3AVGA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avgA00
4DTOA 4E7LA 3VA0A 4B9LA 1KFSA 1TGOA 3LP1A 4FLYA 4FM2A 1T05A 2OYQA 4ZTFA 1L3SA 4K8ZA 1CZ9A 2IAJA 4FJ5A 4I9LA 1C1CA 4OPJA 4KI4A 4ICLA 3PO4A 5J1EA 3I0SA 1KVCA 5CZ2A 4H4MA 2EHGA 3MXMA 3DLGA 3KLIA 3TWHA 4JLHA 4RG8A 2ATQA 2OPRA 3ZSOA 3S3OA 2KZZA 1BI4B 4L8RB 4QCLA 4FJXA 3K58A 2F8SA 2A1SA 1NJYA 1IH7A 4GVMA 4B8CA 4M3XA 2BE2A 1JXEA 5HRPA 1IG9A 4IBNA 5CYQA 2RF2A 3ALYA 4CIFA 4BE1A 4CK2A 3PY8A 1KCFA 4F3TA 4EP5A 1ZBHA 3QEXA 3DRPA 4TSXA 1X9MA 3AVNA 4KI6A 3V6DA 3CQ8A 1VSKA 3DRRA 1S1TA 4E7IA 3V1QA 4DFKA 4FYDA 3SUPA 4NYNA 3NGZA 3P83D 3ZSWA 3QEPA 3PO5A 4OLBA 1JXBA 4EP4A 4PY5A 4CEFA 1I3AA 2G8KA 4CIEA 3VQBA 1JLCA 4K8XA 3SQ0A 4E1MA 3QERA 4LSLA 1XWLA 3OS1A 4CEDA 4PQUA 3RR8A 3DLHA 2W42A 3AA2A 1TKTA 4LY7A 2JLEA 1RNHA 3WNFA 3ZSYA 1NK5A 3KLFA 3L2QA 3LAKA 2G8IA 2KFZA 4DQSA 3QIPA 4N47A 3S3MA 3NGYA 4BDYA 4ZTJA 4DTJA 2PY5A 3HM9A 1QS4A 4PWDA 3OYHA 4W5NA 4FM0A 1BQNA 2KW4A 2DFHA 5KRTA 1BCOA 3SNNA 2PYJA 4FK0A 4RW8A 1ZBUA 3O4NA 3VQCA 3BGRA 4KHSA 2D0AA 3VQDA 3AVIA 1WSGA 4KTWA 5KGWA 3V1RA 2FC0A 1YTAA 3EYZA 1X9SA 2X6NA 4AHSA 3OYJA 3OJUA 2ITGA 4M3TA 3TARA 1C0TA 4KHQA 3K5MA 4FJKA 2HB5A 4OKKA 4M3RA 4YNQA 3K5NA 3RMCA 3ISNC 4DFMA 3TAFA 3KJVA 4CCHA 4FZZA 3E01A 3HSTB 4CEQA 3MEDA 2Y1IA 4ELUA 5CY4A 3KK3A 3TAPA 2GBZA 5FRMA 4CJFA 1S6QA 1RCHA 3ZSXA 3AVLA 2ZE2A 3V4IA 1KFDA 4FLZA 1EXQA 5I42A 1RBVA 4IG3A 2ZQBA 4CFAA 3L8BA 3QO9A 4ID1A 2XO7A 3DYAA 4JRQA 3VQPA 4DLEA 3TABA 2KTQA 1RILA 1BL3A 3OS2A 3AO4A 4AHVA 2GUIA 3HPHA 3O3GA 1NOYA 1HMVA 4FK4A 4HUEA 3AVKA 1RBUA 3G0ZA 5HLFA 1UA0A 2HHQA 5CYMA 3L2WA 4CEEA 4AHCA 3NH2A 4O0IA 2XY5A 3C95A 2OZMA 4DQIA 3HJFA 3VQ6A 3OYBA 1CXQA 2EX3A 4IFVA 1KVBA 2LSNA 3AVHA 1IO2A 4O55A 4GMJB 4HVJA 3NF9A 5T7BA 3DLKA 3L2UA 3VQ8A 1LWCA 5HP1A 1NKBA 4JS4A 3WNGA 1T03A 4MQ3A 3RWUA 1S1WA 4B9MA 1KVAA 3ITHA 3SV4A 3SYZA 1W9HA 3AVFA 4CJVA 2YNHA 3C6UA 3KKRA 4O44A 4C8NA 1B9DA 1JKHA 2OPSA 3AA5X 4QOZB 3OY9A 3JSMA 5I3UA 2A1RA 4H8KA 2Z1HA 4B9UA 4CEOA 2HW3A 2BANA 4BACA 3MECA 1TK5A 1WSFA 3ZT3A 2YKNA 1XC9A 4KKOA 2E6MA 4Q5VA 4HUGA 3RMAA 1D9FA 4CJKA 1SKWA 1UWBA 3V9XA 5C25A 1L3VA 1S9GA 4Z4CA 4Q0BA 1BQMA 1WLJA 3O3HA 3DLBA 1JL1A 1L3UA 1U4BA 3NFAA 2NUBA 3ASMA 4CEZA 3NGIA 4DTRA 1KLNA 3OYLA 1LW0A 4CK3A 5FROA 4B3OA 5D3GA 1HNIA 1FKOA 3IRXA 4B8AB 4CFCA 5SZTA 1C6VA 3T19A 1GOAA 1BISA 2DFFA 3RRHA 1S1XA 5J2MA 2XY6A 2BDPA 4CK1A 1HQEA 3H08A 4I7FA 4FJ8A 3QIOA 5JS2A 3V1OA 2OPPA 3IAYA 4DMNA 3HVTA 1T7PA 4FJIA 4KV8A 1XHXA 4G1QA 4CJQA 4CJ4A 2B6AA 4CEAA 3NAEA 1U48A 4W5TA 4CGJA 2YHAA 1C1AA 1JLEA 3ZT2A 4KO0A 1XI1A 1X9WA 1QSSA 2YHBA 3QINA 3SCXA 1GOBA 4C8LA 3KD1E 4FZYA 3L3UA 4CJUA 1ASWA 4DTMA 3M8PA 5C42A 3OS0A 2HNYA 3OYGA 4CJWA 3L2RA 1TAUA 4LH4A 4FJHA 4FJ7A 1KSPA 1VSEA 3THVA 4CF0A 4N76A 2VG7A 4DLGA 2BGGA 2D0CA 2VG6A 2IC3A 1WNSA 4FLUA 1VSLA 4E19A 2WOMA 4IDKA 2YNIA 3QNOA 1L3TA 1JLGA 1DTQA 1D5AA 1VSIA 4BWJA 3AA4A 1I39A 4EZ6A 4M3UA 4O5BA 2X74A 5FDLA 3SI6A 2FBVA 3DOLA 1VRTA 1T8EA 3L3VA 3OVNA 4E7HA 1ZBFA 4OKEA 4NCGA 2Q3SA 4DSEA 3TAEA 3NDKA 1U45A 1RTHA 4M45A 4E7JA 4B9NA 3DMJA 4FZXC 3CFRA 3HO1A 4OKJA 3AO2A 3TI0A 1WSHA 2HMIA 3JYTA 1IKXA 4DF4A 1NJXA 4KRFA 1BI4A 4CHOA 4CF2A 3O4QA 3LAMA 1TKDA 2JGUA 4DTUA 3SV3A 4QAGA 4CGGA 1YVUA 3AVJA 3D45A 4CERA 2P1JA 1LV5A 4FJNA 1NK4A 4FVMA 4B9TA 3IS9A 1VSDA 3AA3A 4OJRA 4CESA 1JL2A 5J2QA 3WNHA 2P5OA 3RRGA 4C8OA 3D0PA 1S1VA 2HVIA 2IDOA 4N41A 4FLTA 4CECA 4KB0A 4CJ5A 3S9HA 4IFYA 3M8SA 2HHXA 4DTXA 4C8KA 4W5QA 1Q9XA 4Z4EA 3IG1A 2F8TA 2FBTA 5JS1A 2KQ2A 1WAFA 3TANA 3DLRA 3LALA 1SUQA 3VQAA 3L2VA 4XIUA 3LP2A 5KRSA 4I2PA 1CLQA 1LAVA 4OVLA 1D9DA 4CHYA 4FJJA 1Q9YA 4WE1A 3HL8A 2Z1IA 1RTIA 3AO5A 4KHNA 1HYZA 4FXDA 2YNFA 1SKSA 4ELTA 1RT1A 3PUFA 1NKEA 4F2SA 1QE1A 4O0JA 4MFBA 5C24A 4N56A 4F2RA 3NCIA 2RN2A 3HPOA 1RTDA 3BDPA 4J2AA 1XHZA 3LWLA 2X6SA 4KHUA 3OYKA 3SQ1A 1WSJA 3OJSA 4OGEA 2QXFA 4CF1A 4JRPA 2Y1JA 3MEEA 2PYLA 1HYSA 4PA1A 2YV0X 4Z4HA 4DWIA 1Y97A 4ELVA 4IKFA 1BIZA 1CXUA 3LDSA 4HUFA 4E7KA 1RDAA 4M42A 1ASVA 3DRSA 3V9ZA 3V9UA 4DS4A 3ZSRA 1J5OA 4GW6A 1NK8A 1NJWA 1TV6A 1NKCA 3VQ9A 3OYFA 3OYMA 4B9SA 2HNZA 2RPIA 1TL1A 1HPZA 3HYFA 4CFBA 2VWJA 1B92A 4HHTA 1U04A 5SWMA 3C94A 4FJ9A 4CGHA 3VQ7A 4DTNA 2HHWA 3F9KA 2RKIA 3DOKA 1TAQA 4CJRA 3MAQA 1RT4A 4FW2A 4CF9A 3LPTA 3SPZA 4KAZA 3WNEA 3LPUA 3QESA 1IKWA 2B4JA 1VSFA 2D0BA 3NE6A 4HTUA 1TKXA 1KRPA 1S6PA 3NF7A 3VQEA 2XRIA 3RMDA 3HT3A 3SQ2A 2VWKA 2Z1JA 4FLWA 3CYMA 4RW9A 4CHZA 3O3FA 4CJTA 3RR7A 1N5YA 4DFPA 2X78A 1NK9A 4E0DA 4E89A 1HNVA 3CG7A 3VQ4A 5HROA 4DSIA 4DTSA 2P5GA 1EX4A 3PX6A 3ZT4A 2XY8A 2XHBA 1YTUA 4Y1CA 2WONA 3KTQA 1RDDA 1A5XA 1A5VA 1VSHA 4C8MA 3CFPA 3SPYA 1TK8A 2G8HA 1RT6A 3V9SA 2O4GA 1RT7A 4BE0A 3DI6A 3UIQA 1ASUA 2VG5A 2OA8A 1NK0A 1KTQA 1NK7A 1S1UA 3AVCA 1CZBA 2QKKA 4M3YA 4RW7A 1QTMA 1JLAA 5EU7A 1HJRA 1QHTA 3RTVA 1KLMA 4KREA 2GV9A 2HHVA 4CIGA 4CHNA 1A5WA 3OYEA 3AVBA 1FKPA 1TVRA 2F96A 1TL3A 4H4OA 4OGCA 1DTTA 1UOCA 2FBYA 1LW2A 4CF8A 4CJLA 2G8WA 1Z26A 2FBXA 3ZT0A 4LSNA 4Z4GA 3QEVA 4BDPA 2YNGA 3SUNA 1JLQA 1RTJA 5HBMA 3V9WA 3KD5E 4CJSA 1G15A 3LP3A 2XY7A 3QEWA 5E41A 5KGXA 3MXIA 4CJ3A 2R7YA 5KI6A 4N5SA 4F8RA 3K59A 4KTQA 2IGIA 1TK0A 1C0MA 4NCAA 4FK2A 4CJEA 4M3ZA 3DLEA 4OLAA 4CJPA 3AO3A 3KK2A 4M3WA 3AVAA 3LP0A 1RDCA 4B9VA 3AO1A 3M8RA 4UQGA 2E4LA 3P5JA 2P51A 1EETA 1NJZA 4EZ9A 3KK1A 2AJQA 4O4GA 4DU3A 4YFUA 4FJLA 3PV8A 4OPKA 3FFIA 3K5OA 3HVRA 3NH1A 4AILC 4DQPA 3V81A 3HK2A 4FLXA 4J2EA 2HVHA 3B6PA 4AH9A 3TR8A 2IOCA 1S9EA 4CHQA 4JS5A 1BHLA 1Q8IA 3TAGA 2HHUA 2ZD1A 3U6FA 3LWMA 2G8UA 1Z25A 5DK5A 3SJJA 4CGDA 1MU2A 4DG1A 2O4IA 1D8YA 4DU1A 2B5JA 1HYVA 1B9FA 4AHUA 4CHPA 1SL2A 1EKEA 4DSLA 4E1NA 1UA1A 1LWFA 2G8VA 2YKMA 4LH5A 2OPQA 4BE2A 4Y1DA 1NOZA 1ZYQA 5DMRA 2DFEA 4Z4IA 1BGXT 3PX0A 1SL1A 4DSKA 4FCYA 1J53A 1WN7A 4FM1A 1C0UA 3LANA 1FK9A 1VRUA 3QETA 3U3YA 2Z1GA 3T3FA 3VA3A 1ZBIA 3VQ5A 4CE9A 3KLEA 1BIUA 3NF6A 4KFBA 3AV9A 3RMBA 3KIOA 1QQCA 1LWEA 1O1WA 2E6LA 2D5RA 1RBSA 1BCMA 5KTQA 3VQQA 3K57A 3LZJA 4FJMA 1UAXA 4BWMA 4CFDA 3OYNA 1RT2A 2I5JA 3AVGA 4PUOA 4LD0A 3OYIA 1TKZA 1FXXA 1GOCA 4AHRA 3EZ5A 4DS5A 4KHWA 1RT3A 1ZBLA 2IS3A 4AHTA 3MEGA 4DU4A 1RDBA 5HRNA 3OYAA 1DLOA 1VSMA 1W0HA 3QEIA 1WAJA 4Z0UA 3C6TA 4BDZA 3P1GA 1N6QA 3T1AA 3LZIA 4DTPA 3HP6A 3U3GA 2KZMA 2QKBA 4CEBA 2DY4A 3EY1A 3OYCA 5HRRA 3SUQA 3B6OA 1QSLA 3I8DA 1ITGA 3CFOA 1J9AA 3MXJA 3K2PA 4J2DA 1NK6A 3K5LA 4B08A 2QK9A 1HRHA 3QNNA 1WSEA 1JLFA 4RW6A 4W5RA 4W5OA 2OZSA 1J54A 4DSFA 3HPGA 4FJGA 4HCBA 1HQUA 5HRSA 1U47A 2HHTA 3DM2A 4NYFA 1K6YA 4Z4FA 2KFNA 3KLGA 3ZSVA 1X1PA 3ZT1A 3NBPA 4CGFA 1LAWA 1IKVA 3KKSA 3ZCMA 1L5UA 3F73A 4IG0A 4I2QA 5J2NA 5K14A 3ZSZA 4E3SA 3SQ4A 1YT3A 1C1BA 2ETJA 3KLHA 1SV5A 3SZ2A 4I9QA 4FW1A 4KTZA 3G10A 1WSIA 1QSYA 4FLVA 3TAQA 4F3OA 4RW4A 2G8FA 4DSJA 4KPYA 3VN5A 4DQRA 2HHSA 2DTUA 3CM5A 3CM6A 3NHGA 3ULDA 1SKRA 3A2FA 5CZ1A 4DQQA 4DF8A 4ID5A 3M8QA 1RBTA 3I0RA 4DFJA 1RT5A 5J2PA 4F4KA 2HNDA 3OYDA 4HCCA 1VSJA 5FRNA 4KB1A 3SUOA 1S5JA 1IKYA 4M41A 3NF8A 3HXMA 3S3NA 1U49A 4CGIA 1F21A 4NCBA 1EP4A 3QLHA 2PZSA 1REVA 3AVMA 1VK0A 1SL0A 3TAMA 4KHYA 3PX4A 3NH0A 4ZHRA 4J2BA 1JLBA 1R0AA 4R5PA 3HP9A 3ZSQA 1RBRA
chains in the Genus database with same CATH superfamily
4E7LA 4H0OA 3IDHA 1KFSA 3CQYA 3A0IX 1K9MO 2IAJA 4FJ5A 4OX9K 4I9LA 3DXMA 3I0SA 2EHGA 1E4GT 3L0QA 4JLHA 4RG8A 3ZSOA 5AFUA 4HWIA 3S3OA 1BI4B 2QXLA 4NLBA 3VF2A 4L8RB 4FJXA 2F8SA 4RCHA 1NJYA 1IH7A 4JKGA 5HRPA 5CYQA 2O8CB 2RF2A 3ALYA 3J8AA 4A57A 3QICA 4TSXA 4B1XB 3EL2A 4B3TK 3DRRA 2ZWHA 4IEEA 3R8EA 4BQLA 3R9PA 5AQTA 5C0YA 4PY5A 3HZ6A 1I3AA 3FR0A 3VQBA 3VENA 4E1MA 3BZKA 3OS1A 3WEEB 3CJCA 1TKTA 1VQMN 5AZIB 1NK5A 1Z05A 3ZLJA 2W41A 1OH8A 4DQSA 3FE1A 3F5TA 4ISEA 4PWDA 3ATVA 2KW4A 4H0VB 1T3VA 4BRIA 1M90O 1WBBA 4CI6A 4FK0A 3EZWA 3BGRA 2D0AA 3VQDA 1NGBA 1WSGA 3AVIA 4KTWA 2FC0A 2O8FB 1KD1O 1RGIA 2ITGA 4M3TA 1WB9A 1S22A 2HB5A 1YXQA 4M3RA 3K5NA 2Q2RA 2FF3B 4FZZA 1VQ6N 3E01A 2E1ZA 5M1FA 2Y1IA 3WXMB 1NU0A 1S6QA 2FSNA 3MK6A 2A3ZA 5I42A 4CFAA 4JRQA 2ZGYA 5KPZA 2XO7A 3TABA 1RILA 1BL3A 3ULEA 4AHVA 3HPHA 3WQTA 1HMVA 3ENHA 2E8AA 3VEYA 3L2WA 3HJFA 3NH2A 4DQIA 1EO1A 3BZCA 1CXQA 4U7BA 3CI5A 4BR5A 4IFVA 3AVHA 4CZJA 4JNEA 5T7BA 3DLKA 1LWCA 5KQ8A 4YOTA 4IZ9A 3ITHA 2YNHA 4CW7B 3C7NB 3SK3A 1JKHA 2VQFK 3O9UA 1TYQA 2HW3A 4CEOA 1EQYA 2E6MA 4BC2A 1Q18A 1D9FA 4MO4A 5C25A 4Q0BA 3CIPA 3VPZA 3T1HK 1MWMA 3DXMB 3NFAA 3FGUA 1XNRK 3QBWA 1NGHA 3E66A 3N4PA 4B3SK 1GOAA 1BISA 1S1XA 3FZMA 4WFBL 3H6EA 3M1FA 3MCPA 4CK1A 5GIPA 4XH5A 1HQEA 2HBKA 3IFRA 3QB0A 4CZFA 3HVTA 1Q86O 4DV5K 3H1VX 1Q82O 1U48A 2KKZA 3I33A 4CGJA 4QS8A 2EWSA 1C1AA 1JLEA 2P9SA 4YDUA 4EFHA 4JI7K 4A5BA 4FO0A 4CZLA 1QQOA 4JKCA 2RE2A 2HNYA 3OYGA 3L2RA 2FLOA 3LM9A 1KSPA 1O13A 3PIPL 1VSEA 1BWFO 5AQOA 4NB4A 4CF0A 2VG7A 2D0CA 1VSLA 2WOMA 3UKUA 4IFEA 5M1PA 1EWRA 3AA4A 1I39A 2X74A 3L3VA 4OKEA 3NDKA 1U45A 1RTHA 3DMJA 3CCUN 3CERA 3TSPA 2NRZA 2A6AA 1IKXA 2UUCK 5AZJB 4DF4A 4CHOA 3P4IA 1DT9A 3O4QA 1WBDA 5MLCQ 1P90A 3SV3A 4CGGA 3DLLL 2P1JA 1NK4A 2NRVA 4FVMA 2E2OA 5M1KA 4FVUA 3SLCA 3RRGA 4JI3K 3D0PA 2HVIA 1OVYA 1H1VA 4KB0A 4PKIA 3M8SA 4ISFA 4DTXA 1NMNA 3W0LA 1WAFA 3TANA 5A2QO 3C0BA 3L2VA 1T6CA 4OVLA 1D9DA 2UXBK 5M1QA 1RT1A 4F2SA 4O0JA 2OANA 5M1OA 2RN2A 1RTDA 1NWKA 1XHZA 5LJVA 4CD1A 3LWLA 3OYKA 3H3NO 1WSJA 3A5NC 2Y1JA 3MEEA 3I55N 2QWRA 2WFBA 3ZSRA 1NJWA 1TV6A 4EHUA 2RPIA 3HYFA 1B92A 4HTLA 3LDOA 4JK9A 1U04A 5SWMA 3DOKA 3GBTA 3LPUA 1IKWA 4NO7A 3E9PA 2D0BA 4HTUA 2Q36A 1KRPA 3NF7A 3RMDA 5BR9A 4BR0A 3CYMA 4RW9A 3L4IA 2X78A 1DGKN 4E0DA 3C6AA 4DSIA 2P5GA 2P9SB 4B1VA 4PL7A 2F4VK 1VHXA 4C8MA 1A5VA 3CFPA 1RT6A 3VTIA 4JKDA 2VWBA 1RT7A 4WYBA 3DI6A 1ZBSA 4DHYA 4EAHD 2ASMA 5EXWA 5EU7A 5C10A 1HJRA 1KLMA 2HHVA 2FF6A 3AVBA 3UKUB 2NRXA 3VESA 3LL3A 4OGCA 4BR4A 2FBXA 3ZT0A 3NVKA 1HKCA 4BDPA 3TSUA 4GVEA 5HBMA 5C2FA 3KD5E 1G15A 4BRCA 1N32K 3MCAB 5KGXA 3THXA 4KTQA 3PLAA 4M3ZA 4NCAA 3JXUA 4CJPA 1JJ2M 5FPNA 1OKJA 3AVAA 4B9VA 3O9SA 3KK1A 3ZEUB 1GLEG 4MLEA 4FJLA 4OPKA 4AILC 3V81A 5KPRA 4J2EA 3MN9A 4AH9A 4K43A 1S9EA 1YHQN 4JS5A 2G8UA 4IOXA 4AHUA 4E1NA 1YUWA 4A2AA 2G8VA 1ZYQA 4Z4IA 4DSKA 4JI1K 1WN7A 3LANA 1VRUA 1QVGM 3U3YA 3VA3A 1ZBIA 3KLEA 5ADXH 2YJEA 3UKRA 1LWEA 5B8HA 1RBSA 5KTQA 1IBMK 3VQQA 2WTUA 3CCQN 4BWMA 1VAZA 2I5JA 2W40A 3OYIA 3BY5A 1FXXA 3TTCA 4B1ZA 1RT3A 2IS3A 1VSMA 1WAJA 4BDZA 1N6QA 3U3GA 4ILHA 2QKBA 2DY4A 3KZBA 5AR0A 3MXJA 4BRHA 3QDKA 3BEXA 4H0XB 2QK9A 4LF6K 4W5OA 2OZSA 4GKKK 3HM8A 1HQUA 3PIOL 2KFNA 3ZSVA 2IVNA 3NBPA 4CGFA 1I94K 1VQ8N 3KKSA 1L5UA 3F73A 4JHDB 4WQ5C 5K14A 4X66K 3KLHA 3H45C 4KTZA 3G10A 1WSIA 4FLVA 1BA0A 1HNXK 2A42A 4KPYA 3J7AP 3VN5A 4DQRA 3CM6A 3A2FA 5CZ1A 3VF4A 3OYDA 1VSJA 4A59A 3W3DA 1U49A 3EKSA 1F21A 3QLHA 2UXCK 1SL0A 4KHYA 3PX4A 3NH0A 1IG8A 5IT9O 3HP9A 4W5RA 1SKSA 2QI2A 4BRAA 2HF4A 4ZTFA 1L3SA 5EX5A 3PO4A 5J1EA 4JKEA 1KVCA 5CZ2A 4JKFA 4DV0K 2NNWA 4DR7K 4WQ4C 2ATQA 2NRHA 2KZZA 3K58A 4M3XA 1IG9A 4BE1A 4GV9A 4CK2A 2ASOA 1X9MA 3AVNA 4A2BA 1VSKA 4E7IA 4DFKA 4NYNA 1WUAA 1VQKN 3P83D 3ZSWA 3QEPA 4EP4A 4CEFA 2E20A 1GLJO 3RR8A 5TKYA 2W42A 3AA2A 3CD6N 3KLFA 3L2QA 2G8IA 2KFZA 1X9JA 4AQYK 1QZ6A 3M6GA 3NGYA 2PY5A 2D0OA 4MDBA 2BH1A 4CZHA 5GAHP 2F7TA 3VQCA 4KHSA 5KGWA 5JICA 3EYZA 1X9SA 2X6NA 4AHSA 5H1SQ 3TARA 5BPNA 3K5MA 4FJKA 4OKKA 4YNQA 3KJVA 2O8EA 3RSEA 3MEDA 5CY4A 3WXIA 1NGFA 5BR8K 4JK7A 1RCHA 4FLZA 1EXQA 3K0SA 3QO9A 1GLBG 4ID1A 3DYAA 4DLEA 4FOEA 2P9KA 4C23A 4IO8A 5BN9A 2GUIA 1NOYA 3O3GA 3UE5A 4YOYA 3KK7A 4BC5A 4GV3A 1RBUA 3VEXA 5FPEA 2D0PA 2HF3A 3G25A 4M63C 4CEEA 2RHKA 4O0IA 4H5RA 3VQ6A 4DUZK 3OYBA 1D4XA 4HVJA 2LSNA 1IO2A 5AQPA 1HX1A 4GMJB 3VQ8A 5HP1A 4XEIA 3RWUA 3T7ZA 1S1WA 3OA9A 1KVAA 3WT0A 1GLFO 4NXMK 3SV4A 3SYZA 4CJVA 1HNWK 2BUPA 3KKRA 4C8NA 3U9ZA 3AA5X 3OY9A 4WCEL 3TPQA 1TK5A 3ZT3A 2YKNA 1XC9A 4KKOA 2GX9A 4HUGA 4CJKA 1SKWA 3R1XA 1L3VA 4BRDA 4DR2K 3O3HA 4E1JA 3ASMA 4DTRA 3NGIA 1NNEA 4WQ5A 5D3GA 3IRXA 4CFCA 3T19A 3VEZA 2FXUA 2P9UA 4Z94A 4K0KK 3MDQA 2BDPA 4YHHK 3H08A 4I7FA 3QIOA 2E88A 5AQJA 3V1OA 1WOQA 1GLDG 3IAYA 4DMNA 1IBLK 1T7PA 1XHXA 4G1QA 4CJQA 1QVFM 4W5TA 4BVOA 1RFQA 3MX5A 2YHBA 4FZYA 3L3UA 4BQZA 2WUSA 4DTMA 3M8PA 4B1UB 1LCUA 3OS0A 4CJWA 1TAUA 4LH4A 1OH7A 4FJ7A 3THVA 4N76A 3J81O 1BUPA 1NBWA 2QWMA 4I6MA 2IC3A 4FLUA 4BC4A 4IDKA 4YY3K 1L3TA 4YOWA 4H03B 1VSIA 5ELZA 4EZ6A 5AQZA 5BPLA 5FDLA 3SI6A 2Q0UA 3DOLA 2OYQA 1T8EA 4E7HA 4DSEA 2Q3SA 1HJOA 3EEQA 3TAEA 4B9NA 3CPWM 1YF5L 4FWRA 4DR1K 4E7JA 4JV5K 3HO1A 3TI0A 1WSHA 3JYTA 5GINA 4KRFA 2WC9A 4KHPK 3SAGA 1YVUA 3AVJA 2GUPA 3D45A 2O8EB 3RSEB 1V4SA 3IS9A 1VSDA 5J2QA 4CBUA 2ZM6K 1W7AA 1S1VA 4CJ5A 4JI2K 3CJBA 3IG1A 4IXCA 2F8TA 3DXKA 3VTHA 2FBTA 4KH4A 2JWLA 5AQVA 3TSQA 4AM6A 4R79A 5C2DA 1SUQA 3VQAA 3LP2A 4K41A 3E9LA 2IVOA 1R59O 5CE3A 4CHYA 4FJJA 3F2KA 2Z1IA 3THWA 4FXDA 3PUFA 4BC3A 1NKEA 1IJJA 1NJIO 1QE1A 4MFBA 4BRPA 3HOTA 4F2RA 2UYTA 3NCIA 3HPOA 5KPTA 2X6SA 3CC2N 3OJSA 4OGEA 2QXFA 2HBLA 3KVGA 4PA1A 4DWIA 4ELVA 4IKFA 4JI5K 1BIZA 3LDSA 1ASVA 3DRSA 1NK8A 3BF3A 1YAGA 1TL1A 4LC9B 4CFBA 1KAYA 4DTNA 3F9KA 3MAQA 1K8KA 1TAQA 3PSFA 4CJRA 3EN9A 1RT4A 4KAZA 4FL9A 4JKAA 3QESA 3NE6A 2GWKA 1TKXA 3CHWA 1S6PA 3KWIA 4DKWA 3SQ2A 3AGKA 4BGAA 3RR7A 3O3FA 1K8AO 1N5YA 3SMSA 1N33K 4OPHA 4JKGB 1C0GA 4Y1CA 1VSHA 2ZJRL 3M3ZA 4BE0A 2I7PA 3DAWA 1ASUA 1NK0A 1KTQA 1S1UA 1KQSM 4M3YA 4MLHA 4I6MB 1VQON 1QHTA 4CF8A 2FBYA 1Z26A 4LSNA 2YNGA 1RTJA 3V9WA 4M7YA 4LFBK 4DV2K 1QQNA 2XY7A 5E41A 3IUCA 2NRRA 2R7YA 4F8RA 1C0MA 1HUXA 4CZEA 3DLEA 3H1QA 4OLAA 4J8FA 3QFPA 1GLAG 3KK2A 4M3WA 3H46O 4UQGA 4EZ9A 4DV7K 2YHXA 5AQKA 4YFUA 4BRMA 3CC7N 3GG4A 4BY9C 4M7XA 2HVHA 4IWVA 3TR8A 4YOXA 2HHUA 3LWMA 5DK5A 3VGKA 4FWQA 4CGDA 1D8YA 1S3XA 1B9FA 1SL2A 2YI1A 1N36K 3A5MC 2QWNA 1UA1A 2YKMA 4LH5A 2OPQA 5GIOA 3ULEB 5JVGL 1SL1A 4NLCA 1ESVA 3VQ5A 3NF6A 1OH5A 3AV9A 3RMBA 3VF6A 3CCEN 3KIOA 1QQCA 2E6LA 1BCMA 1UAXA 3AVGA 4DV1K 3BP8A 4NXNK 3HRGA 4DS5A 4GY2B 4KHWA 3HSCA 4AF1A 4DU4A 1RDBA 1TYQB 1W0HA 1K8KB 4Z0UA 5AQMA 3LZIA 2QWQA 2KZMA 3QFUA 3ENOA 1YVNA 1QSLA 1J9AA 3CQXA 3K5LA 4B08A 1JLFA 1J54A 3P31A 5EOYA 3ZX0A 1U47A 1K6YA 4BG8A 4CZMA 2QW9A 1VQ5N 3KLGA 1X1PA 1LAWA 4I2QA 1YI2N 3ZSZA 3C65A 1C1BA 3NMUA 3AY9A 1SV5A 3SZ2A 4FW1A 4F3OA 2G8FA 4DV3K 3CM5A 3NHGA 4DQQA 1NLVA 4ID5A 3I0RA 4F4KA 1RT5A 1NGAA 2P9IA 4HCCA 5FRNA 2VYPA 3NF8A 3HXMA 4CGIA 4FPAA 1EP4A 1QQMA 1U2VA 2F9WA 3OHRA 5DM7L 3GOIA 4ZHRA 1R0AA 4CD3A 4DTOA 3VA0A 3LP1A 2YJFA 1T05A 2QWPA 4KH6A 4OPJA 3THYA 4KI4A 4ICLA 4H4MA 3MXMA 3DLGA 3TWHA 5BPMA 2OPRA 4BG9A 4QCLA 4YORA 3EO3A 2A1SA 3T69A 2BE2A 1GLLO 4CIFA 4BGBA 5CR4A 1KCFA 3PY8A 4F3TA 1ZBHA 2NRWA 3QEXA 3DRPA 1ATRA 5EY4A 4FWKA 3CQ8A 3ENBA 3EE9A 3AARA 4FYDA 3SUPA 2NZTA 3NGZA 2BTFA 4OLBA 5GAGP 2HOEA 2KLAA 1JXBA 3O08A 3SAFA 2PFUA 3SBTA 3A8YA 3O6WA 4EIAA 5IWAK 1HLUA 2AP1A 4K8XA 3QERA 4LSLA 5AQXA 2UUBK 3ZETA 1VQ7N 4LY7A 4DUYK 3WNFA 2H3GX 1CZAN 3SAHA 3QIPA 4N47A 3S3MA 2KHOA 2QEXN 4DTJA 3P39A 2E1YA 3SBGA 5AQYA 3OYHA 4K25A 4FM0A 3ZX2A 1BCOA 2GWJA 2HSTA 3EKUA 4H5WA 4RW8A 1ZBUA 3O4NA 4KH5A 3V1RA 5JLHA 3J80O 1YTAA 4PKHA 3OJUA 1C0TA 4KHQA 3F9MA 2QTDA 1W97L 3RMCA 2E2PA 4DFMA 3TAFA 4LF4K 4CEQA 3KK3A 3TAPA 1OVQA 5FRMA 2ZE2A 1QHAA 3O9RA 4IG3A 2ZQBA 3D2EA 3G71N 4JI0K 1OH6A 4FK4A 4O8UA 3G0ZA 5HLFA 2HHQA 2D4WA 2OZMA 3CMEN 3C95A 1XQSC 1IBKK 4JYAK 3WUHA 1KVBA 4O55A 4HCBA 3WXKA 3WNGA 1T03A 4MQ3A 4B9MA 1U2VB 4O44A 3DJCA 2OPSA 5JLFA 4QOZB 3FZKA 5I3UA 4H8KA 4B9UA 5ADXA 4BACA 4DB3A 3RVCA 3RMAA 1UWBA 3V9XA 1BQMA 3THYB 2Q0RA 1WLJA 3ZYYX 1JL1A 2E2QA 1U4BA 3U9DA 4CEZA 3OYLA 1G99A 1LW0A 2QM1A 4CZGA 2YHYA 1FKOA 1HNIA 5BN8A 5SZTA 3HOSA 1C6VA 2Q31A 3THXB 3RRHA 4PL8A 2XY6A 1FJGK 3BUZB 3FFKB 5JS2A 4UY8O 2OPPA 4BROA 1KAZA 4FJIA 3E9OA 3T1YK 2B6AA 4CEAA 3NAEA 1KC8O 1X9WA 3ZT2A 1XI1A 1QSSA 3QINA 2V7YA 1GOBA 3SCXA 3KD1E 4CJUA 5EVZA 5C42A 3MN6A 3ZETB 2BGGA 4KBOA 4H0PA 1FW6A 4B3MK 1WNSA 2HBMA 4E19A 1T6DA 2YNIA 3QNOA 4CBWA 1D5AA 1J5EK 4U67L 4M3UA 2FBVA 1VRTA 2O8BA 4NCGA 3UKRB 2P9LA 1Y64A 3CFRA 4OKJA 3AO2A 3O1WA 1K73O 1BI4A 4IDHA 5TKWA 3LAMA 4OO1J 1TKDA 2JGUA 1YJ9N 2O8CA 4FJNA 4CERA 3HTVA 2CGLA 3AA3A 4C8OA 2P5OA 3H3OB 1VQNN 2IDOA 3ID8A 3D2EB 4IFYA 2HHXA 4C8KA 4W5QA 4OPAA 1Q9XA 4FWNA 5BRHA 1ZXOA 2KQ2A 3HI0A 3DLRA 4XIUA 5KRSA 1U6ZA 4I2PA 3WQUA 1CLQA 3WEEA 5E26A 1Q9YA 5AZIA 5AQHA 1RTIA 4DCHA 4LFAK 4ELTA 3BDPA 4J2AA 4KHUA 3SQ1A 4FWPA 1HYSA 3CCVN 4V19S 4K8ZA 4M42A 1CXUA 4E7KA 2O8FA 3V9ZA 4DS4A 1J5OA 1W2BM 4GW6A 3OYMA 4B9SA 2HNZA 1HPZA 2VWJA 4HHTA 5AFUH 3C94A 4CGHA 3VQ7A 2HHWA 2RKIA 1JCGA 3WNEA 3VQEA 2XRIA 4H5VA 4BRNA 2VWKA 3VGLA 4FLWA 1SQKA 4PKGA 2ZGZA 4E89A 1HNVA 3CG7A 3CCJN 4JEPA 3MX2A 2XY8A 1YTUA 4DV4K 2WONA 5M1NA 1LOTB 3SPYA 3UIQA 1NK7A 2QKKA 4LF9K 1CZBA 1NGIA 1Z6RA 4RW7A 1QTMA 2FSKA 3MWPA 2NLXA 4IO9L 2GV9A 2CGJA 4CHNA 5CHIA 3VOVA 1A5WA 5AQSA 1FKPA 1TVRA 1TL3A 1DTTA 1LW2A 4MDAA 4CJLA 2G8WA 3AAPA 3B8AX 2O8BB 1YIJN 4Z4GA 3SUNA 1JLQA 2P9LB 3VEVA 5FLXO 3LP3A 3FLCO 4WQ4A 5AQGA 3K59A 2IGIA 1TK0A 3AO3A 3LP0A 3M8RA 3E1YA 3P5JA 2P51A 1EETA 2AJQA 5AQNA 4O4GA 4DU3A 2P9NA 4EHTA 3LDPA 3PV8A 3K5OA 3HVRA 4LFCK 3HK2A 3B6PA 4H5TA 4CZKA 2OCEA 3OTOK 2IOCA 4CHQA 1Q8IA 3TAGA 3U6FA 1Z25A 2CGKA 4JKBA 2O4IA 2B5JA 4DSLA 1Q7YO 3EE8A 1LWFA 2P9KB 4X64K 4BREA 4BE2A 1YITN 4Y1DA 1NOZA 3SMPA 4A62A 1BGXT 1TUUA 3CJ7A 3VETA 1FK9A 4A5AA 3O80A 3QETA 4WFAL 1BIUA 1KAXA 5AQWA 1O1WA 5AQIA 2D5RA 4KI6A 4CVNE 5AZJA 3OYNA 1C0FA 1ILYA 1TKZA 1GOCA 1ZBLA 3MEGA 4G9ZA 3N4QA 3QEIA 3CETA 3C6TA 5HOOA 3CMAN 4DTPA 3GDQA 4IEIA 3QBXA 4CEBA 3G4SN 3CCLN 2ASPA 4B9QA 4B1YB 3OYCA 5HRRA 3EY1A 3SUQA 3B6OA 3CJAA 4DQ8A 1ITGA 3CFOA 3K2PA 1HRHA 2ZJQL 4JN4A 5HRSA 4NYFA 1YJWN 3TU5A 4DV6K 3L6QA 2P9UB 3ATUA 1IKVA 3ZCMA 4IG0A 2UUAK 5J2NA 4E3SA 3SQ4A 5AQFA 1YT3A 1SZ2A 4BVPA 2E2NA 3JS6A 4I9QA 3IMXA 4RW4A 4DSJA 2DTUA 1SKRA 3ULDA 4DF8A 2YHWA 3M8QA 4DFJA 4JI8K 5AJ3K 2GEMA 3ZX3A 4KB1A 3SUOA 1S5JA 4M41A 3S3NA 4IJNA 3VMFB 2VCPA 5GAEP 2PZSA 1REVA 3AVMA 1VK0A 4R5PA 3ZSQA 1RBRA 3U8XA 4B9LA 1MWKA 3J7YP 1TGOA 4FM2A 4FLYA 3J7ZO 2NRTA 3OBWA 1CZ9A 1X3MA 1VQPN 1C1CA 1NMDA 1P8ZA 3D7EO 4DR6K 3KLIA 3FZFA 4CBXA 3HBTA 1BOTO 3M5RA 4LF8K 2UU9K 2P9NB 4GVMA 4B8CA 1E3MA 1JXEA 4IBNA 4BR7A 4EP5A 3S41A 3V6DA 1ATNA 5AQRA 1S1TA 3V1QA 1N34K 2PBDA 3PO5A 4FWMA 5JMVA 2O8DA 3VEWA 1S72N 3VERA 1XMQK 3DXKB 2G8KA 3TTFA 4CIEA 1JLCA 3SQ0A 2I7NA 1XWLA 4IOCL 4CEDA 4PQUA 4FSVA 3DLHA 2W6LA 2JLEA 1RNHA 3ZSYA 3THWB 3LAKA 1N8RO 4BDYA 2IVPA 4ZTJA 3L4QA 3HM9A 1QS4A 3NVMA 2E5LK 4W5NA 1BQNA 3LM2A 2ZJPL 2DFHA 5KRTA 3SNNA 2PYJA 4XH1A 1XUPO 4B1WB 3ZEUA 3D2FA 2AA4A 3OYJA 1NM1A 2A41A 3ISNC 2CH5A 1M1KO 3WXLA 4CCHA 2A5XA 3K9JA 3HSTB 4ELUA 2GBZA 4H0TB 4CJFA 3V4IA 3ZSXA 3AVLA 1KFDA 1RBVA 4GKJK 3L8BA 3CXCM 2KTQA 3VQPA 3OS2A 3AO4A 3SJHA 3LDNA 4WFNL 4HUEA 2UXDK 3AVKA 1UA0A 5CYMA 4C1NI 2XY5A 4AHCA 4GV6A 2PAVA 3CC4N 2EX3A 3TTDA 3V9UA 4JAXA 4LF7K 1NKBA 3NF9A 3L2UA 4MO5A 4JS4A 5BRDA 1W9HA 1NGEA 3AVFA 3VGMA 3C6UA 5LY3A 1BO5O 1B9DA 3BF1A 3JSMA 3C6HA 2A1RA 3OW2M 2Z1HA 2BANA 2J4RA 3MECA 1WSFA 5KQDA 4Q5VA 1T44A 4JD2A 3VEOA 2P9PA 1S9GA 3A5LC 4Z4CA 4BR2A 3DLBA 4O5FA 1L3UA 3O9TA 3P38A 3CCSN 2NUBA 4IJAA 2DPNA 1KLNA 4CK3A 5FROA 4B3OA 4B8AB 1HNZK 4FWLA 2W6KA 4CZIA 2DFFA 3FZHA 4BR9A 5J2MA 1HPMA 4QS9A 4FPBA 4RWTA 4JHDA 4FJ8A 3O1BA 2CH6A 3AAQA 4KV8A 4CJ4A 3Q7CA 4AM7A 4PHTX 4DR5K 1VQ4N 2YHAA 4KO0A 2O8DB 4C8LA 1ASWA 5LMUK 4FJHA 3K9KA 3MWTA 3CF5L 4DLGA 2VG6A 4LF5K 3KWGA 4X65K 3ID6A 4C1NK 4O8KA 1JLGA 1DTQA 4BWJA 1NGJA 1QZ5A 4O5BA 5LL6Z 1SAZA 3OVNA 1ZBFA 2GTDA 4FZXC 4M45A 1NGCA 3I56N 2HMIA 4BRKA 5GADP 3D2FB 3MMVA 1NJXA 4CF2A 1KXPA 3O9QA 3FZLA 4DR3K 4DTUA 4QAGA 1LV5A 5BREA 4B9TA 4FWSA 4OJRA 1JL2A 4CESA 3WNHA 4N41A 4FLTA 4CECA 2YX6A 3S9HA 1VQ9N 3CCRN 2V51B 1XMOK 5HL7L 4Z4EA 4JI4K 1TUYA 4FWOA 5I9EB 1XNQK 5JS1A 2OTJN 2F9TA 3LALA 4CJ7A 4FOIA 3PSIA 1DEJA 1LAVA 1HR0K 4WE1A 4WF9L 3HL8A 3AO5A 4KHNA 1HYZA 2YNFA 1EWQA 4BRLA 5C24A 4N56A 2A40A 5E84A 2Q97A 4JRPA 4CF1A 2PYLA 5C15A 2P9IB 4Z4HA 2YV0X 1Y97A 4JD2B 3CJ9A 4HUFA 4IOAL 1NGDA 1RDAA 2P9PB 3JAMO 1NKCA 3VQ9A 1GLCG 3OYFA 3GE1A 1RDWX 2VGNA 4FJ9A 4YOUA 4ILGB 2IIRA 5FPMA 4ILJA 4FW2A 4Y0WA 4CF9A 3LPTA 3SPZA 3LDLA 4H0YB 2B4JA 1VSFA 3A5OC 4A61A 1HKBA 3HT3A 4XH4A 5BRFA 2Z1JA 4CHZA 4CJTA 1DKGD 4DFPA 1NK9A 4QS7A 3D6RA 1MA9B 3VQ4A 3WXJA 3GL1A 4DTSA 5HROA 1EX4A 3PX6A 3ZT4A 1E4FT 2XHBA 3LDQA 4X62K 3KTQA 1RDDA 1A5XA 1TK8A 2ZF5O 3MN7A 2G8HA 3V9SA 2O4GA 2WBNA 3Q7BA 2VG5A 2ITMA 2QA4N 2OA8A 3AVCA 5C12A 1BU6O 3OBYA 1JLAA 3RTVA 1Q81O 4KREA 5LMNK 2FSJA 4CIGA 5AQUA 3G6EN 3OYEA 2F96A 4H4OA 1UOCA 3I8BA 1X3NA 2OTLN 1MDUB 3QEVA 4CJSA 3QEWA 5F0XA 1NGGA 3MXIA 4CJ3A 2V7ZA 4B3RK 5KI6A 5F1XA 4N5SA 4FK2A 5LJWA 2VQEK 4CJEA 5FPDA 1BDGA 1RDCA 3AO1A 2E4LA 2Q1NA 1NJZA 2YCHA 1BA1A 5F2RA 1NG9A 1RDUA 3R6MA 1ATSA 1HKGA 3FFIA 2V52B 3CCMN 3NH1A 4DQPA 4FLXA 4BRGA 1BHLA 5AQLA 3R3LA 2ZD1A 3SJJA 4L3QA 1MU2A 4DG1A 1SS6A 4JK8A 4DR4K 4DU1A 3CJ1A 1HYVA 4CHPA 1EKEA 5DMRA 2DFEA 3PX0A 4FCYA 1J53A 4FM1A 1C0UA 2Z1GA 1VQLN 3U4LA 3T3FA 4BRQA 4CE9A 4KFBA 1IV0A 5JVHL 4BRFA 3K57A 3LZJA 4FJMA 4PUOA 4CFDA 1RT2A 3AGRA 4LD0A 3UB5A 3O5BA 4AHRA 3EZ5A 2QWOA 4AHTA 3MN5A 2JWKA 5HRNA 1J6ZA 3CPEA 3OYAA 1DLOA 3P1GA 3T1AA 4F9OA 3O4WA 4ISGA 3HP6A 4JKHA 1V4TA 1XC3A 2VGMA 3I8DA 2HBJA 3O8MA 1NK6A 3QNNA 4YOVA 1WSEA 4RW6A 4J2DA 2QWLA 4H5NA 3HPGA 3IKMA 4DSFA 4FJGA 2HHTA 3DM2A 2HMPA 3DWLA 4Z4FA 3QMLA 3ZT1A 1BG3A 5AQQA 2ETJA 1JCFA 2D1KA 2GELA 1ZC6A 1QSYA 3TAQA 1JCEA 2HHSA 1RBTA 5J2PA 2HNDA 5DM6L 1IKYA 4RTFD 4K42A 4GNIA 1YJNN 4YDUC 4NCBA 3KHYA 3C7NA 2HHHK 3TAMA 4J2BA 1JLBA 4JI6K
chains in the Genus database with same CATH topology
4DTOA 4E7LA 3VA0A 4B9LA 1KFSA 1TGOA 3LP1A 4FLYA 4FM2A 1T05A 2OYQA 4ZTFA 1L3SA 4K8ZA 1CZ9A 2IAJA 4FJ5A 4I9LA 1C1CA 4OPJA 4KI4A 4ICLA 3PO4A 5J1EA 3I0SA 1KVCA 5CZ2A 4H4MA 2EHGA 3MXMA 3DLGA 3KLIA 3TWHA 4JLHA 4RG8A 2ATQA 2OPRA 3ZSOA 3S3OA 2KZZA 1BI4B 4L8RB 4QCLA 4FJXA 3K58A 2F8SA 2A1SA 1NJYA 1IH7A 4GVMA 4B8CA 4M3XA 2BE2A 1JXEA 5HRPA 1IG9A 4IBNA 5CYQA 2RF2A 3ALYA 4CIFA 4BE1A 4CK2A 3PY8A 1KCFA 4F3TA 4EP5A 1ZBHA 3QEXA 3DRPA 4TSXA 1X9MA 3AVNA 4KI6A 3V6DA 3CQ8A 1VSKA 3DRRA 1S1TA 4E7IA 3V1QA 4DFKA 4FYDA 3SUPA 4NYNA 3NGZA 3P83D 3ZSWA 3QEPA 3PO5A 4OLBA 1JXBA 4EP4A 4PY5A 4CEFA 1I3AA 2G8KA 4CIEA 3VQBA 1JLCA 4K8XA 3SQ0A 4E1MA 3QERA 4LSLA 1XWLA 3OS1A 4CEDA 4PQUA 3RR8A 3DLHA 2W42A 3AA2A 1TKTA 4LY7A 2JLEA 1RNHA 3WNFA 3ZSYA 1NK5A 3KLFA 3L2QA 3LAKA 2G8IA 2KFZA 4DQSA 3QIPA 4N47A 3S3MA 3NGYA 4BDYA 4ZTJA 4DTJA 2PY5A 3HM9A 1QS4A 4PWDA 3OYHA 4W5NA 4FM0A 1BQNA 2KW4A 2DFHA 5KRTA 1BCOA 3SNNA 2PYJA 4FK0A 4RW8A 1ZBUA 3O4NA 3VQCA 3BGRA 4KHSA 2D0AA 3VQDA 3AVIA 1WSGA 4KTWA 5KGWA 3V1RA 2FC0A 1YTAA 3EYZA 1X9SA 2X6NA 4AHSA 3OYJA 3OJUA 2ITGA 4M3TA 3TARA 1C0TA 4KHQA 3K5MA 4FJKA 2HB5A 4OKKA 4M3RA 4YNQA 3K5NA 3RMCA 3ISNC 4DFMA 3TAFA 3KJVA 4CCHA 4FZZA 3E01A 3HSTB 4CEQA 3MEDA 2Y1IA 4ELUA 5CY4A 3KK3A 3TAPA 2GBZA 5FRMA 4CJFA 1S6QA 1RCHA 3ZSXA 3AVLA 2ZE2A 3V4IA 1KFDA 4FLZA 1EXQA 5I42A 1RBVA 4IG3A 2ZQBA 4CFAA 3L8BA 3QO9A 4ID1A 2XO7A 3DYAA 4JRQA 3VQPA 4DLEA 3TABA 2KTQA 1RILA 1BL3A 3OS2A 3AO4A 4AHVA 2GUIA 3HPHA 3O3GA 1NOYA 1HMVA 4FK4A 4HUEA 3AVKA 1RBUA 3G0ZA 5HLFA 1UA0A 2HHQA 5CYMA 3L2WA 4CEEA 4AHCA 3NH2A 4O0IA 2XY5A 3C95A 2OZMA 4DQIA 3HJFA 3VQ6A 3OYBA 1CXQA 2EX3A 4IFVA 1KVBA 2LSNA 3AVHA 1IO2A 4O55A 4GMJB 4HVJA 3NF9A 5T7BA 3DLKA 3L2UA 3VQ8A 1LWCA 5HP1A 1NKBA 4JS4A 3WNGA 1T03A 4MQ3A 3RWUA 1S1WA 4B9MA 1KVAA 3ITHA 3SV4A 3SYZA 1W9HA 3AVFA 4CJVA 2YNHA 3C6UA 3KKRA 4O44A 4C8NA 1B9DA 1JKHA 2OPSA 3AA5X 4QOZB 3OY9A 3JSMA 5I3UA 2A1RA 4H8KA 2Z1HA 4B9UA 4CEOA 2HW3A 2BANA 4BACA 3MECA 1TK5A 1WSFA 3ZT3A 2YKNA 1XC9A 4KKOA 2E6MA 4Q5VA 4HUGA 3RMAA 1D9FA 4CJKA 1SKWA 1UWBA 3V9XA 5C25A 1L3VA 1S9GA 4Z4CA 4Q0BA 1BQMA 1WLJA 3O3HA 3DLBA 1JL1A 1L3UA 1U4BA 3NFAA 2NUBA 3ASMA 4CEZA 3NGIA 4DTRA 1KLNA 3OYLA 1LW0A 4CK3A 5FROA 4B3OA 5D3GA 1HNIA 1FKOA 3IRXA 4B8AB 4CFCA 5SZTA 1C6VA 3T19A 1GOAA 1BISA 2DFFA 3RRHA 1S1XA 5J2MA 2XY6A 2BDPA 4CK1A 1HQEA 3H08A 4I7FA 4FJ8A 3QIOA 5JS2A 3V1OA 2OPPA 3IAYA 4DMNA 3HVTA 1T7PA 4FJIA 4KV8A 1XHXA 4G1QA 4CJQA 4CJ4A 2B6AA 4CEAA 3NAEA 1U48A 4W5TA 4CGJA 2YHAA 1C1AA 1JLEA 3ZT2A 4KO0A 1XI1A 1X9WA 1QSSA 2YHBA 3QINA 3SCXA 1GOBA 4C8LA 3KD1E 4FZYA 3L3UA 4CJUA 1ASWA 4DTMA 3M8PA 5C42A 3OS0A 2HNYA 3OYGA 4CJWA 3L2RA 1TAUA 4LH4A 4FJHA 4FJ7A 1KSPA 1VSEA 3THVA 4CF0A 4N76A 2VG7A 4DLGA 2BGGA 2D0CA 2VG6A 2IC3A 1WNSA 4FLUA 1VSLA 4E19A 2WOMA 4IDKA 2YNIA 3QNOA 1L3TA 1JLGA 1DTQA 1D5AA 1VSIA 4BWJA 3AA4A 1I39A 4EZ6A 4M3UA 4O5BA 2X74A 5FDLA 3SI6A 2FBVA 3DOLA 1VRTA 1T8EA 3L3VA 3OVNA 4E7HA 1ZBFA 4OKEA 4NCGA 2Q3SA 4DSEA 3TAEA 3NDKA 1U45A 1RTHA 4M45A 4E7JA 4B9NA 3DMJA 4FZXC 3CFRA 3HO1A 4OKJA 3AO2A 3TI0A 1WSHA 2HMIA 3JYTA 1IKXA 4DF4A 1NJXA 4KRFA 1BI4A 4CHOA 4CF2A 3O4QA 3LAMA 1TKDA 2JGUA 4DTUA 3SV3A 4QAGA 4CGGA 1YVUA 3AVJA 3D45A 4CERA 2P1JA 1LV5A 4FJNA 1NK4A 4FVMA 4B9TA 3IS9A 1VSDA 3AA3A 4OJRA 4CESA 1JL2A 5J2QA 3WNHA 2P5OA 3RRGA 4C8OA 3D0PA 1S1VA 2HVIA 2IDOA 4N41A 4FLTA 4CECA 4KB0A 4CJ5A 3S9HA 4IFYA 3M8SA 2HHXA 4DTXA 4C8KA 4W5QA 1Q9XA 4Z4EA 3IG1A 2F8TA 2FBTA 5JS1A 2KQ2A 1WAFA 3TANA 3DLRA 3LALA 1SUQA 3VQAA 3L2VA 4XIUA 3LP2A 5KRSA 4I2PA 1CLQA 1LAVA 4OVLA 1D9DA 4CHYA 4FJJA 1Q9YA 4WE1A 3HL8A 2Z1IA 1RTIA 3AO5A 4KHNA 1HYZA 4FXDA 2YNFA 1SKSA 4ELTA 1RT1A 3PUFA 1NKEA 4F2SA 1QE1A 4O0JA 4MFBA 5C24A 4N56A 4F2RA 3NCIA 2RN2A 3HPOA 1RTDA 3BDPA 4J2AA 1XHZA 3LWLA 2X6SA 4KHUA 3OYKA 3SQ1A 1WSJA 3OJSA 4OGEA 2QXFA 4CF1A 4JRPA 2Y1JA 3MEEA 2PYLA 1HYSA 4PA1A 2YV0X 4Z4HA 4DWIA 1Y97A 4ELVA 4IKFA 1BIZA 1CXUA 3LDSA 4HUFA 4E7KA 1RDAA 4M42A 1ASVA 3DRSA 3V9ZA 3V9UA 4DS4A 3ZSRA 1J5OA 4GW6A 1NK8A 1NJWA 1TV6A 1NKCA 3VQ9A 3OYFA 3OYMA 4B9SA 2HNZA 2RPIA 1TL1A 1HPZA 3HYFA 4CFBA 2VWJA 1B92A 4HHTA 1U04A 5SWMA 3C94A 4FJ9A 4CGHA 3VQ7A 4DTNA 2HHWA 3F9KA 2RKIA 3DOKA 1TAQA 4CJRA 3MAQA 1RT4A 4FW2A 4CF9A 3LPTA 3SPZA 4KAZA 3WNEA 3LPUA 3QESA 1IKWA 2B4JA 1VSFA 2D0BA 3NE6A 4HTUA 1TKXA 1KRPA 1S6PA 3NF7A 3VQEA 2XRIA 3RMDA 3HT3A 3SQ2A 2VWKA 2Z1JA 4FLWA 3CYMA 4RW9A 4CHZA 3O3FA 4CJTA 3RR7A 1N5YA 4DFPA 2X78A 1NK9A 4E0DA 4E89A 1HNVA 3CG7A 3VQ4A 5HROA 4DSIA 4DTSA 2P5GA 1EX4A 3PX6A 3ZT4A 2XY8A 2XHBA 1YTUA 4Y1CA 2WONA 3KTQA 1RDDA 1A5XA 1A5VA 1VSHA 4C8MA 3CFPA 3SPYA 1TK8A 2G8HA 1RT6A 3V9SA 2O4GA 1RT7A 4BE0A 3DI6A 3UIQA 1ASUA 2VG5A 2OA8A 1NK0A 1KTQA 1NK7A 1S1UA 3AVCA 1CZBA 2QKKA 4M3YA 4RW7A 1QTMA 1JLAA 5EU7A 1HJRA 1QHTA 3RTVA 1KLMA 4KREA 2GV9A 2HHVA 4CIGA 4CHNA 1A5WA 3OYEA 3AVBA 1FKPA 1TVRA 2F96A 1TL3A 4H4OA 4OGCA 1DTTA 1UOCA 2FBYA 1LW2A 4CF8A 4CJLA 2G8WA 1Z26A 2FBXA 3ZT0A 4LSNA 4Z4GA 3QEVA 4BDPA 2YNGA 3SUNA 1JLQA 1RTJA 5HBMA 3V9WA 3KD5E 4CJSA 1G15A 3LP3A 2XY7A 3QEWA 5E41A 5KGXA 3MXIA 4CJ3A 2R7YA 5KI6A 4N5SA 4F8RA 3K59A 4KTQA 2IGIA 1TK0A 1C0MA 4NCAA 4FK2A 4CJEA 4M3ZA 3DLEA 4OLAA 4CJPA 3AO3A 3KK2A 4M3WA 3AVAA 3LP0A 1RDCA 4B9VA 3AO1A 3M8RA 4UQGA 2E4LA 3P5JA 2P51A 1EETA 1NJZA 4EZ9A 3KK1A 2AJQA 4O4GA 4DU3A 4YFUA 4FJLA 3PV8A 4OPKA 3FFIA 3K5OA 3HVRA 3NH1A 4AILC 4DQPA 3V81A 3HK2A 4FLXA 4J2EA 2HVHA 3B6PA 4AH9A 3TR8A 2IOCA 1S9EA 4CHQA 4JS5A 1BHLA 1Q8IA 3TAGA 2HHUA 2ZD1A 3U6FA 3LWMA 2G8UA 1Z25A 5DK5A 3SJJA 4CGDA 1MU2A 4DG1A 2O4IA 1D8YA 4DU1A 2B5JA 1HYVA 1B9FA 4AHUA 4CHPA 1SL2A 1EKEA 4DSLA 4E1NA 1UA1A 1LWFA 2G8VA 2YKMA 4LH5A 2OPQA 4BE2A 4Y1DA 1NOZA 1ZYQA 5DMRA 2DFEA 4Z4IA 1BGXT 3PX0A 1SL1A 4DSKA 4FCYA 1J53A 1WN7A 4FM1A 1C0UA 3LANA 1FK9A 1VRUA 3QETA 3U3YA 2Z1GA 3T3FA 3VA3A 1ZBIA 3VQ5A 4CE9A 3KLEA 1BIUA 3NF6A 4KFBA 3AV9A 3RMBA 3KIOA 1QQCA 1LWEA 1O1WA 2E6LA 2D5RA 1RBSA 1BCMA 5KTQA 3VQQA 3K57A 3LZJA 4FJMA 1UAXA 4BWMA 4CFDA 3OYNA 1RT2A 2I5JA 3AVGA 4PUOA 4LD0A 3OYIA 1TKZA 1FXXA 1GOCA 4AHRA 3EZ5A 4DS5A 4KHWA 1RT3A 1ZBLA 2IS3A 4AHTA 3MEGA 4DU4A 1RDBA 5HRNA 3OYAA 1DLOA 1VSMA 1W0HA 3QEIA 1WAJA 4Z0UA 3C6TA 4BDZA 3P1GA 1N6QA 3T1AA 3LZIA 4DTPA 3HP6A 3U3GA 2KZMA 2QKBA 4CEBA 2DY4A 3EY1A 3OYCA 5HRRA 3SUQA 3B6OA 1QSLA 3I8DA 1ITGA 3CFOA 1J9AA 3MXJA 3K2PA 4J2DA 1NK6A 3K5LA 4B08A 2QK9A 1HRHA 3QNNA 1WSEA 1JLFA 4RW6A 4W5RA 4W5OA 2OZSA 1J54A 4DSFA 3HPGA 4FJGA 4HCBA 1HQUA 5HRSA 1U47A 2HHTA 3DM2A 4NYFA 1K6YA 4Z4FA 2KFNA 3KLGA 3ZSVA 1X1PA 3ZT1A 3NBPA 4CGFA 1LAWA 1IKVA 3KKSA 3ZCMA 1L5UA 3F73A 4IG0A 4I2QA 5J2NA 5K14A 3ZSZA 4E3SA 3SQ4A 1YT3A 1C1BA 2ETJA 3KLHA 1SV5A 3SZ2A 4I9QA 4FW1A 4KTZA 3G10A 1WSIA 1QSYA 4FLVA 3TAQA 4F3OA 4RW4A 2G8FA 4DSJA 4KPYA 3VN5A 4DQRA 2HHSA 2DTUA 3CM5A 3CM6A 3NHGA 3ULDA 1SKRA 3A2FA 5CZ1A 4DQQA 4DF8A 4ID5A 3M8QA 1RBTA 3I0RA 4DFJA 1RT5A 5J2PA 4F4KA 2HNDA 3OYDA 4HCCA 1VSJA 5FRNA 4KB1A 3SUOA 1S5JA 1IKYA 4M41A 3NF8A 3HXMA 3S3NA 1U49A 4CGIA 1F21A 4NCBA 1EP4A 3QLHA 2PZSA 1REVA 3AVMA 1VK0A 1SL0A 3TAMA 4KHYA 3PX4A 3NH0A 4ZHRA 4J2BA 1JLBA 1R0AA 4R5PA 3HP9A 3ZSQA 1RBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DTO A;  4E7L A;  3VA0 A;  4B9L A;  1KFS A;  1TGO A;  3LP1 A;  4FLY A;  4FM2 A;  1T05 A;  2OYQ A;  4ZTF A;  1L3S A;  4K8Z A;  1CZ9 A;  2IAJ A;  4FJ5 A;  4I9L A;  1C1C A;  4OPJ A;  4KI4 A;  4ICL A;  3PO4 A;  5J1E A;  3I0S A;  1KVC A;  5CZ2 A;  4H4M A;  2EHG A;  3MXM A;  3DLG A;  3KLI A;  3TWH A;  4JLH A;  4RG8 A;  2ATQ A;  2OPR A;  3ZSO A;  3S3O A;  2KZZ A;  1BI4 B;  4L8R B;  4QCL A;  4FJX A;  3K58 A;  2F8S A;  2A1S A;  1NJY A;  1IH7 A;  4GVM A;  4B8C A;  4M3X A;  2BE2 A;  1JXE A;  5HRP A;  1IG9 A;  4IBN A;  5CYQ A;  2RF2 A;  3ALY A;  4CIF A;  4BE1 A;  4CK2 A;  3PY8 A;  1KCF A;  4F3T A;  4EP5 A;  1ZBH A;  3QEX A;  3DRP A;  4TSX A;  1X9M A;  3AVN A;  4KI6 A;  3V6D A;  3CQ8 A;  1VSK A;  3DRR A;  1S1T A;  4E7I A;  3V1Q A;  4DFK A;  4FYD A;  3SUP A;  4NYN A;  3NGZ A;  3P83 D;  3ZSW A;  3QEP A;  3PO5 A;  4OLB A;  1JXB A;  4EP4 A;  4PY5 A;  4CEF A;  1I3A A;  2G8K A;  4CIE A;  3VQB A;  1JLC A;  4K8X A;  3SQ0 A;  4E1M A;  3QER A;  4LSL A;  1XWL A;  3OS1 A;  4CED A;  4PQU A;  3RR8 A;  3DLH A;  2W42 A;  3AA2 A;  1TKT A;  4LY7 A;  2JLE A;  1RNH A;  3WNF A;  3ZSY A;  1NK5 A;  3KLF A;  3L2Q A;  3LAK A;  2G8I A;  2KFZ A;  4DQS A;  3QIP A;  4N47 A;  3S3M A;  3NGY A;  4BDY A;  4ZTJ A;  4DTJ A;  2PY5 A;  3HM9 A;  1QS4 A;  4PWD A;  3OYH A;  4W5N A;  4FM0 A;  1BQN A;  2KW4 A;  2DFH A;  5KRT A;  1BCO A;  3SNN A;  2PYJ A;  4FK0 A;  4RW8 A;  1ZBU A;  3O4N A;  3VQC A;  3BGR A;  4KHS A;  2D0A A;  3VQD A;  3AVI A;  1WSG A;  4KTW A;  5KGW A;  3V1R A;  2FC0 A;  1YTA A;  3EYZ A;  1X9S A;  2X6N A;  4AHS A;  3OYJ A;  3OJU A;  2ITG A;  4M3T A;  3TAR A;  1C0T A;  4KHQ A;  3K5M A;  4FJK A;  2HB5 A;  4OKK A;  4M3R A;  4YNQ A;  3K5N A;  3RMC A;  3ISN C;  4DFM A;  3TAF A;  3KJV A;  4CCH A;  4FZZ A;  3E01 A;  3HST B;  4CEQ A;  3MED A;  2Y1I A;  4ELU A;  5CY4 A;  3KK3 A;  3TAP A;  2GBZ A;  5FRM A;  4CJF A;  1S6Q A;  1RCH A;  3ZSX A;  3AVL A;  2ZE2 A;  3V4I A;  1KFD A;  4FLZ A;  1EXQ A;  5I42 A;  1RBV A;  4IG3 A;  2ZQB A;  4CFA A;  3L8B A;  3QO9 A;  4ID1 A;  2XO7 A;  3DYA A;  4JRQ A;  3VQP A;  4DLE A;  3TAB A;  2KTQ A;  1RIL A;  1BL3 A;  3OS2 A;  3AO4 A;  4AHV A;  2GUI A;  3HPH A;  3O3G A;  1NOY A;  1HMV A;  4FK4 A;  4HUE A;  3AVK A;  1RBU A;  3G0Z A;  5HLF A;  1UA0 A;  2HHQ A;  5CYM A;  3L2W A;  4CEE A;  4AHC A;  3NH2 A;  4O0I A;  2XY5 A;  3C95 A;  2OZM A;  4DQI A;  3HJF A;  3VQ6 A;  3OYB A;  1CXQ A;  2EX3 A;  4IFV A;  1KVB A;  2LSN A;  3AVH A;  1IO2 A;  4O55 A;  4GMJ B;  4HVJ A;  3NF9 A;  5T7B A;  3DLK A;  3L2U A;  3VQ8 A;  1LWC A;  5HP1 A;  1NKB A;  4JS4 A;  3WNG A;  1T03 A;  4MQ3 A;  3RWU A;  1S1W A;  4B9M A;  1KVA A;  3ITH A;  3SV4 A;  3SYZ A;  1W9H A;  3AVF A;  4CJV A;  2YNH A;  3C6U A;  3KKR A;  4O44 A;  4C8N A;  1B9D A;  1JKH A;  2OPS A;  3AA5 X;  4QOZ B;  3OY9 A;  3JSM A;  5I3U A;  2A1R A;  4H8K A;  2Z1H A;  4B9U A;  4CEO A;  2HW3 A;  2BAN A;  4BAC A;  3MEC A;  1TK5 A;  1WSF A;  3ZT3 A;  2YKN A;  1XC9 A;  4KKO A;  2E6M A;  4Q5V A;  4HUG A;  3RMA A;  1D9F A;  4CJK A;  1SKW A;  1UWB A;  3V9X A;  5C25 A;  1L3V A;  1S9G A;  4Z4C A;  4Q0B A;  1BQM A;  1WLJ A;  3O3H A;  3DLB A;  1JL1 A;  1L3U A;  1U4B A;  3NFA A;  2NUB A;  3ASM A;  4CEZ A;  3NGI A;  4DTR A;  1KLN A;  3OYL A;  1LW0 A;  4CK3 A;  5FRO A;  4B3O A;  5D3G A;  1HNI A;  1FKO A;  3IRX A;  4B8A B;  4CFC A;  5SZT A;  1C6V A;  3T19 A;  1GOA A;  1BIS A;  2DFF A;  3RRH A;  1S1X A;  5J2M A;  2XY6 A;  2BDP A;  4CK1 A;  1HQE A;  3H08 A;  4I7F A;  4FJ8 A;  3QIO A;  5JS2 A;  3V1O A;  2OPP A;  3IAY A;  4DMN A;  3HVT A;  1T7P A;  4FJI A;  4KV8 A;  1XHX A;  4G1Q A;  4CJQ A;  4CJ4 A;  2B6A A;  4CEA A;  3NAE A;  1U48 A;  4W5T A;  4CGJ A;  2YHA A;  1C1A A;  1JLE A;  3ZT2 A;  4KO0 A;  1XI1 A;  1X9W A;  1QSS A;  2YHB A;  3QIN A;  3SCX A;  1GOB A;  4C8L A;  3KD1 E;  4FZY A;  3L3U A;  4CJU A;  1ASW A;  4DTM A;  3M8P A;  5C42 A;  3OS0 A;  2HNY A;  3OYG A;  4CJW A;  3L2R A;  1TAU A;  4LH4 A;  4FJH A;  4FJ7 A;  1KSP A;  1VSE A;  3THV A;  4CF0 A;  4N76 A;  2VG7 A;  4DLG A;  2BGG A;  2D0C A;  2VG6 A;  2IC3 A;  1WNS A;  4FLU A;  1VSL A;  4E19 A;  2WOM A;  4IDK A;  2YNI A;  3QNO A;  1L3T A;  1JLG A;  1DTQ A;  1D5A A;  1VSI A;  4BWJ A;  3AA4 A;  1I39 A;  4EZ6 A;  4M3U A;  4O5B A;  2X74 A;  5FDL A;  3SI6 A;  2FBV A;  3DOL A;  1VRT A;  1T8E A;  3L3V A;  3OVN A;  4E7H A;  1ZBF A;  4OKE A;  4NCG A;  2Q3S A;  4DSE A;  3TAE A;  3NDK A;  1U45 A;  1RTH A;  4M45 A;  4E7J A;  4B9N A;  3DMJ A;  4FZX C;  3CFR A;  3HO1 A;  4OKJ A;  3AO2 A;  3TI0 A;  1WSH A;  2HMI A;  3JYT A;  1IKX A;  4DF4 A;  1NJX A;  4KRF A;  1BI4 A;  4CHO A;  4CF2 A;  3O4Q A;  3LAM A;  1TKD A;  2JGU A;  4DTU A;  3SV3 A;  4QAG A;  4CGG A;  1YVU A;  3AVJ A;  3D45 A;  4CER A;  2P1J A;  1LV5 A;  4FJN A;  1NK4 A;  4FVM A;  4B9T A;  3IS9 A;  1VSD A;  3AA3 A;  4OJR A;  4CES A;  1JL2 A;  5J2Q A;  3WNH A;  2P5O A;  3RRG A;  4C8O A;  3D0P A;  1S1V A;  2HVI A;  2IDO A;  4N41 A;  4FLT A;  4CEC A;  4KB0 A;  4CJ5 A;  3S9H A;  4IFY A;  3M8S A;  2HHX A;  4DTX A;  4C8K A;  4W5Q A;  1Q9X A;  4Z4E A;  3IG1 A;  2F8T A;  2FBT A;  5JS1 A;  2KQ2 A;  1WAF A;  3TAN A;  3DLR A;  3LAL A;  1SUQ A;  3VQA A;  3L2V A;  4XIU A;  3LP2 A;  5KRS A;  4I2P A;  1CLQ A;  1LAV A;  4OVL A;  1D9D A;  4CHY A;  4FJJ A;  1Q9Y A;  4WE1 A;  3HL8 A;  2Z1I A;  1RTI A;  3AO5 A;  4KHN A;  1HYZ A;  4FXD A;  2YNF A;  1SKS A;  4ELT A;  1RT1 A;  3PUF A;  1NKE A;  4F2S A;  1QE1 A;  4O0J A;  4MFB A;  5C24 A;  4N56 A;  4F2R A;  3NCI A;  2RN2 A;  3HPO A;  1RTD A;  3BDP A;  4J2A A;  1XHZ A;  3LWL A;  2X6S A;  4KHU A;  3OYK A;  3SQ1 A;  1WSJ A;  3OJS A;  4OGE A;  2QXF A;  4CF1 A;  4JRP A;  2Y1J A;  3MEE A;  2PYL A;  1HYS A;  4PA1 A;  2YV0 X;  4Z4H A;  4DWI A;  1Y97 A;  4ELV A;  4IKF A;  1BIZ A;  1CXU A;  3LDS A;  4HUF A;  4E7K A;  1RDA A;  4M42 A;  1ASV A;  3DRS A;  3V9Z A;  3V9U A;  4DS4 A;  3ZSR A;  1J5O A;  4GW6 A;  1NK8 A;  1NJW A;  1TV6 A;  1NKC A;  3VQ9 A;  3OYF A;  3OYM A;  4B9S A;  2HNZ A;  2RPI A;  1TL1 A;  1HPZ A;  3HYF A;  4CFB A;  2VWJ A;  1B92 A;  4HHT A;  1U04 A;  5SWM A;  3C94 A;  4FJ9 A;  4CGH A;  3VQ7 A;  4DTN A;  2HHW A;  3F9K A;  2RKI A;  3DOK A;  1TAQ A;  4CJR A;  3MAQ A;  1RT4 A;  4FW2 A;  4CF9 A;  3LPT A;  3SPZ A;  4KAZ A;  3WNE A;  3LPU A;  3QES A;  1IKW A;  2B4J A;  1VSF A;  2D0B A;  3NE6 A;  4HTU A;  1TKX A;  1KRP A;  1S6P A;  3NF7 A;  3VQE A;  2XRI A;  3RMD A;  3HT3 A;  3SQ2 A;  2VWK A;  2Z1J A;  4FLW A;  3CYM A;  4RW9 A;  4CHZ A;  3O3F A;  4CJT A;  3RR7 A;  1N5Y A;  4DFP A;  2X78 A;  1NK9 A;  4E0D A;  4E89 A;  1HNV A;  3CG7 A;  3VQ4 A;  5HRO A;  4DSI A;  4DTS A;  2P5G A;  1EX4 A;  3PX6 A;  3ZT4 A;  2XY8 A;  2XHB A;  1YTU A;  4Y1C A;  2WON A;  3KTQ A;  1RDD A;  1A5X A;  1A5V A;  1VSH A;  4C8M A;  3CFP A;  3SPY A;  1TK8 A;  2G8H A;  1RT6 A;  3V9S A;  2O4G A;  1RT7 A;  4BE0 A;  3DI6 A;  3UIQ A;  1ASU A;  2VG5 A;  2OA8 A;  1NK0 A;  1KTQ A;  1NK7 A;  1S1U A;  3AVC A;  1CZB A;  2QKK A;  4M3Y A;  4RW7 A;  1QTM A;  1JLA A;  5EU7 A;  1HJR A;  1QHT A;  3RTV A;  1KLM A;  4KRE A;  2GV9 A;  2HHV A;  4CIG A;  4CHN A;  1A5W A;  3OYE A;  3AVB A;  1FKP A;  1TVR A;  2F96 A;  1TL3 A;  4H4O A;  4OGC A;  1DTT A;  1UOC A;  2FBY A;  1LW2 A;  4CF8 A;  4CJL A;  2G8W A;  1Z26 A;  2FBX A;  3ZT0 A;  4LSN A;  4Z4G A;  3QEV A;  4BDP A;  2YNG A;  3SUN A;  1JLQ A;  1RTJ A;  5HBM A;  3V9W A;  3KD5 E;  4CJS A;  1G15 A;  3LP3 A;  2XY7 A;  3QEW A;  5E41 A;  5KGX A;  3MXI A;  4CJ3 A;  2R7Y A;  5KI6 A;  4N5S A;  4F8R A;  3K59 A;  4KTQ A;  2IGI A;  1TK0 A;  1C0M A;  4NCA A;  4FK2 A;  4CJE A;  4M3Z A;  3DLE A;  4OLA A;  4CJP A;  3AO3 A;  3KK2 A;  4M3W A;  3AVA A;  3LP0 A;  1RDC A;  4B9V A;  3AO1 A;  3M8R A;  4UQG A;  2E4L A;  3P5J A;  2P51 A;  1EET A;  1NJZ A;  4EZ9 A;  3KK1 A;  2AJQ A;  4O4G A;  4DU3 A;  4YFU A;  4FJL A;  3PV8 A;  4OPK A;  3FFI A;  3K5O A;  3HVR A;  3NH1 A;  4AIL C;  4DQP A;  3V81 A;  3HK2 A;  4FLX A;  4J2E A;  2HVH A;  3B6P A;  4AH9 A;  3TR8 A;  2IOC A;  1S9E A;  4CHQ A;  4JS5 A;  1BHL A;  1Q8I A;  3TAG A;  2HHU A;  2ZD1 A;  3U6F A;  3LWM A;  2G8U A;  1Z25 A;  5DK5 A;  3SJJ A;  4CGD A;  1MU2 A;  4DG1 A;  2O4I A;  1D8Y A;  4DU1 A;  2B5J A;  1HYV A;  1B9F A;  4AHU A;  4CHP A;  1SL2 A;  1EKE A;  4DSL A;  4E1N A;  1UA1 A;  1LWF A;  2G8V A;  2YKM A;  4LH5 A;  2OPQ A;  4BE2 A;  4Y1D A;  1NOZ A;  1ZYQ A;  5DMR A;  2DFE A;  4Z4I A;  1BGX T;  3PX0 A;  1SL1 A;  4DSK A;  4FCY A;  1J53 A;  1WN7 A;  4FM1 A;  1C0U A;  3LAN A;  1FK9 A;  1VRU A;  3QET A;  3U3Y A;  2Z1G A;  3T3F A;  3VA3 A;  1ZBI A;  3VQ5 A;  4CE9 A;  3KLE A;  1BIU A;  3NF6 A;  4KFB A;  3AV9 A;  3RMB A;  3KIO A;  1QQC A;  1LWE A;  1O1W A;  2E6L A;  2D5R A;  1RBS A;  1BCM A;  5KTQ A;  3VQQ A;  3K57 A;  3LZJ A;  4FJM A;  1UAX A;  4BWM A;  4CFD A;  3OYN A;  1RT2 A;  2I5J A;  3AVG A;  4PUO A;  4LD0 A;  3OYI A;  1TKZ A;  1FXX A;  1GOC A;  4AHR A;  3EZ5 A;  4DS5 A;  4KHW A;  1RT3 A;  1ZBL A;  2IS3 A;  4AHT A;  3MEG A;  4DU4 A;  1RDB A;  5HRN A;  3OYA A;  1DLO A;  1VSM A;  1W0H A;  3QEI A;  1WAJ A;  4Z0U A;  3C6T A;  4BDZ A;  3P1G A;  1N6Q A;  3T1A A;  3LZI A;  4DTP A;  3HP6 A;  3U3G A;  2KZM A;  2QKB A;  4CEB A;  2DY4 A;  3EY1 A;  3OYC A;  5HRR A;  3SUQ A;  3B6O A;  1QSL A;  3I8D A;  1ITG A;  3CFO A;  1J9A A;  3MXJ A;  3K2P A;  4J2D A;  1NK6 A;  3K5L A;  4B08 A;  2QK9 A;  1HRH A;  3QNN A;  1WSE A;  1JLF A;  4RW6 A;  4W5R A;  4W5O A;  2OZS A;  1J54 A;  4DSF A;  3HPG A;  4FJG A;  4HCB A;  1HQU A;  5HRS A;  1U47 A;  2HHT A;  3DM2 A;  4NYF A;  1K6Y A;  4Z4F A;  2KFN A;  3KLG A;  3ZSV A;  1X1P A;  3ZT1 A;  3NBP A;  4CGF A;  1LAW A;  1IKV A;  3KKS A;  3ZCM A;  1L5U A;  3F73 A;  4IG0 A;  4I2Q A;  5J2N A;  5K14 A;  3ZSZ A;  4E3S A;  3SQ4 A;  1YT3 A;  1C1B A;  2ETJ A;  3KLH A;  1SV5 A;  3SZ2 A;  4I9Q A;  4FW1 A;  4KTZ A;  3G10 A;  1WSI A;  1QSY A;  4FLV A;  3TAQ A;  4F3O A;  4RW4 A;  2G8F A;  4DSJ A;  4KPY A;  3VN5 A;  4DQR A;  2HHS A;  2DTU A;  3CM5 A;  3CM6 A;  3NHG A;  3ULD A;  1SKR A;  3A2F A;  5CZ1 A;  4DQQ A;  4DF8 A;  4ID5 A;  3M8Q A;  1RBT A;  3I0R A;  4DFJ A;  1RT5 A;  5J2P A;  4F4K A;  2HND A;  3OYD A;  4HCC A;  1VSJ A;  5FRN A;  4KB1 A;  3SUO A;  1S5J A;  1IKY A;  4M41 A;  3NF8 A;  3HXM A;  3S3N A;  1U49 A;  4CGI A;  1F21 A;  4NCB A;  1EP4 A;  3QLH A;  2PZS A;  1REV A;  3AVM A;  1VK0 A;  1SL0 A;  3TAM A;  4KHY A;  3PX4 A;  3NH0 A;  4ZHR A;  4J2B A;  1JLB A;  1R0A A;  4R5P A;  3HP9 A;  3ZSQ A;  1RBR A; 
#chains in the Genus database with same CATH topology
 4E7L A;  4H0O A;  3IDH A;  1KFS A;  3CQY A;  3A0I X;  1K9M O;  2IAJ A;  4FJ5 A;  4OX9 K;  4I9L A;  3DXM A;  3I0S A;  2EHG A;  1E4G T;  3L0Q A;  4JLH A;  4RG8 A;  3ZSO A;  5AFU A;  4HWI A;  3S3O A;  1BI4 B;  2QXL A;  4NLB A;  3VF2 A;  4L8R B;  4FJX A;  2F8S A;  4RCH A;  1NJY A;  1IH7 A;  4JKG A;  5HRP A;  5CYQ A;  2O8C B;  2RF2 A;  3ALY A;  3J8A A;  4A57 A;  3QIC A;  4TSX A;  4B1X B;  3EL2 A;  4B3T K;  3DRR A;  2ZWH A;  4IEE A;  3R8E A;  4BQL A;  3R9P A;  5AQT A;  5C0Y A;  4PY5 A;  3HZ6 A;  1I3A A;  3FR0 A;  3VQB A;  3VEN A;  4E1M A;  3BZK A;  3OS1 A;  3WEE B;  3CJC A;  1TKT A;  1VQM N;  5AZI B;  1NK5 A;  1Z05 A;  3ZLJ A;  2W41 A;  1OH8 A;  4DQS A;  3FE1 A;  3F5T A;  4ISE A;  4PWD A;  3ATV A;  2KW4 A;  4H0V B;  1T3V A;  4BRI A;  1M90 O;  1WBB A;  4CI6 A;  4FK0 A;  3EZW A;  3BGR A;  2D0A A;  3VQD A;  1NGB A;  1WSG A;  3AVI A;  4KTW A;  2FC0 A;  2O8F B;  1KD1 O;  1RGI A;  2ITG A;  4M3T A;  1WB9 A;  1S22 A;  2HB5 A;  1YXQ A;  4M3R A;  3K5N A;  2Q2R A;  2FF3 B;  4FZZ A;  1VQ6 N;  3E01 A;  2E1Z A;  5M1F A;  2Y1I A;  3WXM B;  1NU0 A;  1S6Q A;  2FSN A;  3MK6 A;  2A3Z A;  5I42 A;  4CFA A;  4JRQ A;  2ZGY A;  5KPZ A;  2XO7 A;  3TAB A;  1RIL A;  1BL3 A;  3ULE A;  4AHV A;  3HPH A;  3WQT A;  1HMV A;  3ENH A;  2E8A A;  3VEY A;  3L2W A;  3HJF A;  3NH2 A;  4DQI A;  1EO1 A;  3BZC A;  1CXQ A;  4U7B A;  3CI5 A;  4BR5 A;  4IFV A;  3AVH A;  4CZJ A;  4JNE A;  5T7B A;  3DLK A;  1LWC A;  5KQ8 A;  4YOT A;  4IZ9 A;  3ITH A;  2YNH A;  4CW7 B;  3C7N B;  3SK3 A;  1JKH A;  2VQF K;  3O9U A;  1TYQ A;  2HW3 A;  4CEO A;  1EQY A;  2E6M A;  4BC2 A;  1Q18 A;  1D9F A;  4MO4 A;  5C25 A;  4Q0B A;  3CIP A;  3VPZ A;  3T1H K;  1MWM A;  3DXM B;  3NFA A;  3FGU A;  1XNR K;  3QBW A;  1NGH A;  3E66 A;  3N4P A;  4B3S K;  1GOA A;  1BIS A;  1S1X A;  3FZM A;  4WFB L;  3H6E A;  3M1F A;  3MCP A;  4CK1 A;  5GIP A;  4XH5 A;  1HQE A;  2HBK A;  3IFR A;  3QB0 A;  4CZF A;  3HVT A;  1Q86 O;  4DV5 K;  3H1V X;  1Q82 O;  1U48 A;  2KKZ A;  3I33 A;  4CGJ A;  4QS8 A;  2EWS A;  1C1A A;  1JLE A;  2P9S A;  4YDU A;  4EFH A;  4JI7 K;  4A5B A;  4FO0 A;  4CZL A;  1QQO A;  4JKC A;  2RE2 A;  2HNY A;  3OYG A;  3L2R A;  2FLO A;  3LM9 A;  1KSP A;  1O13 A;  3PIP L;  1VSE A;  1BWF O;  5AQO A;  4NB4 A;  4CF0 A;  2VG7 A;  2D0C A;  1VSL A;  2WOM A;  3UKU A;  4IFE A;  5M1P A;  1EWR A;  3AA4 A;  1I39 A;  2X74 A;  3L3V A;  4OKE A;  3NDK A;  1U45 A;  1RTH A;  3DMJ A;  3CCU N;  3CER A;  3TSP A;  2NRZ A;  2A6A A;  1IKX A;  2UUC K;  5AZJ B;  4DF4 A;  4CHO A;  3P4I A;  1DT9 A;  3O4Q A;  1WBD A;  5MLC Q;  1P90 A;  3SV3 A;  4CGG A;  3DLL L;  2P1J A;  1NK4 A;  2NRV A;  4FVM A;  2E2O A;  5M1K A;  4FVU A;  3SLC A;  3RRG A;  4JI3 K;  3D0P A;  2HVI A;  1OVY A;  1H1V A;  4KB0 A;  4PKI A;  3M8S A;  4ISF A;  4DTX A;  1NMN A;  3W0L A;  1WAF A;  3TAN A;  5A2Q O;  3C0B A;  3L2V A;  1T6C A;  4OVL A;  1D9D A;  2UXB K;  5M1Q A;  1RT1 A;  4F2S A;  4O0J A;  2OAN A;  5M1O A;  2RN2 A;  1RTD A;  1NWK A;  1XHZ A;  5LJV A;  4CD1 A;  3LWL A;  3OYK A;  3H3N O;  1WSJ A;  3A5N C;  2Y1J A;  3MEE A;  3I55 N;  2QWR A;  2WFB A;  3ZSR A;  1NJW A;  1TV6 A;  4EHU A;  2RPI A;  3HYF A;  1B92 A;  4HTL A;  3LDO A;  4JK9 A;  1U04 A;  5SWM A;  3DOK A;  3GBT A;  3LPU A;  1IKW A;  4NO7 A;  3E9P A;  2D0B A;  4HTU A;  2Q36 A;  1KRP A;  3NF7 A;  3RMD A;  5BR9 A;  4BR0 A;  3CYM A;  4RW9 A;  3L4I A;  2X78 A;  1DGK N;  4E0D A;  3C6A A;  4DSI A;  2P5G A;  2P9S B;  4B1V A;  4PL7 A;  2F4V K;  1VHX A;  4C8M A;  1A5V A;  3CFP A;  1RT6 A;  3VTI A;  4JKD A;  2VWB A;  1RT7 A;  4WYB A;  3DI6 A;  1ZBS A;  4DHY A;  4EAH D;  2ASM A;  5EXW A;  5EU7 A;  5C10 A;  1HJR A;  1KLM A;  2HHV A;  2FF6 A;  3AVB A;  3UKU B;  2NRX A;  3VES A;  3LL3 A;  4OGC A;  4BR4 A;  2FBX A;  3ZT0 A;  3NVK A;  1HKC A;  4BDP A;  3TSU A;  4GVE A;  5HBM A;  5C2F A;  3KD5 E;  1G15 A;  4BRC A;  1N32 K;  3MCA B;  5KGX A;  3THX A;  4KTQ A;  3PLA A;  4M3Z A;  4NCA A;  3JXU A;  4CJP A;  1JJ2 M;  5FPN A;  1OKJ A;  3AVA A;  4B9V A;  3O9S A;  3KK1 A;  3ZEU B;  1GLE G;  4MLE A;  4FJL A;  4OPK A;  4AIL C;  3V81 A;  5KPR A;  4J2E A;  3MN9 A;  4AH9 A;  4K43 A;  1S9E A;  1YHQ N;  4JS5 A;  2G8U A;  4IOX A;  4AHU A;  4E1N A;  1YUW A;  4A2A A;  2G8V A;  1ZYQ A;  4Z4I A;  4DSK A;  4JI1 K;  1WN7 A;  3LAN A;  1VRU A;  1QVG M;  3U3Y A;  3VA3 A;  1ZBI A;  3KLE A;  5ADX H;  2YJE A;  3UKR A;  1LWE A;  5B8H A;  1RBS A;  5KTQ A;  1IBM K;  3VQQ A;  2WTU A;  3CCQ N;  4BWM A;  1VAZ A;  2I5J A;  2W40 A;  3OYI A;  3BY5 A;  1FXX A;  3TTC A;  4B1Z A;  1RT3 A;  2IS3 A;  1VSM A;  1WAJ A;  4BDZ A;  1N6Q A;  3U3G A;  4ILH A;  2QKB A;  2DY4 A;  3KZB A;  5AR0 A;  3MXJ A;  4BRH A;  3QDK A;  3BEX A;  4H0X B;  2QK9 A;  4LF6 K;  4W5O A;  2OZS A;  4GKK K;  3HM8 A;  1HQU A;  3PIO L;  2KFN A;  3ZSV A;  2IVN A;  3NBP A;  4CGF A;  1I94 K;  1VQ8 N;  3KKS A;  1L5U A;  3F73 A;  4JHD B;  4WQ5 C;  5K14 A;  4X66 K;  3KLH A;  3H45 C;  4KTZ A;  3G10 A;  1WSI A;  4FLV A;  1BA0 A;  1HNX K;  2A42 A;  4KPY A;  3J7A P;  3VN5 A;  4DQR A;  3CM6 A;  3A2F A;  5CZ1 A;  3VF4 A;  3OYD A;  1VSJ A;  4A59 A;  3W3D A;  1U49 A;  3EKS A;  1F21 A;  3QLH A;  2UXC K;  1SL0 A;  4KHY A;  3PX4 A;  3NH0 A;  1IG8 A;  5IT9 O;  3HP9 A;  4W5R A;  1SKS A;  2QI2 A;  4BRA A;  2HF4 A;  4ZTF A;  1L3S A;  5EX5 A;  3PO4 A;  5J1E A;  4JKE A;  1KVC A;  5CZ2 A;  4JKF A;  4DV0 K;  2NNW A;  4DR7 K;  4WQ4 C;  2ATQ A;  2NRH A;  2KZZ A;  3K58 A;  4M3X A;  1IG9 A;  4BE1 A;  4GV9 A;  4CK2 A;  2ASO A;  1X9M A;  3AVN A;  4A2B A;  1VSK A;  4E7I A;  4DFK A;  4NYN A;  1WUA A;  1VQK N;  3P83 D;  3ZSW A;  3QEP A;  4EP4 A;  4CEF A;  2E20 A;  1GLJ O;  3RR8 A;  5TKY A;  2W42 A;  3AA2 A;  3CD6 N;  3KLF A;  3L2Q A;  2G8I A;  2KFZ A;  1X9J A;  4AQY K;  1QZ6 A;  3M6G A;  3NGY A;  2PY5 A;  2D0O A;  4MDB A;  2BH1 A;  4CZH A;  5GAH P;  2F7T A;  3VQC A;  4KHS A;  5KGW A;  5JIC A;  3EYZ A;  1X9S A;  2X6N A;  4AHS A;  5H1S Q;  3TAR A;  5BPN A;  3K5M A;  4FJK A;  4OKK A;  4YNQ A;  3KJV A;  2O8E A;  3RSE A;  3MED A;  5CY4 A;  3WXI A;  1NGF A;  5BR8 K;  4JK7 A;  1RCH A;  4FLZ A;  1EXQ A;  3K0S A;  3QO9 A;  1GLB G;  4ID1 A;  3DYA A;  4DLE A;  4FOE A;  2P9K A;  4C23 A;  4IO8 A;  5BN9 A;  2GUI A;  1NOY A;  3O3G A;  3UE5 A;  4YOY A;  3KK7 A;  4BC5 A;  4GV3 A;  1RBU A;  3VEX A;  5FPE A;  2D0P A;  2HF3 A;  3G25 A;  4M63 C;  4CEE A;  2RHK A;  4O0I A;  4H5R A;  3VQ6 A;  4DUZ K;  3OYB A;  1D4X A;  4HVJ A;  2LSN A;  1IO2 A;  5AQP A;  1HX1 A;  4GMJ B;  3VQ8 A;  5HP1 A;  4XEI A;  3RWU A;  3T7Z A;  1S1W A;  3OA9 A;  1KVA A;  3WT0 A;  1GLF O;  4NXM K;  3SV4 A;  3SYZ A;  4CJV A;  1HNW K;  2BUP A;  3KKR A;  4C8N A;  3U9Z A;  3AA5 X;  3OY9 A;  4WCE L;  3TPQ A;  1TK5 A;  3ZT3 A;  2YKN A;  1XC9 A;  4KKO A;  2GX9 A;  4HUG A;  4CJK A;  1SKW A;  3R1X A;  1L3V A;  4BRD A;  4DR2 K;  3O3H A;  4E1J A;  3ASM A;  4DTR A;  3NGI A;  1NNE A;  4WQ5 A;  5D3G A;  3IRX A;  4CFC A;  3T19 A;  3VEZ A;  2FXU A;  2P9U A;  4Z94 A;  4K0K K;  3MDQ A;  2BDP A;  4YHH K;  3H08 A;  4I7F A;  3QIO A;  2E88 A;  5AQJ A;  3V1O A;  1WOQ A;  1GLD G;  3IAY A;  4DMN A;  1IBL K;  1T7P A;  1XHX A;  4G1Q A;  4CJQ A;  1QVF M;  4W5T A;  4BVO A;  1RFQ A;  3MX5 A;  2YHB A;  4FZY A;  3L3U A;  4BQZ A;  2WUS A;  4DTM A;  3M8P A;  4B1U B;  1LCU A;  3OS0 A;  4CJW A;  1TAU A;  4LH4 A;  1OH7 A;  4FJ7 A;  3THV A;  4N76 A;  3J81 O;  1BUP A;  1NBW A;  2QWM A;  4I6M A;  2IC3 A;  4FLU A;  4BC4 A;  4IDK A;  4YY3 K;  1L3T A;  4YOW A;  4H03 B;  1VSI A;  5ELZ A;  4EZ6 A;  5AQZ A;  5BPL A;  5FDL A;  3SI6 A;  2Q0U A;  3DOL A;  2OYQ A;  1T8E A;  4E7H A;  4DSE A;  2Q3S A;  1HJO A;  3EEQ A;  3TAE A;  4B9N A;  3CPW M;  1YF5 L;  4FWR A;  4DR1 K;  4E7J A;  4JV5 K;  3HO1 A;  3TI0 A;  1WSH A;  3JYT A;  5GIN A;  4KRF A;  2WC9 A;  4KHP K;  3SAG A;  1YVU A;  3AVJ A;  2GUP A;  3D45 A;  2O8E B;  3RSE B;  1V4S A;  3IS9 A;  1VSD A;  5J2Q A;  4CBU A;  2ZM6 K;  1W7A A;  1S1V A;  4CJ5 A;  4JI2 K;  3CJB A;  3IG1 A;  4IXC A;  2F8T A;  3DXK A;  3VTH A;  2FBT A;  4KH4 A;  2JWL A;  5AQV A;  3TSQ A;  4AM6 A;  4R79 A;  5C2D A;  1SUQ A;  3VQA A;  3LP2 A;  4K41 A;  3E9L A;  2IVO A;  1R59 O;  5CE3 A;  4CHY A;  4FJJ A;  3F2K A;  2Z1I A;  3THW A;  4FXD A;  3PUF A;  4BC3 A;  1NKE A;  1IJJ A;  1NJI O;  1QE1 A;  4MFB A;  4BRP A;  3HOT A;  4F2R A;  2UYT A;  3NCI A;  3HPO A;  5KPT A;  2X6S A;  3CC2 N;  3OJS A;  4OGE A;  2QXF A;  2HBL A;  3KVG A;  4PA1 A;  4DWI A;  4ELV A;  4IKF A;  4JI5 K;  1BIZ A;  3LDS A;  1ASV A;  3DRS A;  1NK8 A;  3BF3 A;  1YAG A;  1TL1 A;  4LC9 B;  4CFB A;  1KAY A;  4DTN A;  3F9K A;  3MAQ A;  1K8K A;  1TAQ A;  3PSF A;  4CJR A;  3EN9 A;  1RT4 A;  4KAZ A;  4FL9 A;  4JKA A;  3QES A;  3NE6 A;  2GWK A;  1TKX A;  3CHW A;  1S6P A;  3KWI A;  4DKW A;  3SQ2 A;  3AGK A;  4BGA A;  3RR7 A;  3O3F A;  1K8A O;  1N5Y A;  3SMS A;  1N33 K;  4OPH A;  4JKG B;  1C0G A;  4Y1C A;  1VSH A;  2ZJR L;  3M3Z A;  4BE0 A;  2I7P A;  3DAW A;  1ASU A;  1NK0 A;  1KTQ A;  1S1U A;  1KQS M;  4M3Y A;  4MLH A;  4I6M B;  1VQO N;  1QHT A;  4CF8 A;  2FBY A;  1Z26 A;  4LSN A;  2YNG A;  1RTJ A;  3V9W A;  4M7Y A;  4LFB K;  4DV2 K;  1QQN A;  2XY7 A;  5E41 A;  3IUC A;  2NRR A;  2R7Y A;  4F8R A;  1C0M A;  1HUX A;  4CZE A;  3DLE A;  3H1Q A;  4OLA A;  4J8F A;  3QFP A;  1GLA G;  3KK2 A;  4M3W A;  3H46 O;  4UQG A;  4EZ9 A;  4DV7 K;  2YHX A;  5AQK A;  4YFU A;  4BRM A;  3CC7 N;  3GG4 A;  4BY9 C;  4M7X A;  2HVH A;  4IWV A;  3TR8 A;  4YOX A;  2HHU A;  3LWM A;  5DK5 A;  3VGK A;  4FWQ A;  4CGD A;  1D8Y A;  1S3X A;  1B9F A;  1SL2 A;  2YI1 A;  1N36 K;  3A5M C;  2QWN A;  1UA1 A;  2YKM A;  4LH5 A;  2OPQ A;  5GIO A;  3ULE B;  5JVG L;  1SL1 A;  4NLC A;  1ESV A;  3VQ5 A;  3NF6 A;  1OH5 A;  3AV9 A;  3RMB A;  3VF6 A;  3CCE N;  3KIO A;  1QQC A;  2E6L A;  1BCM A;  1UAX A;  3AVG A;  4DV1 K;  3BP8 A;  4NXN K;  3HRG A;  4DS5 A;  4GY2 B;  4KHW A;  3HSC A;  4AF1 A;  4DU4 A;  1RDB A;  1TYQ B;  1W0H A;  1K8K B;  4Z0U A;  5AQM A;  3LZI A;  2QWQ A;  2KZM A;  3QFU A;  3ENO A;  1YVN A;  1QSL A;  1J9A A;  3CQX A;  3K5L A;  4B08 A;  1JLF A;  1J54 A;  3P31 A;  5EOY A;  3ZX0 A;  1U47 A;  1K6Y A;  4BG8 A;  4CZM A;  2QW9 A;  1VQ5 N;  3KLG A;  1X1P A;  1LAW A;  4I2Q A;  1YI2 N;  3ZSZ A;  3C65 A;  1C1B A;  3NMU A;  3AY9 A;  1SV5 A;  3SZ2 A;  4FW1 A;  4F3O A;  2G8F A;  4DV3 K;  3CM5 A;  3NHG A;  4DQQ A;  1NLV A;  4ID5 A;  3I0R A;  4F4K A;  1RT5 A;  1NGA A;  2P9I A;  4HCC A;  5FRN A;  2VYP A;  3NF8 A;  3HXM A;  4CGI A;  4FPA A;  1EP4 A;  1QQM A;  1U2V A;  2F9W A;  3OHR A;  5DM7 L;  3GOI A;  4ZHR A;  1R0A A;  4CD3 A;  4DTO A;  3VA0 A;  3LP1 A;  2YJF A;  1T05 A;  2QWP A;  4KH6 A;  4OPJ A;  3THY A;  4KI4 A;  4ICL A;  4H4M A;  3MXM A;  3DLG A;  3TWH A;  5BPM A;  2OPR A;  4BG9 A;  4QCL A;  4YOR A;  3EO3 A;  2A1S A;  3T69 A;  2BE2 A;  1GLL O;  4CIF A;  4BGB A;  5CR4 A;  1KCF A;  3PY8 A;  4F3T A;  1ZBH A;  2NRW A;  3QEX A;  3DRP A;  1ATR A;  5EY4 A;  4FWK A;  3CQ8 A;  3ENB A;  3EE9 A;  3AAR A;  4FYD A;  3SUP A;  2NZT A;  3NGZ A;  2BTF A;  4OLB A;  5GAG P;  2HOE A;  2KLA A;  1JXB A;  3O08 A;  3SAF A;  2PFU A;  3SBT A;  3A8Y A;  3O6W A;  4EIA A;  5IWA K;  1HLU A;  2AP1 A;  4K8X A;  3QER A;  4LSL A;  5AQX A;  2UUB K;  3ZET A;  1VQ7 N;  4LY7 A;  4DUY K;  3WNF A;  2H3G X;  1CZA N;  3SAH A;  3QIP A;  4N47 A;  3S3M A;  2KHO A;  2QEX N;  4DTJ A;  3P39 A;  2E1Y A;  3SBG A;  5AQY A;  3OYH A;  4K25 A;  4FM0 A;  3ZX2 A;  1BCO A;  2GWJ A;  2HST A;  3EKU A;  4H5W A;  4RW8 A;  1ZBU A;  3O4N A;  4KH5 A;  3V1R A;  5JLH A;  3J80 O;  1YTA A;  4PKH A;  3OJU A;  1C0T A;  4KHQ A;  3F9M A;  2QTD A;  1W97 L;  3RMC A;  2E2P A;  4DFM A;  3TAF A;  4LF4 K;  4CEQ A;  3KK3 A;  3TAP A;  1OVQ A;  5FRM A;  2ZE2 A;  1QHA A;  3O9R A;  4IG3 A;  2ZQB A;  3D2E A;  3G71 N;  4JI0 K;  1OH6 A;  4FK4 A;  4O8U A;  3G0Z A;  5HLF A;  2HHQ A;  2D4W A;  2OZM A;  3CME N;  3C95 A;  1XQS C;  1IBK K;  4JYA K;  3WUH A;  1KVB A;  4O55 A;  4HCB A;  3WXK A;  3WNG A;  1T03 A;  4MQ3 A;  4B9M A;  1U2V B;  4O44 A;  3DJC A;  2OPS A;  5JLF A;  4QOZ B;  3FZK A;  5I3U A;  4H8K A;  4B9U A;  5ADX A;  4BAC A;  4DB3 A;  3RVC A;  3RMA A;  1UWB A;  3V9X A;  1BQM A;  3THY B;  2Q0R A;  1WLJ A;  3ZYY X;  1JL1 A;  2E2Q A;  1U4B A;  3U9D A;  4CEZ A;  3OYL A;  1G99 A;  1LW0 A;  2QM1 A;  4CZG A;  2YHY A;  1FKO A;  1HNI A;  5BN8 A;  5SZT A;  3HOS A;  1C6V A;  2Q31 A;  3THX B;  3RRH A;  4PL8 A;  2XY6 A;  1FJG K;  3BUZ B;  3FFK B;  5JS2 A;  4UY8 O;  2OPP A;  4BRO A;  1KAZ A;  4FJI A;  3E9O A;  3T1Y K;  2B6A A;  4CEA A;  3NAE A;  1KC8 O;  1X9W A;  3ZT2 A;  1XI1 A;  1QSS A;  3QIN A;  2V7Y A;  1GOB A;  3SCX A;  3KD1 E;  4CJU A;  5EVZ A;  5C42 A;  3MN6 A;  3ZET B;  2BGG A;  4KBO A;  4H0P A;  1FW6 A;  4B3M K;  1WNS A;  2HBM A;  4E19 A;  1T6D A;  2YNI A;  3QNO A;  4CBW A;  1D5A A;  1J5E K;  4U67 L;  4M3U A;  2FBV A;  1VRT A;  2O8B A;  4NCG A;  3UKR B;  2P9L A;  1Y64 A;  3CFR A;  4OKJ A;  3AO2 A;  3O1W A;  1K73 O;  1BI4 A;  4IDH A;  5TKW A;  3LAM A;  4OO1 J;  1TKD A;  2JGU A;  1YJ9 N;  2O8C A;  4FJN A;  4CER A;  3HTV A;  2CGL A;  3AA3 A;  4C8O A;  2P5O A;  3H3O B;  1VQN N;  2IDO A;  3ID8 A;  3D2E B;  4IFY A;  2HHX A;  4C8K A;  4W5Q A;  4OPA A;  1Q9X A;  4FWN A;  5BRH A;  1ZXO A;  2KQ2 A;  3HI0 A;  3DLR A;  4XIU A;  5KRS A;  1U6Z A;  4I2P A;  3WQU A;  1CLQ A;  3WEE A;  5E26 A;  1Q9Y A;  5AZI A;  5AQH A;  1RTI A;  4DCH A;  4LFA K;  4ELT A;  3BDP A;  4J2A A;  4KHU A;  3SQ1 A;  4FWP A;  1HYS A;  3CCV N;  4V19 S;  4K8Z A;  4M42 A;  1CXU A;  4E7K A;  2O8F A;  3V9Z A;  4DS4 A;  1J5O A;  1W2B M;  4GW6 A;  3OYM A;  4B9S A;  2HNZ A;  1HPZ A;  2VWJ A;  4HHT A;  5AFU H;  3C94 A;  4CGH A;  3VQ7 A;  2HHW A;  2RKI A;  1JCG A;  3WNE A;  3VQE A;  2XRI A;  4H5V A;  4BRN A;  2VWK A;  3VGL A;  4FLW A;  1SQK A;  4PKG A;  2ZGZ A;  4E89 A;  1HNV A;  3CG7 A;  3CCJ N;  4JEP A;  3MX2 A;  2XY8 A;  1YTU A;  4DV4 K;  2WON A;  5M1N A;  1LOT B;  3SPY A;  3UIQ A;  1NK7 A;  2QKK A;  4LF9 K;  1CZB A;  1NGI A;  1Z6R A;  4RW7 A;  1QTM A;  2FSK A;  3MWP A;  2NLX A;  4IO9 L;  2GV9 A;  2CGJ A;  4CHN A;  5CHI A;  3VOV A;  1A5W A;  5AQS A;  1FKP A;  1TVR A;  1TL3 A;  1DTT A;  1LW2 A;  4MDA A;  4CJL A;  2G8W A;  3AAP A;  3B8A X;  2O8B B;  1YIJ N;  4Z4G A;  3SUN A;  1JLQ A;  2P9L B;  3VEV A;  5FLX O;  3LP3 A;  3FLC O;  4WQ4 A;  5AQG A;  3K59 A;  2IGI A;  1TK0 A;  3AO3 A;  3LP0 A;  3M8R A;  3E1Y A;  3P5J A;  2P51 A;  1EET A;  2AJQ A;  5AQN A;  4O4G A;  4DU3 A;  2P9N A;  4EHT A;  3LDP A;  3PV8 A;  3K5O A;  3HVR A;  4LFC K;  3HK2 A;  3B6P A;  4H5T A;  4CZK A;  2OCE A;  3OTO K;  2IOC A;  4CHQ A;  1Q8I A;  3TAG A;  3U6F A;  1Z25 A;  2CGK A;  4JKB A;  2O4I A;  2B5J A;  4DSL A;  1Q7Y O;  3EE8 A;  1LWF A;  2P9K B;  4X64 K;  4BRE A;  4BE2 A;  1YIT N;  4Y1D A;  1NOZ A;  3SMP A;  4A62 A;  1BGX T;  1TUU A;  3CJ7 A;  3VET A;  1FK9 A;  4A5A A;  3O80 A;  3QET A;  4WFA L;  1BIU A;  1KAX A;  5AQW A;  1O1W A;  5AQI A;  2D5R A;  4KI6 A;  4CVN E;  5AZJ A;  3OYN A;  1C0F A;  1ILY A;  1TKZ A;  1GOC A;  1ZBL A;  3MEG A;  4G9Z A;  3N4Q A;  3QEI A;  3CET A;  3C6T A;  5HOO A;  3CMA N;  4DTP A;  3GDQ A;  4IEI A;  3QBX A;  4CEB A;  3G4S N;  3CCL N;  2ASP A;  4B9Q A;  4B1Y B;  3OYC A;  5HRR A;  3EY1 A;  3SUQ A;  3B6O A;  3CJA A;  4DQ8 A;  1ITG A;  3CFO A;  3K2P A;  1HRH A;  2ZJQ L;  4JN4 A;  5HRS A;  4NYF A;  1YJW N;  3TU5 A;  4DV6 K;  3L6Q A;  2P9U B;  3ATU A;  1IKV A;  3ZCM A;  4IG0 A;  2UUA K;  5J2N A;  4E3S A;  3SQ4 A;  5AQF A;  1YT3 A;  1SZ2 A;  4BVP A;  2E2N A;  3JS6 A;  4I9Q A;  3IMX A;  4RW4 A;  4DSJ A;  2DTU A;  1SKR A;  3ULD A;  4DF8 A;  2YHW A;  3M8Q A;  4DFJ A;  4JI8 K;  5AJ3 K;  2GEM A;  3ZX3 A;  4KB1 A;  3SUO A;  1S5J A;  4M41 A;  3S3N A;  4IJN A;  3VMF B;  2VCP A;  5GAE P;  2PZS A;  1REV A;  3AVM A;  1VK0 A;  4R5P A;  3ZSQ A;  1RBR A;  3U8X A;  4B9L A;  1MWK A;  3J7Y P;  1TGO A;  4FM2 A;  4FLY A;  3J7Z O;  2NRT A;  3OBW A;  1CZ9 A;  1X3M A;  1VQP N;  1C1C A;  1NMD A;  1P8Z A;  3D7E O;  4DR6 K;  3KLI A;  3FZF A;  4CBX A;  3HBT A;  1BOT O;  3M5R A;  4LF8 K;  2UU9 K;  2P9N B;  4GVM A;  4B8C A;  1E3M A;  1JXE A;  4IBN A;  4BR7 A;  4EP5 A;  3S41 A;  3V6D A;  1ATN A;  5AQR A;  1S1T A;  3V1Q A;  1N34 K;  2PBD A;  3PO5 A;  4FWM A;  5JMV A;  2O8D A;  3VEW A;  1S72 N;  3VER A;  1XMQ K;  3DXK B;  2G8K A;  3TTF A;  4CIE A;  1JLC A;  3SQ0 A;  2I7N A;  1XWL A;  4IOC L;  4CED A;  4PQU A;  4FSV A;  3DLH A;  2W6L A;  2JLE A;  1RNH A;  3ZSY A;  3THW B;  3LAK A;  1N8R O;  4BDY A;  2IVP A;  4ZTJ A;  3L4Q A;  3HM9 A;  1QS4 A;  3NVM A;  2E5L K;  4W5N A;  1BQN A;  3LM2 A;  2ZJP L;  2DFH A;  5KRT A;  3SNN A;  2PYJ A;  4XH1 A;  1XUP O;  4B1W B;  3ZEU A;  3D2F A;  2AA4 A;  3OYJ A;  1NM1 A;  2A41 A;  3ISN C;  2CH5 A;  1M1K O;  3WXL A;  4CCH A;  2A5X A;  3K9J A;  3HST B;  4ELU A;  2GBZ A;  4H0T B;  4CJF A;  3V4I A;  3ZSX A;  3AVL A;  1KFD A;  1RBV A;  4GKJ K;  3L8B A;  3CXC M;  2KTQ A;  3VQP A;  3OS2 A;  3AO4 A;  3SJH A;  3LDN A;  4WFN L;  4HUE A;  2UXD K;  3AVK A;  1UA0 A;  5CYM A;  4C1N I;  2XY5 A;  4AHC A;  4GV6 A;  2PAV A;  3CC4 N;  2EX3 A;  3TTD A;  3V9U A;  4JAX A;  4LF7 K;  1NKB A;  3NF9 A;  3L2U A;  4MO5 A;  4JS4 A;  5BRD A;  1W9H A;  1NGE A;  3AVF A;  3VGM A;  3C6U A;  5LY3 A;  1BO5 O;  1B9D A;  3BF1 A;  3JSM A;  3C6H A;  2A1R A;  3OW2 M;  2Z1H A;  2BAN A;  2J4R A;  3MEC A;  1WSF A;  5KQD A;  4Q5V A;  1T44 A;  4JD2 A;  3VEO A;  2P9P A;  1S9G A;  3A5L C;  4Z4C A;  4BR2 A;  3DLB A;  4O5F A;  1L3U A;  3O9T A;  3P38 A;  3CCS N;  2NUB A;  4IJA A;  2DPN A;  1KLN A;  4CK3 A;  5FRO A;  4B3O A;  4B8A B;  1HNZ K;  4FWL A;  2W6K A;  4CZI A;  2DFF A;  3FZH A;  4BR9 A;  5J2M A;  1HPM A;  4QS9 A;  4FPB A;  4RWT A;  4JHD A;  4FJ8 A;  3O1B A;  2CH6 A;  3AAQ A;  4KV8 A;  4CJ4 A;  3Q7C A;  4AM7 A;  4PHT X;  4DR5 K;  1VQ4 N;  2YHA A;  4KO0 A;  2O8D B;  4C8L A;  1ASW A;  5LMU K;  4FJH A;  3K9K A;  3MWT A;  3CF5 L;  4DLG A;  2VG6 A;  4LF5 K;  3KWG A;  4X65 K;  3ID6 A;  4C1N K;  4O8K A;  1JLG A;  1DTQ A;  4BWJ A;  1NGJ A;  1QZ5 A;  4O5B A;  5LL6 Z;  1SAZ A;  3OVN A;  1ZBF A;  2GTD A;  4FZX C;  4M45 A;  1NGC A;  3I56 N;  2HMI A;  4BRK A;  5GAD P;  3D2F B;  3MMV A;  1NJX A;  4CF2 A;  1KXP A;  3O9Q A;  3FZL A;  4DR3 K;  4DTU A;  4QAG A;  1LV5 A;  5BRE A;  4B9T A;  4FWS A;  4OJR A;  1JL2 A;  4CES A;  3WNH A;  4N41 A;  4FLT A;  4CEC A;  2YX6 A;  3S9H A;  1VQ9 N;  3CCR N;  2V51 B;  1XMO K;  5HL7 L;  4Z4E A;  4JI4 K;  1TUY A;  4FWO A;  5I9E B;  1XNQ K;  5JS1 A;  2OTJ N;  2F9T A;  3LAL A;  4CJ7 A;  4FOI A;  3PSI A;  1DEJ A;  1LAV A;  1HR0 K;  4WE1 A;  4WF9 L;  3HL8 A;  3AO5 A;  4KHN A;  1HYZ A;  2YNF A;  1EWQ A;  4BRL A;  5C24 A;  4N56 A;  2A40 A;  5E84 A;  2Q97 A;  4JRP A;  4CF1 A;  2PYL A;  5C15 A;  2P9I B;  4Z4H A;  2YV0 X;  1Y97 A;  4JD2 B;  3CJ9 A;  4HUF A;  4IOA L;  1NGD A;  1RDA A;  2P9P B;  3JAM O;  1NKC A;  3VQ9 A;  1GLC G;  3OYF A;  3GE1 A;  1RDW X;  2VGN A;  4FJ9 A;  4YOU A;  4ILG B;  2IIR A;  5FPM A;  4ILJ A;  4FW2 A;  4Y0W A;  4CF9 A;  3LPT A;  3SPZ A;  3LDL A;  4H0Y B;  2B4J A;  1VSF A;  3A5O C;  4A61 A;  1HKB A;  3HT3 A;  4XH4 A;  5BRF A;  2Z1J A;  4CHZ A;  4CJT A;  1DKG D;  4DFP A;  1NK9 A;  4QS7 A;  3D6R A;  1MA9 B;  3VQ4 A;  3WXJ A;  3GL1 A;  4DTS A;  5HRO A;  1EX4 A;  3PX6 A;  3ZT4 A;  1E4F T;  2XHB A;  3LDQ A;  4X62 K;  3KTQ A;  1RDD A;  1A5X A;  1TK8 A;  2ZF5 O;  3MN7 A;  2G8H A;  3V9S A;  2O4G A;  2WBN A;  3Q7B A;  2VG5 A;  2ITM A;  2QA4 N;  2OA8 A;  3AVC A;  5C12 A;  1BU6 O;  3OBY A;  1JLA A;  3RTV A;  1Q81 O;  4KRE A;  5LMN K;  2FSJ A;  4CIG A;  5AQU A;  3G6E N;  3OYE A;  2F96 A;  4H4O A;  1UOC A;  3I8B A;  1X3N A;  2OTL N;  1MDU B;  3QEV A;  4CJS A;  3QEW A;  5F0X A;  1NGG A;  3MXI A;  4CJ3 A;  2V7Z A;  4B3R K;  5KI6 A;  5F1X A;  4N5S A;  4FK2 A;  5LJW A;  2VQE K;  4CJE A;  5FPD A;  1BDG A;  1RDC A;  3AO1 A;  2E4L A;  2Q1N A;  1NJZ A;  2YCH A;  1BA1 A;  5F2R A;  1NG9 A;  1RDU A;  3R6M A;  1ATS A;  1HKG A;  3FFI A;  2V52 B;  3CCM N;  3NH1 A;  4DQP A;  4FLX A;  4BRG A;  1BHL A;  5AQL A;  3R3L A;  2ZD1 A;  3SJJ A;  4L3Q A;  1MU2 A;  4DG1 A;  1SS6 A;  4JK8 A;  4DR4 K;  4DU1 A;  3CJ1 A;  1HYV A;  4CHP A;  1EKE A;  5DMR A;  2DFE A;  3PX0 A;  4FCY A;  1J53 A;  4FM1 A;  1C0U A;  2Z1G A;  1VQL N;  3U4L A;  3T3F A;  4BRQ A;  4CE9 A;  4KFB A;  1IV0 A;  5JVH L;  4BRF A;  3K57 A;  3LZJ A;  4FJM A;  4PUO A;  4CFD A;  1RT2 A;  3AGR A;  4LD0 A;  3UB5 A;  3O5B A;  4AHR A;  3EZ5 A;  2QWO A;  4AHT A;  3MN5 A;  2JWK A;  5HRN A;  1J6Z A;  3CPE A;  3OYA A;  1DLO A;  3P1G A;  3T1A A;  4F9O A;  3O4W A;  4ISG A;  3HP6 A;  4JKH A;  1V4T A;  1XC3 A;  2VGM A;  3I8D A;  2HBJ A;  3O8M A;  1NK6 A;  3QNN A;  4YOV A;  1WSE A;  4RW6 A;  4J2D A;  2QWL A;  4H5N A;  3HPG A;  3IKM A;  4DSF A;  4FJG A;  2HHT A;  3DM2 A;  2HMP A;  3DWL A;  4Z4F A;  3QML A;  3ZT1 A;  1BG3 A;  5AQQ A;  2ETJ A;  1JCF A;  2D1K A;  2GEL A;  1ZC6 A;  1QSY A;  3TAQ A;  1JCE A;  2HHS A;  1RBT A;  5J2P A;  2HND A;  5DM6 L;  1IKY A;  4RTF D;  4K42 A;  4GNI A;  1YJN N;  4YDU C;  4NCB A;  3KHY A;  3C7N A;  2HHH K;  3TAM A;  4J2B A;  1JLB A;  4JI6 K; 
#chains in the Genus database with same CATH homology
 4DTO A;  4E7L A;  3VA0 A;  4B9L A;  1KFS A;  1TGO A;  3LP1 A;  4FLY A;  4FM2 A;  1T05 A;  2OYQ A;  4ZTF A;  1L3S A;  4K8Z A;  1CZ9 A;  2IAJ A;  4FJ5 A;  4I9L A;  1C1C A;  4OPJ A;  4KI4 A;  4ICL A;  3PO4 A;  5J1E A;  3I0S A;  1KVC A;  5CZ2 A;  4H4M A;  2EHG A;  3MXM A;  3DLG A;  3KLI A;  3TWH A;  4JLH A;  4RG8 A;  2ATQ A;  2OPR A;  3ZSO A;  3S3O A;  2KZZ A;  1BI4 B;  4L8R B;  4QCL A;  4FJX A;  3K58 A;  2F8S A;  2A1S A;  1NJY A;  1IH7 A;  4GVM A;  4B8C A;  4M3X A;  2BE2 A;  1JXE A;  5HRP A;  1IG9 A;  4IBN A;  5CYQ A;  2RF2 A;  3ALY A;  4CIF A;  4BE1 A;  4CK2 A;  3PY8 A;  1KCF A;  4F3T A;  4EP5 A;  1ZBH A;  3QEX A;  3DRP A;  4TSX A;  1X9M A;  3AVN A;  4KI6 A;  3V6D A;  3CQ8 A;  1VSK A;  3DRR A;  1S1T A;  4E7I A;  3V1Q A;  4DFK A;  4FYD A;  3SUP A;  4NYN A;  3NGZ A;  3P83 D;  3ZSW A;  3QEP A;  3PO5 A;  4OLB A;  1JXB A;  4EP4 A;  4PY5 A;  4CEF A;  1I3A A;  2G8K A;  4CIE A;  3VQB A;  1JLC A;  4K8X A;  3SQ0 A;  4E1M A;  3QER A;  4LSL A;  1XWL A;  3OS1 A;  4CED A;  4PQU A;  3RR8 A;  3DLH A;  2W42 A;  3AA2 A;  1TKT A;  4LY7 A;  2JLE A;  1RNH A;  3WNF A;  3ZSY A;  1NK5 A;  3KLF A;  3L2Q A;  3LAK A;  2G8I A;  2KFZ A;  4DQS A;  3QIP A;  4N47 A;  3S3M A;  3NGY A;  4BDY A;  4ZTJ A;  4DTJ A;  2PY5 A;  3HM9 A;  1QS4 A;  4PWD A;  3OYH A;  4W5N A;  4FM0 A;  1BQN A;  2KW4 A;  2DFH A;  5KRT A;  1BCO A;  3SNN A;  2PYJ A;  4FK0 A;  4RW8 A;  1ZBU A;  3O4N A;  3VQC A;  3BGR A;  4KHS A;  2D0A A;  3VQD A;  3AVI A;  1WSG A;  4KTW A;  5KGW A;  3V1R A;  2FC0 A;  1YTA A;  3EYZ A;  1X9S A;  2X6N A;  4AHS A;  3OYJ A;  3OJU A;  2ITG A;  4M3T A;  3TAR A;  1C0T A;  4KHQ A;  3K5M A;  4FJK A;  2HB5 A;  4OKK A;  4M3R A;  4YNQ A;  3K5N A;  3RMC A;  3ISN C;  4DFM A;  3TAF A;  3KJV A;  4CCH A;  4FZZ A;  3E01 A;  3HST B;  4CEQ A;  3MED A;  2Y1I A;  4ELU A;  5CY4 A;  3KK3 A;  3TAP A;  2GBZ A;  5FRM A;  4CJF A;  1S6Q A;  1RCH A;  3ZSX A;  3AVL A;  2ZE2 A;  3V4I A;  1KFD A;  4FLZ A;  1EXQ A;  5I42 A;  1RBV A;  4IG3 A;  2ZQB A;  4CFA A;  3L8B A;  3QO9 A;  4ID1 A;  2XO7 A;  3DYA A;  4JRQ A;  3VQP A;  4DLE A;  3TAB A;  2KTQ A;  1RIL A;  1BL3 A;  3OS2 A;  3AO4 A;  4AHV A;  2GUI A;  3HPH A;  3O3G A;  1NOY A;  1HMV A;  4FK4 A;  4HUE A;  3AVK A;  1RBU A;  3G0Z A;  5HLF A;  1UA0 A;  2HHQ A;  5CYM A;  3L2W A;  4CEE A;  4AHC A;  3NH2 A;  4O0I A;  2XY5 A;  3C95 A;  2OZM A;  4DQI A;  3HJF A;  3VQ6 A;  3OYB A;  1CXQ A;  2EX3 A;  4IFV A;  1KVB A;  2LSN A;  3AVH A;  1IO2 A;  4O55 A;  4GMJ B;  4HVJ A;  3NF9 A;  5T7B A;  3DLK A;  3L2U A;  3VQ8 A;  1LWC A;  5HP1 A;  1NKB A;  4JS4 A;  3WNG A;  1T03 A;  4MQ3 A;  3RWU A;  1S1W A;  4B9M A;  1KVA A;  3ITH A;  3SV4 A;  3SYZ A;  1W9H A;  3AVF A;  4CJV A;  2YNH A;  3C6U A;  3KKR A;  4O44 A;  4C8N A;  1B9D A;  1JKH A;  2OPS A;  3AA5 X;  4QOZ B;  3OY9 A;  3JSM A;  5I3U A;  2A1R A;  4H8K A;  2Z1H A;  4B9U A;  4CEO A;  2HW3 A;  2BAN A;  4BAC A;  3MEC A;  1TK5 A;  1WSF A;  3ZT3 A;  2YKN A;  1XC9 A;  4KKO A;  2E6M A;  4Q5V A;  4HUG A;  3RMA A;  1D9F A;  4CJK A;  1SKW A;  1UWB A;  3V9X A;  5C25 A;  1L3V A;  1S9G A;  4Z4C A;  4Q0B A;  1BQM A;  1WLJ A;  3O3H A;  3DLB A;  1JL1 A;  1L3U A;  1U4B A;  3NFA A;  2NUB A;  3ASM A;  4CEZ A;  3NGI A;  4DTR A;  1KLN A;  3OYL A;  1LW0 A;  4CK3 A;  5FRO A;  4B3O A;  5D3G A;  1HNI A;  1FKO A;  3IRX A;  4B8A B;  4CFC A;  5SZT A;  1C6V A;  3T19 A;  1GOA A;  1BIS A;  2DFF A;  3RRH A;  1S1X A;  5J2M A;  2XY6 A;  2BDP A;  4CK1 A;  1HQE A;  3H08 A;  4I7F A;  4FJ8 A;  3QIO A;  5JS2 A;  3V1O A;  2OPP A;  3IAY A;  4DMN A;  3HVT A;  1T7P A;  4FJI A;  4KV8 A;  1XHX A;  4G1Q A;  4CJQ A;  4CJ4 A;  2B6A A;  4CEA A;  3NAE A;  1U48 A;  4W5T A;  4CGJ A;  2YHA A;  1C1A A;  1JLE A;  3ZT2 A;  4KO0 A;  1XI1 A;  1X9W A;  1QSS A;  2YHB A;  3QIN A;  3SCX A;  1GOB A;  4C8L A;  3KD1 E;  4FZY A;  3L3U A;  4CJU A;  1ASW A;  4DTM A;  3M8P A;  5C42 A;  3OS0 A;  2HNY A;  3OYG A;  4CJW A;  3L2R A;  1TAU A;  4LH4 A;  4FJH A;  4FJ7 A;  1KSP A;  1VSE A;  3THV A;  4CF0 A;  4N76 A;  2VG7 A;  4DLG A;  2BGG A;  2D0C A;  2VG6 A;  2IC3 A;  1WNS A;  4FLU A;  1VSL A;  4E19 A;  2WOM A;  4IDK A;  2YNI A;  3QNO A;  1L3T A;  1JLG A;  1DTQ A;  1D5A A;  1VSI A;  4BWJ A;  3AA4 A;  1I39 A;  4EZ6 A;  4M3U A;  4O5B A;  2X74 A;  5FDL A;  3SI6 A;  2FBV A;  3DOL A;  1VRT A;  1T8E A;  3L3V A;  3OVN A;  4E7H A;  1ZBF A;  4OKE A;  4NCG A;  2Q3S A;  4DSE A;  3TAE A;  3NDK A;  1U45 A;  1RTH A;  4M45 A;  4E7J A;  4B9N A;  3DMJ A;  4FZX C;  3CFR A;  3HO1 A;  4OKJ A;  3AO2 A;  3TI0 A;  1WSH A;  2HMI A;  3JYT A;  1IKX A;  4DF4 A;  1NJX A;  4KRF A;  1BI4 A;  4CHO A;  4CF2 A;  3O4Q A;  3LAM A;  1TKD A;  2JGU A;  4DTU A;  3SV3 A;  4QAG A;  4CGG A;  1YVU A;  3AVJ A;  3D45 A;  4CER A;  2P1J A;  1LV5 A;  4FJN A;  1NK4 A;  4FVM A;  4B9T A;  3IS9 A;  1VSD A;  3AA3 A;  4OJR A;  4CES A;  1JL2 A;  5J2Q A;  3WNH A;  2P5O A;  3RRG A;  4C8O A;  3D0P A;  1S1V A;  2HVI A;  2IDO A;  4N41 A;  4FLT A;  4CEC A;  4KB0 A;  4CJ5 A;  3S9H A;  4IFY A;  3M8S A;  2HHX A;  4DTX A;  4C8K A;  4W5Q A;  1Q9X A;  4Z4E A;  3IG1 A;  2F8T A;  2FBT A;  5JS1 A;  2KQ2 A;  1WAF A;  3TAN A;  3DLR A;  3LAL A;  1SUQ A;  3VQA A;  3L2V A;  4XIU A;  3LP2 A;  5KRS A;  4I2P A;  1CLQ A;  1LAV A;  4OVL A;  1D9D A;  4CHY A;  4FJJ A;  1Q9Y A;  4WE1 A;  3HL8 A;  2Z1I A;  1RTI A;  3AO5 A;  4KHN A;  1HYZ A;  4FXD A;  2YNF A;  1SKS A;  4ELT A;  1RT1 A;  3PUF A;  1NKE A;  4F2S A;  1QE1 A;  4O0J A;  4MFB A;  5C24 A;  4N56 A;  4F2R A;  3NCI A;  2RN2 A;  3HPO A;  1RTD A;  3BDP A;  4J2A A;  1XHZ A;  3LWL A;  2X6S A;  4KHU A;  3OYK A;  3SQ1 A;  1WSJ A;  3OJS A;  4OGE A;  2QXF A;  4CF1 A;  4JRP A;  2Y1J A;  3MEE A;  2PYL A;  1HYS A;  4PA1 A;  2YV0 X;  4Z4H A;  4DWI A;  1Y97 A;  4ELV A;  4IKF A;  1BIZ A;  1CXU A;  3LDS A;  4HUF A;  4E7K A;  1RDA A;  4M42 A;  1ASV A;  3DRS A;  3V9Z A;  3V9U A;  4DS4 A;  3ZSR A;  1J5O A;  4GW6 A;  1NK8 A;  1NJW A;  1TV6 A;  1NKC A;  3VQ9 A;  3OYF A;  3OYM A;  4B9S A;  2HNZ A;  2RPI A;  1TL1 A;  1HPZ A;  3HYF A;  4CFB A;  2VWJ A;  1B92 A;  4HHT A;  1U04 A;  5SWM A;  3C94 A;  4FJ9 A;  4CGH A;  3VQ7 A;  4DTN A;  2HHW A;  3F9K A;  2RKI A;  3DOK A;  1TAQ A;  4CJR A;  3MAQ A;  1RT4 A;  4FW2 A;  4CF9 A;  3LPT A;  3SPZ A;  4KAZ A;  3WNE A;  3LPU A;  3QES A;  1IKW A;  2B4J A;  1VSF A;  2D0B A;  3NE6 A;  4HTU A;  1TKX A;  1KRP A;  1S6P A;  3NF7 A;  3VQE A;  2XRI A;  3RMD A;  3HT3 A;  3SQ2 A;  2VWK A;  2Z1J A;  4FLW A;  3CYM A;  4RW9 A;  4CHZ A;  3O3F A;  4CJT A;  3RR7 A;  1N5Y A;  4DFP A;  2X78 A;  1NK9 A;  4E0D A;  4E89 A;  1HNV A;  3CG7 A;  3VQ4 A;  5HRO A;  4DSI A;  4DTS A;  2P5G A;  1EX4 A;  3PX6 A;  3ZT4 A;  2XY8 A;  2XHB A;  1YTU A;  4Y1C A;  2WON A;  3KTQ A;  1RDD A;  1A5X A;  1A5V A;  1VSH A;  4C8M A;  3CFP A;  3SPY A;  1TK8 A;  2G8H A;  1RT6 A;  3V9S A;  2O4G A;  1RT7 A;  4BE0 A;  3DI6 A;  3UIQ A;  1ASU A;  2VG5 A;  2OA8 A;  1NK0 A;  1KTQ A;  1NK7 A;  1S1U A;  3AVC A;  1CZB A;  2QKK A;  4M3Y A;  4RW7 A;  1QTM A;  1JLA A;  5EU7 A;  1HJR A;  1QHT A;  3RTV A;  1KLM A;  4KRE A;  2GV9 A;  2HHV A;  4CIG A;  4CHN A;  1A5W A;  3OYE A;  3AVB A;  1FKP A;  1TVR A;  2F96 A;  1TL3 A;  4H4O A;  4OGC A;  1DTT A;  1UOC A;  2FBY A;  1LW2 A;  4CF8 A;  4CJL A;  2G8W A;  1Z26 A;  2FBX A;  3ZT0 A;  4LSN A;  4Z4G A;  3QEV A;  4BDP A;  2YNG A;  3SUN A;  1JLQ A;  1RTJ A;  5HBM A;  3V9W A;  3KD5 E;  4CJS A;  1G15 A;  3LP3 A;  2XY7 A;  3QEW A;  5E41 A;  5KGX A;  3MXI A;  4CJ3 A;  2R7Y A;  5KI6 A;  4N5S A;  4F8R A;  3K59 A;  4KTQ A;  2IGI A;  1TK0 A;  1C0M A;  4NCA A;  4FK2 A;  4CJE A;  4M3Z A;  3DLE A;  4OLA A;  4CJP A;  3AO3 A;  3KK2 A;  4M3W A;  3AVA A;  3LP0 A;  1RDC A;  4B9V A;  3AO1 A;  3M8R A;  4UQG A;  2E4L A;  3P5J A;  2P51 A;  1EET A;  1NJZ A;  4EZ9 A;  3KK1 A;  2AJQ A;  4O4G A;  4DU3 A;  4YFU A;  4FJL A;  3PV8 A;  4OPK A;  3FFI A;  3K5O A;  3HVR A;  3NH1 A;  4AIL C;  4DQP A;  3V81 A;  3HK2 A;  4FLX A;  4J2E A;  2HVH A;  3B6P A;  4AH9 A;  3TR8 A;  2IOC A;  1S9E A;  4CHQ A;  4JS5 A;  1BHL A;  1Q8I A;  3TAG A;  2HHU A;  2ZD1 A;  3U6F A;  3LWM A;  2G8U A;  1Z25 A;  5DK5 A;  3SJJ A;  4CGD A;  1MU2 A;  4DG1 A;  2O4I A;  1D8Y A;  4DU1 A;  2B5J A;  1HYV A;  1B9F A;  4AHU A;  4CHP A;  1SL2 A;  1EKE A;  4DSL A;  4E1N A;  1UA1 A;  1LWF A;  2G8V A;  2YKM A;  4LH5 A;  2OPQ A;  4BE2 A;  4Y1D A;  1NOZ A;  1ZYQ A;  5DMR A;  2DFE A;  4Z4I A;  1BGX T;  3PX0 A;  1SL1 A;  4DSK A;  4FCY A;  1J53 A;  1WN7 A;  4FM1 A;  1C0U A;  3LAN A;  1FK9 A;  1VRU A;  3QET A;  3U3Y A;  2Z1G A;  3T3F A;  3VA3 A;  1ZBI A;  3VQ5 A;  4CE9 A;  3KLE A;  1BIU A;  3NF6 A;  4KFB A;  3AV9 A;  3RMB A;  3KIO A;  1QQC A;  1LWE A;  1O1W A;  2E6L A;  2D5R A;  1RBS A;  1BCM A;  5KTQ A;  3VQQ A;  3K57 A;  3LZJ A;  4FJM A;  1UAX A;  4BWM A;  4CFD A;  3OYN A;  1RT2 A;  2I5J A;  3AVG A;  4PUO A;  4LD0 A;  3OYI A;  1TKZ A;  1FXX A;  1GOC A;  4AHR A;  3EZ5 A;  4DS5 A;  4KHW A;  1RT3 A;  1ZBL A;  2IS3 A;  4AHT A;  3MEG A;  4DU4 A;  1RDB A;  5HRN A;  3OYA A;  1DLO A;  1VSM A;  1W0H A;  3QEI A;  1WAJ A;  4Z0U A;  3C6T A;  4BDZ A;  3P1G A;  1N6Q A;  3T1A A;  3LZI A;  4DTP A;  3HP6 A;  3U3G A;  2KZM A;  2QKB A;  4CEB A;  2DY4 A;  3EY1 A;  3OYC A;  5HRR A;  3SUQ A;  3B6O A;  1QSL A;  3I8D A;  1ITG A;  3CFO A;  1J9A A;  3MXJ A;  3K2P A;  4J2D A;  1NK6 A;  3K5L A;  4B08 A;  2QK9 A;  1HRH A;  3QNN A;  1WSE A;  1JLF A;  4RW6 A;  4W5R A;  4W5O A;  2OZS A;  1J54 A;  4DSF A;  3HPG A;  4FJG A;  4HCB A;  1HQU A;  5HRS A;  1U47 A;  2HHT A;  3DM2 A;  4NYF A;  1K6Y A;  4Z4F A;  2KFN A;  3KLG A;  3ZSV A;  1X1P A;  3ZT1 A;  3NBP A;  4CGF A;  1LAW A;  1IKV A;  3KKS A;  3ZCM A;  1L5U A;  3F73 A;  4IG0 A;  4I2Q A;  5J2N A;  5K14 A;  3ZSZ A;  4E3S A;  3SQ4 A;  1YT3 A;  1C1B A;  2ETJ A;  3KLH A;  1SV5 A;  3SZ2 A;  4I9Q A;  4FW1 A;  4KTZ A;  3G10 A;  1WSI A;  1QSY A;  4FLV A;  3TAQ A;  4F3O A;  4RW4 A;  2G8F A;  4DSJ A;  4KPY A;  3VN5 A;  4DQR A;  2HHS A;  2DTU A;  3CM5 A;  3CM6 A;  3NHG A;  3ULD A;  1SKR A;  3A2F A;  5CZ1 A;  4DQQ A;  4DF8 A;  4ID5 A;  3M8Q A;  1RBT A;  3I0R A;  4DFJ A;  1RT5 A;  5J2P A;  4F4K A;  2HND A;  3OYD A;  4HCC A;  1VSJ A;  5FRN A;  4KB1 A;  3SUO A;  1S5J A;  1IKY A;  4M41 A;  3NF8 A;  3HXM A;  3S3N A;  1U49 A;  4CGI A;  1F21 A;  4NCB A;  1EP4 A;  3QLH A;  2PZS A;  1REV A;  3AVM A;  1VK0 A;  1SL0 A;  3TAM A;  4KHY A;  3PX4 A;  3NH0 A;  4ZHR A;  4J2B A;  1JLB A;  1R0A A;  4R5P A;  3HP9 A;  3ZSQ A;  1RBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...