4GKJK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkjK00
5BR8K 3T1YK 1XMOK 1HNZK 2E5LK 4DV7K 2UUBK 5LMUK 2UU9K 3JAMO 4K0KK 4JI3K 2HHHK 4X65K 4DR6K 2UXDK 4DUZK 4GKKK 4GKJK 4JV5K 2VQFK 4DR1K 4JI1K 1XMQK 4LF7K 4LF8K 4JI7K 4NXNK 4JI4K 5IWAK 1IBKK 2VQEK 4DR2K 5A2QO 4JI0K 4DV5K 4B3MK 2UUCK 4B3RK 5AJ3K 5LL6Z 2UUAK 1HNWK 4DR4K 4DV4K 4KHPK 4X64K 3J7AP 1HR0K 3J7YP 4DV1K 1N36K 4JI5K 4DV0K 4JI6K 4V19S 2F4VK 4JI2K 4B3TK 5LMNK 3J80O 4CVNE 3OTOK 4DV2K 4LFAK 4LFBK 1XNQK 1IBMK 4LF4K 1N33K 4DUYK 4LF6K 5FLXO 4NXMK 4LF5K 4YHHK 1HNXK 1IBLK 4DV6K 4X66K 4DR3K 4OX9K 4DR5K 1J5EK 4JYAK 1FJGK 4JI8K 4YY3K 2ZM6K 3T1HK 2UXBK 4B3SK 1N34K 2UXCK 1XNRK 5IT9O 4CW7B 3J81O 4DR7K 4X62K 4AQYK 1I94K 4DV3K 1N32K 4LFCK 4LF9K
chains in the Genus database with same CATH superfamily
3IKMA 3ZX3A 4K43A 3K57A 3KKRA 4HUFA 4OLAA 1REVA 2WBNA 1B9DA 4CHZA 4BRFA 4DQ8A 3MEEA 4W5QA 3OYAA 3V9WA 1NKEA 3TSPA 4CIFA 3RRHA 2OPQA 2JGUA 3HL8A 4H0VB 3D7EO 1BCMA 4Z4GA 3CFOA 5AQHA 1RDBA 4CHNA 4G9ZA 3VEXA 1OH5A 2P9LA 4AILC 2IOCA 4NLCA 3ZSOA 5F0XA 2QWMA 1IO2A 1X1PA 2EWSA 1DEJA 1Z26A 2RE2A 4WQ4A 5AQSA 4H0TB 3NAEA 3O3HA 1YIJN 2G8HA 1RFQA 4IFVA 3S3MA 4I9LA 4BRQA 5F2RA 3VESA 4K25A 4Y0WA 1WAFA 4FLXA 1C1CA 2A42A 1LOTB 4KHUA 3LPTA 4B1VA 5KQ8A 1RTHA 4M41A 1RT5A 1UOCA 4KV8A 3O9RA 2E2PA 4PKIA 3THWA 2VWKA 2PY5A 1HYZA 1D4XA 3EO3A 4NXMK 4N41A 1ITGA 3U9DA 3VF2A 4GV6A 2NLXA 2BTFA 4IFEA 2OPSA 4IDKA 1FJGK 4JKEA 2QXLA 4CGDA 5I42A 1ZBFA 3PIPL 3RMBA 4Q5VA 3R8EA 2G8KA 4LSLA 1QSLA 3CIPA 3SUOA 2Z1IA 4BACA 3VQ6A 5I9EB 1VSJA 2V52B 2WFBA 2KFZA 4FOIA 4DFMA 1S9EA 3O9QA 1U4BA 3HPGA 5BPLA 1L3TA 4DWIA 3HO1A 1S1XA 1XC9A 4JI3K 1T8EA 1VSHA 4J2AA 4JKDA 3KTQA 4CJQA 4CK1A 3SAHA 4PHTX 3CCLN 1WUAA 4AHSA 1KD1O 3V1OA 5FDLA 3THYB 3SJHA 3QEWA 1E3MA 3V81A 3FZKA 4IBNA 3V9UA 4N76A 2VQEK 1SV5A 3H45C 4QS7A 4W5OA 2P9UB 2UUCK 4ELVA 5AQVA 2YHYA 2HNDA 5C42A 2PZSA 3C94A 3MDQA 5JS1A 4Y1DA 2E2QA 4CZLA 1EKEA 4WQ5A 2E88A 3VQ8A 3BDPA 3I8DA 3KLEA 3OJUA 3DLKA 1XC3A 4A57A 3HPOA 2G8IA 4EAHD 4RCHA 1N36K 3QMLA 3MX2A 4CGHA 2Q0UA 1QHTA 3AARA 1Z6RA 3DRSA 4DTSA 1KTQA 3C0BA 4H4MA 5EXWA 3ZSQA 5C10A 1QQCA 4CEOA 4ELTA 2IC3A 4IWVA 2O8FA 3QIOA 4KI4A 3NDKA 4CJFA 3VF6A 3MMVA 2KQ2A 4DKWA 1S6PA 5CZ2A 4CEDA 3C7NB 3DLGA 3O4WA 1L3VA 4JLHA 5B8HA 3SI6A 3O5BA 4KHQA 3CMAN 4YY3K 5CY4A 1C0FA 4AF1A 4OPJA 2AJQA 3L2UA 4DFPA 3A5MC 3DXKA 4E1JA 1EXQA 4M3TA 4AM6A 1ILYA 1YVUA 3DWLA 2E20A 3V4IA 3ENBA 5KQDA 4EP5A 3LAMA 2D0BA 4DTOA 3N4PA 4LC9B 3SNNA 3ATVA 3W3DA 3CCUN 3T69A 3SAFA 2B4JA 5HROA 1WOQA 5DM7L 3OYFA 3OA9A 2GX9A 4GKKK 3AO4A 3KK7A 4BG8A 4JV5K 1L3SA 1RDWX 5AQFA 3EL2A 3FE1A 1Q8IA 2E6LA 1VQKN 3UKRA 2IAJA 4A62A 4JKBA 2YKNA 5AZJB 1DTQA 5A2QO 1QS4A 3O80A 4CHYA 1NGDA 1RNHA 4B8AB 2Y1JA 1V4TA 1RT4A 3PO5A 3UKUB 5AJ3K 1RTJA 2V51B 4BR4A 1VQ5N 4YNQA 1WSFA 3MCAB 2PFUA 1TK5A 1TGOA 3QEPA 1UWBA 4N5SA 3TAGA 3MN5A 3FZLA 5AFUA 4U7BA 1HKGA 4X64K 2W40A 2ZJRL 2GEMA 4DCHA 1DLOA 1CZAN 5M1QA 4BC3A 4AM7A 3OYEA 3WNEA 1S72N 1S1TA 1W2BM 1KC8O 4O5FA 4CZIA 4OO1J 4B9LA 3CETA 4K41A 3WUHA 2XY7A 3DLEA 4KBOA 3P39A 4BDZA 5GAEP 4I6MA 1TK8A 2IVOA 5HBMA 5KTQA 1CXQA 3AO1A 3OYIA 1NK0A 4ELUA 3CCMN 2HF3A 3AO3A 3O9UA 3VERA 1JL1A 4NLBA 3EE8A 3CJ9A 3CCRN 3A2FA 2O8EA 3OYKA 4CJ4A 5C15A 2JLEA 2FBVA 1DKGD 2KZMA 1W97L 3I0SA 4CECA 4DQIA 4ILHA 3SQ1A 4CZHA 4I7FA 4X62K 4CZGA 4ID1A 4IG0A 1WSJA 3ZT2A 4Z4FA 5BN9A 3ZETB 1XMOK 4PKHA 3QFUA 4BDYA 2E5LK 4M3RA 5AQYA 2YNIA 1NMNA 4B08A 2KHOA 1BO5O 1RTDA 4MLEA 1ATNA 3ATUA 5J2MA 4KAZA 3OBWA 4IEIA 2VWJA 2Q97A 2WUSA 4JKGB 1HKCA 3ULEA 4CJLA 3FZHA 4FVUA 2ZD1A 2IGIA 5E26A 2UYTA 1D9DA 4G1QA 4DF4A 2E8AA 5C2FA 3HOTA 5BRHA 2QKKA 1LCUA 1C0GA 1X3NA 4CEQA 1BI4A 2BE2A 1O1WA 4QAGA 3AVKA 3CMEN 2Q2RA 4CERA 3VEZA 3HRGA 4PQUA 4BR2A 4IG3A 4FL9A 3G25A 3DLHA 1VRTA 4KHSA 2KLAA 2NRHA 1KXPA 3ITHA 1TYQA 3SQ2A 3AVHA 1VQ6N 2F96A 4O8UA 3OVNA 1Z25A 1RT2A 3O4NA 1SQKA 3M3ZA 3SQ4A 3V6DA 1VSFA 4HTLA 1J6ZA 1WSIA 2E6MA 2H3GX 2P9NA 1QTMA 5J2PA 1N5YA 4JHDB 1J54A 4CFAA 5BRFA 4CBWA 4CK2A 2Q3SA 4M45A 4BE1A 4EHTA 3G4SN 3TWHA 4DSJA 5LJWA 2GBZA 3QESA 2NRXA 3MWPA 3R3LA 3TAMA 4AHVA 4GVMA 3E66A 3VF4A 2A1RA 3O08A 2E1ZA 2DFFA 4DSIA 4CJ3A 3D2EB 3OYHA 1VQLN 4JKCA 4FWQA 2W6KA 4B1YB 1BGXT 3S41A 2CGLA 1ZBHA 3ZT4A 5BN8A 2P51A 3ZSWA 4AQYK 5EVZA 3MK6A 2QM1A 4A61A 4PUOA 1MA9B 1N32K 4KTWA 3HZ6A 1T7PA 1Z05A 1YF5L 3AA2A 4NCBA 1IH7A 5AQQA 2UUBK 3D2FB 1OVYA 1EWRA 4BY9C 4CHPA 1JLBA 4FZXC 2X6NA 2G8FA 1BIZA 3R9PA 4ILGB 1BHLA 3C65A 3H1QA 3VEVA 1UA1A 2RKIA 2IIRA 2DPNA 3KZBA 4IXCA 4DQSA 1IKYA 1I39A 2HHTA 4BR7A 2OCEA 1NNEA 3MEDA 3KLIA 3W0LA 4FLWA 4XH4A 5LL6Z 1HMVA 2YX6A 3AO2A 1NGIA 4DU4A 5M1PA 4H03B 5FPDA 3LPUA 4OGCA 3JYTA 4IJAA 3DI6A 4CF1A 1KQSM 2D0OA 3SJJA 4KB1A 3VQDA 2YI1A 2Q31A 2FBTA 1RBSA 4CFDA 3K5OA 4CEEA 4EZ9A 1UA0A 1VHXA 3SBTA 3NCIA 3MN7A 4V19S 4CZEA 1TUUA 2ASPA 1SKRA 2P9KA 4JI2K 1RT6A 3K0SA 1XWLA 2VGNA 4RG8A 3WEEB 3KKSA 1SL2A 1CLQA 4DTUA 4LF6K 3O1BA 4CJSA 3WQTA 1HNXK 3SAGA 4FJLA 1S1VA 1S5JA 2VWBA 1Q9XA 3E01A 3PO4A 2NRZA 1N34K 1YTUA 1NM1A 5TKYA 1QVFM 4Z94A 3JS6A 3B6PA 2ZGYA 1QZ6A 5CR4A 1S3XA 3CQ8A 1WNSA 2WTUA 2FBYA 3A0IX 4H5TA 4WF9L 4IOCL 4J2EA 1HNZK 4B8CA 1VQMN 1YJWN 3SMPA 4DU3A 3THXA 4RTFD 4E7JA 1ASVA 4X65K 3LDNA 3HM8A 4FLVA 1Q7YO 3ISNC 5AQRA 4LF7K 3THYA 4CF0A 3LAKA 3CM5A 2QI2A 2GUIA 4CGIA 5GAHP 5HRNA 4DTXA 5TKWA 1SS6A 3LALA 3OYDA 4KTZA 5AQGA 4B1UB 2DY4A 5FPMA 4E7KA 1VSMA 5DM6L 3EY1A 4FWRA 3O9SA 4DTNA 4H5VA 4DV4K 4ILJA 2YJFA 1YT3A 4FOEA 3H3OB 1A5XA 3IDHA 4HVJA 4JI5K 4U67L 3VQCA 5FRMA 3NF6A 4FSVA 4DTPA 3F9MA 3TI0A 4JI6K 1HLUA 3LWMA 4CVNE 3K9KA 2GTDA 4CJRA 3C7NA 4J2BA 5FLXO 4CF9A 3S9HA 3SV4A 3I0RA 2YJEA 3L8BA 4B9UA 3NH2A 4KREA 2HBLA 4NB4A 3M8RA 4IO9L 4L8RB 5AQJA 1V4SA 3LZIA 2OTLN 3QNNA 3D45A 4CJEA 2GWKA 1X9MA 4OKEA 3NVKA 5AQZA 4MLHA 1YITN 3CCVN 4Z4IA 3CG7A 4YOTA 2ZGZA 1MDUB 3AVFA 1Q86O 5BR8K 4HCCA 1CZ9A 2QTDA 2ZWHA 5CYQA 4CCHA 1VQ8N 1EETA 4W5RA 4KPYA 5T7BA 4M3WA 3JAMO 4FJIA 5AQOA 4IZ9A 3T19A 3M6GA 4CHQA 1H1VA 1B9FA 4CJKA 5AQPA 1D9FA 1JLAA 4DR1K 4FJ8A 1EP4A 4PKGA 4ISGA 1IKVA 3EZ5A 4BRMA 3R6MA 4CJ5A 3BZKA 3IUCA 3F73A 4DR2K 4BR0A 3G71N 3LDLA 3WXJA 2ASOA 3UKUA 4DV5K 4E7HA 2FF3B 4KH5A 3BF1A 1IKXA 1NK8A 5BREA 3VOVA 4FM2A 1ESVA 1OKJA 2VCPA 1WB9A 3ALYA 4H5RA 1FK9A 3EYZA 4F3TA 1ZBUA 3P83D 4FYDA 5EU7A 1K8KB 3CC7N 4KKOA 3NF9A 4CJVA 2CGJA 4FLTA 1ZBIA 4K42A 3NH0A 3AV9A 2I7PA 3O3FA 2OZSA 1T3VA 2DFHA 3AVAA 4CBUA 4PY5A 3VA3A 4FJHA 2BH1A 4B1XB 1JLFA 3TAQA 1Y97A 3MCPA 1BUPA 1ZYQA 1NK7A 4IDHA 3AA5X 4IFYA 2D0CA 4EFHA 3O4QA 3J80O 5LMNK 4HHTA 4DB3A 3SUNA 3NF8A 5ADXA 1KLNA 4GY2B 3P1GA 4O0IA 1KCFA 1U2VB 3CJAA 4FM1A 4MO5A 4E0DA 2IVNA 1JCEA 1RILA 5J1EA 1TKTA 3AVLA 3ZX0A 2D0PA 4Z4HA 4B3SK 3HI0A 3VGKA 2CH6A 4CW7B 3CC2N 4DF8A 1HYVA 2QWQA 4FCYA 5AQIA 1QVGM 4WYBA 4JS5A 4BRLA 1TKXA 4MQ3A 2OZMA 4AHRA 3K5LA 3RMDA 2ZE2A 1FXXA 2P9LB 4K8XA 2ZJPL 3O6WA 1XQSC 3O1WA 3E1YA 3H08A 1TV6A 2O4IA 3C6AA 3NGZA 2PAVA 1TKZA 1GLJO 2D1KA 1XMQK 3DXMA 4YORA 4CEFA 1U6ZA 5AQWA 3CHWA 5AQLA 3VQ7A 4E1MA 4FWNA 3QIPA 4R5PA 2I7NA 3VQAA 1JCGA 1Q82O 2AP1A 4YOXA 1KAYA 3ZT0A 5C12A 1WSGA 5HP1A 2ZJQL 2YV0X 4CJPA 1OH6A 4DR4K 4HCBA 1RDUA 3CPWM 1NK9A 4LH4A 3THWB 2O8DA 2A3ZA 4JKAA 1U47A 1XUPO 1VQ9N 3CJ7A 3DOLA 2HW3A 4QS8A 3U3YA 1TL3A 4M7XA 2LSNA 2OPPA 5AQMA 3AA4A 3CI5A 2P9IB 1IKWA 3SYZA 4XH1A 3IRXA 4CZFA 3HM9A 3VGMA 5MLCQ 4BC4A 1VAZA 3G0ZA 2YNFA 1SL1A 4DV2K 3V9ZA 3UIQA 4BG9A 3U8XA 4FVMA 2NZTA 4JK9A 4DLGA 3WXIA 3OHRA 4FLYA 1GOBA 4YHHK 2B5JA 4NO7A 3D2EA 1TKDA 1C6VA 1F21A 1KAXA 2X6SA 5BR9A 3MN9A 3AVMA 3QICA 3L2RA 4JRPA 4B9SA 2Y1IA 5DMRA 3VEWA 1XNRK 1M1KO 3WT0A 3V1RA 4FJXA 3I55N 3CFRA 1HQEA 5LY3A 4DR7K 5JVHL 3OJSA 3QFPA 1YVNA 3ZSXA 4LD0A 3QO9A 4PA1A 2VG6A 1J5OA 3L4QA 1TL1A 5DK5A 3AO5A 4FZZA 3RSEA 2RHKA 4I2PA 3NE6A 4NCGA 2HHXA 3OYGA 3SQ0A 2YNHA 1BQNA 2VG5A 1NG9A 3O9TA 1HUXA 4GW6A 4CJUA 4DMNA 2UU9K 2RN2A 2HHHK 3RTVA 3QNOA 1P90A 2OPRA 2XY6A 3KD1E 1JXBA 3PUFA 3CM6A 3HP6A 1J53A 1A5WA 1RGIA 5JLFA 2YHAA 4AHCA 3CJCA 1T6CA 1NGEA 3MXJA 3TTCA 3QLHA 2YCHA 1HX1A 2HNZA 2QK9A 4CJTA 4OKKA 2PYJA 3OYJA 4CE9A 2X74A 5AR0A 3LANA 3V9XA 2UUAK 2XY5A 4YFUA 4UY8O 3C6TA 1DGKN 4QOZB 1RT3A 2A40A 4GMJB 3VTIA 4FM0A 5FRNA 3PSIA 3KD5E 2O8FB 2KZZA 1RBUA 2HBKA 3J7AP 2QWRA 4JKHA 1T03A 4CF2A 2G8UA 1QQMA 4H5WA 1S1WA 2ITGA 1VQNN 1ZBSA 3KLGA 1VRUA 1KRPA 3DYAA 4Z0UA 3NGIA 2E4LA 5ELZA 3AGKA 4OLBA 2HVIA 4FJ7A 4DFJA 3DXKB 1W0HA 4BR5A 5GAGP 1TK0A 2KTQA 2HHVA 4F9OA 3PLAA 3FR0A 3KJVA 4CI6A 1TAQA 1IBLK 3KWIA 3B6OA 4DR5K 3DRPA 3DM2A 3KWGA 1JL2A 4FLZA 1ASWA 2CH5A 2FXUA 4RW4A 3MXMA 1BOTO 5AZIA 1S6QA 2G8WA 4CJWA 3CJ1A 4Y1CA 4FWOA 3RR8A 4I2QA 3K5MA 2A5XA 4BREA 2Z1JA 3KK1A 4BQLA 2NUBA 1YXQA 4WCEL 3UKRB 2Q1NA 4CIGA 4A2AA 2F8SA 2HBMA 1NJIO 2HHUA 3TTDA 4CFCA 2GELA 1KAZA 3T1YK 4C8KA 4HUEA 1QZ5A 4DFKA 4KFBA 2QXFA 4B9VA 1N6QA 4CFBA 1M90O 3HXMA 4BRDA 2HSTA 4DUZK 3WXLA 4MDBA 1KFSA 4H0YB 5GIOA 1RCHA 3F5TA 4LF8K 1OVQA 1CXUA 4FK0A 3LP3A 4LH5A 3AVIA 3C95A 1NKBA 4WFAL 3ID6A 4HWIA 3SV3A 4JI0K 1CZBA 3M8QA 4BRKA 3KK2A 4C8LA 1T05A 2X78A 3N4QA 1C1AA 3CCSN 3TABA 3T3FA 2XY8A 3EE9A 4W5TA 3WXKA 1QE1A 2QWNA 4CF8A 3ASMA 2BGGA 4BRCA 4DQQA 2O4GA 4PL7A 3TTFA 5EX5A 1GLCG 4JNEA 3FLCO 4C8NA 1E4FT 2YHWA 3KLHA 5GIPA 1SKWA 4HTUA 3LDOA 1DTTA 3Q7CA 5J2NA 4I6MB 4M3UA 3MX5A 4DV1K 1BDGA 2P1JA 1IG8A 4IKFA 1MWKA 3JSMA 3IS9A 4OPAA 5KPZA 4XIUA 3L2WA 1KSPA 4GV3A 4F2SA 1VSIA 3BUZB 2J4RA 1EO1A 1HNVA 4BVPA 3MN6A 1NJZA 4DV0K 5M1NA 3D0PA 2O8EB 4DTJA 5JICA 3DMJA 4AHUA 1YTAA 2V7YA 1R0AA 5EY4A 3OTOK 1XI1A 3KK3A 4BRAA 3HBTA 3L6QA 5KRTA 1BIUA 4LF4K 1N33K 2GWJA 1VSKA 1E4GT 1K8AO 4KH6A 3VQQA 1W7AA 4X66K 3K9JA 3VQBA 1J5EK 3NFAA 1OH8A 3FFKB 4M3YA 4CHOA 3IMXA 3WNHA 4DTRA 5C25A 2I5JA 1JXEA 3MXIA 4KI6A 2E1YA 2KFNA 4IO8A 3HJFA 3ULEB 4LSNA 1VSEA 5M1KA 3AVJA 2D4WA 4QCLA 3DLBA 4DV7K 1C0TA 3I56N 3ZSRA 4DS4A 4K0KK 1S9GA 1YJ9N 4BC2A 2A6AA 4KHYA 1HNIA 2NRVA 3PSFA 1BI4B 1DT9A 4FJGA 3VA0A 2W41A 1NJXA 1Q9YA 3VTHA 4FWSA 5AQKA 1WSHA 4NXNK 4OPHA 1WLJA 1LW2A 2P9PB 5IWAK 3ZEUB 4FJ9A 3AAPA 5FPNA 3ULDA 4RW9A 4O8KA 1ZBLA 2F7TA 3U3GA 2YKMA 5HOOA 4BRPA 1MU2A 1NLVA 4CD1A 4FLUA 1GLDG 3QBXA 3AY9A 2KKZA 2P9NB 1RT1A 3PX0A 4BWJA 2NRTA 3F2KA 2O8CB 1LWCA 3A5LC 4XH5A 3QETA 1TVRA 4OPKA 3HTVA 2FSNA 1LWEA 4DLEA 3TANA 2ATQA 3AVGA 3AA3A 2P9UA 3H1VX 1KVBA 4YOVA 4N47A 3K5NA 4AH9A 4F4KA 1WBBA 1RT7A 1J9AA 2JWLA 2HNYA 3G6EN 1UAXA 5C2DA 5E41A 1GLAG 4M3ZA 1QQOA 3CQXA 4DHYA 3LWLA 5EOYA 1SL0A 3CC4N 4JD2B 1RDCA 1S1UA 1YJNN 4B3TK 4BGBA 3LZJA 1LWFA 3VQ5A 4CIEA 4KH4A 1HJRA 2A41A 1XNQK 1K9MO 1R59O 4M7YA 1IBMK 1SUQA 2FF6A 4DUYK 3M8SA 1W9HA 4O5BA 2ETJA 1T44A 4RW7A 5LJVA 1HPMA 4JYAK 3J8AA 3T1HK 2UXBK 3KLFA 4JS4A 4CESA 1U45A 2Q0RA 4LY7A 2E2NA 5IT9O 2WOMA 4EIAA 4KB0A 2EX3A 4B9QA 3AGRA 3VETA 4ZTJA 4H0OA 3L2VA 4B9NA 4YOUA 1BISA 2PYLA 3VQPA 2HMIA 1VQ7N 3GBTA 3L0QA 1QSSA 4LFCK 1C0MA 1BQMA 4DSEA 3TAFA 3IG1A 3RR7A 4Z4EA 5HLFA 3PIOL 4KTQA 1WN7A 5KGWA 5LMUK 3VEOA 2XRIA 3ZSYA 4BRGA 2FBXA 3DLRA 4JRQA 4DQRA 5SZTA 3EZWA 3AAQA 1ASUA 1X9SA 1YHQN 1Y64A 3ID8A 3P38A 1HYSA 1S22A 1EQYA 2YHXA 2O8BB 1NBWA 2DTUA 3HT3A 4FJJA 3PV8A 3HOSA 2ZF5O 4A5AA 3A5OC 4R79A 3TSUA 3FFIA 3HPHA 4BRHA 3CCJN 5AFUH 2P9KB 5GADP 4I9QA 1ATRA 5AZJA 4MFBA 4IEEA 3P5JA 4B1WB 1HQUA 3U6FA 1JLQA 2BANA 5KGXA 5GINA 2P9IA 4CGGA 4FJKA 2QWOA 2B6AA 5KPTA 3IFRA 1NGGA 5HRSA 3S3OA 4FJMA 4KO0A 4FO0A 4LFBK 2QWLA 1IV0A 4DTMA 1NGBA 1G15A 1GLLO 1BA1A 3JXUA 4FW1A 3CF5L 3L3VA 3KHYA 2BUPA 3S3NA 4FZYA 3THXB 2UXCK 2VGMA 2KW4A 3TAEA 4YOYA 3DAWA 3LM9A 2IS3A 3ZSVA 5K14A 1SKSA 4FJNA 4ISFA 4O0JA 2P9SB 2HHSA 1VSLA 1I94K 3NMUA 4BRNA 1P8ZA 4E3SA 5KPRA 4LF9K 1U49A 5CE3A 2QW9A 4H8KA 3OYCA 2FSJA 1BL3A 4MDAA 3RMCA 3OW2M 1RBTA 3DRRA 4FWPA 2F9WA 4CZJA 3V1QA 4C23A 3LDSA 2VYPA 2AA4A 3E9OA 3NGYA 4JI1K 3CPEA 2HB5A 2DFEA 3WXMB 4GV9A 3QBWA 4JI4K 3ZETA 1WAJA 1NJYA 1IBKK 1KVAA 5CHIA 3LP2A 4BDPA 3ZT1A 4M63C 4EZ6A 4BR9A 5FPEA 3HSTB 2E2OA 3FZMA 5BRDA 1X3MA 1SZ2A 3DLLL 5BPMA 2ITMA 3UE5A 4B9TA 3EKUA 3I33A 3NVMA 1D8YA 4JKGA 2NNWA 1B92A 3QEXA 4IOXA 5M1FA 3ZSZA 4BQZA 2G8VA 3LL3A 4JN4A 4YDUC 5HRRA 1KLMA 1NOYA 4GNIA 2FC0A 5KI6A 4CZKA 5KRSA 3O3GA 4BE2A 2HHQA 2IDOA 3TR8A 3CCEN 1TAUA 1ZXOA 3O8MA 4GVEA 3GE1A 3NF7A 1XHZA 4F8RA 3ZLJA 1MWMA 4CK3A 3NHGA 1BWFO 4OKJA 3MWTA 3GDQA 3MAQA 2GUPA 3L4IA 4EHUA 4E7IA 3CD6N 4HUGA 4DV6K 1L5UA 4WE1A 3V9SA 4OX9K 3Q7BA 1N8RO 1NGAA 2ZM6K 4JHDA 1RBVA 1T6DA 1BU6O 2EHGA 3QDKA 4RW8A 4K8ZA 3C6UA 4WFBL 1JLCA 4DSKA 4JAXA 4B1ZA 3R1XA 3E9PA 1Q18A 1NU0A 4BWMA 3FGUA 5JS2A 4DQPA 1BG3A 1OH7A 3D6RA 3PX4A 3LDQA 3WQUA 2RF2A 1JJ2M 4BRIA 5I3UA 3SK3A 3GG4A 3MECA 4UQGA 3CCQN 1QQNA 3SMSA 4B9MA 4ID5A 4GKJK 2D0AA 1LW0A 1XHXA 5F1XA 4JK8A 4ICLA 1NK5A 4N56A 1U48A 1VQON 3GL1A 1L3UA 1I3AA 3D2FA 1LAVA 5CYMA 5AQUA 3SLCA 4BC5A 4PL8A 1WSEA 3QEVA 4CEBA 1VQ4N 4A59A 4FW2A 1D5AA 3E9LA 3K2PA 2IVPA 4TSXA 1JKHA 5AQNA 2XHBA 1IG9A 4FPBA 2HMPA 3VENA 3F9KA 1LAWA 3I8BA 4KHPK 4C8OA 4OGEA 2A1SA 1HR0K 3P31A 3UB5A 3J7YP 4NCAA 3QINA 2WONA 3KIOA 1JCFA 3OS0A 3ZX2A 2OYQA 4AHTA 4A2BA 4F2RA 4YOWA 4CZMA 3RMAA 4WQ4C 1X9JA 3KVGA 3OYLA 4FK2A 2W6LA 2Z1HA 3WNGA 4DU1A 1TUYA 4EP4A 3ZCMA 1EWQA 3C6HA 3TARA 3LM2A 3M5RA 4L3QA 3BP8A 1ZC6A 5J2QA 4FWMA 5JMVA 3QERA 3SBGA 3VMFB 4JI8K 1BA0A 4O4GA 2HOEA 1FKOA 4BROA 3HSCA 2WC9A 3OS1A 3SUPA 3J81O 2GV9A 4PWDA 4FK4A 5CZ1A 4CEZA 3WEEA 1GOCA 3OY9A 5BPNA 3VQ9A 4RW6A 3DXMB 4J2DA 3J7ZO 2CGKA 1NK6A 1NJWA 3HK2A 1QSYA 1FW6A 4KHWA 1VK0A 2FSKA 1HRHA 4FWKA 5M1OA 4CGJA 4ISEA 3BZCA 4FPAA 2QEXN 1WBDA 4O55A 1IJJA 1K6YA 3ENOA 4DR6K 2UXDK 3CJBA 2P5GA 3PX6A 2OTJN 2D5RA 1VQPN 3WNFA 3SPYA 3ENHA 2JWKA 3BEXA 4JI7K 2P9PA 3ZEUA 3AVCA 2ASMA 1RTIA 1NWKA 3G10A 4C8MA 3A8YA 2O8DB 1JLGA 1X9WA 4C1NK 2V7ZA 4B3MK 3CFPA 3HYFA 2FLOA 1HPZA 2O8CA 1GLBG 4JEPA 2W42A 2R7YA 1NGCA 1QHAA 4IJNA 3RRGA 3GOIA 1HNWK 2QKBA 2BDPA 4M42A 2QWPA 3T1AA 5JVGL 1RDAA 1A5VA 1KVCA 4E89A 3QEIA 1GLFO 3TPQA 3H6EA 1NMDA 4FJ5A 4RWTA 3EEQA 1FKPA 2P5OA 4JD2A 3B8AX 3HVTA 4DS5A 3THVA 2F4VK 1K73O 3QB0A 3CYMA 4WQ5C 4DG1A 1YAGA 3RWUA 2HF4A 3VQ4A 3K59A 3HVRA 3ZYYX 3H3NO 4LF5K 3BY5A 3RSEB 3FZFA 1NGJA 4DR3K 1NKCA 1SAZA 1GOAA 3VEYA 3SUQA 4CGFA 3EKSA 5D3GA 4J8FA 3DOKA 4Z4CA 2PBDA 4F3OA 5JLHA 4KHNA 4BE0A 2OANA 2QA4N 4OJRA 5AQXA 3VGLA 1U04A 4BGAA 4CBXA 4ZTFA 4C1NI 1YUWA 4H5NA 3H46O 3IAYA 4DSLA 3MEGA 1YI2N 4FXDA 2HBJA 4JKFA 3K58A 5AQTA 5SWMA 2OA8A 3LDPA 4CEAA 4IOAL 1RBRA 3TAPA 1RDDA 4M3XA 1BCOA 3NBPA 2NRRA 3HP9A 5E84A 3T7ZA 4O44A 1NGHA 2VQFK 5HL7L 2O8BA 3OS2A 3VPZA 1Q81O 3OBYA 1JLEA 1HJOA 4NYFA 3ZT3A 1EX4A 5C24A 3L3UA 3DJCA 2XO7A 2RPIA 4H4OA 4YDUA 3VN5A 4B3RK 4A5BA 4XEIA 3OYMA 3U9ZA 5C0YA 1NGFA 1VSDA 4H0XB 3M8PA 3SCXA 1HKBA 4E7LA 4E1NA 3BGRA 3RVCA 4E19A 1LV5A 1NK4A 1NOZA 3LP1A 4NYNA 3CXCM 2HVHA 3M1FA 4CJ7A 3TSQA 4KRFA 4FWLA 3VQEA 3LP0A 1O13A 2YHBA 1TYQB 2YNGA 2ZQBA 4CD3A 2VG7A 3A5NC 3AVNA 5H1SQ 2HHWA 3L2QA 3OYNA 5AZIB 1K8KA 4OVLA 5HRPA 4QS9A 3TU5A 3U4LA 4LFAK 3SPZA 1C1BA 3OYBA 2F9TA 3CERA 5ADXH 4JK7A 2F8TA 3BF3A 3CQYA 1C0UA 4H0PA 2Q36A 2Z1GA 4W5NA 1ATSA 3P4IA 1KFDA 4Q0BA 2P9SA 4MO4A 1GLEG 2NRWA 1G99A 3PY8A 3SZ2A 4BVOA 3EN9A 1U2VA 4WFNL 4DV3K 4ZHRA 3NH1A 3AVBA 4DSFA 4B3OA 5FROA
chains in the Genus database with same CATH topology
5BR8K 3T1YK 1XMOK 1HNZK 2E5LK 4DV7K 2UUBK 5LMUK 2UU9K 3JAMO 4K0KK 4JI3K 2HHHK 4X65K 4DR6K 2UXDK 4DUZK 4GKKK 4GKJK 4JV5K 2VQFK 4DR1K 4JI1K 1XMQK 4LF7K 4LF8K 4JI7K 4NXNK 4JI4K 5IWAK 1IBKK 2VQEK 4DR2K 5A2QO 4JI0K 4DV5K 4B3MK 2UUCK 4B3RK 5AJ3K 5LL6Z 2UUAK 1HNWK 4DR4K 4DV4K 4KHPK 4X64K 3J7AP 1HR0K 3J7YP 4DV1K 1N36K 4JI5K 4DV0K 4JI6K 4V19S 2F4VK 4JI2K 4B3TK 5LMNK 3J80O 4CVNE 3OTOK 4DV2K 4LFAK 4LFBK 1XNQK 1IBMK 4LF4K 1N33K 4DUYK 4LF6K 5FLXO 4NXMK 4LF5K 4YHHK 1HNXK 1IBLK 4DV6K 4X66K 4DR3K 4OX9K 4DR5K 1J5EK 4JYAK 1FJGK 4JI8K 4YY3K 2ZM6K 3T1HK 2UXBK 4B3SK 1N34K 2UXCK 1XNRK 5IT9O 4CW7B 3J81O 4DR7K 4X62K 4AQYK 1I94K 4DV3K 1N32K 4LFCK 4LF9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 K;  3T1Y K;  1XMO K;  1HNZ K;  2E5L K;  4DV7 K;  2UUB K;  5LMU K;  2UU9 K;  3JAM O;  4K0K K;  4JI3 K;  2HHH K;  4X65 K;  4DR6 K;  2UXD K;  4DUZ K;  4GKK K;  4GKJ K;  4JV5 K;  2VQF K;  4DR1 K;  4JI1 K;  1XMQ K;  4LF7 K;  4LF8 K;  4JI7 K;  4NXN K;  4JI4 K;  5IWA K;  1IBK K;  2VQE K;  4DR2 K;  5A2Q O;  4JI0 K;  4DV5 K;  4B3M K;  2UUC K;  4B3R K;  5AJ3 K;  5LL6 Z;  2UUA K;  1HNW K;  4DR4 K;  4DV4 K;  4KHP K;  4X64 K;  3J7A P;  1HR0 K;  3J7Y P;  4DV1 K;  1N36 K;  4JI5 K;  4DV0 K;  4JI6 K;  4V19 S;  2F4V K;  4JI2 K;  4B3T K;  5LMN K;  3J80 O;  4CVN E;  3OTO K;  4DV2 K;  4LFA K;  4LFB K;  1XNQ K;  1IBM K;  4LF4 K;  1N33 K;  4DUY K;  4LF6 K;  5FLX O;  4NXM K;  4LF5 K;  4YHH K;  1HNX K;  1IBL K;  4DV6 K;  4X66 K;  4DR3 K;  4OX9 K;  4DR5 K;  1J5E K;  4JYA K;  1FJG K;  4JI8 K;  4YY3 K;  2ZM6 K;  3T1H K;  2UXB K;  4B3S K;  1N34 K;  2UXC K;  1XNR K;  5IT9 O;  4CW7 B;  3J81 O;  4DR7 K;  4X62 K;  4AQY K;  1I94 K;  4DV3 K;  1N32 K;  4LFC K;  4LF9 K; 
#chains in the Genus database with same CATH topology
 3IKM A;  3ZX3 A;  4K43 A;  3K57 A;  3KKR A;  4HUF A;  4OLA A;  1REV A;  2WBN A;  1B9D A;  4CHZ A;  4BRF A;  4DQ8 A;  3MEE A;  4W5Q A;  3OYA A;  3V9W A;  1NKE A;  3TSP A;  4CIF A;  3RRH A;  2OPQ A;  2JGU A;  3HL8 A;  4H0V B;  3D7E O;  1BCM A;  4Z4G A;  3CFO A;  5AQH A;  1RDB A;  4CHN A;  4G9Z A;  3VEX A;  1OH5 A;  2P9L A;  4AIL C;  2IOC A;  4NLC A;  3ZSO A;  5F0X A;  2QWM A;  1IO2 A;  1X1P A;  2EWS A;  1DEJ A;  1Z26 A;  2RE2 A;  4WQ4 A;  5AQS A;  4H0T B;  3NAE A;  3O3H A;  1YIJ N;  2G8H A;  1RFQ A;  4IFV A;  3S3M A;  4I9L A;  4BRQ A;  5F2R A;  3VES A;  4K25 A;  4Y0W A;  1WAF A;  4FLX A;  1C1C A;  2A42 A;  1LOT B;  4KHU A;  3LPT A;  4B1V A;  5KQ8 A;  1RTH A;  4M41 A;  1RT5 A;  1UOC A;  4KV8 A;  3O9R A;  2E2P A;  4PKI A;  3THW A;  2VWK A;  2PY5 A;  1HYZ A;  1D4X A;  3EO3 A;  4NXM K;  4N41 A;  1ITG A;  3U9D A;  3VF2 A;  4GV6 A;  2NLX A;  2BTF A;  4IFE A;  2OPS A;  4IDK A;  1FJG K;  4JKE A;  2QXL A;  4CGD A;  5I42 A;  1ZBF A;  3PIP L;  3RMB A;  4Q5V A;  3R8E A;  2G8K A;  4LSL A;  1QSL A;  3CIP A;  3SUO A;  2Z1I A;  4BAC A;  3VQ6 A;  5I9E B;  1VSJ A;  2V52 B;  2WFB A;  2KFZ A;  4FOI A;  4DFM A;  1S9E A;  3O9Q A;  1U4B A;  3HPG A;  5BPL A;  1L3T A;  4DWI A;  3HO1 A;  1S1X A;  1XC9 A;  4JI3 K;  1T8E A;  1VSH A;  4J2A A;  4JKD A;  3KTQ A;  4CJQ A;  4CK1 A;  3SAH A;  4PHT X;  3CCL N;  1WUA A;  4AHS A;  1KD1 O;  3V1O A;  5FDL A;  3THY B;  3SJH A;  3QEW A;  1E3M A;  3V81 A;  3FZK A;  4IBN A;  3V9U A;  4N76 A;  2VQE K;  1SV5 A;  3H45 C;  4QS7 A;  4W5O A;  2P9U B;  2UUC K;  4ELV A;  5AQV A;  2YHY A;  2HND A;  5C42 A;  2PZS A;  3C94 A;  3MDQ A;  5JS1 A;  4Y1D A;  2E2Q A;  4CZL A;  1EKE A;  4WQ5 A;  2E88 A;  3VQ8 A;  3BDP A;  3I8D A;  3KLE A;  3OJU A;  3DLK A;  1XC3 A;  4A57 A;  3HPO A;  2G8I A;  4EAH D;  4RCH A;  1N36 K;  3QML A;  3MX2 A;  4CGH A;  2Q0U A;  1QHT A;  3AAR A;  1Z6R A;  3DRS A;  4DTS A;  1KTQ A;  3C0B A;  4H4M A;  5EXW A;  3ZSQ A;  5C10 A;  1QQC A;  4CEO A;  4ELT A;  2IC3 A;  4IWV A;  2O8F A;  3QIO A;  4KI4 A;  3NDK A;  4CJF A;  3VF6 A;  3MMV A;  2KQ2 A;  4DKW A;  1S6P A;  5CZ2 A;  4CED A;  3C7N B;  3DLG A;  3O4W A;  1L3V A;  4JLH A;  5B8H A;  3SI6 A;  3O5B A;  4KHQ A;  3CMA N;  4YY3 K;  5CY4 A;  1C0F A;  4AF1 A;  4OPJ A;  2AJQ A;  3L2U A;  4DFP A;  3A5M C;  3DXK A;  4E1J A;  1EXQ A;  4M3T A;  4AM6 A;  1ILY A;  1YVU A;  3DWL A;  2E20 A;  3V4I A;  3ENB A;  5KQD A;  4EP5 A;  3LAM A;  2D0B A;  4DTO A;  3N4P A;  4LC9 B;  3SNN A;  3ATV A;  3W3D A;  3CCU N;  3T69 A;  3SAF A;  2B4J A;  5HRO A;  1WOQ A;  5DM7 L;  3OYF A;  3OA9 A;  2GX9 A;  4GKK K;  3AO4 A;  3KK7 A;  4BG8 A;  4JV5 K;  1L3S A;  1RDW X;  5AQF A;  3EL2 A;  3FE1 A;  1Q8I A;  2E6L A;  1VQK N;  3UKR A;  2IAJ A;  4A62 A;  4JKB A;  2YKN A;  5AZJ B;  1DTQ A;  5A2Q O;  1QS4 A;  3O80 A;  4CHY A;  1NGD A;  1RNH A;  4B8A B;  2Y1J A;  1V4T A;  1RT4 A;  3PO5 A;  3UKU B;  5AJ3 K;  1RTJ A;  2V51 B;  4BR4 A;  1VQ5 N;  4YNQ A;  1WSF A;  3MCA B;  2PFU A;  1TK5 A;  1TGO A;  3QEP A;  1UWB A;  4N5S A;  3TAG A;  3MN5 A;  3FZL A;  5AFU A;  4U7B A;  1HKG A;  4X64 K;  2W40 A;  2ZJR L;  2GEM A;  4DCH A;  1DLO A;  1CZA N;  5M1Q A;  4BC3 A;  4AM7 A;  3OYE A;  3WNE A;  1S72 N;  1S1T A;  1W2B M;  1KC8 O;  4O5F A;  4CZI A;  4OO1 J;  4B9L A;  3CET A;  4K41 A;  3WUH A;  2XY7 A;  3DLE A;  4KBO A;  3P39 A;  4BDZ A;  5GAE P;  4I6M A;  1TK8 A;  2IVO A;  5HBM A;  5KTQ A;  1CXQ A;  3AO1 A;  3OYI A;  1NK0 A;  4ELU A;  3CCM N;  2HF3 A;  3AO3 A;  3O9U A;  3VER A;  1JL1 A;  4NLB A;  3EE8 A;  3CJ9 A;  3CCR N;  3A2F A;  2O8E A;  3OYK A;  4CJ4 A;  5C15 A;  2JLE A;  2FBV A;  1DKG D;  2KZM A;  1W97 L;  3I0S A;  4CEC A;  4DQI A;  4ILH A;  3SQ1 A;  4CZH A;  4I7F A;  4X62 K;  4CZG A;  4ID1 A;  4IG0 A;  1WSJ A;  3ZT2 A;  4Z4F A;  5BN9 A;  3ZET B;  1XMO K;  4PKH A;  3QFU A;  4BDY A;  2E5L K;  4M3R A;  5AQY A;  2YNI A;  1NMN A;  4B08 A;  2KHO A;  1BO5 O;  1RTD A;  4MLE A;  1ATN A;  3ATU A;  5J2M A;  4KAZ A;  3OBW A;  4IEI A;  2VWJ A;  2Q97 A;  2WUS A;  4JKG B;  1HKC A;  3ULE A;  4CJL A;  3FZH A;  4FVU A;  2ZD1 A;  2IGI A;  5E26 A;  2UYT A;  1D9D A;  4G1Q A;  4DF4 A;  2E8A A;  5C2F A;  3HOT A;  5BRH A;  2QKK A;  1LCU A;  1C0G A;  1X3N A;  4CEQ A;  1BI4 A;  2BE2 A;  1O1W A;  4QAG A;  3AVK A;  3CME N;  2Q2R A;  4CER A;  3VEZ A;  3HRG A;  4PQU A;  4BR2 A;  4IG3 A;  4FL9 A;  3G25 A;  3DLH A;  1VRT A;  4KHS A;  2KLA A;  2NRH A;  1KXP A;  3ITH A;  1TYQ A;  3SQ2 A;  3AVH A;  1VQ6 N;  2F96 A;  4O8U A;  3OVN A;  1Z25 A;  1RT2 A;  3O4N A;  1SQK A;  3M3Z A;  3SQ4 A;  3V6D A;  1VSF A;  4HTL A;  1J6Z A;  1WSI A;  2E6M A;  2H3G X;  2P9N A;  1QTM A;  5J2P A;  1N5Y A;  4JHD B;  1J54 A;  4CFA A;  5BRF A;  4CBW A;  4CK2 A;  2Q3S A;  4M45 A;  4BE1 A;  4EHT A;  3G4S N;  3TWH A;  4DSJ A;  5LJW A;  2GBZ A;  3QES A;  2NRX A;  3MWP A;  3R3L A;  3TAM A;  4AHV A;  4GVM A;  3E66 A;  3VF4 A;  2A1R A;  3O08 A;  2E1Z A;  2DFF A;  4DSI A;  4CJ3 A;  3D2E B;  3OYH A;  1VQL N;  4JKC A;  4FWQ A;  2W6K A;  4B1Y B;  1BGX T;  3S41 A;  2CGL A;  1ZBH A;  3ZT4 A;  5BN8 A;  2P51 A;  3ZSW A;  4AQY K;  5EVZ A;  3MK6 A;  2QM1 A;  4A61 A;  4PUO A;  1MA9 B;  1N32 K;  4KTW A;  3HZ6 A;  1T7P A;  1Z05 A;  1YF5 L;  3AA2 A;  4NCB A;  1IH7 A;  5AQQ A;  2UUB K;  3D2F B;  1OVY A;  1EWR A;  4BY9 C;  4CHP A;  1JLB A;  4FZX C;  2X6N A;  2G8F A;  1BIZ A;  3R9P A;  4ILG B;  1BHL A;  3C65 A;  3H1Q A;  3VEV A;  1UA1 A;  2RKI A;  2IIR A;  2DPN A;  3KZB A;  4IXC A;  4DQS A;  1IKY A;  1I39 A;  2HHT A;  4BR7 A;  2OCE A;  1NNE A;  3MED A;  3KLI A;  3W0L A;  4FLW A;  4XH4 A;  5LL6 Z;  1HMV A;  2YX6 A;  3AO2 A;  1NGI A;  4DU4 A;  5M1P A;  4H03 B;  5FPD A;  3LPU A;  4OGC A;  3JYT A;  4IJA A;  3DI6 A;  4CF1 A;  1KQS M;  2D0O A;  3SJJ A;  4KB1 A;  3VQD A;  2YI1 A;  2Q31 A;  2FBT A;  1RBS A;  4CFD A;  3K5O A;  4CEE A;  4EZ9 A;  1UA0 A;  1VHX A;  3SBT A;  3NCI A;  3MN7 A;  4V19 S;  4CZE A;  1TUU A;  2ASP A;  1SKR A;  2P9K A;  4JI2 K;  1RT6 A;  3K0S A;  1XWL A;  2VGN A;  4RG8 A;  3WEE B;  3KKS A;  1SL2 A;  1CLQ A;  4DTU A;  4LF6 K;  3O1B A;  4CJS A;  3WQT A;  1HNX K;  3SAG A;  4FJL A;  1S1V A;  1S5J A;  2VWB A;  1Q9X A;  3E01 A;  3PO4 A;  2NRZ A;  1N34 K;  1YTU A;  1NM1 A;  5TKY A;  1QVF M;  4Z94 A;  3JS6 A;  3B6P A;  2ZGY A;  1QZ6 A;  5CR4 A;  1S3X A;  3CQ8 A;  1WNS A;  2WTU A;  2FBY A;  3A0I X;  4H5T A;  4WF9 L;  4IOC L;  4J2E A;  1HNZ K;  4B8C A;  1VQM N;  1YJW N;  3SMP A;  4DU3 A;  3THX A;  4RTF D;  4E7J A;  1ASV A;  4X65 K;  3LDN A;  3HM8 A;  4FLV A;  1Q7Y O;  3ISN C;  5AQR A;  4LF7 K;  3THY A;  4CF0 A;  3LAK A;  3CM5 A;  2QI2 A;  2GUI A;  4CGI A;  5GAH P;  5HRN A;  4DTX A;  5TKW A;  1SS6 A;  3LAL A;  3OYD A;  4KTZ A;  5AQG A;  4B1U B;  2DY4 A;  5FPM A;  4E7K A;  1VSM A;  5DM6 L;  3EY1 A;  4FWR A;  3O9S A;  4DTN A;  4H5V A;  4DV4 K;  4ILJ A;  2YJF A;  1YT3 A;  4FOE A;  3H3O B;  1A5X A;  3IDH A;  4HVJ A;  4JI5 K;  4U67 L;  3VQC A;  5FRM A;  3NF6 A;  4FSV A;  4DTP A;  3F9M A;  3TI0 A;  4JI6 K;  1HLU A;  3LWM A;  4CVN E;  3K9K A;  2GTD A;  4CJR A;  3C7N A;  4J2B A;  5FLX O;  4CF9 A;  3S9H A;  3SV4 A;  3I0R A;  2YJE A;  3L8B A;  4B9U A;  3NH2 A;  4KRE A;  2HBL A;  4NB4 A;  3M8R A;  4IO9 L;  4L8R B;  5AQJ A;  1V4S A;  3LZI A;  2OTL N;  3QNN A;  3D45 A;  4CJE A;  2GWK A;  1X9M A;  4OKE A;  3NVK A;  5AQZ A;  4MLH A;  1YIT N;  3CCV N;  4Z4I A;  3CG7 A;  4YOT A;  2ZGZ A;  1MDU B;  3AVF A;  1Q86 O;  5BR8 K;  4HCC A;  1CZ9 A;  2QTD A;  2ZWH A;  5CYQ A;  4CCH A;  1VQ8 N;  1EET A;  4W5R A;  4KPY A;  5T7B A;  4M3W A;  3JAM O;  4FJI A;  5AQO A;  4IZ9 A;  3T19 A;  3M6G A;  4CHQ A;  1H1V A;  1B9F A;  4CJK A;  5AQP A;  1D9F A;  1JLA A;  4DR1 K;  4FJ8 A;  1EP4 A;  4PKG A;  4ISG A;  1IKV A;  3EZ5 A;  4BRM A;  3R6M A;  4CJ5 A;  3BZK A;  3IUC A;  3F73 A;  4DR2 K;  4BR0 A;  3G71 N;  3LDL A;  3WXJ A;  2ASO A;  3UKU A;  4DV5 K;  4E7H A;  2FF3 B;  4KH5 A;  3BF1 A;  1IKX A;  1NK8 A;  5BRE A;  3VOV A;  4FM2 A;  1ESV A;  1OKJ A;  2VCP A;  1WB9 A;  3ALY A;  4H5R A;  1FK9 A;  3EYZ A;  4F3T A;  1ZBU A;  3P83 D;  4FYD A;  5EU7 A;  1K8K B;  3CC7 N;  4KKO A;  3NF9 A;  4CJV A;  2CGJ A;  4FLT A;  1ZBI A;  4K42 A;  3NH0 A;  3AV9 A;  2I7P A;  3O3F A;  2OZS A;  1T3V A;  2DFH A;  3AVA A;  4CBU A;  4PY5 A;  3VA3 A;  4FJH A;  2BH1 A;  4B1X B;  1JLF A;  3TAQ A;  1Y97 A;  3MCP A;  1BUP A;  1ZYQ A;  1NK7 A;  4IDH A;  3AA5 X;  4IFY A;  2D0C A;  4EFH A;  3O4Q A;  3J80 O;  5LMN K;  4HHT A;  4DB3 A;  3SUN A;  3NF8 A;  5ADX A;  1KLN A;  4GY2 B;  3P1G A;  4O0I A;  1KCF A;  1U2V B;  3CJA A;  4FM1 A;  4MO5 A;  4E0D A;  2IVN A;  1JCE A;  1RIL A;  5J1E A;  1TKT A;  3AVL A;  3ZX0 A;  2D0P A;  4Z4H A;  4B3S K;  3HI0 A;  3VGK A;  2CH6 A;  4CW7 B;  3CC2 N;  4DF8 A;  1HYV A;  2QWQ A;  4FCY A;  5AQI A;  1QVG M;  4WYB A;  4JS5 A;  4BRL A;  1TKX A;  4MQ3 A;  2OZM A;  4AHR A;  3K5L A;  3RMD A;  2ZE2 A;  1FXX A;  2P9L B;  4K8X A;  2ZJP L;  3O6W A;  1XQS C;  3O1W A;  3E1Y A;  3H08 A;  1TV6 A;  2O4I A;  3C6A A;  3NGZ A;  2PAV A;  1TKZ A;  1GLJ O;  2D1K A;  1XMQ K;  3DXM A;  4YOR A;  4CEF A;  1U6Z A;  5AQW A;  3CHW A;  5AQL A;  3VQ7 A;  4E1M A;  4FWN A;  3QIP A;  4R5P A;  2I7N A;  3VQA A;  1JCG A;  1Q82 O;  2AP1 A;  4YOX A;  1KAY A;  3ZT0 A;  5C12 A;  1WSG A;  5HP1 A;  2ZJQ L;  2YV0 X;  4CJP A;  1OH6 A;  4DR4 K;  4HCB A;  1RDU A;  3CPW M;  1NK9 A;  4LH4 A;  3THW B;  2O8D A;  2A3Z A;  4JKA A;  1U47 A;  1XUP O;  1VQ9 N;  3CJ7 A;  3DOL A;  2HW3 A;  4QS8 A;  3U3Y A;  1TL3 A;  4M7X A;  2LSN A;  2OPP A;  5AQM A;  3AA4 A;  3CI5 A;  2P9I B;  1IKW A;  3SYZ A;  4XH1 A;  3IRX A;  4CZF A;  3HM9 A;  3VGM A;  5MLC Q;  4BC4 A;  1VAZ A;  3G0Z A;  2YNF A;  1SL1 A;  4DV2 K;  3V9Z A;  3UIQ A;  4BG9 A;  3U8X A;  4FVM A;  2NZT A;  4JK9 A;  4DLG A;  3WXI A;  3OHR A;  4FLY A;  1GOB A;  4YHH K;  2B5J A;  4NO7 A;  3D2E A;  1TKD A;  1C6V A;  1F21 A;  1KAX A;  2X6S A;  5BR9 A;  3MN9 A;  3AVM A;  3QIC A;  3L2R A;  4JRP A;  4B9S A;  2Y1I A;  5DMR A;  3VEW A;  1XNR K;  1M1K O;  3WT0 A;  3V1R A;  4FJX A;  3I55 N;  3CFR A;  1HQE A;  5LY3 A;  4DR7 K;  5JVH L;  3OJS A;  3QFP A;  1YVN A;  3ZSX A;  4LD0 A;  3QO9 A;  4PA1 A;  2VG6 A;  1J5O A;  3L4Q A;  1TL1 A;  5DK5 A;  3AO5 A;  4FZZ A;  3RSE A;  2RHK A;  4I2P A;  3NE6 A;  4NCG A;  2HHX A;  3OYG A;  3SQ0 A;  2YNH A;  1BQN A;  2VG5 A;  1NG9 A;  3O9T A;  1HUX A;  4GW6 A;  4CJU A;  4DMN A;  2UU9 K;  2RN2 A;  2HHH K;  3RTV A;  3QNO A;  1P90 A;  2OPR A;  2XY6 A;  3KD1 E;  1JXB A;  3PUF A;  3CM6 A;  3HP6 A;  1J53 A;  1A5W A;  1RGI A;  5JLF A;  2YHA A;  4AHC A;  3CJC A;  1T6C A;  1NGE A;  3MXJ A;  3TTC A;  3QLH A;  2YCH A;  1HX1 A;  2HNZ A;  2QK9 A;  4CJT A;  4OKK A;  2PYJ A;  3OYJ A;  4CE9 A;  2X74 A;  5AR0 A;  3LAN A;  3V9X A;  2UUA K;  2XY5 A;  4YFU A;  4UY8 O;  3C6T A;  1DGK N;  4QOZ B;  1RT3 A;  2A40 A;  4GMJ B;  3VTI A;  4FM0 A;  5FRN A;  3PSI A;  3KD5 E;  2O8F B;  2KZZ A;  1RBU A;  2HBK A;  3J7A P;  2QWR A;  4JKH A;  1T03 A;  4CF2 A;  2G8U A;  1QQM A;  4H5W A;  1S1W A;  2ITG A;  1VQN N;  1ZBS A;  3KLG A;  1VRU A;  1KRP A;  3DYA A;  4Z0U A;  3NGI A;  2E4L A;  5ELZ A;  3AGK A;  4OLB A;  2HVI A;  4FJ7 A;  4DFJ A;  3DXK B;  1W0H A;  4BR5 A;  5GAG P;  1TK0 A;  2KTQ A;  2HHV A;  4F9O A;  3PLA A;  3FR0 A;  3KJV A;  4CI6 A;  1TAQ A;  1IBL K;  3KWI A;  3B6O A;  4DR5 K;  3DRP A;  3DM2 A;  3KWG A;  1JL2 A;  4FLZ A;  1ASW A;  2CH5 A;  2FXU A;  4RW4 A;  3MXM A;  1BOT O;  5AZI A;  1S6Q A;  2G8W A;  4CJW A;  3CJ1 A;  4Y1C A;  4FWO A;  3RR8 A;  4I2Q A;  3K5M A;  2A5X A;  4BRE A;  2Z1J A;  3KK1 A;  4BQL A;  2NUB A;  1YXQ A;  4WCE L;  3UKR B;  2Q1N A;  4CIG A;  4A2A A;  2F8S A;  2HBM A;  1NJI O;  2HHU A;  3TTD A;  4CFC A;  2GEL A;  1KAZ A;  3T1Y K;  4C8K A;  4HUE A;  1QZ5 A;  4DFK A;  4KFB A;  2QXF A;  4B9V A;  1N6Q A;  4CFB A;  1M90 O;  3HXM A;  4BRD A;  2HST A;  4DUZ K;  3WXL A;  4MDB A;  1KFS A;  4H0Y B;  5GIO A;  1RCH A;  3F5T A;  4LF8 K;  1OVQ A;  1CXU A;  4FK0 A;  3LP3 A;  4LH5 A;  3AVI A;  3C95 A;  1NKB A;  4WFA L;  3ID6 A;  4HWI A;  3SV3 A;  4JI0 K;  1CZB A;  3M8Q A;  4BRK A;  3KK2 A;  4C8L A;  1T05 A;  2X78 A;  3N4Q A;  1C1A A;  3CCS N;  3TAB A;  3T3F A;  2XY8 A;  3EE9 A;  4W5T A;  3WXK A;  1QE1 A;  2QWN A;  4CF8 A;  3ASM A;  2BGG A;  4BRC A;  4DQQ A;  2O4G A;  4PL7 A;  3TTF A;  5EX5 A;  1GLC G;  4JNE A;  3FLC O;  4C8N A;  1E4F T;  2YHW A;  3KLH A;  5GIP A;  1SKW A;  4HTU A;  3LDO A;  1DTT A;  3Q7C A;  5J2N A;  4I6M B;  4M3U A;  3MX5 A;  4DV1 K;  1BDG A;  2P1J A;  1IG8 A;  4IKF A;  1MWK A;  3JSM A;  3IS9 A;  4OPA A;  5KPZ A;  4XIU A;  3L2W A;  1KSP A;  4GV3 A;  4F2S A;  1VSI A;  3BUZ B;  2J4R A;  1EO1 A;  1HNV A;  4BVP A;  3MN6 A;  1NJZ A;  4DV0 K;  5M1N A;  3D0P A;  2O8E B;  4DTJ A;  5JIC A;  3DMJ A;  4AHU A;  1YTA A;  2V7Y A;  1R0A A;  5EY4 A;  3OTO K;  1XI1 A;  3KK3 A;  4BRA A;  3HBT A;  3L6Q A;  5KRT A;  1BIU A;  4LF4 K;  1N33 K;  2GWJ A;  1VSK A;  1E4G T;  1K8A O;  4KH6 A;  3VQQ A;  1W7A A;  4X66 K;  3K9J A;  3VQB A;  1J5E K;  3NFA A;  1OH8 A;  3FFK B;  4M3Y A;  4CHO A;  3IMX A;  3WNH A;  4DTR A;  5C25 A;  2I5J A;  1JXE A;  3MXI A;  4KI6 A;  2E1Y A;  2KFN A;  4IO8 A;  3HJF A;  3ULE B;  4LSN A;  1VSE A;  5M1K A;  3AVJ A;  2D4W A;  4QCL A;  3DLB A;  4DV7 K;  1C0T A;  3I56 N;  3ZSR A;  4DS4 A;  4K0K K;  1S9G A;  1YJ9 N;  4BC2 A;  2A6A A;  4KHY A;  1HNI A;  2NRV A;  3PSF A;  1BI4 B;  1DT9 A;  4FJG A;  3VA0 A;  2W41 A;  1NJX A;  1Q9Y A;  3VTH A;  4FWS A;  5AQK A;  1WSH A;  4NXN K;  4OPH A;  1WLJ A;  1LW2 A;  2P9P B;  5IWA K;  3ZEU B;  4FJ9 A;  3AAP A;  5FPN A;  3ULD A;  4RW9 A;  4O8K A;  1ZBL A;  2F7T A;  3U3G A;  2YKM A;  5HOO A;  4BRP A;  1MU2 A;  1NLV A;  4CD1 A;  4FLU A;  1GLD G;  3QBX A;  3AY9 A;  2KKZ A;  2P9N B;  1RT1 A;  3PX0 A;  4BWJ A;  2NRT A;  3F2K A;  2O8C B;  1LWC A;  3A5L C;  4XH5 A;  3QET A;  1TVR A;  4OPK A;  3HTV A;  2FSN A;  1LWE A;  4DLE A;  3TAN A;  2ATQ A;  3AVG A;  3AA3 A;  2P9U A;  3H1V X;  1KVB A;  4YOV A;  4N47 A;  3K5N A;  4AH9 A;  4F4K A;  1WBB A;  1RT7 A;  1J9A A;  2JWL A;  2HNY A;  3G6E N;  1UAX A;  5C2D A;  5E41 A;  1GLA G;  4M3Z A;  1QQO A;  3CQX A;  4DHY A;  3LWL A;  5EOY A;  1SL0 A;  3CC4 N;  4JD2 B;  1RDC A;  1S1U A;  1YJN N;  4B3T K;  4BGB A;  3LZJ A;  1LWF A;  3VQ5 A;  4CIE A;  4KH4 A;  1HJR A;  2A41 A;  1XNQ K;  1K9M O;  1R59 O;  4M7Y A;  1IBM K;  1SUQ A;  2FF6 A;  4DUY K;  3M8S A;  1W9H A;  4O5B A;  2ETJ A;  1T44 A;  4RW7 A;  5LJV A;  1HPM A;  4JYA K;  3J8A A;  3T1H K;  2UXB K;  3KLF A;  4JS4 A;  4CES A;  1U45 A;  2Q0R A;  4LY7 A;  2E2N A;  5IT9 O;  2WOM A;  4EIA A;  4KB0 A;  2EX3 A;  4B9Q A;  3AGR A;  3VET A;  4ZTJ A;  4H0O A;  3L2V A;  4B9N A;  4YOU A;  1BIS A;  2PYL A;  3VQP A;  2HMI A;  1VQ7 N;  3GBT A;  3L0Q A;  1QSS A;  4LFC K;  1C0M A;  1BQM A;  4DSE A;  3TAF A;  3IG1 A;  3RR7 A;  4Z4E A;  5HLF A;  3PIO L;  4KTQ A;  1WN7 A;  5KGW A;  5LMU K;  3VEO A;  2XRI A;  3ZSY A;  4BRG A;  2FBX A;  3DLR A;  4JRQ A;  4DQR A;  5SZT A;  3EZW A;  3AAQ A;  1ASU A;  1X9S A;  1YHQ N;  1Y64 A;  3ID8 A;  3P38 A;  1HYS A;  1S22 A;  1EQY A;  2YHX A;  2O8B B;  1NBW A;  2DTU A;  3HT3 A;  4FJJ A;  3PV8 A;  3HOS A;  2ZF5 O;  4A5A A;  3A5O C;  4R79 A;  3TSU A;  3FFI A;  3HPH A;  4BRH A;  3CCJ N;  5AFU H;  2P9K B;  5GAD P;  4I9Q A;  1ATR A;  5AZJ A;  4MFB A;  4IEE A;  3P5J A;  4B1W B;  1HQU A;  3U6F A;  1JLQ A;  2BAN A;  5KGX A;  5GIN A;  2P9I A;  4CGG A;  4FJK A;  2QWO A;  2B6A A;  5KPT A;  3IFR A;  1NGG A;  5HRS A;  3S3O A;  4FJM A;  4KO0 A;  4FO0 A;  4LFB K;  2QWL A;  1IV0 A;  4DTM A;  1NGB A;  1G15 A;  1GLL O;  1BA1 A;  3JXU A;  4FW1 A;  3CF5 L;  3L3V A;  3KHY A;  2BUP A;  3S3N A;  4FZY A;  3THX B;  2UXC K;  2VGM A;  2KW4 A;  3TAE A;  4YOY A;  3DAW A;  3LM9 A;  2IS3 A;  3ZSV A;  5K14 A;  1SKS A;  4FJN A;  4ISF A;  4O0J A;  2P9S B;  2HHS A;  1VSL A;  1I94 K;  3NMU A;  4BRN A;  1P8Z A;  4E3S A;  5KPR A;  4LF9 K;  1U49 A;  5CE3 A;  2QW9 A;  4H8K A;  3OYC A;  2FSJ A;  1BL3 A;  4MDA A;  3RMC A;  3OW2 M;  1RBT A;  3DRR A;  4FWP A;  2F9W A;  4CZJ A;  3V1Q A;  4C23 A;  3LDS A;  2VYP A;  2AA4 A;  3E9O A;  3NGY A;  4JI1 K;  3CPE A;  2HB5 A;  2DFE A;  3WXM B;  4GV9 A;  3QBW A;  4JI4 K;  3ZET A;  1WAJ A;  1NJY A;  1IBK K;  1KVA A;  5CHI A;  3LP2 A;  4BDP A;  3ZT1 A;  4M63 C;  4EZ6 A;  4BR9 A;  5FPE A;  3HST B;  2E2O A;  3FZM A;  5BRD A;  1X3M A;  1SZ2 A;  3DLL L;  5BPM A;  2ITM A;  3UE5 A;  4B9T A;  3EKU A;  3I33 A;  3NVM A;  1D8Y A;  4JKG A;  2NNW A;  1B92 A;  3QEX A;  4IOX A;  5M1F A;  3ZSZ A;  4BQZ A;  2G8V A;  3LL3 A;  4JN4 A;  4YDU C;  5HRR A;  1KLM A;  1NOY A;  4GNI A;  2FC0 A;  5KI6 A;  4CZK A;  5KRS A;  3O3G A;  4BE2 A;  2HHQ A;  2IDO A;  3TR8 A;  3CCE N;  1TAU A;  1ZXO A;  3O8M A;  4GVE A;  3GE1 A;  3NF7 A;  1XHZ A;  4F8R A;  3ZLJ A;  1MWM A;  4CK3 A;  3NHG A;  1BWF O;  4OKJ A;  3MWT A;  3GDQ A;  3MAQ A;  2GUP A;  3L4I A;  4EHU A;  4E7I A;  3CD6 N;  4HUG A;  4DV6 K;  1L5U A;  4WE1 A;  3V9S A;  4OX9 K;  3Q7B A;  1N8R O;  1NGA A;  2ZM6 K;  4JHD A;  1RBV A;  1T6D A;  1BU6 O;  2EHG A;  3QDK A;  4RW8 A;  4K8Z A;  3C6U A;  4WFB L;  1JLC A;  4DSK A;  4JAX A;  4B1Z A;  3R1X A;  3E9P A;  1Q18 A;  1NU0 A;  4BWM A;  3FGU A;  5JS2 A;  4DQP A;  1BG3 A;  1OH7 A;  3D6R A;  3PX4 A;  3LDQ A;  3WQU A;  2RF2 A;  1JJ2 M;  4BRI A;  5I3U A;  3SK3 A;  3GG4 A;  3MEC A;  4UQG A;  3CCQ N;  1QQN A;  3SMS A;  4B9M A;  4ID5 A;  4GKJ K;  2D0A A;  1LW0 A;  1XHX A;  5F1X A;  4JK8 A;  4ICL A;  1NK5 A;  4N56 A;  1U48 A;  1VQO N;  3GL1 A;  1L3U A;  1I3A A;  3D2F A;  1LAV A;  5CYM A;  5AQU A;  3SLC A;  4BC5 A;  4PL8 A;  1WSE A;  3QEV A;  4CEB A;  1VQ4 N;  4A59 A;  4FW2 A;  1D5A A;  3E9L A;  3K2P A;  2IVP A;  4TSX A;  1JKH A;  5AQN A;  2XHB A;  1IG9 A;  4FPB A;  2HMP A;  3VEN A;  3F9K A;  1LAW A;  3I8B A;  4KHP K;  4C8O A;  4OGE A;  2A1S A;  1HR0 K;  3P31 A;  3UB5 A;  3J7Y P;  4NCA A;  3QIN A;  2WON A;  3KIO A;  1JCF A;  3OS0 A;  3ZX2 A;  2OYQ A;  4AHT A;  4A2B A;  4F2R A;  4YOW A;  4CZM A;  3RMA A;  4WQ4 C;  1X9J A;  3KVG A;  3OYL A;  4FK2 A;  2W6L A;  2Z1H A;  3WNG A;  4DU1 A;  1TUY A;  4EP4 A;  3ZCM A;  1EWQ A;  3C6H A;  3TAR A;  3LM2 A;  3M5R A;  4L3Q A;  3BP8 A;  1ZC6 A;  5J2Q A;  4FWM A;  5JMV A;  3QER A;  3SBG A;  3VMF B;  4JI8 K;  1BA0 A;  4O4G A;  2HOE A;  1FKO A;  4BRO A;  3HSC A;  2WC9 A;  3OS1 A;  3SUP A;  3J81 O;  2GV9 A;  4PWD A;  4FK4 A;  5CZ1 A;  4CEZ A;  3WEE A;  1GOC A;  3OY9 A;  5BPN A;  3VQ9 A;  4RW6 A;  3DXM B;  4J2D A;  3J7Z O;  2CGK A;  1NK6 A;  1NJW A;  3HK2 A;  1QSY A;  1FW6 A;  4KHW A;  1VK0 A;  2FSK A;  1HRH A;  4FWK A;  5M1O A;  4CGJ A;  4ISE A;  3BZC A;  4FPA A;  2QEX N;  1WBD A;  4O55 A;  1IJJ A;  1K6Y A;  3ENO A;  4DR6 K;  2UXD K;  3CJB A;  2P5G A;  3PX6 A;  2OTJ N;  2D5R A;  1VQP N;  3WNF A;  3SPY A;  3ENH A;  2JWK A;  3BEX A;  4JI7 K;  2P9P A;  3ZEU A;  3AVC A;  2ASM A;  1RTI A;  1NWK A;  3G10 A;  4C8M A;  3A8Y A;  2O8D B;  1JLG A;  1X9W A;  4C1N K;  2V7Z A;  4B3M K;  3CFP A;  3HYF A;  2FLO A;  1HPZ A;  2O8C A;  1GLB G;  4JEP A;  2W42 A;  2R7Y A;  1NGC A;  1QHA A;  4IJN A;  3RRG A;  3GOI A;  1HNW K;  2QKB A;  2BDP A;  4M42 A;  2QWP A;  3T1A A;  5JVG L;  1RDA A;  1A5V A;  1KVC A;  4E89 A;  3QEI A;  1GLF O;  3TPQ A;  3H6E A;  1NMD A;  4FJ5 A;  4RWT A;  3EEQ A;  1FKP A;  2P5O A;  4JD2 A;  3B8A X;  3HVT A;  4DS5 A;  3THV A;  2F4V K;  1K73 O;  3QB0 A;  3CYM A;  4WQ5 C;  4DG1 A;  1YAG A;  3RWU A;  2HF4 A;  3VQ4 A;  3K59 A;  3HVR A;  3ZYY X;  3H3N O;  4LF5 K;  3BY5 A;  3RSE B;  3FZF A;  1NGJ A;  4DR3 K;  1NKC A;  1SAZ A;  1GOA A;  3VEY A;  3SUQ A;  4CGF A;  3EKS A;  5D3G A;  4J8F A;  3DOK A;  4Z4C A;  2PBD A;  4F3O A;  5JLH A;  4KHN A;  4BE0 A;  2OAN A;  2QA4 N;  4OJR A;  5AQX A;  3VGL A;  1U04 A;  4BGA A;  4CBX A;  4ZTF A;  4C1N I;  1YUW A;  4H5N A;  3H46 O;  3IAY A;  4DSL A;  3MEG A;  1YI2 N;  4FXD A;  2HBJ A;  4JKF A;  3K58 A;  5AQT A;  5SWM A;  2OA8 A;  3LDP A;  4CEA A;  4IOA L;  1RBR A;  3TAP A;  1RDD A;  4M3X A;  1BCO A;  3NBP A;  2NRR A;  3HP9 A;  5E84 A;  3T7Z A;  4O44 A;  1NGH A;  2VQF K;  5HL7 L;  2O8B A;  3OS2 A;  3VPZ A;  1Q81 O;  3OBY A;  1JLE A;  1HJO A;  4NYF A;  3ZT3 A;  1EX4 A;  5C24 A;  3L3U A;  3DJC A;  2XO7 A;  2RPI A;  4H4O A;  4YDU A;  3VN5 A;  4B3R K;  4A5B A;  4XEI A;  3OYM A;  3U9Z A;  5C0Y A;  1NGF A;  1VSD A;  4H0X B;  3M8P A;  3SCX A;  1HKB A;  4E7L A;  4E1N A;  3BGR A;  3RVC A;  4E19 A;  1LV5 A;  1NK4 A;  1NOZ A;  3LP1 A;  4NYN A;  3CXC M;  2HVH A;  3M1F A;  4CJ7 A;  3TSQ A;  4KRF A;  4FWL A;  3VQE A;  3LP0 A;  1O13 A;  2YHB A;  1TYQ B;  2YNG A;  2ZQB A;  4CD3 A;  2VG7 A;  3A5N C;  3AVN A;  5H1S Q;  2HHW A;  3L2Q A;  3OYN A;  5AZI B;  1K8K A;  4OVL A;  5HRP A;  4QS9 A;  3TU5 A;  3U4L A;  4LFA K;  3SPZ A;  1C1B A;  3OYB A;  2F9T A;  3CER A;  5ADX H;  4JK7 A;  2F8T A;  3BF3 A;  3CQY A;  1C0U A;  4H0P A;  2Q36 A;  2Z1G A;  4W5N A;  1ATS A;  3P4I A;  1KFD A;  4Q0B A;  2P9S A;  4MO4 A;  1GLE G;  2NRW A;  1G99 A;  3PY8 A;  3SZ2 A;  4BVO A;  3EN9 A;  1U2V A;  4WFN L;  4DV3 K;  4ZHR A;  3NH1 A;  3AVB A;  4DSF A;  4B3O A;  5FRO A; 
#chains in the Genus database with same CATH homology
 5BR8 K;  3T1Y K;  1XMO K;  1HNZ K;  2E5L K;  4DV7 K;  2UUB K;  5LMU K;  2UU9 K;  3JAM O;  4K0K K;  4JI3 K;  2HHH K;  4X65 K;  4DR6 K;  2UXD K;  4DUZ K;  4GKK K;  4GKJ K;  4JV5 K;  2VQF K;  4DR1 K;  4JI1 K;  1XMQ K;  4LF7 K;  4LF8 K;  4JI7 K;  4NXN K;  4JI4 K;  5IWA K;  1IBK K;  2VQE K;  4DR2 K;  5A2Q O;  4JI0 K;  4DV5 K;  4B3M K;  2UUC K;  4B3R K;  5AJ3 K;  5LL6 Z;  2UUA K;  1HNW K;  4DR4 K;  4DV4 K;  4KHP K;  4X64 K;  3J7A P;  1HR0 K;  3J7Y P;  4DV1 K;  1N36 K;  4JI5 K;  4DV0 K;  4JI6 K;  4V19 S;  2F4V K;  4JI2 K;  4B3T K;  5LMN K;  3J80 O;  4CVN E;  3OTO K;  4DV2 K;  4LFA K;  4LFB K;  1XNQ K;  1IBM K;  4LF4 K;  1N33 K;  4DUY K;  4LF6 K;  5FLX O;  4NXM K;  4LF5 K;  4YHH K;  1HNX K;  1IBL K;  4DV6 K;  4X66 K;  4DR3 K;  4OX9 K;  4DR5 K;  1J5E K;  4JYA K;  1FJG K;  4JI8 K;  4YY3 K;  2ZM6 K;  3T1H K;  2UXB K;  4B3S K;  1N34 K;  2UXC K;  1XNR K;  5IT9 O;  4CW7 B;  3J81 O;  4DR7 K;  4X62 K;  4AQY K;  1I94 K;  4DV3 K;  1N32 K;  4LFC K;  4LF9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...