4AHRA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
153
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 59
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahrA00
4B9UA 3OYBA 4WE1A 5HLFA 1EP4A 3RWUA 2XY8A 4PA1A 1NJWA 1LWFA 1X1PA 3O4NA 4M3UA 1RILA 1WAFA 5KRSA 4CHYA 4CIGA 4DTJA 1L5UA 3CQ8A 3MEGA 1VRUA 3VQ8A 4FLXA 3S3MA 1BISA 3IS9A 1XHZA 1U48A 4FJNA 2HVIA 2NUBA 1IKVA 2DFEA 4AHRA 4YFUA 2HHWA 1EETA 4BWMA 3HPGA 3OS0A 2ZE2A 3QLHA 4E7IA 4J2DA 1KVBA 4CF2A 3AO4A 2XO7A 4B9SA 1NOYA 2E4LA 3WNEA 3PY8A 4CEAA 3KK3A 3VQCA 1VSJA 4IFYA 3VQ6A 2P5GA 3RRHA 1MU2A 1N5YA 2D0CA 4Z4CA 3NGYA 4N5SA 4OVLA 1VK0A 2YV0X 3ZT3A 3OYCA 3EYZA 4FJMA 3HVTA 1HYVA 3AVFA 4OGEA 5E41A 3C94A 3THVA 4FZZA 3CM6A 4J2EA 3LAKA 5T7BA 1LAWA 4RW8A 3WNHA 2GV9A 1S1VA 1YT3A 3HXMA 2KW4A 3LP1A 1U4BA 4HCCA 4N41A 1JL1A 4KB0A 4KTZA 1B92A 3L2QA 1RT7A 2IS3A 3V1QA 1U04A 4FW1A 2W42A 1WSGA 3OY9A 4Z4FA 1HRHA 3NDKA 3SQ4A 4E1NA 1UA0A 3I0SA 1O1WA 4IG0A 4W5OA 3VA0A 1RDDA 4Y1DA 3H08A 1RBTA 3O3FA 1U45A 2KQ2A 1L3SA 4HUGA 3ALYA 3L2VA 1BI4A 3CG7A 3AVLA 4FW2A 3QNNA 1C1BA 3CFRA 4W5RA 4FZYA 3CFPA 3FFIA 1RCHA 3G0ZA 3MECA 1UAXA 2OPQA 1IG9A 2OZSA 4RG8A 4KFBA 4O44A 4C8MA 3S9HA 3SQ0A 2Q3SA 3G10A 1JLFA 4W5QA 3D0PA 3SPYA 3SQ1A 3TAMA 4G1QA 4I2PA 2F8SA 1S5JA 3SNNA 4Q5VA 3VQDA 4H8KA 1BL3A 3A2FA 1BCMA 4CJUA 3LWLA 1WSEA 1T03A 3V9WA 1CXUA 1RT2A 2YKMA 4FJIA 2O4IA 4DTUA 4M45A 3ZSVA 3LP3A 3KLGA 2RPIA 4FZXC 3TAEA 1S1TA 4CFBA 3DRSA 1DTQA 1FKPA 4E7HA 1JLGA 4DQRA 1Q9XA 4CFAA 3C6TA 1ASVA 4JS4A 1IH7A 3TANA 4CF0A 3ZT4A 5HBMA 3ZSXA 3ZSOA 4UQGA 1BHLA 4FLYA 3PX6A 3SJJA 1SKSA 4CJVA 4FJLA 3DYAA 3ZSYA 1QTMA 1DLOA 1NKCA 1TK5A 2HMIA 1ZBFA 5JS2A 3SYZA 3LP0A 2JGUA 3JYTA 4I9QA 5HRPA 4QOZB 3T1AA 2G8VA 1ZYQA 4CHQA 4BACA 4GVMA 4FLWA 4DF8A 1NKEA 3P5JA 3OVNA 3ISNC 4NCBA 4IFVA 4AHSA 3T3FA 5JS1A 2HHVA 4FLUA 5I3UA 4KHNA 1TAUA 1LV5A 3VQ4A 3K58A 4IBNA 2IGIA 4KKOA 2BDPA 4H4MA 4F3OA 4FJKA 3VQQA 4O4GA 1S1XA 1VSLA 3V1OA 4EZ9A 3TAQA 3L2WA 4BWJA 3RMBA 3O3HA 3NCIA 2A1RA 3DLEA 4M3RA 4LH5A 3U3YA 3MEEA 2IOCA 4CEZA 3LDSA 4FJ9A 2VG7A 1BQMA 4HHTA 1KVAA 4DTXA 1K6YA 2QK9A 1XWLA 4ZHRA 3TABA 3PX4A 2PYLA 2QXFA 4FJ8A 4W5TA 1XC9A 1QSLA 3K5NA 5KI6A 1KCFA 2FBYA 1JLEA 3CFOA 3AA3A 3L8BA 4ZTFA 1J54A 1Q9YA 4DTMA 4OLBA 1N6QA 1RT6A 1T7PA 4GMJB 1ZBUA 2RN2A 4ID1A 3AVMA 5HROA 4CEQA 4DG1A 3QEWA 4DU1A 4J2BA 3L2RA 5CYMA 4DLEA 4DU3A 3QERA 1VSFA 3MXJA 3OYEA 4CJRA 2R7YA 3QEIA 1X9SA 1RT1A 4Z4IA 2XY7A 4FJXA 2BGGA 1TKZA 1FXXA 3TARA 1UOCA 1TK8A 4OKJA 4DMNA 3M8PA 3HL8A 1D8YA 4DSKA 4DS4A 3PO4A 3D45A 3K2PA 5SWMA 1TL3A 3DLGA 3AVNA 5KTQA 4CK1A 3OYJA 1CXQA 2Z1HA 3AO5A 4Z0UA 4N47A 4M41A 1WSJA 1LWCA 4E89A 3JSMA 4NCGA 1KFDA 1KSPA 4QCLA 3MXIA 1RTHA 4CJ3A 4IKFA 1NK7A 2E6LA 1SL0A 2GBZA 1WSIA 4FYDA 3K5MA 1Z25A 4OGCA 2OZMA 1UA1A 1A5VA 3VQ7A 3UIQA 4CESA 4PQUA 4JRPA 3KLEA 2KZZA 3DRPA 4GW6A 3SPZA 2X6SA 4DSLA 4O55A 4QAGA 2VG6A 4OKEA 1L3UA 4PY5A 1UWBA 1D5AA 1S9GA 4DSJA 3SUQA 4CEEA 3I8DA 3KD1E 4M3YA 4FM0A 4DQIA 3OJUA 4F8RA 3IAYA 3HJFA 3DLKA 1SV5A 1Q8IA 2EHGA 2HVHA 3V9SA 3VQPA 3TAFA 1ITGA 4JLHA 3ZCMA 4CEDA 3AVHA 2YKNA 2FC0A 1RT4A 2ZD1A 2KFNA 3K5LA 2HNZA 4R5PA 3M8SA 4DTSA 1U47A 3SCXA 2G8FA 3OJSA 1L3TA 4HUEA 3V1RA 4CK3A 1HQUA 4B8AB 3SUPA 4HUFA 4F2SA 4CHZA 5CZ1A 5J2NA 4CERA 3E01A 3OYNA 4KHYA 1WN7A 3NAEA 3S3NA 3LALA 1TL1A 4C8LA 2HHUA 4W5NA 1NOZA 3LAMA 1HJRA 3OYLA 2DFHA 3OYDA 3T19A 1YTAA 4C8KA 4EP5A 4DFMA 2P1JA 4B9VA 1IO2A 2X6NA 1EXQA 4E7LA 3RRGA 1C6VA 1BCOA 1GOBA 3DOLA 4CJLA 3OYHA 1W0HA 3ASMA 5SZTA 5J2PA 5FROA 1RDBA 3SUNA 4DQPA 3VQ9A 1NJXA 3CYMA 3VQBA 3V4IA 4LSLA 3DRRA 1RT3A 4B9NA 3LZIA 1RTDA 1TK0A 2YNGA 3ZT0A 4KHUA 3KKRA 1DTTA 4FLTA 1HQEA 4B08A 1RTIA 4OLAA 1KLNA 4CGJA 4FK2A 1B9FA 3V9ZA 3DLHA 1JLQA 4B9MA 2X74A 3QNOA 1BI4B 4RW9A 4CIFA 4E7JA 1TV6A 1LWEA 2F96A 3QIOA 1S1UA 2HB5A 1NKBA 5KGWA 3NH0A 1VSMA 3AA4A 3HP9A 4ICLA 5CY4A 4AHCA 4OPKA 1TKXA 1TKTA 2YHBA 4CECA 5J2QA 2RF2A 1GOAA 1VSDA 3TAPA 4CHNA 1VSIA 4CE9A 4DQSA 1QSYA 4RW4A 4CF9A 4IDKA 2ITGA 3HVRA 1ZBIA 4Z4GA 2VG5A 3L3UA 2VWKA 4CJEA 1ZBHA 1TKDA 3DM2A 1KRPA 2FBTA 4J2AA 4ELUA 5C24A 3NH2A 4FJGA 2BANA 2YHAA 3ZSZA 2HHXA 4FXDA 3HM9A 1RT5A 4NYFA 1KFSA 3KD5E 4TSXA 2HW3A 4CF8A 4B8CA 2P51A 3NE6A 4KI6A 1BIZA 3L3VA 2ATQA 4CJKA 2D5RA 5J2MA 3O3GA 1Z26A 4C8OA 4AHVA 3TAGA 3AVKA 2HHSA 3KTQA 3ITHA 3NGIA 1JXEA 4LH4A 1I39A 1XI1A 4DWIA 4KHSA 4B3OA 1HNVA 3DLRA 5DK5A 1WSFA 2G8KA 2HHTA 4H4OA 2OA8A 2KFZA 2Z1GA 3MAQA 4CJ4A 3OYFA 2P5OA 1T8EA 2O4GA 2G8HA 2G8UA 2DTUA 1NJZA 1RDAA 4I9LA 3OYGA 4JS5A 4DSIA 1SUQA 4MQ3A 4KHWA 4M3TA 3NFAA 1GOCA 1RNHA 1J53A 1RBVA 3OYMA 4JRQA 2HNYA 4HTUA 1RBRA 1YVUA 3KK2A 4M3WA 4Z4HA 4YNQA 2PYJA 4BDPA 4CJQA 4CIEA 1KTQA 3KK1A 3TWHA 3SUOA 4DTRA 3V6DA 4CCHA 3U3GA 1C1CA 3C6UA 4CJTA 4CGDA 4ELTA 3QIPA 4E3SA 1FKOA 2FBXA 4M3XA 3SV3A 1TAQA 4DFKA 1F21A 2XHBA 1S6PA 4EZ6A 3VQEA 3BGRA 2OPRA 4CHOA 1X9MA 4M3ZA 4KAZA 1RDCA 3TI0A 3OS2A 2Y1IA 1C0MA 3B6PA 1Y97A 3I0RA 4CGHA 1QSSA 3F9KA 1SL1A 2KTQA 3ZSQA 4FVMA 4DS5A 1R0AA 3SZ2A 4I2QA 4FM2A 4CJPA 4CJSA 2Z1IA 4B9TA 4LD0A 4BDYA 3VA3A 4E7KA 3AVIA 4CHPA 3HK2A 1G15A 3EY1A 1IKXA 1D9FA 1JL2A 1CLQA 2DFFA 2QKBA 4DSEA 1IKYA 4OJRA 5K14A 4HCBA 2WONA 4I7FA 1J9AA 2OPPA 4ELVA 4KREA 5FRNA 1JLCA 4N56A 1NJYA 3QINA 5D3GA 4OPJA 5HRRA 4PUOA 3DMJA 4KTWA 1SL2A 4B9LA 2DY4A 1QS4A 1X9WA 1HPZA 3ZSRA 3AO1A 3KLIA 3AVGA 1C1AA 4BE1A 1NK9A 3RMDA 1I3AA 5DMRA 4DFPA 3RR8A 1SKWA 4DTNA 2G8IA 1T05A 1NK4A 4FJ5A 1EX4A 3IRXA 2YNHA 4K8ZA 4E19A 1HYZA 5FRMA 3MEDA 5C42A 5KRTA 3HP6A 3QEVA 1BQNA 3PV8A 3NHGA 1JKHA 5HRSA 5KGXA 3OYKA 4BE2A 4CEOA 4KHQA 2XRIA 2YNIA 3K5OA 4LY7A 3OYIA 3HO1A 1ASWA 3AV9A 1SKRA 5C25A 3LPUA 4CGIA 4DFJA 4O0JA 3OS1A 2Z1JA 4PWDA 4K8XA 2IDOA 3VQ5A 1J5OA 2PZSA 4CFDA 2HHQA 3AA5X 3P1GA 1QHTA 4DTPA 4KB1A 1FK9A 1WNSA 4DLGA 4DTOA 4F2RA 1S9EA 2D0AA 3WNGA 4CGGA 3P83D 4IG3A 3AO2A 2IAJA 2G8WA 3DI6A 3KKSA 3ULDA 2X78A 1S1WA 1LW2A 1D9DA 5HRNA 1XHXA 5CZ2A 4CK2A 2E6MA 3B6OA 1TVRA 1TGOA 3AA2A 1NK5A 2B5JA 2PY5A 3V9UA 4RW6A 4FLVA 3PUFA 2Y1JA 4KPYA 4L8RB 1C0UA 4O5BA 1CZBA 1QE1A 2GUIA 2KZMA 4FJHA 1RBSA 4NYNA 5J1EA 1WLJA 1L3VA 4LSNA 3AO3A 4HVJA 4RW7A 4FJJA 4DSFA 4MFBA 2A1SA 2D0BA 4N76A 3ZT2A 3QETA 3O4QA 2I5JA 2EX3A 1NK6A 2VWJA 3KIOA 4DQQA 3NF9A 2F8TA 4OKKA 3AVJA 5CYQA 4CJFA 1VSEA 1ASUA 4KRFA 4CFCA 1BIUA 3AVCA 4Z4EA 3RTVA 1HNIA 3NF6A 4NCAA 2LSNA 1A5XA 3HSTB 3PX0A 1HYSA 4AHUA 3EZ5A 3SQ2A 2RKIA 3IG1A 3M8RA 4AH9A 4CJWA 4KI4A 1WAJA 3OYAA 3LWMA 1NK8A 3KLFA 5HP1A 3HPHA 3RMAA 3V9XA 4KV8A 1RBUA 2OYQA 1IKWA 3HT3A 3QEPA 3AVAA 3QO9A 2ZQBA 3NBPA 4FLZA 2ETJA 2BE2A 3NF8A 4BDZA 4DF4A 2AJQA 2JLEA 2IC3A 3NF7A 3ZT1A 1VSHA 3L2UA 3SV4A 3RR7A 4E0DA 1KLMA 1HMVA 1REVA 2HNDA 1QQCA 2B6AA 3LP2A 2WOMA 3M8QA 4E1MA 4AILC 1S6QA 3LZJA 1NK0A 5EU7A 1C0TA 3NGZA 3SI6A 1ZBLA 1LW0A 1B9DA 3PO5A 3VQAA 1VRTA 3NH1A 3LANA 4DU4A 4FJ7A 1W9HA 3RMCA 4O0IA 4C8NA 4FK0A 3DOKA 3VN5A 4KO0A 3KLHA 3KJVA 3QEXA 1BGXT 4XIUA 4F4KA 1JXBA 3DLBA 4CEBA 2QKKA 2YNFA 3WNFA 3LPTA 2XY6A 3AVBA 3C95A 4Y1CA 1LAVA 4CF1A 3HPOA 3V81A 3F73A 3MXMA 1WSHA 2FBVA 2OPSA 4ZTJA 1U49A 4BE0A 4CEFA 1CZ9A 3U6FA 3K57A 4KTQA 3BDPA 1EKEA 3K59A 4Q0BA 4ID5A 4AHTA 4CJ5A 4M42A 3CM5A 4FM1A 1YTUA 1KVCA 1JLAA 1JLBA 3ZSWA 3TR8A 4CGFA 4EP4A 1A5WA 2B4JA 3S3OA 4FCYA 4FK4A 3QESA 1RTJA 4F3TA 3HYFA 1VSKA 5I42A 5FDLA 2XY5A
chains in the Genus database with same CATH superfamily
2CGLA 3HZ6A 4KHPK 4PA1A 5AQRA 4M3UA 1RILA 5BN8A 1N32K 1C0GA 2A41A 4FLXA 3S3MA 3IS9A 4FO0A 4AHRA 2HHWA 1EETA 3OS0A 3GBTA 4OO1J 3I56N 5F2RA 3AO4A 4CEAA 4IFYA 5A2QO 4YOXA 4EHTA 4DR6K 3HVTA 1QQNA 2A42A 4CW7B 3F5TA 3F2KA 1RDWX 3THVA 3HXMA 1S1VA 1YT3A 4CVNE 2KW4A 1KAYA 1B92A 2HMPA 4RTFD 3CC7N 4PKIA 2ZF5O 2W42A 4FW1A 1WSGA 3OY9A 1HRHA 3NDKA 3SQ4A 3I0SA 1O1WA 4I6MA 4JK8A 1RDDA 3CXCM 3H08A 3O3FA 3P38A 1P8ZA 4MO4A 3ALYA 3CCMN 3CG7A 1C1BA 4W5RA 4IOXA 1N8RO 5GAHP 5LJVA 1RCHA 3G0ZA 2OZSA 4AM6A 4Y0WA 2Q3SA 3SPYA 3EE9A 3D0PA 5CHIA 4X64K 2NRHA 1K9MO 2DTUA 1VQMN 3E1YA 1FJGK 3KLGA 1OKJA 2YHYA 1S1TA 1SAZA 1DTQA 1FKPA 4JKEA 1JLGA 3UKRA 4CFAA 3E66A 2P9PA 3PX6A 3QBXA 1DLOA 1TK5A 2HMIA 3H1VX 3LP0A 2F9WA 4DF8A 4IJNA 4CZJA 3AY9A 4IFVA 3T3FA 4WFNL 5KPTA 4O8KA 2NRZA 3E9LA 4XH1A 1LV5A 4IBNA 2IGIA 2ZGYA 5JMVA 2BDPA 4FJKA 1S1XA 2CH5A 4EZ9A 3CJ7A 3NCIA 3LDOA 3DLEA 3UKUA 3U3YA 4FJ9A 4BGBA 5GAEP 1K6YA 3WT0A 3THWB 4H0XB 2PYLA 4W5TA 5AQXA 5KI6A 4JYAK 2FBYA 1JLEA 3AA3A 1J54A 3H6EA 4DTMA 4OLBA 1RT6A 1ZBUA 4QS7A 3AVMA 1VSFA 1OVYA 1RT1A 2QEXN 4FWNA 3ZEUB 1TKZA 1X9JA 2O8BA 1WBBA 3S41A 4EIAA 2Z1HA 3AO5A 4E89A 1KFDA 4QCLA 1RTHA 3EO3A 4IKFA 4BQZA 1OH7A 2E6LA 2W40A 1OH5A 4NB4A 1Z25A 3K5MA 2OZMA 1UA1A 1A5VA 3UIQA 4JRPA 1Q7YO 4GV6A 3SPZA 3SBTA 4DSLA 4O55A 4PY5A 1NWKA 1D5AA 5M1FA 3KD1E 3HJFA 3IAYA 2HBKA 1Q8IA 2Q1NA 1RT4A 4B3RK 3K5LA 2HNZA 4R5PA 2Q31A 1KD1O 3A8YA 4B8AB 3ZLJA 3O80A 1X3MA 4CERA 3ZETA 2HHUA 4C8LA 3LAMA 2DFHA 3OYDA 2VYPA 2GX9A 1IO2A 2YX6A 3DOLA 1GOBA 4DQPA 4JHDB 1NJXA 1YAGA 3DRRA 3LZIA 1RTDA 3J8AA 1TK0A 3DAWA 5GADP 1TYQA 4I6MB 4PKGA 4BRMA 4M7YA 4FK2A 3AARA 2E88A 4B9MA 1BU6O 2X74A 1SZ2A 4RW9A 4CZEA 4XH5A 4LFAK 3NH0A 3CI5A 1TKTA 4CECA 2RF2A 4DQSA 4IDKA 1T6DA 2HF4A 1YUWA 4ELUA 4IJAA 3NH2A 4FJGA 3ATVA 4FXDA 1NGJA 1RT5A 1X3NA 3MN7A 4B8CA 2ATQA 2D5RA 3B8AX 5J2MA 2VGMA 4C8OA 3QMLA 3HM8A 3ITHA 4LH4A 1XI1A 3MK6A 1HNVA 2KFZA 1WSFA 4H4OA 3TSUA 3MAQA 2A40A 4A62A 4K42A 1N34K 4KHWA 4GVEA 3OYMA 1GOCA 4G9ZA 2NRWA 3FZLA 2HNYA 5BR9A 5M1NA 3VEWA 1KTQA 4BRPA 5AZJB 3UKUB 3V6DA 1C1CA 5KPZA 4CGDA 4ELTA 2E5LK 1FKOA 1TAQA 1S6PA 4YOTA 4EZ6A 3VQEA 3BGRA 1RDCA 4BY9C 4Z94A 4CGHA 2KTQA 4FVMA 1HKGA 3OBWA 3M1FA 3CJ9A 4CJSA 3FE1A 4B9TA 4LD0A 3AVIA 1QVFM 3OHRA 3CCRN 5K14A 2WONA 1JLCA 5D3GA 2HBMA 4B9LA 1QS4A 3AO1A 1KAZA 4B3MK 1NK9A 5DMRA 2IVOA 3THYA 4BRDA 3IRXA 3VF4A 1EWRA 3MEDA 4NXNK 3HP6A 3NHGA 4LF4K 3OYKA 5KPRA 4CEOA 3QFUA 3RSEA 3HO1A 3OYIA 1ASWA 4JKDA 3OS1A 2E20A 4PWDA 3VQ5A 4CFDA 3ZETB 4KB1A 4LF6K 1T44A 1Y64A 3A5LC 4JI4K 3CETA 3P83D 3CQXA 4IG3A 4O8UA 3AO2A 2IAJA 4ISEA 3QICA 2PY5A 5JICA 3C6AA 5ADXA 3UB5A 1IG8A 4O5BA 1TYQB 1IBMK 2KZMA 2WBNA 4HWIA 5AFUA 5J1EA 1L3VA 2UU9K 1GLFO 3VPZA 2D0BA 5M1PA 4N76A 2EX3A 4UY8O 3KIOA 1S3XA 5CYQA 4A59A 3AVCA 4CBXA 4QS8A 1YIJN 3HSTB 1HYSA 2YJEA 1V4TA 3A0IX 4AHUA 3CCEN 4NO7A 5LMNK 3LWMA 2NRVA 4KV8A 1RBUA 2OYQA 2FSKA 5AZIA 3D6RA 5IT9O 1VQ9N 2BE2A 2AJQA 4AQYK 4DF4A 3NF7A 3L2UA 3RR7A 4IOCL 1HMVA 2HNDA 3LP2A 2WOMA 4E1MA 4BC2A 3BY5A 4H0PA 3NGZA 3SI6A 3HOSA 1LW0A 2WTUA 3O9UA 3NVKA 2CH6A 3DOKA 4H5RA 4BRAA 3VN5A 3KLHA 3KJVA 4F4KA 3DLBA 4CEBA 2QKKA 3WNFA 3HBTA 2QWQA 2VWBA 3AGRA 4BE0A 3GOIA 3BEXA 4FWQA 1EKEA 1J6ZA 3J80O 4M42A 1JLAA 1KAXA 5B8HA 4F3TA 2XY5A 2ZM6K 3SLCA 3CJBA 5C0YA 2WC9A 1NJWA 1X1PA 3O4NA 3SAHA 3HI0A 1XC3A 5KRSA 1DEJA 2FLOA 4CIGA 1L5UA 4FJNA 2HVIA 1U48A 2DFEA 3R3LA 5ELZA 2GELA 3HPGA 4BWMA 4J2DA 2XO7A 4MDBA 2E4LA 4GV3A 3VQCA 4DV0K 3R9PA 3ATUA 4YY3K 3RRHA 4FWSA 4Z4CA 3NGYA 5KQDA 1VK0A 1HKCA 2YV0X 3OYCA 3CCUN 4FJMA 2ASOA 1JCGA 5BPNA 5FPDA 3TTDA 3THYB 4JK7A 1I94K 4HCCA 2AA4A 1JL1A 3L2QA 1RT7A 3V1QA 2ZJRL 2BH1A 1MWMA 3RSEB 4E1NA 4IG0A 1JCEA 4W5OA 5AQIA 3BP8A 1RBTA 5EX5A 1U45A 3NVMA 2KQ2A 1L3SA 4HUGA 3L2VA 1BI4A 3AVLA 3QNNA 3MCAB 3CFRA 1NGFA 1G99A 3A5OC 1LCUA 1IG9A 4O44A 4OX9K 3AGKA 4W5QA 3G4SN 1MA9B 2IVNA 4G1QA 4I2PA 3VQDA 1VQ5N 1BCMA 4WF9L 3V9WA 1CXUA 2YKMA 4MO5A 2RPIA 3ID6A 3DRSA 4RCHA 5AQKA 2RHKA 5MLCQ 1RDUA 4JI8K 2PBDA 3TANA 4JI2K 3ZSOA 3ZT4A 3SJJA 1BHLA 3I33A 1SKSA 4A57A 3CCLN 3DYAA 4DR1K 1NKCA 3JYTA 4I9QA 5HRPA 3VETA 4BC5A 2G8VA 4CHQA 4BACA 4FL9A 4GVMA 4FLWA 2CGKA 1NKEA 3P5JA 3OVNA 3ISNC 4NCBA 4AHSA 2VGNA 4KH5A 5E26A 2YI1A 1HLUA 5AZIB 5BR8K 3K58A 3P4IA 4H4MA 3ULEA 4O4GA 3E9PA 3V1OA 5AQFA 1R59O 3RMBA 2A1RA 4IZ9A 4M3RA 4LH5A 4H5WA 3LDSA 2VG7A 1BQMA 3PLAA 4ZHRA 1NBWA 3O9QA 4DR3K 3PX4A 2QXFA 4FJ8A 4LC9B 5AQZA 1KCFA 3PIOL 5C10A 1N6QA 1T7PA 3IFRA 1WB9A 5GINA 1ZBSA 4DU1A 4DU3A 3QERA 3MXJA 3OYEA 2R7YA 3HRGA 2HBLA 3EKSA 3Q7BA 3QEIA 4Z4IA 2XY7A 5EXWA 1FXXA 2QM1A 4DMNA 1D8YA 3PSFA 4DSKA 1BDGA 3PO4A 1YVNA 3K2PA 5KTQA 4CK1A 3OYJA 4Z0UA 2YHXA 1WSJA 3VF2A 4IOAL 3MXIA 2D1KA 4CJ3A 1GLBG 1NK7A 2GBZA 1WSIA 4OGCA 3VQ7A 2KZZA 3J81O 1T3VA 2VG6A 1BA0A 5GAGP 4BR4A 2I7PA 3I8DA 4M3YA 4HTLA 3OJUA 4B1YB 4F8RA 3LM2A 1SV5A 4LFBK 3GE1A 1ATRA 3TAFA 1ITGA 2YKNA 2FC0A 1GLEG 5LMUK 4DTSA 3ENOA 3MN9A 1HQUA 2KLAA 3SUPA 4HUFA 1O13A 1VHXA 5AQGA 4GY2B 5J2NA 3OYNA 4DB3A 3S3NA 4W5NA 3CJ1A 1HJRA 3VEVA 4JI6K 3T19A 2ZJQL 3CD6N 2YHWA 4C8KA 4EP5A 4H5TA 4DFMA 2X6NA 3L4QA 5SZTA 5J2PA 3SUNA 4NLCA 1S72N 3VQ9A 3V4IA 2P9LB 3LDPA 4B9NA 4A2AA 3ZT0A 1DTTA 4B1ZA 5AR0A 3L0QA 4IEEA 4JD2A 3DLHA 4M63C 4DQ8A 1BI4B 4CIFA 4E7JA 1HJOA 4V19S 2HB5A 1SL1A 3BF1A 3AA4A 4ICLA 5CY4A 4AHCA 4OPKA 4DUYK 1TKXA 3CCQN 2RE2A 4BROA 4CHNA 2P9SB 3C7NA 3HVRA 4Z4GA 3VENA 1ZBHA 1OVQA 4BRIA 1QVGM 3D2FA 2V7ZA 4B9QA 3CF5L 2O8DA 1Q18A 2GEMA 5AQPA 3KD5E 1KFSA 4YOWA 3NE6A 5LL6Z 4CJKA 2Q36A 3M6GA 1GLDG 2VQEK 5M1QA 1VQ4N 3NGIA 1I39A 4RWTA 4BVOA 2G8KA 3DLRA 5DK5A 2GWKA 2F9TA 3CPEA 2BUPA 4CZHA 1E4GT 4CJ4A 4IWVA 1NJZA 3OYGA 4FPBA 3FLCO 4MQ3A 3TPQA 3NFAA 1RNHA 1J53A 4JRQA 4M3WA 4Z4HA 2V51B 3ULEB 2PYJA 3A5NC 5JVGL 3KK1A 3SUOA 4DTRA 3SMSA 3QIPA 4E3SA 2FBXA 3L6QA 1WBDA 1TUYA 4BG8A 1IV0A 4X62K 1X9MA 4DV7K 4IXCA 3OS2A 4KBOA 2Y1IA 5BPMA 4DUZK 3UE5A 1QSSA 5AQQA 2E1YA 4DS5A 1R0AA 1NGAA 3SZ2A 1GLJO 2Z1IA 3JS6A 5GIOA 1NM1A 2IIRA 4FVUA 4EAHD 5BRFA 1Q82O 4OJRA 1EO1A 4BR5A 4I7FA 4ELVA 1NJYA 4PUOA 1EWQA 4YDUC 1HPZA 3ZSRA 3AVGA 3J7AP 3RMDA 1I3AA 3RR8A 4FWPA 2G8IA 1NK4A 3TSQA 1YXQA 3VEZA 1MWKA 1CZAN 1EX4A 4DV5K 1D4XA 1QZ5A 1TUUA 4A5AA 3PV8A 4BC4A 1JKHA 5HRSA 5KGXA 1E3MA 2XRIA 3RVCA 3K5OA 5C25A 2O8CA 3C65A 4K8XA 2IDOA 4E1JA 3FZHA 3P1GA 1QHTA 4DLGA 4DTOA 4CD3A 3KZBA 4CGGA 3T7ZA 3H3OB 2G8WA 3DI6A 3KKSA 3W0LA 2X78A 3WXJA 1D9DA 3WXMB 5HRNA 2ZJPL 4MLHA 3B6OA 1TGOA 3T69A 2B5JA 1XNRK 4FLVA 1DKGD 1C0UA 2GUIA 4WFBL 3L4IA 3J7ZO 1RBSA 2HF3A 3ENBA 4NYNA 1HX1A 3BZKA 3MDQA 4JD2B 3AO3A 4LSNA 1NGIA 1IBKK 2QWMA 2QWOA 3ZT2A 5TKYA 2I5JA 1NK6A 4WQ4C 2QI2A 4FWOA 4OKKA 4KRFA 5AQHA 4Z4EA 4NXMK 3UKRB 3RTVA 2D0OA 1HNIA 2P9PB 4BR9A 4C1NK 4H0VB 3C7NB 3SQ2A 3PX0A 2RKIA 3CERA 3GG4A 3IG1A 4AH9A 5C12A 1M1KO 3O9TA 3DXMA 3SK3A 1W7AA 1YJWN 5AQLA 3QEPA 3D2FB 3BUZB 3NBPA 3NF8A 5AQTA 3SV4A 4E0DA 1KLMA 1NK0A 5EU7A 1C0TA 4BRFA 1ZBLA 1B9DA 3PO5A 3Q7CA 2YJFA 3K0SA 4IFEA 1W9HA 3RMCA 4C8NA 4LF7K 1T6CA 2YNFA 4JN4A 2XY6A 4Y1CA 3C95A 4CF1A 1K8AO 3F73A 3MXMA 4ZTJA 2OPSA 2UXCK 5AQNA 3ZX3A 4Q0BA 5E84A 3W3DA 1JLBA 4CZIA 3FR0A 3TR8A 3ZSWA 3S3OA 2B4JA 4FCYA 3OBYA 4BRGA 1VQON 1VQ8N 3ID8A 3O9SA 2O8BB 1ZC6A 4A5BA 4WE1A 3FZFA 3WXKA 3RWUA 2D0PA 1LWFA 1WAFA 4CHYA 2VQFK 1VQPN 3CQ8A 1XHZA 1VRUA 3VQ8A 4FWMA 1IKVA 4YFUA 2AP1A 4JAXA 3WNEA 1VSJA 2EWSA 3VQ6A 1YJ9N 1N5YA 1QZ6A 1HUXA 4WYBA 4DV6K 3AAQA 3BF3A 4FZZA 3CM6A 2HBJA 1YITN 3GDQA 3CHWA 1OH6A 5AQVA 1U04A 3CC2N 4Z4FA 1UA0A 4LF5K 3VEYA 2O8CB 3R1XA 5C2DA 2IVPA 1BUPA 2NRRA 4FOEA 4FZYA 5M1OA 3CFPA 2JWLA 2OPQA 4RG8A 4KFBA 4C8MA 3G10A 4DV2K 2WFBA 3SQ1A 2UUBK 3TAMA 1NJIO 2F8SA 1S5JA 4H8KA 1BL3A 1L3TA 1RT2A 4FJIA 3ZSVA 3LP3A 3CIPA 3PSIA 4U7BA 3TAEA 4CFBA 4CZKA 3CCJN 1VQ6N 2QWRA 2W6KA 2HHHK 4DR7K 1WUAA 1IBLK 3BZCA 3C6TA 1ASVA 3HSCA 4KH4A 4JS4A 2ZWHA 3M3ZA 4BG9A 1FW6A 5H1SQ 4UQGA 4DHYA 4FLYA 4CJVA 4ISFA 3O9RA 1HNWK 1QTMA 3G6EN 3TTFA 4PL8A 2FF6A 4JKGA 3SYZA 4BR7A 1NG9A 3QFPA 4QOZB 3VERA 3DXMB 1ESVA 2HHVA 4FLUA 3H3NO 4KHNA 4FPAA 4WFAL 3SAFA 1VSLA 4BWJA 2Q0UA 1HKBA 3O8MA 3G25A 2IOCA 3CCVN 1XWLA 4BREA 3EN9A 3TABA 5F0XA 4JI1K 1QSLA 3P31A 1U6ZA 2QW9A 4AF1A 4ID1A 1H1VA 4CEQA 4DG1A 3QEWA 4DLEA 2HSTA 4FJXA 3TARA 1TK8A 1UOCA 4WQ5C 3HL8A 5AQJA 2OANA 3DLGA 3AVNA 3KLFA 1CXQA 3D2EA 4M41A 3H1QA 5AQOA 4CBUA 3ZX2A 3CC4N 4NCGA 4LF8K 1NU0A 3VTHA 2E2OA 4PQUA 4BR2A 4CESA 1QHAA 2KKZA 3DRPA 2X6SA 4QAGA 5IWAK 3KVGA 1UWBA 2PFUA 2OCEA 4DSJA 4DCHA 4DQIA 2E2QA 3OW2M 5BRHA 1SS6A 3AVHA 2KFNA 3CMEN 3M8SA 3SCXA 3OJSA 4HUEA 3V1RA 4MLEA 4YORA 4DR4K 2D4WA 4F2SA 2E1ZA 4CHZA 4A61A 1WN7A 3NAEA 3LALA 1NOZA 4BRKA 3OYLA 5C15A 1YTAA 2P9NA 2P1JA 4B9VA 3RRGA 1C6VA 1BCOA 3OYHA 1W0HA 3VGMA 5HOOA 5EVZA 1KXPA 4BRHA 2HOEA 1E4FT 1DGKN 4C23A 2YNGA 4H0OA 4KHUA 3I55N 1HQEA 1RTIA 4OLAA 4CGJA 1B9FA 1JLQA 3QNOA 1LWEA 3QIOA 2VCPA 5JVHL 1S1UA 1NKBA 2Q97A 3VTIA 1GOAA 3TAPA 4GV9A 1VSIA 4CE9A 4RW4A 4CF9A 2ITGA 2VG5A 4CJEA 1TKDA 3DM2A 3DJCA 1GLAG 4J2AA 1N33K 4NLBA 5C24A 2YHAA 2FXUA 4TSXA 2HW3A 4CF8A 3PIPL 1BIZA 3KWGA 3L3VA 3KWIA 4GKKK 4FWRA 3O3GA 4AHVA 4OPHA 1QQOA 3AVKA 2HHSA 3FFKB 4B3OA 1JXEA 4KHSA 2OA8A 3OYFA 4R79A 4JNEA 4JS5A 4DSIA 1SUQA 4HTUA 1RBRA 1YVUA 1KC8O 3EEQA 4CJQA 4CIEA 2FF3B 2ITMA 4JKAA 3WQUA 4DKWA 4CCHA 3GL1A 5FPEA 3SV3A 1F21A 2XHBA 1XNQK 2OPRA 4FWKA 3TI0A 2P9IA 3LL3A 4B1XB 1SQKA 1Y97A 3I0RA 3I8BA 3F9KA 5BN9A 4FM2A 2OTJN 4BDYA 3HK2A 1G15A 2A5XA 4BRNA 1HNZK 4H0YB 2DFFA 1NMDA 4DSEA 1IKYA 4HCBA 1NGBA 4YOYA 5AJ3K 3D2EB 5FRNA 4N56A 3QINA 2NRTA 5HRRA 4OPJA 4KTWA 3O6WA 1OH8A 1SL2A 1C0FA 1X9WA 2DY4A 3MWTA 3KLIA 3G71N 1C1AA 4BE1A 3VGLA 3VOVA 1T05A 4H5VA 2YNHA 4X65K 4K8ZA 4E19A 1HYZA 2E2PA 5FRMA 5C42A 2F7TA 4KHQA 2YNIA 3AV9A 3LPUA 2Z1JA 4U67L 5KQ8A 3AA5X 5EOYA 1FK9A 1NGEA 1WNSA 1VQ7N 4JI5K 4JHDA 2QA4N 3ZYYX 2D0AA 3MWPA 4K25A 3WNGA 2P9NB 3AAPA 4BQLA 5TKWA 4KH6A 4LFCK 2W6LA 5LJWA 3ULDA 1NMNA 3DXKA 2E6MA 1BA1A 3AA2A 5F1XA 3CCSN 3MN6A 2Y1JA 4KPYA 4ILGB 3NMUA 4RW7A 4FJJA 4MFBA 3QETA 2F8TA 3AVJA 4CJFA 1ASUA 4CFCA 3ENHA 2OTLN 2LSNA 4B1WB 3EZ5A 4JEPA 3C6HA 4CJWA 2O8FA 4MDAA 1WAJA 4B1UB 3OYAA 1IKWA 5FPNA 4K0KK 4FLZA 4WCEL 2FSNA 2IC3A 4IDHA 4IO9L 3ZT1A 1VSHA 1JCFA 3QDKA 4AILC 2BTFA 3LZJA 2Q0RA 3VQAA 4DU4A 2A3ZA 2FSJA 4JKHA 3SJHA 4BVPA 4O0IA 4FK0A 4OPAA 5GIPA 4KO0A 1LOTB 4B3SK 4XEIA 1ATSA 1XUPO 3MX5A 2QXLA 3VEOA 4PL7A 5AZJA 3FZKA 3HPOA 1LAVA 4X66K 2FBVA 3VGKA 4CEFA 4CBWA 3J7YP 2P9UA 3BDPA 4BRLA 5DM6L 3VEXA 4CJ5A 4AHTA 5FPMA 3E9OA 4IO8A 3CM5A 4J8FA 4FM1A 4CGFA 1A5WA 3OTOK 4YHHK 4FK4A 2PAVA 5I42A 1VSKA 5FDLA 3LDQA 4B9UA 2P9IB 3OYBA 1P90A 5HLFA 1EP4A 2XY8A 3O1WA 1KQSM 1NLVA 1XMOK 3FGUA 4DTJA 3MEGA 4BGAA 1BISA 2NUBA 2NZTA 2ZE2A 3QLHA 4E7IA 1KVBA 3CJAA 1RFQA 4BC3A 4CF2A 4B9SA 1NOYA 3PY8A 3KK3A 2Q2RA 3K9KA 2P5GA 4DV1K 1MU2A 2D0CA 4N5SA 4OVLA 1W97L 3ZT3A 3EYZA 1HYVA 3QBWA 3WUHA 1N36K 3AVFA 3HTVA 4OGEA 5E41A 3HOTA 3C94A 4LF9K 1HR0K 1K8KA 4J2EA 3LAKA 5T7BA 1LAWA 4RW8A 3WNHA 2GV9A 2QWLA 3LP1A 1U4BA 4N41A 2GUPA 4KB0A 2UYTA 4KTZA 2UUCK 5CR4A 2IS3A 4JI7K 3WXIA 2F4VK 3VA0A 4Y1DA 3VMFB 2UXDK 4CZGA 4FW2A 1NGCA 3R8EA 3FFIA 3MCPA 3MECA 2YCHA 1UAXA 5C2FA 3IUCA 2CGJA 3THXA 3S9HA 3SQ0A 4QS9A 1JLFA 5BPLA 3EKUA 3DXKB 4CJ7A 3SNNA 4Q5VA 4CJUA 3A2FA 1NGGA 3LWLA 1T03A 1WSEA 4PHTX 2O4IA 4CZMA 4DTUA 3LM9A 4M45A 4DR5K 4FZXC 4H0TB 2DPNA 1IJJA 4E7HA 1BOTO 3WQTA 4DQRA 1Q9XA 1IH7A 4CF0A 5HBMA 3ZSXA 2G8HA 4FJLA 1MDUB 3ZSYA 2O8DB 1YF5L 1ZBFA 5JS2A 3H45C 2JGUA 2W41A 3T1AA 1ZYQA 2O8FB 2E8AA 1QQMA 5JS1A 4EFHA 5CE3A 3JAMO 3N4PA 3F9MA 1HNXK 5I3UA 1TAUA 2WUSA 1NGDA 3VQ4A 3U9ZA 3EZWA 4KKOA 1YHQN 4F3OA 5M1KA 3VQQA 3TAQA 3L2WA 3O3HA 3SAGA 2NRXA 2ASPA 3MEEA 4CEZA 4HHTA 1KVAA 4DTXA 2QK9A 1VQKN 1XC9A 3P39A 4DV3K 3K5NA 3CQYA 3ZX0A 4ZTFA 3CFOA 3L8BA 5AQSA 1Q9YA 2ASMA 4GMJB 2RN2A 4J2BA 5HROA 4AM7A 3L2RA 5CYMA 5I9EB 2HHTA 4CJRA 1X9SA 2BGGA 3SMPA 4OKJA 2P9UB 3CMAN 3M8PA 4DS4A 4B1VA 3D45A 5SWMA 1TL3A 4N47A 3JSMA 1LWCA 1Q86O 4DR2K 1KSPA 1SL0A 4YDUA 3KLEA 4GW6A 2E2NA 4OKEA 1L3UA 1S9GA 3SUQA 4CEEA 1ATNA 4FM0A 4IEIA 3DLKA 2EHGA 2HVHA 3V9SA 3VQPA 3IKMA 4JK9A 3IDHA 4JLHA 3ZCMA 4CEDA 2ZD1A 1U47A 2G8FA 4CK3A 3D7EO 2V52B 1XMQK 4BRQA 3O1BA 5CZ1A 3E01A 4KHYA 4JI3K 1VQLN 1TL1A 1K8KB 4ILJA 1VQNN 4E7LA 1EXQA 4H5NA 4M3TA 4CJLA 3ASMA 5FROA 1RDBA 3U4LA 3CYMA 3VQBA 3U9DA 4LSLA 1RT3A 3KKRA 4FLTA 2P9KA 1BG3A 4B08A 5HL7L 4DV4K 1KLNA 3V9ZA 3OA9A 1TV6A 2F96A 3R6MA 5KGWA 1VSMA 3HP9A 4WQ4A 2YHBA 5ADXH 5J2QA 3THXB 1VSDA 4CZLA 1QSYA 4BR0A 1ZBIA 5AFUH 3L3UA 1U2VA 2VWKA 3WXLA 2O8EA 2NNWA 4JKFA 1S22A 1KRPA 2FBTA 1NNEA 2BANA 3ZSZA 2A6AA 5FLXO 2HHXA 3HM9A 4NYFA 4CI6A 4K43A 2P51A 4KI6A 2I7NA 1ZXOA 1Z26A 1GLCG 3WEEA 3TAGA 2KHOA 3KTQA 4DWIA 2J4RA 4YOVA 3M5RA 2Z1GA 5BREA 2P5OA 4K41A 1T8EA 2O4GA 2G8UA 3H46O 1RDAA 4I9LA 3TSPA 2ZGZA 1RBVA 3KK2A 4YNQA 4H03B 3T1HK 3EE8A 4BDPA 3TTCA 3TWHA 1HPMA 3MN5A 3U3GA 4CJTA 3C6UA 4FYDA 4M3XA 2QTDA 2UXBK 3VF6A 4DFKA 4M3ZA 4CHOA 4KAZA 4FSVA 1C0MA 3B6PA 4XH4A 4CD1A 3TU5A 3ZSQA 2GTDA 4O5FA 1BO5O 3SBGA 4I2QA 4CJPA 3A5MC 4ISGA 4E7KA 3VA3A 4CHPA 1V4SA 3EY1A 1IKXA 3C0BA 1D9FA 1JL2A 1CLQA 2QKBA 3KK7A 2QWPA 4KREA 1J9AA 2OPPA 1ILYA 4C1NI 3QB0A 3DMJA 3U8XA 3CPWM 1M90O 4FWLA 3EL2A 5DM7L 4DFPA 1WOQA 1SKWA 4DTNA 3JXUA 5AQWA 4FJ5A 5BRDA 5KRTA 3QEVA 1BQNA 2H3GX 1YJNN 4BE2A 2QWNA 3CJCA 4LY7A 1SKRA 4CGIA 2GWJA 4DFJA 4O0JA 3KHYA 3IMXA 2UUAK 3O5BA 5JLFA 1J5OA 2PZSA 2HHQA 4DTPA 1EQYA 4F2RA 1YI2N 1S9EA 2P9LA 1S1WA 1LW2A 1XHXA 5CZ2A 3VESA 4CK2A 1TVRA 1JJ2M 1NK5A 3LDLA 4B3TK 3V9UA 4RW6A 5AQUA 3PUFA 4A2BA 4L8RB 1CZBA 1QE1A 2P9KB 4FJHA 3N4QA 4GNIA 1WLJA 1RGIA 4HVJA 1GLLO 2P9SA 4DSFA 2A1SA 3O4QA 2VWJA 4DQQA 3NF9A 5JLHA 1VSEA 4GKJK 1BIUA 4JI0K 4NCAA 3NF6A 1A5XA 1DT9A 4JKCA 4JKBA 3M8RA 1U2VB 3O4WA 1Z05A 4KI4A 1NGHA 4BRCA 1NK8A 2O8EB 5HP1A 3HPHA 3RMAA 1K73O 3V9XA 4JKGB 3HT3A 3AVAA 3QO9A 5LY3A 3T1YK 2ZQBA 2ETJA 1W2BM 4BDZA 3K9JA 4F9OA 2JLEA 1XQSC 2NLXA 1REVA 4L3QA 2JWKA 1QQCA 2B6AA 3DWLA 3M8QA 4CZFA 1J5EK 1S6QA 3LDNA 1VAZA 3WEEB 1Z6RA 1VRTA 3NH1A 3LANA 3THWA 4FJ7A 5AQMA 4FOIA 3MX2A 1BWFO 3QEXA 1BGXT 4XIUA 1JXBA 4M7XA 3LPTA 3AVBA 4ILHA 5EY4A 2V7YA 3V81A 1WSHA 1U49A 4PKHA 3ZEUA 1CZ9A 3U6FA 3K57A 4KTQA 3K59A 4YOUA 3FZMA 4ID5A 4WQ5A 5AQYA 3O08A 3DLLL 1Q81O 1YTUA 1KVCA 4EP4A 3MMVA 3QESA 1RTJA 3HYFA 4JV5K 4EHUA
chains in the Genus database with same CATH topology
4B9UA 3OYBA 4WE1A 5HLFA 1EP4A 3RWUA 2XY8A 4PA1A 1NJWA 1LWFA 1X1PA 3O4NA 4M3UA 1RILA 1WAFA 5KRSA 4CHYA 4CIGA 4DTJA 1L5UA 3CQ8A 3MEGA 1VRUA 3VQ8A 4FLXA 3S3MA 1BISA 3IS9A 1XHZA 1U48A 4FJNA 2HVIA 2NUBA 1IKVA 2DFEA 4AHRA 4YFUA 2HHWA 1EETA 4BWMA 3HPGA 3OS0A 2ZE2A 3QLHA 4E7IA 4J2DA 1KVBA 4CF2A 3AO4A 2XO7A 4B9SA 1NOYA 2E4LA 3WNEA 3PY8A 4CEAA 3KK3A 3VQCA 1VSJA 4IFYA 3VQ6A 2P5GA 3RRHA 1MU2A 1N5YA 2D0CA 4Z4CA 3NGYA 4N5SA 4OVLA 1VK0A 2YV0X 3ZT3A 3OYCA 3EYZA 4FJMA 3HVTA 1HYVA 3AVFA 4OGEA 5E41A 3C94A 3THVA 4FZZA 3CM6A 4J2EA 3LAKA 5T7BA 1LAWA 4RW8A 3WNHA 2GV9A 1S1VA 1YT3A 3HXMA 2KW4A 3LP1A 1U4BA 4HCCA 4N41A 1JL1A 4KB0A 4KTZA 1B92A 3L2QA 1RT7A 2IS3A 3V1QA 1U04A 4FW1A 2W42A 1WSGA 3OY9A 4Z4FA 1HRHA 3NDKA 3SQ4A 4E1NA 1UA0A 3I0SA 1O1WA 4IG0A 4W5OA 3VA0A 1RDDA 4Y1DA 3H08A 1RBTA 3O3FA 1U45A 2KQ2A 1L3SA 4HUGA 3ALYA 3L2VA 1BI4A 3CG7A 3AVLA 4FW2A 3QNNA 1C1BA 3CFRA 4W5RA 4FZYA 3CFPA 3FFIA 1RCHA 3G0ZA 3MECA 1UAXA 2OPQA 1IG9A 2OZSA 4RG8A 4KFBA 4O44A 4C8MA 3S9HA 3SQ0A 2Q3SA 3G10A 1JLFA 4W5QA 3D0PA 3SPYA 3SQ1A 3TAMA 4G1QA 4I2PA 2F8SA 1S5JA 3SNNA 4Q5VA 3VQDA 4H8KA 1BL3A 3A2FA 1BCMA 4CJUA 3LWLA 1WSEA 1T03A 3V9WA 1CXUA 1RT2A 2YKMA 4FJIA 2O4IA 4DTUA 4M45A 3ZSVA 3LP3A 3KLGA 2RPIA 4FZXC 3TAEA 1S1TA 4CFBA 3DRSA 1DTQA 1FKPA 4E7HA 1JLGA 4DQRA 1Q9XA 4CFAA 3C6TA 1ASVA 4JS4A 1IH7A 3TANA 4CF0A 3ZT4A 5HBMA 3ZSXA 3ZSOA 4UQGA 1BHLA 4FLYA 3PX6A 3SJJA 1SKSA 4CJVA 4FJLA 3DYAA 3ZSYA 1QTMA 1DLOA 1NKCA 1TK5A 2HMIA 1ZBFA 5JS2A 3SYZA 3LP0A 2JGUA 3JYTA 4I9QA 5HRPA 4QOZB 3T1AA 2G8VA 1ZYQA 4CHQA 4BACA 4GVMA 4FLWA 4DF8A 1NKEA 3P5JA 3OVNA 3ISNC 4NCBA 4IFVA 4AHSA 3T3FA 5JS1A 2HHVA 4FLUA 5I3UA 4KHNA 1TAUA 1LV5A 3VQ4A 3K58A 4IBNA 2IGIA 4KKOA 2BDPA 4H4MA 4F3OA 4FJKA 3VQQA 4O4GA 1S1XA 1VSLA 3V1OA 4EZ9A 3TAQA 3L2WA 4BWJA 3RMBA 3O3HA 3NCIA 2A1RA 3DLEA 4M3RA 4LH5A 3U3YA 3MEEA 2IOCA 4CEZA 3LDSA 4FJ9A 2VG7A 1BQMA 4HHTA 1KVAA 4DTXA 1K6YA 2QK9A 1XWLA 4ZHRA 3TABA 3PX4A 2PYLA 2QXFA 4FJ8A 4W5TA 1XC9A 1QSLA 3K5NA 5KI6A 1KCFA 2FBYA 1JLEA 3CFOA 3AA3A 3L8BA 4ZTFA 1J54A 1Q9YA 4DTMA 4OLBA 1N6QA 1RT6A 1T7PA 4GMJB 1ZBUA 2RN2A 4ID1A 3AVMA 5HROA 4CEQA 4DG1A 3QEWA 4DU1A 4J2BA 3L2RA 5CYMA 4DLEA 4DU3A 3QERA 1VSFA 3MXJA 3OYEA 4CJRA 2R7YA 3QEIA 1X9SA 1RT1A 4Z4IA 2XY7A 4FJXA 2BGGA 1TKZA 1FXXA 3TARA 1UOCA 1TK8A 4OKJA 4DMNA 3M8PA 3HL8A 1D8YA 4DSKA 4DS4A 3PO4A 3D45A 3K2PA 5SWMA 1TL3A 3DLGA 3AVNA 5KTQA 4CK1A 3OYJA 1CXQA 2Z1HA 3AO5A 4Z0UA 4N47A 4M41A 1WSJA 1LWCA 4E89A 3JSMA 4NCGA 1KFDA 1KSPA 4QCLA 3MXIA 1RTHA 4CJ3A 4IKFA 1NK7A 2E6LA 1SL0A 2GBZA 1WSIA 4FYDA 3K5MA 1Z25A 4OGCA 2OZMA 1UA1A 1A5VA 3VQ7A 3UIQA 4CESA 4PQUA 4JRPA 3KLEA 2KZZA 3DRPA 4GW6A 3SPZA 2X6SA 4DSLA 4O55A 4QAGA 2VG6A 4OKEA 1L3UA 4PY5A 1UWBA 1D5AA 1S9GA 4DSJA 3SUQA 4CEEA 3I8DA 3KD1E 4M3YA 4FM0A 4DQIA 3OJUA 4F8RA 3IAYA 3HJFA 3DLKA 1SV5A 1Q8IA 2EHGA 2HVHA 3V9SA 3VQPA 3TAFA 1ITGA 4JLHA 3ZCMA 4CEDA 3AVHA 2YKNA 2FC0A 1RT4A 2ZD1A 2KFNA 3K5LA 2HNZA 4R5PA 3M8SA 4DTSA 1U47A 3SCXA 2G8FA 3OJSA 1L3TA 4HUEA 3V1RA 4CK3A 1HQUA 4B8AB 3SUPA 4HUFA 4F2SA 4CHZA 5CZ1A 5J2NA 4CERA 3E01A 3OYNA 4KHYA 1WN7A 3NAEA 3S3NA 3LALA 1TL1A 4C8LA 2HHUA 4W5NA 1NOZA 3LAMA 1HJRA 3OYLA 2DFHA 3OYDA 3T19A 1YTAA 4C8KA 4EP5A 4DFMA 2P1JA 4B9VA 1IO2A 2X6NA 1EXQA 4E7LA 3RRGA 1C6VA 1BCOA 1GOBA 3DOLA 4CJLA 3OYHA 1W0HA 3ASMA 5SZTA 5J2PA 5FROA 1RDBA 3SUNA 4DQPA 3VQ9A 1NJXA 3CYMA 3VQBA 3V4IA 4LSLA 3DRRA 1RT3A 4B9NA 3LZIA 1RTDA 1TK0A 2YNGA 3ZT0A 4KHUA 3KKRA 1DTTA 4FLTA 1HQEA 4B08A 1RTIA 4OLAA 1KLNA 4CGJA 4FK2A 1B9FA 3V9ZA 3DLHA 1JLQA 4B9MA 2X74A 3QNOA 1BI4B 4RW9A 4CIFA 4E7JA 1TV6A 1LWEA 2F96A 3QIOA 1S1UA 2HB5A 1NKBA 5KGWA 3NH0A 1VSMA 3AA4A 3HP9A 4ICLA 5CY4A 4AHCA 4OPKA 1TKXA 1TKTA 2YHBA 4CECA 5J2QA 2RF2A 1GOAA 1VSDA 3TAPA 4CHNA 1VSIA 4CE9A 4DQSA 1QSYA 4RW4A 4CF9A 4IDKA 2ITGA 3HVRA 1ZBIA 4Z4GA 2VG5A 3L3UA 2VWKA 4CJEA 1ZBHA 1TKDA 3DM2A 1KRPA 2FBTA 4J2AA 4ELUA 5C24A 3NH2A 4FJGA 2BANA 2YHAA 3ZSZA 2HHXA 4FXDA 3HM9A 1RT5A 4NYFA 1KFSA 3KD5E 4TSXA 2HW3A 4CF8A 4B8CA 2P51A 3NE6A 4KI6A 1BIZA 3L3VA 2ATQA 4CJKA 2D5RA 5J2MA 3O3GA 1Z26A 4C8OA 4AHVA 3TAGA 3AVKA 2HHSA 3KTQA 3ITHA 3NGIA 1JXEA 4LH4A 1I39A 1XI1A 4DWIA 4KHSA 4B3OA 1HNVA 3DLRA 5DK5A 1WSFA 2G8KA 2HHTA 4H4OA 2OA8A 2KFZA 2Z1GA 3MAQA 4CJ4A 3OYFA 2P5OA 1T8EA 2O4GA 2G8HA 2G8UA 2DTUA 1NJZA 1RDAA 4I9LA 3OYGA 4JS5A 4DSIA 1SUQA 4MQ3A 4KHWA 4M3TA 3NFAA 1GOCA 1RNHA 1J53A 1RBVA 3OYMA 4JRQA 2HNYA 4HTUA 1RBRA 1YVUA 3KK2A 4M3WA 4Z4HA 4YNQA 2PYJA 4BDPA 4CJQA 4CIEA 1KTQA 3KK1A 3TWHA 3SUOA 4DTRA 3V6DA 4CCHA 3U3GA 1C1CA 3C6UA 4CJTA 4CGDA 4ELTA 3QIPA 4E3SA 1FKOA 2FBXA 4M3XA 3SV3A 1TAQA 4DFKA 1F21A 2XHBA 1S6PA 4EZ6A 3VQEA 3BGRA 2OPRA 4CHOA 1X9MA 4M3ZA 4KAZA 1RDCA 3TI0A 3OS2A 2Y1IA 1C0MA 3B6PA 1Y97A 3I0RA 4CGHA 1QSSA 3F9KA 1SL1A 2KTQA 3ZSQA 4FVMA 4DS5A 1R0AA 3SZ2A 4I2QA 4FM2A 4CJPA 4CJSA 2Z1IA 4B9TA 4LD0A 4BDYA 3VA3A 4E7KA 3AVIA 4CHPA 3HK2A 1G15A 3EY1A 1IKXA 1D9FA 1JL2A 1CLQA 2DFFA 2QKBA 4DSEA 1IKYA 4OJRA 5K14A 4HCBA 2WONA 4I7FA 1J9AA 2OPPA 4ELVA 4KREA 5FRNA 1JLCA 4N56A 1NJYA 3QINA 5D3GA 4OPJA 5HRRA 4PUOA 3DMJA 4KTWA 1SL2A 4B9LA 2DY4A 1QS4A 1X9WA 1HPZA 3ZSRA 3AO1A 3KLIA 3AVGA 1C1AA 4BE1A 1NK9A 3RMDA 1I3AA 5DMRA 4DFPA 3RR8A 1SKWA 4DTNA 2G8IA 1T05A 1NK4A 4FJ5A 1EX4A 3IRXA 2YNHA 4K8ZA 4E19A 1HYZA 5FRMA 3MEDA 5C42A 5KRTA 3HP6A 3QEVA 1BQNA 3PV8A 3NHGA 1JKHA 5HRSA 5KGXA 3OYKA 4BE2A 4CEOA 4KHQA 2XRIA 2YNIA 3K5OA 4LY7A 3OYIA 3HO1A 1ASWA 3AV9A 1SKRA 5C25A 3LPUA 4CGIA 4DFJA 4O0JA 3OS1A 2Z1JA 4PWDA 4K8XA 2IDOA 3VQ5A 1J5OA 2PZSA 4CFDA 2HHQA 3AA5X 3P1GA 1QHTA 4DTPA 4KB1A 1FK9A 1WNSA 4DLGA 4DTOA 4F2RA 1S9EA 2D0AA 3WNGA 4CGGA 3P83D 4IG3A 3AO2A 2IAJA 2G8WA 3DI6A 3KKSA 3ULDA 2X78A 1S1WA 1LW2A 1D9DA 5HRNA 1XHXA 5CZ2A 4CK2A 2E6MA 3B6OA 1TVRA 1TGOA 3AA2A 1NK5A 2B5JA 2PY5A 3V9UA 4RW6A 4FLVA 3PUFA 2Y1JA 4KPYA 4L8RB 1C0UA 4O5BA 1CZBA 1QE1A 2GUIA 2KZMA 4FJHA 1RBSA 4NYNA 5J1EA 1WLJA 1L3VA 4LSNA 3AO3A 4HVJA 4RW7A 4FJJA 4DSFA 4MFBA 2A1SA 2D0BA 4N76A 3ZT2A 3QETA 3O4QA 2I5JA 2EX3A 1NK6A 2VWJA 3KIOA 4DQQA 3NF9A 2F8TA 4OKKA 3AVJA 5CYQA 4CJFA 1VSEA 1ASUA 4KRFA 4CFCA 1BIUA 3AVCA 4Z4EA 3RTVA 1HNIA 3NF6A 4NCAA 2LSNA 1A5XA 3HSTB 3PX0A 1HYSA 4AHUA 3EZ5A 3SQ2A 2RKIA 3IG1A 3M8RA 4AH9A 4CJWA 4KI4A 1WAJA 3OYAA 3LWMA 1NK8A 3KLFA 5HP1A 3HPHA 3RMAA 3V9XA 4KV8A 1RBUA 2OYQA 1IKWA 3HT3A 3QEPA 3AVAA 3QO9A 2ZQBA 3NBPA 4FLZA 2ETJA 2BE2A 3NF8A 4BDZA 4DF4A 2AJQA 2JLEA 2IC3A 3NF7A 3ZT1A 1VSHA 3L2UA 3SV4A 3RR7A 4E0DA 1KLMA 1HMVA 1REVA 2HNDA 1QQCA 2B6AA 3LP2A 2WOMA 3M8QA 4E1MA 4AILC 1S6QA 3LZJA 1NK0A 5EU7A 1C0TA 3NGZA 3SI6A 1ZBLA 1LW0A 1B9DA 3PO5A 3VQAA 1VRTA 3NH1A 3LANA 4DU4A 4FJ7A 1W9HA 3RMCA 4O0IA 4C8NA 4FK0A 3DOKA 3VN5A 4KO0A 3KLHA 3KJVA 3QEXA 1BGXT 4XIUA 4F4KA 1JXBA 3DLBA 4CEBA 2QKKA 2YNFA 3WNFA 3LPTA 2XY6A 3AVBA 3C95A 4Y1CA 1LAVA 4CF1A 3HPOA 3V81A 3F73A 3MXMA 1WSHA 2FBVA 2OPSA 4ZTJA 1U49A 4BE0A 4CEFA 1CZ9A 3U6FA 3K57A 4KTQA 3BDPA 1EKEA 3K59A 4Q0BA 4ID5A 4AHTA 4CJ5A 4M42A 3CM5A 4FM1A 1YTUA 1KVCA 1JLAA 1JLBA 3ZSWA 3TR8A 4CGFA 4EP4A 1A5WA 2B4JA 3S3OA 4FCYA 4FK4A 3QESA 1RTJA 4F3TA 3HYFA 1VSKA 5I42A 5FDLA 2XY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9U A;  3OYB A;  4WE1 A;  5HLF A;  1EP4 A;  3RWU A;  2XY8 A;  4PA1 A;  1NJW A;  1LWF A;  1X1P A;  3O4N A;  4M3U A;  1RIL A;  1WAF A;  5KRS A;  4CHY A;  4CIG A;  4DTJ A;  1L5U A;  3CQ8 A;  3MEG A;  1VRU A;  3VQ8 A;  4FLX A;  3S3M A;  1BIS A;  3IS9 A;  1XHZ A;  1U48 A;  4FJN A;  2HVI A;  2NUB A;  1IKV A;  2DFE A;  4AHR A;  4YFU A;  2HHW A;  1EET A;  4BWM A;  3HPG A;  3OS0 A;  2ZE2 A;  3QLH A;  4E7I A;  4J2D A;  1KVB A;  4CF2 A;  3AO4 A;  2XO7 A;  4B9S A;  1NOY A;  2E4L A;  3WNE A;  3PY8 A;  4CEA A;  3KK3 A;  3VQC A;  1VSJ A;  4IFY A;  3VQ6 A;  2P5G A;  3RRH A;  1MU2 A;  1N5Y A;  2D0C A;  4Z4C A;  3NGY A;  4N5S A;  4OVL A;  1VK0 A;  2YV0 X;  3ZT3 A;  3OYC A;  3EYZ A;  4FJM A;  3HVT A;  1HYV A;  3AVF A;  4OGE A;  5E41 A;  3C94 A;  3THV A;  4FZZ A;  3CM6 A;  4J2E A;  3LAK A;  5T7B A;  1LAW A;  4RW8 A;  3WNH A;  2GV9 A;  1S1V A;  1YT3 A;  3HXM A;  2KW4 A;  3LP1 A;  1U4B A;  4HCC A;  4N41 A;  1JL1 A;  4KB0 A;  4KTZ A;  1B92 A;  3L2Q A;  1RT7 A;  2IS3 A;  3V1Q A;  1U04 A;  4FW1 A;  2W42 A;  1WSG A;  3OY9 A;  4Z4F A;  1HRH A;  3NDK A;  3SQ4 A;  4E1N A;  1UA0 A;  3I0S A;  1O1W A;  4IG0 A;  4W5O A;  3VA0 A;  1RDD A;  4Y1D A;  3H08 A;  1RBT A;  3O3F A;  1U45 A;  2KQ2 A;  1L3S A;  4HUG A;  3ALY A;  3L2V A;  1BI4 A;  3CG7 A;  3AVL A;  4FW2 A;  3QNN A;  1C1B A;  3CFR A;  4W5R A;  4FZY A;  3CFP A;  3FFI A;  1RCH A;  3G0Z A;  3MEC A;  1UAX A;  2OPQ A;  1IG9 A;  2OZS A;  4RG8 A;  4KFB A;  4O44 A;  4C8M A;  3S9H A;  3SQ0 A;  2Q3S A;  3G10 A;  1JLF A;  4W5Q A;  3D0P A;  3SPY A;  3SQ1 A;  3TAM A;  4G1Q A;  4I2P A;  2F8S A;  1S5J A;  3SNN A;  4Q5V A;  3VQD A;  4H8K A;  1BL3 A;  3A2F A;  1BCM A;  4CJU A;  3LWL A;  1WSE A;  1T03 A;  3V9W A;  1CXU A;  1RT2 A;  2YKM A;  4FJI A;  2O4I A;  4DTU A;  4M45 A;  3ZSV A;  3LP3 A;  3KLG A;  2RPI A;  4FZX C;  3TAE A;  1S1T A;  4CFB A;  3DRS A;  1DTQ A;  1FKP A;  4E7H A;  1JLG A;  4DQR A;  1Q9X A;  4CFA A;  3C6T A;  1ASV A;  4JS4 A;  1IH7 A;  3TAN A;  4CF0 A;  3ZT4 A;  5HBM A;  3ZSX A;  3ZSO A;  4UQG A;  1BHL A;  4FLY A;  3PX6 A;  3SJJ A;  1SKS A;  4CJV A;  4FJL A;  3DYA A;  3ZSY A;  1QTM A;  1DLO A;  1NKC A;  1TK5 A;  2HMI A;  1ZBF A;  5JS2 A;  3SYZ A;  3LP0 A;  2JGU A;  3JYT A;  4I9Q A;  5HRP A;  4QOZ B;  3T1A A;  2G8V A;  1ZYQ A;  4CHQ A;  4BAC A;  4GVM A;  4FLW A;  4DF8 A;  1NKE A;  3P5J A;  3OVN A;  3ISN C;  4NCB A;  4IFV A;  4AHS A;  3T3F A;  5JS1 A;  2HHV A;  4FLU A;  5I3U A;  4KHN A;  1TAU A;  1LV5 A;  3VQ4 A;  3K58 A;  4IBN A;  2IGI A;  4KKO A;  2BDP A;  4H4M A;  4F3O A;  4FJK A;  3VQQ A;  4O4G A;  1S1X A;  1VSL A;  3V1O A;  4EZ9 A;  3TAQ A;  3L2W A;  4BWJ A;  3RMB A;  3O3H A;  3NCI A;  2A1R A;  3DLE A;  4M3R A;  4LH5 A;  3U3Y A;  3MEE A;  2IOC A;  4CEZ A;  3LDS A;  4FJ9 A;  2VG7 A;  1BQM A;  4HHT A;  1KVA A;  4DTX A;  1K6Y A;  2QK9 A;  1XWL A;  4ZHR A;  3TAB A;  3PX4 A;  2PYL A;  2QXF A;  4FJ8 A;  4W5T A;  1XC9 A;  1QSL A;  3K5N A;  5KI6 A;  1KCF A;  2FBY A;  1JLE A;  3CFO A;  3AA3 A;  3L8B A;  4ZTF A;  1J54 A;  1Q9Y A;  4DTM A;  4OLB A;  1N6Q A;  1RT6 A;  1T7P A;  4GMJ B;  1ZBU A;  2RN2 A;  4ID1 A;  3AVM A;  5HRO A;  4CEQ A;  4DG1 A;  3QEW A;  4DU1 A;  4J2B A;  3L2R A;  5CYM A;  4DLE A;  4DU3 A;  3QER A;  1VSF A;  3MXJ A;  3OYE A;  4CJR A;  2R7Y A;  3QEI A;  1X9S A;  1RT1 A;  4Z4I A;  2XY7 A;  4FJX A;  2BGG A;  1TKZ A;  1FXX A;  3TAR A;  1UOC A;  1TK8 A;  4OKJ A;  4DMN A;  3M8P A;  3HL8 A;  1D8Y A;  4DSK A;  4DS4 A;  3PO4 A;  3D45 A;  3K2P A;  5SWM A;  1TL3 A;  3DLG A;  3AVN A;  5KTQ A;  4CK1 A;  3OYJ A;  1CXQ A;  2Z1H A;  3AO5 A;  4Z0U A;  4N47 A;  4M41 A;  1WSJ A;  1LWC A;  4E89 A;  3JSM A;  4NCG A;  1KFD A;  1KSP A;  4QCL A;  3MXI A;  1RTH A;  4CJ3 A;  4IKF A;  1NK7 A;  2E6L A;  1SL0 A;  2GBZ A;  1WSI A;  4FYD A;  3K5M A;  1Z25 A;  4OGC A;  2OZM A;  1UA1 A;  1A5V A;  3VQ7 A;  3UIQ A;  4CES A;  4PQU A;  4JRP A;  3KLE A;  2KZZ A;  3DRP A;  4GW6 A;  3SPZ A;  2X6S A;  4DSL A;  4O55 A;  4QAG A;  2VG6 A;  4OKE A;  1L3U A;  4PY5 A;  1UWB A;  1D5A A;  1S9G A;  4DSJ A;  3SUQ A;  4CEE A;  3I8D A;  3KD1 E;  4M3Y A;  4FM0 A;  4DQI A;  3OJU A;  4F8R A;  3IAY A;  3HJF A;  3DLK A;  1SV5 A;  1Q8I A;  2EHG A;  2HVH A;  3V9S A;  3VQP A;  3TAF A;  1ITG A;  4JLH A;  3ZCM A;  4CED A;  3AVH A;  2YKN A;  2FC0 A;  1RT4 A;  2ZD1 A;  2KFN A;  3K5L A;  2HNZ A;  4R5P A;  3M8S A;  4DTS A;  1U47 A;  3SCX A;  2G8F A;  3OJS A;  1L3T A;  4HUE A;  3V1R A;  4CK3 A;  1HQU A;  4B8A B;  3SUP A;  4HUF A;  4F2S A;  4CHZ A;  5CZ1 A;  5J2N A;  4CER A;  3E01 A;  3OYN A;  4KHY A;  1WN7 A;  3NAE A;  3S3N A;  3LAL A;  1TL1 A;  4C8L A;  2HHU A;  4W5N A;  1NOZ A;  3LAM A;  1HJR A;  3OYL A;  2DFH A;  3OYD A;  3T19 A;  1YTA A;  4C8K A;  4EP5 A;  4DFM A;  2P1J A;  4B9V A;  1IO2 A;  2X6N A;  1EXQ A;  4E7L A;  3RRG A;  1C6V A;  1BCO A;  1GOB A;  3DOL A;  4CJL A;  3OYH A;  1W0H A;  3ASM A;  5SZT A;  5J2P A;  5FRO A;  1RDB A;  3SUN A;  4DQP A;  3VQ9 A;  1NJX A;  3CYM A;  3VQB A;  3V4I A;  4LSL A;  3DRR A;  1RT3 A;  4B9N A;  3LZI A;  1RTD A;  1TK0 A;  2YNG A;  3ZT0 A;  4KHU A;  3KKR A;  1DTT A;  4FLT A;  1HQE A;  4B08 A;  1RTI A;  4OLA A;  1KLN A;  4CGJ A;  4FK2 A;  1B9F A;  3V9Z A;  3DLH A;  1JLQ A;  4B9M A;  2X74 A;  3QNO A;  1BI4 B;  4RW9 A;  4CIF A;  4E7J A;  1TV6 A;  1LWE A;  2F96 A;  3QIO A;  1S1U A;  2HB5 A;  1NKB A;  5KGW A;  3NH0 A;  1VSM A;  3AA4 A;  3HP9 A;  4ICL A;  5CY4 A;  4AHC A;  4OPK A;  1TKX A;  1TKT A;  2YHB A;  4CEC A;  5J2Q A;  2RF2 A;  1GOA A;  1VSD A;  3TAP A;  4CHN A;  1VSI A;  4CE9 A;  4DQS A;  1QSY A;  4RW4 A;  4CF9 A;  4IDK A;  2ITG A;  3HVR A;  1ZBI A;  4Z4G A;  2VG5 A;  3L3U A;  2VWK A;  4CJE A;  1ZBH A;  1TKD A;  3DM2 A;  1KRP A;  2FBT A;  4J2A A;  4ELU A;  5C24 A;  3NH2 A;  4FJG A;  2BAN A;  2YHA A;  3ZSZ A;  2HHX A;  4FXD A;  3HM9 A;  1RT5 A;  4NYF A;  1KFS A;  3KD5 E;  4TSX A;  2HW3 A;  4CF8 A;  4B8C A;  2P51 A;  3NE6 A;  4KI6 A;  1BIZ A;  3L3V A;  2ATQ A;  4CJK A;  2D5R A;  5J2M A;  3O3G A;  1Z26 A;  4C8O A;  4AHV A;  3TAG A;  3AVK A;  2HHS A;  3KTQ A;  3ITH A;  3NGI A;  1JXE A;  4LH4 A;  1I39 A;  1XI1 A;  4DWI A;  4KHS A;  4B3O A;  1HNV A;  3DLR A;  5DK5 A;  1WSF A;  2G8K A;  2HHT A;  4H4O A;  2OA8 A;  2KFZ A;  2Z1G A;  3MAQ A;  4CJ4 A;  3OYF A;  2P5O A;  1T8E A;  2O4G A;  2G8H A;  2G8U A;  2DTU A;  1NJZ A;  1RDA A;  4I9L A;  3OYG A;  4JS5 A;  4DSI A;  1SUQ A;  4MQ3 A;  4KHW A;  4M3T A;  3NFA A;  1GOC A;  1RNH A;  1J53 A;  1RBV A;  3OYM A;  4JRQ A;  2HNY A;  4HTU A;  1RBR A;  1YVU A;  3KK2 A;  4M3W A;  4Z4H A;  4YNQ A;  2PYJ A;  4BDP A;  4CJQ A;  4CIE A;  1KTQ A;  3KK1 A;  3TWH A;  3SUO A;  4DTR A;  3V6D A;  4CCH A;  3U3G A;  1C1C A;  3C6U A;  4CJT A;  4CGD A;  4ELT A;  3QIP A;  4E3S A;  1FKO A;  2FBX A;  4M3X A;  3SV3 A;  1TAQ A;  4DFK A;  1F21 A;  2XHB A;  1S6P A;  4EZ6 A;  3VQE A;  3BGR A;  2OPR A;  4CHO A;  1X9M A;  4M3Z A;  4KAZ A;  1RDC A;  3TI0 A;  3OS2 A;  2Y1I A;  1C0M A;  3B6P A;  1Y97 A;  3I0R A;  4CGH A;  1QSS A;  3F9K A;  1SL1 A;  2KTQ A;  3ZSQ A;  4FVM A;  4DS5 A;  1R0A A;  3SZ2 A;  4I2Q A;  4FM2 A;  4CJP A;  4CJS A;  2Z1I A;  4B9T A;  4LD0 A;  4BDY A;  3VA3 A;  4E7K A;  3AVI A;  4CHP A;  3HK2 A;  1G15 A;  3EY1 A;  1IKX A;  1D9F A;  1JL2 A;  1CLQ A;  2DFF A;  2QKB A;  4DSE A;  1IKY A;  4OJR A;  5K14 A;  4HCB A;  2WON A;  4I7F A;  1J9A A;  2OPP A;  4ELV A;  4KRE A;  5FRN A;  1JLC A;  4N56 A;  1NJY A;  3QIN A;  5D3G A;  4OPJ A;  5HRR A;  4PUO A;  3DMJ A;  4KTW A;  1SL2 A;  4B9L A;  2DY4 A;  1QS4 A;  1X9W A;  1HPZ A;  3ZSR A;  3AO1 A;  3KLI A;  3AVG A;  1C1A A;  4BE1 A;  1NK9 A;  3RMD A;  1I3A A;  5DMR A;  4DFP A;  3RR8 A;  1SKW A;  4DTN A;  2G8I A;  1T05 A;  1NK4 A;  4FJ5 A;  1EX4 A;  3IRX A;  2YNH A;  4K8Z A;  4E19 A;  1HYZ A;  5FRM A;  3MED A;  5C42 A;  5KRT A;  3HP6 A;  3QEV A;  1BQN A;  3PV8 A;  3NHG A;  1JKH A;  5HRS A;  5KGX A;  3OYK A;  4BE2 A;  4CEO A;  4KHQ A;  2XRI A;  2YNI A;  3K5O A;  4LY7 A;  3OYI A;  3HO1 A;  1ASW A;  3AV9 A;  1SKR A;  5C25 A;  3LPU A;  4CGI A;  4DFJ A;  4O0J A;  3OS1 A;  2Z1J A;  4PWD A;  4K8X A;  2IDO A;  3VQ5 A;  1J5O A;  2PZS A;  4CFD A;  2HHQ A;  3AA5 X;  3P1G A;  1QHT A;  4DTP A;  4KB1 A;  1FK9 A;  1WNS A;  4DLG A;  4DTO A;  4F2R A;  1S9E A;  2D0A A;  3WNG A;  4CGG A;  3P83 D;  4IG3 A;  3AO2 A;  2IAJ A;  2G8W A;  3DI6 A;  3KKS A;  3ULD A;  2X78 A;  1S1W A;  1LW2 A;  1D9D A;  5HRN A;  1XHX A;  5CZ2 A;  4CK2 A;  2E6M A;  3B6O A;  1TVR A;  1TGO A;  3AA2 A;  1NK5 A;  2B5J A;  2PY5 A;  3V9U A;  4RW6 A;  4FLV A;  3PUF A;  2Y1J A;  4KPY A;  4L8R B;  1C0U A;  4O5B A;  1CZB A;  1QE1 A;  2GUI A;  2KZM A;  4FJH A;  1RBS A;  4NYN A;  5J1E A;  1WLJ A;  1L3V A;  4LSN A;  3AO3 A;  4HVJ A;  4RW7 A;  4FJJ A;  4DSF A;  4MFB A;  2A1S A;  2D0B A;  4N76 A;  3ZT2 A;  3QET A;  3O4Q A;  2I5J A;  2EX3 A;  1NK6 A;  2VWJ A;  3KIO A;  4DQQ A;  3NF9 A;  2F8T A;  4OKK A;  3AVJ A;  5CYQ A;  4CJF A;  1VSE A;  1ASU A;  4KRF A;  4CFC A;  1BIU A;  3AVC A;  4Z4E A;  3RTV A;  1HNI A;  3NF6 A;  4NCA A;  2LSN A;  1A5X A;  3HST B;  3PX0 A;  1HYS A;  4AHU A;  3EZ5 A;  3SQ2 A;  2RKI A;  3IG1 A;  3M8R A;  4AH9 A;  4CJW A;  4KI4 A;  1WAJ A;  3OYA A;  3LWM A;  1NK8 A;  3KLF A;  5HP1 A;  3HPH A;  3RMA A;  3V9X A;  4KV8 A;  1RBU A;  2OYQ A;  1IKW A;  3HT3 A;  3QEP A;  3AVA A;  3QO9 A;  2ZQB A;  3NBP A;  4FLZ A;  2ETJ A;  2BE2 A;  3NF8 A;  4BDZ A;  4DF4 A;  2AJQ A;  2JLE A;  2IC3 A;  3NF7 A;  3ZT1 A;  1VSH A;  3L2U A;  3SV4 A;  3RR7 A;  4E0D A;  1KLM A;  1HMV A;  1REV A;  2HND A;  1QQC A;  2B6A A;  3LP2 A;  2WOM A;  3M8Q A;  4E1M A;  4AIL C;  1S6Q A;  3LZJ A;  1NK0 A;  5EU7 A;  1C0T A;  3NGZ A;  3SI6 A;  1ZBL A;  1LW0 A;  1B9D A;  3PO5 A;  3VQA A;  1VRT A;  3NH1 A;  3LAN A;  4DU4 A;  4FJ7 A;  1W9H A;  3RMC A;  4O0I A;  4C8N A;  4FK0 A;  3DOK A;  3VN5 A;  4KO0 A;  3KLH A;  3KJV A;  3QEX A;  1BGX T;  4XIU A;  4F4K A;  1JXB A;  3DLB A;  4CEB A;  2QKK A;  2YNF A;  3WNF A;  3LPT A;  2XY6 A;  3AVB A;  3C95 A;  4Y1C A;  1LAV A;  4CF1 A;  3HPO A;  3V81 A;  3F73 A;  3MXM A;  1WSH A;  2FBV A;  2OPS A;  4ZTJ A;  1U49 A;  4BE0 A;  4CEF A;  1CZ9 A;  3U6F A;  3K57 A;  4KTQ A;  3BDP A;  1EKE A;  3K59 A;  4Q0B A;  4ID5 A;  4AHT A;  4CJ5 A;  4M42 A;  3CM5 A;  4FM1 A;  1YTU A;  1KVC A;  1JLA A;  1JLB A;  3ZSW A;  3TR8 A;  4CGF A;  4EP4 A;  1A5W A;  2B4J A;  3S3O A;  4FCY A;  4FK4 A;  3QES A;  1RTJ A;  4F3T A;  3HYF A;  1VSK A;  5I42 A;  5FDL A;  2XY5 A; 
#chains in the Genus database with same CATH topology
 2CGL A;  3HZ6 A;  4KHP K;  4PA1 A;  5AQR A;  4M3U A;  1RIL A;  5BN8 A;  1N32 K;  1C0G A;  2A41 A;  4FLX A;  3S3M A;  3IS9 A;  4FO0 A;  4AHR A;  2HHW A;  1EET A;  3OS0 A;  3GBT A;  4OO1 J;  3I56 N;  5F2R A;  3AO4 A;  4CEA A;  4IFY A;  5A2Q O;  4YOX A;  4EHT A;  4DR6 K;  3HVT A;  1QQN A;  2A42 A;  4CW7 B;  3F5T A;  3F2K A;  1RDW X;  3THV A;  3HXM A;  1S1V A;  1YT3 A;  4CVN E;  2KW4 A;  1KAY A;  1B92 A;  2HMP A;  4RTF D;  3CC7 N;  4PKI A;  2ZF5 O;  2W42 A;  4FW1 A;  1WSG A;  3OY9 A;  1HRH A;  3NDK A;  3SQ4 A;  3I0S A;  1O1W A;  4I6M A;  4JK8 A;  1RDD A;  3CXC M;  3H08 A;  3O3F A;  3P38 A;  1P8Z A;  4MO4 A;  3ALY A;  3CCM N;  3CG7 A;  1C1B A;  4W5R A;  4IOX A;  1N8R O;  5GAH P;  5LJV A;  1RCH A;  3G0Z A;  2OZS A;  4AM6 A;  4Y0W A;  2Q3S A;  3SPY A;  3EE9 A;  3D0P A;  5CHI A;  4X64 K;  2NRH A;  1K9M O;  2DTU A;  1VQM N;  3E1Y A;  1FJG K;  3KLG A;  1OKJ A;  2YHY A;  1S1T A;  1SAZ A;  1DTQ A;  1FKP A;  4JKE A;  1JLG A;  3UKR A;  4CFA A;  3E66 A;  2P9P A;  3PX6 A;  3QBX A;  1DLO A;  1TK5 A;  2HMI A;  3H1V X;  3LP0 A;  2F9W A;  4DF8 A;  4IJN A;  4CZJ A;  3AY9 A;  4IFV A;  3T3F A;  4WFN L;  5KPT A;  4O8K A;  2NRZ A;  3E9L A;  4XH1 A;  1LV5 A;  4IBN A;  2IGI A;  2ZGY A;  5JMV A;  2BDP A;  4FJK A;  1S1X A;  2CH5 A;  4EZ9 A;  3CJ7 A;  3NCI A;  3LDO A;  3DLE A;  3UKU A;  3U3Y A;  4FJ9 A;  4BGB A;  5GAE P;  1K6Y A;  3WT0 A;  3THW B;  4H0X B;  2PYL A;  4W5T A;  5AQX A;  5KI6 A;  4JYA K;  2FBY A;  1JLE A;  3AA3 A;  1J54 A;  3H6E A;  4DTM A;  4OLB A;  1RT6 A;  1ZBU A;  4QS7 A;  3AVM A;  1VSF A;  1OVY A;  1RT1 A;  2QEX N;  4FWN A;  3ZEU B;  1TKZ A;  1X9J A;  2O8B A;  1WBB A;  3S41 A;  4EIA A;  2Z1H A;  3AO5 A;  4E89 A;  1KFD A;  4QCL A;  1RTH A;  3EO3 A;  4IKF A;  4BQZ A;  1OH7 A;  2E6L A;  2W40 A;  1OH5 A;  4NB4 A;  1Z25 A;  3K5M A;  2OZM A;  1UA1 A;  1A5V A;  3UIQ A;  4JRP A;  1Q7Y O;  4GV6 A;  3SPZ A;  3SBT A;  4DSL A;  4O55 A;  4PY5 A;  1NWK A;  1D5A A;  5M1F A;  3KD1 E;  3HJF A;  3IAY A;  2HBK A;  1Q8I A;  2Q1N A;  1RT4 A;  4B3R K;  3K5L A;  2HNZ A;  4R5P A;  2Q31 A;  1KD1 O;  3A8Y A;  4B8A B;  3ZLJ A;  3O80 A;  1X3M A;  4CER A;  3ZET A;  2HHU A;  4C8L A;  3LAM A;  2DFH A;  3OYD A;  2VYP A;  2GX9 A;  1IO2 A;  2YX6 A;  3DOL A;  1GOB A;  4DQP A;  4JHD B;  1NJX A;  1YAG A;  3DRR A;  3LZI A;  1RTD A;  3J8A A;  1TK0 A;  3DAW A;  5GAD P;  1TYQ A;  4I6M B;  4PKG A;  4BRM A;  4M7Y A;  4FK2 A;  3AAR A;  2E88 A;  4B9M A;  1BU6 O;  2X74 A;  1SZ2 A;  4RW9 A;  4CZE A;  4XH5 A;  4LFA K;  3NH0 A;  3CI5 A;  1TKT A;  4CEC A;  2RF2 A;  4DQS A;  4IDK A;  1T6D A;  2HF4 A;  1YUW A;  4ELU A;  4IJA A;  3NH2 A;  4FJG A;  3ATV A;  4FXD A;  1NGJ A;  1RT5 A;  1X3N A;  3MN7 A;  4B8C A;  2ATQ A;  2D5R A;  3B8A X;  5J2M A;  2VGM A;  4C8O A;  3QML A;  3HM8 A;  3ITH A;  4LH4 A;  1XI1 A;  3MK6 A;  1HNV A;  2KFZ A;  1WSF A;  4H4O A;  3TSU A;  3MAQ A;  2A40 A;  4A62 A;  4K42 A;  1N34 K;  4KHW A;  4GVE A;  3OYM A;  1GOC A;  4G9Z A;  2NRW A;  3FZL A;  2HNY A;  5BR9 A;  5M1N A;  3VEW A;  1KTQ A;  4BRP A;  5AZJ B;  3UKU B;  3V6D A;  1C1C A;  5KPZ A;  4CGD A;  4ELT A;  2E5L K;  1FKO A;  1TAQ A;  1S6P A;  4YOT A;  4EZ6 A;  3VQE A;  3BGR A;  1RDC A;  4BY9 C;  4Z94 A;  4CGH A;  2KTQ A;  4FVM A;  1HKG A;  3OBW A;  3M1F A;  3CJ9 A;  4CJS A;  3FE1 A;  4B9T A;  4LD0 A;  3AVI A;  1QVF M;  3OHR A;  3CCR N;  5K14 A;  2WON A;  1JLC A;  5D3G A;  2HBM A;  4B9L A;  1QS4 A;  3AO1 A;  1KAZ A;  4B3M K;  1NK9 A;  5DMR A;  2IVO A;  3THY A;  4BRD A;  3IRX A;  3VF4 A;  1EWR A;  3MED A;  4NXN K;  3HP6 A;  3NHG A;  4LF4 K;  3OYK A;  5KPR A;  4CEO A;  3QFU A;  3RSE A;  3HO1 A;  3OYI A;  1ASW A;  4JKD A;  3OS1 A;  2E20 A;  4PWD A;  3VQ5 A;  4CFD A;  3ZET B;  4KB1 A;  4LF6 K;  1T44 A;  1Y64 A;  3A5L C;  4JI4 K;  3CET A;  3P83 D;  3CQX A;  4IG3 A;  4O8U A;  3AO2 A;  2IAJ A;  4ISE A;  3QIC A;  2PY5 A;  5JIC A;  3C6A A;  5ADX A;  3UB5 A;  1IG8 A;  4O5B A;  1TYQ B;  1IBM K;  2KZM A;  2WBN A;  4HWI A;  5AFU A;  5J1E A;  1L3V A;  2UU9 K;  1GLF O;  3VPZ A;  2D0B A;  5M1P A;  4N76 A;  2EX3 A;  4UY8 O;  3KIO A;  1S3X A;  5CYQ A;  4A59 A;  3AVC A;  4CBX A;  4QS8 A;  1YIJ N;  3HST B;  1HYS A;  2YJE A;  1V4T A;  3A0I X;  4AHU A;  3CCE N;  4NO7 A;  5LMN K;  3LWM A;  2NRV A;  4KV8 A;  1RBU A;  2OYQ A;  2FSK A;  5AZI A;  3D6R A;  5IT9 O;  1VQ9 N;  2BE2 A;  2AJQ A;  4AQY K;  4DF4 A;  3NF7 A;  3L2U A;  3RR7 A;  4IOC L;  1HMV A;  2HND A;  3LP2 A;  2WOM A;  4E1M A;  4BC2 A;  3BY5 A;  4H0P A;  3NGZ A;  3SI6 A;  3HOS A;  1LW0 A;  2WTU A;  3O9U A;  3NVK A;  2CH6 A;  3DOK A;  4H5R A;  4BRA A;  3VN5 A;  3KLH A;  3KJV A;  4F4K A;  3DLB A;  4CEB A;  2QKK A;  3WNF A;  3HBT A;  2QWQ A;  2VWB A;  3AGR A;  4BE0 A;  3GOI A;  3BEX A;  4FWQ A;  1EKE A;  1J6Z A;  3J80 O;  4M42 A;  1JLA A;  1KAX A;  5B8H A;  4F3T A;  2XY5 A;  2ZM6 K;  3SLC A;  3CJB A;  5C0Y A;  2WC9 A;  1NJW A;  1X1P A;  3O4N A;  3SAH A;  3HI0 A;  1XC3 A;  5KRS A;  1DEJ A;  2FLO A;  4CIG A;  1L5U A;  4FJN A;  2HVI A;  1U48 A;  2DFE A;  3R3L A;  5ELZ A;  2GEL A;  3HPG A;  4BWM A;  4J2D A;  2XO7 A;  4MDB A;  2E4L A;  4GV3 A;  3VQC A;  4DV0 K;  3R9P A;  3ATU A;  4YY3 K;  3RRH A;  4FWS A;  4Z4C A;  3NGY A;  5KQD A;  1VK0 A;  1HKC A;  2YV0 X;  3OYC A;  3CCU N;  4FJM A;  2ASO A;  1JCG A;  5BPN A;  5FPD A;  3TTD A;  3THY B;  4JK7 A;  1I94 K;  4HCC A;  2AA4 A;  1JL1 A;  3L2Q A;  1RT7 A;  3V1Q A;  2ZJR L;  2BH1 A;  1MWM A;  3RSE B;  4E1N A;  4IG0 A;  1JCE A;  4W5O A;  5AQI A;  3BP8 A;  1RBT A;  5EX5 A;  1U45 A;  3NVM A;  2KQ2 A;  1L3S A;  4HUG A;  3L2V A;  1BI4 A;  3AVL A;  3QNN A;  3MCA B;  3CFR A;  1NGF A;  1G99 A;  3A5O C;  1LCU A;  1IG9 A;  4O44 A;  4OX9 K;  3AGK A;  4W5Q A;  3G4S N;  1MA9 B;  2IVN A;  4G1Q A;  4I2P A;  3VQD A;  1VQ5 N;  1BCM A;  4WF9 L;  3V9W A;  1CXU A;  2YKM A;  4MO5 A;  2RPI A;  3ID6 A;  3DRS A;  4RCH A;  5AQK A;  2RHK A;  5MLC Q;  1RDU A;  4JI8 K;  2PBD A;  3TAN A;  4JI2 K;  3ZSO A;  3ZT4 A;  3SJJ A;  1BHL A;  3I33 A;  1SKS A;  4A57 A;  3CCL N;  3DYA A;  4DR1 K;  1NKC A;  3JYT A;  4I9Q A;  5HRP A;  3VET A;  4BC5 A;  2G8V A;  4CHQ A;  4BAC A;  4FL9 A;  4GVM A;  4FLW A;  2CGK A;  1NKE A;  3P5J A;  3OVN A;  3ISN C;  4NCB A;  4AHS A;  2VGN A;  4KH5 A;  5E26 A;  2YI1 A;  1HLU A;  5AZI B;  5BR8 K;  3K58 A;  3P4I A;  4H4M A;  3ULE A;  4O4G A;  3E9P A;  3V1O A;  5AQF A;  1R59 O;  3RMB A;  2A1R A;  4IZ9 A;  4M3R A;  4LH5 A;  4H5W A;  3LDS A;  2VG7 A;  1BQM A;  3PLA A;  4ZHR A;  1NBW A;  3O9Q A;  4DR3 K;  3PX4 A;  2QXF A;  4FJ8 A;  4LC9 B;  5AQZ A;  1KCF A;  3PIO L;  5C10 A;  1N6Q A;  1T7P A;  3IFR A;  1WB9 A;  5GIN A;  1ZBS A;  4DU1 A;  4DU3 A;  3QER A;  3MXJ A;  3OYE A;  2R7Y A;  3HRG A;  2HBL A;  3EKS A;  3Q7B A;  3QEI A;  4Z4I A;  2XY7 A;  5EXW A;  1FXX A;  2QM1 A;  4DMN A;  1D8Y A;  3PSF A;  4DSK A;  1BDG A;  3PO4 A;  1YVN A;  3K2P A;  5KTQ A;  4CK1 A;  3OYJ A;  4Z0U A;  2YHX A;  1WSJ A;  3VF2 A;  4IOA L;  3MXI A;  2D1K A;  4CJ3 A;  1GLB G;  1NK7 A;  2GBZ A;  1WSI A;  4OGC A;  3VQ7 A;  2KZZ A;  3J81 O;  1T3V A;  2VG6 A;  1BA0 A;  5GAG P;  4BR4 A;  2I7P A;  3I8D A;  4M3Y A;  4HTL A;  3OJU A;  4B1Y B;  4F8R A;  3LM2 A;  1SV5 A;  4LFB K;  3GE1 A;  1ATR A;  3TAF A;  1ITG A;  2YKN A;  2FC0 A;  1GLE G;  5LMU K;  4DTS A;  3ENO A;  3MN9 A;  1HQU A;  2KLA A;  3SUP A;  4HUF A;  1O13 A;  1VHX A;  5AQG A;  4GY2 B;  5J2N A;  3OYN A;  4DB3 A;  3S3N A;  4W5N A;  3CJ1 A;  1HJR A;  3VEV A;  4JI6 K;  3T19 A;  2ZJQ L;  3CD6 N;  2YHW A;  4C8K A;  4EP5 A;  4H5T A;  4DFM A;  2X6N A;  3L4Q A;  5SZT A;  5J2P A;  3SUN A;  4NLC A;  1S72 N;  3VQ9 A;  3V4I A;  2P9L B;  3LDP A;  4B9N A;  4A2A A;  3ZT0 A;  1DTT A;  4B1Z A;  5AR0 A;  3L0Q A;  4IEE A;  4JD2 A;  3DLH A;  4M63 C;  4DQ8 A;  1BI4 B;  4CIF A;  4E7J A;  1HJO A;  4V19 S;  2HB5 A;  1SL1 A;  3BF1 A;  3AA4 A;  4ICL A;  5CY4 A;  4AHC A;  4OPK A;  4DUY K;  1TKX A;  3CCQ N;  2RE2 A;  4BRO A;  4CHN A;  2P9S B;  3C7N A;  3HVR A;  4Z4G A;  3VEN A;  1ZBH A;  1OVQ A;  4BRI A;  1QVG M;  3D2F A;  2V7Z A;  4B9Q A;  3CF5 L;  2O8D A;  1Q18 A;  2GEM A;  5AQP A;  3KD5 E;  1KFS A;  4YOW A;  3NE6 A;  5LL6 Z;  4CJK A;  2Q36 A;  3M6G A;  1GLD G;  2VQE K;  5M1Q A;  1VQ4 N;  3NGI A;  1I39 A;  4RWT A;  4BVO A;  2G8K A;  3DLR A;  5DK5 A;  2GWK A;  2F9T A;  3CPE A;  2BUP A;  4CZH A;  1E4G T;  4CJ4 A;  4IWV A;  1NJZ A;  3OYG A;  4FPB A;  3FLC O;  4MQ3 A;  3TPQ A;  3NFA A;  1RNH A;  1J53 A;  4JRQ A;  4M3W A;  4Z4H A;  2V51 B;  3ULE B;  2PYJ A;  3A5N C;  5JVG L;  3KK1 A;  3SUO A;  4DTR A;  3SMS A;  3QIP A;  4E3S A;  2FBX A;  3L6Q A;  1WBD A;  1TUY A;  4BG8 A;  1IV0 A;  4X62 K;  1X9M A;  4DV7 K;  4IXC A;  3OS2 A;  4KBO A;  2Y1I A;  5BPM A;  4DUZ K;  3UE5 A;  1QSS A;  5AQQ A;  2E1Y A;  4DS5 A;  1R0A A;  1NGA A;  3SZ2 A;  1GLJ O;  2Z1I A;  3JS6 A;  5GIO A;  1NM1 A;  2IIR A;  4FVU A;  4EAH D;  5BRF A;  1Q82 O;  4OJR A;  1EO1 A;  4BR5 A;  4I7F A;  4ELV A;  1NJY A;  4PUO A;  1EWQ A;  4YDU C;  1HPZ A;  3ZSR A;  3AVG A;  3J7A P;  3RMD A;  1I3A A;  3RR8 A;  4FWP A;  2G8I A;  1NK4 A;  3TSQ A;  1YXQ A;  3VEZ A;  1MWK A;  1CZA N;  1EX4 A;  4DV5 K;  1D4X A;  1QZ5 A;  1TUU A;  4A5A A;  3PV8 A;  4BC4 A;  1JKH A;  5HRS A;  5KGX A;  1E3M A;  2XRI A;  3RVC A;  3K5O A;  5C25 A;  2O8C A;  3C65 A;  4K8X A;  2IDO A;  4E1J A;  3FZH A;  3P1G A;  1QHT A;  4DLG A;  4DTO A;  4CD3 A;  3KZB A;  4CGG A;  3T7Z A;  3H3O B;  2G8W A;  3DI6 A;  3KKS A;  3W0L A;  2X78 A;  3WXJ A;  1D9D A;  3WXM B;  5HRN A;  2ZJP L;  4MLH A;  3B6O A;  1TGO A;  3T69 A;  2B5J A;  1XNR K;  4FLV A;  1DKG D;  1C0U A;  2GUI A;  4WFB L;  3L4I A;  3J7Z O;  1RBS A;  2HF3 A;  3ENB A;  4NYN A;  1HX1 A;  3BZK A;  3MDQ A;  4JD2 B;  3AO3 A;  4LSN A;  1NGI A;  1IBK K;  2QWM A;  2QWO A;  3ZT2 A;  5TKY A;  2I5J A;  1NK6 A;  4WQ4 C;  2QI2 A;  4FWO A;  4OKK A;  4KRF A;  5AQH A;  4Z4E A;  4NXM K;  3UKR B;  3RTV A;  2D0O A;  1HNI A;  2P9P B;  4BR9 A;  4C1N K;  4H0V B;  3C7N B;  3SQ2 A;  3PX0 A;  2RKI A;  3CER A;  3GG4 A;  3IG1 A;  4AH9 A;  5C12 A;  1M1K O;  3O9T A;  3DXM A;  3SK3 A;  1W7A A;  1YJW N;  5AQL A;  3QEP A;  3D2F B;  3BUZ B;  3NBP A;  3NF8 A;  5AQT A;  3SV4 A;  4E0D A;  1KLM A;  1NK0 A;  5EU7 A;  1C0T A;  4BRF A;  1ZBL A;  1B9D A;  3PO5 A;  3Q7C A;  2YJF A;  3K0S A;  4IFE A;  1W9H A;  3RMC A;  4C8N A;  4LF7 K;  1T6C A;  2YNF A;  4JN4 A;  2XY6 A;  4Y1C A;  3C95 A;  4CF1 A;  1K8A O;  3F73 A;  3MXM A;  4ZTJ A;  2OPS A;  2UXC K;  5AQN A;  3ZX3 A;  4Q0B A;  5E84 A;  3W3D A;  1JLB A;  4CZI A;  3FR0 A;  3TR8 A;  3ZSW A;  3S3O A;  2B4J A;  4FCY A;  3OBY A;  4BRG A;  1VQO N;  1VQ8 N;  3ID8 A;  3O9S A;  2O8B B;  1ZC6 A;  4A5B A;  4WE1 A;  3FZF A;  3WXK A;  3RWU A;  2D0P A;  1LWF A;  1WAF A;  4CHY A;  2VQF K;  1VQP N;  3CQ8 A;  1XHZ A;  1VRU A;  3VQ8 A;  4FWM A;  1IKV A;  4YFU A;  2AP1 A;  4JAX A;  3WNE A;  1VSJ A;  2EWS A;  3VQ6 A;  1YJ9 N;  1N5Y A;  1QZ6 A;  1HUX A;  4WYB A;  4DV6 K;  3AAQ A;  3BF3 A;  4FZZ A;  3CM6 A;  2HBJ A;  1YIT N;  3GDQ A;  3CHW A;  1OH6 A;  5AQV A;  1U04 A;  3CC2 N;  4Z4F A;  1UA0 A;  4LF5 K;  3VEY A;  2O8C B;  3R1X A;  5C2D A;  2IVP A;  1BUP A;  2NRR A;  4FOE A;  4FZY A;  5M1O A;  3CFP A;  2JWL A;  2OPQ A;  4RG8 A;  4KFB A;  4C8M A;  3G10 A;  4DV2 K;  2WFB A;  3SQ1 A;  2UUB K;  3TAM A;  1NJI O;  2F8S A;  1S5J A;  4H8K A;  1BL3 A;  1L3T A;  1RT2 A;  4FJI A;  3ZSV A;  3LP3 A;  3CIP A;  3PSI A;  4U7B A;  3TAE A;  4CFB A;  4CZK A;  3CCJ N;  1VQ6 N;  2QWR A;  2W6K A;  2HHH K;  4DR7 K;  1WUA A;  1IBL K;  3BZC A;  3C6T A;  1ASV A;  3HSC A;  4KH4 A;  4JS4 A;  2ZWH A;  3M3Z A;  4BG9 A;  1FW6 A;  5H1S Q;  4UQG A;  4DHY A;  4FLY A;  4CJV A;  4ISF A;  3O9R A;  1HNW K;  1QTM A;  3G6E N;  3TTF A;  4PL8 A;  2FF6 A;  4JKG A;  3SYZ A;  4BR7 A;  1NG9 A;  3QFP A;  4QOZ B;  3VER A;  3DXM B;  1ESV A;  2HHV A;  4FLU A;  3H3N O;  4KHN A;  4FPA A;  4WFA L;  3SAF A;  1VSL A;  4BWJ A;  2Q0U A;  1HKB A;  3O8M A;  3G25 A;  2IOC A;  3CCV N;  1XWL A;  4BRE A;  3EN9 A;  3TAB A;  5F0X A;  4JI1 K;  1QSL A;  3P31 A;  1U6Z A;  2QW9 A;  4AF1 A;  4ID1 A;  1H1V A;  4CEQ A;  4DG1 A;  3QEW A;  4DLE A;  2HST A;  4FJX A;  3TAR A;  1TK8 A;  1UOC A;  4WQ5 C;  3HL8 A;  5AQJ A;  2OAN A;  3DLG A;  3AVN A;  3KLF A;  1CXQ A;  3D2E A;  4M41 A;  3H1Q A;  5AQO A;  4CBU A;  3ZX2 A;  3CC4 N;  4NCG A;  4LF8 K;  1NU0 A;  3VTH A;  2E2O A;  4PQU A;  4BR2 A;  4CES A;  1QHA A;  2KKZ A;  3DRP A;  2X6S A;  4QAG A;  5IWA K;  3KVG A;  1UWB A;  2PFU A;  2OCE A;  4DSJ A;  4DCH A;  4DQI A;  2E2Q A;  3OW2 M;  5BRH A;  1SS6 A;  3AVH A;  2KFN A;  3CME N;  3M8S A;  3SCX A;  3OJS A;  4HUE A;  3V1R A;  4MLE A;  4YOR A;  4DR4 K;  2D4W A;  4F2S A;  2E1Z A;  4CHZ A;  4A61 A;  1WN7 A;  3NAE A;  3LAL A;  1NOZ A;  4BRK A;  3OYL A;  5C15 A;  1YTA A;  2P9N A;  2P1J A;  4B9V A;  3RRG A;  1C6V A;  1BCO A;  3OYH A;  1W0H A;  3VGM A;  5HOO A;  5EVZ A;  1KXP A;  4BRH A;  2HOE A;  1E4F T;  1DGK N;  4C23 A;  2YNG A;  4H0O A;  4KHU A;  3I55 N;  1HQE A;  1RTI A;  4OLA A;  4CGJ A;  1B9F A;  1JLQ A;  3QNO A;  1LWE A;  3QIO A;  2VCP A;  5JVH L;  1S1U A;  1NKB A;  2Q97 A;  3VTI A;  1GOA A;  3TAP A;  4GV9 A;  1VSI A;  4CE9 A;  4RW4 A;  4CF9 A;  2ITG A;  2VG5 A;  4CJE A;  1TKD A;  3DM2 A;  3DJC A;  1GLA G;  4J2A A;  1N33 K;  4NLB A;  5C24 A;  2YHA A;  2FXU A;  4TSX A;  2HW3 A;  4CF8 A;  3PIP L;  1BIZ A;  3KWG A;  3L3V A;  3KWI A;  4GKK K;  4FWR A;  3O3G A;  4AHV A;  4OPH A;  1QQO A;  3AVK A;  2HHS A;  3FFK B;  4B3O A;  1JXE A;  4KHS A;  2OA8 A;  3OYF A;  4R79 A;  4JNE A;  4JS5 A;  4DSI A;  1SUQ A;  4HTU A;  1RBR A;  1YVU A;  1KC8 O;  3EEQ A;  4CJQ A;  4CIE A;  2FF3 B;  2ITM A;  4JKA A;  3WQU A;  4DKW A;  4CCH A;  3GL1 A;  5FPE A;  3SV3 A;  1F21 A;  2XHB A;  1XNQ K;  2OPR A;  4FWK A;  3TI0 A;  2P9I A;  3LL3 A;  4B1X B;  1SQK A;  1Y97 A;  3I0R A;  3I8B A;  3F9K A;  5BN9 A;  4FM2 A;  2OTJ N;  4BDY A;  3HK2 A;  1G15 A;  2A5X A;  4BRN A;  1HNZ K;  4H0Y B;  2DFF A;  1NMD A;  4DSE A;  1IKY A;  4HCB A;  1NGB A;  4YOY A;  5AJ3 K;  3D2E B;  5FRN A;  4N56 A;  3QIN A;  2NRT A;  5HRR A;  4OPJ A;  4KTW A;  3O6W A;  1OH8 A;  1SL2 A;  1C0F A;  1X9W A;  2DY4 A;  3MWT A;  3KLI A;  3G71 N;  1C1A A;  4BE1 A;  3VGL A;  3VOV A;  1T05 A;  4H5V A;  2YNH A;  4X65 K;  4K8Z A;  4E19 A;  1HYZ A;  2E2P A;  5FRM A;  5C42 A;  2F7T A;  4KHQ A;  2YNI A;  3AV9 A;  3LPU A;  2Z1J A;  4U67 L;  5KQ8 A;  3AA5 X;  5EOY A;  1FK9 A;  1NGE A;  1WNS A;  1VQ7 N;  4JI5 K;  4JHD A;  2QA4 N;  3ZYY X;  2D0A A;  3MWP A;  4K25 A;  3WNG A;  2P9N B;  3AAP A;  4BQL A;  5TKW A;  4KH6 A;  4LFC K;  2W6L A;  5LJW A;  3ULD A;  1NMN A;  3DXK A;  2E6M A;  1BA1 A;  3AA2 A;  5F1X A;  3CCS N;  3MN6 A;  2Y1J A;  4KPY A;  4ILG B;  3NMU A;  4RW7 A;  4FJJ A;  4MFB A;  3QET A;  2F8T A;  3AVJ A;  4CJF A;  1ASU A;  4CFC A;  3ENH A;  2OTL N;  2LSN A;  4B1W B;  3EZ5 A;  4JEP A;  3C6H A;  4CJW A;  2O8F A;  4MDA A;  1WAJ A;  4B1U B;  3OYA A;  1IKW A;  5FPN A;  4K0K K;  4FLZ A;  4WCE L;  2FSN A;  2IC3 A;  4IDH A;  4IO9 L;  3ZT1 A;  1VSH A;  1JCF A;  3QDK A;  4AIL C;  2BTF A;  3LZJ A;  2Q0R A;  3VQA A;  4DU4 A;  2A3Z A;  2FSJ A;  4JKH A;  3SJH A;  4BVP A;  4O0I A;  4FK0 A;  4OPA A;  5GIP A;  4KO0 A;  1LOT B;  4B3S K;  4XEI A;  1ATS A;  1XUP O;  3MX5 A;  2QXL A;  3VEO A;  4PL7 A;  5AZJ A;  3FZK A;  3HPO A;  1LAV A;  4X66 K;  2FBV A;  3VGK A;  4CEF A;  4CBW A;  3J7Y P;  2P9U A;  3BDP A;  4BRL A;  5DM6 L;  3VEX A;  4CJ5 A;  4AHT A;  5FPM A;  3E9O A;  4IO8 A;  3CM5 A;  4J8F A;  4FM1 A;  4CGF A;  1A5W A;  3OTO K;  4YHH K;  4FK4 A;  2PAV A;  5I42 A;  1VSK A;  5FDL A;  3LDQ A;  4B9U A;  2P9I B;  3OYB A;  1P90 A;  5HLF A;  1EP4 A;  2XY8 A;  3O1W A;  1KQS M;  1NLV A;  1XMO K;  3FGU A;  4DTJ A;  3MEG A;  4BGA A;  1BIS A;  2NUB A;  2NZT A;  2ZE2 A;  3QLH A;  4E7I A;  1KVB A;  3CJA A;  1RFQ A;  4BC3 A;  4CF2 A;  4B9S A;  1NOY A;  3PY8 A;  3KK3 A;  2Q2R A;  3K9K A;  2P5G A;  4DV1 K;  1MU2 A;  2D0C A;  4N5S A;  4OVL A;  1W97 L;  3ZT3 A;  3EYZ A;  1HYV A;  3QBW A;  3WUH A;  1N36 K;  3AVF A;  3HTV A;  4OGE A;  5E41 A;  3HOT A;  3C94 A;  4LF9 K;  1HR0 K;  1K8K A;  4J2E A;  3LAK A;  5T7B A;  1LAW A;  4RW8 A;  3WNH A;  2GV9 A;  2QWL A;  3LP1 A;  1U4B A;  4N41 A;  2GUP A;  4KB0 A;  2UYT A;  4KTZ A;  2UUC K;  5CR4 A;  2IS3 A;  4JI7 K;  3WXI A;  2F4V K;  3VA0 A;  4Y1D A;  3VMF B;  2UXD K;  4CZG A;  4FW2 A;  1NGC A;  3R8E A;  3FFI A;  3MCP A;  3MEC A;  2YCH A;  1UAX A;  5C2F A;  3IUC A;  2CGJ A;  3THX A;  3S9H A;  3SQ0 A;  4QS9 A;  1JLF A;  5BPL A;  3EKU A;  3DXK B;  4CJ7 A;  3SNN A;  4Q5V A;  4CJU A;  3A2F A;  1NGG A;  3LWL A;  1T03 A;  1WSE A;  4PHT X;  2O4I A;  4CZM A;  4DTU A;  3LM9 A;  4M45 A;  4DR5 K;  4FZX C;  4H0T B;  2DPN A;  1IJJ A;  4E7H A;  1BOT O;  3WQT A;  4DQR A;  1Q9X A;  1IH7 A;  4CF0 A;  5HBM A;  3ZSX A;  2G8H A;  4FJL A;  1MDU B;  3ZSY A;  2O8D B;  1YF5 L;  1ZBF A;  5JS2 A;  3H45 C;  2JGU A;  2W41 A;  3T1A A;  1ZYQ A;  2O8F B;  2E8A A;  1QQM A;  5JS1 A;  4EFH A;  5CE3 A;  3JAM O;  3N4P A;  3F9M A;  1HNX K;  5I3U A;  1TAU A;  2WUS A;  1NGD A;  3VQ4 A;  3U9Z A;  3EZW A;  4KKO A;  1YHQ N;  4F3O A;  5M1K A;  3VQQ A;  3TAQ A;  3L2W A;  3O3H A;  3SAG A;  2NRX A;  2ASP A;  3MEE A;  4CEZ A;  4HHT A;  1KVA A;  4DTX A;  2QK9 A;  1VQK N;  1XC9 A;  3P39 A;  4DV3 K;  3K5N A;  3CQY A;  3ZX0 A;  4ZTF A;  3CFO A;  3L8B A;  5AQS A;  1Q9Y A;  2ASM A;  4GMJ B;  2RN2 A;  4J2B A;  5HRO A;  4AM7 A;  3L2R A;  5CYM A;  5I9E B;  2HHT A;  4CJR A;  1X9S A;  2BGG A;  3SMP A;  4OKJ A;  2P9U B;  3CMA N;  3M8P A;  4DS4 A;  4B1V A;  3D45 A;  5SWM A;  1TL3 A;  4N47 A;  3JSM A;  1LWC A;  1Q86 O;  4DR2 K;  1KSP A;  1SL0 A;  4YDU A;  3KLE A;  4GW6 A;  2E2N A;  4OKE A;  1L3U A;  1S9G A;  3SUQ A;  4CEE A;  1ATN A;  4FM0 A;  4IEI A;  3DLK A;  2EHG A;  2HVH A;  3V9S A;  3VQP A;  3IKM A;  4JK9 A;  3IDH A;  4JLH A;  3ZCM A;  4CED A;  2ZD1 A;  1U47 A;  2G8F A;  4CK3 A;  3D7E O;  2V52 B;  1XMQ K;  4BRQ A;  3O1B A;  5CZ1 A;  3E01 A;  4KHY A;  4JI3 K;  1VQL N;  1TL1 A;  1K8K B;  4ILJ A;  1VQN N;  4E7L A;  1EXQ A;  4H5N A;  4M3T A;  4CJL A;  3ASM A;  5FRO A;  1RDB A;  3U4L A;  3CYM A;  3VQB A;  3U9D A;  4LSL A;  1RT3 A;  3KKR A;  4FLT A;  2P9K A;  1BG3 A;  4B08 A;  5HL7 L;  4DV4 K;  1KLN A;  3V9Z A;  3OA9 A;  1TV6 A;  2F96 A;  3R6M A;  5KGW A;  1VSM A;  3HP9 A;  4WQ4 A;  2YHB A;  5ADX H;  5J2Q A;  3THX B;  1VSD A;  4CZL A;  1QSY A;  4BR0 A;  1ZBI A;  5AFU H;  3L3U A;  1U2V A;  2VWK A;  3WXL A;  2O8E A;  2NNW A;  4JKF A;  1S22 A;  1KRP A;  2FBT A;  1NNE A;  2BAN A;  3ZSZ A;  2A6A A;  5FLX O;  2HHX A;  3HM9 A;  4NYF A;  4CI6 A;  4K43 A;  2P51 A;  4KI6 A;  2I7N A;  1ZXO A;  1Z26 A;  1GLC G;  3WEE A;  3TAG A;  2KHO A;  3KTQ A;  4DWI A;  2J4R A;  4YOV A;  3M5R A;  2Z1G A;  5BRE A;  2P5O A;  4K41 A;  1T8E A;  2O4G A;  2G8U A;  3H46 O;  1RDA A;  4I9L A;  3TSP A;  2ZGZ A;  1RBV A;  3KK2 A;  4YNQ A;  4H03 B;  3T1H K;  3EE8 A;  4BDP A;  3TTC A;  3TWH A;  1HPM A;  3MN5 A;  3U3G A;  4CJT A;  3C6U A;  4FYD A;  4M3X A;  2QTD A;  2UXB K;  3VF6 A;  4DFK A;  4M3Z A;  4CHO A;  4KAZ A;  4FSV A;  1C0M A;  3B6P A;  4XH4 A;  4CD1 A;  3TU5 A;  3ZSQ A;  2GTD A;  4O5F A;  1BO5 O;  3SBG A;  4I2Q A;  4CJP A;  3A5M C;  4ISG A;  4E7K A;  3VA3 A;  4CHP A;  1V4S A;  3EY1 A;  1IKX A;  3C0B A;  1D9F A;  1JL2 A;  1CLQ A;  2QKB A;  3KK7 A;  2QWP A;  4KRE A;  1J9A A;  2OPP A;  1ILY A;  4C1N I;  3QB0 A;  3DMJ A;  3U8X A;  3CPW M;  1M90 O;  4FWL A;  3EL2 A;  5DM7 L;  4DFP A;  1WOQ A;  1SKW A;  4DTN A;  3JXU A;  5AQW A;  4FJ5 A;  5BRD A;  5KRT A;  3QEV A;  1BQN A;  2H3G X;  1YJN N;  4BE2 A;  2QWN A;  3CJC A;  4LY7 A;  1SKR A;  4CGI A;  2GWJ A;  4DFJ A;  4O0J A;  3KHY A;  3IMX A;  2UUA K;  3O5B A;  5JLF A;  1J5O A;  2PZS A;  2HHQ A;  4DTP A;  1EQY A;  4F2R A;  1YI2 N;  1S9E A;  2P9L A;  1S1W A;  1LW2 A;  1XHX A;  5CZ2 A;  3VES A;  4CK2 A;  1TVR A;  1JJ2 M;  1NK5 A;  3LDL A;  4B3T K;  3V9U A;  4RW6 A;  5AQU A;  3PUF A;  4A2B A;  4L8R B;  1CZB A;  1QE1 A;  2P9K B;  4FJH A;  3N4Q A;  4GNI A;  1WLJ A;  1RGI A;  4HVJ A;  1GLL O;  2P9S A;  4DSF A;  2A1S A;  3O4Q A;  2VWJ A;  4DQQ A;  3NF9 A;  5JLH A;  1VSE A;  4GKJ K;  1BIU A;  4JI0 K;  4NCA A;  3NF6 A;  1A5X A;  1DT9 A;  4JKC A;  4JKB A;  3M8R A;  1U2V B;  3O4W A;  1Z05 A;  4KI4 A;  1NGH A;  4BRC A;  1NK8 A;  2O8E B;  5HP1 A;  3HPH A;  3RMA A;  1K73 O;  3V9X A;  4JKG B;  3HT3 A;  3AVA A;  3QO9 A;  5LY3 A;  3T1Y K;  2ZQB A;  2ETJ A;  1W2B M;  4BDZ A;  3K9J A;  4F9O A;  2JLE A;  1XQS C;  2NLX A;  1REV A;  4L3Q A;  2JWK A;  1QQC A;  2B6A A;  3DWL A;  3M8Q A;  4CZF A;  1J5E K;  1S6Q A;  3LDN A;  1VAZ A;  3WEE B;  1Z6R A;  1VRT A;  3NH1 A;  3LAN A;  3THW A;  4FJ7 A;  5AQM A;  4FOI A;  3MX2 A;  1BWF O;  3QEX A;  1BGX T;  4XIU A;  1JXB A;  4M7X A;  3LPT A;  3AVB A;  4ILH A;  5EY4 A;  2V7Y A;  3V81 A;  1WSH A;  1U49 A;  4PKH A;  3ZEU A;  1CZ9 A;  3U6F A;  3K57 A;  4KTQ A;  3K59 A;  4YOU A;  3FZM A;  4ID5 A;  4WQ5 A;  5AQY A;  3O08 A;  3DLL L;  1Q81 O;  1YTU A;  1KVC A;  4EP4 A;  3MMV A;  3QES A;  1RTJ A;  3HYF A;  4JV5 K;  4EHU A; 
#chains in the Genus database with same CATH homology
 4B9U A;  3OYB A;  4WE1 A;  5HLF A;  1EP4 A;  3RWU A;  2XY8 A;  4PA1 A;  1NJW A;  1LWF A;  1X1P A;  3O4N A;  4M3U A;  1RIL A;  1WAF A;  5KRS A;  4CHY A;  4CIG A;  4DTJ A;  1L5U A;  3CQ8 A;  3MEG A;  1VRU A;  3VQ8 A;  4FLX A;  3S3M A;  1BIS A;  3IS9 A;  1XHZ A;  1U48 A;  4FJN A;  2HVI A;  2NUB A;  1IKV A;  2DFE A;  4AHR A;  4YFU A;  2HHW A;  1EET A;  4BWM A;  3HPG A;  3OS0 A;  2ZE2 A;  3QLH A;  4E7I A;  4J2D A;  1KVB A;  4CF2 A;  3AO4 A;  2XO7 A;  4B9S A;  1NOY A;  2E4L A;  3WNE A;  3PY8 A;  4CEA A;  3KK3 A;  3VQC A;  1VSJ A;  4IFY A;  3VQ6 A;  2P5G A;  3RRH A;  1MU2 A;  1N5Y A;  2D0C A;  4Z4C A;  3NGY A;  4N5S A;  4OVL A;  1VK0 A;  2YV0 X;  3ZT3 A;  3OYC A;  3EYZ A;  4FJM A;  3HVT A;  1HYV A;  3AVF A;  4OGE A;  5E41 A;  3C94 A;  3THV A;  4FZZ A;  3CM6 A;  4J2E A;  3LAK A;  5T7B A;  1LAW A;  4RW8 A;  3WNH A;  2GV9 A;  1S1V A;  1YT3 A;  3HXM A;  2KW4 A;  3LP1 A;  1U4B A;  4HCC A;  4N41 A;  1JL1 A;  4KB0 A;  4KTZ A;  1B92 A;  3L2Q A;  1RT7 A;  2IS3 A;  3V1Q A;  1U04 A;  4FW1 A;  2W42 A;  1WSG A;  3OY9 A;  4Z4F A;  1HRH A;  3NDK A;  3SQ4 A;  4E1N A;  1UA0 A;  3I0S A;  1O1W A;  4IG0 A;  4W5O A;  3VA0 A;  1RDD A;  4Y1D A;  3H08 A;  1RBT A;  3O3F A;  1U45 A;  2KQ2 A;  1L3S A;  4HUG A;  3ALY A;  3L2V A;  1BI4 A;  3CG7 A;  3AVL A;  4FW2 A;  3QNN A;  1C1B A;  3CFR A;  4W5R A;  4FZY A;  3CFP A;  3FFI A;  1RCH A;  3G0Z A;  3MEC A;  1UAX A;  2OPQ A;  1IG9 A;  2OZS A;  4RG8 A;  4KFB A;  4O44 A;  4C8M A;  3S9H A;  3SQ0 A;  2Q3S A;  3G10 A;  1JLF A;  4W5Q A;  3D0P A;  3SPY A;  3SQ1 A;  3TAM A;  4G1Q A;  4I2P A;  2F8S A;  1S5J A;  3SNN A;  4Q5V A;  3VQD A;  4H8K A;  1BL3 A;  3A2F A;  1BCM A;  4CJU A;  3LWL A;  1WSE A;  1T03 A;  3V9W A;  1CXU A;  1RT2 A;  2YKM A;  4FJI A;  2O4I A;  4DTU A;  4M45 A;  3ZSV A;  3LP3 A;  3KLG A;  2RPI A;  4FZX C;  3TAE A;  1S1T A;  4CFB A;  3DRS A;  1DTQ A;  1FKP A;  4E7H A;  1JLG A;  4DQR A;  1Q9X A;  4CFA A;  3C6T A;  1ASV A;  4JS4 A;  1IH7 A;  3TAN A;  4CF0 A;  3ZT4 A;  5HBM A;  3ZSX A;  3ZSO A;  4UQG A;  1BHL A;  4FLY A;  3PX6 A;  3SJJ A;  1SKS A;  4CJV A;  4FJL A;  3DYA A;  3ZSY A;  1QTM A;  1DLO A;  1NKC A;  1TK5 A;  2HMI A;  1ZBF A;  5JS2 A;  3SYZ A;  3LP0 A;  2JGU A;  3JYT A;  4I9Q A;  5HRP A;  4QOZ B;  3T1A A;  2G8V A;  1ZYQ A;  4CHQ A;  4BAC A;  4GVM A;  4FLW A;  4DF8 A;  1NKE A;  3P5J A;  3OVN A;  3ISN C;  4NCB A;  4IFV A;  4AHS A;  3T3F A;  5JS1 A;  2HHV A;  4FLU A;  5I3U A;  4KHN A;  1TAU A;  1LV5 A;  3VQ4 A;  3K58 A;  4IBN A;  2IGI A;  4KKO A;  2BDP A;  4H4M A;  4F3O A;  4FJK A;  3VQQ A;  4O4G A;  1S1X A;  1VSL A;  3V1O A;  4EZ9 A;  3TAQ A;  3L2W A;  4BWJ A;  3RMB A;  3O3H A;  3NCI A;  2A1R A;  3DLE A;  4M3R A;  4LH5 A;  3U3Y A;  3MEE A;  2IOC A;  4CEZ A;  3LDS A;  4FJ9 A;  2VG7 A;  1BQM A;  4HHT A;  1KVA A;  4DTX A;  1K6Y A;  2QK9 A;  1XWL A;  4ZHR A;  3TAB A;  3PX4 A;  2PYL A;  2QXF A;  4FJ8 A;  4W5T A;  1XC9 A;  1QSL A;  3K5N A;  5KI6 A;  1KCF A;  2FBY A;  1JLE A;  3CFO A;  3AA3 A;  3L8B A;  4ZTF A;  1J54 A;  1Q9Y A;  4DTM A;  4OLB A;  1N6Q A;  1RT6 A;  1T7P A;  4GMJ B;  1ZBU A;  2RN2 A;  4ID1 A;  3AVM A;  5HRO A;  4CEQ A;  4DG1 A;  3QEW A;  4DU1 A;  4J2B A;  3L2R A;  5CYM A;  4DLE A;  4DU3 A;  3QER A;  1VSF A;  3MXJ A;  3OYE A;  4CJR A;  2R7Y A;  3QEI A;  1X9S A;  1RT1 A;  4Z4I A;  2XY7 A;  4FJX A;  2BGG A;  1TKZ A;  1FXX A;  3TAR A;  1UOC A;  1TK8 A;  4OKJ A;  4DMN A;  3M8P A;  3HL8 A;  1D8Y A;  4DSK A;  4DS4 A;  3PO4 A;  3D45 A;  3K2P A;  5SWM A;  1TL3 A;  3DLG A;  3AVN A;  5KTQ A;  4CK1 A;  3OYJ A;  1CXQ A;  2Z1H A;  3AO5 A;  4Z0U A;  4N47 A;  4M41 A;  1WSJ A;  1LWC A;  4E89 A;  3JSM A;  4NCG A;  1KFD A;  1KSP A;  4QCL A;  3MXI A;  1RTH A;  4CJ3 A;  4IKF A;  1NK7 A;  2E6L A;  1SL0 A;  2GBZ A;  1WSI A;  4FYD A;  3K5M A;  1Z25 A;  4OGC A;  2OZM A;  1UA1 A;  1A5V A;  3VQ7 A;  3UIQ A;  4CES A;  4PQU A;  4JRP A;  3KLE A;  2KZZ A;  3DRP A;  4GW6 A;  3SPZ A;  2X6S A;  4DSL A;  4O55 A;  4QAG A;  2VG6 A;  4OKE A;  1L3U A;  4PY5 A;  1UWB A;  1D5A A;  1S9G A;  4DSJ A;  3SUQ A;  4CEE A;  3I8D A;  3KD1 E;  4M3Y A;  4FM0 A;  4DQI A;  3OJU A;  4F8R A;  3IAY A;  3HJF A;  3DLK A;  1SV5 A;  1Q8I A;  2EHG A;  2HVH A;  3V9S A;  3VQP A;  3TAF A;  1ITG A;  4JLH A;  3ZCM A;  4CED A;  3AVH A;  2YKN A;  2FC0 A;  1RT4 A;  2ZD1 A;  2KFN A;  3K5L A;  2HNZ A;  4R5P A;  3M8S A;  4DTS A;  1U47 A;  3SCX A;  2G8F A;  3OJS A;  1L3T A;  4HUE A;  3V1R A;  4CK3 A;  1HQU A;  4B8A B;  3SUP A;  4HUF A;  4F2S A;  4CHZ A;  5CZ1 A;  5J2N A;  4CER A;  3E01 A;  3OYN A;  4KHY A;  1WN7 A;  3NAE A;  3S3N A;  3LAL A;  1TL1 A;  4C8L A;  2HHU A;  4W5N A;  1NOZ A;  3LAM A;  1HJR A;  3OYL A;  2DFH A;  3OYD A;  3T19 A;  1YTA A;  4C8K A;  4EP5 A;  4DFM A;  2P1J A;  4B9V A;  1IO2 A;  2X6N A;  1EXQ A;  4E7L A;  3RRG A;  1C6V A;  1BCO A;  1GOB A;  3DOL A;  4CJL A;  3OYH A;  1W0H A;  3ASM A;  5SZT A;  5J2P A;  5FRO A;  1RDB A;  3SUN A;  4DQP A;  3VQ9 A;  1NJX A;  3CYM A;  3VQB A;  3V4I A;  4LSL A;  3DRR A;  1RT3 A;  4B9N A;  3LZI A;  1RTD A;  1TK0 A;  2YNG A;  3ZT0 A;  4KHU A;  3KKR A;  1DTT A;  4FLT A;  1HQE A;  4B08 A;  1RTI A;  4OLA A;  1KLN A;  4CGJ A;  4FK2 A;  1B9F A;  3V9Z A;  3DLH A;  1JLQ A;  4B9M A;  2X74 A;  3QNO A;  1BI4 B;  4RW9 A;  4CIF A;  4E7J A;  1TV6 A;  1LWE A;  2F96 A;  3QIO A;  1S1U A;  2HB5 A;  1NKB A;  5KGW A;  3NH0 A;  1VSM A;  3AA4 A;  3HP9 A;  4ICL A;  5CY4 A;  4AHC A;  4OPK A;  1TKX A;  1TKT A;  2YHB A;  4CEC A;  5J2Q A;  2RF2 A;  1GOA A;  1VSD A;  3TAP A;  4CHN A;  1VSI A;  4CE9 A;  4DQS A;  1QSY A;  4RW4 A;  4CF9 A;  4IDK A;  2ITG A;  3HVR A;  1ZBI A;  4Z4G A;  2VG5 A;  3L3U A;  2VWK A;  4CJE A;  1ZBH A;  1TKD A;  3DM2 A;  1KRP A;  2FBT A;  4J2A A;  4ELU A;  5C24 A;  3NH2 A;  4FJG A;  2BAN A;  2YHA A;  3ZSZ A;  2HHX A;  4FXD A;  3HM9 A;  1RT5 A;  4NYF A;  1KFS A;  3KD5 E;  4TSX A;  2HW3 A;  4CF8 A;  4B8C A;  2P51 A;  3NE6 A;  4KI6 A;  1BIZ A;  3L3V A;  2ATQ A;  4CJK A;  2D5R A;  5J2M A;  3O3G A;  1Z26 A;  4C8O A;  4AHV A;  3TAG A;  3AVK A;  2HHS A;  3KTQ A;  3ITH A;  3NGI A;  1JXE A;  4LH4 A;  1I39 A;  1XI1 A;  4DWI A;  4KHS A;  4B3O A;  1HNV A;  3DLR A;  5DK5 A;  1WSF A;  2G8K A;  2HHT A;  4H4O A;  2OA8 A;  2KFZ A;  2Z1G A;  3MAQ A;  4CJ4 A;  3OYF A;  2P5O A;  1T8E A;  2O4G A;  2G8H A;  2G8U A;  2DTU A;  1NJZ A;  1RDA A;  4I9L A;  3OYG A;  4JS5 A;  4DSI A;  1SUQ A;  4MQ3 A;  4KHW A;  4M3T A;  3NFA A;  1GOC A;  1RNH A;  1J53 A;  1RBV A;  3OYM A;  4JRQ A;  2HNY A;  4HTU A;  1RBR A;  1YVU A;  3KK2 A;  4M3W A;  4Z4H A;  4YNQ A;  2PYJ A;  4BDP A;  4CJQ A;  4CIE A;  1KTQ A;  3KK1 A;  3TWH A;  3SUO A;  4DTR A;  3V6D A;  4CCH A;  3U3G A;  1C1C A;  3C6U A;  4CJT A;  4CGD A;  4ELT A;  3QIP A;  4E3S A;  1FKO A;  2FBX A;  4M3X A;  3SV3 A;  1TAQ A;  4DFK A;  1F21 A;  2XHB A;  1S6P A;  4EZ6 A;  3VQE A;  3BGR A;  2OPR A;  4CHO A;  1X9M A;  4M3Z A;  4KAZ A;  1RDC A;  3TI0 A;  3OS2 A;  2Y1I A;  1C0M A;  3B6P A;  1Y97 A;  3I0R A;  4CGH A;  1QSS A;  3F9K A;  1SL1 A;  2KTQ A;  3ZSQ A;  4FVM A;  4DS5 A;  1R0A A;  3SZ2 A;  4I2Q A;  4FM2 A;  4CJP A;  4CJS A;  2Z1I A;  4B9T A;  4LD0 A;  4BDY A;  3VA3 A;  4E7K A;  3AVI A;  4CHP A;  3HK2 A;  1G15 A;  3EY1 A;  1IKX A;  1D9F A;  1JL2 A;  1CLQ A;  2DFF A;  2QKB A;  4DSE A;  1IKY A;  4OJR A;  5K14 A;  4HCB A;  2WON A;  4I7F A;  1J9A A;  2OPP A;  4ELV A;  4KRE A;  5FRN A;  1JLC A;  4N56 A;  1NJY A;  3QIN A;  5D3G A;  4OPJ A;  5HRR A;  4PUO A;  3DMJ A;  4KTW A;  1SL2 A;  4B9L A;  2DY4 A;  1QS4 A;  1X9W A;  1HPZ A;  3ZSR A;  3AO1 A;  3KLI A;  3AVG A;  1C1A A;  4BE1 A;  1NK9 A;  3RMD A;  1I3A A;  5DMR A;  4DFP A;  3RR8 A;  1SKW A;  4DTN A;  2G8I A;  1T05 A;  1NK4 A;  4FJ5 A;  1EX4 A;  3IRX A;  2YNH A;  4K8Z A;  4E19 A;  1HYZ A;  5FRM A;  3MED A;  5C42 A;  5KRT A;  3HP6 A;  3QEV A;  1BQN A;  3PV8 A;  3NHG A;  1JKH A;  5HRS A;  5KGX A;  3OYK A;  4BE2 A;  4CEO A;  4KHQ A;  2XRI A;  2YNI A;  3K5O A;  4LY7 A;  3OYI A;  3HO1 A;  1ASW A;  3AV9 A;  1SKR A;  5C25 A;  3LPU A;  4CGI A;  4DFJ A;  4O0J A;  3OS1 A;  2Z1J A;  4PWD A;  4K8X A;  2IDO A;  3VQ5 A;  1J5O A;  2PZS A;  4CFD A;  2HHQ A;  3AA5 X;  3P1G A;  1QHT A;  4DTP A;  4KB1 A;  1FK9 A;  1WNS A;  4DLG A;  4DTO A;  4F2R A;  1S9E A;  2D0A A;  3WNG A;  4CGG A;  3P83 D;  4IG3 A;  3AO2 A;  2IAJ A;  2G8W A;  3DI6 A;  3KKS A;  3ULD A;  2X78 A;  1S1W A;  1LW2 A;  1D9D A;  5HRN A;  1XHX A;  5CZ2 A;  4CK2 A;  2E6M A;  3B6O A;  1TVR A;  1TGO A;  3AA2 A;  1NK5 A;  2B5J A;  2PY5 A;  3V9U A;  4RW6 A;  4FLV A;  3PUF A;  2Y1J A;  4KPY A;  4L8R B;  1C0U A;  4O5B A;  1CZB A;  1QE1 A;  2GUI A;  2KZM A;  4FJH A;  1RBS A;  4NYN A;  5J1E A;  1WLJ A;  1L3V A;  4LSN A;  3AO3 A;  4HVJ A;  4RW7 A;  4FJJ A;  4DSF A;  4MFB A;  2A1S A;  2D0B A;  4N76 A;  3ZT2 A;  3QET A;  3O4Q A;  2I5J A;  2EX3 A;  1NK6 A;  2VWJ A;  3KIO A;  4DQQ A;  3NF9 A;  2F8T A;  4OKK A;  3AVJ A;  5CYQ A;  4CJF A;  1VSE A;  1ASU A;  4KRF A;  4CFC A;  1BIU A;  3AVC A;  4Z4E A;  3RTV A;  1HNI A;  3NF6 A;  4NCA A;  2LSN A;  1A5X A;  3HST B;  3PX0 A;  1HYS A;  4AHU A;  3EZ5 A;  3SQ2 A;  2RKI A;  3IG1 A;  3M8R A;  4AH9 A;  4CJW A;  4KI4 A;  1WAJ A;  3OYA A;  3LWM A;  1NK8 A;  3KLF A;  5HP1 A;  3HPH A;  3RMA A;  3V9X A;  4KV8 A;  1RBU A;  2OYQ A;  1IKW A;  3HT3 A;  3QEP A;  3AVA A;  3QO9 A;  2ZQB A;  3NBP A;  4FLZ A;  2ETJ A;  2BE2 A;  3NF8 A;  4BDZ A;  4DF4 A;  2AJQ A;  2JLE A;  2IC3 A;  3NF7 A;  3ZT1 A;  1VSH A;  3L2U A;  3SV4 A;  3RR7 A;  4E0D A;  1KLM A;  1HMV A;  1REV A;  2HND A;  1QQC A;  2B6A A;  3LP2 A;  2WOM A;  3M8Q A;  4E1M A;  4AIL C;  1S6Q A;  3LZJ A;  1NK0 A;  5EU7 A;  1C0T A;  3NGZ A;  3SI6 A;  1ZBL A;  1LW0 A;  1B9D A;  3PO5 A;  3VQA A;  1VRT A;  3NH1 A;  3LAN A;  4DU4 A;  4FJ7 A;  1W9H A;  3RMC A;  4O0I A;  4C8N A;  4FK0 A;  3DOK A;  3VN5 A;  4KO0 A;  3KLH A;  3KJV A;  3QEX A;  1BGX T;  4XIU A;  4F4K A;  1JXB A;  3DLB A;  4CEB A;  2QKK A;  2YNF A;  3WNF A;  3LPT A;  2XY6 A;  3AVB A;  3C95 A;  4Y1C A;  1LAV A;  4CF1 A;  3HPO A;  3V81 A;  3F73 A;  3MXM A;  1WSH A;  2FBV A;  2OPS A;  4ZTJ A;  1U49 A;  4BE0 A;  4CEF A;  1CZ9 A;  3U6F A;  3K57 A;  4KTQ A;  3BDP A;  1EKE A;  3K59 A;  4Q0B A;  4ID5 A;  4AHT A;  4CJ5 A;  4M42 A;  3CM5 A;  4FM1 A;  1YTU A;  1KVC A;  1JLA A;  1JLB A;  3ZSW A;  3TR8 A;  4CGF A;  4EP4 A;  1A5W A;  2B4J A;  3S3O A;  4FCY A;  4FK4 A;  3QES A;  1RTJ A;  4F3T A;  3HYF A;  1VSK A;  5I42 A;  5FDL A;  2XY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...