4BREA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with transition state mimic adenosine 5'phosphovanadate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
358
structure length
358
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 118
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4breA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4breA02
4M7YA 4FO0A 2E2OA 2P9NB 5EXWA 5JLFA 4CZIA 3F9MA 3JS6A 1ATNA 2HOEA 1NLVA 3VETA 4BROA 1ZXOA 2P9PB 2UYTA 1Y64A 2V52B 3WXJA 4WQ5C 4MO5A 4BC4A 3VEYA 4BC2A 1JCFA 1C0GA 1NGDA 2CGLA 3FR0A 5AZIB 2NRHA 1GLLO 2HMPA 2P9IA 1S3XA 2H3GX 4BRIA 4PL8A 4BRMA 1T44A 4H0PA 3QDKA 4M63C 3UKUB 1IG8A 5AQYA 4WQ4A 5ELZA 2J4RA 5AQKA 5AQUA 2D4WA 3A0IX 2DPNA 4H5TA 4J8FA 5BRHA 4FOIA 5TKYA 2HF4A 1DKGD 1NGCA 1U2VA 2QWLA 2D0PA 3W0LA 3SJHA 3H46O 4YDUC 1TUUA 4CZJA 3BF1A 5KQ8A 4RTFD 3S41A 3WXKA 5B8HA 4EAHD 3WUHA 4H03B 1RDWX 3WT0A 3CJ7A 1RFQA 3FZHA 2QWNA 3RSEB 1Z05A 4NO7A 3O1WA 3VF6A 5AQVA 3R8EA 2A5XA 2E1ZA 5BPLA 2Q2RA 2CH5A 3CHWA 1K8KA 3DXKB 2GUPA 2BUPA 2QWQA 5AQMA 2YJEA 1C0FA 4BQLA 2QXLA 2FSJA 1GLJO 3KVGA 4BRDA 4FWQA 5AQWA 1GLCG 5LJWA 1GLFO 2ASOA 3C7NB 1T6CA 3ENHA 4FPAA 4IJAA 4IO8A 5AQFA 1ATRA 3GE1A 2ZWHA 3EN9A 3H6EA 4H0XB 2E20A 4ISFA 3FFKB 3CIPA 3QICA 4A62A 5BRDA 5AQIA 3FLCO 3O4WA 4FWLA 3LDPA 3MN7A 3VF2A 5AQXA 2Q31A 1X3NA 5AQZA 4WQ5A 1BG3A 1QQOA 5F1XA 3EZWA 5AQPA 5JMVA 2Q0UA 1NGHA 4BRHA 3QBWA 3SMSA 3A8YA 3M3ZA 1KAYA 4BR5A 4RCHA 4WYBA 1S22A 2E1YA 1E4FT 5E84A 2EWSA 2I7PA 2I7NA 2PAVA 3D7EO 1LCUA 3GL1A 4O8KA 3EKSA 4FWKA 2NLXA 4K41A 4FWOA 1GLEG 3CJ9A 4JHDB 4BRGA 4CZEA 1X9JA 3D2EA 4BVPA 3EKUA 3CERA 2V7ZA 3GOIA 3MN9A 4AM6A 4JAXA 5AQRA 3VEWA 4YDUA 1U6ZA 2OANA 3D2FA 3UE5A 4ISEA 3VENA 3HTVA 4XH5A 4C23A 1OKJA 3GBTA 2A3ZA 3CQXA 1BOTO 3KHYA 4CZLA 3CJ1A 3QFPA 1XQSC 1HKGA 2QM1A 1P8ZA 4F9OA 4BR4A 5JLHA 4B1XB 3U4LA 4QS9A 3O5BA 2P9IB 2F9TA 4BGBA 4FWMA 2YHWA 5AQTA 3VGKA 2A6AA 3AY9A 4BR7A 4XEIA 3LDQA 3VERA 4BRQA 1MA9B 3O08A 4H5WA 1NGAA 1HPMA 3LDLA 5AFUH 4BC5A 2FF6A 1SZ2A 5AQNA 1RGIA 3P4IA 1U2VB 4JD2A 4B1YB 1KAZA 2FLOA 5AZJA 3LM2A 3QB0A 4A61A 4BRKA 4E1JA 4BG9A 3LDNA 5I9EB 2GEMA 3WXIA 4A2BA 1JCEA 2AP1A 2V7YA 3O8MA 4B1WB 4CJ7A 4PKIA 3DXMA 5LJVA 2QW9A 5F2RA 3VEXA 4QS8A 2YI1A 3U9ZA 2KHOA 4FL9A 4EIAA 5BPMA 1K8KB 3O1BA 3I8BA 1NGIA 1HX1A 1X3MA 3ULEA 1BU6O 5EOYA 2ITMA 4IXCA 1HUXA 4DQ8A 4PL7A 1J6ZA 1XUPO 3JXUA 1BA1A 4H5RA 1DGKN 4MLEA 2D1KA 2YJFA 4B1VA 4BRNA 1LOTB 2QWOA 1MWKA 2P9SA 2P9UA 5KPRA 3ZX0A 4Y0WA 4BRPA 5ADXA 2ASPA 1H1VA 3VOVA 1XC3A 1EQYA 1BA0A 1NGFA 3HSCA 2FXUA 1MDUB 1HLUA 3ZEUB 3MMVA 3H3NO 3CJBA 3GG4A 4HWIA 4H0OA 5KQDA 3MK6A 2IVOA 3M1FA 4BVOA 4FWNA 3A5LC 2VCPA 3SLCA 3AAPA 4H5VA 5JICA 4EHTA 3BUZB 3IDHA 4CZKA 2NZTA 4CD1A 1Q18A 1YAGA 2CGKA 3WQUA 1NBWA 5FPDA 3SMPA 3DJCA 4FPBA 4H0TB 5AQGA 3DAWA 1QZ5A 3D2EB 3O80A 1NWKA 3A5OC 2GWKA 2IIRA 1CZAN 3HM8A 3ZETB 3C7NA 3D2FB 3FZKA 3LL3A 4CBWA 4M7XA 3A5NC 5AQQA 5AR0A 2Q0RA 3U9DA 4H0YB 3UB5A 5AQLA 1TYQA 1V4SA 2A40A 4FSVA 4H5NA 1SQKA 4CZFA 5BREA 2P9LA 4CBUA 4FWPA 4IJNA 3IUCA 3QFUA 4QS7A 3I33A 3TU5A 4IWVA 2AA4A 3GDQA 1E4GT 2YCHA 3MCPA 2GTDA 4BREA 4CI6A 3WEEA 1BWFO 4H0VB 3ATUA 4I6MA 2IVNA 4NB4A 3VEOA 4BR0A 3MN6A 5KPTA 3TPQA 3WXLA 4PKGA 2A42A 3VESA 2V51B 4BRFA 3J8AA 3VEZA 2Q36A 5E26A 1WOQA 1NGGA 3IMXA 1HJOA 2E88A 2W40A 4JD2B 5AZJB 4FOEA 1JCGA 4EFHA 2D0OA 3ZX3A 3UKRA 4B1UB 4ISGA 2YHYA 5FPNA 3MDQA 2YHXA 3HI0A 2VYPA 2E8AA 4BG8A 3BP8A 2VWBA 3BEXA 3DXMB 2P9KA 1D4XA 3R6MA 3CJCA 1MWMA 1R59O 3OHRA 4DHYA 3G25A 1YXQA 3CQYA 3FZLA 1YVNA 3EL2A 1NGBA 2GELA 2P9NA 2QWRA 1GLAG 3CETA 4XH1A 3ULEB 3VF4A 4MO4A 3SK3A 1V4TA 4BC3A 3H3OB 4RWTA 3H1QA 5LY3A 4CZGA 3H45C 2P9PA 3FZMA 4BRAA 3L0QA 4CBXA 1WUAA 2ZF5O 3M6GA 3WQTA 2ZGZA 1NM1A 2P9SB 2A41A 2FSNA 2P9UB 4FWSA 4DCHA 4BGAA 1Z6RA 2Q97A 2ZGYA 4JNEA 3L6QA 2ASMA 5AQOA 4FWRA 2HF3A 3VGMA 4BRCA 4O5FA 5AZIA 3AAQA 2QWMA 4MLHA 5F0XA 1GLDG 1HKBA 3EO3A 4B1ZA 3B8AX 5EVZA 1ZC6A 3UKUA 3VGLA 1QZ6A 1NGJA 1KXPA 1G99A 3QBXA 3ZX2A 3ID8A 3C0BA 1GLBG 2CH6A 2E2QA 1KAXA 4GY2B 4BR2A 3VEVA 4A2AA 3MN5A 3O6WA 3AARA 4JN4A 1HKCA 4HTLA 1SAZA 4PKHA 3U8XA 5AQSA 3RSEA 2E2PA 4DB3A 1NMDA 5BN8A 3VPZA 2GWJA 1TUYA 3KZBA 4KBOA 3LM9A 4L3QA 3DXKA 3W3DA 1YUWA 2BTFA 2CGJA 4K42A 1TYQB 2Q1NA 1QQNA 3IFRA 3CI5A 3R9PA 4Z94A 2P9LB 3ATVA 5ADXH 1BO5O 1IJJA 4WQ4C 4CZHA 5BR9A 5FPEA 3ENOA 5BN9A 3ZEUA 2WUSA 5AQHA 5AQJA 5EY4A 4BQZA 4LC9B 3WEEB 4GNIA 2FSKA 1ZBSA 3CJAA 1QHAA 4XH4A 1BUPA 3LDOA 4CZMA 2QWPA 4I6MB 2F9WA 2W41A 5BPNA 5BRFA 1ESVA 4AM7A 3FGUA 4K25A 3HZ6A 1DEJA 4B9QA 4BR9A 3A5MC 4BRLA 4EHUA 1QQMA 3FZFA 3BF3A 5FPMA 2FF3B 3DWLA 1BDGA 3HBTA 3QMLA 5CE3A 2E2NA 5AFUA 3UKRB 4IZ9A 1ATSA 3L4IA 1T6DA 2IVPA 5EX5A 2P9KB 4K43A 3ZETA 1NGEA 2PBDA 4CD3A 5KPZA 3H1VX 3FE1A 4JHDA
chains in the Genus database with same CATH superfamily
2NRRA 4M7YA 4B8AB 2E2OA 1UAXA 1R0AA 3OJSA 2HSTA 2RF2A 1S5JA 4E7JA 4FJXA 4BROA 2HNYA 1RT2A 2V52B 3CCVN 4WQ5C 1SKWA 1S9GA 2IAJA 3E9LA 2CGLA 3TSQA 3K57A 4C1NI 1NG9A 3UKUB 3QDKA 3VQ6A 1IG8A 4LSNA 5AQYA 4WCEL 3QNNA 3VQ5A 2J4RA 5AQUA 3A0IX 5BRHA 4FOIA 5CYMA 5TKYA 5A2QO 3NAEA 2X6SA 3KWIA 4YNQA 2O8FB 3J81O 2QWLA 1I3AA 4CZJA 3O4NA 4G9ZA 5KQ8A 3BZKA 3CMAN 3S41A 1QSYA 4H03B 1RDWX 4IBNA 3SZ2A 4B9NA 3N4QA 1Z05A 2NNWA 4FM2A 4DLGA 4FJ5A 4FLVA 5J2PA 2CH5A 2RHKA 4CFCA 3I0RA 2GUPA 4BDYA 3KLFA 2HHVA 3SPYA 1C0FA 1JLEA 2QXLA 3NCIA 4BE1A 1FKPA 3LP1A 4I9LA 3C95A 5GIPA 4BRDA 3QINA 1YJNN 4OLBA 3C7NB 3SQ1A 4FPAA 5J2NA 3NDKA 3GE1A 3SAFA 3KIOA 2ZWHA 2OPPA 2KFZA 3KJVA 4ISFA 4H0XB 2E20A 3LALA 3SJJA 3DLGA 4B3TK 2WOMA 1HNZK 3CYMA 3O4WA 3NH1A 1RBTA 4YHHK 3O3HA 3MN7A 1RT3A 3VF2A 3KLGA 4OGEA 3O3FA 3PV8A 2JWLA 5CHIA 1TV6A 5HRNA 3EZWA 5AQPA 5JMVA 1NGHA 3V1RA 4DTSA 1JXBA 1S1XA 1KAYA 1BHLA 3JYTA 1S22A 3DRRA 2OZSA 5E84A 2EWSA 1RT4A 2I7PA 4KPYA 1RBSA 3E66A 1LCUA 4CEOA 1VQMN 1DLOA 4M3ZA 5C10A 3CJ9A 3AV9A 4CZEA 1M1KO 3D2EA 3CERA 1RTIA 3K5LA 3TABA 3GOIA 5D3GA 3K58A 4JAXA 4YDUA 1U6ZA 2OANA 3D2FA 4KO0A 1RTDA 4ISEA 3G71N 4FJIA 3HTVA 4CJ5A 1JLQA 4XH5A 3NVKA 4M3UA 1OKJA 4N47A 1O13A 3KHYA 4YORA 2YNGA 4CZLA 3CJ1A 3K9JA 1HKGA 1P8ZA 4I2QA 4BR4A 2VGNA 3F73A 3O5BA 2P9IB 1NJIO 2G8VA 2HBLA 1RT5A 1IBKK 3NGIA 5I3UA 3LDQA 3VERA 2HHTA 1MA9B 4H5WA 1J5EK 3OYMA 1BCMA 2KTQA 5M1PA 1NJYA 1NGAA 3RMDA 4LY7A 5AFUH 3PY8A 4YOTA 2YX6A 2DFHA 1KAZA 5AZJA 2W6LA 4KRFA 3ISNC 5DK5A 3QB0A 4CF0A 3CCMN 4NCAA 4BRKA 4E1NA 4E1JA 3C6HA 1KQSM 3MWPA 3WXIA 4X66K 4C8MA 4C8OA 4B1WB 1XC9A 3DXMA 5KGWA 5F2RA 2D0CA 2QTDA 5I42A 3HYFA 2KHOA 3TARA 1HX1A 1X3MA 4W5QA 3VTHA 2FBXA 4ID5A 4FK2A 1J5OA 1XUPO 1BA1A 1HJRA 4W5OA 2YJFA 3PSFA 4YY3K 4CJEA 1MWKA 2P9UA 3VTIA 1NNEA 1Z25A 4DFKA 3MX5A 3VQQA 1NGFA 3VQAA 1OH8A 2FXUA 1KRPA 1MDUB 1BGXT 1NK9A 5M1FA 1HLUA 3ZEUB 3CMEN 4KHYA 3MMVA 3H3NO 2O8BA 3IS9A 3ENBA 5LMUK 3VQDA 2FBYA 3AO5A 3QERA 2OTLN 3OY9A 3AAPA 5KTQA 4FCYA 4EHTA 1W9HA 3BUZB 3IDHA 3VQBA 2YKMA 1REVA 4KKOA 5M1QA 4HUGA 4NXNK 1XMQK 3DJCA 4H0TB 5AQGA 3RVCA 1QZ5A 3O80A 4DSIA 1NWKA 3A5OC 3HM8A 4N76A 3C7NA 3VA0A 4FJMA 3A5NC 3M5RA 1QS4A 3QO9A 4JK7A 2UUBK 3ZT1A 5BREA 3V1QA 3LDSA 1BISA 2AA4A 4OPAA 3MCPA 2UXBK 1MU2A 3WEEA 1IV0A 4A5AA 5T7BA 3ATUA 3RR7A 4DKWA 1BIUA 1ZBHA 3TPQA 1EO1A 3VESA 5E26A 3CCEN 2QA4N 1S6QA 4JD2B 5C24A 4M42A 1JCGA 2EX3A 1NJZA 1L3SA 1WSFA 4RW7A 2F8TA 3HI0A 5DM7L 5C42A 4LF7K 2VWBA 1T8EA 3BEXA 4H8KA 1A5VA 4LSLA 1MWMA 2DFFA 3OHRA 4NYNA 1X9WA 4A5BA 3FZLA 1N34K 2XRIA 3EL2A 3OS0A 1NGBA 2GELA 5JVHL 1GLAG 3CETA 3ULEB 3O9UA 3H45C 1CZ9A 3S9HA 3RMAA 4CBXA 4CEQA 3TAFA 3TAEA 1T7PA 4LF6K 2VWJA 3M6GA 1NM1A 2FSNA 5JS2A 1SKSA 1IH7A 1K73O 1N8RO 2Q97A 3L6QA 1GOBA 2ASMA 3RWUA 3VGMA 4O5FA 1VSJA 2QWMA 4CIEA 5F0XA 3DMJA 1DTTA 3B8AX 1ZC6A 4AHSA 2DTUA 3J80O 1KC8O 2HNZA 1QZ6A 4BE2A 1NGJA 3L2WA 4FLTA 4JYAK 2F7TA 5SWMA 1RT1A 3C0BA 3EYZA 3LANA 2CH6A 3O3GA 3CPEA 1VSDA 4JI0K 4M3RA 3HPGA 3AARA 3SAGA 3L2QA 1HKCA 4HTLA 2AJQA 1A5WA 3RRHA 1VSMA 1KVBA 1J9AA 1LW0A 3DLEA 4JI3K 3U8XA 1A5XA 1XHZA 4O4GA 4DU4A 3RSEA 4LF8K 3V1OA 2YHAA 2QEXN 3KLHA 4M3YA 2JGUA 1YUWA 1JLAA 2ZM6K 1TYQB 1QVFM 3ASMA 5H1SQ 5HLFA 2GBZA 2P9LB 5ADXH 3I55N 4WQ4C 3F2KA 4NXMK 2XO7A 3LPUA 5BN9A 1S1WA 3ZEUA 5LMNK 4LC9B 1QTMA 4GNIA 1TAUA 3OYDA 4NLBA 3Q7BA 4XH4A 1D9FA 1X1PA 4JKCA 3AVJA 4LH4A 2QWPA 1HQUA 4GKJK 1ESVA 4AM7A 3FGUA 3K0SA 2FBVA 1T05A 1DEJA 4B9QA 2B6AA 4Q5VA 4DF8A 2FF3B 3L2UA 3PX4A 2HHSA 3UKRB 5M1KA 1SL0A 4YOXA 1KLNA 3MEEA 2IOCA 1S1VA 2IVPA 5EX5A 4K43A 1NGEA 4ILJA 3ZSVA 4A57A 3NF8A 4JKGA 4LFAK 1TL3A 4JHDA 2PZSA 4F4KA 4K8ZA 2P9NB 1VK0A 5EXWA 1NK5A 2E6MA 4DS5A 1ATNA 4JI5K 3VA3A 2HOEA 1NLVA 3R3LA 3VETA 2DY4A 4DFMA 3LWLA 4FLYA 2G8WA 3KLIA 4MO5A 4BC2A 1JCFA 4JI2K 4WFBL 1C0GA 4PQUA 3I0SA 4EP4A 3FR0A 2GX9A 2E5LK 4L8RB 1S3XA 3V9SA 4RW9A 4BRIA 2D0AA 3U3GA 4H0PA 2HVHA 1NK4A 4KHPK 4IFYA 4W5NA 2UUAK 1KCFA 1S1TA 2DPNA 3CXCM 2HF4A 3DLHA 4ZTJA 1U2VA 1TUUA 3AVCA 4AHRA 3NGYA 2HW3A 5J2QA 4Z4IA 4EAHD 1TKZA 2ZJRL 3WUHA 1SL1A 4GV6A 5GINA 2I5JA 1RFQA 3FZHA 2HB5A 1KD1O 2YNFA 4NO7A 3O1WA 3OYKA 2D5RA 3THXA 4F2SA 1M90O 1JLGA 1K8KA 3DXKB 2BUPA 2QWQA 2YJEA 1BI4B 5DM6L 2XY6A 1OVYA 2XY7A 3NVMA 1GLCG 3AVBA 3HJFA 4HCBA 3AGRA 3OBYA 4IO8A 5AQFA 3V9UA 3H08A 4CHNA 3EN9A 3H6EA 3TI0A 4A62A 3OVNA 1JLBA 1C0UA 2Q31A 4JS4A 3F9KA 3DOLA 3QNOA 2KFNA 3LP2A 1QQOA 3VQ4A 2P5OA 2VG6A 2Q0UA 4BRHA 3MECA 4BR5A 3HPHA 4RCHA 1WBBA 1VAZA 2E1YA 1LV5A 4AHCA 2WC9A 4CGHA 4DQPA 4O8KA 3AA5X 1VRUA 3EKSA 4KI4A 4DR6K 4JKEA 4FWOA 4BRGA 5C0YA 4BVPA 4CJVA 2D0BA 4E1MA 3MN9A 4AM6A 4CHOA 1C1CA 5AQRA 1NJWA 3ZT3A 4MDBA 4NYFA 1JLCA 5FLXO 3C6AA 4N41A 2OYQA 3ZYYX 3GBTA 3CQXA 2O8EB 1W2BM 1XQSC 2QM1A 2X78A 4V19S 1Y97A 3KWGA 4BDPA 4QS9A 2YHWA 4FM0A 4GVEA 4K8XA 1JL2A 2XY8A 3AY9A 4BR7A 4CGFA 4DR2K 3D45A 3HM9A 3O08A 4KTWA 3O9TA 4N56A 3K5MA 4FJGA 3P4IA 1C1AA 3K5NA 1VSHA 3MEGA 2FLOA 4KAZA 4JKFA 4R79A 4BG9A 4KH6A 5I9EB 2GEMA 3LZJA 4A2BA 1JCEA 2W6KA 2QXFA 3MWTA 5LJVA 2WFBA 1YIJN 3NE6A 2RN2A 4M45A 3OYLA 4QS8A 4O0JA 3U9ZA 4EIAA 5HBMA 4I9QA 3CCRN 4DV0K 3KKSA 5C25A 1BU6O 5BR8K 3TAQA 1TK0A 1DT9A 4WFAL 4YOVA 4IXCA 5E41A 4B9SA 3WNGA 4PL7A 4CEAA 3P38A 4MLEA 4E19A 3AVLA 1LOTB 4HVJA 3OBWA 3KD5E 3VQEA 1NJXA 4CECA 4QOZB 4Y0WA 2ASPA 3LP0A 4M3TA 3M8QA 5LL6Z 4CFAA 4DSKA 3HSCA 2ITGA 1YHQN 3PX6A 4E7LA 3SI6A 2P5GA 1XHXA 3MX2A 4CIGA 4DLEA 3GG4A 4HWIA 1SKRA 4H0OA 5KQDA 4FWNA 4AF1A 3TWHA 3SLCA 1VQ7N 1YITN 1LAWA 4CZKA 3VMFB 2NZTA 1LWCA 2CGKA 2QK9A 3QEPA 1NBWA 4AH9A 4CHYA 2F8SA 3SMPA 4FPBA 4LH5A 2RE2A 3DAWA 4J2AA 3L2VA 4FJ7A 1RBRA 4H4OA 2OPRA 3WNEA 4DQSA 3ZETB 1Q8IA 4E89A 2HMIA 3ZLJA 3RMCA 2G8FA 5AQLA 2A40A 1TKXA 1SQKA 4X65K 4CZFA 4CBUA 1SV5A 4B08A 4QS7A 3TU5A 4IWVA 3CF5L 5JS1A 1BWFO 1WSHA 4CF2A 2UUCK 3VEOA 1LWFA 4BR0A 5KPTA 2PYJA 4BRFA 3VQPA 3CM5A 3VEZA 2BE2A 1NGGA 2E6LA 1YI2N 1ASWA 3C94A 3U6FA 3AVMA 5CYQA 4B1UB 4ISGA 5FPNA 4CE9A 2QKBA 2YHXA 4XIUA 4DV3K 2O8DA 3PX0A 3BP8A 3FFIA 2F96A 4CHQA 3SUPA 3RRGA 2P9KA 1WBDA 2IC3A 2G8HA 2ZJPL 1R59O 4DHYA 3G25A 1IBLK 4JV5K 3D6RA 5KGXA 4IDHA 4KHSA 2QWRA 1RDBA 1HNXK 4XH1A 3NH2A 4FLZA 5FDLA 1NKCA 4J2BA 4BACA 3SK3A 1V4TA 4BC3A 3N4PA 3H3OB 4RWTA 4BWJA 4CK3A 3P39A 1WSGA 3PIOL 3T1AA 4UQGA 4BRAA 1UA0A 3AVFA 5K14A 4F8RA 4CESA 2ZGZA 4R5PA 2P9SB 1RT7A 4JK9A 4JNEA 3TSUA 3IRXA 2Y1IA 4BRCA 4MLHA 3EO3A 4B1ZA 4B3RK 2OPQA 3CD6N 3DLRA 3UKUA 3K2PA 2X74A 3HXMA 1KXPA 3QBXA 1VSLA 4OVLA 3IG1A 3ID8A 4KHUA 3OYCA 1ZBLA 1BCOA 1GLBG 2P1JA 3VQ8A 5HRRA 4OX9K 4DTJA 2O8FA 2E2QA 4Z4GA 1XI1A 3VEVA 3O9RA 1K9MO 2HHXA 3E1YA 4W5RA 4PKHA 2A1SA 4Y1DA 3KK3A 1KVCA 4KFBA 3D0PA 2E2PA 1NMDA 4CFDA 4JRPA 3VPZA 1TUYA 3KZBA 4KBOA 1RILA 3LAKA 4RW8A 1JKHA 3LM9A 4DV6K 2O4IA 2KZZA 2HHUA 2Q1NA 3TR8A 3IFRA 3CI5A 3R9PA 1BO5O 2KKZA 4CZHA 2HVIA 1EWQA 3ZSRA 4DTOA 4LF5K 1ASVA 5EY4A 1WLJA 3IKMA 3O9SA 1WAFA 2FSKA 4Y1CA 3DYAA 3AA3A 1G15A 1BUPA 4I6MB 1FKOA 2HBKA 1YF5L 3HZ6A 1HR0K 4BR9A 4DTMA 5FPMA 3K59A 5HOOA 1BDGA 2E2NA 3QEWA 4FYDA 3L4IA 1T6DA 3ZETA 4F3TA 2PBDA 1YTUA 4CD3A 1HMVA 5KPZA 3SUOA 3H1VX 2ZE2A 2EHGA 3FE1A 3CJAA 1D5AA 3AA2A 3UIQA 2NRZA 5JLFA 3F9MA 3JS6A 1K8AO 1VQON 1HNWK 4DUYK 4E0DA 1YJWN 1TGOA 1ZXOA 3THWB 2P9PB 3R1XA 1IKWA 1D9DA 4BC4A 3VEYA 1N32K 1WSIA 3NFAA 1VQPN 1RCHA 1O1WA 3RTVA 1SUQA 4CJ3A 1KSPA 5AZIB 1FXXA 1KVAA 2HBJA 1GLLO 2P9IA 5HRPA 1JLFA 1TKDA 3AO4A 2H3GX 4IG3A 4CEBA 4CEDA 3CCQN 4RW6A 1T44A 5GAGP 1F21A 3SQ4A 5AQKA 3THYB 2D4WA 4H5TA 1WNSA 4J8FA 3ZT4A 4EZ9A 2NRXA 2Z1HA 3OYHA 4DSJA 4E7IA 4CGJA 1DKGD 2IS3A 4DU1A 4BE0A 4IDKA 1N5YA 4YDUC 3WXKA 5B8HA 4CJPA 4BWMA 3WT0A 3CJ7A 3J7AP 4H4MA 4J2EA 4KHWA 4CJKA 2VGMA 5AQVA 4DQQA 3R8EA 4FLUA 2E1ZA 3DLBA 4DTRA 5BPLA 2Q2RA 3CHWA 1Q9YA 4WE1A 3L4QA 4ILHA 4BQLA 4QCLA 4IFVA 4IEIA 4FWQA 3NHGA 4DQIA 3ULDA 2ZQBA 5AQWA 5LJWA 1GLFO 1FW6A 1T6CA 4TSXA 4DSEA 3ENHA 1NKEA 1BIZA 3LWMA 2YNHA 4IJAA 1ATRA 4CK2A 1EXQA 3LAMA 4BY9C 3FFKB 3CIPA 5BRDA 4JRQA 3FLCO 4G1QA 4FWLA 3LDPA 1BQNA 2XHBA 4FJHA 5AQXA 1TVRA 3QEVA 3TAGA 4WQ5A 1C0TA 2HNDA 3AVAA 1B9DA 1L3TA 4MQ3A 3SMSA 3A8YA 1JXEA 3M3ZA 1UA1A 1ITGA 5KI6A 4LFCK 2BGGA 4DV2K 2O8CB 2WBNA 1E4FT 1QSSA 2I7NA 3AO2A 3D7EO 1XWLA 3GL1A 4GV9A 4B9MA 4FWKA 5J2MA 3QESA 2NLXA 4B3OA 1GLEG 3K5OA 3OS2A 1LWEA 2V7ZA 1OH5A 3VEWA 3TTCA 1IO2A 1EP4A 3SYZA 4JI7K 4AHVA 4CERA 3O4QA 3G6EN 4O8UA 3ZSXA 2GV9A 2A3ZA 1BOTO 2ZJQL 4F9OA 1FJGK 4B1XB 2Q3SA 3U4LA 4CK1A 3BDPA 4DR5K 2F9TA 4BGBA 1SL2A 5AQTA 4K0KK 1C6VA 1TL1A 2X6NA 3VGKA 3CM6A 3AO1A 1I94K 3VQCA 3AVKA 1RDAA 4KB0A 4IG0A 2ATQA 4CHZA 1HPMA 4BC5A 2FF6A 1SZ2A 4YOUA 1RGIA 3G10A 3KK7A 4DG1A 4JD2A 4IOAL 3CC2N 4Z4HA 3TTDA 1ZBFA 4NLCA 1EKEA 1HNIA 3SCXA 2AP1A 4B9LA 4CJ7A 4PKIA 4JKDA 3QIOA 3JSMA 3HOSA 1NK7A 2O4GA 4KTZA 2QW9A 3VEXA 3V4IA 4ELTA 2YI1A 5CZ2A 2KLAA 4OKKA 4FL9A 3O1BA 3ULEA 4PY5A 3KLEA 5EOYA 3LZIA 3DI6A 3DLLL 3AVNA 1J6ZA 4DSFA 1T03A 3OYJA 1DGKN 2D1KA 4BRNA 4B1VA 4KHNA 2QWOA 3NBPA 4YOYA 1ASUA 2R7YA 1XC3A 1B92A 1NK8A 2YKNA 3ZSOA 1XNRK 1E3MA 4M3WA 3SUQA 2Z1JA 4YOWA 3M1FA 4LD0A 4DSLA 4DF4A 2KZMA 2VCPA 3DOKA 3OS1A 2PYLA 5JICA 1RTHA 1WN7A 3E01A 4GKKK 2W42A 3OYGA 3OA9A 3S3OA 4IOXA 5FPDA 1KFDA 2RPIA 4MDAA 3D2EB 2Z1GA 2GWKA 3SNNA 4KI6A 1CZAN 1CXUA 3D2FB 4O44A 4GMJB 5AQQA 5AR0A 3OYAA 4CEEA 4B9UA 4JI6K 1XMOK 4H0YB 4E3SA 1TYQA 4B3MK 1V4SA 3CFOA 4H5NA 2P9LA 3PIPL 1K6YA 4IJNA 5C2DA 3IUCA 1U04A 3QFUA 3I33A 5M1OA 4DV7K 4CJSA 3M8SA 3GDQA 1OH6A 4BREA 1GOCA 5FROA 4GVMA 4JS5A 4FJ8A 3SQ0A 4H0VB 3CFRA 1HYVA 2IVNA 2VG7A 1S9EA 2A42A 2V51B 2Q36A 1WOQA 4DU3A 3P31A 3ZT0A 3IMXA 1HJOA 2E88A 2W40A 1ZBUA 3P1GA 5AZJB 2G8UA 3ZX3A 1N33K 4Z4CA 3UKRA 3MXMA 4U7BA 4C8KA 5FRNA 2VYPA 4IOCL 2E8AA 4BG8A 2ETJA 3DXMB 3R6MA 3CJCA 1VSIA 3G0ZA 2YHBA 3M8PA 3CQYA 1YVNA 2B5JA 3PSIA 4O5BA 3HL8A 3U3YA 5KRSA 2P9NA 5CR4A 1VQ9N 4CJRA 3C6TA 4HUEA 4DR3K 5LY3A 1W0HA 2PY5A 3L0QA 4J2DA 1WUAA 2ZF5O 4JLHA 4QAGA 2E4LA 4DCHA 4BDZA 2P9UB 4FWSA 3KTQA 1Z6RA 3E9PA 4DWIA 5AQOA 4FWRA 1WAJA 2HF3A 4CFBA 1DTQA 3KKRA 4CW7B 4FJLA 1VQKN 1T3VA 3VGLA 1UWBA 2O8BB 1G99A 3ZSYA 3F5TA 1QHTA 4X64K 3CC4N 3THVA 3OYNA 3HRGA 1S6PA 4GY2B 4BR2A 2FBTA 2HBMA 4OO1J 1WSEA 2QI2A 4NCGA 5AQSA 2FC0A 4NCBA 1IKYA 1NMNA 4DB3A 1VHXA 1IKXA 4L3QA 3SBTA 3DXKA 2G8IA 2BTFA 2VQFK 1BI4A 4K42A 4JI8K 3OYEA 3OYIA 5FRMA 4Z94A 1CZBA 3ATVA 4FW1A 1WB9A 3DRPA 4JI1K 5BR9A 5FPEA 3ENOA 3HVRA 5AQHA 4CF8A 2HHQA 3OYFA 3WEEB 1UOCA 1QHAA 4FK4A 3L8BA 3A2FA 2F9WA 5BPNA 4CHPA 2WTUA 3O9QA 3BGRA 1WSJA 3A5MC 4BRLA 4DFJA 4DTNA 3PUFA 3BF3A 4HTUA 3HO1A 3DWLA 3HBTA 5CE3A 3QMLA 5AFUA 1VQ4N 1W97L 4IZ9A 4OPHA 1EWRA 1P90A 1YT3A 3CG7A 1ATSA 3TTFA 2VG5A 4OKJA 1VSKA 4W5TA 4PA1A 3B6PA 1NK6A 3MXJA 1KFSA 3CCLN 3LP3A 4EZ6A 3ZSWA 4JEPA 1SS6A 5IT9O 4FO0A 4DTXA 4DTUA 4JI4K 4CZIA 2VQEK 3IAYA 1BL3A 1J54A 4ICLA 1L5UA 2NRTA 1VSEA 2UYTA 4OJRA 1Y64A 4KB1A 3WXJA 4F3OA 1RTJA 2IDOA 3MEDA 2O8EA 1VRTA 1NGDA 3QETA 4IEEA 4B9VA 3DM2A 2NRHA 2HMPA 1Q82O 4AHTA 5GADP 4DR1K 4PL8A 4BRMA 1HRHA 4M63C 4FXDA 1YVUA 4ZTFA 4WQ4A 3SBGA 5DMRA 5ELZA 5HP1A 1U47A 2YNIA 4EP5A 4CJWA 4FJNA 4ELUA 1HYZA 3L2RA 4DV1K 1NGCA 1U48A 4KHQA 2D0PA 3W0LA 3SJHA 3H46O 4FZYA 3BF1A 4RTFD 4JK8A 4KREA 3ITHA 3I8DA 3QEXA 2NRVA 2QWNA 3RSEB 2IGIA 4M3XA 4JKAA 3VF6A 2HHHK 2A5XA 4X62K 4DR7K 4OGCA 4DUZK 3AGKA 2KQ2A 2Z1IA 5AQMA 5IWAK 3SUNA 3QEIA 2FSJA 1GLJO 2G8KA 3KVGA 4DS4A 3C6UA 4JKHA 5KRTA 2ASOA 3TAPA 1IKVA 2BH1A 4CJQA 5HRSA 1RNHA 3P83D 4JKBA 3QICA 5AQIA 3BY5A 3SAHA 3HVTA 5GIOA 3KK2A 1X3NA 5CZ1A 5AQZA 1BG3A 5F1XA 4OKEA 2BDPA 4DMNA 3QBWA 3PO4A 1Q81O 1BQMA 2F4VK 4FVMA 1TAQA 1L3VA 4WYBA 2NUBA 4GV3A 3TAMA 4FJ9A 2PAVA 4CGIA 5C2FA 1YJ9N 3NMUA 5MLCQ 4PWDA 1HYSA 4JKGB 3RMBA 4K41A 4JHDB 4KH5A 1RDDA 2OZMA 1X9JA 4KH4A 3T1HK 3EKUA 3HP9A 1U45A 4I2PA 3NGZA 3VQ7A 3AVIA 4E7HA 4RW4A 3UE5A 1LAVA 2PFUA 2ZD1A 3NF7A 3VENA 3WXMB 3ZSZA 3SV3A 1VQ6N 4C23A 2QKKA 3QFPA 4CJLA 4ID1A 4GW6A 5JVGL 4AQYK 5JLHA 5GAEP 4LF9K 4OLAA 3T69A 3OYBA 4I7FA 3EEQA 4FJKA 4FWMA 4CJTA 1QVGM 2A6AA 1ILYA 4XEIA 4BRQA 3CCSN 3HPOA 1KLMA 2DFEA 3LDLA 3L3UA 5AQNA 3NH0A 1CXQA 1GOAA 1U2VB 4B1YB 1B9FA 3LM2A 1J53A 3I56N 4DV5K 4A61A 3CQ8A 4CGGA 3C65A 3LDNA 4C1NK 3NF6A 4AILC 4Z4EA 4ILGB 3WNFA 2V7YA 2WONA 3ID6A 3O8MA 2BANA 5C15A 4WF9L 1HQEA 3AO3A 1OH7A 3THXB 1N6QA 3SQ2A 3JAMO 1TKTA 5BPMA 3P5JA 1K8KB 3T19A 3TANA 4B3SK 3I8BA 1NGIA 3EZ5A 3ZSQA 2ITMA 1HUXA 4HCCA 4DQ8A 3EE8A 3JXUA 4AHUA 3EE9A 2XY5A 4H5RA 5TKWA 5SZTA 4RG8A 2P9SA 3DRSA 1KTQA 5KPRA 3ZX0A 5ADXA 4BRPA 1H1VA 3VOVA 1TK8A 4CJ4A 1EQYA 1BA0A 3K9KA 4Z0UA 1NU0A 1NOYA 1FK9A 3AA4A 3SPZA 4KTQA 3CJBA 4IO9L 3KD1E 2Y1JA 1L3UA 4CF1A 4UY8O 3MK6A 3T3FA 2IVOA 3V9WA 1VQNN 4BVOA 4PUOA 3T1YK 3A5LC 4MFBA 3V81A 3V6DA 4CVNE 4H5VA 4KV8A 1I39A 3Q7CA 4CD1A 4CEFA 4F2RA 4B8CA 1Q18A 1YAGA 3WQUA 1RT6A 1S1UA 3VQ9A 2OA8A 4C8NA 4OPKA 1EX4A 2IIRA 3HSTB 1QQCA 3FZKA 3LL3A 4CBWA 4M7XA 4M41A 4LF4K 4LFBK 2Q0RA 3U9DA 3UB5A 1N36K 3HOTA 4C8LA 5J1EA 4FSVA 2A1RA 3LPTA 4YFUA 4FWPA 1VSFA 3L3VA 1X9MA 3PLAA 3CPWM 3ZCMA 4HUFA 1E4GT 1RBUA 2YCHA 2GTDA 4CI6A 1NKBA 1Q7YO 1RDCA 4Q0BA 3KK1A 4I6MA 4E7KA 4NB4A 3MN6A 3WXLA 4PKGA 4B9TA 1C1BA 3J8AA 1U49A 4IKFA 1D8YA 5C12A 1NOZA 4DQRA 2JLEA 5GAHP 1VQ8N 5M1NA 4FLXA 1C0MA 4FOEA 4EFHA 2D0OA 4ELVA 4PHTX 4CJFA 2YHYA 4FLWA 3MDQA 2JWKA 4CIFA 2RKIA 3S3NA 5HL7L 2B4JA 4WFNL 1QE1A 3J7YP 1D4XA 3AVHA 3AVGA 1Z26A 1Q9XA 1YXQA 4A59A 4FM1A 1Q86O 1XNQK 4IFEA 3VF4A 4MO4A 3HT3A 4DR4K 4FZXC 1U4BA 3H1QA 4CZGA 4HHTA 3THWA 2P9PA 3FZMA 1LW2A 2OPSA 1VQ5N 3WQTA 3CCUN 3ZT2A 2A41A 1JJ2M 3RR8A 4O0IA 2UXDK 4BGAA 4CJUA 2ZGYA 3V9XA 4N5SA 3MAQA 3ALYA 1X9SA 5AZIA 3V9ZA 3AAQA 3DLKA 1GLDG 4OPJA 1HKBA 5EVZA 4U67L 1RDUA 3OTOK 3QLHA 3S3MA 1IG9A 3CCJN 3ZX2A 3THYA 4FJJA 4FVUA 3HP6A 3SV4A 1NK0A 1S72N 1W7AA 1KAXA 2GUIA 4FW2A 4A2AA 3MN5A 3CFPA 3MCAB 3O6WA 4JN4A 3BZCA 1RBVA 3WNHA 3M8RA 1SAZA 4CGDA 3PO5A 3OW2M 1ZBIA 3B6OA 2OCEA 1HNVA 4Z4FA 2UU9K 5BN8A 5AJ3K 2GWJA 3VN5A 1IBMK 1OVQA 2NRWA 3OJUA 3W3DA 4ZHRA 2CGJA 3J7ZO 3T7ZA 1EETA 1QQNA 1ZYQA 1IJJA 4DFPA 2UXCK 4DTPA 4DV4K 4FK0A 1QSLA 2HHWA 2WUSA 3TSPA 5AQJA 2P51A 4FZZA 4BQZA 3HK2A 2LSNA 3EY1A 1ZBSA 4O55A 5CY4A 1YTAA 3CC7N 3LDOA 4CZMA 2W41A 4CCHA 5BRFA 1TK5A 4K25A 3NF9A 4EHUA 1HPZA 2VWKA 1QQMA 5EU7A 3FZFA 3E9OA 2KW4A 1CLQA 2O8CA 1VQLN 3G4SN 2YV0X 4CEZA 2O8DB 3QIPA 3MXIA 2P9KB 5HROA 4CF9A 2OTJN 1JL1A
chains in the Genus database with same CATH topology
2NRRA 4M7YA 4FO0A 2E2OA 2P9NB 5EXWA 2NRZA 5JLFA 4CZIA 3F9MA 3JS6A 1ATNA 1K8AO 2HSTA 1VQON 2HOEA 1NLVA 3R3LA 1YJWN 3VETA 4BROA 1ZXOA 2NRTA 2P9PB 2UYTA 3R1XA 1Y64A 2V52B 3WXJA 3CCVN 4WQ5C 4MO5A 4BC4A 3VEYA 4BC2A 1JCFA 1VQPN 4WFBL 1C0GA 1NGDA 4IEEA 3E9LA 2CGLA 3TSQA 3FR0A 2GX9A 5AZIB 2NRHA 2HBJA 1GLLO 2HMPA 2P9IA 4C1NI 1S3XA 1Q82O 2H3GX 5GADP 3CCQN 4BRIA 4PL8A 4BRMA 1T44A 4H0PA 3QDKA 4M63C 3UKUB 1IG8A 5GAGP 5AQYA 4WCEL 4WQ4A 3SBGA 5ELZA 2J4RA 5AQKA 5AQUA 2D4WA 3A0IX 2DPNA 4H5TA 4J8FA 5BRHA 4FOIA 3CXCM 5TKYA 2NRXA 2HF4A 3KWIA 1DKGD 1NGCA 1U2VA 2QWLA 2D0PA 3W0LA 3SJHA 3H46O 4YDUC 1TUUA 4CZJA 4G9ZA 3BF1A 5KQ8A 4RTFD 3CMAN 4JK8A 3S41A 3WXKA 5B8HA 4EAHD 2ZJRL 3WUHA 4H03B 1RDWX 3WT0A 3CJ7A 4GV6A 5GINA 2NRVA 1RFQA 3FZHA 2QWNA 3RSEB 1KD1O 3N4QA 1Z05A 4NO7A 4JKAA 2NNWA 3O1WA 3VF6A 2VGMA 5AQVA 3R8EA 2A5XA 2E1ZA 1M90O 5BPLA 2Q2RA 2CH5A 2RHKA 3CHWA 3AGKA 1K8KA 3DXKB 2GUPA 2BUPA 3L4QA 2QWQA 5AQMA 2YJEA 1C0FA 4ILHA 2QXLA 4BQLA 2FSJA 1GLJO 5DM6L 5GIPA 1OVYA 3KVGA 4IEIA 4BRDA 1YJNN 4FWQA 3NVMA 1GLCG 4JKHA 5AQWA 1GLFO 2ASOA 3C7NB 5LJWA 1T6CA 3AGRA 3ENHA 3OBYA 4FPAA 4IJAA 4IO8A 2BH1A 5AQFA 1ATRA 3GE1A 3SAFA 2ZWHA 3EN9A 3H6EA 4H0XB 2E20A 4ISFA 3FFKB 3CIPA 3QICA 4JKBA 4A62A 5BRDA 5AQIA 3SAHA 3FLCO 3O4WA 5GIOA 4FWLA 3LDPA 3MN7A 3VF2A 5AQXA 2Q31A 1X3NA 2JWLA 5AQZA 4WQ5A 1BG3A 1QQOA 5CHIA 5F1XA 3EZWA 5AQPA 5JMVA 2Q0UA 1NGHA 4BRHA 3QBWA 3SMSA 1Q81O 3A8YA 3M3ZA 1KAYA 4BR5A 4RCHA 4WYBA 1S22A 1VAZA 2E1YA 2WBNA 1E4FT 4GV3A 5E84A 2EWSA 2I7PA 2I7NA 2PAVA 3D7EO 3E66A 1LCUA 2WC9A 1VQMN 5C2FA 3GL1A 1YJ9N 4GV9A 3NMUA 4O8KA 5MLCQ 3EKSA 4FWKA 4JKGB 4JKEA 2NLXA 4K41A 5C10A 4FWOA 1GLEG 3CJ9A 4JHDB 4KH5A 4BRGA 4CZEA 1M1KO 1X9JA 3D2EA 4KH4A 3EKUA 4BVPA 5C0YA 3CERA 2V7ZA 3GOIA 3MN9A 4AM6A 4JAXA 5AQRA 3VEWA 4YDUA 3TTCA 1U6ZA 2OANA 3D2FA 3UE5A 4MDBA 2PFUA 4ISEA 3G71N 3VENA 3WXMB 3C6AA 3HTVA 3G6EN 4O8UA 4XH5A 3NVKA 1VQ6N 4C23A 3ZYYX 1OKJA 3GBTA 2A3ZA 3CQXA 1O13A 1BOTO 3KHYA 4YORA 1W2BM 4CZLA 3CJ1A 3QFPA 2ZJQL 3K9JA 1XQSC 1HKGA 2QM1A 1P8ZA 4F9OA 5JVGL 3KWGA 4BR4A 5JLHA 5GAEP 2VGNA 4B1XB 3U4LA 4QS9A 3O5BA 2P9IB 3T69A 1NJIO 2F9TA 4BGBA 4FWMA 2YHWA 5AQTA 1QVGM 4GVEA 2HBLA 3VGKA 2A6AA 3AY9A 1ILYA 4BR7A 4XEIA 3LDQA 3VERA 4BRQA 1MA9B 3O08A 4H5WA 3CCSN 3O9TA 5M1PA 1NGAA 1HPMA 3LDLA 5AFUH 4BC5A 2FF6A 1SZ2A 4YOUA 4YOTA 2YX6A 5AQNA 1RGIA 3P4IA 3KK7A 1U2VB 4JD2A 4B1YB 1KAZA 2FLOA 5AZJA 3LM2A 4IOAL 3I56N 3QB0A 4JKFA 4A61A 4R79A 3TTDA 3CCMN 3CC2N 4BRKA 4E1JA 3C6HA 1KQSM 4BG9A 4KH6A 3C65A 3LDNA 3MWPA 4NLCA 2GEMA 3WXIA 4C1NK 5I9EB 4ILGB 4A2BA 1JCEA 2AP1A 2V7YA 3ID6A 3O8MA 4B1WB 4PKIA 4CJ7A 3MWTA 5C15A 3DXMA 4JKDA 3HOSA 4WF9L 5LJVA 2WFBA 2QW9A 5F2RA 3VEXA 1YIJN 2QTDA 4QS8A 2YI1A 3U9ZA 2KLAA 2KHOA 4FL9A 4EIAA 5BPMA 3CCRN 1K8KB 3O1BA 3I8BA 1NGIA 1HX1A 1X3MA 3ULEA 1BU6O 3VTHA 5EOYA 1DT9A 2ITMA 4WFAL 4YOVA 4IXCA 3DLLL 1HUXA 4DQ8A 3EE8A 1J6ZA 1XUPO 3JXUA 4PL7A 3EE9A 1BA1A 4H5RA 1DGKN 3P38A 4MLEA 2D1KA 2YJFA 5TKWA 4B1VA 1LOTB 4BRNA 3OBWA 2QWOA 1MWKA 2P9SA 2P9UA 3VTIA 4YOYA 5KPRA 3ZX0A 4Y0WA 4BRPA 5ADXA 2ASPA 1H1VA 3VOVA 1XC3A 3MX5A 1EQYA 1BA0A 3K9KA 1NGFA 3HSCA 2FXUA 1YHQN 1MDUB 5M1FA 1HLUA 3MX2A 3ZEUB 3CMEN 3MMVA 3H3NO 3CJBA 4IO9L 3ENBA 3GG4A 4HWIA 4H0OA 5KQDA 4UY8O 3MK6A 4YOWA 2IVOA 1VQNN 2OTLN 3M1FA 4BVOA 4FWNA 4AF1A 3A5LC 2VCPA 3SLCA 1VQ7N 3AAPA 1YITN 4H5VA 5JICA 4EHTA 3BUZB 3IDHA 4CZKA 3VMFB 2NZTA 3Q7CA 4CD1A 1Q18A 1YAGA 2CGKA 3WQUA 5M1QA 3OA9A 1NBWA 4IOXA 5FPDA 3SMPA 3DJCA 4FPBA 4H0TB 5AQGA 2RE2A 3DAWA 4MDAA 3RVCA 1QZ5A 3D2EB 3O80A 1NWKA 3A5OC 2GWKA 2IIRA 1CZAN 3HM8A 3ZETB 3C7NA 3D2FB 3FZKA 3LL3A 4CBWA 4M7XA 3A5NC 3M5RA 5AQQA 5AR0A 2Q0RA 3U9DA 4H0YB 3UB5A 5AQLA 3HOTA 1TYQA 1V4SA 2A40A 4JK7A 4FSVA 4H5NA 1SQKA 4CZFA 5BREA 2P9LA 3PIPL 4CBUA 4FWPA 4IJNA 5C2DA 3IUCA 3QFUA 4QS7A 3I33A 5M1OA 3TU5A 4IWVA 3CF5L 3PLAA 3CPWM 2AA4A 3GDQA 1E4GT 4OPAA 2YCHA 3MCPA 2GTDA 4BREA 4CI6A 1Q7YO 3WEEA 1BWFO 4A5AA 4H0VB 3ATUA 4I6MA 2IVNA 4DKWA 4NB4A 3VEOA 4BR0A 3MN6A 5KPTA 3TPQA 3WXLA 4PKGA 1EO1A 2A42A 3VESA 2V51B 4BRFA 3J8AA 3VEZA 2Q36A 5E26A 1WOQA 1NGGA 3CCEN 5C12A 3P31A 1YI2N 2QA4N 5GAHP 3IMXA 1HJOA 2E88A 2W40A 5M1NA 4JD2B 1VQ8N 5AZJB 4FOEA 1JCGA 4EFHA 2D0OA 3ZX3A 4PHTX 3UKRA 4B1UB 4ISGA 2YHYA 5FPNA 4U7BA 3MDQA 2JWKA 2YHXA 3HI0A 2VYPA 4IOCL 2E8AA 4BG8A 5HL7L 5DM7L 3BP8A 2VWBA 4WFNL 3BEXA 3DXMB 2P9KA 1D4XA 3R6MA 3CJCA 2ZJPL 1MWMA 1R59O 3OHRA 4DHYA 3G25A 1YXQA 3CQYA 4A5BA 3D6RA 3FZLA 1YVNA 4A59A 3EL2A 1NGBA 2GELA 2P9NA 4IDHA 5CR4A 1Q86O 2QWRA 5JVHL 1GLAG 3CETA 4IFEA 4XH1A 3ULEB 4MO4A 3VF4A 1VQ9N 3SK3A 1V4TA 4BC3A 3N4PA 3H3OB 4RWTA 3H1QA 3O9UA 4CZGA 5LY3A 3P39A 3H45C 3PIOL 2P9PA 3FZMA 4BRAA 1VQ5N 3L0QA 4CBXA 1WUAA 2ZF5O 3M6GA 3WQTA 2ZGZA 1NM1A 2P9SB 2A41A 2FSNA 2P9UB 4FWSA 4DCHA 3CCUN 1JJ2M 4JK9A 4BGAA 1K73O 1Z6RA 3E9PA 2Q97A 2ZGYA 4JNEA 1N8RO 3L6QA 3TSUA 2ASMA 5AQOA 4FWRA 2HF3A 3VGMA 4BRCA 4O5FA 5AZIA 3AAQA 2QWMA 4MLHA 5F0XA 1GLDG 1HKBA 3EO3A 4B1ZA 3B8AX 5EVZA 1ZC6A 4U67L 1RDUA 1KC8O 1VQKN 3CD6N 1T3VA 3UKUA 3VGLA 1QZ6A 3CCJN 1NGJA 1KXPA 1G99A 3QBXA 2F7TA 3F5TA 3ZX2A 4FVUA 3ID8A 3C0BA 3CC4N 1GLBG 2CH6A 3HRGA 1S72N 2E2QA 1KAXA 3CPEA 4GY2B 4BR2A 3VEVA 2HBMA 4BY9C 4OO1J 4A2AA 3MN5A 3O9RA 3MCAB 3O6WA 3AARA 4JN4A 3SAGA 1K9MO 1HKCA 3E1YA 4HTLA 2QI2A 1SAZA 4PKHA 3OW2M 3U8XA 5AQSA 3RSEA 2E2PA 4DB3A 2QEXN 1NMDA 5BN8A 3VPZA 2GWJA 1TUYA 3KZBA 4KBOA 2NRWA 3LM9A 4L3QA 3SBTA 3DXKA 3W3DA 1YUWA 2BTFA 2CGJA 4K42A 3J7ZO 1TYQB 2Q1NA 3T7ZA 1QVFM 1QQNA 3IFRA 3CI5A 3R9PA 5H1SQ 4Z94A 2P9LB 3ATVA 5ADXH 1BO5O 1IJJA 2KKZA 4WQ4C 4CZHA 3I55N 5BR9A 3F2KA 5FPEA 3ENOA 5BN9A 3ZEUA 2WUSA 3TSPA 5AQHA 5AQJA 5EY4A 4BQZA 4LC9B 3IKMA 3O9SA 3WEEB 4GNIA 2FSKA 1ZBSA 3Q7BA 3FE1A 4NLBA 1QHAA 4XH4A 1BUPA 4JKCA 3LDOA 4CZMA 2QWPA 3CC7N 4I6MB 2F9WA 2W41A 5BPNA 5BRFA 1ESVA 4AM7A 3FGUA 4K25A 3O9QA 2HBKA 1YF5L 3HZ6A 1DEJA 4B9QA 4BR9A 3A5MC 4BRLA 4EHUA 1QQMA 3FZFA 3BF3A 5FPMA 5HOOA 3E9OA 2FF3B 3DWLA 1BDGA 3HBTA 3QMLA 5CE3A 2E2NA 5AFUA 3UKRB 1W97L 5M1KA 1VQ4N 4YOXA 4IZ9A 4OPHA 1VQLN 3G4SN 1P90A 1ATSA 3TTFA 3L4IA 1T6DA 2IVPA 5EX5A 2P9KB 4K43A 3ZETA 1NGEA 2PBDA 4ILJA 4CD3A 3CCLN 4A57A 5KPZA 4JKGA 2OTJN 3H1VX 4JEPA 1SS6A 3CJAA 4JHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7Y A;  4FO0 A;  2E2O A;  2P9N B;  5EXW A;  5JLF A;  4CZI A;  3F9M A;  3JS6 A;  1ATN A;  2HOE A;  1NLV A;  3VET A;  4BRO A;  1ZXO A;  2P9P B;  2UYT A;  1Y64 A;  2V52 B;  3WXJ A;  4WQ5 C;  4MO5 A;  4BC4 A;  3VEY A;  4BC2 A;  1JCF A;  1C0G A;  1NGD A;  2CGL A;  3FR0 A;  5AZI B;  2NRH A;  1GLL O;  2HMP A;  2P9I A;  1S3X A;  2H3G X;  4BRI A;  4PL8 A;  4BRM A;  1T44 A;  4H0P A;  3QDK A;  4M63 C;  3UKU B;  1IG8 A;  5AQY A;  4WQ4 A;  5ELZ A;  2J4R A;  5AQK A;  5AQU A;  2D4W A;  3A0I X;  2DPN A;  4H5T A;  4J8F A;  5BRH A;  4FOI A;  5TKY A;  2HF4 A;  1DKG D;  1NGC A;  1U2V A;  2QWL A;  2D0P A;  3W0L A;  3SJH A;  3H46 O;  4YDU C;  1TUU A;  4CZJ A;  3BF1 A;  5KQ8 A;  4RTF D;  3S41 A;  3WXK A;  5B8H A;  4EAH D;  3WUH A;  4H03 B;  1RDW X;  3WT0 A;  3CJ7 A;  1RFQ A;  3FZH A;  2QWN A;  3RSE B;  1Z05 A;  4NO7 A;  3O1W A;  3VF6 A;  5AQV A;  3R8E A;  2A5X A;  2E1Z A;  5BPL A;  2Q2R A;  2CH5 A;  3CHW A;  1K8K A;  3DXK B;  2GUP A;  2BUP A;  2QWQ A;  5AQM A;  2YJE A;  1C0F A;  4BQL A;  2QXL A;  2FSJ A;  1GLJ O;  3KVG A;  4BRD A;  4FWQ A;  5AQW A;  1GLC G;  5LJW A;  1GLF O;  2ASO A;  3C7N B;  1T6C A;  3ENH A;  4FPA A;  4IJA A;  4IO8 A;  5AQF A;  1ATR A;  3GE1 A;  2ZWH A;  3EN9 A;  3H6E A;  4H0X B;  2E20 A;  4ISF A;  3FFK B;  3CIP A;  3QIC A;  4A62 A;  5BRD A;  5AQI A;  3FLC O;  3O4W A;  4FWL A;  3LDP A;  3MN7 A;  3VF2 A;  5AQX A;  2Q31 A;  1X3N A;  5AQZ A;  4WQ5 A;  1BG3 A;  1QQO A;  5F1X A;  3EZW A;  5AQP A;  5JMV A;  2Q0U A;  1NGH A;  4BRH A;  3QBW A;  3SMS A;  3A8Y A;  3M3Z A;  1KAY A;  4BR5 A;  4RCH A;  4WYB A;  1S22 A;  2E1Y A;  1E4F T;  5E84 A;  2EWS A;  2I7P A;  2I7N A;  2PAV A;  3D7E O;  1LCU A;  3GL1 A;  4O8K A;  3EKS A;  4FWK A;  2NLX A;  4K41 A;  4FWO A;  1GLE G;  3CJ9 A;  4JHD B;  4BRG A;  4CZE A;  1X9J A;  3D2E A;  4BVP A;  3EKU A;  3CER A;  2V7Z A;  3GOI A;  3MN9 A;  4AM6 A;  4JAX A;  5AQR A;  3VEW A;  4YDU A;  1U6Z A;  2OAN A;  3D2F A;  3UE5 A;  4ISE A;  3VEN A;  3HTV A;  4XH5 A;  4C23 A;  1OKJ A;  3GBT A;  2A3Z A;  3CQX A;  1BOT O;  3KHY A;  4CZL A;  3CJ1 A;  3QFP A;  1XQS C;  1HKG A;  2QM1 A;  1P8Z A;  4F9O A;  4BR4 A;  5JLH A;  4B1X B;  3U4L A;  4QS9 A;  3O5B A;  2P9I B;  2F9T A;  4BGB A;  4FWM A;  2YHW A;  5AQT A;  3VGK A;  2A6A A;  3AY9 A;  4BR7 A;  4XEI A;  3LDQ A;  3VER A;  4BRQ A;  1MA9 B;  3O08 A;  4H5W A;  1NGA A;  1HPM A;  3LDL A;  5AFU H;  4BC5 A;  2FF6 A;  1SZ2 A;  5AQN A;  1RGI A;  3P4I A;  1U2V B;  4JD2 A;  4B1Y B;  1KAZ A;  2FLO A;  5AZJ A;  3LM2 A;  3QB0 A;  4A61 A;  4BRK A;  4E1J A;  4BG9 A;  3LDN A;  5I9E B;  2GEM A;  3WXI A;  4A2B A;  1JCE A;  2AP1 A;  2V7Y A;  3O8M A;  4B1W B;  4CJ7 A;  4PKI A;  3DXM A;  5LJV A;  2QW9 A;  5F2R A;  3VEX A;  4QS8 A;  2YI1 A;  3U9Z A;  2KHO A;  4FL9 A;  4EIA A;  5BPM A;  1K8K B;  3O1B A;  3I8B A;  1NGI A;  1HX1 A;  1X3M A;  3ULE A;  1BU6 O;  5EOY A;  2ITM A;  4IXC A;  1HUX A;  4DQ8 A;  4PL7 A;  1J6Z A;  1XUP O;  3JXU A;  1BA1 A;  4H5R A;  1DGK N;  4MLE A;  2D1K A;  2YJF A;  4B1V A;  4BRN A;  1LOT B;  2QWO A;  1MWK A;  2P9S A;  2P9U A;  5KPR A;  3ZX0 A;  4Y0W A;  4BRP A;  5ADX A;  2ASP A;  1H1V A;  3VOV A;  1XC3 A;  1EQY A;  1BA0 A;  1NGF A;  3HSC A;  2FXU A;  1MDU B;  1HLU A;  3ZEU B;  3MMV A;  3H3N O;  3CJB A;  3GG4 A;  4HWI A;  4H0O A;  5KQD A;  3MK6 A;  2IVO A;  3M1F A;  4BVO A;  4FWN A;  3A5L C;  2VCP A;  3SLC A;  3AAP A;  4H5V A;  5JIC A;  4EHT A;  3BUZ B;  3IDH A;  4CZK A;  2NZT A;  4CD1 A;  1Q18 A;  1YAG A;  2CGK A;  3WQU A;  1NBW A;  5FPD A;  3SMP A;  3DJC A;  4FPB A;  4H0T B;  5AQG A;  3DAW A;  1QZ5 A;  3D2E B;  3O80 A;  1NWK A;  3A5O C;  2GWK A;  2IIR A;  1CZA N;  3HM8 A;  3ZET B;  3C7N A;  3D2F B;  3FZK A;  3LL3 A;  4CBW A;  4M7X A;  3A5N C;  5AQQ A;  5AR0 A;  2Q0R A;  3U9D A;  4H0Y B;  3UB5 A;  5AQL A;  1TYQ A;  1V4S A;  2A40 A;  4FSV A;  4H5N A;  1SQK A;  4CZF A;  5BRE A;  2P9L A;  4CBU A;  4FWP A;  4IJN A;  3IUC A;  3QFU A;  4QS7 A;  3I33 A;  3TU5 A;  4IWV A;  2AA4 A;  3GDQ A;  1E4G T;  2YCH A;  3MCP A;  2GTD A;  4BRE A;  4CI6 A;  3WEE A;  1BWF O;  4H0V B;  3ATU A;  4I6M A;  2IVN A;  4NB4 A;  3VEO A;  4BR0 A;  3MN6 A;  5KPT A;  3TPQ A;  3WXL A;  4PKG A;  2A42 A;  3VES A;  2V51 B;  4BRF A;  3J8A A;  3VEZ A;  2Q36 A;  5E26 A;  1WOQ A;  1NGG A;  3IMX A;  1HJO A;  2E88 A;  2W40 A;  4JD2 B;  5AZJ B;  4FOE A;  1JCG A;  4EFH A;  2D0O A;  3ZX3 A;  3UKR A;  4B1U B;  4ISG A;  2YHY A;  5FPN A;  3MDQ A;  2YHX A;  3HI0 A;  2VYP A;  2E8A A;  4BG8 A;  3BP8 A;  2VWB A;  3BEX A;  3DXM B;  2P9K A;  1D4X A;  3R6M A;  3CJC A;  1MWM A;  1R59 O;  3OHR A;  4DHY A;  3G25 A;  1YXQ A;  3CQY A;  3FZL A;  1YVN A;  3EL2 A;  1NGB A;  2GEL A;  2P9N A;  2QWR A;  1GLA G;  3CET A;  4XH1 A;  3ULE B;  3VF4 A;  4MO4 A;  3SK3 A;  1V4T A;  4BC3 A;  3H3O B;  4RWT A;  3H1Q A;  5LY3 A;  4CZG A;  3H45 C;  2P9P A;  3FZM A;  4BRA A;  3L0Q A;  4CBX A;  1WUA A;  2ZF5 O;  3M6G A;  3WQT A;  2ZGZ A;  1NM1 A;  2P9S B;  2A41 A;  2FSN A;  2P9U B;  4FWS A;  4DCH A;  4BGA A;  1Z6R A;  2Q97 A;  2ZGY A;  4JNE A;  3L6Q A;  2ASM A;  5AQO A;  4FWR A;  2HF3 A;  3VGM A;  4BRC A;  4O5F A;  5AZI A;  3AAQ A;  2QWM A;  4MLH A;  5F0X A;  1GLD G;  1HKB A;  3EO3 A;  4B1Z A;  3B8A X;  5EVZ A;  1ZC6 A;  3UKU A;  3VGL A;  1QZ6 A;  1NGJ A;  1KXP A;  1G99 A;  3QBX A;  3ZX2 A;  3ID8 A;  3C0B A;  1GLB G;  2CH6 A;  2E2Q A;  1KAX A;  4GY2 B;  4BR2 A;  3VEV A;  4A2A A;  3MN5 A;  3O6W A;  3AAR A;  4JN4 A;  1HKC A;  4HTL A;  1SAZ A;  4PKH A;  3U8X A;  5AQS A;  3RSE A;  2E2P A;  4DB3 A;  1NMD A;  5BN8 A;  3VPZ A;  2GWJ A;  1TUY A;  3KZB A;  4KBO A;  3LM9 A;  4L3Q A;  3DXK A;  3W3D A;  1YUW A;  2BTF A;  2CGJ A;  4K42 A;  1TYQ B;  2Q1N A;  1QQN A;  3IFR A;  3CI5 A;  3R9P A;  4Z94 A;  2P9L B;  3ATV A;  5ADX H;  1BO5 O;  1IJJ A;  4WQ4 C;  4CZH A;  5BR9 A;  5FPE A;  3ENO A;  5BN9 A;  3ZEU A;  2WUS A;  5AQH A;  5AQJ A;  5EY4 A;  4BQZ A;  4LC9 B;  3WEE B;  4GNI A;  2FSK A;  1ZBS A;  3CJA A;  1QHA A;  4XH4 A;  1BUP A;  3LDO A;  4CZM A;  2QWP A;  4I6M B;  2F9W A;  2W41 A;  5BPN A;  5BRF A;  1ESV A;  4AM7 A;  3FGU A;  4K25 A;  3HZ6 A;  1DEJ A;  4B9Q A;  4BR9 A;  3A5M C;  4BRL A;  4EHU A;  1QQM A;  3FZF A;  3BF3 A;  5FPM A;  2FF3 B;  3DWL A;  1BDG A;  3HBT A;  3QML A;  5CE3 A;  2E2N A;  5AFU A;  3UKR B;  4IZ9 A;  1ATS A;  3L4I A;  1T6D A;  2IVP A;  5EX5 A;  2P9K B;  4K43 A;  3ZET A;  1NGE A;  2PBD A;  4CD3 A;  5KPZ A;  3H1V X;  3FE1 A;  4JHD A; 
#chains in the Genus database with same CATH topology
 2NRR A;  4M7Y A;  4B8A B;  2E2O A;  1UAX A;  1R0A A;  3OJS A;  2HST A;  2RF2 A;  1S5J A;  4E7J A;  4FJX A;  4BRO A;  2HNY A;  1RT2 A;  2V52 B;  3CCV N;  4WQ5 C;  1SKW A;  1S9G A;  2IAJ A;  3E9L A;  2CGL A;  3TSQ A;  3K57 A;  4C1N I;  1NG9 A;  3UKU B;  3QDK A;  3VQ6 A;  1IG8 A;  4LSN A;  5AQY A;  4WCE L;  3QNN A;  3VQ5 A;  2J4R A;  5AQU A;  3A0I X;  5BRH A;  4FOI A;  5CYM A;  5TKY A;  5A2Q O;  3NAE A;  2X6S A;  3KWI A;  4YNQ A;  2O8F B;  3J81 O;  2QWL A;  1I3A A;  4CZJ A;  3O4N A;  4G9Z A;  5KQ8 A;  3BZK A;  3CMA N;  3S41 A;  1QSY A;  4H03 B;  1RDW X;  4IBN A;  3SZ2 A;  4B9N A;  3N4Q A;  1Z05 A;  2NNW A;  4FM2 A;  4DLG A;  4FJ5 A;  4FLV A;  5J2P A;  2CH5 A;  2RHK A;  4CFC A;  3I0R A;  2GUP A;  4BDY A;  3KLF A;  2HHV A;  3SPY A;  1C0F A;  1JLE A;  2QXL A;  3NCI A;  4BE1 A;  1FKP A;  3LP1 A;  4I9L A;  3C95 A;  5GIP A;  4BRD A;  3QIN A;  1YJN N;  4OLB A;  3C7N B;  3SQ1 A;  4FPA A;  5J2N A;  3NDK A;  3GE1 A;  3SAF A;  3KIO A;  2ZWH A;  2OPP A;  2KFZ A;  3KJV A;  4ISF A;  4H0X B;  2E20 A;  3LAL A;  3SJJ A;  3DLG A;  4B3T K;  2WOM A;  1HNZ K;  3CYM A;  3O4W A;  3NH1 A;  1RBT A;  4YHH K;  3O3H A;  3MN7 A;  1RT3 A;  3VF2 A;  3KLG A;  4OGE A;  3O3F A;  3PV8 A;  2JWL A;  5CHI A;  1TV6 A;  5HRN A;  3EZW A;  5AQP A;  5JMV A;  1NGH A;  3V1R A;  4DTS A;  1JXB A;  1S1X A;  1KAY A;  1BHL A;  3JYT A;  1S22 A;  3DRR A;  2OZS A;  5E84 A;  2EWS A;  1RT4 A;  2I7P A;  4KPY A;  1RBS A;  3E66 A;  1LCU A;  4CEO A;  1VQM N;  1DLO A;  4M3Z A;  5C10 A;  3CJ9 A;  3AV9 A;  4CZE A;  1M1K O;  3D2E A;  3CER A;  1RTI A;  3K5L A;  3TAB A;  3GOI A;  5D3G A;  3K58 A;  4JAX A;  4YDU A;  1U6Z A;  2OAN A;  3D2F A;  4KO0 A;  1RTD A;  4ISE A;  3G71 N;  4FJI A;  3HTV A;  4CJ5 A;  1JLQ A;  4XH5 A;  3NVK A;  4M3U A;  1OKJ A;  4N47 A;  1O13 A;  3KHY A;  4YOR A;  2YNG A;  4CZL A;  3CJ1 A;  3K9J A;  1HKG A;  1P8Z A;  4I2Q A;  4BR4 A;  2VGN A;  3F73 A;  3O5B A;  2P9I B;  1NJI O;  2G8V A;  2HBL A;  1RT5 A;  1IBK K;  3NGI A;  5I3U A;  3LDQ A;  3VER A;  2HHT A;  1MA9 B;  4H5W A;  1J5E K;  3OYM A;  1BCM A;  2KTQ A;  5M1P A;  1NJY A;  1NGA A;  3RMD A;  4LY7 A;  5AFU H;  3PY8 A;  4YOT A;  2YX6 A;  2DFH A;  1KAZ A;  5AZJ A;  2W6L A;  4KRF A;  3ISN C;  5DK5 A;  3QB0 A;  4CF0 A;  3CCM N;  4NCA A;  4BRK A;  4E1N A;  4E1J A;  3C6H A;  1KQS M;  3MWP A;  3WXI A;  4X66 K;  4C8M A;  4C8O A;  4B1W B;  1XC9 A;  3DXM A;  5KGW A;  5F2R A;  2D0C A;  2QTD A;  5I42 A;  3HYF A;  2KHO A;  3TAR A;  1HX1 A;  1X3M A;  4W5Q A;  3VTH A;  2FBX A;  4ID5 A;  4FK2 A;  1J5O A;  1XUP O;  1BA1 A;  1HJR A;  4W5O A;  2YJF A;  3PSF A;  4YY3 K;  4CJE A;  1MWK A;  2P9U A;  3VTI A;  1NNE A;  1Z25 A;  4DFK A;  3MX5 A;  3VQQ A;  1NGF A;  3VQA A;  1OH8 A;  2FXU A;  1KRP A;  1MDU B;  1BGX T;  1NK9 A;  5M1F A;  1HLU A;  3ZEU B;  3CME N;  4KHY A;  3MMV A;  3H3N O;  2O8B A;  3IS9 A;  3ENB A;  5LMU K;  3VQD A;  2FBY A;  3AO5 A;  3QER A;  2OTL N;  3OY9 A;  3AAP A;  5KTQ A;  4FCY A;  4EHT A;  1W9H A;  3BUZ B;  3IDH A;  3VQB A;  2YKM A;  1REV A;  4KKO A;  5M1Q A;  4HUG A;  4NXN K;  1XMQ K;  3DJC A;  4H0T B;  5AQG A;  3RVC A;  1QZ5 A;  3O80 A;  4DSI A;  1NWK A;  3A5O C;  3HM8 A;  4N76 A;  3C7N A;  3VA0 A;  4FJM A;  3A5N C;  3M5R A;  1QS4 A;  3QO9 A;  4JK7 A;  2UUB K;  3ZT1 A;  5BRE A;  3V1Q A;  3LDS A;  1BIS A;  2AA4 A;  4OPA A;  3MCP A;  2UXB K;  1MU2 A;  3WEE A;  1IV0 A;  4A5A A;  5T7B A;  3ATU A;  3RR7 A;  4DKW A;  1BIU A;  1ZBH A;  3TPQ A;  1EO1 A;  3VES A;  5E26 A;  3CCE N;  2QA4 N;  1S6Q A;  4JD2 B;  5C24 A;  4M42 A;  1JCG A;  2EX3 A;  1NJZ A;  1L3S A;  1WSF A;  4RW7 A;  2F8T A;  3HI0 A;  5DM7 L;  5C42 A;  4LF7 K;  2VWB A;  1T8E A;  3BEX A;  4H8K A;  1A5V A;  4LSL A;  1MWM A;  2DFF A;  3OHR A;  4NYN A;  1X9W A;  4A5B A;  3FZL A;  1N34 K;  2XRI A;  3EL2 A;  3OS0 A;  1NGB A;  2GEL A;  5JVH L;  1GLA G;  3CET A;  3ULE B;  3O9U A;  3H45 C;  1CZ9 A;  3S9H A;  3RMA A;  4CBX A;  4CEQ A;  3TAF A;  3TAE A;  1T7P A;  4LF6 K;  2VWJ A;  3M6G A;  1NM1 A;  2FSN A;  5JS2 A;  1SKS A;  1IH7 A;  1K73 O;  1N8R O;  2Q97 A;  3L6Q A;  1GOB A;  2ASM A;  3RWU A;  3VGM A;  4O5F A;  1VSJ A;  2QWM A;  4CIE A;  5F0X A;  3DMJ A;  1DTT A;  3B8A X;  1ZC6 A;  4AHS A;  2DTU A;  3J80 O;  1KC8 O;  2HNZ A;  1QZ6 A;  4BE2 A;  1NGJ A;  3L2W A;  4FLT A;  4JYA K;  2F7T A;  5SWM A;  1RT1 A;  3C0B A;  3EYZ A;  3LAN A;  2CH6 A;  3O3G A;  3CPE A;  1VSD A;  4JI0 K;  4M3R A;  3HPG A;  3AAR A;  3SAG A;  3L2Q A;  1HKC A;  4HTL A;  2AJQ A;  1A5W A;  3RRH A;  1VSM A;  1KVB A;  1J9A A;  1LW0 A;  3DLE A;  4JI3 K;  3U8X A;  1A5X A;  1XHZ A;  4O4G A;  4DU4 A;  3RSE A;  4LF8 K;  3V1O A;  2YHA A;  2QEX N;  3KLH A;  4M3Y A;  2JGU A;  1YUW A;  1JLA A;  2ZM6 K;  1TYQ B;  1QVF M;  3ASM A;  5H1S Q;  5HLF A;  2GBZ A;  2P9L B;  5ADX H;  3I55 N;  4WQ4 C;  3F2K A;  4NXM K;  2XO7 A;  3LPU A;  5BN9 A;  1S1W A;  3ZEU A;  5LMN K;  4LC9 B;  1QTM A;  4GNI A;  1TAU A;  3OYD A;  4NLB A;  3Q7B A;  4XH4 A;  1D9F A;  1X1P A;  4JKC A;  3AVJ A;  4LH4 A;  2QWP A;  1HQU A;  4GKJ K;  1ESV A;  4AM7 A;  3FGU A;  3K0S A;  2FBV A;  1T05 A;  1DEJ A;  4B9Q A;  2B6A A;  4Q5V A;  4DF8 A;  2FF3 B;  3L2U A;  3PX4 A;  2HHS A;  3UKR B;  5M1K A;  1SL0 A;  4YOX A;  1KLN A;  3MEE A;  2IOC A;  1S1V A;  2IVP A;  5EX5 A;  4K43 A;  1NGE A;  4ILJ A;  3ZSV A;  4A57 A;  3NF8 A;  4JKG A;  4LFA K;  1TL3 A;  4JHD A;  2PZS A;  4F4K A;  4K8Z A;  2P9N B;  1VK0 A;  5EXW A;  1NK5 A;  2E6M A;  4DS5 A;  1ATN A;  4JI5 K;  3VA3 A;  2HOE A;  1NLV A;  3R3L A;  3VET A;  2DY4 A;  4DFM A;  3LWL A;  4FLY A;  2G8W A;  3KLI A;  4MO5 A;  4BC2 A;  1JCF A;  4JI2 K;  4WFB L;  1C0G A;  4PQU A;  3I0S A;  4EP4 A;  3FR0 A;  2GX9 A;  2E5L K;  4L8R B;  1S3X A;  3V9S A;  4RW9 A;  4BRI A;  2D0A A;  3U3G A;  4H0P A;  2HVH A;  1NK4 A;  4KHP K;  4IFY A;  4W5N A;  2UUA K;  1KCF A;  1S1T A;  2DPN A;  3CXC M;  2HF4 A;  3DLH A;  4ZTJ A;  1U2V A;  1TUU A;  3AVC A;  4AHR A;  3NGY A;  2HW3 A;  5J2Q A;  4Z4I A;  4EAH D;  1TKZ A;  2ZJR L;  3WUH A;  1SL1 A;  4GV6 A;  5GIN A;  2I5J A;  1RFQ A;  3FZH A;  2HB5 A;  1KD1 O;  2YNF A;  4NO7 A;  3O1W A;  3OYK A;  2D5R A;  3THX A;  4F2S A;  1M90 O;  1JLG A;  1K8K A;  3DXK B;  2BUP A;  2QWQ A;  2YJE A;  1BI4 B;  5DM6 L;  2XY6 A;  1OVY A;  2XY7 A;  3NVM A;  1GLC G;  3AVB A;  3HJF A;  4HCB A;  3AGR A;  3OBY A;  4IO8 A;  5AQF A;  3V9U A;  3H08 A;  4CHN A;  3EN9 A;  3H6E A;  3TI0 A;  4A62 A;  3OVN A;  1JLB A;  1C0U A;  2Q31 A;  4JS4 A;  3F9K A;  3DOL A;  3QNO A;  2KFN A;  3LP2 A;  1QQO A;  3VQ4 A;  2P5O A;  2VG6 A;  2Q0U A;  4BRH A;  3MEC A;  4BR5 A;  3HPH A;  4RCH A;  1WBB A;  1VAZ A;  2E1Y A;  1LV5 A;  4AHC A;  2WC9 A;  4CGH A;  4DQP A;  4O8K A;  3AA5 X;  1VRU A;  3EKS A;  4KI4 A;  4DR6 K;  4JKE A;  4FWO A;  4BRG A;  5C0Y A;  4BVP A;  4CJV A;  2D0B A;  4E1M A;  3MN9 A;  4AM6 A;  4CHO A;  1C1C A;  5AQR A;  1NJW A;  3ZT3 A;  4MDB A;  4NYF A;  1JLC A;  5FLX O;  3C6A A;  4N41 A;  2OYQ A;  3ZYY X;  3GBT A;  3CQX A;  2O8E B;  1W2B M;  1XQS C;  2QM1 A;  2X78 A;  4V19 S;  1Y97 A;  3KWG A;  4BDP A;  4QS9 A;  2YHW A;  4FM0 A;  4GVE A;  4K8X A;  1JL2 A;  2XY8 A;  3AY9 A;  4BR7 A;  4CGF A;  4DR2 K;  3D45 A;  3HM9 A;  3O08 A;  4KTW A;  3O9T A;  4N56 A;  3K5M A;  4FJG A;  3P4I A;  1C1A A;  3K5N A;  1VSH A;  3MEG A;  2FLO A;  4KAZ A;  4JKF A;  4R79 A;  4BG9 A;  4KH6 A;  5I9E B;  2GEM A;  3LZJ A;  4A2B A;  1JCE A;  2W6K A;  2QXF A;  3MWT A;  5LJV A;  2WFB A;  1YIJ N;  3NE6 A;  2RN2 A;  4M45 A;  3OYL A;  4QS8 A;  4O0J A;  3U9Z A;  4EIA A;  5HBM A;  4I9Q A;  3CCR N;  4DV0 K;  3KKS A;  5C25 A;  1BU6 O;  5BR8 K;  3TAQ A;  1TK0 A;  1DT9 A;  4WFA L;  4YOV A;  4IXC A;  5E41 A;  4B9S A;  3WNG A;  4PL7 A;  4CEA A;  3P38 A;  4MLE A;  4E19 A;  3AVL A;  1LOT B;  4HVJ A;  3OBW A;  3KD5 E;  3VQE A;  1NJX A;  4CEC A;  4QOZ B;  4Y0W A;  2ASP A;  3LP0 A;  4M3T A;  3M8Q A;  5LL6 Z;  4CFA A;  4DSK A;  3HSC A;  2ITG A;  1YHQ N;  3PX6 A;  4E7L A;  3SI6 A;  2P5G A;  1XHX A;  3MX2 A;  4CIG A;  4DLE A;  3GG4 A;  4HWI A;  1SKR A;  4H0O A;  5KQD A;  4FWN A;  4AF1 A;  3TWH A;  3SLC A;  1VQ7 N;  1YIT N;  1LAW A;  4CZK A;  3VMF B;  2NZT A;  1LWC A;  2CGK A;  2QK9 A;  3QEP A;  1NBW A;  4AH9 A;  4CHY A;  2F8S A;  3SMP A;  4FPB A;  4LH5 A;  2RE2 A;  3DAW A;  4J2A A;  3L2V A;  4FJ7 A;  1RBR A;  4H4O A;  2OPR A;  3WNE A;  4DQS A;  3ZET B;  1Q8I A;  4E89 A;  2HMI A;  3ZLJ A;  3RMC A;  2G8F A;  5AQL A;  2A40 A;  1TKX A;  1SQK A;  4X65 K;  4CZF A;  4CBU A;  1SV5 A;  4B08 A;  4QS7 A;  3TU5 A;  4IWV A;  3CF5 L;  5JS1 A;  1BWF O;  1WSH A;  4CF2 A;  2UUC K;  3VEO A;  1LWF A;  4BR0 A;  5KPT A;  2PYJ A;  4BRF A;  3VQP A;  3CM5 A;  3VEZ A;  2BE2 A;  1NGG A;  2E6L A;  1YI2 N;  1ASW A;  3C94 A;  3U6F A;  3AVM A;  5CYQ A;  4B1U B;  4ISG A;  5FPN A;  4CE9 A;  2QKB A;  2YHX A;  4XIU A;  4DV3 K;  2O8D A;  3PX0 A;  3BP8 A;  3FFI A;  2F96 A;  4CHQ A;  3SUP A;  3RRG A;  2P9K A;  1WBD A;  2IC3 A;  2G8H A;  2ZJP L;  1R59 O;  4DHY A;  3G25 A;  1IBL K;  4JV5 K;  3D6R A;  5KGX A;  4IDH A;  4KHS A;  2QWR A;  1RDB A;  1HNX K;  4XH1 A;  3NH2 A;  4FLZ A;  5FDL A;  1NKC A;  4J2B A;  4BAC A;  3SK3 A;  1V4T A;  4BC3 A;  3N4P A;  3H3O B;  4RWT A;  4BWJ A;  4CK3 A;  3P39 A;  1WSG A;  3PIO L;  3T1A A;  4UQG A;  4BRA A;  1UA0 A;  3AVF A;  5K14 A;  4F8R A;  4CES A;  2ZGZ A;  4R5P A;  2P9S B;  1RT7 A;  4JK9 A;  4JNE A;  3TSU A;  3IRX A;  2Y1I A;  4BRC A;  4MLH A;  3EO3 A;  4B1Z A;  4B3R K;  2OPQ A;  3CD6 N;  3DLR A;  3UKU A;  3K2P A;  2X74 A;  3HXM A;  1KXP A;  3QBX A;  1VSL A;  4OVL A;  3IG1 A;  3ID8 A;  4KHU A;  3OYC A;  1ZBL A;  1BCO A;  1GLB G;  2P1J A;  3VQ8 A;  5HRR A;  4OX9 K;  4DTJ A;  2O8F A;  2E2Q A;  4Z4G A;  1XI1 A;  3VEV A;  3O9R A;  1K9M O;  2HHX A;  3E1Y A;  4W5R A;  4PKH A;  2A1S A;  4Y1D A;  3KK3 A;  1KVC A;  4KFB A;  3D0P A;  2E2P A;  1NMD A;  4CFD A;  4JRP A;  3VPZ A;  1TUY A;  3KZB A;  4KBO A;  1RIL A;  3LAK A;  4RW8 A;  1JKH A;  3LM9 A;  4DV6 K;  2O4I A;  2KZZ A;  2HHU A;  2Q1N A;  3TR8 A;  3IFR A;  3CI5 A;  3R9P A;  1BO5 O;  2KKZ A;  4CZH A;  2HVI A;  1EWQ A;  3ZSR A;  4DTO A;  4LF5 K;  1ASV A;  5EY4 A;  1WLJ A;  3IKM A;  3O9S A;  1WAF A;  2FSK A;  4Y1C A;  3DYA A;  3AA3 A;  1G15 A;  1BUP A;  4I6M B;  1FKO A;  2HBK A;  1YF5 L;  3HZ6 A;  1HR0 K;  4BR9 A;  4DTM A;  5FPM A;  3K59 A;  5HOO A;  1BDG A;  2E2N A;  3QEW A;  4FYD A;  3L4I A;  1T6D A;  3ZET A;  4F3T A;  2PBD A;  1YTU A;  4CD3 A;  1HMV A;  5KPZ A;  3SUO A;  3H1V X;  2ZE2 A;  2EHG A;  3FE1 A;  3CJA A;  1D5A A;  3AA2 A;  3UIQ A;  2NRZ A;  5JLF A;  3F9M A;  3JS6 A;  1K8A O;  1VQO N;  1HNW K;  4DUY K;  4E0D A;  1YJW N;  1TGO A;  1ZXO A;  3THW B;  2P9P B;  3R1X A;  1IKW A;  1D9D A;  4BC4 A;  3VEY A;  1N32 K;  1WSI A;  3NFA A;  1VQP N;  1RCH A;  1O1W A;  3RTV A;  1SUQ A;  4CJ3 A;  1KSP A;  5AZI B;  1FXX A;  1KVA A;  2HBJ A;  1GLL O;  2P9I A;  5HRP A;  1JLF A;  1TKD A;  3AO4 A;  2H3G X;  4IG3 A;  4CEB A;  4CED A;  3CCQ N;  4RW6 A;  1T44 A;  5GAG P;  1F21 A;  3SQ4 A;  5AQK A;  3THY B;  2D4W A;  4H5T A;  1WNS A;  4J8F A;  3ZT4 A;  4EZ9 A;  2NRX A;  2Z1H A;  3OYH A;  4DSJ A;  4E7I A;  4CGJ A;  1DKG D;  2IS3 A;  4DU1 A;  4BE0 A;  4IDK A;  1N5Y A;  4YDU C;  3WXK A;  5B8H A;  4CJP A;  4BWM A;  3WT0 A;  3CJ7 A;  3J7A P;  4H4M A;  4J2E A;  4KHW A;  4CJK A;  2VGM A;  5AQV A;  4DQQ A;  3R8E A;  4FLU A;  2E1Z A;  3DLB A;  4DTR A;  5BPL A;  2Q2R A;  3CHW A;  1Q9Y A;  4WE1 A;  3L4Q A;  4ILH A;  4BQL A;  4QCL A;  4IFV A;  4IEI A;  4FWQ A;  3NHG A;  4DQI A;  3ULD A;  2ZQB A;  5AQW A;  5LJW A;  1GLF O;  1FW6 A;  1T6C A;  4TSX A;  4DSE A;  3ENH A;  1NKE A;  1BIZ A;  3LWM A;  2YNH A;  4IJA A;  1ATR A;  4CK2 A;  1EXQ A;  3LAM A;  4BY9 C;  3FFK B;  3CIP A;  5BRD A;  4JRQ A;  3FLC O;  4G1Q A;  4FWL A;  3LDP A;  1BQN A;  2XHB A;  4FJH A;  5AQX A;  1TVR A;  3QEV A;  3TAG A;  4WQ5 A;  1C0T A;  2HND A;  3AVA A;  1B9D A;  1L3T A;  4MQ3 A;  3SMS A;  3A8Y A;  1JXE A;  3M3Z A;  1UA1 A;  1ITG A;  5KI6 A;  4LFC K;  2BGG A;  4DV2 K;  2O8C B;  2WBN A;  1E4F T;  1QSS A;  2I7N A;  3AO2 A;  3D7E O;  1XWL A;  3GL1 A;  4GV9 A;  4B9M A;  4FWK A;  5J2M A;  3QES A;  2NLX A;  4B3O A;  1GLE G;  3K5O A;  3OS2 A;  1LWE A;  2V7Z A;  1OH5 A;  3VEW A;  3TTC A;  1IO2 A;  1EP4 A;  3SYZ A;  4JI7 K;  4AHV A;  4CER A;  3O4Q A;  3G6E N;  4O8U A;  3ZSX A;  2GV9 A;  2A3Z A;  1BOT O;  2ZJQ L;  4F9O A;  1FJG K;  4B1X B;  2Q3S A;  3U4L A;  4CK1 A;  3BDP A;  4DR5 K;  2F9T A;  4BGB A;  1SL2 A;  5AQT A;  4K0K K;  1C6V A;  1TL1 A;  2X6N A;  3VGK A;  3CM6 A;  3AO1 A;  1I94 K;  3VQC A;  3AVK A;  1RDA A;  4KB0 A;  4IG0 A;  2ATQ A;  4CHZ A;  1HPM A;  4BC5 A;  2FF6 A;  1SZ2 A;  4YOU A;  1RGI A;  3G10 A;  3KK7 A;  4DG1 A;  4JD2 A;  4IOA L;  3CC2 N;  4Z4H A;  3TTD A;  1ZBF A;  4NLC A;  1EKE A;  1HNI A;  3SCX A;  2AP1 A;  4B9L A;  4CJ7 A;  4PKI A;  4JKD A;  3QIO A;  3JSM A;  3HOS A;  1NK7 A;  2O4G A;  4KTZ A;  2QW9 A;  3VEX A;  3V4I A;  4ELT A;  2YI1 A;  5CZ2 A;  2KLA A;  4OKK A;  4FL9 A;  3O1B A;  3ULE A;  4PY5 A;  3KLE A;  5EOY A;  3LZI A;  3DI6 A;  3DLL L;  3AVN A;  1J6Z A;  4DSF A;  1T03 A;  3OYJ A;  1DGK N;  2D1K A;  4BRN A;  4B1V A;  4KHN A;  2QWO A;  3NBP A;  4YOY A;  1ASU A;  2R7Y A;  1XC3 A;  1B92 A;  1NK8 A;  2YKN A;  3ZSO A;  1XNR K;  1E3M A;  4M3W A;  3SUQ A;  2Z1J A;  4YOW A;  3M1F A;  4LD0 A;  4DSL A;  4DF4 A;  2KZM A;  2VCP A;  3DOK A;  3OS1 A;  2PYL A;  5JIC A;  1RTH A;  1WN7 A;  3E01 A;  4GKK K;  2W42 A;  3OYG A;  3OA9 A;  3S3O A;  4IOX A;  5FPD A;  1KFD A;  2RPI A;  4MDA A;  3D2E B;  2Z1G A;  2GWK A;  3SNN A;  4KI6 A;  1CZA N;  1CXU A;  3D2F B;  4O44 A;  4GMJ B;  5AQQ A;  5AR0 A;  3OYA A;  4CEE A;  4B9U A;  4JI6 K;  1XMO K;  4H0Y B;  4E3S A;  1TYQ A;  4B3M K;  1V4S A;  3CFO A;  4H5N A;  2P9L A;  3PIP L;  1K6Y A;  4IJN A;  5C2D A;  3IUC A;  1U04 A;  3QFU A;  3I33 A;  5M1O A;  4DV7 K;  4CJS A;  3M8S A;  3GDQ A;  1OH6 A;  4BRE A;  1GOC A;  5FRO A;  4GVM A;  4JS5 A;  4FJ8 A;  3SQ0 A;  4H0V B;  3CFR A;  1HYV A;  2IVN A;  2VG7 A;  1S9E A;  2A42 A;  2V51 B;  2Q36 A;  1WOQ A;  4DU3 A;  3P31 A;  3ZT0 A;  3IMX A;  1HJO A;  2E88 A;  2W40 A;  1ZBU A;  3P1G A;  5AZJ B;  2G8U A;  3ZX3 A;  1N33 K;  4Z4C A;  3UKR A;  3MXM A;  4U7B A;  4C8K A;  5FRN A;  2VYP A;  4IOC L;  2E8A A;  4BG8 A;  2ETJ A;  3DXM B;  3R6M A;  3CJC A;  1VSI A;  3G0Z A;  2YHB A;  3M8P A;  3CQY A;  1YVN A;  2B5J A;  3PSI A;  4O5B A;  3HL8 A;  3U3Y A;  5KRS A;  2P9N A;  5CR4 A;  1VQ9 N;  4CJR A;  3C6T A;  4HUE A;  4DR3 K;  5LY3 A;  1W0H A;  2PY5 A;  3L0Q A;  4J2D A;  1WUA A;  2ZF5 O;  4JLH A;  4QAG A;  2E4L A;  4DCH A;  4BDZ A;  2P9U B;  4FWS A;  3KTQ A;  1Z6R A;  3E9P A;  4DWI A;  5AQO A;  4FWR A;  1WAJ A;  2HF3 A;  4CFB A;  1DTQ A;  3KKR A;  4CW7 B;  4FJL A;  1VQK N;  1T3V A;  3VGL A;  1UWB A;  2O8B B;  1G99 A;  3ZSY A;  3F5T A;  1QHT A;  4X64 K;  3CC4 N;  3THV A;  3OYN A;  3HRG A;  1S6P A;  4GY2 B;  4BR2 A;  2FBT A;  2HBM A;  4OO1 J;  1WSE A;  2QI2 A;  4NCG A;  5AQS A;  2FC0 A;  4NCB A;  1IKY A;  1NMN A;  4DB3 A;  1VHX A;  1IKX A;  4L3Q A;  3SBT A;  3DXK A;  2G8I A;  2BTF A;  2VQF K;  1BI4 A;  4K42 A;  4JI8 K;  3OYE A;  3OYI A;  5FRM A;  4Z94 A;  1CZB A;  3ATV A;  4FW1 A;  1WB9 A;  3DRP A;  4JI1 K;  5BR9 A;  5FPE A;  3ENO A;  3HVR A;  5AQH A;  4CF8 A;  2HHQ A;  3OYF A;  3WEE B;  1UOC A;  1QHA A;  4FK4 A;  3L8B A;  3A2F A;  2F9W A;  5BPN A;  4CHP A;  2WTU A;  3O9Q A;  3BGR A;  1WSJ A;  3A5M C;  4BRL A;  4DFJ A;  4DTN A;  3PUF A;  3BF3 A;  4HTU A;  3HO1 A;  3DWL A;  3HBT A;  5CE3 A;  3QML A;  5AFU A;  1VQ4 N;  1W97 L;  4IZ9 A;  4OPH A;  1EWR A;  1P90 A;  1YT3 A;  3CG7 A;  1ATS A;  3TTF A;  2VG5 A;  4OKJ A;  1VSK A;  4W5T A;  4PA1 A;  3B6P A;  1NK6 A;  3MXJ A;  1KFS A;  3CCL N;  3LP3 A;  4EZ6 A;  3ZSW A;  4JEP A;  1SS6 A;  5IT9 O;  4FO0 A;  4DTX A;  4DTU A;  4JI4 K;  4CZI A;  2VQE K;  3IAY A;  1BL3 A;  1J54 A;  4ICL A;  1L5U A;  2NRT A;  1VSE A;  2UYT A;  4OJR A;  1Y64 A;  4KB1 A;  3WXJ A;  4F3O A;  1RTJ A;  2IDO A;  3MED A;  2O8E A;  1VRT A;  1NGD A;  3QET A;  4IEE A;  4B9V A;  3DM2 A;  2NRH A;  2HMP A;  1Q82 O;  4AHT A;  5GAD P;  4DR1 K;  4PL8 A;  4BRM A;  1HRH A;  4M63 C;  4FXD A;  1YVU A;  4ZTF A;  4WQ4 A;  3SBG A;  5DMR A;  5ELZ A;  5HP1 A;  1U47 A;  2YNI A;  4EP5 A;  4CJW A;  4FJN A;  4ELU A;  1HYZ A;  3L2R A;  4DV1 K;  1NGC A;  1U48 A;  4KHQ A;  2D0P A;  3W0L A;  3SJH A;  3H46 O;  4FZY A;  3BF1 A;  4RTF D;  4JK8 A;  4KRE A;  3ITH A;  3I8D A;  3QEX A;  2NRV A;  2QWN A;  3RSE B;  2IGI A;  4M3X A;  4JKA A;  3VF6 A;  2HHH K;  2A5X A;  4X62 K;  4DR7 K;  4OGC A;  4DUZ K;  3AGK A;  2KQ2 A;  2Z1I A;  5AQM A;  5IWA K;  3SUN A;  3QEI A;  2FSJ A;  1GLJ O;  2G8K A;  3KVG A;  4DS4 A;  3C6U A;  4JKH A;  5KRT A;  2ASO A;  3TAP A;  1IKV A;  2BH1 A;  4CJQ A;  5HRS A;  1RNH A;  3P83 D;  4JKB A;  3QIC A;  5AQI A;  3BY5 A;  3SAH A;  3HVT A;  5GIO A;  3KK2 A;  1X3N A;  5CZ1 A;  5AQZ A;  1BG3 A;  5F1X A;  4OKE A;  2BDP A;  4DMN A;  3QBW A;  3PO4 A;  1Q81 O;  1BQM A;  2F4V K;  4FVM A;  1TAQ A;  1L3V A;  4WYB A;  2NUB A;  4GV3 A;  3TAM A;  4FJ9 A;  2PAV A;  4CGI A;  5C2F A;  1YJ9 N;  3NMU A;  5MLC Q;  4PWD A;  1HYS A;  4JKG B;  3RMB A;  4K41 A;  4JHD B;  4KH5 A;  1RDD A;  2OZM A;  1X9J A;  4KH4 A;  3T1H K;  3EKU A;  3HP9 A;  1U45 A;  4I2P A;  3NGZ A;  3VQ7 A;  3AVI A;  4E7H A;  4RW4 A;  3UE5 A;  1LAV A;  2PFU A;  2ZD1 A;  3NF7 A;  3VEN A;  3WXM B;  3ZSZ A;  3SV3 A;  1VQ6 N;  4C23 A;  2QKK A;  3QFP A;  4CJL A;  4ID1 A;  4GW6 A;  5JVG L;  4AQY K;  5JLH A;  5GAE P;  4LF9 K;  4OLA A;  3T69 A;  3OYB A;  4I7F A;  3EEQ A;  4FJK A;  4FWM A;  4CJT A;  1QVG M;  2A6A A;  1ILY A;  4XEI A;  4BRQ A;  3CCS N;  3HPO A;  1KLM A;  2DFE A;  3LDL A;  3L3U A;  5AQN A;  3NH0 A;  1CXQ A;  1GOA A;  1U2V B;  4B1Y B;  1B9F A;  3LM2 A;  1J53 A;  3I56 N;  4DV5 K;  4A61 A;  3CQ8 A;  4CGG A;  3C65 A;  3LDN A;  4C1N K;  3NF6 A;  4AIL C;  4Z4E A;  4ILG B;  3WNF A;  2V7Y A;  2WON A;  3ID6 A;  3O8M A;  2BAN A;  5C15 A;  4WF9 L;  1HQE A;  3AO3 A;  1OH7 A;  3THX B;  1N6Q A;  3SQ2 A;  3JAM O;  1TKT A;  5BPM A;  3P5J A;  1K8K B;  3T19 A;  3TAN A;  4B3S K;  3I8B A;  1NGI A;  3EZ5 A;  3ZSQ A;  2ITM A;  1HUX A;  4HCC A;  4DQ8 A;  3EE8 A;  3JXU A;  4AHU A;  3EE9 A;  2XY5 A;  4H5R A;  5TKW A;  5SZT A;  4RG8 A;  2P9S A;  3DRS A;  1KTQ A;  5KPR A;  3ZX0 A;  5ADX A;  4BRP A;  1H1V A;  3VOV A;  1TK8 A;  4CJ4 A;  1EQY A;  1BA0 A;  3K9K A;  4Z0U A;  1NU0 A;  1NOY A;  1FK9 A;  3AA4 A;  3SPZ A;  4KTQ A;  3CJB A;  4IO9 L;  3KD1 E;  2Y1J A;  1L3U A;  4CF1 A;  4UY8 O;  3MK6 A;  3T3F A;  2IVO A;  3V9W A;  1VQN N;  4BVO A;  4PUO A;  3T1Y K;  3A5L C;  4MFB A;  3V81 A;  3V6D A;  4CVN E;  4H5V A;  4KV8 A;  1I39 A;  3Q7C A;  4CD1 A;  4CEF A;  4F2R A;  4B8C A;  1Q18 A;  1YAG A;  3WQU A;  1RT6 A;  1S1U A;  3VQ9 A;  2OA8 A;  4C8N A;  4OPK A;  1EX4 A;  2IIR A;  3HST B;  1QQC A;  3FZK A;  3LL3 A;  4CBW A;  4M7X A;  4M41 A;  4LF4 K;  4LFB K;  2Q0R A;  3U9D A;  3UB5 A;  1N36 K;  3HOT A;  4C8L A;  5J1E A;  4FSV A;  2A1R A;  3LPT A;  4YFU A;  4FWP A;  1VSF A;  3L3V A;  1X9M A;  3PLA A;  3CPW M;  3ZCM A;  4HUF A;  1E4G T;  1RBU A;  2YCH A;  2GTD A;  4CI6 A;  1NKB A;  1Q7Y O;  1RDC A;  4Q0B A;  3KK1 A;  4I6M A;  4E7K A;  4NB4 A;  3MN6 A;  3WXL A;  4PKG A;  4B9T A;  1C1B A;  3J8A A;  1U49 A;  4IKF A;  1D8Y A;  5C12 A;  1NOZ A;  4DQR A;  2JLE A;  5GAH P;  1VQ8 N;  5M1N A;  4FLX A;  1C0M A;  4FOE A;  4EFH A;  2D0O A;  4ELV A;  4PHT X;  4CJF A;  2YHY A;  4FLW A;  3MDQ A;  2JWK A;  4CIF A;  2RKI A;  3S3N A;  5HL7 L;  2B4J A;  4WFN L;  1QE1 A;  3J7Y P;  1D4X A;  3AVH A;  3AVG A;  1Z26 A;  1Q9X A;  1YXQ A;  4A59 A;  4FM1 A;  1Q86 O;  1XNQ K;  4IFE A;  3VF4 A;  4MO4 A;  3HT3 A;  4DR4 K;  4FZX C;  1U4B A;  3H1Q A;  4CZG A;  4HHT A;  3THW A;  2P9P A;  3FZM A;  1LW2 A;  2OPS A;  1VQ5 N;  3WQT A;  3CCU N;  3ZT2 A;  2A41 A;  1JJ2 M;  3RR8 A;  4O0I A;  2UXD K;  4BGA A;  4CJU A;  2ZGY A;  3V9X A;  4N5S A;  3MAQ A;  3ALY A;  1X9S A;  5AZI A;  3V9Z A;  3AAQ A;  3DLK A;  1GLD G;  4OPJ A;  1HKB A;  5EVZ A;  4U67 L;  1RDU A;  3OTO K;  3QLH A;  3S3M A;  1IG9 A;  3CCJ N;  3ZX2 A;  3THY A;  4FJJ A;  4FVU A;  3HP6 A;  3SV4 A;  1NK0 A;  1S72 N;  1W7A A;  1KAX A;  2GUI A;  4FW2 A;  4A2A A;  3MN5 A;  3CFP A;  3MCA B;  3O6W A;  4JN4 A;  3BZC A;  1RBV A;  3WNH A;  3M8R A;  1SAZ A;  4CGD A;  3PO5 A;  3OW2 M;  1ZBI A;  3B6O A;  2OCE A;  1HNV A;  4Z4F A;  2UU9 K;  5BN8 A;  5AJ3 K;  2GWJ A;  3VN5 A;  1IBM K;  1OVQ A;  2NRW A;  3OJU A;  3W3D A;  4ZHR A;  2CGJ A;  3J7Z O;  3T7Z A;  1EET A;  1QQN A;  1ZYQ A;  1IJJ A;  4DFP A;  2UXC K;  4DTP A;  4DV4 K;  4FK0 A;  1QSL A;  2HHW A;  2WUS A;  3TSP A;  5AQJ A;  2P51 A;  4FZZ A;  4BQZ A;  3HK2 A;  2LSN A;  3EY1 A;  1ZBS A;  4O55 A;  5CY4 A;  1YTA A;  3CC7 N;  3LDO A;  4CZM A;  2W41 A;  4CCH A;  5BRF A;  1TK5 A;  4K25 A;  3NF9 A;  4EHU A;  1HPZ A;  2VWK A;  1QQM A;  5EU7 A;  3FZF A;  3E9O A;  2KW4 A;  1CLQ A;  2O8C A;  1VQL N;  3G4S N;  2YV0 X;  4CEZ A;  2O8D B;  3QIP A;  3MXI A;  2P9K B;  5HRO A;  4CF9 A;  2OTJ N;  1JL1 A; 
#chains in the Genus database with same CATH homology
 2NRR A;  4M7Y A;  4FO0 A;  2E2O A;  2P9N B;  5EXW A;  2NRZ A;  5JLF A;  4CZI A;  3F9M A;  3JS6 A;  1ATN A;  1K8A O;  2HST A;  1VQO N;  2HOE A;  1NLV A;  3R3L A;  1YJW N;  3VET A;  4BRO A;  1ZXO A;  2NRT A;  2P9P B;  2UYT A;  3R1X A;  1Y64 A;  2V52 B;  3WXJ A;  3CCV N;  4WQ5 C;  4MO5 A;  4BC4 A;  3VEY A;  4BC2 A;  1JCF A;  1VQP N;  4WFB L;  1C0G A;  1NGD A;  4IEE A;  3E9L A;  2CGL A;  3TSQ A;  3FR0 A;  2GX9 A;  5AZI B;  2NRH A;  2HBJ A;  1GLL O;  2HMP A;  2P9I A;  4C1N I;  1S3X A;  1Q82 O;  2H3G X;  5GAD P;  3CCQ N;  4BRI A;  4PL8 A;  4BRM A;  1T44 A;  4H0P A;  3QDK A;  4M63 C;  3UKU B;  1IG8 A;  5GAG P;  5AQY A;  4WCE L;  4WQ4 A;  3SBG A;  5ELZ A;  2J4R A;  5AQK A;  5AQU A;  2D4W A;  3A0I X;  2DPN A;  4H5T A;  4J8F A;  5BRH A;  4FOI A;  3CXC M;  5TKY A;  2NRX A;  2HF4 A;  3KWI A;  1DKG D;  1NGC A;  1U2V A;  2QWL A;  2D0P A;  3W0L A;  3SJH A;  3H46 O;  4YDU C;  1TUU A;  4CZJ A;  4G9Z A;  3BF1 A;  5KQ8 A;  4RTF D;  3CMA N;  4JK8 A;  3S41 A;  3WXK A;  5B8H A;  4EAH D;  2ZJR L;  3WUH A;  4H03 B;  1RDW X;  3WT0 A;  3CJ7 A;  4GV6 A;  5GIN A;  2NRV A;  1RFQ A;  3FZH A;  2QWN A;  3RSE B;  1KD1 O;  3N4Q A;  1Z05 A;  4NO7 A;  4JKA A;  2NNW A;  3O1W A;  3VF6 A;  2VGM A;  5AQV A;  3R8E A;  2A5X A;  2E1Z A;  1M90 O;  5BPL A;  2Q2R A;  2CH5 A;  2RHK A;  3CHW A;  3AGK A;  1K8K A;  3DXK B;  2GUP A;  2BUP A;  3L4Q A;  2QWQ A;  5AQM A;  2YJE A;  1C0F A;  4ILH A;  2QXL A;  4BQL A;  2FSJ A;  1GLJ O;  5DM6 L;  5GIP A;  1OVY A;  3KVG A;  4IEI A;  4BRD A;  1YJN N;  4FWQ A;  3NVM A;  1GLC G;  4JKH A;  5AQW A;  1GLF O;  2ASO A;  3C7N B;  5LJW A;  1T6C A;  3AGR A;  3ENH A;  3OBY A;  4FPA A;  4IJA A;  4IO8 A;  2BH1 A;  5AQF A;  1ATR A;  3GE1 A;  3SAF A;  2ZWH A;  3EN9 A;  3H6E A;  4H0X B;  2E20 A;  4ISF A;  3FFK B;  3CIP A;  3QIC A;  4JKB A;  4A62 A;  5BRD A;  5AQI A;  3SAH A;  3FLC O;  3O4W A;  5GIO A;  4FWL A;  3LDP A;  3MN7 A;  3VF2 A;  5AQX A;  2Q31 A;  1X3N A;  2JWL A;  5AQZ A;  4WQ5 A;  1BG3 A;  1QQO A;  5CHI A;  5F1X A;  3EZW A;  5AQP A;  5JMV A;  2Q0U A;  1NGH A;  4BRH A;  3QBW A;  3SMS A;  1Q81 O;  3A8Y A;  3M3Z A;  1KAY A;  4BR5 A;  4RCH A;  4WYB A;  1S22 A;  1VAZ A;  2E1Y A;  2WBN A;  1E4F T;  4GV3 A;  5E84 A;  2EWS A;  2I7P A;  2I7N A;  2PAV A;  3D7E O;  3E66 A;  1LCU A;  2WC9 A;  1VQM N;  5C2F A;  3GL1 A;  1YJ9 N;  4GV9 A;  3NMU A;  4O8K A;  5MLC Q;  3EKS A;  4FWK A;  4JKG B;  4JKE A;  2NLX A;  4K41 A;  5C10 A;  4FWO A;  1GLE G;  3CJ9 A;  4JHD B;  4KH5 A;  4BRG A;  4CZE A;  1M1K O;  1X9J A;  3D2E A;  4KH4 A;  3EKU A;  4BVP A;  5C0Y A;  3CER A;  2V7Z A;  3GOI A;  3MN9 A;  4AM6 A;  4JAX A;  5AQR A;  3VEW A;  4YDU A;  3TTC A;  1U6Z A;  2OAN A;  3D2F A;  3UE5 A;  4MDB A;  2PFU A;  4ISE A;  3G71 N;  3VEN A;  3WXM B;  3C6A A;  3HTV A;  3G6E N;  4O8U A;  4XH5 A;  3NVK A;  1VQ6 N;  4C23 A;  3ZYY X;  1OKJ A;  3GBT A;  2A3Z A;  3CQX A;  1O13 A;  1BOT O;  3KHY A;  4YOR A;  1W2B M;  4CZL A;  3CJ1 A;  3QFP A;  2ZJQ L;  3K9J A;  1XQS C;  1HKG A;  2QM1 A;  1P8Z A;  4F9O A;  5JVG L;  3KWG A;  4BR4 A;  5JLH A;  5GAE P;  2VGN A;  4B1X B;  3U4L A;  4QS9 A;  3O5B A;  2P9I B;  3T69 A;  1NJI O;  2F9T A;  4BGB A;  4FWM A;  2YHW A;  5AQT A;  1QVG M;  4GVE A;  2HBL A;  3VGK A;  2A6A A;  3AY9 A;  1ILY A;  4BR7 A;  4XEI A;  3LDQ A;  3VER A;  4BRQ A;  1MA9 B;  3O08 A;  4H5W A;  3CCS N;  3O9T A;  5M1P A;  1NGA A;  1HPM A;  3LDL A;  5AFU H;  4BC5 A;  2FF6 A;  1SZ2 A;  4YOU A;  4YOT A;  2YX6 A;  5AQN A;  1RGI A;  3P4I A;  3KK7 A;  1U2V B;  4JD2 A;  4B1Y B;  1KAZ A;  2FLO A;  5AZJ A;  3LM2 A;  4IOA L;  3I56 N;  3QB0 A;  4JKF A;  4A61 A;  4R79 A;  3TTD A;  3CCM N;  3CC2 N;  4BRK A;  4E1J A;  3C6H A;  1KQS M;  4BG9 A;  4KH6 A;  3C65 A;  3LDN A;  3MWP A;  4NLC A;  2GEM A;  3WXI A;  4C1N K;  5I9E B;  4ILG B;  4A2B A;  1JCE A;  2AP1 A;  2V7Y A;  3ID6 A;  3O8M A;  4B1W B;  4PKI A;  4CJ7 A;  3MWT A;  5C15 A;  3DXM A;  4JKD A;  3HOS A;  4WF9 L;  5LJV A;  2WFB A;  2QW9 A;  5F2R A;  3VEX A;  1YIJ N;  2QTD A;  4QS8 A;  2YI1 A;  3U9Z A;  2KLA A;  2KHO A;  4FL9 A;  4EIA A;  5BPM A;  3CCR N;  1K8K B;  3O1B A;  3I8B A;  1NGI A;  1HX1 A;  1X3M A;  3ULE A;  1BU6 O;  3VTH A;  5EOY A;  1DT9 A;  2ITM A;  4WFA L;  4YOV A;  4IXC A;  3DLL L;  1HUX A;  4DQ8 A;  3EE8 A;  1J6Z A;  1XUP O;  3JXU A;  4PL7 A;  3EE9 A;  1BA1 A;  4H5R A;  1DGK N;  3P38 A;  4MLE A;  2D1K A;  2YJF A;  5TKW A;  4B1V A;  1LOT B;  4BRN A;  3OBW A;  2QWO A;  1MWK A;  2P9S A;  2P9U A;  3VTI A;  4YOY A;  5KPR A;  3ZX0 A;  4Y0W A;  4BRP A;  5ADX A;  2ASP A;  1H1V A;  3VOV A;  1XC3 A;  3MX5 A;  1EQY A;  1BA0 A;  3K9K A;  1NGF A;  3HSC A;  2FXU A;  1YHQ N;  1MDU B;  5M1F A;  1HLU A;  3MX2 A;  3ZEU B;  3CME N;  3MMV A;  3H3N O;  3CJB A;  4IO9 L;  3ENB A;  3GG4 A;  4HWI A;  4H0O A;  5KQD A;  4UY8 O;  3MK6 A;  4YOW A;  2IVO A;  1VQN N;  2OTL N;  3M1F A;  4BVO A;  4FWN A;  4AF1 A;  3A5L C;  2VCP A;  3SLC A;  1VQ7 N;  3AAP A;  1YIT N;  4H5V A;  5JIC A;  4EHT A;  3BUZ B;  3IDH A;  4CZK A;  3VMF B;  2NZT A;  3Q7C A;  4CD1 A;  1Q18 A;  1YAG A;  2CGK A;  3WQU A;  5M1Q A;  3OA9 A;  1NBW A;  4IOX A;  5FPD A;  3SMP A;  3DJC A;  4FPB A;  4H0T B;  5AQG A;  2RE2 A;  3DAW A;  4MDA A;  3RVC A;  1QZ5 A;  3D2E B;  3O80 A;  1NWK A;  3A5O C;  2GWK A;  2IIR A;  1CZA N;  3HM8 A;  3ZET B;  3C7N A;  3D2F B;  3FZK A;  3LL3 A;  4CBW A;  4M7X A;  3A5N C;  3M5R A;  5AQQ A;  5AR0 A;  2Q0R A;  3U9D A;  4H0Y B;  3UB5 A;  5AQL A;  3HOT A;  1TYQ A;  1V4S A;  2A40 A;  4JK7 A;  4FSV A;  4H5N A;  1SQK A;  4CZF A;  5BRE A;  2P9L A;  3PIP L;  4CBU A;  4FWP A;  4IJN A;  5C2D A;  3IUC A;  3QFU A;  4QS7 A;  3I33 A;  5M1O A;  3TU5 A;  4IWV A;  3CF5 L;  3PLA A;  3CPW M;  2AA4 A;  3GDQ A;  1E4G T;  4OPA A;  2YCH A;  3MCP A;  2GTD A;  4BRE A;  4CI6 A;  1Q7Y O;  3WEE A;  1BWF O;  4A5A A;  4H0V B;  3ATU A;  4I6M A;  2IVN A;  4DKW A;  4NB4 A;  3VEO A;  4BR0 A;  3MN6 A;  5KPT A;  3TPQ A;  3WXL A;  4PKG A;  1EO1 A;  2A42 A;  3VES A;  2V51 B;  4BRF A;  3J8A A;  3VEZ A;  2Q36 A;  5E26 A;  1WOQ A;  1NGG A;  3CCE N;  5C12 A;  3P31 A;  1YI2 N;  2QA4 N;  5GAH P;  3IMX A;  1HJO A;  2E88 A;  2W40 A;  5M1N A;  4JD2 B;  1VQ8 N;  5AZJ B;  4FOE A;  1JCG A;  4EFH A;  2D0O A;  3ZX3 A;  4PHT X;  3UKR A;  4B1U B;  4ISG A;  2YHY A;  5FPN A;  4U7B A;  3MDQ A;  2JWK A;  2YHX A;  3HI0 A;  2VYP A;  4IOC L;  2E8A A;  4BG8 A;  5HL7 L;  5DM7 L;  3BP8 A;  2VWB A;  4WFN L;  3BEX A;  3DXM B;  2P9K A;  1D4X A;  3R6M A;  3CJC A;  2ZJP L;  1MWM A;  1R59 O;  3OHR A;  4DHY A;  3G25 A;  1YXQ A;  3CQY A;  4A5B A;  3D6R A;  3FZL A;  1YVN A;  4A59 A;  3EL2 A;  1NGB A;  2GEL A;  2P9N A;  4IDH A;  5CR4 A;  1Q86 O;  2QWR A;  5JVH L;  1GLA G;  3CET A;  4IFE A;  4XH1 A;  3ULE B;  4MO4 A;  3VF4 A;  1VQ9 N;  3SK3 A;  1V4T A;  4BC3 A;  3N4P A;  3H3O B;  4RWT A;  3H1Q A;  3O9U A;  4CZG A;  5LY3 A;  3P39 A;  3H45 C;  3PIO L;  2P9P A;  3FZM A;  4BRA A;  1VQ5 N;  3L0Q A;  4CBX A;  1WUA A;  2ZF5 O;  3M6G A;  3WQT A;  2ZGZ A;  1NM1 A;  2P9S B;  2A41 A;  2FSN A;  2P9U B;  4FWS A;  4DCH A;  3CCU N;  1JJ2 M;  4JK9 A;  4BGA A;  1K73 O;  1Z6R A;  3E9P A;  2Q97 A;  2ZGY A;  4JNE A;  1N8R O;  3L6Q A;  3TSU A;  2ASM A;  5AQO A;  4FWR A;  2HF3 A;  3VGM A;  4BRC A;  4O5F A;  5AZI A;  3AAQ A;  2QWM A;  4MLH A;  5F0X A;  1GLD G;  1HKB A;  3EO3 A;  4B1Z A;  3B8A X;  5EVZ A;  1ZC6 A;  4U67 L;  1RDU A;  1KC8 O;  1VQK N;  3CD6 N;  1T3V A;  3UKU A;  3VGL A;  1QZ6 A;  3CCJ N;  1NGJ A;  1KXP A;  1G99 A;  3QBX A;  2F7T A;  3F5T A;  3ZX2 A;  4FVU A;  3ID8 A;  3C0B A;  3CC4 N;  1GLB G;  2CH6 A;  3HRG A;  1S72 N;  2E2Q A;  1KAX A;  3CPE A;  4GY2 B;  4BR2 A;  3VEV A;  2HBM A;  4BY9 C;  4OO1 J;  4A2A A;  3MN5 A;  3O9R A;  3MCA B;  3O6W A;  3AAR A;  4JN4 A;  3SAG A;  1K9M O;  1HKC A;  3E1Y A;  4HTL A;  2QI2 A;  1SAZ A;  4PKH A;  3OW2 M;  3U8X A;  5AQS A;  3RSE A;  2E2P A;  4DB3 A;  2QEX N;  1NMD A;  5BN8 A;  3VPZ A;  2GWJ A;  1TUY A;  3KZB A;  4KBO A;  2NRW A;  3LM9 A;  4L3Q A;  3SBT A;  3DXK A;  3W3D A;  1YUW A;  2BTF A;  2CGJ A;  4K42 A;  3J7Z O;  1TYQ B;  2Q1N A;  3T7Z A;  1QVF M;  1QQN A;  3IFR A;  3CI5 A;  3R9P A;  5H1S Q;  4Z94 A;  2P9L B;  3ATV A;  5ADX H;  1BO5 O;  1IJJ A;  2KKZ A;  4WQ4 C;  4CZH A;  3I55 N;  5BR9 A;  3F2K A;  5FPE A;  3ENO A;  5BN9 A;  3ZEU A;  2WUS A;  3TSP A;  5AQH A;  5AQJ A;  5EY4 A;  4BQZ A;  4LC9 B;  3IKM A;  3O9S A;  3WEE B;  4GNI A;  2FSK A;  1ZBS A;  3Q7B A;  3FE1 A;  4NLB A;  1QHA A;  4XH4 A;  1BUP A;  4JKC A;  3LDO A;  4CZM A;  2QWP A;  3CC7 N;  4I6M B;  2F9W A;  2W41 A;  5BPN A;  5BRF A;  1ESV A;  4AM7 A;  3FGU A;  4K25 A;  3O9Q A;  2HBK A;  1YF5 L;  3HZ6 A;  1DEJ A;  4B9Q A;  4BR9 A;  3A5M C;  4BRL A;  4EHU A;  1QQM A;  3FZF A;  3BF3 A;  5FPM A;  5HOO A;  3E9O A;  2FF3 B;  3DWL A;  1BDG A;  3HBT A;  3QML A;  5CE3 A;  2E2N A;  5AFU A;  3UKR B;  1W97 L;  5M1K A;  1VQ4 N;  4YOX A;  4IZ9 A;  4OPH A;  1VQL N;  3G4S N;  1P90 A;  1ATS A;  3TTF A;  3L4I A;  1T6D A;  2IVP A;  5EX5 A;  2P9K B;  4K43 A;  3ZET A;  1NGE A;  2PBD A;  4ILJ A;  4CD3 A;  3CCL N;  4A57 A;  5KPZ A;  4JKG A;  2OTJ N;  3H1V X;  4JEP A;  1SS6 A;  3CJA A;  4JHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...