5C2DA

K428a mutant gp2c of large terminase subunit from bacteriophage sf6 with calcium
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
241
structure length
227
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
total genus 84
structure length 227
sequence length 241
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c2dA00
5M1QA 5M1NA 5M1PA 5C12A 4IEIA 3C6AA 5C10A 3C6HA 3CPEA 5C2DA 5C15A 5M1OA 4IFEA 5C2FA 5M1FA 5M1KA 4IDHA 4IEEA
chains in the Genus database with same CATH superfamily
4CJQA 1K73O 2DFFA 3P83D 3CYMA 4KHWA 4QS7A 4MQ3A 4EP5A 2A3ZA 1FKOA 5AQPA 2P9NB 3VGMA 3TTDA 3AVLA 1RDAA 2ZE2A 4LSNA 3OHRA 4BR2A 2E6LA 5TKYA 1HQUA 4CBXA 3K58A 2O4GA 3OYMA 5DMRA 2P9UB 2BTFA 4DQ8A 3ISNC 1TL1A 1ZXOA 4Y1DA 4J2BA 2QXFA 4FO0A 1ZBSA 4KHSA 3WEEB 4MLHA 2WBNA 3EN9A 3T7ZA 3IG1A 1WBBA 1BGXT 5AQQA 4DSLA 4LF6K 2QKBA 4FLZA 1QQOA 4F8RA 4FWRA 4CEQA 1DGKN 4GKKK 4JKGB 1RT7A 3SBTA 1T05A 3RMDA 4Y0WA 3G6EN 5JVGL 4OKKA 5AQRA 4B9SA 4CW7B 1BA0A 4PKHA 5HRSA 4DG1A 3O4QA 4O8KA 3QICA 2IVOA 4JKAA 1TKZA 2DFHA 2CH6A 3O9RA 5CR4A 1RT5A 4RW7A 1RTJA 2QWMA 3EYZA 2P51A 2Q0RA 5GINA 2JGUA 4E3SA 4CK2A 4CGIA 3PSFA 4CF1A 3ALYA 1YHQN 1ZC6A 5CYQA 4E89A 4DQSA 1SL1A 2IIRA 3PIPL 1UOCA 1VK0A 1HX1A 3VF6A 3ZSRA 3MEGA 3O3HA 4DR5K 2O8CA 3DLBA 2QWRA 5BRDA 1K9MO 3BZKA 3ZT3A 4CZEA 4WFBL 4O5FA 2A5XA 4LSLA 3CPEA 3CIPA 1ASVA 4M7YA 1VQ8N 5M1NA 5JICA 4W5NA 2Z1GA 3CCVN 4IOCL 4B3SK 4OGEA 3A0IX 1TVRA 3WNEA 3KTQA 4DSJA 2UXCK 1VSFA 3QINA 4E1NA 4FWNA 4Z4EA 1JLQA 3UKUB 3G4SN 4FJNA 1B9DA 3KWGA 1QZ6A 2XY6A 1TK0A 4KREA 1NMDA 3H46O 3FZKA 3ENHA 1U47A 4BGBA 2GELA 1NK0A 4IEEA 1NJIO 4WYBA 4BQLA 3ULEA 1KVCA 3DYAA 4XH5A 3D45A 3J7ZO 4CFCA 1VQLN 1XHXA 3HPGA 4BE2A 3DWLA 3F5TA 1WLJA 4DTPA 2CH5A 1BUPA 3P5JA 4AHCA 5JLFA 1Y64A 4BGAA 4JS4A 1NJYA 4O44A 3JS6A 1OVYA 4U67L 1DEJA 4KHQA 4JRPA 5C24A 3QESA 4KBOA 4KHPK 3VEYA 2HVHA 2Q3SA 5GAGP 3E01A 2HHXA 4N41A 3ZT2A 5KGXA 3AVAA 3OW2M 4Z4IA 3HO1A 4KTWA 1VHXA 3B6PA 2G8WA 4JN4A 1SV5A 5JS2A 4IFEA 1BG3A 4DTMA 3VGLA 1WSFA 2X74A 4OKJA 4E0DA 4JI1K 5B8HA 3D0PA 4O8UA 5CZ1A 2E2NA 1IV0A 4DWIA 2D0OA 4FK4A 3MN9A 4BC5A 1IKWA 3AVMA 5KI6A 2P9SA 3A5LC 3K57A 4DUYK 4BRHA 2QA4N 2OYQA 2PZSA 3E1YA 4BRMA 1NK7A 3SYZA 4CJSA 3UKRA 5EY4A 1D4XA 4CFAA 5AZJB 3OJUA 3D2FB 2YNIA 2DY4A 3D2EB 1WSIA 2HHQA 4YOVA 2OPRA 3VA0A 1HRHA 4BDZA 3N4PA 1Y97A 3L2VA 1HKBA 2WC9A 2HHTA 1KFDA 1TUUA 3RRHA 1NGAA 1SUQA 2P1JA 3CHWA 4LFAK 3DXKB 1Q82O 2P9LA 4OX9K 3ZETB 4CHZA 4DSEA 3S3OA 1L3SA 2HB5A 5LL6Z 4DTOA 1RBTA 1RBUA 4AF1A 4ID1A 5EVZA 3WNGA 3OYJA 4I2QA 1EP4A 3VTHA 4KI6A 4LF8K 4JEPA 4KFBA 4HTUA 3CCRN 2P9NA 4CHPA 5FPMA 2QWNA 3SAGA 3CJ1A 4BG8A 3J8AA 3CMAN 3S3MA 1NGHA 4CHQA 1O13A 5FLXO 2UUBK 2A6AA 2P9UA 3G25A 4CCHA 3DLGA 1KLNA 5LJWA 1ITGA 5SWMA 2IGIA 3AAPA 2OANA 3DLLL 3KWIA 1HNXK 3LDQA 1YI2N 3WEEA 1S1UA 3GOIA 4BRCA 4JAXA 2Q0UA 4CEAA 1JLBA 1GOAA 4JK8A 2O8BB 1EO1A 4L3QA 5HRNA 2O8DB 1HLUA 1VQPN 3NH1A 4CZGA 3RMCA 4FOIA 4CJVA 3OYEA 4JKGA 3I33A 1T7PA 2W41A 2XY5A 3S41A 3OYHA 3ENOA 1HNWK 3VA3A 2W6LA 4IXCA 2BE2A 4M42A 2EWSA 2EHGA 3THYA 2NUBA 2HNDA 4EFHA 3OJSA 5FPEA 2KFZA 2YCHA 4FPBA 4KH6A 3VQDA 4BRAA 1S9EA 2KW4A 3K2PA 1E4FT 4QCLA 1VSIA 2OZSA 4DCHA 1CXUA 1TKXA 3AO5A 3CJ9A 3SMPA 2IAJA 4DLEA 4YFUA 3I0SA 3KLEA 3CFPA 3D6RA 4H0VB 1VRUA 2ITMA 1NK5A 4JK7A 3U9ZA 1U6ZA 1QVFM 1N36K 2F8SA 3KIOA 3K9JA 4IG0A 2XO7A 1WN7A 4WQ5A 1O1WA 1S22A 1TUYA 3VN5A 4FLVA 1QZ5A 2X6NA 3HBTA 4H0PA 1TAQA 3ATVA 3KD1E 2I5JA 2HSTA 4A62A 1HYZA 3K5NA 2VYPA 3PX6A 1LWEA 5FROA 3UKUA 4DU1A 4CBUA 3V6DA 5I3UA 4B9LA 3SQ1A 3THXB 3BY5A 2J4RA 4MDBA 3C6TA 3DI6A 4BRIA 3MXJA 1EETA 3UIQA 4Z4GA 3RMAA 3TSUA 4CI6A 1KAZA 1QSYA 3HM8A 1RT6A 1ZYQA 1K6YA 4H0OA 4H0YB 3RTVA 2QTDA 3I0RA 4CD1A 3BGRA 2PFUA 3ATUA 2BGGA 3OYBA 4BREA 1MDUB 5J2NA 3C7NB 1KQSM 1C0GA 1ZBFA 4FJXA 4BWMA 3KLGA 1RT4A 5I42A 3H3NO 2RPIA 5IWAK 1RT1A 4BROA 4TSXA 4CERA 4YOYA 3SK3A 3UE5A 3MEDA 3CFOA 4EP4A 5M1QA 1NM1A 5HOOA 4DS5A 3CCEN 4V19S 3SCXA 4FOEA 4JI7K 4DHYA 1GLAG 3MMVA 4B08A 1YIJN 3AVIA 4CK1A 4DTUA 1BDGA 4WQ4A 1T3VA 2FLOA 2ETJA 1KD1O 4XH4A 3VQ9A 3VTIA 2PBDA 3OYKA 1YVNA 1CXQA 2IS3A 1IO2A 1XMQK 4Z0UA 2ZQBA 2D1KA 1XNQK 3LL3A 3VEXA 4FZZA 3MECA 3MDQA 2R7YA 3JYTA 4L8RB 4H5WA 5AR0A 3VQ5A 1HYVA 5AQVA 3SMSA 5AZJA 1YF5L 3HI0A 3D2FA 3MX5A 5AQHA 3HZ6A 3D2EA 1ATRA 1RBSA 1U2VB 2NRRA 4DU3A 5AQLA 4DV4K 4B1WB 3MN5A 3VESA 3HP6A 1N32K 2ZJRL 3FR0A 2VWKA 3A5MC 1TV6A 1RDBA 1RCHA 3DXKA 4YHHK 3ZETA 4W5TA 5AQJA 4KRFA 3ID6A 5C10A 4A5BA 4B3RK 3ZX0A 4YDUC 1S1TA 5KQ8A 3ZSQA 1FXXA 3HYFA 4G9ZA 5F1XA 3O3GA 3SV4A 5M1OA 2Q31A 3OYCA 3SQ4A 3ZCMA 4E7IA 5M1PA 4DV1K 2LSNA 1S72N 4YOXA 1M90O 3NGYA 2RHKA 4LF9K 5AQYA 3RMBA 3DM2A 5BRHA 5JLHA 1NKBA 4CF8A 3CD6N 2A1RA 1WSJA 3S9HA 4GNIA 4ILHA 1C1AA 3SI6A 4FLWA 4IKFA 3LANA 3TSPA 4HHTA 4JI3K 1VSHA 4BR9A 4XIUA 1HUXA 3VERA 2DFEA 1GOBA 4IZ9A 4HUFA 4LF7K 4M63C 4MFBA 2O8DA 3VGKA 1GLEG 3IS9A 2FC0A 4QOZB 4FYDA 4LFBK 4CGGA 2DPNA 2Z1HA 1TK5A 3U8XA 3QERA 2IVNA 4PKGA 4CFDA 1JJ2M 2G8VA 3SBGA 5J2MA 1CLQA 5AQMA 3TANA 1KXPA 1VQ5N 3QBXA 2ZGYA 3HSTB 4JKFA 3NAEA 3U6FA 1LWCA 3OBYA 4C8LA 4YDUA 1OKJA 3I56N 3L3VA 1NNEA 3PUFA 5JVHL 1C6VA 2I7PA 3CQYA 4J8FA 3O80A 2G8KA 3VQ7A 3LZIA 1C1CA 4JI0K 1R59O 4K25A 1N34K 2G8UA 1JLGA 3GBTA 3M8SA 4IDKA 4Z4FA 5DM6L 5JS1A 3AY9A 3BF1A 4DTXA 1X9MA 4M7XA 1BL3A 1ZBUA 2YHWA 4FPAA 4KI4A 1VSLA 1BI4B 1NGDA 1X3MA 2B5JA 3W0LA 4B9QA 3CCMN 3BUZB 2FF3B 4R79A 3THXA 4B1XB 1W9HA 2HMIA 2VCPA 1L5UA 1NK6A 4RWTA 3JXUA 3VOVA 4NXNK 4OLBA 3GDQA 2ASOA 3TAMA 4KHUA 1WAJA 1JXEA 5IT9O 4C1NK 1RNHA 4J2EA 3NGZA 2V7ZA 1HKGA 4B1UB 1ZBHA 3VQAA 4B1YB 3C7NA 3CJCA 4G1QA 3OYLA 4BR5A 3I55N 3LDSA 4FZYA 2NRHA 3G10A 4CGHA 1SQKA 3THYB 1JCFA 4CF2A 3G71N 4JNEA 3VPZA 4CE9A 4AHRA 3LWMA 1NGEA 2ATQA 3CFRA 4DSKA 4KAZA 2YNFA 1NK8A 2Q1NA 3ZSWA 4FZXC 3HRGA 4IFVA 4A2AA 3U3YA 3O8MA 1Q86O 2HOEA 3OY9A 3L2QA 4RW9A 4DQPA 4EZ6A 1HQEA 1S1WA 4FWKA 4GV6A 5CHIA 3J7YP 1L3VA 1KAYA 3L6QA 3TTFA 4N76A 3IKMA 3CC4N 3AO4A 4OPHA 4FW1A 1GLCG 1Z6RA 1U2VA 4KTZA 3T1HK 2YKNA 4X64K 1XQSC 4J2DA 2DTUA 1BOTO 2HNZA 4B1ZA 3ZEUB 3J7AP 2QKKA 5KGWA 5HROA 3CETA 4OJRA 3WQTA 1YUWA 4CJUA 3O9QA 2G8HA 4JI5K 4GV9A 3R8EA 4FJJA 4Q0BA 3UB5A 3C94A 5AQXA 4KO0A 3HTVA 3L4IA 1W7AA 4CJWA 4CZJA 5C25A 2QXLA 3SUPA 2D0BA 3WUHA 2Q36A 4ILJA 3V1RA 1VAZA 4FJLA 1KAXA 4C1NI 3K9KA 2HHWA 1L3UA 1X9SA 5BPLA 3QO9A 2VG7A 5F0XA 1NOZA 3WXJA 1U45A 5CYMA 4PQUA 1KVAA 3RR8A 4F2SA 1E4GT 2HBMA 4AM6A 3U3GA 4FJHA 4CJ3A 3OYAA 1J5EK 4FJKA 4CEBA 3KK1A 4ELUA 4DV3K 5EU7A 2OCEA 5BREA 3PY8A 4Y1CA 4GMJB 2HBJA 2WUSA 4CZHA 1HKCA 2D4WA 1RFQA 4DSIA 1RTIA 1QVGM 5C42A 4B9VA 2QWOA 4JHDB 4N5SA 4BE0A 2NRVA 4X66K 4WFAL 4DFJA 2QWQA 3E9PA 4DTRA 1BU6O 2P9KB 1GLDG 4DV2K 1VSJA 3AA2A 1C0TA 3AA4A 3A5NC 4C8OA 4CZLA 3TI0A 3NCIA 1QSSA 3CC7N 3CQ8A 3CJAA 3M8PA 3LP2A 3BP8A 1J54A 4BRKA 3EZWA 2NRTA 4PUOA 3TWHA 3TARA 3NF7A 4H03B 4FM2A 4KTQA 1VSDA 1A5WA 2GX9A 4E7LA 3ZT1A 4CEFA 4DSFA 4IFYA 4KB0A 3R6MA 1J53A 4RW8A 4KPYA 3VENA 1WSHA 3HVTA 5LMNK 1BI4A 4OVLA 1IG8A 1WNSA 3CCJN 4M45A 1TYQB 4LY7A 5GIPA 4AILC 3MWTA 2XY8A 4JI4K 3AO2A 1GLBG 3VQCA 4Z4CA 2B6AA 1NGJA 1Q9YA 3QEIA 4PWDA 4WQ5C 3SLCA 3OYDA 4KHYA 3O9SA 4BACA 2F9TA 3IAYA 3PX4A 1ATSA 4PKIA 2IDOA 5FRNA 1HR0K 1KLMA 3FZMA 3VQEA 5GAHP 3OYNA 4DTJA 4FWMA 1LCUA 4K8ZA 3MK6A 1UWBA 4C8NA 4BRDA 3LALA 3LM9A 4E1MA 4E19A 1NGGA 1WSGA 5E41A 3WT0A 2UU9K 3FLCO 4FW2A 1VQ6N 5KPZA 5D3GA 4IG3A 1SL2A 1U04A 3RRGA 3OS2A 1VQ4N 3QIOA 4BE1A 4B8AB 3NHGA 4UQGA 1G15A 4X62K 4FWPA 1FW6A 5LY3A 3HPOA 1EQYA 2VGMA 3DMJA 4ISFA 1KC8O 2JWLA 1LAVA 3GG4A 1NOYA 4AQYK 1S9GA 2GTDA 3M5RA 5FPNA 4A2BA 4FJMA 4R5PA 1WAFA 3WXLA 1W97L 1NJZA 3CM6A 2Z1JA 3AAQA 1SKWA 2EX3A 1KRPA 3LDNA 1SS6A 1GLFO 2HHHK 4H0XB 4M3TA 3ZX3A 2H3GX 3OTOK 1YTAA 3DJCA 4LC9B 1JKHA 4O0IA 4JYAK 3L4QA 2AJQA 2RE2A 3O9TA 1U48A 4WQ4C 4ELTA 4CF9A 4DB3A 3I8DA 2O4IA 3KKSA 2OTJN 5J2QA 3NH0A 4B8CA 3EL2A 2ASPA 3ZEUA 1HYSA 3L2UA 3O08A 3JSMA 4DR1K 4BR0A 2RN2A 3L2RA 2VG6A 1D9FA 4O0JA 3M8RA 1MA9B 3CM5A 3KK7A 3A5OC 2YHAA 2P5GA 3VEZA 3THVA 1OH8A 2VWBA 1BIUA 2W6KA 4FWSA 4FJIA 2XRIA 3HL8A 3CCUN 1UA1A 2QEXN 1ZBIA 2YJEA 1Q18A 5HRPA 3AVGA 4CHNA 4CZFA 4NCGA 4K0KK 3SJHA 1LW2A 1S6QA 3TPQA 1TKTA 3ITHA 4M3ZA 4BY9C 4KH5A 4OPKA 4ISGA 2UXDK 2PY5A 1OH6A 5FPDA 3AVBA 1P90A 2E88A 3BZCA 1QS4A 4ZTJA 4JKBA 4CK3A 4DV7K 1BISA 3PV8A 3NF9A 4O4GA 2OPQA 1HJRA 3AVFA 1VQ9N 3FE1A 1BHLA 1QHTA 4LF5K 1HPMA 4FLTA 2E2QA 1FK9A 3AV9A 4JI2K 2ZWHA 4BRNA 3EKSA 3PLAA 5AZIA 4RW4A 3TAFA 2HMPA 2HNYA 3ZSOA 3C0BA 1J6ZA 4BQZA 2GV9A 5C15A 3DOLA 3JAMO 3TR8A 4HCBA 1T6DA 2ZD1A 4JKEA 3FFKB 3OA9A 3FZHA 3QMLA 2FSKA 4JHDA 4DUZK 3I8BA 1CZBA 2E6MA 5AQOA 4IJNA 4O5BA 3LAKA 5BRFA 2OPPA 2P9KA 5BN9A 3K0SA 3G0ZA 4IJAA 2V7YA 4LF4K 3F9KA 2A40A 4CJLA 4CF0A 2F9WA 3CJ7A 4CD3A 3VQPA 3OYFA 4IO8A 1S1XA 3LPTA 1NK9A 4DF8A 3S3NA 2HHUA 3PX0A 2Y1JA 2BUPA 4DFMA 5AQZA 3QFUA 4H4OA 1SKRA 1J5OA 3PIOL 1YJNN 2KQ2A 1X3NA 2D0AA 3OS0A 4Z94A 3T69A 4BC3A 1NK4A 1SKSA 2HHSA 3E9OA 5KQDA 2B4JA 5C2FA 2X6SA 1N5YA 1YVUA 2Y1IA 3KLHA 2AA4A 3SQ0A 1S1VA 5LJVA 3ZLJA 1TYQA 3EE9A 3V9SA 3CG7A 4ISEA 1NLVA 5AQTA 1W2BM 5C2DA 2E2OA 1IKVA 3LPUA 5DM7L 2YI1A 4CHYA 2OTLN 3ENBA 1IG9A 4OLAA 4W5OA 1K8KB 2FBXA 1C1BA 4YOTA 5KPRA 4CJPA 2QK9A 1BQNA 3QEWA 1EWRA 4CVNE 4LH5A 1NMNA 4K43A 4F9OA 3NGIA 1T03A 3BEXA 1W0HA 4BC2A 2E1YA 3VQ6A 3MXIA 1UAXA 4YY3K 1RGIA 4DKWA 1T6CA 4JV5K 2P9IB 1KTQA 5CZ2A 3WXIA 3RR7A 4KB1A 5BR9A 4U7BA 3PO5A 3A8YA 3H1QA 4JS5A 3LP3A 4DQIA 5BPMA 3AVJA 4YNQA 1JL1A 1QTMA 5ADXA 3ZSXA 2VGNA 4CECA 2F8TA 4A59A 4GKJK 1DLOA 2GWJA 2OZMA 1OH5A 4B3TK 2XY7A 2JLEA 4B9MA 3V4IA 4WFNL 4HUEA 1B9FA 4BR4A 4DQQA 3ZSYA 3SPZA 2FF6A 4DLGA 2NRZA 3DLKA 2D5RA 5AQUA 4DF4A 3H1VX 3V9XA 1XC9A 3V81A 3EEQA 5HRRA 1HMVA 4BRFA 4NLBA 1IKXA 3QLHA 3QEVA 4IOXA 4CJFA 3O3FA 3J80O 1IBKK 2RKIA 4JKCA 3CERA 4H5VA 4B3OA 4IEIA 3HP9A 2W40A 4IO9L 4F2RA 4CJTA 3HPHA 3WXKA 4AHTA 3OS1A 2AP1A 3VF4A 3THWB 3RWUA 1DTTA 1RBRA 2XHBA 3EE8A 1ASUA 1NWKA 3GL1A 4MO4A 3DLHA 5AQIA 1WUAA 5DK5A 2VG5A 3H45C 3VQQA 1B92A 3CJBA 4ELVA 3MN6A 4FJ5A 2E8AA 1LW0A 1NGCA 5FRMA 2O8EB 3D7EO 2O8FB 2YNHA 1I39A 2I7NA 2YHXA 4CHOA 1I94K 3O9UA 3L2WA 4PL7A 4M3XA 4CZKA 1JLAA 3QEPA 1FKPA 1Q8IA 2P9PB 4BRPA 1JLEA 3LDOA 1HPZA 1L3TA 3T19A 1HNIA 4FLXA 4Q5VA 3KD5E 5AFUA 5GADP 4EAHD 2V51B 4NO7A 1RDDA 4BVPA 4BDYA 1IH7A 3L3UA 5KRSA 4NXMK 3RSEB 4NLCA 1F21A 4CGJA 3AO3A 5E26A 3Q7BA 4CGFA 3CF5L 4PL8A 5M1FA 4KV8A 1KVBA 3R9PA 2KZMA 3KKRA 2VQFK 5ELZA 1DKGD 3K5OA 3IRXA 4JK9A 3VF2A 4EHTA 3BDPA 3BF3A 4AH9A 4I7FA 3IDHA 1CZAN 2OPSA 4KHNA 2CGLA 4F4KA 4DFKA 4A57A 3MWPA 1X1PA 5E84A 1U49A 2UUCK 3TAQA 2UYTA 4CEEA 3RVCA 1JLFA 2NNWA 5TKWA 4DR2K 4OKEA 1VSEA 2IOCA 4AHUA 3AVNA 3HSCA 3MN7A 3ZT0A 1UA0A 1JXBA 4CZMA 1BO5O 4JD2B 4PY5A 1VQON 3AARA 4FWOA 2NRXA 3E9LA 1DTQA 3C95A 5AQNA 1TL3A 4KKOA 4BWJA 1BA1A 4BC4A 2YV0X 4ILGB 3OYGA 4B9TA 2PAVA 3KZBA 2YHYA 1BCMA 1J9AA 4RW6A 2E1ZA 4CIFA 4DR6K 4NYFA 3N4QA 2ZJPL 3U9DA 2QI2A 3DLEA 1NGFA 2GUIA 4DR7K 4AHVA 3ZT4A 1NG9A 3SQ2A 2YHBA 3VEWA 3SNNA 3MEEA 1RDWX 3HXMA 5AJ3K 4FJ8A 5C12A 3HT3A 3NMUA 5F2RA 5H1SQ 1K8KA 2HF3A 3ZX2A 3IFRA 3QNOA 4CBWA 1IJJA 3O4NA 5I9EB 5AQKA 3H3OB 2W42A 4BG9A 3NH2A 2WOMA 1A5VA 4DQRA 4H0TB 2Q2RA 3O1WA 3KVGA 4I6MB 3CMEN 3FGUA 1LV5A 2NZTA 4EHUA 4N47A 3FZLA 2P9IA 4FM1A 5C0YA 1T8EA 4IWVA 3TSQA 4H5NA 3AA3A 3V9WA 1X9WA 4OPAA 5AZIB 4F3OA 3CCSN 2QW9A 3FZFA 1XC3A 3TABA 4B3MK 1YITN 1BIZA 3KJVA 4I2PA 5ADXH 4M3YA 1A5XA 4B1VA 2P5OA 4M3RA 1RT3A 1VRTA 4RG8A 3VEVA 3QFPA 2HF4A 1S5JA 1D5AA 3EKUA 4FM0A 3OVNA 4CZIA 4H8KA 4DTNA 1YXQA 4W5QA 1Z25A 3WNFA 4DV6K 4M3UA 2GUPA 1S6PA 1BCOA 4M3WA 2QWPA 1JLCA 4CFBA 3LAMA 4BRGA 4RTFD 1XWLA 1GLJO 4FWQA 4N56A 4LH4A 4FVMA 3F73A 3HOSA 1EWQA 1TGOA 5SZTA 3F2KA 4FVUA 3V1QA 4FWLA 1R0AA 5FDLA 5CE3A 3MXMA 4K8XA 1NGBA 4FL9A 1Q81O 4I9QA 2GWKA 1G99A 4HVJA 3THWA 2NLXA 2GBZA 2UXBK 2G8IA 3QETA 3H08A 4BVOA 5BPNA 3V9ZA 4A5AA 1MWMA 4JRQA 4YORA 2ASMA 1VSKA 5J1EA 5EXWA 3HVRA 5EOYA 1ASWA 4AHSA 1WB9A 1YAGA 2BANA 2BH1A 4FSVA 5HLFA 3WQUA 4JI8K 1HNVA 2V52B 2O8EA 1NU0A 2O8FA 1S3XA 4FXDA 4WCEL 1C0UA 4ICLA 5AQGA 4ID5A 3SUOA 4CJ7A 4JI6K 1U4BA 1XNRK 3SJJA 1NGIA 3OYIA 1D9DA 3CI5A 2A41A 4BR7A 1VQMN 2P9PA 1YJ9N 1RILA 1JCEA 3WNHA 3DXMB 5K14A 3SPYA 1QQMA 4XH1A 3TU5A 1ATNA 4WE1A 3VETA 1XI1A 4E7KA 3SUNA 1EXQA 3EO3A 5HBMA 4E7HA 4CJEA 4M41A 3KK2A 5AFUH 2A42A 3RSEA 3T3FA 2IVPA 3SZ2A 2E4LA 3LZJA 4W5RA 4HCCA 3CC2N 3VQ4A 4J2AA 4DS4A 5AQSA 2FBTA 2F4VK 3NBPA 3SV3A 2KTQA 3LP1A 4LD0A 3QBWA 3O4WA 1RDCA 3P31A 1VQNN 4FJ7A 3V1OA 4AM7A 4NCBA 3B8AX 2CGKA 3DOKA 2JWKA 2A1SA 3F9MA 4PHTX 1TKDA 3HM9A 1FJGK 5T7BA 3LP0A 2HBKA 1Q7YO 4CJ4A 1HNZK 4LFCK 4KH4A 4QS8A 1Z05A 4IDHA 1KSPA 3ID8A 2KKZA 3M8QA 1YJWN 2BDPA 2GEMA 3P4IA 1EKEA 4CIGA 1D8YA 3QB0A 4JD2A 4DTSA 1NKEA 4RCHA 4JKHA 3CPWM 3TTCA 4CEZA 4CIEA 5KPTA 3Q7CA 1QQCA 3O1BA 4C23A 5BN8A 1HJOA 1YTUA 3MAQA 4Z4HA 2D0PA 3K5MA 3AO1A 4GV3A 3CQXA 4HWIA 4XEIA 3LDPA 2FXUA 3OBWA 4F3TA 4DV5K 1CZ9A 1OVQA 1DT9A 1REVA 4HUGA 3EY1A 3ZSZA 3DLRA 4X65K 3C6AA 3NE6A 1OH7A 1WBDA 1ESVA 2E2PA 1E3MA 3VQBA 1NKCA 2YNGA 2HVIA 1V4TA 5AQWA 3V9UA 3NVMA 4MO5A 5M1KA 3ZYYX 2ZJQL 1NJWA 2WTUA 2PYJA 2ITGA 1TK8A 4BDPA 3K59A 5KRTA 1RDUA 1ILYA 4DV0K 2YKMA 3CXCM 3QIPA 2QM1A 4FCYA 3IMXA 4CJKA 2E20A 2HHVA 4DU4A 1LAWA 1NBWA 3C65A 1JL2A 2WONA 3M3ZA 3QEXA 4DR3K 2KHOA 4I6MA 5J2PA 3R1XA 2FSNA 1SAZA 1GOCA 4YOUA 1SL0A 1I3AA 3B6OA 3TAEA 4CEOA 3LDLA 1LWFA 4CJRA 2RF2A 5CY4A 4MLEA 5A2QO 3L8BA 1T44A 3FFIA 3KLFA 4GY2B 5KTQA 4B9UA 2KLAA 4C8KA 1RTHA 3GE1A 2D0CA 2F7TA 3DAWA 3KHYA 4JLHA 5LMUK 1Q9XA 1M1KO 4K41A 4JKDA 4CESA 3L0QA 3VQ8A 2Q97A 3IUCA 5EX5A 3T1YK 4NYNA 2G8FA 2YJFA 2UUAK 2KZZA 1GLLO 3NDKA 2O8CB 3E66A 4GVEA 1JCGA 2X78A 4DMNA 2ZGZA 4YOWA 1C0FA 1XMOK 2ZM6K 4A61A 4FK0A 2YX6A 1SZ2A 1P8ZA 2VWJA 3K5LA 4ZHRA 1VSMA 3SUQA 3AVCA 2ZF5O 1Z26A 3AA5X 3W3DA 4H5TA 4E7JA 4IBNA 3ULDA 2FSJA 3ZSVA 1WOQA 4FJ9A 1VQKN 1N33K 4B9NA 3T1AA 1H1VA 1V4SA 1MWKA 1QSLA 4K42A 2FBVA 3NFAA 3J81O 4BRLA 5AQFA 3M1FA 3ULEB 1RBVA 4EIAA 1X9JA 3KK3A 4HTLA 3WXMB 2OA8A 4CJ5A 4E1JA 4FLUA 1IBMK 4DR4K 4UY8O 4H5RA 3MCPA 4WF9L 3ASMA 2F96A 4CGDA 3AVHA 4GVMA 3QNNA 3AGRA 3LM2A 1VQ7N 3AVKA 3DXMA 3EZ5A 4QAGA 3C6HA 4ZTFA 1BWFO 4NB4A 3DRSA 4GW6A 1NJXA 2WFBA 2PYLA 1BQMA 1YT3A 2QWLA 1N8RO 1RTDA 4MDAA 3O6WA 4FLYA 3O5BA 5HP1A 3P39A 1ZBLA 3R3LA 2O8BA 5BR8K 4OGCA 1IBLK 3DRPA 1N6QA 3C6UA 4QS9A 3CCQN 3MCAB 2Z1IA 3TAGA 1QE1A 3CCLN 4DFPA 3NVKA 1IKYA 3DRRA 1C0MA 1MU2A 3H6EA 3KLIA 3AGKA 1K8AO 4FJGA 3QDKA 5GIOA 2P9SB 3P1GA 4O55A 4OO1J 1RT2A 4NCAA 4FK2A 3LWLA 2HW3A 4I9LA 3SAFA 3HK2A 5HL7L 3PSIA 3HJFA 4EZ9A 3NF8A 5GAEP 3UKRB 4PA1A 2FBYA 2IC3A 2VQEK 3TAPA 2CGJA 3SAHA 1EX4A 3PO4A 3HOTA 3P38A 2HBLA 2E5LK 3MX2A 1XUPO 1QQNA 1WSEA 5MLCQ 4CEDA 3VMFB 3M6GA 4IOAL 2P9LB 3U4LA 3VEOA 1KCFA 2NRWA 1TAUA 3A2FA 5JMVA 1QHAA 4H4MA 1LOTB 1XHZA 4C8MA 3NF6A 2KFNA 4BRQA 1KFSA 4OPJA
chains in the Genus database with same CATH topology
1K73O 4CBWA 1IJJA 5AQVA 4FWPA 3SMSA 1YF5L 3HI0A 5AZJA 4QS7A 3D2FA 3MX5A 3H3OB 3HZ6A 3D2EA 5AQHA 1ATRA 1U2VB 5AQKA 4BG9A 2NRRA 2A3ZA 1EQYA 5AQPA 2P9NB 2VGMA 4ISFA 3VGMA 1KC8O 4H0TB 2JWLA 2Q2RA 3GG4A 3O1WA 3KVGA 4I6MB 5AQLA 3TTDA 4B1WB 3OHRA 3MN5A 3VESA 4BR2A 2GTDA 3M5RA 3FGUA 5FPNA 5TKYA 4A2BA 5AR0A 2ZJRL 3FR0A 4CBXA 2NZTA 4EHUA 3A5MC 3WXLA 1W97L 3FZLA 2P9IA 5C0YA 4IWVA 2P9UB 3DXKA 3TSQA 4H5NA 2BTFA 3AAQA 3ZETA 5AQJA 4DQ8A 4OPAA 1ZXOA 3ID6A 5AZIB 4FO0A 5C10A 3CCSN 4A5BA 2QW9A 3FZFA 3ZX0A 1XC3A 1ZBSA 4YDUC 3LDNA 3WEEB 1SS6A 4MLHA 1GLFO 1YITN 4H0XB 5KQ8A 2WBNA 3EN9A 3T7ZA 3ZX3A 5ADXH 2H3GX 3DJCA 4G9ZA 5AQQA 4LC9B 4B1VA 5F1XA 1QQOA 3L4QA 5M1OA 2Q31A 3VEVA 2RE2A 3O9TA 4FWRA 3QFPA 2HF4A 4WQ4C 1DGKN 3EKUA 4DB3A 2OTJN 4CZIA 4JKGB 3SBTA 1YXQA 5M1PA 1M90O 1S72N 4YOXA 4Y0WA 2RHKA 5I9EB 3EL2A 5AQYA 3G6EN 2GUPA 2ASPA 5JLHA 5BRHA 3ZEUA 5JVGL 2QWPA 5AQRA 3CD6N 3O08A 4BRGA 4GNIA 1BA0A 4ILHA 4RTFD 4PKHA 4BR0A 1GLJO 3TSPA 4FWQA 4O8KA 3QICA 2IVOA 4BR9A 4JKAA 1MA9B 3KK7A 1HUXA 3HOSA 2CH6A 3A5OC 3O9RA 5CR4A 3VERA 4IZ9A 3F2KA 3VEZA 4FVUA 3DLLL 4FWLA 2QWMA 5CE3A 4M63C 2VWBA 1NGBA 2Q0RA 4FWSA 4FL9A 5GINA 1Q81O 2GWKA 1YI2N 3VGKA 1G99A 1GLEG 1YHQN 1ZC6A 3CCUN 2QEXN 2NLXA 2YJEA 1Q18A 2DPNA 3U8XA 2IIRA 4BVOA 5BPNA 2IVNA 3PIPL 4A5AA 1MWMA 4CZFA 4YORA 1HX1A 3VF6A 2ASMA 4PKGA 1JJ2M 5EXWA 3SBGA 2QWRA 5EOYA 3SJHA 1YAGA 2BH1A 4FSVA 5BRDA 1K9MO 3WQUA 4CZEA 5AQMA 4WFBL 4O5FA 2V52B 3TPQA 2A5XA 1KXPA 3CPEA 3CIPA 3QBXA 2ZGYA 1VQ5N 1S3XA 4KH5A 4ISGA 4M7YA 1VQ8N 4WCEL 5M1NA 4JKFA 5AQGA 5JICA 3OBYA 5FPDA 4IOCL 3CCVN 1P90A 4YDUA 2E88A 3A0IX 4CJ7A 4JKBA 4BRQA 1OKJA 3I56N 1NGIA 3CI5A 2A41A 4BR7A 5JVHL 1VQMN 2P9PA 1YJ9N 1VQ9N 4FWNA 1JCEA 2I7PA 3CQYA 4J8FA 3UKUB 3FE1A 3DXMB 3O80A 3G4SN 1QQMA 1HPMA 4XH1A 3KWGA 1QZ6A 2E2QA 3TU5A 1ATNA 3VETA 2ZWHA 1NMDA 4BRNA 3H46O 3EKSA 3FZKA 1R59O 3EO3A 4K25A 3ENHA 5AZIA 2HMPA 4BGBA 2GELA 3PLAA 1NJIO 4IEEA 4WYBA 4BQLA 5AFUH 3ULEA 3C0BA 3GBTA 1J6ZA 4BQZA 2A42A 4XH5A 3RSEA 5C15A 2IVPA 3J7ZO 1VQLN 1T6DA 3DWLA 3F5TA 4JKEA 5DM6L 3FFKB 3OA9A 2CH5A 1BUPA 3AY9A 3FZHA 3QMLA 5JLFA 1Y64A 2FSKA 3BF1A 3CC2N 4JHDA 4BGAA 5AQSA 4M7XA 3I8BA 5AQOA 4IJNA 5BRFA 3JS6A 1OVYA 2YHWA 4FPAA 5BN9A 2P9KA 3QBWA 3O4WA 4U67L 1DEJA 4IJAA 3P31A 2V7YA 1VQNN 1NGDA 1X3MA 3CMEN 4KBOA 2A40A 3W0LA 3VEYA 4AM7A 4B9QA 3CCMN 2F9WA 3CJ7A 3BUZB 4CD3A 2FF3B 4R79A 3B8AX 5GAGP 2CGKA 4B1XB 2JWKA 3F9MA 2VCPA 4IO8A 3OW2M 4PHTX 4JN4A 4RWTA 2HBKA 3JXUA 1Q7YO 2BUPA 3VOVA 4IFEA 5AQZA 3QFUA 3GDQA 3PIOL 1YJNN 2ASOA 1BG3A 1X3NA 3VGLA 4KH4A 4QS8A 4Z94A 4C1NK 1Z05A 3T69A 4IDHA 3ID8A 4BC3A 2KKZA 5B8HA 1YJWN 4BY9C 3E9OA 4O8UA 5KQDA 5C2FA 2E2NA 2GEMA 3P4IA 2V7ZA 1HKGA 2D0OA 4B1UB 3QB0A 4JD2A 2AA4A 4RCHA 4JKHA 5LJVA 3CPWM 1TYQA 4B1YB 3TTCA 3C7NA 3EE9A 5KPTA 3MN9A 3Q7CA 4BC5A 3CJCA 4ISEA 3O1BA 1NLVA 5AQTA 1W2BM 5C2DA 2E2OA 4BR5A 3I55N 5DM7L 2P9SA 3A5LC 2YI1A 4C23A 2NRHA 5BN8A 1HJOA 4BRHA 1SQKA 2QA4N 2OTLN 3ENBA 3E1YA 4BRMA 2D0PA 1JCFA 4GV3A 1K8KB 3G71N 4JNEA 3UKRA 3CQXA 4HWIA 5EY4A 1D4XA 4YOTA 3VPZA 5KPRA 5AZJB 4XEIA 3LDPA 3D2FB 1NGEA 2FXUA 3OBWA 3D2EB 5LY3A 1DT9A 4YOVA 3C6AA 2Q1NA 3N4PA 4K43A 3HRGA 4F9OA 3BEXA 1ESVA 1HKBA 4BC2A 2E1YA 2E2PA 4A2AA 3O8MA 1Q86O 2WC9A 1RGIA 1T6CA 4DKWA 2HOEA 2P9IB 1TUUA 1NGAA 3CHWA 3WXIA 1V4TA 3DXKB 5AQWA 2P9LA 5BR9A 1Q82O 4U7BA 3A8YA 3H1QA 3ZETB 3NVMA 4MO5A 5BPMA 5M1KA 4FWKA 4AF1A 5CHIA 4GV6A 3ZYYX 5ADXA 5EVZA 2VGNA 2ZJQL 1KAYA 3L6QA 4A59A 3TTFA 3IKMA 2GWJA 1RDUA 3CC4N 1ILYA 3CXCM 2QM1A 4OPHA 3IMXA 3VTHA 4WFNL 1GLCG 2E20A 1Z6RA 1U2VA 4JEPA 3CCRN 1NBWA 2P9NA 3C65A 4BR4A 3M3ZA 5FPMA 2KHOA 4I6MA 2QWNA 2FF6A 3R1XA 2NRZA 2FSNA 1SAZA 4YOUA 3SAGA 1XQSC 5AQUA 3CJ1A 4BG8A 3H1VX 1BOTO 3J8AA 3LDLA 3CMAN 1NGHA 1O13A 4MLEA 2A6AA 2P9UA 3G25A 3ZEUB 4B1ZA 4BRFA 4NLBA 5LJWA 4IOXA 1T44A 3AAPA 2OANA 4JKCA 3KWIA 3CETA 3LDQA 3WQTA 1YUWA 4GY2B 3CERA 3WEEA 3O9QA 3GOIA 4BRCA 4JAXA 4H5VA 2Q0UA 4GV9A 2KLAA 4IEIA 3R8EA 2W40A 4IO9L 3GE1A 4JK8A 2F7TA 3DAWA 3KHYA 3WXKA 1EO1A 4L3QA 1M1KO 4K41A 3UB5A 5AQXA 1HLUA 4JKDA 1VQPN 3L0QA 2AP1A 3HTVA 3L4IA 3VF4A 2Q97A 3IUCA 5EX5A 4CZGA 4FOIA 4CZJA 2YJFA 2QXLA 3EE8A 4JKGA 1GLLO 1NWKA 3E66A 3GL1A 3I33A 4GVEA 4MO4A 1JCGA 2W41A 2ZGZA 5AQIA 3WUHA 1WUAA 3S41A 4YOWA 3H45C 1C0FA 3ENOA 2Q36A 4ILJA 1VAZA 3CJBA 3MN6A 4A61A 2E8AA 4IXCA 1NGCA 2EWSA 2YX6A 1SZ2A 3D7EO 1P8ZA 1KAXA 4EFHA 5FPEA 4C1NI 3K9KA 2I7NA 2YHXA 2YCHA 4FPBA 4KH6A 5BPLA 3O9UA 2ZF5O 4BRAA 4PL7A 5F0XA 3W3DA 4H5TA 4CZKA 1E4FT 2FSJA 2P9PB 1WOQA 4DCHA 3WXJA 4BRPA 1VQKN 3LDOA 1H1VA 3CJ9A 3SMPA 1E4GT 1V4SA 2HBMA 1MWKA 4AM6A 5AFUA 4K42A 5GADP 4EAHD 3D6RA 2V51B 4H0VB 2ITMA 4NO7A 4BRLA 5AQFA 3M1FA 4JK7A 3U9ZA 1U6ZA 3ULEB 4BVPA 5BREA 1QVFM 3K9JA 3RSEB 1X9JA 2HBJA 4NLCA 4EIAA 4WQ5A 5E26A 3Q7BA 3CF5L 1S22A 2WUSA 4CZHA 1TUYA 4HTLA 4PL8A 3WXMB 1HKCA 1QZ5A 5M1FA 4E1JA 2D4WA 3HBTA 1RFQA 4H0PA 4UY8O 3R9PA 4H5RA 1QVGM 3MCPA 4WF9L 2QWOA 3ATVA 4JHDB 2HSTA 4A62A 2NRVA 5ELZA 1DKGD 4JK9A 4WFAL 3VF2A 4EHTA 2QWQA 2VYPA 3E9PA 1BU6O 2P9KB 1GLDG 3AGRA 3BF3A 3LM2A 3UKUA 3DXMA 1VQ7N 3A5NC 4CBUA 4CZLA 3C6HA 3CC7N 3IDHA 3CJAA 1BWFO 1CZAN 4MDBA 2J4RA 4NB4A 2CGLA 3BP8A 2WFBA 4BRKA 3EZWA 2NRTA 4A57A 3MWPA 2QWLA 5E84A 4BRIA 1N8RO 4H03B 2UYTA 4MDAA 3RVCA 2NNWA 2GX9A 3O6WA 3O5BA 3P39A 5TKWA 3TSUA 1KAZA 4CI6A 3R3LA 3HM8A 3R6MA 4H0OA 4H0YB 4QS9A 3HSCA 3MN7A 3VENA 2QTDA 3CCQN 3MCAB 4CZMA 4CD1A 1BO5O 4JD2B 2PFUA 3CCLN 1IG8A 3ATUA 3CCJN 3NVKA 1VQON 3AARA 1TYQB 4BREA 1MDUB 3C7NB 4FWOA 5GIPA 2NRXA 1KQSM 1C0GA 3E9LA 3H6EA 3MWTA 5AQNA 3AGKA 1K8AO 1GLBG 3QDKA 3H3NO 5GIOA 1BA1A 2P9SB 1NGJA 4OO1J 4BC4A 4WQ5C 3SLCA 3O9SA 4BROA 4ILGB 2F9TA 3SAFA 5HL7L 1ATSA 4PKIA 3SK3A 3UE5A 4YOYA 5GAEP 2PAVA 3KZBA 3UKRB 2YHYA 5M1QA 1NM1A 5HOOA 3CCEN 2E1ZA 3FZMA 4FOEA 5GAHP 4DHYA 4FWMA 1GLAG 1LCUA 3MMVA 3N4QA 1YIJN 3MK6A 2ZJPL 3U9DA 2QI2A 1BDGA 2CGJA 4WQ4A 3SAHA 4BRDA 1T3VA 1NGFA 2FLOA 3HOTA 3P38A 2HBLA 4XH4A 1KD1O 3LM9A 3MX2A 1XUPO 1QQNA 5MLCQ 3VTIA 2PBDA 1YVNA 1NGGA 3M6GA 3VMFB 4IOAL 2P9LB 3VEWA 3U4LA 3VEOA 3WT0A 3FLCO 1VQ6N 5KPZA 1RDWX 2NRWA 2D1KA 3LL3A 5JMVA 1QHAA 3VEXA 1VQ4N 5C12A 3NMUA 1LOTB 3MDQA 5F2RA 5H1SQ 1K8KA 2HF3A 4H5WA 3ZX2A 3IFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1Q A;  5M1N A;  5M1P A;  5C12 A;  4IEI A;  3C6A A;  5C10 A;  3C6H A;  3CPE A;  5C2D A;  5C15 A;  5M1O A;  4IFE A;  5C2F A;  5M1F A;  5M1K A;  4IDH A;  4IEE A; 
#chains in the Genus database with same CATH topology
 4CJQ A;  1K73 O;  2DFF A;  3P83 D;  3CYM A;  4KHW A;  4QS7 A;  4MQ3 A;  4EP5 A;  2A3Z A;  1FKO A;  5AQP A;  2P9N B;  3VGM A;  3TTD A;  3AVL A;  1RDA A;  2ZE2 A;  4LSN A;  3OHR A;  4BR2 A;  2E6L A;  5TKY A;  1HQU A;  4CBX A;  3K58 A;  2O4G A;  3OYM A;  5DMR A;  2P9U B;  2BTF A;  4DQ8 A;  3ISN C;  1TL1 A;  1ZXO A;  4Y1D A;  4J2B A;  2QXF A;  4FO0 A;  1ZBS A;  4KHS A;  3WEE B;  4MLH A;  2WBN A;  3EN9 A;  3T7Z A;  3IG1 A;  1WBB A;  1BGX T;  5AQQ A;  4DSL A;  4LF6 K;  2QKB A;  4FLZ A;  1QQO A;  4F8R A;  4FWR A;  4CEQ A;  1DGK N;  4GKK K;  4JKG B;  1RT7 A;  3SBT A;  1T05 A;  3RMD A;  4Y0W A;  3G6E N;  5JVG L;  4OKK A;  5AQR A;  4B9S A;  4CW7 B;  1BA0 A;  4PKH A;  5HRS A;  4DG1 A;  3O4Q A;  4O8K A;  3QIC A;  2IVO A;  4JKA A;  1TKZ A;  2DFH A;  2CH6 A;  3O9R A;  5CR4 A;  1RT5 A;  4RW7 A;  1RTJ A;  2QWM A;  3EYZ A;  2P51 A;  2Q0R A;  5GIN A;  2JGU A;  4E3S A;  4CK2 A;  4CGI A;  3PSF A;  4CF1 A;  3ALY A;  1YHQ N;  1ZC6 A;  5CYQ A;  4E89 A;  4DQS A;  1SL1 A;  2IIR A;  3PIP L;  1UOC A;  1VK0 A;  1HX1 A;  3VF6 A;  3ZSR A;  3MEG A;  3O3H A;  4DR5 K;  2O8C A;  3DLB A;  2QWR A;  5BRD A;  1K9M O;  3BZK A;  3ZT3 A;  4CZE A;  4WFB L;  4O5F A;  2A5X A;  4LSL A;  3CPE A;  3CIP A;  1ASV A;  4M7Y A;  1VQ8 N;  5M1N A;  5JIC A;  4W5N A;  2Z1G A;  3CCV N;  4IOC L;  4B3S K;  4OGE A;  3A0I X;  1TVR A;  3WNE A;  3KTQ A;  4DSJ A;  2UXC K;  1VSF A;  3QIN A;  4E1N A;  4FWN A;  4Z4E A;  1JLQ A;  3UKU B;  3G4S N;  4FJN A;  1B9D A;  3KWG A;  1QZ6 A;  2XY6 A;  1TK0 A;  4KRE A;  1NMD A;  3H46 O;  3FZK A;  3ENH A;  1U47 A;  4BGB A;  2GEL A;  1NK0 A;  4IEE A;  1NJI O;  4WYB A;  4BQL A;  3ULE A;  1KVC A;  3DYA A;  4XH5 A;  3D45 A;  3J7Z O;  4CFC A;  1VQL N;  1XHX A;  3HPG A;  4BE2 A;  3DWL A;  3F5T A;  1WLJ A;  4DTP A;  2CH5 A;  1BUP A;  3P5J A;  4AHC A;  5JLF A;  1Y64 A;  4BGA A;  4JS4 A;  1NJY A;  4O44 A;  3JS6 A;  1OVY A;  4U67 L;  1DEJ A;  4KHQ A;  4JRP A;  5C24 A;  3QES A;  4KBO A;  4KHP K;  3VEY A;  2HVH A;  2Q3S A;  5GAG P;  3E01 A;  2HHX A;  4N41 A;  3ZT2 A;  5KGX A;  3AVA A;  3OW2 M;  4Z4I A;  3HO1 A;  4KTW A;  1VHX A;  3B6P A;  2G8W A;  4JN4 A;  1SV5 A;  5JS2 A;  4IFE A;  1BG3 A;  4DTM A;  3VGL A;  1WSF A;  2X74 A;  4OKJ A;  4E0D A;  4JI1 K;  5B8H A;  3D0P A;  4O8U A;  5CZ1 A;  2E2N A;  1IV0 A;  4DWI A;  2D0O A;  4FK4 A;  3MN9 A;  4BC5 A;  1IKW A;  3AVM A;  5KI6 A;  2P9S A;  3A5L C;  3K57 A;  4DUY K;  4BRH A;  2QA4 N;  2OYQ A;  2PZS A;  3E1Y A;  4BRM A;  1NK7 A;  3SYZ A;  4CJS A;  3UKR A;  5EY4 A;  1D4X A;  4CFA A;  5AZJ B;  3OJU A;  3D2F B;  2YNI A;  2DY4 A;  3D2E B;  1WSI A;  2HHQ A;  4YOV A;  2OPR A;  3VA0 A;  1HRH A;  4BDZ A;  3N4P A;  1Y97 A;  3L2V A;  1HKB A;  2WC9 A;  2HHT A;  1KFD A;  1TUU A;  3RRH A;  1NGA A;  1SUQ A;  2P1J A;  3CHW A;  4LFA K;  3DXK B;  1Q82 O;  2P9L A;  4OX9 K;  3ZET B;  4CHZ A;  4DSE A;  3S3O A;  1L3S A;  2HB5 A;  5LL6 Z;  4DTO A;  1RBT A;  1RBU A;  4AF1 A;  4ID1 A;  5EVZ A;  3WNG A;  3OYJ A;  4I2Q A;  1EP4 A;  3VTH A;  4KI6 A;  4LF8 K;  4JEP A;  4KFB A;  4HTU A;  3CCR N;  2P9N A;  4CHP A;  5FPM A;  2QWN A;  3SAG A;  3CJ1 A;  4BG8 A;  3J8A A;  3CMA N;  3S3M A;  1NGH A;  4CHQ A;  1O13 A;  5FLX O;  2UUB K;  2A6A A;  2P9U A;  3G25 A;  4CCH A;  3DLG A;  1KLN A;  5LJW A;  1ITG A;  5SWM A;  2IGI A;  3AAP A;  2OAN A;  3DLL L;  3KWI A;  1HNX K;  3LDQ A;  1YI2 N;  3WEE A;  1S1U A;  3GOI A;  4BRC A;  4JAX A;  2Q0U A;  4CEA A;  1JLB A;  1GOA A;  4JK8 A;  2O8B B;  1EO1 A;  4L3Q A;  5HRN A;  2O8D B;  1HLU A;  1VQP N;  3NH1 A;  4CZG A;  3RMC A;  4FOI A;  4CJV A;  3OYE A;  4JKG A;  3I33 A;  1T7P A;  2W41 A;  2XY5 A;  3S41 A;  3OYH A;  3ENO A;  1HNW K;  3VA3 A;  2W6L A;  4IXC A;  2BE2 A;  4M42 A;  2EWS A;  2EHG A;  3THY A;  2NUB A;  2HND A;  4EFH A;  3OJS A;  5FPE A;  2KFZ A;  2YCH A;  4FPB A;  4KH6 A;  3VQD A;  4BRA A;  1S9E A;  2KW4 A;  3K2P A;  1E4F T;  4QCL A;  1VSI A;  2OZS A;  4DCH A;  1CXU A;  1TKX A;  3AO5 A;  3CJ9 A;  3SMP A;  2IAJ A;  4DLE A;  4YFU A;  3I0S A;  3KLE A;  3CFP A;  3D6R A;  4H0V B;  1VRU A;  2ITM A;  1NK5 A;  4JK7 A;  3U9Z A;  1U6Z A;  1QVF M;  1N36 K;  2F8S A;  3KIO A;  3K9J A;  4IG0 A;  2XO7 A;  1WN7 A;  4WQ5 A;  1O1W A;  1S22 A;  1TUY A;  3VN5 A;  4FLV A;  1QZ5 A;  2X6N A;  3HBT A;  4H0P A;  1TAQ A;  3ATV A;  3KD1 E;  2I5J A;  2HST A;  4A62 A;  1HYZ A;  3K5N A;  2VYP A;  3PX6 A;  1LWE A;  5FRO A;  3UKU A;  4DU1 A;  4CBU A;  3V6D A;  5I3U A;  4B9L A;  3SQ1 A;  3THX B;  3BY5 A;  2J4R A;  4MDB A;  3C6T A;  3DI6 A;  4BRI A;  3MXJ A;  1EET A;  3UIQ A;  4Z4G A;  3RMA A;  3TSU A;  4CI6 A;  1KAZ A;  1QSY A;  3HM8 A;  1RT6 A;  1ZYQ A;  1K6Y A;  4H0O A;  4H0Y B;  3RTV A;  2QTD A;  3I0R A;  4CD1 A;  3BGR A;  2PFU A;  3ATU A;  2BGG A;  3OYB A;  4BRE A;  1MDU B;  5J2N A;  3C7N B;  1KQS M;  1C0G A;  1ZBF A;  4FJX A;  4BWM A;  3KLG A;  1RT4 A;  5I42 A;  3H3N O;  2RPI A;  5IWA K;  1RT1 A;  4BRO A;  4TSX A;  4CER A;  4YOY A;  3SK3 A;  3UE5 A;  3MED A;  3CFO A;  4EP4 A;  5M1Q A;  1NM1 A;  5HOO A;  4DS5 A;  3CCE N;  4V19 S;  3SCX A;  4FOE A;  4JI7 K;  4DHY A;  1GLA G;  3MMV A;  4B08 A;  1YIJ N;  3AVI A;  4CK1 A;  4DTU A;  1BDG A;  4WQ4 A;  1T3V A;  2FLO A;  2ETJ A;  1KD1 O;  4XH4 A;  3VQ9 A;  3VTI A;  2PBD A;  3OYK A;  1YVN A;  1CXQ A;  2IS3 A;  1IO2 A;  1XMQ K;  4Z0U A;  2ZQB A;  2D1K A;  1XNQ K;  3LL3 A;  3VEX A;  4FZZ A;  3MEC A;  3MDQ A;  2R7Y A;  3JYT A;  4L8R B;  4H5W A;  5AR0 A;  3VQ5 A;  1HYV A;  5AQV A;  3SMS A;  5AZJ A;  1YF5 L;  3HI0 A;  3D2F A;  3MX5 A;  5AQH A;  3HZ6 A;  3D2E A;  1ATR A;  1RBS A;  1U2V B;  2NRR A;  4DU3 A;  5AQL A;  4DV4 K;  4B1W B;  3MN5 A;  3VES A;  3HP6 A;  1N32 K;  2ZJR L;  3FR0 A;  2VWK A;  3A5M C;  1TV6 A;  1RDB A;  1RCH A;  3DXK A;  4YHH K;  3ZET A;  4W5T A;  5AQJ A;  4KRF A;  3ID6 A;  5C10 A;  4A5B A;  4B3R K;  3ZX0 A;  4YDU C;  1S1T A;  5KQ8 A;  3ZSQ A;  1FXX A;  3HYF A;  4G9Z A;  5F1X A;  3O3G A;  3SV4 A;  5M1O A;  2Q31 A;  3OYC A;  3SQ4 A;  3ZCM A;  4E7I A;  5M1P A;  4DV1 K;  2LSN A;  1S72 N;  4YOX A;  1M90 O;  3NGY A;  2RHK A;  4LF9 K;  5AQY A;  3RMB A;  3DM2 A;  5BRH A;  5JLH A;  1NKB A;  4CF8 A;  3CD6 N;  2A1R A;  1WSJ A;  3S9H A;  4GNI A;  4ILH A;  1C1A A;  3SI6 A;  4FLW A;  4IKF A;  3LAN A;  3TSP A;  4HHT A;  4JI3 K;  1VSH A;  4BR9 A;  4XIU A;  1HUX A;  3VER A;  2DFE A;  1GOB A;  4IZ9 A;  4HUF A;  4LF7 K;  4M63 C;  4MFB A;  2O8D A;  3VGK A;  1GLE G;  3IS9 A;  2FC0 A;  4QOZ B;  4FYD A;  4LFB K;  4CGG A;  2DPN A;  2Z1H A;  1TK5 A;  3U8X A;  3QER A;  2IVN A;  4PKG A;  4CFD A;  1JJ2 M;  2G8V A;  3SBG A;  5J2M A;  1CLQ A;  5AQM A;  3TAN A;  1KXP A;  1VQ5 N;  3QBX A;  2ZGY A;  3HST B;  4JKF A;  3NAE A;  3U6F A;  1LWC A;  3OBY A;  4C8L A;  4YDU A;  1OKJ A;  3I56 N;  3L3V A;  1NNE A;  3PUF A;  5JVH L;  1C6V A;  2I7P A;  3CQY A;  4J8F A;  3O80 A;  2G8K A;  3VQ7 A;  3LZI A;  1C1C A;  4JI0 K;  1R59 O;  4K25 A;  1N34 K;  2G8U A;  1JLG A;  3GBT A;  3M8S A;  4IDK A;  4Z4F A;  5DM6 L;  5JS1 A;  3AY9 A;  3BF1 A;  4DTX A;  1X9M A;  4M7X A;  1BL3 A;  1ZBU A;  2YHW A;  4FPA A;  4KI4 A;  1VSL A;  1BI4 B;  1NGD A;  1X3M A;  2B5J A;  3W0L A;  4B9Q A;  3CCM N;  3BUZ B;  2FF3 B;  4R79 A;  3THX A;  4B1X B;  1W9H A;  2HMI A;  2VCP A;  1L5U A;  1NK6 A;  4RWT A;  3JXU A;  3VOV A;  4NXN K;  4OLB A;  3GDQ A;  2ASO A;  3TAM A;  4KHU A;  1WAJ A;  1JXE A;  5IT9 O;  4C1N K;  1RNH A;  4J2E A;  3NGZ A;  2V7Z A;  1HKG A;  4B1U B;  1ZBH A;  3VQA A;  4B1Y B;  3C7N A;  3CJC A;  4G1Q A;  3OYL A;  4BR5 A;  3I55 N;  3LDS A;  4FZY A;  2NRH A;  3G10 A;  4CGH A;  1SQK A;  3THY B;  1JCF A;  4CF2 A;  3G71 N;  4JNE A;  3VPZ A;  4CE9 A;  4AHR A;  3LWM A;  1NGE A;  2ATQ A;  3CFR A;  4DSK A;  4KAZ A;  2YNF A;  1NK8 A;  2Q1N A;  3ZSW A;  4FZX C;  3HRG A;  4IFV A;  4A2A A;  3U3Y A;  3O8M A;  1Q86 O;  2HOE A;  3OY9 A;  3L2Q A;  4RW9 A;  4DQP A;  4EZ6 A;  1HQE A;  1S1W A;  4FWK A;  4GV6 A;  5CHI A;  3J7Y P;  1L3V A;  1KAY A;  3L6Q A;  3TTF A;  4N76 A;  3IKM A;  3CC4 N;  3AO4 A;  4OPH A;  4FW1 A;  1GLC G;  1Z6R A;  1U2V A;  4KTZ A;  3T1H K;  2YKN A;  4X64 K;  1XQS C;  4J2D A;  2DTU A;  1BOT O;  2HNZ A;  4B1Z A;  3ZEU B;  3J7A P;  2QKK A;  5KGW A;  5HRO A;  3CET A;  4OJR A;  3WQT A;  1YUW A;  4CJU A;  3O9Q A;  2G8H A;  4JI5 K;  4GV9 A;  3R8E A;  4FJJ A;  4Q0B A;  3UB5 A;  3C94 A;  5AQX A;  4KO0 A;  3HTV A;  3L4I A;  1W7A A;  4CJW A;  4CZJ A;  5C25 A;  2QXL A;  3SUP A;  2D0B A;  3WUH A;  2Q36 A;  4ILJ A;  3V1R A;  1VAZ A;  4FJL A;  1KAX A;  4C1N I;  3K9K A;  2HHW A;  1L3U A;  1X9S A;  5BPL A;  3QO9 A;  2VG7 A;  5F0X A;  1NOZ A;  3WXJ A;  1U45 A;  5CYM A;  4PQU A;  1KVA A;  3RR8 A;  4F2S A;  1E4G T;  2HBM A;  4AM6 A;  3U3G A;  4FJH A;  4CJ3 A;  3OYA A;  1J5E K;  4FJK A;  4CEB A;  3KK1 A;  4ELU A;  4DV3 K;  5EU7 A;  2OCE A;  5BRE A;  3PY8 A;  4Y1C A;  4GMJ B;  2HBJ A;  2WUS A;  4CZH A;  1HKC A;  2D4W A;  1RFQ A;  4DSI A;  1RTI A;  1QVG M;  5C42 A;  4B9V A;  2QWO A;  4JHD B;  4N5S A;  4BE0 A;  2NRV A;  4X66 K;  4WFA L;  4DFJ A;  2QWQ A;  3E9P A;  4DTR A;  1BU6 O;  2P9K B;  1GLD G;  4DV2 K;  1VSJ A;  3AA2 A;  1C0T A;  3AA4 A;  3A5N C;  4C8O A;  4CZL A;  3TI0 A;  3NCI A;  1QSS A;  3CC7 N;  3CQ8 A;  3CJA A;  3M8P A;  3LP2 A;  3BP8 A;  1J54 A;  4BRK A;  3EZW A;  2NRT A;  4PUO A;  3TWH A;  3TAR A;  3NF7 A;  4H03 B;  4FM2 A;  4KTQ A;  1VSD A;  1A5W A;  2GX9 A;  4E7L A;  3ZT1 A;  4CEF A;  4DSF A;  4IFY A;  4KB0 A;  3R6M A;  1J53 A;  4RW8 A;  4KPY A;  3VEN A;  1WSH A;  3HVT A;  5LMN K;  1BI4 A;  4OVL A;  1IG8 A;  1WNS A;  3CCJ N;  4M45 A;  1TYQ B;  4LY7 A;  5GIP A;  4AIL C;  3MWT A;  2XY8 A;  4JI4 K;  3AO2 A;  1GLB G;  3VQC A;  4Z4C A;  2B6A A;  1NGJ A;  1Q9Y A;  3QEI A;  4PWD A;  4WQ5 C;  3SLC A;  3OYD A;  4KHY A;  3O9S A;  4BAC A;  2F9T A;  3IAY A;  3PX4 A;  1ATS A;  4PKI A;  2IDO A;  5FRN A;  1HR0 K;  1KLM A;  3FZM A;  3VQE A;  5GAH P;  3OYN A;  4DTJ A;  4FWM A;  1LCU A;  4K8Z A;  3MK6 A;  1UWB A;  4C8N A;  4BRD A;  3LAL A;  3LM9 A;  4E1M A;  4E19 A;  1NGG A;  1WSG A;  5E41 A;  3WT0 A;  2UU9 K;  3FLC O;  4FW2 A;  1VQ6 N;  5KPZ A;  5D3G A;  4IG3 A;  1SL2 A;  1U04 A;  3RRG A;  3OS2 A;  1VQ4 N;  3QIO A;  4BE1 A;  4B8A B;  3NHG A;  4UQG A;  1G15 A;  4X62 K;  4FWP A;  1FW6 A;  5LY3 A;  3HPO A;  1EQY A;  2VGM A;  3DMJ A;  4ISF A;  1KC8 O;  2JWL A;  1LAV A;  3GG4 A;  1NOY A;  4AQY K;  1S9G A;  2GTD A;  3M5R A;  5FPN A;  4A2B A;  4FJM A;  4R5P A;  1WAF A;  3WXL A;  1W97 L;  1NJZ A;  3CM6 A;  2Z1J A;  3AAQ A;  1SKW A;  2EX3 A;  1KRP A;  3LDN A;  1SS6 A;  1GLF O;  2HHH K;  4H0X B;  4M3T A;  3ZX3 A;  2H3G X;  3OTO K;  1YTA A;  3DJC A;  4LC9 B;  1JKH A;  4O0I A;  4JYA K;  3L4Q A;  2AJQ A;  2RE2 A;  3O9T A;  1U48 A;  4WQ4 C;  4ELT A;  4CF9 A;  4DB3 A;  3I8D A;  2O4I A;  3KKS A;  2OTJ N;  5J2Q A;  3NH0 A;  4B8C A;  3EL2 A;  2ASP A;  3ZEU A;  1HYS A;  3L2U A;  3O08 A;  3JSM A;  4DR1 K;  4BR0 A;  2RN2 A;  3L2R A;  2VG6 A;  1D9F A;  4O0J A;  3M8R A;  1MA9 B;  3CM5 A;  3KK7 A;  3A5O C;  2YHA A;  2P5G A;  3VEZ A;  3THV A;  1OH8 A;  2VWB A;  1BIU A;  2W6K A;  4FWS A;  4FJI A;  2XRI A;  3HL8 A;  3CCU N;  1UA1 A;  2QEX N;  1ZBI A;  2YJE A;  1Q18 A;  5HRP A;  3AVG A;  4CHN A;  4CZF A;  4NCG A;  4K0K K;  3SJH A;  1LW2 A;  1S6Q A;  3TPQ A;  1TKT A;  3ITH A;  4M3Z A;  4BY9 C;  4KH5 A;  4OPK A;  4ISG A;  2UXD K;  2PY5 A;  1OH6 A;  5FPD A;  3AVB A;  1P90 A;  2E88 A;  3BZC A;  1QS4 A;  4ZTJ A;  4JKB A;  4CK3 A;  4DV7 K;  1BIS A;  3PV8 A;  3NF9 A;  4O4G A;  2OPQ A;  1HJR A;  3AVF A;  1VQ9 N;  3FE1 A;  1BHL A;  1QHT A;  4LF5 K;  1HPM A;  4FLT A;  2E2Q A;  1FK9 A;  3AV9 A;  4JI2 K;  2ZWH A;  4BRN A;  3EKS A;  3PLA A;  5AZI A;  4RW4 A;  3TAF A;  2HMP A;  2HNY A;  3ZSO A;  3C0B A;  1J6Z A;  4BQZ A;  2GV9 A;  5C15 A;  3DOL A;  3JAM O;  3TR8 A;  4HCB A;  1T6D A;  2ZD1 A;  4JKE A;  3FFK B;  3OA9 A;  3FZH A;  3QML A;  2FSK A;  4JHD A;  4DUZ K;  3I8B A;  1CZB A;  2E6M A;  5AQO A;  4IJN A;  4O5B A;  3LAK A;  5BRF A;  2OPP A;  2P9K A;  5BN9 A;  3K0S A;  3G0Z A;  4IJA A;  2V7Y A;  4LF4 K;  3F9K A;  2A40 A;  4CJL A;  4CF0 A;  2F9W A;  3CJ7 A;  4CD3 A;  3VQP A;  3OYF A;  4IO8 A;  1S1X A;  3LPT A;  1NK9 A;  4DF8 A;  3S3N A;  2HHU A;  3PX0 A;  2Y1J A;  2BUP A;  4DFM A;  5AQZ A;  3QFU A;  4H4O A;  1SKR A;  1J5O A;  3PIO L;  1YJN N;  2KQ2 A;  1X3N A;  2D0A A;  3OS0 A;  4Z94 A;  3T69 A;  4BC3 A;  1NK4 A;  1SKS A;  2HHS A;  3E9O A;  5KQD A;  2B4J A;  5C2F A;  2X6S A;  1N5Y A;  1YVU A;  2Y1I A;  3KLH A;  2AA4 A;  3SQ0 A;  1S1V A;  5LJV A;  3ZLJ A;  1TYQ A;  3EE9 A;  3V9S A;  3CG7 A;  4ISE A;  1NLV A;  5AQT A;  1W2B M;  5C2D A;  2E2O A;  1IKV A;  3LPU A;  5DM7 L;  2YI1 A;  4CHY A;  2OTL N;  3ENB A;  1IG9 A;  4OLA A;  4W5O A;  1K8K B;  2FBX A;  1C1B A;  4YOT A;  5KPR A;  4CJP A;  2QK9 A;  1BQN A;  3QEW A;  1EWR A;  4CVN E;  4LH5 A;  1NMN A;  4K43 A;  4F9O A;  3NGI A;  1T03 A;  3BEX A;  1W0H A;  4BC2 A;  2E1Y A;  3VQ6 A;  3MXI A;  1UAX A;  4YY3 K;  1RGI A;  4DKW A;  1T6C A;  4JV5 K;  2P9I B;  1KTQ A;  5CZ2 A;  3WXI A;  3RR7 A;  4KB1 A;  5BR9 A;  4U7B A;  3PO5 A;  3A8Y A;  3H1Q A;  4JS5 A;  3LP3 A;  4DQI A;  5BPM A;  3AVJ A;  4YNQ A;  1JL1 A;  1QTM A;  5ADX A;  3ZSX A;  2VGN A;  4CEC A;  2F8T A;  4A59 A;  4GKJ K;  1DLO A;  2GWJ A;  2OZM A;  1OH5 A;  4B3T K;  2XY7 A;  2JLE A;  4B9M A;  3V4I A;  4WFN L;  4HUE A;  1B9F A;  4BR4 A;  4DQQ A;  3ZSY A;  3SPZ A;  2FF6 A;  4DLG A;  2NRZ A;  3DLK A;  2D5R A;  5AQU A;  4DF4 A;  3H1V X;  3V9X A;  1XC9 A;  3V81 A;  3EEQ A;  5HRR A;  1HMV A;  4BRF A;  4NLB A;  1IKX A;  3QLH A;  3QEV A;  4IOX A;  4CJF A;  3O3F A;  3J80 O;  1IBK K;  2RKI A;  4JKC A;  3CER A;  4H5V A;  4B3O A;  4IEI A;  3HP9 A;  2W40 A;  4IO9 L;  4F2R A;  4CJT A;  3HPH A;  3WXK A;  4AHT A;  3OS1 A;  2AP1 A;  3VF4 A;  3THW B;  3RWU A;  1DTT A;  1RBR A;  2XHB A;  3EE8 A;  1ASU A;  1NWK A;  3GL1 A;  4MO4 A;  3DLH A;  5AQI A;  1WUA A;  5DK5 A;  2VG5 A;  3H45 C;  3VQQ A;  1B92 A;  3CJB A;  4ELV A;  3MN6 A;  4FJ5 A;  2E8A A;  1LW0 A;  1NGC A;  5FRM A;  2O8E B;  3D7E O;  2O8F B;  2YNH A;  1I39 A;  2I7N A;  2YHX A;  4CHO A;  1I94 K;  3O9U A;  3L2W A;  4PL7 A;  4M3X A;  4CZK A;  1JLA A;  3QEP A;  1FKP A;  1Q8I A;  2P9P B;  4BRP A;  1JLE A;  3LDO A;  1HPZ A;  1L3T A;  3T19 A;  1HNI A;  4FLX A;  4Q5V A;  3KD5 E;  5AFU A;  5GAD P;  4EAH D;  2V51 B;  4NO7 A;  1RDD A;  4BVP A;  4BDY A;  1IH7 A;  3L3U A;  5KRS A;  4NXM K;  3RSE B;  4NLC A;  1F21 A;  4CGJ A;  3AO3 A;  5E26 A;  3Q7B A;  4CGF A;  3CF5 L;  4PL8 A;  5M1F A;  4KV8 A;  1KVB A;  3R9P A;  2KZM A;  3KKR A;  2VQF K;  5ELZ A;  1DKG D;  3K5O A;  3IRX A;  4JK9 A;  3VF2 A;  4EHT A;  3BDP A;  3BF3 A;  4AH9 A;  4I7F A;  3IDH A;  1CZA N;  2OPS A;  4KHN A;  2CGL A;  4F4K A;  4DFK A;  4A57 A;  3MWP A;  1X1P A;  5E84 A;  1U49 A;  2UUC K;  3TAQ A;  2UYT A;  4CEE A;  3RVC A;  1JLF A;  2NNW A;  5TKW A;  4DR2 K;  4OKE A;  1VSE A;  2IOC A;  4AHU A;  3AVN A;  3HSC A;  3MN7 A;  3ZT0 A;  1UA0 A;  1JXB A;  4CZM A;  1BO5 O;  4JD2 B;  4PY5 A;  1VQO N;  3AAR A;  4FWO A;  2NRX A;  3E9L A;  1DTQ A;  3C95 A;  5AQN A;  1TL3 A;  4KKO A;  4BWJ A;  1BA1 A;  4BC4 A;  2YV0 X;  4ILG B;  3OYG A;  4B9T A;  2PAV A;  3KZB A;  2YHY A;  1BCM A;  1J9A A;  4RW6 A;  2E1Z A;  4CIF A;  4DR6 K;  4NYF A;  3N4Q A;  2ZJP L;  3U9D A;  2QI2 A;  3DLE A;  1NGF A;  2GUI A;  4DR7 K;  4AHV A;  3ZT4 A;  1NG9 A;  3SQ2 A;  2YHB A;  3VEW A;  3SNN A;  3MEE A;  1RDW X;  3HXM A;  5AJ3 K;  4FJ8 A;  5C12 A;  3HT3 A;  3NMU A;  5F2R A;  5H1S Q;  1K8K A;  2HF3 A;  3ZX2 A;  3IFR A;  3QNO A;  4CBW A;  1IJJ A;  3O4N A;  5I9E B;  5AQK A;  3H3O B;  2W42 A;  4BG9 A;  3NH2 A;  2WOM A;  1A5V A;  4DQR A;  4H0T B;  2Q2R A;  3O1W A;  3KVG A;  4I6M B;  3CME N;  3FGU A;  1LV5 A;  2NZT A;  4EHU A;  4N47 A;  3FZL A;  2P9I A;  4FM1 A;  5C0Y A;  1T8E A;  4IWV A;  3TSQ A;  4H5N A;  3AA3 A;  3V9W A;  1X9W A;  4OPA A;  5AZI B;  4F3O A;  3CCS N;  2QW9 A;  3FZF A;  1XC3 A;  3TAB A;  4B3M K;  1YIT N;  1BIZ A;  3KJV A;  4I2P A;  5ADX H;  4M3Y A;  1A5X A;  4B1V A;  2P5O A;  4M3R A;  1RT3 A;  1VRT A;  4RG8 A;  3VEV A;  3QFP A;  2HF4 A;  1S5J A;  1D5A A;  3EKU A;  4FM0 A;  3OVN A;  4CZI A;  4H8K A;  4DTN A;  1YXQ A;  4W5Q A;  1Z25 A;  3WNF A;  4DV6 K;  4M3U A;  2GUP A;  1S6P A;  1BCO A;  4M3W A;  2QWP A;  1JLC A;  4CFB A;  3LAM A;  4BRG A;  4RTF D;  1XWL A;  1GLJ O;  4FWQ A;  4N56 A;  4LH4 A;  4FVM A;  3F73 A;  3HOS A;  1EWQ A;  1TGO A;  5SZT A;  3F2K A;  4FVU A;  3V1Q A;  4FWL A;  1R0A A;  5FDL A;  5CE3 A;  3MXM A;  4K8X A;  1NGB A;  4FL9 A;  1Q81 O;  4I9Q A;  2GWK A;  1G99 A;  4HVJ A;  3THW A;  2NLX A;  2GBZ A;  2UXB K;  2G8I A;  3QET A;  3H08 A;  4BVO A;  5BPN A;  3V9Z A;  4A5A A;  1MWM A;  4JRQ A;  4YOR A;  2ASM A;  1VSK A;  5J1E A;  5EXW A;  3HVR A;  5EOY A;  1ASW A;  4AHS A;  1WB9 A;  1YAG A;  2BAN A;  2BH1 A;  4FSV A;  5HLF A;  3WQU A;  4JI8 K;  1HNV A;  2V52 B;  2O8E A;  1NU0 A;  2O8F A;  1S3X A;  4FXD A;  4WCE L;  1C0U A;  4ICL A;  5AQG A;  4ID5 A;  3SUO A;  4CJ7 A;  4JI6 K;  1U4B A;  1XNR K;  3SJJ A;  1NGI A;  3OYI A;  1D9D A;  3CI5 A;  2A41 A;  4BR7 A;  1VQM N;  2P9P A;  1YJ9 N;  1RIL A;  1JCE A;  3WNH A;  3DXM B;  5K14 A;  3SPY A;  1QQM A;  4XH1 A;  3TU5 A;  1ATN A;  4WE1 A;  3VET A;  1XI1 A;  4E7K A;  3SUN A;  1EXQ A;  3EO3 A;  5HBM A;  4E7H A;  4CJE A;  4M41 A;  3KK2 A;  5AFU H;  2A42 A;  3RSE A;  3T3F A;  2IVP A;  3SZ2 A;  2E4L A;  3LZJ A;  4W5R A;  4HCC A;  3CC2 N;  3VQ4 A;  4J2A A;  4DS4 A;  5AQS A;  2FBT A;  2F4V K;  3NBP A;  3SV3 A;  2KTQ A;  3LP1 A;  4LD0 A;  3QBW A;  3O4W A;  1RDC A;  3P31 A;  1VQN N;  4FJ7 A;  3V1O A;  4AM7 A;  4NCB A;  3B8A X;  2CGK A;  3DOK A;  2JWK A;  2A1S A;  3F9M A;  4PHT X;  1TKD A;  3HM9 A;  1FJG K;  5T7B A;  3LP0 A;  2HBK A;  1Q7Y O;  4CJ4 A;  1HNZ K;  4LFC K;  4KH4 A;  4QS8 A;  1Z05 A;  4IDH A;  1KSP A;  3ID8 A;  2KKZ A;  3M8Q A;  1YJW N;  2BDP A;  2GEM A;  3P4I A;  1EKE A;  4CIG A;  1D8Y A;  3QB0 A;  4JD2 A;  4DTS A;  1NKE A;  4RCH A;  4JKH A;  3CPW M;  3TTC A;  4CEZ A;  4CIE A;  5KPT A;  3Q7C A;  1QQC A;  3O1B A;  4C23 A;  5BN8 A;  1HJO A;  1YTU A;  3MAQ A;  4Z4H A;  2D0P A;  3K5M A;  3AO1 A;  4GV3 A;  3CQX A;  4HWI A;  4XEI A;  3LDP A;  2FXU A;  3OBW A;  4F3T A;  4DV5 K;  1CZ9 A;  1OVQ A;  1DT9 A;  1REV A;  4HUG A;  3EY1 A;  3ZSZ A;  3DLR A;  4X65 K;  3C6A A;  3NE6 A;  1OH7 A;  1WBD A;  1ESV A;  2E2P A;  1E3M A;  3VQB A;  1NKC A;  2YNG A;  2HVI A;  1V4T A;  5AQW A;  3V9U A;  3NVM A;  4MO5 A;  5M1K A;  3ZYY X;  2ZJQ L;  1NJW A;  2WTU A;  2PYJ A;  2ITG A;  1TK8 A;  4BDP A;  3K59 A;  5KRT A;  1RDU A;  1ILY A;  4DV0 K;  2YKM A;  3CXC M;  3QIP A;  2QM1 A;  4FCY A;  3IMX A;  4CJK A;  2E20 A;  2HHV A;  4DU4 A;  1LAW A;  1NBW A;  3C65 A;  1JL2 A;  2WON A;  3M3Z A;  3QEX A;  4DR3 K;  2KHO A;  4I6M A;  5J2P A;  3R1X A;  2FSN A;  1SAZ A;  1GOC A;  4YOU A;  1SL0 A;  1I3A A;  3B6O A;  3TAE A;  4CEO A;  3LDL A;  1LWF A;  4CJR A;  2RF2 A;  5CY4 A;  4MLE A;  5A2Q O;  3L8B A;  1T44 A;  3FFI A;  3KLF A;  4GY2 B;  5KTQ A;  4B9U A;  2KLA A;  4C8K A;  1RTH A;  3GE1 A;  2D0C A;  2F7T A;  3DAW A;  3KHY A;  4JLH A;  5LMU K;  1Q9X A;  1M1K O;  4K41 A;  4JKD A;  4CES A;  3L0Q A;  3VQ8 A;  2Q97 A;  3IUC A;  5EX5 A;  3T1Y K;  4NYN A;  2G8F A;  2YJF A;  2UUA K;  2KZZ A;  1GLL O;  3NDK A;  2O8C B;  3E66 A;  4GVE A;  1JCG A;  2X78 A;  4DMN A;  2ZGZ A;  4YOW A;  1C0F A;  1XMO K;  2ZM6 K;  4A61 A;  4FK0 A;  2YX6 A;  1SZ2 A;  1P8Z A;  2VWJ A;  3K5L A;  4ZHR A;  1VSM A;  3SUQ A;  3AVC A;  2ZF5 O;  1Z26 A;  3AA5 X;  3W3D A;  4H5T A;  4E7J A;  4IBN A;  3ULD A;  2FSJ A;  3ZSV A;  1WOQ A;  4FJ9 A;  1VQK N;  1N33 K;  4B9N A;  3T1A A;  1H1V A;  1V4S A;  1MWK A;  1QSL A;  4K42 A;  2FBV A;  3NFA A;  3J81 O;  4BRL A;  5AQF A;  3M1F A;  3ULE B;  1RBV A;  4EIA A;  1X9J A;  3KK3 A;  4HTL A;  3WXM B;  2OA8 A;  4CJ5 A;  4E1J A;  4FLU A;  1IBM K;  4DR4 K;  4UY8 O;  4H5R A;  3MCP A;  4WF9 L;  3ASM A;  2F96 A;  4CGD A;  3AVH A;  4GVM A;  3QNN A;  3AGR A;  3LM2 A;  1VQ7 N;  3AVK A;  3DXM A;  3EZ5 A;  4QAG A;  3C6H A;  4ZTF A;  1BWF O;  4NB4 A;  3DRS A;  4GW6 A;  1NJX A;  2WFB A;  2PYL A;  1BQM A;  1YT3 A;  2QWL A;  1N8R O;  1RTD A;  4MDA A;  3O6W A;  4FLY A;  3O5B A;  5HP1 A;  3P39 A;  1ZBL A;  3R3L A;  2O8B A;  5BR8 K;  4OGC A;  1IBL K;  3DRP A;  1N6Q A;  3C6U A;  4QS9 A;  3CCQ N;  3MCA B;  2Z1I A;  3TAG A;  1QE1 A;  3CCL N;  4DFP A;  3NVK A;  1IKY A;  3DRR A;  1C0M A;  1MU2 A;  3H6E A;  3KLI A;  3AGK A;  1K8A O;  4FJG A;  3QDK A;  5GIO A;  2P9S B;  3P1G A;  4O55 A;  4OO1 J;  1RT2 A;  4NCA A;  4FK2 A;  3LWL A;  2HW3 A;  4I9L A;  3SAF A;  3HK2 A;  5HL7 L;  3PSI A;  3HJF A;  4EZ9 A;  3NF8 A;  5GAE P;  3UKR B;  4PA1 A;  2FBY A;  2IC3 A;  2VQE K;  3TAP A;  2CGJ A;  3SAH A;  1EX4 A;  3PO4 A;  3HOT A;  3P38 A;  2HBL A;  2E5L K;  3MX2 A;  1XUP O;  1QQN A;  1WSE A;  5MLC Q;  4CED A;  3VMF B;  3M6G A;  4IOA L;  2P9L B;  3U4L A;  3VEO A;  1KCF A;  2NRW A;  1TAU A;  3A2F A;  5JMV A;  1QHA A;  4H4M A;  1LOT B;  1XHZ A;  4C8M A;  3NF6 A;  2KFN A;  4BRQ A;  1KFS A;  4OPJ A; 
#chains in the Genus database with same CATH homology
 1K73 O;  4CBW A;  1IJJ A;  5AQV A;  4FWP A;  3SMS A;  1YF5 L;  3HI0 A;  5AZJ A;  4QS7 A;  3D2F A;  3MX5 A;  3H3O B;  3HZ6 A;  3D2E A;  5AQH A;  1ATR A;  1U2V B;  5AQK A;  4BG9 A;  2NRR A;  2A3Z A;  1EQY A;  5AQP A;  2P9N B;  2VGM A;  4ISF A;  3VGM A;  1KC8 O;  4H0T B;  2JWL A;  2Q2R A;  3GG4 A;  3O1W A;  3KVG A;  4I6M B;  5AQL A;  3TTD A;  4B1W B;  3OHR A;  3MN5 A;  3VES A;  4BR2 A;  2GTD A;  3M5R A;  3FGU A;  5FPN A;  5TKY A;  4A2B A;  5AR0 A;  2ZJR L;  3FR0 A;  4CBX A;  2NZT A;  4EHU A;  3A5M C;  3WXL A;  1W97 L;  3FZL A;  2P9I A;  5C0Y A;  4IWV A;  2P9U B;  3DXK A;  3TSQ A;  4H5N A;  2BTF A;  3AAQ A;  3ZET A;  5AQJ A;  4DQ8 A;  4OPA A;  1ZXO A;  3ID6 A;  5AZI B;  4FO0 A;  5C10 A;  3CCS N;  4A5B A;  2QW9 A;  3FZF A;  3ZX0 A;  1XC3 A;  1ZBS A;  4YDU C;  3LDN A;  3WEE B;  1SS6 A;  4MLH A;  1GLF O;  1YIT N;  4H0X B;  5KQ8 A;  2WBN A;  3EN9 A;  3T7Z A;  3ZX3 A;  5ADX H;  2H3G X;  3DJC A;  4G9Z A;  5AQQ A;  4LC9 B;  4B1V A;  5F1X A;  1QQO A;  3L4Q A;  5M1O A;  2Q31 A;  3VEV A;  2RE2 A;  3O9T A;  4FWR A;  3QFP A;  2HF4 A;  4WQ4 C;  1DGK N;  3EKU A;  4DB3 A;  2OTJ N;  4CZI A;  4JKG B;  3SBT A;  1YXQ A;  5M1P A;  1M90 O;  1S72 N;  4YOX A;  4Y0W A;  2RHK A;  5I9E B;  3EL2 A;  5AQY A;  3G6E N;  2GUP A;  2ASP A;  5JLH A;  5BRH A;  3ZEU A;  5JVG L;  2QWP A;  5AQR A;  3CD6 N;  3O08 A;  4BRG A;  4GNI A;  1BA0 A;  4ILH A;  4RTF D;  4PKH A;  4BR0 A;  1GLJ O;  3TSP A;  4FWQ A;  4O8K A;  3QIC A;  2IVO A;  4BR9 A;  4JKA A;  1MA9 B;  3KK7 A;  1HUX A;  3HOS A;  2CH6 A;  3A5O C;  3O9R A;  5CR4 A;  3VER A;  4IZ9 A;  3F2K A;  3VEZ A;  4FVU A;  3DLL L;  4FWL A;  2QWM A;  5CE3 A;  4M63 C;  2VWB A;  1NGB A;  2Q0R A;  4FWS A;  4FL9 A;  5GIN A;  1Q81 O;  2GWK A;  1YI2 N;  3VGK A;  1G99 A;  1GLE G;  1YHQ N;  1ZC6 A;  3CCU N;  2QEX N;  2NLX A;  2YJE A;  1Q18 A;  2DPN A;  3U8X A;  2IIR A;  4BVO A;  5BPN A;  2IVN A;  3PIP L;  4A5A A;  1MWM A;  4CZF A;  4YOR A;  1HX1 A;  3VF6 A;  2ASM A;  4PKG A;  1JJ2 M;  5EXW A;  3SBG A;  2QWR A;  5EOY A;  3SJH A;  1YAG A;  2BH1 A;  4FSV A;  5BRD A;  1K9M O;  3WQU A;  4CZE A;  5AQM A;  4WFB L;  4O5F A;  2V52 B;  3TPQ A;  2A5X A;  1KXP A;  3CPE A;  3CIP A;  3QBX A;  2ZGY A;  1VQ5 N;  1S3X A;  4KH5 A;  4ISG A;  4M7Y A;  1VQ8 N;  4WCE L;  5M1N A;  4JKF A;  5AQG A;  5JIC A;  3OBY A;  5FPD A;  4IOC L;  3CCV N;  1P90 A;  4YDU A;  2E88 A;  3A0I X;  4CJ7 A;  4JKB A;  4BRQ A;  1OKJ A;  3I56 N;  1NGI A;  3CI5 A;  2A41 A;  4BR7 A;  5JVH L;  1VQM N;  2P9P A;  1YJ9 N;  1VQ9 N;  4FWN A;  1JCE A;  2I7P A;  3CQY A;  4J8F A;  3UKU B;  3FE1 A;  3DXM B;  3O80 A;  3G4S N;  1QQM A;  1HPM A;  4XH1 A;  3KWG A;  1QZ6 A;  2E2Q A;  3TU5 A;  1ATN A;  3VET A;  2ZWH A;  1NMD A;  4BRN A;  3H46 O;  3EKS A;  3FZK A;  1R59 O;  3EO3 A;  4K25 A;  3ENH A;  5AZI A;  2HMP A;  4BGB A;  2GEL A;  3PLA A;  1NJI O;  4IEE A;  4WYB A;  4BQL A;  5AFU H;  3ULE A;  3C0B A;  3GBT A;  1J6Z A;  4BQZ A;  2A42 A;  4XH5 A;  3RSE A;  5C15 A;  2IVP A;  3J7Z O;  1VQL N;  1T6D A;  3DWL A;  3F5T A;  4JKE A;  5DM6 L;  3FFK B;  3OA9 A;  2CH5 A;  1BUP A;  3AY9 A;  3FZH A;  3QML A;  5JLF A;  1Y64 A;  2FSK A;  3BF1 A;  3CC2 N;  4JHD A;  4BGA A;  5AQS A;  4M7X A;  3I8B A;  5AQO A;  4IJN A;  5BRF A;  3JS6 A;  1OVY A;  2YHW A;  4FPA A;  5BN9 A;  2P9K A;  3QBW A;  3O4W A;  4U67 L;  1DEJ A;  4IJA A;  3P31 A;  2V7Y A;  1VQN N;  1NGD A;  1X3M A;  3CME N;  4KBO A;  2A40 A;  3W0L A;  3VEY A;  4AM7 A;  4B9Q A;  3CCM N;  2F9W A;  3CJ7 A;  3BUZ B;  4CD3 A;  2FF3 B;  4R79 A;  3B8A X;  5GAG P;  2CGK A;  4B1X B;  2JWK A;  3F9M A;  2VCP A;  4IO8 A;  3OW2 M;  4PHT X;  4JN4 A;  4RWT A;  2HBK A;  3JXU A;  1Q7Y O;  2BUP A;  3VOV A;  4IFE A;  5AQZ A;  3QFU A;  3GDQ A;  3PIO L;  1YJN N;  2ASO A;  1BG3 A;  1X3N A;  3VGL A;  4KH4 A;  4QS8 A;  4Z94 A;  4C1N K;  1Z05 A;  3T69 A;  4IDH A;  3ID8 A;  4BC3 A;  2KKZ A;  5B8H A;  1YJW N;  4BY9 C;  3E9O A;  4O8U A;  5KQD A;  5C2F A;  2E2N A;  2GEM A;  3P4I A;  2V7Z A;  1HKG A;  2D0O A;  4B1U B;  3QB0 A;  4JD2 A;  2AA4 A;  4RCH A;  4JKH A;  5LJV A;  3CPW M;  1TYQ A;  4B1Y B;  3TTC A;  3C7N A;  3EE9 A;  5KPT A;  3MN9 A;  3Q7C A;  4BC5 A;  3CJC A;  4ISE A;  3O1B A;  1NLV A;  5AQT A;  1W2B M;  5C2D A;  2E2O A;  4BR5 A;  3I55 N;  5DM7 L;  2P9S A;  3A5L C;  2YI1 A;  4C23 A;  2NRH A;  5BN8 A;  1HJO A;  4BRH A;  1SQK A;  2QA4 N;  2OTL N;  3ENB A;  3E1Y A;  4BRM A;  2D0P A;  1JCF A;  4GV3 A;  1K8K B;  3G71 N;  4JNE A;  3UKR A;  3CQX A;  4HWI A;  5EY4 A;  1D4X A;  4YOT A;  3VPZ A;  5KPR A;  5AZJ B;  4XEI A;  3LDP A;  3D2F B;  1NGE A;  2FXU A;  3OBW A;  3D2E B;  5LY3 A;  1DT9 A;  4YOV A;  3C6A A;  2Q1N A;  3N4P A;  4K43 A;  3HRG A;  4F9O A;  3BEX A;  1ESV A;  1HKB A;  4BC2 A;  2E1Y A;  2E2P A;  4A2A A;  3O8M A;  1Q86 O;  2WC9 A;  1RGI A;  1T6C A;  4DKW A;  2HOE A;  2P9I B;  1TUU A;  1NGA A;  3CHW A;  3WXI A;  1V4T A;  3DXK B;  5AQW A;  2P9L A;  5BR9 A;  1Q82 O;  4U7B A;  3A8Y A;  3H1Q A;  3ZET B;  3NVM A;  4MO5 A;  5BPM A;  5M1K A;  4FWK A;  4AF1 A;  5CHI A;  4GV6 A;  3ZYY X;  5ADX A;  5EVZ A;  2VGN A;  2ZJQ L;  1KAY A;  3L6Q A;  4A59 A;  3TTF A;  3IKM A;  2GWJ A;  1RDU A;  3CC4 N;  1ILY A;  3CXC M;  2QM1 A;  4OPH A;  3IMX A;  3VTH A;  4WFN L;  1GLC G;  2E20 A;  1Z6R A;  1U2V A;  4JEP A;  3CCR N;  1NBW A;  2P9N A;  3C65 A;  4BR4 A;  3M3Z A;  5FPM A;  2KHO A;  4I6M A;  2QWN A;  2FF6 A;  3R1X A;  2NRZ A;  2FSN A;  1SAZ A;  4YOU A;  3SAG A;  1XQS C;  5AQU A;  3CJ1 A;  4BG8 A;  3H1V X;  1BOT O;  3J8A A;  3LDL A;  3CMA N;  1NGH A;  1O13 A;  4MLE A;  2A6A A;  2P9U A;  3G25 A;  3ZEU B;  4B1Z A;  4BRF A;  4NLB A;  5LJW A;  4IOX A;  1T44 A;  3AAP A;  2OAN A;  4JKC A;  3KWI A;  3CET A;  3LDQ A;  3WQT A;  1YUW A;  4GY2 B;  3CER A;  3WEE A;  3O9Q A;  3GOI A;  4BRC A;  4JAX A;  4H5V A;  2Q0U A;  4GV9 A;  2KLA A;  4IEI A;  3R8E A;  2W40 A;  4IO9 L;  3GE1 A;  4JK8 A;  2F7T A;  3DAW A;  3KHY A;  3WXK A;  1EO1 A;  4L3Q A;  1M1K O;  4K41 A;  3UB5 A;  5AQX A;  1HLU A;  4JKD A;  1VQP N;  3L0Q A;  2AP1 A;  3HTV A;  3L4I A;  3VF4 A;  2Q97 A;  3IUC A;  5EX5 A;  4CZG A;  4FOI A;  4CZJ A;  2YJF A;  2QXL A;  3EE8 A;  4JKG A;  1GLL O;  1NWK A;  3E66 A;  3GL1 A;  3I33 A;  4GVE A;  4MO4 A;  1JCG A;  2W41 A;  2ZGZ A;  5AQI A;  3WUH A;  1WUA A;  3S41 A;  4YOW A;  3H45 C;  1C0F A;  3ENO A;  2Q36 A;  4ILJ A;  1VAZ A;  3CJB A;  3MN6 A;  4A61 A;  2E8A A;  4IXC A;  1NGC A;  2EWS A;  2YX6 A;  1SZ2 A;  3D7E O;  1P8Z A;  1KAX A;  4EFH A;  5FPE A;  4C1N I;  3K9K A;  2I7N A;  2YHX A;  2YCH A;  4FPB A;  4KH6 A;  5BPL A;  3O9U A;  2ZF5 O;  4BRA A;  4PL7 A;  5F0X A;  3W3D A;  4H5T A;  4CZK A;  1E4F T;  2FSJ A;  2P9P B;  1WOQ A;  4DCH A;  3WXJ A;  4BRP A;  1VQK N;  3LDO A;  1H1V A;  3CJ9 A;  3SMP A;  1E4G T;  1V4S A;  2HBM A;  1MWK A;  4AM6 A;  5AFU A;  4K42 A;  5GAD P;  4EAH D;  3D6R A;  2V51 B;  4H0V B;  2ITM A;  4NO7 A;  4BRL A;  5AQF A;  3M1F A;  4JK7 A;  3U9Z A;  1U6Z A;  3ULE B;  4BVP A;  5BRE A;  1QVF M;  3K9J A;  3RSE B;  1X9J A;  2HBJ A;  4NLC A;  4EIA A;  4WQ5 A;  5E26 A;  3Q7B A;  3CF5 L;  1S22 A;  2WUS A;  4CZH A;  1TUY A;  4HTL A;  4PL8 A;  3WXM B;  1HKC A;  1QZ5 A;  5M1F A;  4E1J A;  2D4W A;  3HBT A;  1RFQ A;  4H0P A;  4UY8 O;  3R9P A;  4H5R A;  1QVG M;  3MCP A;  4WF9 L;  2QWO A;  3ATV A;  4JHD B;  2HST A;  4A62 A;  2NRV A;  5ELZ A;  1DKG D;  4JK9 A;  4WFA L;  3VF2 A;  4EHT A;  2QWQ A;  2VYP A;  3E9P A;  1BU6 O;  2P9K B;  1GLD G;  3AGR A;  3BF3 A;  3LM2 A;  3UKU A;  3DXM A;  1VQ7 N;  3A5N C;  4CBU A;  4CZL A;  3C6H A;  3CC7 N;  3IDH A;  3CJA A;  1BWF O;  1CZA N;  4MDB A;  2J4R A;  4NB4 A;  2CGL A;  3BP8 A;  2WFB A;  4BRK A;  3EZW A;  2NRT A;  4A57 A;  3MWP A;  2QWL A;  5E84 A;  4BRI A;  1N8R O;  4H03 B;  2UYT A;  4MDA A;  3RVC A;  2NNW A;  2GX9 A;  3O6W A;  3O5B A;  3P39 A;  5TKW A;  3TSU A;  1KAZ A;  4CI6 A;  3R3L A;  3HM8 A;  3R6M A;  4H0O A;  4H0Y B;  4QS9 A;  3HSC A;  3MN7 A;  3VEN A;  2QTD A;  3CCQ N;  3MCA B;  4CZM A;  4CD1 A;  1BO5 O;  4JD2 B;  2PFU A;  3CCL N;  1IG8 A;  3ATU A;  3CCJ N;  3NVK A;  1VQO N;  3AAR A;  1TYQ B;  4BRE A;  1MDU B;  3C7N B;  4FWO A;  5GIP A;  2NRX A;  1KQS M;  1C0G A;  3E9L A;  3H6E A;  3MWT A;  5AQN A;  3AGK A;  1K8A O;  1GLB G;  3QDK A;  3H3N O;  5GIO A;  1BA1 A;  2P9S B;  1NGJ A;  4OO1 J;  4BC4 A;  4WQ5 C;  3SLC A;  3O9S A;  4BRO A;  4ILG B;  2F9T A;  3SAF A;  5HL7 L;  1ATS A;  4PKI A;  3SK3 A;  3UE5 A;  4YOY A;  5GAE P;  2PAV A;  3KZB A;  3UKR B;  2YHY A;  5M1Q A;  1NM1 A;  5HOO A;  3CCE N;  2E1Z A;  3FZM A;  4FOE A;  5GAH P;  4DHY A;  4FWM A;  1GLA G;  1LCU A;  3MMV A;  3N4Q A;  1YIJ N;  3MK6 A;  2ZJP L;  3U9D A;  2QI2 A;  1BDG A;  2CGJ A;  4WQ4 A;  3SAH A;  4BRD A;  1T3V A;  1NGF A;  2FLO A;  3HOT A;  3P38 A;  2HBL A;  4XH4 A;  1KD1 O;  3LM9 A;  3MX2 A;  1XUP O;  1QQN A;  5MLC Q;  3VTI A;  2PBD A;  1YVN A;  1NGG A;  3M6G A;  3VMF B;  4IOA L;  2P9L B;  3VEW A;  3U4L A;  3VEO A;  3WT0 A;  3FLC O;  1VQ6 N;  5KPZ A;  1RDW X;  2NRW A;  2D1K A;  3LL3 A;  5JMV A;  1QHA A;  3VEX A;  1VQ4 N;  5C12 A;  3NMU A;  1LOT B;  3MDQ A;  5F2R A;  5H1S Q;  1K8K A;  2HF3 A;  4H5W A;  3ZX2 A;  3IFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...