5C2DA

K428a mutant gp2c of large terminase subunit from bacteriophage sf6 with calcium
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
241
structure length
227
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
total genus 84
structure length 227
sequence length 241
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c2dA00
5C15A 5M1FA 4IEEA 5M1PA 5C2DA 3C6HA 5M1NA 5M1KA 5C2FA 4IFEA 5M1QA 3CPEA 3C6AA 5M1OA 5C10A 5C12A 4IDHA 4IEIA
chains in the Genus database with same CATH superfamily
4BVPA 5HRNA 2JWLA 1S1UA 3DLBA 3O3FA 4JI0K 4JKEA 4CD3A 1FW6A 5BN9A 3DLEA 3ZX2A 4B1XB 4PUOA 4A61A 4GV3A 3SPYA 4BR5A 2CGKA 3LZJA 2ITGA 2IVOA 3BGRA 4OKEA 3CFPA 2XY7A 2KHOA 3HSTB 4FJ8A 3C6TA 1BISA 1RBSA 1XC3A 1TYQA 4DF8A 1UA1A 2HW3A 4KHWA 3EKUA 3PX6A 2B5JA 1KXPA 2V7YA 4M45A 2G8WA 5AQUA 3ATUA 1OVQA 4CEEA 3BEXA 5JICA 1IKWA 1GLAG 1N5YA 4DUZK 4HUFA 4BWJA 2IVNA 1XHZA 1NK4A 1WAFA 1VQON 1RBVA 4FLWA 1UAXA 3K9KA 3U4LA 1ILYA 4DFJA 2FLOA 3AO1A 1BGXT 4KTWA 5IT9O 1SL0A 3A2FA 3ATVA 4F9OA 3JSMA 3O6WA 3GBTA 1HNZK 1GLEG 1NJWA 2GUIA 3QB0A 5HRPA 4GKKK 1QHAA 3VETA 5H1SQ 4BRLA 3J7ZO 3NF8A 4AHCA 3WEEA 3VQ7A 4LFAK 4CF8A 1NGIA 1VQ5N 3QEPA 5CZ1A 2YNGA 3R1XA 3KJVA 1NG9A 4JKHA 5JS2A 3VEWA 4MQ3A 1RT5A 4WQ5A 3PO5A 1YF5L 5CYMA 5LMUK 4WF9L 3SJJA 3BUZB 4H5NA 4O4GA 1QSYA 3VQAA 1K6YA 2E2QA 4CF0A 3VN5A 4DV6K 3QICA 3H45C 4Y1CA 4XEIA 3OYNA 1TKTA 4KB1A 3TSUA 2HNZA 3CM5A 5J2PA 5B8HA 1GOCA 1WBDA 4BRKA 2HMPA 1KAZA 1X3MA 2P9KB 1DTQA 4OPJA 5FRMA 3MEDA 1SZ2A 4OGEA 5AQYA 4WFAL 2P9SB 2IVPA 4CF9A 4FZXC 1TL3A 2D0OA 1Q82O 3AV9A 4NLCA 1L3SA 4H5TA 4IOCL 1IKXA 3K5NA 4E7KA 3OBYA 4B1UB 3DRPA 3AAQA 3HPGA 1JLBA 4HUEA 4B3SK 1YHQN 4CHQA 1YJWN 2EWSA 3CC7N 3V1OA 2BE2A 3DWLA 1NGAA 1Y97A 3LP0A 5FPEA 4EP4A 2VG6A 3FFKB 5M1FA 4Z4HA 3OS0A 3CG7A 4DUYK 2D0CA 4CF2A 2O8CA 3SUQA 1KTQA 1NMDA 1LW0A 2IGIA 4CW7B 2HHVA 3OHRA 4XH4A 2CGJA 5BN8A 4FJHA 5HP1A 4YOVA 1SUQA 4C8NA 4CEFA 2HF3A 2UUAK 3OYEA 2GEMA 3CC2N 3ZYYX 1O13A 1HYVA 1XWLA 3D2EB 3EE9A 4F4KA 3TSQA 4PQUA 3VEVA 2KQ2A 4O0JA 1SL2A 3K9JA 1BQNA 3H1QA 5JS1A 2F9TA 5GAEP 3KLGA 1W2BM 2QWPA 1S1TA 3W3DA 1QQOA 1HPMA 2NRZA 3VEXA 4AHVA 4E19A 3DXKB 4GV6A 2ASPA 1EWQA 3HVRA 2HSTA 4CJFA 4CZGA 4CZLA 4KV8A 3CFRA 2PBDA 2QXLA 2YNFA 3O08A 3FGUA 3RRGA 4CESA 4FLZA 3DLKA 4M3UA 2VWBA 1RCHA 4KFBA 3IAYA 5BPLA 4LD0A 2RPIA 1WB9A 1MU2A 1E3MA 3BP8A 1WBBA 4MLHA 4DF4A 1UA0A 4CFBA 4FXDA 3G71N 3HTVA 4A2BA 1JLEA 5KRSA 4DV7K 1JXBA 3OYBA 1T6DA 3L4QA 5BRHA 3QERA 4Z4EA 2KZZA 3AGRA 3KWIA 4BDYA 2NRRA 4JI3K 3NGIA 3TAQA 4PY5A 4Q0BA 1U4BA 1S9EA 1JLAA 4ILJA 4Z0UA 2PYLA 1YTUA 4B9VA 4FPAA 1A5XA 4DQSA 2Z1GA 5HOOA 3OYGA 3ITHA 3A5OC 1QSSA 1KAYA 4JI5K 3K57A 4JK9A 1BCMA 4WFNL 2HVHA 2QW9A 4J2DA 1CXQA 2X6NA 3V9WA 2OTLN 1J9AA 3RR7A 4KO0A 4DU3A 2QXFA 1N6QA 3QLHA 3R3LA 4JI4K 1XC9A 5AQIA 3MN7A 1GLFO 1CZBA 4QAGA 1OH7A 1L3TA 2VQEK 3F9MA 1HJRA 1HUXA 1C0UA 4B9SA 4BE1A 1VQ6N 1LW2A 4DR1K 4DV0K 2O8DA 4DU4A 1JKHA 1Q18A 3HSCA 5FPMA 4FJLA 3HOTA 1U47A 2O8FA 5KPTA 5HBMA 4YHHK 5FLXO 3KIOA 3ISNC 4BR4A 4KAZA 3P5JA 1IH7A 2QM1A 3CJCA 4CEDA 3S3OA 3PX0A 1LWFA 3VEZA 2VGMA 4DTOA 1D8YA 3PO4A 4LC9B 3ZCMA 3E1YA 3IG1A 3KWGA 4DQRA 3NH0A 4JHDA 4B9LA 1NM1A 4G1QA 4RWTA 1MWKA 5AJ3K 3AO4A 5IWAK 2A40A 4JKDA 4JK7A 3JYTA 3PUFA 4X65K 1IO2A 1HNWK 1P90A 5T7BA 1HQEA 3QETA 4NCAA 4CGFA 3K58A 3IRXA 5EU7A 3MXJA 4CJ4A 4MO4A 4CEBA 2ZWHA 2P9PB 2E2OA 3RVCA 3CJBA 1QHTA 2KW4A 1LWEA 3O1BA 3VA3A 3SAGA 1R0AA 1TK8A 3NVMA 1WLJA 5DK5A 3ENBA 2WC9A 3PSFA 1HRHA 4C8MA 2OTJN 3DXMB 1NK6A 3HI0A 3OYHA 4IJAA 4CGIA 2QWRA 4JAXA 3OVNA 4K8ZA 3SBGA 1LOTB 3DRRA 4E3SA 3TAPA 3OYLA 1DEJA 3ALYA 3ZSWA 4FOEA 2QTDA 4AM6A 3F73A 1WAJA 3QFUA 3O5BA 3C6AA 2P5GA 2W41A 3SBTA 4CIFA 3PLAA 1JL1A 4W5QA 1NK8A 4BRHA 1U2VB 4DKWA 4W5OA 4K0KK 3G10A 4BG9A 4F2SA 3QIOA 4H03B 3TARA 3R9PA 2I7NA 3IMXA 1Q86O 1D9DA 3WQUA 2HBLA 4JV5K 4XH5A 5AQRA 4YOWA 1Z6RA 3WT0A 3K5OA 1NBWA 2Y1JA 4DHYA 1S6QA 4IOXA 4M3WA 2RKIA 4FWOA 3FZKA 1U48A 2AJQA 1WSFA 4HHTA 5CR4A 3D45A 3MDQA 1ZBFA 4LSNA 4H5WA 1VQMN 3KHYA 3K5MA 4CBWA 1GOAA 1LWCA 1M90O 3U3YA 5AQQA 3O3GA 3BF3A 4H0OA 4FWLA 3RRHA 3THXB 4OPKA 5C24A 4CBXA 3ZEUA 1CZ9A 1I39A 4FWQA 1JLGA 4CEZA 3AVNA 2O4GA 3FZHA 3VQ9A 4CE9A 4KREA 2G8FA 1BUPA 4W5RA 4E1MA 2O8BA 5AQXA 2H3GX 1U49A 1NK5A 2XRIA 4E7JA 4JI1K 4KHYA 2XY6A 3ZT3A 1RDCA 1C0MA 3AVKA 2XY5A 3MMVA 2Q36A 4YY3K 4FWKA 2F7TA 3HPOA 2W42A 5BREA 5JVGL 4HTLA 4Y1DA 4CZMA 4U67L 3TTFA 1U6ZA 1T3VA 1QQNA 3EO3A 1XMQK 3VPZA 1HJOA 4FJXA 1FK9A 2AP1A 4CCHA 1BHLA 4B3TK 1OH8A 1NU0A 4B9TA 3PY8A 4IFEA 4M63C 3NF7A 2NRVA 3QEWA 4KTZA 3DLRA 2YV0X 1NKEA 3HP6A 2DFEA 4OKJA 4MDBA 4BGAA 5HL7L 3KLEA 1TUUA 2E2NA 3L2VA 5C2DA 5LL6Z 4DSEA 5C10A 1TYQB 3UKUA 2FF6A 4JKBA 1NMNA 5AQLA 2QWNA 1H1VA 3I0SA 2DY4A 3M1FA 1BWFO 4Y0WA 2JGUA 3L4IA 3NF9A 3U6FA 4JI7K 4UQGA 3Q7BA 3KD5E 3DMJA 3QFPA 3ZSQA 1Z26A 4R79A 3IDHA 1JLFA 2OZMA 5HRSA 3RSEA 3TABA 1TKDA 1WSEA 1WUAA 1HPZA 1T03A 4FWSA 4DSLA 4DTUA 3WXJA 2Q0UA 4A5BA 2HVIA 1QVFM 4O5FA 4F8RA 1OH6A 4KI4A 1RT3A 3TTCA 1N34K 3A5LC 3AGKA 4CEOA 1YAGA 5J2QA 4JS4A 4CI6A 1HQUA 4DTPA 5KI6A 3H46O 4BROA 2KFZA 4FWRA 3L0QA 4FWMA 4BREA 4DLEA 3SK3A 2DPNA 3C0BA 1ZBSA 2D1KA 2HHQA 4C8OA 4M3RA 3VQPA 2YHBA 3QESA 1ASWA 1OH5A 2VG5A 3T3FA 3OYIA 3EY1A 1M1KO 3BZKA 3LDLA 1IKYA 1WSHA 3JS6A 1RDWX 1BO5O 1L5UA 1BQMA 3NH2A 3AVBA 4CK1A 4DV4K 2KZMA 5DM6L 5JMVA 4KHUA 3I55N 4FZZA 2D0BA 3O8MA 4I7FA 4QS9A 1J5OA 3VF4A 4NYFA 2DFHA 1VHXA 1NK7A 1S1XA 3LAKA 3DI6A 3LZIA 1BDGA 1QQMA 2BUPA 4FJGA 2YKMA 3HBTA 2Q1NA 1TK0A 3CC4N 2G8VA 2ZQBA 4FLUA 1S6PA 3FE1A 4JD2A 2O8CB 1T05A 5AZJA 4RW9A 3VEOA 3O9RA 3CJ9A 3M3ZA 4JKGA 3CJ7A 2FSKA 3DLGA 4CJKA 5AR0A 1HNIA 4IFVA 1J53A 4DR5K 5AQVA 4IOAL 3SQ1A 4X64K 4I9LA 3L3UA 4FJNA 3SQ4A 4OLBA 3G0ZA 3QBXA 4N76A 3O1WA 3AO3A 4K42A 2UUBK 4WQ4A 3EYZA 1RNHA 4O5BA 5EVZA 3WXMB 1C1AA 2X74A 3CJAA 2ITMA 2E1YA 4IZ9A 4AF1A 1XHXA 4ICLA 5I42A 3FLCO 3P1GA 4A57A 5AQMA 4LF8K 3DM2A 3VQBA 3Q7CA 4CF1A 3OYDA 4Z94A 4B9NA 3UKRA 2F9WA 3DOKA 2HNDA 4ID1A 3N4PA 4M3TA 5F2RA 3QBWA 5CZ2A 3RTVA 4RW6A 3OBWA 3H3NO 3SPZA 2ZJRL 1T44A 4CIEA 3CJ1A 1KSPA 1FJGK 1XNRK 3D2FA 3JXUA 3LP1A 1L3UA 5FROA 4BDZA 3M6GA 3TTDA 1W0HA 3WXKA 4DFKA 1S22A 4NCBA 4IG0A 4C8KA 3NHGA 3M8SA 3BZCA 3MCPA 4I6MA 5J1EA 1SL1A 3PIPL 1QVGM 2F4VK 2XY8A 1X1PA 2E1ZA 5I3UA 3CFOA 3ZSZA 4PL8A 2YKNA 4CJVA 1WSGA 4DSJA 2CH6A 3GOIA 2FBXA 2XHBA 1X9JA 4FVMA 5LJVA 2NLXA 3HJFA 3H3OB 3CMAN 3ZSVA 4CEQA 2D0AA 3TPQA 3ZETB 4CJWA 3HM9A 3DRSA 3G25A 3EEQA 5FPNA 5F0XA 3KK3A 1WSJA 5AQWA 1WOQA 3KLIA 4DLGA 3LPUA 4CZJA 1OKJA 3NMUA 1VQKN 3VTIA 1ESVA 3GDQA 2ATQA 1RBUA 1J5EK 1KRPA 3GG4A 1G99A 1HKGA 2YHWA 5HLFA 1JJ2M 4NYNA 3I8BA 1RT1A 4EFHA 3IS9A 1NGFA 1NKCA 5ELZA 3TAGA 2YCHA 3MK6A 3PV8A 3B6OA 1T6CA 4BVOA 4H0PA 3CM6A 3C6UA 3ULEA 5J2NA 4CERA 3PX4A 2HBKA 2OCEA 3T1HK 3NFAA 2J4RA 3OY9A 4BDPA 3HOSA 3ID8A 2P5OA 3T69A 4OX9K 3NF6A 1ZYQA 2P9UA 4IFYA 1JL2A 2A5XA 4FM2A 1QTMA 1QZ5A 1BI4A 3FFIA 3P39A 1B9DA 4YDUC 3LP2A 4BRAA 2O8FB 2GTDA 4BC3A 2HHTA 4IG3A 4DCHA 2E20A 3V4IA 5EOYA 5FDLA 5KGXA 1XQSC 3TAFA 3WUHA 2P9KA 3HL8A 3VQ5A 2V7ZA 1V4SA 5KPRA 5C12A 1KD1O 4FLVA 4JLHA 5BRFA 4FSVA 2P9SA 1G15A 2Q31A 2Q97A 2D4WA 2OPQA 2NUBA 2OPPA 2P9NA 5SZTA 3LWMA 2PAVA 4E1NA 4JK8A 1Q81O 4JHDB 4I9QA 4KTQA 1VQLN 4K8XA 2OPRA 2HBMA 3I56N 3RMBA 3V9SA 3RMCA 5E26A 3J7YP 3W0LA 4B9QA 2HF4A 1I3AA 3D7EO 4DTXA 4CJUA 3SUPA 1GLLO 4IKFA 3SZ2A 2UYTA 3C6HA 1NGDA 2OZSA 3SLCA 3VQ6A 4J8FA 1TKXA 2E88A 5C42A 4A62A 2HOEA 4C8LA 3L2RA 4DQPA 4LH4A 1BG3A 4FPBA 5GADP 4ELUA 4C1NI 3V1QA 1C1CA 3ID6A 3UE5A 4FLTA 3LDSA 4DG1A 3CCUN 1NKBA 2EX3A 1NGEA 4WE1A 4JEPA 3QDKA 1CXUA 1C0TA 3T7ZA 1VRTA 1NLVA 4KHQA 4LF9K 2BH1A 4V19S 4DV1K 5C2FA 3IFRA 1VSFA 1VSKA 4CZKA 4H8KA 4DSFA 2IAJA 1EO1A 2BGGA 2HMIA 5HRRA 3AO5A 5GAHP 1RDAA 3ASMA 4FO0A 1VRUA 1XMOK 4B3OA 3H6EA 3OW2M 1X9SA 3QO9A 1RT7A 2OPSA 1HNXK 3S41A 2UXDK 4B9MA 4BACA 1VSIA 4FJJA 1K8KA 3AVAA 4GMJB 1NGCA 2PYJA 4BRNA 1YJNN 4UY8O 1XNQK 1KVBA 2O8EA 1F21A 3J80O 5TKWA 4RW4A 3MXIA 5DMRA 3KD1E 2NRHA 2NRTA 2WFBA 4CGDA 4FJ7A 4JRQA 3L2WA 4ISEA 4HTUA 3SUOA 4NLBA 1IG8A 3C7NA 2GX9A 1HR0K 2ZF5O 2YHYA 3E9OA 4W5TA 4C1NK 3AA3A 3KK2A 1JCFA 1MA9B 2JLEA 4JRPA 4CGGA 2NZTA 2HHUA 3QEVA 1SV5A 4E7IA 4BWMA 4QS7A 3TSPA 3ZEUB 4BR7A 5M1KA 1S72N 1SAZA 3VERA 3O4NA 4CJLA 4CHOA 3RR8A 3AVGA 3CQYA 1WSIA 4DV2K 4QCLA 2FF3B 3H1VX 1ASVA 3A5NC 3CI5A 1KFSA 5C0YA 2P9LA 3AAPA 4CZEA 3S3NA 2O8BB 4BRIA 1D4XA 4AHTA 4MDAA 4Q5VA 4FW1A 1MDUB 5AQGA 4M7XA 4PKIA 1IKVA 2VQFK 4CJSA 3KK7A 3DAWA 3SAHA 3OYKA 5D3GA 2G8KA 3HYFA 1VSDA 4BQZA 4FJ5A 4KRFA 3P83D 2IS3A 3ZT4A 2JWKA 1WNSA 2KTQA 3E01A 1RGIA 4JYAK 2GUPA 2VWJA 3L2QA 4FYDA 1EETA 4PKHA 3RMDA 5KRTA 1FKPA 2FBVA 3TU5A 4H5VA 2DTUA 2HHHK 1T7PA 5JVHL 4JKFA 3VGMA 1QQCA 4Z4CA 1VSLA 2RF2A 5BPMA 4DFMA 1CZAN 3SV4A 1NNEA 5AQPA 3MECA 2XO7A 2QWLA 1Z05A 4FM0A 3BF1A 1KVAA 1REVA 3UKUB 2KLAA 4ZHRA 2GWKA 1ATSA 4KPYA 3TAEA 5F1XA 3ZSYA 2IDOA 4WYBA 5GAGP 4ILGB 4KHPK 4PL7A 4BG8A 5LJWA 3TWHA 3QNNA 2ZJQL 1RDUA 3HM8A 3RSEB 4DR6K 4KH6A 4ID5A 1DT9A 1GLJO 4H0VB 4HCBA 3K2PA 2YJEA 4CFAA 3DOLA 3WNFA 2BDPA 3O9SA 3VEYA 5KQ8A 4ZTJA 1YITN 2NNWA 4CK3A 3M5RA 2P9PA 5AQKA 3SNNA 4CEAA 5JLFA 4CHNA 4LFCK 5A2QO 5JLHA 1FKOA 1A5WA 2YHXA 2UUCK 3K0SA 4J2EA 3AVJA 2NRWA 2UXBK 4F3OA 3CHWA 3BDPA 2ZGYA 4H0TB 1J6ZA 5EX5A 1QSLA 1ZBUA 1VQPN 2AA4A 4BE0A 4BR0A 4B1ZA 4M3ZA 2F96A 3NH1A 4O0IA 4DV3K 4E1JA 1GOBA 4JKCA 3NCIA 3C94A 2FSJA 4I2PA 4DS4A 5LMNK 1N32K 3ZSRA 1A5VA 3CPWM 3SCXA 4B9UA 3LANA 3OJSA 2FXUA 3AVMA 3VGKA 4L3QA 4B3RK 1TVRA 3ZLJA 1BIUA 3M8QA 3DLHA 3LDNA 3LDPA 3V9ZA 4IJNA 4RCHA 4BQLA 3THWA 3LDQA 1VQ7N 3CXCM 4J2AA 4FJKA 3CERA 4JNEA 4KH4A 2VCPA 3SMSA 1NOYA 2D0PA 3VF2A 1KAXA 3OA9A 4LH5A 4AQYK 4FK4A 3F9KA 2CH5A 2YJFA 3U3GA 4JI6K 4CVNE 3ZX3A 2HHWA 5K14A 4CJ7A 5BPNA 4PA1A 3AARA 4CZIA 3GL1A 3NAEA 2QKKA 4PWDA 4JD2B 3O9TA 4M41A 4BRDA 3WNGA 3LWLA 4EAHD 5AZJB 3MCAB 2ZE2A 1BA1A 3MXMA 1GLCG 4JKGB 4EP5A 3SUNA 3WEEB 2VWKA 1IJJA 4LF6K 3THYA 4AHSA 5E84A 1ASUA 5AQJA 2P9IA 3EZ5A 1BL3A 1N33K 3CCLN 4FWNA 4A5AA 1SKRA 4EZ6A 2FC0A 3OYFA 5C15A 3CETA 3HRGA 1RTHA 1LCUA 4U7BA 3A8YA 3DJCA 1EKEA 2BANA 4GKJK 1JXEA 4LF5K 5FPDA 3UKRB 4FJ9A 3CCMN 3MWTA 3MX2A 3B8AX 1JCEA 3WXIA 3L3VA 1DTTA 4MFBA 1DKGD 4LY7A 3EL2A 4FOIA 3HP9A 1BA0A 4RTFD 4WQ4C 1BOTO 4DQQA 1YXQA 1YUWA 3O4QA 4WQ5C 1K8AO 4FLYA 3D2FB 3EN9A 1RTIA 5M1PA 4XIUA 3SAFA 3VQCA 1Q9YA 1TK5A 3S3MA 3HO1A 4NXMK 5BR9A 3ZSOA 4I6MB 2KFNA 1VSHA 4G9ZA 3KKSA 1ZBHA 4FK2A 1YVUA 4YOUA 3V1RA 4Z4FA 4RW8A 4N41A 5KQDA 1HX1A 1RBTA 3OJUA 4HCCA 1EQYA 3ZT1A 3CQXA 4Z4IA 4HUGA 5AZIA 1X3NA 4DTSA 4CJTA 4DTMA 1RDBA 4WCEL 4CFCA 1B9FA 4CJEA 4BC4A 4GNIA 4FLXA 1DGKN 3OYJA 4BGBA 4M3YA 1KLMA 3V9UA 4O8KA 2RE2A 1NGGA 4E89A 1VQ4N 4IEIA 1VAZA 4QS8A 4DMNA 2I7PA 3P38A 1RT2A 2B4JA 4CZHA 1B92A 3FZFA 2O4IA 1S1VA 1RILA 3KKRA 4K43A 1IBKK 3VQ8A 2BTFA 1ZXOA 1YJ9N 3AA5X 4YOYA 3LAMA 4JKAA 3ULEB 2W6KA 3M8PA 1WN7A 4CGHA 4OKKA 4CJ3A 1VQ9N 2F8SA 1YVNA 1BCOA 3AA2A 1JLQA 2VGNA 2Z1HA 2YX6A 4LF7K 4RG8A 1DLOA 3PIOL 5AQFA 2P9UB 1Y64A 4H5RA 3WNEA 4M7YA 4BY9C 2PZSA 1VSMA 3L2UA 4WFBL 3VENA 3UB5A 1BI4B 4HWIA 4BRFA 3KLFA 3LPTA 4FJIA 3ULDA 1EWRA 1O1WA 1IBMK 4OVLA 4B1VA 2HB5A 1UWBA 3AA4A 4DR3K 4DFPA 5LY3A 1NWKA 4ISGA 1K9MO 4H0XB 4M42A 4XH1A 3J8AA 4BRQA 4AILC 3SI6A 2P9NB 3I0RA 3E9PA 3FZLA 3O80A 5AQHA 2B6AA 4GV9A 4F2RA 3HT3A 1RBRA 1KQSM 4BR2A 2E6MA 4IO8A 3MN5A 1LV5A 3EKSA 1ZBLA 4OGCA 3CIPA 4A59A 4H4MA 3FR0A 4GVEA 4ELTA 3C95A 4DB3A 4NO7A 4DSKA 4CHYA 2E5LK 4N47A 2G8UA 1BU6O 3AVLA 1I94K 3AVHA 1XI1A 1ITGA 3MX5A 4CGJA 2A1SA 3G4SN 4OLAA 4BC5A 1C6VA 1EX4A 1VSEA 3U8XA 1Q7YO 2Y1IA 2ZD1A 5AQSA 3TR8A 2OANA 1SKSA 5KTQA 3HZ6A 2YI1A 4LSLA 4DR2K 3V6DA 4CJ5A 3SQ2A 3S9HA 3NVKA 4BC2A 2GELA 4ILHA 4E7LA 5M1NA 2IOCA 2Z1JA 3VQQA 1K73O 4OJRA 4ELVA 4B08A 3MEGA 1E4GT 3G6EN 3OS2A 1EXQA 2O8DB 4BRPA 3J7AP 4DU1A 2P51A 5AFUA 3AY9A 2ASOA 4LF4K 2ZGZA 4H4OA 4EIAA 1VQ8N 3QIPA 1J54A 3CYMA 3O3HA 1C0FA 3EE8A 4C23A 1K8KB 3VESA 5TKYA 1IV0A 4FZYA 3F5TA 3A5MC 3DLLL 1TKZA 2O8EB 5BRDA 4N56A 5M1QA 1Z25A 4YNQA 4IO9L 4E0DA 5CY4A 5AQNA 5AFUH 4AH9A 4BRGA 4X66K 4BE2A 3PSIA 5DM7L 3D6RA 4KKOA 3C7NB 3VMFB 2WTUA 3WNHA 3RWUA 4FM1A 2YNIA 2A42A 2E4LA 2WBNA 3LALA 3VGLA 4NCGA 5ADXA 3MWPA 3N4QA 5HROA 3ZETA 4E7HA 1S5JA 4LFBK 3B6PA 1X9WA 3BY5A 2QK9A 1RDDA 3VQDA 4EHTA 1ZBIA 5CHIA 4KBOA 1C1BA 1NJIO 4JN4A 3D2EA 4I2QA 3ZT2A 1D9FA 1SQKA 1KFDA 2P9LB 1S3XA 1RTJA 2QA4N 2RN2A 5C25A 3EZWA 3L6QA 5GIOA 5MLCQ 4KHSA 1NGBA 5M1OA 4MLEA 4YDUA 5ADXH 2Q0RA 3CCSN 2E2PA 1TUYA 1RT6A 2G8IA 3D0PA 3U9ZA 3TI0A 2GBZA 3DXKA 4FK0A 1ATNA 3E9LA 3AVCA 3TANA 4QOZB 3FZMA 2QI2A 4DTNA 5J2MA 1RFQA 4CK2A 4CJRA 1U45A 2FBTA 1GLBG 2X6SA 3RMAA 4EZ9A 4AM7A 3R8EA 3NGZA 3CCVN 4MO5A 2PFUA 4OO1J 3CCRN 2HHSA 3CCJN 2HBJA 4YORA 3AVFA 4N5SA 3AO2A 3UIQA 4CZFA 3LDOA 2QEXN 1HYSA 4CD1A 4B1YB 3SQ0A 4DQ8A 2V52B 1YIJN 4DTRA 3QEIA 2Z1IA 2W6LA 4IBNA 3P4IA 4CJQA 3M8RA 3CD6N 2D5RA 2WONA 4K41A 3SV3A 2F8TA 3O9UA 4B8CA 1OVYA 5CYQA 3HK2A 3OYMA 2WUSA 3K59A 2A1RA 1IG9A 3NGYA 3KTQA 4TSXA 3E66A 1KC8O 1T8EA 3CPEA 2YNHA 4IDHA 4OPAA 4DQIA 3KK1A 3KZBA 1VK0A 3O4WA 4DR4K 2ETJA 3H08A 3ZSXA 3HPHA 2OA8A 4DWIA 2YHAA 4BR9A 3CCEN 1EP4A 1TL1A 4CIGA 4CFDA 1N36K 3NE6A 4J2BA 3DYAA 4GVMA 3T1YK 2Q2RA 3KLHA 1ATRA 3ZT0A 3MN9A 2IIRA 4PKGA 4YOXA 3WXLA 3J81O 3KVGA 3JAMO 3CQ8A 4GY2B 2KKZA 1R59O 3VQEA 4B8AB 3LM2A 1HKBA 2UXCK 3F2KA 4JI2K 2WOMA 3THVA 2R7YA 2FBYA 1HLUA 1CLQA 1KCFA 3CCQN 3GE1A 3OYCA 3VOVA 1JCGA 1YI2N 1HKCA 3VA0A 4FL9A 1NGHA 3K5LA 2UU9K 1NJXA 1D5AA 4NXNK 1YT3A 2RHKA 4FJMA 2G8HA 1NOZA 1W97L 1QE1A 1NK9A 1BIZA 4CECA 5GIPA 3QMLA 1V4TA 4YOTA 1KLNA 3MN6A 4HVJA 3ZX0A 1NGJA 2FSNA 3THWB 3MAQA 3O9QA 3CF5L 1QS4A 5E41A 5KGWA 3OYAA 2Q3SA 4KI6A 3P31A 5SWMA 2X78A 1MWMA 1GLDG 1KVCA 3QINA 3T1AA 4KB0A 3I33A 5CE3A 4L8RB 1TAQA 1IBLK 1VQNN 1E4FT 2VG7A 3NDKA 1YTAA 5GINA 1HMVA 3T19A 1VSJA 2LSNA 4YFUA 4OPHA 1TV6A 5AQZA 2V51B 5EXWA 4BRCA 4Z4GA 1NJYA 3A0IX 4RW7A 1HYZA 4FCYA 2E6LA 3VQ4A 3THYB 1UOCA 1HNVA 2P1JA 3DXMA 4DR7K 4KH5A 2QWMA 2P9IB 3LP3A 4X62K 2A6AA 4B3MK 4JS5A 4DSIA 1Q8IA 2E8AA 2OYQA 3C65A 3OTOK 1FXXA 3VF6A 3WQTA 2A3ZA 1LAVA 4GW6A 4CJPA 1W7AA 3SYZA 1P8ZA 5I9EB 2IC3A 4O8UA 1S1WA 1JLCA 2HNYA 2HHXA 1U2VA 2QWOA 4KHNA 1C0GA 4JI8K 2W40A 3AVIA 4DTJA 3LM9A 4DV5K 4O55A 3QEXA 4O44A 3CMEN 4DS5A 1SKWA 3TAMA 2NRXA 3HVTA 3U9DA 3IKMA 3QNOA 2PY5A 4CHPA 3IUCA 1L3VA 4EHUA 1ZC6A 1Q9XA 3L8BA 5AQOA 2ZM6K 3V9XA 1XUPO 2DFFA 3ENHA 1SS6A 4FWPA 4PHTX 1NK0A 2ASMA 1TAUA 3VTHA 2CGLA 3R6MA 4F3TA 2A41A 3NBPA 1N8RO 1S9GA 4A2AA 4NB4A 3ENOA 4K25A 4IEEA 1LAWA 2I5JA 3SJHA 1RT4A 2GWJA 1NJZA 3OS1A 3I8DA 4CHZA 3SMPA 4IWVA 2QWQA 3MEEA 4B1WB 3THXA 4FVUA 1W9HA 4IDKA 4M3XA 5EY4A 5AZIB 4FW2A 4BRMA 3LL3A 4IXCA 2GV9A 5BR8K 5FRNA 2QKBA 2ZJPL 5KPZA 4R5PA 4CBUA 1TGOA 1QZ6A 4AHUA 1U04A 2VYPA 3HXMA 2EHGA 1RTDA 4ISFA 3V81A 5AQTA 4AHRA 4ZTFA 1X9MA 4W5NA 4H0YB
chains in the Genus database with same CATH topology
3E9PA 3FZLA 3MDQA 3O80A 5AQHA 2BH1A 4BVPA 4GV9A 2JWLA 4H5WA 1VQMN 3KHYA 3IFRA 4CZKA 4JKEA 4CBWA 5C2FA 4CD3A 1M90O 1KQSM 1EO1A 5AQQA 4BR2A 4IO8A 3MN5A 5BN9A 3BF3A 3EKSA 3ZX2A 4B1XB 5GAHP 4H0OA 4A61A 3CIPA 4FO0A 4GV3A 4FWLA 4A59A 4BR5A 2CGKA 3FR0A 4GVEA 3H6EA 3OW2M 4DB3A 4NO7A 4CBXA 3ZEUA 4FWQA 2IVOA 1VQPN 3S41A 1BU6O 3FZHA 1BUPA 1K8KA 3MX5A 1NGCA 2KHOA 4BRNA 5AQXA 2H3GX 1YJNN 4UY8O 3G4SN 4BC5A 3U8XA 1Q7YO 1TYQA 1XC3A 5AQSA 5TKWA 2OANA 2NRHA 3HZ6A 2YI1A 2NRTA 2WFBA 3EKUA 3MMVA 2Q36A 4FWKA 4ISEA 3NVKA 2F7TA 4BC2A 2GELA 1KXPA 4ILHA 1IG8A 3C7NA 4NLBA 2V7YA 2GX9A 5AQUA 5M1NA 3ATUA 5BREA 3BEXA 2ZF5O 2YHYA 3E9OA 5JICA 5JVGL 4HTLA 1K73O 1GLAG 4CZMA 4C1NK 4U67L 3TTFA 1U6ZA 1T3VA 2IVNA 1QQNA 3EO3A 1E4GT 3G6EN 1JCFA 3VPZA 1VQON 1HJOA 1MA9B 3K9KA 4BRPA 3U4LA 1ILYA 5AFUA 3AY9A 2ASOA 2NZTA 2FLOA 2AP1A 2ZGZA 4IFEA 4M63C 2NRVA 4EIAA 3ATVA 4F9OA 4QS7A 3TSPA 3ZEUB 4BR7A 3O6WA 4MDBA 1SAZA 3GBTA 1GLEG 3VERA 4BGAA 3QB0A 5M1KA 5HL7L 3CQYA 1QHAA 1C0FA 1TUUA 2FF3B 3EE8A 3VETA 1K8KB 4C23A 5H1SQ 2E2NA 3CI5A 3A5NC 3H1VX 4BRLA 5C2DA 3VESA 5TKYA 3J7ZO 2P9LA 3AAPA 4CZEA 5C0YA 3F5TA 4BRIA 1D4XA 3A5MC 3WEEA 5C10A 4MDAA 3DLLL 1NGIA 1MDUB 1TYQB 1VQ5N 5AQGA 5BRDA 4M7XA 3UKUA 4PKIA 2FF6A 5M1QA 3R1XA 4IO9L 4JKBA 5AQLA 5AQNA 3KK7A 2QWNA 3DAWA 5AFUH 3SAHA 1H1VA 3M1FA 4BRGA 1BWFO 4JKHA 3VEWA 4Y0WA 3D6RA 5DM7L 3C7NB 3VMFB 3L4IA 4WQ5A 1YF5L 4BQZA 3Q7BA 4WF9L 3QFPA 3BUZB 4H5NA 2JWKA 3IDHA 4R79A 3RSEA 1RGIA 2A42A 2GUPA 2E2QA 2WBNA 4PKHA 3VGLA 5ADXA 1WUAA 3QICA 3H45C 3MWPA 3N4QA 3ZETA 4XEIA 4FWSA 3TU5A 3WXJA 2Q0UA 4H5VA 4A5BA 3TSUA 5JVHL 1QVFM 4JKFA 3VGMA 4EHTA 4O5FA 5CHIA 5B8HA 4KBOA 5BPMA 4JN4A 4BRKA 1NJIO 3D2EA 3TTCA 2HMPA 1KAZA 3A5LC 1X3MA 3AGKA 2P9KB 1CZAN 1YAGA 5AQPA 1SZ2A 1SQKA 4CI6A 2QWLA 1Z05A 2P9LB 1S3XA 2QA4N 3H46O 5AQYA 4BROA 4WFAL 2P9SB 3BF1A 3EZWA 3L6QA 2IVPA 4FWRA 5GIOA 5MLCQ 3L0QA 1NGBA 4FWMA 5M1OA 4BREA 4MLEA 2D0OA 1Q82O 4YDUA 4NLCA 5ADXH 2Q0RA 4H5TA 3UKUB 2KLAA 3CCSN 4IOCL 2E2PA 3SK3A 2DPNA 2GWKA 1ATSA 1ZBSA 1TUYA 2D1KA 3C0BA 3OBYA 4B1UB 3AAQA 1YHQN 3U9ZA 5F1XA 1YJWN 3DXKA 2EWSA 4WYBA 3CC7N 5GAGP 4ILGB 1ATNA 3E9LA 4PL7A 3DWLA 1NGAA 4BG8A 5FPEA 5LJWA 5M1FA 3FFKB 3FZMA 2ZJQL 2QI2A 1RFQA 1RDUA 3HM8A 3RSEB 1GLBG 4KH6A 1M1KO 1NMDA 1DT9A 1GLJO 1S72N 4H0VB 3LDLA 3OHRA 2YJEA 4AM7A 4XH4A 2CGJA 5BN8A 3R8EA 4YOVA 3O9SA 3VEYA 2HF3A 3JS6A 3CCVN 1RDWX 5KQ8A 4MO5A 1BO5O 2PFUA 1YITN 4OO1J 2NNWA 2GEMA 3CC2N 3CCRN 3CCJN 2HBJA 3M5RA 2P9PA 4YORA 3ZYYX 1O13A 5DM6L 3D2EB 3EE9A 3TSQA 4CZFA 3LDOA 2QEXN 3VEVA 4B1YB 4CD1A 5JMVA 3I55N 5AQKA 3O8MA 4DQ8A 2V52B 5JLFA 1YIJN 3K9JA 4QS9A 3H1QA 3VF4A 2F9TA 5GAEP 5JLHA 1W2BM 2YHXA 3P4IA 2NRWA 3CD6N 2QWPA 1NLVA 1BDGA 3CHWA 4K41A 1QQMA 2BUPA 2ZGYA 4H0TB 1J6ZA 3W3DA 3O9UA 5EX5A 3HBTA 1OVYA 1QQOA 1HPMA 2AA4A 2NRZA 2Q1NA 4XH1A 3VEXA 3CC4N 4BR0A 4B1ZA 3DXKB 4GV6A 2WUSA 2ASPA 2HSTA 4E1JA 4JKCA 3FE1A 4CZGA 4JD2A 4CZLA 2FSJA 3E66A 1KC8O 2PBDA 5AZJA 3CPEA 3VEOA 3O9RA 2QXLA 3CJ9A 4IDHA 4OPAA 3O08A 3FGUA 3CPWM 3KZBA 3M3ZA 4JKGA 3CJ7A 2FSKA 3O4WA 5AR0A 2FXUA 2VWBA 5BPLA 5AQVA 4IOAL 3BP8A 3VGKA 4L3QA 4BR9A 3CCEN 4MLHA 3QBXA 3G71N 3LDNA 3LDPA 4IJNA 3HTVA 3O1WA 4A2BA 4K42A 1VQ8N 4RCHA 4WQ4A 4BQLA 3LDQA 1VQ7N 5EVZA 3CXCM 3CERA 4JNEA 4KH4A 3WXMB 2VCPA 2Q2RA 3SMSA 1T6DA 3L4QA 2D0PA 1ATRA 3CJAA 2ITMA 5BRHA 3AGRA 2E1YA 3KWIA 3MN9A 2IIRA 2NRRA 4PKGA 4YOXA 4IZ9A 3VF2A 3WXLA 1KAXA 4AF1A 3KVGA 3OA9A 4GY2B 3FLCO 4A57A 4ILJA 5AQMA 2CH5A 2KKZA 2YJFA 1R59O 3ZX3A 3Q7CA 4CJ7A 3LM2A 5BPNA 1HKBA 3F2KA 4Z94A 3AARA 4CZIA 3GL1A 4FPAA 1HLUA 4JD2B 3UKRA 3CCQN 3GE1A 3O9TA 2F9WA 4BRDA 5HOOA 4EAHD 3A5OC 3VOVA 3N4PA 5AZJB 5F2RA 3MCAB 1JCGA 1YI2N 3QBWA 1KAYA 3OBWA 1BA1A 1GLCG 1HKCA 3H3NO 4JK9A 4JKGB 4WFNL 2ZJRL 1T44A 2QW9A 4FL9A 1NGHA 3CJ1A 3D2FA 3JXUA 2OTLN 3WEEB 2RHKA 1IJJA 3M6GA 3TTDA 1W97L 3WXKA 5E84A 1S22A 5AQJA 5GIPA 2P9IA 3QMLA 1V4TA 4YOTA 3MN6A 3MCPA 4I6MA 3ZX0A 3CCLN 4FWNA 1NGJA 4A5AA 2FSNA 3PIPL 1QVGM 3R3LA 3O9QA 2E1ZA 5C15A 3CETA 5AQIA 3CF5L 4PL8A 3MN7A 1GLFO 3HRGA 2CH6A 1LCUA 3GOIA 1X9JA 5LJVA 3F9MA 2NLXA 3P31A 4U7BA 3A8YA 3DJCA 1HUXA 3H3OB 3CMAN 1MWMA 1VQ6N 1GLDG 3TPQA 3ZETB 3I33A 1Q18A 3G25A 3HSCA 5CE3A 5FPDA 5FPNA 3UKRB 5F0XA 3CCMN 3MWTA 5FPMA 1VQNN 5AQWA 3MX2A 3B8AX 1JCEA 1E4FT 3WXIA 3HOTA 1WOQA 5KPTA 5GINA 1DKGD 4CZJA 1OKJA 3NMUA 3EL2A 4FOIA 4OPHA 5AQZA 2V51B 3VTIA 1VQKN 5EXWA 1ESVA 1BA0A 3GDQA 4RTFD 4BRCA 4WQ4C 1BOTO 4BR4A 1YXQA 1YUWA 4WQ5C 1K8AO 3GG4A 3A0IX 3D2FB 3EN9A 5M1PA 1G99A 1HKGA 2YHWA 3SAFA 2QM1A 1JJ2M 3CJCA 3DXMA 3I8BA 3VEZA 4KH5A 2QWMA 2P9IB 2VGMA 4EFHA 1NGFA 5BR9A 5ELZA 4I6MB 2A6AA 2YCHA 4LC9B 4G9ZA 3MK6A 3E1YA 1T6CA 4BVOA 3KWGA 4H0PA 4JHDA 2E8AA 3C65A 1NM1A 4YOUA 4RWTA 1MWKA 3ULEA 3VF6A 3WQTA 2A3ZA 5KQDA 1HX1A 2A40A 2HBKA 1EQYA 2J4RA 3CQXA 1P8ZA 4JKDA 4JK7A 5I9EB 3HOSA 3ID8A 1X3NA 5AZIA 4O8UA 3T69A 1P90A 1U2VA 2QWOA 2P9UA 4WCEL 1C0GA 2A5XA 2W40A 1QZ5A 4MO4A 2ZWHA 3P39A 3LM9A 4BC4A 2P9PB 2E2OA 3RVCA 4YDUC 4BRAA 4GNIA 1DGKN 2GTDA 3CJBA 4BC3A 3CMEN 4DCHA 2E20A 3O1BA 4BGBA 5EOYA 3SAGA 1XQSC 2NRXA 3U9DA 3WUHA 3IKMA 3NVMA 4O8KA 2P9KA 3IUCA 2RE2A 4EHUA 1NGGA 2V7ZA 3ENBA 1V4SA 1ZC6A 2WC9A 5C12A 4IEIA 5KPRA 1KD1O 1VAZA 1VQ4N 5AQOA 4QS8A 2I7PA 3P38A 5BRFA 1XUPO 3ENHA 2P9SA 3DXMB 4FSVA 1SS6A 4CZHA 4FWPA 3FZFA 2Q31A 4PHTX 2OTJN 3HI0A 2ASMA 2Q97A 2D4WA 4IJAA 2QWRA 2CGLA 4JAXA 2P9NA 3R6MA 4K43A 1LOTB 2BTFA 3SBGA 3VTHA 1ZXOA 2A41A 1YJ9N 1N8RO 4A2AA 2PAVA 4YOYA 1DEJA 3ENOA 4JK8A 4NB4A 1Q81O 4JHDB 4JKAA 4K25A 4IEEA 4FOEA 2QTDA 3SJHA 4AM6A 2GWJA 3ULEB 3QFUA 3O5BA 3C6AA 1VQLN 3SMPA 4IWVA 2QWQA 2W41A 3SBTA 2HBMA 4B1WB 4FVUA 1VQ9N 3I56N 3PLAA 1YVNA 5EY4A 5AZIB 5E26A 2VGNA 4BRMA 3W0LA 4B9QA 2HF4A 2YX6A 4BRHA 1U2VB 3PIOL 3LL3A 4DKWA 5AQFA 2P9UB 1Y64A 4H5RA 3D7EO 4M7YA 4IXCA 4BY9C 1GLLO 4BG9A 4WFBL 2UYTA 3VENA 3UB5A 3C6HA 4H03B 4HWIA 1NGDA 3R9PA 4BRFA 3SLCA 2ZJPL 2I7NA 3IMXA 4J8FA 2E88A 5KPZA 3WQUA 2HBLA 4CBUA 1Q86O 1QZ6A 4XH5A 5AQRA 4A62A 4YOWA 1Z6RA 3WT0A 2HOEA 1NBWA 2VYPA 4B1VA 4DHYA 1BG3A 4FPBA 5GADP 4IOXA 4ISFA 5AQTA 4C1NI 4FWOA 3FZKA 3ID6A 3UE5A 5LY3A 1NWKA 3CCUN 4ISGA 1K9MO 1NGEA 4JEPA 4H0XB 5CR4A 3QDKA 4H0YB 3J8AA 4BRQA 3T7ZA 2P9NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C15 A;  5M1F A;  4IEE A;  5M1P A;  5C2D A;  3C6H A;  5M1N A;  5M1K A;  5C2F A;  4IFE A;  5M1Q A;  3CPE A;  3C6A A;  5M1O A;  5C10 A;  5C12 A;  4IDH A;  4IEI A; 
#chains in the Genus database with same CATH topology
 4BVP A;  5HRN A;  2JWL A;  1S1U A;  3DLB A;  3O3F A;  4JI0 K;  4JKE A;  4CD3 A;  1FW6 A;  5BN9 A;  3DLE A;  3ZX2 A;  4B1X B;  4PUO A;  4A61 A;  4GV3 A;  3SPY A;  4BR5 A;  2CGK A;  3LZJ A;  2ITG A;  2IVO A;  3BGR A;  4OKE A;  3CFP A;  2XY7 A;  2KHO A;  3HST B;  4FJ8 A;  3C6T A;  1BIS A;  1RBS A;  1XC3 A;  1TYQ A;  4DF8 A;  1UA1 A;  2HW3 A;  4KHW A;  3EKU A;  3PX6 A;  2B5J A;  1KXP A;  2V7Y A;  4M45 A;  2G8W A;  5AQU A;  3ATU A;  1OVQ A;  4CEE A;  3BEX A;  5JIC A;  1IKW A;  1GLA G;  1N5Y A;  4DUZ K;  4HUF A;  4BWJ A;  2IVN A;  1XHZ A;  1NK4 A;  1WAF A;  1VQO N;  1RBV A;  4FLW A;  1UAX A;  3K9K A;  3U4L A;  1ILY A;  4DFJ A;  2FLO A;  3AO1 A;  1BGX T;  4KTW A;  5IT9 O;  1SL0 A;  3A2F A;  3ATV A;  4F9O A;  3JSM A;  3O6W A;  3GBT A;  1HNZ K;  1GLE G;  1NJW A;  2GUI A;  3QB0 A;  5HRP A;  4GKK K;  1QHA A;  3VET A;  5H1S Q;  4BRL A;  3J7Z O;  3NF8 A;  4AHC A;  3WEE A;  3VQ7 A;  4LFA K;  4CF8 A;  1NGI A;  1VQ5 N;  3QEP A;  5CZ1 A;  2YNG A;  3R1X A;  3KJV A;  1NG9 A;  4JKH A;  5JS2 A;  3VEW A;  4MQ3 A;  1RT5 A;  4WQ5 A;  3PO5 A;  1YF5 L;  5CYM A;  5LMU K;  4WF9 L;  3SJJ A;  3BUZ B;  4H5N A;  4O4G A;  1QSY A;  3VQA A;  1K6Y A;  2E2Q A;  4CF0 A;  3VN5 A;  4DV6 K;  3QIC A;  3H45 C;  4Y1C A;  4XEI A;  3OYN A;  1TKT A;  4KB1 A;  3TSU A;  2HNZ A;  3CM5 A;  5J2P A;  5B8H A;  1GOC A;  1WBD A;  4BRK A;  2HMP A;  1KAZ A;  1X3M A;  2P9K B;  1DTQ A;  4OPJ A;  5FRM A;  3MED A;  1SZ2 A;  4OGE A;  5AQY A;  4WFA L;  2P9S B;  2IVP A;  4CF9 A;  4FZX C;  1TL3 A;  2D0O A;  1Q82 O;  3AV9 A;  4NLC A;  1L3S A;  4H5T A;  4IOC L;  1IKX A;  3K5N A;  4E7K A;  3OBY A;  4B1U B;  3DRP A;  3AAQ A;  3HPG A;  1JLB A;  4HUE A;  4B3S K;  1YHQ N;  4CHQ A;  1YJW N;  2EWS A;  3CC7 N;  3V1O A;  2BE2 A;  3DWL A;  1NGA A;  1Y97 A;  3LP0 A;  5FPE A;  4EP4 A;  2VG6 A;  3FFK B;  5M1F A;  4Z4H A;  3OS0 A;  3CG7 A;  4DUY K;  2D0C A;  4CF2 A;  2O8C A;  3SUQ A;  1KTQ A;  1NMD A;  1LW0 A;  2IGI A;  4CW7 B;  2HHV A;  3OHR A;  4XH4 A;  2CGJ A;  5BN8 A;  4FJH A;  5HP1 A;  4YOV A;  1SUQ A;  4C8N A;  4CEF A;  2HF3 A;  2UUA K;  3OYE A;  2GEM A;  3CC2 N;  3ZYY X;  1O13 A;  1HYV A;  1XWL A;  3D2E B;  3EE9 A;  4F4K A;  3TSQ A;  4PQU A;  3VEV A;  2KQ2 A;  4O0J A;  1SL2 A;  3K9J A;  1BQN A;  3H1Q A;  5JS1 A;  2F9T A;  5GAE P;  3KLG A;  1W2B M;  2QWP A;  1S1T A;  3W3D A;  1QQO A;  1HPM A;  2NRZ A;  3VEX A;  4AHV A;  4E19 A;  3DXK B;  4GV6 A;  2ASP A;  1EWQ A;  3HVR A;  2HST A;  4CJF A;  4CZG A;  4CZL A;  4KV8 A;  3CFR A;  2PBD A;  2QXL A;  2YNF A;  3O08 A;  3FGU A;  3RRG A;  4CES A;  4FLZ A;  3DLK A;  4M3U A;  2VWB A;  1RCH A;  4KFB A;  3IAY A;  5BPL A;  4LD0 A;  2RPI A;  1WB9 A;  1MU2 A;  1E3M A;  3BP8 A;  1WBB A;  4MLH A;  4DF4 A;  1UA0 A;  4CFB A;  4FXD A;  3G71 N;  3HTV A;  4A2B A;  1JLE A;  5KRS A;  4DV7 K;  1JXB A;  3OYB A;  1T6D A;  3L4Q A;  5BRH A;  3QER A;  4Z4E A;  2KZZ A;  3AGR A;  3KWI A;  4BDY A;  2NRR A;  4JI3 K;  3NGI A;  3TAQ A;  4PY5 A;  4Q0B A;  1U4B A;  1S9E A;  1JLA A;  4ILJ A;  4Z0U A;  2PYL A;  1YTU A;  4B9V A;  4FPA A;  1A5X A;  4DQS A;  2Z1G A;  5HOO A;  3OYG A;  3ITH A;  3A5O C;  1QSS A;  1KAY A;  4JI5 K;  3K57 A;  4JK9 A;  1BCM A;  4WFN L;  2HVH A;  2QW9 A;  4J2D A;  1CXQ A;  2X6N A;  3V9W A;  2OTL N;  1J9A A;  3RR7 A;  4KO0 A;  4DU3 A;  2QXF A;  1N6Q A;  3QLH A;  3R3L A;  4JI4 K;  1XC9 A;  5AQI A;  3MN7 A;  1GLF O;  1CZB A;  4QAG A;  1OH7 A;  1L3T A;  2VQE K;  3F9M A;  1HJR A;  1HUX A;  1C0U A;  4B9S A;  4BE1 A;  1VQ6 N;  1LW2 A;  4DR1 K;  4DV0 K;  2O8D A;  4DU4 A;  1JKH A;  1Q18 A;  3HSC A;  5FPM A;  4FJL A;  3HOT A;  1U47 A;  2O8F A;  5KPT A;  5HBM A;  4YHH K;  5FLX O;  3KIO A;  3ISN C;  4BR4 A;  4KAZ A;  3P5J A;  1IH7 A;  2QM1 A;  3CJC A;  4CED A;  3S3O A;  3PX0 A;  1LWF A;  3VEZ A;  2VGM A;  4DTO A;  1D8Y A;  3PO4 A;  4LC9 B;  3ZCM A;  3E1Y A;  3IG1 A;  3KWG A;  4DQR A;  3NH0 A;  4JHD A;  4B9L A;  1NM1 A;  4G1Q A;  4RWT A;  1MWK A;  5AJ3 K;  3AO4 A;  5IWA K;  2A40 A;  4JKD A;  4JK7 A;  3JYT A;  3PUF A;  4X65 K;  1IO2 A;  1HNW K;  1P90 A;  5T7B A;  1HQE A;  3QET A;  4NCA A;  4CGF A;  3K58 A;  3IRX A;  5EU7 A;  3MXJ A;  4CJ4 A;  4MO4 A;  4CEB A;  2ZWH A;  2P9P B;  2E2O A;  3RVC A;  3CJB A;  1QHT A;  2KW4 A;  1LWE A;  3O1B A;  3VA3 A;  3SAG A;  1R0A A;  1TK8 A;  3NVM A;  1WLJ A;  5DK5 A;  3ENB A;  2WC9 A;  3PSF A;  1HRH A;  4C8M A;  2OTJ N;  3DXM B;  1NK6 A;  3HI0 A;  3OYH A;  4IJA A;  4CGI A;  2QWR A;  4JAX A;  3OVN A;  4K8Z A;  3SBG A;  1LOT B;  3DRR A;  4E3S A;  3TAP A;  3OYL A;  1DEJ A;  3ALY A;  3ZSW A;  4FOE A;  2QTD A;  4AM6 A;  3F73 A;  1WAJ A;  3QFU A;  3O5B A;  3C6A A;  2P5G A;  2W41 A;  3SBT A;  4CIF A;  3PLA A;  1JL1 A;  4W5Q A;  1NK8 A;  4BRH A;  1U2V B;  4DKW A;  4W5O A;  4K0K K;  3G10 A;  4BG9 A;  4F2S A;  3QIO A;  4H03 B;  3TAR A;  3R9P A;  2I7N A;  3IMX A;  1Q86 O;  1D9D A;  3WQU A;  2HBL A;  4JV5 K;  4XH5 A;  5AQR A;  4YOW A;  1Z6R A;  3WT0 A;  3K5O A;  1NBW A;  2Y1J A;  4DHY A;  1S6Q A;  4IOX A;  4M3W A;  2RKI A;  4FWO A;  3FZK A;  1U48 A;  2AJQ A;  1WSF A;  4HHT A;  5CR4 A;  3D45 A;  3MDQ A;  1ZBF A;  4LSN A;  4H5W A;  1VQM N;  3KHY A;  3K5M A;  4CBW A;  1GOA A;  1LWC A;  1M90 O;  3U3Y A;  5AQQ A;  3O3G A;  3BF3 A;  4H0O A;  4FWL A;  3RRH A;  3THX B;  4OPK A;  5C24 A;  4CBX A;  3ZEU A;  1CZ9 A;  1I39 A;  4FWQ A;  1JLG A;  4CEZ A;  3AVN A;  2O4G A;  3FZH A;  3VQ9 A;  4CE9 A;  4KRE A;  2G8F A;  1BUP A;  4W5R A;  4E1M A;  2O8B A;  5AQX A;  2H3G X;  1U49 A;  1NK5 A;  2XRI A;  4E7J A;  4JI1 K;  4KHY A;  2XY6 A;  3ZT3 A;  1RDC A;  1C0M A;  3AVK A;  2XY5 A;  3MMV A;  2Q36 A;  4YY3 K;  4FWK A;  2F7T A;  3HPO A;  2W42 A;  5BRE A;  5JVG L;  4HTL A;  4Y1D A;  4CZM A;  4U67 L;  3TTF A;  1U6Z A;  1T3V A;  1QQN A;  3EO3 A;  1XMQ K;  3VPZ A;  1HJO A;  4FJX A;  1FK9 A;  2AP1 A;  4CCH A;  1BHL A;  4B3T K;  1OH8 A;  1NU0 A;  4B9T A;  3PY8 A;  4IFE A;  4M63 C;  3NF7 A;  2NRV A;  3QEW A;  4KTZ A;  3DLR A;  2YV0 X;  1NKE A;  3HP6 A;  2DFE A;  4OKJ A;  4MDB A;  4BGA A;  5HL7 L;  3KLE A;  1TUU A;  2E2N A;  3L2V A;  5C2D A;  5LL6 Z;  4DSE A;  5C10 A;  1TYQ B;  3UKU A;  2FF6 A;  4JKB A;  1NMN A;  5AQL A;  2QWN A;  1H1V A;  3I0S A;  2DY4 A;  3M1F A;  1BWF O;  4Y0W A;  2JGU A;  3L4I A;  3NF9 A;  3U6F A;  4JI7 K;  4UQG A;  3Q7B A;  3KD5 E;  3DMJ A;  3QFP A;  3ZSQ A;  1Z26 A;  4R79 A;  3IDH A;  1JLF A;  2OZM A;  5HRS A;  3RSE A;  3TAB A;  1TKD A;  1WSE A;  1WUA A;  1HPZ A;  1T03 A;  4FWS A;  4DSL A;  4DTU A;  3WXJ A;  2Q0U A;  4A5B A;  2HVI A;  1QVF M;  4O5F A;  4F8R A;  1OH6 A;  4KI4 A;  1RT3 A;  3TTC A;  1N34 K;  3A5L C;  3AGK A;  4CEO A;  1YAG A;  5J2Q A;  4JS4 A;  4CI6 A;  1HQU A;  4DTP A;  5KI6 A;  3H46 O;  4BRO A;  2KFZ A;  4FWR A;  3L0Q A;  4FWM A;  4BRE A;  4DLE A;  3SK3 A;  2DPN A;  3C0B A;  1ZBS A;  2D1K A;  2HHQ A;  4C8O A;  4M3R A;  3VQP A;  2YHB A;  3QES A;  1ASW A;  1OH5 A;  2VG5 A;  3T3F A;  3OYI A;  3EY1 A;  1M1K O;  3BZK A;  3LDL A;  1IKY A;  1WSH A;  3JS6 A;  1RDW X;  1BO5 O;  1L5U A;  1BQM A;  3NH2 A;  3AVB A;  4CK1 A;  4DV4 K;  2KZM A;  5DM6 L;  5JMV A;  4KHU A;  3I55 N;  4FZZ A;  2D0B A;  3O8M A;  4I7F A;  4QS9 A;  1J5O A;  3VF4 A;  4NYF A;  2DFH A;  1VHX A;  1NK7 A;  1S1X A;  3LAK A;  3DI6 A;  3LZI A;  1BDG A;  1QQM A;  2BUP A;  4FJG A;  2YKM A;  3HBT A;  2Q1N A;  1TK0 A;  3CC4 N;  2G8V A;  2ZQB A;  4FLU A;  1S6P A;  3FE1 A;  4JD2 A;  2O8C B;  1T05 A;  5AZJ A;  4RW9 A;  3VEO A;  3O9R A;  3CJ9 A;  3M3Z A;  4JKG A;  3CJ7 A;  2FSK A;  3DLG A;  4CJK A;  5AR0 A;  1HNI A;  4IFV A;  1J53 A;  4DR5 K;  5AQV A;  4IOA L;  3SQ1 A;  4X64 K;  4I9L A;  3L3U A;  4FJN A;  3SQ4 A;  4OLB A;  3G0Z A;  3QBX A;  4N76 A;  3O1W A;  3AO3 A;  4K42 A;  2UUB K;  4WQ4 A;  3EYZ A;  1RNH A;  4O5B A;  5EVZ A;  3WXM B;  1C1A A;  2X74 A;  3CJA A;  2ITM A;  2E1Y A;  4IZ9 A;  4AF1 A;  1XHX A;  4ICL A;  5I42 A;  3FLC O;  3P1G A;  4A57 A;  5AQM A;  4LF8 K;  3DM2 A;  3VQB A;  3Q7C A;  4CF1 A;  3OYD A;  4Z94 A;  4B9N A;  3UKR A;  2F9W A;  3DOK A;  2HND A;  4ID1 A;  3N4P A;  4M3T A;  5F2R A;  3QBW A;  5CZ2 A;  3RTV A;  4RW6 A;  3OBW A;  3H3N O;  3SPZ A;  2ZJR L;  1T44 A;  4CIE A;  3CJ1 A;  1KSP A;  1FJG K;  1XNR K;  3D2F A;  3JXU A;  3LP1 A;  1L3U A;  5FRO A;  4BDZ A;  3M6G A;  3TTD A;  1W0H A;  3WXK A;  4DFK A;  1S22 A;  4NCB A;  4IG0 A;  4C8K A;  3NHG A;  3M8S A;  3BZC A;  3MCP A;  4I6M A;  5J1E A;  1SL1 A;  3PIP L;  1QVG M;  2F4V K;  2XY8 A;  1X1P A;  2E1Z A;  5I3U A;  3CFO A;  3ZSZ A;  4PL8 A;  2YKN A;  4CJV A;  1WSG A;  4DSJ A;  2CH6 A;  3GOI A;  2FBX A;  2XHB A;  1X9J A;  4FVM A;  5LJV A;  2NLX A;  3HJF A;  3H3O B;  3CMA N;  3ZSV A;  4CEQ A;  2D0A A;  3TPQ A;  3ZET B;  4CJW A;  3HM9 A;  3DRS A;  3G25 A;  3EEQ A;  5FPN A;  5F0X A;  3KK3 A;  1WSJ A;  5AQW A;  1WOQ A;  3KLI A;  4DLG A;  3LPU A;  4CZJ A;  1OKJ A;  3NMU A;  1VQK N;  3VTI A;  1ESV A;  3GDQ A;  2ATQ A;  1RBU A;  1J5E K;  1KRP A;  3GG4 A;  1G99 A;  1HKG A;  2YHW A;  5HLF A;  1JJ2 M;  4NYN A;  3I8B A;  1RT1 A;  4EFH A;  3IS9 A;  1NGF A;  1NKC A;  5ELZ A;  3TAG A;  2YCH A;  3MK6 A;  3PV8 A;  3B6O A;  1T6C A;  4BVO A;  4H0P A;  3CM6 A;  3C6U A;  3ULE A;  5J2N A;  4CER A;  3PX4 A;  2HBK A;  2OCE A;  3T1H K;  3NFA A;  2J4R A;  3OY9 A;  4BDP A;  3HOS A;  3ID8 A;  2P5O A;  3T69 A;  4OX9 K;  3NF6 A;  1ZYQ A;  2P9U A;  4IFY A;  1JL2 A;  2A5X A;  4FM2 A;  1QTM A;  1QZ5 A;  1BI4 A;  3FFI A;  3P39 A;  1B9D A;  4YDU C;  3LP2 A;  4BRA A;  2O8F B;  2GTD A;  4BC3 A;  2HHT A;  4IG3 A;  4DCH A;  2E20 A;  3V4I A;  5EOY A;  5FDL A;  5KGX A;  1XQS C;  3TAF A;  3WUH A;  2P9K A;  3HL8 A;  3VQ5 A;  2V7Z A;  1V4S A;  5KPR A;  5C12 A;  1KD1 O;  4FLV A;  4JLH A;  5BRF A;  4FSV A;  2P9S A;  1G15 A;  2Q31 A;  2Q97 A;  2D4W A;  2OPQ A;  2NUB A;  2OPP A;  2P9N A;  5SZT A;  3LWM A;  2PAV A;  4E1N A;  4JK8 A;  1Q81 O;  4JHD B;  4I9Q A;  4KTQ A;  1VQL N;  4K8X A;  2OPR A;  2HBM A;  3I56 N;  3RMB A;  3V9S A;  3RMC A;  5E26 A;  3J7Y P;  3W0L A;  4B9Q A;  2HF4 A;  1I3A A;  3D7E O;  4DTX A;  4CJU A;  3SUP A;  1GLL O;  4IKF A;  3SZ2 A;  2UYT A;  3C6H A;  1NGD A;  2OZS A;  3SLC A;  3VQ6 A;  4J8F A;  1TKX A;  2E88 A;  5C42 A;  4A62 A;  2HOE A;  4C8L A;  3L2R A;  4DQP A;  4LH4 A;  1BG3 A;  4FPB A;  5GAD P;  4ELU A;  4C1N I;  3V1Q A;  1C1C A;  3ID6 A;  3UE5 A;  4FLT A;  3LDS A;  4DG1 A;  3CCU N;  1NKB A;  2EX3 A;  1NGE A;  4WE1 A;  4JEP A;  3QDK A;  1CXU A;  1C0T A;  3T7Z A;  1VRT A;  1NLV A;  4KHQ A;  4LF9 K;  2BH1 A;  4V19 S;  4DV1 K;  5C2F A;  3IFR A;  1VSF A;  1VSK A;  4CZK A;  4H8K A;  4DSF A;  2IAJ A;  1EO1 A;  2BGG A;  2HMI A;  5HRR A;  3AO5 A;  5GAH P;  1RDA A;  3ASM A;  4FO0 A;  1VRU A;  1XMO K;  4B3O A;  3H6E A;  3OW2 M;  1X9S A;  3QO9 A;  1RT7 A;  2OPS A;  1HNX K;  3S41 A;  2UXD K;  4B9M A;  4BAC A;  1VSI A;  4FJJ A;  1K8K A;  3AVA A;  4GMJ B;  1NGC A;  2PYJ A;  4BRN A;  1YJN N;  4UY8 O;  1XNQ K;  1KVB A;  2O8E A;  1F21 A;  3J80 O;  5TKW A;  4RW4 A;  3MXI A;  5DMR A;  3KD1 E;  2NRH A;  2NRT A;  2WFB A;  4CGD A;  4FJ7 A;  4JRQ A;  3L2W A;  4ISE A;  4HTU A;  3SUO A;  4NLB A;  1IG8 A;  3C7N A;  2GX9 A;  1HR0 K;  2ZF5 O;  2YHY A;  3E9O A;  4W5T A;  4C1N K;  3AA3 A;  3KK2 A;  1JCF A;  1MA9 B;  2JLE A;  4JRP A;  4CGG A;  2NZT A;  2HHU A;  3QEV A;  1SV5 A;  4E7I A;  4BWM A;  4QS7 A;  3TSP A;  3ZEU B;  4BR7 A;  5M1K A;  1S72 N;  1SAZ A;  3VER A;  3O4N A;  4CJL A;  4CHO A;  3RR8 A;  3AVG A;  3CQY A;  1WSI A;  4DV2 K;  4QCL A;  2FF3 B;  3H1V X;  1ASV A;  3A5N C;  3CI5 A;  1KFS A;  5C0Y A;  2P9L A;  3AAP A;  4CZE A;  3S3N A;  2O8B B;  4BRI A;  1D4X A;  4AHT A;  4MDA A;  4Q5V A;  4FW1 A;  1MDU B;  5AQG A;  4M7X A;  4PKI A;  1IKV A;  2VQF K;  4CJS A;  3KK7 A;  3DAW A;  3SAH A;  3OYK A;  5D3G A;  2G8K A;  3HYF A;  1VSD A;  4BQZ A;  4FJ5 A;  4KRF A;  3P83 D;  2IS3 A;  3ZT4 A;  2JWK A;  1WNS A;  2KTQ A;  3E01 A;  1RGI A;  4JYA K;  2GUP A;  2VWJ A;  3L2Q A;  4FYD A;  1EET A;  4PKH A;  3RMD A;  5KRT A;  1FKP A;  2FBV A;  3TU5 A;  4H5V A;  2DTU A;  2HHH K;  1T7P A;  5JVH L;  4JKF A;  3VGM A;  1QQC A;  4Z4C A;  1VSL A;  2RF2 A;  5BPM A;  4DFM A;  1CZA N;  3SV4 A;  1NNE A;  5AQP A;  3MEC A;  2XO7 A;  2QWL A;  1Z05 A;  4FM0 A;  3BF1 A;  1KVA A;  1REV A;  3UKU B;  2KLA A;  4ZHR A;  2GWK A;  1ATS A;  4KPY A;  3TAE A;  5F1X A;  3ZSY A;  2IDO A;  4WYB A;  5GAG P;  4ILG B;  4KHP K;  4PL7 A;  4BG8 A;  5LJW A;  3TWH A;  3QNN A;  2ZJQ L;  1RDU A;  3HM8 A;  3RSE B;  4DR6 K;  4KH6 A;  4ID5 A;  1DT9 A;  1GLJ O;  4H0V B;  4HCB A;  3K2P A;  2YJE A;  4CFA A;  3DOL A;  3WNF A;  2BDP A;  3O9S A;  3VEY A;  5KQ8 A;  4ZTJ A;  1YIT N;  2NNW A;  4CK3 A;  3M5R A;  2P9P A;  5AQK A;  3SNN A;  4CEA A;  5JLF A;  4CHN A;  4LFC K;  5A2Q O;  5JLH A;  1FKO A;  1A5W A;  2YHX A;  2UUC K;  3K0S A;  4J2E A;  3AVJ A;  2NRW A;  2UXB K;  4F3O A;  3CHW A;  3BDP A;  2ZGY A;  4H0T B;  1J6Z A;  5EX5 A;  1QSL A;  1ZBU A;  1VQP N;  2AA4 A;  4BE0 A;  4BR0 A;  4B1Z A;  4M3Z A;  2F96 A;  3NH1 A;  4O0I A;  4DV3 K;  4E1J A;  1GOB A;  4JKC A;  3NCI A;  3C94 A;  2FSJ A;  4I2P A;  4DS4 A;  5LMN K;  1N32 K;  3ZSR A;  1A5V A;  3CPW M;  3SCX A;  4B9U A;  3LAN A;  3OJS A;  2FXU A;  3AVM A;  3VGK A;  4L3Q A;  4B3R K;  1TVR A;  3ZLJ A;  1BIU A;  3M8Q A;  3DLH A;  3LDN A;  3LDP A;  3V9Z A;  4IJN A;  4RCH A;  4BQL A;  3THW A;  3LDQ A;  1VQ7 N;  3CXC M;  4J2A A;  4FJK A;  3CER A;  4JNE A;  4KH4 A;  2VCP A;  3SMS A;  1NOY A;  2D0P A;  3VF2 A;  1KAX A;  3OA9 A;  4LH5 A;  4AQY K;  4FK4 A;  3F9K A;  2CH5 A;  2YJF A;  3U3G A;  4JI6 K;  4CVN E;  3ZX3 A;  2HHW A;  5K14 A;  4CJ7 A;  5BPN A;  4PA1 A;  3AAR A;  4CZI A;  3GL1 A;  3NAE A;  2QKK A;  4PWD A;  4JD2 B;  3O9T A;  4M41 A;  4BRD A;  3WNG A;  3LWL A;  4EAH D;  5AZJ B;  3MCA B;  2ZE2 A;  1BA1 A;  3MXM A;  1GLC G;  4JKG B;  4EP5 A;  3SUN A;  3WEE B;  2VWK A;  1IJJ A;  4LF6 K;  3THY A;  4AHS A;  5E84 A;  1ASU A;  5AQJ A;  2P9I A;  3EZ5 A;  1BL3 A;  1N33 K;  3CCL N;  4FWN A;  4A5A A;  1SKR A;  4EZ6 A;  2FC0 A;  3OYF A;  5C15 A;  3CET A;  3HRG A;  1RTH A;  1LCU A;  4U7B A;  3A8Y A;  3DJC A;  1EKE A;  2BAN A;  4GKJ K;  1JXE A;  4LF5 K;  5FPD A;  3UKR B;  4FJ9 A;  3CCM N;  3MWT A;  3MX2 A;  3B8A X;  1JCE A;  3WXI A;  3L3V A;  1DTT A;  4MFB A;  1DKG D;  4LY7 A;  3EL2 A;  4FOI A;  3HP9 A;  1BA0 A;  4RTF D;  4WQ4 C;  1BOT O;  4DQQ A;  1YXQ A;  1YUW A;  3O4Q A;  4WQ5 C;  1K8A O;  4FLY A;  3D2F B;  3EN9 A;  1RTI A;  5M1P A;  4XIU A;  3SAF A;  3VQC A;  1Q9Y A;  1TK5 A;  3S3M A;  3HO1 A;  4NXM K;  5BR9 A;  3ZSO A;  4I6M B;  2KFN A;  1VSH A;  4G9Z A;  3KKS A;  1ZBH A;  4FK2 A;  1YVU A;  4YOU A;  3V1R A;  4Z4F A;  4RW8 A;  4N41 A;  5KQD A;  1HX1 A;  1RBT A;  3OJU A;  4HCC A;  1EQY A;  3ZT1 A;  3CQX A;  4Z4I A;  4HUG A;  5AZI A;  1X3N A;  4DTS A;  4CJT A;  4DTM A;  1RDB A;  4WCE L;  4CFC A;  1B9F A;  4CJE A;  4BC4 A;  4GNI A;  4FLX A;  1DGK N;  3OYJ A;  4BGB A;  4M3Y A;  1KLM A;  3V9U A;  4O8K A;  2RE2 A;  1NGG A;  4E89 A;  1VQ4 N;  4IEI A;  1VAZ A;  4QS8 A;  4DMN A;  2I7P A;  3P38 A;  1RT2 A;  2B4J A;  4CZH A;  1B92 A;  3FZF A;  2O4I A;  1S1V A;  1RIL A;  3KKR A;  4K43 A;  1IBK K;  3VQ8 A;  2BTF A;  1ZXO A;  1YJ9 N;  3AA5 X;  4YOY A;  3LAM A;  4JKA A;  3ULE B;  2W6K A;  3M8P A;  1WN7 A;  4CGH A;  4OKK A;  4CJ3 A;  1VQ9 N;  2F8S A;  1YVN A;  1BCO A;  3AA2 A;  1JLQ A;  2VGN A;  2Z1H A;  2YX6 A;  4LF7 K;  4RG8 A;  1DLO A;  3PIO L;  5AQF A;  2P9U B;  1Y64 A;  4H5R A;  3WNE A;  4M7Y A;  4BY9 C;  2PZS A;  1VSM A;  3L2U A;  4WFB L;  3VEN A;  3UB5 A;  1BI4 B;  4HWI A;  4BRF A;  3KLF A;  3LPT A;  4FJI A;  3ULD A;  1EWR A;  1O1W A;  1IBM K;  4OVL A;  4B1V A;  2HB5 A;  1UWB A;  3AA4 A;  4DR3 K;  4DFP A;  5LY3 A;  1NWK A;  4ISG A;  1K9M O;  4H0X B;  4M42 A;  4XH1 A;  3J8A A;  4BRQ A;  4AIL C;  3SI6 A;  2P9N B;  3I0R A;  3E9P A;  3FZL A;  3O80 A;  5AQH A;  2B6A A;  4GV9 A;  4F2R A;  3HT3 A;  1RBR A;  1KQS M;  4BR2 A;  2E6M A;  4IO8 A;  3MN5 A;  1LV5 A;  3EKS A;  1ZBL A;  4OGC A;  3CIP A;  4A59 A;  4H4M A;  3FR0 A;  4GVE A;  4ELT A;  3C95 A;  4DB3 A;  4NO7 A;  4DSK A;  4CHY A;  2E5L K;  4N47 A;  2G8U A;  1BU6 O;  3AVL A;  1I94 K;  3AVH A;  1XI1 A;  1ITG A;  3MX5 A;  4CGJ A;  2A1S A;  3G4S N;  4OLA A;  4BC5 A;  1C6V A;  1EX4 A;  1VSE A;  3U8X A;  1Q7Y O;  2Y1I A;  2ZD1 A;  5AQS A;  3TR8 A;  2OAN A;  1SKS A;  5KTQ A;  3HZ6 A;  2YI1 A;  4LSL A;  4DR2 K;  3V6D A;  4CJ5 A;  3SQ2 A;  3S9H A;  3NVK A;  4BC2 A;  2GEL A;  4ILH A;  4E7L A;  5M1N A;  2IOC A;  2Z1J A;  3VQQ A;  1K73 O;  4OJR A;  4ELV A;  4B08 A;  3MEG A;  1E4G T;  3G6E N;  3OS2 A;  1EXQ A;  2O8D B;  4BRP A;  3J7A P;  4DU1 A;  2P51 A;  5AFU A;  3AY9 A;  2ASO A;  4LF4 K;  2ZGZ A;  4H4O A;  4EIA A;  1VQ8 N;  3QIP A;  1J54 A;  3CYM A;  3O3H A;  1C0F A;  3EE8 A;  4C23 A;  1K8K B;  3VES A;  5TKY A;  1IV0 A;  4FZY A;  3F5T A;  3A5M C;  3DLL L;  1TKZ A;  2O8E B;  5BRD A;  4N56 A;  5M1Q A;  1Z25 A;  4YNQ A;  4IO9 L;  4E0D A;  5CY4 A;  5AQN A;  5AFU H;  4AH9 A;  4BRG A;  4X66 K;  4BE2 A;  3PSI A;  5DM7 L;  3D6R A;  4KKO A;  3C7N B;  3VMF B;  2WTU A;  3WNH A;  3RWU A;  4FM1 A;  2YNI A;  2A42 A;  2E4L A;  2WBN A;  3LAL A;  3VGL A;  4NCG A;  5ADX A;  3MWP A;  3N4Q A;  5HRO A;  3ZET A;  4E7H A;  1S5J A;  4LFB K;  3B6P A;  1X9W A;  3BY5 A;  2QK9 A;  1RDD A;  3VQD A;  4EHT A;  1ZBI A;  5CHI A;  4KBO A;  1C1B A;  1NJI O;  4JN4 A;  3D2E A;  4I2Q A;  3ZT2 A;  1D9F A;  1SQK A;  1KFD A;  2P9L B;  1S3X A;  1RTJ A;  2QA4 N;  2RN2 A;  5C25 A;  3EZW A;  3L6Q A;  5GIO A;  5MLC Q;  4KHS A;  1NGB A;  5M1O A;  4MLE A;  4YDU A;  5ADX H;  2Q0R A;  3CCS N;  2E2P A;  1TUY A;  1RT6 A;  2G8I A;  3D0P A;  3U9Z A;  3TI0 A;  2GBZ A;  3DXK A;  4FK0 A;  1ATN A;  3E9L A;  3AVC A;  3TAN A;  4QOZ B;  3FZM A;  2QI2 A;  4DTN A;  5J2M A;  1RFQ A;  4CK2 A;  4CJR A;  1U45 A;  2FBT A;  1GLB G;  2X6S A;  3RMA A;  4EZ9 A;  4AM7 A;  3R8E A;  3NGZ A;  3CCV N;  4MO5 A;  2PFU A;  4OO1 J;  3CCR N;  2HHS A;  3CCJ N;  2HBJ A;  4YOR A;  3AVF A;  4N5S A;  3AO2 A;  3UIQ A;  4CZF A;  3LDO A;  2QEX N;  1HYS A;  4CD1 A;  4B1Y B;  3SQ0 A;  4DQ8 A;  2V52 B;  1YIJ N;  4DTR A;  3QEI A;  2Z1I A;  2W6L A;  4IBN A;  3P4I A;  4CJQ A;  3M8R A;  3CD6 N;  2D5R A;  2WON A;  4K41 A;  3SV3 A;  2F8T A;  3O9U A;  4B8C A;  1OVY A;  5CYQ A;  3HK2 A;  3OYM A;  2WUS A;  3K59 A;  2A1R A;  1IG9 A;  3NGY A;  3KTQ A;  4TSX A;  3E66 A;  1KC8 O;  1T8E A;  3CPE A;  2YNH A;  4IDH A;  4OPA A;  4DQI A;  3KK1 A;  3KZB A;  1VK0 A;  3O4W A;  4DR4 K;  2ETJ A;  3H08 A;  3ZSX A;  3HPH A;  2OA8 A;  4DWI A;  2YHA A;  4BR9 A;  3CCE N;  1EP4 A;  1TL1 A;  4CIG A;  4CFD A;  1N36 K;  3NE6 A;  4J2B A;  3DYA A;  4GVM A;  3T1Y K;  2Q2R A;  3KLH A;  1ATR A;  3ZT0 A;  3MN9 A;  2IIR A;  4PKG A;  4YOX A;  3WXL A;  3J81 O;  3KVG A;  3JAM O;  3CQ8 A;  4GY2 B;  2KKZ A;  1R59 O;  3VQE A;  4B8A B;  3LM2 A;  1HKB A;  2UXC K;  3F2K A;  4JI2 K;  2WOM A;  3THV A;  2R7Y A;  2FBY A;  1HLU A;  1CLQ A;  1KCF A;  3CCQ N;  3GE1 A;  3OYC A;  3VOV A;  1JCG A;  1YI2 N;  1HKC A;  3VA0 A;  4FL9 A;  1NGH A;  3K5L A;  2UU9 K;  1NJX A;  1D5A A;  4NXN K;  1YT3 A;  2RHK A;  4FJM A;  2G8H A;  1NOZ A;  1W97 L;  1QE1 A;  1NK9 A;  1BIZ A;  4CEC A;  5GIP A;  3QML A;  1V4T A;  4YOT A;  1KLN A;  3MN6 A;  4HVJ A;  3ZX0 A;  1NGJ A;  2FSN A;  3THW B;  3MAQ A;  3O9Q A;  3CF5 L;  1QS4 A;  5E41 A;  5KGW A;  3OYA A;  2Q3S A;  4KI6 A;  3P31 A;  5SWM A;  2X78 A;  1MWM A;  1GLD G;  1KVC A;  3QIN A;  3T1A A;  4KB0 A;  3I33 A;  5CE3 A;  4L8R B;  1TAQ A;  1IBL K;  1VQN N;  1E4F T;  2VG7 A;  3NDK A;  1YTA A;  5GIN A;  1HMV A;  3T19 A;  1VSJ A;  2LSN A;  4YFU A;  4OPH A;  1TV6 A;  5AQZ A;  2V51 B;  5EXW A;  4BRC A;  4Z4G A;  1NJY A;  3A0I X;  4RW7 A;  1HYZ A;  4FCY A;  2E6L A;  3VQ4 A;  3THY B;  1UOC A;  1HNV A;  2P1J A;  3DXM A;  4DR7 K;  4KH5 A;  2QWM A;  2P9I B;  3LP3 A;  4X62 K;  2A6A A;  4B3M K;  4JS5 A;  4DSI A;  1Q8I A;  2E8A A;  2OYQ A;  3C65 A;  3OTO K;  1FXX A;  3VF6 A;  3WQT A;  2A3Z A;  1LAV A;  4GW6 A;  4CJP A;  1W7A A;  3SYZ A;  1P8Z A;  5I9E B;  2IC3 A;  4O8U A;  1S1W A;  1JLC A;  2HNY A;  2HHX A;  1U2V A;  2QWO A;  4KHN A;  1C0G A;  4JI8 K;  2W40 A;  3AVI A;  4DTJ A;  3LM9 A;  4DV5 K;  4O55 A;  3QEX A;  4O44 A;  3CME N;  4DS5 A;  1SKW A;  3TAM A;  2NRX A;  3HVT A;  3U9D A;  3IKM A;  3QNO A;  2PY5 A;  4CHP A;  3IUC A;  1L3V A;  4EHU A;  1ZC6 A;  1Q9X A;  3L8B A;  5AQO A;  2ZM6 K;  3V9X A;  1XUP O;  2DFF A;  3ENH A;  1SS6 A;  4FWP A;  4PHT X;  1NK0 A;  2ASM A;  1TAU A;  3VTH A;  2CGL A;  3R6M A;  4F3T A;  2A41 A;  3NBP A;  1N8R O;  1S9G A;  4A2A A;  4NB4 A;  3ENO A;  4K25 A;  4IEE A;  1LAW A;  2I5J A;  3SJH A;  1RT4 A;  2GWJ A;  1NJZ A;  3OS1 A;  3I8D A;  4CHZ A;  3SMP A;  4IWV A;  2QWQ A;  3MEE A;  4B1W B;  3THX A;  4FVU A;  1W9H A;  4IDK A;  4M3X A;  5EY4 A;  5AZI B;  4FW2 A;  4BRM A;  3LL3 A;  4IXC A;  2GV9 A;  5BR8 K;  5FRN A;  2QKB A;  2ZJP L;  5KPZ A;  4R5P A;  4CBU A;  1TGO A;  1QZ6 A;  4AHU A;  1U04 A;  2VYP A;  3HXM A;  2EHG A;  1RTD A;  4ISF A;  3V81 A;  5AQT A;  4AHR A;  4ZTF A;  1X9M A;  4W5N A;  4H0Y B; 
#chains in the Genus database with same CATH homology
 3E9P A;  3FZL A;  3MDQ A;  3O80 A;  5AQH A;  2BH1 A;  4BVP A;  4GV9 A;  2JWL A;  4H5W A;  1VQM N;  3KHY A;  3IFR A;  4CZK A;  4JKE A;  4CBW A;  5C2F A;  4CD3 A;  1M90 O;  1KQS M;  1EO1 A;  5AQQ A;  4BR2 A;  4IO8 A;  3MN5 A;  5BN9 A;  3BF3 A;  3EKS A;  3ZX2 A;  4B1X B;  5GAH P;  4H0O A;  4A61 A;  3CIP A;  4FO0 A;  4GV3 A;  4FWL A;  4A59 A;  4BR5 A;  2CGK A;  3FR0 A;  4GVE A;  3H6E A;  3OW2 M;  4DB3 A;  4NO7 A;  4CBX A;  3ZEU A;  4FWQ A;  2IVO A;  1VQP N;  3S41 A;  1BU6 O;  3FZH A;  1BUP A;  1K8K A;  3MX5 A;  1NGC A;  2KHO A;  4BRN A;  5AQX A;  2H3G X;  1YJN N;  4UY8 O;  3G4S N;  4BC5 A;  3U8X A;  1Q7Y O;  1TYQ A;  1XC3 A;  5AQS A;  5TKW A;  2OAN A;  2NRH A;  3HZ6 A;  2YI1 A;  2NRT A;  2WFB A;  3EKU A;  3MMV A;  2Q36 A;  4FWK A;  4ISE A;  3NVK A;  2F7T A;  4BC2 A;  2GEL A;  1KXP A;  4ILH A;  1IG8 A;  3C7N A;  4NLB A;  2V7Y A;  2GX9 A;  5AQU A;  5M1N A;  3ATU A;  5BRE A;  3BEX A;  2ZF5 O;  2YHY A;  3E9O A;  5JIC A;  5JVG L;  4HTL A;  1K73 O;  1GLA G;  4CZM A;  4C1N K;  4U67 L;  3TTF A;  1U6Z A;  1T3V A;  2IVN A;  1QQN A;  3EO3 A;  1E4G T;  3G6E N;  1JCF A;  3VPZ A;  1VQO N;  1HJO A;  1MA9 B;  3K9K A;  4BRP A;  3U4L A;  1ILY A;  5AFU A;  3AY9 A;  2ASO A;  2NZT A;  2FLO A;  2AP1 A;  2ZGZ A;  4IFE A;  4M63 C;  2NRV A;  4EIA A;  3ATV A;  4F9O A;  4QS7 A;  3TSP A;  3ZEU B;  4BR7 A;  3O6W A;  4MDB A;  1SAZ A;  3GBT A;  1GLE G;  3VER A;  4BGA A;  3QB0 A;  5M1K A;  5HL7 L;  3CQY A;  1QHA A;  1C0F A;  1TUU A;  2FF3 B;  3EE8 A;  3VET A;  1K8K B;  4C23 A;  5H1S Q;  2E2N A;  3CI5 A;  3A5N C;  3H1V X;  4BRL A;  5C2D A;  3VES A;  5TKY A;  3J7Z O;  2P9L A;  3AAP A;  4CZE A;  5C0Y A;  3F5T A;  4BRI A;  1D4X A;  3A5M C;  3WEE A;  5C10 A;  4MDA A;  3DLL L;  1NGI A;  1MDU B;  1TYQ B;  1VQ5 N;  5AQG A;  5BRD A;  4M7X A;  3UKU A;  4PKI A;  2FF6 A;  5M1Q A;  3R1X A;  4IO9 L;  4JKB A;  5AQL A;  5AQN A;  3KK7 A;  2QWN A;  3DAW A;  5AFU H;  3SAH A;  1H1V A;  3M1F A;  4BRG A;  1BWF O;  4JKH A;  3VEW A;  4Y0W A;  3D6R A;  5DM7 L;  3C7N B;  3VMF B;  3L4I A;  4WQ5 A;  1YF5 L;  4BQZ A;  3Q7B A;  4WF9 L;  3QFP A;  3BUZ B;  4H5N A;  2JWK A;  3IDH A;  4R79 A;  3RSE A;  1RGI A;  2A42 A;  2GUP A;  2E2Q A;  2WBN A;  4PKH A;  3VGL A;  5ADX A;  1WUA A;  3QIC A;  3H45 C;  3MWP A;  3N4Q A;  3ZET A;  4XEI A;  4FWS A;  3TU5 A;  3WXJ A;  2Q0U A;  4H5V A;  4A5B A;  3TSU A;  5JVH L;  1QVF M;  4JKF A;  3VGM A;  4EHT A;  4O5F A;  5CHI A;  5B8H A;  4KBO A;  5BPM A;  4JN4 A;  4BRK A;  1NJI O;  3D2E A;  3TTC A;  2HMP A;  1KAZ A;  3A5L C;  1X3M A;  3AGK A;  2P9K B;  1CZA N;  1YAG A;  5AQP A;  1SZ2 A;  1SQK A;  4CI6 A;  2QWL A;  1Z05 A;  2P9L B;  1S3X A;  2QA4 N;  3H46 O;  5AQY A;  4BRO A;  4WFA L;  2P9S B;  3BF1 A;  3EZW A;  3L6Q A;  2IVP A;  4FWR A;  5GIO A;  5MLC Q;  3L0Q A;  1NGB A;  4FWM A;  5M1O A;  4BRE A;  4MLE A;  2D0O A;  1Q82 O;  4YDU A;  4NLC A;  5ADX H;  2Q0R A;  4H5T A;  3UKU B;  2KLA A;  3CCS N;  4IOC L;  2E2P A;  3SK3 A;  2DPN A;  2GWK A;  1ATS A;  1ZBS A;  1TUY A;  2D1K A;  3C0B A;  3OBY A;  4B1U B;  3AAQ A;  1YHQ N;  3U9Z A;  5F1X A;  1YJW N;  3DXK A;  2EWS A;  4WYB A;  3CC7 N;  5GAG P;  4ILG B;  1ATN A;  3E9L A;  4PL7 A;  3DWL A;  1NGA A;  4BG8 A;  5FPE A;  5LJW A;  5M1F A;  3FFK B;  3FZM A;  2ZJQ L;  2QI2 A;  1RFQ A;  1RDU A;  3HM8 A;  3RSE B;  1GLB G;  4KH6 A;  1M1K O;  1NMD A;  1DT9 A;  1GLJ O;  1S72 N;  4H0V B;  3LDL A;  3OHR A;  2YJE A;  4AM7 A;  4XH4 A;  2CGJ A;  5BN8 A;  3R8E A;  4YOV A;  3O9S A;  3VEY A;  2HF3 A;  3JS6 A;  3CCV N;  1RDW X;  5KQ8 A;  4MO5 A;  1BO5 O;  2PFU A;  1YIT N;  4OO1 J;  2NNW A;  2GEM A;  3CC2 N;  3CCR N;  3CCJ N;  2HBJ A;  3M5R A;  2P9P A;  4YOR A;  3ZYY X;  1O13 A;  5DM6 L;  3D2E B;  3EE9 A;  3TSQ A;  4CZF A;  3LDO A;  2QEX N;  3VEV A;  4B1Y B;  4CD1 A;  5JMV A;  3I55 N;  5AQK A;  3O8M A;  4DQ8 A;  2V52 B;  5JLF A;  1YIJ N;  3K9J A;  4QS9 A;  3H1Q A;  3VF4 A;  2F9T A;  5GAE P;  5JLH A;  1W2B M;  2YHX A;  3P4I A;  2NRW A;  3CD6 N;  2QWP A;  1NLV A;  1BDG A;  3CHW A;  4K41 A;  1QQM A;  2BUP A;  2ZGY A;  4H0T B;  1J6Z A;  3W3D A;  3O9U A;  5EX5 A;  3HBT A;  1OVY A;  1QQO A;  1HPM A;  2AA4 A;  2NRZ A;  2Q1N A;  4XH1 A;  3VEX A;  3CC4 N;  4BR0 A;  4B1Z A;  3DXK B;  4GV6 A;  2WUS A;  2ASP A;  2HST A;  4E1J A;  4JKC A;  3FE1 A;  4CZG A;  4JD2 A;  4CZL A;  2FSJ A;  3E66 A;  1KC8 O;  2PBD A;  5AZJ A;  3CPE A;  3VEO A;  3O9R A;  2QXL A;  3CJ9 A;  4IDH A;  4OPA A;  3O08 A;  3FGU A;  3CPW M;  3KZB A;  3M3Z A;  4JKG A;  3CJ7 A;  2FSK A;  3O4W A;  5AR0 A;  2FXU A;  2VWB A;  5BPL A;  5AQV A;  4IOA L;  3BP8 A;  3VGK A;  4L3Q A;  4BR9 A;  3CCE N;  4MLH A;  3QBX A;  3G71 N;  3LDN A;  3LDP A;  4IJN A;  3HTV A;  3O1W A;  4A2B A;  4K42 A;  1VQ8 N;  4RCH A;  4WQ4 A;  4BQL A;  3LDQ A;  1VQ7 N;  5EVZ A;  3CXC M;  3CER A;  4JNE A;  4KH4 A;  3WXM B;  2VCP A;  2Q2R A;  3SMS A;  1T6D A;  3L4Q A;  2D0P A;  1ATR A;  3CJA A;  2ITM A;  5BRH A;  3AGR A;  2E1Y A;  3KWI A;  3MN9 A;  2IIR A;  2NRR A;  4PKG A;  4YOX A;  4IZ9 A;  3VF2 A;  3WXL A;  1KAX A;  4AF1 A;  3KVG A;  3OA9 A;  4GY2 B;  3FLC O;  4A57 A;  4ILJ A;  5AQM A;  2CH5 A;  2KKZ A;  2YJF A;  1R59 O;  3ZX3 A;  3Q7C A;  4CJ7 A;  3LM2 A;  5BPN A;  1HKB A;  3F2K A;  4Z94 A;  3AAR A;  4CZI A;  3GL1 A;  4FPA A;  1HLU A;  4JD2 B;  3UKR A;  3CCQ N;  3GE1 A;  3O9T A;  2F9W A;  4BRD A;  5HOO A;  4EAH D;  3A5O C;  3VOV A;  3N4P A;  5AZJ B;  5F2R A;  3MCA B;  1JCG A;  1YI2 N;  3QBW A;  1KAY A;  3OBW A;  1BA1 A;  1GLC G;  1HKC A;  3H3N O;  4JK9 A;  4JKG B;  4WFN L;  2ZJR L;  1T44 A;  2QW9 A;  4FL9 A;  1NGH A;  3CJ1 A;  3D2F A;  3JXU A;  2OTL N;  3WEE B;  2RHK A;  1IJJ A;  3M6G A;  3TTD A;  1W97 L;  3WXK A;  5E84 A;  1S22 A;  5AQJ A;  5GIP A;  2P9I A;  3QML A;  1V4T A;  4YOT A;  3MN6 A;  3MCP A;  4I6M A;  3ZX0 A;  3CCL N;  4FWN A;  1NGJ A;  4A5A A;  2FSN A;  3PIP L;  1QVG M;  3R3L A;  3O9Q A;  2E1Z A;  5C15 A;  3CET A;  5AQI A;  3CF5 L;  4PL8 A;  3MN7 A;  1GLF O;  3HRG A;  2CH6 A;  1LCU A;  3GOI A;  1X9J A;  5LJV A;  3F9M A;  2NLX A;  3P31 A;  4U7B A;  3A8Y A;  3DJC A;  1HUX A;  3H3O B;  3CMA N;  1MWM A;  1VQ6 N;  1GLD G;  3TPQ A;  3ZET B;  3I33 A;  1Q18 A;  3G25 A;  3HSC A;  5CE3 A;  5FPD A;  5FPN A;  3UKR B;  5F0X A;  3CCM N;  3MWT A;  5FPM A;  1VQN N;  5AQW A;  3MX2 A;  3B8A X;  1JCE A;  1E4F T;  3WXI A;  3HOT A;  1WOQ A;  5KPT A;  5GIN A;  1DKG D;  4CZJ A;  1OKJ A;  3NMU A;  3EL2 A;  4FOI A;  4OPH A;  5AQZ A;  2V51 B;  3VTI A;  1VQK N;  5EXW A;  1ESV A;  1BA0 A;  3GDQ A;  4RTF D;  4BRC A;  4WQ4 C;  1BOT O;  4BR4 A;  1YXQ A;  1YUW A;  4WQ5 C;  1K8A O;  3GG4 A;  3A0I X;  3D2F B;  3EN9 A;  5M1P A;  1G99 A;  1HKG A;  2YHW A;  3SAF A;  2QM1 A;  1JJ2 M;  3CJC A;  3DXM A;  3I8B A;  3VEZ A;  4KH5 A;  2QWM A;  2P9I B;  2VGM A;  4EFH A;  1NGF A;  5BR9 A;  5ELZ A;  4I6M B;  2A6A A;  2YCH A;  4LC9 B;  4G9Z A;  3MK6 A;  3E1Y A;  1T6C A;  4BVO A;  3KWG A;  4H0P A;  4JHD A;  2E8A A;  3C65 A;  1NM1 A;  4YOU A;  4RWT A;  1MWK A;  3ULE A;  3VF6 A;  3WQT A;  2A3Z A;  5KQD A;  1HX1 A;  2A40 A;  2HBK A;  1EQY A;  2J4R A;  3CQX A;  1P8Z A;  4JKD A;  4JK7 A;  5I9E B;  3HOS A;  3ID8 A;  1X3N A;  5AZI A;  4O8U A;  3T69 A;  1P90 A;  1U2V A;  2QWO A;  2P9U A;  4WCE L;  1C0G A;  2A5X A;  2W40 A;  1QZ5 A;  4MO4 A;  2ZWH A;  3P39 A;  3LM9 A;  4BC4 A;  2P9P B;  2E2O A;  3RVC A;  4YDU C;  4BRA A;  4GNI A;  1DGK N;  2GTD A;  3CJB A;  4BC3 A;  3CME N;  4DCH A;  2E20 A;  3O1B A;  4BGB A;  5EOY A;  3SAG A;  1XQS C;  2NRX A;  3U9D A;  3WUH A;  3IKM A;  3NVM A;  4O8K A;  2P9K A;  3IUC A;  2RE2 A;  4EHU A;  1NGG A;  2V7Z A;  3ENB A;  1V4S A;  1ZC6 A;  2WC9 A;  5C12 A;  4IEI A;  5KPR A;  1KD1 O;  1VAZ A;  1VQ4 N;  5AQO A;  4QS8 A;  2I7P A;  3P38 A;  5BRF A;  1XUP O;  3ENH A;  2P9S A;  3DXM B;  4FSV A;  1SS6 A;  4CZH A;  4FWP A;  3FZF A;  2Q31 A;  4PHT X;  2OTJ N;  3HI0 A;  2ASM A;  2Q97 A;  2D4W A;  4IJA A;  2QWR A;  2CGL A;  4JAX A;  2P9N A;  3R6M A;  4K43 A;  1LOT B;  2BTF A;  3SBG A;  3VTH A;  1ZXO A;  2A41 A;  1YJ9 N;  1N8R O;  4A2A A;  2PAV A;  4YOY A;  1DEJ A;  3ENO A;  4JK8 A;  4NB4 A;  1Q81 O;  4JHD B;  4JKA A;  4K25 A;  4IEE A;  4FOE A;  2QTD A;  3SJH A;  4AM6 A;  2GWJ A;  3ULE B;  3QFU A;  3O5B A;  3C6A A;  1VQL N;  3SMP A;  4IWV A;  2QWQ A;  2W41 A;  3SBT A;  2HBM A;  4B1W B;  4FVU A;  1VQ9 N;  3I56 N;  3PLA A;  1YVN A;  5EY4 A;  5AZI B;  5E26 A;  2VGN A;  4BRM A;  3W0L A;  4B9Q A;  2HF4 A;  2YX6 A;  4BRH A;  1U2V B;  3PIO L;  3LL3 A;  4DKW A;  5AQF A;  2P9U B;  1Y64 A;  4H5R A;  3D7E O;  4M7Y A;  4IXC A;  4BY9 C;  1GLL O;  4BG9 A;  4WFB L;  2UYT A;  3VEN A;  3UB5 A;  3C6H A;  4H03 B;  4HWI A;  1NGD A;  3R9P A;  4BRF A;  3SLC A;  2ZJP L;  2I7N A;  3IMX A;  4J8F A;  2E88 A;  5KPZ A;  3WQU A;  2HBL A;  4CBU A;  1Q86 O;  1QZ6 A;  4XH5 A;  5AQR A;  4A62 A;  4YOW A;  1Z6R A;  3WT0 A;  2HOE A;  1NBW A;  2VYP A;  4B1V A;  4DHY A;  1BG3 A;  4FPB A;  5GAD P;  4IOX A;  4ISF A;  5AQT A;  4C1N I;  4FWO A;  3FZK A;  3ID6 A;  3UE5 A;  5LY3 A;  1NWK A;  3CCU N;  4ISG A;  1K9M O;  1NGE A;  4JEP A;  4H0X B;  5CR4 A;  3QDK A;  4H0Y B;  3J8A A;  4BRQ A;  3T7Z A;  2P9N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...