5C2DA

K428a mutant gp2c of large terminase subunit from bacteriophage sf6 with calcium
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
241
structure length
227
Chain Sequence
MAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTAVEMKQKLGIPSPNLADALMMCMHCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two distinct modes of metal ion binding in the nuclease active site of a viral DNA-packaging terminase: insight into the two-metal-ion catalytic mechanism.
pubmed doi rcsb
source organism Enterobacteria phage sf6
molecule tags Metal binding protein
molecule keywords Gene 2 protein
total genus 84
structure length 227
sequence length 241
ec nomenclature
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5c2dA00
5M1QA 5C12A 5M1FA 5C2FA 5M1NA 3C6AA 3C6HA 4IDHA 5M1PA 5C10A 3CPEA 5C2DA 5M1KA 4IEIA 5M1OA 4IFEA 5C15A 4IEEA
chains in the Genus database with same CATH superfamily
3QBWA 4H0OA 3D6RA 3TAGA 5EVZA 1D4XA 3NE6A 4KHYA 4BG8A 2P9SA 1DT9A 2QI2A 4RCHA 1NGFA 2F96A 2HHUA 4DSJA 4CZHA 4FOIA 1WAJA 3LAMA 4Z4CA 3DRSA 4CF2A 3ZT3A 4Y1DA 1S9EA 5C2FA 1LW0A 4CHNA 3WT0A 4BRCA 2OCEA 1C0TA 3BGRA 4C23A 4AHVA 4JRQA 3KD5E 1X3MA 4H5NA 3M5RA 3OBWA 3CCJN 4IO9L 3S3MA 4F3TA 3QERA 3ID8A 4KO0A 4CECA 3WNFA 3ULDA 2A42A 3AVAA 3OYNA 2P9LA 3C7NB 5M1PA 1YTUA 1HKCA 3H08A 4CZEA 1BA1A 4M41A 2Q31A 2B5JA 3OW2M 3CJBA 4OX9K 3V1RA 2KQ2A 3TAMA 4XIUA 4JKDA 4CBUA 3ASMA 2E1ZA 3J8AA 4H4MA 4KPYA 4DKWA 1WSEA 2F9TA 1RBSA 4FW2A 4BE0A 1DGKN 1KVCA 4ELUA 5GIOA 5ELZA 2D4WA 3DRPA 1RBTA 2O8CB 1C0UA 4H5RA 3VQBA 4K25A 2VCPA 3AVBA 3TAFA 1Y64A 3O08A 4JKAA 3C65A 3SAFA 3L8BA 1BA0A 3VENA 1BUPA 1OVYA 3IAYA 1BL3A 1VAZA 4JKGB 5BN8A 3PIPL 2O8BB 3QIPA 1W97L 5DK5A 4BGAA 1QVFM 5J2NA 3SUPA 4IG0A 1YJWN 1YHQN 1L3UA 3AA2A 3VQCA 4DR3K 2EWSA 4ID1A 3KK2A 5TKYA 1HNIA 2P9PA 3SAGA 5E41A 3NAEA 2QK9A 1KLNA 1GOAA 1TUUA 4F2RA 1RT4A 1Z6RA 1GLCG 4DR1K 1QQNA 5AQIA 4BWJA 4FVMA 5C12A 5JLFA 4A61A 3AV9A 3LDLA 4X65K 1SKWA 3CPEA 4FJGA 4H4OA 3IFRA 2FLOA 5HOOA 1N34K 4Z4FA 3TAPA 4JKCA 1ASUA 1VK0A 4GV9A 5DM7L 4JI3K 1KAYA 1HMVA 3OYHA 3AO1A 1NK9A 1WNSA 3WEEA 1NGJA 3AAPA 3E9LA 3THYA 4EHTA 5LJVA 3K58A 4FYDA 1D8YA 3DRRA 4CF1A 2FSNA 2G8FA 3O6WA 4F4KA 3F9MA 1TL3A 4UY8O 4OGEA 2VGMA 1TK0A 1VSFA 4FXDA 3H6EA 3MCPA 4JV5K 2NUBA 4GV6A 3MXJA 4H5WA 4E3SA 3FE1A 4HUGA 2HBJA 1LCUA 4L8RB 3VQPA 3QEPA 3I0SA 5ADXH 3D0PA 4EZ6A 4FJ8A 1RDBA 4CGJA 2W6KA 1C0GA 1EP4A 1L3TA 5CR4A 4NCBA 1HNWK 1QQMA 1YTAA 2WONA 3PX6A 2FXUA 4DV0K 3N4PA 2NRHA 4WYBA 4EAHD 4B8AB 2XY7A 1VQ5N 1O13A 1BI4B 4FJJA 1Z05A 3DXMB 2OANA 1XQSC 4BDZA 4O0IA 3D2FB 1CXUA 3HYFA 1BIUA 4DQRA 2E6LA 3VF6A 1HQUA 4GVMA 1WN7A 1C0MA 2YCHA 3ZSZA 4AM6A 3OS0A 5JICA 3ITHA 4IEIA 2UYTA 1NLVA 3NDKA 1T44A 3CYMA 3TPQA 1VQLN 1BHLA 3P4IA 3BY5A 4BE2A 2YHYA 1WOQA 5CZ1A 5KRTA 5AQYA 4BRNA 3LDQA 4M3WA 2EX3A 1JJ2M 4H0YB 5HL7L 3J81O 4X66K 3EE9A 3D7EO 3MN5A 1D5AA 4RW7A 3GBTA 4JKHA 2VG7A 3CERA 1JKHA 1RT7A 2O8EB 3A5OC 1M1KO 4FWNA 1VRTA 1E3MA 3PLAA 4EHUA 1J5OA 2WC9A 4B1XB 3O3HA 3ZSOA 3CQYA 3L2RA 3I33A 2KHOA 3KIOA 2DTUA 3CCLN 2KFZA 1B9DA 1GOCA 2ITGA 2FF3B 1F21A 4OKEA 5LY3A 3O3FA 3CCUN 3PX0A 4B9MA 3L2WA 2D5RA 4K43A 2P5OA 4CESA 1VQ7N 1X9SA 3W0LA 1NNEA 4XEIA 2YKMA 1CZ9A 3THXA 4EP5A 2E2QA 3VTIA 5DM6L 3M1FA 1WSGA 1FW6A 1HNZK 4DG1A 3L2VA 1HQEA 1HPMA 3PSIA 1HUXA 4JKBA 2Q3SA 5A2QO 3CJ9A 4ISFA 5E26A 1NGIA 2P9UB 3VGKA 2E4LA 3U9DA 1U48A 3VQQA 1EX4A 2IC3A 4DTOA 2PFUA 4YDUA 4GW6A 4JD2B 3HM8A 1A5VA 5AR0A 2YNHA 3NGYA 4KRFA 3SUOA 4JN4A 4PA1A 4OPHA 4HCBA 1SL1A 2R7YA 1Q7YO 2G8HA 3FZHA 4JK9A 4ZTFA 3HOSA 5AQZA 4FJ5A 3O9RA 4E1MA 3E1YA 3AO2A 2O8EA 4KB1A 2HF4A 4CEEA 4DFPA 4MO5A 3O1BA 4BR7A 4CF8A 5JLHA 2BDPA 2O8CA 4CCHA 2G8UA 4R5PA 1XMOK 1JCEA 4K8XA 3D2EB 1N8RO 1SS6A 3TARA 4BC5A 1D9DA 1RT6A 3EKUA 3SBTA 1LAVA 5FRNA 1FK9A 2J4RA 5TKWA 4IFVA 3EN9A 2VQFK 1GLLO 1N6QA 1ZBFA 1EWRA 4FJKA 3H46O 1BCMA 2IIRA 3WXMB 3HSTB 4BR5A 2P9PB 1ASVA 5EOYA 1DTTA 4OPJA 5AQOA 3B6PA 3CM6A 3QESA 3L6QA 3I0RA 1EQYA 3UE5A 3V1QA 3WEEB 4DV3K 4M3ZA 5T7BA 4RW4A 3AO3A 4A59A 4CEQA 1QHAA 3IS9A 1NJYA 1HR0K 3CCRN 1NGHA 2B4JA 4C8KA 1NGBA 3EYZA 3Q7CA 1Y97A 3VQ6A 1S1TA 4AM7A 3OTOK 3P31A 4CEZA 4N56A 5M1OA 4DTPA 4DS4A 4IDKA 3U8XA 3BP8A 2F8SA 5J1EA 4UQGA 1UOCA 3AVHA 3ZEUA 3CC4N 1OH7A 4BRPA 4CEBA 4IOCL 4GV3A 1GLFO 1CLQA 1NGEA 2ETJA 4AHCA 1K8KB 3R8EA 2E6MA 4KBOA 2BUPA 4JHDA 3KLHA 3OS2A 3U6FA 3QO9A 4DSIA 4B9SA 3OVNA 1RCHA 3RR8A 2RHKA 1RT2A 3AGKA 4BE1A 1NKEA 4KH6A 1RTJA 3EE8A 4JKGA 5M1QA 4JNEA 2ASMA 1E4GT 4LH4A 1S9GA 1S1WA 4N47A 5KPTA 4DWIA 4RW8A 3ZEUB 4CJEA 5AQWA 4JS4A 2ZD1A 3DLLL 2O4IA 2LSNA 3CIPA 4U67L 3SCXA 1DLOA 1NK8A 4IFEA 4AILC 1YI2N 2XY8A 4OKKA 4CI6A 3IDHA 3TWHA 2ASOA 3P83D 4KTZA 1QSYA 4BWMA 4IKFA 1LWCA 1GOBA 1LWEA 4EFHA 1Z26A 4EZ9A 4IO8A 1T7PA 3KD1E 3G25A 3HT3A 3I56N 3DLHA 2HVHA 3CQXA 2IVNA 4DLGA 4KB0A 3DOLA 4IJNA 3OYGA 1QZ6A 2OPQA 3RR7A 3RMCA 1YVUA 3BZCA 2Q2RA 2UU9K 4I9QA 3EL2A 3NF9A 3T3FA 3ALYA 2D0CA 3A8YA 4B3OA 2GV9A 4MFBA 3MDQA 5D3GA 4NYNA 3WXKA 3VEOA 4IG3A 2H3GX 1VQ8N 4DR6K 4GY2B 5FLXO 2QWRA 3HI0A 1IG9A 3BEXA 1M90O 1T6DA 3G4SN 3SBGA 2ZE2A 5BPMA 3LZIA 1XC3A 3LWLA 3F9KA 4CFBA 4YOXA 1I39A 2HHHK 1KC8O 3CI5A 4K42A 4M42A 4HHTA 4E89A 2D0OA 3PX4A 1IO2A 2NRXA 1C1BA 2Q1NA 3U4LA 3F2KA 4IDHA 5CYQA 3ZT1A 4BROA 1C6VA 1JLFA 3VQ5A 2D0AA 3HXMA 3RSEB 4LF5K 4FCYA 1MWMA 2HNZA 4FPAA 1TL1A 4CJLA 1TK5A 1J5EK 4JI0K 3KK1A 1NMNA 4I2QA 3T1HK 5H1SQ 1GLDG 2YX6A 4H03B 3ZYYX 4O0JA 1TYQA 2YKNA 4CHOA 3P1GA 3OS1A 3G6EN 3N4QA 2BH1A 2QXFA 5AZJA 1L3VA 2QKKA 2OZSA 4Z4EA 3FLCO 1P90A 1TGOA 4CEFA 1RDAA 1TUYA 3BF1A 4C8OA 4E1JA 3K2PA 2PYJA 4NO7A 3EKSA 4FM2A 4FWMA 3AVLA 4LSLA 4GKKK 5AQXA 3SZ2A 5M1KA 4J2AA 4AF1A 2FSJA 1OH5A 3MXIA 4PUOA 3SV4A 1UAXA 2GTDA 3GG4A 2P51A 4DTNA 2QA4N 1WUAA 4O5FA 4DF8A 4Y0WA 2CH5A 3O9QA 4GVEA 4JD2A 3CJAA 3OYAA 3ENOA 4ID5A 4R79A 3KHYA 4HUFA 3DXKA 4RG8A 1TV6A 3OYEA 3GOIA 5FPMA 1X9JA 1NK0A 4FLYA 3DLEA 3TSUA 3LDSA 3G10A 2YHXA 4M7XA 1CZBA 4BRKA 1QZ5A 1U4BA 3T19A 5EXWA 4DV6K 1HRHA 3DWLA 3NFAA 3F73A 3PO4A 2NRWA 4OPAA 2HHQA 2XRIA 2F9WA 3H3OB 3VOVA 5J2MA 3TAEA 3H1VX 3VQEA 2KZMA 3UKRA 1NGDA 3DXKB 1N33K 1G99A 3WXIA 5MLCQ 2YJFA 4IEEA 5BPLA 4HUEA 4KFBA 4C8LA 2P9NA 4YOUA 2QWOA 5BR9A 5J2PA 3BZKA 3A5LC 4CIFA 2HW3A 3Q7BA 5BR8K 4Y1CA 2A6AA 3D45A 2KLAA 3RVCA 3J7AP 1RDUA 4B1ZA 3V81A 4ELVA 4M3YA 4BRIA 4CHZA 2E8AA 2FSKA 4HWIA 1ZBIA 3QEIA 4CGHA 4O4GA 4N5SA 4IOAL 3AVGA 5KPRA 4QCLA 2IVPA 4BREA 1TK8A 1T3VA 2QXLA 3D2FA 1W2BM 4B3MK 2RE2A 1TKXA 3T69A 4FJ7A 4MDAA 5GINA 3SQ1A 1SAZA 4O8UA 1NWKA 3G71N 4CW7B 2D0BA 3CMAN 2GX9A 3PSFA 2RPIA 4KHPK 4OPKA 4YOTA 2YI1A 2HHSA 4FM0A 1ZXOA 3NGZA 3NBPA 4KHUA 2G8KA 2GUPA 3ISNC 3AA3A 3ZETB 3DJCA 4BR0A 3RMAA 3QMLA 2YHBA 4KKOA 1VQ9N 5LMUK 3DM2A 1X3NA 2ZJPL 3THVA 1KFDA 5FPEA 3LALA 3L4IA 1BO5O 1BOTO 3P5JA 3U9ZA 4NCAA 4M45A 3AGRA 2ZQBA 3CC2N 3CFOA 1Q86O 1S1UA 4Z4IA 4KHWA 1OH8A 2PY5A 4DU1A 3MEGA 3ULEA 1ZBLA 1NOYA 4B1VA 4M3XA 4B9LA 4IZ9A 4X62K 5AZIA 4BQLA 5AQUA 3VA3A 5CYMA 1CXQA 2IAJA 3DAWA 2E5LK 3VETA 3K5MA 5AQVA 1I94K 4W5OA 3KVGA 3ZCMA 4B9TA 5AFUA 4LH5A 3ZLJA 1NM1A 2PYLA 1S3XA 1N36K 3LP2A 1VQNN 1EWQA 4JS5A 1RT5A 3MN7A 4H0PA 4IBNA 4FM1A 1YIJN 2A1SA 2I7PA 3HPHA 5FPDA 3T7ZA 4JKEA 4FWLA 3R3LA 3FGUA 1RDCA 4E7KA 5LJWA 3HBTA 3LDOA 4H0XB 4CGGA 1IH7A 5AQKA 3ZSWA 4HVJA 1JCFA 4DF4A 5GIPA 5FRMA 3VPZA 5KPZA 3HPOA 4XH1A 3UKUA 4PKGA 2NRTA 1GLBG 3KLFA 1BWFO 3TABA 1DEJA 5FROA 2I5JA 1SL0A 1J54A 1YAGA 4E7JA 3HPGA 2P9IA 4FVUA 2OPSA 3CCEN 3VQ9A 1UA1A 2JLEA 4OJRA 4CJUA 3QNOA 3AVJA 3MWPA 4JI1K 5AQJA 3EZ5A 3EO3A 1KAXA 1HKGA 4JHDB 4FWSA 2GELA 3D2EA 4RW9A 2OPPA 2QKBA 1YITN 3SNNA 4DFJA 2YNFA 2JWLA 3EZWA 4I2PA 3LZJA 4IXCA 1VQ6N 2A40A 1QS4A 2E1YA 3K9JA 5HROA 5C25A 1VRUA 1EETA 1NJWA 4DR7K 5M1FA 2WFBA 2IS3A 4LFCK 1T6CA 1IKVA 1NBWA 4Z94A 4CK1A 4B9UA 2DPNA 2V7ZA 1J53A 3VESA 4HTUA 3V9WA 4CBXA 1RILA 4DSKA 1JXBA 3R6MA 1NGGA 2NLXA 1VSJA 2RKIA 1JLQA 3LP1A 4G1QA 5BN9A 3C7NA 4CJ7A 4KHSA 4FK0A 4W5RA 3VMFB 3CJ7A 3CXCM 4YORA 3MMVA 3AY9A 1BIZA 4YOVA 5KTQA 3HSCA 4KI6A 3ZSYA 1HKBA 4DTRA 2HMPA 1YJNN 1V4TA 2XY6A 2PAVA 4DU3A 4FZXC 4WE1A 3NH0A 1T03A 5C42A 1RT3A 3LP0A 1KVAA 3MEDA 3AA5X 2RN2A 3IUCA 1U45A 2ZM6K 3JXUA 1MDUB 4CE9A 2P1JA 2E2OA 3HM9A 1QHTA 1RGIA 4JAXA 3MX2A 2JWKA 5SWMA 2F7TA 3TI0A 3CF5L 1DKGD 3AVIA 4KTQA 3V9ZA 2B6AA 3KKRA 3NH2A 1JLEA 4FWRA 5FPNA 1X9WA 1ASWA 1XHZA 4ZHRA 4CJTA 1EKEA 2O8BA 5LL6Z 4H5TA 5AQTA 4CZFA 5EX5A 1HPZA 1TAUA 4I6MB 4TSXA 1YUWA 4JK8A 1N5YA 2P9UA 3MX5A 4C1NI 2CH6A 4CD1A 4AHTA 3QINA 3OYFA 2PBDA 3BF3A 3HRGA 3G0ZA 4RWTA 3KK3A 3B6OA 3WUHA 3FZLA 1QQOA 1HYSA 2V52B 1WB9A 4LF8K 3SPZA 2OYQA 1HLUA 1JLAA 4C8NA 2Y1JA 2HHVA 1U49A 1ZYQA 2ZWHA 5CE3A 1W7AA 3QFUA 5I9EB 3PUFA 4CBWA 1SUQA 5M1NA 2F8TA 4I6MA 5ADXA 5I42A 3MEEA 3LP3A 4LSNA 1TVRA 3ID6A 4CZMA 4LF4K 3CCSN 4M7YA 2O8FB 1GLEG 2NRVA 2P5GA 4GNIA 3L2QA 3V9SA 3VEVA 3BDPA 4DTSA 4BRHA 2HNYA 4OVLA 2FF6A 4QOZB 3ATVA 1FKOA 4YDUC 1KXPA 3FZFA 3LDNA 2GWKA 3O8MA 5JS1A 1XUPO 5BPNA 3KWIA 3O4QA 3HP6A 1VQMN 3HP9A 1QVGM 2IDOA 1K8AO 4H0TB 1IV0A 2AP1A 1YVNA 4B1WB 4FJHA 2O8FA 1YXQA 2KFNA 3ZX0A 4JI5K 1OH6A 2KKZA 3PO5A 4M3UA 1QSLA 2ZJRL 4FK2A 5GAGP 2F4VK 1ZBSA 3B8AX 3SI6A 4WF9L 2PZSA 2QEXN 2I7NA 3S3NA 3ATUA 4DU4A 3O1WA 2OA8A 3ZX2A 1HJOA 4I9LA 4CJRA 1Q9XA 3CC7N 4CK2A 3SV3A 5FDLA 2ZJQL 1MWKA 4NYFA 4LFBK 3AAQA 5HRPA 4B9QA 4CJQA 1FKPA 1JL2A 4CZLA 4CF0A 3AARA 5HLFA 4AH9A 1K6YA 1ZBHA 3SAHA 1U2VB 5C15A 3V6DA 4BRGA 4E7HA 3PV8A 5HBMA 2GWJA 2Q97A 4FLXA 1GLAG 1L5UA 4FJ9A 4PWDA 4YHHK 3WQUA 2ATQA 1IG8A 2XY5A 2NRRA 3VQ8A 3H1QA 1LWFA 4BRLA 2YNGA 3JYTA 2WBNA 3WNEA 3ZT2A 2P9IB 2P9LB 4J2DA 4CEOA 4A62A 3K5NA 3VEZA 4YFUA 4BQZA 3MECA 1WLJA 1RNHA 5K14A 2QWMA 1C1AA 2HB5A 1ATSA 1TKTA 2RF2A 3CMEN 4JI8K 2HHWA 4JI4K 2W6LA 4BY9C 4CJFA 4DHYA 4GMJB 4AHUA 5KI6A 4CJPA 3VA0A 1SL2A 3CCVN 4KV8A 1BDGA 5KGWA 3U3YA 3SJJA 3OYIA 3DXMA 4HTLA 4RW6A 1YJ9N 4FWKA 3M8SA 3AVNA 3SMPA 4FJIA 4KI4A 4JK7A 3RMDA 4A2AA 4BRMA 2HNDA 4PKHA 3K5LA 2UUCK 4DV2K 2O8DB 3KLIA 4Z4GA 5AJ3K 4FK4A 3WNGA 1KLMA 2HVIA 2P9SB 1EXQA 3E01A 2GEMA 4WQ5C 1KCFA 2ITMA 3SLCA 1VQ4N 4NXMK 2HHXA 2WOMA 1QQCA 2HMIA 2WTUA 3AO5A 4DFMA 1N32K 5EY4A 3VEXA 4JLHA 1JCGA 2JGUA 4WQ5A 3HVRA 1U2VA 3OA9A 1WSHA 3AO4A 2E88A 1HYZA 4CJSA 2W40A 2G8WA 3LDPA 3SPYA 3I8BA 3PY8A 3OYDA 3VEYA 3NH1A 4DR2K 2G8IA 4CHPA 4BC2A 3TSPA 2A3ZA 3ZX3A 1BCOA 3SQ0A 4Q0BA 2UUAK 3AA4A 3QBXA 2CGLA 3OYCA 2DFFA 2Q36A 4BGBA 2VGNA 3IMXA 3QLHA 3E9OA 3THWA 1NGAA 4FZYA 1A5XA 1ZC6A 3MK6A 4DSEA 1TYQB 3FZKA 3ZSRA 5HRNA 4DQSA 3RRHA 5C2DA 4JI7K 4V19S 1BU6O 3QEXA 4L3QA 4DMNA 2XO7A 2CGKA 4WFAL 1K9MO 3R1XA 3VTHA 3DYAA 3DLBA 5CHIA 3S41A 5BRFA 1NJXA 4FL9A 1X1PA 4C8MA 3C95A 1XC9A 1V4SA 3OYMA 4K0KK 1REVA 3K9KA 3HZ6A 3ULEB 4JEPA 4C1NK 3K5OA 4MLHA 3UIQA 3HK2A 2YHAA 3RMBA 1Q18A 2Q0RA 4PKIA 4ILHA 5F0XA 2FBYA 5JVHL 3DMJA 2UUBK 5B8HA 3THWB 5IWAK 4CZGA 4YNQA 2X6SA 4FLUA 4NCGA 4FZZA 5KQDA 3S9HA 4E19A 3GE1A 1XMQK 3V9UA 3BUZB 4WCEL 1BQMA 3HTVA 4H5VA 3C94A 1VHXA 4DSFA 2QM1A 5F1XA 1NJIO 2VYPA 2VWBA 1JL1A 4CJKA 3DLGA 3KK7A 1VSIA 4G9ZA 4B9VA 4O5BA 3KLEA 1B9FA 1JLBA 3VGMA 3GL1A 1FXXA 4ICLA 4Z0UA 5GADP 2CGJA 4JI2K 4CZIA 3ZT4A 4DQPA 1S72N 1IJJA 4FW1A 2VWKA 3A2FA 4K8ZA 1IKYA 4FO0A 3DOKA 5C10A 3E66A 3TR8A 4ISEA 1FJGK 3S3OA 1ILYA 3QDKA 3T1AA 4N76A 2NNWA 3OJSA 1WBBA 4F8RA 3O4WA 4CERA 3NVMA 1G15A 2UXDK 4MLEA 4F2SA 2BTFA 4IWVA 2W42A 1WSIA 1NU0A 4FJXA 4CIGA 2HSTA 3JS6A 5AQLA 4B3SK 1XI1A 2QW9A 5F2RA 4OO1J 4AQYK 3E9PA 3ENHA 4BACA 2ZGZA 2YJEA 1HX1A 3LAKA 4B3TK 2D0PA 3JAMO 2XHBA 3OBYA 3ZSQA 3NF7A 3QICA 3L4QA 3ZETA 1JLGA 3C6AA 4DS5A 4PL7A 4DSLA 1S6PA 3H45C 2FC0A 3DLRA 4WFBL 4DQIA 1T8EA 1SKRA 5KQ8A 2YHWA 3TAQA 5CZ2A 3L3UA 3O80A 4A57A 3K57A 2VG6A 3C6UA 1NJZA 4DV4K 5JS2A 1K8KA 1RDDA 1EO1A 5AZIB 3DI6A 3CM5A 2VWJA 2FBVA 2IOCA 2Z1HA 4FOEA 5AQFA 5AZJB 1RT1A 3C6TA 1XNRK 4BDYA 1RDWX 4BC4A 3HJFA 3HVTA 3FR0A 1U04A 3VQ4A 4LF9K 1BISA 4ELTA 2A5XA 4LFAK 1IKXA 2EHGA 1NK5A 1KVBA 2OTJN 1Q8IA 3CJCA 1JLCA 1HNVA 1RBVA 1RTDA 4JKFA 1TKZA 3M8PA 3THYB 4OLBA 4LC9B 2UXCK 4DR4K 4DTXA 3A0IX 3SQ4A 4NXNK 4QS7A 4MDBA 3CQ8A 2A41A 3O9SA 1IBLK 4CGFA 3FZMA 3H3NO 4DV7K 3LM2A 2QTDA 1TKDA 4WFNL 3I8DA 4FWPA 3TTCA 2VQEK 3QB0A 1RBRA 1CZAN 5CY4A 4LF7K 4FWOA 3A5NC 4DV5K 4B1YB 3RWUA 3I55N 1VSLA 4FJMA 4IJAA 2E20A 1YT3A 3CG7A 4K41A 3TTFA 2BE2A 2OPRA 2YNIA 5HRRA 2P9KB 5SZTA 3EY1A 4FSVA 2HBLA 4BR2A 3C0BA 5AQSA 3WNHA 3R9PA 4DR5K 3MXMA 3KKSA 1D9FA 3C6HA 4XH4A 1NK7A 2D1KA 4A5BA 2V51B 3MAQA 3MN6A 3J80O 3CPWM 3ENBA 3U3GA 1KAZA 3HO1A 1VQON 1IKWA 4E1NA 4F9OA 5AQRA 3V9XA 1W9HA 4RTFD 3QETA 4QS8A 3M3ZA 3AVFA 1SQKA 1S5JA 3HOTA 4WQ4A 1WSFA 1HJRA 3SQ2A 5AQMA 4CK3A 3J7YP 3VF2A 2DFEA 3NF6A 5BREA 4W5TA 3VF4A 4M3RA 1E4FT 2E2PA 4WQ4C 3ZT0A 3L0QA 1J6ZA 3KJVA 3WXLA 2E2NA 3AVKA 1WAFA 2ZF5O 3L3VA 4CJVA 2O4GA 4Z4HA 2Q0UA 3OJUA 3UB5A 2W41A 4BRAA 1OKJA 3O5BA 1ITGA 2O8DA 2VG5A 4J2EA 2OZMA 1MA9B 5AQGA 2X6NA 4CJ3A 3M6GA 3VQAA 1TAQA 4KH5A 4ILJA 3VEWA 5HRSA 4B1UB 1SZ2A 4MQ3A 1KSPA 4BR4A 1UA0A 3OYJA 4FJLA 2FBXA 5BRDA 1BQNA 4BRFA 4FJNA 4PQUA 3ZSVA 3F5TA 2GUIA 3NVKA 4NLCA 3NF8A 3SMSA 3RTVA 5J2QA 2Z1JA 4CVNE 3KLGA 1VSHA 3VQ7A 4NB4A 2KZZA 4E0DA 1VSDA 3FFIA 3AVCA 4B8CA 1IBKK 4FLVA 1KQSM 3KZBA 4KTWA 3V4IA 3SUQA 1NG9A 5AQPA 5LMNK 1Q82O 4LF6K 1J9AA 2OTLN 4B9NA 2HBKA 4QS9A 3P39A 1DTQA 3O9TA 1WBDA 2Z1GA 2QWNA 4CHYA 3LWMA 1NKBA 4CHQA 4YY3K 3NHGA 3QNNA 3UKRB 4O44A 4J2BA 2X78A 5IT9O 4H8KA 4OGCA 3VERA 4CF9A 2IGIA 2KTQA 3CCMN 1BI4A 3W3DA 4QAGA 4JRPA 3OHRA 3CETA 4X64K 4NLBA 4BC3A 4PHTX 3KTQA 3KWGA 3L2UA 3THXB 3IRXA 3SK3A 4CZKA 4IFYA 4F3OA 2Z1IA 1UWBA 1T05A 4O8KA 5BRHA 1RBUA 4CEDA 2Y1IA 1YF5L 3TTDA 4BR9A 4YOYA 2BANA 1BGXT 3NMUA 5HP1A 5C24A 2G8VA 1ATRA 4H0VB 1Z25A 3OYBA 1LW2A 4FLTA 4BG9A 3VN5A 1ESVA 3SJHA 1VQPN 5DMRA 4AHSA 4AHRA 4OKJA 4CFDA 3NGIA 4YOWA 2P9KA 2ZGYA 1NK4A 1O1WA 4DQ8A 1IBMK 4ILGB 3TANA 4Q5VA 1HNXK 4W5QA 1C1CA 1U6ZA 4FLWA 4KH4A 4CJ4A 1RTIA 3HL8A 2UXBK 1SV5A 2GBZA 3LM9A 4DTJA 1OVQA 1VSKA 1XNQK 2V7YA 4BDPA 1XHXA 3QFPA 3ZSXA 4KHNA 2QWQA 4DV1K 1NKCA 4CJWA 3PIOL 3MCAB 3CFRA 1KFSA 3M8QA 3O9UA 4IOXA 3K59A 3CJ1A 4CJ5A 5JVGL 1S1XA 4LY7A 3TSQA 4DFKA 1S6QA 1Q9YA 3LANA 4PL8A 1ZBUA 1WSJA 5I3UA 4B08A 4A5AA 2NZTA 4LD0A 2KW4A 1QTMA 1KTQA 3K0SA 4CEAA 3IKMA 1R0AA 4M3TA 4CGDA 2ASPA 2DFHA 3V1OA 1NGCA 3SUNA 4E7LA 4CFCA 3UKUB 2IVOA 3O4NA 4JYAK 3QIOA 1KRPA 2WUSA 3LPUA 3NCIA 3SYZA 4CZJA 1L3SA 4BRDA 4FLZA 1R59O 4DB3A 1JXEA 1H1VA 1U47A 4EP4A 4OLAA 3QEWA 4BVOA 4A2BA 1B92A 1SKSA 4I7FA 1GLJO 4FPBA 2YV0X 1I3AA 3JSMA 4KHQA 1VQKN 3EEQA 3QEVA 1KD1O 4CFAA 2HHTA 2BGGA 3IG1A 3WXJA 1QSSA 1X9MA 3GDQA 5AFUH 2HF3A 3FFKB 2NRZA 2HBMA 1LOTB 1QE1A 4DUYK 3OYLA 2X74A 4FWQA 4HCCA 4O55A 2A1RA 4DTUA 5E84A 5JMVA 1ATNA 1C0FA 4B3RK 1XWLA 1NOZA 5AQQA 2P9NB 4GKJK 3VGLA 2AJQA 3MWTA 4XH5A 4N41A 5GAHP 4DLEA 2AA4A 3RSEA 3CD6N 3MN9A 4BRQA 3T1YK 2HOEA 4MO4A 3A5MC 4EIAA 4JI6K 4CD3A 3TU5A 4DQQA 1W0HA 3M8RA 4DTMA 4ZTJA 4PY5A 1LAWA 1Q81O 1HYVA 5AQHA 3CHWA 4CGIA 2QWPA 5EU7A 4CIEA 5GAEP 1MU2A 1LV5A 5KRSA 3CFPA 1S22A 3AVMA 3J7ZO 3WQTA 3VQDA 4J8FA 2QWLA 4KAZA 1P8ZA 1RTHA 4U7BA 3CCQN 4KREA 3RRGA 1VSMA 4DUZK 1K73O 1VSEA 4BVPA 1A5WA 4W5NA 4ISGA 5AQNA 1NMDA 4E7IA 3OY9A 1BG3A 3P38A 4DCHA 2FBTA 4M63C 2DY4A 1S1VA 3O3GA 3LPTA 3OYKA 5KGXA 3DLKA 1NK6A 1RFQA 5C0YA 3LL3A
chains in the Genus database with same CATH topology
4JKGA 3QBWA 3R6MA 1NGGA 2NLXA 3D6RA 4H0OA 4JNEA 5EVZA 3C6AA 5BN9A 2ASMA 1E4GT 1D4XA 4PL7A 3C7NA 4CJ7A 4BG8A 2P9SA 1DT9A 2QI2A 3H45C 3VMFB 3CJ7A 5KPTA 4RCHA 4YORA 1NGFA 3MMVA 4WFBL 3CXCM 3AY9A 3ZEUB 5AQWA 5KQ8A 2YHWA 4YOVA 3HSCA 4CZHA 3DLLL 3CIPA 4FOIA 4A57A 3O80A 4U67L 1HKBA 2HMPA 1YJNN 1V4TA 2PAVA 4IFEA 1YI2N 1K8KA 4CI6A 5C2FA 3IDHA 1EO1A 2ASOA 5AZIB 3WT0A 4BRCA 4EFHA 4C23A 4IO8A 3IUCA 1X3MA 3G25A 4FOEA 5AQFA 3JXUA 5AZJB 4H5NA 3I56N 3M5RA 3CQXA 1MDUB 3OBWA 2IVNA 1RDWX 4BC4A 3CCJN 4IO9L 2E2OA 4IJNA 3FR0A 1QZ6A 3ID8A 1RGIA 4JAXA 3MX2A 3ZETA 2A5XA 2A42A 2JWKA 2F7TA 3CF5L 1DKGD 2P9LA 3C7NB 2OTJN 2Q2RA 3CJCA 5M1PA 4FWRA 5FPNA 1HKCA 3EL2A 4CZEA 1BA1A 4JKFA 2Q31A 3OW2M 3CJBA 3A8YA 4H5TA 4LC9B 5AQTA 4CZFA 5EX5A 4JKDA 4I6MB 3A0IX 4BC5A 4CBUA 2E1ZA 3J8AA 1YUWA 4DKWA 3MDQA 4JK8A 4QS7A 2F9TA 3VEOA 3WXKA 2H3GX 1DGKN 4MDBA 1VQ8N 2A41A 4GY2B 2P9UA 3MX5A 3O9SA 2CH6A 4C1NI 2QWRA 5GIOA 4CD1A 5ELZA 2D4WA 3FZMA 3HI0A 4H5RA 3H3NO 3BEXA 1M90O 4K25A 1T6DA 2VCPA 3G4SN 3LM2A 2QTDA 2PBDA 4WFNL 3BF3A 3SBGA 3HRGA 1Y64A 3O08A 4FWPA 3TTCA 4JKAA 5BPMA 4RWTA 1XC3A 3WUHA 3FZLA 3C65A 1QQOA 3QB0A 3SAFA 2V52B 4YOXA 1CZAN 1BA0A 3VENA 1BUPA 1KC8O 1HLUA 1OVYA 4FWOA 3A5NC 1VAZA 3CI5A 4K42A 4JKGB 4B1YB 5BN8A 2ZWHA 3PIPL 5CE3A 1W97L 4BGAA 2D0OA 3I55N 2NRXA 3QFUA 2Q1NA 4IJAA 5I9EB 3U4LA 4CBWA 5M1NA 3F2KA 1QVFM 4IDHA 2E20A 4K41A 4I6MA 3TTFA 4BROA 5ADXA 1YJWN 1YHQN 2P9KB 3RSEB 4FSVA 2HBLA 2EWSA 3C0BA 1MWMA 4BR2A 5AQSA 4FPAA 3ID6A 3R9PA 4CZMA 3CCSN 4M7YA 5TKYA 2P9PA 1GLEG 3SAGA 2NRVA 3C6HA 4XH4A 2D1KA 4A5BA 2V51B 5H1SQ 1GLDG 1TUUA 2YX6A 3MN6A 4GNIA 4H03B 3ZYYX 3CPWM 3VEVA 3ENBA 1Z6RA 1KAZA 1GLCG 1TYQA 1VQON 1QQNA 5AQIA 3G6EN 4BRHA 3N4QA 4F9OA 5M1QA 5C12A 2BH1A 5AQRA 4A61A 5AZJA 5JLFA 2FF6A 3LDLA 4RTFD 3CPEA 4QS8A 3M3ZA 3FLCO 3IFRA 3ATVA 1SQKA 4YDUC 2FLOA 1KXPA 5HOOA 3FZFA 1P90A 3HOTA 4WQ4A 3LDNA 2GWKA 3O8MA 1XUPO 5BPNA 5AQMA 3KWIA 3VF2A 4JKCA 1VQMN 5BREA 1TUYA 3BF1A 4GV9A 5DM7L 1QVGM 1KAYA 4E1JA 3VF4A 1E4FT 2E2PA 1K8AO 4NO7A 4H0TB 3EKSA 4FWMA 4WQ4C 1YVNA 2AP1A 3WEEA 1NGJA 3AAPA 1J6ZA 3E9LA 3L0QA 5AQXA 4EHTA 5M1KA 4B1WB 3WXLA 5LJVA 2E2NA 2ZF5O 2FSJA 4AF1A 1YXQA 2Q0UA 2GTDA 3ZX0A 3GG4A 2W41A 3UB5A 4BRAA 2QA4N 2FSNA 1OKJA 2KKZA 3O5BA 1WUAA 3O6WA 4O5FA 3F9MA 4Y0WA 2CH5A 3O9QA 1MA9B 4GVEA 2ZJRL 5GAGP 4JD2A 4UY8O 2VGMA 5AQGA 3CJAA 1ZBSA 3ENOA 3B8AX 3M6GA 4WF9L 3H6EA 4R79A 3KHYA 2QEXN 2I7NA 3MCPA 3DXKA 4KH5A 4ILJA 4GV6A 3ATUA 3VEWA 3O1WA 3GOIA 1SZ2A 4H5WA 4B1UB 5FPMA 3ZX2A 1HJOA 3FE1A 4BR4A 2HBJA 1X9JA 5BRDA 1LCUA 3CC7N 5ADXH 4BRFA 2ZJQL 1MWKA 3TSUA 3F5TA 2YHXA 1C0GA 5CR4A 4M7XA 3NVKA 4NLCA 3AAQA 3SMSA 4BRKA 4B9QA 1QZ5A 1QQMA 5EXWA 3DWLA 4CZLA 2FXUA 3N4PA 4NB4A 2NRHA 4WYBA 4EAHD 2NRWA 4OPAA 3AARA 1VQ5N 1O13A 2F9WA 3H3OB 3VOVA 3SAHA 1U2VB 5C15A 1Z05A 4BRGA 3DXMB 2OANA 1KQSM 1XQSC 3KZBA 3H1VX 2GWJA 3UKRA 3D2FB 2Q97A 1GLAG 1NGDA 5AQPA 3VF6A 3DXKB 1Q82O 3WQUA 2OTLN 1IG8A 2HBKA 4QS9A 3P39A 1G99A 3WXIA 2NRRA 2YCHA 3H1QA 4AM6A 5MLCQ 2YJFA 4IEEA 4BRLA 5BPLA 3O9TA 2WBNA 5JICA 2P9NA 4YOUA 4IEIA 2UYTA 2QWOA 2QWNA 1NLVA 5BR9A 1T44A 3A5LC 2P9IB 3Q7BA 2P9LB 3TPQA 1VQLN 2A6AA 4A62A 2KLAA 3VEZA 3P4IA 3RVCA 1RDUA 4B1ZA 4BQZA 3UKRB 2QWMA 4BRIA 1ATSA 1WOQA 2YHYA 3CMEN 2E8AA 2FSKA 4HWIA 5AQYA 4BRNA 4IOAL 3VERA 4BY9C 3LDQA 4DHYA 5KPRA 3CCMN 3CCVN 1BDGA 1JJ2M 4H0YB 3W3DA 5HL7L 2IVPA 3EE9A 4BREA 3OHRA 3D7EO 3DXMA 1T3VA 2QXLA 3MN5A 3CETA 3D2FA 1W2BM 3GBTA 4HTLA 4NLBA 4BC3A 4PHTX 2RE2A 3T69A 1YJ9N 4JKHA 4MDAA 4FWKA 3CERA 5GINA 1SAZA 4O8UA 3KWGA 1NWKA 3SK3A 3SMPA 3G71N 4CZKA 3CMAN 3A5OC 1M1KO 4FWNA 2GX9A 4JK7A 4A2AA 4O8KA 4BRMA 5BRHA 4YOTA 4PKHA 2YI1A 3PLAA 4EHUA 1ZXOA 2WC9A 1YF5L 3TTDA 4B1XB 4BR9A 4YOYA 3CQYA 3NMUA 3I33A 2GUPA 3ZETB 2KHOA 1ATRA 3DJCA 4BR0A 4H0VB 3CCLN 3QMLA 4BG9A 1VQ9N 2P9SB 1ESVA 3SJHA 1VQPN 1X3NA 2ZJPL 2GEMA 2FF3B 4WQ5C 5FPEA 4YOWA 2P9KA 2ZGYA 2ITMA 3SLCA 1VQ4N 4DQ8A 4ILGB 5LY3A 3CCUN 3L4IA 1BO5O 1BOTO 4K43A 1U6ZA 5EY4A 3U9ZA 3VEXA 1VQ7N 4KH4A 1JCGA 3AGRA 4WQ5A 3W0LA 1U2VA 3OA9A 4XEIA 3CC2N 3LM9A 2E88A 1Q86O 2E2QA 2V7YA 3VTIA 2W40A 5DM6L 3LDPA 3QFPA 3M1FA 3I8BA 3ULEA 3VEYA 4B1VA 2QWQA 4BC2A 4IZ9A 3TSPA 2A3ZA 3ZX3A 3PIOL 3MCAB 1HPMA 5AZIA 4BQLA 5AQUA 1HUXA 4JKBA 3QBXA 3O9UA 2CGLA 3CJ9A 3CJ1A 4IOXA 4ISFA 5E26A 3DAWA 1NGIA 2Q36A 2VGNA 3IMXA 3VETA 3E9OA 4BGBA 1NGAA 5JVGL 2P9UB 5AQVA 3TSQA 3VGKA 3U9DA 1ZC6A 4PL8A 3MK6A 3L4QA 1TYQB 3FZKA 2PFUA 4YDUA 4A5AA 2NZTA 5C2DA 3KVGA 4JD2B 1BU6O 5AFUA 3HM8A 3IKMA 4L3QA 5AR0A 1NM1A 2CGKA 4WFAL 1K9MO 3R1XA 2ASPA 1NGCA 1S3XA 4JN4A 4OPHA 3VTHA 5CHIA 3S41A 1VQNN 5BRFA 4FL9A 1Q7YO 3FZHA 3MN7A 4H0PA 1YIJN 4JK9A 3UKUB 2IVOA 1V4SA 3HOSA 2I7PA 5AQZA 2WUSA 5FPDA 4CZJA 3K9KA 3HZ6A 3ULEB 3T7ZA 4JEPA 4BRDA 3O9RA 4JKEA 1R59O 3E1YA 4FWLA 3R3LA 3FGUA 4MLHA 4C1NK 4DB3A 1H1VA 5LJWA 2HF4A 3HBTA 4BVOA 4A2BA 3LDOA 1Q18A 2Q0RA 4PKIA 4H0XB 4ILHA 5F0XA 1GLJO 5AQKA 5JVHL 4MO5A 4FPBA 1JCFA 3O1BA 4BR7A 5B8HA 5JLHA 4CZGA 5GIPA 1VQKN 3VPZA 5KPZA 1KD1O 1JCEA 4XH1A 3D2EB 3WXJA 1N8RO 5KQDA 3GDQA 3GE1A 1SS6A 3UKUA 5AFUH 2HF3A 3FFKB 4PKGA 2NRZA 2NRTA 3BUZB 2HBMA 1LOTB 3EKUA 3HTVA 3SBTA 1GLBG 4H5VA 4WCEL 1BWFO 2QM1A 5F1XA 1NJIO 2VYPA 2J4RA 2VWBA 4FWQA 5TKWA 3EN9A 1GLLO 3KK7A 1DEJA 5E84A 3H46O 5JMVA 1ATNA 1C0FA 2IIRA 3WXMB 4G9ZA 5AQQA 4BR5A 1YAGA 2P9NB 2P9PB 3VGLA 5EOYA 3VGMA 3MWTA 3GL1A 4XH5A 5GAHP 2P9IA 5AQOA 4FVUA 2AA4A 3CCEN 5GADP 3RSEA 2CGJA 3CD6N 4CZIA 3MN9A 4BRQA 3L6QA 1EQYA 3UE5A 3WEEB 2HOEA 4MO4A 3A5MC 4A59A 4EIAA 4CD3A 1S72N 1QHAA 3TU5A 1IJJA 3MWPA 3CCRN 1NGHA 5AQJA 1NGBA 1Q81O 3EO3A 1KAXA 1HKGA 4FO0A 3Q7CA 5AQHA 3CHWA 2QWPA 4JHDB 4FWSA 2GELA 4AM7A 3P31A 5GAEP 5C10A 3D2EA 3E66A 4ISEA 5M1OA 1ILYA 3QDKA 1S22A 2NNWA 3U8XA 3BP8A 1YITN 3J7ZO 3O4WA 2JWLA 3WQTA 3EZWA 4J8FA 2QWLA 3NVMA 4IXCA 1P8ZA 1VQ6N 2A40A 3ZEUA 3CC4N 4BRPA 4U7BA 4MLEA 3CCQN 2E1YA 3K9JA 1GLFO 4IOCL 4GV3A 1NGEA 1K73O 1K8KB 2BTFA 4IWVA 3R8EA 4BVPA 4KBOA 5M1FA 2WFBA 4ISGA 5AQNA 2BUPA 4JHDA 1NMDA 2HSTA 1T6CA 3JS6A 5AQLA 2QW9A 5F2RA 1BG3A 4OO1J 1NBWA 3E9PA 3P38A 4DCHA 4M63C 3ENHA 4Z94A 2ZGZA 2YJEA 1HX1A 2DPNA 2V7ZA 3VESA 2RHKA 2D0PA 4CBXA 3AGKA 1RFQA 3OBYA 3QICA 5C0YA 4KH6A 3LL3A 3EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1Q A;  5C12 A;  5M1F A;  5C2F A;  5M1N A;  3C6A A;  3C6H A;  4IDH A;  5M1P A;  5C10 A;  3CPE A;  5C2D A;  5M1K A;  4IEI A;  5M1O A;  4IFE A;  5C15 A;  4IEE A; 
#chains in the Genus database with same CATH topology
 3QBW A;  4H0O A;  3D6R A;  3TAG A;  5EVZ A;  1D4X A;  3NE6 A;  4KHY A;  4BG8 A;  2P9S A;  1DT9 A;  2QI2 A;  4RCH A;  1NGF A;  2F96 A;  2HHU A;  4DSJ A;  4CZH A;  4FOI A;  1WAJ A;  3LAM A;  4Z4C A;  3DRS A;  4CF2 A;  3ZT3 A;  4Y1D A;  1S9E A;  5C2F A;  1LW0 A;  4CHN A;  3WT0 A;  4BRC A;  2OCE A;  1C0T A;  3BGR A;  4C23 A;  4AHV A;  4JRQ A;  3KD5 E;  1X3M A;  4H5N A;  3M5R A;  3OBW A;  3CCJ N;  4IO9 L;  3S3M A;  4F3T A;  3QER A;  3ID8 A;  4KO0 A;  4CEC A;  3WNF A;  3ULD A;  2A42 A;  3AVA A;  3OYN A;  2P9L A;  3C7N B;  5M1P A;  1YTU A;  1HKC A;  3H08 A;  4CZE A;  1BA1 A;  4M41 A;  2Q31 A;  2B5J A;  3OW2 M;  3CJB A;  4OX9 K;  3V1R A;  2KQ2 A;  3TAM A;  4XIU A;  4JKD A;  4CBU A;  3ASM A;  2E1Z A;  3J8A A;  4H4M A;  4KPY A;  4DKW A;  1WSE A;  2F9T A;  1RBS A;  4FW2 A;  4BE0 A;  1DGK N;  1KVC A;  4ELU A;  5GIO A;  5ELZ A;  2D4W A;  3DRP A;  1RBT A;  2O8C B;  1C0U A;  4H5R A;  3VQB A;  4K25 A;  2VCP A;  3AVB A;  3TAF A;  1Y64 A;  3O08 A;  4JKA A;  3C65 A;  3SAF A;  3L8B A;  1BA0 A;  3VEN A;  1BUP A;  1OVY A;  3IAY A;  1BL3 A;  1VAZ A;  4JKG B;  5BN8 A;  3PIP L;  2O8B B;  3QIP A;  1W97 L;  5DK5 A;  4BGA A;  1QVF M;  5J2N A;  3SUP A;  4IG0 A;  1YJW N;  1YHQ N;  1L3U A;  3AA2 A;  3VQC A;  4DR3 K;  2EWS A;  4ID1 A;  3KK2 A;  5TKY A;  1HNI A;  2P9P A;  3SAG A;  5E41 A;  3NAE A;  2QK9 A;  1KLN A;  1GOA A;  1TUU A;  4F2R A;  1RT4 A;  1Z6R A;  1GLC G;  4DR1 K;  1QQN A;  5AQI A;  4BWJ A;  4FVM A;  5C12 A;  5JLF A;  4A61 A;  3AV9 A;  3LDL A;  4X65 K;  1SKW A;  3CPE A;  4FJG A;  4H4O A;  3IFR A;  2FLO A;  5HOO A;  1N34 K;  4Z4F A;  3TAP A;  4JKC A;  1ASU A;  1VK0 A;  4GV9 A;  5DM7 L;  4JI3 K;  1KAY A;  1HMV A;  3OYH A;  3AO1 A;  1NK9 A;  1WNS A;  3WEE A;  1NGJ A;  3AAP A;  3E9L A;  3THY A;  4EHT A;  5LJV A;  3K58 A;  4FYD A;  1D8Y A;  3DRR A;  4CF1 A;  2FSN A;  2G8F A;  3O6W A;  4F4K A;  3F9M A;  1TL3 A;  4UY8 O;  4OGE A;  2VGM A;  1TK0 A;  1VSF A;  4FXD A;  3H6E A;  3MCP A;  4JV5 K;  2NUB A;  4GV6 A;  3MXJ A;  4H5W A;  4E3S A;  3FE1 A;  4HUG A;  2HBJ A;  1LCU A;  4L8R B;  3VQP A;  3QEP A;  3I0S A;  5ADX H;  3D0P A;  4EZ6 A;  4FJ8 A;  1RDB A;  4CGJ A;  2W6K A;  1C0G A;  1EP4 A;  1L3T A;  5CR4 A;  4NCB A;  1HNW K;  1QQM A;  1YTA A;  2WON A;  3PX6 A;  2FXU A;  4DV0 K;  3N4P A;  2NRH A;  4WYB A;  4EAH D;  4B8A B;  2XY7 A;  1VQ5 N;  1O13 A;  1BI4 B;  4FJJ A;  1Z05 A;  3DXM B;  2OAN A;  1XQS C;  4BDZ A;  4O0I A;  3D2F B;  1CXU A;  3HYF A;  1BIU A;  4DQR A;  2E6L A;  3VF6 A;  1HQU A;  4GVM A;  1WN7 A;  1C0M A;  2YCH A;  3ZSZ A;  4AM6 A;  3OS0 A;  5JIC A;  3ITH A;  4IEI A;  2UYT A;  1NLV A;  3NDK A;  1T44 A;  3CYM A;  3TPQ A;  1VQL N;  1BHL A;  3P4I A;  3BY5 A;  4BE2 A;  2YHY A;  1WOQ A;  5CZ1 A;  5KRT A;  5AQY A;  4BRN A;  3LDQ A;  4M3W A;  2EX3 A;  1JJ2 M;  4H0Y B;  5HL7 L;  3J81 O;  4X66 K;  3EE9 A;  3D7E O;  3MN5 A;  1D5A A;  4RW7 A;  3GBT A;  4JKH A;  2VG7 A;  3CER A;  1JKH A;  1RT7 A;  2O8E B;  3A5O C;  1M1K O;  4FWN A;  1VRT A;  1E3M A;  3PLA A;  4EHU A;  1J5O A;  2WC9 A;  4B1X B;  3O3H A;  3ZSO A;  3CQY A;  3L2R A;  3I33 A;  2KHO A;  3KIO A;  2DTU A;  3CCL N;  2KFZ A;  1B9D A;  1GOC A;  2ITG A;  2FF3 B;  1F21 A;  4OKE A;  5LY3 A;  3O3F A;  3CCU N;  3PX0 A;  4B9M A;  3L2W A;  2D5R A;  4K43 A;  2P5O A;  4CES A;  1VQ7 N;  1X9S A;  3W0L A;  1NNE A;  4XEI A;  2YKM A;  1CZ9 A;  3THX A;  4EP5 A;  2E2Q A;  3VTI A;  5DM6 L;  3M1F A;  1WSG A;  1FW6 A;  1HNZ K;  4DG1 A;  3L2V A;  1HQE A;  1HPM A;  3PSI A;  1HUX A;  4JKB A;  2Q3S A;  5A2Q O;  3CJ9 A;  4ISF A;  5E26 A;  1NGI A;  2P9U B;  3VGK A;  2E4L A;  3U9D A;  1U48 A;  3VQQ A;  1EX4 A;  2IC3 A;  4DTO A;  2PFU A;  4YDU A;  4GW6 A;  4JD2 B;  3HM8 A;  1A5V A;  5AR0 A;  2YNH A;  3NGY A;  4KRF A;  3SUO A;  4JN4 A;  4PA1 A;  4OPH A;  4HCB A;  1SL1 A;  2R7Y A;  1Q7Y O;  2G8H A;  3FZH A;  4JK9 A;  4ZTF A;  3HOS A;  5AQZ A;  4FJ5 A;  3O9R A;  4E1M A;  3E1Y A;  3AO2 A;  2O8E A;  4KB1 A;  2HF4 A;  4CEE A;  4DFP A;  4MO5 A;  3O1B A;  4BR7 A;  4CF8 A;  5JLH A;  2BDP A;  2O8C A;  4CCH A;  2G8U A;  4R5P A;  1XMO K;  1JCE A;  4K8X A;  3D2E B;  1N8R O;  1SS6 A;  3TAR A;  4BC5 A;  1D9D A;  1RT6 A;  3EKU A;  3SBT A;  1LAV A;  5FRN A;  1FK9 A;  2J4R A;  5TKW A;  4IFV A;  3EN9 A;  2VQF K;  1GLL O;  1N6Q A;  1ZBF A;  1EWR A;  4FJK A;  3H46 O;  1BCM A;  2IIR A;  3WXM B;  3HST B;  4BR5 A;  2P9P B;  1ASV A;  5EOY A;  1DTT A;  4OPJ A;  5AQO A;  3B6P A;  3CM6 A;  3QES A;  3L6Q A;  3I0R A;  1EQY A;  3UE5 A;  3V1Q A;  3WEE B;  4DV3 K;  4M3Z A;  5T7B A;  4RW4 A;  3AO3 A;  4A59 A;  4CEQ A;  1QHA A;  3IS9 A;  1NJY A;  1HR0 K;  3CCR N;  1NGH A;  2B4J A;  4C8K A;  1NGB A;  3EYZ A;  3Q7C A;  1Y97 A;  3VQ6 A;  1S1T A;  4AM7 A;  3OTO K;  3P31 A;  4CEZ A;  4N56 A;  5M1O A;  4DTP A;  4DS4 A;  4IDK A;  3U8X A;  3BP8 A;  2F8S A;  5J1E A;  4UQG A;  1UOC A;  3AVH A;  3ZEU A;  3CC4 N;  1OH7 A;  4BRP A;  4CEB A;  4IOC L;  4GV3 A;  1GLF O;  1CLQ A;  1NGE A;  2ETJ A;  4AHC A;  1K8K B;  3R8E A;  2E6M A;  4KBO A;  2BUP A;  4JHD A;  3KLH A;  3OS2 A;  3U6F A;  3QO9 A;  4DSI A;  4B9S A;  3OVN A;  1RCH A;  3RR8 A;  2RHK A;  1RT2 A;  3AGK A;  4BE1 A;  1NKE A;  4KH6 A;  1RTJ A;  3EE8 A;  4JKG A;  5M1Q A;  4JNE A;  2ASM A;  1E4G T;  4LH4 A;  1S9G A;  1S1W A;  4N47 A;  5KPT A;  4DWI A;  4RW8 A;  3ZEU B;  4CJE A;  5AQW A;  4JS4 A;  2ZD1 A;  3DLL L;  2O4I A;  2LSN A;  3CIP A;  4U67 L;  3SCX A;  1DLO A;  1NK8 A;  4IFE A;  4AIL C;  1YI2 N;  2XY8 A;  4OKK A;  4CI6 A;  3IDH A;  3TWH A;  2ASO A;  3P83 D;  4KTZ A;  1QSY A;  4BWM A;  4IKF A;  1LWC A;  1GOB A;  1LWE A;  4EFH A;  1Z26 A;  4EZ9 A;  4IO8 A;  1T7P A;  3KD1 E;  3G25 A;  3HT3 A;  3I56 N;  3DLH A;  2HVH A;  3CQX A;  2IVN A;  4DLG A;  4KB0 A;  3DOL A;  4IJN A;  3OYG A;  1QZ6 A;  2OPQ A;  3RR7 A;  3RMC A;  1YVU A;  3BZC A;  2Q2R A;  2UU9 K;  4I9Q A;  3EL2 A;  3NF9 A;  3T3F A;  3ALY A;  2D0C A;  3A8Y A;  4B3O A;  2GV9 A;  4MFB A;  3MDQ A;  5D3G A;  4NYN A;  3WXK A;  3VEO A;  4IG3 A;  2H3G X;  1VQ8 N;  4DR6 K;  4GY2 B;  5FLX O;  2QWR A;  3HI0 A;  1IG9 A;  3BEX A;  1M90 O;  1T6D A;  3G4S N;  3SBG A;  2ZE2 A;  5BPM A;  3LZI A;  1XC3 A;  3LWL A;  3F9K A;  4CFB A;  4YOX A;  1I39 A;  2HHH K;  1KC8 O;  3CI5 A;  4K42 A;  4M42 A;  4HHT A;  4E89 A;  2D0O A;  3PX4 A;  1IO2 A;  2NRX A;  1C1B A;  2Q1N A;  3U4L A;  3F2K A;  4IDH A;  5CYQ A;  3ZT1 A;  4BRO A;  1C6V A;  1JLF A;  3VQ5 A;  2D0A A;  3HXM A;  3RSE B;  4LF5 K;  4FCY A;  1MWM A;  2HNZ A;  4FPA A;  1TL1 A;  4CJL A;  1TK5 A;  1J5E K;  4JI0 K;  3KK1 A;  1NMN A;  4I2Q A;  3T1H K;  5H1S Q;  1GLD G;  2YX6 A;  4H03 B;  3ZYY X;  4O0J A;  1TYQ A;  2YKN A;  4CHO A;  3P1G A;  3OS1 A;  3G6E N;  3N4Q A;  2BH1 A;  2QXF A;  5AZJ A;  1L3V A;  2QKK A;  2OZS A;  4Z4E A;  3FLC O;  1P90 A;  1TGO A;  4CEF A;  1RDA A;  1TUY A;  3BF1 A;  4C8O A;  4E1J A;  3K2P A;  2PYJ A;  4NO7 A;  3EKS A;  4FM2 A;  4FWM A;  3AVL A;  4LSL A;  4GKK K;  5AQX A;  3SZ2 A;  5M1K A;  4J2A A;  4AF1 A;  2FSJ A;  1OH5 A;  3MXI A;  4PUO A;  3SV4 A;  1UAX A;  2GTD A;  3GG4 A;  2P51 A;  4DTN A;  2QA4 N;  1WUA A;  4O5F A;  4DF8 A;  4Y0W A;  2CH5 A;  3O9Q A;  4GVE A;  4JD2 A;  3CJA A;  3OYA A;  3ENO A;  4ID5 A;  4R79 A;  3KHY A;  4HUF A;  3DXK A;  4RG8 A;  1TV6 A;  3OYE A;  3GOI A;  5FPM A;  1X9J A;  1NK0 A;  4FLY A;  3DLE A;  3TSU A;  3LDS A;  3G10 A;  2YHX A;  4M7X A;  1CZB A;  4BRK A;  1QZ5 A;  1U4B A;  3T19 A;  5EXW A;  4DV6 K;  1HRH A;  3DWL A;  3NFA A;  3F73 A;  3PO4 A;  2NRW A;  4OPA A;  2HHQ A;  2XRI A;  2F9W A;  3H3O B;  3VOV A;  5J2M A;  3TAE A;  3H1V X;  3VQE A;  2KZM A;  3UKR A;  1NGD A;  3DXK B;  1N33 K;  1G99 A;  3WXI A;  5MLC Q;  2YJF A;  4IEE A;  5BPL A;  4HUE A;  4KFB A;  4C8L A;  2P9N A;  4YOU A;  2QWO A;  5BR9 A;  5J2P A;  3BZK A;  3A5L C;  4CIF A;  2HW3 A;  3Q7B A;  5BR8 K;  4Y1C A;  2A6A A;  3D45 A;  2KLA A;  3RVC A;  3J7A P;  1RDU A;  4B1Z A;  3V81 A;  4ELV A;  4M3Y A;  4BRI A;  4CHZ A;  2E8A A;  2FSK A;  4HWI A;  1ZBI A;  3QEI A;  4CGH A;  4O4G A;  4N5S A;  4IOA L;  3AVG A;  5KPR A;  4QCL A;  2IVP A;  4BRE A;  1TK8 A;  1T3V A;  2QXL A;  3D2F A;  1W2B M;  4B3M K;  2RE2 A;  1TKX A;  3T69 A;  4FJ7 A;  4MDA A;  5GIN A;  3SQ1 A;  1SAZ A;  4O8U A;  1NWK A;  3G71 N;  4CW7 B;  2D0B A;  3CMA N;  2GX9 A;  3PSF A;  2RPI A;  4KHP K;  4OPK A;  4YOT A;  2YI1 A;  2HHS A;  4FM0 A;  1ZXO A;  3NGZ A;  3NBP A;  4KHU A;  2G8K A;  2GUP A;  3ISN C;  3AA3 A;  3ZET B;  3DJC A;  4BR0 A;  3RMA A;  3QML A;  2YHB A;  4KKO A;  1VQ9 N;  5LMU K;  3DM2 A;  1X3N A;  2ZJP L;  3THV A;  1KFD A;  5FPE A;  3LAL A;  3L4I A;  1BO5 O;  1BOT O;  3P5J A;  3U9Z A;  4NCA A;  4M45 A;  3AGR A;  2ZQB A;  3CC2 N;  3CFO A;  1Q86 O;  1S1U A;  4Z4I A;  4KHW A;  1OH8 A;  2PY5 A;  4DU1 A;  3MEG A;  3ULE A;  1ZBL A;  1NOY A;  4B1V A;  4M3X A;  4B9L A;  4IZ9 A;  4X62 K;  5AZI A;  4BQL A;  5AQU A;  3VA3 A;  5CYM A;  1CXQ A;  2IAJ A;  3DAW A;  2E5L K;  3VET A;  3K5M A;  5AQV A;  1I94 K;  4W5O A;  3KVG A;  3ZCM A;  4B9T A;  5AFU A;  4LH5 A;  3ZLJ A;  1NM1 A;  2PYL A;  1S3X A;  1N36 K;  3LP2 A;  1VQN N;  1EWQ A;  4JS5 A;  1RT5 A;  3MN7 A;  4H0P A;  4IBN A;  4FM1 A;  1YIJ N;  2A1S A;  2I7P A;  3HPH A;  5FPD A;  3T7Z A;  4JKE A;  4FWL A;  3R3L A;  3FGU A;  1RDC A;  4E7K A;  5LJW A;  3HBT A;  3LDO A;  4H0X B;  4CGG A;  1IH7 A;  5AQK A;  3ZSW A;  4HVJ A;  1JCF A;  4DF4 A;  5GIP A;  5FRM A;  3VPZ A;  5KPZ A;  3HPO A;  4XH1 A;  3UKU A;  4PKG A;  2NRT A;  1GLB G;  3KLF A;  1BWF O;  3TAB A;  1DEJ A;  5FRO A;  2I5J A;  1SL0 A;  1J54 A;  1YAG A;  4E7J A;  3HPG A;  2P9I A;  4FVU A;  2OPS A;  3CCE N;  3VQ9 A;  1UA1 A;  2JLE A;  4OJR A;  4CJU A;  3QNO A;  3AVJ A;  3MWP A;  4JI1 K;  5AQJ A;  3EZ5 A;  3EO3 A;  1KAX A;  1HKG A;  4JHD B;  4FWS A;  2GEL A;  3D2E A;  4RW9 A;  2OPP A;  2QKB A;  1YIT N;  3SNN A;  4DFJ A;  2YNF A;  2JWL A;  3EZW A;  4I2P A;  3LZJ A;  4IXC A;  1VQ6 N;  2A40 A;  1QS4 A;  2E1Y A;  3K9J A;  5HRO A;  5C25 A;  1VRU A;  1EET A;  1NJW A;  4DR7 K;  5M1F A;  2WFB A;  2IS3 A;  4LFC K;  1T6C A;  1IKV A;  1NBW A;  4Z94 A;  4CK1 A;  4B9U A;  2DPN A;  2V7Z A;  1J53 A;  3VES A;  4HTU A;  3V9W A;  4CBX A;  1RIL A;  4DSK A;  1JXB A;  3R6M A;  1NGG A;  2NLX A;  1VSJ A;  2RKI A;  1JLQ A;  3LP1 A;  4G1Q A;  5BN9 A;  3C7N A;  4CJ7 A;  4KHS A;  4FK0 A;  4W5R A;  3VMF B;  3CJ7 A;  3CXC M;  4YOR A;  3MMV A;  3AY9 A;  1BIZ A;  4YOV A;  5KTQ A;  3HSC A;  4KI6 A;  3ZSY A;  1HKB A;  4DTR A;  2HMP A;  1YJN N;  1V4T A;  2XY6 A;  2PAV A;  4DU3 A;  4FZX C;  4WE1 A;  3NH0 A;  1T03 A;  5C42 A;  1RT3 A;  3LP0 A;  1KVA A;  3MED A;  3AA5 X;  2RN2 A;  3IUC A;  1U45 A;  2ZM6 K;  3JXU A;  1MDU B;  4CE9 A;  2P1J A;  2E2O A;  3HM9 A;  1QHT A;  1RGI A;  4JAX A;  3MX2 A;  2JWK A;  5SWM A;  2F7T A;  3TI0 A;  3CF5 L;  1DKG D;  3AVI A;  4KTQ A;  3V9Z A;  2B6A A;  3KKR A;  3NH2 A;  1JLE A;  4FWR A;  5FPN A;  1X9W A;  1ASW A;  1XHZ A;  4ZHR A;  4CJT A;  1EKE A;  2O8B A;  5LL6 Z;  4H5T A;  5AQT A;  4CZF A;  5EX5 A;  1HPZ A;  1TAU A;  4I6M B;  4TSX A;  1YUW A;  4JK8 A;  1N5Y A;  2P9U A;  3MX5 A;  4C1N I;  2CH6 A;  4CD1 A;  4AHT A;  3QIN A;  3OYF A;  2PBD A;  3BF3 A;  3HRG A;  3G0Z A;  4RWT A;  3KK3 A;  3B6O A;  3WUH A;  3FZL A;  1QQO A;  1HYS A;  2V52 B;  1WB9 A;  4LF8 K;  3SPZ A;  2OYQ A;  1HLU A;  1JLA A;  4C8N A;  2Y1J A;  2HHV A;  1U49 A;  1ZYQ A;  2ZWH A;  5CE3 A;  1W7A A;  3QFU A;  5I9E B;  3PUF A;  4CBW A;  1SUQ A;  5M1N A;  2F8T A;  4I6M A;  5ADX A;  5I42 A;  3MEE A;  3LP3 A;  4LSN A;  1TVR A;  3ID6 A;  4CZM A;  4LF4 K;  3CCS N;  4M7Y A;  2O8F B;  1GLE G;  2NRV A;  2P5G A;  4GNI A;  3L2Q A;  3V9S A;  3VEV A;  3BDP A;  4DTS A;  4BRH A;  2HNY A;  4OVL A;  2FF6 A;  4QOZ B;  3ATV A;  1FKO A;  4YDU C;  1KXP A;  3FZF A;  3LDN A;  2GWK A;  3O8M A;  5JS1 A;  1XUP O;  5BPN A;  3KWI A;  3O4Q A;  3HP6 A;  1VQM N;  3HP9 A;  1QVG M;  2IDO A;  1K8A O;  4H0T B;  1IV0 A;  2AP1 A;  1YVN A;  4B1W B;  4FJH A;  2O8F A;  1YXQ A;  2KFN A;  3ZX0 A;  4JI5 K;  1OH6 A;  2KKZ A;  3PO5 A;  4M3U A;  1QSL A;  2ZJR L;  4FK2 A;  5GAG P;  2F4V K;  1ZBS A;  3B8A X;  3SI6 A;  4WF9 L;  2PZS A;  2QEX N;  2I7N A;  3S3N A;  3ATU A;  4DU4 A;  3O1W A;  2OA8 A;  3ZX2 A;  1HJO A;  4I9L A;  4CJR A;  1Q9X A;  3CC7 N;  4CK2 A;  3SV3 A;  5FDL A;  2ZJQ L;  1MWK A;  4NYF A;  4LFB K;  3AAQ A;  5HRP A;  4B9Q A;  4CJQ A;  1FKP A;  1JL2 A;  4CZL A;  4CF0 A;  3AAR A;  5HLF A;  4AH9 A;  1K6Y A;  1ZBH A;  3SAH A;  1U2V B;  5C15 A;  3V6D A;  4BRG A;  4E7H A;  3PV8 A;  5HBM A;  2GWJ A;  2Q97 A;  4FLX A;  1GLA G;  1L5U A;  4FJ9 A;  4PWD A;  4YHH K;  3WQU A;  2ATQ A;  1IG8 A;  2XY5 A;  2NRR A;  3VQ8 A;  3H1Q A;  1LWF A;  4BRL A;  2YNG A;  3JYT A;  2WBN A;  3WNE A;  3ZT2 A;  2P9I B;  2P9L B;  4J2D A;  4CEO A;  4A62 A;  3K5N A;  3VEZ A;  4YFU A;  4BQZ A;  3MEC A;  1WLJ A;  1RNH A;  5K14 A;  2QWM A;  1C1A A;  2HB5 A;  1ATS A;  1TKT A;  2RF2 A;  3CME N;  4JI8 K;  2HHW A;  4JI4 K;  2W6L A;  4BY9 C;  4CJF A;  4DHY A;  4GMJ B;  4AHU A;  5KI6 A;  4CJP A;  3VA0 A;  1SL2 A;  3CCV N;  4KV8 A;  1BDG A;  5KGW A;  3U3Y A;  3SJJ A;  3OYI A;  3DXM A;  4HTL A;  4RW6 A;  1YJ9 N;  4FWK A;  3M8S A;  3AVN A;  3SMP A;  4FJI A;  4KI4 A;  4JK7 A;  3RMD A;  4A2A A;  4BRM A;  2HND A;  4PKH A;  3K5L A;  2UUC K;  4DV2 K;  2O8D B;  3KLI A;  4Z4G A;  5AJ3 K;  4FK4 A;  3WNG A;  1KLM A;  2HVI A;  2P9S B;  1EXQ A;  3E01 A;  2GEM A;  4WQ5 C;  1KCF A;  2ITM A;  3SLC A;  1VQ4 N;  4NXM K;  2HHX A;  2WOM A;  1QQC A;  2HMI A;  2WTU A;  3AO5 A;  4DFM A;  1N32 K;  5EY4 A;  3VEX A;  4JLH A;  1JCG A;  2JGU A;  4WQ5 A;  3HVR A;  1U2V A;  3OA9 A;  1WSH A;  3AO4 A;  2E88 A;  1HYZ A;  4CJS A;  2W40 A;  2G8W A;  3LDP A;  3SPY A;  3I8B A;  3PY8 A;  3OYD A;  3VEY A;  3NH1 A;  4DR2 K;  2G8I A;  4CHP A;  4BC2 A;  3TSP A;  2A3Z A;  3ZX3 A;  1BCO A;  3SQ0 A;  4Q0B A;  2UUA K;  3AA4 A;  3QBX A;  2CGL A;  3OYC A;  2DFF A;  2Q36 A;  4BGB A;  2VGN A;  3IMX A;  3QLH A;  3E9O A;  3THW A;  1NGA A;  4FZY A;  1A5X A;  1ZC6 A;  3MK6 A;  4DSE A;  1TYQ B;  3FZK A;  3ZSR A;  5HRN A;  4DQS A;  3RRH A;  5C2D A;  4JI7 K;  4V19 S;  1BU6 O;  3QEX A;  4L3Q A;  4DMN A;  2XO7 A;  2CGK A;  4WFA L;  1K9M O;  3R1X A;  3VTH A;  3DYA A;  3DLB A;  5CHI A;  3S41 A;  5BRF A;  1NJX A;  4FL9 A;  1X1P A;  4C8M A;  3C95 A;  1XC9 A;  1V4S A;  3OYM A;  4K0K K;  1REV A;  3K9K A;  3HZ6 A;  3ULE B;  4JEP A;  4C1N K;  3K5O A;  4MLH A;  3UIQ A;  3HK2 A;  2YHA A;  3RMB A;  1Q18 A;  2Q0R A;  4PKI A;  4ILH A;  5F0X A;  2FBY A;  5JVH L;  3DMJ A;  2UUB K;  5B8H A;  3THW B;  5IWA K;  4CZG A;  4YNQ A;  2X6S A;  4FLU A;  4NCG A;  4FZZ A;  5KQD A;  3S9H A;  4E19 A;  3GE1 A;  1XMQ K;  3V9U A;  3BUZ B;  4WCE L;  1BQM A;  3HTV A;  4H5V A;  3C94 A;  1VHX A;  4DSF A;  2QM1 A;  5F1X A;  1NJI O;  2VYP A;  2VWB A;  1JL1 A;  4CJK A;  3DLG A;  3KK7 A;  1VSI A;  4G9Z A;  4B9V A;  4O5B A;  3KLE A;  1B9F A;  1JLB A;  3VGM A;  3GL1 A;  1FXX A;  4ICL A;  4Z0U A;  5GAD P;  2CGJ A;  4JI2 K;  4CZI A;  3ZT4 A;  4DQP A;  1S72 N;  1IJJ A;  4FW1 A;  2VWK A;  3A2F A;  4K8Z A;  1IKY A;  4FO0 A;  3DOK A;  5C10 A;  3E66 A;  3TR8 A;  4ISE A;  1FJG K;  3S3O A;  1ILY A;  3QDK A;  3T1A A;  4N76 A;  2NNW A;  3OJS A;  1WBB A;  4F8R A;  3O4W A;  4CER A;  3NVM A;  1G15 A;  2UXD K;  4MLE A;  4F2S A;  2BTF A;  4IWV A;  2W42 A;  1WSI A;  1NU0 A;  4FJX A;  4CIG A;  2HST A;  3JS6 A;  5AQL A;  4B3S K;  1XI1 A;  2QW9 A;  5F2R A;  4OO1 J;  4AQY K;  3E9P A;  3ENH A;  4BAC A;  2ZGZ A;  2YJE A;  1HX1 A;  3LAK A;  4B3T K;  2D0P A;  3JAM O;  2XHB A;  3OBY A;  3ZSQ A;  3NF7 A;  3QIC A;  3L4Q A;  3ZET A;  1JLG A;  3C6A A;  4DS5 A;  4PL7 A;  4DSL A;  1S6P A;  3H45 C;  2FC0 A;  3DLR A;  4WFB L;  4DQI A;  1T8E A;  1SKR A;  5KQ8 A;  2YHW A;  3TAQ A;  5CZ2 A;  3L3U A;  3O80 A;  4A57 A;  3K57 A;  2VG6 A;  3C6U A;  1NJZ A;  4DV4 K;  5JS2 A;  1K8K A;  1RDD A;  1EO1 A;  5AZI B;  3DI6 A;  3CM5 A;  2VWJ A;  2FBV A;  2IOC A;  2Z1H A;  4FOE A;  5AQF A;  5AZJ B;  1RT1 A;  3C6T A;  1XNR K;  4BDY A;  1RDW X;  4BC4 A;  3HJF A;  3HVT A;  3FR0 A;  1U04 A;  3VQ4 A;  4LF9 K;  1BIS A;  4ELT A;  2A5X A;  4LFA K;  1IKX A;  2EHG A;  1NK5 A;  1KVB A;  2OTJ N;  1Q8I A;  3CJC A;  1JLC A;  1HNV A;  1RBV A;  1RTD A;  4JKF A;  1TKZ A;  3M8P A;  3THY B;  4OLB A;  4LC9 B;  2UXC K;  4DR4 K;  4DTX A;  3A0I X;  3SQ4 A;  4NXN K;  4QS7 A;  4MDB A;  3CQ8 A;  2A41 A;  3O9S A;  1IBL K;  4CGF A;  3FZM A;  3H3N O;  4DV7 K;  3LM2 A;  2QTD A;  1TKD A;  4WFN L;  3I8D A;  4FWP A;  3TTC A;  2VQE K;  3QB0 A;  1RBR A;  1CZA N;  5CY4 A;  4LF7 K;  4FWO A;  3A5N C;  4DV5 K;  4B1Y B;  3RWU A;  3I55 N;  1VSL A;  4FJM A;  4IJA A;  2E20 A;  1YT3 A;  3CG7 A;  4K41 A;  3TTF A;  2BE2 A;  2OPR A;  2YNI A;  5HRR A;  2P9K B;  5SZT A;  3EY1 A;  4FSV A;  2HBL A;  4BR2 A;  3C0B A;  5AQS A;  3WNH A;  3R9P A;  4DR5 K;  3MXM A;  3KKS A;  1D9F A;  3C6H A;  4XH4 A;  1NK7 A;  2D1K A;  4A5B A;  2V51 B;  3MAQ A;  3MN6 A;  3J80 O;  3CPW M;  3ENB A;  3U3G A;  1KAZ A;  3HO1 A;  1VQO N;  1IKW A;  4E1N A;  4F9O A;  5AQR A;  3V9X A;  1W9H A;  4RTF D;  3QET A;  4QS8 A;  3M3Z A;  3AVF A;  1SQK A;  1S5J A;  3HOT A;  4WQ4 A;  1WSF A;  1HJR A;  3SQ2 A;  5AQM A;  4CK3 A;  3J7Y P;  3VF2 A;  2DFE A;  3NF6 A;  5BRE A;  4W5T A;  3VF4 A;  4M3R A;  1E4F T;  2E2P A;  4WQ4 C;  3ZT0 A;  3L0Q A;  1J6Z A;  3KJV A;  3WXL A;  2E2N A;  3AVK A;  1WAF A;  2ZF5 O;  3L3V A;  4CJV A;  2O4G A;  4Z4H A;  2Q0U A;  3OJU A;  3UB5 A;  2W41 A;  4BRA A;  1OKJ A;  3O5B A;  1ITG A;  2O8D A;  2VG5 A;  4J2E A;  2OZM A;  1MA9 B;  5AQG A;  2X6N A;  4CJ3 A;  3M6G A;  3VQA A;  1TAQ A;  4KH5 A;  4ILJ A;  3VEW A;  5HRS A;  4B1U B;  1SZ2 A;  4MQ3 A;  1KSP A;  4BR4 A;  1UA0 A;  3OYJ A;  4FJL A;  2FBX A;  5BRD A;  1BQN A;  4BRF A;  4FJN A;  4PQU A;  3ZSV A;  3F5T A;  2GUI A;  3NVK A;  4NLC A;  3NF8 A;  3SMS A;  3RTV A;  5J2Q A;  2Z1J A;  4CVN E;  3KLG A;  1VSH A;  3VQ7 A;  4NB4 A;  2KZZ A;  4E0D A;  1VSD A;  3FFI A;  3AVC A;  4B8C A;  1IBK K;  4FLV A;  1KQS M;  3KZB A;  4KTW A;  3V4I A;  3SUQ A;  1NG9 A;  5AQP A;  5LMN K;  1Q82 O;  4LF6 K;  1J9A A;  2OTL N;  4B9N A;  2HBK A;  4QS9 A;  3P39 A;  1DTQ A;  3O9T A;  1WBD A;  2Z1G A;  2QWN A;  4CHY A;  3LWM A;  1NKB A;  4CHQ A;  4YY3 K;  3NHG A;  3QNN A;  3UKR B;  4O44 A;  4J2B A;  2X78 A;  5IT9 O;  4H8K A;  4OGC A;  3VER A;  4CF9 A;  2IGI A;  2KTQ A;  3CCM N;  1BI4 A;  3W3D A;  4QAG A;  4JRP A;  3OHR A;  3CET A;  4X64 K;  4NLB A;  4BC3 A;  4PHT X;  3KTQ A;  3KWG A;  3L2U A;  3THX B;  3IRX A;  3SK3 A;  4CZK A;  4IFY A;  4F3O A;  2Z1I A;  1UWB A;  1T05 A;  4O8K A;  5BRH A;  1RBU A;  4CED A;  2Y1I A;  1YF5 L;  3TTD A;  4BR9 A;  4YOY A;  2BAN A;  1BGX T;  3NMU A;  5HP1 A;  5C24 A;  2G8V A;  1ATR A;  4H0V B;  1Z25 A;  3OYB A;  1LW2 A;  4FLT A;  4BG9 A;  3VN5 A;  1ESV A;  3SJH A;  1VQP N;  5DMR A;  4AHS A;  4AHR A;  4OKJ A;  4CFD A;  3NGI A;  4YOW A;  2P9K A;  2ZGY A;  1NK4 A;  1O1W A;  4DQ8 A;  1IBM K;  4ILG B;  3TAN A;  4Q5V A;  1HNX K;  4W5Q A;  1C1C A;  1U6Z A;  4FLW A;  4KH4 A;  4CJ4 A;  1RTI A;  3HL8 A;  2UXB K;  1SV5 A;  2GBZ A;  3LM9 A;  4DTJ A;  1OVQ A;  1VSK A;  1XNQ K;  2V7Y A;  4BDP A;  1XHX A;  3QFP A;  3ZSX A;  4KHN A;  2QWQ A;  4DV1 K;  1NKC A;  4CJW A;  3PIO L;  3MCA B;  3CFR A;  1KFS A;  3M8Q A;  3O9U A;  4IOX A;  3K59 A;  3CJ1 A;  4CJ5 A;  5JVG L;  1S1X A;  4LY7 A;  3TSQ A;  4DFK A;  1S6Q A;  1Q9Y A;  3LAN A;  4PL8 A;  1ZBU A;  1WSJ A;  5I3U A;  4B08 A;  4A5A A;  2NZT A;  4LD0 A;  2KW4 A;  1QTM A;  1KTQ A;  3K0S A;  4CEA A;  3IKM A;  1R0A A;  4M3T A;  4CGD A;  2ASP A;  2DFH A;  3V1O A;  1NGC A;  3SUN A;  4E7L A;  4CFC A;  3UKU B;  2IVO A;  3O4N A;  4JYA K;  3QIO A;  1KRP A;  2WUS A;  3LPU A;  3NCI A;  3SYZ A;  4CZJ A;  1L3S A;  4BRD A;  4FLZ A;  1R59 O;  4DB3 A;  1JXE A;  1H1V A;  1U47 A;  4EP4 A;  4OLA A;  3QEW A;  4BVO A;  4A2B A;  1B92 A;  1SKS A;  4I7F A;  1GLJ O;  4FPB A;  2YV0 X;  1I3A A;  3JSM A;  4KHQ A;  1VQK N;  3EEQ A;  3QEV A;  1KD1 O;  4CFA A;  2HHT A;  2BGG A;  3IG1 A;  3WXJ A;  1QSS A;  1X9M A;  3GDQ A;  5AFU H;  2HF3 A;  3FFK B;  2NRZ A;  2HBM A;  1LOT B;  1QE1 A;  4DUY K;  3OYL A;  2X74 A;  4FWQ A;  4HCC A;  4O55 A;  2A1R A;  4DTU A;  5E84 A;  5JMV A;  1ATN A;  1C0F A;  4B3R K;  1XWL A;  1NOZ A;  5AQQ A;  2P9N B;  4GKJ K;  3VGL A;  2AJQ A;  3MWT A;  4XH5 A;  4N41 A;  5GAH P;  4DLE A;  2AA4 A;  3RSE A;  3CD6 N;  3MN9 A;  4BRQ A;  3T1Y K;  2HOE A;  4MO4 A;  3A5M C;  4EIA A;  4JI6 K;  4CD3 A;  3TU5 A;  4DQQ A;  1W0H A;  3M8R A;  4DTM A;  4ZTJ A;  4PY5 A;  1LAW A;  1Q81 O;  1HYV A;  5AQH A;  3CHW A;  4CGI A;  2QWP A;  5EU7 A;  4CIE A;  5GAE P;  1MU2 A;  1LV5 A;  5KRS A;  3CFP A;  1S22 A;  3AVM A;  3J7Z O;  3WQT A;  3VQD A;  4J8F A;  2QWL A;  4KAZ A;  1P8Z A;  1RTH A;  4U7B A;  3CCQ N;  4KRE A;  3RRG A;  1VSM A;  4DUZ K;  1K73 O;  1VSE A;  4BVP A;  1A5W A;  4W5N A;  4ISG A;  5AQN A;  1NMD A;  4E7I A;  3OY9 A;  1BG3 A;  3P38 A;  4DCH A;  2FBT A;  4M63 C;  2DY4 A;  1S1V A;  3O3G A;  3LPT A;  3OYK A;  5KGX A;  3DLK A;  1NK6 A;  1RFQ A;  5C0Y A;  3LL3 A; 
#chains in the Genus database with same CATH homology
 4JKG A;  3QBW A;  3R6M A;  1NGG A;  2NLX A;  3D6R A;  4H0O A;  4JNE A;  5EVZ A;  3C6A A;  5BN9 A;  2ASM A;  1E4G T;  1D4X A;  4PL7 A;  3C7N A;  4CJ7 A;  4BG8 A;  2P9S A;  1DT9 A;  2QI2 A;  3H45 C;  3VMF B;  3CJ7 A;  5KPT A;  4RCH A;  4YOR A;  1NGF A;  3MMV A;  4WFB L;  3CXC M;  3AY9 A;  3ZEU B;  5AQW A;  5KQ8 A;  2YHW A;  4YOV A;  3HSC A;  4CZH A;  3DLL L;  3CIP A;  4FOI A;  4A57 A;  3O80 A;  4U67 L;  1HKB A;  2HMP A;  1YJN N;  1V4T A;  2PAV A;  4IFE A;  1YI2 N;  1K8K A;  4CI6 A;  5C2F A;  3IDH A;  1EO1 A;  2ASO A;  5AZI B;  3WT0 A;  4BRC A;  4EFH A;  4C23 A;  4IO8 A;  3IUC A;  1X3M A;  3G25 A;  4FOE A;  5AQF A;  3JXU A;  5AZJ B;  4H5N A;  3I56 N;  3M5R A;  3CQX A;  1MDU B;  3OBW A;  2IVN A;  1RDW X;  4BC4 A;  3CCJ N;  4IO9 L;  2E2O A;  4IJN A;  3FR0 A;  1QZ6 A;  3ID8 A;  1RGI A;  4JAX A;  3MX2 A;  3ZET A;  2A5X A;  2A42 A;  2JWK A;  2F7T A;  3CF5 L;  1DKG D;  2P9L A;  3C7N B;  2OTJ N;  2Q2R A;  3CJC A;  5M1P A;  4FWR A;  5FPN A;  1HKC A;  3EL2 A;  4CZE A;  1BA1 A;  4JKF A;  2Q31 A;  3OW2 M;  3CJB A;  3A8Y A;  4H5T A;  4LC9 B;  5AQT A;  4CZF A;  5EX5 A;  4JKD A;  4I6M B;  3A0I X;  4BC5 A;  4CBU A;  2E1Z A;  3J8A A;  1YUW A;  4DKW A;  3MDQ A;  4JK8 A;  4QS7 A;  2F9T A;  3VEO A;  3WXK A;  2H3G X;  1DGK N;  4MDB A;  1VQ8 N;  2A41 A;  4GY2 B;  2P9U A;  3MX5 A;  3O9S A;  2CH6 A;  4C1N I;  2QWR A;  5GIO A;  4CD1 A;  5ELZ A;  2D4W A;  3FZM A;  3HI0 A;  4H5R A;  3H3N O;  3BEX A;  1M90 O;  4K25 A;  1T6D A;  2VCP A;  3G4S N;  3LM2 A;  2QTD A;  2PBD A;  4WFN L;  3BF3 A;  3SBG A;  3HRG A;  1Y64 A;  3O08 A;  4FWP A;  3TTC A;  4JKA A;  5BPM A;  4RWT A;  1XC3 A;  3WUH A;  3FZL A;  3C65 A;  1QQO A;  3QB0 A;  3SAF A;  2V52 B;  4YOX A;  1CZA N;  1BA0 A;  3VEN A;  1BUP A;  1KC8 O;  1HLU A;  1OVY A;  4FWO A;  3A5N C;  1VAZ A;  3CI5 A;  4K42 A;  4JKG B;  4B1Y B;  5BN8 A;  2ZWH A;  3PIP L;  5CE3 A;  1W97 L;  4BGA A;  2D0O A;  3I55 N;  2NRX A;  3QFU A;  2Q1N A;  4IJA A;  5I9E B;  3U4L A;  4CBW A;  5M1N A;  3F2K A;  1QVF M;  4IDH A;  2E20 A;  4K41 A;  4I6M A;  3TTF A;  4BRO A;  5ADX A;  1YJW N;  1YHQ N;  2P9K B;  3RSE B;  4FSV A;  2HBL A;  2EWS A;  3C0B A;  1MWM A;  4BR2 A;  5AQS A;  4FPA A;  3ID6 A;  3R9P A;  4CZM A;  3CCS N;  4M7Y A;  5TKY A;  2P9P A;  1GLE G;  3SAG A;  2NRV A;  3C6H A;  4XH4 A;  2D1K A;  4A5B A;  2V51 B;  5H1S Q;  1GLD G;  1TUU A;  2YX6 A;  3MN6 A;  4GNI A;  4H03 B;  3ZYY X;  3CPW M;  3VEV A;  3ENB A;  1Z6R A;  1KAZ A;  1GLC G;  1TYQ A;  1VQO N;  1QQN A;  5AQI A;  3G6E N;  4BRH A;  3N4Q A;  4F9O A;  5M1Q A;  5C12 A;  2BH1 A;  5AQR A;  4A61 A;  5AZJ A;  5JLF A;  2FF6 A;  3LDL A;  4RTF D;  3CPE A;  4QS8 A;  3M3Z A;  3FLC O;  3IFR A;  3ATV A;  1SQK A;  4YDU C;  2FLO A;  1KXP A;  5HOO A;  3FZF A;  1P90 A;  3HOT A;  4WQ4 A;  3LDN A;  2GWK A;  3O8M A;  1XUP O;  5BPN A;  5AQM A;  3KWI A;  3VF2 A;  4JKC A;  1VQM N;  5BRE A;  1TUY A;  3BF1 A;  4GV9 A;  5DM7 L;  1QVG M;  1KAY A;  4E1J A;  3VF4 A;  1E4F T;  2E2P A;  1K8A O;  4NO7 A;  4H0T B;  3EKS A;  4FWM A;  4WQ4 C;  1YVN A;  2AP1 A;  3WEE A;  1NGJ A;  3AAP A;  1J6Z A;  3E9L A;  3L0Q A;  5AQX A;  4EHT A;  5M1K A;  4B1W B;  3WXL A;  5LJV A;  2E2N A;  2ZF5 O;  2FSJ A;  4AF1 A;  1YXQ A;  2Q0U A;  2GTD A;  3ZX0 A;  3GG4 A;  2W41 A;  3UB5 A;  4BRA A;  2QA4 N;  2FSN A;  1OKJ A;  2KKZ A;  3O5B A;  1WUA A;  3O6W A;  4O5F A;  3F9M A;  4Y0W A;  2CH5 A;  3O9Q A;  1MA9 B;  4GVE A;  2ZJR L;  5GAG P;  4JD2 A;  4UY8 O;  2VGM A;  5AQG A;  3CJA A;  1ZBS A;  3ENO A;  3B8A X;  3M6G A;  4WF9 L;  3H6E A;  4R79 A;  3KHY A;  2QEX N;  2I7N A;  3MCP A;  3DXK A;  4KH5 A;  4ILJ A;  4GV6 A;  3ATU A;  3VEW A;  3O1W A;  3GOI A;  1SZ2 A;  4H5W A;  4B1U B;  5FPM A;  3ZX2 A;  1HJO A;  3FE1 A;  4BR4 A;  2HBJ A;  1X9J A;  5BRD A;  1LCU A;  3CC7 N;  5ADX H;  4BRF A;  2ZJQ L;  1MWK A;  3TSU A;  3F5T A;  2YHX A;  1C0G A;  5CR4 A;  4M7X A;  3NVK A;  4NLC A;  3AAQ A;  3SMS A;  4BRK A;  4B9Q A;  1QZ5 A;  1QQM A;  5EXW A;  3DWL A;  4CZL A;  2FXU A;  3N4P A;  4NB4 A;  2NRH A;  4WYB A;  4EAH D;  2NRW A;  4OPA A;  3AAR A;  1VQ5 N;  1O13 A;  2F9W A;  3H3O B;  3VOV A;  3SAH A;  1U2V B;  5C15 A;  1Z05 A;  4BRG A;  3DXM B;  2OAN A;  1KQS M;  1XQS C;  3KZB A;  3H1V X;  2GWJ A;  3UKR A;  3D2F B;  2Q97 A;  1GLA G;  1NGD A;  5AQP A;  3VF6 A;  3DXK B;  1Q82 O;  3WQU A;  2OTL N;  1IG8 A;  2HBK A;  4QS9 A;  3P39 A;  1G99 A;  3WXI A;  2NRR A;  2YCH A;  3H1Q A;  4AM6 A;  5MLC Q;  2YJF A;  4IEE A;  4BRL A;  5BPL A;  3O9T A;  2WBN A;  5JIC A;  2P9N A;  4YOU A;  4IEI A;  2UYT A;  2QWO A;  2QWN A;  1NLV A;  5BR9 A;  1T44 A;  3A5L C;  2P9I B;  3Q7B A;  2P9L B;  3TPQ A;  1VQL N;  2A6A A;  4A62 A;  2KLA A;  3VEZ A;  3P4I A;  3RVC A;  1RDU A;  4B1Z A;  4BQZ A;  3UKR B;  2QWM A;  4BRI A;  1ATS A;  1WOQ A;  2YHY A;  3CME N;  2E8A A;  2FSK A;  4HWI A;  5AQY A;  4BRN A;  4IOA L;  3VER A;  4BY9 C;  3LDQ A;  4DHY A;  5KPR A;  3CCM N;  3CCV N;  1BDG A;  1JJ2 M;  4H0Y B;  3W3D A;  5HL7 L;  2IVP A;  3EE9 A;  4BRE A;  3OHR A;  3D7E O;  3DXM A;  1T3V A;  2QXL A;  3MN5 A;  3CET A;  3D2F A;  1W2B M;  3GBT A;  4HTL A;  4NLB A;  4BC3 A;  4PHT X;  2RE2 A;  3T69 A;  1YJ9 N;  4JKH A;  4MDA A;  4FWK A;  3CER A;  5GIN A;  1SAZ A;  4O8U A;  3KWG A;  1NWK A;  3SK3 A;  3SMP A;  3G71 N;  4CZK A;  3CMA N;  3A5O C;  1M1K O;  4FWN A;  2GX9 A;  4JK7 A;  4A2A A;  4O8K A;  4BRM A;  5BRH A;  4YOT A;  4PKH A;  2YI1 A;  3PLA A;  4EHU A;  1ZXO A;  2WC9 A;  1YF5 L;  3TTD A;  4B1X B;  4BR9 A;  4YOY A;  3CQY A;  3NMU A;  3I33 A;  2GUP A;  3ZET B;  2KHO A;  1ATR A;  3DJC A;  4BR0 A;  4H0V B;  3CCL N;  3QML A;  4BG9 A;  1VQ9 N;  2P9S B;  1ESV A;  3SJH A;  1VQP N;  1X3N A;  2ZJP L;  2GEM A;  2FF3 B;  4WQ5 C;  5FPE A;  4YOW A;  2P9K A;  2ZGY A;  2ITM A;  3SLC A;  1VQ4 N;  4DQ8 A;  4ILG B;  5LY3 A;  3CCU N;  3L4I A;  1BO5 O;  1BOT O;  4K43 A;  1U6Z A;  5EY4 A;  3U9Z A;  3VEX A;  1VQ7 N;  4KH4 A;  1JCG A;  3AGR A;  4WQ5 A;  3W0L A;  1U2V A;  3OA9 A;  4XEI A;  3CC2 N;  3LM9 A;  2E88 A;  1Q86 O;  2E2Q A;  2V7Y A;  3VTI A;  2W40 A;  5DM6 L;  3LDP A;  3QFP A;  3M1F A;  3I8B A;  3ULE A;  3VEY A;  4B1V A;  2QWQ A;  4BC2 A;  4IZ9 A;  3TSP A;  2A3Z A;  3ZX3 A;  3PIO L;  3MCA B;  1HPM A;  5AZI A;  4BQL A;  5AQU A;  1HUX A;  4JKB A;  3QBX A;  3O9U A;  2CGL A;  3CJ9 A;  3CJ1 A;  4IOX A;  4ISF A;  5E26 A;  3DAW A;  1NGI A;  2Q36 A;  2VGN A;  3IMX A;  3VET A;  3E9O A;  4BGB A;  1NGA A;  5JVG L;  2P9U B;  5AQV A;  3TSQ A;  3VGK A;  3U9D A;  1ZC6 A;  4PL8 A;  3MK6 A;  3L4Q A;  1TYQ B;  3FZK A;  2PFU A;  4YDU A;  4A5A A;  2NZT A;  5C2D A;  3KVG A;  4JD2 B;  1BU6 O;  5AFU A;  3HM8 A;  3IKM A;  4L3Q A;  5AR0 A;  1NM1 A;  2CGK A;  4WFA L;  1K9M O;  3R1X A;  2ASP A;  1NGC A;  1S3X A;  4JN4 A;  4OPH A;  3VTH A;  5CHI A;  3S41 A;  1VQN N;  5BRF A;  4FL9 A;  1Q7Y O;  3FZH A;  3MN7 A;  4H0P A;  1YIJ N;  4JK9 A;  3UKU B;  2IVO A;  1V4S A;  3HOS A;  2I7P A;  5AQZ A;  2WUS A;  5FPD A;  4CZJ A;  3K9K A;  3HZ6 A;  3ULE B;  3T7Z A;  4JEP A;  4BRD A;  3O9R A;  4JKE A;  1R59 O;  3E1Y A;  4FWL A;  3R3L A;  3FGU A;  4MLH A;  4C1N K;  4DB3 A;  1H1V A;  5LJW A;  2HF4 A;  3HBT A;  4BVO A;  4A2B A;  3LDO A;  1Q18 A;  2Q0R A;  4PKI A;  4H0X B;  4ILH A;  5F0X A;  1GLJ O;  5AQK A;  5JVH L;  4MO5 A;  4FPB A;  1JCF A;  3O1B A;  4BR7 A;  5B8H A;  5JLH A;  4CZG A;  5GIP A;  1VQK N;  3VPZ A;  5KPZ A;  1KD1 O;  1JCE A;  4XH1 A;  3D2E B;  3WXJ A;  1N8R O;  5KQD A;  3GDQ A;  3GE1 A;  1SS6 A;  3UKU A;  5AFU H;  2HF3 A;  3FFK B;  4PKG A;  2NRZ A;  2NRT A;  3BUZ B;  2HBM A;  1LOT B;  3EKU A;  3HTV A;  3SBT A;  1GLB G;  4H5V A;  4WCE L;  1BWF O;  2QM1 A;  5F1X A;  1NJI O;  2VYP A;  2J4R A;  2VWB A;  4FWQ A;  5TKW A;  3EN9 A;  1GLL O;  3KK7 A;  1DEJ A;  5E84 A;  3H46 O;  5JMV A;  1ATN A;  1C0F A;  2IIR A;  3WXM B;  4G9Z A;  5AQQ A;  4BR5 A;  1YAG A;  2P9N B;  2P9P B;  3VGL A;  5EOY A;  3VGM A;  3MWT A;  3GL1 A;  4XH5 A;  5GAH P;  2P9I A;  5AQO A;  4FVU A;  2AA4 A;  3CCE N;  5GAD P;  3RSE A;  2CGJ A;  3CD6 N;  4CZI A;  3MN9 A;  4BRQ A;  3L6Q A;  1EQY A;  3UE5 A;  3WEE B;  2HOE A;  4MO4 A;  3A5M C;  4A59 A;  4EIA A;  4CD3 A;  1S72 N;  1QHA A;  3TU5 A;  1IJJ A;  3MWP A;  3CCR N;  1NGH A;  5AQJ A;  1NGB A;  1Q81 O;  3EO3 A;  1KAX A;  1HKG A;  4FO0 A;  3Q7C A;  5AQH A;  3CHW A;  2QWP A;  4JHD B;  4FWS A;  2GEL A;  4AM7 A;  3P31 A;  5GAE P;  5C10 A;  3D2E A;  3E66 A;  4ISE A;  5M1O A;  1ILY A;  3QDK A;  1S22 A;  2NNW A;  3U8X A;  3BP8 A;  1YIT N;  3J7Z O;  3O4W A;  2JWL A;  3WQT A;  3EZW A;  4J8F A;  2QWL A;  3NVM A;  4IXC A;  1P8Z A;  1VQ6 N;  2A40 A;  3ZEU A;  3CC4 N;  4BRP A;  4U7B A;  4MLE A;  3CCQ N;  2E1Y A;  3K9J A;  1GLF O;  4IOC L;  4GV3 A;  1NGE A;  1K73 O;  1K8K B;  2BTF A;  4IWV A;  3R8E A;  4BVP A;  4KBO A;  5M1F A;  2WFB A;  4ISG A;  5AQN A;  2BUP A;  4JHD A;  1NMD A;  2HST A;  1T6C A;  3JS6 A;  5AQL A;  2QW9 A;  5F2R A;  1BG3 A;  4OO1 J;  1NBW A;  3E9P A;  3P38 A;  4DCH A;  4M63 C;  3ENH A;  4Z94 A;  2ZGZ A;  2YJE A;  1HX1 A;  2DPN A;  2V7Z A;  3VES A;  2RHK A;  2D0P A;  4CBX A;  3AGK A;  1RFQ A;  3OBY A;  3QIC A;  5C0Y A;  4KH6 A;  3LL3 A;  3EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...