1LWEA

Crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
554
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKSTKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 134
structure length 542
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lweA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lweA05
2D7SA 4FJGA 1S6QA 5CZ2A 1K1SA 3B6OA 4X2BA 3PJWA 4NCGA 4J2DA 4Q0BA 4YR2A 3PX6A 1RT3B 1JLCA 3ZCMA 3TAPA 4KFBA 3WNHA 2AJQA 5I3UB 4IFVA 4N41A 4YR0A 4AHTA 5J1EA 2RDJA 1TVRB 4Z4FA 5HROB 3RMBA 1IKVA 3F9KA 4CJ5A 4CHQA 4R5PB 4B9NA 2ASLA 1WSHA 4F3OA 4K4WA 4NLSA 4CGDA 3V1RA 4E7LA 3SFUA 1SL2A 3ZSRA 4W5RA 3HVTB 1KFSA 3AA5X 5KRSA 3MEDA 3ULDA 3SV3A 1FKPA 3TAMB 4AHSA 1SKSA 4J9LA 5KFGA 2E9TA 1QSSA 2KFZA 4CF9A 5KFNA 2ETJA 3DMJB 5T14A 3AVBA 3K58A 4FXDA 2Z1HA 3OLBA 3NKYA 5DGBA 3GILA 4FLUA 4CHPA 1CLQA 1RAJA 2R2SA 3ZSZA 5I3UA 3FQLA 3TANA 2QV6A 2C2EA 4DFKA 4K8XA 3VQ7A 1TVRA 1L5UA 2ZD1B 4NLQA 3PVXA 1WSJA 4ZVHA 3AVAA 1S1XB 4DSJA 3NH2A 1KLNA 2GC8A 1VSIA 4BACA 3B6PA 4AHCA 4FK0A 1NOZA 3AA3A 1FKOB 3PR5B 2Q3SA 1TK8A 3NBPA 4DL2A 4CCHA 1T03B 4NRTA 4WYWA 3NMAA 2E6MA 3UDLA 3OL6A 1RCHA 3KK3B 3AVKA 4FJ9A 4FS2A 1HJRA 3SFGA 4K4XA 2FVPA 1WSFA 5DMRA 4TQSA 3MTKA 3HT3A 4LH5A 3LP0B 4I2QA 4NLDA 3QO9A 1X1PA 3AO1A 5KFZA 1T05B 4KHRA 3SPYA 4R8UB 4EP4A 2G8IA 3HO1A 1BQMA 1HPZB 1N48A 4IDKB 2QKBA 3AVHA 4FJ8A 1RBSA 4RNMA 4CJFA 4O4GA 4B9TA 3KK2B 2ZD1A 4ZP9A 1R0AB 1S1XA 3PW5A 3KIOA 2Z1GA 4M95A 3T5HA 1NK0A 5KTQA 3I0SB 4EZ6A 3RWUA 4CHNA 3LPUA 2RF2B 4FW2A 4QW8A 1SKRA 2V4QA 2ASDA 2IS3A 4PUOB 4H8KA 3DRSB 1RA7A 4CEEA 3SNNA 1SUQB 1RT6A 2OPSA 4M3YA 3KD5E 2WRMA 1L3TA 2EHGA 2G8VA 1VSHA 3OYLA 4KSEB 5J2PB 1VRTB 1C6VA 4W5NA 2HHVA 2OZSA 5DG7A 4OJRA 5EWEA 3CDWA 3LP0A 1C0MA 1RT1B 3EZUA 4JS5A 1S6PA 1EP4B 4RG8A 3KLGB 3GIJA 4R8UA 3IGVA 1HNIB 3E01B 4DF8A 4ZTFA 4ECXA 1JLGB 4CHOA 1N6QB 3KK2A 4DTUA 4DS5A 4MK8A 3G0ZA 3CJ5A 3G6VA 2QK9A 1RDRA 2YKNB 1CSJA 4MFBA 2D41A 3DOKB 3FRZA 2O4GA 3L3VA 4NLVA 1VSMA 5FRMA 4WXOA 3I0SA 3EPGA 2IDOA 3HJFA 5L1IA 3DRRA 4DL3A 4CJSA 4PUOA 2B43A 3DRSA 4DF4A 3H2LA 4TY9A 3M8QB 5CZ1A 1S4FA 4CF8A 3E51A 5EDWA 1S9GB 2BRKA 3CQ8A 3AO3A 5J2PA 2HAIA 5KFXA 2VA2A 5D3GA 3PX4A 1TKDA 2YNFB 1D9DA 4I2PB 4F8RA 5KG4A 3KHGA 1BIUA 1Q9XA 4FYDA 1RT1A 3ZT1A 3V1QA 3A2FA 2R8GA 4KHQA 1K1QA 3DLEA 2VG5A 4KAZA 3E01A 4LSNB 5CY4A 1JLGA 3CO9A 4O3NA 4DQRA 1N6QA 1RTJB 2JLEA 3KMQA 3CYMA 3K5LA 1XHXA 3MXIA 3AV9A 3CDUA 4O3OA 2OPRA 3ZT4A 4URGA 5KG1A 3MECB 1O1WA 1EX4A 3MEEB 4CEBA 4FM2A 2ATQA 3TWHA 3MF5A 4IKAA 3LPTA 3D0PA 1HRHA 2O5DA 5KT5A 1BGXT 3KJVA 4KHUA 3CM5A 4M42A 2P51A 3VQQA 3TAEA 5KGWA 3M8QA 5KG7A 3T5JA 1S9GA 1RYRA 1HQEA 4EP5A 2ILZA 1WSEA 5DQHA 4URQU 3U3GA 3CWJA 2YNFA 4B08A 3AVGA 3PO4A 4FCYA 1ZTTA 4WZQA 1QSYA 2J6TA 2R7YA 1RT2B 4F4WA 3RRHA 1S97A 1TL1A 4CJEA 1LWCA 2YNGA 3UR0A 3PW2A 1RYSA 1I6JA 3KOAA 4CJWA 4B8AB 4LSNA 4K4TA 3S9HA 3M9MB 3OYJA 4LD0A 1XR5A 5KFVA 2UVVA 1RTJA 4M3WA 4O3RA 5HRNA 5KGXA 3ZSVA 3OYAA 3HVRA 4F4KA 3CJ4A 4FJHA 2IM3A 4RW4A 1GOAA 3U6FA 3QYYA 1VSKA 5HBMB 1BQNA 4QWBA 3P1GA 1HQUA 2PYJA 3GIKA 3OVNA 5DG8A 2RDIA 1W0HA 3QEPA 5KFKA 2JGUA 3O3FA 4OL8A 2FBXA 5KT4A 4CERA 3VQ4A 3I8DA 4DS4A 3NF6A 3WNEA 2UVUA 1JKHB 3D5MA 2XY8A 4U6PA 3LP3A 4TXSA 3K5NA 4TY8B 5L1KA 3QLHB 4ZPAA 2OPPB 1RT2A 4FJXA 1DTTB 4GVMA 4Z4HA 2C22A 1ZBLA 4IFYB 2IJFA 2JEFA 2W9CB 3SQ4A 4CEOA 2WB4A 4ID1A 3HPGA 1L3VA 3OYCA 3T1AA 1VSJA 1C0UA 1S10A 1WN7A 4NYZA 3RMAA 1Z26A 5C25A 1XHZA 4KTQA 2IM1A 1MU2A 1WAFA 4ICLB 3VQ5A 1Y97A 1NHVA 4NLYA 1OS5A 3PY8A 3HYFA 1IG9A 4CIGA 3V6DB 4RW9A 3DRPB 1S1TB 4O3SA 4E7JA 4NLGA 3NCIA 3SJJA 5J2QA 3QERA 4N76A 3HP9A 2KQ2A 4Y3CA 1VSLA 4IH5A 4TY8A 4CGGA 4KKOA 2OPPA 3L3UA 4DSLA 2X78A 4W5QA 1TGOA 3KMSA 3SQ0A 4DTRA 2IM2A 1RDAA 2XY5A 2HHSA 3LZIA 1L3UA 1HMVB 2W9CA 1RNHA 4FS1A 4CJRA 4CFCA 4RZRA 4J2BA 1S9EB 4JV0A 1S6QB 1NK7A 3RMDA 1NK9A 2D0BA 4NCGB 3QNNA 4WFYA 3NDKA 1DLOA 3TVKA 2GBZA 4KFBB 5KG3A 4DFJA 2VG6A 4URSA 3RTVA 1VK0A 3PX0A 4CFAA 3DI6A 5K14A 3DM2A 3ZSQA 3N6MA 3DRPA 3NGDA 5J1EB 3RAQA 3RB3A 4AHRA 1IKVB 2JC1A 1S9FA 4FLYA 2KTQA 3KLIA 5KFDA 3PR4A 3SZ2A 1ZBHA 3QGIA 4QW9A 3IAYA 1YTAA 2B6AA 3KTQA 4CJ4A 4CK1A 3HM9A 1BISA 2XI2A 2F96A 4BE0A 4IR9A 3RMCA 2FBVA 3MR5A 3MEDB 1HMVA 1Z25A 1FKPB 3V81A 2OZMA 3WNGA 2G8HA 1ZBUA 4CEAA 1S9EA 3L2QA 1QS4A 4WE1B 5KG5A 1Q8IA 1SV5A 2QKKA 1S1WB 3M8PA 4M41A 1I39A 3JSMB 3NF9A 5EU7A 3BR9A 3P83D 4GC6A 4H4MB 3OL7A 1TKZB 2I1RA 2ZKUA 3EZ5A 1JLQA 2DPJA 3VQ6A 2HWHA 4HKQA 3SUQA 3VQDA 4CJ3A 3IGNA 5KFTA 5CYMA 1TAQA 3I5AA 4K4VA 2X6NA 3SUPA 2XI3A 3V4IA 4XIUA 2UUTA 3HXMA 4Z0UA 2QE5A 5F8IA 4JRQA 3LALA 1N56A 2GUIA 1YT3A 3FQKA 1WSIA 3NBPB 2IMWP 3MR2A 4CJKA 4G1QA 2HHTA 4DTSA 1UAXA 4TYAA 2D5RA 4WE1A 2IA6A 4PQUB 3EY1A 1S1WA 1TQLA 3V6KA 3DOLB 4Q45A 1ZBFA 1NKCA 4I2QB 1TV6A 3JSMA 2HMIB 3QO9B 4H4MA 3I5BA 1JL1A 5DK5A 1TKZA 1T94A 3NAEA 4IRKA 4CECA 1BQMB 3I5CA 2UVRA 4C8OA 3DLGA 1TKXA 2BQ3A 1N5YA 5DQGA 4O3PA 4DTNA 1KFDA 4FJIA 3K57A 3V6HA 2XGQA 4O4GB 3CFRA 2V0NA 3NFAA 4BE1A 2AU0A 4BE2A 4CIFA 4KB7A 3BSCA 4L8RB 2CJQA 1C1AA 2Y1JA 2G8UA 4FK2A 4J9MA 3C6TB 4J9PA 4DU4A 4IH6A 1SH0A 4BDPA 3NE6A 4RNOA 4OLAA 1GOCA 4FK4A 4NLPA 4C8MA 3VQSA 4ECRA 4FVMA 3SQ2A 2FBYA 3GQCA 1RT6B 4NLOA 2OPSB 1TK0A 2D0CA 4FLXA 4TLRA 3KKSA 2BR0A 4ECWA 2YKMA 4PQUA 4ZHRA 4QOZB 3DOLA 3MEGB 1J5OA 3H5UA 3G86A 2HMIA 4FBUA 4ECQA 1RT4A 1CXUA 1S6PB 3AVFA 2HVHA 3OYGA 5FDLB 3TQ1A 3OSNA 4CJQA 5KFAA 4PA1A 1S0OA 3OYNA 4HTUA 4QWAA 2WTFA 3P5JA 4FLVA 5C42A 4MH8A 3DLRA 4QWEA 1LAWA 4MFBB 3OJSA 2DFFA 1U48A 2HWIA 3C6TA 3GV7B 4ED1A 3NGIA 3ZSWA 1C1CA 4Q5VA 1HYZA 1IKXB 2NUBA 3DRRB 2JEIA 3SI8A 2RN2A 3Q8QB 2W7PA 2E9RX 3NL0A 4O3QA 3HVWA 3V6JA 3GIMA 3OS2A 3IS9B 4CGFA 5D3GB 3LZJA 2E4LA 3CVKA 3Q8PB 3MEGA 1RTDB 1JLBB 4TSXA 3SPZA 1ASWA 1TL3A 3DLEB 2VG5B 5FDLA 4KV8A 1IM4A 3M9NB 3OLAA 1KHWA 4ZP6A 4ZPBA 3QZ8A 1C1BA 2JC0A 3ZSOA 4CHYA 3WNFA 4RW7A 5EWFA 3VA3A 3VQ8A 1ASUA 3BSOA 2OPRB 4ZP7A 4Z4GA 1IO2A 1C2PA 3ZT0A 5KFRA 4ECTA 3SCXA 3BSAA 4NCAA 1QE1A 1IKXA 5KG6A 4LH4A 4OGCA 4QAGA 3KJVB 4K4SA 3IRXB 4FBTA 4BDYA 5I42B 4NRUA 5HLFB 2FVSA 4DU1A 3O3HA 4CEZA 3AO5A 3TABA 1TAUA 1HQEB 2RKIA 2XCPA 3IS9A 2HHWA 4HYKA 1JXBA 1D5AA 4KBIA 5KFJA 4KAIA 1RTDA 4ED6A 3ZT3A 4F4ZA 4RNHA 1JLBA 4N5SA 2D0AA 2YHAA 4Z4IA 4ED7A 4OKJA 4CGIA 3NAHA 1TL1B 1LWCB 2YNGB 3QNOA 1KLMB 1QTMA 4DL7A 4ED3A 1F21A 4KI4A 2DFHA 3MFHA 4LSLA 4MKAA 3CJ3A 4KHMA 2HB5A 4DMNA 4U7CA 1LW0A 3SUNA 4RW4B 5KT3A 4RNNA 1RTHA 3EYZA 1BQNB 3F73A 3HPHA 1HQUB 2HW3A 4OKEA 1HNVA 4Q8FA 3C95A 1NNDA 3IRXA 5I42A 5HLFA 4ELTA 4ID5B 2ATLA 3NGZA 3V9SA 2R2TA 4IH7A 2HHQA 1JXLA 3T5KA 4RNFA 3MR3A 1RBVA 3QINA 4FZZA 4FLWA 5CYQA 4Y1DA 4FW1A 5FROA 3OJUA 1IH7A 4DL6A 1Q9YA 5SWMA 4RW8A 4DSEA 1S1VB 2WONA 1KVBA 4IG0B 5KG0A 4DU3A 3ISNC 4AHUA 2BGGA 4WYLA 1KLMA 3DYAB 2X6SA 1U09A 5KFLA 1KCFA 2AGPA 4ECYA 2E9ZA 1RT7A 4XPEA 3LP1A 3L2RA 1CZ9A 2WOMA 3KNAA 5KT6A 2ALZA 3QGGA 5HRRA 3NGYA 1QAIA 1WSGA 2ASJA 5C24B 1C0UB 3TAQA 2OA8A 4FJNA 3PO5A 3HKWA 4HCBA 2OPQA 2IBKA 4IRCA 4CHZA 5C25B 3OL9A 3PW0A 4JV1A 4ED0A 1XI1A 1X9WA 1MU2B 2XHBA 3GV5B 2WCXA 2X74A 4TN2A 4DFMA 2F8TA 2HHUA 3PW7A 4ID5A 4RW9B 2FJWA 3AVJA 3BGRA 4PWDA 2OH2A 5J2NB 3TAFA 1YVFA 3QEWA 2IM0A 4Q8EA 5J2QB 3AVLA 4I9QA 2WK4A 1XWLA 4KKOB 3LAKA 4KHYA 3G6YA 4O44B 4C8LA 1S1VA 4YR3A 4OVLA 4NYFA 4IG0A 3C94A 4KTWA 1NK5A 3HK2A 4QWCA 4KHWA 4ZVFA 4CGHA 4J9SA 5HP1A 3DYAA 2HHXA 1RILA 4J9KA 1ZYQA 4FZXC 4GC7A 2FVCA 3UPFA 1T3NA 1VSDA 3PV8A 4I9LA 1CXQA 4H4OA 3H5YA 3QETA 1BCOA 5C24A 4E3SA 4XO0A 1KVAA 1JLAB 5E41A 3FDSA 4M94A 1A5XA 5F8NA 1ASVA 4O55A 2ZQBA 4HCCA 3CIZA 3QEVA 2I5JB 2D3UA 2YNHA 1DLOB 1S5JA 4J9OA 2VG6B 4E89A 3DI6B 4W5TA 2R8IA 5K14B 4ECSA 3DM2B 4YMEA 1KHVA 2FVQA 4HVJA 5J2NA 4LQ9A 3IN5A 2XO7A 1QAJA 4KPYA 2FLLA 5EUHA 1IKWA 3C6UA 1FK9B 4F4XA 3KLIB 1Z4UA 4NYNA 2IOCA 4MKBA 5KT2A 4O44A 2C2RA 2KFNA 4KO0A 2B6AB 1NK6A 4B3OA 4NLWA 2V9WA 1U04A 3O4NA 5DG9A 3VQ9A 3VQPA 3OYFA 1RBRA 4ED2A 2HNYA 1ZETA 1TP7A 2HNZA 2VG7A 3K5MA 1S1UA 2W42A 4H54A 2F8EX 4E1MA 3V81B 3SI6A 3AVMA 4ECZA 2A1SA 4EYHB 3CFPA 4JS4A 2XGPA 3CJ2A 4WFXA 3DLBA 3FFIB 3LAMA 3RBEA 1SV5B 4KI6A 2R2RA 2F8SA 1WAJA 1BCMA 1JLAA 3M8PB 1ITGA 1IKYA 3QIDA 4I7FB 3QIPB 1QUVA 2BANB 2I5JA 1D9FA 3CJ0A 2YV0X 2G8WA 1JLQB 1NJZA 4ZVGA 3V1OA 3TARA 4F2SA 1BI4B 2QXFA 3PZPA 1EKEA 4QWDA 3SQ1A 3T5LA 3G6XA 1BHLA 1LWFB 5CYMB 3K5OA 2KZMA 1FK9A 4W5OA 4EZ9A 3L2UA 2DY4A 4CEQA 3KK1A 5FRNA 1G15A 1KTQA 3V4IB 1LW2A 3OS1A 2HNDB 1JLFB 2B5JA 3JYTA 1ZTWA 2DFEA 4DG1A 1TKTA 3ZSYA 1S0MA 2YNIA 4M3XA 1J9AA 4GMJB 2W9BB 2Z1IA 1RTIA 4WXWA 4EBCA 4KTZA 4Z4EA 2ITGA 4G1QB 4ZP8A 4J9QA 4MK9A 2EC0A 5J2MB 3FFIA 1FXXA 3QEIA 4MIAA 4M3TA 4TYBA 1TV6B 4I7FA 3QIPA 1T8EA 4EEYA 2BANA 3RRGA 3MAQA 3T19A 2FC0A 3DLGB 1TKXB 1HYVA 1N5YB 1BI4A 1S49A 1SL1A 4DL5A 4OKKA 3KLHA 4E7KA 4FJMA 2G8KA 3DLKA 4N56A 1CZBA 1LWFA 3V9XA 4DTPA 1VRUB 1I3AA 1J53A 4HUGA 4DTXA 2PYLA 4DWIA 3I0RA 2BE2A 4Y1CA 2HNDA 4ED8A 1JLFA 5SZTA 4CE9A 4ZMMA 4ZPCA 4CEFA 4EBEA 4DTOA 3ITHA 5KFHA 3LWLA 3TAGA 1RT5A 5KT7A 2W9BA 5F8MA 1D8YA 4DQPA 2W9AA 4B8CA 4FLTA 3K59A 1W25A 3Q8SB 5J2MA 4K50A 2YHBA 2Y1IA 2YKMB 4ZHRB 1JIHA 4J9NA 1ZBIA 1J5OB 3LP2A 3KLEB 5KRTA 1C0TA 1RT4B 5DLFA 1UOCA 4MQ3A 4ZPDA 3OHBA 3L2WA 5L1LA 1NJWA 2Z1JA 1S0NA 3KLFA 3HP6A 3S3OA 1T7PA 2JEGA 4JLHA 4F4YA 1YTUA 4DLGA 1SL0A 4QCLA 4DEZA 2XY6A 3HHKA 4KHSA 3BQ2A 5L9XA 3BSNA 2FBTA 5C42B 2FJVA 3LANA 1RT3A 1VRUA 4N47A 3AVIA 5F9LA 4E7IA 4B9VA 4FLZA 2BDPA 3AO2A 3PJXA 1C1CB 4UQGA 5KFOA 5KG2A 4DSIA 4BWMA 5HROA 4R5PA 3TR8A 4Y2CA 4ZTJA 2KZZA 3O3GA 2PZSA 5KFUA 4B9SA 2FLPA 1B9FA 3VQEA 1WLJA 1REVB 3OSPA 3OYIA 1J54A 4GW6A 1BL3A 3HVTA 2C28A 1K6YA 4CJUA 4JV2A 4WFZA 2E6LA 4CF0A 2P5GA 4YNQA 3KLEA 5KFYA 1LV5A 4QPXA 1RBUA 4YQWA 3TAMA 1TL3B 1LAVA 3H98A 4ELVA 2UVWA 4KV8B 2GV9A 4IR1A 1L3SA 3AVCA 1NK4A 3DMJA 4E7HA 1MMLA 1C1BB 1KSPA 3D28A 5KI6A 3ISND 4RW7B 3KLVA 2AQ4A 1KVCA 3MXJA 3TI0A 3EPIA 5DLGA 4B9LA 4FJ5A 3VA0A 3OY9A 4RUAA 2J6UA 3H5XA 2KW4A 2VA3A 1JX4A 1QE1B 2XRIA 4CJTA 2AGQA 2C2DA 4RU9A 1EXQA 1WNEA 5DGAA 3ZT2A 3MXMA 1LWEB 4OGEA 2RKIB 1REVA 3H59A 2XCAA 1RDBA 3UIQA 4DQQA 1FKOA 4Q43A 3V9WA 4O4RA 1NKBA 4YP3A 4CEDA 4CF1A 3DLHA 3H4DA 2AWZA 1SKWA 1SH3A 2W8LA 4AILC 1T03A 3KK3A 4IKFA 1RA6A 2O4IA 4LSLB 4LY7A 4DSFA 1QHTA 1XC9A 2AX1A 1NHUA 3PHEA 3RBDA 3VQBA 2UUWA 4FM0A 1T05A 3V9ZA 2XC9A 1LW0B 4O0IA 4CESA 4FM1A 4CK2A 1HPZA 4IDKA 1RTHB 3NH1A 3HSTB 1NJYA 3PW4A 4IOBA 4AH9A 1HNVB 5KFMA 2W7OA 4EBDA 5F8HA 3NH0A 5C5JA 4KHNA 4EO6A 4HUFA 3NAIA 3ICLA 4FJKA 2ILYA 1R0AA 3KD1E 1LWEA 4Q44A 3OYBA 4M3UA 5KFQA 4IBNA 5KFSA 3N6LA 1HYSB 5HRSA 2RF2A 2FJXA 5CYQB 4DQSA 1JL2A 3RB0A 3QIOA 1N4LA 4LQ3A 2IGIA 4RW8B 4J9RA 2WONB 1SUQA 2FVRA 4ZVEA 4C8NA 3H08A 3M8RA 3QGHA 2VWJA 3KHHA 4F2RA 3VN5A 1VRTA 4K8ZA 1XR6A 4IQXA 3L8BA 1RT7B 1GOBA 1HARA 1B92A 3LP1B 1YVUA 4DFPA 1KRPA 4IG3B 2LSNA 2WOMB 3BQ0A 1VSFA 1EETB 5KFFA 1EP4A 3Q8RB 3KLGA 4AHVA 4CF2A 3FSIA 4NLTA 2OPQB 4NLUA 3SUOA 1HNIA 3OYEA 3BDPA 3ALYA 3M8SA 3IG1B 5KFCA 4NLRA 2IC3B 2ZE2B 4E1NA 5JXSA 2YKNA 3CFOA 2R8JA 1RDCA 3DOKA 3RR8A 3BREA 3BGRB 4DSKA 2VWKA 4PWDB 3VQAA 3V9UA 3BQ1A 1HYSA 3VQCA 4KB1A 2R2UA 2IAJB 4F50A 5KFIA 4BWJA 3S3MA 3MFIA 4HHTA 5HP1B 3KHRA 4O5BA 4FZYA 4M45A 5HRPA 4DL4A 3OS0A 1QQCA 5F8LA 4RUCA 4I2PA 4DLEA 4FJLA 4KREA 1VSEA 3RB4A 4M3RA 4IG3A 1QSLA 1NJXA 4H4OB 4KRFA 3GYNA 4ECVA 2DPIA 4PY5A 1EETA 3DDKA 1A5VA 4OPJA 3OYHA 3OYMA 5F8GA 4K4ZA 4OPKA 4G3IA 5EWGA 1U47A 3IG1A 3H5SA 2GIQA 2BQUA 4CFBA 2YNHB 1DTQB 2RPIA 2IC3A 2ZE2A 1X9SA 1RBTA 4ELUA 4FJJA 3RB6A 2R8HA 4KB0A 3AVNA 2D3ZA 5KFBA 3T3FA 2IJNA 3THVA 3MECA 3KHLA 3MEEA 2OYQA 1IKWB 3C6UB 5L1JA 3ASMA 4CK3A 1UWBB 3O4QA 3QZ7A 1U49A 2IAJA 2GIRA 1S48A 4KO0B 1XR7A 3HVAA 1RDDA 4B3OB 4WZMA 1GX6A 3RR7A 2HNYB 2HNZB 1NKEA 3OHAA 2VG7B 4FJ7A 3HL8A 1S1UB 4NZ0A 1W9HA 4J2AA 4Z4CA 3N6NA 4YFUA 4Y2AA 5F9NA 5KFEA 3SYZA 3NF7A 3RAXA 2XWYA 2V4RA 3QESA 2JEJA 2P1JA 3K2PA 1IKYB 4B9UA 3U3YA 4RW6B 2W8KA 1JLEB 2BQRA 1D0EA 1TK5A 4C8KA 2EX3A 5T7BA 2R8KA 1DTQA 3H40A 4JRPA 4J2EA 3M9OB 4OLBA 1SH2A 5KFPA 4MK7A 5DQIA 4HUEA 5JS1A 2FLNA 3GV8B 5HBMA 4Y34A 5F8JA 2WHOA 2AX0A 1UWBA 3KK1B 1LW2B 5JS2A 3CG7A 4DTMA 2B5JB 3JYTB 4IRDA 4DG1B 2A1RA 1TKTB 2YNIB 4CJPA 2P5OA 3OYKA 4BDZA 1JKHA 4F3TA 1RTIB 3KKRA 1WNSA 3ZSXA 4E19A 2HVIA 1B9DA 4DTJA 3OYDA 3LDSA 1JXEA 1NOYA 3QLHA 4CGJA 1BIZA 3QEXA 1DTTA 4R0EA 3OL8A 3S3NA 1UA0A 3L2VA 5JUMA 3H4BA 4IFYA 2G8FA 4RW6A 4MIBA 1JLEA 1D1UA 4B9MA 3G10A 4CJVA 4NLXA 1UA1A 4CJLA 4TQRA 1X9MA 3KLHB 4XPCA 4K4YA 3MR6A 3DLKB 4Q0BB 3LWMA 4JUZA 1JLCB 1GX5A 2B4JA 3UQSA 1U4BA 1A5WA 4ICLA 3I0RB 2BE2B 4IFVB 2PY5A 4EYIB 3V6DA 2AGOA 2J6SA 3ITHB 1S1TA 3HPOA 3AO4A 3CDEA 1RT5B 4E0DA 2DTUA 2CKWA 3GIIA 4K4UA 4DQIA 4O0JA 2BRLA 4CIEA 4EO8A 4M3ZA 3PUFA 4ECUA 3NF8A 2XY7A 3LP2B 5KFWA 3CM6A 3D45A 1C0TB 3NHGA 4KE5A 3AA2A 3AA4A 3SV4A 3BJYA 1U45A 4NCBA 3KLFB 4CFDA 1NK8A
chains in the Genus database with same CATH superfamily
3H2VE 2D7SA 2CPHA 1RFQA 4J2DA 1KBRA 3FMWA 1JCEA 3TTFA 2COLA 1R6YA 2ASMA 4BC5A 4ZIVA 2HRTA 2CAJA 4YOTA 4Q7AA 3FGUA 2XB2D 4JI0F 3LW5C 1RAIB 1U6FA 5H9FJ 2RDJA 5HROB 4CJ5A 3OVBA 4B9NA 3AODA 4YN3B 4F3OA 3R2CJ 1OY6A 4CGDA 4E7LA 2WUSA 2Q66A 4AF1A 3ET6A 3AOAA 8ATCB 2M7SA 4GRSA 2P8IA 4AHSA 1N36K 5KFGA 3VGUA 1A9NB 2NRVA 4LFCF 1JJHA 3AAQA 3DMJB 2B7BB 2CA9A 2W41A 3K58A 3AVBA 2Z1HA 2V94A 2PO4A 5M1PA 2EFQA 4FLUA 1H6KX 1HUXA 3O1LA 2NREA 2R2SA 1U02A 2QV6A 1FT8A 4PAAA 3AB2B 1HKGA 3CCUN 4ETZA 2XMVA 4K8XA 3CF5Q 1GXLA 1L5UA 3VV2B 2OMLA 1UPMB 3KWIA 3WQTA 1YHQS 4NLBA 2GWKA 5DETA 2KYXA 5AJ3K 2ZDPA 5GAGU 2C2MB 3HD1A 3THWB 4WBFA 3T1YJ 3AA3A 3PR5B 4LSZB 3MMJA 1TK8A 2E7VA 3NBPA 4DL2A 1T9TA 2P9PA 4CCHA 3HOTA 4WYWA 4UOGA 3NS5A 3UDLA 2O8FA 5M1NA 2ZZNA 2D74B 2PD1A 1TELA 3UD4P 1WSFA 1M5KC 4OYWA 4TQSA 3QFHA 1N34K 3LP0B 4B3RK 1X1PA 3J7Z5 2W40A 5KFZA 1G1XA 4KBOA 2W2PP 2G8IA 4IDKB 2QKBA 1WOQA 4KGVB 4H5RA 3OW2R 2E5IA 4L76A 3GONA 2UYTA 3QBCA 5IOLA 4FOIA 3WHIA 3PW5A 2GW8A 4X4UA 1NGGA 4USIA 4F02A 1G7CB 1JJ2M 2OEJA 4CHNA 3D9BA 2I2YA 4KH5A 3M6XA 3BPDA 1Q5YA 4R25A 4PUOB 4H8KA 3DRSB 3SNNA 1Q82T 3TTCA 4FF1A 1VYAA 4NLCA 3QJPA 3VAGA 2IVOA 2WRMA 1L3TA 2G8VA 4KSEB 1SKUB 3O9QA 1VK8A 1Z2LA 3HZGA 2HHVA 1SJ4P 3A8YA 2MPUA 3MMAA 5EWEA 1RHMB 3PG9A 1NZAA 1C0MA 3CJCA 4YDXA 2ZHBA 4JKHA 1S6PA 1EP4B 3GIJA 4MO4A 3IGVA 4LF6K 2Q1LA 4ZVQB 3W8GA 1JLGB 2CQ2A 2RH3A 4X84A 2G0JA 4Q2MA 3KK2A 1Y0HA 3CJ5A 3G6VA 2QK9A 3KYLA 2YKNB 3WXLA 4FYWB 1Q1KA 4CLKA 3DOKB 4N8NA 3P39A 3S01A 1HNZK 3L3VA 1N5QA 4QYZK 1F9EB 4AUKA 4TU9A 1E6YA 1OIAA 2GX8A 3OVAA 1NAQA 4TY9A 3M8QB 2Q31A 5EDWA 1HHQA 3CQ8A 3AO3A 3EEQA 3CETA 4DV1F 5D3GA 1TKDA 2YNFB 1J27A 4F8RA 2X51A 1PG5B 1S79A 2RS8A 4KHQA 4LFBF 1RAEB 4KAZA 4MLHA 4OYIA 5C2DA 2KDOA 2H5IB 3UN5A 1X31C 4NO7A 2JLEA 3T1HF 4M7XA 3KMQA 4Y0FA 4Z7CA 3CDUA 3AV9A 2OPRA 3FEZA 1O1WA 3TWHA 3D0PA 1HRHA 2O5DA 1BGXT 3A12A 4F36A 5A8RA 4M42A 3H1QA 2MSSA 2EG1A 2BZ2A 3VQQA 1N33F 1ZAWA 4OHYA 4NI2B 1WSEA 4A5BA 4URQU 2C3MA 3O1BA 3PO4A 3N01A 2DGTA 2J6TA 1B3TA 2IVFB 5TKYA 4CLZA 4DV7F 4K42A 2MQ8A 1LWCA 4CJEA 1I6JA 3KUHA 2XZWA 4K4TA 2V9KA 1T9YA 3M9MB 4LD0A 5CCLA 2C42A 4CNZA 3RW7A 5D15A 4M3WA 4JI4J 3CJBA 3ZSVA 4DL0C 3HVRA 2GMLA 1X4EA 1R8PA 2P9CA 4KHPK 1FJCA 3GBTA 2IM3A 4JI5K 1T3VA 2FHJA 3HSCA 1VSKA 3LUYA 3NWGA 4GKJJ 1XTZA 3GIKA 5RUBA 1P27B 5K8OA 2JWLA 1QDUB 2ZOGA 4KT0C 2BJEA 2P9EA 3I56S 2FBXA 3X3UA 3VQ4A 1JKHB 4OZ0A 2RE2A 3CJ7A 4U6PA 3B82A 4H0OA 2KRBA 5L1KA 3VAKA 4FJXA 2C22A 2WTUA 2AIRB 1W7WA 3Q86A 1VQ7S 3JSRA 1QY7A 1P8GA 4LT6A 5MLCV 1WC5A 2VCPA 4ID1A 3WIVA 3OYCA 1F2GA 2KM8B 4PZVA 1U24A 3GZ7A 4DCPB 1CJUA 1VBXA 4X62F 1XHZA 4RO0A 2E1PA 1MU2A 3AAWB 1Y5NB 4CO1A 3VQ5A 4NLYA 4NPOA 1VQKS 1DARA 4NZ6A 3W2WA 3V6DB 4V1Ak 1E4FT 3DRPB 2JVOA 1PBAA 4X4VA 4NLGA 3SJJA 4A8SA 3CERA 3L0QA 4ATNA 2KB2A 4IH5A 5HVGA 4CGGA 4J91A 5GIPA 5D4NA 2OPPA 2CG8A 5DDRC 2X78A 3THPA 2F9JA 3KMSA 3SQ0A 4DTRA 2CADA 3SCJE 3RSEA 4UUWA 3LZIA 1L3UA 4PKDB 1VQMN 1WTFA 2OAUA 1CJVB 1RNHA 1Y5LB 2EC2A 2F4VJ 4LIRA 3SSRA 1NK9A 2AJ2A 1AROP 2DNRA 4WWSA 1OWXA 2OSQA 2VFTA 3HJVA 3MOJB 3CD6N 3NDKA 2JHEA 1VK3A 3TVKA 5KG3A 4N7TA 3RTVA 3B78A 1VK0A 3PX0A 3CQXA 3DI6A 4CFAA 2HBYB 1IBKF 2MZ1A 4DR3F 1FRMA 1XMQF 2PIIA 3E2EA 4HDHA 4FLYA 2W4CA 5KFDA 3PR4A 4KY3A 3Q0AA 1Y11A 4BR9A 2O67A 1YTAA 2YTCA 2P9LA 4CK1A 3ET6B 3ZZRA 3RMCA 3MCMA 3CCQS 1HMVA 3U9ZA 3V81A 1DQAA 3WNGA 3B8HA 4CO0A 3MMBA 2EVZA 3CCEN 1QS4A 4WE1B 1TL7B 4CYUB 2NLWA 3PCOB 4DV2F 4JP8A 3CUNA 1UP1A 2GQCA 3A0IX 1I39A 3NF9A 4OMFG 3P83D 2HPUA 1TKZB 3QICA 2I1RA 3AARA 1JLQA 2DPJA 4FF4A 1TL4A 1Q7YO 4RUHA 2C2KB 4P2FA 4K2XA 3ILOA 3IGNA 1KXPA 4DQ8A 2O8EA 1Q4RA 3SUPA 4IO9L 4XIUA 1KNZA 4Z0UA 4JRQA 3MWBA 2VDHA 3FQKA 4EU0A 4NMLA 1NGFA 2DRAA 3NBPB 4UOHA 2P9UB 2HHTA 4DTSA 2B8PA 4DMZA 2HSEB 4JI0K 1HLUA 2LQ9A 2A6AA 1IJFB 2Q6BA 5DDPC 2E2NA 4PQUB 3EY1A 3AD9C 3RJMB 3JSMA 2KKZA 1FEHA 5BPLA 4H4MA 5DK5A 1JWWA 3VTIA 4DUYJ 4X4PA 1HPMA 4IRKA 4CECA 2UVRA 4H5NA 3DLGA 2A3JA 5E84A 4O3PA 4DTNA 4HEA9 4FJIA 3V6HA 3AGRA 2XGQA 3CFRA 4BR4A 5AQPA 1A7GE 2I38A 2Y1JA 4L3QA 1YTYA 4DU4A 4EAHD 2XMKA 2VL1A 1BA1A 1YSJA 4B1XB 2FZCB 1HWUA 1KQKA 5LMUJ 4A8XA 4KGKA 2P9KB 5D0EA 4TLRA 2CPYA 1DRZA 2UXBK 1I94J 3O9TA 3W60A 1IJEB 4ZHRA 1O13A 1V4TA 5BPNA 5AXNA 2V69A 5AQMA 3G6EN 1J5OA 3MMAB 3G86A 3D1QA 2NPIA 5EX5A 1S6PB 1QLNA 2HVHA 3OYGA 1RHUB 3TQ1A 3VPZA 1CJKB 4CJQA 3EVMA 1SI9A 1WF1A 3GMGA 2DO4A 5BR8J 3POTA 1S0OA 1IBMJ 1F3VA 4JI6F 2ROEA 4QWAA 5GMDA 2YQ3A 3DLRA 4QWEA 1LAWA 4V19X 3O1WA 2VBXA 1RADB 1OYEA 3CJ9A 3IBCB 1BG3A 2QWQA 2UXCK 2FSNA 3SI8A 2VHGA 2W7PA 4NA2A 3NL0A 4O3QA 4CO5A 5L9NA 3GIMA 3SDEA 4L3NA 5D3GB 1JCFA 3LZJA 5CYJA 4ILMA 2YH1A 4CBUA 3CVKA 4FF3A 3SPZA 1RDUA 2OFHX 1G4CA 3P96A 3M9NB 3OLAA 3FZHA 2CQ1A 2JC0A 1H74A 2RQKA 2HG4A 3WNFA 4RW7A 4DN0A 5EWFA 3CCMS 2YX4A 1S4EA 4P2SA 2OPRB 4LFAF 2VU5A 4Z4GA 2CJAA 3G8SA 5KFRA 4ECTA 1X4GA 3FKBA 2J7WA 1H1VA 1IKXA 5DDOC 2NRTA 4BRAA 3N5FA 3NVMA 3NS7B 3MM9A 4QAGA 2ZWOA 1M5PC 5A8RB 3MD3A 3C7NB 3D4JA 4LR7A 3O3HA 3AO5A 1MN9A 3C46A 3PIOQ 5B0AA 1FJ7A 1ACMB 1JXBA 1D5AA 4KBIA 2XHWA 2P9GA 3ZT3A 4F4ZA 1S7HA 2YHAA 4CGIA 4DR1F 3NCQA 2NQPA 4QR1A 1LWCB 3QNOA 1RWPB 4A57A 1SPBP 1QTMA 1K8KA 4DL7A 4P7VA 2CUYA 3FCVA 1XJWB 3W65A 3MFHA 4LSLA 4MKAA 3R5AA 3OTDA 4FZVA 1MA9B 2YKQA 1QQMA 1N52B 1I51B 2VQFJ 1KVIA 2BUPA 1HLWA 4DV1K 3NGKA 3SUNA 2M9KA 5KT3A 2J9CA 4M5LA 3DFEA 1XIQA 4OKEA 2PDAA 2IPOB 1HBNA 2R7OA 2HVEA 3IRXA 2MEWA 4CH7A 1Q18A 3IXQA 1YI2N 2F63A 4IXCA 2ATLA 3MUMP 3V9SA 4LF5F 1VQ9N 3T1HK 2AMCB 1RBVA 2ZWPA 4Y1DA 1N32K 5FROA 3OJUA 4DL6A 3SLCA 1MWYA 4DSEA 2F7TA 2GHPA 2WONA 4WQ5C 2NLXA 5KG0A 1GXUA 3ISNC 3ULEB 1KLMA 2X6SA 3K89A 1YLXA 5KFLA 1J5EF 2OTJS 5CA5A 3E9LA 1K47A 1FXLA 2XWXA 1IUJA 1N33K 1AA1B 2Z56B 3NGYA 1WSGA 1UVKA 2ASJA 5C24B 3TAQA 4HCBA 2OPQA 4F9OA 4GV6A 5ADXA 1RHJB 4IRCA 4LBIA 1CJUB 2LQ5A 4ED0A 4DV7K 2R7SA 5AZIA 1MU2B 2CXEA 3SCIE 2XHBA 3ISZA 2VGNA 2WCXA 2FHKA 4DFMA 2PBDA 4GO7X 3W2WB 3FBFA 1U1PA 2E2PA 2CRLA 3TAFA 1YVFA 1NGHA 2IM0A 4R79A 4BC2A 4ZDNA 4X4SA 1XWLA 4KHYA 3G6YA 1YJTA 1S1VA 3MCNA 4ZLPA 4YR3A 4OVLA 3VGLA 3C94A 4JYAK 4QS7A 2MZRA 2VBYA 1W7AA 1NWKA 4KHWA 4ZVFA 3RSEB 2OD4A 4J9SA 2QFIA 3DYAA 2N3LA 2HHXA 2B4UA 2FVCA 2V5HG 4CLSA 2J0XA 3CE8A 4I9LA 4LF7F 4H4OA 2MHNA 2QLFB 4IUFA 2YVSA 1RWXB 5E41A 1CULB 1A5XA 5F8NA 5GAHP 2ZQBA 1F1BB 3CIZA 3QEVA 5B0EA 1OH7A 1S5JA 2BW7A 1FRIA 2HGNA 4E89A 1H98A 3DI6B 4W5TA 1QUPA 5AT1B 1KHVA 3G2XA 2RU9A 4HVJA 2UUCK 5J2NA 2XO7A 5K5MA 1EQ0A 3JQMA 2F40A 5GADP 3CTRA 2HFVA 2KM8C 4KO0A 1DQ9A 4JI3J 2EFOA 4A8MP 1NK6A 4NLWA 1U04A 4X62K 2C3UA 3OYFA 4I64A 3R6GB 1ZETA 1SBRA 2VG7A 3K5MA 5AQYA 2ROPA 4E1MA 3V81B 3SI6A 3MMBB 2B7CB 5IZHA 2KH9A 4WFXA 4CLWA 3FFIB 2J0QD 2F8SA 1ELOA 3DHXA 4I7FB 2VPYB 1SXLA 1X5TA 1LQ9A 3CJ0A 1FTCA 2BH1A 1JLQB 3PLAA 4F2SA 2QXFA 3PZPA 1T6DA 2PE8A 1WC0A 1T95A 3EGVA 4K7QA 3L2UA 2O8EB 3NOGA 4AL5A 3BV8A 3D6MB 2HIQA 1JLFB 2LVWA 2DFEA 1NMDA 3MOZA 4CBXA 5BRHA 1CC7A 2PFFB 1HNXK 1YJUA 1KKHA 5J2MB 1XMQK 3L3CA 2HHHK 1NH7A 3OTEA 3AFGA 2FGOA 4B9QA 3FVYA 3QEIA 4NZ7A 4QR2A 3N5BA 2GFFA 4C6AA 2E5GA 2C2NA 2FC0A 3FBEA 3DLGB 1OY8A 4H5WA 2V8GA 4ZN3A 1HYVA 4JAXA 3CPEA 2VPXB 3C3LA 4DL5A 2MY8A 3KLHA 4KIAA 1T9VA 4FJMA 2G8KA 3DNCA 4USKA 3V9XA 1FNOA 5ETPA 5I4MA 2EFNA 2PYLA 1VQ5N 4Y1CA 4ED8A 4JK8A 5SZTA 3P49B 3MAHA 1OH8A 2JWKA 4EBEA 1X4CA 1EO1A 4GO5X 5JVGQ 3UFCX 4WFAQ 1ZM9A 4X4OA 2W9BA 5KT7A 2UU9K 4DQPA 3VF0B 4FOEA 4FLTA 2A18A 5A2QY 4NL5A 2ZOFA 4ZHRB 3CIMA 4J9NA 3SXLA 1RXOB 1SS6A 1J5OB 1XQIA 5ETMA 3LP2A 3T1YF 1YJVA 1R3NA 3KLEB 5KRTA 1C0TA 4RWTA 5DLFA 4IO9Q 3PJ9A 4FXVA 4ZPDA 3H3OB 3HP6A 3OUYA 1T7PA 3EE9A 4JV5J 4L6V3 5IWAJ 2Z30B 1YTUA 9ATCB 1GLLO 3POTB 2MDAA 3BQ2A 1K44A 3BSNA 1ESVA 2IVPA 2QEXS 3UKRA 4B9VA 4ZVOB 1FX4A 4B3SF 2BDPA 2D1KA 1F9HA 4DSIA 4BWMA 4IOCQ 5AQHA 3PEHA 2XTJP 5AQKA 4DR5K 2KZZA 3O3GA 2FLPA 1B9FA 2RUSA 3OYIA 4GW6A 3SDEB 1BL3A 3HVTA 2XEXA 2C28A 2CGLA 4ANEA 5A8WA 2FJAB 5L39A 1NSKL 3OXGA 4U7UK 2EXUA 5BYRA 5KFYA 1RBUA 4YQWA 3TAMA 4Y6IA 3HMJG 2NRZA 4U9RA 1VQ8S 3HOSA 4B1UB 3MUTP 3MPYA 1W97L 4E7HA 2DHXA 1KSPA 1O0PA 3S8SA 1VHIA 4RW7B 2DGUA 1HWLA 3KLVA 2AQ4A 3OPKA 1FE0A 3BEXA 3IP0A 3LM2A 4HHUA 2LKZA 1ZM4A 3CSKA 1FERA 3H5XA 2KW4A 3AXKA 3DGPA 5FLXO 5F0WA 3CD0A 3MM9B 4ZIWA 3H0PA 3E1YA 3ZT2A 2JZ5A 1TTHB 4HH0A 3BF3A 2XCAA 3U9DA 5AZJA 1WBDA 3E9OA 3AJ1A 1FKOA 1RSCA 4CEDA 4PXBA 1FXRA 5ETKA 2U2FA 3WIUA 1YK9A 4ZCMA 1Q7YT 4C97A 1WHYA 2C2ZB 2KG0A 4LSLB 2AX1A 4OJ3A 3TUIC 2XS5A 3CDAA 2D4WA 2Q6CA 4DV0J 3VQBA 3VWSA 4AQYF 3ELHA 1T05A 2QLJB 2XC9A 3KK7A 1WG4A 4CT9A 2H54B 2WBNA 2DRDA 3NH1A 3Q2TC 4FPIA 2RT3A 5AFUH 5KFMA 1MDUB 2RJZA 5IQ6A 2M70A 3NH0A 4FJKA 1AB8A 4AT1B 1LWEA 3RUBL 4Q44A 2HFSA 2FSJA 5THWA 3EKSA 3QSYB 5HRSA 1JL2A 3QRRA 5HSPA 5IXUA 3ATVA 3W3SA 2WONB 4KH4A 1C0GA 5ETQA 2QLXA 1Q8LA 2J76E 5IS2A 3NNAA 4CLLA 1ZC6A 1W2IA 5DM7L 4K8ZA 1XR6A 3TNVA 2GCFA 3EKUA 1K73O 4DFPA 1KRPA 1SAZA 3RZAA 1X8DA 4BRMA 4GVBA 4DV3K 4I6AA 2XLKA 3KLGA 5AQSA 2OPQB 1U1RA 1NSAA 3BDPA 4LIWA 4YEAA 2J7UA 2VOPA 3MDFA 1KAYA 3IG1B 2CDRB 5AZIB 4H5VA 3C16A 2Z2YB 4OZNA 2A1BA 4W4MA 5JXSA 2BA9A 4CO4A 3NMRA 1KN6A 3VQAA 5B08A 3BQ1A 3VQCA 4UY85 3I31A 4GKJF 4WCEL 4F50A 5KFIA 4BWJA 4WKYA 2CQBA 4LR9A 3MFIA 1PCAA 1Q0NA 2BBEA 5HRPA 2KT5A 4DL4A 5B7WA 4DR2J 3OT9A 1X4DA 4I2PA 3TTDA 4DLEA 5BN9A 3C15A 3ZFVA 4IG3A 1QSLA 3N79A 4H4OB 4KRFA 3TA1A 4LF5K 2VKRA 2NXCA 1EETA 2MKJA 1H2UX 5KPRA 4USMA 5F8GA 2XG8A 2B3TB 2XBPA 4CH0S 5L8RC 5EWGA 3IC1A 1KQSM 1FA0A 2BTFA 2BQUA 2R7RA 3G87A 1K0VA 1DTQB 3TA2A 4USWA 3RB6A 1RWUA 1FJGF 3OA9A 3BH7B 3KHLA 3ASMA 3QZ7A 1V3SA 2IAJA 1S0VA 4DR7K 4OJHA 1FVSA 2CQPA 1X3MA 2QYGA 5I3QA 4KO0B 4LJMA 1RDDA 4K8RA 1J6ZA 4CI0B 1H3DA 2BJ9A 5ETTA 1VQON 3F56A 1NKEA 3OHAA 2VG7B 1SQGA 4FO0A 2E1RA 1H2TZ 5F9NA 2QW9A 4WP8A 1Q7LB 3VR1A 3SYZA 5FD1A 4DDFA 2EPIA 2AYGA 3K2PA 4DUZF 1Y10A 4RW6B 3MTJA 1Q79A 1D0EA 3DOMA 4C8KA 5GAEI 4JI1K 3QMQA 1YIJS 1NUEA 3A13A 4B17A 1SH2A 4LRAA 3D6TB 5JS1A 2DD8S 1HHTP 2ZH2A 2V8VA 4LF7K 4K0KF 1BMQB 2DVIA 2AX0A 2N4CA 3ZX0A 2HIYA 1FTRA 4IRDA 4TNOA 3SSSA 2H5JB 2P5OA 1AZSB 5DS7A 4FYXB 4IO8A 4YHHF 4A8KA 2HVIA 1B9DA 4KGMA 2FZGB 1U2FA 4NA1A 5AQXA 2AP1A 3DXMA 3BKUA 1AW0A 1UA0A 1N0VC 5JUMA 4UW2A 2G8FA 4JKCA 4I4BA 4MIBA 1F5AA 5CE3A 4CJVA 3CCLN 1GLEG 3T9NA 4FP9A 1JQGA 2QL7B 5JVHL 2IVYA 1UFKA 3W2VA 2J9EA 3THYA 2N82B 1FDAA 3M6WA 4FWKA 4ZS6A 3KLHB 2RE1A 3G8TA 2MY7A 3NY0A 2HOEA 4JUZA 1BC6A 2RNEA 3THXA 3UQSA 1OY9A 4K5SA 4X66J 3KZBA 4LF2A 5D0GA 1KOOA 1S1TA 1N5SA 2V63A 3HPOA 4DV5F 3CDEA 2DTUA 3CCUS 5HOOA 1H0HB 1HR0J 4ISGA 3CC2N 4M3ZA 3UDCA 2E1ZA 4A47A 2P6TA 3LQVA 4XH1A 4FYVB 3LP2B 1CEZA 3VVTA 4G1PA 2DR8A 3V2UC 5DM6Q 1X5PA 3D45A 3CPWM 1C0TB 3S1TA 3FCWA 4NXNJ 3SV4A 3AA2A 3J80Y 4NCBA 2GGPA 3T41A 2B56A 3NGSA 1S6QA 1A6LA 2DK2A 1K1SA 5H9FK 1HI8A 4BRDA 2BJDA 4B3TJ 1KP6A 3PX6A 4EMDA 1HNWJ 2DNZA 3QSIA 5AXLA 2HF4A 4LC9B 5I3UB 1T44A 2VGMA 2DHSA 4C3KA 4YR0A 3K8VA 5J1EA 3VGSA 5LMNJ 1IKVA 2ASLA 1WSHA 2JFDA 4K4WA 3V1RA 2RB7A 1FWLA 3ZSRA 1RWKB 1S59A 3HVTB 4JI2J 3O8WA 3MURP 1NPRA 4PPDA 2CJYB 5A8WB 3QWUA 1KFSA 3MM7B 5KRSA 4IDHA 3ULDA 1FKPA 3TAMB 2ZZMA 4J9LA 2EKNA 4JKFA 2QWLA 5CD4H 4CF9A 2RUGA 4Y2MA 5D4PA 4LREA 4E2FB 5DGBA 2JWNA 3GILA 2HRYA 4JI8F 1MMDA 3DKDA 4WP3A 4CIOA 3GOIA 1RQ0A 2VPZB 3ZSZA 3FQLA 2OD6A 2UZAA 5HJYA 3TANA 3T1YK 3DGPB 2FXUA 4DFKA 5DJBA 3VQ7A 4BCAA 1RISA 1TVRA 2HQDA 2ZD1B 5BR8F 1IBMF 3PVXA 2CIMA 1WSJA 1QM9A 2QL5B 2QWRA 3MEKA 3NH2A 2YKAA 3H1VX 2LFVA 1KLNA 5CH7B 1J2VA 2GC8A 1MNEA 4M5GA 4BACA 3B6PA 4AHCA 3AT1B 4KH0B 3MCOA 1FKOB 2NRXA 4DR4K 1PYOB 1EIYB 2PC6A 4PCQA 3NMAA 1NDCA 1UTAA 1OSCA 2GHWA 1F6TA 1DKGD 5M2UA 3AHPA 4FS2A 3SFGA 3EJMA 3QFWA 3CIPA 1UVLA 2FVPA 2FPHX 3O8MA 2ZJRL 3HT3A 4LH5A 4I2QA 3QO9A 1T05B 3M8YA 4ZVSB 2ZH8A 4DU8A 1N48A 2RHKA 3HULA 4FJ8A 2KI2A 3PTWA 4B9TA 1XMOF 4ZP9A 4K43A 1S1XA 2Y1RI 2R7XA 3Q8UA 3MI7X 3H46O 3L7PA 2BM1A 3C14A 2WW4A 3KIOA 2NR0A 2Z1GA 3FMBA 4GNIA 3T5HA 2CVIA 1NB7A 3LPUA 2NRRA 2KYZA 3L09A 4NE9C 1QQOA 2ASDA 1RA7A 4AXJA 1VJQA 1RT6A 4M3YA 1XC3A 2ALYB 5B0CA 3O5TB 1UPPA 1C6VA 1NGCA 2NUUG 4I6MA 3WDOA 3W9JA 2Z2ZA 3CDWA 2YWHA 4GVBB 3J8AA 4RG8A 3KLGB 4R8UA 1S22A 2E7XA 3MCPA 1RU1A 4ECXA 2E88A 3IMQJ 2VQEF 4LRFA 1N6QB 3ADAC 3C16B 4DTUA 4DS5A 4DKWA 2BE7D 2D41A 2ZC4A 2WVDA 2VQFF 3FRZA 5HO4A 2O4GA 2UUAJ 2E5LJ 1VSMA 1B70B 3I0SA 1PSDA 3EE8A 3BUZB 2B43A 2VD3A 1T0TV 3M1VA 1I5OB 3E51A 1S9GB 2JDJA 3NMUA 4RPFA 5J2PA 2VA2A 3PX4A 4XH4A 5HK4A 3PYDA 4I2PB 3KHGA 1BD6A 2ZFHA 1RT1A 1VBYA 3V1QA 2R8GA 5T7LB 3Q24A 3DLEA 3E01A 3GWCA 4LSNB 2LQJA 3FCHA 4B3MK 4P71A 1RTJB 5CXTA 5HJXA 4U67L 3NLCA 4X64F 3K5LA 2DEJA 3PHTA 3KUGA 5KG1A 1HWIA 1AFIA 1EX4A 4CEBA 4FM2A 4IKAA 4OX9K 5KT5A 3DLLL 1VC5A 3AH6A 3KJVA 4KHUA 3TW0A 4GKKF 2GJ2A 3D7SB 5KG7A 4J8FA 1RYRA 1HQEA 1NPKA 1XK8A 4JBCA 5DQHA 4JI4K 3CWJA 2CQCA 4B08A 3VAMA 2ACMA 2R7YA 3I32A 5ETOA 5L38A 1D4XA 3D2EA 4ANCA 1TUGB 3FLCO 3UR0A 2KKHA 3C6AA 4B8AB 1TYQA 4GKJK 3OYJA 2Q2RA 2UVVA 1GMUA 1GLFO 2LCWA 1VQMS 4ALZA 1VQNN 3CJ4A 2DH7A 2IIHA 3U6FA 3QYYA 2ZM6J 3ZZOA 2IY5B 1BQNA 4QWBA 1RP5A 5EVZA 2PYJA 3R7NB 2A40A 3OVNA 4ISFA 5DG8A 2RDIA 5FPEA 1W0HA 1TFWA 5E5NA 2V34A 3W63A 3VEVA 4ER8A 1M0SA 4DZ6A 4M5KA 1TU0B 4OL8A 3NVKA 5KT4A 4ZLLA 3SAGA 3NF6A 2XY8A 3HCXA 2GTDA 3QJLA 3HSDA 4KH1B 3D1OA 4TY8B 1RT2A 2AHOB 3DXMB 3GPAA 4Z4HA 2E5HA 3EWGA 3O3LA 3FZBA 4EIAA 3V5RA 4LF4J 2EFPA 1EKRA 4EUVA 2IJFA 2JEFA 2W9CB 4ZJQA 2Z58B 2NXEA 3J81U 4P2XA 2MKCA 1L3VA 3HPGA 1YRUA 3W2VB 3THYB 2EW9A 3T1AA 3GFXA 1C0UA 2FZKB 1WN7A 3RMAA 3CCES 4JKEA 1Z26A 3G8QA 5C25A 1HBMA 4CLPA 2ZJPL 3THXB 1WAFA 1OS5A 1WKLA 2BMBA 2DYAA 4A2BA 3HYFA 1JK9B 4RW9A 4NA3A 1S1TB 1S72N 3ZO7A 3NCRA 2F4VK 5K8NA 3HP9A 2KQ2A 2EK1A 4KKOA 1VLOA 2IM2A 1RDAA 4LF9J 1MWMA 2HQFA 4WIIA 4OYXA 2DHAA 2IRXA 3CCVN 4FS1A 2V50A 3AA8A 2M2BA 3R5DA 4FWOA 2GGPB 1S9EB 5HN0A 3SK3A 1S6QB 4WFNL 3RMDA 3RG6A 3OTBA 4TLQA 2DR9A 1BY9A 2VBZA 2EFVA 3QNNA 5LSOA 3VMFB 3U8XA 4I1TA 1R8AA 5K14A 2MTLA 4NX9A 3ILIA 4M8LA 5J1EB 3RAQA 4AHRA 4AD6A 1M1HA 1NEEA 1IKVB 3OR2A 2JC1A 1S9FA 3CJ1A 3HFZB 4QIFA 1BWEA 2N7YA 2QA4N 5DDQC 5D4OA 3IAYA 4CJ4A 4Y65A 4DV6K 1BISA 3QATA 2ADCA 5LY3A 5KOXA 1BXNA 1U0SA 2ZJQQ 1FKPB 3W3DA 2OZMA 1ZBUA 4CEAA 1WKJA 3L2QA 1XNQJ 1Q8IA 5KG5A 3BP8A 1Q53A 3IFEA 2AEJA 3VESA 1M5OC 1BU6O 5EU7A 2LU1A 3JSYA 2KT2A 3QAUA 2ZKUA 3EZ5A 4RU2A 1IBKJ 4ZKAA 4DR3J 1IM6A 1RK8A 3M2VB 1YRTA 2DH9A 2V2KA 4O0NA 3P5BP 3VQDA 3Q83A 3P31A 3WX4A 3BZKA 1ZS6A 5KFTA 4ZPVR 3OTOJ 4K4VA 1BOTO 2CQGA 2X6NA 2XI3A 5CAAA 1YZ6A 1UEUA 2QE5A 3FC9A 2FYXA 4M5NA 4BY9C 1WSIA 3TVZA 2G0CA 4DUYK 4OI6A 1FCAA 3ZEUA 3E8OA 4CJKA 1PYSB 5AQRA 1UAXA 3KJFB 3ATUA 2VJUA 2HBJA 4KJIA 2IA6A 4DV2J 3A3OB 5KOWA 4BR0A 1S1WA 4L75A 3V6KA 3DOLB 4MJKA 4Q45A 4I2QB 2HMIB 3QO9B 5IT4A 2EWHA 1UVIA 2AZ3A 5ITHA 1T94A 1FDBA 4F7VA 3I5CA 4K2JA 5K20B 3K57A 5F3TA 1LFWA 2XS7A 5LMUK 1N0UA 1I94K 2CJQA 1C1AA 3C14B 4J9MA 3SEOA 4IH6A 1SH0A 4ZVPB 2O8BB 1KD1O 4RNOA 4LR8A 4NLPA 4C8MA 2MMYA 2XLIA 4FVMA 2DNKA 2ZHAA 1DGKN 1RT6B 5JLHA 3NNCA 1TK0A 2QIFA 2XHCA 2FY1A 2LA4A 4NOHA 3KKSA 3CCWA 2GVDA 3WXMB 2QTWA 1CZAN 2YKMA 4IFEA 5BR8K 1U1OA 4QOZB 2FHJD 4GMKA 3MK6A 3MEGB 2KJVA 1NMNA 4KPCA 3D3CJ 1HA1A 3ZZZA 4ECQA 1CXUA 2QMUB 2CH5A 5FDLB 4DB3A 1HI0P 5HMWA 2O66A 4OI4A 3JB9k 1EX8A 4MLEA 4HTUA 2WTFA 3QNWB 4MH8A 4DV0F 3OJSA 2ZITA 4PWWA 1U48A 3C6TA 4YOYA 1CQNA 2OGUA 4RL1A 4Q5VA 1HYZA 2VH7A 4JHDA 2JEIA 2HEKA 3IM8A 1XNRF 3IR6B 1UAWA 2E9RX 3MPWA 2X1BA 3M1VB 2O8DA 4QZVB 2XM3A 3HVWA 5AXMA 2AKWB 4KH6A 1YI2S 2ZH4A 1NGDA 1DFDA 3VGMA 2HWTA 1EQYA 3P5TL 2UV8G 1AFJA 3ZTQA 3DLEB 2GVZA 2BKNA 1TUUA 5AQFA 4F67A 4ZP6A 3QZ8A 4JI6J 1YHQN 3H90A 3IWNC 1FX2A 3CC4N 4M5HA 2G4BA 1ASUA 4F0MA 3ZT0A 3BSAA 3UDVA 4LF6J 2ZNZA 4LH4A 4OGCA 4IZ9A 3VF4A 4A8OA 2MQNA 3KJVB 4K4SA 4CLUA 4OYMA 5I42B 4IYQA 2KHDA 1TMMA 3HLUA 5FLXY 4DR6K 3TABA 1HQEB 2XCPA 4EHUA 3IS9A 4WF9Q 4CNYA 2HHWA 5KFJA 1WOSA 2M5YA 2VQFK 4USUA 1RTDA 4ED6A 2XMUA 4RNHA 1JLBA 1HHSA 2AJ4A 3D2EB 3SCLE 4AXIA 4FDFA 1U1MA 5KPTA 1FFSB 3KUEA 2V8DA 3MM8B 4JK9A 1NDLA 1F21A 3CI5A 3IDHA 5LL6d 4KI4A 2KXHA 2K8GA 4DMNA 4KHMA 3VZHA 1DEJA 3HZEA 4CZGA 5MLCQ 4GY2B 4KGXB 4P72A 4OHVA 5AE3A 1EKSA 4LFAJ 3GFZA 1LW0A 2JH3A 2A41A 4BVOA 3UWTA 4RNNA 1RTHA 1OVYA 4LRCA 1BQNB 3M7VA 2G2ZA 4JD2A 2OEKA 1NNDA 1R43A 4FN5A 1VDHA 3VEWA 5HLFA 4TVAB 3TSUA 4ELTA 4ID5B 3NGZA 4O8KA 2R2TA 4IH7A 5F0UA 1RGVA 3CJQA 3T5KA 3MR3A 3QINA 4FZZA 5CYQA 3BYPA 1V3RA 5AQVA 3M2UA 1ATNA 1VLYA 4DR1J 4PL7A 2BJ8A 2G2OA 3B4DA 3BZCA 3T69A 1NMEB 4DU3A 2BGGA 4WYBA 1JMTA 3MWPA 1KCFA 3HRGA 2JJ4D 2E9ZA 1RT7A 4I56A 4B1YB 2CQDA 1CZ9A 2WOMA 3CHWA 5KT6A 3QGGA 2DHGA 5HRRA 4LVOP 1B7YB 1C0UB 3PO5A 5I3PA 3NCPA 4CHZA 1YXQA 1B99A 1KC8O 5C25B 1HBMB 2HZVA 4ZK7M 1UKUA 2HHUA 2XMAA 2Z0GA 3RW6A 4RW9B 4CT8A 3BGRA 1WWHA 2OH2A 4JI5J 3QEWA 3WEEA 3A5NC 5AE2A 3ONQA 3MWTA 4YB1P 2VBWA 3FZLA 4I9QA 4CM0A 2YKOA 3LH2S 4KKOB 3LAKA 3A8JA 4O44B 2YWWA 4C23A 4W98A 4IG0A 3OQ2A 5B0FA 4KTWA 2RIJA 3DC2A 1J5EJ 2ROGA 1B0PA 4J9KA 1ZYQA 2QZ8A 2I7NA 3DHWC 4GC7A 3UPFA 4NMXA 3PV8A 4D3GA 4H0YB 3QETA 1BCOA 2UXDJ 2QSFA 4NXMF 4LF8J 4HACA 4M94A 1ASVA 5FPDA 1YWXA 2V4JA 5IV3A 4C1NI 2I5JB 1DBDA 4OI2A 3UN2A 4JI3K 4J9OA 2OCEA 1VGYA 5K14B 4YMEA 3A5MC 1EZZB 1F9FA 3WXIA 3OR2B 2FLLA 4KPYA 5EUHA 1IKWA 3BGOP 1FK9B 1G2EA 2IOCA 5EHHA 1TUWA 4CO3A 4QBUA 5JMVA 1U7LA 2KFNA 2E20A 4FWNA 5BREA 2DGWA 2LEBA 5DG9A 3VQPA 2H3GX 1M5VC 1TP7A 2HNZA 2ZJPQ 4H54A 4FWLA 1N54B 2F8EX 5CZVA 3AVMA 4BQZA 2A1SA 5B8HA 3CFPA 1HR0F 1G99A 2W6KA 3LAMA 4WQ4A 1WI8A 2R2RA 3V4MA 1JLAA 2E8AA 3LPYA 3KKFA 4CBWA 4WK3A 3QIDA 4RX6A 2RQ4A 3QIPB 2WSCC 3GJRB 2E1YA 3FFKB 2BANB 3ZZPA 3I56N 2M4MA 4M63A 4B1WB 1MWQA 2A42A 3PIPL 2B0GA 2BYCA 3U7JA 3W5YA 5HQMA 2V8PA 2W4DA 1DURA 3THTA 4EZ9A 3SBMA 4B3TF 3NEKA 4CEQA 1S76D 4QS8A 4PHTX 4CTAA 3BZQA 5FRNA 5CCMA 1HNWF 4WFNQ 3BF1A 5BRFA 3J81j 2HNDB 4IEIA 2B5JA 4XTTA 4DG1A 3ETOA 2YNIA 1ZM2A 2QWOA 2Z1IA 1LK7A 4WXWA 2ITGA 4ZP8A 4J9QA 4CZIA 2EC0A 1S57A 2H1YA 4PKGA 3VAIA 4UT4A 4BC7A 2HQIA 2YXLA 1U0HA 4RR5A 2K2PA 3QT6A 1VQKN 1T8EA 4DPXA 1FE4A 3RRGA 3VALA 3CCJN 2A6MA 1N5TA 5M2PA 1SL1A 1BI4A 1U2VB 4OKKA 4PYAA 4CJ7A 2R7WA 3DLKA 2FHOB 4P74A 1CZBA 1LWFA 4DTPA 2D9PA 4C11B 1YUWA 2O01C 4HUGA 4DTXA 1VBKA 3I0RA 2BE2A 1APSA 4FXWA 3W1YC 3EXYA 4ZMMA 4IJNA 4ZPCA 2HVZA 4DTOA 2IYIA 3ITHA 3CD5A 2K06A 2Z2MA 1RT5A 2BE9B 1HBOA 4X65F 4JV5K 2PAVA 5IWAK 3BPSP 1K9MO 2ZH3A 2GVDB 2YKMB 3AGKA 5T41A 3W7BA 2XNQA 1ZBIA 2DCUB 2HBQB 4HR2A 2ZBQA 1UOCA 2L9WA 4QPTA 3R3TA 5L1LA 1NJWA 2Z1JA 5BN8A 1NB2A 1HKBA 4X4RA 3S3OA 4DX7A 1RWVB 4F4YA 4DEZA 3HHKA 1OKJA 5ELZA 1TL5A 4O23A 1VRUA 3SJHA 5GMKa 4E7IA 4OYPA 2RU3A 1C4CA 3AO2A 1KS2A 5KFOA 2K3KA 5AQQA 3K2YA 1M1GA 4BRQA 2BW2A 2O8DB 4ZTJA 2PZSA 5KFUA 3VQEA 6FDRA 3A8IA 1J54A 1DY3A 1RHRB 1NDPA 3P3DA 3VEZA 4JV2A 3CMAN 3RVCA 1HD0A 2VKZG 5A0YA 4QPXA 1LAVA 3H98A 4ELVA 1PJ6A 3VAHA 2VASA 2GVZB 2UVWA 2GV9A 1L3SA 1VQYA 3UDEA 1NK4A 4DX6A 2UXBJ 3QT8A 3TP2A 3TZXA 2QI2A 4EFHA 3NGUA 5KI6A 4GV3A 1KVCA 3MXJA 3TI0A 1YJ7A 4Z37A 3EPIA 4FF2A 4Z7YA 2B9YA 4B3SJ 3VEXA 1P9YA 2J6UA 5C2FA 2XRIA 2E1AA 4CJTA 2W2QP 2C2DA 4RU9A 2ABYA 1EXQA 3DGVA 1UEVA 4QIGA 4CWBA 4BRIA 1OO0B 5D77A 3QDKA 1SQEA 1REVA 2WVCA 4BGBA 2UUAF 2E5LF 1V9OA 2MSTA 1OH6A 1NKBA 3ULHA 4Q43A 1H73A 4O4RA 2YPZA 1SKWA 2M88A 2UXCJ 4BRLA 1H7WA 5GAEU 1FDNA 4AILC 1WJ9A 4LRDA 3KK3A 3PDNA 2W2MP 2PA8D 2W2OP 3W9IA 2A2DA 4LY7A 4DSFA 3VHQA 4PXCA 3PHEA 3RBDA 3MD1A 4FM0A 1LW0B 1UWAA 2OJ3A 2OLWA 3O5BA 4CESA 3WT0A 3FNNA 1HPZA 1RTHB 1NJYA 1XERA 4JD2B 4P9SA 2W7OA 3AY9A 5F8HA 4EK2A 1TR0A 1NGAA 3NAIA 3GSIA 2C3YA 4P75A 4ZVRB 1LNQA 1UJ5A 2RF2A 3T7ZA 1YJWN 5CYQB 2QG9B 1PAUB 7FDRA 2E2QA 1N4LA 2ZEJA 4LQ3A 3JS9A 3M2UB 2IGIA 4OZ2A 2B9WA 4WP9A 2DGXA 2D0OA 1SUQA 2HK3A 2FVRA 4ZVEA 3H08A 9RUBA 3AOBA 3VN5A 1VRTA 1FJEB 3KNGA 3L8BA 1RT7B 1WD6A 1B92A 4AQYJ 2WOMB 2B4OA 3BQ0A 1VSFA 5HMYA 2OKQA 5KFFA 3TZZA 4CM2A 4AHVA 3SUOA 1HNIA 1Q8KA 1R31A 3ALYA 1EQMA 3M1FA 1KD1T 4BREA 3R8EA 4WTYA 2AT1B 3UVJB 2IC3B 1D8ZA 3W9HA 3D0HE 3EDQB 3G4SN 3BREA 3BGRB 2VWKA 1FNXH 4DR2K 2DY9A 2F5GA 4NYPA 3VF2A 3WEEB 3V9UA 5DRKA 1HYSA 2BUNA 3J7YI 2ZM6F 3I6PA 1LKZA 3CNQP 3MN7A 1YKWA 2QJ3A 4FPBA 2YQ1A 1WSVA 4FZYA 2YWKA 3Q7BA 1QQCA 5F8LA 1ULRA 2XZDB 2HZAA 3GE1A 4RUCA 1RKJA 2D69A 3TYTA 2KJWA 1VSEA 4M3RA 3NXZA 2LEPA 1N32J 1GFWB 4ECVA 3DDKA 4E8UA 3OYHA 3OYMA 4K4ZA 4OPKA 5ETVA 3EGZA 3MM6A 1BQXA 3LGHA 4LRBA 1UJ4A 4CVNE 4LF4F 3H5SA 4YB5A 4PG7A 4J37A 2ZKTA 4CD1A 3LGMA 2ZE2A 2H65B 3CCLS 2ZGYA 2UUBJ 4FJJA 4KB0A 3AVNA 2GJFA 3T3FA 2CQ3A 1FRXA 3THVA 3R3LA 1LFPA 4H0PA 1VIXA 1IKWB 2XYHB 3LA0A 1E4GT 1UWBB 1VQSA 5AQJA 1U49A 4QR0A 1Q8BA 2GIRA 1S48A 3R1HA 4Y2IA 2HNZB 1FFGB 4FJ7A 1Z6RA 2QSWA 1W9HA 4C48A 4Z4CA 2QRRA 4Y2AA 1QVGM 5KFEA 1CS4A 3GG1A 5E7OB 3NF7A 1JJCB 2R4FA 2V4RA 2JEJA 3PSFA 4LF9F 1JLEB 1TK5A 2CFXA 4ZCLA 1IR2A 1OYDA 5T7BA 2XSJB 3E66A 4JRPA 3H40A 4J2EA 1WELA 3GE9A 3IBWA 3BGFA 1FJGJ 4USTA 1MSWD 3K7RA 2RSQA 2PA3A 3FGVA 2FLNA 3CCRS 5F8JA 2WHOA 3TUPA 2CVEA 4CTAB 2VWBA 3C65A 4YB7A 4DTMA 2B5JB 2OTJN 3EL2A 4DG1B 3X1LB 4UF4A 1D9AA 2YNIB 1S6OA 3K9KA 3NGRA 2LECA 2UUCJ 3I96A 3U27A 4E19A 2NPFA 4RWWA 1NOYA 3QLHA 1BIZA 3PRVA 3MCSA 4DUZJ 5EX3A 3L2VA 4IFYA 3ZC4A 3SQGA 1D1UA 3HHLA 2DGSA 2MYFA 3PRBA 1UA1A 4X66K 1A0OB 1NZ8A 3ZETA 1XNQF 3KDOA 1NGEA 3GP9A 2GMJA 4XPCA 4K4YA 4OPHA 3DLKB 4K0KJ 1HR0K 1P6TA 2A3ZA 2B4JA 4C9DA 5C10A 1U4BA 1A5WA 3I0RB 2BE2B 4PQAA 2R42A 2HS4A 1SJFA 4USHA 2AGOA 3SQOP 2DHHA 3L7UA 3ITHB 3AO4A 2Q79A 4DU7A 2DR6A 2H48B 1RT5B 4NXNK 4YHHJ 2CKWA 3GTYX 3GIIA 1HBOB 1WC1A 4NWBA 2OIHA 2AYEA 3OTOF 2P9SA 5HL7Q 1S5ZA 2DNMA 2G13A 3EGWB 4B3TK 4F04B 2XY7A 5IM0A 2MJUA 1HNWK 1KC8T 3AA4A 1R0BG 3GR0A 2OI2A 4FJGA 1VQPS 3F5TA 4IOXA 5LMNK 3CJRA 3PJWA 4NCGA 3IO1A 5K9FA 4Q0BA 4YR2A 4AE5A 5KQDA 3TUZC 1JLCA 4JEPA 4JI2K 2NZCA 4IFVA 2DR7A 4N41A 1N36F 3J81O 4DV5J 3BR8A 4Z4FA 3RMBA 1VQLN 1WEYA 1Y9OA 4NLSA 2DR5A 2H5EA 1SL2A 1YITS 3UCGA 3M05A 1G6BA 3Q7CA 3R27A 5A0YB 1B0TA 5IC6B 3MEDA 2P9PB 1SKSA 2ZBRA 2UU9J 2O8FB 1QSSA 2J9DE 3GR1A 3JTOA 4DPWA 5T14A 5AJ3F 4FXDA 1Q16B 3OBIA 1N88A 3NKYA 3CMQA 4CP5A 2OEMA 3RGIA 2RRBA 4ANDA 3R9PA 2KVQE 5E33A 4ILJA 2IBOA 2XYPB 2YHYA 4NLQA 4LFCK 3IBFB 4Z94A 4ILRA 3HZ6A 1KQSR 4FK0A 1UVJA 5U47A 1NOZA 1M90O 3HBTA 5LJ3Y 4MYUA 3OFFA 4GVLA 1RB0A 1RCHA 3KK3B 2HURA 2IHR1 1NBEB 5DMRA 2OSRA 3GLJA 3MTKA 3UD3P 1QVFM 4JI8J 4C2MA 3D67A 4NLDA 4MIWA 4KHRA 1Y00A 4HHJA 1AT1B 5H9EK 3R5BA 5IT9U 3HO1A 2GEMA 1BQMA 1HPZB 4WIQA 5BRDA 3W61A 3M8WA 3GJSB 3AVHA 4U95A 3R7SB 1AXQA 2DNHA 2YQ0A 1RBSA 4O4GA 1KONA 7FD1A 1OQ3A 2B4VA 3KK2B 2M8HA 1NGBA 5KTQA 3EMTA 3RWUA 2RF2B 3C19A 4LF6F 2V4QA 2IS3A 5AQNA 2KFYA 4ZITA 4CEEA 2V52B 1E6YB 1SUQB 3GYGA 3HSJA 2Q97A 1MLAA 4H4KA 3KD5E 3JSBA 2EHGA 1VSHA 5ADXH 1VRTB 3BN7A 3MN9A 4TU8A 2BACA 2OZSA 4OJRA 2QEXN 3LP0A 2HVDA 4DX5A 2UUAK 2DNGA 3O6WA 2E5LK 1T11A 3DU6A 1SCJB 2BJ1A 1N8RO 1HNIB 1IQZA 2HFUA 4ZTFA 5H1SV 4ITSA 3N9UC 5BXIA 1AUSL 3HFVA 3L4BC 1RAGB 3QWPA 3UW1A 1XMOJ 1MWKA 3QB0A 4MFBA 4ZJOA 1WG5A 2ATCB 3NG8A 3GYXB 2RQMA 3HJFA 5L1IA 3D2WA 3AJ2A 5D0HA 4DL3A 2CQ0A 4PUOA 3S7RA 3WXKA 3DRSA 1S4FA 4CF8A 4IOAL 2BRKA 3MHYA 2GV1A 5HVFA 5AQTA 2HAIA 1WACA 5KFXA 1FRLA 3VGTA 4NB4A 2YX6A 4FPAA 3G71N 1Y64A 4CLTA 1P1TA 1WBBA 4A2AA 4ERDA 1K1QA 2VG5A 3OFHA 2VQEJ 3MM6B 3UI3A 1JLGA 3CO9A 5C2GA 4O3NA 4CW7B 3QQCD 4OLPA 3A3PB 3GCXP 4M5DA 1YGYA 1NHKL 3BDEA 4O3OA 3HD2A 3ZT4A 2RDDA 1YJ9S 4DV3J 2WVEA 3AB4B 3CPWR 3OBWA 3LPTA 2YWFA 1DHMA 2QYCA 6AT1B 4LFBK 1WOPA 2QO3A 3TAEA 3LM9A 2H9ZA 5KGWA 3M8QA 2PT0A 3T5JA 3ENOA 1DJ0A 4KHPF 2RQCA 2YNFA 4JI5F 3EVOA 4K59A 2CPEA 4F4WA 2NYIA 3RRHA 1S97A 1TL1A 1RYSA 2YNGA 1RJJA 3KOAA 1SQKA 3MPUB 3M4XA 2MZSA 4X64J 4O3RA 2DNLA 5KGXA 3OYAA 4F4KA 3I33A 3CCVS 4FJHA 3AOCA 2UXDF 4RW4A 1GOAA 2QTDA 4LF8F 2R7QA 1HQUA 1ICEB 4UUXA 1OPZA 1RWMB 1Y4ZB 3HT0A 4GKKJ 2I0XA 3HM8A 5ETRA 2JGUA 4LF4K 2XLJA 2DB1A 4CERA 3I8DA 4NI2A 3WNEA 3D5MA 1FW6A 3JAMO 4L73A 3FSXA 1NJIO 3QLHB 2HFOA 2VB6A 1RE1B 4LVNP 3D6HB 2OPPB 5E3PA 3TO8A 3WBZA 3SBGA 2KHCA 1Q78A 4GVMA 4DR7J 1UW9A 3U1LA 4IFYB 3SQGB 4BROA 3NP5A 4XDCA 1NBWA 4OIXA 3HI0A 2HRUA 3S6EA 4UY8O 3ZETB 1S10A 2OP5A 3O44A 2DXDA 1YDLA 3VEOA 3UB5A 5M1KA 3EICA 4KTQA 2IM1A 3D66A 4WQ4C 2FHMA 1Y97A 1BLUA 4LF9K 4CIGA 4O3SA 4E7JA 3ZZ0A 2CPFA 3DLJA 3D54A 2NXNA 3D3BJ 5J2QA 3QERA 4M63C 3L6QA 3G9CA 2YPYA 2P9SB 2V67A 4W5QA 2P9LB 1B64A 3H42A 5C0YA 2XY5A 2HHSA 2D1CA 5IM0B 3UR3C 4R0JA 1HMVB 2VODA 4W92B 4PRFA 4CFCA 1WC4A 4J2BA 2YWEA 4JV0A 1KWMA 4UZCA 2HBZB 2ZGZA 1WF0A 4NCGB 1HI1A 4PWUA 4WK1A 4D3HA 3TWZA 3L4QA 4CZLA 2Q0UA 1DLOA 4FWPA 3PKMA 4DFJA 1WOOA 4URSA 1FESA 2R7TA 1HWJA 2CNKB 2E5JA 1V5IB 3DM2A 3ZSQA 3N6MA 3AD7C 3DRPA 3GG0A 2IDEA 2OANA 2CJXB 1KTVA 4AYBD 3R2DJ 4X4QA 2BOPA 2KTQA 3ZNUA 2IVMA 2W6LA 2FY8A 4C3MA 5AQWA 1ZBHA 3QGIA 2B6AA 3HM9A 3IRWP 2XI2A 4BE0A 1T02A 2GMHA 3MR5A 3MEDB 1Z25A 1IBKK 4DR3K 4OI3A 3I9V9 2G8HA 4Z2XA 2W1BA 4OZ5A 1VC0A 1SV5A 4HH1A 2QKKA 1PAEX 2MGZA 2CWKA 4M41A 2JX2A 3OTOK 3JSMB 3BR9A 4GC6A 4H4MB 3OL7A 2VFUA 1VHXA 2X3GA 4BRHA 2HWHA 4P7TA 3SUQA 1VCTA 5FPNA 4CJ3A 2MZJA 1QQNA 5CYMA 1TAQA 3I5AA 4FWRA 1NRKA 1JNRB 4DV2K 4N8OA 2UUTA 3HXMA 2OO4A 1XN9A 3LALA 1B0VA 1IR0A 1N56A 2GUIA 2CZVC 2LDIA 4ILGB 1IG8A 4DUTA 1FHTA 3IUCA 2MQOA 4AM7A 4V19J 3MR2A 4ENOA 4G1QA 2P9IA 4BC4A 2H51B 2D5RA 2EK6A 4WE1A 2G1HA 3SMPA 1TL7A 4CYUA 4KQZA 4ES3A 4DOZA 2R7VA 3J7A1 1ZBFA 4FWQA 4FPRA 1VAZA 1TV6A 2QN6B 3GCWP 1OQ6A 3I5BA 1JL1A 2MQPA 1TKZA 4BRPA 2MQMA 1Q95G 1BQMB 4C8OA 5JLFA 1N5YA 1KFDA 2UXBF 4O4GB 4OFZA 2V0NA 4XH5A 4BE1A 2AU0A 4BE2A 2WAQD 4CIFA 5BPMA 4KB7A 3VVUA 3BSCA 4L8RB 2HBRB 3CC4S 4J9PA 1U6ZA 3H3NO 3UCUP 3IR5B 4BDPA 4FK4A 4ES2A 3VQSA 4ECRA 3UE5A 3SQ2A 2FBYA 3GQCA 2Y0BB 4NLOA 3ENVA 1GLCG 1GMWA 2P9UA 4W90B 1FEEA 3IFRA 3EM1A 4FLXA 3LGNA 1GXTA 4F26A 3CXCM 3OVSA 3HTVA 1B4SA 4ECWA 3KG1A 1RWWB 4PQUA 1SC1B 3B4MA 2WVBA 4U8YA 3H5UA 1KVJA 4FBUA 1QHAA 5ETSA 4MKYA 1GQEA 2MQQA 4DR4J 2UXCF 4DBQA 3AVFA 4JN4A 3OSNA 1GLBG 2PEHA 4BGAA 3EXCX 1R89A 3DRYA 3MPDA 1XUPO 1E6VA 3EZWA 3TEGA 2IIRA 2APOA 4MFBB 2HWIA 3MAAA 1V3ZA 1F0XA 4BVPA 3GB0A 5D78A 3NGIA 1IKXB 3O2IA 2K3IA 5GINA 3Q8QB 2CNNB 2LDYA 2P9KA 3V6JA 3OS2A 4JI6K 4CGFA 5FIIA 1RLDA 2E4LA 3Q8PB 1Y3JA 2H4YB 4TSXA 2MKHA 1ASWA 2WFBA 5LOQA 2CPDA 2VIHA 2VG5B 1MN7A 4KV8A 1IM4A 1K8KB 1CJKA 2P6SA 2HS3A 5EY4A 4ZPBA 3KFWX 1C1BA 1NLVA 3PIOL 1VS3A 3ZSOA 3Q89A 3A8EA 4M5DB 4CHYA 1SJRA 1I1GA 2D0PA 3BSOA 1RLCL 3CDBA 3NRBA 2OTLS 4ZOSA 3SCXA 4GVEA 2X1AA 4NCAA 1WC6A 1QE1A 5KG6A 1HBNB 1EAYC 1UEKA 1XNRJ 4K41A 3QGPA 3IRXB 4BDYA 1Y3KA 3EZOA 2CGJA 2FVSA 4DU1A 4CEZA 1TAUA 2QM1A 2GUPA 3KJNB 3TA0A 2AJ1A 4HYKA 1VBZA 3B6BA 4LFAK 1VIOA 4Z4IA 3AQOA 4OKJA 3NAHA 1TL1B 2YNGB 3QBWA 1KLMB 1ZOTA 4DV4J 1VQ6S 3QPIA 3OR1A 2DFHA 2LU2A 4A48A 4M7YA 4J7CA 2HB5A 4U7CA 4IOAQ 1N32F 1EWRA 5A8KA 4RW4B 2AV5A 2Y9HA 3MN5A 3US5A 5AR0A 3HPHA 1HQUB 2HW3A 5HMXA 1M90T 4DR1K 1ZBTA 4B3MJ 4I67A 1TUVA 3C95A 1HQ2A 1EHWA 3C7NA 5C15A 1RKIA 2UUBF 4QYRA 3WQUA 2HHQA 1FD2A 1JXLA 1VQ4N 5LJVA 4OX9J 1OSDA 1Q9YA 3JTPA 5SWMA 4RW8A 1S1VB 5F3ZA 4DCOB 3I55N 4HL9A 1DT9A 4AHUA 2NNWA 3DYAB 1RAHB 1PO6A 2NSCA 4RTFD 2FJEB 3L2RA 1K8AO 3KNAA 2ALZA 1QAIA 2ZH6A 2IRYA 3AJDA 2DO0A 4FJNA 3HKWA 2G1DA 1UW4A 4G1IA 2IBKA 1PYTA 4PEOA 4JYAF 3W64A 3OL9A 1X0PA 4AL6A 1XQSC 4AM6A 1U1NA 1XI1A 5AQIA 3O9UA 4ILLA 1IWAA 4PPZA 4TN2A 3JQJA 1J5EK 1X7VA 3PW7A 3LPEA 4PR6A 4PWDA 2BEFA 5J2NB 2M8DB 2NXJA 5J2QB 3MMCA 4YY3J 4BS2A 3MZIA 1R6VA 3AVLA 3IWXA 2UXDK 3D1HA 1RHQB 4NYFA 1U6BA 4LF8K 1HD1A 1BUXA 4QWCA 2ZBIA 3ULEA 2FF6A 1N8RT 1Z2ZA 5HP1A 2C3PA 4CZKA 3G82A 1R27B 4FZXC 4DPOA 1T3NA 3FEYB 2UUCF 1VSDA 3CJSA 1AUDA 3CJTA 2F9WA 4Y0WA 1EJ7L 5C24A 4BR2A 4E3SA 4XO0A 1KVAA 3NOCA 3I82A 3FDSA 1F5BA 2HLTA 2FIUA 5EXWA 4PXEA 1NU4A 2M0GB 2D3UA 4CZMA 2YNHA 1DLOB 4CZCA 4WFBL 5J1PA 2MLYA 2R8IA 4ECSA 4C98A 3DM2B 3CCJS 3HHLC 5M1OA 2FVQA 4LQ9A 1QAJA 3MCAB 2GAHC 2HS0A 4F4XA 4P2MA 4NYNA 1Z4UA 3B8AX 4MKBA 2YKPA 5KT2A 4PG8A 2B6AB 2RRAA 3O4NA 3J80O 4K5RA 3VQ9A 2X3DA 4UOCA 2K7KA 4S0MA 3WUHA 4ZVUB 2LP4A 1V4SA 2L48A 4EYHB 4PYDA 2XGPA 1FFWB 3CJ2A 1GTEA 4OI0A 4FVCA 3DLBA 3RBEA 4NXMJ 1SV5B