  3ZSZ A;  2G8F A;  4CF8 A;  3NGZ A;  5J2Q A;  1J53 A;  4B08 A;  4ID5 A;  3ZSQ A;  2KZM A;  2W42 A;  2HHU A;  3IS9 A;  2IS3 A;  3DRR A;  4O0I A;  1RT7 A;  5SZT A;  4W5R A;  3KD1 E;  2HVI A;  1TV6 A;  3K5M A;  3SV4 A;  4CJ4 A;  3LAK A;  4N76 A;  4DFP A;  3HJF A;  4FLY A;  3L2V A;  3HM9 A;  2XRI A;  3NHG A;  1RBS A;  2B5J A;  2Z1G A;  1X9M A;  2G8I A;  4CJF A;  2ZE2 A;  3PX6 A;  1S1U A;  1TL3 A;  1R0A A;  3ZSV A;  1L3V A;  1U4B A;  1VSL A;  4I7F A;  2X74 A;  4B3O A;  3V1R A;  3SYZ A;  1NJZ A;  3SUO A;  4H8K A;  3MED A;  5CZ1 A;  3RMC A;  3THV A;  4RW9 A;  1FKO A;  2Z1J A;  2VG6 A;  1GOA A;  3AO1 A;  3VQ7 A;  3CFP A;  4DSL A;  1J54 A;  4I2P A;  4CJR A;  5JS1 A;  2WOM A;  1BCM A;  3QEI A;  2XY7 A;  4AHT A;  2DTU A;  1J9A A;  4E7L A;  3IAY A;  3NF8 A;  4FJ7 A;  1WSI A;  4HUF A;  1KLN A;  4BE0 A;  3ZCM A;  1BCO A;  3PO4 A;  3SQ4 A;  4NCG A;  4KTZ A;  1GOB A;  4OKJ A;  4CGF A;  4R5P A;  1X9S A;  4CK1 A;  3O3G A;  1UOC A;  5T7B A;  2G8W A;  3QIO A;  3PO5 A;  4KB0 A;  3OYJ A;  3VA0 A;  2D0A A;  1NJY A;  3OYL A;  1RT3 A;  2RPI A;  1L5U A;  3TR8 A;  1JLC A;  4KPY A;  3V9Z A;  1C0T A;  3SQ0 A;  1UA0 A;  1RTI A;  4M3U A;  1Q9X A;  4HHT A;  3ZSO A;  3B6O A;  2KTQ A;  1UA1 A;  4F2R A;  3L2Q A;  5HRR A;  5I3U A;  4CEQ A;  1YVU A;  1KCF A;  2HNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...