5C2DA

K428a mutant gp2c of large terminase subunit from bacteriophage sf6 with calcium
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
241
structure length
227
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
molecule keywords Gene 2 protein
total genus 84
structure length 227
sequence length 241
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c2dA00
4IEEA 5C2FA 3CPEA 5M1QA 5C15A 5M1NA 3C6HA 4IEIA 5M1PA 5C2DA 5M1KA 5M1FA 5M1OA 4IDHA 3C6AA 4IFEA 5C12A 5C10A
chains in the Genus database with same CATH superfamily
2WUSA 4CIGA 3MK6A 3H46O 3TSUA 1J6ZA 3I33A 2R7YA 4LF5K 4CCHA 2B4JA 2IVOA 3TANA 3I0RA 1DGKN 3LZJA 2G8UA 1BI4A 3MN5A 4IBNA 3U3GA 1C0MA 3QFPA 3TI0A 5AFUH 4JI6K 3E9LA 2KQ2A 1RT5A 2FSNA 4CHNA 5BRFA 5FPMA 3EE9A 3GDQA 3OBYA 5AQXA 5BRDA 1K9MO 5JLHA 1VQPN 4DTOA 2P9IA 2RKIA 4IFYA 3ID6A 2HHSA 3HBTA 4FL9A 3KK1A 3CFPA 4DQPA 1K8KA 4PA1A 4A57A 4EIAA 3VEVA 3FZHA 4FWPA 4JHDA 4AILC 5AQSA 3ULEB 4ZTFA 1ASWA 3SYZA 3ALYA 1T44A 2ZGYA 3CC7N 4DV5K 4Z94A 4FLWA 1SKSA 1IG9A 1I39A 4KH4A 3SMPA 1GLAG 1LWFA 1NJIO 2OPQA 1Q81O 3KLHA 2CGLA 4Z4EA 1HRHA 3OYCA 3O5BA 4CFBA 2X74A 2E2OA 3KLEA 3MX2A 4K41A 4C8NA 5C25A 5M1OA 4BRGA 4CHQA 4YOYA 4BR2A 4JD2B 4CE9A 3L2WA 1WSIA 4AHUA 1T03A 2HF3A 3QERA 4Z4IA 5C0YA 3TTDA 4K0KK 4CEBA 2P9SA 1OVYA 2YJFA 3LWLA 1TUUA 1VSIA 2Z1GA 4HTLA 4M3ZA 4NCGA 4FK2A 3VQCA 4LFBK 5GIPA 3ULDA 1Q82O 3SZ2A 4KHPK 1VSFA 3P39A 3TTFA 3SQ4A 4WF9L 1NJWA 3WEEA 4K43A 5EVZA 5JMVA 1I94K 5C12A 3AA4A 4IWVA 4ZHRA 3F9MA 1WN7A 4BWMA 4FSVA 3QICA 4CEFA 3E9PA 4FZXC 2NNWA 4UQGA 4CGIA 1GLBG 3IG1A 4I7FA 3BY5A 3P4IA 5HBMA 4BE1A 4F2SA 5AQTA 4AM6A 4FCYA 3OYIA 2NRVA 3TAEA 3K9JA 3LDQA 1VQ5N 1OKJA 2V52B 1S1VA 1WNSA 1LAVA 3S41A 4DFMA 2UXDK 4FM2A 5JS2A 3L2RA 3CJ7A 1RBUA 3F5TA 3QINA 4H4OA 3V9WA 4C1NK 2IVNA 3K2PA 1RDCA 3LM2A 5FPEA 3PUFA 2O4GA 2JLEA 3TARA 2Q97A 3SBTA 1BI4B 4B9SA 4YY3K 4CJFA 3IRXA 4GV9A 4YOVA 3TAQA 3DI6A 4JN4A 1IBMK 2PBDA 4E0DA 1EETA 1BUPA 4Y0WA 1R0AA 1GLCG 4FM0A 5AQFA 2RE2A 4FJGA 2IGIA 2GTDA 2Q36A 4B3TK 2QWLA 3GBTA 3SMSA 4Z0UA 4CD1A 1OVQA 1S22A 4YDUC 4HVJA 2ITGA 1YI2N 1ATRA 3ZSWA 2F8TA 2QWRA 5BRHA 4ILGB 3WXIA 1CZBA 5KPRA 1SUQA 4LSNA 3B6PA 4CK3A 1JCEA 4NB4A 2VGNA 4BRAA 3NGIA 3K57A 4F4KA 1XMOK 4A5AA 4X62K 3N4PA 1YVNA 3B6OA 1RT6A 4KB0A 1YJNN 4JS5A 2ZQBA 4JKCA 1Z25A 3EZWA 2QM1A 4NLCA 4MFBA 1KVCA 4B8AB 4CEQA 5KPTA 3PO4A 4CJQA 1C1CA 3NVKA 2F9TA 4DTUA 4CGDA 2EX3A 3QNOA 1X9SA 3SAHA 5FRNA 4GMJB 5LJWA 4E3SA 3WNGA 3EL2A 1RDBA 2XHBA 3CJBA 3AAPA 4JHDB 3U8XA 1CXUA 4B1UB 4K8XA 3ZT3A 1N33K 2FF3B 2HW3A 1UA0A 3H1VX 3ZSZA 5FDLA 4E7LA 4B9NA 3D6RA 4DF8A 4M3XA 4M42A 2QEXN 3QBWA 2VG6A 4DG1A 3AVJA 3SPYA 2Q1NA 4FW2A 2VG7A 4U67L 3EO3A 1MA9B 2RF2A 3RWUA 4NLBA 4BR9A 4Y1CA 5AQLA 2NRRA 3CPEA 4IJNA 5AZIA 3JAMO 3IFRA 4JK9A 5AQWA 4BDPA 1HX1A 3M1FA 1CZ9A 2HBMA 3A5OC 3AVCA 3ZT2A 2UYTA 3AGKA 2FC0A 5K14A 3QEWA 2HVIA 1FW6A 5SWMA 3D2FB 3JYTA 3A8YA 4H5RA 1Q9XA 1ZBFA 3ZLJA 3MN9A 3HZ6A 4I2PA 1S72N 3VQBA 1QQNA 1Z6RA 4E7HA 2FLOA 4CZHA 2FSJA 3MECA 4BRFA 1FJGK 1Z05A 4JLHA 3FLCO 4DSFA 3LAKA 2A6AA 3F73A 3SJHA 3OS2A 1HJOA 4CJWA 2VQEK 3S9HA 2JWLA 3VETA 2ASMA 4CEDA 3A2FA 3R9PA 3PX6A 4CIFA 4EZ9A 1U47A 2ZF5O 1FKOA 2Q0UA 2Q2RA 3CG7A 4YOTA 5H1SQ 5IWAK 3MCAB 3THYA 4M3WA 1K8AO 3AGRA 1P8ZA 4LF9K 1ASVA 4B8CA 2B6AA 3GE1A 1NK7A 4CZGA 4BG8A 1ATSA 4B1VA 2DFHA 3CJ1A 4A61A 4CW7B 1RILA 1NJYA 5M1FA 4OKEA 1VQLN 3P1GA 3DXMA 1GLDG 4H0XB 2NRHA 1S9GA 3MXJA 2Y1JA 4BREA 4EHTA 5FRMA 3OTOK 4FLTA 3C0BA 3CQ8A 4MQ3A 1QQCA 2KLAA 2VWKA 3EY1A 3NBPA 3R6MA 3OYAA 1D9DA 2W41A 2E6LA 2QKKA 3CIPA 3DYAA 5D3GA 3RVCA 1D5AA 1NGIA 4M3UA 1IKXA 5AQNA 3DRRA 4DV4K 4FJJA 1WOQA 4IKFA 2HNDA 5JLFA 4DV0K 4DTSA 3FZKA 4RW8A 4CJ4A 1W2BM 2GUPA 4FZYA 1P90A 3RMAA 3OW2M 3ID8A 1S5JA 4DSJA 2V7ZA 1U04A 1X1PA 1ITGA 1WSEA 3WXLA 4FWOA 1N5YA 1C6VA 1TGOA 2YNIA 4MLHA 3SK3A 4NCBA 3THVA 1X3NA 1NGFA 3HTVA 3NFAA 4E7KA 5EU7A 1KAZA 3FZMA 1CZAN 1C0GA 1EO1A 3UKUB 4CHYA 3ZEUB 4WQ5C 2D0CA 1NK6A 4EZ6A 4EHUA 3ZETB 4AHSA 2CGKA 4DB3A 5AQVA 3I8DA 1NK5A 3VESA 4KTQA 3VEZA 3CCJN 1KTQA 4B1XB 4X65K 3LWMA 4DFKA 2QWPA 3B8AX 3DLGA 4JI8K 2HHQA 3E9OA 3SNNA 1RBVA 4N76A 3MX5A 4B9UA 4FJ7A 4BC2A 5BREA 4R79A 4FJIA 2IC3A 1GLFO 4K42A 4BRQA 4KFBA 3OYKA 1ZBUA 5DMRA 5LY3A 3FFKB 4B9QA 1S1XA 4BRPA 4GV6A 1K8KB 1GLJO 3C6HA 4WCEL 4DCHA 1ILYA 1L3TA 4JAXA 3WQTA 5AQRA 3ZT4A 3VQPA 3AA5X 1RTHA 3KKRA 1EWRA 3BGRA 4YHHK 2P9NB 5AQGA 2HNYA 2Y1IA 1KLNA 3ZEUA 3C94A 1WAJA 2PFUA 4CGHA 3TAMA 4LF4K 4DMNA 4CVNE 1K73O 4GKJK 4MLEA 4CZFA 1NK0A 3SPZA 4MDAA 1N34K 1HNXK 4DQQA 1NGCA 2RPIA 1QVGM 3M8SA 2IDOA 1JXEA 4DR6K 1T7PA 3CF5L 3T1AA 5IT9O 4FLUA 4AH9A 4I6MA 4E1NA 5T7BA 3AV9A 2O4IA 1O13A 1NBWA 4ISFA 1BIZA 3LZIA 3CXCM 3M8QA 4KRFA 4HUGA 4NXMK 3SI6A 3RR8A 1HUXA 4JRQA 4BE0A 3V9SA 1OH6A 4BDZA 4EFHA 4FJHA 3HO1A 5M1PA 4IJAA 4YFUA 1DKGD 1G15A 4BRKA 4BR4A 2GELA 3TABA 4PKIA 4BC3A 3NH0A 4JI4K 4KAZA 4A2AA 3CJAA 2FBXA 3MN7A 4E7JA 1NGGA 1N8RO 4DQIA 3LDOA 3AVMA 4DWIA 1KXPA 4A2BA 5CZ2A 4XH1A 2HVHA 1FXXA 5KGWA 3OYMA 3NF8A 1WB9A 2QKBA 1OH7A 1VHXA 3OHRA 4JKEA 4BGBA 3MEDA 3NE6A 3SUPA 3G4SN 1YTUA 4BGAA 4K25A 4PWDA 1S3XA 5AQOA 1TUYA 2Q31A 3MXMA 5FLXO 4LFCK 3HXMA 4HCBA 3CCMN 4B3SK 4I6MB 3KD5E 4LSLA 2ASOA 1BL3A 3THWA 1VK0A 4C23A 4IFVA 1XI1A 1X9WA 2YX6A 3UKRA 1YJ9N 3TAFA 1VSDA 3QMLA 4DTJA 4DTPA 5AQIA 1D4XA 3M8PA 2LSNA 4CJEA 4CEZA 1NJZA 4CIEA 3IKMA 4KREA 4B9TA 3MEEA 2YHXA 1LW2A 3L3VA 1NMDA 1XC3A 5LMNK 1QQMA 4C1NI 2PYJA 2P9UB 3KWGA 3C7NB 3AO3A 1BA0A 4E1JA 5KRTA 1NKBA 2O8FB 5CR4A 2ETJA 2XO7A 4GV3A 4HCCA 5AJ3K 3KIOA 1RBRA 4HWIA 1JL2A 3A0IX 3O3GA 4DQRA 5FPDA 4JV5K 3DJCA 2O8BB 3ZX0A 4BG9A 3DXKA 1C0UA 5C2FA 1SL0A 3ZSVA 4BVOA 1VSHA 4BR5A 1XUPO 3ZX3A 4OPJA 4B3OA 4JKDA 4DFPA 2E2PA 5BR9A 4FYDA 3S3NA 1FKPA 4GNIA 3LDPA 2ZJPL 3CCEN 5EY4A 4M3TA 4CBXA 1HKCA 3OYBA 1N32K 5KTQA 1LWCA 4CJVA 4RTFD 2KFZA 5GINA 1TYQA 3NDKA 1NM1A 3K5NA 3ITHA 4DHYA 4DTRA 3NGYA 5SZTA 4AHCA 2W6KA 4DV7K 1NK9A 4WQ4A 1I3AA 3Q7CA 4M41A 1RT2A 2OPPA 3KJVA 4H8KA 2BGGA 4FW1A 3V9UA 4YNQA 4QCLA 4GY2B 2J4RA 3VGKA 1C1AA 4CF1A 4X66K 1HPZA 1UOCA 3H3OB 3PIPL 3HT3A 3W0LA 1S6QA 1V4TA 4CK1A 4WYBA 4CGFA 2GUIA 3T7ZA 3ZX2A 3WNFA 3NCIA 2BANA 4CGJA 3V6DA 1S9EA 3HM9A 3JS6A 3VGMA 1JKHA 1XQSC 2KKZA 2YV0X 5J2MA 2P5OA 4BROA 3C6TA 3QBXA 4CJ5A 3SAFA 3J81O 1N36K 2ASPA 3HI0A 1LOTB 1ZC6A 3ATUA 4JI1K 3DLRA 3HP6A 1T3VA 3WQUA 2V7YA 3CPWM 4PHTX 3OY9A 4JI0K 1QSLA 2F4VK 3M6GA 3VA3A 4FWMA 3VEYA 4XIUA 3CCRN 4JI5K 3AVFA 1UA1A 2KFNA 2HHUA 5E84A 1BISA 2I5JA 3DLKA 3MXIA 1KVBA 1RT1A 5C42A 3K5LA 4F8RA 3SV3A 1CLQA 2WC9A 2YNHA 3A5LC 1TL3A 3EE8A 3OYEA 1BU6O 3PV8A 4ELTA 2IIRA 2UU9K 4B3RK 4KB1A 2G8KA 4O55A 3CETA 4ILHA 3TR8A 4FK4A 4OO1J 1EKEA 2P9PA 3O1BA 3L2QA 5I42A 3DRPA 3CCVN 1NKCA 4DV3K 4C8LA 1XNRK 4CZLA 4DSKA 3VN5A 1LV5A 4PKGA 3CMEN 3VPZA 4CZMA 4RW7A 3WNHA 4KBOA 4LH4A 3KD1E 4O44A 1WSFA 4L3QA 4RW9A 2FBTA 3BZCA 3NF9A 5HRSA 1BHLA 1ZBHA 4Q5VA 3J7AP 2Z1JA 1RTIA 1BGXT 3CCSN 4JI3K 4JEPA 3S3OA 3THXA 4IOXA 2O8BA 2ZE2A 1BCOA 2GWJA 4JK8A 4W5RA 2HSTA 2OANA 3KK2A 4BE2A 1B9DA 4CHPA 3OYDA 3NHGA 3VEXA 5ADXA 2G8HA 4WFNL 4KHWA 4CHZA 1RFQA 4QAGA 1SQKA 3ZT1A 3J8AA 3C7NA 4WQ5A 4AF1A 2G8WA 4CEAA 3CCQN 1Q18A 2YNGA 3D2EA 4IZ9A 2O8FA 1NGAA 4JD2A 4DQ8A 4ZTJA 2AA4A 2QWOA 3J7YP 5CYMA 2VWBA 4JNEA 1H1VA 1Q9YA 3QIPA 1YITN 2P9LA 4A5BA 3CM5A 4IEEA 3H3NO 3IMXA 1W9HA 1MU2A 1NGJA 2P9KA 2NZTA 4DTXA 3KTQA 2NRXA 1NK8A 3VERA 4M3YA 1XMQK 5JVGL 1RBSA 2P5GA 1JLBA 1HLUA 4RW6A 4YOWA 4G1QA 2FSKA 5LL6Z 3AVNA 3PSFA 3AY9A 3CQXA 3PY8A 2HBLA 3HOSA 5AQJA 4FVMA 1WLJA 2AP1A 2D1KA 4B9LA 4DV1K 4O0JA 3IS9A 1ATNA 1JLEA 4YOUA 4FWQA 4KHQA 2QA4N 3AVAA 1U45A 1MWMA 3GOIA 2ITMA 4FWRA 3KK3A 3LDSA 4BWJA 4O5BA 4NO7A 4KH5A 2XY8A 2G8FA 3DLHA 3EKUA 1RTJA 3SBGA 2E1YA 3TAPA 3LPUA 1HNIA 3HL8A 1VQNN 1D9FA 3VQ9A 4FLYA 5GIOA 3LAMA 4H5VA 2NRTA 4KI6A 3LP1A 2RHKA 4N56A 2IOCA 3UKRB 3PLAA 3M8RA 3G71N 4N47A 3VQDA 4LY7A 4FM1A 1OH5A 4CZIA 4J2EA 4O5FA 4FLVA 3NVMA 2O8DA 3CFRA 2RN2A 4BRNA 4HTUA 4FWNA 3QNNA 3LPTA 3KHYA 5M1KA 3H08A 3VEOA 3L0QA 4JI2K 1NKEA 3OYLA 4LF7K 5E41A 4LC9B 3BDPA 3LANA 3AVBA 4WQ4C 4CJPA 3O9RA 3QIOA 2WONA 1TVRA 1U4BA 5C2DA 1NG9A 2D0OA 4PUOA 3SQ1A 3A5MC 3GG4A 5DK5A 4JRPA 3P5JA 4GVEA 1JLGA 3L4QA 4B1YB 3NF6A 3CC2N 1NGBA 4FJ9A 4IG0A 4OJRA 1EQYA 2DY4A 1SS6A 5MLCQ 4BDYA 1IKYA 3WXMB 4A62A 1BQNA 3DXMB 2X6SA 3ZYYX 1HMVA 5F1XA 3ENHA 2E8AA 4A59A 4V19S 1RDUA 2A3ZA 2HB5A 4C8MA 1JLAA 4ELVA 1WSGA 3ATVA 3ZT0A 3AO4A 3KZBA 1IKVA 1JLFA 4CHOA 3C6UA 4WE1A 4CJLA 3L2VA 3T69A 1IJJA 2YKNA 4CF0A 4AHVA 4BRMA 4O8KA 4FJLA 5AZJA 3D7EO 2QWNA 4F9OA 1BIUA 4AM7A 2A5XA 5AQMA 4FWLA 1NOZA 1ZBLA 2P9UA 2I7NA 2CGJA 4CJTA 4FWKA 4KPYA 4FJ5A 4BC4A 4Z4FA 1WUAA 3CC4N 4KTZA 3V1OA 1S1UA 2GX9A 5FPNA 5EX5A 3VTIA 2O8DB 5DM6L 1KCFA 2Q3SA 3V1QA 1NK4A 2CH6A 4O0IA 1J54A 1VSKA 4OLAA 5J1EA 1U2VB 4FK0A 1YVUA 2P9NA 4OPKA 4W5TA 4BRIA 4DV6K 4H0YB 1T8EA 4M45A 1G99A 2HNZA 3EZ5A 3D2FA 1X9JA 1KFSA 2JWKA 3LP2A 5FROA 3WXKA 4CBUA 3C65A 3O3FA 4B08A 4LH5A 3U6FA 1LWEA 3PSIA 3RMDA 2KTQA 4OPHA 1S6PA 3HJFA 3WNEA 3PX0A 1NNEA 3VQ5A 4RWTA 5E26A 1GOCA 4KHYA 3ENBA 3L3UA 1TL1A 5F2RA 3QEIA 1BA1A 5HOOA 1NMNA 1HYZA 4CZJA 2P51A 5KGXA 4EP4A 3I8BA 5GAHP 5AQZA 5CY4A 3WEEB 3O3HA 3VF2A 3CHWA 2Z1IA 3MAQA 1T05A 3DLLL 2YHBA 3TSQA 4BR7A 3RRGA 3FFIA 1RNHA 5KQDA 3R1XA 3VMFB 1EP4A 1BWFO 3RRHA 2HBJA 3NAEA 3T19A 3SCXA 2VQFK 1KAXA 3CCUN 3V81A 4I2QA 1NLVA 3EN9A 3R3LA 3O9UA 5AQPA 1IO2A 4B9VA 5CE3A 4CF9A 4DSLA 1J5OA 4NYNA 3AVKA 4FOIA 2HHTA 1HNVA 1IBKK 4G9ZA 2YI1A 1JLQA 4IFEA 2Q0RA 4OKJA 4HHTA 3QEVA 3DLEA 4N5SA 4M63C 3OYHA 2O8CB 4XH5A 4M7YA 4U7BA 1NWKA 2VYPA 2A40A 4DR7K 1U49A 2KHOA 5AQYA 1EX4A 3E01A 1RBTA 1YXQA 2E1ZA 3AARA 3CFOA 1E4GT 1B9FA 1GOBA 1GLEG 2WBNA 4EAHD 3AVHA 1YAGA 1VQ8N 3RSEB 4WFBL 3HP9A 3QESA 1HNWK 4BRHA 4CD3A 1OH8A 4ISGA 2O8EB 4DTNA 5I9EB 3K5MA 4R5PA 4OGCA 1NJXA 4BVPA 3W3DA 2D0PA 3O4WA 2ZM6K 1ZXOA 1X3MA 1C0TA 4HUFA 3FZLA 4DTMA 3PX4A 3IUCA 1VQ9N 4FPBA 2D5RA 3FGUA 3VQEA 3O4QA 2PZSA 4KHSA 4H0TB 1EXQA 1SL2A 1KLMA 1RT3A 1NOYA 1TAUA 2B5JA 2P9IB 3NH1A 3K9KA 4CJRA 4WFAL 4F3TA 1A5WA 1WSHA 4GVMA 1IG8A 5HL7L 4YORA 3E66A 3RTVA 2BDPA 4FJ8A 2QWQA 4E7IA 1Y64A 3HK2A 1MWKA 2FXUA 5GADP 2A1RA 1U6ZA 3T3FA 3IDHA 1E3MA 4IG3A 4DUYK 3MWPA 4JI7K 4Q0BA 1HYVA 1S1WA 1KFDA 3ZSRA 4DUZK 5KQ8A 1GOAA 4YDUA 4LF6K 4ISEA 1DTQA 1O1WA 4W5OA 2NRZA 1J9AA 2X6NA 2ZJRL 2YNFA 2ZGZA 2QK9A 3O8MA 1D8YA 1FK9A 4CEOA 3SJJA 1WSJA 2KZMA 1NU0A 3TSPA 4FO0A 4Z4GA 3VQ7A 4CESA 2UXBK 4H03B 4AHRA 5LJVA 3ZSQA 1WAFA 2A42A 3DXKB 4CFCA 2W42A 2Z1HA 1QTMA 3OYFA 5ELZA 4IOCL 3ZSXA 3HVRA 1KRPA 2FBVA 3UB5A 1QS4A 4H0OA 4H5WA 1KAYA 1HKBA 3GL1A 4JKBA 3LM9A 5HP1A 2FBYA 3SAGA 4BRDA 2D0BA 2VG5A 3CJCA 3NF7A 3I56N 1YT3A 3OYNA 3ZETA 4MDBA 1U48A 4CBWA 5J2NA 4YOXA 2GBZA 2IS3A 2OTLN 1NGDA 4IO9L 1K6YA 4CK2A 4Z4HA 5BN9A 3D2EB 4BQLA 3H1QA 2E6MA 2QW9A 4H5NA 3VA0A 1DEJA 1IKWA 2E4LA 3DM2A 5GAEP 4CFAA 4HUEA 3U3YA 4M3RA 1SKRA 1A5VA 3DMJA 3U9DA 5DM7L 2OZSA 4DF4A 3HRGA 1KVAA 3HSTB 2HHHK 1J5EK 2ZWHA 2OPRA 4Z4CA 1X9MA 2NLXA 3AA3A 3RSEA 4ICLA 2OA8A 4JK7A 1KSPA 4ELUA 3P31A 1SL1A 5HROA 2CH5A 1VQKN 1SKWA 3CM6A 5B8HA 3OYGA 2OPSA 1L5UA 2F8SA 3SUQA 3H45C 1NGEA 4FWSA 2E2NA 1Z26A 3AO1A 4CJKA 3K58A 4ID1A 3AO2A 2YKMA 4J8FA 1IV0A 4MO4A 1TK0A 4PKHA 3VQ8A 2HF4A 1DLOA 2E20A 4DV2K 2VGMA 1L3VA 2ZJQL 1XWLA 4CZKA 1C0FA 5AQHA 2VWJA 4CZEA 4CGGA 1QSSA 4DLGA 3O80A 3U9ZA 3V9XA 2PY5A 4GKKK 1W0HA 3VOVA 3C6AA 4PQUA 3F9KA 1E4FT 4PY5A 1M90O 3PIOL 1IH7A 1XC9A 1QHTA 3CQYA 1L3UA 1UWBA 3ZSOA 4DFJA 3O08A 1Q8IA 4OGEA 1KQSM 3RMCA 3QO9A 3HPHA 3ISNC 5TKWA 3O1WA 3N4QA 2UXCK 4CFDA 3M3ZA 1TYQB 2EHGA 5BR8K 5C15A 4F3OA 4RG8A 4J2BA 1TV6A 2UUAK 3WUHA 4H0PA 4JKFA 1ESVA 3TWHA 4FPAA 3TPQA 5TKYA 3O9QA 4IDKA 4QS7A 1BCMA 2P9LB 4DKWA 3O9TA 5I3UA 1VQMN 2ZD1A 4JKGA 3AO5A 1RDDA 1ASUA 4DLEA 1DT9A 1JCFA 3BEXA 1JCGA 4B1ZA 1QSYA 4IXCA 3JSMA 3K5OA 3K0SA 1UAXA 4DSEA 1W97L 3CJ9A 2YHAA 1LCUA 3CMAN 5KI6A 4JKHA 4C8OA 3NH2A 1QHAA 4L8RB 1TK5A 4CI6A 2V51B 4OX9K 3WT0A 4FJNA 2A41A 1TKZA 3AA2A 3SUNA 3CI5A 4LF8K 1HQEA 4XEIA 1VQ6N 1MDUB 4DR5K 2G8VA 3EEQA 1WBDA 1B92A 1SZ2A 2XY7A 1CXQA 3MWTA 3VQAA 5BN8A 4BQZA 1V4SA 2OZMA 4J2DA 2BUPA 4DS4A 4B9MA 2F96A 3TAGA 2DFEA 3LALA 1Q86O 3QEXA 4E89A 4JKGB 4O4GA 1RTDA 4W5NA 1Q7YO 3MMVA 2OYQA 1S1TA 3J7ZO 3VEWA 3MEGA 5ADXH 3OJUA 1WBBA 3U4LA 4NYFA 4H0VB 1N6QA 3KLFA 2W40A 3THXB 3G10A 1IBLK 2ATQA 2VCPA 3L4IA 3MCPA 2DFFA 3IAYA 4B1WB 2H3GX 1M1KO 1TAQA 3HPOA 1EWQA 3M5RA 3I55N 3RR7A 4IOAL 4DR4K 3R8EA 5M1QA 3QDKA 3AVIA 3JXUA 5HRNA 3V4IA 1C1BA 4FZZA 3T1HK 4KO0A 2XY6A 4AQYK 1VSEA 4KH6A 4EP5A 3KVGA 4CF2A 1R59O 4O8UA 4DU4A 1ZYQA 4B3MK 3Q7BA 1QVFM 4I9LA 5AQUA 4DR2K 3VGLA 3AVLA 3MDQA 1JL1A 1GLLO 3LP0A 3CERA 3ASMA 5F0XA 2GWKA 1VRUA 3L6QA 2BH1A 2YCHA 5AR0A 2HOEA 4E19A 3V9ZA 3FE1A 4RW4A 4BR0A 1VQ7N 3QEPA 2YJEA 5CHIA 2FF6A 3O9SA 1W7AA 2QI2A 2E5LK 2QXFA 2GEMA 3QB0A 4NCAA 1VSMA 2O8CA 5C24A 2F9WA 2P9SB 3D0PA 3HYFA 4IDHA 1XHXA 4KV8A 1TKDA 4K8ZA 1TKXA 3OS0A 4W5QA 4PL7A 2I7PA 4MO5A 5JS1A 2WOMA 4FOEA 4DU1A 1QE1A 3VQQA 1DTTA 3PO5A 4FJXA 3OVNA 3H6EA 4KTWA 5HRRA 3THWB 4QS9A 4OPAA 5KPZA 1T6DA 1HNZK 3FR0A 1A5XA 1VSJA 2QXLA 3BF1A 5BPMA 3DLBA 1L3SA 1NGHA 4IEIA 4RCHA 5AQQA 3E1YA 1YTAA 5BPLA 4KHUA 4CERA 4ILJA 1HQUA 3BP8A 1BQMA 3VF6A 4QOZB 4BY9C 3VQ6A 3DWLA 3I0SA 3KKSA 2OCEA 3T1YK 3EYZA 5AFUA 5AZIB 3HM8A 2KZZA 4UY8O 4Y1DA 3LP3A 3ULEA 5AZJB 3DOKA 4BACA 2IVPA 2QTDA 2HMPA 2AJQA 3A5NC 3O4NA 1RGIA 3HOTA 2BTFA 1RCHA 3OYJA 3CCLN 1HKGA 2WTUA 5HRPA 1TKTA 1TK8A 1RDAA 3OBWA 2OTJN 3ZCMA 2X78A 3QFUA 3VQ4A 4KI4A 1YIJN 4GW6A 2HHWA 5A2QO 4KHNA 4ID5A 4FLXA 2PAVA 4M7XA 4JKAA 1QZ5A 1YJWN 3AAQA 3THYB 1VAZA 1BDGA 3LDLA 2P1JA 4H5TA 3G0ZA 2DPNA 3D45A 3MN6A 2HBKA 4LD0A 2HHVA 4CJ3A 2HMIA 4CECA 4J2AA 3P38A 1BO5O 2NRWA 1U2VA 2W6LA 2XY5A 5AQKA 4OKKA 3TTCA 1RT4A 3VTHA 5CYQA 3OJSA 1YHQN 1KD1O 2D4WA 3UIQA 3EKSA 2IAJA 3KK7A 5KRSA 2NUBA 1ZBSA 1LW0A 2UUCK 3HSCA 4DR1K 4DS5A 4CJSA 1JXBA 1XHZA 1REVA 1SV5A 2JGUA 3SUOA 3V1RA 4QS8A 2YHWA 5C10A 2P9PB 3F2KA 2G8IA 4KKOA 4CF8A 4FJKA 2XRIA 4FLZA 2DTUA 4CJ7A 3LDNA 4F2RA 1RT7A 3KWIA 4X64K 3QLHA 3SQ0A 3SQ2A 5J2PA 1VRTA 4XH4A 1HYSA 2YHYA 1YF5L 1YUWA 3C95A 4DU3A 5CZ1A 4CJUA 2GV9A 4DR3K 4LFAK 4FXDA 3DAWA 3S3MA 1RDWX 2P9KB 1QZ6A 3P83D 4DQSA 3TU5A 3UKUA 2BE2A 3SLCA 1SAZA 2D0AA 4C8KA 2WFBA 3RMBA 2F7TA 1VQ4N 4BRLA 3SV4A 2HHXA 3NMUA 3G25A 5M1NA 3HPGA 3KLIA 4TSXA 1KC8O 4JYAK 4OLBA 1Y97A 3ENOA 3O6WA 3G6EN 3KLGA 3QETA 2PYLA 3HVTA 4CEEA 3CYMA 1HPMA 3DRSA 1BOTO 1LAWA 5BPNA 2QWMA 4NXNK 4IO8A 2EWSA 1HJRA 2UUBK 1T6CA 3FZFA 2E88A 4E1MA 1JLCA 5JVHL 4FVUA 4H4MA 4I9QA 3CD6N 5JICA 4BC5A 2O8EA 5GAGP 3OA9A 5EXWA 1JJ2M 3AVGA 4OVLA 5J2QA 4N41A 3BF3A 3UE5A 1ZBIA 4PL8A 3J80O 5EOYA 4FJMA 1J53A 4BRCA 3ZSYA 4DSIA 3K59A 3BZKA 5HLFA 3VENA 1XNQK 3OS1A 2E2QA 3BUZB 3L2UA 1VQON 4AHTA 5LMUK 2A1SA 1HR0K 3L8BA 3DOLA 1QQOA 4JS4A 3LL3A 1BG3A 1F21A 1VSLA 2KW4A 3VF4A 3WXJA 3NGZA
chains in the Genus database with same CATH topology
2CGKA 2WUSA 4DB3A 1E4FT 5AQVA 3MK6A 1M90O 3H46O 3EKUA 3SBGA 3TSUA 1J6ZA 3VESA 2E1YA 3PIOL 3I33A 3VEZA 3CCJN 4B1XB 2IVOA 3CQYA 1VQNN 3O08A 1DGKN 1KQSM 5GIOA 2QWPA 3MN5A 4H5VA 3B8AX 2NRTA 2RHKA 3E9OA 3N4QA 3O1WA 5TKWA 3QFPA 3MX5A 3UKRB 3PLAA 3M3ZA 1TYQB 4BC2A 5AFUH 5BREA 4R79A 3G71N 1GLFO 4K42A 3E9LA 4BRQA 4CZIA 5C15A 2FSNA 5LY3A 5BRFA 3FFKB 4O5FA 4B9QA 5FPMA 4BRPA 4GV6A 3EE9A 1K8KB 3GDQA 3NVMA 3WUHA 4H0PA 4JKFA 1ESVA 1GLJO 3C6HA 3OBYA 4FPAA 5AQXA 4BRNA 4WCEL 3TPQA 5TKYA 3O9QA 4QS7A 4DCHA 5BRDA 1K9MO 5JLHA 1ILYA 2P9LB 4FWNA 1VQPN 4JAXA 3WQTA 4DKWA 3KHYA 2P9IA 5AQRA 3ID6A 3O9TA 5M1KA 3HBTA 1VQMN 4FL9A 4JKGA 3VEOA 3L0QA 2P9NB 1K8KA 4LC9B 5AQGA 4A57A 4EIAA 3VEVA 3FZHA 4FWPA 1DT9A 1JCFA 3BEXA 4WQ4C 3ZEUA 2PFUA 1JCGA 3O9RA 4B1ZA 4JHDA 5C2DA 2D0OA 4IXCA 1K73O 4MLEA 4CZFA 3A5MC 3GG4A 4GVEA 4MDAA 3L4QA 5AQSA 3ULEB 4B1YB 3CC2N 1NGCA 1NGBA 1W97L 3CJ9A 1QVGM 1EQYA 1SS6A 5MLCQ 1T44A 2ZGYA 1LCUA 3CMAN 3CC7N 4JKHA 3CF5L 3WXMB 4A62A 3DXMB 4Z94A 3ZYYX 1QHAA 5F1XA 4CI6A 2V51B 4I6MA 3ENHA 3WT0A 2E8AA 2A41A 4A59A 4KH4A 3CI5A 3SMPA 1RDUA 1GLAG 2A3ZA 1NJIO 4XEIA 1O13A 1NBWA 4ISFA 1Q81O 1VQ6N 3ATVA 3KZBA 3CXCM 1MDUB 2CGLA 3T69A 3O5BA 1IJJA 1HUXA 1SZ2A 2E2OA 4BRMA 4O8KA 3MX2A 4EFHA 5AZJA 3MWTA 3D7EO 4K41A 5M1PA 2QWNA 4F9OA 5BN8A 4IJAA 5M1OA 4BRGA 4BQZA 4YOYA 4BR2A 4JD2B 1DKGD 4AM7A 1V4SA 2A5XA 4BRKA 4BR4A 5AQMA 2BUPA 4FWLA 2GELA 2HF3A 4PKIA 4BC3A 2P9UA 2I7NA 4A2AA 2CGJA 5C0YA 3CJAA 3TTDA 3MN7A 4FWKA 1Q86O 4JKGB 2P9SA 1NGGA 1OVYA 2YJFA 3LDOA 3MMVA 4BC4A 1Q7YO 1KXPA 1TUUA 1WUAA 4HTLA 3VEWA 4A2BA 5ADXH 3J7ZO 2GX9A 3CC4N 5FPNA 5EX5A 3VTIA 5DM6L 4XH1A 3U4LA 5GIPA 4H0VB 1Q82O 2W40A 2CH6A 3OHRA 4JKEA 3P39A 2VCPA 3L4IA 3MCPA 3TTFA 4BGBA 4B1WB 2H3GX 1M1KO 1U2VB 3M5RA 3G4SN 2P9NA 4WF9L 3I55N 3WEEA 4IOAL 4K43A 5EVZA 5JMVA 4BGAA 4K25A 3R8EA 5C12A 4BRIA 5M1QA 3QDKA 1S3XA 4IWVA 5AQOA 3F9MA 3JXUA 1TUYA 4H0YB 4FSVA 1G99A 3QICA 2Q31A 3E9PA 2NNWA 3D2FA 1X9JA 1GLBG 2JWKA 3P4IA 4KH6A 3CCMN 4I6MB 5AQTA 3KVGA 4AM6A 1R59O 4O8UA 2NRVA 3WXKA 3C65A 4CBUA 3Q7BA 1QVFM 3K9JA 3LDQA 1VQ5N 1OKJA 2ASOA 2V52B 5AQUA 3VGLA 4C23A 3MDQA 4OPHA 1GLLO 3S41A 3CERA 2YX6A 5F0XA 2GWKA 3CJ7A 3UKRA 1YJ9N 3L6QA 2BH1A 3F5TA 4RWTA 4C1NK 2IVNA 2YCHA 5E26A 5AR0A 3LM2A 2HOEA 3QMLA 5FPEA 5AQIA 1D4XA 3FE1A 3ENBA 5F2RA 2Q97A 3SBTA 3IKMA 4BR0A 1VQ7N 1BA1A 5HOOA 2YJEA 2YHXA 5CHIA 2FF6A 3O9SA 1NMDA 1XC3A 1QQMA 4C1NI 2QI2A 2P9UB 4CZJA 3KWGA 3C7NB 2GEMA 3QB0A 4GV9A 1BA0A 3I8BA 4E1JA 4YOVA 2F9WA 2P9SB 4IDHA 5CR4A 4GV3A 4JN4A 5GAHP 2PBDA 5AQZA 4HWIA 1BUPA 3WEEB 4Y0WA 3VF2A 4PL7A 3A0IX 1GLCG 3CHWA 2I7PA 4MO5A 5FPDA 3DJCA 4FOEA 5AQFA 3DLLL 2RE2A 3ZX0A 3TSQA 4BG9A 3DXKA 2GTDA 4BR7A 5C2FA 2Q36A 2QWLA 4BVOA 3GBTA 3H6EA 3R1XA 3SMSA 3VMFB 4CD1A 5KQDA 1BWFO 4BR5A 2HBJA 1XUPO 3ZX3A 4QS9A 4OPAA 4JKDA 1S22A 4YDUC 5KPZA 1KAXA 1T6DA 3CCUN 2E2PA 1ATRA 3FR0A 1YI2N 2QWRA 5BR9A 5BRHA 2QXLA 4GNIA 4ILGB 3BF1A 5BPMA 3WXIA 1NGHA 1NLVA 4IEIA 3EN9A 5KPRA 3R3LA 3O9UA 3LDPA 4RCHA 5AQPA 3E1YA 5AQQA 2ZJPL 5CE3A 1JCEA 5EY4A 5BPLA 3CCEN 4CBXA 4ILJA 1HKCA 4FOIA 3BP8A 4NB4A 2VGNA 3VF6A 4G9ZA 4BY9C 4BRAA 3DWLA 2YI1A 4IFEA 2Q0RA 4RTFD 3N4PA 1YVNA 4A5AA 5GINA 1TYQA 5AFUA 5AZIB 1NM1A 3HM8A 1YJNN 4UY8O 4M63C 3ULEA 4DHYA 5AZJB 4JKCA 3EZWA 4XH5A 4M7YA 2IVPA 2QM1A 4U7BA 1NWKA 2QTDA 2A40A 2HMPA 2VYPA 4NLCA 2KHOA 5AQYA 3A5NC 1YXQA 2E1ZA 1RGIA 4WQ4A 3HOTA 3AARA 2BTFA 3Q7CA 1E4GT 5KPTA 3CCLN 1HKGA 1GLEG 2WBNA 4EAHD 1YAGA 1VQ8N 3RSEB 4WFBL 3OBWA 3NVKA 2OTJN 4BRHA 2F9TA 4GY2B 4CD3A 2J4RA 3VGKA 4ISGA 3QFUA 1YIJN 3SAHA 5I9EB 5LJWA 3H3OB 3PIPL 3EL2A 3W0LA 2PAVA 4BVPA 2D0PA 3O4WA 4M7XA 4JKAA 3W3DA 1V4TA 1QZ5A 3AAPA 3CJBA 4JHDB 1YJWN 3AAQA 1ZXOA 3U8XA 1X3MA 4WYBA 3T7ZA 3FZLA 1VAZA 1BDGA 3LDLA 3ZX2A 4B1UB 3IUCA 1VQ9N 4FPBA 3FGUA 4H5TA 2DPNA 4H0TB 2FF3B 3MN6A 2HBKA 3H1VX 3JS6A 3VGMA 1XQSC 2KKZA 3P38A 3D6RA 1BO5O 2NRWA 2P9IB 4BROA 2QEXN 3K9KA 3QBXA 3SAFA 3QBWA 4WFAL 2ASPA 3HI0A 1U2VA 1LOTB 1ZC6A 3ATUA 1IG8A 5HL7L 2Q1NA 1T3VA 3E66A 4YORA 5AQKA 3WQUA 3TTCA 4U67L 3EO3A 1MA9B 2V7YA 3CPWM 4PHTX 2QWQA 3VTHA 4NLBA 1Y64A 4BR9A 1MWKA 3M6GA 2FXUA 5AQLA 5GADP 2NRRA 4FWMA 1U6ZA 3CPEA 3IDHA 4IJNA 3VEYA 5AZIA 1YHQN 1KD1O 2D4WA 3IFRA 3MWPA 4JK9A 3EKSA 5AQWA 3KK7A 1HX1A 3M1FA 3CCRN 2HBMA 3A5OC 5E84A 2UYTA 1ZBSA 3HSCA 3AGKA 5KQ8A 4YDUA 4ISEA 3D2FB 2WC9A 2NRZA 3A5LC 3A8YA 4H5RA 4QS8A 2YHWA 5C10A 2ZJRL 3EE8A 2ZGZA 3VOVA 2P9PB 1BU6O 3HZ6A 3MN9A 3O8MA 1S72N 3F2KA 1QQNA 1Z6RA 2IIRA 2FLOA 4CZHA 2FSJA 4CJ7A 3TSPA 3LDNA 4BRFA 3CETA 4FO0A 4ILHA 3KWIA 4OO1J 1Z05A 3FLCO 4H03B 5LJVA 2A42A 3DXKB 2A6AA 2P9PA 3O1BA 3SJHA 4XH4A 5ELZA 2YHYA 1HJOA 3CCVN 2JWLA 3VETA 4IOCL 2ASMA 1YF5L 1YUWA 3R9PA 4CZLA 4PKGA 3UB5A 3CMEN 3VPZA 4CZMA 4H0OA 4H5WA 1KAYA 4KBOA 1HKBA 2ZF5O 2Q0UA 2Q2RA 3GL1A 4JKBA 4YOTA 5H1SQ 3LM9A 3MCAB 3DAWA 3SAGA 4L3QA 1RDWX 2P9KB 4BRDA 1N8RO 1QZ6A 3CJCA 1K8AO 3I56N 3TU5A 3AGRA 3UKUA 3SLCA 3CCSN 1P8ZA 4JEPA 3ZETA 4MDBA 1SAZA 4CBWA 4IOXA 4YOXA 2GWJA 3GE1A 4JK8A 2OTLN 1NGDA 4CZGA 2WFBA 4BG8A 2HSTA 1ATSA 2OANA 2F7TA 4IO9L 4BRLA 1VQ4N 4B1VA 3NMUA 3CJ1A 4A61A 3G25A 5BN9A 5M1NA 3D2EB 4BQLA 3H1QA 2QW9A 4H5NA 3VEXA 1DEJA 5M1FA 5ADXA 1VQLN 1KC8O 3ENOA 3O6WA 4WFNL 3G6EN 3DXMA 1GLDG 5GAEP 4H0XB 1RFQA 4AF1A 1SQKA 3J8AA 3C7NA 4WQ5A 2NRHA 3CCQN 1Q18A 4BREA 4EHTA 1HPMA 3D2EA 4IZ9A 3C0BA 3U9DA 1BOTO 1NGAA 2KLAA 4JD2A 4DQ8A 5DM7L 2AA4A 3HRGA 2QWOA 3R6MA 5BPNA 2VWBA 2W41A 1H1VA 4JNEA 3CIPA 3RVCA 1NGIA 2QWMA 2P9LA 2ZWHA 1YITN 5AQNA 4A5BA 4IO8A 3H3NO 2EWSA 3IMXA 4IEEA 1T6CA 2NLXA 3FZFA 2E88A 3RSEA 5JVHL 1NGJA 1WOQA 4FVUA 4JK7A 5JLFA 3CD6N 2P9KA 2NZTA 3FZKA 5JICA 1W2BM 3P31A 2GUPA 2NRXA 4BC5A 5GAGP 3OA9A 3VERA 1P90A 2CH5A 5EXWA 1VQKN 5JVGL 1JJ2M 5B8HA 3ID8A 3OW2M 3BF3A 1HLUA 4NO7A 4YOWA 2FSKA 3H45C 2V7ZA 3UE5A 1NGEA 4FWSA 4PL8A 5EOYA 2E2NA 4BRCA 3AY9A 3CQXA 3WXLA 3VENA 4J8FA 2HBLA 3HOSA 4MO4A 4FWOA 4PKHA 5AQJA 2HF4A 2E20A 2E2QA 3BUZB 1VQON 2AP1A 2D1KA 4MLHA 2VGMA 3SK3A 2ZJQL 1ATNA 1X3NA 1NGFA 1C0FA 4FWQA 3HTVA 4YOUA 5AQHA 4CZKA 2QA4N 4CZEA 1MWMA 1KAZA 1QQOA 1CZAN 3FZMA 1C0GA 3GOIA 2ITMA 3O80A 1EO1A 4FWRA 3U9ZA 3UKUB 3LL3A 3ZEUB 4WQ5C 1BG3A 3VF4A 3WXJA 3ZETB 4EHUA 3C6AA 4KH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEE A;  5C2F A;  3CPE A;  5M1Q A;  5C15 A;  5M1N A;  3C6H A;  4IEI A;  5M1P A;  5C2D A;  5M1K A;  5M1F A;  5M1O A;  4IDH A;  3C6A A;  4IFE A;  5C12 A;  5C10 A; 
#chains in the Genus database with same CATH topology
 2WUS A;  4CIG A;  3MK6 A;  3H46 O;  3TSU A;  1J6Z A;  3I33 A;  2R7Y A;  4LF5 K;  4CCH A;  2B4J A;  2IVO A;  3TAN A;  3I0R A;  1DGK N;  3LZJ A;  2G8U A;  1BI4 A;  3MN5 A;  4IBN A;  3U3G A;  1C0M A;  3QFP A;  3TI0 A;  5AFU H;  4JI6 K;  3E9L A;  2KQ2 A;  1RT5 A;  2FSN A;  4CHN A;  5BRF A;  5FPM A;  3EE9 A;  3GDQ A;  3OBY A;  5AQX A;  5BRD A;  1K9M O;  5JLH A;  1VQP N;  4DTO A;  2P9I A;  2RKI A;  4IFY A;  3ID6 A;  2HHS A;  3HBT A;  4FL9 A;  3KK1 A;  3CFP A;  4DQP A;  1K8K A;  4PA1 A;  4A57 A;  4EIA A;  3VEV A;  3FZH A;  4FWP A;  4JHD A;  4AIL C;  5AQS A;  3ULE B;  4ZTF A;  1ASW A;  3SYZ A;  3ALY A;  1T44 A;  2ZGY A;  3CC7 N;  4DV5 K;  4Z94 A;  4FLW A;  1SKS A;  1IG9 A;  1I39 A;  4KH4 A;  3SMP A;  1GLA G;  1LWF A;  1NJI O;  2OPQ A;  1Q81 O;  3KLH A;  2CGL A;  4Z4E A;  1HRH A;  3OYC A;  3O5B A;  4CFB A;  2X74 A;  2E2O A;  3KLE A;  3MX2 A;  4K41 A;  4C8N A;  5C25 A;  5M1O A;  4BRG A;  4CHQ A;  4YOY A;  4BR2 A;  4JD2 B;  4CE9 A;  3L2W A;  1WSI A;  4AHU A;  1T03 A;  2HF3 A;  3QER A;  4Z4I A;  5C0Y A;  3TTD A;  4K0K K;  4CEB A;  2P9S A;  1OVY A;  2YJF A;  3LWL A;  1TUU A;  1VSI A;  2Z1G A;  4HTL A;  4M3Z A;  4NCG A;  4FK2 A;  3VQC A;  4LFB K;  5GIP A;  3ULD A;  1Q82 O;  3SZ2 A;  4KHP K;  1VSF A;  3P39 A;  3TTF A;  3SQ4 A;  4WF9 L;  1NJW A;  3WEE A;  4K43 A;  5EVZ A;  5JMV A;  1I94 K;  5C12 A;  3AA4 A;  4IWV A;  4ZHR A;  3F9M A;  1WN7 A;  4BWM A;  4FSV A;  3QIC A;  4CEF A;  3E9P A;  4FZX C;  2NNW A;  4UQG A;  4CGI A;  1GLB G;  3IG1 A;  4I7F A;  3BY5 A;  3P4I A;  5HBM A;  4BE1 A;  4F2S A;  5AQT A;  4AM6 A;  4FCY A;  3OYI A;  2NRV A;  3TAE A;  3K9J A;  3LDQ A;  1VQ5 N;  1OKJ A;  2V52 B;  1S1V A;  1WNS A;  1LAV A;  3S41 A;  4DFM A;  2UXD K;  4FM2 A;  5JS2 A;  3L2R A;  3CJ7 A;  1RBU A;  3F5T A;  3QIN A;  4H4O A;  3V9W A;  4C1N K;  2IVN A;  3K2P A;  1RDC A;  3LM2 A;  5FPE A;  3PUF A;  2O4G A;  2JLE A;  3TAR A;  2Q97 A;  3SBT A;  1BI4 B;  4B9S A;  4YY3 K;  4CJF A;  3IRX A;  4GV9 A;  4YOV A;  3TAQ A;  3DI6 A;  4JN4 A;  1IBM K;  2PBD A;  4E0D A;  1EET A;  1BUP A;  4Y0W A;  1R0A A;  1GLC G;  4FM0 A;  5AQF A;  2RE2 A;  4FJG A;  2IGI A;  2GTD A;  2Q36 A;  4B3T K;  2QWL A;  3GBT A;  3SMS A;  4Z0U A;  4CD1 A;  1OVQ A;  1S22 A;  4YDU C;  4HVJ A;  2ITG A;  1YI2 N;  1ATR A;  3ZSW A;  2F8T A;  2QWR A;  5BRH A;  4ILG B;  3WXI A;  1CZB A;  5KPR A;  1SUQ A;  4LSN A;  3B6P A;  4CK3 A;  1JCE A;  4NB4 A;  2VGN A;  4BRA A;  3NGI A;  3K57 A;  4F4K A;  1XMO K;  4A5A A;  4X62 K;  3N4P A;  1YVN A;  3B6O A;  1RT6 A;  4KB0 A;  1YJN N;  4JS5 A;  2ZQB A;  4JKC A;  1Z25 A;  3EZW A;  2QM1 A;  4NLC A;  4MFB A;  1KVC A;  4B8A B;  4CEQ A;  5KPT A;  3PO4 A;  4CJQ A;  1C1C A;  3NVK A;  2F9T A;  4DTU A;  4CGD A;  2EX3 A;  3QNO A;  1X9S A;  3SAH A;  5FRN A;  4GMJ B;  5LJW A;  4E3S A;  3WNG A;  3EL2 A;  1RDB A;  2XHB A;  3CJB A;  3AAP A;  4JHD B;  3U8X A;  1CXU A;  4B1U B;  4K8X A;  3ZT3 A;  1N33 K;  2FF3 B;  2HW3 A;  1UA0 A;  3H1V X;  3ZSZ A;  5FDL A;  4E7L A;  4B9N A;  3D6R A;  4DF8 A;  4M3X A;  4M42 A;  2QEX N;  3QBW A;  2VG6 A;  4DG1 A;  3AVJ A;  3SPY A;  2Q1N A;  4FW2 A;  2VG7 A;  4U67 L;  3EO3 A;  1MA9 B;  2RF2 A;  3RWU A;  4NLB A;  4BR9 A;  4Y1C A;  5AQL A;  2NRR A;  3CPE A;  4IJN A;  5AZI A;  3JAM O;  3IFR A;  4JK9 A;  5AQW A;  4BDP A;  1HX1 A;  3M1F A;  1CZ9 A;  2HBM A;  3A5O C;  3AVC A;  3ZT2 A;  2UYT A;  3AGK A;  2FC0 A;  5K14 A;  3QEW A;  2HVI A;  1FW6 A;  5SWM A;  3D2F B;  3JYT A;  3A8Y A;  4H5R A;  1Q9X A;  1ZBF A;  3ZLJ A;  3MN9 A;  3HZ6 A;  4I2P A;  1S72 N;  3VQB A;  1QQN A;  1Z6R A;  4E7H A;  2FLO A;  4CZH A;  2FSJ A;  3MEC A;  4BRF A;  1FJG K;  1Z05 A;  4JLH A;  3FLC O;  4DSF A;  3LAK A;  2A6A A;  3F73 A;  3SJH A;  3OS2 A;  1HJO A;  4CJW A;  2VQE K;  3S9H A;  2JWL A;  3VET A;  2ASM A;  4CED A;  3A2F A;  3R9P A;  3PX6 A;  4CIF A;  4EZ9 A;  1U47 A;  2ZF5 O;  1FKO A;  2Q0U A;  2Q2R A;  3CG7 A;  4YOT A;  5H1S Q;  5IWA K;  3MCA B;  3THY A;  4M3W A;  1K8A O;  3AGR A;  1P8Z A;  4LF9 K;  1ASV A;  4B8C A;  2B6A A;  3GE1 A;  1NK7 A;  4CZG A;  4BG8 A;  1ATS A;  4B1V A;  2DFH A;  3CJ1 A;  4A61 A;  4CW7 B;  1RIL A;  1NJY A;  5M1F A;  4OKE A;  1VQL N;  3P1G A;  3DXM A;  1GLD G;  4H0X B;  2NRH A;  1S9G A;  3MXJ A;  2Y1J A;  4BRE A;  4EHT A;  5FRM A;  3OTO K;  4FLT A;  3C0B A;  3CQ8 A;  4MQ3 A;  1QQC A;  2KLA A;  2VWK A;  3EY1 A;  3NBP A;  3R6M A;  3OYA A;  1D9D A;  2W41 A;  2E6L A;  2QKK A;  3CIP A;  3DYA A;  5D3G A;  3RVC A;  1D5A A;  1NGI A;  4M3U A;  1IKX A;  5AQN A;  3DRR A;  4DV4 K;  4FJJ A;  1WOQ A;  4IKF A;  2HND A;  5JLF A;  4DV0 K;  4DTS A;  3FZK A;  4RW8 A;  4CJ4 A;  1W2B M;  2GUP A;  4FZY A;  1P90 A;  3RMA A;  3OW2 M;  3ID8 A;  1S5J A;  4DSJ A;  2V7Z A;  1U04 A;  1X1P A;  1ITG A;  1WSE A;  3WXL A;  4FWO A;  1N5Y A;  1C6V A;  1TGO A;  2YNI A;  4MLH A;  3SK3 A;  4NCB A;  3THV A;  1X3N A;  1NGF A;  3HTV A;  3NFA A;  4E7K A;  5EU7 A;  1KAZ A;  3FZM A;  1CZA N;  1C0G A;  1EO1 A;  3UKU B;  4CHY A;  3ZEU B;  4WQ5 C;  2D0C A;  1NK6 A;  4EZ6 A;  4EHU A;  3ZET B;  4AHS A;  2CGK A;  4DB3 A;  5AQV A;  3I8D A;  1NK5 A;  3VES A;  4KTQ A;  3VEZ A;  3CCJ N;  1KTQ A;  4B1X B;  4X65 K;  3LWM A;  4DFK A;  2QWP A;  3B8A X;  3DLG A;  4JI8 K;  2HHQ A;  3E9O A;  3SNN A;  1RBV A;  4N76 A;  3MX5 A;  4B9U A;  4FJ7 A;  4BC2 A;  5BRE A;  4R79 A;  4FJI A;  2IC3 A;  1GLF O;  4K42 A;  4BRQ A;  4KFB A;  3OYK A;  1ZBU A;  5DMR A;  5LY3 A;  3FFK B;  4B9Q A;  1S1X A;  4BRP A;  4GV6 A;  1K8K B;  1GLJ O;  3C6H A;  4WCE L;  4DCH A;  1ILY A;  1L3T A;  4JAX A;  3WQT A;  5AQR A;  3ZT4 A;  3VQP A;  3AA5 X;  1RTH A;  3KKR A;  1EWR A;  3BGR A;  4YHH K;  2P9N B;  5AQG A;  2HNY A;  2Y1I A;  1KLN A;  3ZEU A;  3C94 A;  1WAJ A;  2PFU A;  4CGH A;  3TAM A;  4LF4 K;  4DMN A;  4CVN E;  1K73 O;  4GKJ K;  4MLE A;  4CZF A;  1NK0 A;  3SPZ A;  4MDA A;  1N34 K;  1HNX K;  4DQQ A;  1NGC A;  2RPI A;  1QVG M;  3M8S A;  2IDO A;  1JXE A;  4DR6 K;  1T7P A;  3CF5 L;  3T1A A;  5IT9 O;  4FLU A;  4AH9 A;  4I6M A;  4E1N A;  5T7B A;  3AV9 A;  2O4I A;  1O13 A;  1NBW A;  4ISF A;  1BIZ A;  3LZI A;  3CXC M;  3M8Q A;  4KRF A;  4HUG A;  4NXM K;  3SI6 A;  3RR8 A;  1HUX A;  4JRQ A;  4BE0 A;  3V9S A;  1OH6 A;  4BDZ A;  4EFH A;  4FJH A;  3HO1 A;  5M1P A;  4IJA A;  4YFU A;  1DKG D;  1G15 A;  4BRK A;  4BR4 A;  2GEL A;  3TAB A;  4PKI A;  4BC3 A;  3NH0 A;  4JI4 K;  4KAZ A;  4A2A A;  3CJA A;  2FBX A;  3MN7 A;  4E7J A;  1NGG A;  1N8R O;  4DQI A;  3LDO A;  3AVM A;  4DWI A;  1KXP A;  4A2B A;  5CZ2 A;  4XH1 A;  2HVH A;  1FXX A;  5KGW A;  3OYM A;  3NF8 A;  1WB9 A;  2QKB A;  1OH7 A;  1VHX A;  3OHR A;  4JKE A;  4BGB A;  3MED A;  3NE6 A;  3SUP A;  3G4S N;  1YTU A;  4BGA A;  4K25 A;  4PWD A;  1S3X A;  5AQO A;  1TUY A;  2Q31 A;  3MXM A;  5FLX O;  4LFC K;  3HXM A;  4HCB A;  3CCM N;  4B3S K;  4I6M B;  3KD5 E;  4LSL A;  2ASO A;  1BL3 A;  3THW A;  1VK0 A;  4C23 A;  4IFV A;  1XI1 A;  1X9W A;  2YX6 A;  3UKR A;  1YJ9 N;  3TAF A;  1VSD A;  3QML A;  4DTJ A;  4DTP A;  5AQI A;  1D4X A;  3M8P A;  2LSN A;  4CJE A;  4CEZ A;  1NJZ A;  4CIE A;  3IKM A;  4KRE A;  4B9T A;  3MEE A;  2YHX A;  1LW2 A;  3L3V A;  1NMD A;  1XC3 A;  5LMN K;  1QQM A;  4C1N I;  2PYJ A;  2P9U B;  3KWG A;  3C7N B;  3AO3 A;  1BA0 A;  4E1J A;  5KRT A;  1NKB A;  2O8F B;  5CR4 A;  2ETJ A;  2XO7 A;  4GV3 A;  4HCC A;  5AJ3 K;  3KIO A;  1RBR A;  4HWI A;  1JL2 A;  3A0I X;  3O3G A;  4DQR A;  5FPD A;  4JV5 K;  3DJC A;  2O8B B;  3ZX0 A;  4BG9 A;  3DXK A;  1C0U A;  5C2F A;  1SL0 A;  3ZSV A;  4BVO A;  1VSH A;  4BR5 A;  1XUP O;  3ZX3 A;  4OPJ A;  4B3O A;  4JKD A;  4DFP A;  2E2P A;  5BR9 A;  4FYD A;  3S3N A;  1FKP A;  4GNI A;  3LDP A;  2ZJP L;  3CCE N;  5EY4 A;  4M3T A;  4CBX A;  1HKC A;  3OYB A;  1N32 K;  5KTQ A;  1LWC A;  4CJV A;  4RTF D;  2KFZ A;  5GIN A;  1TYQ A;  3NDK A;  1NM1 A;  3K5N A;  3ITH A;  4DHY A;  4DTR A;  3NGY A;  5SZT A;  4AHC A;  2W6K A;  4DV7 K;  1NK9 A;  4WQ4 A;  1I3A A;  3Q7C A;  4M41 A;  1RT2 A;  2OPP A;  3KJV A;  4H8K A;  2BGG A;  4FW1 A;  3V9U A;  4YNQ A;  4QCL A;  4GY2 B;  2J4R A;  3VGK A;  1C1A A;  4CF1 A;  4X66 K;  1HPZ A;  1UOC A;  3H3O B;  3PIP L;  3HT3 A;  3W0L A;  1S6Q A;  1V4T A;  4CK1 A;  4WYB A;  4CGF A;  2GUI A;  3T7Z A;  3ZX2 A;  3WNF A;  3NCI A;  2BAN A;  4CGJ A;  3V6D A;  1S9E A;  3HM9 A;  3JS6 A;  3VGM A;  1JKH A;  1XQS C;  2KKZ A;  2YV0 X;  5J2M A;  2P5O A;  4BRO A;  3C6T A;  3QBX A;  4CJ5 A;  3SAF A;  3J81 O;  1N36 K;  2ASP A;  3HI0 A;  1LOT B;  1ZC6 A;  3ATU A;  4JI1 K;  3DLR A;  3HP6 A;  1T3V A;  3WQU A;  2V7Y A;  3CPW M;  4PHT X;  3OY9 A;  4JI0 K;  1QSL A;  2F4V K;  3M6G A;  3VA3 A;  4FWM A;  3VEY A;  4XIU A;  3CCR N;  4JI5 K;  3AVF A;  1UA1 A;  2KFN A;  2HHU A;  5E84 A;  1BIS A;  2I5J A;  3DLK A;  3MXI A;  1KVB A;  1RT1 A;  5C42 A;  3K5L A;  4F8R A;  3SV3 A;  1CLQ A;  2WC9 A;  2YNH A;  3A5L C;  1TL3 A;  3EE8 A;  3OYE A;  1BU6 O;  3PV8 A;  4ELT A;  2IIR A;  2UU9 K;  4B3R K;  4KB1 A;  2G8K A;  4O55 A;  3CET A;  4ILH A;  3TR8 A;  4FK4 A;  4OO1 J;  1EKE A;  2P9P A;  3O1B A;  3L2Q A;  5I42 A;  3DRP A;  3CCV N;  1NKC A;  4DV3 K;  4C8L A;  1XNR K;  4CZL A;  4DSK A;  3VN5 A;  1LV5 A;  4PKG A;  3CME N;  3VPZ A;  4CZM A;  4RW7 A;  3WNH A;  4KBO A;  4LH4 A;  3KD1 E;  4O44 A;  1WSF A;  4L3Q A;  4RW9 A;  2FBT A;  3BZC A;  3NF9 A;  5HRS A;  1BHL A;  1ZBH A;  4Q5V A;  3J7A P;  2Z1J A;  1RTI A;  1BGX T;  3CCS N;  4JI3 K;  4JEP A;  3S3O A;  3THX A;  4IOX A;  2O8B A;  2ZE2 A;  1BCO A;  2GWJ A;  4JK8 A;  4W5R A;  2HST A;  2OAN A;  3KK2 A;  4BE2 A;  1B9D A;  4CHP A;  3OYD A;  3NHG A;  3VEX A;  5ADX A;  2G8H A;  4WFN L;  4KHW A;  4CHZ A;  1RFQ A;  4QAG A;  1SQK A;  3ZT1 A;  3J8A A;  3C7N A;  4WQ5 A;  4AF1 A;  2G8W A;  4CEA A;  3CCQ N;  1Q18 A;  2YNG A;  3D2E A;  4IZ9 A;  2O8F A;  1NGA A;  4JD2 A;  4DQ8 A;  4ZTJ A;  2AA4 A;  2QWO A;  3J7Y P;  5CYM A;  2VWB A;  4JNE A;  1H1V A;  1Q9Y A;  3QIP A;  1YIT N;  2P9L A;  4A5B A;  3CM5 A;  4IEE A;  3H3N O;  3IMX A;  1W9H A;  1MU2 A;  1NGJ A;  2P9K A;  2NZT A;  4DTX A;  3KTQ A;  2NRX A;  1NK8 A;  3VER A;  4M3Y A;  1XMQ K;  5JVG L;  1RBS A;  2P5G A;  1JLB A;  1HLU A;  4RW6 A;  4YOW A;  4G1Q A;  2FSK A;  5LL6 Z;  3AVN A;  3PSF A;  3AY9 A;  3CQX A;  3PY8 A;  2HBL A;  3HOS A;  5AQJ A;  4FVM A;  1WLJ A;  2AP1 A;  2D1K A;  4B9L A;  4DV1 K;  4O0J A;  3IS9 A;  1ATN A;  1JLE A;  4YOU A;  4FWQ A;  4KHQ A;  2QA4 N;  3AVA A;  1U45 A;  1MWM A;  3GOI A;  2ITM A;  4FWR A;  3KK3 A;  3LDS A;  4BWJ A;  4O5B A;  4NO7 A;  4KH5 A;  2XY8 A;  2G8F A;  3DLH A;  3EKU A;  1RTJ A;  3SBG A;  2E1Y A;  3TAP A;  3LPU A;  1HNI A;  3HL8 A;  1VQN N;  1D9F A;  3VQ9 A;  4FLY A;  5GIO A;  3LAM A;  4H5V A;  2NRT A;  4KI6 A;  3LP1 A;  2RHK A;  4N56 A;  2IOC A;  3UKR B;  3PLA A;  3M8R A;  3G71 N;  4N47 A;  3VQD A;  4LY7 A;  4FM1 A;  1OH5 A;  4CZI A;  4J2E A;  4O5F A;  4FLV A;  3NVM A;  2O8D A;  3CFR A;  2RN2 A;  4BRN A;  4HTU A;  4FWN A;  3QNN A;  3LPT A;  3KHY A;  5M1K A;  3H08 A;  3VEO A;  3L0Q A;  4JI2 K;  1NKE A;  3OYL A;  4LF7 K;  5E41 A;  4LC9 B;  3BDP A;  3LAN A;  3AVB A;  4WQ4 C;  4CJP A;  3O9R A;  3QIO A;  2WON A;  1TVR A;  1U4B A;  5C2D A;  1NG9 A;  2D0O A;  4PUO A;  3SQ1 A;  3A5M C;  3GG4 A;  5DK5 A;  4JRP A;  3P5J A;  4GVE A;  1JLG A;  3L4Q A;  4B1Y B;  3NF6 A;  3CC2 N;  1NGB A;  4FJ9 A;  4IG0 A;  4OJR A;  1EQY A;  2DY4 A;  1SS6 A;  5MLC Q;  4BDY A;  1IKY A;  3WXM B;  4A62 A;  1BQN A;  3DXM B;  2X6S A;  3ZYY X;  1HMV A;  5F1X A;  3ENH A;  2E8A A;  4A59 A;  4V19 S;  1RDU A;  2A3Z A;  2HB5 A;  4C8M A;  1JLA A;  4ELV A;  1WSG A;  3ATV A;  3ZT0 A;  3AO4 A;  3KZB A;  1IKV A;  1JLF A;  4CHO A;  3C6U A;  4WE1 A;  4CJL A;  3L2V A;  3T69 A;  1IJJ A;  2YKN A;  4CF0 A;  4AHV A;  4BRM A;  4O8K A;  4FJL A;  5AZJ A;  3D7E O;  2QWN A;  4F9O A;  1BIU A;  4AM7 A;  2A5X A;  5AQM A;  4FWL A;  1NOZ A;  1ZBL A;  2P9U A;  2I7N A;  2CGJ A;  4CJT A;  4FWK A;  4KPY A;  4FJ5 A;  4BC4 A;  4Z4F A;  1WUA A;  3CC4 N;  4KTZ A;  3V1O A;  1S1U A;  2GX9 A;  5FPN A;  5EX5 A;  3VTI A;  2O8D B;  5DM6 L;  1KCF A;  2Q3S A;  3V1Q A;  1NK4 A;  2CH6 A;  4O0I A;  1J54 A;  1VSK A;  4OLA A;  5J1E A;  1U2V B;  4FK0 A;  1YVU A;  2P9N A;  4OPK A;  4W5T A;  4BRI A;  4DV6 K;  4H0Y B;  1T8E A;  4M45 A;  1G99 A;  2HNZ A;  3EZ5 A;  3D2F A;  1X9J A;  1KFS A;  2JWK A;  3LP2 A;  5FRO A;  3WXK A;  4CBU A;  3C65 A;  3O3F A;  4B08 A;  4LH5 A;  3U6F A;  1LWE A;  3PSI A;  3RMD A;  2KTQ A;  4OPH A;  1S6P A;  3HJF A;  3WNE A;  3PX0 A;  1NNE A;  3VQ5 A;  4RWT A;  5E26 A;  1GOC A;  4KHY A;  3ENB A;  3L3U A;  1TL1 A;  5F2R A;  3QEI A;  1BA1 A;  5HOO A;  1NMN A;  1HYZ A;  4CZJ A;  2P51 A;  5KGX A;  4EP4 A;  3I8B A;  5GAH P;  5AQZ A;  5CY4 A;  3WEE B;  3O3H A;  3VF2 A;  3CHW A;  2Z1I A;  3MAQ A;  1T05 A;  3DLL L;  2YHB A;  3TSQ A;  4BR7 A;  3RRG A;  3FFI A;  1RNH A;  5KQD A;  3R1X A;  3VMF B;  1EP4 A;  1BWF O;  3RRH A;  2HBJ A;  3NAE A;  3T19 A;  3SCX A;  2VQF K;  1KAX A;  3CCU N;  3V81 A;  4I2Q A;  1NLV A;  3EN9 A;  3R3L A;  3O9U A;  5AQP A;  1IO2 A;  4B9V A;  5CE3 A;  4CF9 A;  4DSL A;  1J5O A;  4NYN A;  3AVK A;  4FOI A;  2HHT A;  1HNV A;  1IBK K;  4G9Z A;  2YI1 A;  1JLQ A;  4IFE A;  2Q0R A;  4OKJ A;  4HHT A;  3QEV A;  3DLE A;  4N5S A;  4M63 C;  3OYH A;  2O8C B;  4XH5 A;  4M7Y A;  4U7B A;  1NWK A;  2VYP A;  2A40 A;  4DR7 K;  1U49 A;  2KHO A;  5AQY A;  1EX4 A;  3E01 A;  1RBT A;  1YXQ A;  2E1Z A;  3AAR A;  3CFO A;  1E4G T;  1B9F A;  1GOB A;  1GLE G;  2WBN A;  4EAH D;  3AVH A;  1YAG A;  1VQ8 N;  3RSE B;  4WFB L;  3HP9 A;  3QES A;  1HNW K;  4BRH A;  4CD3 A;  1OH8 A;  4ISG A;  2O8E B;  4DTN A;  5I9E B;  3K5M A;  4R5P A;  4OGC A;  1NJX A;  4BVP A;  3W3D A;  2D0P A;  3O4W A;  2ZM6 K;  1ZXO A;  1X3M A;  1C0T A;  4HUF A;  3FZL A;  4DTM A;  3PX4 A;  3IUC A;  1VQ9 N;  4FPB A;  2D5R A;  3FGU A;  3VQE A;  3O4Q A;  2PZS A;  4KHS A;  4H0T B;  1EXQ A;  1SL2 A;  1KLM A;  1RT3 A;  1NOY A;  1TAU A;  2B5J A;  2P9I B;  3NH1 A;  3K9K A;  4CJR A;  4WFA L;  4F3T A;  1A5W A;  1WSH A;  4GVM A;  1IG8 A;  5HL7 L;  4YOR A;  3E66 A;  3RTV A;  2BDP A;  4FJ8 A;  2QWQ A;  4E7I A;  1Y64 A;  3HK2 A;  1MWK A;  2FXU A;  5GAD P;  2A1R A;  1U6Z A;  3T3F A;  3IDH A;  1E3M A;  4IG3 A;  4DUY K;  3MWP A;  4JI7 K;  4Q0B A;  1HYV A;  1S1W A;  1KFD A;  3ZSR A;  4DUZ K;  5KQ8 A;  1GOA A;  4YDU A;  4LF6 K;  4ISE A;  1DTQ A;  1O1W A;  4W5O A;  2NRZ A;  1J9A A;  2X6N A;  2ZJR L;  2YNF A;  2ZGZ A;  2QK9 A;  3O8M A;  1D8Y A;  1FK9 A;  4CEO A;  3SJJ A;  1WSJ A;  2KZM A;  1NU0 A;  3TSP A;  4FO0 A;  4Z4G A;  3VQ7 A;  4CES A;  2UXB K;  4H03 B;  4AHR A;  5LJV A;  3ZSQ A;  1WAF A;  2A42 A;  3DXK B;  4CFC A;  2W42 A;  2Z1H A;  1QTM A;  3OYF A;  5ELZ A;  4IOC L;  3ZSX A;  3HVR A;  1KRP A;  2FBV A;  3UB5 A;  1QS4 A;  4H0O A;  4H5W A;  1KAY A;  1HKB A;  3GL1 A;  4JKB A;  3LM9 A;  5HP1 A;  2FBY A;  3SAG A;  4BRD A;  2D0B A;  2VG5 A;  3CJC A;  3NF7 A;  3I56 N;  1YT3 A;  3OYN A;  3ZET A;  4MDB A;  1U48 A;  4CBW A;  5J2N A;  4YOX A;  2GBZ A;  2IS3 A;  2OTL N;  1NGD A;  4IO9 L;  1K6Y A;  4CK2 A;  4Z4H A;  5BN9 A;  3D2E B;  4BQL A;  3H1Q A;  2E6M A;  2QW9 A;  4H5N A;  3VA0 A;  1DEJ A;  1IKW A;  2E4L A;  3DM2 A;  5GAE P;  4CFA A;  4HUE A;  3U3Y A;  4M3R A;  1SKR A;  1A5V A;  3DMJ A;  3U9D A;  5DM7 L;  2OZS A;  4DF4 A;  3HRG A;  1KVA A;  3HST B;  2HHH K;  1J5E K;  2ZWH A;  2OPR A;  4Z4C A;  1X9M A;  2NLX A;  3AA3 A;  3RSE A;  4ICL A;  2OA8 A;  4JK7 A;  1KSP A;  4ELU A;  3P31 A;  1SL1 A;  5HRO A;  2CH5 A;  1VQK N;  1SKW A;  3CM6 A;  5B8H A;  3OYG A;  2OPS A;  1L5U A;  2F8S A;  3SUQ A;  3H45 C;  1NGE A;  4FWS A;  2E2N A;  1Z26 A;  3AO1 A;  4CJK A;  3K58 A;  4ID1 A;  3AO2 A;  2YKM A;  4J8F A;  1IV0 A;  4MO4 A;  1TK0 A;  4PKH A;  3VQ8 A;  2HF4 A;  1DLO A;  2E20 A;  4DV2 K;  2VGM A;  1L3V A;  2ZJQ L;  1XWL A;  4CZK A;  1C0F A;  5AQH A;  2VWJ A;  4CZE A;  4CGG A;  1QSS A;  4DLG A;  3O80 A;  3U9Z A;  3V9X A;  2PY5 A;  4GKK K;  1W0H A;  3VOV A;  3C6A A;  4PQU A;  3F9K A;  1E4F T;  4PY5 A;  1M90 O;  3PIO L;  1IH7 A;  1XC9 A;  1QHT A;  3CQY A;  1L3U A;  1UWB A;  3ZSO A;  4DFJ A;  3O08 A;  1Q8I A;  4OGE A;  1KQS M;  3RMC A;  3QO9 A;  3HPH A;  3ISN C;  5TKW A;  3O1W A;  3N4Q A;  2UXC K;  4CFD A;  3M3Z A;  1TYQ B;  2EHG A;  5BR8 K;  5C15 A;  4F3O A;  4RG8 A;  4J2B A;  1TV6 A;  2UUA K;  3WUH A;  4H0P A;  4JKF A;  1ESV A;  3TWH A;  4FPA A;  3TPQ A;  5TKY A;  3O9Q A;  4IDK A;  4QS7 A;  1BCM A;  2P9L B;  4DKW A;  3O9T A;  5I3U A;  1VQM N;  2ZD1 A;  4JKG A;  3AO5 A;  1RDD A;  1ASU A;  4DLE A;  1DT9 A;  1JCF A;  3BEX A;  1JCG A;  4B1Z A;  1QSY A;  4IXC A;  3JSM A;  3K5O A;  3K0S A;  1UAX A;  4DSE A;  1W97 L;  3CJ9 A;  2YHA A;  1LCU A;  3CMA N;  5KI6 A;  4JKH A;  4C8O A;  3NH2 A;  1QHA A;  4L8R B;  1TK5 A;  4CI6 A;  2V51 B;  4OX9 K;  3WT0 A;  4FJN A;  2A41 A;  1TKZ A;  3AA2 A;  3SUN A;  3CI5 A;  4LF8 K;  1HQE A;  4XEI A;  1VQ6 N;  1MDU B;  4DR5 K;  2G8V A;  3EEQ A;  1WBD A;  1B92 A;  1SZ2 A;  2XY7 A;  1CXQ A;  3MWT A;  3VQA A;  5BN8 A;  4BQZ A;  1V4S A;  2OZM A;  4J2D A;  2BUP A;  4DS4 A;  4B9M A;  2F96 A;  3TAG A;  2DFE A;  3LAL A;  1Q86 O;  3QEX A;  4E89 A;  4JKG B;  4O4G A;  1RTD A;  4W5N A;  1Q7Y O;  3MMV A;  2OYQ A;  1S1T A;  3J7Z O;  3VEW A;  3MEG A;  5ADX H;  3OJU A;  1WBB A;  3U4L A;  4NYF A;  4H0V B;  1N6Q A;  3KLF A;  2W40 A;  3THX B;  3G10 A;  1IBL K;  2ATQ A;  2VCP A;  3L4I A;  3MCP A;  2DFF A;  3IAY A;  4B1W B;  2H3G X;  1M1K O;  1TAQ A;  3HPO A;  1EWQ A;  3M5R A;  3I55 N;  3RR7 A;  4IOA L;  4DR4 K;  3R8E A;  5M1Q A;  3QDK A;  3AVI A;  3JXU A;  5HRN A;  3V4I A;  1C1B A;  4FZZ A;  3T1H K;  4KO0 A;  2XY6 A;  4AQY K;  1VSE A;  4KH6 A;  4EP5 A;  3KVG A;  4CF2 A;  1R59 O;  4O8U A;  4DU4 A;  1ZYQ A;  4B3M K;  3Q7B A;  1QVF M;  4I9L A;  5AQU A;  4DR2 K;  3VGL A;  3AVL A;  3MDQ A;  1JL1 A;  1GLL O;  3LP0 A;  3CER A;  3ASM A;  5F0X A;  2GWK A;  1VRU A;  3L6Q A;  2BH1 A;  2YCH A;  5AR0 A;  2HOE A;  4E19 A;  3V9Z A;  3FE1 A;  4RW4 A;  4BR0 A;  1VQ7 N;  3QEP A;  2YJE A;  5CHI A;  2FF6 A;  3O9S A;  1W7A A;  2QI2 A;  2E5L K;  2QXF A;  2GEM A;  3QB0 A;  4NCA A;  1VSM A;  2O8C A;  5C24 A;  2F9W A;  2P9S B;  3D0P A;  3HYF A;  4IDH A;  1XHX A;  4KV8 A;  1TKD A;  4K8Z A;  1TKX A;  3OS0 A;  4W5Q A;  4PL7 A;  2I7P A;  4MO5 A;  5JS1 A;  2WOM A;  4FOE A;  4DU1 A;  1QE1 A;  3VQQ A;  1DTT A;  3PO5 A;  4FJX A;  3OVN A;  3H6E A;  4KTW A;  5HRR A;  3THW B;  4QS9 A;  4OPA A;  5KPZ A;  1T6D A;  1HNZ K;  3FR0 A;  1A5X A;  1VSJ A;  2QXL A;  3BF1 A;  5BPM A;  3DLB A;  1L3S A;  1NGH A;  4IEI A;  4RCH A;  5AQQ A;  3E1Y A;  1YTA A;  5BPL A;  4KHU A;  4CER A;  4ILJ A;  1HQU A;  3BP8 A;  1BQM A;  3VF6 A;  4QOZ B;  4BY9 C;  3VQ6 A;  3DWL A;  3I0S A;  3KKS A;  2OCE A;  3T1Y K;  3EYZ A;  5AFU A;  5AZI B;  3HM8 A;  2KZZ A;  4UY8 O;  4Y1D A;  3LP3 A;  3ULE A;  5AZJ B;  3DOK A;  4BAC A;  2IVP A;  2QTD A;  2HMP A;  2AJQ A;  3A5N C;  3O4N A;  1RGI A;  3HOT A;  2BTF A;  1RCH A;  3OYJ A;  3CCL N;  1HKG A;  2WTU A;  5HRP A;  1TKT A;  1TK8 A;  1RDA A;  3OBW A;  2OTJ N;  3ZCM A;  2X78 A;  3QFU A;  3VQ4 A;  4KI4 A;  1YIJ N;  4GW6 A;  2HHW A;  5A2Q O;  4KHN A;  4ID5 A;  4FLX A;  2PAV A;  4M7X A;  4JKA A;  1QZ5 A;  1YJW N;  3AAQ A;  3THY B;  1VAZ A;  1BDG A;  3LDL A;  2P1J A;  4H5T A;  3G0Z A;  2DPN A;  3D45 A;  3MN6 A;  2HBK A;  4LD0 A;  2HHV A;  4CJ3 A;  2HMI A;  4CEC A;  4J2A A;  3P38 A;  1BO5 O;  2NRW A;  1U2V A;  2W6L A;  2XY5 A;  5AQK A;  4OKK A;  3TTC A;  1RT4 A;  3VTH A;  5CYQ A;  3OJS A;  1YHQ N;  1KD1 O;  2D4W A;  3UIQ A;  3EKS A;  2IAJ A;  3KK7 A;  5KRS A;  2NUB A;  1ZBS A;  1LW0 A;  2UUC K;  3HSC A;  4DR1 K;  4DS5 A;  4CJS A;  1JXB A;  1XHZ A;  1REV A;  1SV5 A;  2JGU A;  3SUO A;  3V1R A;  4QS8 A;  2YHW A;  5C10 A;  2P9P B;  3F2K A;  2G8I A;  4KKO A;  4CF8 A;  4FJK A;  2XRI A;  4FLZ A;  2DTU A;  4CJ7 A;  3LDN A;  4F2R A;  1RT7 A;  3KWI A;  4X64 K;  3QLH A;  3SQ0 A;  3SQ2 A;  5J2P A;  1VRT A;  4XH4 A;  1HYS A;  2YHY A;  1YF5 L;  1YUW A;  3C95 A;  4DU3 A;  5CZ1 A;  4CJU A;  2GV9 A;  4DR3 K;  4LFA K;  4FXD A;  3DAW A;  3S3M A;  1RDW X;  2P9K B;  1QZ6 A;  3P83 D;  4DQS A;  3TU5 A;  3UKU A;  2BE2 A;  3SLC A;  1SAZ A;  2D0A A;  4C8K A;  2WFB A;  3RMB A;  2F7T A;  1VQ4 N;  4BRL A;  3SV4 A;  2HHX A;  3NMU A;  3G25 A;  5M1N A;  3HPG A;  3KLI A;  4TSX A;  1KC8 O;  4JYA K;  4OLB A;  1Y97 A;  3ENO A;  3O6W A;  3G6E N;  3KLG A;  3QET A;  2PYL A;  3HVT A;  4CEE A;  3CYM A;  1HPM A;  3DRS A;  1BOT O;  1LAW A;  5BPN A;  2QWM A;  4NXN K;  4IO8 A;  2EWS A;  1HJR A;  2UUB K;  1T6C A;  3FZF A;  2E88 A;  4E1M A;  1JLC A;  5JVH L;  4FVU A;  4H4M A;  4I9Q A;  3CD6 N;  5JIC A;  4BC5 A;  2O8E A;  5GAG P;  3OA9 A;  5EXW A;  1JJ2 M;  3AVG A;  4OVL A;  5J2Q A;  4N41 A;  3BF3 A;  3UE5 A;  1ZBI A;  4PL8 A;  3J80 O;  5EOY A;  4FJM A;  1J53 A;  4BRC A;  3ZSY A;  4DSI A;  3K59 A;  3BZK A;  5HLF A;  3VEN A;  1XNQ K;  3OS1 A;  2E2Q A;  3BUZ B;  3L2U A;  1VQO N;  4AHT A;  5LMU K;  2A1S A;  1HR0 K;  3L8B A;  3DOL A;  1QQO A;  4JS4 A;  3LL3 A;  1BG3 A;  1F21 A;  1VSL A;  2KW4 A;  3VF4 A;  3WXJ A;  3NGZ A; 
#chains in the Genus database with same CATH homology
 2CGK A;  2WUS A;  4DB3 A;  1E4F T;  5AQV A;  3MK6 A;  1M90 O;  3H46 O;  3EKU A;  3SBG A;  3TSU A;  1J6Z A;  3VES A;  2E1Y A;  3PIO L;  3I33 A;  3VEZ A;  3CCJ N;  4B1X B;  2IVO A;  3CQY A;  1VQN N;  3O08 A;  1DGK N;  1KQS M;  5GIO A;  2QWP A;  3MN5 A;  4H5V A;  3B8A X;  2NRT A;  2RHK A;  3E9O A;  3N4Q A;  3O1W A;  5TKW A;  3QFP A;  3MX5 A;  3UKR B;  3PLA A;  3M3Z A;  1TYQ B;  4BC2 A;  5AFU H;  5BRE A;  4R79 A;  3G71 N;  1GLF O;  4K42 A;  3E9L A;  4BRQ A;  4CZI A;  5C15 A;  2FSN A;  5LY3 A;  5BRF A;  3FFK B;  4O5F A;  4B9Q A;  5FPM A;  4BRP A;  4GV6 A;  3EE9 A;  1K8K B;  3GDQ A;  3NVM A;  3WUH A;  4H0P A;  4JKF A;  1ESV A;  1GLJ O;  3C6H A;  3OBY A;  4FPA A;  5AQX A;  4BRN A;  4WCE L;  3TPQ A;  5TKY A;  3O9Q A;  4QS7 A;  4DCH A;  5BRD A;  1K9M O;  5JLH A;  1ILY A;  2P9L B;  4FWN A;  1VQP N;  4JAX A;  3WQT A;  4DKW A;  3KHY A;  2P9I A;  5AQR A;  3ID6 A;  3O9T A;  5M1K A;  3HBT A;  1VQM N;  4FL9 A;  4JKG A;  3VEO A;  3L0Q A;  2P9N B;  1K8K A;  4LC9 B;  5AQG A;  4A57 A;  4EIA A;  3VEV A;  3FZH A;  4FWP A;  1DT9 A;  1JCF A;  3BEX A;  4WQ4 C;  3ZEU A;  2PFU A;  1JCG A;  3O9R A;  4B1Z A;  4JHD A;  5C2D A;  2D0O A;  4IXC A;  1K73 O;  4MLE A;  4CZF A;  3A5M C;  3GG4 A;  4GVE A;  4MDA A;  3L4Q A;  5AQS A;  3ULE B;  4B1Y B;  3CC2 N;  1NGC A;  1NGB A;  1W97 L;  3CJ9 A;  1QVG M;  1EQY A;  1SS6 A;  5MLC Q;  1T44 A;  2ZGY A;  1LCU A;  3CMA N;  3CC7 N;  4JKH A;  3CF5 L;  3WXM B;  4A62 A;  3DXM B;  4Z94 A;  3ZYY X;  1QHA A;  5F1X A;  4CI6 A;  2V51 B;  4I6M A;  3ENH A;  3WT0 A;  2E8A A;  2A41 A;  4A59 A;  4KH4 A;  3CI5 A;  3SMP A;  1RDU A;  1GLA G;  2A3Z A;  1NJI O;  4XEI A;  1O13 A;  1NBW A;  4ISF A;  1Q81 O;  1VQ6 N;  3ATV A;  3KZB A;  3CXC M;  1MDU B;  2CGL A;  3T69 A;  3O5B A;  1IJJ A;  1HUX A;  1SZ2 A;  2E2O A;  4BRM A;  4O8K A;  3MX2 A;  4EFH A;  5AZJ A;  3MWT A;  3D7E O;  4K41 A;  5M1P A;  2QWN A;  4F9O A;  5BN8 A;  4IJA A;  5M1O A;  4BRG A;  4BQZ A;  4YOY A;  4BR2 A;  4JD2 B;  1DKG D;  4AM7 A;  1V4S A;  2A5X A;  4BRK A;  4BR4 A;  5AQM A;  2BUP A;  4FWL A;  2GEL A;  2HF3 A;  4PKI A;  4BC3 A;  2P9U A;  2I7N A;  4A2A A;  2CGJ A;  5C0Y A;  3CJA A;  3TTD A;  3MN7 A;  4FWK A;  1Q86 O;  4JKG B;  2P9S A;  1NGG A;  1OVY A;  2YJF A;  3LDO A;  3MMV A;  4BC4 A;  1Q7Y O;  1KXP A;  1TUU A;  1WUA A;  4HTL A;  3VEW A;  4A2B A;  5ADX H;  3J7Z O;  2GX9 A;  3CC4 N;  5FPN A;  5EX5 A;  3VTI A;  5DM6 L;  4XH1 A;  3U4L A;  5GIP A;  4H0V B;  1Q82 O;  2W40 A;  2CH6 A;  3OHR A;  4JKE A;  3P39 A;  2VCP A;  3L4I A;  3MCP A;  3TTF A;  4BGB A;  4B1W B;  2H3G X;  1M1K O;  1U2V B;  3M5R A;  3G4S N;  2P9N A;  4WF9 L;  3I55 N;  3WEE A;  4IOA L;  4K43 A;  5EVZ A;  5JMV A;  4BGA A;  4K25 A;  3R8E A;  5C12 A;  4BRI A;  5M1Q A;  3QDK A;  1S3X A;  4IWV A;  5AQO A;  3F9M A;  3JXU A;  1TUY A;  4H0Y B;  4FSV A;  1G99 A;  3QIC A;  2Q31 A;  3E9P A;  2NNW A;  3D2F A;  1X9J A;  1GLB G;  2JWK A;  3P4I A;  4KH6 A;  3CCM N;  4I6M B;  5AQT A;  3KVG A;  4AM6 A;  1R59 O;  4O8U A;  2NRV A;  3WXK A;  3C65 A;  4CBU A;  3Q7B A;  1QVF M;  3K9J A;  3LDQ A;  1VQ5 N;  1OKJ A;  2ASO A;  2V52 B;  5AQU A;  3VGL A;  4C23 A;  3MDQ A;  4OPH A;  1GLL O;  3S41 A;  3CER A;  2YX6 A;  5F0X A;  2GWK A;  3CJ7 A;  3UKR A;  1YJ9 N;  3L6Q A;  2BH1 A;  3F5T A;  4RWT A;  4C1N K;  2IVN A;  2YCH A;  5E26 A;  5AR0 A;  3LM2 A;  2HOE A;  3QML A;  5FPE A;  5AQI A;  1D4X A;  3FE1 A;  3ENB A;  5F2R A;  2Q97 A;  3SBT A;  3IKM A;  4BR0 A;  1VQ7 N;  1BA1 A;  5HOO A;  2YJE A;  2YHX A;  5CHI A;  2FF6 A;  3O9S A;  1NMD A;  1XC3 A;  1QQM A;  4C1N I;  2QI2 A;  2P9U B;  4CZJ A;  3KWG A;  3C7N B;  2GEM A;  3QB0 A;  4GV9 A;  1BA0 A;  3I8B A;  4E1J A;  4YOV A;  2F9W A;  2P9S B;  4IDH A;  5CR4 A;  4GV3 A;  4JN4 A;  5GAH P;  2PBD A;  5AQZ A;  4HWI A;  1BUP A;  3WEE B;  4Y0W A;  3VF2 A;  4PL7 A;  3A0I X;  1GLC G;  3CHW A;  2I7P A;  4MO5 A;  5FPD A;  3DJC A;  4FOE A;  5AQF A;  3DLL L;  2RE2 A;  3ZX0 A;  3TSQ A;  4BG9 A;  3DXK A;  2GTD A;  4BR7 A;  5C2F A;  2Q36 A;  2QWL A;  4BVO A;  3GBT A;  3H6E A;  3R1X A;  3SMS A;  3VMF B;  4CD1 A;  5KQD A;  1BWF O;  4BR5 A;  2HBJ A;  1XUP O;  3ZX3 A;  4QS9 A;  4OPA A;  4JKD A;  1S22 A;  4YDU C;  5KPZ A;  1KAX A;  1T6D A;  3CCU N;  2E2P A;  1ATR A;  3FR0 A;  1YI2 N;  2QWR A;  5BR9 A;  5BRH A;  2QXL A;  4GNI A;  4ILG B;  3BF1 A;  5BPM A;  3WXI A;  1NGH A;  1NLV A;  4IEI A;  3EN9 A;  5KPR A;  3R3L A;  3O9U A;  3LDP A;  4RCH A;  5AQP A;  3E1Y A;  5AQQ A;  2ZJP L;  5CE3 A;  1JCE A;  5EY4 A;  5BPL A;  3CCE N;  4CBX A;  4ILJ A;  1HKC A;  4FOI A;  3BP8 A;  4NB4 A;  2VGN A;  3VF6 A;  4G9Z A;  4BY9 C;  4BRA A;  3DWL A;  2YI1 A;  4IFE A;  2Q0R A;  4RTF D;  3N4P A;  1YVN A;  4A5A A;  5GIN A;  1TYQ A;  5AFU A;  5AZI B;  1NM1 A;  3HM8 A;  1YJN N;  4UY8 O;  4M63 C;  3ULE A;  4DHY A;  5AZJ B;  4JKC A;  3EZW A;  4XH5 A;  4M7Y A;  2IVP A;  2QM1 A;  4U7B A;  1NWK A;  2QTD A;  2A40 A;  2HMP A;  2VYP A;  4NLC A;  2KHO A;  5AQY A;  3A5N C;  1YXQ A;  2E1Z A;  1RGI A;  4WQ4 A;  3HOT A;  3AAR A;  2BTF A;  3Q7C A;  1E4G T;  5KPT A;  3CCL N;  1HKG A;  1GLE G;  2WBN A;  4EAH D;  1YAG A;  1VQ8 N;  3RSE B;  4WFB L;  3OBW A;  3NVK A;  2OTJ N;  4BRH A;  2F9T A;  4GY2 B;  4CD3 A;  2J4R A;  3VGK A;  4ISG A;  3QFU A;  1YIJ N;  3SAH A;  5I9E B;  5LJW A;  3H3O B;  3PIP L;  3EL2 A;  3W0L A;  2PAV A;  4BVP A;  2D0P A;  3O4W A;  4M7X A;  4JKA A;  3W3D A;  1V4T A;  1QZ5 A;  3AAP A;  3CJB A;  4JHD B;  1YJW N;  3AAQ A;  1ZXO A;  3U8X A;  1X3M A;  4WYB A;  3T7Z A;  3FZL A;  1VAZ A;  1BDG A;  3LDL A;  3ZX2 A;  4B1U B;  3IUC A;  1VQ9 N;  4FPB A;  3FGU A;  4H5T A;  2DPN A;  4H0T B;  2FF3 B;  3MN6 A;  2HBK A;  3H1V X;  3JS6 A;  3VGM A;  1XQS C;  2KKZ A;  3P38 A;  3D6R A;  1BO5 O;  2NRW A;  2P9I B;  4BRO A;  2QEX N;  3K9K A;  3QBX A;  3SAF A;  3QBW A;  4WFA L;  2ASP A;  3HI0 A;  1U2V A;  1LOT B;  1ZC6 A;  3ATU A;  1IG8 A;  5HL7 L;  2Q1N A;  1T3V A;  3E66 A;  4YOR A;  5AQK A;  3WQU A;  3TTC A;  4U67 L;  3EO3 A;  1MA9 B;  2V7Y A;  3CPW M;  4PHT X;  2QWQ A;  3VTH A;  4NLB A;  1Y64 A;  4BR9 A;  1MWK A;  3M6G A;  2FXU A;  5AQL A;  5GAD P;  2NRR A;  4FWM A;  1U6Z A;  3CPE A;  3IDH A;  4IJN A;  3VEY A;  5AZI A;  1YHQ N;  1KD1 O;  2D4W A;  3IFR A;  3MWP A;  4JK9 A;  3EKS A;  5AQW A;  3KK7 A;  1HX1 A;  3M1F A;  3CCR N;  2HBM A;  3A5O C;  5E84 A;  2UYT A;  1ZBS A;  3HSC A;  3AGK A;  5KQ8 A;  4YDU A;  4ISE A;  3D2F B;  2WC9 A;  2NRZ A;  3A5L C;  3A8Y A;  4H5R A;  4QS8 A;  2YHW A;  5C10 A;  2ZJR L;  3EE8 A;  2ZGZ A;  3VOV A;  2P9P B;  1BU6 O;  3HZ6 A;  3MN9 A;  3O8M A;  1S72 N;  3F2K A;  1QQN A;  1Z6R A;  2IIR A;  2FLO A;  4CZH A;  2FSJ A;  4CJ7 A;  3TSP A;  3LDN A;  4BRF A;  3CET A;  4FO0 A;  4ILH A;  3KWI A;  4OO1 J;  1Z05 A;  3FLC O;  4H03 B;  5LJV A;  2A42 A;  3DXK B;  2A6A A;  2P9P A;  3O1B A;  3SJH A;  4XH4 A;  5ELZ A;  2YHY A;  1HJO A;  3CCV N;  2JWL A;  3VET A;  4IOC L;  2ASM A;  1YF5 L;  1YUW A;  3R9P A;  4CZL A;  4PKG A;  3UB5 A;  3CME N;  3VPZ A;  4CZM A;  4H0O A;  4H5W A;  1KAY A;  4KBO A;  1HKB A;  2ZF5 O;  2Q0U A;  2Q2R A;  3GL1 A;  4JKB A;  4YOT A;  5H1S Q;  3LM9 A;  3MCA B;  3DAW A;  3SAG A;  4L3Q A;  1RDW X;  2P9K B;  4BRD A;  1N8R O;  1QZ6 A;  3CJC A;  1K8A O;  3I56 N;  3TU5 A;  3AGR A;  3UKU A;  3SLC A;  3CCS N;  1P8Z A;  4JEP A;  3ZET A;  4MDB A;  1SAZ A;  4CBW A;  4IOX A;  4YOX A;  2GWJ A;  3GE1 A;  4JK8 A;  2OTL N;  1NGD A;  4CZG A;  2WFB A;  4BG8 A;  2HST A;  1ATS A;  2OAN A;  2F7T A;  4IO9 L;  4BRL A;  1VQ4 N;  4B1V A;  3NMU A;  3CJ1 A;  4A61 A;  3G25 A;  5BN9 A;  5M1N A;  3D2E B;  4BQL A;  3H1Q A;  2QW9 A;  4H5N A;  3VEX A;  1DEJ A;  5M1F A;  5ADX A;  1VQL N;  1KC8 O;  3ENO A;  3O6W A;  4WFN L;  3G6E N;  3DXM A;  1GLD G;  5GAE P;  4H0X B;  1RFQ A;  4AF1 A;  1SQK A;  3J8A A;  3C7N A;  4WQ5 A;  2NRH A;  3CCQ N;  1Q18 A;  4BRE A;  4EHT A;  1HPM A;  3D2E A;  4IZ9 A;  3C0B A;  3U9D A;  1BOT O;  1NGA A;  2KLA A;  4JD2 A;  4DQ8 A;  5DM7 L;  2AA4 A;  3HRG A;  2QWO A;  3R6M A;  5BPN A;  2VWB A;  2W41 A;  1H1V A;  4JNE A;  3CIP A;  3RVC A;  1NGI A;  2QWM A;  2P9L A;  2ZWH A;  1YIT N;  5AQN A;  4A5B A;  4IO8 A;  3H3N O;  2EWS A;  3IMX A;  4IEE A;  1T6C A;  2NLX A;  3FZF A;  2E88 A;  3RSE A;  5JVH L;  1NGJ A;  1WOQ A;  4FVU A;  4JK7 A;  5JLF A;  3CD6 N;  2P9K A;  2NZT A;  3FZK A;  5JIC A;  1W2B M;  3P31 A;  2GUP A;  2NRX A;  4BC5 A;  5GAG P;  3OA9 A;  3VER A;  1P90 A;  2CH5 A;  5EXW A;  1VQK N;  5JVG L;  1JJ2 M;  5B8H A;  3ID8 A;  3OW2 M;  3BF3 A;  1HLU A;  4NO7 A;  4YOW A;  2FSK A;  3H45 C;  2V7Z A;  3UE5 A;  1NGE A;  4FWS A;  4PL8 A;  5EOY A;  2E2N A;  4BRC A;  3AY9 A;  3CQX A;  3WXL A;  3VEN A;  4J8F A;  2HBL A;  3HOS A;  4MO4 A;  4FWO A;  4PKH A;  5AQJ A;  2HF4 A;  2E20 A;  2E2Q A;  3BUZ B;  1VQO N;  2AP1 A;  2D1K A;  4MLH A;  2VGM A;  3SK3 A;  2ZJQ L;  1ATN A;  1X3N A;  1NGF A;  1C0F A;  4FWQ A;  3HTV A;  4YOU A;  5AQH A;  4CZK A;  2QA4 N;  4CZE A;  1MWM A;  1KAZ A;  1QQO A;  1CZA N;  3FZM A;  1C0G A;  3GOI A;  2ITM A;  3O80 A;  1EO1 A;  4FWR A;  3U9Z A;  3UKU B;  3LL3 A;  3ZEU B;  4WQ5 C;  1BG3 A;  3VF4 A;  3WXJ A;  3ZET B;  4EHU A;  3C6A A;  4KH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...