1T3VA

The nmr solution structure of tm1816
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHHHEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title NMR structure determination of the conserved hypothetical protein TM1816 from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1t3vA01
2YX6A 2QTDA 1EO1A 1T3VA 2RE2A 2WFBA 2KLAA 1RDUA 1P90A 1O13A
chains in the Genus database with same CATH superfamily
3AVJA 3EL2A 3NF6A 2QW9A 4BRQA 2P5OA 4BE0A 4JKCA 3R9PA 2A42A 4GVEA 4BE2A 2QM1A 4GMJB 4F2RA 4AILC 5CZ1A 3W3DA 4ELTA 1NK0A 1I94K 4L3QA 3K0SA 1IKWA 3THVA 3NMUA 3SPZA 3P1GA 3TSPA 1S1WA 4ID1A 2X74A 2GUPA 5GAGP 2XO7A 4DTRA 3SUNA 3THYA 2PYJA 5AQIA 3Q7BA 2P9KB 1BU6O 5T7BA 3AVFA 3TU5A 3J81O 3JSMA 4LF4K 1E3MA 2CGJA 3AAPA 4FWNA 4DB3A 3OJSA 4BGAA 1O13A 4BG8A 4RW7A 4ILGB 2VQEK 2D4WA 3BGRA 3S9HA 3MXIA 4H8KA 3CJCA 3HRGA 4ILHA 3TAPA 2UUBK 4FLVA 1R59O 2DPNA 3DOLA 3PIOL 3LDNA 3ZEUA 2R7YA 1YI2N 4CGHA 3HO1A 3HVRA 4KH6A 1YTUA 3SV4A 1ZBHA 3M8RA 1OKJA 1VSDA 5TKYA 2Q31A 3C65A 3LP3A 4CHQA 3O80A 1OVYA 3TSQA 4OPHA 5AQUA 2WUSA 5AQWA 4BR9A 4J2DA 4FPAA 2H3GX 3VQDA 1XI1A 4KB0A 2HBJA 3SQ1A 1SQKA 2OTJN 1T05A 1IH7A 3CJ1A 3FLCO 2P9KA 1Z26A 2FBVA 4JNEA 5AZJB 2G8HA 3TTFA 4ZTJA 4FZXC 3MWPA 1HYZA 1OH5A 2GV9A 3ASMA 3HSTB 2ZD1A 1T3VA 3L4IA 3VQ7A 1B9FA 4AM7A 2OPPA 1KFDA 1P8ZA 2YJFA 3QO9A 3DYAA 4CZHA 4CEOA 1KSPA 3MDQA 3OYFA 4DV2K 4JI3K 4RG8A 3KD5E 4CF0A 3E1YA 3VMFB 3VGLA 2HHVA 4DSEA 3K5OA 1X3NA 4CEDA 2A1SA 1RDAA 3HJFA 1K6YA 1HNZK 1XNRK 3NBPA 2ETJA 3L3VA 5JS2A 1B92A 2QWMA 1ZBSA 4NYNA 3I56N 5AQXA 5HRPA 4FWSA 4EZ6A 2P1JA 3RMBA 4KREA 3U9ZA 4WQ4A 3DLRA 4QOZB 3O9QA 3L2QA 3CFOA 1RDWX 3TARA 3T1HK 5LJWA 4ELUA 3TPQA 3DLEA 5C25A 4CEAA 5AZJA 5CYQA 4LC9B 5CHIA 4QS7A 3M5RA 4WQ5C 3J7AP 1JCGA 1GOBA 1YIJN 1GLDG 3RMAA 4H0TB 4OJRA 3MWTA 3KK2A 4CD1A 3AVAA 4A2AA 3RWUA 3PO5A 4MDAA 1G15A 4CGJA 3U3YA 3MEGA 2HNYA 1BO5O 5HRSA 2ZWHA 4MO4A 5HOOA 3GL1A 1CXUA 3QEWA 2QTDA 2FXUA 1XQSC 1Q7YO 1KD1O 2QI2A 4H0YB 2O8EB 1U6ZA 4IOCL 2Q2RA 1ASWA 2OCEA 5AQSA 4E7HA 1NGBA 3LANA 3IAYA 3TR8A 4FLYA 1UA0A 2F9WA 4NXNK 3VTHA 1C1CA 3PIPL 2VGMA 3T3FA 4AM6A 4W5RA 3CG7A 1XHZA 2YHBA 2Z1IA 2HHSA 4YDUC 4FJ9A 1L3SA 4CZEA 3O1BA 2Q0UA 2NRVA 2DFFA 1JL1A 4FYDA 3KK3A 4CHYA 2FF6A 3SNNA 4O8KA 4RW6A 3OS2A 2HW3A 5LMNK 2HHWA 4AQYK 2FSJA 3WXJA 4XH1A 4FLXA 4DFPA 3V9WA 3D2EB 1WLJA 4M41A 5C10A 1X9MA 3CCQN 3BF1A 4WYBA 4CZJA 1OH6A 3BY5A 3CMEN 1S1XA 5LY3A 4CF8A 5CY4A 4CJLA 3EKUA 4Z4IA 1Z05A 2WFBA 4H0XB 4BC5A 4NB4A 4EAHD 1ZBFA 2O8EA 2G8WA 2ASOA 3KKSA 3OYKA 4DSKA 4B9MA 2P9IB 4HUEA 2OA8A 2E5LK 4M3XA 4CEBA 5FRMA 4EHUA 4OPJA 4DF4A 3HM9A 5GADP 3HBTA 5ELZA 4FK4A 3IUCA 1VQ8N 4ZTFA 5GAEP 3SI6A 4KI4A 1ZBIA 2CGLA 4DQRA 3CJAA 3KWGA 4MFBA 2V7YA 5M1NA 3EYZA 4DQPA 4B8AB 3CJBA 3O9RA 2XY8A 2V51B 3MMVA 2JWKA 4C8OA 4DSFA 4JK7A 5AQVA 4J2EA 4FJNA 1WUAA 4DLGA 2YNFA 5JLFA 3G10A 2E2NA 3AAQA 3D2EA 4DKWA 3VQQA 4I7FA 4RW9A 4BRHA 1NK9A 1VSIA 1W97L 4KHUA 1HJOA 4BC3A 4FJIA 4BG9A 4FO0A 4DTSA 1K8AO 1E4GT 2YHWA 5KGWA 1IG8A 3NGYA 4C8KA 3ZSZA 1HQUA 4DR3K 1VQON 2P9IA 1NK6A 1W0HA 3G6EN 4G9ZA 3QLHA 4DTUA 3KK1A 2E2PA 1L5UA 4K25A 1HLUA 1NU0A 4HUFA 4FVMA 3VQ9A 4YY3K 1BGXT 4IXCA 1U2VB 3PV8A 3E9LA 4R79A 4DUYK 2HMPA 2F8TA 4FVUA 4CZFA 2ITGA 1SL2A 1X9JA 1WN7A 3LALA 1QQOA 4F3TA 3TWHA 3HVTA 1KVAA 2G8FA 1N34K 4UY8O 3MN9A 4LF5K 1Z6RA 3CJ9A 1J6ZA 2QWRA 3BDPA 3QESA 1C1BA 4BY9C 4IBNA 4IG3A 4ID5A 2GELA 1QQMA 1IJJA 4IFEA 4A5BA 3CQ8A 3TTDA 2HNDA 3OS1A 3ALYA 4AH9A 2P9PB 5AQJA 3MX2A 4B3RK 2RKIA 2OZSA 3CM5A 4B1YB 5KPZA 3WUHA 2JWLA 4CHPA 3GG4A 1FJGK 3MN5A 3CFRA 1NJWA 2GTDA 5M1OA 3SQ4A 3RR7A 4O55A 4FWPA 3AARA 1Y97A 1U2VA 3SCXA 4JRPA 2VYPA 4O8UA 3TABA 1JLGA 4O0JA 1N32K 1S1UA 3U9DA 2ZE2A 3L2VA 5BRDA 1BG3A 1GOCA 4HCBA 4B3OA 3OJUA 2F8SA 1WSGA 4CFAA 3KHYA 4DLEA 4Z4CA 1BUPA 2W6LA 4A61A 4Z94A 2E1YA 5J1EA 3IRXA 3NGIA 1HR0K 2W6KA 1S3XA 3HTVA 4N5SA 2QA4N 1VQKN 3KD1E 1BIUA 4KO0A 2P9PA 2V52B 3WT0A 1C0UA 2BH1A 4IG0A 3KIOA 3PSIA 3EN9A 1MU2A 3GBTA 3O3HA 1MWKA 2NRHA 1ZXOA 3HOTA 1XC9A 3DLHA 4Z4HA 3O3GA 5AQYA 3CQYA 4CZKA 3FFIA 4JI7K 3VGKA 3VGMA 3ZT2A 4FK0A 1M1KO 1FKOA 4YDUA 3G4SN 3K57A 1L3TA 1U4BA 2OYQA 4IWVA 3KK7A 4C8NA 3E9OA 4BR5A 3GOIA 4FJ8A 3K5MA 3FR0A 4E7LA 3MX5A 1JXBA 4B3TK 5E26A 4HWIA 3V9UA 2I7PA 2W41A 3O4NA 1BQNA 2RN2A 4PHTX 3EKSA 1NKBA 5LMUK 2WC9A 4A2BA 2O8CB 3KZBA 2HHHK 1VQ4N 2FSKA 1JJ2M 3KJVA 3H1VX 1HPMA 3CERA 1A5VA 4YOVA 4FSVA 4W5NA 2IOCA 4DG1A 1NJXA 4DR5K 1IKXA 1KAYA 3VQ4A 4DR1K 4M3TA 4DU4A 5JVGL 2HSTA 5K14A 4EIAA 4K43A 4W5OA 4B8CA 4BR2A 3AVBA 1VSFA 5FPEA 2BANA 1NBWA 4Y1DA 1CZAN 4DF8A 3TSUA 4H0VB 4B1VA 4V19S 5C2DA 3J80O 3O5BA 1N36K 1GLJO 3ZT4A 3O9TA 1HYSA 5KRTA 3CPWM 1RTJA 3ENOA 3VA0A 1RT7A 4FJMA 4AHTA 1EWRA 3WNEA 4J8FA 3AA2A 1BL3A 3H1QA 3LWMA 5AQKA 4E7KA 3BZKA 4ILJA 2D0AA 4JI5K 3NVKA 4OKEA 1S72N 4OPKA 5BRFA 1VRUA 2QEXN 3LPUA 4M63C 4CBWA 4WFAL 4B1ZA 4JKHA 4HTLA 4BRMA 3I8DA 2O8CA 1IO2A 2CH6A 2YKNA 4AF1A 3ATVA 3P83D 5M1KA 2ZM6K 1VQ7N 5AQMA 5AZIB 2Y1IA 4DV1K 3ULEB 3MEDA 4YNQA 3VQ6A 3SAFA 2QWQA 4WE1A 2B5JA 3E9PA 1TAUA 2RF2A 4JI0K 4CI6A 4DWIA 5E84A 1YXQA 4WFBL 4CJUA 4O0IA 1KLMA 2HVIA 4XH5A 3D45A 4YORA 3IMXA 4DFKA 4LY7A 2UXDK 4KHWA 3LWLA 3O8MA 3KLHA 2DTUA 2FLOA 1TKZA 3D7EO 1D8YA 3CPEA 1QHAA 4CJ7A 2VG7A 3U4LA 3VEXA 4M7YA 3NF8A 1YJNN 5JICA 3MXMA 2P9LB 4BREA 5BREA 1QSLA 4AHUA 4JYAK 4NYFA 4QAGA 2NRTA 2VG5A 4BWMA 3ZT1A 3V9ZA 3QETA 4IJNA 4N41A 4FLUA 5AZIA 3SQ2A 2VGNA 3CCJN 1SAZA 3ULEA 4ISEA 3CCMN 3HPOA 3RTVA 2P9NB 3CJ7A 3ID8A 2A5XA 4KFBA 4JV5K 3F5TA 1N6QA 1RFQA 4CGDA 4B1XB 3IG1A 2YJEA 3CCVN 2VWJA 3QFUA 1K73O 3FZKA 4B9TA 5I42A 3NH2A 4FWMA 4RTFD 2AJQA 1EETA 1NJYA 3OYMA 3QERA 4CZIA 3SJJA 1ITGA 3S41A 1QE1A 1GLBG 1JCFA 4M3YA 3V81A 2HBMA 3WQUA 1LWCA 4IDKA 4Q5VA 3V9XA 2P9LA 3AVLA 4KHPK 2BGGA 1KVCA 2IGIA 2PFUA 3D6RA 5C42A 1SS6A 3OVNA 3QB0A 4LSNA 4DMNA 1WB9A 4CJKA 2X6SA 4CJQA 1H1VA 2VWKA 3VF2A 4BRGA 5FDLA 4EHTA 3G71N 2P9NA 1CLQA 4JKDA 4FOEA 1HX1A 4ICLA 1S9EA 4IOAL 1ZYQA 1D5AA 1NGDA 4YHHK 5KPRA 1JLAA 2F9TA 2VWBA 1IKYA 4GV6A 4JKEA 2O4GA 1QQNA 1DGKN 1NMDA 1NGAA 3TAEA 3IFRA 4FXDA 1RT1A 3B8AX 4JKAA 4TSXA 3QMLA 3PUFA 3RRGA 4BR4A 5CYMA 4J2BA 2W40A 1GOAA 5J2NA 3OYNA 5KRSA 4DSLA 3QDKA 2YHYA 3BZCA 4CJWA 4BC2A 1XC3A 3DLLL 1QVGM 1LAWA 3U8XA 2XY7A 3T1AA 1BISA 4FPBA 5M1QA 2KQ2A 2ZF5O 3V6DA 4CHNA 1WSFA 3KKRA 1JCEA 4YOTA 4ELVA 1WSIA 2Q97A 3AO5A 4N47A 4BR0A 3A5LC 4M3WA 1DTTA 1WSEA 4DTMA 3UB5A 3ZT0A 2B4JA 4CIFA 1W7AA 1M90O 4DTOA 1IBLK 4DQIA 3JAMO 3D0PA 4Z4FA 4PQUA 5C24A 1XNQK 2E2QA 4JI2K 1VSLA 4KV8A 3AVIA 1Q18A 5SWMA 2AA4A 3ZSYA 5BRHA 3FE1A 1A5XA 4E0DA 1EX4A 5AFUH 3PX4A 1EQYA 1SKRA 4HTUA 4KAZA 1T6CA 1SV5A 4H5TA 1HMVA 3ZSRA 3HM8A 1RBVA 5GAHP 4E3SA 4B1UB 3LDLA 3B6PA 4XH4A 1IV0A 4CJEA 1D9DA 3Q7CA 4I2QA 1RDUA 1HUXA 3SLCA 1HRHA 5D3GA 1YHQN 4F2SA 3DXMB 2B6AA 4E89A 3MEEA 3O9UA 4WF9L 2JLEA 3K59A 1NLVA 2E6LA 1UAXA 4BDPA 3H46O 4CJ5A 3TAFA 3VEVA 3BF3A 3QNOA 4CJPA 3HP6A 1WBBA 2OZMA 1BOTO 4BQLA 5IT9O 4H5WA 1KVBA 4CJSA 3HYFA 4CF1A 4CIEA 5F0XA 1HYVA 3M8SA 4W5QA 1UWBA 3QIOA 4NCGA 4Y1CA 2ATQA 2WOMA 1NK5A 4KTQA 5AQZA 4DV4K 1WSJA 1NKCA 1GLAG 1TK5A 3OHRA 2Q1NA 3DI6A 3K9JA 2E2OA 4C23A 2X78A 3WNHA 4DV7K 5AQFA 3AVMA 5EY4A 2NRZA 3ZSQA 4CGIA 2EWSA 4B9QA 3CD6N 4DR7K 3K58A 3AA3A 3DXMA 3LDPA 2UU9K 4IEIA 2NRRA 2ASPA 3LPTA 4JEPA 2D1KA 1QVFM 1X1PA 1KXPA 3JYTA 4O44A 1KAZA 4DR6K 4M3ZA 3MCAB 1MWMA 1U47A 3S3OA 4JRQA 4JAXA 3QNNA 3NAEA 3QBWA 1GLCG 3S3MA 5I9EB 3ULDA 2HHXA 1HPZA 4EP5A 4C1NI 1RBSA 1G99A 1IKVA 3J7YP 5AFUA 1JLCA 3AO1A 1KTQA 3ENBA 4BQZA 1D9FA 3QBXA 3HOSA 4UQGA 4FJKA 5EX5A 5KPTA 4DFJA 4A5AA 4FJHA 4CK1A 3F9KA 1NGFA 2Z1GA 2I5JA 4WCEL 3R6MA 3O3FA 2FSNA 1ESVA 2YHAA 3IKMA 1VQ5N 3F73A 2KZMA 1JKHA 2A6AA 1YVNA 3T7ZA 3I55N 1C0GA 1EO1A 3ISNC 1P90A 3DM2A 5JVHL 2XY5A 4KBOA 3TTCA 3NHGA 3CFPA 4F9OA 4CVNE 4WFNL 1XUPO 5BR9A 3CXCM 1OH8A 3SUOA 4XIUA 4N56A 4FWQA 4FM2A 2IC3A 4BRDA 4NO7A 4M7XA 3BP8A 4I9LA 5BN9A 4BRFA 4FJJA 3U3GA 4IO8A 4CIGA 4BRNA 4KH5A 3DXKB 1TKTA 3SPYA 2FBXA 4JKBA 1C6VA 2FBTA 1Q9XA 1HKBA 2QWNA 1XMOK 3SBGA 1NNEA 3QEPA 4KKOA 5BN8A 1HKGA 4FJGA 2NUBA 3TAGA 4FZYA 5AQHA 3KLFA 3RMCA 1NJIO 4CHOA 2GWKA 1QSYA 1RBTA 5AR0A 3LDQA 3WNFA 1BI4B 3SAGA 4FJ7A 2KLAA 5EU7A 4K8XA 2F96A 1ZC6A 4DR4K 4WQ5A 3ZYYX 4H03B 4JI8K 4CZLA 3AVKA 3A5OC 2G8IA 1GLFO 5B8HA 5AQQA 1SKWA 2DFEA 3KWIA 3LDOA 2NRWA 4PKGA 2G8VA 5FLXO 1TL3A 1BWFO 2OPRA 3SUPA 3H3OB 2Z1JA 4O4GA 4M3RA 1REVA 1RTDA 3HPGA 4CFDA 4LF6K 3TAQA 3OYBA 3JXUA 1VRTA 1SZ2A 5J2QA 4GV9A 1RTIA 3H08A 3SV3A 2ZJPL 2O8BB 1V4TA 3F2KA 4NCAA 4KI6A 2D0BA 2NNWA 5FPDA 4FLTA 4K0KK 3C6HA 3EE9A 4DSJA 1U45A 4OGEA 1TYQB 1JLEA 1KFSA 2HHTA 4PA1A 1J9AA 5KQ8A 1OH7A 2UUCK 5EOYA 1JLBA 1BI4A 2YV0X 2D0OA 3DRRA 3FZFA 4OVLA 4GW6A 3SMSA 3L2UA 2QXFA 1TUUA 2JGUA 4OX9K 3MN6A 1VQ9N 3O08A 2Y1JA 1NKEA 4DUZK 1VQLN 5AQGA 4FLZA 4BDZA 3AVCA 2QWLA 3A2FA 4B3MK 3CCUN 3SAHA 3AA5X 4H5RA 4AHRA 2HBKA 4NXMK 4MQ3A 2HNZA 3QICA 3OYEA 3L3UA 1QSSA 1TK8A 1KC8O 3KLGA 5GINA 4FWRA 4I6MB 3HT3A 3OYDA 1T8EA 1HNIA 2HF4A 3ZLJA 2J4RA 2ZQBA 4CZGA 4CEEA 3VQBA 5KGXA 2O8BA 2O4IA 4JI6K 5HRRA 4A62A 1TYQA 5DM6L 3EZ5A 2YCHA 3AVHA 3K9KA 1SL1A 2O8DB 4GKJK 1CZBA 1VHXA 2ITMA 3UKRB 3L6QA 3AO2A 4GNIA 1MDUB 5LL6Z 1ILYA 3OY9A 1NGGA 3LP0A 4CJ4A 4E1JA 3OYIA 1WNSA 3LM9A 4KTWA 5HLFA 2NRXA 3FZLA 1FKPA 4X64K 1DKGD 3JS6A 1I3AA 3AVGA 1V4SA 4F4KA 1RDBA 1WAJA 4CGGA 4E7JA 3NGZA 3I0SA 4BROA 2YX6A 2ASMA 3I8BA 3ZT3A 4CJFA 3DLGA 3FFKB 3CHWA 5AQRA 1E4FT 4I6MA 3A5MC 3SZ2A 3ZSXA 4CFBA 1Q86O 1ASVA 5KI6A 5TKWA 3VQPA 1IG9A 2A41A 3O4WA 3LM2A 3SQ0A 1ATSA 4DQSA 1NMNA 3O9SA 3AA4A 1HKCA 4AHCA 3V1RA 4Y0WA 5F2RA 2KW4A 4JHDB 2PY5A 2O8DA 3UKRA 3WXLA 3ZSOA 4GVMA 1RT6A 4JLHA 3NH0A 3HPHA 5EVZA 4C8MA 4CHZA 2BDPA 1NGJA 2IAJA 5M1FA 4BC4A 4DS4A 3DRSA 5H1SQ 4FM0A 3P4IA 2HMIA 4CF2A 2QKBA 3THWB 1I39A 1MA9B 1K9MO 3AO4A 1QZ5A 3CIPA 2XHBA 2D5RA 4Z0UA 1RNHA 5JS1A 1KAXA 4OPAA 4CFCA 1X3MA 2RE2A 1U04A 3AY9A 3V9SA 4PY5A 1CXQA 4LFCK 3OW2M 4K41A 4KHNA 3MAQA 3VQ5A 3VF6A 3E66A 4CJ3A 2IIRA 3E01A 3DOKA 2UUAK 1NM1A 1LWFA 4JHDA 1KCFA 5A2QO 2BUPA 1LW0A 3MCPA 2WONA 5AQNA 3VESA 1ATNA 1Q9YA 3OBYA 1N5YA 4MLEA 1SL0A 3O1WA 4IJAA 3OYAA 3NF9A 3P31A 3HP9A 3OYLA 1YF5L 3EY1A 1O1WA 5M1PA 3I33A 3S3NA 4DSIA 1BIZA 4RWTA 4K8ZA 2AP1A 3THWA 4O5BA 1HNVA 3L0QA 5BPNA 4GV3A 1Q8IA 1TUYA 4CJRA 4JKFA 2PYLA 1XWLA 3AVNA 4I2PA 2PBDA 4H0PA 2UYTA 3M6GA 4YOYA 1W2BM 3ZETB 3VPZA 3PY8A 4DFMA 2WTUA 5GIOA 4G1QA 4HUGA 3N4PA 1RTHA 3MK6A 3C6TA 4CK2A 4I9QA 1RT4A 5GIPA 2E1ZA 3FZMA 1IBKK 3UE5A 3V4IA 2IVOA 2VG6A 5J2MA 2KFNA 1YT3A 5ADXH 3LP2A 2XY6A 2Z1HA 2P9SB 4LF7K 3NFAA 1ATRA 3KVGA 3SYZA 4JS5A 1BQMA 3H3NO 4GY2B 4IZ9A 2QKKA 1QHTA 3VEOA 4M42A 3QEIA 3G0ZA 1BCMA 3WEEB 3HSCA 4MLHA 3CC2N 4KHQA 3K2PA 1TVRA 1RILA 3ZSWA 4IOXA 5I3UA 3C95A 1WBDA 1J5OA 3HL8A 4CECA 5KQDA 2HHQA 2G8KA 3ATUA 4R5PA 3T69A 3OYGA 4B9VA 1J53A 1RGIA 1NK4A 5DK5A 3WXIA 1C0FA 3VQCA 4DTJA 3VEWA 1NG9A 1S1TA 3NVMA 1B9DA 1D4XA 3ZETA 1RDDA 2KZZA 3CCRN 4DQQA 4FWKA 1S6QA 4KH4A 4CJVA 5DMRA 4BVPA 4FW2A 4BDYA 1NGEA 5DM7L 5AJ3K 2D0CA 2Q3SA 3R3LA 1T7PA 1J54A 4CCHA 1RT5A 3RSEB 3WXKA 2WBNA 5JMVA 3BUZB 3LAMA 5HBMA 2P51A 1W9HA 4DV3K 2NZTA 3DRPA 2GEMA 5HL7L 4CBXA 2P9SA 4FZZA 1DTQA 1S1VA 3KLIA 4CERA 1VSKA 4BR7A 1BA1A 3VENA 2ZGYA 4KTZA 4CBUA 2OTLN 3F9MA 4ISFA 1DT9A 4LFBK 1OVQA 3WEEA 1C1AA 4DCHA 4E7IA 4X62K 2A40A 2IS3A 4E1MA 2GBZA 1TGOA 4PL8A 4IEEA 2OANA 3ZSVA 3CM6A 1SUQA 4M3UA 4KPYA 3ZX0A 1YJ9N 1TL1A 2CGKA 1N8RO 2IVPA 4LFAK 4X65K 2FF3B 3AGRA 2O8FB 4DTPA 3PSFA 4OO1J 1TKXA 3SJHA 1YITN 3L2RA 3GDQA 5C0YA 1X9SA 4PL7A 3DWLA 3P38A 5ADXA 3LL3A 3ZX3A 3RSEA 3RR8A 3OTOK 4B9NA 4OLAA 3V1OA 2VCPA 3WNGA 4IFYA 4QS8A 1Y64A 2RHKA 4EFHA 4NCBA 5BPLA 4BE1A 3KTQA 3ID6A 5HRNA 2E88A 2KKZA 3PX0A 2HHUA 4LSLA 4FOIA 4HHTA 1TV6A 3K5LA 5C15A 3QIPA 5FPMA 4AHSA 2E4LA 3H6EA 5FRNA 4BRKA 3VETA 4C1NK 2QWOA 3CC7N 3M1FA 4ISGA 3RVCA 3BEXA 3OYCA 3J8AA 3CCEN 1S6PA 4W5TA 1L3UA 4RCHA 1S22A 3NE6A 3CC4N 2OPQA 4B9LA 2HOEA 1TAQA 5AQTA 1A5WA 3KLEA 1HJRA 1VQ6N 2A1RA 4H5VA 2ZJRL 1GLLO 2HF3A 1NGIA 4DS5A 1ZBLA 4CEZA 4IKFA 3G25A 5LJVA 2O8FA 4H5NA 3AGKA 4MO5A 2UXBK 1DLOA 4YFUA 3R8EA 2FBYA 3IS9A 4ZHRA 3T19A 1C0TA 1LV5A 2NLXA 4U7BA 1CZ9A 4CE9A 1L3VA 4YOUA 2G8UA 3VQ8A 3VA3A 4JI1K 3C6AA 3HZ6A 3LDSA 3EEQA 1IBMK 3HI0A 3C7NB 1EKEA 1TK0A 4Q0BA 1YVUA 2CH5A 3DJCA 3PO4A 2F4VK 3VQAA 1T6DA 1ZBUA 4DR2K 3UIQA 1U48A 2GWJA 2EX3A 3N4QA 4BRIA 3HXMA 4OLBA 3NH1A 4QCLA 2OPSA 1J5EK 3QEVA 3A0IX 4E19A 3QEXA 3DLBA 1NWKA 1SKSA 3VEZA 1NOZA 3AO3A 3M8PA 3M8QA 1VSHA 4AHVA 3OS0A 1NGHA 1UA1A 2W42A 3SMPA 3MECA 4CF9A 1NOYA 1TKDA 5AQLA 2LSNA 3VN5A 4DU3A 3R1XA 4E1NA 2VQFK 1R0AA 1KQSM 1NGCA 1WOQA 4FM1A 1VK0A 3CI5A 3U6FA 4YOWA 1HQEA 3ENHA 2DFHA 1FW6A 1JLQA 1VSMA 3L8BA 4LH5A 5SZTA 4FJXA 1JXEA 1WAFA 2YI1A 2I7NA 2YNGA 4DTNA 3ITHA 5F1XA 2ZJQL 2KTQA 4PKIA 4BACA 5C12A 3OYJA 3EE8A 3FZHA 3C7NA 3C0BA 4JD2B 1RT3A 2YHXA 4FJ5A 3DAWA 3OBWA 3LAKA 1QTMA 1EWQA 3TI0A 2A3ZA 4M45A 1Z25A 4LF9K 2QWPA 2Q36A 4A59A 2ZGZA 4DTXA 2UXCK 3SUQA 2RPIA 4NLBA 5E41A 4H4MA 3WXMB 5HP1A 2P5GA 1VSJA 2KFZA 4FWLA 4OKJA 3CCLN 3OYHA 3SBTA 1RCHA 4K42A 4BRCA 5EXWA 3GE1A 1Q81O 5JLHA 3L4QA 2X6NA 3HK2A 1YUWA 1YTAA 4B9SA 1BCOA 5IWAK 4KHSA 3EZWA 4HCCA 2E20A 1NK8A 3DMJA 4B1WB 1EP4A 1UOCA 1KRPA 4FWOA 3P39A 3I0RA 3CETA 3RMDA 4BGBA 4NLCA 3FGUA 3QINA 4XEIA 3SK3A 3DXKA 1YAGA 3CYMA 4IO9L 2YNIA 2BE2A 1VAZA 4QS9A 3C94A 3RRHA 2DY4A 3V1QA 1EXQA 3NCIA 4OKKA 3THXB 3L2WA 2PZSA 4FK2A 1QZ6A 3D2FB 4CK3A 4CD3A 3H45C 4JD2A 3QFPA 4HVJA 3B6OA 2IVNA 3CMAN 1T03A 3MN7A 4BRPA 3WQTA 4KHYA 4B3SK 5KTQA 1KLNA 5AQPA 4CESA 1RT2A 2IDOA 1S5JA 4JS4A 3MXJA 2PAVA 4L8RB 2BTFA 1VSEA 3VF4A 4B08A 4FLWA 4KRFA 4CZMA 4LH4A 1FK9A 3O4QA 4X66K 1BDGA 2GUIA 1LCUA 3PX6A 3C6UA 2Q0RA 4J2AA 2GX9A 3NF7A 3CQXA 1ASUA 4KB1A 4H0OA 4PWDA 3VOVA 4LF8K 4JK8A 1FXXA 4BRAA 5MLCQ 3CF5L 4RW8A 4A57A 4PKHA 3A5NC 1RBUA 4WQ4C 5C2FA 1S9GA 1XHXA 5J2PA 4FW1A 2HBLA 3THXA 2FC0A 1NK7A 3D2FA 1U49A 1X9WA 1RDCA 4JKGB 4DV5K 2P9UB 3VERA 4B9UA 4Z4GA 4BRLA 4FCYA 5CE3A 4IDHA 5AQOA 4JI4K 4BVOA 3DLKA 5CR4A 5FPNA 4CW7B 4Z4EA 3OA9A 3UKUB 4YOXA 1XMQK 3M3ZA 3LZJA 1T44A 1K8KB 3J7ZO 5BPMA 4FJLA 3AV9A 1C0MA 2QK9A 2YKMA 1YJWN 5CZ2A 2HVHA 1Q82O 4CEQA 3T1YK 1QS4A 2E8AA 4F3OA 3VEYA 4H4OA 1RBRA 2KHOA 4CEFA 4U67L 3VTIA 4DQ8A 4DU1A 1LOTB 2V7ZA 1DEJA 3CCSN 4DHYA 4DV0K 5HROA 1VQNN 4JK9A 1LWEA 2E6MA 1GLEG 1VQMN 3LZIA 2HB5A 2F7TA 3NDKA 3TAMA 4RW4A 2YNHA 4DV6K 4LD0A 4EP4A 3THYB 3ZCMA 1LW2A 3O6WA 4MDBA 5FROA 1JLFA 3A8YA 3P5JA 4C8LA 1BHLA 3PLAA 2D0PA 2QXLA 1HNXK 4PUOA 1WSHA 3W0LA 1QQCA 1HNWK 1JL2A 4JKGA 4IFVA 2P9UA 4FL9A 3ZX2A 4GKKK 3EO3A 4F8RA 3IDHA 4O5FA 1N33K 4BWJA 1NJZA 4OGCA 4JN4A 2EHGA 3UKUA 3K5NA 1F21A 5BR8K 1BA0A 4CGFA 4N76A 3LP1A 1LAVA 1K8KA 3ZEUB 4CJTA 2XRIA 3TANA 1VQPN 4EZ9A 3VQEA
chains in the Genus database with same CATH topology
5I9EB 3EL2A 3EN9A 1RGIA 3GBTA 1MWKA 2NRHA 1ZXOA 2QW9A 3WXIA 4BRQA 1C0FA 3HOTA 4C1NI 4JKCA 3R9PA 2A42A 4GVEA 1G99A 2QM1A 3VEWA 5AFUA 5AQYA 3NVMA 3ENBA 4BQZA 3CQYA 1D4XA 3ZETA 4CZKA 3W3DA 3QBXA 3HOSA 3CCRN 3VGKA 4L3QA 2OTLN 3VGMA 4FWKA 1M1KO 3NMUA 4YDUA 4KH4A 3G4SN 5EX5A 5KPTA 3TSPA 4BVPA 4A5AA 1NGEA 5DM7L 2GUPA 5GAGP 3R3LA 5AQIA 4IWVA 3KK7A 1NGFA 3E9OA 3RSEB 3Q7BA 2P9KB 1BU6O 3TU5A 3WXKA 2WBNA 4WCEL 5JMVA 4BR5A 3BUZB 3R6MA 3GOIA 2FSNA 3FR0A 1ESVA 2NZTA 3MX5A 2GEMA 5HL7L 3IKMA 1VQ5N 2CGJA 4CBXA 2P9SA 2A6AA 3AAPA 1YVNA 4FWNA 5E26A 4HWIA 3T7ZA 1O13A 4BGAA 3I55N 2I7PA 2W41A 4BG8A 1C0GA 1EO1A 4PHTX 3EKSA 4ILGB 4BR7A 2D4WA 1P90A 1BA1A 5JVHL 3VENA 2WC9A 4A2BA 2ZGYA 3CJCA 4KBOA 3F9MA 3HRGA 4ISFA 3TTCA 1DT9A 3KZBA 4ILHA 4CBUA 4F9OA 1VQ4N 2FSKA 1R59O 4WFNL 1JJ2M 2DPNA 3WEEA 3H1VX 1XUPO 5BR9A 3LDNA 1HPMA 3PIOL 3CERA 3CXCM 3ZEUA 4DCHA 4YOVA 4FSVA 4FWQA 1YI2N 4BRDA 4NO7A 4KH6A 1KAYA 2A40A 4M7XA 3BP8A 5BN9A 4BRFA 4PL8A 5JVGL 2HSTA 4IEEA 2OANA 4EIAA 4K43A 4BR2A 1OKJA 4IO8A 5TKYA 4KH5A 2Q31A 3C65A 3DXKB 4BRNA 5FPEA 1NBWA 3ZX0A 3O80A 1YJ9N 2CGKA 1OVYA 1CZAN 2IVPA 1N8RO 3TSQA 4JKBA 2FF3B 4OPHA 3AGRA 1HKBA 5AQUA 3TSUA 2QWNA 4H0VB 2WUSA 5AQWA 4B1VA 3SBGA 4BR9A 4FPAA 5C2DA 2H3GX 3O5BA 4OO1J 5BN8A 3SJHA 1GLJO 1HKGA 3O9TA 1YITN 2HBJA 3GDQA 3CPWM 5C0YA 3ENOA 1SQKA 4PL7A 2OTJN 3DWLA 3P38A 5AQHA 5ADXA 3LL3A 3CJ1A 3ZX3A 3RSEA 3FLCO 2P9KA 1NJIO 4JNEA 5AZJB 3TTFA 2GWKA 4J8FA 2VCPA 3MWPA 3H1QA 5AQKA 5AR0A 3LDQA 4ILJA 4QS8A 1Y64A 2RHKA 1T3VA 4EFHA 3SAGA 2KLAA 3L4IA 3NVKA 5BPLA 1S72N 3ID6A 5BRFA 1ZC6A 2E88A 2KKZA 2QEXN 4AM7A 4WQ5A 2YJFA 1P8ZA 4H03B 4M63C 3ZYYX 4CBWA 4CZLA 4CZHA 4WFAL 4FOIA 3A5OC 4B1ZA 3MDQA 1GLFO 5B8HA 4JKHA 4HTLA 5AQQA 5FPMA 4BRMA 5C15A 3H6EA 3KWIA 3LDOA 2CH6A 4BRKA 3VETA 4C1NK 2NRWA 3E1YA 3VMFB 3VGLA 4PKGA 3ATVA 4AF1A 5M1KA 1VQ7N 2QWOA 5AQMA 5AZIB 3CC7N 3M1FA 4ISGA 1BWFO 1X3NA 3ULEB 3RVCA 3BEXA 3J8AA 3CCEN 3H3OB 4RCHA 1S22A 3SAFA 3CC4N 2QWQA 3E9PA 2HOEA 5AQTA 2QWMA 1ZBSA 4CI6A 5E84A 1VQ6N 3JXUA 1YXQA 4H5VA 4WFBL 3I56N 5AQXA 2ZJRL 1GLLO 2HF3A 1NGIA 1SZ2A 4GV9A 4FWSA 3G25A 5LJVA 4H5NA 4XH5A 3AGKA 4MO5A 4YORA 3R8EA 3IMXA 3U9ZA 4WQ4A 1V4TA 3F2KA 2ZJPL 2NNWA 5FPDA 3O9QA 2NLXA 4U7BA 1RDWX 3C6HA 3EE9A 4YOUA 3O8MA 5LJWA 2FLOA 1TYQB 3D7EO 3TPQA 3C6AA 3HZ6A 5AZJA 3CPEA 1QHAA 4LC9B 3HI0A 4CJ7A 3C7NB 3U4LA 4QS7A 3VEXA 3M5RA 4WQ5C 4M7YA 5EOYA 2CH5A 3DJCA 5CHIA 1JCGA 1YIJN 2D0OA 1YJNN 3FZFA 1T6DA 5JICA 1GLDG 4H0TB 2P9LB 4BREA 5BREA 3MWTA 2GWJA 3SMSA 4CD1A 3N4QA 4BRIA 4A2AA 2NRTA 1TUUA 4MDAA 3MN6A 1VQ9N 3O08A 3A0IX 1BO5O 1VQLN 5AQGA 2ZWHA 1NWKA 4IJNA 4MO4A 3VEZA 5HOOA 3GL1A 2QWLA 2QTDA 2FXUA 1XQSC 5AZIA 1Q7YO 2VGNA 1KD1O 3CCUN 3CCJN 2QI2A 1SAZA 4H0YB 4H5RA 3ULEA 3SAHA 4ISEA 1U6ZA 4IOCL 2Q2RA 3CCMN 5AQSA 2HBKA 1NGHA 1NGBA 3SMPA 2P9NB 3CJ7A 5AQLA 3QICA 3ID8A 2A5XA 4DB3A 3R1XA 3F5TA 1RFQA 4B1XB 1KC8O 1KQSM 1NGCA 1WOQA 2YJEA 5GINA 4FWRA 4I6MB 3CCVN 2F9WA 2HF4A 3CI5A 3QFUA 1K73O 2J4RA 3FZKA 3VTHA 4YOWA 4CZGA 3ENHA 3PIPL 4FWMA 2VGMA 4AM6A 4RTFD 4CZIA 4A62A 4YDUC 2YI1A 2I7NA 1TYQA 4CZEA 3O1BA 5DM6L 2Q0UA 2NRVA 2YCHA 3S41A 5F1XA 2ZJQL 1GLBG 1JCFA 4PKIA 5C12A 3EE8A 3FZHA 3K9KA 3C7NA 3C0BA 4JD2B 2HBMA 3WQUA 2YHXA 2FF6A 2ITMA 3UKRB 4O8KA 3L6QA 2P9LA 4GNIA 2FSJA 3WXJA 4XH1A 3DAWA 3OBWA 1MDUB 1ILYA 1NGGA 3D2EB 5C10A 2A3ZA 3CCQN 2QWPA 4E1JA 2PFUA 2Q36A 3D6RA 2ZGZA 4A59A 3BF1A 4WYBA 3LM9A 4CZJA 1SS6A 3QB0A 3CMEN 5LY3A 2NRXA 3FZLA 4NLBA 3EKUA 1DKGD 3JS6A 3WXMB 1Z05A 2WFBA 4H0XB 4BC5A 4NB4A 4EAHD 1V4SA 4FWLA 3CCLN 3SBTA 2ASOA 4K42A 5EXWA 1H1VA 3GE1A 3VF2A 4BRCA 4BRGA 3L4QA 5JLHA 1Q81O 4EHTA 3G71N 2P9IB 2P9NA 1YUWA 4JKDA 2YX6A 4BROA 4FOEA 1HX1A 2ASMA 4EHUA 4IOAL 3EZWA 3I8BA 3FFKB 5GADP 2E20A 3CHWA 5AQRA 3HBTA 5ELZA 4B1WB 1E4FT 1NGDA 4I6MA 3A5MC 5KPRA 4FWOA 3P39A 3IUCA 3CETA 1Q86O 2F9TA 5TKWA 1VQ8N 4BGBA 4NLCA 5GAEP 3FGUA 4XEIA 3SK3A 2VWBA 3DXKA 4GV6A 4JKEA 2CGLA 1YAGA 1QQNA 3CJAA 4IO9L 1DGKN 3KWGA 1NMDA 2A41A 1NGAA 1VAZA 2V7YA 4QS9A 3O4WA 5M1NA 3LM2A 1ATSA 3IFRA 3CJBA 3O9RA 5KQ8A 2V51B 3B8AX 2JWKA 1QZ6A 3MMVA 3O9SA 3D2FB 4JKAA 1HKCA 3QMLA 4JK7A 4CD3A 5AQVA 3H45C 4JD2A 4BR4A 3QFPA 4Y0WA 5F2RA 1WUAA 4JHDB 2W40A 2IVNA 3UKRA 3WXLA 5JLFA 3CMAN 2E2NA 3AAQA 5EVZA 3MN7A 4BRPA 3D2EA 4DKWA 3WQTA 1NGJA 5M1FA 3QDKA 4BC4A 4BRHA 2YHYA 4BC2A 1XC3A 3DLLL 5H1SQ 1QVGM 5AQPA 3P4IA 3U8XA 1W97L 1HJOA 4BC3A 4BG9A 4FO0A 1K8AO 1E4GT 2YHWA 4FPBA 5M1QA 2PAVA 1MA9B 2ZF5O 1K9MO 2BTFA 1IG8A 1JCEA 1QZ5A 4YOTA 3VF4A 1VQON 2Q97A 2P9IA 4BR0A 3A5LC 3CIPA 3G6EN 3UB5A 4G9ZA 4CZMA 1M90O 1BDGA 1LCUA 1KAXA 2Q0RA 4OPAA 2GX9A 1X3MA 2RE2A 3AY9A 2E2QA 3CQXA 2E2PA 4H0OA 1Q18A 4K25A 2AA4A 1HLUA 5BRHA 3FE1A 3VOVA 4JK8A 4K41A 3OW2M 4BRAA 5MLCQ 3CF5L 4IXCA 1U2VB 5AFUH 1EQYA 4A57A 4PKHA 3E9LA 4R79A 1T6CA 2HMPA 3A5NC 4H5TA 4WQ4C 5C2FA 3VF6A 4FVUA 4CZFA 3HM8A 3E66A 2HBLA 5GAHP 2IIRA 1X9JA 4B1UB 1QQOA 3LDLA 4XH4A 3D2FA 1NM1A 3Q7CA 1RDUA 1HUXA 3SLCA 4JHDA 1YHQN 2BUPA 4UY8O 3MN9A 4JKGB 1Z6RA 2P9UB 3DXMB 3MCPA 3VERA 3CJ9A 5AQNA 3O9UA 3VESA 1ATNA 4BRLA 1J6ZA 2QWRA 5CE3A 4IDHA 5AQOA 4BVOA 4WF9L 3OBYA 1NLVA 4MLEA 4BY9C 5CR4A 3O1WA 4IJAA 5FPNA 2GELA 1QQMA 3P31A 3OA9A 3H46O 3UKUB 4YOXA 1YF5L 3T69A 1IJJA 3BF3A 4IFEA 5M1PA 3I33A 3VEVA 4A5BA 4RWTA 3M3ZA 3TTDA 1BOTO 1T44A 2AP1A 4BQLA 1K8KB 3J7ZO 5BPMA 2P9PB 5AQJA 4H5WA 3L0QA 3MX2A 1YJWN 5BPNA 4GV3A 4B1YB 5KPZA 1Q82O 2E8AA 1TUYA 3VEYA 4JKFA 3WUHA 2JWLA 5F0XA 3GG4A 2KHOA 3MN5A 2PBDA 4U67L 4H0PA 2UYTA 3M6GA 3VTIA 4DQ8A 1LOTB 2GTDA 1DEJA 2V7ZA 5AQZA 5M1OA 4DHYA 4YOYA 3CCSN 3ZETB 4JK9A 3VPZA 1W2BM 1VQNN 1GLEG 1VQMN 1GLAG 4FWPA 3AARA 2F7TA 3OHRA 2Q1NA 1U2VA 5GIOA 3K9JA 2E2OA 4C23A 2VYPA 4O8UA 3N4PA 3MK6A 3O6WA 4MDBA 3A8YA 5AQFA 3U9DA 5GIPA 2E1ZA 2NRZA 5EY4A 3PLAA 3FZMA 2D0PA 2EWSA 4B9QA 3UE5A 2IVOA 2QXLA 5BRDA 1BG3A 3CD6N 3W0LA 5ADXH 2P9SB 4JKGA 2P9UA 3DXMA 1ATRA 3KHYA 3LDPA 4FL9A 3ZX2A 3KVGA 3EO3A 4IEIA 3IDHA 2NRRA 4O5FA 2ASPA 1BUPA 4A61A 3H3NO 4GY2B 2E1YA 4IZ9A 4JEPA 2D1KA 4Z94A 4JN4A 3VEOA 1QVFM 3UKUA 1KXPA 1S3XA 3HTVA 2QA4N 1VQKN 3WEEB 3HSCA 4MLHA 3CC2N 1BA0A 1KAZA 4IOXA 3MCAB 1K8KA 1MWMA 3ZEUB 2P9PA 2V52B 3WT0A 1VQPN 5KQDA 4JAXA 2BH1A 3ATUA 3QBWA 1GLCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YX6 A;  2QTD A;  1EO1 A;  1T3V A;  2RE2 A;  2WFB A;  2KLA A;  1RDU A;  1P90 A;  1O13 A; 
#chains in the Genus database with same CATH topology
 3AVJ A;  3EL2 A;  3NF6 A;  2QW9 A;  4BRQ A;  2P5O A;  4BE0 A;  4JKC A;  3R9P A;  2A42 A;  4GVE A;  4BE2 A;  2QM1 A;  4GMJ B;  4F2R A;  4AIL C;  5CZ1 A;  3W3D A;  4ELT A;  1NK0 A;  1I94 K;  4L3Q A;  3K0S A;  1IKW A;  3THV A;  3NMU A;  3SPZ A;  3P1G A;  3TSP A;  1S1W A;  4ID1 A;  2X74 A;  2GUP A;  5GAG P;  2XO7 A;  4DTR A;  3SUN A;  3THY A;  2PYJ A;  5AQI A;  3Q7B A;  2P9K B;  1BU6 O;  5T7B A;  3AVF A;  3TU5 A;  3J81 O;  3JSM A;  4LF4 K;  1E3M A;  2CGJ A;  3AAP A;  4FWN A;  4DB3 A;  3OJS A;  4BGA A;  1O13 A;  4BG8 A;  4RW7 A;  4ILG B;  2VQE K;  2D4W A;  3BGR A;  3S9H A;  3MXI A;  4H8K A;  3CJC A;  3HRG A;  4ILH A;  3TAP A;  2UUB K;  4FLV A;  1R59 O;  2DPN A;  3DOL A;  3PIO L;  3LDN A;  3ZEU A;  2R7Y A;  1YI2 N;  4CGH A;  3HO1 A;  3HVR A;  4KH6 A;  1YTU A;  3SV4 A;  1ZBH A;  3M8R A;  1OKJ A;  1VSD A;  5TKY A;  2Q31 A;  3C65 A;  3LP3 A;  4CHQ A;  3O80 A;  1OVY A;  3TSQ A;  4OPH A;  5AQU A;  2WUS A;  5AQW A;  4BR9 A;  4J2D A;  4FPA A;  2H3G X;  3VQD A;  1XI1 A;  4KB0 A;  2HBJ A;  3SQ1 A;  1SQK A;  2OTJ N;  1T05 A;  1IH7 A;  3CJ1 A;  3FLC O;  2P9K A;  1Z26 A;  2FBV A;  4JNE A;  5AZJ B;  2G8H A;  3TTF A;  4ZTJ A;  4FZX C;  3MWP A;  1HYZ A;  1OH5 A;  2GV9 A;  3ASM A;  3HST B;  2ZD1 A;  1T3V A;  3L4I A;  3VQ7 A;  1B9F A;  4AM7 A;  2OPP A;  1KFD A;  1P8Z A;  2YJF A;  3QO9 A;  3DYA A;  4CZH A;  4CEO A;  1KSP A;  3MDQ A;  3OYF A;  4DV2 K;  4JI3 K;  4RG8 A;  3KD5 E;  4CF0 A;  3E1Y A;  3VMF B;  3VGL A;  2HHV A;  4DSE A;  3K5O A;  1X3N A;  4CED A;  2A1S A;  1RDA A;  3HJF A;  1K6Y A;  1HNZ K;  1XNR K;  3NBP A;  2ETJ A;  3L3V A;  5JS2 A;  1B92 A;  2QWM A;  1ZBS A;  4NYN A;  3I56 N;  5AQX A;  5HRP A;  4FWS A;  4EZ6 A;  2P1J A;  3RMB A;  4KRE A;  3U9Z A;  4WQ4 A;  3DLR A;  4QOZ B;  3O9Q A;  3L2Q A;  3CFO A;  1RDW X;  3TAR A;  3T1H K;  5LJW A;  4ELU A;  3TPQ A;  3DLE A;  5C25 A;  4CEA A;  5AZJ A;  5CYQ A;  4LC9 B;  5CHI A;  4QS7 A;  3M5R A;  4WQ5 C;  3J7A P;  1JCG A;  1GOB A;  1YIJ N;  1GLD G;  3RMA A;  4H0T B;  4OJR A;  3MWT A;  3KK2 A;  4CD1 A;  3AVA A;  4A2A A;  3RWU A;  3PO5 A;  4MDA A;  1G15 A;  4CGJ A;  3U3Y A;  3MEG A;  2HNY A;  1BO5 O;  5HRS A;  2ZWH A;  4MO4 A;  5HOO A;  3GL1 A;  1CXU A;  3QEW A;  2QTD A;  2FXU A;  1XQS C;  1Q7Y O;  1KD1 O;  2QI2 A;  4H0Y B;  2O8E B;  1U6Z A;  4IOC L;  2Q2R A;  1ASW A;  2OCE A;  5AQS A;  4E7H A;  1NGB A;  3LAN A;  3IAY A;  3TR8 A;  4FLY A;  1UA0 A;  2F9W A;  4NXN K;  3VTH A;  1C1C A;  3PIP L;  2VGM A;  3T3F A;  4AM6 A;  4W5R A;  3CG7 A;  1XHZ A;  2YHB A;  2Z1I A;  2HHS A;  4YDU C;  4FJ9 A;  1L3S A;  4CZE A;  3O1B A;  2Q0U A;  2NRV A;  2DFF A;  1JL1 A;  4FYD A;  3KK3 A;  4CHY A;  2FF6 A;  3SNN A;  4O8K A;  4RW6 A;  3OS2 A;  2HW3 A;  5LMN K;  2HHW A;  4AQY K;  2FSJ A;  3WXJ A;  4XH1 A;  4FLX A;  4DFP A;  3V9W A;  3D2E B;  1WLJ A;  4M41 A;  5C10 A;  1X9M A;  3CCQ N;  3BF1 A;  4WYB A;  4CZJ A;  1OH6 A;  3BY5 A;  3CME N;  1S1X A;  5LY3 A;  4CF8 A;  5CY4 A;  4CJL A;  3EKU A;  4Z4I A;  1Z05 A;  2WFB A;  4H0X B;  4BC5 A;  4NB4 A;  4EAH D;  1ZBF A;  2O8E A;  2G8W A;  2ASO A;  3KKS A;  3OYK A;  4DSK A;  4B9M A;  2P9I B;  4HUE A;  2OA8 A;  2E5L K;  4M3X A;  4CEB A;  5FRM A;  4EHU A;  4OPJ A;  4DF4 A;  3HM9 A;  5GAD P;  3HBT A;  5ELZ A;  4FK4 A;  3IUC A;  1VQ8 N;  4ZTF A;  5GAE P;  3SI6 A;  4KI4 A;  1ZBI A;  2CGL A;  4DQR A;  3CJA A;  3KWG A;  4MFB A;  2V7Y A;  5M1N A;  3EYZ A;  4DQP A;  4B8A B;  3CJB A;  3O9R A;  2XY8 A;  2V51 B;  3MMV A;  2JWK A;  4C8O A;  4DSF A;  4JK7 A;  5AQV A;  4J2E A;  4FJN A;  1WUA A;  4DLG A;  2YNF A;  5JLF A;  3G10 A;  2E2N A;  3AAQ A;  3D2E A;  4DKW A;  3VQQ A;  4I7F A;  4RW9 A;  4BRH A;  1NK9 A;  1VSI A;  1W97 L;  4KHU A;  1HJO A;  4BC3 A;  4FJI A;  4BG9 A;  4FO0 A;  4DTS A;  1K8A O;  1E4G T;  2YHW A;  5KGW A;  1IG8 A;  3NGY A;  4C8K A;  3ZSZ A;  1HQU A;  4DR3 K;  1VQO N;  2P9I A;  1NK6 A;  1W0H A;  3G6E N;  4G9Z A;  3QLH A;  4DTU A;  3KK1 A;  2E2P A;  1L5U A;  4K25 A;  1HLU A;  1NU0 A;  4HUF A;  4FVM A;  3VQ9 A;  4YY3 K;  1BGX T;  4IXC A;  1U2V B;  3PV8 A;  3E9L A;  4R79 A;  4DUY K;  2HMP A;  2F8T A;  4FVU A;  4CZF A;  2ITG A;  1SL2 A;  1X9J A;  1WN7 A;  3LAL A;  1QQO A;  4F3T A;  3TWH A;  3HVT A;  1KVA A;  2G8F A;  1N34 K;  4UY8 O;  3MN9 A;  4LF5 K;  1Z6R A;  3CJ9 A;  1J6Z A;  2QWR A;  3BDP A;  3QES A;  1C1B A;  4BY9 C;  4IBN A;  4IG3 A;  4ID5 A;  2GEL A;  1QQM A;  1IJJ A;  4IFE A;  4A5B A;  3CQ8 A;  3TTD A;  2HND A;  3OS1 A;  3ALY A;  4AH9 A;  2P9P B;  5AQJ A;  3MX2 A;  4B3R K;  2RKI A;  2OZS A;  3CM5 A;  4B1Y B;  5KPZ A;  3WUH A;  2JWL A;  4CHP A;  3GG4 A;  1FJG K;  3MN5 A;  3CFR A;  1NJW A;  2GTD A;  5M1O A;  3SQ4 A;  3RR7 A;  4O55 A;  4FWP A;  3AAR A;  1Y97 A;  1U2V A;  3SCX A;  4JRP A;  2VYP A;  4O8U A;  3TAB A;  1JLG A;  4O0J A;  1N32 K;  1S1U A;  3U9D A;  2ZE2 A;  3L2V A;  5BRD A;  1BG3 A;  1GOC A;  4HCB A;  4B3O A;  3OJU A;  2F8S A;  1WSG A;  4CFA A;  3KHY A;  4DLE A;  4Z4C A;  1BUP A;  2W6L A;  4A61 A;  4Z94 A;  2E1Y A;  5J1E A;  3IRX A;  3NGI A;  1HR0 K;  2W6K A;  1S3X A;  3HTV A;  4N5S A;  2QA4 N;  1VQK N;  3KD1 E;  1BIU A;  4KO0 A;  2P9P A;  2V52 B;  3WT0 A;  1C0U A;  2BH1 A;  4IG0 A;  3KIO A;  3PSI A;  3EN9 A;  1MU2 A;  3GBT A;  3O3H A;  1MWK A;  2NRH A;  1ZXO A;  3HOT A;  1XC9 A;  3DLH A;  4Z4H A;  3O3G A;  5AQY A;  3CQY A;  4CZK A;  3FFI A;  4JI7 K;  3VGK A;  3VGM A;  3ZT2 A;  4FK0 A;  1M1K O;  1FKO A;  4YDU A;  3G4S N;  3K57 A;  1L3T A;  1U4B A;  2OYQ A;  4IWV A;  3KK7 A;  4C8N A;  3E9O A;  4BR5 A;  3GOI A;  4FJ8 A;  3K5M A;  3FR0 A;  4E7L A;  3MX5 A;  1JXB A;  4B3T K;  5E26 A;  4HWI A;  3V9U A;  2I7P A;  2W41 A;  3O4N A;  1BQN A;  2RN2 A;  4PHT X;  3EKS A;  1NKB A;  5LMU K;  2WC9 A;  4A2B A;  2O8C B;  3KZB A;  2HHH K;  1VQ4 N;  2FSK A;  1JJ2 M;  3KJV A;  3H1V X;  1HPM A;  3CER A;  1A5V A;  4YOV A;  4FSV A;  4W5N A;  2IOC A;  4DG1 A;  1NJX A;  4DR5 K;  1IKX A;  1KAY A;  3VQ4 A;  4DR1 K;  4M3T A;  4DU4 A;  5JVG L;  2HST A;  5K14 A;  4EIA A;  4K43 A;  4W5O A;  4B8C A;  4BR2 A;  3AVB A;  1VSF A;  5FPE A;  2BAN A;  1NBW A;  4Y1D A;  1CZA N;  4DF8 A;  3TSU A;  4H0V B;  4B1V A;  4V19 S;  5C2D A;  3J80 O;  3O5B A;  1N36 K;  1GLJ O;  3ZT4 A;  3O9T A;  1HYS A;  5KRT A;  3CPW M;  1RTJ A;  3ENO A;  3VA0 A;  1RT7 A;  4FJM A;  4AHT A;  1EWR A;  3WNE A;  4J8F A;  3AA2 A;  1BL3 A;  3H1Q A;  3LWM A;  5AQK A;  4E7K A;  3BZK A;  4ILJ A;  2D0A A;  4JI5 K;  3NVK A;  4OKE A;  1S72 N;  4OPK A;  5BRF A;  1VRU A;  2QEX N;  3LPU A;  4M63 C;  4CBW A;  4WFA L;  4B1Z A;  4JKH A;  4HTL A;  4BRM A;  3I8D A;  2O8C A;  1IO2 A;  2CH6 A;  2YKN A;  4AF1 A;  3ATV A;  3P83 D;  5M1K A;  2ZM6 K;  1VQ7 N;  5AQM A;  5AZI B;  2Y1I A;  4DV1 K;  3ULE B;  3MED A;  4YNQ A;  3VQ6 A;  3SAF A;  2QWQ A;  4WE1 A;  2B5J A;  3E9P A;  1TAU A;  2RF2 A;  4JI0 K;  4CI6 A;  4DWI A;  5E84 A;  1YXQ A;  4WFB L;  4CJU A;  4O0I A;  1KLM A;  2HVI A;  4XH5 A;  3D45 A;  4YOR A;  3IMX A;  4DFK A;  4LY7 A;  2UXD K;  4KHW A;  3LWL A;  3O8M A;  3KLH A;  2DTU A;  2FLO A;  1TKZ A;  3D7E O;  1D8Y A;  3CPE A;  1QHA A;  4CJ7 A;  2VG7 A;  3U4L A;  3VEX A;  4M7Y A;  3NF8 A;  1YJN N;  5JIC A;  3MXM A;  2P9L B;  4BRE A;  5BRE A;  1QSL A;  4AHU A;  4JYA K;  4NYF A;  4QAG A;  2NRT A;  2VG5 A;  4BWM A;  3ZT1 A;  3V9Z A;  3QET A;  4IJN A;  4N41 A;  4FLU A;  5AZI A;  3SQ2 A;  2VGN A;  3CCJ N;  1SAZ A;  3ULE A;  4ISE A;  3CCM N;  3HPO A;  3RTV A;  2P9N B;  3CJ7 A;  3ID8 A;  2A5X A;  4KFB A;  4JV5 K;  3F5T A;  1N6Q A;  1RFQ A;  4CGD A;  4B1X B;  3IG1 A;  2YJE A;  3CCV N;  2VWJ A;  3QFU A;  1K73 O;  3FZK A;  4B9T A;  5I42 A;  3NH2 A;  4FWM A;  4RTF D;  2AJQ A;  1EET A;  1NJY A;  3OYM A;  3QER A;  4CZI A;  3SJJ A;  1ITG A;  3S41 A;  1QE1 A;  1GLB G;  1JCF A;  4M3Y A;  3V81 A;  2HBM A;  3WQU A;  1LWC A;  4IDK A;  4Q5V A;  3V9X A;  2P9L A;  3AVL A;  4KHP K;  2BGG A;  1KVC A;  2IGI A;  2PFU A;  3D6R A;  5C42 A;  1SS6 A;  3OVN A;  3QB0 A;  4LSN A;  4DMN A;  1WB9 A;  4CJK A;  2X6S A;  4CJQ A;  1H1V A;  2VWK A;  3VF2 A;  4BRG A;  5FDL A;  4EHT A;  3G71 N;  2P9N A;  1CLQ A;  4JKD A;  4FOE A;  1HX1 A;  4ICL A;  1S9E A;  4IOA L;  1ZYQ A;  1D5A A;  1NGD A;  4YHH K;  5KPR A;  1JLA A;  2F9T A;  2VWB A;  1IKY A;  4GV6 A;  4JKE A;  2O4G A;  1QQN A;  1DGK N;  1NMD A;  1NGA A;  3TAE A;  3IFR A;  4FXD A;  1RT1 A;  3B8A X;  4JKA A;  4TSX A;  3QML A;  3PUF A;  3RRG A;  4BR4 A;  5CYM A;  4J2B A;  2W40 A;  1GOA A;  5J2N A;  3OYN A;  5KRS A;  4DSL A;  3QDK A;  2YHY A;  3BZC A;  4CJW A;  4BC2 A;  1XC3 A;  3DLL L;  1QVG M;  1LAW A;  3U8X A;  2XY7 A;  3T1A A;  1BIS A;  4FPB A;  5M1Q A;  2KQ2 A;  2ZF5 O;  3V6D A;  4CHN A;  1WSF A;  3KKR A;  1JCE A;  4YOT A;  4ELV A;  1WSI A;  2Q97 A;  3AO5 A;  4N47 A;  4BR0 A;  3A5L C;  4M3W A;  1DTT A;  1WSE A;  4DTM A;  3UB5 A;  3ZT0 A;  2B4J A;  4CIF A;  1W7A A;  1M90 O;  4DTO A;  1IBL K;  4DQI A;  3JAM O;  3D0P A;  4Z4F A;  4PQU A;  5C24 A;  1XNQ K;  2E2Q A;  4JI2 K;  1VSL A;  4KV8 A;  3AVI A;  1Q18 A;  5SWM A;  2AA4 A;  3ZSY A;  5BRH A;  3FE1 A;  1A5X A;  4E0D A;  1EX4 A;  5AFU H;  3PX4 A;  1EQY A;  1SKR A;  4HTU A;  4KAZ A;  1T6C A;  1SV5 A;  4H5T A;  1HMV A;  3ZSR A;  3HM8 A;  1RBV A;  5GAH P;  4E3S A;  4B1U B;  3LDL A;  3B6P A;  4XH4 A;  1IV0 A;  4CJE A;  1D9D A;  3Q7C A;  4I2Q A;  1RDU A;  1HUX A;  3SLC A;  1HRH A;  5D3G A;  1YHQ N;  4F2S A;  3DXM B;  2B6A A;  4E89 A;  3MEE A;  3O9U A;  4WF9 L;  2JLE A;  3K59 A;  1NLV A;  2E6L A;  1UAX A;  4BDP A;  3H46 O;  4CJ5 A;  3TAF A;  3VEV A;  3BF3 A;  3QNO A;  4CJP A;  3HP6 A;  1WBB A;  2OZM A;  1BOT O;  4BQL A;  5IT9 O;  4H5W A;  1KVB A;  4CJS A;  3HYF A;  4CF1 A;  4CIE A;  5F0X A;  1HYV A;  3M8S A;  4W5Q A;  1UWB A;  3QIO A;  4NCG A;  4Y1C A;  2ATQ A;  2WOM A;  1NK5 A;  4KTQ A;  5AQZ A;  4DV4 K;  1WSJ A;  1NKC A;  1GLA G;  1TK5 A;  3OHR A;  2Q1N A;  3DI6 A;  3K9J A;  2E2O A;  4C23 A;  2X78 A;  3WNH A;  4DV7 K;  5AQF A;  3AVM A;  5EY4 A;  2NRZ A;  3ZSQ A;  4CGI A;  2EWS A;  4B9Q A;  3CD6 N;  4DR7 K;  3K58 A;  3AA3 A;  3DXM A;  3LDP A;  2UU9 K;  4IEI A;  2NRR A;  2ASP A;  3LPT A;  4JEP A;  2D1K A;  1QVF M;  1X1P A;  1KXP A;  3JYT A;  4O44 A;  1KAZ A;  4DR6 K;  4M3Z A;  3MCA B;  1MWM A;  1U47 A;  3S3O A;  4JRQ A;  4JAX A;  3QNN A;  3NAE A;  3QBW A;  1GLC G;  3S3M A;  5I9E B;  3ULD A;  2HHX A;  1HPZ A;  4EP5 A;  4C1N I;  1RBS A;  1G99 A;  1IKV A;  3J7Y P;  5AFU A;  1JLC A;  3AO1 A;  1KTQ A;  3ENB A;  4BQZ A;  1D9F A;  3QBX A;  3HOS A;  4UQG A;  4FJK A;  5EX5 A;  5KPT A;  4DFJ A;  4A5A A;  4FJH A;  4CK1 A;  3F9K A;  1NGF A;  2Z1G A;  2I5J A;  4WCE L;  3R6M A;  3O3F A;  2FSN A;  1ESV A;  2YHA A;  3IKM A;  1VQ5 N;  3F73 A;  2KZM A;  1JKH A;  2A6A A;  1YVN A;  3T7Z A;  3I55 N;  1C0G A;  1EO1 A;  3ISN C;  1P90 A;  3DM2 A;  5JVH L;  2XY5 A;  4KBO A;  3TTC A;  3NHG A;  3CFP A;  4F9O A;  4CVN E;  4WFN L;  1XUP O;  5BR9 A;  3CXC M;  1OH8 A;  3SUO A;  4XIU A;  4N56 A;  4FWQ A;  4FM2 A;  2IC3 A;  4BRD A;  4NO7 A;  4M7X A;  3BP8 A;  4I9L A;  5BN9 A;  4BRF A;  4FJJ A;  3U3G A;  4IO8 A;  4CIG A;  4BRN A;  4KH5 A;  3DXK B;  1TKT A;  3SPY A;  2FBX A;  4JKB A;  1C6V A;  2FBT A;  1Q9X A;  1HKB A;  2QWN A;  1XMO K;  3SBG A;  1NNE A;  3QEP A;  4KKO A;  5BN8 A;  1HKG A;  4FJG A;  2NUB A;  3TAG A;  4FZY A;  5AQH A;  3KLF A;  3RMC A;  1NJI O;  4CHO A;  2GWK A;  1QSY A;  1RBT A;  5AR0 A;  3LDQ A;  3WNF A;  1BI4 B;  3SAG A;  4FJ7 A;  2KLA A;  5EU7 A;  4K8X A;  2F96 A;  1ZC6 A;  4DR4 K;  4WQ5 A;  3ZYY X;  4H03 B;  4JI8 K;  4CZL A;  3AVK A;  3A5O C;  2G8I A;  1GLF O;  5B8H A;  5AQQ A;  1SKW A;  2DFE A;  3KWI A;  3LDO A;  2NRW A;  4PKG A;  2G8V A;  5FLX O;  1TL3 A;  1BWF O;  2OPR A;  3SUP A;  3H3O B;  2Z1J A;  4O4G A;  4M3R A;  1REV A;  1RTD A;  3HPG A;  4CFD A;  4LF6 K;  3TAQ A;  3OYB A;  3JXU A;  1VRT A;  1SZ2 A;  5J2Q A;  4GV9 A;  1RTI A;  3H08 A;  3SV3 A;  2ZJP L;  2O8B B;  1V4T A;  3F2K A;  4NCA A;  4KI6 A;  2D0B A;  2NNW A;  5FPD A;  4FLT A;  4K0K K;  3C6H A;  3EE9 A;  4DSJ A;  1U45 A;  4OGE A;  1TYQ B;  1JLE A;  1KFS A;  2HHT A;  4PA1 A;  1J9A A;  5KQ8 A;  1OH7 A;  2UUC K;  5EOY A;  1JLB A;  1BI4 A;  2YV0 X;  2D0O A;  3DRR A;  3FZF A;  4OVL A;  4GW6 A;  3SMS A;  3L2U A;  2QXF A;  1TUU A;  2JGU A;  4OX9 K;  3MN6 A;  1VQ9 N;  3O08 A;  2Y1J A;  1NKE A;  4DUZ K;  1VQL N;  5AQG A;  4FLZ A;  4BDZ A;  3AVC A;  2QWL A;  3A2F A;  4B3M K;  3CCU N;  3SAH A;  3AA5 X;  4H5R A;  4AHR A;  2HBK A;  4NXM K;  4MQ3 A;  2HNZ A;  3QIC A;  3OYE A;  3L3U A;  1QSS A;  1TK8 A;  1KC8 O;  3KLG A;  5GIN A;  4FWR A;  4I6M B;  3HT3 A;  3OYD A;  1T8E A;  1HNI A;  2HF4 A;  3ZLJ A;  2J4R A;  2ZQB A;  4CZG A;  4CEE A;  3VQB A;  5KGX A;  2O8B A;  2O4I A;  4JI6 K;  5HRR A;  4A62 A;  1TYQ A;  5DM6 L;  3EZ5 A;  2YCH A;  3AVH A;  3K9K A;  1SL1 A;  2O8D B;  4GKJ K;  1CZB A;  1VHX A;  2ITM A;  3UKR B;  3L6Q A;  3AO2 A;  4GNI A;  1MDU B;  5LL6 Z;  1ILY A;  3OY9 A;  1NGG A;  3LP0 A;  4CJ4 A;  4E1J A;  3OYI A;  1WNS A;  3LM9 A;  4KTW A;  5HLF A;  2NRX A;  3FZL A;  1FKP A;  4X64 K;  1DKG D;  3JS6 A;  1I3A A;  3AVG A;  1V4S A;  4F4K A;  1RDB A;  1WAJ A;  4CGG A;  4E7J A;  3NGZ A;  3I0S A;  4BRO A;  2YX6 A;  2ASM A;  3I8B A;  3ZT3 A;  4CJF A;  3DLG A;  3FFK B;  3CHW A;  5AQR A;  1E4F T;  4I6M A;  3A5M C;  3SZ2 A;  3ZSX A;  4CFB A;  1Q86 O;  1ASV A;  5KI6 A;  5TKW A;  3VQP A;  1IG9 A;  2A41 A;  3O4W A;  3LM2 A;  3SQ0 A;  1ATS A;  4DQS A;  1NMN A;  3O9S A;  3AA4 A;  1HKC A;  4AHC A;  3V1R A;  4Y0W A;  5F2R A;  2KW4 A;  4JHD B;  2PY5 A;  2O8D A;  3UKR A;  3WXL A;  3ZSO A;  4GVM A;  1RT6 A;  4JLH A;  3NH0 A;  3HPH A;  5EVZ A;  4C8M A;  4CHZ A;  2BDP A;  1NGJ A;  2IAJ A;  5M1F A;  4BC4 A;  4DS4 A;  3DRS A;  5H1S Q;  4FM0 A;  3P4I A;  2HMI A;  4CF2 A;  2QKB A;  3THW B;  1I39 A;  1MA9 B;  1K9M O;  3AO4 A;  1QZ5 A;  3CIP A;  2XHB A;  2D5R A;  4Z0U A;  1RNH A;  5JS1 A;  1KAX A;  4OPA A;  4CFC A;  1X3M A;  2RE2 A;  1U04 A;  3AY9 A;  3V9S A;  4PY5 A;  1CXQ A;  4LFC K;  3OW2 M;  4K41 A;  4KHN A;  3MAQ A;  3VQ5 A;  3VF6 A;  3E66 A;  4CJ3 A;  2IIR A;  3E01 A;  3DOK A;  2UUA K;  1NM1 A;  1LWF A;  4JHD A;  1KCF A;  5A2Q O;  2BUP A;  1LW0 A;  3MCP A;  2WON A;  5AQN A;  3VES A;  1ATN A;  1Q9Y A;  3OBY A;  1N5Y A;  4MLE A;  1SL0 A;  3O1W A;  4IJA A;  3OYA A;  3NF9 A;  3P31 A;  3HP9 A;  3OYL A;  1YF5 L;  3EY1 A;  1O1W A;  5M1P A;  3I33 A;  3S3N A;  4DSI A;  1BIZ A;  4RWT A;  4K8Z A;  2AP1 A;  3THW A;  4O5B A;  1HNV A;  3L0Q A;  5BPN A;  4GV3 A;  1Q8I A;  1TUY A;  4CJR A;  4JKF A;  2PYL A;  1XWL A;  3AVN A;  4I2P A;  2PBD A;  4H0P A;  2UYT A;  3M6G A;  4YOY A;  1W2B M;  3ZET B;  3VPZ A;  3PY8 A;  4DFM A;  2WTU A;  5GIO A;  4G1Q A;  4HUG A;  3N4P A;  1RTH A;  3MK6 A;  3C6T A;  4CK2 A;  4I9Q A;  1RT4 A;  5GIP A;  2E1Z A;  3FZM A;  1IBK K;  3UE5 A;  3V4I A;  2IVO A;  2VG6 A;  5J2M A;  2KFN A;  1YT3 A;  5ADX H;  3LP2 A;  2XY6 A;  2Z1H A;  2P9S B;  4LF7 K;  3NFA A;  1ATR A;  3KVG A;  3SYZ A;  4JS5 A;  1BQM A;  3H3N O;  4GY2 B;  4IZ9 A;  2QKK A;  1QHT A;  3VEO A;  4M42 A;  3QEI A;  3G0Z A;  1BCM A;  3WEE B;  3HSC A;  4MLH A;  3CC2 N;  4KHQ A;  3K2P A;  1TVR A;  1RIL A;  3ZSW A;  4IOX A;  5I3U A;  3C95 A;  1WBD A;  1J5O A;  3HL8 A;  4CEC A;  5KQD A;  2HHQ A;  2G8K A;  3ATU A;  4R5P A;  3T69 A;  3OYG A;  4B9V A;  1J53 A;  1RGI A;  1NK4 A;  5DK5 A;  3WXI A;  1C0F A;  3VQC A;  4DTJ A;  3VEW A;  1NG9 A;  1S1T A;  3NVM A;  1B9D A;  1D4X A;  3ZET A;  1RDD A;  2KZZ A;  3CCR N;  4DQQ A;  4FWK A;  1S6Q A;  4KH4 A;  4CJV A;  5DMR A;  4BVP A;  4FW2 A;  4BDY A;  1NGE A;  5DM7 L;  5AJ3 K;  2D0C A;  2Q3S A;  3R3L A;  1T7P A;  1J54 A;  4CCH A;  1RT5 A;  3RSE B;  3WXK A;  2WBN A;  5JMV A;  3BUZ B;  3LAM A;  5HBM A;  2P51 A;  1W9H A;  4DV3 K;  2NZT A;  3DRP A;  2GEM A;  5HL7 L;  4CBX A;  2P9S A;  4FZZ A;  1DTQ A;  1S1V A;  3KLI A;  4CER A;  1VSK A;  4BR7 A;  1BA1 A;  3VEN A;  2ZGY A;  4KTZ A;  4CBU A;  2OTL N;  3F9M A;  4ISF A;  1DT9 A;  4LFB K;  1OVQ A;  3WEE A;  1C1A A;  4DCH A;  4E7I A;  4X62 K;  2A40 A;  2IS3 A;  4E1M A;  2GBZ A;  1TGO A;  4PL8 A;  4IEE A;  2OAN A;  3ZSV A;  3CM6 A;  1SUQ A;  4M3U A;  4KPY A;  3ZX0 A;  1YJ9 N;  1TL1 A;  2CGK A;  1N8R O;  2IVP A;  4LFA K;  4X65 K;  2FF3 B;  3AGR A;  2O8F B;  4DTP A;  3PSF A;  4OO1 J;  1TKX A;  3SJH A;  1YIT N;  3L2R A;  3GDQ A;  5C0Y A;  1X9S A;  4PL7 A;  3DWL A;  3P38 A;  5ADX A;  3LL3 A;  3ZX3 A;  3RSE A;  3RR8 A;  3OTO K;  4B9N A;  4OLA A;  3V1O A;  2VCP A;  3WNG A;  4IFY A;  4QS8 A;  1Y64 A;  2RHK A;  4EFH A;  4NCB A;  5BPL A;  4BE1 A;  3KTQ A;  3ID6 A;  5HRN A;  2E88 A;  2KKZ A;  3PX0 A;  2HHU A;  4LSL A;  4FOI A;  4HHT A;  1TV6 A;  3K5L A;  5C15 A;  3QIP A;  5FPM A;  4AHS A;  2E4L A;  3H6E A;  5FRN A;  4BRK A;  3VET A;  4C1N K;  2QWO A;  3CC7 N;  3M1F A;  4ISG A;  3RVC A;  3BEX A;  3OYC A;  3J8A A;  3CCE N;  1S6P A;  4W5T A;  1L3U A;  4RCH A;  1S22 A;  3NE6 A;  3CC4 N;  2OPQ A;  4B9L A;  2HOE A;  1TAQ A;  5AQT A;  1A5W A;  3KLE A;  1HJR A;  1VQ6 N;  2A1R A;  4H5V A;  2ZJR L;  1GLL O;  2HF3 A;  1NGI A;  4DS5 A;  1ZBL A;  4CEZ A;  4IKF A;  3G25 A;  5LJV A;  2O8F A;  4H5N A;  3AGK A;  4MO5 A;  2UXB K;  1DLO A;  4YFU A;  3R8E A;  2FBY A;  3IS9 A;  4ZHR A;  3T19 A;  1C0T A;  1LV5 A;  2NLX A;  4U7B A;  1CZ9 A;  4CE9 A;  1L3V A;  4YOU A;  2G8U A;  3VQ8 A;  3VA3 A;  4JI1 K;  3C6A A;  3HZ6 A;  3LDS A;  3EEQ A;  1IBM K;  3HI0 A;  3C7N B;  1EKE A;  1TK0 A;  4Q0B A;  1YVU A;  2CH5 A;  3DJC A;  3PO4 A;  2F4V K;  3VQA A;  1T6D A;  1ZBU A;  4DR2 K;  3UIQ A;  1U48 A;  2GWJ A;  2EX3 A;  3N4Q A;  4BRI A;  3HXM A;  4OLB A;  3NH1 A;  4QCL A;  2OPS A;  1J5E K;  3QEV A;  3A0I X;  4E19 A;  3QEX A;  3DLB A;  1NWK A;  1SKS A;  3VEZ A;  1NOZ A;  3AO3 A;  3M8P A;  3M8Q A;  1VSH A;  4AHV A;  3OS0 A;  1NGH A;  1UA1 A;  2W42 A;  3SMP A;  3MEC A;  4CF9 A;  1NOY A;  1TKD A;  5AQL A;  2LSN A;  3VN5 A;  4DU3 A;  3R1X A;  4E1N A;  2VQF K;  1R0A A;  1KQS M;  1NGC A;  1WOQ A;  4FM1 A;  1VK0 A;  3CI5 A;  3U6F A;  4YOW A;  1HQE A;  3ENH A;  2DFH A;  1FW6 A;  1JLQ A;  1VSM A;  3L8B A;  4LH5 A;  5SZT A;  4FJX A;  1JXE A;  1WAF A;  2YI1 A;  2I7N A;  2YNG A;  4DTN A;  3ITH A;  5F1X A;  2ZJQ L;  2KTQ A;  4PKI A;  4BAC A;  5C12 A;  3OYJ A;  3EE8 A;  3FZH A;  3C7N A;  3C0B A;  4JD2 B;  1RT3 A;  2YHX A;  4FJ5 A;  3DAW A;  3OBW A;  3LAK A;  1QTM A;  1EWQ A;  3TI0 A;  2A3Z A;  4M45 A;  1Z25 A;  4LF9 K;  2QWP A;  2Q36 A;  4A59 A;  2ZGZ A;  4DTX A;  2UXC K;  3SUQ A;  2RPI A;  4NLB A;  5E41 A;  4H4M A;  3WXM B;  5HP1 A;  2P5G A;  1VSJ A;  2KFZ A;  4FWL A;  4OKJ A;  3CCL N;  3OYH A;  3SBT A;  1RCH A;  4K42 A;  4BRC A;  5EXW A;  3GE1 A;  1Q81 O;  5JLH A;  3L4Q A;  2X6N A;  3HK2 A;  1YUW A;  1YTA A;  4B9S A;  1BCO A;  5IWA K;  4KHS A;  3EZW A;  4HCC A;  2E20 A;  1NK8 A;  3DMJ A;  4B1W B;  1EP4 A;  1UOC A;  1KRP A;  4FWO A;  3P39 A;  3I0R A;  3CET A;  3RMD A;  4BGB A;  4NLC A;  3FGU A;  3QIN A;  4XEI A;  3SK3 A;  3DXK A;  1YAG A;  3CYM A;  4IO9 L;  2YNI A;  2BE2 A;  1VAZ A;  4QS9 A;  3C94 A;  3RRH A;  2DY4 A;  3V1Q A;  1EXQ A;  3NCI A;  4OKK A;  3THX B;  3L2W A;  2PZS A;  4FK2 A;  1QZ6 A;  3D2F B;  4CK3 A;  4CD3 A;  3H45 C;  4JD2 A;  3QFP A;  4HVJ A;  3B6O A;  2IVN A;  3CMA N;  1T03 A;  3MN7 A;  4BRP A;  3WQT A;  4KHY A;  4B3S K;  5KTQ A;  1KLN A;  5AQP A;  4CES A;  1RT2 A;  2IDO A;  1S5J A;  4JS4 A;  3MXJ A;  2PAV A;  4L8R B;  2BTF A;  1VSE A;  3VF4 A;  4B08 A;  4FLW A;  4KRF A;  4CZM A;  4LH4 A;  1FK9 A;  3O4Q A;  4X66 K;  1BDG A;  2GUI A;  1LCU A;  3PX6 A;  3C6U A;  2Q0R A;  4J2A A;  2GX9 A;  3NF7 A;  3CQX A;  1ASU A;  4KB1 A;  4H0O A;  4PWD A;  3VOV A;  4LF8 K;  4JK8 A;  1FXX A;  4BRA A;  5MLC Q;  3CF5 L;  4RW8 A;  4A57 A;  4PKH A;  3A5N C;  1RBU A;  4WQ4 C;  5C2F A;  1S9G A;  1XHX A;  5J2P A;  4FW1 A;  2HBL A;  3THX A;  2FC0 A;  1NK7 A;  3D2F A;  1U49 A;  1X9W A;  1RDC A;  4JKG B;  4DV5 K;  2P9U B;  3VER A;  4B9U A;  4Z4G A;  4BRL A;  4FCY A;  5CE3 A;  4IDH A;  5AQO A;  4JI4 K;  4BVO A;  3DLK A;  5CR4 A;  5FPN A;  4CW7 B;  4Z4E A;  3OA9 A;  3UKU B;  4YOX A;  1XMQ K;  3M3Z A;  3LZJ A;  1T44 A;  1K8K B;  3J7Z O;  5BPM A;  4FJL A;  3AV9 A;  1C0M A;  2QK9 A;  2YKM A;  1YJW N;  5CZ2 A;  2HVH A;  1Q82 O;  4CEQ A;  3T1Y K;  1QS4 A;  2E8A A;  4F3O A;  3VEY A;  4H4O A;  1RBR A;  2KHO A;  4CEF A;  4U67 L;  3VTI A;  4DQ8 A;  4DU1 A;  1LOT B;  2V7Z A;  1DEJ A;  3CCS N;  4DHY A;  4DV0 K;  5HRO A;  1VQN N;  4JK9 A;  1LWE A;  2E6M A;  1GLE G;  1VQM N;  3LZI A;  2HB5 A;  2F7T A;  3NDK A;  3TAM A;  4RW4 A;  2YNH A;  4DV6 K;  4LD0 A;  4EP4 A;  3THY B;  3ZCM A;  1LW2 A;  3O6W A;  4MDB A;  5FRO A;  1JLF A;  3A8Y A;  3P5J A;  4C8L A;  1BHL A;  3PLA A;  2D0P A;  2QXL A;  1HNX K;  4PUO A;  1WSH A;  3W0L A;  1QQC A;  1HNW K;  1JL2 A;  4JKG A;  4IFV A;  2P9U A;  4FL9 A;  3ZX2 A;  4GKK K;  3EO3 A;  4F8R A;  3IDH A;  4O5F A;  1N33 K;  4BWJ A;  1NJZ A;  4OGC A;  4JN4 A;  2EHG A;  3UKU A;  3K5N A;  1F21 A;  5BR8 K;  1BA0 A;  4CGF A;  4N76 A;  3LP1 A;  1LAV A;  1K8K A;  3ZEU B;  4CJT A;  2XRI A;  3TAN A;  1VQP N;  4EZ9 A;  3VQE A; 
#chains in the Genus database with same CATH homology
 5I9E B;  3EL2 A;  3EN9 A;  1RGI A;  3GBT A;  1MWK A;  2NRH A;  1ZXO A;  2QW9 A;  3WXI A;  4BRQ A;  1C0F A;  3HOT A;  4C1N I;  4JKC A;  3R9P A;  2A42 A;  4GVE A;  1G99 A;  2QM1 A;  3VEW A;  5AFU A;  5AQY A;  3NVM A;  3ENB A;  4BQZ A;  3CQY A;  1D4X A;  3ZET A;  4CZK A;  3W3D A;  3QBX A;  3HOS A;  3CCR N;  3VGK A;  4L3Q A;  2OTL N;  3VGM A;  4FWK A;  1M1K O;  3NMU A;  4YDU A;  4KH4 A;  3G4S N;  5EX5 A;  5KPT A;  3TSP A;  4BVP A;  4A5A A;  1NGE A;  5DM7 L;  2GUP A;  5GAG P;  3R3L A;  5AQI A;  4IWV A;  3KK7 A;  1NGF A;  3E9O A;  3RSE B;  3Q7B A;  2P9K B;  1BU6 O;  3TU5 A;  3WXK A;  2WBN A;  4WCE L;  5JMV A;  4BR5 A;  3BUZ B;  3R6M A;  3GOI A;  2FSN A;  3FR0 A;  1ESV A;  2NZT A;  3MX5 A;  2GEM A;  5HL7 L;  3IKM A;  1VQ5 N;  2CGJ A;  4CBX A;  2P9S A;  2A6A A;  3AAP A;  1YVN A;  4FWN A;  5E26 A;  4HWI A;  3T7Z A;  1O13 A;  4BGA A;  3I55 N;  2I7P A;  2W41 A;  4BG8 A;  1C0G A;  1EO1 A;  4PHT X;  3EKS A;  4ILG B;  4BR7 A;  2D4W A;  1P90 A;  1BA1 A;  5JVH L;  3VEN A;  2WC9 A;  4A2B A;  2ZGY A;  3CJC A;  4KBO A;  3F9M A;  3HRG A;  4ISF A;  3TTC A;  1DT9 A;  3KZB A;  4ILH A;  4CBU A;  4F9O A;  1VQ4 N;  2FSK A;  1R59 O;  4WFN L;  1JJ2 M;  2DPN A;  3WEE A;  3H1V X;  1XUP O;  5BR9 A;  3LDN A;  1HPM A;  3PIO L;  3CER A;  3CXC M;  3ZEU A;  4DCH A;  4YOV A;  4FSV A;  4FWQ A;  1YI2 N;  4BRD A;  4NO7 A;  4KH6 A;  1KAY A;  2A40 A;  4M7X A;  3BP8 A;  5BN9 A;  4BRF A;  4PL8 A;  5JVG L;  2HST A;  4IEE A;  2OAN A;  4EIA A;  4K43 A;  4BR2 A;  1OKJ A;  4IO8 A;  5TKY A;  4KH5 A;  2Q31 A;  3C65 A;  3DXK B;  4BRN A;  5FPE A;  1NBW A;  3ZX0 A;  3O80 A;  1YJ9 N;  2CGK A;  1OVY A;  1CZA N;  2IVP A;  1N8R O;  3TSQ A;  4JKB A;  2FF3 B;  4OPH A;  3AGR A;  1HKB A;  5AQU A;  3TSU A;  2QWN A;  4H0V B;  2WUS A;  5AQW A;  4B1V A;  3SBG A;  4BR9 A;  4FPA A;  5C2D A;  2H3G X;  3O5B A;  4OO1 J;  5BN8 A;  3SJH A;  1GLJ O;  1HKG A;  3O9T A;  1YIT N;  2HBJ A;  3GDQ A;  3CPW M;  5C0Y A;  3ENO A;  1SQK A;  4PL7 A;  2OTJ N;  3DWL A;  3P38 A;  5AQH A;  5ADX A;  3LL3 A;  3CJ1 A;  3ZX3 A;  3RSE A;  3FLC O;  2P9K A;  1NJI O;  4JNE A;  5AZJ B;  3TTF A;  2GWK A;  4J8F A;  2VCP A;  3MWP A;  3H1Q A;  5AQK A;  5AR0 A;  3LDQ A;  4ILJ A;  4QS8 A;  1Y64 A;  2RHK A;  1T3V A;  4EFH A;  3SAG A;  2KLA A;  3L4I A;  3NVK A;  5BPL A;  1S72 N;  3ID6 A;  5BRF A;  1ZC6 A;  2E88 A;  2KKZ A;  2QEX N;  4AM7 A;  4WQ5 A;  2YJF A;  1P8Z A;  4H03 B;  4M63 C;  3ZYY X;  4CBW A;  4CZL A;  4CZH A;  4WFA L;  4FOI A;  3A5O C;  4B1Z A;  3MDQ A;  1GLF O;  5B8H A;  4JKH A;  4HTL A;  5AQQ A;  5FPM A;  4BRM A;  5C15 A;  3H6E A;  3KWI A;  3LDO A;  2CH6 A;  4BRK A;  3VET A;  4C1N K;  2NRW A;  3E1Y A;  3VMF B;  3VGL A;  4PKG A;  3ATV A;  4AF1 A;  5M1K A;  1VQ7 N;  2QWO A;  5AQM A;  5AZI B;  3CC7 N;  3M1F A;  4ISG A;  1BWF O;  1X3N A;  3ULE B;  3RVC A;  3BEX A;  3J8A A;  3CCE N;  3H3O B;  4RCH A;  1S22 A;  3SAF A;  3CC4 N;  2QWQ A;  3E9P A;  2HOE A;  5AQT A;  2QWM A;  1ZBS A;  4CI6 A;  5E84 A;  1VQ6 N;  3JXU A;  1YXQ A;  4H5V A;  4WFB L;  3I56 N;  5AQX A;  2ZJR L;  1GLL O;  2HF3 A;  1NGI A;  1SZ2 A;  4GV9 A;  4FWS A;  3G25 A;  5LJV A;  4H5N A;  4XH5 A;  3AGK A;  4MO5 A;  4YOR A;  3R8E A;  3IMX A;  3U9Z A;  4WQ4 A;  1V4T A;  3F2K A;  2ZJP L;  2NNW A;  5FPD A;  3O9Q A;  2NLX A;  4U7B A;  1RDW X;  3C6H A;  3EE9 A;  4YOU A;  3O8M A;  5LJW A;  2FLO A;  1TYQ B;  3D7E O;  3TPQ A;  3C6A A;  3HZ6 A;  5AZJ A;  3CPE A;  1QHA A;  4LC9 B;  3HI0 A;  4CJ7 A;  3C7N B;  3U4L A;  4QS7 A;  3VEX A;  3M5R A;  4WQ5 C;  4M7Y A;  5EOY A;  2CH5 A;  3DJC A;  5CHI A;  1JCG A;  1YIJ N;  2D0O A;  1YJN N;  3FZF A;  1T6D A;  5JIC A;  1GLD G;  4H0T B;  2P9L B;  4BRE A;  5BRE A;  3MWT A;  2GWJ A;  3SMS A;  4CD1 A;  3N4Q A;  4BRI A;  4A2A A;  2NRT A;  1TUU A;  4MDA A;  3MN6 A;  1VQ9 N;  3O08 A;  3A0I X;  1BO5 O;  1VQL N;  5AQG A;  2ZWH A;  1NWK A;  4IJN A;  4MO4 A;  3VEZ A;  5HOO A;  3GL1 A;  2QWL A;  2QTD A;  2FXU A;  1XQS C;  5AZI A;  1Q7Y O;  2VGN A;  1KD1 O;  3CCU N;  3CCJ N;  2QI2 A;  1SAZ A;  4H0Y B;  4H5R A;  3ULE A;  3SAH A;  4ISE A;  1U6Z A;  4IOC L;  2Q2R A;  3CCM N;  5AQS A;  2HBK A;  1NGH A;  1NGB A;  3SMP A;  2P9N B;  3CJ7 A;  5AQL A;  3QIC A;  3ID8 A;  2A5X A;  4DB3 A;  3R1X A;  3F5T A;  1RFQ A;  4B1X B;  1KC8 O;  1KQS M;  1NGC A;  1WOQ A;  2YJE A;  5GIN A;  4FWR A;  4I6M B;  3CCV N;  2F9W A;  2HF4 A;  3CI5 A;  3QFU A;  1K73 O;  2J4R A;  3FZK A;  3VTH A;  4YOW A;  4CZG A;  3ENH A;  3PIP L;  4FWM A;  2VGM A;  4AM6 A;  4RTF D;  4CZI A;  4A62 A;  4YDU C;  2YI1 A;  2I7N A;  1TYQ A;  4CZE A;  3O1B A;  5DM6 L;  2Q0U A;  2NRV A;  2YCH A;  3S41 A;  5F1X A;  2ZJQ L;  1GLB G;  1JCF A;  4PKI A;  5C12 A;  3EE8 A;  3FZH A;  3K9K A;  3C7N A;  3C0B A;  4JD2 B;  2HBM A;  3WQU A;  2YHX A;  2FF6 A;  2ITM A;  3UKR B;  4O8K A;  3L6Q A;  2P9L A;  4GNI A;  2FSJ A;  3WXJ A;  4XH1 A;  3DAW A;  3OBW A;  1MDU B;  1ILY A;  1NGG A;  3D2E B;  5C10 A;  2A3Z A;  3CCQ N;  2QWP A;  4E1J A;  2PFU A;  2Q36 A;  3D6R A;  2ZGZ A;  4A59 A;  3BF1 A;  4WYB A;  3LM9 A;  4CZJ A;  1SS6 A;  3QB0 A;  3CME N;  5LY3 A;  2NRX A;  3FZL A;  4NLB A;  3EKU A;  1DKG D;  3JS6 A;  3WXM B;  1Z05 A;  2WFB A;  4H0X B;  4BC5 A;  4NB4 A;  4EAH D;  1V4S A;  4FWL A;  3CCL N;  3SBT A;  2ASO A;  4K42 A;  5EXW A;  1H1V A;  3GE1 A;  3VF2 A;  4BRC A;  4BRG A;  3L4Q A;  5JLH A;  1Q81 O;  4EHT A;  3G71 N;  2P9I B;  2P9N A;  1YUW A;  4JKD A;  2YX6 A;  4BRO A;  4FOE A;  1HX1 A;  2ASM A;  4EHU A;  4IOA L;  3EZW A;  3I8B A;  3FFK B;  5GAD P;  2E20 A;  3CHW A;  5AQR A;  3HBT A;  5ELZ A;  4B1W B;  1E4F T;  1NGD A;  4I6M A;  3A5M C;  5KPR A;  4FWO A;  3P39 A;  3IUC A;  3CET A;  1Q86 O;  2F9T A;  5TKW A;  1VQ8 N;  4BGB A;  4NLC A;  5GAE P;  3FGU A;  4XEI A;  3SK3 A;  2VWB A;  3DXK A;  4GV6 A;  4JKE A;  2CGL A;  1YAG A;  1QQN A;  3CJA A;  4IO9 L;  1DGK N;  3KWG A;  1NMD A;  2A41 A;  1NGA A;  1VAZ A;  2V7Y A;  4QS9 A;  3O4W A;  5M1N A;  3LM2 A;  1ATS A;  3IFR A;  3CJB A;  3O9R A;  5KQ8 A;  2V51 B;  3B8A X;  2JWK A;  1QZ6 A;  3MMV A;  3O9S A;  3D2F B;  4JKA A;  1HKC A;  3QML A;  4JK7 A;  4CD3 A;  5AQV A;  3H45 C;  4JD2 A;  4BR4 A;  3QFP A;  4Y0W A;  5F2R A;  1WUA A;  4JHD B;  2W40 A;  2IVN A;  3UKR A;  3WXL A;  5JLF A;  3CMA N;  2E2N A;  3AAQ A;  5EVZ A;  3MN7 A;  4BRP A;  3D2E A;  4DKW A;  3WQT A;  1NGJ A;  5M1F A;  3QDK A;  4BC4 A;  4BRH A;  2YHY A;  4BC2 A;  1XC3 A;  3DLL L;  5H1S Q;  1QVG M;  5AQP A;  3P4I A;  3U8X A;  1W97 L;  1HJO A;  4BC3 A;  4BG9 A;  4FO0 A;  1K8A O;  1E4G T;  2YHW A;  4FPB A;  5M1Q A;  2PAV A;  1MA9 B;  2ZF5 O;  1K9M O;  2BTF A;  1IG8 A;  1JCE A;  1QZ5 A;  4YOT A;  3VF4 A;  1VQO N;  2Q97 A;  2P9I A;  4BR0 A;  3A5L C;  3CIP A;  3G6E N;  3UB5 A;  4G9Z A;  4CZM A;  1M90 O;  1BDG A;  1LCU A;  1KAX A;  2Q0R A;  4OPA A;  2GX9 A;  1X3M A;  2RE2 A;  3AY9 A;  2E2Q A;  3CQX A;  2E2P A;  4H0O A;  1Q18 A;  4K25 A;  2AA4 A;  1HLU A;  5BRH A;  3FE1 A;  3VOV A;  4JK8 A;  4K41 A;  3OW2 M;  4BRA A;  5MLC Q;  3CF5 L;  4IXC A;  1U2V B;  5AFU H;  1EQY A;  4A57 A;  4PKH A;  3E9L A;  4R79 A;  1T6C A;  2HMP A;  3A5N C;  4H5T A;  4WQ4 C;  5C2F A;  3VF6 A;  4FVU A;  4CZF A;  3HM8 A;  3E66 A;  2HBL A;  5GAH P;  2IIR A;  1X9J A;  4B1U B;  1QQO A;  3LDL A;  4XH4 A;  3D2F A;  1NM1 A;  3Q7C A;  1RDU A;  1HUX A;  3SLC A;  4JHD A;  1YHQ N;  2BUP A;  4UY8 O;  3MN9 A;  4JKG B;  1Z6R A;  2P9U B;  3DXM B;  3MCP A;  3VER A;  3CJ9 A;  5AQN A;  3O9U A;  3VES A;  1ATN A;  4BRL A;  1J6Z A;  2QWR A;  5CE3 A;  4IDH A;  5AQO A;  4BVO A;  4WF9 L;  3OBY A;  1NLV A;  4MLE A;  4BY9 C;  5CR4 A;  3O1W A;  4IJA A;  5FPN A;  2GEL A;  1QQM A;  3P31 A;  3OA9 A;  3H46 O;  3UKU B;  4YOX A;  1YF5 L;  3T69 A;  1IJJ A;  3BF3 A;  4IFE A;  5M1P A;  3I33 A;  3VEV A;  4A5B A;  4RWT A;  3M3Z A;  3TTD A;  1BOT O;  1T44 A;  2AP1 A;  4BQL A;  1K8K B;  3J7Z O;  5BPM A;  2P9P B;  5AQJ A;  4H5W A;  3L0Q A;  3MX2 A;  1YJW N;  5BPN A;  4GV3 A;  4B1Y B;  5KPZ A;  1Q82 O;  2E8A A;  1TUY A;  3VEY A;  4JKF A;  3WUH A;  2JWL A;  5F0X A;  3GG4 A;  2KHO A;  3MN5 A;  2PBD A;  4U67 L;  4H0P A;  2UYT A;  3M6G A;  3VTI A;  4DQ8 A;  1LOT B;  2GTD A;  1DEJ A;  2V7Z A;  5AQZ A;  5M1O A;  4DHY A;  4YOY A;  3CCS N;  3ZET B;  4JK9 A;  3VPZ A;  1W2B M;  1VQN N;  1GLE G;  1VQM N;  1GLA G;  4FWP A;  3AAR A;  2F7T A;  3OHR A;  2Q1N A;  1U2V A;  5GIO A;  3K9J A;  2E2O A;  4C23 A;  2VYP A;  4O8U A;  3N4P A;  3MK6 A;  3O6W A;  4MDB A;  3A8Y A;  5AQF A;  3U9D A;  5GIP A;  2E1Z A;  2NRZ A;  5EY4 A;  3PLA A;  3FZM A;  2D0P A;  2EWS A;  4B9Q A;  3UE5 A;  2IVO A;  2QXL A;  5BRD A;  1BG3 A;  3CD6 N;  3W0L A;  5ADX H;  2P9S B;  4JKG A;  2P9U A;  3DXM A;  1ATR A;  3KHY A;  3LDP A;  4FL9 A;  3ZX2 A;  3KVG A;  3EO3 A;  4IEI A;  3IDH A;  2NRR A;  4O5F A;  2ASP A;  1BUP A;  4A61 A;  3H3N O;  4GY2 B;  2E1Y A;  4IZ9 A;  4JEP A;  2D1K A;  4Z94 A;  4JN4 A;  3VEO A;  1QVF M;  3UKU A;  1KXP A;  1S3X A;  3HTV A;  2QA4 N;  1VQK N;  3WEE B;  3HSC A;  4MLH A;  3CC2 N;  1BA0 A;  1KAZ A;  4IOX A;  3MCA B;  1K8K A;  1MWM A;  3ZEU B;  2P9P A;  2V52 B;  3WT0 A;  1VQP N;  5KQD A;  4JAX A;  2BH1 A;  3ATU A;  3QBW A;  1GLC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...