1T3VA

The nmr solution structure of tm1816
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHHHEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title NMR structure determination of the conserved hypothetical protein TM1816 from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1t3vA01
2RE2A 2WFBA 2KLAA 1O13A 1EO1A 1P90A 2YX6A 2QTDA 1RDUA 1T3VA
chains in the Genus database with same CATH superfamily
1SQKA 3WXLA 4NLCA 4BRQA 2GELA 1UA1A 3HTVA 3CFOA 4E3SA 1JLCA 1EWRA 3I55N 2E1YA 1QQOA 3RVCA 5JICA 3QO9A 2V7ZA 4DTPA 1HX1A 3L2WA 2CGLA 4HUGA 4BRCA 5B8HA 1Q8IA 2FBYA 4V19S 3HRGA 1VQ5N 3SV3A 4K8ZA 1HYVA 3HPHA 4KI4A 4IO8A 3O1BA 4DFKA 2F96A 5KPTA 4JAXA 4I7FA 1REVA 1ATSA 1RCHA 4IDKA 5CY4A 3TI0A 3LAKA 4DF4A 3HI0A 3SAGA 4MFBA 5AQNA 1ASWA 3ZT0A 5AFUA 4OX9K 3K57A 4GKKK 2KZMA 1WBBA 3KKSA 1B9FA 4GV9A 3L3UA 4BRFA 1KAXA 3KLEA 1X1PA 4LF6K 4FSVA 5EXWA 4B1VA 4KHQA 3B6PA 3VQ6A 3NDKA 2ZJQL 4PKGA 1NGFA 4F2RA 2QA4N 1Z26A 4A59A 4ZHRA 4K43A 1HNVA 1HNZK 3ZSRA 3MEDA 4NYFA 4CJPA 1RT7A 1U4BA 3HOSA 2UXDK 4KHNA 1VQ8N 2X74A 1L3SA 1LAVA 4JKEA 4XH4A 4BR2A 3KD5E 1NK5A 4CBWA 1GLEG 2O8EA 1ATNA 3C6AA 5M1OA 1RT4A 1N33K 1VQ6N 4KHPK 5EU7A 4CFAA 4O8UA 4B9MA 4GNIA 3MN7A 3VQEA 4R79A 1LWFA 4RW9A 4FK2A 3CYMA 1E3MA 3VGKA 2HOEA 3K58A 1U2VA 4KTWA 2D4WA 4B9NA 5C25A 4FJHA 2JWKA 1BL3A 5F2RA 3SUQA 3PV8A 1YI2N 4A2AA 4BRNA 4GV6A 5AQIA 4JEPA 4CHQA 3CPEA 2P9PB 3MN5A 3SNNA 3SLCA 4EZ9A 2UUAK 4A2BA 4JRQA 3SPZA 1HLUA 3CG7A 3G25A 3C95A 1IKVA 3EZ5A 3QETA 1HJRA 3DRRA 4EP5A 1L3UA 5DK5A 4H5RA 3F5TA 1YVNA 3VGLA 2XY6A 3CMEN 4QS8A 1YJNN 3U8XA 4Z4GA 3ZEUB 3L4IA 3ZETB 5ELZA 5ADXH 3A5NC 5M1QA 3CC7N 5E26A 1O13A 2VWKA 4DV7K 3F9KA 3TSPA 4OPKA 4X66K 2O8CA 2O8BB 1SL2A 3VQ4A 5BR9A 1C0MA 2O8FA 4FWOA 4YORA 3K2PA 4BVOA 2IGIA 2P9KA 4BRIA 3QBWA 4YOTA 5F1XA 2B5JA 3HZ6A 4Z4EA 3R1XA 5SZTA 1JLEA 3PO5A 4B1UB 3UB5A 3TPQA 4CGJA 3L2VA 1MU2A 4CHNA 4H5WA 5FDLA 3OYNA 4W5RA 4OKKA 5BREA 2J4RA 3A2FA 3M8PA 1C1CA 3LZIA 4FWSA 2QEXN 2LSNA 5J2MA 3AVBA 1RT5A 4E89A 1QZ6A 5HP1A 4FM1A 3NBPA 5JLFA 4ZTJA 1LW0A 3O9TA 3VESA 1RDCA 2HSTA 4XH1A 2YHBA 4DKWA 3EE8A 4F2SA 4O8KA 3SAFA 4FLYA 1JLFA 3JSMA 2VYPA 3OYAA 3DWLA 3VQAA 1KVCA 3P39A 3A5LC 4Y1CA 4DFJA 2YJFA 1KC8O 3U9ZA 3DLLL 3AA5X 4GVMA 2P9LA 1VQ9N 4B9UA 1RFQA 1D4XA 3SK3A 3F2KA 1BCMA 2GWKA 4JRPA 3NFAA 5CZ2A 1U04A 5IT9O 4YOVA 3H46O 4KFBA 5M1NA 2QWRA 2E6LA 1TVRA 2I7PA 3AY9A 4KKOA 3VA3A 5BRDA 4FWMA 4BQZA 3U3GA 4O55A 1FW6A 4CZFA 1SL0A 2E4LA 4CF2A 4BR7A 4DU4A 1VQPN 1OH5A 1U6ZA 3TSQA 3QFPA 3HT3A 3OBWA 5SWMA 2XY8A 3CJBA 3NH2A 4OLBA 2A41A 2E6MA 3ENBA 2YI1A 5J2QA 2GWJA 4YOUA 4EHTA 1U48A 3PIPL 1IH7A 4CJKA 1I94K 3O08A 4JS5A 3OYMA 5MLCQ 3BUZB 1RBUA 4FWLA 3E9OA 4YDUA 3TR8A 3K5MA 4HUFA 1JXBA 2NLXA 1GOBA 1RTJA 4FLTA 1K6YA 4YDUC 1RDDA 1T05A 4FVUA 1EO1A 1S3XA 3SUNA 2ETJA 4C23A 3NVKA 5BRFA 3L4QA 2OTJN 1RNHA 4M3ZA 4PQUA 3MX5A 3VQ8A 4KH6A 4IKFA 2QWMA 3ID8A 3OS0A 2KKZA 3MN9A 4AH9A 2PYLA 2RHKA 3T19A 3VQ7A 3OYDA 4KH4A 4F3TA 2YJEA 5CE3A 1OKJA 5AQRA 1YT3A 2UU9K 4CFCA 3BDPA 3D2FA 1Q86O 4I9LA 3ASMA 4LFCK 3S3MA 3K0SA 4CESA 3OJSA 2GBZA 4JK8A 3CD6N 4QOZB 4MO5A 1W9HA 3DRSA 4C1NI 4CGFA 1JCFA 3LP3A 4FZYA 1T7PA 2HNDA 2WOMA 4O5FA 4AHTA 4NB4A 3WT0A 1S1XA 5LJWA 3DLHA 2G8VA 5AQQA 4FVMA 4FLXA 5GADP 5AQFA 5AQJA 4UY8O 3H1QA 5CZ1A 4JI0K 3RR8A 3CCQN 1NK4A 1C0FA 3EKSA 4BGBA 3R8EA 2HW3A 2UXBK 1B92A 2GUPA 4M3XA 2H3GX 4EIAA 3BP8A 1CZBA 3DXKB 4BWJA 3AO2A 2HHHK 4MQ3A 4DV1K 4KHSA 1EP4A 2UYTA 4YNQA 2CH5A 4WFBL 3THWB 2GTDA 1U2VB 1KAYA 3MN6A 3NHGA 2HMIA 4R5PA 1EX4A 5I9EB 4MLEA 1GLBG 1BA1A 3AA3A 4M7XA 4FWQA 4DLEA 2E2QA 2ITMA 4F8RA 3AVMA 1NKBA 3ULDA 2OYQA 4KREA 4OKJA 5AQUA 4G9ZA 1JLAA 4LD0A 5KRSA 3ZT3A 3J7ZO 4FZZA 4DSJA 5AQGA 1SKSA 3AO4A 3KK1A 3ZYYX 4DTNA 2NRRA 4CZGA 2UXCK 3FGUA 4DU3A 1TK8A 3TANA 3B6OA 4DR6K 2ZD1A 4DTMA 1K9MO 4KB1A 2UUBK 2KZZA 2P9PA 1U47A 2YHWA 2D0BA 1S1WA 4B9QA 5KRTA 2RN2A 2ZJPL 4CIEA 4IBNA 4CIGA 2F9TA 5HROA 4EAHD 2QXFA 3VQ9A 5BPLA 2Q1NA 2WBNA 1FKOA 3CCRN 3I8BA 2P9KB 3OYFA 3FE1A 5HLFA 4M63C 2HHWA 3KLIA 3EL2A 3ZEUA 5DMRA 1N6QA 3NH0A 1LW2A 3ZETA 3ZSVA 3OTOK 3KLFA 4RCHA 3OS1A 1HNIA 1S9EA 4JI3K 3E9PA 1W0HA 4DHYA 1SV5A 2NRZA 2O8BA 3RMCA 4O0JA 2ITGA 3QLHA 2YHAA 4Q0BA 5GIPA 1N36K 1X9JA 3GL1A 2D1KA 4H8KA 1VQNN 3LDOA 1DEJA 1ILYA 1YHQN 2HHXA 1BQNA 1BOTO 3BGRA 1WLJA 5GAEP 1HKGA 4JD2B 4CEFA 4BRGA 5KPZA 1W2BM 1NKCA 4O4GA 4WQ4A 3G4SN 3LDQA 4IG0A 3OS2A 1HYSA 4FZXC 1VSIA 3VPZA 4CF0A 3V6DA 1RBVA 2P9UB 2PBDA 2VWBA 1TYQB 4IFVA 3LDLA 4WQ4C 3C6TA 4N76A 1S6QA 2IS3A 2BGGA 2HBLA 4E0DA 4ZTFA 4DR1K 3O4NA 1BCOA 2P51A 4BC4A 5JS1A 4CEQA 3DLBA 3JXUA 3CF5L 4HUEA 4DV6K 2Z1HA 3K5OA 4CJQA 3LM9A 3VOVA 3QERA 3A5MC 4CJ3A 4JKBA 4FJ7A 4YOWA 4HTUA 3WXMB 2RF2A 5T7BA 2AJQA 2YNIA 2PFUA 4RW8A 5AQXA 5AJ3K 4KAZA 4BRPA 1XWLA 3V9XA 4J2DA 4BDYA 3SQ0A 2YNFA 3QNOA 2RKIA 4PUOA 4BRMA 3AVLA 4NXNK 1JLGA 1VQLN 4A62A 4DV3K 4FJ5A 4DFMA 4E1NA 1J9AA 4PL8A 5FPDA 3A5OC 4FK4A 3VQDA 3KK3A 1ATRA 3OYJA 1RDBA 1YAGA 4BG9A 4CJ4A 4BR4A 1J6ZA 5C15A 2VQFK 5KQDA 5LMNK 5AZIB 1VRUA 3LP0A 1N32K 2IIRA 4ELVA 4ILGB 2HHVA 3CCVN 3ZX2A 4EP4A 4KB0A 5J2NA 2HNZA 3CERA 4IEEA 2Q2RA 3NGIA 4BR5A 4JK9A 1LOTB 3WXIA 2FBVA 4CZEA 2NRVA 4FJXA 4H0YB 4AHRA 2IVNA 3CPWM 4NYNA 3D2FB 3I33A 1TKZA 2EX3A 1ZBSA 4B08A 4WFNL 2XRIA 5GIOA 3T7ZA 4EHUA 3EYZA 2D0OA 3AVAA 3FZFA 4JKDA 1HJOA 5AQMA 1YF5L 2VG6A 5EX5A 4HHTA 4DQPA 5LL6Z 3RMDA 3J81O 1RDWX 4A57A 1WNSA 2G8UA 3KK2A 1SL1A 1X9WA 1EWQA 4K8XA 1TUUA 3OYIA 3ZSXA 3ZT1A 5LY3A 1NGGA 3ULEB 1NJXA 1VQ4N 3QEVA 3K59A 1OH8A 3F9MA 3L2RA 2WC9A 1NGDA 5LJVA 3CCJN 4DV5K 1KXPA 3BF1A 4DLGA 4JHDB 3UIQA 3V4IA 4DTXA 5EY4A 3MWPA 3TAEA 1YUWA 3MK6A 4JI7K 3OW2M 1HUXA 3CETA 2DFHA 1FKPA 1VQKN 1JL1A 2QWLA 4LC9B 1RGIA 2QWOA 3OYGA 3CI5A 4IOAL 4FW1A 5AQSA 3CCUN 4W5TA 1BWFO 2FSJA 4LSLA 2HVIA 2NRHA 1KSPA 2QTDA 1BUPA 3TU5A 4BROA 1S6PA 3O9QA 1GOCA 3MEGA 5BN9A 1N34K 4B9VA 3OYLA 3WQTA 3DXKA 1TL3A 2FLOA 2OPSA 4DQSA 2FSNA 3LWMA 1TAQA 4O5BA 4FWKA 1NWKA 3PSFA 4CHZA 4L8RB 3DOKA 3W0LA 3THWA 3S3OA 3KJVA 3O8MA 1X3MA 1NOYA 1NG9A 3LP2A 3HSTB 4E1JA 3V81A 3T1YK 2YHYA 3WXJA 3TWHA 1ZBUA 1TGOA 4X64K 4C8OA 4CEAA 1BU6O 3ZT4A 1RT3A 4FOEA 4PKIA 3DLEA 5FPEA 2YKNA 4CK2A 3J8AA 4BRAA 4OGEA 1TAUA 3TAGA 3U9DA 3CQXA 2IC3A 1A5XA 4L3QA 5BPMA 4N56A 4BDZA 3WUHA 4HVJA 4JKHA 4FJKA 2BTFA 1QSLA 5KPRA 2X6NA 1ITGA 1LV5A 3WNHA 3SBTA 2CGKA 4JV5K 3VMFB 4IJNA 2D0PA 4DS4A 4QS9A 3SMPA 1VQ7N 5H1SQ 3O9UA 5HRSA 4U67L 1WSGA 3AV9A 3GG4A 4CD1A 3QEPA 3HVRA 3RTVA 3KLHA 3ZSYA 4DR5K 3FZMA 2NNWA 2JLEA 5C2DA 2OPQA 4JI8K 4J2AA 1C6VA 4CW7B 2IOCA 3H3OB 1JL2A 4BRDA 4CJVA 1VK0A 3MDQA 1TL1A 1IKYA 4BGAA 5CR4A 1WB9A 2Z1JA 1ASVA 4CJWA 4A5AA 1GLFO 4O0IA 1M1KO 4DQRA 2VGNA 1EXQA 1K8KB 2VGMA 3VQBA 4DV2K 4BE1A 3WNGA 4JD2A 3ZSOA 2YCHA 1QQMA 3CC4N 1EKEA 1XC3A 1IV0A 1A5WA 3OYKA 5DM7L 4BREA 4FCYA 1QHAA 3SZ2A 1YVUA 3H3NO 3L8BA 4BC5A 4B1XB 1B9DA 5DM6L 2P9UA 2NRXA 5KGXA 1TYQA 3RMBA 4K0KK 1YITN 1DTTA 4LY7A 1NGHA 1EETA 1VSEA 1Y97A 3M8SA 1WSEA 4IJAA 4FLWA 2G8KA 1NK9A 3L0QA 1VHXA 2E2OA 1C1AA 1T44A 4WE1A 4DSIA 3AAQA 3LDNA 4DS5A 2P5GA 2F8SA 5HBMA 2KLAA 2E2PA 4CJRA 4RW7A 5BR8K 3P38A 3R9PA 4CEBA 4B3RK 3T1AA 2KW4A 1KFDA 3TAMA 3ALYA 3IUCA 4MDBA 1QSYA 3KVGA 3SI6A 1HNWK 4AHCA 3THXA 4J8FA 3HP9A 2Q31A 5EVZA 4AM6A 3ID6A 4CK1A 3QDKA 4U7BA 4DUZK 3RWUA 1K8AO 1U49A 3MAQA 4FYDA 1OVYA 1NU0A 2ZWHA 1RILA 3C0BA 5AQZA 3IFRA 3U4LA 2V51B 3I0SA 5CHIA 4B8CA 4ELUA 1HRHA 4XEIA 5AQYA 3VQ5A 4DQIA 1VSKA 4A5BA 4NLBA 3MMVA 3ZLJA 3A8YA 1RBRA 2A6AA 2HNYA 2I5JA 3IKMA 4IFYA 5AZIA 3O9SA 1T3VA 4LH5A 4E7HA 4AILC 5TKYA 1UA0A 4RWTA 3KTQA 3V9WA 1NGJA 2W42A 3ZCMA 3OJUA 4DG1A 1N8RO 3VQQA 4OVLA 2EWSA 3H6EA 3FR0A 1S5JA 2E1ZA 2BANA 3G71N 2FBXA 3CCEN 2QI2A 3V1QA 2W6LA 5EOYA 1M90O 4DF8A 1NMDA 1BI4B 4E7LA 3AAPA 3NH1A 2DY4A 3PUFA 5AQPA 4CZJA 2ZGZA 4MO4A 4C1NK 4IWVA 4IO9L 2HHSA 4O44A 3MXMA 1J5OA 3UKUA 3O4QA 5C2FA 4NXMK 1BGXT 2HVHA 3D7EO 1Y64A 1UOCA 3ULEA 1D5AA 4FWRA 3VEVA 2IDOA 2Y1IA 3MECA 1NNEA 3L3VA 5FRMA 4DCHA 1TK5A 4GV3A 1ZYQA 3DRPA 5GAHP 2ZM6K 3AVIA 4PY5A 4JHDA 4CJLA 1Q18A 3LDPA 3KK7A 3HYFA 2R7YA 4N41A 2VG5A 3OYCA 1V4SA 3LZJA 5FRNA 1ZBLA 3DM2A 2E5LK 3SCXA 3M8QA 4CFDA 4F4KA 3VGMA 4FW2A 4B1YB 1NGBA 3ENOA 3HJFA 3VETA 4DR3K 4BR0A 3VQCA 1TKTA 3T69A 4W5QA 2GX9A 2OA8A 1HMVA 1QQNA 2CH6A 4B3SK 1N5YA 5KTQA 2B6AA 1VSHA 2YHXA 4W5NA 1QZ5A 4CGDA 1RT1A 3UE5A 1SKWA 3V9ZA 1XNRK 1NGEA 3JS6A 3ZSQA 3KIOA 2NZTA 2HF3A 2NUBA 3PX6A 5IWAK 4LH4A 3AVGA 4I6MB 3SQ1A 3CHWA 1RDAA 3LAMA 5I42A 3LP1A 3H1VX 5ADXA 4AHVA 1YTUA 4RW4A 5AQTA 1IJJA 3GOIA 3SJJA 3NF6A 1L3VA 1MWKA 4M3RA 4B9TA 5KGWA 5C12A 1WAFA 3D2EB 3Q7CA 1CZ9A 1CXUA 4FOIA 1Q9XA 4M42A 2P5OA 3C94A 1QHTA 5JMVA 3UKRB 3HBTA 3EZWA 1J53A 4CJFA 3LL3A 4FK0A 3C7NB 3NE6A 3TTCA 2ZF5O 5GINA 2ZQBA 1HR0K 3AVNA 2W41A 3CJ1A 4CFBA 4DWIA 1NK6A 4ISGA 4FO0A 2A1RA 2E8AA 3R3LA 3DLKA 3T3FA 3VEOA 3ZX3A 4Y0WA 2OCEA 2PZSA 2JGUA 3VENA 3D6RA 4DUYK 1NBWA 4OKEA 4LF8K 4IXCA 4ISEA 3DLGA 3EEQA 3T1HK 1ZC6A 4FJ8A 2X6SA 1GLDG 3PSIA 3MCAB 2CGJA 4CZMA 1G15A 3O6WA 3ZSWA 1K8KA 4DU1A 4CEDA 2WFBA 3I56N 4DQ8A 5BRHA 4HWIA 3DMJA 3HL8A 2HHTA 3OHRA 5CYMA 2Z1GA 2P1JA 4H03B 3RMAA 1D8YA 4TSXA 1P90A 1VSFA 1FXXA 2B4JA 4DR2K 3TTFA 2HBMA 4FWNA 1BQMA 3AA2A 2XY7A 2P9SA 4CCHA 3TARA 3WNEA 4W5OA 3LPTA 4IOCL 3CXCM 4UQGA 3HPOA 4H4MA 1S9GA 4N5SA 3AO5A 1F21A 1QE1A 3OYBA 1QTMA 4JKAA 5F0XA 3THXB 1VSMA 3KWGA 3AVFA 3IS9A 4N47A 3DJCA 3DXMB 3SQ2A 1KAZA 2E2NA 3W3DA 3LALA 2QWNA 1BG3A 2V52B 4FJIA 5HRPA 3RRHA 3THVA 2KFNA 1HKBA 4MDAA 3O3GA 1WBDA 4H0OA 5HRNA 2I7NA 1BA0A 2XHBA 4NCAA 2OTLN 5C10A 3P4IA 4FPBA 4WCEL 3IG1A 2QW9A 1KLMA 4CI6A 3KLGA 3OYEA 3ZX0A 2OPPA 1RDUA 3PX0A 4H0PA 1HYZA 1P8ZA 3KKRA 2DTUA 3CCLN 2BH1A 1S22A 2FF3B 3PIOL 1LWEA 4M3UA 3CQ8A 3KWIA 5J1EA 1NGAA 1X9SA 4B9LA 3CIPA 4K41A 3OA9A 4QAGA 5LMUK 3H08A 3HVTA 5D3GA 1GLCG 4B3TK 2G8WA 4X65K 3IAYA 3DI6A 2GUIA 1GLAG 4GVEA 2OZMA 1TV6A 2HBKA 4BACA 4OO1J 1IO2A 4M3TA 1NLVA 1VSLA 3P83D 3WXKA 1E4GT 5BPNA 2BDPA 1C0UA 1Z6RA 3U3YA 2PAVA 3UKUB 5HOOA 1BIUA 4ISFA 4FXDA 1DTQA 3L6QA 1OH7A 3NF7A 1JJ2M 4DR4K 2P9IA 3HM8A 1BIZA 3AO1A 3CC2N 1BI4A 4OLAA 1NGIA 1H1VA 3HPGA 1HPMA 4CBUA 1VQON 1GOAA 3AVJA 1YJ9N 3VA0A 1X3NA 3CFPA 4OJRA 3QMLA 4AM7A 4EFHA 4BRKA 5HL7L 4B3OA 1RT6A 1UAXA 3JAMO 4KI6A 3SJHA 2AP1A 3THYB 4JN4A 2A42A 3LWLA 4ICLA 4ID5A 4JKFA 3MEEA 3V9UA 4LFAK 1BDGA 4DTOA 3P1GA 4LSNA 3DLRA 3AARA 4JI1K 1L3TA 1BISA 1OVQA 3S9HA 4M3WA 3J80O 1WSJA 4CEOA 5FLXO 1QQCA 1HQEA 2VCPA 1XNQK 5AZJB 3ATVA 3MX2A 1TK0A 1T8EA 4M41A 4JLHA 4H0VB 2ASOA 4DR7K 1R0AA 3CQYA 3K5LA 4KHYA 4KO0A 4H5TA 2Q36A 2QM1A 3TABA 1IBLK 1TUYA 1S1TA 2YX6A 4Z0UA 2ZE2A 4CJUA 1NKEA 4DFPA 4JKCA 5FROA 2O4GA 3HSCA 3VEXA 3NCIA 2P9NB 2QK9A 2IAJA 2XY5A 4DSFA 2FSKA 2QKKA 4OPAA 2HF4A 1EQYA 1MDUB 5JVGL 4KRFA 1QVFM 3VEWA 1S1VA 5C0YA 1KVAA 1NJIO 4A61A 4PWDA 3D45A 3LPUA 1DKGD 2JWLA 4ILJA 5HRRA 4M45A 4DMNA 3SPYA 3O3FA 2QWQA 3CJAA 4OPJA 3NGZA 4BG8A 4FLZA 3SQ4A 2HHQA 4K42A 4WQ5A 3WEEB 4FLUA 4AHUA 4DTUA 2A1SA 4PL7A 4DV0K 2V7YA 2ZGYA 4I6MA 3EY1A 3LANA 1IG8A 1HKCA 4LF7K 3HM9A 4DV4K 3SV4A 4WQ5C 5I3UA 4K25A 3MXJA 1WSHA 3N4QA 3O4WA 1YIJN 3BEXA 4E7IA 2QKBA 4AHSA 3AGKA 3FLCO 1KTQA 4AQYK 1KLNA 4LF5K 2ZJRL 1KRPA 4QCLA 2E88A 3D2EA 5C24A 3QICA 4KHUA 3E66A 1HNXK 2X78A 2DFFA 4B9SA 1WUAA 2EHGA 4FM0A 3FZLA 5AQLA 3H45C 1GLLO 3ENHA 1W7AA 3UKRA 3FZKA 3GDQA 3C7NA 4FJ9A 5JLHA 2ATQA 4JYAK 1JLBA 2XO7A 3SUOA 4HCBA 2W40A 4KH5A 2O8DB 3PY8A 4YFUA 1KFSA 4CK3A 4MLHA 3M6GA 5JS2A 2D0CA 3WNFA 1OH6A 2E20A 4F3OA 4G1QA 1SZ2A 2QWPA 4CZIA 4CHYA 4FJJA 1XMQK 3IMXA 3BF3A 1I39A 4ELTA 3TAQA 2A40A 4KPYA 4OPHA 1SAZA 3C6UA 1SKRA 1YXQA 3U6FA 3PO4A 3RSEB 4CD3A 1MWMA 2G8IA 2DPNA 2F8TA 2BUPA 1C1BA 3VQPA 2Q3SA 4B3MK 1A5VA 2KQ2A 3VF4A 1J54A 3I8DA 4Z4FA 2Y1JA 5A2QO 2P9SB 1BO5O 3VTHA 1ESVA 1NJWA 1QS4A 4CJSA 3S41A 2W6KA 1NJYA 1ZBFA 4B1ZA 4YOXA 4LF9K 4QS7A 2WONA 4CJTA 5M1PA 1YJWN 4IZ9A 4KV8A 3K9KA 3HXMA 2WTUA 5AQVA 1K73O 3VEYA 4CZHA 4IEIA 3E1YA 3AA4A 3CM6A 1VSDA 1C0TA 4JKGA 1XI1A 4YHHK 2AA4A 1DGKN 1S72N 4CEZA 1S1UA 3ATUA 4DSEA 5FPMA 5K14A 3OVNA 3IRXA 4CZKA 1J5EK 3DXMA 3V1OA 3O3HA 2G8FA 3TTDA 4FPAA 4BR9A 3IDHA 3E01A 4E1MA 1VAZA 1L5UA 1RBSA 4JI4K 3GBTA 4IFEA 4J2BA 1FJGK 2Q97A 4DSKA 4DTJA 3EE9A 3A0IX 3C65A 2RPIA 3RRGA 5AR0A 3GE1A 4C8NA 3L2QA 4XH5A 4FJMA 5AQWA 3NVMA 1E4FT 4CBXA 4YOYA 3RR7A 1G99A 1CZAN 3AGRA 4WF9L 4LFBK 3O1WA 3P31A 5E84A 3QESA 3P5JA 3M1FA 4JNEA 4CVNE 4CJEA 1T6CA 4CGGA 1Q81O 3CFRA 4CF8A 3I0RA 2P9IB 3PX4A 1X9MA 1RBTA 3SMSA 2YNHA 3G10A 1RTHA 2HHUA 3SBGA 3HK2A 2F4VK 2QXLA 1VRTA 1CXQA 2F7TA 4FL9A 1XC9A 2IVOA 4PHTX 4Z4CA 5AQOA 3FFKB 4Q5VA 1T6DA 3QIOA 2D5RA 1IBMK 4C8MA 4IG3A 4JS4A 1NK8A 1JLQA 3QFUA 4WYBA 4F9OA 4DTSA 3QNNA 3HP6A 1CLQA 1VSJA 4FJGA 4X62K 4HCCA 1I3AA 4FJNA 1V4TA 2IVPA 4GKJK 3C6HA 2YNGA 4H5NA 4CE9A 4J2EA 3ITHA 2FXUA 4BE0A 4KHWA 2HB5A 3THYA 3EO3A 3LDSA 1JXEA 1RTIA 4FM2A 2D0AA 4XIUA 3CJCA 4BC3A 2GEMA 3LM2A 4BWMA 1W97L 2NRTA 1SUQA 4BE2A 4FJLA 1NM1A 3ZT2A 3CCMN 5AFUH 4B8AB 3CJ7A 2ASPA 4BRHA 4HTLA 3WQUA 1VQMN 1Z25A 2DFEA 3QINA 5AZJA 3DAWA 3PLAA 1WSIA 4FWPA 4RTFD 4KTQA 3J7YP 4YY3K 2O8EB 3CMAN 2F9WA 1NMNA 4C8LA 4CGHA 3M3ZA 1ZBIA 2VWJA 1NOZA 1ASUA 3VF6A 3D0PA 4IOXA 4GW6A 2Z1IA 1KCFA 4E7KA 4E7JA 2P9NA 1LWCA 3HO1A 3CCSN 3SAHA 1NK7A 5AQHA 4I2QA 2GV9A 5M1FA 4CEEA 2FF6A 2Q0UA 1RT2A 3CM5A 1XMOK 1YTAA 3F73A 4E19A 3BY5A 3DYAA 1Z05A 1XUPO 3MXIA 2KHOA 4BQLA 3KHYA 3WEEA 4LF4K 4H5VA 2NRWA 1JCEA 4I2PA 4ILHA 1ZBHA 1WAJA 3BZCA 4GMJB 4CERA 5TKWA 3QEIA 1MA9B 3FZHA 1HPZA 1O1WA 3NF8A 1NK0A 4CJ7A 2O4IA 5AQKA 4DB3A 1U45A 2O8CB 2OPRA 3O80A 2O8FB 4B1WB 2KFZA 1TKDA 3TAPA 3OYHA 1JCGA 3ISNC 3NAEA 4C8KA 3AO3A 3MCPA 2ASMA 3M8RA 1KD1O 4H4OA 4Z94A 3DOLA 1IKXA 2G8HA 4WFAL 2RE2A 1XHZA 4CGIA 5C42A 4CHPA 2BE2A 2OZSA 4PKHA 1IG9A 5FPNA 2WUSA 3HOTA 3KD1E 1R59O 2O8DA 4H0TB 1XHXA 1QVGM 2KTQA 3M5RA 1TKXA 3NGYA 4AF1A 2VQEK 3TSUA 2HBJA 2OANA 3SUPA 3S3NA 5JVHL 5J2PA 3AVHA 4M7YA 1T03A 3R6MA 3AVKA 3G0ZA 3NF9A 4H0XB 4KTZA 3QBXA 4GY2B 3K5NA 5M1KA 1FK9A 3Q7BA 1BHLA 4Z4IA 4ID1A 3RSEA 4JK7A 3G6EN 4RG8A 2P9LB 4DTRA 3ZSZA 3CJ9A 3OBYA 4NO7A 2A3ZA 1KQSM 4BVPA 1Q9YA 3EN9A 1ZXOA 2Q0RA 5BN8A 4CZLA 4JKGB 5KQ8A 2FC0A 3N4PA 3B8AX 3MWTA 4IDHA 1SS6A 3JYTA 4JI6K 3QEWA 3AVCA 1WOQA 2HMPA 4CHOA 1IBKK 3E9LA 3OY9A 1UWBA 2UUCK 4I9QA 3SYZA 2PYJA 2YV0X 4BY9C 1Q7YO 1WN7A 3VERA 3O5BA 3K9JA 2VG7A 1NGCA 1QSSA 4NCBA 2YKMA 3KZBA 3V1RA 1LCUA 4FLVA 4DSLA 3EKUA 3QIPA 3FFIA 1LAWA 4JI2K 3VTIA 3L2UA 4CJ5A 5E41A 3QB0A 1D9DA 1XQSC 5GAGP 3VN5A 4BC2A 1JKHA 4DQQA 1DT9A 3TAFA 4EZ6A 1C0GA 1GLJO 3VEZA 3VF2A 4Z4HA 1NJZA 4KBOA 4RW6A 3J7AP 1WSFA 1IKWA 4PA1A 1D9FA 3QEXA 4CIFA 4BDPA 3V9SA 5KI6A 2A5XA 4OGCA 3NMUA 1RTDA 1KVBA 4NCGA 4CECA 5CYQA 3O9RA 4Y1DA 1Q82O 4CF1A 4JI5K 4BRLA 3BZKA 1HQUA 2PY5A 4M3YA 4CF9A 1DLOA 2FBTA
chains in the Genus database with same CATH topology
1NGJA 2E88A 1SQKA 3D2EA 3WXLA 4NLCA 3I8BA 4BRQA 2P9KB 3QICA 3FE1A 3E66A 3CCRN 1N8RO 2GELA 4M63C 2EWSA 1WUAA 3H6EA 3HTVA 3FZLA 5AQLA 3FR0A 3EL2A 3H45C 3ZEUA 1GLLO 2E1ZA 3ENHA 3G71N 3UKRA 3I55N 3CCEN 2QI2A 3ZETA 2E1YA 3FZKA 1QQOA 3RVCA 3GDQA 5EOYA 3C7NA 1M90O 5JLHA 1NMDA 4RCHA 5JICA 2V7ZA 3AAPA 3E9PA 4DHYA 1HX1A 2NRZA 2CGLA 2W40A 4KH5A 4BRCA 5B8HA 5AQPA 4CZJA 2ZGZA 3HRGA 4MO4A 1VQ5N 4C1NK 4IWVA 4MLHA 3M6GA 4IO9L 5GIPA 4IO8A 3O1BA 1X9JA 2E20A 3GL1A 2D1KA 3UKUA 5C2FA 1SZ2A 2QWPA 3LDOA 1DEJA 4JAXA 4CZIA 5KPTA 1YHQN 1VQNN 1ILYA 3D7EO 1ATSA 1Y64A 3IMXA 1BOTO 3BF3A 4FWRA 2A40A 3ULEA 3VEVA 5GAEP 4OPHA 1HKGA 3HI0A 4JD2B 1SAZA 3SAGA 4BRGA 1YXQA 5AQNA 3RSEB 4CD3A 1MWMA 5KPZA 2DPNA 5AFUA 4DCHA 2BUPA 1W2BM 4GV3A 5GAHP 4WQ4A 3G4SN 3LDQA 4GV9A 3VF4A 4JHDA 4BRFA 2P9SB 1KAXA 3VPZA 1BO5O 1Q18A 3VTHA 2P9UB 2PBDA 2VWBA 1TYQB 1ESVA 3LDLA 4FSVA 4WQ4C 5EXWA 4B1VA 3LDPA 3KK7A 2ZJQL 4PKGA 3S41A 1NGFA 2HBLA 2QA4N 1V4SA 4A59A 4B1ZA 4YOXA 4QS7A 4K43A 4BC4A 5M1PA 3JXUA 3CF5L 1YJWN 3VGMA 4B1YB 4IZ9A 3LM9A 3VOVA 3A5MC 1NGBA 3ENOA 3HOSA 4JKBA 3K9KA 4YOWA 1VQ8N 5AQVA 3VETA 1K73O 3VEYA 4BR0A 3WXMB 4JKEA 4IEIA 3E1YA 4CZHA 4XH4A 3T69A 4BR2A 2PFUA 2GX9A 5AQXA 4CBWA 1QQNA 2CH6A 4JKGA 1VQLN 4BRPA 1GLEG 2AA4A 1ATNA 1DGKN 1S72N 2YHXA 3C6AA 5M1OA 3ATUA 1QZ5A 1VQ6N 4BRMA 4O8UA 5FPMA 4GNIA 3UE5A 4CZKA 3MN7A 3DXMA 4A62A 4R79A 1NGEA 3JS6A 4FPAA 3TTDA 3IDHA 4BR9A 1VAZA 3VGKA 2HOEA 2NZTA 1U2VA 2HF3A 4PL8A 3GBTA 4IFEA 2D4WA 5FPDA 2JWKA 2Q97A 5F2RA 1YI2N 4I6MB 3CHWA 4A2AA 4BRNA 4GV6A 5AQIA 3A5OC 4JEPA 3H1VX 5ADXA 1ATRA 3A0IX 3C65A 1YAGA 3CPEA 2P9PB 3EE9A 3MN5A 4BG9A 5AR0A 3GE1A 3SLCA 5AQTA 1J6ZA 4BR4A 4XH5A 5C15A 5AQWA 1IJJA 3GOIA 3NVMA 1E4FT 5AZIB 5KQDA 4CBXA 4YOYA 4A2BA 1HLUA 3G25A 1G99A 1CZAN 1MWKA 2IIRA 3AGRA 4WF9L 4ILGB 5C12A 3CCVN 3O1WA 3ZX2A 3P31A 5E84A 3D2EB 3CERA 3Q7CA 3M1FA 4JNEA 4IEEA 4DQ8A 4H5RA 2Q2RA 3F5TA 4BR5A 4FOIA 1YVNA 4JK9A 1LOTB 3VGLA 3WXIA 3CMEN 1T6CA 4QS8A 1YJNN 3U8XA 2NRVA 4CZEA 3ZEUB 4H0YB 2IVNA 5JMVA 1Q81O 3L4IA 3CPWM 3UKRB 3HBTA 3EZWA 3D2FB 3ZETB 3LL3A 5ELZA 5ADXH 3I33A 2P9IB 3A5NC 3C7NB 5M1QA 3TTCA 2ZF5O 1ZBSA 5GINA 5E26A 1O13A 3SMSA 3CC7N 4WFNL 4BC3A 3T7ZA 5GIOA 4EHUA 3TSPA 2D0OA 3FZFA 4JKDA 5BR9A 1HJOA 5AQMA 2W41A 3CJ1A 1YF5L 4FWOA 4YORA 5EX5A 3SBGA 2QXLA 4BVOA 4ISGA 1RDWX 4FO0A 4A57A 2P9KA 2E8AA 4BRIA 2F7TA 4FL9A 2IVOA 3R3LA 3QBWA 4YOTA 4PHTX 5AQOA 5F1XA 3FFKB 1T6DA 3HZ6A 3R1XA 3VEOA 1TUUA 4B1UB 3UB5A 3TPQA 3ZX3A 5LY3A 1NGGA 3ULEB 1VQ4N 4Y0WA 3VENA 3D6RA 4H5WA 1NBWA 3F9MA 3QFUA 4WYBA 4IXCA 2J4RA 4F9OA 2WC9A 5BREA 1NGDA 4ISEA 5LJVA 3CCJN 4FWSA 1KXPA 2QEXN 1ZC6A 3BF1A 4JHDB 1QZ6A 1V4TA 2IVPA 3C6HA 1GLDG 4H5NA 5JLFA 3MCAB 5EY4A 2CGJA 2FXUA 4CZMA 3O6WA 3MWPA 3O9TA 3VESA 3EO3A 2HSTA 4XH1A 4DKWA 1YUWA 3EE8A 3MK6A 4O8KA 3SAFA 1K8KA 3OW2M 1HUXA 3CETA 2VYPA 1VQKN 2WFBA 2QWLA 4LC9B 3I56N 3CJCA 3DWLA 2GEMA 3LM2A 4HWIA 1RGIA 1W97L 2NRTA 2QWOA 3P39A 3A5LC 1KC8O 2YJFA 3CI5A 1NM1A 4IOAL 3OHRA 3U9ZA 3DLLL 4H03B 5AQSA 3CCUN 1P90A 2P9LA 3CCMN 1VQ9N 1RFQA 1BWFO 2FSJA 5AFUH 1D4XA 3CJ7A 2ASPA 4BRHA 4HTLA 3TTFA 2HBMA 4FWNA 3SK3A 3WQUA 3F2KA 2P9SA 1VQMN 2GWKA 5AZJA 2NRHA 3DAWA 4IOCL 3CXCM 2QTDA 3PLAA 4FWPA 1BUPA 3TU5A 4BROA 4YOVA 3H46O 3O9QA 4RTFD 5M1NA 2QWRA 3CMAN 5BN9A 4JKAA 2I7PA 2F9WA 5F0XA 3WQTA 3DXKA 3M3ZA 3AY9A 2FLOA 3KWGA 5BRDA 2FSNA 4FWMA 3DJCA 3DXMB 3VF6A 1KAZA 2E2NA 4BQZA 4FWKA 1NWKA 3W3DA 2QWNA 1BG3A 2V52B 4IOXA 4CZFA 4BR7A 3W0LA 1VQPN 1HKBA 4MDAA 1U6ZA 3TSQA 3QFPA 2P9NA 3O8MA 4H0OA 3OBWA 2I7NA 1BA0A 1X3MA 3CJBA 2OTLN 5C10A 3P4IA 4FPBA 4WCEL 3CCSN 2A41A 3SAHA 4E1JA 2QW9A 5AQHA 2YHYA 3ENBA 3WXJA 2YI1A 4CI6A 3ZX0A 5M1FA 2GWJA 4YOUA 1RDUA 1BU6O 4FOEA 4H0PA 1P8ZA 4EHTA 2FF6A 4PKIA 5FPEA 3PIPL 3CCLN 2Q0UA 2BH1A 3O08A 3J8AA 1S22A 4BRAA 2FF3B 5MLCQ 3BUZB 3PIOL 3U9DA 3CQXA 4FWLA 3E9OA 4YDUA 1Z05A 1XUPO 3KWIA 1NGAA 2KHOA 4BQLA 3CIPA 3KHYA 2NLXA 3WEEA 4K41A 4L3QA 3OA9A 5BPMA 4H5VA 2NRWA 4YDUC 1JCEA 4JKHA 3WUHA 1GLCG 4ILHA 2BTFA 5KPRA 4FVUA 1EO1A 5TKWA 1MA9B 3FZHA 1S3XA 3SBTA 2CGKA 4C23A 3NVKA 5BRFA 1GLAG 3L4QA 4GVEA 3VMFB 2OTJN 4IJNA 4CJ7A 5AQKA 4DB3A 2D0PA 3O80A 3MX5A 4QS9A 2HBKA 3SMPA 4B1WB 4OO1J 1VQ7N 4KH6A 2QWMA 3ID8A 5H1SQ 2KKZA 3MN9A 1NLVA 3O9UA 5BPNA 3WXKA 1E4GT 4U67L 1JCGA 2RHKA 4KH4A 5BRHA 3GG4A 4CD1A 1Z6RA 2YJEA 3MCPA 2ASMA 2PAVA 1KD1O 3UKUB 5CE3A 1OKJA 5AQRA 5HOOA 4Z94A 4ISFA 3L6QA 3D2FA 1Q86O 1JJ2M 3FZMA 4WFAL 2RE2A 2NNWA 2P9IA 5C2DA 3HM8A 3CC2N 1NGIA 1H1VA 4PKHA 1HPMA 4CBUA 1VQON 4JK8A 3H3OB 2WUSA 5FPNA 4MO5A 3HOTA 1R59O 1X3NA 1YJ9N 3CD6N 4C1NI 4BRDA 3QMLA 4H0TB 1JCFA 1QVGM 3M5RA 3MDQA 4AM7A 4AF1A 4BRKA 4EFHA 5HL7L 4BGAA 3TSUA 4O5FA 2HBJA 5CR4A 2OANA 3SJHA 4NB4A 5JVHL 3WT0A 2AP1A 4A5AA 1GLFO 5LJWA 4M7YA 1M1KO 4JN4A 2A42A 3R6MA 2VGNA 4JKFA 1K8KB 2VGMA 4H0XB 3QBXA 1BDGA 5AQQA 4GY2B 5GADP 5M1KA 3Q7BA 4JD2A 5AQJA 5AQFA 3H1QA 4UY8O 3AARA 2YCHA 1QQMA 4JK7A 3RSEA 3G6EN 3CC4N 1XC3A 2P9LB 3CCQN 3CJ9A 5DM7L 1C0FA 3EKSA 3OBYA 4BREA 1QHAA 2VCPA 2A3ZA 4NO7A 4BGBA 1KQSM 4BVPA 3H3NO 3R8EA 5AZJB 3ATVA 4BC5A 3EN9A 1ZXOA 4B1XB 2GUPA 3MX2A 5DM6L 2P9UA 2NRXA 2H3GX 1TYQA 2Q0RA 4EIAA 5BN8A 4H0VB 2ASOA 1YITN 3CQYA 3BP8A 4CZLA 4JKGB 5KQ8A 1NGHA 4H5TA 3N4PA 3DXKB 2Q36A 4IJAA 3B8AX 2QM1A 1SS6A 3L0QA 3MWTA 4IDHA 2E2OA 1T44A 1TUYA 3AAQA 1WOQA 2HMPA 2YX6A 3LDNA 2UYTA 3E9LA 2CH5A 4JKCA 2KLAA 2E2PA 3HSCA 4WFBL 3VEXA 2GTDA 3P38A 1U2VB 3R9PA 1KAYA 3MN6A 4BY9C 2P9NB 1Q7YO 5I9EB 3VERA 4MLEA 2FSKA 3O5BA 1GLBG 1BA1A 3K9JA 4M7XA 4FWQA 1NGCA 3IUCA 4OPAA 2HF4A 4MDBA 2E2QA 2ITMA 1EQYA 1MDUB 5JVGL 3KZBA 1QVFM 3VEWA 3KVGA 1LCUA 5C0YA 5AQUA 3EKUA 4J8FA 1NJIO 4G9ZA 2Q31A 5EVZA 4A61A 4AM6A 3ID6A 3QDKA 1DKGD 2JWLA 4U7BA 4ILJA 3VTIA 1K8AO 1OVYA 2ZWHA 3QB0A 3J7ZO 1XQSC 2QWQA 3CJAA 3C0BA 5GAGP 5AQGA 5AQZA 4BG8A 4BC2A 1DT9A 4K42A 4WQ5A 1C0GA 3WEEB 3ZYYX 1GLJO 3IFRA 3VEZA 3VF2A 3U4LA 2V51B 4KBOA 4PL7A 2NRRA 4CZGA 5CHIA 2V7YA 2ZGYA 3FGUA 4I6MA 4XEIA 1IG8A 1HKCA 4WQ5C 5AQYA 1K9MO 2A5XA 4A5BA 4K25A 3NMUA 2P9PA 3MMVA 3N4QA 3O4WA 4NLBA 1YIJN 3BEXA 2YHWA 3A8YA 2A6AA 5AZIA 3IKMA 4B9QA 3O9RA 3AGKA 3FLCO 2ZJPL 3O9SA 1T3VA 2ZJRL 2F9TA 1Q82O 4EAHD 4BRLA 5TKYA 5BPLA 4RWTA 2Q1NA 2WBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RE2 A;  2WFB A;  2KLA A;  1O13 A;  1EO1 A;  1P90 A;  2YX6 A;  2QTD A;  1RDU A;  1T3V A; 
#chains in the Genus database with same CATH topology
 1SQK A;  3WXL A;  4NLC A;  4BRQ A;  2GEL A;  1UA1 A;  3HTV A;  3CFO A;  4E3S A;  1JLC A;  1EWR A;  3I55 N;  2E1Y A;  1QQO A;  3RVC A;  5JIC A;  3QO9 A;  2V7Z A;  4DTP A;  1HX1 A;  3L2W A;  2CGL A;  4HUG A;  4BRC A;  5B8H A;  1Q8I A;  2FBY A;  4V19 S;  3HRG A;  1VQ5 N;  3SV3 A;  4K8Z A;  1HYV A;  3HPH A;  4KI4 A;  4IO8 A;  3O1B A;  4DFK A;  2F96 A;  5KPT A;  4JAX A;  4I7F A;  1REV A;  1ATS A;  1RCH A;  4IDK A;  5CY4 A;  3TI0 A;  3LAK A;  4DF4 A;  3HI0 A;  3SAG A;  4MFB A;  5AQN A;  1ASW A;  3ZT0 A;  5AFU A;  4OX9 K;  3K57 A;  4GKK K;  2KZM A;  1WBB A;  3KKS A;  1B9F A;  4GV9 A;  3L3U A;  4BRF A;  1KAX A;  3KLE A;  1X1P A;  4LF6 K;  4FSV A;  5EXW A;  4B1V A;  4KHQ A;  3B6P A;  3VQ6 A;  3NDK A;  2ZJQ L;  4PKG A;  1NGF A;  4F2R A;  2QA4 N;  1Z26 A;  4A59 A;  4ZHR A;  4K43 A;  1HNV A;  1HNZ K;  3ZSR A;  3MED A;  4NYF A;  4CJP A;  1RT7 A;  1U4B A;  3HOS A;  2UXD K;  4KHN A;  1VQ8 N;  2X74 A;  1L3S A;  1LAV A;  4JKE A;  4XH4 A;  4BR2 A;  3KD5 E;  1NK5 A;  4CBW A;  1GLE G;  2O8E A;  1ATN A;  3C6A A;  5M1O A;  1RT4 A;  1N33 K;  1VQ6 N;  4KHP K;  5EU7 A;  4CFA A;  4O8U A;  4B9M A;  4GNI A;  3MN7 A;  3VQE A;  4R79 A;  1LWF A;  4RW9 A;  4FK2 A;  3CYM A;  1E3M A;  3VGK A;  2HOE A;  3K58 A;  1U2V A;  4KTW A;  2D4W A;  4B9N A;  5C25 A;  4FJH A;  2JWK A;  1BL3 A;  5F2R A;  3SUQ A;  3PV8 A;  1YI2 N;  4A2A A;  4BRN A;  4GV6 A;  5AQI A;  4JEP A;  4CHQ A;  3CPE A;  2P9P B;  3MN5 A;  3SNN A;  3SLC A;  4EZ9 A;  2UUA K;  4A2B A;  4JRQ A;  3SPZ A;  1HLU A;  3CG7 A;  3G25 A;  3C95 A;  1IKV A;  3EZ5 A;  3QET A;  1HJR A;  3DRR A;  4EP5 A;  1L3U A;  5DK5 A;  4H5R A;  3F5T A;  1YVN A;  3VGL A;  2XY6 A;  3CME N;  4QS8 A;  1YJN N;  3U8X A;  4Z4G A;  3ZEU B;  3L4I A;  3ZET B;  5ELZ A;  5ADX H;  3A5N C;  5M1Q A;  3CC7 N;  5E26 A;  1O13 A;  2VWK A;  4DV7 K;  3F9K A;  3TSP A;  4OPK A;  4X66 K;  2O8C A;  2O8B B;  1SL2 A;  3VQ4 A;  5BR9 A;  1C0M A;  2O8F A;  4FWO A;  4YOR A;  3K2P A;  4BVO A;  2IGI A;  2P9K A;  4BRI A;  3QBW A;  4YOT A;  5F1X A;  2B5J A;  3HZ6 A;  4Z4E A;  3R1X A;  5SZT A;  1JLE A;  3PO5 A;  4B1U B;  3UB5 A;  3TPQ A;  4CGJ A;  3L2V A;  1MU2 A;  4CHN A;  4H5W A;  5FDL A;  3OYN A;  4W5R A;  4OKK A;  5BRE A;  2J4R A;  3A2F A;  3M8P A;  1C1C A;  3LZI A;  4FWS A;  2QEX N;  2LSN A;  5J2M A;  3AVB A;  1RT5 A;  4E89 A;  1QZ6 A;  5HP1 A;  4FM1 A;  3NBP A;  5JLF A;  4ZTJ A;  1LW0 A;  3O9T A;  3VES A;  1RDC A;  2HST A;  4XH1 A;  2YHB A;  4DKW A;  3EE8 A;  4F2S A;  4O8K A;  3SAF A;  4FLY A;  1JLF A;  3JSM A;  2VYP A;  3OYA A;  3DWL A;  3VQA A;  1KVC A;  3P39 A;  3A5L C;  4Y1C A;  4DFJ A;  2YJF A;  1KC8 O;  3U9Z A;  3DLL L;  3AA5 X;  4GVM A;  2P9L A;  1VQ9 N;  4B9U A;  1RFQ A;  1D4X A;  3SK3 A;  3F2K A;  1BCM A;  2GWK A;  4JRP A;  3NFA A;  5CZ2 A;  1U04 A;  5IT9 O;  4YOV A;  3H46 O;  4KFB A;  5M1N A;  2QWR A;  2E6L A;  1TVR A;  2I7P A;  3AY9 A;  4KKO A;  3VA3 A;  5BRD A;  4FWM A;  4BQZ A;  3U3G A;  4O55 A;  1FW6 A;  4CZF A;  1SL0 A;  2E4L A;  4CF2 A;  4BR7 A;  4DU4 A;  1VQP N;  1OH5 A;  1U6Z A;  3TSQ A;  3QFP A;  3HT3 A;  3OBW A;  5SWM A;  2XY8 A;  3CJB A;  3NH2 A;  4OLB A;  2A41 A;  2E6M A;  3ENB A;  2YI1 A;  5J2Q A;  2GWJ A;  4YOU A;  4EHT A;  1U48 A;  3PIP L;  1IH7 A;  4CJK A;  1I94 K;  3O08 A;  4JS5 A;  3OYM A;  5MLC Q;  3BUZ B;  1RBU A;  4FWL A;  3E9O A;  4YDU A;  3TR8 A;  3K5M A;  4HUF A;  1JXB A;  2NLX A;  1GOB A;  1RTJ A;  4FLT A;  1K6Y A;  4YDU C;  1RDD A;  1T05 A;  4FVU A;  1EO1 A;  1S3X A;  3SUN A;  2ETJ A;  4C23 A;  3NVK A;  5BRF A;  3L4Q A;  2OTJ N;  1RNH A;  4M3Z A;  4PQU A;  3MX5 A;  3VQ8 A;  4KH6 A;  4IKF A;  2QWM A;  3ID8 A;  3OS0 A;  2KKZ A;  3MN9 A;  4AH9 A;  2PYL A;  2RHK A;  3T19 A;  3VQ7 A;  3OYD A;  4KH4 A;  4F3T A;  2YJE A;  5CE3 A;  1OKJ A;  5AQR A;  1YT3 A;  2UU9 K;  4CFC A;  3BDP A;  3D2F A;  1Q86 O;  4I9L A;  3ASM A;  4LFC K;  3S3M A;  3K0S A;  4CES A;  3OJS A;  2GBZ A;  4JK8 A;  3CD6 N;  4QOZ B;  4MO5 A;  1W9H A;  3DRS A;  4C1N I;  4CGF A;  1JCF A;  3LP3 A;  4FZY A;  1T7P A;  2HND A;  2WOM A;  4O5F A;  4AHT A;  4NB4 A;  3WT0 A;  1S1X A;  5LJW A;  3DLH A;  2G8V A;  5AQQ A;  4FVM A;  4FLX A;  5GAD P;  5AQF A;  5AQJ A;  4UY8 O;  3H1Q A;  5CZ1 A;  4JI0 K;  3RR8 A;  3CCQ N;  1NK4 A;  1C0F A;  3EKS A;  4BGB A;  3R8E A;  2HW3 A;  2UXB K;  1B92 A;  2GUP A;  4M3X A;  2H3G X;  4EIA A;  3BP8 A;  1CZB A;  3DXK B;  4BWJ A;  3AO2 A;  2HHH K;  4MQ3 A;  4DV1 K;  4KHS A;  1EP4 A;  2UYT A;  4YNQ A;  2CH5 A;  4WFB L;  3THW B;  2GTD A;  1U2V B;  1KAY A;  3MN6 A;  3NHG A;  2HMI A;  4R5P A;  1EX4 A;  5I9E B;  4MLE A;  1GLB G;  1BA1 A;  3AA3 A;  4M7X A;  4FWQ A;  4DLE A;  2E2Q A;  2ITM A;  4F8R A;  3AVM A;  1NKB A;  3ULD A;  2OYQ A;  4KRE A;  4OKJ A;  5AQU A;  4G9Z A;  1JLA A;  4LD0 A;  5KRS A;  3ZT3 A;  3J7Z O;  4FZZ A;  4DSJ A;  5AQG A;  1SKS A;  3AO4 A;  3KK1 A;  3ZYY X;  4DTN A;  2NRR A;  4CZG A;  2UXC K;  3FGU A;  4DU3 A;  1TK8 A;  3TAN A;  3B6O A;  4DR6 K;  2ZD1 A;  4DTM A;  1K9M O;  4KB1 A;  2UUB K;  2KZZ A;  2P9P A;  1U47 A;  2YHW A;  2D0B A;  1S1W A;  4B9Q A;  5KRT A;  2RN2 A;  2ZJP L;  4CIE A;  4IBN A;  4CIG A;  2F9T A;  5HRO A;  4EAH D;  2QXF A;  3VQ9 A;  5BPL A;  2Q1N A;  2WBN A;  1FKO A;  3CCR N;  3I8B A;  2P9K B;  3OYF A;  3FE1 A;  5HLF A;  4M63 C;  2HHW A;  3KLI A;  3EL2 A;  3ZEU A;  5DMR A;  1N6Q A;  3NH0 A;  1LW2 A;  3ZET A;  3ZSV A;  3OTO K;  3KLF A;  4RCH A;  3OS1 A;  1HNI A;  1S9E A;  4JI3 K;  3E9P A;  1W0H A;  4DHY A;  1SV5 A;  2NRZ A;  2O8B A;  3RMC A;  4O0J A;  2ITG A;  3QLH A;  2YHA A;  4Q0B A;  5GIP A;  1N36 K;  1X9J A;  3GL1 A;  2D1K A;  4H8K A;  1VQN N;  3LDO A;  1DEJ A;  1ILY A;  1YHQ N;  2HHX A;  1BQN A;  1BOT O;  3BGR A;  1WLJ A;  5GAE P;  1HKG A;  4JD2 B;  4CEF A;  4BRG A;  5KPZ A;  1W2B M;  1NKC A;  4O4G A;  4WQ4 A;  3G4S N;  3LDQ A;  4IG0 A;  3OS2 A;  1HYS A;  4FZX C;  1VSI A;  3VPZ A;  4CF0 A;  3V6D A;  1RBV A;  2P9U B;  2PBD A;  2VWB A;  1TYQ B;  4IFV A;  3LDL A;  4WQ4 C;  3C6T A;  4N76 A;  1S6Q A;  2IS3 A;  2BGG A;  2HBL A;  4E0D A;  4ZTF A;  4DR1 K;  3O4N A;  1BCO A;  2P51 A;  4BC4 A;  5JS1 A;  4CEQ A;  3DLB A;  3JXU A;  3CF5 L;  4HUE A;  4DV6 K;  2Z1H A;  3K5O A;  4CJQ A;  3LM9 A;  3VOV A;  3QER A;  3A5M C;  4CJ3 A;  4JKB A;  4FJ7 A;  4YOW A;  4HTU A;  3WXM B;  2RF2 A;  5T7B A;  2AJQ A;  2YNI A;  2PFU A;  4RW8 A;  5AQX A;  5AJ3 K;  4KAZ A;  4BRP A;  1XWL A;  3V9X A;  4J2D A;  4BDY A;  3SQ0 A;  2YNF A;  3QNO A;  2RKI A;  4PUO A;  4BRM A;  3AVL A;  4NXN K;  1JLG A;  1VQL N;  4A62 A;  4DV3 K;  4FJ5 A;  4DFM A;  4E1N A;  1J9A A;  4PL8 A;  5FPD A;  3A5O C;  4FK4 A;  3VQD A;  3KK3 A;  1ATR A;  3OYJ A;  1RDB A;  1YAG A;  4BG9 A;  4CJ4 A;  4BR4 A;  1J6Z A;  5C15 A;  2VQF K;  5KQD A;  5LMN K;  5AZI B;  1VRU A;  3LP0 A;  1N32 K;  2IIR A;  4ELV A;  4ILG B;  2HHV A;  3CCV N;  3ZX2 A;  4EP4 A;  4KB0 A;  5J2N A;  2HNZ A;  3CER A;  4IEE A;  2Q2R A;  3NGI A;  4BR5 A;  4JK9 A;  1LOT B;  3WXI A;  2FBV A;  4CZE A;  2NRV A;  4FJX A;  4H0Y B;  4AHR A;  2IVN A;  3CPW M;  4NYN A;  3D2F B;  3I33 A;  1TKZ A;  2EX3 A;  1ZBS A;  4B08 A;  4WFN L;  2XRI A;  5GIO A;  3T7Z A;  4EHU A;  3EYZ A;  2D0O A;  3AVA A;  3FZF A;  4JKD A;  1HJO A;  5AQM A;  1YF5 L;  2VG6 A;  5EX5 A;  4HHT A;  4DQP A;  5LL6 Z;  3RMD A;  3J81 O;  1RDW X;  4A57 A;  1WNS A;  2G8U A;  3KK2 A;  1SL1 A;  1X9W A;  1EWQ A;  4K8X A;  1TUU A;  3OYI A;  3ZSX A;  3ZT1 A;  5LY3 A;  1NGG A;  3ULE B;  1NJX A;  1VQ4 N;  3QEV A;  3K59 A;  1OH8 A;  3F9M A;  3L2R A;  2WC9 A;  1NGD A;  5LJV A;  3CCJ N;  4DV5 K;  1KXP A;  3BF1 A;  4DLG A;  4JHD B;  3UIQ A;  3V4I A;  4DTX A;  5EY4 A;  3MWP A;  3TAE A;  1YUW A;  3MK6 A;  4JI7 K;  3OW2 M;  1HUX A;  3CET A;  2DFH A;  1FKP A;  1VQK N;  1JL1 A;  2QWL A;  4LC9 B;  1RGI A;  2QWO A;  3OYG A;  3CI5 A;  4IOA L;  4FW1 A;  5AQS A;  3CCU N;  4W5T A;  1BWF O;  2FSJ A;  4LSL A;  2HVI A;  2NRH A;  1KSP A;  2QTD A;  1BUP A;  3TU5 A;  4BRO A;  1S6P A;  3O9Q A;  1GOC A;  3MEG A;  5BN9 A;  1N34 K;  4B9V A;  3OYL A;  3WQT A;  3DXK A;  1TL3 A;  2FLO A;  2OPS A;  4DQS A;  2FSN A;  3LWM A;  1TAQ A;  4O5B A;  4FWK A;  1NWK A;  3PSF A;  4CHZ A;  4L8R B;  3DOK A;  3W0L A;  3THW A;  3S3O A;  3KJV A;  3O8M A;  1X3M A;  1NOY A;  1NG9 A;  3LP2 A;  3HST B;  4E1J A;  3V81 A;  3T1Y K;  2YHY A;  3WXJ A;  3TWH A;  1ZBU A;  1TGO A;  4X64 K;  4C8O A;  4CEA A;  1BU6 O;  3ZT4 A;  1RT3 A;  4FOE A;  4PKI A;  3DLE A;  5FPE A;  2YKN A;  4CK2 A;  3J8A A;  4BRA A;  4OGE A;  1TAU A;  3TAG A;  3U9D A;  3CQX A;  2IC3 A;  1A5X A;  4L3Q A;  5BPM A;  4N56 A;  4BDZ A;  3WUH A;  4HVJ A;  4JKH A;  4FJK A;  2BTF A;  1QSL A;  5KPR A;  2X6N A;  1ITG A;  1LV5 A;  3WNH A;  3SBT A;  2CGK A;  4JV5 K;  3VMF B;  4IJN A;  2D0P A;  4DS4 A;  4QS9 A;  3SMP A;  1VQ7 N;  5H1S Q;  3O9U A;  5HRS A;  4U67 L;  1WSG A;  3AV9 A;  3GG4 A;  4CD1 A;  3QEP A;  3HVR A;  3RTV A;  3KLH A;  3ZSY A;  4DR5 K;  3FZM A;  2NNW A;  2JLE A;  5C2D A;  2OPQ A;  4JI8 K;  4J2A A;  1C6V A;  4CW7 B;  2IOC A;  3H3O B;  1JL2 A;  4BRD A;  4CJV A;  1VK0 A;  3MDQ A;  1TL1 A;  1IKY A;  4BGA A;  5CR4 A;  1WB9 A;  2Z1J A;  1ASV A;  4CJW A;  4A5A A;  1GLF O;  4O0I A;  1M1K O;  4DQR A;  2VGN A;  1EXQ A;  1K8K B;  2VGM A;  3VQB A;  4DV2 K;  4BE1 A;  3WNG A;  4JD2 A;  3ZSO A;  2YCH A;  1QQM A;  3CC4 N;  1EKE A;  1XC3 A;  1IV0 A;  1A5W A;  3OYK A;  5DM7 L;  4BRE A;  4FCY A;  1QHA A;  3SZ2 A;  1YVU A;  3H3N O;  3L8B A;  4BC5 A;  4B1X B;  1B9D A;  5DM6 L;  2P9U A;  2NRX A;  5KGX A;  1TYQ A;  3RMB A;  4K0K K;  1YIT N;  1DTT A;  4LY7 A;  1NGH A;  1EET A;  1VSE A;  1Y97 A;  3M8S A;  1WSE A;  4IJA A;  4FLW A;  2G8K A;  1NK9 A;  3L0Q A;  1VHX A;  2E2O A;  1C1A A;  1T44 A;  4WE1 A;  4DSI A;  3AAQ A;  3LDN A;  4DS5 A;  2P5G A;  2F8S A;  5HBM A;  2KLA A;  2E2P A;  4CJR A;  4RW7 A;  5BR8 K;  3P38 A;  3R9P A;  4CEB A;  4B3R K;  3T1A A;  2KW4 A;  1KFD A;  3TAM A;  3ALY A;  3IUC A;  4MDB A;  1QSY A;  3KVG A;  3SI6 A;  1HNW K;  4AHC A;  3THX A;  4J8F A;  3HP9 A;  2Q31 A;  5EVZ A;  4AM6 A;  3ID6 A;  4CK1 A;  3QDK A;  4U7B A;  4DUZ K;  3RWU A;  1K8A O;  1U49 A;  3MAQ A;  4FYD A;  1OVY A;  1NU0 A;  2ZWH A;  1RIL A;  3C0B A;  5AQZ A;  3IFR A;  3U4L A;  2V51 B;  3I0S A;  5CHI A;  4B8C A;  4ELU A;  1HRH A;  4XEI A;  5AQY A;  3VQ5 A;  4DQI A;  1VSK A;  4A5B A;  4NLB A;  3MMV A;  3ZLJ A;  3A8Y A;  1RBR A;  2A6A A;  2HNY A;  2I5J A;  3IKM A;  4IFY A;  5AZI A;  3O9S A;  1T3V A;  4LH5 A;  4E7H A;  4AIL C;  5TKY A;  1UA0 A;  4RWT A;  3KTQ A;  3V9W A;  1NGJ A;  2W42 A;  3ZCM A;  3OJU A;  4DG1 A;  1N8R O;  3VQQ A;  4OVL A;  2EWS A;  3H6E A;  3FR0 A;  1S5J A;  2E1Z A;  2BAN A;  3G71 N;  2FBX A;  3CCE N;  2QI2 A;  3V1Q A;  2W6L A;  5EOY A;  1M90 O;  4DF8 A;  1NMD A;  1BI4 B;  4E7L A;  3AAP A;  3NH1 A;  2DY4 A;  3PUF A;  5AQP A;  4CZJ A;  2ZGZ A;  4MO4 A;  4C1N K;  4IWV A;  4IO9 L;  2HHS A;  4O44 A;  3MXM A;  1J5O A;  3UKU A;  3O4Q A;  5C2F A;  4NXM K;  1BGX T;  2HVH A;  3D7E O;  1Y64 A;  1UOC A;  3ULE A;  1D5A A;  4FWR A;  3VEV A;  2IDO A;  2Y1I A;  3MEC A;  1NNE A;  3L3V A;  5FRM A;  4DCH A;  1TK5 A;  4GV3 A;  1ZYQ A;  3DRP A;  5GAH P;  2ZM6 K;  3AVI A;  4PY5 A;  4JHD A;  4CJL A;  1Q18 A;  3LDP A;  3KK7 A;  3HYF A;  2R7Y A;  4N41 A;  2VG5 A;  3OYC A;  1V4S A;  3LZJ A;  5FRN A;  1ZBL A;  3DM2 A;  2E5L K;  3SCX A;  3M8Q A;  4CFD A;  4F4K A;  3VGM A;  4FW2 A;  4B1Y B;  1NGB A;  3ENO A;  3HJF A;  3VET A;  4DR3 K;  4BR0 A;  3VQC A;  1TKT A;  3T69 A;  4W5Q A;  2GX9 A;  2OA8 A;  1HMV A;  1QQN A;  2CH6 A;  4B3S K;  1N5Y A;  5KTQ A;  2B6A A;  1VSH A;  2YHX A;  4W5N A;  1QZ5 A;  4CGD A;  1RT1 A;  3UE5 A;  1SKW A;  3V9Z A;  1XNR K;  1NGE A;  3JS6 A;  3ZSQ A;  3KIO A;  2NZT A;  2HF3 A;  2NUB A;  3PX6 A;  5IWA K;  4LH4 A;  3AVG A;  4I6M B;  3SQ1 A;  3CHW A;  1RDA A;  3LAM A;  5I42 A;  3LP1 A;  3H1V X;  5ADX A;  4AHV A;  1YTU A;  4RW4 A;  5AQT A;  1IJJ A;  3GOI A;  3SJJ A;  3NF6 A;  1L3V A;  1MWK A;  4M3R A;  4B9T A;  5KGW A;  5C12 A;  1WAF A;  3D2E B;  3Q7C A;  1CZ9 A;  1CXU A;  4FOI A;  1Q9X A;  4M42 A;  2P5O A;  3C94 A;  1QHT A;  5JMV A;  3UKR B;  3HBT A;  3EZW A;  1J53 A;  4CJF A;  3LL3 A;  4FK0 A;  3C7N B;  3NE6 A;  3TTC A;  2ZF5 O;  5GIN A;  2ZQB A;  1HR0 K;  3AVN A;  2W41 A;  3CJ1 A;  4CFB A;  4DWI A;  1NK6 A;  4ISG A;  4FO0 A;  2A1R A;  2E8A A;  3R3L A;  3DLK A;  3T3F A;  3VEO A;  3ZX3 A;  4Y0W A;  2OCE A;  2PZS A;  2JGU A;  3VEN A;  3D6R A;  4DUY K;  1NBW A;  4OKE A;  4LF8 K;  4IXC A;  4ISE A;  3DLG A;  3EEQ A;  3T1H K;  1ZC6 A;  4FJ8 A;  2X6S A;  1GLD G;  3PSI A;  3MCA B;  2CGJ A;  4CZM A;  1G15 A;  3O6W A;  3ZSW A;  1K8K A;  4DU1 A;  4CED A;  2WFB A;  3I56 N;  4DQ8 A;  5BRH A;  4HWI A;  3DMJ A;  3HL8 A;  2HHT A;  3OHR A;  5CYM A;  2Z1G A;  2P1J A;  4H03 B;  3RMA A;  1D8Y A;  4TSX A;  1P90 A;  1VSF A;  1FXX A;  2B4J A;  4DR2 K;  3TTF A;  2HBM A;  4FWN A;  1BQM A;  3AA2 A;  2XY7 A;  2P9S A;  4CCH A;  3TAR A;  3WNE A;  4W5O A;  3LPT A;  4IOC L;  3CXC M;  4UQG A;  3HPO A;  4H4M A;  1S9G A;  4N5S A;  3AO5 A;  1F21 A;  1QE1 A;  3OYB A;  1QTM A;  4JKA A;  5F0X A;  3THX B;  1VSM A;  3KWG A;  3AVF A;  3IS9 A;  4N47 A;  3DJC A;  3DXM B;  3SQ2 A;  1KAZ A;  2E2N A;  3W3D A;  3LAL A;  2QWN A;  1BG3 A;  2V52 B;  4FJI A;  5HRP A;  3RRH A;  3THV A;  2KFN A;  1HKB A;  4MDA A;  3O3G A;  1WBD A;  4H0O A;  5HRN A;  2I7N A;  1BA0 A;  2XHB A;  4NCA A;  2OTL N;  5C10 A;  3P4I A;  4FPB A;  4WCE L;  3IG1 A;  2QW9 A;  1KLM A;  4CI6 A;  3KLG A;  3OYE A;  3ZX0 A;  2OPP A;  1RDU A;  3PX0 A;  4H0P A;  1HYZ A;  1P8Z A;  3KKR A;  2DTU A;  3CCL N;  2BH1 A;  1S22 A;  2FF3 B;  3PIO L;  1LWE A;  4M3U A;  3CQ8 A;  3KWI A;  5J1E A;  1NGA A;  1X9S A;  4B9L A;  3CIP A;  4K41 A;  3OA9 A;  4QAG A;  5LMU K;  3H08 A;  3HVT A;  5D3G A;  1GLC G;  4B3T K;  2G8W A;  4X65 K;  3IAY A;  3DI6 A;  2GUI A;  1GLA G;  4GVE A;  2OZM A;  1TV6 A;  2HBK A;  4BAC A;  4OO1 J;  1IO2 A;  4M3T A;  1NLV A;  1VSL A;  3P83 D;  3WXK A;  1E4G T;  5BPN A;  2BDP A;  1C0U A;  1Z6R A;  3U3Y A;  2PAV A;  3UKU B;  5HOO A;  1BIU A;  4ISF A;  4FXD A;  1DTQ A;  3L6Q A;  1OH7 A;  3NF7 A;  1JJ2 M;  4DR4 K;  2P9I A;  3HM8 A;  1BIZ A;  3AO1 A;  3CC2 N;  1BI4 A;  4OLA A;  1NGI A;  1H1V A;  3HPG A;  1HPM A;  4CBU A;  1VQO N;  1GOA A;  3AVJ A;  1YJ9 N;  3VA0 A;  1X3N A;  3CFP A;  4OJR A;  3QML A;  4AM7 A;  4EFH A;  4BRK A;  5HL7 L;  4B3O A;  1RT6 A;  1UAX A;  3JAM O;  4KI6 A;  3SJH A;  2AP1 A;  3THY B;  4JN4 A;  2A42 A;  3LWL A;  4ICL A;  4ID5 A;  4JKF A;  3MEE A;  3V9U A;  4LFA K;  1BDG A;  4DTO A;  3P1G A;  4LSN A;  3DLR A;  3AAR A;  4JI1 K;  1L3T A;  1BIS A;  1OVQ A;  3S9H A;  4M3W A;  3J80 O;  1WSJ A;  4CEO A;  5FLX O;  1QQC A;  1HQE A;  2VCP A;  1XNQ K;  5AZJ B;  3ATV A;  3MX2 A;  1TK0 A;  1T8E A;  4M41 A;  4JLH A;  4H0V B;  2ASO A;  4DR7 K;  1R0A A;  3CQY A;  3K5L A;  4KHY A;  4KO0 A;  4H5T A;  2Q36 A;  2QM1 A;  3TAB A;  1IBL K;  1TUY A;  1S1T A;  2YX6 A;  4Z0U A;  2ZE2 A;  4CJU A;  1NKE A;  4DFP A;  4JKC A;  5FRO A;  2O4G A;  3HSC A;  3VEX A;  3NCI A;  2P9N B;  2QK9 A;  2IAJ A;  2XY5 A;  4DSF A;  2FSK A;  2QKK A;  4OPA A;  2HF4 A;  1EQY A;  1MDU B;  5JVG L;  4KRF A;  1QVF M;  3VEW A;  1S1V A;  5C0Y A;  1KVA A;  1NJI O;  4A61 A;  4PWD A;  3D45 A;  3LPU A;  1DKG D;  2JWL A;  4ILJ A;  5HRR A;  4M45 A;  4DMN A;  3SPY A;  3O3F A;  2QWQ A;  3CJA A;  4OPJ A;  3NGZ A;  4BG8 A;  4FLZ A;  3SQ4 A;  2HHQ A;  4K42 A;  4WQ5 A;  3WEE B;  4FLU A;  4AHU A;  4DTU A;  2A1S A;  4PL7 A;  4DV0 K;  2V7Y A;  2ZGY A;  4I6M A;  3EY1 A;  3LAN A;  1IG8 A;  1HKC A;  4LF7 K;  3HM9 A;  4DV4 K;  3SV4 A;  4WQ5 C;  5I3U A;  4K25 A;  3MXJ A;  1WSH A;  3N4Q A;  3O4W A;  1YIJ N;  3BEX A;  4E7I A;  2QKB A;  4AHS A;  3AGK A;  3FLC O;  1KTQ A;  4AQY K;  1KLN A;  4LF5 K;  2ZJR L;  1KRP A;  4QCL A;  2E88 A;  3D2E A;  5C24 A;  3QIC A;  4KHU A;  3E66 A;  1HNX K;  2X78 A;  2DFF A;  4B9S A;  1WUA A;  2EHG A;  4FM0 A;  3FZL A;  5AQL A;  3H45 C;  1GLL O;  3ENH A;  1W7A A;  3UKR A;  3FZK A;  3GDQ A;  3C7N A;  4FJ9 A;  5JLH A;  2ATQ A;  4JYA K;  1JLB A;  2XO7 A;  3SUO A;  4HCB A;  2W40 A;  4KH5 A;  2O8D B;  3PY8 A;  4YFU A;  1KFS A;  4CK3 A;  4MLH A;  3M6G A;  5JS2 A;  2D0C A;  3WNF A;  1OH6 A;  2E20 A;  4F3O A;  4G1Q A;  1SZ2 A;  2QWP A;  4CZI A;  4CHY A;  4FJJ A;  1XMQ K;  3IMX A;  3BF3 A;  1I39 A;  4ELT A;  3TAQ A;  2A40 A;  4KPY A;  4OPH A;  1SAZ A;  3C6U A;  1SKR A;  1YXQ A;  3U6F A;  3PO4 A;  3RSE B;  4CD3 A;  1MWM A;  2G8I A;  2DPN A;  2F8T A;  2BUP A;  1C1B A;  3VQP A;  2Q3S A;  4B3M K;  1A5V A;  2KQ2 A;  3VF4 A;  1J54 A;  3I8D A;  4Z4F A;  2Y1J A;  5A2Q O;  2P9S B;  1BO5 O;  3VTH A;  1ESV A;  1NJW A;  1QS4 A;  4CJS A;  3S41 A;  2W6K A;  1NJY A;  1ZBF A;  4B1Z A;  4YOX A;  4LF9 K;  4QS7 A;  2WON A;  4CJT A;  5M1P A;  1YJW N;  4IZ9 A;  4KV8 A;  3K9K A;  3HXM A;  2WTU A;  5AQV A;  1K73 O;  3VEY A;  4CZH A;  4IEI A;  3E1Y A;  3AA4 A;  3CM6 A;  1VSD A;  1C0T A;  4JKG A;  1XI1 A;  4YHH K;  2AA4 A;  1DGK N;  1S72 N;  4CEZ A;  1S1U A;  3ATU A;  4DSE A;  5FPM A;  5K14 A;  3OVN A;  3IRX A;  4CZK A;  1J5E K;  3DXM A;  3V1O A;  3O3H A;  2G8F A;  3TTD A;  4FPA A;  4BR9 A;  3IDH A;  3E01 A;  4E1M A;  1VAZ A;  1L5U A;  1RBS A;  4JI4 K;  3GBT A;  4IFE A;  4J2B A;  1FJG K;  2Q97 A;  4DSK A;  4DTJ A;  3EE9 A;  3A0I X;  3C65 A;  2RPI A;  3RRG A;  5AR0 A;  3GE1 A;  4C8N A;  3L2Q A;  4XH5 A;  4FJM A;  5AQW A;  3NVM A;  1E4F T;  4CBX A;  4YOY A;  3RR7 A;  1G99 A;  1CZA N;  3AGR A;  4WF9 L;  4LFB K;  3O1W A;  3P31 A;  5E84 A;  3QES A;  3P5J A;  3M1F A;  4JNE A;  4CVN E;  4CJE A;  1T6C A;  4CGG A;  1Q81 O;  3CFR A;  4CF8 A;  3I0R A;  2P9I B;  3PX4 A;  1X9M A;  1RBT A;  3SMS A;  2YNH A;  3G10 A;  1RTH A;  2HHU A;  3SBG A;  3HK2 A;  2F4V K;  2QXL A;  1VRT A;  1CXQ A;  2F7T A;  4FL9 A;  1XC9 A;  2IVO A;  4PHT X;  4Z4C A;  5AQO A;  3FFK B;  4Q5V A;  1T6D A;  3QIO A;  2D5R A;  1IBM K;  4C8M A;  4IG3 A;  4JS4 A;  1NK8 A;  1JLQ A;  3QFU A;  4WYB A;  4F9O A;  4DTS A;  3QNN A;  3HP6 A;  1CLQ A;  1VSJ A;  4FJG A;  4X62 K;  4HCC A;  1I3A A;  4FJN A;  1V4T A;  2IVP A;  4GKJ K;  3C6H A;  2YNG A;  4H5N A;  4CE9 A;  4J2E A;  3ITH A;  2FXU A;  4BE0 A;  4KHW A;  2HB5 A;  3THY A;  3EO3 A;  3LDS A;  1JXE A;  1RTI A;  4FM2 A;  2D0A A;  4XIU A;  3CJC A;  4BC3 A;  2GEM A;  3LM2 A;  4BWM A;  1W97 L;  2NRT A;  1SUQ A;  4BE2 A;  4FJL A;  1NM1 A;  3ZT2 A;  3CCM N;  5AFU H;  4B8A B;  3CJ7 A;  2ASP A;  4BRH A;  4HTL A;  3WQU A;  1VQM N;  1Z25 A;  2DFE A;  3QIN A;  5AZJ A;  3DAW A;  3PLA A;  1WSI A;  4FWP A;  4RTF D;  4KTQ A;  3J7Y P;  4YY3 K;  2O8E B;  3CMA N;  2F9W A;  1NMN A;  4C8L A;  4CGH A;  3M3Z A;  1ZBI A;  2VWJ A;  1NOZ A;  1ASU A;  3VF6 A;  3D0P A;  4IOX A;  4GW6 A;  2Z1I A;  1KCF A;  4E7K A;  4E7J A;  2P9N A;  1LWC A;  3HO1 A;  3CCS N;  3SAH A;  1NK7 A;  5AQH A;  4I2Q A;  2GV9 A;  5M1F A;  4CEE A;  2FF6 A;  2Q0U A;  1RT2 A;  3CM5 A;  1XMO K;  1YTA A;  3F73 A;  4E19 A;  3BY5 A;  3DYA A;  1Z05 A;  1XUP O;  3MXI A;  2KHO A;  4BQL A;  3KHY A;  3WEE A;  4LF4 K;  4H5V A;  2NRW A;  1JCE A;  4I2P A;  4ILH A;  1ZBH A;  1WAJ A;  3BZC A;  4GMJ B;  4CER A;  5TKW A;  3QEI A;  1MA9 B;  3FZH A;  1HPZ A;  1O1W A;  3NF8 A;  1NK0 A;  4CJ7 A;  2O4I A;  5AQK A;  4DB3 A;  1U45 A;  2O8C B;  2OPR A;  3O80 A;  2O8F B;  4B1W B;  2KFZ A;  1TKD A;  3TAP A;  3OYH A;  1JCG A;  3ISN C;  3NAE A;  4C8K A;  3AO3 A;  3MCP A;  2ASM A;  3M8R A;  1KD1 O;  4H4O A;  4Z94 A;  3DOL A;  1IKX A;  2G8H A;  4WFA L;  2RE2 A;  1XHZ A;  4CGI A;  5C42 A;  4CHP A;  2BE2 A;  2OZS A;  4PKH A;  1IG9 A;  5FPN A;  2WUS A;  3HOT A;  3KD1 E;  1R59 O;  2O8D A;  4H0T B;  1XHX A;  1QVG M;  2KTQ A;  3M5R A;  1TKX A;  3NGY A;  4AF1 A;  2VQE K;  3TSU A;  2HBJ A;  2OAN A;  3SUP A;  3S3N A;  5JVH L;  5J2P A;  3AVH A;  4M7Y A;  1T03 A;  3R6M A;  3AVK A;  3G0Z A;  3NF9 A;  4H0X B;  4KTZ A;  3QBX A;  4GY2 B;  3K5N A;  5M1K A;  1FK9 A;  3Q7B A;  1BHL A;  4Z4I A;  4ID1 A;  3RSE A;  4JK7 A;  3G6E N;  4RG8 A;  2P9L B;  4DTR A;  3ZSZ A;  3CJ9 A;  3OBY A;  4NO7 A;  2A3Z A;  1KQS M;  4BVP A;  1Q9Y A;  3EN9 A;  1ZXO A;  2Q0R A;  5BN8 A;  4CZL A;  4JKG B;  5KQ8 A;  2FC0 A;  3N4P A;  3B8A X;  3MWT A;  4IDH A;  1SS6 A;  3JYT A;  4JI6 K;  3QEW A;  3AVC A;  1WOQ A;  2HMP A;  4CHO A;  1IBK K;  3E9L A;  3OY9 A;  1UWB A;  2UUC K;  4I9Q A;  3SYZ A;  2PYJ A;  2YV0 X;  4BY9 C;  1Q7Y O;  1WN7 A;  3VER A;  3O5B A;  3K9J A;  2VG7 A;  1NGC A;  1QSS A;  4NCB A;  2YKM A;  3KZB A;  3V1R A;  1LCU A;  4FLV A;  4DSL A;  3EKU A;  3QIP A;  3FFI A;  1LAW A;  4JI2 K;  3VTI A;  3L2U A;  4CJ5 A;  5E41 A;  3QB0 A;  1D9D A;  1XQS C;  5GAG P;  3VN5 A;  4BC2 A;  1JKH A;  4DQQ A;  1DT9 A;  3TAF A;  4EZ6 A;  1C0G A;  1GLJ O;  3VEZ A;  3VF2 A;  4Z4H A;  1NJZ A;  4KBO A;  4RW6 A;  3J7A P;  1WSF A;  1IKW A;  4PA1 A;  1D9F A;  3QEX A;  4CIF A;  4BDP A;  3V9S A;  5KI6 A;  2A5X A;  4OGC A;  3NMU A;  1RTD A;  1KVB A;  4NCG A;  4CEC A;  5CYQ A;  3O9R A;  4Y1D A;  1Q82 O;  4CF1 A;  4JI5 K;  4BRL A;  3BZK A;  1HQU A;  2PY5 A;  4M3Y A;  4CF9 A;  1DLO A;  2FBT A; 
#chains in the Genus database with same CATH homology
 1NGJ A;  2E88 A;  1SQK A;  3D2E A;  3WXL A;  4NLC A;  3I8B A;  4BRQ A;  2P9K B;  3QIC A;  3FE1 A;  3E66 A;  3CCR N;  1N8R O;  2GEL A;  4M63 C;  2EWS A;  1WUA A;  3H6E A;  3HTV A;  3FZL A;  5AQL A;  3FR0 A;  3EL2 A;  3H45 C;  3ZEU A;  1GLL O;  2E1Z A;  3ENH A;  3G71 N;  3UKR A;  3I55 N;  3CCE N;  2QI2 A;  3ZET A;  2E1Y A;  3FZK A;  1QQO A;  3RVC A;  3GDQ A;  5EOY A;  3C7N A;  1M90 O;  5JLH A;  1NMD A;  4RCH A;  5JIC A;  2V7Z A;  3AAP A;  3E9P A;  4DHY A;  1HX1 A;  2NRZ A;  2CGL A;  2W40 A;  4KH5 A;  4BRC A;  5B8H A;  5AQP A;  4CZJ A;  2ZGZ A;  3HRG A;  4MO4 A;  1VQ5 N;  4C1N K;  4IWV A;  4MLH A;  3M6G A;  4IO9 L;  5GIP A;  4IO8 A;  3O1B A;  1X9J A;  2E20 A;  3GL1 A;  2D1K A;  3UKU A;  5C2F A;  1SZ2 A;  2QWP A;  3LDO A;  1DEJ A;  4JAX A;  4CZI A;  5KPT A;  1YHQ N;  1VQN N;  1ILY A;  3D7E O;  1ATS A;  1Y64 A;  3IMX A;  1BOT O;  3BF3 A;  4FWR A;  2A40 A;  3ULE A;  3VEV A;  5GAE P;  4OPH A;  1HKG A;  3HI0 A;  4JD2 B;  1SAZ A;  3SAG A;  4BRG A;  1YXQ A;  5AQN A;  3RSE B;  4CD3 A;  1MWM A;  5KPZ A;  2DPN A;  5AFU A;  4DCH A;  2BUP A;  1W2B M;  4GV3 A;  5GAH P;  4WQ4 A;  3G4S N;  3LDQ A;  4GV9 A;  3VF4 A;  4JHD A;  4BRF A;  2P9S B;  1KAX A;  3VPZ A;  1BO5 O;  1Q18 A;  3VTH A;  2P9U B;  2PBD A;  2VWB A;  1TYQ B;  1ESV A;  3LDL A;  4FSV A;  4WQ4 C;  5EXW A;  4B1V A;  3LDP A;  3KK7 A;  2ZJQ L;  4PKG A;  3S41 A;  1NGF A;  2HBL A;  2QA4 N;  1V4S A;  4A59 A;  4B1Z A;  4YOX A;  4QS7 A;  4K43 A;  4BC4 A;  5M1P A;  3JXU A;  3CF5 L;  1YJW N;  3VGM A;  4B1Y B;  4IZ9 A;  3LM9 A;  3VOV A;  3A5M C;  1NGB A;  3ENO A;  3HOS A;  4JKB A;  3K9K A;  4YOW A;  1VQ8 N;  5AQV A;  3VET A;  1K73 O;  3VEY A;  4BR0 A;  3WXM B;  4JKE A;  4IEI A;  3E1Y A;  4CZH A;  4XH4 A;  3T69 A;  4BR2 A;  2PFU A;  2GX9 A;  5AQX A;  4CBW A;  1QQN A;  2CH6 A;  4JKG A;  1VQL N;  4BRP A;  1GLE G;  2AA4 A;  1ATN A;  1DGK N;  1S72 N;  2YHX A;  3C6A A;  5M1O A;  3ATU A;  1QZ5 A;  1VQ6 N;  4BRM A;  4O8U A;  5FPM A;  4GNI A;  3UE5 A;  4CZK A;  3MN7 A;  3DXM A;  4A62 A;  4R79 A;  1NGE A;  3JS6 A;  4FPA A;  3TTD A;  3IDH A;  4BR9 A;  1VAZ A;  3VGK A;  2HOE A;  2NZT A;  1U2V A;  2HF3 A;  4PL8 A;  3GBT A;  4IFE A;  2D4W A;  5FPD A;  2JWK A;  2Q97 A;  5F2R A;  1YI2 N;  4I6M B;  3CHW A;  4A2A A;  4BRN A;  4GV6 A;  5AQI A;  3A5O C;  4JEP A;  3H1V X;  5ADX A;  1ATR A;  3A0I X;  3C65 A;  1YAG A;  3CPE A;  2P9P B;  3EE9 A;  3MN5 A;  4BG9 A;  5AR0 A;  3GE1 A;  3SLC A;  5AQT A;  1J6Z A;  4BR4 A;  4XH5 A;  5C15 A;  5AQW A;  1IJJ A;  3GOI A;  3NVM A;  1E4F T;  5AZI B;  5KQD A;  4CBX A;  4YOY A;  4A2B A;  1HLU A;  3G25 A;  1G99 A;  1CZA N;  1MWK A;  2IIR A;  3AGR A;  4WF9 L;  4ILG B;  5C12 A;  3CCV N;  3O1W A;  3ZX2 A;  3P31 A;  5E84 A;  3D2E B;  3CER A;  3Q7C A;  3M1F A;  4JNE A;  4IEE A;  4DQ8 A;  4H5R A;  2Q2R A;  3F5T A;  4BR5 A;  4FOI A;  1YVN A;  4JK9 A;  1LOT B;  3VGL A;  3WXI A;  3CME N;  1T6C A;  4QS8 A;  1YJN N;  3U8X A;  2NRV A;  4CZE A;  3ZEU B;  4H0Y B;  2IVN A;  5JMV A;  1Q81 O;  3L4I A;  3CPW M;  3UKR B;  3HBT A;  3EZW A;  3D2F B;  3ZET B;  3LL3 A;  5ELZ A;  5ADX H;  3I33 A;  2P9I B;  3A5N C;  3C7N B;  5M1Q A;  3TTC A;  2ZF5 O;  1ZBS A;  5GIN A;  5E26 A;  1O13 A;  3SMS A;  3CC7 N;  4WFN L;  4BC3 A;  3T7Z A;  5GIO A;  4EHU A;  3TSP A;  2D0O A;  3FZF A;  4JKD A;  5BR9 A;  1HJO A;  5AQM A;  2W41 A;  3CJ1 A;  1YF5 L;  4FWO A;  4YOR A;  5EX5 A;  3SBG A;  2QXL A;  4BVO A;  4ISG A;  1RDW X;  4FO0 A;  4A57 A;  2P9K A;  2E8A A;  4BRI A;  2F7T A;  4FL9 A;  2IVO A;  3R3L A;  3QBW A;  4YOT A;  4PHT X;  5AQO A;  5F1X A;  3FFK B;  1T6D A;  3HZ6 A;  3R1X A;  3VEO A;  1TUU A;  4B1U B;  3UB5 A;  3TPQ A;  3ZX3 A;  5LY3 A;  1NGG A;  3ULE B;  1VQ4 N;  4Y0W A;  3VEN A;  3D6R A;  4H5W A;  1NBW A;  3F9M A;  3QFU A;  4WYB A;  4IXC A;  2J4R A;  4F9O A;  2WC9 A;  5BRE A;  1NGD A;  4ISE A;  5LJV A;  3CCJ N;  4FWS A;  1KXP A;  2QEX N;  1ZC6 A;  3BF1 A;  4JHD B;  1QZ6 A;  1V4T A;  2IVP A;  3C6H A;  1GLD G;  4H5N A;  5JLF A;  3MCA B;  5EY4 A;  2CGJ A;  2FXU A;  4CZM A;  3O6W A;  3MWP A;  3O9T A;  3VES A;  3EO3 A;  2HST A;  4XH1 A;  4DKW A;  1YUW A;  3EE8 A;  3MK6 A;  4O8K A;  3SAF A;  1K8K A;  3OW2 M;  1HUX A;  3CET A;  2VYP A;  1VQK N;  2WFB A;  2QWL A;  4LC9 B;  3I56 N;  3CJC A;  3DWL A;  2GEM A;  3LM2 A;  4HWI A;  1RGI A;  1W97 L;  2NRT A;  2QWO A;  3P39 A;  3A5L C;  1KC8 O;  2YJF A;  3CI5 A;  1NM1 A;  4IOA L;  3OHR A;  3U9Z A;  3DLL L;  4H03 B;  5AQS A;  3CCU N;  1P90 A;  2P9L A;  3CCM N;  1VQ9 N;  1RFQ A;  1BWF O;  2FSJ A;  5AFU H;  1D4X A;  3CJ7 A;  2ASP A;  4BRH A;  4HTL A;  3TTF A;  2HBM A;  4FWN A;  3SK3 A;  3WQU A;  3F2K A;  2P9S A;  1VQM N;  2GWK A;  5AZJ A;  2NRH A;  3DAW A;  4IOC L;  3CXC M;  2QTD A;  3PLA A;  4FWP A;  1BUP A;  3TU5 A;  4BRO A;  4YOV A;  3H46 O;  3O9Q A;  4RTF D;  5M1N A;  2QWR A;  3CMA N;  5BN9 A;  4JKA A;  2I7P A;  2F9W A;  5F0X A;  3WQT A;  3DXK A;  3M3Z A;  3AY9 A;  2FLO A;  3KWG A;  5BRD A;  2FSN A;  4FWM A;  3DJC A;  3DXM B;  3VF6 A;  1KAZ A;  2E2N A;  4BQZ A;  4FWK A;  1NWK A;  3W3D A;  2QWN A;  1BG3 A;  2V52 B;  4IOX A;  4CZF A;  4BR7 A;  3W0L A;  1VQP N;  1HKB A;  4MDA A;  1U6Z A;  3TSQ A;  3QFP A;  2P9N A;  3O8M A;  4H0O A;  3OBW A;  2I7N A;  1BA0 A;  1X3M A;  3CJB A;  2OTL N;  5C10 A;  3P4I A;  4FPB A;  4WCE L;  3CCS N;  2A41 A;  3SAH A;  4E1J A;  2QW9 A;  5AQH A;  2YHY A;  3ENB A;  3WXJ A;  2YI1 A;  4CI6 A;  3ZX0 A;  5M1F A;  2GWJ A;  4YOU A;  1RDU A;  1BU6 O;  4FOE A;  4H0P A;  1P8Z A;  4EHT A;  2FF6 A;  4PKI A;  5FPE A;  3PIP L;  3CCL N;  2Q0U A;  2BH1 A;  3O08 A;  3J8A A;  1S22 A;  4BRA A;  2FF3 B;  5MLC Q;  3BUZ B;  3PIO L;  3U9D A;  3CQX A;  4FWL A;  3E9O A;  4YDU A;  1Z05 A;  1XUP O;  3KWI A;  1NGA A;  2KHO A;  4BQL A;  3CIP A;  3KHY A;  2NLX A;  3WEE A;  4K41 A;  4L3Q A;  3OA9 A;  5BPM A;  4H5V A;  2NRW A;  4YDU C;  1JCE A;  4JKH A;  3WUH A;  1GLC G;  4ILH A;  2BTF A;  5KPR A;  4FVU A;  1EO1 A;  5TKW A;  1MA9 B;  3FZH A;  1S3X A;  3SBT A;  2CGK A;  4C23 A;  3NVK A;  5BRF A;  1GLA G;  3L4Q A;  4GVE A;  3VMF B;  2OTJ N;  4IJN A;  4CJ7 A;  5AQK A;  4DB3 A;  2D0P A;  3O80 A;  3MX5 A;  4QS9 A;  2HBK A;  3SMP A;  4B1W B;  4OO1 J;  1VQ7 N;  4KH6 A;  2QWM A;  3ID8 A;  5H1S Q;  2KKZ A;  3MN9 A;  1NLV A;  3O9U A;  5BPN A;  3WXK A;  1E4G T;  4U67 L;  1JCG A;  2RHK A;  4KH4 A;  5BRH A;  3GG4 A;  4CD1 A;  1Z6R A;  2YJE A;  3MCP A;  2ASM A;  2PAV A;  1KD1 O;  3UKU B;  5CE3 A;  1OKJ A;  5AQR A;  5HOO A;  4Z94 A;  4ISF A;  3L6Q A;  3D2F A;  1Q86 O;  1JJ2 M;  3FZM A;  4WFA L;  2RE2 A;  2NNW A;  2P9I A;  5C2D A;  3HM8 A;  3CC2 N;  1NGI A;  1H1V A;  4PKH A;  1HPM A;  4CBU A;  1VQO N;  4JK8 A;  3H3O B;  2WUS A;  5FPN A;  4MO5 A;  3HOT A;  1R59 O;  1X3N A;  1YJ9 N;  3CD6 N;  4C1N I;  4BRD A;  3QML A;  4H0T B;  1JCF A;  1QVG M;  3M5R A;  3MDQ A;  4AM7 A;  4AF1 A;  4BRK A;  4EFH A;  5HL7 L;  4BGA A;  3TSU A;  4O5F A;  2HBJ A;  5CR4 A;  2OAN A;  3SJH A;  4NB4 A;  5JVH L;  3WT0 A;  2AP1 A;  4A5A A;  1GLF O;  5LJW A;  4M7Y A;  1M1K O;  4JN4 A;  2A42 A;  3R6M A;  2VGN A;  4JKF A;  1K8K B;  2VGM A;  4H0X B;  3QBX A;  1BDG A;  5AQQ A;  4GY2 B;  5GAD P;  5M1K A;  3Q7B A;  4JD2 A;  5AQJ A;  5AQF A;  3H1Q A;  4UY8 O;  3AAR A;  2YCH A;  1QQM A;  4JK7 A;  3RSE A;  3G6E N;  3CC4 N;  1XC3 A;  2P9L B;  3CCQ N;  3CJ9 A;  5DM7 L;  1C0F A;  3EKS A;  3OBY A;  4BRE A;  1QHA A;  2VCP A;  2A3Z A;  4NO7 A;  4BGB A;  1KQS M;  4BVP A;  3H3N O;  3R8E A;  5AZJ B;  3ATV A;  4BC5 A;  3EN9 A;  1ZXO A;  4B1X B;  2GUP A;  3MX2 A;  5DM6 L;  2P9U A;  2NRX A;  2H3G X;  1TYQ A;  2Q0R A;  4EIA A;  5BN8 A;  4H0V B;  2ASO A;  1YIT N;  3CQY A;  3BP8 A;  4CZL A;  4JKG B;  5KQ8 A;  1NGH A;  4H5T A;  3N4P A;  3DXK B;  2Q36 A;  4IJA A;  3B8A X;  2QM1 A;  1SS6 A;  3L0Q A;  3MWT A;  4IDH A;  2E2O A;  1T44 A;  1TUY A;  3AAQ A;  1WOQ A;  2HMP A;  2YX6 A;  3LDN A;  2UYT A;  3E9L A;  2CH5 A;  4JKC A;  2KLA A;  2E2P A;  3HSC A;  4WFB L;  3VEX A;  2GTD A;  3P38 A;  1U2V B;  3R9P A;  1KAY A;  3MN6 A;  4BY9 C;  2P9N B;  1Q7Y O;  5I9E B;  3VER A;  4MLE A;  2FSK A;  3O5B A;  1GLB G;  1BA1 A;  3K9J A;  4M7X A;  4FWQ A;  1NGC A;  3IUC A;  4OPA A;  2HF4 A;  4MDB A;  2E2Q A;  2ITM A;  1EQY A;  1MDU B;  5JVG L;  3KZB A;  1QVF M;  3VEW A;  3KVG A;  1LCU A;  5C0Y A;  5AQU A;  3EKU A;  4J8F A;  1NJI O;  4G9Z A;  2Q31 A;  5EVZ A;  4A61 A;  4AM6 A;  3ID6 A;  3QDK A;  1DKG D;  2JWL A;  4U7B A;  4ILJ A;  3VTI A;  1K8A O;  1OVY A;  2ZWH A;  3QB0 A;  3J7Z O;  1XQS C;  2QWQ A;  3CJA A;  3C0B A;  5GAG P;  5AQG A;  5AQZ A;  4BG8 A;  4BC2 A;  1DT9 A;  4K42 A;  4WQ5 A;  1C0G A;  3WEE B;  3ZYY X;  1GLJ O;  3IFR A;  3VEZ A;  3VF2 A;  3U4L A;  2V51 B;  4KBO A;  4PL7 A;  2NRR A;  4CZG A;  5CHI A;  2V7Y A;  2ZGY A;  3FGU A;  4I6M A;  4XEI A;  1IG8 A;  1HKC A;  4WQ5 C;  5AQY A;  1K9M O;  2A5X A;  4A5B A;  4K25 A;  3NMU A;  2P9P A;  3MMV A;  3N4Q A;  3O4W A;  4NLB A;  1YIJ N;  3BEX A;  2YHW A;  3A8Y A;  2A6A A;  5AZI A;  3IKM A;  4B9Q A;  3O9R A;  3AGK A;  3FLC O;  2ZJP L;  3O9S A;  1T3V A;  2ZJR L;  2F9T A;  1Q82 O;  4EAH D;  4BRL A;  5TKY A;  5BPL A;  4RWT A;  2Q1N A;  2WBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...