1T3VA

The nmr solution structure of tm1816
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
b'MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHHHEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title NMR structure determination of the conserved hypothetical protein TM1816 from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1t3vA01
1RDUA 2KLAA 1T3VA 2YX6A 2QTDA 1EO1A 1P90A 2WFBA 1O13A 2RE2A
chains in the Genus database with same CATH superfamily
2YCHA 3MWPA 1QQNA 4C1NI 4DQPA 2Z1JA 1Q9YA 4DS5A 4FLUA 1HJOA 1RGIA 1X3NA 4L3QA 3QERA 4IKFA 3J7AP 4LC9B 4F8RA 1N36K 1WAJA 5C15A 4FJ9A 2E6MA 1K8KA 4A2AA 3WXJA 1BISA 4DFMA 1UOCA 2HB5A 4E7IA 5HRPA 4PKIA 1TAQA 1BI4B 3EL2A 5E41A 3PIOL 1BOTO 4DMNA 3WXMB 1YVNA 2FF6A 4YY3K 1U4BA 5FRNA 4BRCA 3ZSYA 1S6PA 3LWLA 2HHQA 1HPZA 3P31A 3VQ5A 3L4QA 3VMFB 3CQYA 3KTQA 1ITGA 5AFUA 4KBOA 5FPNA 2HHWA 2ASOA 1KRPA 2HNDA 4JV5K 1WSHA 2NLXA 2O8EB 1RT5A 3IDHA 3QBWA 3MMVA 2VWBA 5KI6A 4RW9A 4HTLA 2ITMA 1YAGA 5KRTA 1YXQA 1U6ZA 5F2RA 2VQFK 1D4XA 2FSJA 3ZLJA 4BG8A 1JCEA 3A5MC 1QSYA 3VQPA 4HUGA 5BR8K 1JLBA 1TL3A 5GAEP 4DF8A 3ULDA 3CG7A 2ZE2A 4BR7A 1S72N 3K9JA 1DTTA 4ISFA 3RR8A 3L2UA 1JLFA 4CJQA 4CF1A 4B1YB 4IWVA 1IKYA 1BGXT 4M45A 3SV4A 3ZX2A 4DQQA 1VQPN 4XH5A 4NXMK 1M1KO 3K5NA 3T7ZA 1BG3A 2HBMA 3E9LA 5EY4A 3PV8A 4C8KA 4I6MA 5FRMA 3PSFA 3AVBA 3AVAA 3BF1A 1RBUA 4DSLA 3CCUN 3C7NA 5M1NA 5M1KA 4HVJA 1EP4A 3L0QA 4IBNA 2DFEA 3CJCA 3AO1A 4KFBA 1OH5A 3UKUB 2W42A 4B9UA 1QQCA 1I3AA 4OX9K 3O8MA 4EP5A 3FGUA 4ISEA 4O55A 2E5LK 3DRRA 5AQIA 2OA8A 3PY8A 5DM6L 4Y1CA 3F73A 3OW2M 1RT4A 4H0VB 3OYKA 4FSVA 3LZIA 1NMDA 1H1VA 3H3NO 1KLNA 4H8KA 1VRUA 3CYMA 4CGFA 3AAQA 4CCHA 4IFVA 3CJAA 3G6EN 3AVIA 4CGGA 1BCOA 4U67L 1SL0A 3I0SA 3CHWA 3NF8A 1NWKA 4YORA 4A62A 1SV5A 2QTDA 4AHUA 5AQHA 1DGKN 3E9PA 1RBTA 3WXLA 3TAMA 3TARA 1HLUA 2VWKA 1EETA 1ESVA 4CI6A 2Q2RA 1GLBG 2IVNA 4KHPK 5C12A 5IWAK 2NRZA 4M41A 4Q5VA 1TK5A 4BQLA 1WB9A 3LP3A 4H4MA 1ASUA 3P39A 4GY2B 1VQ8N 4A5AA 4R79A 3R3LA 3PSIA 2H3GX 3K9KA 3MN7A 3CJ1A 3CPEA 1KSPA 1IBLK 4W5NA 3QINA 3N4PA 4B3SK 3VQ6A 2VGMA 2P9NA 3OYBA 5ELZA 1SQKA 3O3HA 4CF0A 2VG5A 2KZZA 3SPZA 2OPRA 3THYB 4DTUA 3AVFA 3S3MA 3CCLN 4CJ4A 1KXPA 4BE1A 4H0TB 4CFDA 1TKTA 3RVCA 2RF2A 1NJXA 4AHCA 5BPMA 2A42A 4OLAA 4JI8K 3AO4A 2D0PA 3HVRA 4CE9A 1EKEA 4HTUA 3J8AA 4B1XB 5C25A 2O8DB 2F9WA 1YI2N 1IKVA 3VF4A 4PL7A 1E4FT 1VQON 5C0YA 4DTNA 1WNSA 4HHTA 4BY9C 4AH9A 5J1EA 3SJHA 1J6ZA 4BVOA 3PX6A 3VEOA 2NNWA 1I39A 1Q9XA 4CHYA 1YITN 2O4IA 2HHHK 4OGEA 4NLBA 3E1YA 4FVMA 4HWIA 2DPNA 5KRSA 4IJAA 1X3MA 2P9UB 3HJFA 4JI1K 4B9SA 1C1AA 4CZMA 2YHWA 2CH6A 4FXDA 4I9QA 3T1HK 1RBSA 1ATRA 4M63C 1BIZA 3EE8A 5AZJA 3Q7CA 4DTPA 3NAEA 1D9DA 1QHTA 1WSEA 3D45A 2O8BA 1XWLA 4B8CA 1RTHA 1C0MA 3OTOK 1SS6A 3L2QA 3KLGA 3THXA 3LALA 3VQ8A 2QXLA 3AA2A 2I7NA 2IVPA 2FBYA 2WTUA 4DTOA 1J53A 3CFOA 3QIPA 4EZ9A 1EWQA 5HL7L 4NLCA 2D5RA 1XNQK 1QHAA 4FJNA 3H6EA 2F9TA 4N76A 4JK9A 3NMUA 4KRFA 2JWKA 1J5OA 1XQSC 2RKIA 4E7JA 2D0OA 5LJVA 3TAFA 4H5TA 5AR0A 3RSEB 2G8IA 1TL1A 5AQRA 5EVZA 2UUAK 4KH4A 2YNFA 3VERA 4DTSA 4C8OA 2RE2A 1N34K 3MAQA 4JKFA 4BGAA 4OPKA 1MA9B 4B3RK 3AVHA 4JKCA 2P1JA 2O8CA 4E7KA 1N6QA 5AQKA 3AARA 4QS9A 3EKUA 1YIJN 2GELA 5GAHP 4UY8O 4E0DA 1NG9A 5AQGA 3P38A 2Q0RA 5GINA 2OYQA 1LWCA 2UXCK 4J2BA 4M3XA 1VRTA 3DOKA 2HF4A 3C0BA 4EAHD 3SJJA 4KHWA 4BRNA 3ZSRA 4ELVA 3ATVA 1EO1A 2HVIA 3LDOA 4JI5K 4CK3A 4QOZB 4DQRA 1IH7A 5B8HA 2YHBA 4FJMA 4BG9A 4OO1J 4FLXA 3QFPA 4H03B 2P9LA 3PO5A 2GUPA 5BPNA 3B8AX 4MLEA 4DTJA 1Q86O 2IVOA 4JI3K 2D4WA 3MEGA 3V9SA 4FPBA 5CZ1A 3JAMO 1KFDA 1VQ9N 4JKHA 3I56N 1U04A 5M1OA 4DSFA 2A5XA 4NB4A 4J2DA 2F8TA 3I8BA 2KZMA 2QEXN 4LF6K 3ZEUA 4B9VA 1VQMN 4F2SA 2JGUA 3CIPA 1NKCA 1QQMA 4B9QA 1IJJA 2Q97A 4BC5A 3ENHA 1RTIA 5HOOA 3P5JA 1LWFA 1VSKA 4RCHA 4BRLA 3THWA 3HO1A 4NXNK 4XH1A 4K41A 1S1TA 4PQUA 2R7YA 1NK5A 1HNXK 4LF8K 3VF2A 4OKJA 2UUBK 2VG7A 3FZLA 2QXFA 4LF4K 1K8KB 1Z6RA 4BDYA 4AQYK 2XY8A 4RW6A 3ENBA 4YNQA 3I8DA 3LDLA 3VEXA 2AJQA 1QVGM 2NRRA 3SQ4A 4WYBA 4FWLA 3C6UA 3HPGA 4ICLA 4H5RA 1UAXA 2UUCK 4M3WA 4DV3K 3ZETB 5BN8A 4AHTA 5LL6Z 4BR5A 1LAVA 2GTDA 4J2EA 2YNGA 2B4JA 1C6VA 1MU2A 1K6YA 3SK3A 4CIEA 1R59O 4KREA 3IFRA 5KTQA 1L3UA 1EWRA 1YJWN 1HQEA 1TUYA 3O9QA 1TKZA 1NGDA 4QCLA 1RT2A 1GOBA 2OTLN 4FK2A 3CCRN 2RPIA 1JJ2M 4U7BA 4GV9A 4AILC 4ISGA 4HUFA 2YHYA 3K59A 3A5NC 1ASWA 4I2QA 3EEQA 1OH8A 1ZBHA 3OYMA 4Z4IA 1KAYA 4IOXA 3CPWM 4A59A 3V9ZA 4GNIA 3O80A 2DFFA 5M1PA 3DI6A 1QQOA 4X66K 2A3ZA 4LF9K 2WONA 4CFBA 1KAZA 2O4GA 2QWNA 2XY7A 3GDQA 4CHNA 1SKRA 3BP8A 3SI6A 3WQUA 3BEXA 1IG8A 4F3TA 1U47A 5AZIB 2IAJA 4JKBA 1E3MA 4CJEA 3AO3A 3SQ1A 1HKGA 3TSPA 3V1QA 4E3SA 4M7YA 3D2EB 5JMVA 2QI2A 3HPHA 2FBXA 3AA3A 1ZBIA 3V6DA 2VG6A 3O9SA 4FWSA 4DV0K 4RW7A 1T03A 4LF7K 2E8AA 4WFNL 1ZXOA 2FSNA 1RTDA 4DV1K 2O8FA 1KCFA 1RDCA 4KI6A 1EQYA 2NRHA 4CJFA 5MLCQ 1Q8IA 2VWJA 1Z26A 4B3MK 1RT1A 4OPJA 3DJCA 2W41A 3K5LA 4DR4K 1O1WA 3C95A 4BR2A 1U49A 1KQSM 3M8PA 2B5JA 4N5SA 1U48A 3LAKA 3ZT0A 5C24A 3HP9A 3V1OA 1A5VA 2P9KB 3T69A 3OYAA 3DRSA 4IG0A 1NM1A 3HRGA 3RMBA 3SUOA 2HVHA 5TKWA 3CERA 5CZ2A 5AQJA 5CYQA 3OYJA 3JS6A 4CJRA 3VQBA 3PIPL 4PL8A 3P4IA 2GEMA 1W9HA 2KW4A 4EIAA 4LH4A 3OS1A 2ZWHA 3K5MA 3DMJA 2HBJA 1NJWA 5AQQA 4B3TK 1C1CA 3QEVA 1Z25A 3MN9A 5EOYA 2HF3A 2G8FA 4DR5K 4F2RA 1C0UA 2PZSA 4W5QA 3ZT3A 2E1ZA 3FZHA 4OKEA 4DS4A 3CC4N 1S3XA 3UKRA 1OH7A 3W3DA 4A57A 1D9FA 3M3ZA 4DUZK 4AM6A 4JI7K 1X9JA 3NVKA 2Q3SA 4I9LA 4KKOA 3MWTA 2E2QA 4XEIA 3HXMA 1N32K 3F2KA 3FLCO 4DSEA 3OHRA 3S9HA 1TYQB 1TK8A 3ZSVA 1Z05A 3QESA 5AQYA 3AV9A 5CY4A 1RCHA 5SWMA 3V9XA 1ZBLA 1JXEA 2YI1A 2X6NA 4IZ9A 3FFIA 3SBGA 3TTCA 4FW2A 4YOUA 4PKGA 3SNNA 1V4SA 4JK7A 2WOMA 3D7EO 4KTZA 3JSMA 2VCPA 2NRXA 3V9UA 5A2QO 1T05A 3SLCA 4B8AB 2CH5A 3VQDA 3L6QA 4NYNA 4FYDA 1XMQK 3CC2N 3O9RA 1JLAA 4KH5A 4AF1A 1QTMA 2XY6A 5JS2A 5FPDA 4O4GA 4O5FA 4BREA 4CFAA 4OKKA 4DG1A 4J2AA 5JS1A 3DLRA 4KB1A 4JAXA 4DLEA 4FJIA 4JD2A 4DR6K 1YTUA 4MDBA 3ULEA 4DFKA 2HHVA 1B9DA 5AZJB 5C2DA 2DTUA 1K73O 1FK9A 3QNNA 1HNZK 4FK0A 1T3VA 4BRHA 5H1SQ 2HNZA 1NKEA 4CZFA 4DSKA 3CJ7A 4FLYA 4JKGB 3THXB 3AGKA 3ZCMA 4CIGA 1JLGA 2ASMA 2NUBA 3RR7A 3KK2A 3BY5A 1S1UA 2YHXA 3CCQN 4Q0BA 3TSQA 4CEZA 2A40A 4DHYA 5E26A 1W0HA 5EX5A 3HP6A 5I42A 2FLOA 4CERA 1RBVA 4O8KA 2YNIA 1KD1O 5BN9A 3C94A 4B9MA 2QA4N 1RNHA 4CBXA 4L8RB 2O8CB 3NDKA 3PLAA 2NZTA 3NF6A 1GLCG 1WLJA 4E1NA 1QZ6A 2P9PB 3HTVA 3L4IA 3EE9A 2ZF5O 3CMEN 3ZX0A 4BRAA 4B1UB 3CFPA 4V19S 2FSKA 1QVFM 5LY3A 1JLEA 4BRKA 2RN2A 3KLFA 4LH5A 4H0PA 1VSLA 3RMDA 3AVKA 2V51B 3V9WA 4CZHA 2YX6A 3DYAA 4JHDB 3AVGA 3NCIA 1A5WA 4DFPA 2IIRA 4FJ8A 4B9NA 1F21A 4PHTX 3VF6A 2X6SA 3ZSQA 4IG3A 1BCMA 1HYZA 1FJGK 4CJ5A 3J80O 3C65A 1ATNA 3CD6N 4CHZA 2FXUA 5JLFA 4FVUA 1NGFA 1IBKK 3KK1A 3G0ZA 4JI2K 1WSGA 2E2PA 1SKSA 5JVGL 3VEVA 4I2PA 4CVNE 1TKDA 4FJHA 3WEEB 3RMAA 5AJ3K 1W97L 4GVMA 1WN7A 3AY9A 2E4LA 3LWMA 1CZBA 5EU7A 1NJYA 3OS0A 3LP2A 4MFBA 2PBDA 2UXBK 5T7BA 3RMCA 1D8YA 4DV2K 3OS2A 1BI4A 2QWOA 4AHRA 2UXDK 1CLQA 3CMAN 4WQ5C 4PKHA 5KGWA 4ELUA 3VQ9A 4ZTFA 3KLEA 2E2OA 3LDPA 4GV3A 3QNOA 4DCHA 1IO2A 4GVEA 1ZBFA 4FJJA 3R8EA 1SKWA 1RDDA 5GIOA 3RRGA 1JL2A 2CGLA 4CJPA 2X78A 1EXQA 1T8EA 3T1YK 2V52B 3MCPA 2YV0X 4BR0A 3SMPA 5DM7L 3CQXA 4CJ3A 1X9MA 4GW6A 4BE2A 3J81O 1DLOA 2O8EA 1UA1A 2Z1GA 3R9PA 1L3TA 3HSTB 1N33K 2P9SB 3DLEA 5AQLA 3M8RA 3O4WA 4H5VA 3MX2A 4C8MA 4DV7K 3V81A 4DB3A 3THVA 5JLHA 3OYHA 3LPUA 1VQ5N 1BU6O 3B6PA 3VA3A 5FROA 3MXIA 2E20A 3GG4A 4KPYA 4X65K 4LFAK 3U6FA 4BQZA 4FZZA 3TPQA 1IG9A 1L5UA 3SAGA 1S5JA 3K57A 4BDPA 4JI0K 2V7ZA 5AQWA 3BZCA 3MXJA 3L3UA 1GLLO 4IO9L 1Q81O 3SQ2A 1U2VB 1OH6A 2VYPA 3ITHA 4QAGA 1BO5O 1JL1A 4ILJA 4C23A 4ZTJA 2Q0UA 4CJKA 3RTVA 1SUQA 3FFKB 5GIPA 4HCBA 3AA4A 2B6AA 1X9WA 4WFAL 3KZBA 4GMJB 1HNWK 4BRPA 3O1BA 3JXUA 3M1FA 3VQ7A 4BR4A 1BQNA 5I3UA 2G8KA 4BE0A 4CZKA 3EYZA 4N47A 3UKUA 1HQUA 3G4SN 5AFUH 5F0XA 5HP1A 3M5RA 3A5LC 2QK9A 4ILGB 2IC3A 4CGHA 3M8QA 2W40A 1P90A 4PUOA 3HM8A 1NGGA 1S1WA 4BR9A 5I9EB 1GLDG 2BH1A 3AVMA 1XHXA 3AO2A 3TWHA 2XY5A 4BRGA 2LSNA 5CE3A 1WBBA 2E2NA 4CJLA 4KAZA 4CEFA 5CHIA 3DLBA 1C0FA 4N41A 1C1BA 3M6GA 2YNHA 2P9IA 1VSDA 1Y64A 1K8AO 5AQFA 2QW9A 2QWPA 1SZ2A 3K5OA 3LM2A 3F9MA 4BDZA 4CK2A 1NK8A 5BRFA 2ZGZA 2Y1IA 3SYZA 3VGMA 3BF3A 1KVCA 2GBZA 2IOCA 4KTWA 4H4OA 4YOXA 3CC7N 2ASPA 3O6WA 3ID6A 3LDSA 3E01A 4BC4A 3QICA 4QS8A 1ZYQA 4CD1A 2KFZA 2ZJRL 4KHUA 4BWJA 1NOYA 4M3TA 4CF9A 4FO0A 3EZ5A 4JEPA 1NGJA 4CF8A 4KI4A 4B08A 2F8SA 3SUQA 1HX1A 5F1XA 4GKJK 4YFUA 1XNRK 4A61A 5IT9O 1OVYA 4OPHA 3KLIA 1NJZA 5TKYA 3ZSWA 3O1WA 4JNEA 1RT7A 3ATUA 3ISNC 3AVNA 1JCFA 3THYA 1FKOA 2XHBA 3SUNA 3WNEA 4IEEA 3CXCM 5FDLA 3B6OA 1VSJA 1GLEG 4DLGA 4WCEL 1HPMA 4IXCA 3LAMA 4JKEA 1MWMA 2QKKA 3A2FA 4NO7A 1RDAA 1TV6A 2O8DA 5LMNK 3DRPA 3SPYA 3LL3A 4M3YA 3VQEA 4X64K 5D3GA 3OYIA 3I33A 1CXQA 4I7FA 3KLHA 3P1GA 4K42A 1V4TA 4JN4A 4JYAK 3H3OB 4H0YB 1VQ6N 4J8FA 4CFCA 3K2PA 1RT6A 2Q1NA 2P9UA 1JLQA 1GOAA 1VK0A 2UU9K 5CR4A 4DSIA 2QM1A 4DTRA 1J9AA 3WXKA 1LW0A 3KVGA 4RG8A 1M90O 4K8XA 3CCMN 4CD3A 3VQAA 3CETA 4DU3A 3MEDA 4JK8A 5HLFA 4FWRA 1BHLA 1GLFO 3QMLA 2G8UA 4DQIA 2I7PA 3U9ZA 4JRQA 1ASVA 4MO4A 3CJBA 5KGXA 5AQMA 4K8ZA 3PX0A 1LWEA 4AHSA 4PY5A 3SUPA 1KVBA 1T6CA 2Z1HA 4RTFD 4FJ7A 2EHGA 3UIQA 2F4VK 3MEEA 3GOIA 3DAWA 4FWPA 4NCBA 5M1QA 2FBVA 2KKZA 1TKXA 3LDQA 4I6MB 3RSEA 3ZSXA 3O3GA 4KH6A 2G8WA 1BUPA 2AP1A 3C7NB 4F9OA 2YKMA 1KLMA 4IOCL 1VQ4N 1REVA 3MX5A 2Q36A 4N56A 3VQCA 3OVNA 4CEDA 1J54A 4XH4A 4FK4A 2VQEK 1I94K 1HUXA 4Z4FA 4ZHRA 4HCCA 4WF9L 1DTQA 4YHHK 4JKDA 4KHNA 4CJWA 3WT0A 1NGIA 1WAFA 3AO5A 3DM2A 3H1QA 3TU5A 3TTFA 3OJSA 3WUHA 1RBRA 4AHVA 1CXUA 2X74A 2ZJPL 4UQGA 4CBWA 3CCSN 5FLXO 2ZD1A 4O0JA 2NRVA 4E1MA 3VGKA 4OJRA 4FPAA 4Z0UA 2BANA 4CHQA 4WQ5A 1RILA 2OPQA 3IRXA 3NH2A 4DTXA 3VEWA 4H0XB 1EX4A 4O0IA 4LFBK 2ZM6K 3H46O 1J5EK 1WSFA 2NRTA 1Q18A 3SQ0A 3GBTA 3TAPA 1YJ9N 4YOTA 3VTIA 1TK0A 2OZMA 1KVAA 1X1PA 1WUAA 3VN5A 1BIUA 3TR8A 4LFCK 2D0BA 4E19A 4HUEA 1IBMK 2HBLA 2G8HA 4B3OA 3I55N 1VSFA 5BRDA 4JI4K 3CQ8A 3IAYA 2HHTA 4DU1A 1SL1A 4JI6K 3DXKA 2XRIA 4BROA 4C8NA 4C1NK 1VSMA 3VQ4A 4ILHA 3ZSOA 4JS5A 4FWMA 3QEIA 2OTJN 2P9NB 3ZX3A 1HR0K 5FPMA 1VQNN 1HRHA 3VENA 2HHUA 4FWOA 2CGKA 4C8LA 1VAZA 4FJGA 4Z94A 3O9TA 1ZC6A 4CIFA 4O8UA 3GL1A 1JLCA 1T6DA 4NCGA 4KO0A 3FZMA 2PAVA 4CZEA 1MWKA 3HT3A 5DK5A 4IJNA 4BGBA 4CJVA 3EKSA 2F7TA 1HNIA 4H5NA 3ZETA 1C0TA 2AA4A 1NGCA 4H0OA 1VSEA 2E6LA 3OBYA 3V4IA 1HKCA 3FE1A 3HI0A 4BACA 2HHXA 3ZSZA 1XC3A 1GLAG 1NBWA 1NK4A 4EZ6A 3TANA 4FW1A 4PA1A 1CZAN 3QDKA 4BRIA 3HL8A 4EHTA 4A5BA 4FWKA 1WSIA 4Z4GA 2YJFA 1NGHA 4BRDA 3T1AA 4CW7B 3JYTA 5J2PA 4FLVA 3BUZB 3BDPA 4KTQA 3PX4A 4K43A 1ATSA 4CECA 2Z1IA 3GE1A 1BDGA 4Y1DA 2BE2A 5AQUA 5J2MA 2HW3A 2VGNA 4FJLA 1NU0A 2A41A 2EX3A 2EWSA 2RHKA 2O8BB 1XHZA 3QLHA 3H08A 4IFEA 5JICA 2ZJQL 1VSIA 4YDUC 4F3OA 4DF4A 3QETA 4G9ZA 1YVUA 3HK2A 3CJ9A 3F9KA 3MDQA 1D5AA 4W5TA 4KHYA 5AQPA 2HMIA 3A0IX 3KWGA 5KQ8A 4DKWA 5K14A 1NNEA 1CZ9A 3W0LA 1RDWX 3H1VX 1KC8O 1VHXA 5ADXH 5AZIA 3VESA 1NK9A 3DOLA 3ENOA 4CF2A 2PYJA 3MN6A 2ATQA 1E4GT 3T19A 3D2EA 1DEJA 1WSJA 3OA9A 4ID1A 4WE1A 1LCUA 5C42A 1K9MO 2FC0A 2YJEA 4BRMA 1P8ZA 5SZTA 3ID8A 3U3YA 1QE1A 4B1VA 1G15A 4ID5A 4CEAA 4RWTA 1S9GA 2KHOA 5HRRA 3CF5L 3DXMA 1KAXA 3LPTA 4WQ4C 1Q7YO 1JCGA 3U4LA 3TAGA 4IO8A 1YUWA 3U3GA 1C0GA 3QBXA 5AQVA 2IGIA 3VQQA 4W5OA 4LF5K 4FL9A 3L2RA 4YOYA 2QWQA 3AVCA 3VETA 4CHPA 3TAEA 1QSSA 4CJSA 4Z4EA 3OYNA 3RWUA 4ELTA 1XUPO 4IFYA 3MK6A 1W2BM 2WUSA 4E1JA 1NKBA 1N8RO 3D2FA 1R0AA 3NFAA 3OBWA 2P9IB 4OPAA 4CGIA 2P5GA 5HRNA 2P9KA 3OJUA 4M3ZA 4FLTA 4KHQA 1WOQA 3K58A 4JS4A 3F5TA 1DT9A 2P9LB 4FLWA 5EXWA 4JKAA 1W7AA 5J2QA 5BPLA 3NE6A 3LDNA 3HPOA 3T3FA 4NCAA 3IG1A 3HZ6A 4CJUA 1LV5A 1QS4A 1HJRA 2WFBA 1LW2A 4E7LA 1QZ5A 3G71N 3QEPA 4FJXA 5BR9A 3CFRA 3ZEUB 3EN9A 4BC2A 3OYEA 1BQMA 1IKWA 3O5BA 5KQDA 1NGBA 1HYSA 2GX9A 4DTMA 3FZFA 3O4NA 4MDAA 3SZ2A 3THWB 1NOZA 3NVMA 2PYLA 3ZYYX 4M42A 4DQ8A 1U45A 1TYQA 1OVQA 3ZT4A 4CZIA 1XI1A 3H45C 2OANA 1RDUA 3O3FA 4B1WB 4DQSA 5JVHL 3QO9A 1LOTB 1A5XA 4CZGA 2OZSA 3IUCA 1SAZA 2HHSA 3OYGA 5AQXA 4R5PA 3HSCA 1TGOA 2E88A 2JWLA 3LM9A 4LSLA 3VA0A 3C6HA 1XC9A 4IDKA 5AQNA 2P5OA 3NHGA 3L2WA 2KLAA 1YT3A 4CEEA 3TAQA 2UYTA 4YOWA 1IV0A 3E9OA 2CGJA 1B92A 5KPTA 1BA0A 1BWFO 2BUPA 4EFHA 1OKJA 3LP1A 4IEIA 3G10A 3FR0A 3EO3A 3R6MA 3DLHA 3UE5A 4CEQA 4CEOA 1RTJA 1B9FA 3WNGA 4CESA 3ZT2A 1T7PA 1NGEA 1Q82O 4LD0A 2HBKA 5HBMA 3VPZA 3SAFA 3J7YP 4CGDA 5KPZA 2ZGYA 1S9EA 2JLEA 3NGZA 3O4QA 2OCEA 4JKGA 5HRSA 4G1QA 4GKKK 1HNVA 2DY4A 4MQ3A 1BL3A 3VTHA 2GV9A 5CYMA 4BVPA 1DKGD 4BWMA 2QWMA 3VEYA 2OPPA 3AVJA 3CM6A 3D6RA 5AQOA 4LY7A 3EZWA 4CJTA 5LJWA 4DUYK 4DR3K 1NJIO 3LANA 2IS3A 2XO7A 3U9DA 1TUUA 1UA0A 3L2VA 5KPRA 3SV3A 4JRPA 4CK1A 4DV6K 4E7HA 3SAHA 4OGCA 3A5OC 3K0SA 3KD1E 3KK7A 3OYDA 2O8FB 2HSTA 2DFHA 3VOVA 3LZJA 4KHSA 3QEWA 1YHQN 1YTAA 3S3NA 3MECA 1WBDA 3TTDA 1RT3A 3QIOA 4B9TA 2P9PA 3OYCA 2Q31A 4M3RA 3L8BA 4JLHA 2D0CA 3RRHA 3M8SA 2BTFA 3Q7BA 4FM1A 4IOAL 3CI5A 2PY5A 1FW6A 2YHAA 3R1XA 2Y1JA 4JHDA 2E1YA 2BDPA 1X9SA 2W6LA 2IDOA 2HOEA 5M1FA 1VQKN 4F4KA 3OY9A 3NBPA 1XMOK 1S6QA 2P51A 4B1ZA 4FWNA 3KKRA 2ITGA 1NK6A 4B9LA 3KKSA 1RDBA 2ETJA 3BZKA 4FZXC 3U8XA 3WNHA 3C6TA 3P83D 3DLGA 1KTQA 4FLZA 4FZYA 4RW8A 3NH1A 4KB0A 3ZT1A 3WEEA 3AA5X 4W5RA 3HOSA 2J4RA 1L3VA 3AGRA 5BRHA 4CBUA 1NMNA 4WFBL 3SCXA 4DR1K 2WBNA 1HKBA 3QB0A 4KV8A 3UKRB 2A1SA 3TI0A 5BREA 4E89A 3IMXA 3IS9A 3DXKB 4A2BA 5HROA 4FM2A 3D0PA 4DV5K 3O08A 4BRQA 1JXBA 3C6AA 2KQ2A 4M7XA 3S41A 2BGGA 2W6KA 4DV4K 3I0RA 1ZBUA 2PFUA 4YDUA 2KTQA 4CGJA 3SMSA 3OYFA 2HNYA 1RFQA 5ADXA 1HMVA 3SBTA 4CZJA 3AVLA 4DSJA 1VQ7N 3MN5A 2NRWA 3WXIA 3QEXA 3LP0A 4FJ5A 3AAPA 3DWLA 3KHYA 4FM0A 1TVRA 3VGLA 4FCYA 1JKHA 2P9SA 2D1KA 5AQTA 1UWBA 4CHOA 4MO5A 3HYFA 5J2NA 4TSXA 4PWDA 3HOTA 3PUFA 3NGYA 4FOIA 1VQLN 2QKBA 4Y0WA 5AQZA 5AQSA 2QWRA 4DFJA 3PO4A 1SL2A 4EHUA 2I5JA 3CCEN 1KFSA 4AM7A 3S3OA 4WQ4A 2GUIA 3EY1A 2YKNA 1IKXA 2FBTA 4M3UA 5DMRA 1O13A 4MLHA 4JD2B 3N4QA 3FZKA 1TAUA 4QS7A 1U2VA 4IDHA 1Y97A 3VEZA 2V7YA 3CCVN 1NLVA 4CEBA 3ULEB 4DWIA 3KWIA 3UB5A 1NGAA 4K25A 1FKPA 1BA1A 3OYLA 1GOCA 3NF9A 4DR2K 3MXMA 3A8YA 4FJKA 3E66A 4OVLA 4NYFA 2D0AA 1YJNN 4BC3A 3NF7A 3QFUA 3O9UA 3DLLL 4EP4A 4CJ7A 3IKMA 4K0KK 4DU4A 3MCAB 3V1RA 4CZLA 2GWKA 5C10A 1T44A 1NK7A 1MDUB 4LSNA 4H5WA 4YOVA 3TABA 2GWJA 3HBTA 5LMUK 4DR7K 2A6AA 3ALYA 2QWLA 3L3VA 2F96A 2FF3B 3WNFA 1YF5L 4FOEA 4OLBA 1GLJO 3KJVA 1QSLA 1L3SA 4X62K 3NH0A 3BGRA 1LAWA 3CCJN 3NGIA 1HYVA 2G8VA 1ZBSA 3DXMB 1ILYA 2ZQBA 1S1XA 4RW4A 3KIOA 4Z4CA 1N5YA 2KFNA 2WC9A 4O5BA 3CM5A 3HVTA 3DLKA 2A1RA 4XIUA 1VSHA 5E84A 3KK3A 4Z4HA 2HMPA 3D2FB 3WQTA 4GV6A 5GADP 5C2FA 3G25A 3KD5E 2OPSA 3J7ZO 3TSUA 1S22A 4FWQA 3ASMA 4BRFA 1S1VA 3HM9A 4O44A 1G99A 1FXXA 1NK0A 5GAGP 5FPEA
chains in the Genus database with same CATH topology
2YCHA 3CF5L 4IO9L 3DXMA 1KAXA 4WQ4C 1Q81O 3MWPA 1Q7YO 1QQNA 1U2VB 4H5RA 1JCGA 3U4LA 4C1NI 2VYPA 4IO8A 1YUWA 3ZETB 5BN8A 4BR5A 1C0GA 1HJOA 1RGIA 1X3NA 3QBXA 1BO5O 5AQVA 4ILJA 4L3QA 2GTDA 4FL9A 4YOYA 4C23A 2QWQA 2Q0UA 3VETA 3SK3A 4LC9B 3FFKB 5GIPA 1R59O 3IFRA 1XUPO 3MK6A 1W2BM 5C15A 2WUSA 4WFAL 3KZBA 4E1JA 1YJWN 1N8RO 3D2FA 1K8KA 1TUYA 3O1BA 3O9QA 4A2AA 3WXJA 4BRPA 3JXUA 1NGDA 3OBWA 2P9IB 4OPAA 2OTLN 3M1FA 4BR4A 3CCRN 1JJ2M 2P9KA 4U7BA 4PKIA 4GV9A 4ISGA 1WOQA 4CZKA 3EL2A 3F5TA 1BOTO 3UKUA 3PIOL 3WXMB 1YVNA 2YHYA 3G4SN 2FF6A 1DT9A 3A5NC 5AFUH 5F0XA 2P9LB 4BRCA 3M5RA 3A5LC 5EXWA 4ILGB 4JKAA 2W40A 1KAYA 4IOXA 5BPLA 1P90A 3CMEN 3CPWM 4A59A 3P31A 3LDNA 3L4QA 4GNIA 3O80A 3HZ6A 3HM8A 5M1PA 3VMFB 1NGGA 4BR9A 1QQOA 5I9EB 1GLDG 2A3ZA 3CQYA 2BH1A 2WFBA 1QZ5A 3G71N 5AFUA 4KBOA 5BR9A 4BRGA 5CE3A 3ZEUB 3EN9A 2E2NA 5FPNA 1KAZA 4BC2A 5CHIA 2ASOA 2QWNA 1C0FA 3O5BA 5KQDA 1NGBA 3M6GA 3GDQA 2GX9A 1Y64A 2NLXA 2P9IA 1K8AO 5AQFA 3FZFA 2QW9A 3IDHA 2QWPA 3QBWA 4MDAA 3MMVA 1SZ2A 3LM2A 3BP8A 2VWBA 3F9MA 4HTLA 2ITMA 1YAGA 3WQUA 5BRFA 2ZGZA 1YXQA 1IG8A 1U6ZA 3BEXA 3VGMA 3BF3A 5F2RA 5AZIB 1D4XA 2FSJA 4JKBA 3NVMA 3ZYYX 4YOXA 3CC7N 4BG8A 2ASPA 3O6WA 3ID6A 1HKGA 4DQ8A 3TSPA 1JCEA 3A5MC 1TYQA 4BC4A 4M7YA 3D2EB 3QICA 5JMVA 2QI2A 4QS8A 4CD1A 4CZIA 2ZJRL 3H45C 2OANA 5GAEP 3O9SA 4FWSA 1RDUA 4B1WB 4FO0A 2E8AA 4WFNL 4BR7A 1S72N 1ZXOA 4JEPA 3K9JA 5JVHL 2FSNA 1LOTB 4ISFA 1NGJA 4CZGA 3IUCA 1SAZA 5AQXA 1EQYA 3HSCA 2E88A 4B1YB 1HX1A 5F1XA 2NRHA 4IWVA 2JWLA 3LM9A 4A61A 5MLCQ 3ZX2A 3C6HA 1OVYA 4OPHA 5AQNA 5TKYA 1VQPN 3DJCA 4XH5A 2KLAA 3O1WA 4JNEA 3ATUA 2W41A 2UYTA 1M1KO 3T7ZA 1BG3A 2HBMA 3E9OA 3E9LA 5EY4A 4YOWA 1JCFA 2CGJA 4I6MA 4BR2A 5KPTA 1BA0A 1BWFO 1KQSM 2BUPA 3BF1A 4EFHA 4IEEA 3CCUN 3C7NA 5M1NA 3CXCM 5M1KA 1OKJA 4IEIA 3L0QA 2P9KB 3T69A 1GLEG 3CJCA 4WCEL 1HPMA 1NM1A 3FR0A 3HRGA 4IXCA 3EO3A 5TKWA 3UKUB 3R6MA 4JKEA 1MWMA 3UE5A 3CERA 4NO7A 5AQJA 3O8MA 3JS6A 3FGUA 4ISEA 5AQIA 5DM6L 3OW2M 3LL3A 3PIPL 4H0VB 4PL8A 1NGEA 3P4IA 4FSVA 1Q82O 3I33A 1NMDA 2GEMA 2HBKA 3VPZA 3SAFA 4EIAA 1H1VA 2ZWHA 3H3NO 5KPZA 2ZGYA 2HBJA 3AAQA 5AQQA 4K42A 1V4TA 4JN4A 3MN9A 3CJAA 3G6EN 5EOYA 3H3OB 4H0YB 1VQ6N 2HF3A 4JKGA 4J8FA 4U67L 3CHWA 2Q1NA 2E1ZA 2P9UA 3FZHA 1NWKA 3VTHA 1S3XA 4YORA 4A62A 3UKRA 2QTDA 5CR4A 3CC4N 5AQHA 3W3DA 4BVPA 2QM1A 1DKGD 4A57A 1DGKN 2QWMA 3E9PA 3M3ZA 3WXKA 3VEYA 4AM6A 1X9JA 3NVKA 3D6RA 5AQOA 3WXLA 3KVGA 1M90O 3EZWA 3MWTA 3CCMN 4CD3A 2E2QA 4XEIA 1HLUA 5LJWA 3F2KA 3FLCO 1ESVA 3OHRA 1NJIO 3CETA 3U9DA 4CI6A 1TYQB 2Q2RA 4JK8A 1TUUA 1GLBG 2IVNA 5KPRA 5C12A 1Z05A 4FWRA 5AQYA 2NRZA 3SAHA 1GLFO 2YI1A 3QMLA 3A5OC 4BQLA 3KK7A 2I7PA 3U9ZA 4IZ9A 4MO4A 3SBGA 3TTCA 3P39A 3CJBA 4GY2B 4YOUA 2HSTA 5AQMA 1VQ8N 4A5AA 4R79A 3VOVA 4PKGA 3R3LA 1V4SA 4JK7A 1YHQN 2H3GX 3D7EO 3K9KA 1T6CA 3CJ1A 2VCPA 3CPEA 3MN7A 2NRXA 4RTFD 3TTDA 2P9PA 2Q31A 3DAWA 3GOIA 3SLCA 2CH5A 4FWPA 3N4PA 3L6QA 5M1QA 2VGMA 2KKZA 2P9NA 3O9RA 3CC2N 5ELZA 1SQKA 4KH5A 4AF1A 2BTFA 3LDQA 3Q7BA 4I6MB 3RSEA 4IOAL 3CI5A 5FPDA 3R1XA 4O5FA 4KH6A 4BREA 4JHDA 2E1YA 3CCLN 1BUPA 2AP1A 1KXPA 3C7NB 4F9OA 4H0TB 2HOEA 4IOCL 3RVCA 5M1FA 1VQ4N 1VQKN 3MX5A 2Q36A 5BPMA 4B1ZA 2A42A 4FWNA 4JAXA 2D0PA 4JD2A 4XH4A 4MDBA 1HUXA 3J8AA 4B1XB 2F9WA 3ULEA 4WF9L 1YI2N 3U8XA 3VF4A 4PL7A 5AZJB 4JKDA 1E4FT 5C2DA 1VQON 5C0YA 1K73O 3WT0A 4BY9C 3NMUA 1NGIA 3SJHA 1J6ZA 3H1QA 3WEEA 3TU5A 4BVOA 3VEOA 2NNWA 1T3VA 3TTFA 4BRHA 1YITN 3WUHA 5H1SQ 4CZFA 3HOSA 4NLBA 2J4RA 3CJ7A 4JKGB 3AGRA 2ZJPL 5BRHA 3AGKA 4CBUA 3E1YA 4HWIA 2DPNA 4WFBL 2ASMA 4CBWA 3CCSN 4IJAA 1X3MA 2P9UB 2WBNA 2NRVA 1HKBA 3VGKA 3QB0A 4FPAA 3UKRB 5BREA 4WQ5A 3IMXA 4CZMA 3DXKB 2YHWA 2CH6A 2YHXA 4A2BA 3VEWA 4H0XB 3CCQN 3O08A 3H46O 3CCVN 4BRQA 1ATRA 4M63C 2NRTA 3C6AA 1Q18A 3TSQA 2A40A 4M7XA 3EE8A 3S41A 4DHYA 3Q7CA 5E26A 5AZJA 5EX5A 3GBTA 2FLOA 2PFUA 4YDUA 1YJ9N 4O8KA 4YOTA 3VTIA 1KD1O 3SMSA 1RFQA 5BN9A 5ADXA 3SBTA 4CZJA 1SS6A 2QA4N 1WUAA 3MN5A 1VQ7N 2NRWA 3WXIA 4CBXA 2QXLA 3AAPA 3PLAA 2I7NA 2IVPA 2HBLA 2NZTA 1GLCG 3DWLA 3KHYA 3VGLA 3I55N 5BRDA 5HL7L 2P9SA 1QZ6A 2D1KA 2P9PB 4NLCA 3HTVA 1QHAA 4MO5A 5AQTA 3L4IA 3DXKA 2F9TA 2ZF5O 3EE9A 3H6EA 4JK9A 3ZX0A 4B1UB 2JWKA 4BROA 4BRAA 4C1NK 3HOTA 4ILHA 1XQSC 4FWMA 2FSKA 2OTJN 2P9NB 1QVFM 3ZX3A 5LY3A 4BRKA 5FPMA 2D0OA 4FOIA 1VQLN 1VQNN 4Y0WA 3VENA 5AQZA 5LJVA 4H0PA 4H5TA 2QWRA 5AR0A 5AQSA 4FWOA 3RSEB 2V51B 4CZHA 2YX6A 5AQRA 5EVZA 4EHUA 2CGKA 3CCEN 4JHDB 2IIRA 1VAZA 4KH4A 3VERA 4Z94A 2RE2A 3O9TA 4AM7A 1ZC6A 4WQ4A 4PHTX 3VF6A 4JKFA 4O8UA 3GL1A 4BGAA 1T6DA 1MA9B 1O13A 3FZMA 2PAVA 4CZEA 4MLHA 1MWKA 4JD2B 3N4QA 3FZKA 4JKCA 3C65A 4IJNA 1ATNA 3CD6N 2FXUA 4QS7A 1U2VA 5AQKA 4IDHA 3AARA 4QS9A 2V7YA 3EKUA 3EKSA 1NLVA 2F7TA 1NGFA 3ULEB 3VEZA 1YIJN 4H5NA 3KWIA 3ZETA 3UB5A 1NGAA 4K25A 1BA1A 2GELA 2AA4A 1NGCA 2E2PA 5GAHP 4H0OA 5JVGL 4UY8O 3VEVA 5AQGA 3A8YA 3P38A 2Q0RA 5GINA 3OBYA 1HKCA 3E66A 3FE1A 3HI0A 1XC3A 3WEEB 1YJNN 2HF4A 1GLAG 1W97L 1NBWA 3C0BA 4BC3A 4EAHD 4BRNA 3AY9A 1CZAN 3QDKA 5JLFA 3ATVA 1EO1A 4BRIA 3QFUA 3LDOA 3O9UA 4EHTA 4A5BA 3DLLL 4FWKA 4CJ7A 3IKMA 2YJFA 1NGHA 3MCAB 4BRDA 4CZLA 2PBDA 2GWKA 5C10A 5B8HA 1T44A 3BUZB 1MDUB 4OO1J 4BG9A 2QWOA 4H5WA 4YOVA 4K43A 2GWJA 1ATSA 3HBTA 3QFPA 4H03B 2P9LA 3GE1A 2A6AA 3CMAN 2GUPA 1BDGA 5BPNA 3B8AX 4MLEA 2QWLA 1Q86O 2IVOA 4WQ5C 5AQUA 2D4WA 4PKHA 4FPBA 2FF3B 1YF5L 2E2OA 3LDPA 4GV3A 4FOEA 4DCHA 4GVEA 1GLJO 4JKHA 3R8EA 3I56N 5M1OA 2VGNA 2A5XA 4NB4A 1VQ9N 5GIOA 2CGLA 2A41A 3I8BA 2QEXN 2EWSA 2RHKA 2V52B 3MCPA 4IFEA 4BR0A 5JICA 2ZJQL 3ZEUA 3SMPA 5DM7L 3CQXA 4YDUC 1VQMN 3CCJN 3CIPA 1QQMA 4B9QA 4G9ZA 1IJJA 2Q97A 1ZBSA 4BC5A 3ENHA 3DXMB 1ILYA 5HOOA 3CJ9A 4RCHA 3MDQA 5AQPA 4BRLA 3A0IX 3KWGA 5KQ8A 3R9PA 4DKWA 4XH1A 2P9SB 4K41A 1RDWX 5AQLA 3O4WA 2WC9A 3H1VX 3W0LA 4H5VA 1KC8O 3MX2A 5ADXH 5AZIA 3VESA 4FVUA 3ENOA 4DB3A 5JLHA 3VF2A 3MN6A 5E84A 1E4GT 1VQ5N 3D2EA 3FZLA 1BU6O 1DEJA 3OA9A 2HMPA 3D2FB 1K8KB 1Z6RA 3WQTA 1LCUA 4GV6A 5GADP 5C2FA 2E20A 3GG4A 4BRMA 2YJEA 3G25A 1K9MO 1P8ZA 3ENBA 4BGBA 3ID8A 4BQZA 3J7ZO 3TPQA 3TSUA 1S22A 4B1VA 3SAGA 4FWQA 3LDLA 3VEXA 4BRFA 4RWTA 1QVGM 2NRRA 1G99A 2KHOA 2V7ZA 4WYBA 5AQWA 4FWLA 5GAGP 5FPEA 1GLLO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDU A;  2KLA A;  1T3V A;  2YX6 A;  2QTD A;  1EO1 A;  1P90 A;  2WFB A;  1O13 A;  2RE2 A; 
#chains in the Genus database with same CATH topology
 2YCH A;  3MWP A;  1QQN A;  4C1N I;  4DQP A;  2Z1J A;  1Q9Y A;  4DS5 A;  4FLU A;  1HJO A;  1RGI A;  1X3N A;  4L3Q A;  3QER A;  4IKF A;  3J7A P;  4LC9 B;  4F8R A;  1N36 K;  1WAJ A;  5C15 A;  4FJ9 A;  2E6M A;  1K8K A;  4A2A A;  3WXJ A;  1BIS A;  4DFM A;  1UOC A;  2HB5 A;  4E7I A;  5HRP A;  4PKI A;  1TAQ A;  1BI4 B;  3EL2 A;  5E41 A;  3PIO L;  1BOT O;  4DMN A;  3WXM B;  1YVN A;  2FF6 A;  4YY3 K;  1U4B A;  5FRN A;  4BRC A;  3ZSY A;  1S6P A;  3LWL A;  2HHQ A;  1HPZ A;  3P31 A;  3VQ5 A;  3L4Q A;  3VMF B;  3CQY A;  3KTQ A;  1ITG A;  5AFU A;  4KBO A;  5FPN A;  2HHW A;  2ASO A;  1KRP A;  2HND A;  4JV5 K;  1WSH A;  2NLX A;  2O8E B;  1RT5 A;  3IDH A;  3QBW A;  3MMV A;  2VWB A;  5KI6 A;  4RW9 A;  4HTL A;  2ITM A;  1YAG A;  5KRT A;  1YXQ A;  1U6Z A;  5F2R A;  2VQF K;  1D4X A;  2FSJ A;  3ZLJ A;  4BG8 A;  1JCE A;  3A5M C;  1QSY A;  3VQP A;  4HUG A;  5BR8 K;  1JLB A;  1TL3 A;  5GAE P;  4DF8 A;  3ULD A;  3CG7 A;  2ZE2 A;  4BR7 A;  1S72 N;  3K9J A;  1DTT A;  4ISF A;  3RR8 A;  3L2U A;  1JLF A;  4CJQ A;  4CF1 A;  4B1Y B;  4IWV A;  1IKY A;  1BGX T;  4M45 A;  3SV4 A;  3ZX2 A;  4DQQ A;  1VQP N;  4XH5 A;  4NXM K;  1M1K O;  3K5N A;  3T7Z A;  1BG3 A;  2HBM A;  3E9L A;  5EY4 A;  3PV8 A;  4C8K A;  4I6M A;  5FRM A;  3PSF A;  3AVB A;  3AVA A;  3BF1 A;  1RBU A;  4DSL A;  3CCU N;  3C7N A;  5M1N A;  5M1K A;  4HVJ A;  1EP4 A;  3L0Q A;  4IBN A;  2DFE A;  3CJC A;  3AO1 A;  4KFB A;  1OH5 A;  3UKU B;  2W42 A;  4B9U A;  1QQC A;  1I3A A;  4OX9 K;  3O8M A;  4EP5 A;  3FGU A;  4ISE A;  4O55 A;  2E5L K;  3DRR A;  5AQI A;  2OA8 A;  3PY8 A;  5DM6 L;  4Y1C A;  3F73 A;  3OW2 M;  1RT4 A;  4H0V B;  3OYK A;  4FSV A;  3LZI A;  1NMD A;  1H1V A;  3H3N O;  1KLN A;  4H8K A;  1VRU A;  3CYM A;  4CGF A;  3AAQ A;  4CCH A;  4IFV A;  3CJA A;  3G6E N;  3AVI A;  4CGG A;  1BCO A;  4U67 L;  1SL0 A;  3I0S A;  3CHW A;  3NF8 A;  1NWK A;  4YOR A;  4A62 A;  1SV5 A;  2QTD A;  4AHU A;  5AQH A;  1DGK N;  3E9P A;  1RBT A;  3WXL A;  3TAM A;  3TAR A;  1HLU A;  2VWK A;  1EET A;  1ESV A;  4CI6 A;  2Q2R A;  1GLB G;  2IVN A;  4KHP K;  5C12 A;  5IWA K;  2NRZ A;  4M41 A;  4Q5V A;  1TK5 A;  4BQL A;  1WB9 A;  3LP3 A;  4H4M A;  1ASU A;  3P39 A;  4GY2 B;  1VQ8 N;  4A5A A;  4R79 A;  3R3L A;  3PSI A;  2H3G X;  3K9K A;  3MN7 A;  3CJ1 A;  3CPE A;  1KSP A;  1IBL K;  4W5N A;  3QIN A;  3N4P A;  4B3S K;  3VQ6 A;  2VGM A;  2P9N A;  3OYB A;  5ELZ A;  1SQK A;  3O3H A;  4CF0 A;  2VG5 A;  2KZZ A;  3SPZ A;  2OPR A;  3THY B;  4DTU A;  3AVF A;  3S3M A;  3CCL N;  4CJ4 A;  1KXP A;  4BE1 A;  4H0T B;  4CFD A;  1TKT A;  3RVC A;  2RF2 A;  1NJX A;  4AHC A;  5BPM A;  2A42 A;  4OLA A;  4JI8 K;  3AO4 A;  2D0P A;  3HVR A;  4CE9 A;  1EKE A;  4HTU A;  3J8A A;  4B1X B;  5C25 A;  2O8D B;  2F9W A;  1YI2 N;  1IKV A;  3VF4 A;  4PL7 A;  1E4F T;  1VQO N;  5C0Y A;  4DTN A;  1WNS A;  4HHT A;  4BY9 C;  4AH9 A;  5J1E A;  3SJH A;  1J6Z A;  4BVO A;  3PX6 A;  3VEO A;  2NNW A;  1I39 A;  1Q9X A;  4CHY A;  1YIT N;  2O4I A;  2HHH K;  4OGE A;  4NLB A;  3E1Y A;  4FVM A;  4HWI A;  2DPN A;  5KRS A;  4IJA A;  1X3M A;  2P9U B;  3HJF A;  4JI1 K;  4B9S A;  1C1A A;  4CZM A;  2YHW A;  2CH6 A;  4FXD A;  4I9Q A;  3T1H K;  1RBS A;  1ATR A;  4M63 C;  1BIZ A;  3EE8 A;  5AZJ A;  3Q7C A;  4DTP A;  3NAE A;  1D9D A;  1QHT A;  1WSE A;  3D45 A;  2O8B A;  1XWL A;  4B8C A;  1RTH A;  1C0M A;  3OTO K;  1SS6 A;  3L2Q A;  3KLG A;  3THX A;  3LAL A;  3VQ8 A;  2QXL A;  3AA2 A;  2I7N A;  2IVP A;  2FBY A;  2WTU A;  4DTO A;  1J53 A;  3CFO A;  3QIP A;  4EZ9 A;  1EWQ A;  5HL7 L;  4NLC A;  2D5R A;  1XNQ K;  1QHA A;  4FJN A;  3H6E A;  2F9T A;  4N76 A;  4JK9 A;  3NMU A;  4KRF A;  2JWK A;  1J5O A;  1XQS C;  2RKI A;  4E7J A;  2D0O A;  5LJV A;  3TAF A;  4H5T A;  5AR0 A;  3RSE B;  2G8I A;  1TL1 A;  5AQR A;  5EVZ A;  2UUA K;  4KH4 A;  2YNF A;  3VER A;  4DTS A;  4C8O A;  2RE2 A;  1N34 K;  3MAQ A;  4JKF A;  4BGA A;  4OPK A;  1MA9 B;  4B3R K;  3AVH A;  4JKC A;  2P1J A;  2O8C A;  4E7K A;  1N6Q A;  5AQK A;  3AAR A;  4QS9 A;  3EKU A;  1YIJ N;  2GEL A;  5GAH P;  4UY8 O;  4E0D A;  1NG9 A;  5AQG A;  3P38 A;  2Q0R A;  5GIN A;  2OYQ A;  1LWC A;  2UXC K;  4J2B A;  4M3X A;  1VRT A;  3DOK A;  2HF4 A;  3C0B A;  4EAH D;  3SJJ A;  4KHW A;  4BRN A;  3ZSR A;  4ELV A;  3ATV A;  1EO1 A;  2HVI A;  3LDO A;  4JI5 K;  4CK3 A;  4QOZ B;  4DQR A;  1IH7 A;  5B8H A;  2YHB A;  4FJM A;  4BG9 A;  4OO1 J;  4FLX A;  3QFP A;  4H03 B;  2P9L A;  3PO5 A;  2GUP A;  5BPN A;  3B8A X;  4MLE A;  4DTJ A;  1Q86 O;  2IVO A;  4JI3 K;  2D4W A;  3MEG A;  3V9S A;  4FPB A;  5CZ1 A;  3JAM O;  1KFD A;  1VQ9 N;  4JKH A;  3I56 N;  1U04 A;  5M1O A;  4DSF A;  2A5X A;  4NB4 A;  4J2D A;  2F8T A;  3I8B A;  2KZM A;  2QEX N;  4LF6 K;  3ZEU A;  4B9V A;  1VQM N;  4F2S A;  2JGU A;  3CIP A;  1NKC A;  1QQM A;  4B9Q A;  1IJJ A;  2Q97 A;  4BC5 A;  3ENH A;  1RTI A;  5HOO A;  3P5J A;  1LWF A;  1VSK A;  4RCH A;  4BRL A;  3THW A;  3HO1 A;  4NXN K;  4XH1 A;  4K41 A;  1S1T A;  4PQU A;  2R7Y A;  1NK5 A;  1HNX K;  4LF8 K;  3VF2 A;  4OKJ A;  2UUB K;  2VG7 A;  3FZL A;  2QXF A;  4LF4 K;  1K8K B;  1Z6R A;  4BDY A;  4AQY K;  2XY8 A;  4RW6 A;  3ENB A;  4YNQ A;  3I8D A;  3LDL A;  3VEX A;  2AJQ A;  1QVG M;  2NRR A;  3SQ4 A;  4WYB A;  4FWL A;  3C6U A;  3HPG A;  4ICL A;  4H5R A;  1UAX A;  2UUC K;  4M3W A;  4DV3 K;  3ZET B;  5BN8 A;  4AHT A;  5LL6 Z;  4BR5 A;  1LAV A;  2GTD A;  4J2E A;  2YNG A;  2B4J A;  1C6V A;  1MU2 A;  1K6Y A;  3SK3 A;  4CIE A;  1R59 O;  4KRE A;  3IFR A;  5KTQ A;  1L3U A;  1EWR A;  1YJW N;  1HQE A;  1TUY A;  3O9Q A;  1TKZ A;  1NGD A;  4QCL A;  1RT2 A;  1GOB A;  2OTL N;  4FK2 A;  3CCR N;  2RPI A;  1JJ2 M;  4U7B A;  4GV9 A;  4AIL C;  4ISG A;  4HUF A;  2YHY A;  3K59 A;  3A5N C;  1ASW A;  4I2Q A;  3EEQ A;  1OH8 A;  1ZBH A;  3OYM A;  4Z4I A;  1KAY A;  4IOX A;  3CPW M;  4A59 A;  3V9Z A;  4GNI A;  3O80 A;  2DFF A;  5M1P A;  3DI6 A;  1QQO A;  4X66 K;  2A3Z A;  4LF9 K;  2WON A;  4CFB A;  1KAZ A;  2O4G A;  2QWN A;  2XY7 A;  3GDQ A;  4CHN A;  1SKR A;  3BP8 A;  3SI6 A;  3WQU A;  3BEX A;  1IG8 A;  4F3T A;  1U47 A;  5AZI B;  2IAJ A;  4JKB A;  1E3M A;  4CJE A;  3AO3 A;  3SQ1 A;  1HKG A;  3TSP A;  3V1Q A;  4E3S A;  4M7Y A;  3D2E B;  5JMV A;  2QI2 A;  3HPH A;  2FBX A;  3AA3 A;  1ZBI A;  3V6D A;  2VG6 A;  3O9S A;  4FWS A;  4DV0 K;  4RW7 A;  1T03 A;  4LF7 K;  2E8A A;  4WFN L;  1ZXO A;  2FSN A;  1RTD A;  4DV1 K;  2O8F A;  1KCF A;  1RDC A;  4KI6 A;  1EQY A;  2NRH A;  4CJF A;  5MLC Q;  1Q8I A;  2VWJ A;  1Z26 A;  4B3M K;  1RT1 A;  4OPJ A;  3DJC A;  2W41 A;  3K5L A;  4DR4 K;  1O1W A;  3C95 A;  4BR2 A;  1U49 A;  1KQS M;  3M8P A;  2B5J A;  4N5S A;  1U48 A;  3LAK A;  3ZT0 A;  5C24 A;  3HP9 A;  3V1O A;  1A5V A;  2P9K B;  3T69 A;  3OYA A;  3DRS A;  4IG0 A;  1NM1 A;  3HRG A;  3RMB A;  3SUO A;  2HVH A;  5TKW A;  3CER A;  5CZ2 A;  5AQJ A;  5CYQ A;  3OYJ A;  3JS6 A;  4CJR A;  3VQB A;  3PIP L;  4PL8 A;  3P4I A;  2GEM A;  1W9H A;  2KW4 A;  4EIA A;  4LH4 A;  3OS1 A;  2ZWH A;  3K5M A;  3DMJ A;  2HBJ A;  1NJW A;  5AQQ A;  4B3T K;  1C1C A;  3QEV A;  1Z25 A;  3MN9 A;  5EOY A;  2HF3 A;  2G8F A;  4DR5 K;  4F2R A;  1C0U A;  2PZS A;  4W5Q A;  3ZT3 A;  2E1Z A;  3FZH A;  4OKE A;  4DS4 A;  3CC4 N;  1S3X A;  3UKR A;  1OH7 A;  3W3D A;  4A57 A;  1D9F A;  3M3Z A;  4DUZ K;  4AM6 A;  4JI7 K;  1X9J A;  3NVK A;  2Q3S A;  4I9L A;  4KKO A;  3MWT A;  2E2Q A;  4XEI A;  3HXM A;  1N32 K;  3F2K A;  3FLC O;  4DSE A;  3OHR A;  3S9H A;  1TYQ B;  1TK8 A;  3ZSV A;  1Z05 A;  3QES A;  5AQY A;  3AV9 A;  5CY4 A;  1RCH A;  5SWM A;  3V9X A;  1ZBL A;  1JXE A;  2YI1 A;  2X6N A;  4IZ9 A;  3FFI A;  3SBG A;  3TTC A;  4FW2 A;  4YOU A;  4PKG A;  3SNN A;  1V4S A;  4JK7 A;  2WOM A;  3D7E O;  4KTZ A;  3JSM A;  2VCP A;  2NRX A;  3V9U A;  5A2Q O;  1T05 A;  3SLC A;  4B8A B;  2CH5 A;  3VQD A;  3L6Q A;  4NYN A;  4FYD A;  1XMQ K;  3CC2 N;  3O9R A;  1JLA A;  4KH5 A;  4AF1 A;  1QTM A;  2XY6 A;  5JS2 A;  5FPD A;  4O4G A;  4O5F A;  4BRE A;  4CFA A;  4OKK A;  4DG1 A;  4J2A A;  5JS1 A;  3DLR A;  4KB1 A;  4JAX A;  4DLE A;  4FJI A;  4JD2 A;  4DR6 K;  1YTU A;  4MDB A;  3ULE A;  4DFK A;  2HHV A;  1B9D A;  5AZJ B;  5C2D A;  2DTU A;  1K73 O;  1FK9 A;  3QNN A;  1HNZ K;  4FK0 A;  1T3V A;  4BRH A;  5H1S Q;  2HNZ A;  1NKE A;  4CZF A;  4DSK A;  3CJ7 A;  4FLY A;  4JKG B;  3THX B;  3AGK A;  3ZCM A;  4CIG A;  1JLG A;  2ASM A;  2NUB A;  3RR7 A;  3KK2 A;  3BY5 A;  1S1U A;  2YHX A;  3CCQ N;  4Q0B A;  3TSQ A;  4CEZ A;  2A40 A;  4DHY A;  5E26 A;  1W0H A;  5EX5 A;  3HP6 A;  5I42 A;  2FLO A;  4CER A;  1RBV A;  4O8K A;  2YNI A;  1KD1 O;  5BN9 A;  3C94 A;  4B9M A;  2QA4 N;  1RNH A;  4CBX A;  4L8R B;  2O8C B;  3NDK A;  3PLA A;  2NZT A;  3NF6 A;  1GLC G;  1WLJ A;  4E1N A;  1QZ6 A;  2P9P B;  3HTV A;  3L4I A;  3EE9 A;  2ZF5 O;  3CME N;  3ZX0 A;  4BRA A;  4B1U B;  3CFP A;  4V19 S;  2FSK A;  1QVF M;  5LY3 A;  1JLE A;  4BRK A;  2RN2 A;  3KLF A;  4LH5 A;  4H0P A;  1VSL A;  3RMD A;  3AVK A;  2V51 B;  3V9W A;  4CZH A;  2YX6 A;  3DYA A;  4JHD B;  3AVG A;  3NCI A;  1A5W A;  4DFP A;  2IIR A;  4FJ8 A;  4B9N A;  1F21 A;  4PHT X;  3VF6 A;  2X6S A;  3ZSQ A;  4IG3 A;  1BCM A;  1HYZ A;  1FJG K;  4CJ5 A;  3J80 O;  3C65 A;  1ATN A;  3CD6 N;  4CHZ A;  2FXU A;  5JLF A;  4FVU A;  1NGF A;  1IBK K;  3KK1 A;  3G0Z A;  4JI2 K;  1WSG A;  2E2P A;  1SKS A;  5JVG L;  3VEV A;  4I2P A;  4CVN E;  1TKD A;  4FJH A;  3WEE B;  3RMA A;  5AJ3 K;  1W97 L;  4GVM A;  1WN7 A;  3AY9 A;  2E4L A;  3LWM A;  1CZB A;  5EU7 A;  1NJY A;  3OS0 A;  3LP2 A;  4MFB A;  2PBD A;  2UXB K;  5T7B A;  3RMC A;  1D8Y A;  4DV2 K;  3OS2 A;  1BI4 A;  2QWO A;  4AHR A;  2UXD K;  1CLQ A;  3CMA N;  4WQ5 C;  4PKH A;  5KGW A;  4ELU A;  3VQ9 A;  4ZTF A;  3KLE A;  2E2O A;  3LDP A;  4GV3 A;  3QNO A;  4DCH A;  1IO2 A;  4GVE A;  1ZBF A;  4FJJ A;  3R8E A;  1SKW A;  1RDD A;  5GIO A;  3RRG A;  1JL2 A;  2CGL A;  4CJP A;  2X78 A;  1EXQ A;  1T8E A;  3T1Y K;  2V52 B;  3MCP A;  2YV0 X;  4BR0 A;  3SMP A;  5DM7 L;  3CQX A;  4CJ3 A;  1X9M A;  4GW6 A;  4BE2 A;  3J81 O;  1DLO A;  2O8E A;  1UA1 A;  2Z1G A;  3R9P A;  1L3T A;  3HST B;  1N33 K;  2P9S B;  3DLE A;  5AQL A;  3M8R A;  3O4W A;  4H5V A;  3MX2 A;  4C8M A;  4DV7 K;  3V81 A;  4DB3 A;  3THV A;  5JLH A;  3OYH A;  3LPU A;  1VQ5 N;  1BU6 O;  3B6P A;  3VA3 A;  5FRO A;  3MXI A;  2E20 A;  3GG4 A;  4KPY A;  4X65 K;  4LFA K;  3U6F A;  4BQZ A;  4FZZ A;  3TPQ A;  1IG9 A;  1L5U A;  3SAG A;  1S5J A;  3K57 A;  4BDP A;  4JI0 K;  2V7Z A;  5AQW A;  3BZC A;  3MXJ A;  3L3U A;  1GLL O;  4IO9 L;  1Q81 O;  3SQ2 A;  1U2V B;  1OH6 A;  2VYP A;  3ITH A;  4QAG A;  1BO5 O;  1JL1 A;  4ILJ A;  4C23 A;  4ZTJ A;  2Q0U A;  4CJK A;  3RTV A;  1SUQ A;  3FFK B;  5GIP A;  4HCB A;  3AA4 A;  2B6A A;  1X9W A;  4WFA L;  3KZB A;  4GMJ B;  1HNW K;  4BRP A;  3O1B A;  3JXU A;  3M1F A;  3VQ7 A;  4BR4 A;  1BQN A;  5I3U A;  2G8K A;  4BE0 A;  4CZK A;  3EYZ A;  4N47 A;  3UKU A;  1HQU A;  3G4S N;  5AFU H;  5F0X A;  5HP1 A;  3M5R A;  3A5L C;  2QK9 A;  4ILG B;  2IC3 A;  4CGH A;  3M8Q A;  2W40 A;  1P90 A;  4PUO A;  3HM8 A;  1NGG A;  1S1W A;  4BR9 A;  5I9E B;  1GLD G;  2BH1 A;  3AVM A;  1XHX A;  3AO2 A;  3TWH A;  2XY5 A;  4BRG A;  2LSN A;  5CE3 A;  1WBB A;  2E2N A;  4CJL A;  4KAZ A;  4CEF A;  5CHI A;  3DLB A;  1C0F A;  4N41 A;  1C1B A;  3M6G A;  2YNH A;  2P9I A;  1VSD A;  1Y64 A;  1K8A O;  5AQF A;  2QW9 A;  2QWP A;  1SZ2 A;  3K5O A;  3LM2 A;  3F9M A;  4BDZ A;  4CK2 A;  1NK8 A;  5BRF A;  2ZGZ A;  2Y1I A;  3SYZ A;  3VGM A;  3BF3 A;  1KVC A;  2GBZ A;  2IOC A;  4KTW A;  4H4O A;  4YOX A;  3CC7 N;  2ASP A;  3O6W A;  3ID6 A;  3LDS A;  3E01 A;  4BC4 A;  3QIC A;  4QS8 A;  1ZYQ A;  4CD1 A;  2KFZ A;  2ZJR L;  4KHU A;  4BWJ A;  1NOY A;  4M3T A;  4CF9 A;  4FO0 A;  3EZ5 A;  4JEP A;  1NGJ A;  4CF8 A;  4KI4 A;  4B08 A;  2F8S A;  3SUQ A;  1HX1 A;  5F1X A;  4GKJ K;  4YFU A;  1XNR K;  4A61 A;  5IT9 O;  1OVY A;  4OPH A;  3KLI A;  1NJZ A;  5TKY A;  3ZSW A;  3O1W A;  4JNE A;  1RT7 A;  3ATU A;  3ISN C;  3AVN A;  1JCF A;  3THY A;  1FKO A;  2XHB A;  3SUN A;  3WNE A;  4IEE A;  3CXC M;  5FDL A;  3B6O A;  1VSJ A;  1GLE G;  4DLG A;  4WCE L;  1HPM A;  4IXC A;  3LAM A;  4JKE A;  1MWM A;  2QKK A;  3A2F A;  4NO7 A;  1RDA A;  1TV6 A;  2O8D A;  5LMN K;  3DRP A;  3SPY A;  3LL3 A;  4M3Y A;  3VQE A;  4X64 K;  5D3G A;  3OYI A;  3I33 A;  1CXQ A;  4I7F A;  3KLH A;  3P1G A;  4K42 A;  1V4T A;  4JN4 A;  4JYA K;  3H3O B;  4H0Y B;  1VQ6 N;  4J8F A;  4CFC A;  3K2P A;  1RT6 A;  2Q1N A;  2P9U A;  1JLQ A;  1GOA A;  1VK0 A;  2UU9 K;  5CR4 A;  4DSI A;  2QM1 A;  4DTR A;  1J9A A;  3WXK A;  1LW0 A;  3KVG A;  4RG8 A;  1M90 O;  4K8X A;  3CCM N;  4CD3 A;  3VQA A;  3CET A;  4DU3 A;  3MED A;  4JK8 A;  5HLF A;  4FWR A;  1BHL A;  1GLF O;  3QML A;  2G8U A;  4DQI A;  2I7P A;  3U9Z A;  4JRQ A;  1ASV A;  4MO4 A;  3CJB A;  5KGX A;  5AQM A;  4K8Z A;  3PX0 A;  1LWE A;  4AHS A;  4PY5 A;  3SUP A;  1KVB A;  1T6C A;  2Z1H A;  4RTF D;  4FJ7 A;  2EHG A;  3UIQ A;  2F4V K;  3MEE A;  3GOI A;  3DAW A;  4FWP A;  4NCB A;  5M1Q A;  2FBV A;  2KKZ A;  1TKX A;  3LDQ A;  4I6M B;  3RSE A;  3ZSX A;  3O3G A;  4KH6 A;  2G8W A;  1BUP A;  2AP1 A;  3C7N B;  4F9O A;  2YKM A;  1KLM A;  4IOC L;  1VQ4 N;  1REV A;  3MX5 A;  2Q36 A;  4N56 A;  3VQC A;  3OVN A;  4CED A;  1J54 A;  4XH4 A;  4FK4 A;  2VQE K;  1I94 K;  1HUX A;  4Z4F A;  4ZHR A;  4HCC A;  4WF9 L;  1DTQ A;  4YHH K;  4JKD A;  4KHN A;  4CJW A;  3WT0 A;  1NGI A;  1WAF A;  3AO5 A;  3DM2 A;  3H1Q A;  3TU5 A;  3TTF A;  3OJS A;  3WUH A;  1RBR A;  4AHV A;  1CXU A;  2X74 A;  2ZJP L;  4UQG A;  4CBW A;  3CCS N;  5FLX O;  2ZD1 A;  4O0J A;  2NRV A;  4E1M A;  3VGK A;  4OJR A;  4FPA A;  4Z0U A;  2BAN A;  4CHQ A;  4WQ5 A;  1RIL A;  2OPQ A;  3IRX A;  3NH2 A;  4DTX A;  3VEW A;  4H0X B;  1EX4 A;  4O0I A;  4LFB K;  2ZM6 K;  3H46 O;  1J5E K;  1WSF A;  2NRT A;  1Q18 A;  3SQ0 A;  3GBT A;  3TAP A;  1YJ9 N;  4YOT A;  3VTI A;  1TK0 A;  2OZM A;  1KVA A;  1X1P A;  1WUA A;  3VN5 A;  1BIU A;  3TR8 A;  4LFC K;  2D0B A;  4E19 A;  4HUE A;  1IBM K;  2HBL A;  2G8H A;  4B3O A;  3I55 N;  1VSF A;  5BRD A;  4JI4 K;  3CQ8 A;  3IAY A;  2HHT A;  4DU1 A;  1SL1 A;  4JI6 K;  3DXK A;  2XRI A;  4BRO A;  4C8N A;  4C1N K;  1VSM A;  3VQ4 A;  4ILH A;  3ZSO A;  4JS5 A;  4FWM A;  3QEI A;  2OTJ N;  2P9N B;  3ZX3 A;  1HR0 K;  5FPM A;  1VQN N;  1HRH A;  3VEN A;  2HHU A;  4FWO A;  2CGK A;  4C8L A;  1VAZ A;  4FJG A;  4Z94 A;  3O9T A;  1ZC6 A;  4CIF A;  4O8U A;  3GL1 A;  1JLC A;  1T6D A;  4NCG A;  4KO0 A;  3FZM A;  2PAV A;  4CZE A;  1MWK A;  3HT3 A;  5DK5 A;  4IJN A;  4BGB A;  4CJV A;  3EKS A;  2F7T A;  1HNI A;  4H5N A;  3ZET A;  1C0T A;  2AA4 A;  1NGC A;  4H0O A;  1VSE A;  2E6L A;  3OBY A;  3V4I A;  1HKC A;  3FE1 A;  3HI0 A;  4BAC A;  2HHX A;  3ZSZ A;  1XC3 A;  1GLA G;  1NBW A;  1NK4 A;  4EZ6 A;  3TAN A;  4FW1 A;  4PA1 A;  1CZA N;  3QDK A;  4BRI A;  3HL8 A;  4EHT A;  4A5B A;  4FWK A;  1WSI A;  4Z4G A;  2YJF A;  1NGH A;  4BRD A;  3T1A A;  4CW7 B;  3JYT A;  5J2P A;  4FLV A;  3BUZ B;  3BDP A;  4KTQ A;  3PX4 A;  4K43 A;  1ATS A;  4CEC A;  2Z1I A;  3GE1 A;  1BDG A;  4Y1D A;  2BE2 A;  5AQU A;  5J2M A;  2HW3 A;  2VGN A;  4FJL A;  1NU0 A;  2A41 A;  2EX3 A;  2EWS A;  2RHK A;  2O8B B;  1XHZ A;  3QLH A;  3H08 A;  4IFE A;  5JIC A;  2ZJQ L;  1VSI A;  4YDU C;  4F3O A;  4DF4 A;  3QET A;  4G9Z A;  1YVU A;  3HK2 A;  3CJ9 A;  3F9K A;  3MDQ A;  1D5A A;  4W5T A;  4KHY A;  5AQP A;  2HMI A;  3A0I X;  3KWG A;  5KQ8 A;  4DKW A;  5K14 A;  1NNE A;  1CZ9 A;  3W0L A;  1RDW X;  3H1V X;  1KC8 O;  1VHX A;  5ADX H;  5AZI A;  3VES A;  1NK9 A;  3DOL A;  3ENO A;  4CF2 A;  2PYJ A;  3MN6 A;  2ATQ A;  1E4G T;  3T19 A;  3D2E A;  1DEJ A;  1WSJ A;  3OA9 A;  4ID1 A;  4WE1 A;  1LCU A;  5C42 A;  1K9M O;  2FC0 A;  2YJE A;  4BRM A;  1P8Z A;  5SZT A;  3ID8 A;  3U3Y A;  1QE1 A;  4B1V A;  1G15 A;  4ID5 A;  4CEA A;  4RWT A;  1S9G A;  2KHO A;  5HRR A;  3CF5 L;  3DXM A;  1KAX A;  3LPT A;  4WQ4 C;  1Q7Y O;  1JCG A;  3U4L A;  3TAG A;  4IO8 A;  1YUW A;  3U3G A;  1C0G A;  3QBX A;  5AQV A;  2IGI A;  3VQQ A;  4W5O A;  4LF5 K;  4FL9 A;  3L2R A;  4YOY A;  2QWQ A;  3AVC A;  3VET A;  4CHP A;  3TAE A;  1QSS A;  4CJS A;  4Z4E A;  3OYN A;  3RWU A;  4ELT A;  1XUP O;  4IFY A;  3MK6 A;  1W2B M;  2WUS A;  4E1J A;  1NKB A;  1N8R O;  3D2F A;  1R0A A;  3NFA A;  3OBW A;  2P9I B;  4OPA A;  4CGI A;  2P5G A;  5HRN A;  2P9K A;  3OJU A;  4M3Z A;  4FLT A;  4KHQ A;  1WOQ A;  3K58 A;  4JS4 A;  3F5T A;  1DT9 A;  2P9L B;  4FLW A;  5EXW A;  4JKA A;  1W7A A;  5J2Q A;  5BPL A;  3NE6 A;  3LDN A;  3HPO A;  3T3F A;  4NCA A;  3IG1 A;  3HZ6 A;  4CJU A;  1LV5 A;  1QS4 A;  1HJR A;  2WFB A;  1LW2 A;  4E7L A;  1QZ5 A;  3G71 N;  3QEP A;  4FJX A;  5BR9 A;  3CFR A;  3ZEU B;  3EN9 A;  4BC2 A;  3OYE A;  1BQM A;  1IKW A;  3O5B A;  5KQD A;  1NGB A;  1HYS A;  2GX9 A;  4DTM A;  3FZF A;  3O4N A;  4MDA A;  3SZ2 A;  3THW B;  1NOZ A;  3NVM A;  2PYL A;  3ZYY X;  4M42 A;  4DQ8 A;  1U45 A;  1TYQ A;  1OVQ A;  3ZT4 A;  4CZI A;  1XI1 A;  3H45 C;  2OAN A;  1RDU A;  3O3F A;  4B1W B;  4DQS A;  5JVH L;  3QO9 A;  1LOT B;  1A5X A;  4CZG A;  2OZS A;  3IUC A;  1SAZ A;  2HHS A;  3OYG A;  5AQX A;  4R5P A;  3HSC A;  1TGO A;  2E88 A;  2JWL A;  3LM9 A;  4LSL A;  3VA0 A;  3C6H A;  1XC9 A;  4IDK A;  5AQN A;  2P5O A;  3NHG A;  3L2W A;  2KLA A;  1YT3 A;  4CEE A;  3TAQ A;  2UYT A;  4YOW A;  1IV0 A;  3E9O A;  2CGJ A;  1B92 A;  5KPT A;  1BA0 A;  1BWF O;  2BUP A;  4EFH A;  1OKJ A;  3LP1 A;  4IEI A;  3G10 A;  3FR0 A;  3EO3 A;  3R6M A;  3DLH A;  3UE5 A;  4CEQ A;  4CEO A;  1RTJ A;  1B9F A;  3WNG A;  4CES A;  3ZT2 A;  1T7P A;  1NGE A;  1Q82 O;  4LD0 A;  2HBK A;  5HBM A;  3VPZ A;  3SAF A;  3J7Y P;  4CGD A;  5KPZ A;  2ZGY A;  1S9E A;  2JLE A;  3NGZ A;  3O4Q A;  2OCE A;  4JKG A;  5HRS A;  4G1Q A;  4GKK K;  1HNV A;  2DY4 A;  4MQ3 A;  1BL3 A;  3VTH A;  2GV9 A;  5CYM A;  4BVP A;  1DKG D;  4BWM A;  2QWM A;  3VEY A;  2OPP A;  3AVJ A;  3CM6 A;  3D6R A;  5AQO A;  4LY7 A;  3EZW A;  4CJT A;  5LJW A;  4DUY K;  4DR3 K;  1NJI O;  3LAN A;  2IS3 A;  2XO7 A;  3U9D A;  1TUU A;  1UA0 A;  3L2V A;  5KPR A;  3SV3 A;  4JRP A;  4CK1 A;  4DV6 K;  4E7H A;  3SAH A;  4OGC A;  3A5O C;  3K0S A;  3KD1 E;  3KK7 A;  3OYD A;  2O8F B;  2HST A;  2DFH A;  3VOV A;  3LZJ A;  4KHS A;  3QEW A;  1YHQ N;  1YTA A;  3S3N A;  3MEC A;  1WBD A;  3TTD A;  1RT3 A;  3QIO A;  4B9T A;  2P9P A;  3OYC A;  2Q31 A;  4M3R A;  3L8B A;  4JLH A;  2D0C A;  3RRH A;  3M8S A;  2BTF A;  3Q7B A;  4FM1 A;  4IOA L;  3CI5 A;  2PY5 A;  1FW6 A;  2YHA A;  3R1X A;  2Y1J A;  4JHD A;  2E1Y A;  2BDP A;  1X9S A;  2W6L A;  2IDO A;  2HOE A;  5M1F A;  1VQK N;  4F4K A;  3OY9 A;  3NBP A;  1XMO K;  1S6Q A;  2P51 A;  4B1Z A;  4FWN A;  3KKR A;  2ITG A;  1NK6 A;  4B9L A;  3KKS A;  1RDB A;  2ETJ A;  3BZK A;  4FZX C;  3U8X A;  3WNH A;  3C6T A;  3P83 D;  3DLG A;  1KTQ A;  4FLZ A;  4FZY A;  4RW8 A;  3NH1 A;  4KB0 A;  3ZT1 A;  3WEE A;  3AA5 X;  4W5R A;  3HOS A;  2J4R A;  1L3V A;  3AGR A;  5BRH A;  4CBU A;  1NMN A;  4WFB L;  3SCX A;  4DR1 K;  2WBN A;  1HKB A;  3QB0 A;  4KV8 A;  3UKR B;  2A1S A;  3TI0 A;  5BRE A;  4E89 A;  3IMX A;  3IS9 A;  3DXK B;  4A2B A;  5HRO A;  4FM2 A;  3D0P A;  4DV5 K;  3O08 A;  4BRQ A;  1JXB A;  3C6A A;  2KQ2 A;  4M7X A;  3S41 A;  2BGG A;  2W6K A;  4DV4 K;  3I0R A;  1ZBU A;  2PFU A;  4YDU A;  2KTQ A;  4CGJ A;  3SMS A;  3OYF A;  2HNY A;  1RFQ A;  5ADX A;  1HMV A;  3SBT A;  4CZJ A;  3AVL A;  4DSJ A;  1VQ7 N;  3MN5 A;  2NRW A;  3WXI A;  3QEX A;  3LP0 A;  4FJ5 A;  3AAP A;  3DWL A;  3KHY A;  4FM0 A;  1TVR A;  3VGL A;  4FCY A;  1JKH A;  2P9S A;  2D1K A;  5AQT A;  1UWB A;  4CHO A;  4MO5 A;  3HYF A;  5J2N A;  4TSX A;  4PWD A;  3HOT A;  3PUF A;  3NGY A;  4FOI A;  1VQL N;  2QKB A;  4Y0W A;  5AQZ A;  5AQS A;  2QWR A;  4DFJ A;  3PO4 A;  1SL2 A;  4EHU A;  2I5J A;  3CCE N;  1KFS A;  4AM7 A;  3S3O A;  4WQ4 A;  2GUI A;  3EY1 A;  2YKN A;  1IKX A;  2FBT A;  4M3U A;  5DMR A;  1O13 A;  4MLH A;  4JD2 B;  3N4Q A;  3FZK A;  1TAU A;  4QS7 A;  1U2V A;  4IDH A;  1Y97 A;  3VEZ A;  2V7Y A;  3CCV N;  1NLV A;  4CEB A;  3ULE B;  4DWI A;  3KWI A;  3UB5 A;  1NGA A;  4K25 A;  1FKP A;  1BA1 A;  3OYL A;  1GOC A;  3NF9 A;  4DR2 K;  3MXM A;  3A8Y A;  4FJK A;  3E66 A;  4OVL A;  4NYF A;  2D0A A;  1YJN N;  4BC3 A;  3NF7 A;  3QFU A;  3O9U A;  3DLL L;  4EP4 A;  4CJ7 A;  3IKM A;  4K0K K;  4DU4 A;  3MCA B;  3V1R A;  4CZL A;  2GWK A;  5C10 A;  1T44 A;  1NK7 A;  1MDU B;  4LSN A;  4H5W A;  4YOV A;  3TAB A;  2GWJ A;  3HBT A;  5LMU K;  4DR7 K;  2A6A A;  3ALY A;  2QWL A;  3L3V A;  2F96 A;  2FF3 B;  3WNF A;  1YF5 L;  4FOE A;  4OLB A;  1GLJ O;  3KJV A;  1QSL A;  1L3S A;  4X62 K;  3NH0 A;  3BGR A;  1LAW A;  3CCJ N;  3NGI A;  1HYV A;  2G8V A;  1ZBS A;  3DXM B;  1ILY A;  2ZQB A;  1S1X A;  4RW4 A;  3KIO A;  4Z4C A;  1N5Y A;  2KFN A;  2WC9 A;  4O5B A;  3CM5 A;  3HVT A;  3DLK A;  2A1R A;  4XIU A;  1VSH A;  5E84 A;  3KK3 A;  4Z4H A;  2HMP A;  3D2F B;  3WQT A;  4GV6 A;  5GAD P;  5C2F A;  3G25 A;  3KD5 E;  2OPS A;  3J7Z O;  3TSU A;  1S22 A;  4FWQ A;  3ASM A;  4BRF A;  1S1V A;  3HM9 A;  4O44 A;  1G99 A;  1FXX A;  1NK0 A;  5GAG P;  5FPE A; 
#chains in the Genus database with same CATH homology
 2YCH A;  3CF5 L;  4IO9 L;  3DXM A;  1KAX A;  4WQ4 C;  1Q81 O;  3MWP A;  1Q7Y O;  1QQN A;  1U2V B;  4H5R A;  1JCG A;  3U4L A;  4C1N I;  2VYP A;  4IO8 A;  1YUW A;  3ZET B;  5BN8 A;  4BR5 A;  1C0G A;  1HJO A;  1RGI A;  1X3N A;  3QBX A;  1BO5 O;  5AQV A;  4ILJ A;  4L3Q A;  2GTD A;  4FL9 A;  4YOY A;  4C23 A;  2QWQ A;  2Q0U A;  3VET A;  3SK3 A;  4LC9 B;  3FFK B;  5GIP A;  1R59 O;  3IFR A;  1XUP O;  3MK6 A;  1W2B M;  5C15 A;  2WUS A;  4WFA L;  3KZB A;  4E1J A;  1YJW N;  1N8R O;  3D2F A;  1K8K A;  1TUY A;  3O1B A;  3O9Q A;  4A2A A;  3WXJ A;  4BRP A;  3JXU A;  1NGD A;  3OBW A;  2P9I B;  4OPA A;  2OTL N;  3M1F A;  4BR4 A;  3CCR N;  1JJ2 M;  2P9K A;  4U7B A;  4PKI A;  4GV9 A;  4ISG A;  1WOQ A;  4CZK A;  3EL2 A;  3F5T A;  1BOT O;  3UKU A;  3PIO L;  3WXM B;  1YVN A;  2YHY A;  3G4S N;  2FF6 A;  1DT9 A;  3A5N C;  5AFU H;  5F0X A;  2P9L B;  4BRC A;  3M5R A;  3A5L C;  5EXW A;  4ILG B;  4JKA A;  2W40 A;  1KAY A;  4IOX A;  5BPL A;  1P90 A;  3CME N;  3CPW M;  4A59 A;  3P31 A;  3LDN A;  3L4Q A;  4GNI A;  3O80 A;  3HZ6 A;  3HM8 A;  5M1P A;  3VMF B;  1NGG A;  4BR9 A;  1QQO A;  5I9E B;  1GLD G;  2A3Z A;  3CQY A;  2BH1 A;  2WFB A;  1QZ5 A;  3G71 N;  5AFU A;  4KBO A;  5BR9 A;  4BRG A;  5CE3 A;  3ZEU B;  3EN9 A;  2E2N A;  5FPN A;  1KAZ A;  4BC2 A;  5CHI A;  2ASO A;  2QWN A;  1C0F A;  3O5B A;  5KQD A;  1NGB A;  3M6G A;  3GDQ A;  2GX9 A;  1Y64 A;  2NLX A;  2P9I A;  1K8A O;  5AQF A;  3FZF A;  2QW9 A;  3IDH A;  2QWP A;  3QBW A;  4MDA A;  3MMV A;  1SZ2 A;  3LM2 A;  3BP8 A;  2VWB A;  3F9M A;  4HTL A;  2ITM A;  1YAG A;  3WQU A;  5BRF A;  2ZGZ A;  1YXQ A;  1IG8 A;  1U6Z A;  3BEX A;  3VGM A;  3BF3 A;  5F2R A;  5AZI B;  1D4X A;  2FSJ A;  4JKB A;  3NVM A;  3ZYY X;  4YOX A;  3CC7 N;  4BG8 A;  2ASP A;  3O6W A;  3ID6 A;  1HKG A;  4DQ8 A;  3TSP A;  1JCE A;  3A5M C;  1TYQ A;  4BC4 A;  4M7Y A;  3D2E B;  3QIC A;  5JMV A;  2QI2 A;  4QS8 A;  4CD1 A;  4CZI A;  2ZJR L;  3H45 C;  2OAN A;  5GAE P;  3O9S A;  4FWS A;  1RDU A;  4B1W B;  4FO0 A;  2E8A A;  4WFN L;  4BR7 A;  1S72 N;  1ZXO A;  4JEP A;  3K9J A;  5JVH L;  2FSN A;  1LOT B;  4ISF A;  1NGJ A;  4CZG A;  3IUC A;  1SAZ A;  5AQX A;  1EQY A;  3HSC A;  2E88 A;  4B1Y B;  1HX1 A;  5F1X A;  2NRH A;  4IWV A;  2JWL A;  3LM9 A;  4A61 A;  5MLC Q;  3ZX2 A;  3C6H A;  1OVY A;  4OPH A;  5AQN A;  5TKY A;  1VQP N;  3DJC A;  4XH5 A;  2KLA A;  3O1W A;  4JNE A;  3ATU A;  2W41 A;  2UYT A;  1M1K O;  3T7Z A;  1BG3 A;  2HBM A;  3E9O A;  3E9L A;  5EY4 A;  4YOW A;  1JCF A;  2CGJ A;  4I6M A;  4BR2 A;  5KPT A;  1BA0 A;  1BWF O;  1KQS M;  2BUP A;  3BF1 A;  4EFH A;  4IEE A;  3CCU N;  3C7N A;  5M1N A;  3CXC M;  5M1K A;  1OKJ A;  4IEI A;  3L0Q A;  2P9K B;  3T69 A;  1GLE G;  3CJC A;  4WCE L;  1HPM A;  1NM1 A;  3FR0 A;  3HRG A;  4IXC A;  3EO3 A;  5TKW A;  3UKU B;  3R6M A;  4JKE A;  1MWM A;  3UE5 A;  3CER A;  4NO7 A;  5AQJ A;  3O8M A;  3JS6 A;  3FGU A;  4ISE A;  5AQI A;  5DM6 L;  3OW2 M;  3LL3 A;  3PIP L;  4H0V B;  4PL8 A;  1NGE A;  3P4I A;  4FSV A;  1Q82 O;  3I33 A;  1NMD A;  2GEM A;  2HBK A;  3VPZ A;  3SAF A;  4EIA A;  1H1V A;  2ZWH A;  3H3N O;  5KPZ A;  2ZGY A;  2HBJ A;  3AAQ A;  5AQQ A;  4K42 A;  1V4T A;  4JN4 A;  3MN9 A;  3CJA A;  3G6E N;  5EOY A;  3H3O B;  4H0Y B;  1VQ6 N;  2HF3 A;  4JKG A;  4J8F A;  4U67 L;  3CHW A;  2Q1N A;  2E1Z A;  2P9U A;  3FZH A;  1NWK A;  3VTH A;  1S3X A;  4YOR A;  4A62 A;  3UKR A;  2QTD A;  5CR4 A;  3CC4 N;  5AQH A;  3W3D A;  4BVP A;  2QM1 A;  1DKG D;  4A57 A;  1DGK N;  2QWM A;  3E9P A;  3M3Z A;  3WXK A;  3VEY A;  4AM6 A;  1X9J A;  3NVK A;  3D6R A;  5AQO A;  3WXL A;  3KVG A;  1M90 O;  3EZW A;  3MWT A;  3CCM N;  4CD3 A;  2E2Q A;  4XEI A;  1HLU A;  5LJW A;  3F2K A;  3FLC O;  1ESV A;  3OHR A;  1NJI O;  3CET A;  3U9D A;  4CI6 A;  1TYQ B;  2Q2R A;  4JK8 A;  1TUU A;  1GLB G;  2IVN A;  5KPR A;  5C12 A;  1Z05 A;  4FWR A;  5AQY A;  2NRZ A;  3SAH A;  1GLF O;  2YI1 A;  3QML A;  3A5O C;  4BQL A;  3KK7 A;  2I7P A;  3U9Z A;  4IZ9 A;  4MO4 A;  3SBG A;  3TTC A;  3P39 A;  3CJB A;  4GY2 B;  4YOU A;  2HST A;  5AQM A;  1VQ8 N;  4A5A A;  4R79 A;  3VOV A;  4PKG A;  3R3L A;  1V4S A;  4JK7 A;  1YHQ N;  2H3G X;  3D7E O;  3K9K A;  1T6C A;  3CJ1 A;  2VCP A;  3CPE A;  3MN7 A;  2NRX A;  4RTF D;  3TTD A;  2P9P A;  2Q31 A;  3DAW A;  3GOI A;  3SLC A;  2CH5 A;  4FWP A;  3N4P A;  3L6Q A;  5M1Q A;  2VGM A;  2KKZ A;  2P9N A;  3O9R A;  3CC2 N;  5ELZ A;  1SQK A;  4KH5 A;  4AF1 A;  2BTF A;  3LDQ A;  3Q7B A;  4I6M B;  3RSE A;  4IOA L;  3CI5 A;  5FPD A;  3R1X A;  4O5F A;  4KH6 A;  4BRE A;  4JHD A;  2E1Y A;  3CCL N;  1BUP A;  2AP1 A;  1KXP A;  3C7N B;  4F9O A;  4H0T B;  2HOE A;  4IOC L;  3RVC A;  5M1F A;  1VQ4 N;  1VQK N;  3MX5 A;  2Q36 A;  5BPM A;  4B1Z A;  2A42 A;  4FWN A;  4JAX A;  2D0P A;  4JD2 A;  4XH4 A;  4MDB A;  1HUX A;  3J8A A;  4B1X B;  2F9W A;  3ULE A;  4WF9 L;  1YI2 N;  3U8X A;  3VF4 A;  4PL7 A;  5AZJ B;  4JKD A;  1E4F T;  5C2D A;  1VQO N;  5C0Y A;  1K73 O;  3WT0 A;  4BY9 C;  3NMU A;  1NGI A;  3SJH A;  1J6Z A;  3H1Q A;  3WEE A;  3TU5 A;  4BVO A;  3VEO A;  2NNW A;  1T3V A;  3TTF A;  4BRH A;  1YIT N;  3WUH A;  5H1S Q;  4CZF A;  3HOS A;  4NLB A;  2J4R A;  3CJ7 A;  4JKG B;  3AGR A;  2ZJP L;  5BRH A;  3AGK A;  4CBU A;  3E1Y A;  4HWI A;  2DPN A;  4WFB L;  2ASM A;  4CBW A;  3CCS N;  4IJA A;  1X3M A;  2P9U B;  2WBN A;  2NRV A;  1HKB A;  3VGK A;  3QB0 A;  4FPA A;  3UKR B;  5BRE A;  4WQ5 A;  3IMX A;  4CZM A;  3DXK B;  2YHW A;  2CH6 A;  2YHX A;  4A2B A;  3VEW A;  4H0X B;  3CCQ N;  3O08 A;  3H46 O;  3CCV N;  4BRQ A;  1ATR A;  4M63 C;  2NRT A;  3C6A A;  1Q18 A;  3TSQ A;  2A40 A;  4M7X A;  3EE8 A;  3S41 A;  4DHY A;  3Q7C A;  5E26 A;  5AZJ A;  5EX5 A;  3GBT A;  2FLO A;  2PFU A;  4YDU A;  1YJ9 N;  4O8K A;  4YOT A;  3VTI A;  1KD1 O;  3SMS A;  1RFQ A;  5BN9 A;  5ADX A;  3SBT A;  4CZJ A;  1SS6 A;  2QA4 N;  1WUA A;  3MN5 A;  1VQ7 N;  2NRW A;  3WXI A;  4CBX A;  2QXL A;  3AAP A;  3PLA A;  2I7N A;  2IVP A;  2HBL A;  2NZT A;  1GLC G;  3DWL A;  3KHY A;  3VGL A;  3I55 N;  5BRD A;  5HL7 L;  2P9S A;  1QZ6 A;  2D1K A;  2P9P B;  4NLC A;  3HTV A;  1QHA A;  4MO5 A;  5AQT A;  3L4I A;  3DXK A;  2F9T A;  2ZF5 O;  3EE9 A;  3H6E A;  4JK9 A;  3ZX0 A;  4B1U B;  2JWK A;  4BRO A;  4BRA A;  4C1N K;  3HOT A;  4ILH A;  1XQS C;  4FWM A;  2FSK A;  2OTJ N;  2P9N B;  1QVF M;  3ZX3 A;  5LY3 A;  4BRK A;  5FPM A;  2D0O A;  4FOI A;  1VQL N;  1VQN N;  4Y0W A;  3VEN A;  5AQZ A;  5LJV A;  4H0P A;  4H5T A;  2QWR A;  5AR0 A;  5AQS A;  4FWO A;  3RSE B;  2V51 B;  4CZH A;  2YX6 A;  5AQR A;  5EVZ A;  4EHU A;  2CGK A;  3CCE N;  4JHD B;  2IIR A;  1VAZ A;  4KH4 A;  3VER A;  4Z94 A;  2RE2 A;  3O9T A;  4AM7 A;  1ZC6 A;  4WQ4 A;  4PHT X;  3VF6 A;  4JKF A;  4O8U A;  3GL1 A;  4BGA A;  1T6D A;  1MA9 B;  1O13 A;  3FZM A;  2PAV A;  4CZE A;  4MLH A;  1MWK A;  4JD2 B;  3N4Q A;  3FZK A;  4JKC A;  3C65 A;  4IJN A;  1ATN A;  3CD6 N;  2FXU A;  4QS7 A;  1U2V A;  5AQK A;  4IDH A;  3AAR A;  4QS9 A;  2V7Y A;  3EKU A;  3EKS A;  1NLV A;  2F7T A;  1NGF A;  3ULE B;  3VEZ A;  1YIJ N;  4H5N A;  3KWI A;  3ZET A;  3UB5 A;  1NGA A;  4K25 A;  1BA1 A;  2GEL A;  2AA4 A;  1NGC A;  2E2P A;  5GAH P;  4H0O A;  5JVG L;  4UY8 O;  3VEV A;  5AQG A;  3A8Y A;  3P38 A;  2Q0R A;  5GIN A;  3OBY A;  1HKC A;  3E66 A;  3FE1 A;  3HI0 A;  1XC3 A;  3WEE B;  1YJN N;  2HF4 A;  1GLA G;  1W97 L;  1NBW A;  3C0B A;  4BC3 A;  4EAH D;  4BRN A;  3AY9 A;  1CZA N;  3QDK A;  5JLF A;  3ATV A;  1EO1 A;  4BRI A;  3QFU A;  3LDO A;  3O9U A;  4EHT A;  4A5B A;  3DLL L;  4FWK A;  4CJ7 A;  3IKM A;  2YJF A;  1NGH A;  3MCA B;  4BRD A;  4CZL A;  2PBD A;  2GWK A;  5C10 A;  5B8H A;  1T44 A;  3BUZ B;  1MDU B;  4OO1 J;  4BG9 A;  2QWO A;  4H5W A;  4YOV A;  4K43 A;  2GWJ A;  1ATS A;  3HBT A;  3QFP A;  4H03 B;  2P9L A;  3GE1 A;  2A6A A;  3CMA N;  2GUP A;  1BDG A;  5BPN A;  3B8A X;  4MLE A;  2QWL A;  1Q86 O;  2IVO A;  4WQ5 C;  5AQU A;  2D4W A;  4PKH A;  4FPB A;  2FF3 B;  1YF5 L;  2E2O A;  3LDP A;  4GV3 A;  4FOE A;  4DCH A;  4GVE A;  1GLJ O;  4JKH A;  3R8E A;  3I56 N;  5M1O A;  2VGN A;  2A5X A;  4NB4 A;  1VQ9 N;  5GIO A;  2CGL A;  2A41 A;  3I8B A;  2QEX N;  2EWS A;  2RHK A;  2V52 B;  3MCP A;  4IFE A;  4BR0 A;  5JIC A;  2ZJQ L;  3ZEU A;  3SMP A;  5DM7 L;  3CQX A;  4YDU C;  1VQM N;  3CCJ N;  3CIP A;  1QQM A;  4B9Q A;  4G9Z A;  1IJJ A;  2Q97 A;  1ZBS A;  4BC5 A;  3ENH A;  3DXM B;  1ILY A;  5HOO A;  3CJ9 A;  4RCH A;  3MDQ A;  5AQP A;  4BRL A;  3A0I X;  3KWG A;  5KQ8 A;  3R9P A;  4DKW A;  4XH1 A;  2P9S B;  4K41 A;  1RDW X;  5AQL A;  3O4W A;  2WC9 A;  3H1V X;  3W0L A;  4H5V A;  1KC8 O;  3MX2 A;  5ADX H;  5AZI A;  3VES A;  4FVU A;  3ENO A;  4DB3 A;  5JLH A;  3VF2 A;  3MN6 A;  5E84 A;  1E4G T;  1VQ5 N;  3D2E A;  3FZL A;  1BU6 O;  1DEJ A;  3OA9 A;  2HMP A;  3D2F B;  1K8K B;  1Z6R A;  3WQT A;  1LCU A;  4GV6 A;  5GAD P;  5C2F A;  2E20 A;  3GG4 A;  4BRM A;  2YJE A;  3G25 A;  1K9M O;  1P8Z A;  3ENB A;  4BGB A;  3ID8 A;  4BQZ A;  3J7Z O;  3TPQ A;  3TSU A;  1S22 A;  4B1V A;  3SAG A;  4FWQ A;  3LDL A;  3VEX A;  4BRF A;  4RWT A;  1QVG M;  2NRR A;  1G99 A;  2KHO A;  2V7Z A;  4WYB A;  5AQW A;  4FWL A;  5GAG P;  5FPE A;  1GLL O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...