2YHXA

Sequencing a protein by x-ray crystallography. ii. refinement of yeast hexokinase b co-ordinates and sequence at 2.1 angstroms resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
457
structure length
457
Chain Sequence
AAAXDXSLVEVHXXVFIVPPXILQAVVSILTTRXDDXDSSAASIPMVPGWVLKQVSGAQAGSFLAIVMGGGDLEVILISLAGRQESSIXASRSLAAAMSTTAIPSDLWGNXAXSNAAFSSXEFSSXAGSVPLGFTFXEAGAKEXVIKGQITXQAXAFSLAXLXKLISAMXNAXFPAGDXXXSVADIXDSHGILXXVNYTDAXIKMGIIFGSGVNAAYWCDSTXIGDAADGGXXGGAGXMXICCDQSSFRKAFPSLPQIXYLXTLNXXSPXAXKTFXKNSXAKNXGQSLRDVLMXFKXXGQXHXXXAXSFXAANVENTSYPAKIQKLPHFDLRXXXDLFXGDQGIAXKTXMKXVVRRXLFLIAAYAFRLVVCXIXAICQKKGYSSGHIAAXGSXRSYSGFSXNSATXNXNIYGWPQSAXXSKPIXITPAIDGXGAASXVIXSIASAXXSXAXXSAXXA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEXOKINASE B
publication title Sequencing a protein by x-ray crystallography. II. Refinement of yeast hexokinase B co-ordinates and sequence at 2.1 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase(phosphoryl,alcohol acceptor)
total genus 123
structure length 457
sequence length 457
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 1978-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03727 Hexokinase_2 Hexokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2yhxA02
3.40.367.20 Alpha Beta 3-Layer(aba) Sandwich Hexokinase; domain 1 Hexokinase; domain 1 2yhxA03
3BP8A 4H5NA 5AQZA 4B1VA 2ASOA 4A2AA 5AQSA 4B1XB 4FWNA 1DEJA 2D0PA 5AZJA 4BR2A 3FZMA 3WEEA 4CZLA 4JD2B 2QXLA 3M1FA 4MO4A 5EVZA 3QFPA 4XEIA 3A5NC 1GLFO 2V7YA 3UE5A 3DXMB 4MLEA 2IVPA 3G25A 3R8EA 4PKGA 4BC5A 1HPMA 4DHYA 3JS6A 4O8KA 3I33A 2D0OA 2Q0UA 4WQ4C 2QWRA 3ATVA 3ZX3A 2OANA 3WUHA 3ID8A 1BUPA 3WQTA 2AA4A 2P9PB 2Q2RA 1KAXA 2YJEA 4JN4A 5KQDA 3CQXA 3BF1A 4BC3A 1NBWA 1BO5O 4IXCA 1XUPO 3HSCA 3UKUA 4BRKA 2QW9A 1NLVA 4MLHA 2PBDA 3MMVA 4BR7A 5AZIB 3ZETB 5AQVA 4B1WB 2GUPA 5KPTA 4BROA 1BG3A 2D4WA 3BEXA 3GBTA 1R59O 4FOIA 4FWOA 4DB3A 3R6MA 2P9SA 4Z94A 4KBOA 3IUCA 3D2EB 3A8YA 3EL2A 4CBUA 3LM9A 4BRLA 2P9UA 4ISEA 2E2NA 4BRQA 3HM8A 2CH6A 4RCHA 5EX5A 1HKBA 1U6ZA 2QWQA 2QWMA 3O1BA 4JAXA 4BR9A 5TKYA 1BA0A 3I8BA 4FOEA 4BQLA 2PAVA 2QWLA 3VENA 1LOTB 4FSVA 1S22A 4FWPA 1ATNA 5F1XA 3B8AX 3L6QA 3SMPA 3WXJA 1GLEG 3CQYA 3MN9A 1E4FT 1NMDA 1V4SA 1V4TA 3VGLA 3RSEB 4M7XA 1X3NA 3BUZB 4B9QA 2Q97A 4XH5A 3VEYA 2V52B 3MN6A 4FWMA 4RTFD 3QICA 4H5TA 2E1ZA 5AQQA 2Q1NA 3ZX0A 4CZMA 1ZXOA 4XH1A 5FPMA 4O5FA 2W40A 1LCUA 1NGIA 5AQHA 4B1ZA 2YJFA 4C23A 3L0QA 5CE3A 2IVNA 3GDQA 3QDKA 3U9DA 4CI6A 5B8HA 2CGLA 3M6GA 5AQNA 2P9IB 2P9NA 2E2QA 4IJAA 4BRMA 3DXKA 1NGGA 2P9LB 4BRCA 3VF6A 3HTVA 3AAPA 2A42A 3D7EO 1G99A 1HLUA 1XQSC 2E1YA 1RDWX 1E4GT 5AFUA 1KAZA 4IJNA 3O08A 2QM1A 4QS8A 3FR0A 4XH4A 4CD3A 3ULEB 5E26A 3FZLA 5AZIA 4FL9A 2FLOA 4BRNA 3IDHA 5JLFA 4EAHD 4QS7A 3D2FB 3VESA 2WUSA 3O6WA 3SLCA 3EZWA 4BGBA 2EWSA 3FZKA 2ZF5O 5AQKA 2QWOA 1ZBSA 1H1VA 4FWQA 3VOVA 3FE1A 3SMSA 2FF6A 4EFHA 1WOQA 5EXWA 2FXUA 2HF3A 4BC4A 3IFRA 4BC2A 5FPDA 2FSNA 4FWKA 3VEOA 4FWLA 3CERA 3ZEUA 4BRHA 4I6MA 3ZX2A 1MA9B 2P9KA 3H1QA 1K8KB 4K42A 4M7YA 2VCPA 4GY2B 2CGJA 4GNIA 3C7NB 1BOTO 1QZ5A 3VEWA 5BPMA 5AQIA 1OKJA 2CGKA 5AQYA 3A5OC 4JNEA 2FF3B 3CJ7A 2FSJA 2HOEA 2ZGYA 3A5MC 4K25A 4LC9B 2YI1A 1S3XA 3WT0A 4CD1A 4YDUA 3GE1A 4A62A 4CJ7A 2BTFA 3KZBA 4CZIA 3QBXA 4ISFA 3LDPA 3GOIA 4CBWA 2VWBA 5BPLA 3CJAA 4PL7A 1T6DA 4JHDA 3EKSA 5AZJB 1NGJA 3WEEB 2I7PA 4BVOA 3KHYA 5E84A 2F9WA 5AQUA 4BRFA 5AFUH 3UKRB 5AQRA 4CZJA 2BUPA 3FLCO 2DPNA 3DWLA 1XC3A 3FGUA 4H03B 1YXQA 4EHTA 1Y64A 2P9IA 4NO7A 3AY9A 3H3OB 3LL3A 1NM1A 3LDNA 2CH5A 4A2BA 3IMXA 4YDUC 1BU6O 1RFQA 5AQOA 1EQYA 1QZ6A 4IZ9A 5FPEA 1NGEA 1KXPA 4PKHA 1NGFA 1TYQB 3ENHA 1U2VA 1Z05A 3H1VX 1C0GA 1SAZA 5EOYA 4AM6A 4H0XB 3CI5A 4NB4A 4BR4A 3ULEA 4WQ5A 2E20A 4BR0A 1JCEA 5ELZA 4JD2A 4H0OA 3W3DA 3VF4A 3SK3A 1IG8A 3W0LA 1ATRA 5AQMA 4CZHA 4FPAA 3VEXA 4H5VA 5BRHA 4CZFA 3DXMA 1MWMA 2P9UB 1QQNA 3ENOA 5ADXA 1D4XA 5I9EB 3VETA 2UYTA 5AQPA 5JLHA 2IVOA 5AQXA 3VGMA 2P9PA 1GLBG 3CHWA 5EY4A 2GWKA 4L3QA 4M63C 3FZHA 2KHOA 4WQ5C 4BRDA 3UB5A 3AARA 2NRHA 5BRFA 5LJVA 3S41A 1QHAA 3ZETA 2A41A 4FWSA 3MDQA 2YHYA 2GWJA 4IO8A 1Q18A 1YVNA 3HI0A 1BWFO 3WXKA 1X9JA 4FO0A 3U8XA 4H0VB 3A0IX 5LY3A 4B1YB 4H5WA 2YHWA 3CIPA 1NGCA 3AAQA 3WXIA 1JCGA 3VGKA 3D2EA 4H0TB 2HF4A 3P4IA 5F2RA 3DJCA 4QS9A 5BRDA 2A6AA 1WUAA 3H45C 3QMLA 2Q36A 2ITMA 1T44A 4CZGA 4PKIA 1SQKA 4FWRA 3EO3A 4DQ8A 3UKRA 1GLCG 2E2PA 3MCPA 2GEMA 3O5BA 2QWPA 2P9NB 1GLDG 1HJOA 5AQGA 4ISGA 3VEVA 2AP1A 3J8AA 1NGHA 3DXKB 1TUYA 1ATSA 3U9ZA 1J6ZA 2FSKA 4FPBA 1MDUB 1NGBA 3QB0A 2GTDA 3EKUA 3VF2A 3RSEA 1CZAN 2E2OA 2A5XA 5BN9A 3VEZA 3TU5A 1TYQA 3VERA 1BDGA 5LJWA 5BR9A 5ADXH 1Z6RA 3A5LC 4BG8A 3H3NO 2ZGZA 1KAYA 1IJJA 1MWKA 3VPZA 1GLLO 1RGIA 4Y0WA 3CJ1A 2H3GX 4K41A 2I7NA 2IIRA 3TPQA 3O1WA 2Q0RA 5BPNA 1NGAA 1P8ZA 4IWVA 1HKCA 3M3ZA 3R9PA 4BRPA 1TUUA 3H46O 3KVGA 2E8AA 1YAGA 4EIAA 4EHUA 2P9LA 3EN9A 4AM7A 4RWTA 1BA1A 2YCHA 3CJCA 2VYPA 3CETA 4A61A 4BQZA 3ZEUB 2ZWHA 3C0BA 4I6MB 3CJBA 2P9KB 4CBXA 5JICA 2GELA 4E1JA 3GG4A 4WYBA 5FPNA 5AQJA 5BN8A 5AQTA 4BREA 4F9OA 3HZ6A 3O4WA 3UKUB 3JXUA 4PL8A 3LDQA 3O8MA 5F0XA 2NLXA 4BG9A 3HBTA 3MN7A 4CZEA 4MO5A 3U4LA 3WQUA 3QBWA 5KPZA 2A40A 2QWNA 1NGDA 1HUXA 3SJHA 3ATUA 1ZC6A 1T6CA 3D2FA 3LM2A 1C0FA 3WXLA 5BREA 2HMPA 1NWKA 1HX1A 2Q31A 3LDOA 5AQLA 2P9SB 2E88A 2F9TA 2V7ZA 3L4IA 4K43A 4BRGA 3MN5A 5AR0A 4BVPA 2ASMA 4J8FA 3DAWA 1SZ2A 3BF3A 4H0YB 4JHDB 1ESVA 4BGAA 5AQFA 2J4RA 2ASPA 3MK6A 3QFUA 4BRIA 4B1UB 1QQMA 5KQ8A 3LDLA 1K8KA 1GLJO 3C7NA 1DKGD 3FZFA 4HTLA 5JMVA 2W41A 3CJ9A 3GL1A 5AQWA 1QQOA 4CZKA 1HKGA 3F9MA 1DGKN 2V51B 2YHXA 3O80A 3OHRA 2D1KA 1YUWA 4HWIA 2NZTA 1GLAG 4H0PA 4DCHA 4WQ4A 3H6EA 4BRAA 5KPRA 3FFKB 1JCFA 1U2VB 2A3ZA 4H5RA 1X3MA 4BR5A
chains in the Genus database with same CATH superfamily
4M3UA 2E6MA 3BP8A 1IKXA 2R7YA 4AHSA 2ASOA 5AQSA 2Y1IA 2HBLA 3KLHA 3DOKA 1YI2N 3MEDA 3KLFA 4BR2A 3WEEA 5JVHL 1QQCA 3OYDA 3CPWM 2QXLA 3M1FA 4MO4A 5EVZA 1RBUA 2RPIA 1GLFO 2NRTA 3UE5A 4MLEA 3R8EA 3SNNA 4O8KA 3J7YP 2Q0UA 2HHVA 2QWRA 4B3OA 4JRPA 3ID8A 4CF8A 1UA1A 1BUPA 3TSUA 4DKWA 1GOBA 3AVHA 3WQTA 5KQDA 1TAQA 3BF1A 3O9TA 3F2KA 4IXCA 3AA3A 1ITGA 4BRKA 4J2DA 3SQ2A 3OY9A 1NLVA 2ETJA 3MMVA 4BR7A 1B9DA 5AZIB 1HYSA 4CK2A 4BDPA 2GUPA 3G0ZA 4CGFA 1RDBA 3K5OA 3RRHA 2BDPA 2IS3A 4JK9A 2B4JA 3L3VA 4FWOA 4BWJA 1I39A 4KBOA 1RT7A 3D2EB 3A8YA 3ZT1A 2GV9A 3LM9A 1WB9A 4BRLA 2P9UA 3IG1A 4FLVA 5CYQA 3T7ZA 2CH6A 1HKBA 2QWMA 3DLEA 2ZJRL 3I8BA 1EX4A 5HROA 3J80O 4YNQA 4BY9C 1TKTA 2PAVA 2O8BA 4FWPA 1S22A 1ATNA 3KWGA 1NJZA 3VA0A 1JXBA 4KH4A 1GLEG 1NOYA 1E4FT 1NMDA 1V4SA 2Y1JA 3RSEB 1LWEA 1X3NA 4B9QA 3C65A 3WNEA 2A1RA 4DR1K 1HRHA 4H5TA 1L5UA 3Q7BA 2O4IA 2AJQA 4DTPA 2Q1NA 3ZX0A 1S5JA 3HXMA 4CHOA 3DLGA 3ID6A 4R5PA 1OH6A 2W40A 1JL2A 4IOCL 4B1ZA 4FJ8A 3VQQA 3NF6A 2IVNA 5B8HA 1U45A 4JYAK 1VK0A 4IJAA 3AA5X 5JVGL 4BRCA 3C94A 3VF6A 3AVAA 3CD6N 4DSEA 3TAMA 3KD1E 3NHGA 2O8FB 1G99A 4N76A 3PSFA 4Z4FA 2QM1A 2XO7A 2G8WA 1S9EA 4QS8A 4C1NI 4CEDA 4XH4A 3ULEB 3CQ8A 1LWCA 3MX2A 5JLFA 4BRNA 4CEQA 2RKIA 4LD0A 4JKGA 4CGDA 3VN5A 1Q9XA 2WUSA 4NCGA 2HVHA 2EWSA 3PY8A 2QWOA 3TTFA 1H1VA 3LP1A 4CIFA 3FE1A 4CJEA 4I2PA 4KTQA 2FXUA 4JKCA 3O3GA 3VEOA 1SL1A 2F7TA 3O9UA 3ZEUA 1HNXK 4F2RA 1MA9B 2VCPA 4GY2B 4DTSA 3TTDA 4CFDA 1QZ5A 2VWKA 1JLBA 3HM9A 2CGKA 4FJLA 1IKWA 1Q82O 3CJ7A 3IKMA 1NKBA 4FM2A 2ZGYA 4LC9B 3WT0A 3AVKA 3TAFA 5I42A 1BI4B 1QE1A 4YDUA 4DTOA 4CZIA 3SPZA 3LDPA 2OZSA 1NK8A 4LF5K 4IO9L 1I3AA 1XI1A 4KHYA 1J9AA 1T6DA 3MEGA 4DV0K 5AZJB 4DSJA 1NGJA 4DG1A 4YOWA 1HNZK 5E84A 2YNHA 2F9WA 4BRFA 4LSNA 5AQRA 1NU0A 4J2BA 4E7LA 3DWLA 4CJ4A 4G9ZA 4FW2A 4AH9A 1NK0A 2YKMA 3C6UA 1VQ8N 5BR8K 3LDNA 4AF1A 3T1AA 2CH5A 3AV9A 3HO1A 1BU6O 2HHXA 1O13A 3T19A 1NGEA 4PKHA 3ITHA 4N56A 3AVFA 3ENHA 4JI2K 1U2VA 3KWIA 4CJKA 2UXBK 3KK7A 1XC9A 4DFJA 3HL8A 3OA9A 1KVAA 3O9QA 1TK8A 1U48A 3OJSA 3VF4A 3UIQA 5AQMA 4EZ6A 3VEXA 5BRHA 4CJVA 4HCCA 1VSMA 4Z4CA 3ENOA 5ADXA 1D4XA 5I9EB 3SUOA 3KD5E 2UYTA 3VQDA 3TARA 2WTUA 3CCVN 3AA2A 3VGMA 4W5QA 5EY4A 3U6FA 3QNOA 4DR2K 1WSEA 4BRDA 4YOYA 5HLFA 5D3GA 1M90O 3OVNA 5LJVA 3HPGA 1QHAA 1A5XA 3THXB 2A41A 4FWSA 3HK2A 1VQNN 3MDQA 2YHYA 3PSIA 1OVQA 3CCEN 2X78A 3CIPA 1K8AO 1RDCA 1NGCA 2NUBA 3WXIA 3D2EA 4E3SA 2YNFA 2HF4A 4QS9A 2A6AA 1WUAA 3CFRA 3QETA 3U3YA 3OYGA 3VQCA 2KKZA 4DF4A 3MXIA 5IT9O 1RTJA 4CHYA 1SQKA 3VA3A 2E2PA 2PZSA 5DM6L 4N5SA 1W2BM 1GLDG 4LFAK 2AP1A 3J8AA 3ZSXA 5K14A 1JL1A 4RW8A 4O55A 3U9ZA 5SWMA 4LFCK 2FSKA 4DQIA 1ZYQA 2HVIA 4B3MK 4DR4K 1N5YA 1NGBA 2IAJA 2GTDA 3EKUA 3OBWA 3RSEA 2E2OA 2A5XA 1W9HA 2Q3SA 3V9SA 4CJSA 1VAZA 3O4NA 3VERA 4ILJA 5BR9A 2XY5A 3EZ5A 5KRSA 2E5LK 4DLGA 4CF0A 2RN2A 3ZSQA 1MWKA 1GLLO 1HNWK 3L2UA 2HMIA 2UU9K 4KHSA 2IIRA 2NRVA 3HVTA 2ZM6K 1NGAA 4M45A 1P8ZA 1HKCA 3M3ZA 4CFBA 3R9PA 4BRPA 3DLBA 3HP9A 3BDPA 4GMJB 4OGCA 3KJVA 2Z1IA 4RWTA 3OS2A 2P1JA 1IBMK 3E01A 1TVRA 4BQZA 4CESA 3C0BA 2O8FA 4ICLA 2GELA 4WYBA 4IEEA 4KHUA 4F9OA 3JXUA 3IAYA 2OZMA 1HYVA 4BG9A 1Y97A 4MO5A 4WFBL 3CCMN 1BGXT 3SUNA 1EWQA 2QWNA 1NGDA 1Q7YO 3E9OA 3LM2A 3WXLA 4CIGA 3NCIA 1HX1A 4F3OA 5AQLA 3TAGA 5HL7L 4B8CA 5AR0A 2ASMA 5KI6A 1JXEA 3D6RA 3BF3A 4RG8A 3NVKA 1BCMA 3U3GA 1VQ7N 1RT4A 1O1WA 3QFUA 1QSSA 3BZCA 1JLGA 1VQON 4CECA 2QKBA 3THYB 3T3FA 4CF1A 4RW6A 1KSPA 4KTZA 2W41A 4W5OA 4Q5VA 1KRPA 1CLQA 4CZKA 4IG0A 1VSJA 4A5AA 5LL6Z 5LMNK 1XMOK 3O80A 3OHRA 1VQ6N 3TSQA 4KV8A 4O5BA 1C1CA 5EU7A 1VSDA 3P83D 4KRFA 3NH1A 1KC8O 1BI4A 5DMRA 2A3ZA 4H5RA 3J7ZO 3QEXA 3C95A 1ZBFA 3AVBA 2UXCK 4H5NA 5AQZA 4A2AA 5GAEP 1DEJA 4RW4A 3NF7A 5AZJA 2O8DB 4CGHA 4CZLA 4LFBK 2KZMA 3HSTB 1YVUA 3CXCM 3TR8A 3ZSVA 3C6HA 2NRZA 3P39A 2IVPA 3G25A 4KB1A 4PKGA 1HPMA 2D0OA 3ATVA 3ZX3A 2VGNA 3WUHA 4DTUA 4JI1K 3QEWA 2ITGA 5GADP 2P9PB 3IRXA 1KAXA 1YT3A 3DM2A 4JN4A 3QIOA 3CQXA 4AHTA 4BC3A 1BO5O 1XUPO 3HSCA 1UOCA 3UKUA 4CEEA 2QW9A 1K9MO 4MLHA 2PBDA 3HP6A 2X6NA 3V9UA 5MLCQ 3OYEA 2UXDK 3ZETB 3KKSA 4B1WB 1QVFM 4BROA 4B3SK 3RMDA 3OYJA 1EKEA 3GBTA 1R59O 4NCAA 2Z1JA 3VQAA 2P9SA 4Z94A 5C24A 3IUCA 3EL2A 3TI0A 4FJJA 4ISEA 3E1YA 3HM8A 5EX5A 4M3RA 4B9SA 4JAXA 1YJNN 3SAHA 5FRNA 4BQLA 1KD1O 2HHQA 3HVRA 4FM0A 4IG3A 4FSVA 2KLAA 5F1XA 3ZCMA 3TABA 3L6QA 3QNNA 3SMPA 4LF6K 1XHXA 3THXA 2D0AA 4CW7B 4JKAA 4JV5K 4M7XA 4OX9K 3BUZB 1YJ9N 3VQ8A 5HRPA 4AILC 1NK6A 2V52B 4F8RA 3R3LA 1VSLA 1CZ9A 3CF5L 2P51A 4RTFD 3QICA 1NNEA 5DM7L 3SYZA 5AQQA 2DFFA 2OCEA 3EYZA 1ZXOA 2O8CB 4OPAA 1LCUA 2PYLA 4B9LA 1NGIA 2YJFA 2OPRA 2ZJQL 4DQSA 3P38A 5CE3A 3GDQA 3QDKA 4DS5A 3K2PA 1K6YA 3M6GA 4Z4EA 4FCYA 2E2QA 4OKKA 3RMCA 5M1PA 4H4MA 1NGGA 3VMFB 2XY8A 4B9UA 4FJGA 3NVMA 2A42A 2W42A 1RDWX 3C6AA 4JKBA 4KHPK 1KAZA 3IS9A 3HT3A 4KH5A 3K59A 1RDUA 3K58A 4FLTA 4CD3A 2YNGA 1RILA 1FKPA 1OH7A 3CCJN 2FLOA 3OYKA 4BE1A 3VESA 1YHQN 4DF8A 3EZWA 4BGBA 3FZKA 3DI6A 5AQKA 5M1NA 5HRNA 4KI4A 1ZBSA 1BQMA 2OPPA 4M3WA 3G10A 4JI0K 2JWKA 4LF8K 4DV3K 1ZBUA 3DLLL 3ISNC 5GINA 4GKKK 3G4SN 4YOTA 3K9KA 4I2QA 5FPDA 2WC9A 3H1QA 1L3TA 3NBPA 4NXMK 1ASVA 4ZHRA 5C15A 3CYMA 4ZTFA 5BPMA 1S1TA 4CERA 2QK9A 1ASUA 4JEPA 1KCFA 4DR7K 1S1XA 1NG9A 2HOEA 3A5MC 2WFBA 3GE1A 4A62A 1J53A 2BTFA 4LF4K 3PX0A 1TKXA 4ISFA 1RNHA 3CJAA 1RBTA 3EY1A 3RVCA 5HP1A 5C0YA 2VG7A 2ZJPL 2I7PA 3TAPA 5AQUA 1VSIA 3K57A 1YIJN 2O8EB 1KVCA 2DPNA 4H03B 1XC3A 3FGUA 3THYA 1YXQA 4NO7A 3AY9A 4OPJA 1ASWA 1VRUA 4I9QA 4EZ9A 3M8RA 1SKWA 2GX9A 3OYBA 4U7BA 5KGXA 4Y1CA 4DLEA 4DSFA 4DR5K 1G15A 3H1VX 3K5LA 1C0GA 1VSHA 1VSFA 3CI5A 3BZKA 4NB4A 4DTXA 3CC2N 4ELUA 1TAUA 2O8DA 2NRXA 2IGIA 4RW7A 3W3DA 3T1YK 4PUOA 2B6AA 1ATRA 4CEOA 1RT1A 4CZFA 1VSEA 5GAGP 3ZSYA 2G8FA 1QQNA 5CHIA 3SAGA 4K0KK 3CPEA 5JS1A 5AQPA 3I55N 5JLHA 2VQFK 1S6PA 4CF9A 2P9PA 1GLBG 1EXQA 5M1FA 4BWMA 4KREA 2GWKA 1Q86O 4N47A 4WQ5C 3CMAN 3V9ZA 4I9LA 3PIPL 1TKZA 3ZETA 3M5RA 4FJMA 2GWJA 3HI0A 1BWFO 4FO0A 4E89A 4H0VB 3A0IX 1WN7A 4B1YB 4WFNL 3SV4A 1JCGA 2FBYA 3VGKA 4FJXA 4DQRA 4H0TB 5F2RA 5BRDA 3DJCA 3MXJA 4O4GA 3E9PA 4BDZA 4YOUA 4X66K 3H45C 2Q36A 2ITMA 1T44A 3F9KA 3DLRA 1RDDA 4CZGA 1IBLK 1SS6A 4FWRA 3EO3A 1ZBIA 3UKRA 1GLCG 3AVIA 3N4QA 2QWPA 1HJOA 2RHKA 4A57A 4ID1A 3VQPA 1NJYA 3DXKB 1W97L 1X1PA 5AJ3K 1TUYA 4DV1K 4JKHA 1ATSA 4U67L 4DTJA 4JKDA 4DFPA 3SUQA 4A59A 3K9JA 4DV7K 4NCBA 3MECA 3VF2A 4IFVA 1CZAN 4LY7A 2HB5A 4E7IA 1KFSA 1TYQA 4LF9K 5LJWA 1UAXA 2WOMA 4W5NA 5FRMA 3AVNA 3SBTA 5ADXH 3OYIA 3NDKA 3HJFA 3I0RA 3NF9A 3KK3A 1IJJA 1JLQA 2O8CA 4Y0WA 3KTQA 1KVBA 1UA0A 1YF5L 3K5MA 1ZBLA 4GV6A 1Z25A 4CJWA 2RE2A 5HOOA 5A2QO 2PYJA 3H46O 2W6KA 4ILHA 2HW3A 1HQEA 4DTNA 1YITN 1RT5A 3NMUA 4EHUA 3TAEA 3LAMA 2VG6A 3DLKA 4OVLA 1IKYA 2F8TA 4CGGA 2ZWHA 4KPYA 1XWLA 3B6PA 4CBXA 4MDAA 4E1JA 1LW2A 5FPNA 3AVLA 1EO1A 3DMJA 4OKJA 5AQTA 3HZ6A 3AO1A 3UKUB 4C8LA 3AVCA 5C2FA 1Q9YA 1VQMN 3K5NA 2NLXA 3MN7A 4CZEA 2KFZA 3HOTA 4KKOA 1TL1A 1S1UA 4OLBA 3ZSZA 1P90A 4FLUA 1T6CA 1C0FA 3ENBA 1RTDA 2HMPA 1NWKA 1N34K 5HBMA 2P9SB 2F9TA 2V7ZA 4BRGA 2WBNA 5GAHP 3K0SA 4J8FA 1SZ2A 2G8UA 2XRIA 4H0YB 3MCAB 3P5JA 4CJQA 4JHDB 2FC0A 4BGAA 2J4RA 2P5OA 4QCLA 2E6LA 4BRIA 4PA1A 1QQMA 3O4QA 1KQSM 3BGRA 1VQ4N 3LDLA 3RMBA 1GLJO 4O0JA 1IH7A 5GIPA 1FK9A 3B6OA 2DY4A 1R0AA 1OH5A 1HKGA 4LSLA 1DGKN 3SPYA 1QVGM 2V51B 4OPHA 2D1KA 2OPSA 1GLAG 3MWPA 4H0PA 4BRAA 4F2SA 3AVMA 5GIOA 5AQYA 1U4BA 4BR5A 4L8RB 4ZTJA 4B1VA 4B1XB 3ZLJA 3VQ7A 5M1QA 3FZMA 4DUYK 4F4KA 1KFDA 4CGJA 3QFPA 3CC4N 2O8EA 4XEIA 3KKRA 3A5NC 5C12A 3MX5A 3V6DA 2V7YA 3DXMB 3O9RA 4BC5A 2HBJA 3NGIA 3JS6A 3I33A 1VQ9N 4WQ4C 3SJJA 4DQPA 4UQGA 5FDLA 1QS4A 4LH5A 4E0DA 2AA4A 1S1VA 2Q2RA 3M8QA 4FM1A 5M1KA 3NE6A 2GUIA 5AQVA 4JI3K 3G71N 1YTAA 3SCXA 1TL3A 4DU4A 4OLAA 1J5OA 3QIPA 3EEQA 3T1HK 4GV9A 4DB3A 3R6MA 1N32K 4CBUA 3MAQA 2E2NA 4LF7K 4NLCA 1DLOA 4BR9A 5TKYA 4JI8K 1HNIA 3AO5A 3ZSWA 4FOEA 3CC7N 3LP2A 2QWLA 3VENA 1LOTB 1BQNA 1SUQA 1T3VA 4WFAL 1NOZA 3DRPA 3O3HA 1V4TA 3VGLA 4FJIA 1YTUA 3QESA 4A5BA 4XH5A 3SQ4A 3VEYA 3AGRA 4RW9A 3JSMA 1CXQA 3CFPA 3LDSA 2D5RA 2E1ZA 3ZSOA 3SI6A 2HHHK 4FZYA 4XH1A 4B9MA 4ID5A 4JK7A 5FPMA 4O5FA 4WF9L 4CJFA 4JRQA 5AQHA 5TKWA 4NXNK 2HSTA 5J2NA 2Z1GA 3L0QA 4KHQA 3U9DA 1DT9A 2DFHA 4BRMA 1S9GA 3CCRN 4YHHK 3DXKA 1XHZA 2P9LB 2KTQA 3QINA 4B3RK 1BHLA 4YFUA 1J5EK 3VQBA 4Z4HA 4C8NA 1XQSC 2HHSA 4Z0UA 4FVMA 1E4GT 5AFUA 3PX4A 4IJNA 3AVGA 1VSKA 3FR0A 4CJTA 3HPHA 5E26A 4E19A 3FZLA 4CJRA 4FL9A 1GOCA 3TAQA 4TSXA 1SKRA 4EAHD 1X9SA 4QS7A 1XNQK 3SLCA 1RBSA 3ZT2A 3SQ1A 3L2RA 3V9XA 1NK5A 2WONA 5J2QA 4CJLA 1I94K 3SBGA 4OPKA 4IOAL 3NH0A 3PIOL 4EFHA 3ZT0A 4BC4A 3IFRA 4NYFA 1IG9A 3ZT3A 4FWLA 3CERA 1A5WA 4BRHA 4ILGB 4K42A 4M7YA 2G8HA 2CGJA 3C7NB 1BOTO 4FJ7A 1FW6A 2BE2A 3VEWA 1NMNA 4FYDA 1OKJA 4X64K 4W5TA 3A5OC 3S3NA 4M3TA 2FSJA 1C1BA 3KIOA 2F8SA 4C1NK 2YI1A 4CD1A 5SZTA 3QBXA 3PO4A 3GOIA 4CBWA 4OGEA 1U04A 2VWBA 4E7KA 1RBRA 1T7PA 4KHWA 4JHDA 4MQ3A 3EKSA 4K8XA 3KHYA 3S3OA 4M42A 3RWUA 3UKRB 4FZXC 2BUPA 2VWJA 2XHBA 3D0PA 4FK2A 1SKSA 4EHTA 3HPOA 2P9IA 3H3OB 3LL3A 1VQKN 3NF8A 5M1OA 4JI4K 3OTOK 3LWLA 3RMAA 4A2BA 3WNHA 4GKJK 5J1EA 1NKCA 5CZ1A 1T05A 1RFQA 3NGYA 5AQOA 4FLYA 4KH6A 1EQYA 2KW4A 4V19S 4KI6A 1NJXA 5FPEA 1NK4A 2VGMA 3H08A 4YOXA 5C25A 1TYQB 3VQ4A 1Z05A 4C8KA 1N36K 3CM5A 4QOZB 2KFNA 1SAZA 4AM6A 4NLBA 1U49A 1FKOA 2HNZA 3VQ6A 4MDBA 4WQ5A 1W0HA 2E20A 4BR0A 5HRRA 1XMQK 3G6EN 1JCEA 4KFBA 3E66A 4H0OA 3SK3A 4DUZK 1IG8A 3W0LA 4FPAA 4B9VA 4CFAA 1IKVA 3DXMA 3THVA 3ASMA 4NYNA 4G1QA 3J7AP 1HMVA 4B3TK 2YKNA 3HRGA 5AQXA 3LZIA 4M3ZA 3PLAA 5CYMA 2D0CA 1LAWA 3SQ0A 4L3QA 2PY5A 3FZHA 4XIUA 4H8KA 3UB5A 3AARA 1BCOA 4J2AA 3BY5A 1TK0A 2NRHA 4YORA 5CR4A 3OS1A 3WXMB 1BIUA 1EWRA 1KTQA 1YVNA 4DSIA 4B08A 3CCSN 1D9FA 4DR3K 3I56N 3AAQA 4JI6K 2YNIA 1X9WA 3OJUA 1WSFA 4M41A 3HYFA 3QMLA 3OYAA 1NK9A 3VQ5A 3ZYYX 4DQ8A 4J2EA 5DK5A 3I8DA 3KLGA 2P9NB 5AQGA 1D9DA 1FJGK 1VHXA 1NGHA 4BE2A 2QEXN 3WNFA 1BISA 1T03A 3KLEA 2E4LA 4IFEA 3TSPA 5I3UA 4H4OA 3PV8A 1CZBA 4KB0A 2HHUA 1MDUB 1X9MA 3QB0A 2IOCA 2OPQA 4YOVA 3QEPA 4FW1A 1F21A 3VEZA 1IO2A 3TU5A 4DV6K 4WCEL 4OO1J 5H1SQ 1Z6RA 3A5LC 4BG8A 1REVA 2HNDA 2OYQA 3H3NO 1RT2A 2ZGZA 3LPTA 1KAYA 3SV3A 4OKEA 5KTQA 3OBYA 1RGIA 4DFKA 3KK2A 3CJ1A 1BL3A 2Q0RA 3NAEA 5BPNA 1LW0A 3ZT4A 1TUUA 3KVGA 2E8AA 1YAGA 4EIAA 3V1OA 2P9LA 1BA1A 2YCHA 2NRWA 2VYPA 3RTVA 1SL0A 4EP4A 4I6MB 1WAJA 2P9KB 3CJBA 3NFAA 2OTJN 3GG4A 5BN8A 4FJNA 3O4WA 4FLXA 4PL8A 3LDQA 3O8MA 5F0XA 2JGUA 3U4LA 3F73A 3WQUA 3QBWA 5KPZA 2A40A 3AO3A 4R79A 2Z1HA 3ATUA 3THWA 1ZC6A 5BREA 2OTLN 1T8EA 2Q31A 3LDOA 3L4IA 2E88A 2RF2A 4K43A 2EHGA 3MN5A 4CF2A 3O9SA 4B9TA 4CK1A 1ESVA 4IOXA 5AQFA 3TTCA 1WSJA 3MK6A 4PWDA 4C8OA 3QO9A 5KGWA 4I7FA 1S1WA 3CM6A 2D0BA 5IWAK 3ULDA 3C7NA 1DKGD 4AHRA 3FZFA 4HTLA 3VQEA 5JMVA 1NKEA 1HPZA 3GL1A 1D5AA 2DTUA 3JYTA 5HRSA 3LPUA 3MWTA 1QTMA 4W5RA 2YHXA 3DYAA 2NZTA 1EP4A 4DCHA 4CEZA 5JS2A 3T69A 2HNYA 4WQ4A 5KPRA 1SV5A 3FFKB 4GVEA 4AHVA 4HCBA 2UUBK 1X3MA 2UUAK 4GVMA 1ILYA 3KK1A 2P5GA 3DLHA 4FWNA 2XY7A 3RR8A 4BDYA 4HHTA 1KLMA 2D0PA 2G8VA 1N33K 3JAMO 2FBVA 3VTHA 1FXXA 4JD2B 3L2VA 4DWIA 2GBZA 2YX6A 1NJIO 4KO0A 1HJRA 2OA8A 4HUFA 3OS0A 4CIEA 1OH8A 3LAKA 3SZ2A 4KHNA 4DHYA 2OANA 4IKFA 1WNSA 3OYFA 1NK7A 2YJEA 1VQ5N 4PY5A 3F5TA 1NBWA 1JKHA 4K8ZA 4LH4A 2O4GA 4CJPA 3TANA 1BIZA 5KPTA 1BG3A 2D4WA 4CEAA 3BEXA 3M8PA 1LWFA 4FOIA 4CE9A 4FJ9A 1IV0A 4FJHA 3SAFA 3RR7A 2ZQBA 3E9LA 4DU1A 5J2MA 4IFYA 1S72N 4N41A 4BRQA 4RCHA 1TV6A 2QWQA 1U6ZA 2KQ2A 3O1BA 1BA0A 3NH2A 4E1MA 4F3TA 4DU3A 3I0SA 4DR6K 3B8AX 3OW2M 1A5VA 2YV0X 2YHAA 1B9FA 3WXJA 3CQYA 3MN9A 3MXMA 4FLZA 2Q97A 1Z26A 3CMEN 3CG7A 2HHWA 4ELTA 2B5JA 3MN6A 3CCLN 4FWMA 3L2WA 3PX6A 4DV4K 4CZMA 1VQLN 4WE1A 2BGGA 3R1XA 3CCUN 1MU2A 4C23A 5T7BA 1HNVA 3O3FA 4CI6A 2CGLA 3L2QA 5AQNA 4HTUA 2P9IB 3V9WA 2P9NA 5LMUK 4E7JA 3S3MA 3LZJA 4KTWA 4DTRA 3P1GA 3TWHA 1WBDA 4EP5A 3HTVA 4AHUA 3ALYA 2IDOA 3DRSA 3AAPA 3D7EO 3QLHA 1HLUA 4JKEA 2E1YA 1C6VA 1RDAA 3O08A 3P31A 5C42A 4FJKA 2HBKA 2QI2A 5AZIA 3IDHA 2FBXA 5C2DA 3D2FB 2X6SA 3LP3A 3O6WA 1HQUA 2G8IA 4DS4A 1EETA 4IBNA 1RT3A 2ZF5O 2XY6A 2F4VK 3V81A 2ZD1A 4FWQA 1J54A 3DOLA 3VOVA 3SMSA 1SL2A 2FF6A 3A2FA 3RRGA 1WOQA 3S9HA 5EXWA 2HF3A 1RCHA 4BC2A 4CHQA 2FSNA 4FWKA 4CHNA 4C8MA 4O44A 1JLEA 4I6MA 3ZX2A 2P9KA 1K8KB 4GNIA 1QHTA 4FVUA 1N6QA 4DQQA 5AQIA 1Q8IA 4CJUA 3V1QA 2YHBA 3FFIA 1E3MA 4JNEA 2FF3B 3LP0A 2DFEA 4ELVA 4K25A 1S3XA 2X74A 4CJ7A 1JLCA 4CVNE 3KZBA 4FK4A 5BPLA 4DTMA 3L4QA 4GW6A 4GV3A 4PL7A 4E7HA 1LV5A 3WEEB 4FJ5A 1DTTA 4BVOA 4IDHA 5AFUH 4CZJA 1LAVA 4CGIA 3FLCO 3MEEA 3LWMA 1Y64A 1NM1A 4FZZA 1C0UA 2ATQA 2KZZA 4X65K 3IMXA 4YDUC 1NJWA 1C1AA 1D8YA 3V1RA 1QZ6A 4IZ9A 4IDKA 4Z4GA 1JLAA 1KXPA 3M8SA 2VG5A 1NGFA 3C6TA 4JK8A 2QTDA 4MFBA 5EOYA 4H0XB 1ZBHA 4BR4A 3ULEA 3QEVA 1GOAA 5FROA 4B9NA 2I5JA 5ELZA 3VQ9A 4JD2A 1VRTA 3J81O 4DV2K 3PUFA 4CZHA 4H5VA 1MWMA 1JLFA 2P9UB 3OYMA 2G8KA 2F96A 5CZ2A 3OYCA 5J2PA 3AO2A 4DV5K 2IVOA 4CHPA 4Y1DA 3CHWA 4CEFA 4HVJA 2JLEA 4M3XA 2O8BB 3N4PA 4M63C 1RTHA 2KHOA 1JJ2M 4BACA 1RBVA 4CHZA 2BH1A 5BRFA 3S41A 4HUEA 5KRTA 3THWB 1HR0K 3CFOA 4IO8A 1Q18A 3LALA 1C0TA 1X9JA 1RTIA 3WXKA 3U8XA 1IBKK 5LY3A 3NGZA 4H5WA 1C0MA 2YHWA 1S6QA 4JI7K 3P4IA 4M3YA 3VTIA 3L8BA 1WSGA 4DSKA 4PKIA 4CFCA 4FLWA 3SUPA 2IC3A 3MCPA 2GEMA 3O5BA 4DSLA 4ISGA 3VEVA 3KLIA 1Q81O 4Z4IA 1VQPN 1J6ZA 2UUCK 4CJ3A 1N8RO 4FPBA 5BN9A 1CXUA 1WBBA 4QAGA 1BDGA 4HUGA 4BE0A 2LSNA 1L3SA 1HYZA 5CY4A 4Q0BA 5C10A 2VQEK 3AO4A 3VPZA 3EE8A 4JKGB 1B92A 4DMNA 3OYNA 2H3GX 4K41A 2I7NA 3TPQA 3O1WA 3DRRA 1WSHA 5FLXO 1K73O 2JWLA 4IWVA 4B8AB 1TK5A 4OJRA 3WNGA 2QXFA 2NNWA 3LANA 4O0IA 3PO5A 3EN9A 4AM7A 1WLJA 1QSLA 1L3UA 3CJCA 3CETA 4A61A 3AGKA 3ZEUB 2BANA 5JICA 4KAZA 2ZE2A 4CEBA 4CK3A 5AQJA 3QEIA 4JKFA 4BREA 2HHTA 2QA4N 2QKKA 1WSIA 3HBTA 4YY3K 4AQYK 1M1KO 3AVJA 1DTQA 1YJWN 4PQUA 3EE9A 1KLNA 4IEIA 4JS5A 1U47A 1HUXA 3SJHA 3ZSRA 4FXDA 2FBTA 2PFUA 3D2FA 1L3VA 3D45A 4DFMA 3AA4A 2W6LA 4X62K 4JLHA 4O8UA 4BVPA 4JS4A 4CCHA 3Q7CA 4E1NA 3DAWA 1TKDA 1WAFA 1W7AA 3QERA 1TGOA 3OYHA 4JI5K 3HOSA 1XNRK 2ASPA 2HBMA 4B1UB 5KQ8A 1K8KA 4AHCA 3CJ9A 5E41A 5AQWA 3V4IA 1QQOA 1OVYA 4PHTX 3OYLA 3F9MA 4FK0A 2NRRA 3CCQN 1RT6A 1UWBA 4UY8O 1YUWA 4HWIA 4CJ5A 3L3UA 2EX3A 3H6EA 1QSYA 1JCFA 1U2VB 3VETA 2A1SA
chains in the Genus database with same CATH topology
3BP8A 4H5NA 5AQZA 1ILYA 4B1VA 2ASOA 4A2AA 5AQSA 5GAEP 2HBLA 4FWNA 4B1XB 1DEJA 1YI2N 2D0PA 5AZJA 5M1QA 4BR2A 3FZMA 3WEEA 4CZLA 3VTHA 4JD2B 5JVHL 3CPWM 2QXLA 3M1FA 2YX6A 4MO4A 5EVZA 1NJIO 3QFPA 3CC4N 3CXCM 4XEIA 3A5NC 5C12A 3MX5A 3C6HA 1GLFO 2NRTA 2V7YA 2NRZA 3DXMB 3P39A 2IVPA 4MLEA 3UE5A 3G25A 3R8EA 3O9RA 4PKGA 4BC5A 1HPMA 2HBJA 4DHYA 3JS6A 4O8KA 3I33A 2D0OA 2Q0UA 1VQ9N 4WQ4C 2QWRA 3ATVA 3ZX3A 2OANA 2VGNA 3WUHA 5GADP 3ID8A 1BUPA 3TSUA 4DKWA 3WQTA 2AA4A 2P9PB 2Q2RA 1KAXA 2YJEA 1VQ5N 4JN4A 5KQDA 3CQXA 3BF1A 3F5TA 3O9TA 1NBWA 1BO5O 4BC3A 3F2KA 1XUPO 3HSCA 4IXCA 3UKUA 4BRKA 2QW9A 1K9MO 1NLVA 4MLHA 2PBDA 5M1KA 3MMVA 4BR7A 5MLCQ 5AZIB 3ZETB 5AQVA 4B1WB 1QVFM 2GUPA 3G71N 5KPTA 4BROA 1BG3A 2D4WA 3BEXA 4JK9A 3GBTA 1R59O 4FOIA 4FWOA 4GV9A 4DB3A 3R6MA 2P9SA 4Z94A 3SAFA 4KBOA 3IUCA 3D2EB 3A8YA 3E9LA 3EL2A 4CBUA 3LM9A 4BRLA 2P9UA 4ISEA 1S72N 3E1YA 2E2NA 4BRQA 3T7ZA 3HM8A 2CH6A 4RCHA 4NLCA 5EX5A 1HKBA 1U6ZA 2QWQA 2QWMA 3O1BA 4JAXA 4BR9A 5TKYA 1BA0A 1YJNN 2ZJRL 3I8BA 5HL7L 3SAHA 4FOEA 3CC7N 4BQLA 4BY9C 2PAVA 1KD1O 2QWLA 3VENA 1LOTB 4FSVA 1S22A 4FWPA 1ATNA 2KLAA 3KWGA 5F1XA 3B8AX 3OW2M 3L6QA 3SMPA 3WXJA 1T3VA 4KH4A 1GLEG 3CQYA 3MN9A 4WFAL 1E4FT 1NMDA 4JKAA 1V4SA 1V4TA 3VGLA 3RSEB 4M7XA 1X3NA 3BUZB 4B9QA 2Q97A 3CMEN 4A5BA 4XH5A 1YJ9N 3C65A 3VEYA 2V52B 3AGRA 3R3LA 3MN6A 3CCLN 3CF5L 4FWMA 4RTFD 3QICA 4H5TA 3Q7BA 5DM7L 2E1ZA 5AQQA 2Q1NA 3ZX0A 4CZMA 1ZXOA 4XH1A 4JK7A 1VQLN 5FPMA 4O5FA 3ID6A 4WF9L 4OPAA 2W40A 1LCUA 3R1XA 1NGIA 5AQHA 5TKWA 4B1ZA 2YJFA 3CCUN 4IOCL 2HSTA 2ZJQL 4C23A 3P38A 3L0QA 5CE3A 2IVNA 3GDQA 3QDKA 3U9DA 4CI6A 5B8HA 2CGLA 3M6GA 5AQNA 2P9IB 1DT9A 2P9NA 2E2QA 4IJAA 4BRMA 5M1PA 3CCRN 3DXKA 5JVGL 1NGGA 2P9LB 3VMFB 4BRCA 3VF6A 3HTVA 3CD6N 3NVMA 3AAPA 2A42A 3D7EO 1G99A 1HLUA 1XQSC 2E1YA 4JKEA 1RDWX 1E4GT 3C6AA 4JKBA 5AFUA 1KAZA 4IJNA 3O08A 2QM1A 4KH5A 3P31A 1RDUA 4QS8A 4C1NI 3FR0A 4XH4A 4CD3A 3ULEB 2HBKA 5E26A 3MX2A 2QI2A 3CCJN 3FZLA 5AZIA 4FL9A 2FLOA 4BRNA 3IDHA 5JLFA 4EAHD 5C2DA 4QS7A 3D2FB 4JKGA 3VESA 2WUSA 3O6WA 3SLCA 1YHQN 3EZWA 4BGBA 2EWSA 3FZKA 2ZF5O 5AQKA 5M1NA 2QWOA 1ZBSA 1H1VA 4FWQA 3TTFA 3SBGA 3VOVA 4IOAL 2JWKA 3FE1A 2FF6A 3SMSA 3PIOL 4EFHA 1WOQA 3DLLL 5EXWA 2FXUA 2HF3A 4BC4A 5GINA 3G4SN 3IFRA 4YOTA 4BC2A 4JKCA 3K9KA 5FPDA 2FSNA 4FWKA 3VEOA 4FWLA 2WC9A 3CERA 2F7TA 3O9UA 3ZEUA 4BRHA 4I6MA 3ZX2A 1MA9B 2P9KA 4ILGB 3H1QA 1K8KB 4K42A 4M7YA 2VCPA 4GY2B 2CGJA 4GNIA 3C7NB 3TTDA 1BOTO 5C15A 1QZ5A 4FVUA 3VEWA 5BPMA 5AQIA 1OKJA 2CGKA 5AQYA 4JEPA 3A5OC 1Q82O 4JNEA 2FF3B 3CJ7A 2FSJA 3IKMA 2HOEA 2ZGYA 3A5MC 4K25A 4LC9B 2WFBA 2YI1A 1S3XA 3WT0A 4C1NK 4CD1A 4YDUA 3GE1A 4A62A 4CJ7A 2BTFA 3KZBA 4CZIA 3QBXA 4ISFA 3LDPA 3GOIA 4CBWA 2VWBA 5BPLA 3CJAA 4IO9L 3L4QA 4GV3A 4PL7A 1T6DA 4JHDA 3RVCA 3EKSA 5AZJB 5C0YA 1NGJA 4YOWA 3WEEB 2I7PA 2ZJPL 4BVOA 3KHYA 4IDHA 2F9WA 5E84A 5AQUA 5AFUH 4BRFA 3UKRB 5AQRA 4CZJA 2BUPA 3FLCO 1YIJN 2DPNA 3DWLA 1XC3A 3FGUA 4H03B 4G9ZA 1YXQA 4EHTA 1Y64A 2P9IA 4NO7A 3AY9A 3H3OB 3LL3A 1VQKN 1NM1A 5M1OA 1VQ8N 3LDNA 4AF1A 2CH5A 4A2BA 2GX9A 3IMXA 4YDUC 4U7BA 1BU6O 1RFQA 1O13A 5AQOA 4KH6A 1EQYA 1QZ6A 4IZ9A 5FPEA 2VGMA 1NGEA 1KXPA 4PKHA 4YOXA 1NGFA 1TYQB 3ENHA 1U2VA 1Z05A 3KWIA 3H1VX 4JK8A 2QTDA 3KK7A 1C0GA 1SAZA 5EOYA 4AM6A 4H0XB 4NLBA 3CI5A 3OA9A 4NB4A 4BR4A 3ULEA 3CC2N 4MDBA 4WQ5A 2E20A 4BR0A 3O9QA 3G6EN 2NRXA 1JCEA 5ELZA 4JD2A 3E66A 4H0OA 3W3DA 3VF4A 3SK3A 1IG8A 3W0LA 1ATRA 5AQMA 4CZHA 4FPAA 3VEXA 4H5VA 5BRHA 4CZFA 3DXMA 5GAGP 1MWMA 2P9UB 1QQNA 3ENOA 5ADXA 3SAGA 5CHIA 1D4XA 5I9EB 3VETA 3CPEA 2UYTA 5AQPA 3I55N 5JLHA 3HRGA 3CCVN 2IVOA 5AQXA 3PLAA 3VGMA 2P9PA 1GLBG 3CHWA 5EY4A 5M1FA 2GWKA 1Q86O 4L3QA 3N4PA 3FZHA 2KHOA 4M63C 4WQ5C 4BRDA 4YOYA 3CMAN 3UB5A 3AARA 1M90O 1JJ2M 2NRHA 2BH1A 5BRFA 5LJVA 3PIPL 4YORA 1QHAA 5CR4A 3S41A 3ZETA 2A41A 4FWSA 3M5RA 1VQNN 3WXMB 3MDQA 2YHYA 2GWJA 4IO8A 1Q18A 1YVNA 3HI0A 1BWFO 3WXKA 1X9JA 4FO0A 3U8XA 4H0VB 3A0IX 5LY3A 4B1YB 4H5WA 4WFNL 3CCEN 3CCSN 2YHWA 3CIPA 1K8AO 3I56N 1NGCA 3AAQA 3WXIA 1JCGA 3VGKA 3D2EA 4H0TB 2HF4A 3P4IA 5F2RA 3DJCA 4QS9A 5BRDA 3E9PA 3VTIA 2A6AA 4YOUA 1WUAA 3H45C 3QMLA 2Q36A 2ITMA 1T44A 2KKZA 3ZYYX 4CZGA 4PKIA 1SQKA 1SS6A 4FWRA 3EO3A 4DQ8A 3UKRA 1GLCG 2E2PA 3MCPA 5DM6L 2GEMA 3N4QA 2QWPA 3O5BA 1W2BM 2P9NB 1GLDG 1HJOA 2RHKA 5AQGA 4ISGA 3VEVA 4A57A 2AP1A 3J8AA 1Q81O 1VQPN 1NGHA 2QEXN 3DXKB 1W97L 1TUYA 4JKHA 1ATSA 4U67L 3U9ZA 4IFEA 1J6ZA 2FSKA 4JKDA 3TSPA 1N8RO 4FPBA 1MDUB 1NGBA 4A59A 3K9JA 2GTDA 3QB0A 3EKUA 3VF2A 3OBWA 3RSEA 1CZAN 2E2OA 2A5XA 4YOVA 5BN9A 3VEZA 3TU5A 1TYQA 1VAZA 3VERA 1BDGA 4ILJA 4WCEL 5LJWA 5BR9A 4OO1J 5H1SQ 3SBTA 5ADXH 1Z6RA 3A5LC 4BG8A 3H3NO 2ZGZA 5C10A 1KAYA 1IJJA 1MWKA 3VPZA 3EE8A 1GLLO 3OBYA 1RGIA 4Y0WA 4JKGB 1YF5L 2H3GX 3CJ1A 2I7NA 4K41A 2IIRA 2NRVA 3TPQA 3O1WA 4GV6A 2Q0RA 2RE2A 1NGAA 5BPNA 1P8ZA 5HOOA 1K73O 2JWLA 4IWVA 1HKCA 3M3ZA 3R9PA 4BRPA 1TUUA 3H46O 3KVGA 2E8AA 1YAGA 2NNWA 4ILHA 4EIAA 1YITN 3NMUA 4EHUA 2P9LA 3EN9A 4AM7A 4RWTA 1BA1A 2YCHA 2NRWA 3CJCA 2VYPA 3CETA 4A61A 3AGKA 4BQZA 3ZEUB 2ZWHA 3C0BA 4I6MB 3CJBA 2P9KB 4CBXA 5JICA 2OTJN 2GELA 4MDAA 4E1JA 3GG4A 4WYBA 4IEEA 5FPNA 5AQJA 5BN8A 1EO1A 5AQTA 4JKFA 4BREA 3HZ6A 3O4WA 3UKUB 4F9OA 3JXUA 4PL8A 2QA4N 3LDQA 5C2FA 1VQMN 3O8MA 5F0XA 2NLXA 4BG9A 3HBTA 3MN7A 4CZEA 1M1KO 4MO5A 3U4LA 4WFBL 3HOTA 3CCMN 3WQUA 3QBWA 1YJWN 5KPZA 3EE9A 4IEIA 2A40A 2QWNA 1NGDA 1P90A 1HUXA 4R79A 1Q7YO 3SJHA 3ATUA 3E9OA 1ZC6A 1T6CA 2PFUA 3D2FA 1C0FA 3LM2A 3ENBA 3WXLA 5BREA 2OTLN 2HMPA 1NWKA 1HX1A 2Q31A 3LDOA 5AQLA 2P9SB 2E88A 2F9TA 2V7ZA 3L4IA 4K43A 4O8UA 3MN5A 5AR0A 2WBNA 4BRGA 4BVPA 2ASMA 3Q7CA 4J8FA 5GAHP 3DAWA 3D6RA 1SZ2A 3O9SA 3BF3A 3NVKA 4H0YB 3MCAB 4JHDB 1ESVA 1VQ7N 4BGAA 4IOXA 5AQFA 3HOSA 2J4RA 3TTCA 2ASPA 2HBMA 3MK6A 3QFUA 4BRIA 4B1UB 1QQMA 1KQSM 5KQ8A 1VQ4N 3LDLA 1K8KA 1GLJO 1VQON 3C7NA 1DKGD 3FZFA 4HTLA 5JMVA 5GIPA 2W41A 3CJ9A 3GL1A 5AQWA 1QQOA 4CZKA 1OVYA 4PHTX 1HKGA 3MWTA 4A5AA 3F9MA 1DGKN 2NRRA 1QVGM 2V51B 2YHXA 3O80A 3OHRA 2D1KA 4OPHA 3TSQA 1YUWA 3CCQN 4UY8O 1VQ6N 4HWIA 2NZTA 1GLAG 3MWPA 4H0PA 4DCHA 3T69A 4WQ4A 3H6EA 4BRAA 5KPRA 1KC8O 3FFKB 4GVEA 1JCFA 1U2VB 2A3ZA 4H5RA 3J7ZO 5GIOA 1X3MA 4BR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP8 A;  4H5N A;  5AQZ A;  4B1V A;  2ASO A;  4A2A A;  5AQS A;  4B1X B;  4FWN A;  1DEJ A;  2D0P A;  5AZJ A;  4BR2 A;  3FZM A;  3WEE A;  4CZL A;  4JD2 B;  2QXL A;  3M1F A;  4MO4 A;  5EVZ A;  3QFP A;  4XEI A;  3A5N C;  1GLF O;  2V7Y A;  3UE5 A;  3DXM B;  4MLE A;  2IVP A;  3G25 A;  3R8E A;  4PKG A;  4BC5 A;  1HPM A;  4DHY A;  3JS6 A;  4O8K A;  3I33 A;  2D0O A;  2Q0U A;  4WQ4 C;  2QWR A;  3ATV A;  3ZX3 A;  2OAN A;  3WUH A;  3ID8 A;  1BUP A;  3WQT A;  2AA4 A;  2P9P B;  2Q2R A;  1KAX A;  2YJE A;  4JN4 A;  5KQD A;  3CQX A;  3BF1 A;  4BC3 A;  1NBW A;  1BO5 O;  4IXC A;  1XUP O;  3HSC A;  3UKU A;  4BRK A;  2QW9 A;  1NLV A;  4MLH A;  2PBD A;  3MMV A;  4BR7 A;  5AZI B;  3ZET B;  5AQV A;  4B1W B;  2GUP A;  5KPT A;  4BRO A;  1BG3 A;  2D4W A;  3BEX A;  3GBT A;  1R59 O;  4FOI A;  4FWO A;  4DB3 A;  3R6M A;  2P9S A;  4Z94 A;  4KBO A;  3IUC A;  3D2E B;  3A8Y A;  3EL2 A;  4CBU A;  3LM9 A;  4BRL A;  2P9U A;  4ISE A;  2E2N A;  4BRQ A;  3HM8 A;  2CH6 A;  4RCH A;  5EX5 A;  1HKB A;  1U6Z A;  2QWQ A;  2QWM A;  3O1B A;  4JAX A;  4BR9 A;  5TKY A;  1BA0 A;  3I8B A;  4FOE A;  4BQL A;  2PAV A;  2QWL A;  3VEN A;  1LOT B;  4FSV A;  1S22 A;  4FWP A;  1ATN A;  5F1X A;  3B8A X;  3L6Q A;  3SMP A;  3WXJ A;  1GLE G;  3CQY A;  3MN9 A;  1E4F T;  1NMD A;  1V4S A;  1V4T A;  3VGL A;  3RSE B;  4M7X A;  1X3N A;  3BUZ B;  4B9Q A;  2Q97 A;  4XH5 A;  3VEY A;  2V52 B;  3MN6 A;  4FWM A;  4RTF D;  3QIC A;  4H5T A;  2E1Z A;  5AQQ A;  2Q1N A;  3ZX0 A;  4CZM A;  1ZXO A;  4XH1 A;  5FPM A;  4O5F A;  2W40 A;  1LCU A;  1NGI A;  5AQH A;  4B1Z A;  2YJF A;  4C23 A;  3L0Q A;  5CE3 A;  2IVN A;  3GDQ A;  3QDK A;  3U9D A;  4CI6 A;  5B8H A;  2CGL A;  3M6G A;  5AQN A;  2P9I B;  2P9N A;  2E2Q A;  4IJA A;  4BRM A;  3DXK A;  1NGG A;  2P9L B;  4BRC A;  3VF6 A;  3HTV A;  3AAP A;  2A42 A;  3D7E O;  1G99 A;  1HLU A;  1XQS C;  2E1Y A;  1RDW X;  1E4G T;  5AFU A;  1KAZ A;  4IJN A;  3O08 A;  2QM1 A;  4QS8 A;  3FR0 A;  4XH4 A;  4CD3 A;  3ULE B;  5E26 A;  3FZL A;  5AZI A;  4FL9 A;  2FLO A;  4BRN A;  3IDH A;  5JLF A;  4EAH D;  4QS7 A;  3D2F B;  3VES A;  2WUS A;  3O6W A;  3SLC A;  3EZW A;  4BGB A;  2EWS A;  3FZK A;  2ZF5 O;  5AQK A;  2QWO A;  1ZBS A;  1H1V A;  4FWQ A;  3VOV A;  3FE1 A;  3SMS A;  2FF6 A;  4EFH A;  1WOQ A;  5EXW A;  2FXU A;  2HF3 A;  4BC4 A;  3IFR A;  4BC2 A;  5FPD A;  2FSN A;  4FWK A;  3VEO A;  4FWL A;  3CER A;  3ZEU A;  4BRH A;  4I6M A;  3ZX2 A;  1MA9 B;  2P9K A;  3H1Q A;  1K8K B;  4K42 A;  4M7Y A;  2VCP A;  4GY2 B;  2CGJ A;  4GNI A;  3C7N B;  1BOT O;  1QZ5 A;  3VEW A;  5BPM A;  5AQI A;  1OKJ A;  2CGK A;  5AQY A;  3A5O C;  4JNE A;  2FF3 B;  3CJ7 A;  2FSJ A;  2HOE A;  2ZGY A;  3A5M C;  4K25 A;  4LC9 B;  2YI1 A;  1S3X A;  3WT0 A;  4CD1 A;  4YDU A;  3GE1 A;  4A62 A;  4CJ7 A;  2BTF A;  3KZB A;  4CZI A;  3QBX A;  4ISF A;  3LDP A;  3GOI A;  4CBW A;  2VWB A;  5BPL A;  3CJA A;  4PL7 A;  1T6D A;  4JHD A;  3EKS A;  5AZJ B;  1NGJ A;  3WEE B;  2I7P A;  4BVO A;  3KHY A;  5E84 A;  2F9W A;  5AQU A;  4BRF A;  5AFU H;  3UKR B;  5AQR A;  4CZJ A;  2BUP A;  3FLC O;  2DPN A;  3DWL A;  1XC3 A;  3FGU A;  4H03 B;  1YXQ A;  4EHT A;  1Y64 A;  2P9I A;  4NO7 A;  3AY9 A;  3H3O B;  3LL3 A;  1NM1 A;  3LDN A;  2CH5 A;  4A2B A;  3IMX A;  4YDU C;  1BU6 O;  1RFQ A;  5AQO A;  1EQY A;  1QZ6 A;  4IZ9 A;  5FPE A;  1NGE A;  1KXP A;  4PKH A;  1NGF A;  1TYQ B;  3ENH A;  1U2V A;  1Z05 A;  3H1V X;  1C0G A;  1SAZ A;  5EOY A;  4AM6 A;  4H0X B;  3CI5 A;  4NB4 A;  4BR4 A;  3ULE A;  4WQ5 A;  2E20 A;  4BR0 A;  1JCE A;  5ELZ A;  4JD2 A;  4H0O A;  3W3D A;  3VF4 A;  3SK3 A;  1IG8 A;  3W0L A;  1ATR A;  5AQM A;  4CZH A;  4FPA A;  3VEX A;  4H5V A;  5BRH A;  4CZF A;  3DXM A;  1MWM A;  2P9U B;  1QQN A;  3ENO A;  5ADX A;  1D4X A;  5I9E B;  3VET A;  2UYT A;  5AQP A;  5JLH A;  2IVO A;  5AQX A;  3VGM A;  2P9P A;  1GLB G;  3CHW A;  5EY4 A;  2GWK A;  4L3Q A;  4M63 C;  3FZH A;  2KHO A;  4WQ5 C;  4BRD A;  3UB5 A;  3AAR A;  2NRH A;  5BRF A;  5LJV A;  3S41 A;  1QHA A;  3ZET A;  2A41 A;  4FWS A;  3MDQ A;  2YHY A;  2GWJ A;  4IO8 A;  1Q18 A;  1YVN A;  3HI0 A;  1BWF O;  3WXK A;  1X9J A;  4FO0 A;  3U8X A;  4H0V B;  3A0I X;  5LY3 A;  4B1Y B;  4H5W A;  2YHW A;  3CIP A;  1NGC A;  3AAQ A;  3WXI A;  1JCG A;  3VGK A;  3D2E A;  4H0T B;  2HF4 A;  3P4I A;  5F2R A;  3DJC A;  4QS9 A;  5BRD A;  2A6A A;  1WUA A;  3H45 C;  3QML A;  2Q36 A;  2ITM A;  1T44 A;  4CZG A;  4PKI A;  1SQK A;  4FWR A;  3EO3 A;  4DQ8 A;  3UKR A;  1GLC G;  2E2P A;  3MCP A;  2GEM A;  3O5B A;  2QWP A;  2P9N B;  1GLD G;  1HJO A;  5AQG A;  4ISG A;  3VEV A;  2AP1 A;  3J8A A;  1NGH A;  3DXK B;  1TUY A;  1ATS A;  3U9Z A;  1J6Z A;  2FSK A;  4FPB A;  1MDU B;  1NGB A;  3QB0 A;  2GTD A;  3EKU A;  3VF2 A;  3RSE A;  1CZA N;  2E2O A;  2A5X A;  5BN9 A;  3VEZ A;  3TU5 A;  1TYQ A;  3VER A;  1BDG A;  5LJW A;  5BR9 A;  5ADX H;  1Z6R A;  3A5L C;  4BG8 A;  3H3N O;  2ZGZ A;  1KAY A;  1IJJ A;  1MWK A;  3VPZ A;  1GLL O;  1RGI A;  4Y0W A;  3CJ1 A;  2H3G X;  4K41 A;  2I7N A;  2IIR A;  3TPQ A;  3O1W A;  2Q0R A;  5BPN A;  1NGA A;  1P8Z A;  4IWV A;  1HKC A;  3M3Z A;  3R9P A;  4BRP A;  1TUU A;  3H46 O;  3KVG A;  2E8A A;  1YAG A;  4EIA A;  4EHU A;  2P9L A;  3EN9 A;  4AM7 A;  4RWT A;  1BA1 A;  2YCH A;  3CJC A;  2VYP A;  3CET A;  4A61 A;  4BQZ A;  3ZEU B;  2ZWH A;  3C0B A;  4I6M B;  3CJB A;  2P9K B;  4CBX A;  5JIC A;  2GEL A;  4E1J A;  3GG4 A;  4WYB A;  5FPN A;  5AQJ A;  5BN8 A;  5AQT A;  4BRE A;  4F9O A;  3HZ6 A;  3O4W A;  3UKU B;  3JXU A;  4PL8 A;  3LDQ A;  3O8M A;  5F0X A;  2NLX A;  4BG9 A;  3HBT A;  3MN7 A;  4CZE A;  4MO5 A;  3U4L A;  3WQU A;  3QBW A;  5KPZ A;  2A40 A;  2QWN A;  1NGD A;  1HUX A;  3SJH A;  3ATU A;  1ZC6 A;  1T6C A;  3D2F A;  3LM2 A;  1C0F A;  3WXL A;  5BRE A;  2HMP A;  1NWK A;  1HX1 A;  2Q31 A;  3LDO A;  5AQL A;  2P9S B;  2E88 A;  2F9T A;  2V7Z A;  3L4I A;  4K43 A;  4BRG A;  3MN5 A;  5AR0 A;  4BVP A;  2ASM A;  4J8F A;  3DAW A;  1SZ2 A;  3BF3 A;  4H0Y B;  4JHD B;  1ESV A;  4BGA A;  5AQF A;  2J4R A;  2ASP A;  3MK6 A;  3QFU A;  4BRI A;  4B1U B;  1QQM A;  5KQ8 A;  3LDL A;  1K8K A;  1GLJ O;  3C7N A;  1DKG D;  3FZF A;  4HTL A;  5JMV A;  2W41 A;  3CJ9 A;  3GL1 A;  5AQW A;  1QQO A;  4CZK A;  1HKG A;  3F9M A;  1DGK N;  2V51 B;  2YHX A;  3O80 A;  3OHR A;  2D1K A;  1YUW A;  4HWI A;  2NZT A;  1GLA G;  4H0P A;  4DCH A;  4WQ4 A;  3H6E A;  4BRA A;  5KPR A;  3FFK B;  1JCF A;  1U2V B;  2A3Z A;  4H5R A;  1X3M A;  4BR5 A; 
#chains in the Genus database with same CATH topology
 4M3U A;  2E6M A;  3BP8 A;  1IKX A;  2R7Y A;  4AHS A;  2ASO A;  5AQS A;  2Y1I A;  2HBL A;  3KLH A;  3DOK A;  1YI2 N;  3MED A;  3KLF A;  4BR2 A;  3WEE A;  5JVH L;  1QQC A;  3OYD A;  3CPW M;  2QXL A;  3M1F A;  4MO4 A;  5EVZ A;  1RBU A;  2RPI A;  1GLF O;  2NRT A;  3UE5 A;  4MLE A;  3R8E A;  3SNN A;  4O8K A;  3J7Y P;  2Q0U A;  2HHV A;  2QWR A;  4B3O A;  4JRP A;  3ID8 A;  4CF8 A;  1UA1 A;  1BUP A;  3TSU A;  4DKW A;  1GOB A;  3AVH A;  3WQT A;  5KQD A;  1TAQ A;  3BF1 A;  3O9T A;  3F2K A;  4IXC A;  3AA3 A;  1ITG A;  4BRK A;  4J2D A;  3SQ2 A;  3OY9 A;  1NLV A;  2ETJ A;  3MMV A;  4BR7 A;  1B9D A;  5AZI B;  1HYS A;  4CK2 A;  4BDP A;  2GUP A;  3G0Z A;  4CGF A;  1RDB A;  3K5O A;  3RRH A;  2BDP A;  2IS3 A;  4JK9 A;  2B4J A;  3L3V A;  4FWO A;  4BWJ A;  1I39 A;  4KBO A;  1RT7 A;  3D2E B;  3A8Y A;  3ZT1 A;  2GV9 A;  3LM9 A;  1WB9 A;  4BRL A;  2P9U A;  3IG1 A;  4FLV A;  5CYQ A;  3T7Z A;  2CH6 A;  1HKB A;  2QWM A;  3DLE A;  2ZJR L;  3I8B A;  1EX4 A;  5HRO A;  3J80 O;  4YNQ A;  4BY9 C;  1TKT A;  2PAV A;  2O8B A;  4FWP A;  1S22 A;  1ATN A;  3KWG A;  1NJZ A;  3VA0 A;  1JXB A;  4KH4 A;  1GLE G;  1NOY A;  1E4F T;  1NMD A;  1V4S A;  2Y1J A;  3RSE B;  1LWE A;  1X3N A;  4B9Q A;  3C65 A;  3WNE A;  2A1R A;  4DR1 K;  1HRH A;  4H5T A;  1L5U A;  3Q7B A;  2O4I A;  2AJQ A;  4DTP A;  2Q1N A;  3ZX0 A;  1S5J A;  3HXM A;  4CHO A;  3DLG A;  3ID6 A;  4R5P A;  1OH6 A;  2W40 A;  1JL2 A;  4IOC L;  4B1Z A;  4FJ8 A;  3VQQ A;  3NF6 A;  2IVN A;  5B8H A;  1U45 A;  4JYA K;  1VK0 A;  4IJA A;  3AA5 X;  5JVG L;  4BRC A;  3C94 A;  3VF6 A;  3AVA A;  3CD6 N;  4DSE A;  3TAM A;  3KD1 E;  3NHG A;  2O8F B;  1G99 A;  4N76 A;  3PSF A;  4Z4F A;  2QM1 A;  2XO7 A;  2G8W A;  1S9E A;  4QS8 A;  4C1N I;  4CED A;  4XH4 A;  3ULE B;  3CQ8 A;  1LWC A;  3MX2 A;  5JLF A;  4BRN A;  4CEQ A;  2RKI A;  4LD0 A;  4JKG A;  4CGD A;  3VN5 A;  1Q9X A;  2WUS A;  4NCG A;  2HVH A;  2EWS A;  3PY8 A;  2QWO A;  3TTF A;  1H1V A;  3LP1 A;  4CIF A;  3FE1 A;  4CJE A;  4I2P A;  4KTQ A;  2FXU A;  4JKC A;  3O3G A;  3VEO A;  1SL1 A;  2F7T A;  3O9U A;  3ZEU A;  1HNX K;  4F2R A;  1MA9 B;  2VCP A;  4GY2 B;  4DTS A;  3TTD A;  4CFD A;  1QZ5 A;  2VWK A;  1JLB A;  3HM9 A;  2CGK A;  4FJL A;  1IKW A;  1Q82 O;  3CJ7 A;  3IKM A;  1NKB A;  4FM2 A;  2ZGY A;  4LC9 B;  3WT0 A;  3AVK A;  3TAF A;  5I42 A;  1BI4 B;  1QE1 A;  4YDU A;  4DTO A;  4CZI A;  3SPZ A;  3LDP A;  2OZS A;  1NK8 A;  4LF5 K;  4IO9 L;  1I3A A;  1XI1 A;  4KHY A;  1J9A A;  1T6D A;  3MEG A;  4DV0 K;  5AZJ B;  4DSJ A;  1NGJ A;  4DG1 A;  4YOW A;  1HNZ K;  5E84 A;  2YNH A;  2F9W A;  4BRF A;  4LSN A;  5AQR A;  1NU0 A;  4J2B A;  4E7L A;  3DWL A;  4CJ4 A;  4G9Z A;  4FW2 A;  4AH9 A;  1NK0 A;  2YKM A;  3C6U A;  1VQ8 N;  5BR8 K;  3LDN A;  4AF1 A;  3T1A A;  2CH5 A;  3AV9 A;  3HO1 A;  1BU6 O;  2HHX A;  1O13 A;  3T19 A;  1NGE A;  4PKH A;  3ITH A;  4N56 A;  3AVF A;  3ENH A;  4JI2 K;  1U2V A;  3KWI A;  4CJK A;  2UXB K;  3KK7 A;  1XC9 A;  4DFJ A;  3HL8 A;  3OA9 A;  1KVA A;  3O9Q A;  1TK8 A;  1U48 A;  3OJS A;  3VF4 A;  3UIQ A;  5AQM A;  4EZ6 A;  3VEX A;  5BRH A;  4CJV A;  4HCC A;  1VSM A;  4Z4C A;  3ENO A;  5ADX A;  1D4X A;  5I9E B;  3SUO A;  3KD5 E;  2UYT A;  3VQD A;  3TAR A;  2WTU A;  3CCV N;  3AA2 A;  3VGM A;  4W5Q A;  5EY4 A;  3U6F A;  3QNO A;  4DR2 K;  1WSE A;  4BRD A;  4YOY A;  5HLF A;  5D3G A;  1M90 O;  3OVN A;  5LJV A;  3HPG A;  1QHA A;  1A5X A;  3THX B;  2A41 A;  4FWS A;  3HK2 A;  1VQN N;  3MDQ A;  2YHY A;  3PSI A;  1OVQ A;  3CCE N;  2X78 A;  3CIP A;  1K8A O;  1RDC A;  1NGC A;  2NUB A;  3WXI A;  3D2E A;  4E3S A;  2YNF A;  2HF4 A;  4QS9 A;  2A6A A;  1WUA A;  3CFR A;  3QET A;  3U3Y A;  3OYG A;  3VQC A;  2KKZ A;  4DF4 A;  3MXI A;  5IT9 O;  1RTJ A;  4CHY A;  1SQK A;  3VA3 A;  2E2P A;  2PZS A;  5DM6 L;  4N5S A;  1W2B M;  1GLD G;  4LFA K;  2AP1 A;  3J8A A;  3ZSX A;  5K14 A;  1JL1 A;  4RW8 A;  4O55 A;  3U9Z A;  5SWM A;  4LFC K;  2FSK A;  4DQI A;  1ZYQ A;  2HVI A;  4B3M K;  4DR4 K;  1N5Y A;  1NGB A;  2IAJ A;  2GTD A;  3EKU A;  3OBW A;  3RSE A;  2E2O A;  2A5X A;  1W9H A;  2Q3S A;  3V9S A;  4CJS A;  1VAZ A;  3O4N A;  3VER A;  4ILJ A;  5BR9 A;  2XY5 A;  3EZ5 A;  5KRS A;  2E5L K;  4DLG A;  4CF0 A;  2RN2 A;  3ZSQ A;  1MWK A;  1GLL O;  1HNW K;  3L2U A;  2HMI A;  2UU9 K;  4KHS A;  2IIR A;  2NRV A;  3HVT A;  2ZM6 K;  1NGA A;  4M45 A;  1P8Z A;  1HKC A;  3M3Z A;  4CFB A;  3R9P A;  4BRP A;  3DLB A;  3HP9 A;  3BDP A;  4GMJ B;  4OGC A;  3KJV A;  2Z1I A;  4RWT A;  3OS2 A;  2P1J A;  1IBM K;  3E01 A;  1TVR A;  4BQZ A;  4CES A;  3C0B A;  2O8F A;  4ICL A;  2GEL A;  4WYB A;  4IEE A;  4KHU A;  4F9O A;  3JXU A;  3IAY A;  2OZM A;  1HYV A;  4BG9 A;  1Y97 A;  4MO5 A;  4WFB L;  3CCM N;  1BGX T;  3SUN A;  1EWQ A;  2QWN A;  1NGD A;  1Q7Y O;  3E9O A;  3LM2 A;  3WXL A;  4CIG A;  3NCI A;  1HX1 A;  4F3O A;  5AQL A;  3TAG A;  5HL7 L;  4B8C A;  5AR0 A;  2ASM A;  5KI6 A;  1JXE A;  3D6R A;  3BF3 A;  4RG8 A;  3NVK A;  1BCM A;  3U3G A;  1VQ7 N;  1RT4 A;  1O1W A;  3QFU A;  1QSS A;  3BZC A;  1JLG A;  1VQO N;  4CEC A;  2QKB A;  3THY B;  3T3F A;  4CF1 A;  4RW6 A;  1KSP A;  4KTZ A;  2W41 A;  4W5O A;  4Q5V A;  1KRP A;  1CLQ A;  4CZK A;  4IG0 A;  1VSJ A;  4A5A A;  5LL6 Z;  5LMN K;  1XMO K;  3O80 A;  3OHR A;  1VQ6 N;  3TSQ A;  4KV8 A;  4O5B A;  1C1C A;  5EU7 A;  1VSD A;  3P83 D;  4KRF A;  3NH1 A;  1KC8 O;  1BI4 A;  5DMR A;  2A3Z A;  4H5R A;  3J7Z O;  3QEX A;  3C95 A;  1ZBF A;  3AVB A;  2UXC K;  4H5N A;  5AQZ A;  4A2A A;  5GAE P;  1DEJ A;  4RW4 A;  3NF7 A;  5AZJ A;  2O8D B;  4CGH A;  4CZL A;  4LFB K;  2KZM A;  3HST B;  1YVU A;  3CXC M;  3TR8 A;  3ZSV A;  3C6H A;  2NRZ A;  3P39 A;  2IVP A;  3G25 A;  4KB1 A;  4PKG A;  1HPM A;  2D0O A;  3ATV A;  3ZX3 A;  2VGN A;  3WUH A;  4DTU A;  4JI1 K;  3QEW A;  2ITG A;  5GAD P;  2P9P B;  3IRX A;  1KAX A;  1YT3 A;  3DM2 A;  4JN4 A;  3QIO A;  3CQX A;  4AHT A;  4BC3 A;  1BO5 O;  1XUP O;  3HSC A;  1UOC A;  3UKU A;  4CEE A;  2QW9 A;  1K9M O;  4MLH A;  2PBD A;  3HP6 A;  2X6N A;  3V9U A;  5MLC Q;  3OYE A;  2UXD K;  3ZET B;  3KKS A;  4B1W B;  1QVF M;  4BRO A;  4B3S K;  3RMD A;  3OYJ A;  1EKE A;  3GBT A;  1R59 O;  4NCA A;  2Z1J A;  3VQA A;  2P9S A;  4Z94 A;  5C24 A;  3IUC A;  3EL2 A;  3TI0 A;  4FJJ A;  4ISE A;  3E1Y A;  3HM8 A;  5EX5 A;  4M3R A;  4B9S A;  4JAX A;  1YJN N;  3SAH A;  5FRN A;  4BQL A;  1KD1 O;  2HHQ A;  3HVR A;  4FM0 A;  4IG3 A;  4FSV A;  2KLA A;  5F1X A;  3ZCM A;  3TAB A;  3L6Q A;  3QNN A;  3SMP A;  4LF6 K;  1XHX A;  3THX A;  2D0A A;  4CW7 B;  4JKA A;  4JV5 K;  4M7X A;  4OX9 K;  3BUZ B;  1YJ9 N;  3VQ8 A;  5HRP A;  4AIL C;  1NK6 A;  2V52 B;  4F8R A;  3R3L A;  1VSL A;  1CZ9 A;  3CF5 L;  2P51 A;  4RTF D;  3QIC A;  1NNE A;  5DM7 L;  3SYZ A;  5AQQ A;  2DFF A;  2OCE A;  3EYZ A;  1ZXO A;  2O8C B;  4OPA A;  1LCU A;  2PYL A;  4B9L A;  1NGI A;  2YJF A;  2OPR A;  2ZJQ L;  4DQS A;  3P38 A;  5CE3 A;  3GDQ A;  3QDK A;  4DS5 A;  3K2P A;  1K6Y A;  3M6G A;  4Z4E A;  4FCY A;  2E2Q A;  4OKK A;  3RMC A;  5M1P A;  4H4M A;  1NGG A;  3VMF B;  2XY8 A;  4B9U A;  4FJG A;  3NVM A;  2A42 A;  2W42 A;  1RDW X;  3C6A A;  4JKB A;  4KHP K;  1KAZ A;  3IS9 A;  3HT3 A;  4KH5 A;  3K59 A;  1RDU A;  3K58 A;  4FLT A;  4CD3 A;  2YNG A;  1RIL A;  1FKP A;  1OH7 A;  3CCJ N;  2FLO A;  3OYK A;  4BE1 A;  3VES A;  1YHQ N;  4DF8 A;  3EZW A;  4BGB A;  3FZK A;  3DI6 A;  5AQK A;  5M1N A;  5HRN A;  4KI4 A;  1ZBS A;  1BQM A;  2OPP A;  4M3W A;  3G10 A;  4JI0 K;  2JWK A;  4LF8 K;  4DV3 K;  1ZBU A;  3DLL L;  3ISN C;  5GIN A;  4GKK K;  3G4S N;  4YOT A;  3K9K A;  4I2Q A;  5FPD A;  2WC9 A;  3H1Q A;  1L3T A;  3NBP A;  4NXM K;  1ASV A;  4ZHR A;  5C15 A;  3CYM A;  4ZTF A;  5BPM A;  1S1T A;  4CER A;  2QK9 A;  1ASU A;  4JEP A;  1KCF A;  4DR7 K;  1S1X A;  1NG9 A;  2HOE A;  3A5M C;  2WFB A;  3GE1 A;  4A62 A;  1J53 A;  2BTF A;  4LF4 K;  3PX0 A;  1TKX A;  4ISF A;  1RNH A;  3CJA A;  1RBT A;  3EY1 A;  3RVC A;  5HP1 A;  5C0Y A;  2VG7 A;  2ZJP L;  2I7P A;  3TAP A;  5AQU A;  1VSI A;  3K57 A;  1YIJ N;  2O8E B;  1KVC A;  2DPN A;  4H03 B;  1XC3 A;  3FGU A;  3THY A;  1YXQ A;  4NO7 A;  3AY9 A;  4OPJ A;  1ASW A;  1VRU A;  4I9Q A;  4EZ9 A;  3M8R A;  1SKW A;  2GX9 A;  3OYB A;  4U7B A;  5KGX A;  4Y1C A;  4DLE A;  4DSF A;  4DR5 K;  1G15 A;  3H1V X;  3K5L A;  1C0G A;  1VSH A;  1VSF A;  3CI5 A;  3BZK A;  4NB4 A;  4DTX A;  3CC2 N;  4ELU A;  1TAU A;  2O8D A;  2NRX A;  2IGI A;  4RW7 A;  3W3D A;  3T1Y K;  4PUO A;  2B6A A;  1ATR A;  4CEO A;  1RT1 A;  4CZF A;  1VSE A;  5GAG P;  3ZSY A;  2G8F A;  1QQN A;  5CHI A;  3SAG A;  4K0K K;  3CPE A;  5JS1 A;  5AQP A;  3I55 N;  5JLH A;  2VQF K;  1S6P A;  4CF9 A;  2P9P A;  1GLB G;  1EXQ A;  5M1F A;  4BWM A;  4KRE A;  2GWK A;  1Q86 O;  4N47 A;  4WQ5 C;  3CMA N;  3V9Z A;  4I9L A;  3PIP L;  1TKZ A;  3ZET A;  3M5R A;  4FJM A;  2GWJ A;  3HI0 A;  1BWF O;  4FO0 A;  4E89 A;  4H0V B;  3A0I X;  1WN7 A;  4B1Y B;  4WFN L;  3SV4 A;  1JCG A;  2FBY A;  3VGK A;  4FJX A;  4DQR A;  4H0T B;  5F2R A;  5BRD A;  3DJC A;  3MXJ A;  4O4G A;  3E9P A;  4BDZ A;  4YOU A;  4X66 K;  3H45 C;  2Q36 A;  2ITM A;  1T44 A;  3F9K A;  3DLR A;  1RDD A;  4CZG A;  1IBL K;  1SS6 A;  4FWR A;  3EO3 A;  1ZBI A;  3UKR A;  1GLC G;  3AVI A;  3N4Q A;  2QWP A;  1HJO A;  2RHK A;  4A57 A;  4ID1 A;  3VQP A;  1NJY A;  3DXK B;  1W97 L;  1X1P A;  5AJ3 K;  1TUY A;  4DV1 K;  4JKH A;  1ATS A;  4U67 L;  4DTJ A;  4JKD A;  4DFP A;  3SUQ A;  4A59 A;  3K9J A;  4DV7 K;  4NCB A;  3MEC A;  3VF2 A;  4IFV A;  1CZA N;  4LY7 A;  2HB5 A;  4E7I A;  1KFS A;  1TYQ A;  4LF9 K;  5LJW A;  1UAX A;  2WOM A;  4W5N A;  5FRM A;  3AVN A;  3SBT A;  5ADX H;  3OYI A;  3NDK A;  3HJF A;  3I0R A;  3NF9 A;  3KK3 A;  1IJJ A;  1JLQ A;  2O8C A;  4Y0W A;  3KTQ A;  1KVB A;  1UA0 A;  1YF5 L;  3K5M A;  1ZBL A;  4GV6 A;  1Z25 A;  4CJW A;  2RE2 A;  5HOO A;  5A2Q O;  2PYJ A;  3H46 O;  2W6K A;  4ILH A;  2HW3 A;  1HQE A;  4DTN A;  1YIT N;  1RT5 A;  3NMU A;  4EHU A;  3TAE A;  3LAM A;  2VG6 A;  3DLK A;  4OVL A;  1IKY A;  2F8T A;  4CGG A;  2ZWH A;  4KPY A;  1XWL A;  3B6P A;  4CBX A;  4MDA A;  4E1J A;  1LW2 A;  5FPN A;  3AVL A;  1EO1 A;  3DMJ A;  4OKJ A;  5AQT A;  3HZ6 A;  3AO1 A;  3UKU B;  4C8L A;  3AVC A;  5C2F A;  1Q9Y A;  1VQM N;  3K5N A;  2NLX A;  3MN7 A;  4CZE A;  2KFZ A;  3HOT A;  4KKO A;  1TL1 A;  1S1U A;  4OLB A;  3ZSZ A;  1P90 A;  4FLU A;  1T6C A;  1C0F A;  3ENB A;  1RTD A;  2HMP A;  1NWK A;  1N34 K;  5HBM A;  2P9S B;  2F9T A;  2V7Z A;  4BRG A;  2WBN A;  5GAH P;  3K0S A;  4J8F A;  1SZ2 A;  2G8U A;  2XRI A;  4H0Y B;  3MCA B;  3P5J A;  4CJQ A;  4JHD B;  2FC0 A;  4BGA A;  2J4R A;  2P5O A;  4QCL A;  2E6L A;  4BRI A;  4PA1 A;  1QQM A;  3O4Q A;  1KQS M;  3BGR A;  1VQ4 N;  3LDL A;  3RMB A;  1GLJ O;  4O0J A;  1IH7 A;  5GIP A;  1FK9 A;  3B6O A;  2DY4 A;  1R0A A;  1OH5 A;  1HKG A;  4LSL A;  1DGK N;  3SPY A;  1QVG M;  2V51 B;  4OPH A;  2D1K A;  2OPS A;  1GLA G;  3MWP A;  4H0P A;  4BRA A;  4F2S A;  3AVM A;  5GIO A;  5AQY A;  1U4B A;  4BR5 A;  4L8R B;  4ZTJ A;  4B1V A;  4B1X B;  3ZLJ A;  3VQ7 A;  5M1Q A;  3FZM A;  4DUY K;  4F4K A;  1KFD A;  4CGJ A;  3QFP A;  3CC4 N;  2O8E A;  4XEI A;  3KKR A;  3A5N C;  5C12 A;  3MX5 A;  3V6D A;  2V7Y A;  3DXM B;  3O9R A;  4BC5 A;  2HBJ A;  3NGI A;  3JS6 A;  3I33 A;  1VQ9 N;  4WQ4 C;  3SJJ A;  4DQP A;  4UQG A;  5FDL A;  1QS4 A;  4LH5 A;  4E0D A;  2AA4 A;  1S1V A;  2Q2R A;  3M8Q A;  4FM1 A;  5M1K A;  3NE6 A;  2GUI A;  5AQV A;  4JI3 K;  3G71 N;  1YTA A;  3SCX A;  1TL3 A;  4DU4 A;  4OLA A;  1J5O A;  3QIP A;  3EEQ A;  3T1H K;  4GV9 A;  4DB3 A;  3R6M A;  1N32 K;  4CBU A;  3MAQ A;  2E2N A;  4LF7 K;  4NLC A;  1DLO A;  4BR9 A;  5TKY A;  4JI8 K;  1HNI A;  3AO5 A;  3ZSW A;  4FOE A;  3CC7 N;  3LP2 A;  2QWL A;  3VEN A;  1LOT B;  1BQN A;  1SUQ A;  1T3V A;  4WFA L;  1NOZ A;  3DRP A;  3O3H A;  1V4T A;  3VGL A;  4FJI A;  1YTU A;  3QES A;  4A5B A;  4XH5 A;  3SQ4 A;  3VEY A;  3AGR A;  4RW9 A;  3JSM A;  1CXQ A;  3CFP A;  3LDS A;  2D5R A;  2E1Z A;  3ZSO A;  3SI6 A;  2HHH K;  4FZY A;  4XH1 A;  4B9M A;  4ID5 A;  4JK7 A;  5FPM A;  4O5F A;  4WF9 L;  4CJF A;  4JRQ A;  5AQH A;  5TKW A;  4NXN K;  2HST A;  5J2N A;  2Z1G A;  3L0Q A;  4KHQ A;  3U9D A;  1DT9 A;  2DFH A;  4BRM A;  1S9G A;  3CCR N;  4YHH K;  3DXK A;  1XHZ A;  2P9L B;  2KTQ A;  3QIN A;  4B3R K;  1BHL A;  4YFU A;  1J5E K;  3VQB A;  4Z4H A;  4C8N A;  1XQS C;  2HHS A;  4Z0U A;  4FVM A;  1E4G T;  5AFU A;  3PX4 A;  4IJN A;  3AVG A;  1VSK A;  3FR0 A;  4CJT A;  3HPH A;  5E26 A;  4E19 A;  3FZL A;  4CJR A;  4FL9 A;  1GOC A;  3TAQ A;  4TSX A;  1SKR A;  4EAH D;  1X9S A;  4QS7 A;  1XNQ K;  3SLC A;  1RBS A;  3ZT2 A;  3SQ1 A;  3L2R A;  3V9X A;  1NK5 A;  2WON A;  5J2Q A;  4CJL A;  1I94 K;  3SBG A;  4OPK A;  4IOA L;  3NH0 A;  3PIO L;  4EFH A;  3ZT0 A;  4BC4 A;  3IFR A;  4NYF A;  1IG9 A;  3ZT3 A;  4FWL A;  3CER A;  1A5W A;  4BRH A;  4ILG B;  4K42 A;  4M7Y A;  2G8H A;  2CGJ A;  3C7N B;  1BOT O;  4FJ7 A;  1FW6 A;  2BE2 A;  3VEW A;  1NMN A;  4FYD A;  1OKJ A;  4X64 K;  4W5T A;  3A5O C;  3S3N A;  4M3T A;  2FSJ A;  1C1B A;  3KIO A;  2F8S A;  4C1N K;  2YI1 A;  4CD1 A;  5SZT A;  3QBX A;  3PO4 A;  3GOI A;  4CBW A;  4OGE A;  1U04 A;  2VWB A;  4E7K A;  1RBR A;  1T7P A;  4KHW A;  4JHD A;  4MQ3 A;  3EKS A;  4K8X A;  3KHY A;  3S3O A;  4M42 A;  3RWU A;  3UKR B;  4FZX C;  2BUP A;  2VWJ A;  2XHB A;  3D0P A;  4FK2 A;  1SKS A;  4EHT A;  3HPO A;  2P9I A;  3H3O B;  3LL3 A;  1VQK N;  3NF8 A;  5M1O A;  4JI4 K;  3OTO K;  3LWL A;  3RMA A;  4A2B A;  3WNH A;  4GKJ K;  5J1E A;  1NKC A;  5CZ1 A;  1T05 A;  1RFQ A;  3NGY A;  5AQO A;  4FLY A;  4KH6 A;  1EQY A;  2KW4 A;  4V19 S;  4KI6 A;  1NJX A;  5FPE A;  1NK4 A;  2VGM A;  3H08 A;  4YOX A;  5C25 A;  1TYQ B;  3VQ4 A;  1Z05 A;  4C8K A;  1N36 K;  3CM5 A;  4QOZ B;  2KFN A;  1SAZ A;  4AM6 A;  4NLB A;  1U49 A;  1FKO A;  2HNZ A;  3VQ6 A;  4MDB A;  4WQ5 A;  1W0H A;  2E20 A;  4BR0 A;  5HRR A;  1XMQ K;  3G6E N;  1JCE A;  4KFB A;  3E66 A;  4H0O A;  3SK3 A;  4DUZ K;  1IG8 A;  3W0L A;  4FPA A;  4B9V A;  4CFA A;  1IKV A;  3DXM A;  3THV A;  3ASM A;  4NYN A;  4G1Q A;  3J7A P;  1HMV A;  4B3T K;  2YKN A;  3HRG A;  5AQX A;  3LZI A;  4M3Z A;  3PLA A;  5CYM A;  2D0C A;  1LAW A;  3SQ0 A;  4L3Q A;  2PY5 A;  3FZH A;  4XIU A;  4H8K A;  3UB5 A;  3AAR A;  1BCO A;  4J2A A;  3BY5 A;  1TK0 A;  2NRH A;  4YOR A;  5CR4 A;  3OS1 A;  3WXM B;  1BIU A;  1EWR A;  1KTQ A;  1YVN A;  4DSI A;  4B08 A;  3CCS N;  1D9F A;  4DR3 K;  3I56 N;  3AAQ A;  4JI6 K;  2YNI A;  1X9W A;  3OJU A;  1WSF A;  4M41 A;  3HYF A;  3QML A;  3OYA A;  1NK9 A;  3VQ5 A;  3ZYY X;  4DQ8 A;  4J2E A;  5DK5 A;  3I8D A;  3KLG A;  2P9N B;  5AQG A;  1D9D A;  1FJG K;  1VHX A;  1NGH A;  4BE2 A;  2QEX N;  3WNF A;  1BIS A;  1T03 A;  3KLE A;  2E4L A;  4IFE A;  3TSP A;  5I3U A;  4H4O A;  3PV8 A;  1CZB A;  4KB0 A;  2HHU A;  1MDU B;  1X9M A;  3QB0 A;  2IOC A;  2OPQ A;  4YOV A;  3QEP A;  4FW1 A;  1F21 A;  3VEZ A;  1IO2 A;  3TU5 A;  4DV6 K;  4WCE L;  4OO1 J;  5H1S Q;  1Z6R A;  3A5L C;  4BG8 A;  1REV A;  2HND A;  2OYQ A;  3H3N O;  1RT2 A;  2ZGZ A;  3LPT A;  1KAY A;  3SV3 A;  4OKE A;  5KTQ A;  3OBY A;  1RGI A;  4DFK A;  3KK2 A;  3CJ1 A;  1BL3 A;  2Q0R A;  3NAE A;  5BPN A;  1LW0 A;  3ZT4 A;  1TUU A;  3KVG A;  2E8A A;  1YAG A;  4EIA A;  3V1O A;  2P9L A;  1BA1 A;  2YCH A;  2NRW A;  2VYP A;  3RTV A;  1SL0 A;  4EP4 A;  4I6M B;  1WAJ A;  2P9K B;  3CJB A;  3NFA A;  2OTJ N;  3GG4 A;  5BN8 A;  4FJN A;  3O4W A;  4FLX A;  4PL8 A;  3LDQ A;  3O8M A;  5F0X A;  2JGU A;  3U4L A;  3F73 A;  3WQU A;  3QBW A;  5KPZ A;  2A40 A;  3AO3 A;  4R79 A;  2Z1H A;  3ATU A;  3THW A;  1ZC6 A;  5BRE A;  2OTL N;  1T8E A;  2Q31 A;  3LDO A;  3L4I A;  2E88 A;  2RF2 A;  4K43 A;  2EHG A;  3MN5 A;  4CF2 A;  3O9S A;  4B9T A;  4CK1 A;  1ESV A;  4IOX A;  5AQF A;  3TTC A;  1WSJ A;  3MK6 A;  4PWD A;  4C8O A;  3QO9 A;  5KGW A;  4I7F A;  1S1W A;  3CM6 A;  2D0B A;  5IWA K;  3ULD A;  3C7N A;  1DKG D;  4AHR A;  3FZF A;  4HTL A;  3VQE A;  5JMV A;  1NKE A;  1HPZ A;  3GL1 A;  1D5A A;  2DTU A;  3JYT A;  5HRS A;  3LPU A;  3MWT A;  1QTM A;  4W5R A;  2YHX A;  3DYA A;  2NZT A;  1EP4 A;  4DCH A;  4CEZ A;  5JS2 A;  3T69 A;  2HNY A;  4WQ4 A;  5KPR A;  1SV5 A;  3FFK B;  4GVE A;  4AHV A;  4HCB A;  2UUB K;  1X3M A;  2UUA K;  4GVM A;  1ILY A;  3KK1 A;  2P5G A;  3DLH A;  4FWN A;  2XY7 A;  3RR8 A;  4BDY A;  4HHT A;  1KLM A;  2D0P A;  2G8V A;  1N33 K;  3JAM O;  2FBV A;  3VTH A;  1FXX A;  4JD2 B;  3L2V A;  4DWI A;  2GBZ A;  2YX6 A;  1NJI O;  4KO0 A;  1HJR A;  2OA8 A;  4HUF A;  3OS0 A;  4CIE A;  1OH8 A;  3LAK A;  3SZ2 A;  4KHN A;  4DHY A;  2OAN A;  4IKF A;  1WNS A;  3OYF A;  1NK7 A;  2YJE A;  1VQ5 N;  4PY5 A;  3F5T A;  1NBW A;  1JKH A;  4K8Z A;  4LH4 A;  2O4G A;  4CJP A;  3TAN A;  1BIZ A;  5KPT A;  1BG3 A;  2D4W A;  4CEA A;  3BEX A;  3M8P A;  1LWF A;  4FOI A;  4CE9 A;  4FJ9 A;  1IV0 A;  4FJH A;  3SAF A;  3RR7 A;  2ZQB A;  3E9L A;  4DU1 A;  5J2M A;  4IFY A;  1S72 N;  4N41 A;  4BRQ A;  4RCH A;  1TV6 A;  2QWQ A;  1U6Z A;  2KQ2 A;  3O1B A;  1BA0 A;  3NH2 A;  4E1M A;  4F3T A;  4DU3 A;  3I0S A;  4DR6 K;  3B8A X;  3OW2 M;  1A5V A;  2YV0 X;  2YHA A;  1B9F A;  3WXJ A;  3CQY A;  3MN9 A;  3MXM A;  4FLZ A;  2Q97 A;  1Z26 A;  3CME N;  3CG7 A;  2HHW A;  4ELT A;  2B5J A;  3MN6 A;  3CCL N;  4FWM A;  3L2W A;  3PX6 A;  4DV4 K;  4CZM A;  1VQL N;  4WE1 A;  2BGG A;  3R1X A;  3CCU N;  1MU2 A;  4C23 A;  5T7B A;  1HNV A;  3O3F A;  4CI6 A;  2CGL A;  3L2Q A;  5AQN A;  4HTU A;  2P9I B;  3V9W A;  2P9N A;  5LMU K;  4E7J A;  3S3M A;  3LZJ A;  4KTW A;  4DTR A;  3P1G A;  3TWH A;  1WBD A;  4EP5 A;  3HTV A;  4AHU A;  3ALY A;  2IDO A;  3DRS A;  3AAP A;  3D7E O;  3QLH A;  1HLU A;  4JKE A;  2E1Y A;  1C6V A;  1RDA A;  3O08 A;  3P31 A;  5C42 A;  4FJK A;  2HBK A;  2QI2 A;  5AZI A;  3IDH A;  2FBX A;  5C2D A;  3D2F B;  2X6S A;  3LP3 A;  3O6W A;  1HQU A;  2G8I A;  4DS4 A;  1EET A;  4IBN A;  1RT3 A;  2ZF5 O;  2XY6 A;  2F4V K;  3V81 A;  2ZD1 A;  4FWQ A;  1J54 A;  3DOL A;  3VOV A;  3SMS A;  1SL2 A;  2FF6 A;  3A2F A;  3RRG A;  1WOQ A;  3S9H A;  5EXW A;  2HF3 A;  1RCH A;  4BC2 A;  4CHQ A;  2FSN A;  4FWK A;  4CHN A;  4C8M A;  4O44 A;  1JLE A;  4I6M A;  3ZX2 A;  2P9K A;  1K8K B;  4GNI A;  1QHT A;  4FVU A;  1N6Q A;  4DQQ A;  5AQI A;  1Q8I A;  4CJU A;  3V1Q A;  2YHB A;  3FFI A;  1E3M A;  4JNE A;  2FF3 B;  3LP0 A;  2DFE A;  4ELV A;  4K25 A;  1S3X A;  2X74 A;  4CJ7 A;  1JLC A;  4CVN E;  3KZB A;  4FK4 A;  5BPL A;  4DTM A;  3L4Q A;  4GW6 A;  4GV3 A;  4PL7 A;  4E7H A;  1LV5 A;  3WEE B;  4FJ5 A;  1DTT A;  4BVO A;  4IDH A;  5AFU H;  4CZJ A;  1LAV A;  4CGI A;  3FLC O;  3MEE A;  3LWM A;  1Y64 A;  1NM1 A;  4FZZ A;  1C0U A;  2ATQ A;  2KZZ A;  4X65 K;  3IMX A;  4YDU C;  1NJW A;  1C1A A;  1D8Y A;  3V1R A;  1QZ6 A;  4IZ9 A;  4IDK A;  4Z4G A;  1JLA A;  1KXP A;  3M8S A;  2VG5 A;  1NGF A;  3C6T A;  4JK8 A;  2QTD A;  4MFB A;  5EOY A;  4H0X B;  1ZBH A;  4BR4 A;  3ULE A;  3QEV A;  1GOA A;  5FRO A;  4B9N A;  2I5J A;  5ELZ A;  3VQ9 A;  4JD2 A;  1VRT A;  3J81 O;  4DV2 K;  3PUF A;  4CZH A;  4H5V A;  1MWM A;  1JLF A;  2P9U B;  3OYM A;  2G8K A;  2F96 A;  5CZ2 A;  3OYC A;  5J2P A;  3AO2 A;  4DV5 K;  2IVO A;  4CHP A;  4Y1D A;  3CHW A;  4CEF A;  4HVJ A;  2JLE A;  4M3X A;  2O8B B;  3N4P A;  4M63 C;  1RTH A;  2KHO A;  1JJ2 M;  4BAC A;  1RBV A;  4CHZ A;  2BH1 A;  5BRF A;  3S41 A;  4HUE A;  5KRT A;  3THW B;  1HR0 K;  3CFO A;  4IO8 A;  1Q18 A;  3LAL A;  1C0T A;  1X9J A;  1RTI A;  3WXK A;  3U8X A;  1IBK K;  5LY3 A;  3NGZ A;  4H5W A;  1C0M A;  2YHW A;  1S6Q A;  4JI7 K;  3P4I A;  4M3Y A;  3VTI A;  3L8B A;  1WSG A;  4DSK A;  4PKI A;  4CFC A;  4FLW A;  3SUP A;  2IC3 A;  3MCP A;  2GEM A;  3O5B A;  4DSL A;  4ISG A;  3VEV A;  3KLI A;  1Q81 O;  4Z4I A;  1VQP N;  1J6Z A;  2UUC K;  4CJ3 A;  1N8R O;  4FPB A;  5BN9 A;  1CXU A;  1WBB A;  4QAG A;  1BDG A;  4HUG A;  4BE0 A;  2LSN A;  1L3S A;  1HYZ A;  5CY4 A;  4Q0B A;  5C10 A;  2VQE K;  3AO4 A;  3VPZ A;  3EE8 A;  4JKG B;  1B92 A;  4DMN A;  3OYN A;  2H3G X;  4K41 A;  2I7N A;  3TPQ A;  3O1W A;  3DRR A;  1WSH A;  5FLX O;  1K73 O;  2JWL A;  4IWV A;  4B8A B;  1TK5 A;  4OJR A;  3WNG A;  2QXF A;  2NNW A;  3LAN A;  4O0I A;  3PO5 A;  3EN9 A;  4AM7 A;  1WLJ A;  1QSL A;  1L3U A;  3CJC A;  3CET A;  4A61 A;  3AGK A;  3ZEU B;  2BAN A;  5JIC A;  4KAZ A;  2ZE2 A;  4CEB A;  4CK3 A;  5AQJ A;  3QEI A;  4JKF A;  4BRE A;  2HHT A;  2QA4 N;  2QKK A;  1WSI A;  3HBT A;  4YY3 K;  4AQY K;  1M1K O;  3AVJ A;  1DTQ A;  1YJW N;  4PQU A;  3EE9 A;  1KLN A;  4IEI A;  4JS5 A;  1U47 A;  1HUX A;  3SJH A;  3ZSR A;  4FXD A;  2FBT A;  2PFU A;  3D2F A;  1L3V A;  3D45 A;  4DFM A;  3AA4 A;  2W6L A;  4X62 K;  4JLH A;  4O8U A;  4BVP A;  4JS4 A;  4CCH A;  3Q7C A;  4E1N A;  3DAW A;  1TKD A;  1WAF A;  1W7A A;  3QER A;  1TGO A;  3OYH A;  4JI5 K;  3HOS A;  1XNR K;  2ASP A;  2HBM A;  4B1U B;  5KQ8 A;  1K8K A;  4AHC A;  3CJ9 A;  5E41 A;  5AQW A;  3V4I A;  1QQO A;  1OVY A;  4PHT X;  3OYL A;  3F9M A;  4FK0 A;  2NRR A;  3CCQ N;  1RT6 A;  1UWB A;  4UY8 O;  1YUW A;  4HWI A;  4CJ5 A;  3L3U A;  2EX3 A;  3H6E A;  1QSY A;  1JCF A;  1U2V B;  3VET A;  2A1S A; 
#chains in the Genus database with same CATH homology
 3BP8 A;  4H5N A;  5AQZ A;  1ILY A;  4B1V A;  2ASO A;  4A2A A;  5AQS A;  5GAE P;  2HBL A;  4FWN A;  4B1X B;  1DEJ A;  1YI2 N;  2D0P A;  5AZJ A;  5M1Q A;  4BR2 A;  3FZM A;  3WEE A;  4CZL A;  3VTH A;  4JD2 B;  5JVH L;  3CPW M;  2QXL A;  3M1F A;  2YX6 A;  4MO4 A;  5EVZ A;  1NJI O;  3QFP A;  3CC4 N;  3CXC M;  4XEI A;  3A5N C;  5C12 A;  3MX5 A;  3C6H A;  1GLF O;  2NRT A;  2V7Y A;  2NRZ A;  3DXM B;  3P39 A;  2IVP A;  4MLE A;  3UE5 A;  3G25 A;  3R8E A;  3O9R A;  4PKG A;  4BC5 A;  1HPM A;  2HBJ A;  4DHY A;  3JS6 A;  4O8K A;  3I33 A;  2D0O A;  2Q0U A;  1VQ9 N;  4WQ4 C;  2QWR A;  3ATV A;  3ZX3 A;  2OAN A;  2VGN A;  3WUH A;  5GAD P;  3ID8 A;  1BUP A;  3TSU A;  4DKW A;  3WQT A;  2AA4 A;  2P9P B;  2Q2R A;  1KAX A;  2YJE A;  1VQ5 N;  4JN4 A;  5KQD A;  3CQX A;  3BF1 A;  3F5T A;  3O9T A;  1NBW A;  1BO5 O;  4BC3 A;  3F2K A;  1XUP O;  3HSC A;  4IXC A;  3UKU A;  4BRK A;  2QW9 A;  1K9M O;  1NLV A;  4MLH A;  2PBD A;  5M1K A;  3MMV A;  4BR7 A;  5MLC Q;  5AZI B;  3ZET B;  5AQV A;  4B1W B;  1QVF M;  2GUP A;  3G71 N;  5KPT A;  4BRO A;  1BG3 A;  2D4W A;  3BEX A;  4JK9 A;  3GBT A;  1R59 O;  4FOI A;  4FWO A;  4GV9 A;  4DB3 A;  3R6M A;  2P9S A;  4Z94 A;  3SAF A;  4KBO A;  3IUC A;  3D2E B;  3A8Y A;  3E9L A;  3EL2 A;  4CBU A;  3LM9 A;  4BRL A;  2P9U A;  4ISE A;  1S72 N;  3E1Y A;  2E2N A;  4BRQ A;  3T7Z A;  3HM8 A;  2CH6 A;  4RCH A;  4NLC A;  5EX5 A;  1HKB A;  1U6Z A;  2QWQ A;  2QWM A;  3O1B A;  4JAX A;  4BR9 A;  5TKY A;  1BA0 A;  1YJN N;  2ZJR L;  3I8B A;  5HL7 L;  3SAH A;  4FOE A;  3CC7 N;  4BQL A;  4BY9 C;  2PAV A;  1KD1 O;  2QWL A;  3VEN A;  1LOT B;  4FSV A;  1S22 A;  4FWP A;  1ATN A;  2KLA A;  3KWG A;  5F1X A;  3B8A X;  3OW2 M;  3L6Q A;  3SMP A;  3WXJ A;  1T3V A;  4KH4 A;  1GLE G;  3CQY A;  3MN9 A;  4WFA L;  1E4F T;  1NMD A;  4JKA A;  1V4S A;  1V4T A;  3VGL A;  3RSE B;  4M7X A;  1X3N A;  3BUZ B;  4B9Q A;  2Q97 A;  3CME N;  4A5B A;  4XH5 A;  1YJ9 N;  3C65 A;  3VEY A;  2V52 B;  3AGR A;  3R3L A;  3MN6 A;  3CCL N;  3CF5 L;  4FWM A;  4RTF D;  3QIC A;  4H5T A;  3Q7B A;  5DM7 L;  2E1Z A;  5AQQ A;  2Q1N A;  3ZX0 A;  4CZM A;  1ZXO A;  4XH1 A;  4JK7 A;  1VQL N;  5FPM A;  4O5F A;  3ID6 A;  4WF9 L;  4OPA A;  2W40 A;  1LCU A;  3R1X A;  1NGI A;  5AQH A;  5TKW A;  4B1Z A;  2YJF A;  3CCU N;  4IOC L;  2HST A;  2ZJQ L;  4C23 A;  3P38 A;  3L0Q A;  5CE3 A;  2IVN A;  3GDQ A;  3QDK A;  3U9D A;  4CI6 A;  5B8H A;  2CGL A;  3M6G A;  5AQN A;  2P9I B;  1DT9 A;  2P9N A;  2E2Q A;  4IJA A;  4BRM A;  5M1P A;  3CCR N;  3DXK A;  5JVG L;  1NGG A;  2P9L B;  3VMF B;  4BRC A;  3VF6 A;  3HTV A;  3CD6 N;  3NVM A;  3AAP A;  2A42 A;  3D7E O;  1G99 A;  1HLU A;  1XQS C;  2E1Y A;  4JKE A;  1RDW X;  1E4G T;  3C6A A;  4JKB A;  5AFU A;  1KAZ A;  4IJN A;  3O08 A;  2QM1 A;  4KH5 A;  3P31 A;  1RDU A;  4QS8 A;  4C1N I;  3FR0 A;  4XH4 A;  4CD3 A;  3ULE B;  2HBK A;  5E26 A;  3MX2 A;  2QI2 A;  3CCJ N;  3FZL A;  5AZI A;  4FL9 A;  2FLO A;  4BRN A;  3IDH A;  5JLF A;  4EAH D;  5C2D A;  4QS7 A;  3D2F B;  4JKG A;  3VES A;  2WUS A;  3O6W A;  3SLC A;  1YHQ N;  3EZW A;  4BGB A;  2EWS A;  3FZK A;  2ZF5 O;  5AQK A;  5M1N A;  2QWO A;  1ZBS A;  1H1V A;  4FWQ A;  3TTF A;  3SBG A;  3VOV A;  4IOA L;  2JWK A;  3FE1 A;  2FF6 A;  3SMS A;  3PIO L;  4EFH A;  1WOQ A;  3DLL L;  5EXW A;  2FXU A;  2HF3 A;  4BC4 A;  5GIN A;  3G4S N;  3IFR A;  4YOT A;  4BC2 A;  4JKC A;  3K9K A;  5FPD A;  2FSN A;  4FWK A;  3VEO A;  4FWL A;  2WC9 A;  3CER A;  2F7T A;  3O9U A;  3ZEU A;  4BRH A;  4I6M A;  3ZX2 A;  1MA9 B;  2P9K A;  4ILG B;  3H1Q A;  1K8K B;  4K42 A;  4M7Y A;  2VCP A;  4GY2 B;  2CGJ A;  4GNI A;  3C7N B;  3TTD A;  1BOT O;  5C15 A;  1QZ5 A;  4FVU A;  3VEW A;  5BPM A;  5AQI A;  1OKJ A;  2CGK A;  5AQY A;  4JEP A;  3A5O C;  1Q82 O;  4JNE A;  2FF3 B;  3CJ7 A;  2FSJ A;  3IKM A;  2HOE A;  2ZGY A;  3A5M C;  4K25 A;  4LC9 B;  2WFB A;  2YI1 A;  1S3X A;  3WT0 A;  4C1N K;  4CD1 A;  4YDU A;  3GE1 A;  4A62 A;  4CJ7 A;  2BTF A;  3KZB A;  4CZI A;  3QBX A;  4ISF A;  3LDP A;  3GOI A;  4CBW A;  2VWB A;  5BPL A;  3CJA A;  4IO9 L;  3L4Q A;  4GV3 A;  4PL7 A;  1T6D A;  4JHD A;  3RVC A;  3EKS A;  5AZJ B;  5C0Y A;  1NGJ A;  4YOW A;  3WEE B;  2I7P A;  2ZJP L;  4BVO A;  3KHY A;  4IDH A;  2F9W A;  5E84 A;  5AQU A;  5AFU H;  4BRF A;  3UKR B;  5AQR A;  4CZJ A;  2BUP A;  3FLC O;  1YIJ N;  2DPN A;  3DWL A;  1XC3 A;  3FGU A;  4H03 B;  4G9Z A;  1YXQ A;  4EHT A;  1Y64 A;  2P9I A;  4NO7 A;  3AY9 A;  3H3O B;  3LL3 A;  1VQK N;  1NM1 A;  5M1O A;  1VQ8 N;  3LDN A;  4AF1 A;  2CH5 A;  4A2B A;  2GX9 A;  3IMX A;  4YDU C;  4U7B A;  1BU6 O;  1RFQ A;  1O13 A;  5AQO A;  4KH6 A;  1EQY A;  1QZ6 A;  4IZ9 A;  5FPE A;  2VGM A;  1NGE A;  1KXP A;  4PKH A;  4YOX A;  1NGF A;  1TYQ B;  3ENH A;  1U2V A;  1Z05 A;  3KWI A;  3H1V X;  4JK8 A;  2QTD A;  3KK7 A;  1C0G A;  1SAZ A;  5EOY A;  4AM6 A;  4H0X B;  4NLB A;  3CI5 A;  3OA9 A;  4NB4 A;  4BR4 A;  3ULE A;  3CC2 N;  4MDB A;  4WQ5 A;  2E20 A;  4BR0 A;  3O9Q A;  3G6E N;  2NRX A;  1JCE A;  5ELZ A;  4JD2 A;  3E66 A;  4H0O A;  3W3D A;  3VF4 A;  3SK3 A;  1IG8 A;  3W0L A;  1ATR A;  5AQM A;  4CZH A;  4FPA A;  3VEX A;  4H5V A;  5BRH A;  4CZF A;  3DXM A;  5GAG P;  1MWM A;  2P9U B;  1QQN A;  3ENO A;  5ADX A;  3SAG A;  5CHI A;  1D4X A;  5I9E B;  3VET A;  3CPE A;  2UYT A;  5AQP A;  3I55 N;  5JLH A;  3HRG A;  3CCV N;  2IVO A;  5AQX A;  3PLA A;  3VGM A;  2P9P A;  1GLB G;  3CHW A;  5EY4 A;  5M1F A;  2GWK A;  1Q86 O;  4L3Q A;  3N4P A;  3FZH A;  2KHO A;  4M63 C;  4WQ5 C;  4BRD A;  4YOY A;  3CMA N;  3UB5 A;  3AAR A;  1M90 O;  1JJ2 M;  2NRH A;  2BH1 A;  5BRF A;  5LJV A;  3PIP L;  4YOR A;  1QHA A;  5CR4 A;  3S41 A;  3ZET A;  2A41 A;  4FWS A;  3M5R A;  1VQN N;  3WXM B;  3MDQ A;  2YHY A;  2GWJ A;  4IO8 A;  1Q18 A;  1YVN A;  3HI0 A;  1BWF O;  3WXK A;  1X9J A;  4FO0 A;  3U8X A;  4H0V B;  3A0I X;  5LY3 A;  4B1Y B;  4H5W A;  4WFN L;  3CCE N;  3CCS N;  2YHW A;  3CIP A;  1K8A O;  3I56 N;  1NGC A;  3AAQ A;  3WXI A;  1JCG A;  3VGK A;  3D2E A;  4H0T B;  2HF4 A;  3P4I A;  5F2R A;  3DJC A;  4QS9 A;  5BRD A;  3E9P A;  3VTI A;  2A6A A;  4YOU A;  1WUA A;  3H45 C;  3QML A;  2Q36 A;  2ITM A;  1T44 A;  2KKZ A;  3ZYY X;  4CZG A;  4PKI A;  1SQK A;  1SS6 A;  4FWR A;  3EO3 A;  4DQ8 A;  3UKR A;  1GLC G;  2E2P A;  3MCP A;  5DM6 L;  2GEM A;  3N4Q A;  2QWP A;  3O5B A;  1W2B M;  2P9N B;  1GLD G;  1HJO A;  2RHK A;  5AQG A;  4ISG A;  3VEV A;  4A57 A;  2AP1 A;  3J8A A;  1Q81 O;  1VQP N;  1NGH A;  2QEX N;  3DXK B;  1W97 L;  1TUY A;  4JKH A;  1ATS A;  4U67 L;  3U9Z A;  4IFE A;  1J6Z A;  2FSK A;  4JKD A;  3TSP A;  1N8R O;  4FPB A;  1MDU B;  1NGB A;  4A59 A;  3K9J A;  2GTD A;  3QB0 A;  3EKU A;  3VF2 A;  3OBW A;  3RSE A;  1CZA N;  2E2O A;  2A5X A;  4YOV A;  5BN9 A;  3VEZ A;  3TU5 A;  1TYQ A;  1VAZ A;  3VER A;  1BDG A;  4ILJ A;  4WCE L;  5LJW A;  5BR9 A;  4OO1 J;  5H1S Q;  3SBT A;  5ADX H;  1Z6R A;  3A5L C;  4BG8 A;  3H3N O;  2ZGZ A;  5C10 A;  1KAY A;  1IJJ A;  1MWK A;  3VPZ A;  3EE8 A;  1GLL O;  3OBY A;  1RGI A;  4Y0W A;  4JKG B;  1YF5 L;  2H3G X;  3CJ1 A;  2I7N A;  4K41 A;  2IIR A;  2NRV A;  3TPQ A;  3O1W A;  4GV6 A;  2Q0R A;  2RE2 A;  1NGA A;  5BPN A;  1P8Z A;  5HOO A;  1K73 O;  2JWL A;  4IWV A;  1HKC A;  3M3Z A;  3R9P A;  4BRP A;  1TUU A;  3H46 O;  3KVG A;  2E8A A;  1YAG A;  2NNW A;  4ILH A;  4EIA A;  1YIT N;  3NMU A;  4EHU A;  2P9L A;  3EN9 A;  4AM7 A;  4RWT A;  1BA1 A;  2YCH A;  2NRW A;  3CJC A;  2VYP A;  3CET A;  4A61 A;  3AGK A;  4BQZ A;  3ZEU B;  2ZWH A;  3C0B A;  4I6M B;  3CJB A;  2P9K B;  4CBX A;  5JIC A;  2OTJ N;  2GEL A;  4MDA A;  4E1J A;  3GG4 A;  4WYB A;  4IEE A;  5FPN A;  5AQJ A;  5BN8 A;  1EO1 A;  5AQT A;  4JKF A;  4BRE A;  3HZ6 A;  3O4W A;  3UKU B;  4F9O A;  3JXU A;  4PL8 A;  2QA4 N;  3LDQ A;  5C2F A;  1VQM N;  3O8M A;  5F0X A;  2NLX A;  4BG9 A;  3HBT A;  3MN7 A;  4CZE A;  1M1K O;  4MO5 A;  3U4L A;  4WFB L;  3HOT A;  3CCM N;  3WQU A;  3QBW A;  1YJW N;  5KPZ A;  3EE9 A;  4IEI A;  2A40 A;  2QWN A;  1NGD A;  1P90 A;  1HUX A;  4R79 A;  1Q7Y O;  3SJH A;  3ATU A;  3E9O A;  1ZC6 A;  1T6C A;  2PFU A;  3D2F A;  1C0F A;  3LM2 A;  3ENB A;  3WXL A;  5BRE A;  2OTL N;  2HMP A;  1NWK A;  1HX1 A;  2Q31 A;  3LDO A;  5AQL A;  2P9S B;  2E88 A;  2F9T A;  2V7Z A;  3L4I A;  4K43 A;  4O8U A;  3MN5 A;  5AR0 A;  2WBN A;  4BRG A;  4BVP A;  2ASM A;  3Q7C A;  4J8F A;  5GAH P;  3DAW A;  3D6R A;  1SZ2 A;  3O9S A;  3BF3 A;  3NVK A;  4H0Y B;  3MCA B;  4JHD B;  1ESV A;  1VQ7 N;  4BGA A;  4IOX A;  5AQF A;  3HOS A;  2J4R A;  3TTC A;  2ASP A;  2HBM A;  3MK6 A;  3QFU A;  4BRI A;  4B1U B;  1QQM A;  1KQS M;  5KQ8 A;  1VQ4 N;  3LDL A;  1K8K A;  1GLJ O;  1VQO N;  3C7N A;  1DKG D;  3FZF A;  4HTL A;  5JMV A;  5GIP A;  2W41 A;  3CJ9 A;  3GL1 A;  5AQW A;  1QQO A;  4CZK A;  1OVY A;  4PHT X;  1HKG A;  3MWT A;  4A5A A;  3F9M A;  1DGK N;  2NRR A;  1QVG M;  2V51 B;  2YHX A;  3O80 A;  3OHR A;  2D1K A;  4OPH A;  3TSQ A;  1YUW A;  3CCQ N;  4UY8 O;  1VQ6 N;  4HWI A;  2NZT A;  1GLA G;  3MWP A;  4H0P A;  4DCH A;  3T69 A;  4WQ4 A;  3H6E A;  4BRA A;  5KPR A;  1KC8 O;  3FFK B;  4GVE A;  1JCF A;  1U2V B;  2A3Z A;  4H5R A;  3J7Z O;  5GIO A;  1X3M A;  4BR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...