4AHRA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
155
structure length
153
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 59
structure length 153
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahrA00
2XRIA 2JLEA 3CFPA 3E01A 1HNVA 2YHAA 3LANA 3VA3A 3DRRA 1NOZA 4B3OA 1VSKA 1F21A 4AHRA 4JS4A 1JKHA 2YV0X 1Q9YA 4EP4A 1C1AA 1BGXT 1YT3A 2RPIA 3JSMA 4HUEA 1RTDA 2G8WA 4B9NA 4F2RA 3HJFA 4CK1A 1Y97A 4DTSA 1XWLA 4FM2A 3AVKA 4KTZA 1NK4A 1ASWA 1UOCA 3CM6A 1SUQA 3IS9A 3K2PA 1VRUA 3PUFA 4Z4HA 4E89A 3L2VA 3LWMA 3JYTA 3PV8A 3TAFA 3FFIA 3HSTB 2PY5A 4RW8A 4CJSA 4LSNA 2YNHA 4FJ9A 4RW6A 4B9MA 2PZSA 4Y1CA 1RT7A 3AV9A 4CF9A 3LZIA 1RBVA 5KI6A 2YNIA 1D8YA 3OYCA 4AHVA 1QSYA 1RBTA 2B5JA 4M3WA 1TL3A 3T19A 3EZ5A 4CERA 3S9HA 5J1EA 4CFAA 3RR7A 3SPYA 1BI4B 3VQ9A 3QESA 3MXIA 2G8VA 2ZD1A 2PYLA 1DTQA 1LWFA 3NGIA 1XC9A 4JRQA 3SUOA 1VSFA 5HBMA 3PO4A 2OZSA 4F8RA 1X9SA 1DLOA 4YFUA 5K14A 3TAQA 4DQSA 3O4NA 4KREA 1WSGA 2E6LA 4K8ZA 1RCHA 2KQ2A 2XY5A 3G10A 4N56A 4AH9A 3PX0A 3AO1A 2G8FA 1KLMA 4MFBA 4OKKA 4CJWA 3IG1A 3KD5E 3AVFA 5FRMA 4W5TA 4OPKA 1S6PA 4GVMA 3P83D 4HUFA 1XHZA 3PY8A 4CJ3A 3OYKA 5CYQA 2HHWA 4W5QA 1IG9A 2HMIA 1LWCA 1WAJA 3KD1E 5FDLA 4HVJA 1QHTA 4NYFA 5CZ2A 1S1XA 3NF8A 5E41A 4DTPA 4CHYA 1RT3A 5SWMA 2GV9A 2XO7A 4FW2A 3V6DA 4B9TA 4Z4IA 3V1RA 1N5YA 1C0MA 1RTHA 3AA2A 4KHUA 1JL1A 4RW7A 4BE1A 3SI6A 1LV5A 4CJUA 3NH2A 3D0PA 4EZ6A 1SKWA 3OJSA 4ELTA 2X78A 3AVMA 3U3GA 2FBVA 4DQPA 1W0HA 1HPZA 1BI4A 3CQ8A 4DFPA 1SKRA 3K5LA 1X9MA 2HHVA 3NFAA 1JLAA 3U3YA 3OYEA 2AJQA 3L2QA 3VQAA 3OYDA 4DU3A 1NJXA 2ATQA 1HRHA 1ZBFA 4DTNA 3ALYA 3AVIA 4OGEA 4CF1A 1TKDA 1TGOA 3ZT2A 3OYLA 1U47A 4OLAA 3MXJA 2VWJA 1KVBA 3OS2A 3PX4A 3SQ4A 4KHNA 2EHGA 3VQ4A 1L3TA 4O5BA 3OVNA 4Z0UA 3OYJA 4HUGA 3VN5A 1HNIA 3WNEA 2QK9A 1IH7A 3DI6A 4E7IA 1I39A 1QS4A 3AVBA 3QIPA 3DLHA 2FBYA 2Z1JA 1KVCA 4W5NA 1IO2A 1O1WA 1JLQA 3OJUA 3NH0A 3DLBA 1S9GA 1C6VA 3RRHA 1NJYA 4KB0A 3QERA 3M8PA 2KFNA 3KIOA 1KRPA 1NK0A 3OYMA 1L5UA 1NK8A 3NH1A 2ITGA 3LP2A 4AHSA 4ID1A 4J2BA 4M3ZA 3BGRA 4FCYA 1ASUA 4DTOA 1VSEA 1EX4A 3NF6A 4FLYA 3DLEA 3RMCA 1X9WA 2P5OA 1UA0A 5HRPA 1RT6A 3NHGA 4GMJB 3VQ8A 4B9LA 1NKCA 4CJFA 4KTQA 4QOZB 3NF9A 5EU7A 2F8TA 3ZSOA 1EKEA 1J54A 3KK1A 1VSMA 1ASVA 4LY7A 1WSJA 4OKJA 1XHXA 2OYQA 3NDKA 3LP3A 3AVNA 4FLXA 4F3TA 4DTRA 1RDCA 4Q0BA 1VK0A 1GOCA 5J2MA 1SKSA 3HXMA 3LZJA 4W5OA 4FM1A 4FLTA 4I9LA 3TARA 2YKNA 3L3VA 3S3NA 3IAYA 3EYZA 1J5OA 1Q8IA 4CJQA 3OYAA 3B6OA 3OS0A 3TAPA 4CK2A 2KW4A 3LALA 1VSDA 4DFMA 4CEOA 3C95A 1FKOA 3NCIA 1Z26A 3HL8A 2D0AA 3QEPA 1KFSA 1MU2A 4YNQA 3HT3A 1BCOA 1S1VA 2W42A 3SQ1A 3ZT3A 2NUBA 1ZBIA 3OYNA 4CEZA 3MEEA 4PQUA 1S6QA 3BDPA 1U49A 2Z1GA 4M45A 4BDPA 2ETJA 3AA4A 4DMNA 3OYGA 3A2FA 1T05A 4BE2A 4FJXA 4FZZA 1A5XA 3MEDA 4NCGA 3TWHA 4KKOA 2YKMA 3AO2A 1U4BA 3C94A 1UWBA 4KFBA 3DM2A 4PA1A 3VQCA 4CEAA 3QEWA 3TANA 2X6NA 4FJHA 4FVMA 4WE1A 5C24A 4CEBA 1BISA 3PO5A 4CFBA 4FK4A 3SYZA 3C6UA 3SV3A 1NOYA 1BQNA 2JGUA 3TAGA 4L8RB 5J2PA 4F2SA 3DLGA 2Q3SA 5J2NA 4DQIA 3I0SA 3NGZA 5HROA 1RT5A 2HHQA 3ZSZA 2HHSA 3V81A 3L2RA 1TK5A 1T7PA 1I3AA 1ZBHA 4RG8A 5FROA 2FC0A 4B8AB 1T8EA 3VQDA 1QE1A 1Q9XA 3AA5X 5I42A 4ID5A 4DLEA 2X74A 1TKZA 4FLVA 3NGYA 4CF0A 3ZSYA 1KTQA 4QAGA 5DMRA 3K5NA 3LAMA 4IKFA 3TAEA 1SL1A 2XY6A 1UAXA 1RDDA 2P51A 3RWUA 3DRPA 2BDPA 1VSHA 4E1MA 5KRSA 2Y1IA 4CJKA 3SUPA 5DK5A 3OYHA 4O55A 4Z4CA 1WSHA 1HQEA 2P5GA 5KGXA 4M42A 2ZE2A 2F8SA 2HVHA 1NK6A 1DTTA 1TAQA 4FJ7A 3KKSA 2VG7A 4LH4A 2IAJA 3KLHA 5HLFA 3DRSA 1LWEA 5C42A 5CZ1A 3PX6A 2LSNA 3AVLA 4I2QA 1L3UA 1CZ9A 4E3SA 1A5WA 2Y1JA 3ZSVA 4CECA 3QETA 4H4OA 4FLUA 3WNHA 4QCLA 1QQCA 3RMDA 3HPOA 4DTXA 4FJGA 4LH5A 4BDYA 4KO0A 1LW0A 4FW1A 1FXXA 3L8BA 4JS5A 4FJ5A 4PY5A 3SNNA 3SV4A 4OVLA 4NCAA 1BL3A 1WNSA 3V1OA 5HP1A 3MXMA 1ZYQA 3QEVA 4OLBA 2O4GA 1KFDA 3KTQA 4FXDA 3MECA 1BHLA 1J53A 4DWIA 4M3XA 4O0JA 3L2UA 3K58A 5J2QA 4ZTJA 1ZBLA 3SJJA 3NAEA 2HB5A 3VQEA 3ITHA 3WNFA 3MEGA 4H8KA 4OPJA 4EP5A 4FM0A 2G8UA 1JXBA 1EP4A 1J9AA 2IS3A 4DFJA 2WONA 4FJKA 3K57A 1TVRA 1VSJA 1FKPA 1WLJA 2G8IA 3L3UA 1A5VA 2VG5A 3VQ6A 2OA8A 1WAFA 1RT2A 2P1JA 4E7LA 4F4KA 3QEXA 3QNOA 5C25A 1L3SA 4N41A 4Q5VA 1RDBA 3KLFA 4C8MA 4BDZA 1NJWA 3WNGA 4RW9A 4AILC 4E7KA 4DQQA 3M8QA 4FLWA 4R5PA 1Z25A 1X1PA 2A1SA 3NBPA 3M8RA 3V9SA 4FK0A 1VSLA 3L2WA 4C8LA 4BWJA 4FK2A 4CGHA 4KHQA 4AHCA 3RR8A 3LP1A 1LW2A 3HP9A 4B9UA 1YTAA 2BANA 4NYNA 1NK5A 2RF2A 4N76A 1BCMA 3I0RA 1NK9A 3MAQA 3SQ0A 1IKYA 2D0BA 3V9WA 3D45A 4JLHA 4CJVA 3HPHA 4DS4A 3VQ7A 4CGJA 1NKEA 2BGGA 3ULDA 4CIFA 2G8KA 2YNFA 5I3UA 2YHBA 4CIGA 3AO4A 1IKXA 3QO9A 1HYSA 3VQQA 4HTUA 4F3OA 2HNYA 3AO5A 3HVTA 4BACA 3SPZA 4I2PA 2FBTA 2HHXA 1BIUA 4XIUA 4CF8A 3HPGA 5SZTA 4W5RA 1HYZA 4CEDA 4KHYA 1BQMA 1RT1A 4AHTA 4DU4A 3VQ5A 4FJJA 1RBUA 3OYIA 2OPQA 4CFCA 3T1AA 4DSIA 1GOAA 3NE6A 3B6PA 3THVA 4FJIA 3F9KA 4O44A 4HHTA 4C8KA 2IC3A 5T7BA 5JS2A 1KSPA 3LPTA 4CHOA 4CJEA 1TK8A 2R7YA 1RILA 3KLIA 4KRFA 4CJ4A 2XY8A 3AVHA 3OYBA 2KZMA 1S1WA 3CFOA 1CXUA 1RTIA 1D9FA 3S3OA 2PYJA 1YTUA 5CYMA 4OJRA 3ZSRA 4E19A 3AVJA 4H4MA 4CJLA 1C0TA 3AVGA 1TKXA 3K5MA 2E6MA 3LP0A 4IBNA 4M3UA 3P1GA 4B9VA 2GUIA 4M3YA 2BE2A 3ZT4A 4BWMA 2KFZA 4Z4FA 2OPPA 5CY4A 4FJNA 5HRRA 1B9DA 1XI1A 2G8HA 3IRXA 3LAKA 4DSLA 3KK3A 2O4IA 4KB1A 2HNDA 4CFDA 3KKRA 1JL2A 1G15A 3KLGA 4GW6A 5D3GA 2OPSA 4DFKA 4B9SA 4FJLA 1UA1A 4CHNA 2QXFA 3QINA 1D9DA 1HMVA 2DFEA 2FBXA 2D0CA 2I5JA 1JLGA 1VRTA 4O0IA 3O3GA 2XY7A 1LAWA 1S1UA 3V4IA 3SUQA 3SCXA 1QSSA 1W9HA 3P5JA 1TKTA 2DFFA 3I8DA 4DTMA 2WOMA 3SUNA 4DF4A 4RW4A 1KLNA 1LAVA 4DSKA 3H08A 1NK7A 2HHTA 4CF2A 4ZTFA 1EETA 4DSEA 3AO3A 3SZ2A 4KI4A 2EX3A 3RRGA 4IFVA 3NF7A 4CJTA 4N5SA 4N47A 1IKWA 2DFHA 3O3FA 1REVA 1QSLA 5JS1A 3ISNC 4E1NA 4CGDA 1R0AA 1U45A 1TV6A 1RBSA 3AVAA 4J2EA 4E7HA 3O4QA 4CK3A 3EY1A 3K59A 1K6YA 3ZT0A 1RBRA 1HYVA 5KGWA 1HJRA 4B08A 3ZSXA 2IGIA 4FJ8A 3HYFA 4CCHA 3HM9A 4KV8A 4IDKA 3RMAA 1B92A 1CXQA 2OPRA 1FK9A 3G0ZA 1SL2A 2KTQA 1JLEA 5HRNA 4DTJA 3SQ2A 1L3VA 3LDSA 3AVCA 4CGGA 2YNGA 4KAZA 1U04A 5FRNA 4FYDA 5KTQA 3U6FA 3K5OA 1SV5A 3TABA 1CLQA 3KJVA 4HCBA 1CZBA 3C6TA 1TK0A 3VQPA 4CHZA 3RTVA 3F73A 3DYAA 4Y1DA 3HVRA 4CGFA 2QKKA 1WSIA 1QTMA 3ZSQA 3DMJA 4DTUA 2ZQBA 4E0DA 4KI6A 1RT4A 2HNZA 4OKEA 4DSJA 2VWKA 4KHSA 5KRTA 5HRSA 3V1QA 1JLBA 4G1QA 4CGIA 4FZXC 4M3RA 1ITGA 3AA3A 1RTJA 3KK2A 3UIQA 1BIZA 4J2DA 3HO1A 3OS1A 4DQRA 1KCFA 4CEQA 2A1RA 3DOLA 4CJRA 1RDAA 1S9EA 1N6QA 4DSFA 3M8SA 4K8XA 4FJMA 3LWLA 4ELVA 3O3HA 4FZYA 4ICLA 1C1BA 1U48A 4AHUA 1EXQA 2HHUA 2DTUA 4I7FA 2B4JA 4DF8A 1NKBA 2QKBA 2D5RA 3QEIA 4MQ3A 2IOCA 1SL0A 2X6SA 4Z4GA 3OY9A 3S3MA 4Z4EA 4CESA 4PWDA 4CE9A 3V9ZA 2HW3A 1TAUA 4DG1A 3DOKA 1WSEA 2E4LA 4CHQA 2HVIA 2B6AA 2DY4A 3VQBA 4HCCA 2KZZA 2XHBA 4EZ9A 4J2AA 4IFYA 3CG7A 3HP6A 3T3FA 1B9FA 1JLFA 4B8CA 1IKVA 4CHPA 4IG3A 4C8NA 1S5JA 2VG6A 3TI0A 4TSXA 4DU1A 3TAMA 1WN7A 4DLGA 4LD0A 3ZCMA 3V9XA 2IDOA 3CYMA 2F96A 4OGCA 4ELUA 4IG0A 2Z1IA 4PUOA 4I9QA 3CM5A 3LPUA 3ZSWA 4UQGA 4KTWA 4O4GA 4CJPA 4CEEA 3DLKA 4DS5A 1YVUA 4C8OA 1HQUA 2GBZA 1ZBUA 4CIEA 4NCBA 4CJ5A 1D5AA 1TL1A 2Z1HA 4BE0A 3QIOA 3KLEA 1S1TA 3HK2A 4LSLA 1WSFA 4KPYA 3TR8A 4JRPA 3VA0A 1C0UA 1KVAA 3OYFA 1JLCA 4M3TA 2RKIA 2RN2A 3CFRA 4E7JA 1RNHA 4M41A 1GOBA 1T03A 1VSIA 3ASMA 3QNNA 1JXEA 1NJZA 2OZMA 3RMBA 4KHWA 3QLHA 3V9UA 3ZT1A 4ZHRA 3DLRA 4CEFA 4FLZA 1C1CA
chains in the Genus database with same CATH superfamily
4JKDA 1VSKA 4AHRA 2YV0X 5LJWA 1BGXT 4HUEA 3MWPA 2VCPA 2E1ZA 4BRKA 1VQ5N 3ATUA 4FM2A 3SBTA 2E88A 3B8AX 1ASWA 3IS9A 3PUFA 3PV8A 3JYTA 4Z4HA 3O9TA 3TAFA 5AQZA 2PY5A 3E9PA 3EKUA 4RW8A 4CJSA 3MCPA 3G25A 1D8YA 2O8DB 1JCFA 3MN6A 1RBTA 4GKJK 1TL3A 4PHTX 5J1EA 1BI4B 4K43A 4JRQA 3PO4A 4Y0WA 1X9SA 4YFUA 4KREA 3TAQA 1VQ4N 2ASOA 3VEWA 1FW6A 3O08A 2G8FA 3KD5E 4CJWA 3IG1A 4W5TA 3PY8A 2E2QA 1QQMA 2OCEA 4YY3K 4AF1A 5FDLA 4HVJA 5GINA 1QHTA 4NYFA 4ILJA 5E41A 4Z4IA 3CETA 1K8KA 3KWGA 4KHUA 1YHQN 1JL1A 3AARA 3SI6A 1LV5A 5MLCQ 3CC2N 4DQPA 1W0HA 1SKRA 3R3LA 2BH1A 1JLAA 3CC4N 3PSFA 2AJQA 3OYDA 3CCMN 3AVIA 4OLAA 4YOWA 4B1YB 3C65A 2VWJA 1OVYA 5AQXA 3PX4A 1L3TA 3OYJA 2E20A 1OH6A 1QS4A 1Y64A 4W5NA 4H0OA 1K9MO 2UU9K 5AFUA 1JLQA 3NH0A 4O8UA 5AQKA 1C6VA 1NJYA 1NK0A 1VQON 1L5UA 4JHDB 1NK8A 3NH1A 3LP2A 1ATRA 5AQOA 4CBXA 5HRPA 4GMJB 2QEXN 3TTCA 4CJFA 4KTQA 3CJ1A 3TSPA 4JKCA 1EKEA 1VSMA 1ASVA 4LY7A 4XH1A 4OKJA 4BG9A 3PIPL 3AVNA 1WOQA 4DQ8A 1RDCA 4Q0BA 1SKSA 4MLEA 4KH4A 4FLTA 4I9LA 1YUWA 3IAYA 3CIPA 1Q8IA 4IJAA 3D2EA 3SK3A 3TAPA 2KW4A 3S41A 4DFMA 3C95A 1FKOA 4IOAL 3ZX0A 3HT3A 2P9KB 2NUBA 4PQUA 3OYNA 1S6QA 1GLAG 3BDPA 1U49A 2ETJA 4DMNA 2GUPA 3FR0A 1A5XA 2VGMA 4YHHK 3HM8A 4JI4K 3M3ZA 1U6ZA 3VEOA 4FJHA 2X6NA 4FVMA 4CEBA 4UY8O 4CFBA 1VQMN 3L4QA 3TAGA 4L8RB 4FWQA 4DQIA 5HROA 2HHQA 3ZSZA 3V81A 1I3AA 5FROA 2FC0A 3WXKA 4B8AB 1T8EA 1Q86O 1Q9XA 4K25A 4ID5A 1TKZA 4FLVA 3NGYA 4CF0A 2HHHK 1KTQA 5DMRA 4IKFA 3LAMA 2XY6A 4B1VA 3DRPA 3QICA 2GX9A 3DLLL 3SUPA 1OH7A 3SJHA 4Z4CA 1P90A 1HQEA 1WSHA 3VERA 4JK7A 2F8SA 2HVHA 1NK6A 1DTTA 1TAQA 5BPNA 4NXNK 2IAJA 1T6CA 4E1JA 3MX5A 5M1KA 5C42A 4LF6K 2LSNA 3AVLA 3LDQA 2Y1JA 1FJGK 4FLUA 4QCLA 1NLVA 2ASMA 4C1NK 3PLAA 4KO0A 4FW1A 3L8BA 1Z6RA 3THWB 2O8DA 3SNNA 1BL3A 2KKZA 2ZGYA 3V1OA 2YX6A 2ZF5O 4IOXA 1KFDA 1WUAA 4M3XA 2H3GX 1GLLO 3NAEA 1YJWN 4H8KA 4CZKA 2QI2A 2IS3A 1EP4A 1J9AA 3THYB 3K57A 4JKAA 1WLJA 2G8IA 1QVFM 3L4IA 1RDWX 2Q1NA 1RT2A 4F4KA 1TYQB 4N41A 4Q5VA 1Q18A 2Q36A 1NMNA 4C8MA 1NJWA 2FXUA 3LDPA 3CJCA 3SLCA 4X66K 2QWRA 4DQQA 4H0PA 4EAHD 4X65K 1Z25A 4FWMA 2A1SA 4R5PA 2W6LA 3QFPA 4KHQA 1LW2A 1T3VA 3HP9A 2RF2A 4FOEA 2D0BA 3V9WA 4JLHA 3WXJA 3VQ7A 2YHYA 3ULDA 2G8KA 2YNFA 4V19S 3UKUB 3BY5A 1IKXA 3QO9A 4KHPK 3BF1A 4BACA 3AO5A 3HVTA 3SPZA 2HHXA 3CHWA 2QWOA 4CF8A 5SZTA 3HOTA 3J7AP 3OYIA 4DSIA 4CFCA 2UXCK 3NE6A 3THVA 3F9KA 5T7BA 1KSPA 3CXCM 3LPTA 2GTDA 1RILA 3KLIA 3CFOA 1RTIA 1D9FA 5A2QO 3S3OA 4KH6A 3ZSRA 1C0TA 4M3UA 2GUIA 4BRGA 4Z4FA 2OPPA 3HSCA 4DSLA 4A62A 2YCHA 1IJJA 5AQHA 3VF2A 3KLGA 4GW6A 1NNEA 1UA1A 1D9DA 1N32K 4FWPA 4O0IA 4BR2A 2XY7A 3ULEA 3GDQA 2YJEA 3VESA 3P5JA 5TKWA 1TKTA 4DHYA 2HMPA 2WTUA 4DF4A 3CCRN 1NK7A 5F2RA 4ZTFA 1EETA 3D6RA 1N8RO 3AO3A 2EX3A 4DV7K 1IKWA 4PKIA 1REVA 1QSLA 3CC7N 4CGDA 1U45A 2O8BB 1RBSA 3JAMO 4E7HA 3K59A 4GY2B 4CK3A 3CQYA 1K6YA 3GBTA 3IMXA 1KAZA 1YIJN 4OPAA 1HYVA 5KGWA 3IKMA 3ZSXA 3HM9A 3PIOL 1CXQA 1FK9A 4JKGA 5HRNA 1NGAA 3VENA 1NG9A 3TSQA 4FYDA 2IVPA 2P9PA 3Q7CA 3K5OA 1CZBA 5H1SQ 3F5TA 3RTVA 5TKYA 1WBBA 4Y1DA 4CGFA 1WSIA 1QTMA 3ZSQA 3DMJA 4E0DA 1E3MA 3H6EA 4YOTA 4JI5K 3OBWA 1RGIA 1BUPA 4G1QA 3CCLN 1HX1A 1ITGA 3AA3A 1N34K 5C2DA 4CEQA 5AQTA 2V7YA 4NLBA 4AM6A 4DSFA 1K8AO 3MCAB 3IUCA 1V4SA 2VQEK 4BQZA 1U48A 1S72N 2HHUA 2ZGZA 1NKBA 1XNQK 2D5RA 3QEIA 1YJ9N 1XMQK 1W7AA 1SS6A 4BR7A 4CESA 1HNWK 1TAUA 2E4LA 3VQBA 4HCCA 2KZZA 4J2AA 3CG7A 1JLFA 2I7NA 4IG3A 4C8NA 5AQGA 2VG6A 3C6HA 4TSXA 1H1VA 4DB3A 3FE1A 2DPNA 3CYMA 3E9LA 4IG0A 2QM1A 4PUOA 2NLXA 1P8ZA 2J4RA 1TYQA 4DS5A 4C8OA 4BY9C 2GBZA 4NCBA 2IVOA 3EE8A 2QWMA 2IVNA 4BRPA 3HK2A 4LSLA 4OO1J 4JRPA 4BC4A 3VA0A 3OYFA 2AA4A 5AQRA 1NWKA 3SMPA 4M41A 2NRZA 3VEVA 3ASMA 2OZMA 5DM6L 4B1XB 1Q7YO 3QLHA 3ZT1A 4CZIA 4CEFA 4FLZA 4CHQA 2XRIA 4GVEA 2JLEA 3OHRA 3CFPA 1HNVA 2YHAA 3LANA 3VA3A 3DRRA 3JS6A 1NBWA 1JKHA 1SQKA 4H5RA 4EP4A 4JS4A 1YT3A 2RPIA 2G8WA 2E1YA 3VGKA 1Y97A 3CMAN 3LM2A 3AVKA 3O8MA 1ILYA 3ZYYX 1UOCA 3L2VA 3LWMA 4E89A 3KWIA 4A2BA 5JMVA 4LSNA 2YNHA 4FJ9A 4B9MA 1K8KB 1RT7A 4CF9A 4BR4A 3LZIA 1GLDG 5KI6A 4X62K 4BRHA 3EZ5A 4CERA 3S9HA 4ILHA 5AZIA 3VF6A 2QWPA 3VQ9A 3QESA 2PYLA 1LWFA 4JI0K 4F8RA 1ESVA 3ZETA 1DLOA 5K14A 3VEZA 1WSGA 4K8ZA 1RCHA 4N56A 2YJFA 4OKKA 4JI6K 1S6PA 4GVMA 1Q81O 4CJ7A 5CYQA 5C2FA 5AQVA 4B3RK 1S1XA 4DTPA 1HLUA 1RT3A 1VQ9N 3V1RA 1N5YA 3AA2A 5AJ3K 2P9NA 3GL1A 4BE1A 4EZ6A 3CJ7A 3NH2A 4CBWA 3AAQA 4JK8A 2E2OA 3AVMA 3U3GA 2FBVA 2HBLA 1HPZA 4M63C 4MO4A 3CQ8A 3K5LA 1X9MA 4WFNL 3LM9A 1ZBFA 3QBXA 4OGEA 4CF1A 1TKDA 3ZT2A 3OYLA 3G6EN 1LOTB 3CQXA 3AAPA 2YHXA 4E7IA 1VQ6N 3L0QA 4B3MK 3D2EB 1KVCA 3OJUA 3ZX2A 3RRHA 3KIOA 1KRPA 4M7XA 2ITGA 1DGKN 4ID1A 3BGRA 4FCYA 2BUPA 1VSEA 1X9WA 3NF6A 4FLYA 3RMCA 2P5OA 4U67L 1RT6A 3VQ8A 1NKCA 2F8TA 2QWQA 2P9IA 1WSJA 4LF9K 2E5LK 1EO1A 5GIOA 2OYQA 1Z05A 4F3TA 1HKBA 4DTRA 1GLEG 1VK0A 3LZJA 1J5EK 3J7ZO 1YXQA 4HTLA 3WXMB 4FM1A 4DR3K 2YKNA 4BR9A 3S3NA 3LDLA 4EFHA 1D4XA 2PAVA 3EL2A 5AQYA 1VSDA 4FOIA 3RVCA 1SZ2A 1Z26A 3HL8A 3QEPA 1MU2A 2Q0RA 3BP8A 2W42A 1ZBIA 2Z1GA 4M45A 2RE2A 3KHYA 3T69A 4WQ4A 1T05A 4BE2A 4NCGA 3MEDA 4IXCA 1U4BA 4KKOA 2YKMA 3C94A 1UWBA 4CEAA 1U2VB 5C24A 4WE1A 3PO5A 4FK4A 1BISA 3H45C 1T6DA 3SV3A 4QS7A 5AFUH 1NGBA 4F2SA 3WEEA 4F9OA 3NGZA 3FZMA 4B3TK 4CD3A 1HR0K 2HHSA 1BWFO 4BRIA 1T7PA 4FSVA 1ZBHA 3H1QA 5GAEP 2GEMA 3P38A 4DLEA 2Q2RA 4QAGA 4CZMA 3K5NA 1WB9A 1SL1A 2BDPA 1VSHA 4E1MA 5AQUA 2P5GA 4O55A 4LFAK 2O8FA 5KGXA 2ZE2A 4LH4A 4WFAL 1YAGA 3KLHA 5HLFA 3DRSA 2FSKA 4I2QA 1L3UA 1CZ9A 4CW7B 2F9TA 4H4OA 4BG8A 1QQCA 3HPOA 3QFUA 4LH5A 5JLFA 4JS5A 5JVGL 4FJ5A 1ZYQA 3MXMA 4BREA 4JEPA 3HI0A 4FXDA 1BHLA 1J53A 2NRXA 1KC8O 3L2UA 3CJAA 3SJJA 3VQEA 4BVOA 2P9UA 2HSTA 4FJKA 2WONA 3VOVA 1TVRA 3O4WA 3L3UA 3VQ6A 1WAFA 1KXPA 3QEXA 3QNOA 3C0BA 3KLFA 1IG8A 3BZKA 3WNGA 4AILC 4JI7K 4FLWA 4YOYA 3GG4A 3NBPA 4GNIA 3O9RA 3RR8A 3BEXA 4BC2A 3H3OB 1NK5A 1BCMA 3I0RA 2UXBK 3MAQA 3SQ0A 3D45A 4CJVA 3HPHA 3ID6A 5M1PA 4BGAA 1NKEA 4CIFA 4IZ9A 4PL8A 4WQ4C 4B1WB 3AO4A 5EVZA 3IFRA 2HNYA 1KQSM 1EQYA 2V51B 1N33K 1NGCA 4CEDA 4BRAA 4AHTA 3DXKA 4DU4A 3VQ5A 1RBUA 3ULEB 1QZ6A 4O44A 4HHTA 4AM7A 3CCEN 4C8KA 5JS2A 4DKWA 1HPMA 4CJEA 2KZMA 3OYBA 1NGDA 1S1WA 2PBDA 4DR1K 2PFUA 1X9JA 3I33A 3AVJA 3AVGA 1TKXA 1BA0A 3H46O 3O9UA 2KFZA 2JWLA 3FZKA 5HRRA 3M6GA 2G8HA 3IRXA 3KK3A 2O4IA 3KKRA 1KAYA 5D3GA 2OPSA 4FJLA 2F4VK 2QXFA 3QINA 1HMVA 5KPZA 4JKGB 2QXLA 2I5JA 1JLGA 3O3GA 3SCXA 2P9PB 1W9HA 2WOMA 3SUNA 5BREA 5B8HA 4C23A 4DSEA 5M1NA 4KI4A 1ZXOA 3O9QA 3G71N 4H0TB 1HKGA 4CJTA 4AQYK 3Q7BA 2DFHA 3ISNC 4E1NA 1R0AA 4RWTA 2E2NA 3F9MA 5AQPA 3ZT0A 1U2VA 2FSJA 1RBRA 3L6QA 4DUYK 3VEYA 3FZLA 4B08A 2IGIA 3HYFA 2D1KA 4IDKA 5C12A 3UE5A 4QS9A 1SL2A 3SQ2A 1L3VA 4KAZA 4FWRA 3WQUA 1W97L 4ISGA 1CLQA 4HCBA 3GOIA 5LJVA 4CHZA 3DYAA 5CE3A 2Q31A 4KI6A 4OKEA 3NVKA 5BPMA 1JLBA 1NGFA 4CGIA 5GIPA 2O8EA 3THXA 2NNWA 4RCHA 3OS1A 4DQRA 3RSEA 1RDAA 3A5LC 3M8SA 3LWLA 5IWAK 3O3HA 4ICLA 1C1BA 5M1QA 3WXIA 1Q82O 2DTUA 4MLHA 4GV3A 2B4JA 2QKBA 4MQ3A 3S3MA 5KQ8A 4Z4EA 3OTOK 4PWDA 3MN9A 2B6AA 2F7TA 3E66A 3BF3A 5I9EB 1G99A 3TI0A 4DU1A 4H03B 3V9XA 2IDOA 2F96A 2Q0UA 3J81O 3CM5A 3FFKB 3ZSWA 4O4GA 3LDNA 4CEEA 1XMOK 1ZBUA 4CJ5A 1TL1A 4BE0A 3QIOA 1WSFA 4M3TA 2FSNA 2RKIA 3AGKA 2GELA 3CFRA 1RNHA 5AZIB 4H0VB 3VF4A 3QNNA 3AGRA 4KHWA 3V9UA 5BN8A 3ZETB 1C1CA 5F1XA 1J5OA 3I8BA 4PKHA 1NOZA 4JV5K 1C1AA 3JSMA 1CZAN 1RTDA 4B9NA 4F2RA 4DTSA 3NMUA 1YITN 1C0GA 2GWKA 5EX5A 3UKRA 3IDHA 3R1XA 1SUQA 1IG9A 1VRUA 1NMDA 5KQDA 3FFIA 3HSTB 3ZEUA 1BU6O 4RW6A 4IEIA 2PZSA 2FLOA 2P9NB 4BRFA 1RBVA 4H0YB 3OYCA 4AHVA 2B5JA 3J80O 1HNZK 4M3WA 3T19A 4JI1K 4CFAA 3LDOA 3RR7A 1BG3A 3SPYA 2G8VA 3MXIA 1J6ZA 2ZD1A 4BRMA 1DTQA 2OZSA 1GLFO 3O4NA 4DQSA 4JYAK 4MFBA 5FRMA 3AVFA 4OPKA 3P83D 3R8EA 1XHZA 2HHWA 4HWIA 1MWMA 2IIRA 2HMIA 4G9ZA 3H3NO 3R9PA 2I7PA 4FWKA 3BZCA 3NF8A 2XO7A 4FW2A 4CZLA 4BVPA 4CJUA 4KBOA 5KPTA 3KZBA 2UUCK 4BRDA 5FPMA 2P9IB 2HHVA 3OYEA 3L2QA 4DU3A 1HRHA 4DTNA 3ALYA 2UYTA 1TGOA 1KVBA 4JKHA 3OS2A 2EHGA 3VQ4A 4Z0UA 5ADXA 3EE9A 2QK9A 1IH7A 3QIPA 1O13A 3DLHA 1NM1A 3G4SN 1IO2A 1O1WA 4KB0A 2KFNA 2VQFK 3QERA 3M8PA 3ID8A 4B3SK 4AHSA 3A5OC 4JD2A 1RFQA 4DTOA 1HUXA 3DLEA 1UA0A 3NHGA 3MK6A 4BRQA 4DR2K 1OVQA 5EU7A 4ILGB 3ZSOA 1J54A 3KK1A 2V7ZA 3OW2M 1XHXA 2P9LA 4QS8A 4K42A 1GOCA 3WEEB 5J2MA 3HXMA 4W5OA 3TARA 3L3VA 4O5FA 3KVGA 5M1OA 3EEQA 3TTFA 3OYAA 3OS0A 1E4GT 3LALA 2W41A 3H1VX 3NCIA 1KFSA 4FWNA 2D0AA 4CZEA 1BCOA 1S1VA 3K9JA 3ZT3A 5BR9A 2O8FB 4CEZA 3MEEA 3A0IX 3AA4A 4CZFA 4EHTA 3A2FA 4FJXA 4FZZA 3TWHA 1TUYA 4PA1A 3DM2A 3VMFB 3TANA 3QEWA 5KPRA 2D4WA 4NB4A 3W3DA 1NOYA 1BQNA 3E1YA 5AQNA 5J2PA 5J2NA 2Q3SA 3I0SA 5AQJA 3WT0A 4K41A 2ZJRL 3AA5X 4FL9A 2D0PA 2P9UB 4FWSA 5I42A 4H5WA 2X74A 5M1FA 3TAEA 1UAXA 1RDDA 4IFEA 3RWUA 2GWJA 5KRSA 4JNEA 4CJKA 1RDUA 5DK5A 3HBTA 3KKSA 1BOTO 1XUPO 3PX6A 2QA4N 1A5WA 2FF6A 3ZSVA 1S3XA 4FJGA 1MA9B 1LW0A 1FXXA 4PY5A 3MN5A 4FPAA 4OVLA 3SV4A 3FLCO 5HP1A 3QEVA 3E9OA 4JI8K 4OLBA 2O4GA 3KTQA 3MECA 4O0JA 3K58A 5J2QA 4LC9B 1K73O 3CD6N 3D2FA 3WNFA 2ZJPL 2G8UA 4EP5A 4GKKK 4DFJA 3SAHA 4A57A 2P9SB 3DXKB 2VG5A 3N4PA 2P1JA 2JWKA 4E7LA 1RDBA 3ATVA 4LFBK 3TTDA 1X1PA 3M8RA 3V9SA 3QDKA 1VSLA 4C8LA 1GLCG 4BWJA 4RTFD 4CGHA 5GAGP 4AHCA 3WXLA 3LP1A 4M7YA 3QB0A 4B9UA 1YTAA 3VGMA 4N76A 3TPQA 1IKYA 4MO5A 5BPLA 4DS4A 4CGJA 5I3UA 2YHBA 4CIGA 4JK9A 3O5BA 3VQQA 4HTUA 4IO8A 4I2PA 2KHOA 3HPGA 4JAXA 3O1WA 4KHYA 1LCUA 1RT1A 4FJJA 1GOAA 3B6PA 4FJIA 1KAXA 4CHOA 1TK8A 2NRWA 3VGLA 2R7YA 4CZGA 3AVHA 2VYPA 1CXUA 2PYJA 1YTUA 4CZHA 4CJLA 1T44A 4GV6A 4DR5K 3ZX3A 3ENBA 1IV0A 4M3YA 4B9VA 1GLJO 1NGEA 5AZJA 4BWMA 3M5RA 5CY4A 4FJNA 1B9DA 1XI1A 3LAKA 4KB1A 4CFDA 5BRHA 3FZHA 1G15A 4B9SA 4DFKA 5C0YA 4CHNA 1NJIO 3C7NA 2D0CA 1LAWA 1S1UA 3V4IA 1QSSA 3CJ9A 3I8DA 3VEXA 3CCSN 4XH5A 4DTMA 1KLNA 4DSKA 3H08A 4OPHA 1JCGA 5CHIA 4IFVA 3NF7A 4IWVA 1YF5L 4N47A 3O3FA 5JS1A 4IEEA 3SMSA 2O8EB 3THXB 4I6MA 5EOYA 3AVAA 4J2EA 3RSEB 3U9ZA 3EY1A 5F0XA 2VWBA 3P4IA 2HBJA 1HJRA 4ISFA 4FJ8A 4CCHA 1QVGM 1X3MA 4KV8A 1B92A 2OPRA 3JXUA 2KTQA 1JLEA 2HF4A 4DTJA 3AVCA 5FRNA 5FPEA 3FGUA 1SV5A 4DV3K 3TABA 1BDGA 3KJVA 3EZWA 2RHKA 5LY3A 4Z94A 1XNRK 3F73A 3HZ6A 2QKKA 2ZQBA 3I56N 2D0OA 2HNZA 4DSJA 2VWKA 4KHSA 2OTJN 2V52B 4FPBA 2YI1A 4MDBA 3KK2A 1BIZA 4J2DA 2A1RA 3DOLA 4FK2A 4K8XA 2FF3B 4FJMA 1HJOA 4LF7K 3J8AA 3WQTA 1EXQA 4NO7A 3R6MA 1SL0A 2X6SA 4Z4GA 3DXMB 1EWQA 3V9ZA 2OANA 4DG1A 1IBKK 1WSEA 2HF3A 2HVIA 2DY4A 2XHBA 1VQ8N 3HP6A 3T3FA 1B9FA 4B8CA 1IKVA 4CHPA 1X3NA 4DLGA 3ZCMA 2P9SA 3D7EO 2Q97A 4I9QA 2UXDK 4UQGA 3CCUN 4KTWA 4FWLA 3UKRB 5BRFA 3DLKA 3GE1A 1HQUA 4CIEA 1WBDA 4A59A 1D5AA 2Z1HA 1OKJA 3ZEUB 3KLEA 1S1TA 4B9QA 4GV9A 3VETA 4BQLA 5GADP 4KPYA 4NLCA 3TR8A 1C0UA 1KVAA 4MDAA 1BO5O 2RN2A 2UUAK 4B1UB 1ATNA 1MDUB 1VSIA 4LF8K 1NJZA 3QMLA 1V4TA 1DKGD 2NRTA 3MN7A 3E01A 5LL6Z 2AP1A 4B3OA 1F21A 4JKFA 1Q9YA 2CGJA 3HJFA 4CK1A 2KLAA 3CCVN 1XWLA 5CR4A 4KTZA 5AQSA 1NK4A 3CM6A 3K2PA 2O8CA 2A5XA 4YOVA 2WC9A 2E2PA 3EKSA 3MX2A 4Y1CA 3AV9A 5C10A 2A3ZA 4L3QA 2YNIA 1QSYA 4IJNA 3K9KA 3J7YP 5JICA 3SAGA 3NGIA 1XC9A 3SUOA 1VSFA 5HBMA 3VTIA 1YJNN 1OH8A 2E6LA 2KQ2A 4PKGA 2XY5A 3G10A 4AH9A 3PX0A 3AO1A 1KLMA 3A5MC 4BC3A 4HUFA 4CJ3A 3OYKA 4K0KK 4EIAA 4W5QA 3KD1E 1LWCA 1WAJA 5CZ2A 4FVUA 4LF5K 4CHYA 2HBMA 5SWMA 2GV9A 3V6DA 4B9TA 5E26A 4A5AA 4C1NI 4JD2B 3TU5A 1C0MA 1RTHA 4RW7A 1OH5A 3D0PA 1SKWA 3OJSA 4ELTA 2X78A 1XQSC 1BI4A 5AQQA 4DFPA 4BGBA 4ISEA 3DAWA 3NFAA 3U3YA 4NXMK 4FO0A 1QZ5A 3VQAA 1NJXA 2ATQA 2P9LB 5AQWA 4WF9L 1U47A 3MXJA 3SQ4A 4KHNA 4O5BA 3OVNA 4HUGA 4H5NA 3CPWM 3VN5A 1HNIA 3WNEA 4WCEL 3DI6A 1I39A 4X64K 5EY4A 3AVBA 1N36K 2FBYA 2Z1JA 1QQNA 3CJBA 3DLBA 1S9GA 2NRHA 3MMVA 4BRNA 3BUZB 3OYMA 4JI3K 4J2BA 4M3ZA 4DV4K 1ASUA 1EX4A 2A42A 4B9LA 4QOZB 3NF9A 4H0XB 3OBYA 2CGLA 3NDKA 3LP3A 5EXWA 4FLXA 1M90O 4H5VA 2WUSA 3DXMA 3EYZA 5C15A 1NGIA 1EWRA 3O80A 4CJQA 3B6OA 4CK2A 3N4QA 5AR0A 4CEOA 3HTVA 2CH5A 3ENHA 3O6WA 4JHDA 4YNQA 3CERA 3KK7A 3SQ1A 2QW9A 4PL7A 4OX9K 1DT9A 1S22A 3FZFA 4BDPA 5AQLA 3OYGA 2A6AA 2F9WA 3AO2A 3CCQN 4KFBA 3VQCA 5ADXH 3SYZA 3C6UA 3CPEA 2JGUA 5BRDA 3DLGA 4DV6K 1RT5A 3QBWA 4A5BA 1TUUA 1TK5A 3L2RA 5BR8K 4RG8A 5AQFA 1ZBSA 4IDHA 3VQDA 1QE1A 3D2FB 4CZJA 5JLHA 3ZLJA 1C0FA 3ZSYA 3A5NC 3SAFA 2ZJQL 2P51A 4J8FA 2Y1IA 2P9KA 3OYHA 4M42A 2ZWHA 1KD1O 4FJ7A 2VG7A 5FPNA 1LWEA 5CZ1A 4E3SA 4YDUA 3U4LA 4CECA 3QETA 3WNHA 3T1YK 2VGNA 4DTXA 3RMDA 2W6KA 3MWTA 4BDYA 4XEIA 3HOSA 5JVHL 2E8AA 4NCAA 1VAZA 1WNSA 2W40A 4BRCA 2A41A 2ASPA 3M1FA 5FLXO 1ZC6A 4DWIA 4DV0K 5E84A 4ZTJA 1BA1A 1ZBLA 4LF4K 2NRRA 2HB5A 4DR7K 3ITHA 4FM0A 3MEGA 4OPJA 1JXBA 3ENOA 1XC3A 1VSJA 1FKPA 4FWOA 1A5VA 4O8KA 2OA8A 1W2BM 3HRGA 3VPZA 1E4FT 5C25A 1L3SA 4BDZA 4RW9A 1HNXK 4E7KA 1JCEA 3T7ZA 3M8QA 3U9DA 4FK0A 3EN9A 3L2WA 3T1HK 2BANA 3THWA 4NYNA 1NK9A 5AZJB 2BGGA 4YORA 4EHUA 3W0LA 1HYSA 4F3OA 3A8YA 3UB5A 2FBTA 3THYA 1BIUA 4XIUA 4XH4A 4W5RA 2NRVA 1HYZA 1BQMA 1I94K 3C7NB 2OPQA 3I55N 3T1AA 4LFCK 2IC3A 3K0SA 2BTFA 4BC5A 4CD1A 4H5TA 2HBKA 4KRFA 4CJ4A 2XY8A 5FPDA 2UUBK 2QWNA 5CYMA 4OJRA 3DWLA 4E19A 4H4MA 5AQMA 3K5MA 2E6MA 3LP0A 4IBNA 3LL3A 3P1GA 5LMNK 2BE2A 1NGHA 3ZT4A 1VQPN 4I6MB 4DV5K 1YVNA 3UKUA 1VQLN 3EO3A 1YI2N 4WYBA 2HNDA 4KH5A 4YDUC 5DM7L 1JL2A 3OA9A 5IT9O 4WQ5A 2DFEA 2FBXA 4IOCL 1VRTA 5ELZA 3SUQA 3P31A 2DFFA 3NVMA 1QHAA 1JJ2M 1VQNN 4RW4A 1LAVA 1NGJA 4JKEA 1VQKN 4R79A 4DUZK 4CF2A 2HHTA 3CI5A 3SZ2A 4CI6A 3RRGA 3SBGA 1VQ7N 4N5SA 3PSIA 3MDQA 3F2KA 4JKBA 3U8XA 1TV6A 3DJCA 1SAZA 2CGKA 3O4QA 4DR4K 2NZTA 1R59O 4IO9L 3RMAA 3G0ZA 5HOOA 1MWKA 2ZM6K 3LDSA 4DR6K 4CGGA 2YNGA 1U04A 5BN9A 5KTQA 4CVNE 4YOXA 3U6FA 3C6TA 1TK0A 3VQPA 3O1BA 4CBUA 4DCHA 3C6AA 3HVRA 4BROA 1IBMK 4DTUA 4WFBL 1RT4A 5KRTA 5GAHP 5HRSA 3AY9A 3V1QA 3TSUA 1M1KO 2WBNA 5LMUK 2QTDA 4FZXC 4M3RA 2CH6A 1RTJA 3UIQA 2O8BA 3O9SA 3HO1A 4BRLA 1KCFA 4DV1K 5HL7L 3CF5L 4CJRA 1S9EA 1N6QA 4ELVA 2QWLA 4FZYA 1DEJA 4AHUA 2YHWA 1HKCA 4I7FA 4DF8A 2IOCA 3OY9A 1VHXA 1ATSA 4JI2K 1QQOA 2HW3A 4CE9A 1GLBG 1NU0A 3DOKA 4U7BA 4EZ9A 3WUHA 4IFYA 2ITMA 4DV2K 4JN4A 4BR5A 3CMEN 1S5JA 3TAMA 1WN7A 4LD0A 3CCJN 4OGCA 4ELUA 2Z1IA 3LPUA 4WQ5C 4CJPA 2A40A 2O8CB 1YVUA 4A61A 2EWSA 4YOUA 4B1ZA 5AQIA 3VTHA 1JLCA 2OTLN 4E7JA 1IBLK 1NGGA 4A2AA 1GOBA 2WFBA 1T03A 2HOEA 1JXEA 3RMBA 3P39A 4ZHRA 3DLRA 4BR0A
chains in the Genus database with same CATH topology
2XRIA 2JLEA 3CFPA 3E01A 1HNVA 2YHAA 3LANA 3VA3A 3DRRA 1NOZA 4B3OA 1VSKA 1F21A 4AHRA 4JS4A 1JKHA 2YV0X 1Q9YA 4EP4A 1C1AA 1BGXT 1YT3A 2RPIA 3JSMA 4HUEA 1RTDA 2G8WA 4B9NA 4F2RA 3HJFA 4CK1A 1Y97A 4DTSA 1XWLA 4FM2A 3AVKA 4KTZA 1NK4A 1ASWA 1UOCA 3CM6A 1SUQA 3IS9A 3K2PA 1VRUA 3PUFA 4Z4HA 4E89A 3L2VA 3LWMA 3JYTA 3PV8A 3TAFA 3FFIA 3HSTB 2PY5A 4RW8A 4CJSA 4LSNA 2YNHA 4FJ9A 4RW6A 4B9MA 2PZSA 4Y1CA 1RT7A 3AV9A 4CF9A 3LZIA 1RBVA 5KI6A 2YNIA 1D8YA 3OYCA 4AHVA 1QSYA 1RBTA 2B5JA 4M3WA 1TL3A 3T19A 3EZ5A 4CERA 3S9HA 5J1EA 4CFAA 3RR7A 3SPYA 1BI4B 3VQ9A 3QESA 3MXIA 2G8VA 2ZD1A 2PYLA 1DTQA 1LWFA 3NGIA 1XC9A 4JRQA 3SUOA 1VSFA 5HBMA 3PO4A 2OZSA 4F8RA 1X9SA 1DLOA 4YFUA 5K14A 3TAQA 4DQSA 3O4NA 4KREA 1WSGA 2E6LA 4K8ZA 1RCHA 2KQ2A 2XY5A 3G10A 4N56A 4AH9A 3PX0A 3AO1A 2G8FA 1KLMA 4MFBA 4OKKA 4CJWA 3IG1A 3KD5E 3AVFA 5FRMA 4W5TA 4OPKA 1S6PA 4GVMA 3P83D 4HUFA 1XHZA 3PY8A 4CJ3A 3OYKA 5CYQA 2HHWA 4W5QA 1IG9A 2HMIA 1LWCA 1WAJA 3KD1E 5FDLA 4HVJA 1QHTA 4NYFA 5CZ2A 1S1XA 3NF8A 5E41A 4DTPA 4CHYA 1RT3A 5SWMA 2GV9A 2XO7A 4FW2A 3V6DA 4B9TA 4Z4IA 3V1RA 1N5YA 1C0MA 1RTHA 3AA2A 4KHUA 1JL1A 4RW7A 4BE1A 3SI6A 1LV5A 4CJUA 3NH2A 3D0PA 4EZ6A 1SKWA 3OJSA 4ELTA 2X78A 3AVMA 3U3GA 2FBVA 4DQPA 1W0HA 1HPZA 1BI4A 3CQ8A 4DFPA 1SKRA 3K5LA 1X9MA 2HHVA 3NFAA 1JLAA 3U3YA 3OYEA 2AJQA 3L2QA 3VQAA 3OYDA 4DU3A 1NJXA 2ATQA 1HRHA 1ZBFA 4DTNA 3ALYA 3AVIA 4OGEA 4CF1A 1TKDA 1TGOA 3ZT2A 3OYLA 1U47A 4OLAA 3MXJA 2VWJA 1KVBA 3OS2A 3PX4A 3SQ4A 4KHNA 2EHGA 3VQ4A 1L3TA 4O5BA 3OVNA 4Z0UA 3OYJA 4HUGA 3VN5A 1HNIA 3WNEA 2QK9A 1IH7A 3DI6A 4E7IA 1I39A 1QS4A 3AVBA 3QIPA 3DLHA 2FBYA 2Z1JA 1KVCA 4W5NA 1IO2A 1O1WA 1JLQA 3OJUA 3NH0A 3DLBA 1S9GA 1C6VA 3RRHA 1NJYA 4KB0A 3QERA 3M8PA 2KFNA 3KIOA 1KRPA 1NK0A 3OYMA 1L5UA 1NK8A 3NH1A 2ITGA 3LP2A 4AHSA 4ID1A 4J2BA 4M3ZA 3BGRA 4FCYA 1ASUA 4DTOA 1VSEA 1EX4A 3NF6A 4FLYA 3DLEA 3RMCA 1X9WA 2P5OA 1UA0A 5HRPA 1RT6A 3NHGA 4GMJB 3VQ8A 4B9LA 1NKCA 4CJFA 4KTQA 4QOZB 3NF9A 5EU7A 2F8TA 3ZSOA 1EKEA 1J54A 3KK1A 1VSMA 1ASVA 4LY7A 1WSJA 4OKJA 1XHXA 2OYQA 3NDKA 3LP3A 3AVNA 4FLXA 4F3TA 4DTRA 1RDCA 4Q0BA 1VK0A 1GOCA 5J2MA 1SKSA 3HXMA 3LZJA 4W5OA 4FM1A 4FLTA 4I9LA 3TARA 2YKNA 3L3VA 3S3NA 3IAYA 3EYZA 1J5OA 1Q8IA 4CJQA 3OYAA 3B6OA 3OS0A 3TAPA 4CK2A 2KW4A 3LALA 1VSDA 4DFMA 4CEOA 3C95A 1FKOA 3NCIA 1Z26A 3HL8A 2D0AA 3QEPA 1KFSA 1MU2A 4YNQA 3HT3A 1BCOA 1S1VA 2W42A 3SQ1A 3ZT3A 2NUBA 1ZBIA 3OYNA 4CEZA 3MEEA 4PQUA 1S6QA 3BDPA 1U49A 2Z1GA 4M45A 4BDPA 2ETJA 3AA4A 4DMNA 3OYGA 3A2FA 1T05A 4BE2A 4FJXA 4FZZA 1A5XA 3MEDA 4NCGA 3TWHA 4KKOA 2YKMA 3AO2A 1U4BA 3C94A 1UWBA 4KFBA 3DM2A 4PA1A 3VQCA 4CEAA 3QEWA 3TANA 2X6NA 4FJHA 4FVMA 4WE1A 5C24A 4CEBA 1BISA 3PO5A 4CFBA 4FK4A 3SYZA 3C6UA 3SV3A 1NOYA 1BQNA 2JGUA 3TAGA 4L8RB 5J2PA 4F2SA 3DLGA 2Q3SA 5J2NA 4DQIA 3I0SA 3NGZA 5HROA 1RT5A 2HHQA 3ZSZA 2HHSA 3V81A 3L2RA 1TK5A 1T7PA 1I3AA 1ZBHA 4RG8A 5FROA 2FC0A 4B8AB 1T8EA 3VQDA 1QE1A 1Q9XA 3AA5X 5I42A 4ID5A 4DLEA 2X74A 1TKZA 4FLVA 3NGYA 4CF0A 3ZSYA 1KTQA 4QAGA 5DMRA 3K5NA 3LAMA 4IKFA 3TAEA 1SL1A 2XY6A 1UAXA 1RDDA 2P51A 3RWUA 3DRPA 2BDPA 1VSHA 4E1MA 5KRSA 2Y1IA 4CJKA 3SUPA 5DK5A 3OYHA 4O55A 4Z4CA 1WSHA 1HQEA 2P5GA 5KGXA 4M42A 2ZE2A 2F8SA 2HVHA 1NK6A 1DTTA 1TAQA 4FJ7A 3KKSA 2VG7A 4LH4A 2IAJA 3KLHA 5HLFA 3DRSA 1LWEA 5C42A 5CZ1A 3PX6A 2LSNA 3AVLA 4I2QA 1L3UA 1CZ9A 4E3SA 1A5WA 2Y1JA 3ZSVA 4CECA 3QETA 4H4OA 4FLUA 3WNHA 4QCLA 1QQCA 3RMDA 3HPOA 4DTXA 4FJGA 4LH5A 4BDYA 4KO0A 1LW0A 4FW1A 1FXXA 3L8BA 4JS5A 4FJ5A 4PY5A 3SNNA 3SV4A 4OVLA 4NCAA 1BL3A 1WNSA 3V1OA 5HP1A 3MXMA 1ZYQA 3QEVA 4OLBA 2O4GA 1KFDA 3KTQA 4FXDA 3MECA 1BHLA 1J53A 4DWIA 4M3XA 4O0JA 3L2UA 3K58A 5J2QA 4ZTJA 1ZBLA 3SJJA 3NAEA 2HB5A 3VQEA 3ITHA 3WNFA 3MEGA 4H8KA 4OPJA 4EP5A 4FM0A 2G8UA 1JXBA 1EP4A 1J9AA 2IS3A 4DFJA 2WONA 4FJKA 3K57A 1TVRA 1VSJA 1FKPA 1WLJA 2G8IA 3L3UA 1A5VA 2VG5A 3VQ6A 2OA8A 1WAFA 1RT2A 2P1JA 4E7LA 4F4KA 3QEXA 3QNOA 5C25A 1L3SA 4N41A 4Q5VA 1RDBA 3KLFA 4C8MA 4BDZA 1NJWA 3WNGA 4RW9A 4AILC 4E7KA 4DQQA 3M8QA 4FLWA 4R5PA 1Z25A 1X1PA 2A1SA 3NBPA 3M8RA 3V9SA 4FK0A 1VSLA 3L2WA 4C8LA 4BWJA 4FK2A 4CGHA 4KHQA 4AHCA 3RR8A 3LP1A 1LW2A 3HP9A 4B9UA 1YTAA 2BANA 4NYNA 1NK5A 2RF2A 4N76A 1BCMA 3I0RA 1NK9A 3MAQA 3SQ0A 1IKYA 2D0BA 3V9WA 3D45A 4JLHA 4CJVA 3HPHA 4DS4A 3VQ7A 4CGJA 1NKEA 2BGGA 3ULDA 4CIFA 2G8KA 2YNFA 5I3UA 2YHBA 4CIGA 3AO4A 1IKXA 3QO9A 1HYSA 3VQQA 4HTUA 4F3OA 2HNYA 3AO5A 3HVTA 4BACA 3SPZA 4I2PA 2FBTA 2HHXA 1BIUA 4XIUA 4CF8A 3HPGA 5SZTA 4W5RA 1HYZA 4CEDA 4KHYA 1BQMA 1RT1A 4AHTA 4DU4A 3VQ5A 4FJJA 1RBUA 3OYIA 2OPQA 4CFCA 3T1AA 4DSIA 1GOAA 3NE6A 3B6PA 3THVA 4FJIA 3F9KA 4O44A 4HHTA 4C8KA 2IC3A 5T7BA 5JS2A 1KSPA 3LPTA 4CHOA 4CJEA 1TK8A 2R7YA 1RILA 3KLIA 4KRFA 4CJ4A 2XY8A 3AVHA 3OYBA 2KZMA 1S1WA 3CFOA 1CXUA 1RTIA 1D9FA 3S3OA 2PYJA 1YTUA 5CYMA 4OJRA 3ZSRA 4E19A 3AVJA 4H4MA 4CJLA 1C0TA 3AVGA 1TKXA 3K5MA 2E6MA 3LP0A 4IBNA 4M3UA 3P1GA 4B9VA 2GUIA 4M3YA 2BE2A 3ZT4A 4BWMA 2KFZA 4Z4FA 2OPPA 5CY4A 4FJNA 5HRRA 1B9DA 1XI1A 2G8HA 3IRXA 3LAKA 4DSLA 3KK3A 2O4IA 4KB1A 2HNDA 4CFDA 3KKRA 1JL2A 1G15A 3KLGA 4GW6A 5D3GA 2OPSA 4DFKA 4B9SA 4FJLA 1UA1A 4CHNA 2QXFA 3QINA 1D9DA 1HMVA 2DFEA 2FBXA 2D0CA 2I5JA 1JLGA 1VRTA 4O0IA 3O3GA 2XY7A 1LAWA 1S1UA 3V4IA 3SUQA 3SCXA 1QSSA 1W9HA 3P5JA 1TKTA 2DFFA 3I8DA 4DTMA 2WOMA 3SUNA 4DF4A 4RW4A 1KLNA 1LAVA 4DSKA 3H08A 1NK7A 2HHTA 4CF2A 4ZTFA 1EETA 4DSEA 3AO3A 3SZ2A 4KI4A 2EX3A 3RRGA 4IFVA 3NF7A 4CJTA 4N5SA 4N47A 1IKWA 2DFHA 3O3FA 1REVA 1QSLA 5JS1A 3ISNC 4E1NA 4CGDA 1R0AA 1U45A 1TV6A 1RBSA 3AVAA 4J2EA 4E7HA 3O4QA 4CK3A 3EY1A 3K59A 1K6YA 3ZT0A 1RBRA 1HYVA 5KGWA 1HJRA 4B08A 3ZSXA 2IGIA 4FJ8A 3HYFA 4CCHA 3HM9A 4KV8A 4IDKA 3RMAA 1B92A 1CXQA 2OPRA 1FK9A 3G0ZA 1SL2A 2KTQA 1JLEA 5HRNA 4DTJA 3SQ2A 1L3VA 3LDSA 3AVCA 4CGGA 2YNGA 4KAZA 1U04A 5FRNA 4FYDA 5KTQA 3U6FA 3K5OA 1SV5A 3TABA 1CLQA 3KJVA 4HCBA 1CZBA 3C6TA 1TK0A 3VQPA 4CHZA 3RTVA 3F73A 3DYAA 4Y1DA 3HVRA 4CGFA 2QKKA 1WSIA 1QTMA 3ZSQA 3DMJA 4DTUA 2ZQBA 4E0DA 4KI6A 1RT4A 2HNZA 4OKEA 4DSJA 2VWKA 4KHSA 5KRTA 5HRSA 3V1QA 1JLBA 4G1QA 4CGIA 4FZXC 4M3RA 1ITGA 3AA3A 1RTJA 3KK2A 3UIQA 1BIZA 4J2DA 3HO1A 3OS1A 4DQRA 1KCFA 4CEQA 2A1RA 3DOLA 4CJRA 1RDAA 1S9EA 1N6QA 4DSFA 3M8SA 4K8XA 4FJMA 3LWLA 4ELVA 3O3HA 4FZYA 4ICLA 1C1BA 1U48A 4AHUA 1EXQA 2HHUA 2DTUA 4I7FA 2B4JA 4DF8A 1NKBA 2QKBA 2D5RA 3QEIA 4MQ3A 2IOCA 1SL0A 2X6SA 4Z4GA 3OY9A 3S3MA 4Z4EA 4CESA 4PWDA 4CE9A 3V9ZA 2HW3A 1TAUA 4DG1A 3DOKA 1WSEA 2E4LA 4CHQA 2HVIA 2B6AA 2DY4A 3VQBA 4HCCA 2KZZA 2XHBA 4EZ9A 4J2AA 4IFYA 3CG7A 3HP6A 3T3FA 1B9FA 1JLFA 4B8CA 1IKVA 4CHPA 4IG3A 4C8NA 1S5JA 2VG6A 3TI0A 4TSXA 4DU1A 3TAMA 1WN7A 4DLGA 4LD0A 3ZCMA 3V9XA 2IDOA 3CYMA 2F96A 4OGCA 4ELUA 4IG0A 2Z1IA 4PUOA 4I9QA 3CM5A 3LPUA 3ZSWA 4UQGA 4KTWA 4O4GA 4CJPA 4CEEA 3DLKA 4DS5A 1YVUA 4C8OA 1HQUA 2GBZA 1ZBUA 4CIEA 4NCBA 4CJ5A 1D5AA 1TL1A 2Z1HA 4BE0A 3QIOA 3KLEA 1S1TA 3HK2A 4LSLA 1WSFA 4KPYA 3TR8A 4JRPA 3VA0A 1C0UA 1KVAA 3OYFA 1JLCA 4M3TA 2RKIA 2RN2A 3CFRA 4E7JA 1RNHA 4M41A 1GOBA 1T03A 1VSIA 3ASMA 3QNNA 1JXEA 1NJZA 2OZMA 3RMBA 4KHWA 3QLHA 3V9UA 3ZT1A 4ZHRA 3DLRA 4CEFA 4FLZA 1C1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRI A;  2JLE A;  3CFP A;  3E01 A;  1HNV A;  2YHA A;  3LAN A;  3VA3 A;  3DRR A;  1NOZ A;  4B3O A;  1VSK A;  1F21 A;  4AHR A;  4JS4 A;  1JKH A;  2YV0 X;  1Q9Y A;  4EP4 A;  1C1A A;  1BGX T;  1YT3 A;  2RPI A;  3JSM A;  4HUE A;  1RTD A;  2G8W A;  4B9N A;  4F2R A;  3HJF A;  4CK1 A;  1Y97 A;  4DTS A;  1XWL A;  4FM2 A;  3AVK A;  4KTZ A;  1NK4 A;  1ASW A;  1UOC A;  3CM6 A;  1SUQ A;  3IS9 A;  3K2P A;  1VRU A;  3PUF A;  4Z4H A;  4E89 A;  3L2V A;  3LWM A;  3JYT A;  3PV8 A;  3TAF A;  3FFI A;  3HST B;  2PY5 A;  4RW8 A;  4CJS A;  4LSN A;  2YNH A;  4FJ9 A;  4RW6 A;  4B9M A;  2PZS A;  4Y1C A;  1RT7 A;  3AV9 A;  4CF9 A;  3LZI A;  1RBV A;  5KI6 A;  2YNI A;  1D8Y A;  3OYC A;  4AHV A;  1QSY A;  1RBT A;  2B5J A;  4M3W A;  1TL3 A;  3T19 A;  3EZ5 A;  4CER A;  3S9H A;  5J1E A;  4CFA A;  3RR7 A;  3SPY A;  1BI4 B;  3VQ9 A;  3QES A;  3MXI A;  2G8V A;  2ZD1 A;  2PYL A;  1DTQ A;  1LWF A;  3NGI A;  1XC9 A;  4JRQ A;  3SUO A;  1VSF A;  5HBM A;  3PO4 A;  2OZS A;  4F8R A;  1X9S A;  1DLO A;  4YFU A;  5K14 A;  3TAQ A;  4DQS A;  3O4N A;  4KRE A;  1WSG A;  2E6L A;  4K8Z A;  1RCH A;  2KQ2 A;  2XY5 A;  3G10 A;  4N56 A;  4AH9 A;  3PX0 A;  3AO1 A;  2G8F A;  1KLM A;  4MFB A;  4OKK A;  4CJW A;  3IG1 A;  3KD5 E;  3AVF A;  5FRM A;  4W5T A;  4OPK A;  1S6P A;  4GVM A;  3P83 D;  4HUF A;  1XHZ A;  3PY8 A;  4CJ3 A;  3OYK A;  5CYQ A;  2HHW A;  4W5Q A;  1IG9 A;  2HMI A;  1LWC A;  1WAJ A;  3KD1 E;  5FDL A;  4HVJ A;  1QHT A;  4NYF A;  5CZ2 A;  1S1X A;  3NF8 A;  5E41 A;  4DTP A;  4CHY A;  1RT3 A;  5SWM A;  2GV9 A;  2XO7 A;  4FW2 A;  3V6D A;  4B9T A;  4Z4I A;  3V1R A;  1N5Y A;  1C0M A;  1RTH A;  3AA2 A;  4KHU A;  1JL1 A;  4RW7 A;  4BE1 A;  3SI6 A;  1LV5 A;  4CJU A;  3NH2 A;  3D0P A;  4EZ6 A;  1SKW A;  3OJS A;  4ELT A;  2X78 A;  3AVM A;  3U3G A;  2FBV A;  4DQP A;  1W0H A;  1HPZ A;  1BI4 A;  3CQ8 A;  4DFP A;  1SKR A;  3K5L A;  1X9M A;  2HHV A;  3NFA A;  1JLA A;  3U3Y A;  3OYE A;  2AJQ A;  3L2Q A;  3VQA A;  3OYD A;  4DU3 A;  1NJX A;  2ATQ A;  1HRH A;  1ZBF A;  4DTN A;  3ALY A;  3AVI A;  4OGE A;  4CF1 A;  1TKD A;  1TGO A;  3ZT2 A;  3OYL A;  1U47 A;  4OLA A;  3MXJ A;  2VWJ A;  1KVB A;  3OS2 A;  3PX4 A;  3SQ4 A;  4KHN A;  2EHG A;  3VQ4 A;  1L3T A;  4O5B A;  3OVN A;  4Z0U A;  3OYJ A;  4HUG A;  3VN5 A;  1HNI A;  3WNE A;  2QK9 A;  1IH7 A;  3DI6 A;  4E7I A;  1I39 A;  1QS4 A;  3AVB A;  3QIP A;  3DLH A;  2FBY A;  2Z1J A;  1KVC A;  4W5N A;  1IO2 A;  1O1W A;  1JLQ A;  3OJU A;  3NH0 A;  3DLB A;  1S9G A;  1C6V A;  3RRH A;  1NJY A;  4KB0 A;  3QER A;  3M8P A;  2KFN A;  3KIO A;  1KRP A;  1NK0 A;  3OYM A;  1L5U A;  1NK8 A;  3NH1 A;  2ITG A;  3LP2 A;  4AHS A;  4ID1 A;  4J2B A;  4M3Z A;  3BGR A;  4FCY A;  1ASU A;  4DTO A;  1VSE A;  1EX4 A;  3NF6 A;  4FLY A;  3DLE A;  3RMC A;  1X9W A;  2P5O A;  1UA0 A;  5HRP A;  1RT6 A;  3NHG A;  4GMJ B;  3VQ8 A;  4B9L A;  1NKC A;  4CJF A;  4KTQ A;  4QOZ B;  3NF9 A;  5EU7 A;  2F8T A;  3ZSO A;  1EKE A;  1J54 A;  3KK1 A;  1VSM A;  1ASV A;  4LY7 A;  1WSJ A;  4OKJ A;  1XHX A;  2OYQ A;  3NDK A;  3LP3 A;  3AVN A;  4FLX A;  4F3T A;  4DTR A;  1RDC A;  4Q0B A;  1VK0 A;  1GOC A;  5J2M A;  1SKS A;  3HXM A;  3LZJ A;  4W5O A;  4FM1 A;  4FLT A;  4I9L A;  3TAR A;  2YKN A;  3L3V A;  3S3N A;  3IAY A;  3EYZ A;  1J5O A;  1Q8I A;  4CJQ A;  3OYA A;  3B6O A;  3OS0 A;  3TAP A;  4CK2 A;  2KW4 A;  3LAL A;  1VSD A;  4DFM A;  4CEO A;  3C95 A;  1FKO A;  3NCI A;  1Z26 A;  3HL8 A;  2D0A A;  3QEP A;  1KFS A;  1MU2 A;  4YNQ A;  3HT3 A;  1BCO A;  1S1V A;  2W42 A;  3SQ1 A;  3ZT3 A;  2NUB A;  1ZBI A;  3OYN A;  4CEZ A;  3MEE A;  4PQU A;  1S6Q A;  3BDP A;  1U49 A;  2Z1G A;  4M45 A;  4BDP A;  2ETJ A;  3AA4 A;  4DMN A;  3OYG A;  3A2F A;  1T05 A;  4BE2 A;  4FJX A;  4FZZ A;  1A5X A;  3MED A;  4NCG A;  3TWH A;  4KKO A;  2YKM A;  3AO2 A;  1U4B A;  3C94 A;  1UWB A;  4KFB A;  3DM2 A;  4PA1 A;  3VQC A;  4CEA A;  3QEW A;  3TAN A;  2X6N A;  4FJH A;  4FVM A;  4WE1 A;  5C24 A;  4CEB A;  1BIS A;  3PO5 A;  4CFB A;  4FK4 A;  3SYZ A;  3C6U A;  3SV3 A;  1NOY A;  1BQN A;  2JGU A;  3TAG A;  4L8R B;  5J2P A;  4F2S A;  3DLG A;  2Q3S A;  5J2N A;  4DQI A;  3I0S A;  3NGZ A;  5HRO A;  1RT5 A;  2HHQ A;  3ZSZ A;  2HHS A;  3V81 A;  3L2R A;  1TK5 A;  1T7P A;  1I3A A;  1ZBH A;  4RG8 A;  5FRO A;  2FC0 A;  4B8A B;  1T8E A;  3VQD A;  1QE1 A;  1Q9X A;  3AA5 X;  5I42 A;  4ID5 A;  4DLE A;  2X74 A;  1TKZ A;  4FLV A;  3NGY A;  4CF0 A;  3ZSY A;  1KTQ A;  4QAG A;  5DMR A;  3K5N A;  3LAM A;  4IKF A;  3TAE A;  1SL1 A;  2XY6 A;  1UAX A;  1RDD A;  2P51 A;  3RWU A;  3DRP A;  2BDP A;  1VSH A;  4E1M A;  5KRS A;  2Y1I A;  4CJK A;  3SUP A;  5DK5 A;  3OYH A;  4O55 A;  4Z4C A;  1WSH A;  1HQE A;  2P5G A;  5KGX A;  4M42 A;  2ZE2 A;  2F8S A;  2HVH A;  1NK6 A;  1DTT A;  1TAQ A;  4FJ7 A;  3KKS A;  2VG7 A;  4LH4 A;  2IAJ A;  3KLH A;  5HLF A;  3DRS A;  1LWE A;  5C42 A;  5CZ1 A;  3PX6 A;  2LSN A;  3AVL A;  4I2Q A;  1L3U A;  1CZ9 A;  4E3S A;  1A5W A;  2Y1J A;  3ZSV A;  4CEC A;  3QET A;  4H4O A;  4FLU A;  3WNH A;  4QCL A;  1QQC A;  3RMD A;  3HPO A;  4DTX A;  4FJG A;  4LH5 A;  4BDY A;  4KO0 A;  1LW0 A;  4FW1 A;  1FXX A;  3L8B A;  4JS5 A;  4FJ5 A;  4PY5 A;  3SNN A;  3SV4 A;  4OVL A;  4NCA A;  1BL3 A;  1WNS A;  3V1O A;  5HP1 A;  3MXM A;  1ZYQ A;  3QEV A;  4OLB A;  2O4G A;  1KFD A;  3KTQ A;  4FXD A;  3MEC A;  1BHL A;  1J53 A;  4DWI A;  4M3X A;  4O0J A;  3L2U A;  3K58 A;  5J2Q A;  4ZTJ A;  1ZBL A;  3SJJ A;  3NAE A;  2HB5 A;  3VQE A;  3ITH A;  3WNF A;  3MEG A;  4H8K A;  4OPJ A;  4EP5 A;  4FM0 A;  2G8U A;  1JXB A;  1EP4 A;  1J9A A;  2IS3 A;  4DFJ A;  2WON A;  4FJK A;  3K57 A;  1TVR A;  1VSJ A;  1FKP A;  1WLJ A;  2G8I A;  3L3U A;  1A5V A;  2VG5 A;  3VQ6 A;  2OA8 A;  1WAF A;  1RT2 A;  2P1J A;  4E7L A;  4F4K A;  3QEX A;  3QNO A;  5C25 A;  1L3S A;  4N41 A;  4Q5V A;  1RDB A;  3KLF A;  4C8M A;  4BDZ A;  1NJW A;  3WNG A;  4RW9 A;  4AIL C;  4E7K A;  4DQQ A;  3M8Q A;  4FLW A;  4R5P A;  1Z25 A;  1X1P A;  2A1S A;  3NBP A;  3M8R A;  3V9S A;  4FK0 A;  1VSL A;  3L2W A;  4C8L A;  4BWJ A;  4FK2 A;  4CGH A;  4KHQ A;  4AHC A;  3RR8 A;  3LP1 A;  1LW2 A;  3HP9 A;  4B9U A;  1YTA A;  2BAN A;  4NYN A;  1NK5 A;  2RF2 A;  4N76 A;  1BCM A;  3I0R A;  1NK9 A;  3MAQ A;  3SQ0 A;  1IKY A;  2D0B A;  3V9W A;  3D45 A;  4JLH A;  4CJV A;  3HPH A;  4DS4 A;  3VQ7 A;  4CGJ A;  1NKE A;  2BGG A;  3ULD A;  4CIF A;  2G8K A;  2YNF A;  5I3U A;  2YHB A;  4CIG A;  3AO4 A;  1IKX A;  3QO9 A;  1HYS A;  3VQQ A;  4HTU A;  4F3O A;  2HNY A;  3AO5 A;  3HVT A;  4BAC A;  3SPZ A;  4I2P A;  2FBT A;  2HHX A;  1BIU A;  4XIU A;  4CF8 A;  3HPG A;  5SZT A;  4W5R A;  1HYZ A;  4CED A;  4KHY A;  1BQM A;  1RT1 A;  4AHT A;  4DU4 A;  3VQ5 A;  4FJJ A;  1RBU A;  3OYI A;  2OPQ A;  4CFC A;  3T1A A;  4DSI A;  1GOA A;  3NE6 A;  3B6P A;  3THV A;  4FJI A;  3F9K A;  4O44 A;  4HHT A;  4C8K A;  2IC3 A;  5T7B A;  5JS2 A;  1KSP A;  3LPT A;  4CHO A;  4CJE A;  1TK8 A;  2R7Y A;  1RIL A;  3KLI A;  4KRF A;  4CJ4 A;  2XY8 A;  3AVH A;  3OYB A;  2KZM A;  1S1W A;  3CFO A;  1CXU A;  1RTI A;  1D9F A;  3S3O A;  2PYJ A;  1YTU A;  5CYM A;  4OJR A;  3ZSR A;  4E19 A;  3AVJ A;  4H4M A;  4CJL A;  1C0T A;  3AVG A;  1TKX A;  3K5M A;  2E6M A;  3LP0 A;  4IBN A;  4M3U A;  3P1G A;  4B9V A;  2GUI A;  4M3Y A;  2BE2 A;  3ZT4 A;  4BWM A;  2KFZ A;  4Z4F A;  2OPP A;  5CY4 A;  4FJN A;  5HRR A;  1B9D A;  1XI1 A;  2G8H A;  3IRX A;  3LAK A;  4DSL A;  3KK3 A;  2O4I A;  4KB1 A;  2HND A;  4CFD A;  3KKR A;  1JL2 A;  1G15 A;  3KLG A;  4GW6 A;  5D3G A;  2OPS A;  4DFK A;  4B9S A;  4FJL A;  1UA1 A;  4CHN A;  2QXF A;  3QIN A;  1D9D A;  1HMV A;  2DFE A;  2FBX A;  2D0C A;  2I5J A;  1JLG A;  1VRT A;  4O0I A;  3O3G A;  2XY7 A;  1LAW A;  1S1U A;  3V4I A;  3SUQ A;  3SCX A;  1QSS A;  1W9H A;  3P5J A;  1TKT A;  2DFF A;  3I8D A;  4DTM A;  2WOM A;  3SUN A;  4DF4 A;  4RW4 A;  1KLN A;  1LAV A;  4DSK A;  3H08 A;  1NK7 A;  2HHT A;  4CF2 A;  4ZTF A;  1EET A;  4DSE A;  3AO3 A;  3SZ2 A;  4KI4 A;  2EX3 A;  3RRG A;  4IFV A;  3NF7 A;  4CJT A;  4N5S A;  4N47 A;  1IKW A;  2DFH A;  3O3F A;  1REV A;  1QSL A;  5JS1 A;  3ISN C;  4E1N A;  4CGD A;  1R0A A;  1U45 A;  1TV6 A;  1RBS A;  3AVA A;  4J2E A;  4E7H A;  3O4Q A;  4CK3 A;  3EY1 A;  3K59 A;  1K6Y A;  3ZT0 A;  1RBR A;  1HYV A;  5KGW A;  1HJR A;  4B08 A;  3ZSX A;  2IGI A;  4FJ8 A;  3HYF A;  4CCH A;  3HM9 A;  4KV8 A;  4IDK A;  3RMA A;  1B92 A;  1CXQ A;  2OPR A;  1FK9 A;  3G0Z A;  1SL2 A;  2KTQ A;  1JLE A;  5HRN A;  4DTJ A;  3SQ2 A;  1L3V A;  3LDS A;  3AVC A;  4CGG A;  2YNG A;  4KAZ A;  1U04 A;  5FRN A;  4FYD A;  5KTQ A;  3U6F A;  3K5O A;  1SV5 A;  3TAB A;  1CLQ A;  3KJV A;  4HCB A;  1CZB A;  3C6T A;  1TK0 A;  3VQP A;  4CHZ A;  3RTV A;  3F73 A;  3DYA A;  4Y1D A;  3HVR A;  4CGF A;  2QKK A;  1WSI A;  1QTM A;  3ZSQ A;  3DMJ A;  4DTU A;  2ZQB A;  4E0D A;  4KI6 A;  1RT4 A;  2HNZ A;  4OKE A;  4DSJ A;  2VWK A;  4KHS A;  5KRT A;  5HRS A;  3V1Q A;  1JLB A;  4G1Q A;  4CGI A;  4FZX C;  4M3R A;  1ITG A;  3AA3 A;  1RTJ A;  3KK2 A;  3UIQ A;  1BIZ A;  4J2D A;  3HO1 A;  3OS1 A;  4DQR A;  1KCF A;  4CEQ A;  2A1R A;  3DOL A;  4CJR A;  1RDA A;  1S9E A;  1N6Q A;  4DSF A;  3M8S A;  4K8X A;  4FJM A;  3LWL A;  4ELV A;  3O3H A;  4FZY A;  4ICL A;  1C1B A;  1U48 A;  4AHU A;  1EXQ A;  2HHU A;  2DTU A;  4I7F A;  2B4J A;  4DF8 A;  1NKB A;  2QKB A;  2D5R A;  3QEI A;  4MQ3 A;  2IOC A;  1SL0 A;  2X6S A;  4Z4G A;  3OY9 A;  3S3M A;  4Z4E A;  4CES A;  4PWD A;  4CE9 A;  3V9Z A;  2HW3 A;  1TAU A;  4DG1 A;  3DOK A;  1WSE A;  2E4L A;  4CHQ A;  2HVI A;  2B6A A;  2DY4 A;  3VQB A;  4HCC A;  2KZZ A;  2XHB A;  4EZ9 A;  4J2A A;  4IFY A;  3CG7 A;  3HP6 A;  3T3F A;  1B9F A;  1JLF A;  4B8C A;  1IKV A;  4CHP A;  4IG3 A;  4C8N A;  1S5J A;  2VG6 A;  3TI0 A;  4TSX A;  4DU1 A;  3TAM A;  1WN7 A;  4DLG A;  4LD0 A;  3ZCM A;  3V9X A;  2IDO A;  3CYM A;  2F96 A;  4OGC A;  4ELU A;  4IG0 A;  2Z1I A;  4PUO A;  4I9Q A;  3CM5 A;  3LPU A;  3ZSW A;  4UQG A;  4KTW A;  4O4G A;  4CJP A;  4CEE A;  3DLK A;  4DS5 A;  1YVU A;  4C8O A;  1HQU A;  2GBZ A;  1ZBU A;  4CIE A;  4NCB A;  4CJ5 A;  1D5A A;  1TL1 A;  2Z1H A;  4BE0 A;  3QIO A;  3KLE A;  1S1T A;  3HK2 A;  4LSL A;  1WSF A;  4KPY A;  3TR8 A;  4JRP A;  3VA0 A;  1C0U A;  1KVA A;  3OYF A;  1JLC A;  4M3T A;  2RKI A;  2RN2 A;  3CFR A;  4E7J A;  1RNH A;  4M41 A;  1GOB A;  1T03 A;  1VSI A;  3ASM A;  3QNN A;  1JXE A;  1NJZ A;  2OZM A;  3RMB A;  4KHW A;  3QLH A;  3V9U A;  3ZT1 A;  4ZHR A;  3DLR A;  4CEF A;  4FLZ A;  1C1C A; 
#chains in the Genus database with same CATH topology
 4JKD A;  1VSK A;  4AHR A;  2YV0 X;  5LJW A;  1BGX T;  4HUE A;  3MWP A;  2VCP A;  2E1Z A;  4BRK A;  1VQ5 N;  3ATU A;  4FM2 A;  3SBT A;  2E88 A;  3B8A X;  1ASW A;  3IS9 A;  3PUF A;  3PV8 A;  3JYT A;  4Z4H A;  3O9T A;  3TAF A;  5AQZ A;  2PY5 A;  3E9P A;  3EKU A;  4RW8 A;  4CJS A;  3MCP A;  3G25 A;  1D8Y A;  2O8D B;  1JCF A;  3MN6 A;  1RBT A;  4GKJ K;  1TL3 A;  4PHT X;  5J1E A;  1BI4 B;  4K43 A;  4JRQ A;  3PO4 A;  4Y0W A;  1X9S A;  4YFU A;  4KRE A;  3TAQ A;  1VQ4 N;  2ASO A;  3VEW A;  1FW6 A;  3O08 A;  2G8F A;  3KD5 E;  4CJW A;  3IG1 A;  4W5T A;  3PY8 A;  2E2Q A;  1QQM A;  2OCE A;  4YY3 K;  4AF1 A;  5FDL A;  4HVJ A;  5GIN A;  1QHT A;  4NYF A;  4ILJ A;  5E41 A;  4Z4I A;  3CET A;  1K8K A;  3KWG A;  4KHU A;  1YHQ N;  1JL1 A;  3AAR A;  3SI6 A;  1LV5 A;  5MLC Q;  3CC2 N;  4DQP A;  1W0H A;  1SKR A;  3R3L A;  2BH1 A;  1JLA A;  3CC4 N;  3PSF A;  2AJQ A;  3OYD A;  3CCM N;  3AVI A;  4OLA A;  4YOW A;  4B1Y B;  3C65 A;  2VWJ A;  1OVY A;  5AQX A;  3PX4 A;  1L3T A;  3OYJ A;  2E20 A;  1OH6 A;  1QS4 A;  1Y64 A;  4W5N A;  4H0O A;  1K9M O;  2UU9 K;  5AFU A;  1JLQ A;  3NH0 A;  4O8U A;  5AQK A;  1C6V A;  1NJY A;  1NK0 A;  1VQO N;  1L5U A;  4JHD B;  1NK8 A;  3NH1 A;  3LP2 A;  1ATR A;  5AQO A;  4CBX A;  5HRP A;  4GMJ B;  2QEX N;  3TTC A;  4CJF A;  4KTQ A;  3CJ1 A;  3TSP A;  4JKC A;  1EKE A;  1VSM A;  1ASV A;  4LY7 A;  4XH1 A;  4OKJ A;  4BG9 A;  3PIP L;  3AVN A;  1WOQ A;  4DQ8 A;  1RDC A;  4Q0B A;  1SKS A;  4MLE A;  4KH4 A;  4FLT A;  4I9L A;  1YUW A;  3IAY A;  3CIP A;  1Q8I A;  4IJA A;  3D2E A;  3SK3 A;  3TAP A;  2KW4 A;  3S41 A;  4DFM A;  3C95 A;  1FKO A;  4IOA L;  3ZX0 A;  3HT3 A;  2P9K B;  2NUB A;  4PQU A;  3OYN A;  1S6Q A;  1GLA G;  3BDP A;  1U49 A;  2ETJ A;  4DMN A;  2GUP A;  3FR0 A;  1A5X A;  2VGM A;  4YHH K;  3HM8 A;  4JI4 K;  3M3Z A;  1U6Z A;  3VEO A;  4FJH A;  2X6N A;  4FVM A;  4CEB A;  4UY8 O;  4CFB A;  1VQM N;  3L4Q A;  3TAG A;  4L8R B;  4FWQ A;  4DQI A;  5HRO A;  2HHQ A;  3ZSZ A;  3V81 A;  1I3A A;  5FRO A;  2FC0 A;  3WXK A;  4B8A B;  1T8E A;  1Q86 O;  1Q9X A;  4K25 A;  4ID5 A;  1TKZ A;  4FLV A;  3NGY A;  4CF0 A;  2HHH K;  1KTQ A;  5DMR A;  4IKF A;  3LAM A;  2XY6 A;  4B1V A;  3DRP A;  3QIC A;  2GX9 A;  3DLL L;  3SUP A;  1OH7 A;  3SJH A;  4Z4C A;  1P90 A;  1HQE A;  1WSH A;  3VER A;  4JK7 A;  2F8S A;  2HVH A;  1NK6 A;  1DTT A;  1TAQ A;  5BPN A;  4NXN K;  2IAJ A;  1T6C A;  4E1J A;  3MX5 A;  5M1K A;  5C42 A;  4LF6 K;  2LSN A;  3AVL A;  3LDQ A;  2Y1J A;  1FJG K;  4FLU A;  4QCL A;  1NLV A;  2ASM A;  4C1N K;  3PLA A;  4KO0 A;  4FW1 A;  3L8B A;  1Z6R A;  3THW B;  2O8D A;  3SNN A;  1BL3 A;  2KKZ A;  2ZGY A;  3V1O A;  2YX6 A;  2ZF5 O;  4IOX A;  1KFD A;  1WUA A;  4M3X A;  2H3G X;  1GLL O;  3NAE A;  1YJW N;  4H8K A;  4CZK A;  2QI2 A;  2IS3 A;  1EP4 A;  1J9A A;  3THY B;  3K57 A;  4JKA A;  1WLJ A;  2G8I A;  1QVF M;  3L4I A;  1RDW X;  2Q1N A;  1RT2 A;  4F4K A;  1TYQ B;  4N41 A;  4Q5V A;  1Q18 A;  2Q36 A;  1NMN A;  4C8M A;  1NJW A;  2FXU A;  3LDP A;  3CJC A;  3SLC A;  4X66 K;  2QWR A;  4DQQ A;  4H0P A;  4EAH D;  4X65 K;  1Z25 A;  4FWM A;  2A1S A;  4R5P A;  2W6L A;  3QFP A;  4KHQ A;  1LW2 A;  1T3V A;  3HP9 A;  2RF2 A;  4FOE A;  2D0B A;  3V9W A;  4JLH A;  3WXJ A;  3VQ7 A;  2YHY A;  3ULD A;  2G8K A;  2YNF A;  4V19 S;  3UKU B;  3BY5 A;  1IKX A;  3QO9 A;  4KHP K;  3BF1 A;  4BAC A;  3AO5 A;  3HVT A;  3SPZ A;  2HHX A;  3CHW A;  2QWO A;  4CF8 A;  5SZT A;  3HOT A;  3J7A P;  3OYI A;  4DSI A;  4CFC A;  2UXC K;  3NE6 A;  3THV A;  3F9K A;  5T7B A;  1KSP A;  3CXC M;  3LPT A;  2GTD A;  1RIL A;  3KLI A;  3CFO A;  1RTI A;  1D9F A;  5A2Q O;  3S3O A;  4KH6 A;  3ZSR A;  1C0T A;  4M3U A;  2GUI A;  4BRG A;  4Z4F A;  2OPP A;  3HSC A;  4DSL A;  4A62 A;  2YCH A;  1IJJ A;  5AQH A;  3VF2 A;  3KLG A;  4GW6 A;  1NNE A;  1UA1 A;  1D9D A;  1N32 K;  4FWP A;  4O0I A;  4BR2 A;  2XY7 A;  3ULE A;  3GDQ A;  2YJE A;  3VES A;  3P5J A;  5TKW A;  1TKT A;  4DHY A;  2HMP A;  2WTU A;  4DF4 A;  3CCR N;  1NK7 A;  5F2R A;  4ZTF A;  1EET A;  3D6R A;  1N8R O;  3AO3 A;  2EX3 A;  4DV7 K;  1IKW A;  4PKI A;  1REV A;  1QSL A;  3CC7 N;  4CGD A;  1U45 A;  2O8B B;  1RBS A;  3JAM O;  4E7H A;  3K59 A;  4GY2 B;  4CK3 A;  3CQY A;  1K6Y A;  3GBT A;  3IMX A;  1KAZ A;  1YIJ N;  4OPA A;  1HYV A;  5KGW A;  3IKM A;  3ZSX A;  3HM9 A;  3PIO L;  1CXQ A;  1FK9 A;  4JKG A;  5HRN A;  1NGA A;  3VEN A;  1NG9 A;  3TSQ A;  4FYD A;  2IVP A;  2P9P A;  3Q7C A;  3K5O A;  1CZB A;  5H1S Q;  3F5T A;  3RTV A;  5TKY A;  1WBB A;  4Y1D A;  4CGF A;  1WSI A;  1QTM A;  3ZSQ A;  3DMJ A;  4E0D A;  1E3M A;  3H6E A;  4YOT A;  4JI5 K;  3OBW A;  1RGI A;  1BUP A;  4G1Q A;  3CCL N;  1HX1 A;  1ITG A;  3AA3 A;  1N34 K;  5C2D A;  4CEQ A;  5AQT A;  2V7Y A;  4NLB A;  4AM6 A;  4DSF A;  1K8A O;  3MCA B;  3IUC A;  1V4S A;  2VQE K;  4BQZ A;  1U48 A;  1S72 N;  2HHU A;  2ZGZ A;  1NKB A;  1XNQ K;  2D5R A;  3QEI A;  1YJ9 N;  1XMQ K;  1W7A A;  1SS6 A;  4BR7 A;  4CES A;  1HNW K;  1TAU A;  2E4L A;  3VQB A;  4HCC A;  2KZZ A;  4J2A A;  3CG7 A;  1JLF A;  2I7N A;  4IG3 A;  4C8N A;  5AQG A;  2VG6 A;  3C6H A;  4TSX A;  1H1V A;  4DB3 A;  3FE1 A;  2DPN A;  3CYM A;  3E9L A;  4IG0 A;  2QM1 A;  4PUO A;  2NLX A;  1P8Z A;  2J4R A;  1TYQ A;  4DS5 A;  4C8O A;  4BY9 C;  2GBZ A;  4NCB A;  2IVO A;  3EE8 A;  2QWM A;  2IVN A;  4BRP A;  3HK2 A;  4LSL A;  4OO1 J;  4JRP A;  4BC4 A;  3VA0 A;  3OYF A;  2AA4 A;  5AQR A;  1NWK A;  3SMP A;  4M41 A;  2NRZ A;  3VEV A;  3ASM A;  2OZM A;  5DM6 L;  4B1X B;  1Q7Y O;  3QLH A;  3ZT1 A;  4CZI A;  4CEF A;  4FLZ A;  4CHQ A;  2XRI A;  4GVE A;  2JLE A;  3OHR A;  3CFP A;  1HNV A;  2YHA A;  3LAN A;  3VA3 A;  3DRR A;  3JS6 A;  1NBW A;  1JKH A;  1SQK A;  4H5R A;  4EP4 A;  4JS4 A;  1YT3 A;  2RPI A;  2G8W A;  2E1Y A;  3VGK A;  1Y97 A;  3CMA N;  3LM2 A;  3AVK A;  3O8M A;  1ILY A;  3ZYY X;  1UOC A;  3L2V A;  3LWM A;  4E89 A;  3KWI A;  4A2B A;  5JMV A;  4LSN A;  2YNH A;  4FJ9 A;  4B9M A;  1K8K B;  1RT7 A;  4CF9 A;  4BR4 A;  3LZI A;  1GLD G;  5KI6 A;  4X62 K;  4BRH A;  3EZ5 A;  4CER A;  3S9H A;  4ILH A;  5AZI A;  3VF6 A;  2QWP A;  3VQ9 A;  3QES A;  2PYL A;  1LWF A;  4JI0 K;  4F8R A;  1ESV A;  3ZET A;  1DLO A;  5K14 A;  3VEZ A;  1WSG A;  4K8Z A;  1RCH A;  4N56 A;  2YJF A;  4OKK A;  4JI6 K;  1S6P A;  4GVM A;  1Q81 O;  4CJ7 A;  5CYQ A;  5C2F A;  5AQV A;  4B3R K;  1S1X A;  4DTP A;  1HLU A;  1RT3 A;  1VQ9 N;  3V1R A;  1N5Y A;  3AA2 A;  5AJ3 K;  2P9N A;  3GL1 A;  4BE1 A;  4EZ6 A;  3CJ7 A;  3NH2 A;  4CBW A;  3AAQ A;  4JK8 A;  2E2O A;  3AVM A;  3U3G A;  2FBV A;  2HBL A;  1HPZ A;  4M63 C;  4MO4 A;  3CQ8 A;  3K5L A;  1X9M A;  4WFN L;  3LM9 A;  1ZBF A;  3QBX A;  4OGE A;  4CF1 A;  1TKD A;  3ZT2 A;  3OYL A;  3G6E N;  1LOT B;  3CQX A;  3AAP A;  2YHX A;  4E7I A;  1VQ6 N;  3L0Q A;  4B3M K;  3D2E B;  1KVC A;  3OJU A;  3ZX2 A;  3RRH A;  3KIO A;  1KRP A;  4M7X A;  2ITG A;  1DGK N;  4ID1 A;  3BGR A;  4FCY A;  2BUP A;  1VSE A;  1X9W A;  3NF6 A;  4FLY A;  3RMC A;  2P5O A;  4U67 L;  1RT6 A;  3VQ8 A;  1NKC A;  2F8T A;  2QWQ A;  2P9I A;  1WSJ A;  4LF9 K;  2E5L K;  1EO1 A;  5GIO A;  2OYQ A;  1Z05 A;  4F3T A;  1HKB A;  4DTR A;  1GLE G;  1VK0 A;  3LZJ A;  1J5E K;  3J7Z O;  1YXQ A;  4HTL A;  3WXM B;  4FM1 A;  4DR3 K;  2YKN A;  4BR9 A;  3S3N A;  3LDL A;  4EFH A;  1D4X A;  2PAV A;  3EL2 A;  5AQY A;  1VSD A;  4FOI A;  3RVC A;  1SZ2 A;  1Z26 A;  3HL8 A;  3QEP A;  1MU2 A;  2Q0R A;  3BP8 A;  2W42 A;  1ZBI A;  2Z1G A;  4M45 A;  2RE2 A;  3KHY A;  3T69 A;  4WQ4 A;  1T05 A;  4BE2 A;  4NCG A;  3MED A;  4IXC A;  1U4B A;  4KKO A;  2YKM A;  3C94 A;  1UWB A;  4CEA A;  1U2V B;  5C24 A;  4WE1 A;  3PO5 A;  4FK4 A;  1BIS A;  3H45 C;  1T6D A;  3SV3 A;  4QS7 A;  5AFU H;  1NGB A;  4F2S A;  3WEE A;  4F9O A;  3NGZ A;  3FZM A;  4B3T K;  4CD3 A;  1HR0 K;  2HHS A;  1BWF O;  4BRI A;  1T7P A;  4FSV A;  1ZBH A;  3H1Q A;  5GAE P;  2GEM A;  3P38 A;  4DLE A;  2Q2R A;  4QAG A;  4CZM A;  3K5N A;  1WB9 A;  1SL1 A;  2BDP A;  1VSH A;  4E1M A;  5AQU A;  2P5G A;  4O55 A;  4LFA K;  2O8F A;  5KGX A;  2ZE2 A;  4LH4 A;  4WFA L;  1YAG A;  3KLH A;  5HLF A;  3DRS A;  2FSK A;  4I2Q A;  1L3U A;  1CZ9 A;  4CW7 B;  2F9T A;  4H4O A;  4BG8 A;  1QQC A;  3HPO A;  3QFU A;  4LH5 A;  5JLF A;  4JS5 A;  5JVG L;  4FJ5 A;  1ZYQ A;  3MXM A;  4BRE A;  4JEP A;  3HI0 A;  4FXD A;  1BHL A;  1J53 A;  2NRX A;  1KC8 O;  3L2U A;  3CJA A;  3SJJ A;  3VQE A;  4BVO A;  2P9U A;  2HST A;  4FJK A;  2WON A;  3VOV A;  1TVR A;  3O4W A;  3L3U A;  3VQ6 A;  1WAF A;  1KXP A;  3QEX A;  3QNO A;  3C0B A;  3KLF A;  1IG8 A;  3BZK A;  3WNG A;  4AIL C;  4JI7 K;  4FLW A;  4YOY A;  3GG4 A;  3NBP A;  4GNI A;  3O9R A;  3RR8 A;  3BEX A;  4BC2 A;  3H3O B;  1NK5 A;  1BCM A;  3I0R A;  2UXB K;  3MAQ A;  3SQ0 A;  3D45 A;  4CJV A;  3HPH A;  3ID6 A;  5M1P A;  4BGA A;  1NKE A;  4CIF A;  4IZ9 A;  4PL8 A;  4WQ4 C;  4B1W B;  3AO4 A;  5EVZ A;  3IFR A;  2HNY A;  1KQS M;  1EQY A;  2V51 B;  1N33 K;  1NGC A;  4CED A;  4BRA A;  4AHT A;  3DXK A;  4DU4 A;  3VQ5 A;  1RBU A;  3ULE B;  1QZ6 A;  4O44 A;  4HHT A;  4AM7 A;  3CCE N;  4C8K A;  5JS2 A;  4DKW A;  1HPM A;  4CJE A;  2KZM A;  3OYB A;  1NGD A;  1S1W A;  2PBD A;  4DR1 K;  2PFU A;  1X9J A;  3I33 A;  3AVJ A;  3AVG A;  1TKX A;  1BA0 A;  3H46 O;  3O9U A;  2KFZ A;  2JWL A;  3FZK A;  5HRR A;  3M6G A;  2G8H A;  3IRX A;  3KK3 A;  2O4I A;  3KKR A;  1KAY A;  5D3G A;  2OPS A;  4FJL A;  2F4V K;  2QXF A;  3QIN A;  1HMV A;  5KPZ A;  4JKG B;  2QXL A;  2I5J A;  1JLG A;  3O3G A;  3SCX A;  2P9P B;  1W9H A;  2WOM A;  3SUN A;  5BRE A;  5B8H A;  4C23 A;  4DSE A;  5M1N A;  4KI4 A;  1ZXO A;  3O9Q A;  3G71 N;  4H0T B;  1HKG A;  4CJT A;  4AQY K;  3Q7B A;  2DFH A;  3ISN C;  4E1N A;  1R0A A;  4RWT A;  2E2N A;  3F9M A;  5AQP A;  3ZT0 A;  1U2V A;  2FSJ A;  1RBR A;  3L6Q A;  4DUY K;  3VEY A;  3FZL A;  4B08 A;  2IGI A;  3HYF A;  2D1K A;  4IDK A;  5C12 A;  3UE5 A;  4QS9 A;  1SL2 A;  3SQ2 A;  1L3V A;  4KAZ A;  4FWR A;  3WQU A;  1W97 L;  4ISG A;  1CLQ A;  4HCB A;  3GOI A;  5LJV A;  4CHZ A;  3DYA A;  5CE3 A;  2Q31 A;  4KI6 A;  4OKE A;  3NVK A;  5BPM A;  1JLB A;  1NGF A;  4CGI A;  5GIP A;  2O8E A;  3THX A;  2NNW A;  4RCH A;  3OS1 A;  4DQR A;  3RSE A;  1RDA A;  3A5L C;  3M8S A;  3LWL A;  5IWA K;  3O3H A;  4ICL A;  1C1B A;  5M1Q A;  3WXI A;  1Q82 O;  2DTU A;  4MLH A;  4GV3 A;  2B4J A;  2QKB A;  4MQ3 A;  3S3M A;  5KQ8 A;  4Z4E A;  3OTO K;  4PWD A;  3MN9 A;  2B6A A;  2F7T A;  3E66 A;  3BF3 A;  5I9E B;  1G99 A;  3TI0 A;  4DU1 A;  4H03 B;  3V9X A;  2IDO A;  2F96 A;  2Q0U A;  3J81 O;  3CM5 A;  3FFK B;  3ZSW A;  4O4G A;  3LDN A;  4CEE A;  1XMO K;  1ZBU A;  4CJ5 A;  1TL1 A;  4BE0 A;  3QIO A;  1WSF A;  4M3T A;  2FSN A;  2RKI A;  3AGK A;  2GEL A;  3CFR A;  1RNH A;  5AZI B;  4H0V B;  3VF4 A;  3QNN A;  3AGR A;  4KHW A;  3V9U A;  5BN8 A;  3ZET B;  1C1C A;  5F1X A;  1J5O A;  3I8B A;  4PKH A;  1NOZ A;  4JV5 K;  1C1A A;  3JSM A;  1CZA N;  1RTD A;  4B9N A;  4F2R A;  4DTS A;  3NMU A;  1YIT N;  1C0G A;  2GWK A;  5EX5 A;  3UKR A;  3IDH A;  3R1X A;  1SUQ A;  1IG9 A;  1VRU A;  1NMD A;  5KQD A;  3FFI A;  3HST B;  3ZEU A;  1BU6 O;  4RW6 A;  4IEI A;  2PZS A;  2FLO A;  2P9N B;  4BRF A;  1RBV A;  4H0Y B;  3OYC A;  4AHV A;  2B5J A;  3J80 O;  1HNZ K;  4M3W A;  3T19 A;  4JI1 K;  4CFA A;  3LDO A;  3RR7 A;  1BG3 A;  3SPY A;  2G8V A;  3MXI A;  1J6Z A;  2ZD1 A;  4BRM A;  1DTQ A;  2OZS A;  1GLF O;  3O4N A;  4DQS A;  4JYA K;  4MFB A;  5FRM A;  3AVF A;  4OPK A;  3P83 D;  3R8E A;  1XHZ A;  2HHW A;  4HWI A;  1MWM A;  2IIR A;  2HMI A;  4G9Z A;  3H3N O;  3R9P A;  2I7P A;  4FWK A;  3BZC A;  3NF8 A;  2XO7 A;  4FW2 A;  4CZL A;  4BVP A;  4CJU A;  4KBO A;  5KPT A;  3KZB A;  2UUC K;  4BRD A;  5FPM A;  2P9I B;  2HHV A;  3OYE A;  3L2Q A;  4DU3 A;  1HRH A;  4DTN A;  3ALY A;  2UYT A;  1TGO A;  1KVB A;  4JKH A;  3OS2 A;  2EHG A;  3VQ4 A;  4Z0U A;  5ADX A;  3EE9 A;  2QK9 A;  1IH7 A;  3QIP A;  1O13 A;  3DLH A;  1NM1 A;  3G4S N;  1IO2 A;  1O1W A;  4KB0 A;  2KFN A;  2VQF K;  3QER A;  3M8P A;  3ID8 A;  4B3S K;  4AHS A;  3A5O C;  4JD2 A;  1RFQ A;  4DTO A;  1HUX A;  3DLE A;  1UA0 A;  3NHG A;  3MK6 A;  4BRQ A;  4DR2 K;  1OVQ A;  5EU7 A;  4ILG B;  3ZSO A;  1J54 A;  3KK1 A;  2V7Z A;  3OW2 M;  1XHX A;  2P9L A;  4QS8 A;  4K42 A;  1GOC A;  3WEE B;  5J2M A;  3HXM A;  4W5O A;  3TAR A;  3L3V A;  4O5F A;  3KVG A;  5M1O A;  3EEQ A;  3TTF A;  3OYA A;  3OS0 A;  1E4G T;  3LAL A;  2W41 A;  3H1V X;  3NCI A;  1KFS A;  4FWN A;  2D0A A;  4CZE A;  1BCO A;  1S1V A;  3K9J A;  3ZT3 A;  5BR9 A;  2O8F B;  4CEZ A;  3MEE A;  3A0I X;  3AA4 A;  4CZF A;  4EHT A;  3A2F A;  4FJX A;  4FZZ A;  3TWH A;  1TUY A;  4PA1 A;  3DM2 A;  3VMF B;  3TAN A;  3QEW A;  5KPR A;  2D4W A;  4NB4 A;  3W3D A;  1NOY A;  1BQN A;  3E1Y A;  5AQN A;  5J2P A;  5J2N A;  2Q3S A;  3I0S A;  5AQJ A;  3WT0 A;  4K41 A;  2ZJR L;  3AA5 X;  4FL9 A;  2D0P A;  2P9U B;  4FWS A;  5I42 A;  4H5W A;  2X74 A;  5M1F A;  3TAE A;  1UAX A;  1RDD A;  4IFE A;  3RWU A;  2GWJ A;  5KRS A;  4JNE A;  4CJK A;  1RDU A;  5DK5 A;  3HBT A;  3KKS A;  1BOT O;  1XUP O;  3PX6 A;  2QA4 N;  1A5W A;  2FF6 A;  3ZSV A;  1S3X A;  4FJG A;  1MA9 B;  1LW0 A;  1FXX A;  4PY5 A;  3MN5 A;  4FPA A;  4OVL A;  3SV4 A;  3FLC O;  5HP1 A;  3QEV A;  3E9O A;  4JI8 K;  4OLB A;  2O4G A;  3KTQ A;  3MEC A;  4O0J A;  3K58 A;  5J2Q A;  4LC9 B;  1K73 O;  3CD6 N;  3D2F A;  3WNF A;  2ZJP L;  2G8U A;  4EP5 A;  4GKK K;  4DFJ A;  3SAH A;  4A57 A;  2P9S B;  3DXK B;  2VG5 A;  3N4P A;  2P1J A;  2JWK A;  4E7L A;  1RDB A;  3ATV A;  4LFB K;  3TTD A;  1X1P A;  3M8R A;  3V9S A;  3QDK A;  1VSL A;  4C8L A;  1GLC G;  4BWJ A;  4RTF D;  4CGH A;  5GAG P;  4AHC A;  3WXL A;  3LP1 A;  4M7Y A;  3QB0 A;  4B9U A;  1YTA A;  3VGM A;  4N76 A;  3TPQ A;  1IKY A;  4MO5 A;  5BPL A;  4DS4 A;  4CGJ A;  5I3U A;  2YHB A;  4CIG A;  4JK9 A;  3O5B A;  3VQQ A;  4HTU A;  4IO8 A;  4I2P A;  2KHO A;  3HPG A;  4JAX A;  3O1W A;  4KHY A;  1LCU A;  1RT1 A;  4FJJ A;  1GOA A;  3B6P A;  4FJI A;  1KAX A;  4CHO A;  1TK8 A;  2NRW A;  3VGL A;  2R7Y A;  4CZG A;  3AVH A;  2VYP A;  1CXU A;  2PYJ A;  1YTU A;  4CZH A;  4CJL A;  1T44 A;  4GV6 A;  4DR5 K;  3ZX3 A;  3ENB A;  1IV0 A;  4M3Y A;  4B9V A;  1GLJ O;  1NGE A;  5AZJ A;  4BWM A;  3M5R A;  5CY4 A;  4FJN A;  1B9D A;  1XI1 A;  3LAK A;  4KB1 A;  4CFD A;  5BRH A;  3FZH A;  1G15 A;  4B9S A;  4DFK A;  5C0Y A;  4CHN A;  1NJI O;  3C7N A;  2D0C A;  1LAW A;  1S1U A;  3V4I A;  1QSS A;  3CJ9 A;  3I8D A;  3VEX A;  3CCS N;  4XH5 A;  4DTM A;  1KLN A;  4DSK A;  3H08 A;  4OPH A;  1JCG A;  5CHI A;  4IFV A;  3NF7 A;  4IWV A;  1YF5 L;  4N47 A;  3O3F A;  5JS1 A;  4IEE A;  3SMS A;  2O8E B;  3THX B;  4I6M A;  5EOY A;  3AVA A;  4J2E A;  3RSE B;  3U9Z A;  3EY1 A;  5F0X A;  2VWB A;  3P4I A;  2HBJ A;  1HJR A;  4ISF A;  4FJ8 A;  4CCH A;  1QVG M;  1X3M A;  4KV8 A;  1B92 A;  2OPR A;  3JXU A;  2KTQ A;  1JLE A;  2HF4 A;  4DTJ A;  3AVC A;  5FRN A;  5FPE A;  3FGU A;  1SV5 A;  4DV3 K;  3TAB A;  1BDG A;  3KJV A;  3EZW A;  2RHK A;  5LY3 A;  4Z94 A;  1XNR K;  3F73 A;  3HZ6 A;  2QKK A;  2ZQB A;  3I56 N;  2D0O A;  2HNZ A;  4DSJ A;  2VWK A;  4KHS A;  2OTJ N;  2V52 B;  4FPB A;  2YI1 A;  4MDB A;  3KK2 A;  1BIZ A;  4J2D A;  2A1R A;  3DOL A;  4FK2 A;  4K8X A;  2FF3 B;  4FJM A;  1HJO A;  4LF7 K;  3J8A A;  3WQT A;  1EXQ A;  4NO7 A;  3R6M A;  1SL0 A;  2X6S A;  4Z4G A;  3DXM B;  1EWQ A;  3V9Z A;  2OAN A;  4DG1 A;  1IBK K;  1WSE A;  2HF3 A;  2HVI A;  2DY4 A;  2XHB A;  1VQ8 N;  3HP6 A;  3T3F A;  1B9F A;  4B8C A;  1IKV A;  4CHP A;  1X3N A;  4DLG A;  3ZCM A;  2P9S A;  3D7E O;  2Q97 A;  4I9Q A;  2UXD K;  4UQG A;  3CCU N;  4KTW A;  4FWL A;  3UKR B;  5BRF A;  3DLK A;  3GE1 A;  1HQU A;  4CIE A;  1WBD A;  4A59 A;  1D5A A;  2Z1H A;  1OKJ A;  3ZEU B;  3KLE A;  1S1T A;  4B9Q A;  4GV9 A;  3VET A;  4BQL A;  5GAD P;  4KPY A;  4NLC A;  3TR8 A;  1C0U A;  1KVA A;  4MDA A;  1BO5 O;  2RN2 A;  2UUA K;  4B1U B;  1ATN A;  1MDU B;  1VSI A;  4LF8 K;  1NJZ A;  3QML A;  1V4T A;  1DKG D;  2NRT A;  3MN7 A;  3E01 A;  5LL6 Z;  2AP1 A;  4B3O A;  1F21 A;  4JKF A;  1Q9Y A;  2CGJ A;  3HJF A;  4CK1 A;  2KLA A;  3CCV N;  1XWL A;  5CR4 A;  4KTZ A;  5AQS A;  1NK4 A;  3CM6 A;  3K2P A;  2O8C A;  2A5X A;  4YOV A;  2WC9 A;  2E2P A;  3EKS A;  3MX2 A;  4Y1C A;  3AV9 A;  5C10 A;  2A3Z A;  4L3Q A;  2YNI A;  1QSY A;  4IJN A;  3K9K A;  3J7Y P;  5JIC A;  3SAG A;  3NGI A;  1XC9 A;  3SUO A;  1VSF A;  5HBM A;  3VTI A;  1YJN N;  1OH8 A;  2E6L A;  2KQ2 A;  4PKG A;  2XY5 A;  3G10 A;  4AH9 A;  3PX0 A;  3AO1 A;  1KLM A;  3A5M C;  4BC3 A;  4HUF A;  4CJ3 A;  3OYK A;  4K0K K;  4EIA A;  4W5Q A;  3KD1 E;  1LWC A;  1WAJ A;  5CZ2 A;  4FVU A;  4LF5 K;  4CHY A;  2HBM A;  5SWM A;  2GV9 A;  3V6D A;  4B9T A;  5E26 A;  4A5A A;  4C1N I;  4JD2 B;  3TU5 A;  1C0M A;  1RTH A;  4RW7 A;  1OH5 A;  3D0P A;  1SKW A;  3OJS A;  4ELT A;  2X78 A;  1XQS C;  1BI4 A;  5AQQ A;  4DFP A;  4BGB A;  4ISE A;  3DAW A;  3NFA A;  3U3Y A;  4NXM K;  4FO0 A;  1QZ5 A;  3VQA A;  1NJX A;  2ATQ A;  2P9L B;  5AQW A;  4WF9 L;  1U47 A;  3MXJ A;  3SQ4 A;  4KHN A;  4O5B A;  3OVN A;  4HUG A;  4H5N A;  3CPW M;  3VN5 A;  1HNI A;  3WNE A;  4WCE L;  3DI6 A;  1I39 A;  4X64 K;  5EY4 A;  3AVB A;  1N36 K;  2FBY A;  2Z1J A;  1QQN A;  3CJB A;  3DLB A;  1S9G A;  2NRH A;  3MMV A;  4BRN A;  3BUZ B;  3OYM A;  4JI3 K;  4J2B A;  4M3Z A;  4DV4 K;  1ASU A;  1EX4 A;  2A42 A;  4B9L A;  4QOZ B;  3NF9 A;  4H0X B;  3OBY A;  2CGL A;  3NDK A;  3LP3 A;  5EXW A;  4FLX A;  1M90 O;  4H5V A;  2WUS A;  3DXM A;  3EYZ A;  5C15 A;  1NGI A;  1EWR A;  3O80 A;  4CJQ A;  3B6O A;  4CK2 A;  3N4Q A;  5AR0 A;  4CEO A;  3HTV A;  2CH5 A;  3ENH A;  3O6W A;  4JHD A;  4YNQ A;  3CER A;  3KK7 A;  3SQ1 A;  2QW9 A;  4PL7 A;  4OX9 K;  1DT9 A;  1S22 A;  3FZF A;  4BDP A;  5AQL A;  3OYG A;  2A6A A;  2F9W A;  3AO2 A;  3CCQ N;  4KFB A;  3VQC A;  5ADX H;  3SYZ A;  3C6U A;  3CPE A;  2JGU A;  5BRD A;  3DLG A;  4DV6 K;  1RT5 A;  3QBW A;  4A5B A;  1TUU A;  1TK5 A;  3L2R A;  5BR8 K;  4RG8 A;  5AQF A;  1ZBS A;  4IDH A;  3VQD A;  1QE1 A;  3D2F B;  4CZJ A;  5JLH A;  3ZLJ A;  1C0F A;  3ZSY A;  3A5N C;  3SAF A;  2ZJQ L;  2P51 A;  4J8F A;  2Y1I A;  2P9K A;  3OYH A;  4M42 A;  2ZWH A;  1KD1 O;  4FJ7 A;  2VG7 A;  5FPN A;  1LWE A;  5CZ1 A;  4E3S A;  4YDU A;  3U4L A;  4CEC A;  3QET A;  3WNH A;  3T1Y K;  2VGN A;  4DTX A;  3RMD A;  2W6K A;  3MWT A;  4BDY A;  4XEI A;  3HOS A;  5JVH L;  2E8A A;  4NCA A;  1VAZ A;  1WNS A;  2W40 A;  4BRC A;  2A41 A;  2ASP A;  3M1F A;  5FLX O;  1ZC6 A;  4DWI A;  4DV0 K;  5E84 A;  4ZTJ A;  1BA1 A;  1ZBL A;  4LF4 K;  2NRR A;  2HB5 A;  4DR7 K;  3ITH A;  4FM0 A;  3MEG A;  4OPJ A;  1JXB A;  3ENO A;  1XC3 A;  1VSJ A;  1FKP A;  4FWO A;  1A5V A;  4O8K A;  2OA8 A;  1W2B M;  3HRG A;  3VPZ A;  1E4F T;  5C25 A;  1L3S A;  4BDZ A;  4RW9 A;  1HNX K;  4E7K A;  1JCE A;  3T7Z A;  3M8Q A;  3U9D A;  4FK0 A;  3EN9 A;  3L2W A;  3T1H K;  2BAN A;  3THW A;  4NYN A;  1NK9 A;  5AZJ B;  2BGG A;  4YOR A;  4EHU A;  3W0L A;  1HYS A;  4F3O A;  3A8Y A;  3UB5 A;  2FBT A;  3THY A;  1BIU A;  4XIU A;  4XH4 A;  4W5R A;  2NRV A;  1HYZ A;  1BQM A;  1I94 K;  3C7N B;  2OPQ A;  3I55 N;  3T1A A;  4LFC K;  2IC3 A;  3K0S A;  2BTF A;  4BC5 A;  4CD1 A;  4H5T A;  2HBK A;  4KRF A;  4CJ4 A;  2XY8 A;  5FPD A;  2UUB K;  2QWN A;  5CYM A;  4OJR A;  3DWL A;  4E19 A;  4H4M A;  5AQM A;  3K5M A;  2E6M A;  3LP0 A;  4IBN A;  3LL3 A;  3P1G A;  5LMN K;  2BE2 A;  1NGH A;  3ZT4 A;  1VQP N;  4I6M B;  4DV5 K;  1YVN A;  3UKU A;  1VQL N;  3EO3 A;  1YI2 N;  4WYB A;  2HND A;  4KH5 A;  4YDU C;  5DM7 L;  1JL2 A;  3OA9 A;  5IT9 O;  4WQ5 A;  2DFE A;  2FBX A;  4IOC L;  1VRT A;  5ELZ A;  3SUQ A;  3P31 A;  2DFF A;  3NVM A;  1QHA A;  1JJ2 M;  1VQN N;  4RW4 A;  1LAV A;  1NGJ A;  4JKE A;  1VQK N;  4R79 A;  4DUZ K;  4CF2 A;  2HHT A;  3CI5 A;  3SZ2 A;  4CI6 A;  3RRG A;  3SBG A;  1VQ7 N;  4N5S A;  3PSI A;  3MDQ A;  3F2K A;  4JKB A;  3U8X A;  1TV6 A;  3DJC A;  1SAZ A;  2CGK A;  3O4Q A;  4DR4 K;  2NZT A;  1R59 O;  4IO9 L;  3RMA A;  3G0Z A;  5HOO A;  1MWK A;  2ZM6 K;  3LDS A;  4DR6 K;  4CGG A;  2YNG A;  1U04 A;  5BN9 A;  5KTQ A;  4CVN E;  4YOX A;  3U6F A;  3C6T A;  1TK0 A;  3VQP A;  3O1B A;  4CBU A;  4DCH A;  3C6A A;  3HVR A;  4BRO A;  1IBM K;  4DTU A;  4WFB L;  1RT4 A;  5KRT A;  5GAH P;  5HRS A;  3AY9 A;  3V1Q A;  3TSU A;  1M1K O;  2WBN A;  5LMU K;  2QTD A;  4FZX C;  4M3R A;  2CH6 A;  1RTJ A;  3UIQ A;  2O8B A;  3O9S A;  3HO1 A;  4BRL A;  1KCF A;  4DV1 K;  5HL7 L;  3CF5 L;  4CJR A;  1S9E A;  1N6Q A;  4ELV A;  2QWL A;  4FZY A;  1DEJ A;  4AHU A;  2YHW A;  1HKC A;  4I7F A;  4DF8 A;  2IOC A;  3OY9 A;  1VHX A;  1ATS A;  4JI2 K;  1QQO A;  2HW3 A;  4CE9 A;  1GLB G;  1NU0 A;  3DOK A;  4U7B A;  4EZ9 A;  3WUH A;  4IFY A;  2ITM A;  4DV2 K;  4JN4 A;  4BR5 A;  3CME N;  1S5J A;  3TAM A;  1WN7 A;  4LD0 A;  3CCJ N;  4OGC A;  4ELU A;  2Z1I A;  3LPU A;  4WQ5 C;  4CJP A;  2A40 A;  2O8C B;  1YVU A;  4A61 A;  2EWS A;  4YOU A;  4B1Z A;  5AQI A;  3VTH A;  1JLC A;  2OTL N;  4E7J A;  1IBL K;  1NGG A;  4A2A A;  1GOB A;  2WFB A;  1T03 A;  2HOE A;  1JXE A;  3RMB A;  3P39 A;  4ZHR A;  3DLR A;  4BR0 A; 
#chains in the Genus database with same CATH homology
 2XRI A;  2JLE A;  3CFP A;  3E01 A;  1HNV A;  2YHA A;  3LAN A;  3VA3 A;  3DRR A;  1NOZ A;  4B3O A;  1VSK A;  1F21 A;  4AHR A;  4JS4 A;  1JKH A;  2YV0 X;  1Q9Y A;  4EP4 A;  1C1A A;  1BGX T;  1YT3 A;  2RPI A;  3JSM A;  4HUE A;  1RTD A;  2G8W A;  4B9N A;  4F2R A;  3HJF A;  4CK1 A;  1Y97 A;  4DTS A;  1XWL A;  4FM2 A;  3AVK A;  4KTZ A;  1NK4 A;  1ASW A;  1UOC A;  3CM6 A;  1SUQ A;  3IS9 A;  3K2P A;  1VRU A;  3PUF A;  4Z4H A;  4E89 A;  3L2V A;  3LWM A;  3JYT A;  3PV8 A;  3TAF A;  3FFI A;  3HST B;  2PY5 A;  4RW8 A;  4CJS A;  4LSN A;  2YNH A;  4FJ9 A;  4RW6 A;  4B9M A;  2PZS A;  4Y1C A;  1RT7 A;  3AV9 A;  4CF9 A;  3LZI A;  1RBV A;  5KI6 A;  2YNI A;  1D8Y A;  3OYC A;  4AHV A;  1QSY A;  1RBT A;  2B5J A;  4M3W A;  1TL3 A;  3T19 A;  3EZ5 A;  4CER A;  3S9H A;  5J1E A;  4CFA A;  3RR7 A;  3SPY A;  1BI4 B;  3VQ9 A;  3QES A;  3MXI A;  2G8V A;  2ZD1 A;  2PYL A;  1DTQ A;  1LWF A;  3NGI A;  1XC9 A;  4JRQ A;  3SUO A;  1VSF A;  5HBM A;  3PO4 A;  2OZS A;  4F8R A;  1X9S A;  1DLO A;  4YFU A;  5K14 A;  3TAQ A;  4DQS A;  3O4N A;  4KRE A;  1WSG A;  2E6L A;  4K8Z A;  1RCH A;  2KQ2 A;  2XY5 A;  3G10 A;  4N56 A;  4AH9 A;  3PX0 A;  3AO1 A;  2G8F A;  1KLM A;  4MFB A;  4OKK A;  4CJW A;  3IG1 A;  3KD5 E;  3AVF A;  5FRM A;  4W5T A;  4OPK A;  1S6P A;  4GVM A;  3P83 D;  4HUF A;  1XHZ A;  3PY8 A;  4CJ3 A;  3OYK A;  5CYQ A;  2HHW A;  4W5Q A;  1IG9 A;  2HMI A;  1LWC A;  1WAJ A;  3KD1 E;  5FDL A;  4HVJ A;  1QHT A;  4NYF A;  5CZ2 A;  1S1X A;  3NF8 A;  5E41 A;  4DTP A;  4CHY A;  1RT3 A;  5SWM A;  2GV9 A;  2XO7 A;  4FW2 A;  3V6D A;  4B9T A;  4Z4I A;  3V1R A;  1N5Y A;  1C0M A;  1RTH A;  3AA2 A;  4KHU A;  1JL1 A;  4RW7 A;  4BE1 A;  3SI6 A;  1LV5 A;  4CJU A;  3NH2 A;  3D0P A;  4EZ6 A;  1SKW A;  3OJS A;  4ELT A;  2X78 A;  3AVM A;  3U3G A;  2FBV A;  4DQP A;  1W0H A;  1HPZ A;  1BI4 A;  3CQ8 A;  4DFP A;  1SKR A;  3K5L A;  1X9M A;  2HHV A;  3NFA A;  1JLA A;  3U3Y A;  3OYE A;  2AJQ A;  3L2Q A;  3VQA A;  3OYD A;  4DU3 A;  1NJX A;  2ATQ A;  1HRH A;  1ZBF A;  4DTN A;  3ALY A;  3AVI A;  4OGE A;  4CF1 A;  1TKD A;  1TGO A;  3ZT2 A;  3OYL A;  1U47 A;  4OLA A;  3MXJ A;  2VWJ A;  1KVB A;  3OS2 A;  3PX4 A;  3SQ4 A;  4KHN A;  2EHG A;  3VQ4 A;  1L3T A;  4O5B A;  3OVN A;  4Z0U A;  3OYJ A;  4HUG A;  3VN5 A;  1HNI A;  3WNE A;  2QK9 A;  1IH7 A;  3DI6 A;  4E7I A;  1I39 A;  1QS4 A;  3AVB A;  3QIP A;  3DLH A;  2FBY A;  2Z1J A;  1KVC A;  4W5N A;  1IO2 A;  1O1W A;  1JLQ A;  3OJU A;  3NH0 A;  3DLB A;  1S9G A;  1C6V A;  3RRH A;  1NJY A;  4KB0 A;  3QER A;  3M8P A;  2KFN A;  3KIO A;  1KRP A;  1NK0 A;  3OYM A;  1L5U A;  1NK8 A;  3NH1 A;  2ITG A;  3LP2 A;  4AHS A;  4ID1 A;  4J2B A;  4M3Z A;  3BGR A;  4FCY A;  1ASU A;  4DTO A;  1VSE A;  1EX4 A;  3NF6 A;  4FLY A;  3DLE A;  3RMC A;  1X9W A;  2P5O A;  1UA0 A;  5HRP A;  1RT6 A;  3NHG A;  4GMJ B;  3VQ8 A;  4B9L A;  1NKC A;  4CJF A;  4KTQ A;  4QOZ B;  3NF9 A;  5EU7 A;  2F8T A;  3ZSO A;  1EKE A;  1J54 A;  3KK1 A;  1VSM A;  1ASV A;  4LY7 A;  1WSJ A;  4OKJ A;  1XHX A;  2OYQ A;  3NDK A;  3LP3 A;  3AVN A;  4FLX A;  4F3T A;  4DTR A;  1RDC A;  4Q0B A;  1VK0 A;  1GOC A;  5J2M A;  1SKS A;  3HXM A;  3LZJ A;  4W5O A;  4FM1 A;  4FLT A;  4I9L A;  3TAR A;  2YKN A;  3L3V A;  3S3N A;  3IAY A;  3EYZ A;  1J5O A;  1Q8I A;  4CJQ A;  3OYA A;  3B6O A;  3OS0 A;  3TAP A;  4CK2 A;  2KW4 A;  3LAL A;  1VSD A;  4DFM A;  4CEO A;  3C95 A;  1FKO A;  3NCI A;  1Z26 A;  3HL8 A;  2D0A A;  3QEP A;  1KFS A;  1MU2 A;  4YNQ A;  3HT3 A;  1BCO A;  1S1V A;  2W42 A;  3SQ1 A;  3ZT3 A;  2NUB A;  1ZBI A;  3OYN A;  4CEZ A;  3MEE A;  4PQU A;  1S6Q A;  3BDP A;  1U49 A;  2Z1G A;  4M45 A;  4BDP A;  2ETJ A;  3AA4 A;  4DMN A;  3OYG A;  3A2F A;  1T05 A;  4BE2 A;  4FJX A;  4FZZ A;  1A5X A;  3MED A;  4NCG A;  3TWH A;  4KKO A;  2YKM A;  3AO2 A;  1U4B A;  3C94 A;  1UWB A;  4KFB A;  3DM2 A;  4PA1 A;  3VQC A;  4CEA A;  3QEW A;  3TAN A;  2X6N A;  4FJH A;  4FVM A;  4WE1 A;  5C24 A;  4CEB A;  1BIS A;  3PO5 A;  4CFB A;  4FK4 A;  3SYZ A;  3C6U A;  3SV3 A;  1NOY A;  1BQN A;  2JGU A;  3TAG A;  4L8R B;  5J2P A;  4F2S A;  3DLG A;  2Q3S A;  5J2N A;  4DQI A;  3I0S A;  3NGZ A;  5HRO A;  1RT5 A;  2HHQ A;  3ZSZ A;  2HHS A;  3V81 A;  3L2R A;  1TK5 A;  1T7P A;  1I3A A;  1ZBH A;  4RG8 A;  5FRO A;  2FC0 A;  4B8A B;  1T8E A;  3VQD A;  1QE1 A;  1Q9X A;  3AA5 X;  5I42 A;  4ID5 A;  4DLE A;  2X74 A;  1TKZ A;  4FLV A;  3NGY A;  4CF0 A;  3ZSY A;  1KTQ A;  4QAG A;  5DMR A;  3K5N A;  3LAM A;  4IKF A;  3TAE A;  1SL1 A;  2XY6 A;  1UAX A;  1RDD A;  2P51 A;  3RWU A;  3DRP A;  2BDP A;  1VSH A;  4E1M A;  5KRS A;  2Y1I A;  4CJK A;  3SUP A;  5DK5 A;  3OYH A;  4O55 A;  4Z4C A;  1WSH A;  1HQE A;  2P5G A;  5KGX A;  4M42 A;  2ZE2 A;  2F8S A;  2HVH A;  1NK6 A;  1DTT A;  1TAQ A;  4FJ7 A;  3KKS A;  2VG7 A;  4LH4 A;  2IAJ A;  3KLH A;  5HLF A;  3DRS A;  1LWE A;  5C42 A;  5CZ1 A;  3PX6 A;  2LSN A;  3AVL A;  4I2Q A;  1L3U A;  1CZ9 A;  4E3S A;  1A5W A;  2Y1J A;  3ZSV A;  4CEC A;  3QET A;  4H4O A;  4FLU A;  3WNH A;  4QCL A;  1QQC A;  3RMD A;  3HPO A;  4DTX A;  4FJG A;  4LH5 A;  4BDY A;  4KO0 A;  1LW0 A;  4FW1 A;  1FXX A;  3L8B A;  4JS5 A;  4FJ5 A;  4PY5 A;  3SNN A;  3SV4 A;  4OVL A;  4NCA A;  1BL3 A;  1WNS A;  3V1O A;  5HP1 A;  3MXM A;  1ZYQ A;  3QEV A;  4OLB A;  2O4G A;  1KFD A;  3KTQ A;  4FXD A;  3MEC A;  1BHL A;  1J53 A;  4DWI A;  4M3X A;  4O0J A;  3L2U A;  3K58 A;  5J2Q A;  4ZTJ A;  1ZBL A;  3SJJ A;  3NAE A;  2HB5 A;  3VQE A;  3ITH A;  3WNF A;  3MEG A;  4H8K A;  4OPJ A;  4EP5 A;  4FM0 A;  2G8U A;  1JXB A;  1EP4 A;  1J9A A;  2IS3 A;  4DFJ A;  2WON A;  4FJK A;  3K57 A;  1TVR A;  1VSJ A;  1FKP A;  1WLJ A;  2G8I A;  3L3U A;  1A5V A;  2VG5 A;  3VQ6 A;  2OA8 A;  1WAF A;  1RT2 A;  2P1J A;  4E7L A;  4F4K A;  3QEX A;  3QNO A;  5C25 A;  1L3S A;  4N41 A;  4Q5V A;  1RDB A;  3KLF A;  4C8M A;  4BDZ A;  1NJW A;  3WNG A;  4RW9 A;  4AIL C;  4E7K A;  4DQQ A;  3M8Q A;  4FLW A;  4R5P A;  1Z25 A;  1X1P A;  2A1S A;  3NBP A;  3M8R A;  3V9S A;  4FK0 A;  1VSL A;  3L2W A;  4C8L A;  4BWJ A;  4FK2 A;  4CGH A;  4KHQ A;  4AHC A;  3RR8 A;  3LP1 A;  1LW2 A;  3HP9 A;  4B9U A;  1YTA A;  2BAN A;  4NYN A;  1NK5 A;  2RF2 A;  4N76 A;  1BCM A;  3I0R A;  1NK9 A;  3MAQ A;  3SQ0 A;  1IKY A;  2D0B A;  3V9W A;  3D45 A;  4JLH A;  4CJV A;  3HPH A;  4DS4 A;  3VQ7 A;  4CGJ A;  1NKE A;  2BGG A;  3ULD A;  4CIF A;  2G8K A;  2YNF A;  5I3U A;  2YHB A;  4CIG A;  3AO4 A;  1IKX A;  3QO9 A;  1HYS A;  3VQQ A;  4HTU A;  4F3O A;  2HNY A;  3AO5 A;  3HVT A;  4BAC A;  3SPZ A;  4I2P A;  2FBT A;  2HHX A;  1BIU A;  4XIU A;  4CF8 A;  3HPG A;  5SZT A;  4W5R A;  1HYZ A;  4CED A;  4KHY A;  1BQM A;  1RT1 A;  4AHT A;  4DU4 A;  3VQ5 A;  4FJJ A;  1RBU A;  3OYI A;  2OPQ A;  4CFC A;  3T1A A;  4DSI A;  1GOA A;  3NE6 A;  3B6P A;  3THV A;  4FJI A;  3F9K A;  4O44 A;  4HHT A;  4C8K A;  2IC3 A;  5T7B A;  5JS2 A;  1KSP A;  3LPT A;  4CHO A;  4CJE A;  1TK8 A;  2R7Y A;  1RIL A;  3KLI A;  4KRF A;  4CJ4 A;  2XY8 A;  3AVH A;  3OYB A;  2KZM A;  1S1W A;  3CFO A;  1CXU A;  1RTI A;  1D9F A;  3S3O A;  2PYJ A;  1YTU A;  5CYM A;  4OJR A;  3ZSR A;  4E19 A;  3AVJ A;  4H4M A;  4CJL A;  1C0T A;  3AVG A;  1TKX A;  3K5M A;  2E6M A;  3LP0 A;  4IBN A;  4M3U A;  3P1G A;  4B9V A;  2GUI A;  4M3Y A;  2BE2 A;  3ZT4 A;  4BWM A;  2KFZ A;  4Z4F A;  2OPP A;  5CY4 A;  4FJN A;  5HRR A;  1B9D A;  1XI1 A;  2G8H A;  3IRX A;  3LAK A;  4DSL A;  3KK3 A;  2O4I A;  4KB1 A;  2HND A;  4CFD A;  3KKR A;  1JL2 A;  1G15 A;  3KLG A;  4GW6 A;  5D3G A;  2OPS A;  4DFK A;  4B9S A;  4FJL A;  1UA1 A;  4CHN A;  2QXF A;  3QIN A;  1D9D A;  1HMV A;  2DFE A;  2FBX A;  2D0C A;  2I5J A;  1JLG A;  1VRT A;  4O0I A;  3O3G A;  2XY7 A;  1LAW A;  1S1U A;  3V4I A;  3SUQ A;  3SCX A;  1QSS A;  1W9H A;  3P5J A;  1TKT A;  2DFF A;  3I8D A;  4DTM A;  2WOM A;  3SUN A;  4DF4 A;  4RW4 A;  1KLN A;  1LAV A;  4DSK A;  3H08 A;  1NK7 A;  2HHT A;  4CF2 A;  4ZTF A;  1EET A;  4DSE A;  3AO3 A;  3SZ2 A;  4KI4 A;  2EX3 A;  3RRG A;  4IFV A;  3NF7 A;  4CJT A;  4N5S A;  4N47 A;  1IKW A;  2DFH A;  3O3F A;  1REV A;  1QSL A;  5JS1 A;  3ISN C;  4E1N A;  4CGD A;  1R0A A;  1U45 A;  1TV6 A;  1RBS A;  3AVA A;  4J2E A;  4E7H A;  3O4Q A;  4CK3 A;  3EY1 A;  3K59 A;  1K6Y A;  3ZT0 A;  1RBR A;  1HYV A;  5KGW A;  1HJR A;  4B08 A;  3ZSX A;  2IGI A;  4FJ8 A;  3HYF A;  4CCH A;  3HM9 A;  4KV8 A;  4IDK A;  3RMA A;  1B92 A;  1CXQ A;  2OPR A;  1FK9 A;  3G0Z A;  1SL2 A;  2KTQ A;  1JLE A;  5HRN A;  4DTJ A;  3SQ2 A;  1L3V A;  3LDS A;  3AVC A;  4CGG A;  2YNG A;  4KAZ A;  1U04 A;  5FRN A;  4FYD A;  5KTQ A;  3U6F A;  3K5O A;  1SV5 A;  3TAB A;  1CLQ A;  3KJV A;  4HCB A;  1CZB A;  3C6T A;  1TK0 A;  3VQP A;  4CHZ A;  3RTV A;  3F73 A;  3DYA A;  4Y1D A;  3HVR A;  4CGF A;  2QKK A;  1WSI A;  1QTM A;  3ZSQ A;  3DMJ A;  4DTU A;  2ZQB A;  4E0D A;  4KI6 A;  1RT4 A;  2HNZ A;  4OKE A;  4DSJ A;  2VWK A;  4KHS A;  5KRT A;  5HRS A;  3V1Q A;  1JLB A;  4G1Q A;  4CGI A;  4FZX C;  4M3R A;  1ITG A;  3AA3 A;  1RTJ A;  3KK2 A;  3UIQ A;  1BIZ A;  4J2D A;  3HO1 A;  3OS1 A;  4DQR A;  1KCF A;  4CEQ A;  2A1R A;  3DOL A;  4CJR A;  1RDA A;  1S9E A;  1N6Q A;  4DSF A;  3M8S A;  4K8X A;  4FJM A;  3LWL A;  4ELV A;  3O3H A;  4FZY A;  4ICL A;  1C1B A;  1U48 A;  4AHU A;  1EXQ A;  2HHU A;  2DTU A;  4I7F A;  2B4J A;  4DF8 A;  1NKB A;  2QKB A;  2D5R A;  3QEI A;  4MQ3 A;  2IOC A;  1SL0 A;  2X6S A;  4Z4G A;  3OY9 A;  3S3M A;  4Z4E A;  4CES A;  4PWD A;  4CE9 A;  3V9Z A;  2HW3 A;  1TAU A;  4DG1 A;  3DOK A;  1WSE A;  2E4L A;  4CHQ A;  2HVI A;  2B6A A;  2DY4 A;  3VQB A;  4HCC A;  2KZZ A;  2XHB A;  4EZ9 A;  4J2A A;  4IFY A;  3CG7 A;  3HP6 A;  3T3F A;  1B9F A;  1JLF A;  4B8C A;  1IKV A;  4CHP A;  4IG3 A;  4C8N A;  1S5J A;  2VG6 A;  3TI0 A;  4TSX A;  4DU1 A;  3TAM A;  1WN7 A;  4DLG A;  4LD0 A;  3ZCM A;  3V9X A;  2IDO A;  3CYM A;  2F96 A;  4OGC A;  4ELU A;  4IG0 A;  2Z1I A;  4PUO A;  4I9Q A;  3CM5 A;  3LPU A;  3ZSW A;  4UQG A;  4KTW A;  4O4G A;  4CJP A;  4CEE A;  3DLK A;  4DS5 A;  1YVU A;  4C8O A;  1HQU A;  2GBZ A;  1ZBU A;  4CIE A;  4NCB A;  4CJ5 A;  1D5A A;  1TL1 A;  2Z1H A;  4BE0 A;  3QIO A;  3KLE A;  1S1T A;  3HK2 A;  4LSL A;  1WSF A;  4KPY A;  3TR8 A;  4JRP A;  3VA0 A;  1C0U A;  1KVA A;  3OYF A;  1JLC A;  4M3T A;  2RKI A;  2RN2 A;  3CFR A;  4E7J A;  1RNH A;  4M41 A;  1GOB A;  1T03 A;  1VSI A;  3ASM A;  3QNN A;  1JXE A;  1NJZ A;  2OZM A;  3RMB A;  4KHW A;  3QLH A;  3V9U A;  3ZT1 A;  4ZHR A;  3DLR A;  4CEF A;  4FLZ A;  1C1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...