3AVGA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avgA00
1I3AA 3AVLA 4NYFA 4FK2A 2I5JA 4CERA 3RR7A 3QLHA 4O4GA 4DWIA 3THVA 3RRGA 1CLQA 1WSEA 3PY8A 5KGWA 3TAEA 1S1TA 1NJWA 4NYNA 1XHXA 1C1CA 2FBVA 4FYDA 4W5TA 2XY7A 3D0PA 1KFSA 2YNIA 4QAGA 4E7JA 5T7BA 2IS3A 2VG5A 1T05A 3VQAA 3E01A 1JKHA 1WAFA 5KRSA 2DFHA 3WNFA 4QOZB 4Z4IA 3C94A 3NGIA 3DLKA 4J2BA 1C0TA 2HHWA 4CIGA 3NGYA 4M3YA 1L5UA 1ZYQA 3LWMA 2YNFA 3TAPA 3K5MA 1NK5A 3B6PA 4LD0A 4IG3A 2LSNA 3ZSXA 4DF4A 4DSEA 3VQ6A 3QERA 3PX4A 3PO5A 4CEEA 3RWUA 1TKZA 1KRPA 3MEGA 4IFYA 4DS5A 3TR8A 1J5OA 2IC3A 1N5YA 3HVTA 3NHGA 4K8ZA 3NGZA 5D3GA 3V1QA 3DRSA 4H4MA 1LW0A 2YV0X 3AVGA 3VQ4A 4UQGA 4Z0UA 3HT3A 4FZYA 3NF7A 2E6MA 1KLNA 3AO1A 3O3HA 4TSXA 3V9WA 1NJXA 4PWDA 3OS1A 4M45A 3KK2A 4CEZA 1RNHA 4FLVA 3I0SA 4Q0BA 1RBRA 1VRUA 4CGFA 3EYZA 1RCHA 1WSHA 4O55A 5K14A 1L3VA 1HYZA 3TARA 3OYFA 1L3UA 1QSLA 3VQ7A 4CEFA 2P5OA 3QESA 1RBUA 4HUFA 1HQUA 2B4JA 3AVCA 1RDCA 1QSSA 2A1SA 2XHBA 4C8LA 1CZ9A 1NK6A 4CJKA 1T03A 4RW8A 1LWCA 4GMJB 2P51A 5KRTA 4ZHRA 2EX3A 4CFBA 4KAZA 1QHTA 2KQ2A 1RT3A 2KW4A 1Q9XA 3T19A 4CF0A 3OYNA 1NKEA 4CJSA 3JYTA 3EY1A 4ZTFA 1RT4A 4KREA 1YT3A 1SL2A 3WNGA 1EXQA 4PUOA 1JLGA 2YHAA 4CJWA 3P1GA 3NDKA 4O5BA 1F21A 1HJRA 4FLZA 4DQRA 1U48A 1O1WA 4DTOA 4C8OA 4DTUA 2D0CA 1Q8IA 1VSIA 1ZBFA 5J2PA 4Y1CA 4CEAA 1N6QA 3KTQA 2VWKA 4OGCA 1VSFA 1ZBIA 3O3GA 4OLAA 1TGOA 1HNIA 3AA4A 3T1AA 3LP2A 5HBMA 2R7YA 4C8KA 4FJGA 3C95A 2ETJA 3VQBA 3RMDA 1YTUA 1ZBUA 3DMJA 3RTVA 4CHZA 3KIOA 1KTQA 3DYAA 4KB0A 4KV8A 1FKPA 1QE1A 4H4OA 4CFDA 1XI1A 3SPZA 3L2WA 4NCBA 5FDLA 4JLHA 4WE1A 2G8FA 1HPZA 3AVKA 4N5SA 3ITHA 4E1MA 2HNYA 3DLBA 4CGGA 2W42A 4B08A 4FJ9A 5HLFA 4E19A 3KLGA 3AA2A 1X9SA 3SQ2A 1RTIA 5SZTA 3HXMA 1X1PA 1K6YA 3K59A 3C6UA 4RG8A 1BI4A 3TAMA 3V4IA 3TI0A 3QIPA 4YNQA 3NH2A 3I8DA 4M3RA 4N76A 4AHRA 3SYZA 1Y97A 3IS9A 3I0RA 4CHYA 4ZTJA 1JLAA 1KLMA 3CYMA 4DG1A 1TV6A 5KGXA 3SUOA 2Q3SA 4G1QA 1TK0A 4F3OA 3VN5A 3LAMA 3AO5A 4B9UA 2ZE2A 1C1BA 3MAQA 4CHQA 1LV5A 1TL3A 1DLOA 2GUIA 3OS0A 4E0DA 3VA0A 1S6PA 4HCBA 4CEDA 4FJ8A 2KTQA 2JGUA 4CJEA 4HVJA 1LW2A 1UWBA 1C0UA 3S3MA 2PY5A 1TKTA 1GOCA 1CXUA 1RDDA 3VQ9A 5HRSA 4CJFA 4DSIA 2BDPA 4HCCA 4AHSA 5HROA 1NOZA 3S3NA 4GVMA 3HPOA 3V9UA 3L2UA 3NCIA 1Q9YA 3SJJA 3RMCA 3KLEA 4FLXA 1JLBA 3ZT4A 5J1EA 1RTDA 4OPKA 3BDPA 1UAXA 1KFDA 4YFUA 4CJQA 1RILA 1RBTA 1BCOA 3V1OA 4DLGA 5JS1A 4DLEA 3OYAA 4CCHA 2KFZA 2IOCA 4RW6A 1KSPA 4KTQA 2HHSA 1J9AA 4FJNA 2YNGA 2D0BA 4FLWA 2YHBA 1WNSA 5CYMA 2IAJA 1ZBLA 3LALA 3KK3A 3DLGA 4CEOA 1VSMA 2HVHA 4GW6A 3OYEA 2Y1IA 1VSEA 1VRTA 1JXEA 2BANA 2G8VA 2X6NA 3ASMA 1S9EA 1FKOA 4CJUA 3HSTB 3HJFA 3SQ4A 3LAKA 4CHNA 4CJ3A 4CECA 2DTUA 1BL3A 1BGXT 3HVRA 1RBVA 4OVLA 3ZSQA 3DOKA 3CG7A 3NFAA 4W5RA 2G8HA 4B9SA 2GBZA 3NAEA 1HYSA 5I42A 1C6VA 1TVRA 3O3FA 1L3SA 3ZSOA 1QTMA 4E3SA 2PYLA 2JLEA 1VSDA 4CHPA 5J2QA 2OA8A 4LH4A 3H08A 4ID5A 4BDZA 4CIFA 5E41A 2YKMA 4FM1A 1TKXA 2XY8A 4DF8A 1TK5A 4FJKA 3HO1A 2HVIA 3K57A 1NK9A 4FJXA 5FRNA 4DQQA 1QSYA 1EP4A 3AV9A 3OYIA 5CYQA 3AVIA 2BE2A 3HPGA 4E7HA 4M3TA 2OPPA 1IKVA 1S1XA 2XRIA 1VSHA 3SUQA 4ID1A 2FBYA 3SNNA 3ZT0A 1LAWA 1G15A 1HNVA 1S1WA 4IG0A 4KHUA 4Z4GA 3O4QA 2D5RA 1BCMA 3OYLA 4E7IA 4KTWA 4CF1A 1BIUA 4MFBA 4JS5A 4I2QA 4F4KA 3AA3A 2BGGA 1B92A 1MU2A 2B5JA 3DLEA 3M8RA 4FK0A 3NH1A 3O4NA 4F2RA 4CJRA 2QK9A 3BGRA 2KZMA 4DTJA 4J2AA 4Y1DA 2G8WA 4FJIA 4W5NA 2QXFA 2HHQA 2DFFA 4J2EA 4DSKA 2FC0A 1NK7A 3CFOA 3DLHA 4FZXC 3AO3A 4CGHA 1NK8A 1EKEA 1IH7A 4KI4A 1RBSA 2A1RA 4H8KA 4L8RB 4CE9A 1U4BA 2Y1JA 2RN2A 3QO9A 1GOAA 4HHTA 2IDOA 3OYMA 4KTZA 3TANA 4QCLA 3ZSWA 4O44A 1TAUA 4CK2A 4ELTA 3LPTA 4EZ9A 1ASUA 3VQ5A 1RT5A 4EP5A 1RDBA 4AHVA 3K58A 5C25A 1HQEA 3AO2A 3WNHA 3RMAA 2FBTA 1IO2A 1WSIA 3NBPA 1U45A 2E6LA 1DTTA 1FK9A 1S5JA 1JLFA 3P83D 1RTHA 4CIEA 3OYGA 4AHTA 1TAQA 3SV3A 5HP1A 3IRXA 3QNNA 4DMNA 1UA1A 4FZZA 4B9VA 4M3ZA 2X6SA 2HHVA 5HRPA 1BHLA 2OPRA 4HUEA 1TL1A 1WSGA 4O0JA 2GV9A 3NF6A 1S6QA 1IKXA 3ZSRA 1YVUA 4FM0A 4FCYA 1D9FA 4Z4EA 4NCAA 1JL2A 3QNOA 3AA5X 1ITGA 3G10A 1LWEA 3ZT2A 1Z25A 3SUNA 1W9HA 3NF9A 3M8QA 4OKEA 4CF2A 3KLHA 1SV5A 3ZSVA 3OYJA 3SZ2A 3U3YA 2HHUA 3TAGA 5KTQA 2XY5A 2OPSA 3OY9A 3PUFA 4KI6A 4CJPA 3MECA 5HRRA 1SUQA 2ZD1A 4C8MA 3SV4A 3QINA 1SL1A 1D5AA 4M41A 3VQCA 2RPIA 3HPHA 1BISA 1S1UA 2OZMA 4FJ7A 3KLFA 3ZSZA 4AHCA 3OS2A 4AHUA 2KZZA 3C6TA 3VQPA 4DFKA 1JLEA 4ELVA 4NCGA 4FJ5A 1BQMA 4FJMA 1D8YA 3K5LA 4DFMA 3LPUA 5I3UA 1A5XA 4N47A 3AVNA 3MXMA 4M3UA 2Z1GA 3P5JA 3QEPA 3CFPA 5DK5A 1BIZA 1KVAA 3F9KA 4F2SA 3TWHA 1A5VA 3M8SA 4CGDA 4E1NA 3SCXA 4BDPA 1RT1A 4DTNA 2IGIA 3LZIA 1X9MA 4KPYA 3S9HA 3MEEA 2Z1HA 1VSLA 1HMVA 3K5NA 2F8SA 4B9LA 4KHQA 1JXBA 3L2RA 3VQQA 1S1VA 5C24A 3DRPA 3VQEA 3HL8A 3G0ZA 4O0IA 4DQPA 4DQIA 3K2PA 1XC9A 1D9DA 1T7PA 5CZ1A 1A5WA 5EU7A 4CEBA 4CHOA 3LDSA 4DQSA 2DFEA 2PYJA 2AJQA 1L3TA 1ASWA 3HM9A 3QEXA 3TAFA 2QKBA 5CZ2A 3SQ1A 4DTSA 4IFVA 4IDKA 4CFAA 3RRHA 5HRNA 1SKRA 3NF8A 2HHXA 1B9DA 4DTXA 3DLRA 3DOLA 4HUGA 2G8KA 3KKSA 3VQ8A 1CXQA 1ZBHA 5JS2A 4E89A 1KCFA 3HYFA 4PA1A 3KD5E 1UOCA 4M42A 1CZBA 3ZT1A 4HTUA 3T3FA 2WOMA 1B9FA 2ZQBA 3ZT3A 4DU4A 4DU3A 4M3XA 1REVA 1U04A 4KHSA 4RW4A 1X9WA 3OYKA 2YKNA 3OJUA 3MEDA 2OYQA 3ISNC 4CK1A 4LH5A 3OYBA 3KKRA 1WLJA 2F8TA 3QETA 3L2QA 4AILC 4CGJA 4RW9A 4CFCA 2HB5A 2Z1JA 1YTAA 4Z4HA 4DS4A 2PZSA 2HNDA 4IKFA 1S9GA 3V6DA 4F8RA 1XHZA 1TK8A 4Z4CA 3CM6A 3JSMA 3S3OA 1J53A 2G8UA 4B9NA 2XO7A 1NK4A 4F3TA 2RKIA 3SI6A 2HMIA 2O4GA 1R0AA 1NK0A 2RF2A 4OKKA 4OKJA 3AO4A 1GOBA 1SKWA 3DI6A 4ICLA 3PV8A 3SUPA 5CY4A 1BQNA 4BWJA 5DMRA 4FJJA 3ZSYA 1EX4A 4OPJA 2YNHA 4AH9A 4FM2A 1IKYA 4KO0A 3AVAA 3F73A 4E7LA 1ASVA 2OPQA 3LWLA 3AVHA 2KFNA 1RT2A 3QEIA 4B9TA 3RR8A 1RDAA 3LZJA 2X74A 5SWMA 4DSLA 4N56A 1T8EA 2D0AA 2NUBA 4CJLA 4FVMA 3AVBA 4BWMA 4JRPA 1C0MA 4DTRA 4FJLA 4M3WA 2VWJA 3V9XA 3SPYA 4DSJA 3KLIA 3V9SA 1I39A 4W5QA 3KD1E 4LSLA 3HP9A 3UIQA 3QEVA 3IG1A 4DTMA 4OGEA 1HYVA 4CEQA 4I2PA 3QEWA 3IAYA 5FRMA 4CF9A 4KHWA 4PQUA 1IG9A 4CJTA 5J2NA 2DY4A 2O4IA 3NH0A 1VSKA 2ITGA 4C8NA 2E4LA 4CESA 5FROA 4BACA 4CJ5A 3LP3A 3V81A 4DTPA 3PX0A 4OJRA 3CQ8A 5J2MA 2XY6A 2HHTA 1BI4B 4CF8A 4EP4A 1HRHA 4BDYA 3VQDA 3QIOA 4R5PA 1Z26A 4E7KA 3LP0A 1TKDA 4KHNA 3B6OA 4BE2A 4BE0A 4FLTA 4Z4FA 3L8BA 3A2FA 4I9QA 2QKKA 3L2VA 3M8PA 3MXJA 3OYCA 4ELUA 4KRFA 3OYHA 4FLUA 3ALYA 3SQ0A 1UA0A 4KB1A 3DRRA 1XWLA 3LANA 4I7FA 3U3GA 3V1RA 1NKCA 4EZ6A 4B3OA 3KJVA 1NJZA 3AVFA 3EZ5A 4DFPA 3HP6A 1LWFA 3HK2A 4CK3A 3TABA 1RT7A 4KFBA 3PO4A 4CJ4A 1WSFA 4N41A 2B6AA 1J54A 2VG6A 2EHGA 4RW7A 1JLCA 3D45A 4W5OA 2HW3A 4KKOA 3CFRA 3V9ZA 2FBXA 3L3VA 3OJSA 1WSJA 1WN7A 4FW2A 1FXXA 1IKWA 4B8CA 1NJYA 4FW1A 4JS4A 1NOYA 3MXIA 3OVNA 4CGIA 1EETA 3AVJA 3L3UA 4XIUA 4LY7A 3KK1A 4DU1A 3RMBA 3WNEA 1RT6A 3U6FA 3PX6A 2VG7A 4PY5A 4MQ3A 4LSNA 4BE1A 1JLQA 1SKSA 1KVCA 3FFIA 4B8AB 1U49A 2WONA 3OYDA 1LAVA 2HNZA 3NE6A 4JRQA 3VA3A 4B9MA 4FJHA 2X78A 4DFJA 1SL0A 3K5OA 2ATQA 3AVMA 1RTJA 4IBNA 3TAQA 2G8IA 2Z1IA 4OLBA 4FXDA 4J2DA 4CJVA 5KI6A 2P1JA 3CM5A 1DTQA 1QS4A 3DM2A 3ZCMA 5C42A 4Q5VA 1U47A 2OZSA 4KHYA 4FK4A 1VK0A 1VSJA 1WAJA 1KVBA 1W0HA 2F96A 3LP1A 4I9LA 4FLYA 1NKBA 2P5GA 4K8XA 1C1AA 3ULDA 4DSFA 1JL1A 1QQCA
chains in the Genus database with same CATH superfamily
1NGBA 1I3AA 3AVLA 4FK2A 1CLQA 3KK7A 4HWIA 3PY8A 1NJWA 5FPEA 3DJCA 4H0YB 3LDQA 2VG5A 3WNFA 3MWPA 4JI4K 4DUZK 3O9UA 3NGIA 2HHWA 4CIGA 3NGYA 4BGBA 1L5UA 3LWMA 2YNFA 3TAPA 3K5MA 3B6PA 4IG3A 5LMUK 4DSEA 1O13A 3PX4A 3RWUA 1TKZA 1KRPA 4DS5A 5D3GA 2IC3A 1N5YA 4QS8A 1LW0A 3VQ4A 4FZYA 2RE2A 2YJEA 4PWDA 3OS1A 2IVOA 4FPAA 4CEZA 3VEWA 1RBRA 3CCMN 5AQHA 4O55A 1L3VA 1QSLA 1HYZA 2RHKA 4WYBA 3WUHA 1S72N 4HUFA 1HQUA 1RDCA 1GLDG 1T03A 4GMJB 5KRTA 4ZHRA 4CFBA 2Q0RA 5LMNK 2KQ2A 3CJ1A 4JI2K 4CZIA 3OA9A 4MLHA 4PUOA 3ENOA 1HJRA 1S22A 4DQRA 4A59A 1Q8IA 1SAZA 1KXPA 5J2PA 1VSFA 2ZJRL 3BF1A 2O8CA 3EEQA 4OLAA 4NXNK 3LP2A 4C8KA 3SMPA 3RMDA 3OW2M 1Z05A 1YTUA 3O80A 3RTVA 1VHXA 1KTQA 3DYAA 3D2EA 1T3VA 4KV8A 1VQMN 3SPZA 1K8AO 4EFHA 4WE1A 1HPZA 3AVKA 4JV5K 4XEIA 3CQXA 3HXMA 2F4VK 1VQ8N 1BI4A 3TAMA 3V4IA 3TI0A 4YNQA 3I8DA 4M3RA 4WFBL 4ZTJA 1KLMA 4F3OA 4NLBA 5KGXA 1QQNA 3UKUB 4WQ5A 1NM1A 1V4TA 1GLFO 3L6QA 1TL3A 2GUIA 4WFAL 4JK9A 5AQUA 4BRIA 4BREA 1C0UA 3S3MA 1GOCA 2ZJQL 4BG9A 4CJFA 2V52B 3FZFA 5HROA 4H5NA 3V9UA 2FXUA 3NCIA 4Y0WA 1QZ6A 3CD6N 1RTDA 3KWIA 5BPMA 1KFDA 1RILA 3LDOA 4YOUA 4O8KA 4RW6A 1T6DA 2YNGA 1WNSA 4FPBA 5CYMA 2IAJA 1RGIA 1ZBLA 3DLGA 3P31A 3EKUA 4GW6A 1VRTA 3MN9A 2X6NA 1X3NA 1S9EA 1VQPN 3RSEA 3HSTB 3LAKA 3WQTA 3THYA 2G8HA 1RBVA 3DOKA 3NFAA 1HR0K 3O9SA 5I42A 1Z6RA 1TVRA 3ZSOA 2PYLA 5CHIA 1VSDA 4H0VB 4LH4A 2QWNA 4DF8A 3HO1A 4YOTA 4FJXA 4DQQA 1BA1A 1NMDA 3AVIA 2BE2A 2ASMA 3HPGA 3MWTA 3SNNA 3ZT0A 1D4XA 1HNVA 4Z4GA 4KTWA 4BRFA 4CF1A 3DLEA 1MU2A 3M8RA 3O4NA 4JYAK 4J2AA 4H0TB 4Y1DA 4G9ZA 2G8WA 2QXFA 4BR5A 4O8UA 1NK7A 4FZXC 4YOXA 1EKEA 4KI4A 2WFBA 4H8KA 4L8RB 1U4BA 1G99A 2RN2A 3QO9A 4HHTA 3WXLA 4A5AA 2HHHK 3E1YA 3VOVA 4QS9A 4JI8K 1TAUA 5BREA 4CK2A 1YXQA 4ELTA 1ASUA 3VTIA 1RDBA 4AHVA 4JN4A 1NGDA 1U2VB 1N36K 1FK9A 3P83D 5AQYA 1TAQA 1UA1A 3KVGA 4WCEL 5HRPA 4BROA 2UUAK 4O0JA 3CIPA 5TKYA 1YVUA 4FCYA 1JL2A 3D2FB 3QNOA 4CD1A 3G10A 3M8QA 4OKEA 3ZSVA 3M5RA 5HRRA 4XH4A 1SUQA 3QINA 3F2KA 1D5AA 5BRFA 3VQCA 2RPIA 2OZMA 2GELA 2E1YA 3ZSZA 4AHCA 1WBBA 3VEZA 4ELVA 1CZAN 4NCGA 1BQMA 1BWFO 3JAMO 3K5LA 5I3UA 1A5XA 2VCPA 4N47A 4M3UA 3LM9A 4FWMA 3QEPA 5DK5A 1BIZA 1KVAA 4F2SA 3EE9A 1A5VA 3SCXA 4DTNA 1X9MA 3LZIA 1SQKA 2Z1HA 4IDHA 3CERA 3K5NA 5M1PA 4DR7K 1JXBA 2J4RA 3J81O 2E2PA 3QFUA 3DXMA 3M6GA 2PBDA 4O0IA 4DQPA 3O8MA 4CZJA 1XC9A 1T7PA 5EU7A 3TTDA 3LDSA 1KC8O 2Q1NA 5M1QA 3ZYYX 3TAFA 1N33K 1X3MA 3RRHA 3QBXA 2E5LK 4AM7A 3IDHA 3KKSA 4LF6K 3VMFB 4PA1A 1OH7A 3KD5E 3CCSN 4JK8A 1XNRK 5JVGL 3T3FA 1ILYA 5C15A 4RW4A 1X9WA 3H3NO 2OYQA 4JKFA 3ISNC 4CK1A 4GY2B 3OYBA 2F7TA 1BDGA 4IEIA 1WLJA 1EWRA 5F1XA 4CGJA 1YTAA 4DS4A 4IKFA 4F8RA 1XHZA 1TK8A 4Z4CA 4FOIA 3CC4N 1J53A 4F3TA 2XO7A 4LF7K 2O4GA 1R0AA 2D0OA 1NK0A 2RF2A 2ZWHA 4OKJA 3AO4A 1SKWA 3AGKA 4CBWA 4ICLA 4FWSA 4DV2K 2QI2A 5DMRA 4DR1K 1ASVA 4IZ9A 4UY8O 2YJFA 1QQMA 3FE1A 4DB3A 3AVBA 3FFKB 2NRZA 3D2EB 3QEVA 4DTMA 5M1OA 4CEQA 3UKRA 3SBTA 4KHWA 1IG8A 2ITGA 4K0KK 2E4LA 1HNWK 5AZIB 3V81A 1TYQA 3CQ8A 1BI4B 1HRHA 2HOEA 4BE2A 4BC4A 3HBTA 2QKKA 3L2VA 3DRRA 4B3OA 4CVNE 2YI1A 3KJVA 3EZ5A 1YJ9N 1HKBA 2O8DA 5AQPA 4N41A 1WSFA 2HW3A 3FZMA 3C6HA 1MWMA 5AZJB 3CFRA 1KAZA 5ADXA 1BOTO 3C65A 4LF9K 3F5TA 4B8CA 4BVOA 1EQYA 2GTDA 2YCHA 1YVNA 1EETA 3AVJA 4DU1A 3KK1A 2OCEA 4KH4A 2VG7A 4PY5A 4LSNA 1JLQA 1M1KO 1VQLN 1SKSA 3VEYA 5LJVA 3NE6A 4PKIA 4EIAA 4IJNA 4X65K 1SL0A 1QVGM 4X64K 2O8BA 4FXDA 3H46O 3RSEB 4YOVA 4Q5VA 1U47A 1VK0A 1QZ5A 1VSJA 2P9NA 3MN6A 4I9LA 5E84A 2P5GA 3THYB 4CZLA 3GL1A 1OVYA 3Q7BA 3JYTA 4DV3K 2NNWA 3KHYA 1WUAA 3THVA 4DWIA 4A5BA 4OPAA 2FBVA 2EWSA 4FYDA 2XY7A 3QICA 1KFSA 2YNIA 4QAGA 5T7BA 3I55N 3VQAA 1T05A 3E01A 4RTFD 1JKHA 1XC3A 4QOZB 3VF4A 4FWPA 4NO7A 4B1VA 1NK5A 1DKGD 3BP8A 4DF4A 3VQ6A 4IOCL 5AQTA 3PO5A 4CZMA 3MEGA 1J5OA 4K8ZA 4IJAA 3V1QA 5FLXO 2CH5A 4FO0A 2YV0X 4UQGA 1NGFA 3NF7A 2E6MA 1KLNA 1NJXA 3KK2A 3G6EN 2Q0UA 4ILHA 4Q0BA 5GIOA 2A5XA 4CGFA 3P38A 3EYZA 4LFCK 5K14A 3OYFA 3VQ7A 3QESA 1RBUA 1RDUA 5JICA 1CZ9A 1ESVA 3FR0A 3CCQN 2EX3A 2NZTA 3CC2N 1QHTA 4GV6A 2KW4A 4ISFA 3T19A 3EY1A 1RT4A 4OX9K 1YT3A 2YHYA 1SL2A 4IOXA 2YHAA 3P1GA 3NDKA 4O5BA 1F21A 4C8OA 2D0CA 1ZBFA 3H6EA 2WTUA 2Q31A 4MDBA 4IEEA 4LFBK 1HNIA 3T1AA 2R7YA 5HBMA 2QWMA 1ZBUA 3DMJA 1HUXA 2KHOA 3EO3A 4PHTX 5AQVA 1IBLK 4BRLA 4H4OA 3T69A 3L2WA 3DLBA 4E1MA 4CGGA 3VEOA 4JHDA 5BR8K 3KLGA 1IJJA 4RG8A 3PIOL 3T1HK 3SYZA 1Y97A 3I0RA 1JLAA 3SUOA 1Q9YA 1TV6A 4G1QA 1ZBSA 3LAMA 2P9PA 3ULEB 3C0BA 1C1BA 3MAQA 1NWKA 4CHQA 3D7EO 4DR5K 3OS0A 4E0DA 4FJ8A 2E88A 3WXMB 3DXMB 3CCUN 3G71N 2JGUA 1UWBA 3T7ZA 4DSIA 1Q18A 1HLUA 4AHSA 3HPOA 4CI6A 3RMCA 3KLEA 4FWNA 3J8AA 3ZT4A 4GV9A 4OPKA 2FF6A 4Z94A 5HL7L 3BDPA 4JEPA 4CJQA 2AA4A 1RBTA 2FF3B 1BCOA 3V1OA 5KPRA 4BGAA 2IOCA 2HHSA 1NMNA 2D0BA 2YHBA 3VEXA 4FVUA 3LALA 3KK3A 4GKKK 4CEOA 1VSMA 1VQNN 3OYEA 1VSEA 3GDQA 3PSFA 3R6MA 4MO5A 3ASMA 4YOYA 1YIJN 4CHNA 1ATNA 4CECA 1BGXT 5FPMA 1QHAA 4B9SA 2GBZA 4H0OA 1L3SA 3O3FA 1VQON 2JLEA 4CHPA 2UYTA 4ID5A 4JKCA 4CIFA 3CETA 5E41A 2YKMA 2Q97A 1TKXA 1TK5A 3BY5A 2P9LA 4FJKA 2HVIA 3K57A 1QSYA 3VETA 3AV9A 3MN7A 5CYQA 4NB4A 4M7XA 1S1XA 1VQKN 1HX1A 5AQMA 4BR2A 3UKRB 1G15A 1S1WA 4KHUA 3OYLA 1VQ6N 1BIUA 4I2QA 3WXJA 2D0PA 2IIRA 1B92A 4ISGA 3CPEA 3NH1A 1TYQB 4DTJA 3CFOA 4KBOA 4H5RA 1IH7A 2P9IA 4CE9A 2P9UA 3KZBA 1BUPA 3SLCA 4KTZA 2I7NA 4PL7A 3TANA 4QCLA 5AR0A 4O44A 5C12A 1E4FT 2E20A 3LPTA 1BA0A 2A42A 4EZ9A 1FJGK 3VQ5A 1Q81O 4BR7A 5C25A 1HQEA 4FWOA 4MLEA 3RMAA 2FBTA 1WSIA 3ZEUA 4DR6K 1JLFA 4LF8K 4O5FA 4CIEA 3ENBA 3OYGA 4AHTA 3IRXA 4DMNA 2X6SA 4HUEA 1TL1A 4CBUA 3NF6A 3R3LA 1S6QA 1IKXA 3EKSA 1M90O 3O9QA 5AQFA 4JI5K 4FSVA 4JI7K 1ITGA 3ZT2A 1Z25A 3O1BA 3SUNA 3KLHA 3NF9A 3CC7N 4BC5A 1SV5A 2UUBK 1GLBG 4JKDA 2W6LA 2P9NB 1SL1A 5BR9A 3QB0A 1S1UA 4FJ7A 4AHUA 3C6TA 3VQPA 1D8YA 3FZLA 4DFMA 4XH5A 3P5JA 5JLFA 4E1NA 1ZXOA 3E9OA 4PKGA 4K41A 4C1NK 4DV7K 3VQQA 5C24A 3DRPA 3HL8A 4BRGA 1A5WA 4U7BA 1TUYA 5H1SQ 2DFEA 4DQSA 2PYJA 2AJQA 1L3TA 2QKBA 3HM9A 5CZ2A 3SQ1A 1N34K 4CFAA 2O8FA 1B9DA 3DLLL 3DLRA 3DOLA 3AY9A 4HUGA 2G8KA 5M1NA 1ZBHA 5JS2A 4E89A 2F9WA 3HYFA 5GINA 3ENHA 4KH6A 3ZT1A 1NNEA 4DU3A 4M3XA 1JCGA 4CZEA 4KHSA 3OBWA 3HM8A 3KKRA 3QETA 3L2QA 5GADP 4AILC 4RW9A 1NGJA 1QQOA 1YUWA 3MCPA 2A3ZA 5AQGA 3TTCA 4DCHA 4YDUA 2RKIA 4RWTA 2HMIA 4OKKA 1LOTB 5C2DA 3DI6A 3PV8A 3SUPA 3U8XA 3ZSYA 1EX4A 2YNHA 3JXUA 1JCEA 2FSKA 4KO0A 3AVAA 1XQSC 3K9JA 4E7LA 3LWLA 2NLXA 4B9TA 3RR8A 5M1KA 2X74A 4JAXA 4B1YB 2NUBA 4CJLA 4FVMA 4BWMA 4DTRA 4JRPA 4FJLA 2VWJA 1I39A 4W5QA 3IG1A 3EE8A 4I2PA 5FRMA 1YITN 1NGCA 4CF9A 4PQUA 1IG9A 4CJTA 3NH0A 1VSKA 4C8NA 4U67L 4CESA 1S3XA 4JHDB 4B3SK 3TSUA 4FOEA 4DTPA 3HTVA 1NGIA 3VQDA 3QIOA 4E7KA 3PIPL 4I9QA 4KRFA 4FLUA 3O1WA 2P9PB 5AQIA 1XWLA 3AARA 3AVFA 3WEEB 4BRDA 2JWLA 4DFPA 1LWFA 3HRGA 4CK3A 3PO4A 1U6ZA 2VG6A 5ELZA 5ADXH 4BRCA 5DM7L 4KKOA 5AFUH 3V9ZA 2WC9A 3OJSA 1WSJA 4FW2A 4H5VA 1IKWA 3E9LA 4FW1A 5TKWA 3OVNA 3J7AP 4CGIA 4IOAL 4FL9A 3L3UA 4LY7A 4PKHA 3MN5A 3U6FA 4MQ3A 4BE1A 4JKBA 3E9PA 3FFIA 3OYDA 1IBKK 3P39A 2BTFA 4JKGA 4B9MA 4GV3A 1LCUA 4AQYK 2ATQA 3AVMA 1RTJA 3ZLJA 3W0LA 4J2DA 3M3ZA 5CR4A 3ZCMA 3C7NA 2OZSA 4DR4K 1W0HA 2F96A 4FLYA 4DSFA 1NGEA 1QQCA 4ISEA 2I5JA 4CERA 3RR7A 4O4GA 1IV0A 2DPNA 4DV1K 1E3MA 1XHXA 1BG3A 4B1WB 3J7ZO 3MCAB 2YHWA 2P9LB 2IS3A 5KRSA 4A57A 4Z4IA 3C94A 3DLKA 3O08A 3K0SA 4M3YA 2CGLA 4DR2K 4JI1K 5GAEP 1ZYQA 2QWOA 1Q82O 2LSNA 3QERA 1DEJA 4CEEA 3HVTA 3NHGA 3NGZA 3R1XA 3DWLA 2VWBA 3DRSA 4H4MA 3AVGA 4Z0UA 5AQKA 1MDUB 2KLAA 3AO1A 3O3HA 4TSXA 3V9WA 5HOOA 4M45A 1RNHA 4OPHA 3F9MA 3DXKA 4BRNA 2OANA 3NVMA 1RCHA 2P5OA 1L3UA 2O8CB 4CEFA 3M1FA 1N32K 1HNXK 3AVCA 4C8LA 4CJKA 4RW8A 1LWCA 5IT9O 1RT3A 1Q9XA 3OYNA 4CJSA 3ZETA 1YI2N 4YDUC 1FW6A 3IFRA 4CJWA 4DKWA 4FLZA 1U48A 4DTOA 1VSIA 2D1KA 3U9ZA 1N6QA 3KTQA 2VWKA 4OGCA 4B3MK 1ZBIA 1W97L 5BRHA 1TGOA 3U9DA 2HSTA 3CCVN 5AQQA 3C95A 1YHQN 2Q2RA 3VQBA 1KQSM 2WBNA 1T6CA 3KIOA 4KB0A 4H03B 1W2BM 1FKPA 1QE1A 1XI1A 4H0PA 4NCBA 5FDLA 3TSPA 1H1VA 2VGNA 3MDQA 4N5SA 3ITHA 2HNYA 5F2RA 1XUPO 4FJ9A 5SZTA 1X1PA 1K6YA 3QIPA 5AFUA 3NH2A 1BU6O 3W3DA 4AHRA 3GE1A 3IS9A 4DG1A 4X66K 2Q3SA 1VQ7N 1VQ4N 3G25A 3WT0A 4B9UA 1LV5A 3VA0A 1S6PA 5DM6L 4CEDA 1Q86O 3OBYA 4HVJA 1LW2A 1RDDA 3VQ9A 3EL2A 2BDPA 1C0GA 4BRMA 3VTHA 3S3NA 4GVMA 5CE3A 5FPDA 4DV4K 4KHPK 2O8FB 1JLBA 4YORA 3CJ9A 3AAPA 3CMAN 2KFZA 1J5EK 1KSPA 4KTQA 3VGLA 1J9AA 4FJNA 3AAQA 5AQJA 2VYPA 4BG8A 4AM6A 1HNZK 2Y1IA 1JXEA 2BANA 2G8VA 5AQZA 3SQ4A 3H3OB 4CJ3A 2DTUA 1BL3A 4OVLA 1HYSA 3NAEA 2NRTA 3ID8A 1QTMA 5J2QA 3BF3A 3AGRA 3MK6A 4A2AA 3SK3A 3LM2A 5C0YA 3A5LC 2HBMA 3VEVA 3R9PA 3OYIA 2XRIA 3SUQA 4ID1A 2FBYA 2QTDA 3O9RA 4X62K 2V51B 4CBXA 4V19S 4IG0A 1OH8A 3O4QA 2D5RA 4E7IA 4ILJA 4F4KA 3O6WA 3SBGA 2BGGA 2QK9A 2KZMA 3UB5A 2HHQA 2DFFA 4J2EA 3N4PA 4CGHA 3SAFA 1RBSA 2A1RA 2Y1JA 3D6RA 3BUZB 3S41A 1GOAA 1VQ5N 4IO9L 2IDOA 2ASPA 3OYMA 3FLCO 4K25A 1RT5A 3AO2A 3WNHA 3CCRN 3LDPA 2E6LA 3SAHA 3SMSA 2GEMA 1DTTA 2Q36A 1KAYA 1WOQA 2H3GX 3CCEN 3C6AA 4CJ7A 4M3ZA 3CJCA 2OPRA 2GV9A 2YHXA 3A0IX 3ID6A 5F0XA 4FM0A 3BZCA 4NCAA 3AA5X 4JKGB 1LWEA 4NLCA 3CCLN 3OYJA 3HSCA 3TAGA 5BPLA 5KTQA 2XY5A 4BR9A 3OY9A 3PUFA 3O9TA 4KI6A 3I8BA 3MECA 3C7NB 1U2VA 3SV4A 4I6MA 4B1XB 3KLFA 4YOWA 2QM1A 4FJ5A 3QMLA 3LPUA 3HI0A 4FWRA 5JVHL 2QXLA 3F9KA 3TWHA 4CZGA 5FPNA 4CGDA 4BDPA 2IGIA 4K43A 3S9HA 4ILGB 1VSLA 1JCFA 1HMVA 4K42A 1HJOA 3PLAA 4B9LA 4KHQA 3L2RA 5AQXA 4WQ4C 1S1VA 1J6ZA 3VQEA 4BR4A 3K2PA 1D9DA 5CZ1A 4CHOA 3QEXA 2W41A 4IFVA 4IDKA 5AQRA 3DAWA 1SKRA 5HRNA 2HBKA 3N4QA 4C23A 2QA4N 3MMVA 1CXQA 1KCFA 3MX5A 3H45C 1VQ9N 1CZBA 2WOMA 2ZQBA 1U04A 3DXKB 3OYKA 2YKNA 4C1NI 3OJUA 1Q7YO 2HB5A 2Z1JA 3A8YA 4Z4HA 2OTLN 1GLLO 3VF6A 3CM6A 2G8UA 4B9NA 2PFUA 3SI6A 4GVEA 1K8KA 3ZETB 1GOBA 3HZ6A 1KD1O 1BQNA 4BWJA 4FJJA 4AH9A 1IKYA 3WXKA 3AVHA 1T44A 1RT2A 1TUUA 4WF9L 3LZJA 2YX6A 4DSLA 1T8EA 1NGGA 2D0AA 4BC3A 4H0XB 1YF5L 1E4GT 3KLIA 3V9SA 4AF1A 3WQUA 3EZWA 4OGEA 4E1JA 2O8DB 1P90A 4BACA 4JD2A 4CJ5A 1ATSA 2XY6A 4EP4A 3LP0A 4KHNA 3B6OA 4BE0A 3L8BA 3M8PA 3OYHA 3SQ0A 3K9KA 3LANA 3U3GA 1NKCA 4EZ6A 3VPZA 4BR0A 3JS6A 3P4IA 3HP6A 3SJHA 3HK2A 2O8BB 1RT7A 4HTLA 4CJ4A 3QDKA 1J54A 2B6AA 4RW7A 1JLCA 3D45A 1RFQA 2CH6A 4W5OA 5AZIA 1WN7A 1RDWX 1NJYA 4JS4A 1NOYA 2HF3A 3SAGA 2ZM6K 4DR3K 3PX6A 3OTOK 5GIPA 4IXCA 2FSJA 3TU5A 3TPQA 1DGKN 1U49A 2WONA 4JRQA 1LAVA 3VA3A 3CJAA 1I94K 5AQLA 4FJHA 4DFJA 4DV0K 2E8AA 3K5OA 3CF5L 3TAQA 4IBNA 2G8IA 1NJIO 4OLBA 4BRAA 5AQWA 1HKGA 5AQOA 2IVPA 2P1JA 3DM2A 4KHYA 5AZJA 2I7PA 1NKBA 4K8XA 1C1AA 5EXWA 1JL1A 1GLEG 4EHTA 2NRXA 4NYFA 2HF4A 2QWRA 3QLHA 3RRGA 1WSEA 4BVPA 5KGWA 1SZ2A 1S1TA 3TAEA 4NYNA 1W7AA 1C1CA 4W5TA 2UU9K 3D0PA 4E7JA 3CJ7A 2VQEK 4J8FA 1NGHA 3CCJN 1WAFA 2DFHA 5JMVA 2CGKA 4J2BA 1C0TA 5KPZA 4LD0A 3TSQA 3ZSXA 4CD3A 1NGAA 1ZC6A 3VF2A 4YY3K 4IFYA 2F9TA 3TR8A 5A2QO 3A5MC 1HPMA 4IWVA 3Q7CA 3HT3A 2P9KA 4WFNL 1VAZA 5AJ3K 2JWKA 4FLVA 3I0SA 3EN9A 3LDLA 1IBMK 5EX5A 1VRUA 2A40A 5GAHP 5BN9A 1YAGA 1WSHA 5BPNA 3TARA 4LF5K 2B4JA 1GLAG 2V7YA 1QSSA 2A1SA 2XHBA 2QW9A 1NK6A 2P9SA 1NBWA 2P51A 4JKAA 4JI0K 1XMOK 4KAZA 1KAXA 2O8EA 3UE5A 4CF0A 2NRRA 1NKEA 4ZTFA 3ATUA 4KREA 3THXA 3THWA 3WNGA 1EXQA 1JLGA 1O1WA 4DTUA 1XMQK 4Y1CA 1GLJO 4MO4A 4CEAA 2NRWA 3H1QA 2QEXN 3CHWA 3O3GA 3AA4A 4FJGA 1V4SA 2ETJA 3BZKA 4DUYK 2D4WA 2E2OA 3O5BA 4CHZA 2CGJA 4CFDA 4JLHA 2G8FA 4I6MB 4BRHA 4EAHD 2W42A 4B08A 5HLFA 3TTFA 3L4QA 3AA2A 4BRKA 4E19A 3I56N 3SQ2A 1RTIA 3K59A 3VERA 1X9SA 3C6UA 3RVCA 4N76A 4CHYA 5LJWA 3CYMA 1TK0A 4BY9C 3VN5A 2KKZA 3AO5A 4B1UB 2ZE2A 3LDNA 1DLOA 2BH1A 3J80O 4B3TK 4LFAK 4HCBA 2KTQA 4CJEA 2W40A 3WXIA 2PY5A 3CXCM 1TKTA 1CXUA 5HRSA 1Y64A 2HBLA 4HCCA 5EOYA 1NOZA 2GUPA 3L2UA 4LC9B 3SJJA 2ZGYA 1K73O 4FLXA 4H5WA 5J1EA 2GX9A 3CI5A 1UAXA 4YFUA 4A2BA 2E1ZA 2VGMA 4BQLA 4DLGA 3VGMA 5LL6Z 4DLEA 5IWAK 5JS1A 3OYAA 4CCHA 4KH5A 3ULEA 1EWQA 3KWGA 4FLWA 2HMPA 4WQ5C 3IUCA 2FLOA 5C10A 2IVNA 1NLVA 2HVHA 1OVQA 1R59O 3HJFA 1FKOA 2NRVA 4CJUA 3HVRA 3IKMA 3ZSQA 5AQSA 1K8KB 3CG7A 4W5RA 5M1FA 1C6VA 3FZHA 3GBTA 4E3SA 1ATRA 2A41A 2OA8A 3H08A 4BDZA 1EO1A 4CZKA 4FM1A 2XY8A 3L4IA 3GG4A 3O4WA 1NK9A 5FRNA 5EVZA 1YJWN 1MA9B 1EP4A 2P9IB 2P9UB 3ZX2A 4E7HA 4M3TA 2OPPA 1IKVA 5LY3A 3PSIA 1VSHA 1LAWA 1DT9A 5BN8A 2DY4A 1BCMA 4MFBA 3H1VX 4JS5A 3AA3A 2B5JA 4FK0A 4PL8A 4JD2B 4IFEA 4FWLA 5EY4A 4F2RA 4CJRA 3ZEUB 3BGRA 3NMUA 2QWQA 4FJIA 4W5NA 2QWLA 4IO8A 4DSKA 4B9QA 2FC0A 4BRPA 3DLHA 3AO3A 1NK8A 2A6AA 1GLCG 2UXDK 3I33A 2E2QA 3ZSWA 4BC2A 4EHUA 4DV6K 4EP5A 2ITMA 3K58A 1IO2A 3NBPA 1U45A 4LF4K 1S5JA 4M7YA 1RTHA 4R79A 3SV3A 4JNEA 3QNNA 5HP1A 2ZJPL 4FZZA 2HHVA 4B9VA 4JI6K 4RCHA 1BHLA 2VQFK 3VESA 5I9EB 1WSGA 2NRHA 2BUPA 3VENA 3ZSRA 1NG9A 3ATVA 1OH5A 3R8EA 3ZX3A 1OH6A 1D9FA 4Z4EA 4L3QA 4DQ8A 5C2FA 2ZF5O 1XNQK 1W9HA 4CF2A 4WQ4A 3A5NC 4BQZA 3SZ2A 2HHUA 1MWKA 3U3YA 2V7ZA 2OPSA 1YJNN 4CJPA 4MDAA 2ZD1A 3A5OC 4JK7A 4C8MA 4M41A 3HPHA 4FWKA 1BISA 4CZFA 1NU0A 3OS2A 4DFKA 1JLEA 4GNIA 1WBDA 4FJMA 3NVKA 5KPTA 3AVNA 3MXMA 2Z1GA 3L0QA 3CFPA 3M8SA 5KQDA 1RT1A 4KPYA 3UKUA 3MEEA 2F8SA 2WUSA 5GAGP 3B8AX 2E2NA 2W6KA 3G4SN 3G0ZA 4CZHA 4DQIA 4CEBA 4JI3K 2AP1A 2ASOA 2UXCK 1ASWA 3FZKA 4DTSA 4M63C 3NF8A 2HHXA 4DTXA 4DV5K 2P9KB 3IMXA 3VQ8A 1UOCA 5JLHA 4M42A 4JKEA 4HTUA 3ZT3A 1B9FA 5E26A 4DU4A 1REVA 5AQNA 4OO1J 3MEDA 3J7YP 4LH5A 2PAVA 3GOIA 2F8TA 4H5TA 3BEXA 4CFCA 3HOSA 4GKJK 2PZSA 2HNDA 2P9SB 1S9GA 3V6DA 4F9OA 3VGKA 3JSMA 3S3OA 4JKHA 1NK4A 2O8EB 2QWPA 2UUCK 2GWJA 3THXB 1WB9A 3THWB 5CY4A 4OPJA 4DHYA 3OHRA 5B8HA 4FM2A 3FGUA 3F73A 3LL3A 3QFPA 3CQYA 2UXBK 2OPQA 5KQ8A 2KFNA 3QEIA 1RDAA 3MX2A 5SWMA 5MLCQ 3U4LA 4N56A 1OKJA 4M3WA 1C0MA 3V9XA 3SPYA 4DSJA 1P8ZA 1JJ2M 3KD1E 4LSLA 3HP9A 3UIQA 2GWKA 1HYVA 3QEWA 1HKCA 3IAYA 1QVFM 3CPWM 5J2NA 2O4IA 2HBJA 1BO5O 1SS6A 5FROA 4XH1A 4B3RK 3LP3A 4A62A 3PX0A 4OJRA 5J2MA 2HHTA 4CF8A 4BDYA 4NXMK 4R5PA 1Z26A 1TKDA 4FLTA 4Z4FA 3A2FA 3MXJA 3OYCA 4ELUA 3ALYA 1UA0A 4KB1A 4I7FA 3V1RA 3CJBA 1NJZA 2FSNA 3TABA 4KFBA 1X9JA 2EHGA 2FBXA 3L3VA 3T1YK 1FXXA 3HOTA 3MXIA 3QBWA 3ZX0A 4XIUA 3RMBA 1C0FA 3WNEA 1RT6A 4YHHK 1N8RO 4FWQA 2OTJN 1KVCA 2ZGZA 4B8AB 2HNZA 3D2FA 2X78A 3WEEA 1K9MO 4CW7B 4BRQA 2Z1IA 4B1ZA 4CJVA 4QS7A 5KI6A 3CM5A 1DTQA 1QS4A 5C42A 4FK4A 1WAJA 1KVBA 5BRDA 3LP1A 3ULDA 3CMEN 2KZZA 3E66A 4A61A
chains in the Genus database with same CATH topology
1I3AA 3AVLA 4NYFA 4FK2A 2I5JA 4CERA 3RR7A 3QLHA 4O4GA 4DWIA 3THVA 3RRGA 1CLQA 1WSEA 3PY8A 5KGWA 3TAEA 1S1TA 1NJWA 4NYNA 1XHXA 1C1CA 2FBVA 4FYDA 4W5TA 2XY7A 3D0PA 1KFSA 2YNIA 4QAGA 4E7JA 5T7BA 2IS3A 2VG5A 1T05A 3VQAA 3E01A 1JKHA 1WAFA 5KRSA 2DFHA 3WNFA 4QOZB 4Z4IA 3C94A 3NGIA 3DLKA 4J2BA 1C0TA 2HHWA 4CIGA 3NGYA 4M3YA 1L5UA 1ZYQA 3LWMA 2YNFA 3TAPA 3K5MA 1NK5A 3B6PA 4LD0A 4IG3A 2LSNA 3ZSXA 4DF4A 4DSEA 3VQ6A 3QERA 3PX4A 3PO5A 4CEEA 3RWUA 1TKZA 1KRPA 3MEGA 4IFYA 4DS5A 3TR8A 1J5OA 2IC3A 1N5YA 3HVTA 3NHGA 4K8ZA 3NGZA 5D3GA 3V1QA 3DRSA 4H4MA 1LW0A 2YV0X 3AVGA 3VQ4A 4UQGA 4Z0UA 3HT3A 4FZYA 3NF7A 2E6MA 1KLNA 3AO1A 3O3HA 4TSXA 3V9WA 1NJXA 4PWDA 3OS1A 4M45A 3KK2A 4CEZA 1RNHA 4FLVA 3I0SA 4Q0BA 1RBRA 1VRUA 4CGFA 3EYZA 1RCHA 1WSHA 4O55A 5K14A 1L3VA 1HYZA 3TARA 3OYFA 1L3UA 1QSLA 3VQ7A 4CEFA 2P5OA 3QESA 1RBUA 4HUFA 1HQUA 2B4JA 3AVCA 1RDCA 1QSSA 2A1SA 2XHBA 4C8LA 1CZ9A 1NK6A 4CJKA 1T03A 4RW8A 1LWCA 4GMJB 2P51A 5KRTA 4ZHRA 2EX3A 4CFBA 4KAZA 1QHTA 2KQ2A 1RT3A 2KW4A 1Q9XA 3T19A 4CF0A 3OYNA 1NKEA 4CJSA 3JYTA 3EY1A 4ZTFA 1RT4A 4KREA 1YT3A 1SL2A 3WNGA 1EXQA 4PUOA 1JLGA 2YHAA 4CJWA 3P1GA 3NDKA 4O5BA 1F21A 1HJRA 4FLZA 4DQRA 1U48A 1O1WA 4DTOA 4C8OA 4DTUA 2D0CA 1Q8IA 1VSIA 1ZBFA 5J2PA 4Y1CA 4CEAA 1N6QA 3KTQA 2VWKA 4OGCA 1VSFA 1ZBIA 3O3GA 4OLAA 1TGOA 1HNIA 3AA4A 3T1AA 3LP2A 5HBMA 2R7YA 4C8KA 4FJGA 3C95A 2ETJA 3VQBA 3RMDA 1YTUA 1ZBUA 3DMJA 3RTVA 4CHZA 3KIOA 1KTQA 3DYAA 4KB0A 4KV8A 1FKPA 1QE1A 4H4OA 4CFDA 1XI1A 3SPZA 3L2WA 4NCBA 5FDLA 4JLHA 4WE1A 2G8FA 1HPZA 3AVKA 4N5SA 3ITHA 4E1MA 2HNYA 3DLBA 4CGGA 2W42A 4B08A 4FJ9A 5HLFA 4E19A 3KLGA 3AA2A 1X9SA 3SQ2A 1RTIA 5SZTA 3HXMA 1X1PA 1K6YA 3K59A 3C6UA 4RG8A 1BI4A 3TAMA 3V4IA 3TI0A 3QIPA 4YNQA 3NH2A 3I8DA 4M3RA 4N76A 4AHRA 3SYZA 1Y97A 3IS9A 3I0RA 4CHYA 4ZTJA 1JLAA 1KLMA 3CYMA 4DG1A 1TV6A 5KGXA 3SUOA 2Q3SA 4G1QA 1TK0A 4F3OA 3VN5A 3LAMA 3AO5A 4B9UA 2ZE2A 1C1BA 3MAQA 4CHQA 1LV5A 1TL3A 1DLOA 2GUIA 3OS0A 4E0DA 3VA0A 1S6PA 4HCBA 4CEDA 4FJ8A 2KTQA 2JGUA 4CJEA 4HVJA 1LW2A 1UWBA 1C0UA 3S3MA 2PY5A 1TKTA 1GOCA 1CXUA 1RDDA 3VQ9A 5HRSA 4CJFA 4DSIA 2BDPA 4HCCA 4AHSA 5HROA 1NOZA 3S3NA 4GVMA 3HPOA 3V9UA 3L2UA 3NCIA 1Q9YA 3SJJA 3RMCA 3KLEA 4FLXA 1JLBA 3ZT4A 5J1EA 1RTDA 4OPKA 3BDPA 1UAXA 1KFDA 4YFUA 4CJQA 1RILA 1RBTA 1BCOA 3V1OA 4DLGA 5JS1A 4DLEA 3OYAA 4CCHA 2KFZA 2IOCA 4RW6A 1KSPA 4KTQA 2HHSA 1J9AA 4FJNA 2YNGA 2D0BA 4FLWA 2YHBA 1WNSA 5CYMA 2IAJA 1ZBLA 3LALA 3KK3A 3DLGA 4CEOA 1VSMA 2HVHA 4GW6A 3OYEA 2Y1IA 1VSEA 1VRTA 1JXEA 2BANA 2G8VA 2X6NA 3ASMA 1S9EA 1FKOA 4CJUA 3HSTB 3HJFA 3SQ4A 3LAKA 4CHNA 4CJ3A 4CECA 2DTUA 1BL3A 1BGXT 3HVRA 1RBVA 4OVLA 3ZSQA 3DOKA 3CG7A 3NFAA 4W5RA 2G8HA 4B9SA 2GBZA 3NAEA 1HYSA 5I42A 1C6VA 1TVRA 3O3FA 1L3SA 3ZSOA 1QTMA 4E3SA 2PYLA 2JLEA 1VSDA 4CHPA 5J2QA 2OA8A 4LH4A 3H08A 4ID5A 4BDZA 4CIFA 5E41A 2YKMA 4FM1A 1TKXA 2XY8A 4DF8A 1TK5A 4FJKA 3HO1A 2HVIA 3K57A 1NK9A 4FJXA 5FRNA 4DQQA 1QSYA 1EP4A 3AV9A 3OYIA 5CYQA 3AVIA 2BE2A 3HPGA 4E7HA 4M3TA 2OPPA 1IKVA 1S1XA 2XRIA 1VSHA 3SUQA 4ID1A 2FBYA 3SNNA 3ZT0A 1LAWA 1G15A 1HNVA 1S1WA 4IG0A 4KHUA 4Z4GA 3O4QA 2D5RA 1BCMA 3OYLA 4E7IA 4KTWA 4CF1A 1BIUA 4MFBA 4JS5A 4I2QA 4F4KA 3AA3A 2BGGA 1B92A 1MU2A 2B5JA 3DLEA 3M8RA 4FK0A 3NH1A 3O4NA 4F2RA 4CJRA 2QK9A 3BGRA 2KZMA 4DTJA 4J2AA 4Y1DA 2G8WA 4FJIA 4W5NA 2QXFA 2HHQA 2DFFA 4J2EA 4DSKA 2FC0A 1NK7A 3CFOA 3DLHA 4FZXC 3AO3A 4CGHA 1NK8A 1EKEA 1IH7A 4KI4A 1RBSA 2A1RA 4H8KA 4L8RB 4CE9A 1U4BA 2Y1JA 2RN2A 3QO9A 1GOAA 4HHTA 2IDOA 3OYMA 4KTZA 3TANA 4QCLA 3ZSWA 4O44A 1TAUA 4CK2A 4ELTA 3LPTA 4EZ9A 1ASUA 3VQ5A 1RT5A 4EP5A 1RDBA 4AHVA 3K58A 5C25A 1HQEA 3AO2A 3WNHA 3RMAA 2FBTA 1IO2A 1WSIA 3NBPA 1U45A 2E6LA 1DTTA 1FK9A 1S5JA 1JLFA 3P83D 1RTHA 4CIEA 3OYGA 4AHTA 1TAQA 3SV3A 5HP1A 3IRXA 3QNNA 4DMNA 1UA1A 4FZZA 4B9VA 4M3ZA 2X6SA 2HHVA 5HRPA 1BHLA 2OPRA 4HUEA 1TL1A 1WSGA 4O0JA 2GV9A 3NF6A 1S6QA 1IKXA 3ZSRA 1YVUA 4FM0A 4FCYA 1D9FA 4Z4EA 4NCAA 1JL2A 3QNOA 3AA5X 1ITGA 3G10A 1LWEA 3ZT2A 1Z25A 3SUNA 1W9HA 3NF9A 3M8QA 4OKEA 4CF2A 3KLHA 1SV5A 3ZSVA 3OYJA 3SZ2A 3U3YA 2HHUA 3TAGA 5KTQA 2XY5A 2OPSA 3OY9A 3PUFA 4KI6A 4CJPA 3MECA 5HRRA 1SUQA 2ZD1A 4C8MA 3SV4A 3QINA 1SL1A 1D5AA 4M41A 3VQCA 2RPIA 3HPHA 1BISA 1S1UA 2OZMA 4FJ7A 3KLFA 3ZSZA 4AHCA 3OS2A 4AHUA 2KZZA 3C6TA 3VQPA 4DFKA 1JLEA 4ELVA 4NCGA 4FJ5A 1BQMA 4FJMA 1D8YA 3K5LA 4DFMA 3LPUA 5I3UA 1A5XA 4N47A 3AVNA 3MXMA 4M3UA 2Z1GA 3P5JA 3QEPA 3CFPA 5DK5A 1BIZA 1KVAA 3F9KA 4F2SA 3TWHA 1A5VA 3M8SA 4CGDA 4E1NA 3SCXA 4BDPA 1RT1A 4DTNA 2IGIA 3LZIA 1X9MA 4KPYA 3S9HA 3MEEA 2Z1HA 1VSLA 1HMVA 3K5NA 2F8SA 4B9LA 4KHQA 1JXBA 3L2RA 3VQQA 1S1VA 5C24A 3DRPA 3VQEA 3HL8A 3G0ZA 4O0IA 4DQPA 4DQIA 3K2PA 1XC9A 1D9DA 1T7PA 5CZ1A 1A5WA 5EU7A 4CEBA 4CHOA 3LDSA 4DQSA 2DFEA 2PYJA 2AJQA 1L3TA 1ASWA 3HM9A 3QEXA 3TAFA 2QKBA 5CZ2A 3SQ1A 4DTSA 4IFVA 4IDKA 4CFAA 3RRHA 5HRNA 1SKRA 3NF8A 2HHXA 1B9DA 4DTXA 3DLRA 3DOLA 4HUGA 2G8KA 3KKSA 3VQ8A 1CXQA 1ZBHA 5JS2A 4E89A 1KCFA 3HYFA 4PA1A 3KD5E 1UOCA 4M42A 1CZBA 3ZT1A 4HTUA 3T3FA 2WOMA 1B9FA 2ZQBA 3ZT3A 4DU4A 4DU3A 4M3XA 1REVA 1U04A 4KHSA 4RW4A 1X9WA 3OYKA 2YKNA 3OJUA 3MEDA 2OYQA 3ISNC 4CK1A 4LH5A 3OYBA 3KKRA 1WLJA 2F8TA 3QETA 3L2QA 4AILC 4CGJA 4RW9A 4CFCA 2HB5A 2Z1JA 1YTAA 4Z4HA 4DS4A 2PZSA 2HNDA 4IKFA 1S9GA 3V6DA 4F8RA 1XHZA 1TK8A 4Z4CA 3CM6A 3JSMA 3S3OA 1J53A 2G8UA 4B9NA 2XO7A 1NK4A 4F3TA 2RKIA 3SI6A 2HMIA 2O4GA 1R0AA 1NK0A 2RF2A 4OKKA 4OKJA 3AO4A 1GOBA 1SKWA 3DI6A 4ICLA 3PV8A 3SUPA 5CY4A 1BQNA 4BWJA 5DMRA 4FJJA 3ZSYA 1EX4A 4OPJA 2YNHA 4AH9A 4FM2A 1IKYA 4KO0A 3AVAA 3F73A 4E7LA 1ASVA 2OPQA 3LWLA 3AVHA 2KFNA 1RT2A 3QEIA 4B9TA 3RR8A 1RDAA 3LZJA 2X74A 5SWMA 4DSLA 4N56A 1T8EA 2D0AA 2NUBA 4CJLA 4FVMA 3AVBA 4BWMA 4JRPA 1C0MA 4DTRA 4FJLA 4M3WA 2VWJA 3V9XA 3SPYA 4DSJA 3KLIA 3V9SA 1I39A 4W5QA 3KD1E 4LSLA 3HP9A 3UIQA 3QEVA 3IG1A 4DTMA 4OGEA 1HYVA 4CEQA 4I2PA 3QEWA 3IAYA 5FRMA 4CF9A 4KHWA 4PQUA 1IG9A 4CJTA 5J2NA 2DY4A 2O4IA 3NH0A 1VSKA 2ITGA 4C8NA 2E4LA 4CESA 5FROA 4BACA 4CJ5A 3LP3A 3V81A 4DTPA 3PX0A 4OJRA 3CQ8A 5J2MA 2XY6A 2HHTA 1BI4B 4CF8A 4EP4A 1HRHA 4BDYA 3VQDA 3QIOA 4R5PA 1Z26A 4E7KA 3LP0A 1TKDA 4KHNA 3B6OA 4BE2A 4BE0A 4FLTA 4Z4FA 3L8BA 3A2FA 4I9QA 2QKKA 3L2VA 3M8PA 3MXJA 3OYCA 4ELUA 4KRFA 3OYHA 4FLUA 3ALYA 3SQ0A 1UA0A 4KB1A 3DRRA 1XWLA 3LANA 4I7FA 3U3GA 3V1RA 1NKCA 4EZ6A 4B3OA 3KJVA 1NJZA 3AVFA 3EZ5A 4DFPA 3HP6A 1LWFA 3HK2A 4CK3A 3TABA 1RT7A 4KFBA 3PO4A 4CJ4A 1WSFA 4N41A 2B6AA 1J54A 2VG6A 2EHGA 4RW7A 1JLCA 3D45A 4W5OA 2HW3A 4KKOA 3CFRA 3V9ZA 2FBXA 3L3VA 3OJSA 1WSJA 1WN7A 4FW2A 1FXXA 1IKWA 4B8CA 1NJYA 4FW1A 4JS4A 1NOYA 3MXIA 3OVNA 4CGIA 1EETA 3AVJA 3L3UA 4XIUA 4LY7A 3KK1A 4DU1A 3RMBA 3WNEA 1RT6A 3U6FA 3PX6A 2VG7A 4PY5A 4MQ3A 4LSNA 4BE1A 1JLQA 1SKSA 1KVCA 3FFIA 4B8AB 1U49A 2WONA 3OYDA 1LAVA 2HNZA 3NE6A 4JRQA 3VA3A 4B9MA 4FJHA 2X78A 4DFJA 1SL0A 3K5OA 2ATQA 3AVMA 1RTJA 4IBNA 3TAQA 2G8IA 2Z1IA 4OLBA 4FXDA 4J2DA 4CJVA 5KI6A 2P1JA 3CM5A 1DTQA 1QS4A 3DM2A 3ZCMA 5C42A 4Q5VA 1U47A 2OZSA 4KHYA 4FK4A 1VK0A 1VSJA 1WAJA 1KVBA 1W0HA 2F96A 3LP1A 4I9LA 4FLYA 1NKBA 2P5GA 4K8XA 1C1AA 3ULDA 4DSFA 1JL1A 1QQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3A A;  3AVL A;  4NYF A;  4FK2 A;  2I5J A;  4CER A;  3RR7 A;  3QLH A;  4O4G A;  4DWI A;  3THV A;  3RRG A;  1CLQ A;  1WSE A;  3PY8 A;  5KGW A;  3TAE A;  1S1T A;  1NJW A;  4NYN A;  1XHX A;  1C1C A;  2FBV A;  4FYD A;  4W5T A;  2XY7 A;  3D0P A;  1KFS A;  2YNI A;  4QAG A;  4E7J A;  5T7B A;  2IS3 A;  2VG5 A;  1T05 A;  3VQA A;  3E01 A;  1JKH A;  1WAF A;  5KRS A;  2DFH A;  3WNF A;  4QOZ B;  4Z4I A;  3C94 A;  3NGI A;  3DLK A;  4J2B A;  1C0T A;  2HHW A;  4CIG A;  3NGY A;  4M3Y A;  1L5U A;  1ZYQ A;  3LWM A;  2YNF A;  3TAP A;  3K5M A;  1NK5 A;  3B6P A;  4LD0 A;  4IG3 A;  2LSN A;  3ZSX A;  4DF4 A;  4DSE A;  3VQ6 A;  3QER A;  3PX4 A;  3PO5 A;  4CEE A;  3RWU A;  1TKZ A;  1KRP A;  3MEG A;  4IFY A;  4DS5 A;  3TR8 A;  1J5O A;  2IC3 A;  1N5Y A;  3HVT A;  3NHG A;  4K8Z A;  3NGZ A;  5D3G A;  3V1Q A;  3DRS A;  4H4M A;  1LW0 A;  2YV0 X;  3AVG A;  3VQ4 A;  4UQG A;  4Z0U A;  3HT3 A;  4FZY A;  3NF7 A;  2E6M A;  1KLN A;  3AO1 A;  3O3H A;  4TSX A;  3V9W A;  1NJX A;  4PWD A;  3OS1 A;  4M45 A;  3KK2 A;  4CEZ A;  1RNH A;  4FLV A;  3I0S A;  4Q0B A;  1RBR A;  1VRU A;  4CGF A;  3EYZ A;  1RCH A;  1WSH A;  4O55 A;  5K14 A;  1L3V A;  1HYZ A;  3TAR A;  3OYF A;  1L3U A;  1QSL A;  3VQ7 A;  4CEF A;  2P5O A;  3QES A;  1RBU A;  4HUF A;  1HQU A;  2B4J A;  3AVC A;  1RDC A;  1QSS A;  2A1S A;  2XHB A;  4C8L A;  1CZ9 A;  1NK6 A;  4CJK A;  1T03 A;  4RW8 A;  1LWC A;  4GMJ B;  2P51 A;  5KRT A;  4ZHR A;  2EX3 A;  4CFB A;  4KAZ A;  1QHT A;  2KQ2 A;  1RT3 A;  2KW4 A;  1Q9X A;  3T19 A;  4CF0 A;  3OYN A;  1NKE A;  4CJS A;  3JYT A;  3EY1 A;  4ZTF A;  1RT4 A;  4KRE A;  1YT3 A;  1SL2 A;  3WNG A;  1EXQ A;  4PUO A;  1JLG A;  2YHA A;  4CJW A;  3P1G A;  3NDK A;  4O5B A;  1F21 A;  1HJR A;  4FLZ A;  4DQR A;  1U48 A;  1O1W A;  4DTO A;  4C8O A;  4DTU A;  2D0C A;  1Q8I A;  1VSI A;  1ZBF A;  5J2P A;  4Y1C A;  4CEA A;  1N6Q A;  3KTQ A;  2VWK A;  4OGC A;  1VSF A;  1ZBI A;  3O3G A;  4OLA A;  1TGO A;  1HNI A;  3AA4 A;  3T1A A;  3LP2 A;  5HBM A;  2R7Y A;  4C8K A;  4FJG A;  3C95 A;  2ETJ A;  3VQB A;  3RMD A;  1YTU A;  1ZBU A;  3DMJ A;  3RTV A;  4CHZ A;  3KIO A;  1KTQ A;  3DYA A;  4KB0 A;  4KV8 A;  1FKP A;  1QE1 A;  4H4O A;  4CFD A;  1XI1 A;  3SPZ A;  3L2W A;  4NCB A;  5FDL A;  4JLH A;  4WE1 A;  2G8F A;  1HPZ A;  3AVK A;  4N5S A;  3ITH A;  4E1M A;  2HNY A;  3DLB A;  4CGG A;  2W42 A;  4B08 A;  4FJ9 A;  5HLF A;  4E19 A;  3KLG A;  3AA2 A;  1X9S A;  3SQ2 A;  1RTI A;  5SZT A;  3HXM A;  1X1P A;  1K6Y A;  3K59 A;  3C6U A;  4RG8 A;  1BI4 A;  3TAM A;  3V4I A;  3TI0 A;  3QIP A;  4YNQ A;  3NH2 A;  3I8D A;  4M3R A;  4N76 A;  4AHR A;  3SYZ A;  1Y97 A;  3IS9 A;  3I0R A;  4CHY A;  4ZTJ A;  1JLA A;  1KLM A;  3CYM A;  4DG1 A;  1TV6 A;  5KGX A;  3SUO A;  2Q3S A;  4G1Q A;  1TK0 A;  4F3O A;  3VN5 A;  3LAM A;  3AO5 A;  4B9U A;  2ZE2 A;  1C1B A;  3MAQ A;  4CHQ A;  1LV5 A;  1TL3 A;  1DLO A;  2GUI A;  3OS0 A;  4E0D A;  3VA0 A;  1S6P A;  4HCB A;  4CED A;  4FJ8 A;  2KTQ A;  2JGU A;  4CJE A;  4HVJ A;  1LW2 A;  1UWB A;  1C0U A;  3S3M A;  2PY5 A;  1TKT A;  1GOC A;  1CXU A;  1RDD A;  3VQ9 A;  5HRS A;  4CJF A;  4DSI A;  2BDP A;  4HCC A;  4AHS A;  5HRO A;  1NOZ A;  3S3N A;  4GVM A;  3HPO A;  3V9U A;  3L2U A;  3NCI A;  1Q9Y A;  3SJJ A;  3RMC A;  3KLE A;  4FLX A;  1JLB A;  3ZT4 A;  5J1E A;  1RTD A;  4OPK A;  3BDP A;  1UAX A;  1KFD A;  4YFU A;  4CJQ A;  1RIL A;  1RBT A;  1BCO A;  3V1O A;  4DLG A;  5JS1 A;  4DLE A;  3OYA A;  4CCH A;  2KFZ A;  2IOC A;  4RW6 A;  1KSP A;  4KTQ A;  2HHS A;  1J9A A;  4FJN A;  2YNG A;  2D0B A;  4FLW A;  2YHB A;  1WNS A;  5CYM A;  2IAJ A;  1ZBL A;  3LAL A;  3KK3 A;  3DLG A;  4CEO A;  1VSM A;  2HVH A;  4GW6 A;  3OYE A;  2Y1I A;  1VSE A;  1VRT A;  1JXE A;  2BAN A;  2G8V A;  2X6N A;  3ASM A;  1S9E A;  1FKO A;  4CJU A;  3HST B;  3HJF A;  3SQ4 A;  3LAK A;  4CHN A;  4CJ3 A;  4CEC A;  2DTU A;  1BL3 A;  1BGX T;  3HVR A;  1RBV A;  4OVL A;  3ZSQ A;  3DOK A;  3CG7 A;  3NFA A;  4W5R A;  2G8H A;  4B9S A;  2GBZ A;  3NAE A;  1HYS A;  5I42 A;  1C6V A;  1TVR A;  3O3F A;  1L3S A;  3ZSO A;  1QTM A;  4E3S A;  2PYL A;  2JLE A;  1VSD A;  4CHP A;  5J2Q A;  2OA8 A;  4LH4 A;  3H08 A;  4ID5 A;  4BDZ A;  4CIF A;  5E41 A;  2YKM A;  4FM1 A;  1TKX A;  2XY8 A;  4DF8 A;  1TK5 A;  4FJK A;  3HO1 A;  2HVI A;  3K57 A;  1NK9 A;  4FJX A;  5FRN A;  4DQQ A;  1QSY A;  1EP4 A;  3AV9 A;  3OYI A;  5CYQ A;  3AVI A;  2BE2 A;  3HPG A;  4E7H A;  4M3T A;  2OPP A;  1IKV A;  1S1X A;  2XRI A;  1VSH A;  3SUQ A;  4ID1 A;  2FBY A;  3SNN A;  3ZT0 A;  1LAW A;  1G15 A;  1HNV A;  1S1W A;  4IG0 A;  4KHU A;  4Z4G A;  3O4Q A;  2D5R A;  1BCM A;  3OYL A;  4E7I A;  4KTW A;  4CF1 A;  1BIU A;  4MFB A;  4JS5 A;  4I2Q A;  4F4K A;  3AA3 A;  2BGG A;  1B92 A;  1MU2 A;  2B5J A;  3DLE A;  3M8R A;  4FK0 A;  3NH1 A;  3O4N A;  4F2R A;  4CJR A;  2QK9 A;  3BGR A;  2KZM A;  4DTJ A;  4J2A A;  4Y1D A;  2G8W A;  4FJI A;  4W5N A;  2QXF A;  2HHQ A;  2DFF A;  4J2E A;  4DSK A;  2FC0 A;  1NK7 A;  3CFO A;  3DLH A;  4FZX C;  3AO3 A;  4CGH A;  1NK8 A;  1EKE A;  1IH7 A;  4KI4 A;  1RBS A;  2A1R A;  4H8K A;  4L8R B;  4CE9 A;  1U4B A;  2Y1J A;  2RN2 A;  3QO9 A;  1GOA A;  4HHT A;  2IDO A;  3OYM A;  4KTZ A;  3TAN A;  4QCL A;  3ZSW A;  4O44 A;  1TAU A;  4CK2 A;  4ELT A;  3LPT A;  4EZ9 A;  1ASU A;  3VQ5 A;  1RT5 A;  4EP5 A;  1RDB A;  4AHV A;  3K58 A;  5C25 A;  1HQE A;  3AO2 A;  3WNH A;  3RMA A;  2FBT A;  1IO2 A;  1WSI A;  3NBP A;  1U45 A;  2E6L A;  1DTT A;  1FK9 A;  1S5J A;  1JLF A;  3P83 D;  1RTH A;  4CIE A;  3OYG A;  4AHT A;  1TAQ A;  3SV3 A;  5HP1 A;  3IRX A;  3QNN A;  4DMN A;  1UA1 A;  4FZZ A;  4B9V A;  4M3Z A;  2X6S A;  2HHV A;  5HRP A;  1BHL A;  2OPR A;  4HUE A;  1TL1 A;  1WSG A;  4O0J A;  2GV9 A;  3NF6 A;  1S6Q A;  1IKX A;  3ZSR A;  1YVU A;  4FM0 A;  4FCY A;  1D9F A;  4Z4E A;  4NCA A;  1JL2 A;  3QNO A;  3AA5 X;  1ITG A;  3G10 A;  1LWE A;  3ZT2 A;  1Z25 A;  3SUN A;  1W9H A;  3NF9 A;  3M8Q A;  4OKE A;  4CF2 A;  3KLH A;  1SV5 A;  3ZSV A;  3OYJ A;  3SZ2 A;  3U3Y A;  2HHU A;  3TAG A;  5KTQ A;  2XY5 A;  2OPS A;  3OY9 A;  3PUF A;  4KI6 A;  4CJP A;  3MEC A;  5HRR A;  1SUQ A;  2ZD1 A;  4C8M A;  3SV4 A;  3QIN A;  1SL1 A;  1D5A A;  4M41 A;  3VQC A;  2RPI A;  3HPH A;  1BIS A;  1S1U A;  2OZM A;  4FJ7 A;  3KLF A;  3ZSZ A;  4AHC A;  3OS2 A;  4AHU A;  2KZZ A;  3C6T A;  3VQP A;  4DFK A;  1JLE A;  4ELV A;  4NCG A;  4FJ5 A;  1BQM A;  4FJM A;  1D8Y A;  3K5L A;  4DFM A;  3LPU A;  5I3U A;  1A5X A;  4N47 A;  3AVN A;  3MXM A;  4M3U A;  2Z1G A;  3P5J A;  3QEP A;  3CFP A;  5DK5 A;  1BIZ A;  1KVA A;  3F9K A;  4F2S A;  3TWH A;  1A5V A;  3M8S A;  4CGD A;  4E1N A;  3SCX A;  4BDP A;  1RT1 A;  4DTN A;  2IGI A;  3LZI A;  1X9M A;  4KPY A;  3S9H A;  3MEE A;  2Z1H A;  1VSL A;  1HMV A;  3K5N A;  2F8S A;  4B9L A;  4KHQ A;  1JXB A;  3L2R A;  3VQQ A;  1S1V A;  5C24 A;  3DRP A;  3VQE A;  3HL8 A;  3G0Z A;  4O0I A;  4DQP A;  4DQI A;  3K2P A;  1XC9 A;  1D9D A;  1T7P A;  5CZ1 A;  1A5W A;  5EU7 A;  4CEB A;  4CHO A;  3LDS A;  4DQS A;  2DFE A;  2PYJ A;  2AJQ A;  1L3T A;  1ASW A;  3HM9 A;  3QEX A;  3TAF A;  2QKB A;  5CZ2 A;  3SQ1 A;  4DTS A;  4IFV A;  4IDK A;  4CFA A;  3RRH A;  5HRN A;  1SKR A;  3NF8 A;  2HHX A;  1B9D A;  4DTX A;  3DLR A;  3DOL A;  4HUG A;  2G8K A;  3KKS A;  3VQ8 A;  1CXQ A;  1ZBH A;  5JS2 A;  4E89 A;  1KCF A;  3HYF A;  4PA1 A;  3KD5 E;  1UOC A;  4M42 A;  1CZB A;  3ZT1 A;  4HTU A;  3T3F A;  2WOM A;  1B9F A;  2ZQB A;  3ZT3 A;  4DU4 A;  4DU3 A;  4M3X A;  1REV A;  1U04 A;  4KHS A;  4RW4 A;  1X9W A;  3OYK A;  2YKN A;  3OJU A;  3MED A;  2OYQ A;  3ISN C;  4CK1 A;  4LH5 A;  3OYB A;  3KKR A;  1WLJ A;  2F8T A;  3QET A;  3L2Q A;  4AIL C;  4CGJ A;  4RW9 A;  4CFC A;  2HB5 A;  2Z1J A;  1YTA A;  4Z4H A;  4DS4 A;  2PZS A;  2HND A;  4IKF A;  1S9G A;  3V6D A;  4F8R A;  1XHZ A;  1TK8 A;  4Z4C A;  3CM6 A;  3JSM A;  3S3O A;  1J53 A;  2G8U A;  4B9N A;  2XO7 A;  1NK4 A;  4F3T A;  2RKI A;  3SI6 A;  2HMI A;  2O4G A;  1R0A A;  1NK0 A;  2RF2 A;  4OKK A;  4OKJ A;  3AO4 A;  1GOB A;  1SKW A;  3DI6 A;  4ICL A;  3PV8 A;  3SUP A;  5CY4 A;  1BQN A;  4BWJ A;  5DMR A;  4FJJ A;  3ZSY A;  1EX4 A;  4OPJ A;  2YNH A;  4AH9 A;  4FM2 A;  1IKY A;  4KO0 A;  3AVA A;  3F73 A;  4E7L A;  1ASV A;  2OPQ A;  3LWL A;  3AVH A;  2KFN A;  1RT2 A;  3QEI A;  4B9T A;  3RR8 A;  1RDA A;  3LZJ A;  2X74 A;  5SWM A;  4DSL A;  4N56 A;  1T8E A;  2D0A A;  2NUB A;  4CJL A;  4FVM A;  3AVB A;  4BWM A;  4JRP A;  1C0M A;  4DTR A;  4FJL A;  4M3W A;  2VWJ A;  3V9X A;  3SPY A;  4DSJ A;  3KLI A;  3V9S A;  1I39 A;  4W5Q A;  3KD1 E;  4LSL A;  3HP9 A;  3UIQ A;  3QEV A;  3IG1 A;  4DTM A;  4OGE A;  1HYV A;  4CEQ A;  4I2P A;  3QEW A;  3IAY A;  5FRM A;  4CF9 A;  4KHW A;  4PQU A;  1IG9 A;  4CJT A;  5J2N A;  2DY4 A;  2O4I A;  3NH0 A;  1VSK A;  2ITG A;  4C8N A;  2E4L A;  4CES A;  5FRO A;  4BAC A;  4CJ5 A;  3LP3 A;  3V81 A;  4DTP A;  3PX0 A;  4OJR A;  3CQ8 A;  5J2M A;  2XY6 A;  2HHT A;  1BI4 B;  4CF8 A;  4EP4 A;  1HRH A;  4BDY A;  3VQD A;  3QIO A;  4R5P A;  1Z26 A;  4E7K A;  3LP0 A;  1TKD A;  4KHN A;  3B6O A;  4BE2 A;  4BE0 A;  4FLT A;  4Z4F A;  3L8B A;  3A2F A;  4I9Q A;  2QKK A;  3L2V A;  3M8P A;  3MXJ A;  3OYC A;  4ELU A;  4KRF A;  3OYH A;  4FLU A;  3ALY A;  3SQ0 A;  1UA0 A;  4KB1 A;  3DRR A;  1XWL A;  3LAN A;  4I7F A;  3U3G A;  3V1R A;  1NKC A;  4EZ6 A;  4B3O A;  3KJV A;  1NJZ A;  3AVF A;  3EZ5 A;  4DFP A;  3HP6 A;  1LWF A;  3HK2 A;  4CK3 A;  3TAB A;  1RT7 A;  4KFB A;  3PO4 A;  4CJ4 A;  1WSF A;  4N41 A;  2B6A A;  1J54 A;  2VG6 A;  2EHG A;  4RW7 A;  1JLC A;  3D45 A;  4W5O A;  2HW3 A;  4KKO A;  3CFR A;  3V9Z A;  2FBX A;  3L3V A;  3OJS A;  1WSJ A;  1WN7 A;  4FW2 A;  1FXX A;  1IKW A;  4B8C A;  1NJY A;  4FW1 A;  4JS4 A;  1NOY A;  3MXI A;  3OVN A;  4CGI A;  1EET A;  3AVJ A;  3L3U A;  4XIU A;  4LY7 A;  3KK1 A;  4DU1 A;  3RMB A;  3WNE A;  1RT6 A;  3U6F A;  3PX6 A;  2VG7 A;  4PY5 A;  4MQ3 A;  4LSN A;  4BE1 A;  1JLQ A;  1SKS A;  1KVC A;  3FFI A;  4B8A B;  1U49 A;  2WON A;  3OYD A;  1LAV A;  2HNZ A;  3NE6 A;  4JRQ A;  3VA3 A;  4B9M A;  4FJH A;  2X78 A;  4DFJ A;  1SL0 A;  3K5O A;  2ATQ A;  3AVM A;  1RTJ A;  4IBN A;  3TAQ A;  2G8I A;  2Z1I A;  4OLB A;  4FXD A;  4J2D A;  4CJV A;  5KI6 A;  2P1J A;  3CM5 A;  1DTQ A;  1QS4 A;  3DM2 A;  3ZCM A;  5C42 A;  4Q5V A;  1U47 A;  2OZS A;  4KHY A;  4FK4 A;  1VK0 A;  1VSJ A;  1WAJ A;  1KVB A;  1W0H A;  2F96 A;  3LP1 A;  4I9L A;  4FLY A;  1NKB A;  2P5G A;  4K8X A;  1C1A A;  3ULD A;  4DSF A;  1JL1 A;  1QQC A; 
#chains in the Genus database with same CATH topology
 1NGB A;  1I3A A;  3AVL A;  4FK2 A;  1CLQ A;  3KK7 A;  4HWI A;  3PY8 A;  1NJW A;  5FPE A;  3DJC A;  4H0Y B;  3LDQ A;  2VG5 A;  3WNF A;  3MWP A;  4JI4 K;  4DUZ K;  3O9U A;  3NGI A;  2HHW A;  4CIG A;  3NGY A;  4BGB A;  1L5U A;  3LWM A;  2YNF A;  3TAP A;  3K5M A;  3B6P A;  4IG3 A;  5LMU K;  4DSE A;  1O13 A;  3PX4 A;  3RWU A;  1TKZ A;  1KRP A;  4DS5 A;  5D3G A;  2IC3 A;  1N5Y A;  4QS8 A;  1LW0 A;  3VQ4 A;  4FZY A;  2RE2 A;  2YJE A;  4PWD A;  3OS1 A;  2IVO A;  4FPA A;  4CEZ A;  3VEW A;  1RBR A;  3CCM N;  5AQH A;  4O55 A;  1L3V A;  1QSL A;  1HYZ A;  2RHK A;  4WYB A;  3WUH A;  1S72 N;  4HUF A;  1HQU A;  1RDC A;  1GLD G;  1T03 A;  4GMJ B;  5KRT A;  4ZHR A;  4CFB A;  2Q0R A;  5LMN K;  2KQ2 A;  3CJ1 A;  4JI2 K;  4CZI A;  3OA9 A;  4MLH A;  4PUO A;  3ENO A;  1HJR A;  1S22 A;  4DQR A;  4A59 A;  1Q8I A;  1SAZ A;  1KXP A;  5J2P A;  1VSF A;  2ZJR L;  3BF1 A;  2O8C A;  3EEQ A;  4OLA A;  4NXN K;  3LP2 A;  4C8K A;  3SMP A;  3RMD A;  3OW2 M;  1Z05 A;  1YTU A;  3O80 A;  3RTV A;  1VHX A;  1KTQ A;  3DYA A;  3D2E A;  1T3V A;  4KV8 A;  1VQM N;  3SPZ A;  1K8A O;  4EFH A;  4WE1 A;  1HPZ A;  3AVK A;  4JV5 K;  4XEI A;  3CQX A;  3HXM A;  2F4V K;  1VQ8 N;  1BI4 A;  3TAM A;  3V4I A;  3TI0 A;  4YNQ A;  3I8D A;  4M3R A;  4WFB L;  4ZTJ A;  1KLM A;  4F3O A;  4NLB A;  5KGX A;  1QQN A;  3UKU B;  4WQ5 A;  1NM1 A;  1V4T A;  1GLF O;  3L6Q A;  1TL3 A;  2GUI A;  4WFA L;  4JK9 A;  5AQU A;  4BRI A;  4BRE A;  1C0U A;  3S3M A;  1GOC A;  2ZJQ L;  4BG9 A;  4CJF A;  2V52 B;  3FZF A;  5HRO A;  4H5N A;  3V9U A;  2FXU A;  3NCI A;  4Y0W A;  1QZ6 A;  3CD6 N;  1RTD A;  3KWI A;  5BPM A;  1KFD A;  1RIL A;  3LDO A;  4YOU A;  4O8K A;  4RW6 A;  1T6D A;  2YNG A;  1WNS A;  4FPB A;  5CYM A;  2IAJ A;  1RGI A;  1ZBL A;  3DLG A;  3P31 A;  3EKU A;  4GW6 A;  1VRT A;  3MN9 A;  2X6N A;  1X3N A;  1S9E A;  1VQP N;  3RSE A;  3HST B;  3LAK A;  3WQT A;  3THY A;  2G8H A;  1RBV A;  3DOK A;  3NFA A;  1HR0 K;  3O9S A;  5I42 A;  1Z6R A;  1TVR A;  3ZSO A;  2PYL A;  5CHI A;  1VSD A;  4H0V B;  4LH4 A;  2QWN A;  4DF8 A;  3HO1 A;  4YOT A;  4FJX A;  4DQQ A;  1BA1 A;  1NMD A;  3AVI A;  2BE2 A;  2ASM A;  3HPG A;  3MWT A;  3SNN A;  3ZT0 A;  1D4X A;  1HNV A;  4Z4G A;  4KTW A;  4BRF A;  4CF1 A;  3DLE A;  1MU2 A;  3M8R A;  3O4N A;  4JYA K;  4J2A A;  4H0T B;  4Y1D A;  4G9Z A;  2G8W A;  2QXF A;  4BR5 A;  4O8U A;  1NK7 A;  4FZX C;  4YOX A;  1EKE A;  4KI4 A;  2WFB A;  4H8K A;  4L8R B;  1U4B A;  1G99 A;  2RN2 A;  3QO9 A;  4HHT A;  3WXL A;  4A5A A;  2HHH K;  3E1Y A;  3VOV A;  4QS9 A;  4JI8 K;  1TAU A;  5BRE A;  4CK2 A;  1YXQ A;  4ELT A;  1ASU A;  3VTI A;  1RDB A;  4AHV A;  4JN4 A;  1NGD A;  1U2V B;  1N36 K;  1FK9 A;  3P83 D;  5AQY A;  1TAQ A;  1UA1 A;  3KVG A;  4WCE L;  5HRP A;  4BRO A;  2UUA K;  4O0J A;  3CIP A;  5TKY A;  1YVU A;  4FCY A;  1JL2 A;  3D2F B;  3QNO A;  4CD1 A;  3G10 A;  3M8Q A;  4OKE A;  3ZSV A;  3M5R A;  5HRR A;  4XH4 A;  1SUQ A;  3QIN A;  3F2K A;  1D5A A;  5BRF A;  3VQC A;  2RPI A;  2OZM A;  2GEL A;  2E1Y A;  3ZSZ A;  4AHC A;  1WBB A;  3VEZ A;  4ELV A;  1CZA N;  4NCG A;  1BQM A;  1BWF O;  3JAM O;  3K5L A;  5I3U A;  1A5X A;  2VCP A;  4N47 A;  4M3U A;  3LM9 A;  4FWM A;  3QEP A;  5DK5 A;  1BIZ A;  1KVA A;  4F2S A;  3EE9 A;  1A5V A;  3SCX A;  4DTN A;  1X9M A;  3LZI A;  1SQK A;  2Z1H A;  4IDH A;  3CER A;  3K5N A;  5M1P A;  4DR7 K;  1JXB A;  2J4R A;  3J81 O;  2E2P A;  3QFU A;  3DXM A;  3M6G A;  2PBD A;  4O0I A;  4DQP A;  3O8M A;  4CZJ A;  1XC9 A;  1T7P A;  5EU7 A;  3TTD A;  3LDS A;  1KC8 O;  2Q1N A;  5M1Q A;  3ZYY X;  3TAF A;  1N33 K;  1X3M A;  3RRH A;  3QBX A;  2E5L K;  4AM7 A;  3IDH A;  3KKS A;  4LF6 K;  3VMF B;  4PA1 A;  1OH7 A;  3KD5 E;  3CCS N;  4JK8 A;  1XNR K;  5JVG L;  3T3F A;  1ILY A;  5C15 A;  4RW4 A;  1X9W A;  3H3N O;  2OYQ A;  4JKF A;  3ISN C;  4CK1 A;  4GY2 B;  3OYB A;  2F7T A;  1BDG A;  4IEI A;  1WLJ A;  1EWR A;  5F1X A;  4CGJ A;  1YTA A;  4DS4 A;  4IKF A;  4F8R A;  1XHZ A;  1TK8 A;  4Z4C A;  4FOI A;  3CC4 N;  1J53 A;  4F3T A;  2XO7 A;  4LF7 K;  2O4G A;  1R0A A;  2D0O A;  1NK0 A;  2RF2 A;  2ZWH A;  4OKJ A;  3AO4 A;  1SKW A;  3AGK A;  4CBW A;  4ICL A;  4FWS A;  4DV2 K;  2QI2 A;  5DMR A;  4DR1 K;  1ASV A;  4IZ9 A;  4UY8 O;  2YJF A;  1QQM A;  3FE1 A;  4DB3 A;  3AVB A;  3FFK B;  2NRZ A;  3D2E B;  3QEV A;  4DTM A;  5M1O A;  4CEQ A;  3UKR A;  3SBT A;  4KHW A;  1IG8 A;  2ITG A;  4K0K K;  2E4L A;  1HNW K;  5AZI B;  3V81 A;  1TYQ A;  3CQ8 A;  1BI4 B;  1HRH A;  2HOE A;  4BE2 A;  4BC4 A;  3HBT A;  2QKK A;  3L2V A;  3DRR A;  4B3O A;  4CVN E;  2YI1 A;  3KJV A;  3EZ5 A;  1YJ9 N;  1HKB A;  2O8D A;  5AQP A;  4N41 A;  1WSF A;  2HW3 A;  3FZM A;  3C6H A;  1MWM A;  5AZJ B;  3CFR A;  1KAZ A;  5ADX A;  1BOT O;  3C65 A;  4LF9 K;  3F5T A;  4B8C A;  4BVO A;  1EQY A;  2GTD A;  2YCH A;  1YVN A;  1EET A;  3AVJ A;  4DU1 A;  3KK1 A;  2OCE A;  4KH4 A;  2VG7 A;  4PY5 A;  4LSN A;  1JLQ A;  1M1K O;  1VQL N;  1SKS A;  3VEY A;  5LJV A;  3NE6 A;  4PKI A;  4EIA A;  4IJN A;  4X65 K;  1SL0 A;  1QVG M;  4X64 K;  2O8B A;  4FXD A;  3H46 O;  3RSE B;  4YOV A;  4Q5V A;  1U47 A;  1VK0 A;  1QZ5 A;  1VSJ A;  2P9N A;  3MN6 A;  4I9L A;  5E84 A;  2P5G A;  3THY B;  4CZL A;  3GL1 A;  1OVY A;  3Q7B A;  3JYT A;  4DV3 K;  2NNW A;  3KHY A;  1WUA A;  3THV A;  4DWI A;  4A5B A;  4OPA A;  2FBV A;  2EWS A;  4FYD A;  2XY7 A;  3QIC A;  1KFS A;  2YNI A;  4QAG A;  5T7B A;  3I55 N;  3VQA A;  1T05 A;  3E01 A;  4RTF D;  1JKH A;  1XC3 A;  4QOZ B;  3VF4 A;  4FWP A;  4NO7 A;  4B1V A;  1NK5 A;  1DKG D;  3BP8 A;  4DF4 A;  3VQ6 A;  4IOC L;  5AQT A;  3PO5 A;  4CZM A;  3MEG A;  1J5O A;  4K8Z A;  4IJA A;  3V1Q A;  5FLX O;  2CH5 A;  4FO0 A;  2YV0 X;  4UQG A;  1NGF A;  3NF7 A;  2E6M A;  1KLN A;  1NJX A;  3KK2 A;  3G6E N;  2Q0U A;  4ILH A;  4Q0B A;  5GIO A;  2A5X A;  4CGF A;  3P38 A;  3EYZ A;  4LFC K;  5K14 A;  3OYF A;  3VQ7 A;  3QES A;  1RBU A;  1RDU A;  5JIC A;  1CZ9 A;  1ESV A;  3FR0 A;  3CCQ N;  2EX3 A;  2NZT A;  3CC2 N;  1QHT A;  4GV6 A;  2KW4 A;  4ISF A;  3T19 A;  3EY1 A;  1RT4 A;  4OX9 K;  1YT3 A;  2YHY A;  1SL2 A;  4IOX A;  2YHA A;  3P1G A;  3NDK A;  4O5B A;  1F21 A;  4C8O A;  2D0C A;  1ZBF A;  3H6E A;  2WTU A;  2Q31 A;  4MDB A;  4IEE A;  4LFB K;  1HNI A;  3T1A A;  2R7Y A;  5HBM A;  2QWM A;  1ZBU A;  3DMJ A;  1HUX A;  2KHO A;  3EO3 A;  4PHT X;  5AQV A;  1IBL K;  4BRL A;  4H4O A;  3T69 A;  3L2W A;  3DLB A;  4E1M A;  4CGG A;  3VEO A;  4JHD A;  5BR8 K;  3KLG A;  1IJJ A;  4RG8 A;  3PIO L;  3T1H K;  3SYZ A;  1Y97 A;  3I0R A;  1JLA A;  3SUO A;  1Q9Y A;  1TV6 A;  4G1Q A;  1ZBS A;  3LAM A;  2P9P A;  3ULE B;  3C0B A;  1C1B A;  3MAQ A;  1NWK A;  4CHQ A;  3D7E O;  4DR5 K;  3OS0 A;  4E0D A;  4FJ8 A;  2E88 A;  3WXM B;  3DXM B;  3CCU N;  3G71 N;  2JGU A;  1UWB A;  3T7Z A;  4DSI A;  1Q18 A;  1HLU A;  4AHS A;  3HPO A;  4CI6 A;  3RMC A;  3KLE A;  4FWN A;  3J8A A;  3ZT4 A;  4GV9 A;  4OPK A;  2FF6 A;  4Z94 A;  5HL7 L;  3BDP A;  4JEP A;  4CJQ A;  2AA4 A;  1RBT A;  2FF3 B;  1BCO A;  3V1O A;  5KPR A;  4BGA A;  2IOC A;  2HHS A;  1NMN A;  2D0B A;  2YHB A;  3VEX A;  4FVU A;  3LAL A;  3KK3 A;  4GKK K;  4CEO A;  1VSM A;  1VQN N;  3OYE A;  1VSE A;  3GDQ A;  3PSF A;  3R6M A;  4MO5 A;  3ASM A;  4YOY A;  1YIJ N;  4CHN A;  1ATN A;  4CEC A;  1BGX T;  5FPM A;  1QHA A;  4B9S A;  2GBZ A;  4H0O A;  1L3S A;  3O3F A;  1VQO N;  2JLE A;  4CHP A;  2UYT A;  4ID5 A;  4JKC A;  4CIF A;  3CET A;  5E41 A;  2YKM A;  2Q97 A;  1TKX A;  1TK5 A;  3BY5 A;  2P9L A;  4FJK A;  2HVI A;  3K57 A;  1QSY A;  3VET A;  3AV9 A;  3MN7 A;  5CYQ A;  4NB4 A;  4M7X A;  1S1X A;  1VQK N;  1HX1 A;  5AQM A;  4BR2 A;  3UKR B;  1G15 A;  1S1W A;  4KHU A;  3OYL A;  1VQ6 N;  1BIU A;  4I2Q A;  3WXJ A;  2D0P A;  2IIR A;  1B92 A;  4ISG A;  3CPE A;  3NH1 A;  1TYQ B;  4DTJ A;  3CFO A;  4KBO A;  4H5R A;  1IH7 A;  2P9I A;  4CE9 A;  2P9U A;  3KZB A;  1BUP A;  3SLC A;  4KTZ A;  2I7N A;  4PL7 A;  3TAN A;  4QCL A;  5AR0 A;  4O44 A;  5C12 A;  1E4F T;  2E20 A;  3LPT A;  1BA0 A;  2A42 A;  4EZ9 A;  1FJG K;  3VQ5 A;  1Q81 O;  4BR7 A;  5C25 A;  1HQE A;  4FWO A;  4MLE A;  3RMA A;  2FBT A;  1WSI A;  3ZEU A;  4DR6 K;  1JLF A;  4LF8 K;  4O5F A;  4CIE A;  3ENB A;  3OYG A;  4AHT A;  3IRX A;  4DMN A;  2X6S A;  4HUE A;  1TL1 A;  4CBU A;  3NF6 A;  3R3L A;  1S6Q A;  1IKX A;  3EKS A;  1M90 O;  3O9Q A;  5AQF A;  4JI5 K;  4FSV A;  4JI7 K;  1ITG A;  3ZT2 A;  1Z25 A;  3O1B A;  3SUN A;  3KLH A;  3NF9 A;  3CC7 N;  4BC5 A;  1SV5 A;  2UUB K;  1GLB G;  4JKD A;  2W6L A;  2P9N B;  1SL1 A;  5BR9 A;  3QB0 A;  1S1U A;  4FJ7 A;  4AHU A;  3C6T A;  3VQP A;  1D8Y A;  3FZL A;  4DFM A;  4XH5 A;  3P5J A;  5JLF A;  4E1N A;  1ZXO A;  3E9O A;  4PKG A;  4K41 A;  4C1N K;  4DV7 K;  3VQQ A;  5C24 A;  3DRP A;  3HL8 A;  4BRG A;  1A5W A;  4U7B A;  1TUY A;  5H1S Q;  2DFE A;  4DQS A;  2PYJ A;  2AJQ A;  1L3T A;  2QKB A;  3HM9 A;  5CZ2 A;  3SQ1 A;  1N34 K;  4CFA A;  2O8F A;  1B9D A;  3DLL L;  3DLR A;  3DOL A;  3AY9 A;  4HUG A;  2G8K A;  5M1N A;  1ZBH A;  5JS2 A;  4E89 A;  2F9W A;  3HYF A;  5GIN A;  3ENH A;  4KH6 A;  3ZT1 A;  1NNE A;  4DU3 A;  4M3X A;  1JCG A;  4CZE A;  4KHS A;  3OBW A;  3HM8 A;  3KKR A;  3QET A;  3L2Q A;  5GAD P;  4AIL C;  4RW9 A;  1NGJ A;  1QQO A;  1YUW A;  3MCP A;  2A3Z A;  5AQG A;  3TTC A;  4DCH A;  4YDU A;  2RKI A;  4RWT A;  2HMI A;  4OKK A;  1LOT B;  5C2D A;  3DI6 A;  3PV8 A;  3SUP A;  3U8X A;  3ZSY A;  1EX4 A;  2YNH A;  3JXU A;  1JCE A;  2FSK A;  4KO0 A;  3AVA A;  1XQS C;  3K9J A;  4E7L A;  3LWL A;  2NLX A;  4B9T A;  3RR8 A;  5M1K A;  2X74 A;  4JAX A;  4B1Y B;  2NUB A;  4CJL A;  4FVM A;  4BWM A;  4DTR A;  4JRP A;  4FJL A;  2VWJ A;  1I39 A;  4W5Q A;  3IG1 A;  3EE8 A;  4I2P A;  5FRM A;  1YIT N;  1NGC A;  4CF9 A;  4PQU A;  1IG9 A;  4CJT A;  3NH0 A;  1VSK A;  4C8N A;  4U67 L;  4CES A;  1S3X A;  4JHD B;  4B3S K;  3TSU A;  4FOE A;  4DTP A;  3HTV A;  1NGI A;  3VQD A;  3QIO A;  4E7K A;  3PIP L;  4I9Q A;  4KRF A;  4FLU A;  3O1W A;  2P9P B;  5AQI A;  1XWL A;  3AAR A;  3AVF A;  3WEE B;  4BRD A;  2JWL A;  4DFP A;  1LWF A;  3HRG A;  4CK3 A;  3PO4 A;  1U6Z A;  2VG6 A;  5ELZ A;  5ADX H;  4BRC A;  5DM7 L;  4KKO A;  5AFU H;  3V9Z A;  2WC9 A;  3OJS A;  1WSJ A;  4FW2 A;  4H5V A;  1IKW A;  3E9L A;  4FW1 A;  5TKW A;  3OVN A;  3J7A P;  4CGI A;  4IOA L;  4FL9 A;  3L3U A;  4LY7 A;  4PKH A;  3MN5 A;  3U6F A;  4MQ3 A;  4BE1 A;  4JKB A;  3E9P A;  3FFI A;  3OYD A;  1IBK K;  3P39 A;  2BTF A;  4JKG A;  4B9M A;  4GV3 A;  1LCU A;  4AQY K;  2ATQ A;  3AVM A;  1RTJ A;  3ZLJ A;  3W0L A;  4J2D A;  3M3Z A;  5CR4 A;  3ZCM A;  3C7N A;  2OZS A;  4DR4 K;  1W0H A;  2F96 A;  4FLY A;  4DSF A;  1NGE A;  1QQC A;  4ISE A;  2I5J A;  4CER A;  3RR7 A;  4O4G A;  1IV0 A;  2DPN A;  4DV1 K;  1E3M A;  1XHX A;  1BG3 A;  4B1W B;  3J7Z O;  3MCA B;  2YHW A;  2P9L B;  2IS3 A;  5KRS A;  4A57 A;  4Z4I A;  3C94 A;  3DLK A;  3O08 A;  3K0S A;  4M3Y A;  2CGL A;  4DR2 K;  4JI1 K;  5GAE P;  1ZYQ A;  2QWO A;  1Q82 O;  2LSN A;  3QER A;  1DEJ A;  4CEE A;  3HVT A;  3NHG A;  3NGZ A;  3R1X A;  3DWL A;  2VWB A;  3DRS A;  4H4M A;  3AVG A;  4Z0U A;  5AQK A;  1MDU B;  2KLA A;  3AO1 A;  3O3H A;  4TSX A;  3V9W A;  5HOO A;  4M45 A;  1RNH A;  4OPH A;  3F9M A;  3DXK A;  4BRN A;  2OAN A;  3NVM A;  1RCH A;  2P5O A;  1L3U A;  2O8C B;  4CEF A;  3M1F A;  1N32 K;  1HNX K;  3AVC A;  4C8L A;  4CJK A;  4RW8 A;  1LWC A;  5IT9 O;  1RT3 A;  1Q9X A;  3OYN A;  4CJS A;  3ZET A;  1YI2 N;  4YDU C;  1FW6 A;  3IFR A;  4CJW A;  4DKW A;  4FLZ A;  1U48 A;  4DTO A;  1VSI A;  2D1K A;  3U9Z A;  1N6Q A;  3KTQ A;  2VWK A;  4OGC A;  4B3M K;  1ZBI A;  1W97 L;  5BRH A;  1TGO A;  3U9D A;  2HST A;  3CCV N;  5AQQ A;  3C95 A;  1YHQ N;  2Q2R A;  3VQB A;  1KQS M;  2WBN A;  1T6C A;  3KIO A;  4KB0 A;  4H03 B;  1W2B M;  1FKP A;  1QE1 A;  1XI1 A;  4H0P A;  4NCB A;  5FDL A;  3TSP A;  1H1V A;  2VGN A;  3MDQ A;  4N5S A;  3ITH A;  2HNY A;  5F2R A;  1XUP O;  4FJ9 A;  5SZT A;  1X1P A;  1K6Y A;  3QIP A;  5AFU A;  3NH2 A;  1BU6 O;  3W3D A;  4AHR A;  3GE1 A;  3IS9 A;  4DG1 A;  4X66 K;  2Q3S A;  1VQ7 N;  1VQ4 N;  3G25 A;  3WT0 A;  4B9U A;  1LV5 A;  3VA0 A;  1S6P A;  5DM6 L;  4CED A;  1Q86 O;  3OBY A;  4HVJ A;  1LW2 A;  1RDD A;  3VQ9 A;  3EL2 A;  2BDP A;  1C0G A;  4BRM A;  3VTH A;  3S3N A;  4GVM A;  5CE3 A;  5FPD A;  4DV4 K;  4KHP K;  2O8F B;  1JLB A;  4YOR A;  3CJ9 A;  3AAP A;  3CMA N;  2KFZ A;  1J5E K;  1KSP A;  4KTQ A;  3VGL A;  1J9A A;  4FJN A;  3AAQ A;  5AQJ A;  2VYP A;  4BG8 A;  4AM6 A;  1HNZ K;  2Y1I A;  1JXE A;  2BAN A;  2G8V A;  5AQZ A;  3SQ4 A;  3H3O B;  4CJ3 A;  2DTU A;  1BL3 A;  4OVL A;  1HYS A;  3NAE A;  2NRT A;  3ID8 A;  1QTM A;  5J2Q A;  3BF3 A;  3AGR A;  3MK6 A;  4A2A A;  3SK3 A;  3LM2 A;  5C0Y A;  3A5L C;  2HBM A;  3VEV A;  3R9P A;  3OYI A;  2XRI A;  3SUQ A;  4ID1 A;  2FBY A;  2QTD A;  3O9R A;  4X62 K;  2V51 B;  4CBX A;  4V19 S;  4IG0 A;  1OH8 A;  3O4Q A;  2D5R A;  4E7I A;  4ILJ A;  4F4K A;  3O6W A;  3SBG A;  2BGG A;  2QK9 A;  2KZM A;  3UB5 A;  2HHQ A;  2DFF A;  4J2E A;  3N4P A;  4CGH A;  3SAF A;  1RBS A;  2A1R A;  2Y1J A;  3D6R A;  3BUZ B;  3S41 A;  1GOA A;  1VQ5 N;  4IO9 L;  2IDO A;  2ASP A;  3OYM A;  3FLC O;  4K25 A;  1RT5 A;  3AO2 A;  3WNH A;  3CCR N;  3LDP A;  2E6L A;  3SAH A;  3SMS A;  2GEM A;  1DTT A;  2Q36 A;  1KAY A;  1WOQ A;  2H3G X;  3CCE N;  3C6A A;  4CJ7 A;  4M3Z A;  3CJC A;  2OPR A;  2GV9 A;  2YHX A;  3A0I X;  3ID6 A;  5F0X A;  4FM0 A;  3BZC A;  4NCA A;  3AA5 X;  4JKG B;  1LWE A;  4NLC A;  3CCL N;  3OYJ A;  3HSC A;  3TAG A;  5BPL A;  5KTQ A;  2XY5 A;  4BR9 A;  3OY9 A;  3PUF A;  3O9T A;  4KI6 A;  3I8B A;  3MEC A;  3C7N B;  1U2V A;  3SV4 A;  4I6M A;  4B1X B;  3KLF A;  4YOW A;  2QM1 A;  4FJ5 A;  3QML A;  3LPU A;  3HI0 A;  4FWR A;  5JVH L;  2QXL A;  3F9K A;  3TWH A;  4CZG A;  5FPN A;  4CGD A;  4BDP A;  2IGI A;  4K43 A;  3S9H A;  4ILG B;  1VSL A;  1JCF A;  1HMV A;  4K42 A;  1HJO A;  3PLA A;  4B9L A;  4KHQ A;  3L2R A;  5AQX A;  4WQ4 C;  1S1V A;  1J6Z A;  3VQE A;  4BR4 A;  3K2P A;  1D9D A;  5CZ1 A;  4CHO A;  3QEX A;  2W41 A;  4IFV A;  4IDK A;  5AQR A;  3DAW A;  1SKR A;  5HRN A;  2HBK A;  3N4Q A;  4C23 A;  2QA4 N;  3MMV A;  1CXQ A;  1KCF A;  3MX5 A;  3H45 C;  1VQ9 N;  1CZB A;  2WOM A;  2ZQB A;  1U04 A;  3DXK B;  3OYK A;  2YKN A;  4C1N I;  3OJU A;  1Q7Y O;  2HB5 A;  2Z1J A;  3A8Y A;  4Z4H A;  2OTL N;  1GLL O;  3VF6 A;  3CM6 A;  2G8U A;  4B9N A;  2PFU A;  3SI6 A;  4GVE A;  1K8K A;  3ZET B;  1GOB A;  3HZ6 A;  1KD1 O;  1BQN A;  4BWJ A;  4FJJ A;  4AH9 A;  1IKY A;  3WXK A;  3AVH A;  1T44 A;  1RT2 A;  1TUU A;  4WF9 L;  3LZJ A;  2YX6 A;  4DSL A;  1T8E A;  1NGG A;  2D0A A;  4BC3 A;  4H0X B;  1YF5 L;  1E4G T;  3KLI A;  3V9S A;  4AF1 A;  3WQU A;  3EZW A;  4OGE A;  4E1J A;  2O8D B;  1P90 A;  4BAC A;  4JD2 A;  4CJ5 A;  1ATS A;  2XY6 A;  4EP4 A;  3LP0 A;  4KHN A;  3B6O A;  4BE0 A;  3L8B A;  3M8P A;  3OYH A;  3SQ0 A;  3K9K A;  3LAN A;  3U3G A;  1NKC A;  4EZ6 A;  3VPZ A;  4BR0 A;  3JS6 A;  3P4I A;  3HP6 A;  3SJH A;  3HK2 A;  2O8B B;  1RT7 A;  4HTL A;  4CJ4 A;  3QDK A;  1J54 A;  2B6A A;  4RW7 A;  1JLC A;  3D45 A;  1RFQ A;  2CH6 A;  4W5O A;  5AZI A;  1WN7 A;  1RDW X;  1NJY A;  4JS4 A;  1NOY A;  2HF3 A;  3SAG A;  2ZM6 K;  4DR3 K;  3PX6 A;  3OTO K;  5GIP A;  4IXC A;  2FSJ A;  3TU5 A;  3TPQ A;  1DGK N;  1U49 A;  2WON A;  4JRQ A;  1LAV A;  3VA3 A;  3CJA A;  1I94 K;  5AQL A;  4FJH A;  4DFJ A;  4DV0 K;  2E8A A;  3K5O A;  3CF5 L;  3TAQ A;  4IBN A;  2G8I A;  1NJI O;  4OLB A;  4BRA A;  5AQW A;  1HKG A;  5AQO A;  2IVP A;  2P1J A;  3DM2 A;  4KHY A;  5AZJ A;  2I7P A;  1NKB A;  4K8X A;  1C1A A;  5EXW A;  1JL1 A;  1GLE G;  4EHT A;  2NRX A;  4NYF A;  2HF4 A;  2QWR A;  3QLH A;  3RRG A;  1WSE A;  4BVP A;  5KGW A;  1SZ2 A;  1S1T A;  3TAE A;  4NYN A;  1W7A A;  1C1C A;  4W5T A;  2UU9 K;  3D0P A;  4E7J A;  3CJ7 A;  2VQE K;  4J8F A;  1NGH A;  3CCJ N;  1WAF A;  2DFH A;  5JMV A;  2CGK A;  4J2B A;  1C0T A;  5KPZ A;  4LD0 A;  3TSQ A;  3ZSX A;  4CD3 A;  1NGA A;  1ZC6 A;  3VF2 A;  4YY3 K;  4IFY A;  2F9T A;  3TR8 A;  5A2Q O;  3A5M C;  1HPM A;  4IWV A;  3Q7C A;  3HT3 A;  2P9K A;  4WFN L;  1VAZ A;  5AJ3 K;  2JWK A;  4FLV A;  3I0S A;  3EN9 A;  3LDL A;  1IBM K;  5EX5 A;  1VRU A;  2A40 A;  5GAH P;  5BN9 A;  1YAG A;  1WSH A;  5BPN A;  3TAR A;  4LF5 K;  2B4J A;  1GLA G;  2V7Y A;  1QSS A;  2A1S A;  2XHB A;  2QW9 A;  1NK6 A;  2P9S A;  1NBW A;  2P51 A;  4JKA A;  4JI0 K;  1XMO K;  4KAZ A;  1KAX A;  2O8E A;  3UE5 A;  4CF0 A;  2NRR A;  1NKE A;  4ZTF A;  3ATU A;  4KRE A;  3THX A;  3THW A;  3WNG A;  1EXQ A;  1JLG A;  1O1W A;  4DTU A;  1XMQ K;  4Y1C A;  1GLJ O;  4MO4 A;  4CEA A;  2NRW A;  3H1Q A;  2QEX N;  3CHW A;  3O3G A;  3AA4 A;  4FJG A;  1V4S A;  2ETJ A;  3BZK A;  4DUY K;  2D4W A;  2E2O A;  3O5B A;  4CHZ A;  2CGJ A;  4CFD A;  4JLH A;  2G8F A;  4I6M B;  4BRH A;  4EAH D;  2W42 A;  4B08 A;  5HLF A;  3TTF A;  3L4Q A;  3AA2 A;  4BRK A;  4E19 A;  3I56 N;  3SQ2 A;  1RTI A;  3K59 A;  3VER A;  1X9S A;  3C6U A;  3RVC A;  4N76 A;  4CHY A;  5LJW A;  3CYM A;  1TK0 A;  4BY9 C;  3VN5 A;  2KKZ A;  3AO5 A;  4B1U B;  2ZE2 A;  3LDN A;  1DLO A;  2BH1 A;  3J80 O;  4B3T K;  4LFA K;  4HCB A;  2KTQ A;  4CJE A;  2W40 A;  3WXI A;  2PY5 A;  3CXC M;  1TKT A;  1CXU A;  5HRS A;  1Y64 A;  2HBL A;  4HCC A;  5EOY A;  1NOZ A;  2GUP A;  3L2U A;  4LC9 B;  3SJJ A;  2ZGY A;  1K73 O;  4FLX A;  4H5W A;  5J1E A;  2GX9 A;  3CI5 A;  1UAX A;  4YFU A;  4A2B A;  2E1Z A;  2VGM A;  4BQL A;  4DLG A;  3VGM A;  5LL6 Z;  4DLE A;  5IWA K;  5JS1 A;  3OYA A;  4CCH A;  4KH5 A;  3ULE A;  1EWQ A;  3KWG A;  4FLW A;  2HMP A;  4WQ5 C;  3IUC A;  2FLO A;  5C10 A;  2IVN A;  1NLV A;  2HVH A;  1OVQ A;  1R59 O;  3HJF A;  1FKO A;  2NRV A;  4CJU A;  3HVR A;  3IKM A;  3ZSQ A;  5AQS A;  1K8K B;  3CG7 A;  4W5R A;  5M1F A;  1C6V A;  3FZH A;  3GBT A;  4E3S A;  1ATR A;  2A41 A;  2OA8 A;  3H08 A;  4BDZ A;  1EO1 A;  4CZK A;  4FM1 A;  2XY8 A;  3L4I A;  3GG4 A;  3O4W A;  1NK9 A;  5FRN A;  5EVZ A;  1YJW N;  1MA9 B;  1EP4 A;  2P9I B;  2P9U B;  3ZX2 A;  4E7H A;  4M3T A;  2OPP A;  1IKV A;  5LY3 A;  3PSI A;  1VSH A;  1LAW A;  1DT9 A;  5BN8 A;  2DY4 A;  1BCM A;  4MFB A;  3H1V X;  4JS5 A;  3AA3 A;  2B5J A;  4FK0 A;  4PL8 A;  4JD2 B;  4IFE A;  4FWL A;  5EY4 A;  4F2R A;  4CJR A;  3ZEU B;  3BGR A;  3NMU A;  2QWQ A;  4FJI A;  4W5N A;  2QWL A;  4IO8 A;  4DSK A;  4B9Q A;  2FC0 A;  4BRP A;  3DLH A;  3AO3 A;  1NK8 A;  2A6A A;  1GLC G;  2UXD K;  3I33 A;  2E2Q A;  3ZSW A;  4BC2 A;  4EHU A;  4DV6 K;  4EP5 A;  2ITM A;  3K58 A;  1IO2 A;  3NBP A;  1U45 A;  4LF4 K;  1S5J A;  4M7Y A;  1RTH A;  4R79 A;  3SV3 A;  4JNE A;  3QNN A;  5HP1 A;  2ZJP L;  4FZZ A;  2HHV A;  4B9V A;  4JI6 K;  4RCH A;  1BHL A;  2VQF K;  3VES A;  5I9E B;  1WSG A;  2NRH A;  2BUP A;  3VEN A;  3ZSR A;  1NG9 A;  3ATV A;  1OH5 A;  3R8E A;  3ZX3 A;  1OH6 A;  1D9F A;  4Z4E A;  4L3Q A;  4DQ8 A;  5C2F A;  2ZF5 O;  1XNQ K;  1W9H A;  4CF2 A;  4WQ4 A;  3A5N C;  4BQZ A;  3SZ2 A;  2HHU A;  1MWK A;  3U3Y A;  2V7Z A;  2OPS A;  1YJN N;  4CJP A;  4MDA A;  2ZD1 A;  3A5O C;  4JK7 A;  4C8M A;  4M41 A;  3HPH A;  4FWK A;  1BIS A;  4CZF A;  1NU0 A;  3OS2 A;  4DFK A;  1JLE A;  4GNI A;  1WBD A;  4FJM A;  3NVK A;  5KPT A;  3AVN A;  3MXM A;  2Z1G A;  3L0Q A;  3CFP A;  3M8S A;  5KQD A;  1RT1 A;  4KPY A;  3UKU A;  3MEE A;  2F8S A;  2WUS A;  5GAG P;  3B8A X;  2E2N A;  2W6K A;  3G4S N;  3G0Z A;  4CZH A;  4DQI A;  4CEB A;  4JI3 K;  2AP1 A;  2ASO A;  2UXC K;  1ASW A;  3FZK A;  4DTS A;  4M63 C;  3NF8 A;  2HHX A;  4DTX A;  4DV5 K;  2P9K B;  3IMX A;  3VQ8 A;  1UOC A;  5JLH A;  4M42 A;  4JKE A;  4HTU A;  3ZT3 A;  1B9F A;  5E26 A;  4DU4 A;  1REV A;  5AQN A;  4OO1 J;  3MED A;  3J7Y P;  4LH5 A;  2PAV A;  3GOI A;  2F8T A;  4H5T A;  3BEX A;  4CFC A;  3HOS A;  4GKJ K;  2PZS A;  2HND A;  2P9S B;  1S9G A;  3V6D A;  4F9O A;  3VGK A;  3JSM A;  3S3O A;  4JKH A;  1NK4 A;  2O8E B;  2QWP A;  2UUC K;  2GWJ A;  3THX B;  1WB9 A;  3THW B;  5CY4 A;  4OPJ A;  4DHY A;  3OHR A;  5B8H A;  4FM2 A;  3FGU A;  3F73 A;  3LL3 A;  3QFP A;  3CQY A;  2UXB K;  2OPQ A;  5KQ8 A;  2KFN A;  3QEI A;  1RDA A;  3MX2 A;  5SWM A;  5MLC Q;  3U4L A;  4N56 A;  1OKJ A;  4M3W A;  1C0M A;  3V9X A;  3SPY A;  4DSJ A;  1P8Z A;  1JJ2 M;  3KD1 E;  4LSL A;  3HP9 A;  3UIQ A;  2GWK A;  1HYV A;  3QEW A;  1HKC A;  3IAY A;  1QVF M;  3CPW M;  5J2N A;  2O4I A;  2HBJ A;  1BO5 O;  1SS6 A;  5FRO A;  4XH1 A;  4B3R K;  3LP3 A;  4A62 A;  3PX0 A;  4OJR A;  5J2M A;  2HHT A;  4CF8 A;  4BDY A;  4NXM K;  4R5P A;  1Z26 A;  1TKD A;  4FLT A;  4Z4F A;  3A2F A;  3MXJ A;  3OYC A;  4ELU A;  3ALY A;  1UA0 A;  4KB1 A;  4I7F A;  3V1R A;  3CJB A;  1NJZ A;  2FSN A;  3TAB A;  4KFB A;  1X9J A;  2EHG A;  2FBX A;  3L3V A;  3T1Y K;  1FXX A;  3HOT A;  3MXI A;  3QBW A;  3ZX0 A;  4XIU A;  3RMB A;  1C0F A;  3WNE A;  1RT6 A;  4YHH K;  1N8R O;  4FWQ A;  2OTJ N;  1KVC A;  2ZGZ A;  4B8A B;  2HNZ A;  3D2F A;  2X78 A;  3WEE A;  1K9M O;  4CW7 B;  4BRQ A;  2Z1I A;  4B1Z A;  4CJV A;  4QS7 A;  5KI6 A;  3CM5 A;  1DTQ A;  1QS4 A;  5C42 A;  4FK4 A;  1WAJ A;  1KVB A;  5BRD A;  3LP1 A;  3ULD A;  3CME N;  2KZZ A;  3E66 A;  4A61 A; 
#chains in the Genus database with same CATH homology
 1I3A A;  3AVL A;  4NYF A;  4FK2 A;  2I5J A;  4CER A;  3RR7 A;  3QLH A;  4O4G A;  4DWI A;  3THV A;  3RRG A;  1CLQ A;  1WSE A;  3PY8 A;  5KGW A;  3TAE A;  1S1T A;  1NJW A;  4NYN A;  1XHX A;  1C1C A;  2FBV A;  4FYD A;  4W5T A;  2XY7 A;  3D0P A;  1KFS A;  2YNI A;  4QAG A;  4E7J A;  5T7B A;  2IS3 A;  2VG5 A;  1T05 A;  3VQA A;  3E01 A;  1JKH A;  1WAF A;  5KRS A;  2DFH A;  3WNF A;  4QOZ B;  4Z4I A;  3C94 A;  3NGI A;  3DLK A;  4J2B A;  1C0T A;  2HHW A;  4CIG A;  3NGY A;  4M3Y A;  1L5U A;  1ZYQ A;  3LWM A;  2YNF A;  3TAP A;  3K5M A;  1NK5 A;  3B6P A;  4LD0 A;  4IG3 A;  2LSN A;  3ZSX A;  4DF4 A;  4DSE A;  3VQ6 A;  3QER A;  3PX4 A;  3PO5 A;  4CEE A;  3RWU A;  1TKZ A;  1KRP A;  3MEG A;  4IFY A;  4DS5 A;  3TR8 A;  1J5O A;  2IC3 A;  1N5Y A;  3HVT A;  3NHG A;  4K8Z A;  3NGZ A;  5D3G A;  3V1Q A;  3DRS A;  4H4M A;  1LW0 A;  2YV0 X;  3AVG A;  3VQ4 A;  4UQG A;  4Z0U A;  3HT3 A;  4FZY A;  3NF7 A;  2E6M A;  1KLN A;  3AO1 A;  3O3H A;  4TSX A;  3V9W A;  1NJX A;  4PWD A;  3OS1 A;  4M45 A;  3KK2 A;  4CEZ A;  1RNH A;  4FLV A;  3I0S A;  4Q0B A;  1RBR A;  1VRU A;  4CGF A;  3EYZ A;  1RCH A;  1WSH A;  4O55 A;  5K14 A;  1L3V A;  1HYZ A;  3TAR A;  3OYF A;  1L3U A;  1QSL A;  3VQ7 A;  4CEF A;  2P5O A;  3QES A;  1RBU A;  4HUF A;  1HQU A;  2B4J A;  3AVC A;  1RDC A;  1QSS A;  2A1S A;  2XHB A;  4C8L A;  1CZ9 A;  1NK6 A;  4CJK A;  1T03 A;  4RW8 A;  1LWC A;  4GMJ B;  2P51 A;  5KRT A;  4ZHR A;  2EX3 A;  4CFB A;  4KAZ A;  1QHT A;  2KQ2 A;  1RT3 A;  2KW4 A;  1Q9X A;  3T19 A;  4CF0 A;  3OYN A;  1NKE A;  4CJS A;  3JYT A;  3EY1 A;  4ZTF A;  1RT4 A;  4KRE A;  1YT3 A;  1SL2 A;  3WNG A;  1EXQ A;  4PUO A;  1JLG A;  2YHA A;  4CJW A;  3P1G A;  3NDK A;  4O5B A;  1F21 A;  1HJR A;  4FLZ A;  4DQR A;  1U48 A;  1O1W A;  4DTO A;  4C8O A;  4DTU A;  2D0C A;  1Q8I A;  1VSI A;  1ZBF A;  5J2P A;  4Y1C A;  4CEA A;  1N6Q A;  3KTQ A;  2VWK A;  4OGC A;  1VSF A;  1ZBI A;  3O3G A;  4OLA A;  1TGO A;  1HNI A;  3AA4 A;  3T1A A;  3LP2 A;  5HBM A;  2R7Y A;  4C8K A;  4FJG A;  3C95 A;  2ETJ A;  3VQB A;  3RMD A;  1YTU A;  1ZBU A;  3DMJ A;  3RTV A;  4CHZ A;  3KIO A;  1KTQ A;  3DYA A;  4KB0 A;  4KV8 A;  1FKP A;  1QE1 A;  4H4O A;  4CFD A;  1XI1 A;  3SPZ A;  3L2W A;  4NCB A;  5FDL A;  4JLH A;  4WE1 A;  2G8F A;  1HPZ A;  3AVK A;  4N5S A;  3ITH A;  4E1M A;  2HNY A;  3DLB A;  4CGG A;  2W42 A;  4B08 A;  4FJ9 A;  5HLF A;  4E19 A;  3KLG A;  3AA2 A;  1X9S A;  3SQ2 A;  1RTI A;  5SZT A;  3HXM A;  1X1P A;  1K6Y A;  3K59 A;  3C6U A;  4RG8 A;  1BI4 A;  3TAM A;  3V4I A;  3TI0 A;  3QIP A;  4YNQ A;  3NH2 A;  3I8D A;  4M3R A;  4N76 A;  4AHR A;  3SYZ A;  1Y97 A;  3IS9 A;  3I0R A;  4CHY A;  4ZTJ A;  1JLA A;  1KLM A;  3CYM A;  4DG1 A;  1TV6 A;  5KGX A;  3SUO A;  2Q3S A;  4G1Q A;  1TK0 A;  4F3O A;  3VN5 A;  3LAM A;  3AO5 A;  4B9U A;  2ZE2 A;  1C1B A;  3MAQ A;  4CHQ A;  1LV5 A;  1TL3 A;  1DLO A;  2GUI A;  3OS0 A;  4E0D A;  3VA0 A;  1S6P A;  4HCB A;  4CED A;  4FJ8 A;  2KTQ A;  2JGU A;  4CJE A;  4HVJ A;  1LW2 A;  1UWB A;  1C0U A;  3S3M A;  2PY5 A;  1TKT A;  1GOC A;  1CXU A;  1RDD A;  3VQ9 A;  5HRS A;  4CJF A;  4DSI A;  2BDP A;  4HCC A;  4AHS A;  5HRO A;  1NOZ A;  3S3N A;  4GVM A;  3HPO A;  3V9U A;  3L2U A;  3NCI A;  1Q9Y A;  3SJJ A;  3RMC A;  3KLE A;  4FLX A;  1JLB A;  3ZT4 A;  5J1E A;  1RTD A;  4OPK A;  3BDP A;  1UAX A;  1KFD A;  4YFU A;  4CJQ A;  1RIL A;  1RBT A;  1BCO A;  3V1O A;  4DLG A;  5JS1 A;  4DLE A;  3OYA A;  4CCH A;  2KFZ A;  2IOC A;  4RW6 A;  1KSP A;  4KTQ A;  2HHS A;  1J9A A;  4FJN A;  2YNG A;  2D0B A;  4FLW A;  2YHB A;  1WNS A;  5CYM A;  2IAJ A;  1ZBL A;  3LAL A;  3KK3 A;  3DLG A;  4CEO A;  1VSM A;  2HVH A;  4GW6 A;  3OYE A;  2Y1I A;  1VSE A;  1VRT A;  1JXE A;  2BAN A;  2G8V A;  2X6N A;  3ASM A;  1S9E A;  1FKO A;  4CJU A;  3HST B;  3HJF A;  3SQ4 A;  3LAK A;  4CHN A;  4CJ3 A;  4CEC A;  2DTU A;  1BL3 A;  1BGX T;  3HVR A;  1RBV A;  4OVL A;  3ZSQ A;  3DOK A;  3CG7 A;  3NFA A;  4W5R A;  2G8H A;  4B9S A;  2GBZ A;  3NAE A;  1HYS A;  5I42 A;  1C6V A;  1TVR A;  3O3F A;  1L3S A;  3ZSO A;  1QTM A;  4E3S A;  2PYL A;  2JLE A;  1VSD A;  4CHP A;  5J2Q A;  2OA8 A;  4LH4 A;  3H08 A;  4ID5 A;  4BDZ A;  4CIF A;  5E41 A;  2YKM A;  4FM1 A;  1TKX A;  2XY8 A;  4DF8 A;  1TK5 A;  4FJK A;  3HO1 A;  2HVI A;  3K57 A;  1NK9 A;  4FJX A;  5FRN A;  4DQQ A;  1QSY A;  1EP4 A;  3AV9 A;  3OYI A;  5CYQ A;  3AVI A;  2BE2 A;  3HPG A;  4E7H A;  4M3T A;  2OPP A;  1IKV A;  1S1X A;  2XRI A;  1VSH A;  3SUQ A;  4ID1 A;  2FBY A;  3SNN A;  3ZT0 A;  1LAW A;  1G15 A;  1HNV A;  1S1W A;  4IG0 A;  4KHU A;  4Z4G A;  3O4Q A;  2D5R A;  1BCM A;  3OYL A;  4E7I A;  4KTW A;  4CF1 A;  1BIU A;  4MFB A;  4JS5 A;  4I2Q A;  4F4K A;  3AA3 A;  2BGG A;  1B92 A;  1MU2 A;  2B5J A;  3DLE A;  3M8R A;  4FK0 A;  3NH1 A;  3O4N A;  4F2R A;  4CJR A;  2QK9 A;  3BGR A;  2KZM A;  4DTJ A;  4J2A A;  4Y1D A;  2G8W A;  4FJI A;  4W5N A;  2QXF A;  2HHQ A;  2DFF A;  4J2E A;  4DSK A;  2FC0 A;  1NK7 A;  3CFO A;  3DLH A;  4FZX C;  3AO3 A;  4CGH A;  1NK8 A;  1EKE A;  1IH7 A;  4KI4 A;  1RBS A;  2A1R A;  4H8K A;  4L8R B;  4CE9 A;  1U4B A;  2Y1J A;  2RN2 A;  3QO9 A;  1GOA A;  4HHT A;  2IDO A;  3OYM A;  4KTZ A;  3TAN A;  4QCL A;  3ZSW A;  4O44 A;  1TAU A;  4CK2 A;  4ELT A;  3LPT A;  4EZ9 A;  1ASU A;  3VQ5 A;  1RT5 A;  4EP5 A;  1RDB A;  4AHV A;  3K58 A;  5C25 A;  1HQE A;  3AO2 A;  3WNH A;  3RMA A;  2FBT A;  1IO2 A;  1WSI A;  3NBP A;  1U45 A;  2E6L A;  1DTT A;  1FK9 A;  1S5J A;  1JLF A;  3P83 D;  1RTH A;  4CIE A;  3OYG A;  4AHT A;  1TAQ A;  3SV3 A;  5HP1 A;  3IRX A;  3QNN A;  4DMN A;  1UA1 A;  4FZZ A;  4B9V A;  4M3Z A;  2X6S A;  2HHV A;  5HRP A;  1BHL A;  2OPR A;  4HUE A;  1TL1 A;  1WSG A;  4O0J A;  2GV9 A;  3NF6 A;  1S6Q A;  1IKX A;  3ZSR A;  1YVU A;  4FM0 A;  4FCY A;  1D9F A;  4Z4E A;  4NCA A;  1JL2 A;  3QNO A;  3AA5 X;  1ITG A;  3G10 A;  1LWE A;  3ZT2 A;  1Z25 A;  3SUN A;  1W9H A;  3NF9 A;  3M8Q A;  4OKE A;  4CF2 A;  3KLH A;  1SV5 A;  3ZSV A;  3OYJ A;  3SZ2 A;  3U3Y A;  2HHU A;  3TAG A;  5KTQ A;  2XY5 A;  2OPS A;  3OY9 A;  3PUF A;  4KI6 A;  4CJP A;  3MEC A;  5HRR A;  1SUQ A;  2ZD1 A;  4C8M A;  3SV4 A;  3QIN A;  1SL1 A;  1D5A A;  4M41 A;  3VQC A;  2RPI A;  3HPH A;  1BIS A;  1S1U A;  2OZM A;  4FJ7 A;  3KLF A;  3ZSZ A;  4AHC A;  3OS2 A;  4AHU A;  2KZZ A;  3C6T A;  3VQP A;  4DFK A;  1JLE A;  4ELV A;  4NCG A;  4FJ5 A;  1BQM A;  4FJM A;  1D8Y A;  3K5L A;  4DFM A;  3LPU A;  5I3U A;  1A5X A;  4N47 A;  3AVN A;  3MXM A;  4M3U A;  2Z1G A;  3P5J A;  3QEP A;  3CFP A;  5DK5 A;  1BIZ A;  1KVA A;  3F9K A;  4F2S A;  3TWH A;  1A5V A;  3M8S A;  4CGD A;  4E1N A;  3SCX A;  4BDP A;  1RT1 A;  4DTN A;  2IGI A;  3LZI A;  1X9M A;  4KPY A;  3S9H A;  3MEE A;  2Z1H A;  1VSL A;  1HMV A;  3K5N A;  2F8S A;  4B9L A;  4KHQ A;  1JXB A;  3L2R A;  3VQQ A;  1S1V A;  5C24 A;  3DRP A;  3VQE A;  3HL8 A;  3G0Z A;  4O0I A;  4DQP A;  4DQI A;  3K2P A;  1XC9 A;  1D9D A;  1T7P A;  5CZ1 A;  1A5W A;  5EU7 A;  4CEB A;  4CHO A;  3LDS A;  4DQS A;  2DFE A;  2PYJ A;  2AJQ A;  1L3T A;  1ASW A;  3HM9 A;  3QEX A;  3TAF A;  2QKB A;  5CZ2 A;  3SQ1 A;  4DTS A;  4IFV A;  4IDK A;  4CFA A;  3RRH A;  5HRN A;  1SKR A;  3NF8 A;  2HHX A;  1B9D A;  4DTX A;  3DLR A;  3DOL A;  4HUG A;  2G8K A;  3KKS A;  3VQ8 A;  1CXQ A;  1ZBH A;  5JS2 A;  4E89 A;  1KCF A;  3HYF A;  4PA1 A;  3KD5 E;  1UOC A;  4M42 A;  1CZB A;  3ZT1 A;  4HTU A;  3T3F A;  2WOM A;  1B9F A;  2ZQB A;  3ZT3 A;  4DU4 A;  4DU3 A;  4M3X A;  1REV A;  1U04 A;  4KHS A;  4RW4 A;  1X9W A;  3OYK A;  2YKN A;  3OJU A;  3MED A;  2OYQ A;  3ISN C;  4CK1 A;  4LH5 A;  3OYB A;  3KKR A;  1WLJ A;  2F8T A;  3QET A;  3L2Q A;  4AIL C;  4CGJ A;  4RW9 A;  4CFC A;  2HB5 A;  2Z1J A;  1YTA A;  4Z4H A;  4DS4 A;  2PZS A;  2HND A;  4IKF A;  1S9G A;  3V6D A;  4F8R A;  1XHZ A;  1TK8 A;  4Z4C A;  3CM6 A;  3JSM A;  3S3O A;  1J53 A;  2G8U A;  4B9N A;  2XO7 A;  1NK4 A;  4F3T A;  2RKI A;  3SI6 A;  2HMI A;  2O4G A;  1R0A A;  1NK0 A;  2RF2 A;  4OKK A;  4OKJ A;  3AO4 A;  1GOB A;  1SKW A;  3DI6 A;  4ICL A;  3PV8 A;  3SUP A;  5CY4 A;  1BQN A;  4BWJ A;  5DMR A;  4FJJ A;  3ZSY A;  1EX4 A;  4OPJ A;  2YNH A;  4AH9 A;  4FM2 A;  1IKY A;  4KO0 A;  3AVA A;  3F73 A;  4E7L A;  1ASV A;  2OPQ A;  3LWL A;  3AVH A;  2KFN A;  1RT2 A;  3QEI A;  4B9T A;  3RR8 A;  1RDA A;  3LZJ A;  2X74 A;  5SWM A;  4DSL A;  4N56 A;  1T8E A;  2D0A A;  2NUB A;  4CJL A;  4FVM A;  3AVB A;  4BWM A;  4JRP A;  1C0M A;  4DTR A;  4FJL A;  4M3W A;  2VWJ A;  3V9X A;  3SPY A;  4DSJ A;  3KLI A;  3V9S A;  1I39 A;  4W5Q A;  3KD1 E;  4LSL A;  3HP9 A;  3UIQ A;  3QEV A;  3IG1 A;  4DTM A;  4OGE A;  1HYV A;  4CEQ A;  4I2P A;  3QEW A;  3IAY A;  5FRM A;  4CF9 A;  4KHW A;  4PQU A;  1IG9 A;  4CJT A;  5J2N A;  2DY4 A;  2O4I A;  3NH0 A;  1VSK A;  2ITG A;  4C8N A;  2E4L A;  4CES A;  5FRO A;  4BAC A;  4CJ5 A;  3LP3 A;  3V81 A;  4DTP A;  3PX0 A;  4OJR A;  3CQ8 A;  5J2M A;  2XY6 A;  2HHT A;  1BI4 B;  4CF8 A;  4EP4 A;  1HRH A;  4BDY A;  3VQD A;  3QIO A;  4R5P A;  1Z26 A;  4E7K A;  3LP0 A;  1TKD A;  4KHN A;  3B6O A;  4BE2 A;  4BE0 A;  4FLT A;  4Z4F A;  3L8B A;  3A2F A;  4I9Q A;  2QKK A;  3L2V A;  3M8P A;  3MXJ A;  3OYC A;  4ELU A;  4KRF A;  3OYH A;  4FLU A;  3ALY A;  3SQ0 A;  1UA0 A;  4KB1 A;  3DRR A;  1XWL A;  3LAN A;  4I7F A;  3U3G A;  3V1R A;  1NKC A;  4EZ6 A;  4B3O A;  3KJV A;  1NJZ A;  3AVF A;  3EZ5 A;  4DFP A;  3HP6 A;  1LWF A;  3HK2 A;  4CK3 A;  3TAB A;  1RT7 A;  4KFB A;  3PO4 A;  4CJ4 A;  1WSF A;  4N41 A;  2B6A A;  1J54 A;  2VG6 A;  2EHG A;  4RW7 A;  1JLC A;  3D45 A;  4W5O A;  2HW3 A;  4KKO A;  3CFR A;  3V9Z A;  2FBX A;  3L3V A;  3OJS A;  1WSJ A;  1WN7 A;  4FW2 A;  1FXX A;  1IKW A;  4B8C A;  1NJY A;  4FW1 A;  4JS4 A;  1NOY A;  3MXI A;  3OVN A;  4CGI A;  1EET A;  3AVJ A;  3L3U A;  4XIU A;  4LY7 A;  3KK1 A;  4DU1 A;  3RMB A;  3WNE A;  1RT6 A;  3U6F A;  3PX6 A;  2VG7 A;  4PY5 A;  4MQ3 A;  4LSN A;  4BE1 A;  1JLQ A;  1SKS A;  1KVC A;  3FFI A;  4B8A B;  1U49 A;  2WON A;  3OYD A;  1LAV A;  2HNZ A;  3NE6 A;  4JRQ A;  3VA3 A;  4B9M A;  4FJH A;  2X78 A;  4DFJ A;  1SL0 A;  3K5O A;  2ATQ A;  3AVM A;  1RTJ A;  4IBN A;  3TAQ A;  2G8I A;  2Z1I A;  4OLB A;  4FXD A;  4J2D A;  4CJV A;  5KI6 A;  2P1J A;  3CM5 A;  1DTQ A;  1QS4 A;  3DM2 A;  3ZCM A;  5C42 A;  4Q5V A;  1U47 A;  2OZS A;  4KHY A;  4FK4 A;  1VK0 A;  1VSJ A;  1WAJ A;  1KVB A;  1W0H A;  2F96 A;  3LP1 A;  4I9L A;  4FLY A;  1NKB A;  2P5G A;  4K8X A;  1C1A A;  3ULD A;  4DSF A;  1JL1 A;  1QQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...