1LWEA

Crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKSTKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 134
structure length 542
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lweA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lweA05
2ZD1B 2RDIA 2A1SA 4DS4A 4NLYA 3M8QA 4HKQA 5C25A 1Q8IA 4DU1A 3SZ2A 2JEFA 4AHTA 1LV5A 3GIIA 1QTMA 3MEDA 3NAEA 5KG6A 3SYZA 1SH3A 1UA0A 4DQIA 4YR0A 4H4MB 3EYZA 4ED1A 4M3XA 1KLMA 4FXDA 1F21A 2IAJB 5HRSA 2OPQA 5KT2A 1JL2A 3WNEA 3I0RA 5CYQB 3JSMB 5DQGA 2AGOA 1TL1A 5T7BA 5HROA 4IG0B 2IM0A 3DLKA 3BQ0A 3LP1A 5I42A 1GOAA 3DRRA 3IS9A 2ASDA 5J2NA 4URGA 3TANA 3Q8QB 1B9DA 2W7OA 4LH4A 2DY4A 3PO4A 5KRSA 2YNIA 3SQ4A 3VQEA 4O4GB 3NGYA 1HNVA 1RAJA 3MXIA 1SL1A 1ASWA 1TV6A 1S9EA 4CJ3A 1HPZB 5KG5A 2XY8A 1JXEA 1XWLA 1MMLA 4DG1B 2BQRA 1XR6A 1JLFB 3BJYA 5KG7A 2DFFA 4J2AA 4FJGA 4WFYA 2OH2A 1WSEA 4G1QA 4KHMA 5KFDA 4GW6A 2AGPA 1UOCA 1HARA 4M94A 3G86A 4N47A 4K4YA 1ZBFA 4NCGA 3QIDA 3ZT2A 4O3SA 3Q8RB 1RBUA 2Z1JA 2FJWA 3MEDB 5KFOA 5K14A 4DL2A 1S6PA 1WAFA 1U47A 3LDSA 2P5GA 3MFHA 3SV4A 4EZ6A 4JUZA 3IG1B 3AVKA 4EZ9A 1RYRA 3V9XA 2X78A 2QE5A 4U7CA 3NMAA 3AVNA 4KBIA 4TYBA 2YHBA 1C0UA 3L3VA 4CESA 4K8ZA 4FK2A 4KHWA 3CDUA 4ECRA 3QGHA 4ZP9A 3LP3A 1BQMB 2OPSB 2W9AA 2J6UA 3TABA 4WZQA 3HM9A 4QWAA 4H4MA 5L9XA 2X6SA 1REVA 4AHUA 3DRRB 1S9FA 5HRRA 3K5NA 3SJJA 3OYHA 1RTIA 1NK0A 3F9KA 3SV3A 4RNMA 5KG4A 4JS4A 2R8HA 2F8EX 4O5BA 1HYSA 1NOYA 2PZSA 3RB4A 4IFVB 4O4GA 2FLLA 3KD1E 5KFEA 1TV6B 2IJNA 4RW9B 3BR9A 2HNZA 1KHWA 3OYIA 4FLZA 3QEPA 4O3OA 3EPIA 4E3SA 1LWFA 1NKCA 4CJKA 4DS5A 5KTQA 5JS1A 3ZT3A 4L8RB 1HMVB 1NNDA 2RKIB 4CHPA 3NHGA 3SUOA 2VG7B 1SL2A 4TQSA 2R8IA 3QEWA 1X1PA 4DG1A 3HPHA 4QAGA 3RBEA 3SI8A 4HCCA 5F8MA 4NCGB 1RT6B 4ZTFA 4B8CA 3L2WA 3BSOA 2YNGB 4G1QB 4FS1A 3QO9B 4DTUA 1RTHB 4OLBA 1EP4A 2XRIA 4NYNA 2R8JA 1J54A 4KHUA 3OS1A 4NLGA 3CWJA 3DOLB 4IDKA 3PY8A 2B4JA 3DM2A 2OPRA 4ECXA 5HBMA 3LP1B 4E7LA 2DPIA 1IH7A 3SCXA 2ZD1A 1SH0A 5J2QB 4M45A 3M8QB 4YMEA 5C25B 3V6JA 5KFSA 4FK4A 4ZP7A 3LAKA 2YNFA 2ILZA 1TL3B 4NLPA 4AHSA 3OL8A 2YNIB 4DL5A 3IRXB 3LP2B 1GX5A 1RTIB 4FK0A 3NF7A 4KHQA 4O3RA 4TYAA 1ZTTA 1BQMA 2OPSA 3E01A 2RN2A 3KLEB 4NCBA 1LW0A 5DGBA 2FVRA 3OS2A 4ICLB 1YT3A 2FVSA 3KK2A 3KHRA 2D5RA 2P5OA 4I7FB 1ASUA 4YQWA 4DWIA 4NRTA 1S1XA 2WK4A 4DL4A 1QSLA 1BCOA 3IS9B 2VG5A 2B43A 4KE5A 3QERA 3FQKA 5KFMA 3FQLA 3I0SB 1IM4A 3NGIA 2HVIA 4Y2CA 1JLEA 3CFPA 1R0AB 3UDLA 3TAFA 3ISNC 3VQ6A 3KLIA 3AVHA 3G6XA 5KFXA 3MXMA 1HMVA 1K1QA 1BI4A 5J2MB 4OKKA 4CJ5A 4DQSA 3KKRA 3H08A 4IKAA 3H2LA 2UVUA 4J2DA 3DM2B 2KFZA 4EO8A 5KFFA 3SPYA 4ED6A 1JLCB 4QWBA 1CZBA 2YNHB 4KTQA 1S97A 4FLVA 3NCIA 2QXFA 4MFBA 3V4IA 3PO5A 3DOLA 1S1VA 3LP0B 4IDKB 2WB4A 3GILA 1J9AA 4JV0A 3UPFA 5K14B 3ZSQA 3U6FA 3WNHA 4BE0A 3KMSA 1T05B 3BREA 2XI3A 4TY8A 3VQ8A 4C8LA 3CM6A 4CF0A 4RW4A 4FM1A 4ZTJA 4ZHRA 2GC8A 3CDEA 2HNYA 3MAQA 1NHUA 3AVJA 5D3GB 2FVCA 4F8RA 3C94A 5DLGA 1VSDA 1NJYA 1YVFA 2QKBA 1C2PA 3ZT4A 4NLSA 1LWCA 4KO0A 1LWEA 1VSEA 5KFZA 3FDSA 4Z4IA 4IKFA 1S1WB 4IFYB 3FFIB 4QWEA 3NGZA 4QW8A 5KFHA 1S1XB 4B9LA 3CVKA 1L3TA 3VQAA 3HVWA 1I39A 4CF8A 1JL1A 4KFBB 4QPXA 2JC0A 4E7IA 2Y1IA 4WXWA 3VA0A 3TAMB 5SWMA 2AX1A 3MR2A 3AVBA 1IG9A 4CIFA 4YFUA 1BGXT 5C42A 1I6JA 4EBCA 4FCYA 1SKRA 1EX4A 2W42A 3FSIA 3RB6A 4ZPDA 3QIPA 4CE9A 1RTJA 3V4IB 2FBYA 1T3NA 2GBZA 4FJKA 4DTJA 4CJEA 4IRCA 5KFYA 1LW0B 5KG0A 1JLCA 2JEJA 2YNHA 3NAHA 3H4BA 4PQUA 3HP9A 2CKWA 4ZMMA 4F4ZA 4M3ZA 1S1TB 1WSIA 5E41A 4OPJA 3TVKA 2R7YA 3T3FA 3MECA 1RDAA 1A5XA 3RAQA 4OKJA 4O0IA 3CQ8A 5J2QA 3CJ3A 4HHTA 3H5UA 1WSFA 2YNFB 4M3UA 1RA6A 1HRHA 1EXQA 1TKXA 4C8NA 4NYFA 3DLEB 3CJ0A 4EO6A 4BWJA 3FFIA 2HHVA 1J53A 1TKZA 1BQNB 4MK8A 2VG6B 3G6YA 3VQQA 4O0JA 4RW8B 1Y97A 3DYAA 1NHVA 4WFZA 2G8FA 4ZP6A 3P83D 3GIKA 3UR0A 3OL6A 2HMIA 3VQDA 1N5YA 1C1CB 3V6HA 3S3OA 3AO3A 3LPTA 1LAVA 4F2RA 1S0MA 3CO9A 3RBDA 4KB7A 3DDKA 1U4BA 3ZSYA 2FC0A 5T14A 1S6QA 5C42B 4FLUA 3OSPA 1RT1A 5DMRA 4OLAA 1NK7A 1MU2B 1SL0A 5JS2A 5F9NA 4J2EA 3PR4A 3BSNA 1EKEA 2PYLA 4ELTA 1HNIA 4NLWA 2UVVA 2AU0A 4PA1A 4C8KA 5J1EA 4Y3CA 2BANB 3OYFA 4CEBA 1HQUA 2G8VA 4ID5B 3SI6A 1S4FA 2GV9A 4J9KA 1U45A 1DTQA 1TQLA 2FLPA 2IBKA 1JKHB 2YKMA 3NKYA 2IGIA 3RMDA 1BL3A 2ZQBA 3LANA 5KFBA 1J5OB 3I8DA 3DRPA 4QWDA 4RW6B 3OJUA 3D28A 3SQ0A 1KVCA 4CJ4A 4QW9A 2BQUA 3QYYA 3EZUA 1VRUA 3BQ2A 3QZ8A 3NGDA 3C6UA 4CFBA 4B3OA 4CGHA 2DFEA 3HVTB 1TP7A 2FVPA 3ITHB 3G10A 3T1AA 3VQ9A 1SUQB 1D9DA 4M42A 2KTQA 1JXBA 3AVCA 1C0TA 1S49A 3OY9A 2J6SA 4E19A 2IC3B 4C8MA 4WYWA 2RF2B 2XY7A 3DLEA 3KHLA 3RWUA 3SNNA 1YTAA 4B9MA 1XHXA 1N6QB 4TSXA 1KVAA 3TAMA 4FBTA 3MEGA 4E7HA 1T03B 1RT3B 3NDKA 4ECVA 1N5YB 4IG0A 3ISND 4GC6A 3MEEB 4O44B 3VQSA 3OHAA 2X6NA 2ATQA 2R2RA 2IA6A 4ZP8A 3KLFB 4KB1A 1G15A 4KO0B 3D45A 2D7SA 4RNHA 4U6PA 5FROA 1NK5A 3V1QA 3CFOA 2IM3A 3KLVA 3C6TA 3OYEA 4H4OB 3QZ7A 4ZVEA 4ECZA 2I1RA 3NF8A 3RMAA 2YHAA 4ID5A 4CJTA 2JGUA 3AVFA 4I2QB 1IKXA 3I5CA 4BDPA 4DQQA 4NLVA 5JUMA 3MECB 3LWLA 4Q44A 5FDLA 5CZ1A 3ULDA 3K59A 4Z0UA 4MK9A 3PW0A 4RW6A 2G8KA 4DLEA 2ZE2A 4CEEA 1HYVA 3NAIA 4PUOA 4IR1A 2RPIA 1JKHA 3PW4A 3VQ5A 3AO2A 4NLXA 2AWZA 2ETJA 4URQU 1S6PB 4EEYA 3NH1A 1SUQA 3SQ2A 1FKOA 1VSKA 1TGOA 3TARA 4JV1A 3HHKA 4F4XA 4RNNA 1VRTA 1LW2A 3V1RA 2BRKA 2KFNA 1S1UB 3NF9A 4QCLA 4DL3A 4B9NA 2KW4A 5KFWA 3H5SA 3BSCA 2XGQA 3AO4A 3QGIA 1C0TB 2EHGA 4FLWA 4FLXA 3DOKA 5SZTA 4JS5A 2G8HA 1EETA 3H5XA 4ELUA 4CJUA 4FZZA 1B9FA 3RR8A 3SQ1A 1XR5A 4LSNB 4JV2A 2BANA 2ITGA 1T03A 4E0DA 5KGXA 1IO2A 3OL9A 4HCBA 1C0MA 4OPKA 1L3VA 3OHBA 2O4GA 2Z1IA 4NLUA 4YR2A 2IS3A 1FKPA 4CEOA 3HP6A 2I5JA 3I5AA 1NJXA 2XI2A 4IRKA 3KK1A 4I2QA 1VSFA 1IKXB 1VSIA 1A5WA 1C1CA 4CFCA 3RAXA 3DLRA 3PJXA 1IKWB 4CEQA 3PHEA 4YP3A 4QOZB 4N76A 4FM0A 2BQ3A 3C6UB 4W5RA 3EZ5A 1QUVA 4CECA 2VG7A 5F8LA 2ASJA 4EYHB 2HB5A 5EUHA 4K4UA 3GV7B 4Q0BB 3N6LA 4DSIA 1VSLA 3QEXA 3TI0A 3M8PB 5I3UB 4R5PB 5FDLB 3IN5A 2W8LA 1RT5B 2YNGA 2WRMA 4MK7A 5KFCA 4N41A 1HQUB 4EBDA 3KMQA 4CJLA 3DMJB 2R8KA 4KHYA 3V9UA 2FLNA 2G8IA 4TLRA 5F8IA 3CJ5A 3CM5A 3T5KA 5C24A 4LSLA 4BDYA 1QSSA 1N48A 1HQEB 5J2PB 4OKEA 4F3TA 4GVMA 4JLHA 1U09A 1QS4A 1SKWA 2YKNB 4ED0A 2FJVA 4I9QA 3AVIA 3IAYA 1U48A 3CYMA 4DL7A 2ILYA 3QEIA 4EYIB 2HNDB 1W0HA 4DTSA 4OL8A 5J2NB 3D5MA 3GV8B 2WONB 3KK2B 4O3PA 4FJ5A 5HP1B 3BQ1A 2E9TA 4QWCA 3RB0A 2D0BA 1RT3A 4ED3A 3KHGA 4BDZA 1NK8A 3AVMA 1QQCA 4O44A 2D0CA 4J9RA 4ED8A 4KHSA 3DI6B 3KLGB 1FKPB 1DLOA 4XPCA 4KREA 4K4SA 3DRSA 2WTFA 1JLEB 1UWBA 5KFJA 2BGGA 2ASLA 4IH5A 5DLFA 2FBTA 3HL8A 3T5LA 4E89A 3OYCA 1JLAA 1RDDA 1RT7A 1TK8A 4I2PA 4TN2A 2UUTA 4DTNA 3V6DA 3PUFA 4WE1A 3VQCA 5HRPA 5KT5A 4CF9A 1ZYQA 3G0ZA 4NZ0A 5L1IA 3V81B 1JLQA 1TK5A 1TKTA 3KLHA 1Z26A 3M8PA 3PJWA 5I42B 2W7PA 2ZE2B 3PW5A 4Q8FA 3T5HA 3B6OA 3LPUA 1EETB 4F4KA 4NLDA 1CXQA 4DU3A 3F73A 4RU9A 5EWEA 1TL1B 1RDCA 1ITGA 3QETA 3QEVA 2IM1A 4M3TA 2JC1A 4G3IA 3M9NB 1KSPA 4DTMA 3NBPA 3MF5A 3B6PA 3S9HA 4RUAA 4CHNA 4FZYA 2I5JB 4WZMA 4N56A 3IGVA 1D9FA 1LW2B 1QSYA 3PR5B 4FS2A 2F8SA 1RDBA 1U04A 3BSAA 4RNFA 1RNHA 3D0PA 3BGRB 1CZ9A 4MQ3A 4CEZA 4JRQA 3UQSA 4CJQA 3G6VA 3PVXA 4IFVA 2W9CA 2JEIA 2HWHA 3V9SA 3U3YA 2XGPA 2G8WA 1VK0A 4Y1DA 4ZPBA 2OPQB 2RDJA 4R5PA 3V6KA 5DG8A 2OYQA 1JLBA 4J9NA 2FVQA 1X9SA 4ECUA 3DLKB 4DMNA 4Z4FA 2Z1GA 1X9WA 4C8OA 2C2EA 1C1AA 4B8AB 2RKIA 3KLGA 2V4QA 4J2BA 1C0UB 3MXJA 4B9UA 1WSJA 3EY1A 4J9SA 3TWHA 3HVAA 4DL6A 3V81A 3V9ZA 1RT6A 5KT4A 4TQRA 2HHQA 4RW7A 5KFGA 1S9EB 3NF6A 2KZMA 3TAQA 4DSEA 3AVGA 3V1OA 4CF1A 4CGDA 2V4RA 4EP4A 4Y34A 4KRFA 1S5JA 3K5OA 1B92A 2P1JA 4AILC 1TKTB 3KLHB 1S9GB 4IR9A 2E6LA 5KFPA 1RBSA 4F2SA 1HYZA 1Z25A 2IAJA 1K1SA 4M95A 1NKEA 4CJPA 3WNGA 4PWDA 4CGFA 3M9OB 3PW7A 1W9HA 2DFHA 2B6AB 4CGIA 2D41A 1K6YA 1ZTWA 3MR5A 2D3ZA 4LSLB 1QE1A 3DI6A 3NBPB 3IG1A 4FZXC 3OYGA 1JLGA 3LALA 2D0AA 2W9CB 3NL0A 5F8NA 1WSHA 2WCXA 1LWFB 3OLAA 1BHLA 3GQCA 1HNVB 1RA7A 3NE6A 2IMWP 1TK0A 4I7FA 1FXXA 2HHUA 4XO0A 3AV9A 3CDWA 1DTTB 1VSMA 2C22A 4O55A 2C2RA 1JLFA 4O4RA 3MR6A 4CJVA 3OJSA 2BR0A 1RT2B 4FBUA 3L2VA 4Z4EA 3M9MB 2OPPB 3HK2A 3T5JA 2UUWA 1X9MA 2D3UA 4AHCA 1MU2A 5DQIA 4DTOA 4DQPA 1N4LA 3K5LA 4HUFA 4RUCA 1UWBB 3KTQA 3QIOA 3L2RA 1JLAB 1S9GA 4F50A 2CJQA 4MH8A 4J9OA 1JX4A 1CXUA 3OYNA 4HYKA 3QO9A 3ZT1A 4I2PB 2G8UA 5L1JA 4O3QA 1C6VA 2ZKUA 1L3SA 3ASMA 2XWYA 3MR3A 3NH0A 4O3NA 5L1LA 2E6MA 1ZBLA 2PY5A 2DPJA 1RT4B 3HVRA 1WAJA 1D8YA 3N6NA 4K4WA 2OPRB 4LD0A 3ZSRA 2EX3A 5KI6A 4CHOA 1VRUB 2WOMB 2EC0A 4R0EA 3SUQA 1QE1B 1EP4B 1WLJA 1NJWA 3C95A 2HHXA 4FW1A 5KT6A 3ZSOA 1TL3A 3KOAA 4PWDB 1JLBB 2F8TA 3IRXA 3LP2A 4CERA 1R0AA 2E4LA 2GIQA 1KFDA 4CHYA 1XHZA 4H54A 3ZCMA 1UA1A 2HNZB 5KFTA 1RILA 2Y1JA 3H59A 3I0SA 2AQ4A 4CEDA 1KRPA 4BWMA 4DF4A 3BDPA 2QK9A 3OYAA 4E7KA 2JLEA 4KTWA 4M3RA 1N56A 1VSHA 3MEEA 3BGRA 3HO1A 4KI4A 5J2MA 3K5MA 5CZ2A 5DK5A 4CK1A 4OGEA 4KFBA 3AO5A 1C1BB 4W5TA 3U3GA 5HRNA 4F4WA 1KCFA 3O4QA 3L2UA 3C6TB 3Q8SB 2HW3A 1QAJA 5KFNA 4ZPCA 4H4OA 1T05A 4J9QA 1WN7A 1S0NA 2Z1HA 2VG5B 4ZVFA 2UVWA 4YNQA 1UAXA 2XCAA 2B6AA 4FLYA 4LH5A 3UIQA 3SUNA 1S48A 3HPOA 4N5SA 5F8GA 1ASVA 3O3GA 3TAEA 1IKYA 2B5JB 4RW7B 2BRLA 2XY5A 1D1UA 4CGJA 3QNNA 5KFQA 4RW4B 1LWCB 4OJRA 3M8RA 5F8JA 2R2TA 3TQ1A 4RG8A 4HUGA 1Q9YA 3I0RB 4Q43A 1RBTA 2JEGA 4B9SA 1SV5B 5HROB 1DTTA 5EWFA 1HJRA 4KAIA 3AVLA 3VQ7A 3PV8A 3SPZA 4ICLA 3CFRA 3KIOA 3O3HA 4CK2A 2IM2A 4CFDA 2Q3SA 4KSEB 4CJRA 5KFUA 4TY8B 5KFAA 1WNEA 2OPPA 2E9ZA 2AJQA 4ZHRB 4KPYA 4M3WA 1D0EA 1BQNA 1I3AA 4FJ7A 4CEFA 4DSKA 3QIPB 4R8UB 1LWEB 3VQBA 4Q45A 1U49A 4FJIA 2BE2B 3KLIB 4IBNA 4BE2A 1T8EA 1CLQA 2XC9A 3TAGA 4W5OA 1BI4B 4I9LA 5CYMA 2OA8A 4NLTA 3AA2A 1NK6A 2QV6A 5JXSA 1RBVA 4ELVA 1T94A 3RMBA 5KG2A 1S1WA 4IFYA 3H40A 1QAIA 3ZSXA 3TAPA 4GC7A 4NLQA 3VQPA 4IOBA 4K4ZA 1IKYB 2B5JA 3JYTB 3L8BA 4CHZA 4ECSA 4MFBB 4IRDA 1A5VA 1ZETA 1Q9XA 2OZSA 1RTDB 4F3OA 5F9LA 3KJVB 3OLBA 5I3UA 5KT3A 1RTJB 4ECWA 1TKZB 1SV5A 3OS0A 4DSFA 2VG6A 4BE1A 2VWJA 4WFXA 4CJSA 4URSA 1REVB 2E9RX 1S0OA 3QLHB 2HNYB 3KNAA 4BACA 2VA3A 5D3GA 4CCHA 2KQ2A 4IG3B 4K50A 4RZRA 1RT4A 4J9PA 1HQEA 2HVHA 4ECTA 4HUEA 3NFAA 1S6QB 3KHHA 2WOMA 2RF2A 4ECQA 3OVNA 1RT1B 4NLOA 4PQUB 4B9VA 4OGCA 3RRHA 1TAQA 1S1TA 4ED7A 4FJ8A 4UQGA 2C2DA 2A1RA 3RR7A 4LQ9A 4E7JA 1RYSA 3MEGB 3Q8PB 2YV0X 3OYKA 1SH2A 3HJFA 3L3UA 3E51A 4ED2A 1DTQB 3RB3A 4DSLA 3S3MA 1BCMA 4RW8A 2WONA 2FJXA 1SKSA 2O5DA 3PW2A 2OZMA 2HWIA 3KK3A 4FJNA 4MIBA 1BIUA 1Z4UA 1TVRB 4E1NA 2HHWA 3H98A 4Z4GA 5CYMB 2FBVA 3O4NA 1NK4A 3RMCA 3HVTA 3ITHA 3GIMA 3ZSWA 3A2FA 2HMIB 1RDRA 4M3YA 3EPGA 4HVJA 1RBRA 2HHSA 4CJFA 4AH9A 4FJHA 5HBMB 1GOBA 2J6TA 3K58A 3LAMA 1W25A 4ZVHA 4K4TA 4B08A 4WYLA 3MTKA 4IQXA 4LQ3A 5KT7A 5DG9A 4TXSA 2YKMB 4J9MA 2FBXA 5KG3A 3K57A 3GYNA 3MFIA 2IC3A 4GMJB 4KAZA 4DFKA 4IG3A 4DTXA 1IKVA 3E01B 4DLGA 1N6QA 4KI6A 4FYDA 3KLEA 3ZSVA 3QLHA 1WNSA 4R8UA 3AA3A 3WNFA 1TKXB 1VRTB 4B3OB 3KD5E 1QHTA 3DRPB 3L2QA 4DEZA 2AX0A 3CG7A 5FRNA 3NH2A 2XY6A 4M41A 3KLFA 4J9LA 3RRGA 5DGAA 4DF8A 4B9TA 2O4IA 2R2UA 4KHRA 1L3UA 3OYBA 5KFRA 4RNOA 3QGGA 4TY9A 2W8KA 1ZBHA 3JYTA 1TVRA 2HHTA 4JRPA 4CIGA 4MKBA 1BIZA 3M8SA 1RTDA 4CIEA 3KJVA 1ZBIA 3VQ4A 4NYZA 1JIHA 4K8XA 3LZJA 4CGGA 4DQRA 4KKOA 3KK3B 4F4YA 2X74A 4CHQA 2BE2A 1KVBA 4MIAA 1FKOB 4K4XA 3O3FA 1FK9A 1T7PA 3LWMA 5KRTA 1RCHA 4FW2A 2PYJA 2R8GA 3PX0A 3FRZA 4FM2A 1S1UA 1LAWA 3SFUA 3PX4A 3T19A 3AA5X 1JXLA 1WSGA 4FJMA 4FJXA 3TR8A 4EP5A 1S1VB 3LP0A 2IJFA 3OYMA 2V0NA 4Y1CA 2WHOA 3HSTB 5DQHA 5EU7A 2V9WA 1TAUA 1KHVA 4CJWA 5C5JA 1KLMB 3SFGA 5F8HA 4K4VA 3S3NA 4PUOB 4E1MA 4PY5A 2BDPA 1KTQA 4KHNA 4CEAA 2XO7A 5DG7A 2R2SA 3CJ2A 4KV8A 3DLGB 5HLFA 4MKAA 1KLNA 4H8KA 4XPEA 4YR3A 1O1WA 5KFIA 3QINA 2IOCA 4X2BA 3RTVA 4DSJA 4DFMA 1HPZA 3K2PA 3HT3A 1JLGB 5EDWA 1NK9A 4FJJA 3HXMA 2IDOA 2LSNA 2QKKA 5KFVA 2ALZA 1NOZA 3JSMA 3AVAA 4OVLA 5KFKA 4IH7A 2W9BA 4FVMA 2DTUA 3HKWA 1FK9B 5L1KA 4DU4A 3CJ4A 2NUBA 4Z4CA 4ID1A 4CF2A 3DOKB 1S10A 4Q8EA 4W5QA 1CSJA 3DLHA 1RT2A 4NCAA 1YTUA 3CIZA 4W5NA 4KTZA 3KKSA 1XR7A 3KK1B 4NLRA 4NRUA 3DRSB 3ICLA 5EWGA 2F96A 5J2PA 3AO1A 1IKWA 3OYLA 3ZSZA 4XIUA 4CK3A 4DFJA 1YVUA 4WE1B 4Z4HA 4KB0A 3H5YA 4EBEA 2XHBA 1JLQB 4Q5VA 1BISA 3QNOA 1RT5A 4DTRA 2GUIA 5KGWA 4WXOA 1KFSA 3THVA 4DFPA 2UVRA 3DLGA 4KV8B 5HLFB 4Q0BA 2VA2A 3HPGA 1XC9A 4CFAA 3VA3A 5CYQA 1NJZA 4FJLA 3HYFA 3P1GA 1OS5A 2HAIA 2ATLA 1D5AA 1L5UA 2KZZA 3ALYA 3OL7A 1GOCA 3H4DA 3GIJA 3V9WA 1IKVB 3SUPA 4ZPAA 1NKBA 4RW9A 3DMJA 4FLTA 3DYAB 1ZBUA 5HP1A 4AHVA 1VSJA 2YKNA 4LSNA 4ECYA 3VN5A 5KG1A 3OYDA 4ZVGA 5C24B 5FRMA 3P5JA 3ZT0A 4FJ9A 3V6DB 3IGNA 2AGQA 4LY7A 2HNDA 3PX6A 1GX6A 2P51A 2XCPA 1TKDA 3AA4A 3OSNA 3LZIA 3N6MA 1HNIB 2GIRA 5J1EB 1HYSB 1RT7B 2VWKA 4Y2AA 4DTPA 1XI1A 2C28A 3OYJA 1RTHA 2W9BB 3GV5B 1C1BA 3I5BA 3DLBA 5KFLA 3PZPA 1DLOB 4HTUA 5CY4A 1J5OA 4KKOB 4AHRA 3QESA 4IH6A
chains in the Genus database with same CATH superfamily
3QFUA 2CQ4A 1JNRB 3T7ZA 4DU1A 4WQ4A 2LECA 3SZ2A 2JEFA 2E20A 4AHTA 1HBNA 3GIIA 2MKKA 1RISA 4LF2A 3R5JB 1UA0A 1DEJA 1YSJA 2X3GA 3BB5A 4DQIA 3FLCO 1ZAWA 3K7RA 4LRFA 2QL7B 2UUAK 3DNCA 2DK2A 1ZAXA 4NYPA 2IAJB 2OPQA 3CC4S 1JL2A 3WNEA 2XZDB 3ATUA 5DQGA 2ZH8A 1Q1KA 4JKDA 2IM0A 2P9PA 3DLKA 1GLBG 2F7VA 2E1RA 5LJWA 3IS9A 1SC3B 3TANA 5GAGU 5LM7E 2DY4A 2QXLA 2RRBA 1RWKB 1ZXOA 2O8FB 1IV0A 1BUXA 4O4GB 4NZ7A 3NGYA 4PKGA 4ETZA 1ASWA 2CWXA 4CJ7A 4CJ3A 2MY7A 2DR6A 5B7WA 1Q86T 5M1PA 2D0OA 1H2UX 1FFWB 5M1OA 3AT1B 4UOFA 1BWVA 4WFYA 2F9JA 2VIHA 4L3QA 5B08A 2Y0BB 3CMAN 1ZPVA 1R43A 4FWSA 2MDAA 2DYAA 3DGPA 1FF2A 2BE7D 1M90T 4B3TF 1DQAA 2BKPA 4O3SA 3Q8RB 1YJUA 4AL6A 1RBUA 4EWTA 4LF4F 2MSSA 2QX0A 1WAFA 1FD2A 2O8BB 3NVMA 4EZ6A 2O8CA 1G3OA 5C0YA 2HZAA 3V9XA 4FF4A 2XSJB 2VB6A 1KXPA 4K8ZA 4YY3F 5FD1A 2MTLA 4ECRA 4DUYK 1BQMB 2DKOB 3G8TA 5CYJA 3GFXA 2H4WB 3DRRB 3J81O 1WB9A 3K5NA 4K43A 2QO3A 1KD1T 1LK5A 3BH7B 3VEZA 4K59A 1GQEA 3QNWB 3J7ZO 2OEJA 4OJGA 2DGVA 4F26A 4IFEA 4J91A 4V19X 3OTDA 1TYQA 1U6BA 3OXFA 4P52A 2R4FA 4L8RB 1HMVB 4JI7K 2R8IA 1HBUB 3HPHA 4MO4A 4OYZA 5F8MA 3BF1A 3BSOA 2YNGB 2CQBA 3CPWM 5D4OA 4DTUA 1RTHB 3VQTA 2VQEF 3RSEB 3MPWA 4GVBB 3GB0A 2R8JA 4CZIA 1J54A 1NH7A 2Q6BA 4AT1B 3CWJA 4IDKA 2I7NA 4WQ5A 2OPRA 2XQCA 3LP1B 4E7LA 1IH7A 4IXCA 4H5RA 1SH0A 5J2QB 4LF8J 3M8QB 2LXIA 5C25B 3V6JA 2YHXA 4LRCA 1VQ7S 1SIZA 4QR2A 2BACA 3IR7B 2BM0A 2WTUA 5FJ4A 3TUIC 2YNIB 4GKKF 3IRXB 2KH9A 4IYQA 3UWTA 4DN0A 4RX6A 4X64F 4O3RA 2OPSA 1N36J 4XDDA 4F3QA 3R2DJ 2BX6A 2P9GA 2FVRA 4JN4A 1VQKS 2EC2A 4QIEA 2FVSA 3W2VB 3KK2A 1Q81O 4LF6J 4I7FB 1RWWB 1ASUA 2CJKA 3FVYA 1GAOA 1QSLA 2HRYA 4HLBA 1LKZA 2R7SA 1BCOA 3IS9B 2VG5A 5HSPA 4H0VB 2OP5A 1VQNN 1X4CA 3I0SB 1H7WA 4DXLA 1BU6O 3D7SB 1HLUA 2LMIA 2HVIA 4Y2CA 2V7ZA 2O8FA 4ZK7M 3UDLA 3ISNC 1VIXA 2GHVC 3VQ6A 3KLIA 3AVHA 3WXJA 4CO0A 4KYZA 1HMVA 1BI4A 5AQLA 4ZCKA 5CA5A 1RHJB 1IR2A 3EICA 4B3RJ 2JX2A 3CJAA 1SI9A 5CAAA 5KFFA 3SPYA 2FDNA 2YNHB 1F2GA 3IXQA 4RWTA 3W5ZA 2GO8A 3SMSA 4USTA 4BVPA 2YWKA 2M3DA 4DOZA 4JKGA 1PG5B 4V1Ak 2X51A 3PO5A 3DOLA 2NRXA 3I32A 2EFQA 4JV0A 2GTDA 3ZSQA 5KAKA 3I55N 2H9ZA 1V9OA 1V3ZA 2V2ZA 4CF0A 3RBZA 1VHIA 2OMLA 3CDEA 2HNYA 3MAQA 2DISA 3M1VA 1PJ6A 4F8RA 3C94A 1VSDA 1YVFA 1MA9B 3BO4A 2YHWA 1VSEA 3DJCA 4FPRA 3F41A 5B0DA 4J8FA 4IFYB 3HI0A 2MSTA 4QWEA 4KGVB 4YOVA 2QI2A 3Q2TC 5KFHA 3CD5A 1S1XB 3VGTA 2CPIA 3R5AA 1YHQS 3ILJA 1X0FA 1M90O 4E7IA 3TAMB 5SWMA 2AX1A 3W61A 1IG9A 2HGLA 4CIFA 2I6WA 3A8YA 2BEFA 5C42A 2ZKTA 1BA0A 1X9JA 1TELA 5KOXA 2DY1A 1SKRA 2AKWB 4ZVQB 4FJKA 1CC7A 2O67A 4CH1A 4CJEA 1FW6A 2YNHA 2E66A 4U7UK 5U47A 2CKWA 5LL6d 2F9WA 4ZMMA 1GLCG 1WSIA 3H6EA 3FEXB 3BEXA 1HNWF 3OUYB 3H25A 3TJ8A 4DR2J 4YHHJ 4ZLPA 4O0IA 5J2QA 1VQ7N 4XEIA 1S0VA 3KWMA 3BDEA 3MM8A 1K8KB 4WPAA 1HRHA 3SBMA 4G6VB 1XMQK 1OPZA 4X4UA 1KDNA 4NYFA 2FZKB 3QWPA 4GO7X 3D66A 2MB0B 1WDTA 1C0GA 1BQXA 1BG3A 1Y97A 4WFZA 1PC5A 3MM6B 4DR2K 2HMIA 3VQDA 1Q18A 4BR7A 2XLIA 2BUNA 1VDHA 5IV3A 1EO1A 1S0MA 1YI2N 3RBDA 1YRXA 3DDKA 4BR9A 2KT5A 3OSPA 1RT1A 3HHNB 4FF2A 2WZ1A 1CJKB 3C19A 4H0TB 5F3ZA 2UVVA 4RBTA 2E44A 2RAQA 2DNLA 3HKZD 4NYOA 1U1OA 5ETTA 3OYFA 2QTDA 4P10A 2P9LB 4LJMA 4J9KA 5IQ6A 2PFFB 1DTQA 1TQLA 2FLPA 3D54A 1JKHB 3NKYA 2ZF5O 4X84A 3TQEA 1GMWD 1RQ0A 1FEEA 2QYCA 3OJUA 1VAZA 4JK8A 3SQ0A 1KVCA 4X66F 3QYYA 4WTOB 1VRUA 2KFYA 5ADZA 4CFBA 5BRHA 4NA2A 5AJ3K 3HLUA 2V8GA 4M42A 1SUQB 2KTQA 4P73A 4PYAA 5GADU 4E19A 4WYWA 4EI2A 4RU2A 2UXCJ 3A0IX 2ZBCA 1AYEA 1YTAA 5H9EJ 4WP8A 2UZAA 3IFRA 4FKYA 2JFDA 2VQEK 2CPHA 2KDOA 4FWOA 3EVOA 4FBTA 3MEGA 4PCQA 4E7HA 1T03B 4JKHA 1N5YB 4IG0A 3H0PA 4QIFA 4NI2B 3ISND 4O44B 4A2AA 5AQMA 4LREA 2R2RA 2IA6A 1UVMA 4ZP8A 3TSQA 4ILGB 4KB1A 5H9FK 1J27A 1PJ7A 2ROEA 3TJ9A 3JAMY 3QFWA 3NGTA 3TWZA 2I2YA 3QZ7A 1HL6A 4ECZA 2I1RA 3E9OA 1VBYA 2B7BB 4I2QB 1LFWA 1IKXA 2B9XA 3OVBA 3W3SA 5JUMA 4WQ4C 2P6SA 3P4IA 4ZITA 2O8DB 2HBLA 1GLEG 2GA7A 4JI6F 1U0HA 3KDNA 3CCLS 2ZE2A 2WVDA 4CTAB 1I1GA 5KQ8A 3M8WA 2ZHAA 4UUWA 3WZ0A 2AWZA 4D3HA 1G7CB 1S6PB 1SUQA 3THYB 3M32A 2UXBJ 4HTJA 4P6QA 1NBWA 4JV1A 4DR2F 1VFJA 4C98A 3HFVA 5ITHA 3V1RA 4QCLA 3NF9A 4F0KA 5AT1B 3CCMN 4B9NA 2KW4A 2NXNA 3R5CA 3GDQA 4JI1J 4LFCJ 1C0TB 4BREA 1WEZA 2CFXA 3AHPA 1Y5NB 5SZTA 1IXKA 1XNRK 1EETA 4ELUA 2JOQA 2CIMA 3RR8A 3EKUA 3SQ1A 1R31A 4E0DA 3LO3A 3LM2A 2VGNA 4OLPA 1WKLA 1C0MA 4OPKA 5L39A 2J7KA 1LCUA 3NCQA 1Y7PA 4CEOA 3I5AA 1GXTA 3MMAB 1NJXA 4AM7A 4I2QA 3OA9A 2W2PP 1VSFA 4CFCA 3RAXA 3D2EB 4CEQA 2BJ1A 2YJEA 4FM0A 3EZ5A 1XNRJ 4DR6K 5F8LA 5EUHA 2UU9J 3GV7B 2XTJP 1PBUA 3N6LA 5A8KA 1KEKA 4C11A 4OZLA 1BY9A 5I3UB 5FDLB 2YNGA 4N41A 2Z2MA 4USJC 5LJVA 2DJWA 1HQUB 1DT9A 3KMQA 3M32B 1WOQA 2E1MC 5AQOA 2R8KA 5LXYA 2WVBA 3AA8A 4TLRA 3RU0A 3G9CA 3OV7A 2GQCA 1AB8A 1WORA 3CM5A 3T5KA 2E7VA 5C24A 2BE9B 4AFFA 3RRKA 1TUUA 1HQEB 5J2PB 3US5A 4OKEA 4F3TA 3VGUA 4IWVA 4JLHA 2HF3A 2NXUA 3VVTA 4X65K 1QS4A 3L7UA 2E88A 1SKWA 2CZVC 1RJJA 1PIEA 2QMUB 8ATCB 4H0YB 4ED0A 4I9QA 3ETOA 2RB7A 3JXUA 2GV1A 2DH7A 3G25A 2VPXB 4HI2A 4DR3F 3CYMA 2LA4A 3NG8A 4DTSA 2HNDB 3DHWC 5G0RB 4EHUA 1K9MT 5HP1B 3BQ1A 4QWCA 4H0OA 4JI6K 2OTJN 4QR0A 4ED3A 3C16A 3S8SA 2V94A 3MPUB 4O44A 2BUPA 2D0CA 4J9RA 2F4FA 4AUKA 3DOMB 1FDBA 3KLGB 1FKPB 2K3KA 2FSJA 4KY3A 4KREA 3CC2N 3GR0A 5KFJA 4IH5A 3HTVA 2FBTA 2DIUA 2CPYA 4E89A 1WHWA 1RT7A 2P9NA 3TP2A 3BO3A 2CYYA 1U0SA 5KT5A 2F63A 3HHLC 1NEEA 2OEKA 5T7LB 1VI7A 5AQXA 5L1IA 2Z2YB 4DPYA 1GLFO 1JLQA 1TKTA 2C3UA 1M5KC 4GKJK 3KNGA 1N36F 5I42B 3CXCM 3HZ6A 3CCUN 2ZE2B 1R8PA 3B6OA 3LPUA 4NA1A 1TFWA 4F4KA 1CXQA 5FPDA 2CGKA 2IM1A 4M3TA 1VBZA 4A8KA 2BJDA 2CQ0A 4RO0A 4X64K 3A12A 4RUAA 4FZYA 2I5JB 4WZMA 3D67A 3GCWP 3KJNB 1CVJA 1YAGA 1QSYA 4WKYA 2FZCB 3W66A 1U04A 3D6HB 2Z0GA 4ZN1A 4AL7A 1CZ9A 4JRQA 4GKKJ 1WUAA 3U4LA 4CJQA 1U7LA 3U3YA 1VK0A 3T1HF 4WIQA 1V4TA 1OQ6A 2B8QA 3CT9A 4R5PA 5EVZA 5AJ3F 5BJRA 1VQKN 3BY5A 5KQDA 3OW2R 4ECUA 5H1SV 4DMNA 2G13A 2ASOA 2VQEJ 2DR5A 3BN4A 2HQCA 2CUYA 1N54B 1NSPA 4U7BA 4LBIA 2B3TB 1WSJA 3L7OA 5DDPC 4A62A 3EY1A 3TWHA 2BZ2A 1OYEA 4DL6A 4O0NA 5A2QY 1RT6A 4UT4A 2MHNA 5KFGA 4LF9J 3DFEA 2KZMA 1XNQJ 2IIHA 3J81U 3V1OA 1V3SA 4CGDA 4ZVOB 2ACMA 2DNYA 4X4OA 1FTRA 4NXNK 1FVSA 4BRKA 4K25A 2P1JA 4AILC 4J5OA 1P6TA 3KLHB 1S9GB 4YDXA 1HUXA 2GWKA 1RBSA 2H3GX 4F2SA 1HYZA 1Z25A 4M95A 1NKEA 3CJQA 4LFBK 1N52B 5BYQA 4CJPA 2KN4A 3HOSA 4PWDA 3MMVA 1HHQA 2QLJB 3I87A 2DFHA 5TKYA 3RG6A 3A8KA 4PG6A 3EGVA 1K6YA 1ZTWA 1APSA 2PD1A 2HBZB 3T1HJ 1QE1A 4MIWA 3IG1A 1ITPA 3OYGA 4FZXC 1NGDA 3LALA 2D0AA 4MKYA 1WSHA 2WCXA 5BYRA 4JHDA 3FCWA 5LMNJ 1LWFB 1HNXF 3GQCA 3W2VA 2IMWP 4WP9A 1N33F 1CEZA 4I7FA 4FVCA 3CDAA 1DTTB 4O55A 2ZEJA 1N5QA 2VBWA 1CULB 2BR0A 3O80A 2GQQA 3AJ2A 4E1JA 4OZJA 4EMDA 3MK6A 3HK2A 4H5TA 4F3MA 1FDAA 3W2WB 2IVPA 2D3UA 1VQMN 2PFDA 2PT0A 2A5XA 5DQIA 3G6EN 2E5IA 4DUZJ 1N4LA 3PRVA 1KKHA 4HUFA 4UUXA 2CZ4A 3RW6A 3QIOA 3ULHA 1JLAB 2MGZB 3G82A 2DGUA 1R8CA 4J9OA 1JX4A 4ISEA 2GELA 3ZT1A 3CF5L 5L1JA 4CI6A 2EG2A 2MJNA 3WXMB 3RZAA 4FNHA 3E1YA 2QLWA 1RT4B 3N6NA 1JJ4A 2UV8A 3D4JA 4AE5A 3SUQA 3H1VX 1EP4B 4H5VA 5D8HB 1VQON 2HHXA 3DRYA 3M2RB 1NHKL 3KOAA 2F8TA 4CERA 2E4LA 1BHNA 1KFDA 3Q22A 3Q89A 4H54A 3D3CJ 1UA1A 4J9UE 2HNZB 3TZYA 1NGBA 3J7A1 3M30B 3H59A 3I0SA 3BDPA 4DR3J 3NOGA 4E7KA 1ACMB 4KTWA 2AYBA 2P9UA 1VQ6N 2E1YA 4KI4A 2VASA 2R7WA 3VERA 3MMCB 3Q86A 1LOTB 5CZ2A 3OVAA 1VC6A 2A6OA 4KFBA 4IOAQ 4W5TA 4F4WA 2GMLA 3MHYA 1MG7A 4C6AA 2CVEA 4ISFA 2UU9K 2HW3A 2Q0RA 3MAAB 2V4JA 4P72A 2GCFA 2QA4S 1LFPA 2Z1HA 1SJ3P 4JI8J 1UAXA 1SAZA 4N5SA 3OR2A 1IKYA 1I5OB 2BRLA 1D1UA 5E3AA 4CTAA 3V2UC 5KFQA 1UVLA 4RW4B 1WC1A 4OJRA 2R7XA 2Z56B 3QPIA 4OHWA 2RE2A 4DV2F 1FCAA 4CO2A 2BW7A 4KRWA 1DTTA 3GL1A 3AVLA 4JI4J 3SPZA 4ICLA 4CK2A 2D0PA 4DUYJ 3W9HA 1LWXA 5KOWA 4CJRA 4BC2A 3M2RA 1S7IA 5KFAA 1IN0A 1X8DA 3H90A 2PI4A 4ZHRB 1ZZFA 3BP8A 4M3WA 1KOOA 4P71A 3WC0A 5LSRA 4B1VA 2OKQA 4IQMA 1I3AA 1W26A 4FJ7A 1ZA2B 4NA3A 2UUBF 4R8UB 3W65A 4JI1F 1LWEB 3AD8C 5EOYA 1RGIA 4BE2A 5C2CA 4A8YA 4I9LA 2VC1A 2HURA 2CPXA 4NLTA 3AA2A 2MQLA 3R5BA 3CE8A 5HVGA 1TU0B 3BGOP 1YBAA 1QQOA 5KG2A 3BYRA 2E5LK 1S1WA 3CCZA 3BR8A 3TAPA 2RHSB 3KUEA 4BCAA 3W2WA 5ETRA 4NLQA 1FJGF 2O8BA 1VJWA 3JXOA 5A8WB 2NZTA 4JEPA 4IRDA 1YJ9N 3HMJG 3OLBA 1RTJB 1GLDG 4M5JA 2C2MB 3VETA 1TKZB 2VG6A 2VJUA 5JICA 2ROPA 2HQDA 3HDSA 1WSRA 4URSA 4E8UA 4CZHA 2COLA 3QJJA 3VAIA 4HWIA 2K7KA 2UXBK 3HHLA 5A6PA 4K50A 5A76A 4ZJOA 3MUMP 4ECTA 3O9RA 1TUWA 4DR4J 4FXWA 2NRRA 3WXIA 4USWA 4ECQA 2RF2A 2W01A 2F65A 1U1RA 2ZFHA 1XBWA 4UQGA 3WC2A 3G4SN 4IO9L 4FF1A 2XZWA 1Q16B 1RYSA 3O1LA 3PIPQ 1OPIA 2VFUA 3WX4A 1NU0A 2A18A 1K0VA 4LF6K 1S57A 2FUG9 1FJ7A 3OD2A 4CYUB 2FC9A 1DTQB 5ADXH 4H4KA 3IR5B 3WIUA 3ZX3A 4TNOA 1SKSA 3C3LA 3R7SB 4A47A 5BRFA 4YN3B 3CC7N 3H98A 2V6AA 4ZLNA 4C9DA 5CYMB 4PR6A 2FBVA 1NK4A 4O8UA 4FOEA 1FWLA 3VZHA 1DAXA 2MHEA 1NJIT 3R27A 2V8HA 4WFNL 4BY9C 3O2IA 4A4JA 1GOBA 1K73O 1FESA 3K58A 4DZDA 4K4TA 4WYLA 1XQSC 2DNHA 4IQXA 5KT7A 3EKSA 3HHEA 2YKMB 2FBXA 1SQKA 4BC5A 4DMZA 2IC3A 2ZHOA 2XMUA 2L9WA 4IG3A 1IKVA 1HR0K 4DLGA 3H8YA 2B0GA 4CLTA 4Y0WA 1VQPS 1WNSA 3WNFA 1TKXB 1VRTB 1TMMA 4KH6A 3NS7B 1OYDA 4U8YA 1Z6RA 2OI2A 4CQ1A 2A3ZA 3DRPB 3L2QA 3THWA 2LKZA 2NXJA 5GAHU 5FRNA 3WQPA 2XULA 2DIVA 4M41A 1Y11A 3WEEA 4M5DB 4HT5A 3LDNA 2R2UA 1QLNA 2M5YA 4N77A 4DX5A 2AYGA 5KFRA 2VJVA 4RNOA 2Q31A 2CPFA 2UXDK 1ZBHA 1TVRA 4JRPA 3M8SA 1RTDA 3R6LB 1ELOA 3H45C 2Q1LA 1FKOB 4K4XA 1FK9A 1UPMB 2DRDA 3LWMA 1T7PA 1WC3A 1RCHA 2PYJA 2Z30B 2R8GA 3PX0A 4FM2A 3GFYA 3NRBA 5ETNA 1LAWA 3T19A 1YGYA 1JCFA 1Y9OA 5B0CA 2WHOA 3HSTB 5L46A 5DQHA 1VC0A 1E4GT 3D3BJ 2V9WA 3TEHB 1NMEB 5C5JA 4W90B 5A8WA 3M6GA 3S3NA 4RTFD 4OI6A 2P6TA 5J1PA 1BO5O 3JB9k 4KR0B 2QSFA 2NYIA 5IC4B 1Z05A 2F7TA 4MKAA 4KV8A 4PXCA 3QT6A 5KFIA 3QINA 5AQGA 4FL9A 3I56S 3CETA 3UFCX 2Q0UA 4QYZJ 4CZKA 2CPDA 4DFMA 2AYMA 2KB2A 3P4UB 1TR0A 3BF4A 5DDQC 1RB0A 4FJJA 2J8AA 4DV7F 3T1HK 3O9UA 5KFVA 1OY8A 4DV3F 2FIUA 1NOZA 5EY4A 4DV4J 1RU2A 4IH7A 4J7CA 1NH8A 4DU4A 3CJ4A 2NUBA 3TX0A 4Q8EA 2YY3A 3DLHA 3IMXA 1YTUA 4C4WA 1X7VA 3CIZA 4KTZA 2RS2A 1XR7A 3KK1B 4ES2A 5EWGA 2F96A 4CD3A 2H65B 1SB6A 4M5MA 3A3NB 4GY2B 1UW9A 2JDJA 1VQPN 4JI5K 4DFJA 1CQMA 3MMAA 2JNJA 4WE1B 1VOMA 3GG4A 2LU1A 4Z4HA 4KB0A 4IO1A 5BPMA 1GK8A 4BG9A 1NPPA 4Q5VA 3QNOA 2NRTA 1RT5A 3R1LA 5AQHA 5KGWA 1PAUB 2DNMA 4GNIA 1KFSA 2ZH2A 2FHJA 3ZETA 2DHHA 4Q0BA 3HPGA 2XS5A 4CFAA 1PYSB 1HI8A 3OTBA 5JMNA 3P1GA 3ZTQA 2KZZA 3ALYA 3OL7A 4YOTA 3VPZA 3H4DA 3GIJA 3V9WA 1IKVB 1IWAA 1UFLA 4ZPAA 3C6AA 1NKBA 4OO1J 4FLTA 1MLAA 4FWPA 1VSJA 5AQKA 2YKNA 4ETXA 2QN6B 3MDQA 4OX9F 2QTWA 4CIOA 3OYDA 2KXFA 5C24B 3E9LA 4B3RK 3CMQA 2JLFA 1FNXH 5FRMA 2AV5A 2ZUAA 1U1KA 2GJIA 5HQ8A 1CS4A 3V6DB 1FX4A 3IGNA 1WJ9A 4CO4A 2F8HA 3OFHA 2CGJA 2P51A 1FXLA 3DN9A 3TA0A 3OSNA 3GP9A 1FRIA 1CJKA 5F1XA 4PHTX 1EB0A 4WCEQ 5J1EB 1VQ8S 3P8BB 1U1PA 2FHJD 3OYJA 3CJ1A 3TTCA 3RBXA 1T9TA 1C1BA 4RUHA 3DLBA 3PZPA 4HTUA 5CY4A 1VQ8N 2IDEA 4WP3A 1EJ7L 4YORA 1KVIA 4KKOB 2KVQE 1FNOA 2F8MA 4NLYA 3M8QA 4HKQA 3TX8A 2MQOA 3M2UA 1Q8IA 3SEOA 3FZMA 1ATNA 3K89A 1IJEB 3EUNA 2GX9A 2LCWA 4BR5A 2RU3A 2DNPA 2Q97A 3NAEA 4C3LA 5KG6A 1FE0A 1CC8A 4J9VA 1S6UA 4YR0A 2HS0A 4X4SA 3P96A 2A0FB 4GKKK 2DT9A 1SC1B 4FXDA 5DDRC 4OJHA 1RABB 4DV7K 4DV3K 3I0RA 2NUUG 1Q82O 3JSMB 5ETPA 2VODA 5T7BA 2MQQA 2ABYA 3LP1A 1GOAA 3DRRA 4HVZA 4URGA 3CCLN 4FNIA 1VQ6S 1B9DA 3GR1A 5I3QA 5KRSA 2YNIA 1FRHA 3MUTP 1HNVA 1RAJA 3GFHA 3MX5A 1SL1A 4YDUA 2HQFA 1HPZB 5KG5A 3O08A 3L09A 2QMWA 1VHFA 2WSCC 4A48A 1F5BA 1HR0F 4DG1B 3FR0A 5IS2A 1XR6A 1BMQB 5KG7A 1RGVA 4FJGA 2CQCA 4QR1A 4HHJA 1XQIA 2MQNA 5CD4A 5C15A 3ZTSA 1R27B 4KHMA 4GW6A 2AGPA 2C42A 2RU9A 1FDDA 3MN6A 4M94A 3G86A 3QJPA 1ZBSA 1VIOA 1SC6A 3ZT2A 3W8GA 4C7QA 3K0JA 5K14A 2DPNA 3CJCA 4JK7A 3RSEA 3IG1B 4BQZA 2Q43A 3M2UB 1RWVB 4U7CA 3NMAA 4KBIA 4TYBA 4OZ5A 1VCTA 2YH1A 5CD4H 2MYFA 4FK2A 2QEXN 3WXKA 4KHWA 3VEYA 4ZP9A 3LP3A 2NXEA 4CLYA 2J6UA 2E1AA 2DNOA 5FPEA 2PE8A 2B7CB 5JJBA 4QWAA 5L9XA 3CQXA 2X6SA 4U95A 2FJEB 1S9FA 1NK0A 4LFCK 3U7JA 3SV3A 2HBMA 4C0BA 3PXGa 3CB4A 2A3JA 1RLCL 3FFKB 2XM3A 5KFEA 3M1FA 3CMAS 2IJNA 5F41A 1KC8O 1HI0P 3J7AN 3BR9A 2V52B 4DV5K 1KHWA 5LSLA 5IOLA 4U7UD 3QEPA 1FFGB 3PKMA 1NKCA 1LWFA 4CVNE 1IG8A 5CQGA 5JS1A 2BJ3A 3UCUP 3TTDA 1NGGA 4M63C 3ZT3A 1FKAF 5C2FA 1KTVA 4MYUA 2OJ3A 1RLDA 2VG7B 1XIQA 4QAGA 3RBEA 4GV3A 4HCCA 3TR5A 1N5TA 1DY3A 3DGPB 4IOCQ 3LDQA 4ZTFA 4B8CA 1U1LA 2JH3A 4JYAK 2JVRA 4JI3J 4PQAA 4C8YA 4NYNA 1BXNA 1X5SA 3LOUA 4G9ZA 3EGNA 3F56A 3DOLB 3PY8A 1NDCA 2DGQA 5C2GA 2YXLA 3GYXB 4C0OC 5HBMA 4DV6J 2YQ3A 2ZD1A 1S72N 1RAOA 3OR2B 4YMEA 4X4QA 4F02A 1N34J 4FK4A 1WHXA 2EK1A 5ETQA 3F0NA 4ZP7A 4NLPA 3OL8A 3UB5A 2HS3A 2P8IA 4DL5A 3LP2B 1GX5A 2R42A 4KHQA 1HI1A 3SK3A 4TYAA 1ZTTA 3C2PA 3E01A 2RN2A 4L72B 3KLEB 5DGBA 4WU2A 4ZDNA 1YT3A 3JTPA 2MY8A 3KHRA 2F1FA 4JI3F 2YQ0A 2Q79A 5A8RB 1HNZJ 3DXMA 4DWIA 3A8JA 1S1XA 2QFIA 3K5PA 3OPKA 2YCHA 3IFEA 3SSSA 2H51B 4KE5A 3C7NB 1GMUA 3NGIA 3D1OA 1JLEA 1NAQA 3CFPA 1QQNA 5E33A 1H2TZ 5FPMA 1CJUA 2JZ5A 4XH4A 3MXMA 3JTNA 1K1QA 2UYTA 5J2MB 2ASPA 1WOPA 5E3PA 4M8LA 5DM6L 4IKAA 1OQ3A 2IVMA 3DM2B 1SJ1A 1T9YA 2DBBA 4EO8A 3HULA 1JLCB 2R7QA 1C4AA 4KTQA 3CCQN 1S97A 2R7VA 3TEGA 3UVJB 3ZEUA 2CWKA 4A8MP 4MFBA 4FYWB 3V4IA 3CCWA 4I4BA 4IDKB 1S1VA 5AXLA 2ZITA 2VPYB 4X4RA 1QJHA 4BC4A 1D8ZA 4BE0A 3KXDA 3VTIA 1EAYC 2XMTA 5I9EB 1N32F 2Q2RA 4M5GA 3M6XA 4WFNQ 3VQ8A 3THXB 4RW4A 4OMFG 4FM1A 4ZTJA 3KDOA 2CNOB 5K8NA 2BJ7A 1OO0B 2YX1A 2FVCA 1OWXA 3OTCA 4NEZA 1UZHA 2PEHA 3PYFA 1NJYA 1IBKK 1K73T 4NLSA 4KO0A 3I9V9 5KFZA 4O5FA 4IKFA 3V4MA 4CLFA 3FFIB 1ZM3A 2Z2LA 4QW8A 2UUCF 4NXMF 1J5EF 3CVKA 3VQAA 4ILJA 1G1XA 4IUFA 1JL1A 4QPXA 2W6KA 1DURA 2JC0A 4OX9J 3MM7A 3MM9A 1XNQK 4ZS6A 3FBEA 5K8OA 3AVBA 5M2UA 2HFZA 4JP8A 4YFUA 2BJ8A 1BGXT 2I0XA 5DDOC 3P38A 3I4PA 5D6GA 1JXVA 2CJXB 4LC9B 4AYBD 2QWRA 3QIPA 4CE9A 4PL7A 2KG0A 2WBNA 2PI5A 2NXCA 2AW0A 1AZSB 2U2FA 3MURP 2KHCA 1KAZA 1AT1B 1K9MO 4DTJA 3WDOA 4IRCA 1LW0B 4ZPVR 3IUCA 3IBWA 3NAHA 1RDUA 3QBWA 3H4BA 2W24A 3CD0A 2IVOA 4F4ZA 4M3ZA 3VF0B 4ZVPB 4OPJA 1NXIA 3MZIA 3AY0A 3T3FA 3MPDA 2VKZG 2HVEA 2UUAJ 1A5XA 4OKJA 3M1VB 2MKHA 3CJ3A 2DNGA 4PXDA 4DI6A 3O44A 2ZH9A 5GAHI 5CE3A 2ZZMA 4C48A 1D09B 2V7YA 3ENHA 1TKXA 2Y1LB 4C8NA 1MW7A 5LJ5Y 5DZ7A 3MN5A 3CJ0A 4BWJA 3FFIA 1J53A 4NOHA 1TKZA 4B3MF 3EZWA 1NSAA 1UEKA 4RW8B 3WUHA 4ED5A 4BRDA 4ILLA 5F0XA 3AARA 2ZJQQ 3QATA 1RZMA 1N5YA 5BPLA 3QT7A 2BV3A 4F2RA 4KB7A 1E4FT 2FC0A 1GMVA 4OLAA 4P2FA 1AXQA 4B3SJ 5JS2A 1EKEA 5JVGL 3ZYYX 2PYLA 4DHYA 4NMLA 2A40A 4PA1A 2WSEC 4AXJA 2QWPA 4Y3CA 4JI0J 2BANB 1HQUA 1VQ5S 2IIRA 5IT9U 5JVHQ 1GEHA 3MOJB 4CLSA 4LF7F 3I8DA 3DRPA 2RT3A 3ZTRA 5AQWA 4QWDA 3AAQA 4DR1J 1V3RA 4CJ4A 2BBEA 4A57A 3EZUA 3DKDA 4GVEA 3ZNJ1 2M8HA 4B3OA 1UAWA 3HVTB 3FBCA 1B0TA 5AQSA 2Q36A 3VQ9A 1S4EA 1D9DA 1S49A 1UJ4A 3AVCA 2J6SA 5AQQA 3T6JA 4C8MA 1EX8A 2RF2B 2OO4A 2XY7A 4LRBA 2A2CA 3UNGC 1YZ6A 3GWCA 3LF0A 4USMA 1W2IA 4F9OA 4GC6A 3MEEB 2ATQA 4LMZA 3W7BA 3I33A 3NNHA 3D45A 3GJQB 3FCHA 1KONA 4OX7A 1MWKA 1UTAA 3KLVA 3N01A 2GVDA 2VH7A 1FJEB 2GWJA 2CADA 4RWXA 2HHHK 4H4OB 3N9UC 4CNZA 1Q53A 2NPIA 2MLZA 1YITS 4ID5A 3ILLA 5J1NA 3R2CJ 4CJTA 2JGUA 3N79A 4LF8F 4BDPA 5IXUA 1HWKA 3LWLA 2KYZA 1PGZA 2NNWA 3NMRA 3ULDA 2FF6A 9ATCB 3T41A 5DM6Q 2D3OR 3ZC4A 5GAEU 5AXMA 4DLEA 4CEEA 4B9QA 2KKZA 4IR1A 5GMDA 4DV6K 1R6YA 4BQLA 7AT1B 5AXNA 3AO2A 4NLXA 3UR3C 4KHPK 4EEYA 1MNEA 3SQ2A 1FKOA 6FDRA 1RAIB 3TARA 1OY6A 1RWMB 1Y3JA 1WI6A 3SMZA 4F4XA 1VRTA 3KKFA 3HFKA 2BRKA 4W4MA 4B3MJ 2K7JA 2UU9F 4KGXB 3OUYA 3BSCA 4BLGA 4LFAJ 5GIOA 3CJ7A 3FNNA 1P8GA 2KYXA 9RUBA 4FLWA 3AD7C 3GONA 3VF6A 2AEFA 4QU7A 3MUVP 4JS5A 3NS6A 3PEJA 3PNIA 4CJUA 4FZZA 1IR0A 1UETA 1B0VA 2ZBPA 4LSNB 3PEHA 3AD9C 5DZ6A 5KGXA 4E2FB 1S3XA 5HQLA 1M5HA 3OHBA 2O4GA 2Z1IA 4NLUA 4YR2A 4HT7A 2K1RB 3UDVA 2I5JA 4DR6F 4PL8A 2V34A 4WFBL 1IKXB 3O9QA 3QSYB 1C1CA 3PJXA 1IKWB 3PHEA 4QOZB 1F0XA 4B02A 1NGEA 4PRFA 2W25A 4BC3A 4DR5K 4K4UA 2HKEA 1B7FA 4Q0BB 1WDDA 1AUSL 3CGIA 4DSIA 3CIPA 1PKUA 3RYLA 3KHYA 3UE2A 4WFAQ 3MPVA 3CCEN 3IN5A 1RT5B 3BKUA 2EEYA 2WRMA 2QWMA 3SDEB 2B9WA 3VAGA 2BXJA 2PIIA 4LVOP 3OTOF 4KHYA 5T7LA 5K20B 2GVZA 1J5EJ 3VF4A 4NXMJ 4NL5A 4DV1K 5F8IA 1YJ7A 3NXZA 3HOTA 3CJKB 1ZM2A 1KNZA 3AOAA 3AAWB 1IBCB 1N48A 1Z2ZA 4GVMA 2VONA 2WVFA 2NREA 1U24A 2J76E 2DRBA 5I4MA 1U09A 4USHA 2KVIA 4H03B 4JI8K 5BN9A 1EQ0A 1AUDA 4TU7A 1RE1B 1Q82T 4FWMA 1TFYA 3W8PA 3IAYA 1FWPA 1FEHA 4KH5A 4DZ6A 4EYIB 2OUGA 1SBRA 2LFVA 3GV8B 3KK2B 4FJ5A 4K0KF 1S5ZA 2M52A 3ZTOA 4ITSA 1X5PA 1R7IA 4LR8A 1GLAG 2LEBA 2WVCA 2RVJA 4RCHA 1NK8A 2N3OA 1QQCA 3AXKA 2NUHA 4ED8A 2BJEA 2K1RA 3DU6A 4CP5A 1KN6A 1UW4A 3SQGA 2WTFA 1GLLO 1JLEB 3G8SA 2ASLA 1KWMA 2GMJA 2LQ8A 2GVDB 3HCXA 3F5TA 5D15A 4I2PA 4WE1A 3VQCA 4V19J 2PO4A 3BZCA 4NZ0A 1EHWA 5HK4A 2VDHA 1TK5A 3M8PA 4HHUA 4OPAA 2W7PA 4DPOA 1P1LA 4Q8FA 4ZKAA 2EG1A 2FHMA 4JKGB 1V4SA 3VGSA 5EWEA 3SIPB 4DPXA 3HSGA 4CBXA 4O23A 4G3IA 1G4CA 3VVUA 2HIYA 3PFOA 4PWWA 3MF5A 2MJUA 1FJCA 4CHNA 5A2QO 2KI2A 5DM7L 2MGZA 3QBXA 2MZTA 2FZGB 3W62A 3SCLE 1H38A 3ZZUA 1KQKA 3ENBA 5BR8K 4FS2A 2F8SA 3BSAA 1RWPB 1FJGJ 4MQ3A 3UQSA 5A6WA 2Y3YA 1Q95G 5E84A 2W9CA 2JEIA 1H74A 2HWHA 4LFBJ 1YF5L 2G8WA 2BOPA 3UW1A 2RDJA 1BWEA 1ZA1B 2HSTA 5E2QA 5M2RA 4RKUC 4A8SA 1SC4B 3DLKB 2Z1GA 4C8OA 1U8WA 5RUBA 2RKIA 3KLGA 2V4QA 1M5SA 3M6UA 2QEXS 2ITMA 3HVAA 2XLJA 1JJ2R 3LA0A 5AFUH 2GS8A 3V81A 3W63A 1E6YB 4YHHF 1S9EB 5EXWA 3TAQA 4L73A 2D3O1 4DSEA 1AA1B 4JOUA 2Z4PA 3HSDA 1M1KO 4DL0C 4EP4A 2GX8A 2BOAA 2CQGA 2EPIA 3K5OA 4FXVA 3DDNA 3S7RA 2KXNB 4IR9A 2E6LA 3MCOA 4K0KJ 1MROA 3D6RA 4WKRA 2FC8A 2CJYB 4PG7A 5BPNA 5E7OB 4X62K 3THTA 2K8GA 3BZQA 3ZLJA 3M2VB 3CCRS 2B6AB 1I94K 3RUBL 4CGIA 5DETA 3E9PA 4LSLB 3DI6A 1UZDA 4LFBF 1ROFA 3EDRB 3VEVA 2A42A 1YJNN 2N7YA 2QG9B 3QQCD 4UY8T 5F8NA 2E7WA 3GPAA 1NZ8A 1QY7A 2GIFA 4A59A 4ZVSB 3OLAA 4FWNA 3ZZOA 4DUZK 1N8RO 1OMSA 1FXXA 1QVGR 2M7SA 4HACB 2J9CA 2C22A 2IA0A 2HG4A 1XMQJ 1KQSR 2C2RA 1JLFA 5HVHA 1HNXJ 4FBUA 3L2VA 2ZZNA 1WUUA 1IBLK 4K8RA 3OTEA 1KAXA 2OPPB 3T5JA 3ZZYA 2RHQB 3MAAA 2MQPA 2ATCB 1WTBA 2K3IA 3U1NA 2IFXA 3TJAA 4DPWA 1NU4A 2LLZA 4FO0A 5LY3A 2HQGA 2UUCK 1UWBB 5D4LA 2A2DA 2AJ1A 1TYQB 4Y2KA 4WK1A 4F50A 2XSJA 2CJQA 2YWHA 2J7UA 1X4AA 2G8UA 3UVJA 2ZKUA 1L3SA 4M1KA 3ASMA 2XWYA 3MR3A 3CJSA 2G0IA 2E6MA 2PY5A 2DPJA 3L4BC 3NNAA 2IHR1 4S0MA 2EX3A 5CABA 5MLCV 1WLJA 4XK8C 4P7TA 4FW1A 3G96A 4WF9L 3H7HB 1S6OA 4CWBA 4PWDB 5AXKA 3JTOA 3IRXA 2QIFA 3QDKA 5LXRA 4JKAA 2NCKL 1GFWB 1XUPO 5CHCB 4I6AA 3FGUA 2P9EA 1RILA 4UOHA 2AQ4A 4B3MK 2CNKB 2CQDA 1FWKA 1ZOTA 1YKWA 2BM1A 4M3RA 2ASYA 1N56A 1OIAA 2RNEA 5GADI 3HO1A 5HMZA 4MAKA 2SXLA 4LF4K 5DK5A 4CK1A 3CHWA 1TL4A 4NLCA 1K8AT 3AO5A 3J7YP 3L2UA 3C6TB 3Q8SB 1BOTO 5CCMA 4H4OA 3O1WA 3ELHA 3GJRB 2D1KA 2JVOA 3C7NA 3LPYA 1YI2S 3Q7BA 2FYXA 3UIQA 3SUNA 2JFKA 3HPOA 3VAJA 1R59O 5F8GA 1ASVA 3O3GA 5K9FA 1OJ4A 1AZSA 2H5JB 4RW7B 5ADXA 2MKSA 4BC9A 4RG8A 4HUGA 1NB7A 2J7WA 5BXIA 3HJVA 1SV5B 1HQ2A 4BR4A 5HROB 4F0HA 1HJRA 5B8HA 4WFBQ 5HN0A 3CCJS 3KIOA 2ZJRL 1PAEX 1NGFA 4LF7K 4R79A 3IC1A 3M30A 5KFUA 4TY8B 3SAGA 2V2QA 1KBRA 2LQ5A 3Q24A 1N33K 5GMKa 1HBMB 3QIPB 2P9IA 2QL5B 3MI7X 1XMBA 3KLIB 4IBNA 4DR7K 2ACYA 1IBKJ 3LL3A 4LF7J 4BRFA 5JVHL 1VQSA 4MTPA 1YJWS 4ELVA 4UY8O 4OV1A 4Q2MA 3MM9B 3RMBA 3LH2S 3ZSXA 3VAFA 2AEMA 2DR8A 4IOBA 4K4ZA 1N5VA 3JYTB 3L8BA 1RI7A 4CHZA 2LEPA 4MFBB 2RE1A 3C66A 1ZETA 4DV4F 2OZSA 4H0XB 2DGSA 4DV3J 2OFHX 1LQ9A 4KJIA 4ECWA 2R3VA 3SDEA 4GRSA 4DSFA 3U1MA 3GG1A 4WFXA 2EVZA 4KH1B 5KPRA 1S0OA 3JQMA 3QLHB 4B3TJ 2G9OA 5AQUA 2HGNA 1M1KT 3L6QA 2VPWB 3VZIA 2VA3A 5D3GA 3GJSB 2V68A 1HQEA 2HVHA 4HUEA 1F5AA 1WC0A 1S6QB 2WOMA 4L3KA 1YBTA 3WIVA 4OGCA 3I6PA 1QHAA 1S22A 1ZM4A 2C2DA 1TL7A 1I3OB 2CDQA 2DD8S 4E7JA 3LUYA 1W7WA 3HJFA 3GMGA 4AXIA 1Z2LA 4ZVRB 2ZNZA 1BCMA 3DWLA 4RW8A 1RDWX 2FJXA 3AODA 2O5DA 2DEIA 2CPEA 1WTFA 1FFSB 3AAPA 4Z4GA 5FLXO 3ENVA 3HZEA 2E1CA 4JAXA 2XZTB 2LDIA 3O4NA 3SQOP 4K7QA 1H3DA 1Q5YA 4LFCF 2WAQD 3HVTA 2BMBA 2RQKA 3ITHA 2XMMA 2HMIB 1RDRA 3TA1A 3A2FA 1X4BA 2HHSA 1RBRA 1NDLA 3PIOQ 4AH9A 3ETMA 2J6TA 2HGMA 2EBGA 3LAMA 4GVLA 1W25A 5B09A 4B08A 1ILYA 2DHAA 1HPMA 2C3MA 2F9DA 4TLQA 1CQNA 1URRA 4B1YB 4RR5A 4J9MA 1WEYA 4YDDB 1PSDA 3K57A 4DV1F 1F6TA 3TVYA 2FHOB 3J7Z5 4DTXA 3E01B 3B6BA 4L74A 4DCOB 1N6QA 3L7PA 5LL6Z 4KI6A 4FYDA 1RXOB 3KLEA 5C10A 3QLHA 1WG1A 2JRSA 3PHTA 3T1YF 2LP4A 3IRWP 4DV0F 5EHHA 2AX0A 4P75A 3NH2A 2XY6A 3MOZA 4CLZA 1HHTP 2YWEA 5LMNK 2NSCA 2D4WA 4B3TK 1S79A 4B9TA 2KHOA 1YZ7A 3T69A 2MXYA 3QGGA 1PBAA 4TY9A 3BKTA 4BRHA 3JYTA 2QLBB 4CIGA 2HLUA 5KPTA 2FY1A 4AL5A 1ZBIA 3VQ4A 1JIHA 4CO3A 3CJTA 2HMPA 3KWGA 4DQRA 4KKOA 4BRAA 2VGMA 1WHYA 2BE2A 3V5RA 1FRLA 4DCPB 3D2EA 1YQHA 1CBKA 2O8EA 2MLYA 2VHGA 4QPTA 1M5OC 4BVOA 4JI3K 3SBGA 1U2RA 2V0NA 2HIQA 4Y1CA 3SAFA 3KUHA 3AOCA 2C2NA 3TSPA 1KHVA 3POTB 4OJ3A 5CZXA 3CCTA 5F8HA 2QYGA 2PFUA 1WKKA 3HSJA 4PY5A 2FTRA 2BDPA 1O0PA 4KHNA 3H42A 2BKNA 1HNZK 2UXBF 4PKIA 2XO7A 4JI7F 1M0SA 1HIYA 2C2OB 1YX2A 1YG0A 1IWGA 1FA0A 1LXNA 4H8KA 3B8AX 1SQFA 1XMQF 1O1WA 4DR4F 1WD6A 1WBBA 3M2VA 3CCVN 1HBNB 4X2BA 5BR8F 3K9JA 3RTVA 4F0MA 1GXUA 3EJMA 4ZA1A 1JB0C 1O6XA 2LQBA 4YB6A 4JYAJ 3QRPA 2NRZA 2ZDOA 2E5GA 2OELA 3HXMA 1U2FA 2IDOA 4K42A 2LSNA 4DB3A 2DGWA 1NJIO 2GJ2A 1F60B 2Q66A 4OVLA 2W9BA 1FXDA 2Y1RI 3HKWA 3PRBA 1IJJA 3ZO7A 1CSJA 2B4VA 3UKRB 1GXLA 3QWUA 4NRUA 1DHMA 5J2PA 1WSVA 4BRQA 2ZJPL 3CD7A 3RW7A 1XEZA 3GSIA 1NSKL 2A6MA 3L4IA 4IEIA 5GAEP 2XHBA 2PMWA 1JLQB 4RBUA 1BISA 2D69A 2AJ4A 3G82B 4WXOA 4EIAA 4BRPA 4LBPA 3THVA 1NDKA 4KV8B 3IKMA 3CCMS 2VA2A 1NJZA 2HFSA 2H3EB 3DU5A 2ATLA 2DNQA 4DR7J 1NMNA 1VJQA 1GOCA 3A5LC 3CC4N 5AQZA 3H46O 4DU8A 1ZBUA 5HP1A 4AHVA 4LSNA 2Z58B 1R89A 1GH8A 4ATNA 1FI4A 4M5IA 4LY7A 5B0FA 2HNDA 2XCPA 3LGNA 1TKDA 1H7XA 3N6MA 3SXLA 1HYSB 1RT7B 4OZ2A 1RTHA 3C14B 2A10A 3HF5A 1OVQA 1RAHB 3T1YJ 4NWBA 2G0CA 3I5BA 5KFLA 4HL9A 1IVZA 2Y0SD 4CLUA 1J5OA 3VESA 4F36A 2DNKA 5CCLA 3QESA 2ZD1B 1YJRA 4DS4A 2MKCA 1JWWA 2HWTA 1C4CA 2GAHC 1YIJS 3ILOA 1LV5A 4EUVA 2R7TA 3UN5A 4UY85 3OXLA 3SYZA 5ETSA 5D0EA 3QT8A 3MMBB 4NMXA 4PYDA 4ED1A 3VGLA 1PCAA 8RUCA 2BA9A 3A4TA 1HNWJ 2H5EA 2KLAA 1KP6A 5KT2A 4I6YA 1VLOA 3R7BB 5CYQB 3KG4A 3ENOA 2AGOA 5HROA 4IG0B 4C0HA 1N0VC 5I42A 1FX2A 1UCNA 2ASDA 4NASA 1FJGK 2ZM6K 4LH4A 1NBEB 3QSIA 5B0BA 3SSRA 3PO4A 1SS6A 3SQ4A 1ZC6A 3W0LA 4UF4A 1VLYA 1RFQA 3MXIA 2GQ2A 3OW2M 3DGVA 1TV6A 1S9EA 2PMHA 2J0SD 1JXEA 1MMLA 5FPNA 1B70B 5B0AA 4Y0FA 2BQRA 3SCIE 1JLFB 3CXCR 2DFFA 4J2AA 1NCLA 1YRTA 1WSEA 5HMWA 3R8EA 1F9EB 2DO4A 1FD8A 4G1QA 1UP1A 3FZFA 5KFDA 1UOCA 3EM1A 4U67Q 3TU5A 4N47A 4K4YA 3CEDA 5LMNF 4X65F 2V67A 1RHKB 1EARA 3EN9A 3QIDA 2N4DA 1ZZNA 1KQSM 2Z2ZA 5KFOA 1S6PA 1U47A 5IC6B 2P5GA 3MFHA 1HWJA 3SV4A 4JUZA 3CCSS 3AVKA 1RYRA 3F2KA 4C1NK 3UO0A 2V9KA 2QE5A 4B3SK 4BBYA 5JMVA 3S41A 2YHBA 3L3VA 4OYAA 1S12A 3CDUA 3QGHA 1VHXA 2OPSB 4ZVTB 2W9AA 3C15A 3TABA 4FYXB 1NGHA 3BO2A 1EQYA 3VGMA 4B1WB 2MMYA 2DR7A 5HRRA 3SJJA 1RTIA 2DXDA 1REGX 2HVZA 2F8EX 1TZ0A 1NOYA 4ZCLA 2B4OA 2PZSA 3QFHA 2R9LA 4HACA 1WC4A 2GHPA 1IBKF 2FLLA 2XLKA 2IVFB 4ID8A 4B3RF 1TV6B 2H5IB 4RW9B 2HNZA 3BGUA 4V19S 1RACB 3EPIA 4RLEA 2W2QP 4E3SA 2WBRA 5H9FJ 2IMOA 4ALZA 4CJKA 2JWLA 2XEXA 5KTQA 4DS5A 1B64A 3JSYA 2WB1D 1NNDA 2RKIB 2CQ3A 3SUOA 1XNQF 2AYEA 3QEWA 1X1PA 1T3OA 4DG1A 4F4AA 3JS9A 3SI8A 4LF9K 4NCGB 3E8OA 3JAMO 3L2WA 1X4EA 4A5AA 1IBLF 4YOWA 2FGOA 3AY9A 3QO9B 2APOA 2RQMA 2E7XA 3BKFA 4KHUA 4NLGA 2CJBA 3DM2A 4FKXA 4DV4K 2LQJA 5AJ3J 1A6LA 1FO1A 3GBTA 1TTHB 3SCXA 1OH8A 3GZ7A 1U26A 5GAHP 2QJ3A 5KFSA 3LM9A 1U25A 4OHYA 3T9ZA 2YNFA 1DBDA 5D0HA 2DY9A 3J7AP 3PJ9A 1JCEA 1RTIB 1NGIA 4FK0A 2QWQA 3NF7A 4UOCA 4RBVA 1O13A 2Z57B 1BQMA 1KS2A 3C15B 2M88A 2AP1A 1LW0A 3OS2A 4ICLB 3MD1A 1JQGA 2E2QA 1NWKA 2DH9A 4YQWA 2WK4A 4DL4A 1RHUB 4WJBA 4K2XA 2B43A 3QERA 5KFMA 1UKUA 1RAFB 1IM4A 3IDHA 3MN7A 2HBQB 3SBTA 3G6XA 5KFXA 3Q23A 2YI1A 5AQJA 3N5BA 3J7YI 3MM7B 3OXGA 4OKKA 4YY3K 4DQSA 1X0PA 3TOQA 3KKRA 3H08A 2UVUA 3H2LA 1KC8T 2KFZA 2ZH3A 4QWBA 1X4HA 4K0KK 3BV8A 2QXFA 5TKWA 4DV2K 3A1YG 1MWQA 2BVZA 3LP0B 4CRJA 3GILA 2WB4A 4MJKA 2YHYA 3P45B 3UPFA 2X1FA 1OH7A 5K14B 4ILMA 5IM0B 4QS8A 1B7YB 4K41A 4BRIA 3DRXA 3KMSA 2X3DA 3BREA 4TY8A 4ZHRA 5LSOA 2EKNA 1NHUA 5D3GB 1YRUA 1KOHA 4IJNA 3C65A 3Q8VA 1HBUA 1Y5LB 3ZT4A 2MQ8A 1SCJB 5L38A 2V5HG 4Z4IA 2I9SA 4IO9Q 3NGZA 2VFSA 2VF3A 1L3TA 3PYGA 4ZCIA 3JQKA 4KFBB 1QAXA 4DKWA 3SLCA 2IYIA 1U1QA 2Y1IA 2UUAF 2J0WA 4QYRA 1J5EK 3WX8A 2R7OA 2W40A 3BBCA 4DR7F 1T44A 2AIRB 5THWA 2EFNA 4FN5A 2LQ9A 3J7YU 5HAOA 3FSIA 3PSIA 4TVAB 1VQ4S 2FBYA 1Z1ZA 1T3NA 2QRRA 2FSNA 3ENAA 1EKRA 5KFYA 1JLCA 3OFEA 5IWAJ 4PQUA 5IT9Y 3A8EA 3HP9A 1S1TB 4HH0A 5E41A 4MKVA 3MM5B 4NX9A 5A8RA 2P9KB 1PILA 3MECA 4HI1A 1RDAA 2KJWA 4C23A 3QICA 1HW8A 3MN9A 3TPQA 1Y00A 5AE3A 1WSFA 5AZIB 4M3UA 3NGKA 3BBBA 1S59A 3VAHA 2ZVIA 2EWHA 3MEKA 2AMCB 4FVUA 2NQPA 1MWZA 3BGFA 1VQOS 1EIYB 5H1SQ 4MK8A 4JI6J 2VG6B 3G6YA 5AQFA 3VQQA 2VBZA 2XS2A 4M7YA 3G8QA 3HHDA 4ZP6A 3GIKA 3O5TB 3UR0A 3OL6A 3CMES 1NPRA 4NI2A 3V6HA 1LAVA 3CO9A 2VC0A 2WSFC 1XTZA 2YVSA 1T9UA 5T14A 3AB4B 3NGUA 1SL0A 5A8KB 3R8YA 1I94F 1ZS6A 4J2EA 2NR0A 3PR4A 3BSNA 4ELTA 4Y6IA 1HNIA 2AU0A 5CHIA 5J1EA 1P9YA 5EGYA 4CEBA 4CH7A 1S4FA 2JHEA 3AA9A 1U45A 4PPDA 3RMDA 1HKGA 1MMNA 1HFEL 5KFBA 1J5OB 3I56N 2VBXA 3D1QA 3IMQJ 5D0GA 4RW6B 3WQUA 3D28A 3E2EA 4IOXA 4JKCA 2ZUGA 1Q5VA 2L48A 3BQ2A 4PXEA 3NGDA 3C6UA 3POTA 4P9SA 4CGHA 2DFEA 3FGVA 3O8WA 2FVPA 3G10A 5AZIA 3AFGA 4DX7A 4PWUA 1R8BA 2IC3B 3KHLA 3RWUA 1AROP 3SNNA 4CI0B 1I51B 2YWGA 4JD2B 2DGOA 4WIIA 4TSXA 3TAMA 4JI4K 3MWBA 2WW4A 2V8DA 2QW9A 2HEKA 1RT3B 1W2BR 4RUBA 3JSRA 4JV5F 3K2YA 2E5LF 2M70A 3VQSA 2X6NA 1SQEA 1T6DA 2OSRA 1MSWD 3A5MC 3MM6A 4OI2A 3PYDA 2D7SA 4RNHA 4U6PA 1HA1A 5FROA 1NK5A 2KRRA 3V1QA 3CFOA 2GMHA 1NPKA 2IM3A 4WTYA 3C6TA 1IBMK 2W6LA 3OYEA 4ZVEA 3RMAA 1FRXA 2YHAA 3ZZRA 2AEJA 3EXYA 3AVFA 4DHVA 1L3KA 1SKUB 2ZDPA 4DV6F 4Q44A 5D4PA 3CD6S 3K59A 3OHRA 4Z0UA 3PW0A 4RW6A 1I94J 1AFJA 2L41A 3D0GE 2QWNA 4A8FA 2DHXA 4ZPWR 3NAIA 4MLEA 1HNXK 2RPIA 1JKHA 2XB2D 2V2KA 3VQ5A 1OH6A 3P39A 3FBFA 4URQU 2ETJA 4AM6A 3NH1A 3J80O 1BWFO 1TGOA 4OV6A 4YDUC 2N82B 4DUTA 4ES3A 4BROA 3HHKA 4U67L 4CZFA 2L08A 2KFNA 3L3CA 1B3TA 3BS9A 2JJ4D 3H5SA 4BR2A 1KD1O 3PACA 2DRAA 2IRXA 5IWAF 2HFOA 1S72S 2DNRA 1YXQA 4GV6A 4XDCA 3DOKA 1FDNA 4FWQA 1Q8KA 2G8HA 1NM1A 1T11A 3EGWB 1B9FA 1P90A 5IT9O 2ZM6F 1XR5A 4JV2A 2BANA 2AHOB 1T03A 2ITGA 4BG8A 3OL9A 4HCBA 4CM2A 1E3MA 2Z8QA 3HBTA 3CQYA 1FKPA 5AQTA 3HP6A 3SQGB 2XI2A 4IRKA 3CPWR 1A5WA 2NLWA 2VYPA 4YP3A 2PSZA 4N76A 3VWSA 4CECA 2ASJA 1U2VA 3DXBA 5GVQA 1VSLA 3O8MA 4LR7A 4R5PB 2W8LA 4I67A 1QD1A 1F1BB 1EWQA 3C6HA 2C1EB 1QUPA 4WBFA 3V9UA 2FLNA 2G8IA 4L3NA 1XC3A 3CJ5A 2EFGA 1NNEA 2C3PA 4KT0C 4LSLA 4I0WA 4DR5J 1QSSA 4D3GA 2AJ0A 3OTOK 2KU7A 1V6HA 3MMBA 2IVNA 2ZH1A 3OR1B 3W1YC 3O9SA 4OX9K 4LBHA 5LMUK 1BUPA 2FJVA 1WACA 1IQZA 5C2DA 2EFOA 1U48A 3ET6B 1CJTA 4DL7A 1QZ5A 1WHVA 4LUBA 4C97A 1YWXA 5GAGI 5HI7A 1VGYA 5J2NB 1P9QC 2ZH6A 2E9TA 1NZAA 3RB0A 2P9SB 2GZOA 3TUJC 2VOOA 4I64A 1O8BA 3FMBA 4KC5A 1UWAA 2X7IA 2HZCA 3D2FA 4KHSA 2W2OP 3MGJA 1DLOA 4AQYF 2KRBA 4JKFA 4K4SA 2BGGA 2ZHBA 2GFFA 1WF1A 5DLFA 4FOIA 4KQZA 1EKSA 3B54A 3T5LA 1JLAA 3SCJE 4QIGA 3TZXA 1TK8A 2OSQA 4FSVA 3ATVA 2CXEA 3NCRA 2UUTA 4DTNA 5HRPA 2HAFA 4CF9A 3G0ZA 2PEBA 3KLHA 4BRNA 1Z26A 5GIPA 3PJWA 3NVKA 4NE9C 4Y28C 3D6FB 5AQRA 3PG9A 3PW5A 3T5HA 1B0PA 1J2VA 2ZOGA 1QTNB 3F73A 4CLWA 1S99A 3G6ES 2ZJPQ 3QETA 3QEVA 1IQTA 1U2CA 2LDYA 2V50A 3NMUA 4DTMA 3S9HA 5D0RA 2D74B 4N56A 4B1XB 3THXA 3IGVA 4Q7AA 1D9FA 1LW2B 4U8VA 1KQFB 1RK8A 1RWUA 3T9NA 1RNHA 1YLXA 1WG5A 3ET6A 3G6VA 2Y8YA 4IFVA 2ROGA 2R7RA 1LOUA 4BS2A 2HK3A 4Y1DA 4ZPBA 4IOCL 2GHWA 3KUGA 3CO0P 3Q0AA 3O5BA 1OSCA 2CJAA 3QFPA 2OYQA 1JLBA 2NPFA 4J9NA 2FVQA 4Y00A 1X9SA 4PG5A 1X9WA 2C2EA 2KT3A 1CULA 4J2BA 1C0UB 2JLGA 1G2EA 2HS4A 4CZCA 1S76D 2DCLA 2RRNA 4NEYA 3VAMA 3NEKA 1A0OB 3V9ZA 1D3WA 4PAAA 2UV8G 3NF6A 3AVGA 4CF1A 2V4RA 5LT5A 5GINA 4Y34A 2J9EA 3OVSA 3FKBA 4R0JA 4CT9A 1MN7A 2HQ3A 1TKTB 3D0IE 1R8AA 2EXUA 2VICA 3A5NC </