4GKJK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkjK00
4CVNE 5LMUK 4AQYK 4DR6K 1HNXK 4X66K 4DV7K 3T1HK 5FLXO 4X64K 4K0KK 4DR3K 3J81O 4NXMK 4OX9K 1XNQK 3T1YK 4DR1K 3JAMO 4JI8K 4DR5K 4CW7B 4LF5K 4LF9K 4JI6K 4LFAK 1FJGK 1IBMK 4DR7K 1N34K 1J5EK 1XMQK 4LFBK 2E5LK 4DR4K 4B3RK 3J80O 4X65K 4YHHK 4JI1K 1HNZK 2ZM6K 2UUAK 4JI3K 1IBLK 4DUYK 4LF7K 1N32K 4DV0K 4V19S 2F4VK 1XMOK 2UXCK 5LL6Z 4GKJK 4B3SK 4JI4K 3J7AP 4DR2K 2UU9K 5A2QO 4JYAK 2UUBK 4X62K 1IBKK 1I94K 4JI5K 2UUCK 4LF8K 5BR8K 5IT9O 4DV5K 4JV5K 1HR0K 4NXNK 2HHHK 1N36K 4LF6K 3OTOK 2UXDK 4JI0K 5LMNK 4JI2K 4DUZK 4LFCK 4JI7K 2VQEK 1N33K 4DV6K 5IWAK 4YY3K 4KHPK 4B3TK 4GKKK 5AJ3K 1HNWK 4B3MK 3J7YP 4DV1K 4DV4K 2UXBK 4LF4K 1XNRK 4DV3K 4DV2K 2VQFK
chains in the Genus database with same CATH superfamily
1QHAA 4CFBA 3AY9A 3NGYA 3AO3A 1X3NA 4DF4A 3L0QA 3AVCA 4DKWA 4CJPA 3CQ8A 5FPMA 4X64K 3K9JA 5AQPA 3GL1A 3L4IA 4BQLA 4OX9K 1H1VA 4GV6A 4DR1K 1RT1A 1WOQA 2ZJRL 3OYDA 1B9DA 2F8TA 3D45A 4YOYA 4CJ5A 3ITHA 3VQ4A 1U6ZA 2YJFA 4RW4A 2GELA 1S6QA 3L2QA 1C0TA 4N56A 1GLLO 2I7PA 3EKUA 3LM9A 2E5LK 2NUBA 4EHTA 3K5LA 1L3VA 1DTQA 3FFKB 4Z4IA 4XEIA 4I6MB 4B3RK 1HKBA 3HM9A 3TAFA 4FWQA 2A41A 4BROA 3Q7CA 4JN4A 3OYLA 4H4MA 1RDUA 4Z4GA 1LW0A 1Q86O 3QEXA 1RBRA 1ZBSA 3PV8A 4KFBA 1HJOA 2ASOA 1LWFA 4WQ5A 2D0OA 2YNIA 5KTQA 4CHQA 1V4TA 3OYIA 4IEEA 4BRPA 2IS3A 4IFVA 5BPMA 3EKSA 4C1NK 1FKOA 2LSNA 1X9WA 1VQLN 4W5TA 5KI6A 4CJ3A 4F3TA 2HHHK 1E4FT 2ATQA 1EP4A 1TK0A 3BZCA 3MWPA 4CEZA 4CI6A 4BGAA 3HL8A 5JMVA 3ZSYA 4DFJA 1U47A 3WXIA 2HHUA 3KTQA 3BGRA 1Q7YO 2FF6A 2GX9A 1RBSA 4J2EA 4IBNA 2F8SA 3MECA 3KK3A 4DTPA 1JL2A 2RHKA 5JICA 4OPAA 3HPOA 2XO7A 3ENOA 1G15A 3FE1A 3LP1A 2CGLA 4X66K 3MDQA 4YOWA 5BRFA 3CFOA 4OVLA 3KLHA 1VK0A 1IG8A 3G71N 4B9VA 3MEGA 3DLHA 2VG6A 2X74A 4IG0A 4CBXA 4NLCA 3MXMA 4W5OA 4OKJA 5AQNA 2UYTA 1N8RO 4JI8K 5C2DA 4CHPA 3H3OB 4LF5K 1NJZA 5DK5A 5EOYA 3H6EA 3M1FA 2FSNA 2D1KA 4JLHA 1JCGA 2P9IA 4IXCA 2P5OA 4KTQA 1T3VA 4Y0WA 2PFUA 4RW8A 4FPBA 1S1WA 3R6MA 3QEIA 1RFQA 4PUOA 1HUXA 5FRMA 4AF1A 1DLOA 3VA0A 1BQMA 3H1VX 2UXCK 5JLHA 3O4WA 5LL6Z 3C6UA 3LPUA 4B1YB 3ASMA 4J2DA 3E1YA 1QHTA 4ILJA 3P1GA 2WC9A 3PO5A 4KB1A 2O8FA 3LALA 4JYAK 2QTDA 1OVYA 2DFFA 2GTDA 2IDOA 5LY3A 4JK7A 3VMFB 4FJIA 1Q82O 1NJWA 3K58A 3VEVA 5AQRA 4BC3A 3VQCA 4M42A 3KLEA 3WEEB 4FJGA 3CCMN 4IEIA 5ADXH 2P9KA 4FWRA 4CF1A 4JI7K 4Q5VA 1QVGM 4IKFA 1LCUA 3WXKA 4KAZA 2YHBA 1BO5O 1TKZA 3V1OA 3CFPA 1FXXA 3FFIA 2DPNA 4Q0BA 1A5WA 4DV2K 3CYMA 1HNVA 4J2BA 1P8ZA 4CEDA 4EFHA 1C0UA 4OO1J 4JKGA 2FLOA 2P9SB 3E9LA 4AQYK 3F5TA 4OKEA 4U67L 3MN9A 4MQ3A 1BUPA 4FJMA 1TKXA 1WSJA 3C0BA 3V81A 2IC3A 3O4NA 2P9LB 5KGWA 1JLCA 1E3MA 4NCBA 4BDYA 4B8CA 3QEPA 2P9NA 1TGOA 2NZTA 3VQAA 2FBVA 3V9XA 3AA4A 4LSLA 5TKYA 1D9DA 3QNOA 5SZTA 4LF9K 3HVTA 1IBMK 2YCHA 1S1TA 1N34K 2QWMA 5I9EB 1KRPA 1A5VA 4M41A 3TAGA 1W97L 3L2RA 1S6PA 4KI6A 4EAHD 4QS8A 3S3MA 4RW6A 4BREA 3DYAA 4BRKA 3CCVN 4GVEA 1OH5A 3ULEA 4XIUA 3ZT3A 4AH9A 4DV0K 1KLMA 1NKEA 2F4VK 2CGKA 3H45C 3CCEN 5FDLA 1IKVA 4F2SA 5KPRA 3U9DA 4JD2A 3Q7BA 3OJUA 4UY8O 3NF8A 1NU0A 5AQFA 5JS1A 2UU9K 1QQMA 1Z26A 3WT0A 5A2QO 3M8RA 4ILGB 3SYZA 1YF5L 3AVJA 2I7NA 3V9SA 4PQUA 3SAHA 5HBMA 3NF9A 2QXFA 3MWTA 2V7ZA 2KFZA 4B9QA 3OYHA 3ZSRA 4DSIA 3SK3A 5J2MA 3TI0A 5CZ1A 1SKRA 4QS9A 3BY5A 1NK9A 4R5PA 3VETA 4NLBA 4CK2A 2A5XA 3NMUA 4M3YA 5AFUH 4AHTA 1GLEG 3BDPA 1WLJA 3RSEA 5EVZA 4C1NI 4B9MA 4H5RA 2PAVA 5HROA 1TYQB 1SL1A 1N5YA 3K57A 1KTQA 1O13A 3DXKB 1HNXK 4E7KA 4KREA 4EHUA 4XH5A 3K5NA 5HLFA 1YUWA 3DRPA 4BE1A 2Q31A 4ZTJA 2ZQBA 4FO0A 5SWMA 3AVLA 2JGUA 3WNEA 2D0CA 3DLLL 3PSIA 4BRFA 3QLHA 1RTJA 3ZSWA 1Q81O 4CD1A 2G8WA 3V9UA 2BE2A 4BC2A 3VERA 3TAMA 4G1QA 1LWCA 1BWFO 1Q18A 2O4GA 3TABA 4K8ZA 2D4WA 1Q8IA 4JI6K 4LFAK 4DQPA 3S3NA 1FJGK 3TSQA 3O6WA 4H0XB 3MCPA 4B08A 3RR8A 1BHLA 3OS1A 1WBBA 4FLYA 4DMNA 4BRQA 3LP0A 1RTHA 1V4SA 5KPZA 1NGAA 2OPPA 4FJ7A 4FJJA 4NCAA 4Z94A 3ZT2A 4JI3K 3OY9A 5AQSA 1XI1A 4YDUC 1TAQA 2HNDA 3ZX0A 2ZGYA 3I0SA 4NYNA 3SQ1A 5AQMA 2YKNA 3DRSA 3KK7A 3AO1A 4H5WA 3VF6A 3MXJA 4FWPA 4FWMA 2UUCK 5GIPA 1J54A 2W42A 4AHUA 2HBLA 3IUCA 3WNFA 3KLGA 3QFUA 5CY4A 3MN6A 1VSIA 1S1VA 3CG7A 1JL1A 4OGEA 3CCJN 1MWMA 1HX1A 1OVQA 2WFBA 3G0ZA 1SL0A 4JS5A 5AQHA 4DUZK 3V9ZA 1VAZA 4FOIA 3CJBA 4DLEA 2HB5A 4CF9A 3E9OA 1JCEA 1RDAA 5LJVA 4C8OA 3H3NO 4A2AA 4OJRA 4BRDA 4PA1A 5KQ8A 3C95A 4BR7A 3HXMA 1YI2N 5E41A 4KV8A 3NVKA 3QESA 4B9SA 1C6VA 5B8HA 3ULDA 5FROA 4B8AB 5DM6L 3ZT4A 1JLEA 3THVA 3SUOA 1VQ5N 3AVHA 3DI6A 3O9QA 2QEXN 1ASWA 4GVMA 4CF8A 4GV9A 1UAXA 4ELUA 2E2QA 5FLXO 2O4IA 3CJAA 3CM6A 4O0IA 4RW7A 3QO9A 4NXMK 4DTSA 2HNZA 4IOXA 3V1RA 3PUFA 3P4IA 2WUSA 2P51A 4KRFA 1XUPO 4CF0A 4CJUA 3CJ1A 3LDLA 4FJHA 4GNIA 4FWOA 1UA0A 3ZT1A 4CZEA 3TSUA 4IFEA 2ITGA 4Y1DA 2QKBA 2KZZA 3OBYA 5M1NA 4CHYA 4AILC 1N6QA 5AR0A 2ZWHA 1QZ5A 1X9MA 3UKUA 5AZIB 3OYKA 3THWB 1HYZA 2DY4A 3HSTB 4W5QA 3DXMA 4DTNA 2I5JA 3KZBA 4FPAA 3CJCA 3QBXA 5HRPA 2ASPA 4DWIA 2O8BB 3AVNA 3GBTA 4KPYA 3QICA 3MXIA 3U3GA 2HW3A 2RF2A 3HVRA 4H5NA 5BPLA 3OYBA 2P9PB 4M63C 2E6MA 5FPNA 4LH5A 4DHYA 3ZEUB 3OYJA 3BF3A 3SCXA 2O8CA 1IV0A 1S3XA 1EO1A 2VWBA 2RPIA 4B3OA 3PY8A 5LJWA 2F7TA 1NK5A 5KGXA 2E2OA 4DSKA 1QQNA 1MDUB 3QINA 2OPQA 5C12A 3C65A 3AVAA 4CJRA 2FBYA 1ZBFA 4CZFA 2UXBK 3DOKA 4DTOA 2X78A 1D8YA 2PZSA 1NWKA 4Z4HA 4KTZA 1KAZA 4B1XB 4FLXA 4FZZA 3HP6A 3THYA 4KHQA 3QFPA 1IKXA 3D2EB 3GE1A 3F73A 1WSEA 3SUPA 2HSTA 1YXQA 2HHTA 5JVGL 5M1KA 4Z4EA 3UE5A 4A5AA 5AQYA 4CEEA 4DS5A 1J9AA 2NLXA 4JKFA 3SBTA 3OS2A 1R0AA 2O8EA 4YFUA 3AGKA 4JAXA 2Q3SA 3O9RA 4BRHA 2IAJA 2HF3A 3K5OA 4EZ9A 1VQ8N 1RGIA 3LDPA 2QWPA 5MLCQ 5AZJB 4LC9B 2E4LA 2HOEA 3HYFA 2CH6A 3IS9A 1REVA 4OPHA 2QWQA 1KAYA 4CEQA 3DM2A 3RRGA 4QCLA 4O0JA 4BRLA 4E0DA 3QNNA 1D5AA 1BL3A 4NO7A 1TVRA 4FZXC 2NRXA 2BDPA 3EEQA 3AVIA 2DFHA 4B3SK 1LWEA 4AHVA 4BVOA 4E7HA 4FWNA 4YOVA 2BANA 3D6RA 4ISGA 4RWTA 4CECA 3HPHA 5CR4A 3LZIA 4O8KA 4JEPA 1XC9A 3RVCA 3LP2A 4LF8K 3WUHA 5EXWA 2QI2A 3M8QA 1QVFM 4DTRA 1VQ9N 3AA3A 1VQKN 1CZAN 3O8MA 1M90O 1NOYA 4KHWA 2RKIA 4BC4A 3ZCMA 3A5OC 2W40A 3CJ9A 4CJEA 4N47A 1LAVA 4WFNL 4DQQA 4B9LA 2VQEK 4EIAA 4DB3A 3FZMA 1I39A 4IWVA 3UKRA 3V1QA 1VQ4N 4KH4A 4Z4FA 3QMLA 2YNGA 5KRTA 3FLCO 3W3DA 4I9LA 4DFKA 4B3MK 1NLVA 2Q0RA 2Q2RA 4BG8A 4CE9A 1L5UA 3B6OA 3H1QA 3IG1A 1NK6A 2HHSA 3P5JA 4IFYA 3QBWA 3C94A 3ATUA 4CGIA 3I56N 1CXUA 4DTUA 1LAWA 3K9KA 4CFDA 3T19A 1RT2A 3GOIA 3SZ2A 1X9SA 1HLUA 5JVHL 1E4GT 1YTUA 1U49A 1XHXA 3TR8A 1WBDA 3A5MC 3H46O 4HUGA 4HWIA 4I9QA 3N4QA 3S9HA 2XHBA 1RT6A 3L8BA 3BEXA 2V52B 3C6HA 3FZLA 4BG9A 1RBUA 3IDHA 3VQDA 4A59A 2OCEA 4CFAA 3CMEN 4B1ZA 5BRDA 3P83D 1SKWA 2QWOA 1R59O 3SUNA 1RCHA 4YHHK 1YITN 2HF4A 2ZGZA 2YJEA 4FJKA 3TAEA 1ILYA 2UUAK 5CZ2A 2P9IB 1F21A 1VSHA 2AP1A 2HHXA 1C1BA 4V19S 3CCRN 3L2UA 2XY7A 2HBJA 4BRNA 4QS7A 4GY2B 4DQ8A 4F3OA 2P1JA 3CERA 4FL9A 3VEZA 1L3UA 3CMAN 1NNEA 3E9PA 3QDKA 2Z1JA 4M3UA 3C6TA 1TL3A 4YOXA 1IBKK 1K8KA 3CETA 4DSJA 4CJKA 4BE0A 4CZGA 4JHDA 3F9KA 2O8FB 4L3QA 4EP4A 1ITGA 2JWKA 4LH4A 4F2RA 3ZETA 1RT5A 3OS0A 4MLEA 1U48A 4DU3A 3ENBA 2HHVA 3ZSXA 4BR5A 3RMBA 3O3HA 4O4GA 2R7YA 1QSSA 4KHPK 3WNGA 2HMPA 4CF2A 1VSJA 2H3GX 2P9KB 4GKKK 2VGNA 2BTFA 1LW2A 3U3YA 4RTFD 3PIOL 3AA2A 3KKRA 4FK0A 1C0FA 3I8BA 3VQ5A 4EZ6A 1NGJA 5C25A 1VSMA 2GUIA 4WCEL 4CD3A 3P38A 4DSEA 1NJIO 3LZJA 2KKZA 4CIGA 4XH1A 2B4JA 1DT9A 2W41A 4BDZA 5AQVA 4JKGB 5AQZA 5AQLA 4WFAL 3RRHA 4DR3K 4IG3A 4HCBA 3ISNC 4GMJB 3BUZB 4KH5A 3CHWA 2V7YA 4RW9A 4FLVA 3AARA 3HPGA 4PKGA 2ZJQL 4CGGA 3DMJA 1NM1A 4JKDA 4HUFA 1Y64A 4CW7B 4ISFA 1YVUA 1KVAA 4E1MA 1BQNA 2P9NB 4DSFA 4LFBK 4DR4K 4CK1A 4FSVA 4CGDA 3WEEA 3FZFA 1SKSA 4CJWA 3IMXA 5CE3A 3CQXA 1VSDA 2FBTA 3VQQA 1HMVA 4CZKA 3NH1A 5AQOA 3ZLJA 3HT3A 2HHWA 4R79A 4I7FA 2D0PA 4KHSA 1U04A 3DLRA 1WUAA 2J4RA 3ZYYX 3V6DA 4E7IA 2B6AA 3VOVA 3OYMA 2G8VA 1U2VB 2A1RA 3C7NA 2O8DA 3OYEA 4JD2B 3HTVA 2P9SA 1MA9B 4FWLA 1YAGA 5GAEP 3SPYA 1O1WA 4H0YB 2ZF5O 3DRRA 4NXNK 3THXA 4LF6K 4ICLA 4BR2A 1VQ6N 2FXUA 3VQPA 3QEWA 3GDQA 1VRTA 4BGBA 2CGJA 2ZE2A 1W0HA 3D2FA 2XRIA 3DWLA 3TAQA 4KHUA 3P39A 4AM7A 4YY3K 3HZ6A 4F4KA 3KWIA 1VSFA 3VF2A 5DM7L 4O5FA 4CHZA 3AVFA 1S9EA 1FW6A 5E84A 3EYZA 3KLFA 4FWSA 3PX6A 3O80A 2VWJA 4DR6K 3TTFA 3RSEB 1K8AO 1JLQA 2E1ZA 1JCFA 4YOTA 3T1HK 3M8PA 4CJQA 4CJLA 3HSCA 4KHYA 4CGFA 3PLAA 1W2BM 3VTIA 2G8UA 4XH4A 1Q9XA 3QERA 5HRSA 3RTVA 1ZBHA 4CBWA 1RILA 3L3UA 4RCHA 1NKCA 4CESA 1ASVA 1J5EK 4NCGA 1BI4A 1TL1A 3TARA 4AM6A 5J2PA 4G9ZA 1KFDA 2ASMA 1VQON 3ALYA 4OLBA 2X6SA 4JI1K 3EY1A 3DLKA 3OBWA 4M3ZA 3R3LA 3TANA 3AGRA 4FW2A 1RNHA 3UB5A 1IH7A 1KXPA 2G8FA 2WOMA 3TU5A 3NDKA 4M3XA 3R1XA 4X62K 4BRCA 4A62A 2GEMA 4DG1A 5M1FA 1NK0A 1I94K 1BIZA 1SL2A 4M3TA 1K6YA 2BGGA 2Z1GA 3NGIA 3CJ7A 4BE2A 2E2NA 4K25A 1DTTA 3PX4A 2KW4A 3CI5A 1D4XA 5CHIA 2QK9A 2QWNA 3M5RA 3SNNA 1XHZA 3NCIA 4PL7A 1BG3A 4WE1A 3SAFA 4E1JA 3KHYA 3A5LC 1NJXA 4KB0A 3SMSA 1QQOA 3TSPA 1RDDA 1U45A 4WYBA 4DV3K 4IOCL 1NOZA 2A42A 4DV5K 1QS4A 3VEOA 3I0RA 3UIQA 4FM0A 3ZSOA 4DTXA 3OYGA 4E89A 2KTQA 4E3SA 4DFMA 2Z1HA 5F0XA 3G6EN 5E26A 3V4IA 3O9UA 1HNIA 2YNHA 4FJXA 4E7JA 3CFRA 3T1YK 4J2AA 2NRRA 4ELTA 4H0PA 3LDOA 1HKGA 5AQTA 5ADXA 2CH5A 4PHTX 4CCHA 2P9UB 3VN5A 4OLAA 1S22A 1GLJO 3O08A 1NMDA 4CGHA 3AO5A 5FRNA 4K8XA 3M6GA 1HNZK 5M1OA 2FF3B 1JXEA 2KZMA 3PX0A 1N32K 2FC0A 3MEEA 3ZSVA 3VENA 1XMOK 1W7AA 2QW9A 2QWLA 1S72N 1L3TA 4W5RA 1Y97A 3UKUB 3HM8A 3IFRA 3KIOA 1RTDA 4O55A 3DXMB 4PWDA 3LM2A 5ELZA 2WTUA 3AVMA 1SQKA 1JJ2M 1HQEA 3O4QA 1RDBA 1C1AA 3OTOK 2GBZA 4JI0K 5KQDA 4MO5A 2Y1JA 3NHGA 1SZ2A 3K59A 3LDNA 1VRUA 4GW6A 3A2FA 2XY5A 3W0LA 3O3FA 4JS4A 5J2NA 1MWKA 1S9GA 2E1YA 5EY4A 2ZJPL 3HO1A 1NK4A 1OH6A 2IGIA 3O5BA 2P5GA 3LDSA 3I55N 1WAFA 3AAPA 1FK9A 5DMRA 3QB0A 1T05A 2PYJA 4HTUA 1ASUA 1CXQA 2A1SA 2DFEA 3TTDA 4CEBA 4ID5A 4Z4CA 3CF5L 3CC7N 3HP9A 5BREA 3OYFA 3KKSA 2PBDA 4NYFA 1KC8O 4FXDA 3LPTA 3THYB 4IOAL 2GWJA 5BRHA 4KI4A 1XNQK 4BWJA 1VHXA 3MX5A 1TV6A 5BR9A 4JK8A 1EXQA 3E01A 3SUQA 3VESA 2VG5A 4MO4A 1NKBA 1EX4A 1YJNN 5C10A 3ZX2A 3LDQA 1MU2A 2O8EB 4H5TA 1GOBA 1VSEA 4CERA 1IG9A 3EE8A 2ZM6K 2ETJA 4FLTA 5C24A 4MDBA 3SPZA 3MMVA 4JK9A 4PL8A 1Z25A 3AV9A 4BR4A 4KKOA 2V51B 5M1PA 4JI4K 4MDAA 2Z1IA 2OTLN 4DR2K 2OPRA 1IKYA 1YIJN 3EZWA 2UUBK 3SI6A 4JI5K 4CZLA 4IJNA 2JLEA 5GAGP 1J53A 4HUEA 2F9TA 2Y1IA 1KAXA 2Q0UA 5BR8K 3H08A 4CEAA 4E1NA 1CZ9A 2NRZA 4H4OA 2NRTA 1HR0K 3N4PA 4PKHA 2WBNA 5CYQA 1YJ9N 3D0PA 1NBWA 4DTJA 1ZBIA 3L3VA 3J8AA 4WQ4C 3VTHA 3MCAB 3DJCA 1WSIA 1Z05A 3SV3A 4B3TK 2W6LA 1HKCA 3QIPA 4FJNA 3CPWM 1IO2A 1P90A 1L3SA 4DV1K 1T6DA 3HJFA 5AZJA 2VQFK 3UKRB 3K0SA 1YT3A 2X6NA 1BCMA 5LMUK 4HCCA 1BOTO 5AQGA 4BRGA 4IZ9A 4DF8A 4C8LA 3L6QA 3OHRA 4BRAA 4IDHA 3ZT0A 3SQ2A 1QTMA 3TAPA 2GUPA 2GWKA 4K0KK 2G8IA 4PY5A 4MLHA 1NGCA 3J81O 4M7XA 4YORA 4AHRA 3JYTA 5H1SQ 3HOTA 3VQ8A 4DCHA 2YX6A 4FOEA 1TUUA 2VYPA 3KJVA 4I6MA 5AQQA 2VG7A 3CCUN 1KFSA 3O1BA 3SJHA 2OZSA 2E8AA 4LSNA 3WQTA 5T7BA 5C15A 1TKDA 2HVIA 4DSLA 4LD0A 3CCQN 3CPEA 3IAYA 1BDGA 4ILHA 1EQYA 3SQ4A 3MN7A 4H5VA 4DTMA 3AA5X 1RDCA 3F9MA 4BR0A 3OVNA 2YHWA 3QIOA 3BP8A 4Z0UA 4DU1A 2NRWA 2D0BA 3DOLA 5FPDA 1TUYA 2YHXA 1RBVA 3CIPA 1DGKN 5GADP 3U9ZA 3MN5A 4CIFA 1S1XA 3VQ9A 3TPQA 3V9WA 3EZ5A 4H03B 5F1XA 2IIRA 5F2RA 3I33A 1D9FA 2OANA 1K8KB 2D0AA 2ITMA 4K41A 4A5BA 3S3OA 4JHDB 1TKTA 4ID1A 3NE6A 2HVHA 4H8KA 2D5RA 3RMCA 2IOCA 3ZETB 4B1VA 3A5NC 4ISEA 4CZIA 1IJJA 1RDWX 3D7EO 1JLBA 1NGEA 4TSXA 1KLNA 1HPZA 1M1KO 4IO8A 2YNFA 3NF6A 3NVMA 1WB9A 5KPTA 3T1AA 4YNQA 4FJ5A 1VQ7N 1ZBLA 3FZKA 4FWKA 4CIEA 3ENHA 3MEDA 2EWSA 2QXLA 4BWMA 1VQPN 3G4SN 4CEFA 4QAGA 1NK8A 3VGMA 3CC2N 3FR0A 1IKWA 3CCLN 4ZTFA 3S41A 2RE2A 4WF9L 4C8NA 5C2FA 4DFPA 1XMQK 3KD5E 2FSJA 3CQYA 4CJ7A 3J80O 1RTIA 2VCPA 2YI1A 3VA3A 1BA0A 4FVUA 1EETA 5AQKA 5I3UA 4BRIA 3ZX3A 1HYSA 5BN8A 3JS6A 3SAGA 4N76A 1T8EA 4J8FA 4CFCA 4WQ5C 2B5JA 3WNHA 4M3WA 1BA1A 2HMIA 3B6PA 5BN9A 1KSPA 1GOAA 1QZ6A 2IVPA 3CC4N 2AJQA 1BISA 1VSLA 4YOUA 1WNSA 1T03A 1WN7A 4YDUA 4FM2A 3C7NB 2O8DB 1XC3A 1A5XA 2QWRA 3K2PA 1KVCA 3KLIA 4JI2K 1QSYA 1ZBUA 3LANA 3AO4A 2VWKA 1Q9YA 3ULEB 2A40A 4B1UB 3THXB 3MK6A 1GOCA 2PY5A 1HPMA 3GG4A 4A2BA 3OJSA 1JLAA 3BF1A 3QETA 3SMPA 1G99A 3D2FB 3J7YP 5HRRA 2IVOA 1QE1A 3T7ZA 1J5OA 4LF4K 3MX2A 2AA4A 3L4QA 4EP5A 3L2VA 4O44A 1XQSC 2E2PA 4CVNE 3MAQA 3ATVA 3TWHA 1TAUA 1JKHA 1K9MO 3AVBA 3OYAA 4DU4A 1GLBG 2P9LA 4JRQA 3SLCA 5JS2A 4OPJA 1U4BA 3VEWA 5HP1A 5C0YA 4JNEA 1SV5A 1RBTA 3K5MA 1YHQN 1T44A 2JWLA 4MFBA 4CZJA 4FLZA 3DLBA 3QEVA 1ESVA 1TK5A 1NGGA 4GV3A 1NGDA 3OYNA 1I3AA 1ATNA 1U2VA 1BIUA 4FJ9A 2YKMA 4DR5K 3SQ0A 2KFNA 1RT3A 1YTAA 4M3RA 2Q36A 3L2WA 3KD1E 3M3ZA 4JKEA 1UWBA 3A0IX 1VQNN 4KO0A 4B9UA 2XY6A 4X65K 2HBKA 3EN9A 1BI4B 3FGUA 3PSFA 4KH6A 1OH7A 1K73O 1C1CA 4W5NA 1GLFO 4FLUA 3R8EA 1SUQA 2BUPA 3NAEA 5D3GA 3VEXA 3SJJA 2W6KA 4BRMA 1T7PA 1BGXT 3C6AA 1CZBA 4N5SA 3E66A 4FZYA 4B9NA 1T6CA 3BZKA 3A8YA 1X9JA 4O5BA 1NGBA 3I8DA 3NF7A 3RR7A 1WSGA 2G8KA 1SAZA 4L8RB 1VSKA 3ZSQA 3RMAA 4JV5K 4Y1CA 3VGKA 4WFBL 3M8SA 5JLFA 3P31A 1N36K 2VGMA 3VQEA 1QSLA 5LMNK 2FSKA 1NK7A 3O1WA 4IO9L 1EWRA 5AQJA 3AVKA 2QA4N 3IKMA 3NH2A 4JKAA 5AQWA 5M1QA 3FZHA 5KRSA 4KTWA 1TYQA 4CZMA 1HNWK 4CHOA 3LWLA 1JLFA 3J7ZO 3DXKA 3AVGA 4K43A 3VEYA 3RMDA 4CJFA 1XNRK 4DV6K 2NNWA 2IVNA 4AHCA 1HRHA 2EX3A 1TK8A 5AQXA 4BQZA 1JLGA 4BR9A 2F96A 3PIPL 3WQUA 4FYDA 3SV4A 1ZXOA 1HYVA 4FLWA 2XY8A 1WSFA 2F9WA 4B9TA 1LOTB 4CHNA 4FJLA 1BU6O 2E20A 1NJYA 1GLAG 4C8KA 3LL3A 3ID6A 5GAHP 2EHGA 4I2PA 4JKCA 3NGZA 3PO4A 2KHOA 4DR7K 2OTJN 1RT7A 3JXUA 4ZHRA 4ELVA 4F9OA 1ATRA 1C0GA 1XWLA 1WSHA 2FBXA 4C23A 4U7BA 3U8XA 1KVBA 2KQ2A 3VQ6A 1NGIA 2HBMA 1IBLK 4KBOA 4LF7K 2DTUA 4C8MA 4FM1A 2OA8A 3HI0A 4GKJK 1NMNA 3F2KA 5TKWA 4NB4A 4OPKA 1B9FA 3HRGA 4DLGA 3CXCM 1S5JA 4IJAA 1CLQA 4HTLA 2RN2A 2BH1A 4JRPA 4A57A 2HNYA 3JSMA 3OW2M 5IT9O 1OH8A 1KCFA 4F8RA 1GLDG 1RT4A 1GLCG 3KK1A 1C0MA 3VF4A 4E7LA 4DS4A 3LP3A 4HHTA 5J2QA 4CEOA 2PYLA 3EL2A 1NG9A 2Q97A 4WQ4A 3R9PA 3KK2A 3LAMA 4BDPA 2UXDK 4CJTA 5J1EA 2Q1NA 1NGHA 3DLEA 4E19A 3RWUA 4QOZB 1HJRA 1SS6A 5EU7A 2E88A 4DQRA 1BCOA 1NGFA 1ZC6A 3AO2A 1X3MA 2GV9A 2QKKA 5EX5A 4CGJA 1B92A 3LWMA 1YJWN 3U6FA 1UOCA 2G8HA 3VQBA 4DV4K 3IRXA 1ATSA 3KVGA 2P9UA 2OZMA 1KD1O 2E6LA 4RG8A 1YVNA 2HHQA 4N41A 2KLAA 4IDKA 4A61A 5FPEA 4LY7A 4DV7K 5AQUA 5BPNA 1ZYQA 2WONA 1FKPA 2OPSA 4DQSA 2O8CB 4AHSA 4H0OA 4BACA 2NRVA 3EE9A 4K42A 4FJ8A 1Z6RA 4JKBA 2YHAA 3HK2A 4M45A 1JXBA 4CZHA 3JAMO 4DQIA 2NRHA 3DAWA 4BY9C 1EKEA 3VPZA 2A6AA 3NH0A 2YHYA 3HOSA 2YV0X 4BVPA 5AZIA 3THWA 4H0VB 3VQ7A 1OKJA 4CJVA 4FK2A 4FCYA 4BC5A 2O8BA 4DUYK 3SBGA 5AQIA 5HL7L 2A3ZA 4HVJA 4KHNA 4CJ4A 3WXMB 1X1PA 1DKGD 3KWGA 3J7AP 4PKIA 3LAKA 4CJSA 3OYCA 2P9PA 3WXLA 3TTCA 3T3FA 1EWQA 4OKKA 4M7YA 3ZEUA 2ZD1A 5HRNA 3HBTA 5C42A 5GINA 1UA1A 5AFUA 5CYMA 1WAJA 5I42A 3O3GA 1J6ZA 3B8AX 4I2QA 3EO3A 3ZSZA 1W9HA 5K14A 3U4LA 3O9TA 4FW1A 4H0TB 2QM1A 4FVMA 3WXJA 4CK3A 2OYQA 3AAQA 1VQMN 4FK4A 3CM5A 3G25A 4CBUA 5HOOA 4JKHA 4LFCK 3O9SA 3NFAA 1KQSM 5GIOA 1N33K 3ID8A 1QQCA 5IWAK 4UQGA 3DLGA 3NBPA 1S1UA 4O8UA 5AJ3K 3CCSN 1HQUA 3G10A 3VGLA 3CD6N 4OGCA 3OA9A 1DEJA 4B1WB 3T69A 1LV5A 3D2EA
chains in the Genus database with same CATH topology
4CVNE 5LMUK 4AQYK 4DR6K 1HNXK 4X66K 4DV7K 3T1HK 5FLXO 4X64K 4K0KK 4DR3K 3J81O 4NXMK 4OX9K 1XNQK 3T1YK 4DR1K 3JAMO 4JI8K 4DR5K 4CW7B 4LF5K 4LF9K 4JI6K 4LFAK 1FJGK 1IBMK 4DR7K 1N34K 1J5EK 1XMQK 4LFBK 2E5LK 4DR4K 4B3RK 3J80O 4X65K 4YHHK 4JI1K 1HNZK 2ZM6K 2UUAK 4JI3K 1IBLK 4DUYK 4LF7K 1N32K 4DV0K 4V19S 2F4VK 1XMOK 2UXCK 5LL6Z 4GKJK 4B3SK 4JI4K 3J7AP 4DR2K 2UU9K 5A2QO 4JYAK 2UUBK 4X62K 1IBKK 1I94K 4JI5K 2UUCK 4LF8K 5BR8K 5IT9O 4DV5K 4JV5K 1HR0K 4NXNK 2HHHK 1N36K 4LF6K 3OTOK 2UXDK 4JI0K 5LMNK 4JI2K 4DUZK 4LFCK 4JI7K 2VQEK 1N33K 4DV6K 5IWAK 4YY3K 4KHPK 4B3TK 4GKKK 5AJ3K 1HNWK 4B3MK 3J7YP 4DV1K 4DV4K 2UXBK 4LF4K 1XNRK 4DV3K 4DV2K 2VQFK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVN E;  5LMU K;  4AQY K;  4DR6 K;  1HNX K;  4X66 K;  4DV7 K;  3T1H K;  5FLX O;  4X64 K;  4K0K K;  4DR3 K;  3J81 O;  4NXM K;  4OX9 K;  1XNQ K;  3T1Y K;  4DR1 K;  3JAM O;  4JI8 K;  4DR5 K;  4CW7 B;  4LF5 K;  4LF9 K;  4JI6 K;  4LFA K;  1FJG K;  1IBM K;  4DR7 K;  1N34 K;  1J5E K;  1XMQ K;  4LFB K;  2E5L K;  4DR4 K;  4B3R K;  3J80 O;  4X65 K;  4YHH K;  4JI1 K;  1HNZ K;  2ZM6 K;  2UUA K;  4JI3 K;  1IBL K;  4DUY K;  4LF7 K;  1N32 K;  4DV0 K;  4V19 S;  2F4V K;  1XMO K;  2UXC K;  5LL6 Z;  4GKJ K;  4B3S K;  4JI4 K;  3J7A P;  4DR2 K;  2UU9 K;  5A2Q O;  4JYA K;  2UUB K;  4X62 K;  1IBK K;  1I94 K;  4JI5 K;  2UUC K;  4LF8 K;  5BR8 K;  5IT9 O;  4DV5 K;  4JV5 K;  1HR0 K;  4NXN K;  2HHH K;  1N36 K;  4LF6 K;  3OTO K;  2UXD K;  4JI0 K;  5LMN K;  4JI2 K;  4DUZ K;  4LFC K;  4JI7 K;  2VQE K;  1N33 K;  4DV6 K;  5IWA K;  4YY3 K;  4KHP K;  4B3T K;  4GKK K;  5AJ3 K;  1HNW K;  4B3M K;  3J7Y P;  4DV1 K;  4DV4 K;  2UXB K;  4LF4 K;  1XNR K;  4DV3 K;  4DV2 K;  2VQF K; 
#chains in the Genus database with same CATH topology
 1QHA A;  4CFB A;  3AY9 A;  3NGY A;  3AO3 A;  1X3N A;  4DF4 A;  3L0Q A;  3AVC A;  4DKW A;  4CJP A;  3CQ8 A;  5FPM A;  4X64 K;  3K9J A;  5AQP A;  3GL1 A;  3L4I A;  4BQL A;  4OX9 K;  1H1V A;  4GV6 A;  4DR1 K;  1RT1 A;  1WOQ A;  2ZJR L;  3OYD A;  1B9D A;  2F8T A;  3D45 A;  4YOY A;  4CJ5 A;  3ITH A;  3VQ4 A;  1U6Z A;  2YJF A;  4RW4 A;  2GEL A;  1S6Q A;  3L2Q A;  1C0T A;  4N56 A;  1GLL O;  2I7P A;  3EKU A;  3LM9 A;  2E5L K;  2NUB A;  4EHT A;  3K5L A;  1L3V A;  1DTQ A;  3FFK B;  4Z4I A;  4XEI A;  4I6M B;  4B3R K;  1HKB A;  3HM9 A;  3TAF A;  4FWQ A;  2A41 A;  4BRO A;  3Q7C A;  4JN4 A;  3OYL A;  4H4M A;  1RDU A;  4Z4G A;  1LW0 A;  1Q86 O;  3QEX A;  1RBR A;  1ZBS A;  3PV8 A;  4KFB A;  1HJO A;  2ASO A;  1LWF A;  4WQ5 A;  2D0O A;  2YNI A;  5KTQ A;  4CHQ A;  1V4T A;  3OYI A;  4IEE A;  4BRP A;  2IS3 A;  4IFV A;  5BPM A;  3EKS A;  4C1N K;  1FKO A;  2LSN A;  1X9W A;  1VQL N;  4W5T A;  5KI6 A;  4CJ3 A;  4F3T A;  2HHH K;  1E4F T;  2ATQ A;  1EP4 A;  1TK0 A;  3BZC A;  3MWP A;  4CEZ A;  4CI6 A;  4BGA A;  3HL8 A;  5JMV A;  3ZSY A;  4DFJ A;  1U47 A;  3WXI A;  2HHU A;  3KTQ A;  3BGR A;  1Q7Y O;  2FF6 A;  2GX9 A;  1RBS A;  4J2E A;  4IBN A;  2F8S A;  3MEC A;  3KK3 A;  4DTP A;  1JL2 A;  2RHK A;  5JIC A;  4OPA A;  3HPO A;  2XO7 A;  3ENO A;  1G15 A;  3FE1 A;  3LP1 A;  2CGL A;  4X66 K;  3MDQ A;  4YOW A;  5BRF A;  3CFO A;  4OVL A;  3KLH A;  1VK0 A;  1IG8 A;  3G71 N;  4B9V A;  3MEG A;  3DLH A;  2VG6 A;  2X74 A;  4IG0 A;  4CBX A;  4NLC A;  3MXM A;  4W5O A;  4OKJ A;  5AQN A;  2UYT A;  1N8R O;  4JI8 K;  5C2D A;  4CHP A;  3H3O B;  4LF5 K;  1NJZ A;  5DK5 A;  5EOY A;  3H6E A;  3M1F A;  2FSN A;  2D1K A;  4JLH A;  1JCG A;  2P9I A;  4IXC A;  2P5O A;  4KTQ A;  1T3V A;  4Y0W A;  2PFU A;  4RW8 A;  4FPB A;  1S1W A;  3R6M A;  3QEI A;  1RFQ A;  4PUO A;  1HUX A;  5FRM A;  4AF1 A;  1DLO A;  3VA0 A;  1BQM A;  3H1V X;  2UXC K;  5JLH A;  3O4W A;  5LL6 Z;  3C6U A;  3LPU A;  4B1Y B;  3ASM A;  4J2D A;  3E1Y A;  1QHT A;  4ILJ A;  3P1G A;  2WC9 A;  3PO5 A;  4KB1 A;  2O8F A;  3LAL A;  4JYA K;  2QTD A;  1OVY A;  2DFF A;  2GTD A;  2IDO A;  5LY3 A;  4JK7 A;  3VMF B;  4FJI A;  1Q82 O;  1NJW A;  3K58 A;  3VEV A;  5AQR A;  4BC3 A;  3VQC A;  4M42 A;  3KLE A;  3WEE B;  4FJG A;  3CCM N;  4IEI A;  5ADX H;  2P9K A;  4FWR A;  4CF1 A;  4JI7 K;  4Q5V A;  1QVG M;  4IKF A;  1LCU A;  3WXK A;  4KAZ A;  2YHB A;  1BO5 O;  1TKZ A;  3V1O A;  3CFP A;  1FXX A;  3FFI A;  2DPN A;  4Q0B A;  1A5W A;  4DV2 K;  3CYM A;  1HNV A;  4J2B A;  1P8Z A;  4CED A;  4EFH A;  1C0U A;  4OO1 J;  4JKG A;  2FLO A;  2P9S B;  3E9L A;  4AQY K;  3F5T A;  4OKE A;  4U67 L;  3MN9 A;  4MQ3 A;  1BUP A;  4FJM A;  1TKX A;  1WSJ A;  3C0B A;  3V81 A;  2IC3 A;  3O4N A;  2P9L B;  5KGW A;  1JLC A;  1E3M A;  4NCB A;  4BDY A;  4B8C A;  3QEP A;  2P9N A;  1TGO A;  2NZT A;  3VQA A;  2FBV A;  3V9X A;  3AA4 A;  4LSL A;  5TKY A;  1D9D A;  3QNO A;  5SZT A;  4LF9 K;  3HVT A;  1IBM K;  2YCH A;  1S1T A;  1N34 K;  2QWM A;  5I9E B;  1KRP A;  1A5V A;  4M41 A;  3TAG A;  1W97 L;  3L2R A;  1S6P A;  4KI6 A;  4EAH D;  4QS8 A;  3S3M A;  4RW6 A;  4BRE A;  3DYA A;  4BRK A;  3CCV N;  4GVE A;  1OH5 A;  3ULE A;  4XIU A;  3ZT3 A;  4AH9 A;  4DV0 K;  1KLM A;  1NKE A;  2F4V K;  2CGK A;  3H45 C;  3CCE N;  5FDL A;  1IKV A;  4F2S A;  5KPR A;  3U9D A;  4JD2 A;  3Q7B A;  3OJU A;  4UY8 O;  3NF8 A;  1NU0 A;  5AQF A;  5JS1 A;  2UU9 K;  1QQM A;  1Z26 A;  3WT0 A;  5A2Q O;  3M8R A;  4ILG B;  3SYZ A;  1YF5 L;  3AVJ A;  2I7N A;  3V9S A;  4PQU A;  3SAH A;  5HBM A;  3NF9 A;  2QXF A;  3MWT A;  2V7Z A;  2KFZ A;  4B9Q A;  3OYH A;  3ZSR A;  4DSI A;  3SK3 A;  5J2M A;  3TI0 A;  5CZ1 A;  1SKR A;  4QS9 A;  3BY5 A;  1NK9 A;  4R5P A;  3VET A;  4NLB A;  4CK2 A;  2A5X A;  3NMU A;  4M3Y A;  5AFU H;  4AHT A;  1GLE G;  3BDP A;  1WLJ A;  3RSE A;  5EVZ A;  4C1N I;  4B9M A;  4H5R A;  2PAV A;  5HRO A;  1TYQ B;  1SL1 A;  1N5Y A;  3K57 A;  1KTQ A;  1O13 A;  3DXK B;  1HNX K;  4E7K A;  4KRE A;  4EHU A;  4XH5 A;  3K5N A;  5HLF A;  1YUW A;  3DRP A;  4BE1 A;  2Q31 A;  4ZTJ A;  2ZQB A;  4FO0 A;  5SWM A;  3AVL A;  2JGU A;  3WNE A;  2D0C A;  3DLL L;  3PSI A;  4BRF A;  3QLH A;  1RTJ A;  3ZSW A;  1Q81 O;  4CD1 A;  2G8W A;  3V9U A;  2BE2 A;  4BC2 A;  3VER A;  3TAM A;  4G1Q A;  1LWC A;  1BWF O;  1Q18 A;  2O4G A;  3TAB A;  4K8Z A;  2D4W A;  1Q8I A;  4JI6 K;  4LFA K;  4DQP A;  3S3N A;  1FJG K;  3TSQ A;  3O6W A;  4H0X B;  3MCP A;  4B08 A;  3RR8 A;  1BHL A;  3OS1 A;  1WBB A;  4FLY A;  4DMN A;  4BRQ A;  3LP0 A;  1RTH A;  1V4S A;  5KPZ A;  1NGA A;  2OPP A;  4FJ7 A;  4FJJ A;  4NCA A;  4Z94 A;  3ZT2 A;  4JI3 K;  3OY9 A;  5AQS A;  1XI1 A;  4YDU C;  1TAQ A;  2HND A;  3ZX0 A;  2ZGY A;  3I0S A;  4NYN A;  3SQ1 A;  5AQM A;  2YKN A;  3DRS A;  3KK7 A;  3AO1 A;  4H5W A;  3VF6 A;  3MXJ A;  4FWP A;  4FWM A;  2UUC K;  5GIP A;  1J54 A;  2W42 A;  4AHU A;  2HBL A;  3IUC A;  3WNF A;  3KLG A;  3QFU A;  5CY4 A;  3MN6 A;  1VSI A;  1S1V A;  3CG7 A;  1JL1 A;  4OGE A;  3CCJ N;  1MWM A;  1HX1 A;  1OVQ A;  2WFB A;  3G0Z A;  1SL0 A;  4JS5 A;  5AQH A;  4DUZ K;  3V9Z A;  1VAZ A;  4FOI A;  3CJB A;  4DLE A;  2HB5 A;  4CF9 A;  3E9O A;  1JCE A;  1RDA A;  5LJV A;  4C8O A;  3H3N O;  4A2A A;  4OJR A;  4BRD A;  4PA1 A;  5KQ8 A;  3C95 A;  4BR7 A;  3HXM A;  1YI2 N;  5E41 A;  4KV8 A;  3NVK A;  3QES A;  4B9S A;  1C6V A;  5B8H A;  3ULD A;  5FRO A;  4B8A B;  5DM6 L;  3ZT4 A;  1JLE A;  3THV A;  3SUO A;  1VQ5 N;  3AVH A;  3DI6 A;  3O9Q A;  2QEX N;  1ASW A;  4GVM A;  4CF8 A;  4GV9 A;  1UAX A;  4ELU A;  2E2Q A;  5FLX O;  2O4I A;  3CJA A;  3CM6 A;  4O0I A;  4RW7 A;  3QO9 A;  4NXM K;  4DTS A;  2HNZ A;  4IOX A;  3V1R A;  3PUF A;  3P4I A;  2WUS A;  2P51 A;  4KRF A;  1XUP O;  4CF0 A;  4CJU A;  3CJ1 A;  3LDL A;  4FJH A;  4GNI A;  4FWO A;  1UA0 A;  3ZT1 A;  4CZE A;  3TSU A;  4IFE A;  2ITG A;  4Y1D A;  2QKB A;  2KZZ A;  3OBY A;  5M1N A;  4CHY A;  4AIL C;  1N6Q A;  5AR0 A;  2ZWH A;  1QZ5 A;  1X9M A;  3UKU A;  5AZI B;  3OYK A;  3THW B;  1HYZ A;  2DY4 A;  3HST B;  4W5Q A;  3DXM A;  4DTN A;  2I5J A;  3KZB A;  4FPA A;  3CJC A;  3QBX A;  5HRP A;  2ASP A;  4DWI A;  2O8B B;  3AVN A;  3GBT A;  4KPY A;  3QIC A;  3MXI A;  3U3G A;  2HW3 A;  2RF2 A;  3HVR A;  4H5N A;  5BPL A;  3OYB A;  2P9P B;  4M63 C;  2E6M A;  5FPN A;  4LH5 A;  4DHY A;  3ZEU B;  3OYJ A;  3BF3 A;  3SCX A;  2O8C A;  1IV0 A;  1S3X A;  1EO1 A;  2VWB A;  2RPI A;  4B3O A;  3PY8 A;  5LJW A;  2F7T A;  1NK5 A;  5KGX A;  2E2O A;  4DSK A;  1QQN A;  1MDU B;  3QIN A;  2OPQ A;  5C12 A;  3C65 A;  3AVA A;  4CJR A;  2FBY A;  1ZBF A;  4CZF A;  2UXB K;  3DOK A;  4DTO A;  2X78 A;  1D8Y A;  2PZS A;  1NWK A;  4Z4H A;  4KTZ A;  1KAZ A;  4B1X B;  4FLX A;  4FZZ A;  3HP6 A;  3THY A;  4KHQ A;  3QFP A;  1IKX A;  3D2E B;  3GE1 A;  3F73 A;  1WSE A;  3SUP A;  2HST A;  1YXQ A;  2HHT A;  5JVG L;  5M1K A;  4Z4E A;  3UE5 A;  4A5A A;  5AQY A;  4CEE A;  4DS5 A;  1J9A A;  2NLX A;  4JKF A;  3SBT A;  3OS2 A;  1R0A A;  2O8E A;  4YFU A;  3AGK A;  4JAX A;  2Q3S A;  3O9R A;  4BRH A;  2IAJ A;  2HF3 A;  3K5O A;  4EZ9 A;  1VQ8 N;  1RGI A;  3LDP A;  2QWP A;  5MLC Q;  5AZJ B;  4LC9 B;  2E4L A;  2HOE A;  3HYF A;  2CH6 A;  3IS9 A;  1REV A;  4OPH A;  2QWQ A;  1KAY A;  4CEQ A;  3DM2 A;  3RRG A;  4QCL A;  4O0J A;  4BRL A;  4E0D A;  3QNN A;  1D5A A;  1BL3 A;  4NO7 A;  1TVR A;  4FZX C;  2NRX A;  2BDP A;  3EEQ A;  3AVI A;  2DFH A;  4B3S K;  1LWE A;  4AHV A;  4BVO A;  4E7H A;  4FWN A;  4YOV A;  2BAN A;  3D6R A;  4ISG A;  4RWT A;  4CEC A;  3HPH A;  5CR4 A;  3LZI A;  4O8K A;  4JEP A;  1XC9 A;  3RVC A;  3LP2 A;  4LF8 K;  3WUH A;  5EXW A;  2QI2 A;  3M8Q A;  1QVF M;  4DTR A;  1VQ9 N;  3AA3 A;  1VQK N;  1CZA N;  3O8M A;  1M90 O;  1NOY A;  4KHW A;  2RKI A;  4BC4 A;  3ZCM A;  3A5O C;  2W40 A;  3CJ9 A;  4CJE A;  4N47 A;  1LAV A;  4WFN L;  4DQQ A;  4B9L A;  2VQE K;  4EIA A;  4DB3 A;  3FZM A;  1I39 A;  4IWV A;  3UKR A;  3V1Q A;  1VQ4 N;  4KH4 A;  4Z4F A;  3QML A;  2YNG A;  5KRT A;  3FLC O;  3W3D A;  4I9L A;  4DFK A;  4B3M K;  1NLV A;  2Q0R A;  2Q2R A;  4BG8 A;  4CE9 A;  1L5U A;  3B6O A;  3H1Q A;  3IG1 A;  1NK6 A;  2HHS A;  3P5J A;  4IFY A;  3QBW A;  3C94 A;  3ATU A;  4CGI A;  3I56 N;  1CXU A;  4DTU A;  1LAW A;  3K9K A;  4CFD A;  3T19 A;  1RT2 A;  3GOI A;  3SZ2 A;  1X9S A;  1HLU A;  5JVH L;  1E4G T;  1YTU A;  1U49 A;  1XHX A;  3TR8 A;  1WBD A;  3A5M C;  3H46 O;  4HUG A;  4HWI A;  4I9Q A;  3N4Q A;  3S9H A;  2XHB A;  1RT6 A;  3L8B A;  3BEX A;  2V52 B;  3C6H A;  3FZL A;  4BG9 A;  1RBU A;  3IDH A;  3VQD A;  4A59 A;  2OCE A;  4CFA A;  3CME N;  4B1Z A;  5BRD A;  3P83 D;  1SKW A;  2QWO A;  1R59 O;  3SUN A;  1RCH A;  4YHH K;  1YIT N;  2HF4 A;  2ZGZ A;  2YJE A;  4FJK A;  3TAE A;  1ILY A;  2UUA K;  5CZ2 A;  2P9I B;  1F21 A;  1VSH A;  2AP1 A;  2HHX A;  1C1B A;  4V19 S;  3CCR N;  3L2U A;  2XY7 A;  2HBJ A;  4BRN A;  4QS7 A;  4GY2 B;  4DQ8 A;  4F3O A;  2P1J A;  3CER A;  4FL9 A;  3VEZ A;  1L3U A;  3CMA N;  1NNE A;  3E9P A;  3QDK A;  2Z1J A;  4M3U A;  3C6T A;  1TL3 A;  4YOX A;  1IBK K;  1K8K A;  3CET A;  4DSJ A;  4CJK A;  4BE0 A;  4CZG A;  4JHD A;  3F9K A;  2O8F B;  4L3Q A;  4EP4 A;  1ITG A;  2JWK A;  4LH4 A;  4F2R A;  3ZET A;  1RT5 A;  3OS0 A;  4MLE A;  1U48 A;  4DU3 A;  3ENB A;  2HHV A;  3ZSX A;  4BR5 A;  3RMB A;  3O3H A;  4O4G A;  2R7Y A;  1QSS A;  4KHP K;  3WNG A;  2HMP A;  4CF2 A;  1VSJ A;  2H3G X;  2P9K B;  4GKK K;  2VGN A;  2BTF A;  1LW2 A;  3U3Y A;  4RTF D;  3PIO L;  3AA2 A;  3KKR A;  4FK0 A;  1C0F A;  3I8B A;  3VQ5 A;  4EZ6 A;  1NGJ A;  5C25 A;  1VSM A;  2GUI A;  4WCE L;  4CD3 A;  3P38 A;  4DSE A;  1NJI O;  3LZJ A;  2KKZ A;  4CIG A;  4XH1 A;  2B4J A;  1DT9 A;  2W41 A;  4BDZ A;  5AQV A;  4JKG B;  5AQZ A;  5AQL A;  4WFA L;  3RRH A;  4DR3 K;  4IG3 A;  4HCB A;  3ISN C;  4GMJ B;  3BUZ B;  4KH5 A;  3CHW A;  2V7Y A;  4RW9 A;  4FLV A;  3AAR A;  3HPG A;  4PKG A;  2ZJQ L;  4CGG A;  3DMJ A;  1NM1 A;  4JKD A;  4HUF A;  1Y64 A;  4CW7 B;  4ISF A;  1YVU A;  1KVA A;  4E1M A;  1BQN A;  2P9N B;  4DSF A;  4LFB K;  4DR4 K;  4CK1 A;  4FSV A;  4CGD A;  3WEE A;  3FZF A;  1SKS A;  4CJW A;  3IMX A;  5CE3 A;  3CQX A;  1VSD A;  2FBT A;  3VQQ A;  1HMV A;  4CZK A;  3NH1 A;  5AQO A;  3ZLJ A;  3HT3 A;  2HHW A;  4R79 A;  4I7F A;  2D0P A;  4KHS A;  1U04 A;  3DLR A;  1WUA A;  2J4R A;  3ZYY X;  3V6D A;  4E7I A;  2B6A A;  3VOV A;  3OYM A;  2G8V A;  1U2V B;  2A1R A;  3C7N A;  2O8D A;  3OYE A;  4JD2 B;  3HTV A;  2P9S A;  1MA9 B;  4FWL A;  1YAG A;  5GAE P;  3SPY A;  1O1W A;  4H0Y B;  2ZF5 O;  3DRR A;  4NXN K;  3THX A;  4LF6 K;  4ICL A;  4BR2 A;  1VQ6 N;  2FXU A;  3VQP A;  3QEW A;  3GDQ A;  1VRT A;  4BGB A;  2CGJ A;  2ZE2 A;  1W0H A;  3D2F A;  2XRI A;  3DWL A;  3TAQ A;  4KHU A;  3P39 A;  4AM7 A;  4YY3 K;  3HZ6 A;  4F4K A;  3KWI A;  1VSF A;  3VF2 A;  5DM7 L;  4O5F A;  4CHZ A;  3AVF A;  1S9E A;  1FW6 A;  5E84 A;  3EYZ A;  3KLF A;  4FWS A;  3PX6 A;  3O80 A;  2VWJ A;  4DR6 K;  3TTF A;  3RSE B;  1K8A O;  1JLQ A;  2E1Z A;  1JCF A;  4YOT A;  3T1H K;  3M8P A;  4CJQ A;  4CJL A;  3HSC A;  4KHY A;  4CGF A;  3PLA A;  1W2B M;  3VTI A;  2G8U A;  4XH4 A;  1Q9X A;  3QER A;  5HRS A;  3RTV A;  1ZBH A;  4CBW A;  1RIL A;  3L3U A;  4RCH A;  1NKC A;  4CES A;  1ASV A;  1J5E K;  4NCG A;  1BI4 A;  1TL1 A;  3TAR A;  4AM6 A;  5J2P A;  4G9Z A;  1KFD A;  2ASM A;  1VQO N;  3ALY A;  4OLB A;  2X6S A;  4JI1 K;  3EY1 A;  3DLK A;  3OBW A;  4M3Z A;  3R3L A;  3TAN A;  3AGR A;  4FW2 A;  1RNH A;  3UB5 A;  1IH7 A;  1KXP A;  2G8F A;  2WOM A;  3TU5 A;  3NDK A;  4M3X A;  3R1X A;  4X62 K;  4BRC A;  4A62 A;  2GEM A;  4DG1 A;  5M1F A;  1NK0 A;  1I94 K;  1BIZ A;  1SL2 A;  4M3T A;  1K6Y A;  2BGG A;  2Z1G A;  3NGI A;  3CJ7 A;  4BE2 A;  2E2N A;  4K25 A;  1DTT A;  3PX4 A;  2KW4 A;  3CI5 A;  1D4X A;  5CHI A;  2QK9 A;  2QWN A;  3M5R A;  3SNN A;  1XHZ A;  3NCI A;  4PL7 A;  1BG3 A;  4WE1 A;  3SAF A;  4E1J A;  3KHY A;  3A5L C;  1NJX A;  4KB0 A;  3SMS A;  1QQO A;  3TSP A;  1RDD A;  1U45 A;  4WYB A;  4DV3 K;  4IOC L;  1NOZ A;  2A42 A;  4DV5 K;  1QS4 A;  3VEO A;  3I0R A;  3UIQ A;  4FM0 A;  3ZSO A;  4DTX A;  3OYG A;  4E89 A;  2KTQ A;  4E3S A;  4DFM A;  2Z1H A;  5F0X A;  3G6E N;  5E26 A;  3V4I A;  3O9U A;  1HNI A;  2YNH A;  4FJX A;  4E7J A;  3CFR A;  3T1Y K;  4J2A A;  2NRR A;  4ELT A;  4H0P A;  3LDO A;  1HKG A;  5AQT A;  5ADX A;  2CH5 A;  4PHT X;  4CCH A;  2P9U B;  3VN5 A;  4OLA A;  1S22 A;  1GLJ O;  3O08 A;  1NMD A;  4CGH A;  3AO5 A;  5FRN A;  4K8X A;  3M6G A;  1HNZ K;  5M1O A;  2FF3 B;  1JXE A;  2KZM A;  3PX0 A;  1N32 K;  2FC0 A;  3MEE A;  3ZSV A;  3VEN A;  1XMO K;  1W7A A;  2QW9 A;  2QWL A;  1S72 N;  1L3T A;  4W5R A;  1Y97 A;  3UKU B;  3HM8 A;  3IFR A;  3KIO A;  1RTD A;  4O55 A;  3DXM B;  4PWD A;  3LM2 A;  5ELZ A;  2WTU A;  3AVM A;  1SQK A;  1JJ2 M;  1HQE A;  3O4Q A;  1RDB A;  1C1A A;  3OTO K;  2GBZ A;  4JI0 K;  5KQD A;  4MO5 A;  2Y1J A;  3NHG A;  1SZ2 A;  3K59 A;  3LDN A;  1VRU A;  4GW6 A;  3A2F A;  2XY5 A;  3W0L A;  3O3F A;  4JS4 A;  5J2N A;  1MWK A;  1S9G A;  2E1Y A;  5EY4 A;  2ZJP L;  3HO1 A;  1NK4 A;  1OH6 A;  2IGI A;  3O5B A;  2P5G A;  3LDS A;  3I55 N;  1WAF A;  3AAP A;  1FK9 A;  5DMR A;  3QB0 A;  1T05 A;  2PYJ A;  4HTU A;  1ASU A;  1CXQ A;  2A1S A;  2DFE A;  3TTD A;  4CEB A;  4ID5 A;  4Z4C A;  3CF5 L;  3CC7 N;  3HP9 A;  5BRE A;  3OYF A;  3KKS A;  2PBD A;  4NYF A;  1KC8 O;  4FXD A;  3LPT A;  3THY B;  4IOA L;  2GWJ A;  5BRH A;  4KI4 A;  1XNQ K;  4BWJ A;  1VHX A;  3MX5 A;  1TV6 A;  5BR9 A;  4JK8 A;  1EXQ A;  3E01 A;  3SUQ A;  3VES A;  2VG5 A;  4MO4 A;  1NKB A;  1EX4 A;  1YJN N;  5C10 A;  3ZX2 A;  3LDQ A;  1MU2 A;  2O8E B;  4H5T A;  1GOB A;  1VSE A;  4CER A;  1IG9 A;  3EE8 A;  2ZM6 K;  2ETJ A;  4FLT A;  5C24 A;  4MDB A;  3SPZ A;  3MMV A;  4JK9 A;  4PL8 A;  1Z25 A;  3AV9 A;  4BR4 A;  4KKO A;  2V51 B;  5M1P A;  4JI4 K;  4MDA A;  2Z1I A;  2OTL N;  4DR2 K;  2OPR A;  1IKY A;  1YIJ N;  3EZW A;  2UUB K;  3SI6 A;  4JI5 K;  4CZL A;  4IJN A;  2JLE A;  5GAG P;  1J53 A;  4HUE A;  2F9T A;  2Y1I A;  1KAX A;  2Q0U A;  5BR8 K;  3H08 A;  4CEA A;  4E1N A;  1CZ9 A;  2NRZ A;  4H4O A;  2NRT A;  1HR0 K;  3N4P A;  4PKH A;  2WBN A;  5CYQ A;  1YJ9 N;  3D0P A;  1NBW A;  4DTJ A;  1ZBI A;  3L3V A;  3J8A A;  4WQ4 C;  3VTH A;  3MCA B;  3DJC A;  1WSI A;  1Z05 A;  3SV3 A;  4B3T K;  2W6L A;  1HKC A;  3QIP A;  4FJN A;  3CPW M;  1IO2 A;  1P90 A;  1L3S A;  4DV1 K;  1T6D A;  3HJF A;  5AZJ A;  2VQF K;  3UKR B;  3K0S A;  1YT3 A;  2X6N A;  1BCM A;  5LMU K;  4HCC A;  1BOT O;  5AQG A;  4BRG A;  4IZ9 A;  4DF8 A;  4C8L A;  3L6Q A;  3OHR A;  4BRA A;  4IDH A;  3ZT0 A;  3SQ2 A;  1QTM A;  3TAP A;  2GUP A;  2GWK A;  4K0K K;  2G8I A;  4PY5 A;  4MLH A;  1NGC A;  3J81 O;  4M7X A;  4YOR A;  4AHR A;  3JYT A;  5H1S Q;  3HOT A;  3VQ8 A;  4DCH A;  2YX6 A;  4FOE A;  1TUU A;  2VYP A;  3KJV A;  4I6M A;  5AQQ A;  2VG7 A;  3CCU N;  1KFS A;  3O1B A;  3SJH A;  2OZS A;  2E8A A;  4LSN A;  3WQT A;  5T7B A;  5C15 A;  1TKD A;  2HVI A;  4DSL A;  4LD0 A;  3CCQ N;  3CPE A;  3IAY A;  1BDG A;  4ILH A;  1EQY A;  3SQ4 A;  3MN7 A;  4H5V A;  4DTM A;  3AA5 X;  1RDC A;  3F9M A;  4BR0 A;  3OVN A;  2YHW A;  3QIO A;  3BP8 A;  4Z0U A;  4DU1 A;  2NRW A;  2D0B A;  3DOL A;  5FPD A;  1TUY A;  2YHX A;  1RBV A;  3CIP A;  1DGK N;  5GAD P;  3U9Z A;  3MN5 A;  4CIF A;  1S1X A;  3VQ9 A;  3TPQ A;  3V9W A;  3EZ5 A;  4H03 B;  5F1X A;  2IIR A;  5F2R A;  3I33 A;  1D9F A;  2OAN A;  1K8K B;  2D0A A;  2ITM A;  4K41 A;  4A5B A;  3S3O A;  4JHD B;  1TKT A;  4ID1 A;  3NE6 A;  2HVH A;  4H8K A;  2D5R A;  3RMC A;  2IOC A;  3ZET B;  4B1V A;  3A5N C;  4ISE A;  4CZI A;  1IJJ A;  1RDW X;  3D7E O;  1JLB A;  1NGE A;  4TSX A;  1KLN A;  1HPZ A;  1M1K O;  4IO8 A;  2YNF A;  3NF6 A;  3NVM A;  1WB9 A;  5KPT A;  3T1A A;  4YNQ A;  4FJ5 A;  1VQ7 N;  1ZBL A;  3FZK A;  4FWK A;  4CIE A;  3ENH A;  3MED A;  2EWS A;  2QXL A;  4BWM A;  1VQP N;  3G4S N;  4CEF A;  4QAG A;  1NK8 A;  3VGM A;  3CC2 N;  3FR0 A;  1IKW A;  3CCL N;  4ZTF A;  3S41 A;  2RE2 A;  4WF9 L;  4C8N A;  5C2F A;  4DFP A;  1XMQ K;  3KD5 E;  2FSJ A;  3CQY A;  4CJ7 A;  3J80 O;  1RTI A;  2VCP A;  2YI1 A;  3VA3 A;  1BA0 A;  4FVU A;  1EET A;  5AQK A;  5I3U A;  4BRI A;  3ZX3 A;  1HYS A;  5BN8 A;  3JS6 A;  3SAG A;  4N76 A;  1T8E A;  4J8F A;  4CFC A;  4WQ5 C;  2B5J A;  3WNH A;  4M3W A;  1BA1 A;  2HMI A;  3B6P A;  5BN9 A;  1KSP A;  1GOA A;  1QZ6 A;  2IVP A;  3CC4 N;  2AJQ A;  1BIS A;  1VSL A;  4YOU A;  1WNS A;  1T03 A;  1WN7 A;  4YDU A;  4FM2 A;  3C7N B;  2O8D B;  1XC3 A;  1A5X A;  2QWR A;  3K2P A;  1KVC A;  3KLI A;  4JI2 K;  1QSY A;  1ZBU A;  3LAN A;  3AO4 A;  2VWK A;  1Q9Y A;  3ULE B;  2A40 A;  4B1U B;  3THX B;  3MK6 A;  1GOC A;  2PY5 A;  1HPM A;  3GG4 A;  4A2B A;  3OJS A;  1JLA A;  3BF1 A;  3QET A;  3SMP A;  1G99 A;  3D2F B;  3J7Y P;  5HRR A;  2IVO A;  1QE1 A;  3T7Z A;  1J5O A;  4LF4 K;  3MX2 A;  2AA4 A;  3L4Q A;  4EP5 A;  3L2V A;  4O44 A;  1XQS C;  2E2P A;  4CVN E;  3MAQ A;  3ATV A;  3TWH A;  1TAU A;  1JKH A;  1K9M O;  3AVB A;  3OYA A;  4DU4 A;  1GLB G;  2P9L A;  4JRQ A;  3SLC A;  5JS2 A;  4OPJ A;  1U4B A;  3VEW A;  5HP1 A;  5C0Y A;  4JNE A;  1SV5 A;  1RBT A;  3K5M A;  1YHQ N;  1T44 A;  2JWL A;  4MFB A;  4CZJ A;  4FLZ A;  3DLB A;  3QEV A;  1ESV A;  1TK5 A;  1NGG A;  4GV3 A;  1NGD A;  3OYN A;  1I3A A;  1ATN A;  1U2V A;  1BIU A;  4FJ9 A;  2YKM A;  4DR5 K;  3SQ0 A;  2KFN A;  1RT3 A;  1YTA A;  4M3R A;  2Q36 A;  3L2W A;  3KD1 E;  3M3Z A;  4JKE A;  1UWB A;  3A0I X;  1VQN N;  4KO0 A;  4B9U A;  2XY6 A;  4X65 K;  2HBK A;  3EN9 A;  1BI4 B;  3FGU A;  3PSF A;  4KH6 A;  1OH7 A;  1K73 O;  1C1C A;  4W5N A;  1GLF O;  4FLU A;  3R8E A;  1SUQ A;  2BUP A;  3NAE A;  5D3G A;  3VEX A;  3SJJ A;  2W6K A;  4BRM A;  1T7P A;  1BGX T;  3C6A A;  1CZB A;  4N5S A;  3E66 A;  4FZY A;  4B9N A;  1T6C A;  3BZK A;  3A8Y A;  1X9J A;  4O5B A;  1NGB A;  3I8D A;  3NF7 A;  3RR7 A;  1WSG A;  2G8K A;  1SAZ A;  4L8R B;  1VSK A;  3ZSQ A;  3RMA A;  4JV5 K;  4Y1C A;  3VGK A;  4WFB L;  3M8S A;  5JLF A;  3P31 A;  1N36 K;  2VGM A;  3VQE A;  1QSL A;  5LMN K;  2FSK A;  1NK7 A;  3O1W A;  4IO9 L;  1EWR A;  5AQJ A;  3AVK A;  2QA4 N;  3IKM A;  3NH2 A;  4JKA A;  5AQW A;  5M1Q A;  3FZH A;  5KRS A;  4KTW A;  1TYQ A;  4CZM A;  1HNW K;  4CHO A;  3LWL A;  1JLF A;  3J7Z O;  3DXK A;  3AVG A;  4K43 A;  3VEY A;  3RMD A;  4CJF A;  1XNR K;  4DV6 K;  2NNW A;  2IVN A;  4AHC A;  1HRH A;  2EX3 A;  1TK8 A;  5AQX A;  4BQZ A;  1JLG A;  4BR9 A;  2F96 A;  3PIP L;  3WQU A;  4FYD A;  3SV4 A;  1ZXO A;  1HYV A;  4FLW A;  2XY8 A;  1WSF A;  2F9W A;  4B9T A;  1LOT B;  4CHN A;  4FJL A;  1BU6 O;  2E20 A;  1NJY A;  1GLA G;  4C8K A;  3LL3 A;  3ID6 A;  5GAH P;  2EHG A;  4I2P A;  4JKC A;  3NGZ A;  3PO4 A;  2KHO A;  4DR7 K;  2OTJ N;  1RT7 A;  3JXU A;  4ZHR A;  4ELV A;  4F9O A;  1ATR A;  1C0G A;  1XWL A;  1WSH A;  2FBX A;  4C23 A;  4U7B A;  3U8X A;  1KVB A;  2KQ2 A;  3VQ6 A;  1NGI A;  2HBM A;  1IBL K;  4KBO A;  4LF7 K;  2DTU A;  4C8M A;  4FM1 A;  2OA8 A;  3HI0 A;  4GKJ K;  1NMN A;  3F2K A;  5TKW A;  4NB4 A;  4OPK A;  1B9F A;  3HRG A;  4DLG A;  3CXC M;  1S5J A;  4IJA A;  1CLQ A;  4HTL A;  2RN2 A;  2BH1 A;  4JRP A;  4A57 A;  2HNY A;  3JSM A;  3OW2 M;  5IT9 O;  1OH8 A;  1KCF A;  4F8R A;  1GLD G;  1RT4 A;  1GLC G;  3KK1 A;  1C0M A;  3VF4 A;  4E7L A;  4DS4 A;  3LP3 A;  4HHT A;  5J2Q A;  4CEO A;  2PYL A;  3EL2 A;  1NG9 A;  2Q97 A;  4WQ4 A;  3R9P A;  3KK2 A;  3LAM A;  4BDP A;  2UXD K;  4CJT A;  5J1E A;  2Q1N A;  1NGH A;  3DLE A;  4E19 A;  3RWU A;  4QOZ B;  1HJR A;  1SS6 A;  5EU7 A;  2E88 A;  4DQR A;  1BCO A;  1NGF A;  1ZC6 A;  3AO2 A;  1X3M A;  2GV9 A;  2QKK A;  5EX5 A;  4CGJ A;  1B92 A;  3LWM A;  1YJW N;  3U6F A;  1UOC A;  2G8H A;  3VQB A;  4DV4 K;  3IRX A;  1ATS A;  3KVG A;  2P9U A;  2OZM A;  1KD1 O;  2E6L A;  4RG8 A;  1YVN A;  2HHQ A;  4N41 A;  2KLA A;  4IDK A;  4A61 A;  5FPE A;  4LY7 A;  4DV7 K;  5AQU A;  5BPN A;  1ZYQ A;  2WON A;  1FKP A;  2OPS A;  4DQS A;  2O8C B;  4AHS A;  4H0O A;  4BAC A;  2NRV A;  3EE9 A;  4K42 A;  4FJ8 A;  1Z6R A;  4JKB A;  2YHA A;  3HK2 A;  4M45 A;  1JXB A;  4CZH A;  3JAM O;  4DQI A;  2NRH A;  3DAW A;  4BY9 C;  1EKE A;  3VPZ A;  2A6A A;  3NH0 A;  2YHY A;  3HOS A;  2YV0 X;  4BVP A;  5AZI A;  3THW A;  4H0V B;  3VQ7 A;  1OKJ A;  4CJV A;  4FK2 A;  4FCY A;  4BC5 A;  2O8B A;  4DUY K;  3SBG A;  5AQI A;  5HL7 L;  2A3Z A;  4HVJ A;  4KHN A;  4CJ4 A;  3WXM B;  1X1P A;  1DKG D;  3KWG A;  3J7A P;  4PKI A;  3LAK A;  4CJS A;  3OYC A;  2P9P A;  3WXL A;  3TTC A;  3T3F A;  1EWQ A;  4OKK A;  4M7Y A;  3ZEU A;  2ZD1 A;  5HRN A;  3HBT A;  5C42 A;  5GIN A;  1UA1 A;  5AFU A;  5CYM A;  1WAJ A;  5I42 A;  3O3G A;  1J6Z A;  3B8A X;  4I2Q A;  3EO3 A;  3ZSZ A;  1W9H A;  5K14 A;  3U4L A;  3O9T A;  4FW1 A;  4H0T B;  2QM1 A;  4FVM A;  3WXJ A;  4CK3 A;  2OYQ A;  3AAQ A;  1VQM N;  4FK4 A;  3CM5 A;  3G25 A;  4CBU A;  5HOO A;  4JKH A;  4LFC K;  3O9S A;  3NFA A;  1KQS M;  5GIO A;  1N33 K;  3ID8 A;  1QQC A;  5IWA K;  4UQG A;  3DLG A;  3NBP A;  1S1U A;  4O8U A;  5AJ3 K;  3CCS N;  1HQU A;  3G10 A;  3VGL A;  3CD6 N;  4OGC A;  3OA9 A;  1DEJ A;  4B1W B;  3T69 A;  1LV5 A;  3D2E A; 
#chains in the Genus database with same CATH homology
 4CVN E;  5LMU K;  4AQY K;  4DR6 K;  1HNX K;  4X66 K;  4DV7 K;  3T1H K;  5FLX O;  4X64 K;  4K0K K;  4DR3 K;  3J81 O;  4NXM K;  4OX9 K;  1XNQ K;  3T1Y K;  4DR1 K;  3JAM O;  4JI8 K;  4DR5 K;  4CW7 B;  4LF5 K;  4LF9 K;  4JI6 K;  4LFA K;  1FJG K;  1IBM K;  4DR7 K;  1N34 K;  1J5E K;  1XMQ K;  4LFB K;  2E5L K;  4DR4 K;  4B3R K;  3J80 O;  4X65 K;  4YHH K;  4JI1 K;  1HNZ K;  2ZM6 K;  2UUA K;  4JI3 K;  1IBL K;  4DUY K;  4LF7 K;  1N32 K;  4DV0 K;  4V19 S;  2F4V K;  1XMO K;  2UXC K;  5LL6 Z;  4GKJ K;  4B3S K;  4JI4 K;  3J7A P;  4DR2 K;  2UU9 K;  5A2Q O;  4JYA K;  2UUB K;  4X62 K;  1IBK K;  1I94 K;  4JI5 K;  2UUC K;  4LF8 K;  5BR8 K;  5IT9 O;  4DV5 K;  4JV5 K;  1HR0 K;  4NXN K;  2HHH K;  1N36 K;  4LF6 K;  3OTO K;  2UXD K;  4JI0 K;  5LMN K;  4JI2 K;  4DUZ K;  4LFC K;  4JI7 K;  2VQE K;  1N33 K;  4DV6 K;  5IWA K;  4YY3 K;  4KHP K;  4B3T K;  4GKK K;  5AJ3 K;  1HNW K;  4B3M K;  3J7Y P;  4DV1 K;  4DV4 K;  2UXB K;  4LF4 K;  1XNR K;  4DV3 K;  4DV2 K;  2VQF K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...