4GKJK

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4gkjK00
4YHHK 3J7YP 2E5LK 4OX9K 3J80O 5IWAK 4LF7K 4B3RK 2UUBK 3JAMO 4NXMK 3T1YK 4JI3K 2UUAK 4JV5K 2VQFK 2F4VK 5FLXO 4DR2K 4GKJK 4DR3K 4DV2K 1XMOK 1IBKK 4DR7K 4DR1K 4DR5K 4DR4K 4DV7K 1J5EK 4AQYK 4DV6K 1XNQK 5LMNK 4LF8K 5A2QO 1N33K 4K0KK 4X65K 3J81O 4LFAK 1HNWK 4X62K 4JI1K 4V19S 4DUZK 4X66K 4YY3K 4LF6K 4JI4K 3T1HK 4DUYK 2VQEK 1HNXK 4NXNK 4JI7K 4DR6K 2HHHK 5LMUK 4B3SK 2UXDK 4JI6K 4DV5K 4LF9K 2ZM6K 1IBLK 1XMQK 4JI0K 5LL6Z 1IBMK 4DV4K 4X64K 4B3MK 4B3TK 5IT9O 4KHPK 1N36K 1I94K 4LFBK 1HR0K 3OTOK 4CVNE 1XNRK 2UUCK 2UXBK 2UU9K 2UXCK 4DV3K 4JYAK 4DV0K 4JI2K 4CW7B 3J7AP 4LF5K 1N34K 1FJGK 4DV1K 1N32K 4JI5K 1HNZK 4GKKK 5AJ3K 4JI8K 5BR8K 4LFCK 4LF4K
chains in the Genus database with same CATH superfamily
5EX5A 2G8IA 3VQ4A 3G4SN 1P8ZA 1S6QA 3ATUA 4R5PA 1U4BA 4LF7K 1BI4B 1JLAA 4YOTA 4JI3K 4RG8A 5GINA 4B1VA 2P9IB 3HYFA 4CBWA 4BRLA 2XHBA 4CIFA 1JXBA 1XQSC 4I7FA 1MU2A 1Q9XA 2G8HA 4BRNA 3PO4A 4JRQA 1ATNA 4DV7K 4DF4A 1NGJA 4CEOA 4PKHA 3EKUA 3HZ6A 2NZTA 3VQ8A 4EP5A 4PL8A 3SPZA 3MN7A 3OYLA 3SBGA 3NAEA 3ZSOA 2P9KB 4CZLA 1G15A 4BACA 3ZT1A 2YKMA 1VSKA 4HCBA 4X65K 3VESA 2ZE2A 2CGKA 4X62K 4KHQA 1KQSM 4HUFA 3M3ZA 3M8QA 1C6VA 1JJ2M 1E4GT 1WNSA 1GOCA 3SLCA 3VETA 1NK5A 1GLFO 4N5SA 4KBOA 5FRMA 2QWOA 1V4SA 4F3TA 2V7YA 5FRNA 4FWNA 4ILJA 3TSUA 3ZX0A 3HO1A 4CEEA 4W5TA 2O8DB 3ZEUA 1BOTO 4ID1A 1RBTA 2ZM6K 5BRFA 3L2RA 2QM1A 4JKEA 2FXUA 3CMAN 4W5NA 3KLEA 3S3NA 1ZBFA 2ZQBA 2W40A 2JWLA 5KQDA 2ZJQL 3L2UA 4IG0A 3U3YA 4CJ7A 3AVBA 5IT9O 2HF3A 3VQCA 2XY7A 3LP3A 3OYIA 1RBRA 1TYQB 1SL2A 2LSNA 4EAHD 4JHDB 3W3DA 1RBSA 4CZKA 1REVA 3V1OA 2HBJA 2Q1NA 4Y1CA 3H1QA 1A5VA 5DK5A 2OZMA 3UB5A 3PLAA 4HHTA 4AH9A 3LL3A 4GKKK 1TKXA 3SK3A 2A6AA 3LP0A 2X6NA 5JMVA 4LF4K 4FYDA 1NGDA 3CJBA 1R59O 3ULEB 4DSEA 4HUEA 2VGNA 1XHXA 4FWSA 4WQ4A 1RCHA 1S1XA 4OKKA 4WQ4C 1WBBA 2QTDA 4YOWA 2V52B 1LWFA 4YORA 3CCUN 4IOCL 3I56N 3OA9A 4JK8A 3S3MA 4BDZA 1G99A 5I42A 4DR4K 1OVYA 2Q97A 1HUXA 3ULDA 2CGJA 4QS8A 5BPLA 4CESA 3A5LC 1X1PA 5JS2A 2FSNA 5KTQA 4DSLA 4N41A 3AAPA 1K6YA 4JI1K 4V19S 2OTJN 1TK8A 2B6AA 1GOBA 2QWRA 3K2PA 2D0AA 2VYPA 4XH4A 1S22A 1J54A 3TTFA 1QSYA 4CK1A 4K8XA 3AO5A 5LMUK 2UXDK 5C2DA 1YI2N 1IKYA 2WUSA 3EN9A 2P9LB 1L3UA 3LPTA 1RT3A 4Z0UA 4J2EA 3CJCA 3HSTB 3QO9A 3I8DA 2QEXN 1RT4A 1LCUA 3FE1A 5AQHA 4CVNE 1A5WA 3CI5A 1J53A 4BE0A 3KLHA 3GE1A 3OHRA 3LP1A 4AHRA 5CY4A 3KKSA 1DGKN 1W0HA 5AQNA 4M45A 4J2BA 2HOEA 3SUNA 4E19A 4JKGA 4M42A 1LAWA 4W5QA 4EP4A 1D5AA 3L3VA 3AVHA 4B9QA 4B3RK 4BC3A 2EWSA 2YHBA 4HWIA 2UUBK 2O4GA 4UQGA 1ZBSA 3C0BA 1VQON 1TUYA 3O4WA 3HXMA 4QS9A 3OYAA 4JV5K 5EU7A 1ZBUA 2PYLA 3E9OA 3VEVA 4NLBA 4CZJA 1Q8IA 3V9WA 4FWKA 3RMDA 3C7NA 4FLUA 1OKJA 2XY8A 3O5BA 5AQLA 4AHCA 2QWPA 3TAQA 3VPZA 2HHXA 5K14A 4Z94A 4IDHA 4A5AA 1NGCA 3L6QA 3CJ7A 1WSHA 1U48A 4O8UA 3T19A 2QA4N 3QMLA 5AQGA 1EO1A 4OPKA 2O8DA 2PZSA 4CF0A 5AR0A 3CCEN 3HJFA 4DKWA 2Q36A 3K5MA 3NGIA 4RW8A 3SQ4A 2NRWA 3S41A 4LFAK 1OVQA 4A2BA 4E1MA 1W9HA 2YX6A 3PSFA 5JVHL 2QWQA 2E1ZA 2I5JA 1FKOA 1SAZA 2E2PA 3T1HK 1UA0A 3EY1A 4DSKA 3CIPA 5ADXA 2HBLA 3P39A 5M1PA 4LF9K 1VSJA 1ZYQA 2FLOA 4C8KA 2ITGA 3Q7BA 1U45A 3OYDA 3SQ0A 3ZLJA 3K0SA 3EKSA 2OANA 3K5LA 4JS4A 1I94K 1VHXA 3OTOK 2QWNA 1C0GA 3F2KA 3HOTA 3H1VX 3QLHA 3C65A 4OKEA 4DG1A 1YJ9N 1X9JA 4J8FA 3BEXA 3F9KA 3K5NA 2P5GA 1EKEA 5KGXA 1NJYA 3ZT2A 4CJFA 1NGFA 3AV9A 4C1NK 1SKSA 4M3TA 3BUZB 3HM8A 1RBVA 3H3NO 4NLCA 1OH7A 2KHOA 2BGGA 1NG9A 1ATSA 3G25A 3O3HA 3D2EA 3D6RA 3AVCA 4JRPA 3T1YK 4JEPA 3IG1A 3D2FB 3KD1E 2RN2A 3AO2A 5KRTA 5JS1A 2F4VK 2X78A 3WXLA 1QSLA 3PSIA 2KFZA 4A57A 4YNQA 3RRHA 2KZZA 3QEXA 2F8TA 4C1NI 3RTVA 1NK4A 1JCFA 2I7PA 1QHTA 3CCMN 3D45A 1K73O 1VQ8N 3SBTA 3V9XA 3AARA 3CFPA 4KH4A 1LAVA 1B9FA 3TPQA 3KD5E 4K0KK 4CJVA 1N6QA 4CECA 1KD1O 2FC0A 4BRAA 4JKFA 3ZEUB 4DCHA 2NRTA 4BRPA 4UY8O 4DU4A 3RMAA 2IIRA 2NRHA 1YUWA 2ZF5O 4DFKA 3CC4N 4CJ3A 4AF1A 3WNEA 3VQ5A 1HJOA 2BDPA 4FJHA 1NJWA 3P5JA 5C15A 3G6EN 4OLBA 5LL6Z 4JKDA 4DV4K 1XHZA 1JCGA 3B6OA 1BISA 3B6PA 3AVMA 2BE2A 2D0BA 4FK2A 3O3FA 4JD2A 3CXCM 4H0VB 3VQBA 3N4QA 1SUQA 3O80A 3BF3A 4CW7B 4JKGB 4FJKA 3P4IA 1X3NA 1EQYA 1UOCA 4ISEA 3WQUA 3DXMA 5LJWA 1IKVA 1D8YA 3LM2A 4U7BA 3H3OB 1JLEA 4H4MA 4IXCA 3SMPA 4IKFA 4CGIA 2FBYA 1WSFA 1T3VA 4EZ6A 2YNFA 1ZBIA 3R3LA 3L0QA 3WXMB 3M8RA 2HNDA 2OPPA 4DHYA 2G8VA 4KAZA 2D1KA 2P1JA 1RT1A 4NCAA 3KJVA 4EHUA 2KW4A 3OYNA 3F5TA 2FBXA 2E20A 3H6EA 5CYQA 4DR5K 4FOIA 1VRUA 3TI0A 4F4KA 3DRPA 1NGGA 3O4NA 3VERA 2GUIA 1OH6A 1F21A 4FLWA 3K58A 3DI6A 4OKJA 4DV6K 3ZCMA 1T8EA 4KI6A 4PKGA 2AJQA 3U3GA 1WAJA 5F0XA 5TKYA 4H5NA 4H0PA 3T1AA 3HVTA 2OCEA 3V9SA 4CJTA 3OYCA 3D0PA 4HUGA 3MEDA 1BL3A 2P5OA 4BR7A 4CFAA 3QFPA 3AAQA 1IJJA 2QW9A 1KFDA 1ASWA 1T03A 3KK2A 4NCGA 2EHGA 1YT3A 2RKIA 5I9EB 3IFRA 3P38A 4BE2A 4B3OA 4YOUA 1KCFA 2OA8A 4FLTA 4JS5A 2IS3A 3AVNA 4IBNA 1HQUA 4BR5A 4H0XB 4YOYA 2W6LA 5FDLA 3DOLA 4ICLA 5AQWA 3IS9A 4LF5K 2GWKA 1UWBA 3QDKA 3A5NC 4WFAL 4XIUA 4PWDA 4Q0BA 1ZC6A 3CCRN 4PKIA 1HNZK 2DFEA 5GIPA 5AJ3K 5AQTA 3LANA 2IC3A 3CJ1A 3LZIA 3OW2M 5AQYA 3GL1A 4A59A 4EFHA 2Q0UA 1RBUA 2H3GX 3WQTA 3CPWM 4E7KA 4QAGA 1BQMA 1NOZA 3C95A 1Q7YO 2A1RA 3ZSVA 3OS1A 1DTQA 3WT0A 4BGAA 4CD1A 1VQ5N 3V1RA 2OPRA 1VSEA 5KPTA 3SZ2A 4E1JA 4I6MA 2IGIA 4FLVA 4CK2A 1NGHA 4H5WA 5BN8A 2BH1A 3THXA 3VF2A 4BC2A 3LDLA 5E26A 3CQXA 4O4GA 1DTTA 4RW6A 3RSEB 1LWEA 3CQ8A 3EE9A 1KLMA 1Y64A 3R8EA 1BHLA 3DAWA 5J2MA 4M3RA 1JL2A 3TR8A 3QIPA 1NJIO 4HCCA 3FZKA 3QNNA 5EXWA 1TKZA 1RT6A 1VSLA 2D4WA 4IFVA 2Z1IA 4NYFA 4H5VA 4NXNK 4JI7K 1OH8A 5AQSA 2GTDA 3VEOA 3SNNA 1WOQA 2BTFA 1XMQK 4FPAA 4DTNA 3WNFA 1YVNA 1DLOA 1EX4A 4DTXA 1DT9A 4DQRA 4GV9A 4B3MK 3BGRA 3SCXA 3ZSYA 1E4FT 1IG8A 3V9ZA 3FLCO 1T6CA 3O8MA 4U67L 2UU9K 4GVEA 1Q86O 4DV0K 4DTPA 3VEWA 3FZLA 4BG9A 3HPGA 4CZHA 4BR0A 3A2FA 1NM1A 3GG4A 1BGXT 1M90O 1NOYA 4B9SA 1EXQA 3P1GA 4CGJA 1RT2A 3C94A 4LFCK 4M7XA 4CEZA 4KI4A 4IG3A 1V4TA 2VCPA 3MWPA 3TTDA 3MEGA 4GV6A 3LAMA 3G10A 2BUPA 3M5RA 4KB1A 2IOCA 4OJRA 1SS6A 4QOZB 4M63C 5M1NA 2HHWA 4Y1DA 2DFHA 3FFIA 3QINA 1JLGA 1JKHA 4JK9A 5JLHA 3VF4A 5JLFA 3O9UA 3A5OC 4CEBA 3HL8A 1FW6A 3TTCA 1HKCA 1GLDG 3UIQA 1TK0A 4DR1K 1YITN 3MN9A 3WNGA 3G0ZA 1BWFO 4GV3A 1QSSA 3R9PA 3KIOA 3AGKA 3D7EO 4KKOA 2P9NB 1ESVA 3QB0A 1VRTA 5A2QO 3CCQN 1KVCA 3RR7A 2HVHA 3J81O 1L3VA 1RDWX 3MXIA 3UKRA 4FXDA 4DUZK 5AQPA 4BRFA 1IKXA 1TAQA 4M41A 2E88A 1WSIA 1Q81O 4CHYA 4CI6A 1NK7A 2VQEK 4JN4A 3EEQA 1NJXA 5CR4A 4A5BA 2NNWA 1C0UA 3VTHA 2G8UA 3QEIA 1SQKA 2UYTA 5FPEA 4CZFA 3HRGA 3KKRA 4B9LA 1KVAA 1IBMK 1L3SA 1HYVA 1BUPA 4FJMA 2D0PA 4X64K 2PAVA 3QEWA 3W0LA 1L5UA 3DXKA 4C8LA 2O8FA 3MCPA 3B8AX 4CZIA 1LV5A 3MWTA 1DEJA 3SV4A 4WQ5A 3NH1A 3PV8A 5FPNA 4DQIA 1XWLA 3G71N 3TU5A 4L8RB 4RTFD 1TGOA 1ASVA 3FR0A 4LH5A 3JXUA 2ZJRL 2O4IA 2DY4A 4FWOA 2ZJPL 4YDUA 4DLEA 4BVOA 1QTMA 3P83D 1K8KA 4KPYA 3TWHA 3J80O 5IWAK 5HP1A 1C1BA 4C23A 3EYZA 2UUAK 3MX2A 2IDOA 3ZX2A 4IWVA 4W5OA 2QKKA 1NK0A 4K43A 4C8MA 2Q3SA 4IEIA 3ZSQA 2P9LA 3HPHA 2FBTA 4DTOA 4MDAA 5D3GA 2B4JA 4DV2K 2QXLA 1YIJN 3WEEB 3TAGA 2HNYA 5KQ8A 3VQQA 3VQ9A 3PIOL 2ASOA 4BRDA 1S1TA 2FSKA 5BRHA 1XNQK 2VGMA 2HHTA 2W41A 2HHSA 5MLCQ 4LF8K 4BROA 3OS0A 4EHTA 4CEFA 3VF6A 4DB3A 3QEVA 3SAHA 3OY9A 1C0TA 1CLQA 3CJAA 3T69A 3ENHA 3ZSWA 4N56A 2OZSA 1BDGA 3CJ9A 3KLIA 2HMPA 4B08A 2GEMA 4G1QA 4YY3K 3NMUA 1NMNA 4F8RA 2HW3A 4H0OA 2NRZA 1HNXK 3PX0A 3KVGA 4MQ3A 3L8BA 2V7ZA 4LH4A 1IBLK 1TKDA 4CFBA 4C8NA 5T7BA 3WXIA 1W7AA 3E01A 2NLXA 4EIAA 3ZETB 3LALA 2O8BB 1RDDA 3RMCA 4LC9B 3KHYA 1SZ2A 5J2NA 3U4LA 2PBDA 1S1WA 4BREA 5AQXA 1LWCA 1QVGM 1L3TA 3MECA 4O44A 3ZSZA 4LY7A 1NBWA 3L2QA 3KK1A 3CYMA 3LZJA 3CCSN 2VG6A 3ENBA 3O9TA 2HF4A 1XC3A 1X9MA 4JI5K 4JNEA 4CBUA 2OTLN 2HHUA 1J5OA 5C0YA 2CH6A 5LY3A 1I39A 5BR8K 2YNIA 1YAGA 3THWA 3SV3A 4FO0A 4IDKA 5HRRA 3TAFA 1S5JA 3TANA 1H1VA 5AQJA 4FJJA 3TAMA 4BGBA 2A5XA 2HVIA 4CGHA 3CFOA 4WQ5C 2V51B 4DU3A 3VA3A 4O5FA 4ZTJA 4NCBA 3VQAA 1QVFM 2P9PA 1NNEA 3H08A 3AVKA 1KAZA 5JICA 1YXQA 4FOEA 3LPUA 3OYEA 5F1XA 3M8PA 5AQKA 5M1KA 1RT5A 2PFUA 3HOSA 3VGLA 4DQ8A 4DR7K 1JCEA 2VG7A 2A41A 4QS7A 2FF3B 3DYAA 3BZCA 4BG8A 5BRDA 1J5EK 1X9WA 2GBZA 4FWQA 5HROA 2O8EA 1GOAA 1ZXOA 1A5XA 4CEQA 3HP6A 3AGRA 4QCLA 3OJSA 1VQ9N 2RE2A 4FJLA 2HB5A 3MEEA 3TARA 4FW2A 5GAGP 3NH2A 3NDKA 3K57A 1RGIA 1NKCA 4BWMA 2X74A 1NGBA 3AA4A 1KSPA 2IVOA 3AY9A 4LF6K 2E2NA 4E89A 1EWRA 4C8OA 4DR6K 3MMVA 1WBDA 3V4IA 2CGLA 3CCJN 4Z4CA 4JI6K 4FVMA 2RHKA 4F3OA 1QQOA 3K9KA 2WBNA 4LSNA 4BRKA 4CJUA 4DTMA 2EX3A 4BRHA 2YHAA 4FM2A 3ZYYX 5CZ1A 3QNOA 4B1UB 3CHWA 2HBMA 4O0IA 1K9MO 4DV3K 1NKEA 4JI2K 3UKUA 5ADXH 2QKBA 3AVAA 1YJWN 3AVJA 1LW2A 3DLEA 3N4PA 4A2AA 4CFDA 2D0OA 3CD6N 3L4QA 4O55A 3L4IA 3ZSXA 3QEPA 4WE1A 3VGKA 3RVCA 3D2EB 3BY5A 4B9TA 2D0CA 3MXMA 4JI8K 5GAEP 3S3OA 1X3MA 2DFFA 3MXJA 1S9EA 5C2FA 4CHQA 1HKBA 1TK5A 2YKNA 4FJXA 3QESA 4MO5A 3L2VA 2RF2A 4FLXA 5AZIB 1UAXA 4H5TA 4WF9L 1HX1A 1FKPA 3THWB 4H03B 1MWMA 2PY5A 3LDSA 3SUOA 4M3UA 3DLRA 3MAQA 1Y97A 3V9UA 4CGGA 1GLJO 3TSQA 1S6PA 3DLGA 2ZGYA 1XC9A 2HBKA 1WSGA 4L3QA 1YJNN 1BA1A 3CM6A 3E9LA 4DLGA 4B9UA 1SKRA 3OYBA 3WXJA 2GUPA 2W42A 3HBTA 3VQ6A 1HNWK 4KFBA 4DQSA 1C0MA 4BC4A 3SI6A 3O6WA 3GBTA 3VEYA 1T05A 1LW0A 3WEEA 2F96A 4JAXA 4PHTX 3IKMA 1VQ6N 3LM9A 3THVA 4FZYA 3HSCA 2NRXA 3LDPA 3CPEA 4PA1A 2YHYA 3TSPA 3DXKB 1WN7A 1HLUA 2Q0RA 4DMNA 4CGFA 4IO8A 2QXFA 3KLGA 1Z26A 4KHSA 3SUQA 2Z1GA 1NK8A 2G8KA 5AQUA 2IAJA 3E66A 2XO7A 4OLAA 4Z4EA 1N5YA 4B3TK 4KHPK 1HR0K 3WUHA 3HTVA 3HP9A 3VN5A 3KWIA 5TKWA 3FFKB 2NRRA 3V1QA 5C10A 4JYAK 1W97L 5KPZA 3KLFA 2A42A 1U6ZA 1N34K 4FVUA 5J2QA 4OPHA 1HPMA 1D9DA 1TYQA 1Z6RA 4IZ9A 1IG9A 5E84A 5AFUH 4FCYA 4RCHA 4FK0A 4BRCA 3AVIA 2P9IA 2W6KA 4B8CA 3HI0A 3PY8A 2JLEA 4YFUA 3THYB 2P9SB 3QICA 2E8AA 1M1KO 1RFQA 4CJQA 4I2PA 1Z25A 3AO1A 3M1FA 3KWGA 4J2AA 3CMEN 3ENOA 4KRFA 2AA4A 3H46O 3T3FA 4FJ5A 4DR3K 2VWBA 3R6MA 3E1YA 4A62A 1Z05A 4FZXC 4H0YB 5C42A 1VSFA 4FLZA 5HRNA 1QQCA 5DM6L 4B9MA 3QFUA 3FGUA 3KTQA 1NKBA 4E7LA 2QWLA 1RDCA 2ATQA 1C0FA 3I33A 3VQPA 3PO5A 1BIZA 4K41A 4LD0A 4DSFA 2E1YA 4GMJB 1U2VA 3NF7A 2KZMA 3OBYA 3ITHA 4CF9A 4X66K 2ITMA 1BCOA 2ETJA 1QZ5A 1FXXA 2A3ZA 2HHQA 4FJIA 2XRIA 4CZGA 4Z4HA 5FPMA 1SL0A 2GELA 1Q82O 1VK0A 3I0SA 1BU6O 2GX9A 1RTIA 1MDUB 4OGEA 2KTQA 3RMBA 4M7YA 4BVPA 2WONA 1P90A 4O8KA 4R79A 3Q7CA 1S9GA 4I6MB 1NK9A 2YHWA 3A0IX 2OPQA 3QBWA 4HTUA 3KZBA 4CK3A 4FLYA 1CZAN 4DSJA 4OO1J 1QHAA 2A40A 4CD3A 3AA2A 2UXCK 1KAXA 5FROA 3OYFA 3J7AP 1VSHA 4BR4A 5J2PA 4ISGA 4B8AB 4K42A 1EETA 1N32K 4KREA 3IAYA 3AA3A 4B1YB 4H0TB 2Z1JA 3OBWA 4CHZA 3O1WA 1YTAA 1WUAA 2P9PB 4YHHK 4AHTA 3J7YP 2E5LK 3DLLL 1IH7A 3NCIA 3O08A 4B9VA 3O1BA 4DQPA 4GNIA 5AQFA 1QS4A 4O0JA 4BY9C 4CJLA 1VQNN 4I9QA 3NF9A 1QZ6A 5E41A 3SMSA 5J1EA 4E0DA 3CQYA 3LDNA 4F2SA 3J7ZO 4AQYK 5AQIA 1K8AO 3ID8A 3PX4A 1EP4A 5M1QA 4BQZA 2D5RA 1RILA 3LWLA 2JGUA 3I0RA 2GWJA 3L3UA 2P9UB 4F2RA 4DU1A 4CHPA 1GLBG 4ELUA 3EL2A 4IFYA 1X9SA 1I3AA 1CXQA 2O8CA 1BO5O 5H1SQ 2P9SA 4KTQA 1RDUA 3R1XA 2OPSA 3ZT0A 1SKWA 1UA1A 4DV5K 4WFNL 4CJPA 4KTZA 3MCAB 4Y0WA 4LFBK 4XH1A 3SAGA 4FW1A 4FK4A 1XNRK 2Y1IA 4CGDA 1GLAG 2B5JA 5SWMA 2ZD1A 2R7YA 3RRGA 1FJGK 1ZBLA 1CZBA 2O8FB 1ASUA 1NU0A 3IMXA 3T7ZA 3QETA 5AZJA 1JL1A 3VQ7A 4DQQA 4J2DA 3VOVA 3C6AA 1IO2A 2E6MA 3WXKA 1BA0A 4AHSA 3ALYA 5F2RA 4CCHA 3P31A 3OYMA 1O13A 3DLBA 2P9NA 3C7NB 4MLHA 5HLFA 3TAPA 1S3XA 3NBPA 3CC7N 4CJ5A 3NFAA 4BC5A 3HM9A 5BPNA 3C6TA 1K8KB 5HBMA 5HRSA 3AVFA 5CZ2A 5KRSA 4GKJK 1BIUA 1BG3A 4Z4GA 1YTUA 3CF5L 4ZTFA 4DFMA 3VA0A 4IOXA 2FF6A 4OVLA 3PX6A 3CG7A 1VQMN 3CC2N 4CIGA 3EO3A 2WC9A 1XI1A 1VQ4N 3SQ2A 3SJHA 4FWRA 3E9PA 4ZHRA 4JLHA 2ASMA 1RDBA 4CF2A 4Z4FA 1U04A 3CERA 4CHOA 4CFCA 4LSLA 4PQUA 4JKAA 2JWKA 3FZHA 3DWLA 4NO7A 4AM7A 4CBXA 1U47A 4K8ZA 4M3WA 4CZMA 4BRGA 3F73A 2YJFA 3VGMA 3NH0A 4CEDA 4CJ4A 1TAUA 2QI2A 3AO4A 1RTJA 3F9MA 3NHGA 1S1VA 1E3MA 5HL7L 3DMJA 3DRRA 3VQDA 4PUOA 3SYZA 3ZX3A 1VQ7N 2HHHK 4I9LA 1J9AA 4ID5A 1HMVA 5BN9A 4M3ZA 3FZFA 4DSIA 2HSTA 2G8FA 1JLQA 4I2QA 3HPOA 4FJ9A 1HPZA 1U2VB 3OVNA 4NB4A 3VEXA 4TSXA 3ZT4A 1BQNA 3KK7A 1N36K 4PL7A 5EVZA 3AO3A 4DTRA 5BR9A 2F8SA 4CZEA 3EZ5A 4CE9A 5HOOA 3SAFA 3CM5A 5C24A 4JKHA 1KC8O 2Q31A 4KTWA 4JK7A 4E7JA 3AVLA 2WTUA 2OYQA 4O5BA 5HRPA 4OPAA 2ASPA 4FZZA 1EWQA 1IKWA 3TABA 1T7PA 3DLHA 3NGYA 1YHQN 1YF5L 4RW9A 2QK9A 3A8YA 3BZKA 4BDYA 3VMFB 3O9RA 3S9HA 1NGIA 3EZWA 3I8BA 1C1AA 3U6FA 3L2WA 3IDHA 2YJEA 3JAMO 2WFBA 4CJSA 5GADP 1NK6A 3K59A 4BDPA 2E2OA 1WAFA 1BCMA 3ISNC 1JLCA 1WSJA 2KQ2A 1WB9A 2P9UA 2CH5A 4E7IA 1Q9YA 2DPNA 3OYKA 1IBKK 1NWKA 2KKZA 3D2FA 4CIEA 4FJ7A 3ATVA 4KB0A 5JVGL 3H45C 5GAHP 2WOMA 3NF8A 3UE5A 3JYTA 2E2QA 1ITGA 3ASMA 3QIOA 5SZTA 4H4OA 4KHUA 1QE1A 1QQMA 3NF6A 3V6DA 4CJEA 1B9DA 3VEZA 1VSDA 4DS5A 3DRSA 1GLLO 2O8EB 2VG5A 3ZETA 3SUPA 3J8AA 1S72N 4ELVA 5AQZA 2O8BA 1VSIA 2AP1A 1HYSA 3HT3A 1KVBA 3M6GA 4NYNA 1VQKN 2GV9A 2RPIA 4Z4IA 4AM6A 1KAYA 1NGEA 1RTDA 3QERA 1MWKA 2I7NA 2G8WA 4JI0K 4BR9A 1RT7A 3AVGA 1TVRA 4E3SA 2KFNA 4B1WB 3DXMB 4IJAA 4BRIA 3O9SA 4BRQA 1OH5A 3OYHA 3NVKA 4ISFA 2HHVA 4BE1A 4DFJA 3IRXA 2UUCK 1NGAA 1KXPA 3V81A 2XY5A 2E6LA 1YVUA 4M3XA 4DF8A 4AHUA 1NLVA 1HRHA 5CE3A 4JD2B 3C6HA 4AHVA 3IUCA 2DTUA 4RW7A 2YNGA 4KO0A 4FM0A 5I3UA 2FBVA 2BANA 1U49A 3DOKA 1JXEA 4WCEL 3O3GA 3MDQA 4IEEA 5CYMA 3M8SA 2X6SA 4GVMA 4A61A 3CCLN 4OX9K 5AZJB 4DTJA 1T6DA 2IVNA 5AFUA 1RTHA 4NXMK 4B1XB 3VENA 4E1NA 2P9KA 4E7HA 3GDQA 4HTLA 5B8HA 4XH5A 3OYGA 3RWUA 4DWIA 4ELTA 1TL1A 1Q18A 3DM2A 1ZBHA 1XMOK 3ZT3A 3VQEA 5CHIA 4KHYA 4CF1A 1NJZA 1O1WA 1DKGD 2ZGZA 1LOTB 4CHNA 1QQNA 1C1CA 3I55N 5EY4A 3UKUB 3O9QA 1KRPA 3VTIA 4MLEA 2F9TA 3NE6A 2O8CB 3ZSRA 3SPYA 2KLAA 4WYBA 2YNHA 2FSJA 5AQMA 3SJJA 4IOAL 1J6ZA 4JI4K 3A5MC 1NMDA 4DUYK 4HVJA 1KFSA 5BPMA 5DM7L 4B3SK 3K9JA 1TKTA 4KHWA 4H8KA 4IFEA 3C6UA 1RNHA 3ID6A 3CETA 3RR8A 3PUFA 4PY5A 1W2BM 4DS4A 5C25A 4MFBA 1JLBA 1GLEG 1SL1A 1XUPO 4FJNA 3O4QA 1VSMA 2YHXA 4RW4A 2YV0X 4CJWA 2NRVA 4ILHA 4OGCA 3DLKA 3U9ZA 3LWMA 1GLCG 5M1FA 2E4LA 4JKCA 5AZIA 4FPBA 5FPDA 4IJNA 4H5RA 4Q5VA 3PIPL 4CJRA 4B9NA 3SQ1A 4XEIA 1T44A 4KH5A 1S1UA 4DV1K 4M3YA 3DJCA 4KH6A 4DFPA 4FM1A 1BI4A 4BQLA 4JHDA 1VQLN 4K25A 4CEAA 4MO4A 4JKBA 4CF8A 3OS2A 1D9FA 4KV8A 5EOYA 2Y1JA 3KK3A 1ATRA 2Q2RA 1CXUA 3HK2A 4B1ZA 5KPRA 4IO9L 3MK6A 3RSEA 2VQFK 1WSEA 4W5RA 1ILYA 4FWLA 4DTUA 5FLXO 4DR2K 2Z1HA 1KLNA 3THXB 4EZ9A 3JS6A 5KGWA 5DMRA 3WNHA 5AQQA 3CFRA 3BDPA 1TV6A 3LAKA 2NUBA 3CCVN 4F9OA 1KTQA 3NVMA 2F7TA 5LMNK 3OYJA 3LDOA 4FWMA 1N33K 4FJ8A 1B92A 1HNVA 5GIOA 5M1OA 3LP2A 4CERA 3U8XA 1HYZA 1MA9B 3GOIA 4BRMA 5C12A 1HNIA 1D4XA 2QWMA 4CJKA 4AILC 2J4RA 3BP8A 1WLJA 4FJGA 1IV0A 3UKRB 2HNZA 4RWTA 3TAEA 1RDAA 2PYJA 3NGZA 5LJVA 4YOXA 3BF1A 1VQPN 4WFBL 3QBXA 1VAZA 1HKGA 4KHNA 1HJRA 1CZ9A 3AA5X 1SV5A 2YI1A 4FWPA 4YOVA 1FK9A 5AQRA 2VWKA 4MDBA 4YDUC 3JSMA 3MN6A 1TUUA 4FL9A 2IVPA 5AQOA 4N76A 3U9DA 4G9ZA 1HQEA 2XY6A 2UXBK 3K5OA 1R0AA 4BWJA 4BR2A 4GY2B 4DTSA 1JLFA 5BREA 4N47A 4ILGB 4FSVA 4GW6A 3ULEA 3OJUA 3FZMA 2VWJA 2YCHA 2ZWHA 3EE8A 2F9WA 3THYA 2A1SA 1TL3A 4OPJA 3LDQA 2P51A 5KI6A 3MN5A 3HVRA 1N8RO 3MX5A 5AQVA 5ELZA 2HMIA
chains in the Genus database with same CATH topology
4YHHK 3J7YP 2E5LK 4OX9K 3J80O 5IWAK 4LF7K 4B3RK 2UUBK 3JAMO 4NXMK 3T1YK 4JI3K 2UUAK 4JV5K 2VQFK 2F4VK 5FLXO 4DR2K 4GKJK 4DR3K 4DV2K 1XMOK 1IBKK 4DR7K 4DR1K 4DR5K 4DR4K 4DV7K 1J5EK 4AQYK 4DV6K 1XNQK 5LMNK 4LF8K 5A2QO 1N33K 4K0KK 4X65K 3J81O 4LFAK 1HNWK 4X62K 4JI1K 4V19S 4DUZK 4X66K 4YY3K 4LF6K 4JI4K 3T1HK 4DUYK 2VQEK 1HNXK 4NXNK 4JI7K 4DR6K 2HHHK 5LMUK 4B3SK 2UXDK 4JI6K 4DV5K 4LF9K 2ZM6K 1IBLK 1XMQK 4JI0K 5LL6Z 1IBMK 4DV4K 4X64K 4B3MK 4B3TK 5IT9O 4KHPK 1N36K 1I94K 4LFBK 1HR0K 3OTOK 4CVNE 1XNRK 2UUCK 2UXBK 2UU9K 2UXCK 4DV3K 4JYAK 4DV0K 4JI2K 4CW7B 3J7AP 4LF5K 1N34K 1FJGK 4DV1K 1N32K 4JI5K 1HNZK 4GKKK 5AJ3K 4JI8K 5BR8K 4LFCK 4LF4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH K;  3J7Y P;  2E5L K;  4OX9 K;  3J80 O;  5IWA K;  4LF7 K;  4B3R K;  2UUB K;  3JAM O;  4NXM K;  3T1Y K;  4JI3 K;  2UUA K;  4JV5 K;  2VQF K;  2F4V K;  5FLX O;  4DR2 K;  4GKJ K;  4DR3 K;  4DV2 K;  1XMO K;  1IBK K;  4DR7 K;  4DR1 K;  4DR5 K;  4DR4 K;  4DV7 K;  1J5E K;  4AQY K;  4DV6 K;  1XNQ K;  5LMN K;  4LF8 K;  5A2Q O;  1N33 K;  4K0K K;  4X65 K;  3J81 O;  4LFA K;  1HNW K;  4X62 K;  4JI1 K;  4V19 S;  4DUZ K;  4X66 K;  4YY3 K;  4LF6 K;  4JI4 K;  3T1H K;  4DUY K;  2VQE K;  1HNX K;  4NXN K;  4JI7 K;  4DR6 K;  2HHH K;  5LMU K;  4B3S K;  2UXD K;  4JI6 K;  4DV5 K;  4LF9 K;  2ZM6 K;  1IBL K;  1XMQ K;  4JI0 K;  5LL6 Z;  1IBM K;  4DV4 K;  4X64 K;  4B3M K;  4B3T K;  5IT9 O;  4KHP K;  1N36 K;  1I94 K;  4LFB K;  1HR0 K;  3OTO K;  4CVN E;  1XNR K;  2UUC K;  2UXB K;  2UU9 K;  2UXC K;  4DV3 K;  4JYA K;  4DV0 K;  4JI2 K;  4CW7 B;  3J7A P;  4LF5 K;  1N34 K;  1FJG K;  4DV1 K;  1N32 K;  4JI5 K;  1HNZ K;  4GKK K;  5AJ3 K;  4JI8 K;  5BR8 K;  4LFC K;  4LF4 K; 
#chains in the Genus database with same CATH topology
 5EX5 A;  2G8I A;  3VQ4 A;  3G4S N;  1P8Z A;  1S6Q A;  3ATU A;  4R5P A;  1U4B A;  4LF7 K;  1BI4 B;  1JLA A;  4YOT A;  4JI3 K;  4RG8 A;  5GIN A;  4B1V A;  2P9I B;  3HYF A;  4CBW A;  4BRL A;  2XHB A;  4CIF A;  1JXB A;  1XQS C;  4I7F A;  1MU2 A;  1Q9X A;  2G8H A;  4BRN A;  3PO4 A;  4JRQ A;  1ATN A;  4DV7 K;  4DF4 A;  1NGJ A;  4CEO A;  4PKH A;  3EKU A;  3HZ6 A;  2NZT A;  3VQ8 A;  4EP5 A;  4PL8 A;  3SPZ A;  3MN7 A;  3OYL A;  3SBG A;  3NAE A;  3ZSO A;  2P9K B;  4CZL A;  1G15 A;  4BAC A;  3ZT1 A;  2YKM A;  1VSK A;  4HCB A;  4X65 K;  3VES A;  2ZE2 A;  2CGK A;  4X62 K;  4KHQ A;  1KQS M;  4HUF A;  3M3Z A;  3M8Q A;  1C6V A;  1JJ2 M;  1E4G T;  1WNS A;  1GOC A;  3SLC A;  3VET A;  1NK5 A;  1GLF O;  4N5S A;  4KBO A;  5FRM A;  2QWO A;  1V4S A;  4F3T A;  2V7Y A;  5FRN A;  4FWN A;  4ILJ A;  3TSU A;  3ZX0 A;  3HO1 A;  4CEE A;  4W5T A;  2O8D B;  3ZEU A;  1BOT O;  4ID1 A;  1RBT A;  2ZM6 K;  5BRF A;  3L2R A;  2QM1 A;  4JKE A;  2FXU A;  3CMA N;  4W5N A;  3KLE A;  3S3N A;  1ZBF A;  2ZQB A;  2W40 A;  2JWL A;  5KQD A;  2ZJQ L;  3L2U A;  4IG0 A;  3U3Y A;  4CJ7 A;  3AVB A;  5IT9 O;  2HF3 A;  3VQC A;  2XY7 A;  3LP3 A;  3OYI A;  1RBR A;  1TYQ B;  1SL2 A;  2LSN A;  4EAH D;  4JHD B;  3W3D A;  1RBS A;  4CZK A;  1REV A;  3V1O A;  2HBJ A;  2Q1N A;  4Y1C A;  3H1Q A;  1A5V A;  5DK5 A;  2OZM A;  3UB5 A;  3PLA A;  4HHT A;  4AH9 A;  3LL3 A;  4GKK K;  1TKX A;  3SK3 A;  2A6A A;  3LP0 A;  2X6N A;  5JMV A;  4LF4 K;  4FYD A;  1NGD A;  3CJB A;  1R59 O;  3ULE B;  4DSE A;  4HUE A;  2VGN A;  1XHX A;  4FWS A;  4WQ4 A;  1RCH A;  1S1X A;  4OKK A;  4WQ4 C;  1WBB A;  2QTD A;  4YOW A;  2V52 B;  1LWF A;  4YOR A;  3CCU N;  4IOC L;  3I56 N;  3OA9 A;  4JK8 A;  3S3M A;  4BDZ A;  1G99 A;  5I42 A;  4DR4 K;  1OVY A;  2Q97 A;  1HUX A;  3ULD A;  2CGJ A;  4QS8 A;  5BPL A;  4CES A;  3A5L C;  1X1P A;  5JS2 A;  2FSN A;  5KTQ A;  4DSL A;  4N41 A;  3AAP A;  1K6Y A;  4JI1 K;  4V19 S;  2OTJ N;  1TK8 A;  2B6A A;  1GOB A;  2QWR A;  3K2P A;  2D0A A;  2VYP A;  4XH4 A;  1S22 A;  1J54 A;  3TTF A;  1QSY A;  4CK1 A;  4K8X A;  3AO5 A;  5LMU K;  2UXD K;  5C2D A;  1YI2 N;  1IKY A;  2WUS A;  3EN9 A;  2P9L B;  1L3U A;  3LPT A;  1RT3 A;  4Z0U A;  4J2E A;  3CJC A;  3HST B;  3QO9 A;  3I8D A;  2QEX N;  1RT4 A;  1LCU A;  3FE1 A;  5AQH A;  4CVN E;  1A5W A;  3CI5 A;  1J53 A;  4BE0 A;  3KLH A;  3GE1 A;  3OHR A;  3LP1 A;  4AHR A;  5CY4 A;  3KKS A;  1DGK N;  1W0H A;  5AQN A;  4M45 A;  4J2B A;  2HOE A;  3SUN A;  4E19 A;  4JKG A;  4M42 A;  1LAW A;  4W5Q A;  4EP4 A;  1D5A A;  3L3V A;  3AVH A;  4B9Q A;  4B3R K;  4BC3 A;  2EWS A;  2YHB A;  4HWI A;  2UUB K;  2O4G A;  4UQG A;  1ZBS A;  3C0B A;  1VQO N;  1TUY A;  3O4W A;  3HXM A;  4QS9 A;  3OYA A;  4JV5 K;  5EU7 A;  1ZBU A;  2PYL A;  3E9O A;  3VEV A;  4NLB A;  4CZJ A;  1Q8I A;  3V9W A;  4FWK A;  3RMD A;  3C7N A;  4FLU A;  1OKJ A;  2XY8 A;  3O5B A;  5AQL A;  4AHC A;  2QWP A;  3TAQ A;  3VPZ A;  2HHX A;  5K14 A;  4Z94 A;  4IDH A;  4A5A A;  1NGC A;  3L6Q A;  3CJ7 A;  1WSH A;  1U48 A;  4O8U A;  3T19 A;  2QA4 N;  3QML A;  5AQG A;  1EO1 A;  4OPK A;  2O8D A;  2PZS A;  4CF0 A;  5AR0 A;  3CCE N;  3HJF A;  4DKW A;  2Q36 A;  3K5M A;  3NGI A;  4RW8 A;  3SQ4 A;  2NRW A;  3S41 A;  4LFA K;  1OVQ A;  4A2B A;  4E1M A;  1W9H A;  2YX6 A;  3PSF A;  5JVH L;  2QWQ A;  2E1Z A;  2I5J A;  1FKO A;  1SAZ A;  2E2P A;  3T1H K;  1UA0 A;  3EY1 A;  4DSK A;  3CIP A;  5ADX A;  2HBL A;  3P39 A;  5M1P A;  4LF9 K;  1VSJ A;  1ZYQ A;  2FLO A;  4C8K A;  2ITG A;  3Q7B A;  1U45 A;  3OYD A;  3SQ0 A;  3ZLJ A;  3K0S A;  3EKS A;  2OAN A;  3K5L A;  4JS4 A;  1I94 K;  1VHX A;  3OTO K;  2QWN A;  1C0G A;  3F2K A;  3HOT A;  3H1V X;  3QLH A;  3C65 A;  4OKE A;  4DG1 A;  1YJ9 N;  1X9J A;  4J8F A;  3BEX A;  3F9K A;  3K5N A;  2P5G A;  1EKE A;  5KGX A;  1NJY A;  3ZT2 A;  4CJF A;  1NGF A;  3AV9 A;  4C1N K;  1SKS A;  4M3T A;  3BUZ B;  3HM8 A;  1RBV A;  3H3N O;  4NLC A;  1OH7 A;  2KHO A;  2BGG A;  1NG9 A;  1ATS A;  3G25 A;  3O3H A;  3D2E A;  3D6R A;  3AVC A;  4JRP A;  3T1Y K;  4JEP A;  3IG1 A;  3D2F B;  3KD1 E;  2RN2 A;  3AO2 A;  5KRT A;  5JS1 A;  2F4V K;  2X78 A;  3WXL A;  1QSL A;  3PSI A;  2KFZ A;  4A57 A;  4YNQ A;  3RRH A;  2KZZ A;  3QEX A;  2F8T A;  4C1N I;  3RTV A;  1NK4 A;  1JCF A;  2I7P A;  1QHT A;  3CCM N;  3D45 A;  1K73 O;  1VQ8 N;  3SBT A;  3V9X A;  3AAR A;  3CFP A;  4KH4 A;  1LAV A;  1B9F A;  3TPQ A;  3KD5 E;  4K0K K;  4CJV A;  1N6Q A;  4CEC A;  1KD1 O;  2FC0 A;  4BRA A;  4JKF A;  3ZEU B;  4DCH A;  2NRT A;  4BRP A;  4UY8 O;  4DU4 A;  3RMA A;  2IIR A;  2NRH A;  1YUW A;  2ZF5 O;  4DFK A;  3CC4 N;  4CJ3 A;  4AF1 A;  3WNE A;  3VQ5 A;  1HJO A;  2BDP A;  4FJH A;  1NJW A;  3P5J A;  5C15 A;  3G6E N;  4OLB A;  5LL6 Z;  4JKD A;  4DV4 K;  1XHZ A;  1JCG A;  3B6O A;  1BIS A;  3B6P A;  3AVM A;  2BE2 A;  2D0B A;  4FK2 A;  3O3F A;  4JD2 A;  3CXC M;  4H0V B;  3VQB A;  3N4Q A;  1SUQ A;  3O80 A;  3BF3 A;  4CW7 B;  4JKG B;  4FJK A;  3P4I A;  1X3N A;  1EQY A;  1UOC A;  4ISE A;  3WQU A;  3DXM A;  5LJW A;  1IKV A;  1D8Y A;  3LM2 A;  4U7B A;  3H3O B;  1JLE A;  4H4M A;  4IXC A;  3SMP A;  4IKF A;  4CGI A;  2FBY A;  1WSF A;  1T3V A;  4EZ6 A;  2YNF A;  1ZBI A;  3R3L A;  3L0Q A;  3WXM B;  3M8R A;  2HND A;  2OPP A;  4DHY A;  2G8V A;  4KAZ A;  2D1K A;  2P1J A;  1RT1 A;  4NCA A;  3KJV A;  4EHU A;  2KW4 A;  3OYN A;  3F5T A;  2FBX A;  2E20 A;  3H6E A;  5CYQ A;  4DR5 K;  4FOI A;  1VRU A;  3TI0 A;  4F4K A;  3DRP A;  1NGG A;  3O4N A;  3VER A;  2GUI A;  1OH6 A;  1F21 A;  4FLW A;  3K58 A;  3DI6 A;  4OKJ A;  4DV6 K;  3ZCM A;  1T8E A;  4KI6 A;  4PKG A;  2AJQ A;  3U3G A;  1WAJ A;  5F0X A;  5TKY A;  4H5N A;  4H0P A;  3T1A A;  3HVT A;  2OCE A;  3V9S A;  4CJT A;  3OYC A;  3D0P A;  4HUG A;  3MED A;  1BL3 A;  2P5O A;  4BR7 A;  4CFA A;  3QFP A;  3AAQ A;  1IJJ A;  2QW9 A;  1KFD A;  1ASW A;  1T03 A;  3KK2 A;  4NCG A;  2EHG A;  1YT3 A;  2RKI A;  5I9E B;  3IFR A;  3P38 A;  4BE2 A;  4B3O A;  4YOU A;  1KCF A;  2OA8 A;  4FLT A;  4JS5 A;  2IS3 A;  3AVN A;  4IBN A;  1HQU A;  4BR5 A;  4H0X B;  4YOY A;  2W6L A;  5FDL A;  3DOL A;  4ICL A;  5AQW A;  3IS9 A;  4LF5 K;  2GWK A;  1UWB A;  3QDK A;  3A5N C;  4WFA L;  4XIU A;  4PWD A;  4Q0B A;  1ZC6 A;  3CCR N;  4PKI A;  1HNZ K;  2DFE A;  5GIP A;  5AJ3 K;  5AQT A;  3LAN A;  2IC3 A;  3CJ1 A;  3LZI A;  3OW2 M;  5AQY A;  3GL1 A;  4A59 A;  4EFH A;  2Q0U A;  1RBU A;  2H3G X;  3WQT A;  3CPW M;  4E7K A;  4QAG A;  1BQM A;  1NOZ A;  3C95 A;  1Q7Y O;  2A1R A;  3ZSV A;  3OS1 A;  1DTQ A;  3WT0 A;  4BGA A;  4CD1 A;  1VQ5 N;  3V1R A;  2OPR A;  1VSE A;  5KPT A;  3SZ2 A;  4E1J A;  4I6M A;  2IGI A;  4FLV A;  4CK2 A;  1NGH A;  4H5W A;  5BN8 A;  2BH1 A;  3THX A;  3VF2 A;  4BC2 A;  3LDL A;  5E26 A;  3CQX A;  4O4G A;  1DTT A;  4RW6 A;  3RSE B;  1LWE A;  3CQ8 A;  3EE9 A;  1KLM A;  1Y64 A;  3R8E A;  1BHL A;  3DAW A;  5J2M A;  4M3R A;  1JL2 A;  3TR8 A;  3QIP A;  1NJI O;  4HCC A;  3FZK A;  3QNN A;  5EXW A;  1TKZ A;  1RT6 A;  1VSL A;  2D4W A;  4IFV A;  2Z1I A;  4NYF A;  4H5V A;  4NXN K;  4JI7 K;  1OH8 A;  5AQS A;  2GTD A;  3VEO A;  3SNN A;  1WOQ A;  2BTF A;  1XMQ K;  4FPA A;  4DTN A;  3WNF A;  1YVN A;  1DLO A;  1EX4 A;  4DTX A;  1DT9 A;  4DQR A;  4GV9 A;  4B3M K;  3BGR A;  3SCX A;  3ZSY A;  1E4F T;  1IG8 A;  3V9Z A;  3FLC O;  1T6C A;  3O8M A;  4U67 L;  2UU9 K;  4GVE A;  1Q86 O;  4DV0 K;  4DTP A;  3VEW A;  3FZL A;  4BG9 A;  3HPG A;  4CZH A;  4BR0 A;  3A2F A;  1NM1 A;  3GG4 A;  1BGX T;  1M90 O;  1NOY A;  4B9S A;  1EXQ A;  3P1G A;  4CGJ A;  1RT2 A;  3C94 A;  4LFC K;  4M7X A;  4CEZ A;  4KI4 A;  4IG3 A;  1V4T A;  2VCP A;  3MWP A;  3TTD A;  3MEG A;  4GV6 A;  3LAM A;  3G10 A;  2BUP A;  3M5R A;  4KB1 A;  2IOC A;  4OJR A;  1SS6 A;  4QOZ B;  4M63 C;  5M1N A;  2HHW A;  4Y1D A;  2DFH A;  3FFI A;  3QIN A;  1JLG A;  1JKH A;  4JK9 A;  5JLH A;  3VF4 A;  5JLF A;  3O9U A;  3A5O C;  4CEB A;  3HL8 A;  1FW6 A;  3TTC A;  1HKC A;  1GLD G;  3UIQ A;  1TK0 A;  4DR1 K;  1YIT N;  3MN9 A;  3WNG A;  3G0Z A;  1BWF O;  4GV3 A;  1QSS A;  3R9P A;  3KIO A;  3AGK A;  3D7E O;  4KKO A;  2P9N B;  1ESV A;  3QB0 A;  1VRT A;  5A2Q O;  3CCQ N;  1KVC A;  3RR7 A;  2HVH A;  3J81 O;  1L3V A;  1RDW X;  3MXI A;  3UKR A;  4FXD A;  4DUZ K;  5AQP A;  4BRF A;  1IKX A;  1TAQ A;  4M41 A;  2E88 A;  1WSI A;  1Q81 O;  4CHY A;  4CI6 A;  1NK7 A;  2VQE K;  4JN4 A;  3EEQ A;  1NJX A;  5CR4 A;  4A5B A;  2NNW A;  1C0U A;  3VTH A;  2G8U A;  3QEI A;  1SQK A;  2UYT A;  5FPE A;  4CZF A;  3HRG A;  3KKR A;  4B9L A;  1KVA A;  1IBM K;  1L3S A;  1HYV A;  1BUP A;  4FJM A;  2D0P A;  4X64 K;  2PAV A;  3QEW A;  3W0L A;  1L5U A;  3DXK A;  4C8L A;  2O8F A;  3MCP A;  3B8A X;  4CZI A;  1LV5 A;  3MWT A;  1DEJ A;  3SV4 A;  4WQ5 A;  3NH1 A;  3PV8 A;  5FPN A;  4DQI A;  1XWL A;  3G71 N;  3TU5 A;  4L8R B;  4RTF D;  1TGO A;  1ASV A;  3FR0 A;  4LH5 A;  3JXU A;  2ZJR L;  2O4I A;  2DY4 A;  4FWO A;  2ZJP L;  4YDU A;  4DLE A;  4BVO A;  1QTM A;  3P83 D;  1K8K A;  4KPY A;  3TWH A;  3J80 O;  5IWA K;  5HP1 A;  1C1B A;  4C23 A;  3EYZ A;  2UUA K;  3MX2 A;  2IDO A;  3ZX2 A;  4IWV A;  4W5O A;  2QKK A;  1NK0 A;  4K43 A;  4C8M A;  2Q3S A;  4IEI A;  3ZSQ A;  2P9L A;  3HPH A;  2FBT A;  4DTO A;  4MDA A;  5D3G A;  2B4J A;  4DV2 K;  2QXL A;  1YIJ N;  3WEE B;  3TAG A;  2HNY A;  5KQ8 A;  3VQQ A;  3VQ9 A;  3PIO L;  2ASO A;  4BRD A;  1S1T A;  2FSK A;  5BRH A;  1XNQ K;  2VGM A;  2HHT A;  2W41 A;  2HHS A;  5MLC Q;  4LF8 K;  4BRO A;  3OS0 A;  4EHT A;  4CEF A;  3VF6 A;  4DB3 A;  3QEV A;  3SAH A;  3OY9 A;  1C0T A;  1CLQ A;  3CJA A;  3T69 A;  3ENH A;  3ZSW A;  4N56 A;  2OZS A;  1BDG A;  3CJ9 A;  3KLI A;  2HMP A;  4B08 A;  2GEM A;  4G1Q A;  4YY3 K;  3NMU A;  1NMN A;  4F8R A;  2HW3 A;  4H0O A;  2NRZ A;  1HNX K;  3PX0 A;  3KVG A;  4MQ3 A;  3L8B A;  2V7Z A;  4LH4 A;  1IBL K;  1TKD A;  4CFB A;  4C8N A;  5T7B A;  3WXI A;  1W7A A;  3E01 A;  2NLX A;  4EIA A;  3ZET B;  3LAL A;  2O8B B;  1RDD A;  3RMC A;  4LC9 B;  3KHY A;  1SZ2 A;  5J2N A;  3U4L A;  2PBD A;  1S1W A;  4BRE A;  5AQX A;  1LWC A;  1QVG M;  1L3T A;  3MEC A;  4O44 A;  3ZSZ A;  4LY7 A;  1NBW A;  3L2Q A;  3KK1 A;  3CYM A;  3LZJ A;  3CCS N;  2VG6 A;  3ENB A;  3O9T A;  2HF4 A;  1XC3 A;  1X9M A;  4JI5 K;  4JNE A;  4CBU A;  2OTL N;  2HHU A;  1J5O A;  5C0Y A;  2CH6 A;  5LY3 A;  1I39 A;  5BR8 K;  2YNI A;  1YAG A;  3THW A;  3SV3 A;  4FO0 A;  4IDK A;  5HRR A;  3TAF A;  1S5J A;  3TAN A;  1H1V A;  5AQJ A;  4FJJ A;  3TAM A;  4BGB A;  2A5X A;  2HVI A;  4CGH A;  3CFO A;  4WQ5 C;  2V51 B;  4DU3 A;  3VA3 A;  4O5F A;  4ZTJ A;  4NCB A;  3VQA A;  1QVF M;  2P9P A;  1NNE A;  3H08 A;  3AVK A;  1KAZ A;  5JIC A;  1YXQ A;  4FOE A;  3LPU A;  3OYE A;  5F1X A;  3M8P A;  5AQK A;  5M1K A;  1RT5 A;  2PFU A;  3HOS A;  3VGL A;  4DQ8 A;  4DR7 K;  1JCE A;  2VG7 A;  2A41 A;  4QS7 A;  2FF3 B;  3DYA A;  3BZC A;  4BG8 A;  5BRD A;  1J5E K;  1X9W A;  2GBZ A;  4FWQ A;  5HRO A;  2O8E A;  1GOA A;  1ZXO A;  1A5X A;  4CEQ A;  3HP6 A;  3AGR A;  4QCL A;  3OJS A;  1VQ9 N;  2RE2 A;  4FJL A;  2HB5 A;  3MEE A;  3TAR A;  4FW2 A;  5GAG P;  3NH2 A;  3NDK A;  3K57 A;  1RGI A;  1NKC A;  4BWM A;  2X74 A;  1NGB A;  3AA4 A;  1KSP A;  2IVO A;  3AY9 A;  4LF6 K;  2E2N A;  4E89 A;  1EWR A;  4C8O A;  4DR6 K;  3MMV A;  1WBD A;  3V4I A;  2CGL A;  3CCJ N;  4Z4C A;  4JI6 K;  4FVM A;  2RHK A;  4F3O A;  1QQO A;  3K9K A;  2WBN A;  4LSN A;  4BRK A;  4CJU A;  4DTM A;  2EX3 A;  4BRH A;  2YHA A;  4FM2 A;  3ZYY X;  5CZ1 A;  3QNO A;  4B1U B;  3CHW A;  2HBM A;  4O0I A;  1K9M O;  4DV3 K;  1NKE A;  4JI2 K;  3UKU A;  5ADX H;  2QKB A;  3AVA A;  1YJW N;  3AVJ A;  1LW2 A;  3DLE A;  3N4P A;  4A2A A;  4CFD A;  2D0O A;  3CD6 N;  3L4Q A;  4O55 A;  3L4I A;  3ZSX A;  3QEP A;  4WE1 A;  3VGK A;  3RVC A;  3D2E B;  3BY5 A;  4B9T A;  2D0C A;  3MXM A;  4JI8 K;  5GAE P;  3S3O A;  1X3M A;  2DFF A;  3MXJ A;  1S9E A;  5C2F A;  4CHQ A;  1HKB A;  1TK5 A;  2YKN A;  4FJX A;  3QES A;  4MO5 A;  3L2V A;  2RF2 A;  4FLX A;  5AZI B;  1UAX A;  4H5T A;  4WF9 L;  1HX1 A;  1FKP A;  3THW B;  4H03 B;  1MWM A;  2PY5 A;  3LDS A;  3SUO A;  4M3U A;  3DLR A;  3MAQ A;  1Y97 A;  3V9U A;  4CGG A;  1GLJ O;  3TSQ A;  1S6P A;  3DLG A;  2ZGY A;  1XC9 A;  2HBK A;  1WSG A;  4L3Q A;  1YJN N;  1BA1 A;  3CM6 A;  3E9L A;  4DLG A;  4B9U A;  1SKR A;  3OYB A;  3WXJ A;  2GUP A;  2W42 A;  3HBT A;  3VQ6 A;  1HNW K;  4KFB A;  4DQS A;  1C0M A;  4BC4 A;  3SI6 A;  3O6W A;  3GBT A;  3VEY A;  1T05 A;  1LW0 A;  3WEE A;  2F96 A;  4JAX A;  4PHT X;  3IKM A;  1VQ6 N;  3LM9 A;  3THV A;  4FZY A;  3HSC A;  2NRX A;  3LDP A;  3CPE A;  4PA1 A;  2YHY A;  3TSP A;  3DXK B;  1WN7 A;  1HLU A;  2Q0R A;  4DMN A;  4CGF A;  4IO8 A;  2QXF A;  3KLG A;  1Z26 A;  4KHS A;  3SUQ A;  2Z1G A;  1NK8 A;  2G8K A;  5AQU A;  2IAJ A;  3E66 A;  2XO7 A;  4OLA A;  4Z4E A;  1N5Y A;  4B3T K;  4KHP K;  1HR0 K;  3WUH A;  3HTV A;  3HP9 A;  3VN5 A;  3KWI A;  5TKW A;  3FFK B;  2NRR A;  3V1Q A;  5C10 A;  4JYA K;  1W97 L;  5KPZ A;  3KLF A;  2A42 A;  1U6Z A;  1N34 K;  4FVU A;  5J2Q A;  4OPH A;  1HPM A;  1D9D A;  1TYQ A;  1Z6R A;  4IZ9 A;  1IG9 A;  5E84 A;  5AFU H;  4FCY A;  4RCH A;  4FK0 A;  4BRC A;  3AVI A;  2P9I A;  2W6K A;  4B8C A;  3HI0 A;  3PY8 A;  2JLE A;  4YFU A;  3THY B;  2P9S B;  3QIC A;  2E8A A;  1M1K O;  1RFQ A;  4CJQ A;  4I2P A;  1Z25 A;  3AO1 A;  3M1F A;  3KWG A;  4J2A A;  3CME N;  3ENO A;  4KRF A;  2AA4 A;  3H46 O;  3T3F A;  4FJ5 A;  4DR3 K;  2VWB A;  3R6M A;  3E1Y A;  4A62 A;  1Z05 A;  4FZX C;  4H0Y B;  5C42 A;  1VSF A;  4FLZ A;  5HRN A;  1QQC A;  5DM6 L;  4B9M A;  3QFU A;  3FGU A;  3KTQ A;  1NKB A;  4E7L A;  2QWL A;  1RDC A;  2ATQ A;  1C0F A;  3I33 A;  3VQP A;  3PO5 A;  1BIZ A;  4K41 A;  4LD0 A;  4DSF A;  2E1Y A;  4GMJ B;  1U2V A;  3NF7 A;  2KZM A;  3OBY A;  3ITH A;  4CF9 A;  4X66 K;  2ITM A;  1BCO A;  2ETJ A;  1QZ5 A;  1FXX A;  2A3Z A;  2HHQ A;  4FJI A;  2XRI A;  4CZG A;  4Z4H A;  5FPM A;  1SL0 A;  2GEL A;  1Q82 O;  1VK0 A;  3I0S A;  1BU6 O;  2GX9 A;  1RTI A;  1MDU B;  4OGE A;  2KTQ A;  3RMB A;  4M7Y A;  4BVP A;  2WON A;  1P90 A;  4O8K A;  4R79 A;  3Q7C A;  1S9G A;  4I6M B;  1NK9 A;  2YHW A;  3A0I X;  2OPQ A;  3QBW A;  4HTU A;  3KZB A;  4CK3 A;  4FLY A;  1CZA N;  4DSJ A;  4OO1 J;  1QHA A;  2A40 A;  4CD3 A;  3AA2 A;  2UXC K;  1KAX A;  5FRO A;  3OYF A;  3J7A P;  1VSH A;  4BR4 A;  5J2P A;  4ISG A;  4B8A B;  4K42 A;  1EET A;  1N32 K;  4KRE A;  3IAY A;  3AA3 A;  4B1Y B;  4H0T B;  2Z1J A;  3OBW A;  4CHZ A;  3O1W A;  1YTA A;  1WUA A;  2P9P B;  4YHH K;  4AHT A;  3J7Y P;  2E5L K;  3DLL L;  1IH7 A;  3NCI A;  3O08 A;  4B9V A;  3O1B A;  4DQP A;  4GNI A;  5AQF A;  1QS4 A;  4O0J A;  4BY9 C;  4CJL A;  1VQN N;  4I9Q A;  3NF9 A;  1QZ6 A;  5E41 A;  3SMS A;  5J1E A;  4E0D A;  3CQY A;  3LDN A;  4F2S A;  3J7Z O;  4AQY K;  5AQI A;  1K8A O;  3ID8 A;  3PX4 A;  1EP4 A;  5M1Q A;  4BQZ A;  2D5R A;  1RIL A;  3LWL A;  2JGU A;  3I0R A;  2GWJ A;  3L3U A;  2P9U B;  4F2R A;  4DU1 A;  4CHP A;  1GLB G;  4ELU A;  3EL2 A;  4IFY A;  1X9S A;  1I3A A;  1CXQ A;  2O8C A;  1BO5 O;  5H1S Q;  2P9S A;  4KTQ A;  1RDU A;  3R1X A;  2OPS A;  3ZT0 A;  1SKW A;  1UA1 A;  4DV5 K;  4WFN L;  4CJP A;  4KTZ A;  3MCA B;  4Y0W A;  4LFB K;  4XH1 A;  3SAG A;  4FW1 A;  4FK4 A;  1XNR K;  2Y1I A;  4CGD A;  1GLA G;  2B5J A;  5SWM A;  2ZD1 A;  2R7Y A;  3RRG A;  1FJG K;  1ZBL A;  1CZB A;  2O8F B;  1ASU A;  1NU0 A;  3IMX A;  3T7Z A;  3QET A;  5AZJ A;  1JL1 A;  3VQ7 A;  4DQQ A;  4J2D A;  3VOV A;  3C6A A;  1IO2 A;  2E6M A;  3WXK A;  1BA0 A;  4AHS A;  3ALY A;  5F2R A;  4CCH A;  3P31 A;  3OYM A;  1O13 A;  3DLB A;  2P9N A;  3C7N B;  4MLH A;  5HLF A;  3TAP A;  1S3X A;  3NBP A;  3CC7 N;  4CJ5 A;  3NFA A;  4BC5 A;  3HM9 A;  5BPN A;  3C6T A;  1K8K B;  5HBM A;  5HRS A;  3AVF A;  5CZ2 A;  5KRS A;  4GKJ K;  1BIU A;  1BG3 A;  4Z4G A;  1YTU A;  3CF5 L;  4ZTF A;  4DFM A;  3VA0 A;  4IOX A;  2FF6 A;  4OVL A;  3PX6 A;  3CG7 A;  1VQM N;  3CC2 N;  4CIG A;  3EO3 A;  2WC9 A;  1XI1 A;  1VQ4 N;  3SQ2 A;  3SJH A;  4FWR A;  3E9P A;  4ZHR A;  4JLH A;  2ASM A;  1RDB A;  4CF2 A;  4Z4F A;  1U04 A;  3CER A;  4CHO A;  4CFC A;  4LSL A;  4PQU A;  4JKA A;  2JWK A;  3FZH A;  3DWL A;  4NO7 A;  4AM7 A;  4CBX A;  1U47 A;  4K8Z A;  4M3W A;  4CZM A;  4BRG A;  3F73 A;  2YJF A;  3VGM A;  3NH0 A;  4CED A;  4CJ4 A;  1TAU A;  2QI2 A;  3AO4 A;  1RTJ A;  3F9M A;  3NHG A;  1S1V A;  1E3M A;  5HL7 L;  3DMJ A;  3DRR A;  3VQD A;  4PUO A;  3SYZ A;  3ZX3 A;  1VQ7 N;  2HHH K;  4I9L A;  1J9A A;  4ID5 A;  1HMV A;  5BN9 A;  4M3Z A;  3FZF A;  4DSI A;  2HST A;  2G8F A;  1JLQ A;  4I2Q A;  3HPO A;  4FJ9 A;  1HPZ A;  1U2V B;  3OVN A;  4NB4 A;  3VEX A;  4TSX A;  3ZT4 A;  1BQN A;  3KK7 A;  1N36 K;  4PL7 A;  5EVZ A;  3AO3 A;  4DTR A;  5BR9 A;  2F8S A;  4CZE A;  3EZ5 A;  4CE9 A;  5HOO A;  3SAF A;  3CM5 A;  5C24 A;  4JKH A;  1KC8 O;  2Q31 A;  4KTW A;  4JK7 A;  4E7J A;  3AVL A;  2WTU A;  2OYQ A;  4O5B A;  5HRP A;  4OPA A;  2ASP A;  4FZZ A;  1EWQ A;  1IKW A;  3TAB A;  1T7P A;  3DLH A;  3NGY A;  1YHQ N;  1YF5 L;  4RW9 A;  2QK9 A;  3A8Y A;  3BZK A;  4BDY A;  3VMF B;  3O9R A;  3S9H A;  1NGI A;  3EZW A;  3I8B A;  1C1A A;  3U6F A;  3L2W A;  3IDH A;  2YJE A;  3JAM O;  2WFB A;  4CJS A;  5GAD P;  1NK6 A;  3K59 A;  4BDP A;  2E2O A;  1WAF A;  1BCM A;  3ISN C;  1JLC A;  1WSJ A;  2KQ2 A;  1WB9 A;  2P9U A;  2CH5 A;  4E7I A;  1Q9Y A;  2DPN A;  3OYK A;  1IBK K;  1NWK A;  2KKZ A;  3D2F A;  4CIE A;  4FJ7 A;  3ATV A;  4KB0 A;  5JVG L;  3H45 C;  5GAH P;  2WOM A;  3NF8 A;  3UE5 A;  3JYT A;  2E2Q A;  1ITG A;  3ASM A;  3QIO A;  5SZT A;  4H4O A;  4KHU A;  1QE1 A;  1QQM A;  3NF6 A;  3V6D A;  4CJE A;  1B9D A;  3VEZ A;  1VSD A;  4DS5 A;  3DRS A;  1GLL O;  2O8E B;  2VG5 A;  3ZET A;  3SUP A;  3J8A A;  1S72 N;  4ELV A;  5AQZ A;  2O8B A;  1VSI A;  2AP1 A;  1HYS A;  3HT3 A;  1KVB A;  3M6G A;  4NYN A;  1VQK N;  2GV9 A;  2RPI A;  4Z4I A;  4AM6 A;  1KAY A;  1NGE A;  1RTD A;  3QER A;  1MWK A;  2I7N A;  2G8W A;  4JI0 K;  4BR9 A;  1RT7 A;  3AVG A;  1TVR A;  4E3S A;  2KFN A;  4B1W B;  3DXM B;  4IJA A;  4BRI A;  3O9S A;  4BRQ A;  1OH5 A;  3OYH A;  3NVK A;  4ISF A;  2HHV A;  4BE1 A;  4DFJ A;  3IRX A;  2UUC K;  1NGA A;  1KXP A;  3V81 A;  2XY5 A;  2E6L A;  1YVU A;  4M3X A;  4DF8 A;  4AHU A;  1NLV A;  1HRH A;  5CE3 A;  4JD2 B;  3C6H A;  4AHV A;  3IUC A;  2DTU A;  4RW7 A;  2YNG A;  4KO0 A;  4FM0 A;  5I3U A;  2FBV A;  2BAN A;  1U49 A;  3DOK A;  1JXE A;  4WCE L;  3O3G A;  3MDQ A;  4IEE A;  5CYM A;  3M8S A;  2X6S A;  4GVM A;  4A61 A;  3CCL N;  4OX9 K;  5AZJ B;  4DTJ A;  1T6D A;  2IVN A;  5AFU A;  1RTH A;  4NXM K;  4B1X B;  3VEN A;  4E1N A;  2P9K A;  4E7H A;  3GDQ A;  4HTL A;  5B8H A;  4XH5 A;  3OYG A;  3RWU A;  4DWI A;  4ELT A;  1TL1 A;  1Q18 A;  3DM2 A;  1ZBH A;  1XMO K;  3ZT3 A;  3VQE A;  5CHI A;  4KHY A;  4CF1 A;  1NJZ A;  1O1W A;  1DKG D;  2ZGZ A;  1LOT B;  4CHN A;  1QQN A;  1C1C A;  3I55 N;  5EY4 A;  3UKU B;  3O9Q A;  1KRP A;  3VTI A;  4MLE A;  2F9T A;  3NE6 A;  2O8C B;  3ZSR A;  3SPY A;  2KLA A;  4WYB A;  2YNH A;  2FSJ A;  5AQM A;  3SJJ A;  4IOA L;  1J6Z A;  4JI4 K;  3A5M C;  1NMD A;  4DUY K;  4HVJ A;  1KFS A;  5BPM A;  5DM7 L;  4B3S K;  3K9J A;  1TKT A;  4KHW A;  4H8K A;  4IFE A;  3C6U A;  1RNH A;  3ID6 A;  3CET A;  3RR8 A;  3PUF A;  4PY5 A;  1W2B M;  4DS4 A;  5C25 A;  4MFB A;  1JLB A;  1GLE G;  1SL1 A;  1XUP O;  4FJN A;  3O4Q A;  1VSM A;  2YHX A;  4RW4 A;  2YV0 X;  4CJW A;  2NRV A;  4ILH A;  4OGC A;  3DLK A;  3U9Z A;  3LWM A;  1GLC G;  5M1F A;  2E4L A;  4JKC A;  5AZI A;  4FPB A;  5FPD A;  4IJN A;  4H5R A;  4Q5V A;  3PIP L;  4CJR A;  4B9N A;  3SQ1 A;  4XEI A;  1T44 A;  4KH5 A;  1S1U A;  4DV1 K;  4M3Y A;  3DJC A;  4KH6 A;  4DFP A;  4FM1 A;  1BI4 A;  4BQL A;  4JHD A;  1VQL N;  4K25 A;  4CEA A;  4MO4 A;  4JKB A;  4CF8 A;  3OS2 A;  1D9F A;  4KV8 A;  5EOY A;  2Y1J A;  3KK3 A;  1ATR A;  2Q2R A;  1CXU A;  3HK2 A;  4B1Z A;  5KPR A;  4IO9 L;  3MK6 A;  3RSE A;  2VQF K;  1WSE A;  4W5R A;  1ILY A;  4FWL A;  4DTU A;  5FLX O;  4DR2 K;  2Z1H A;  1KLN A;  3THX B;  4EZ9 A;  3JS6 A;  5KGW A;  5DMR A;  3WNH A;  5AQQ A;  3CFR A;  3BDP A;  1TV6 A;  3LAK A;  2NUB A;  3CCV N;  4F9O A;  1KTQ A;  3NVM A;  2F7T A;  5LMN K;  3OYJ A;  3LDO A;  4FWM A;  1N33 K;  4FJ8 A;  1B92 A;  1HNV A;  5GIO A;  5M1O A;  3LP2 A;  4CER A;  3U8X A;  1HYZ A;  1MA9 B;  3GOI A;  4BRM A;  5C12 A;  1HNI A;  1D4X A;  2QWM A;  4CJK A;  4AIL C;  2J4R A;  3BP8 A;  1WLJ A;  4FJG A;  1IV0 A;  3UKR B;  2HNZ A;  4RWT A;  3TAE A;  1RDA A;  2PYJ A;  3NGZ A;  5LJV A;  4YOX A;  3BF1 A;  1VQP N;  4WFB L;  3QBX A;  1VAZ A;  1HKG A;  4KHN A;  1HJR A;  1CZ9 A;  3AA5 X;  1SV5 A;  2YI1 A;  4FWP A;  4YOV A;  1FK9 A;  5AQR A;  2VWK A;  4MDB A;  4YDU C;  3JSM A;  3MN6 A;  1TUU A;  4FL9 A;  2IVP A;  5AQO A;  4N76 A;  3U9D A;  4G9Z A;  1HQE A;  2XY6 A;  2UXB K;  3K5O A;  1R0A A;  4BWJ A;  4BR2 A;  4GY2 B;  4DTS A;  1JLF A;  5BRE A;  4N47 A;  4ILG B;  4FSV A;  4GW6 A;  3ULE A;  3OJU A;  3FZM A;  2VWJ A;  2YCH A;  2ZWH A;  3EE8 A;  2F9W A;  3THY A;  2A1S A;  1TL3 A;  4OPJ A;  3LDQ A;  2P51 A;  5KI6 A;  3MN5 A;  3HVR A;  1N8R O;  3MX5 A;  5AQV A;  5ELZ A;  2HMI A; 
#chains in the Genus database with same CATH homology
 4YHH K;  3J7Y P;  2E5L K;  4OX9 K;  3J80 O;  5IWA K;  4LF7 K;  4B3R K;  2UUB K;  3JAM O;  4NXM K;  3T1Y K;  4JI3 K;  2UUA K;  4JV5 K;  2VQF K;  2F4V K;  5FLX O;  4DR2 K;  4GKJ K;  4DR3 K;  4DV2 K;  1XMO K;  1IBK K;  4DR7 K;  4DR1 K;  4DR5 K;  4DR4 K;  4DV7 K;  1J5E K;  4AQY K;  4DV6 K;  1XNQ K;  5LMN K;  4LF8 K;  5A2Q O;  1N33 K;  4K0K K;  4X65 K;  3J81 O;  4LFA K;  1HNW K;  4X62 K;  4JI1 K;  4V19 S;  4DUZ K;  4X66 K;  4YY3 K;  4LF6 K;  4JI4 K;  3T1H K;  4DUY K;  2VQE K;  1HNX K;  4NXN K;  4JI7 K;  4DR6 K;  2HHH K;  5LMU K;  4B3S K;  2UXD K;  4JI6 K;  4DV5 K;  4LF9 K;  2ZM6 K;  1IBL K;  1XMQ K;  4JI0 K;  5LL6 Z;  1IBM K;  4DV4 K;  4X64 K;  4B3M K;  4B3T K;  5IT9 O;  4KHP K;  1N36 K;  1I94 K;  4LFB K;  1HR0 K;  3OTO K;  4CVN E;  1XNR K;  2UUC K;  2UXB K;  2UU9 K;  2UXC K;  4DV3 K;  4JYA K;  4DV0 K;  4JI2 K;  4CW7 B;  3J7A P;  4LF5 K;  1N34 K;  1FJG K;  4DV1 K;  1N32 K;  4JI5 K;  1HNZ K;  4GKK K;  5AJ3 K;  4JI8 K;  5BR8 K;  4LFC K;  4LF4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...