4BREA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with transition state mimic adenosine 5'phosphovanadate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
358
structure length
358
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 118
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4breA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4breA02
4JNEA 4BR7A 1E4FT 1MA9B 3ENOA 4BRFA 3O1WA 1P8ZA 1HUXA 3I33A 4C23A 4B1XB 3MMVA 4BR2A 3HSCA 3EZWA 3SMSA 3UKRB 2CGLA 5AQWA 4B1UB 2V51B 4JD2A 1BA0A 3FR0A 2Q31A 4I6MA 3KHYA 2E1YA 3C0BA 5AFUH 3UE5A 1ZBSA 2IVOA 3OHRA 4JHDA 4IJAA 2OANA 4FWRA 2E20A 2QWOA 3SLCA 4RCHA 4XH5A 3GE1A 3VERA 3BF3A 1U2VA 1NGJA 3JXUA 2QWLA 4L3QA 1GLEG 2P9PB 1NGHA 4WYBA 3DWLA 3ID8A 3ENHA 4BC3A 3W3DA 4CZIA 1V4SA 3VF4A 2WUSA 3M3ZA 4JD2B 3HM8A 5FPDA 1NGCA 5AZIB 4I6MB 2P9SA 3VEOA 3GOIA 3H3OB 3ZEUA 3H45C 5CE3A 4M7YA 5AQPA 4CZFA 4BREA 5AQOA 1H1VA 3IUCA 4QS8A 1U2VB 1HKGA 1SZ2A 4A61A 5AQMA 2YHWA 3O1BA 1Y64A 1X3MA 2QWNA 4J8FA 3WEEA 4H5TA 2I7PA 2IIRA 1BWFO 1HPMA 4O8KA 2VWBA 3CHWA 4MLEA 3DAWA 1U6ZA 1T6CA 3LDOA 2P9SB 5AQNA 4LC9B 3A5LC 5EY4A 3H46O 3ZEUB 2E1ZA 2PAVA 3LM9A 2QW9A 3TPQA 1GLFO 3O6WA 1XUPO 4XH1A 4BRQA 2QWMA 3A5OC 2ASOA 4MO5A 1GLCG 3ATUA 1BOTO 3FE1A 4B1ZA 1ZC6A 3GL1A 4HTLA 4DHYA 4IJNA 5EXWA 4BRAA 5AZJA 1XC3A 3WXKA 4BRLA 5B8HA 5JICA 1KAZA 3F9MA 2KHOA 1DEJA 1D4XA 2FF3B 3W0LA 4K41A 2GEMA 1BA1A 3H1QA 1G99A 4PKGA 1DGKN 3D2EB 4A2AA 2A41A 2H3GX 2QWQA 4BC4A 4FWQA 4DQ8A 3FZKA 1CZAN 3CI5A 3QBXA 3MN9A 5AZJB 3VENA 3U9ZA 2GWKA 2NZTA 4B9QA 4BRDA 3J8AA 4JN4A 5E84A 4CBXA 3ZX2A 4FWKA 4AM6A 3BF1A 3MDQA 5AQUA 2IVNA 1S3XA 5ADXA 1X9JA 3JS6A 1ATNA 5EVZA 3AAQA 3WQTA 2E2QA 1Q18A 4E1JA 4Z94A 5KPRA 1T44A 2Q0RA 2ZF5O 2P9NB 4CZJA 3IFRA 2CH6A 2AA4A 1JCFA 1ATSA 1NGDA 2Q2RA 3RSEB 4QS7A 1C0FA 2YJFA 4BGBA 4BVPA 5KPTA 3VGKA 1T6DA 2D0OA 2ITMA 1E4GT 4ISFA 2ZGZA 4BC5A 3IDHA 4EHUA 4EFHA 3A5NC 1MWMA 2DPNA 2P9PA 3AARA 4BRCA 3WQUA 3SJHA 3BEXA 4BR4A 3DXMA 4EHTA 3QBWA 5EOYA 4GNIA 1HKBA 2QXLA 3A0IX 4PL8A 4YDUA 3VEXA 1NWKA 2IVPA 1NBWA 5AZIA 5FPEA 1Z05A 4BG8A 5BR9A 3H6EA 2AP1A 4BRIA 4AM7A 5JLFA 5BN9A 1JCEA 4CBWA 2F9TA 4H5RA 2HF4A 3O5BA 1QQOA 3DXMB 3QMLA 2QWRA 4FWOA 4FWNA 1KXPA 3U4LA 3CJ1A 2FF6A 4B1VA 2QM1A 4CZGA 1NGBA 2E88A 3ZETA 3ZX0A 4IWVA 2A6AA 3KZBA 5AQIA 1NGAA 4NB4A 3MCPA 4PL7A 5BPMA 4CZEA 1LCUA 3VOVA 3R9PA 4F9OA 2Q1NA 1EQYA 1RGIA 3I8BA 4NO7A 3G25A 3C7NB 2HOEA 4H5WA 4H03B 4CJ7A 2ASPA 3M6GA 3ZETB 4WQ5C 1NM1A 4CZHA 3VEWA 5BN8A 1Z6RA 2A42A 3R6MA 2P9LB 5BPNA 5EX5A 3VPZA 3CIPA 1IJJA 2GWJA 2V7YA 4BGAA 3D2EA 2QWPA 2HMPA 5KQDA 3QFUA 3KVGA 4MO4A 4H0OA 1TYQB 1GLLO 1JCGA 2FSNA 1NGEA 4FO0A 4FWSA 2P9UB 4IXCA 4BR0A 3SMPA 5KPZA 4H0XB 3WT0A 5FPNA 1ZXOA 5LJVA 3HBTA 3GDQA 3HTVA 5BREA 4BRHA 4BRPA 4M7XA 4H0TB 5LY3A 3FFKB 1TUYA 1MDUB 4H0YB 5LJWA 5BRFA 4H5NA 4HWIA 2F9WA 5ELZA 4FPAA 1IG8A 2D1KA 2E8AA 3EKUA 2P9NA 1C0GA 4BRNA 3U9DA 2D4WA 4EIAA 3FGUA 3LDLA 3GG4A 3RSEA 1BO5O 4FWPA 5AQFA 1X3NA 3R8EA 1RDWX 2J4RA 3CJ7A 3HI0A 2ZGYA 5AQRA 1HJOA 5BPLA 3CQYA 4K25A 1DKGD 4PKIA 1TUUA 3CJBA 3VF2A 2E2OA 1KAYA 4Y0WA 2W40A 1QQMA 1SAZA 4FSVA 5TKYA 4CZMA 2CH5A 3MK6A 1J6ZA 3GBTA 4FWMA 1WOQA 3EO3A 3O80A 2CGJA 4JAXA 4CZLA 1YXQA 4FOIA 2YI1A 4IZ9A 3O08A 4B1YB 3FZHA 5JLHA 2P9KA 2I7NA 3D2FA 4XEIA 2P9IB 3H1VX 4IO8A 4B1WB 3WXIA 4BRGA 2FSJA 5AR0A 4BG9A 4BVOA 2W41A 4DCHA 2FSKA 2Q97A 3LDPA 3VETA 2ZWHA 1BU6O 1ATRA 2P9KB 2VYPA 3D2FB 5AQXA 2GUPA 4CD1A 4K42A 1NGFA 2BTFA 4WQ4C 3CJAA 4EAHD 3MN7A 4FWLA 2YHYA 4H0PA 3S41A 3ZX3A 1NGIA 2A5XA 2PBDA 3P4IA 5I9EB 3QICA 3C7NA 5AQSA 3QFPA 3TU5A 1MWKA 3LM2A 2GELA 1GLJO 5JMVA 5BRDA 2P9LA 4ISEA 1NMDA 3DJCA 1YAGA 3VEYA 3CERA 4A62A 1YVNA 2ASMA 3M1FA 2NLXA 2GTDA 3MN5A 2E2PA 2FXUA 4BR5A 2CGKA 3B8AX 4RTFD 5AFUA 3HZ6A 3O4WA 1GLBG 1OKJA 1TYQA 3QDKA 5FPMA 3AAPA 5AQQA 3LDNA 2P9UA 1LOTB 3BUZB 4JHDB 5AQHA 2D0PA 4GY2B 3CJCA 3QB0A 1QZ6A 1K8KA 1YUWA 5AQLA 2VCPA 4K43A 3LL3A 1QZ5A 3BP8A 4H5VA 3VF6A 1QHAA 2BUPA 3ATVA 4ISGA 4XH4A 5AQYA 2Q36A 2HF3A 4H0VB 5F1XA 2A40A 3UKUA 3VESA 4DB3A 5AQVA 3FZMA 1HKCA 5AQJA 3EL2A 2YJEA 1XQSC 4BC2A 1S22A 1K8KB 1V4TA 2A3ZA 4BR9A 2YHXA 3VEVA 4WQ4A 3WEEB 3IMXA 5ADXH 2NRHA 3DXKA 2YCHA 2E2NA 3CETA 3A8YA 3FZLA 5F0XA 2V52B 4YDUC 3UKUB 4CD3A 4CI6A 4A2BA 2UYTA 3VEZA 3L4IA 4QS9A 3O8MA 3MN6A 3AY9A 4M63C 4FPBA 5AQGA 1BDGA 2FLOA 4MLHA 5AQKA 3DXKB 3FZFA 3H3NO 2P9IA 1ESVA 4BQZA 3L0QA 5AQTA 3WXLA 3VGLA 1BUPA 2V7ZA 3WXJA 3A5MC 4BROA 1BG3A 4WQ5A 3ULEA 3EKSA 5KQ8A 1HX1A 4BRKA 3U8XA 1HLUA 1R59O 5AQZA 5E26A 1GLAG 4RWTA 3LDQA 3CJ9A 4PKHA 1RFQA 3L6QA 2EWSA 4KBOA 3WUHA 3CQXA 2Q0UA 1NLVA 3SK3A 4BRMA 3UB5A 4O5FA 3FLCO 1KAXA 1WUAA 4FOEA 4BQLA 3UKRA 3VGMA 4CBUA 1SQKA 1NGGA 3ULEB 5BRHA 3EN9A 4CZKA 3D7EO 4FL9A 1GLDG 1QQNA 5F2RA
chains in the Genus database with same CATH superfamily
3KLIA 3KD1E 2A1RA 5IWAK 4DU1A 2HNZA 4BRFA 1UA0A 4B1XB 3WNGA 4FW2A 4YORA 4J2DA 2CGLA 3VQ4A 2V51B 4JD2A 4B9MA 2Q31A 3M8PA 4CEQA 2E1YA 3C0BA 3ZSOA 3UE5A 1ZBSA 2IVOA 2E20A 4RCHA 4N76A 3BF3A 4I9QA 3SZ2A 5C0YA 2QWLA 4L3QA 1GLEG 1ITGA 4UY8O 3NE6A 3DRSA 4JI0K 1BGXT 4DTNA 1OH7A 1L3UA 2QK9A 5FPDA 4DTOA 2HSTA 4I6MB 3VEOA 3LWLA 3ASMA 3GOIA 3ZEUA 5JVHL 1OH5A 4DR2K 4CK3A 4CZFA 1SL1A 4BREA 4N41A 3ZCMA 1U2VB 4PQUA 3QNNA 1YJ9N 4I9LA 4A61A 5AQMA 1X3MA 4J8FA 2IIRA 4PUOA 1HPMA 4O8KA 3MEGA 4MLEA 3CCQN 2OA8A 1T6CA 4JK7A 3DM2A 2E1ZA 1LWEA 3LM9A 3CD6N 1RDAA 3EEQA 4XH1A 2QWMA 3HO1A 3A5OC 3R1XA 1RDCA 4M3RA 2KW4A 2RKIA 3TAGA 4B1ZA 1KSPA 1ZC6A 3GL1A 4HHTA 4BRAA 5AZJA 4BRLA 4CJ5A 3HYFA 2KHOA 1CZ9A 3O4NA 4Z4HA 3CCSN 4J2EA 4OLAA 4YFUA 2PY5A 2HNYA 3PY8A 3VQCA 2IAJA 1DGKN 2BH1A 4CERA 2A41A 1J5EK 4JI7K 1BCMA 3QEPA 3MXJA 4BC4A 3MXMA 4DQ8A 3FZKA 5J2PA 1CZAN 3QBXA 3VENA 4KREA 2RN2A 2GV9A 1XWLA 4CJSA 4MDAA 3J8AA 4LH4A 1P90A 4FJIA 3ZX2A 3DOKA 4Z4CA 3BF1A 5AQUA 3DYAA 1S3XA 3JS6A 3DMJA 4FLYA 4TSXA 3EE9A 3WQTA 4Z4FA 2E2QA 1Q18A 1D8YA 2IDOA 4LFAK 4Z94A 2NNWA 4JK9A 2P9NB 1O13A 3O9UA 2CH6A 2AA4A 1ATSA 1NGDA 4QS7A 1C0FA 2YJFA 3OYLA 1DTTA 2D0OA 5HOOA 4NCBA 4FVMA 1W0HA 1BCOA 2G8KA 1MWMA 4JI2K 4X66K 2P9PA 2KTQA 2D0AA 3O9SA 3QETA 4PHTX 3QBWA 2XO7A 3KLEA 3ZSRA 2IVPA 1NBWA 3SPZA 2AP1A 3S3MA 3HPOA 4IG0A 1F21A 1D5AA 1LAVA 3VQAA 1JCEA 1RT7A 3T1HK 3M8SA 4M3ZA 3AA4A 2HF4A 3O5BA 4JKEA 1C0UA 3ALYA 2D0CA 1RBUA 1KXPA 3U4LA 4V19S 1KFDA 4CZGA 2VWKA 3OYAA 4YOVA 4K8ZA 2HBKA 2QKBA 3ZX0A 3J7ZO 3MCPA 5DMRA 4A5BA 4N5SA 4CZEA 3VOVA 2D5RA 4F9OA 2E5LK 4KHWA 1EQYA 4M3WA 2IC3A 4DKWA 1RGIA 1TK5A 4ILJA 2KLAA 4JKFA 1WSJA 4ZHRA 3OA9A 3C7NB 1NMNA 3CXCM 3P1GA 3HM9A 4H5WA 4YY3K 4CJ7A 2ASPA 4WQ5C 1VSDA 2GBZA 4O4GA 5EX5A 1JLAA 2JGUA 1X9SA 1NK6A 3D2EA 5I3UA 1S9GA 4ELVA 4O55A 3WNHA 4LSNA 1JCGA 4Y1CA 5GAGP 2QKKA 4KI4A 3PLAA 4FO0A 2P9UB 3OS1A 3SV4A 3L3VA 4BR0A 3CQ8A 3WT0A 4AILC 4FW1A 1VAZA 3GDQA 2O8DA 2BANA 2WONA 3F73A 2IOCA 4CF1A 4BRPA 4CEOA 3G6EN 5LY3A 3FFKB 3F9KA 4FZYA 3RRHA 3TTCA 3ZSYA 1IKXA 4FJXA 1MDUB 3VQ7A 4H0YB 1QSLA 4FPAA 4CW7B 4WCEL 1IO2A 4RW8A 3ULDA 1YTUA 1X3NA 2UUBK 3HI0A 3M8RA 2RF2A 2ZGYA 2ZJQL 4DSJA 5AQRA 5BPLA 4CHQA 1DKGD 4C8MA 1CLQA 2OPQA 4WF9L 3THVA 4CE9A 3Q7BA 5KI6A 4FSVA 3CMEN 4DTSA 1OH6A 4DF4A 3JYTA 3MECA 4DFJA 1XMQK 2G8FA 1VQ4N 3EO3A 1XNRK 1HPZA 2XHBA 4F3OA 3FZHA 3S9HA 2I7NA 4XEIA 3THXA 4B1WB 3J80O 4X65K 4KKOA 4DCHA 4CEEA 4FVUA 3LANA 1Q9XA 3LDPA 3AO3A 1TL3A 1SKWA 2P9KB 4CVNE 1QVFM 5AQXA 1IKYA 4CD1A 3P39A 5CYMA 2X74A 1VQLN 4WQ4C 3CJAA 4EAHD 1JJ2M 1VQMN 3ISNC 4DV3K 1NKEA 4CGDA 4HTUA 5C25A 4FZXC 5AQSA 2HHUA 4CHZA 1N33K 3SBTA 2O8FA 4MQ3A 5C12A 3T69A 3AVMA 2JLEA 1EX4A 4ZTFA 1NJXA 3HL8A 4A62A 4FZZA 2FXUA 3L8BA 1VQ5N 4BR5A 2CGKA 3AGRA 3HOSA 5C2FA 5AFUA 3P38A 4CEFA 2YNGA 3HZ6A 1OKJA 4FJLA 5KTQA 4C1NK 3BUZB 5AQHA 2D0PA 3SJJA 1BI4A 3CJCA 2O8EA 3QB0A 3S3OA 3J7YP 3KKSA 1T05A 1YUWA 4U7BA 3SUQA 4KHSA 2BUPA 4ISGA 4XH4A 3TSUA 1N5YA 3QEXA 4NXMK 3ZT2A 4FYDA 4LSLA 3P31A 1KVAA 4GW6A 1Q82O 1HKCA 2HVIA 4E1NA 2A3ZA 4JS4A 4BR9A 1NU0A 2O8CB 1BQMA 2I5JA 1QSYA 2WOMA 1S1WA 3N4PA 4CGFA 3JAMO 3QNOA 4DSFA 4X62K 1T7PA 2WBNA 3TWHA 2HHHK 3SBGA 2HHWA 4CI6A 3HJFA 4DSLA 1ZBUA 2NRXA 2HBMA 4GMJB 2AJQA 1JLEA 4FPBA 4DR4K 4U67L 2FLOA 3DXKB 3TAFA 3QEIA 4O5BA 4IFEA 5JS2A 2P9IA 3G0ZA 3ENBA 4CJWA 1VQ7N 4BQZA 4KTQA 5H1SQ 3VGLA 3K57A 3A5MC 4KHYA 4FCYA 1NKCA 1K9MO 4I7FA 3E9OA 3WNFA 4RW9A 4BRKA 1SV5A 3U8XA 1HLUA 1R59O 4JKGA 4XIUA 3OYDA 1I94K 3LDQA 2EX3A 3NH2A 2LSNA 3K58A 2YHAA 3OYGA 3SK3A 5HRNA 3UB5A 4FLZA 1J53A 5M1OA 3B6OA 4DR5K 1VSHA 1NGGA 3ULEB 4CEDA 4DTMA 4JI3K 1RCHA 3HVRA 4FL9A 4KV8A 5F2RA 3AGKA 4OPJA 4JNEA 1TKZA 1FKOA 4DSIA 3NMUA 1HRHA 1P8ZA 3RTVA 2KZMA 1UWBA 4CF9A 4M3YA 4BR2A 1R0AA 1IH7A 3HSCA 3SMSA 5AQWA 4O0JA 1BA0A 1S6PA 3KHYA 5AFUH 3OHRA 1TKDA 4CFDA 1KLMA 4CIGA 2QWOA 3SPYA 3RWUA 2NRVA 4G9ZA 1I39A 1NGHA 2P9PB 3CG7A 4BC3A 4OVLA 4DU3A 3HM8A 3HXMA 5KRTA 3AVLA 4FLTA 1NK7A 4M7YA 2WFBA 3VQ8A 1H1VA 2O4IA 1VK0A 4JI6K 3CCJN 1HKGA 1TL1A 1SZ2A 2Z1GA 1OVQA 3MEEA 2KZZA 1Y64A 1KVCA 2QWNA 4H5TA 2I7PA 1BWFO 1SUQA 1WNSA 2W6KA 3BY5A 3NF9A 2OPSA 3DAWA 2HNDA 1U6ZA 4FJGA 2FC0A 2P9SB 3AV9A 4LC9B 1REVA 2PAVA 2NRWA 1Q9YA 4A57A 4FM2A 3O6WA 4B9VA 4B8AB 3RMAA 4AHVA 4NCAA 4JI1K 2B6AA 3TR8A 1JXEA 3HK2A 4BRQA 3DLGA 1U4BA 4MO5A 3ATUA 3V1OA 5CR4A 3L2WA 4O0IA 3LPUA 2F7TA 4DWIA 3KK2A 4Z4EA 4DHYA 3H08A 5EXWA 3SYZA 1XC3A 5JICA 1KAZA 4GKKK 3CF5L 4M3TA 4W5TA 3IAYA 3CFOA 1U04A 4WFAL 3LP1A 3NVMA 2GEMA 3RR7A 4FJ8A 4PKGA 4DV5K 3CPEA 4QAGA 4FJ5A 3D2EB 4LH5A 5D3GA 3I56N 1U47A 4FWQA 3SQ2A 3CI5A 3MX5A 3LALA 1N6QA 1W2BM 3G4SN 2O8DB 1ZYQA 4B3OA 4FWKA 3E9LA 5C2DA 5CYQA 4AM6A 1L5UA 3QESA 3LWMA 4O44A 4YOWA 5EVZA 1K73O 4IO9L 1EWRA 1I3AA 3DLEA 3KLGA 1KVBA 2Q3SA 3MCAB 3LAMA 4CZJA 2F8TA 3IFRA 4JK8A 1JCFA 2Q2RA 4EZ9A 5KPTA 2O4GA 5BR8K 4X64K 1E4GT 4ISFA 4E7JA 2UXBK 3NFAA 3IG1A 3F5TA 4EFHA 1XNQK 1HYVA 4IDHA 4DV4K 4BRCA 4QOZB 3WQUA 4BR4A 4GNIA 1HKBA 3A0IX 4DR3K 5J2QA 3AVGA 5AZIA 3RRGA 1Z05A 4BG8A 5T7BA 4DFPA 2RHKA 4BRIA 4KB0A 4AM7A 3THXB 2F9TA 1XMOK 1ASWA 1N36K 1A5XA 1WBDA 3L2QA 5CY4A 1QQOA 3DXMB 3DOLA 3OYIA 2QWRA 1QVGM 4B1VA 1NGBA 2E88A 3ZETA 3HPGA 2E4LA 4IWVA 4YOYA 1GOBA 3HOTA 1NGAA 3G10A 5BPMA 3J7AP 2IS3A 1LCUA 3MXIA 3R9PA 1QHTA 5C15A 1K8AO 4WFNL 1JLGA 4KRFA 3VQ9A 3NH1A 4H03B 4DS5A 1NM1A 3PX6A 3TAQA 1VSLA 1W97L 2O8FB 2DFFA 3DRPA 1VSEA 1Z6RA 2A42A 3PSIA 3R6MA 3AA5X 5BPNA 4IEEA 3PO5A 4ICLA 2ATQA 3K5OA 3VPZA 3CC4N 4BE0A 1IJJA 3CCMN 4BGAA 1SL0A 4KHQA 1VSMA 4QCLA 4ID1A 4KO0A 1C0TA 2Y1IA 4B3TK 2FSNA 1NGEA 4RW7A 5J1EA 1RBTA 4CJTA 1EKEA 3U6FA 4O8UA 1C1CA 3F2KA 4H0XB 1BI4B 1Y97A 1ZXOA 5CZ2A 4ILGB 5KPZA 5LJVA 3CCVN 4G1QA 5BREA 3O3FA 3V4IA 4H0TB 4DR1K 4GV6A 3MAQA 1TUYA 4Z0UA 5GADP 5LJWA 2PFUA 4H5NA 4HWIA 1NG9A 3ZSWA 3HRGA 1TKTA 3TAMA 1IG8A 3BDPA 3EKUA 1BQNA 4KB1A 1FXXA 3U9DA 2D4WA 4EIAA 3LDLA 3PIOL 1VQNN 5AQFA 3BZKA 4FJJA 3AVKA 4CJFA 1RDWX 3O9QA 3VN5A 4K25A 4CEZA 2ZM6K 4PKIA 3CJBA 1IBMK 5GAEP 3V9WA 4Y0WA 3V81A 3R3LA 1OH8A 4HVJA 1KTQA 5CZ1A 3TTDA 2QEXN 4JKBA 1WOQA 1J9AA 1QS4A 3O80A 2CGJA 1CZBA 1SKRA 5HP1A 2P9IB 2G8WA 4IO8A 2HW3A 5TKWA 3HPHA 1Z25A 3QLHA 3OYBA 5FDLA 3OY9A 1J54A 1CXUA 5HRPA 2W41A 2Q97A 3RMDA 4I2PA 4JKGB 1BL3A 2HHTA 1LAWA 2VYPA 3D2FB 2GUPA 1ILYA 4E89A 3M5RA 1RTDA 3LPTA 4H0PA 4LF5K 1C0MA 1EETA 3NBPA 2PBDA 3SQ4A 5I9EB 1HQUA 1IG9A 3QICA 3QFPA 2YNHA 2KKZA 4FXDA 3VA3A 3EE8A 4CEBA 5JMVA 5IT9O 2P9LA 4YHHK 4B9TA 4ISEA 3DJCA 3VEYA 4C8LA 2FBVA 3CERA 2YHBA 1YVNA 2GTDA 2VWJA 2E2PA 4NXNK 3AVBA 4JKHA 3THYA 4RTFD 3SQ1A 3QDKA 5AQQA 3NH0A 3LDNA 1IBKK 3QEWA 4OPKA 1NJIO 1QSSA 4L8RB 1QZ6A 1K8KA 3AVCA 3RR8A 4OPAA 2VCPA 4DLGA 4K43A 4OX9K 1QZ5A 4H5VA 1QHAA 4IEIA 4PY5A 1YI2N 4H0VB 3SAGA 3LDSA 4BWMA 3UKUA 3VESA 3ZT1A 4DB3A 1XQSC 1S22A 1FKPA 3CCLN 2HB5A 3VEVA 3S3NA 3OTOK 3IMXA 4B3RK 4KH6A 1S1VA 4DG1A 2E2NA 3FZLA 4NYNA 4IOXA 3AO1A 4B9SA 4CK2A 3O8MA 3AY9A 1IBLK 4M63C 4DU4A 4N56A 3TARA 4DR7K 3AVFA 1S1TA 3PSFA 1ESVA 1VQ8N 3L0QA 3WXLA 4ELUA 1BUPA 1NK4A 2KFNA 4A59A 4W5NA 1HX1A 5AQZA 3SCXA 3C94A 4RWTA 3D6RA 3UIQA 1RFQA 4RW4A 4KBOA 4B08A 2QA4N 4J2BA 4YOXA 4OKJA 2Q0UA 3SNNA 4Y1DA 4A5AA 4CGHA 4WFBL 4CJ4A 3FLCO 1KAXA 2UXDK 4DV1K 1U48A 1SQKA 4FK2A 4CEAA 3K9JA 1QQNA 3V9XA 1VSJA 3VQ5A 3KWGA 4JI8K 1E4FT 1JL1A 1YVUA 3V9UA 1MA9B 3ENOA 5FLXO 3I33A 4C23A 3V9SA 3N4QA 4CHYA 3EZWA 3UKRB 2B4JA 2PYJA 4JLHA 4I6MA 4H4OA 3I55N 2ZJRL 5M1PA 4IJAA 2OANA 2P5OA 2OZSA 4FWRA 1WB9A 4EP5A 1YJNN 3GE1A 1U2VA 2OYQA 1NGJA 3O4QA 3VA0A 3DLKA 3DWLA 2BE2A 3ENHA 1V4SA 2VG6A 1WSIA 4JD2B 5AZIB 4IFVA 3H3OB 4FJ9A 5CE3A 1B9DA 5AQPA 1VQ6N 5AQOA 1NJZA 3RMCA 3K9KA 3DLLL 3WEEA 1HYZA 4GKJK 1DT9A 3V6DA 2HHQA 4M41A 5EY4A 5AQNA 3A5LC 4OKKA 3P83D 4FM0A 3ZEUB 4DTUA 3AVAA 3TPQA 1GLFO 2YNFA 3AO2A 3OYJA 3OJUA 3VQDA 2B5JA 2OTJN 3OBYA 4DQPA 1Q81O 1BOTO 4C1NI 3QIPA 4DQSA 4CHOA 4C8KA 4IJNA 1RTIA 4KTZA 3WXKA 4AH9A 1IKVA 1G15A 5B8HA 5SZTA 3F9MA 5HRSA 3L2UA 2DFHA 1D4XA 3O9TA 2FF3B 4WE1A 4IOAL 5HRRA 3W0LA 4DV7K 3H1QA 3THWA 4BE1A 4A2AA 3KIOA 2H3GX 4DSKA 2QWQA 4CHPA 3LP0A 3FFIA 1RDUA 4AHSA 5AZJB 4JRPA 2G8IA 1RTJA 4RG8A 4FJKA 2GWKA 4B9QA 4KFBA 3PUFA 1S6QA 4DUYK 4CBXA 3ITHA 3K59A 4CESA 2Z1HA 2WTUA 5ADXA 1X9JA 1ATNA 4UQGA 3AAQA 3OJSA 3B6PA 4Q5VA 1HNXK 4ID5A 5KPRA 3OYHA 1T44A 1NJYA 4E7KA 4YOUA 3I8DA 1RTHA 4BDZA 3VGKA 1T6DA 2RPIA 3P5JA 3HP9A 2VGNA 4CFAA 1EXQA 4CJ3A 5M1NA 2ZGZA 4BC5A 2XRIA 2DY4A 2DPNA 4CIEA 4FLWA 3SJHA 1W9HA 1WAFA 4PL8A 4YDUA 3VEXA 1NWKA 3LP2A 1LWCA 5GIPA 5FPEA 5GAHP 3A2FA 4YNQA 3CC2N 2X6NA 4Z4GA 4E7HA 5JLFA 5BN9A 5C24A 4JKCA 3LP3A 2X6SA 2X78A 1EWQA 3ID6A 4CBWA 3TSQA 4F2RA 5JS1A 1JXBA 2QXFA 3QMLA 4FWOA 3TAEA 4FWNA 1CXQA 4HUGA 3KLHA 1VQKN 1T03A 4Z4IA 2F8SA 3NHGA 5DM7L 3KZBA 4JI4K 4PL7A 2GUIA 4AHUA 3DLHA 1ASVA 2Q1NA 1BHLA 4DQQA 2HHXA 1ASUA 3I8BA 4CHNA 4NO7A 4NCGA 1RBRA 2HOEA 3NCIA 3M6GA 1K6YA 5M1QA 4CZHA 3VEWA 5BN8A 2P9LB 1EO1A 1RBVA 4B9NA 2QWPA 2HMPA 3QFUA 3KVGA 1LWFA 4JV5K 1C1AA 3G71N 3SMPA 2KQ2A 1S9EA 5FPNA 1LV5A 3HBTA 3ZSXA 5LMNK 2IGIA 1M1KO 1LW0A 2PZSA 3EZ5A 3C6TA 4DS4A 3T1YK 5BRFA 2UXCK 2F9WA 5ELZA 3EY1A 3AVJA 1QTMA 4H4MA 3NAEA 3QEVA 4BACA 1NJWA 2YV0X 1TAUA 1HQEA 1YT3A 3RSEA 1S5JA 4FWPA 4IOCL 4DTRA 3U3YA 3PX4A 2XY7A 3CJ7A 4DLEA 1VHXA 2DTUA 4CCHA 4DFMA 1WSGA 4JRQA 2ITGA 2PYLA 4LF7K 1D9DA 1ZBHA 1DLOA 1JLQA 4CZMA 3MK6A 4M3XA 4FWMA 3VQEA 4JAXA 1YXQA 2YI1A 4IZ9A 2OPRA 2P9KA 4DV2K 3H1VX 4LFCK 3KTQA 3WXIA 4PA1A 4CK1A 3PIPL 5JVGL 2FSJA 1YTAA 4CF2A 4BVOA 1RILA 2YKMA 1TK0A 4CGJA 4BWJA 4AQYK 3Q7CA 1NOYA 3VETA 3M8QA 2D0BA 3NGIA 3NF7A 1Q86O 1KQSM 1NK0A 4BDPA 2F96A 5KRSA 4K42A 2E6MA 1Z26A 3MN7A 1JLFA 1GOAA 3E01A 2YHYA 3S41A 2A5XA 3AVHA 4JYAK 3T3FA 3P4IA 3L3UA 3VQBA 2HVHA 3WNEA 2QTDA 4OGCA 1MWKA 3IS9A 3LM2A 2GELA 1GLJO 4E1MA 5BRDA 5AJ3K 1Q7YO 1C6VA 1YAGA 2VG7A 1A5WA 3M1FA 3PV8A 4C8NA 3MWPA 1IV0A 5EU7A 1KC8O 3OVNA 1N32K 1GLBG 1TYQA 1M90O 2ZQBA 5J2MA 2VGMA 1LOTB 3VTHA 4EZ6A 3TI0A 3VQQA 1TVRA 2EHGA 5AQLA 2O8CA 1HMVA 3VF6A 3ATVA 4HUEA 3SAHA 4H8KA 3ZYYX 2HF3A 4JS5A 1S1UA 4B3MK 3CCUN 1KLNA 4KHNA 1EP4A 4GV9A 2O8EB 5AQJA 1BIUA 2YJEA 4BC2A 1V4TA 5HROA 3TABA 4CJLA 4WQ4A 1NK9A 3WEEB 2NRHA 3DXKA 3CM6A 2YCHA 2WC9A 3C6AA 1Q8IA 4GVEA 1NK8A 3A8YA 3PO4A 5F0XA 1O1WA 1RDBA 3C6UA 4YDUC 3K0SA 4CJVA 2UYTA 3VEZA 5A2QO 2XY6A 5AQGA 1BDGA 1VRUA 4MLHA 4KH4A 3FZFA 3LZIA 3H3NO 1SS6A 4ILHA 3C95A 4CJUA 1X9WA 4FJNA 4CFBA 1N34K 1BIZA 2V7ZA 3WXJA 4BROA 1BG3A 1YJWN 3ULEA 3EKSA 5KQ8A 3KLFA 3HP6A 3THWB 5E26A 3NGYA 3VTIA 3L6QA 1TGOA 4M42A 4E7IA 4FJ7A 3QIOA 4BRMA 1TK8A 3NF8A 3CMAN 3HSTB 2Z1IA 4KHPK 1WUAA 4FOEA 4BQLA 4CBUA 4DQIA 3OYCA 4C8OA 4CF0A 5HLFA 1SL2A 1JLCA 4AF1A 1VQON 4CZKA 2JWLA 3D7EO 4CFCA 1GLDG 4E3SA 1S1XA 5LL6Z 4BR7A 4N47A 2P51A 4B8CA 3O1WA 3ZT4A 1HUXA 3MMVA 5M1FA 4CGIA 3I0SA 3SUPA 4M3UA 1KRPA 5I42A 1N8RO 3KKRA 4B1UB 3FR0A 4AHRA 1HJRA 4JHDA 2UU9K 4JKAA 3SLCA 4CJQA 3KJVA 2A1SA 4XH5A 4ZTJA 3VERA 1FK9A 3JXUA 3IKMA 4WYBA 4R79A 4FLVA 3C6HA 3ID8A 1WSEA 3W3DA 4CZIA 4DTPA 1WAJA 4E19A 3VF4A 2WUSA 3M3ZA 4LF4K 4MDBA 4BY9C 1NGCA 3OYMA 2P9SA 1MU2A 3H45C 3NF6A 3SUNA 3OS2A 4E7LA 3IUCA 4QS8A 3TSPA 1LW2A 3D0PA 4KHUA 2YHWA 3O1BA 3AO4A 4LF8K 2VWBA 3CHWA 2G8HA 3LDOA 1RT1A 3H46O 4AHCA 4DTJA 2QW9A 3MWTA 2VG5A 4F3TA 1BISA 4DTXA 1XUPO 1L3TA 4CECA 2ASOA 3AVIA 1GLCG 4DF8A 2O8BA 4W5OA 1RDDA 1L3VA 3FE1A 4AHTA 4I2QA 4HTLA 1NKBA 4DFKA 1DTQA 3ZSQA 1DEJA 1WN7A 4NLCA 4K41A 4EP4A 3SQ0A 1BA1A 2E6LA 1X1PA 1G99A 1HNZK 1RNHA 1FW6A 1YIJN 1YF5L 3LZJA 1HNIA 3AA3A 1NNEA 3MN9A 3J81O 3U9ZA 3QINA 1UA1A 2NZTA 1ZBIA 4BRDA 4JN4A 5E84A 3CC7N 1J5OA 3MDQA 3T1AA 3D45A 2IVNA 4OPHA 5K14A 1RT4A 1C1BA 5HL7L 4E1JA 1YHQN 4K8XA 1YITN 2Q0RA 3SI6A 3AO5A 3ZLJA 1E3MA 1XHXA 2ZF5O 1IKWA 4CJEA 3K2PA 3MX2A 3VQPA 3RSEB 4BGBA 4BVPA 2ITMA 1HNVA 4R5PA 1HR0K 4CJKA 1WSFA 1UOCA 3IDHA 4EHUA 3A5NC 2BDPA 5LMUK 3NVKA 2W6LA 5M1KA 3AARA 3BEXA 2UUAK 3DXMA 4EHTA 1RT6A 5EOYA 2QXLA 4LD0A 2R7YA 5C10A 1HYSA 1XI1A 5BR9A 4DV0K 3H6EA 4HCCA 3KD5E 2VQFK 4ELTA 5DK5A 4F4KA 1TKXA 3OYFA 2P5GA 4H5RA 2Y1JA 3EYZA 4JI5K 4IG3A 4K0KK 4LF9K 1QE1A 1TAQA 2KFZA 3CJ1A 2FF6A 2QM1A 3V9ZA 1VRTA 1FJGK 4IFYA 4OKEA 3CFPA 2A6AA 5AQIA 4GVMA 4NB4A 1TV6A 4W5RA 3NDKA 1RT3A 4CJPA 3DLRA 1VSIA 2ETJA 3G25A 5E41A 4OJRA 1XHZA 2YNIA 3ZETB 3CPWM 1UAXA 3L2RA 4YOTA 3QERA 4NYFA 3CM5A 2NRRA 5FROA 4NLBA 2NRZA 3ZSZA 3CIPA 4KI6A 2GWJA 2V7YA 5KQDA 3O3GA 1JLBA 4JKDA 4MO4A 4B3SK 4H0OA 1TYQB 1GLLO 1B9FA 4FWSA 3WXMB 4IXCA 1RT5A 3OYNA 3L4QA 3HTVA 1S72N 4BRHA 5MLCQ 4M7XA 4FM1A 2HMIA 4KH5A 1L3SA 5KGXA 1T8EA 3K5LA 2D1KA 2E8AA 3VMFB 2P9NA 1C0GA 4BRNA 3KK7A 4FLUA 4CF8A 5DM6L 3FGUA 1KD1O 2P1JA 3GG4A 1BO5O 3U3GA 4DMNA 3QO9A 3R8EA 1VQPN 3OYEA 3T19A 4J2AA 1HNWK 2J4RA 3KWIA 4OGEA 3T7ZA 3CFRA 3KK3A 1HJOA 3CQYA 2YKNA 5GIOA 1TUUA 2ZJPL 4DV6K 1XC9A 3VF2A 2E2OA 1KAYA 2YX6A 3CYMA 2W40A 1QQMA 3OS0A 3NGZA 1SAZA 4DR6K 5TKYA 3IRXA 2CH5A 1J6ZA 3GBTA 4CZLA 4FOIA 4B1YB 3O08A 5JLHA 4M45A 3D2FA 4KAZA 3K5NA 1T3VA 2FBYA 1ZBLA 1QQCA 4BRGA 5SWMA 5AR0A 4BG9A 4PWDA 2FSKA 3K5MA 4CJRA 1JL2A 4IKFA 2FBTA 2ZWHA 1B92A 3TTFA 1BU6O 1ATRA 2HBJA 2FBXA 1NGFA 4BDYA 2BTFA 2OCEA 1U49A 4DQRA 1KFSA 4FWLA 3ZX3A 1NGIA 1WSHA 2OTLN 3ZT3A 2G8VA 2RE2A 3OBWA 3ZSVA 1VQ9N 3C7NA 3HVTA 1D9FA 3RVCA 2XY5A 3TU5A 3BGRA 4F2SA 4FJHA 4FJMA 4OLBA 2HBLA 5GINA 3HT3A 2NUBA 3MEDA 4W5QA 3L2VA 1NMDA 2HHVA 3CCRN 1GOCA 2QI2A 3RMBA 2ZD1A 2ASMA 2NLXA 5C42A 3MN5A 1W7AA 3E1YA 3B8AX 5FPMA 3O4WA 3AAPA 1KCFA 3SV3A 2XY8A 3E9PA 5FRMA 2P9UA 4JHDB 4HCBA 4GY2B 4E0DA 4KPYA 2F4VK 5FRNA 5HBMA 2HHSA 4HUFA 1VSFA 2DFEA 3VQ6A 4OO1J 3I0RA 2ZE2A 3LL3A 3BP8A 2OZMA 1U45A 5AQYA 3THYB 3OW2M 3TAPA 2Q36A 4FLXA 3DI6A 3AA2A 2BGGA 5F1XA 2A40A 2OPPA 4KTWA 3TANA 4BE2A 3C65A 5AQVA 3FZMA 3EL2A 1K8KB 4CGGA 2YHXA 4GV3A 2UUCK 5ADXH 2G8UA 1RT2A 1NK5A 4F8RA 3CETA 1RBSA 2JWKA 2V52B 4FK0A 1A5VA 4JEPA 3UKUB 1NOZA 5CHIA 3ZT0A 4IDKA 4CD3A 1WBBA 4LY7A 4A2BA 3BZCA 2GX9A 1SKSA 2Z1JA 4QS9A 3L4IA 3MN6A 3SAFA 5AQKA 3SUOA 4B9LA 2O8BB 3LAKA 3V1RA 3KK1A 2W42A 4LFBK 3O9RA 4Q0BA 4FK4A 4DUZK 1VSKA 5AQTA 4LF6K 4WQ5A 3DRRA 3E66A 1GLAG 4IBNA 2NRTA 3AVNA 3CJ9A 4PKHA 4CIFA 2EWSA 3PX0A 3WUHA 3CQXA 4DSEA 1NLVA 1JKHA 4MFBA 4O5FA 4RW6A 1ZBFA 3UKRA 3VGMA 2VQEK 1WLJA 3JSMA 3CCEN 5BRHA 3V1QA 5J2NA 1OVYA 3O3HA 3EN9A 3OYKA 4B9UA 5KGWA 1X9MA 3DLBA
chains in the Genus database with same CATH topology
4JNEA 4BR7A 1E4FT 1MA9B 3ENOA 4BRFA 3O1WA 3NMUA 1P8ZA 1HUXA 3I33A 4C23A 4B1XB 3MMVA 4YORA 4BR2A 5M1FA 3N4QA 3HSCA 3EZWA 3SMSA 3UKRB 2CGLA 5AQWA 1N8RO 4B1UB 2V51B 4JD2A 1BA0A 3FR0A 2Q31A 4I6MA 3KHYA 2E1YA 3C0BA 5AFUH 3I55N 2ZJRL 3UE5A 1ZBSA 2IVOA 3OHRA 4JHDA 5M1PA 4IJAA 2OANA 4JKAA 4FWRA 2E20A 2QWOA 3SLCA 4RCHA 4XH5A 1YJNN 3GE1A 3VERA 3BF3A 2NRVA 1U2VA 1NGJA 5C0YA 3JXUA 4G9ZA 2QWLA 4L3QA 1GLEG 2P9PB 1NGHA 3IKMA 4WYBA 3DWLA 4R79A 3C6HA 3ID8A 4UY8O 3ENHA 4BC3A 3W3DA 4CZIA 1V4SA 3VF4A 2WUSA 3M3ZA 4JD2B 3HM8A 4MDBA 5FPDA 4BY9C 1NGCA 5AZIB 2HSTA 4I6MB 2P9SA 3VEOA 3GOIA 3H3OB 3ZEUA 3H45C 5JVHL 5CE3A 4M7YA 2WFBA 5AQPA 4CZFA 1VQ6N 4BREA 5AQOA 1H1VA 3IUCA 4QS8A 3TSPA 1U2VB 3K9KA 3CCJN 1HKGA 1SZ2A 1YJ9N 4A61A 5AQMA 2YHWA 3O1BA 3DLLL 1Y64A 1X3MA 2QWNA 4J8FA 3WEEA 4H5TA 2I7PA 2IIRA 1BWFO 1HPMA 4O8KA 1DT9A 2VWBA 3CHWA 4MLEA 5KPZA 3CCQN 3DAWA 1U6ZA 1T6CA 3LDOA 2P9SB 5AQNA 4JK7A 3A5LC 4LC9B 5EY4A 3H46O 3ZEUB 2E1ZA 2PAVA 2NRWA 2QW9A 3LM9A 3TPQA 4A57A 3CD6N 1GLFO 3MWTA 3O6WA 1XUPO 4XH1A 4BRQA 2QWMA 2OTJN 3A5OC 3R1XA 2ASOA 4MO5A 1GLCG 3OBYA 3ATUA 5CR4A 1Q81O 1BOTO 4C1NI 3FE1A 4B1ZA 2F7TA 1ZC6A 3GL1A 4HTLA 4DHYA 4IJNA 5EXWA 4BRAA 5AZJA 1XC3A 3WXKA 4BRLA 5B8HA 5JICA 1KAZA 3F9MA 2KHOA 3CF5L 1DEJA 1D4XA 3CCSN 3O9TA 2FF3B 4NLCA 4IOAL 3W0LA 4K41A 4WFAL 3NVMA 2GEMA 1BA1A 3H1QA 1G99A 4PKGA 1DGKN 2BH1A 3CPEA 3D2EB 4A2AA 2A41A 2H3GX 1YIJN 2QWQA 4BC4A 3I56N 1YF5L 4FWQA 1RDUA 3FZKA 4DQ8A 1CZAN 3CI5A 3MX5A 3QBXA 3MN9A 5AZJB 3VENA 3U9ZA 2GWKA 2NZTA 4MDAA 4B9QA 4BRDA 3J8AA 4JN4A 1W2BM 5E84A 1P90A 4CBXA 3G4SN 3ZX2A 3CC7N 4FWKA 3E9LA 5C2DA 4AM6A 3BF1A 3MDQA 5AQUA 2IVNA 1S3XA 5ADXA 1X9JA 3JS6A 1ATNA 4YOWA 3EE9A 4OPHA 5EVZA 1K73O 3AAQA 4IO9L 3WQTA 2E2QA 1Q18A 5HL7L 4E1JA 1YHQN 4Z94A 5KPRA 1YITN 1T44A 2NNWA 2Q0RA 4JK9A 2ZF5O 2P9NB 1O13A 3MCAB 4YOUA 4CZJA 3IFRA 3O9UA 2CH6A 2AA4A 4JK8A 3MX2A 1JCFA 1ATSA 1NGDA 2Q2RA 3RSEB 4QS7A 1C0FA 2YJFA 4BGBA 4BVPA 5KPTA 3VGKA 1T6DA 5HOOA 2D0OA 2ITMA 2VGNA 1E4GT 4ISFA 5M1NA 2ZGZA 4BC5A 3IDHA 3F5TA 4EHUA 4EFHA 3A5NC 4IDHA 3NVKA 1MWMA 2DPNA 5M1KA 2P9PA 3AARA 4BRCA 3WQUA 3SJHA 3BEXA 4BR4A 3DXMA 3O9SA 4EHTA 4PHTX 3QBWA 5EOYA 4GNIA 1HKBA 2QXLA 3A0IX 4PL8A 4YDUA 3VEXA 1NWKA 2IVPA 1NBWA 5GIPA 5C10A 5AZIA 5FPEA 1Z05A 4BG8A 5BR9A 5GAHP 2RHKA 3CC2N 3H6EA 2AP1A 4BRIA 4AM7A 5JLFA 5BN9A 4JKCA 1JCEA 3ID6A 4CBWA 2F9TA 3TSQA 4H5RA 2HF4A 3O5BA 1QQOA 3DXMB 4JKEA 3QMLA 2QWRA 4FWOA 4FWNA 1KXPA 3U4LA 1QVGM 3CJ1A 2FF6A 4B1VA 2QM1A 4CZGA 1NGBA 2E88A 4YOVA 1VQKN 3ZETA 2HBKA 3ZX0A 4IWVA 2A6AA 4YOYA 5DM7L 3KZBA 5AQIA 3J7ZO 3HOTA 1NGAA 4NB4A 3MCPA 4PL7A 5BPMA 4A5BA 4CZEA 1LCUA 3VOVA 3R9PA 4F9OA 2Q1NA 1EQYA 5C15A 1K8AO 4DKWA 1RGIA 4WFNL 4ILJA 2KLAA 3I8BA 4JKFA 4NO7A 3G25A 3OA9A 3C7NB 2HOEA 3CXCM 4H5WA 4H03B 4CJ7A 2ASPA 3M6GA 5M1QA 3ZETB 4WQ5C 1NM1A 4CZHA 3CPWM 3VEWA 1W97L 4YOTA 5BN8A 1Z6RA 2A42A 3R6MA 2P9LB 5BPNA 1EO1A 2NRRA 4IEEA 5EX5A 4NLBA 2NRZA 3VPZA 3CC4N 3CIPA 1IJJA 3CCMN 2GWJA 2V7YA 4BGAA 3D2EA 2QWPA 2HMPA 5KQDA 3QFUA 3KVGA 4MO4A 4JKDA 4H0OA 1TYQB 1GLLO 1JCGA 3PLAA 5GAGP 2FSNA 1NGEA 3G71N 4FO0A 4FWSA 2P9UB 3WXMB 4IXCA 4BR0A 4O8UA 3F2KA 3SMPA 4H0XB 3WT0A 5FPNA 1ZXOA 4ILGB 3HBTA 1VAZA 3GDQA 3L4QA 5LJVA 3HTVA 3CCVN 5BREA 1S72N 4BRHA 5MLCQ 4BRPA 4M7XA 4H0TB 5LY3A 3G6EN 4GV6A 3FFKB 1TUYA 1M1KO 4KH5A 3TTCA 1MDUB 5GADP 4H0YB 5LJWA 5BRFA 2PFUA 4H5NA 4HWIA 2F9WA 5ELZA 3HRGA 4FPAA 1IG8A 2D1KA 2E8AA 3EKUA 2P9NA 1C0GA 3KWGA 3VMFB 4BRNA 4WCEL 3KK7A 3U9DA 2D4WA 4EIAA 5DM6L 3FGUA 3LDLA 1KD1O 3PIOL 3GG4A 3RSEA 1BO5O 1VQNN 4FWPA 5AQFA 1X3NA 4IOCL 3R8EA 1VQPN 1RDWX 2J4RA 3CJ7A 3HI0A 3KWIA 3T7ZA 2ZGYA 2ZJQL 3O9QA 5AQRA 1HJOA 5BPLA 3CQYA 4K25A 1DKGD 5GIOA 4PKIA 1TUUA 2ZJPL 3CJBA 3VF2A 2E2OA 4WF9L 1KAYA 2YX6A 5GAEP 3Q7BA 4Y0WA 2W40A 1QQMA 3R3LA 3TTDA 1SAZA 4FSVA 5TKYA 3CMEN 4CZMA 2CH5A 3MK6A 1J6ZA 2QEXN 4JKBA 3GBTA 1VQ4N 4FWMA 1WOQA 3EO3A 3O80A 2CGJA 4JAXA 4CZLA 1YXQA 4FOIA 2YI1A 4IZ9A 3O08A 4B1YB 3FZHA 5JLHA 2P9KA 2I7NA 3D2FA 4XEIA 2P9IB 1T3VA 3H1VX 4IO8A 4B1WB 5TKWA 3WXIA 5JVGL 3PIPL 4BRGA 2FSJA 5AR0A 4BG9A 4BVOA 2W41A 4DCHA 2FSKA 2Q97A 4FVUA 3Q7CA 3LDPA 4JKGB 3VETA 2ZWHA 3TTFA 1Q86O 1BU6O 1KQSM 1ATRA 2HBJA 2P9KB 2VYPA 3D2FB 5AQXA 2GUPA 4CD1A 1QVFM 3P39A 4K42A 1ILYA 1NGFA 2BTFA 3M5RA 4WQ4C 3CJAA 4EAHD 1JJ2M 1VQMN 1VQLN 3MN7A 4FWLA 2YHYA 4H0PA 3S41A 3ZX3A 1NGIA 2A5XA 2OTLN 2PBDA 3P4IA 5I9EB 2RE2A 3OBWA 3QICA 1VQ9N 3C7NA 5AQSA 3QFPA 2QTDA 3RVCA 3TU5A 1MWKA 3LM2A 2GELA 2KKZA 3SBTA 2HBLA 1GLJO 3EE8A 5JMVA 5GINA 5BRDA 5C12A 3T69A 2P9LA 4ISEA 1Q7YO 1NMDA 3DJCA 3CCRN 1YAGA 3VEYA 2QI2A 3CERA 4A62A 1YVNA 2ASMA 3M1FA 2NLXA 2GTDA 3MN5A 2E2PA 2FXUA 1VQ5N 3MWPA 3E1YA 4BR5A 2CGKA 3AGRA 3B8AX 4JKHA 3HOSA 4RTFD 5C2FA 5AFUA 3P38A 1KC8O 3HZ6A 3O4WA 1GLBG 1OKJA 1TYQA 3QDKA 5FPMA 3AAPA 1M90O 5AQQA 3E9PA 2VGMA 3LDNA 2P9UA 1LOTB 3BUZB 4JHDB 5AQHA 3VTHA 2D0PA 4GY2B 4C1NK 3CJCA 1NJIO 3QB0A 1QZ6A 1K8KA 1YUWA 4U7BA 4OPAA 2VCPA 5AQLA 4OO1J 4K43A 3LL3A 1QZ5A 3BP8A 4H5VA 3VF6A 1QHAA 2BUPA 3ATVA 4IEIA 4ISGA 4XH4A 5AQYA 2Q36A 3SAHA 3OW2M 3TSUA 1YI2N 3ZYYX 2HF3A 4H0VB 5F1XA 3SAGA 2A40A 3UKUA 3CCUN 3VESA 3C65A 4GV9A 4DB3A 3P31A 5AQVA 3FZMA 1HKCA 5AQJA 3EL2A 1Q82O 2YJEA 1XQSC 4BC2A 1S22A 1K8KB 1V4TA 2A3ZA 4BR9A 2YHXA 3CCLN 3VEVA 4WQ4A 4GV3A 3WEEB 3IMXA 5ADXH 2NRHA 3DXKA 4KH6A 2YCHA 2WC9A 3C6AA 2E2NA 3CETA 3N4PA 4GVEA 3A8YA 2JWKA 3FZLA 5F0XA 2V52B 2WBNA 4JEPA 4YDUC 3UKUB 3SBGA 4IOXA 5CHIA 4CD3A 4CI6A 4A2BA 2UYTA 2GX9A 3VEZA 3L4IA 4QS9A 2NRXA 2HBMA 3AY9A 3MN6A 3O8MA 4M63C 4FPBA 5AQGA 3SAFA 1BDGA 4U67L 2FLOA 4MLHA 5AQKA 3DXKB 4KH4A 3FZFA 4IFEA 3H3NO 2P9IA 3ENBA 1VQ7N 1SS6A 3O9RA 4ILHA 1ESVA 4BQZA 1VQ8N 5H1SQ 3L0QA 5AQTA 3WXLA 3VGLA 1BUPA 2V7ZA 3WXJA 3A5MC 4BROA 1BG3A 1YJWN 1K9MO 4WQ5A 3ULEA 3E9OA 3EKSA 4A59A 5KQ8A 1HX1A 4BRKA 3E66A 1HLUA 1R59O 4JKGA 5AQZA 3U8XA 5E26A 1GLAG 4RWTA 3D6RA 3LDQA 2NRTA 3CJ9A 4PKHA 3VTIA 1RFQA 3L6QA 2EWSA 4KBOA 2QA4N 3WUHA 3CQXA 4YOXA 2Q0UA 1NLVA 4A5AA 3SK3A 4WFBL 4BRMA 3UB5A 4O5FA 3CMAN 5M1OA 3FLCO 1KAXA 1WUAA 4FOEA 4BQLA 3UKRA 3VGMA 4CBUA 1SQKA 1NGGA 3ULEB 3CCEN 5BRHA 1OVYA 3EN9A 4AF1A 1VQON 3K9JA 4CZKA 2JWLA 3D7EO 4FL9A 1GLDG 1QQNA 5F2RA 3AGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNE A;  4BR7 A;  1E4F T;  1MA9 B;  3ENO A;  4BRF A;  3O1W A;  1P8Z A;  1HUX A;  3I33 A;  4C23 A;  4B1X B;  3MMV A;  4BR2 A;  3HSC A;  3EZW A;  3SMS A;  3UKR B;  2CGL A;  5AQW A;  4B1U B;  2V51 B;  4JD2 A;  1BA0 A;  3FR0 A;  2Q31 A;  4I6M A;  3KHY A;  2E1Y A;  3C0B A;  5AFU H;  3UE5 A;  1ZBS A;  2IVO A;  3OHR A;  4JHD A;  4IJA A;  2OAN A;  4FWR A;  2E20 A;  2QWO A;  3SLC A;  4RCH A;  4XH5 A;  3GE1 A;  3VER A;  3BF3 A;  1U2V A;  1NGJ A;  3JXU A;  2QWL A;  4L3Q A;  1GLE G;  2P9P B;  1NGH A;  4WYB A;  3DWL A;  3ID8 A;  3ENH A;  4BC3 A;  3W3D A;  4CZI A;  1V4S A;  3VF4 A;  2WUS A;  3M3Z A;  4JD2 B;  3HM8 A;  5FPD A;  1NGC A;  5AZI B;  4I6M B;  2P9S A;  3VEO A;  3GOI A;  3H3O B;  3ZEU A;  3H45 C;  5CE3 A;  4M7Y A;  5AQP A;  4CZF A;  4BRE A;  5AQO A;  1H1V A;  3IUC A;  4QS8 A;  1U2V B;  1HKG A;  1SZ2 A;  4A61 A;  5AQM A;  2YHW A;  3O1B A;  1Y64 A;  1X3M A;  2QWN A;  4J8F A;  3WEE A;  4H5T A;  2I7P A;  2IIR A;  1BWF O;  1HPM A;  4O8K A;  2VWB A;  3CHW A;  4MLE A;  3DAW A;  1U6Z A;  1T6C A;  3LDO A;  2P9S B;  5AQN A;  4LC9 B;  3A5L C;  5EY4 A;  3H46 O;  3ZEU B;  2E1Z A;  2PAV A;  3LM9 A;  2QW9 A;  3TPQ A;  1GLF O;  3O6W A;  1XUP O;  4XH1 A;  4BRQ A;  2QWM A;  3A5O C;  2ASO A;  4MO5 A;  1GLC G;  3ATU A;  1BOT O;  3FE1 A;  4B1Z A;  1ZC6 A;  3GL1 A;  4HTL A;  4DHY A;  4IJN A;  5EXW A;  4BRA A;  5AZJ A;  1XC3 A;  3WXK A;  4BRL A;  5B8H A;  5JIC A;  1KAZ A;  3F9M A;  2KHO A;  1DEJ A;  1D4X A;  2FF3 B;  3W0L A;  4K41 A;  2GEM A;  1BA1 A;  3H1Q A;  1G99 A;  4PKG A;  1DGK N;  3D2E B;  4A2A A;  2A41 A;  2H3G X;  2QWQ A;  4BC4 A;  4FWQ A;  4DQ8 A;  3FZK A;  1CZA N;  3CI5 A;  3QBX A;  3MN9 A;  5AZJ B;  3VEN A;  3U9Z A;  2GWK A;  2NZT A;  4B9Q A;  4BRD A;  3J8A A;  4JN4 A;  5E84 A;  4CBX A;  3ZX2 A;  4FWK A;  4AM6 A;  3BF1 A;  3MDQ A;  5AQU A;  2IVN A;  1S3X A;  5ADX A;  1X9J A;  3JS6 A;  1ATN A;  5EVZ A;  3AAQ A;  3WQT A;  2E2Q A;  1Q18 A;  4E1J A;  4Z94 A;  5KPR A;  1T44 A;  2Q0R A;  2ZF5 O;  2P9N B;  4CZJ A;  3IFR A;  2CH6 A;  2AA4 A;  1JCF A;  1ATS A;  1NGD A;  2Q2R A;  3RSE B;  4QS7 A;  1C0F A;  2YJF A;  4BGB A;  4BVP A;  5KPT A;  3VGK A;  1T6D A;  2D0O A;  2ITM A;  1E4G T;  4ISF A;  2ZGZ A;  4BC5 A;  3IDH A;  4EHU A;  4EFH A;  3A5N C;  1MWM A;  2DPN A;  2P9P A;  3AAR A;  4BRC A;  3WQU A;  3SJH A;  3BEX A;  4BR4 A;  3DXM A;  4EHT A;  3QBW A;  5EOY A;  4GNI A;  1HKB A;  2QXL A;  3A0I X;  4PL8 A;  4YDU A;  3VEX A;  1NWK A;  2IVP A;  1NBW A;  5AZI A;  5FPE A;  1Z05 A;  4BG8 A;  5BR9 A;  3H6E A;  2AP1 A;  4BRI A;  4AM7 A;  5JLF A;  5BN9 A;  1JCE A;  4CBW A;  2F9T A;  4H5R A;  2HF4 A;  3O5B A;  1QQO A;  3DXM B;  3QML A;  2QWR A;  4FWO A;  4FWN A;  1KXP A;  3U4L A;  3CJ1 A;  2FF6 A;  4B1V A;  2QM1 A;  4CZG A;  1NGB A;  2E88 A;  3ZET A;  3ZX0 A;  4IWV A;  2A6A A;  3KZB A;  5AQI A;  1NGA A;  4NB4 A;  3MCP A;  4PL7 A;  5BPM A;  4CZE A;  1LCU A;  3VOV A;  3R9P A;  4F9O A;  2Q1N A;  1EQY A;  1RGI A;  3I8B A;  4NO7 A;  3G25 A;  3C7N B;  2HOE A;  4H5W A;  4H03 B;  4CJ7 A;  2ASP A;  3M6G A;  3ZET B;  4WQ5 C;  1NM1 A;  4CZH A;  3VEW A;  5BN8 A;  1Z6R A;  2A42 A;  3R6M A;  2P9L B;  5BPN A;  5EX5 A;  3VPZ A;  3CIP A;  1IJJ A;  2GWJ A;  2V7Y A;  4BGA A;  3D2E A;  2QWP A;  2HMP A;  5KQD A;  3QFU A;  3KVG A;  4MO4 A;  4H0O A;  1TYQ B;  1GLL O;  1JCG A;  2FSN A;  1NGE A;  4FO0 A;  4FWS A;  2P9U B;  4IXC A;  4BR0 A;  3SMP A;  5KPZ A;  4H0X B;  3WT0 A;  5FPN A;  1ZXO A;  5LJV A;  3HBT A;  3GDQ A;  3HTV A;  5BRE A;  4BRH A;  4BRP A;  4M7X A;  4H0T B;  5LY3 A;  3FFK B;  1TUY A;  1MDU B;  4H0Y B;  5LJW A;  5BRF A;  4H5N A;  4HWI A;  2F9W A;  5ELZ A;  4FPA A;  1IG8 A;  2D1K A;  2E8A A;  3EKU A;  2P9N A;  1C0G A;  4BRN A;  3U9D A;  2D4W A;  4EIA A;  3FGU A;  3LDL A;  3GG4 A;  3RSE A;  1BO5 O;  4FWP A;  5AQF A;  1X3N A;  3R8E A;  1RDW X;  2J4R A;  3CJ7 A;  3HI0 A;  2ZGY A;  5AQR A;  1HJO A;  5BPL A;  3CQY A;  4K25 A;  1DKG D;  4PKI A;  1TUU A;  3CJB A;  3VF2 A;  2E2O A;  1KAY A;  4Y0W A;  2W40 A;  1QQM A;  1SAZ A;  4FSV A;  5TKY A;  4CZM A;  2CH5 A;  3MK6 A;  1J6Z A;  3GBT A;  4FWM A;  1WOQ A;  3EO3 A;  3O80 A;  2CGJ A;  4JAX A;  4CZL A;  1YXQ A;  4FOI A;  2YI1 A;  4IZ9 A;  3O08 A;  4B1Y B;  3FZH A;  5JLH A;  2P9K A;  2I7N A;  3D2F A;  4XEI A;  2P9I B;  3H1V X;  4IO8 A;  4B1W B;  3WXI A;  4BRG A;  2FSJ A;  5AR0 A;  4BG9 A;  4BVO A;  2W41 A;  4DCH A;  2FSK A;  2Q97 A;  3LDP A;  3VET A;  2ZWH A;  1BU6 O;  1ATR A;  2P9K B;  2VYP A;  3D2F B;  5AQX A;  2GUP A;  4CD1 A;  4K42 A;  1NGF A;  2BTF A;  4WQ4 C;  3CJA A;  4EAH D;  3MN7 A;  4FWL A;  2YHY A;  4H0P A;  3S41 A;  3ZX3 A;  1NGI A;  2A5X A;  2PBD A;  3P4I A;  5I9E B;  3QIC A;  3C7N A;  5AQS A;  3QFP A;  3TU5 A;  1MWK A;  3LM2 A;  2GEL A;  1GLJ O;  5JMV A;  5BRD A;  2P9L A;  4ISE A;  1NMD A;  3DJC A;  1YAG A;  3VEY A;  3CER A;  4A62 A;  1YVN A;  2ASM A;  3M1F A;  2NLX A;  2GTD A;  3MN5 A;  2E2P A;  2FXU A;  4BR5 A;  2CGK A;  3B8A X;  4RTF D;  5AFU A;  3HZ6 A;  3O4W A;  1GLB G;  1OKJ A;  1TYQ A;  3QDK A;  5FPM A;  3AAP A;  5AQQ A;  3LDN A;  2P9U A;  1LOT B;  3BUZ B;  4JHD B;  5AQH A;  2D0P A;  4GY2 B;  3CJC A;  3QB0 A;  1QZ6 A;  1K8K A;  1YUW A;  5AQL A;  2VCP A;  4K43 A;  3LL3 A;  1QZ5 A;  3BP8 A;  4H5V A;  3VF6 A;  1QHA A;  2BUP A;  3ATV A;  4ISG A;  4XH4 A;  5AQY A;  2Q36 A;  2HF3 A;  4H0V B;  5F1X A;  2A40 A;  3UKU A;  3VES A;  4DB3 A;  5AQV A;  3FZM A;  1HKC A;  5AQJ A;  3EL2 A;  2YJE A;  1XQS C;  4BC2 A;  1S22 A;  1K8K B;  1V4T A;  2A3Z A;  4BR9 A;  2YHX A;  3VEV A;  4WQ4 A;  3WEE B;  3IMX A;  5ADX H;  2NRH A;  3DXK A;  2YCH A;  2E2N A;  3CET A;  3A8Y A;  3FZL A;  5F0X A;  2V52 B;  4YDU C;  3UKU B;  4CD3 A;  4CI6 A;  4A2B A;  2UYT A;  3VEZ A;  3L4I A;  4QS9 A;  3O8M A;  3MN6 A;  3AY9 A;  4M63 C;  4FPB A;  5AQG A;  1BDG A;  2FLO A;  4MLH A;  5AQK A;  3DXK B;  3FZF A;  3H3N O;  2P9I A;  1ESV A;  4BQZ A;  3L0Q A;  5AQT A;  3WXL A;  3VGL A;  1BUP A;  2V7Z A;  3WXJ A;  3A5M C;  4BRO A;  1BG3 A;  4WQ5 A;  3ULE A;  3EKS A;  5KQ8 A;  1HX1 A;  4BRK A;  3U8X A;  1HLU A;  1R59 O;  5AQZ A;  5E26 A;  1GLA G;  4RWT A;  3LDQ A;  3CJ9 A;  4PKH A;  1RFQ A;  3L6Q A;  2EWS A;  4KBO A;  3WUH A;  3CQX A;  2Q0U A;  1NLV A;  3SK3 A;  4BRM A;  3UB5 A;  4O5F A;  3FLC O;  1KAX A;  1WUA A;  4FOE A;  4BQL A;  3UKR A;  3VGM A;  4CBU A;  1SQK A;  1NGG A;  3ULE B;  5BRH A;  3EN9 A;  4CZK A;  3D7E O;  4FL9 A;  1GLD G;  1QQN A;  5F2R A; 
#chains in the Genus database with same CATH topology
 3KLI A;  3KD1 E;  2A1R A;  5IWA K;  4DU1 A;  2HNZ A;  4BRF A;  1UA0 A;  4B1X B;  3WNG A;  4FW2 A;  4YOR A;  4J2D A;  2CGL A;  3VQ4 A;  2V51 B;  4JD2 A;  4B9M A;  2Q31 A;  3M8P A;  4CEQ A;  2E1Y A;  3C0B A;  3ZSO A;  3UE5 A;  1ZBS A;  2IVO A;  2E20 A;  4RCH A;  4N76 A;  3BF3 A;  4I9Q A;  3SZ2 A;  5C0Y A;  2QWL A;  4L3Q A;  1GLE G;  1ITG A;  4UY8 O;  3NE6 A;  3DRS A;  4JI0 K;  1BGX T;  4DTN A;  1OH7 A;  1L3U A;  2QK9 A;  5FPD A;  4DTO A;  2HST A;  4I6M B;  3VEO A;  3LWL A;  3ASM A;  3GOI A;  3ZEU A;  5JVH L;  1OH5 A;  4DR2 K;  4CK3 A;  4CZF A;  1SL1 A;  4BRE A;  4N41 A;  3ZCM A;  1U2V B;  4PQU A;  3QNN A;  1YJ9 N;  4I9L A;  4A61 A;  5AQM A;  1X3M A;  4J8F A;  2IIR A;  4PUO A;  1HPM A;  4O8K A;  3MEG A;  4MLE A;  3CCQ N;  2OA8 A;  1T6C A;  4JK7 A;  3DM2 A;  2E1Z A;  1LWE A;  3LM9 A;  3CD6 N;  1RDA A;  3EEQ A;  4XH1 A;  2QWM A;  3HO1 A;  3A5O C;  3R1X A;  1RDC A;  4M3R A;  2KW4 A;  2RKI A;  3TAG A;  4B1Z A;  1KSP A;  1ZC6 A;  3GL1 A;  4HHT A;  4BRA A;  5AZJ A;  4BRL A;  4CJ5 A;  3HYF A;  2KHO A;  1CZ9 A;  3O4N A;  4Z4H A;  3CCS N;  4J2E A;  4OLA A;  4YFU A;  2PY5 A;  2HNY A;  3PY8 A;  3VQC A;  2IAJ A;  1DGK N;  2BH1 A;  4CER A;  2A41 A;  1J5E K;  4JI7 K;  1BCM A;  3QEP A;  3MXJ A;  4BC4 A;  3MXM A;  4DQ8 A;  3FZK A;  5J2P A;  1CZA N;  3QBX A;  3VEN A;  4KRE A;  2RN2 A;  2GV9 A;  1XWL A;  4CJS A;  4MDA A;  3J8A A;  4LH4 A;  1P90 A;  4FJI A;  3ZX2 A;  3DOK A;  4Z4C A;  3BF1 A;  5AQU A;  3DYA A;  1S3X A;  3JS6 A;  3DMJ A;  4FLY A;  4TSX A;  3EE9 A;  3WQT A;  4Z4F A;  2E2Q A;  1Q18 A;  1D8Y A;  2IDO A;  4LFA K;  4Z94 A;  2NNW A;  4JK9 A;  2P9N B;  1O13 A;  3O9U A;  2CH6 A;  2AA4 A;  1ATS A;  1NGD A;  4QS7 A;  1C0F A;  2YJF A;  3OYL A;  1DTT A;  2D0O A;  5HOO A;  4NCB A;  4FVM A;  1W0H A;  1BCO A;  2G8K A;  1MWM A;  4JI2 K;  4X66 K;  2P9P A;  2KTQ A;  2D0A A;  3O9S A;  3QET A;  4PHT X;  3QBW A;  2XO7 A;  3KLE A;  3ZSR A;  2IVP A;  1NBW A;  3SPZ A;  2AP1 A;  3S3M A;  3HPO A;  4IG0 A;  1F21 A;  1D5A A;  1LAV A;  3VQA A;  1JCE A;  1RT7 A;  3T1H K;  3M8S A;  4M3Z A;  3AA4 A;  2HF4 A;  3O5B A;  4JKE A;  1C0U A;  3ALY A;  2D0C A;  1RBU A;  1KXP A;  3U4L A;  4V19 S;  1KFD A;  4CZG A;  2VWK A;  3OYA A;  4YOV A;  4K8Z A;  2HBK A;  2QKB A;  3ZX0 A;  3J7Z O;  3MCP A;  5DMR A;  4A5B A;  4N5S A;  4CZE A;  3VOV A;  2D5R A;  4F9O A;  2E5L K;  4KHW A;  1EQY A;  4M3W A;  2IC3 A;  4DKW A;  1RGI A;  1TK5 A;  4ILJ A;  2KLA A;  4JKF A;  1WSJ A;  4ZHR A;  3OA9 A;  3C7N B;  1NMN A;  3CXC M;  3P1G A;  3HM9 A;  4H5W A;  4YY3 K;  4CJ7 A;  2ASP A;  4WQ5 C;  1VSD A;  2GBZ A;  4O4G A;  5EX5 A;  1JLA A;  2JGU A;  1X9S A;  1NK6 A;  3D2E A;  5I3U A;  1S9G A;  4ELV A;  4O55 A;  3WNH A;  4LSN A;  1JCG A;  4Y1C A;  5GAG P;  2QKK A;  4KI4 A;  3PLA A;  4FO0 A;  2P9U B;  3OS1 A;  3SV4 A;  3L3V A;  4BR0 A;  3CQ8 A;  3WT0 A;  4AIL C;  4FW1 A;  1VAZ A;  3GDQ A;  2O8D A;  2BAN A;  2WON A;  3F73 A;  2IOC A;  4CF1 A;  4BRP A;  4CEO A;  3G6E N;  5LY3 A;  3FFK B;  3F9K A;  4FZY A;  3RRH A;  3TTC A;  3ZSY A;  1IKX A;  4FJX A;  1MDU B;  3VQ7 A;  4H0Y B;  1QSL A;  4FPA A;  4CW7 B;  4WCE L;  1IO2 A;  4RW8 A;  3ULD A;  1YTU A;  1X3N A;  2UUB K;  3HI0 A;  3M8R A;  2RF2 A;  2ZGY A;  2ZJQ L;  4DSJ A;  5AQR A;  5BPL A;  4CHQ A;  1DKG D;  4C8M A;  1CLQ A;  2OPQ A;  4WF9 L;  3THV A;  4CE9 A;  3Q7B A;  5KI6 A;  4FSV A;  3CME N;  4DTS A;  1OH6 A;  4DF4 A;  3JYT A;  3MEC A;  4DFJ A;  1XMQ K;  2G8F A;  1VQ4 N;  3EO3 A;  1XNR K;  1HPZ A;  2XHB A;  4F3O A;  3FZH A;  3S9H A;  2I7N A;  4XEI A;  3THX A;  4B1W B;  3J80 O;  4X65 K;  4KKO A;  4DCH A;  4CEE A;  4FVU A;  3LAN A;  1Q9X A;  3LDP A;  3AO3 A;  1TL3 A;  1SKW A;  2P9K B;  4CVN E;  1QVF M;  5AQX A;  1IKY A;  4CD1 A;  3P39 A;  5CYM A;  2X74 A;  1VQL N;  4WQ4 C;  3CJA A;  4EAH D;  1JJ2 M;  1VQM N;  3ISN C;  4DV3 K;  1NKE A;  4CGD A;  4HTU A;  5C25 A;  4FZX C;  5AQS A;  2HHU A;  4CHZ A;  1N33 K;  3SBT A;  2O8F A;  4MQ3 A;  5C12 A;  3T69 A;  3AVM A;  2JLE A;  1EX4 A;  4ZTF A;  1NJX A;  3HL8 A;  4A62 A;  4FZZ A;  2FXU A;  3L8B A;  1VQ5 N;  4BR5 A;  2CGK A;  3AGR A;  3HOS A;  5C2F A;  5AFU A;  3P38 A;  4CEF A;  2YNG A;  3HZ6 A;  1OKJ A;  4FJL A;  5KTQ A;  4C1N K;  3BUZ B;  5AQH A;  2D0P A;  3SJJ A;  1BI4 A;  3CJC A;  2O8E A;  3QB0 A;  3S3O A;  3J7Y P;  3KKS A;  1T05 A;  1YUW A;  4U7B A;  3SUQ A;  4KHS A;  2BUP A;  4ISG A;  4XH4 A;  3TSU A;  1N5Y A;  3QEX A;  4NXM K;  3ZT2 A;  4FYD A;  4LSL A;  3P31 A;  1KVA A;  4GW6 A;  1Q82 O;  1HKC A;  2HVI A;  4E1N A;  2A3Z A;  4JS4 A;  4BR9 A;  1NU0 A;  2O8C B;  1BQM A;  2I5J A;  1QSY A;  2WOM A;  1S1W A;  3N4P A;  4CGF A;  3JAM O;  3QNO A;  4DSF A;  4X62 K;  1T7P A;  2WBN A;  3TWH A;  2HHH K;  3SBG A;  2HHW A;  4CI6 A;  3HJF A;  4DSL A;  1ZBU A;  2NRX A;  2HBM A;  4GMJ B;  2AJQ A;  1JLE A;  4FPB A;  4DR4 K;  4U67 L;  2FLO A;  3DXK B;  3TAF A;  3QEI A;  4O5B A;  4IFE A;  5JS2 A;  2P9I A;  3G0Z A;  3ENB A;  4CJW A;  1VQ7 N;  4BQZ A;  4KTQ A;  5H1S Q;  3VGL A;  3K57 A;  3A5M C;  4KHY A;  4FCY A;  1NKC A;  1K9M O;  4I7F A;  3E9O A;  3WNF A;  4RW9 A;  4BRK A;  1SV5 A;  3U8X A;  1HLU A;  1R59 O;  4JKG A;  4XIU A;  3OYD A;  1I94 K;  3LDQ A;  2EX3 A;  3NH2 A;  2LSN A;  3K58 A;  2YHA A;  3OYG A;  3SK3 A;  5HRN A;  3UB5 A;  4FLZ A;  1J53 A;  5M1O A;  3B6O A;  4DR5 K;  1VSH A;  1NGG A;  3ULE B;  4CED A;  4DTM A;  4JI3 K;  1RCH A;  3HVR A;  4FL9 A;  4KV8 A;  5F2R A;  3AGK A;  4OPJ A;  4JNE A;  1TKZ A;  1FKO A;  4DSI A;  3NMU A;  1HRH A;  1P8Z A;  3RTV A;  2KZM A;  1UWB A;  4CF9 A;  4M3Y A;  4BR2 A;  1R0A A;  1IH7 A;  3HSC A;  3SMS A;  5AQW A;  4O0J A;  1BA0 A;  1S6P A;  3KHY A;  5AFU H;  3OHR A;  1TKD A;  4CFD A;  1KLM A;  4CIG A;  2QWO A;  3SPY A;  3RWU A;  2NRV A;  4G9Z A;  1I39 A;  1NGH A;  2P9P B;  3CG7 A;  4BC3 A;  4OVL A;  4DU3 A;  3HM8 A;  3HXM A;  5KRT A;  3AVL A;  4FLT A;  1NK7 A;  4M7Y A;  2WFB A;  3VQ8 A;  1H1V A;  2O4I A;  1VK0 A;  4JI6 K;  3CCJ N;  1HKG A;  1TL1 A;  1SZ2 A;  2Z1G A;  1OVQ A;  3MEE A;  2KZZ A;  1Y64 A;  1KVC A;  2QWN A;  4H5T A;  2I7P A;  1BWF O;  1SUQ A;  1WNS A;  2W6K A;  3BY5 A;  3NF9 A;  2OPS A;  3DAW A;  2HND A;  1U6Z A;  4FJG A;  2FC0 A;  2P9S B;  3AV9 A;  4LC9 B;  1REV A;  2PAV A;  2NRW A;  1Q9Y A;  4A57 A;  4FM2 A;  3O6W A;  4B9V A;  4B8A B;  3RMA A;  4AHV A;  4NCA A;  4JI1 K;  2B6A A;  3TR8 A;  1JXE A;  3HK2 A;  4BRQ A;  3DLG A;  1U4B A;  4MO5 A;  3ATU A;  3V1O A;  5CR4 A;  3L2W A;  4O0I A;  3LPU A;  2F7T A;  4DWI A;  3KK2 A;  4Z4E A;  4DHY A;  3H08 A;  5EXW A;  3SYZ A;  1XC3 A;  5JIC A;  1KAZ A;  4GKK K;  3CF5 L;  4M3T A;  4W5T A;  3IAY A;  3CFO A;  1U04 A;  4WFA L;  3LP1 A;  3NVM A;  2GEM A;  3RR7 A;  4FJ8 A;  4PKG A;  4DV5 K;  3CPE A;  4QAG A;  4FJ5 A;  3D2E B;  4LH5 A;  5D3G A;  3I56 N;  1U47 A;  4FWQ A;  3SQ2 A;  3CI5 A;  3MX5 A;  3LAL A;  1N6Q A;  1W2B M;  3G4S N;  2O8D B;  1ZYQ A;  4B3O A;  4FWK A;  3E9L A;  5C2D A;  5CYQ A;  4AM6 A;  1L5U A;  3QES A;  3LWM A;  4O44 A;  4YOW A;  5EVZ A;  1K73 O;  4IO9 L;  1EWR A;  1I3A A;  3DLE A;  3KLG A;  1KVB A;  2Q3S A;  3MCA B;  3LAM A;  4CZJ A;  2F8T A;  3IFR A;  4JK8 A;  1JCF A;  2Q2R A;  4EZ9 A;  5KPT A;  2O4G A;  5BR8 K;  4X64 K;  1E4G T;  4ISF A;  4E7J A;  2UXB K;  3NFA A;  3IG1 A;  3F5T A;  4EFH A;  1XNQ K;  1HYV A;  4IDH A;  4DV4 K;  4BRC A;  4QOZ B;  3WQU A;  4BR4 A;  4GNI A;  1HKB A;  3A0I X;  4DR3 K;  5J2Q A;  3AVG A;  5AZI A;  3RRG A;  1Z05 A;  4BG8 A;  5T7B A;  4DFP A;  2RHK A;  4BRI A;  4KB0 A;  4AM7 A;  3THX B;  2F9T A;  1XMO K;  1ASW A;  1N36 K;  1A5X A;  1WBD A;  3L2Q A;  5CY4 A;  1QQO A;  3DXM B;  3DOL A;  3OYI A;  2QWR A;  1QVG M;  4B1V A;  1NGB A;  2E88 A;  3ZET A;  3HPG A;  2E4L A;  4IWV A;  4YOY A;  1GOB A;  3HOT A;  1NGA A;  3G10 A;  5BPM A;  3J7A P;  2IS3 A;  1LCU A;  3MXI A;  3R9P A;  1QHT A;  5C15 A;  1K8A O;  4WFN L;  1JLG A;  4KRF A;  3VQ9 A;  3NH1 A;  4H03 B;  4DS5 A;  1NM1 A;  3PX6 A;  3TAQ A;  1VSL A;  1W97 L;  2O8F B;  2DFF A;  3DRP A;  1VSE A;  1Z6R A;  2A42 A;  3PSI A;  3R6M A;  3AA5 X;  5BPN A;  4IEE A;  3PO5 A;  4ICL A;  2ATQ A;  3K5O A;  3VPZ A;  3CC4 N;  4BE0 A;  1IJJ A;  3CCM N;  4BGA A;  1SL0 A;  4KHQ A;  1VSM A;  4QCL A;  4ID1 A;  4KO0 A;  1C0T A;  2Y1I A;  4B3T K;  2FSN A;  1NGE A;  4RW7 A;  5J1E A;  1RBT A;  4CJT A;  1EKE A;  3U6F A;  4O8U A;  1C1C A;  3F2K A;  4H0X B;  1BI4 B;  1Y97 A;  1ZXO A;  5CZ2 A;  4ILG B;  5KPZ A;  5LJV A;  3CCV N;  4G1Q A;  5BRE A;  3O3F A;  3V4I A;  4H0T B;  4DR1 K;  4GV6 A;  3MAQ A;  1TUY A;  4Z0U A;  5GAD P;  5LJW A;  2PFU A;  4H5N A;  4HWI A;  1NG9 A;  3ZSW A;  3HRG A;  1TKT A;  3TAM A;  1IG8 A;  3BDP A;  3EKU A;  1BQN A;  4KB1 A;  1FXX A;  3U9D A;  2D4W A;  4EIA A;  3LDL A;  3PIO L;  1VQN N;  5AQF A;  3BZK A;  4FJJ A;  3AVK A;  4CJF A;  1RDW X;  3O9Q A;  3VN5 A;  4K25 A;  4CEZ A;  2ZM6 K;  4PKI A;  3CJB A;  1IBM K;  5GAE P;  3V9W A;  4Y0W A;  3V81 A;  3R3L A;  1OH8 A;  4HVJ A;  1KTQ A;  5CZ1 A;  3TTD A;  2QEX N;  4JKB A;  1WOQ A;  1J9A A;  1QS4 A;  3O80 A;  2CGJ A;  1CZB A;  1SKR A;  5HP1 A;  2P9I B;  2G8W A;  4IO8 A;  2HW3 A;  5TKW A;  3HPH A;  1Z25 A;  3QLH A;  3OYB A;  5FDL A;  3OY9 A;  1J54 A;  1CXU A;  5HRP A;  2W41 A;  2Q97 A;  3RMD A;  4I2P A;  4JKG B;  1BL3 A;  2HHT A;  1LAW A;  2VYP A;  3D2F B;  2GUP A;  1ILY A;  4E89 A;  3M5R A;  1RTD A;  3LPT A;  4H0P A;  4LF5 K;  1C0M A;  1EET A;  3NBP A;  2PBD A;  3SQ4 A;  5I9E B;  1HQU A;  1IG9 A;  3QIC A;  3QFP A;  2YNH A;  2KKZ A;  4FXD A;  3VA3 A;  3EE8 A;  4CEB A;  5JMV A;  5IT9 O;  2P9L A;  4YHH K;  4B9T A;  4ISE A;  3DJC A;  3VEY A;  4C8L A;  2FBV A;  3CER A;  2YHB A;  1YVN A;  2GTD A;  2VWJ A;  2E2P A;  4NXN K;  3AVB A;  4JKH A;  3THY A;  4RTF D;  3SQ1 A;  3QDK A;  5AQQ A;  3NH0 A;  3LDN A;  1IBK K;  3QEW A;  4OPK A;  1NJI O;  1QSS A;  4L8R B;  1QZ6 A;  1K8K A;  3AVC A;  3RR8 A;  4OPA A;  2VCP A;  4DLG A;  4K43 A;  4OX9 K;  1QZ5 A;  4H5V A;  1QHA A;  4IEI A;  4PY5 A;  1YI2 N;  4H0V B;  3SAG A;  3LDS A;  4BWM A;  3UKU A;  3VES A;  3ZT1 A;  4DB3 A;  1XQS C;  1S22 A;  1FKP A;  3CCL N;  2HB5 A;  3VEV A;  3S3N A;  3OTO K;  3IMX A;  4B3R K;  4KH6 A;  1S1V A;  4DG1 A;  2E2N A;  3FZL A;  4NYN A;  4IOX A;  3AO1 A;  4B9S A;  4CK2 A;  3O8M A;  3AY9 A;  1IBL K;  4M63 C;  4DU4 A;  4N56 A;  3TAR A;  4DR7 K;  3AVF A;  1S1T A;  3PSF A;  1ESV A;  1VQ8 N;  3L0Q A;  3WXL A;  4ELU A;  1BUP A;  1NK4 A;  2KFN A;  4A59 A;  4W5N A;  1HX1 A;  5AQZ A;  3SCX A;  3C94 A;  4RWT A;  3D6R A;  3UIQ A;  1RFQ A;  4RW4 A;  4KBO A;  4B08 A;  2QA4 N;  4J2B A;  4YOX A;  4OKJ A;  2Q0U A;  3SNN A;  4Y1D A;  4A5A A;  4CGH A;  4WFB L;  4CJ4 A;  3FLC O;  1KAX A;  2UXD K;  4DV1 K;  1U48 A;  1SQK A;  4FK2 A;  4CEA A;  3K9J A;  1QQN A;  3V9X A;  1VSJ A;  3VQ5 A;  3KWG A;  4JI8 K;  1E4F T;  1JL1 A;  1YVU A;  3V9U A;  1MA9 B;  3ENO A;  5FLX O;  3I33 A;  4C23 A;  3V9S A;  3N4Q A;  4CHY A;  3EZW A;  3UKR B;  2B4J A;  2PYJ A;  4JLH A;  4I6M A;  4H4O A;  3I55 N;  2ZJR L;  5M1P A;  4IJA A;  2OAN A;  2P5O A;  2OZS A;  4FWR A;  1WB9 A;  4EP5 A;  1YJN N;  3GE1 A;  1U2V A;  2OYQ A;  1NGJ A;  3O4Q A;  3VA0 A;  3DLK A;  3DWL A;  2BE2 A;  3ENH A;  1V4S A;  2VG6 A;  1WSI A;  4JD2 B;  5AZI B;  4IFV A;  3H3O B;  4FJ9 A;  5CE3 A;  1B9D A;  5AQP A;  1VQ6 N;  5AQO A;  1NJZ A;  3RMC A;  3K9K A;  3DLL L;  3WEE A;  1HYZ A;  4GKJ K;  1DT9 A;  3V6D A;  2HHQ A;  4M41 A;  5EY4 A;  5AQN A;  3A5L C;  4OKK A;  3P83 D;  4FM0 A;  3ZEU B;  4DTU A;  3AVA A;  3TPQ A;  1GLF O;  2YNF A;  3AO2 A;  3OYJ A;  3OJU A;  3VQD A;  2B5J A;  2OTJ N;  3OBY A;  4DQP A;  1Q81 O;  1BOT O;  4C1N I;  3QIP A;  4DQS A;  4CHO A;  4C8K A;  4IJN A;  1RTI A;  4KTZ A;  3WXK A;  4AH9 A;  1IKV A;  1G15 A;  5B8H A;  5SZT A;  3F9M A;  5HRS A;  3L2U A;  2DFH A;  1D4X A;  3O9T A;  2FF3 B;  4WE1 A;  4IOA L;  5HRR A;  3W0L A;  4DV7 K;  3H1Q A;  3THW A;  4BE1 A;  4A2A A;  3KIO A;  2H3G X;  4DSK A;  2QWQ A;  4CHP A;  3LP0 A;  3FFI A;  1RDU A;  4AHS A;  5AZJ B;  4JRP A;  2G8I A;  1RTJ A;  4RG8 A;  4FJK A;  2GWK A;  4B9Q A;  4KFB A;  3PUF A;  1S6Q A;  4DUY K;  4CBX A;  3ITH A;  3K59 A;  4CES A;  2Z1H A;  2WTU A;  5ADX A;  1X9J A;  1ATN A;  4UQG A;  3AAQ A;  3OJS A;  3B6P A;  4Q5V A;  1HNX K;  4ID5 A;  5KPR A;  3OYH A;  1T44 A;  1NJY A;  4E7K A;  4YOU A;  3I8D A;  1RTH A;  4BDZ A;  3VGK A;  1T6D A;  2RPI A;  3P5J A;  3HP9 A;  2VGN A;  4CFA A;  1EXQ A;  4CJ3 A;  5M1N A;  2ZGZ A;  4BC5 A;  2XRI A;  2DY4 A;  2DPN A;  4CIE A;  4FLW A;  3SJH A;  1W9H A;  1WAF A;  4PL8 A;  4YDU A;  3VEX A;  1NWK A;  3LP2 A;  1LWC A;  5GIP A;  5FPE A;  5GAH P;  3A2F A;  4YNQ A;  3CC2 N;  2X6N A;  4Z4G A;  4E7H A;  5JLF A;  5BN9 A;  5C24 A;  4JKC A;  3LP3 A;  2X6S A;  2X78 A;  1EWQ A;  3ID6 A;  4CBW A;  3TSQ A;  4F2R A;  5JS1 A;  1JXB A;  2QXF A;  3QML A;  4FWO A;  3TAE A;  4FWN A;  1CXQ A;  4HUG A;  3KLH A;  1VQK N;  1T03 A;  4Z4I A;  2F8S A;  3NHG A;  5DM7 L;  3KZB A;  4JI4 K;  4PL7 A;  2GUI A;  4AHU A;  3DLH A;  1ASV A;  2Q1N A;  1BHL A;  4DQQ A;  2HHX A;  1ASU A;  3I8B A;  4CHN A;  4NO7 A;  4NCG A;  1RBR A;  2HOE A;  3NCI A;  3M6G A;  1K6Y A;  5M1Q A;  4CZH A;  3VEW A;  5BN8 A;  2P9L B;  1EO1 A;  1RBV A;  4B9N A;  2QWP A;  2HMP A;  3QFU A;  3KVG A;  1LWF A;  4JV5 K;  1C1A A;  3G71 N;  3SMP A;  2KQ2 A;  1S9E A;  5FPN A;  1LV5 A;  3HBT A;  3ZSX A;  5LMN K;  2IGI A;  1M1K O;  1LW0 A;  2PZS A;  3EZ5 A;  3C6T A;  4DS4 A;  3T1Y K;  5BRF A;  2UXC K;  2F9W A;  5ELZ A;  3EY1 A;  3AVJ A;  1QTM A;  4H4M A;  3NAE A;  3QEV A;  4BAC A;  1NJW A;  2YV0 X;  1TAU A;  1HQE A;  1YT3 A;  3RSE A;  1S5J A;  4FWP A;  4IOC L;  4DTR A;  3U3Y A;  3PX4 A;  2XY7 A;  3CJ7 A;  4DLE A;  1VHX A;  2DTU A;  4CCH A;  4DFM A;  1WSG A;  4JRQ A;  2ITG A;  2PYL A;  4LF7 K;  1D9D A;  1ZBH A;  1DLO A;  1JLQ A;  4CZM A;  3MK6 A;  4M3X A;  4FWM A;  3VQE A;  4JAX A;  1YXQ A;  2YI1 A;  4IZ9 A;  2OPR A;  2P9K A;  4DV2 K;  3H1V X;  4LFC K;  3KTQ A;  3WXI A;  4PA1 A;  4CK1 A;  3PIP L;  5JVG L;  2FSJ A;  1YTA A;  4CF2 A;  4BVO A;  1RIL A;  2YKM A;  1TK0 A;  4CGJ A;  4BWJ A;  4AQY K;  3Q7C A;  1NOY A;  3VET A;  3M8Q A;  2D0B A;  3NGI A;  3NF7 A;  1Q86 O;  1KQS M;  1NK0 A;  4BDP A;  2F96 A;  5KRS A;  4K42 A;  2E6M A;  1Z26 A;  3MN7 A;  1JLF A;  1GOA A;  3E01 A;  2YHY A;  3S41 A;  2A5X A;  3AVH A;  4JYA K;  3T3F A;  3P4I A;  3L3U A;  3VQB A;  2HVH A;  3WNE A;  2QTD A;  4OGC A;  1MWK A;  3IS9 A;  3LM2 A;  2GEL A;  1GLJ O;  4E1M A;  5BRD A;  5AJ3 K;  1Q7Y O;  1C6V A;  1YAG A;  2VG7 A;  1A5W A;  3M1F A;  3PV8 A;  4C8N A;  3MWP A;  1IV0 A;  5EU7 A;  1KC8 O;  3OVN A;  1N32 K;  1GLB G;  1TYQ A;  1M90 O;  2ZQB A;  5J2M A;  2VGM A;  1LOT B;  3VTH A;  4EZ6 A;  3TI0 A;  3VQQ A;  1TVR A;  2EHG A;  5AQL A;  2O8C A;  1HMV A;  3VF6 A;  3ATV A;  4HUE A;  3SAH A;  4H8K A;  3ZYY X;  2HF3 A;  4JS5 A;  1S1U A;  4B3M K;  3CCU N;  1KLN A;  4KHN A;  1EP4 A;  4GV9 A;  2O8E B;  5AQJ A;  1BIU A;  2YJE A;  4BC2 A;  1V4T A;  5HRO A;  3TAB A;  4CJL A;  4WQ4 A;  1NK9 A;  3WEE B;  2NRH A;  3DXK A;  3CM6 A;  2YCH A;  2WC9 A;  3C6A A;  1Q8I A;  4GVE A;  1NK8 A;  3A8Y A;  3PO4 A;  5F0X A;  1O1W A;  1RDB A;  3C6U A;  4YDU C;  3K0S A;  4CJV A;  2UYT A;  3VEZ A;  5A2Q O;  2XY6 A;  5AQG A;  1BDG A;  1VRU A;  4MLH A;  4KH4 A;  3FZF A;  3LZI A;  3H3N O;  1SS6 A;  4ILH A;  3C95 A;  4CJU A;  1X9W A;  4FJN A;  4CFB A;  1N34 K;  1BIZ A;  2V7Z A;  3WXJ A;  4BRO A;  1BG3 A;  1YJW N;  3ULE A;  3EKS A;  5KQ8 A;  3KLF A;  3HP6 A;  3THW B;  5E26 A;  3NGY A;  3VTI A;  3L6Q A;  1TGO A;  4M42 A;  4E7I A;  4FJ7 A;  3QIO A;  4BRM A;  1TK8 A;  3NF8 A;  3CMA N;  3HST B;  2Z1I A;  4KHP K;  1WUA A;  4FOE A;  4BQL A;  4CBU A;  4DQI A;  3OYC A;  4C8O A;  4CF0 A;  5HLF A;  1SL2 A;  1JLC A;  4AF1 A;  1VQO N;  4CZK A;  2JWL A;  3D7E O;  4CFC A;  1GLD G;  4E3S A;  1S1X A;  5LL6 Z;  4BR7 A;  4N47 A;  2P51 A;  4B8C A;  3O1W A;  3ZT4 A;  1HUX A;  3MMV A;  5M1F A;  4CGI A;  3I0S A;  3SUP A;  4M3U A;  1KRP A;  5I42 A;  1N8R O;  3KKR A;  4B1U B;  3FR0 A;  4AHR A;  1HJR A;  4JHD A;  2UU9 K;  4JKA A;  3SLC A;  4CJQ A;  3KJV A;  2A1S A;  4XH5 A;  4ZTJ A;  3VER A;  1FK9 A;  3JXU A;  3IKM A;  4WYB A;  4R79 A;  4FLV A;  3C6H A;  3ID8 A;  1WSE A;  3W3D A;  4CZI A;  4DTP A;  1WAJ A;  4E19 A;  3VF4 A;  2WUS A;  3M3Z A;  4LF4 K;  4MDB A;  4BY9 C;  1NGC A;  3OYM A;  2P9S A;  1MU2 A;  3H45 C;  3NF6 A;  3SUN A;  3OS2 A;  4E7L A;  3IUC A;  4QS8 A;  3TSP A;  1LW2 A;  3D0P A;  4KHU A;  2YHW A;  3O1B A;  3AO4 A;  4LF8 K;  2VWB A;  3CHW A;  2G8H A;  3LDO A;  1RT1 A;  3H46 O;  4AHC A;  4DTJ A;  2QW9 A;  3MWT A;  2VG5 A;  4F3T A;  1BIS A;  4DTX A;  1XUP O;  1L3T A;  4CEC A;  2ASO A;  3AVI A;  1GLC G;  4DF8 A;  2O8B A;  4W5O A;  1RDD A;  1L3V A;  3FE1 A;  4AHT A;  4I2Q A;  4HTL A;  1NKB A;  4DFK A;  1DTQ A;  3ZSQ A;  1DEJ A;  1WN7 A;  4NLC A;  4K41 A;  4EP4 A;  3SQ0 A;  1BA1 A;  2E6L A;  1X1P A;  1G99 A;  1HNZ K;  1RNH A;  1FW6 A;  1YIJ N;  1YF5 L;  3LZJ A;  1HNI A;  3AA3 A;  1NNE A;  3MN9 A;  3J81 O;  3U9Z A;  3QIN A;  1UA1 A;  2NZT A;  1ZBI A;  4BRD A;  4JN4 A;  5E84 A;  3CC7 N;  1J5O A;  3MDQ A;  3T1A A;  3D45 A;  2IVN A;  4OPH A;  5K14 A;  1RT4 A;  1C1B A;  5HL7 L;  4E1J A;  1YHQ N;  4K8X A;  1YIT N;  2Q0R A;  3SI6 A;  3AO5 A;  3ZLJ A;  1E3M A;  1XHX A;  2ZF5 O;  1IKW A;  4CJE A;  3K2P A;  3MX2 A;  3VQP A;  3RSE B;  4BGB A;  4BVP A;  2ITM A;  1HNV A;  4R5P A;  1HR0 K;  4CJK A;  1WSF A;  1UOC A;  3IDH A;  4EHU A;  3A5N C;  2BDP A;  5LMU K;  3NVK A;  2W6L A;  5M1K A;  3AAR A;  3BEX A;  2UUA K;  3DXM A;  4EHT A;  1RT6 A;  5EOY A;  2QXL A;  4LD0 A;  2R7Y A;  5C10 A;  1HYS A;  1XI1 A;  5BR9 A;  4DV0 K;  3H6E A;  4HCC A;  3KD5 E;  2VQF K;  4ELT A;  5DK5 A;  4F4K A;  1TKX A;  3OYF A;  2P5G A;  4H5R A;  2Y1J A;  3EYZ A;  4JI5 K;  4IG3 A;  4K0K K;  4LF9 K;  1QE1 A;  1TAQ A;  2KFZ A;  3CJ1 A;  2FF6 A;  2QM1 A;  3V9Z A;  1VRT A;  1FJG K;  4IFY A;  4OKE A;  3CFP A;  2A6A A;  5AQI A;  4GVM A;  4NB4 A;  1TV6 A;  4W5R A;  3NDK A;  1RT3 A;  4CJP A;  3DLR A;  1VSI A;  2ETJ A;  3G25 A;  5E41 A;  4OJR A;  1XHZ A;  2YNI A;  3ZET B;  3CPW M;  1UAX A;  3L2R A;  4YOT A;  3QER A;  4NYF A;  3CM5 A;  2NRR A;  5FRO A;  4NLB A;  2NRZ A;  3ZSZ A;  3CIP A;  4KI6 A;  2GWJ A;  2V7Y A;  5KQD A;  3O3G A;  1JLB A;  4JKD A;  4MO4 A;  4B3S K;  4H0O A;  1TYQ B;  1GLL O;  1B9F A;  4FWS A;  3WXM B;  4IXC A;  1RT5 A;  3OYN A;  3L4Q A;  3HTV A;  1S72 N;  4BRH A;  5MLC Q;  4M7X A;  4FM1 A;  2HMI A;  4KH5 A;  1L3S A;  5KGX A;  1T8E A;  3K5L A;  2D1K A;  2E8A A;  3VMF B;  2P9N A;  1C0G A;  4BRN A;  3KK7 A;  4FLU A;  4CF8 A;  5DM6 L;  3FGU A;  1KD1 O;  2P1J A;  3GG4 A;  1BO5 O;  3U3G A;  4DMN A;  3QO9 A;  3R8E A;  1VQP N;  3OYE A;  3T19 A;  4J2A A;  1HNW K;  2J4R A;  3KWI A;  4OGE A;  3T7Z A;  3CFR A;  3KK3 A;  1HJO A;  3CQY A;  2YKN A;  5GIO A;  1TUU A;  2ZJP L;  4DV6 K;  1XC9 A;  3VF2 A;  2E2O A;  1KAY A;  2YX6 A;  3CYM A;  2W40 A;  1QQM A;  3OS0 A;  3NGZ A;  1SAZ A;  4DR6 K;  5TKY A;  3IRX A;  2CH5 A;  1J6Z A;  3GBT A;  4CZL A;  4FOI A;  4B1Y B;  3O08 A;  5JLH A;  4M45 A;  3D2F A;  4KAZ A;  3K5N A;  1T3V A;  2FBY A;  1ZBL A;  1QQC A;  4BRG A;  5SWM A;  5AR0 A;  4BG9 A;  4PWD A;  2FSK A;  3K5M A;  4CJR A;  1JL2 A;  4IKF A;  2FBT A;  2ZWH A;  1B92 A;  3TTF A;  1BU6 O;  1ATR A;  2HBJ A;  2FBX A;  1NGF A;  4BDY A;  2BTF A;  2OCE A;  1U49 A;  4DQR A;  1KFS A;  4FWL A;  3ZX3 A;  1NGI A;  1WSH A;  2OTL N;  3ZT3 A;  2G8V A;  2RE2 A;  3OBW A;  3ZSV A;  1VQ9 N;  3C7N A;  3HVT A;  1D9F A;  3RVC A;  2XY5 A;  3TU5 A;  3BGR A;  4F2S A;  4FJH A;  4FJM A;  4OLB A;  2HBL A;  5GIN A;  3HT3 A;  2NUB A;  3MED A;  4W5Q A;  3L2V A;  1NMD A;  2HHV A;  3CCR N;  1GOC A;  2QI2 A;  3RMB A;  2ZD1 A;  2ASM A;  2NLX A;  5C42 A;  3MN5 A;  1W7A A;  3E1Y A;  3B8A X;  5FPM A;  3O4W A;  3AAP A;  1KCF A;  3SV3 A;  2XY8 A;  3E9P A;  5FRM A;  2P9U A;  4JHD B;  4HCB A;  4GY2 B;  4E0D A;  4KPY A;  2F4V K;  5FRN A;  5HBM A;  2HHS A;  4HUF A;  1VSF A;  2DFE A;  3VQ6 A;  4OO1 J;  3I0R A;  2ZE2 A;  3LL3 A;  3BP8 A;  2OZM A;  1U45 A;  5AQY A;  3THY B;  3OW2 M;  3TAP A;  2Q36 A;  4FLX A;  3DI6 A;  3AA2 A;  2BGG A;  5F1X A;  2A40 A;  2OPP A;  4KTW A;  3TAN A;  4BE2 A;  3C65 A;  5AQV A;  3FZM A;  3EL2 A;  1K8K B;  4CGG A;  2YHX A;  4GV3 A;  2UUC K;  5ADX H;  2G8U A;  1RT2 A;  1NK5 A;  4F8R A;  3CET A;  1RBS A;  2JWK A;  2V52 B;  4FK0 A;  1A5V A;  4JEP A;  3UKU B;  1NOZ A;  5CHI A;  3ZT0 A;  4IDK A;  4CD3 A;  1WBB A;  4LY7 A;  4A2B A;  3BZC A;  2GX9 A;  1SKS A;  2Z1J A;  4QS9 A;  3L4I A;  3MN6 A;  3SAF A;  5AQK A;  3SUO A;  4B9L A;  2O8B B;  3LAK A;  3V1R A;  3KK1 A;  2W42 A;  4LFB K;  3O9R A;  4Q0B A;  4FK4 A;  4DUZ K;  1VSK A;  5AQT A;  4LF6 K;  4WQ5 A;  3DRR A;  3E66 A;  1GLA G;  4IBN A;  2NRT A;  3AVN A;  3CJ9 A;  4PKH A;  4CIF A;  2EWS A;  3PX0 A;  3WUH A;  3CQX A;  4DSE A;  1NLV A;  1JKH A;  4MFB A;  4O5F A;  4RW6 A;  1ZBF A;  3UKR A;  3VGM A;  2VQE K;  1WLJ A;  3JSM A;  3CCE N;  5BRH A;  3V1Q A;  5J2N A;  1OVY A;  3O3H A;  3EN9 A;  3OYK A;  4B9U A;  5KGW A;  1X9M A;  3DLB A; 
#chains in the Genus database with same CATH homology
 4JNE A;  4BR7 A;  1E4F T;  1MA9 B;  3ENO A;  4BRF A;  3O1W A;  3NMU A;  1P8Z A;  1HUX A;  3I33 A;  4C23 A;  4B1X B;  3MMV A;  4YOR A;  4BR2 A;  5M1F A;  3N4Q A;  3HSC A;  3EZW A;  3SMS A;  3UKR B;  2CGL A;  5AQW A;  1N8R O;  4B1U B;  2V51 B;  4JD2 A;  1BA0 A;  3FR0 A;  2Q31 A;  4I6M A;  3KHY A;  2E1Y A;  3C0B A;  5AFU H;  3I55 N;  2ZJR L;  3UE5 A;  1ZBS A;  2IVO A;  3OHR A;  4JHD A;  5M1P A;  4IJA A;  2OAN A;  4JKA A;  4FWR A;  2E20 A;  2QWO A;  3SLC A;  4RCH A;  4XH5 A;  1YJN N;  3GE1 A;  3VER A;  3BF3 A;  2NRV A;  1U2V A;  1NGJ A;  5C0Y A;  3JXU A;  4G9Z A;  2QWL A;  4L3Q A;  1GLE G;  2P9P B;  1NGH A;  3IKM A;  4WYB A;  3DWL A;  4R79 A;  3C6H A;  3ID8 A;  4UY8 O;  3ENH A;  4BC3 A;  3W3D A;  4CZI A;  1V4S A;  3VF4 A;  2WUS A;  3M3Z A;  4JD2 B;  3HM8 A;  4MDB A;  5FPD A;  4BY9 C;  1NGC A;  5AZI B;  2HST A;  4I6M B;  2P9S A;  3VEO A;  3GOI A;  3H3O B;  3ZEU A;  3H45 C;  5JVH L;  5CE3 A;  4M7Y A;  2WFB A;  5AQP A;  4CZF A;  1VQ6 N;  4BRE A;  5AQO A;  1H1V A;  3IUC A;  4QS8 A;  3TSP A;  1U2V B;  3K9K A;  3CCJ N;  1HKG A;  1SZ2 A;  1YJ9 N;  4A61 A;  5AQM A;  2YHW A;  3O1B A;  3DLL L;  1Y64 A;  1X3M A;  2QWN A;  4J8F A;  3WEE A;  4H5T A;  2I7P A;  2IIR A;  1BWF O;  1HPM A;  4O8K A;  1DT9 A;  2VWB A;  3CHW A;  4MLE A;  5KPZ A;  3CCQ N;  3DAW A;  1U6Z A;  1T6C A;  3LDO A;  2P9S B;  5AQN A;  4JK7 A;  3A5L C;  4LC9 B;  5EY4 A;  3H46 O;  3ZEU B;  2E1Z A;  2PAV A;  2NRW A;  2QW9 A;  3LM9 A;  3TPQ A;  4A57 A;  3CD6 N;  1GLF O;  3MWT A;  3O6W A;  1XUP O;  4XH1 A;  4BRQ A;  2QWM A;  2OTJ N;  3A5O C;  3R1X A;  2ASO A;  4MO5 A;  1GLC G;  3OBY A;  3ATU A;  5CR4 A;  1Q81 O;  1BOT O;  4C1N I;  3FE1 A;  4B1Z A;  2F7T A;  1ZC6 A;  3GL1 A;  4HTL A;  4DHY A;  4IJN A;  5EXW A;  4BRA A;  5AZJ A;  1XC3 A;  3WXK A;  4BRL A;  5B8H A;  5JIC A;  1KAZ A;  3F9M A;  2KHO A;  3CF5 L;  1DEJ A;  1D4X A;  3CCS N;  3O9T A;  2FF3 B;  4NLC A;  4IOA L;  3W0L A;  4K41 A;  4WFA L;  3NVM A;  2GEM A;  1BA1 A;  3H1Q A;  1G99 A;  4PKG A;  1DGK N;  2BH1 A;  3CPE A;  3D2E B;  4A2A A;  2A41 A;  2H3G X;  1YIJ N;  2QWQ A;  4BC4 A;  3I56 N;  1YF5 L;  4FWQ A;  1RDU A;  3FZK A;  4DQ8 A;  1CZA N;  3CI5 A;  3MX5 A;  3QBX A;  3MN9 A;  5AZJ B;  3VEN A;  3U9Z A;  2GWK A;  2NZT A;  4MDA A;  4B9Q A;  4BRD A;  3J8A A;  4JN4 A;  1W2B M;  5E84 A;  1P90 A;  4CBX A;  3G4S N;  3ZX2 A;  3CC7 N;  4FWK A;  3E9L A;  5C2D A;  4AM6 A;  3BF1 A;  3MDQ A;  5AQU A;  2IVN A;  1S3X A;  5ADX A;  1X9J A;  3JS6 A;  1ATN A;  4YOW A;  3EE9 A;  4OPH A;  5EVZ A;  1K73 O;  3AAQ A;  4IO9 L;  3WQT A;  2E2Q A;  1Q18 A;  5HL7 L;  4E1J A;  1YHQ N;  4Z94 A;  5KPR A;  1YIT N;  1T44 A;  2NNW A;  2Q0R A;  4JK9 A;  2ZF5 O;  2P9N B;  1O13 A;  3MCA B;  4YOU A;  4CZJ A;  3IFR A;  3O9U A;  2CH6 A;  2AA4 A;  4JK8 A;  3MX2 A;  1JCF A;  1ATS A;  1NGD A;  2Q2R A;  3RSE B;  4QS7 A;  1C0F A;  2YJF A;  4BGB A;  4BVP A;  5KPT A;  3VGK A;  1T6D A;  5HOO A;  2D0O A;  2ITM A;  2VGN A;  1E4G T;  4ISF A;  5M1N A;  2ZGZ A;  4BC5 A;  3IDH A;  3F5T A;  4EHU A;  4EFH A;  3A5N C;  4IDH A;  3NVK A;  1MWM A;  2DPN A;  5M1K A;  2P9P A;  3AAR A;  4BRC A;  3WQU A;  3SJH A;  3BEX A;  4BR4 A;  3DXM A;  3O9S A;  4EHT A;  4PHT X;  3QBW A;  5EOY A;  4GNI A;  1HKB A;  2QXL A;  3A0I X;  4PL8 A;  4YDU A;  3VEX A;  1NWK A;  2IVP A;  1NBW A;  5GIP A;  5C10 A;  5AZI A;  5FPE A;  1Z05 A;  4BG8 A;  5BR9 A;  5GAH P;  2RHK A;  3CC2 N;  3H6E A;  2AP1 A;  4BRI A;  4AM7 A;  5JLF A;  5BN9 A;  4JKC A;  1JCE A;  3ID6 A;  4CBW A;  2F9T A;  3TSQ A;  4H5R A;  2HF4 A;  3O5B A;  1QQO A;  3DXM B;  4JKE A;  3QML A;  2QWR A;  4FWO A;  4FWN A;  1KXP A;  3U4L A;  1QVG M;  3CJ1 A;  2FF6 A;  4B1V A;  2QM1 A;  4CZG A;  1NGB A;  2E88 A;  4YOV A;  1VQK N;  3ZET A;  2HBK A;  3ZX0 A;  4IWV A;  2A6A A;  4YOY A;  5DM7 L;  3KZB A;  5AQI A;  3J7Z O;  3HOT A;  1NGA A;  4NB4 A;  3MCP A;  4PL7 A;  5BPM A;  4A5B A;  4CZE A;  1LCU A;  3VOV A;  3R9P A;  4F9O A;  2Q1N A;  1EQY A;  5C15 A;  1K8A O;  4DKW A;  1RGI A;  4WFN L;  4ILJ A;  2KLA A;  3I8B A;  4JKF A;  4NO7 A;  3G25 A;  3OA9 A;  3C7N B;  2HOE A;  3CXC M;  4H5W A;  4H03 B;  4CJ7 A;  2ASP A;  3M6G A;  5M1Q A;  3ZET B;  4WQ5 C;  1NM1 A;  4CZH A;  3CPW M;  3VEW A;  1W97 L;  4YOT A;  5BN8 A;  1Z6R A;  2A42 A;  3R6M A;  2P9L B;  5BPN A;  1EO1 A;  2NRR A;  4IEE A;  5EX5 A;  4NLB A;  2NRZ A;  3VPZ A;  3CC4 N;  3CIP A;  1IJJ A;  3CCM N;  2GWJ A;  2V7Y A;  4BGA A;  3D2E A;  2QWP A;  2HMP A;  5KQD A;  3QFU A;  3KVG A;  4MO4 A;  4JKD A;  4H0O A;  1TYQ B;  1GLL O;  1JCG A;  3PLA A;  5GAG P;  2FSN A;  1NGE A;  3G71 N;  4FO0 A;  4FWS A;  2P9U B;  3WXM B;  4IXC A;  4BR0 A;  4O8U A;  3F2K A;  3SMP A;  4H0X B;  3WT0 A;  5FPN A;  1ZXO A;  4ILG B;  3HBT A;  1VAZ A;  3GDQ A;  3L4Q A;  5LJV A;  3HTV A;  3CCV N;  5BRE A;  1S72 N;  4BRH A;  5MLC Q;  4BRP A;  4M7X A;  4H0T B;  5LY3 A;  3G6E N;  4GV6 A;  3FFK B;  1TUY A;  1M1K O;  4KH5 A;  3TTC A;  1MDU B;  5GAD P;  4H0Y B;  5LJW A;  5BRF A;  2PFU A;  4H5N A;  4HWI A;  2F9W A;  5ELZ A;  3HRG A;  4FPA A;  1IG8 A;  2D1K A;  2E8A A;  3EKU A;  2P9N A;  1C0G A;  3KWG A;  3VMF B;  4BRN A;  4WCE L;  3KK7 A;  3U9D A;  2D4W A;  4EIA A;  5DM6 L;  3FGU A;  3LDL A;  1KD1 O;  3PIO L;  3GG4 A;  3RSE A;  1BO5 O;  1VQN N;  4FWP A;  5AQF A;  1X3N A;  4IOC L;  3R8E A;  1VQP N;  1RDW X;  2J4R A;  3CJ7 A;  3HI0 A;  3KWI A;  3T7Z A;  2ZGY A;  2ZJQ L;  3O9Q A;  5AQR A;  1HJO A;  5BPL A;  3CQY A;  4K25 A;  1DKG D;  5GIO A;  4PKI A;  1TUU A;  2ZJP L;  3CJB A;  3VF2 A;  2E2O A;  4WF9 L;  1KAY A;  2YX6 A;  5GAE P;  3Q7B A;  4Y0W A;  2W40 A;  1QQM A;  3R3L A;  3TTD A;  1SAZ A;  4FSV A;  5TKY A;  3CME N;  4CZM A;  2CH5 A;  3MK6 A;  1J6Z A;  2QEX N;  4JKB A;  3GBT A;  1VQ4 N;  4FWM A;  1WOQ A;  3EO3 A;  3O80 A;  2CGJ A;  4JAX A;  4CZL A;  1YXQ A;  4FOI A;  2YI1 A;  4IZ9 A;  3O08 A;  4B1Y B;  3FZH A;  5JLH A;  2P9K A;  2I7N A;  3D2F A;  4XEI A;  2P9I B;  1T3V A;  3H1V X;  4IO8 A;  4B1W B;  5TKW A;  3WXI A;  5JVG L;  3PIP L;  4BRG A;  2FSJ A;  5AR0 A;  4BG9 A;  4BVO A;  2W41 A;  4DCH A;  2FSK A;  2Q97 A;  4FVU A;  3Q7C A;  3LDP A;  4JKG B;  3VET A;  2ZWH A;  3TTF A;  1Q86 O;  1BU6 O;  1KQS M;  1ATR A;  2HBJ A;  2P9K B;  2VYP A;  3D2F B;  5AQX A;  2GUP A;  4CD1 A;  1QVF M;  3P39 A;  4K42 A;  1ILY A;  1NGF A;  2BTF A;  3M5R A;  4WQ4 C;  3CJA A;  4EAH D;  1JJ2 M;  1VQM N;  1VQL N;  3MN7 A;  4FWL A;  2YHY A;  4H0P A;  3S41 A;  3ZX3 A;  1NGI A;  2A5X A;  2OTL N;  2PBD A;  3P4I A;  5I9E B;  2RE2 A;  3OBW A;  3QIC A;  1VQ9 N;  3C7N A;  5AQS A;  3QFP A;  2QTD A;  3RVC A;  3TU5 A;  1MWK A;  3LM2 A;  2GEL A;  2KKZ A;  3SBT A;  2HBL A;  1GLJ O;  3EE8 A;  5JMV A;  5GIN A;  5BRD A;  5C12 A;  3T69 A;  2P9L A;  4ISE A;  1Q7Y O;  1NMD A;  3DJC A;  3CCR N;  1YAG A;  3VEY A;  2QI2 A;  3CER A;  4A62 A;  1YVN A;  2ASM A;  3M1F A;  2NLX A;  2GTD A;  3MN5 A;  2E2P A;  2FXU A;  1VQ5 N;  3MWP A;  3E1Y A;  4BR5 A;  2CGK A;  3AGR A;  3B8A X;  4JKH A;  3HOS A;  4RTF D;  5C2F A;  5AFU A;  3P38 A;  1KC8 O;  3HZ6 A;  3O4W A;  1GLB G;  1OKJ A;  1TYQ A;  3QDK A;  5FPM A;  3AAP A;  1M90 O;  5AQQ A;  3E9P A;  2VGM A;  3LDN A;  2P9U A;  1LOT B;  3BUZ B;  4JHD B;  5AQH A;  3VTH A;  2D0P A;  4GY2 B;  4C1N K;  3CJC A;  1NJI O;  3QB0 A;  1QZ6 A;  1K8K A;  1YUW A;  4U7B A;  4OPA A;  2VCP A;  5AQL A;  4OO1 J;  4K43 A;  3LL3 A;  1QZ5 A;  3BP8 A;  4H5V A;  3VF6 A;  1QHA A;  2BUP A;  3ATV A;  4IEI A;  4ISG A;  4XH4 A;  5AQY A;  2Q36 A;  3SAH A;  3OW2 M;  3TSU A;  1YI2 N;  3ZYY X;  2HF3 A;  4H0V B;  5F1X A;  3SAG A;  2A40 A;  3UKU A;  3CCU N;  3VES A;  3C65 A;  4GV9 A;  4DB3 A;  3P31 A;  5AQV A;  3FZM A;  1HKC A;  5AQJ A;  3EL2 A;  1Q82 O;  2YJE A;  1XQS C;  4BC2 A;  1S22 A;  1K8K B;  1V4T A;  2A3Z A;  4BR9 A;  2YHX A;  3CCL N;  3VEV A;  4WQ4 A;  4GV3 A;  3WEE B;  3IMX A;  5ADX H;  2NRH A;  3DXK A;  4KH6 A;  2YCH A;  2WC9 A;  3C6A A;  2E2N A;  3CET A;  3N4P A;  4GVE A;  3A8Y A;  2JWK A;  3FZL A;  5F0X A;  2V52 B;  2WBN A;  4JEP A;  4YDU C;  3UKU B;  3SBG A;  4IOX A;  5CHI A;  4CD3 A;  4CI6 A;  4A2B A;  2UYT A;  2GX9 A;  3VEZ A;  3L4I A;  4QS9 A;  2NRX A;  2HBM A;  3AY9 A;  3MN6 A;  3O8M A;  4M63 C;  4FPB A;  5AQG A;  3SAF A;  1BDG A;  4U67 L;  2FLO A;  4MLH A;  5AQK A;  3DXK B;  4KH4 A;  3FZF A;  4IFE A;  3H3N O;  2P9I A;  3ENB A;  1VQ7 N;  1SS6 A;  3O9R A;  4ILH A;  1ESV A;  4BQZ A;  1VQ8 N;  5H1S Q;  3L0Q A;  5AQT A;  3WXL A;  3VGL A;  1BUP A;  2V7Z A;  3WXJ A;  3A5M C;  4BRO A;  1BG3 A;  1YJW N;  1K9M O;  4WQ5 A;  3ULE A;  3E9O A;  3EKS A;  4A59 A;  5KQ8 A;  1HX1 A;  4BRK A;  3E66 A;  1HLU A;  1R59 O;  4JKG A;  5AQZ A;  3U8X A;  5E26 A;  1GLA G;  4RWT A;  3D6R A;  3LDQ A;  2NRT A;  3CJ9 A;  4PKH A;  3VTI A;  1RFQ A;  3L6Q A;  2EWS A;  4KBO A;  2QA4 N;  3WUH A;  3CQX A;  4YOX A;  2Q0U A;  1NLV A;  4A5A A;  3SK3 A;  4WFB L;  4BRM A;  3UB5 A;  4O5F A;  3CMA N;  5M1O A;  3FLC O;  1KAX A;  1WUA A;  4FOE A;  4BQL A;  3UKR A;  3VGM A;  4CBU A;  1SQK A;  1NGG A;  3ULE B;  3CCE N;  5BRH A;  1OVY A;  3EN9 A;  4AF1 A;  1VQO N;  3K9J A;  4CZK A;  2JWL A;  3D7E O;  4FL9 A;  1GLD G;  1QQN A;  5F2R A;  3AGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...