1LWEA

Crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKSTKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 134
structure length 542
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lweA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lweA05
2Z1HA 1HMVB 3PX0A 1C1CB 3VQ6A 4Y1CA 2FLNA 2HHXA 3DRSB 4QPXA 4DL2A 1VSFA 1TKXB 2XCPA 1S6PB 3CJ4A 4ZVFA 2WTFA 1X9SA 1TL3A 1HNVB 3E51A 4M42A 3L2WA 3V1OA 5JS2A 1D9DA 1K1SA 4CFAA 4CF2A 4DSIA 5SWMA 3C95A 4Y1DA 1BCOA 2FVPA 4HYKA 3VQCA 2B4JA 4HVJA 1BCMA 3M8QB 2X6SA 3HYFA 3CFPA 2G8WA 2OPPB 3QGGA 2AJQA 3KKSA 2F8EX 1SKSA 4CJSA 1QAIA 1DTTB 1MU2B 3GIJA 1OS5A 4KB0A 4CIFA 4DLEA 5KTQA 3PHEA 3CO9A 1KVCA 3VQ7A 1T03A 3FFIA 3ZSXA 3MEEB 4RW4B 2IC3B 1S1WA 2KZZA 3OYLA 5F8JA 4TYBA 4OLBA 4I2QB 4Z4FA 3CM5A 3ZSWA 3OSPA 4LSNB 3ZT2A 1RAJA 5FRMA 3SV3A 3RR8A 1NKBA 3CJ0A 1RTIB 2HVHA 4E7KA 4KHQA 4DQRA 1QHTA 1RT1B 2GBZA 3MEGA 3QEIA 3VQ9A 4EYHB 4TN2A 4DSFA 4NCGB 3DLKA 2BANB 3CG7A 3NF8A 3OYAA 5L1JA 3BSCA 2HNDA 4CGHA 3PUFA 4M3UA 5C5JA 2V4RA 2HW3A 4ECVA 2B6AB 2ZD1B 1IM4A 3DI6B 3M9NB 1JLCA 4FLVA 3LDSA 4TQSA 5L1LA 1HQEA 1YVFA 5KFNA 2XGQA 4Q8EA 2WHOA 1HNIB 2HHWA 4J9SA 4DTOA 3DMJA 3E01B 3AO2A 4JV2A 3KK2B 1VSHA 2JEIA 1CLQA 1VSDA 3AVNA 2Y1IA 1JLFB 3CIZA 4DL6A 5KRSA 2YNIB 5KFXA 1WN7A 1TVRB 4ZHRB 3MTKA 5J2MB 5KFWA 3DRRB 3ULDA 2DY4A 3ITHA 2YV0X 3H5SA 4Q0BB 3Q8PB 2DPIA 1NJXA 1XHXA 2JEJA 4FLXA 4DTNA 4YR0A 1SL1A 1S6QB 3DOLA 4URGA 3HO1A 3NBPB 4DFPA 4CHOA 4Z0UA 3OYIA 4K4VA 1JKHA 5JUMA 3P5JA 3QGHA 3MR2A 1RT4A 4K4TA 5F8HA 5EU7A 1VSJA 1K1QA 3D28A 3DLRA 5F8LA 5HRPA 4DTMA 3MXMA 2ASDA 4ELTA 4J9NA 3O3FA 3BSNA 4CK2A 4CE9A 5CYQA 1WSHA 2VG5B 4HCCA 2XCAA 2PZSA 1BISA 4O55A 3KOAA 4ELUA 3FQLA 3O4NA 3EPGA 4CJ4A 4QCLA 4W5OA 4FM0A 2I5JB 1VSKA 5KFOA 4OJRA 3CYMA 2HNZA 4CHQA 4AHTA 1RT2A 5DK5A 4J9PA 3LPUA 4C8LA 4L8RB 3OYMA 2D3ZA 4NYFA 4B9SA 1S1UB 1C0TA 2BQUA 1KLNA 3H5YA 3TI0A 3QYYA 1GX5A 5EWGA 1HYVA 2BDPA 4ICLA 3SUPA 4ECYA 3CDUA 4ZP8A 4JLHA 1W25A 3QEPA 4WYWA 1WNEA 3SQ0A 4FJ9A 2EHGA 4NLVA 3M9OB 3M8SA 1KHVA 1TK5A 4HTUA 3HVAA 1N6QB 5DGAA 3HXMA 4R8UB 4G3IA 3VQEA 1U4BA 3OS0A 3JSMA 3C6UB 4E3SA 4DFKA 4DSEA 4CF8A 2IAJB 1EETB 3K58A 4DQPA 3NKYA 4OL8A 4IQXA 4Q8FA 2YHBA 5KT3A 4ECWA 1C2PA 3PW2A 1NHUA 5DG9A 3RBEA 2FJWA 5F8MA 3VQAA 1S1VB 5I3UA 2YHAA 5HBMB 4FJGA 2KFZA 3BJYA 4MKBA 1VSLA 5KT2A 3PJXA 5KGXA 3H2LA 3NMAA 3OJSA 2E4LA 3KLFA 3KIOA 1I3AA 1LWCA 3IG1A 4JRPA 3DOKA 4NLWA 1LW0B 1S0NA 2OPSA 4B8CA 4CIGA 1IKYB 3SCXA 4MFBB 4M3WA 3K5OA 3TR8A 3ZT4A 3QETA 4KB7A 4M3YA 1RYSA 1KLMB 1XR6A 4F2RA 5J2QB 1J5OB 3TQ1A 1RT7B 5KT5A 1QAJA 4F50A 4RW7B 5KFDA 2NUBA 4DS5A 4FK2A 2R2SA 3V6DB 3RBDA 3V9SA 3SJJA 2XRIA 4B9UA 1UAXA 1ASVA 4IR9A 5EDWA 4H4OA 4F2SA 2FVSA 3AVLA 1JLEA 4I7FB 3LP3A 1IH7A 1ZBUA 5F9NA 1TGOA 2OPQB 3TABA 4J2DA 4JS4A 4W5NA 4RNNA 1J9AA 2O4GA 1VSIA 1YTAA 3V1QA 5CZ1A 2OYQA 1ZETA 3MR6A 2VWJA 4CEZA 3SZ2A 1JL1A 4NLPA 3MR5A 4DTSA 3PW7A 3PVXA 4QWEA 4DL3A 2IGIA 5KT4A 1TL3B 4CHYA 3SI8A 1Z26A 1IKVA 4MQ3A 3V6HA 1HYSA 4CJTA 2Q3SA 1LW2A 4WXOA 5DLFA 3IN5A 4RNFA 2HHTA 2QK9A 1S4FA 3IS9A 2UVUA 2YNFA 4IH5A 3L2VA 4B9MA 3OYGA 3AO4A 1R0AA 4O3NA 3AVIA 5KFVA 1O1WA 2IM1A 2XY5A 3BQ1A 4M3TA 1RTDA 2XC9A 4Z4EA 3U3YA 2RF2A 4PA1A 3LP2A 4KHSA 1T03B 5L1IA 3FFIB 3KMSA 4J9QA 3UPFA 1B9DA 1Z4UA 1S1WB 1LWEA 5KFRA 4CHZA 2WK4A 1JLGA 1L3TA 3BSOA 3NCIA 3AV9A 1HARA 5KG4A 1KRPA 2B43A 3LZIA 2XHBA 3C94A 4TLRA 3H4BA 5KFKA 2OPRA 4Z4HA 2Z1IA 3DLGA 2RKIA 4XPEA 2D41A 4FZZA 3MEGB 4AHRA 4FJ5A 1CSJA 3DLKB 2R2RA 4IBNA 2A1SA 2A1RA 3HM9A 3SNNA 2HNDB 4FZXC 3AA3A 1QE1A 1B92A 3LP0A 2HNYA 3HJFA 2XY6A 3SYZA 1JLCB 4DTPA 4KBIA 3KLHA 4NLUA 3RWUA 1S0OA 4BE2A 4HUGA 4O3OA 3EZ5A 4FBTA 1NOYA 3I0RA 4PWDA 3DMJB 2R2TA 4F4YA 1S0MA 3AO3A 4O44A 5DG8A 4OVLA 3NGDA 4KO0A 4KE5A 2W8KA 5K14A 3HK2A 5J1EA 4ZPBA 2VG6B 1SH3A 4K4WA 1QSYA 3ITHB 1YT3A 3SQ4A 4NLTA 4CHPA 2O4IA 5KFIA 3KHGA 3HT3A 3DOLB 4DQIA 4NRTA 3B6OA 4ZPDA 1QUVA 4CECA 4K4SA 2FVRA 1Q9XA 4DF8A 1U45A 4DSKA 1JKHB 4E0DA 2UUTA 3KNAA 2EX3A 4B08A 1RT4B 3NH0A 1S9EA 1UWBA 4DSJA 5KG3A 5HRRA 3OS1A 2PY5A 3H4DA 4IRDA 3M9MB 5CYQB 2AGPA 1QQCA 1JXLA 1J54A 1CXQA 4GC6A 1VRTA 3AVCA 5HRSA 3V81A 5KG1A 3AVHA 5FRNA 3V9WA 2ZQBA 3PX4A 1C1BA 2HNZB 3F9KA 1FK9A 1S10A 4GVMA 4URQU 2ASJA 1XR5A 4CEEA 1RA7A 3AA4A 4F8RA 3PR4A 4AILC 1C0TB 2W9BA 2F8TA 5C24A 4W5QA 3LP1A 3SQ2A 4RW8A 4CJWA 3PX6A 4ICLB 3V9ZA 3OLBA 2VG7A 4N41A 3P83D 4C8OA 5KG2A 4CF0A 3EY1A 3QIOA 3NGIA 3K57A 3I8DA 1WLJA 3HP6A 4KI4A 4FK4A 3WNFA 3JSMB 3H59A 2DPJA 4CJRA 4AHSA 4CJ5A 3LAKA 3DRPA 3AVBA 3KTQA 1A5XA 2WOMA 2ITGA 1SUQA 2ATLA 2IDOA 1SKWA 5I3UB 3I0SA 4FS1A 3KD1E 4ECQA 1VRUA 4BWMA 3SPZA 3PV8A 4CEBA 4DS4A 3MECA 3L2RA 3KLEA 2CJQA 2D7SA 2BGGA 3KLFB 4K4YA 2RPIA 4EBCA 2OZMA 4FCYA 4ED8A 1WAFA 4IR1A 4NCBA 5KT7A 4O3SA 4K8XA 3IG1B 4LY7A 3DOKB 2HWIA 4J2BA 2OPSB 4B8AB 5EUHA 4ZPAA 3GV5B 4CJQA 4NLXA 1N56A 4DMNA 1RA6A 2PYLA 4RW9A 3NF6A 3FSIA 2BQRA 1L3UA 4MK7A 2J6SA 4ECSA 3G86A 5J2NA 4OGEA 3QO9A 5KFBA 1FKPB 1S1XA 4BACA 1G15A 4CIEA 4DU3A 3N6NA 3SPYA 1I6JA 3CJ5A 4YMEA 3VQQA 3F73A 2HHVA 2WCXA 3DDKA 3Q8RB 4CEDA 2D5RA 1RT5A 4H4OB 3WNGA 4R0EA 1JLEB 4CGGA 5KFTA 2XY8A 4YNQA 1ZBLA 3OYBA 1LAVA 4DTRA 1KFDA 3GV7B 4YP3A 4ED7A 3RTVA 3MXJA 4OKEA 1MMLA 4I9LA 3M8PB 4FJJA 2VA2A 2JEGA 2FLPA 2YNHA 1X9WA 3OLAA 4K4XA 2D0AA 5D3GA 4OPKA 2ZKUA 3RMBA 1IKVB 4W5TA 3QLHA 5F9LA 4F4XA 1KVBA 3I5BA 4F3TA 1TKZA 3JYTA 2KQ2A 1LW2B 4IDKA 4NLSA 1HRHA 2F8SA 3IS9B 3BGRA 4IRKA 3WNEA 2YNFB 1TKTA 2FC0A 3RAXA 3TAGA 4LD0A 1R0AB 5KFJA 4CEOA 1LWFA 3S3MA 4O4GA 4F4ZA 1Y97A 1RDRA 2HB5A 4Q5VA 2AX0A 2RF2B 2YKMA 3LP2B 1QSSA 5EWFA 2BQ3A 3AA5X 4E7JA 4DTJA 2G8VA 1A5WA 5C42A 4Y2AA 4KRFA 3UR0A 1HQUA 4CJKA 2IJFA 3T5LA 2KW4A 4BDZA 1LWEB 2R8IA 1XHZA 4O4RA 1JLGB 3NGYA 5KFSA 4CEQA 2BRKA 1JXBA 4NLRA 3HKWA 3L3UA 1BQNA 4KHYA 5DQGA 3ISNC 4JS5A 1N5YA 4BE0A 3SI6A 3PW5A 4ZP9A 2OPRB 4YFUA 1U48A 2JGUA 4NLGA 3DLGB 2XWYA 2IMWP 3V1RA 2RKIB 2JLEA 3G6VA 4FYDA 2DFEA 2R8GA 3RRHA 3NH1A 3UIQA 1U49A 1U47A 1T3NA 4FXDA 2C22A 2AWZA 3KHLA 4LH5A 4Z4GA 3ZSVA 1QE1B 1RBSA 3LP0B 2HNYB 3BSAA 2DFHA 4QWBA 2AU0A 2QKKA 1VSEA 1RT3B 2G8HA 2HHQA 1TK8A 2LSNA 3KLHB 2V9WA 3U6FA 2Z1JA 4RW6A 5I42A 1GX6A 3RB6A 1RBUA 3I0RB 4HUFA 3C6TA 4E7HA 4O44B 5KFEA 2GV9A 1T7PA 1RDCA 3IRXA 5F8IA 2HHSA 5K14B 2RN2A 5J1EB 4O0IA 1TAUA 4CESA 1RBRA 4QWAA 4MKAA 5DGBA 3NH2A 3RMAA 4I2PA 5C25A 3H08A 5KFZA 4WXWA 2E9RX 4MIAA 4ID5A 4DFJA 5HP1A 2FLLA 1S9EB 1UWBB 1VK0A 4TYAA 2ALZA 4OKKA 2UVWA 2HHUA 2AX1A 4K4UA 3GIIA 3NAHA 2CKWA 4NLQA 1S9GA 1DLOA 1JLAA 1NK6A 4Y2CA 4M95A 1VRTB 4ED6A 3V81B 4FJIA 1N4LA 3S3NA 4LSLA 3HVTA 5KFGA 2OPPA 4IKFA 1C1BB 3KLIA 1BIUA 1FK9B 3MEDA 4W5RA 4G1QA 2JC1A 5DQHA 4RNMA 4R5PA 4O3RA 3PO4A 2W9BB 5C24B 3LP1B 4URSA 4ZP7A 4RW8B 3MFHA 5DG7A 5KI6A 4PUOA 4K4ZA 2VG7B 1TV6A 4XPCA 3AO5A 1QS4A 4B9TA 4ED1A 4FLUA 3IGVA 1WNSA 4EEYA 4DF4A 4M45A 1EKEA 4O3QA 4CEFA 4DU1A 4CJFA 2HWHA 4M94A 4ZTFA 3DLHA 1JXEA 5FDLA 4IH7A 4DU4A 1U04A 3H40A 2ILZA 3DRPB 3HL8A 4BDYA 5CYMA 2WOMB 1BGXT 2HMIA 4E7LA 1ZTWA 1SUQB 5KG0A 3I0SB 4KV8A 1VRUB 3L2QA 1KCFA 4ECTA 1BI4A 3QNNA 2E6LA 3MECB 2W9AA 3N6LA 1TQLA 3KLEB 4E1MA 5KG6A 3NHGA 4NCAA 4MH8A 4QW8A 2B5JA 2RDIA 2KZMA 4E19A 3NGZA 3EYZA 3PW0A 3S9HA 3VQ8A 3DRRA 4KPYA 4RW9B 4WYLA 1HJRA 4KTZA 5SZTA 1XI1A 1KSPA 2QE5A 3KLGA 5J2NB 3OYCA 4DLGA 1L5UA 1S6QA 3QO9B 4AHUA 1S1XB 4TY9A 2R7YA 3RB4A 4HCBA 3V6JA 4CK3A 3VN5A 4F4WA 1SL2A 4ID1A 3RB3A 4M3RA 3OY9A 2EC0A 2AGOA 2UUWA 3MR3A 3Q8SB 3H98A 3KLVA 1BQMA 3CDWA 4MIBA 2ETJA 3VQSA 4CGIA 3QERA 1RT5B 2C2RA 1C0UA 2W42A 3THVA 1RBTA 1FKOA 4JRQA 4FLTA 3D45A 2VG5A 3BREA 4F3OA 3BQ0A 1WSIA 2QKBA 3IGNA 1CZ9A 2YKNA 3NAEA 1UA0A 1B9FA 3KMQA 2R8HA 4CF1A 3KJVA 1D0EA 3UQSA 3OHBA 3K5MA 1HQEB 3QGIA 5T14A 3IAYA 4BDPA 2YNHB 1U09A 3L2UA 3QIPA 5DMRA 2X74A 5D3GB 3GYNA 2OA8A 4N76A 1W0HA 4TXSA 5KFAA 2Z1GA 3QLHB 1TP7A 1TKZB 4ECXA 3NE6A 2E6MA 3JYTB 4IG3A 4QOZB 4IDKB 4FW1A 3K2PA 4FJMA 4KAIA 4DG1A 3BGRB 4FJ8A 4NRUA 1TKTB 4M3ZA 3PY8A 4XO0A 1RTHA 3HP9A 1RDAA 1LWFB 4O4GB 4IFVA 1RYRA 1WSFA 3MFIA 4QWCA 3OS2A 1RDBA 2P5GA 4DSLA 4CEAA 1YTUA 1CXUA 2YKMB 3CM6A 5KFYA 4KTWA 2X6NA 4PY5A 3BDPA 2WB4A 5C42B 1CZBA 1HQUB 5T7BA 4C8NA 3QZ8A 2W9CA 3AVKA 3AO1A 1JL2A 1BQNB 4WE1A 4KFBA 3LAMA 4AHVA 3CJ3A 2BE2A 2JC0A 1SH0A 2G8UA 5JXSA 3G10A 4B9VA 1RT2B 3CVKA 2WRMA 1UA1A 2BR0A 1IKXA 3SQ1A 1RCHA 2ZE2A 2QXFA 2XGPA 2E9ZA 1C6VA 3PZPA 1EXQA 1ASUA 3OL9A 4DQQA 4ZVHA 5L1KA 4RW6B 5I42B 3V6KA 2GUIA 2XI2A 4HKQA 2C28A 3C6TB 5KG7A 2X78A 4RUAA 4AH9A 3KK3A 4J9OA 1ZBIA 1I39A 1L3SA 3OL6A 3V9UA 3AVMA 1NOZA 4CJVA 4CGDA 4FJXA 3IRXB 3QINA 3I5AA 4IG0A 1J53A 5FROA 1NK9A 2W7PA 1SH2A 3AVJA 5CY4A 4KHWA 3RR7A 4LQ3A 4Y3CA 4RNHA 3TVKA 2AGQA 1RT6A 3SUNA 2R8KA 4YR3A 4KTQA 1WAJA 4EZ9A 1C1AA 4I2PB 1KFSA 5C25B 3WNHA 4ID5B 3ZSQA 1SKRA 5HP1B 4PQUA 3T5JA 1LWCB 3ASMA 3CJ2A 2GIRA 2P51A 5F8GA 3CFOA 3KHRA 4ZP6A 4KSEB 3LWLA 4XIUA 1S9GB 3P1GA 1IKWA 1DLOB 1JLAB 1HYZA 2KTQA 4DL7A 4HUEA 4LSLB 3HVTB 4H54A 3V4IA 3M8RA 4LQ9A 3KLIB 1X9MA 1QTMA 4X2BA 3G6YA 4TSXA 2XY7A 3MEDB 4G1QB 1S97A 2DTUA 1D9FA 2GIQA 4R5PB 4H4MA 4FW2A 3B6PA 4U7CA 4O0JA 1NKCA 3ZSRA 4WZQA 3TAFA 2R8JA 4PUOB 4ZMMA 2IA6A 1TKDA 1TV6B 3TAMA 4K8ZA 4FJHA 3ZT0A 3SFGA 1JLQA 3FQKA 1A5VA 4WFXA 4TY8A 1FXXA 1F21A 3CWJA 2UVRA 4Z4IA 5KT6A 4ECZA 3H5XA 3LPTA 1ASWA 4CFDA 1S1TA 4GW6A 1BL3A 3KK1A 1NJYA 3RMDA 5FDLB 2E9TA 3KKRA 3TAQA 4MK9A 1NK7A 1RILA 3ICLA 4O3PA 5CYMB 3VQ4A 2HMIB 4J9LA 4ED0A 4E7IA 5KFHA 4KV8B 1T05A 1HYSB 1BI4B 2IBKA 3UDLA 3CQ8A 4DFMA 4ZVEA 2Y1JA 3HHKA 2C2EA 1RTJA 1TL1A 4EBEA 2J6UA 4EP5A 4OGCA 2B5JB 1LAWA 2G8FA 3K59A 3KD5E 1REVA 4IOBA 4OKJA 3VQBA 3ZSOA 5KFQA 2G8IA 1RTDB 1HPZA 2VG6A 5HLFA 4ELVA 1Z25A 1EP4A 4Q45A 3KLGB 1KTQA 3S3OA 2HVIA 1GOCA 2YNGA 3HPGA 4QAGA 4NYZA 3Q8QB 1DTQA 4K50A 2JEFA 4BE1A 1NK0A 4FM1A 3GIKA 3ZT3A 1ZYQA 3AA2A 3ZCMA 3VQPA 1GOAA 3DM2A 4J9RA 1BQMB 5J2PA 4CFBA 3NFAA 3T1AA 4NLDA 3D0PA 3AVAA 3PO5A 1C0UB 2GC8A 4EZ6A 1FKOB 5DQIA 2WONA 2V4QA 4KKOA 3TWHA 1SL0A 3DLEA 4DQSA 3RB0A 2QV6A 4NZ0A 1C0MA 3K5NA 4CF9A 4B3OA 4Q44A 1NHVA 3AVFA 4EO6A 5E41A 3OYNA 3ALYA 2YKNB 2C2DA 2VWKA 1Q8IA 1SV5A 1S9FA 3O3HA 4FBUA 1XR7A 3KJVB 4M41A 1T94A 4EYIB 1K6YA 3QESA 4CCHA 4CK1A 4NLOA 1BIZA 1T8EA 4WFZA 3QEXA 4PWDB 3QIPB 4ZPCA 4E1NA 4QWDA 3A2FA 2ILYA 4ZTJA 3DYAA 4C8MA 4IFYA 3T19A 3RAQA 4KO0B 4HHTA 1ZBHA 1JLBA 4J9MA 5KG5A 3BQ2A 3O3GA 4IG3B 2OZSA 4CERA 4WZMA 2FBTA 1S48A 5KGWA 4DG1B 4YQWA 2XO7A 3OYDA 5HROA 4ECUA 3TARA 1RTHB 2VA3A 3VQ5A 2BRLA 4KHUA 1HMVA 1C1CA 4IFVB 2IJNA 1RDDA 3DRSA 2IM3A 1WSGA 3NF7A 3NF9A 3FDSA 3VQDA 1TKXA 4FLWA 1S6PA 2J6TA 2DFFA 4CJUA 1HNVA 4FVMA 4OLAA 4FJNA 4DL5A 4FLZA 1BHLA 3OHAA 2W9CB 3GV8B 4CJPA 1XWLA 4RZRA 3MAQA 3HVRA 3QEWA 4WFYA 5KFPA 3QNOA 4WE1B 1D1UA 4KFBB 3OL7A 3M8QA 2BE2B 3LANA 3NAIA 3MF5A 4NLYA 3V9XA 4E89A 1DTTA 1MU2A 4B9LA 1IKXB 3QZ7A 1X1PA 2P5OA 4CJ3A 3TAPA 1TK0A 2ZE2B 1LV5A 2W7OA 5KFMA 4DWIA 3SFUA 1VSMA 3LALA 2RDJA 5KFUA 4Q43A 4GC7A 1NJZA 3MEEA 4RW4A 3AVGA 2IC3A 3TAEA 4J2EA 1FKPA 3OJUA 4I2QA 4BWJA 4LSNA 3KK3B 4JUZA 2HAIA 3OVNA 3L8BA 4EO8A 3OYJA 4FZYA 1RTIA 2IOCA 1RT1A 1TAQA 4IG0B 3MXIA 1D8YA 4NCGA 3SUOA 2BANA 3SUQA 4FJ7A 2D3UA 3PR5B 3HSTB 4IH6A 1RT6B 1JX4A 4CGJA 2PYJA 4C8KA 3D5MA 4DTUA 2B6AA 1KHWA 2ZD1A 3DI6A 5L9XA 4IRCA 1RNHA 2G8KA 3M8PA 2W8LA 3K5LA 1EX4A 4U6PA 4PQUB 4KHMA 5KFCA 1HNIA 2XI3A 2UVVA 1Q9YA 3E01A 3KK2A 4Y34A 1JLFA 3BR9A 1N48A 2YNIA 4KHRA 1IKWB 3I5CA 1TVRA 4ZHRA 5J2MA 2I1RA 3T5KA 2AQ4A 5KFLA 4JV0A 4Q0BA 3TANA 5JS1A 2FVQA 1W9HA 3V4IB 3NDKA 4RUCA 1XC9A 4YR2A 1IG9A 3NBPA 4FS2A 3CDEA 3PJWA 4F4KA 4UQGA 4KI6A 2D0BA 3ZSZA 4CJEA 4H4MB 3DLBA 1WSEA 4AHCA 3VA0A 3T5HA 3PW4A 3TAMB 2P1JA 3HPHA 1JLQB 3OL8A 1UOCA 5DLGA 3OYKA 4TY8B 4FJLA 1NKEA 3U3GA 1ZTTA 4ED2A 1S1TB 2I5JA 5EWEA 4N47A 4J2AA 3H5UA 3KK1B 3HVWA 3GIMA 3FRZA 3L3VA 3NL0A 3OYEA 4CFCA 3OYFA 4KAZA 1WSJA 1S1UA 3GQCA 4CGFA 4RNOA 4NYNA 3ZT1A 2FBXA 3SV4A 1T05B 1RT3A 2FBYA 3KHHA 1YVUA 1ZBFA 1IO2A 4FJKA 3LWMA 2ATQA 1JIHA 1RTJB 1TL1B 4N5SA 1RBVA 1N6QA 4R8UA 4IKAA 4FM2A 1KVAA 2ASLA 3O4QA 1REVB 3QEVA 4RG8A 4ECRA 5CZ2A 1L3VA 3C6UA 4JV1A 2F96A 4OPJA 4EBDA 4QW9A 2IAJA 1EETA 1HPZB 5KFFA 5HLFB 3G0ZA 3EZUA 4FK0A 1NNDA 1EP4B 4DEZA 4RU9A 4LH4A 4Z4CA 3RRGA 4EP4A 4B9NA 2YNGB 1S1VA 1DTQB 3QIDA 5HBMA 4H8KA 4GMJB 3GILA 1N5YB 3CFRA 1NJWA 3DM2B 2D0CA 3OYHA 5J2PB 4KHNA 4ZVGA 1NK4A 1LW0A 3N6MA 2IM0A 2WONB 1IKYA 4KKOB 3ZSYA 3RMCA 1NK8A 1QSLA 1GOBA 4TQRA 3DLEB 4MFBA 4I9QA 1S49A 3T3FA 2FJVA 1NK5A 4B3OB 4ED3A 2FBVA 1KLMA 2R2UA 5J2QA 4DL4A 2IM2A 4MK8A 1D5AA 1SV5B 4FLYA 1J5OA 5KRTA 1RT7A 4J9KA 3HPOA 4RW7A 5F8NA 2IS3A 2V0NA 4CJLA 4CHNA 3V6DA 3DYAB 4IFYB 5HRNA 1S5JA 3G6XA 1JLBB 3VA3A 2OH2A 2KFNA 3OSNA 3LZJA 4I7FA 4KREA 2FJXA 2OPQA 2FVCA 3ISND 4M3XA 4KB1A 3EPIA 5HROB 4N56A 4O5BA 4DTXA 2O5DA 1ITGA
chains in the Genus database with same CATH superfamily
3VQ6A 4Y1CA 1HFEL 2MY8A 2FLNA 3NCPA 2L9DA 1TKXB 1OPIA 3A3PB 3HHEA 3MR7A 4USJC 5FIIA 1AXQA 3RGIA 2CQ0A 3E51A 3L2WA 1U6ZA 1K1SA 3SEOA 3OD2A 4NYOA 3C95A 4Y1DA 3I4PA 1KQSR 2F65A 4QOTA 1VC5A 2B7BB 3VQCA 1BCMA 3QRPA 1XK8A 4DR4J 2NQPA 2D0PA 1J5EK 2RIJA 2VF3A 1Q82T 2AJQA 3KKSA 1MU2B 2QWMA 4ILHA 1QQMA 2QG9B 3GTYX 3F5TA 2HVZA 1NEEA 5HMYA 3CO9A 4CLKA 3GZ7A 3VQ7A 1Y5IB 3F41A 3FFIA 4C8ZA 3R3LA 1J5EF 1S1WA 5GAGI 5DS7A 5F8JA 1HJOA 2PDAA 4YHHF 1MWZA 4BLGA 1NB7A 4AXJA 1M5VC 1X4HA 5ADZA 1HNWF 1WDTA 2GNKA 1RTIB 1WHWA 1RBAA 5AZIA 4H5NA 2G1DA 2GBZA 2HBRB 4EYHB 4DSFA 3G8TA 4NCGB 2XYHB 2HRUA 2RILA 3CG7A 3NF8A 3BKUA 5L1JA 3PUFA 2HW3A 2V4RA 2B6AB 2ZD1B 1RHRB 4OI6A 2ZH7A 2R7SA 3CC2N 3LDSA 1UETA 1YVFA 1XMOK 2HBLA 2LQ9A 4AL6A 5GAEP 4C6AA 1V6HA 3VGVA 2CJKA 3E9PA 2P6TA 3PRVA 1CLQA 2FB0A 1JLFB 2Q3PA 2YQ0A 2OUGA 5L39A 3JSRA 1YDLA 5J2MB 3ITHA 2YV0X 3H5SA 4Q0BB 1XMOF 5HVFA 4IYQA 2DNGA 1XHXA 2HFOA 4FLXA 1SL1A 1S6QB 3WC2A 5CXTA 3DOLA 3NBPB 1IN0A 2XMAA 3G71S 5BYQA 1EO1A 3R8EA 5JUMA 2HQ3A 1RT4A 3VENA 4K4TA 2DIUA 5F3TA 2J7KA 3SMZA 1RFQA 3H3NO 1RP5A 2FD2A 4J9NA 5CYQA 1WSHA 4HCCA 5D6GA 4L75A 1BISA 1XQSC 2PN6A 4ELUA 3FQLA 3P49B 3EPGA 4CJ4A 4QCLA 2E2OA 4I6MB 3MM7A 3CD6N 4OJRA 1KAZA 2HNZA 4AHTA 1QZ6A 3SCIE 4J9PA 2CJBA 4G6VB 4WTYA 1U1QA 2NUHA 4X66J 5DM6Q 1R0BG 3QRRA 4PG7A 3AJDA 1IBKJ 1KLNA 4P9SA 4AFFA 3H5YA 3TI0A 2Y8YA 1RZMA 2LU1A 4DV5K 4A8YA 1G2EA 1WUUA 4A8OA 2HG4A 2EHGA 4NLVA 3M8SA 1U2VA 4LFBJ 1P90A 4A8XA 3MMCB 4DFKA 2C3YA 1MN9A 4DV5F 3V5RA 4FZVA 4DQPA 3QBWA 3M2UA 2VC0A 4OL8A 2IVMA 3UNYA 2YHBA 1W2BR 4DUZK 3JS6A 3DCAA 2GWKA 5DG9A 3RBEA 1FA0A 3UCUP 5F8MA 4J91A 1DARA 5I3UA 2HBYB 1PG5B 2R9LA 2FTRA 3PJXA 3DXSX 3D6FB 3NMAA 1RGVA 1LWCA 3WDOA 3AGRA 4O8KA 3CGIA 3IG1A 4RTFD 4JRPA 3DOKA 4NLWA 2OPSA 1IKYB 1H1VA 3PSIA 4M3WA 4C98A 3MD3A 1F2GA 1U26A 3KWMA 2OEJA 1YZ6A 3K5OA 3ZT4A 2V8HA 1KLMB 3CC7S 4BRMA 3W2WA 3AA9A 1J5OB 3W9JA 4JI6J 1N52B 1OQ3A 3US5A 3C15B 5TKYA 1MWQA 4DOZA 5FLXU 2MXYA 2R2SA 4YB1P 4MKVA 4FF2A 3O8WA 4BS2A 1HBUB 3POTB 1ASVA 2DNYA 4IR9A 5EDWA 3HDSA 1JLEA 3FSYA 3W8GA 1ZBUA 1FTCA 1YIJN 1EQ0A 3AXKA 5E7OB 3HX9A 1R27B 4ISFA 3V1QA 3RBZA 1IBMJ 2KYZA 1B64A 2OYQA 3R5CA 3MR6A 1H98A 3SZ2A 1JL1A 4LFAK 3LM2A 1RHKB 3PVXA 4QWEA 3ILIA 2UU9F 5AXKA 4NEZA 5KT4A 4ZK7M 1PGZA 4CP5A 4M5JA 1Z26A 3FCVA 5M1OA 2BVZA 3V6HA 4K0KJ 4LF5J 4H5TA 4IEEA 2RS8A 4CJTA 4PKDB 3HI0A 2Q3SA 3CCUS 5DLFA 5LT5A 4LFAF 3BYPA 2IIHA 4FPRA 4U96A 2UVUA 1G4CA 1VS3A 4EK2A 3JTOA 4CBXA 3L2VA 2ZM6J 3AVIA 3KNGA 2EKYA 8ATCB 2XY5A 2D74B 2CQPA 2RF2A 3LP2A 1T03B 2MQOA 4WFBL 3GBTA 3I56N 2A3JA 3UPFA 3CMAN 1VQMS 1Y4ZB 4C1NI 4L3KA 4CHZA 2AJ0A 3AV9A 4TLRA 3MI7X 1XQIA 2DHSA 3DLGA 4CZKA 4XPEA 1ACMB 4CLUA 2AHOB 4AHRA 1CSJA 1FFWB 4Z2XA 2R2RA 3CQYA 2FF3B 5D4LA 3DXKA 2DH9A 4ISGA 3JXUA 4A8QA 2XY6A 3KLHA 4CLZA 2F5GA 4BE2A 1NAQA 4HUGA 5AQRA 2COLA 4OVLA 2W4CA 3DKDA 2N7YA 2WVFA 4X65J 2YCHA 3BBFA 3WHIA 5K14A 1YJNN 5J1EA 4XTTA 2VG6B 3VETA 3C65A 1BD6A 2C2ZB 4CHPA 3X1LB 5KFIA 3ENWA 4NRTA 4CYUB 1GLDG 4CECA 1QUVA 1UVJA 1IV0A 4NASA 2FVRA 3C19A 4UW2A 4IWVA 3KJFB 2CFXA 4DSKA 4CH0S 2EX3A 1Q86O 3R1HA 1UWBA 1MW7A 3D68A 3HHLA 4DSJA 5KG3A 1IWGA 4AYBD 1Z1ZA 2B4VA 2JWNA 5IQ6A 4BRQA 2WVEA 4C97A 2QLJB 1TZ0A 4M8LA 2V4JB 4ILRA 1WOQA 2AGPA 3E9OA 2UUAK 1JXLA 1RWWB 4E8UA 1J54A 2G2ZA 3CJBA 4GC6A 1S7IA 3ZTRA 1T11A 3O08A 3AVHA 3V9WA 1BA1A 4ES1A 5E3CA 3HSGA 3I96A 3OTBA 1TELA 3T9NA 3GFZA 2GGPA 1S10A 3QT6A 2RAQA 4CEEA 1NDPA 3MM8B 2E1YA 3HSZA 1C0TB 1HLWA 4I4BA 4MYTA 2VBZA 4RW8A 1NDLA 3OLBA 3D67A 4CLYA 4N41A 3B82A 2ZJPL 2M4MA 2KN4A 1TR0A 3M32B 3NGIA 5IXUA 3HKZD 4MLEA 4LF4K 3MPVA 1QD1A 3T1HJ 1RWUA 4DCOB 4OX8A 2QRRA 3ULHA 2KI2A 2V6AA 1VHXA 4KH6A 1HD0A 5B7WA 3MMAB 1U8WA 5ETNA 3Q7CA 3W66A 3AVBA 1A5XA 4P74A 1ATNA 3M1VB 3MAAB 1DT9A 5AQWA 1SUQA 3J81j 2BXJA 4BC2A 4LF4F 3KD1E 2JVOA 4FXVA 1VRUA 4ECQA 4DS4A 2P8IA 1RGIA 3L2RA 3KLEA 3KLFB 2ASYA 2OZMA 2DRDA 4LSZB 1WAFA 1I1GA 2HWIA 4EWTA 2HZVA 5EUHA 5CCLA 1CJKB 3JXOA 3DJCA 3VCDA 3H3OB 1ZC6A 2B8QA 2GO8A 2PYLA 2RUSA 3CCZA 2J6SA 2OEMA 2GJ2A 4KH5A 1KQSM 4KH1B 1TL4A 4CIEA 2K1RB 3SPYA 3HOTA 2EBEA 1OYDA 3CJ5A 4PXBA 1NSAA 3QB0A 2VGNA 3I55N 4B02A 2QMUB 2PFUA 5D0EA 2WCXA 1HBNB 1HNXJ 2AYBA 2G2OA 3J7YP 2Y3YA 1HNZJ 3Q8RB 3H2VE 2KRRA 1RT5A 1SBRA 2NRHA 2WBRA 3UD4P 3G9CA 1QM9A 5LMUJ 3EJMA 4YNQA 1ZBLA 2CQ2A 1CG2A 2CNNB 1VQYA 4ED7A 4CZLA 3I8BA 3Q7BA 4OKEA 2DRAA 3VF2A 4I9LA 3M2VB 2VA2A 2JEGA 3AT1B 2A18A 4P7VA 4K4XA 2PO4A 5D3GA 1FO1A 2YTCA 3IKMA 4HDGA 2GVZA 3QLHA 4L6V3 1NGBA 5DJBA 1LW2B 4GVEA 4IDKA 4FKXA 4FF4A 4NLSA 2QWQA 2OELA 2F8SA 3IS9B 2PMHA 5B08A 1RHMB 3J7ZT 2E1PA 3WNEA 3MX2A 2FC0A 2GCFA 5KFJA 3HSJA 3Q2SC 2ABYA 4F4ZA 3ZTPA 4FDFA 1QY7A 2IY5B 1GEHA 1O5JA 4ZITA 2HB5A 4Q5VA 3ZZPA 4IXCA 3A0IX 2MYFA 5EWFA 4LR7A 2GVDA 4DU7A 3MURP 5C42A 2Q6CA 4RX6A 4Y2AA 2KW4A 1LWEB 2R8IA 1JLGB 5KFSA 2BRKA 1JXBA 2K06A 3L3UA 1RWOB 2YX6A 2VFUA 5IZHA 3CCJN 4ZP9A 2OPRB 4YFUA 2C3MA 1GQEA 3V1RA 3M8WA 2R42A 1YJRA 4YY3J 2DFEA 1VLYA 4JKEA 4DPYA 3P39A 1NBEB 1FX4A 2AWZA 3KHLA 4LH5A 1YITS 3HD2A 2ZUGA 2QKKA 2HHQA 1TK8A 4BRNA 1LCUA 2EW9A 4HHJA 2Z1JA 2J8AA 5I42A 2M88A 4CI0B 2UXCJ 1CEZA 3QT8A 2ZGZA 2VCPA 3M3ZA 2DXFA 4O44B 2CJYB 3GR1A 2LU2A 3SJHA 1RCXB 5AXMA 1QLNA 3TUJC 4O0IA 1RBRA 3SMPA 2X3DA 2YX7A 1X5PA 4CZMA 4I2PA 1WBBA 3H08A 5KFZA 2O8CB 2Z0GA 2E9RX 4ID5A 3D3CJ 1X60A 4DFJA 1GLEG 5HP1A 1S9EB 3FGUA 1VK0A 3PFEA 2CQBA 4K4UA 4RO0A 2E5GA 3GIIA 3NAHA 4NLQA 3CC4N 1MLAA 1DLOA 4NMXA 1NMDA 1JLAA 1W2BM 1VRTB 3LM9A 3ZEUA 3V81B 3CPEA 4C9DA 4KGVB 1NLKL 2LMIA 3RUBL 5KFGA 2DGQA 2GHVC 1C1BB 4FO0A 5E0OA 1IM6A 2RD5C 4AUKA 4USTA 2GIFA 5C2FA 3M30A 4X65F 5DQHA 3ZZ0A 4R5PA 4O3RA 2W9BB 4H4KC 4UZBA 4OZNA 3HFZB 2VG7B 1TV6A 1QAYA 3BYRA 1N34J 4A8SA 2DR7A 4FLUA 2NZ4A 4ZCKA 1WNSA 1NXIA 4M45A 3VHQA 1HW8A 5MAOA 4JI1K 1UEUA 4CEFA 3NGTA 4DU1A 1RACB 4AL5A 3W2VB 1JXEA 3L4BC 2K8GA 2PSZA 1U04A 1CJTB 3T9ZA 3H40A 3P96A 3PYGA 4USWA 4E7LA 2OTJS 4LFCJ 2M8HA 3ID8A 3MUMP 3L2QA 5M2UA 4ZKAA 3QNNA 4JN4A 4OYXA 3O44A 4YEAA 2RE2A 4E1MA 4WU3A 4MH8A 3TEGA 4NI2B 4QW8A 1NGAA 3B8HA 4E19A 3NGZA 3GG1A 1GXTA 4P71A 3S9HA 4LF1A 2CRLA 4Y2IA 3CW2C 1HJRA 2IVNA 5SZTA 2QE5A 1L5UA 4DKWA 1TFWA 2FQQB 2Z2LA 3I82A 2ZJRL 1RKJA 3Q8SB 2CQIA 1IBCB 2KT2A 4FKYA 3EE9A 4RPFA 3ET6A 2ETJA 2Y1RI 1NMEB 2DIVA 4LR8A 2C2RA 2NPFA 1FKOA 1Q81T 4FF3A 4FLTA 3AGKA 3NGRA 3BREA 5F2RA 2QEXS 1WSIA 3SSQA 5JLFA 4ZPTR 3NAEA 1UA0A 4JI3J 1SC1B 1GMWA 5K8NA 1D0EA 1WC1A 3BEXA 4GV9A 2P9EA 2HLTA 2YNHB 3GFHA 4BR2A 2LP4A 5DMRA 2X74A 2OA8A 3WXIA 4B1UB 1W0HA 2Z1GA 4DI6A 4IZ9A 4FYVB 3P3DA 3NNAA 3TX0A 3BGLA 4KAIA 4CO2A 1IWAA 1BUXA 4DR2K 2NXUA 4M3ZA 2KFYA 4XO0A 2F9TA 1B70B 4UTGA 1HNXF 4H5WA 2V63A 1HNZF 4U67L 3MPWA 2E2NA 1PAUB 4CEAA 1SXLA 4KGZB 5LMUF 5D0HA 2Q6BA 5M1NA 5DDOC 3TOQA 2I2YA 2CNKB 2XG8A 3TZYA 5RUBA 3OUYA 1HQUB 2GO9A 2M8DB 4C8NA 3IMXA 2KHDA 3KK7A 1JL2A 4JNEA 1WSVA 4YN3B 1N5QA 1HR0K 1U0SA 1MMNA 4OI0A 2BJ8A 2VB6A 3G10A 3GE9A 1RT2B 3CJKB 4WQ5A 1FEEA 3F2KA 4DX8H 2BR0A 1ZM2A 4N8NA 2ZGYA 1U0HB 5AQFA 2QXFA 2E9ZA 4GO5X 2P9PB 1M90O 4PXCA 3ENVA 5LL6Z 4JB8B 2ZJQL 4V19S 1FTRA 1V3SA 3U7JA 1JB0C 4HHHA 1HPMA 4UOHA 2E5LJ 1L3SA 4PYDA 5IT0A 4IG0A 4F3QA 1NK9A 2QSFA 1AZSB 3R6LB 3AVJA 4WCEL 4Y3CA 4J5OA 1RT6A 3O6QA 3AJ1A 2A0FB 2RHKA 3CO0P 2R8KA 4KTQA 4B1ZA 4EZ9A 2H4WB 2ZEJA 1TTHB 1SKRA 4PQUA 3NRBA 3ASMA 4DUTA 2LQBA 4JI0J 2P51A 2MJUA 1KBRA 3CD7A 4DR7J 1XMBA 2WW8A 4YORA 2OANA 1UFKA 2RB7A 4P2MA 1S9GB 3P1GA 3EGZA 1N36J 3IRWP 4JI8J 3ZETB 3O6WA 2UXCF 4PG4A 4Y0WA 1X9MA 1UMJA 4LF6J 2YWHA 2P9CA 1D9FA 1KDNA 4FW2A 1HD1A 1VJWA 4WZQA 2VPXB 2DR5A 2R8JA 3THYB 2IA6A 2EFOA 4YB5A 5HI7A 4K8ZA 2LA6A 4FJHA 1MWKA 5GAHI 1RAFB 3FQKA 1A5VA 2V2VA 1O8BA 1FXXA 2QN6B 1WTBA 1VYAA 3Q86A 2A6AA 2NRTA 2HS4A 4TNOA 4TVAB 3C46A 3A12A 4CW7B 2HBQB 2WVCA 2VFRA 3PNIA 4K2JA 3KKRA 4MK9A 1NK7A 2X1BA 3HBTA 4JYAK 1KQGB 5CQGA 2MB0B 4BRHA 2DGXA 4DV6J 4MO5A 4JKDA 4KV8B 1HYSB 4CVNE 4OZ2A 1BI4B 3T6JA 1VQ6S 2DRBA 2GV1A 4AM6A 1YBAA 2C2EA 1TL1A 2JVRA 4OGCA 4JYAF 2HSTA 3MM6A 4P7TA 3KD5E 3D9BA 3VQBA 2P9UA 5A2QO 4ELVA 5HSPA 1CBKA 1HI1A 3FCWA 2Y9HA 5IWAJ 3OXLA 1PIEA 4ZVRB 4QAGA 3EKUA 4D3GA 4FWKA 4BE1A 4UT4A 1SJ1A 2FC8A 1OWXA 5AQKA 3VQPA 3CJRA 1OQ6A 5GMDA 3D0PA 2P9KB 3PO5A 5LMNJ 2GC8A 3LDQA 1BOTO 1IG8A 4LFCF 1SL0A 2FZKB 4C0OC 3OPKA 2QV6A 1C0MA 2D1CA 3A8JA 2BE7D 1E3MA 3UN2A 4Q44A 3AVFA 1JJ4A 3ALYA 2YKNB 2C2DA 4ZVOB 4DR6J 1K73O 1DAXA 1SV5A 1S9FA 3O3HA 1XR7A 1T94A 2P9NB 4CCHA 2MLYA 1BIZA 1T8EA 3L4IA 4E1NA 2Y1LB 2GAGC 1UEVA 1W7WA 1WC0A 4OPHA 3NG8A 3DYAA 2RHSB 4X62K 3RAQA 5HMWA 3K0JA 2APOA 1ZBTA 2KT3A 1OIAA 4A61A 4BRDA 5KG5A 3O3GA 2OZSA 4K2XA 4WZMA 2FBTA 4PL7A 2XB2D 3NCQA 4QIFA 3OYDA 1W2IA 4ECUA 3TARA 3THTA 5H9EJ 1K0TA 4IFVB 2CADA 3BZKA 3N28A 3R2DJ 4IO9Q 1WSGA 3UO0A 3OHRA 1TKXA 1VDHA 5KPZA 2J6TA 2DFFA 2NSBA 1BXNA 4FVMA 4OLAA 4RWXA 1Q4RA 4WIQA 2ADCA 4DL5A 5L38A 3OHAA 3EKSA 2W9CB 1SPBP 2G4BA 3I4HX 1VQ4N 4JI3F 3FMBA 3SSRA 4BVPA 3HVRA 5KFPA 4JV5K 4KFBB 2CA9A 1R7IA 2A6OA 3VEWA 3CQXA 3NAIA 4M1KA 4NLYA 1MU2A 1R89A 2V69A 4U7UD 4DXLA 4IFEA 3DWLA 3DC2A 2A2DA 4DWIA 5HO4A 4B3MJ 1Y3KA 1VSMA 3LALA 2RDJA 4JV5F 3H20A 3NOGA 3HLUA 3SBGA 2ZFHA 1FKPA 1GTHA 1VQOS 4BRFA 3BGFA 2Q0RA 4BWJA 2CPHA 2KG0A 2D3OR 4WQ4C 3SCJE 3OVNA 3L8BA 1RTIA 4BBYA 2N7CA 3ZNJ1 1TAQA 3MXIA 4V19J 3NVKA 4NCGA 5CD4A 3SUOA 4ZJLA 3SUQA 3UVJB 1JX4A 1HHQA 3J81O 2EXUA 3D5MA 1ZZFA 1XERA 2B6AA 1X8DA 1KHWA 2ZD1A 3ZNUA 4DB3A 3P6YC 5LJWA 1RJJA 2G1HA 3FCHA 1KVIA 4IRCA 1RNHA 2G8KA 3IBWA 4U6PA 1ZM4A 2HURA 4EMDA 3MM5B 3CCVN 3CPWR 2LXFA 3VEOA 1JLFA 1Q7LB 1HI0P 1FF2A 1GMWD 4X4PA 3QFUA 2MKYA 2BW7A 5J2MA 3T5KA 4Q0BA 2OCEA 4CNZA 1FDDA 1XC9A 1N0VC 4C3MA 3NBPA 2E5LF 4FSVA 3OTOK 2Q97A 2WZ1A 3MGJA 2KHCA 2BM0A 1LXNA 5AFUH 3AFGA 2G0JA 1PYOB 3THWB 2BKPA 4OX9K 4WU2A 2QLFB 5CABA 1JLQB 1UOCA 5DLGA 3OTOF 4TY8B 5T7LB 4RUHA 3FVYA 3QWUA 4FYXB 5DDPC 1S1TB 4I6MA 3S1TA 3SBMA 3HVWA 3OYEA 4IJNA 3EDRB 4OX9F 4KY3A 4H0OA 3J7ZO 2E2PA 1WTFA 4KYZA 3VV2B 1S57A 1N36F 4R25A 4QIWD 4NYNA 3ZT1A 4JI8F 4WFNL 3L4QA 1TUYA 2OD6A 3EO3A 1MSWD 3KHHA 1YVUA 1LNQA 4YDXA 4N5SA 3W60A 3RZAA 4K59A 3FZMA 4IKAA 3IO1A 1KVAA 3ILLA 2QLXA 3HJVA 4RG8A 2O8BA 2LEPA 4QW9A 2HQIA 3LA0A 3PKMA 1EP4B 2QYGA 4DEZA 4RU9A 1PC5A 4LH4A 1S3XA 1FRHA 3AB4B 4H0YB 4HACB 3VEZA 3FZBA 3E9LA 2XYPB 3IC1A 4H8KA 4DV7F 3FRYA 4ZCMA 3GILA 1NJWA 2DYAA 2XNRA 5J2PB 2IRUA 2OIHA 3CC2S 2BACA 1IKYA 4KKOB 1JNZB 4ANCA 1NK8A 1QSLA 3MN9A 1GOBA 2JSXA 3DLEB 5JMNA 5DO2A 5BXIA 1R0CB 3U8XA 2FBVA 1KLMA 3JS9A 4P2SA 3BP8A 4DL4A 2R7RA 1FDBA 1SJFA 1J5OA 5KRTA 2VD3A 3LO3A 3HPOA 3CCSN 3C15A 1XMQK 5GAGP 4DV4J 5HRNA 3SK3A 1WC5A 5BREA 4A47A 3EE8A 1JLBB 3POTA 3LZJA 1YLXA 4I6WA 1C0GA 3D7EO 3DRXA 3MUVP 2ZBIA 1NSKL 2J8SA 4X66K 3ISND 4UF4A 5CAAA 3EPIA 3VGKA 5HROB 4N56A 1XMQF 1FJGF 2YWEA 4OX7A 3FE1A 7AT1B 3VF0B 3PX0A 3DRSB 4QPXA 2RDDA 4E98A 4ANDA 1VSFA 4DR1K 1D8ZA 2MZSA 2KL8A 3A5OC 4USVA 1S6PB 4LF9J 2WTFA 4LFBK 3CD6S 1HNVB 4M42A 5ETVA 1XBWA 1VQNN 4DSIA 2LQ8A 4B3SJ 1BCOA 4A62A 3NGKA 3QATA 3M8QB 2X6SA 1FD8A 2G8WA 1RHQB 2CIMA 1VQ9N 1UP1A 4M5KA 2F8EX 1SKSA 1QAIA 1B0PA 4QU7A 1OS5A 3V4MA 4KB0A 4CIFA 4DLEA 5AQLA 2J9DE 4BG8A 4DR3K 2NYHA 1T03A 4YUDA 4QR1A 3ZSXA 3SAGA 4Z7YA 4RW4B 1VQPN 4L73A 3VZHA 3OYLA 4TYBA 2C3UA 2XSJB 3ZSWA 4OJ1A 3OSPA 3K9JA 4F36A 3ZT2A 2Q36A 2GA7A 5G4DA 3CJ0A 3GJTB 2HVHA 4DR3F 4DN0A 4DQRA 1RT1B 3QEIA 4JI6K 3VQ9A 3IM9A 1FDNA 1OMSA 4LIWA 2BANB 3BB5A 3KWIA 1KTVA 2H65B 1IJFB 3OYAA 2QSWA 3BSCA 2ZBRA 1S4EA 4ECVA 1IM4A 5HMXA 1CPZA 5I3QA 5GAEU 4HWIA 2FF6A 1KQFB 4CZCA 2HPUA 2MGZB 4J9SA 4BRPA 1FHTA 1HW9A 4K5SA 4C0HA 2FY8A 1QUPA 1FXDA 2Y1IA 2FJDB 4B3MF 1VSDA 1U1NA 3CIZA 5I4MA 4WK3A 5KRSA 2DISA 1L3KA 5KFXA 1TVRB 2QT7A 2QMXA 4ZHRB 4ES3A 4UY8T 1XIQA 3DRRB 3ULDA 1E6VB 5A8WB 5LSLA 3MDFA 3PYFA 4C7QA 3Q8PB 1Y64A 2AEMA 2JEJA 4QYRA 2P9LB 1WOOA 2VGMA 4URGA 4GVBB 3HO1A 4CYUA 4Z0UA 1P9QC 1YIJS 1SB6A 3KDOA 3BGOP 3H1VX 1V5IB 2IA0A 1WORA 3CB4A 1KAXA 4CLFA 5F8HA 4MIWA 1VSJA 3D28A 2QWOA 4DTMA 1S59A 3C16B 4H0VB 1RLDA 4ELTA 2BM1A 2V4JA 2VG5B 4CO1A 3U1NA 2ZF5O 1FRIA 2I5JB 2ZC3A 3M2RB 3CYMA 4C8LA 3H90A 2CH6A 3OYMA 1KOHA 1KC8O 1FWLA 2W25A 4NYFA 1NZ8A 3MM8A 4B9SA 1C0TA 2BQUA 3QYYA 1SAZA 1GX5A 2YKOA 2DB1A 4A57A 5A6WA 1TFYA 3FBBA 4ZP8A 1W25A 3QEPA 1GLFO 3M9OB 2BEFA 2JH3A 3M32A 3CCTA 1TK5A 3HVAA 3I56S 5DGAA 3HXMA 3BR8A 3CMAS 3KYLA 2BKOA 1UAWA 1U4BA 3OS0A 3MMAA 1U1MA 1YWXA 2F4VJ 3C6UB 4E3SA 5KAKA 2IAJB 1EETB 4PWWA 2MKCA 3NKYA 4BC5A 4OYAA 4Q8FA 2YWFA 2ZBPA 4C4WA 4WIIA 1PSDA 3GONA 1NHUA 2PI4A 1JXVA 3M1VA 2FJWA 3MAAA 2BOPA 4DUYK 5A8KB 1S1VB 4ER8A 3BJYA 1MMDA 1VSLA 3G8SA 3OJSA 4USHA 3KLFA 3KIOA 2VBXA 1C0FA 1I3AA 3MWTA 4O5FA 4QBUA 3I32A 3AAPA 4CIGA 1LW0B 1FFSB 1CJKA 2C2NA 2GX8A 3ATUA 4FWOA 3SCXA 1SS6A 4MFBB 4DUYF 2A10A 1XNQK 4M3YA 1RYSA 3CCWA 4PRFA 2HRTA 5J2QB 2O1PA 1YJNS 1QQOA 1JJCB 1DGKN 4FPBA 4F50A 3KG4A 1LK5A 2H3EB 2MQNA 4FWRA 4FK2A 3V6DB 2XTJP 1NH7A 3RBDA 2DH7A 1HBNA 3SJJA 5CHIA 1XNQF 1UAXA 1U7LA 2AMCB 1FNMA 2FIUA 2R3VA 2XYGB 4KC5A 2UXDK 3H0PA 3J7AP 1TGOA 4WKRA 3LTOA 1FCAA 1BY9A 4JS4A 4W5NA 1U1KA 1J9AA 2ZH5A 3HZEA 1YTAA 5CZ1A 3QICA 2GQ2A 1ZETA 4EFHA 2XZTB 4FPIA 4CWBA 3M2VA 2QA2A 4DTSA 3DLLL 1N33J 3WXJA 2FZGB 2UXDF 1ZS6A 3AH6A 2CQ4A 1TL3B 4J9VA 3SI8A 4CHYA 4DPUA 1KEKA 2PBDA 4MQ3A 2ZH4A 4BG9A 1VHFA 1LW2A 3GU0A 5LL6d 2QK9A 4HT7A 3IS9A 2L9NA 2GMJA 4B9MA 5KFVA 2BJDA 2G2YA 4TLQA 4M3TA 4DV3J 2XC9A 4CLTA 3U3YA 4W92B 4MKYA 3CPWM 4J9QA 2QO3A 2ASOA 1VK8A 3LGNA 1B9DA 2JDJA 3R27A 1LWEA 1JLGA 3NCIA 1WC4A 1KRPA 2B43A 5AQUA 3LZIA 2XHBA 3MAHA 3CJSA 2BUNA 5A8RB 5FPDA 2OPRA 1SQKA 3BPSP 4LF9F 2MDAA 4D3HA 2J4RA 2D41A 4OJ3A 3MCNA 3BUZB 3CT9A 3PM9A 4NE9C 3VEVA 2NZCA 1M1GA 4B3SF 3D1QA 2A1SA 2A1RA 3SNNA 2HNDB 1U8SA 2V5HG 4FZXC 4CLPA 3H8YA 2XBPA 1HKAA 3SYZA 1OSCA 3RWUA 1S0OA 4HR2A 1ATRA 4H0TB 3R7BB 4PWDA 1JQGA 3DMJB 2R2TA 1WB9A 4O44A 3HFKA 1FERA 5AQPA 2DNPA 4KE5A 2HS0A 2VQEJ 3I55S 3HK2A 2ZZNA 3L6QA 3OR2B 4ZPBA 1SH3A 1YT3A 5F0XA 2F3JA 4NLTA 1VQ5N 2O4IA 1T9TA 3HT3A 1WG5A 1YBTA 4K4SA 4ZA1A 3MPUB 1Y0HA 3I6PA 4EI2A 2ERRA 2IYIA 4YOXA 4OX6A 3NH0A 1S9EA 2GS8A 3TVYA 2FDNA 3ENOA 2R7QA 3GYXB 3MD1A 4GKJK 3H4DA 2ZWOA 3M9MB 3ILJA 3K89A 1VRTA 3AVCA 3V81A 5IV4A 1GMVA 1FDAA 3PX4A 2CNOB 1C1BA 3HZ6A 1DBDA 4JI2K 3FK4A 4LC9B 3JQKA 4GKJF 1IXKA 3PEHA 4URQU 2ASJA 2E1RA 3AA4A 3B78A 2GTDA 3IBCB 2W9BA 2F8TA 3H1QA 3J80O 4W5QA 2HRYA 3EZOA 4ZIWA 3PX6A 4ICLB 3V9ZA 3A5LC 2VG7A 4YY3K 3NS5A 2VKZG 4C8OA 5KG2A 3EY1A 2WB1D 2YKPA 4AQYJ 1WD6A 1K8AT 3FGVA 3C6AA 4KI4A 6FDRA 3H25A 1FW6A 4LBPA 2VODA 5D4PA 3W2VA 4JHDB 4DZ6A 1V3RA 2DPJA 4LVOP 3T1YF 5K8MA 4YOVA 1CJTA 4AHSA 3CCJS 2M7SA 2XLJA 4QR0A 1F0XA 5DDQC 3KTQA 5THWA 1VFJA 4RBVA 2NR0A 1ILYA 3PV8A 4WPAA 5EHHA 2NRWA 2CJQA 2BGGA 2ZH9A 2KLAA 4ED8A 4B17A 4BCAA 3O1WA 4NI2A 3CF5Q 1RCOB 4LY7A 4J2BA 4RL1A 5D15A 2OD4A 4ZPAA 4M63C 2JX2A 3JAMO 1LFWA 1LXJA 4NLXA 2D1KA 1N56A 1YGYA 4DMNA 1LFPA 5CCMA 1YJVA 1U1LA 3G86A 5BRFA 2W2PP 4FL9A 1KAYA 5H9FK 2GAHC 4BACA 4OO1J 2DNLA 4DU3A 3N6NA 3P5BP 4YMEA 5L9NA 2ADBA 1MN7A 1N32K 1RAGB 1N54B 3J7YU 2MHNA 1MWMA 4H4OB 3DAWA 3D0GE 1ZOTA 5KFTA 2XY8A 2I7PA 4ZLNA 2OSQA 4ILLA 4X64K 4OZ0A 4GV3A 1N32F 2VPWB 2KKHA 3CC4S 4LREA 5JICA 3PLAA 2YNHA 3OLAA 5B0BA 3JTNA 4PPDA 3EN9A 2QTDA 4W5TA 4DV2J 3I5BA 1R8CA 1Q95G 4F3TA 1FE0A 5E2QA 3JSYA 2KQ2A 1U2FA 4XDDA 1SKUB 3PIPQ 2UUCJ 5HL7L 1YRXA 4QPTA 1S72N 4IRKA 1HKCA 1R0AB 1JJ2R 2GEMA 3HRGA 1RDRA 4P73A 2DHHA 2A3ZA 1QSSA 4E7JA 4OYOA 2BE9B 1HQUA 2IJFA 3VR1A 4BDZA 5JVHQ 2PA3A 3D6TB 1VBYA 3HKWA 5JMVA 2XHWA 5AQNA 5DQGA 2V8PA 4JS5A 1N5YA 3SAHA 2UXBK 1U48A 4NLGA 2IMWP 2RKIB 4CRJA 1TMJA 2FSKA 2IPOB 3CJKA 2VICA 4PKIA 3NH1A 4WQ4A 4F9OA 1U47A 5T41A 1U0HA 2C22A 1T3NA 5IT9Y 4Z4GA 2P9PA 2HF3A 1QE1B 2HNYB 3BSAA 2DFHA 4QWBA 2AU0A 1EIYB 2UXBF 4PEOA 3W9IA 1JCGA 1N8RO 2E1CA 2B9YA 3RB6A 5GADU 2DTJA 3I0RB 2VDHA 4E7HA 2XMJA 3O4WA 4CD1A 4NXNF 5F8IA 5LXRA 2HHSA 3CMEN 2IHR1 1AZSA 2E29A 4CESA 4DDFA 1UJ6A 2PA8D 2PFDA 1UPMB 1H2TZ 3VF6A 1J5EJ 2CG4A 3EXCX 4DZDA 2IVYA 3NH2A 3RMAA 1RK8A 4MIAA 1M1KO 1QVGR 3DGPB 1HNWJ 3OTEA 3KUGA 3L3CA 3CJAA 3O9QA 3MCMA 4CZJA 2BJ3A 3SLCA 1T9XA 3MEKA 5LSOA 5D0GA 3G4SN 1OH8A 2V7ZA 1S9GA 3N0VA 4X4VA 3CMQA 2X1FA 3C66A 3ZETA 1WOPA 3A13A 1KS2A 2OPPA 1KVJA 1X5SA 1HKGA 1F5BA 1BIUA 1FK9B 4MMOA 3W0LA 3Q2TC 2E1AA 5DM7L 2A41A 1S6UA 1ZZNA 2B0GA 3LP1B 4URSA 1SZ2A 4PYAA 5BR9A 3THYA 2W7AA 1NDKA 2YWGA 3U1MA 4AE5A 4ZVTB 3AO5A 2FHKA 1XMOJ 1FJ7A 3O80A 2VDIA 4ED1A 3IGVA 4R79A 2J0XA 1EKEA 2O67A 4FOEA 4ZVUB 4CJFA 2HWHA 4M94A 1TU0B 3ENBA 3DLHA 2WFBA 3RW7A 1EWRA 4DU4A 4UOCA 2VASA 3HL8A 3VWSA 4ZIVA 4BDYA 3CCQN 6AT1B 5L46A 3DU5A 4BRGA 2F1FA 2ATCB 2XMKA 3I0SB 4KV8A 1KCFA 3M6WA 4ECTA 1BI4A 3MWBA 1WC3A 1XN9A 3N6LA 5IC6B 3ENAA 2G13A 3A1YG 4I6YA 2NRXA 2RDIA 5HVGA 4X4OA 2KZMA 4HTLA 3MCSA 1AROP 3D2WA 4CM2A 2RQ4A 3AODA 4MYUA 1OYEA 1X4BA 1TMMA 4KPYA 4RW9B 4WYLA 1XI1A 5J2NB 1M5HA 4TY9A 2R7YA 4HCBA 3L0QA 5EN1A 4CK3A 1OH5A 2KB2A 1WACA 4M3RA 2EC0A 3HULA 3CDWA 4MIBA 3TQEA 4CGIA 2P9KA 3R5GA 3QERA 4DV5J 2W42A 1FRJA 4JRQA 4JD2B 2QA1A 4CZEA 1SJ4P 5BR8F 2UP1A 1VQ7N 2QKBA 2WW4A 1GFWB 3IGNA 2RU9A 2HK3A 1CZ9A 2SXLA 2YKNA 4IDHA 3KMQA 3UQSA 4NYPA 1NCLA 4UY8O 3K5MA 2V8GA 2P9NA 3W62A 1RI7A 4OYWA 4BDPA 2HQDA 3L2UA 3O3LA 2H5EA 4P2XA 4DUZJ 3GYNA 4DR5K 4C11B 1TKZB 1Y10A 2K7JA 4FJMA 2E88A 4ED5A 1WHVA 1R43A 4NRUA 4DV6K 3PY8A 1U02A 1LWFB 4DR5F 4IFVA 1RYRA 1WSFA 3MFIA 2POKA 2K2PA 2EFNA 4QYZK 1UTAA 2V2QA 2YKMB 4KTWA 5JJBA 2E7WA 5KFYA 2YX1A 2X6NA 1YZ7A 2C1EB 4JKFA 4X4QA 4PY5A 3BDPA 5DRKA 1CS4B 2HHPA 1HHSA 1WUAA 5T7BA 3DHXA 3QZ8A 2W9CA 3AVKA 3AO1A 1J27A 1NGFA 4XK8C 2F7TA 4KFBA 2B4UA 3WEEB 4CD3A 2M3DA 3GJQB 8AT1B 1SH0A 2G8UA 3PCOB 2BA9A 5E3RA 3CD5A 2LA4A 3VALA 1RCHA 2ZNZA 1P8ZA 3OR1B 5AE2A 1ULRA 2ZH6A 2WTUA 3PZPA 3WUHA 2MZ1A 4LFAJ 3OL9A 3J7AN 4ZVHA 1HWLA 2L08A 4RW6B 3JTPA 4A2AA 3V6KA 2Q31A 1V5VA 4CM0A 2C28A 2LKZA 3E3XA 1I39A 4CJVA 3IRXB 1Z05A 4DR6K 4CQ1A 3X3UA 3AOCA 3I5AA 5FROA 1F9HA 3AD9C 3QJPA 2W7PA 3M2UB 5CY4A 2RRAA 4KHWA 4M5DB 3RR7A 4LQ3A 3TVKA 2AJFE 3UVJA 4X4NA 1QJHA 4FVCA 1VIXA 4YR3A 1X3MA 4MTPA 3JB9k 3GP9A 2BABA 5CE3A 2QFIA 2VC1A 3CCEN 1VOMA 1LWCB 4TU7A 2GIRA 3VGTA 5F8GA 2KXHA 2ACMA 3KHRA 3J8AA 2DXDA 2EG2A 3MM5A 4KSEB 4WFBQ 3LWLA 4WP3A 1KQKA 4XIUA 2GWJA 3NEKA 2DGVA 2KTQA 1NO8A 4LSLB 3HVTB 2DR6A 2ZH3A 4H03B 2AEJA 4H54A 3M8RA 3NMRA 3R9PA 2L3MA 5E3PA 4EUVA 3KLIB 1QTMA 3MWPA 2DK2A 3G6YA 4TSXA 1IR1A 2DTUA 3D7SB 5CH7B 5AQHA 3TW0A 1U1RA 2AP1A 1NKCA 2OJ3A 4PUOB 3THWA 4ZMMA 4OFZA 3S6EA 3ZZRA 1OVYA 3CULA 1JLQA 5DZ6A 3W1YC 4TY8A 1F21A 3CWJA 5T7LA 2UVRA 1D4XA 4Z4IA 3OQ2A 4ECZA 3H5XA 1S1TA 3QFWA 1X4DA 1BL3A 2MKSA 1VQ4S 5FDLB 1JK9B 2E9TA 2DEJA 4FVUA 2QTWA 2WSCC 3WXMB 3TAQA 1RILA 1QVFR 3ICLA 1VBXA 2KT5A 3VQ4A 2HMIB 2V50A 3THXB 4E1JA 1XTZA 3CSKA 1ICEB 1PAEX 1BQXA 2F7VA 2IBKA 3CQ8A 5AQQA 2J6UA 2A42A 1KWMA 2B5JB 1NJIO 2G8FA 3KUHA 3K59A 4OKJA 4IOBA 1URRA 4K5RA 3RVCA 2Y8WA 3M5RA 4USUA 1YHQN 3P5TL 1Q5YA 1Z25A 1VMBA 2MZTA 1EP4A 2P9SB 1SC3B 2JLGA 2IFXA 2ZNYA 5I3PA 1GOCA 4HACA 1CULB 4NEYA 2V51B 4BR5A 4NYZA 2IRYA 3SDEB 2HEKA 1NK0A 3VPZA 5C2CA 3AA2A 1UL3A 4L74A 1GOAA 1JJ2M 4J9RA 1BQMB 5J2PA 4CFBA 1EKRA 3NFAA 3T1AA 1S22A 3KG1A 5IT9U 5JVGQ 3AVAA 1HLUA 3N5FA 4JK8A 4KKOA 2H9ZA 3DLEA 4DQSA 5C2GA 2DKOB 1UVKA 3FNNA 4CH7A 4CF9A 2MQQA 4LF4J 2UYTA 3GL1A 4QIGA 3CCVS 1GAOA 1JWWA 2CUYA 2V34A 3EGVA 2VWKA 2DCLA 1VBZA 4FBUA 3KJVB 4M41A 1KONA 1K6YA 4CK1A 4JP8A 2KM8C 4U95A 2RH3A 3QEXA 2BKNA 3QIPB 2P5VA 2XS5A 3UKUB 3A2FA 1UEKA 4ZTJA 2V2ZA 3T19A 1K9MO 4B3RK 1G7CB 5LOQA 3GJRB 1JLBA 4OZ1A 4IG3B 3GWCA 4CERA 4DG1B 1VK3A 4YQWA 5GMEA 5HROA 3LDOA 4ID8A 1RTHB 1FVSA 5CD4H 4YOTA 3VQ5A 2BRLA 1PILA 4FN5A 4A8WA 3ULEB 1RDDA 2AA4A 3SSSA 3DRSA 1UFLA 3FDSA 3OXFA 3VQDA 1RBLA 3C7NB 4QS8A 1KD1T 4AD6A 1S6PA 1WEZA 1YKWA 3ATVA 4CJUA 1HNVA 3MUTP 3EWGA 3DXMB 4FJNA 5BPMA 3TA0A 1XWLA 4RZRA 4RKUC 4LMZA 5D4NA 2E7VA 4QR2A 4WFYA 3QNOA 1D1UA 3OL7A 3M8QA 2BE2B 4OHZA 4ZLLA 3MF5A 4DUZF 1T6CA 4E89A 2JFDA 3BZQA 2KJWA 2VZ9A 1QVGM 4B9LA 1KKHA 1IKXB 3QZ7A 2LVWA 2Y0BB 5A76A 3D54A 4TU8A 3Q8VA 1YJ7A 2VHGA 5B0DA 1NJZA 4RW4A 3TTCA 3AVGA 2RQMA 2XSJA 3NMUA 3MZIA 3TUPA 3VERA 4BGBA 1H0HB 3OYJA 4G65A 3Q24A 2D3O1 2IOCA 1RT1A 1H7WA 4PABA 2BANA 3UE2A 2D3UA 2RVJA 1H2VZ 1F3FA 5FLXO 4DV4K 1R59O 2PYJA 1T9UA 4Z94A 2XEXA 1SJQA 5L9XA 2Z2MA 4BR0A 3M8PA 4FWMA 3TZZA 3K5LA 1MG7A 1E4GT 1GLCG 2XI3A 2MGZA 1JJHA 3FEYB 4UQTA 2CVIA 4Y34A 3CCSS 1N48A 1Q7YO 1IKWB 1TVRA 4CNYA 4ZHRA 2I1RA 1E6VA 5A8WA 2AQ4A 5KFLA 1HA1A 3LUYA 2BX6A 1EB0A 3V4IB 3NDKA 2P9LA 4FNIA 4YR2A 4GVBA 3HM8A 3PJWA 2EK6A 4F4KA 3S41A 4KI6A 3THPA 5AQOA 4PCQA 2D0BA 3ZYYX 4CJEA 2EVZA 2CPDA 1FJEB 4RUBA 4F25A 3DLBA 2X7IA 3VA0A 4F7VA 3C16A 2BOAA 2L9WA 3PW4A 3TAMB 4OJGA 4X4SA 1OY6A 3GR0A 2HGLA 3OBYA 1GLJO 5K8PA 1RLCL 4UUXA 2AP6A 1FWKA 1NKEA 1RAIB 3CTRA 3U3GA 1ZTTA 4ED2A 1VQNS 2I5JA 3IBFB 3M2RA 3H5UA 4OYBA 1UVNA 2N3LA 3L3VA 3GG4A 2DY1A 4Y2MA 1VQ9S 1K44A 3GQCA 1P6TA 3NS7B 4RNOA 3FR0A 1T05B 1RT3A 3E2EA 2VYPA 2IDLA 2DNZA 1ZBFA 4FJKA 1RBVA 4B1VA 4JI4K 5IC4B 1VQPS 2ASLA 3QEVA 2BZ2A 2ACYA 3QBCA 1L3VA 3C6UA 2IAJA 1EETA 5KFFA 5HLFB 4EHTA 3G0ZA 3EZUA 1NNDA 1OKJA 4OV6A 1WEYA 2ZHOA 2UUBK 4DPTA 1T02A 4JI4F 4B9NA 2YNGB 2IIRA 5A8KA 1S1VA 2J0SD 2Z8QA 2CG8A 3QIDA 1BO5O 1J6ZA 2YKAA 4GMJB 2KU7A 1I5OB 3DM2B 2F8HA 2D0CA 5E84A 3OYHA 5EY4A 1EHWA 4KHNA 1VISA 2W2QP 4NLCA 1LW0A 5M1FA 1RE1B 2IM0A 2UUBF 4DQ8A 4MFBA 1DRZA 1A0OB 1S49A 3T3FA 2FJVA 1NK5A 1YJWN 2HFUA 2R2UA 3BY5A 2FGOA 5J2QA 4MK8A 4H0PA 3QQCD 3AA8A 4DPXA 2MSSA 1F60B 5GAGU 3BKFA 2UUAF 2V0NA 3QRQA 3TVZA 4DV0K 2ALYB 3V6DA 3IR5B 4DPOA 1S5JA 4I1TA 3CJQA 3VA3A 4YDUA 4W98A 1M5KC 2FJXA 2FVCA 5D77A 2Q79A 3LPEA 4KB1A 4O5BA 2XS7A 2Z1HA 1Z6RA 1WJ9A 1C1CB 3VGUA 2HHXA 1ZAVA 2RT3A 3DLJA 3CJ1A 2MQPA 2XCPA 5AXLA 3MMJA 2VJVA 2FPHX 3D6RA 2GW8A 4BVOA 1X9SA 5F0WA 1TL3A 3DDNA 3BF1A 3NWGA 1FE4A 1Q16B 1D9DA 1OH6A 3M6XA 4CF2A 5SWMA 2FVPA 4ED4A 2ZJRQ 2F63A 2EFVA 1RU2A 2CZVC 4GKKK 2HWTA 3HYFA 3M8ZA 1YRUA 4C3LA 3QGGA 2QYCA 3P31A 1NPPA 1HL6A 4CJSA 2F40A 3GIJA 2LEBA 2FZCB 3PHEA 4NMLA 1KVCA 2XMVA 4QU6A 2RQKA 4LVNP 3M1FA 1RISA 2IC3B 4WWSA 2VOOA 4OLBA 4GNIA 4O0NA 1NMNA 1FI4A 4OZ3A 3SV3A 1F9FA 4WKYA 5A8RA 1F1BB 2FHMA 2X3GA 1FWPA 3OVSA 2I7NA 4E7KA 4KHQA 1YVNA 2OLWA 4RWWA 1KN6A 4JKGA 2CZ4A 2CZ9A 3K8VA 2GUPA 4Y6IA 5D78A 2HNDA 4M3UA 2Z56B 3IWNC 5LM7E 3DI6B 3M9NB 1Q78A 2RU3A 4IOXA 2CQ3A 2QLWA 4C0BA 4FLVA 4V1Ak 2QJ3A 5AQVA 1HQEA 3VOVA 1ZPWX 4PG6A 4U67Q 4DTOA 3DMJA 1M1HA 4PL8A 4DN9A 4JV2A 3KK2B 3LW5C 2GQQA 1VSHA 2JEIA 4PHTX 4DL6A 3VF4A 2AYEA 1QVFM 3OR2A 1EAYC 3MTKA 2N4DA 4PKGA 1HR0J 2CPIA 3L7UA 3A3NB 1HBOB 1NJXA 1FNXH 3AOBA 2HAFA 1FESA 4DTNA 5J1NA 1S7HA 2XZDB 1NNEA 2HHHK 2Z2YB 4CT8A 5D8HB 3OYIA 4K4VA 3P5JA 3QGHA 4ZJQA 2NUUG 1UFWA 5IT4A 3CD0A 2NLXA 2I6WA 4Q7AA 2HLUA 2OO4A 5ETPA 3F9MA 5EU7A 4BRAA 4PXEA 4LBIA 5F8LA 5HRPA 2CPEA 2ROEA 3MXMA 2ASDA 1UCNA 3W9HA 1XJWB 4BR7A 4ZVSB 4MJKA 2W01A 4CE9A 2P2CB 2CJ9A 3CCLN 1PBUA 2XCAA 2PZSA 3KOAA 1T0TV 2Q1NA 1Q86T 4P10A 2VQFK 1FD2A 5KFOA 1K0VA 1UKUA 4P2FA 4CHQA 3LPUA 2K7KA 1GT8A 4L72B 4WCEQ 2B4PA 3A8KA 5AZJB 3ID6A 2CJXB 3D6HB 5EWGA 4NB4A 2BDPA 3O9TA 4ICLA 3SUPA 2JNJA 1WNEA 3SQ0A 4FJ9A 3F56A 4LRFA 3BBBA 5GADP 2A1BA 2MKHA 4HTUA 2EC2A 1N6QB 2F9WA 4C48A 4K41A 2DHGA 5EGYA 4BHQA 1QAXA 3MMBB 4JHDA 1IJJA 4CF8A 2QMWA 5E3AA 2NXJA 3DOMB 3K2YA 2GMLA 1C2PA 3PW2A 2RE1A 5F41A 3VQAA 1IBLK 3RU0A 2YHAA 3SQGB 2KFZA 3FZLA 4MKBA 4B3TK 2DNNA 5TKWA 1UJ5A 3K9KA 3LH2S 3WX4A 2E4LA 4BR9A 2CWKA 1PJ5A 1WHXA 3P38A 4J37A 1BLUA 3R7NB 2J9EA 4KHPK 4G1IA 1S0NA 4B8CA 3J7A1 2DPNA 4I67A 5BPLA 3VEXA 1F5CA 3PJ9A 1A7GE 3VZIA 2Z2ZA 1MROB 3IP0A 3TR8A 4A2BA 1WKJA 4KB7A 2NZTA 1O0PA 2R4FA 4ZPWR 3PKYA 1XR6A 2F4FA 2AIRB 1T3OA 1NH8A 2VWBA 3TQ1A 1RT7B 4KHPF 4LRAA 5B0GA 4BROA 1QAJA 1VQ5S 4JYAJ 2NUBA 3PYDA 4M7XA 3N4QA 3BO4A 4NXMK 1NDCA 4H4OA 2FVSA 3W8PA 5F9NA 3TABA 2OPQB 4J2DA 2AEFA 2HFVA 1RWKB 5MLCV 4RNNA 2LXUA 2VL1A 2OSRA 2VWJA 2HK2A 1VRQC 4NLPA 4NXMF 5DZ7A 3N9UC 2GQCA 2HQFA 2ZDPA 2VONA 1Q82O 4JI1F 5LSRA 4WXOA 1H6KX 2OHDA 5KOWA 7FD1A 2HHTA 1F9EB 4H0XB 3OYGA 1R0AA 4O3NA 4LF7K 2IM1A 4U7UK 2MTLA 4FYYB 1RTDA 2AJ1A 3BEGB 4Z4EA 2PEBA 2J7WA 4PA1A 4U7BA 1YI2N 2CH5A 5E5NA 4JKBA 2RNEA 1GK8A 3O1BA 2WK4A 1SJRA 3D1OA 1L3TA 4BREA 1HARA 5KG4A 1VLOA 2DR8A 3C94A 3KWGA 1KR4A 2EFQA 1F6TA 3H4BA 2LQJA 2YPZA 2RKIA 4FZZA 3MEGB 4FJ5A 2DHAA 1WF2A 3DLKB 3RSEB 1EARA 3JQMA 2ASMA 4IBNA 4DCPB 3HM9A 2QL7B 1QE1A 3HHLD 4X4UA 2HNYA 3CCMN 5B8HA 1JLCB 1C4CA 1ROFA 2MMYA 1UW9A 1I94K 1Y00A 4JOUA 3BS9A 4DV1K 4FBTA 3I0RA 1D9AA 4Y0FA 3OFHA 3H7HB 2HBZB 3GE1A 5GIOA 5DG8A 3NGDA 4KO0A 2PFFB 2W8KA 2HKEA 1SQFA 4IJAA 3UR3C 4AF1A 2P9UB 4PG8A 4K4WA 4RCHA 1QSYA 4JV5J 3SQ4A 1I94F 4DV1F 3BO2A 2NXNA 2YI1A 3ZX0A 1RWNB 4DQIA 3B6OA 3TUIC 3C14A 4DF8A 4DV2K 1JKHB 3PIPL 4E0DA 1LQ9A 4JI7K 2ZVSA 2UUTA 2O8FA 4MAKA 3IFRA 4QS7A 2ZHAA 3DGPA 4OHXA 1VGYA 4GVLA 4Z7CA 4WF9Q 3C8YA 4O23A 4DL0C 1CLFA 4L3NA 4DR2F 3OS1A 3MN6A 2PY5A 5B09A 1MDUB 2WSFC 3O9UA 3UDEA 3QT7A 1B7YB 1CXQA 3WQUA 4JI7F 5B0AA 2YY3A 2F9JA 2ZQBA 3GJSB 1FK9A 4LF8K 3EGNA 4GVMA 4ZLPA 2BV3A 1S72S 2KO1A 1T9WA 4F8RA 3PR4A 3GFYA 4NX9A 4OJHA 1WI6A 1YF5L 1HR0F 3LP1A 4DX7A 2OMOA 3P83D 2JHEA 4LF8F 3K57A 1WLJA 3WNFA 3KHYA 3JSMB 3H59A 2YWKA 3OFGA 2E5IA 4CJRA 1FEHA 5GINA 4K8RA 3FKBA 1U25A 3A8EA 2E7XA 1RWXB 3LAKA 2EKNA 4OLPA 2DEIA 2VUGA 4HI2A 3I0SA 5LJVA 4BWMA 3UFCX 1PBAA 3OTOJ 4CEBA 2D7SA 2CDRB 4K4YA 4EBCA 4IOAQ 4M5IA 4IR1A 4NCBA 4K8XA 5HVHA 2EWHA 4F4AA 1EQYA 4OX9J 4YHHK 4EGLA 3D0HE 4CJQA 1S6OA 3K17A 4Y00A 3GFXA 2OP5A 2U1AA 1HNWK 3CHWA 4RW9A 3NF6A 3FSIA 2BQRA 1L3UA 4MK7A 4ECSA 3EZWA 2JRSA 5GVQA 4FPAA 5J2NA 2JZ5A 4OGEA 3EX7B 1FKPB 3CMES 3CJ8A 5HANA 1V4TA 1G15A 4WQ5C 1S77D 3P4UB 3VQQA 2HHVA 1PKUA 1QQNA 4HHUA 4U9RA 4OLOA 4TU9A 2D5RA 1VBKA 3WNGA 2NYIA 4R0EA 4J8FA 4WFNQ 4JD2A 2DNQA 4DCJB 3OYBA 1LAVA 2R7UA 3GV7B 3PFOA 4YP3A 3RTVA 2H1YA 1EJ7L 3FBCA 4DV7J 3G4SS 1MMLA 3ZC4A 4FJJA 3AY9A 4PWUA 2B9WA 2M5YA 3L7PA 1X9WA 2FLPA 3N4PA 2PAVA 2W6KA 4OPKA 2DBBA 2ZZTA 1IKVB 4RR5A 4C11A 1NM1A 1R6VA 3Q89A 4F4XA 1KVBA 1N88A 9ATCB 3H42A 4RU2A 1TKZA 3I9ZA 2V2KA 1PYSB 2MZQA 3KUEA 1XNRK 4JBCA 2YNFB 2F8MA 1F5AA 3RAXA 3TAGA 4LD0A 1LWFA 3S3MA 2HZAA 2HBMA 2BMBA 2BUPA 3NGSA 2ZH8A 5EX5A 1GXUA 1B0VA 1OVQA 3W3SA 2AX0A 2YKMA 3VMFB 3R1XA 2V7YA 1RTZA 1CS4A 4KRFA 3UR0A 1XNRF 4CJKA 3H45C 5AQYA 2DNHA 2GX9A 4O4RA 4DMZA 3NGYA 4NLRA 1XMQJ 3CCQS 1FJGJ 4DU8A 4OV1A 3D2EB 2LDYA 5EVZA 3NP5A 1N5TA 3ISNC 4BE0A 3PW5A 5ADXH 3WC0A 3WEEA 2XWYA 4C8YA 4KJIA 3CXCR 4HTIA 3G6VA 3K5PA 1R8PA 2W6LA 2QA4G 3CDAA 3UIQA 1U49A 3AXMA 3KKFA 4NA2A 3MCOA 3ILOA 2HOEA 3OR1A 3ZSVA 2V52B 1RBSA 3LP0B 2LSNA 2V9WA 3U6FA 5M1QA 2DITA 1RUSA 3MXHP 4DR1J 4RW6A 1RBUA 5K5MA 4OZLA 3CNQP 1PJ6A 4CDIA 2QM1A 4N8OA 1FRLA 2YJEA 1SI9A 4Z37A 3W7BA 5KFEA 1M90T 3WXLA 1T7PA 3IRXA 5L8RC 8RUCA 2O8BB 1F3VA 2NXEA 2XS2A 1RAHB 2RN2A 4DX6A 3RBXA 4M5DA 3QFPA 4G9ZA 5FPEA 4MKAA 1CJUB 5GMKa 2MZRA 4X62F 1PC4A 2KKZA 3F44A 1X4CA 4WXWA 2CVEA 1VQ7S 1H74A 4DR3J 2BJ9A 4TYAA 1HBMB 2ALZA 4HEA9 4OKKA 2UVWA 4DJBA 2AX1A 1DJ0A 2CKWA 2AJ2A 3NXZA 1K8KB 3BN7A 1NK6A 4M95A 3G8QA 4ED6A 1YJ9N 4FJIA 3S3NA 4LSLA 3HVTA 4IO8A 1M0SA 1UZHA 4IKFA 1LEOA 3KLIA 2C3PA 2QXLA 1ZA1B 4W5RA 2VV5A 3VAGA 2JC1A 5AQXA 4RNMA 3M8YA 4ES2A 3ZTQA 5C24B 4ZP7A 2FHOB 4YB7A 3MFHA 5DG7A 5KI6A 4PUOA 4K4ZA 4XPCA 2DNRA 1QS4A 2UU9K 1I51B 4B9TA 1OSDA 4NZ6A 4EEYA 3CJ7A 2C3OA 4JI5K 2QI2A 3CJTA 5ETQA 5FDLA 4IH7A 2ZC4A 4H5RA 3DRPB 2EI5A 2WOMB 2HMIA 3WZ0A 1ZTWA 1U2CA 1RWVB 4ATNA 1T9YA 3THXA 5KG0A 4JI5F 2IRXA 1X9JA 4GY2B 3MECB 2W9AA 4ZJOA 1TQLA 1Y9OA 5KG6A 3NHGA 5E26A 1DFDA 2BJ1A 4NCAA 1KOOA 3HHDA 2N82B 2PT0A 5ETKA 3VVUA 3WT0A 1O6XA 2B5JA 2Z57B 4EU0A 5AJ3K 5IOLA 4K42A 3EYZA 5KQ8A 3PW0A 3OTCA 3VQ8A 4BRIA 2PIIA 4GRSA 1Y3JA 1P1LA 3KXDA 2KXNB 5AR0A 4BQLA 2P9SA 3OYCA 2OMLA 1S6QA 3TJAA 3QO9B 1CULA 1X7VA 1S1XB 1BDGA 4L76A 3SDEA 5AJ3F 1P8GA 2RHQB 3UI3A 3VN5A 4F4WA 1U6BA 1SL2A 4ID1A 4WFAQ 3RB3A 2A6MA 3KLVA 1BQMA 4DR4K 4F04B 5AQZA 3THVA 4BC7A 3CCES 3D45A 4ETXA 3D0IE 1FRMA 3O2IA 5FPMA 1NM2A 3LDPA 2AV5A 5C7PA 2E20A 3MOJB 2R8HA 4B1YB