5C2DA

K428a mutant gp2c of large terminase subunit from bacteriophage sf6 with calcium
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
241
structure length
227
Chain Sequence
b'MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
total genus 84
structure length 227
sequence length 241
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c2dA00
3CPEA 5C2DA 5M1PA 5M1KA 3C6HA 4IEEA 4IFEA 5C2FA 3C6AA 5M1OA 5C12A 5C15A 4IDHA 5M1FA 5M1NA 5M1QA 4IEIA 5C10A
chains in the Genus database with same CATH superfamily
1B9FA 5KPRA 5FROA 4OPAA 4ZHRA 1LWCA 5KRTA 2ZF5O 4BDPA 1VQ4N 1A5XA 2E1ZA 4ELVA 4M3WA 4ELUA 2WFBA 3IFRA 1UA1A 1WSJA 3O5BA 1LAWA 1NK6A 3ASMA 4AM7A 4BGAA 3L6QA 1RFQA 2YNIA 3N4PA 1RCHA 3FFIA 5BR9A 1NMDA 4FLTA 1DGKN 4DFJA 1JCFA 5FRNA 1H1VA 4H0YB 5C2FA 4H0VB 4KTWA 3I55N 4NYNA 2OA8A 1ZBSA 3K57A 2E6LA 1NOYA 2NLXA 5I3UA 3OTOK 3QFPA 1B9DA 4CFDA 2YHAA 1NGIA 4EZ6A 3ID6A 5M1FA 4FJ5A 3M8SA 1TKTA 5HOOA 4JI1K 2Q31A 4HCCA 3JAMO 4GKJK 1C0UA 4HTUA 4M45A 3SBGA 3LPTA 1OKJA 2F9TA 2OPPA 3AO4A 3CM5A 4BRKA 1BWFO 4CEAA 1BI4B 4CVNE 1W7AA 3EZ5A 3J7AP 4FJGA 1ITGA 1HQUA 3AVMA 4CF1A 5AQNA 1UA0A 2GWJA 1CXUA 1D8YA 3N4QA 1YTUA 2QWPA 2V7ZA 1FKPA 4U7BA 3M5RA 2HHXA 3P83D 2I5JA 2JWKA 5GADP 3LP3A 4BWJA 2VGMA 3BP8A 4BRHA 3V4IA 1KAZA 4CHQA 1S9EA 3AAPA 4DTXA 3RMDA 2E2NA 2ITGA 4BRIA 4L8RB 3K58A 1XQSC 4PKHA 1U4BA 1ASUA 2UUCK 3VA0A 1W97L 2VCPA 1XWLA 3QETA 1RT7A 1ATNA 2IIRA 2QI2A 4AHVA 4YOTA 3T19A 3P38A 4JK9A 5JS2A 3HXMA 1HYSA 1NGJA 3LP1A 1WBBA 2XY7A 4KHUA 3ZSZA 2HVHA 3CJ9A 3KKRA 3L2QA 2ZJPL 4BR0A 1X9SA 1HYZA 4I7FA 4X65K 2P9PB 2V52B 4FPAA 1JCEA 4XH5A 3OYKA 3ID8A 4CW7B 1NK5A 4CZJA 2KZMA 3SAGA 3CJ1A 2HOEA 2VYPA 3O8MA 4FJKA 5GIPA 4CJ3A 2HHHK 4FJHA 3G4SN 2F9WA 3ULDA 4E1NA 4DU4A 3OHRA 5LL6Z 4B3SK 1KFDA 2NNWA 4A2AA 4FCYA 3CCQN 4JKEA 3WEEB 3HBTA 4Z4CA 1K73O 4AH9A 4PA1A 1IBKK 4CGIA 4O0IA 4BE1A 1HQEA 2HB5A 2VWKA 1CLQA 5JMVA 1GOBA 4IEIA 3QFUA 3S3OA 5AQTA 4DTJA 2F96A 4DSLA 3IKMA 3VQDA 2FBXA 1QSYA 4FWRA 3O4NA 4DTRA 1F21A 1P90A 2BH1A 3ZSWA 4BR7A 3KWIA 4ICLA 2NRVA 4DB3A 4BROA 3RMCA 4AQYK 3PLAA 4PWDA 4JK8A 3MX2A 3C6AA 3MXMA 3AVJA 1J5EK 1C1BA 4DV5K 3KLFA 2W41A 3CJ7A 5F0XA 3F9MA 4UQGA 2G8KA 3OYDA 3OVNA 4DR2K 3RMBA 3SPYA 4IDKA 2A5XA 1TL3A 4KHWA 1EWRA 3PIPL 1KD1O 4FK2A 4CIGA 1NGCA 1N6QA 1J53A 1LW2A 1EETA 3CCMN 4JV5K 3CFRA 2G8HA 4UY8O 3AGRA 4C8LA 3R3LA 1HNXK 3MECA 4DR6K 1U6ZA 1S6PA 3SZ2A 3GBTA 3U8XA 3JSMA 3MWPA 2FSNA 4F3OA 3FGUA 3DLBA 2VWBA 1K8AO 3M8RA 1JXBA 1I3AA 4XEIA 3CCSN 3RRHA 3PUFA 3DXKA 4M3UA 1GLEG 4M3ZA 4LFCK 2A41A 1K6YA 3CJAA 2YKNA 4FWSA 4E7JA 4JNEA 1NJIO 1RTHA 4JHDB 2UXCK 4R79A 1T44A 1DLOA 3EKSA 1LOTB 4FZXC 5CYMA 3BF1A 1HKBA 1Z25A 3KK3A 4CEQA 1NGBA 3DLKA 4Z4HA 4E89A 4MO5A 1IKXA 3TSPA 3HP9A 3DWLA 4FLYA 4CEOA 1XC9A 3D2EB 1BCMA 3HM8A 4JKBA 1EKEA 5AQGA 5JLFA 3VEWA 5AFUA 1WSIA 5BRFA 4K8XA 5C42A 2CGJA 3OA9A 3VA3A 3CCLN 1C1CA 3SAHA 3DM2A 4OO1J 2YV0X 4H5VA 4BQLA 4W5TA 4IG3A 1BO5O 3O9QA 1NJZA 4JN4A 2O4GA 5KGWA 3NCIA 1YJWN 1VSKA 3H08A 1YVNA 3KK1A 3D0PA 3QNOA 3KWGA 3CMEN 5LY3A 3VENA 2P9IB 2ETJA 1WBDA 3FZLA 1KLNA 3KD5E 4MDAA 4FM0A 3CC4N 4KHNA 4JYAK 1VQLN 3H6EA 5BREA 3OYEA 5AQVA 4FOEA 4LH5A 3HJFA 3ZYYX 4CZFA 2DFFA 1VQ5N 1GLJO 4B1UB 2GUPA 3QEWA 4Y1CA 3A5MC 4K8ZA 4CJ4A 3WXKA 5GINA 2HNDA 3AY9A 1KAXA 4DTNA 4DFKA 2NRHA 1BIZA 3ZETA 3PX4A 1QHAA 4CF0A 3O3HA 3SYZA 1VSLA 2KKZA 4F2RA 3AO3A 5KTQA 1VSHA 2FSKA 3M1FA 2R7YA 3KLHA 5CR4A 4O44A 1X3MA 3WXMB 4C23A 3AARA 3LP0A 3L2WA 4EHTA 1WSHA 5E41A 1XUPO 3AVFA 3K9KA 3KK7A 3MMVA 3HP6A 4H0XB 1RTDA 4CEDA 4A62A 1VQNN 3OJSA 4NLBA 4OPJA 1L3TA 4DSEA 3NH1A 3VN5A 3L2RA 4CD1A 5AQMA 2HVIA 3V9XA 3AVKA 1C0GA 2J4RA 4EFHA 4M63C 3VQ4A 5AZIA 3G6EN 1LAVA 1XHXA 3MXJA 5HRNA 2GBZA 4H03B 2ZGYA 3I56N 5I42A 2ZQBA 4BVOA 3AAQA 1NKCA 2P9LB 4JRPA 3V1QA 1ZYQA 4DWIA 4KHQA 1SZ2A 3DOLA 1LW0A 3R8EA 4DQRA 2XY5A 3PO5A 3CI5A 3M8PA 4B3MK 4CGGA 1N34K 1LWEA 2VQEK 4KH5A 1U48A 3VF2A 1NK0A 4FWKA 4B9TA 4IXCA 1DKGD 2IDOA 4EIAA 3I8DA 3I0RA 5AQKA 3J81O 4FLWA 2ZM6K 1D4XA 2ITMA 1MWMA 1TAUA 4CHOA 3VF6A 3E1YA 2DPNA 4YY3K 1C0FA 1LV5A 4PY5A 2Q0RA 5SWMA 4MO4A 1BDGA 3L8BA 4ILHA 3OYFA 5MLCQ 1HX1A 3RTVA 4CI6A 1FW6A 1TYQB 1ZBFA 4M42A 5LJVA 1BGXT 1MA9B 5TKYA 4V19S 4J2EA 3VOVA 3CXCM 4JI4K 1REVA 3VQ7A 3C6HA 4CGHA 1VSEA 3E01A 2IOCA 3TU5A 1S9GA 4KKOA 4DCHA 4BRQA 4CGJA 5SZTA 4I6MA 1X9JA 1T6DA 1ZBHA 4J2BA 2Z1JA 1B92A 4CIEA 3OW2M 3A8YA 3GL1A 3THYB 1IH7A 3HSCA 4C8KA 1IJJA 3ZT2A 2XO7A 1N36K 4NXMK 2E2PA 4BQZA 3HTVA 3BZCA 5DM6L 2BGGA 3AGKA 2V51B 4DV3K 4IO8A 3HI0A 3LANA 3C0BA 1TKDA 3T3FA 3O9UA 4FJ8A 1FK9A 3PO4A 5CZ2A 4W5OA 2G8IA 1NGDA 4MQ3A 3K2PA 1BA0A 2QWNA 4IDHA 4Y1DA 1Q7YO 2WC9A 3ENOA 4B8CA 3H45C 2EWSA 4FJIA 4JI7K 2O8BA 4HUEA 4XIUA 5M1PA 1GLAG 2A1RA 1MWKA 4R5PA 4BR2A 1NU0A 1RT3A 4JKCA 4NB4A 4OPKA 3GOIA 4EAHD 2OTLN 4LC9B 1DTQA 4CJQA 2FF3B 4DKWA 4QS7A 4J8FA 4FK4A 3KLGA 2X6NA 4J2DA 4LF4K 5C25A 4FJ9A 3VETA 2EX3A 1S1VA 4ELTA 3WQTA 1RDAA 1IBMK 1D5AA 2JLEA 4MLEA 4CJUA 4C8OA 4ISEA 3WNFA 1I94K 4J2AA 1HPMA 3SQ2A 1J9AA 4BRAA 3P39A 2HF4A 3IUCA 5FPDA 2YNGA 3ZT0A 3E9OA 2QWLA 3E9LA 3RMAA 3KZBA 3QERA 3VQ8A 5AQIA 2D0PA 2OTJN 3LAMA 1OH8A 3VPZA 3HK2A 1TGOA 1TUYA 1SL0A 4FM1A 1XI1A 4H4OA 3D2FB 3TAPA 1TK8A 2FBTA 4KREA 4DUZK 3O1WA 1BI4A 2E4LA 4BE0A 4CHPA 4A2BA 3R9PA 5LJWA 4YOYA 3B8AX 1ASWA 3NH2A 1RILA 2VG7A 4FWMA 1HJRA 3QEXA 3R1XA 3NF7A 3QESA 4IEEA 2DFEA 2UYTA 2F7TA 3MN9A 1V4SA 4JEPA 3LDLA 3WQUA 1NJYA 1V4TA 4W5NA 3VQBA 1Z26A 1S5JA 4CBUA 3EEQA 4FJ7A 4KBOA 3OYMA 4E7LA 3QEPA 4PHTX 1S22A 4Q0BA 3AO5A 5E26A 3TARA 4JRQA 3QNNA 3TR8A 4A61A 4YNQA 1SAZA 3U9ZA 4KTQA 1QSLA 3V9UA 5C24A 1VQ9N 1TL1A 1RGIA 2E6MA 4M7YA 3K5MA 3WT0A 4CEFA 4EZ9A 2DTUA 2A1SA 5GAGP 4E7KA 4HHTA 3K9JA 3O4QA 3BDPA 1L5UA 3L3UA 2EHGA 2VG6A 4FW1A 1KLMA 2V7YA 3CCVN 1KXPA 2D0CA 1XNRK 3TI0A 1GLFO 1TV6A 3SLCA 3CPWM 3LDPA 3OY9A 4FVMA 4BDYA 1BHLA 3EL2A 3EN9A 3LM2A 1C6VA 4AHCA 3O3FA 1Z6RA 1CZAN 3MCAB 2HBLA 4BRCA 1QHTA 3NE6A 4PKGA 3QIPA 2FF6A 4F2SA 3LDOA 3AVHA 3WEEA 2FBVA 5D3GA 3RWUA 5AQPA 4ID1A 2YHBA 2HHUA 3HRGA 5BPNA 4FLVA 1EXQA 2VGNA 4B1YB 2RHKA 4BDZA 1X9WA 3HOSA 1JLEA 1S1TA 2Z1GA 3BY5A 3MK6A 4L3QA 1J54A 3SQ4A 4FM2A 4EP4A 3O08A 5GAHP 1EO1A 1W2BM 1KQSM 1MDUB 2QXFA 3CYMA 4N47A 2D0BA 4CJWA 4JLHA 3D7EO 5BR8K 4Z4IA 2DFHA 3NF6A 2YHWA 2E88A 2A3ZA 4M3TA 1RDCA 5JICA 3S9HA 1YITN 1VRTA 4XH1A 4YOWA 3K0SA 4AHSA 2W6LA 1WSFA 4B08A 3SV3A 4H5RA 4B1WB 1ZXOA 1YUWA 4B9SA 3VEYA 4B9LA 4LF7K 4WF9L 3CQ8A 5HLFA 2W40A 4LY7A 5HRPA 4JK7A 2XHBA 5E84A 3EKUA 1BUPA 1C0TA 4CJPA 3VQAA 3V1OA 3AO1A 2WUSA 3PX6A 5AZJB 3AVIA 3LALA 4BRPA 4G1QA 5LMNK 3F73A 4CESA 3RSEB 3NGZA 3OYJA 3NVMA 3D6RA 3IG1A 3CCUN 4W5QA 3VESA 1VQ7N 4HCBA 3AA4A 1SL2A 1NGHA 4IFVA 2GUIA 5C0YA 1X9MA 4DTPA 1QQMA 4M41A 3K5LA 4AHTA 4FOIA 2O8EB 2LSNA 3CM6A 3RR7A 1YTAA 5CZ1A 1QQOA 3MEDA 4H0TB 3T7ZA 2P5OA 3QMLA 1QVGM 3ITHA 1HRHA 4JI0K 3J7ZO 4BG8A 3SK3A 5GIOA 1X3NA 3KIOA 4JHDA 5C2DA 4CIFA 4PUOA 4OVLA 5AQYA 4MFBA 3PV8A 4BE2A 3NGYA 4KO0A 3T1AA 1E3MA 2G8FA 4BVPA 3W3DA 3J8AA 4IWVA 1GLDG 3VEZA 1BG3A 3BUZB 3SUPA 3HPHA 1O1WA 4CEBA 3BF3A 4YORA 3U6FA 3VEVA 3D2EA 1DTTA 1BQMA 5CY4A 1NK7A 3CCRN 4GV6A 4W5RA 3HT3A 4BC2A 3CETA 2P9NB 4LH4A 1RTJA 4F9OA 2QA4N 2P9KA 2B4JA 1NMNA 1VSFA 3ISNC 4C1NK 3J80O 4ID5A 4FK0A 3QB0A 3OYGA 1T3VA 1NM1A 5HRRA 3ZSXA 2PY5A 3AVBA 4DR4K 4LSLA 4FZZA 4CFAA 2P9IA 2RF2A 1Q18A 3AVCA 4JI2K 3U4LA 4IJNA 3U3GA 2JGUA 3DXMB 2HMPA 4FSVA 1YAGA 2BANA 4E19A 1RBUA 2Q36A 4DR5K 1JLCA 3A5OC 2FXUA 5LMUK 1NGFA 2E8AA 3UKRB 2Q2RA 2B5JA 4M3RA 4DTMA 5CE3A 4QS8A 2UXDK 1C0MA 2OPSA 4FLUA 3SPZA 5FPEA 4CEZA 4IZ9A 3MWTA 1Q82O 2KHOA 5AQFA 2IGIA 2QWOA 4E3SA 4U67L 2YCHA 3IMXA 5F2RA 5C10A 3M6GA 4CF2A 5GAEP 3IRXA 3NF8A 3QINA 2ZWHA 4DMNA 4DQPA 4CZMA 1EWQA 2NRRA 2XRIA 4DR1K 4DSFA 3TSUA 4DSJA 2HBMA 1GOCA 5TKWA 3DLLL 1JL1A 4E0DA 1VK0A 3LDSA 5J1EA 5J2MA 2F8SA 1IKWA 3I8BA 3GG4A 4OX9K 2ZE2A 2HSTA 1NK4A 4LFAK 5C15A 3KLIA 4BWMA 2HMIA 4Z94A 1JXEA 5AQJA 3BEXA 1E4FT 3NBPA 4RW7A 2VWJA 2HHSA 3OJUA 2E2OA 1GLLO 3RRGA 4O8UA 2WOMA 1L3VA 4CJVA 3DXKB 2P9LA 4E7IA 1VQPN 4M7XA 4RW8A 2ZD1A 1IG9A 4PL7A 4X66K 3CC7N 1OVYA 1HUXA 1GLCG 2KW4A 1S3XA 3DLRA 3C7NB 1FJGK 5HROA 1XMQK 5IWAK 3QO9A 4CBWA 3TAMA 5AQXA 3NHGA 3P4IA 4DQIA 1SS6A 1Q8IA 3VQ9A 1FKOA 3UE5A 2X78A 2GWKA 3FLCO 3SV4A 4B9UA 3TSQA 5BRDA 4JS4A 5ADXH 3SMSA 4OKEA 1JCGA 4FLZA 2RN2A 3F9KA 4C1NI 3SUQA 2ASOA 3HYFA 5FPMA 4NCBA 1KVCA 4KRFA 3A5LC 3PSFA 3SNNA 3TAQA 4BR5A 3QBWA 3DLEA 4WQ4C 1TYQA 2QM1A 2WBNA 3WXJA 3WNEA 1CZ9A 2Y1IA 1HJOA 1Q9XA 4JD2B 3TAEA 3ZX0A 1QE1A 3K59A 4JI3K 4KHSA 3OS2A 2PFUA 4QAGA 3ULEB 2BTFA 3DRSA 4PKIA 3VQCA 5C12A 1XHZA 2A40A 4DTSA 4BRDA 4DV2K 3IS9A 4OKKA 1WNSA 5BRHA 3OYAA 3MDQA 2D1KA 3THYA 3CHWA 1T8EA 3CPEA 3O9RA 4KB0A 2CH6A 2G8WA 2O8FB 1YF5L 1P8ZA 2IC3A 5H1SQ 2YHYA 4KFBA 4PQUA 1NJWA 1M1KO 2IVPA 4CJ5A 3H1VX 3M8QA 2UU9K 2AP1A 3WXLA 1NGEA 3QDKA 4YOVA 3VTHA 1KFSA 2KFZA 3THXA 3AVNA 4CJKA 2P9SA 5HP1A 4ILJA 5CHIA 4GKKK 4KH6A 4OGCA 4Z0UA 1KC8O 1L3SA 1T05A 4WFNL 2O8CA 4CHNA 3UKUB 3KK2A 1OH7A 2O4IA 4I2QA 3BGRA 2E1YA 3A5NC 2D0OA 1YVUA 3DAWA 4CF8A 4ISGA 3LDNA 4DTOA 3KD1E 3C94A 2X74A 2BE2A 1E4GT 3KVGA 3LPUA 3HPOA 3VQEA 1U49A 1Y97A 3OBYA 3HVRA 3OBWA 3ZEUB 5FLXO 3IDHA 3P1GA 5BN8A 3FFKB 3L2VA 1K8KA 1QTMA 3AA5X 3MN6A 3D45A 2P1JA 5FPNA 3Q7BA 2D4WA 3L4QA 5AJ3K 1RT2A 2E2QA 3O1BA 2UUBK 4WQ4A 3E66A 4FWOA 4CK1A 4NCGA 4WCEL 4X64K 3U9DA 3V9WA 4CGFA 4RG8A 1IKYA 3S3NA 3SQ1A 4B9QA 1RDUA 2FLOA 3OS1A 3K5NA 2UUAK 3HO1A 2D5RA 2AA4A 1Y64A 1VRUA 5AQOA 3THWB 4FVUA 3QEVA 1NOZA 1RT4A 2KLAA 3VEXA 1RDBA 2JWLA 4A57A 4E1JA 3RVCA 3L4IA 1OVQA 2HBKA 3NH0A 4KPYA 3HZ6A 3A2FA 4N5SA 1U04A 3LL3A 1VQ6N 3DMJA 1KVBA 3T1HK 4GV9A 1NGAA 2G8VA 4A5AA 1JLQA 2RKIA 2W6KA 3VGMA 1NK9A 3FZHA 1KCFA 4KI4A 2PBDA 4GVMA 3L0QA 1ATRA 1QQCA 4GW6A 2Z1HA 3S3MA 1VAZA 1RBRA 1N5YA 2HHVA 4I6MB 2CH5A 4Z4FA 3HPGA 4DTUA 3SAFA 1R59O 2QWRA 2WONA 4BC4A 3F2KA 4IO9L 3LDQA 1U45A 3LZJA 3ZSQA 3OYBA 2IVOA 3G0ZA 3KLEA 4DU3A 5M1KA 4FJXA 3F5TA 1RBTA 4HWIA 2QW9A 3EE8A 4CZLA 3CQYA 4XH4A 5AQRA 3SJJA 1W9HA 3NAEA 2OYQA 1HKGA 2YX6A 3HVTA 4LF8K 1HMVA 1HLUA 5DMRA 1RT6A 4JKGB 4CFCA 5BPLA 1IBLK 3PSIA 4EP5A 2HHWA 3C95A 4KV8A 3ZT4A 2FSJA 3FZMA 1S1UA 2NRZA 4CK2A 3CJCA 2XY8A 1BQNA 3MAQA 3AV9A 4DFPA 3CD6N 4JI5K 3O6WA 5AQHA 3AO2A 1M90O 4BREA 2HF3A 2O8DB 4DV6K 5K14A 4BRLA 4CGDA 1CZBA 1RT1A 4RCHA 5KPTA 3J7YP 3P5JA 4IG0A 4CERA 1W0HA 4FWLA 1WLJA 4AM6A 4GY2B 5EY4A 1JLAA 2P9UB 3WUHA 4CECA 3L2UA 2AJQA 2QTDA 1TKXA 2P9PA 2BUPA 4CJFA 4Q5VA 1NK8A 1WOQA 1D9FA 4RTFD 2Q3SA 1A5VA 2A6AA 4K43A 1U2VB 2ZJQL 3DI6A 5J2PA 4LF6K 2FBYA 1HNZK 1VQMN 1HR0K 4K0KK 3V9SA 1HPZA 4H5WA 1YT3A 2OZSA 3DLGA 4GV3A 4IOAL 4DQ8A 5EXWA 3B6PA 4NLCA 5AZJA 2GX9A 1K9MO 2QKKA 2OPRA 1OH5A 2D0AA 3LM9A 4YDUA 4E1MA 5J2NA 4OLAA 3RSEA 1R0AA 3DRRA 1G99A 3TAGA 4AHUA 3WXIA 3GE1A 1LCUA 4WFBL 3VGKA 4DQSA 1BA1A 1DEJA 4IFEA 5I9EB 1JJ2M 3CC2N 3MX5A 4FO0A 1ZBIA 2FC0A 3ENBA 3LP2A 4O5BA 3AVGA 4BACA 4I9QA 3WNGA 3O4WA 1YXQA 3TABA 5HRSA 4OLBA 1SKRA 5KQDA 2O8EA 4KB1A 2KTQA 5EX5A 4WYBA 1WN7A 1NGGA 2QK9A 2I7NA 3LWMA 3CF5L 3TAFA 1S72N 4F4KA 5CYQA 1L3UA 3L3VA 4DU1A 1N33K 2QKBA 4DUYK 2HNYA 5EU7A 4QCLA 2QXLA 5ADXA 1GOAA 1NKBA 3JXUA 4DLGA 3ZSRA 1BL3A 2PYLA 2QWMA 4GVEA 5HBMA 4DG1A 3ALYA 2YJEA 1RT5A 2DY4A 4KH4A 1NBWA 3A0IX 1WSEA 3O9TA 4NCAA 2HHQA 1UAXA 2P9NA 3OYIA 4DS5A 4CJSA 3G71N 4CJTA 2YNHA 3UB5A 1JL2A 2ZGZA 1VHXA 3SUOA 4N76A 2P5GA 5BN9A 4EHUA 4ISFA 5J2QA 3ZT3A 1YJ9N 2YJFA 3R6MA 4YFUA 3DXMA 3K5OA 1NG9A 1VSIA 2F4VK 4FJMA 3CCEN 2G8UA 5HL7L 1NKEA 1T03A 1X1PA 5FRMA 1ESVA 1ATSA 5KI6A 3CG7A 2OZMA 2GEMA 3UKRA 4A59A 1C1AA 2F8TA 1Q9YA 1BIUA 4N56A 2BDPA 4DV0K 4WQ5C 1NLVA 4PL8A 5ELZA 1ZC6A 3VF4A 1XC3A 3ATUA 4AHRA 2HNZA 4MLHA 1IO2A 3T69A 1QS4A 4BRGA 1FXXA 2PAVA 4DF4A 4BR9A 5M1NA 3NDKA 1Q81O 2GTDA 4BR4A 5JVHL 4CZEA 3JYTA 3DLHA 4B9MA 1WUAA 3P31A 5BPMA 2Z1IA 1DT9A 2NRTA 4LFBK 3THVA 4O4GA 1D9DA 2KFNA 3OYHA 2CGLA 5A2QO 4H0PA 3MN5A 4GMJB 2ZJRL 4CJLA 1RNHA 1TKZA 4CK3A 1J5OA 4KI6A 4RW6A 4CFBA 1JLFA 1TUUA 2YKMA 4CJ7A 4Z4GA 4ILGB 1NNEA 1BOTO 4YOUA 4CF9A 3ENHA 4CZKA 4K25A 1YJNN 3IAYA 4DHYA 3VMFB 1YIJN 1JLBA 5B8HA 4HUFA 2I7PA 4DV4K 4YHHK 1KAYA 4FJJA 1BCOA 1NJXA 4BRMA 1BISA 4M3XA 5AQLA 4B8AB 3W0LA 3ZCMA 1TAQA 4H8KA 5AQSA 3TTCA 1XNQK 4KHPK 3C6TA 4O0JA 3C7NA 5EVZA 4JS5A 1WSGA 2WTUA 3FR0A 4JI8K 4FJLA 4H5TA 1YHQN 1TVRA 2NRWA 3H1QA 4DSKA 3SBTA 4NYFA 3AA3A 4JKDA 2PYJA 3CIPA 4IOXA 3EO3A 1TK5A 3HSTB 4LSNA 1RTIA 2GELA 4MDBA 1SUQA 4I9LA 4CHZA 5FDLA 4DV7K 1UWBA 3KHYA 2P9KB 3LWLA 3VQPA 2A42A 3GDQA 4DFMA 1VQ8N 4CZIA 4JKAA 4QS9A 1VQON 4F3TA 1I39A 4WQ5A 4K41A 3HM9A 4B3OA 4TSXA 3WNHA 3ZX3A 3H3NO 1UOCA 1ZBUA 2H3GX 4JD2A 4RWTA 4DV1K 1VQKN 2ASPA 4BG9A 2P51A 4CZGA 4Z4EA 1IV0A 3ULEA 3C6UA 1SKWA 3NFAA 3VGLA 2Q97A 4IBNA 2OPQA 3CFPA 3C65A 3ZLJA 2NRXA 3AA2A 4BC3A 5KRSA 2O8FA 4FLXA 3O80A 4DQQA 1J6ZA 3I33A 4GNIA 3SI6A 4KTZA 4C8NA 1KTQA 3MXIA 2IAJA 5KGXA 3OS0A 1N8RO 1EP4A 3VEOA 1ZBLA 3QLHA 3FE1A 4BRFA 4FL9A 1ASVA 4CZHA 3QICA 1OH6A 5DK5A 3ATVA 3EY1A 3NF9A 2Q0UA 5KPZA 3CQXA 4BGBA 1HKCA 4OGEA 2OCEA 4YOXA 4FZYA 5F1XA 5JS1A 1EX4A 3QBXA 3VTIA 3H46O 1IKVA 3SJHA 3RR8A 3B6OA 3UKUA 1XMOK 3G25A 3MEGA 1WAJA 4F8RA 3S41A 1N32K 2HBJA 4FWPA 4CD3A 4OJRA 4B3TK 1U47A 5AR0A 2VQFK 4WE1A 3EYZA 5EOYA 4DF8A 3PX0A 5AQQA 1G15A 1SKSA 4FW2A 3FZFA 1SL1A 1WB9A 3V81A 3TPQA 4LD0A 3ZEUA 4HUGA 3I0SA 2NUBA 4JKFA 4B9VA 3MCPA 2E5LK 4CCHA 2UXBK 2YI1A 3V6DA 3NGIA 1CXQA 1A5WA 1Z05A 3UIQA 1MU2A 3ZT1A 2B6AA 2VG5A 3FZKA 5AQWA 3CFOA 3LZIA 1T6CA 3VQ6A 2HHTA 3DYAA 2KZZA 3CJBA 4G9ZA 3PY8A 4RW9A 3ZETB 4IOCL 2Y1JA 3DRPA 1O13A 4RW4A 1VSDA 1T7PA 4Y0WA 4IJAA 3QEIA 2CGKA 2ATQA 2XY6A 1EQYA 4ZTJA 2GV9A 3TTDA 2IS3A 5JLHA 1VSJA 1LWFA 4B1XB 4CEEA 4FYDA 4H5NA 1S1XA 3SCXA 3THWA 2Q1NA 4IKFA 4FWQA 3ZSYA 1RBVA 1HYVA 1WAFA 4DS4A 4OKJA 1SQKA 3U3YA 4FWNA 4A5BA 4K42A 4X62K 4KHYA 1VSMA 3ZX2A 5AZIB 5JVGL 4CJEA 3EE9A 4ZTFA 4E7HA 2W42A 3CERA 4O8KA 3O3GA 2YNFA 3NMUA 2ASMA 3DJCA 4B1VA 3TANA 2QWQA 4OPHA 4BY9C 3SQ0A 3Q7CA 5M1OA 2QEXN 4O55A 3OYNA 4B3RK 3H3OB 3HOTA 4LF9K 4KAZA 3QIOA 4CJRA 3BZKA 3CMAN 5IT9O 3SUNA 1S1WA 3TWHA 4DR7K 3VERA 2YHXA 1KVAA 4FPBA 2E20A 3D2FA 4AILC 1HNVA 4BC5A 3JS6A 3VQQA 4IFYA 1HNWK 4I2PA 3HL8A 4B9NA 4CHYA 3T1YK 3THXB 4FJNA 2P9SB 3KJVA 2RPIA 4CE9A 4WFAL 1ILYA 3V9ZA 2O8CB 5AFUH 1S6QA 1RDWX 3V1RA 4HTLA 3DOKA 5AQUA 3AVAA 4JKGA 1HNIA 2IVNA 2HW3A 1QQNA 2X6SA 1IG8A 5AQZA 1TK0A 3PIOL 3E9PA 4DR3K 3NVKA 3VQ5A 1QSSA 3MN7A 5M1QA 1Q86O 4H0OA 2NZTA 3EZWA 4C8MA 1QZ5A 4HVJA 1RBSA 2PZSA 1QZ6A 4NXNK 3TTFA 1KSPA 4JAXA 2O8DA 4B1ZA 3AVLA 1BU6O 1K8KB 4JI6K 3ZSOA 5KQ8A 4YDUC 5DM7L 4DLEA 1YI2N 4LF5K 4JKHA 3M3ZA 2KQ2A 4N41A 3MEEA 1JLGA 5T7BA 2P9UA 3KTQA 3ZSVA 4CBXA 1RDDA 2OANA 1JKHA 3LAKA 4O5FA 4BRNA 1SV5A 3CCJN 4QOZB 4DSIA 1NWKA 3KKSA 3SMPA 4FXDA 3G10A 1U2VA 4AF1A 4M3YA 3OYLA 3OYCA 1QVFM 2O8BB 2RE2A 3O9SA 1GLBG 4NO7A 1KRPA 4H4MA
chains in the Genus database with same CATH topology
3M6GA 2QWMA 5GAEP 4GVEA 5KPRA 4MO4A 1BDGA 2ZWHA 4OPAA 4ILHA 2ZF5O 1HX1A 4CZMA 5MLCQ 2NRRA 4CI6A 2YJEA 3TSUA 1VQ4N 4KH4A 2HBMA 1NBWA 3A0IX 2E1ZA 1TYQB 3O9TA 2P9NA 2WFBA 3IFRA 5TKWA 3DLLL 3O5BA 3G71N 5LJVA 1MA9B 5TKYA 3UB5A 2ZGZA 4AM7A 3L6QA 4BGAA 3VOVA 3I8BA 3CXCM 1RFQA 3GG4A 3N4PA 2HSTA 5BR9A 1NMDA 1DGKN 3C6HA 1JCFA 5BN9A 4EHUA 5C15A 1H1VA 4H0YB 4ISFA 3TU5A 4Z94A 4DCHA 5C2FA 4H0VB 3I55N 1YJ9N 2YJFA 5AQJA 3R6MA 4I6MA 3BEXA 4BRQA 1E4FT 1X9JA 1T6DA 2E2OA 3DXMA 3OW2M 1ZBSA 3A8YA 3GL1A 1GLLO 3HSCA 4O8UA 3CCEN 2NLXA 3DXKB 5HL7L 1IJJA 3QFPA 2P9LA 1VQPN 4M7XA 1NGIA 1ESVA 2E2PA 4BQZA 4PL7A 3HTVA 1ATSA 3ID6A 5M1FA 3CC7N 1OVYA 5HOOA 1HUXA 2GEMA 3UKRA 5DM6L 2Q31A 3AGKA 4A59A 2V51B 1GLCG 1S3XA 3C7NB 4IO8A 3HI0A 3C0BA 3O9UA 3SBGA 4CBWA 5AQXA 3P4IA 1SS6A 4WQ5C 1OKJA 2F9TA 1NLVA 4PL8A 4BRKA 1BWFO 5ELZA 1ZC6A 3UE5A 1NGDA 3VF4A 2GWKA 1XC3A 3ATUA 1BA0A 2QWNA 3FLCO 4IDHA 4MLHA 1Q7YO 3T69A 4BRGA 2WC9A 3ENOA 3TSQA 5AQNA 5BRDA 3H45C 5ADXH 2EWSA 2GWJA 3SMSA 2PAVA 4BR9A 5M1NA 1JCGA 1Q81O 2GTDA 4BR4A 5JVHL 5M1PA 4CZEA 4C1NI 2ASOA 3N4QA 1GLAG 1MWKA 1WUAA 3P31A 5FPMA 4NB4A 4BR2A 1DT9A 2NRTA 4JKCA 2QWPA 5BPMA 2V7ZA 3GOIA 4EAHD 3A5LC 4LC9B 2OTLN 4U7BA 3M5RA 4BR5A 3QBWA 4WQ4C 2CGLA 2FF3B 4H0PA 2JWKA 4QS7A 4J8FA 1TYQA 4DKWA 3MN5A 5GADP 2QM1A 2WBNA 3WXJA 2ZJRL 4BRHA 2VGMA 3BP8A 1KAZA 3VETA 1HJOA 3AAPA 4JD2B 2E2NA 3WQTA 3ZX0A 1TUUA 4CJ7A 4BRIA 2PFUA 4ILGB 1BOTO 1XQSC 4MLEA 3ENHA 4PKHA 2BTFA 4PKIA 4YOUA 3ULEB 4ISEA 4CZKA 5C12A 1W97L 4K25A 1YJNN 2VCPA 2A40A 1HPMA 4BRAA 4DHYA 1ATNA 2QI2A 2IIRA 3VMFB 4BRDA 3P39A 4YOTA 1YIJN 3P38A 4JK9A 5B8HA 2I7PA 2HF4A 3IUCA 1NGJA 5BRHA 5FPDA 1KAYA 3MDQA 2D1KA 3CHWA 4BRMA 3CJ9A 3CPEA 3E9OA 2QWLA 3E9LA 3O9RA 4BR0A 2ZJPL 2CH6A 5AQLA 3KZBA 1YF5L 3W0LA 1P8ZA 5AQSA 5H1SQ 5AQIA 2D0PA 2OTJN 3TTCA 2YHYA 2P9PB 2V52B 4FPAA 3VPZA 1JCEA 1TUYA 4XH5A 3ID8A 3C7NA 5EVZA 3D2FB 1M1KO 3FR0A 2IVPA 4H5TA 3H1VX 1YHQN 2AP1A 3WXLA 4CZJA 3SAGA 3CJ1A 1NGEA 2HOEA 2NRWA 2VYPA 3O8MA 3H1QA 3QDKA 4YOVA 3VTHA 3SBTA 5GIPA 3O1WA 4JKDA 3G4SN 2F9WA 4A2BA 2P9SA 3CIPA 3R9PA 4ILJA 4IOXA 5LJWA 3B8AX 5CHIA 4YOYA 4KH6A 3EO3A 1KC8O 3OHRA 4FWMA 4WFNL 2NNWA 2GELA 3UKUB 3R1XA 4MDBA 4IEEA 4A2AA 3CCQN 2UYTA 2F7TA 3MN9A 1V4SA 3KHYA 2P9KB 4JKEA 3WEEB 2E1YA 4JEPA 3LDLA 3WQUA 3A5NC 2D0OA 3HBTA 1V4TA 2A42A 3GDQA 1K73O 3DAWA 1VQ8N 4CZIA 4JKAA 4QS9A 1VQON 4ISGA 3LDNA 4WQ5A 4CBUA 4K41A 4KBOA 5JMVA 4PHTX 1S22A 4IEIA 1E4GT 3KVGA 3QFUA 5AQTA 3OBYA 3ZX3A 3H3NO 3IKMA 3OBWA 2H3GX 4JD2A 5E26A 3ZEUB 4RWTA 1VQNN 1VQKN 3IDHA 5BN8A 2ASPA 3FFKB 4BG9A 4A61A 4FWRA 1P90A 1SAZA 4CZGA 3U9ZA 3ULEA 2BH1A 1K8KA 3MN6A 1VQ9N 4BR7A 3KWIA 5FPNA 1RGIA 2NRVA 3Q7BA 4DB3A 3VGLA 2D4WA 3L4QA 4BROA 2Q97A 4M7YA 2E2QA 3C65A 3O1BA 4WQ4A 3WT0A 3E66A 4FWOA 2NRXA 5GAGP 4BC3A 3K9JA 3PLAA 3O80A 4JK8A 3MX2A 3C6AA 4WCEL 1J6ZA 3I33A 4GNIA 3U9DA 3CCVN 2V7YA 1KXPA 2W41A 1N8RO 4B9QA 1RDUA 2FLOA 3CJ7A 3VEOA 4BRFA 3F9MA 1GLFO 3FE1A 4FL9A 3SLCA 5F0XA 3CPWM 2AA4A 4CZHA 1Y64A 3LDPA 3QICA 5AQOA 4FVUA 3ATVA 5KPZA 2KLAA 2A5XA 2Q0UA 3CQXA 3VEXA 4BGBA 2JWLA 4A57A 4E1JA 1HKCA 3RVCA 3L4IA 3EL2A 3EN9A 3LM2A 4YOXA 3PIPL 5F1XA 1KD1O 1Z6RA 2HBKA 3QBXA 1CZAN 3MCAB 2HBLA 3H46O 3VTIA 3HZ6A 1NGCA 3SJHA 4BRCA 3UKUA 3G25A 3LL3A 1VQ6N 4PKGA 3CCMN 4GV9A 4UY8O 2FF6A 3AGRA 1NGAA 3LDOA 3R3LA 3WEEA 4A5AA 3VGMA 3S41A 5AQPA 2HBJA 4FWPA 4CD3A 3FZHA 2PBDA 3L0QA 1ATRA 3HRGA 5BPNA 1U6ZA 2VGNA 5AR0A 2RHKA 4B1YB 1VAZA 3GBTA 3U8XA 3HOSA 5EOYA 4L3QA 3MK6A 3MWPA 2FSNA 5AQQA 3FGUA 3O08A 2VWBA 5GAHP 1EO1A 3FZFA 1K8AO 4I6MB 4XEIA 3TPQA 3ZEUA 1MDUB 2CH5A 1W2BM 1KQSM 3CCSN 4JKFA 3DXKA 3MCPA 1GLEG 3SAFA 1R59O 2YI1A 2A41A 3CJAA 3D7EO 2QWRA 1Z05A 2YHWA 4BC4A 2E88A 4FWSA 2A3ZA 4JNEA 1NJIO 4JHDB 5JICA 3F2KA 1YITN 4IO9L 3FZKA 5AQWA 1T6CA 4R79A 3LDQA 1T44A 4XH1A 4YOWA 3EKSA 1LOTB 4H5RA 3CJBA 4G9ZA 4B1WB 3BF1A 1ZXOA 1YUWA 3ZETB 3VEYA 4IOCL 1HKBA 2IVOA 5M1KA 1O13A 1NGBA 3F5TA 4WF9L 4HWIA 4Y0WA 2W40A 4IJAA 2QW9A 2CGKA 4JK7A 4MO5A 3EE8A 3TSPA 4CZLA 1EQYA 3CQYA 4XH4A 3DWLA 5E84A 3EKUA 1BUPA 5AQRA 3TTDA 3D2EB 3HM8A 1HKGA 2YX6A 4JKBA 5JLHA 4B1XB 2WUSA 1HLUA 5AQGA 4H5NA 3VEWA 5JLFA 5AFUA 5BRFA 5AZJB 2CGJA 4JKGB 3OA9A 5BPLA 2Q1NA 3CCLN 3SAHA 4FWQA 4OO1J 4H5VA 4BQLA 4BRPA 1BO5O 1SQKA 2FSJA 3O9QA 4FWNA 3RSEB 4JN4A 3FZMA 4K42A 4A5BA 1YJWN 3NVMA 3D6RA 2NRZA 1YVNA 3ZX2A 3CMEN 3KWGA 5LY3A 3CCUN 3CJCA 5AZIB 3VESA 3VENA 5JVGL 1VQ7N 2P9IB 1NGHA 3CD6N 3O6WA 5AQHA 3FZLA 1M90O 5C0YA 4BREA 2HF3A 3EE9A 1QQMA 4MDAA 3CC4N 3CERA 4O8KA 4BRLA 1VQLN 3H6EA 3NMUA 4FOIA 2ASMA 5BREA 5AQVA 5KPTA 4RCHA 3DJCA 4B1VA 4FOEA 1QQOA 2QWQA 4OPHA 3ZYYX 3Q7CA 4H0TB 5M1OA 3T7ZA 2QEXN 4BY9C 4CZFA 1VQ5N 3QMLA 3H3OB 3HOTA 4FWLA 1QVGM 1GLJO 4AM6A 4GY2B 4B1UB 5EY4A 2GUPA 2P9UB 3WUHA 3CMAN 3J7ZO 4BG8A 3SK3A 2QTDA 5GIOA 1X3NA 3A5MC 4JHDA 5C2DA 2P9PA 2BUPA 3WXKA 3VERA 2YHXA 5GINA 4FPBA 5AQYA 2E20A 3D2FA 1WOQA 1KAXA 3AY9A 4RTFD 2NRHA 4BC5A 3JS6A 3ZETA 1QHAA 2A6AA 4K43A 1U2VB 2KKZA 2ZJQL 4BVPA 3W3DA 2FSKA 3M1FA 3J8AA 4IWVA 1GLDG 3VEZA 5CR4A 1BG3A 3BUZB 1X3MA 3WXMB 4C23A 3AARA 3BF3A 4YORA 2P9SB 4EHTA 1VQMN 3VEVA 3D2EA 1XUPO 4WFAL 4H5WA 3K9KA 3KK7A 1ILYA 3CCRN 4GV3A 4GV6A 4DQ8A 5EXWA 3MMVA 4IOAL 4H0XB 4BC2A 5AFUH 4NLCA 3CETA 2P9NB 4A62A 4F9OA 1RDWX 5AZJA 2GX9A 2P9KA 4HTLA 4JKGA 5AQUA 2QA4N 1K9MO 2IVNA 4NLBA 1QQNA 4C1NK 1IG8A 5AQZA 3PIOL 3LM9A 3E9PA 4YDUA 3NVKA 3QB0A 4CD1A 3RSEA 3MN7A 5M1QA 1T3VA 1NM1A 5AQMA 1G99A 1Q86O 3WXIA 3GE1A 1LCUA 1C0GA 2J4RA 4H0OA 4EFHA 4WFBL 2NZTA 3VGKA 3EZWA 4M63C 5AZIA 3G6EN 1QZ5A 1BA1A 1DEJA 4IFEA 5I9EB 2P9IA 1JJ2M 1Q18A 3CC2N 3U4LA 3MX5A 4H03B 2ZGYA 4IJNA 3DXMB 4FO0A 3ENBA 4BVOA 3I56N 2HMPA 1QZ6A 3AAQA 4FSVA 3TTFA 4JAXA 3O4WA 1YAGA 4B1ZA 1YXQA 2P9LB 2Q36A 1BU6O 5KQDA 1K8KB 3A5OC 2FXUA 1NGFA 2E8AA 5EX5A 3UKRB 1SZ2A 2Q2RA 4WYBA 3R8EA 5KQ8A 3CI5A 5DM7L 4YDUC 1YI2N 1NGGA 4JKHA 5CE3A 3M3ZA 2I7NA 3CF5L 4QS8A 2P9UA 1S72N 4KH5A 3VF2A 4CBXA 5FPEA 4FWKA 4IXCA 2OANA 1DKGD 4IZ9A 4EIAA 3MWTA 4O5FA 1Q82O 2KHOA 5AQFA 4BRNA 2QWOA 5AQKA 3CCJN 4U67L 1NWKA 2QXLA 5ADXA 2YCHA 3SMPA 1D4XA 3JXUA 1MWMA 2ITMA 1U2VA 4AF1A 3VF6A 3E1YA 1QVFM 3IMXA 2RE2A 2DPNA 3O9SA 1C0FA 1GLBG 4NO7A 2Q0RA 5F2RA 5C10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPE A;  5C2D A;  5M1P A;  5M1K A;  3C6H A;  4IEE A;  4IFE A;  5C2F A;  3C6A A;  5M1O A;  5C12 A;  5C15 A;  4IDH A;  5M1F A;  5M1N A;  5M1Q A;  4IEI A;  5C10 A; 
#chains in the Genus database with same CATH topology
 1B9F A;  5KPR A;  5FRO A;  4OPA A;  4ZHR A;  1LWC A;  5KRT A;  2ZF5 O;  4BDP A;  1VQ4 N;  1A5X A;  2E1Z A;  4ELV A;  4M3W A;  4ELU A;  2WFB A;  3IFR A;  1UA1 A;  1WSJ A;  3O5B A;  1LAW A;  1NK6 A;  3ASM A;  4AM7 A;  4BGA A;  3L6Q A;  1RFQ A;  2YNI A;  3N4P A;  1RCH A;  3FFI A;  5BR9 A;  1NMD A;  4FLT A;  1DGK N;  4DFJ A;  1JCF A;  5FRN A;  1H1V A;  4H0Y B;  5C2F A;  4H0V B;  4KTW A;  3I55 N;  4NYN A;  2OA8 A;  1ZBS A;  3K57 A;  2E6L A;  1NOY A;  2NLX A;  5I3U A;  3OTO K;  3QFP A;  1B9D A;  4CFD A;  2YHA A;  1NGI A;  4EZ6 A;  3ID6 A;  5M1F A;  4FJ5 A;  3M8S A;  1TKT A;  5HOO A;  4JI1 K;  2Q31 A;  4HCC A;  3JAM O;  4GKJ K;  1C0U A;  4HTU A;  4M45 A;  3SBG A;  3LPT A;  1OKJ A;  2F9T A;  2OPP A;  3AO4 A;  3CM5 A;  4BRK A;  1BWF O;  4CEA A;  1BI4 B;  4CVN E;  1W7A A;  3EZ5 A;  3J7A P;  4FJG A;  1ITG A;  1HQU A;  3AVM A;  4CF1 A;  5AQN A;  1UA0 A;  2GWJ A;  1CXU A;  1D8Y A;  3N4Q A;  1YTU A;  2QWP A;  2V7Z A;  1FKP A;  4U7B A;  3M5R A;  2HHX A;  3P83 D;  2I5J A;  2JWK A;  5GAD P;  3LP3 A;  4BWJ A;  2VGM A;  3BP8 A;  4BRH A;  3V4I A;  1KAZ A;  4CHQ A;  1S9E A;  3AAP A;  4DTX A;  3RMD A;  2E2N A;  2ITG A;  4BRI A;  4L8R B;  3K58 A;  1XQS C;  4PKH A;  1U4B A;  1ASU A;  2UUC K;  3VA0 A;  1W97 L;  2VCP A;  1XWL A;  3QET A;  1RT7 A;  1ATN A;  2IIR A;  2QI2 A;  4AHV A;  4YOT A;  3T19 A;  3P38 A;  4JK9 A;  5JS2 A;  3HXM A;  1HYS A;  1NGJ A;  3LP1 A;  1WBB A;  2XY7 A;  4KHU A;  3ZSZ A;  2HVH A;  3CJ9 A;  3KKR A;  3L2Q A;  2ZJP L;  4BR0 A;  1X9S A;  1HYZ A;  4I7F A;  4X65 K;  2P9P B;  2V52 B;  4FPA A;  1JCE A;  4XH5 A;  3OYK A;  3ID8 A;  4CW7 B;  1NK5 A;  4CZJ A;  2KZM A;  3SAG A;  3CJ1 A;  2HOE A;  2VYP A;  3O8M A;  4FJK A;  5GIP A;  4CJ3 A;  2HHH K;  4FJH A;  3G4S N;  2F9W A;  3ULD A;  4E1N A;  4DU4 A;  3OHR A;  5LL6 Z;  4B3S K;  1KFD A;  2NNW A;  4A2A A;  4FCY A;  3CCQ N;  4JKE A;  3WEE B;  3HBT A;  4Z4C A;  1K73 O;  4AH9 A;  4PA1 A;  1IBK K;  4CGI A;  4O0I A;  4BE1 A;  1HQE A;  2HB5 A;  2VWK A;  1CLQ A;  5JMV A;  1GOB A;  4IEI A;  3QFU A;  3S3O A;  5AQT A;  4DTJ A;  2F96 A;  4DSL A;  3IKM A;  3VQD A;  2FBX A;  1QSY A;  4FWR A;  3O4N A;  4DTR A;  1F21 A;  1P90 A;  2BH1 A;  3ZSW A;  4BR7 A;  3KWI A;  4ICL A;  2NRV A;  4DB3 A;  4BRO A;  3RMC A;  4AQY K;  3PLA A;  4PWD A;  4JK8 A;  3MX2 A;  3C6A A;  3MXM A;  3AVJ A;  1J5E K;  1C1B A;  4DV5 K;  3KLF A;  2W41 A;  3CJ7 A;  5F0X A;  3F9M A;  4UQG A;  2G8K A;  3OYD A;  3OVN A;  4DR2 K;  3RMB A;  3SPY A;  4IDK A;  2A5X A;  1TL3 A;  4KHW A;  1EWR A;  3PIP L;  1KD1 O;  4FK2 A;  4CIG A;  1NGC A;  1N6Q A;  1J53 A;  1LW2 A;  1EET A;  3CCM N;  4JV5 K;  3CFR A;  2G8H A;  4UY8 O;  3AGR A;  4C8L A;  3R3L A;  1HNX K;  3MEC A;  4DR6 K;  1U6Z A;  1S6P A;  3SZ2 A;  3GBT A;  3U8X A;  3JSM A;  3MWP A;  2FSN A;  4F3O A;  3FGU A;  3DLB A;  2VWB A;  1K8A O;  3M8R A;  1JXB A;  1I3A A;  4XEI A;  3CCS N;  3RRH A;  3PUF A;  3DXK A;  4M3U A;  1GLE G;  4M3Z A;  4LFC K;  2A41 A;  1K6Y A;  3CJA A;  2YKN A;  4FWS A;  4E7J A;  4JNE A;  1NJI O;  1RTH A;  4JHD B;  2UXC K;  4R79 A;  1T44 A;  1DLO A;  3EKS A;  1LOT B;  4FZX C;  5CYM A;  3BF1 A;  1HKB A;  1Z25 A;  3KK3 A;  4CEQ A;  1NGB A;  3DLK A;  4Z4H A;  4E89 A;  4MO5 A;  1IKX A;  3TSP A;  3HP9 A;  3DWL A;  4FLY A;  4CEO A;  1XC9 A;  3D2E B;  1BCM A;  3HM8 A;  4JKB A;  1EKE A;  5AQG A;  5JLF A;  3VEW A;  5AFU A;  1WSI A;  5BRF A;  4K8X A;  5C42 A;  2CGJ A;  3OA9 A;  3VA3 A;  3CCL N;  1C1C A;  3SAH A;  3DM2 A;  4OO1 J;  2YV0 X;  4H5V A;  4BQL A;  4W5T A;  4IG3 A;  1BO5 O;  3O9Q A;  1NJZ A;  4JN4 A;  2O4G A;  5KGW A;  3NCI A;  1YJW N;  1VSK A;  3H08 A;  1YVN A;  3KK1 A;  3D0P A;  3QNO A;  3KWG A;  3CME N;  5LY3 A;  3VEN A;  2P9I B;  2ETJ A;  1WBD A;  3FZL A;  1KLN A;  3KD5 E;  4MDA A;  4FM0 A;  3CC4 N;  4KHN A;  4JYA K;  1VQL N;  3H6E A;  5BRE A;  3OYE A;  5AQV A;  4FOE A;  4LH5 A;  3HJF A;  3ZYY X;  4CZF A;  2DFF A;  1VQ5 N;  1GLJ O;  4B1U B;  2GUP A;  3QEW A;  4Y1C A;  3A5M C;  4K8Z A;  4CJ4 A;  3WXK A;  5GIN A;  2HND A;  3AY9 A;  1KAX A;  4DTN A;  4DFK A;  2NRH A;  1BIZ A;  3ZET A;  3PX4 A;  1QHA A;  4CF0 A;  3O3H A;  3SYZ A;  1VSL A;  2KKZ A;  4F2R A;  3AO3 A;  5KTQ A;  1VSH A;  2FSK A;  3M1F A;  2R7Y A;  3KLH A;  5CR4 A;  4O44 A;  1X3M A;  3WXM B;  4C23 A;  3AAR A;  3LP0 A;  3L2W A;  4EHT A;  1WSH A;  5E41 A;  1XUP O;  3AVF A;  3K9K A;  3KK7 A;  3MMV A;  3HP6 A;  4H0X B;  1RTD A;  4CED A;  4A62 A;  1VQN N;  3OJS A;  4NLB A;  4OPJ A;  1L3T A;  4DSE A;  3NH1 A;  3VN5 A;  3L2R A;  4CD1 A;  5AQM A;  2HVI A;  3V9X A;  3AVK A;  1C0G A;  2J4R A;  4EFH A;  4M63 C;  3VQ4 A;  5AZI A;  3G6E N;  1LAV A;  1XHX A;  3MXJ A;  5HRN A;  2GBZ A;  4H03 B;  2ZGY A;  3I56 N;  5I42 A;  2ZQB A;  4BVO A;  3AAQ A;  1NKC A;  2P9L B;  4JRP A;  3V1Q A;  1ZYQ A;  4DWI A;  4KHQ A;  1SZ2 A;  3DOL A;  1LW0 A;  3R8E A;  4DQR A;  2XY5 A;  3PO5 A;  3CI5 A;  3M8P A;  4B3M K;  4CGG A;  1N34 K;  1LWE A;  2VQE K;  4KH5 A;  1U48 A;  3VF2 A;  1NK0 A;  4FWK A;  4B9T A;  4IXC A;  1DKG D;  2IDO A;  4EIA A;  3I8D A;  3I0R A;  5AQK A;  3J81 O;  4FLW A;  2ZM6 K;  1D4X A;  2ITM A;  1MWM A;  1TAU A;  4CHO A;  3VF6 A;  3E1Y A;  2DPN A;  4YY3 K;  1C0F A;  1LV5 A;  4PY5 A;  2Q0R A;  5SWM A;  4MO4 A;  1BDG A;  3L8B A;  4ILH A;  3OYF A;  5MLC Q;  1HX1 A;  3RTV A;  4CI6 A;  1FW6 A;  1TYQ B;  1ZBF A;  4M42 A;  5LJV A;  1BGX T;  1MA9 B;  5TKY A;  4V19 S;  4J2E A;  3VOV A;  3CXC M;  4JI4 K;  1REV A;  3VQ7 A;  3C6H A;  4CGH A;  1VSE A;  3E01 A;  2IOC A;  3TU5 A;  1S9G A;  4KKO A;  4DCH A;  4BRQ A;  4CGJ A;  5SZT A;  4I6M A;  1X9J A;  1T6D A;  1ZBH A;  4J2B A;  2Z1J A;  1B92 A;  4CIE A;  3OW2 M;  3A8Y A;  3GL1 A;  3THY B;  1IH7 A;  3HSC A;  4C8K A;  1IJJ A;  3ZT2 A;  2XO7 A;  1N36 K;  4NXM K;  2E2P A;  4BQZ A;  3HTV A;  3BZC A;  5DM6 L;  2BGG A;  3AGK A;  2V51 B;  4DV3 K;  4IO8 A;  3HI0 A;  3LAN A;  3C0B A;  1TKD A;  3T3F A;  3O9U A;  4FJ8 A;  1FK9 A;  3PO4 A;  5CZ2 A;  4W5O A;  2G8I A;  1NGD A;  4MQ3 A;  3K2P A;  1BA0 A;  2QWN A;  4IDH A;  4Y1D A;  1Q7Y O;  2WC9 A;  3ENO A;  4B8C A;  3H45 C;  2EWS A;  4FJI A;  4JI7 K;  2O8B A;  4HUE A;  4XIU A;  5M1P A;  1GLA G;  2A1R A;  1MWK A;  4R5P A;  4BR2 A;  1NU0 A;  1RT3 A;  4JKC A;  4NB4 A;  4OPK A;  3GOI A;  4EAH D;  2OTL N;  4LC9 B;  1DTQ A;  4CJQ A;  2FF3 B;  4DKW A;  4QS7 A;  4J8F A;  4FK4 A;  3KLG A;  2X6N A;  4J2D A;  4LF4 K;  5C25 A;  4FJ9 A;  3VET A;  2EX3 A;  1S1V A;  4ELT A;  3WQT A;  1RDA A;  1IBM K;  1D5A A;  2JLE A;  4MLE A;  4CJU A;  4C8O A;  4ISE A;  3WNF A;  1I94 K;  4J2A A;  1HPM A;  3SQ2 A;  1J9A A;  4BRA A;  3P39 A;  2HF4 A;  3IUC A;  5FPD A;  2YNG A;  3ZT0 A;  3E9O A;  2QWL A;  3E9L A;  3RMA A;  3KZB A;  3QER A;  3VQ8 A;  5AQI A;  2D0P A;  2OTJ N;  3LAM A;  1OH8 A;  3VPZ A;  3HK2 A;  1TGO A;  1TUY A;  1SL0 A;  4FM1 A;  1XI1 A;  4H4O A;  3D2F B;  3TAP A;  1TK8 A;  2FBT A;  4KRE A;  4DUZ K;  3O1W A;  1BI4 A;  2E4L A;  4BE0 A;  4CHP A;  4A2B A;  3R9P A;  5LJW A;  4YOY A;  3B8A X;  1ASW A;  3NH2 A;  1RIL A;  2VG7 A;  4FWM A;  1HJR A;  3QEX A;  3R1X A;  3NF7 A;  3QES A;  4IEE A;  2DFE A;  2UYT A;  2F7T A;  3MN9 A;  1V4S A;  4JEP A;  3LDL A;  3WQU A;  1NJY A;  1V4T A;  4W5N A;  3VQB A;  1Z26 A;  1S5J A;  4CBU A;  3EEQ A;  4FJ7 A;  4KBO A;  3OYM A;  4E7L A;  3QEP A;  4PHT X;  1S22 A;  4Q0B A;  3AO5 A;  5E26 A;  3TAR A;  4JRQ A;  3QNN A;  3TR8 A;  4A61 A;  4YNQ A;  1SAZ A;  3U9Z A;  4KTQ A;  1QSL A;  3V9U A;  5C24 A;  1VQ9 N;  1TL1 A;  1RGI A;  2E6M A;  4M7Y A;  3K5M A;  3WT0 A;  4CEF A;  4EZ9 A;  2DTU A;  2A1S A;  5GAG P;  4E7K A;  4HHT A;  3K9J A;  3O4Q A;  3BDP A;  1L5U A;  3L3U A;  2EHG A;  2VG6 A;  4FW1 A;  1KLM A;  2V7Y A;  3CCV N;  1KXP A;  2D0C A;  1XNR K;  3TI0 A;  1GLF O;  1TV6 A;  3SLC A;  3CPW M;  3LDP A;  3OY9 A;  4FVM A;  4BDY A;  1BHL A;  3EL2 A;  3EN9 A;  3LM2 A;  1C6V A;  4AHC A;  3O3F A;  1Z6R A;  1CZA N;  3MCA B;  2HBL A;  4BRC A;  1QHT A;  3NE6 A;  4PKG A;  3QIP A;  2FF6 A;  4F2S A;  3LDO A;  3AVH A;  3WEE A;  2FBV A;  5D3G A;  3RWU A;  5AQP A;  4ID1 A;  2YHB A;  2HHU A;  3HRG A;  5BPN A;  4FLV A;  1EXQ A;  2VGN A;  4B1Y B;  2RHK A;  4BDZ A;  1X9W A;  3HOS A;  1JLE A;  1S1T A;  2Z1G A;  3BY5 A;  3MK6 A;  4L3Q A;  1J54 A;  3SQ4 A;  4FM2 A;  4EP4 A;  3O08 A;  5GAH P;  1EO1 A;  1W2B M;  1KQS M;  1MDU B;  2QXF A;  3CYM A;  4N47 A;  2D0B A;  4CJW A;  4JLH A;  3D7E O;  5BR8 K;  4Z4I A;  2DFH A;  3NF6 A;  2YHW A;  2E88 A;  2A3Z A;  4M3T A;  1RDC A;  5JIC A;  3S9H A;  1YIT N;  1VRT A;  4XH1 A;  4YOW A;  3K0S A;  4AHS A;  2W6L A;  1WSF A;  4B08 A;  3SV3 A;  4H5R A;  4B1W B;  1ZXO A;  1YUW A;  4B9S A;  3VEY A;  4B9L A;  4LF7 K;  4WF9 L;  3CQ8 A;  5HLF A;  2W40 A;  4LY7 A;  5HRP A;  4JK7 A;  2XHB A;  5E84 A;  3EKU A;  1BUP A;  1C0T A;  4CJP A;  3VQA A;  3V1O A;  3AO1 A;  2WUS A;  3PX6 A;  5AZJ B;  3AVI A;  3LAL A;  4BRP A;  4G1Q A;  5LMN K;  3F73 A;  4CES A;  3RSE B;  3NGZ A;  3OYJ A;  3NVM A;  3D6R A;  3IG1 A;  3CCU N;  4W5Q A;  3VES A;  1VQ7 N;  4HCB A;  3AA4 A;  1SL2 A;  1NGH A;  4IFV A;  2GUI A;  5C0Y A;  1X9M A;  4DTP A;  1QQM A;  4M41 A;  3K5L A;  4AHT A;  4FOI A;  2O8E B;  2LSN A;  3CM6 A;  3RR7 A;  1YTA A;  5CZ1 A;  1QQO A;  3MED A;  4H0T B;  3T7Z A;  2P5O A;  3QML A;  1QVG M;  3ITH A;  1HRH A;  4JI0 K;  3J7Z O;  4BG8 A;  3SK3 A;  5GIO A;  1X3N A;  3KIO A;  4JHD A;  5C2D A;  4CIF A;  4PUO A;  4OVL A;  5AQY A;  4MFB A;  3PV8 A;  4BE2 A;  3NGY A;  4KO0 A;  3T1A A;  1E3M A;  2G8F A;  4BVP A;  3W3D A;  3J8A A;  4IWV A;  1GLD G;  3VEZ A;  1BG3 A;  3BUZ B;  3SUP A;  3HPH A;  1O1W A;  4CEB A;  3BF3 A;  4YOR A;  3U6F A;  3VEV A;  3D2E A;  1DTT A;  1BQM A;  5CY4 A;  1NK7 A;  3CCR N;  4GV6 A;  4W5R A;  3HT3 A;  4BC2 A;  3CET A;  2P9N B;  4LH4 A;  1RTJ A;  4F9O A;  2QA4 N;  2P9K A;  2B4J A;  1NMN A;  1VSF A;  3ISN C;  4C1N K;  3J80 O;  4ID5 A;  4FK0 A;  3QB0 A;  3OYG A;  1T3V A;  1NM1 A;  5HRR A;  3ZSX A;  2PY5 A;  3AVB A;  4DR4 K;  4LSL A;  4FZZ A;  4CFA A;  2P9I A;  2RF2 A;  1Q18 A;  3AVC A;  4JI2 K;  3U4L A;  4IJN A;  3U3G A;  2JGU A;  3DXM B;  2HMP A;  4FSV A;  1YAG A;  2BAN A;  4E19 A;  1RBU A;  2Q36 A;  4DR5 K;  1JLC A;  3A5O C;  2FXU A;  5LMU K;  1NGF A;  2E8A A;  3UKR B;  2Q2R A;  2B5J A;  4M3R A;  4DTM A;  5CE3 A;  4QS8 A;  2UXD K;  1C0M A;  2OPS A;  4FLU A;  3SPZ A;  5FPE A;  4CEZ A;  4IZ9 A;  3MWT A;  1Q82 O;  2KHO A;  5AQF A;  2IGI A;  2QWO A;  4E3S A;  4U67 L;  2YCH A;  3IMX A;  5F2R A;  5C10 A;  3M6G A;  4CF2 A;  5GAE P;  3IRX A;  3NF8 A;  3QIN A;  2ZWH A;  4DMN A;  4DQP A;  4CZM A;  1EWQ A;  2NRR A;  2XRI A;  4DR1 K;  4DSF A;  3TSU A;  4DSJ A;  2HBM A;  1GOC A;  5TKW A;  3DLL L;  1JL1 A;  4E0D A;  1VK0 A;  3LDS A;  5J1E A;  5J2M A;  2F8S A;  1IKW A;  3I8B A;  3GG4 A;  4OX9 K;  2ZE2 A;  2HST A;  1NK4 A;  4LFA K;  5C15 A;  3KLI A;  4BWM A;  2HMI A;  4Z94 A;  1JXE A;  5AQJ A;  3BEX A;  1E4F T;  3NBP A;  4RW7 A;  2VWJ A;  2HHS A;  3OJU A;  2E2O A;  1GLL O;  3RRG A;  4O8U A;  2WOM A;  1L3V A;  4CJV A;  3DXK B;  2P9L A;  4E7I A;  1VQP N;  4M7X A;  4RW8 A;  2ZD1 A;  1IG9 A;  4PL7 A;  4X66 K;  3CC7 N;  1OVY A;  1HUX A;  1GLC G;  2KW4 A;  1S3X A;  3DLR A;  3C7N B;  1FJG K;  5HRO A;  1XMQ K;  5IWA K;  3QO9 A;  4CBW A;  3TAM A;  5AQX A;  3NHG A;  3P4I A;  4DQI A;  1SS6 A;  1Q8I A;  3VQ9 A;  1FKO A;  3UE5 A;  2X78 A;  2GWK A;  3FLC O;  3SV4 A;  4B9U A;  3TSQ A;  5BRD A;  4JS4 A;  5ADX H;  3SMS A;  4OKE A;  1JCG A;  4FLZ A;  2RN2 A;  3F9K A;  4C1N I;  3SUQ A;  2ASO A;  3HYF A;  5FPM A;  4NCB A;  1KVC A;  4KRF A;  3A5L C;  3PSF A;  3SNN A;  3TAQ A;  4BR5 A;  3QBW A;  3DLE A;  4WQ4 C;  1TYQ A;  2QM1 A;  2WBN A;  3WXJ A;  3WNE A;  1CZ9 A;  2Y1I A;  1HJO A;  1Q9X A;  4JD2 B;  3TAE A;  3ZX0 A;  1QE1 A;  3K59 A;  4JI3 K;  4KHS A;  3OS2 A;  2PFU A;  4QAG A;  3ULE B;  2BTF A;  3DRS A;  4PKI A;  3VQC A;  5C12 A;  1XHZ A;  2A40 A;  4DTS A;  4BRD A;  4DV2 K;  3IS9 A;  4OKK A;  1WNS A;  5BRH A;  3OYA A;  3MDQ A;  2D1K A;  3THY A;  3CHW A;  1T8E A;  3CPE A;  3O9R A;  4KB0 A;  2CH6 A;  2G8W A;  2O8F B;  1YF5 L;  1P8Z A;  2IC3 A;  5H1S Q;  2YHY A;  4KFB A;  4PQU A;  1NJW A;  1M1K O;  2IVP A;  4CJ5 A;  3H1V X;  3M8Q A;  2UU9 K;  2AP1 A;  3WXL A;  1NGE A;  3QDK A;  4YOV A;  3VTH A;  1KFS A;  2KFZ A;  3THX A;  3AVN A;  4CJK A;  2P9S A;  5HP1 A;  4ILJ A;  5CHI A;  4GKK K;  4KH6 A;  4OGC A;  4Z0U A;  1KC8 O;  1L3S A;  1T05 A;  4WFN L;  2O8C A;  4CHN A;  3UKU B;  3KK2 A;  1OH7 A;  2O4I A;  4I2Q A;  3BGR A;  2E1Y A;  3A5N C;  2D0O A;  1YVU A;  3DAW A;  4CF8 A;  4ISG A;  3LDN A;  4DTO A;  3KD1 E;  3C94 A;  2X74 A;  2BE2 A;  1E4G T;  3KVG A;  3LPU A;  3HPO A;  3VQE A;  1U49 A;  1Y97 A;  3OBY A;  3HVR A;  3OBW A;  3ZEU B;  5FLX O;  3IDH A;  3P1G A;  5BN8 A;  3FFK B;  3L2V A;  1K8K A;  1QTM A;  3AA5 X;  3MN6 A;  3D45 A;  2P1J A;  5FPN A;  3Q7B A;  2D4W A;  3L4Q A;  5AJ3 K;  1RT2 A;  2E2Q A;  3O1B A;  2UUB K;  4WQ4 A;  3E66 A;  4FWO A;  4CK1 A;  4NCG A;  4WCE L;  4X64 K;  3U9D A;  3V9W A;  4CGF A;  4RG8 A;  1IKY A;  3S3N A;  3SQ1 A;  4B9Q A;  1RDU A;  2FLO A;  3OS1 A;  3K5N A;  2UUA K;  3HO1 A;  2D5R A;  2AA4 A;  1Y64 A;  1VRU A;  5AQO A;  3THW B;  4FVU A;  3QEV A;  1NOZ A;  1RT4 A;  2KLA A;  3VEX A;  1RDB A;  2JWL A;  4A57 A;  4E1J A;  3RVC A;  3L4I A;  1OVQ A;  2HBK A;  3NH0 A;  4KPY A;  3HZ6 A;  3A2F A;  4N5S A;  1U04 A;  3LL3 A;  1VQ6 N;  3DMJ A;  1KVB A;  3T1H K;  4GV9 A;  1NGA A;  2G8V A;  4A5A A;  1JLQ A;  2RKI A;  2W6K A;  3VGM A;  1NK9 A;  3FZH A;  1KCF A;  4KI4 A;  2PBD A;  4GVM A;  3L0Q A;  1ATR A;  1QQC A;  4GW6 A;  2Z1H A;  3S3M A;  1VAZ A;  1RBR A;  1N5Y A;  2HHV A;  4I6M B;  2CH5 A;  4Z4F A;  3HPG A;  4DTU A;  3SAF A;  1R59 O;  2QWR A;  2WON A;  4BC4 A;  3F2K A;  4IO9 L;  3LDQ A;  1U45 A;  3LZJ A;  3ZSQ A;  3OYB A;  2IVO A;  3G0Z A;  3KLE A;  4DU3 A;  5M1K A;  4FJX A;  3F5T A;  1RBT A;  4HWI A;  2QW9 A;  3EE8 A;  4CZL A;  3CQY A;  4XH4 A;  5AQR A;  3SJJ A;  1W9H A;  3NAE A;  2OYQ A;  1HKG A;  2YX6 A;  3HVT A;  4LF8 K;  1HMV A;  1HLU A;  5DMR A;  1RT6 A;  4JKG B;  4CFC A;  5BPL A;  1IBL K;  3PSI A;  4EP5 A;  2HHW A;  3C95 A;  4KV8 A;  3ZT4 A;  2FSJ A;  3FZM A;  1S1U A;  2NRZ A;  4CK2 A;  3CJC A;  2XY8 A;  1BQN A;  3MAQ A;  3AV9 A;  4DFP A;  3CD6 N;  4JI5 K;  3O6W A;  5AQH A;  3AO2 A;  1M90 O;  4BRE A;  2HF3 A;  2O8D B;  4DV6 K;  5K14 A;  4BRL A;  4CGD A;  1CZB A;  1RT1 A;  4RCH A;  5KPT A;  3J7Y P;  3P5J A;  4IG0 A;  4CER A;  1W0H A;  4FWL A;  1WLJ A;  4AM6 A;  4GY2 B;  5EY4 A;  1JLA A;  2P9U B;  3WUH A;  4CEC A;  3L2U A;  2AJQ A;  2QTD A;  1TKX A;  2P9P A;  2BUP A;  4CJF A;  4Q5V A;  1NK8 A;  1WOQ A;  1D9F A;  4RTF D;  2Q3S A;  1A5V A;  2A6A A;  4K43 A;  1U2V B;  2ZJQ L;  3DI6 A;  5J2P A;  4LF6 K;  2FBY A;  1HNZ K;  1VQM N;  1HR0 K;  4K0K K;  3V9S A;  1HPZ A;  4H5W A;  1YT3 A;  2OZS A;  3DLG A;  4GV3 A;  4IOA L;  4DQ8 A;  5EXW A;  3B6P A;  4NLC A;  5AZJ A;  2GX9 A;  1K9M O;  2QKK A;  2OPR A;  1OH5 A;  2D0A A;  3LM9 A;  4YDU A;  4E1M A;  5J2N A;  4OLA A;  3RSE A;  1R0A A;  3DRR A;  1G99 A;  3TAG A;  4AHU A;  3WXI A;  3GE1 A;  1LCU A;  4WFB L;  3VGK A;  4DQS A;  1BA1 A;  1DEJ A;  4IFE A;  5I9E B;  1JJ2 M;  3CC2 N;  3MX5 A;  4FO0 A;  1ZBI A;  2FC0 A;  3ENB A;  3LP2 A;  4O5B A;  3AVG A;  4BAC A;  4I9Q A;  3WNG A;  3O4W A;  1YXQ A;  3TAB A;  5HRS A;  4OLB A;  1SKR A;  5KQD A;  2O8E A;  4KB1 A;  2KTQ A;  5EX5 A;  4WYB A;  1WN7 A;  1NGG A;  2QK9 A;  2I7N A;  3LWM A;  3CF5 L;  3TAF A;  1S72 N;  4F4K A;  5CYQ A;  1L3U A;  3L3V A;  4DU1 A;  1N33 K;  2QKB A;  4DUY K;  2HNY A;  5EU7 A;  4QCL A;  2QXL A;  5ADX A;  1GOA A;  1NKB A;  3JXU A;  4DLG A;  3ZSR A;  1BL3 A;  2PYL A;  2QWM A;  4GVE A;  5HBM A;  4DG1 A;  3ALY A;  2YJE A;  1RT5 A;  2DY4 A;  4KH4 A;  1NBW A;  3A0I X;  1WSE A;  3O9T A;  4NCA A;  2HHQ A;  1UAX A;  2P9N A;  3OYI A;  4DS5 A;  4CJS A;  3G71 N;  4CJT A;  2YNH A;  3UB5 A;  1JL2 A;  2ZGZ A;  1VHX A;  3SUO A;  4N76 A;  2P5G A;  5BN9 A;  4EHU A;  4ISF A;  5J2Q A;  3ZT3 A;  1YJ9 N;  2YJF A;  3R6M A;  4YFU A;  3DXM A;  3K5O A;  1NG9 A;  1VSI A;  2F4V K;  4FJM A;  3CCE N;  2G8U A;  5HL7 L;  1NKE A;  1T03 A;  1X1P A;  5FRM A;  1ESV A;  1ATS A;  5KI6 A;  3CG7 A;  2OZM A;  2GEM A;  3UKR A;  4A59 A;  1C1A A;  2F8T A;  1Q9Y A;  1BIU A;  4N56 A;  2BDP A;  4DV0 K;  4WQ5 C;  1NLV A;  4PL8 A;  5ELZ A;  1ZC6 A;  3VF4 A;  1XC3 A;  3ATU A;  4AHR A;  2HNZ A;  4MLH A;  1IO2 A;  3T69 A;  1QS4 A;  4BRG A;  1FXX A;  2PAV A;  4DF4 A;  4BR9 A;  5M1N A;  3NDK A;  1Q81 O;  2GTD A;  4BR4 A;  5JVH L;  4CZE A;  3JYT A;  3DLH A;  4B9M A;  1WUA A;  3P31 A;  5BPM A;  2Z1I A;  1DT9 A;  2NRT A;  4LFB K;  3THV A;  4O4G A;  1D9D A;  2KFN A;  3OYH A;  2CGL A;  5A2Q O;  4H0P A;  3MN5 A;  4GMJ B;  2ZJR L;  4CJL A;  1RNH A;  1TKZ A;  4CK3 A;  1J5O A;  4KI6 A;  4RW6 A;  4CFB A;  1JLF A;  1TUU A;  2YKM A;  4CJ7 A;  4Z4G A;  4ILG B;  1NNE A;  1BOT O;  4YOU A;  4CF9 A;  3ENH A;  4CZK A;  4K25 A;  1YJN N;  3IAY A;  4DHY A;  3VMF B;  1YIJ N;  1JLB A;  5B8H A;  4HUF A;  2I7P A;  4DV4 K;  4YHH K;  1KAY A;  4FJJ A;  1BCO A;  1NJX A;  4BRM A;  1BIS A;  4M3X A;  5AQL A;  4B8A B;  3W0L A;  3ZCM A;  1TAQ A;  4H8K A;  5AQS A;  3TTC A;  1XNQ K;  4KHP K;  3C6T A;  4O0J A;  3C7N A;  5EVZ A;  4JS5 A;  1WSG A;  2WTU A;  3FR0 A;  4JI8 K;  4FJL A;  4H5T A;  1YHQ N;  1TVR A;  2NRW A;  3H1Q A;  4DSK A;  3SBT A;  4NYF A;  3AA3 A;  4JKD A;  2PYJ A;  3CIP A;  4IOX A;  3EO3 A;  1TK5 A;  3HST B;  4LSN A;  1RTI A;  2GEL A;  4MDB A;  1SUQ A;  4I9L A;  4CHZ A;  5FDL A;  4DV7 K;  1UWB A;  3KHY A;  2P9K B;  3LWL A;  3VQP A;  2A42 A;  3GDQ A;  4DFM A;  1VQ8 N;  4CZI A;  4JKA A;  4QS9 A;  1VQO N;  4F3T A;  1I39 A;  4WQ5 A;  4K41 A;  3HM9 A;  4B3O A;  4TSX A;  3WNH A;  3ZX3 A;  3H3N O;  1UOC A;  1ZBU A;  2H3G X;  4JD2 A;  4RWT A;  4DV1 K;  1VQK N;  2ASP A;  4BG9 A;  2P51 A;  4CZG A;  4Z4E A;  1IV0 A;  3ULE A;  3C6U A;  1SKW A;  3NFA A;  3VGL A;  2Q97 A;  4IBN A;  2OPQ A;  3CFP A;  3C65 A;  3ZLJ A;  2NRX A;  3AA2 A;  4BC3 A;  5KRS A;  2O8F A;  4FLX A;  3O80 A;  4DQQ A;  1J6Z A;  3I33 A;  4GNI A;  3SI6 A;  4KTZ A;  4C8N A;  1KTQ A;  3MXI A;  2IAJ A;  5KGX A;  3OS0 A;  1N8R O;  1EP4 A;  3VEO A;  1ZBL A;  3QLH A;  3FE1 A;  4BRF A;  4FL9 A;  1ASV A;  4CZH A;  3QIC A;  1OH6 A;  5DK5 A;  3ATV A;  3EY1 A;  3NF9 A;  2Q0U A;  5KPZ A;  3CQX A;  4BGB A;  1HKC A;  4OGE A;  2OCE A;  4YOX A;  4FZY A;  5F1X A;  5JS1 A;  1EX4 A;  3QBX A;  3VTI A;  3H46 O;  1IKV A;  3SJH A;  3RR8 A;  3B6O A;  3UKU A;  1XMO K;  3G25 A;  3MEG A;  1WAJ A;  4F8R A;  3S41 A;  1N32 K;  2HBJ A;  4FWP A;  4CD3 A;  4OJR A;  4B3T K;  1U47 A;  5AR0 A;  2VQF K;  4WE1 A;  3EYZ A;  5EOY A;  4DF8 A;  3PX0 A;  5AQQ A;  1G15 A;  1SKS A;  4FW2 A;  3FZF A;  1SL1 A;  1WB9 A;  3V81 A;  3TPQ A;  4LD0 A;  3ZEU A;  4HUG A;  3I0S A;  2NUB A;  4JKF A;  4B9V A;  3MCP A;  2E5L K;  4CCH A;  2UXB K;  2YI1 A;  3V6D A;  3NGI A;  1CXQ A;  1A5W A;  1Z05 A;  3UIQ A;  1MU2 A;  3ZT1 A;  2B6A A;  2VG5 A;  3FZK A;  5AQW A;  3CFO A;  3LZI A;  1T6C A;  3VQ6 A;  2HHT A;  3DYA A;  2KZZ A;  3CJB A;  4G9Z A;  3PY8 A;  4RW9 A;  3ZET B;  4IOC L;  2Y1J A;  3DRP A;  1O13 A;  4RW4 A;  1VSD A;  1T7P A;  4Y0W A;  4IJA A;  3QEI A;  2CGK A;  2ATQ A;  2XY6 A;  1EQY A;  4ZTJ A;  2GV9 A;  3TTD A;  2IS3 A;  5JLH A;  1VSJ A;  1LWF A;  4B1X B;  4CEE A;  4FYD A;  4H5N A;  1S1X A;  3SCX A;  3THW A;  2Q1N A;  4IKF A;  4FWQ A;  3ZSY A;  1RBV A;  1HYV A;  1WAF A;  4DS4 A;  4OKJ A;  1SQK A;  3U3Y A;  4FWN A;  4A5B A;  4K42 A;  4X62 K;  4KHY A;  1VSM A;  3ZX2 A;  5AZI B;  5JVG L;  4CJE A;  3EE9 A;  4ZTF A;  4E7H A;  2W42 A;  3CER A;  4O8K A;  3O3G A;  2YNF A;  3NMU A;  2ASM A;  3DJC A;  4B1V A;  3TAN A;  2QWQ A;  4OPH A;  4BY9 C;  3SQ0 A;  3Q7C A;  5M1O A;  2QEX N;  4O55 A;  3OYN A;  4B3R K;  3H3O B;  3HOT A;  4LF9 K;  4KAZ A;  3QIO A;  4CJR A;  3BZK A;  3CMA N;  5IT9 O;  3SUN A;  1S1W A;  3TWH A;  4DR7 K;  3VER A;  2YHX A;  1KVA A;  4FPB A;  2E20 A;  3D2F A;  4AIL C;  1HNV A;  4BC5 A;  3JS6 A;  3VQQ A;  4IFY A;  1HNW K;  4I2P A;  3HL8 A;  4B9N A;  4CHY A;  3T1Y K;  3THX B;  4FJN A;  2P9S B;  3KJV A;  2RPI A;  4CE9 A;  4WFA L;  1ILY A;  3V9Z A;  2O8C B;  5AFU H;  1S6Q A;  1RDW X;  3V1R A;  4HTL A;  3DOK A;  5AQU A;  3AVA A;  4JKG A;  1HNI A;  2IVN A;  2HW3 A;  1QQN A;  2X6S A;  1IG8 A;  5AQZ A;  1TK0 A;  3PIO L;  3E9P A;  4DR3 K;  3NVK A;  3VQ5 A;  1QSS A;  3MN7 A;  5M1Q A;  1Q86 O;  4H0O A;  2NZT A;  3EZW A;  4C8M A;  1QZ5 A;  4HVJ A;  1RBS A;  2PZS A;  1QZ6 A;  4NXN K;  3TTF A;  1KSP A;  4JAX A;  2O8D A;  4B1Z A;  3AVL A;  1BU6 O;  1K8K B;  4JI6 K;  3ZSO A;  5KQ8 A;  4YDU C;  5DM7 L;  4DLE A;  1YI2 N;  4LF5 K;  4JKH A;  3M3Z A;  2KQ2 A;  4N41 A;  3MEE A;  1JLG A;  5T7B A;  2P9U A;  3KTQ A;  3ZSV A;  4CBX A;  1RDD A;  2OAN A;  1JKH A;  3LAK A;  4O5F A;  4BRN A;  1SV5 A;  3CCJ N;  4QOZ B;  4DSI A;  1NWK A;  3KKS A;  3SMP A;  4FXD A;  3G10 A;  1U2V A;  4AF1 A;  4M3Y A;  3OYL A;  3OYC A;  1QVF M;  2O8B B;  2RE2 A;  3O9S A;  1GLB G;  4NO7 A;  1KRP A;  4H4M A; 
#chains in the Genus database with same CATH homology
 3M6G A;  2QWM A;  5GAE P;  4GVE A;  5KPR A;  4MO4 A;  1BDG A;  2ZWH A;  4OPA A;  4ILH A;  2ZF5 O;  1HX1 A;  4CZM A;  5MLC Q;  2NRR A;  4CI6 A;  2YJE A;  3TSU A;  1VQ4 N;  4KH4 A;  2HBM A;  1NBW A;  3A0I X;  2E1Z A;  1TYQ B;  3O9T A;  2P9N A;  2WFB A;  3IFR A;  5TKW A;  3DLL L;  3O5B A;  3G71 N;  5LJV A;  1MA9 B;  5TKY A;  3UB5 A;  2ZGZ A;  4AM7 A;  3L6Q A;  4BGA A;  3VOV A;  3I8B A;  3CXC M;  1RFQ A;  3GG4 A;  3N4P A;  2HST A;  5BR9 A;  1NMD A;  1DGK N;  3C6H A;  1JCF A;  5BN9 A;  4EHU A;  5C15 A;  1H1V A;  4H0Y B;  4ISF A;  3TU5 A;  4Z94 A;  4DCH A;  5C2F A;  4H0V B;  3I55 N;  1YJ9 N;  2YJF A;  5AQJ A;  3R6M A;  4I6M A;  3BEX A;  4BRQ A;  1E4F T;  1X9J A;  1T6D A;  2E2O A;  3DXM A;  3OW2 M;  1ZBS A;  3A8Y A;  3GL1 A;  1GLL O;  3HSC A;  4O8U A;  3CCE N;  2NLX A;  3DXK B;  5HL7 L;  1IJJ A;  3QFP A;  2P9L A;  1VQP N;  4M7X A;  1NGI A;  1ESV A;  2E2P A;  4BQZ A;  4PL7 A;  3HTV A;  1ATS A;  3ID6 A;  5M1F A;  3CC7 N;  1OVY A;  5HOO A;  1HUX A;  2GEM A;  3UKR A;  5DM6 L;  2Q31 A;  3AGK A;  4A59 A;  2V51 B;  1GLC G;  1S3X A;  3C7N B;  4IO8 A;  3HI0 A;  3C0B A;  3O9U A;  3SBG A;  4CBW A;  5AQX A;  3P4I A;  1SS6 A;  4WQ5 C;  1OKJ A;  2F9T A;  1NLV A;  4PL8 A;  4BRK A;  1BWF O;  5ELZ A;  1ZC6 A;  3UE5 A;  1NGD A;  3VF4 A;  2GWK A;  1XC3 A;  3ATU A;  1BA0 A;  2QWN A;  3FLC O;  4IDH A;  4MLH A;  1Q7Y O;  3T69 A;  4BRG A;  2WC9 A;  3ENO A;  3TSQ A;  5AQN A;  5BRD A;  3H45 C;  5ADX H;  2EWS A;  2GWJ A;  3SMS A;  2PAV A;  4BR9 A;  5M1N A;  1JCG A;  1Q81 O;  2GTD A;  4BR4 A;  5JVH L;  5M1P A;  4CZE A;  4C1N I;  2ASO A;  3N4Q A;  1GLA G;  1MWK A;  1WUA A;  3P31 A;  5FPM A;  4NB4 A;  4BR2 A;  1DT9 A;  2NRT A;  4JKC A;  2QWP A;  5BPM A;  2V7Z A;  3GOI A;  4EAH D;  3A5L C;  4LC9 B;  2OTL N;  4U7B A;  3M5R A;  4BR5 A;  3QBW A;  4WQ4 C;  2CGL A;  2FF3 B;  4H0P A;  2JWK A;  4QS7 A;  4J8F A;  1TYQ A;  4DKW A;  3MN5 A;  5GAD P;  2QM1 A;  2WBN A;  3WXJ A;  2ZJR L;  4BRH A;  2VGM A;  3BP8 A;  1KAZ A;  3VET A;  1HJO A;  3AAP A;  4JD2 B;  2E2N A;  3WQT A;  3ZX0 A;  1TUU A;  4CJ7 A;  4BRI A;  2PFU A;  4ILG B;  1BOT O;  1XQS C;  4MLE A;  3ENH A;  4PKH A;  2BTF A;  4PKI A;  4YOU A;  3ULE B;  4ISE A;  4CZK A;  5C12 A;  1W97 L;  4K25 A;  1YJN N;  2VCP A;  2A40 A;  1HPM A;  4BRA A;  4DHY A;  1ATN A;  2QI2 A;  2IIR A;  3VMF B;  4BRD A;  3P39 A;  4YOT A;  1YIJ N;  3P38 A;  4JK9 A;  5B8H A;  2I7P A;  2HF4 A;  3IUC A;  1NGJ A;  5BRH A;  5FPD A;  1KAY A;  3MDQ A;  2D1K A;  3CHW A;  4BRM A;  3CJ9 A;  3CPE A;  3E9O A;  2QWL A;  3E9L A;  3O9R A;  4BR0 A;  2ZJP L;  2CH6 A;  5AQL A;  3KZB A;  1YF5 L;  3W0L A;  1P8Z A;  5AQS A;  5H1S Q;  5AQI A;  2D0P A;  2OTJ N;  3TTC A;  2YHY A;  2P9P B;  2V52 B;  4FPA A;  3VPZ A;  1JCE A;  1TUY A;  4XH5 A;  3ID8 A;  3C7N A;  5EVZ A;  3D2F B;  1M1K O;  3FR0 A;  2IVP A;  4H5T A;  3H1V X;  1YHQ N;  2AP1 A;  3WXL A;  4CZJ A;  3SAG A;  3CJ1 A;  1NGE A;  2HOE A;  2NRW A;  2VYP A;  3O8M A;  3H1Q A;  3QDK A;  4YOV A;  3VTH A;  3SBT A;  5GIP A;  3O1W A;  4JKD A;  3G4S N;  2F9W A;  4A2B A;  2P9S A;  3CIP A;  3R9P A;  4ILJ A;  4IOX A;  5LJW A;  3B8A X;  5CHI A;  4YOY A;  4KH6 A;  3EO3 A;  1KC8 O;  3OHR A;  4FWM A;  4WFN L;  2NNW A;  2GEL A;  3UKU B;  3R1X A;  4MDB A;  4IEE A;  4A2A A;  3CCQ N;  2UYT A;  2F7T A;  3MN9 A;  1V4S A;  3KHY A;  2P9K B;  4JKE A;  3WEE B;  2E1Y A;  4JEP A;  3LDL A;  3WQU A;  3A5N C;  2D0O A;  3HBT A;  1V4T A;  2A42 A;  3GDQ A;  1K73 O;  3DAW A;  1VQ8 N;  4CZI A;  4JKA A;  4QS9 A;  1VQO N;  4ISG A;  3LDN A;  4WQ5 A;  4CBU A;  4K41 A;  4KBO A;  5JMV A;  4PHT X;  1S22 A;  4IEI A;  1E4G T;  3KVG A;  3QFU A;  5AQT A;  3OBY A;  3ZX3 A;  3H3N O;  3IKM A;  3OBW A;  2H3G X;  4JD2 A;  5E26 A;  3ZEU B;  4RWT A;  1VQN N;  1VQK N;  3IDH A;  5BN8 A;  2ASP A;  3FFK B;  4BG9 A;  4A61 A;  4FWR A;  1P90 A;  1SAZ A;  4CZG A;  3U9Z A;  3ULE A;  2BH1 A;  1K8K A;  3MN6 A;  1VQ9 N;  4BR7 A;  3KWI A;  5FPN A;  1RGI A;  2NRV A;  3Q7B A;  4DB3 A;  3VGL A;  2D4W A;  3L4Q A;  4BRO A;  2Q97 A;  4M7Y A;  2E2Q A;  3C65 A;  3O1B A;  4WQ4 A;  3WT0 A;  3E66 A;  4FWO A;  2NRX A;  5GAG P;  4BC3 A;  3K9J A;  3PLA A;  3O80 A;  4JK8 A;  3MX2 A;  3C6A A;  4WCE L;  1J6Z A;  3I33 A;  4GNI A;  3U9D A;  3CCV N;  2V7Y A;  1KXP A;  2W41 A;  1N8R O;  4B9Q A;  1RDU A;  2FLO A;  3CJ7 A;  3VEO A;  4BRF A;  3F9M A;  1GLF O;  3FE1 A;  4FL9 A;  3SLC A;  5F0X A;  3CPW M;  2AA4 A;  4CZH A;  1Y64 A;  3LDP A;  3QIC A;  5AQO A;  4FVU A;  3ATV A;  5KPZ A;  2KLA A;  2A5X A;  2Q0U A;  3CQX A;  3VEX A;  4BGB A;  2JWL A;  4A57 A;  4E1J A;  1HKC A;  3RVC A;  3L4I A;  3EL2 A;  3EN9 A;  3LM2 A;  4YOX A;  3PIP L;  5F1X A;  1KD1 O;  1Z6R A;  2HBK A;  3QBX A;  1CZA N;  3MCA B;  2HBL A;  3H46 O;  3VTI A;  3HZ6 A;  1NGC A;  3SJH A;  4BRC A;  3UKU A;  3G25 A;  3LL3 A;  1VQ6 N;  4PKG A;  3CCM N;  4GV9 A;  4UY8 O;  2FF6 A;  3AGR A;  1NGA A;  3LDO A;  3R3L A;  3WEE A;  4A5A A;  3VGM A;  3S41 A;  5AQP A;  2HBJ A;  4FWP A;  4CD3 A;  3FZH A;  2PBD A;  3L0Q A;  1ATR A;  3HRG A;  5BPN A;  1U6Z A;  2VGN A;  5AR0 A;  2RHK A;  4B1Y B;  1VAZ A;  3GBT A;  3U8X A;  3HOS A;  5EOY A;  4L3Q A;  3MK6 A;  3MWP A;  2FSN A;  5AQQ A;  3FGU A;  3O08 A;  2VWB A;  5GAH P;  1EO1 A;  3FZF A;  1K8A O;  4I6M B;  4XEI A;  3TPQ A;  3ZEU A;  1MDU B;  2CH5 A;  1W2B M;  1KQS M;  3CCS N;  4JKF A;  3DXK A;  3MCP A;  1GLE G;  3SAF A;  1R59 O;  2YI1 A;  2A41 A;  3CJA A;  3D7E O;  2QWR A;  1Z05 A;  2YHW A;  4BC4 A;  2E88 A;  4FWS A;  2A3Z A;  4JNE A;  1NJI O;  4JHD B;  5JIC A;  3F2K A;  1YIT N;  4IO9 L;  3FZK A;  5AQW A;  1T6C A;  4R79 A;  3LDQ A;  1T44 A;  4XH1 A;  4YOW A;  3EKS A;  1LOT B;  4H5R A;  3CJB A;  4G9Z A;  4B1W B;  3BF1 A;  1ZXO A;  1YUW A;  3ZET B;  3VEY A;  4IOC L;  1HKB A;  2IVO A;  5M1K A;  1O13 A;  1NGB A;  3F5T A;  4WF9 L;  4HWI A;  4Y0W A;  2W40 A;  4IJA A;  2QW9 A;  2CGK A;  4JK7 A;  4MO5 A;  3EE8 A;  3TSP A;  4CZL A;  1EQY A;  3CQY A;  4XH4 A;  3DWL A;  5E84 A;  3EKU A;  1BUP A;  5AQR A;  3TTD A;  3D2E B;  3HM8 A;  1HKG A;  2YX6 A;  4JKB A;  5JLH A;  4B1X B;  2WUS A;  1HLU A;  5AQG A;  4H5N A;  3VEW A;  5JLF A;  5AFU A;  5BRF A;  5AZJ B;  2CGJ A;  4JKG B;  3OA9 A;  5BPL A;  2Q1N A;  3CCL N;  3SAH A;  4FWQ A;  4OO1 J;  4H5V A;  4BQL A;  4BRP A;  1BO5 O;  1SQK A;  2FSJ A;  3O9Q A;  4FWN A;  3RSE B;  4JN4 A;  3FZM A;  4K42 A;  4A5B A;  1YJW N;  3NVM A;  3D6R A;  2NRZ A;  1YVN A;  3ZX2 A;  3CME N;  3KWG A;  5LY3 A;  3CCU N;  3CJC A;  5AZI B;  3VES A;  3VEN A;  5JVG L;  1VQ7 N;  2P9I B;  1NGH A;  3CD6 N;  3O6W A;  5AQH A;  3FZL A;  1M90 O;  5C0Y A;  4BRE A;  2HF3 A;  3EE9 A;  1QQM A;  4MDA A;  3CC4 N;  3CER A;  4O8K A;  4BRL A;  1VQL N;  3H6E A;  3NMU A;  4FOI A;  2ASM A;  5BRE A;  5AQV A;  5KPT A;  4RCH A;  3DJC A;  4B1V A;  4FOE A;  1QQO A;  2QWQ A;  4OPH A;  3ZYY X;  3Q7C A;  4H0T B;  5M1O A;  3T7Z A;  2QEX N;  4BY9 C;  4CZF A;  1VQ5 N;  3QML A;  3H3O B;  3HOT A;  4FWL A;  1QVG M;  1GLJ O;  4AM6 A;  4GY2 B;  4B1U B;  5EY4 A;  2GUP A;  2P9U B;  3WUH A;  3CMA N;  3J7Z O;  4BG8 A;  3SK3 A;  2QTD A;  5GIO A;  1X3N A;  3A5M C;  4JHD A;  5C2D A;  2P9P A;  2BUP A;  3WXK A;  3VER A;  2YHX A;  5GIN A;  4FPB A;  5AQY A;  2E20 A;  3D2F A;  1WOQ A;  1KAX A;  3AY9 A;  4RTF D;  2NRH A;  4BC5 A;  3JS6 A;  3ZET A;  1QHA A;  2A6A A;  4K43 A;  1U2V B;  2KKZ A;  2ZJQ L;  4BVP A;  3W3D A;  2FSK A;  3M1F A;  3J8A A;  4IWV A;  1GLD G;  3VEZ A;  5CR4 A;  1BG3 A;  3BUZ B;  1X3M A;  3WXM B;  4C23 A;  3AAR A;  3BF3 A;  4YOR A;  2P9S B;  4EHT A;  1VQM N;  3VEV A;  3D2E A;  1XUP O;  4WFA L;  4H5W A;  3K9K A;  3KK7 A;  1ILY A;  3CCR N;  4GV3 A;  4GV6 A;  4DQ8 A;  5EXW A;  3MMV A;  4IOA L;  4H0X B;  4BC2 A;  5AFU H;  4NLC A;  3CET A;  2P9N B;  4A62 A;  4F9O A;  1RDW X;  5AZJ A;  2GX9 A;  2P9K A;  4HTL A;  4JKG A;  5AQU A;  2QA4 N;  1K9M O;  2IVN A;  4NLB A;  1QQN A;  4C1N K;  1IG8 A;  5AQZ A;  3PIO L;  3LM9 A;  3E9P A;  4YDU A;  3NVK A;  3QB0 A;  4CD1 A;  3RSE A;  3MN7 A;  5M1Q A;  1T3V A;  1NM1 A;  5AQM A;  1G99 A;  1Q86 O;  3WXI A;  3GE1 A;  1LCU A;  1C0G A;  2J4R A;  4H0O A;  4EFH A;  4WFB L;  2NZT A;  3VGK A;  3EZW A;  4M63 C;  5AZI A;  3G6E N;  1QZ5 A;  1BA1 A;  1DEJ A;  4IFE A;  5I9E B;  2P9I A;  1JJ2 M;  1Q18 A;  3CC2 N;  3U4L A;  3MX5 A;  4H03 B;  2ZGY A;  4IJN A;  3DXM B;  4FO0 A;  3ENB A;  4BVO A;  3I56 N;  2HMP A;  1QZ6 A;  3AAQ A;  4FSV A;  3TTF A;  4JAX A;  3O4W A;  1YAG A;  4B1Z A;  1YXQ A;  2P9L B;  2Q36 A;  1BU6 O;  5KQD A;  1K8K B;  3A5O C;  2FXU A;  1NGF A;  2E8A A;  5EX5 A;  3UKR B;  1SZ2 A;  2Q2R A;  4WYB A;  3R8E A;  5KQ8 A;  3CI5 A;  5DM7 L;  4YDU C;  1YI2 N;  1NGG A;  4JKH A;  5CE3 A;  3M3Z A;  2I7N A;  3CF5 L;  4QS8 A;  2P9U A;  1S72 N;  4KH5 A;  3VF2 A;  4CBX A;  5FPE A;  4FWK A;  4IXC A;  2OAN A;  1DKG D;  4IZ9 A;  4EIA A;  3MWT A;  4O5F A;  1Q82 O;  2KHO A;  5AQF A;  4BRN A;  2QWO A;  5AQK A;  3CCJ N;  4U67 L;  1NWK A;  2QXL A;  5ADX A;  2YCH A;  3SMP A;  1D4X A;  3JXU A;  1MWM A;  2ITM A;  1U2V A;  4AF1 A;  3VF6 A;  3E1Y A;  1QVF M;  3IMX A;  2RE2 A;  2DPN A;  3O9S A;  1C0F A;  1GLB G;  4NO7 A;  2Q0R A;  5F2R A;  5C10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...