3AVGA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avgA00
4OPKA 4DTJA 1UA1A 1JL1A 2IC3A 1LW2A 3QEIA 2VG5A 3D45A 3AVJA 4AH9A 4KB1A 4OLAA 2KFZA 4N41A 4Z4CA 4B9VA 4XIUA 2IS3A 1C0MA 3TAMA 2F8SA 2X6SA 1NJYA 4J2DA 4PA1A 1TGOA 4GW6A 5CZ1A 3QETA 2RF2A 3MAQA 2ITGA 4DTSA 5T7BA 1WSGA 3V9UA 3NH2A 4LSLA 3HYFA 1BIZA 1EXQA 3LALA 4CK2A 4O5BA 4RW8A 3HT3A 3PX0A 3P1GA 1I39A 1A5XA 2A1SA 4ICLA 4CFCA 3CM6A 1REVA 4CFAA 3K2PA 4OJRA 2BE2A 4UQGA 3RMAA 1S5JA 1NK7A 4FZXC 4O44A 4NCGA 1TL3A 1BHLA 4AHVA 4FM0A 4KHUA 2KZMA 3ZT3A 4DTRA 3AO3A 1DTQA 3AVBA 1T05A 3OYFA 3VQ6A 2PY5A 2XHBA 3SUQA 3NF9A 1SUQA 1JLCA 3LAKA 1RTIA 3V81A 3ZSVA 3TARA 4NCAA 3QEWA 1EP4A 4GMJB 1RILA 1RTHA 4OKEA 4KTWA 3VQAA 4CJWA 4LD0A 4YNQA 1RDAA 1RDBA 2W42A 1QSSA 4C8NA 4CJ3A 2Y1JA 2HHTA 4O0JA 4EZ6A 1NKBA 4FJ5A 1T7PA 1NK6A 4LY7A 5FRNA 4CJFA 3SUNA 1VSJA 1W9HA 1TKDA 3NGYA 4FM1A 2BDPA 1Q8IA 3AA4A 1A5WA 4CF0A 4N5SA 1RT2A 4KHNA 2YNFA 1U45A 5JS1A 3DRSA 3M8PA 4B9SA 2D5RA 4KRFA 2EHGA 1TKTA 3WNHA 3HK2A 4B3OA 5CYMA 3NDKA 2D0BA 3SZ2A 1BQNA 1UOCA 4LSNA 3VQ9A 1TV6A 1XHXA 3G10A 3OVNA 5KGXA 1HQUA 3ALYA 2D0CA 4OGEA 3ULDA 3SQ0A 3I0SA 4KHWA 1ZBFA 3I8DA 1VSDA 1GOAA 3ASMA 3CM5A 1SKSA 1KVBA 3SQ1A 3T1AA 3I0RA 1NJWA 3VN5A 4CJ4A 2G8WA 2P51A 3B6PA 2P1JA 1HQEA 1WLJA 3CYMA 4YFUA 3OYJA 4CEBA 1TVRA 3D0PA 4E7KA 1QTMA 1WNSA 3C6UA 3V9WA 3TANA 2HHXA 3L2QA 4PUOA 2YNIA 4FLVA 4DTPA 1EETA 3WNGA 4E19A 1GOCA 4QAGA 4M3WA 4CJUA 2O4GA 4I7FA 4CEOA 1RT1A 4CK1A 4FK4A 2KTQA 3ZSWA 1HRHA 3HL8A 1J53A 1UAXA 3ZSZA 3H08A 5D3GA 1D8YA 4E1MA 2KQ2A 4E7LA 1GOBA 2BGGA 4C8MA 3PV8A 3RMCA 1S1UA 1WAJA 2KW4A 3DM2A 4IFYA 1TK8A 3KD5E 4QCLA 5I3UA 4EP5A 3CFOA 1JLAA 1FXXA 1VSKA 1ZBHA 2IDOA 2Z1GA 2JLEA 3LZIA 2YHAA 3RMDA 1KLMA 4I2PA 5CY4A 4CECA 2QKKA 2OZSA 1KFSA 3HVRA 2XRIA 2ZE2A 5EU7A 3ZT4A 4KPYA 5DMRA 3VQEA 4DU3A 3KJVA 4DF8A 3OYMA 1SV5A 4ID1A 2E6LA 4CHOA 4KI6A 5HLFA 5J2NA 4CGIA 1QSYA 1SKRA 3VQ7A 5I42A 4AHSA 2HVIA 4E7JA 4FW1A 3K59A 4DFMA 2XY6A 1J9AA 4BACA 2Q3SA 4FLZA 4M3TA 4DTNA 1S1XA 4M3YA 3AVFA 3DRPA 3HP9A 4OKKA 4CEQA 5FRMA 1TL1A 3TABA 5E41A 3P5JA 3SV4A 1L3TA 1UWBA 4CGHA 4E3SA 1T8EA 1B9FA 2E4LA 3OY9A 3ZSOA 3ZSYA 4AHUA 1KTQA 1S1WA 2OA8A 3SQ2A 1IH7A 3AVNA 1C1AA 3NAEA 2F8TA 3KD1E 3AVCA 1NKCA 3KK3A 3JYTA 1Q9YA 4E89A 4JLHA 2R7YA 3EZ5A 4CEEA 4DSJA 2PYJA 4CF1A 1JLQA 3OYIA 1QHTA 4G1QA 1S6PA 5KGWA 3NGIA 2HMIA 4J2EA 2OYQA 3LP1A 3L8BA 4JRPA 2HB5A 4FJ8A 5K14A 4J2BA 1WN7A 1TKZA 3BGRA 4GVMA 3V1RA 4FJGA 1ITGA 2E6MA 3LZJA 1L5UA 3OYEA 3NF6A 5DK5A 4H8KA 2FBTA 3AVKA 4DG1A 1LW0A 3U6FA 5HRRA 3OJSA 3KLHA 5J2MA 3OYLA 1KRPA 4O0IA 4CIFA 3U3GA 4RW9A 1TK5A 1HYSA 1BGXT 4DFKA 4IG3A 1YTUA 2HHSA 4IBNA 1ASWA 1KVCA 5SWMA 3FFIA 3SV3A 2X78A 3QNOA 4N56A 2IOCA 4W5TA 3OJUA 3V9SA 4DU4A 3OYAA 5SZTA 3VQDA 1NK0A 1A5VA 4H4OA 3WNFA 2YV0X 5J2PA 3ZSXA 1WSHA 1CLQA 1QQCA 1HNIA 4FZZA 3V9XA 3IRXA 1LAWA 1RDDA 2HHWA 1UA0A 3L2RA 3T3FA 2VG6A 2QKBA 4OVLA 1S6QA 3M8SA 2G8IA 4IG0A 2X74A 4FJIA 3OYBA 3NCIA 4HHTA 2G8VA 5J2QA 1ASUA 2YHBA 1X9SA 1RTDA 4M42A 2FC0A 3K5MA 3SYZA 3QNNA 1VSHA 3V9ZA 2Z1HA 4CGJA 4CJLA 3NBPA 1VRTA 3V1QA 1EKEA 3IS9A 3ISNC 4DFPA 3QESA 3HPHA 3DLBA 2QK9A 3E01A 1Z25A 1LWCA 4HUFA 4KV8A 1KFDA 1DLOA 3SJJA 5FROA 4CJQA 3O3HA 3TWHA 1NKEA 3HVTA 1HYVA 4ELUA 2DY4A 1CXUA 1C6VA 1DTTA 3MEDA 2O4IA 1RCHA 1ZBLA 2B5JA 1IKVA 3O3FA 3LPTA 3TI0A 3DOKA 3CQ8A 1U49A 4ELVA 4F8RA 1BISA 2FBYA 3THVA 4PWDA 1VRUA 1C0UA 3LDSA 3RR8A 4RW7A 3SPZA 3AVMA 4DSKA 4FK0A 3RWUA 2G8HA 4K8ZA 1BQMA 4FCYA 2JGUA 3SPYA 1IKYA 1JLBA 1YTAA 2P5GA 2GBZA 3M8QA 4KB0A 4M3UA 1SL1A 4CJ5A 2RKIA 1RBUA 3VQ8A 1C1BA 3DLRA 1J5OA 3NF8A 1Z26A 4CE9A 4CGFA 1RBVA 1RT6A 4FLXA 3U3YA 4KHYA 2AJQA 3M8RA 3HP6A 1BL3A 4F2RA 2Z1IA 1EX4A 1ZBIA 4BE1A 3L2VA 1C1CA 2HW3A 4I9LA 4M41A 5HRPA 4CF9A 1RDCA 2DFEA 3NH1A 1X9MA 4Z4EA 4DMNA 4KI4A 2GV9A 1NJXA 4NYFA 4R5PA 3S3OA 4FLYA 4MQ3A 1FKOA 4B9TA 4AHTA 3RMBA 1RT4A 3P83D 1XWLA 4OPJA 4C8OA 4CGGA 1ZBUA 1IG9A 5JS2A 4C8KA 4RG8A 4B08A 4Z4IA 3AVHA 1IKWA 2EX3A 4EZ9A 2OPPA 4CF8A 2P5OA 4FJMA 4CCHA 2DFHA 4DTUA 4DLGA 5HP1A 4H4MA 3PO4A 1L3VA 3TAEA 4KKOA 1ZYQA 2X6NA 3KK1A 5KI6A 4O4GA 3MEEA 3VQ5A 3DI6A 2LSNA 3DLKA 4CESA 3OS1A 4OKJA 4JS5A 1ASVA 1JLFA 4M45A 4BWJA 4B9UA 4Z4FA 4PQUA 1S1TA 3DRRA 3SQ4A 1RNHA 4FJ7A 3QIOA 1LWFA 5KRTA 2DFFA 4W5NA 3AO5A 3KLIA 4M3RA 4E7IA 1KVAA 4FLUA 3QEPA 3L3VA 4Z4HA 4E1NA 2F96A 1XC9A 2HHQA 3CFPA 1LV5A 4CJKA 4OGCA 3F9KA 5C25A 3O3GA 1U47A 3AVGA 3EY1A 3AA3A 4DQSA 2XY8A 4DSIA 4DF4A 3BDPA 4EP4A 1C0TA 3KLGA 4IKFA 1NOZA 1S9GA 2XO7A 3K57A 3RRGA 4KAZA 4L8RB 3AVAA 4FJ9A 2GUIA 3OYHA 2ZQBA 2I5JA 2WOMA 1WSFA 3OYNA 1NK5A 2OZMA 3DLEA 4HCBA 4CIEA 4N76A 4KREA 3PUFA 4ELTA 1N5YA 2YNGA 1W0HA 3VQPA 4BDPA 4FJKA 1U04A 3T19A 2HHVA 3OS2A 4DFJA 4MFBA 4Y1CA 1HYZA 4HUGA 1B92A 4TSXA 3HSTB 2B4JA 3PY8A 1RT3A 3VQ4A 2Z1JA 3MEGA 3V1OA 4CGDA 4F4KA 3QEXA 4KTQA 4OLBA 2HHUA 3DOLA 3K5LA 4CHYA 1VK0A 4PY5A 1L3SA 4Z0UA 4CJEA 4M3ZA 4DS4A 4K8XA 4W5QA 2YNHA 3C6TA 1BI4A 1VSEA 3KLEA 3HXMA 3AO4A 4KTZA 3LWMA 4CHZA 1U48A 3A2FA 3S9HA 4HVJA 1FK9A 3O4QA 1BIUA 1HJRA 2OPSA 3LPUA 4HUEA 4CF2A 3C95A 1X9WA 1L3UA 4DWIA 4N47A 3V6DA 4CHQA 4CFBA 3K5NA 1LAVA 1D9DA 4DSEA 1CZ9A 2VG7A 4DSLA 1J54A 1SL2A 3QERA 1RBTA 4FJXA 4CHPA 2OPQA 2ZD1A 2FBXA 1T03A 1VSFA 3L3UA 3AO2A 3QIPA 3IAYA 3TAFA 2ETJA 4BDZA 1VSMA 3LP2A 4KO0A 1TK0A 3B6OA 4B8CA 3DLHA 4B9LA 2XY7A 5J1EA 4FJNA 4CJTA 4DSFA 4QOZB 4J2AA 3VQQA 4FJHA 1XI1A 3ZT0A 1N6QA 1TAUA 4W5OA 3EYZA 4FM2A 1BCOA 3MECA 4Q0BA 4Y1DA 1R0AA 1BCMA 1I3AA 2NUBA 3QO9A 4AHCA 3OYDA 4DQRA 3AVIA 4O55A 3TAQA 2A1RA 3HJFA 1YVUA 3KTQA 1JXBA 4Z4GA 3S3MA 1S9EA 3ITHA 4FW2A 3DMJA 4DS5A 3KLFA 1QS4A 2QXFA 3L2UA 3C94A 5HRNA 4C8LA 2DTUA 4KHQA 3NH0A 4AILC 2KFNA 2IAJA 3O4NA 4CFDA 1RBRA 3OYCA 3LWLA 4Q5VA 4ZTFA 3SCXA 3TR8A 4CHNA 3WNEA 4BE2A 4DU1A 2HNYA 4DTXA 2PZSA 4CJRA 5FDLA 3SI6A 1HNVA 3AA2A 4FJJA 3OYGA 2RN2A 3TAPA 4F3TA 1NJZA 2OPRA 3HM9A 3NFAA 4HTUA 3V4IA 5HBMA 2G8UA 1VSIA 1JLEA 3UIQA 4FVMA 3KK2A 4DTOA 1QSLA 5HRSA 3RTVA 1BI4B 3KKSA 3NF7A 2YKNA 2HNDA 3DLGA 4B8AB 2HVHA 3LP3A 3LP0A 3RR7A 4B9NA 3AO1A 3AVLA 3QEVA 3NHGA 4DLEA 4CEFA 1KSPA 1RT5A 4CEAA 1FKPA 1S1VA 3MXJA 4CEZA 3SNNA 3SUOA 3IG1A 3KKRA 1TAQA 4FLWA 3LAMA 4DTMA 4BDYA 4RW4A 3NGZA 1G15A 4HCCA 1K6YA 3HPGA 3CFRA 3PX6A 4E0DA 3PO5A 4ZTJA 2IGIA 2B6AA 1IKXA 1RTJA 3LANA 4ID5A 2G8KA 4CK3A 1JKHA 2XY5A 2HNZA 1RBSA 1JLGA 1X1PA 3MXMA 3OYKA 4M3XA 4NYNA 1TKXA 3KIOA 4W5RA 1NOYA 4IDKA 3QLHA 3DYAA 1MU2A 4JS4A 1LWEA 3G0ZA 2G8FA 2YKMA 4BWMA 4B9MA 3ZT1A 1CZBA 3AA5X 1Y97A 4KHSA 4LH4A 1JL2A 2BANA 4DQIA 1HMVA 1RT7A 3K5OA 4E7HA 4F3OA 1D5AA 3S3NA 1B9DA 1YT3A 2KZZA 3ZT2A 4WE1A 3QINA 1CXQA 1O1WA 1WSEA 4LH5A 1U4BA 4FK2A 4CIGA 5CYQA 1NK9A 4I9QA 5HROA 2WONA 3AV9A 2VWJA 3VA0A 2FBVA 1WAFA 2Y1IA 4NCBA 5CZ2A 1Q9XA 3HO1A 5KRSA 3ZCMA 4CJPA 1VSLA 4I2QA 2ATQA 3F73A 3VA3A 4CEDA 4ZHRA 1XHZA 4FLTA 4AHRA 4FXDA 1NK4A 3MXIA 4JRQA 3HPOA 3VQBA 4CERA 1NK8A 1JXEA 3ZSQA 1WSJA 3ZSRA 3TAGA 3CG7A 4FYDA 1HPZA 3K58A 1SL0A 1SKWA 3JSMA 1WSIA 3RRHA 1KLNA 4F2SA 2D0AA 4FJLA 4KFBA 1IO2A 4CJVA 3L2WA 3VQCA 2PYLA 1F21A 4IFVA 2RPIA 4RW6A 4CJSA 4BE0A 3PX4A 4DQPA 2VWKA 5C24A 5C42A 3SUPA 1QE1A 4FZYA 1D9FA 1KCFA 3NE6A 4DQQA 5KTQA 3OS0A
chains in the Genus database with same CATH superfamily
3AVJA 4KHPK 4B9VA 3THWB 4IJNA 3M3ZA 1NJYA 4J2DA 2O8EB 3AARA 1TGOA 3MAQA 2O8DB 1ATNA 2ITGA 4FWNA 4OX9K 3TTCA 1BIZA 3LALA 3HT3A 4RW8A 4B3MK 2A1SA 3I55N 4UQGA 2ZF5O 3VPZA 4KH6A 1BHLA 3CCMN 4KHUA 1XMOK 2FSNA 3AO3A 2HMPA 3ID8A 3AVBA 1T05A 3NF9A 5AQZA 3LAKA 1XC3A 4ILGB 3V81A 4NCAA 4EHTA 3QEWA 1KAXA 1EP4A 3BEXA 3BY5A 3VQAA 3D7EO 4LD0A 3KK7A 4Z94A 2QW9A 1BUPA 3KWIA 5E84A 2Y1JA 3B8AX 3P38A 1NKBA 4DHYA 3VOVA 1VSJA 1W9HA 3NGYA 4FM1A 1KAYA 5AQHA 2BDPA 3GL1A 2E20A 4X62K 4KHNA 5F1XA 5JS1A 4B9SA 1GLDG 1TKTA 4B3OA 5CYMA 3NDKA 2P9UB 3SBTA 3VQ9A 3TAPA 3ULDA 3EZWA 1HQUA 2D0CA 3SQ0A 3BF1A 4DV4K 4KHWA 3ASMA 3CM5A 1KVBA 5AQOA 3F2KA 4AF1A 3UKUB 4FWKA 1GLEG 4YFUA 3NVMA 1XUPO 3C6UA 1N36K 3TANA 3CJCA 4PUOA 4FLVA 3MK6A 1EETA 3HTVA 1I94K 2HBMA 5BRFA 4M3WA 4CJUA 4CEOA 5FPDA 1RT1A 4CK1A 4E1MA 1GOBA 2E2PA 3RMCA 1S1UA 1WAJA 4IFYA 3KD5E 3CFOA 5EX5A 3ZX3A 5BRHA 2IDOA 2YHAA 2P9PA 1X3MA 1KLMA 3EL2A 1N34K 4KPYA 3H46O 5CR4A 4DU3A 5LJVA 3ULEA 4KI6A 5J2NA 5AQIA 5JVGL 3K59A 4DFMA 2XY6A 1LOTB 1J9AA 4AQYK 1VQNN 4NXMK 4DTNA 4K43A 4OKKA 3THYA 3VESA 3LDPA 5AQTA 2ZJQL 3P5JA 3SV4A 1UWBA 3CCVN 2E4LA 3ZSOA 3ZSYA 3SQ2A 1IH7A 3KD1E 3AVCA 1NKCA 3JYTA 1Q9YA 4CEEA 4DSJA 2PYJA 4GKJK 3OYIA 2FSKA 3N4PA 3O1BA 2P9LA 5K14A 3V1RA 4FJGA 2E6MA 3LZJA 3ENHA 3OYEA 3NF6A 3OBYA 4DG1A 1S22A 3U6FA 3OJSA 4LFCK 4LF6K 1TK5A 1BGXT 4IG3A 4IBNA 1TYQB 3FFIA 2X78A 3QNOA 1QZ6A 1HJOA 3V9SA 3O9UA 4JKGA 3WNFA 4QS8A 4CI6A 3K0SA 1QQCA 2BUPA 4WQ5A 4FZZA 3DXMA 4IZ9A 2HHWA 1UA0A 2W41A 3L2RA 5EXWA 1TUYA 3M8SA 2G8IA 4IG0A 2X74A 4XH4A 3OYBA 4HHTA 4M42A 4WYBA 3QNNA 3V9ZA 3G71N 3CF5L 3NBPA 2A3ZA 4DFPA 3WXLA 2QK9A 4HUFA 3UE5A 3VEVA 2P9SB 3PSIA 4CJQA 3TWHA 1HYVA 2DY4A 1T3VA 1DTTA 2GELA 3ATVA 1RCHA 3MEDA 4BG8A 3C6HA 3O3FA 4A57A 4FSVA 4F8RA 1BISA 5C12A 3THVA 3QMLA 3TTFA 3TTDA 4JI2K 4K8ZA 2JWLA 4FCYA 2HVHA 4KB0A 1QHAA 3T1HK 4CJ5A 5GIPA 2ASPA 2NRZA 2HHHK 2E2OA 4BE1A 4H5NA 4CF9A 4O8UA 2RHKA 4DMNA 2GX9A 1YJNN 1IBLK 2F7TA 4FLYA 4B1XB 1GLCG 4AHTA 5GAEP 1OH7A 4IEEA 4BVOA 4R79A 4C8KA 3EKSA 2OPPA 4CF8A 4FJMA 2ZGYA 2X6NA 3KK1A 3VQ5A 4JS5A 3DLKA 4OKJA 1JLFA 4JKDA 1NJIO 4YORA 1T6CA 1RNHA 5BREA 3QIOA 4FJ7A 1BA0A 1SZ2A 3AO5A 3L3VA 4Z4HA 2VYPA 4E1NA 4J8FA 4O8KA 1Y64A 3KZBA 4DF4A 4EP4A 4NXNK 3HOSA 3VEYA 4IKFA 2XO7A 3RRGA 3WXIA 4N76A 3P31A 2GEMA 3SAGA 1W0HA 4FJKA 1U04A 3T19A 5AQRA 4WFAL 4DFJA 4HUGA 1HYZA 1B92A 1OH6A 2F4VK 3PY8A 1RT3A 5AQKA 2Z1JA 3MEGA 3V1OA 4CGDA 4F4KA 3QEXA 4OLBA 2HHUA 4H5RA 4PY5A 4CJEA 2OANA 4M3ZA 3E9OA 3A2FA 5GAGP 2ZM6K 1FK9A 3O4QA 4HUEA 4CF2A 1L3UA 4LF4K 4DSEA 3BUZB 4CHPA 4FJXA 2OPQA 2O8BA 4CZHA 2FBXA 3IAYA 3AO2A 1M1KO 3TAFA 2YCHA 4FJNA 4U7BA 5J1EA 2NRRA 1DEJA 4J2AA 1V4SA 1TAUA 5AZJA 4Y1DA 1R0AA 5BPMA 3TAQA 4O55A 1Q7YO 2A1RA 5M1KA 4Z4GA 2E5LK 3ITHA 4C8LA 3C94A 2V7ZA 3CPWM 3O4NA 4ZTFA 3CCRN 4CHNA 4MDBA 4BE2A 4DTXA 3SI6A 2QWQA 3OYGA 3M5RA 1NJZA 2OPRA 1KAZA 3V4IA 5HBMA 5LL6Z 4CBWA 1VSIA 1VQMN 3VMFB 4FVUA 3UIQA 3KK2A 3NVKA 3Q7CA 3RTVA 3VGMA 1VHXA 2HNDA 3RR7A 1Q18A 3AVLA 3FZHA 4KBOA 3NHGA 3QEVA 1RT5A 4CEAA 1FKPA 3SNNA 3IG1A 3KKRA 1TAQA 4DB3A 5C15A 4BDYA 3F5TA 1E3MA 3VEWA 1YF5L 2B6AA 3VF4A 4BRIA 4ID5A 3LANA 4CK3A 1HNWK 2AP1A 2VGMA 3G4SN 4NYNA 1TKXA 4IDKA 3QLHA 3DYAA 1MU2A 1LWEA 3IDHA 3ZT1A 3AA5X 1BWFO 4CZEA 5M1PA 4F3OA 2BANA 4E7HA 5EY4A 1B9DA 1YT3A 4V19S 4WE1A 1U4BA 3H1VX 3ZEUA 2WONA 4YOTA 5HROA 4NCBA 1NK4A 2QA4N 4JRQA 3R9PA 4C1NK 4H5TA 2GTDA 3ZSRA 1R59O 4WCEL 3C6AA 3R8EA 1WSIA 1KLNA 2D0AA 1Q81O 4KFBA 4CJVA 3VQCA 3CCLN 4BE0A 5C42A 4X66K 3NE6A 4OPKA 4DTJA 3W0LA 1UA1A 3QEIA 3D45A 4AH9A 4OLAA 2KFZA 1VQKN 2X6SA 5F0XA 1NBWA 4PA1A 2E1YA 4BR5A 5CZ1A 2WC9A 1DKGD 5T7BA 3U4LA 3FGUA 2P9IA 5CHIA 1NG9A 4JKBA 1EXQA 3PX0A 4UY8O 4ICLA 4CFCA 3CM6A 1LCUA 1S5JA 1NK7A 3K9JA 2HSTA 4O44A 4FL9A 4FM0A 4AHVA 5AQNA 4DTRA 4IEIA 2NRTA 3VQ6A 5BN8A 1JLCA 1VQON 4C23A 4DV0K 1RILA 1RDAA 1U6ZA 4C8NA 3TSPA 4CJ3A 4JI6K 3BZKA 4DUZK 1NK6A 4CJFA 3GE1A 4GV6A 3HZ6A 3AAQA 4CF0A 2YNFA 5AZIB 3DRSA 4YOYA 3U9ZA 3WNHA 2D0BA 3HRGA 1BQNA 1UOCA 3H3NO 1KRPA 3G10A 3OVNA 3ALYA 4OGEA 3N4QA 3I8BA 4BR4A 4IWVA 3O9RA 3SQ1A 1P90A 2P1JA 5M1QA 3T69A 3OTOK 2VCPA 4FWQA 4CEBA 1TVRA 1WNSA 1FJGK 3V9WA 2HHXA 2P9KA 1O13A 3WNGA 4QAGA 4FWSA 4A2AA 1QZ5A 1HRHA 2I7NA 3HL8A 4JD2B 5D3GA 1D8YA 1IV0A 2BGGA 3PV8A 5AQQA 4F3TA 2KW4A 5I3UA 3DLLL 4CZIA 3DXMB 1NGJA 2Z1GA 3RMDA 5CY4A 2XRIA 2ZE2A 5EU7A 5IT9O 3KJVA 1SV5A 2E6LA 4XH1A 5KPTA 4JK7A 3VQ7A 4E7JA 4DR6K 4FW1A 4BACA 2BTFA 3BF3A 1S1XA 4M3YA 3P39A 1TL1A 3TABA 1T8EA 1B9FA 1HR0K 1HYSA 4K0KK 4BRNA 3AVNA 3KK3A 1YJWN 4K41A 3EZ5A 4CF1A 3SBGA 3HBTA 4G1QA 3ATUA 1S6PA 4J2EA 2OYQA 3LP1A 2VGNA 3CERA 4JK8A 1WN7A 1TKZA 3AAPA 3EEQA 4CW7B 4IXCA 5DK5A 2P9NA 2HBLA 4H8KA 3AVKA 3E9PA 3T1YK 1LW0A 3CD6N 3H1QA 3KLHA 3VGKA 3U3GA 1BG3A 5SWMA 1S3XA 3O5BA 4N56A 2IOCA 4GV3A 4DU4A 4DR3K 1A5VA 3SJHA 5TKWA 3CHWA 4PKIA 3AY9A 4FWPA 1RDDA 4YOUA 2GUPA 3O4WA 4OVLA 3DXKA 4BY9C 3FR0A 1S6QA 4B1VA 4FJIA 3NCIA 5J2QA 2YHBA 1RTDA 1VSHA 4CGJA 3V1QA 3IS9A 5BR8K 3D2EB 4DV5K 3HPHA 4I6MB 1IBKK 3O9TA 1VQ4N 3MN5A 4PHTX 4U67L 1JCFA 4JHDB 1NKEA 3J80O 4ELUA 1V4TA 1ZBLA 1IKVA 4BC2A 4B3SK 3EE9A 4DR1K 3TI0A 1K8KA 5F2RA 1W2BM 4RW7A 3JS6A 4DSKA 1BQMA 4BQLA 1RFQA 3SPYA 1JCEA 3M8QA 1Z6RA 4H5WA 3DLRA 1J5OA 3NF8A 3TSUA 1DT9A 5M1FA 3U3YA 3KHYA 3M8RA 4FPAA 1BL3A 3HP6A 2Z1IA 4DR5K 4LF5K 2UXDK 3L2VA 4I9LA 4M41A 1ZBSA 3R6MA 1C0FA 1RDCA 3QBWA 1NMDA 4KI4A 5IWAK 1NJXA 3KWGA 4NYFA 3S3OA 4DR2K 4B9TA 5AQMA 1RT4A 4C8OA 4OPJA 3O08A 4RG8A 3AVHA 4EZ9A 2P5OA 2HF4A 2DFHA 4DLGA 4YOVA 1ZYQA 2A42A 5KI6A 1FW6A 3ZETA 4B3RK 1J5EK 3OBWA 3GOIA 4M45A 4Z4FA 4XH5A 3SQ4A 5A2QO 4K42A 1LWFA 1KVAA 3VTIA 4BC3A 2HHQA 1NGCA 2XY8A 3KLGA 1S9GA 4KAZA 4L8RB 3AVAA 2I5JA 2ZQBA 2WOMA 1WSFA 3OYNA 1NK5A 4KREA 3DLEA 4CIEA 4JAXA 4CBXA 4Y0WA 2UUCK 1N5YA 3HOTA 1NGFA 4LF9K 2FXUA 3ID6A 5BRDA 4BRGA 5JLFA 3OS2A 5BPNA 4B1WB 5GAHP 4JNEA 5BPLA 3DOLA 3K5LA 1VK0A 3WQUA 4Z0UA 2UXCK 1NM1A 4DS4A 4W5QA 2YNHA 4K8XA 1BI4A 1RDWX 1U2VA 4KTZA 3D2FA 4EIAA 1BIUA 3C95A 3CCSN 2WTUA 1LAVA 1NU0A 3T7ZA 4DV3K 1CZ9A 2VG7A 2VQFK 3QERA 2O8FA 1NMNA 5H1SQ 2ZD1A 1QQMA 4YOWA 3IKMA 2ETJA 2E2NA 3FLCO 3LP2A 4KO0A 3B6OA 2XY7A 1MA9B 4DSFA 4QOZB 1OVQA 3VQQA 3ZEUB 3ZT0A 1N6QA 3MDQA 3EYZA 1BCOA 3MECA 1N32K 1BCMA 2D4WA 4AHCA 4DQRA 3HJFA 3EO3A 1YVUA 3CC2N 1K8AO 4FW2A 4DS5A 5KQ8A 3KLFA 1QS4A 2QXFA 2PAVA 3MWTA 1NGBA 1W97L 2KFNA 4CFDA 3OYCA 1RBRA 3LWLA 1JJ2M 4NB4A 3ZX2A 2UU9K 4CJ7A 1GLLO 3FZFA 4PL7A 4CJRA 5FDLA 5KPRA 1HNVA 3AA2A 3FFKB 4FJJA 2RN2A 2CH6A 2CGLA 3GG4A 4QS9A 2G8UA 1C0GA 1OH5A 4FVMA 5KPZA 5HRSA 3KKSA 5TKYA 4B9NA 1YI2N 2P9IB 4FLWA 2E8AA 5ADXA 3NGZA 3SAFA 5LMNK 4HCCA 2Q36A 4B1UB 4X64K 3ENOA 1IKXA 2G8KA 1WBBA 2XY5A 1MDUB 1Q82O 2HNZA 1RBSA 3MXMA 3OYKA 4M3XA 3LM9A 4W5RA 4B9MA 1H1VA 3J7AP 2G8FA 3O9QA 3WEEB 1Y97A 4FOEA 4C1NI 1JL2A 1RT7A 3K5OA 1D5AA 1O1WA 1WSEA 4LH5A 2EWSA 1NK9A 4FJ8A 5CZ2A 3OW2M 2J4RA 1Q9XA 5KRSA 1VSLA 2QTDA 2ATQA 4JK9A 4ZHRA 4FLTA 4AHRA 4JI8K 4ISFA 3RSEB 3VQBA 1NK8A 2E1ZA 1JXEA 3ZSQA 3TAGA 4FYDA 1HPZA 1BU6O 1SKWA 3RRHA 3L2WA 1F21A 3PX4A 2RPIA 4RW6A 3U8XA 3U9DA 2P9UA 4FZYA 2Q31A 3A5MC 3CCEN 1YJ9N 1HLUA 2UUAK 3SLCA 1LW2A 1VAZA 2VG5A 2QXLA 4KB1A 3O1WA 4Z4CA 2P9KB 4XIUA 4YDUA 1C0MA 2F8SA 2NRWA 3I33A 1OH8A 4DR7K 4GW6A 3QETA 5FPNA 1WSGA 3V9UA 3CJ7A 4LF8K 3NH2A 4LSLA 4M7XA 3FZKA 3P1GA 1I39A 1REVA 3K2PA 3RMAA 2BE2A 1T6DA 4FZXC 4DQ8A 5ADXH 3OYFA 2XHBA 3SUQA 1SUQA 2QEXN 3A5OC 1RTIA 3ZSVA 3SMPA 4KTWA 2W42A 4H0YB 4WQ5C 4EZ6A 4JI3K 3O80A 3THXB 4FJ5A 5FRNA 1DGKN 2V7YA 1ESVA 3TSQA 4FPBA 4N5SA 4JI1K 3M8PA 4KRFA 4LF7K 2EHGA 3M1FA 3H6EA 3SZ2A 1TV6A 1XHXA 5KGXA 3DAWA 3I0SA 1K9MO 1YVNA 1GOAA 2AA4A 2YJFA 3T1AA 3W3DA 3J7YP 1NJWA 5M1OA 4CJ4A 4BVPA 2P51A 1WLJA 3CJ1A 2P9NB 4BROA 3OYJA 4E7KA 1QTMA 2F9WA 1NGIA 4O5FA 2KHOA 3A5LC 1GOCA 4CZJA 1VQ9N 4I7FA 3MN7A 1Z05A 4JKHA 3ZSWA 2KTQA 3BZCA 1J53A 4E7LA 4C8MA 3DM2A 1ZBHA 1FXXA 1VSKA 4CD3A 3JXUA 2WBNA 3LZIA 1HX1A 2YHWA 4CECA 2OZSA 1ATSA 3DXKB 3WXJA 4BQZA 3ZT4A 3SMSA 5DMRA 4DF8A 4ID1A 2A41A 4CHOA 5JMVA 5HLFA 2O8CA 4CGIA 1QSYA 5I42A 4DV7K 2ZGZA 4HTLA 2Q3SA 4FLZA 3DRPA 4CEQA 3E1YA 3EKUA 3OY9A 3C0BA 1VQ7N 4AHUA 4N41A 1KTQA 2CGJA 5JVHL 2F8TA 5C10A 3NAEA 1C1AA 3PLAA 4IOAL 2P9SA 1K8KB 3BP8A 3AGKA 1IBMK 5C2DA 2Q2RA 1JLQA 2QI2A 1QHTA 3NGIA 1NGAA 1JCGA 4H0XB 2HB5A 3VERA 4GVMA 3BGRA 5AQYA 1ITGA 2OTLN 2FBTA 1VQ6N 5AQVA 5HRRA 5J2MA 2CGKA 4O0IA 4CIFA 3QB0A 2Q1NA 4PKGA 4FOIA 3SV3A 5LY3A 4W5TA 2P9PB 5SZTA 5AQFA 1WSHA 3ZSXA 1BO5O 3IRXA 2QWLA 4M63C 3ULEB 1M90O 2IVOA 1E4GT 4CZKA 4YOXA 2H3GX 4B1YB 1ILYA 5FPEA 3J7ZO 3SYZA 3THYB 4CJLA 1VRTA 3ISNC 4IOXA 2ITMA 3QESA 3DLBA 1Z25A 3CMAN 4KV8A 3KVGA 1KFDA 3C7NA 1DLOA 4BRCA 1WBDA 3SJJA 3O3HA 4JI7K 3WXKA 2A6AA 3HVTA 4WF9L 1CXUA 1C6VA 3FZMA 2O4IA 3LM2A 2B5JA 4CZGA 1NLVA 4M7YA 3LPTA 4MO5A 1Q86O 4X65K 2BH1A 2P9LB 2FBYA 1C0UA 3GDQA 4FK0A 1BOTO 1JLBA 1YTAA 3CJ9A 1W7AA 3Q7BA 1SL1A 4M3UA 2RKIA 5LJWA 2VQEK 3WXMB 3CCUN 1Z26A 1RBVA 1KXPA 4FLXA 2AJQA 4F2RA 1EX4A 4MLHA 1ZBIA 4JKGB 1QQOA 2IVPA 4HWIA 2E88A 4WQ4A 1KC8O 5HRPA 2DFEA 1NGEA 3NH1A 1U2VB 1ZXOA 1G99A 3VEXA 4R5PA 4BRMA 1FKOA 3RMBA 1YHQN 2QWRA 1XWLA 1WB9A 4CGGA 1ZBUA 1IG9A 2HF3A 5JS2A 4B08A 1IKWA 3FZLA 3UKRA 3MCAB 3PO4A 4H5VA 1L3VA 3TAEA 2V52B 3LDQA 4O4GA 3MEEA 4CESA 1TUUA 1ASVA 2Q0UA 4BWJA 5AQLA 3DRRA 2WUSA 5KRTA 3WT0A 4BGAA 2YI1A 3KLIA 4FLUA 3VEOA 3QEPA 1XC9A 4A62A 2ASOA 1LV5A 4OGCA 3F9KA 2A40A 3O3GA 1U47A 4DSIA 4YHHK 5HOOA 3K57A 1QVGM 2OZMA 1HKBA 4F9OA 2QWOA 3PUFA 2QWNA 2YNGA 3VQPA 1VQ5N 3JAMO 4MFBA 3VGLA 2W6KA 3R1XA 1NGGA 3HSTB 3VQ4A 2VWBA 4KTQA 1L3SA 3C6TA 4H0VB 3H45C 3HXMA 1HNZK 4MO4A 4CHZA 1U48A 3S9HA 4HVJA 2JWKA 5DM7L 2RE2A 1HJRA 2OPSA 4BC5A 4DWIA 5FPMA 1X9WA 5AQUA 4CHQA 4CFBA 2D0OA 1D9DA 4DSLA 3OA9A 4BR0A 2YHXA 4A5BA 3S41A 3L3UA 3HI0A 4JKEA 4BDZA 3DLHA 1TK0A 2D0PA 4B8CA 4CJTA 5AQWA 4FJHA 1YXQA 1XI1A 1XNRK 4JI0K 3HSCA 3OYDA 1I3AA 2NUBA 5AQGA 3KTQA 1JXBA 3S3MA 3DMJA 3L0QA 4OPHA 5HRNA 3CMEN 2DTUA 4KHQA 1SAZA 3TU5A 3NH0A 4AILC 3F9MA 3SCXA 3TR8A 2NRHA 4KH5A 1SQKA 3IMXA 4B9QA 4RTFD 2DPNA 1NWKA 1JLEA 5M1NA 5AFUA 4DTOA 3ZX0A 3NF7A 3A5NC 3DLGA 4B8AB 2UUBK 3H3OB 3LP0A 1CZAN 4PQUA 4DLEA 4JN4A 1J6ZA 1S1VA 3VETA 4CEZA 3SUOA 2ZJPL 3MN9A 3E66A 1G15A 1K6YA 3HPGA 3CFRA 4E0DA 1QVFM 3PO5A 1D4XA 4ZTJA 2O8BB 4IDHA 3J81O 1JLGA 2D1KA 1NOYA 4ELVA 4H0PA 1WUAA 5AJ3K 3O6WA 4BWMA 1VQPN 1YIJN 4JI5K 5AZJB 4KHSA 4PKHA 1HMVA 4WQ4C 2KZZA 2NNWA 3L4QA 4CIGA 4I9QA 3VA0A 3AV9A 2FBVA 1WAFA 4ISEA 4A59A 4JYAK 3HO1A 4CJPA 3E9LA 4CEDA 1EQYA 4FXDA 2UYTA 4GVEA 4PL8A 4E1JA 4IOCL 1WSJA 3CG7A 5AQXA 1QQNA 5AZIA 4F2SA 1NGDA 1IO2A 3EN9A 3VTHA 4IFEA 4IFVA 2VWKA 3IUCA 5C24A 3SUPA 1QE1A 3MX2A 1D9FA 4NO7A 3CJBA 2WFBA 4DQQA 5GIOA 1JL1A 2IC3A 2W6LA 1IG8A 2GWKA 2IS3A 3TAMA 4QS7A 4DV1K 3CCJN 2RF2A 3VEZA 3CIPA 4DTSA 4XEIA 5AFUH 2HOEA 3SK3A 3HYFA 4CK2A 3CQYA 4O5BA 2NZTA 1A5XA 1KQSM 4CFAA 4JI4K 3PIOL 4OJRA 3WQTA 2FF6A 4A5AA 4JD2A 4NCGA 1TL3A 4H0OA 3M6GA 2KZMA 3ZT3A 1DTQA 4RWTA 4WFBL 4IO8A 2PY5A 5GADP 1NGHA 4H0TB 2O8CB 3TARA 4G9ZA 1E4FT 4ILJA 4JKCA 4OO1J 4GMJB 1RTHA 4OKEA 4CJWA 1QSSA 1N33K 4YNQA 1RDBA 2QWMA 5KQDA 5GINA 3LDLA 4BR2A 2HHTA 4O0JA 1T7PA 4LY7A 3SUNA 4BRKA 1TKDA 5ELZA 4EHUA 4WFNL 1Q8IA 3AA4A 1A5WA 1RT2A 3CC4N 2HBJA 1U45A 2D5RA 3MMVA 4CVNE 3HK2A 1EWRA 4K25A 1SKSA 3G25A 4LSNA 4AM7A 1L3TA 3CJAA 1ZBFA 3RVCA 3I8DA 1XMQK 4CZLA 1VSDA 1N8RO 4GNIA 3I0RA 5CE3A 3VN5A 2G8WA 3B6PA 1HQEA 1OVYA 3CYMA 3D0PA 1EO1A 3UB5A 3L2QA 2QM1A 2YNIA 4DTPA 3THWA 1VQLN 4E19A 2O8EA 2FF3B 2O4GA 4FK4A 2O8DA 3VENA 1UAXA 3ZSZA 3H08A 2KQ2A 3O8MA 1TK8A 1GLFO 4QCLA 4EP5A 1JLAA 4YY3K 2JLEA 2HBKA 2W40A 3A8YA 4I2PA 2QKKA 1BA1A 1KFSA 3HVRA 4A2BA 1HUXA 3VQEA 2KKZA 3OYMA 4BREA 4AM6A 1SKRA 5AR0A 4GKKK 1HPMA 4AHSA 2HVIA 5DM6L 3C7NB 4M3TA 1BDGA 1K73O 3AVFA 3HP9A 4EAHD 5FRMA 5E41A 3MN6A 4CGHA 4E3SA 3D2EA 4I6MA 2OA8A 1S1WA 3QDKA 4BRFA 3CC7N 4E89A 3CCQN 4JLHA 4CD1A 2R7YA 4JHDA 2ZWHA 4JV5K 4CBUA 3O9SA 2HMIA 5KGWA 1P8ZA 3L8BA 4JRPA 4CZFA 5HL7L 2Q97A 1YITN 4J2BA 1L5UA 4BGBA 2OCEA 3UKUA 2GWJA 1SS6A 4FO0A 3PIPL 3OYLA 3J8AA 4RW9A 4A61A 1YTUA 4DFKA 2HHSA 1ASWA 1MWMA 1KVCA 3P4IA 1ATRA 4BRAA 5MLCQ 3OJUA 4BRLA 4BRPA 3OYAA 1NK0A 3VQDA 4H4OA 5BR9A 2YV0X 5J2PA 1CLQA 1HNIA 2E2QA 3V9XA 4BR7A 1LAWA 3UKRB 4DV2K 3T3FA 2VG6A 2QKBA 1GLAG 3I56N 4GV9A 2G8VA 1X9SA 1ASUA 2V51B 2PBDA 2FC0A 3K5MA 3CI5A 2Z1HA 3WUHA 1EKEA 3CQXA 3DJCA 3E01A 5JICA 1LWCA 4DR4K 4FWOA 5FROA 5AQPA 4IJAA 4FWMA 4OPAA 4LFBK 1HKCA 3DOKA 4BC4A 3CQ8A 1U49A 1NNEA 4PWDA 1EWQA 1VRUA 3LDSA 3RR8A 3A0IX 3SPZA 4GY2B 3AVMA 3L6QA 3VF2A 3RWUA 2G8HA 2YJEA 1YAGA 2JGUA 1IKYA 2P5GA 3C65A 2GBZA 3QBXA 1RBUA 3VQ8A 1C1BA 4CE9A 4CGFA 1RT6A 4KHYA 3CXCM 2CH5A 1C1CA 2HW3A 4Z4EA 3GBTA 5LMUK 1TYQA 1X9MA 3MX5A 2GV9A 4RCHA 4B1ZA 4DCHA 2I7PA 4MQ3A 1OKJA 1HKGA 3K9KA 3P83D 4FWLA 4DUYK 4Z4IA 3SAHA 3LDNA 2EX3A 1S72N 4CCHA 5EVZA 4DTUA 5HP1A 4H4MA 3ZYYX 4KKOA 4NLCA 3IFRA 3DI6A 2LSNA 3OS1A 4FWRA 2IIRA 3G6EN 4B9UA 4EFHA 1S1TA 4LC9B 5FLXO 1IJJA 2DFFA 4W5NA 4E7IA 4M3RA 1RGIA 2F96A 3QICA 2ZJRL 3CFPA 4CJKA 5C25A 1GLBG 3AVGA 3EY1A 3AA3A 4DQSA 3BDPA 2QWPA 1C0TA 1NOZA 3TPQA 5C0YA 4FJ9A 2GUIA 3OYHA 4HCBA 2Q0RA 3DWLA 4ELTA 1GLJO 1MWKA 5AQJA 4BDPA 4BG9A 2A5XA 2HHVA 2OTJN 1VQ8N 4Y1CA 4TSXA 2B4JA 4CZMA 1T44A 1RDUA 4DKWA 4CHYA 1YUWA 4BRDA 3EE8A 3LDOA 1VSEA 3ENBA 3KLEA 2FLOA 3AO4A 2KLAA 3LWMA 3LPUA 5BN9A 4B3TK 2UXBK 4N47A 3V6DA 4ILHA 3K5NA 2PFUA 5C2FA 3ZETB 1J54A 4YDUC 1SL2A 1WOQA 1RBTA 4BRHA 4DV6K 3PSFA 1T03A 1VSFA 3QIPA 4NLBA 1VSMA 2ASMA 4B9LA 2NRXA 4JKAA 1XNQK 4W5OA 3WEEA 4FM2A 4Q0BA 3NMUA 3QO9A 3AVIA 4MDAA 1S9EA 3AGRA 3L2UA 2FSJA 1X9JA 4MLEA 2IAJA 3L4IA 1ZC6A 4Q5VA 3WNEA 4DU1A 2PZSA 2HNYA 3RSEA 3OHRA 3HM9A 3NFAA 4HTUA 4ISGA 3ZLJA 1KD1O 1QSLA 5EOYA 4LFAK 1BI4B 2YKNA 3LP3A 3D2FB 3AO1A 4CEFA 2F9TA 1KSPA 2YHYA 3MXJA 4BRQA 5AQSA 3LAMA 4DTMA 4RW4A 3PX6A 2O8FB 1X3NA 5JLHA 2IGIA 3HM8A 1RTJA 2NRVA 4H03B 1JKHA 3QFPA 1X1PA 3KIOA 1HNXK 4JS4A 3G0ZA 2YKMA 5I9EB 4JEPA 1CZBA 2NLXA 4LH4A 4DQIA 3LL3A 3CPEA 3S3NA 3ZT2A 3QINA 1CXQA 4FK2A 5CYQA 3MWPA 2Y1IA 2VWJA 3VF6A 3D6RA 3ZCMA 4I2QA 4IO9L 3F73A 3VA3A 1XQSC 1XHZA 3QFUA 3MXIA 4KH4A 4L3QA 3THXA 3R3LA 3HPOA 2IVNA 4CERA 5B8HA 3FE1A 4JKFA 3K58A 1SL0A 3JSMA 3MCPA 4FJLA 5E26A 2PYLA 4BR9A 4CJSA 4DQPA 2YX6A 3CETA 1KCFA 5KTQA 3OS0A
chains in the Genus database with same CATH topology
4OPKA 4DTJA 1UA1A 1JL1A 2IC3A 1LW2A 3QEIA 2VG5A 3D45A 3AVJA 4AH9A 4KB1A 4OLAA 2KFZA 4N41A 4Z4CA 4B9VA 4XIUA 2IS3A 1C0MA 3TAMA 2F8SA 2X6SA 1NJYA 4J2DA 4PA1A 1TGOA 4GW6A 5CZ1A 3QETA 2RF2A 3MAQA 2ITGA 4DTSA 5T7BA 1WSGA 3V9UA 3NH2A 4LSLA 3HYFA 1BIZA 1EXQA 3LALA 4CK2A 4O5BA 4RW8A 3HT3A 3PX0A 3P1GA 1I39A 1A5XA 2A1SA 4ICLA 4CFCA 3CM6A 1REVA 4CFAA 3K2PA 4OJRA 2BE2A 4UQGA 3RMAA 1S5JA 1NK7A 4FZXC 4O44A 4NCGA 1TL3A 1BHLA 4AHVA 4FM0A 4KHUA 2KZMA 3ZT3A 4DTRA 3AO3A 1DTQA 3AVBA 1T05A 3OYFA 3VQ6A 2PY5A 2XHBA 3SUQA 3NF9A 1SUQA 1JLCA 3LAKA 1RTIA 3V81A 3ZSVA 3TARA 4NCAA 3QEWA 1EP4A 4GMJB 1RILA 1RTHA 4OKEA 4KTWA 3VQAA 4CJWA 4LD0A 4YNQA 1RDAA 1RDBA 2W42A 1QSSA 4C8NA 4CJ3A 2Y1JA 2HHTA 4O0JA 4EZ6A 1NKBA 4FJ5A 1T7PA 1NK6A 4LY7A 5FRNA 4CJFA 3SUNA 1VSJA 1W9HA 1TKDA 3NGYA 4FM1A 2BDPA 1Q8IA 3AA4A 1A5WA 4CF0A 4N5SA 1RT2A 4KHNA 2YNFA 1U45A 5JS1A 3DRSA 3M8PA 4B9SA 2D5RA 4KRFA 2EHGA 1TKTA 3WNHA 3HK2A 4B3OA 5CYMA 3NDKA 2D0BA 3SZ2A 1BQNA 1UOCA 4LSNA 3VQ9A 1TV6A 1XHXA 3G10A 3OVNA 5KGXA 1HQUA 3ALYA 2D0CA 4OGEA 3ULDA 3SQ0A 3I0SA 4KHWA 1ZBFA 3I8DA 1VSDA 1GOAA 3ASMA 3CM5A 1SKSA 1KVBA 3SQ1A 3T1AA 3I0RA 1NJWA 3VN5A 4CJ4A 2G8WA 2P51A 3B6PA 2P1JA 1HQEA 1WLJA 3CYMA 4YFUA 3OYJA 4CEBA 1TVRA 3D0PA 4E7KA 1QTMA 1WNSA 3C6UA 3V9WA 3TANA 2HHXA 3L2QA 4PUOA 2YNIA 4FLVA 4DTPA 1EETA 3WNGA 4E19A 1GOCA 4QAGA 4M3WA 4CJUA 2O4GA 4I7FA 4CEOA 1RT1A 4CK1A 4FK4A 2KTQA 3ZSWA 1HRHA 3HL8A 1J53A 1UAXA 3ZSZA 3H08A 5D3GA 1D8YA 4E1MA 2KQ2A 4E7LA 1GOBA 2BGGA 4C8MA 3PV8A 3RMCA 1S1UA 1WAJA 2KW4A 3DM2A 4IFYA 1TK8A 3KD5E 4QCLA 5I3UA 4EP5A 3CFOA 1JLAA 1FXXA 1VSKA 1ZBHA 2IDOA 2Z1GA 2JLEA 3LZIA 2YHAA 3RMDA 1KLMA 4I2PA 5CY4A 4CECA 2QKKA 2OZSA 1KFSA 3HVRA 2XRIA 2ZE2A 5EU7A 3ZT4A 4KPYA 5DMRA 3VQEA 4DU3A 3KJVA 4DF8A 3OYMA 1SV5A 4ID1A 2E6LA 4CHOA 4KI6A 5HLFA 5J2NA 4CGIA 1QSYA 1SKRA 3VQ7A 5I42A 4AHSA 2HVIA 4E7JA 4FW1A 3K59A 4DFMA 2XY6A 1J9AA 4BACA 2Q3SA 4FLZA 4M3TA 4DTNA 1S1XA 4M3YA 3AVFA 3DRPA 3HP9A 4OKKA 4CEQA 5FRMA 1TL1A 3TABA 5E41A 3P5JA 3SV4A 1L3TA 1UWBA 4CGHA 4E3SA 1T8EA 1B9FA 2E4LA 3OY9A 3ZSOA 3ZSYA 4AHUA 1KTQA 1S1WA 2OA8A 3SQ2A 1IH7A 3AVNA 1C1AA 3NAEA 2F8TA 3KD1E 3AVCA 1NKCA 3KK3A 3JYTA 1Q9YA 4E89A 4JLHA 2R7YA 3EZ5A 4CEEA 4DSJA 2PYJA 4CF1A 1JLQA 3OYIA 1QHTA 4G1QA 1S6PA 5KGWA 3NGIA 2HMIA 4J2EA 2OYQA 3LP1A 3L8BA 4JRPA 2HB5A 4FJ8A 5K14A 4J2BA 1WN7A 1TKZA 3BGRA 4GVMA 3V1RA 4FJGA 1ITGA 2E6MA 3LZJA 1L5UA 3OYEA 3NF6A 5DK5A 4H8KA 2FBTA 3AVKA 4DG1A 1LW0A 3U6FA 5HRRA 3OJSA 3KLHA 5J2MA 3OYLA 1KRPA 4O0IA 4CIFA 3U3GA 4RW9A 1TK5A 1HYSA 1BGXT 4DFKA 4IG3A 1YTUA 2HHSA 4IBNA 1ASWA 1KVCA 5SWMA 3FFIA 3SV3A 2X78A 3QNOA 4N56A 2IOCA 4W5TA 3OJUA 3V9SA 4DU4A 3OYAA 5SZTA 3VQDA 1NK0A 1A5VA 4H4OA 3WNFA 2YV0X 5J2PA 3ZSXA 1WSHA 1CLQA 1QQCA 1HNIA 4FZZA 3V9XA 3IRXA 1LAWA 1RDDA 2HHWA 1UA0A 3L2RA 3T3FA 2VG6A 2QKBA 4OVLA 1S6QA 3M8SA 2G8IA 4IG0A 2X74A 4FJIA 3OYBA 3NCIA 4HHTA 2G8VA 5J2QA 1ASUA 2YHBA 1X9SA 1RTDA 4M42A 2FC0A 3K5MA 3SYZA 3QNNA 1VSHA 3V9ZA 2Z1HA 4CGJA 4CJLA 3NBPA 1VRTA 3V1QA 1EKEA 3IS9A 3ISNC 4DFPA 3QESA 3HPHA 3DLBA 2QK9A 3E01A 1Z25A 1LWCA 4HUFA 4KV8A 1KFDA 1DLOA 3SJJA 5FROA 4CJQA 3O3HA 3TWHA 1NKEA 3HVTA 1HYVA 4ELUA 2DY4A 1CXUA 1C6VA 1DTTA 3MEDA 2O4IA 1RCHA 1ZBLA 2B5JA 1IKVA 3O3FA 3LPTA 3TI0A 3DOKA 3CQ8A 1U49A 4ELVA 4F8RA 1BISA 2FBYA 3THVA 4PWDA 1VRUA 1C0UA 3LDSA 3RR8A 4RW7A 3SPZA 3AVMA 4DSKA 4FK0A 3RWUA 2G8HA 4K8ZA 1BQMA 4FCYA 2JGUA 3SPYA 1IKYA 1JLBA 1YTAA 2P5GA 2GBZA 3M8QA 4KB0A 4M3UA 1SL1A 4CJ5A 2RKIA 1RBUA 3VQ8A 1C1BA 3DLRA 1J5OA 3NF8A 1Z26A 4CE9A 4CGFA 1RBVA 1RT6A 4FLXA 3U3YA 4KHYA 2AJQA 3M8RA 3HP6A 1BL3A 4F2RA 2Z1IA 1EX4A 1ZBIA 4BE1A 3L2VA 1C1CA 2HW3A 4I9LA 4M41A 5HRPA 4CF9A 1RDCA 2DFEA 3NH1A 1X9MA 4Z4EA 4DMNA 4KI4A 2GV9A 1NJXA 4NYFA 4R5PA 3S3OA 4FLYA 4MQ3A 1FKOA 4B9TA 4AHTA 3RMBA 1RT4A 3P83D 1XWLA 4OPJA 4C8OA 4CGGA 1ZBUA 1IG9A 5JS2A 4C8KA 4RG8A 4B08A 4Z4IA 3AVHA 1IKWA 2EX3A 4EZ9A 2OPPA 4CF8A 2P5OA 4FJMA 4CCHA 2DFHA 4DTUA 4DLGA 5HP1A 4H4MA 3PO4A 1L3VA 3TAEA 4KKOA 1ZYQA 2X6NA 3KK1A 5KI6A 4O4GA 3MEEA 3VQ5A 3DI6A 2LSNA 3DLKA 4CESA 3OS1A 4OKJA 4JS5A 1ASVA 1JLFA 4M45A 4BWJA 4B9UA 4Z4FA 4PQUA 1S1TA 3DRRA 3SQ4A 1RNHA 4FJ7A 3QIOA 1LWFA 5KRTA 2DFFA 4W5NA 3AO5A 3KLIA 4M3RA 4E7IA 1KVAA 4FLUA 3QEPA 3L3VA 4Z4HA 4E1NA 2F96A 1XC9A 2HHQA 3CFPA 1LV5A 4CJKA 4OGCA 3F9KA 5C25A 3O3GA 1U47A 3AVGA 3EY1A 3AA3A 4DQSA 2XY8A 4DSIA 4DF4A 3BDPA 4EP4A 1C0TA 3KLGA 4IKFA 1NOZA 1S9GA 2XO7A 3K57A 3RRGA 4KAZA 4L8RB 3AVAA 4FJ9A 2GUIA 3OYHA 2ZQBA 2I5JA 2WOMA 1WSFA 3OYNA 1NK5A 2OZMA 3DLEA 4HCBA 4CIEA 4N76A 4KREA 3PUFA 4ELTA 1N5YA 2YNGA 1W0HA 3VQPA 4BDPA 4FJKA 1U04A 3T19A 2HHVA 3OS2A 4DFJA 4MFBA 4Y1CA 1HYZA 4HUGA 1B92A 4TSXA 3HSTB 2B4JA 3PY8A 1RT3A 3VQ4A 2Z1JA 3MEGA 3V1OA 4CGDA 4F4KA 3QEXA 4KTQA 4OLBA 2HHUA 3DOLA 3K5LA 4CHYA 1VK0A 4PY5A 1L3SA 4Z0UA 4CJEA 4M3ZA 4DS4A 4K8XA 4W5QA 2YNHA 3C6TA 1BI4A 1VSEA 3KLEA 3HXMA 3AO4A 4KTZA 3LWMA 4CHZA 1U48A 3A2FA 3S9HA 4HVJA 1FK9A 3O4QA 1BIUA 1HJRA 2OPSA 3LPUA 4HUEA 4CF2A 3C95A 1X9WA 1L3UA 4DWIA 4N47A 3V6DA 4CHQA 4CFBA 3K5NA 1LAVA 1D9DA 4DSEA 1CZ9A 2VG7A 4DSLA 1J54A 1SL2A 3QERA 1RBTA 4FJXA 4CHPA 2OPQA 2ZD1A 2FBXA 1T03A 1VSFA 3L3UA 3AO2A 3QIPA 3IAYA 3TAFA 2ETJA 4BDZA 1VSMA 3LP2A 4KO0A 1TK0A 3B6OA 4B8CA 3DLHA 4B9LA 2XY7A 5J1EA 4FJNA 4CJTA 4DSFA 4QOZB 4J2AA 3VQQA 4FJHA 1XI1A 3ZT0A 1N6QA 1TAUA 4W5OA 3EYZA 4FM2A 1BCOA 3MECA 4Q0BA 4Y1DA 1R0AA 1BCMA 1I3AA 2NUBA 3QO9A 4AHCA 3OYDA 4DQRA 3AVIA 4O55A 3TAQA 2A1RA 3HJFA 1YVUA 3KTQA 1JXBA 4Z4GA 3S3MA 1S9EA 3ITHA 4FW2A 3DMJA 4DS5A 3KLFA 1QS4A 2QXFA 3L2UA 3C94A 5HRNA 4C8LA 2DTUA 4KHQA 3NH0A 4AILC 2KFNA 2IAJA 3O4NA 4CFDA 1RBRA 3OYCA 3LWLA 4Q5VA 4ZTFA 3SCXA 3TR8A 4CHNA 3WNEA 4BE2A 4DU1A 2HNYA 4DTXA 2PZSA 4CJRA 5FDLA 3SI6A 1HNVA 3AA2A 4FJJA 3OYGA 2RN2A 3TAPA 4F3TA 1NJZA 2OPRA 3HM9A 3NFAA 4HTUA 3V4IA 5HBMA 2G8UA 1VSIA 1JLEA 3UIQA 4FVMA 3KK2A 4DTOA 1QSLA 5HRSA 3RTVA 1BI4B 3KKSA 3NF7A 2YKNA 2HNDA 3DLGA 4B8AB 2HVHA 3LP3A 3LP0A 3RR7A 4B9NA 3AO1A 3AVLA 3QEVA 3NHGA 4DLEA 4CEFA 1KSPA 1RT5A 4CEAA 1FKPA 1S1VA 3MXJA 4CEZA 3SNNA 3SUOA 3IG1A 3KKRA 1TAQA 4FLWA 3LAMA 4DTMA 4BDYA 4RW4A 3NGZA 1G15A 4HCCA 1K6YA 3HPGA 3CFRA 3PX6A 4E0DA 3PO5A 4ZTJA 2IGIA 2B6AA 1IKXA 1RTJA 3LANA 4ID5A 2G8KA 4CK3A 1JKHA 2XY5A 2HNZA 1RBSA 1JLGA 1X1PA 3MXMA 3OYKA 4M3XA 4NYNA 1TKXA 3KIOA 4W5RA 1NOYA 4IDKA 3QLHA 3DYAA 1MU2A 4JS4A 1LWEA 3G0ZA 2G8FA 2YKMA 4BWMA 4B9MA 3ZT1A 1CZBA 3AA5X 1Y97A 4KHSA 4LH4A 1JL2A 2BANA 4DQIA 1HMVA 1RT7A 3K5OA 4E7HA 4F3OA 1D5AA 3S3NA 1B9DA 1YT3A 2KZZA 3ZT2A 4WE1A 3QINA 1CXQA 1O1WA 1WSEA 4LH5A 1U4BA 4FK2A 4CIGA 5CYQA 1NK9A 4I9QA 5HROA 2WONA 3AV9A 2VWJA 3VA0A 2FBVA 1WAFA 2Y1IA 4NCBA 5CZ2A 1Q9XA 3HO1A 5KRSA 3ZCMA 4CJPA 1VSLA 4I2QA 2ATQA 3F73A 3VA3A 4CEDA 4ZHRA 1XHZA 4FLTA 4AHRA 4FXDA 1NK4A 3MXIA 4JRQA 3HPOA 3VQBA 4CERA 1NK8A 1JXEA 3ZSQA 1WSJA 3ZSRA 3TAGA 3CG7A 4FYDA 1HPZA 3K58A 1SL0A 1SKWA 3JSMA 1WSIA 3RRHA 1KLNA 4F2SA 2D0AA 4FJLA 4KFBA 1IO2A 4CJVA 3L2WA 3VQCA 2PYLA 1F21A 4IFVA 2RPIA 4RW6A 4CJSA 4BE0A 3PX4A 4DQPA 2VWKA 5C24A 5C42A 3SUPA 1QE1A 4FZYA 1D9FA 1KCFA 3NE6A 4DQQA 5KTQA 3OS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPK A;  4DTJ A;  1UA1 A;  1JL1 A;  2IC3 A;  1LW2 A;  3QEI A;  2VG5 A;  3D45 A;  3AVJ A;  4AH9 A;  4KB1 A;  4OLA A;  2KFZ A;  4N41 A;  4Z4C A;  4B9V A;  4XIU A;  2IS3 A;  1C0M A;  3TAM A;  2F8S A;  2X6S A;  1NJY A;  4J2D A;  4PA1 A;  1TGO A;  4GW6 A;  5CZ1 A;  3QET A;  2RF2 A;  3MAQ A;  2ITG A;  4DTS A;  5T7B A;  1WSG A;  3V9U A;  3NH2 A;  4LSL A;  3HYF A;  1BIZ A;  1EXQ A;  3LAL A;  4CK2 A;  4O5B A;  4RW8 A;  3HT3 A;  3PX0 A;  3P1G A;  1I39 A;  1A5X A;  2A1S A;  4ICL A;  4CFC A;  3CM6 A;  1REV A;  4CFA A;  3K2P A;  4OJR A;  2BE2 A;  4UQG A;  3RMA A;  1S5J A;  1NK7 A;  4FZX C;  4O44 A;  4NCG A;  1TL3 A;  1BHL A;  4AHV A;  4FM0 A;  4KHU A;  2KZM A;  3ZT3 A;  4DTR A;  3AO3 A;  1DTQ A;  3AVB A;  1T05 A;  3OYF A;  3VQ6 A;  2PY5 A;  2XHB A;  3SUQ A;  3NF9 A;  1SUQ A;  1JLC A;  3LAK A;  1RTI A;  3V81 A;  3ZSV A;  3TAR A;  4NCA A;  3QEW A;  1EP4 A;  4GMJ B;  1RIL A;  1RTH A;  4OKE A;  4KTW A;  3VQA A;  4CJW A;  4LD0 A;  4YNQ A;  1RDA A;  1RDB A;  2W42 A;  1QSS A;  4C8N A;  4CJ3 A;  2Y1J A;  2HHT A;  4O0J A;  4EZ6 A;  1NKB A;  4FJ5 A;  1T7P A;  1NK6 A;  4LY7 A;  5FRN A;  4CJF A;  3SUN A;  1VSJ A;  1W9H A;  1TKD A;  3NGY A;  4FM1 A;  2BDP A;  1Q8I A;  3AA4 A;  1A5W A;  4CF0 A;  4N5S A;  1RT2 A;  4KHN A;  2YNF A;  1U45 A;  5JS1 A;  3DRS A;  3M8P A;  4B9S A;  2D5R A;  4KRF A;  2EHG A;  1TKT A;  3WNH A;  3HK2 A;  4B3O A;  5CYM A;  3NDK A;  2D0B A;  3SZ2 A;  1BQN A;  1UOC A;  4LSN A;  3VQ9 A;  1TV6 A;  1XHX A;  3G10 A;  3OVN A;  5KGX A;  1HQU A;  3ALY A;  2D0C A;  4OGE A;  3ULD A;  3SQ0 A;  3I0S A;  4KHW A;  1ZBF A;  3I8D A;  1VSD A;  1GOA A;  3ASM A;  3CM5 A;  1SKS A;  1KVB A;  3SQ1 A;  3T1A A;  3I0R A;  1NJW A;  3VN5 A;  4CJ4 A;  2G8W A;  2P51 A;  3B6P A;  2P1J A;  1HQE A;  1WLJ A;  3CYM A;  4YFU A;  3OYJ A;  4CEB A;  1TVR A;  3D0P A;  4E7K A;  1QTM A;  1WNS A;  3C6U A;  3V9W A;  3TAN A;  2HHX A;  3L2Q A;  4PUO A;  2YNI A;  4FLV A;  4DTP A;  1EET A;  3WNG A;  4E19 A;  1GOC A;  4QAG A;  4M3W A;  4CJU A;  2O4G A;  4I7F A;  4CEO A;  1RT1 A;  4CK1 A;  4FK4 A;  2KTQ A;  3ZSW A;  1HRH A;  3HL8 A;  1J53 A;  1UAX A;  3ZSZ A;  3H08 A;  5D3G A;  1D8Y A;  4E1M A;  2KQ2 A;  4E7L A;  1GOB A;  2BGG A;  4C8M A;  3PV8 A;  3RMC A;  1S1U A;  1WAJ A;  2KW4 A;  3DM2 A;  4IFY A;  1TK8 A;  3KD5 E;  4QCL A;  5I3U A;  4EP5 A;  3CFO A;  1JLA A;  1FXX A;  1VSK A;  1ZBH A;  2IDO A;  2Z1G A;  2JLE A;  3LZI A;  2YHA A;  3RMD A;  1KLM A;  4I2P A;  5CY4 A;  4CEC A;  2QKK A;  2OZS A;  1KFS A;  3HVR A;  2XRI A;  2ZE2 A;  5EU7 A;  3ZT4 A;  4KPY A;  5DMR A;  3VQE A;  4DU3 A;  3KJV A;  4DF8 A;  3OYM A;  1SV5 A;  4ID1 A;  2E6L A;  4CHO A;  4KI6 A;  5HLF A;  5J2N A;  4CGI A;  1QSY A;  1SKR A;  3VQ7 A;  5I42 A;  4AHS A;  2HVI A;  4E7J A;  4FW1 A;  3K59 A;  4DFM A;  2XY6 A;  1J9A A;  4BAC A;  2Q3S A;  4FLZ A;  4M3T A;  4DTN A;  1S1X A;  4M3Y A;  3AVF A;  3DRP A;  3HP9 A;  4OKK A;  4CEQ A;  5FRM A;  1TL1 A;  3TAB A;  5E41 A;  3P5J A;  3SV4 A;  1L3T A;  1UWB A;  4CGH A;  4E3S A;  1T8E A;  1B9F A;  2E4L A;  3OY9 A;  3ZSO A;  3ZSY A;  4AHU A;  1KTQ A;  1S1W A;  2OA8 A;  3SQ2 A;  1IH7 A;  3AVN A;  1C1A A;  3NAE A;  2F8T A;  3KD1 E;  3AVC A;  1NKC A;  3KK3 A;  3JYT A;  1Q9Y A;  4E89 A;  4JLH A;  2R7Y A;  3EZ5 A;  4CEE A;  4DSJ A;  2PYJ A;  4CF1 A;  1JLQ A;  3OYI A;  1QHT A;  4G1Q A;  1S6P A;  5KGW A;  3NGI A;  2HMI A;  4J2E A;  2OYQ A;  3LP1 A;  3L8B A;  4JRP A;  2HB5 A;  4FJ8 A;  5K14 A;  4J2B A;  1WN7 A;  1TKZ A;  3BGR A;  4GVM A;  3V1R A;  4FJG A;  1ITG A;  2E6M A;  3LZJ A;  1L5U A;  3OYE A;  3NF6 A;  5DK5 A;  4H8K A;  2FBT A;  3AVK A;  4DG1 A;  1LW0 A;  3U6F A;  5HRR A;  3OJS A;  3KLH A;  5J2M A;  3OYL A;  1KRP A;  4O0I A;  4CIF A;  3U3G A;  4RW9 A;  1TK5 A;  1HYS A;  1BGX T;  4DFK A;  4IG3 A;  1YTU A;  2HHS A;  4IBN A;  1ASW A;  1KVC A;  5SWM A;  3FFI A;  3SV3 A;  2X78 A;  3QNO A;  4N56 A;  2IOC A;  4W5T A;  3OJU A;  3V9S A;  4DU4 A;  3OYA A;  5SZT A;  3VQD A;  1NK0 A;  1A5V A;  4H4O A;  3WNF A;  2YV0 X;  5J2P A;  3ZSX A;  1WSH A;  1CLQ A;  1QQC A;  1HNI A;  4FZZ A;  3V9X A;  3IRX A;  1LAW A;  1RDD A;  2HHW A;  1UA0 A;  3L2R A;  3T3F A;  2VG6 A;  2QKB A;  4OVL A;  1S6Q A;  3M8S A;  2G8I A;  4IG0 A;  2X74 A;  4FJI A;  3OYB A;  3NCI A;  4HHT A;  2G8V A;  5J2Q A;  1ASU A;  2YHB A;  1X9S A;  1RTD A;  4M42 A;  2FC0 A;  3K5M A;  3SYZ A;  3QNN A;  1VSH A;  3V9Z A;  2Z1H A;  4CGJ A;  4CJL A;  3NBP A;  1VRT A;  3V1Q A;  1EKE A;  3IS9 A;  3ISN C;  4DFP A;  3QES A;  3HPH A;  3DLB A;  2QK9 A;  3E01 A;  1Z25 A;  1LWC A;  4HUF A;  4KV8 A;  1KFD A;  1DLO A;  3SJJ A;  5FRO A;  4CJQ A;  3O3H A;  3TWH A;  1NKE A;  3HVT A;  1HYV A;  4ELU A;  2DY4 A;  1CXU A;  1C6V A;  1DTT A;  3MED A;  2O4I A;  1RCH A;  1ZBL A;  2B5J A;  1IKV A;  3O3F A;  3LPT A;  3TI0 A;  3DOK A;  3CQ8 A;  1U49 A;  4ELV A;  4F8R A;  1BIS A;  2FBY A;  3THV A;  4PWD A;  1VRU A;  1C0U A;  3LDS A;  3RR8 A;  4RW7 A;  3SPZ A;  3AVM A;  4DSK A;  4FK0 A;  3RWU A;  2G8H A;  4K8Z A;  1BQM A;  4FCY A;  2JGU A;  3SPY A;  1IKY A;  1JLB A;  1YTA A;  2P5G A;  2GBZ A;  3M8Q A;  4KB0 A;  4M3U A;  1SL1 A;  4CJ5 A;  2RKI A;  1RBU A;  3VQ8 A;  1C1B A;  3DLR A;  1J5O A;  3NF8 A;  1Z26 A;  4CE9 A;  4CGF A;  1RBV A;  1RT6 A;  4FLX A;  3U3Y A;  4KHY A;  2AJQ A;  3M8R A;  3HP6 A;  1BL3 A;  4F2R A;  2Z1I A;  1EX4 A;  1ZBI A;  4BE1 A;  3L2V A;  1C1C A;  2HW3 A;  4I9L A;  4M41 A;  5HRP A;  4CF9 A;  1RDC A;  2DFE A;  3NH1 A;  1X9M A;  4Z4E A;  4DMN A;  4KI4 A;  2GV9 A;  1NJX A;  4NYF A;  4R5P A;  3S3O A;  4FLY A;  4MQ3 A;  1FKO A;  4B9T A;  4AHT A;  3RMB A;  1RT4 A;  3P83 D;  1XWL A;  4OPJ A;  4C8O A;  4CGG A;  1ZBU A;  1IG9 A;  5JS2 A;  4C8K A;  4RG8 A;  4B08 A;  4Z4I A;  3AVH A;  1IKW A;  2EX3 A;  4EZ9 A;  2OPP A;  4CF8 A;  2P5O A;  4FJM A;  4CCH A;  2DFH A;  4DTU A;  4DLG A;  5HP1 A;  4H4M A;  3PO4 A;  1L3V A;  3TAE A;  4KKO A;  1ZYQ A;  2X6N A;  3KK1 A;  5KI6 A;  4O4G A;  3MEE A;  3VQ5 A;  3DI6 A;  2LSN A;  3DLK A;  4CES A;  3OS1 A;  4OKJ A;  4JS5 A;  1ASV A;  1JLF A;  4M45 A;  4BWJ A;  4B9U A;  4Z4F A;  4PQU A;  1S1T A;  3DRR A;  3SQ4 A;  1RNH A;  4FJ7 A;  3QIO A;  1LWF A;  5KRT A;  2DFF A;  4W5N A;  3AO5 A;  3KLI A;  4M3R A;  4E7I A;  1KVA A;  4FLU A;  3QEP A;  3L3V A;  4Z4H A;  4E1N A;  2F96 A;  1XC9 A;  2HHQ A;  3CFP A;  1LV5 A;  4CJK A;  4OGC A;  3F9K A;  5C25 A;  3O3G A;  1U47 A;  3AVG A;  3EY1 A;  3AA3 A;  4DQS A;  2XY8 A;  4DSI A;  4DF4 A;  3BDP A;  4EP4 A;  1C0T A;  3KLG A;  4IKF A;  1NOZ A;  1S9G A;  2XO7 A;  3K57 A;  3RRG A;  4KAZ A;  4L8R B;  3AVA A;  4FJ9 A;  2GUI A;  3OYH A;  2ZQB A;  2I5J A;  2WOM A;  1WSF A;  3OYN A;  1NK5 A;  2OZM A;  3DLE A;  4HCB A;  4CIE A;  4N76 A;  4KRE A;  3PUF A;  4ELT A;  1N5Y A;  2YNG A;  1W0H A;  3VQP A;  4BDP A;  4FJK A;  1U04 A;  3T19 A;  2HHV A;  3OS2 A;  4DFJ A;  4MFB A;  4Y1C A;  1HYZ A;  4HUG A;  1B92 A;  4TSX A;  3HST B;  2B4J A;  3PY8 A;  1RT3 A;  3VQ4 A;  2Z1J A;  3MEG A;  3V1O A;  4CGD A;  4F4K A;  3QEX A;  4KTQ A;  4OLB A;  2HHU A;  3DOL A;  3K5L A;  4CHY A;  1VK0 A;  4PY5 A;  1L3S A;  4Z0U A;  4CJE A;  4M3Z A;  4DS4 A;  4K8X A;  4W5Q A;  2YNH A;  3C6T A;  1BI4 A;  1VSE A;  3KLE A;  3HXM A;  3AO4 A;  4KTZ A;  3LWM A;  4CHZ A;  1U48 A;  3A2F A;  3S9H A;  4HVJ A;  1FK9 A;  3O4Q A;  1BIU A;  1HJR A;  2OPS A;  3LPU A;  4HUE A;  4CF2 A;  3C95 A;  1X9W A;  1L3U A;  4DWI A;  4N47 A;  3V6D A;  4CHQ A;  4CFB A;  3K5N A;  1LAV A;  1D9D A;  4DSE A;  1CZ9 A;  2VG7 A;  4DSL A;  1J54 A;  1SL2 A;  3QER A;  1RBT A;  4FJX A;  4CHP A;  2OPQ A;  2ZD1 A;  2FBX A;  1T03 A;  1VSF A;  3L3U A;  3AO2 A;  3QIP A;  3IAY A;  3TAF A;  2ETJ A;  4BDZ A;  1VSM A;  3LP2 A;  4KO0 A;  1TK0 A;  3B6O A;  4B8C A;  3DLH A;  4B9L A;  2XY7 A;  5J1E A;  4FJN A;  4CJT A;  4DSF A;  4QOZ B;  4J2A A;  3VQQ A;  4FJH A;  1XI1 A;  3ZT0 A;  1N6Q A;  1TAU A;  4W5O A;  3EYZ A;  4FM2 A;  1BCO A;  3MEC A;  4Q0B A;  4Y1D A;  1R0A A;  1BCM A;  1I3A A;  2NUB A;  3QO9 A;  4AHC A;  3OYD A;  4DQR A;  3AVI A;  4O55 A;  3TAQ A;  2A1R A;  3HJF A;  1YVU A;  3KTQ A;  1JXB A;  4Z4G A;  3S3M A;  1S9E A;  3ITH A;  4FW2 A;  3DMJ A;  4DS5 A;  3KLF A;  1QS4 A;  2QXF A;  3L2U A;  3C94 A;  5HRN A;  4C8L A;  2DTU A;  4KHQ A;  3NH0 A;  4AIL C;  2KFN A;  2IAJ A;  3O4N A;  4CFD A;  1RBR A;  3OYC A;  3LWL A;  4Q5V A;  4ZTF A;  3SCX A;  3TR8 A;  4CHN A;  3WNE A;  4BE2 A;  4DU1 A;  2HNY A;  4DTX A;  2PZS A;  4CJR A;  5FDL A;  3SI6 A;  1HNV A;  3AA2 A;  4FJJ A;  3OYG A;  2RN2 A;  3TAP A;  4F3T A;  1NJZ A;  2OPR A;  3HM9 A;  3NFA A;  4HTU A;  3V4I A;  5HBM A;  2G8U A;  1VSI A;  1JLE A;  3UIQ A;  4FVM A;  3KK2 A;  4DTO A;  1QSL A;  5HRS A;  3RTV A;  1BI4 B;  3KKS A;  3NF7 A;  2YKN A;  2HND A;  3DLG A;  4B8A B;  2HVH A;  3LP3 A;  3LP0 A;  3RR7 A;  4B9N A;  3AO1 A;  3AVL A;  3QEV A;  3NHG A;  4DLE A;  4CEF A;  1KSP A;  1RT5 A;  4CEA A;  1FKP A;  1S1V A;  3MXJ A;  4CEZ A;  3SNN A;  3SUO A;  3IG1 A;  3KKR A;  1TAQ A;  4FLW A;  3LAM A;  4DTM A;  4BDY A;  4RW4 A;  3NGZ A;  1G15 A;  4HCC A;  1K6Y A;  3HPG A;  3CFR A;  3PX6 A;  4E0D A;  3PO5 A;  4ZTJ A;  2IGI A;  2B6A A;  1IKX A;  1RTJ A;  3LAN A;  4ID5 A;  2G8K A;  4CK3 A;  1JKH A;  2XY5 A;  2HNZ A;  1RBS A;  1JLG A;  1X1P A;  3MXM A;  3OYK A;  4M3X A;  4NYN A;  1TKX A;  3KIO A;  4W5R A;  1NOY A;  4IDK A;  3QLH A;  3DYA A;  1MU2 A;  4JS4 A;  1LWE A;  3G0Z A;  2G8F A;  2YKM A;  4BWM A;  4B9M A;  3ZT1 A;  1CZB A;  3AA5 X;  1Y97 A;  4KHS A;  4LH4 A;  1JL2 A;  2BAN A;  4DQI A;  1HMV A;  1RT7 A;  3K5O A;  4E7H A;  4F3O A;  1D5A A;  3S3N A;  1B9D A;  1YT3 A;  2KZZ A;  3ZT2 A;  4WE1 A;  3QIN A;  1CXQ A;  1O1W A;  1WSE A;  4LH5 A;  1U4B A;  4FK2 A;  4CIG A;  5CYQ A;  1NK9 A;  4I9Q A;  5HRO A;  2WON A;  3AV9 A;  2VWJ A;  3VA0 A;  2FBV A;  1WAF A;  2Y1I A;  4NCB A;  5CZ2 A;  1Q9X A;  3HO1 A;  5KRS A;  3ZCM A;  4CJP A;  1VSL A;  4I2Q A;  2ATQ A;  3F73 A;  3VA3 A;  4CED A;  4ZHR A;  1XHZ A;  4FLT A;  4AHR A;  4FXD A;  1NK4 A;  3MXI A;  4JRQ A;  3HPO A;  3VQB A;  4CER A;  1NK8 A;  1JXE A;  3ZSQ A;  1WSJ A;  3ZSR A;  3TAG A;  3CG7 A;  4FYD A;  1HPZ A;  3K58 A;  1SL0 A;  1SKW A;  3JSM A;  1WSI A;  3RRH A;  1KLN A;  4F2S A;  2D0A A;  4FJL A;  4KFB A;  1IO2 A;  4CJV A;  3L2W A;  3VQC A;  2PYL A;  1F21 A;  4IFV A;  2RPI A;  4RW6 A;  4CJS A;  4BE0 A;  3PX4 A;  4DQP A;  2VWK A;  5C24 A;  5C42 A;  3SUP A;  1QE1 A;  4FZY A;  1D9F A;  1KCF A;  3NE6 A;  4DQQ A;  5KTQ A;  3OS0 A; 
#chains in the Genus database with same CATH topology
 3AVJ A;  4KHP K;  4B9V A;  3THW B;  4IJN A;  3M3Z A;  1NJY A;  4J2D A;  2O8E B;  3AAR A;  1TGO A;  3MAQ A;  2O8D B;  1ATN A;  2ITG A;  4FWN A;  4OX9 K;  3TTC A;  1BIZ A;  3LAL A;  3HT3 A;  4RW8 A;  4B3M K;  2A1S A;  3I55 N;  4UQG A;  2ZF5 O;  3VPZ A;  4KH6 A;  1BHL A;  3CCM N;  4KHU A;  1XMO K;  2FSN A;  3AO3 A;  2HMP A;  3ID8 A;  3AVB A;  1T05 A;  3NF9 A;  5AQZ A;  3LAK A;  1XC3 A;  4ILG B;  3V81 A;  4NCA A;  4EHT A;  3QEW A;  1KAX A;  1EP4 A;  3BEX A;  3BY5 A;  3VQA A;  3D7E O;  4LD0 A;  3KK7 A;  4Z94 A;  2QW9 A;  1BUP A;  3KWI A;  5E84 A;  2Y1J A;  3B8A X;  3P38 A;  1NKB A;  4DHY A;  3VOV A;  1VSJ A;  1W9H A;  3NGY A;  4FM1 A;  1KAY A;  5AQH A;  2BDP A;  3GL1 A;  2E20 A;  4X62 K;  4KHN A;  5F1X A;  5JS1 A;  4B9S A;  1GLD G;  1TKT A;  4B3O A;  5CYM A;  3NDK A;  2P9U B;  3SBT A;  3VQ9 A;  3TAP A;  3ULD A;  3EZW A;  1HQU A;  2D0C A;  3SQ0 A;  3BF1 A;  4DV4 K;  4KHW A;  3ASM A;  3CM5 A;  1KVB A;  5AQO A;  3F2K A;  4AF1 A;  3UKU B;  4FWK A;  1GLE G;  4YFU A;  3NVM A;  1XUP O;  3C6U A;  1N36 K;  3TAN A;  3CJC A;  4PUO A;  4FLV A;  3MK6 A;  1EET A;  3HTV A;  1I94 K;  2HBM A;  5BRF A;  4M3W A;  4CJU A;  4CEO A;  5FPD A;  1RT1 A;  4CK1 A;  4E1M A;  1GOB A;  2E2P A;  3RMC A;  1S1U A;  1WAJ A;  4IFY A;  3KD5 E;  3CFO A;  5EX5 A;  3ZX3 A;  5BRH A;  2IDO A;  2YHA A;  2P9P A;  1X3M A;  1KLM A;  3EL2 A;  1N34 K;  4KPY A;  3H46 O;  5CR4 A;  4DU3 A;  5LJV A;  3ULE A;  4KI6 A;  5J2N A;  5AQI A;  5JVG L;  3K59 A;  4DFM A;  2XY6 A;  1LOT B;  1J9A A;  4AQY K;  1VQN N;  4NXM K;  4DTN A;  4K43 A;  4OKK A;  3THY A;  3VES A;  3LDP A;  5AQT A;  2ZJQ L;  3P5J A;  3SV4 A;  1UWB A;  3CCV N;  2E4L A;  3ZSO A;  3ZSY A;  3SQ2 A;  1IH7 A;  3KD1 E;  3AVC A;  1NKC A;  3JYT A;  1Q9Y A;  4CEE A;  4DSJ A;  2PYJ A;  4GKJ K;  3OYI A;  2FSK A;  3N4P A;  3O1B A;  2P9L A;  5K14 A;  3V1R A;  4FJG A;  2E6M A;  3LZJ A;  3ENH A;  3OYE A;  3NF6 A;  3OBY A;  4DG1 A;  1S22 A;  3U6F A;  3OJS A;  4LFC K;  4LF6 K;  1TK5 A;  1BGX T;  4IG3 A;  4IBN A;  1TYQ B;  3FFI A;  2X78 A;  3QNO A;  1QZ6 A;  1HJO A;  3V9S A;  3O9U A;  4JKG A;  3WNF A;  4QS8 A;  4CI6 A;  3K0S A;  1QQC A;  2BUP A;  4WQ5 A;  4FZZ A;  3DXM A;  4IZ9 A;  2HHW A;  1UA0 A;  2W41 A;  3L2R A;  5EXW A;  1TUY A;  3M8S A;  2G8I A;  4IG0 A;  2X74 A;  4XH4 A;  3OYB A;  4HHT A;  4M42 A;  4WYB A;  3QNN A;  3V9Z A;  3G71 N;  3CF5 L;  3NBP A;  2A3Z A;  4DFP A;  3WXL A;  2QK9 A;  4HUF A;  3UE5 A;  3VEV A;  2P9S B;  3PSI A;  4CJQ A;  3TWH A;  1HYV A;  2DY4 A;  1T3V A;  1DTT A;  2GEL A;  3ATV A;  1RCH A;  3MED A;  4BG8 A;  3C6H A;  3O3F A;  4A57 A;  4FSV A;  4F8R A;  1BIS A;  5C12 A;  3THV A;  3QML A;  3TTF A;  3TTD A;  4JI2 K;  4K8Z A;  2JWL A;  4FCY A;  2HVH A;  4KB0 A;  1QHA A;  3T1H K;  4CJ5 A;  5GIP A;  2ASP A;  2NRZ A;  2HHH K;  2E2O A;  4BE1 A;  4H5N A;  4CF9 A;  4O8U A;  2RHK A;  4DMN A;  2GX9 A;  1YJN N;  1IBL K;  2F7T A;  4FLY A;  4B1X B;  1GLC G;  4AHT A;  5GAE P;  1OH7 A;  4IEE A;  4BVO A;  4R79 A;  4C8K A;  3EKS A;  2OPP A;  4CF8 A;  4FJM A;  2ZGY A;  2X6N A;  3KK1 A;  3VQ5 A;  4JS5 A;  3DLK A;  4OKJ A;  1JLF A;  4JKD A;  1NJI O;  4YOR A;  1T6C A;  1RNH A;  5BRE A;  3QIO A;  4FJ7 A;  1BA0 A;  1SZ2 A;  3AO5 A;  3L3V A;  4Z4H A;  2VYP A;  4E1N A;  4J8F A;  4O8K A;  1Y64 A;  3KZB A;  4DF4 A;  4EP4 A;  4NXN K;  3HOS A;  3VEY A;  4IKF A;  2XO7 A;  3RRG A;  3WXI A;  4N76 A;  3P31 A;  2GEM A;  3SAG A;  1W0H A;  4FJK A;  1U04 A;  3T19 A;  5AQR A;  4WFA L;  4DFJ A;  4HUG A;  1HYZ A;  1B92 A;  1OH6 A;  2F4V K;  3PY8 A;  1RT3 A;  5AQK A;  2Z1J A;  3MEG A;  3V1O A;  4CGD A;  4F4K A;  3QEX A;  4OLB A;  2HHU A;  4H5R A;  4PY5 A;  4CJE A;  2OAN A;  4M3Z A;  3E9O A;  3A2F A;  5GAG P;  2ZM6 K;  1FK9 A;  3O4Q A;  4HUE A;  4CF2 A;  1L3U A;  4LF4 K;  4DSE A;  3BUZ B;  4CHP A;  4FJX A;  2OPQ A;  2O8B A;  4CZH A;  2FBX A;  3IAY A;  3AO2 A;  1M1K O;  3TAF A;  2YCH A;  4FJN A;  4U7B A;  5J1E A;  2NRR A;  1DEJ A;  4J2A A;  1V4S A;  1TAU A;  5AZJ A;  4Y1D A;  1R0A A;  5BPM A;  3TAQ A;  4O55 A;  1Q7Y O;  2A1R A;  5M1K A;  4Z4G A;  2E5L K;  3ITH A;  4C8L A;  3C94 A;  2V7Z A;  3CPW M;  3O4N A;  4ZTF A;  3CCR N;  4CHN A;  4MDB A;  4BE2 A;  4DTX A;  3SI6 A;  2QWQ A;  3OYG A;  3M5R A;  1NJZ A;  2OPR A;  1KAZ A;  3V4I A;  5HBM A;  5LL6 Z;  4CBW A;  1VSI A;  1VQM N;  3VMF B;  4FVU A;  3UIQ A;  3KK2 A;  3NVK A;  3Q7C A;  3RTV A;  3VGM A;  1VHX A;  2HND A;  3RR7 A;  1Q18 A;  3AVL A;  3FZH A;  4KBO A;  3NHG A;  3QEV A;  1RT5 A;  4CEA A;  1FKP A;  3SNN A;  3IG1 A;  3KKR A;  1TAQ A;  4DB3 A;  5C15 A;  4BDY A;  3F5T A;  1E3M A;  3VEW A;  1YF5 L;  2B6A A;  3VF4 A;  4BRI A;  4ID5 A;  3LAN A;  4CK3 A;  1HNW K;  2AP1 A;  2VGM A;  3G4S N;  4NYN A;  1TKX A;  4IDK A;  3QLH A;  3DYA A;  1MU2 A;  1LWE A;  3IDH A;  3ZT1 A;  3AA5 X;  1BWF O;  4CZE A;  5M1P A;  4F3O A;  2BAN A;  4E7H A;  5EY4 A;  1B9D A;  1YT3 A;  4V19 S;  4WE1 A;  1U4B A;  3H1V X;  3ZEU A;  2WON A;  4YOT A;  5HRO A;  4NCB A;  1NK4 A;  2QA4 N;  4JRQ A;  3R9P A;  4C1N K;  4H5T A;  2GTD A;  3ZSR A;  1R59 O;  4WCE L;  3C6A A;  3R8E A;  1WSI A;  1KLN A;  2D0A A;  1Q81 O;  4KFB A;  4CJV A;  3VQC A;  3CCL N;  4BE0 A;  5C42 A;  4X66 K;  3NE6 A;  4OPK A;  4DTJ A;  3W0L A;  1UA1 A;  3QEI A;  3D45 A;  4AH9 A;  4OLA A;  2KFZ A;  1VQK N;  2X6S A;  5F0X A;  1NBW A;  4PA1 A;  2E1Y A;  4BR5 A;  5CZ1 A;  2WC9 A;  1DKG D;  5T7B A;  3U4L A;  3FGU A;  2P9I A;  5CHI A;  1NG9 A;  4JKB A;  1EXQ A;  3PX0 A;  4UY8 O;  4ICL A;  4CFC A;  3CM6 A;  1LCU A;  1S5J A;  1NK7 A;  3K9J A;  2HST A;  4O44 A;  4FL9 A;  4FM0 A;  4AHV A;  5AQN A;  4DTR A;  4IEI A;  2NRT A;  3VQ6 A;  5BN8 A;  1JLC A;  1VQO N;  4C23 A;  4DV0 K;  1RIL A;  1RDA A;  1U6Z A;  4C8N A;  3TSP A;  4CJ3 A;  4JI6 K;  3BZK A;  4DUZ K;  1NK6 A;  4CJF A;  3GE1 A;  4GV6 A;  3HZ6 A;  3AAQ A;  4CF0 A;  2YNF A;  5AZI B;  3DRS A;  4YOY A;  3U9Z A;  3WNH A;  2D0B A;  3HRG A;  1BQN A;  1UOC A;  3H3N O;  1KRP A;  3G10 A;  3OVN A;  3ALY A;  4OGE A;  3N4Q A;  3I8B A;  4BR4 A;  4IWV A;  3O9R A;  3SQ1 A;  1P90 A;  2P1J A;  5M1Q A;  3T69 A;  3OTO K;  2VCP A;  4FWQ A;  4CEB A;  1TVR A;  1WNS A;  1FJG K;  3V9W A;  2HHX A;  2P9K A;  1O13 A;  3WNG A;  4QAG A;  4FWS A;  4A2A A;  1QZ5 A;  1HRH A;  2I7N A;  3HL8 A;  4JD2 B;  5D3G A;  1D8Y A;  1IV0 A;  2BGG A;  3PV8 A;  5AQQ A;  4F3T A;  2KW4 A;  5I3U A;  3DLL L;  4CZI A;  3DXM B;  1NGJ A;  2Z1G A;  3RMD A;  5CY4 A;  2XRI A;  2ZE2 A;  5EU7 A;  5IT9 O;  3KJV A;  1SV5 A;  2E6L A;  4XH1 A;  5KPT A;  4JK7 A;  3VQ7 A;  4E7J A;  4DR6 K;  4FW1 A;  4BAC A;  2BTF A;  3BF3 A;  1S1X A;  4M3Y A;  3P39 A;  1TL1 A;  3TAB A;  1T8E A;  1B9F A;  1HR0 K;  1HYS A;  4K0K K;  4BRN A;  3AVN A;  3KK3 A;  1YJW N;  4K41 A;  3EZ5 A;  4CF1 A;  3SBG A;  3HBT A;  4G1Q A;  3ATU A;  1S6P A;  4J2E A;  2OYQ A;  3LP1 A;  2VGN A;  3CER A;  4JK8 A;  1WN7 A;  1TKZ A;  3AAP A;  3EEQ A;  4CW7 B;  4IXC A;  5DK5 A;  2P9N A;  2HBL A;  4H8K A;  3AVK A;  3E9P A;  3T1Y K;  1LW0 A;  3CD6 N;  3H1Q A;  3KLH A;  3VGK A;  3U3G A;  1BG3 A;  5SWM A;  1S3X A;  3O5B A;  4N56 A;  2IOC A;  4GV3 A;  4DU4 A;  4DR3 K;  1A5V A;  3SJH A;  5TKW A;  3CHW A;  4PKI A;  3AY9 A;  4FWP A;  1RDD A;  4YOU A;  2GUP A;  3O4W A;  4OVL A;  3DXK A;  4BY9 C;  3FR0 A;  1S6Q A;  4B1V A;  4FJI A;  3NCI A;  5J2Q A;  2YHB A;  1RTD A;  1VSH A;  4CGJ A;  3V1Q A;  3IS9 A;  5BR8 K;  3D2E B;  4DV5 K;  3HPH A;  4I6M B;  1IBK K;  3O9T A;  1VQ4 N;  3MN5 A;  4PHT X;  4U67 L;  1JCF A;  4JHD B;  1NKE A;  3J80 O;  4ELU A;  1V4T A;  1ZBL A;  1IKV A;  4BC2 A;  4B3S K;  3EE9 A;  4DR1 K;  3TI0 A;  1K8K A;  5F2R A;  1W2B M;  4RW7 A;  3JS6 A;  4DSK A;  1BQM A;  4BQL A;  1RFQ A;  3SPY A;  1JCE A;  3M8Q A;  1Z6R A;  4H5W A;  3DLR A;  1J5O A;  3NF8 A;  3TSU A;  1DT9 A;  5M1F A;  3U3Y A;  3KHY A;  3M8R A;  4FPA A;  1BL3 A;  3HP6 A;  2Z1I A;  4DR5 K;  4LF5 K;  2UXD K;  3L2V A;  4I9L A;  4M41 A;  1ZBS A;  3R6M A;  1C0F A;  1RDC A;  3QBW A;  1NMD A;  4KI4 A;  5IWA K;  1NJX A;  3KWG A;  4NYF A;  3S3O A;  4DR2 K;  4B9T A;  5AQM A;  1RT4 A;  4C8O A;  4OPJ A;  3O08 A;  4RG8 A;  3AVH A;  4EZ9 A;  2P5O A;  2HF4 A;  2DFH A;  4DLG A;  4YOV A;  1ZYQ A;  2A42 A;  5KI6 A;  1FW6 A;  3ZET A;  4B3R K;  1J5E K;  3OBW A;  3GOI A;  4M45 A;  4Z4F A;  4XH5 A;  3SQ4 A;  5A2Q O;  4K42 A;  1LWF A;  1KVA A;  3VTI A;  4BC3 A;  2HHQ A;  1NGC A;  2XY8 A;  3KLG A;  1S9G A;  4KAZ A;  4L8R B;  3AVA A;  2I5J A;  2ZQB A;  2WOM A;  1WSF A;  3OYN A;  1NK5 A;  4KRE A;  3DLE A;  4CIE A;  4JAX A;  4CBX A;  4Y0W A;  2UUC K;  1N5Y A;  3HOT A;  1NGF A;  4LF9 K;  2FXU A;  3ID6 A;  5BRD A;  4BRG A;  5JLF A;  3OS2 A;  5BPN A;  4B1W B;  5GAH P;  4JNE A;  5BPL A;  3DOL A;  3K5L A;  1VK0 A;  3WQU A;  4Z0U A;  2UXC K;  1NM1 A;  4DS4 A;  4W5Q A;  2YNH A;  4K8X A;  1BI4 A;  1RDW X;  1U2V A;  4KTZ A;  3D2F A;  4EIA A;  1BIU A;  3C95 A;  3CCS N;  2WTU A;  1LAV A;  1NU0 A;  3T7Z A;  4DV3 K;  1CZ9 A;  2VG7 A;  2VQF K;  3QER A;  2O8F A;  1NMN A;  5H1S Q;  2ZD1 A;  1QQM A;  4YOW A;  3IKM A;  2ETJ A;  2E2N A;  3FLC O;  3LP2 A;  4KO0 A;  3B6O A;  2XY7 A;  1MA9 B;  4DSF A;  4QOZ B;  1OVQ A;  3VQQ A;  3ZEU B;  3ZT0 A;  1N6Q A;  3MDQ A;  3EYZ A;  1BCO A;  3MEC A;  1N32 K;  1BCM A;  2D4W A;  4AHC A;  4DQR A;  3HJF A;  3EO3 A;  1YVU A;  3CC2 N;  1K8A O;  4FW2 A;  4DS5 A;  5KQ8 A;  3KLF A;  1QS4 A;  2QXF A;  2PAV A;  3MWT A;  1NGB A;  1W97 L;  2KFN A;  4CFD A;  3OYC A;  1RBR A;  3LWL A;  1JJ2 M;  4NB4 A;  3ZX2 A;  2UU9 K;  4CJ7 A;  1GLL O;  3FZF A;  4PL7 A;  4CJR A;  5FDL A;  5KPR A;  1HNV A;  3AA2 A;  3FFK B;  4FJJ A;  2RN2 A;  2CH6 A;  2CGL A;  3GG4 A;  4QS9 A;  2G8U A;  1C0G A;  1OH5 A;  4FVM A;  5KPZ A;  5HRS A;  3KKS A;  5TKY A;  4B9N A;  1YI2 N;  2P9I B;  4FLW A;  2E8A A;  5ADX A;  3NGZ A;  3SAF A;  5LMN K;  4HCC A;  2Q36 A;  4B1U B;  4X64 K;  3ENO A;  1IKX A;  2G8K A;  1WBB A;  2XY5 A;  1MDU B;  1Q82 O;  2HNZ A;  1RBS A;  3MXM A;  3OYK A;  4M3X A;  3LM9 A;  4W5R A;  4B9M A;  1H1V A;  3J7A P;  2G8F A;  3O9Q A;  3WEE B;  1Y97 A;  4FOE A;  4C1N I;  1JL2 A;  1RT7 A;  3K5O A;  1D5A A;  1O1W A;  1WSE A;  4LH5 A;  2EWS A;  1NK9 A;  4FJ8 A;  5CZ2 A;  3OW2 M;  2J4R A;  1Q9X A;  5KRS A;  1VSL A;  2QTD A;  2ATQ A;  4JK9 A;  4ZHR A;  4FLT A;  4AHR A;  4JI8 K;  4ISF A;  3RSE B;  3VQB A;  1NK8 A;  2E1Z A;  1JXE A;  3ZSQ A;  3TAG A;  4FYD A;  1HPZ A;  1BU6 O;  1SKW A;  3RRH A;  3L2W A;  1F21 A;  3PX4 A;  2RPI A;  4RW6 A;  3U8X A;  3U9D A;  2P9U A;  4FZY A;  2Q31 A;  3A5M C;  3CCE N;  1YJ9 N;  1HLU A;  2UUA K;  3SLC A;  1LW2 A;  1VAZ A;  2VG5 A;  2QXL A;  4KB1 A;  3O1W A;  4Z4C A;  2P9K B;  4XIU A;  4YDU A;  1C0M A;  2F8S A;  2NRW A;  3I33 A;  1OH8 A;  4DR7 K;  4GW6 A;  3QET A;  5FPN A;  1WSG A;  3V9U A;  3CJ7 A;  4LF8 K;  3NH2 A;  4LSL A;  4M7X A;  3FZK A;  3P1G A;  1I39 A;  1REV A;  3K2P A;  3RMA A;  2BE2 A;  1T6D A;  4FZX C;  4DQ8 A;  5ADX H;  3OYF A;  2XHB A;  3SUQ A;  1SUQ A;  2QEX N;  3A5O C;  1RTI A;  3ZSV A;  3SMP A;  4KTW A;  2W42 A;  4H0Y B;  4WQ5 C;  4EZ6 A;  4JI3 K;  3O80 A;  3THX B;  4FJ5 A;  5FRN A;  1DGK N;  2V7Y A;  1ESV A;  3TSQ A;  4FPB A;  4N5S A;  4JI1 K;  3M8P A;  4KRF A;  4LF7 K;  2EHG A;  3M1F A;  3H6E A;  3SZ2 A;  1TV6 A;  1XHX A;  5KGX A;  3DAW A;  3I0S A;  1K9M O;  1YVN A;  1GOA A;  2AA4 A;  2YJF A;  3T1A A;  3W3D A;  3J7Y P;  1NJW A;  5M1O A;  4CJ4 A;  4BVP A;  2P51 A;  1WLJ A;  3CJ1 A;  2P9N B;  4BRO A;  3OYJ A;  4E7K A;  1QTM A;  2F9W A;  1NGI A;  4O5F A;  2KHO A;  3A5L C;  1GOC A;  4CZJ A;  1VQ9 N;  4I7F A;  3MN7 A;  1Z05 A;  4JKH A;  3ZSW A;  2KTQ A;  3BZC A;  1J53 A;  4E7L A;  4C8M A;  3DM2 A;  1ZBH A;  1FXX A;  1VSK A;  4CD3 A;  3JXU A;  2WBN A;  3LZI A;  1HX1 A;  2YHW A;  4CEC A;  2OZS A;  1ATS A;  3DXK B;  3WXJ A;  4BQZ A;  3ZT4 A;  3SMS A;  5DMR A;  4DF8 A;  4ID1 A;  2A41 A;  4CHO A;  5JMV A;  5HLF A;  2O8C A;  4CGI A;  1QSY A;  5I42 A;  4DV7 K;  2ZGZ A;  4HTL A;  2Q3S A;  4FLZ A;  3DRP A;  4CEQ A;  3E1Y A;  3EKU A;  3OY9 A;  3C0B A;  1VQ7 N;  4AHU A;  4N41 A;  1KTQ A;  2CGJ A;  5JVH L;  2F8T A;  5C10 A;  3NAE A;  1C1A A;  3PLA A;  4IOA L;  2P9S A;  1K8K B;  3BP8 A;  3AGK A;  1IBM K;  5C2D A;  2Q2R A;  1JLQ A;  2QI2 A;  1QHT A;  3NGI A;  1NGA A;  1JCG A;  4H0X B;  2HB5 A;  3VER A;  4GVM A;  3BGR A;  5AQY A;  1ITG A;  2OTL N;  2FBT A;  1VQ6 N;  5AQV A;  5HRR A;  5J2M A;  2CGK A;  4O0I A;  4CIF A;  3QB0 A;  2Q1N A;  4PKG A;  4FOI A;  3SV3 A;  5LY3 A;  4W5T A;  2P9P B;  5SZT A;  5AQF A;  1WSH A;  3ZSX A;  1BO5 O;  3IRX A;  2QWL A;  4M63 C;  3ULE B;  1M90 O;  2IVO A;  1E4G T;  4CZK A;  4YOX A;  2H3G X;  4B1Y B;  1ILY A;  5FPE A;  3J7Z O;  3SYZ A;  3THY B;  4CJL A;  1VRT A;  3ISN C;  4IOX A;  2ITM A;  3QES A;  3DLB A;  1Z25 A;  3CMA N;  4KV8 A;  3KVG A;  1KFD A;  3C7N A;  1DLO A;  4BRC A;  1WBD A;  3SJJ A;  3O3H A;  4JI7 K;  3WXK A;  2A6A A;  3HVT A;  4WF9 L;  1CXU A;  1C6V A;  3FZM A;  2O4I A;  3LM2 A;  2B5J A;  4CZG A;  1NLV A;  4M7Y A;  3LPT A;  4MO5 A;  1Q86 O;  4X65 K;  2BH1 A;  2P9L B;  2FBY A;  1C0U A;  3GDQ A;  4FK0 A;  1BOT O;  1JLB A;  1YTA A;  3CJ9 A;  1W7A A;  3Q7B A;  1SL1 A;  4M3U A;  2RKI A;  5LJW A;  2VQE K;  3WXM B;  3CCU N;  1Z26 A;  1RBV A;  1KXP A;  4FLX A;  2AJQ A;  4F2R A;  1EX4 A;  4MLH A;  1ZBI A;  4JKG B;  1QQO A;  2IVP A;  4HWI A;  2E88 A;  4WQ4 A;  1KC8 O;  5HRP A;  2DFE A;  1NGE A;  3NH1 A;  1U2V B;  1ZXO A;  1G99 A;  3VEX A;  4R5P A;  4BRM A;  1FKO A;  3RMB A;  1YHQ N;  2QWR A;  1XWL A;  1WB9 A;  4CGG A;  1ZBU A;  1IG9 A;  2HF3 A;  5JS2 A;  4B08 A;  1IKW A;  3FZL A;  3UKR A;  3MCA B;  3PO4 A;  4H5V A;  1L3V A;  3TAE A;  2V52 B;  3LDQ A;  4O4G A;  3MEE A;  4CES A;  1TUU A;  1ASV A;  2Q0U A;  4BWJ A;  5AQL A;  3DRR A;  2WUS A;  5KRT A;  3WT0 A;  4BGA A;  2YI1 A;  3KLI A;  4FLU A;  3VEO A;  3QEP A;  1XC9 A;  4A62 A;  2ASO A;  1LV5 A;  4OGC A;  3F9K A;  2A40 A;  3O3G A;  1U47 A;  4DSI A;  4YHH K;  5HOO A;  3K57 A;  1QVG M;  2OZM A;  1HKB A;  4F9O A;  2QWO A;  3PUF A;  2QWN A;  2YNG A;  3VQP A;  1VQ5 N;  3JAM O;  4MFB A;  3VGL A;  2W6K A;  3R1X A;  1NGG A;  3HST B;  3VQ4 A;  2VWB A;  4KTQ A;  1L3S A;  3C6T A;  4H0V B;  3H45 C;  3HXM A;  1HNZ K;  4MO4 A;  4CHZ A;  1U48 A;  3S9H A;  4HVJ A;  2JWK A;  5DM7 L;  2RE2 A;  1HJR A;  2OPS A;  4BC5 A;  4DWI A;  5FPM A;  1X9W A;  5AQU A;  4CHQ A;  4CFB A;  2D0O A;  1D9D A;  4DSL A;  3OA9 A;  4BR0 A;  2YHX A;  4A5B A;  3S41 A;  3L3U A;  3HI0 A;  4JKE A;  4BDZ A;  3DLH A;  1TK0 A;  2D0P A;  4B8C A;  4CJT A;  5AQW A;  4FJH A;  1YXQ A;  1XI1 A;  1XNR K;  4JI0 K;  3HSC A;  3OYD A;  1I3A A;  2NUB A;  5AQG A;  3KTQ A;  1JXB A;  3S3M A;  3DMJ A;  3L0Q A;  4OPH A;  5HRN A;  3CME N;  2DTU A;  4KHQ A;  1SAZ A;  3TU5 A;  3NH0 A;  4AIL C;  3F9M A;  3SCX A;  3TR8 A;  2NRH A;  4KH5 A;  1SQK A;  3IMX A;  4B9Q A;  4RTF D;  2DPN A;  1NWK A;  1JLE A;  5M1N A;  5AFU A;  4DTO A;  3ZX0 A;  3NF7 A;  3A5N C;  3DLG A;  4B8A B;  2UUB K;  3H3O B;  3LP0 A;  1CZA N;  4PQU A;  4DLE A;  4JN4 A;  1J6Z A;  1S1V A;  3VET A;  4CEZ A;  3SUO A;  2ZJP L;  3MN9 A;  3E66 A;  1G15 A;  1K6Y A;  3HPG A;  3CFR A;  4E0D A;  1QVF M;  3PO5 A;  1D4X A;  4ZTJ A;  2O8B B;  4IDH A;  3J81 O;  1JLG A;  2D1K A;  1NOY A;  4ELV A;  4H0P A;  1WUA A;  5AJ3 K;  3O6W A;  4BWM A;  1VQP N;  1YIJ N;  4JI5 K;  5AZJ B;  4KHS A;  4PKH A;  1HMV A;  4WQ4 C;  2KZZ A;  2NNW A;  3L4Q A;  4CIG A;  4I9Q A;  3VA0 A;  3AV9 A;  2FBV A;  1WAF A;  4ISE A;  4A59 A;  4JYA K;  3HO1 A;  4CJP A;  3E9L A;  4CED A;  1EQY A;  4FXD A;  2UYT A;  4GVE A;  4PL8 A;  4E1J A;  4IOC L;  1WSJ A;  3CG7 A;  5AQX A;  1QQN A;  5AZI A;  4F2S A;  1NGD A;  1IO2 A;  3EN9 A;  3VTH A;  4IFE A;  4IFV A;  2VWK A;  3IUC A;  5C24 A;  3SUP A;  1QE1 A;  3MX2 A;  1D9F A;  4NO7 A;  3CJB A;  2WFB A;  4DQQ A;  5GIO A;  1JL1 A;  2IC3 A;  2W6L A;  1IG8 A;  2GWK A;  2IS3 A;  3TAM A;  4QS7 A;  4DV1 K;  3CCJ N;  2RF2 A;  3VEZ A;  3CIP A;  4DTS A;  4XEI A;  5AFU H;  2HOE A;  3SK3 A;  3HYF A;  4CK2 A;  3CQY A;  4O5B A;  2NZT A;  1A5X A;  1KQS M;  4CFA A;  4JI4 K;  3PIO L;  4OJR A;  3WQT A;  2FF6 A;  4A5A A;  4JD2 A;  4NCG A;  1TL3 A;  4H0O A;  3M6G A;  2KZM A;  3ZT3 A;  1DTQ A;  4RWT A;  4WFB L;  4IO8 A;  2PY5 A;  5GAD P;  1NGH A;  4H0T B;  2O8C B;  3TAR A;  4G9Z A;  1E4F T;  4ILJ A;  4JKC A;  4OO1 J;  4GMJ B;  1RTH A;  4OKE A;  4CJW A;  1QSS A;  1N33 K;  4YNQ A;  1RDB A;  2QWM A;  5KQD A;  5GIN A;  3LDL A;  4BR2 A;  2HHT A;  4O0J A;  1T7P A;  4LY7 A;  3SUN A;  4BRK A;  1TKD A;  5ELZ A;  4EHU A;  4WFN L;  1Q8I A;  3AA4 A;  1A5W A;  1RT2 A;  3CC4 N;  2HBJ A;  1U45 A;  2D5R A;  3MMV A;  4CVN E;  3HK2 A;  1EWR A;  4K25 A;  1SKS A;  3G25 A;  4LSN A;  4AM7 A;  1L3T A;  3CJA A;  1ZBF A;  3RVC A;  3I8D A;  1XMQ K;  4CZL A;  1VSD A;  1N8R O;  4GNI A;  3I0R A;  5CE3 A;  3VN5 A;  2G8W A;  3B6P A;  1HQE A;  1OVY A;  3CYM A;  3D0P A;  1EO1 A;  3UB5 A;  3L2Q A;  2QM1 A;  2YNI A;  4DTP A;  3THW A;  1VQL N;  4E19 A;  2O8E A;  2FF3 B;  2O4G A;  4FK4 A;  2O8D A;  3VEN A;  1UAX A;  3ZSZ A;  3H08 A;  2KQ2 A;  3O8M A;  1TK8 A;  1GLF O;  4QCL A;  4EP5 A;  1JLA A;  4YY3 K;  2JLE A;  2HBK A;  2W40 A;  3A8Y A;  4I2P A;  2QKK A;  1BA1 A;  1KFS A;  3HVR A;  4A2B A;  1HUX A;  3VQE A;  2KKZ A;  3OYM A;  4BRE A;  4AM6 A;  1SKR A;  5AR0 A;  4GKK K;  1HPM A;  4AHS A;  2HVI A;  5DM6 L;  3C7N B;  4M3T A;  1BDG A;  1K73 O;  3AVF A;  3HP9 A;  4EAH D;  5FRM A;  5E41 A;  3MN6 A;  4CGH A;  4E3S A;  3D2E A;  4I6M A;  2OA8 A;  1S1W A;  3QDK A;  4BRF A;  3CC7 N;  4E89 A;  3CCQ N;  4JLH A;  4CD1 A;  2R7Y A;  4JHD A;  2ZWH A;  4JV5 K;  4CBU A;  3O9S A;  2HMI A;  5KGW A;  1P8Z A;  3L8B A;  4JRP A;  4CZF A;  5HL7 L;  2Q97 A;  1YIT N;  4J2B A;  1L5U A;  4BGB A;  2OCE A;  3UKU A;  2GWJ A;  1SS6 A;  4FO0 A;  3PIP L;  3OYL A;  3J8A A;  4RW9 A;  4A61 A;  1YTU A;  4DFK A;  2HHS A;  1ASW A;  1MWM A;  1KVC A;  3P4I A;  1ATR A;  4BRA A;  5MLC Q;  3OJU A;  4BRL A;  4BRP A;  3OYA A;  1NK0 A;  3VQD A;  4H4O A;  5BR9 A;  2YV0 X;  5J2P A;  1CLQ A;  1HNI A;  2E2Q A;  3V9X A;  4BR7 A;  1LAW A;  3UKR B;  4DV2 K;  3T3F A;  2VG6 A;  2QKB A;  1GLA G;  3I56 N;  4GV9 A;  2G8V A;  1X9S A;  1ASU A;  2V51 B;  2PBD A;  2FC0 A;  3K5M A;  3CI5 A;  2Z1H A;  3WUH A;  1EKE A;  3CQX A;  3DJC A;  3E01 A;  5JIC A;  1LWC A;  4DR4 K;  4FWO A;  5FRO A;  5AQP A;  4IJA A;  4FWM A;  4OPA A;  4LFB K;  1HKC A;  3DOK A;  4BC4 A;  3CQ8 A;  1U49 A;  1NNE A;  4PWD A;  1EWQ A;  1VRU A;  3LDS A;  3RR8 A;  3A0I X;  3SPZ A;  4GY2 B;  3AVM A;  3L6Q A;  3VF2 A;  3RWU A;  2G8H A;  2YJE A;  1YAG A;  2JGU A;  1IKY A;  2P5G A;  3C65 A;  2GBZ A;  3QBX A;  1RBU A;  3VQ8 A;  1C1B A;  4CE9 A;  4CGF A;  1RT6 A;  4KHY A;  3CXC M;  2CH5 A;  1C1C A;  2HW3 A;  4Z4E A;  3GBT A;  5LMU K;  1TYQ A;  1X9M A;  3MX5 A;  2GV9 A;  4RCH A;  4B1Z A;  4DCH A;  2I7P A;  4MQ3 A;  1OKJ A;  1HKG A;  3K9K A;  3P83 D;  4FWL A;  4DUY K;  4Z4I A;  3SAH A;  3LDN A;  2EX3 A;  1S72 N;  4CCH A;  5EVZ A;  4DTU A;  5HP1 A;  4H4M A;  3ZYY X;  4KKO A;  4NLC A;  3IFR A;  3DI6 A;  2LSN A;  3OS1 A;  4FWR A;  2IIR A;  3G6E N;  4B9U A;  4EFH A;  1S1T A;  4LC9 B;  5FLX O;  1IJJ A;  2DFF A;  4W5N A;  4E7I A;  4M3R A;  1RGI A;  2F96 A;  3QIC A;  2ZJR L;  3CFP A;  4CJK A;  5C25 A;  1GLB G;  3AVG A;  3EY1 A;  3AA3 A;  4DQS A;  3BDP A;  2QWP A;  1C0T A;  1NOZ A;  3TPQ A;  5C0Y A;  4FJ9 A;  2GUI A;  3OYH A;  4HCB A;  2Q0R A;  3DWL A;  4ELT A;  1GLJ O;  1MWK A;  5AQJ A;  4BDP A;  4BG9 A;  2A5X A;  2HHV A;  2OTJ N;  1VQ8 N;  4Y1C A;  4TSX A;  2B4J A;  4CZM A;  1T44 A;  1RDU A;  4DKW A;  4CHY A;  1YUW A;  4BRD A;  3EE8 A;  3LDO A;  1VSE A;  3ENB A;  3KLE A;  2FLO A;  3AO4 A;  2KLA A;  3LWM A;  3LPU A;  5BN9 A;  4B3T K;  2UXB K;  4N47 A;  3V6D A;  4ILH A;  3K5N A;  2PFU A;  5C2F A;  3ZET B;  1J54 A;  4YDU C;  1SL2 A;  1WOQ A;  1RBT A;  4BRH A;  4DV6 K;  3PSF A;  1T03 A;  1VSF A;  3QIP A;  4NLB A;  1VSM A;  2ASM A;  4B9L A;  2NRX A;  4JKA A;  1XNQ K;  4W5O A;  3WEE A;  4FM2 A;  4Q0B A;  3NMU A;  3QO9 A;  3AVI A;  4MDA A;  1S9E A;  3AGR A;  3L2U A;  2FSJ A;  1X9J A;  4MLE A;  2IAJ A;  3L4I A;  1ZC6 A;  4Q5V A;  3WNE A;  4DU1 A;  2PZS A;  2HNY A;  3RSE A;  3OHR A;  3HM9 A;  3NFA A;  4HTU A;  4ISG A;  3ZLJ A;  1KD1 O;  1QSL A;  5EOY A;  4LFA K;  1BI4 B;  2YKN A;  3LP3 A;  3D2F B;  3AO1 A;  4CEF A;  2F9T A;  1KSP A;  2YHY A;  3MXJ A;  4BRQ A;  5AQS A;  3LAM A;  4DTM A;  4RW4 A;  3PX6 A;  2O8F B;  1X3N A;  5JLH A;  2IGI A;  3HM8 A;  1RTJ A;  2NRV A;  4H03 B;  1JKH A;  3QFP A;  1X1P A;  3KIO A;  1HNX K;  4JS4 A;  3G0Z A;  2YKM A;  5I9E B;  4JEP A;  1CZB A;  2NLX A;  4LH4 A;  4DQI A;  3LL3 A;  3CPE A;  3S3N A;  3ZT2 A;  3QIN A;  1CXQ A;  4FK2 A;  5CYQ A;  3MWP A;  2Y1I A;  2VWJ A;  3VF6 A;  3D6R A;  3ZCM A;  4I2Q A;  4IO9 L;  3F73 A;  3VA3 A;  1XQS C;  1XHZ A;  3QFU A;  3MXI A;  4KH4 A;  4L3Q A;  3THX A;  3R3L A;  3HPO A;  2IVN A;  4CER A;  5B8H A;  3FE1 A;  4JKF A;  3K58 A;  1SL0 A;  3JSM A;  3MCP A;  4FJL A;  5E26 A;  2PYL A;  4BR9 A;  4CJS A;  4DQP A;  2YX6 A;  3CET A;  1KCF A;  5KTQ A;  3OS0 A; 
#chains in the Genus database with same CATH homology
 4OPK A;  4DTJ A;  1UA1 A;  1JL1 A;  2IC3 A;  1LW2 A;  3QEI A;  2VG5 A;  3D45 A;  3AVJ A;  4AH9 A;  4KB1 A;  4OLA A;  2KFZ A;  4N41 A;  4Z4C A;  4B9V A;  4XIU A;  2IS3 A;  1C0M A;  3TAM A;  2F8S A;  2X6S A;  1NJY A;  4J2D A;  4PA1 A;  1TGO A;  4GW6 A;  5CZ1 A;  3QET A;  2RF2 A;  3MAQ A;  2ITG A;  4DTS A;  5T7B A;  1WSG A;  3V9U A;  3NH2 A;  4LSL A;  3HYF A;  1BIZ A;  1EXQ A;  3LAL A;  4CK2 A;  4O5B A;  4RW8 A;  3HT3 A;  3PX0 A;  3P1G A;  1I39 A;  1A5X A;  2A1S A;  4ICL A;  4CFC A;  3CM6 A;  1REV A;  4CFA A;  3K2P A;  4OJR A;  2BE2 A;  4UQG A;  3RMA A;  1S5J A;  1NK7 A;  4FZX C;  4O44 A;  4NCG A;  1TL3 A;  1BHL A;  4AHV A;  4FM0 A;  4KHU A;  2KZM A;  3ZT3 A;  4DTR A;  3AO3 A;  1DTQ A;  3AVB A;  1T05 A;  3OYF A;  3VQ6 A;  2PY5 A;  2XHB A;  3SUQ A;  3NF9 A;  1SUQ A;  1JLC A;  3LAK A;  1RTI A;  3V81 A;  3ZSV A;  3TAR A;  4NCA A;  3QEW A;  1EP4 A;  4GMJ B;  1RIL A;  1RTH A;  4OKE A;  4KTW A;  3VQA A;  4CJW A;  4LD0 A;  4YNQ A;  1RDA A;  1RDB A;  2W42 A;  1QSS A;  4C8N A;  4CJ3 A;  2Y1J A;  2HHT A;  4O0J A;  4EZ6 A;  1NKB A;  4FJ5 A;  1T7P A;  1NK6 A;  4LY7 A;  5FRN A;  4CJF A;  3SUN A;  1VSJ A;  1W9H A;  1TKD A;  3NGY A;  4FM1 A;  2BDP A;  1Q8I A;  3AA4 A;  1A5W A;  4CF0 A;  4N5S A;  1RT2 A;  4KHN A;  2YNF A;  1U45 A;  5JS1 A;  3DRS A;  3M8P A;  4B9S A;  2D5R A;  4KRF A;  2EHG A;  1TKT A;  3WNH A;  3HK2 A;  4B3O A;  5CYM A;  3NDK A;  2D0B A;  3SZ2 A;  1BQN A;  1UOC A;  4LSN A;  3VQ9 A;  1TV6 A;  1XHX A;  3G10 A;  3OVN A;  5KGX A;  1HQU A;  3ALY A;  2D0C A;  4OGE A;  3ULD A;  3SQ0 A;  3I0S A;  4KHW A;  1ZBF A;  3I8D A;  1VSD A;  1GOA A;  3ASM A;  3CM5 A;  1SKS A;  1KVB A;  3SQ1 A;  3T1A A;  3I0R A;  1NJW A;  3VN5 A;  4CJ4 A;  2G8W A;  2P51 A;  3B6P A;  2P1J A;  1HQE A;  1WLJ A;  3CYM A;  4YFU A;  3OYJ A;  4CEB A;  1TVR A;  3D0P A;  4E7K A;  1QTM A;  1WNS A;  3C6U A;  3V9W A;  3TAN A;  2HHX A;  3L2Q A;  4PUO A;  2YNI A;  4FLV A;  4DTP A;  1EET A;  3WNG A;  4E19 A;  1GOC A;  4QAG A;  4M3W A;  4CJU A;  2O4G A;  4I7F A;  4CEO A;  1RT1 A;  4CK1 A;  4FK4 A;  2KTQ A;  3ZSW A;  1HRH A;  3HL8 A;  1J53 A;  1UAX A;  3ZSZ A;  3H08 A;  5D3G A;  1D8Y A;  4E1M A;  2KQ2 A;  4E7L A;  1GOB A;  2BGG A;  4C8M A;  3PV8 A;  3RMC A;  1S1U A;  1WAJ A;  2KW4 A;  3DM2 A;  4IFY A;  1TK8 A;  3KD5 E;  4QCL A;  5I3U A;  4EP5 A;  3CFO A;  1JLA A;  1FXX A;  1VSK A;  1ZBH A;  2IDO A;  2Z1G A;  2JLE A;  3LZI A;  2YHA A;  3RMD A;  1KLM A;  4I2P A;  5CY4 A;  4CEC A;  2QKK A;  2OZS A;  1KFS A;  3HVR A;  2XRI A;  2ZE2 A;  5EU7 A;  3ZT4 A;  4KPY A;  5DMR A;  3VQE A;  4DU3 A;  3KJV A;  4DF8 A;  3OYM A;  1SV5 A;  4ID1 A;  2E6L A;  4CHO A;  4KI6 A;  5HLF A;  5J2N A;  4CGI A;  1QSY A;  1SKR A;  3VQ7 A;  5I42 A;  4AHS A;  2HVI A;  4E7J A;  4FW1 A;  3K59 A;  4DFM A;  2XY6 A;  1J9A A;  4BAC A;  2Q3S A;  4FLZ A;  4M3T A;  4DTN A;  1S1X A;  4M3Y A;  3AVF A;  3DRP A;  3HP9 A;  4OKK A;  4CEQ A;  5FRM A;  1TL1 A;  3TAB A;  5E41 A;  3P5J A;  3SV4 A;  1L3T A;  1UWB A;  4CGH A;  4E3S A;  1T8E A;  1B9F A;  2E4L A;  3OY9 A;  3ZSO A;  3ZSY A;  4AHU A;  1KTQ A;  1S1W A;  2OA8 A;  3SQ2 A;  1IH7 A;  3AVN A;  1C1A A;  3NAE A;  2F8T A;  3KD1 E;  3AVC A;  1NKC A;  3KK3 A;  3JYT A;  1Q9Y A;  4E89 A;  4JLH A;  2R7Y A;  3EZ5 A;  4CEE A;  4DSJ A;  2PYJ A;  4CF1 A;  1JLQ A;  3OYI A;  1QHT A;  4G1Q A;  1S6P A;  5KGW A;  3NGI A;  2HMI A;  4J2E A;  2OYQ A;  3LP1 A;  3L8B A;  4JRP A;  2HB5 A;  4FJ8 A;  5K14 A;  4J2B A;  1WN7 A;  1TKZ A;  3BGR A;  4GVM A;  3V1R A;  4FJG A;  1ITG A;  2E6M A;  3LZJ A;  1L5U A;  3OYE A;  3NF6 A;  5DK5 A;  4H8K A;  2FBT A;  3AVK A;  4DG1 A;  1LW0 A;  3U6F A;  5HRR A;  3OJS A;  3KLH A;  5J2M A;  3OYL A;  1KRP A;  4O0I A;  4CIF A;  3U3G A;  4RW9 A;  1TK5 A;  1HYS A;  1BGX T;  4DFK A;  4IG3 A;  1YTU A;  2HHS A;  4IBN A;  1ASW A;  1KVC A;  5SWM A;  3FFI A;  3SV3 A;  2X78 A;  3QNO A;  4N56 A;  2IOC A;  4W5T A;  3OJU A;  3V9S A;  4DU4 A;  3OYA A;  5SZT A;  3VQD A;  1NK0 A;  1A5V A;  4H4O A;  3WNF A;  2YV0 X;  5J2P A;  3ZSX A;  1WSH A;  1CLQ A;  1QQC A;  1HNI A;  4FZZ A;  3V9X A;  3IRX A;  1LAW A;  1RDD A;  2HHW A;  1UA0 A;  3L2R A;  3T3F A;  2VG6 A;  2QKB A;  4OVL A;  1S6Q A;  3M8S A;  2G8I A;  4IG0 A;  2X74 A;  4FJI A;  3OYB A;  3NCI A;  4HHT A;  2G8V A;  5J2Q A;  1ASU A;  2YHB A;  1X9S A;  1RTD A;  4M42 A;  2FC0 A;  3K5M A;  3SYZ A;  3QNN A;  1VSH A;  3V9Z A;  2Z1H A;  4CGJ A;  4CJL A;  3NBP A;  1VRT A;  3V1Q A;  1EKE A;  3IS9 A;  3ISN C;  4DFP A;  3QES A;  3HPH A;  3DLB A;  2QK9 A;  3E01 A;  1Z25 A;  1LWC A;  4HUF A;  4KV8 A;  1KFD A;  1DLO A;  3SJJ A;  5FRO A;  4CJQ A;  3O3H A;  3TWH A;  1NKE A;  3HVT A;  1HYV A;  4ELU A;  2DY4 A;  1CXU A;  1C6V A;  1DTT A;  3MED A;  2O4I A;  1RCH A;  1ZBL A;  2B5J A;  1IKV A;  3O3F A;  3LPT A;  3TI0 A;  3DOK A;  3CQ8 A;  1U49 A;  4ELV A;  4F8R A;  1BIS A;  2FBY A;  3THV A;  4PWD A;  1VRU A;  1C0U A;  3LDS A;  3RR8 A;  4RW7 A;  3SPZ A;  3AVM A;  4DSK A;  4FK0 A;  3RWU A;  2G8H A;  4K8Z A;  1BQM A;  4FCY A;  2JGU A;  3SPY A;  1IKY A;  1JLB A;  1YTA A;  2P5G A;  2GBZ A;  3M8Q A;  4KB0 A;  4M3U A;  1SL1 A;  4CJ5 A;  2RKI A;  1RBU A;  3VQ8 A;  1C1B A;  3DLR A;  1J5O A;  3NF8 A;  1Z26 A;  4CE9 A;  4CGF A;  1RBV A;  1RT6 A;  4FLX A;  3U3Y A;  4KHY A;  2AJQ A;  3M8R A;  3HP6 A;  1BL3 A;  4F2R A;  2Z1I A;  1EX4 A;  1ZBI A;  4BE1 A;  3L2V A;  1C1C A;  2HW3 A;  4I9L A;  4M41 A;  5HRP A;  4CF9 A;  1RDC A;  2DFE A;  3NH1 A;  1X9M A;  4Z4E A;  4DMN A;  4KI4 A;  2GV9 A;  1NJX A;  4NYF A;  4R5P A;  3S3O A;  4FLY A;  4MQ3 A;  1FKO A;  4B9T A;  4AHT A;  3RMB A;  1RT4 A;  3P83 D;  1XWL A;  4OPJ A;  4C8O A;  4CGG A;  1ZBU A;  1IG9 A;  5JS2 A;  4C8K A;  4RG8 A;  4B08 A;  4Z4I A;  3AVH A;  1IKW A;  2EX3 A;  4EZ9 A;  2OPP A;  4CF8 A;  2P5O A;  4FJM A;  4CCH A;  2DFH A;  4DTU A;  4DLG A;  5HP1 A;  4H4M A;  3PO4 A;  1L3V A;  3TAE A;  4KKO A;  1ZYQ A;  2X6N A;  3KK1 A;  5KI6 A;  4O4G A;  3MEE A;  3VQ5 A;  3DI6 A;  2LSN A;  3DLK A;  4CES A;  3OS1 A;  4OKJ A;  4JS5 A;  1ASV A;  1JLF A;  4M45 A;  4BWJ A;  4B9U A;  4Z4F A;  4PQU A;  1S1T A;  3DRR A;  3SQ4 A;  1RNH A;  4FJ7 A;  3QIO A;  1LWF A;  5KRT A;  2DFF A;  4W5N A;  3AO5 A;  3KLI A;  4M3R A;  4E7I A;  1KVA A;  4FLU A;  3QEP A;  3L3V A;  4Z4H A;  4E1N A;  2F96 A;  1XC9 A;  2HHQ A;  3CFP A;  1LV5 A;  4CJK A;  4OGC A;  3F9K A;  5C25 A;  3O3G A;  1U47 A;  3AVG A;  3EY1 A;  3AA3 A;  4DQS A;  2XY8 A;  4DSI A;  4DF4 A;  3BDP A;  4EP4 A;  1C0T A;  3KLG A;  4IKF A;  1NOZ A;  1S9G A;  2XO7 A;  3K57 A;  3RRG A;  4KAZ A;  4L8R B;  3AVA A;  4FJ9 A;  2GUI A;  3OYH A;  2ZQB A;  2I5J A;  2WOM A;  1WSF A;  3OYN A;  1NK5 A;  2OZM A;  3DLE A;  4HCB A;  4CIE A;  4N76 A;  4KRE A;  3PUF A;  4ELT A;  1N5Y A;  2YNG A;  1W0H A;  3VQP A;  4BDP A;  4FJK A;  1U04 A;  3T19 A;  2HHV A;  3OS2 A;  4DFJ A;  4MFB A;  4Y1C A;  1HYZ A;  4HUG A;  1B92 A;  4TSX A;  3HST B;  2B4J A;  3PY8 A;  1RT3 A;  3VQ4 A;  2Z1J A;  3MEG A;  3V1O A;  4CGD A;  4F4K A;  3QEX A;  4KTQ A;  4OLB A;  2HHU A;  3DOL A;  3K5L A;  4CHY A;  1VK0 A;  4PY5 A;  1L3S A;  4Z0U A;  4CJE A;  4M3Z A;  4DS4 A;  4K8X A;  4W5Q A;  2YNH A;  3C6T A;  1BI4 A;  1VSE A;  3KLE A;  3HXM A;  3AO4 A;  4KTZ A;  3LWM A;  4CHZ A;  1U48 A;  3A2F A;  3S9H A;  4HVJ A;  1FK9 A;  3O4Q A;  1BIU A;  1HJR A;  2OPS A;  3LPU A;  4HUE A;  4CF2 A;  3C95 A;  1X9W A;  1L3U A;  4DWI A;  4N47 A;  3V6D A;  4CHQ A;  4CFB A;  3K5N A;  1LAV A;  1D9D A;  4DSE A;  1CZ9 A;  2VG7 A;  4DSL A;  1J54 A;  1SL2 A;  3QER A;  1RBT A;  4FJX A;  4CHP A;  2OPQ A;  2ZD1 A;  2FBX A;  1T03 A;  1VSF A;  3L3U A;  3AO2 A;  3QIP A;  3IAY A;  3TAF A;  2ETJ A;  4BDZ A;  1VSM A;  3LP2 A;  4KO0 A;  1TK0 A;  3B6O A;  4B8C A;  3DLH A;  4B9L A;  2XY7 A;  5J1E A;  4FJN A;  4CJT A;  4DSF A;  4QOZ B;  4J2A A;  3VQQ A;  4FJH A;  1XI1 A;  3ZT0 A;  1N6Q A;  1TAU A;  4W5O A;  3EYZ A;  4FM2 A;  1BCO A;  3MEC A;  4Q0B A;  4Y1D A;  1R0A A;  1BCM A;  1I3A A;  2NUB A;  3QO9 A;  4AHC A;  3OYD A;  4DQR A;  3AVI A;  4O55 A;  3TAQ A;  2A1R A;  3HJF A;  1YVU A;  3KTQ A;  1JXB A;  4Z4G A;  3S3M A;  1S9E A;  3ITH A;  4FW2 A;  3DMJ A;  4DS5 A;  3KLF A;  1QS4 A;  2QXF A;  3L2U A;  3C94 A;  5HRN A;  4C8L A;  2DTU A;  4KHQ A;  3NH0 A;  4AIL C;  2KFN A;  2IAJ A;  3O4N A;  4CFD A;  1RBR A;  3OYC A;  3LWL A;  4Q5V A;  4ZTF A;  3SCX A;  3TR8 A;  4CHN A;  3WNE A;  4BE2 A;  4DU1 A;  2HNY A;  4DTX A;  2PZS A;  4CJR A;  5FDL A;  3SI6 A;  1HNV A;  3AA2 A;  4FJJ A;  3OYG A;  2RN2 A;  3TAP A;  4F3T A;  1NJZ A;  2OPR A;  3HM9 A;  3NFA A;  4HTU A;  3V4I A;  5HBM A;  2G8U A;  1VSI A;  1JLE A;  3UIQ A;  4FVM A;  3KK2 A;  4DTO A;  1QSL A;  5HRS A;  3RTV A;  1BI4 B;  3KKS A;  3NF7 A;  2YKN A;  2HND A;  3DLG A;  4B8A B;  2HVH A;  3LP3 A;  3LP0 A;  3RR7 A;  4B9N A;  3AO1 A;  3AVL A;  3QEV A;  3NHG A;  4DLE A;  4CEF A;  1KSP A;  1RT5 A;  4CEA A;  1FKP A;  1S1V A;  3MXJ A;  4CEZ A;  3SNN A;  3SUO A;  3IG1 A;  3KKR A;  1TAQ A;  4FLW A;  3LAM A;  4DTM A;  4BDY A;  4RW4 A;  3NGZ A;  1G15 A;  4HCC A;  1K6Y A;  3HPG A;  3CFR A;  3PX6 A;  4E0D A;  3PO5 A;  4ZTJ A;  2IGI A;  2B6A A;  1IKX A;  1RTJ A;  3LAN A;  4ID5 A;  2G8K A;  4CK3 A;  1JKH A;  2XY5 A;  2HNZ A;  1RBS A;  1JLG A;  1X1P A;  3MXM A;  3OYK A;  4M3X A;  4NYN A;  1TKX A;  3KIO A;  4W5R A;  1NOY A;  4IDK A;  3QLH A;  3DYA A;  1MU2 A;  4JS4 A;  1LWE A;  3G0Z A;  2G8F A;  2YKM A;  4BWM A;  4B9M A;  3ZT1 A;  1CZB A;  3AA5 X;  1Y97 A;  4KHS A;  4LH4 A;  1JL2 A;  2BAN A;  4DQI A;  1HMV A;  1RT7 A;  3K5O A;  4E7H A;  4F3O A;  1D5A A;  3S3N A;  1B9D A;  1YT3 A;  2KZZ A;  3ZT2 A;  4WE1 A;  3QIN A;  1CXQ A;  1O1W A;  1WSE A;  4LH5 A;  1U4B A;  4FK2 A;  4CIG A;  5CYQ A;  1NK9 A;  4I9Q A;  5HRO A;  2WON A;  3AV9 A;  2VWJ A;  3VA0 A;  2FBV A;  1WAF A;  2Y1I A;  4NCB A;  5CZ2 A;  1Q9X A;  3HO1 A;  5KRS A;  3ZCM A;  4CJP A;  1VSL A;  4I2Q A;  2ATQ A;  3F73 A;  3VA3 A;  4CED A;  4ZHR A;  1XHZ A;  4FLT A;  4AHR A;  4FXD A;  1NK4 A;  3MXI A;  4JRQ A;  3HPO A;  3VQB A;  4CER A;  1NK8 A;  1JXE A;  3ZSQ A;  1WSJ A;  3ZSR A;  3TAG A;  3CG7 A;  4FYD A;  1HPZ A;  3K58 A;  1SL0 A;  1SKW A;  3JSM A;  1WSI A;  3RRH A;  1KLN A;  4F2S A;  2D0A A;  4FJL A;  4KFB A;  1IO2 A;  4CJV A;  3L2W A;  3VQC A;  2PYL A;  1F21 A;  4IFV A;  2RPI A;  4RW6 A;  4CJS A;  4BE0 A;  3PX4 A;  4DQP A;  2VWK A;  5C24 A;  5C42 A;  3SUP A;  1QE1 A;  4FZY A;  1D9F A;  1KCF A;  3NE6 A;  4DQQ A;  5KTQ A;  3OS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...