4GKJK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkjK00
4GKJK 4LFAK 1XMOK 4CVNE 4DR3K 4DV2K 4B3MK 4X65K 4DR1K 4DR5K 2ZM6K 4OX9K 4JI3K 1N34K 4DV6K 5LMUK 1FJGK 3JAMO 4DR4K 1IBKK 4DR6K 1HNXK 4JI0K 3J81O 4X66K 4JI5K 5BR8K 4CW7B 2F4VK 4LFBK 2UXBK 4DUZK 5IWAK 1XNRK 4GKKK 4AQYK 2VQEK 2E5LK 4JI2K 2UU9K 4KHPK 1IBLK 3J7AP 4JI8K 4JI1K 4JI4K 1HNZK 1HR0K 4DV4K 2UXDK 2HHHK 4JYAK 4NXNK 1N36K 4X62K 4DV0K 3J7YP 5A2QO 4DR7K 4B3SK 4LF7K 2VQFK 4DV3K 5AJ3K 4LF6K 4K0KK 4DR2K 4DV5K 4DUYK 1N32K 4B3TK 1I94K 3OTOK 4LF5K 4NXMK 1J5EK 2UUAK 4V19S 1N33K 4DV7K 4JI7K 1HNWK 4B3RK 4LF8K 5IT9O 2UUBK 1IBMK 1XMQK 3J80O 4LF4K 4LF9K 2UXCK 5FLXO 4JV5K 5LL6Z 3T1YK 1XNQK 4YY3K 2UUCK 4JI6K 4X64K 3T1HK 5LMNK 4DV1K 4YHHK 4LFCK
chains in the Genus database with same CATH superfamily
5KPRA 2VCPA 5HOOA 4CEDA 3EZWA 3HI0A 3T69A 4IWVA 1BA0A 2GX9A 4CZGA 5HRNA 4DTMA 1RTJA 4B1VA 3ZX0A 3KK1A 5AQJA 3DI6A 5M1QA 1RBVA 4U67L 4CEBA 1SKSA 1NJXA 3CQ8A 1ZYQA 4B08A 3AA4A 2QWPA 3RTVA 3V9XA 5LJVA 2UXBK 3WQTA 4CJ5A 4B9QA 3TSUA 5LJWA 1CZBA 4QCLA 2NRWA 3GL1A 1W9HA 5F0XA 1QQCA 4QOZB 1FKPA 2O8CB 1YUWA 1D9FA 1H1VA 2OCEA 3ULEB 1HRHA 1VSLA 3HPGA 3QEWA 3P31A 1TL3A 4DHYA 2ZJRL 3LDOA 4ICLA 3A5MC 3VEYA 4EHTA 3UKUB 4F4KA 3G10A 3CIPA 4B3SK 4ILGB 2RE2A 3VF2A 4NLBA 3E9LA 1TGOA 1J6ZA 3MK6A 4JKGA 1LAWA 4FLWA 3DYAA 1QQNA 3QESA 4U7BA 3TU5A 3A5NC 3H3NO 2HHUA 4BDPA 4AHSA 3ZETA 3ZEUA 3AA2A 4N56A 1CZ9A 4LF8K 4ID5A 4B9TA 5MLCQ 4PKHA 1B92A 1VSDA 3SAFA 3SNNA 3KLHA 3R9PA 3SV4A 4F2RA 5AQLA 3HP6A 4F3TA 2ZE2A 1L5UA 3VQ7A 4M45A 2IVNA 4ILJA 2B6AA 2X6NA 5M1OA 1JCGA 1Q82O 4CJEA 3BP8A 1SUQA 1C0FA 4FOIA 3CHWA 3ZT1A 3O9RA 4KH4A 4ISFA 1U2VB 3C95A 1GLLO 3ZSXA 4N5SA 4C8KA 3AO3A 3C65A 3LANA 1WSIA 3C6UA 2IVOA 1HQEA 3U8XA 3VQAA 5BN8A 4A5AA 2W6KA 1KFSA 1QQMA 4MFBA 5C2DA 3TAQA 4EHUA 1ATSA 3KHYA 5AR0A 4M3TA 3QBWA 1MDUB 2NRVA 4AF1A 4DTPA 1T6DA 1ASUA 3VERA 4CCHA 4CBWA 1GOBA 2O8DA 3AO5A 3VMFB 3AVIA 4IOCL 2WFBA 1Q81O 3UE5A 4JI2K 1BG3A 3CJBA 4FJJA 2IVPA 3DAWA 1YVUA 5CE3A 5J2PA 4EAHD 4A2BA 3C6AA 2DFHA 2PAVA 3LWLA 4DV4K 4I2PA 3MXMA 1SL2A 3U9DA 1KLMA 4E7LA 3MDQA 4BC5A 5I42A 1RFQA 4DTXA 4CE9A 4ZTJA 1HUXA 2E1YA 4JK7A 3CJ9A 2PFUA 4DV5K 3H1QA 3IAYA 1WAJA 3OTOK 2FF6A 5BPNA 2HHTA 2GV9A 4DFPA 3ZYYX 3K5OA 3F73A 5AQNA 1ATNA 3VA3A 1BA1A 4GY2B 2EX3A 4FJXA 3VEVA 4V19S 4AHCA 1EO1A 5ADXH 4JLHA 3MN7A 4FWMA 3SJJA 3SMPA 3ZETB 3K9JA 1RBUA 1REVA 5GAEP 3D0PA 5C24A 4EP4A 4LF9K 1O13A 3K9KA 3CCRN 2FBYA 3NVMA 1GLFO 2GELA 3FZFA 3M1FA 5C12A 3HPOA 4DFKA 4JV5K 4ISEA 3WUHA 3KKRA 3L8BA 2GWKA 3NFAA 4I6MA 4EIAA 3PSIA 4FXDA 2HF3A 3WXMB 1NGBA 1SZ2A 3LP0A 2EHGA 3I0SA 3EKUA 3T3FA 2ASMA 2Y1JA 3KD5E 4LFAK 4CFCA 1T44A 1S1TA 1BOTO 4CJSA 2VYPA 3VGLA 3HSTB 3U3YA 2YNIA 4KHYA 3VQQA 1IBKK 2Z1HA 1HJOA 5M1PA 4KHWA 2D0OA 2F7TA 1KCFA 3SBGA 4ELTA 1ASVA 2P9SA 4OPJA 1VQ8N 4B1YB 1XNRK 1VSIA 3QIOA 4H03B 3OW2M 1ZC6A 1U4BA 1NK8A 2P9IB 1M90O 3HBTA 5AFUH 3NH0A 4GV9A 4E1NA 1R0AA 1Z05A 4CEZA 3H46O 4CJLA 5BPMA 4DQQA 1HMVA 1SKWA 4IOAL 1J9AA 2H3GX 3RRGA 4IKFA 3KWIA 2FSKA 4DTUA 3OBYA 1SL0A 4DQRA 2G8WA 4JD2B 4ZTFA 4DV0K 3J7YP 3ID8A 2P5OA 1RT6A 2VQFK 4DV3K 3O9UA 4A61A 2QA4N 2KTQA 5C10A 4FJ7A 4LF5K 1J5EK 3BDPA 2IIRA 3SUPA 1S1XA 1NGCA 3O9SA 4DV7K 4BRQA 1NK0A 3K0SA 3DJCA 1HNWK 1GLEG 1X1PA 4WYBA 1FW6A 3PX0A 2YKNA 3CCEN 1KVCA 3OYHA 1NK5A 2QI2A 1IBMK 3HPHA 3TANA 4DSLA 3BF1A 3SYZA 3MWPA 3R6MA 3VF4A 2FBXA 4BVOA 1YJ9N 5AZJB 4BGAA 3FFKB 4Z94A 1LW0A 2E2PA 4AM6A 3SQ2A 1TUUA 3KK7A 2Q36A 1B9FA 1NKBA 3MX2A 3CMAN 1KC8O 1HYZA 3CJ7A 1EXQA 3SPYA 1FKOA 3FE1A 2P9PB 1JXEA 2NNWA 1J5OA 4M3ZA 2XRIA 5JLFA 4DTSA 1BGXT 2DTUA 3P1GA 2AP1A 3VEZA 4WCEL 4Z4EA 1IV0A 1W7AA 2HHXA 2YI1A 3SLCA 2WC9A 2E88A 3KIOA 3LP3A 3U4LA 4KREA 1NGEA 4PY5A 2D0CA 3OYGA 1GLDG 3ALYA 2XO7A 3ASMA 4DCHA 4KBOA 3KLEA 3AO1A 1E4GT 2E6MA 2O8EA 1RILA 3OYIA 4KI6A 4YORA 4CFAA 3AO2A 3WXJA 3OS1A 1BCOA 2FBVA 3ZSZA 1B9DA 1JXBA 1Z6RA 2ASOA 4JI4K 4M3XA 5BRHA 1QVFM 4F8RA 5KTQA 3HYFA 3ENBA 5EVZA 1RDBA 1G15A 3PIOL 2FC0A 2Q0RA 3HT3A 3SZ2A 3KVGA 5CZ1A 5AJ3K 3TTFA 3O3FA 2HNZA 3PO5A 1S6QA 4DUYK 3OA9A 1NJIO 2QTDA 4BG8A 4C8LA 3U9ZA 4BC4A 3NVKA 3T7ZA 4CJUA 2ZD1A 1TK8A 5I3UA 2JWLA 4H0PA 5LY3A 2KLAA 2O8DB 1S6PA 2ITMA 1Z25A 3VOVA 2A40A 3SUNA 4FK4A 5DM7L 4DF8A 4FVUA 1RT5A 3V81A 3QFUA 1RT3A 3WNHA 2NRZA 4BDZA 4DMNA 2OPRA 3QNNA 2QEXN 4UQGA 4E1JA 3I33A 1IG9A 3QBXA 4I9QA 3CM6A 4JEPA 4H4OA 1JL1A 3KKSA 1YJWN 3EL2A 4BRFA 4DV1K 1U2VA 2O4GA 1HX1A 2KFNA 4JHDA 3DRSA 3DLGA 4CVNE 4DV2K 2Q3SA 3JSMA 4X65K 1V4SA 2ZM6K 3DOKA 3IS9A 3HXMA 1N34K 5HRRA 4OPKA 3AGKA 4H8KA 3K5LA 3TABA 2KQ2A 1QQOA 5TKYA 1S3XA 1L3UA 4CESA 2YNFA 2GEMA 3E66A 4Q5VA 4CW7B 2YX6A 3OHRA 4LY7A 4OGEA 4A62A 3EY1A 4FWPA 2D1KA 2QWMA 3M3ZA 5FRMA 3R1XA 3IG1A 2VQEK 3O4NA 4OO1J 4IXCA 5AQYA 3EO3A 1T03A 4WQ4A 3DLRA 4DFMA 3V9ZA 4F3OA 5C2FA 1KVBA 2PZSA 1GOAA 4CEQA 2RF2A 4NB4A 1RT7A 3KLIA 4KHQA 3D45A 4I6MB 3W0LA 5M1KA 1EP4A 3NGIA 3TWHA 4KTQA 4PQUA 1TAUA 2FF3B 3CPWM 4B3TK 1N5YA 4AILC 4NXMK 3CFOA 4BQLA 2HMIA 4O5BA 1IG8A 1LOTB 3PLAA 1JCFA 4RWTA 3NCIA 2DPNA 3C0BA 3AA5X 1ZBFA 3FGUA 3OS2A 4NLCA 4FWLA 2OA8A 1VSHA 1NJZA 3B6OA 2ZWHA 5HBMA 4CEFA 3D6RA 1QHAA 1M1KO 3QO9A 3RR7A 4H4MA 4O0IA 1TYQB 4CJPA 3SBTA 4CEOA 3L2UA 2G8IA 4JI6K 4O8UA 1NWKA 2D4WA 3VEXA 4Y0WA 2YHAA 5AZIB 2P5GA 1S1VA 3SJHA 4HUFA 4Z4IA 3T19A 3SPZA 1FXXA 3VEWA 1Q9YA 1GLCG 3UKRA 2Q0UA 3V1OA 1IKYA 2V51B 3LALA 3O4WA 4JD2A 1FJGK 2NUBA 1KVAA 1LWCA 2P9UB 5C42A 4HUGA 3AVCA 1BO5O 4KAZA 1S9EA 4ID1A 3JXUA 3WXLA 4DU4A 1WSEA 5AQSA 3KK2A 3LM9A 3LM2A 1RDAA 4B3OA 5DK5A 3TTDA 2QKKA 2E5LK 3OY9A 4CI6A 2BDPA 4GW6A 1LV5A 1A5WA 2FSNA 5DMRA 1RDUA 2BANA 1Q18A 1TKXA 4KRFA 1HR0K 3JS6A 4BRDA 2B5JA 3H08A 1T7PA 3S9HA 5EXWA 5A2QO 1VQNN 5KRSA 1QTMA 4LF6K 2NZTA 1RBSA 1IKXA 3OYJA 4ZHRA 4JK8A 2KZZA 4BR4A 3NH1A 1BCMA 2OZMA 4FWNA 1VQKN 3IUCA 3SAHA 3I56N 2F8SA 1NU0A 2BH1A 4BGBA 4FYDA 4CJ7A 2Q1NA 2WTUA 4JI7K 2QM1A 2P9KB 4E89A 1NOYA 2HOEA 3HP9A 1YTUA 1JLCA 2RKIA 3N4QA 1DGKN 4H5VA 1BUPA 2EWSA 4O5FA 3TTCA 2UXCK 3V1RA 3CQYA 4CBUA 3PY8A 1K8KB 1UAXA 3WNGA 3AVNA 1V4TA 4IEIA 3QDKA 4DKWA 3F5TA 1I3AA 5C25A 5SWMA 4M41A 3IDHA 2O4IA 4YOUA 5AQPA 2QWLA 1VQ7N 2YKMA 3HM8A 4BRKA 3QEPA 1ZBHA 3AVJA 4B9SA 1K6YA 2ITGA 2WOMA 4K43A 3NDKA 2AJQA 4E0DA 3CETA 4DR1K 2OPPA 1VK0A 3CCUN 4HTLA 3THXB 4Z4CA 2UYTA 4RCHA 2I7PA 4N76A 3QICA 1LCUA 4FJKA 4LSNA 2OTJN 3J81O 2ZJPL 4E7JA 4XIUA 3THXA 5ELZA 4Z4HA 3HTVA 2YHYA 3BGRA 3ZSYA 1C6VA 2D0PA 3Q7BA 2Q97A 1VSEA 2XY6A 4FK0A 5AQZA 1Q8IA 3CMEN 1SKRA 1L3VA 3MAQA 2WONA 5J2NA 3ZSQA 3VPZA 3MCPA 1CXUA 3E01A 3MXJA 3SAGA 2UXDK 4KTZA 1IJJA 4CD3A 3KWGA 2ATQA 2XY5A 1N36K 3DRPA 2YJEA 3AAPA 1DLOA 4NCAA 4HVJA 1GLAG 2E20A 3TSPA 4BY9C 2IOCA 1QHTA 1NGGA 4NO7A 3NGYA 2QXLA 2BTFA 5KPTA 1JLAA 1LWEA 1NKCA 3CM5A 5KQ8A 1IKVA 3O3GA 4IOXA 3QFPA 2UUBK 1KD1O 1CZAN 1RBTA 3ZT2A 4CF1A 3THYB 3H1VX 1BDGA 4WFBL 1RBRA 1NLVA 3HRGA 4RW6A 1JLFA 4YY3K 4HCCA 1KQSM 4J8FA 1X9SA 4N47A 4FZZA 3T1AA 4B9UA 2ZF5O 2HVIA 4PWDA 1JCEA 3CC4N 4GVMA 4CHZA 3V4IA 3L6QA 2RN2A 3MEDA 3FR0A 3TI0A 1TK5A 4FOEA 4Z0UA 4NCBA 2HVHA 4H5NA 4I9LA 3MN5A 4PL8A 2OPQA 4FSVA 3DOLA 4H5WA 3K2PA 4BG9A 3VQ9A 3AVBA 2E6LA 4DR5K 3ENHA 2O8EB 5CYMA 3CCLN 3VQBA 4DR4K 1KRPA 4OLBA 2HF4A 4JS4A 4LH4A 2G8KA 3HOSA 2ASPA 4AM7A 1SV5A 4DUZK 4CJ4A 5C15A 3KK3A 1C0MA 4C23A 5GAGP 3OS0A 3CC2N 4KKOA 1EWQA 4CJ3A 4CZEA 2VGNA 4FWOA 1XUPO 2V7ZA 3VQCA 2QWQA 2Z1GA 3ISNC 4KHPK 3P38A 1L3SA 3S3OA 4N41A 1YJNN 3A5LC 1EQYA 3NGZA 1JL2A 3FZMA 2CH5A 3SV3A 2X6SA 2JWKA 1ASWA 3RSEB 3V9UA 1HPMA 1VQON 4RW9A 3VF6A 4JKBA 2OPSA 4A2AA 1SQKA 3KLFA 4M3WA 3CD6N 5AQRA 5AZJA 4M42A 1G99A 3DWLA 4M7YA 1NK7A 1I94K 1UA0A 1MWMA 4O8KA 3C94A 3A2FA 1ITGA 3LDPA 3HVTA 4KV8A 1YITN 5IT9O 2GUPA 1X9MA 4HUEA 3CCJN 4JKAA 1C1AA 4O4GA 1YF5L 1BISA 5CY4A 2NRHA 3VQDA 2FLOA 3DLKA 3SUOA 3OVNA 5EY4A 4DU3A 1DTTA 2O8BA 5AQTA 3PIPL 4C8MA 2CH6A 2QK9A 4HCBA 5KQDA 4CGDA 1UOCA 3QEIA 5KGWA 4LFCK 3VGMA 3DLHA 5AQFA 3S3MA 4DR3K 4A57A 3UKRB 5EU7A 1VQPN 3TR8A 2A42A 4FLTA 1TUYA 3G6EN 4C1NI 4PA1A 1BU6O 1TKZA 3LWMA 3NF8A 3M8RA 2O8FB 1OH7A 1KAZA 3G0ZA 4QS8A 1S1WA 2RPIA 2VWBA 3G4SN 3LZJA 3NHGA 1D9DA 3LDQA 4Y1CA 1HYSA 3ULDA 3L4IA 4IDHA 5IWAK 4FJGA 2W41A 1A5XA 1VQ5N 4H0OA 2ZGYA 1QE1A 3M6GA 3K58A 4WFNL 3VEOA 2HBKA 4CHQA 2G8UA 4FWQA 3M5RA 4BRLA 4CHPA 3EZ5A 4FLXA 3VTHA 3LDSA 5BRDA 1T8EA 4KH5A 1NM1A 1YT3A 3HL8A 4F2SA 3TSQA 2HBLA 5KI6A 4JKCA 5TKWA 4G9ZA 1LWFA 1XWLA 3AVFA 1HPZA 4OKKA 4LF7K 3AAQA 4CZFA 4FLYA 1U45A 1HQUA 4CGFA 3E9OA 4Z4GA 4WQ5C 3VQ5A 2OZSA 1S22A 1MA9B 2UUAK 1LW2A 2P9IA 3OYLA 3CI5A 1NBWA 2G8FA 2CGLA 3UKUA 4K8ZA 5HROA 2W6LA 2P9KA 3RMDA 3AVHA 1XC3A 5AQKA 3K59A 4FO0A 1NMNA 3QETA 3HSCA 1WSHA 3B8AX 4LF4K 1GOCA 3ULEA 4FJIA 4B1XB 2Z1JA 2P9NA 3Q7CA 3I0RA 1JLGA 2P9LA 4CF2A 2PBDA 5B8HA 1TK0A 3OYEA 4CZMA 3UIQA 4EZ6A 1BIZA 1TKTA 3AVAA 5HP1A 4YDUA 5AQXA 3E1YA 5EX5A 2VG7A 4JK9A 1EWRA 3WEEB 1NGDA 2A3ZA 3E9PA 3UB5A 3O80A 2QWOA 4K42A 4CGHA 1T3VA 4IBNA 5BRFA 3AVLA 4BR2A 4E7HA 4B1UB 3O5BA 4IJAA 3I8DA 3CQXA 3VETA 3NE6A 3NH2A 5LMUK 4FW1A 3QEXA 2E2OA 2Q31A 3JAMO 3EEQA 4JKFA 2A41A 2GBZA 2KHOA 4CZLA 2OTLN 1C0GA 3CFRA 3OBWA 3HZ6A 3N4PA 4PUOA 4FJ5A 4DSJA 1C1BA 3DXKB 3WNEA 4JRQA 3L3VA 5I9EB 1T05A 4BRHA 4GV6A 3KLGA 3PO4A 4CJQA 2A1RA 1SL1A 4IZ9A 1KAYA 3F9KA 1WBDA 3CPEA 5AQGA 1JLBA 3G71N 4CIFA 3O8MA 1WSJA 3LP2A 4LSLA 4WE1A 4CEEA 4IFEA 5M1FA 4UY8O 2YNGA 4CJRA 2A6AA 1S9GA 1D5AA 4E19A 1OVQA 3TAGA 1U48A 2D0BA 5AQVA 1QS4A 3WNFA 3V6DA 1Q7YO 1OH5A 3OJUA 2BE2A 1WNSA 2E8AA 3CC7N 3VENA 3LDLA 4JKDA 4B9LA 3TARA 1Y64A 4M3YA 2IGIA 3AARA 2CGJA 4B8AB 4FPAA 2ZQBA 5AQIA 3HVRA 1MWKA 1JJ2M 3BY5A 3THWB 5KGXA 1NJWA 5FPNA 5AFUA 4E3SA 1HLUA 4FJ8A 3MN6A 4CJFA 5HLFA 4L8RB 4DSKA 4CIEA 5LMNK 4QS7A 4H0XB 4BR5A 2E2NA 3RRHA 1KTQA 2W40A 4RW7A 2IC3A 2X74A 3DXMA 4FM1A 1D8YA 4CIGA 1KAXA 5JVHL 4FLZA 2VG6A 4MQ3A 1VSKA 4BWMA 2P9SB 4IFVA 4RTFD 3AGRA 3WEEA 3ZSWA 3M8PA 4FLUA 4R5PA 1YHQN 4Y1DA 1HKBA 5CZ2A 1K8AO 1X3MA 3CJ1A 4DQSA 4MO5A 2F9WA 3GE1A 4GKKK 4KPYA 4JNEA 2F96A 2I7NA 3TAMA 3SQ0A 1XQSC 5AQHA 3WT0A 3ZSOA 1JLQA 3L2RA 4CJWA 1CXQA 3MEGA 4B1WB 4JI8K 3BEXA 4CK3A 4PHTX 1OVYA 2HNYA 5CR4A 4K41A 4IG0A 5GINA 5CHIA 4NXNK 1RCHA 1YAGA 4BRMA 4KH6A 1FK9A 4FM0A 1RDWX 4XH5A 3VTIA 4BR7A 4OKJA 3FLCO 2OANA 5AQOA 4IEEA 1W2BM 1VQ6N 3S3NA 2AA4A 3BZCA 3EE8A 2HNDA 2O8CA 1BWFO 4B3RK 4IO9L 4JKHA 1VQMN 1C0UA 1RNHA 1NK4A 1HNVA 3DLBA 1J53A 2RHKA 4DQ8A 3RSEA 4KHNA 2P9LB 3ID6A 1NNEA 1KFDA 4FZYA 2DY4A 1BI4B 3O4QA 1VQ9N 4BRCA 3ZT3A 2Q2RA 4MDBA 4XH1A 2QW9A 3D2FB 3O3HA 3HM9A 1WLJA 4XH4A 3IMXA 2NRXA 2G8HA 4FCYA 2P51A 4YHHK 1IH7A 4W5TA 1YTAA 5KPZA 4CJTA 1NKEA 3LDNA 4FJLA 5FPMA 5F2RA 4BACA 3F2KA 5H1SQ 3MWTA 5E26A 3QIPA 1RT2A 5DM6L 2QWRA 1HNXK 4AHTA 4EZ9A 3LAKA 4J2DA 2F4VK 4OPHA 4BDYA 4E7KA 4ELVA 1DEJA 1MU2A 3AVGA 4WF9L 3OYNA 3QINA 4CEAA 4DF4A 1X9JA 5GAHP 4H0YB 1WB9A 3OYKA 4FVMA 4H5TA 3CXCM 1X9WA 5KRTA 3LL3A 4RW8A 1NGFA 3C6TA 1NOZA 2W42A 4BRIA 3VA0A 2HB5A 1VSMA 2P9PA 3IRXA 4CJVA 3D2EA 4O44A 4NYFA 2PYLA 4CF9A 1EETA 1O1WA 3O9TA 1XHXA 3LPUA 4CGJA 5HL7L 1HYVA 1SS6A 5FPDA 1N8RO 1RTDA 2BGGA 4AHVA 3O08A 1XC9A 3NF7A 1N32K 1ILYA 3OJSA 4BE2A 3P39A 3ZCMA 2ZJQL 3AVMA 3J7ZO 3CERA 1C1CA 4CGGA 3L0QA 1RGIA 1WN7A 2O8BB 2GWJA 2PY5A 4MDAA 3EE9A 4M3RA 2HMPA 3HOTA 2XHBA 4FJMA 1GLJO 1KSPA 1WSGA 2Z1IA 3VN5A 1R59O 2HHSA 5JS1A 5JMVA 1ESVA 2CGKA 5E41A 1DT9A 1VQ4N 4X64K 4DSIA 3ZX3A 4YOXA 3J8AA 3MN9A 4IFYA 3CCVN 4KB1A 3V1QA 3PX4A 5E84A 4FWKA 4M3UA 2FSJA 4DFJA 1Q9XA 4KHSA 1U49A 1YVNA 4E1MA 1YXQA 4FJHA 3TAPA 1NJYA 1QVGM 4DQIA 4FPBA 4OX9K 3R3LA 3TAEA 2KW4A 5JLHA 4JAXA 1BL3A 1JLEA 5F1XA 1RTHA 1ZXOA 5AQMA 1HJRA 1U6ZA 3AV9A 3THYA 4X66K 1BHLA 5BR8K 1VRUA 1T6CA 4KO0A 2D5RA 5JVGL 3RVCA 3I8BA 4H0VB 1RT1A 1VSFA 4DSEA 4EFHA 1IKWA 4RW4A 3SUQA 1NK6A 1F21A 4PKGA 1IBLK 3J7AP 1OH6A 1QZ5A 2YCHA 4YDUC 4AHRA 4DU1A 5AQUA 1VSJA 4DTRA 3P4IA 4ELUA 4J2BA 4Q0BA 3VQ6A 4DTJA 3ZEUB 4X62K 3H45C 3WXKA 1KXPA 3SK3A 5HRSA 3CJAA 3RWUA 4CZIA 1N6QA 1L3TA 2YJFA 4BC2A 2HHWA 1ZBIA 3IFRA 4JKEA 2J4RA 3LAMA 3VQEA 3V9WA 4CGIA 1NGIA 3OYAA 1ZBSA 2HBMA 3C7NA 4O55A 4DSFA 4LC9B 3CCMN 5J1EA 4CHYA 4W5QA 2A5XA 3SQ1A 4K25A 2XY7A 1XMQK 3SCXA 1W97L 4YFUA 3CJCA 3D2EB 2FXUA 4CZJA 2VWJA 5BN9A 2B4JA 3L4QA 2O8FA 4BE1A 1BQNA 4BC3A 3MCAB 3ITHA 3KD1E 3VQ4A 1EKEA 3K57A 1U04A 3RR8A 4B1ZA 4B9NA 3MMVA 2P1JA 3NF9A 4W5OA 1X3NA 4BWJA 3F9MA 4H0TB 4TSXA 3VQ8A 2E2QA 3NF6A 3HK2A 4WFAL 3AVKA 4BRAA 4A5BA 3GDQA 3L2VA 4B3MK 4GMJB 3FFIA 4JRPA 5HRPA 4JI3K 1HKCA 3THWA 1NGJA 1VHXA 1SAZA 3O6WA 1WUAA 4DG1A 1HKGA 4NYNA 2BUPA 2V7YA 3QMLA 5GIOA 4W5RA 2PYJA 4JI0K 5FDLA 4J2AA 3ZSRA 4H5RA 5K14A 2QXFA 3EKSA 4FJ9A 1DKGD 2JLEA 3PX6A 3P83D 1K9MO 4AQYK 1QZ6A 1TVRA 3MECA 4CF0A 1K8KA 4HTUA 3NMUA 4CERA 2YV0X 3U3GA 3DLEA 4JI1K 5JICA 3KJVA 2HHQA 2NRRA 1CLQA 1UWBA 1J54A 3SI6A 1W0HA 2E1ZA 2Y1IA 3GG4A 1VRTA 1QSLA 4JYAK 4C8NA 1TAQA 4FL9A 1RT4A 2D0AA 2WUSA 2NLXA 1TKDA 1TV6A 4OPAA 3L3UA 1U47A 2GUIA 4WQ5A 3BF3A 4BR9A 3O1WA 3KTQA 4CK1A 4BREA 3VQPA 1D4XA 3W3DA 4W5NA 4BR0A 3CCSN 1QSYA 3DRRA 2OYQA 2WBNA 3B6PA 3A5OC 3AY9A 1NK9A 4FWSA 4GVEA 3CYMA 4JN4A 1ATRA 2V52B 5FROA 4DS5A 3R8EA 3OYDA 3RMCA 1XNQK 2A1SA 4E7IA 3S41A 3TAFA 4YOWA 3MXIA 3JYTA 1HNIA 4KB0A 4DTOA 3O9QA 5BPLA 3TPQA 4J2EA 4MLEA 1RDCA 3C6HA 1TL1A 3QLHA 3PSFA 4OJRA 4NCGA 3M8QA 5C0YA 4CHNA 1WOQA 4GKJK 1JKHA 3OYMA 5AQWA 4DWIA 4ILHA 4FW2A 1EX4A 2FBTA 2GTDA 1LAVA 3ENOA 2I5JA 2P9NB 3PUFA 4FWRA 3L2QA 4I7FA 4C1NK 5ADXA 3DXMB 3KZBA 3HJFA 2YNHA 4G1QA 1K73O 4XEIA 1XI1A 5GADP 3L2WA 1A5VA 4B9VA 4JS5A 4IDKA 2VG5A 4OKEA 1XHZA 4AH9A 3DXKA 4BRPA 1BI4A 1WBBA 4CFDA 1KLNA 1VQLN 4KFBA 1E4FT 3A8YA 3AO4A 2UU9K 4CECA 3WQUA 2QWNA 3MX5A 1HNZK 2HHHK 2JGUA 3CCQN 3G25A 1BIUA 1WSFA 3P5JA 4BE0A 4DR7K 4DB3A 1QSSA 2KKZA 3QB0A 2ETJA 4K0KK 4DR2K 1UA1A 3LP1A 4BQZA 4BVPA 3EYZA 1S72N 1GLBG 4DTNA 3GOIA 1Y97A 3DLLL 3ZSVA 2HSTA 5AZIA 1N33K 4OGCA 1TYQA 3ZLJA 3D2FA 4CBXA 5SZTA 3NAEA 4FM2A 5J2MA 2IAJA 1DTQA 3CFPA 4EP5A 5AQQA 5FPEA 3DMJA 4BRGA 4CF8A 3MEEA 1YI2N 4Z4FA 1YIJN 4DLEA 4LD0A 3K5MA 3SQ4A 2QKBA 3BUZB 1NMDA 4C8OA 4I2QA 4DS4A 2KFZA 3FZHA 1RTIA 4M7XA 3T1HK 4L3QA 3DM2A 3AA3A 4AHUA 1OH8A 3ZT4A 4JHDB 3RMBA 3ZX2A 4LH5A 4CFBA 2DFFA 1VAZA 3K5NA 1NG9A 1XMOK 1NGHA 4F9OA 5BR9A 3CG7A 2VWKA 1BQMA 2HBJA 4YNQA 4ISGA 4OLAA 4DV6K 5D3GA 3QERA 4CZHA 3QNOA 4BROA 4DR6K 2DFEA 1IO2A 3OYFA 4JI5K 1Z26A 3ATUA 4LFBK 4M63C 5GIPA 1NGAA 4IG3A 4CHOA 1P8ZA 3IKMA 3EN9A 2HHVA 3LZIA 1ZBLA 2LSNA 2X78A 4CZKA 1OKJA 4MO4A 4HHTA 3H3OB 5FRNA 2G8VA 4WQ4C 4KHUA 2YHBA 5T7BA 2YHWA 4KTWA 3V9SA 4IJNA 4YOYA 1RDDA 4IO8A 5JS2A 2F8TA 4DQPA 1C0TA 1S5JA 2IS3A 4GV3A 1S1UA 3A0IX 4HWIA 4O0JA 4FLVA 1E3MA 4QS9A 2KZMA 3OYBA 4BRNA 3D7EO 4YOVA 3VESA 4FK2A 1ZBUA 4CJKA 3LPTA 4B8CA 3FZLA 4OVLA 3U6FA 5EOYA 5J2QA 3C7NB 2IDOA 1Q86O 4K8XA 2VGMA 3M8SA 5BREA 4PL7A 2E4LA 3PV8A 4YOTA 4FJNA 3NBPA 2R7YA 4CK2A 1P90A 2YHXA 3J80O 3THVA 3QEVA 4GNIA 3OYCA 5CYQA 4CD1A 4JKGB 1WAFA 3ATVA 1I39A 2P9UA 3SMSA 3H6EA 3VGKA 5FLXO 3FZKA 5LL6Z 3T1YK 4RG8A 4B9MA 4DLGA 2ZGZA 3HO1A 2NRTA 5M1NA 3I55N 3GBTA 3CF5L 4KI4A 4MLHA 3BZKA 2UUCK 3O1BA 4FZXC 3WXIA 4PKIA 4R79A 2XY8A 3ZT0A 4QAGA 2F9TA 3RMAA 2HW3A 4A59A
chains in the Genus database with same CATH topology
4GKJK 4LFAK 1XMOK 4CVNE 4DR3K 4DV2K 4B3MK 4X65K 4DR1K 4DR5K 2ZM6K 4OX9K 4JI3K 1N34K 4DV6K 5LMUK 1FJGK 3JAMO 4DR4K 1IBKK 4DR6K 1HNXK 4JI0K 3J81O 4X66K 4JI5K 5BR8K 4CW7B 2F4VK 4LFBK 2UXBK 4DUZK 5IWAK 1XNRK 4GKKK 4AQYK 2VQEK 2E5LK 4JI2K 2UU9K 4KHPK 1IBLK 3J7AP 4JI8K 4JI1K 4JI4K 1HNZK 1HR0K 4DV4K 2UXDK 2HHHK 4JYAK 4NXNK 1N36K 4X62K 4DV0K 3J7YP 5A2QO 4DR7K 4B3SK 4LF7K 2VQFK 4DV3K 5AJ3K 4LF6K 4K0KK 4DR2K 4DV5K 4DUYK 1N32K 4B3TK 1I94K 3OTOK 4LF5K 4NXMK 1J5EK 2UUAK 4V19S 1N33K 4DV7K 4JI7K 1HNWK 4B3RK 4LF8K 5IT9O 2UUBK 1IBMK 1XMQK 3J80O 4LF4K 4LF9K 2UXCK 5FLXO 4JV5K 5LL6Z 3T1YK 1XNQK 4YY3K 2UUCK 4JI6K 4X64K 3T1HK 5LMNK 4DV1K 4YHHK 4LFCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ K;  4LFA K;  1XMO K;  4CVN E;  4DR3 K;  4DV2 K;  4B3M K;  4X65 K;  4DR1 K;  4DR5 K;  2ZM6 K;  4OX9 K;  4JI3 K;  1N34 K;  4DV6 K;  5LMU K;  1FJG K;  3JAM O;  4DR4 K;  1IBK K;  4DR6 K;  1HNX K;  4JI0 K;  3J81 O;  4X66 K;  4JI5 K;  5BR8 K;  4CW7 B;  2F4V K;  4LFB K;  2UXB K;  4DUZ K;  5IWA K;  1XNR K;  4GKK K;  4AQY K;  2VQE K;  2E5L K;  4JI2 K;  2UU9 K;  4KHP K;  1IBL K;  3J7A P;  4JI8 K;  4JI1 K;  4JI4 K;  1HNZ K;  1HR0 K;  4DV4 K;  2UXD K;  2HHH K;  4JYA K;  4NXN K;  1N36 K;  4X62 K;  4DV0 K;  3J7Y P;  5A2Q O;  4DR7 K;  4B3S K;  4LF7 K;  2VQF K;  4DV3 K;  5AJ3 K;  4LF6 K;  4K0K K;  4DR2 K;  4DV5 K;  4DUY K;  1N32 K;  4B3T K;  1I94 K;  3OTO K;  4LF5 K;  4NXM K;  1J5E K;  2UUA K;  4V19 S;  1N33 K;  4DV7 K;  4JI7 K;  1HNW K;  4B3R K;  4LF8 K;  5IT9 O;  2UUB K;  1IBM K;  1XMQ K;  3J80 O;  4LF4 K;  4LF9 K;  2UXC K;  5FLX O;  4JV5 K;  5LL6 Z;  3T1Y K;  1XNQ K;  4YY3 K;  2UUC K;  4JI6 K;  4X64 K;  3T1H K;  5LMN K;  4DV1 K;  4YHH K;  4LFC K; 
#chains in the Genus database with same CATH topology
 5KPR A;  2VCP A;  5HOO A;  4CED A;  3EZW A;  3HI0 A;  3T69 A;  4IWV A;  1BA0 A;  2GX9 A;  4CZG A;  5HRN A;  4DTM A;  1RTJ A;  4B1V A;  3ZX0 A;  3KK1 A;  5AQJ A;  3DI6 A;  5M1Q A;  1RBV A;  4U67 L;  4CEB A;  1SKS A;  1NJX A;  3CQ8 A;  1ZYQ A;  4B08 A;  3AA4 A;  2QWP A;  3RTV A;  3V9X A;  5LJV A;  2UXB K;  3WQT A;  4CJ5 A;  4B9Q A;  3TSU A;  5LJW A;  1CZB A;  4QCL A;  2NRW A;  3GL1 A;  1W9H A;  5F0X A;  1QQC A;  4QOZ B;  1FKP A;  2O8C B;  1YUW A;  1D9F A;  1H1V A;  2OCE A;  3ULE B;  1HRH A;  1VSL A;  3HPG A;  3QEW A;  3P31 A;  1TL3 A;  4DHY A;  2ZJR L;  3LDO A;  4ICL A;  3A5M C;  3VEY A;  4EHT A;  3UKU B;  4F4K A;  3G10 A;  3CIP A;  4B3S K;  4ILG B;  2RE2 A;  3VF2 A;  4NLB A;  3E9L A;  1TGO A;  1J6Z A;  3MK6 A;  4JKG A;  1LAW A;  4FLW A;  3DYA A;  1QQN A;  3QES A;  4U7B A;  3TU5 A;  3A5N C;  3H3N O;  2HHU A;  4BDP A;  4AHS A;  3ZET A;  3ZEU A;  3AA2 A;  4N56 A;  1CZ9 A;  4LF8 K;  4ID5 A;  4B9T A;  5MLC Q;  4PKH A;  1B92 A;  1VSD A;  3SAF A;  3SNN A;  3KLH A;  3R9P A;  3SV4 A;  4F2R A;  5AQL A;  3HP6 A;  4F3T A;  2ZE2 A;  1L5U A;  3VQ7 A;  4M45 A;  2IVN A;  4ILJ A;  2B6A A;  2X6N A;  5M1O A;  1JCG A;  1Q82 O;  4CJE A;  3BP8 A;  1SUQ A;  1C0F A;  4FOI A;  3CHW A;  3ZT1 A;  3O9R A;  4KH4 A;  4ISF A;  1U2V B;  3C95 A;  1GLL O;  3ZSX A;  4N5S A;  4C8K A;  3AO3 A;  3C65 A;  3LAN A;  1WSI A;  3C6U A;  2IVO A;  1HQE A;  3U8X A;  3VQA A;  5BN8 A;  4A5A A;  2W6K A;  1KFS A;  1QQM A;  4MFB A;  5C2D A;  3TAQ A;  4EHU A;  1ATS A;  3KHY A;  5AR0 A;  4M3T A;  3QBW A;  1MDU B;  2NRV A;  4AF1 A;  4DTP A;  1T6D A;  1ASU A;  3VER A;  4CCH A;  4CBW A;  1GOB A;  2O8D A;  3AO5 A;  3VMF B;  3AVI A;  4IOC L;  2WFB A;  1Q81 O;  3UE5 A;  4JI2 K;  1BG3 A;  3CJB A;  4FJJ A;  2IVP A;  3DAW A;  1YVU A;  5CE3 A;  5J2P A;  4EAH D;  4A2B A;  3C6A A;  2DFH A;  2PAV A;  3LWL A;  4DV4 K;  4I2P A;  3MXM A;  1SL2 A;  3U9D A;  1KLM A;  4E7L A;  3MDQ A;  4BC5 A;  5I42 A;  1RFQ A;  4DTX A;  4CE9 A;  4ZTJ A;  1HUX A;  2E1Y A;  4JK7 A;  3CJ9 A;  2PFU A;  4DV5 K;  3H1Q A;  3IAY A;  1WAJ A;  3OTO K;  2FF6 A;  5BPN A;  2HHT A;  2GV9 A;  4DFP A;  3ZYY X;  3K5O A;  3F73 A;  5AQN A;  1ATN A;  3VA3 A;  1BA1 A;  4GY2 B;  2EX3 A;  4FJX A;  3VEV A;  4V19 S;  4AHC A;  1EO1 A;  5ADX H;  4JLH A;  3MN7 A;  4FWM A;  3SJJ A;  3SMP A;  3ZET B;  3K9J A;  1RBU A;  1REV A;  5GAE P;  3D0P A;  5C24 A;  4EP4 A;  4LF9 K;  1O13 A;  3K9K A;  3CCR N;  2FBY A;  3NVM A;  1GLF O;  2GEL A;  3FZF A;  3M1F A;  5C12 A;  3HPO A;  4DFK A;  4JV5 K;  4ISE A;  3WUH A;  3KKR A;  3L8B A;  2GWK A;  3NFA A;  4I6M A;  4EIA A;  3PSI A;  4FXD A;  2HF3 A;  3WXM B;  1NGB A;  1SZ2 A;  3LP0 A;  2EHG A;  3I0S A;  3EKU A;  3T3F A;  2ASM A;  2Y1J A;  3KD5 E;  4LFA K;  4CFC A;  1T44 A;  1S1T A;  1BOT O;  4CJS A;  2VYP A;  3VGL A;  3HST B;  3U3Y A;  2YNI A;  4KHY A;  3VQQ A;  1IBK K;  2Z1H A;  1HJO A;  5M1P A;  4KHW A;  2D0O A;  2F7T A;  1KCF A;  3SBG A;  4ELT A;  1ASV A;  2P9S A;  4OPJ A;  1VQ8 N;  4B1Y B;  1XNR K;  1VSI A;  3QIO A;  4H03 B;  3OW2 M;  1ZC6 A;  1U4B A;  1NK8 A;  2P9I B;  1M90 O;  3HBT A;  5AFU H;  3NH0 A;  4GV9 A;  4E1N A;  1R0A A;  1Z05 A;  4CEZ A;  3H46 O;  4CJL A;  5BPM A;  4DQQ A;  1HMV A;  1SKW A;  4IOA L;  1J9A A;  2H3G X;  3RRG A;  4IKF A;  3KWI A;  2FSK A;  4DTU A;  3OBY A;  1SL0 A;  4DQR A;  2G8W A;  4JD2 B;  4ZTF A;  4DV0 K;  3J7Y P;  3ID8 A;  2P5O A;  1RT6 A;  2VQF K;  4DV3 K;  3O9U A;  4A61 A;  2QA4 N;  2KTQ A;  5C10 A;  4FJ7 A;  4LF5 K;  1J5E K;  3BDP A;  2IIR A;  3SUP A;  1S1X A;  1NGC A;  3O9S A;  4DV7 K;  4BRQ A;  1NK0 A;  3K0S A;  3DJC A;  1HNW K;  1GLE G;  1X1P A;  4WYB A;  1FW6 A;  3PX0 A;  2YKN A;  3CCE N;  1KVC A;  3OYH A;  1NK5 A;  2QI2 A;  1IBM K;  3HPH A;  3TAN A;  4DSL A;  3BF1 A;  3SYZ A;  3MWP A;  3R6M A;  3VF4 A;  2FBX A;  4BVO A;  1YJ9 N;  5AZJ B;  4BGA A;  3FFK B;  4Z94 A;  1LW0 A;  2E2P A;  4AM6 A;  3SQ2 A;  1TUU A;  3KK7 A;  2Q36 A;  1B9F A;  1NKB A;  3MX2 A;  3CMA N;  1KC8 O;  1HYZ A;  3CJ7 A;  1EXQ A;  3SPY A;  1FKO A;  3FE1 A;  2P9P B;  1JXE A;  2NNW A;  1J5O A;  4M3Z A;  2XRI A;  5JLF A;  4DTS A;  1BGX T;  2DTU A;  3P1G A;  2AP1 A;  3VEZ A;  4WCE L;  4Z4E A;  1IV0 A;  1W7A A;  2HHX A;  2YI1 A;  3SLC A;  2WC9 A;  2E88 A;  3KIO A;  3LP3 A;  3U4L A;  4KRE A;  1NGE A;  4PY5 A;  2D0C A;  3OYG A;  1GLD G;  3ALY A;  2XO7 A;  3ASM A;  4DCH A;  4KBO A;  3KLE A;  3AO1 A;  1E4G T;  2E6M A;  2O8E A;  1RIL A;  3OYI A;  4KI6 A;  4YOR A;  4CFA A;  3AO2 A;  3WXJ A;  3OS1 A;  1BCO A;  2FBV A;  3ZSZ A;  1B9D A;  1JXB A;  1Z6R A;  2ASO A;  4JI4 K;  4M3X A;  5BRH A;  1QVF M;  4F8R A;  5KTQ A;  3HYF A;  3ENB A;  5EVZ A;  1RDB A;  1G15 A;  3PIO L;  2FC0 A;  2Q0R A;  3HT3 A;  3SZ2 A;  3KVG A;  5CZ1 A;  5AJ3 K;  3TTF A;  3O3F A;  2HNZ A;  3PO5 A;  1S6Q A;  4DUY K;  3OA9 A;  1NJI O;  2QTD A;  4BG8 A;  4C8L A;  3U9Z A;  4BC4 A;  3NVK A;  3T7Z A;  4CJU A;  2ZD1 A;  1TK8 A;  5I3U A;  2JWL A;  4H0P A;  5LY3 A;  2KLA A;  2O8D B;  1S6P A;  2ITM A;  1Z25 A;  3VOV A;  2A40 A;  3SUN A;  4FK4 A;  5DM7 L;  4DF8 A;  4FVU A;  1RT5 A;  3V81 A;  3QFU A;  1RT3 A;  3WNH A;  2NRZ A;  4BDZ A;  4DMN A;  2OPR A;  3QNN A;  2QEX N;  4UQG A;  4E1J A;  3I33 A;  1IG9 A;  3QBX A;  4I9Q A;  3CM6 A;  4JEP A;  4H4O A;  1JL1 A;  3KKS A;  1YJW N;  3EL2 A;  4BRF A;  4DV1 K;  1U2V A;  2O4G A;  1HX1 A;  2KFN A;  4JHD A;  3DRS A;  3DLG A;  4CVN E;  4DV2 K;  2Q3S A;  3JSM A;  4X65 K;  1V4S A;  2ZM6 K;  3DOK A;  3IS9 A;  3HXM A;  1N34 K;  5HRR A;  4OPK A;  3AGK A;  4H8K A;  3K5L A;  3TAB A;  2KQ2 A;  1QQO A;  5TKY A;  1S3X A;  1L3U A;  4CES A;  2YNF A;  2GEM A;  3E66 A;  4Q5V A;  4CW7 B;  2YX6 A;  3OHR A;  4LY7 A;  4OGE A;  4A62 A;  3EY1 A;  4FWP A;  2D1K A;  2QWM A;  3M3Z A;  5FRM A;  3R1X A;  3IG1 A;  2VQE K;  3O4N A;  4OO1 J;  4IXC A;  5AQY A;  3EO3 A;  1T03 A;  4WQ4 A;  3DLR A;  4DFM A;  3V9Z A;  4F3O A;  5C2F A;  1KVB A;  2PZS A;  1GOA A;  4CEQ A;  2RF2 A;  4NB4 A;  1RT7 A;  3KLI A;  4KHQ A;  3D45 A;  4I6M B;  3W0L A;  5M1K A;  1EP4 A;  3NGI A;  3TWH A;  4KTQ A;  4PQU A;  1TAU A;  2FF3 B;  3CPW M;  4B3T K;  1N5Y A;  4AIL C;  4NXM K;  3CFO A;  4BQL A;  2HMI A;  4O5B A;  1IG8 A;  1LOT B;  3PLA A;  1JCF A;  4RWT A;  3NCI A;  2DPN A;  3C0B A;  3AA5 X;  1ZBF A;  3FGU A;  3OS2 A;  4NLC A;  4FWL A;  2OA8 A;  1VSH A;  1NJZ A;  3B6O A;  2ZWH A;  5HBM A;  4CEF A;  3D6R A;  1QHA A;  1M1K O;  3QO9 A;  3RR7 A;  4H4M A;  4O0I A;  1TYQ B;  4CJP A;  3SBT A;  4CEO A;  3L2U A;  2G8I A;  4JI6 K;  4O8U A;  1NWK A;  2D4W A;  3VEX A;  4Y0W A;  2YHA A;  5AZI B;  2P5G A;  1S1V A;  3SJH A;  4HUF A;  4Z4I A;  3T19 A;  3SPZ A;  1FXX A;  3VEW A;  1Q9Y A;  1GLC G;  3UKR A;  2Q0U A;  3V1O A;  1IKY A;  2V51 B;  3LAL A;  3O4W A;  4JD2 A;  1FJG K;  2NUB A;  1KVA A;  1LWC A;  2P9U B;  5C42 A;  4HUG A;  3AVC A;  1BO5 O;  4KAZ A;  1S9E A;  4ID1 A;  3JXU A;  3WXL A;  4DU4 A;  1WSE A;  5AQS A;  3KK2 A;  3LM9 A;  3LM2 A;  1RDA A;  4B3O A;  5DK5 A;  3TTD A;  2QKK A;  2E5L K;  3OY9 A;  4CI6 A;  2BDP A;  4GW6 A;  1LV5 A;  1A5W A;  2FSN A;  5DMR A;  1RDU A;  2BAN A;  1Q18 A;  1TKX A;  4KRF A;  1HR0 K;  3JS6 A;  4BRD A;  2B5J A;  3H08 A;  1T7P A;  3S9H A;  5EXW A;  5A2Q O;  1VQN N;  5KRS A;  1QTM A;  4LF6 K;  2NZT A;  1RBS A;  1IKX A;  3OYJ A;  4ZHR A;  4JK8 A;  2KZZ A;  4BR4 A;  3NH1 A;  1BCM A;  2OZM A;  4FWN A;  1VQK N;  3IUC A;  3SAH A;  3I56 N;  2F8S A;  1NU0 A;  2BH1 A;  4BGB A;  4FYD A;  4CJ7 A;  2Q1N A;  2WTU A;  4JI7 K;  2QM1 A;  2P9K B;  4E89 A;  1NOY A;  2HOE A;  3HP9 A;  1YTU A;  1JLC A;  2RKI A;  3N4Q A;  1DGK N;  4H5V A;  1BUP A;  2EWS A;  4O5F A;  3TTC A;  2UXC K;  3V1R A;  3CQY A;  4CBU A;  3PY8 A;  1K8K B;  1UAX A;  3WNG A;  3AVN A;  1V4T A;  4IEI A;  3QDK A;  4DKW A;  3F5T A;  1I3A A;  5C25 A;  5SWM A;  4M41 A;  3IDH A;  2O4I A;  4YOU A;  5AQP A;  2QWL A;  1VQ7 N;  2YKM A;  3HM8 A;  4BRK A;  3QEP A;  1ZBH A;  3AVJ A;  4B9S A;  1K6Y A;  2ITG A;  2WOM A;  4K43 A;  3NDK A;  2AJQ A;  4E0D A;  3CET A;  4DR1 K;  2OPP A;  1VK0 A;  3CCU N;  4HTL A;  3THX B;  4Z4C A;  2UYT A;  4RCH A;  2I7P A;  4N76 A;  3QIC A;  1LCU A;  4FJK A;  4LSN A;  2OTJ N;  3J81 O;  2ZJP L;  4E7J A;  4XIU A;  3THX A;  5ELZ A;  4Z4H A;  3HTV A;  2YHY A;  3BGR A;  3ZSY A;  1C6V A;  2D0P A;  3Q7B A;  2Q97 A;  1VSE A;  2XY6 A;  4FK0 A;  5AQZ A;  1Q8I A;  3CME N;  1SKR A;  1L3V A;  3MAQ A;  2WON A;  5J2N A;  3ZSQ A;  3VPZ A;  3MCP A;  1CXU A;  3E01 A;  3MXJ A;  3SAG A;  2UXD K;  4KTZ A;  1IJJ A;  4CD3 A;  3KWG A;  2ATQ A;  2XY5 A;  1N36 K;  3DRP A;  2YJE A;  3AAP A;  1DLO A;  4NCA A;  4HVJ A;  1GLA G;  2E20 A;  3TSP A;  4BY9 C;  2IOC A;  1QHT A;  1NGG A;  4NO7 A;  3NGY A;  2QXL A;  2BTF A;  5KPT A;  1JLA A;  1LWE A;  1NKC A;  3CM5 A;  5KQ8 A;  1IKV A;  3O3G A;  4IOX A;  3QFP A;  2UUB K;  1KD1 O;  1CZA N;  1RBT A;  3ZT2 A;  4CF1 A;  3THY B;  3H1V X;  1BDG A;  4WFB L;  1RBR A;  1NLV A;  3HRG A;  4RW6 A;  1JLF A;  4YY3 K;  4HCC A;  1KQS M;  4J8F A;  1X9S A;  4N47 A;  4FZZ A;  3T1A A;  4B9U A;  2ZF5 O;  2HVI A;  4PWD A;  1JCE A;  3CC4 N;  4GVM A;  4CHZ A;  3V4I A;  3L6Q A;  2RN2 A;  3MED A;  3FR0 A;  3TI0 A;  1TK5 A;  4FOE A;  4Z0U A;  4NCB A;  2HVH A;  4H5N A;  4I9L A;  3MN5 A;  4PL8 A;  2OPQ A;  4FSV A;  3DOL A;  4H5W A;  3K2P A;  4BG9 A;  3VQ9 A;  3AVB A;  2E6L A;  4DR5 K;  3ENH A;  2O8E B;  5CYM A;  3CCL N;  3VQB A;  4DR4 K;  1KRP A;  4OLB A;  2HF4 A;  4JS4 A;  4LH4 A;  2G8K A;  3HOS A;  2ASP A;  4AM7 A;  1SV5 A;  4DUZ K;  4CJ4 A;  5C15 A;  3KK3 A;  1C0M A;  4C23 A;  5GAG P;  3OS0 A;  3CC2 N;  4KKO A;  1EWQ A;  4CJ3 A;  4CZE A;  2VGN A;  4FWO A;  1XUP O;  2V7Z A;  3VQC A;  2QWQ A;  2Z1G A;  3ISN C;  4KHP K;  3P38 A;  1L3S A;  3S3O A;  4N41 A;  1YJN N;  3A5L C;  1EQY A;  3NGZ A;  1JL2 A;  3FZM A;  2CH5 A;  3SV3 A;  2X6S A;  2JWK A;  1ASW A;  3RSE B;  3V9U A;  1HPM A;  1VQO N;  4RW9 A;  3VF6 A;  4JKB A;  2OPS A;  4A2A A;  1SQK A;  3KLF A;  4M3W A;  3CD6 N;  5AQR A;  5AZJ A;  4M42 A;  1G99 A;  3DWL A;  4M7Y A;  1NK7 A;  1I94 K;  1UA0 A;  1MWM A;  4O8K A;  3C94 A;  3A2F A;  1ITG A;  3LDP A;  3HVT A;  4KV8 A;  1YIT N;  5IT9 O;  2GUP A;  1X9M A;  4HUE A;  3CCJ N;  4JKA A;  1C1A A;  4O4G A;  1YF5 L;  1BIS A;  5CY4 A;  2NRH A;  3VQD A;  2FLO A;  3DLK A;  3SUO A;  3OVN A;  5EY4 A;  4DU3 A;  1DTT A;  2O8B A;  5AQT A;  3PIP L;  4C8M A;  2CH6 A;  2QK9 A;  4HCB A;  5KQD A;  4CGD A;  1UOC A;  3QEI A;  5KGW A;  4LFC K;  3VGM A;  3DLH A;  5AQF A;  3S3M A;  4DR3 K;  4A57 A;  3UKR B;  5EU7 A;  1VQP N;  3TR8 A;  2A42 A;  4FLT A;  1TUY A;  3G6E N;  4C1N I;  4PA1 A;  1BU6 O;  1TKZ A;  3LWM A;  3NF8 A;  3M8R A;  2O8F B;  1OH7 A;  1KAZ A;  3G0Z A;  4QS8 A;  1S1W A;  2RPI A;  2VWB A;  3G4S N;  3LZJ A;  3NHG A;  1D9D A;  3LDQ A;  4Y1C A;  1HYS A;  3ULD A;  3L4I A;  4IDH A;  5IWA K;  4FJG A;  2W41 A;  1A5X A;  1VQ5 N;  4H0O A;  2ZGY A;  1QE1 A;  3M6G A;  3K58 A;  4WFN L;  3VEO A;  2HBK A;  4CHQ A;  2G8U A;  4FWQ A;  3M5R A;  4BRL A;  4CHP A;  3EZ5 A;  4FLX A;  3VTH A;  3LDS A;  5BRD A;  1T8E A;  4KH5 A;  1NM1 A;  1YT3 A;  3HL8 A;  4F2S A;  3TSQ A;  2HBL A;  5KI6 A;  4JKC A;  5TKW A;  4G9Z A;  1LWF A;  1XWL A;  3AVF A;  1HPZ A;  4OKK A;  4LF7 K;  3AAQ A;  4CZF A;  4FLY A;  1U45 A;  1HQU A;  4CGF A;  3E9O A;  4Z4G A;  4WQ5 C;  3VQ5 A;  2OZS A;  1S22 A;  1MA9 B;  2UUA K;  1LW2 A;  2P9I A;  3OYL A;  3CI5 A;  1NBW A;  2G8F A;  2CGL A;  3UKU A;  4K8Z A;  5HRO A;  2W6L A;  2P9K A;  3RMD A;  3AVH A;  1XC3 A;  5AQK A;  3K59 A;  4FO0 A;  1NMN A;  3QET A;  3HSC A;  1WSH A;  3B8A X;  4LF4 K;  1GOC A;  3ULE A;  4FJI A;  4B1X B;  2Z1J A;  2P9N A;  3Q7C A;  3I0R A;  1JLG A;  2P9L A;  4CF2 A;  2PBD A;  5B8H A;  1TK0 A;  3OYE A;  4CZM A;  3UIQ A;  4EZ6 A;  1BIZ A;  1TKT A;  3AVA A;  5HP1 A;  4YDU A;  5AQX A;  3E1Y A;  5EX5 A;  2VG7 A;  4JK9 A;  1EWR A;  3WEE B;  1NGD A;  2A3Z A;  3E9P A;  3UB5 A;  3O80 A;  2QWO A;  4K42 A;  4CGH A;  1T3V A;  4IBN A;  5BRF A;  3AVL A;  4BR2 A;  4E7H A;  4B1U B;  3O5B A;  4IJA A;  3I8D A;  3CQX A;  3VET A;  3NE6 A;  3NH2 A;  5LMU K;  4FW1 A;  3QEX A;  2E2O A;  2Q31 A;  3JAM O;  3EEQ A;  4JKF A;  2A41 A;  2GBZ A;  2KHO A;  4CZL A;  2OTL N;  1C0G A;  3CFR A;  3OBW A;  3HZ6 A;  3N4P A;  4PUO A;  4FJ5 A;  4DSJ A;  1C1B A;  3DXK B;  3WNE A;  4JRQ A;  3L3V A;  5I9E B;  1T05 A;  4BRH A;  4GV6 A;  3KLG A;  3PO4 A;  4CJQ A;  2A1R A;  1SL1 A;  4IZ9 A;  1KAY A;  3F9K A;  1WBD A;  3CPE A;  5AQG A;  1JLB A;  3G71 N;  4CIF A;  3O8M A;  1WSJ A;  3LP2 A;  4LSL A;  4WE1 A;  4CEE A;  4IFE A;  5M1F A;  4UY8 O;  2YNG A;  4CJR A;  2A6A A;  1S9G A;  1D5A A;  4E19 A;  1OVQ A;  3TAG A;  1U48 A;  2D0B A;  5AQV A;  1QS4 A;  3WNF A;  3V6D A;  1Q7Y O;  1OH5 A;  3OJU A;  2BE2 A;  1WNS A;  2E8A A;  3CC7 N;  3VEN A;  3LDL A;  4JKD A;  4B9L A;  3TAR A;  1Y64 A;  4M3Y A;  2IGI A;  3AAR A;  2CGJ A;  4B8A B;  4FPA A;  2ZQB A;  5AQI A;  3HVR A;  1MWK A;  1JJ2 M;  3BY5 A;  3THW B;  5KGX A;  1NJW A;  5FPN A;  5AFU A;  4E3S A;  1HLU A;  4FJ8 A;  3MN6 A;  4CJF A;  5HLF A;  4L8R B;  4DSK A;  4CIE A;  5LMN K;  4QS7 A;  4H0X B;  4BR5 A;  2E2N A;  3RRH A;  1KTQ A;  2W40 A;  4RW7 A;  2IC3 A;  2X74 A;  3DXM A;  4FM1 A;  1D8Y A;  4CIG A;  1KAX A;  5JVH L;  4FLZ A;  2VG6 A;  4MQ3 A;  1VSK A;  4BWM A;  2P9S B;  4IFV A;  4RTF D;  3AGR A;  3WEE A;  3ZSW A;  3M8P A;  4FLU A;  4R5P A;  1YHQ N;  4Y1D A;  1HKB A;  5CZ2 A;  1K8A O;  1X3M A;  3CJ1 A;  4DQS A;  4MO5 A;  2F9W A;  3GE1 A;  4GKK K;  4KPY A;  4JNE A;  2F96 A;  2I7N A;  3TAM A;  3SQ0 A;  1XQS C;  5AQH A;  3WT0 A;  3ZSO A;  1JLQ A;  3L2R A;  4CJW A;  1CXQ A;  3MEG A;  4B1W B;  4JI8 K;  3BEX A;  4CK3 A;  4PHT X;  1OVY A;  2HNY A;  5CR4 A;  4K41 A;  4IG0 A;  5GIN A;  5CHI A;  4NXN K;  1RCH A;  1YAG A;  4BRM A;  4KH6 A;  1FK9 A;  4FM0 A;  1RDW X;  4XH5 A;  3VTI A;  4BR7 A;  4OKJ A;  3FLC O;  2OAN A;  5AQO A;  4IEE A;  1W2B M;  1VQ6 N;  3S3N A;  2AA4 A;  3BZC A;  3EE8 A;  2HND A;  2O8C A;  1BWF O;  4B3R K;  4IO9 L;  4JKH A;  1VQM N;  1C0U A;  1RNH A;  1NK4 A;  1HNV A;  3DLB A;  1J53 A;  2RHK A;  4DQ8 A;  3RSE A;  4KHN A;  2P9L B;  3ID6 A;  1NNE A;  1KFD A;  4FZY A;  2DY4 A;  1BI4 B;  3O4Q A;  1VQ9 N;  4BRC A;  3ZT3 A;  2Q2R A;  4MDB A;  4XH1 A;  2QW9 A;  3D2F B;  3O3H A;  3HM9 A;  1WLJ A;  4XH4 A;  3IMX A;  2NRX A;  2G8H A;  4FCY A;  2P51 A;  4YHH K;  1IH7 A;  4W5T A;  1YTA A;  5KPZ A;  4CJT A;  1NKE A;  3LDN A;  4FJL A;  5FPM A;  5F2R A;  4BAC A;  3F2K A;  5H1S Q;  3MWT A;  5E26 A;  3QIP A;  1RT2 A;  5DM6 L;  2QWR A;  1HNX K;  4AHT A;  4EZ9 A;  3LAK A;  4J2D A;  2F4V K;  4OPH A;  4BDY A;  4E7K A;  4ELV A;  1DEJ A;  1MU2 A;  3AVG A;  4WF9 L;  3OYN A;  3QIN A;  4CEA A;  4DF4 A;  1X9J A;  5GAH P;  4H0Y B;  1WB9 A;  3OYK A;  4FVM A;  4H5T A;  3CXC M;  1X9W A;  5KRT A;  3LL3 A;  4RW8 A;  1NGF A;  3C6T A;  1NOZ A;  2W42 A;  4BRI A;  3VA0 A;  2HB5 A;  1VSM A;  2P9P A;  3IRX A;  4CJV A;  3D2E A;  4O44 A;  4NYF A;  2PYL A;  4CF9 A;  1EET A;  1O1W A;  3O9T A;  1XHX A;  3LPU A;  4CGJ A;  5HL7 L;  1HYV A;  1SS6 A;  5FPD A;  1N8R O;  1RTD A;  2BGG A;  4AHV A;  3O08 A;  1XC9 A;  3NF7 A;  1N32 K;  1ILY A;  3OJS A;  4BE2 A;  3P39 A;  3ZCM A;  2ZJQ L;  3AVM A;  3J7Z O;  3CER A;  1C1C A;  4CGG A;  3L0Q A;  1RGI A;  1WN7 A;  2O8B B;  2GWJ A;  2PY5 A;  4MDA A;  3EE9 A;  4M3R A;  2HMP A;  3HOT A;  2XHB A;  4FJM A;  1GLJ O;  1KSP A;  1WSG A;  2Z1I A;  3VN5 A;  1R59 O;  2HHS A;  5JS1 A;  5JMV A;  1ESV A;  2CGK A;  5E41 A;  1DT9 A;  1VQ4 N;  4X64 K;  4DSI A;  3ZX3 A;  4YOX A;  3J8A A;  3MN9 A;  4IFY A;  3CCV N;  4KB1 A;  3V1Q A;  3PX4 A;  5E84 A;  4FWK A;  4M3U A;  2FSJ A;  4DFJ A;  1Q9X A;  4KHS A;  1U49 A;  1YVN A;  4E1M A;  1YXQ A;  4FJH A;  3TAP A;  1NJY A;  1QVG M;  4DQI A;  4FPB A;  4OX9 K;  3R3L A;  3TAE A;  2KW4 A;  5JLH A;  4JAX A;  1BL3 A;  1JLE A;  5F1X A;  1RTH A;  1ZXO A;  5AQM A;  1HJR A;  1U6Z A;  3AV9 A;  3THY A;  4X66 K;  1BHL A;  5BR8 K;  1VRU A;  1T6C A;  4KO0 A;  2D5R A;  5JVG L;  3RVC A;  3I8B A;  4H0V B;  1RT1 A;  1VSF A;  4DSE A;  4EFH A;  1IKW A;  4RW4 A;  3SUQ A;  1NK6 A;  1F21 A;  4PKG A;  1IBL K;  3J7A P;  1OH6 A;  1QZ5 A;  2YCH A;  4YDU C;  4AHR A;  4DU1 A;  5AQU A;  1VSJ A;  4DTR A;  3P4I A;  4ELU A;  4J2B A;  4Q0B A;  3VQ6 A;  4DTJ A;  3ZEU B;  4X62 K;  3H45 C;  3WXK A;  1KXP A;  3SK3 A;  5HRS A;  3CJA A;  3RWU A;  4CZI A;  1N6Q A;  1L3T A;  2YJF A;  4BC2 A;  2HHW A;  1ZBI A;  3IFR A;  4JKE A;  2J4R A;  3LAM A;  3VQE A;  3V9W A;  4CGI A;  1NGI A;  3OYA A;  1ZBS A;  2HBM A;  3C7N A;  4O55 A;  4DSF A;  4LC9 B;  3CCM N;  5J1E A;  4CHY A;  4W5Q A;  2A5X A;  3SQ1 A;  4K25 A;  2XY7 A;  1XMQ K;  3SCX A;  1W97 L;  4YFU A;  3CJC A;  3D2E B;  2FXU A;  4CZJ A;  2VWJ A;  5BN9 A;  2B4J A;  3L4Q A;  2O8F A;  4BE1 A;  1BQN A;  4BC3 A;  3MCA B;  3ITH A;  3KD1 E;  3VQ4 A;  1EKE A;  3K57 A;  1U04 A;  3RR8 A;  4B1Z A;  4B9N A;  3MMV A;  2P1J A;  3NF9 A;  4W5O A;  1X3N A;  4BWJ A;  3F9M A;  4H0T B;  4TSX A;  3VQ8 A;  2E2Q A;  3NF6 A;  3HK2 A;  4WFA L;  3AVK A;  4BRA A;  4A5B A;  3GDQ A;  3L2V A;  4B3M K;  4GMJ B;  3FFI A;  4JRP A;  5HRP A;  4JI3 K;  1HKC A;  3THW A;  1NGJ A;  1VHX A;  1SAZ A;  3O6W A;  1WUA A;  4DG1 A;  1HKG A;  4NYN A;  2BUP A;  2V7Y A;  3QML A;  5GIO A;  4W5R A;  2PYJ A;  4JI0 K;  5FDL A;  4J2A A;  3ZSR A;  4H5R A;  5K14 A;  2QXF A;  3EKS A;  4FJ9 A;  1DKG D;  2JLE A;  3PX6 A;  3P83 D;  1K9M O;  4AQY K;  1QZ6 A;  1TVR A;  3MEC A;  4CF0 A;  1K8K A;  4HTU A;  3NMU A;  4CER A;  2YV0 X;  3U3G A;  3DLE A;  4JI1 K;  5JIC A;  3KJV A;  2HHQ A;  2NRR A;  1CLQ A;  1UWB A;  1J54 A;  3SI6 A;  1W0H A;  2E1Z A;  2Y1I A;  3GG4 A;  1VRT A;  1QSL A;  4JYA K;  4C8N A;  1TAQ A;  4FL9 A;  1RT4 A;  2D0A A;  2WUS A;  2NLX A;  1TKD A;  1TV6 A;  4OPA A;  3L3U A;  1U47 A;  2GUI A;  4WQ5 A;  3BF3 A;  4BR9 A;  3O1W A;  3KTQ A;  4CK1 A;  4BRE A;  3VQP A;  1D4X A;  3W3D A;  4W5N A;  4BR0 A;  3CCS N;  1QSY A;  3DRR A;  2OYQ A;  2WBN A;  3B6P A;  3A5O C;  3AY9 A;  1NK9 A;  4FWS A;  4GVE A;  3CYM A;  4JN4 A;  1ATR A;  2V52 B;  5FRO A;  4DS5 A;  3R8E A;  3OYD A;  3RMC A;  1XNQ K;  2A1S A;  4E7I A;  3S41 A;  3TAF A;  4YOW A;  3MXI A;  3JYT A;  1HNI A;  4KB0 A;  4DTO A;  3O9Q A;  5BPL A;  3TPQ A;  4J2E A;  4MLE A;  1RDC A;  3C6H A;  1TL1 A;  3QLH A;  3PSF A;  4OJR A;  4NCG A;  3M8Q A;  5C0Y A;  4CHN A;  1WOQ A;  4GKJ K;  1JKH A;  3OYM A;  5AQW A;  4DWI A;  4ILH A;  4FW2 A;  1EX4 A;  2FBT A;  2GTD A;  1LAV A;  3ENO A;  2I5J A;  2P9N B;  3PUF A;  4FWR A;  3L2Q A;  4I7F A;  4C1N K;  5ADX A;  3DXM B;  3KZB A;  3HJF A;  2YNH A;  4G1Q A;  1K73 O;  4XEI A;  1XI1 A;  5GAD P;  3L2W A;  1A5V A;  4B9V A;  4JS5 A;  4IDK A;  2VG5 A;  4OKE A;  1XHZ A;  4AH9 A;  3DXK A;  4BRP A;  1BI4 A;  1WBB A;  4CFD A;  1KLN A;  1VQL N;  4KFB A;  1E4F T;  3A8Y A;  3AO4 A;  2UU9 K;  4CEC A;  3WQU A;  2QWN A;  3MX5 A;  1HNZ K;  2HHH K;  2JGU A;  3CCQ N;  3G25 A;  1BIU A;  1WSF A;  3P5J A;  4BE0 A;  4DR7 K;  4DB3 A;  1QSS A;  2KKZ A;  3QB0 A;  2ETJ A;  4K0K K;  4DR2 K;  1UA1 A;  3LP1 A;  4BQZ A;  4BVP A;  3EYZ A;  1S72 N;  1GLB G;  4DTN A;  3GOI A;  1Y97 A;  3DLL L;  3ZSV A;  2HST A;  5AZI A;  1N33 K;  4OGC A;  1TYQ A;  3ZLJ A;  3D2F A;  4CBX A;  5SZT A;  3NAE A;  4FM2 A;  5J2M A;  2IAJ A;  1DTQ A;  3CFP A;  4EP5 A;  5AQQ A;  5FPE A;  3DMJ A;  4BRG A;  4CF8 A;  3MEE A;  1YI2 N;  4Z4F A;  1YIJ N;  4DLE A;  4LD0 A;  3K5M A;  3SQ4 A;  2QKB A;  3BUZ B;  1NMD A;  4C8O A;  4I2Q A;  4DS4 A;  2KFZ A;  3FZH A;  1RTI A;  4M7X A;  3T1H K;  4L3Q A;  3DM2 A;  3AA3 A;  4AHU A;  1OH8 A;  3ZT4 A;  4JHD B;  3RMB A;  3ZX2 A;  4LH5 A;  4CFB A;  2DFF A;  1VAZ A;  3K5N A;  1NG9 A;  1XMO K;  1NGH A;  4F9O A;  5BR9 A;  3CG7 A;  2VWK A;  1BQM A;  2HBJ A;  4YNQ A;  4ISG A;  4OLA A;  4DV6 K;  5D3G A;  3QER A;  4CZH A;  3QNO A;  4BRO A;  4DR6 K;  2DFE A;  1IO2 A;  3OYF A;  4JI5 K;  1Z26 A;  3ATU A;  4LFB K;  4M63 C;  5GIP A;  1NGA A;  4IG3 A;  4CHO A;  1P8Z A;  3IKM A;  3EN9 A;  2HHV A;  3LZI A;  1ZBL A;  2LSN A;  2X78 A;  4CZK A;  1OKJ A;  4MO4 A;  4HHT A;  3H3O B;  5FRN A;  2G8V A;  4WQ4 C;  4KHU A;  2YHB A;  5T7B A;  2YHW A;  4KTW A;  3V9S A;  4IJN A;  4YOY A;  1RDD A;  4IO8 A;  5JS2 A;  2F8T A;  4DQP A;  1C0T A;  1S5J A;  2IS3 A;  4GV3 A;  1S1U A;  3A0I X;  4HWI A;  4O0J A;  4FLV A;  1E3M A;  4QS9 A;  2KZM A;  3OYB A;  4BRN A;  3D7E O;  4YOV A;  3VES A;  4FK2 A;  1ZBU A;  4CJK A;  3LPT A;  4B8C A;  3FZL A;  4OVL A;  3U6F A;  5EOY A;  5J2Q A;  3C7N B;  2IDO A;  1Q86 O;  4K8X A;  2VGM A;  3M8S A;  5BRE A;  4PL7 A;  2E4L A;  3PV8 A;  4YOT A;  4FJN A;  3NBP A;  2R7Y A;  4CK2 A;  1P90 A;  2YHX A;  3J80 O;  3THV A;  3QEV A;  4GNI A;  3OYC A;  5CYQ A;  4CD1 A;  4JKG B;  1WAF A;  3ATV A;  1I39 A;  2P9U A;  3SMS A;  3H6E A;  3VGK A;  5FLX O;  3FZK A;  5LL6 Z;  3T1Y K;  4RG8 A;  4B9M A;  4DLG A;  2ZGZ A;  3HO1 A;  2NRT A;  5M1N A;  3I55 N;  3GBT A;  3CF5 L;  4KI4 A;  4MLH A;  3BZK A;  2UUC K;  3O1B A;  4FZX C;  3WXI A;  4PKI A;  4R79 A;  2XY8 A;  3ZT0 A;  4QAG A;  2F9T A;  3RMA A;  2HW3 A;  4A59 A; 
#chains in the Genus database with same CATH homology
 4GKJ K;  4LFA K;  1XMO K;  4CVN E;  4DR3 K;  4DV2 K;  4B3M K;  4X65 K;  4DR1 K;  4DR5 K;  2ZM6 K;  4OX9 K;  4JI3 K;  1N34 K;  4DV6 K;  5LMU K;  1FJG K;  3JAM O;  4DR4 K;  1IBK K;  4DR6 K;  1HNX K;  4JI0 K;  3J81 O;  4X66 K;  4JI5 K;  5BR8 K;  4CW7 B;  2F4V K;  4LFB K;  2UXB K;  4DUZ K;  5IWA K;  1XNR K;  4GKK K;  4AQY K;  2VQE K;  2E5L K;  4JI2 K;  2UU9 K;  4KHP K;  1IBL K;  3J7A P;  4JI8 K;  4JI1 K;  4JI4 K;  1HNZ K;  1HR0 K;  4DV4 K;  2UXD K;  2HHH K;  4JYA K;  4NXN K;  1N36 K;  4X62 K;  4DV0 K;  3J7Y P;  5A2Q O;  4DR7 K;  4B3S K;  4LF7 K;  2VQF K;  4DV3 K;  5AJ3 K;  4LF6 K;  4K0K K;  4DR2 K;  4DV5 K;  4DUY K;  1N32 K;  4B3T K;  1I94 K;  3OTO K;  4LF5 K;  4NXM K;  1J5E K;  2UUA K;  4V19 S;  1N33 K;  4DV7 K;  4JI7 K;  1HNW K;  4B3R K;  4LF8 K;  5IT9 O;  2UUB K;  1IBM K;  1XMQ K;  3J80 O;  4LF4 K;  4LF9 K;  2UXC K;  5FLX O;  4JV5 K;  5LL6 Z;  3T1Y K;  1XNQ K;  4YY3 K;  2UUC K;  4JI6 K;  4X64 K;  3T1H K;  5LMN K;  4DV1 K;  4YHH K;  4LFC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...