4AHRA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
153
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 59
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahrA00
1RTHA 4Q0BA 3IS9A 1J53A 1RDAA 1WSFA 4HTUA 1TKTA 3AO4A 3MEDA 4DSEA 1RBRA 2OZMA 4KI4A 4CGIA 3LP0A 1WN7A 2BANA 3V9XA 3SYZA 4FJKA 1VSEA 3OYIA 1NJXA 3NE6A 5CYQA 1NK5A 4F3OA 1U04A 2OPRA 2IOCA 4N47A 3KJVA 2PYJA 4KFBA 4AHSA 3M8SA 3SI6A 4QCLA 4TSXA 3S3OA 1S9EA 2ETJA 1RNHA 4CJ3A 4JS5A 1VSDA 3NHGA 4NCAA 1L3VA 3VN5A 1BI4B 1S1XA 2Y1IA 5DMRA 4MQ3A 3LDSA 4CEDA 3TAEA 4J2AA 3L3VA 1JL1A 1UA1A 3O3FA 1T05A 1Q9XA 1CZBA 2ZE2A 3CFPA 1BQMA 1RILA 1S1TA 3ZT0A 1C1CA 4CJVA 2R7YA 4DF8A 4DSIA 4M3YA 2VG7A 2WONA 3OYHA 3TI0A 1ZBIA 3OYDA 3RRGA 3AA4A 2YNFA 3AO2A 1JXBA 3KK3A 4CGGA 3SQ0A 5SWMA 3AV9A 5JS2A 4PWDA 2GUIA 3SQ2A 1RBVA 3PV8A 1C1BA 1C0TA 3BDPA 5J1EA 1T8EA 4RG8A 5KI6A 3ZSRA 4FK2A 1NK6A 2Z1JA 3M8QA 3ZCMA 4K8XA 1O1WA 4LD0A 2KQ2A 3NH0A 4M45A 4CHNA 1BI4A 4HUGA 3KD1E 4Q5VA 1S9GA 2FBYA 4E89A 3IRXA 4FLYA 2HNDA 4BWJA 1BQNA 4DFMA 3RTVA 3MEEA 3NH2A 5J2QA 4HCBA 3SQ1A 3OJSA 2Z1HA 4B08A 2E6LA 4EZ6A 2KTQA 1J9AA 3QIPA 4FJNA 4Z4EA 1QHTA 2XO7A 4CEFA 2OPSA 2IDOA 3AA3A 1RT3A 1KLNA 4Z4GA 1JL2A 3MEGA 3C94A 3ZSZA 1NK7A 4FJJA 1KTQA 3OYNA 4OKEA 1A5VA 1JLQA 3I0RA 4B9MA 4CIEA 1KVAA 3DLHA 4DSFA 5FDLA 4DQIA 3NBPA 4IDKA 4M3RA 2PZSA 2DFFA 4CJPA 1CXUA 4BE2A 3AVCA 2G8FA 2FBXA 4B9UA 3RMCA 1LAVA 4E3SA 4KKOA 4IFYA 3LAMA 3LP1A 3PUFA 4UQGA 3OYBA 1BL3A 1LAWA 3VQBA 4R5PA 4J2BA 5K14A 1WAJA 3DRRA 4CJFA 2OPQA 2YNHA 4M3XA 1D8YA 3CG7A 4B9LA 4HCCA 2G8IA 1F21A 1TV6A 1WAFA 1CXQA 1RDBA 3I8DA 2FBVA 4FM2A 4WE1A 2HHSA 3JSMA 3TARA 4FW2A 1GOCA 4AHCA 1B9FA 2VG6A 3V1RA 3NCIA 3TANA 1BCOA 3UIQA 3TAMA 4F3TA 4W5QA 4KRFA 3ZSOA 3ISNC 4LH4A 3LPUA 4E7LA 3QLHA 1A5XA 4DTUA 3MXIA 4KREA 1LWEA 4FZYA 1HYVA 4B8CA 3VQ4A 1RT1A 1TAUA 1Y97A 3FFIA 3NF9A 3SUPA 4F2SA 3OS1A 3NAEA 4B9NA 3VA3A 4DU3A 4CJWA 4HVJA 3PX4A 1VSJA 1JLAA 3HSTB 4W5OA 1ZBLA 2HNZA 2HNYA 1K6YA 3K5MA 5KTQA 3P1GA 1I3AA 1RBSA 1VK0A 3AVIA 4FJ5A 1VSKA 4Z4HA 4AHRA 3EZ5A 3K5OA 2XHBA 3TWHA 3TAGA 3SCXA 4M42A 1EKEA 4CK2A 2D5RA 1ASUA 3VQ9A 1D5AA 4CHPA 3SJJA 1TVRA 3MXMA 4CF8A 3D45A 4OKKA 4Z4FA 2HHVA 1HJRA 1IKVA 4FLZA 2DTUA 1LWCA 2D0AA 4RW6A 4CF9A 2XRIA 4ELTA 1TKXA 3LZIA 4FYDA 3QNOA 4CFAA 2O4IA 4LSNA 3HVTA 4BE1A 3AO3A 2HHTA 1RDDA 3H08A 4FLXA 1TK8A 1NK4A 1IH7A 4LSLA 3ZSVA 1ITGA 4I9QA 3VQEA 1JLCA 4ZTFA 1NOYA 2P1JA 2JLEA 4RW8A 4EP5A 4DSKA 4FJXA 4Z4CA 4DFJA 3V9UA 3TR8A 4PQUA 1RT4A 3ZSYA 4FM0A 1TK0A 4OKJA 1BIZA 4CJ4A 1DTQA 3LANA 4O5BA 3HYFA 3KLHA 5HRNA 4FLVA 3ALYA 1NK9A 4E7JA 4FJHA 4I2QA 1JLEA 3EY1A 2XY5A 2WOMA 4C8OA 1ZYQA 4PUOA 2FC0A 4KTZA 1W9HA 5FRMA 4CJ5A 5KRSA 4YFUA 4CEQA 1HMVA 3LWMA 1QS4A 3AVGA 2OA8A 4O0JA 1ASVA 4CJEA 1JXEA 4DQQA 1TKDA 4FJIA 3CM6A 1S5JA 4B9TA 4AHVA 1SKWA 3WNGA 1SL2A 3OVNA 1Q9YA 3T19A 4H4OA 1HNVA 5EU7A 5FROA 1BISA 2F96A 3ZSXA 3SV3A 4DFKA 4RW9A 4YNQA 4CFCA 3JYTA 4F2RA 4OGEA 2HVHA 1VSHA 4FJ8A 3OYCA 4QOZB 4H4MA 1XWLA 1X9WA 3KKRA 1HYSA 3DLKA 5DK5A 3OYMA 3KK2A 4CE9A 4XIUA 4J2DA 3V9SA 2QKKA 3OS2A 1LW0A 3ULDA 1RT5A 1JKHA 2DFEA 4G1QA 1VSIA 4C8MA 1XC9A 1NKEA 1Q8IA 3L3UA 2OYQA 3SNNA 2ATQA 3CM5A 3O4QA 2BE2A 4FJGA 1W0HA 1NOZA 3DOKA 1ZBUA 4RW7A 1L3TA 2QXFA 4CEOA 2IGIA 2E4LA 1XI1A 1RT6A 3K58A 4DS4A 5HLFA 4M3WA 4OJRA 4CHQA 1VSLA 2VWKA 2E6MA 3WNHA 4DU1A 3LZJA 4CGDA 3RMDA 3RMBA 4CJRA 5I42A 1NK0A 3BGRA 4DFPA 4CF2A 4DQRA 4AILC 3QERA 4E7IA 4NCGA 4CGFA 3IG1A 4FLUA 2HVIA 4BDPA 1QQCA 3HL8A 3NDKA 4EP4A 4W5NA 3QIOA 3HPGA 1HPZA 1TL1A 3VQ6A 1BGXT 1DTTA 3V9WA 1NK8A 4K8ZA 5SZTA 5KGXA 4CEEA 3KLIA 3KLEA 2G8VA 3QEIA 4N41A 1RTIA 5J2PA 3LAKA 1EETA 3NGZA 1IKWA 2VG5A 4DG1A 3HK2A 1UAXA 2FBTA 3MAQA 3PX0A 4KHUA 3THVA 1VRTA 4Y1CA 4FJMA 4KTWA 4CIGA 1HQUA 2I5JA 4CF0A 2XY7A 1LWFA 4DLGA 5CYMA 4Z0UA 3OS0A 3OYAA 4DTMA 1U49A 1KLMA 4NYNA 4BACA 3MECA 1UA0A 3HXMA 3K57A 3EYZA 1CZ9A 3DI6A 2A1SA 3F73A 2X78A 1EXQA 4RW4A 3OYLA 3NF6A 4CEAA 2HHQA 1FXXA 2OPPA 4KB0A 2EHGA 1KRPA 1D9FA 3S9HA 2B4JA 2Z1GA 4O0IA 4DF4A 1HRHA 1TL3A 3TAPA 1KSPA 3TAFA 4E7HA 3DMJA 2W42A 3ZT1A 3NF8A 3O4NA 2YHBA 4CJSA 3ZT3A 2KZMA 2YNIA 3AVAA 1SV5A 1X1PA 4FXDA 5FRNA 1TGOA 4I7FA 5T7BA 2IS3A 4GVMA 3DOLA 1T03A 5D3GA 2X6SA 3AVKA 4FW1A 1KCFA 4M3TA 4FZZA 3D0PA 3K5LA 3ZT4A 4KHNA 3E01A 2Z1IA 3VQDA 5J2NA 4W5RA 2XY6A 4KV8A 2EX3A 3PX6A 3TAQA 2B5JA 3VA0A 1LV5A 1J5OA 3SQ4A 4ELUA 3G10A 1U47A 4Z4IA 4DSJA 3B6OA 3LP2A 3CFRA 1XHZA 1UOCA 3LPTA 2B6AA 4DSLA 4KB1A 4B3OA 4CGHA 1SL1A 2ZD1A 2G8WA 2RN2A 1RCHA 1TKZA 4KPYA 1RTJA 4CK1A 4DTXA 3RRHA 1S1WA 4AHTA 4HUEA 4QAGA 4OVLA 3LP3A 1C6VA 4CECA 5C42A 1WSIA 3LWLA 3S3NA 2G8KA 1BCMA 4CHZA 4E19A 1REVA 4IFVA 4OLAA 3NF7A 4BDZA 3DYAA 4CHOA 1WSHA 4DWIA 1YTUA 1RBUA 3G0ZA 3M8RA 3VQ7A 3C6UA 1JLGA 3SV4A 2HHUA 4KHYA 4CERA 3C6TA 1RBTA 4O4GA 5C25A 1FK9A 2PY5A 1UWBA 2YV0X 4B9SA 3KTQA 3NGYA 4CFDA 4DS5A 1MU2A 2O4GA 3U3YA 3P5JA 1WLJA 4DMNA 3VQCA 1S6PA 1FKOA 1KVBA 4CJUA 3V1OA 3C95A 5HRSA 3ZSWA 3OYEA 3QEWA 4MFBA 3LALA 3AVMA 2YKMA 4BDYA 4M3ZA 1NKBA 1ASWA 1SUQA 2RF2A 2F8TA 3AVLA 3AVNA 5I3UA 3HT3A 4CK3A 1N5YA 1NJYA 1YT3A 1SKRA 2RKIA 2HW3A 4FVMA 3HM9A 3QINA 2D0CA 1IG9A 3T3FA 4DTSA 5HBMA 1T7PA 3RR8A 4DU4A 4KO0A 4N56A 4W5TA 1L3UA 1EX4A 4DQSA 4F8RA 2QK9A 5KRTA 3VQPA 4GW6A 4FLWA 3KD5E 1BHLA 1TAQA 1JLBA 2HHXA 3B6PA 3QEVA 4JRQA 5C24A 4KHSA 3DLGA 1IKXA 3QO9A 2RPIA 3WNFA 3KIOA 2DY4A 2KFNA 3MXJA 3KK1A 3K59A 3PO4A 3OJUA 4OPKA 3O3HA 3PY8A 1RT2A 1HQEA 1B9DA 3WNEA 2KFZA 1FKPA 4E7KA 5E41A 1SKSA 1WSEA 1RT7A 3HP6A 2VWJA 5CY4A 1NJWA 3U6FA 4IKFA 3I0SA 4KHQA 3HPHA 2NUBA 4OGCA 4J2EA 3AVBA 3QETA 3U3GA 2IC3A 4H8KA 2D0BA 4I2PA 1NKCA 4FCYA 2IAJA 4N5SA 2QKBA 4FLTA 3AO5A 4Y1DA 2HMIA 3QESA 1RTDA 4BWMA 1X9SA 4CFBA 1G15A 4CEBA 2YKNA 3AO1A 3ZT2A 4LY7A 3CQ8A 4FJLA 4N76A 1U48A 1RDCA 3DLRA 2BGGA 2BDPA 2F8SA 1WSGA 4AH9A 4ELVA 4CJKA 4IG3A 3CFOA 1JLFA 2G8HA 1Z25A 1CLQA 4DTNA 4PY5A 4CEZA 1HNIA 4ZHRA 3OYGA 3L8BA 3RR7A 3ITHA 5HRRA 3SZ2A 1BIUA 2AJQA 4DTOA 4KHWA 4FM1A 3O3GA 3AVFA 1WSJA 3SPYA 2GBZA 3DLEA 5JS1A 4I9LA 4PA1A 1HYZA 4M3UA 3QEXA 2G8UA 3L2RA 4DTPA 4CIFA 4NYFA 3VQQA 3L2VA 3QNNA 1B92A 3V4IA 1L3SA 1QTMA 2JGUA 5J2MA 2P5GA 4FJ7A 3RMAA 1N6QA 4C8LA 3NGIA 5CZ2A 3HPOA 1U4BA 3V1QA 1DLOA 1IKYA 4OPJA 3KLFA 2LSNA 4C8NA 1J54A 3OYJA 5HROA 3SPZA 4CGJA 4F4KA 5CZ1A 1C1AA 2OZSA 3HJFA 1EP4A 4CESA 4KI6A 3TABA 3VQ5A 2KZZA 3QEPA 2PYLA 3K5NA 1I39A 3PO5A 3K2PA 4CCHA 1LW2A 4LH5A 1TK5A 1QSYA 3V81A 4GMJB 1QSSA 1SL0A 1YVUA 1Z26A 1IO2A 4AHUA 3KLGA 4JRPA 2DFHA 4CJLA 3VQAA 4KAZA 3A2FA 3HO1A 1S1UA 1GOBA 2A1RA 4IBNA 2YHAA 3OYFA 3AA2A 4ICLA 2Y1JA 1U45A 1A5WA 1C0UA 1QSLA 3L2WA 4HHTA 4KTQA 4C8KA 4ID5A 4E0DA 1ZBFA 2HHWA 1XHXA 4FK0A 3AA5X 4JS4A 3F9KA 3AVHA 1KVCA 4CF1A 4FJ9A 4JLHA 3V6DA 4B9VA 4O44A 4CJTA 5HP1A 2XY8A 2Q3SA 3L2QA 3DM2A 4OLBA 4CJQA 1VRUA 2ITGA 3L2UA 4HUFA 1YTAA 3SUNA 1VSFA 3RWUA 5KGWA 4FK4A 4NCBA 3SUQA 1X9MA 2HB5A 2X6NA 3S3MA 2KW4A 4ID1A 2P5OA 1WNSA 3KKSA 3T1AA 1NJZA 4DTJA 5HRPA 3OY9A 3ASMA 4IG0A 3OYKA 4BE0A 1R0AA 1ZBHA 2ZQBA 3DRSA 2YNGA 3NH1A 1VSMA 2P51A 3P83D 3M8PA 3HVRA 1QE1A 4B8AB 4DTRA 4CHYA 3IAYA 4O55A 2GV9A 1GOAA 1L5UA 4EZ9A 3DRPA 3HP9A 3SUOA 3NFAA 1C0MA 3CYMA 4M41A 4FZXC 4L8RB 4DQPA 3VQ8A 1KFSA 1KFDA 3AVJA 3V9ZA 3DLBA 2X74A 1S1VA 4DLEA 1D9DA 4E1MA 4ZTJA 3ZSQA 1S6QA 4E1NA
chains in the Genus database with same CATH superfamily
1LOTB 1WSFA 2OZMA 1TKTA 1NBWA 3U4LA 3C65A 5E26A 3LP0A 1IBMK 2BANA 4H0VB 2O8EB 3DJCA 1NK5A 1D4XA 3K9JA 4F3OA 3NMUA 3M8SA 3SI6A 3S3OA 2F7TA 1NGDA 3H45C 3ATUA 4MQ3A 3LDSA 4J2AA 3C6AA 3L3VA 1UA1A 3O3FA 3GDQA 1CZBA 3ZT0A 5M1PA 2R7YA 1NGIA 3TI0A 4NO7A 2YNFA 3AO2A 1JXBA 2O8EA 1SZ2A 4CGGA 2O8DB 1GLAG 3AV9A 1NGAA 3SQ2A 3J7AP 1NK6A 3QBXA 4K8XA 4LD0A 2KQ2A 4BGBA 1YITN 2P9SB 3A5MC 4CHNA 1S9GA 4E89A 4OPHA 4CZIA 1BQNA 3NH2A 4DUYK 3OJSA 2Z1HA 3PSFA 3VGMA 4BR9A 3MX5A 3MWPA 4CEFA 2O8DA 1JL2A 3MEGA 4FJJA 3GBTA 3DLHA 4BREA 3RMCA 2P9SA 3U9DA 4KKOA 3TTFA 4IFYA 5C0YA 4UQGA 3QMLA 4JK8A 5EX5A 4R5PA 4J2BA 3MN6A 3DRRA 3L4QA 4M3XA 1D8YA 2G8IA 4B9LA 1WAFA 4FWMA 2FBVA 2UU9K 4FW2A 1GOCA 3BZCA 4A57A 4F3TA 4KRFA 3ZSOA 1QZ6A 4LH4A 4KREA 4DTUA 1K9MO 5LY3A 2CGLA 3FZFA 2VGNA 3VQ4A 1IV0A 3NAEA 3D7EO 1JLAA 1ZBLA 2HNYA 1SS6A 4CZKA 5KTQA 4LF9K 3P1GA 3F2KA 1I3AA 3AVIA 1XC3A 5CE3A 2DPNA 4CHPA 5JICA 3SJJA 1YJ9N 4CF8A 4Z4FA 5GAGP 1IKVA 4FLZA 2FSJA 1LWCA 2D0AA 3OBWA 4ELTA 2O4IA 2VQEK 3AO3A 3H08A 4FLXA 4AM6A 1TK8A 1NK4A 4LSLA 3ZSVA 1ITGA 2GUPA 4I6MB 2OANA 2UYTA 3VQEA 3I56N 4KH5A 1NOYA 2JLEA 4RW8A 3AGKA 4A2BA 4DSKA 4DV2K 4Z4CA 1RT4A 4CZJA 4OKJA 2Q2RA 1DTQA 4F9OA 3WT0A 4BG9A 4JI7K 3MK6A 1XNQK 4FJHA 4I2QA 5CHIA 2WOMA 3TPQA 4YORA 4CJ5A 3QICA 4LFAK 4EHUA 3D6RA 3LWMA 2RHKA 1QS4A 3AVGA 2OA8A 4DQQA 5AZIB 4I6MA 1TKDA 2E8AA 4H4OA 4YNQA 4PKGA 3QFUA 3OYMA 5ADXH 4XIUA 4J2DA 1RT5A 3FLCO 4C23A 2ATQA 1GLLO 3BUZB 2I7PA 1ZBUA 4B9TA 4CEOA 2IGIA 1NLVA 5AZIA 5HLFA 2CGKA 2VWKA 4DU1A 3LZJA 3RMDA 1BDGA 1HNWK 2E2OA 4CF2A 3D2EB 4E7IA 3M6GA 4CGFA 2HVIA 4H0OA 4BDPA 4EP4A 3QIOA 1HPZA 3VQ6A 4DV7K 1K8AO 4BC3A 1HNXK 5KGXA 2V7ZA 1RTIA 4MO4A 2VG5A 4DG1A 3MAQA 3PX0A 3VOVA 3WXKA 4CF0A 4CBWA 4Z0UA 3OYAA 1KAXA 3VPZA 3U8XA 5JLHA 3J81O 4BACA 2NRXA 2OTLN 4O8UA 3PSIA 3K57A 3EE9A 4RW4A 3KWIA 1HX1A 4UY8O 4AM7A 3NF6A 4LF7K 3S9HA 1KSPA 1HRHA 4CW7B 3DMJA 4E7HA 4DV4K 3DAWA 5BPNA 3AVAA 3CJCA 5LJVA 3AY9A 4RCHA 1T6DA 4MDBA 2NRWA 2X6SA 2BTFA 3D0PA 3ZT4A 4KHNA 5FPDA 3ENOA 1QVGM 5EY4A 3B6OA 3LPTA 2HBKA 2G8WA 4IEEA 4KPYA 1TKZA 3E1YA 5KPRA 4CK1A 4DTXA 4B3SK 4HTLA 3CPWM 4A5AA 4AHTA 4HUEA 4BVPA 1C6VA 2G8KA 3FZKA 4GKJK 4E19A 4OLAA 4BDZA 1T6CA 4WFNL 5AFUA 4DWIA 1VHXA 5M1NA 1RBUA 1XNRK 3M8RA 3SAFA 2UXDK 2GTDA 4O4GA 1RBTA 4YOXA 1VQ4N 1UWBA 4B9SA 3KTQA 4CFDA 1MU2A 3ZX0A 2D4WA 3VESA 4YY3K 4MFBA 1SUQA 3AVNA 4CK3A 1YT3A 2RKIA 1FJGK 4DQ8A 1IG9A 5HBMA 4DR6K 1EX4A 5AQGA 4F8RA 1BU6O 5KRTA 3VQPA 2Q97A 3W3DA 4CBXA 2HHXA 3QEVA 5KQ8A 3DLGA 3CHWA 3KIOA 3VF2A 1NMNA 3K59A 3OJUA 3J7ZO 3PY8A 3WNEA 1FKPA 1RT7A 3HP6A 4FWKA 3FZMA 5CY4A 3VEWA 4IKFA 3I0SA 3CJ7A 4KHQA 4MLEA 4J2EA 3AVBA 4H5TA 2NRVA 4I2PA 3GE1A 4Y1DA 5EOYA 4M7YA 1X9SA 4CFBA 3ZEUB 4CEBA 2J4RA 4BC5A 1U48A 3DLRA 2Q36A 2FXUA 2JWLA 1K73O 2F8SA 3CCJN 4AH9A 4CJKA 4IG3A 3CFOA 4CBUA 4CEZA 4ZHRA 3LDNA 3ITHA 3SZ2A 3AAPA 1W7AA 4DTOA 4H0YB 2ZGZA 3O3GA 3AVFA 3SPYA 3CCMN 4LFBK 4WFBL 3VGLA 4PA1A 1WUAA 2E1YA 3ZEUA 3L2VA 4JI0K 4EIAA 4JD2B 2D0OA 1QTMA 3D2FB 2P5GA 4FJ7A 4WQ5C 1DLOA 1IKYA 1J54A 3HJFA 4CESA 4KI6A 5F1XA 1V4SA 1KXPA 4LH5A 1GLEG 1Z26A 4AHUA 2NRZA 1N33K 2DFHA 4CD1A 1ATNA 4KAZA 3OBYA 4JD2A 4IBNA 2YHAA 4BY9C 1C0UA 1OVQA 2HF3A 3CI5A 3L2WA 4HHTA 1Z6RA 1E4FT 4KH6A 4C8KA 4E0DA 4WQ5A 4FK0A 1WB9A 3FZLA 4JLHA 4B3MK 3L2QA 4CJQA 1VRUA 3O9RA 5AQIA 4HUFA 1YTAA 3RWUA 3AARA 3S3MA 2KW4A 4ID1A 4CZMA 2P5OA 3KKSA 3VEXA 4FOIA 4DTJA 4IG0A 5JLFA 2P51A 3M8PA 4B8AB 1OH8A 3ATVA 3HM8A 1C0MA 3CYMA 4FZXC 4L8RB 3LDOA 1E4GT 5AQPA 4DB3A 5BN8A 1KFSA 3AVJA 3T69A 3V9ZA 1ATSA 1S1VA 2X74A 1IBKK 1NG9A 4CD3A 2QWLA 1S6QA 4E1NA 4ISFA 3IS9A 1VQMN 3VETA 3FFKB 4HTUA 3O4WA 4DSEA 4KI4A 4CGIA 2VYPA 4BRDA 3G4SN 1U04A 5E84A 2QWRA 2YJFA 3C7NB 5BREA 4GKKK 3SBTA 2YI1A 4JS5A 3NHGA 4NCAA 1NGHA 2Y1IA 5M1QA 1YAGA 1KAYA 1VQNN 4DSIA 1S1TA 3K0SA 2WONA 1YVNA 3KK3A 5AQVA 5JS2A 2GUIA 3C7NA 5J1EA 5KI6A 2Z1JA 1K8KB 3O9QA 2AA4A 3KD1E 3IRXA 3Q7CA 4FLYA 4DFMA 1Q82O 3RTVA 3MEEA 3H46O 5J2QA 2O8FB 3SMSA 4B08A 4FPBA 3QIPA 4FJNA 3BF3A 2XO7A 1X3MA 2OPSA 2IDOA 1KLNA 1RT3A 4Z4GA 4IWVA 1A5VA 1JLQA 4A62A 4DQIA 1K8KA 3NBPA 4IDKA 4M3RA 4CJPA 2E88A 4QS8A 2E20A 3CC7N 4X64K 3PUFA 4O8KA 3OYBA 1BOTO 5K14A 1WAJA 1O13A 2OPQA 1NNEA 3MCPA 1F21A 1CXQA 2HHSA 3TARA 1P90A 5BN9A 1B9FA 2VG6A 3EKSA 3NCIA 1KD1O 1BCOA 1HPMA 3TAMA 3ISNC 4E7LA 3QLHA 4ILGB 2P9KB 3BF1A 3K9KA 1HYVA 3CC2N 3CETA 5AQQA 3VA3A 2E2PA 2OTJN 1VSJA 2HNZA 5MLCQ 4FJ5A 3TWHA 4K41A 3K5OA 3SCXA 3VF4A 2Q0UA 4BGAA 1XMOK 2A3ZA 4M42A 3C0BA 1TVRA 3P39A 1TUUA 1HJRA 2P9KA 4RW6A 4CF9A 3BY5A 1GLJO 3LZIA 4FYDA 1JCFA 4I9QA 1IH7A 4GV6A 3KK7A 2P1JA 5AQHA 4EP5A 4FJXA 4FWSA 4DFJA 1NGCA 4JAXA 1TK0A 1BIZA 3C6HA 5KPZA 3H3OB 3LANA 2ZWHA 4M7XA 4O5BA 3HYFA 1NK9A 4BR4A 4E7JA 4JKDA 4PL7A 1JLEA 3O5BA 4RWTA 1ZYQA 2HHHK 4PUOA 3AGRA 2IVPA 5FRMA 1OH5A 4YFUA 4K25A 4O0JA 1ASVA 1TUYA 2FSKA 4CJEA 3CM6A 1S5JA 1GLCG 1SL2A 1Q9YA 3ZSXA 1HNVA 3SV3A 4RW9A 5A2QO 4CFCA 4H5NA 4GVEA 2HVHA 1VSHA 4FJ8A 4H4MA 1X9WA 2NRRA 3KK2A 5AQUA 3LDPA 2QKKA 3KWGA 1LW0A 1JKHA 1QQOA 5LMUK 4G1QA 3TSUA 2OYQA 2BE2A 4M63C 4FJGA 1NOZA 1SAZA 3CXCM 1L3TA 2E4LA 4X62K 3K58A 4OJRA 4XEIA 1VSLA 2E6MA 2HOEA 4Y0WA 4BRIA 4CGDA 3R3LA 4B1ZA 1NK0A 4DFPA 3OA9A 3SAHA 4ISGA 4NCGA 3FZHA 3VTHA 4BR7A 3HL8A 3WQTA 4BRKA 1NK8A 3MCAB 3CQXA 1XUPO 4CEEA 3KLEA 2G8VA 1WBDA 4B1XB 3NGZA 1IKWA 4L3QA 1UAXA 2FBTA 4MLHA 2E2NA 4KHUA 1VRTA 4KTWA 2I5JA 2W41A 3WXMB 4PKIA 3SMPA 5CYMA 5ADXA 4DLGA 4B3RK 1UA0A 3HXMA 1CZ9A 3DI6A 2A1SA 1BO5O 4CEAA 2HHQA 1BUPA 4DR5K 4CZHA 1D9FA 2P9LB 2Z1GA 3HOTA 4DF4A 4JHDB 1TL3A 3TAPA 2A5XA 4BROA 3PLAA 1EWQA 3NF8A 3G71N 3ZT3A 2KZMA 2YNIA 2FSNA 5T7BA 1KAZA 1JCGA 1VQ7N 2IS3A 5AQRA 3DOLA 1OH6A 5D3GA 2F4VK 4FW1A 1KCFA 1RGIA 2IIRA 4M3TA 3VEOA 3EE8A 3O80A 3E01A 2Z1IA 3VQDA 3ID6A 3TAQA 4Z4IA 2UUBK 1J5OA 4DSJA 3R8EA 1XHZA 3CFRA 4FPAA 1UOCA 5F0XA 2P9LA 2ZD1A 4JHDA 1RTJA 1S1WA 2CH6A 4OVLA 4CECA 1WSIA 4LF8K 3S3NA 4CHZA 4BG8A 3NF7A 4DR3K 3CCQN 1JLGA 1HKBA 2F9TA 3VERA 4CERA 5GIPA 3WEEB 3HBTA 1FK9A 2YV0X 2O4GA 3VQCA 4B1VA 1FKOA 1KVBA 4FOEA 5GAEP 3ZSWA 3OYEA 3VEVA 5DM7L 2F8TA 1NKBA 1ASWA 1NMDA 3AVLA 3NVMA 1QQNA 1N5YA 3HM9A 3IMXA 3T3FA 3M5RA 1T7PA 1N8RO 4KO0A 3WEEA 3UKRB 1BHLA 1TAQA 2Q31A 1IKXA 3QO9A 2RPIA 4CZEA 2BH1A 2WBNA 4WF9L 1B9DA 2KFZA 3DLLL 1EQYA 1SKSA 1WSEA 4EAHD 1NJWA 3TTCA 3HTVA 2HF4A 2P9PB 1Q81O 3HPHA 4OGCA 1RFQA 3QETA 3UKRA 3BEXA 4IFEA 1NKCA 2IAJA 3R6MA 2I7NA 2ASPA 3AO5A 2HMIA 4LC9B 4B3TK 3WUHA 2ASMA 1G15A 4GNIA 2YKNA 4LY7A 3CQ8A 4JKCA 3VMFB 4NB4A 3FE1A 3RSEB 2P9PA 2G8HA 3SK3A 4PY5A 1HNIA 4YDUC 2AJQA 4FWQA 1Q18A 4DHYA 2GBZA 3DLEA 3F9MA 3D2EA 5JVGL 4I9LA 2EWSA 3OW2M 1HYZA 3HSCA 3QEXA 4WFAL 4DTPA 3VQQA 3L6QA 1L3SA 1B92A 1X3NA 4EFHA 2JGUA 5J2MA 3ZX3A 3RMAA 3VEYA 3CMEN 3DXKB 3NGIA 4YOTA 3HPOA 3RSEA 4OPJA 2P9UB 4RTFD 1BA0A 3CCSN 1C1AA 2JWKA 1OVYA 3VQ5A 4IOXA 3QEPA 3ZETB 4CCHA 2HBJA 4BRHA 3V81A 1QSSA 4DV3K 1YVUA 4YDUA 1Y64A 4FO0A 5BPLA 4DR4K 4PHTX 2A1RA 4BRNA 3CJBA 3AA2A 3TU5A 1A5WA 3DXKA 1QSLA 2P9UA 3E9LA 4FJ9A 3V6DA 4CJTA 2Q3SA 3P38A 3ZETA 4CZLA 3DM2A 1HR0K 4BRFA 5C2DA 5KGWA 3SUQA 1X9MA 2HB5A 4JI2K 4O5FA 1NJZA 5HRPA 3OY9A 1ZBHA 1R0AA 3DRSA 1KC8O 3E9OA 2NRTA 3HVRA 3OTOK 5EXWA 4CI6A 4DTRA 4LFCK 1GOAA 1L5UA 3DRPA 4M41A 2CGJA 4DQPA 3A0IX 1D9DA 4A5BA 3A5LC 5HL7L 1RTHA 3AO4A 1RBRA 2ZGYA 4FWPA 1VSEA 1NJXA 3NE6A 1BG3A 4PKHA 5GINA 3KJVA 2IOCA 3H1QA 4N47A 4QCLA 4Z94A 4TSXA 5I9EB 2ETJA 1RNHA 1L3VA 3VN5A 1S1XA 3EN9A 5DMRA 2ZJPL 3TAEA 1JL1A 1VQON 3N4QA 1Q9XA 1T05A 2ZE2A 3A5OC 1ESVA 4CJVA 4DF8A 3OYDA 3SQ0A 5SWMA 4PWDA 1T8EA 3SAGA 4RG8A 4FK2A 2D0PA 2ASOA 3DXMB 3ZCMA 4M45A 1WOQA 1CZAN 5FPNA 4H5RA 3VTIA 2FBYA 2WC9A 5GIOA 4Q5VA 2VGMA 3MN5A 2V51B 2QI2A 3R9PA 4BR5A 4HCBA 4Z4EA 1QHTA 1NK7A 3C94A 4PL8A 1KTQA 1VQ8N 3OYNA 3LDQA 3THYB 3DXMA 5FDLA 4DSFA 2PZSA 2DFFA 3AVCA 2FBXA 1LAVA 3IFRA 4E3SA 3G6EN 3LAMA 3LP1A 1C0GA 2KKZA 1LAWA 3VQBA 4CJFA 5AQMA 3VGKA 1RDBA 3I8DA 3JSMA 2PAVA 4AHCA 1HLUA 3H6EA 3V1RA 4BC4A 3LM2A 4YOVA 3UIQA 3THYA 4W5QA 1IJJA 3D2FA 4A59A 3MXIA 1A5XA 4FZYA 4B8CA 1TAUA 5KQDA 3VF6A 3OS1A 4B9NA 1NGBA 3PX4A 1T44A 3HSTB 3F5TA 1RBSA 4DKWA 4KBOA 1VSKA 4Z4HA 4AHRA 3EZ5A 3TAGA 2XHBA 3GL1A 4CK2A 3CCUN 1FW6A 1D5AA 3MXMA 3BZKA 3D45A 2FF3B 4OKKA 3AAQA 4IOCL 5DM6L 2DTUA 3EL2A 2XRIA 3WQUA 4LF4K 4LSNA 5JMVA 3HVTA 4BE1A 1RDDA 3P4IA 4IJNA 5AQZA 1JLCA 4ZTFA 5AR0A 4CJ4A 4DR2K 4H0PA 4JK9A 4FLVA 3ALYA 3EY1A 5AQWA 3ZYYX 4KTZA 1W9HA 5KRSA 2YHYA 1HMVA 2VQFK 4FJIA 3O6WA 3S41A 1VQKN 4K42A 3WNGA 4DFKA 5EU7A 4NCBA 4H5VA 4BC2A 3JYTA 5C2FA 4F2RA 1VQ9N 4H0XB 3OYCA 4QOZB 1XWLA 4BRAA 5DK5A 2V52B 4CE9A 3V9SA 4H03B 3ULDA 2DFEA 1XC9A 4C8MA 1HJOA 1Q8IA 4IZ9A 3L3UA 3SNNA 4GY2B 4WYBA 3CM5A 4X66K 2GWJA 1W0HA 1GLBG 3ID8A 4RW7A 1XI1A 1RT6A 3CCRN 2QWOA 4AILC 4FVUA 3IG1A 4X65K 1S3XA 3NDKA 1GLFO 3E66A 3HPGA 3V9WA 4BR0A 5SZTA 3KLIA 3TTDA 3QEIA 5BRDA 5J2PA 3LAKA 4C1NK 5AQFA 1MWMA 4ISEA 5TKYA 4BRQA 4K43A 5AQOA 3THVA 4BR2A 5AQSA 1LWFA 1VAZA 1KLMA 3MECA 5GADP 1Z05A 2O8FA 3FGUA 5AQNA 1EXQA 2UXBK 1KRPA 3QBWA 2B4JA 3TAFA 4C1NI 2ITMA 2HSTA 3ZT1A 3O4NA 2YHBA 4CJSA 4ILHA 4EHTA 1TGOA 4NXNK 2W6KA 1T03A 2YHWA 3PIOL 3JXUA 4NXMK 3MX2A 3MDQA 4CJ7A 5J2NA 2XY6A 4W5RA 3PX6A 4KV8A 2EX3A 4ELUA 2B5JA 3G10A 3I55N 2BUPA 3LP2A 4DSLA 4B3OA 1C0FA 4CGHA 1P8ZA 5C42A 3LWLA 4H0TB 1BCMA 1REVA 2VCPA 4JKGB 4IFVA 2E1ZA 3MN9A 3DYAA 3ZLJA 4CHOA 1WSHA 1YTUA 3VQ7A 3C6UA 3SLCA 2HHUA 4KHYA 3UE5A 1VQLN 5C25A 1N34K 2PY5A 2AP1A 4DS5A 3P5JA 1WLJA 3O9TA 4DMNA 1S72N 1S6PA 3ENHA 3M1FA 3V1OA 3KZBA 1VQPN 5HRSA 2P9NB 3LALA 2YKMA 4M3ZA 2RF2A 2A42A 4JKGA 1YHQN 3HOSA 2O8BB 3LM9A 3QINA 1EO1A 4DTSA 3RR8A 4DU4A 4N56A 4E1JA 1MDUB 4FLWA 3KD5E 2E2QA 1JLBA 2KHOA 4YOWA 2DY4A 4JI1K 3WNFA 2P9NA 4U67L 2KFNA 3ENBA 4IJAA 1X9JA 1RT2A 1HQEA 2A6AA 4OO1J 5E41A 2O8BA 3WXIA 2QWNA 3KHYA 2RE2A 3U6FA 2PFUA 2FLOA 3U3GA 2IC3A 3OHRA 2QWQA 4FCYA 4MO5A 3B8AX 4BRGA 3QESA 1RTDA 4BWMA 4QS7A 3AO1A 4FJLA 1RDCA 2D1KA 1SQKA 2BDPA 4A2AA 4DR1K 4ELVA 5TKWA 4BVOA 1QHAA 1JLFA 5LJWA 4IEIA 3UB5A 3O1WA 3OYGA 3L8BA 1YJNN 4FM1A 1WSJA 3I8BA 5JS1A 3JAMO 4M3UA 2G8UA 5M1FA 1HKGA 1TYQB 4NYFA 4CIFA 3QNNA 3V4IA 4YHHK 1QZ5A 1HKCA 4C8LA 5ELZA 5CZ2A 5BPMA 4B1YB 1J5EK 1U4BA 1J6ZA 3V1QA 3KLFA 2LSNA 4C8NA 3SPZA 4U7BA 1EP4A 2V7YA 3O9SA 2E5LK 3T7ZA 2PYLA 3K5NA 2F9WA 3CERA 1LW2A 4GMJB 1SL0A 2QEXN 4JKEA 5GAHP 3KLGA 1R59O 4BRMA 3VQAA 1TYQA 4FWNA 3HO1A 3A2FA 3E9PA 2IVNA 1S1UA 1GOBA 2Y1JA 4ICLA 4JKHA 3DWLA 1XQSC 1ZBFA 2HHWA 4JS4A 3LL3A 3CPEA 1U6ZA 3AVHA 3F9KA 1KVCA 4IO8A 4CF1A 5IWAK 4GV3A 4B9VA 4MDAA 5HP1A 5EVZA 4OLBA 3SUNA 3L2UA 4FK4A 1MA9B 4IOAL 1VSFA 2CH5A 4BQZA 1WNSA 3T1AA 4BE0A 1MWKA 5BR8K 4FWLA 2YNGA 3VENA 3P83D 4NLBA 1HUXA 2ZJQL 1QE1A 2YJEA 2O8CB 3IAYA 4LF6K 2GV9A 3U9ZA 5BRFA 3HP9A 3SUOA 3NFAA 5C10A 5AJ3K 3THWB 4E1MA 4ZTJA 3ZSQA 5AQJA 4GV9A 4Q0BA 1NU0A 1J53A 1RDAA 3MEDA 4JV5K 4IDHA 2NNWA 1WN7A 3V9XA 4FJKA 3SYZA 3TSPA 3OYIA 5CYQA 4WCEL 5IT9O 2OPRA 2PYJA 2O8CA 4KFBA 4AHSA 3SJHA 2ZF5O 1S9EA 4CJ3A 2ZM6K 1VSDA 3A8YA 1BI4B 4HWIA 3THWA 4CEDA 5AQTA 4K0KK 3CFPA 1BQMA 1RILA 1C1CA 4NLCA 2UUCK 4M3YA 2VG7A 3OYHA 1ZBIA 3RRGA 4JI5K 3AA4A 5H1SQ 1NJIO 3O8MA 1RBVA 3PV8A 1C1BA 1C0TA 1RDUA 3BDPA 3ZSRA 3M8QA 1O1WA 3NH0A 2ZJRL 1BI4A 4HUGA 2HNDA 4BWJA 3HRGA 2QW9A 1LCUA 3LDLA 1ZBSA 3SQ1A 4EZ6A 2E6LA 2KTQA 1V4TA 1J9AA 1ZC6A 3AA3A 4WQ4C 2QM1A 3ZSZA 3O9UA 3TSQA 4OKEA 1EWRA 3I0RA 4B9MA 2QWPA 2PBDA 4CIEA 1KVAA 1JCEA 4DUZK 4IO9L 1CXUA 4JKAA 4BE2A 2G8FA 4B9UA 2FF6A 4BQLA 1BL3A 2GWKA 4DR7K 4JKFA 2YNHA 2QA4N 3CG7A 4HCCA 1TV6A 4JKBA 4FM2A 4WE1A 1M1KO 3TANA 4KH4A 1H1VA 3CIPA 4WQ4A 4FSVA 1DKGD 3LPUA 2NZTA 5F2RA 1LWEA 1RT1A 1Y97A 3FFIA 3NF9A 3SUPA 4F2SA 5FLXO 3KVGA 4DU3A 4A61A 4CJWA 4HVJA 2VWBA 4DV5K 3QB0A 4W5OA 1K6YA 3K5MA 1VK0A 1G99A 5KPTA 3VEZA 1YI2N 1EKEA 3WXLA 2D5RA 1ASUA 3VQ9A 4JNEA 3O08A 2HHVA 5JVHL 1NGGA 1Q7YO 1TKXA 3QNOA 4CFAA 4JEPA 3A5NC 2HHTA 1W97L 1M90O 5C12A 4PQUA 3V9UA 3TR8A 1NGJA 3L4IA 3ZSYA 4H5WA 4FM0A 1JJ2M 2YCHA 4JI6K 3KLHA 5HRNA 4C8OA 2XY5A 2FC0A 1DEJA 4CEQA 3T1YK 1JXEA 3QFPA 5CR4A 2UXCK 4AHVA 1SKWA 3OVNA 3T19A 5FROA 1YIJN 1BISA 2F96A 3EEQA 4LF5K 4J8FA 4OGEA 1OKJA 3KKRA 1HYSA 3DLKA 2A41A 1YUWA 3OS2A 1Q86O 4OX9K 2WUSA 1VSIA 1NKEA 3O4QA 3JS6A 1VQ5N 1KQSM 2OCEA 1YXQA 3DOKA 4N41A 2QXFA 4M3WA 4DS4A 5M1OA 4CHQA 3WNHA 3RMBA 1HNZK 4CJRA 5I42A 3BGRA 3ZX2A 4B9QA 4DQRA 3QERA 2YX6A 1QVFM 4FWRA 4W5NA 4FLUA 1I94K 1QQCA 1DT9A 3H3NO 5LL6Z 1TL1A 3IKMA 1U2VB 1BGXT 1DTTA 4K8ZA 3FR0A 1EETA 4YOUA 3L0QA 1RDWX 3HK2A 5HOOA 1YJWN 4Y1CA 5FPMA 4FJMA 4CIGA 1HQUA 2XY7A 1ILYA 5LMNK 3OS0A 4DTMA 5C15A 1U49A 4NYNA 5FPEA 4B1WB 3EYZA 1NM1A 2UUAK 3R1XA 4JI8K 3F73A 2X78A 2HBMA 2KLAA 5AQLA 4YOYA 2GX9A 3CJ1A 3OYLA 2H3GX 5AFUH 4BRLA 3MN7A 1FXXA 1U2VA 2NLXA 2OPPA 2EHGA 5BR9A 4KB0A 3J7YP 4O0IA 2W42A 2YHXA 2P9IB 2QXLA 1T3VA 3UKUB 4FXDA 1SV5A 1X1PA 5FRNA 1ATRA 4I7FA 4JN4A 4GVMA 3CQYA 3AVKA 3IUCA 4FZZA 3K5LA 1QQMA 3CD6N 2HBLA 1NWKA 2WTUA 1LV5A 3VA0A 3SQ4A 1U47A 4IXCA 5AQXA 4G9ZA 2B6AA 4ILJA 4KB1A 1SL1A 2RN2A 1RCHA 5AQYA 4AF1A 3RRHA 4QAGA 3LP3A 2P9IA 3UKUA 2NRHA 5M1KA 3O1BA 3G0ZA 3W0LA 3SV4A 3C6TA 3NGYA 3U3YA 3CC4N 4BRCA 2A40A 2W40A 1NGFA 4CJUA 1VQ6N 3C95A 3H1VX 1WBBA 3QEWA 3AVMA 4BDYA 4XH5A 5I3UA 1GLDG 3HT3A 3QDKA 1NJYA 1SKRA 2HW3A 1IG8A 4FVMA 3MWTA 2D0CA 1OH7A 4CZGA 4W5TA 1L3UA 4DQSA 3RVCA 2QK9A 2Q1NA 3N4PA 4JYAK 4GW6A 1BA1A 2QWMA 3B6PA 4FL9A 4JRQA 5C24A 4KHSA 3GOIA 3WXJA 3IDHA 3CCVN 3MMVA 3MXJA 4CVNE 3KK1A 3PO4A 1YF5L 4OPKA 2IVOA 3O3HA 1E3MA 4E7KA 5BRHA 2VWJA 2NUBA 4H8KA 2D0BA 4N5SA 4DV0K 2QKBA 4FLTA 4QS9A 3M3ZA 3ZT2A 4BRPA 4N76A 1DGKN 3I33A 2BGGA 1WSGA 2QTDA 1Z25A 1CLQA 4DTNA 5AQKA 4DCHA 3RR7A 2WFBA 5HRRA 1BIUA 1IBLK 1N32K 1S22A 1NGEA 4KHWA 3P31A 3EZWA 4DV1K 3THXB 3L2RA 4V19S 3SBGA 3J80O 4KHPK 1N6QA 4OPAA 1BWFO 5AZJB 4B1UB 3G25A 2GELA 3OYJA 5HROA 2GEMA 4CGJA 4F4KA 5CZ1A 2OZSA 5B8HA 3TABA 2KZZA 1I39A 3PO5A 3K2PA 4DV6K 3EO3A 1TK5A 1QSYA 3THXA 3Q7BA 4XH4A 1IO2A 4JRPA 4CJLA 3ULEB 3OYFA 1U45A 3CJAA 4XH1A 3T1HK 4KTQA 5AZJA 4AQYK 4ID5A 3CCEN 3HZ6A 1XHXA 3AA5X 4R79A 3CF5L 3PIPL 3CCLN 1ZXOA 3NVKA 4JI3K 4O44A 4CZFA 3HI0A 2XY8A 4JI4K 2ITGA 4JK7A 2X6NA 2HMPA 3GG4A 3EKUA 3ULEA 1XMQK 1N36K 3BP8A 3ASMA 3OYKA 2W6LA 2ZQBA 3NH1A 1VSMA 1W2BM 4CHYA 4O55A 4FWOA 4EZ9A 2Q0RA 3J8AA 3VQ8A 1KFDA 3DLBA 3CJ9A 4DLEA 3CMAN
chains in the Genus database with same CATH topology
1RTHA 4Q0BA 3IS9A 1J53A 1RDAA 1WSFA 4HTUA 1TKTA 3AO4A 3MEDA 4DSEA 1RBRA 2OZMA 4KI4A 4CGIA 3LP0A 1WN7A 2BANA 3V9XA 3SYZA 4FJKA 1VSEA 3OYIA 1NJXA 3NE6A 5CYQA 1NK5A 4F3OA 1U04A 2OPRA 2IOCA 4N47A 3KJVA 2PYJA 4KFBA 4AHSA 3M8SA 3SI6A 4QCLA 4TSXA 3S3OA 1S9EA 2ETJA 1RNHA 4CJ3A 4JS5A 1VSDA 3NHGA 4NCAA 1L3VA 3VN5A 1BI4B 1S1XA 2Y1IA 5DMRA 4MQ3A 3LDSA 4CEDA 3TAEA 4J2AA 3L3VA 1JL1A 1UA1A 3O3FA 1T05A 1Q9XA 1CZBA 2ZE2A 3CFPA 1BQMA 1RILA 1S1TA 3ZT0A 1C1CA 4CJVA 2R7YA 4DF8A 4DSIA 4M3YA 2VG7A 2WONA 3OYHA 3TI0A 1ZBIA 3OYDA 3RRGA 3AA4A 2YNFA 3AO2A 1JXBA 3KK3A 4CGGA 3SQ0A 5SWMA 3AV9A 5JS2A 4PWDA 2GUIA 3SQ2A 1RBVA 3PV8A 1C1BA 1C0TA 3BDPA 5J1EA 1T8EA 4RG8A 5KI6A 3ZSRA 4FK2A 1NK6A 2Z1JA 3M8QA 3ZCMA 4K8XA 1O1WA 4LD0A 2KQ2A 3NH0A 4M45A 4CHNA 1BI4A 4HUGA 3KD1E 4Q5VA 1S9GA 2FBYA 4E89A 3IRXA 4FLYA 2HNDA 4BWJA 1BQNA 4DFMA 3RTVA 3MEEA 3NH2A 5J2QA 4HCBA 3SQ1A 3OJSA 2Z1HA 4B08A 2E6LA 4EZ6A 2KTQA 1J9AA 3QIPA 4FJNA 4Z4EA 1QHTA 2XO7A 4CEFA 2OPSA 2IDOA 3AA3A 1RT3A 1KLNA 4Z4GA 1JL2A 3MEGA 3C94A 3ZSZA 1NK7A 4FJJA 1KTQA 3OYNA 4OKEA 1A5VA 1JLQA 3I0RA 4B9MA 4CIEA 1KVAA 3DLHA 4DSFA 5FDLA 4DQIA 3NBPA 4IDKA 4M3RA 2PZSA 2DFFA 4CJPA 1CXUA 4BE2A 3AVCA 2G8FA 2FBXA 4B9UA 3RMCA 1LAVA 4E3SA 4KKOA 4IFYA 3LAMA 3LP1A 3PUFA 4UQGA 3OYBA 1BL3A 1LAWA 3VQBA 4R5PA 4J2BA 5K14A 1WAJA 3DRRA 4CJFA 2OPQA 2YNHA 4M3XA 1D8YA 3CG7A 4B9LA 4HCCA 2G8IA 1F21A 1TV6A 1WAFA 1CXQA 1RDBA 3I8DA 2FBVA 4FM2A 4WE1A 2HHSA 3JSMA 3TARA 4FW2A 1GOCA 4AHCA 1B9FA 2VG6A 3V1RA 3NCIA 3TANA 1BCOA 3UIQA 3TAMA 4F3TA 4W5QA 4KRFA 3ZSOA 3ISNC 4LH4A 3LPUA 4E7LA 3QLHA 1A5XA 4DTUA 3MXIA 4KREA 1LWEA 4FZYA 1HYVA 4B8CA 3VQ4A 1RT1A 1TAUA 1Y97A 3FFIA 3NF9A 3SUPA 4F2SA 3OS1A 3NAEA 4B9NA 3VA3A 4DU3A 4CJWA 4HVJA 3PX4A 1VSJA 1JLAA 3HSTB 4W5OA 1ZBLA 2HNZA 2HNYA 1K6YA 3K5MA 5KTQA 3P1GA 1I3AA 1RBSA 1VK0A 3AVIA 4FJ5A 1VSKA 4Z4HA 4AHRA 3EZ5A 3K5OA 2XHBA 3TWHA 3TAGA 3SCXA 4M42A 1EKEA 4CK2A 2D5RA 1ASUA 3VQ9A 1D5AA 4CHPA 3SJJA 1TVRA 3MXMA 4CF8A 3D45A 4OKKA 4Z4FA 2HHVA 1HJRA 1IKVA 4FLZA 2DTUA 1LWCA 2D0AA 4RW6A 4CF9A 2XRIA 4ELTA 1TKXA 3LZIA 4FYDA 3QNOA 4CFAA 2O4IA 4LSNA 3HVTA 4BE1A 3AO3A 2HHTA 1RDDA 3H08A 4FLXA 1TK8A 1NK4A 1IH7A 4LSLA 3ZSVA 1ITGA 4I9QA 3VQEA 1JLCA 4ZTFA 1NOYA 2P1JA 2JLEA 4RW8A 4EP5A 4DSKA 4FJXA 4Z4CA 4DFJA 3V9UA 3TR8A 4PQUA 1RT4A 3ZSYA 4FM0A 1TK0A 4OKJA 1BIZA 4CJ4A 1DTQA 3LANA 4O5BA 3HYFA 3KLHA 5HRNA 4FLVA 3ALYA 1NK9A 4E7JA 4FJHA 4I2QA 1JLEA 3EY1A 2XY5A 2WOMA 4C8OA 1ZYQA 4PUOA 2FC0A 4KTZA 1W9HA 5FRMA 4CJ5A 5KRSA 4YFUA 4CEQA 1HMVA 3LWMA 1QS4A 3AVGA 2OA8A 4O0JA 1ASVA 4CJEA 1JXEA 4DQQA 1TKDA 4FJIA 3CM6A 1S5JA 4B9TA 4AHVA 1SKWA 3WNGA 1SL2A 3OVNA 1Q9YA 3T19A 4H4OA 1HNVA 5EU7A 5FROA 1BISA 2F96A 3ZSXA 3SV3A 4DFKA 4RW9A 4YNQA 4CFCA 3JYTA 4F2RA 4OGEA 2HVHA 1VSHA 4FJ8A 3OYCA 4QOZB 4H4MA 1XWLA 1X9WA 3KKRA 1HYSA 3DLKA 5DK5A 3OYMA 3KK2A 4CE9A 4XIUA 4J2DA 3V9SA 2QKKA 3OS2A 1LW0A 3ULDA 1RT5A 1JKHA 2DFEA 4G1QA 1VSIA 4C8MA 1XC9A 1NKEA 1Q8IA 3L3UA 2OYQA 3SNNA 2ATQA 3CM5A 3O4QA 2BE2A 4FJGA 1W0HA 1NOZA 3DOKA 1ZBUA 4RW7A 1L3TA 2QXFA 4CEOA 2IGIA 2E4LA 1XI1A 1RT6A 3K58A 4DS4A 5HLFA 4M3WA 4OJRA 4CHQA 1VSLA 2VWKA 2E6MA 3WNHA 4DU1A 3LZJA 4CGDA 3RMDA 3RMBA 4CJRA 5I42A 1NK0A 3BGRA 4DFPA 4CF2A 4DQRA 4AILC 3QERA 4E7IA 4NCGA 4CGFA 3IG1A 4FLUA 2HVIA 4BDPA 1QQCA 3HL8A 3NDKA 4EP4A 4W5NA 3QIOA 3HPGA 1HPZA 1TL1A 3VQ6A 1BGXT 1DTTA 3V9WA 1NK8A 4K8ZA 5SZTA 5KGXA 4CEEA 3KLIA 3KLEA 2G8VA 3QEIA 4N41A 1RTIA 5J2PA 3LAKA 1EETA 3NGZA 1IKWA 2VG5A 4DG1A 3HK2A 1UAXA 2FBTA 3MAQA 3PX0A 4KHUA 3THVA 1VRTA 4Y1CA 4FJMA 4KTWA 4CIGA 1HQUA 2I5JA 4CF0A 2XY7A 1LWFA 4DLGA 5CYMA 4Z0UA 3OS0A 3OYAA 4DTMA 1U49A 1KLMA 4NYNA 4BACA 3MECA 1UA0A 3HXMA 3K57A 3EYZA 1CZ9A 3DI6A 2A1SA 3F73A 2X78A 1EXQA 4RW4A 3OYLA 3NF6A 4CEAA 2HHQA 1FXXA 2OPPA 4KB0A 2EHGA 1KRPA 1D9FA 3S9HA 2B4JA 2Z1GA 4O0IA 4DF4A 1HRHA 1TL3A 3TAPA 1KSPA 3TAFA 4E7HA 3DMJA 2W42A 3ZT1A 3NF8A 3O4NA 2YHBA 4CJSA 3ZT3A 2KZMA 2YNIA 3AVAA 1SV5A 1X1PA 4FXDA 5FRNA 1TGOA 4I7FA 5T7BA 2IS3A 4GVMA 3DOLA 1T03A 5D3GA 2X6SA 3AVKA 4FW1A 1KCFA 4M3TA 4FZZA 3D0PA 3K5LA 3ZT4A 4KHNA 3E01A 2Z1IA 3VQDA 5J2NA 4W5RA 2XY6A 4KV8A 2EX3A 3PX6A 3TAQA 2B5JA 3VA0A 1LV5A 1J5OA 3SQ4A 4ELUA 3G10A 1U47A 4Z4IA 4DSJA 3B6OA 3LP2A 3CFRA 1XHZA 1UOCA 3LPTA 2B6AA 4DSLA 4KB1A 4B3OA 4CGHA 1SL1A 2ZD1A 2G8WA 2RN2A 1RCHA 1TKZA 4KPYA 1RTJA 4CK1A 4DTXA 3RRHA 1S1WA 4AHTA 4HUEA 4QAGA 4OVLA 3LP3A 1C6VA 4CECA 5C42A 1WSIA 3LWLA 3S3NA 2G8KA 1BCMA 4CHZA 4E19A 1REVA 4IFVA 4OLAA 3NF7A 4BDZA 3DYAA 4CHOA 1WSHA 4DWIA 1YTUA 1RBUA 3G0ZA 3M8RA 3VQ7A 3C6UA 1JLGA 3SV4A 2HHUA 4KHYA 4CERA 3C6TA 1RBTA 4O4GA 5C25A 1FK9A 2PY5A 1UWBA 2YV0X 4B9SA 3KTQA 3NGYA 4CFDA 4DS5A 1MU2A 2O4GA 3U3YA 3P5JA 1WLJA 4DMNA 3VQCA 1S6PA 1FKOA 1KVBA 4CJUA 3V1OA 3C95A 5HRSA 3ZSWA 3OYEA 3QEWA 4MFBA 3LALA 3AVMA 2YKMA 4BDYA 4M3ZA 1NKBA 1ASWA 1SUQA 2RF2A 2F8TA 3AVLA 3AVNA 5I3UA 3HT3A 4CK3A 1N5YA 1NJYA 1YT3A 1SKRA 2RKIA 2HW3A 4FVMA 3HM9A 3QINA 2D0CA 1IG9A 3T3FA 4DTSA 5HBMA 1T7PA 3RR8A 4DU4A 4KO0A 4N56A 4W5TA 1L3UA 1EX4A 4DQSA 4F8RA 2QK9A 5KRTA 3VQPA 4GW6A 4FLWA 3KD5E 1BHLA 1TAQA 1JLBA 2HHXA 3B6PA 3QEVA 4JRQA 5C24A 4KHSA 3DLGA 1IKXA 3QO9A 2RPIA 3WNFA 3KIOA 2DY4A 2KFNA 3MXJA 3KK1A 3K59A 3PO4A 3OJUA 4OPKA 3O3HA 3PY8A 1RT2A 1HQEA 1B9DA 3WNEA 2KFZA 1FKPA 4E7KA 5E41A 1SKSA 1WSEA 1RT7A 3HP6A 2VWJA 5CY4A 1NJWA 3U6FA 4IKFA 3I0SA 4KHQA 3HPHA 2NUBA 4OGCA 4J2EA 3AVBA 3QETA 3U3GA 2IC3A 4H8KA 2D0BA 4I2PA 1NKCA 4FCYA 2IAJA 4N5SA 2QKBA 4FLTA 3AO5A 4Y1DA 2HMIA 3QESA 1RTDA 4BWMA 1X9SA 4CFBA 1G15A 4CEBA 2YKNA 3AO1A 3ZT2A 4LY7A 3CQ8A 4FJLA 4N76A 1U48A 1RDCA 3DLRA 2BGGA 2BDPA 2F8SA 1WSGA 4AH9A 4ELVA 4CJKA 4IG3A 3CFOA 1JLFA 2G8HA 1Z25A 1CLQA 4DTNA 4PY5A 4CEZA 1HNIA 4ZHRA 3OYGA 3L8BA 3RR7A 3ITHA 5HRRA 3SZ2A 1BIUA 2AJQA 4DTOA 4KHWA 4FM1A 3O3GA 3AVFA 1WSJA 3SPYA 2GBZA 3DLEA 5JS1A 4I9LA 4PA1A 1HYZA 4M3UA 3QEXA 2G8UA 3L2RA 4DTPA 4CIFA 4NYFA 3VQQA 3L2VA 3QNNA 1B92A 3V4IA 1L3SA 1QTMA 2JGUA 5J2MA 2P5GA 4FJ7A 3RMAA 1N6QA 4C8LA 3NGIA 5CZ2A 3HPOA 1U4BA 3V1QA 1DLOA 1IKYA 4OPJA 3KLFA 2LSNA 4C8NA 1J54A 3OYJA 5HROA 3SPZA 4CGJA 4F4KA 5CZ1A 1C1AA 2OZSA 3HJFA 1EP4A 4CESA 4KI6A 3TABA 3VQ5A 2KZZA 3QEPA 2PYLA 3K5NA 1I39A 3PO5A 3K2PA 4CCHA 1LW2A 4LH5A 1TK5A 1QSYA 3V81A 4GMJB 1QSSA 1SL0A 1YVUA 1Z26A 1IO2A 4AHUA 3KLGA 4JRPA 2DFHA 4CJLA 3VQAA 4KAZA 3A2FA 3HO1A 1S1UA 1GOBA 2A1RA 4IBNA 2YHAA 3OYFA 3AA2A 4ICLA 2Y1JA 1U45A 1A5WA 1C0UA 1QSLA 3L2WA 4HHTA 4KTQA 4C8KA 4ID5A 4E0DA 1ZBFA 2HHWA 1XHXA 4FK0A 3AA5X 4JS4A 3F9KA 3AVHA 1KVCA 4CF1A 4FJ9A 4JLHA 3V6DA 4B9VA 4O44A 4CJTA 5HP1A 2XY8A 2Q3SA 3L2QA 3DM2A 4OLBA 4CJQA 1VRUA 2ITGA 3L2UA 4HUFA 1YTAA 3SUNA 1VSFA 3RWUA 5KGWA 4FK4A 4NCBA 3SUQA 1X9MA 2HB5A 2X6NA 3S3MA 2KW4A 4ID1A 2P5OA 1WNSA 3KKSA 3T1AA 1NJZA 4DTJA 5HRPA 3OY9A 3ASMA 4IG0A 3OYKA 4BE0A 1R0AA 1ZBHA 2ZQBA 3DRSA 2YNGA 3NH1A 1VSMA 2P51A 3P83D 3M8PA 3HVRA 1QE1A 4B8AB 4DTRA 4CHYA 3IAYA 4O55A 2GV9A 1GOAA 1L5UA 4EZ9A 3DRPA 3HP9A 3SUOA 3NFAA 1C0MA 3CYMA 4M41A 4FZXC 4L8RB 4DQPA 3VQ8A 1KFSA 1KFDA 3AVJA 3V9ZA 3DLBA 2X74A 1S1VA 4DLEA 1D9DA 4E1MA 4ZTJA 3ZSQA 1S6QA 4E1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTH A;  4Q0B A;  3IS9 A;  1J53 A;  1RDA A;  1WSF A;  4HTU A;  1TKT A;  3AO4 A;  3MED A;  4DSE A;  1RBR A;  2OZM A;  4KI4 A;  4CGI A;  3LP0 A;  1WN7 A;  2BAN A;  3V9X A;  3SYZ A;  4FJK A;  1VSE A;  3OYI A;  1NJX A;  3NE6 A;  5CYQ A;  1NK5 A;  4F3O A;  1U04 A;  2OPR A;  2IOC A;  4N47 A;  3KJV A;  2PYJ A;  4KFB A;  4AHS A;  3M8S A;  3SI6 A;  4QCL A;  4TSX A;  3S3O A;  1S9E A;  2ETJ A;  1RNH A;  4CJ3 A;  4JS5 A;  1VSD A;  3NHG A;  4NCA A;  1L3V A;  3VN5 A;  1BI4 B;  1S1X A;  2Y1I A;  5DMR A;  4MQ3 A;  3LDS A;  4CED A;  3TAE A;  4J2A A;  3L3V A;  1JL1 A;  1UA1 A;  3O3F A;  1T05 A;  1Q9X A;  1CZB A;  2ZE2 A;  3CFP A;  1BQM A;  1RIL A;  1S1T A;  3ZT0 A;  1C1C A;  4CJV A;  2R7Y A;  4DF8 A;  4DSI A;  4M3Y A;  2VG7 A;  2WON A;  3OYH A;  3TI0 A;  1ZBI A;  3OYD A;  3RRG A;  3AA4 A;  2YNF A;  3AO2 A;  1JXB A;  3KK3 A;  4CGG A;  3SQ0 A;  5SWM A;  3AV9 A;  5JS2 A;  4PWD A;  2GUI A;  3SQ2 A;  1RBV A;  3PV8 A;  1C1B A;  1C0T A;  3BDP A;  5J1E A;  1T8E A;  4RG8 A;  5KI6 A;  3ZSR A;  4FK2 A;  1NK6 A;  2Z1J A;  3M8Q A;  3ZCM A;  4K8X A;  1O1W A;  4LD0 A;  2KQ2 A;  3NH0 A;  4M45 A;  4CHN A;  1BI4 A;  4HUG A;  3KD1 E;  4Q5V A;  1S9G A;  2FBY A;  4E89 A;  3IRX A;  4FLY A;  2HND A;  4BWJ A;  1BQN A;  4DFM A;  3RTV A;  3MEE A;  3NH2 A;  5J2Q A;  4HCB A;  3SQ1 A;  3OJS A;  2Z1H A;  4B08 A;  2E6L A;  4EZ6 A;  2KTQ A;  1J9A A;  3QIP A;  4FJN A;  4Z4E A;  1QHT A;  2XO7 A;  4CEF A;  2OPS A;  2IDO A;  3AA3 A;  1RT3 A;  1KLN A;  4Z4G A;  1JL2 A;  3MEG A;  3C94 A;  3ZSZ A;  1NK7 A;  4FJJ A;  1KTQ A;  3OYN A;  4OKE A;  1A5V A;  1JLQ A;  3I0R A;  4B9M A;  4CIE A;  1KVA A;  3DLH A;  4DSF A;  5FDL A;  4DQI A;  3NBP A;  4IDK A;  4M3R A;  2PZS A;  2DFF A;  4CJP A;  1CXU A;  4BE2 A;  3AVC A;  2G8F A;  2FBX A;  4B9U A;  3RMC A;  1LAV A;  4E3S A;  4KKO A;  4IFY A;  3LAM A;  3LP1 A;  3PUF A;  4UQG A;  3OYB A;  1BL3 A;  1LAW A;  3VQB A;  4R5P A;  4J2B A;  5K14 A;  1WAJ A;  3DRR A;  4CJF A;  2OPQ A;  2YNH A;  4M3X A;  1D8Y A;  3CG7 A;  4B9L A;  4HCC A;  2G8I A;  1F21 A;  1TV6 A;  1WAF A;  1CXQ A;  1RDB A;  3I8D A;  2FBV A;  4FM2 A;  4WE1 A;  2HHS A;  3JSM A;  3TAR A;  4FW2 A;  1GOC A;  4AHC A;  1B9F A;  2VG6 A;  3V1R A;  3NCI A;  3TAN A;  1BCO A;  3UIQ A;  3TAM A;  4F3T A;  4W5Q A;  4KRF A;  3ZSO A;  3ISN C;  4LH4 A;  3LPU A;  4E7L A;  3QLH A;  1A5X A;  4DTU A;  3MXI A;  4KRE A;  1LWE A;  4FZY A;  1HYV A;  4B8C A;  3VQ4 A;  1RT1 A;  1TAU A;  1Y97 A;  3FFI A;  3NF9 A;  3SUP A;  4F2S A;  3OS1 A;  3NAE A;  4B9N A;  3VA3 A;  4DU3 A;  4CJW A;  4HVJ A;  3PX4 A;  1VSJ A;  1JLA A;  3HST B;  4W5O A;  1ZBL A;  2HNZ A;  2HNY A;  1K6Y A;  3K5M A;  5KTQ A;  3P1G A;  1I3A A;  1RBS A;  1VK0 A;  3AVI A;  4FJ5 A;  1VSK A;  4Z4H A;  4AHR A;  3EZ5 A;  3K5O A;  2XHB A;  3TWH A;  3TAG A;  3SCX A;  4M42 A;  1EKE A;  4CK2 A;  2D5R A;  1ASU A;  3VQ9 A;  1D5A A;  4CHP A;  3SJJ A;  1TVR A;  3MXM A;  4CF8 A;  3D45 A;  4OKK A;  4Z4F A;  2HHV A;  1HJR A;  1IKV A;  4FLZ A;  2DTU A;  1LWC A;  2D0A A;  4RW6 A;  4CF9 A;  2XRI A;  4ELT A;  1TKX A;  3LZI A;  4FYD A;  3QNO A;  4CFA A;  2O4I A;  4LSN A;  3HVT A;  4BE1 A;  3AO3 A;  2HHT A;  1RDD A;  3H08 A;  4FLX A;  1TK8 A;  1NK4 A;  1IH7 A;  4LSL A;  3ZSV A;  1ITG A;  4I9Q A;  3VQE A;  1JLC A;  4ZTF A;  1NOY A;  2P1J A;  2JLE A;  4RW8 A;  4EP5 A;  4DSK A;  4FJX A;  4Z4C A;  4DFJ A;  3V9U A;  3TR8 A;  4PQU A;  1RT4 A;  3ZSY A;  4FM0 A;  1TK0 A;  4OKJ A;  1BIZ A;  4CJ4 A;  1DTQ A;  3LAN A;  4O5B A;  3HYF A;  3KLH A;  5HRN A;  4FLV A;  3ALY A;  1NK9 A;  4E7J A;  4FJH A;  4I2Q A;  1JLE A;  3EY1 A;  2XY5 A;  2WOM A;  4C8O A;  1ZYQ A;  4PUO A;  2FC0 A;  4KTZ A;  1W9H A;  5FRM A;  4CJ5 A;  5KRS A;  4YFU A;  4CEQ A;  1HMV A;  3LWM A;  1QS4 A;  3AVG A;  2OA8 A;  4O0J A;  1ASV A;  4CJE A;  1JXE A;  4DQQ A;  1TKD A;  4FJI A;  3CM6 A;  1S5J A;  4B9T A;  4AHV A;  1SKW A;  3WNG A;  1SL2 A;  3OVN A;  1Q9Y A;  3T19 A;  4H4O A;  1HNV A;  5EU7 A;  5FRO A;  1BIS A;  2F96 A;  3ZSX A;  3SV3 A;  4DFK A;  4RW9 A;  4YNQ A;  4CFC A;  3JYT A;  4F2R A;  4OGE A;  2HVH A;  1VSH A;  4FJ8 A;  3OYC A;  4QOZ B;  4H4M A;  1XWL A;  1X9W A;  3KKR A;  1HYS A;  3DLK A;  5DK5 A;  3OYM A;  3KK2 A;  4CE9 A;  4XIU A;  4J2D A;  3V9S A;  2QKK A;  3OS2 A;  1LW0 A;  3ULD A;  1RT5 A;  1JKH A;  2DFE A;  4G1Q A;  1VSI A;  4C8M A;  1XC9 A;  1NKE A;  1Q8I A;  3L3U A;  2OYQ A;  3SNN A;  2ATQ A;  3CM5 A;  3O4Q A;  2BE2 A;  4FJG A;  1W0H A;  1NOZ A;  3DOK A;  1ZBU A;  4RW7 A;  1L3T A;  2QXF A;  4CEO A;  2IGI A;  2E4L A;  1XI1 A;  1RT6 A;  3K58 A;  4DS4 A;  5HLF A;  4M3W A;  4OJR A;  4CHQ A;  1VSL A;  2VWK A;  2E6M A;  3WNH A;  4DU1 A;  3LZJ A;  4CGD A;  3RMD A;  3RMB A;  4CJR A;  5I42 A;  1NK0 A;  3BGR A;  4DFP A;  4CF2 A;  4DQR A;  4AIL C;  3QER A;  4E7I A;  4NCG A;  4CGF A;  3IG1 A;  4FLU A;  2HVI A;  4BDP A;  1QQC A;  3HL8 A;  3NDK A;  4EP4 A;  4W5N A;  3QIO A;  3HPG A;  1HPZ A;  1TL1 A;  3VQ6 A;  1BGX T;  1DTT A;  3V9W A;  1NK8 A;  4K8Z A;  5SZT A;  5KGX A;  4CEE A;  3KLI A;  3KLE A;  2G8V A;  3QEI A;  4N41 A;  1RTI A;  5J2P A;  3LAK A;  1EET A;  3NGZ A;  1IKW A;  2VG5 A;  4DG1 A;  3HK2 A;  1UAX A;  2FBT A;  3MAQ A;  3PX0 A;  4KHU A;  3THV A;  1VRT A;  4Y1C A;  4FJM A;  4KTW A;  4CIG A;  1HQU A;  2I5J A;  4CF0 A;  2XY7 A;  1LWF A;  4DLG A;  5CYM A;  4Z0U A;  3OS0 A;  3OYA A;  4DTM A;  1U49 A;  1KLM A;  4NYN A;  4BAC A;  3MEC A;  1UA0 A;  3HXM A;  3K57 A;  3EYZ A;  1CZ9 A;  3DI6 A;  2A1S A;  3F73 A;  2X78 A;  1EXQ A;  4RW4 A;  3OYL A;  3NF6 A;  4CEA A;  2HHQ A;  1FXX A;  2OPP A;  4KB0 A;  2EHG A;  1KRP A;  1D9F A;  3S9H A;  2B4J A;  2Z1G A;  4O0I A;  4DF4 A;  1HRH A;  1TL3 A;  3TAP A;  1KSP A;  3TAF A;  4E7H A;  3DMJ A;  2W42 A;  3ZT1 A;  3NF8 A;  3O4N A;  2YHB A;  4CJS A;  3ZT3 A;  2KZM A;  2YNI A;  3AVA A;  1SV5 A;  1X1P A;  4FXD A;  5FRN A;  1TGO A;  4I7F A;  5T7B A;  2IS3 A;  4GVM A;  3DOL A;  1T03 A;  5D3G A;  2X6S A;  3AVK A;  4FW1 A;  1KCF A;  4M3T A;  4FZZ A;  3D0P A;  3K5L A;  3ZT4 A;  4KHN A;  3E01 A;  2Z1I A;  3VQD A;  5J2N A;  4W5R A;  2XY6 A;  4KV8 A;  2EX3 A;  3PX6 A;  3TAQ A;  2B5J A;  3VA0 A;  1LV5 A;  1J5O A;  3SQ4 A;  4ELU A;  3G10 A;  1U47 A;  4Z4I A;  4DSJ A;  3B6O A;  3LP2 A;  3CFR A;  1XHZ A;  1UOC A;  3LPT A;  2B6A A;  4DSL A;  4KB1 A;  4B3O A;  4CGH A;  1SL1 A;  2ZD1 A;  2G8W A;  2RN2 A;  1RCH A;  1TKZ A;  4KPY A;  1RTJ A;  4CK1 A;  4DTX A;  3RRH A;  1S1W A;  4AHT A;  4HUE A;  4QAG A;  4OVL A;  3LP3 A;  1C6V A;  4CEC A;  5C42 A;  1WSI A;  3LWL A;  3S3N A;  2G8K A;  1BCM A;  4CHZ A;  4E19 A;  1REV A;  4IFV A;  4OLA A;  3NF7 A;  4BDZ A;  3DYA A;  4CHO A;  1WSH A;  4DWI A;  1YTU A;  1RBU A;  3G0Z A;  3M8R A;  3VQ7 A;  3C6U A;  1JLG A;  3SV4 A;  2HHU A;  4KHY A;  4CER A;  3C6T A;  1RBT A;  4O4G A;  5C25 A;  1FK9 A;  2PY5 A;  1UWB A;  2YV0 X;  4B9S A;  3KTQ A;  3NGY A;  4CFD A;  4DS5 A;  1MU2 A;  2O4G A;  3U3Y A;  3P5J A;  1WLJ A;  4DMN A;  3VQC A;  1S6P A;  1FKO A;  1KVB A;  4CJU A;  3V1O A;  3C95 A;  5HRS A;  3ZSW A;  3OYE A;  3QEW A;  4MFB A;  3LAL A;  3AVM A;  2YKM A;  4BDY A;  4M3Z A;  1NKB A;  1ASW A;  1SUQ A;  2RF2 A;  2F8T A;  3AVL A;  3AVN A;  5I3U A;  3HT3 A;  4CK3 A;  1N5Y A;  1NJY A;  1YT3 A;  1SKR A;  2RKI A;  2HW3 A;  4FVM A;  3HM9 A;  3QIN A;  2D0C A;  1IG9 A;  3T3F A;  4DTS A;  5HBM A;  1T7P A;  3RR8 A;  4DU4 A;  4KO0 A;  4N56 A;  4W5T A;  1L3U A;  1EX4 A;  4DQS A;  4F8R A;  2QK9 A;  5KRT A;  3VQP A;  4GW6 A;  4FLW A;  3KD5 E;  1BHL A;  1TAQ A;  1JLB A;  2HHX A;  3B6P A;  3QEV A;  4JRQ A;  5C24 A;  4KHS A;  3DLG A;  1IKX A;  3QO9 A;  2RPI A;  3WNF A;  3KIO A;  2DY4 A;  2KFN A;  3MXJ A;  3KK1 A;  3K59 A;  3PO4 A;  3OJU A;  4OPK A;  3O3H A;  3PY8 A;  1RT2 A;  1HQE A;  1B9D A;  3WNE A;  2KFZ A;  1FKP A;  4E7K A;  5E41 A;  1SKS A;  1WSE A;  1RT7 A;  3HP6 A;  2VWJ A;  5CY4 A;  1NJW A;  3U6F A;  4IKF A;  3I0S A;  4KHQ A;  3HPH A;  2NUB A;  4OGC A;  4J2E A;  3AVB A;  3QET A;  3U3G A;  2IC3 A;  4H8K A;  2D0B A;  4I2P A;  1NKC A;  4FCY A;  2IAJ A;  4N5S A;  2QKB A;  4FLT A;  3AO5 A;  4Y1D A;  2HMI A;  3QES A;  1RTD A;  4BWM A;  1X9S A;  4CFB A;  1G15 A;  4CEB A;  2YKN A;  3AO1 A;  3ZT2 A;  4LY7 A;  3CQ8 A;  4FJL A;  4N76 A;  1U48 A;  1RDC A;  3DLR A;  2BGG A;  2BDP A;  2F8S A;  1WSG A;  4AH9 A;  4ELV A;  4CJK A;  4IG3 A;  3CFO A;  1JLF A;  2G8H A;  1Z25 A;  1CLQ A;  4DTN A;  4PY5 A;  4CEZ A;  1HNI A;  4ZHR A;  3OYG A;  3L8B A;  3RR7 A;  3ITH A;  5HRR A;  3SZ2 A;  1BIU A;  2AJQ A;  4DTO A;  4KHW A;  4FM1 A;  3O3G A;  3AVF A;  1WSJ A;  3SPY A;  2GBZ A;  3DLE A;  5JS1 A;  4I9L A;  4PA1 A;  1HYZ A;  4M3U A;  3QEX A;  2G8U A;  3L2R A;  4DTP A;  4CIF A;  4NYF A;  3VQQ A;  3L2V A;  3QNN A;  1B92 A;  3V4I A;  1L3S A;  1QTM A;  2JGU A;  5J2M A;  2P5G A;  4FJ7 A;  3RMA A;  1N6Q A;  4C8L A;  3NGI A;  5CZ2 A;  3HPO A;  1U4B A;  3V1Q A;  1DLO A;  1IKY A;  4OPJ A;  3KLF A;  2LSN A;  4C8N A;  1J54 A;  3OYJ A;  5HRO A;  3SPZ A;  4CGJ A;  4F4K A;  5CZ1 A;  1C1A A;  2OZS A;  3HJF A;  1EP4 A;  4CES A;  4KI6 A;  3TAB A;  3VQ5 A;  2KZZ A;  3QEP A;  2PYL A;  3K5N A;  1I39 A;  3PO5 A;  3K2P A;  4CCH A;  1LW2 A;  4LH5 A;  1TK5 A;  1QSY A;  3V81 A;  4GMJ B;  1QSS A;  1SL0 A;  1YVU A;  1Z26 A;  1IO2 A;  4AHU A;  3KLG A;  4JRP A;  2DFH A;  4CJL A;  3VQA A;  4KAZ A;  3A2F A;  3HO1 A;  1S1U A;  1GOB A;  2A1R A;  4IBN A;  2YHA A;  3OYF A;  3AA2 A;  4ICL A;  2Y1J A;  1U45 A;  1A5W A;  1C0U A;  1QSL A;  3L2W A;  4HHT A;  4KTQ A;  4C8K A;  4ID5 A;  4E0D A;  1ZBF A;  2HHW A;  1XHX A;  4FK0 A;  3AA5 X;  4JS4 A;  3F9K A;  3AVH A;  1KVC A;  4CF1 A;  4FJ9 A;  4JLH A;  3V6D A;  4B9V A;  4O44 A;  4CJT A;  5HP1 A;  2XY8 A;  2Q3S A;  3L2Q A;  3DM2 A;  4OLB A;  4CJQ A;  1VRU A;  2ITG A;  3L2U A;  4HUF A;  1YTA A;  3SUN A;  1VSF A;  3RWU A;  5KGW A;  4FK4 A;  4NCB A;  3SUQ A;  1X9M A;  2HB5 A;  2X6N A;  3S3M A;  2KW4 A;  4ID1 A;  2P5O A;  1WNS A;  3KKS A;  3T1A A;  1NJZ A;  4DTJ A;  5HRP A;  3OY9 A;  3ASM A;  4IG0 A;  3OYK A;  4BE0 A;  1R0A A;  1ZBH A;  2ZQB A;  3DRS A;  2YNG A;  3NH1 A;  1VSM A;  2P51 A;  3P83 D;  3M8P A;  3HVR A;  1QE1 A;  4B8A B;  4DTR A;  4CHY A;  3IAY A;  4O55 A;  2GV9 A;  1GOA A;  1L5U A;  4EZ9 A;  3DRP A;  3HP9 A;  3SUO A;  3NFA A;  1C0M A;  3CYM A;  4M41 A;  4FZX C;  4L8R B;  4DQP A;  3VQ8 A;  1KFS A;  1KFD A;  3AVJ A;  3V9Z A;  3DLB A;  2X74 A;  1S1V A;  4DLE A;  1D9D A;  4E1M A;  4ZTJ A;  3ZSQ A;  1S6Q A;  4E1N A; 
#chains in the Genus database with same CATH topology
 1LOT B;  1WSF A;  2OZM A;  1TKT A;  1NBW A;  3U4L A;  3C65 A;  5E26 A;  3LP0 A;  1IBM K;  2BAN A;  4H0V B;  2O8E B;  3DJC A;  1NK5 A;  1D4X A;  3K9J A;  4F3O A;  3NMU A;  3M8S A;  3SI6 A;  3S3O A;  2F7T A;  1NGD A;  3H45 C;  3ATU A;  4MQ3 A;  3LDS A;  4J2A A;  3C6A A;  3L3V A;  1UA1 A;  3O3F A;  3GDQ A;  1CZB A;  3ZT0 A;  5M1P A;  2R7Y A;  1NGI A;  3TI0 A;  4NO7 A;  2YNF A;  3AO2 A;  1JXB A;  2O8E A;  1SZ2 A;  4CGG A;  2O8D B;  1GLA G;  3AV9 A;  1NGA A;  3SQ2 A;  3J7A P;  1NK6 A;  3QBX A;  4K8X A;  4LD0 A;  2KQ2 A;  4BGB A;  1YIT N;  2P9S B;  3A5M C;  4CHN A;  1S9G A;  4E89 A;  4OPH A;  4CZI A;  1BQN A;  3NH2 A;  4DUY K;  3OJS A;  2Z1H A;  3PSF A;  3VGM A;  4BR9 A;  3MX5 A;  3MWP A;  4CEF A;  2O8D A;  1JL2 A;  3MEG A;  4FJJ A;  3GBT A;  3DLH A;  4BRE A;  3RMC A;  2P9S A;  3U9D A;  4KKO A;  3TTF A;  4IFY A;  5C0Y A;  4UQG A;  3QML A;  4JK8 A;  5EX5 A;  4R5P A;  4J2B A;  3MN6 A;  3DRR A;  3L4Q A;  4M3X A;  1D8Y A;  2G8I A;  4B9L A;  1WAF A;  4FWM A;  2FBV A;  2UU9 K;  4FW2 A;  1GOC A;  3BZC A;  4A57 A;  4F3T A;  4KRF A;  3ZSO A;  1QZ6 A;  4LH4 A;  4KRE A;  4DTU A;  1K9M O;  5LY3 A;  2CGL A;  3FZF A;  2VGN A;  3VQ4 A;  1IV0 A;  3NAE A;  3D7E O;  1JLA A;  1ZBL A;  2HNY A;  1SS6 A;  4CZK A;  5KTQ A;  4LF9 K;  3P1G A;  3F2K A;  1I3A A;  3AVI A;  1XC3 A;  5CE3 A;  2DPN A;  4CHP A;  5JIC A;  3SJJ A;  1YJ9 N;  4CF8 A;  4Z4F A;  5GAG P;  1IKV A;  4FLZ A;  2FSJ A;  1LWC A;  2D0A A;  3OBW A;  4ELT A;  2O4I A;  2VQE K;  3AO3 A;  3H08 A;  4FLX A;  4AM6 A;  1TK8 A;  1NK4 A;  4LSL A;  3ZSV A;  1ITG A;  2GUP A;  4I6M B;  2OAN A;  2UYT A;  3VQE A;  3I56 N;  4KH5 A;  1NOY A;  2JLE A;  4RW8 A;  3AGK A;  4A2B A;  4DSK A;  4DV2 K;  4Z4C A;  1RT4 A;  4CZJ A;  4OKJ A;  2Q2R A;  1DTQ A;  4F9O A;  3WT0 A;  4BG9 A;  4JI7 K;  3MK6 A;  1XNQ K;  4FJH A;  4I2Q A;  5CHI A;  2WOM A;  3TPQ A;  4YOR A;  4CJ5 A;  3QIC A;  4LFA K;  4EHU A;  3D6R A;  3LWM A;  2RHK A;  1QS4 A;  3AVG A;  2OA8 A;  4DQQ A;  5AZI B;  4I6M A;  1TKD A;  2E8A A;  4H4O A;  4YNQ A;  4PKG A;  3QFU A;  3OYM A;  5ADX H;  4XIU A;  4J2D A;  1RT5 A;  3FLC O;  4C23 A;  2ATQ A;  1GLL O;  3BUZ B;  2I7P A;  1ZBU A;  4B9T A;  4CEO A;  2IGI A;  1NLV A;  5AZI A;  5HLF A;  2CGK A;  2VWK A;  4DU1 A;  3LZJ A;  3RMD A;  1BDG A;  1HNW K;  2E2O A;  4CF2 A;  3D2E B;  4E7I A;  3M6G A;  4CGF A;  2HVI A;  4H0O A;  4BDP A;  4EP4 A;  3QIO A;  1HPZ A;  3VQ6 A;  4DV7 K;  1K8A O;  4BC3 A;  1HNX K;  5KGX A;  2V7Z A;  1RTI A;  4MO4 A;  2VG5 A;  4DG1 A;  3MAQ A;  3PX0 A;  3VOV A;  3WXK A;  4CF0 A;  4CBW A;  4Z0U A;  3OYA A;  1KAX A;  3VPZ A;  3U8X A;  5JLH A;  3J81 O;  4BAC A;  2NRX A;  2OTL N;  4O8U A;  3PSI A;  3K57 A;  3EE9 A;  4RW4 A;  3KWI A;  1HX1 A;  4UY8 O;  4AM7 A;  3NF6 A;  4LF7 K;  3S9H A;  1KSP A;  1HRH A;  4CW7 B;  3DMJ A;  4E7H A;  4DV4 K;  3DAW A;  5BPN A;  3AVA A;  3CJC A;  5LJV A;  3AY9 A;  4RCH A;  1T6D A;  4MDB A;  2NRW A;  2X6S A;  2BTF A;  3D0P A;  3ZT4 A;  4KHN A;  5FPD A;  3ENO A;  1QVG M;  5EY4 A;  3B6O A;  3LPT A;  2HBK A;  2G8W A;  4IEE A;  4KPY A;  1TKZ A;  3E1Y A;  5KPR A;  4CK1 A;  4DTX A;  4B3S K;  4HTL A;  3CPW M;  4A5A A;  4AHT A;  4HUE A;  4BVP A;  1C6V A;  2G8K A;  3FZK A;  4GKJ K;  4E19 A;  4OLA A;  4BDZ A;  1T6C A;  4WFN L;  5AFU A;  4DWI A;  1VHX A;  5M1N A;  1RBU A;  1XNR K;  3M8R A;  3SAF A;  2UXD K;  2GTD A;  4O4G A;  1RBT A;  4YOX A;  1VQ4 N;  1UWB A;  4B9S A;  3KTQ A;  4CFD A;  1MU2 A;  3ZX0 A;  2D4W A;  3VES A;  4YY3 K;  4MFB A;  1SUQ A;  3AVN A;  4CK3 A;  1YT3 A;  2RKI A;  1FJG K;  4DQ8 A;  1IG9 A;  5HBM A;  4DR6 K;  1EX4 A;  5AQG A;  4F8R A;  1BU6 O;  5KRT A;  3VQP A;  2Q97 A;  3W3D A;  4CBX A;  2HHX A;  3QEV A;  5KQ8 A;  3DLG A;  3CHW A;  3KIO A;  3VF2 A;  1NMN A;  3K59 A;  3OJU A;  3J7Z O;  3PY8 A;  3WNE A;  1FKP A;  1RT7 A;  3HP6 A;  4FWK A;  3FZM A;  5CY4 A;  3VEW A;  4IKF A;  3I0S A;  3CJ7 A;  4KHQ A;  4MLE A;  4J2E A;  3AVB A;  4H5T A;  2NRV A;  4I2P A;  3GE1 A;  4Y1D A;  5EOY A;  4M7Y A;  1X9S A;  4CFB A;  3ZEU B;  4CEB A;  2J4R A;  4BC5 A;  1U48 A;  3DLR A;  2Q36 A;  2FXU A;  2JWL A;  1K73 O;  2F8S A;  3CCJ N;  4AH9 A;  4CJK A;  4IG3 A;  3CFO A;  4CBU A;  4CEZ A;  4ZHR A;  3LDN A;  3ITH A;  3SZ2 A;  3AAP A;  1W7A A;  4DTO A;  4H0Y B;  2ZGZ A;  3O3G A;  3AVF A;  3SPY A;  3CCM N;  4LFB K;  4WFB L;  3VGL A;  4PA1 A;  1WUA A;  2E1Y A;  3ZEU A;  3L2V A;  4JI0 K;  4EIA A;  4JD2 B;  2D0O A;  1QTM A;  3D2F B;  2P5G A;  4FJ7 A;  4WQ5 C;  1DLO A;  1IKY A;  1J54 A;  3HJF A;  4CES A;  4KI6 A;  5F1X A;  1V4S A;  1KXP A;  4LH5 A;  1GLE G;  1Z26 A;  4AHU A;  2NRZ A;  1N33 K;  2DFH A;  4CD1 A;  1ATN A;  4KAZ A;  3OBY A;  4JD2 A;  4IBN A;  2YHA A;  4BY9 C;  1C0U A;  1OVQ A;  2HF3 A;  3CI5 A;  3L2W A;  4HHT A;  1Z6R A;  1E4F T;  4KH6 A;  4C8K A;  4E0D A;  4WQ5 A;  4FK0 A;  1WB9 A;  3FZL A;  4JLH A;  4B3M K;  3L2Q A;  4CJQ A;  1VRU A;  3O9R A;  5AQI A;  4HUF A;  1YTA A;  3RWU A;  3AAR A;  3S3M A;  2KW4 A;  4ID1 A;  4CZM A;  2P5O A;  3KKS A;  3VEX A;  4FOI A;  4DTJ A;  4IG0 A;  5JLF A;  2P51 A;  3M8P A;  4B8A B;  1OH8 A;  3ATV A;  3HM8 A;  1C0M A;  3CYM A;  4FZX C;  4L8R B;  3LDO A;  1E4G T;  5AQP A;  4DB3 A;  5BN8 A;  1KFS A;  3AVJ A;  3T69 A;  3V9Z A;  1ATS A;  1S1V A;  2X74 A;  1IBK K;  1NG9 A;  4CD3 A;  2QWL A;  1S6Q A;  4E1N A;  4ISF A;  3IS9 A;  1VQM N;  3VET A;  3FFK B;  4HTU A;  3O4W A;  4DSE A;  4KI4 A;  4CGI A;  2VYP A;  4BRD A;  3G4S N;  1U04 A;  5E84 A;  2QWR A;  2YJF A;  3C7N B;  5BRE A;  4GKK K;  3SBT A;  2YI1 A;  4JS5 A;  3NHG A;  4NCA A;  1NGH A;  2Y1I A;  5M1Q A;  1YAG A;  1KAY A;  1VQN N;  4DSI A;  1S1T A;  3K0S A;  2WON A;  1YVN A;  3KK3 A;  5AQV A;  5JS2 A;  2GUI A;  3C7N A;  5J1E A;  5KI6 A;  2Z1J A;  1K8K B;  3O9Q A;  2AA4 A;  3KD1 E;  3IRX A;  3Q7C A;  4FLY A;  4DFM A;  1Q82 O;  3RTV A;  3MEE A;  3H46 O;  5J2Q A;  2O8F B;  3SMS A;  4B08 A;  4FPB A;  3QIP A;  4FJN A;  3BF3 A;  2XO7 A;  1X3M A;  2OPS A;  2IDO A;  1KLN A;  1RT3 A;  4Z4G A;  4IWV A;  1A5V A;  1JLQ A;  4A62 A;  4DQI A;  1K8K A;  3NBP A;  4IDK A;  4M3R A;  4CJP A;  2E88 A;  4QS8 A;  2E20 A;  3CC7 N;  4X64 K;  3PUF A;  4O8K A;  3OYB A;  1BOT O;  5K14 A;  1WAJ A;  1O13 A;  2OPQ A;  1NNE A;  3MCP A;  1F21 A;  1CXQ A;  2HHS A;  3TAR A;  1P90 A;  5BN9 A;  1B9F A;  2VG6 A;  3EKS A;  3NCI A;  1KD1 O;  1BCO A;  1HPM A;  3TAM A;  3ISN C;  4E7L A;  3QLH A;  4ILG B;  2P9K B;  3BF1 A;  3K9K A;  1HYV A;  3CC2 N;  3CET A;  5AQQ A;  3VA3 A;  2E2P A;  2OTJ N;  1VSJ A;  2HNZ A;  5MLC Q;  4FJ5 A;  3TWH A;  4K41 A;  3K5O A;  3SCX A;  3VF4 A;  2Q0U A;  4BGA A;  1XMO K;  2A3Z A;  4M42 A;  3C0B A;  1TVR A;  3P39 A;  1TUU A;  1HJR A;  2P9K A;  4RW6 A;  4CF9 A;  3BY5 A;  1GLJ O;  3LZI A;  4FYD A;  1JCF A;  4I9Q A;  1IH7 A;  4GV6 A;  3KK7 A;  2P1J A;  5AQH A;  4EP5 A;  4FJX A;  4FWS A;  4DFJ A;  1NGC A;  4JAX A;  1TK0 A;  1BIZ A;  3C6H A;  5KPZ A;  3H3O B;  3LAN A;  2ZWH A;  4M7X A;  4O5B A;  3HYF A;  1NK9 A;  4BR4 A;  4E7J A;  4JKD A;  4PL7 A;  1JLE A;  3O5B A;  4RWT A;  1ZYQ A;  2HHH K;  4PUO A;  3AGR A;  2IVP A;  5FRM A;  1OH5 A;  4YFU A;  4K25 A;  4O0J A;  1ASV A;  1TUY A;  2FSK A;  4CJE A;  3CM6 A;  1S5J A;  1GLC G;  1SL2 A;  1Q9Y A;  3ZSX A;  1HNV A;  3SV3 A;  4RW9 A;  5A2Q O;  4CFC A;  4H5N A;  4GVE A;  2HVH A;  1VSH A;  4FJ8 A;  4H4M A;  1X9W A;  2NRR A;  3KK2 A;  5AQU A;  3LDP A;  2QKK A;  3KWG A;  1LW0 A;  1JKH A;  1QQO A;  5LMU K;  4G1Q A;  3TSU A;  2OYQ A;  2BE2 A;  4M63 C;  4FJG A;  1NOZ A;  1SAZ A;  3CXC M;  1L3T A;  2E4L A;  4X62 K;  3K58 A;  4OJR A;  4XEI A;  1VSL A;  2E6M A;  2HOE A;  4Y0W A;  4BRI A;  4CGD A;  3R3L A;  4B1Z A;  1NK0 A;  4DFP A;  3OA9 A;  3SAH A;  4ISG A;  4NCG A;  3FZH A;  3VTH A;  4BR7 A;  3HL8 A;  3WQT A;  4BRK A;  1NK8 A;  3MCA B;  3CQX A;  1XUP O;  4CEE A;  3KLE A;  2G8V A;  1WBD A;  4B1X B;  3NGZ A;  1IKW A;  4L3Q A;  1UAX A;  2FBT A;  4MLH A;  2E2N A;  4KHU A;  1VRT A;  4KTW A;  2I5J A;  2W41 A;  3WXM B;  4PKI A;  3SMP A;  5CYM A;  5ADX A;  4DLG A;  4B3R K;  1UA0 A;  3HXM A;  1CZ9 A;  3DI6 A;  2A1S A;  1BO5 O;  4CEA A;  2HHQ A;  1BUP A;  4DR5 K;  4CZH A;  1D9F A;  2P9L B;  2Z1G A;  3HOT A;  4DF4 A;  4JHD B;  1TL3 A;  3TAP A;  2A5X A;  4BRO A;  3PLA A;  1EWQ A;  3NF8 A;  3G71 N;  3ZT3 A;  2KZM A;  2YNI A;  2FSN A;  5T7B A;  1KAZ A;  1JCG A;  1VQ7 N;  2IS3 A;  5AQR A;  3DOL A;  1OH6 A;  5D3G A;  2F4V K;  4FW1 A;  1KCF A;  1RGI A;  2IIR A;  4M3T A;  3VEO A;  3EE8 A;  3O80 A;  3E01 A;  2Z1I A;  3VQD A;  3ID6 A;  3TAQ A;  4Z4I A;  2UUB K;  1J5O A;  4DSJ A;  3R8E A;  1XHZ A;  3CFR A;  4FPA A;  1UOC A;  5F0X A;  2P9L A;  2ZD1 A;  4JHD A;  1RTJ A;  1S1W A;  2CH6 A;  4OVL A;  4CEC A;  1WSI A;  4LF8 K;  3S3N A;  4CHZ A;  4BG8 A;  3NF7 A;  4DR3 K;  3CCQ N;  1JLG A;  1HKB A;  2F9T A;  3VER A;  4CER A;  5GIP A;  3WEE B;  3HBT A;  1FK9 A;  2YV0 X;  2O4G A;  3VQC A;  4B1V A;  1FKO A;  1KVB A;  4FOE A;  5GAE P;  3ZSW A;  3OYE A;  3VEV A;  5DM7 L;  2F8T A;  1NKB A;  1ASW A;  1NMD A;  3AVL A;  3NVM A;  1QQN A;  1N5Y A;  3HM9 A;  3IMX A;  3T3F A;  3M5R A;  1T7P A;  1N8R O;  4KO0 A;  3WEE A;  3UKR B;  1BHL A;  1TAQ A;  2Q31 A;  1IKX A;  3QO9 A;  2RPI A;  4CZE A;  2BH1 A;  2WBN A;  4WF9 L;  1B9D A;  2KFZ A;  3DLL L;  1EQY A;  1SKS A;  1WSE A;  4EAH D;  1NJW A;  3TTC A;  3HTV A;  2HF4 A;  2P9P B;  1Q81 O;  3HPH A;  4OGC A;  1RFQ A;  3QET A;  3UKR A;  3BEX A;  4IFE A;  1NKC A;  2IAJ A;  3R6M A;  2I7N A;  2ASP A;  3AO5 A;  2HMI A;  4LC9 B;  4B3T K;  3WUH A;  2ASM A;  1G15 A;  4GNI A;  2YKN A;  4LY7 A;  3CQ8 A;  4JKC A;  3VMF B;  4NB4 A;  3FE1 A;  3RSE B;  2P9P A;  2G8H A;  3SK3 A;  4PY5 A;  1HNI A;  4YDU C;  2AJQ A;  4FWQ A;  1Q18 A;  4DHY A;  2GBZ A;  3DLE A;  3F9M A;  3D2E A;  5JVG L;  4I9L A;  2EWS A;  3OW2 M;  1HYZ A;  3HSC A;  3QEX A;  4WFA L;  4DTP A;  3VQQ A;  3L6Q A;  1L3S A;  1B92 A;  1X3N A;  4EFH A;  2JGU A;  5J2M A;  3ZX3 A;  3RMA A;  3VEY A;  3CME N;  3DXK B;  3NGI A;  4YOT A;  3HPO A;  3RSE A;  4OPJ A;  2P9U B;  4RTF D;  1BA0 A;  3CCS N;  1C1A A;  2JWK A;  1OVY A;  3VQ5 A;  4IOX A;  3QEP A;  3ZET B;  4CCH A;  2HBJ A;  4BRH A;  3V81 A;  1QSS A;  4DV3 K;  1YVU A;  4YDU A;  1Y64 A;  4FO0 A;  5BPL A;  4DR4 K;  4PHT X;  2A1R A;  4BRN A;  3CJB A;  3AA2 A;  3TU5 A;  1A5W A;  3DXK A;  1QSL A;  2P9U A;  3E9L A;  4FJ9 A;  3V6D A;  4CJT A;  2Q3S A;  3P38 A;  3ZET A;  4CZL A;  3DM2 A;  1HR0 K;  4BRF A;  5C2D A;  5KGW A;  3SUQ A;  1X9M A;  2HB5 A;  4JI2 K;  4O5F A;  1NJZ A;  5HRP A;  3OY9 A;  1ZBH A;  1R0A A;  3DRS A;  1KC8 O;  3E9O A;  2NRT A;  3HVR A;  3OTO K;  5EXW A;  4CI6 A;  4DTR A;  4LFC K;  1GOA A;  1L5U A;  3DRP A;  4M41 A;  2CGJ A;  4DQP A;  3A0I X;  1D9D A;  4A5B A;  3A5L C;  5HL7 L;  1RTH A;  3AO4 A;  1RBR A;  2ZGY A;  4FWP A;  1VSE A;  1NJX A;  3NE6 A;  1BG3 A;  4PKH A;  5GIN A;  3KJV A;  2IOC A;  3H1Q A;  4N47 A;  4QCL A;  4Z94 A;  4TSX A;  5I9E B;  2ETJ A;  1RNH A;  1L3V A;  3VN5 A;  1S1X A;  3EN9 A;  5DMR A;  2ZJP L;  3TAE A;  1JL1 A;  1VQO N;  3N4Q A;  1Q9X A;  1T05 A;  2ZE2 A;  3A5O C;  1ESV A;  4CJV A;  4DF8 A;  3OYD A;  3SQ0 A;  5SWM A;  4PWD A;  1T8E A;  3SAG A;  4RG8 A;  4FK2 A;  2D0P A;  2ASO A;  3DXM B;  3ZCM A;  4M45 A;  1WOQ A;  1CZA N;  5FPN A;  4H5R A;  3VTI A;  2FBY A;  2WC9 A;  5GIO A;  4Q5V A;  2VGM A;  3MN5 A;  2V51 B;  2QI2 A;  3R9P A;  4BR5 A;  4HCB A;  4Z4E A;  1QHT A;  1NK7 A;  3C94 A;  4PL8 A;  1KTQ A;  1VQ8 N;  3OYN A;  3LDQ A;  3THY B;  3DXM A;  5FDL A;  4DSF A;  2PZS A;  2DFF A;  3AVC A;  2FBX A;  1LAV A;  3IFR A;  4E3S A;  3G6E N;  3LAM A;  3LP1 A;  1C0G A;  2KKZ A;  1LAW A;  3VQB A;  4CJF A;  5AQM A;  3VGK A;  1RDB A;  3I8D A;  3JSM A;  2PAV A;  4AHC A;  1HLU A;  3H6E A;  3V1R A;  4BC4 A;  3LM2 A;  4YOV A;  3UIQ A;  3THY A;  4W5Q A;  1IJJ A;  3D2F A;  4A59 A;  3MXI A;  1A5X A;  4FZY A;  4B8C A;  1TAU A;  5KQD A;  3VF6 A;  3OS1 A;  4B9N A;  1NGB A;  3PX4 A;  1T44 A;  3HST B;  3F5T A;  1RBS A;  4DKW A;  4KBO A;  1VSK A;  4Z4H A;  4AHR A;  3EZ5 A;  3TAG A;  2XHB A;  3GL1 A;  4CK2 A;  3CCU N;  1FW6 A;  1D5A A;  3MXM A;  3BZK A;  3D45 A;  2FF3 B;  4OKK A;  3AAQ A;  4IOC L;  5DM6 L;  2DTU A;  3EL2 A;  2XRI A;  3WQU A;  4LF4 K;  4LSN A;  5JMV A;  3HVT A;  4BE1 A;  1RDD A;  3P4I A;  4IJN A;  5AQZ A;  1JLC A;  4ZTF A;  5AR0 A;  4CJ4 A;  4DR2 K;  4H0P A;  4JK9 A;  4FLV A;  3ALY A;  3EY1 A;  5AQW A;  3ZYY X;  4KTZ A;  1W9H A;  5KRS A;  2YHY A;  1HMV A;  2VQF K;  4FJI A;  3O6W A;  3S41 A;  1VQK N;  4K42 A;  3WNG A;  4DFK A;  5EU7 A;  4NCB A;  4H5V A;  4BC2 A;  3JYT A;  5C2F A;  4F2R A;  1VQ9 N;  4H0X B;  3OYC A;  4QOZ B;  1XWL A;  4BRA A;  5DK5 A;  2V52 B;  4CE9 A;  3V9S A;  4H03 B;  3ULD A;  2DFE A;  1XC9 A;  4C8M A;  1HJO A;  1Q8I A;  4IZ9 A;  3L3U A;  3SNN A;  4GY2 B;  4WYB A;  3CM5 A;  4X66 K;  2GWJ A;  1W0H A;  1GLB G;  3ID8 A;  4RW7 A;  1XI1 A;  1RT6 A;  3CCR N;  2QWO A;  4AIL C;  4FVU A;  3IG1 A;  4X65 K;  1S3X A;  3NDK A;  1GLF O;  3E66 A;  3HPG A;  3V9W A;  4BR0 A;  5SZT A;  3KLI A;  3TTD A;  3QEI A;  5BRD A;  5J2P A;  3LAK A;  4C1N K;  5AQF A;  1MWM A;  4ISE A;  5TKY A;  4BRQ A;  4K43 A;  5AQO A;  3THV A;  4BR2 A;  5AQS A;  1LWF A;  1VAZ A;  1KLM A;  3MEC A;  5GAD P;  1Z05 A;  2O8F A;  3FGU A;  5AQN A;  1EXQ A;  2UXB K;  1KRP A;  3QBW A;  2B4J A;  3TAF A;  4C1N I;  2ITM A;  2HST A;  3ZT1 A;  3O4N A;  2YHB A;  4CJS A;  4ILH A;  4EHT A;  1TGO A;  4NXN K;  2W6K A;  1T03 A;  2YHW A;  3PIO L;  3JXU A;  4NXM K;  3MX2 A;  3MDQ A;  4CJ7 A;  5J2N A;  2XY6 A;  4W5R A;  3PX6 A;  4KV8 A;  2EX3 A;  4ELU A;  2B5J A;  3G10 A;  3I55 N;  2BUP A;  3LP2 A;  4DSL A;  4B3O A;  1C0F A;  4CGH A;  1P8Z A;  5C42 A;  3LWL A;  4H0T B;  1BCM A;  1REV A;  2VCP A;  4JKG B;  4IFV A;  2E1Z A;  3MN9 A;  3DYA A;  3ZLJ A;  4CHO A;  1WSH A;  1YTU A;  3VQ7 A;  3C6U A;  3SLC A;  2HHU A;  4KHY A;  3UE5 A;  1VQL N;  5C25 A;  1N34 K;  2PY5 A;  2AP1 A;  4DS5 A;  3P5J A;  1WLJ A;  3O9T A;  4DMN A;  1S72 N;  1S6P A;  3ENH A;  3M1F A;  3V1O A;  3KZB A;  1VQP N;  5HRS A;  2P9N B;  3LAL A;  2YKM A;  4M3Z A;  2RF2 A;  2A42 A;  4JKG A;  1YHQ N;  3HOS A;  2O8B B;  3LM9 A;  3QIN A;  1EO1 A;  4DTS A;  3RR8 A;  4DU4 A;  4N56 A;  4E1J A;  1MDU B;  4FLW A;  3KD5 E;  2E2Q A;  1JLB A;  2KHO A;  4YOW A;  2DY4 A;  4JI1 K;  3WNF A;  2P9N A;  4U67 L;  2KFN A;  3ENB A;  4IJA A;  1X9J A;  1RT2 A;  1HQE A;  2A6A A;  4OO1 J;  5E41 A;  2O8B A;  3WXI A;  2QWN A;  3KHY A;  2RE2 A;  3U6F A;  2PFU A;  2FLO A;  3U3G A;  2IC3 A;  3OHR A;  2QWQ A;  4FCY A;  4MO5 A;  3B8A X;  4BRG A;  3QES A;  1RTD A;  4BWM A;  4QS7 A;  3AO1 A;  4FJL A;  1RDC A;  2D1K A;  1SQK A;  2BDP A;  4A2A A;  4DR1 K;  4ELV A;  5TKW A;  4BVO A;  1QHA A;  1JLF A;  5LJW A;  4IEI A;  3UB5 A;  3O1W A;  3OYG A;  3L8B A;  1YJN N;  4FM1 A;  1WSJ A;  3I8B A;  5JS1 A;  3JAM O;  4M3U A;  2G8U A;  5M1F A;  1HKG A;  1TYQ B;  4NYF A;  4CIF A;  3QNN A;  3V4I A;  4YHH K;  1QZ5 A;  1HKC A;  4C8L A;  5ELZ A;  5CZ2 A;  5BPM A;  4B1Y B;  1J5E K;  1U4B A;  1J6Z A;  3V1Q A;  3KLF A;  2LSN A;  4C8N A;  3SPZ A;  4U7B A;  1EP4 A;  2V7Y A;  3O9S A;  2E5L K;  3T7Z A;  2PYL A;  3K5N A;  2F9W A;  3CER A;  1LW2 A;  4GMJ B;  1SL0 A;  2QEX N;  4JKE A;  5GAH P;  3KLG A;  1R59 O;  4BRM A;  3VQA A;  1TYQ A;  4FWN A;  3HO1 A;  3A2F A;  3E9P A;  2IVN A;  1S1U A;  1GOB A;  2Y1J A;  4ICL A;  4JKH A;  3DWL A;  1XQS C;  1ZBF A;  2HHW A;  4JS4 A;  3LL3 A;  3CPE A;  1U6Z A;  3AVH A;  3F9K A;  1KVC A;  4IO8 A;  4CF1 A;  5IWA K;  4GV3 A;  4B9V A;  4MDA A;  5HP1 A;  5EVZ A;  4OLB A;  3SUN A;  3L2U A;  4FK4 A;  1MA9 B;  4IOA L;  1VSF A;  2CH5 A;  4BQZ A;  1WNS A;  3T1A A;  4BE0 A;  1MWK A;  5BR8 K;  4FWL A;  2YNG A;  3VEN A;  3P83 D;  4NLB A;  1HUX A;  2ZJQ L;  1QE1 A;  2YJE A;  2O8C B;  3IAY A;  4LF6 K;  2GV9 A;  3U9Z A;  5BRF A;  3HP9 A;  3SUO A;  3NFA A;  5C10 A;  5AJ3 K;  3THW B;  4E1M A;  4ZTJ A;  3ZSQ A;  5AQJ A;  4GV9 A;  4Q0B A;  1NU0 A;  1J53 A;  1RDA A;  3MED A;  4JV5 K;  4IDH A;  2NNW A;  1WN7 A;  3V9X A;  4FJK A;  3SYZ A;  3TSP A;  3OYI A;  5CYQ A;  4WCE L;  5IT9 O;  2OPR A;  2PYJ A;  2O8C A;  4KFB A;  4AHS A;  3SJH A;  2ZF5 O;  1S9E A;  4CJ3 A;  2ZM6 K;  1VSD A;  3A8Y A;  1BI4 B;  4HWI A;  3THW A;  4CED A;  5AQT A;  4K0K K;  3CFP A;  1BQM A;  1RIL A;  1C1C A;  4NLC A;  2UUC K;  4M3Y A;  2VG7 A;  3OYH A;  1ZBI A;  3RRG A;  4JI5 K;  3AA4 A;  5H1S Q;  1NJI O;  3O8M A;  1RBV A;  3PV8 A;  1C1B A;  1C0T A;  1RDU A;  3BDP A;  3ZSR A;  3M8Q A;  1O1W A;  3NH0 A;  2ZJR L;  1BI4 A;  4HUG A;  2HND A;  4BWJ A;  3HRG A;  2QW9 A;  1LCU A;  3LDL A;  1ZBS A;  3SQ1 A;  4EZ6 A;  2E6L A;  2KTQ A;  1V4T A;  1J9A A;  1ZC6 A;  3AA3 A;  4WQ4 C;  2QM1 A;  3ZSZ A;  3O9U A;  3TSQ A;  4OKE A;  1EWR A;  3I0R A;  4B9M A;  2QWP A;  2PBD A;  4CIE A;  1KVA A;  1JCE A;  4DUZ K;  4IO9 L;  1CXU A;  4JKA A;  4BE2 A;  2G8F A;  4B9U A;  2FF6 A;  4BQL A;  1BL3 A;  2GWK A;  4DR7 K;  4JKF A;  2YNH A;  2QA4 N;  3CG7 A;  4HCC A;  1TV6 A;  4JKB A;  4FM2 A;  4WE1 A;  1M1K O;  3TAN A;  4KH4 A;  1H1V A;  3CIP A;  4WQ4 A;  4FSV A;  1DKG D;  3LPU A;  2NZT A;  5F2R A;  1LWE A;  1RT1 A;  1Y97 A;  3FFI A;  3NF9 A;  3SUP A;  4F2S A;  5FLX O;  3KVG A;  4DU3 A;  4A61 A;  4CJW A;  4HVJ A;  2VWB A;  4DV5 K;  3QB0 A;  4W5O A;  1K6Y A;  3K5M A;  1VK0 A;  1G99 A;  5KPT A;  3VEZ A;  1YI2 N;  1EKE A;  3WXL A;  2D5R A;  1ASU A;  3VQ9 A;  4JNE A;  3O08 A;  2HHV A;  5JVH L;  1NGG A;  1Q7Y O;  1TKX A;  3QNO A;  4CFA A;  4JEP A;  3A5N C;  2HHT A;  1W97 L;  1M90 O;  5C12 A;  4PQU A;  3V9U A;  3TR8 A;  1NGJ A;  3L4I A;  3ZSY A;  4H5W A;  4FM0 A;  1JJ2 M;  2YCH A;  4JI6 K;  3KLH A;  5HRN A;  4C8O A;  2XY5 A;  2FC0 A;  1DEJ A;  4CEQ A;  3T1Y K;  1JXE A;  3QFP A;  5CR4 A;  2UXC K;  4AHV A;  1SKW A;  3OVN A;  3T19 A;  5FRO A;  1YIJ N;  1BIS A;  2F96 A;  3EEQ A;  4LF5 K;  4J8F A;  4OGE A;  1OKJ A;  3KKR A;  1HYS A;  3DLK A;  2A41 A;  1YUW A;  3OS2 A;  1Q86 O;  4OX9 K;  2WUS A;  1VSI A;  1NKE A;  3O4Q A;  3JS6 A;  1VQ5 N;  1KQS M;  2OCE A;  1YXQ A;  3DOK A;  4N41 A;  2QXF A;  4M3W A;  4DS4 A;  5M1O A;  4CHQ A;  3WNH A;  3RMB A;  1HNZ K;  4CJR A;  5I42 A;  3BGR A;  3ZX2 A;  4B9Q A;  4DQR A;  3QER A;  2YX6 A;  1QVF M;  4FWR A;  4W5N A;  4FLU A;  1I94 K;  1QQC A;  1DT9 A;  3H3N O;  5LL6 Z;  1TL1 A;  3IKM A;  1U2V B;  1BGX T;  1DTT A;  4K8Z A;  3FR0 A;  1EET A;  4YOU A;  3L0Q A;  1RDW X;  3HK2 A;  5HOO A;  1YJW N;  4Y1C A;  5FPM A;  4FJM A;  4CIG A;  1HQU A;  2XY7 A;  1ILY A;  5LMN K;  3OS0 A;  4DTM A;  5C15 A;  1U49 A;  4NYN A;  5FPE A;  4B1W B;  3EYZ A;  1NM1 A;  2UUA K;  3R1X A;  4JI8 K;  3F73 A;  2X78 A;  2HBM A;  2KLA A;  5AQL A;  4YOY A;  2GX9 A;  3CJ1 A;  3OYL A;  2H3G X;  5AFU H;  4BRL A;  3MN7 A;  1FXX A;  1U2V A;  2NLX A;  2OPP A;  2EHG A;  5BR9 A;  4KB0 A;  3J7Y P;  4O0I A;  2W42 A;  2YHX A;  2P9I B;  2QXL A;  1T3V A;  3UKU B;  4FXD A;  1SV5 A;  1X1P A;  5FRN A;  1ATR A;  4I7F A;  4JN4 A;  4GVM A;  3CQY A;  3AVK A;  3IUC A;  4FZZ A;  3K5L A;  1QQM A;  3CD6 N;  2HBL A;  1NWK A;  2WTU A;  1LV5 A;  3VA0 A;  3SQ4 A;  1U47 A;  4IXC A;  5AQX A;  4G9Z A;  2B6A A;  4ILJ A;  4KB1 A;  1SL1 A;  2RN2 A;  1RCH A;  5AQY A;  4AF1 A;  3RRH A;  4QAG A;  3LP3 A;  2P9I A;  3UKU A;  2NRH A;  5M1K A;  3O1B A;  3G0Z A;  3W0L A;  3SV4 A;  3C6T A;  3NGY A;  3U3Y A;  3CC4 N;  4BRC A;  2A40 A;  2W40 A;  1NGF A;  4CJU A;  1VQ6 N;  3C95 A;  3H1V X;  1WBB A;  3QEW A;  3AVM A;  4BDY A;  4XH5 A;  5I3U A;  1GLD G;  3HT3 A;  3QDK A;  1NJY A;  1SKR A;  2HW3 A;  1IG8 A;  4FVM A;  3MWT A;  2D0C A;  1OH7 A;  4CZG A;  4W5T A;  1L3U A;  4DQS A;  3RVC A;  2QK9 A;  2Q1N A;  3N4P A;  4JYA K;  4GW6 A;  1BA1 A;  2QWM A;  3B6P A;  4FL9 A;  4JRQ A;  5C24 A;  4KHS A;  3GOI A;  3WXJ A;  3IDH A;  3CCV N;  3MMV A;  3MXJ A;  4CVN E;  3KK1 A;  3PO4 A;  1YF5 L;  4OPK A;  2IVO A;  3O3H A;  1E3M A;  4E7K A;  5BRH A;  2VWJ A;  2NUB A;  4H8K A;  2D0B A;  4N5S A;  4DV0 K;  2QKB A;  4FLT A;  4QS9 A;  3M3Z A;  3ZT2 A;  4BRP A;  4N76 A;  1DGK N;  3I33 A;  2BGG A;  1WSG A;  2QTD A;  1Z25 A;  1CLQ A;  4DTN A;  5AQK A;  4DCH A;  3RR7 A;  2WFB A;  5HRR A;  1BIU A;  1IBL K;  1N32 K;  1S22 A;  1NGE A;  4KHW A;  3P31 A;  3EZW A;  4DV1 K;  3THX B;  3L2R A;  4V19 S;  3SBG A;  3J80 O;  4KHP K;  1N6Q A;  4OPA A;  1BWF O;  5AZJ B;  4B1U B;  3G25 A;  2GEL A;  3OYJ A;  5HRO A;  2GEM A;  4CGJ A;  4F4K A;  5CZ1 A;  2OZS A;  5B8H A;  3TAB A;  2KZZ A;  1I39 A;  3PO5 A;  3K2P A;  4DV6 K;  3EO3 A;  1TK5 A;  1QSY A;  3THX A;  3Q7B A;  4XH4 A;  1IO2 A;  4JRP A;  4CJL A;  3ULE B;  3OYF A;  1U45 A;  3CJA A;  4XH1 A;  3T1H K;  4KTQ A;  5AZJ A;  4AQY K;  4ID5 A;  3CCE N;  3HZ6 A;  1XHX A;  3AA5 X;  4R79 A;  3CF5 L;  3PIP L;  3CCL N;  1ZXO A;  3NVK A;  4JI3 K;  4O44 A;  4CZF A;  3HI0 A;  2XY8 A;  4JI4 K;  2ITG A;  4JK7 A;  2X6N A;  2HMP A;  3GG4 A;  3EKU A;  3ULE A;  1XMQ K;  1N36 K;  3BP8 A;  3ASM A;  3OYK A;  2W6L A;  2ZQB A;  3NH1 A;  1VSM A;  1W2B M;  4CHY A;  4O55 A;  4FWO A;  4EZ9 A;  2Q0R A;  3J8A A;  3VQ8 A;  1KFD A;  3DLB A;  3CJ9 A;  4DLE A;  3CMA N; 
#chains in the Genus database with same CATH homology
 1RTH A;  4Q0B A;  3IS9 A;  1J53 A;  1RDA A;  1WSF A;  4HTU A;  1TKT A;  3AO4 A;  3MED A;  4DSE A;  1RBR A;  2OZM A;  4KI4 A;  4CGI A;  3LP0 A;  1WN7 A;  2BAN A;  3V9X A;  3SYZ A;  4FJK A;  1VSE A;  3OYI A;  1NJX A;  3NE6 A;  5CYQ A;  1NK5 A;  4F3O A;  1U04 A;  2OPR A;  2IOC A;  4N47 A;  3KJV A;  2PYJ A;  4KFB A;  4AHS A;  3M8S A;  3SI6 A;  4QCL A;  4TSX A;  3S3O A;  1S9E A;  2ETJ A;  1RNH A;  4CJ3 A;  4JS5 A;  1VSD A;  3NHG A;  4NCA A;  1L3V A;  3VN5 A;  1BI4 B;  1S1X A;  2Y1I A;  5DMR A;  4MQ3 A;  3LDS A;  4CED A;  3TAE A;  4J2A A;  3L3V A;  1JL1 A;  1UA1 A;  3O3F A;  1T05 A;  1Q9X A;  1CZB A;  2ZE2 A;  3CFP A;  1BQM A;  1RIL A;  1S1T A;  3ZT0 A;  1C1C A;  4CJV A;  2R7Y A;  4DF8 A;  4DSI A;  4M3Y A;  2VG7 A;  2WON A;  3OYH A;  3TI0 A;  1ZBI A;  3OYD A;  3RRG A;  3AA4 A;  2YNF A;  3AO2 A;  1JXB A;  3KK3 A;  4CGG A;  3SQ0 A;  5SWM A;  3AV9 A;  5JS2 A;  4PWD A;  2GUI A;  3SQ2 A;  1RBV A;  3PV8 A;  1C1B A;  1C0T A;  3BDP A;  5J1E A;  1T8E A;  4RG8 A;  5KI6 A;  3ZSR A;  4FK2 A;  1NK6 A;  2Z1J A;  3M8Q A;  3ZCM A;  4K8X A;  1O1W A;  4LD0 A;  2KQ2 A;  3NH0 A;  4M45 A;  4CHN A;  1BI4 A;  4HUG A;  3KD1 E;  4Q5V A;  1S9G A;  2FBY A;  4E89 A;  3IRX A;  4FLY A;  2HND A;  4BWJ A;  1BQN A;  4DFM A;  3RTV A;  3MEE A;  3NH2 A;  5J2Q A;  4HCB A;  3SQ1 A;  3OJS A;  2Z1H A;  4B08 A;  2E6L A;  4EZ6 A;  2KTQ A;  1J9A A;  3QIP A;  4FJN A;  4Z4E A;  1QHT A;  2XO7 A;  4CEF A;  2OPS A;  2IDO A;  3AA3 A;  1RT3 A;  1KLN A;  4Z4G A;  1JL2 A;  3MEG A;  3C94 A;  3ZSZ A;  1NK7 A;  4FJJ A;  1KTQ A;  3OYN A;  4OKE A;  1A5V A;  1JLQ A;  3I0R A;  4B9M A;  4CIE A;  1KVA A;  3DLH A;  4DSF A;  5FDL A;  4DQI A;  3NBP A;  4IDK A;  4M3R A;  2PZS A;  2DFF A;  4CJP A;  1CXU A;  4BE2 A;  3AVC A;  2G8F A;  2FBX A;  4B9U A;  3RMC A;  1LAV A;  4E3S A;  4KKO A;  4IFY A;  3LAM A;  3LP1 A;  3PUF A;  4UQG A;  3OYB A;  1BL3 A;  1LAW A;  3VQB A;  4R5P A;  4J2B A;  5K14 A;  1WAJ A;  3DRR A;  4CJF A;  2OPQ A;  2YNH A;  4M3X A;  1D8Y A;  3CG7 A;  4B9L A;  4HCC A;  2G8I A;  1F21 A;  1TV6 A;  1WAF A;  1CXQ A;  1RDB A;  3I8D A;  2FBV A;  4FM2 A;  4WE1 A;  2HHS A;  3JSM A;  3TAR A;  4FW2 A;  1GOC A;  4AHC A;  1B9F A;  2VG6 A;  3V1R A;  3NCI A;  3TAN A;  1BCO A;  3UIQ A;  3TAM A;  4F3T A;  4W5Q A;  4KRF A;  3ZSO A;  3ISN C;  4LH4 A;  3LPU A;  4E7L A;  3QLH A;  1A5X A;  4DTU A;  3MXI A;  4KRE A;  1LWE A;  4FZY A;  1HYV A;  4B8C A;  3VQ4 A;  1RT1 A;  1TAU A;  1Y97 A;  3FFI A;  3NF9 A;  3SUP A;  4F2S A;  3OS1 A;  3NAE A;  4B9N A;  3VA3 A;  4DU3 A;  4CJW A;  4HVJ A;  3PX4 A;  1VSJ A;  1JLA A;  3HST B;  4W5O A;  1ZBL A;  2HNZ A;  2HNY A;  1K6Y A;  3K5M A;  5KTQ A;  3P1G A;  1I3A A;  1RBS A;  1VK0 A;  3AVI A;  4FJ5 A;  1VSK A;  4Z4H A;  4AHR A;  3EZ5 A;  3K5O A;  2XHB A;  3TWH A;  3TAG A;  3SCX A;  4M42 A;  1EKE A;  4CK2 A;  2D5R A;  1ASU A;  3VQ9 A;  1D5A A;  4CHP A;  3SJJ A;  1TVR A;  3MXM A;  4CF8 A;  3D45 A;  4OKK A;  4Z4F A;  2HHV A;  1HJR A;  1IKV A;  4FLZ A;  2DTU A;  1LWC A;  2D0A A;  4RW6 A;  4CF9 A;  2XRI A;  4ELT A;  1TKX A;  3LZI A;  4FYD A;  3QNO A;  4CFA A;  2O4I A;  4LSN A;  3HVT A;  4BE1 A;  3AO3 A;  2HHT A;  1RDD A;  3H08 A;  4FLX A;  1TK8 A;  1NK4 A;  1IH7 A;  4LSL A;  3ZSV A;  1ITG A;  4I9Q A;  3VQE A;  1JLC A;  4ZTF A;  1NOY A;  2P1J A;  2JLE A;  4RW8 A;  4EP5 A;  4DSK A;  4FJX A;  4Z4C A;  4DFJ A;  3V9U A;  3TR8 A;  4PQU A;  1RT4 A;  3ZSY A;  4FM0 A;  1TK0 A;  4OKJ A;  1BIZ A;  4CJ4 A;  1DTQ A;  3LAN A;  4O5B A;  3HYF A;  3KLH A;  5HRN A;  4FLV A;  3ALY A;  1NK9 A;  4E7J A;  4FJH A;  4I2Q A;  1JLE A;  3EY1 A;  2XY5 A;  2WOM A;  4C8O A;  1ZYQ A;  4PUO A;  2FC0 A;  4KTZ A;  1W9H A;  5FRM A;  4CJ5 A;  5KRS A;  4YFU A;  4CEQ A;  1HMV A;  3LWM A;  1QS4 A;  3AVG A;  2OA8 A;  4O0J A;  1ASV A;  4CJE A;  1JXE A;  4DQQ A;  1TKD A;  4FJI A;  3CM6 A;  1S5J A;  4B9T A;  4AHV A;  1SKW A;  3WNG A;  1SL2 A;  3OVN A;  1Q9Y A;  3T19 A;  4H4O A;  1HNV A;  5EU7 A;  5FRO A;  1BIS A;  2F96 A;  3ZSX A;  3SV3 A;  4DFK A;  4RW9 A;  4YNQ A;  4CFC A;  3JYT A;  4F2R A;  4OGE A;  2HVH A;  1VSH A;  4FJ8 A;  3OYC A;  4QOZ B;  4H4M A;  1XWL A;  1X9W A;  3KKR A;  1HYS A;  3DLK A;  5DK5 A;  3OYM A;  3KK2 A;  4CE9 A;  4XIU A;  4J2D A;  3V9S A;  2QKK A;  3OS2 A;  1LW0 A;  3ULD A;  1RT5 A;  1JKH A;  2DFE A;  4G1Q A;  1VSI A;  4C8M A;  1XC9 A;  1NKE A;  1Q8I A;  3L3U A;  2OYQ A;  3SNN A;  2ATQ A;  3CM5 A;  3O4Q A;  2BE2 A;  4FJG A;  1W0H A;  1NOZ A;  3DOK A;  1ZBU A;  4RW7 A;  1L3T A;  2QXF A;  4CEO A;  2IGI A;  2E4L A;  1XI1 A;  1RT6 A;  3K58 A;  4DS4 A;  5HLF A;  4M3W A;  4OJR A;  4CHQ A;  1VSL A;  2VWK A;  2E6M A;  3WNH A;  4DU1 A;  3LZJ A;  4CGD A;  3RMD A;  3RMB A;  4CJR A;  5I42 A;  1NK0 A;  3BGR A;  4DFP A;  4CF2 A;  4DQR A;  4AIL C;  3QER A;  4E7I A;  4NCG A;  4CGF A;  3IG1 A;  4FLU A;  2HVI A;  4BDP A;  1QQC A;  3HL8 A;  3NDK A;  4EP4 A;  4W5N A;  3QIO A;  3HPG A;  1HPZ A;  1TL1 A;  3VQ6 A;  1BGX T;  1DTT A;  3V9W A;  1NK8 A;  4K8Z A;  5SZT A;  5KGX A;  4CEE A;  3KLI A;  3KLE A;  2G8V A;  3QEI A;  4N41 A;  1RTI A;  5J2P A;  3LAK A;  1EET A;  3NGZ A;  1IKW A;  2VG5 A;  4DG1 A;  3HK2 A;  1UAX A;  2FBT A;  3MAQ A;  3PX0 A;  4KHU A;  3THV A;  1VRT A;  4Y1C A;  4FJM A;  4KTW A;  4CIG A;  1HQU A;  2I5J A;  4CF0 A;  2XY7 A;  1LWF A;  4DLG A;  5CYM A;  4Z0U A;  3OS0 A;  3OYA A;  4DTM A;  1U49 A;  1KLM A;  4NYN A;  4BAC A;  3MEC A;  1UA0 A;  3HXM A;  3K57 A;  3EYZ A;  1CZ9 A;  3DI6 A;  2A1S A;  3F73 A;  2X78 A;  1EXQ A;  4RW4 A;  3OYL A;  3NF6 A;  4CEA A;  2HHQ A;  1FXX A;  2OPP A;  4KB0 A;  2EHG A;  1KRP A;  1D9F A;  3S9H A;  2B4J A;  2Z1G A;  4O0I A;  4DF4 A;  1HRH A;  1TL3 A;  3TAP A;  1KSP A;  3TAF A;  4E7H A;  3DMJ A;  2W42 A;  3ZT1 A;  3NF8 A;  3O4N A;  2YHB A;  4CJS A;  3ZT3 A;  2KZM A;  2YNI A;  3AVA A;  1SV5 A;  1X1P A;  4FXD A;  5FRN A;  1TGO A;  4I7F A;  5T7B A;  2IS3 A;  4GVM A;  3DOL A;  1T03 A;  5D3G A;  2X6S A;  3AVK A;  4FW1 A;  1KCF A;  4M3T A;  4FZZ A;  3D0P A;  3K5L A;  3ZT4 A;  4KHN A;  3E01 A;  2Z1I A;  3VQD A;  5J2N A;  4W5R A;  2XY6 A;  4KV8 A;  2EX3 A;  3PX6 A;  3TAQ A;  2B5J A;  3VA0 A;  1LV5 A;  1J5O A;  3SQ4 A;  4ELU A;  3G10 A;  1U47 A;  4Z4I A;  4DSJ A;  3B6O A;  3LP2 A;  3CFR A;  1XHZ A;  1UOC A;  3LPT A;  2B6A A;  4DSL A;  4KB1 A;  4B3O A;  4CGH A;  1SL1 A;  2ZD1 A;  2G8W A;  2RN2 A;  1RCH A;  1TKZ A;  4KPY A;  1RTJ A;  4CK1 A;  4DTX A;  3RRH A;  1S1W A;  4AHT A;  4HUE A;  4QAG A;  4OVL A;  3LP3 A;  1C6V A;  4CEC A;  5C42 A;  1WSI A;  3LWL A;  3S3N A;  2G8K A;  1BCM A;  4CHZ A;  4E19 A;  1REV A;  4IFV A;  4OLA A;  3NF7 A;  4BDZ A;  3DYA A;  4CHO A;  1WSH A;  4DWI A;  1YTU A;  1RBU A;  3G0Z A;  3M8R A;  3VQ7 A;  3C6U A;  1JLG A;  3SV4 A;  2HHU A;  4KHY A;  4CER A;  3C6T A;  1RBT A;  4O4G A;  5C25 A;  1FK9 A;  2PY5 A;  1UWB A;  2YV0 X;  4B9S A;  3KTQ A;  3NGY A;  4CFD A;  4DS5 A;  1MU2 A;  2O4G A;  3U3Y A;  3P5J A;  1WLJ A;  4DMN A;  3VQC A;  1S6P A;  1FKO A;  1KVB A;  4CJU A;  3V1O A;  3C95 A;  5HRS A;  3ZSW A;  3OYE A;  3QEW A;  4MFB A;  3LAL A;  3AVM A;  2YKM A;  4BDY A;  4M3Z A;  1NKB A;  1ASW A;  1SUQ A;  2RF2 A;  2F8T A;  3AVL A;  3AVN A;  5I3U A;  3HT3 A;  4CK3 A;  1N5Y A;  1NJY A;  1YT3 A;  1SKR A;  2RKI A;  2HW3 A;  4FVM A;  3HM9 A;  3QIN A;  2D0C A;  1IG9 A;  3T3F A;  4DTS A;  5HBM A;  1T7P A;  3RR8 A;  4DU4 A;  4KO0 A;  4N56 A;  4W5T A;  1L3U A;  1EX4 A;  4DQS A;  4F8R A;  2QK9 A;  5KRT A;  3VQP A;  4GW6 A;  4FLW A;  3KD5 E;  1BHL A;  1TAQ A;  1JLB A;  2HHX A;  3B6P A;  3QEV A;  4JRQ A;  5C24 A;  4KHS A;  3DLG A;  1IKX A;  3QO9 A;  2RPI A;  3WNF A;  3KIO A;  2DY4 A;  2KFN A;  3MXJ A;  3KK1 A;  3K59 A;  3PO4 A;  3OJU A;  4OPK A;  3O3H A;  3PY8 A;  1RT2 A;  1HQE A;  1B9D A;  3WNE A;  2KFZ A;  1FKP A;  4E7K A;  5E41 A;  1SKS A;  1WSE A;  1RT7 A;  3HP6 A;  2VWJ A;  5CY4 A;  1NJW A;  3U6F A;  4IKF A;  3I0S A;  4KHQ A;  3HPH A;  2NUB A;  4OGC A;  4J2E A;  3AVB A;  3QET A;  3U3G A;  2IC3 A;  4H8K A;  2D0B A;  4I2P A;  1NKC A;  4FCY A;  2IAJ A;  4N5S A;  2QKB A;  4FLT A;  3AO5 A;  4Y1D A;  2HMI A;  3QES A;  1RTD A;  4BWM A;  1X9S A;  4CFB A;  1G15 A;  4CEB A;  2YKN A;  3AO1 A;  3ZT2 A;  4LY7 A;  3CQ8 A;  4FJL A;  4N76 A;  1U48 A;  1RDC A;  3DLR A;  2BGG A;  2BDP A;  2F8S A;  1WSG A;  4AH9 A;  4ELV A;  4CJK A;  4IG3 A;  3CFO A;  1JLF A;  2G8H A;  1Z25 A;  1CLQ A;  4DTN A;  4PY5 A;  4CEZ A;  1HNI A;  4ZHR A;  3OYG A;  3L8B A;  3RR7 A;  3ITH A;  5HRR A;  3SZ2 A;  1BIU A;  2AJQ A;  4DTO A;  4KHW A;  4FM1 A;  3O3G A;  3AVF A;  1WSJ A;  3SPY A;  2GBZ A;  3DLE A;  5JS1 A;  4I9L A;  4PA1 A;  1HYZ A;  4M3U A;  3QEX A;  2G8U A;  3L2R A;  4DTP A;  4CIF A;  4NYF A;  3VQQ A;  3L2V A;  3QNN A;  1B92 A;  3V4I A;  1L3S A;  1QTM A;  2JGU A;  5J2M A;  2P5G A;  4FJ7 A;  3RMA A;  1N6Q A;  4C8L A;  3NGI A;  5CZ2 A;  3HPO A;  1U4B A;  3V1Q A;  1DLO A;  1IKY A;  4OPJ A;  3KLF A;  2LSN A;  4C8N A;  1J54 A;  3OYJ A;  5HRO A;  3SPZ A;  4CGJ A;  4F4K A;  5CZ1 A;  1C1A A;  2OZS A;  3HJF A;  1EP4 A;  4CES A;  4KI6 A;  3TAB A;  3VQ5 A;  2KZZ A;  3QEP A;  2PYL A;  3K5N A;  1I39 A;  3PO5 A;  3K2P A;  4CCH A;  1LW2 A;  4LH5 A;  1TK5 A;  1QSY A;  3V81 A;  4GMJ B;  1QSS A;  1SL0 A;  1YVU A;  1Z26 A;  1IO2 A;  4AHU A;  3KLG A;  4JRP A;  2DFH A;  4CJL A;  3VQA A;  4KAZ A;  3A2F A;  3HO1 A;  1S1U A;  1GOB A;  2A1R A;  4IBN A;  2YHA A;  3OYF A;  3AA2 A;  4ICL A;  2Y1J A;  1U45 A;  1A5W A;  1C0U A;  1QSL A;  3L2W A;  4HHT A;  4KTQ A;  4C8K A;  4ID5 A;  4E0D A;  1ZBF A;  2HHW A;  1XHX A;  4FK0 A;  3AA5 X;  4JS4 A;  3F9K A;  3AVH A;  1KVC A;  4CF1 A;  4FJ9 A;  4JLH A;  3V6D A;  4B9V A;  4O44 A;  4CJT A;  5HP1 A;  2XY8 A;  2Q3S A;  3L2Q A;  3DM2 A;  4OLB A;  4CJQ A;  1VRU A;  2ITG A;  3L2U A;  4HUF A;  1YTA A;  3SUN A;  1VSF A;  3RWU A;  5KGW A;  4FK4 A;  4NCB A;  3SUQ A;  1X9M A;  2HB5 A;  2X6N A;  3S3M A;  2KW4 A;  4ID1 A;  2P5O A;  1WNS A;  3KKS A;  3T1A A;  1NJZ A;  4DTJ A;  5HRP A;  3OY9 A;  3ASM A;  4IG0 A;  3OYK A;  4BE0 A;  1R0A A;  1ZBH A;  2ZQB A;  3DRS A;  2YNG A;  3NH1 A;  1VSM A;  2P51 A;  3P83 D;  3M8P A;  3HVR A;  1QE1 A;  4B8A B;  4DTR A;  4CHY A;  3IAY A;  4O55 A;  2GV9 A;  1GOA A;  1L5U A;  4EZ9 A;  3DRP A;  3HP9 A;  3SUO A;  3NFA A;  1C0M A;  3CYM A;  4M41 A;  4FZX C;  4L8R B;  4DQP A;  3VQ8 A;  1KFS A;  1KFD A;  3AVJ A;  3V9Z A;  3DLB A;  2X74 A;  1S1V A;  4DLE A;  1D9D A;  4E1M A;  4ZTJ A;  3ZSQ A;  1S6Q A;  4E1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...