1LWEA

Crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKSTKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 134
structure length 542
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lweA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lweA05
5F8GA 4K4XA 2GIQA 5KRSA 3I0RB 3DRPA 4M3ZA 4KV8A 2HVHA 4NLRA 3BSNA 4EEYA 4Q8EA 3HYFA 3SJJA 3OYMA 3P5JA 3C95A 2XC9A 5EU7A 4QCLA 5EUHA 1RCHA 2VWKA 4NLPA 2AQ4A 2Q3SA 3RR7A 3PW5A 3FFIB 5J2MA 2ZKUA 2IC3B 4IRCA 1S1WA 3KKRA 1TVRA 3I5AA 3L3VA 1FKOB 3K5MA 3DDKA 3HSTB 4AH9A 2AJQA 1RT2B 4DG1B 1LW2A 3SCXA 4DQPA 4Q43A 3NH2A 5KFFA 3OYGA 1BQNA 3CJ0A 1GX6A 3HVTB 3G10A 3NCIA 3SZ2A 3HVRA 4ZP6A 4FJHA 5J2QB 4TY8A 4K4TA 1JLBB 1KFSA 3ZSRA 2HHWA 1KSPA 2R8JA 4RW9A 1J54A 2EHGA 2YHBA 3B6OA 1BGXT 4JUZA 1J9AA 1VRTB 3KLVA 3C6TB 4LH4A 4E7JA 2W7PA 4PWDA 4W5NA 4WXWA 4ECQA 4O0JA 1DTTB 1S1TA 3E01A 2G8UA 3AV9A 3KLEB 2HNZB 3T1AA 2HHSA 3KLIB 2OPPB 2BANA 3TVKA 2ASLA 3CO9A 3VQQA 4ID5B 3C6UA 5KFVA 3V4IA 5KFOA 3RAQA 4DLGA 2ASDA 5EDWA 1LWEA 4Z4CA 3VQSA 1RBSA 4DFPA 1HYZA 5KFQA 4U7CA 2FC0A 3K57A 4K8ZA 4MIAA 2C2EA 3FQKA 5J2PA 4H4MA 1JXLA 1JLEA 4CJFA 2YKNA 3QESA 2FLNA 3L8BA 3UQSA 3PJWA 1CZ9A 4DMNA 3ZT1A 3QNNA 4FW1A 1J53A 5T14A 4F4WA 2NUBA 1CLQA 4CJ5A 5DLFA 4B3OB 4DSEA 3IRXB 1NK0A 4YR3A 1T05A 1WAFA 5I42B 3KHGA 2YNHA 2V0NA 3OVNA 1RBRA 5CY4A 5DLGA 3BR9A 2ALZA 4DSKA 4TQSA 3OYEA 3DMJB 4CHPA 3VQ7A 3QZ8A 3RRHA 1RT1A 4CEAA 5KT3A 2G8WA 2AGQA 1NK9A 4KHQA 1A5VA 4YR0A 4DS4A 3TWHA 3MECA 1HJRA 3VQCA 1HNVA 1HQEA 5KFSA 1BIUA 3RMDA 4MK7A 1RILA 3IN5A 3PO5A 3NKYA 3F73A 1LW0B 1KHVA 4TQRA 3F9KA 2W7OA 1I6JA 4EBDA 2AGPA 3QEPA 4F4KA 2B43A 1LAWA 3QNOA 3KMSA 4IG0B 3LZJA 3KKSA 1JLFA 4ED7A 3ZSYA 5SWMA 1XHXA 3VQEA 1JLCB 3JYTB 2YNIB 3NF8A 4H4OA 2QV6A 1IKWA 5KT7A 4CF0A 4OGEA 1C0TB 3AVJA 5DQGA 1WNEA 1VRUB 3ASMA 4EBCA 2WHOA 3G6VA 1EXQA 3ALYA 2WONB 1S0OA 2B6AA 1B9DA 4CGIA 5KG2A 4DQRA 1D5AA 2OPSA 1UAXA 5C25A 1R0AA 3PUFA 4E89A 2FLPA 1S9EA 2IM3A 4DLEA 3KMQA 1FKPB 1FXXA 5CYQB 4WZMA 3LPUA 1SL0A 3OHAA 3HHKA 5DG9A 1WSHA 3ZT3A 4AHSA 3NDKA 4ELVA 4M3UA 4J9PA 2UUTA 1L3UA 4O3QA 3V6DA 3DYAA 5C24A 1LV5A 5FDLA 3BQ0A 4DTOA 4FLVA 5DK5A 1GOBA 5FROA 4LSLA 4NLOA 2YV0X 4RNFA 3TABA 4RG8A 5KFZA 3D0PA 3BGRB 2Z1GA 3L2RA 3CYMA 1RA7A 4RW7B 1XR7A 3M8PA 4W5TA 1RT7A 1UWBA 1TKXA 1YTUA 3MEGB 3H98A 5KFTA 4O3RA 1BCMA 2W9CA 1RT3A 1QHTA 2P51A 1B92A 4Z4GA 1C6VA 3S9HA 3ITHA 4CIGA 4KB1A 4R5PB 1IKVA 1L5UA 3MTKA 5CZ2A 1HMVA 4F3TA 3M8RA 1NHUA 5KG1A 4DSLA 2XY7A 3T5JA 3AA2A 1JLAB 2EC0A 4FZYA 3OYKA 1EETB 2A1SA 1QSYA 4RUAA 2W9BA 1S97A 4RW4A 4FJ8A 4OVLA 3PW4A 4K4ZA 4IG3B 3OLBA 3KK2B 4Y3CA 3AVBA 1U47A 4DF4A 3KJVA 4R8UB 4IFVB 5KT6A 4LY7A 4IR9A 3VQ6A 4N76A 2VG7B 2BDPA 4CK1A 2KQ2A 1C1CB 4J9OA 2VG6A 2WOMB 3GIIA 2YNGB 3S3OA 1S6QA 4RNNA 5F8MA 4YNQA 4HKQA 4CGDA 1XC9A 4Z4EA 5T7BA 3DLGA 1IKXB 1TAUA 4DS5A 1HYSA 4DWIA 1N6QA 3ZSZA 5KFRA 1T8EA 3AO1A 3ZT0A 2FBXA 3KLGB 1BI4B 1W25A 3H5SA 3L2QA 2FVCA 3DLBA 1XR6A 1RT6A 4GW6A 3CJ3A 1NK8A 2EX3A 1KLMB 3H5YA 3HVWA 3AA4A 3MAQA 3K5NA 3EPIA 1WSJA 3CVKA 1FK9B 4ELUA 4TYAA 4DTSA 4CJEA 2E9RX 2RKIA 1BQMA 4NLWA 3HT3A 4F3OA 5DQIA 4JRQA 4NLGA 4QWAA 3ZSVA 1RDRA 2R2TA 1ITGA 4J9LA 1S9GB 2UUWA 1TL3B 1YTAA 1QE1B 4BE0A 4FJMA 2ETJA 3LPTA 4FLXA 2HMIB 2GIRA 4FJ9A 4CEDA 4DL4A 4MKBA 2C2DA 5CZ1A 3ICLA 2OA8A 4MFBA 5J1EB 4I7FA 4ICLA 1SKWA 3RB0A 4O5BA 4U6PA 1T3NA 1U04A 4EP4A 1KVCA 4J9KA 4KRFA 3DI6B 1HYVA 1S1VA 1U45A 3DLKB 5L1IA 2R8KA 4DTMA 4CESA 1LWFA 2Z1HA 1T03B 4ED6A 2DFEA 2O4IA 2XWYA 3SUNA 3ZSXA 1RTDA 3PVXA 5L9XA 3V6KA 4O3NA 4O4GB 1SH3A 2OPQB 1JX4A 5KG5A 3MXJA 4C8MA 3GIMA 4BWJA 1XI1A 1REVA 1TL1A 1VSEA 3THVA 3VA0A 5HBMA 3T5HA 3AVGA 3OYCA 3KOAA 4G1QB 4NYZA 4KFBA 3HKWA 5KFGA 5KT4A 4IQXA 3M9OB 4CGJA 3V9XA 1ZTWA 4Z0UA 4JS4A 2J6TA 3BJYA 3A2FA 1S1XA 4KO0B 4NCGA 4KI4A 4KI6A 2BE2A 3NL0A 4FYDA 2G8HA 4KTQA 2C22A 5KFEA 2WTFA 3PW0A 3HP6A 5HRPA 3U6FA 1JKHB 4B9TA 2PY5A 4IFYB 2R2RA 3OS1A 4KREA 2R8GA 1GOAA 4YR2A 3PY8A 3G0ZA 4NLUA 5JXSA 4WYWA 3TQ1A 2ATQA 4Q45A 4F2SA 1EX4A 1RT4B 3QIPB 1MMLA 1S9FA 1SL2A 4M42A 4H8KA 5K14A 2IS3A 2HAIA 4IDKA 5KFUA 2YNFA 2V4QA 2XRIA 4OL8A 1C0UB 3LP2B 2D3ZA 4M3WA 2R8IA 2HVIA 3V9ZA 3G6YA 2QXFA 1F21A 3QO9B 4E7LA 5CYMB 3GIKA 3KLEA 3GILA 4J9QA 4FS2A 1O1WA 2HB5A 2XO7A 4DL5A 4I2QB 2R8HA 4GC6A 2JEJA 3V9UA 3K5LA 3SUPA 5KFYA 3PX6A 1IKYB 3UIQA 2V4RA 1S5JA 1S1UB 4Z4FA 4XPEA 2I5JA 5J2NA 4Q44A 2HNDB 2C2RA 2WCXA 3H5XA 3LALA 1N48A 4C8KA 3V1RA 3DLHA 3IS9B 4I2PB 3BQ1A 3KLFA 3OS2A 4WE1A 1EP4A 2HWIA 4R0EA 2WB4A 4HHTA 1LWCA 3MR2A 3CJ4A 4PUOB 2FVSA 1Q9YA 4MIBA 3MEEB 3NF9A 4J9SA 4IBNA 2G8VA 3NGDA 3BREA 4CHYA 4KPYA 2UVVA 4EP5A 4KE5A 1U09A 5DGAA 3IG1B 3LP1A 5DG7A 4RW8A 4CFBA 4XIUA 2P5OA 4RNMA 4ZTFA 3SQ1A 1HNIA 3LAMA 4F8RA 1RDAA 1S6PB 3KK3A 4ZP7A 1TKTA 4J2EA 1ASUA 4OPKA 3VQ5A 3TAEA 5DMRA 4AHVA 1JLGA 1W9HA 1JLQA 3V9WA 3H4BA 4LSNB 4KKOA 5D3GB 3LP0B 1WAJA 3AO2A 1MU2A 4PQUA 3BSCA 5HP1B 4FK0A 1HPZB 1JIHA 2GUIA 4W5RA 1YVFA 3MR5A 2BGGA 4ZVHA 5HLFB 1QTMA 1TKZA 3KK1A 3DOLA 4N5SA 3OYJA 3T19A 1SUQA 3OHBA 4QOZB 4FBTA 1Z25A 1SV5A 2BQUA 4O4RA 4B9LA 2HNYA 5KFKA 3Q8SB 2X6NA 4ZMMA 3JYTA 4M3RA 2YNIA 3DRPB 4CF2A 4CIFA 4KV8B 2VG5A 3P1GA 4EYIB 4ZVEA 1ZTTA 4NLSA 4OLAA 4RU9A 3OL6A 4IH5A 1RTHA 2VWJA 3ZSOA 4ECXA 4URGA 2IM0A 3SV4A 1RBVA 5J2MB 1S1WB 2PYJA 1TVRB 3DOKA 4CJ3A 4CCHA 4F50A 1RDBA 3HJFA 2RF2A 2YKMA 1J5OA 3I5BA 4ZVGA 3OJUA 3V1OA 4BE2A 2BR0A 2F8SA 4KHWA 1LW2B 4DQQA 4KSEB 1BQNB 4Y34A 3GV8B 1ZBUA 5KG0A 1XR5A 1XHZA 3DM2A 3CDWA 4TY8B 2IBKA 4F4YA 3OL9A 4B8AB 3OYFA 3O3GA 3U3GA 2D0BA 4RW9B 3LWMA 3M8SA 3UDLA 4QAGA 2UVUA 3FDSA 5KFXA 2B5JA 3NBPA 3D28A 3Q8RB 1KTQA 3AVCA 2IAJA 1JL1A 3PW7A 1SKSA 4NLVA 3I0SA 3LZIA 2FJXA 4PWDB 3RBDA 3DLEA 4CJKA 1S1TB 3E01B 1IO2A 3QERA 4O55A 3M9MB 3BDPA 2HHVA 4E7KA 3OY9A 3RMBA 1TV6A 2BANB 1CZBA 3V1QA 1IG9A 4ED1A 3RB4A 1N4LA 3PJXA 1G15A 3MEDA 5L1LA 3C6UB 3V4IB 1WSFA 2F8EX 1LWEB 3DRRA 2F8TA 4CHZA 1LAVA 1GOCA 4K50A 4J9RA 1UOCA 1QQCA 5KFJA 5J2PB 4H4MB 1JLEB 2YKNB 5HRNA 4C8NA 3NMAA 4IKAA 4L8RB 4Q0BA 3IGVA 2A1RA 5FRMA 2KZZA 1CSJA 3UR0A 4HUEA 2HWHA 2DFHA 4BDZA 4J2AA 1D9FA 4B9MA 5JS1A 1NKEA 1C2PA 3HM9A 4DU3A 1C0MA 5F8HA 4FS1A 4PA1A 4M3TA 2BQ3A 3TR8A 4DSIA 1HQUA 1T05B 4FLYA 1W0HA 3H5UA 1S49A 3ZSQA 4KHNA 2FJVA 2DPIA 4KAIA 4CHQA 3PV8A 2YNHB 4J2DA 4ZP9A 1VSKA 3DRSA 5KRTA 4NRUA 1RTJA 3HXMA 1NK5A 3NGIA 3JSMA 1DLOA 3AVMA 1RT1B 4DU1A 3GV5B 5KFHA 3QGGA 1S10A 4YFUA 3I8DA 4DL3A 4X2BA 2D5RA 4M95A 3TI0A 3KD1E 1CXQA 5I3UA 3NFAA 2HHQA 3MECB 3MF5A 1NJWA 4NYNA 5KGXA 2XCAA 1HNVB 1HQEB 3KLHA 1HRHA 1S0MA 1UA1A 3M8QA 3EYZA 3WNHA 2KZMA 3T3FA 3WNEA 2G8FA 4F2RA 3OL8A 4OJRA 1QSSA 4CEFA 4OPJA 4Y1DA 3NF6A 4O44A 4QW9A 3LWLA 4DL2A 3LDSA 3OJSA 3CQ8A 4XO0A 3VQPA 4ZVFA 4CK2A 3KHLA 2QE5A 2E6LA 4FK2A 3CDUA 4QWDA 4FW2A 4B9SA 4NZ0A 1RTIA 2RDIA 4JV2A 4BE1A 2ZE2A 4H4OB 2I1RA 3O4QA 1U48A 1IKWB 1TK0A 2JGUA 1T7PA 1BIZA 4FLTA 1L3SA 2P1JA 2IOCA 3SQ0A 5DQHA 2ZD1A 2B6AB 4GVMA 1QUVA 3S3MA 2HW3A 2OPSB 4DSJA 5C25B 1R0AB 1QS4A 2OPRA 5HRRA 1S9EB 1NK6A 4WFYA 2G8IA 1BL3A 1N56A 4CFDA 1T03A 3SFGA 1JL2A 3D45A 3GYNA 4IR1A 3SPYA 4EBEA 4ZPAA 1KLNA 3V6DB 3DYAB 5C24B 2GBZA 5FDLB 2HHTA 1VK0A 3LANA 4XPCA 4DQIA 4DTRA 3OSNA 4LSLB 2RDJA 3HPOA 2J6UA 1Y97A 4AHRA 1KHWA 4CF9A 3MXIA 2KTQA 2JC1A 1RAJA 2RN2A 5KI6A 3CFPA 4B9VA 1NJZA 2W9AA 4PY5A 4MK9A 4IH7A 3M8PB 1RT7B 1UWBB 1TKXB 4FCYA 4KHSA 2AWZA 1DTQA 2ATLA 1Z26A 4K4UA 4LH5A 4O3PA 2W9CB 2Z1JA 3O4NA 1RT3B 1C1BA 5KFNA 1RT5A 3QLHA 2Y1JA 3ITHB 1K6YA 4CE9A 3RTVA 1IKVB 3CDEA 4ZHRA 3CFOA 1HMVB 4TN2A 3QEXA 3AA3A 2XCPA 4EYHB 3L2UA 5EWFA 3TAMA 2ASJA 3QIOA 1N5YA 4HCBA 4LD0A 5HROA 3SUOA 2OYQA 2DPJA 2W9BB 4RW4B 3L3UA 5C42A 4RW6A 2R2SA 2IM1A 3D5MA 4FJJA 4NYFA 3NAEA 4Z4IA 3KJVB 3RAXA 4E3SA 1YT3A 4C8OA 3U3YA 1SKRA 3TAPA 4IRDA 4Y2CA 3V81A 4CIEA 3IGNA 2G8KA 3I0RA 4FXDA 2VG6B 1S6QB 3I5CA 1RNHA 3PR4A 1UA0A 1RBUA 1S4FA 3DLGB 3V9SA 1X9MA 1ZBLA 1HYSB 1C1AA 4BWMA 5KFWA 1VSIA 3PW2A 1N6QB 4WFXA 3CFRA 3Q8QB 2B4JA 2P5GA 3FFIA 2IC3A 1RT6B 4QW8A 4NLTA 4TLRA 1FKOA 2BQRA 1RYRA 3KNAA 4KHRA 3AVIA 3HP9A 4ECVA 3WNFA 4ECTA 3DLRA 1WLJA 3CIZA 3PR5B 1RT2A 4DG1A 1NNDA 4JLHA 4IRKA 2XHBA 2KFNA 4DSFA 5L1KA 3QYYA 3SPZA 1WSGA 3NF7A 3HVTA 4OKKA 1TP7A 3QINA 5J2QA 2RKIB 1BQMB 1JLBA 3VQAA 1OS5A 4ECUA 3SQ2A 3NAHA 1QSLA 1Q8IA 1WSEA 4CJTA 3QETA 1WNSA 3OLAA 1VRTA 4MK8A 3C6TA 3G6XA 4FLWA 2E9ZA 2DTUA 1L3TA 2E6MA 3AA5X 5KG3A 4J9NA 4OKEA 1DTTA 2IMWP 4MFBB 2HNZA 3KLIA 2OPPA 4ICLB 3OYHA 3BSOA 1X9WA 1TKDA 4ID5A 1Q9XA 4CF1A 1TGOA 4HYKA 3TARA 4M94A 1S1VB 3TAFA 4URSA 2AX0A 5JUMA 2PYLA 3AO3A 1LWFB 2D0CA 4N56A 1JXEA 4NLXA 3SUQA 2UVWA 2IJFA 4HCCA 1RTDB 1NOZA 3L2VA 4IOBA 3VQ9A 4WYLA 4N41A 1REVB 1TL1B 2OH2A 5KFAA 3EY1A 5HBMB 3V6HA 3VQ8A 3CJ5A 3KHRA 3CM5A 3T5LA 3FSIA 2IDOA 4KFBB 5KG7A 4B3OA 4B9NA 3IRXA 4DFJA 3OSPA 5I42A 4BACA 3H2LA 5KG6A 2OZSA 4ZTJA 1S1XB 4NCGB 1KFDA 3NGZA 2BE2B 4M41A 3M9NB 3DMJA 4DQSA 3O3HA 5C5JA 4ECWA 4CJLA 3SNNA 4BDPA 1K1QA 3QEIA 4M45A 3BSAA 5KGWA 1JXBA 3NE6A 2XI2A 4NCAA 4QWBA 4FM0A 3EZUA 4ELTA 2XY5A 2YHAA 4EO6A 2AX1A 3QGIA 5K14B 3H40A 4AHCA 3HPHA 4IDKB 1LW0A 4FJGA 3RR8A 2HHUA 2YNFB 2FBYA 2F96A 4O3OA 4LQ3A 4IG0A 1X9SA 3AVAA 2GV9A 4KAZA 4CEOA 4RZRA 2D41A 3K58A 1JLCA 3NH1A 2ZQBA 3MXMA 4AILC 3AVFA 1NJYA 5KT2A 1C0TA 2FVQA 2ITGA 1B9FA 4ID1A 4W5OA 2I5JB 1VRUA 2GC8A 4HUFA 3QEVA 4K8XA 2BRLA 2Y1IA 2J6SA 3G86A 4Y1CA 2WONA 3LP3A 5J2NB 4B9UA 5KFBA 1QAIA 4F4XA 2D0AA 2W8KA 4JV0A 1I39A 1FKPA 3KLFB 4W5QA 3QZ7A 5CYQA 4WE1B 3AO5A 1EP4B 2XY6A 3KD5E 4B8CA 4CF8A 4RNHA 1LWCB 3SI6A 3OYAA 1RA6A 3N6LA 5EWEA 5KFPA 5KFCA 3V6JA 5F8NA 3HVAA 3SV3A 3LP1B 3AO4A 1NHVA 3RRGA 3P83D 4FJXA 5HRSA 4RW8B 3OYNA 5KG4A 3BGRA 3NHGA 1HNIB 3LAKA 3KK3B 1TAQA 4CHNA 4RW7A 3B6PA 2JC0A 1TKTB 1S48A 2IA6A 4CERA 1D8YA 4QPXA 1A5XA 1JLGB 3MEGA 1JLQB 4B08A 4M3XA 3EPGA 4KKOB 4O0IA 4E1MA 3TAQA 1MU2B 4URQU 4K4WA 4HVJA 4PQUB 4CJ4A 4CEEA 5SZTA 4CJVA 4ED3A 2ILYA 4R5PA 4EO8A 1GX5A 4FJ7A 4DFMA 2Z1IA 1TKZB 3KK1B 3DOLB 3N6NA 4ECSA 4FLZA 3PHEA 3Q8PB 3K5OA 4KBIA 1SUQB 3SI8A 1U49A 4OLBA 2PZSA 4NLQA 3HL8A 1SV5B 1JLAA 4JS5A 1IH7A 4CGGA 4DL7A 4I9LA 1EETA 4O3SA 2HNYB 3RBEA 1CXUA 4GC7A 1NKCA 4FM1A 4IG3A 2VG5B 3KK2A 4FZXC 1Z4UA 4NLDA 2KW4A 3N6MA 4DTUA 4R8UA 4IFVA 3ZT4A 1RTHB 2KFZA 4CEZA 3RB3A 4CHOA 2VG7A 4FZZA 2FVPA 1ZETA 1C1CA 5KTQA 2WOMA 2YNGA 1RDCA 1SH2A 4CEQA 4IKFA 3HK2A 1T94A 1SH0A 2WRMA 1IKXA 3DOKB 3HPGA 4LQ9A 4MQ3A 2IJNA 4CJWA 2RF2B 2YKMB 1J5OB 4C8LA 2XI3A 3WNGA 3CWJA 2JLEA 3KLGA 1BI4A 4ED2A 1SL1A 4FJLA 2QKBA 4ED8A 4UQGA 1QAJA 2RPIA 4CEBA 3QGHA 1KLMA 3H59A 5KFLA 3DM2B 4CFCA 1KVAA 3S3NA 3IAYA 3ZCMA 3ISND 2V9WA 4ZP8A 1X1PA 4NLYA 2UVRA 4CJUA 2FVRA 3EZ5A 3PO4A 2B5JB 3NBPB 3FRZA 3ULDA 2IAJB 2JEGA 1FK9A 2VA3A 3I0SB 4E1NA 4E0DA 1NJXA 4FJIA 4Z4HA 3MR3A 5EWGA 3DLEB 3RWUA 2E4LA 3E51A 1XWLA 2FBTA 1S9GA 4FM2A 4CJQA 1TL3A 4FJKA 1JLFB 5KFIA 4KHMA 3GV7B 1TV6B 2OZMA 1QE1A 4Y2AA 2HMIA 3SYZA 3MEDB 2R2UA 2DFFA 4FK4A 3VQ4A 3RB6A 3L2WA 2XGPA 2R7YA 5J1EA 4I9QA 3DRRB 4YP3A 1I3AA 2O5DA 4K4VA 3DI6A 3SQ4A 4Q0BB 3PX0A 2XGQA 3DLKA 3NGYA 4EZ9A 2W42A 1RDDA 1VSLA 5KFMA 3MFIA 4TY9A 2BRKA 1VSMA 2JEFA 4QWCA 4WFZA 5F8IA 3VQDA 1KRPA 1HQUB 4DTPA 4O4GA 2OPQA 4K4SA 4FBUA 3FQLA 2CKWA 4CFAA 3OL7A 3DRSB 3MFHA 2ILZA 1RTJB 1KVBA 2JEIA 4ZPDA 5DGBA 3AVKA 3AVLA 3OYBA 4BDYA 1TK8A 4M3YA 4G1QA 3TAGA 3RMCA 4DTJA 3JSMB 1DLOB 3KHHA 3QIDA 1BCOA 1RYSA 4KHYA 2D7SA 4FVMA 3HO1A 1A5WA 2X6SA 3ZT2A 4KO0A 5I3UB 1BHLA 1ASVA 4DL6A 4KTWA 1ZBIA 4EZ6A 5F8JA 3KLHB 1NK7A 3M8QB 1K1SA 4DTXA 4KTZA 1JKHA 3PX4A 4IFYA 3BQ2A 4AHUA 2QK9A 1KCFA 1RBTA 2D3UA 4O44B 2O4GA 1EKEA 4AHTA 1VSFA 4OKJA 4DTNA 4YQWA 1RT4A 3QIPA 2FLLA 4YMEA 3TANA 4H54A 1D9DA 2IM2A 3K2PA 1YVUA 3H08A 4IH6A 1ZYQA 5FRNA 1RTIB 3CJ2A 4CGHA 4E19A 4CJPA 5F8LA 2ZE2B 1C0UA 3VA3A 3LP2A 1NOYA 4FJNA 3QO9A 5CYMA 5F9NA 1L3VA 3UPFA 4NCBA 3ISNC 4TYBA 4WXOA 3MR6A 1ZBFA 2C28A 2ZD1B 4I2QA 4FJ5A 4KB0A 1D0EA 1WN7A 3OYLA 2OPRB 1IKYA 4MKAA 4ZPCA 4TSXA 1BISA 1NKBA 4NRTA 4MH8A 1S1UA 4FLUA 2AU0A 2VA2A 4HUGA 1ZBHA 4GMJB 3AVNA 4CJSA 4QWEA 5DG8A 3CG7A 2E9TA 2HNDA 2DY4A 3GIJA 3T5KA 3RMAA 3VN5A 4JRPA 4E7HA 3IS9A 1TQLA 4I2PA 4F4ZA 3OYIA 2X78A 4ED0A 3KIOA 5JS2A 4E7IA 4PUOA 2QKKA 4KHUA 4Q5VA 4K4YA 3MEEA 3O3FA 4ZPBA 1VSDA 4OGCA 5L1JA 3H4DA 1VSJA 4N47A 3QEWA 3K59A 1VSHA 2W8LA 1DTQB 4G3IA 3IG1A 1IM4A 1D1UA 4DU4A 3NAIA 2XY8A 3ZSWA 1U4BA 1TK5A 4Q8FA 1C1BB 1S6PA 3AVHA 3CM6A 4CGFA 1RT5B 3QLHB 2HHXA 2LSNA 4J2BA 1HARA 4CK3A 4CECA 2AGOA 4KB7A 4ZHRB 2WK4A 4WZQA 2IGIA 1WSIA 4LSNA 3PZPA 5E41A 2X74A 2CJQA 3NH0A 5D3GA 3LP0A 2FJWA 4TXSA 4I7FB 4JV1A 1ASWA 4RNOA 3C94A 3OS0A 3TAMB 5HP1A 1N5YB 5HROB 1HPZA 4DF8A 4RUCA 3GQCA 4ECRA 5C42B 4RW6B 3SFUA 5HLFA 4DFKA 5F9LA 3OYDA 5KFDA 4ECYA 1S0NA 5KT5A 4ECZA 4J9MA 4HTUA 4DEZA 3VQBA 1NK4A 4CJRA 2FBVA 3KTQA 3V81B
chains in the Genus database with same CATH superfamily
3R1LA 1OQ3A 4K4XA 4CM0A 2HVHA 3CD0A 1RI7A 3BSNA 5F3TA 5LSOA 5HVHA 4CI0B 3NOCA 3LDQA 3TTFA 2IA0A 3C95A 5EU7A 2CZ9A 1RCHA 2VWKA 4CH1A 3PW5A 2MPUA 1VQOS 2IIHA 1U1OA 2A3ZA 2CNNB 3I5AA 3GG4A 1DFDA 3AD7C 1Y5IB 2ASYA 3DDKA 1HPMA 4AH9A 1TL4A 5HANA 3H0PA 4WF9Q 1MWYA 3NCIA 3E9LA 5IOLA 4YDXA 4K4TA 1KD1T 2NPFA 5F1XA 5FLXU 4JKFA 4RW9A 1FX2A 3SSQA 4DR3J 3AHPA 1J27A 3EVWA 3O5TB 1B99A 1A6LA 1S1TA 2G8UA 4PG6A 4WJBA 2IJRA 2Z2MA 1M1HA 3I32A 3KLEB 2HNZB 3T1AA 1QQOA 3KLIB 2OPPB 3B8AX 1AYEA 1FRHA 4NXNF 2B8QA 1BOTO 2E88A 2K7KA 1IJFB 3VQQA 2XSFA 3V4IA 4V1Ak 4DLGA 4BHQA 3RAQA 2ASDA 1U1RA 3VQSA 2XZTB 1RBSA 5GAEP 4U7CA 3R7SB 3OW2R 3K57A 4K8ZA 2H3EB 5J2PA 1R31A 3FQKA 1JXLA 1HBUA 2P9PA 3OTOK 2Y8WA 1IJEB 3QT8A 1QTNB 1CZ9A 4DMNA 3BUZB 3ZT1A 4HL9A 5T14A 3CCSN 1VRQC 4U7UD 3P5TL 2NXCA 3GU0A 2GQ2A 4CJ5A 2EW9A 2A42A 4OYAA 1RGIA 1BWFO 4K43A 2Z57B 2EKYA 3VF6A 5H9EK 1VHIA 1GXUA 3MPUB 3CJSA 4N77A 1RWKB 5DM7L 4GO7X 5DLGA 3TSUA 4DSKA 1YDLA 3GIRA 4RKUC 4CHPA 1HKAA 3I33A 4BC2A 3CCSS 1NK9A 3SAHA 3T1YJ 2W25A 3TWHA 4DMZA 4DV5K 2HBJA 1HJRA 4H0VB 4WK1A 2O8DB 1QVFM 1HNVA 2BKOA 1CBKA 1BD6A 3RMDA 3J7Z5 2GZOA 2DHAA 3NKYA 5AQTA 2E5IA 1KHVA 1RWWB 1VC0A 3JAMU 1I6JA 3BZQA 2B43A 1LAWA 5IQQA 4YHHK 5I4MA 4GKJK 1Q8BA 4JK8A 2GQQA 3KMSA 5T7LA 1WJ9A 3SMPA 3LZJA 2BJ8A 1JLFA 3CJAA 1XHXA 3VQEA 2HBLA 2YNIB 5HQ8A 3O9RA 1SC3B 5KT7A 1D4XA 3P45B 2DEJA 4OHVA 3O3LA 3WEEA 4EBCA 2WHOA 4F02A 3ALYA 1S0OA 5KG2A 4C48A 2WVCA 5C25A 3PUFA 3ZX2A 2IM3A 2BV3A 3CJQA 4DLEA 3KMQA 2DGUA 1FXXA 2QL5B 1R27B 5CYQB 5EHHA 4WZMA 1R8HA 3DAWA 5B0EA 3NDKA 1L3UA 4O3QA 3OR1A 3DXKA 4NXMJ 3O6QA 5DK5A 4LC9B 1GOBA 3VAJA 4IOXA 3OQ2A 4Z2XA 2GQCA 4RG8A 3CB4A 4DU7A 1XNRK 3L2RA 4RW7B 1XR7A 4W5TA 1VCTA 4FWSA 1TKXA 2O8CB 3MEGB 3H98A 3DRYA 4CM2A 2W9CA 2RVJA 2JOQA 1AUDA 2XSJB 5CZ2A 1XQSC 3P39A 2RNEA 4OI1A 1F9EB 3UE5A 1YAGA 3M8RA 2OD6A 2PI5A 2XY7A 3T5JA 2DNRA 3PIOQ 2LQBA 1JQGA 2QC3A 4JHDB 1FXLA 4FZYA 4MLHA 3O6WA 4M7XA 2A1SA 2PMWA 4RUAA 1S97A 3JQMA 3GBTA 4FJ8A 4OVLA 3I82A 2IRXA 2MYFA 3OLBA 3KK2B 3HFKA 2QRRA 5JMVA 3WXIA 4LY7A 4IR9A 2GCFA 4N76A 3D3CJ 3A8EA 4ILLA 2BDPA 2VG6A 2WOMB 3JQKA 2XM3A 3TZWA 3S3OA 4RNNA 5F8MA 4KGMA 3OT9A 5T7BA 1TAUA 4DWIA 3SSRA 4JD2A 2E7VA 1T8EA 1VQMN 3AO1A 3W64A 1YJRA 1U1KA 2E5LJ 1W25A 2FVCA 4ZJOA 1VQ5N 2UXBJ 1RT6A 3VAMA 4GW6A 2ZVSA 3CJ3A 1JXVA 2EX3A 3A4TA 4XH4A 1KLMB 3ETMA 4U67L 2V4JA 3H5YA 2V2VA 3AA4A 1U2FA 5IWAJ 3RVCA 4H4KC 2KT3A 3EPIA 4KGVB 4WWSA 3S01A 4ELUA 1FK9B 4D3HA 4DTSA 4P10A 2E9RX 2RKIA 4GVLA 3MOJB 1RWNB 4A57A 3E9PA 4Z94A 4DL0C 5D4NA 4JKAA 3L7UA 1NXIA 1HWJA 2YWHA 4DV5F 1YTAA 5D4LA 1SB6A 3J80O 2RHQB 2MZJA 2ETJA 3LPTA 5J1NA 2GIRA 2W7AA 5E7OB 3FZHA 3ICLA 2OA8A 4WBFA 1K9MT 3K0JA 4I7FA 3T6JA 3P4IA 3M6VA 5HAOA 1SKWA 4GKJF 1MW7A 3KJQB 3EXYA 3DI6B 3SAGA 6FDRA 2QLBB 4DCJB 3JTOA 2UV8G 1MMNA 4CESA 2UXCK 4LFBJ 3MCNA 3O9SA 4ED6A 1EWRA 2DFEA 2O4IA 2XWYA 4DR7J 1WG1A 1MMDA 4BWJA 4C8MA 2XWXA 5KFGA 3VEVA 2C42A 3UKUA 4CT9A 4K0KK 4CGJA 1AW0A 1ZTWA 1R3NA 2OEJA 3ELHA 2BABA 1XNQK 3W61A 2CJKA 4XH5A 1ZA2B 4KO0B 1W2IA 3OXGA 4KI4A 1IBLJ 4L6V3 4PL7A 1UFWA 2ZOGA 5GAEI 2PY5A 1E6VB 3ILOA 4WQ5C 1P9YA 4KREA 1VHFA 3BB5A 4C8YA 2R8GA 1XNRF 2HFSA 4A2BA 3PY8A 3G0ZA 2ACYA 4OYIA 1BY9A 2V94A 3TQ1A 3QIPB 3GONA 3LO3A 4LVNP 2MQLA 3AQOA 3G71N 2C2ZB 1ZZNA 3W3SA 2XRIA 1RAHB 3UD3P 4V19X 2AHOB 1C0UB 1OH6A 3V9ZA 4E7LA 5CYMB 4KJIA 1XK8A 2C2OB 3DNCA 3GILA 1YHQN 5AXLA 3ZYYX 1VQ8S 3SUPA 2CQ0A 2O8BB 1IKYB 5M2RA 5L39A 5FPNA 3UIQA 2DTJA 2V4RA 4Z4FA 1ZM2A 4XPEA 2BM1A 2B51A 5CABA 3QBWA 2EEYA 5F0UA 1HW8A 1ZAVA 4M5HA 4AM6A 1UWAA 3L95X 4G9ZA 1M5SA 2WCXA 3H5XA 4C8KA 3V1RA 1YHQS 3IS9B 4CP5A 5AQGA 5BN9A 4R0EA 4HHTA 2QA4S 3F41A 3AQPA 3U02A 2FVSA 1UMJA 2AA4A 3DDIA 3NGDA 5B0AA 2G8VA 4WU3A 4UZBA 4H0OA 2M7SA 4KE5A 3GCWP 5DGAA 1O51A 3IG1B 3LP1A 3W0LA 3FNNA 1FD2A 4RW8A 4XIUA 3T9NA 4RNMA 3DU5A 4F8RA 1HNWJ 3IRWP 1RDAA 4BRDA 3D66A 1OSCA 4J2EA 3H2UB 1ASUA 2JWNA 1X4EA 1GLDG 5DMRA 4OYBA 1JLQA 2YWGA 1T9VA 3BBCA 4LSNB 1UCNA 4KKOA 2VBZA 2ZH7A 1WAJA 1MU2A 3CNQP 4TU8A 1N36F 5C2CA 2FLOA 3CJBA 2VKRA 4W5RA 1KQSM 3ENBA 4ZVHA 3CC4S 3KK1A 1SJQA 3DOLA 3OYJA 3PCOB 2V69A 1X0FA 2ZH8A 3J7ZO 4FBTA 1Z25A 5B09A 4O4RA 2XHCA 2ZJPL 1TFYA 1P8GA 2HMPA 5AQUA 4OLPA 2W2NP 4CIFA 4IDHA 4IOCL 5A2QO 3ENQA 1VLYA 3P1GA 4OLAA 4C2MA 3OFEA 4RU9A 2DGSA 3R5DA 4IH5A 1FNOA 3D2WA 3D1QA 2WBNA 5HVGA 2OHDA 4BR5A 3ZETB 2XEXA 1LKZA 2OELA 3W8GA 4H0XB 3QFWA 1S1WB 2PYJA 1TVRB 3I5BA 3BYPA 4ANEA 4KRWA 3FRYA 3CC7N 4DB3A 1E4FT 3KDOA 4KHWA 4BGBA 2KYZA 2MTLA 2IBOA 1BQNB 4OI2A 1RISA 3GV8B 1BHNA 1ZBUA 3J7A1 2NS1B 1XHZA 4K0KF 3CDWA 3C16A 2UXDJ 2IBKA 3P38A 2XZDB 1R0CB 3O3GA 5AQPA 1XNQF 5D0GA 2M3DA 4C11B 3ZEUA 2UUAK 2JDJA 3D28A 4DBQA 1NUEA 2L48A 4DV1K 3IMQJ 1SKSA 5GAHI 4CNYA 3LZIA 2FJXA 1RHJB 3SQGB 3Q2SC 3E01B 3BPDA 1VQ7S 2DNZA 3W2VA 1IO2A 3R27A 3M9MB 4O55A 2F1FA 3GDQA 4PG8A 5CE3A 4E7KA 3KHYA 1NDPA 3ISZA 1KOOA 3MEDA 5H9FK 1S5ZA 2A18A 1NLKL 2RH3A 4CHZA 1GOCA 2OUGA 4YY3K 1QQCA 1JLEB 4CZIA 2LLZA 4DQ8A 5LL6d 4Q0BA 2QX0A 4BC7A 3W1YC 3UR0A 3H25A 4HUEA 2J9CA 3CJ1A 2DFHA 3VTIA 4YOYA 4BDZA 4J2AA 2Q43A 4ZITA 2HZAA 2VQEK 4WQ5A 5JS1A 4DU3A 3P4UB 3SJHA 1C0MA 4FS1A 3PYGA 1N0UA 2BZ2A 4FLYA 5FIIA 3X3UA 4KHNA 1NJIO 2FJVA 3GLJA 1U2RA 3DRSA 3M6WA 3PYFA 2PMHA 1KQGB 3G96A 4QOTA 2EFQA 2YPZA 3D1HA 3JSMA 1RT1B 3MAAA 2W1BA 1HKGA 3GV5B 4UY8O 5KFHA 3IM8A 4YFUA 3KUEA 1CULB 1Q82O 2HHQA 3MECB 3MF5A 4JKHA 1FE0A 4R79A 3DKDA 1UA1A 3EYZA 1CJTB 5T41A 5ETMA 1SCJB 5CXTA 2G8FA 3DHWC 1QSSA 4OJRA 4CEFA 4OPJA 3QRPA 4A8SA 4DR6K 4Y1DA 3LWLA 2QMWA 1OYDA 3VQPA 2QL9B 2WSCC 1FRKA 3RAMA 3BGOP 2QE5A 4FW2A 3ILLA 2CDRB 3D6FB 5D15A 2BOPA 3MM8B 3D9BA 1KC8T 4BE1A 2ZE2A 1U48A 2DITA 4USTA 1T7PA 4CJ7A 2QFJA 2AJ2A 5DQHA 2CADA 4K8RA 2YX7A 3CXCM 4GVMA 2HW3A 4A5AA 2M4MA 2OTLN 3AGKA 1AT1B 1U0HA 2OPRA 1QS4A 4JI3K 1S9EB 3MZIA 2DVIA 2A6OA 1T03A 1M0SA 1HKCA 3DYAB 1Q7LB 4LBIA 5FDLB 4JI5J 1RU1A 4H5TA 3AFGA 5HN0A 2GX9A 3MD3A 1KHWA 3MXIA 2ZH4A 2E1MC 4UUXA 2DR9A 1V3SA 1SC1B 1NJZA 1FKAF 4PY5A 1UVLA 4MK9A 4IH7A 1VQ6N 3M8PB 4B02A 4FDFA 4CRJA 2HBKA 4KHSA 1Z26A 2OEKA 2E2OA 3MCSA 3O4NA 1WELA 3M2VA 3QLHA 2MQQA 2IHR1 2P9IA 2IVOA 2UUAF 3QNWB 5KOXA 1IV0A 2HBZB 4ZLNA 2HF3A 1NPRA 3QEXA 2EC2A 4CD3A 1RBAA 2XZWA 4IO9Q 3L2UA 1MA9B 5CQGA 1K8AT 3QIOA 4ISFA 2W9BB 4A62A 3L3UA 4RW6A 1ZS6A 3CMEN 3ZNUA 3D5MA 5BYSA 1C0GA 2RT3A 1EO1A 4C8OA 3BP8A 2FIUA 3AOAA 4FSVA 1Z2LA 3V81A 2J0XA 2QEXN 5AQWA 4QS9A 2HQFA 1WEZA 1S6QB 4YY3F 3I5CA 1RNHA 3PR4A 3AODA 2KHDA 3M1VB 1X9MA 3V9SA 3DLGB 1NDLA 1KN6A 1VJQA 1HYSB 5KFWA 1HHTP 1VSIA 5AR0A 5E3QA 2ASMA 3CMES 5FLXO 3VVTA 4WKRA 2AP1A 5K8MA 3FEYB 2VQEF 2MZSA 1CEZA 4QW8A 4TLRA 3KNAA 5BRFA 4ECVA 3WNFA 3PEHA 3DLRA 2QEXS 1WLJA 4PXCA 3W9IA 3VOVA 3AAWB 4A8YA 1CS4B 5L1KA 3A5LC 4WTYA 2DNPA 3CIPA 4M7YA 3NF7A 1EQYA 3TYTA 2EG1A 2BYCA 1DRZA 3FCVA 3VQAA 4ZCLA 3CJ9A 1PJ5A 4ECUA 2FSKA 1U0SA 3A8JA 4CJTA 3H3OB 4P2XA 5IC4B 3CIMA 2GWJA 3R2DJ 1L3TA 2WUSA 5HMWA 2IMWP 3NCQA 1UPPA 5AQVA 4DR6F 4P74A 2HNZA 2X1FA 5AQKA 3KLIA 2OPPA 3OYHA 5LMNK 2IRYA 1X9WA 1IBCB 1TKDA 4KBOA 4ZVSB 1TGOA 4HYKA 2EBEA 4CLYA 4HR2A 2I38A 2B4PA 2PYLA 1M5OC 1LWFB 2FF6A 3MCOA 2Q6CA 4N56A 4DUTA 1JXEA 3NXZA 3EXCX 2HQDA 2FHJD 4KC5A 2IJFA 1HWIA 3FLCO 1NPPA 2NCKL 3I9ZA 2QWLA 4WYLA 4LR7A 4XEIA 3CCLN 4EU0A 3LL3A 2RDDA 4JI3F 5HVFA 4P72A 4RL1A 3T5LA 4KFBB 2ADCA 3NGSA 4DFJA 1GAOA 3CCRS 1N88A 1R7IA 3RYLA 2BE9B 3PSFA 4NCGB 3NGZA 4FOEA 1ZZFA 2VGNA 3VV2B 1IBKK 2PE8A 3A5OC 5C5JA 4ECWA 4WFNQ 4BDPA 3QEIA 3CD5A 5A2QY 5C10A 4A48A 2O8DA 1ATSA 1NMEB 4LFAJ 4UOCA 4A8KA 1RLDA 4AHCA 2P8IA 1F1BB 1RAFB 2AJ4A 4O3OA 1IR2A 2DK2A 4KY3A 2EFNA 1R8CA 4JI4J 2M88A 2JZ5A 1SI9A 2PSZA 1BWVA 1UVMA 3JSRA 3G4SS 7FD1A 1PBUA 1TTHB 3EGWB 2LFVA 3WHIA 1B9FA 4ED4A 3L4BC 3EEQA 3AAQA 3T7ZA 2C1EB 4X4UA 2HK3A 3LP3A 3ENOA 3TEGA 1Q1KA 4FKXA 1CJVB 4KH1B 5CHCB 2FUG9 2D0AA 4JV0A 3K8VA 4W5QA 5CYQA 4WE1B 1EP4B 2DCLA 4ITSA 3CCMS 2CXEA 4X4SA 2AYMA 3HT0A 5JJBA 2MKYA 2OIHA 3M6XA 2KVIA 2VC0A 2J8SA 8AT1B 3V6JA 3HVAA 2R7SA 2LXIA 2HS0A 3M6UA 4FJXA 2PGCA 3RZAA 5B8HA 5BPLA 1QUPA 1TAQA 2V2KA 4RW7A 4DV0K 2MZTA 2VOPA 3OA9A 2JC0A 2YX6A 2O8CA 4QPXA 3MEGA 4O0IA 3TAQA 2A40A 4C97A 4Z37A 4UF4A 4HVJA 1X4BA 3C19A 4GVBB 4NXMK 4EO8A 1WDTA 1G1XA 2XSJA 2CJBA 5BR8J 1TKZB 1F9HA 4ECSA 2O67A 2Z2ZA 3RGIA 4KBIA 1FJGJ 2M8HA 4JHDA 5CR4A 4I9LA 5IT9U 3GMGA 3UVJB 1DEJA 2PFDA 2VG5B 1FA0A 2VHGA 5LMNF 3X1LB 3KK2A 2ZEJA 2FQQB 2KW4A 4XK8C 1NWKA 4DTUA 2JWKA 1T3VA 3RB3A 3CSKA 1KXPA 5KTQA 2WOMA 4P7TA 1SH2A 2GUPA 1J2VA 1T94A 3L3CA 4CJWA 4LQ9A 1LXJA 2IJNA 1YITS 2MZQA 1WHVA 2ADBA 1ZAWA 1SQEA 4QS8A 4ED8A 1IXKA 2VKZG 4UQGA 3QGHA 1RKJA 1KLMA 1WI8A 4I0WA 4USUA 2NRWA 2XLIA 2UVRA 4GNIA 2J4RA 2FVRA 3EZ5A 3PO4A 2B5JB 3MCPA 2VDIA 1HKBA 2HG4A 2IAJB 4ILJA 1FK9A 3A12A 3I0SB 3DDNA 4E0DA 2EFVA 1IBKF 4FJIA 1LFPA 3DLEB 1VK3A 2G2YA 3TO8A 3EZWA 5AXMA 1FFSB 4G6VB 1YK9A 3IMXA 5F2RA 4ETXA 3PSIA 4FJKA 3VGTA 5KFIA 3GV7B 4I6WA 2OZMA 1OY8A 1RWPB 2Q66A 2W41A 1DJ0A 2NR0A 5EOYA 3BN7A 2LA6A 4N8OA 3L2WA 4AL7A 3EE3A 4I9QA 1VQYA 4LF6J 4K4VA 2IVNA 4H0TB 2OTJN 1GXLA 5D78A 2UYTA 3DI6A 1ZXOA 3SQ4A 5BPMA 3BPSP 2QWQA 3BO3A 3DLLL 3MXHP 5E26A 1VSLA 4HTJA 2BRKA 2IMOA 4M5KA 1WDDA 2EG2A 2JFKA 3V4MA 3B8HA 2DNGA 3CQXA 4QYZK 3D6MB 4BROA 4BRKA 3VEOA 2ILZA 1RTJB 3ZTSA 3AVKA 4ZPDA 3HD1A 4ZN1A 2DD8S 3CJKB 4JI7K 4M3YA 2RJZA 3RMCA 4DTJA 4EFAC 2DGQA 2YKQA 2L41A 3A5MC 2OFGX 1RYSA 3K9KA 4GKKK 4ATNA 3UR3C 3HD2A 5HJYA 4KO0A 1BHLA 3F2KA 1VQ9S 2X51A 4OQJA 3M8QB 4JI8J 2CPJA 4DTXA 2HGNA 5LXRA 2SXLA 3PX4A 2BUPA 1E6VA 1I5OB 2AZ1A 2VODA 1RBTA 3M2UA 2MKIA 4DU8A 4JI2J 4DV0F 1VSFA 4YQWA 1WSVA 3QIPA 2C3MA 4L75A 2ZBCA 1ZYQA 1APSA 3W2WB 2DNMA 4CGHA 2R7UA 5FLXY 1C0UA 2CQCA 4S0MA 4M5LA 1AROP 3VETA 4NXMF 2MHNA 5CYMA 2OGUA 5F9NA 4NCBA 4KPCA 3FBCA 3MR6A 3CCJS 1NGBA 2RQCA 4WCEQ 4GV3A 2O8BA 1FTCA 3PIPQ 3OYLA 1IKYA 4MKAA 3A3NB 5B7WA 4LBPA 1FDAA 2ZBIA 3M2RB 2JFDA 3CCQS 4RBUA 2FHJA 3R7BB 2ZM6K 2V6AA 4CJSA 3BV8A 3GIJA 3T5KA 1UZDA 5M2UA 3RMAA 3SCLE 2E1AA 2E7XA 4JRPA 2EFPA 3IS9A 3OYIA 2KG1A 4ED0A 4X4TA 3AAPA 1WG4A 1PCAA 1YKWA 3AOCA 3TX8A 3ZTPA 2MEWA 2QKKA 1H72C 4A46A 3PFOA 1U25A 4OGCA 5ETTA 3MMBB 2WW8A 3H4DA 1VSJA 4N47A 2N3OA 3QEWA 4W98A 5MLCQ 1IWAA 1UW9A 2Z8QA 4DHVA 2W8LA 3IG1A 3NVKA 3W62A 1GLLO 1PYTA 5E3CA 4NOHA 3NAIA 2N3LA 1F3VA 2FHKA 4OIXA 3CM6A 1RT5B 3SCIE 4FXWA 1Y0HA 2LSNA 3N4QA 3GFZA 1BQXA 4ES2A 2AGOA 4ZHRB 3VMFB 4LSNA 2X74A 3J81O 4BG9A 3MEKA 3TAMB 1N5YB 3A3OB 4M8LA 4DF8A 1VJWA 2Q31A 3Q2TC 1CQNA 4B3TJ 3NNAA 4ECYA 1CLFA 1S0NA 1EARA 4ECZA 4J9MA 2RQ4A 2QT7A 4DEZA 3JAMY 2YX1A 2QLJB 3KWGA 5KQ8A 1NGCA 4DV3J 4LIRA 3R6MA 4CZEA 4GV9A 1WEXA 3HYFA 3AARA 4TU9A 3WZ0A 3P5JA 2GO9A 1HNZJ 1YJ9S 1KBRA 5LJ5Y 3IUCA 4TLQA 3ZLJA 3U8XA 2AQ4A 3ZETA 4AL6A 1FI4A 2IPOB 1K8AO 3AJ1A 1S1WA 3KKRA 1TVRA 1ZPWX 2FJBB 2VFRA 1OKJA 5ETNA 2P9EA 3HI9A 4DN0A 3QSYB 5LSRA 1XN9A 3LGHA 4Q43A 5HMXA 3NH2A 1BQNA 4JI7F 3MDQA 5J2QB 2VQFJ 2V52B 1AZSB 2BBEA 1Q4RA 4GKKF 3L4IA 4E1JA 4C11A 4LF7J 1J54A 2VCPA 2YHBA 3S7RA 4JUZA 1JNZB 1J9AA 3C6TB 2RS2A 1YRXA 4IO9L 3JQJA 2W7PA 4DR7F 1RU2A 4E8UA 3SQGA 4PAAA 4O0JA 3E01A 4DN9A 2MKJA 3AV9A 2YJEA 1QM9A 3OVSA 3ZTOA 4DJBA 3D54A 4C3KA 4ID5B 2UXDK 1UW4A 3W5XA 2HSTA 4ZCIA 5KFQA 5DM6Q 5HMYA 2IYGA 2DNHA 2C2EA 1JLEA 4NZ7A 1WB9A 4N8NA 1WBDA 1SS6A 1N33J 2CZVC 1B4SA 4BC9A 5SUHA 2ZBQA 2MKKA 4FW1A 1J53A 2NUBA 2YQ3A 3QT6A 4P9SA 2ZDPA 5DLFA 1TUVA 2HBYB 1X3MA 3IRXB 2ZM6F 1IR1A 1PAUB 4PKHA 4YDUA 1FRMA 1UFLA 5EX0A 2OSRA 1X7VA 1K0VA 3SQOP 3H8YA 3ENVA 3OVNA 2L9NA 5L38A 3CCEN 3FEXB 3QQCD 3SBMA 5JVGQ 5FJ4A 3OYEA 3QZ8A 2CWKA 1RT1A 4CEAA 2XLJA 5KT3A 2B9XA 3IWNC 2AGQA 2IFXA 1CULA 4KHQA 1QLNA 4YR0A 3KUHA 3LGMA 3MECA 1DAXA 3QSIA 2LCWA 4CO3A 4O5FA 3FMBA 1CJTA 4MK7A 1LXNA 4I68A 1LW0B 1EIYB 3R7NB 2ROGA 2W7OA 1YBAA 2CQ1A 1YZ7A 3QEPA 1X4DA 1FRJA 3MMCB 3PKMA 1HWKA 5SWMA 4OZJA 2FXUA 3MM8A 3EGVA 1JCFA 1TUYA 3VF4A 4H0PA 1XUPO 2Z30B 1C0TB 4BRGA 5DQGA 3C46A 3HLUA 1VRUB 4I6YA 3G6VA 3W9HA 5RUBA 4CGIA 4LF8J 1D5AA 1S7IA 2CPEA 1UAXA 4WFAQ 4WP8A 4E89A 2FLPA 4TNOA 1S9EA 1FKPB 3KG0A 2NXJA 1SJ3P 1SL0A 4P73A 1WSHA 3ZT3A 5AZIB 3CC2N 2UUTA 4K41A 3DYAA 1LV5A 3I4HX 5FDLA 4V19J 2G1HA 4PXDA 2Y0BB 4HEA9 4B1WB 5DDQC 4DTOA 4NLOA 4WFNL 4LRBA 3L7OA 1G4CA 4LFCK 3TABA 5KFZA 1TMMA 3D0PA 4O8KA 3CYMA 3HFVA 1RA7A 2QLWA 4OX9J 3M8PA 3JTPA 2W2MP 2Q0UA 1SQFA 2WSEC 1EKSA 5KFTA 4O3RA 4BGAA 1Y5NB 1NGDA 3CULA 2HYIB 1WF1A 2P51A 5DDOC 1B92A 4Q2MA 3VESA 3S9HA 3L09A 1P1TA 2KRRA 4CIGA 3FUYA 2BW2A 4KB1A 3MTKA 1KQKA 1Y3KA 5EGYA 5M1QA 3UCGA 1NHUA 4DSLA 1Q81T 4ZN3A 2KM8B 3OYKA 2PI4A 1EETB 2Q97A 1X5SA 1Y9OA 2W9BA 2E1YA 5BRDA 2UP1A 4IG3B 2RIJA 4Y3CA 3AVBA 4CLPA 3U4LA 2J9DE 4DF4A 2PIIA 5KT6A 2UXDF 2I7PA 4X66K 1VISA 5ETQA 2O3DA 4PCQA 5LT5A 1C1CB 4J9OA 1S6QA 4YNQA 3OVBA 3HJVA 2QLXA 4LRCA 4CGDA 1XC9A 4Z4EA 3M1VA 2D1CA 3DLGA 1Q7YO 1HYSA 3B6BA 2M8DB 2MSTA 2CQGA 5G4DA 5KFRA 2KVQE 1U26A 2RHSB 2EK1A 4TVAB 1BI4B 2CPHA 2YH0A 3H5SA 3L6QA 1RHQB 3WIVA 1Q79A 5DZ6A 1C0FA 1SAZA 3FZBA 1HWUA 2P9NB 1RTZA 2Z56B 3I4PA 3IO1A 4IEEA 2CQBA 4ER8A 1LOTB 2HOEA 1CS4A 2AJ1A 2AJ0A 1SPBP 4M1KA 4WQ4C 3CI5A 2EKNA 3QATA 3CVKA 2ATCB 1GLCG 4NLWA 3HDSA 1Q86T 4F3OA 5DQIA 3MMVA 4X64J 4QWAA 4O23A 3E1YA 4ZIVA 4J9LA 4J90A 2UUWA 1TL3B 1VOMA 3PYEA 1O0PA 2W24A 1U1QA 4FLXA 2FZKB 3K9JA 4CEDA 2CQHA 2KN4A 4C0BA 5CZ1A 1J5EK 2XB2D 2UZAA 1VQ4N 1UL3A 4BRMA 2FYXA 2OEMA 1Y10A 4O5BA 2HZVA 1FWPA 4J9KA 1NH8A 2CG8A 3OBIA 2AMCB 1PC5A 5L46A 5L1IA 3VTHA 4DPOA 1LWFA 3N28A 2Z1HA 2MSSA 1ITPA 4JV5J 1VQ4S 3CCZA 3SUNA 4O4GB 1JX4A 3ZZOA 3MXJA 2V2ZA 1FFGB 4ZVRB 5E2QA 5GAEU 2MY8A 2K1RB 3AVGA 3OYCA 4G1QB 4KFBA 3J81Y 4IQXA 3M9OB 3R9LA 2ZZNA 4RBVA 5I3QA 2RILA 4ZA1A 2QSWA 3RW7A 4L76A 3HSDA 4X65K 3A2FA 1RUSA 4NCGA 1OVQA 1MG7A 1R8AA 2KI2A 2G8HA 4KTQA 5KFEA 3PW0A 1JJ4A 3HP6A 4DPYA 2BJ9A 5HRPA 3W63A 1JKHB 4LMZA 4LFCF 3SXLA 3NCRA 4OMFG 1PJ6A 1XTZA 1GOAA 4YR2A 5KQDA 1RDWX 3C6HA 2V7ZA 4NLCA 4MYUA 3CF5Q 5CAAA 3N4PA 2YPYA 2CJXB 1MMLA 1S9FA 4M42A 3OBWA 3TZXA 2HBQB 3KNGA 2V4QA 9ATCB 1FRXA 4OL8A 3LP2B 2D3ZA 2C3OA 3G6YA 2QXFA 2BJDA 1F21A 1T9XA 9RUBA 1JJHA 4M5NA 1MWQA 1TELA 2XO7A 3J81j 1OQ6A 1HNXJ 4DL5A 2R8HA 1FESA 4F36A 3OXFA 4HI2A 4J7CA 4Y28C 4JI6J 5K20B 1NU4A 3J80U 2J0QD 4CH7A 2AIRB 4USHA 2K06A 4KGKA 4X66F 2MQOA 1CJVA 3M4XA 3DLHA 3BQ1A 3M6GA 4WE1A 1EP4A 1JJ2M 3FVYA 1NGIA 5LJ3Y 2YBVA 2WB1D 5KAKA 2WB4A 3CJ4A 2BOAA 1Q9YA 4MIBA 4OHZA 5A76A 5LMUJ 4DX6A 1FJ7A 1V3RA 4IBNA 3BREA 2GIFA 2CPDA 2UVVA 4MT1A 2VV5A 3EGNA 3LH2S 4DR5K 1RAOA 1R6VA 1XMOK 3VALA 4ZJLA 2P5OA 4ZTFA 3SQ1A 3LAMA 1S6PB 4KHPJ 1QAYA 4DX5A 3O1BA 4P2SA 3A8IA 4YOUA 3C66A 4EFHA 3TVZA 2I2YA 5D3GB 3AO2A 4JI1K 2HEKA 2HVDA 3DWLA 2KXNB 1PYSB 1C4CA 2CNKB 4GVBA 3N9UC 1HPZB 3TP2A 1JIHA 2GUIA 2BGGA 4K25A 3W9JA 2VICA 2V67A 1QTMA 1TKZA 2AYBA 4N5SA 4WCEL 3T19A 2Y8YA 4ILGB 4QOZB 3SBTA 1KEKA 4DV2J 2HQ3A 4CZCA 3HSCA 4NEYA 1J5EF 3NVMA 5AJ3J 3JYTA 4M3RA 4PEOA 3UN5A 4N7TA 2PBDA 4CF2A 1O5JA 3UVJA 4HDHA 2VG5A 4ZVEA 3QRQA 2E1CA 1YJUA 1ZTTA 1FDBA 2V8VA 2NRVA 4WQ4A 1VI7A 4OZ2A 4JKCA 5JICA 1VAZA 4KH4A 1YJWS 4P7VA 3UCZP 4LR8A 4EAHD 3MWBA 4ZCKA 4FP9A 3MN5A 1ATRA 1Y5LB 2A2DA 2MY7A 1RBVA 5J2MB 4CJ3A 2DHXA 3HJFA 3EUNA 3FR0A 5GAHU 5GAGP 1P9QC 2DHSA 2BR0A 1LW2B 1VR6A 3R2CJ 4UZCA 3TA0A 1HR0K 4LF1A 4CNZA 1XR5A 1V5VA 1G2EA 2NRHA 4K5SA 4AXIA 1FWLA 4EMDA 3M8SA 4X65F 4QAGA 2N7YA 3FDSA 2B5JA 2VD3A 3CJRA 3HMJG 1QVGR 3VWSA 2IVPA 3AVCA 2IAJA 3IBWA 3PW7A 3DCAA 4NLVA 3I0SA 2V8HA 1LEOA 4PWDB 4BVOA 3DLEA 4CJKA 1QQNA 3BDPA 4MKVA 3POTB 3RMBA 4PYAA 2HRUA 2QWRA 2BANB 1CZBA 2GVZB 3AY9A 1GK8A 1VBZA 2F4VJ 1QDUB 5L1LA 2DR5A 1AA1B 3C6UB 1LWEB 2G0JA 5GADP 3W65A 3EN9A 5AQHA 4K50A 1X0PA 1UOCA 3CUNA 1KS2A 4H4MB 5KPTA 2YKNB 5HRNA 5IXUA 1N32J 4ZS6A 1Y7PA 4IKAA 1OPIA 5FRMA 5AQXA 2KZZA 4FN5A 4USJC 2HWHA 5ADXA 4FPAA 2U2FA 1HHSA 3OTDA 5F8HA 4PA1A 1KR4A 2BQ3A 4BC3A 4Z7CA 2DR6A 5HSPA 3H5UA 3IWLA 1S49A 3CT9A 2QWOA 3ZSQA 4DR2K 2YNHB 4J2DA 5HL7Q 5KRTA 3A13A 2HIQA 1RTJA 3CJKA 1RKIA 1NK5A 3C3LA 1GNKA 4JI4F 4CO2A 5A2QU 3MPVA 3B4MA 3QGGA 1S10A 4DL3A 4QU6A 2D5RA 3TI0A 5HI7A 2A1BA 2QA2A 3NFAA 1WKJA 1B64A 1HQEB 1S0MA 3M8QA 3CCUN 4DR5F 1MNEA 2CQPA 4F2RA 5IS2A 3BDEA 5F0WA 5LSLA 3KWIA 4DR1J 2VOOA 3CPWR 3BZKA 4PG7A 3KHLA 3NS7B 4FK2A 3CDUA 3TNVA 4CZKA 4B9SA 4A8QA 2F5GA 3D7EO 4IFEA 3W2WA 4JI1F 4I4BA 3QMLA 1IKWB 2JGUA 1BIZA 1GLBG 4WIIA 2C3UA 1GH8A 1F5CA 3OBYA 4ZVUB 2RRAA 2NREA 1VYAA 4QR2A 2B6AB 1QUVA 3S3MA 2B7BB 1LQ9A 4DSJA 1R0AB 4JI2K 4DV4J 3OFFA 2VBYA 2G8IA 3M2RA 3HM8A 1JL2A 3D45A 3CJ8A 3KK7A 1KLNA 1QZ5A 3V6DB 5JVGL 3ZXWA 2HPUA 4XPCA 4DQIA 4P71A 4LSLB 3VHQA 2ZH6A 1R8BA 4UT4A 5BR8F 3VGUA 1Y97A 1HI1A 2CGKA 5BPNA 2JC1A 1RAJA 4JEPA 2E20A 5CCLA 3MMBA 1N8RO 4DV7K 1NH7A 4LF4J 2ATLA 1RHMB 1HR0F 1OY9A 4IJAA 2FGOA 2KJWA 1BLUA 1RT3B 4DCOB 2NRXA 5KFNA 1RT5A 2P2CB 3ITHB 1K6YA 4CE9A 3CDEA 4ZHRA 1X5TA 3CFOA 4NXNK 1HMVB 1XMQK 4RJVA 4TN2A 1ATNA 3GYXB 2XCPA 2XMKA 2UV8A 3VPZA 5EWFA 3FGUA 3VENA 3TAMA 2ASJA 1N5YA 3E9OA 4LD0A 2DPJA 1YIJN 1IM6A 2GMLA 4RW4B 2RAQA 2XMUA 2R7QA 3CETA 2BW7A 2GAGC 2GAHC 4NYFA 5B0DA 2IDEA 4Z4IA 5IV3A 5ADXH 3KJVB 5H1SV 3TAPA 4IZ9A 3ENHA 4CIEA 3TJ9A 3MX5A 4P52A 1CZAN 2K2PA 3T6BA 3AOBA 3O8WA 2FJAB 1UA0A 2V63A 4RX6A 4F4AA 1C1AA 1N6QB 4I67A 4WFXA 3CFRA 1IBMK 4RWWA 1KQFB 3PACA 1FXRA 2B4JA 1QD1A 2Q0RA 1S76D 2KM8C 3IBCB 4NLTA 3NGUA 1RYRA 3DXMB 4KHRA 3AVIA 4H5RA 1YJNN 2XS5A 4ZLPA 4DR2F 4JLHA 4DV3K 2XHBA 4OV6A 1LK7A 2CPYA 3ZZTA 1S0VA 1WSGA 3C8YA 2GGPB 1TP7A 1B7FA 1WF2A 5J2QA 2RB7A 3J7ZT 3PJ9A 1AZSA 4U8VA 1OS5A 4Y2IA 2JL9A 1Q8IA 1ROFA 2PC6A 4WFBQ 1WSEA 3EMTA 3C6TA 4BRHA 4FLWA 1GLFO 2E9ZA 2ZH3A 2E6MA 5IZHA 4OX8A 2BM0A 4MFBB 3MGJA 3K17A 4ICLB 3BSOA 1SC6A 1B7YB 4ID5A 1Q9XA 4CF1A 4I69A 2W4CA 3TAFA 4URSA 1VQON 5GINA 4AL5A 2J9EA 4MDBA 2VL1A 2RMLA 3LPEA 4NLXA 3SUQA 2AZ3A 2W40A 2DB1A 2GNKA 3VGLA 4YOWA 2HRTA 3L2VA 2HHHK 4IOBA 1BDGA 4Z7YA 4OZLA 5IT9Y 3E3XA 2Q36A 5HQMA 2OH2A 3VQ8A 3KHRA 2E29A 4JI2F 2A2CA 3FSIA 2IDOA 5KG7A 4B9NA 1FE4A 3IRXA 4PXBA 4FXVA 4BBYA 2KL8A 1M1KO 1NDCA 4BACA 4F0KA 1X4HA 2OZSA 1TUGB 4OYMA 2YX4A 2BE2B 2D0PA 4M41A 1IR0A 2ASOA 5DJBA 4FWLA 2EXUA 3O3HA 4CJLA 5GADI 2QTWA 4DR4K 4FPIA 1PC4A 3SNNA 2QM1A 4HH0A 1JXBA 3EZUA 4ELTA 4B3MK 2J0SD 1D9AA 4LF5K 4DV7F 3M30B 3V2UC 5K14B 4IDKB 1LW0A 4CLUA 4KGZB 3CERA 4FVCA 3RR8A 2Q2RA 4KH6A 4YOTA 2FBYA 1W7AA 1BU6O 3MMCA 1E6YB 4KQZA 4QIFA 4DPUA 3AVAA 1DY3A 2W01A 4L73A 4CEOA 2D41A 3K58A 2GHPA 1WG5A 1XMQF 3NH1A 1NJIT 1REGX 1NBEB 3RG6A 3UD5A 3MXMA 3DJCA 1WUUA 4AILC 3AVFA 1NJYA 4FF1A 1C0TA 4ILHA 3IBFB 3F9MA 2I5JB 1VRUA 3QEVA 4HUFA 4K8XA 4WPAA 2WSFC 3G86A 4UY8T 5DETA 2ZZTA 5J2NB 2J0WA 1Q82T 4B9UA 3M32B 2KHOA 4F4XA 2XMWA 1MLAA 4P6QA 2R42A 2AEMA 4JYAK 1FKPA 2HBMA 3QZ7A 2F63A 5JLHA 1W7WA 2E44A 2HQIA 2OFHX 2ASPA 4CF8A 4Y0WA 4RNHA 3HX9A 3UI3A 3B54A 1LWCB 5AZIA 1RA6A 1IBMF 2DYAA 2LMIA 1S72S 2MGZA 2EWSA 5EWEA 4OLOA 2HLUA 2CYYA 3OTEA 4ILRA 3RRGA 5HRSA 4OI6A 5ETPA 3NHGA 1HA1A 3LAKA 1FCAA 3KK3B 2HURA 2HQCA 4DV3F 3OTOJ 1D8YA 2D69A 4ED5A 2RRNA 3EPGA 4F04B 4M5JA 5IFMA 1RQ0A 4PQUB 4YB5A 4CJ4A 1HNZF 1EQ0A 2ZHBA 5C0YA 2O01C 3NG8A 2BJ1A 2E5JA 4RUHA 1GX5A 2QA4G 4DFMA 4FJ7A 2Z1IA 5H9EJ 3MCMA 3NS6A 2UUCK 2QO3A 3K5OA 2EPIA 3SI8A 5DS7A 2H5EA 1PJ7A 4RR5A 1N5VA 3F5TA 4J9UE 3HL8A 3NWGA 4B3SK 4JS5A 2BACA 1EETA 3FZKA 2HNYB 2DHHA 2UUBK 1WHYA 1CXUA 2R3VA 5HQLA 4IG3A 5L8RC 1K8KB 1NB2A 4NLDA 3N6MA 2H5IB 5ETOA 1RTHB 3KJNB 4PHTX 4CEZA 1A0OB 2B8PA 1ZETA 1C1CA 1M5PC 4AXJA 1RDCA 3LM9A 2XNQA 3L0QA 4CEQA 5JVHQ 2XQCA 2MKCA 3DOKB 2L9WA 3I8BA 2YKMB 1TFWA 4YHHJ 2HHHF 4GKJJ 3WNGA 2E5HA 1FNMA 1I51B 4DOZA 4FF2A 1JCGA 2QZ8A 1BI4A 1TUWA 1JB0C 1SL1A 5E3AA 3T9ZA 3BH6B 1QAJA 4CEBA 1X5OA 3W5YA 1EQMA 1UKUA 5KFLA 1RADB 2P9NA 4PPDA 1N34K 3S3NA 4ZP8A 3TQEA 2HFZA 3K7RA 1NRKA 3NBPB 4L3NA 3O9UA 1WBBA 3ULDA 3MM7B 3NCPA 3TTCA 2VA3A 3THWB 1V9OA 3H1QA 1NJXA 1DHMA 3RWUA 2E4LA 3E51A 2ROEA 4DX8H 4DR4F 2E2QA 4CJQA 1TL3A 1JLFB 4KHMA 4JB8B 4Y2AA 3TZYA 3SYZA 3K2YA 1VMBA 2M9KA 4B3MF 2CPZA 3AB2B 2R2UA 4LF5F 2QMUB 4FK4A 3RB6A 2GO8A 3WXMB 2FZCB 3DRRB 5DRKA 5GVQA 2O5DA 4CO4A 3NGTA 4OI4A 3Q0AA 1XNRJ 1XEZA 4K42A 4QIGA 1T0TV 4E98A 3VCDA 2WZ1A 3NGYA 4GV6A 3TSQA 1M5HA 4X62K 4DUYJ 2W42A 5KFMA 5GAHP 3OPKA 4FF4A 3MK6A 1VSMA 5TKWA 4QWCA 1OMSA 1CG2A 4WFZA 5F8IA 1KRPA 1HQUB 3EGZA 4DTPA 4O4GA 4K4SA 4FBUA 2DY1A 3FQLA 3D2EB 2BE7D 4UY85 2C2NA 1IUJA 1FDDA 4CFAA 2K1RA 2ZF5O 3OYBA 3AVLA 3NOGA 1TK8A 4JYAF 4G1QA 2E1RA 4DCHA 4CW7B 1DLOB 3R6GB 4KHYA 3O1WA 1B70B 4KYZA 1DQAA 1A5WA 3A5NC 2X6SA 1JJ2R 3JS6A 1VQKN 4IOAQ 4U7UK 4KTWA 3W7BA 3HOTA 1T44A 5F8JA 1M90O 2NZTA 3KLHB 1AFIA 1S99A 4KTZA 1JKHA 2L08A 1WOQA 5C7PA 4DUZK 3NEKA 2YQ1A 4AHUA 4M63C 2P9SB 4ANCA 2D3UA 4O44B 3A8YA 1N36K 4OKJA 3CMQA 4DTNA 2KJVA 2I8EA 4LRAA 5D77A 2FLLA 4H54A 1HW9A 2GX8A 4A8XA 1VQKS 3I56N 2QFIA 1HI8A 2Q1NA 2B9WA 4LR9A 3LP2A 4I64A 3GG1A 5IV4A 4TYBA 2UUCF 2ZD1B 1NG9A 4OZNA 1H98A 3D1OA 4B3SF 1D0EA 3MPDA 1WN7A 4LF2A 1WHXA 4LRDA 3GR1A 2UUBF 3DHXA 1BWEA 2AU0A 4HUGA 1FW6A 3VEXA 3I56S 3MN7A 2UU9K 3D2FB 3CG7A 4DX7A 5HL7L 4CTAB 1FJEB 1Z6RA 3TWZA 2YWKA 4E7HA 4PWWA 3R5CA 1MDUB 4JNEA 1VQLS 3ZC4A 2X78A 1VLOA 1ZH5A 3KIOA 1EZZB 4YB6A 2VB6A 5JS2A 2VGMA 1HNXK 1P27B 2B9EA 1S22A 1GLEG 2RS8A 3O4WA 4ZPBA 4IEIA 1RCOB 3DFEA 4G3IA 4OYXA 2R7RA 3QMQA 2YXLA 3P6YC 4KR0B 3NGKA 5BR9A 3BEGB 2UXCJ 1V4SA 1N34F 3ZSWA 1TK5A 1C1BB 1S6PA 3TA1A 3BKTA 1NO8A 4JP8A 1UPMB 1FJCA 1IJJA 1Q8LA 3ETOA 1HARA 1VQ8N 2WK4A 1WSIA 3PZPA 1BA0A 1U1LA 2FHOB 3NH0A 5D3GA 4JBCA 4I7FB 4JV1A 4RNOA 2LQ9A 3VEWA 1HPZA 3GSIA 4F3MA 4ECRA 4K0KJ 5C42B 3SFUA 3BF3A 1N52B 1IG8A 5KT5A 2YVSA 1XNQJ 4IWVA 4HTUA 1NK4A 1EKRA 4PQAA 2DKOB 4CJRA 4K2XA 1RWMB 1XQIA 1U1MA 2HS3A 5KRSA 3I0RB 2MJUA 4QBUA 3B4DA 2AW0A 2QA4N 1X9JA 5BJRA 3H1VX 2Q6BA 3HZ6A 2JHEA 3SJJA 3AY0A 2RUSA 4BQLA 3C2PA 2DIVA 2QWMA 4B3RJ 1FEHA 5EUHA 4X62F 4QYRA 5HOOA 3RR7A 3FFIB 2ZUGA 5J2MA 2ZKUA 2IC3B 5MAOA 4WKYA 5LJVA 1FKOB 3J7YP 4OPHA 2JSXA 5HO4A 2VH7A 1LK5A 3C65A 3N0VA 4AD6A 1RT2B 4DG1B 1YXQA 2GJ2A 5AJ3K 1LW2A 4DQPA 2HVZA 2LQJA 1JK9B 5KFFA 3CJ0A 1GX6A 3SZ2A 2MB0B 3CMAS 4FJHA 4JN4A 3LA0A 2WW4A 3THPA 2HHWA 3E66A 4ZDNA 3ULHA 4CLTA 2R8JA 3CC4N 4RLEA 1FRLA 1RCXB 1BGXT 2POKA 4CT8A 3QBCA 3KLVA 1UP1A 2ZOFA 3KVGA 3M8WA 2F65A 4PWDA 4R0JA 4LT6A 3SCKE 1EWQA 4I6MB 4ECQA 2XLKA 3FJ2A 1DTTB 4C8ZA 3HHLB 4DUZF 1RGVA 3OD2A 1QQMA 3TRGA 3MI7X 3QFHA 5B0CA 2HHSA 2BANA 2GVZA 1X8DA 2EFOA 3C7NB 4RUBA 3C6UA 2NZCA 5EDWA 1LWEA 1YSJA 2ERRA 4HT7A 4HHJA 2M70A 1HYZA 2GHWA 4CLFA 4X4PA 2FC0A 1B3TA 4KT0C 4MIAA 2OI2A 4H4MA 2YKNA 1WUAA 3FBFA 3MM6B 3J81U 3PJWA 2BJ7A 3I87A 4H4KA 2VZ9A 3PRBA 4ZPWR 4F4WA 3MN9A 2BKPA 5GIOA 1Z2ZA 2FZGB 2DEIA 1NGHA 4ZK7M 4DSEA 4BR9A 1Y00A 1NK0A 4YR3A 1WAFA 2UU9F 5C12A 4CDIA 3NLCA 2YNHA 4NA3A 1RBRA 4AQYK 5EVZA 2WAQD 3BR9A 1BMQB 5G0RB 1N32K 3RRHA 4NEZA 1JCEA 3UB5A 1VQ7N 3HHDA 4U67Q 4DCPB 2G8WA 3GTYX 2F9DA 1HNXF 4WFBL 2VFUA 1WACA 4DS4A 3T1HJ 3VQCA 1XERA 2LQ5A 1HQEA 4C0OC 3THXB 1RILA 3IN5A 3PO5A 1GMUA 4OX7A 3S1TA 3FZ2A 4TQRA 4LREA 4EBDA 2K3IA 2GELA 3QNOA 4CYUB 3R5GA 3FZMA 5CD4A 4FZVA 4D3GA 3KKSA 1T3OA 4ED7A 3ZSYA 2DNOA 1H73A 1JLCB 4L3KA 4WP9A 3IFRA 2C3YA 3TU5A 4IO1A 3NF8A 3MX2A 1OO0B 2XMJA 1SC4B 1YRTA 3KKFA 3US5A 1IKWA 5FPDA 2OSQA 3UFCX 3U27A 3AB4B 2XYGB 3AVJA 4FWRA 5IT4A 2W2PP 2WONB 2NXEA 3HHEA 4E2FB 2B6AA 4G1PA 5M1NA 2UUAJ 3EDQB 1R0AA 5A6PA 2DRDA 3L7PA 2BUNA 1NDKA 1WD6A 4DV1J 4JI0K 3QGPA 1T6DA 1RHUB 1UAWA 1PO6A 5FPEA 3LPUA 2U1AA 4P2FA 3HHKA 3QICA 4AHSA 4M3UA 3V6DA 1NGJA 1FVSA 3G8TA 2RRBA 2X1GA 2EVZA 2LXUA 4FLVA 4RBTA 4WF9L 1S3XA 2ZH2A 2QN6B 1Q16B 2ZH1A 4LSLA 5FROA 5H9FJ 4FL9A 4PKDB 3FBBA 3GYGA 4DV2F 3BGRB 4YY3J 2Z1GA 2VASA 2V2QA 1CJKB 2H5JB 3ATUA 5AJ3F 4ES3A 2PA8D 2IVYA 3A1YG 2HFVA 1H2UX 1S6UA 1RT3A 4Z4GA 4FNHA 2VQEJ 1C6VA 2BEFA 3NGRA 4UOHA 3ITHA 3HHNB 2KT2A 2QYGA 2CAJA 3GR0A 4HI1A 3DXSX 1NEEA 1HMVA 4F3TA 2XBPA 1RZMA 2CVIA 4HVZA 2E5GA 3A3PB 1QSYA 5B0FA 4RW4A 3Q8YA 2B4UA 1VBYA 3HBTA 2CH6A 1FWKA 5L9NA 1U47A 1BE4A 3KJVA 3PDNA 1RWXB 4A4JA 3O44A 3MWTA 5BRHA 2YH1A 3CCVS 1TR0A 2YNGB 1NMNA 4HKQA 3ID8A 4PPZA 1RAIB 2H4YB 2Y1LB 1IKXB 4Q7AA 2FJDB 5ETLA 3R8YA 4DR6J 1N6QA 1FD8A 5AQJA 1YI2S 2XYHB 3OUYB 1YZ6A 3ZT0A 2FBXA 2DY9A 3KLGB 4USIA 4FVUA 1R59O 3L2QA 1UEUA 1ULRA 1WKLA 2DNLA 1I94K 3HZEA 3J80Y 1HHQA 3DXMA 3EDRB 1M5KC 3HVWA 3QWUA 3MAQA 3KYLA 5AXNA 1LOUA 4AQYF 2NPIA 2GGPA 2V8GA 2R7VA 4TYAA 2PD1A 2VYPA 1N32F 3HT3A 4JRQA 4JI3J 4NLGA 3R5AA 5CD4H 1RDRA 2FTRA 1ITGA 2V5HG 3SLCA 1S9GB 1HFEL 3THYA 2CJAA 3MTJA 4QJVA 4CBXA 4DKWA 2WTUA 2QWPA 4CH0S 2KKHA 1T9UA 4BE0A 5CHIA 3FSYA 3QB0A 2P9LB 4WU2A 1YTYA 2P5VA 4YUDA 3J7AN 2LEPA 4MKBA 4DL4A 5A0YB 4FYXB 4MFBA 4BRCA 2E1PA 4HTLA 2BVZA 4PYDA 5C2DA 4ICLA 3MOZA 2F9TA 4U6PA 3J7YI 2V50A 1KVCA 2CZ4A 4L72B 3FGVA 4NPOA 1HYVA 1HBOB 2ZJPQ 3DLKB 1URRA 2R8KA 3ILJA 4DTMA 2JVOA 5H1SQ 2VFTA 3H2VE 2P9KB 1F2HA 1T03B 2HBRB 5I3PA 1DKGD 3H3NO 2GVDB 3V6KA 4IYQA 1O13A 3UE2A 3DC2A 3GIMA 1XI1A 4ZPTR 4CLWA 1H2TZ 2OAUA 5BYRA 4JI0F 4MO5A 2F7VA 5BXIA 4NYZA 3HKWA 3SCJE 5KT4A 1H1VA 1VQPS 4Z0UA 3AXKA 2J6TA 1K73O 2XULA 1GT8A 3ZZUA 4KI6A 2BE2A 3NL0A 4FYDA 2C22A 3MM5B 3VAGA 1TUUA 3P96A 3LDOA 2IYIA 2H48B 5C15A 3U6FA 4Y2KA 2R2RA 3JSYA 2GHVC 3FMWA 2M52A 4NLUA 2WC9A 4DV4F 5JXSA 4WYWA 2DT9A 2ATQA 4WYBA 4F2SA 1EX4A 1RT4B 3M30A 1SL2A 4IJNA 4H8KA 5K14A 2IS3A 2HAIA 4IDKA 2AYGA 3PIOL 2P9UB 2IDLA 3VVUA 4O0NA 4M3WA 2HVIA 1E6YA 2JJ4D 3QO9B 5FD1A 2N4CA 3KLEA 2I7NA 1UVJA 3IA0A 4NB4A 1O1WA 3QBXA 2HB5A 2CPFA 2J7UA 3V9UA 4GC6A 2JEJA 3K5LA 5KFYA 1OIAA 4H5WA 2MQPA 3VEYA 4YEAA 3GG0A 1CC8A 2EI5A 3CCRN 2I5JA 1BC6A 4LF4F 4DR3K 2PN6A 1LCUA 3Q23A 1U6ZA 3J7AP 3OFGA 2DJWA 5J2NA 5ETSA 4DXLA 3M32A 3PHTA 1TYQB 4L3QA 3B78A 1L3KA 1NBWA 3LALA 5M1KA 1DQ8A 3OS2A 1UTAA 2HWIA 3WQPA 2P6SA 1LWCA 2ZH5A 4OZ1A 3MR2A 4PUOB 4IOAL 1FDNA 3OTCA 5LMNJ 2W6LA 3C14B 4CHYA 4KPYA 4EP5A 1FEEA 4BLGA 1U09A 1ILYA 3IR6B 1I94F 4GRSA 5DG7A 1SBRA 4B1ZA 3R6LB 1CJUB 3QFPA 3KK3A 5HATA 3TTDA 3WXLA 2M2BA 1H6KX 3G4SN 1F2GA 2QYCA 3GJSB 4OPKA 4K2JA 3PLAA 4AHVA 4CLSA 3H4BA 3LP0B 3HHLD 4PQUA 3QT5A 3BSCA 3CCWA 3D7SB 2DNQA 5HP1B 3TOQA 2C2MB 3RSEB 4FK0A 2JH3A 2JLGA 3MDFA 2XHWA 3MD1A 1S59A 3O08A 3BBFA 4XDCA 2N82B 4RWTA 1GMWD 3SAFA 4QZVB 3CCTA 3OHBA 2D9PA 1HD1A 2HNYA 5HJXA 4NO7A 2X6NA 2YNIA 3WXKA 3DRPB 4KV8B 1IBKJ 2ZZMA 3CCMN 1WC4A 3T1YK 2QI2A 5LXYA 8ATCB 4EYIB 1K8KA 1RJJA 3OL6A 4UTGA 1RTHA 1H38A 4NASA 4LVOP 2OCEA 1E4GT 3IKMA 2J9DA 4NI2B 1Q8KA 3GZ7A 1VS3A 2IM0A 2DIUA 2LXFA 4BQZA 1T02A 3DOKA 4CCHA 4F50A 2YKMA 1SKUB 2E2NA 1OJ4A 2DNKA 4CWBA 4Y00A 5M1PA 3V1OA 4BE2A 3EJMA 4GO5X 4DQQA 8RUCA 4Y34A 2FGCA 3D0GE 5KG0A 1NMDA 3BEXA 3D3BJ 4TY8B 5E84A 4F4YA 1RSCA 3OYFA 3U3GA 3LWMA 3E2EA 3N5FA 3NBPA 4JKGB 3Q8RB 3MM7A 3THWA 1XJWB 3RBDA 5M2PA 1O6XA 4ZIWA 3QERA 2E2PA 1KKHA 2CQDA 4ED1A 2X1AA 1Q7YT 1YGYA 3RB4A 1VFJA 4G1IA 3QAEA 4DV6J 3WIUA 3DU6A 1WSFA 2F8EX 2H65B 4USMA 3UD4P 2NRTA 4DHYA 2XS7A 2YKPA 3DRRA 2J8AA 2Q79A 3IFEA 2F8TA 1LAVA 1DARA 2F8MA 4BRFA 1YITN 5KFJA 3A0IX 3G87A 1OVYA 1V3ZA 2LDIA 4L8RB 2EFGA 3IGVA 3IM9A 4DV0J 1VHXA 2VFSA 2CH5A 4B9MA 1C2PA 3HHLC 3ZO7A 3TR8A 4DSIA 3G9CA 4DR3F 1HQUA 1T05B 4H03B 3D2EA 2DPIA 4KAIA 4ZP9A 1S12A 6AT1B 1DZ5A 3THTA 1DLOA 3CO0P 2XS2A 1FFWB 1U8WA 3I8DA 3W60A 4M95A 4DUYK 1CXQA 4NYNA 2XCAA 3SK3A 3KLHA 1HRHA 4C9DA 3K8WA 3VF2A 3WNHA 3T3FA 3L4QA 4IO8A 3OXLA 2NUHA 4B17A 3OL8A 2P9SA 4HWIA 4AT1B 4O44A 3LDSA 3OJSA 3EO3A 5AQFA 4XO0A 4CK2A 5EX3A 3VAIA 2ZGZA 4BC4A 2F8HA 2E5LK 3DRXA 4W92B 2ZDOA 2UXBK 2O8FB 1ACMB 2RDIA 4JV2A 3NNHA 2NRRA 2Q1LA 4H4OB 3DLJA 4LUBA 2PFUA 2IY5B 5IWAK 4U7BA 1L3SA 2P1JA 2IOCA 2DHGA 3EICA 3FEZA 4X4QA 2ZD1A 2MDAA 2K3KA 2OPSB 2V8DA 3BZCA 1NK6A 4WFYA 3OTOF 3D68A 2QA1A 3T1YF 3S8SA 5U47A 3M7VA 2W6KA 3SFGA 3D2FA 3CPEA 1NSAA 3GYNA 3SPYA 3SMSA 4H5VA 4ZPAA 4CTAA 4ZVTB 2I9SA 1VQ9N 5C24B 2HHTA 3PFEA 3LANA 4NA2A 4DTRA 4KIAA 3OSNA 2NUUG 1KP6A 3HPOA 4AHRA 4F9OA 3CFPA 3W66A 1QVGM 2W9AA 2J5AA 3HTVA 1VQMS 1RT7B 4CZMA 1UWBB 3MR7A 3WC2A 4FCYA 2AWZA 4AUKA 4LFBK 4K4UA 4O3PA 2W2QP 3U1LA 1VQ5S 2G1DA 3NMUA 4DR7K 1ZBSA 3FBEA 4PKIA 1YRUA 1C1BA 3M8ZA 1IKVB 3BO4A 3CCJN 2AKWB 5JLFA 4QYZJ 4PWUA 2AEFA 2VJVA 3AA3A