1T3VA

The nmr solution structure of tm1816
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHHHEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure determination of the conserved hypothetical protein TM1816 from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1t3vA01
1T3VA 1EO1A 2KLAA 2QTDA 2YX6A 2RE2A 2WFBA 1O13A 1RDUA 1P90A
chains in the Genus database with same CATH superfamily
4B9NA 4CZIA 3K59A 1P8ZA 2F4VK 3LP1A 3O08A 3A5MC 3QFUA 4JI2K 1HYZA 1OH7A 3VQPA 4DSKA 1Q82O 5AQRA 4DFMA 3V1RA 2PZSA 1NBWA 4I2PA 4CJ5A 4CF8A 3DJCA 5FPDA 3F73A 3O9TA 1OH8A 4DSJA 5IWAK 4B3OA 5AQPA 3SBGA 4F8RA 5BRHA 4CHOA 4FYDA 4LFAK 1EX4A 3M6GA 4FLXA 1GLFO 4C8MA 1IJJA 2FC0A 1CZ9A 4FLYA 4ZTFA 3SUQA 3B6OA 3KLGA 4L3QA 3ZSOA 3DXMB 3MWTA 3GG4A 3U9DA 1U48A 3QIOA 2G8KA 1HPZA 4H5WA 3QO9A 3KLIA 3QICA 3R8EA 3V4IA 5ELZA 3VGMA 4RTFD 4BVOA 4EP5A 2W6KA 2ITGA 3FFIA 1D4XA 3E1YA 3TAPA 1HJRA 3K5LA 4CK1A 3SPYA 2YHXA 3ZSQA 3RR8A 1ASVA 4JKHA 5ADXA 2O8FB 2P9KB 3WQUA 2HHSA 4DUZK 3WQTA 2VWBA 4H8KA 1QSSA 3OS2A 4RCHA 3TAMA 3VQBA 3D0PA 3CJAA 1HLUA 1VQ4N 1VSFA 1IKVA 3T69A 2D5RA 2VWKA 2HBKA 3SAFA 1YXQA 2HBMA 4QCLA 1LOTB 2UXCK 5GIOA 3ZT0A 4W5RA 4H0PA 1FKOA 3OYJA 5TKWA 1NGIA 3FR0A 1H1VA 3KLEA 4C1NI 4CJEA 1YF5L 3KTQA 3QETA 4CEEA 4JK7A 4KHSA 2VGNA 4FK2A 1NNEA 1BO5O 3O1WA 3HRGA 4CZEA 3PIPL 4I9LA 3T1YK 3U3GA 3LP0A 4NYNA 4HTLA 1GOBA 3I8BA 3MCPA 4FJNA 5AQZA 3OVNA 1YTAA 4BWMA 4DHYA 3DRSA 3T1HK 4Z94A 1RDDA 5KQDA 4KBOA 1C1BA 4DU3A 4BGAA 1NKEA 3FE1A 4PQUA 3SJJA 4DTUA 4DKWA 2X6SA 4IOXA 2IGIA 2RHKA 3CM6A 5CZ1A 4FJ8A 3ULEB 1DTTA 4GVMA 2OYQA 5AQFA 2VQEK 5F2RA 3AA2A 4AHUA 5CHIA 5BREA 3SQ2A 3VQ5A 3CFRA 3QLHA 3VETA 1ZBLA 2ITMA 2GWJA 3IS9A 3VERA 3OTOK 3AO2A 3R6MA 1IBLK 3VA3A 2RF2A 3DXMA 2JGUA 4YY3K 1D9DA 1XNRK 4IG3A 3G6EN 4CK2A 3R3LA 2XO7A 2V7ZA 3VEVA 2ASPA 1YUWA 5LMUK 2NZTA 2Z1GA 3HT3A 4B8AB 2KFZA 2JLEA 3OYMA 4XH1A 2CH5A 3HP9A 3RSEA 3S9HA 3AA5X 2AJQA 1X9MA 3LM9A 3THWA 1QE1A 3TSUA 1L3SA 4CGIA 1HKGA 4DQPA 1MU2A 1VSMA 5LMNK 2BUPA 1SUQA 3OYNA 1WAJA 3MEGA 2KLAA 4MLEA 3NF7A 3CF5L 3QNNA 3VQEA 2E20A 2ATQA 3VEZA 1S9GA 1RDCA 3HOSA 5JS2A 3PY8A 1C0FA 1TAQA 4CIEA 4HUGA 3VEWA 3S3OA 1YVNA 3N4QA 1Z26A 4RW4A 3G71N 1NOYA 2F8SA 3CHWA 1C1AA 4KHUA 4DR5K 4AHVA 1KVAA 3O4WA 4ILGB 1Q9XA 3OYLA 4EFHA 3L4IA 2Q0RA 4FOEA 3CD6N 4Z4HA 2CGLA 3UKUB 4BACA 4K8XA 2O8BA 4PL7A 2B6AA 4DF8A 3VQ8A 5BR9A 4CF9A 4CF1A 4E7HA 2OPSA 1GLLO 3JS6A 4A2AA 4GKKK 3D45A 3TSPA 4OKKA 1Q18A 2FBVA 2OPPA 3K9KA 4O0JA 2P9PB 3TWHA 4WF9L 3IDHA 2WTUA 1RTJA 3HP6A 1ESVA 2HW3A 3HPHA 2QWLA 5FRMA 3DLRA 3NFAA 4IFVA 4CERA 5JLHA 1NK8A 1NKBA 4JD2B 3THXA 3MX2A 2I5JA 2BTFA 5K14A 5AZJB 4E3SA 3LP3A 2NRWA 1RT3A 3KHYA 3GL1A 4DS5A 2JWKA 2NRXA 4B3TK 4F9OA 4EHUA 3BGRA 4Z4GA 4CCHA 1QZ5A 3K5MA 4W5OA 4FWMA 3MDQA 2PBDA 4M3RA 5FLXO 4DTPA 4IJNA 3SPZA 4M3TA 3K2PA 1N5YA 4CBUA 4HUEA 1OKJA 4M3ZA 4FZXC 2P5OA 1N6QA 2E2NA 1BWFO 3TTFA 1VQ6N 3LWLA 3C65A 2QXLA 4OO1J 4PL8A 4CIGA 3U4LA 4BC5A 1LWEA 4B9VA 4H4OA 4NB4A 3C94A 2ZM6K 1F21A 1SAZA 5DK5A 5EY4A 1WSFA 3KK2A 3DLLL 3THVA 4A5AA 2YHAA 3DLGA 1QVGM 1U2VA 4DMNA 4IO8A 1TKDA 4BQLA 3WXIA 4DV0K 3ENOA 4WFBL 4IJAA 4CE9A 4B08A 1SQKA 2QTDA 2NLXA 5KTQA 2HVHA 1S1TA 1TK0A 3SCXA 2I7NA 5AQJA 3ZSXA 1QQMA 3V81A 3HK2A 4BR4A 3H1VX 5FDLA 3HM8A 2EHGA 4OLBA 4BC2A 1NMNA 3MK6A 1VSJA 5EX5A 3AV9A 5FPEA 4YNQA 4MLHA 3KK3A 3L4QA 2GEMA 4CI6A 3ZEUA 1VQLN 2DFHA 3O9QA 3LDNA 3FZMA 2YJEA 2XHBA 3CCUN 1HYSA 5BPMA 2KZZA 2HHUA 4A5BA 3J80O 4E19A 1GLJO 3G4SN 2ZGZA 3DM2A 2RKIA 2NRVA 2Q3SA 2YJFA 4ILJA 4Y0WA 1VQ8N 3VGKA 4H03B 3P39A 1S6QA 1QZ6A 1ASWA 3DLKA 5BN9A 3NBPA 1RT4A 1SKRA 3O4QA 3OJSA 4KB1A 3HTVA 1OH5A 3BF3A 3HZ6A 3ZT4A 5AFUH 4XH4A 3OW2M 1YAGA 1REVA 4B3SK 2E2OA 1KAYA 3EYZA 1IKXA 3EE9A 3E66A 3ZLJA 2A5XA 1NGDA 4JI1K 1C6VA 4KKOA 3WXLA 5LL6Z 4FSVA 4LF7K 2P9NB 3THYA 2P9SA 4UQGA 3FLCO 2JWLA 4H0XB 3TAEA 1T03A 3LP2A 1BUPA 4FJ5A 2A42A 4DWIA 4RG8A 4FW1A 4JS4A 1RCHA 3CCRN 3PV8A 3NH2A 5SZTA 4HCCA 3UKRA 2Q1NA 4W5QA 1TYQB 3J7AP 1HX1A 4CF2A 3AO4A 4BR2A 3QERA 1KAZA 3WXMB 4AH9A 4CFBA 4DB3A 4F2RA 3ID6A 3NHGA 4DSIA 4WFAL 1T05A 4H5TA 1V4SA 1ZBFA 4CEQA 3E9OA 4O5BA 4ISEA 2ZGYA 1EXQA 3OYGA 5AQXA 5C15A 5AJ3K 3QEIA 4J2DA 2QKKA 1IO2A 2ZJRL 1K8KB 2YKNA 3BF1A 3NF6A 4ELVA 3ULDA 2NUBA 3ATUA 3CCMN 2G8UA 3ZSVA 4E89A 4FXDA 4YHHK 1NJYA 3SQ1A 2OANA 2Q0UA 4YFUA 4DSEA 3HVTA 1NK0A 2BH1A 3P38A 3V6DA 4PA1A 3JYTA 4B8CA 1KVCA 1RT2A 3OYAA 4O0IA 3HYFA 3O80A 1S1VA 1QTMA 2FBYA 2QWOA 4BRQA 1IKYA 2HHTA 3SUNA 1K8KA 1DEJA 2RE2A 3OYEA 4EHTA 5KGWA 5GAHP 4KB0A 4H5RA 3L2UA 1WSHA 4JKGA 2IC3A 4H5NA 3OS1A 1IBMK 3CFPA 3AA3A 2E2PA 3QB0A 1JXBA 5MLCQ 2IVPA 3HO1A 3VTIA 4CZFA 4CJKA 4CBWA 2UU9K 2YCHA 1J54A 1HQUA 4PWDA 5J1EA 4HWIA 3CG7A 3S3MA 4QS9A 5TKYA 3KD1E 3A0IX 3K5OA 3D2EA 4YOWA 3SZ2A 3IUCA 1EETA 1NK5A 4EIAA 1M90O 1N36K 1NGCA 4CJVA 1S6PA 4B9LA 3KKSA 4BE0A 4WQ4A 4JNEA 2GX9A 4NCAA 5KPTA 4CJ7A 4M45A 4RW8A 1WB9A 4NXNK 3ID8A 2KTQA 5M1FA 1HNZK 1B9FA 4FK0A 3L3VA 4GKJK 3MEDA 3S3NA 2Q97A 1D8YA 3R1XA 4Q0BA 2PY5A 5I42A 4NLCA 4CZKA 5JICA 3ENBA 4NCBA 4IOCL 2WBNA 4OLAA 3ZX3A 5IT9O 1RILA 1RT7A 2YI1A 1NK4A 3EN9A 3KKRA 4K25A 2F9WA 4J2AA 1DGKN 4X62K 4I7FA 4DR2K 1TUUA 4BREA 2O4GA 4DTXA 3RMBA 3J8AA 4IOAL 2IS3A 2XY7A 1JCFA 1LAWA 2ZWHA 3HI0A 1S1XA 1NMDA 2D4WA 3BDPA 1WOQA 2GV9A 1C0GA 4CHPA 5HOOA 4AM6A 5M1KA 4IEIA 3UB5A 3SLCA 3WUHA 1DT9A 3ENHA 1RDAA 4O8KA 4DQ8A 4FPBA 3OBYA 1OVYA 2VYPA 4MFBA 4B3MK 1HMVA 5FPMA 2FSJA 1UOCA 1GLEG 4DV2K 1SL2A 2B5JA 4KRFA 4DU1A 3CYMA 2E6MA 3K5NA 1X9SA 2WOMA 5BPNA 2J4RA 4F2SA 3AARA 3KLFA 4OPKA 4FJJA 3I33A 4BQZA 3ZSRA 5F1XA 1TKXA 2QK9A 4BRKA 5HRSA 4FJGA 1IH7A 5KGXA 1WNSA 1S22A 2HF4A 4KTQA 3M8QA 1NGBA 2O8EA 4CESA 4JYAK 3W3DA 1B92A 3OYIA 1L3TA 5ADXH 3P83D 1A5WA 1ZBUA 4FJKA 3D2EB 2UYTA 3DRRA 1XMOK 1RT6A 3K9JA 3L8BA 4CGHA 3VA0A 1LV5A 3O5BA 3HBTA 3HXMA 1IG9A 1BIUA 2YHWA 4MDBA 1IG8A 1RGIA 3EL2A 1WSJA 1Y97A 3VQCA 4DV7K 3EKSA 4DQRA 4RWTA 3ZSYA 4ELTA 1UA0A 4C8NA 1I94K 5AQNA 4BRMA 4CGFA 4JK8A 1JLFA 2KZMA 1XI1A 3A2FA 1BI4A 1BG3A 3AVIA 5A2QO 5AQLA 3CI5A 1JCGA 3I55N 3CQXA 4CJ3A 3GOIA 1XMQK 5AQHA 1MWMA 3ZX2A 3FFKB 1ASUA 1L5UA 4N41A 3D6RA 3KWGA 2LSNA 3JSMA 3NF9A 4E0DA 4IG0A 2GTDA 4O8UA 2A1RA 3V9SA 4PY5A 4Z0UA 1NJIO 3EEQA 1JLGA 1YI2N 4B9SA 3QNOA 1P90A 1SZ2A 1QQCA 1ZC6A 2KW4A 3C7NA 3DRPA 4JRQA 1X1PA 4DLGA 2OCEA 4JAXA 2DFEA 4KO0A 4FK4A 3KK1A 3CETA 3THWB 1KLNA 3MEEA 5J2QA 1O13A 4X66K 4B9MA 2NNWA 4A59A 2PYJA 2QKBA 3F9KA 4K0KK 4AM7A 1JLAA 3ZSWA 4IDHA 4I6MA 4ISFA 3RMDA 2Z1IA 5KI6A 3NGZA 1KQSM 3VEOA 2Q2RA 1HKBA 2IAJA 3I0SA 3AVJA 2HB5A 3DLEA 3GDQA 4B9UA 3A5LC 2E2QA 3NH1A 4LH4A 1TAUA 2DPNA 5E26A 2A40A 1BL3A 2D0BA 4CEZA 4CW7B 5KRTA 4FJ9A 3OBWA 4DR1K 3BUZB 4AHSA 1C0UA 4W5NA 1VAZA 1QSLA 2VG7A 2AP1A 4AHCA 1VQPN 3VEYA 3QBWA 3TAQA 1HR0K 4OKEA 3TPQA 4X65K 3FZFA 3LM2A 3UKUA 3M1FA 4HUFA 4CK3A 4FLWA 2HBJA 3O9RA 3MN5A 2QWNA 4LF5K 1J5OA 1BU6O 4CJTA 2O8FA 5AFUA 4BWJA 4M7XA 1RDUA 3C0BA 2P9PA 3VENA 1NJXA 1RTHA 5CE3A 4KHPK 3V9ZA 1WAFA 4L8RB 3PX4A 1GLCG 5CY4A 4EZ6A 1JXEA 4DR3K 3IKMA 3TR8A 1CZBA 5E84A 3SAHA 2H3GX 4GV9A 5HL7L 2E6LA 4FCYA 3QFPA 3W0LA 4J8FA 4OPHA 2HVIA 1BA0A 3B6PA 2OTJN 1BA1A 3R9PA 3G0ZA 4GY2B 4DV1K 5HROA 2Z1JA 3FGUA 1ZXOA 3UE5A 5GIPA 2F9TA 3CJ1A 4CJWA 5AZIA 2HOEA 3QMLA 4BRDA 4FJIA 5BRDA 1YTUA 3LDQA 3MWPA 2KFNA 4BRFA 4OVLA 5KQ8A 3VF6A 2X6NA 1YVUA 3P4IA 2VG6A 3U8XA 4WFNL 4YDUC 4F3TA 3ZT2A 4CBXA 2HNYA 3WXJA 3M3ZA 2G8IA 1IBKK 2E8AA 1EO1A 3P31A 1VSEA 3ALYA 3CERA 3RMCA 3HM9A 1YJNN 4O5FA 1IKWA 3OYDA 1GLBG 2D0OA 4IFEA 3CM5A 5AQQA 1C0MA 1U2VB 3TTDA 1VQMN 4C1NK 3T7ZA 3VMFB 4DQSA 1VQKN 1T7PA 4IFYA 2P51A 5AQVA 4BR0A 4Z4IA 1X3MA 2EX3A 4FOIA 4WE1A 4FVUA 1JLCA 1TV6A 3VQAA 4CJPA 4LFCK 3WNEA 3RMAA 3M8RA 4KHWA 2UXDK 2I7PA 4KI4A 4C8OA 4IXCA 1A5VA 1Q8IA 3AVMA 4H0OA 4H0YB 4KH5A 4UY8O 4FLTA 5GADP 4Y1CA 3D2FB 4AF1A 1ITGA 3MMVA 1HNIA 3LL3A 2WFBA 4DTJA 3WNHA 3HSTB 5FRNA 1KCFA 4DTRA 3LPUA 3L0QA 3UKRB 3VEXA 4DV6K 3AVNA 3SI6A 3L6QA 2Z1HA 1VQON 4Z4FA 3P1GA 3C6UA 3VPZA 1E4FT 2Y1JA 4BR9A 4FJXA 1Q86O 2KHOA 2EWSA 2WUSA 1YITN 4CFCA 3VF4A 2G8HA 4M3YA 1U49A 3SAGA 1BGXT 3FZKA 1RBSA 2Q36A 3M8PA 1KC8O 2O8CA 3OYBA 1L3UA 3IMXA 3AVKA 1TGOA 3LPTA 3WEEA 5LJVA 4YOXA 3VQ9A 2ASOA 3CJ7A 3PX6A 3L3UA 5HRNA 4AILC 3J7ZO 1BISA 2YHBA 3KIOA 3ZETB 3AVHA 3AAQA 1VSHA 4DV5K 4CHZA 1LW0A 2A41A 1JL1A 2YNGA 3L2WA 3C6TA 2P9LB 4CJSA 1VQ5N 2ASMA 2YHYA 4A62A 4N76A 1J5EK 5JS1A 3O9UA 1S1WA 2F96A 4IBNA 3AVGA 3VN5A 4C8LA 3CCSN 2XY5A 3N4PA 2O8EB 3V9WA 3Q7BA 3PX0A 2QWMA 2PFUA 4CJRA 1RT1A 4KREA 3FZLA 3THYB 1VQ7N 2DTUA 1U45A 2HHHK 1LWFA 4BRHA 2E1ZA 2BE2A 2GBZA 2FF6A 4B1WB 3AO3A 1QHTA 1XUPO 3CC4N 1RBVA 1T44A 4CZLA 1RDBA 3LDLA 4JN4A 4JRPA 1K9MO 2A6AA 2YNHA 1NK7A 3SMSA 1C0TA 1NG9A 4FM0A 1VRTA 3OJUA 3SBTA 1WLJA 4C8KA 3O4NA 2DY4A 5FPNA 1EP4A 4BROA 3NCIA 1GOAA 2P1JA 1YJ9N 4DS4A 4KHYA 4NYFA 1DTQA 4OGEA 2VCPA 1VSDA 1A5XA 4K8ZA 4M3UA 1BOTO 1VSLA 3TABA 1LCUA 4NCGA 5BPLA 2W40A 1UA1A 3VQQA 4BC3A 4M42A 2QXFA 4WQ4C 3WNGA 3CCEN 5LY3A 1JLEA 4FM2A 2E4LA 2O8DA 1JLQA 3E9LA 1UAXA 3H1QA 4BR5A 4NLBA 3ZCMA 4DFPA 1S5JA 2IDOA 2P9KA 3TSQA 1W7AA 2FSKA 3OS0A 3AA4A 1NU0A 4LF8K 4I6MB 4B1ZA 1ATSA 1FXXA 4OPAA 4GNIA 3LDPA 4BRAA 4JHDB 1O1WA 3CPEA 1NK6A 4FJMA 1S1UA 1JJ2M 4JKBA 1J53A 3PSIA 4R5PA 4JKCA 1SL1A 4KI6A 5EVZA 4ZTJA 3O3FA 2QWQA 2E88A 4FWPA 2E1YA 4EZ9A 2KKZA 1BCOA 2XY6A 3LDSA 2WC9A 3CJCA 2V51B 2O8DB 4Z4EA 1OVQA 1N8RO 3A8YA 1R59O 3AGRA 2P9LA 3F9MA 3O8MA 1CLQA 1HYVA 4DSFA 5BR8K 2ZD1A 4NXMK 2QM1A 1S72N 4FLVA 2ETJA 1JLBA 3LANA 3CC7N 3L2QA 3F5TA 5H1SQ 2ZJPL 4AHRA 1KAXA 3ULEA 2QI2A 3QINA 2HHQA 4H0TB 2VQFK 3C6HA 3EKUA 2X78A 4QS8A 5AQWA 2HHXA 1TK5A 1Q7YO 4ID5A 1VSKA 3SK3A 3MAQA 2G8FA 2OPRA 3KWIA 3MCAB 4BDPA 3SQ4A 1VRUA 4PKIA 4B9TA 4B3RK 2HHWA 1SS6A 1SKWA 3KJVA 3NF8A 4JK9A 3CQYA 2HF3A 4JS5A 2D0CA 1L3VA 1BQNA 3KK7A 2NRHA 1HNWK 2HMIA 4JI0K 5C0YA 4F4KA 4HTUA 3C95A 3Q7CA 4WQ5C 1SKSA 4GV6A 1S3XA 2YKMA 1C1CA 4FWOA 5AZIB 4A61A 2OA8A 4FJLA 3CMEN 3PIOL 4M41A 2P9NA 3RSEB 3TI0A 1R0AA 1CXUA 2NRZA 3THXB 4CD1A 1K6YA 1G99A 1NGEA 4CHQA 5AQUA 5M1PA 3DYAA 1GLAG 3DWLA 5HRPA 1IV0A 1TKZA 3GE1A 4MO5A 4B1VA 1NGFA 4O44A 1BI4B 1RBTA 5M1OA 3KLHA 2ZE2A 4O4GA 1U6ZA 5C10A 3DAWA 4DTMA 3NH0A 4KHNA 3LALA 4ELUA 5M1QA 1EWRA 3VQ6A 3ZSZA 3ZEUB 1KTQA 4OKJA 4JKDA 3O3GA 4DSLA 3H08A 5BN8A 4CHNA 3DMJA 1VK0A 3QIPA 1BCMA 4J2EA 1W0HA 3MECA 4OGCA 1Z25A 2YNFA 4W5TA 3CCVN 4ISGA 3EO3A 3KD5E 3AVAA 3H46O 1NLVA 4N47A 2HSTA 4NO7A 1HRHA 4FVMA 1OH6A 2VG5A 3U6FA 1RBRA 2ZQBA 4IDKA 1N32K 5DM6L 2PYLA 4DR4K 1Q9YA 2WONA 1FK9A 4FL9A 4HCBA 4KHQA 4CJFA 3LWMA 4IKFA 3V1QA 5AQSA 1W97L 3VQDA 1ATRA 1TL1A 4M63C 1RT5A 5HBMA 4BRPA 3UIQA 5AQMA 3MX5A 1VSIA 4B1YB 3EZ5A 1NJZA 4JV5K 4DCHA 3PSFA 3NGIA 1JKHA 3ISNC 2QEXN 4OX9K 1ZBIA 4CEDA 4BRIA 3OYHA 1YT3A 3QEVA 3VOVA 3ATVA 4N56A 3ZX0A 4OPJA 1KFSA 1E4GT 4A57A 5CZ2A 4BVPA 5C2DA 5AZJA 3WEEB 2VGMA 3ASMA 1U4BA 3I8DA 3TAFA 4KH4A 3T19A 4YOTA 3WNFA 2IVNA 3SJHA 1ATNA 3LAMA 4C23A 4CFDA 3IAYA 4KAZA 2HBLA 4AQYK 2CGKA 1ILYA 2FBTA 1WUAA 4RW6A 3NE6A 3BY5A 3MN6A 3ZT1A 3AVBA 3QEPA 4KTWA 4H4MA 3CIPA 3TANA 1XC3A 4MO4A 3KVGA 3J81O 3E01A 3PUFA 4EP4A 2V7YA 3IRXA 2DFFA 3LZIA 4LC9B 3K0SA 1KD1O 1VQ9N 4K41A 1Z6RA 1BQMA 2A1SA 2W41A 1X9JA 3SUOA 4LF4K 4XIUA 4B1XB 4X64K 1U47A 2D0AA 2OTLN 4RW7A 4DV3K 1KFDA 2F7TA 3SV3A 4JKAA 4DV4K 3T1AA 5I3UA 4DQIA 3HL8A 4E1MA 4DLEA 4QS7A 4EAHD 4GVEA 5AQGA 4E7KA 2P9IA 2FSNA 5C25A 2YNIA 2UUCK 4CZMA 3SNNA 2NRRA 1J9AA 1TKTA 1NGGA 3AGKA 2IIRA 4PHTX 4ILHA 5C12A 4BG8A 4CEOA 2VWJA 1WBDA 2G8WA 3KZBA 1V4TA 2YX6A 3VESA 1GLDG 4I9QA 5JLFA 4V19S 3QEWA 4CGJA 3A5OC 3AAPA 4DUYK 1VHXA 1HJOA 1TYQA 3G25A 4JKEA 4CECA 1I39A 4TSXA 2GELA 3LAKA 3DXKA 4FLZA 2QW9A 3VTHA 4E1NA 1ZYQA 3C6AA 1UWBA 2QWPA 1J6ZA 3DI6A 3A5NC 4G1QA 1YJWN 2CGJA 1YIJN 1XWLA 4CJUA 1MWKA 4BY9C 4CJQA 4H5VA 5JVGL 5KPZA 2RPIA 3OYKA 4BRLA 3SV4A 1HKCA 2ZF5O 3O9SA 4FWRA 1FW6A 3NVMA 1NGJA 4M3WA 4LY7A 4JEPA 2Y1IA 3OA9A 3K58A 1NOZA 3HSCA 4BRCA 3V9UA 5DMRA 4PUOA 5KPRA 3BZKA 2OZSA 3MXJA 4CGDA 5AQIA 3OHRA 2D1KA 3CJBA 2P9UB 5AQTA 3CQ8A 2B4JA 3DXKB 5J2MA 2V52B 1JCEA 1LWCA 4FWNA 5E41A 1DKGD 3H6EA 4Y1DA 2UUAK 2HNZA 2FXUA 1GOCA 5C24A 1JL2A 4BRGA 4DTOA 3RR7A 1QQOA 3U9ZA 3AVCA 4E7JA 3DLBA 2YV0X 2FBXA 3EY1A 1D9FA 4LF6K 1S9EA 3CC2N 5LJWA 3QDKA 5HRRA 3ZETA 5JVHL 4JI7K 3H3OB 1DLOA 1B9DA 5GAEP 2FF3B 4IO9L 1QQNA 2D0PA 2KQ2A 2BGGA 4CJLA 3OY9A 1WSGA 3EE8A 5GAGP 4U7BA 4O55A 3QESA 3MN9A 3B8AX 2P9IB 1XNQK 1BHLA 4KPYA 5CR4A 4H0VB 4JI4K 3L2VA 3T3FA 4WYBA 3NGYA 1NGAA 1NM1A 1K8AO 1EKEA 3S41A 5B8HA 3D2FA 3RTVA 4LF9K 2HMPA 5GINA 4QOZB 3CFOA 4JKFA 3JXUA 2W42A 1X3NA 1HNVA 5KRSA 2BDPA 4WQ5A 2PAVA 5AQKA 1T8EA 3NDKA 4DF4A 3CMAN 3CCJN 1TK8A 4FJ7A 4K42A 3L2RA 5HLFA 1CXQA 4FW2A 4DR6K 2E5LK 4DG1A 4KFBA 4JI8K 1NJWA 1VQNN 4GW6A 4FWQA 4DFJA 1Y64A 1RBUA 4LSLA 3VQ4A 4FPAA 2O8CB 4DQQA 3IG1A 5C2FA 3J7YP 2IVOA 3BZCA 2XRIA 4LSNA 3I0RA 3SQ0A 3NVKA 5JMVA 4IWVA 5I9EB 4JD2A 5EOYA 4CF0A 3H45C 1CZAN 4MQ3A 4CZHA 1M1KO 4BE2A 4JKGB 5DM7L 3HOTA 2HNDA 3DOKA 4FWSA 4YOYA 4BE1A 4DTNA 1ZBSA 3H3NO 3JAMO 2X74A 1QHAA 1EWQA 3OYCA 2R7YA 5AQOA 1RTIA 4Q5VA 4YDUA 4YORA 5J2PA 3MXMA 1MA9B 4CHYA 3DLHA 1QSYA 4DTSA 3TU5A 3NMUA 4J2BA 4LD0A 1NKCA 1X9WA 4B1UB 4I2QA 4DFKA 4PKHA 4GMJB 3AVFA 3SUPA 4K43A 3C7NB 2F8TA 4JI3K 1LW2A 5T7BA 1TVRA 2CH6A 3BP8A 3SYZA 3WT0A 1RDWX 1XQSC 4DR7K 4CFAA 1TL3A 4HVJA 1N34K 3F2KA 4XEIA 2G8VA 3NAEA 4FWLA 5EU7A 5M1NA 3HVRA 2O8BB 4PKGA 1WBBA 5F0XA 3VGLA 2UXBK 3AY9A 4IZ9A 4CEBA 2OZMA 2NRTA 3CPWM 1WSIA 1ZBHA 4E7LA 4A2BA 4CIFA 2QA4N 1T6DA 2A3ZA 1WN7A 1Q81O 2GUPA 3FZHA 3LZJA 3O1BA 3AVLA 4RW9A 3HPOA 3QBXA 3PO5A 4BG9A 2OPQA 3U3YA 5J2NA 1HQEA 2P9SB 3RWUA 3MN7A 4BGBA 3TAGA 3DOLA 1T6CA 4FO0A 5FROA 1RFQA 3G10A 1HNXK 4CJ4A 4BDZA 3MXIA 4XH5A 4FZYA 1LAVA 4M7YA 2QWRA 3BEXA 4KV8A 1E3MA 4CD3A 4HHTA 1KLMA 4YOUA 4ICLA 4KH6A 4JHDA 3RVCA 1BDGA 1RNHA 1W9HA 3K57A 2O4IA 1KSPA 3AO1A 4JLHA 5CYMA 4FJHA 2IOCA 1SL0A 4CEFA 2Q31A 3V9XA 4E1JA 2W6LA 2HHVA 2P5GA 4F3OA 3EZWA 3PLAA 4BRNA 4GV3A 1KRPA 5HP1A 3ITHA 3ZYYX 4WCEL 4CGGA 1FKPA 3GBTA 5CYQA 1EQYA 3E9PA 4LFBK 3TARA 4M3XA 2RN2A 1WSEA 2XY8A 5C42A 4OJRA 3O3HA 1QS4A 3TTCA 4CVNE 3HPGA 4YOVA 5BRFA 5D3GA 3I56N 3CXCM 1U04A 3D7EO 4DU4A 1HUXA 3RRHA 2FLOA 3VF2A 5EXWA 4JI5K 3P5JA 3OYFA 4IEEA 1D5AA 1MDUB 5AR0A 4FLUA 1YHQN 2ZJQL 1BIZA 1NK9A 3AO5A 1N33K 2GUIA 1FJGK 3PO4A 4ZHRA 3RRGA 4R79A 3CJ9A 1KVBA 2AA4A 3QEXA 4BC4A 4B9QA 1XHZA 4U67L 1K73O 4N5SA 1Z05A 3HJFA 4MDAA 4KTZA 3WXKA 3V1OA 1QVFM 3M8SA 4QAGA 4FZZA 4FM1A 3IFRA 3M5RA 1HPMA 1T3VA 5SWMA 4AHTA 3SMPA 4LH5A 1TUYA 5AQYA 4Z4CA 1NWKA 3O6WA 1XHXA 4FWKA 4CZJA 4BDYA 3CCQN 1KXPA 1NGHA 2BANA 4ID1A 1RTDA 4CEAA 1I3AA 2P9UA 1G15A 1W2BM 3CCLN 1SV5A 3VQ7A 1XC9A 4E7IA 3LDOA 3ZT3A 2UUBK 4JI6K 2GWKA 4BR7A 4CZGA 4G9ZA
chains in the Genus database with same CATH topology
2P9NB 5KQ8A 2P9SA 3VF6A 4CZIA 3FLCO 1P8ZA 2JWLA 3P4IA 2V7YA 3O08A 3A5MC 3QFUA 4H0XB 3U8XA 4WFNL 4LC9B 4YDUC 1KD1O 1VQ9N 1Q82O 4K41A 1Z6RA 5AQRA 4CBXA 2W41A 3WXJA 3M3ZA 2E8AA 1BUPA 1EO1A 1NBWA 3P31A 3CERA 1X9JA 2A42A 3DJCA 5FPDA 3CCRN 1YJNN 3O9TA 4O5FA 1GLBG 3UKRA 2Q1NA 4B1XB 2D0OA 4IFEA 5AQPA 2OTLN 3SBGA 1TYQB 5AQQA 5BRHA 1HX1A 1U2VB 3TTDA 2F7TA 4C1NK 3T7ZA 3M6GA 3VMFB 4BR2A 1GLFO 1VQMN 1VQKN 1KAZA 5AQVA 4JKAA 1IJJA 3WXMB 4BR0A 1X3MA 4DB3A 3ID6A 4FOIA 4FVUA 4QS7A 4EAHD 4GVEA 4L3QA 5AQGA 3DXMB 2P9IA 3MWTA 4WFAL 2FSNA 3GG4A 3U9DA 4H5TA 2I7PA 4H5WA 1V4SA 3QICA 4IXCA 4CZMA 3E9OA 3R8EA 2NRRA 4ISEA 4H0OA 2ZGYA 5ELZA 3VGMA 4H0YB 5AQXA 5C15A 4RTFD 1NGGA 3AGKA 4KH5A 4UY8O 2IIRA 4BVOA 4PHTX 2ZJRL 4ILHA 1D4XA 5C12A 1K8KB 5GADP 3BF1A 4BG8A 3D2FB 3E1YA 3KZBA 4AF1A 3ATUA 3CCMN 1V4TA 3MMVA 2YX6A 3LL3A 2WFBA 3VESA 2YHXA 1GLDG 5JLFA 2OANA 3L0QA 3UKRB 3VEXA 3A5OC 3AAPA 4JKHA 5ADXA 2Q0UA 2P9KB 3WQUA 3L6QA 1VQON 1HJOA 1TYQA 3G25A 4JKEA 3WQTA 2VWBA 2BH1A 2GELA 3P38A 4RCHA 3VPZA 1E4FT 3DXKA 2QW9A 3VTHA 3CJAA 4BR9A 3C6AA 1HLUA 1VQ4N 3T69A 1Q86O 2KHOA 2QWPA 1J6ZA 2EWSA 2HBKA 3A5NC 1YXQA 3SAFA 2WUSA 1YJWN 1YITN 2HBMA 2CGJA 3O80A 3VF4A 1YIJN 1LOTB 3SAGA 5GIOA 1MWKA 4BY9C 4H0PA 3FZKA 2QWOA 4H5VA 5JVGL 2Q36A 5TKWA 1NGIA 3FR0A 4BRQA 1H1VA 4BRLA 3IMXA 5KPZA 1KC8O 4C1NI 1HKCA 2ZF5O 3WEEA 1YF5L 3O9SA 4FWRA 5LJVA 4YOXA 2ASOA 4JK7A 3CJ7A 1K8KA 2VGNA 1DEJA 1BO5O 3NVMA 2RE2A 3HRGA 3O1WA 4CZEA 1NGJA 4EHTA 3J7ZO 3PIPL 4G9ZA 4JEPA 3ZETB 5GAHP 3AAQA 3OA9A 4HTLA 3MCPA 3I8BA 4H5RA 3HSCA 4BRCA 2A41A 5KPRA 5AQZA 2P9LB 4JKGA 1VQ5N 2ASMA 4H5NA 4DHYA 2YHYA 4A62A 5AQIA 3OHRA 2D1KA 3QB0A 2E2PA 4Z94A 3CJBA 5MLCQ 2IVPA 2P9UB 3O9UA 5AQTA 3VTIA 4CZFA 4KBOA 3DXKB 5KQDA 2V52B 4CBWA 3CCSN 2YCHA 1JCEA 3FE1A 3N4PA 4FWNA 4BGAA 3Q7BA 2QWMA 1DKGD 2PFUA 3H6EA 4DKWA 4HWIA 3FZLA 2FXUA 4IOXA 1VQ7N 2RHKA 4QS9A 5TKYA 3A0IX 3ULEB 4BRGA 3D2EA 4YOWA 4BRHA 2E1ZA 1QQOA 2FF6A 3IUCA 3U9ZA 4B1WB 4EIAA 5AQFA 1M90O 5F2RA 1XUPO 3CC4N 1NGCA 5CHIA 1T44A 4CZLA 5BREA 4MO4A 3CC2N 4WQ4A 4JNEA 2GX9A 3LDLA 4JN4A 3VETA 5LJWA 1K9MO 2A6AA 5KPTA 3QDKA 3ZETA 4CJ7A 2ITMA 5C2DA 5JVHL 3H3OB 2GWJA 3SMSA 5GAEP 2FF3B 4IO9L 1QQNA 2D0PA 3ID8A 5M1FA 3VERA 3SBTA 3R6MA 2Q97A 3R1XA 3EE8A 5GAGP 4U7BA 5FPNA 4NLCA 4BROA 4CZKA 5JICA 3ENBA 3DXMA 3MN9A 3B8AX 1YJ9N 2P9IB 4IOCL 2WBNA 2VCPA 3ZX3A 2YI1A 3G6EN 3EN9A 4K25A 2F9WA 1BOTO 1DGKN 5CR4A 4H0VB 3R3LA 4WYBA 1NGAA 1TUUA 4BREA 1LCUA 2V7ZA 1NM1A 3VEVA 5BPLA 3J8AA 2ASPA 1K8AO 1YUWA 4IOAL 2W40A 2NZTA 4BC3A 1JCFA 4WQ4C 3S41A 3D2FA 5B8HA 5LY3A 3CCEN 2ZWHA 3HI0A 2HMPA 5GINA 1NMDA 2D4WA 1WOQA 4XH1A 3E9LA 4JKFA 3JXUA 2CH5A 3H1QA 3RSEA 4BR5A 4NLBA 1X3NA 1C0GA 3LM9A 2P9KA 4WQ5A 3TSUA 2PAVA 5AQKA 3TSQA 2FSKA 5HOOA 4AM6A 5M1KA 3CMAN 4IEIA 3UB5A 3SLCA 3WUHA 1DT9A 3ENHA 3CCJN 4O8KA 4I6MB 1HKGA 4K42A 1ATSA 4OPAA 4B1ZA 4DQ8A 4GNIA 4FPBA 3LDPA 2BUPA 3OBYA 4BRAA 4JHDB 3CPEA 2VYPA 1OVYA 1VQNN 4FWQA 2KLAA 2FSJA 1Y64A 5FPMA 4JKBA 4MLEA 1JJ2M 1GLEG 4FPAA 3CF5L 4JKCA 5EVZA 2E20A 5C2FA 2IVOA 2QWQA 2E88A 3VEZA 4FWPA 2E1YA 2J4RA 5BPNA 3NVKA 3HOSA 5JMVA 2KKZA 1C0FA 3AARA 4IWVA 3VEWA 2WC9A 5I9EB 3CJCA 1YVNA 4JD2A 2V51B 3I33A 3N4QA 4BQZA 3G71N 5EOYA 5F1XA 3CHWA 3H45C 1CZAN 1N8RO 3A8YA 1R59O 4BRKA 4CZHA 1M1KO 3AGRA 2P9LA 3O4WA 3F9MA 3O8MA 4ILGB 4JKGB 5DM7L 4EFHA 3HOTA 3L4IA 2Q0RA 4FOEA 4YOYA 4FWSA 3CD6N 1S22A 2CGLA 3UKUB 1ZBSA 2HF4A 2QM1A 3H3NO 1S72N 1QHAA 1NGBA 4PL7A 5BR9A 3CC7N 5AQOA 1GLLO 3F5TA 3W3DA 3JS6A 5H1SQ 4A2AA 2ZJPL 4YDUA 4YORA 5ADXH 1KAXA 1MA9B 3TSPA 3ULEA 2QI2A 1Q18A 3D2EB 2UYTA 3K9KA 4H0TB 3TU5A 2P9PB 3K9JA 3NMUA 4WF9L 3C6HA 3EKUA 3IDHA 4QS8A 3O5BA 3HBTA 5AQWA 4B1UB 4PKHA 2YHWA 4MDBA 1IG8A 1ESVA 4K43A 3C7NB 1RGIA 1Q7YO 3EL2A 2QWLA 3SK3A 3EKSA 5JLHA 4JD2B 4RWTA 2CH6A 3BP8A 3MX2A 3KWIA 3MCAB 3WT0A 5AQNA 2BTFA 4PKIA 1RDWX 1XQSC 4BRMA 1SS6A 4JK8A 5AZJB 3F2KA 4XEIA 4JK9A 3CQYA 1BG3A 2HF3A 2NRWA 4FWLA 5M1NA 3KHYA 3GL1A 5AQLA 3CI5A 1JCGA 3I55N 3KK7A 3CQXA 3GOIA 4PKGA 2NRHA 5AQHA 2JWKA 3VGLA 5F0XA 1MWMA 3ZX2A 3FFKB 2NRXA 3AY9A 4IZ9A 4F9OA 4BRFA 2NRTA 4EHUA 3D6RA 3KWGA 3CPWM 5C0YA 4A2BA 1QZ5A 2GTDA 4O8UA 4FWMA 1T6DA 2QA4N 2A3ZA 1Q81O 1NJIO 3MDQA 2GUPA 3FZHA 2PBDA 3O1BA 3Q7CA 4WQ5C 1YI2N 4GV6A 1S3XA 4IJNA 4FWOA 1P90A 5AZIB 1SZ2A 4A61A 3QBXA 1ZC6A 3C7NA 4CBUA 4BG9A 1OKJA 3PIOL 3CMEN 2P9NA 2P9SB 3RSEB 3MN7A 4BGBA 2E2NA 2NRZA 4JAXA 1T6CA 4FO0A 1BWFO 3CETA 4CD1A 3TTFA 1VQ6N 1G99A 1NGEA 3C65A 1RFQA 2QXLA 1O13A 4OO1J 4PL8A 5AQUA 5M1PA 3U4LA 4BC5A 1GLAG 2NNWA 4NB4A 3DWLA 4A59A 3GE1A 4XH5A 4MO5A 4AM7A 4B1VA 1NGFA 5M1OA 4M7YA 2QWRA 1SAZA 3BEXA 4I6MA 4IDHA 4ISFA 5EY4A 3DLLL 1U6ZA 5C10A 3DAWA 4CD3A 4YOUA 1KQSM 4KH6A 3VEOA 2Q2RA 4JHDA 3RVCA 1BDGA 5M1QA 1HKBA 4A5AA 1QVGM 1U2VA 3ZEUB 4IO8A 4JKDA 3GDQA 5BN8A 4BQLA 3WXIA 3ENOA 4WFBL 4IJAA 3A5LC 2E2QA 2Q31A 2DPNA 5E26A 2A40A 4E1JA 1SQKA 2QTDA 2NLXA 3CCVN 3OBWA 4ISGA 3BUZB 3EO3A 3EZWA 3H46O 1VAZA 3PLAA 4BRNA 4GV3A 1NLVA 2I7NA 2AP1A 1VQPN 5AQJA 3ZYYX 1QQMA 3VEYA 4WCEL 2HSTA 3GBTA 3QBWA 4NO7A 4BR4A 3TPQA 3H1VX 1EQYA 3HM8A 3E9PA 3FZFA 3LM2A 3UKUA 3M1FA 4BC2A 3MK6A 5EX5A 5DM6L 2HBJA 3O9RA 5FPEA 3MN5A 2QWNA 3TTCA 4FL9A 4YOVA 4MLHA 5BRFA 3L4QA 1BU6O 2GEMA 5AFUA 5AQSA 1W97L 3I56N 4M7XA 3CXCM 1ATRA 4M63C 4BRPA 1RDUA 3D7EO 3C0BA 3ZEUA 5AQMA 4CI6A 3MX5A 1VQLN 2P9PA 4B1YB 3VENA 1HUXA 2FLOA 5CE3A 3VF2A 3O9QA 3LDNA 5EXWA 3FZMA 4DCHA 4IEEA 1MDUB 5AR0A 2YJEA 3CCUN 2QEXN 1YHQN 1GLCG 2ZJQL 4BRIA 3VOVA 5BPMA 3ATVA 3IKMA 4A5BA 4R79A 3CJ9A 3ZX0A 1GLJO 5E84A 3G4SN 2ZGZA 3SAHA 2H3GX 4GV9A 1E4GT 2AA4A 4A57A 5HL7L 4BVPA 2NRVA 4BC4A 2YJFA 4B9QA 3WEEB 2VGMA 3QFPA 4ILJA 4U67L 5AZJA 1K73O 3W0LA 1Z05A 4MDAA 4Y0WA 4KH4A 3VGKA 1VQ8N 3WXKA 4J8FA 4H03B 4YOTA 1QVFM 3P39A 4OPHA 2IVNA 1QZ6A 1BA0A 5BN9A 3SJHA 1ATNA 3IFRA 3M5RA 2OTJN 4C23A 1BA1A 3R9PA 1HPMA 1T3VA 3HTVA 3BF3A 2HBLA 3SMPA 2CGKA 1TUYA 3HZ6A 4GY2B 5AQYA 5AFUH 1ILYA 1NWKA 1WUAA 3O6WA 4XH4A 4FWKA 4CZJA 3FGUA 1YAGA 1ZXOA 3OW2M 3UE5A 2E2OA 5GIPA 1KXPA 1KAYA 3CCQN 2F9TA 1NGHA 3EE9A 3E66A 2P9UA 3MN6A 1W2BM 3CCLN 3CJ1A 2A5XA 1NGDA 3LDOA 3CIPA 5AZIA 2HOEA 3QMLA 4BRDA 3WXLA 5BRDA 2GWKA 3LDQA 1XC3A 3MWPA 4FSVA 4BR7A 3KVGA 4CZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3V A;  1EO1 A;  2KLA A;  2QTD A;  2YX6 A;  2RE2 A;  2WFB A;  1O13 A;  1RDU A;  1P90 A; 
#chains in the Genus database with same CATH topology
 4B9N A;  4CZI A;  3K59 A;  1P8Z A;  2F4V K;  3LP1 A;  3O08 A;  3A5M C;  3QFU A;  4JI2 K;  1HYZ A;  1OH7 A;  3VQP A;  4DSK A;  1Q82 O;  5AQR A;  4DFM A;  3V1R A;  2PZS A;  1NBW A;  4I2P A;  4CJ5 A;  4CF8 A;  3DJC A;  5FPD A;  3F73 A;  3O9T A;  1OH8 A;  4DSJ A;  5IWA K;  4B3O A;  5AQP A;  3SBG A;  4F8R A;  5BRH A;  4CHO A;  4FYD A;  4LFA K;  1EX4 A;  3M6G A;  4FLX A;  1GLF O;  4C8M A;  1IJJ A;  2FC0 A;  1CZ9 A;  4FLY A;  4ZTF A;  3SUQ A;  3B6O A;  3KLG A;  4L3Q A;  3ZSO A;  3DXM B;  3MWT A;  3GG4 A;  3U9D A;  1U48 A;  3QIO A;  2G8K A;  1HPZ A;  4H5W A;  3QO9 A;  3KLI A;  3QIC A;  3R8E A;  3V4I A;  5ELZ A;  3VGM A;  4RTF D;  4BVO A;  4EP5 A;  2W6K A;  2ITG A;  3FFI A;  1D4X A;  3E1Y A;  3TAP A;  1HJR A;  3K5L A;  4CK1 A;  3SPY A;  2YHX A;  3ZSQ A;  3RR8 A;  1ASV A;  4JKH A;  5ADX A;  2O8F B;  2P9K B;  3WQU A;  2HHS A;  4DUZ K;  3WQT A;  2VWB A;  4H8K A;  1QSS A;  3OS2 A;  4RCH A;  3TAM A;  3VQB A;  3D0P A;  3CJA A;  1HLU A;  1VQ4 N;  1VSF A;  1IKV A;  3T69 A;  2D5R A;  2VWK A;  2HBK A;  3SAF A;  1YXQ A;  2HBM A;  4QCL A;  1LOT B;  2UXC K;  5GIO A;  3ZT0 A;  4W5R A;  4H0P A;  1FKO A;  3OYJ A;  5TKW A;  1NGI A;  3FR0 A;  1H1V A;  3KLE A;  4C1N I;  4CJE A;  1YF5 L;  3KTQ A;  3QET A;  4CEE A;  4JK7 A;  4KHS A;  2VGN A;  4FK2 A;  1NNE A;  1BO5 O;  3O1W A;  3HRG A;  4CZE A;  3PIP L;  4I9L A;  3T1Y K;  3U3G A;  3LP0 A;  4NYN A;  4HTL A;  1GOB A;  3I8B A;  3MCP A;  4FJN A;  5AQZ A;  3OVN A;  1YTA A;  4BWM A;  4DHY A;  3DRS A;  3T1H K;  4Z94 A;  1RDD A;  5KQD A;  4KBO A;  1C1B A;  4DU3 A;  4BGA A;  1NKE A;  3FE1 A;  4PQU A;  3SJJ A;  4DTU A;  4DKW A;  2X6S A;  4IOX A;  2IGI A;  2RHK A;  3CM6 A;  5CZ1 A;  4FJ8 A;  3ULE B;  1DTT A;  4GVM A;  2OYQ A;  5AQF A;  2VQE K;  5F2R A;  3AA2 A;  4AHU A;  5CHI A;  5BRE A;  3SQ2 A;  3VQ5 A;  3CFR A;  3QLH A;  3VET A;  1ZBL A;  2ITM A;  2GWJ A;  3IS9 A;  3VER A;  3OTO K;  3AO2 A;  3R6M A;  1IBL K;  3VA3 A;  2RF2 A;  3DXM A;  2JGU A;  4YY3 K;  1D9D A;  1XNR K;  4IG3 A;  3G6E N;  4CK2 A;  3R3L A;  2XO7 A;  2V7Z A;  3VEV A;  2ASP A;  1YUW A;  5LMU K;  2NZT A;  2Z1G A;  3HT3 A;  4B8A B;  2KFZ A;  2JLE A;  3OYM A;  4XH1 A;  2CH5 A;  3HP9 A;  3RSE A;  3S9H A;  3AA5 X;  2AJQ A;  1X9M A;  3LM9 A;  3THW A;  1QE1 A;  3TSU A;  1L3S A;  4CGI A;  1HKG A;  4DQP A;  1MU2 A;  1VSM A;  5LMN K;  2BUP A;  1SUQ A;  3OYN A;  1WAJ A;  3MEG A;  2KLA A;  4MLE A;  3NF7 A;  3CF5 L;  3QNN A;  3VQE A;  2E20 A;  2ATQ A;  3VEZ A;  1S9G A;  1RDC A;  3HOS A;  5JS2 A;  3PY8 A;  1C0F A;  1TAQ A;  4CIE A;  4HUG A;  3VEW A;  3S3O A;  1YVN A;  3N4Q A;  1Z26 A;  4RW4 A;  3G71 N;  1NOY A;  2F8S A;  3CHW A;  1C1A A;  4KHU A;  4DR5 K;  4AHV A;  1KVA A;  3O4W A;  4ILG B;  1Q9X A;  3OYL A;  4EFH A;  3L4I A;  2Q0R A;  4FOE A;  3CD6 N;  4Z4H A;  2CGL A;  3UKU B;  4BAC A;  4K8X A;  2O8B A;  4PL7 A;  2B6A A;  4DF8 A;  3VQ8 A;  5BR9 A;  4CF9 A;  4CF1 A;  4E7H A;  2OPS A;  1GLL O;  3JS6 A;  4A2A A;  4GKK K;  3D45 A;  3TSP A;  4OKK A;  1Q18 A;  2FBV A;  2OPP A;  3K9K A;  4O0J A;  2P9P B;  3TWH A;  4WF9 L;  3IDH A;  2WTU A;  1RTJ A;  3HP6 A;  1ESV A;  2HW3 A;  3HPH A;  2QWL A;  5FRM A;  3DLR A;  3NFA A;  4IFV A;  4CER A;  5JLH A;  1NK8 A;  1NKB A;  4JD2 B;  3THX A;  3MX2 A;  2I5J A;  2BTF A;  5K14 A;  5AZJ B;  4E3S A;  3LP3 A;  2NRW A;  1RT3 A;  3KHY A;  3GL1 A;  4DS5 A;  2JWK A;  2NRX A;  4B3T K;  4F9O A;  4EHU A;  3BGR A;  4Z4G A;  4CCH A;  1QZ5 A;  3K5M A;  4W5O A;  4FWM A;  3MDQ A;  2PBD A;  4M3R A;  5FLX O;  4DTP A;  4IJN A;  3SPZ A;  4M3T A;  3K2P A;  1N5Y A;  4CBU A;  4HUE A;  1OKJ A;  4M3Z A;  4FZX C;  2P5O A;  1N6Q A;  2E2N A;  1BWF O;  3TTF A;  1VQ6 N;  3LWL A;  3C65 A;  2QXL A;  4OO1 J;  4PL8 A;  4CIG A;  3U4L A;  4BC5 A;  1LWE A;  4B9V A;  4H4O A;  4NB4 A;  3C94 A;  2ZM6 K;  1F21 A;  1SAZ A;  5DK5 A;  5EY4 A;  1WSF A;  3KK2 A;  3DLL L;  3THV A;  4A5A A;  2YHA A;  3DLG A;  1QVG M;  1U2V A;  4DMN A;  4IO8 A;  1TKD A;  4BQL A;  3WXI A;  4DV0 K;  3ENO A;  4WFB L;  4IJA A;  4CE9 A;  4B08 A;  1SQK A;  2QTD A;  2NLX A;  5KTQ A;  2HVH A;  1S1T A;  1TK0 A;  3SCX A;  2I7N A;  5AQJ A;  3ZSX A;  1QQM A;  3V81 A;  3HK2 A;  4BR4 A;  3H1V X;  5FDL A;  3HM8 A;  2EHG A;  4OLB A;  4BC2 A;  1NMN A;  3MK6 A;  1VSJ A;  5EX5 A;  3AV9 A;  5FPE A;  4YNQ A;  4MLH A;  3KK3 A;  3L4Q A;  2GEM A;  4CI6 A;  3ZEU A;  1VQL N;  2DFH A;  3O9Q A;  3LDN A;  3FZM A;  2YJE A;  2XHB A;  3CCU N;  1HYS A;  5BPM A;  2KZZ A;  2HHU A;  4A5B A;  3J80 O;  4E19 A;  1GLJ O;  3G4S N;  2ZGZ A;  3DM2 A;  2RKI A;  2NRV A;  2Q3S A;  2YJF A;  4ILJ A;  4Y0W A;  1VQ8 N;  3VGK A;  4H03 B;  3P39 A;  1S6Q A;  1QZ6 A;  1ASW A;  3DLK A;  5BN9 A;  3NBP A;  1RT4 A;  1SKR A;  3O4Q A;  3OJS A;  4KB1 A;  3HTV A;  1OH5 A;  3BF3 A;  3HZ6 A;  3ZT4 A;  5AFU H;  4XH4 A;  3OW2 M;  1YAG A;  1REV A;  4B3S K;  2E2O A;  1KAY A;  3EYZ A;  1IKX A;  3EE9 A;  3E66 A;  3ZLJ A;  2A5X A;  1NGD A;  4JI1 K;  1C6V A;  4KKO A;  3WXL A;  5LL6 Z;  4FSV A;  4LF7 K;  2P9N B;  3THY A;  2P9S A;  4UQG A;  3FLC O;  2JWL A;  4H0X B;  3TAE A;  1T03 A;  3LP2 A;  1BUP A;  4FJ5 A;  2A42 A;  4DWI A;  4RG8 A;  4FW1 A;  4JS4 A;  1RCH A;  3CCR N;  3PV8 A;  3NH2 A;  5SZT A;  4HCC A;  3UKR A;  2Q1N A;  4W5Q A;  1TYQ B;  3J7A P;  1HX1 A;  4CF2 A;  3AO4 A;  4BR2 A;  3QER A;  1KAZ A;  3WXM B;  4AH9 A;  4CFB A;  4DB3 A;  4F2R A;  3ID6 A;  3NHG A;  4DSI A;  4WFA L;  1T05 A;  4H5T A;  1V4S A;  1ZBF A;  4CEQ A;  3E9O A;  4O5B A;  4ISE A;  2ZGY A;  1EXQ A;  3OYG A;  5AQX A;  5C15 A;  5AJ3 K;  3QEI A;  4J2D A;  2QKK A;  1IO2 A;  2ZJR L;  1K8K B;  2YKN A;  3BF1 A;  3NF6 A;  4ELV A;  3ULD A;  2NUB A;  3ATU A;  3CCM N;  2G8U A;  3ZSV A;  4E89 A;  4FXD A;  4YHH K;  1NJY A;  3SQ1 A;  2OAN A;  2Q0U A;  4YFU A;  4DSE A;  3HVT A;  1NK0 A;  2BH1 A;  3P38 A;  3V6D A;  4PA1 A;  3JYT A;  4B8C A;  1KVC A;  1RT2 A;  3OYA A;  4O0I A;  3HYF A;  3O80 A;  1S1V A;  1QTM A;  2FBY A;  2QWO A;  4BRQ A;  1IKY A;  2HHT A;  3SUN A;  1K8K A;  1DEJ A;  2RE2 A;  3OYE A;  4EHT A;  5KGW A;  5GAH P;  4KB0 A;  4H5R A;  3L2U A;  1WSH A;  4JKG A;  2IC3 A;  4H5N A;  3OS1 A;  1IBM K;  3CFP A;  3AA3 A;  2E2P A;  3QB0 A;  1JXB A;  5MLC Q;  2IVP A;  3HO1 A;  3VTI A;  4CZF A;  4CJK A;  4CBW A;  2UU9 K;  2YCH A;  1J54 A;  1HQU A;  4PWD A;  5J1E A;  4HWI A;  3CG7 A;  3S3M A;  4QS9 A;  5TKY A;  3KD1 E;  3A0I X;  3K5O A;  3D2E A;  4YOW A;  3SZ2 A;  3IUC A;  1EET A;  1NK5 A;  4EIA A;  1M90 O;  1N36 K;  1NGC A;  4CJV A;  1S6P A;  4B9L A;  3KKS A;  4BE0 A;  4WQ4 A;  4JNE A;  2GX9 A;  4NCA A;  5KPT A;  4CJ7 A;  4M45 A;  4RW8 A;  1WB9 A;  4NXN K;  3ID8 A;  2KTQ A;  5M1F A;  1HNZ K;  1B9F A;  4FK0 A;  3L3V A;  4GKJ K;  3MED A;  3S3N A;  2Q97 A;  1D8Y A;  3R1X A;  4Q0B A;  2PY5 A;  5I42 A;  4NLC A;  4CZK A;  5JIC A;  3ENB A;  4NCB A;  4IOC L;  2WBN A;  4OLA A;  3ZX3 A;  5IT9 O;  1RIL A;  1RT7 A;  2YI1 A;  1NK4 A;  3EN9 A;  3KKR A;  4K25 A;  2F9W A;  4J2A A;  1DGK N;  4X62 K;  4I7F A;  4DR2 K;  1TUU A;  4BRE A;  2O4G A;  4DTX A;  3RMB A;  3J8A A;  4IOA L;  2IS3 A;  2XY7 A;  1JCF A;  1LAW A;  2ZWH A;  3HI0 A;  1S1X A;  1NMD A;  2D4W A;  3BDP A;  1WOQ A;  2GV9 A;  1C0G A;  4CHP A;  5HOO A;  4AM6 A;  5M1K A;  4IEI A;  3UB5 A;  3SLC A;  3WUH A;  1DT9 A;  3ENH A;  1RDA A;  4O8K A;  4DQ8 A;  4FPB A;  3OBY A;  1OVY A;  2VYP A;  4MFB A;  4B3M K;  1HMV A;  5FPM A;  2FSJ A;  1UOC A;  1GLE G;  4DV2 K;  1SL2 A;  2B5J A;  4KRF A;  4DU1 A;  3CYM A;  2E6M A;  3K5N A;  1X9S A;  2WOM A;  5BPN A;  2J4R A;  4F2S A;  3AAR A;  3KLF A;  4OPK A;  4FJJ A;  3I33 A;  4BQZ A;  3ZSR A;  5F1X A;  1TKX A;  2QK9 A;  4BRK A;  5HRS A;  4FJG A;  1IH7 A;  5KGX A;  1WNS A;  1S22 A;  2HF4 A;  4KTQ A;  3M8Q A;  1NGB A;  2O8E A;  4CES A;  4JYA K;  3W3D A;  1B92 A;  3OYI A;  1L3T A;  5ADX H;  3P83 D;  1A5W A;  1ZBU A;  4FJK A;  3D2E B;  2UYT A;  3DRR A;  1XMO K;  1RT6 A;  3K9J A;  3L8B A;  4CGH A;  3VA0 A;  1LV5 A;  3O5B A;  3HBT A;  3HXM A;  1IG9 A;  1BIU A;  2YHW A;  4MDB A;  1IG8 A;  1RGI A;  3EL2 A;  1WSJ A;  1Y97 A;  3VQC A;  4DV7 K;  3EKS A;  4DQR A;  4RWT A;  3ZSY A;  4ELT A;  1UA0 A;  4C8N A;  1I94 K;  5AQN A;  4BRM A;  4CGF A;  4JK8 A;  1JLF A;  2KZM A;  1XI1 A;  3A2F A;  1BI4 A;  1BG3 A;  3AVI A;  5A2Q O;  5AQL A;  3CI5 A;  1JCG A;  3I55 N;  3CQX A;  4CJ3 A;  3GOI A;  1XMQ K;  5AQH A;  1MWM A;  3ZX2 A;  3FFK B;  1ASU A;  1L5U A;  4N41 A;  3D6R A;  3KWG A;  2LSN A;  3JSM A;  3NF9 A;  4E0D A;  4IG0 A;  2GTD A;  4O8U A;  2A1R A;  3V9S A;  4PY5 A;  4Z0U A;  1NJI O;  3EEQ A;  1JLG A;  1YI2 N;  4B9S A;  3QNO A;  1P90 A;  1SZ2 A;  1QQC A;  1ZC6 A;  2KW4 A;  3C7N A;  3DRP A;  4JRQ A;  1X1P A;  4DLG A;  2OCE A;  4JAX A;  2DFE A;  4KO0 A;  4FK4 A;  3KK1 A;  3CET A;  3THW B;  1KLN A;  3MEE A;  5J2Q A;  1O13 A;  4X66 K;  4B9M A;  2NNW A;  4A59 A;  2PYJ A;  2QKB A;  3F9K A;  4K0K K;  4AM7 A;  1JLA A;  3ZSW A;  4IDH A;  4I6M A;  4ISF A;  3RMD A;  2Z1I A;  5KI6 A;  3NGZ A;  1KQS M;  3VEO A;  2Q2R A;  1HKB A;  2IAJ A;  3I0S A;  3AVJ A;  2HB5 A;  3DLE A;  3GDQ A;  4B9U A;  3A5L C;  2E2Q A;  3NH1 A;  4LH4 A;  1TAU A;  2DPN A;  5E26 A;  2A40 A;  1BL3 A;  2D0B A;  4CEZ A;  4CW7 B;  5KRT A;  4FJ9 A;  3OBW A;  4DR1 K;  3BUZ B;  4AHS A;  1C0U A;  4W5N A;  1VAZ A;  1QSL A;  2VG7 A;  2AP1 A;  4AHC A;  1VQP N;  3VEY A;  3QBW A;  3TAQ A;  1HR0 K;  4OKE A;  3TPQ A;  4X65 K;  3FZF A;  3LM2 A;  3UKU A;  3M1F A;  4HUF A;  4CK3 A;  4FLW A;  2HBJ A;  3O9R A;  3MN5 A;  2QWN A;  4LF5 K;  1J5O A;  1BU6 O;  4CJT A;  2O8F A;  5AFU A;  4BWJ A;  4M7X A;  1RDU A;  3C0B A;  2P9P A;  3VEN A;  1NJX A;  1RTH A;  5CE3 A;  4KHP K;  3V9Z A;  1WAF A;  4L8R B;  3PX4 A;  1GLC G;  5CY4 A;  4EZ6 A;  1JXE A;  4DR3 K;  3IKM A;  3TR8 A;  1CZB A;  5E84 A;  3SAH A;  2H3G X;  4GV9 A;  5HL7 L;  2E6L A;  4FCY A;  3QFP A;  3W0L A;  4J8F A;  4OPH A;  2HVI A;  1BA0 A;  3B6P A;  2OTJ N;  1BA1 A;  3R9P A;  3G0Z A;  4GY2 B;  4DV1 K;  5HRO A;  2Z1J A;  3FGU A;  1ZXO A;  3UE5 A;  5GIP A;  2F9T A;  3CJ1 A;  4CJW A;  5AZI A;  2HOE A;  3QML A;  4BRD A;  4FJI A;  5BRD A;  1YTU A;  3LDQ A;  3MWP A;  2KFN A;  4BRF A;  4OVL A;  5KQ8 A;  3VF6 A;  2X6N A;  1YVU A;  3P4I A;  2VG6 A;  3U8X A;  4WFN L;  4YDU C;  4F3T A;  3ZT2 A;  4CBX A;  2HNY A;  3WXJ A;  3M3Z A;  2G8I A;  1IBK K;  2E8A A;  1EO1 A;  3P31 A;  1VSE A;  3ALY A;  3CER A;  3RMC A;  3HM9 A;  1YJN N;  4O5F A;  1IKW A;  3OYD A;  1GLB G;  2D0O A;  4IFE A;  3CM5 A;  5AQQ A;  1C0M A;  1U2V B;  3TTD A;  1VQM N;  4C1N K;  3T7Z A;  3VMF B;  4DQS A;  1VQK N;  1T7P A;  4IFY A;  2P51 A;  5AQV A;  4BR0 A;  4Z4I A;  1X3M A;  2EX3 A;  4FOI A;  4WE1 A;  4FVU A;  1JLC A;  1TV6 A;  3VQA A;  4CJP A;  4LFC K;  3WNE A;  3RMA A;  3M8R A;  4KHW A;  2UXD K;  2I7P A;  4KI4 A;  4C8O A;  4IXC A;  1A5V A;  1Q8I A;  3AVM A;  4H0O A;  4H0Y B;  4KH5 A;  4UY8 O;  4FLT A;  5GAD P;  4Y1C A;  3D2F B;  4AF1 A;  1ITG A;  3MMV A;  1HNI A;  3LL3 A;  2WFB A;  4DTJ A;  3WNH A;  3HST B;  5FRN A;  1KCF A;  4DTR A;  3LPU A;  3L0Q A;  3UKR B;  3VEX A;  4DV6 K;  3AVN A;  3SI6 A;  3L6Q A;  2Z1H A;  1VQO N;  4Z4F A;  3P1G A;  3C6U A;  3VPZ A;  1E4F T;  2Y1J A;  4BR9 A;  4FJX A;  1Q86 O;  2KHO A;  2EWS A;  2WUS A;  1YIT N;  4CFC A;  3VF4 A;  2G8H A;  4M3Y A;  1U49 A;  3SAG A;  1BGX T;  3FZK A;  1RBS A;  2Q36 A;  3M8P A;  1KC8 O;  2O8C A;  3OYB A;  1L3U A;  3IMX A;  3AVK A;  1TGO A;  3LPT A;  3WEE A;  5LJV A;  4YOX A;  3VQ9 A;  2ASO A;  3CJ7 A;  3PX6 A;  3L3U A;  5HRN A;  4AIL C;  3J7Z O;  1BIS A;  2YHB A;  3KIO A;  3ZET B;  3AVH A;  3AAQ A;  1VSH A;  4DV5 K;  4CHZ A;  1LW0 A;  2A41 A;  1JL1 A;  2YNG A;  3L2W A;  3C6T A;  2P9L B;  4CJS A;  1VQ5 N;  2ASM A;  2YHY A;  4A62 A;  4N76 A;  1J5E K;  5JS1 A;  3O9U A;  1S1W A;  2F96 A;  4IBN A;  3AVG A;  3VN5 A;  4C8L A;  3CCS N;  2XY5 A;  3N4P A;  2O8E B;  3V9W A;  3Q7B A;  3PX0 A;  2QWM A;  2PFU A;  4CJR A;  1RT1 A;  4KRE A;  3FZL A;  3THY B;  1VQ7 N;  2DTU A;  1U45 A;  2HHH K;  1LWF A;  4BRH A;  2E1Z A;  2BE2 A;  2GBZ A;  2FF6 A;  4B1W B;  3AO3 A;  1QHT A;  1XUP O;  3CC4 N;  1RBV A;  1T44 A;  4CZL A;  1RDB A;  3LDL A;  4JN4 A;  4JRP A;  1K9M O;  2A6A A;  2YNH A;  1NK7 A;  3SMS A;  1C0T A;  1NG9 A;  4FM0 A;  1VRT A;  3OJU A;  3SBT A;  1WLJ A;  4C8K A;  3O4N A;  2DY4 A;  5FPN A;  1EP4 A;  4BRO A;  3NCI A;  1GOA A;  2P1J A;  1YJ9 N;  4DS4 A;  4KHY A;  4NYF A;  1DTQ A;  4OGE A;  2VCP A;  1VSD A;  1A5X A;  4K8Z A;  4M3U A;  1BOT O;  1VSL A;  3TAB A;  1LCU A;  4NCG A;  5BPL A;  2W40 A;  1UA1 A;  3VQQ A;  4BC3 A;  4M42 A;  2QXF A;  4WQ4 C;  3WNG A;  3CCE N;  5LY3 A;  1JLE A;  4FM2 A;  2E4L A;  2O8D A;  1JLQ A;  3E9L A;  1UAX A;  3H1Q A;  4BR5 A;  4NLB A;  3ZCM A;  4DFP A;  1S5J A;  2IDO A;  2P9K A;  3TSQ A;  1W7A A;  2FSK A;  3OS0 A;  3AA4 A;  1NU0 A;  4LF8 K;  4I6M B;  4B1Z A;  1ATS A;  1FXX A;  4OPA A;  4GNI A;  3LDP A;  4BRA A;  4JHD B;  1O1W A;  3CPE A;  1NK6 A;  4FJM A;  1S1U A;  1JJ2 M;  4JKB A;  1J53 A;  3PSI A;  4R5P A;  4JKC A;  1SL1 A;  4KI6 A;  5EVZ A;  4ZTJ A;  3O3F A;  2QWQ A;  2E88 A;  4FWP A;  2E1Y A;  4EZ9 A;  2KKZ A;  1BCO A;  2XY6 A;  3LDS A;  2WC9 A;  3CJC A;  2V51 B;  2O8D B;  4Z4E A;  1OVQ A;  1N8R O;  3A8Y A;  1R59 O;  3AGR A;  2P9L A;  3F9M A;  3O8M A;  1CLQ A;  1HYV A;  4DSF A;  5BR8 K;  2ZD1 A;  4NXM K;  2QM1 A;  1S72 N;  4FLV A;  2ETJ A;  1JLB A;  3LAN A;  3CC7 N;  3L2Q A;  3F5T A;  5H1S Q;  2ZJP L;  4AHR A;  1KAX A;  3ULE A;  2QI2 A;  3QIN A;  2HHQ A;  4H0T B;  2VQF K;  3C6H A;  3EKU A;  2X78 A;  4QS8 A;  5AQW A;  2HHX A;  1TK5 A;  1Q7Y O;  4ID5 A;  1VSK A;  3SK3 A;  3MAQ A;  2G8F A;  2OPR A;  3KWI A;  3MCA B;  4BDP A;  3SQ4 A;  1VRU A;  4PKI A;  4B9T A;  4B3R K;  2HHW A;  1SS6 A;  1SKW A;  3KJV A;  3NF8 A;  4JK9 A;  3CQY A;  2HF3 A;  4JS5 A;  2D0C A;  1L3V A;  1BQN A;  3KK7 A;  2NRH A;  1HNW K;  2HMI A;  4JI0 K;  5C0Y A;  4F4K A;  4HTU A;  3C95 A;  3Q7C A;  4WQ5 C;  1SKS A;  4GV6 A;  1S3X A;  2YKM A;  1C1C A;  4FWO A;  5AZI B;  4A61 A;  2OA8 A;  4FJL A;  3CME N;  3PIO L;  4M41 A;  2P9N A;  3RSE B;  3TI0 A;  1R0A A;  1CXU A;  2NRZ A;  3THX B;  4CD1 A;  1K6Y A;  1G99 A;  1NGE A;  4CHQ A;  5AQU A;  5M1P A;  3DYA A;  1GLA G;  3DWL A;  5HRP A;  1IV0 A;  1TKZ A;  3GE1 A;  4MO5 A;  4B1V A;  1NGF A;  4O44 A;  1BI4 B;  1RBT A;  5M1O A;  3KLH A;  2ZE2 A;  4O4G A;  1U6Z A;  5C10 A;  3DAW A;  4DTM A;  3NH0 A;  4KHN A;  3LAL A;  4ELU A;  5M1Q A;  1EWR A;  3VQ6 A;  3ZSZ A;  3ZEU B;  1KTQ A;  4OKJ A;  4JKD A;  3O3G A;  4DSL A;  3H08 A;  5BN8 A;  4CHN A;  3DMJ A;  1VK0 A;  3QIP A;  1BCM A;  4J2E A;  1W0H A;  3MEC A;  4OGC A;  1Z25 A;  2YNF A;  4W5T A;  3CCV N;  4ISG A;  3EO3 A;  3KD5 E;  3AVA A;  3H46 O;  1NLV A;  4N47 A;  2HST A;  4NO7 A;  1HRH A;  4FVM A;  1OH6 A;  2VG5 A;  3U6F A;  1RBR A;  2ZQB A;  4IDK A;  1N32 K;  5DM6 L;  2PYL A;  4DR4 K;  1Q9Y A;  2WON A;  1FK9 A;  4FL9 A;  4HCB A;  4KHQ A;  4CJF A;  3LWM A;  4IKF A;  3V1Q A;  5AQS A;  1W97 L;  3VQD A;  1ATR A;  1TL1 A;  4M63 C;  1RT5 A;  5HBM A;  4BRP A;  3UIQ A;  5AQM A;  3MX5 A;  1VSI A;  4B1Y B;  3EZ5 A;  1NJZ A;  4JV5 K;  4DCH A;  3PSF A;  3NGI A;  1JKH A;  3ISN C;  2QEX N;  4OX9 K;  1ZBI A;  4CED A;  4BRI A;  3OYH A;  1YT3 A;  3QEV A;  3VOV A;  3ATV A;  4N56 A;  3ZX0 A;  4OPJ A;  1KFS A;  1E4G T;  4A57 A;  5CZ2 A;  4BVP A;  5C2D A;  5AZJ A;  3WEE B;  2VGM A;  3ASM A;  1U4B A;  3I8D A;  3TAF A;  4KH4 A;  3T19 A;  4YOT A;  3WNF A;  2IVN A;  3SJH A;  1ATN A;  3LAM A;  4C23 A;  4CFD A;  3IAY A;  4KAZ A;  2HBL A;  4AQY K;  2CGK A;  1ILY A;  2FBT A;  1WUA A;  4RW6 A;  3NE6 A;  3BY5 A;  3MN6 A;  3ZT1 A;  3AVB A;  3QEP A;  4KTW A;  4H4M A;  3CIP A;  3TAN A;  1XC3 A;  4MO4 A;  3KVG A;  3J81 O;  3E01 A;  3PUF A;  4EP4 A;  2V7Y A;  3IRX A;  2DFF A;  3LZI A;  4LC9 B;  3K0S A;  1KD1 O;  1VQ9 N;  4K41 A;  1Z6R A;  1BQM A;  2A1S A;  2W41 A;  1X9J A;  3SUO A;  4LF4 K;  4XIU A;  4B1X B;  4X64 K;  1U47 A;  2D0A A;  2OTL N;  4RW7 A;  4DV3 K;  1KFD A;  2F7T A;  3SV3 A;  4JKA A;  4DV4 K;  3T1A A;  5I3U A;  4DQI A;  3HL8 A;  4E1M A;  4DLE A;  4QS7 A;  4EAH D;  4GVE A;  5AQG A;  4E7K A;  2P9I A;  2FSN A;  5C25 A;  2YNI A;  2UUC K;  4CZM A;  3SNN A;  2NRR A;  1J9A A;  1TKT A;  1NGG A;  3AGK A;  2IIR A;  4PHT X;  4ILH A;  5C12 A;  4BG8 A;  4CEO A;  2VWJ A;  1WBD A;  2G8W A;  3KZB A;  1V4T A;  2YX6 A;  3VES A;  1GLD G;  4I9Q A;  5JLF A;  4V19 S;  3QEW A;  4CGJ A;  3A5O C;  3AAP A;  4DUY K;  1VHX A;  1HJO A;  1TYQ A;  3G25 A;  4JKE A;  4CEC A;  1I39 A;  4TSX A;  2GEL A;  3LAK A;  3DXK A;  4FLZ A;  2QW9 A;  3VTH A;  4E1N A;  1ZYQ A;  3C6A A;  1UWB A;  2QWP A;  1J6Z A;  3DI6 A;  3A5N C;  4G1Q A;  1YJW N;  2CGJ A;  1YIJ N;  1XWL A;  4CJU A;  1MWK A;  4BY9 C;  4CJQ A;  4H5V A;  5JVG L;  5KPZ A;  2RPI A;  3OYK A;  4BRL A;  3SV4 A;  1HKC A;  2ZF5 O;  3O9S A;  4FWR A;  1FW6 A;  3NVM A;  1NGJ A;  4M3W A;  4LY7 A;  4JEP A;  2Y1I A;  3OA9 A;  3K58 A;  1NOZ A;  3HSC A;  4BRC A;  3V9U A;  5DMR A;  4PUO A;  5KPR A;  3BZK A;  2OZS A;  3MXJ A;  4CGD A;  5AQI A;  3OHR A;  2D1K A;  3CJB A;  2P9U B;  5AQT A;  3CQ8 A;  2B4J A;  3DXK B;  5J2M A;  2V52 B;  1JCE A;  1LWC A;  4FWN A;  5E41 A;  1DKG D;  3H6E A;  4Y1D A;  2UUA K;  2HNZ A;  2FXU A;  1GOC A;  5C24 A;  1JL2 A;  4BRG A;  4DTO A;  3RR7 A;  1QQO A;  3U9Z A;  3AVC A;  4E7J A;  3DLB A;  2YV0 X;  2FBX A;  3EY1 A;  1D9F A;  4LF6 K;  1S9E A;  3CC2 N;  5LJW A;  3QDK A;  5HRR A;  3ZET A;  5JVH L;  4JI7 K;  3H3O B;  1DLO A;  1B9D A;  5GAE P;  2FF3 B;  4IO9 L;  1QQN A;  2D0P A;  2KQ2 A;  2BGG A;  4CJL A;  3OY9 A;  1WSG A;  3EE8 A;  5GAG P;  4U7B A;  4O55 A;  3QES A;  3MN9 A;  3B8A X;  2P9I B;  1XNQ K;  1BHL A;  4KPY A;  5CR4 A;  4H0V B;  4JI4 K;  3L2V A;  3T3F A;  4WYB A;  3NGY A;  1NGA A;  1NM1 A;  1K8A O;  1EKE A;  3S41 A;  5B8H A;  3D2F A;  3RTV A;  4LF9 K;  2HMP A;  5GIN A;  4QOZ B;  3CFO A;  4JKF A;  3JXU A;  2W42 A;  1X3N A;  1HNV A;  5KRS A;  2BDP A;  4WQ5 A;  2PAV A;  5AQK A;  1T8E A;  3NDK A;  4DF4 A;  3CMA N;  3CCJ N;  1TK8 A;  4FJ7 A;  4K42 A;  3L2R A;  5HLF A;  1CXQ A;  4FW2 A;  4DR6 K;  2E5L K;  4DG1 A;  4KFB A;  4JI8 K;  1NJW A;  1VQN N;  4GW6 A;  4FWQ A;  4DFJ A;  1Y64 A;  1RBU A;  4LSL A;  3VQ4 A;  4FPA A;  2O8C B;  4DQQ A;  3IG1 A;  5C2F A;  3J7Y P;  2IVO A;  3BZC A;  2XRI A;  4LSN A;  3I0R A;  3SQ0 A;  3NVK A;  5JMV A;  4IWV A;  5I9E B;  4JD2 A;  5EOY A;  4CF0 A;  3H45 C;  1CZA N;  4MQ3 A;  4CZH A;  1M1K O;  4BE2 A;  4JKG B;  5DM7 L;  3HOT A;  2HND A;  3DOK A;  4FWS A;  4YOY A;  4BE1 A;  4DTN A;  1ZBS A;  3H3N O;  3JAM O;  2X74 A;  1QHA A;  1EWQ A;  3OYC A;  2R7Y A;  5AQO A;  1RTI A;  4Q5V A;  4YDU A;  4YOR A;  5J2P A;  3MXM A;  1MA9 B;  4CHY A;  3DLH A;  1QSY A;  4DTS A;  3TU5 A;  3NMU A;  4J2B A;  4LD0 A;  1NKC A;  1X9W A;  4B1U B;  4I2Q A;  4DFK A;  4PKH A;  4GMJ B;  3AVF A;  3SUP A;  4K43 A;  3C7N B;  2F8T A;  4JI3 K;  1LW2 A;  5T7B A;  1TVR A;  2CH6 A;  3BP8 A;  3SYZ A;  3WT0 A;  1RDW X;  1XQS C;  4DR7 K;  4CFA A;  1TL3 A;  4HVJ A;  1N34 K;  3F2K A;  4XEI A;  2G8V A;  3NAE A;  4FWL A;  5EU7 A;  5M1N A;  3HVR A;  2O8B B;  4PKG A;  1WBB A;  5F0X A;  3VGL A;  2UXB K;  3AY9 A;  4IZ9 A;  4CEB A;  2OZM A;  2NRT A;  3CPW M;  1WSI A;  1ZBH A;  4E7L A;  4A2B A;  4CIF A;  2QA4 N;  1T6D A;  2A3Z A;  1WN7 A;  1Q81 O;  2GUP A;  3FZH A;  3LZJ A;  3O1B A;  3AVL A;  4RW9 A;  3HPO A;  3QBX A;  3PO5 A;  4BG9 A;  2OPQ A;  3U3Y A;  5J2N A;  1HQE A;  2P9S B;  3RWU A;  3MN7 A;  4BGB A;  3TAG A;  3DOL A;  1T6C A;  4FO0 A;  5FRO A;  1RFQ A;  3G10 A;  1HNX K;  4CJ4 A;  4BDZ A;  3MXI A;  4XH5 A;  4FZY A;  1LAV A;  4M7Y A;  2QWR A;  3BEX A;  4KV8 A;  1E3M A;  4CD3 A;  4HHT A;  1KLM A;  4YOU A;  4ICL A;  4KH6 A;  4JHD A;  3RVC A;  1BDG A;  1RNH A;  1W9H A;  3K57 A;  2O4I A;  1KSP A;  3AO1 A;  4JLH A;  5CYM A;  4FJH A;  2IOC A;  1SL0 A;  4CEF A;  2Q31 A;  3V9X A;  4E1J A;  2W6L A;  2HHV A;  2P5G A;  4F3O A;  3EZW A;  3PLA A;  4BRN A;  4GV3 A;  1KRP A;  5HP1 A;  3ITH A;  3ZYY X;  4WCE L;  4CGG A;  1FKP A;  3GBT A;  5CYQ A;  1EQY A;  3E9P A;  4LFB K;  3TAR A;  4M3X A;  2RN2 A;  1WSE A;  2XY8 A;  5C42 A;  4OJR A;  3O3H A;  1QS4 A;  3TTC A;  4CVN E;  3HPG A;  4YOV A;  5BRF A;  5D3G A;  3I56 N;  3CXC M;  1U04 A;  3D7E O;  4DU4 A;  1HUX A;  3RRH A;  2FLO A;  3VF2 A;  5EXW A;  4JI5 K;  3P5J A;  3OYF A;  4IEE A;  1D5A A;  1MDU B;  5AR0 A;  4FLU A;  1YHQ N;  2ZJQ L;  1BIZ A;  1NK9 A;  3AO5 A;  1N33 K;  2GUI A;  1FJG K;  3PO4 A;  4ZHR A;  3RRG A;  4R79 A;  3CJ9 A;  1KVB A;  2AA4 A;  3QEX A;  4BC4 A;  4B9Q A;  1XHZ A;  4U67 L;  1K73 O;  4N5S A;  1Z05 A;  3HJF A;  4MDA A;  4KTZ A;  3WXK A;  3V1O A;  1QVF M;  3M8S A;  4QAG A;  4FZZ A;  4FM1 A;  3IFR A;  3M5R A;  1HPM A;  1T3V A;  5SWM A;  4AHT A;  3SMP A;  4LH5 A;  1TUY A;  5AQY A;  4Z4C A;  1NWK A;  3O6W A;  1XHX A;  4FWK A;  4CZJ A;  4BDY A;  3CCQ N;  1KXP A;  1NGH A;  2BAN A;  4ID1 A;  1RTD A;  4CEA A;  1I3A A;  2P9U A;  1G15 A;  1W2B M;  3CCL N;  1SV5 A;  3VQ7 A;  1XC9 A;  4E7I A;  3LDO A;  3ZT3 A;  2UUB K;  4JI6 K;  2GWK A;  4BR7 A;  4CZG A;  4G9Z A; 
#chains in the Genus database with same CATH homology
 2P9N B;  5KQ8 A;  2P9S A;  3VF6 A;  4CZI A;  3FLC O;  1P8Z A;  2JWL A;  3P4I A;  2V7Y A;  3O08 A;  3A5M C;  3QFU A;  4H0X B;  3U8X A;  4WFN L;  4LC9 B;  4YDU C;  1KD1 O;  1VQ9 N;  1Q82 O;  4K41 A;  1Z6R A;  5AQR A;  4CBX A;  2W41 A;  3WXJ A;  3M3Z A;  2E8A A;  1BUP A;  1EO1 A;  1NBW A;  3P31 A;  3CER A;  1X9J A;  2A42 A;  3DJC A;  5FPD A;  3CCR N;  1YJN N;  3O9T A;  4O5F A;  1GLB G;  3UKR A;  2Q1N A;  4B1X B;  2D0O A;  4IFE A;  5AQP A;  2OTL N;  3SBG A;  1TYQ B;  5AQQ A;  5BRH A;  1HX1 A;  1U2V B;  3TTD A;  2F7T A;  4C1N K;  3T7Z A;  3M6G A;  3VMF B;  4BR2 A;  1GLF O;  1VQM N;  1VQK N;  1KAZ A;  5AQV A;  4JKA A;  1IJJ A;  3WXM B;  4BR0 A;  1X3M A;  4DB3 A;  3ID6 A;  4FOI A;  4FVU A;  4QS7 A;  4EAH D;  4GVE A;  4L3Q A;  5AQG A;  3DXM B;  2P9I A;  3MWT A;  4WFA L;  2FSN A;  3GG4 A;  3U9D A;  4H5T A;  2I7P A;  4H5W A;  1V4S A;  3QIC A;  4IXC A;  4CZM A;  3E9O A;  3R8E A;  2NRR A;  4ISE A;  4H0O A;  2ZGY A;  5ELZ A;  3VGM A;  4H0Y B;  5AQX A;  5C15 A;  4RTF D;  1NGG A;  3AGK A;  4KH5 A;  4UY8 O;  2IIR A;  4BVO A;  4PHT X;  2ZJR L;  4ILH A;  1D4X A;  5C12 A;  1K8K B;  5GAD P;  3BF1 A;  4BG8 A;  3D2F B;  3E1Y A;  3KZB A;  4AF1 A;  3ATU A;  3CCM N;  1V4T A;  3MMV A;  2YX6 A;  3LL3 A;  2WFB A;  3VES A;  2YHX A;  1GLD G;  5JLF A;  2OAN A;  3L0Q A;  3UKR B;  3VEX A;  3A5O C;  3AAP A;  4JKH A;  5ADX A;  2Q0U A;  2P9K B;  3WQU A;  3L6Q A;  1VQO N;  1HJO A;  1TYQ A;  3G25 A;  4JKE A;  3WQT A;  2VWB A;  2BH1 A;  2GEL A;  3P38 A;  4RCH A;  3VPZ A;  1E4F T;  3DXK A;  2QW9 A;  3VTH A;  3CJA A;  4BR9 A;  3C6A A;  1HLU A;  1VQ4 N;  3T69 A;  1Q86 O;  2KHO A;  2QWP A;  1J6Z A;  2EWS A;  2HBK A;  3A5N C;  1YXQ A;  3SAF A;  2WUS A;  1YJW N;  1YIT N;  2HBM A;  2CGJ A;  3O80 A;  3VF4 A;  1YIJ N;  1LOT B;  3SAG A;  5GIO A;  1MWK A;  4BY9 C;  4H0P A;  3FZK A;  2QWO A;  4H5V A;  5JVG L;  2Q36 A;  5TKW A;  1NGI A;  3FR0 A;  4BRQ A;  1H1V A;  4BRL A;  3IMX A;  5KPZ A;  1KC8 O;  4C1N I;  1HKC A;  2ZF5 O;  3WEE A;  1YF5 L;  3O9S A;  4FWR A;  5LJV A;  4YOX A;  2ASO A;  4JK7 A;  3CJ7 A;  1K8K A;  2VGN A;  1DEJ A;  1BO5 O;  3NVM A;  2RE2 A;  3HRG A;  3O1W A;  4CZE A;  1NGJ A;  4EHT A;  3J7Z O;  3PIP L;  4G9Z A;  4JEP A;  3ZET B;  5GAH P;  3AAQ A;  3OA9 A;  4HTL A;  3MCP A;  3I8B A;  4H5R A;  3HSC A;  4BRC A;  2A41 A;  5KPR A;  5AQZ A;  2P9L B;  4JKG A;  1VQ5 N;  2ASM A;  4H5N A;  4DHY A;  2YHY A;  4A62 A;  5AQI A;  3OHR A;  2D1K A;  3QB0 A;  2E2P A;  4Z94 A;  3CJB A;  5MLC Q;  2IVP A;  2P9U B;  3O9U A;  5AQT A;  3VTI A;  4CZF A;  4KBO A;  3DXK B;  5KQD A;  2V52 B;  4CBW A;  3CCS N;  2YCH A;  1JCE A;  3FE1 A;  3N4P A;  4FWN A;  4BGA A;  3Q7B A;  2QWM A;  1DKG D;  2PFU A;  3H6E A;  4DKW A;  4HWI A;  3FZL A;  2FXU A;  4IOX A;  1VQ7 N;  2RHK A;  4QS9 A;  5TKY A;  3A0I X;  3ULE B;  4BRG A;  3D2E A;  4YOW A;  4BRH A;  2E1Z A;  1QQO A;  2FF6 A;  3IUC A;  3U9Z A;  4B1W B;  4EIA A;  5AQF A;  1M90 O;  5F2R A;  1XUP O;  3CC4 N;  1NGC A;  5CHI A;  1T44 A;  4CZL A;  5BRE A;  4MO4 A;  3CC2 N;  4WQ4 A;  4JNE A;  2GX9 A;  3LDL A;  4JN4 A;  3VET A;  5LJW A;  1K9M O;  2A6A A;  5KPT A;  3QDK A;  3ZET A;  4CJ7 A;  2ITM A;  5C2D A;  5JVH L;  3H3O B;  2GWJ A;  3SMS A;  5GAE P;  2FF3 B;  4IO9 L;  1QQN A;  2D0P A;  3ID8 A;  5M1F A;  3VER A;  3SBT A;  3R6M A;  2Q97 A;  3R1X A;  3EE8 A;  5GAG P;  4U7B A;  5FPN A;  4NLC A;  4BRO A;  4CZK A;  5JIC A;  3ENB A;  3DXM A;  3MN9 A;  3B8A X;  1YJ9 N;  2P9I B;  4IOC L;  2WBN A;  2VCP A;  3ZX3 A;  2YI1 A;  3G6E N;  3EN9 A;  4K25 A;  2F9W A;  1BOT O;  1DGK N;  5CR4 A;  4H0V B;  3R3L A;  4WYB A;  1NGA A;  1TUU A;  4BRE A;  1LCU A;  2V7Z A;  1NM1 A;  3VEV A;  5BPL A;  3J8A A;  2ASP A;  1K8A O;  1YUW A;  4IOA L;  2W40 A;  2NZT A;  4BC3 A;  1JCF A;  4WQ4 C;  3S41 A;  3D2F A;  5B8H A;  5LY3 A;  3CCE N;  2ZWH A;  3HI0 A;  2HMP A;  5GIN A;  1NMD A;  2D4W A;  1WOQ A;  4XH1 A;  3E9L A;  4JKF A;  3JXU A;  2CH5 A;  3H1Q A;  3RSE A;  4BR5 A;  4NLB A;  1X3N A;  1C0G A;  3LM9 A;  2P9K A;  4WQ5 A;  3TSU A;  2PAV A;  5AQK A;  3TSQ A;  2FSK A;  5HOO A;  4AM6 A;  5M1K A;  3CMA N;  4IEI A;  3UB5 A;  3SLC A;  3WUH A;  1DT9 A;  3ENH A;  3CCJ N;  4O8K A;  4I6M B;  1HKG A;  4K42 A;  1ATS A;  4OPA A;  4B1Z A;  4DQ8 A;  4GNI A;  4FPB A;  3LDP A;  2BUP A;  3OBY A;  4BRA A;  4JHD B;  3CPE A;  2VYP A;  1OVY A;  1VQN N;  4FWQ A;  2KLA A;  2FSJ A;  1Y64 A;  5FPM A;  4JKB A;  4MLE A;  1JJ2 M;  1GLE G;  4FPA A;  3CF5 L;  4JKC A;  5EVZ A;  2E20 A;  5C2F A;  2IVO A;  2QWQ A;  2E88 A;  3VEZ A;  4FWP A;  2E1Y A;  2J4R A;  5BPN A;  3NVK A;  3HOS A;  5JMV A;  2KKZ A;  1C0F A;  3AAR A;  4IWV A;  3VEW A;  2WC9 A;  5I9E B;  3CJC A;  1YVN A;  4JD2 A;  2V51 B;  3I33 A;  3N4Q A;  4BQZ A;  3G71 N;  5EOY A;  5F1X A;  3CHW A;  3H45 C;  1CZA N;  1N8R O;  3A8Y A;  1R59 O;  4BRK A;  4CZH A;  1M1K O;  3AGR A;  2P9L A;  3O4W A;  3F9M A;  3O8M A;  4ILG B;  4JKG B;  5DM7 L;  4EFH A;  3HOT A;  3L4I A;  2Q0R A;  4FOE A;  4YOY A;  4FWS A;  3CD6 N;  1S22 A;  2CGL A;  3UKU B;  1ZBS A;  2HF4 A;  2QM1 A;  3H3N O;  1S72 N;  1QHA A;  1NGB A;  4PL7 A;  5BR9 A;  3CC7 N;  5AQO A;  1GLL O;  3F5T A;  3W3D A;  3JS6 A;  5H1S Q;  4A2A A;  2ZJP L;  4YDU A;  4YOR A;  5ADX H;  1KAX A;  1MA9 B;  3TSP A;  3ULE A;  2QI2 A;  1Q18 A;  3D2E B;  2UYT A;  3K9K A;  4H0T B;  3TU5 A;  2P9P B;  3K9J A;  3NMU A;  4WF9 L;  3C6H A;  3EKU A;  3IDH A;  4QS8 A;  3O5B A;  3HBT A;  5AQW A;  4B1U B;  4PKH A;  2YHW A;  4MDB A;  1IG8 A;  1ESV A;  4K43 A;  3C7N B;  1RGI A;  1Q7Y O;  3EL2 A;  2QWL A;  3SK3 A;  3EKS A;  5JLH A;  4JD2 B;  4RWT A;  2CH6 A;  3BP8 A;  3MX2 A;  3KWI A;  3MCA B;  3WT0 A;  5AQN A;  2BTF A;  4PKI A;  1RDW X;  1XQS C;  4BRM A;  1SS6 A;  4JK8 A;  5AZJ B;  3F2K A;  4XEI A;  4JK9 A;  3CQY A;  1BG3 A;  2HF3 A;  2NRW A;  4FWL A;  5M1N A;  3KHY A;  3GL1 A;  5AQL A;  3CI5 A;  1JCG A;  3I55 N;  3KK7 A;  3CQX A;  3GOI A;  4PKG A;  2NRH A;  5AQH A;  2JWK A;  3VGL A;  5F0X A;  1MWM A;  3ZX2 A;  3FFK B;  2NRX A;  3AY9 A;  4IZ9 A;  4F9O A;  4BRF A;  2NRT A;  4EHU A;  3D6R A;  3KWG A;  3CPW M;  5C0Y A;  4A2B A;  1QZ5 A;  2GTD A;  4O8U A;  4FWM A;  1T6D A;  2QA4 N;  2A3Z A;  1Q81 O;  1NJI O;  3MDQ A;  2GUP A;  3FZH A;  2PBD A;  3O1B A;  3Q7C A;  4WQ5 C;  1YI2 N;  4GV6 A;  1S3X A;  4IJN A;  4FWO A;  1P90 A;  5AZI B;  1SZ2 A;  4A61 A;  3QBX A;  1ZC6 A;  3C7N A;  4CBU A;  4BG9 A;  1OKJ A;  3PIO L;  3CME N;  2P9N A;  2P9S B;  3RSE B;  3MN7 A;  4BGB A;  2E2N A;  2NRZ A;  4JAX A;  1T6C A;  4FO0 A;  1BWF O;  3CET A;  4CD1 A;  3TTF A;  1VQ6 N;  1G99 A;  1NGE A;  3C65 A;  1RFQ A;  2QXL A;  1O13 A;  4OO1 J;  4PL8 A;  5AQU A;  5M1P A;  3U4L A;  4BC5 A;  1GLA G;  2NNW A;  4NB4 A;  3DWL A;  4A59 A;  3GE1 A;  4XH5 A;  4MO5 A;  4AM7 A;  4B1V A;  1NGF A;  5M1O A;  4M7Y A;  2QWR A;  1SAZ A;  3BEX A;  4I6M A;  4IDH A;  4ISF A;  5EY4 A;  3DLL L;  1U6Z A;  5C10 A;  3DAW A;  4CD3 A;  4YOU A;  1KQS M;  4KH6 A;  3VEO A;  2Q2R A;  4JHD A;  3RVC A;  1BDG A;  5M1Q A;  1HKB A;  4A5A A;  1QVG M;  1U2V A;  3ZEU B;  4IO8 A;  4JKD A;  3GDQ A;  5BN8 A;  4BQL A;  3WXI A;  3ENO A;  4WFB L;  4IJA A;  3A5L C;  2E2Q A;  2Q31 A;  2DPN A;  5E26 A;  2A40 A;  4E1J A;  1SQK A;  2QTD A;  2NLX A;  3CCV N;  3OBW A;  4ISG A;  3BUZ B;  3EO3 A;  3EZW A;  3H46 O;  1VAZ A;  3PLA A;  4BRN A;  4GV3 A;  1NLV A;  2I7N A;  2AP1 A;  1VQP N;  5AQJ A;  3ZYY X;  1QQM A;  3VEY A;  4WCE L;  2HST A;  3GBT A;  3QBW A;  4NO7 A;  4BR4 A;  3TPQ A;  3H1V X;  1EQY A;  3HM8 A;  3E9P A;  3FZF A;  3LM2 A;  3UKU A;  3M1F A;  4BC2 A;  3MK6 A;  5EX5 A;  5DM6 L;  2HBJ A;  3O9R A;  5FPE A;  3MN5 A;  2QWN A;  3TTC A;  4FL9 A;  4YOV A;  4MLH A;  5BRF A;  3L4Q A;  1BU6 O;  2GEM A;  5AFU A;  5AQS A;  1W97 L;  3I56 N;  4M7X A;  3CXC M;  1ATR A;  4M63 C;  4BRP A;  1RDU A;  3D7E O;  3C0B A;  3ZEU A;  5AQM A;  4CI6 A;  3MX5 A;  1VQL N;  2P9P A;  4B1Y B;  3VEN A;  1HUX A;  2FLO A;  5CE3 A;  3VF2 A;  3O9Q A;  3LDN A;  5EXW A;  3FZM A;  4DCH A;  4IEE A;  1MDU B;  5AR0 A;  2YJE A;  3CCU N;  2QEX N;  1YHQ N;  1GLC G;  2ZJQ L;  4BRI A;  3VOV A;  5BPM A;  3ATV A;  3IKM A;  4A5B A;  4R79 A;  3CJ9 A;  3ZX0 A;  1GLJ O;  5E84 A;  3G4S N;  2ZGZ A;  3SAH A;  2H3G X;  4GV9 A;  1E4G T;  2AA4 A;  4A57 A;  5HL7 L;  4BVP A;  2NRV A;  4BC4 A;  2YJF A;  4B9Q A;  3WEE B;  2VGM A;  3QFP A;  4ILJ A;  4U67 L;  5AZJ A;  1K73 O;  3W0L A;  1Z05 A;  4MDA A;  4Y0W A;  4KH4 A;  3VGK A;  1VQ8 N;  3WXK A;  4J8F A;  4H03 B;  4YOT A;  1QVF M;  3P39 A;  4OPH A;  2IVN A;  1QZ6 A;  1BA0 A;  5BN9 A;  3SJH A;  1ATN A;  3IFR A;  3M5R A;  2OTJ N;  4C23 A;  1BA1 A;  3R9P A;  1HPM A;  1T3V A;  3HTV A;  3BF3 A;  2HBL A;  3SMP A;  2CGK A;  1TUY A;  3HZ6 A;  4GY2 B;  5AQY A;  5AFU H;  1ILY A;  1NWK A;  1WUA A;  3O6W A;  4XH4 A;  4FWK A;  4CZJ A;  3FGU A;  1YAG A;  1ZXO A;  3OW2 M;  3UE5 A;  2E2O A;  5GIP A;  1KXP A;  1KAY A;  3CCQ N;  2F9T A;  1NGH A;  3EE9 A;  3E66 A;  2P9U A;  3MN6 A;  1W2B M;  3CCL N;  3CJ1 A;  2A5X A;  1NGD A;  3LDO A;  3CIP A;  5AZI A;  2HOE A;  3QML A;  4BRD A;  3WXL A;  5BRD A;  2GWK A;  3LDQ A;  1XC3 A;  3MWP A;  4FSV A;  4BR7 A;  3KVG A;  4CZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...