3AVGA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avgA00
4ZTJA 4E3SA 3OJUA 4Y1DA 1NJYA 3DYAA 4OJRA 4BE0A 4BDYA 4DTRA 3I0SA 3QEIA 3M8SA 1LWFA 4PQUA 1VRTA 1BCOA 1RDDA 1ITGA 2HNZA 3CM5A 3VA0A 4CEQA 3SV3A 5CZ1A 5FRNA 2GBZA 1TK0A 3AVAA 1BI4B 4CJRA 1FXXA 3LZIA 3SNNA 3S3NA 3RR8A 1TK8A 4B3OA 2PYJA 3AVLA 5CYQA 3OYFA 1RNHA 4CJ5A 4M45A 3V1OA 3LWMA 3VQ8A 4HUEA 4DTUA 3TANA 1U48A 1IG9A 2PZSA 2OYQA 4NCBA 1S9GA 1NJZA 5CZ2A 4BE1A 1UA1A 4RW8A 4DSEA 2XHBA 4L8RB 3RMBA 4N47A 4KO0A 3TARA 1N6QA 3QO9A 2BDPA 2HMIA 3OYNA 4DTOA 1T03A 3AVFA 2EX3A 4BWMA 3D45A 2ITGA 1TKZA 4AHCA 4CERA 3K57A 4CEZA 4E19A 4CGFA 3V9UA 3O3GA 1NK4A 4DWIA 4CJ4A 3PO5A 4CIGA 4Q5VA 4KHUA 4OKJA 3QEWA 2I5JA 2A1SA 3HL8A 4ID5A 3U3GA 3VQQA 4W5RA 5J2QA 2IDOA 3TAFA 3SQ0A 1WNSA 3VA3A 4I2QA 3PO4A 1TL3A 3VQCA 4B9SA 3LZJA 3ZT4A 3AO3A 3S3OA 5C42A 4CIEA 2VG5A 4AHSA 3DLHA 4ZHRA 3I8DA 1RTIA 4CK2A 3KKRA 4O5BA 4FZYA 2F96A 3V81A 1C0TA 1TL1A 2X6SA 1JLBA 2YNHA 3NDKA 4O0IA 4I7FA 1TK5A 3EYZA 1G15A 1JLCA 3C94A 3MAQA 2QK9A 3ULDA 1W9HA 4F2SA 1QSSA 3U3YA 4KFBA 4FLTA 1CZBA 1C0MA 5D3GA 4OGCA 4DFJA 3S9HA 3OYBA 4M42A 4DSIA 4CHQA 1CXQA 4KHQA 3ASMA 5KI6A 4HCCA 3OYHA 4CIFA 3PX0A 5I42A 1RTHA 3L2RA 4Q0BA 3OVNA 4CFDA 5FROA 2HHTA 1C1AA 3HSTB 3T19A 3FFIA 2JLEA 4N5SA 4OLBA 3KD1E 3QEPA 4J2DA 3C6TA 3OYIA 3HJFA 4B9NA 4FJMA 1RT3A 3NGZA 1DLOA 2YKNA 3P83D 4DU3A 4IG3A 1LW2A 3O3HA 2GUIA 4M41A 3M8RA 1RT6A 1S6PA 2F8TA 2Z1GA 1RT7A 1JLQA 4IG0A 1SL1A 3BDPA 4DFKA 3HPOA 3HT3A 1HYVA 3O3FA 3KKSA 1TVRA 3U6FA 3SPYA 1D5AA 1WSIA 3TAMA 3LANA 1QSYA 4M3ZA 2KFZA 1XHXA 3V1RA 3L8BA 4DU4A 4PA1A 1IKVA 1WN7A 3QERA 2OPQA 5HBMA 1RBSA 1KSPA 4FK4A 2B4JA 1U49A 4FJXA 3TAQA 1KCFA 4O44A 3LDSA 3HP9A 4FJNA 2P5GA 4GVMA 1KFDA 3NE6A 3WNGA 3L3VA 3OY9A 1D9FA 2IC3A 3HPGA 2HHWA 5KRTA 4M3UA 2YNIA 3M8PA 2Y1JA 3VQEA 2ZD1A 4EP5A 1L5UA 4Z4HA 1BL3A 3AV9A 3DRRA 3TAEA 2YNFA 4CJPA 4O4GA 3S3MA 2XRIA 4IFYA 3PX6A 3SCXA 2QKKA 3KK2A 3V1QA 1QE1A 4KB0A 5T7BA 4FM2A 4DFMA 3NF7A 4C8MA 1EETA 2ZQBA 3B6OA 3AO1A 3NFAA 3O4NA 4O55A 4RG8A 4KAZA 3K5LA 3QESA 5EU7A 1RDAA 1S5JA 1LAWA 2B6AA 1JXBA 3K5OA 2R7YA 4BACA 2RPIA 1WSHA 4NCGA 1U04A 2D0BA 3M8QA 4M3YA 4FLWA 4F2RA 3QEXA 4I9LA 4CF1A 4KI4A 4CEBA 1IKXA 1O1WA 4Z0UA 4CJEA 4Z4GA 3B6PA 4W5QA 4Y1CA 4HUFA 3HVRA 3IAYA 1IO2A 4CJSA 4E7HA 2HVIA 5KGWA 2KFNA 4AH9A 2G8VA 4F4KA 2ATQA 2QKBA 3CFPA 4RW7A 2BGGA 3LAMA 1UAXA 2WONA 3OYLA 4N76A 3MXJA 1HYSA 3K5NA 1SKWA 2VWKA 1YT3A 3L2QA 4KHNA 3TABA 5J2MA 3ALYA 2JGUA 1HPZA 2O4GA 2DY4A 4C8NA 1WSFA 4J2EA 3P5JA 4PY5A 1QS4A 4GMJB 3VQPA 4B8AB 3AVIA 3KD5E 2DFHA 3OYCA 3T1AA 3NHGA 4ELVA 1Q9YA 3ZT1A 1RDBA 2GV9A 3VQ5A 3RWUA 3KLHA 4CEAA 1RTJA 2QXFA 2YKMA 3ZT3A 5KGXA 4FZZA 5KRSA 4DTNA 1KVCA 1Z25A 4FJ9A 1WSEA 3G10A 3F73A 1TKDA 1SKRA 3OYJA 4CF0A 2HHSA 1VSKA 1J5OA 1J54A 2YV0X 3AA5X 4AHTA 1JLFA 3SQ4A 3QNNA 4FW1A 4DQSA 1QHTA 3RMAA 2D0CA 3DLGA 4YFUA 1SL0A 2BANA 1BHLA 3AO4A 1TKTA 4DSJA 4Z4EA 4C8KA 3VQ4A 4HTUA 1FKPA 4W5NA 3LP3A 1NK8A 1T05A 4FW2A 4KRFA 5C25A 3EZ5A 4IBNA 3CG7A 4DQPA 3KK1A 3HYFA 3NF6A 3RR7A 2HHXA 3MEDA 3IG1A 4CF9A 1LWEA 1S1XA 2VG6A 3PV8A 1QQCA 2RKIA 2DFFA 5HRNA 4E89A 1KLMA 4W5OA 3CYMA 4DSLA 4FJJA 4K8XA 4CECA 1XHZA 4KI6A 4E7JA 4H8KA 1RT2A 2XY5A 4HCBA 3JYTA 2FBXA 5SZTA 3CM6A 1RDCA 1VRUA 1WLJA 2RN2A 4CFBA 4FLZA 3DLRA 4BWJA 1VSMA 4FJ8A 1S1UA 4FZXC 4AHRA 1F21A 2HVHA 3SPZA 3OS1A 3V4IA 1L3UA 2HHUA 3VN5A 4EP4A 3CFOA 3LALA 1MU2A 3MEGA 1BGXT 4OGEA 4CJQA 3DLKA 4O0JA 1KVAA 4KHSA 4CJLA 4G1QA 2HNYA 3RTVA 4XIUA 4BDZA 3SV4A 1BISA 4LSLA 3OYAA 1N5YA 4F3OA 3SUQA 5HRRA 3H08A 3OYKA 3SUOA 4KHWA 1NK5A 3KIOA 2PYLA 4LD0A 3K5MA 4CK1A 3SYZA 3SUNA 3ZSYA 4DQRA 2OPPA 1VSHA 2E6MA 4B9LA 2EHGA 4B9TA 1NOYA 1TAUA 2Z1JA 1LWCA 4DTXA 2P51A 4H4OA 5FRMA 4DSFA 3KK3A 4KPYA 4CGDA 4JLHA 3C95A 2Z1IA 4CJ3A 3D0PA 1QTMA 1C6VA 2OPSA 4FVMA 4IFVA 3L2WA 2G8HA 4Z4FA 2HNDA 3NGYA 5C24A 1HMVA 4DF8A 1CXUA 1T7PA 1S1WA 3HO1A 1RCHA 1ZBUA 4NCAA 1WAFA 4J2BA 4DFPA 4E1MA 4CJKA 1NK7A 5CYMA 1NK0A 4DSKA 1NKCA 3WNFA 3ZSWA 3DRPA 1IKWA 1HNVA 4BDPA 1TV6A 1TKXA 2YNGA 5HRPA 1XWLA 1RBVA 5HLFA 3T3FA 3V9ZA 3AVGA 1U45A 1R0AA 5JS1A 1ASWA 4CHOA 3HPHA 1HYZA 4PUOA 4WE1A 1ZBIA 3NCIA 3DMJA 4KREA 1A5WA 3DM2A 1NJWA 4N41A 1BQMA 1FKOA 3L2VA 1KVBA 3MXIA 1ZBFA 3VQ9A 4E7IA 2P5OA 2HHVA 3QIOA 1VSEA 1A5XA 2O4IA 3QNOA 4J2AA 1SKSA 3LPUA 1ZBHA 3NF9A 4CJUA 1IH7A 4M3RA 4KV8A 3K59A 3TI0A 1KLNA 2WOMA 3NGIA 2FBTA 4ELUA 1YVUA 5DK5A 4FYDA 1NOZA 1UOCA 1LV5A 3VQAA 2G8IA 1D8YA 3OS2A 1GOBA 3MECA 1ZBLA 1Z26A 4FK2A 3KLIA 4JRPA 3L3UA 4CFCA 4FK0A 1SV5A 3G0ZA 3DOLA 3OJSA 2KW4A 5J1EA 3AVJA 4FJKA 2KZZA 1CLQA 4HHTA 4IDKA 3VQDA 3VQ6A 1SUQA 3OS0A 1VSJA 4B08A 2Y1IA 1SL2A 4CEDA 3CQ8A 3VQ7A 4EZ6A 1VSDA 1YTAA 4HUGA 4KHYA 4NYFA 4N56A 4E7KA 2IOCA 2Q3SA 2ETJA 4KTZA 4QAGA 3DI6A 4UQGA 1EP4A 3F9KA 3LP1A 1NKEA 3DLBA 2AJQA 2G8WA 3WNEA 4DS5A 5DMRA 3RMDA 4OVLA 1RT1A 4KTQA 3ITHA 4CHPA 4DQQA 3SQ2A 4BE2A 2LSNA 4KTWA 2X74A 3ZT2A 2VWJA 1JLAA 4CJTA 4FM1A 1BIUA 3P1GA 4Z4IA 1U47A 4CJWA 1T8EA 2B5JA 3L2UA 3MXMA 4F3TA 1FK9A 5J2PA 3AVCA 2E4LA 3HXMA 3QINA 2XY8A 1X9MA 3RRHA 4CJFA 3V9WA 2NUBA 3SUPA 4CJVA 1LW0A 4B9VA 4B9MA 1WAJA 1RBRA 1S6QA 3ZT0A 3V6DA 2VG7A 2IGIA 1XC9A 4YNQA 3RRGA 1DTQA 5KTQA 1RTDA 4DF4A 1UWBA 3ISNC 4CESA 3AO5A 1DTTA 3K58A 3RMCA 4CGGA 1REVA 1KFSA 4R5PA 3ZSVA 5FDLA 4FLXA 1VSLA 4DTPA 1RT4A 1L3VA 1I39A 1HJRA 3QEVA 2OZMA 4FCYA 4C8LA 4FXDA 1IKYA 1A5VA 1ASVA 1EX4A 1WSJA 4IKFA 1JLEA 3BGRA 3TR8A 3V9XA 3LP0A 4CHNA 1S9EA 3A2FA 4H4MA 2OPRA 4ID1A 4OKEA 4HVJA 4JS5A 4DLEA 4GW6A 1JL2A 4LY7A 4CE9A 1RT5A 1S1TA 3JSMA 4CEEA 1BI4A 4B9UA 1BIZA 4LH4A 3NH0A 3E01A 4OKKA 4CGIA 1L3SA 1BCMA 1UA0A 3DLEA 3NBPA 4M3XA 1YTUA 4ZTFA 4RW4A 4CGHA 1TGOA 3O4QA 4CF2A 4E0DA 2P1JA 1X9WA 2E6LA 1B9DA 1BQNA 4DS4A 3KLFA 4OLAA 1VSIA 2W42A 2FBYA 1QSLA 4DQIA 3OYDA 2BE2A 5E41A 3DRSA 4LSNA 4CHZA 4DTJA 1J9AA 3I0RA 4JS4A 1JLGA 3TAGA 2OA8A 2HB5A 3OYMA 4FM0A 1B92A 3MEEA 1EXQA 1NK6A 4DLGA 2A1RA 1HQEA 1K6YA 4LH5A 3AA2A 4AILC 1NJXA 4KB1A 1C0UA 3AA4A 1X1PA 3ZSRA 1I3AA 3OYEA 3AA3A 1EKEA 2XY7A 5SWMA 4RW6A 1RILA 3NAEA 1WSGA 1Q9XA 4M3TA 4CEFA 1CZ9A 2X78A 2RF2A 4DG1A 4CCHA 4FJ5A 3KJVA 3SZ2A 4OPJA 1X9SA 1JKHA 3ZSXA 4RW9A 3IRXA 4CF8A 3V9SA 1GOCA 2XO7A 4PWDA 4E7LA 3CFRA 2HW3A 3AVKA 5HP1A 3ZSQA 3AVNA 3PY8A 1D9DA 2YHBA 1KTQA 3NH1A 2D5RA 3KTQA 3LAKA 4W5TA 3IS9A 5CY4A 2OZSA 1VSFA 4NYNA 4C8OA 4E1NA 3DOKA 2PY5A 4DMNA 2HHQA 3WNHA 3LWLA 1Q8IA 4TSXA 3NF8A 5K14A 3OYGA 4F8RA 4DTSA 3AVHA 1ASUA 4CHYA 4KKOA 4CK3A 4AHVA 4QCLA 1J53A 3VQBA 4M3WA 4MQ3A 3LP2A 1TAQA 1NK9A 4EZ9A 4ELTA 1C1BA 2IAJA 4FLUA 4B8CA 1HQUA 2X6NA 3KLEA 3QIPA 1JL1A 3EY1A 4MFBA 4Z4CA 4FJGA 4FLYA 2IS3A 4FJHA 4CGJA 3HM9A 3PX4A 3PUFA 1JXEA 3ZSOA 1RBTA 3LPTA 1GOAA 5HRSA 1XI1A 2G8UA 2XY6A 2Z1HA 5HROA 3QETA 3HVTA 5JS2A 1HRHA 1VK0A 4ICLA 1ZYQA 2FC0A 3AVMA 4OPKA 3KLGA 1U4BA 2G8KA 4QOZB 3TWHA 3THVA 1RBUA 3ZCMA 4FLVA 2FBVA 2D0AA 1L3TA 1S1VA 2DFEA 2KQ2A 3UIQA 4FJ7A 3SJJA 4FJIA 2ZE2A 3NH2A 4JRQA 4I9QA 1HNIA 2YHAA 4DTMA 5J2NA 2F8SA 2KTQA 3SQ1A 4CFAA 4K8ZA 4DU1A 3C6UA 1NKBA 5I3UA 3AO2A 1LAVA 3HK2A 1W0HA 2G8FA 4CEOA 3HP6A 3TAPA 3K2PA 4FJLA 3ZSZA 3SI6A 3AVBA 4I2PA 2DTUA 1C1CA 4AHUA 1B9FA 2KZMA 1KRPA 3QLHA 1Y97A
chains in the Genus database with same CATH superfamily
4E3SA 3OJUA 4Y1DA 3T69A 4DTRA 3FLCO 3U4LA 5A2QO 5CZ1A 1TK0A 3AVAA 3S3NA 3RR8A 4B3OA 1WBBA 5CYQA 3OYFA 3LWMA 4DTUA 3TANA 4HUEA 3F2KA 4ILHA 1P90A 4BE1A 3SBTA 4CZJA 3PSIA 3RMBA 1N6QA 3AGRA 3BF1A 5AQLA 1VQPN 2FLOA 4H0XB 3CCJN 3VEZA 4PKGA 4AHCA 4CERA 4E1JA 3ZLJA 4H03B 3O3GA 4DWIA 4Q5VA 4KHUA 3EO3A 4OKJA 1K8KA 4ID5A 4W5RA 1WNSA 3LZJA 2QTDA 3OA9A 4CIEA 4AHSA 4ZHRA 3I8DA 5KQ8A 3U9ZA 3I56N 3THWB 1N8RO 4FZYA 3LL3A 2X6SA 3NDKA 1HR0K 1Z6RA 1VQ6N 1G15A 3HTVA 1JLCA 3ULEA 2H3GX 1QSSA 4IEIA 3S9HA 3OYBA 2QA4N 3ENHA 5M1KA 1QVFM 5TKWA 3OYHA 3W3DA 3O1BA 3PX0A 4Q0BA 3OVNA 4CFDA 2HHTA 2VWBA 4N5SA 2HBKA 2CH5A 5M1QA 2GWKA 1XUPO 1DLOA 1P8ZA 3EL2A 4BRDA 2GUIA 4O5FA 4M41A 3M8RA 2HBLA 2Z1GA 3MWPA 4IXCA 1SL1A 4M7YA 3HPOA 1X9JA 3KKSA 3U6FA 1QSYA 1D5AA 3TAMA 3LANA 1IBMK 3L8BA 3QERA 1H1VA 2OPQA 1KAYA 2B4JA 3CD6N 4FWSA 4O44A 4FJNA 1BWFO 4DR7K 3G6EN 4H0VB 3NE6A 1D9FA 1XMQK 1GLBG 2IC3A 4GV6A 5KRTA 2YNIA 3VQEA 4XH1A 4LF4K 4Z4HA 3CQYA 5BN8A 3SCXA 2QKKA 2HF4A 4FM2A 3NF7A 4C8MA 1NNEA 4O55A 4FSVA 5EU7A 3LDQA 3AAPA 3K5OA 5AQFA 4BACA 1WSHA 4PL7A 2D0BA 5FPNA 1OH7A 4CBUA 4I9LA 3M1FA 4DV5K 4CF1A 1XC3A 4CEBA 4LFAK 4Z0UA 4YOYA 4Y1CA 3EKUA 2HVIA 5KGWA 1WBDA 3MWTA 4LFCK 1NWKA 1C0GA 4BQZA 2ATQA 3O6WA 2QKBA 2CGLA 3CJ7A 4FL9A 2NRRA 3K9JA 1VQ7N 4H0PA 4A62A 1HPZA 1WSFA 5TKYA 1QS4A 2QEXN 3AVIA 4CZIA 1BUPA 4QS7A 4DR6K 3T1AA 3NHGA 4DR1K 3ZT1A 1RDBA 3AAQA 2YHWA 3KLHA 4FWPA 4CZLA 1VHXA 4EFHA 3CCVN 1HX1A 1FW6A 1JCFA 3C65A 5AQWA 3H45C 1VSKA 1J5OA 2YV0X 3SQ4A 3EKSA 4JHDB 2Q2RA 3CCSN 4YFUA 1SL0A 3AO4A 4DSJA 4Z4EA 3VQ4A 1FKPA 4W5NA 3LP3A 1NK8A 4KRFA 1TUUA 5C25A 4IBNA 3EZ5A 3KK1A 2HHXA 3MEDA 3O9QA 1LWEA 1S1XA 2VG6A 3PV8A 5HRNA 3CYMA 2NNWA 4K8XA 4CECA 3AGKA 4HCBA 2NZTA 1RDCA 4H5RA 5F1XA 4FLZA 3DLRA 4BWJA 1VSMA 4AHRA 1YVNA 1F21A 4DV0K 3SBGA 3CFOA 1MU2A 3RSEB 5LMUK 4OGEA 3WT0A 1QHAA 4O0JA 3FR0A 3QICA 4G1QA 2HNYA 4CJLA 4XIUA 4BDZA 5AQUA 1BISA 5C2DA 1KD1O 5AQZA 4X64K 3KIOA 3TU5A 4LD0A 3JS6A 2YHYA 3SUNA 2OPPA 4B9LA 4JKCA 1NOYA 1TAUA 3I8BA 2EWSA 4H4OA 3KK3A 4JLHA 2Z1IA 1YXQA 1MA9B 4JI0K 4IFVA 4JHDA 2HF3A 1XNQK 4NCAA 4M7XA 3SLCA 4E1MA 5BREA 4DSKA 1NKCA 3WNFA 4AM7A 5ELZA 2YCHA 5BRFA 1HNVA 1TKXA 3D2FB 5HRPA 5HLFA 3H6EA 1ILYA 1VQLN 4JI1K 3HPHA 1ATNA 1ZBIA 1FKOA 4CZEA 1KVBA 4JKGA 4BRNA 1SZ2A 4LF5K 1T3VA 3VQ9A 2HHVA 3QIOA 4B1UB 1N32K 3MCPA 5F2RA 3VEOA 2VCPA 1SAZA 1IH7A 1YHQN 2WOMA 1YVUA 2G8IA 4BRFA 4DQ8A 1ZBLA 1Z26A 4JD2A 4JKGB 3L3UA 4AF1A 4CFCA 4FK0A 3PLAA 3O9UA 3DOLA 3OJSA 5J1EA 2ZGYA 5GAHP 1CLQA 3OS0A 3VQ6A 2Y1IA 1SL2A 1VSJA 2OTLN 1W97L 1VSDA 1YTAA 3D2FA 4N56A 2ETJA 1NMNA 4UQGA 3F9KA 1NKEA 3DLBA 3WNEA 4FOEA 1YJNN 4CHPA 4DQQA 4BE2A 4YOXA 4LFBK 2LSNA 3QB0A 2Q1NA 4KTWA 1BIUA 3D2EA 1XNRK 4CJWA 1T8EA 2B5JA 4QS8A 1C0FA 3K9KA 3J7AP 1FK9A 2GUPA 4QS9A 3GBTA 1ZC6A 1X9MA 3RRHA 1IBKK 1RBRA 3ZT0A 2VG7A 4YNQA 1DTQA 1RTDA 3CJBA 4DF4A 1UWBA 4OX9K 4CZMA 3IKMA 4R5PA 1G99A 3ZSVA 4FLXA 1HJRA 3QEVA 1ASVA 1WSJA 3KHYA 1JLEA 3J8AA 3TR8A 4KBOA 3A2FA 4ID1A 5ADXH 4OKEA 4PQUA 1JL2A 1RT5A 4B9UA 3WXJA 1BI4A 1MWKA 3WQUA 1S22A 1RDUA 3ATVA 1Q82O 5AQYA 4CF2A 4E0DA 1GLCG 4OLAA 1VSIA 1QSLA 4DQIA 5CR4A 2BE2A 5AZIA 3R8EA 4RTFD 4CHZA 4DTJA 3I0RA 3OYMA 3R3LA 4IO9L 2UXDK 2A3ZA 2A1RA 4LH5A 1NJXA 3AA4A 3CJCA 3QBWA 3OTOK 3NAEA 4BRHA 1CZ9A 4DG1A 2RF2A 4FJ5A 3KJVA 1X9SA 1JKHA 2XO7A 4PWDA 3J81O 4YOUA 1VAZA 3PY8A 2UUCK 2YHBA 3LAKA 1T44A 2OZSA 1E4FT 1EQYA 1Q8IA 4Y0WA 3NF8A 4AHVA 1J53A 4M3WA 1TAQA 4K41A 4B8CA 2A6AA 3BY5A 4DR2K 3EY1A 4Z4CA 4FJGA 4FLYA 4FJHA 3HM9A 3PX4A 3LPTA 2G8UA 5HROA 3QETA 3NMUA 4B1WB 4H5TA 1VK0A 4FPAA 4ICLA 2FC0A 3AVMA 4OPKA 4QOZB 3VOVA 5GIPA 2FSKA 2QXLA 3TWHA 1RBUA 4CJ7A 1GLAG 4FJ7A 2P9PA 2ZE2A 5AQQA 1TYQA 4KH4A 4CFAA 4YHHK 1NKBA 5DM7L 5CHIA 1GLFO 3J7YP 1W0HA 4JK9A 2RHKA 3TAPA 4FJLA 1U2VA 3AVBA 2HBMA 3IDHA 4AHUA 4DUZK 1B9FA 2NRHA 3MX2A 3DYAA 1SS6A 3I0SA 2E5LK 1LWFA 1VRTA 1BCOA 1RDDA 1ITGA 4CEQA 3SV3A 5AQJA 4BC5A 3HOTA 2QWMA 1U48A 4BGAA 2OYQA 3CJAA 1V4TA 5CZ2A 1UA1A 1R59O 3CIPA 5LY3A 3QO9A 2Q97A 5AZJA 4DUYK 1T03A 2EX3A 2YJEA 1FJGK 1BOTO 3K57A 3QEWA 2I5JA 2A1SA 4IZ9A 3U3GA 1VQNN 3VQQA 2IDOA 3PO4A 1TL3A 1BG3A 2WC9A 3AO3A 3WQTA 5C42A 2HHHK 4BRIA 2VG5A 1E4GT 1RTIA 3NVKA 3WUHA 4O5BA 1HPMA 4JI7K 2QWOA 1TK5A 3THYB 3C94A 3MAQA 4GV9A 4JKHA 1EWQA 4IOCL 3S41A 1CZBA 1QZ5A 1HNZK 3MX5A 4CHQA 4B3MK 1CXQA 2F7TA 3ASMA 4HCCA 4NB4A 1RTHA 1Q7YO 4C1NI 4FWMA 2P9SA 4BROA 4WCEL 1K8KB 1C1AA 3CC4N 5JICA 3FFIA 4OLBA 3KD1E 4J2DA 1GLDG 3ID6A 3OYIA 3HJFA 4BRKA 3NGZA 2UUBK 4FWLA 2YKNA 4C23A 1LW2A 3O3HA 4JYAK 2F8TA 1RT7A 3M5RA 3VF4A 3HT3A 3FGUA 3O3FA 2P9IB 3UB5A 2W6KA 2KFZA 1BDGA 1HLUA 3V1RA 1KSPA 1WN7A 4FK4A 1RBSA 1D4XA 4FJXA 3TAQA 4LC9B 4LF8K 3HP9A 2HOEA 1OH8A 4FWNA 3JAMO 3WNGA 3HPGA 2P9KB 2HHWA 3QFUA 2Y1JA 1HNXK 3DRRA 3TAEA 3S3MA 2XRIA 4RWTA 4DFMA 1YJWN 3LM2A 4RG8A 1RDAA 1NG9A 4IO8A 4K25A 4M3YA 4FLWA 5EX5A 4FWRA 3KWGA 1O1WA 2YX6A 2YI1A 3DXMA 4HUFA 3HVRA 1IO2A 4CJSA 5M1NA 4AH9A 1O13A 3T1YK 3CFPA 4RW7A 2WONA 3OYLA 3MXJA 2VWKA 5AQRA 4IWVA 2DY4A 3EEQA 4C8NA 3CMEN 4PY5A 1DEJA 2ZJRL 3VQPA 2NRWA 3CJ1A 1YUWA 4V19S 4UY8O 1ZBSA 4CEAA 5FPDA 4IOXA 4FZZA 3ENBA 4DTNA 4WQ4C 3G10A 4DV1K 1YIJN 3OYJA 3ID8A 3THYA 3QNNA 1DT9A 2ASOA 4LF9K 4FW1A 4JK7A 4DQSA 1QHTA 1TKTA 4I6MA 4HTUA 1T05A 3NF6A 2F9TA 1NU0A 3IG1A 2RKIA 1NLVA 1KLMA 2QWQA 4E89A 4KI6A 4IOAL 3JYTA 1CZAN 3CJ9A 3CHWA 2GELA 2RN2A 4IDHA 3O1WA 4BVPA 1QVGM 5IWAK 1S1UA 1KAZA 1Q18A 4CBWA 4EP4A 3MEGA 3MN5A 1K9MO 3DLKA 1YI2N 4KHSA 3SV4A 1YAGA 5KPTA 4KHWA 2AA4A 3SUOA 1WUAA 4FOIA 5JMVA 4BR9A 3ZSYA 4DQRA 1VSHA 4B9TA 3CXCM 4BR4A 2Z1JA 1LWCA 4X65K 3H3OB 1U2VB 3C95A 4FPBA 3A0IX 1C6VA 2HNDA 3NGYA 3CCQN 1CXUA 5JVHL 4J2BA 4DFPA 3LDNA 4MDBA 2QWLA 4YOWA 3FZMA 2UUAK 1IKWA 4BDPA 1VQ9N 3U8XA 3O80A 1U45A 1R0AA 5JS1A 4CHOA 1KC8O 3DMJA 1A5WA 4B3TK 5HOOA 5JLFA 3MXIA 3CI5A 1ZBFA 1VSEA 3QNOA 4J2AA 3F5TA 3LPUA 5AQNA 2NRZA 3NF9A 4CJUA 4CD1A 2FBTA 2P9SB 4FYDA 1UOCA 3OS2A 3BUZB 3MECA 5FPEA 4FK2A 1ATSA 2F4VK 3VEYA 1SV5A 5BR9A 2KZZA 4B08A 4CI6A 4CEDA 4JI5K 4EZ6A 4DV2K 4NYFA 4E7KA 2IOCA 4KTZA 5E26A 5FPMA 3EZWA 2V7ZA 4G9ZA 4JK8A 3RMDA 1RT1A 3E9OA 3ITHA 3U9DA 4CJTA 4Z4IA 2O8FA 3L2UA 1NGBA 2E1YA 3HXMA 3SUPA 4CJFA 2NUBA 1LW0A 4B9MA 5B8HA 2IIRA 1XC9A 5KTQA 4CESA 4OO1J 4A2BA 4DTPA 2PAVA 3N4QA 2ASMA 4FCYA 4C8LA 1IKYA 1A5VA 1VQMN 3VEVA 3BGRA 3GOIA 3LP0A 5I9EB 1S9EA 2D4WA 4GW6A 4LY7A 3RVCA 4CE9A 1HNWK 3TSUA 4LH4A 2NRVA 2ZF5O 4GY2B 1YTUA 4ZTFA 4CGHA 2I7PA 3O4QA 1X9WA 4OPAA 2E6LA 1BQNA 4DS4A 3KLFA 3SAGA 3OYDA 4LSNA 1J9AA 3KZBA 1B92A 1HQEA 1V4SA 4BG9A 1BA1A 4AILC 1I3AA 1EKEA 1YITN 1RILA 1WSGA 3H1QA 4M3TA 2X78A 4NO7A 4IFEA 4CCHA 3SZ2A 4OPJA 3ZSXA 1GOCA 4JI6K 3TTFA 2J4RA 3CFRA 1GLEG 2HW3A 5GIOA 2BUPA 3B8AX 1NMDA 4MO4A 1KTQA 1QQOA 4W5TA 3IS9A 2FSJA 1N36K 4DV6K 4F8RA 3UKUA 2Q0RA 4CK3A 4BY9C 4CVNE 2E2QA 4MQ3A 3LP2A 1NK9A 4WQ4A 1VQON 3VGMA 2IAJA 4FLUA 1HQUA 2X6NA 3KLEA 3I33A 4MFBA 4CGJA 1JXEA 1Z05A 1XI1A 4PL8A 2Z1HA 1KAXA 3SMSA 1HRHA 3DAWA 1ZYQA 3C7NB 1U4BA 3PSFA 4FLVA 1L3TA 2KQ2A 3TSQA 1MDUB 4JRQA 3G71N 3P4IA 3OBYA 5BPLA 2F8SA 2A42A 3SQ1A 5LMNK 4DU1A 3R9PA 5AJ3K 5BR8K 5I3UA 3AO2A 1MWMA 2G8FA 3HP6A 3ZSZA 4CBXA 2E20A 5BPMA 3CCEN 1HUXA 3C6AA 2KZMA 3QLHA 2IVPA 4OJRA 4BDYA 3QEIA 3M8SA 4ILJA 4ISGA 3HOSA 2O8CB 2GBZA 5AFUH 1BI4B 2W41A 5KPRA 2E1ZA 2PYJA 3AVLA 3O8MA 1RNHA 1IG9A 3V1OA 2PZSA 2HBJA 1NJZA 4L8RB 4DSEA 4WFNL 4KO0A 3TARA 2BDPA 3AVFA 4BWMA 3HSCA 2O8DB 3D45A 3D6RA 3IMXA 4E19A 4CGFA 5BN9A 4B3SK 3Q7CA 3ZETA 5DM6L 4CJ4A 4DR3K 3GG4A 3THXB 3HL8A 2V51B 3VA3A 4I2QA 3VQCA 3ZT4A 3S3OA 3DLHA 3QDKA 4FWQA 3KKRA 3Q7BA 3LDOA 2F96A 1C0TA 2YNHA 3FZHA 3LDPA 4H0OA 2ZJPL 4H5VA 3EYZA 3VENA 3ZEUB 2QK9A 1W9HA 3U3YA 4KFBA 4FLTA 5D3GA 4OGCA 4CZKA 4A57A 4M42A 4DV4K 4DSIA 4MDAA 2JWLA 3ZX3A 4CIFA 1VQ4N 5I42A 2O8EA 1SQKA 2KLAA 5AQSA 3MN6A 3HSTB 3DLLL 3T19A 1NGEA 4YOVA 1WOQA 3PIPL 3QEPA 3C6TA 3M3ZA 2P9KA 1RT3A 2O8EB 2DPNA 3TPQA 4CW7B 3EE8A 3ZX2A 3FZKA 3SK3A 3UKUB 4EHTA 4DU3A 3AARA 3W0LA 4IG3A 3A5NC 4CZGA 3CERA 3VESA 4XH4A 1J6ZA 2CGJA 5EXWA 1NGJA 2ZM6K 1HYVA 2E2NA 4MLEA 3MN9A 1WSIA 2P9IA 4M3ZA 3O08A 1XHXA 4DU4A 1VQ8N 5HBMA 3WEEA 1U49A 1KCFA 3T7ZA 4CD3A 2P5GA 4GVMA 1KFDA 3L3VA 1YJ9N 2ZWHA 4M3UA 2ZD1A 1L5UA 1BL3A 2VGNA 4CJPA 4X66K 3CCMN 4O4GA 4IFYA 3PX6A 2UXCK 4B1YB 3V1QA 1QE1A 4JKFA 5T7BA 1EETA 2ZQBA 3B6OA 3AO1A 3NFAA 3O4NA 5LJWA 1NGHA 3TTDA 4KAZA 4PHTX 4IJAA 3JXUA 1S5JA 1ZXOA 1JXBA 4ISFA 2R7YA 4KH5A 1U04A 3M8QA 2QW9A 1GLLO 3D7EO 4F2RA 3QEXA 4U7BA 2O8CA 4Z4GA 4CJEA 3BP8A 3B6PA 4W5QA 1NGFA 5KQDA 3IAYA 1NGCA 4E7HA 2KFNA 3BZKA 2G8VA 4F4KA 1HYSA 1UAXA 5H1SQ 1SKWA 3E9PA 1YT3A 1E3MA 1VQKN 4GMJB 1K8AO 4B8AB 4KH6A 2O8FB 2DFHA 3MK6A 3OYCA 4BR2A 4ELVA 1Q9YA 3T1HK 2OCEA 3F9MA 2QXFA 3ZT3A 5KGXA 1LCUA 2NRTA 4H0TB 1Z25A 3VEWA 3F73A 1TKDA 1N34K 2QWPA 2CGKA 2VGMA 2Q0UA 3AA5X 1T6DA 3CQXA 4XEIA 4FO0A 2D0CA 4JKAA 3DLGA 2BANA 1BHLA 1HKGA 4EIAA 3C6HA 1OH5A 2OANA 1WB9A 3O9RA 1T6CA 1NGDA 1N33K 3HYFA 4CF9A 5HL7L 2DFFA 4DSLA 4FJJA 1XHZA 4E7JA 2FBXA 4DV7K 3C0BA 1M90O 2RE2A 4FJ8A 4FZXC 1ESVA 3SAFA 2P9PB 4YDUC 1L3UA 3O4WA 1BGXT 5AQOA 5AQTA 3RTVA 3L4IA 5E84A 5KPZA 4LSLA 5EY4A 4F3OA 3SUQA 3H08A 3UE5A 3OYKA 1NK5A 1BU6O 3K5MA 2UYTA 1GLJO 2E6MA 3CCRN 2EHGA 1IG8A 4BRAA 1TUYA 5FRMA 1HKBA 1X3NA 4A5BA 3D0PA 2OPSA 4FVMA 3P39A 5C24A 4DF8A 1S1WA 4ISEA 3R1XA 5CYMA 3CMAN 3IFRA 3QFPA 3DRPA 3T3FA 3AVGA 4WE1A 5C0YA 4BRQA 3NCIA 4KREA 3DM2A 1NJWA 4N41A 2A5XA 4BRLA 1A5XA 1W2BM 3E66A 1ATRA 4M3RA 4KV8A 3K59A 4GV3A 3NGIA 4ELUA 1LV5A 3VQAA 1D8YA 4BQLA 3KLIA 1NGGA 3G0ZA 4IDKA 3VQDA 1SUQA 3DJCA 1BO5O 3CQ8A 5EOYA 3WXIA 4KHYA 1S72N 2Q3SA 4QAGA 2W40A 3LP1A 1IBLK 4U67L 2GWJA 4DS5A 4M63C 5DMRA 4OVLA 4KTQA 3SQ2A 3ZT2A 3DWLA 1U47A 4BRMA 3CC7N 3MXMA 4F3TA 5J2PA 3AVCA 3CCUN 3QINA 2XY8A 3VETA 3V9WA 4CJVA 2P9NB 2HMPA 1S6QA 2E2PA 3V6DA 3CETA 5JLHA 2NRXA 3AO5A 1DTTA 3K58A 5M1FA 5C2FA 5EVZA 5FDLA 4BG8A 4NXMK 2FSNA 1I39A 4JI4K 1OKJA 3TSPA 1XQSC 3HM8A 1EX4A 4C1NK 4BR7A 4IKFA 3V9XA 4CHNA 4DLEA 2OPRA 4JS5A 4CEEA 3CCLN 3NH0A 3E01A 4OKKA 1IV0A 4CGIA 1L3SA 1UA0A 3DLEA 4BRCA 2P1JA 3BEXA 3MDQA 4JEPA 2IVOA 2FBYA 2F9WA 3WXMB 4JS4A 1Q86O 1JLGA 2HB5A 4FM0A 4H5NA 4DV3K 1NJIO 3UKRB 4F9OA 1NK6A 4DLGA 2UXBK 1K6YA 3AA2A 1C0UA 1X1PA 3ZSRA 3OYEA 2XY7A 3AA3A 4WQ5A 4RW6A 4K43A 1Q9XA 4CEFA 3ZX0A 3VMFB 3IRXA 4CF8A 5BPNA 1NBWA 5C15A 3AVKA 5HP1A 3ZSQA 3AVNA 3ZEUA 3NH1A 3KTQA 4BRPA 5CY4A 1VSFA 3ZYYX 4E1NA 2PY5A 3WNHA 3LWLA 1QZ6A 4TSXA 5K14A 2KHOA 1ASUA 4CHYA 4GNIA 4JKDA 5M1OA 4B1VA 4QCLA 4ELTA 1C1BA 2BTFA 3QIPA 4I6MB 1JL1A 3MMVA 4EAHD 4IEEA 3ZSOA 5HRSA 2FXUA 2O8DA 4AQYK 1I94K 5JS2A 3G25A 2G8KA 3THVA 3ZCMA 3RSEA 1S1VA 3UIQA 3LM9A 4IJNA 4MLHA 4BC2A 4I9QA 4DTMA 2KKZA 5ADXA 2ASPA 1BA0A 3VGKA 3VERA 3DXKA 3K2PA 1OH6A 4I2PA 4NLCA 3VGLA 4WYBA 2HSTA 2P9LB 1KRPA 1Y97A 4ZTJA 1NJYA 4EHUA 4BE0A 3KK7A 4A61A 5JVGL 3DXMB 3O9SA 2PBDA 3CM5A 2HNZA 3VA0A 2VQFK 3WEEB 5FRNA 3LZIA 4CJRA 1FXXA 2GX9A 5AQGA 3SNNA 1TK8A 4CJ5A 4M45A 5GADP 3VQ8A 4NCBA 1S9GA 4LF7K 3HBTA 4RW8A 2XHBA 3GE1A 4N47A 2GEMA 2HMIA 3OYNA 4DTOA 2BH1A 4A59A 5MLCQ 4JI3K 4J8FA 2ITGA 1TKZA 1DGKN 4CEZA 3V9UA 3NVMA 1YF5L 3UKRA 1NK4A 1EO1A 2CH6A 4BC4A 1VQ5N 3PO5A 4CIGA 3G4SN 4BRGA 5J2QA 3TAFA 3SQ0A 1IJJA 4B9SA 2O8BB 3QBXA 4WFAL 1X3MA 4CK2A 3V81A 3J7ZO 3VTIA 1TL1A 1JLBA 4O0IA 4I7FA 3VF6A 3ULDA 4F2SA 2WUSA 1C0MA 4DFJA 4O8KA 3QMLA 4FWOA 4KHQA 5KI6A 4WF9L 5GAGP 3K0SA 3L2RA 4JKEA 3A5LC 5FROA 5AQVA 2JLEA 4FWKA 3MCAB 4CZFA 4B9NA 4FJMA 4K42A 1HKCA 4H0YB 3P83D 1RT6A 1QQMA 1S6PA 4A5AA 1JLQA 4IG0A 3BDPA 2VQEK 4DFKA 3FE1A 3SPYA 1TVRA 4LF6K 4PA1A 1IKVA 4GKJK 5IT9O 2D0PA 3ATUA 2P9UA 4HWIA 3LDSA 4GKKK 1Q81O 2QI2A 4L3QA 1HJOA 3OY9A 4JN4A 3I55N 3M8PA 4EP5A 3SMPA 3AV9A 1LOTB 2YNFA 1KXPA 2AP1A 5AZIB 2D0OA 3KK2A 4KB0A 3P38A 4B9QA 2P9UB 4YORA 3K5LA 3QESA 1LAWA 2B6AA 4B3RK 1JJ2M 2W6LA 2RPIA 3CPWM 3BF3A 4NCGA 4AM6A 3H46O 3CC2N 3C7NA 5BRHA 4ILGB 4KI4A 4KHPK 1IKXA 2VYPA 2ZJQL 3THWA 4BVOA 1Y64A 3O9TA 1EWRA 1J5EK 2JWKA 2QM1A 4JKBA 3R6MA 4BR0A 2E8AA 1U6ZA 2BGGA 3LAMA 4N76A 3K5NA 3GDQA 3CF5L 1K73O 2A40A 4KHNA 3L2QA 3TABA 5J2MA 1RFQA 3ALYA 4B1XB 2JGUA 2O4GA 4Z94A 4J2EA 3TTCA 3EE9A 3P5JA 3LDLA 4XH5A 3M6GA 3KD5E 1OVQA 4MO5A 1TYQB 4O8UA 2GV9A 3VQ5A 3RWUA 1RTJA 3WXLA 2YKMA 5KRSA 3IUCA 1KVCA 4FJ9A 1WSEA 1SKRA 1XMOK 4CF0A 2HHSA 4GVEA 3FZFA 2D1KA 4DCHA 1J54A 4AHTA 3P31A 4DKWA 1JLFA 3L0QA 5F0XA 3RMAA 1M1KO 2O8BA 4JD2B 4C8KA 4FW2A 5AQHA 4DQPA 3CG7A 2YJFA 3OHRA 3RR7A 3N4PA 1QQCA 4W5OA 4H8KA 1RT2A 2XY5A 5SZTA 3CM6A 4BR5A 1VRUA 2V52B 1WLJA 4CFBA 4H5WA 2HVHA 4WQ5C 3SPZA 3OS1A 3V4IA 2HHUA 3VN5A 3LALA 4CJQA 1KVAA 2WFBA 2FF3B 3OYAA 1N5YA 5HRRA 2PYLA 2E88A 4CK1A 3SYZA 3OBWA 4JI8K 4PKHA 5AQKA 4HTLA 4DTXA 5AQIA 2P51A 4DSFA 4KPYA 1NGIA 4CGDA 3VTHA 2YHXA 3VF2A 4CJ3A 1QTMA 3A5OC 3KVGA 2Q31A 3L2WA 4BC3A 2G8HA 4Z4FA 1HMVA 1T7PA 3HO1A 1RCHA 1ZBUA 1WAFA 3FZLA 4CJKA 1NK7A 1NK0A 2OTJN 3ZSWA 5GAEP 1TV6A 2YNGA 1XWLA 1RBVA 3L4QA 2E2OA 3E9LA 3VEXA 3J80O 1ASWA 4PUOA 1HYZA 4JAXA 2NLXA 1BQMA 3L2VA 4E7IA 2P5OA 3L6QA 2O4IA 1SKSA 1ZBHA 5AQPA 5FLXO 3A8YA 3SJHA 3TI0A 1KLNA 5C10A 5DK5A 1NOZA 1GOBA 3D2EB 4JRPA 4DR5K 4FJKA 2KW4A 3AVJA 4HHTA 2WTUA 3HZ6A 3VQ7A 3WXKA 4HUGA 2PFUA 3HI0A 3DI6A 1EP4A 3MN7A 2AJQA 2G8WA 5LL6Z 3FFKB 2GTDA 4R79A 4FM1A 2X74A 2VWJA 1JLAA 3P1GA 4OPHA 1RGIA 1KQSM 2E4LA 5AQMA 4B9VA 1WAJA 2IGIA 4BREA 4WFBL 3RRGA 2Q36A 3ISNC 1OVYA 3RMCA 4CGGA 1REVA 1KFSA 1S3XA 1VSLA 1RT4A 1L3VA 3BZCA 2V7YA 2ITMA 2OZMA 4FXDA 5GINA 4DB3A 4A2AA 5BRDA 3KWIA 4H4MA 4HVJA 3O5BA 3V9ZA 3E1YA 1S1TA 3JSMA 5LJVA 4JV5K 1BIZA 1BCMA 4M3XA 3NBPA 4BGBA 4RW4A 1TGOA 2IVNA 3VPZA 5C12A 1B9DA 2W42A 2P9LA 2UU9K 4DR4K 5E41A 3THXA 3DRSA 3TAGA 2P9NA 3ZETB 2OA8A 3DXKB 3MEEA 1EXQA 4NXNK 5M1PA 4YOTA 2ZGZA 4FVUA 3A5MC 4KB1A 5CE3A 4YDUA 5SWMA 3ENOA 4CZHA 5AFUA 2I7NA 4X62K 4JNEA 4PKIA 4RW9A 3V9SA 4E7LA 4RCHA 1D9DA 2D5RA 2HHQA 4NYNA 4C8OA 3DOKA 4DMNA 3OYGA 4DTSA 3AVHA 3EN9A 4JI2K 5AQXA 4KKOA 3GL1A 1JCGA 3VQBA 4EZ9A 5AR0A 3HRGA 4K0KK 2IS3A 3PUFA 1RBTA 1GOAA 3SAHA 2XY6A 3HVTA 5AZJB 4YY3K 4NLBA 3AY9A 3KLGA 1NGAA 2FBVA 1JCEA 2D0AA 3CPEA 2QWNA 2DFEA 3H1VX 1W7AA 3SJJA 4FJIA 3NH2A 1HNIA 1RDWX 3PIOL 3ULEB 2YHAA 5J2NA 2QWRA 2KTQA 3OW2M 4K8ZA 3C6UA 1LAVA 3HK2A 2FF6A 4DHYA 1QQNA 4CEOA 1NM1A 3H3NO 3SI6A 2DTUA 1C1CA 4B1ZA 1DKGD 2A41A 2WBNA
chains in the Genus database with same CATH topology
4ZTJA 4E3SA 3OJUA 4Y1DA 1NJYA 3DYAA 4OJRA 4BE0A 4BDYA 4DTRA 3I0SA 3QEIA 3M8SA 1LWFA 4PQUA 1VRTA 1BCOA 1RDDA 1ITGA 2HNZA 3CM5A 3VA0A 4CEQA 3SV3A 5CZ1A 5FRNA 2GBZA 1TK0A 3AVAA 1BI4B 4CJRA 1FXXA 3LZIA 3SNNA 3S3NA 3RR8A 1TK8A 4B3OA 2PYJA 3AVLA 5CYQA 3OYFA 1RNHA 4CJ5A 4M45A 3V1OA 3LWMA 3VQ8A 4HUEA 4DTUA 3TANA 1U48A 1IG9A 2PZSA 2OYQA 4NCBA 1S9GA 1NJZA 5CZ2A 4BE1A 1UA1A 4RW8A 4DSEA 2XHBA 4L8RB 3RMBA 4N47A 4KO0A 3TARA 1N6QA 3QO9A 2BDPA 2HMIA 3OYNA 4DTOA 1T03A 3AVFA 2EX3A 4BWMA 3D45A 2ITGA 1TKZA 4AHCA 4CERA 3K57A 4CEZA 4E19A 4CGFA 3V9UA 3O3GA 1NK4A 4DWIA 4CJ4A 3PO5A 4CIGA 4Q5VA 4KHUA 4OKJA 3QEWA 2I5JA 2A1SA 3HL8A 4ID5A 3U3GA 3VQQA 4W5RA 5J2QA 2IDOA 3TAFA 3SQ0A 1WNSA 3VA3A 4I2QA 3PO4A 1TL3A 3VQCA 4B9SA 3LZJA 3ZT4A 3AO3A 3S3OA 5C42A 4CIEA 2VG5A 4AHSA 3DLHA 4ZHRA 3I8DA 1RTIA 4CK2A 3KKRA 4O5BA 4FZYA 2F96A 3V81A 1C0TA 1TL1A 2X6SA 1JLBA 2YNHA 3NDKA 4O0IA 4I7FA 1TK5A 3EYZA 1G15A 1JLCA 3C94A 3MAQA 2QK9A 3ULDA 1W9HA 4F2SA 1QSSA 3U3YA 4KFBA 4FLTA 1CZBA 1C0MA 5D3GA 4OGCA 4DFJA 3S9HA 3OYBA 4M42A 4DSIA 4CHQA 1CXQA 4KHQA 3ASMA 5KI6A 4HCCA 3OYHA 4CIFA 3PX0A 5I42A 1RTHA 3L2RA 4Q0BA 3OVNA 4CFDA 5FROA 2HHTA 1C1AA 3HSTB 3T19A 3FFIA 2JLEA 4N5SA 4OLBA 3KD1E 3QEPA 4J2DA 3C6TA 3OYIA 3HJFA 4B9NA 4FJMA 1RT3A 3NGZA 1DLOA 2YKNA 3P83D 4DU3A 4IG3A 1LW2A 3O3HA 2GUIA 4M41A 3M8RA 1RT6A 1S6PA 2F8TA 2Z1GA 1RT7A 1JLQA 4IG0A 1SL1A 3BDPA 4DFKA 3HPOA 3HT3A 1HYVA 3O3FA 3KKSA 1TVRA 3U6FA 3SPYA 1D5AA 1WSIA 3TAMA 3LANA 1QSYA 4M3ZA 2KFZA 1XHXA 3V1RA 3L8BA 4DU4A 4PA1A 1IKVA 1WN7A 3QERA 2OPQA 5HBMA 1RBSA 1KSPA 4FK4A 2B4JA 1U49A 4FJXA 3TAQA 1KCFA 4O44A 3LDSA 3HP9A 4FJNA 2P5GA 4GVMA 1KFDA 3NE6A 3WNGA 3L3VA 3OY9A 1D9FA 2IC3A 3HPGA 2HHWA 5KRTA 4M3UA 2YNIA 3M8PA 2Y1JA 3VQEA 2ZD1A 4EP5A 1L5UA 4Z4HA 1BL3A 3AV9A 3DRRA 3TAEA 2YNFA 4CJPA 4O4GA 3S3MA 2XRIA 4IFYA 3PX6A 3SCXA 2QKKA 3KK2A 3V1QA 1QE1A 4KB0A 5T7BA 4FM2A 4DFMA 3NF7A 4C8MA 1EETA 2ZQBA 3B6OA 3AO1A 3NFAA 3O4NA 4O55A 4RG8A 4KAZA 3K5LA 3QESA 5EU7A 1RDAA 1S5JA 1LAWA 2B6AA 1JXBA 3K5OA 2R7YA 4BACA 2RPIA 1WSHA 4NCGA 1U04A 2D0BA 3M8QA 4M3YA 4FLWA 4F2RA 3QEXA 4I9LA 4CF1A 4KI4A 4CEBA 1IKXA 1O1WA 4Z0UA 4CJEA 4Z4GA 3B6PA 4W5QA 4Y1CA 4HUFA 3HVRA 3IAYA 1IO2A 4CJSA 4E7HA 2HVIA 5KGWA 2KFNA 4AH9A 2G8VA 4F4KA 2ATQA 2QKBA 3CFPA 4RW7A 2BGGA 3LAMA 1UAXA 2WONA 3OYLA 4N76A 3MXJA 1HYSA 3K5NA 1SKWA 2VWKA 1YT3A 3L2QA 4KHNA 3TABA 5J2MA 3ALYA 2JGUA 1HPZA 2O4GA 2DY4A 4C8NA 1WSFA 4J2EA 3P5JA 4PY5A 1QS4A 4GMJB 3VQPA 4B8AB 3AVIA 3KD5E 2DFHA 3OYCA 3T1AA 3NHGA 4ELVA 1Q9YA 3ZT1A 1RDBA 2GV9A 3VQ5A 3RWUA 3KLHA 4CEAA 1RTJA 2QXFA 2YKMA 3ZT3A 5KGXA 4FZZA 5KRSA 4DTNA 1KVCA 1Z25A 4FJ9A 1WSEA 3G10A 3F73A 1TKDA 1SKRA 3OYJA 4CF0A 2HHSA 1VSKA 1J5OA 1J54A 2YV0X 3AA5X 4AHTA 1JLFA 3SQ4A 3QNNA 4FW1A 4DQSA 1QHTA 3RMAA 2D0CA 3DLGA 4YFUA 1SL0A 2BANA 1BHLA 3AO4A 1TKTA 4DSJA 4Z4EA 4C8KA 3VQ4A 4HTUA 1FKPA 4W5NA 3LP3A 1NK8A 1T05A 4FW2A 4KRFA 5C25A 3EZ5A 4IBNA 3CG7A 4DQPA 3KK1A 3HYFA 3NF6A 3RR7A 2HHXA 3MEDA 3IG1A 4CF9A 1LWEA 1S1XA 2VG6A 3PV8A 1QQCA 2RKIA 2DFFA 5HRNA 4E89A 1KLMA 4W5OA 3CYMA 4DSLA 4FJJA 4K8XA 4CECA 1XHZA 4KI6A 4E7JA 4H8KA 1RT2A 2XY5A 4HCBA 3JYTA 2FBXA 5SZTA 3CM6A 1RDCA 1VRUA 1WLJA 2RN2A 4CFBA 4FLZA 3DLRA 4BWJA 1VSMA 4FJ8A 1S1UA 4FZXC 4AHRA 1F21A 2HVHA 3SPZA 3OS1A 3V4IA 1L3UA 2HHUA 3VN5A 4EP4A 3CFOA 3LALA 1MU2A 3MEGA 1BGXT 4OGEA 4CJQA 3DLKA 4O0JA 1KVAA 4KHSA 4CJLA 4G1QA 2HNYA 3RTVA 4XIUA 4BDZA 3SV4A 1BISA 4LSLA 3OYAA 1N5YA 4F3OA 3SUQA 5HRRA 3H08A 3OYKA 3SUOA 4KHWA 1NK5A 3KIOA 2PYLA 4LD0A 3K5MA 4CK1A 3SYZA 3SUNA 3ZSYA 4DQRA 2OPPA 1VSHA 2E6MA 4B9LA 2EHGA 4B9TA 1NOYA 1TAUA 2Z1JA 1LWCA 4DTXA 2P51A 4H4OA 5FRMA 4DSFA 3KK3A 4KPYA 4CGDA 4JLHA 3C95A 2Z1IA 4CJ3A 3D0PA 1QTMA 1C6VA 2OPSA 4FVMA 4IFVA 3L2WA 2G8HA 4Z4FA 2HNDA 3NGYA 5C24A 1HMVA 4DF8A 1CXUA 1T7PA 1S1WA 3HO1A 1RCHA 1ZBUA 4NCAA 1WAFA 4J2BA 4DFPA 4E1MA 4CJKA 1NK7A 5CYMA 1NK0A 4DSKA 1NKCA 3WNFA 3ZSWA 3DRPA 1IKWA 1HNVA 4BDPA 1TV6A 1TKXA 2YNGA 5HRPA 1XWLA 1RBVA 5HLFA 3T3FA 3V9ZA 3AVGA 1U45A 1R0AA 5JS1A 1ASWA 4CHOA 3HPHA 1HYZA 4PUOA 4WE1A 1ZBIA 3NCIA 3DMJA 4KREA 1A5WA 3DM2A 1NJWA 4N41A 1BQMA 1FKOA 3L2VA 1KVBA 3MXIA 1ZBFA 3VQ9A 4E7IA 2P5OA 2HHVA 3QIOA 1VSEA 1A5XA 2O4IA 3QNOA 4J2AA 1SKSA 3LPUA 1ZBHA 3NF9A 4CJUA 1IH7A 4M3RA 4KV8A 3K59A 3TI0A 1KLNA 2WOMA 3NGIA 2FBTA 4ELUA 1YVUA 5DK5A 4FYDA 1NOZA 1UOCA 1LV5A 3VQAA 2G8IA 1D8YA 3OS2A 1GOBA 3MECA 1ZBLA 1Z26A 4FK2A 3KLIA 4JRPA 3L3UA 4CFCA 4FK0A 1SV5A 3G0ZA 3DOLA 3OJSA 2KW4A 5J1EA 3AVJA 4FJKA 2KZZA 1CLQA 4HHTA 4IDKA 3VQDA 3VQ6A 1SUQA 3OS0A 1VSJA 4B08A 2Y1IA 1SL2A 4CEDA 3CQ8A 3VQ7A 4EZ6A 1VSDA 1YTAA 4HUGA 4KHYA 4NYFA 4N56A 4E7KA 2IOCA 2Q3SA 2ETJA 4KTZA 4QAGA 3DI6A 4UQGA 1EP4A 3F9KA 3LP1A 1NKEA 3DLBA 2AJQA 2G8WA 3WNEA 4DS5A 5DMRA 3RMDA 4OVLA 1RT1A 4KTQA 3ITHA 4CHPA 4DQQA 3SQ2A 4BE2A 2LSNA 4KTWA 2X74A 3ZT2A 2VWJA 1JLAA 4CJTA 4FM1A 1BIUA 3P1GA 4Z4IA 1U47A 4CJWA 1T8EA 2B5JA 3L2UA 3MXMA 4F3TA 1FK9A 5J2PA 3AVCA 2E4LA 3HXMA 3QINA 2XY8A 1X9MA 3RRHA 4CJFA 3V9WA 2NUBA 3SUPA 4CJVA 1LW0A 4B9VA 4B9MA 1WAJA 1RBRA 1S6QA 3ZT0A 3V6DA 2VG7A 2IGIA 1XC9A 4YNQA 3RRGA 1DTQA 5KTQA 1RTDA 4DF4A 1UWBA 3ISNC 4CESA 3AO5A 1DTTA 3K58A 3RMCA 4CGGA 1REVA 1KFSA 4R5PA 3ZSVA 5FDLA 4FLXA 1VSLA 4DTPA 1RT4A 1L3VA 1I39A 1HJRA 3QEVA 2OZMA 4FCYA 4C8LA 4FXDA 1IKYA 1A5VA 1ASVA 1EX4A 1WSJA 4IKFA 1JLEA 3BGRA 3TR8A 3V9XA 3LP0A 4CHNA 1S9EA 3A2FA 4H4MA 2OPRA 4ID1A 4OKEA 4HVJA 4JS5A 4DLEA 4GW6A 1JL2A 4LY7A 4CE9A 1RT5A 1S1TA 3JSMA 4CEEA 1BI4A 4B9UA 1BIZA 4LH4A 3NH0A 3E01A 4OKKA 4CGIA 1L3SA 1BCMA 1UA0A 3DLEA 3NBPA 4M3XA 1YTUA 4ZTFA 4RW4A 4CGHA 1TGOA 3O4QA 4CF2A 4E0DA 2P1JA 1X9WA 2E6LA 1B9DA 1BQNA 4DS4A 3KLFA 4OLAA 1VSIA 2W42A 2FBYA 1QSLA 4DQIA 3OYDA 2BE2A 5E41A 3DRSA 4LSNA 4CHZA 4DTJA 1J9AA 3I0RA 4JS4A 1JLGA 3TAGA 2OA8A 2HB5A 3OYMA 4FM0A 1B92A 3MEEA 1EXQA 1NK6A 4DLGA 2A1RA 1HQEA 1K6YA 4LH5A 3AA2A 4AILC 1NJXA 4KB1A 1C0UA 3AA4A 1X1PA 3ZSRA 1I3AA 3OYEA 3AA3A 1EKEA 2XY7A 5SWMA 4RW6A 1RILA 3NAEA 1WSGA 1Q9XA 4M3TA 4CEFA 1CZ9A 2X78A 2RF2A 4DG1A 4CCHA 4FJ5A 3KJVA 3SZ2A 4OPJA 1X9SA 1JKHA 3ZSXA 4RW9A 3IRXA 4CF8A 3V9SA 1GOCA 2XO7A 4PWDA 4E7LA 3CFRA 2HW3A 3AVKA 5HP1A 3ZSQA 3AVNA 3PY8A 1D9DA 2YHBA 1KTQA 3NH1A 2D5RA 3KTQA 3LAKA 4W5TA 3IS9A 5CY4A 2OZSA 1VSFA 4NYNA 4C8OA 4E1NA 3DOKA 2PY5A 4DMNA 2HHQA 3WNHA 3LWLA 1Q8IA 4TSXA 3NF8A 5K14A 3OYGA 4F8RA 4DTSA 3AVHA 1ASUA 4CHYA 4KKOA 4CK3A 4AHVA 4QCLA 1J53A 3VQBA 4M3WA 4MQ3A 3LP2A 1TAQA 1NK9A 4EZ9A 4ELTA 1C1BA 2IAJA 4FLUA 4B8CA 1HQUA 2X6NA 3KLEA 3QIPA 1JL1A 3EY1A 4MFBA 4Z4CA 4FJGA 4FLYA 2IS3A 4FJHA 4CGJA 3HM9A 3PX4A 3PUFA 1JXEA 3ZSOA 1RBTA 3LPTA 1GOAA 5HRSA 1XI1A 2G8UA 2XY6A 2Z1HA 5HROA 3QETA 3HVTA 5JS2A 1HRHA 1VK0A 4ICLA 1ZYQA 2FC0A 3AVMA 4OPKA 3KLGA 1U4BA 2G8KA 4QOZB 3TWHA 3THVA 1RBUA 3ZCMA 4FLVA 2FBVA 2D0AA 1L3TA 1S1VA 2DFEA 2KQ2A 3UIQA 4FJ7A 3SJJA 4FJIA 2ZE2A 3NH2A 4JRQA 4I9QA 1HNIA 2YHAA 4DTMA 5J2NA 2F8SA 2KTQA 3SQ1A 4CFAA 4K8ZA 4DU1A 3C6UA 1NKBA 5I3UA 3AO2A 1LAVA 3HK2A 1W0HA 2G8FA 4CEOA 3HP6A 3TAPA 3K2PA 4FJLA 3ZSZA 3SI6A 3AVBA 4I2PA 2DTUA 1C1CA 4AHUA 1B9FA 2KZMA 1KRPA 3QLHA 1Y97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZTJ A;  4E3S A;  3OJU A;  4Y1D A;  1NJY A;  3DYA A;  4OJR A;  4BE0 A;  4BDY A;  4DTR A;  3I0S A;  3QEI A;  3M8S A;  1LWF A;  4PQU A;  1VRT A;  1BCO A;  1RDD A;  1ITG A;  2HNZ A;  3CM5 A;  3VA0 A;  4CEQ A;  3SV3 A;  5CZ1 A;  5FRN A;  2GBZ A;  1TK0 A;  3AVA A;  1BI4 B;  4CJR A;  1FXX A;  3LZI A;  3SNN A;  3S3N A;  3RR8 A;  1TK8 A;  4B3O A;  2PYJ A;  3AVL A;  5CYQ A;  3OYF A;  1RNH A;  4CJ5 A;  4M45 A;  3V1O A;  3LWM A;  3VQ8 A;  4HUE A;  4DTU A;  3TAN A;  1U48 A;  1IG9 A;  2PZS A;  2OYQ A;  4NCB A;  1S9G A;  1NJZ A;  5CZ2 A;  4BE1 A;  1UA1 A;  4RW8 A;  4DSE A;  2XHB A;  4L8R B;  3RMB A;  4N47 A;  4KO0 A;  3TAR A;  1N6Q A;  3QO9 A;  2BDP A;  2HMI A;  3OYN A;  4DTO A;  1T03 A;  3AVF A;  2EX3 A;  4BWM A;  3D45 A;  2ITG A;  1TKZ A;  4AHC A;  4CER A;  3K57 A;  4CEZ A;  4E19 A;  4CGF A;  3V9U A;  3O3G A;  1NK4 A;  4DWI A;  4CJ4 A;  3PO5 A;  4CIG A;  4Q5V A;  4KHU A;  4OKJ A;  3QEW A;  2I5J A;  2A1S A;  3HL8 A;  4ID5 A;  3U3G A;  3VQQ A;  4W5R A;  5J2Q A;  2IDO A;  3TAF A;  3SQ0 A;  1WNS A;  3VA3 A;  4I2Q A;  3PO4 A;  1TL3 A;  3VQC A;  4B9S A;  3LZJ A;  3ZT4 A;  3AO3 A;  3S3O A;  5C42 A;  4CIE A;  2VG5 A;  4AHS A;  3DLH A;  4ZHR A;  3I8D A;  1RTI A;  4CK2 A;  3KKR A;  4O5B A;  4FZY A;  2F96 A;  3V81 A;  1C0T A;  1TL1 A;  2X6S A;  1JLB A;  2YNH A;  3NDK A;  4O0I A;  4I7F A;  1TK5 A;  3EYZ A;  1G15 A;  1JLC A;  3C94 A;  3MAQ A;  2QK9 A;  3ULD A;  1W9H A;  4F2S A;  1QSS A;  3U3Y A;  4KFB A;  4FLT A;  1CZB A;  1C0M A;  5D3G A;  4OGC A;  4DFJ A;  3S9H A;  3OYB A;  4M42 A;  4DSI A;  4CHQ A;  1CXQ A;  4KHQ A;  3ASM A;  5KI6 A;  4HCC A;  3OYH A;  4CIF A;  3PX0 A;  5I42 A;  1RTH A;  3L2R A;  4Q0B A;  3OVN A;  4CFD A;  5FRO A;  2HHT A;  1C1A A;  3HST B;  3T19 A;  3FFI A;  2JLE A;  4N5S A;  4OLB A;  3KD1 E;  3QEP A;  4J2D A;  3C6T A;  3OYI A;  3HJF A;  4B9N A;  4FJM A;  1RT3 A;  3NGZ A;  1DLO A;  2YKN A;  3P83 D;  4DU3 A;  4IG3 A;  1LW2 A;  3O3H A;  2GUI A;  4M41 A;  3M8R A;  1RT6 A;  1S6P A;  2F8T A;  2Z1G A;  1RT7 A;  1JLQ A;  4IG0 A;  1SL1 A;  3BDP A;  4DFK A;  3HPO A;  3HT3 A;  1HYV A;  3O3F A;  3KKS A;  1TVR A;  3U6F A;  3SPY A;  1D5A A;  1WSI A;  3TAM A;  3LAN A;  1QSY A;  4M3Z A;  2KFZ A;  1XHX A;  3V1R A;  3L8B A;  4DU4 A;  4PA1 A;  1IKV A;  1WN7 A;  3QER A;  2OPQ A;  5HBM A;  1RBS A;  1KSP A;  4FK4 A;  2B4J A;  1U49 A;  4FJX A;  3TAQ A;  1KCF A;  4O44 A;  3LDS A;  3HP9 A;  4FJN A;  2P5G A;  4GVM A;  1KFD A;  3NE6 A;  3WNG A;  3L3V A;  3OY9 A;  1D9F A;  2IC3 A;  3HPG A;  2HHW A;  5KRT A;  4M3U A;  2YNI A;  3M8P A;  2Y1J A;  3VQE A;  2ZD1 A;  4EP5 A;  1L5U A;  4Z4H A;  1BL3 A;  3AV9 A;  3DRR A;  3TAE A;  2YNF A;  4CJP A;  4O4G A;  3S3M A;  2XRI A;  4IFY A;  3PX6 A;  3SCX A;  2QKK A;  3KK2 A;  3V1Q A;  1QE1 A;  4KB0 A;  5T7B A;  4FM2 A;  4DFM A;  3NF7 A;  4C8M A;  1EET A;  2ZQB A;  3B6O A;  3AO1 A;  3NFA A;  3O4N A;  4O55 A;  4RG8 A;  4KAZ A;  3K5L A;  3QES A;  5EU7 A;  1RDA A;  1S5J A;  1LAW A;  2B6A A;  1JXB A;  3K5O A;  2R7Y A;  4BAC A;  2RPI A;  1WSH A;  4NCG A;  1U04 A;  2D0B A;  3M8Q A;  4M3Y A;  4FLW A;  4F2R A;  3QEX A;  4I9L A;  4CF1 A;  4KI4 A;  4CEB A;  1IKX A;  1O1W A;  4Z0U A;  4CJE A;  4Z4G A;  3B6P A;  4W5Q A;  4Y1C A;  4HUF A;  3HVR A;  3IAY A;  1IO2 A;  4CJS A;  4E7H A;  2HVI A;  5KGW A;  2KFN A;  4AH9 A;  2G8V A;  4F4K A;  2ATQ A;  2QKB A;  3CFP A;  4RW7 A;  2BGG A;  3LAM A;  1UAX A;  2WON A;  3OYL A;  4N76 A;  3MXJ A;  1HYS A;  3K5N A;  1SKW A;  2VWK A;  1YT3 A;  3L2Q A;  4KHN A;  3TAB A;  5J2M A;  3ALY A;  2JGU A;  1HPZ A;  2O4G A;  2DY4 A;  4C8N A;  1WSF A;  4J2E A;  3P5J A;  4PY5 A;  1QS4 A;  4GMJ B;  3VQP A;  4B8A B;  3AVI A;  3KD5 E;  2DFH A;  3OYC A;  3T1A A;  3NHG A;  4ELV A;  1Q9Y A;  3ZT1 A;  1RDB A;  2GV9 A;  3VQ5 A;  3RWU A;  3KLH A;  4CEA A;  1RTJ A;  2QXF A;  2YKM A;  3ZT3 A;  5KGX A;  4FZZ A;  5KRS A;  4DTN A;  1KVC A;  1Z25 A;  4FJ9 A;  1WSE A;  3G10 A;  3F73 A;  1TKD A;  1SKR A;  3OYJ A;  4CF0 A;  2HHS A;  1VSK A;  1J5O A;  1J54 A;  2YV0 X;  3AA5 X;  4AHT A;  1JLF A;  3SQ4 A;  3QNN A;  4FW1 A;  4DQS A;  1QHT A;  3RMA A;  2D0C A;  3DLG A;  4YFU A;  1SL0 A;  2BAN A;  1BHL A;  3AO4 A;  1TKT A;  4DSJ A;  4Z4E A;  4C8K A;  3VQ4 A;  4HTU A;  1FKP A;  4W5N A;  3LP3 A;  1NK8 A;  1T05 A;  4FW2 A;  4KRF A;  5C25 A;  3EZ5 A;  4IBN A;  3CG7 A;  4DQP A;  3KK1 A;  3HYF A;  3NF6 A;  3RR7 A;  2HHX A;  3MED A;  3IG1 A;  4CF9 A;  1LWE A;  1S1X A;  2VG6 A;  3PV8 A;  1QQC A;  2RKI A;  2DFF A;  5HRN A;  4E89 A;  1KLM A;  4W5O A;  3CYM A;  4DSL A;  4FJJ A;  4K8X A;  4CEC A;  1XHZ A;  4KI6 A;  4E7J A;  4H8K A;  1RT2 A;  2XY5 A;  4HCB A;  3JYT A;  2FBX A;  5SZT A;  3CM6 A;  1RDC A;  1VRU A;  1WLJ A;  2RN2 A;  4CFB A;  4FLZ A;  3DLR A;  4BWJ A;  1VSM A;  4FJ8 A;  1S1U A;  4FZX C;  4AHR A;  1F21 A;  2HVH A;  3SPZ A;  3OS1 A;  3V4I A;  1L3U A;  2HHU A;  3VN5 A;  4EP4 A;  3CFO A;  3LAL A;  1MU2 A;  3MEG A;  1BGX T;  4OGE A;  4CJQ A;  3DLK A;  4O0J A;  1KVA A;  4KHS A;  4CJL A;  4G1Q A;  2HNY A;  3RTV A;  4XIU A;  4BDZ A;  3SV4 A;  1BIS A;  4LSL A;  3OYA A;  1N5Y A;  4F3O A;  3SUQ A;  5HRR A;  3H08 A;  3OYK A;  3SUO A;  4KHW A;  1NK5 A;  3KIO A;  2PYL A;  4LD0 A;  3K5M A;  4CK1 A;  3SYZ A;  3SUN A;  3ZSY A;  4DQR A;  2OPP A;  1VSH A;  2E6M A;  4B9L A;  2EHG A;  4B9T A;  1NOY A;  1TAU A;  2Z1J A;  1LWC A;  4DTX A;  2P51 A;  4H4O A;  5FRM A;  4DSF A;  3KK3 A;  4KPY A;  4CGD A;  4JLH A;  3C95 A;  2Z1I A;  4CJ3 A;  3D0P A;  1QTM A;  1C6V A;  2OPS A;  4FVM A;  4IFV A;  3L2W A;  2G8H A;  4Z4F A;  2HND A;  3NGY A;  5C24 A;  1HMV A;  4DF8 A;  1CXU A;  1T7P A;  1S1W A;  3HO1 A;  1RCH A;  1ZBU A;  4NCA A;  1WAF A;  4J2B A;  4DFP A;  4E1M A;  4CJK A;  1NK7 A;  5CYM A;  1NK0 A;  4DSK A;  1NKC A;  3WNF A;  3ZSW A;  3DRP A;  1IKW A;  1HNV A;  4BDP A;  1TV6 A;  1TKX A;  2YNG A;  5HRP A;  1XWL A;  1RBV A;  5HLF A;  3T3F A;  3V9Z A;  3AVG A;  1U45 A;  1R0A A;  5JS1 A;  1ASW A;  4CHO A;  3HPH A;  1HYZ A;  4PUO A;  4WE1 A;  1ZBI A;  3NCI A;  3DMJ A;  4KRE A;  1A5W A;  3DM2 A;  1NJW A;  4N41 A;  1BQM A;  1FKO A;  3L2V A;  1KVB A;  3MXI A;  1ZBF A;  3VQ9 A;  4E7I A;  2P5O A;  2HHV A;  3QIO A;  1VSE A;  1A5X A;  2O4I A;  3QNO A;  4J2A A;  1SKS A;  3LPU A;  1ZBH A;  3NF9 A;  4CJU A;  1IH7 A;  4M3R A;  4KV8 A;  3K59 A;  3TI0 A;  1KLN A;  2WOM A;  3NGI A;  2FBT A;  4ELU A;  1YVU A;  5DK5 A;  4FYD A;  1NOZ A;  1UOC A;  1LV5 A;  3VQA A;  2G8I A;  1D8Y A;  3OS2 A;  1GOB A;  3MEC A;  1ZBL A;  1Z26 A;  4FK2 A;  3KLI A;  4JRP A;  3L3U A;  4CFC A;  4FK0 A;  1SV5 A;  3G0Z A;  3DOL A;  3OJS A;  2KW4 A;  5J1E A;  3AVJ A;  4FJK A;  2KZZ A;  1CLQ A;  4HHT A;  4IDK A;  3VQD A;  3VQ6 A;  1SUQ A;  3OS0 A;  1VSJ A;  4B08 A;  2Y1I A;  1SL2 A;  4CED A;  3CQ8 A;  3VQ7 A;  4EZ6 A;  1VSD A;  1YTA A;  4HUG A;  4KHY A;  4NYF A;  4N56 A;  4E7K A;  2IOC A;  2Q3S A;  2ETJ A;  4KTZ A;  4QAG A;  3DI6 A;  4UQG A;  1EP4 A;  3F9K A;  3LP1 A;  1NKE A;  3DLB A;  2AJQ A;  2G8W A;  3WNE A;  4DS5 A;  5DMR A;  3RMD A;  4OVL A;  1RT1 A;  4KTQ A;  3ITH A;  4CHP A;  4DQQ A;  3SQ2 A;  4BE2 A;  2LSN A;  4KTW A;  2X74 A;  3ZT2 A;  2VWJ A;  1JLA A;  4CJT A;  4FM1 A;  1BIU A;  3P1G A;  4Z4I A;  1U47 A;  4CJW A;  1T8E A;  2B5J A;  3L2U A;  3MXM A;  4F3T A;  1FK9 A;  5J2P A;  3AVC A;  2E4L A;  3HXM A;  3QIN A;  2XY8 A;  1X9M A;  3RRH A;  4CJF A;  3V9W A;  2NUB A;  3SUP A;  4CJV A;  1LW0 A;  4B9V A;  4B9M A;  1WAJ A;  1RBR A;  1S6Q A;  3ZT0 A;  3V6D A;  2VG7 A;  2IGI A;  1XC9 A;  4YNQ A;  3RRG A;  1DTQ A;  5KTQ A;  1RTD A;  4DF4 A;  1UWB A;  3ISN C;  4CES A;  3AO5 A;  1DTT A;  3K58 A;  3RMC A;  4CGG A;  1REV A;  1KFS A;  4R5P A;  3ZSV A;  5FDL A;  4FLX A;  1VSL A;  4DTP A;  1RT4 A;  1L3V A;  1I39 A;  1HJR A;  3QEV A;  2OZM A;  4FCY A;  4C8L A;  4FXD A;  1IKY A;  1A5V A;  1ASV A;  1EX4 A;  1WSJ A;  4IKF A;  1JLE A;  3BGR A;  3TR8 A;  3V9X A;  3LP0 A;  4CHN A;  1S9E A;  3A2F A;  4H4M A;  2OPR A;  4ID1 A;  4OKE A;  4HVJ A;  4JS5 A;  4DLE A;  4GW6 A;  1JL2 A;  4LY7 A;  4CE9 A;  1RT5 A;  1S1T A;  3JSM A;  4CEE A;  1BI4 A;  4B9U A;  1BIZ A;  4LH4 A;  3NH0 A;  3E01 A;  4OKK A;  4CGI A;  1L3S A;  1BCM A;  1UA0 A;  3DLE A;  3NBP A;  4M3X A;  1YTU A;  4ZTF A;  4RW4 A;  4CGH A;  1TGO A;  3O4Q A;  4CF2 A;  4E0D A;  2P1J A;  1X9W A;  2E6L A;  1B9D A;  1BQN A;  4DS4 A;  3KLF A;  4OLA A;  1VSI A;  2W42 A;  2FBY A;  1QSL A;  4DQI A;  3OYD A;  2BE2 A;  5E41 A;  3DRS A;  4LSN A;  4CHZ A;  4DTJ A;  1J9A A;  3I0R A;  4JS4 A;  1JLG A;  3TAG A;  2OA8 A;  2HB5 A;  3OYM A;  4FM0 A;  1B92 A;  3MEE A;  1EXQ A;  1NK6 A;  4DLG A;  2A1R A;  1HQE A;  1K6Y A;  4LH5 A;  3AA2 A;  4AIL C;  1NJX A;  4KB1 A;  1C0U A;  3AA4 A;  1X1P A;  3ZSR A;  1I3A A;  3OYE A;  3AA3 A;  1EKE A;  2XY7 A;  5SWM A;  4RW6 A;  1RIL A;  3NAE A;  1WSG A;  1Q9X A;  4M3T A;  4CEF A;  1CZ9 A;  2X78 A;  2RF2 A;  4DG1 A;  4CCH A;  4FJ5 A;  3KJV A;  3SZ2 A;  4OPJ A;  1X9S A;  1JKH A;  3ZSX A;  4RW9 A;  3IRX A;  4CF8 A;  3V9S A;  1GOC A;  2XO7 A;  4PWD A;  4E7L A;  3CFR A;  2HW3 A;  3AVK A;  5HP1 A;  3ZSQ A;  3AVN A;  3PY8 A;  1D9D A;  2YHB A;  1KTQ A;  3NH1 A;  2D5R A;  3KTQ A;  3LAK A;  4W5T A;  3IS9 A;  5CY4 A;  2OZS A;  1VSF A;  4NYN A;  4C8O A;  4E1N A;  3DOK A;  2PY5 A;  4DMN A;  2HHQ A;  3WNH A;  3LWL A;  1Q8I A;  4TSX A;  3NF8 A;  5K14 A;  3OYG A;  4F8R A;  4DTS A;  3AVH A;  1ASU A;  4CHY A;  4KKO A;  4CK3 A;  4AHV A;  4QCL A;  1J53 A;  3VQB A;  4M3W A;  4MQ3 A;  3LP2 A;  1TAQ A;  1NK9 A;  4EZ9 A;  4ELT A;  1C1B A;  2IAJ A;  4FLU A;  4B8C A;  1HQU A;  2X6N A;  3KLE A;  3QIP A;  1JL1 A;  3EY1 A;  4MFB A;  4Z4C A;  4FJG A;  4FLY A;  2IS3 A;  4FJH A;  4CGJ A;  3HM9 A;  3PX4 A;  3PUF A;  1JXE A;  3ZSO A;  1RBT A;  3LPT A;  1GOA A;  5HRS A;  1XI1 A;  2G8U A;  2XY6 A;  2Z1H A;  5HRO A;  3QET A;  3HVT A;  5JS2 A;  1HRH A;  1VK0 A;  4ICL A;  1ZYQ A;  2FC0 A;  3AVM A;  4OPK A;  3KLG A;  1U4B A;  2G8K A;  4QOZ B;  3TWH A;  3THV A;  1RBU A;  3ZCM A;  4FLV A;  2FBV A;  2D0A A;  1L3T A;  1S1V A;  2DFE A;  2KQ2 A;  3UIQ A;  4FJ7 A;  3SJJ A;  4FJI A;  2ZE2 A;  3NH2 A;  4JRQ A;  4I9Q A;  1HNI A;  2YHA A;  4DTM A;  5J2N A;  2F8S A;  2KTQ A;  3SQ1 A;  4CFA A;  4K8Z A;  4DU1 A;  3C6U A;  1NKB A;  5I3U A;  3AO2 A;  1LAV A;  3HK2 A;  1W0H A;  2G8F A;  4CEO A;  3HP6 A;  3TAP A;  3K2P A;  4FJL A;  3ZSZ A;  3SI6 A;  3AVB A;  4I2P A;  2DTU A;  1C1C A;  4AHU A;  1B9F A;  2KZM A;  1KRP A;  3QLH A;  1Y97 A; 
#chains in the Genus database with same CATH topology
 4E3S A;  3OJU A;  4Y1D A;  3T69 A;  4DTR A;  3FLC O;  3U4L A;  5A2Q O;  5CZ1 A;  1TK0 A;  3AVA A;  3S3N A;  3RR8 A;  4B3O A;  1WBB A;  5CYQ A;  3OYF A;  3LWM A;  4DTU A;  3TAN A;  4HUE A;  3F2K A;  4ILH A;  1P90 A;  4BE1 A;  3SBT A;  4CZJ A;  3PSI A;  3RMB A;  1N6Q A;  3AGR A;  3BF1 A;  5AQL A;  1VQP N;  2FLO A;  4H0X B;  3CCJ N;  3VEZ A;  4PKG A;  4AHC A;  4CER A;  4E1J A;  3ZLJ A;  4H03 B;  3O3G A;  4DWI A;  4Q5V A;  4KHU A;  3EO3 A;  4OKJ A;  1K8K A;  4ID5 A;  4W5R A;  1WNS A;  3LZJ A;  2QTD A;  3OA9 A;  4CIE A;  4AHS A;  4ZHR A;  3I8D A;  5KQ8 A;  3U9Z A;  3I56 N;  3THW B;  1N8R O;  4FZY A;  3LL3 A;  2X6S A;  3NDK A;  1HR0 K;  1Z6R A;  1VQ6 N;  1G15 A;  3HTV A;  1JLC A;  3ULE A;  2H3G X;  1QSS A;  4IEI A;  3S9H A;  3OYB A;  2QA4 N;  3ENH A;  5M1K A;  1QVF M;  5TKW A;  3OYH A;  3W3D A;  3O1B A;  3PX0 A;  4Q0B A;  3OVN A;  4CFD A;  2HHT A;  2VWB A;  4N5S A;  2HBK A;  2CH5 A;  5M1Q A;  2GWK A;  1XUP O;  1DLO A;  1P8Z A;  3EL2 A;  4BRD A;  2GUI A;  4O5F A;  4M41 A;  3M8R A;  2HBL A;  2Z1G A;  3MWP A;  4IXC A;  1SL1 A;  4M7Y A;  3HPO A;  1X9J A;  3KKS A;  3U6F A;  1QSY A;  1D5A A;  3TAM A;  3LAN A;  1IBM K;  3L8B A;  3QER A;  1H1V A;  2OPQ A;  1KAY A;  2B4J A;  3CD6 N;  4FWS A;  4O44 A;  4FJN A;  1BWF O;  4DR7 K;  3G6E N;  4H0V B;  3NE6 A;  1D9F A;  1XMQ K;  1GLB G;  2IC3 A;  4GV6 A;  5KRT A;  2YNI A;  3VQE A;  4XH1 A;  4LF4 K;  4Z4H A;  3CQY A;  5BN8 A;  3SCX A;  2QKK A;  2HF4 A;  4FM2 A;  3NF7 A;  4C8M A;  1NNE A;  4O55 A;  4FSV A;  5EU7 A;  3LDQ A;  3AAP A;  3K5O A;  5AQF A;  4BAC A;  1WSH A;  4PL7 A;  2D0B A;  5FPN A;  1OH7 A;  4CBU A;  4I9L A;  3M1F A;  4DV5 K;  4CF1 A;  1XC3 A;  4CEB A;  4LFA K;  4Z0U A;  4YOY A;  4Y1C A;  3EKU A;  2HVI A;  5KGW A;  1WBD A;  3MWT A;  4LFC K;  1NWK A;  1C0G A;  4BQZ A;  2ATQ A;  3O6W A;  2QKB A;  2CGL A;  3CJ7 A;  4FL9 A;  2NRR A;  3K9J A;  1VQ7 N;  4H0P A;  4A62 A;  1HPZ A;  1WSF A;  5TKY A;  1QS4 A;  2QEX N;  3AVI A;  4CZI A;  1BUP A;  4QS7 A;  4DR6 K;  3T1A A;  3NHG A;  4DR1 K;  3ZT1 A;  1RDB A;  3AAQ A;  2YHW A;  3KLH A;  4FWP A;  4CZL A;  1VHX A;  4EFH A;  3CCV N;  1HX1 A;  1FW6 A;  1JCF A;  3C65 A;  5AQW A;  3H45 C;  1VSK A;  1J5O A;  2YV0 X;  3SQ4 A;  3EKS A;  4JHD B;  2Q2R A;  3CCS N;  4YFU A;  1SL0 A;  3AO4 A;  4DSJ A;  4Z4E A;  3VQ4 A;  1FKP A;  4W5N A;  3LP3 A;  1NK8 A;  4KRF A;  1TUU A;  5C25 A;  4IBN A;  3EZ5 A;  3KK1 A;  2HHX A;  3MED A;  3O9Q A;  1LWE A;  1S1X A;  2VG6 A;  3PV8 A;  5HRN A;  3CYM A;  2NNW A;  4K8X A;  4CEC A;  3AGK A;  4HCB A;  2NZT A;  1RDC A;  4H5R A;  5F1X A;  4FLZ A;  3DLR A;  4BWJ A;  1VSM A;  4AHR A;  1YVN A;  1F21 A;  4DV0 K;  3SBG A;  3CFO A;  1MU2 A;  3RSE B;  5LMU K;  4OGE A;  3WT0 A;  1QHA A;  4O0J A;  3FR0 A;  3QIC A;  4G1Q A;  2HNY A;  4CJL A;  4XIU A;  4BDZ A;  5AQU A;  1BIS A;  5C2D A;  1KD1 O;  5AQZ A;  4X64 K;  3KIO A;  3TU5 A;  4LD0 A;  3JS6 A;  2YHY A;  3SUN A;  2OPP A;  4B9L A;  4JKC A;  1NOY A;  1TAU A;  3I8B A;  2EWS A;  4H4O A;  3KK3 A;  4JLH A;  2Z1I A;  1YXQ A;  1MA9 B;  4JI0 K;  4IFV A;  4JHD A;  2HF3 A;  1XNQ K;  4NCA A;  4M7X A;  3SLC A;  4E1M A;  5BRE A;  4DSK A;  1NKC A;  3WNF A;  4AM7 A;  5ELZ A;  2YCH A;  5BRF A;  1HNV A;  1TKX A;  3D2F B;  5HRP A;  5HLF A;  3H6E A;  1ILY A;  1VQL N;  4JI1 K;  3HPH A;  1ATN A;  1ZBI A;  1FKO A;  4CZE A;  1KVB A;  4JKG A;  4BRN A;  1SZ2 A;  4LF5 K;  1T3V A;  3VQ9 A;  2HHV A;  3QIO A;  4B1U B;  1N32 K;  3MCP A;  5F2R A;  3VEO A;  2VCP A;  1SAZ A;  1IH7 A;  1YHQ N;  2WOM A;  1YVU A;  2G8I A;  4BRF A;  4DQ8 A;  1ZBL A;  1Z26 A;  4JD2 A;  4JKG B;  3L3U A;  4AF1 A;  4CFC A;  4FK0 A;  3PLA A;  3O9U A;  3DOL A;  3OJS A;  5J1E A;  2ZGY A;  5GAH P;  1CLQ A;  3OS0 A;  3VQ6 A;  2Y1I A;  1SL2 A;  1VSJ A;  2OTL N;  1W97 L;  1VSD A;  1YTA A;  3D2F A;  4N56 A;  2ETJ A;  1NMN A;  4UQG A;  3F9K A;  1NKE A;  3DLB A;  3WNE A;  4FOE A;  1YJN N;  4CHP A;  4DQQ A;  4BE2 A;  4YOX A;  4LFB K;  2LSN A;  3QB0 A;  2Q1N A;  4KTW A;  1BIU A;  3D2E A;  1XNR K;  4CJW A;  1T8E A;  2B5J A;  4QS8 A;  1C0F A;  3K9K A;  3J7A P;  1FK9 A;  2GUP A;  4QS9 A;  3GBT A;  1ZC6 A;  1X9M A;  3RRH A;  1IBK K;  1RBR A;  3ZT0 A;  2VG7 A;  4YNQ A;  1DTQ A;  1RTD A;  3CJB A;  4DF4 A;  1UWB A;  4OX9 K;  4CZM A;  3IKM A;  4R5P A;  1G99 A;  3ZSV A;  4FLX A;  1HJR A;  3QEV A;  1ASV A;  1WSJ A;  3KHY A;  1JLE A;  3J8A A;  3TR8 A;  4KBO A;  3A2F A;  4ID1 A;  5ADX H;  4OKE A;  4PQU A;  1JL2 A;  1RT5 A;  4B9U A;  3WXJ A;  1BI4 A;  1MWK A;  3WQU A;  1S22 A;  1RDU A;  3ATV A;  1Q82 O;  5AQY A;  4CF2 A;  4E0D A;  1GLC G;  4OLA A;  1VSI A;  1QSL A;  4DQI A;  5CR4 A;  2BE2 A;  5AZI A;  3R8E A;  4RTF D;  4CHZ A;  4DTJ A;  3I0R A;  3OYM A;  3R3L A;  4IO9 L;  2UXD K;  2A3Z A;  2A1R A;  4LH5 A;  1NJX A;  3AA4 A;  3CJC A;  3QBW A;  3OTO K;  3NAE A;  4BRH A;  1CZ9 A;  4DG1 A;  2RF2 A;  4FJ5 A;  3KJV A;  1X9S A;  1JKH A;  2XO7 A;  4PWD A;  3J81 O;  4YOU A;  1VAZ A;  3PY8 A;  2UUC K;  2YHB A;  3LAK A;  1T44 A;  2OZS A;  1E4F T;  1EQY A;  1Q8I A;  4Y0W A;  3NF8 A;  4AHV A;  1J53 A;  4M3W A;  1TAQ A;  4K41 A;  4B8C A;  2A6A A;  3BY5 A;  4DR2 K;  3EY1 A;  4Z4C A;  4FJG A;  4FLY A;  4FJH A;  3HM9 A;  3PX4 A;  3LPT A;  2G8U A;  5HRO A;  3QET A;  3NMU A;  4B1W B;  4H5T A;  1VK0 A;  4FPA A;  4ICL A;  2FC0 A;  3AVM A;  4OPK A;  4QOZ B;  3VOV A;  5GIP A;  2FSK A;  2QXL A;  3TWH A;  1RBU A;  4CJ7 A;  1GLA G;  4FJ7 A;  2P9P A;  2ZE2 A;  5AQQ A;  1TYQ A;  4KH4 A;  4CFA A;  4YHH K;  1NKB A;  5DM7 L;  5CHI A;  1GLF O;  3J7Y P;  1W0H A;  4JK9 A;  2RHK A;  3TAP A;  4FJL A;  1U2V A;  3AVB A;  2HBM A;  3IDH A;  4AHU A;  4DUZ K;  1B9F A;  2NRH A;  3MX2 A;  3DYA A;  1SS6 A;  3I0S A;  2E5L K;  1LWF A;  1VRT A;  1BCO A;  1RDD A;  1ITG A;  4CEQ A;  3SV3 A;  5AQJ A;  4BC5 A;  3HOT A;  2QWM A;  1U48 A;  4BGA A;  2OYQ A;  3CJA A;  1V4T A;  5CZ2 A;  1UA1 A;  1R59 O;  3CIP A;  5LY3 A;  3QO9 A;  2Q97 A;  5AZJ A;  4DUY K;  1T03 A;  2EX3 A;  2YJE A;  1FJG K;  1BOT O;  3K57 A;  3QEW A;  2I5J A;  2A1S A;  4IZ9 A;  3U3G A;  1VQN N;  3VQQ A;  2IDO A;  3PO4 A;  1TL3 A;  1BG3 A;  2WC9 A;  3AO3 A;  3WQT A;  5C42 A;  2HHH K;  4BRI A;  2VG5 A;  1E4G T;  1RTI A;  3NVK A;  3WUH A;  4O5B A;  1HPM A;  4JI7 K;  2QWO A;  1TK5 A;  3THY B;  3C94 A;  3MAQ A;  4GV9 A;  4JKH A;  1EWQ A;  4IOC L;  3S41 A;  1CZB A;  1QZ5 A;  1HNZ K;  3MX5 A;  4CHQ A;  4B3M K;  1CXQ A;  2F7T A;  3ASM A;  4HCC A;  4NB4 A;  1RTH A;  1Q7Y O;  4C1N I;  4FWM A;  2P9S A;  4BRO A;  4WCE L;  1K8K B;  1C1A A;  3CC4 N;  5JIC A;  3FFI A;  4OLB A;  3KD1 E;  4J2D A;  1GLD G;  3ID6 A;  3OYI A;  3HJF A;  4BRK A;  3NGZ A;  2UUB K;  4FWL A;  2YKN A;  4C23 A;  1LW2 A;  3O3H A;  4JYA K;  2F8T A;  1RT7 A;  3M5R A;  3VF4 A;  3HT3 A;  3FGU A;  3O3F A;  2P9I B;  3UB5 A;  2W6K A;  2KFZ A;  1BDG A;  1HLU A;  3V1R A;  1KSP A;  1WN7 A;  4FK4 A;  1RBS A;  1D4X A;  4FJX A;  3TAQ A;  4LC9 B;  4LF8 K;  3HP9 A;  2HOE A;  1OH8 A;  4FWN A;  3JAM O;  3WNG A;  3HPG A;  2P9K B;  2HHW A;  3QFU A;  2Y1J A;  1HNX K;  3DRR A;  3TAE A;  3S3M A;  2XRI A;  4RWT A;  4DFM A;  1YJW N;  3LM2 A;  4RG8 A;  1RDA A;  1NG9 A;  4IO8 A;  4K25 A;  4M3Y A;  4FLW A;  5EX5 A;  4FWR A;  3KWG A;  1O1W A;  2YX6 A;  2YI1 A;  3DXM A;  4HUF A;  3HVR A;  1IO2 A;  4CJS A;  5M1N A;  4AH9 A;  1O13 A;  3T1Y K;  3CFP A;  4RW7 A;  2WON A;  3OYL A;  3MXJ A;  2VWK A;  5AQR A;  4IWV A;  2DY4 A;  3EEQ A;  4C8N A;  3CME N;  4PY5 A;  1DEJ A;  2ZJR L;  3VQP A;  2NRW A;  3CJ1 A;  1YUW A;  4V19 S;  4UY8 O;  1ZBS A;  4CEA A;  5FPD A;  4IOX A;  4FZZ A;  3ENB A;  4DTN A;  4WQ4 C;  3G10 A;  4DV1 K;  1YIJ N;  3OYJ A;  3ID8 A;  3THY A;  3QNN A;  1DT9 A;  2ASO A;  4LF9 K;  4FW1 A;  4JK7 A;  4DQS A;  1QHT A;  1TKT A;  4I6M A;  4HTU A;  1T05 A;  3NF6 A;  2F9T A;  1NU0 A;  3IG1 A;  2RKI A;  1NLV A;  1KLM A;  2QWQ A;  4E89 A;  4KI6 A;  4IOA L;  3JYT A;  1CZA N;  3CJ9 A;  3CHW A;  2GEL A;  2RN2 A;  4IDH A;  3O1W A;  4BVP A;  1QVG M;  5IWA K;  1S1U A;  1KAZ A;  1Q18 A;  4CBW A;  4EP4 A;  3MEG A;  3MN5 A;  1K9M O;  3DLK A;  1YI2 N;  4KHS A;  3SV4 A;  1YAG A;  5KPT A;  4KHW A;  2AA4 A;  3SUO A;  1WUA A;  4FOI A;  5JMV A;  4BR9 A;  3ZSY A;  4DQR A;  1VSH A;  4B9T A;  3CXC M;  4BR4 A;  2Z1J A;  1LWC A;  4X65 K;  3H3O B;  1U2V B;  3C95 A;  4FPB A;  3A0I X;  1C6V A;  2HND A;  3NGY A;  3CCQ N;  1CXU A;  5JVH L;  4J2B A;  4DFP A;  3LDN A;  4MDB A;  2QWL A;  4YOW A;  3FZM A;  2UUA K;  1IKW A;  4BDP A;  1VQ9 N;  3U8X A;  3O80 A;  1U45 A;  1R0A A;  5JS1 A;  4CHO A;  1KC8 O;  3DMJ A;  1A5W A;  4B3T K;  5HOO A;  5JLF A;  3MXI A;  3CI5 A;  1ZBF A;  1VSE A;  3QNO A;  4J2A A;  3F5T A;  3LPU A;  5AQN A;  2NRZ A;  3NF9 A;  4CJU A;  4CD1 A;  2FBT A;  2P9S B;  4FYD A;  1UOC A;  3OS2 A;  3BUZ B;  3MEC A;  5FPE A;  4FK2 A;  1ATS A;  2F4V K;  3VEY A;  1SV5 A;  5BR9 A;  2KZZ A;  4B08 A;  4CI6 A;  4CED A;  4JI5 K;  4EZ6 A;  4DV2 K;  4NYF A;  4E7K A;  2IOC A;  4KTZ A;  5E26 A;  5FPM A;  3EZW A;  2V7Z A;  4G9Z A;  4JK8 A;  3RMD A;  1RT1 A;  3E9O A;  3ITH A;  3U9D A;  4CJT A;  4Z4I A;  2O8F A;  3L2U A;  1NGB A;  2E1Y A;  3HXM A;  3SUP A;  4CJF A;  2NUB A;  1LW0 A;  4B9M A;  5B8H A;  2IIR A;  1XC9 A;  5KTQ A;  4CES A;  4OO1 J;  4A2B A;  4DTP A;  2PAV A;  3N4Q A;  2ASM A;  4FCY A;  4C8L A;  1IKY A;  1A5V A;  1VQM N;  3VEV A;  3BGR A;  3GOI A;  3LP0 A;  5I9E B;  1S9E A;  2D4W A;  4GW6 A;  4LY7 A;  3RVC A;  4CE9 A;  1HNW K;  3TSU A;  4LH4 A;  2NRV A;  2ZF5 O;  4GY2 B;  1YTU A;  4ZTF A;  4CGH A;  2I7P A;  3O4Q A;  1X9W A;  4OPA A;  2E6L A;  1BQN A;  4DS4 A;  3KLF A;  3SAG A;  3OYD A;  4LSN A;  1J9A A;  3KZB A;  1B92 A;  1HQE A;  1V4S A;  4BG9 A;  1BA1 A;  4AIL C;  1I3A A;  1EKE A;  1YIT N;  1RIL A;  1WSG A;  3H1Q A;  4M3T A;  2X78 A;  4NO7 A;  4IFE A;  4CCH A;  3SZ2 A;  4OPJ A;  3ZSX A;  1GOC A;  4JI6 K;  3TTF A;  2J4R A;  3CFR A;  1GLE G;  2HW3 A;  5GIO A;  2BUP A;  3B8A X;  1NMD A;  4MO4 A;  1KTQ A;  1QQO A;  4W5T A;  3IS9 A;  2FSJ A;  1N36 K;  4DV6 K;  4F8R A;  3UKU A;  2Q0R A;  4CK3 A;  4BY9 C;  4CVN E;  2E2Q A;  4MQ3 A;  3LP2 A;  1NK9 A;  4WQ4 A;  1VQO N;  3VGM A;  2IAJ A;  4FLU A;  1HQU A;  2X6N A;  3KLE A;  3I33 A;  4MFB A;  4CGJ A;  1JXE A;  1Z05 A;  1XI1 A;  4PL8 A;  2Z1H A;  1KAX A;  3SMS A;  1HRH A;  3DAW A;  1ZYQ A;  3C7N B;  1U4B A;  3PSF A;  4FLV A;  1L3T A;  2KQ2 A;  3TSQ A;  1MDU B;  4JRQ A;  3G71 N;  3P4I A;  3OBY A;  5BPL A;  2F8S A;  2A42 A;  3SQ1 A;  5LMN K;  4DU1 A;  3R9P A;  5AJ3 K;  5BR8 K;  5I3U A;  3AO2 A;  1MWM A;  2G8F A;  3HP6 A;  3ZSZ A;  4CBX A;  2E20 A;  5BPM A;  3CCE N;  1HUX A;  3C6A A;  2KZM A;  3QLH A;  2IVP A;  4OJR A;  4BDY A;  3QEI A;  3M8S A;  4ILJ A;  4ISG A;  3HOS A;  2O8C B;  2GBZ A;  5AFU H;  1BI4 B;  2W41 A;  5KPR A;  2E1Z A;  2PYJ A;  3AVL A;  3O8M A;  1RNH A;  1IG9 A;  3V1O A;  2PZS A;  2HBJ A;  1NJZ A;  4L8R B;  4DSE A;  4WFN L;  4KO0 A;  3TAR A;  2BDP A;  3AVF A;  4BWM A;  3HSC A;  2O8D B;  3D45 A;  3D6R A;  3IMX A;  4E19 A;  4CGF A;  5BN9 A;  4B3S K;  3Q7C A;  3ZET A;  5DM6 L;  4CJ4 A;  4DR3 K;  3GG4 A;  3THX B;  3HL8 A;  2V51 B;  3VA3 A;  4I2Q A;  3VQC A;  3ZT4 A;  3S3O A;  3DLH A;  3QDK A;  4FWQ A;  3KKR A;  3Q7B A;  3LDO A;  2F96 A;  1C0T A;  2YNH A;  3FZH A;  3LDP A;  4H0O A;  2ZJP L;  4H5V A;  3EYZ A;  3VEN A;  3ZEU B;  2QK9 A;  1W9H A;  3U3Y A;  4KFB A;  4FLT A;  5D3G A;  4OGC A;  4CZK A;  4A57 A;  4M42 A;  4DV4 K;  4DSI A;  4MDA A;  2JWL A;  3ZX3 A;  4CIF A;  1VQ4 N;  5I42 A;  2O8E A;  1SQK A;  2KLA A;  5AQS A;  3MN6 A;  3HST B;  3DLL L;  3T19 A;  1NGE A;  4YOV A;  1WOQ A;  3PIP L;  3QEP A;  3C6T A;  3M3Z A;  2P9K A;  1RT3 A;  2O8E B;  2DPN A;  3TPQ A;  4CW7 B;  3EE8 A;  3ZX2 A;  3FZK A;  3SK3 A;  3UKU B;  4EHT A;  4DU3 A;  3AAR A;  3W0L A;  4IG3 A;  3A5N C;  4CZG A;  3CER A;  3VES A;  4XH4 A;  1J6Z A;  2CGJ A;  5EXW A;  1NGJ A;  2ZM6 K;  1HYV A;  2E2N A;  4MLE A;  3MN9 A;  1WSI A;  2P9I A;  4M3Z A;  3O08 A;  1XHX A;  4DU4 A;  1VQ8 N;  5HBM A;  3WEE A;  1U49 A;  1KCF A;  3T7Z A;  4CD3 A;  2P5G A;  4GVM A;  1KFD A;  3L3V A;  1YJ9 N;  2ZWH A;  4M3U A;  2ZD1 A;  1L5U A;  1BL3 A;  2VGN A;  4CJP A;  4X66 K;  3CCM N;  4O4G A;  4IFY A;  3PX6 A;  2UXC K;  4B1Y B;  3V1Q A;  1QE1 A;  4JKF A;  5T7B A;  1EET A;  2ZQB A;  3B6O A;  3AO1 A;  3NFA A;  3O4N A;  5LJW A;  1NGH A;  3TTD A;  4KAZ A;  4PHT X;  4IJA A;  3JXU A;  1S5J A;  1ZXO A;  1JXB A;  4ISF A;  2R7Y A;  4KH5 A;  1U04 A;  3M8Q A;  2QW9 A;  1GLL O;  3D7E O;  4F2R A;  3QEX A;  4U7B A;  2O8C A;  4Z4G A;  4CJE A;  3BP8 A;  3B6P A;  4W5Q A;  1NGF A;  5KQD A;  3IAY A;  1NGC A;  4E7H A;  2KFN A;  3BZK A;  2G8V A;  4F4K A;  1HYS A;  1UAX A;  5H1S Q;  1SKW A;  3E9P A;  1YT3 A;  1E3M A;  1VQK N;  4GMJ B;  1K8A O;  4B8A B;  4KH6 A;  2O8F B;  2DFH A;  3MK6 A;  3OYC A;  4BR2 A;  4ELV A;  1Q9Y A;  3T1H K;  2OCE A;  3F9M A;  2QXF A;  3ZT3 A;  5KGX A;  1LCU A;  2NRT A;  4H0T B;  1Z25 A;  3VEW A;  3F73 A;  1TKD A;  1N34 K;  2QWP A;  2CGK A;  2VGM A;  2Q0U A;  3AA5 X;  1T6D A;  3CQX A;  4XEI A;  4FO0 A;  2D0C A;  4JKA A;  3DLG A;  2BAN A;  1BHL A;  1HKG A;  4EIA A;  3C6H A;  1OH5 A;  2OAN A;  1WB9 A;  3O9R A;  1T6C A;  1NGD A;  1N33 K;  3HYF A;  4CF9 A;  5HL7 L;  2DFF A;  4DSL A;  4FJJ A;  1XHZ A;  4E7J A;  2FBX A;  4DV7 K;  3C0B A;  1M90 O;  2RE2 A;  4FJ8 A;  4FZX C;  1ESV A;  3SAF A;  2P9P B;  4YDU C;  1L3U A;  3O4W A;  1BGX T;  5AQO A;  5AQT A;  3RTV A;  3L4I A;  5E84 A;  5KPZ A;  4LSL A;  5EY4 A;  4F3O A;  3SUQ A;  3H08 A;  3UE5 A;  3OYK A;  1NK5 A;  1BU6 O;  3K5M A;  2UYT A;  1GLJ O;  2E6M A;  3CCR N;  2EHG A;  1IG8 A;  4BRA A;  1TUY A;  5FRM A;  1HKB A;  1X3N A;  4A5B A;  3D0P A;  2OPS A;  4FVM A;  3P39 A;  5C24 A;  4DF8 A;  1S1W A;  4ISE A;  3R1X A;  5CYM A;  3CMA N;  3IFR A;  3QFP A;  3DRP A;  3T3F A;  3AVG A;  4WE1 A;  5C0Y A;  4BRQ A;  3NCI A;  4KRE A;  3DM2 A;  1NJW A;  4N41 A;  2A5X A;  4BRL A;  1A5X A;  1W2B M;  3E66 A;  1ATR A;  4M3R A;  4KV8 A;  3K59 A;  4GV3 A;  3NGI A;  4ELU A;  1LV5 A;  3VQA A;  1D8Y A;  4BQL A;  3KLI A;  1NGG A;  3G0Z A;  4IDK A;  3VQD A;  1SUQ A;  3DJC A;  1BO5 O;  3CQ8 A;  5EOY A;  3WXI A;  4KHY A;  1S72 N;  2Q3S A;  4QAG A;  2W40 A;  3LP1 A;  1IBL K;  4U67 L;  2GWJ A;  4DS5 A;  4M63 C;  5DMR A;  4OVL A;  4KTQ A;  3SQ2 A;  3ZT2 A;  3DWL A;  1U47 A;  4BRM A;  3CC7 N;  3MXM A;  4F3T A;  5J2P A;  3AVC A;  3CCU N;  3QIN A;  2XY8 A;  3VET A;  3V9W A;  4CJV A;  2P9N B;  2HMP A;  1S6Q A;  2E2P A;  3V6D A;  3CET A;  5JLH A;  2NRX A;  3AO5 A;  1DTT A;  3K58 A;  5M1F A;  5C2F A;  5EVZ A;  5FDL A;  4BG8 A;  4NXM K;  2FSN A;  1I39 A;  4JI4 K;  1OKJ A;  3TSP A;  1XQS C;  3HM8 A;  1EX4 A;  4C1N K;  4BR7 A;  4IKF A;  3V9X A;  4CHN A;  4DLE A;  2OPR A;  4JS5 A;  4CEE A;  3CCL N;  3NH0 A;  3E01 A;  4OKK A;  1IV0 A;  4CGI A;  1L3S A;  1UA0 A;  3DLE A;  4BRC A;  2P1J A;  3BEX A;  3MDQ A;  4JEP A;  2IVO A;  2FBY A;  2F9W A;  3WXM B;  4JS4 A;  1Q86 O;  1JLG A;  2HB5 A;  4FM0 A;  4H5N A;  4DV3 K;  1NJI O;  3UKR B;  4F9O A;  1NK6 A;  4DLG A;  2UXB K;  1K6Y A;  3AA2 A;  1C0U A;  1X1P A;  3ZSR A;  3OYE A;  2XY7 A;  3AA3 A;  4WQ5 A;  4RW6 A;  4K43 A;  1Q9X A;  4CEF A;  3ZX0 A;  3VMF B;  3IRX A;  4CF8 A;  5BPN A;  1NBW A;  5C15 A;  3AVK A;  5HP1 A;  3ZSQ A;  3AVN A;  3ZEU A;  3NH1 A;  3KTQ A;  4BRP A;  5CY4 A;  1VSF A;  3ZYY X;  4E1N A;  2PY5 A;  3WNH A;  3LWL A;  1QZ6 A;  4TSX A;  5K14 A;  2KHO A;  1ASU A;  4CHY A;  4GNI A;  4JKD A;  5M1O A;  4B1V A;  4QCL A;  4ELT A;  1C1B A;  2BTF A;  3QIP A;  4I6M B;  1JL1 A;  3MMV A;  4EAH D;  4IEE A;  3ZSO A;  5HRS A;  2FXU A;  2O8D A;  4AQY K;  1I94 K;  5JS2 A;  3G25 A;  2G8K A;  3THV A;  3ZCM A;  3RSE A;  1S1V A;  3UIQ A;  3LM9 A;  4IJN A;  4MLH A;  4BC2 A;  4I9Q A;  4DTM A;  2KKZ A;  5ADX A;  2ASP A;  1BA0 A;  3VGK A;  3VER A;  3DXK A;  3K2P A;  1OH6 A;  4I2P A;  4NLC A;  3VGL A;  4WYB A;  2HST A;  2P9L B;  1KRP A;  1Y97 A;  4ZTJ A;  1NJY A;  4EHU A;  4BE0 A;  3KK7 A;  4A61 A;  5JVG L;  3DXM B;  3O9S A;  2PBD A;  3CM5 A;  2HNZ A;  3VA0 A;  2VQF K;  3WEE B;  5FRN A;  3LZI A;  4CJR A;  1FXX A;  2GX9 A;  5AQG A;  3SNN A;  1TK8 A;  4CJ5 A;  4M45 A;  5GAD P;  3VQ8 A;  4NCB A;  1S9G A;  4LF7 K;  3HBT A;  4RW8 A;  2XHB A;  3GE1 A;  4N47 A;  2GEM A;  2HMI A;  3OYN A;  4DTO A;  2BH1 A;  4A59 A;  5MLC Q;  4JI3 K;  4J8F A;  2ITG A;  1TKZ A;  1DGK N;  4CEZ A;  3V9U A;  3NVM A;  1YF5 L;  3UKR A;  1NK4 A;  1EO1 A;  2CH6 A;  4BC4 A;  1VQ5 N;  3PO5 A;  4CIG A;  3G4S N;  4BRG A;  5J2Q A;  3TAF A;  3SQ0 A;  1IJJ A;  4B9S A;  2O8B B;  3QBX A;  4WFA L;  1X3M A;  4CK2 A;  3V81 A;  3J7Z O;  3VTI A;  1TL1 A;  1JLB A;  4O0I A;  4I7F A;  3VF6 A;  3ULD A;  4F2S A;  2WUS A;  1C0M A;  4DFJ A;  4O8K A;  3QML A;  4FWO A;  4KHQ A;  5KI6 A;  4WF9 L;  5GAG P;  3K0S A;  3L2R A;  4JKE A;  3A5L C;  5FRO A;  5AQV A;  2JLE A;  4FWK A;  3MCA B;  4CZF A;  4B9N A;  4FJM A;  4K42 A;  1HKC A;  4H0Y B;  3P83 D;  1RT6 A;  1QQM A;  1S6P A;  4A5A A;  1JLQ A;  4IG0 A;  3BDP A;  2VQE K;  4DFK A;  3FE1 A;  3SPY A;  1TVR A;  4LF6 K;  4PA1 A;  1IKV A;  4GKJ K;  5IT9 O;  2D0P A;  3ATU A;  2P9U A;  4HWI A;  3LDS A;  4GKK K;  1Q81 O;  2QI2 A;  4L3Q A;  1HJO A;  3OY9 A;  4JN4 A;  3I55 N;  3M8P A;  4EP5 A;  3SMP A;  3AV9 A;  1LOT B;  2YNF A;  1KXP A;  2AP1 A;  5AZI B;  2D0O A;  3KK2 A;  4KB0 A;  3P38 A;  4B9Q A;  2P9U B;  4YOR A;  3K5L A;  3QES A;  1LAW A;  2B6A A;  4B3R K;  1JJ2 M;  2W6L A;  2RPI A;  3CPW M;  3BF3 A;  4NCG A;  4AM6 A;  3H46 O;  3CC2 N;  3C7N A;  5BRH A;  4ILG B;  4KI4 A;  4KHP K;  1IKX A;  2VYP A;  2ZJQ L;  3THW A;  4BVO A;  1Y64 A;  3O9T A;  1EWR A;  1J5E K;  2JWK A;  2QM1 A;  4JKB A;  3R6M A;  4BR0 A;  2E8A A;  1U6Z A;  2BGG A;  3LAM A;  4N76 A;  3K5N A;  3GDQ A;  3CF5 L;  1K73 O;  2A40 A;  4KHN A;  3L2Q A;  3TAB A;  5J2M A;  1RFQ A;  3ALY A;  4B1X B;  2JGU A;  2O4G A;  4Z94 A;  4J2E A;  3TTC A;  3EE9 A;  3P5J A;  3LDL A;  4XH5 A;  3M6G A;  3KD5 E;  1OVQ A;  4MO5 A;  1TYQ B;  4O8U A;  2GV9 A;  3VQ5 A;  3RWU A;  1RTJ A;  3WXL A;  2YKM A;  5KRS A;  3IUC A;  1KVC A;  4FJ9 A;  1WSE A;  1SKR A;  1XMO K;  4CF0 A;  2HHS A;  4GVE A;  3FZF A;  2D1K A;  4DCH A;  1J54 A;  4AHT A;  3P31 A;  4DKW A;  1JLF A;  3L0Q A;  5F0X A;  3RMA A;  1M1K O;  2O8B A;  4JD2 B;  4C8K A;  4FW2 A;  5AQH A;  4DQP A;  3CG7 A;  2YJF A;  3OHR A;  3RR7 A;  3N4P A;  1QQC A;  4W5O A;  4H8K A;  1RT2 A;  2XY5 A;  5SZT A;  3CM6 A;  4BR5 A;  1VRU A;  2V52 B;  1WLJ A;  4CFB A;  4H5W A;  2HVH A;  4WQ5 C;  3SPZ A;  3OS1 A;  3V4I A;  2HHU A;  3VN5 A;  3LAL A;  4CJQ A;  1KVA A;  2WFB A;  2FF3 B;  3OYA A;  1N5Y A;  5HRR A;  2PYL A;  2E88 A;  4CK1 A;  3SYZ A;  3OBW A;  4JI8 K;  4PKH A;  5AQK A;  4HTL A;  4DTX A;  5AQI A;  2P51 A;  4DSF A;  4KPY A;  1NGI A;  4CGD A;  3VTH A;  2YHX A;  3VF2 A;  4CJ3 A;  1QTM A;  3A5O C;  3KVG A;  2Q31 A;  3L2W A;  4BC3 A;  2G8H A;  4Z4F A;  1HMV A;  1T7P A;  3HO1 A;  1RCH A;  1ZBU A;  1WAF A;  3FZL A;  4CJK A;  1NK7 A;  1NK0 A;  2OTJ N;  3ZSW A;  5GAE P;  1TV6 A;  2YNG A;  1XWL A;  1RBV A;  3L4Q A;  2E2O A;  3E9L A;  3VEX A;  3J80 O;  1ASW A;  4PUO A;  1HYZ A;  4JAX A;  2NLX A;  1BQM A;  3L2V A;  4E7I A;  2P5O A;  3L6Q A;  2O4I A;  1SKS A;  1ZBH A;  5AQP A;  5FLX O;  3A8Y A;  3SJH A;  3TI0 A;  1KLN A;  5C10 A;  5DK5 A;  1NOZ A;  1GOB A;  3D2E B;  4JRP A;  4DR5 K;  4FJK A;  2KW4 A;  3AVJ A;  4HHT A;  2WTU A;  3HZ6 A;  3VQ7 A;  3WXK A;  4HUG A;  2PFU A;  3HI0 A;  3DI6 A;  1EP4 A;  3MN7 A;  2AJQ A;  2G8W A;  5LL6 Z;  3FFK B;  2GTD A;  4R79 A;  4FM1 A;  2X74 A;  2VWJ A;  1JLA A;  3P1G A;  4OPH A;  1RGI A;  1KQS M;  2E4L A;  5AQM A;  4B9V A;  1WAJ A;  2IGI A;  4BRE A;  4WFB L;  3RRG A;  2Q36 A;  3ISN C;  1OVY A;  3RMC A;  4CGG A;  1REV A;  1KFS A;  1S3X A;  1VSL A;  1RT4 A;  1L3V A;  3BZC A;  2V7Y A;  2ITM A;  2OZM A;  4FXD A;  5GIN A;  4DB3 A;  4A2A A;  5BRD A;  3KWI A;  4H4M A;  4HVJ A;  3O5B A;  3V9Z A;  3E1Y A;  1S1T A;  3JSM A;  5LJV A;  4JV5 K;  1BIZ A;  1BCM A;  4M3X A;  3NBP A;  4BGB A;  4RW4 A;  1TGO A;  2IVN A;  3VPZ A;  5C12 A;  1B9D A;  2W42 A;  2P9L A;  2UU9 K;  4DR4 K;  5E41 A;  3THX A;  3DRS A;  3TAG A;  2P9N A;  3ZET B;  2OA8 A;  3DXK B;  3MEE A;  1EXQ A;  4NXN K;  5M1P A;  4YOT A;  2ZGZ A;  4FVU A;  3A5M C;  4KB1 A;  5CE3 A;  4YDU A;  5SWM A;  3ENO A;  4CZH A;  5AFU A;  2I7N A;  4X62 K;  4JNE A;  4PKI A;  4RW9 A;  3V9S A;  4E7L A;  4RCH A;  1D9D A;  2D5R A;  2HHQ A;  4NYN A;  4C8O A;  3DOK A;  4DMN A;  3OYG A;  4DTS A;  3AVH A;  3EN9 A;  4JI2 K;  5AQX A;  4KKO A;  3GL1 A;  1JCG A;  3VQB A;  4EZ9 A;  5AR0 A;  3HRG A;  4K0K K;  2IS3 A;  3PUF A;  1RBT A;  1GOA A;  3SAH A;  2XY6 A;  3HVT A;  5AZJ B;  4YY3 K;  4NLB A;  3AY9 A;  3KLG A;  1NGA A;  2FBV A;  1JCE A;  2D0A A;  3CPE A;  2QWN A;  2DFE A;  3H1V X;  1W7A A;  3SJJ A;  4FJI A;  3NH2 A;  1HNI A;  1RDW X;  3PIO L;  3ULE B;  2YHA A;  5J2N A;  2QWR A;  2KTQ A;  3OW2 M;  4K8Z A;  3C6U A;  1LAV A;  3HK2 A;  2FF6 A;  4DHY A;  1QQN A;  4CEO A;  1NM1 A;  3H3N O;  3SI6 A;  2DTU A;  1C1C A;  4B1Z A;  1DKG D;  2A41 A;  2WBN A; 
#chains in the Genus database with same CATH homology
 4ZTJ A;  4E3S A;  3OJU A;  4Y1D A;  1NJY A;  3DYA A;  4OJR A;  4BE0 A;  4BDY A;  4DTR A;  3I0S A;  3QEI A;  3M8S A;  1LWF A;  4PQU A;  1VRT A;  1BCO A;  1RDD A;  1ITG A;  2HNZ A;  3CM5 A;  3VA0 A;  4CEQ A;  3SV3 A;  5CZ1 A;  5FRN A;  2GBZ A;  1TK0 A;  3AVA A;  1BI4 B;  4CJR A;  1FXX A;  3LZI A;  3SNN A;  3S3N A;  3RR8 A;  1TK8 A;  4B3O A;  2PYJ A;  3AVL A;  5CYQ A;  3OYF A;  1RNH A;  4CJ5 A;  4M45 A;  3V1O A;  3LWM A;  3VQ8 A;  4HUE A;  4DTU A;  3TAN A;  1U48 A;  1IG9 A;  2PZS A;  2OYQ A;  4NCB A;  1S9G A;  1NJZ A;  5CZ2 A;  4BE1 A;  1UA1 A;  4RW8 A;  4DSE A;  2XHB A;  4L8R B;  3RMB A;  4N47 A;  4KO0 A;  3TAR A;  1N6Q A;  3QO9 A;  2BDP A;  2HMI A;  3OYN A;  4DTO A;  1T03 A;  3AVF A;  2EX3 A;  4BWM A;  3D45 A;  2ITG A;  1TKZ A;  4AHC A;  4CER A;  3K57 A;  4CEZ A;  4E19 A;  4CGF A;  3V9U A;  3O3G A;  1NK4 A;  4DWI A;  4CJ4 A;  3PO5 A;  4CIG A;  4Q5V A;  4KHU A;  4OKJ A;  3QEW A;  2I5J A;  2A1S A;  3HL8 A;  4ID5 A;  3U3G A;  3VQQ A;  4W5R A;  5J2Q A;  2IDO A;  3TAF A;  3SQ0 A;  1WNS A;  3VA3 A;  4I2Q A;  3PO4 A;  1TL3 A;  3VQC A;  4B9S A;  3LZJ A;  3ZT4 A;  3AO3 A;  3S3O A;  5C42 A;  4CIE A;  2VG5 A;  4AHS A;  3DLH A;  4ZHR A;  3I8D A;  1RTI A;  4CK2 A;  3KKR A;  4O5B A;  4FZY A;  2F96 A;  3V81 A;  1C0T A;  1TL1 A;  2X6S A;  1JLB A;  2YNH A;  3NDK A;  4O0I A;  4I7F A;  1TK5 A;  3EYZ A;  1G15 A;  1JLC A;  3C94 A;  3MAQ A;  2QK9 A;  3ULD A;  1W9H A;  4F2S A;  1QSS A;  3U3Y A;  4KFB A;  4FLT A;  1CZB A;  1C0M A;  5D3G A;  4OGC A;  4DFJ A;  3S9H A;  3OYB A;  4M42 A;  4DSI A;  4CHQ A;  1CXQ A;  4KHQ A;  3ASM A;  5KI6 A;  4HCC A;  3OYH A;  4CIF A;  3PX0 A;  5I42 A;  1RTH A;  3L2R A;  4Q0B A;  3OVN A;  4CFD A;  5FRO A;  2HHT A;  1C1A A;  3HST B;  3T19 A;  3FFI A;  2JLE A;  4N5S A;  4OLB A;  3KD1 E;  3QEP A;  4J2D A;  3C6T A;  3OYI A;  3HJF A;  4B9N A;  4FJM A;  1RT3 A;  3NGZ A;  1DLO A;  2YKN A;  3P83 D;  4DU3 A;  4IG3 A;  1LW2 A;  3O3H A;  2GUI A;  4M41 A;  3M8R A;  1RT6 A;  1S6P A;  2F8T A;  2Z1G A;  1RT7 A;  1JLQ A;  4IG0 A;  1SL1 A;  3BDP A;  4DFK A;  3HPO A;  3HT3 A;  1HYV A;  3O3F A;  3KKS A;  1TVR A;  3U6F A;  3SPY A;  1D5A A;  1WSI A;  3TAM A;  3LAN A;  1QSY A;  4M3Z A;  2KFZ A;  1XHX A;  3V1R A;  3L8B A;  4DU4 A;  4PA1 A;  1IKV A;  1WN7 A;  3QER A;  2OPQ A;  5HBM A;  1RBS A;  1KSP A;  4FK4 A;  2B4J A;  1U49 A;  4FJX A;  3TAQ A;  1KCF A;  4O44 A;  3LDS A;  3HP9 A;  4FJN A;  2P5G A;  4GVM A;  1KFD A;  3NE6 A;  3WNG A;  3L3V A;  3OY9 A;  1D9F A;  2IC3 A;  3HPG A;  2HHW A;  5KRT A;  4M3U A;  2YNI A;  3M8P A;  2Y1J A;  3VQE A;  2ZD1 A;  4EP5 A;  1L5U A;  4Z4H A;  1BL3 A;  3AV9 A;  3DRR A;  3TAE A;  2YNF A;  4CJP A;  4O4G A;  3S3M A;  2XRI A;  4IFY A;  3PX6 A;  3SCX A;  2QKK A;  3KK2 A;  3V1Q A;  1QE1 A;  4KB0 A;  5T7B A;  4FM2 A;  4DFM A;  3NF7 A;  4C8M A;  1EET A;  2ZQB A;  3B6O A;  3AO1 A;  3NFA A;  3O4N A;  4O55 A;  4RG8 A;  4KAZ A;  3K5L A;  3QES A;  5EU7 A;  1RDA A;  1S5J A;  1LAW A;  2B6A A;  1JXB A;  3K5O A;  2R7Y A;  4BAC A;  2RPI A;  1WSH A;  4NCG A;  1U04 A;  2D0B A;  3M8Q A;  4M3Y A;  4FLW A;  4F2R A;  3QEX A;  4I9L A;  4CF1 A;  4KI4 A;  4CEB A;  1IKX A;  1O1W A;  4Z0U A;  4CJE A;  4Z4G A;  3B6P A;  4W5Q A;  4Y1C A;  4HUF A;  3HVR A;  3IAY A;  1IO2 A;  4CJS A;  4E7H A;  2HVI A;  5KGW A;  2KFN A;  4AH9 A;  2G8V A;  4F4K A;  2ATQ A;  2QKB A;  3CFP A;  4RW7 A;  2BGG A;  3LAM A;  1UAX A;  2WON A;  3OYL A;  4N76 A;  3MXJ A;  1HYS A;  3K5N A;  1SKW A;  2VWK A;  1YT3 A;  3L2Q A;  4KHN A;  3TAB A;  5J2M A;  3ALY A;  2JGU A;  1HPZ A;  2O4G A;  2DY4 A;  4C8N A;  1WSF A;  4J2E A;  3P5J A;  4PY5 A;  1QS4 A;  4GMJ B;  3VQP A;  4B8A B;  3AVI A;  3KD5 E;  2DFH A;  3OYC A;  3T1A A;  3NHG A;  4ELV A;  1Q9Y A;  3ZT1 A;  1RDB A;  2GV9 A;  3VQ5 A;  3RWU A;  3KLH A;  4CEA A;  1RTJ A;  2QXF A;  2YKM A;  3ZT3 A;  5KGX A;  4FZZ A;  5KRS A;  4DTN A;  1KVC A;  1Z25 A;  4FJ9 A;  1WSE A;  3G10 A;  3F73 A;  1TKD A;  1SKR A;  3OYJ A;  4CF0 A;  2HHS A;  1VSK A;  1J5O A;  1J54 A;  2YV0 X;  3AA5 X;  4AHT A;  1JLF A;  3SQ4 A;  3QNN A;  4FW1 A;  4DQS A;  1QHT A;  3RMA A;  2D0C A;  3DLG A;  4YFU A;  1SL0 A;  2BAN A;  1BHL A;  3AO4 A;  1TKT A;  4DSJ A;  4Z4E A;  4C8K A;  3VQ4 A;  4HTU A;  1FKP A;  4W5N A;  3LP3 A;  1NK8 A;  1T05 A;  4FW2 A;  4KRF A;  5C25 A;  3EZ5 A;  4IBN A;  3CG7 A;  4DQP A;  3KK1 A;  3HYF A;  3NF6 A;  3RR7 A;  2HHX A;  3MED A;  3IG1 A;  4CF9 A;  1LWE A;  1S1X A;  2VG6 A;  3PV8 A;  1QQC A;  2RKI A;  2DFF A;  5HRN A;  4E89 A;  1KLM A;  4W5O A;  3CYM A;  4DSL A;  4FJJ A;  4K8X A;  4CEC A;  1XHZ A;  4KI6 A;  4E7J A;  4H8K A;  1RT2 A;  2XY5 A;  4HCB A;  3JYT A;  2FBX A;  5SZT A;  3CM6 A;  1RDC A;  1VRU A;  1WLJ A;  2RN2 A;  4CFB A;  4FLZ A;  3DLR A;  4BWJ A;  1VSM A;  4FJ8 A;  1S1U A;  4FZX C;  4AHR A;  1F21 A;  2HVH A;  3SPZ A;  3OS1 A;  3V4I A;  1L3U A;  2HHU A;  3VN5 A;  4EP4 A;  3CFO A;  3LAL A;  1MU2 A;  3MEG A;  1BGX T;  4OGE A;  4CJQ A;  3DLK A;  4O0J A;  1KVA A;  4KHS A;  4CJL A;  4G1Q A;  2HNY A;  3RTV A;  4XIU A;  4BDZ A;  3SV4 A;  1BIS A;  4LSL A;  3OYA A;  1N5Y A;  4F3O A;  3SUQ A;  5HRR A;  3H08 A;  3OYK A;  3SUO A;  4KHW A;  1NK5 A;  3KIO A;  2PYL A;  4LD0 A;  3K5M A;  4CK1 A;  3SYZ A;  3SUN A;  3ZSY A;  4DQR A;  2OPP A;  1VSH A;  2E6M A;  4B9L A;  2EHG A;  4B9T A;  1NOY A;  1TAU A;  2Z1J A;  1LWC A;  4DTX A;  2P51 A;  4H4O A;  5FRM A;  4DSF A;  3KK3 A;  4KPY A;  4CGD A;  4JLH A;  3C95 A;  2Z1I A;  4CJ3 A;  3D0P A;  1QTM A;  1C6V A;  2OPS A;  4FVM A;  4IFV A;  3L2W A;  2G8H A;  4Z4F A;  2HND A;  3NGY A;  5C24 A;  1HMV A;  4DF8 A;  1CXU A;  1T7P A;  1S1W A;  3HO1 A;  1RCH A;  1ZBU A;  4NCA A;  1WAF A;  4J2B A;  4DFP A;  4E1M A;  4CJK A;  1NK7 A;  5CYM A;  1NK0 A;  4DSK A;  1NKC A;  3WNF A;  3ZSW A;  3DRP A;  1IKW A;  1HNV A;  4BDP A;  1TV6 A;  1TKX A;  2YNG A;  5HRP A;  1XWL A;  1RBV A;  5HLF A;  3T3F A;  3V9Z A;  3AVG A;  1U45 A;  1R0A A;  5JS1 A;  1ASW A;  4CHO A;  3HPH A;  1HYZ A;  4PUO A;  4WE1 A;  1ZBI A;  3NCI A;  3DMJ A;  4KRE A;  1A5W A;  3DM2 A;  1NJW A;  4N41 A;  1BQM A;  1FKO A;  3L2V A;  1KVB A;  3MXI A;  1ZBF A;  3VQ9 A;  4E7I A;  2P5O A;  2HHV A;  3QIO A;  1VSE A;  1A5X A;  2O4I A;  3QNO A;  4J2A A;  1SKS A;  3LPU A;  1ZBH A;  3NF9 A;  4CJU A;  1IH7 A;  4M3R A;  4KV8 A;  3K59 A;  3TI0 A;  1KLN A;  2WOM A;  3NGI A;  2FBT A;  4ELU A;  1YVU A;  5DK5 A;  4FYD A;  1NOZ A;  1UOC A;  1LV5 A;  3VQA A;  2G8I A;  1D8Y A;  3OS2 A;  1GOB A;  3MEC A;  1ZBL A;  1Z26 A;  4FK2 A;  3KLI A;  4JRP A;  3L3U A;  4CFC A;  4FK0 A;  1SV5 A;  3G0Z A;  3DOL A;  3OJS A;  2KW4 A;  5J1E A;  3AVJ A;  4FJK A;  2KZZ A;  1CLQ A;  4HHT A;  4IDK A;  3VQD A;  3VQ6 A;  1SUQ A;  3OS0 A;  1VSJ A;  4B08 A;  2Y1I A;  1SL2 A;  4CED A;  3CQ8 A;  3VQ7 A;  4EZ6 A;  1VSD A;  1YTA A;  4HUG A;  4KHY A;  4NYF A;  4N56 A;  4E7K A;  2IOC A;  2Q3S A;  2ETJ A;  4KTZ A;  4QAG A;  3DI6 A;  4UQG A;  1EP4 A;  3F9K A;  3LP1 A;  1NKE A;  3DLB A;  2AJQ A;  2G8W A;  3WNE A;  4DS5 A;  5DMR A;  3RMD A;  4OVL A;  1RT1 A;  4KTQ A;  3ITH A;  4CHP A;  4DQQ A;  3SQ2 A;  4BE2 A;  2LSN A;  4KTW A;  2X74 A;  3ZT2 A;  2VWJ A;  1JLA A;  4CJT A;  4FM1 A;  1BIU A;  3P1G A;  4Z4I A;  1U47 A;  4CJW A;  1T8E A;  2B5J A;  3L2U A;  3MXM A;  4F3T A;  1FK9 A;  5J2P A;  3AVC A;  2E4L A;  3HXM A;  3QIN A;  2XY8 A;  1X9M A;  3RRH A;  4CJF A;  3V9W A;  2NUB A;  3SUP A;  4CJV A;  1LW0 A;  4B9V A;  4B9M A;  1WAJ A;  1RBR A;  1S6Q A;  3ZT0 A;  3V6D A;  2VG7 A;  2IGI A;  1XC9 A;  4YNQ A;  3RRG A;  1DTQ A;  5KTQ A;  1RTD A;  4DF4 A;  1UWB A;  3ISN C;  4CES A;  3AO5 A;  1DTT A;  3K58 A;  3RMC A;  4CGG A;  1REV A;  1KFS A;  4R5P A;  3ZSV A;  5FDL A;  4FLX A;  1VSL A;  4DTP A;  1RT4 A;  1L3V A;  1I39 A;  1HJR A;  3QEV A;  2OZM A;  4FCY A;  4C8L A;  4FXD A;  1IKY A;  1A5V A;  1ASV A;  1EX4 A;  1WSJ A;  4IKF A;  1JLE A;  3BGR A;  3TR8 A;  3V9X A;  3LP0 A;  4CHN A;  1S9E A;  3A2F A;  4H4M A;  2OPR A;  4ID1 A;  4OKE A;  4HVJ A;  4JS5 A;  4DLE A;  4GW6 A;  1JL2 A;  4LY7 A;  4CE9 A;  1RT5 A;  1S1T A;  3JSM A;  4CEE A;  1BI4 A;  4B9U A;  1BIZ A;  4LH4 A;  3NH0 A;  3E01 A;  4OKK A;  4CGI A;  1L3S A;  1BCM A;  1UA0 A;  3DLE A;  3NBP A;  4M3X A;  1YTU A;  4ZTF A;  4RW4 A;  4CGH A;  1TGO A;  3O4Q A;  4CF2 A;  4E0D A;  2P1J A;  1X9W A;  2E6L A;  1B9D A;  1BQN A;  4DS4 A;  3KLF A;  4OLA A;  1VSI A;  2W42 A;  2FBY A;  1QSL A;  4DQI A;  3OYD A;  2BE2 A;  5E41 A;  3DRS A;  4LSN A;  4CHZ A;  4DTJ A;  1J9A A;  3I0R A;  4JS4 A;  1JLG A;  3TAG A;  2OA8 A;  2HB5 A;  3OYM A;  4FM0 A;  1B92 A;  3MEE A;  1EXQ A;  1NK6 A;  4DLG A;  2A1R A;  1HQE A;  1K6Y A;  4LH5 A;  3AA2 A;  4AIL C;  1NJX A;  4KB1 A;  1C0U A;  3AA4 A;  1X1P A;  3ZSR A;  1I3A A;  3OYE A;  3AA3 A;  1EKE A;  2XY7 A;  5SWM A;  4RW6 A;  1RIL A;  3NAE A;  1WSG A;  1Q9X A;  4M3T A;  4CEF A;  1CZ9 A;  2X78 A;  2RF2 A;  4DG1 A;  4CCH A;  4FJ5 A;  3KJV A;  3SZ2 A;  4OPJ A;  1X9S A;  1JKH A;  3ZSX A;  4RW9 A;  3IRX A;  4CF8 A;  3V9S A;  1GOC A;  2XO7 A;  4PWD A;  4E7L A;  3CFR A;  2HW3 A;  3AVK A;  5HP1 A;  3ZSQ A;  3AVN A;  3PY8 A;  1D9D A;  2YHB A;  1KTQ A;  3NH1 A;  2D5R A;  3KTQ A;  3LAK A;  4W5T A;  3IS9 A;  5CY4 A;  2OZS A;  1VSF A;  4NYN A;  4C8O A;  4E1N A;  3DOK A;  2PY5 A;  4DMN A;  2HHQ A;  3WNH A;  3LWL A;  1Q8I A;  4TSX A;  3NF8 A;  5K14 A;  3OYG A;  4F8R A;  4DTS A;  3AVH A;  1ASU A;  4CHY A;  4KKO A;  4CK3 A;  4AHV A;  4QCL A;  1J53 A;  3VQB A;  4M3W A;  4MQ3 A;  3LP2 A;  1TAQ A;  1NK9 A;  4EZ9 A;  4ELT A;  1C1B A;  2IAJ A;  4FLU A;  4B8C A;  1HQU A;  2X6N A;  3KLE A;  3QIP A;  1JL1 A;  3EY1 A;  4MFB A;  4Z4C A;  4FJG A;  4FLY A;  2IS3 A;  4FJH A;  4CGJ A;  3HM9 A;  3PX4 A;  3PUF A;  1JXE A;  3ZSO A;  1RBT A;  3LPT A;  1GOA A;  5HRS A;  1XI1 A;  2G8U A;  2XY6 A;  2Z1H A;  5HRO A;  3QET A;  3HVT A;  5JS2 A;  1HRH A;  1VK0 A;  4ICL A;  1ZYQ A;  2FC0 A;  3AVM A;  4OPK A;  3KLG A;  1U4B A;  2G8K A;  4QOZ B;  3TWH A;  3THV A;  1RBU A;  3ZCM A;  4FLV A;  2FBV A;  2D0A A;  1L3T A;  1S1V A;  2DFE A;  2KQ2 A;  3UIQ A;  4FJ7 A;  3SJJ A;  4FJI A;  2ZE2 A;  3NH2 A;  4JRQ A;  4I9Q A;  1HNI A;  2YHA A;  4DTM A;  5J2N A;  2F8S A;  2KTQ A;  3SQ1 A;  4CFA A;  4K8Z A;  4DU1 A;  3C6U A;  1NKB A;  5I3U A;  3AO2 A;  1LAV A;  3HK2 A;  1W0H A;  2G8F A;  4CEO A;  3HP6 A;  3TAP A;  3K2P A;  4FJL A;  3ZSZ A;  3SI6 A;  3AVB A;  4I2P A;  2DTU A;  1C1C A;  4AHU A;  1B9F A;  2KZM A;  1KRP A;  3QLH A;  1Y97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...