2YHXA

Sequencing a protein by x-ray crystallography. ii. refinement of yeast hexokinase b co-ordinates and sequence at 2.1 angstroms resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
457
structure length
457
Chain Sequence
AAAXDXSLVEVHXXVFIVPPXILQAVVSILTTRXDDXDSSAASIPMVPGWVLKQVSGAQAGSFLAIVMGGGDLEVILISLAGRQESSIXASRSLAAAMSTTAIPSDLWGNXAXSNAAFSSXEFSSXAGSVPLGFTFXEAGAKEXVIKGQITXQAXAFSLAXLXKLISAMXNAXFPAGDXXXSVADIXDSHGILXXVNYTDAXIKMGIIFGSGVNAAYWCDSTXIGDAADGGXXGGAGXMXICCDQSSFRKAFPSLPQIXYLXTLNXXSPXAXKTFXKNSXAKNXGQSLRDVLMXFKXXGQXHXXXAXSFXAANVENTSYPAKIQKLPHFDLRXXXDLFXGDQGIAXKTXMKXVVRRXLFLIAAYAFRLVVCXIXAICQKKGYSSGHIAAXGSXRSYSGFSXNSATXNXNIYGWPQSAXXSKPIXITPAIDGXGAASXVIXSIASAXXSXAXXSAXXA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequencing a protein by x-ray crystallography. II. Refinement of yeast hexokinase B co-ordinates and sequence at 2.1 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase(phosphoryl,alcohol acceptor)
molecule keywords HEXOKINASE B
total genus 123
structure length 457
sequence length 457
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 1978-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03727 Hexokinase_2 Hexokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2yhxA02
3.40.367.20 Alpha Beta 3-Layer(aba) Sandwich Hexokinase; domain 1 Hexokinase; domain 1 2yhxA03
3QDKA 2CH6A 3MMVA 4WYBA 3D2FA 5BR9A 2PAVA 2QWPA 1T44A 3EZWA 4EAHD 1OKJA 2GELA 5TKYA 1Y64A 2YHWA 2NRHA 5FPMA 3VGMA 1BWFO 2YJEA 3ULEA 2W40A 3D2EB 3U9ZA 5JLFA 3GG4A 2A3ZA 1YUWA 3VGLA 4FO0A 2W41A 3WXIA 4H0XB 1KAYA 3HTVA 1J6ZA 3MCPA 3VEOA 4CD3A 1QQOA 4FWQA 3VENA 5BREA 1ZBSA 5KPZA 5AQUA 5BN8A 3AAPA 4IJNA 1S3XA 5AQNA 4A62A 2Q0RA 3KHYA 4HWIA 2D0OA 3M6GA 5BPNA 4CI6A 3QBXA 4WQ5C 1H1VA 5AQTA 4JD2A 2P9IB 3ENOA 5AQQA 4BROA 5AQSA 3FLCO 2E2QA 3CHWA 5AQYA 3H3OB 2GTDA 4FWRA 3VF2A 1ZXOA 5EX5A 5BRFA 1P8ZA 1QZ5A 5KQ8A 3CIPA 3CJCA 3LDLA 5AQPA 3VERA 2E20A 5AQFA 2BUPA 5KQDA 5KPTA 5AZJA 4FWSA 4EIAA 1U2VB 1S22A 3QBWA 1HUXA 1ATRA 2P9KA 3ZX3A 2P9UA 4BRCA 5AQKA 4XH5A 3GDQA 3FR0A 1JCEA 2FF3B 3VEVA 2Q36A 2P9SB 4M63C 2F9TA 4JN4A 1Z6RA 1BDGA 1U2VA 2AP1A 2E88A 1BU6O 3QFUA 2P9LB 5ELZA 3VPZA 4E1JA 1E4GT 5JLHA 3FZMA 2Q1NA 4BR5A 1GLBG 1BA1A 1XQSC 5AQZA 4YDUC 4ISGA 2QWNA 2HF4A 5AQVA 4PKHA 1NGHA 5AQRA 1K8KA 3UKRA 3DXKA 3ZEUA 2ZGZA 4EHTA 3MN9A 3FZKA 1QQMA 2HOEA 1ATNA 3CJ1A 4BC2A 2E2NA 1CZAN 3FFKB 1BO5O 3KVGA 4BREA 4LC9B 2EWSA 2I7PA 1NGDA 4GY2B 3BF3A 1X3NA 4CZHA 3CJ7A 3EKUA 4QS8A 1ATSA 3BUZB 2A40A 3CI5A 5EOYA 4BR0A 1HKCA 4XH1A 4FPBA 5BPMA 2ASPA 4BVPA 1GLDG 1WOQA 4BRNA 4CZJA 3MN6A 3C7NB 3IMXA 4BRIA 3L0QA 1DKGD 3A8YA 4CZKA 5AQMA 4JHDA 5AR0A 3A0IX 3SJHA 3OHRA 3FZHA 1BUPA 2A6AA 2H3GX 1SQKA 2OANA 5FPNA 3U4LA 1HLUA 3EO3A 4H5RA 4DQ8A 2P9SA 4A2BA 4BQZA 1HX1A 5E26A 1V4TA 3L4IA 2E2PA 1XUPO 1ESVA 3AY9A 3CETA 2IVOA 5E84A 3W0LA 4H0OA 3FZLA 1TUYA 4FL9A 4FWNA 3H46O 5AQIA 4PL8A 4GNIA 5AZIB 4I6MA 4BRMA 4PKGA 4RCHA 4RWTA 3O4WA 3D7EO 2Q97A 2FSKA 4QS7A 3U9DA 4O5FA 5KPRA 4BRAA 4Y0WA 3RSEB 3TU5A 4BC4A 3BP8A 3P4IA 3WXJA 3WXLA 4JNEA 3LDPA 5F2RA 2A5XA 2V52B 5AQJA 3VETA 3WT0A 2NZTA 4FOIA 3H3NO 5EVZA 5FPDA 1Z05A 1NGGA 3UE5A 1IJJA 4B1WB 2QW9A 2IVNA 3H45C 2P9NA 2V51B 3ZETB 4H03B 4BG9A 1MWKA 2GWJA 2P9LA 3DAWA 1BOTO 3WEEA 3R9PA 4BGBA 4IJAA 3GOIA 4B9QA 1NGAA 3VEZA 1NGBA 3I8BA 2YCHA 1Q18A 3AAQA 1MWMA 3FE1A 4K43A 2VYPA 1NMDA 3M1FA 3B8AX 3I33A 5AFUA 2ZF5O 3LDNA 1KXPA 1X3MA 2I7NA 4YDUA 4DB3A 5F0XA 3CQYA 2E1ZA 1TYQA 3O80A 4NB4A 3L6QA 3AARA 1NLVA 1EQYA 1C0GA 1LOTB 3ZEUB 4CZEA 3ATVA 2UYTA 3UKUB 2DPNA 2ZGYA 4M7XA 3VEYA 4FPAA 5BRHA 4FWOA 3CJ9A 4J8FA 3SK3A 3CQXA 2FSNA 1X9JA 5AQXA 4DCHA 4A61A 1QZ6A 2E8AA 3WXKA 3DWLA 3EL2A 2D0PA 3ULEB 4BR4A 3SLCA 4CBXA 4EHUA 1HPMA 1NGCA 2CH5A 4K25A 3U8XA 3BEXA 4H0PA 2A42A 4H5VA 5AQOA 5AZIA 5I9EB 2QWLA 4K41A 3LDOA 4RTFD 1RDWX 5AQHA 1JCFA 3CJBA 3O08A 2AA4A 3QB0A 3A5MC 4BRFA 3H1QA 2IIRA 3VEXA 4CBUA 1NGEA 2FSJA 3HBTA 4BR2A 3D2EA 4CZFA 2CGJA 5ADXH 4H5NA 3ZETA 4JHDB 3MN5A 4O8KA 2P9KB 4HTLA 4WQ4A 2D1KA 3H1VX 3SMSA 3WUHA 5FPEA 5AQGA 3VEWA 1T6CA 4FOEA 3O1WA 2E1YA 4CZIA 3VF4A 2P9UB 2NLXA 2VCPA 1G99A 1KAZA 2WUSA 3RSEA 4H0VB 3QICA 4KBOA 4FWKA 1K8KB 1T6DA 5AZJB 3SMPA 1KAXA 2GUPA 4CBWA 3UB5A 2QWRA 3H6EA 1NGJA 4F9OA 1IG8A 1GLFO 4BC5A 4CZLA 4FSVA 4H0TB 3GL1A 2Q0UA 4BVOA 4M7YA 3F9MA 3DXMA 2P9IA 2ASMA 2Q2RA 1SZ2A 4BR9A 4CD1A 4EFHA 4IO8A 3WEEB 4MO4A 3ID8A 1GLEG 1YXQA 4H5TA 2QWOA 2A41A 4IWVA 1HKBA 3S41A 3QMLA 3IFRA 1YAGA 1YVNA 4WQ5A 5BN9A 4BRDA 2IVPA 2QWQA 4AM6A 3DJCA 2HMPA 2P9NB 3O5BA 1LCUA 1ZC6A 2J4RA 5AQWA 4BRGA 3C7NA 2ZWHA 3A5OC 4C23A 4B1UB 3D2FB 3HSCA 3VESA 1DGKN 3ZX2A 2P9PA 4CZGA 3G25A 5AFUH 4BRKA 3JS6A 2YI1A 4BGAA 3FZFA 4FWLA 1BA0A 1NM1A 3LDQA 1NBWA 4NO7A 2ASOA 2V7ZA 4B1ZA 3WQTA 1V4SA 3M3ZA 4QS9A 5F1XA 4MLEA 4ISFA 3W3DA 3C0BA 5BRDA 3O8MA 3UKUA 3O6WA 4PL7A 3ATUA 3KZBA 4XEIA 3O1BA 5JICA 4BQLA 4IZ9A 2QXLA 4JAXA 2GWKA 2V7YA 1HKGA 5LJWA 4BC3A 3ZX0A 4MO5A 5LY3A 2YHXA 1XC3A 1HJOA 3J8AA 1MDUB 1R59O 2QWMA 4BR7A 2D4WA 4XH4A 1NGIA 2YHYA 4FWMA 5JMVA 1GLJO 1GLAG 3VF6A 1NWKA 4MLHA 3CJAA 1NGFA 4Z94A 3VOVA 3CERA 2KHOA 1TYQB 2FF6A 3HM8A 4JD2B 1GLCG 4BG8A 3MDQA 4H0YB 4CZMA 2BTFA 1E4FT 3R6MA 4BRQA 5ADXA 4B1VA 2ITMA 4CJ7A 5BPLA 2VWBA 4WQ4C 2CGLA 3EN9A 3LM9A 2FLOA 4I6MB 3MK6A 3DXMB 1QHAA 3BF1A 3FGUA 3R8EA 1TUUA 4BRLA 3GE1A 3MN7A 3IUCA 2YJFA 1QQNA 1JCGA 3ENHA 1C0FA 3VGKA 5LJVA 3A5LC 4AM7A 3UKRB 2E2OA 1RFQA 1DEJA 1D4XA 3HI0A 3LL3A 5AQLA 4DHYA 4IXCA 1BG3A 1U6ZA 3QFPA 3IDHA 2PBDA 5EXWA 2CGKA 4B1YB 4PKIA 3GBTA 4FWPA 2Q31A 3DXKB 4L3QA 4BRHA 2P9PB 4B1XB 3A5NC 3TPQA 5EY4A 4BRPA 1SAZA 2GEMA 4H5WA 3LM2A 1MA9B 3HZ6A 2HF3A 1GLLO 3WQUA 1WUAA 1RGIA 2FXUA 3EKSA 2F9WA 2QM1A 5B8HA 5CE3A 4ISEA 4K42A 4A2AA 3JXUA
chains in the Genus database with same CATH superfamily
4HTUA 3QDKA 2CH6A 3MMVA 4WYBA 1QE1A 2QWPA 1OKJA 2GELA 5TKYA 1Y64A 3OA9A 4E7KA 3KLGA 3PX4A 4CF9A 3J7AP 3VGMA 2PYJA 3MAQA 1BL3A 3ULEA 3LP2A 5LMUK 2W40A 1WSGA 1NKCA 3WXIA 3DLLL 1D9DA 1NK0A 3SI6A 4BE2A 3QERA 4E19A 4CEQA 2XO7A 1QQOA 4FWQA 3VENA 1IBLK 3HXMA 1ZBSA 4ZTJA 4IJNA 5AQNA 2D5RA 4GW6A 1VSEA 2WOMA 5FDLA 4CEZA 4WQ5C 2NRRA 1D5AA 4OPAA 4F2RA 2HB5A 4FJ7A 3TAMA 1QZ5A 3NH1A 3CIPA 2XHBA 4O55A 1XMOK 3VERA 2E20A 2BUPA 5T7BA 1BISA 3QEXA 2UUBK 4B08A 3QBWA 1IKVA 1HUXA 4DF8A 3O9TA 3ZX3A 1S1TA 1JL1A 3VQDA 5J2PA 4YOTA 2UUCK 4HHTA 2P9SB 5GIPA 3E9PA 4CIEA 3SNNA 3E66A 2AP1A 4DV2K 2PY5A 4JKGB 4E1JA 1E4GT 1BCOA 4IOXA 2QWNA 1BGXT 1LAVA 4KH4A 3VQ8A 3HL8A 1NGHA 3RTVA 3UKRA 2DY4A 1EETA 3DM2A 1QQMA 2BE2A 5C25A 3V9ZA 4BC2A 1JLQA 1VSIA 5SZTA 3KLEA 4ELTA 3BF3A 3HYFA 5HRNA 3SQ1A 3ISNC 2OPPA 1L3VA 1KCFA 3VQPA 3OYJA 4LFCK 2GV9A 2D0AA 2I5JA 3IAYA 4DTUA 3HOSA 3L0QA 1DKGD 3A8YA 4N41A 3FZHA 3MEDA 2OANA 5JS1A 4DQ8A 4DV3K 4DS5A 3EO3A 4H5RA 4QCLA 3V9UA 4A2BA 3I0SA 2Z1JA 1HX1A 1U47A 4KHYA 1V4TA 1ESVA 3OW2M 3AY9A 3CETA 4LF7K 1M1KO 1FW6A 3WNGA 1NJXA 1D9FA 1TL1A 4FL9A 2HW3A 1C1AA 4FWNA 5AQIA 4AHRA 5AZIB 3N4QA 3LZJA 4BRMA 1HQEA 1YJ9N 4RCHA 3EYZA 3NFAA 2Q97A 3VQQA 4DU4A 2VWKA 3ZSZA 3TU5A 3AVIA 4LD0A 3BP8A 1NK8A 3P4IA 1C6VA 3WXJA 2X74A 1ITGA 2A5XA 3QIOA 2V52B 3VETA 4MFBA 4GV9A 4J2EA 3H3NO 4CGGA 2XY7A 2KFZA 5C42A 3T3FA 2QW9A 3VQ9A 3H45C 4LSNA 2KW4A 3V6DA 1MWKA 2P9LA 4AQYK 4OPHA 5FRNA 2UXDK 4N76A 4TSXA 1MWMA 3FE1A 2VYPA 4PWDA 1B9FA 4CEDA 2YNHA 2B5JA 2ZF5O 1KXPA 1WBBA 3AGKA 3CQYA 4ID5A 3O9UA 2HHSA 3L6QA 4B9VA 5KTQA 1JXBA 3TSQA 3V9XA 3SUQA 3UKUB 3NVKA 1RTHA 2IAJA 4F3TA 2OCEA 2VGMA 4DV5K 4FPAA 4FWOA 1J5EK 1VQNN 3SK3A 4CEAA 2FSNA 1X9JA 3NAEA 1KRPA 4HUEA 4CK2A 5DM6L 3HVTA 1W97L 2E8AA 1JJ2M 3L2VA 3EL2A 1IO2A 3D6RA 1U04A 4EHUA 3KD1E 1RCHA 3TTFA 4KTQA 5AQOA 3IS9A 3HOTA 4K41A 3LDOA 3HP6A 3SAFA 4JRQA 5HL7L 3NGZA 3K0SA 3BGRA 3TAPA 1C0TA 4K0KK 2OTJN 1S1WA 2E6MA 4M42A 4FJLA 2BH1A 2IIRA 3TSPA 1HNWK 4BR2A 4CZFA 5IWAK 3R1XA 3VQ6A 1N8RO 5GINA 1NK5A 3RWUA 3SMSA 3H1VX 3E9LA 5AQGA 4ZTFA 3VEWA 2KZZA 5HP1A 3KK2A 3LZIA 4B9NA 3VMFB 4DSLA 2E1YA 5A2QO 5JVGL 2A1SA 1LW0A 2VCPA 1VHXA 3QICA 4H8KA 3SMPA 2GUPA 1DTQA 1YJWN 1RT4A 1WSJA 3H6EA 1YI2N 3SUOA 3NF7A 3AO2A 4FSVA 4CZLA 4H0TB 1SKSA 2QKBA 3GL1A 1NJYA 1JKHA 1SV5A 1VSJA 1LAWA 3F9MA 2P9IA 2ASMA 2Q2RA 1SZ2A 4BR9A 4LF8K 1MU2A 3K2PA 4N5SA 1TAQA 1RDBA 1YXQA 4IEEA 3PX6A 1HKBA 3S41A 1Q82O 3IFRA 1XI1A 4WQ5A 4O0JA 3C65A 4JLHA 2QWQA 4LY7A 4N47A 4CHYA 4AM6A 2HMPA 1J54A 3SV3A 2WC9A 5AQWA 3EY1A 4JI6K 3LP1A 2ZJPL 1ZBIA 1EKEA 4CZGA 2IDOA 3S3OA 4BRKA 2O4IA 4WCEL 2OPQA 2YI1A 4E1NA 4DV1K 3P83D 1NM1A 3LDQA 1VSDA 3L4QA 2RKIA 4E7IA 3TAGA 4NO7A 4MDBA 1NOYA 5F1XA 1A5XA 2W42A 1CLQA 3R3LA 3TAFA 3ZT3A 5M1FA 3UKUA 2F8TA 1N32K 3VQBA 3KZBA 2NRVA 1C0UA 4J2DA 3ZYYX 3S3MA 4IZ9A 3K5NA 4CJ3A 5LJWA 1FJGK 2RHKA 4JYAK 3CM5A 1HJOA 1BCMA 4J2AA 1N33K 1MDUB 3RRHA 2QWMA 4BR7A 4CEEA 4FYDA 3THYA 1NGIA 4FCYA 2YHYA 1IBKK 4CJRA 1GLJO 3PSFA 1QSLA 3PY8A 4MLHA 3PSIA 4OGEA 1HNVA 3CPWM 3CERA 4YNQA 2KHOA 1Z25A 1TYQB 1NKEA 4DTJA 4DTSA 1F21A 2Y1IA 1E4FT 5CYMA 5ADXA 3HM9A 4L8RB 3G0ZA 4B1VA 2ITMA 5BPLA 3KKSA 4I6MB 1VSFA 3SCXA 3FGUA 3VQ7A 4BRLA 2G8FA 3IUCA 1JCGA 3ENHA 3V1OA 4DFKA 5LJVA 2E2OA 1RFQA 3ZLJA 1DEJA 1QS4A 1RDUA 3FFIA 3HI0A 3SPYA 1VQMN 3LL3A 1OH8A 5C15A 4A5AA 4CEBA 4IXCA 1NKBA 2OZMA 1RNHA 3IDHA 2PBDA 2CGKA 4B1YB 4DG1A 3RR8A 4CJQA 2B4JA 5EY4A 4FW2A 1KFSA 2JGUA 4OVLA 2ETJA 3AVBA 4CHPA 2FXUA 1W9HA 1VRUA 1ZBHA 2QM1A 4BACA 4B3TK 1JLAA 3RR7A 4CJTA 4ZHRA 3V4IA 2G8IA 4PA1A 4IOCL 4KB0A 1CZ9A 3DLEA 4JKFA 5BR9A 2KLAA 2PAVA 3EZWA 4BDYA 4JK7A 1FK9A 4IFEA 1X9MA 4V19S 4DQQA 1Q7YO 3ZSWA 4DR3K 5JLFA 2A3ZA 3G10A 1YUWA 3VGLA 4IKFA 2W41A 4H0XB 4I2QA 1J6ZA 3OYEA 3WNEA 3OYFA 3VEOA 2R7YA 1NJZA 1LWFA 4KHNA 3DI6A 3OS2A 5AQUA 3AAPA 4CCHA 3CCUN 3NVMA 3L3VA 4A62A 2Q0RA 1QVFM 3M6GA 4CI6A 4OLBA 3NMUA 1H1VA 3K5LA 3OYMA 4FXDA 3FLCO 3VA0A 2GTDA 3VF2A 3E9OA 1ZXOA 2QI2A 4FJXA 2UXBK 5KQ8A 2E5LK 2HHQA 3LWLA 1GOAA 4NYNA 1GOCA 5AZJA 4FWSA 5HROA 4JS5A 1VQ7N 3LPUA 5AJ3K 1ATRA 4PUOA 3ULDA 4CJEA 1JCEA 3FR0A 2G8UA 3TAQA 4FK2A 2FF3B 2F9TA 4FJGA 2O8FA 4K8XA 4WE1A 4IDHA 3AVMA 4CEFA 1BDGA 4ID1A 2E88A 4FLVA 4AILC 5ELZA 3VPZA 2A1RA 5C2DA 4PY5A 3FZMA 4AHTA 3OBWA 3CCSN 3O3HA 2AJQA 1N6QA 2HBKA 2WFBA 3M8SA 3EEQA 1YF5L 5DK5A 5AQRA 1K8KA 3DXKA 4GKJK 4IFYA 4HVJA 3MN9A 3AO3A 2HNYA 1NJWA 3DLRA 3CJ1A 1OVYA 2E2NA 5DM7L 3J81O 4LC9B 3PIOL 4DSKA 3S3NA 1HYSA 1NGDA 4GY2B 3SYZA 1FXXA 1X3NA 3CJ7A 3EKUA 1ATSA 3U6FA 1YT3A 1KVBA 4Z0UA 2IOCA 4XH1A 5J2MA 1S5JA 1GLDG 5C24A 1U48A 3IMXA 1D8YA 3AVAA 4CZKA 4JHDA 1K6YA 3SJHA 4DLEA 1SQKA 1HPZA 2O8EA 4PQUA 3TTCA 4YOYA 2IVOA 3JSMA 1WN7A 1VQ9N 3H46O 4I6MA 1WSFA 4OO1J 1QSSA 2HHHK 4H4OA 3D7EO 4JS4A 5J2NA 4CFBA 2FSKA 4QS7A 3U9DA 4DTPA 4J2BA 4Y0WA 3RSEB 2BANA 4OX9K 3O3FA 1XMQK 3VTIA 1KSPA 4JNEA 3CC2N 5F2RA 5AQJA 1B92A 3MWTA 4B1WB 4BY9C 2IVNA 2OYQA 2P9NA 3TTDA 3VQCA 1TK8A 1TVRA 4ICLA 4JKGA 2GWJA 3LP3A 3NHGA 3WEEA 5TKWA 4CF2A 5I3UA 4BGBA 3GOIA 2O8DB 3T1YK 3CM6A 1NGAA 4CJSA 4CFCA 3SUNA 2YCHA 1Q18A 2HBMA 4M3UA 2XRIA 3KLIA 1NMDA 4I9LA 4UQGA 4DR1K 1IBMK 3M1FA 1TKDA 3DLHA 4FZYA 4JI1K 5AFUA 5K14A 1KTQA 3L3UA 3K59A 3CPEA 4CF8A 3KKRA 1X3MA 4DB3A 1SKRA 3CD6N 3K9JA 2E1ZA 3ZT1A 4YOUA 1TYQA 3ZSRA 2UYTA 1U45A 3PO4A 1RTJA 1W7AA 4DR7K 4W5QA 1L3UA 5M1OA 3CC7N 1Z26A 2P1JA 4AHVA 4Q5VA 2DTUA 1J9AA 3WXKA 3DWLA 4CJUA 4EP4A 3KLHA 1TK5A 3KK7A 1HPMA 2CH5A 1RBRA 4K25A 4QOZB 3U8XA 3OS1A 1VAZA 5J2QA 3BEXA 4YFUA 4E89A 1FKOA 4H5VA 1C1CA 5I9EB 1A5WA 2QWLA 1RDWX 1HMVA 5AQHA 4BE1A 4F8RA 3ALYA 3THWB 3CCQN 2KQ2A 3CJBA 4RW4A 3QO9A 4JI8K 1C0MA 4YHHK 4BRFA 4EZ6A 4FJ8A 4FJMA 3VEXA 4CBUA 2OA8A 3V9WA 3WXMB 3D2EA 2YNIA 4CGJA 3OYBA 1WSIA 3MN5A 3CCLN 3K9KA 2P9KB 2W6KA 2YX6A 4KHQA 4LSLA 4B9MA 4GV6A 2YV0X 1T6CA 2RPIA 4FOEA 1NK6A 2P5GA 3O1WA 2PFUA 4B3OA 4IG0A 4E7JA 1G99A 2WUSA 1IKWA 4KBOA 1K8KB 4NXNK 3U3YA 4CBWA 2JLEA 2XY5A 1RT2A 1NGJA 3ZSQA 4JI0K 1IG8A 1NOZA 1GLFO 4CHQA 2ZM6K 2F96A 4LF9K 4K8ZA 3CC4N 4CGDA 1Q9XA 3G6EN 5HRPA 2VG5A 4EFHA 4DF4A 4FLWA 3KIOA 4CVNE 3CYMA 3OYGA 2WTUA 3CG7A 2QWOA 2IS3A 1N5YA 1KFDA 2Y1JA 1JLFA 1S9GA 1YAGA 1IH7A 4OPKA 4DSEA 1UWBA 3B6OA 1WAJA 1QTMA 1X1PA 1EXQA 1VQ5N 2IGIA 4AHSA 1YJNN 1WSHA 1DGKN 3ZX2A 3JYTA 3TAEA 2F7TA 4U67L 3G25A 3IKMA 4FK4A 4BGAA 2EX3A 3ZSYA 4FWLA 1BA0A 3ENBA 3SV4A 2ASOA 2HBLA 2O8EB 3M3ZA 4QS9A 4MLEA 4ISFA 4W5RA 3W3DA 3O8MA 1RBTA 3ATUA 4C8NA 4XEIA 4IOAL 3HO1A 2BGGA 2RE2A 4CJFA 4FJHA 4CJ5A 4JV5K 1SL1A 2NNWA 4F4KA 1JL2A 4JAXA 3V81A 4FJ9A 1HKGA 2Z1IA 3MXJA 1T03A 3ZX0A 5LY3A 3QINA 2PYLA 4OKKA 1NJIO 3O4QA 4ILGB 4JI4K 5J1EA 1WAFA 4XH4A 5CY4A 2HMIA 1RT1A 3OBYA 5JMVA 2PZSA 3VF6A 1YTAA 1I3AA 3ZCMA 1ILYA 3I55N 3AVCA 1VQ6N 4Y1DA 5C10A 3LANA 4DV4K 3R6MA 4BRQA 3MWPA 3HVRA 5H1SQ 2VWBA 4WQ4C 4AF1A 4MDAA 1WSEA 3LM9A 3DXMB 4KKOA 1TUUA 3CCJN 2P51A 3VGKA 4AM7A 3PV8A 4GV3A 3L2QA 3WNHA 1NNEA 1ZBUA 1BQNA 3MX5A 5AQLA 3OJUA 4DHYA 4E0DA 1W0HA 3KWGA 5C12A 2DFHA 1UA0A 4FWPA 3PO5A 4BRHA 4LH5A 1BQMA 1WLJA 2RN2A 5JVHL 3QNOA 4AHCA 3BDPA 3T69A 3VN5A 4CFAA 3TI0A 2KKZA 3WQUA 1RGIA 2F9WA 5CE3A 4ISEA 5M1PA 2RF2A 3NE6A 1YVUA 4K42A 4A2AA 3C6UA 3JXUA 4PHTX 5LL6Z 5C0YA 3D2FA 3CCVN 4ELVA 3ZSVA 4DUYK 2YHWA 2VQFK 4FW1A 3EE8A 3SZ2A 3ZT4A 1BWFO 2YJEA 5CYQA 3J7ZO 3D2EB 3U9ZA 2DFEA 1HQUA 1S1UA 1U49A 3MCAB 4M3RA 3AA2A 3QNNA 1XHXA 3HTVA 4KTWA 3QEVA 4NCBA 4CK1A 1K9MO 3MCPA 4C1NI 4CD3A 1K73O 2FC0A 1T05A 3DLKA 4DU3A 5BN8A 1BI4B 1S3XA 1L5UA 1DLOA 4BWJA 4HWIA 1RDAA 4A59A 5BPNA 4ILJA 5AQTA 2P9IB 3ENOA 4BROA 5AQSA 1VQ4N 2JWLA 2E2QA 1GOBA 4Z4CA 3H3OB 4FWRA 2UUAK 5EX5A 1VRTA 3SBGA 5BRFA 4M3TA 1P8ZA 3E01A 4IO9L 2GX9A 3LDLA 2VG7A 3O9RA 5KQDA 5AQFA 5HBMA 2F4VK 2Z1HA 3KD5E 1U2VB 4KFBA 1CXQA 4FJ5A 4DQRA 4IBNA 3AV9A 1N36K 4KHWA 2F8SA 3VEVA 4JN4A 1U2VA 3B6PA 3QFUA 1BU6O 2HNDA 3ZT0A 4KAZA 5IT9O 4NXMK 3ASMA 2Q1NA 4BR5A 1Q81O 4O4GA 1GLBG 4DR2K 4DTRA 3QEPA 5AQZA 3PIPL 1KC8O 2HF4A 3PUFA 4PKHA 3CCMN 2HBJA 1ZBLA 4N56A 2ZGZA 4DTOA 1RTIA 2HOEA 1HJRA 3D45A 3FFKB 1BO5O 3LAKA 3C94A 4BREA 1W2BM 4DQSA 1L3SA 2EWSA 4CJLA 4AHUA 4CZHA 3KTQA 1EWQA 4QS8A 3BUZB 2A40A 3Q7BA 4DWIA 2KTQA 3AVFA 5EOYA 3J80O 1XNRK 4F2SA 1HKCA 3NF8A 4FM0A 1KLNA 1LW2A 2ASPA 2BDPA 4GKKK 2QK9A 3THXB 3NF9A 1WOQA 3C6AA 5CZ1A 4KV8A 4BRNA 3MN6A 1BHLA 5AQMA 5AR0A 3A0IX 2H3GX 1IG9A 3DLBA 4BE0A 1YHQN 5C2FA 2P9SA 1DT9A 3ITHA 1XUPO 1JLGA 2KFNA 3P38A 1ASWA 3W0LA 5GADP 4RW7A 1EX4A 3OYKA 4PL8A 4GNIA 4PKGA 4JKHA 3T19A 4CJ4A 4YORA 4RWTA 4JKCA 4KHSA 4CJWA 1WBDA 4O5FA 2ZJQL 4BRAA 4BC4A 1RBVA 3QLHA 3DRSA 3KK1A 1TKXA 3WXLA 3LDPA 1J53A 3HPHA 3WT0A 5EVZA 4XIUA 2FBVA 5FPDA 1IJJA 3M8QA 4CE9A 3AVKA 2V51B 2HSTA 3ZETB 4H03B 4BG9A 4CIGA 3DAWA 3L2UA 1BOTO 3OYHA 4I2PA 4CJPA 3QEWA 1TGOA 1SL0A 4C8LA 4LH4A 5E41A 4LFBK 3I8BA 4OGCA 2W6LA 4K43A 3HJFA 3LAMA 3NH2A 4FZZA 3AVGA 3Q7CA 3I0RA 2O4GA 3LPTA 4OJRA 4WFBL 3AGRA 2I7NA 4YDUA 4JKBA 3RMDA 4FM2A 3O80A 3LDSA 1EQYA 1C0GA 4CZEA 3ATVA 3SUPA 1HYZA 3C95A 3WNFA 3K5MA 3VEYA 2ZE2A 3CJ9A 4J8FA 2HVIA 1BI4A 3CQXA 1QZ6A 3P31A 3HK2A 4CIFA 4DTMA 2D0PA 2VG6A 4Z4IA 4JI2K 4HCBA 4WFNL 3BZCA 1IKYA 1J5OA 3AA5X 3HPOA 3LALA 2QEXN 1QQCA 2NRWA 3IG1A 1JCFA 4RW9A 1NMNA 1TKZA 3QB0A 3A5MC 1LWCA 3CCEN 3AA4A 3H1QA 4CF0A 1JLBA 1NGEA 3HBTA 2B6AA 2CGJA 4FJNA 4H5NA 1SL2A 3J7YP 1WB9A 2XY8A 4WQ4A 1I39A 2D1KA 4KH5A 3WUHA 4EZ9A 5FPEA 1X9WA 1U4BA 3JAMO 3VF4A 2NLXA 3V1RA 1KAZA 1ASVA 4DKWA 1JLCA 1T6DA 5AZJB 3TANA 2QWRA 4F9OA 5HOOA 1T3VA 3F5TA 4BC5A 2VGNA 1TK0A 4M3YA 3MXMA 4IDKA 3DXMA 4A57A 1VSKA 4MO4A 3ID8A 3P1GA 1G15A 4CJKA 1ZYQA 5M1NA 3V1QA 4IWVA 1OH7A 3I8DA 5HLFA 4DU1A 5BN9A 4BRDA 2IVPA 4CHNA 1VQON 5FROA 1LCUA 3OS0A 1C1BA 1R0AA 4FVUA 4O44A 3A5OC 4C23A 3VQ5A 3RMCA 3HSCA 3VESA 3C6TA 3K57A 3M8RA 3JS6A 4NCGA 3MXIA 2Z1GA 3OY9A 1N34K 1NBWA 5KGWA 4RG8A 2V7ZA 4B1ZA 4CESA 3WQTA 1V4SA 4O0IA 1XHZA 1RTDA 3D0PA 3QESA 4W5TA 4DLGA 5BRDA 3OYCA 2QXFA 3EZ5A 3O6WA 4PL7A 4FLUA 4B9TA 4BQLA 3SPZA 1RT5A 1IKXA 2QXLA 5I42A 1EP4A 4KH6A 4JI7K 4CF1A 3ID6A 4I9QA 4MO5A 2YHXA 2NRXA 4M3ZA 3J8AA 1R59O 4JK9A 1YTUA 1VSHA 2YHBA 4Z4GA 4FWMA 3O9QA 2HHXA 3NH0A 2VQEK 1NWKA 3CJAA 4Z94A 4E1MA 4KHUA 3VOVA 4JI5K 4JI3K 5KRSA 4FLTA 1GLCG 2ZD1A 3MDQA 3CFPA 4H0YB 4CZMA 3I56N 4YY3K 3OJSA 2LSNA 3VQEA 5GAHP 3MK6A 3AA3A 1S1XA 3ZSXA 1SKWA 3SQ2A 1QQNA 1RT7A 1C0FA 3A5LC 4B9SA 2UU9K 4QAGA 2YNGA 3NGYA 4JKEA 4EP5A 4FLZA 1UA1A 5M1KA 4FK0A 3O4NA 3M8PA 1BG3A 1U6ZA 5EXWA 5LMNK 1BIZA 1RILA 2OZSA 4O5BA 2P9PB 3AO5A 3A5NC 3TPQA 4DR4K 3LP0A 4BRPA 1SAZA 2GEMA 5HRRA 5KRTA 3LM2A 1MA9B 3HZ6A 4KO0A 3NGIA 1GLLO 1RBUA 4CEOA 5B8HA 4LF6K 4JKAA 4AH9A 3QEIA 3AO1A 4X64K 2YKNA 3VTHA 1WNSA 2E6LA 1T44A 4EAHD 3RRGA 5EU7A 5M1QA 4BWMA 4B3MK 4M3WA 2Q3SA 5HRSA 3CMAN 2NRHA 1E3MA 5FPMA 3DRPA 4X66K 4CGFA 1B9DA 1RBSA 1Q8IA 2ITGA 3QETA 3GG4A 4FO0A 4E7LA 4CHZA 1SUQA 1KAYA 4DSFA 4H4MA 1Y97A 4Z4EA 2HVHA 3ZSOA 4X62K 4FVMA 5BREA 3CF5L 5KPZA 1Q86O 5GIOA 4KB1A 2HHTA 1S72N 3KHYA 2D0OA 3LWMA 4I7FA 3QBXA 1IV0A 4FZXC 4JD2A 5AQQA 3THWA 3CHWA 4KPYA 5AQYA 2YNFA 3HT3A 4HUGA 3ZT2A 1UAXA 2QTDA 2X6SA 3CJCA 5AQPA 4YOWA 3THVA 3K5OA 5KPTA 4HUFA 4EIAA 1T8EA 1S22A 3SQ0A 4JKDA 2P9KA 2P9UA 1ZBFA 4BRCA 5AQKA 2O8BA 1XNQK 3CFOA 1LV5A 3CQ8A 4XH5A 3GDQA 3F73A 2Q36A 4M63C 3DLGA 1VQPN 1Z6RA 3QIPA 4WF9L 4FLXA 2P9LB 1RDDA 4NLBA 2OPRA 5JLHA 4B3RK 5BR8K 4OKEA 1YIJN 1BA1A 1XQSC 4YDUC 5SWMA 4ISGA 4FLYA 5AQVA 1OH6A 1S6QA 4ELUA 4DV7K 3ZEUA 4EHTA 3SAGA 1QVGM 3O9SA 1XC9A 1UOCA 3FZKA 1ATNA 3A2FA 2FBYA 1Q9YA 4DSIA 1CZAN 3KVGA 2I7PA 2YHAA 4DMNA 3NBPA 4NLCA 4KRFA 4G1QA 1VK0A 4FJIA 2D0BA 3CI5A 3P39A 5D3GA 3V9SA 4BR0A 3M5RA 4FPBA 4NYFA 5BPMA 1CXUA 4KTZA 2O8DA 4BVPA 1VSMA 4DR5K 4CZJA 1YITN 3C7NB 3O3GA 1EWRA 4BRIA 4G9ZA 4YOXA 3KLFA 3OHRA 1BUPA 2A6AA 3BZKA 3U4LA 5FPNA 1HLUA 1HNIA 4C8OA 4BQZA 2KZMA 5E26A 3MEGA 3L4IA 2E2PA 4JEPA 4KI4A 5E84A 3L2RA 4H0OA 3FZLA 4R5PA 1TUYA 1HNZK 3CMEN 4LF5K 2GBZA 2O8CA 3EE9A 2ZQBA 1RDCA 5KGXA 3CCRN 3HP9A 1P90A 3O4WA 3TR8A 3OVNA 3MEEA 5KPRA 4KI6A 4W5NA 4E3SA 1S1VA 3F2KA 4WFAL 1VSLA 3SQ4A 2QKKA 4FM1A 1XWLA 4BDZA 2NZTA 4FOIA 1Z05A 1NGGA 3UE5A 1REVA 3NF6A 1HNXK 2GUIA 4KHPK 1M90O 3AVJA 3BY5A 3P5JA 3R9PA 3CXCM 3L8BA 4IJAA 4B9QA 5GAGP 4UY8O 3AO4A 3VEZA 4CGHA 3H08A 2JWKA 2UXCK 1NGBA 3AAQA 4CW7B 4CHOA 5CZ2A 3OTOK 4OKJA 5JS2A 3B8AX 3I33A 3LDNA 5CR4A 4U7BA 5F0XA 3DMJA 5FRMA 4M45A 4JK8A 1NG9A 1VQKN 2NRTA 1T7PA 4CECA 3SBTA 4NB4A 2NUBA 1NLVA 3AARA 1LOTB 3ZEUB 2DPNA 2ZGYA 4M7XA 2HHUA 5BRHA 3RMAA 4B9UA 2YKMA 5AQXA 4DFPA 4DCHA 4A61A 1KQSM 4Z4HA 3ULEB 3T1AA 4BR4A 3SLCA 3PX0A 4CBXA 1FKPA 1NGCA 3L2WA 4MQ3A 4OPJA 4CK3A 2D0CA 4BDPA 4H0PA 1I94K 2A42A 2XY6A 5AZIA 4RW6A 3K58A 4RTFD 4IEIA 3VA3A 4W5OA 3O08A 2AA4A 4B3SK 4OLAA 4DUZK 3AVLA 2O8BB 2NRZA 3OYDA 2FSJA 3DRRA 1ASUA 1X9SA 5ADXH 1QHTA 4X65K 3ZETA 1L3TA 4JHDB 4O8KA 4HTLA 4GMJB 3OYIA 1S9EA 4CGIA 4GVEA 1SS6A 3SJJA 3AVHA 1JXEA 3MECA 4M41A 3IRXA 4DQIA 4CZIA 2P9UB 4C1NK 5DMRA 3RSEA 3HSTB 1HYVA 4H0VB 3VQ4A 1TAUA 4FWKA 4C8KA 1HRHA 1KAXA 3UB5A 4E7HA 1RT6A 3C6HA 1QSYA 1NU0A 2ZJRL 4FJKA 2Q0UA 4DV6K 4BVOA 1O1WA 3S9HA 4M7YA 4B8CA 4CD1A 4IO8A 3U3GA 4HCCA 3WEEB 3N4PA 3AVNA 3DYAA 1GLEG 4H5TA 3TWHA 2A41A 3OYLA 3QMLA 4FJJA 5KI6A 1YVNA 1VQ8N 3NDKA 4IG3A 2G8KA 3DJCA 2P9NB 3O5BA 1ZC6A 2G8HA 2J4RA 4BRGA 3C7NA 1DTTA 2HNZA 2ZWHA 1OH5A 2ATQA 4B1UB 1JLEA 3D2FB 1CZBA 3KK3A 1O13A 2P9PA 1KD1O 2DFFA 5AFUH 3F9KA 1LWEA 5FLXO 4Z4FA 3RMBA 3PLAA 3FZFA 4LFAK 2HHVA 4DFJA 4Q0BA 4CJVA 3DOLA 3C0BA 4DR6K 2OPSA 4NCAA 2OTLN 3HRGA 2FBTA 4RW8A 2X78A 3SAHA 4M3XA 4JRPA 3O1BA 5JICA 1NK7A 4DS4A 2O8CB 3HPGA 3UIQA 2G8WA 2GWKA 2V7YA 2WBNA 4DQPA 4BC3A 4DTNA 3E1YA 1XC3A 1HR0K 2IC3A 2WONA 4GVMA 2P5OA 1A5VA 2D4WA 4O8UA 2QA4N 2HHWA 1S6PA 3RVCA 4F3OA 1GLAG 4CERA 3KWIA 3VQAA 1NGFA 3T1HK 4A5BA 2FF6A 3HM8A 4JD2B 3DOKA 4BG8A 1BIUA 2EHGA 3OYAA 1EO1A 3G4SN 2BTFA 1NK9A 4CJ7A 3TSUA 2CGLA 3EN9A 3THYB 2FLOA 4DTXA 1KVAA 1QHAA 3BF1A 3R8EA 3GE1A 2FBXA 3MN7A 2YJFA 1K8AO 3UKRB 4B9LA 1OVQA 1D4XA 5GAEP 1NK4A 4YOVA 3KJVA 4Y1CA 1TV6A 4KREA 5CHIA 3QFPA 4PKIA 3GBTA 1KVCA 1KLMA 2Q31A 3DXKB 4IFVA 4L3QA 3TABA 2E4LA 4B8AB 3OYNA 2O8FB 4B1XB 4DFMA 4CFDA 3THXA 1VQLN 3MX2A 3T7ZA 4H5WA 4R79A 5MLCQ 1TKTA 3CFRA 2HF3A 2X6NA 1WUAA 3TARA 4LF4K 3EKSA 3G71N 4C8MA 4ILHA 3NCIA 1TL3A 2VWJA 4DSJA 4DV0K 1RT3A 2G8VA
chains in the Genus database with same CATH topology
3QDKA 2CH6A 5C0YA 3MMVA 4JKFA 3D2FA 4WYBA 5BR9A 3CCVN 2KLAA 2PAVA 1T44A 2QWPA 3EZWA 4EAHD 4JK7A 1OKJA 2GELA 5TKYA 1Y64A 3OA9A 5M1QA 2YHWA 4IFEA 3CMAN 2NRHA 3EE8A 5FPMA 3VGMA 1Q7YO 1BWFO 2YJEA 3ULEA 3J7ZO 2W40A 3D2EB 3U9ZA 5JLFA 3GG4A 2A3ZA 1YUWA 3MCAB 4FO0A 2W41A 3VGLA 3WXIA 4H0XB 3DLLL 1KAYA 3HTVA 1J6ZA 1K9MO 3MCPA 3VEOA 4C1NI 4CD3A 1K73O 1QQOA 4FWQA 3VENA 5BREA 3CF5L 1ZBSA 5KPZA 1Q86O 5AQUA 5BN8A 3AAPA 5GIOA 4IJNA 1S3XA 5AQNA 3CCUN 3NVMA 4A62A 2Q0RA 1QVFM 1S72N 3KHYA 4HWIA 2D0OA 3M6GA 4A59A 5BPNA 4ILJA 4CI6A 3QBXA 4WQ5C 3NMUA 1H1VA 5AQTA 2NRRA 4JD2A 2P9IB 3ENOA 5AQQA 4BROA 4OPAA 5AQSA 1VQ4N 2JWLA 2E2QA 3CHWA 3FLCO 5AQYA 3H3OB 2GTDA 4FWRA 3VF2A 3E9OA 1ZXOA 5EX5A 3SBGA 5BRFA 2QI2A 2QTDA 1P8ZA 1QZ5A 5KQ8A 3CIPA 2GX9A 4IO9L 3CJCA 3LDLA 5AQPA 3O9RA 2E20A 5AQFA 2BUPA 3VERA 5KQDA 4YOWA 5KPTA 5AZJA 4FWSA 4EIAA 1U2VB 1S22A 1VQ7N 3QBWA 1HUXA 4JKDA 1ATRA 2P9KA 3O9TA 3ZX3A 2P9UA 4BRCA 5AQKA 4XH5A 4YOTA 3GDQA 1JCEA 3FR0A 2FF3B 3VEVA 2Q36A 2P9SB 4M63C 2F9TA 3E9PA 5GIPA 4JN4A 1VQPN 3E66A 1Z6RA 4IDHA 1BDGA 1U2VA 2AP1A 2E88A 1BU6O 3QFUA 4WF9L 2P9LB 4JKGB 5ELZA 4NLBA 3VPZA 4E1JA 5C2DA 1E4GT 5JLHA 3FZMA 2Q1NA 4BR5A 1Q81O 1GLBG 3OBWA 3CCSN 4IOXA 1YIJN 1BA1A 1XQSC 5AQZA 2HBKA 4YDUC 3PIPL 1KC8O 2WFBA 4ISGA 2QWNA 2HF4A 1YF5L 5AQVA 4KH4A 4PKHA 3CCMN 1NGHA 2HBJA 5AQRA 1K8KA 3UKRA 3DXKA 3ZEUA 2ZGZA 4EHTA 3SAGA 1QVGM 3O9SA 3MN9A 3FZKA 1QQMA 2HOEA 1ATNA 3CJ1A 1OVYA 4BC2A 2E2NA 1CZAN 3FFKB 1BO5O 3KVGA 5DM7L 4BREA 4LC9B 1W2BM 3PIOL 2EWSA 2I7PA 1NGDA 4GY2B 3BF3A 1X3NA 4CZHA 3CJ7A 3EKUA 4NLCA 4QS8A 1ATSA 3BUZB 2A40A 3Q7BA 3CI5A 3P39A 5EOYA 4BR0A 1HKCA 3M5RA 4FPBA 4XH1A 5BPMA 2ASPA 4BVPA 1GLDG 1WOQA 3C6AA 4BRNA 4CZJA 3MN6A 1YITN 3C7NB 3IMXA 4BRIA 4G9ZA 4YOXA 3L0QA 1DKGD 3A8YA 4CZKA 3HOSA 5AQMA 4JHDA 5AR0A 3A0IX 3SJHA 3OHRA 3FZHA 1BUPA 2A6AA 2H3GX 1SQKA 2OANA 5FPNA 3U4LA 1HLUA 3EO3A 4H5RA 4DQ8A 1YHQN 5C2FA 2P9SA 4A2BA 1DT9A 4BQZA 1HX1A 5E26A 1V4TA 3L4IA 2E2PA 4JEPA 1XUPO 1ESVA 3OW2M 3AY9A 3CETA 3TTCA 2IVOA 5E84A 3P38A 4YOYA 3W0LA 5GADP 4H0OA 1M1KO 3FZLA 1TUYA 4FL9A 3CMEN 4FWNA 1VQ9N 3EE9A 3H46O 5AQIA 4PL8A 4GNIA 3N4QA 4I6MA 5AZIB 4PKGA 4JKHA 4BRMA 3CCRN 1YJ9N 4OO1J 1P90A 4RCHA 4YORA 4RWTA 3O4WA 3D7EO 2Q97A 2FSKA 4QS7A 4JKCA 3U9DA 4O5FA 2ZJQL 5KPRA 4BRAA 4Y0WA 3RSEB 3TU5A 4BC4A 3F2KA 3BP8A 3P4IA 3WXJA 3VTIA 3WXLA 4JNEA 3LDPA 4WFAL 3CC2N 5F2RA 2A5XA 2V52B 5AQJA 3VETA 4GV9A 3WT0A 2NZTA 4FOIA 3H3NO 5EVZA 5FPDA 1Z05A 3MWTA 1NGGA 3UE5A 1IJJA 4B1WB 2QW9A 4BY9C 2IVNA 3H45C 2P9NA 2V51B 2HSTA 3TTDA 3ZETB 4H03B 4BG9A 1MWKA 2GWJA 2P9LA 4JKGA 3DAWA 1BOTO 4OPHA 3WEEA 1M90O 5TKWA 3R9PA 4BGBA 3CXCM 4IJAA 3GOIA 4B9QA 5GAGP 1NGAA 4UY8O 3VEZA 2JWKA 1NGBA 3I8BA 2YCHA 1Q18A 3AAQA 1MWMA 3FE1A 2HBMA 4K43A 2VYPA 1NMDA 3Q7CA 3M1FA 3B8AX 3I33A 5AFUA 2ZF5O 3LDNA 4WFBL 3CPEA 1KXPA 5CR4A 4U7BA 3AGRA 1X3MA 2I7NA 4YDUA 4DB3A 5F0XA 3AGKA 3K9JA 4JKBA 3CD6N 4JK8A 3CQYA 1VQKN 2NRTA 2E1ZA 3O9UA 1TYQA 4YOUA 3SBTA 3O80A 4NB4A 3L6QA 3AARA 1NLVA 1EQYA 1C0GA 1LOTB 3ZEUB 3TSQA 3ATVA 4CZEA 2UYTA 3UKUB 2DPNA 3NVKA 2ZGYA 4M7XA 5M1OA 2VGMA 3VEYA 4FPAA 5BRHA 3CC7N 4FWOA 3CJ9A 4J8FA 1VQNN 3SK3A 3CQXA 2FSNA 1X9JA 5AQXA 4DCHA 4A61A 5DM6L 1QZ6A 1W97L 3P31A 1KQSM 2E8AA 3WXKA 3DWLA 1JJ2M 3EL2A 2D0PA 3D6RA 3ULEB 4BR4A 3SLCA 3KK7A 4CBXA 1HPMA 4EHUA 1NGCA 2CH5A 4K25A 4WFNL 3U8XA 3TTFA 1VAZA 3BEXA 4H0PA 2A42A 4H5VA 5AQOA 3HOTA 5AZIA 5I9EB 2QWLA 4K41A 2QEXN 3LDOA 4RTFD 3SAFA 1RDWX 4IEIA 2NRWA 5AQHA 5HL7L 3CCQN 1JCFA 3CJBA 3O08A 2AA4A 3QB0A 2OTJN 3A5MC 4BRFA 3CCEN 3H1QA 2BH1A 2IIRA 3TSPA 3VEXA 2NRZA 4CBUA 1NGEA 2FSJA 3HBTA 4BR2A 3WXMB 3D2EA 4CZFA 2CGJA 5ADXH 3R1XA 4H5NA 3ZETA 1N8RO 5GINA 4JHDB 3MN5A 3CCLN 3K9KA 4O8KA 2P9KB 4HTLA 2YX6A 4WQ4A 2D1KA 4KH5A 3H1VX 3SMSA 3WUHA 5FPEA 3E9LA 4GVEA 1SS6A 5AQGA 4GV6A 3VEWA 1T6CA 4FOEA 3VMFB 3O1WA 2E1YA 2PFUA 4CZIA 5JVGL 3VF4A 2P9UB 2NLXA 4C1NK 2VCPA 1G99A 1KAZA 2WUSA 3RSEA 4H0VB 4DKWA 3QICA 4KBOA 4FWKA 1K8KB 1T6DA 5AZJB 3SMPA 1KAXA 2GUPA 4CBWA 3UB5A 1YJWN 2QWRA 3H6EA 3C6HA 1NGJA 4F9OA 1IG8A 1YI2N 1GLFO 5HOOA 1T3VA 3F5TA 4BC5A 2VGNA 4CZLA 4FSVA 2ZJRL 4H0TB 3GL1A 2Q0UA 4BVOA 3CC4N 4M7YA 3DXMA 2P9IA 2ASMA 2Q2RA 3F9MA 3G6EN 1SZ2A 4A57A 4BR9A 4CD1A 4EFHA 4IO8A 3WEEB 3N4PA 4MO4A 3ID8A 1GLEG 1YXQA 4H5TA 2QWOA 4IEEA 5M1NA 2A41A 4IWVA 1HKBA 3S41A 3QMLA 1Q82O 3IFRA 1YAGA 1YVNA 4WQ5A 3C65A 5BN9A 4BRDA 2IVPA 2QWQA 1VQ8N 1VQON 4AM6A 3DJCA 2HMPA 2P9NB 3O5BA 1LCUA 1ZC6A 2J4RA 2WC9A 5AQWA 4BRGA 3C7NA 1VQ5N 4FVUA 2ZWHA 1YJNN 3A5OC 4C23A 4B1UB 3D2FB 2ZJPL 3HSCA 3VESA 1DGKN 3ZX2A 1O13A 2P9PA 4CZGA 1KD1O 2F7TA 4U67L 3G25A 5AFUH 4BRKA 3JS6A 3IKMA 4WCEL 2YI1A 4BGAA 3PLAA 3FZFA 4FWLA 1BA0A 1NM1A 3LDQA 3L4QA 3ENBA 1NBWA 4NO7A 4MDBA 2ASOA 2HBLA 2V7ZA 4B1ZA 3WQTA 1V4SA 3M3ZA 4QS9A 5F1XA 4MLEA 4ISFA 3W3DA 3C0BA 5BRDA 3R3LA 3O8MA 2OTLN 3HRGA 5M1FA 3UKUA 3O6WA 4PL7A 3ATUA 3SAHA 3KZBA 4XEIA 3O1BA 2NRVA 5JICA 4IOAL 2RE2A 4BQLA 3ZYYX 4IZ9A 2NNWA 2QXLA 4KH6A 4JAXA 2GWKA 2V7YA 1HKGA 2WBNA 3ID6A 5LJWA 2RHKA 4BC3A 3ZX0A 4MO5A 5LY3A 2YHXA 3E1YA 1XC3A 2NRXA 1HJOA 3J8AA 1NJIO 4ILGB 1MDUB 1R59O 2QWMA 4BR7A 2D4WA 4JK9A 4O8UA 2QA4N 4XH4A 1NGIA 2YHYA 3RVCA 3OBYA 4FWMA 5JMVA 3O9QA 1GLJO 1GLAG 3VF6A 1NWKA 3KWIA 4MLHA 3CJAA 1NGFA 4Z94A 1ILYA 3VOVA 3I55N 3CPWM 1VQ6N 3CERA 2KHOA 1TYQB 4A5BA 2FF6A 5C10A 3HM8A 4JD2B 1GLCG 4BG8A 3MDQA 1EO1A 4H0YB 4CZMA 3I56N 2BTFA 1E4FT 3R6MA 4BRQA 5ADXA 3G4SN 3MWPA 4B1VA 2ITMA 4CJ7A 5BPLA 5H1SQ 2VWBA 4WQ4C 2CGLA 4MDAA 3TSUA 3EN9A 4AF1A 3LM9A 2FLOA 5GAHP 4I6MB 3MK6A 3DXMB 1QHAA 3BF1A 3FGUA 3R8EA 1TUUA 4BRLA 3CCJN 3GE1A 3MN7A 3IUCA 2YJFA 1K8AO 1QQNA 1JCGA 1C0FA 3ENHA 3VGKA 5LJVA 3A5LC 4AM7A 3UKRB 2E2OA 1RFQA 4GV3A 1DEJA 1D4XA 1RDUA 3HI0A 5GAEP 1VQMN 4JKEA 3LL3A 3MX5A 5C15A 5M1KA 5AQLA 4A5AA 4DHYA 4YOVA 4IXCA 1BG3A 1U6ZA 3KWGA 3QFPA 3IDHA 5C12A 2PBDA 5EXWA 2CGKA 5CHIA 4B1YB 4PKIA 3GBTA 4FWPA 2Q31A 3DXKB 4L3QA 4BRHA 2P9PB 4B1XB 3A5NC 3TPQA 5EY4A 5JVHL 1VQLN 4BRPA 1SAZA 2GEMA 3MX2A 3T7ZA 4H5WA 3LM2A 3T69A 1MA9B 3HZ6A 4R79A 5MLCQ 2HF3A 1GLLO 2KKZA 3WQUA 1WUAA 1RGIA 2FXUA 3EKSA 2F9WA 2QM1A 5B8HA 5CE3A 4ISEA 3G71N 5M1PA 4ILHA 4JKAA 4K42A 4A2AA 3JXUA 4PHTX 4IOCL 3VTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QDK A;  2CH6 A;  3MMV A;  4WYB A;  3D2F A;  5BR9 A;  2PAV A;  2QWP A;  1T44 A;  3EZW A;  4EAH D;  1OKJ A;  2GEL A;  5TKY A;  1Y64 A;  2YHW A;  2NRH A;  5FPM A;  3VGM A;  1BWF O;  2YJE A;  3ULE A;  2W40 A;  3D2E B;  3U9Z A;  5JLF A;  3GG4 A;  2A3Z A;  1YUW A;  3VGL A;  4FO0 A;  2W41 A;  3WXI A;  4H0X B;  1KAY A;  3HTV A;  1J6Z A;  3MCP A;  3VEO A;  4CD3 A;  1QQO A;  4FWQ A;  3VEN A;  5BRE A;  1ZBS A;  5KPZ A;  5AQU A;  5BN8 A;  3AAP A;  4IJN A;  1S3X A;  5AQN A;  4A62 A;  2Q0R A;  3KHY A;  4HWI A;  2D0O A;  3M6G A;  5BPN A;  4CI6 A;  3QBX A;  4WQ5 C;  1H1V A;  5AQT A;  4JD2 A;  2P9I B;  3ENO A;  5AQQ A;  4BRO A;  5AQS A;  3FLC O;  2E2Q A;  3CHW A;  5AQY A;  3H3O B;  2GTD A;  4FWR A;  3VF2 A;  1ZXO A;  5EX5 A;  5BRF A;  1P8Z A;  1QZ5 A;  5KQ8 A;  3CIP A;  3CJC A;  3LDL A;  5AQP A;  3VER A;  2E20 A;  5AQF A;  2BUP A;  5KQD A;  5KPT A;  5AZJ A;  4FWS A;  4EIA A;  1U2V B;  1S22 A;  3QBW A;  1HUX A;  1ATR A;  2P9K A;  3ZX3 A;  2P9U A;  4BRC A;  5AQK A;  4XH5 A;  3GDQ A;  3FR0 A;  1JCE A;  2FF3 B;  3VEV A;  2Q36 A;  2P9S B;  4M63 C;  2F9T A;  4JN4 A;  1Z6R A;  1BDG A;  1U2V A;  2AP1 A;  2E88 A;  1BU6 O;  3QFU A;  2P9L B;  5ELZ A;  3VPZ A;  4E1J A;  1E4G T;  5JLH A;  3FZM A;  2Q1N A;  4BR5 A;  1GLB G;  1BA1 A;  1XQS C;  5AQZ A;  4YDU C;  4ISG A;  2QWN A;  2HF4 A;  5AQV A;  4PKH A;  1NGH A;  5AQR A;  1K8K A;  3UKR A;  3DXK A;  3ZEU A;  2ZGZ A;  4EHT A;  3MN9 A;  3FZK A;  1QQM A;  2HOE A;  1ATN A;  3CJ1 A;  4BC2 A;  2E2N A;  1CZA N;  3FFK B;  1BO5 O;  3KVG A;  4BRE A;  4LC9 B;  2EWS A;  2I7P A;  1NGD A;  4GY2 B;  3BF3 A;  1X3N A;  4CZH A;  3CJ7 A;  3EKU A;  4QS8 A;  1ATS A;  3BUZ B;  2A40 A;  3CI5 A;  5EOY A;  4BR0 A;  1HKC A;  4XH1 A;  4FPB A;  5BPM A;  2ASP A;  4BVP A;  1GLD G;  1WOQ A;  4BRN A;  4CZJ A;  3MN6 A;  3C7N B;  3IMX A;  4BRI A;  3L0Q A;  1DKG D;  3A8Y A;  4CZK A;  5AQM A;  4JHD A;  5AR0 A;  3A0I X;  3SJH A;  3OHR A;  3FZH A;  1BUP A;  2A6A A;  2H3G X;  1SQK A;  2OAN A;  5FPN A;  3U4L A;  1HLU A;  3EO3 A;  4H5R A;  4DQ8 A;  2P9S A;  4A2B A;  4BQZ A;  1HX1 A;  5E26 A;  1V4T A;  3L4I A;  2E2P A;  1XUP O;  1ESV A;  3AY9 A;  3CET A;  2IVO A;  5E84 A;  3W0L A;  4H0O A;  3FZL A;  1TUY A;  4FL9 A;  4FWN A;  3H46 O;  5AQI A;  4PL8 A;  4GNI A;  5AZI B;  4I6M A;  4BRM A;  4PKG A;  4RCH A;  4RWT A;  3O4W A;  3D7E O;  2Q97 A;  2FSK A;  4QS7 A;  3U9D A;  4O5F A;  5KPR A;  4BRA A;  4Y0W A;  3RSE B;  3TU5 A;  4BC4 A;  3BP8 A;  3P4I A;  3WXJ A;  3WXL A;  4JNE A;  3LDP A;  5F2R A;  2A5X A;  2V52 B;  5AQJ A;  3VET A;  3WT0 A;  2NZT A;  4FOI A;  3H3N O;  5EVZ A;  5FPD A;  1Z05 A;  1NGG A;  3UE5 A;  1IJJ A;  4B1W B;  2QW9 A;  2IVN A;  3H45 C;  2P9N A;  2V51 B;  3ZET B;  4H03 B;  4BG9 A;  1MWK A;  2GWJ A;  2P9L A;  3DAW A;  1BOT O;  3WEE A;  3R9P A;  4BGB A;  4IJA A;  3GOI A;  4B9Q A;  1NGA A;  3VEZ A;  1NGB A;  3I8B A;  2YCH A;  1Q18 A;  3AAQ A;  1MWM A;  3FE1 A;  4K43 A;  2VYP A;  1NMD A;  3M1F A;  3B8A X;  3I33 A;  5AFU A;  2ZF5 O;  3LDN A;  1KXP A;  1X3M A;  2I7N A;  4YDU A;  4DB3 A;  5F0X A;  3CQY A;  2E1Z A;  1TYQ A;  3O80 A;  4NB4 A;  3L6Q A;  3AAR A;  1NLV A;  1EQY A;  1C0G A;  1LOT B;  3ZEU B;  4CZE A;  3ATV A;  2UYT A;  3UKU B;  2DPN A;  2ZGY A;  4M7X A;  3VEY A;  4FPA A;  5BRH A;  4FWO A;  3CJ9 A;  4J8F A;  3SK3 A;  3CQX A;  2FSN A;  1X9J A;  5AQX A;  4DCH A;  4A61 A;  1QZ6 A;  2E8A A;  3WXK A;  3DWL A;  3EL2 A;  2D0P A;  3ULE B;  4BR4 A;  3SLC A;  4CBX A;  4EHU A;  1HPM A;  1NGC A;  2CH5 A;  4K25 A;  3U8X A;  3BEX A;  4H0P A;  2A42 A;  4H5V A;  5AQO A;  5AZI A;  5I9E B;  2QWL A;  4K41 A;  3LDO A;  4RTF D;  1RDW X;  5AQH A;  1JCF A;  3CJB A;  3O08 A;  2AA4 A;  3QB0 A;  3A5M C;  4BRF A;  3H1Q A;  2IIR A;  3VEX A;  4CBU A;  1NGE A;  2FSJ A;  3HBT A;  4BR2 A;  3D2E A;  4CZF A;  2CGJ A;  5ADX H;  4H5N A;  3ZET A;  4JHD B;  3MN5 A;  4O8K A;  2P9K B;  4HTL A;  4WQ4 A;  2D1K A;  3H1V X;  3SMS A;  3WUH A;  5FPE A;  5AQG A;  3VEW A;  1T6C A;  4FOE A;  3O1W A;  2E1Y A;  4CZI A;  3VF4 A;  2P9U B;  2NLX A;  2VCP A;  1G99 A;  1KAZ A;  2WUS A;  3RSE A;  4H0V B;  3QIC A;  4KBO A;  4FWK A;  1K8K B;  1T6D A;  5AZJ B;  3SMP A;  1KAX A;  2GUP A;  4CBW A;  3UB5 A;  2QWR A;  3H6E A;  1NGJ A;  4F9O A;  1IG8 A;  1GLF O;  4BC5 A;  4CZL A;  4FSV A;  4H0T B;  3GL1 A;  2Q0U A;  4BVO A;  4M7Y A;  3F9M A;  3DXM A;  2P9I A;  2ASM A;  2Q2R A;  1SZ2 A;  4BR9 A;  4CD1 A;  4EFH A;  4IO8 A;  3WEE B;  4MO4 A;  3ID8 A;  1GLE G;  1YXQ A;  4H5T A;  2QWO A;  2A41 A;  4IWV A;  1HKB A;  3S41 A;  3QML A;  3IFR A;  1YAG A;  1YVN A;  4WQ5 A;  5BN9 A;  4BRD A;  2IVP A;  2QWQ A;  4AM6 A;  3DJC A;  2HMP A;  2P9N B;  3O5B A;  1LCU A;  1ZC6 A;  2J4R A;  5AQW A;  4BRG A;  3C7N A;  2ZWH A;  3A5O C;  4C23 A;  4B1U B;  3D2F B;  3HSC A;  3VES A;  1DGK N;  3ZX2 A;  2P9P A;  4CZG A;  3G25 A;  5AFU H;  4BRK A;  3JS6 A;  2YI1 A;  4BGA A;  3FZF A;  4FWL A;  1BA0 A;  1NM1 A;  3LDQ A;  1NBW A;  4NO7 A;  2ASO A;  2V7Z A;  4B1Z A;  3WQT A;  1V4S A;  3M3Z A;  4QS9 A;  5F1X A;  4MLE A;  4ISF A;  3W3D A;  3C0B A;  5BRD A;  3O8M A;  3UKU A;  3O6W A;  4PL7 A;  3ATU A;  3KZB A;  4XEI A;  3O1B A;  5JIC A;  4BQL A;  4IZ9 A;  2QXL A;  4JAX A;  2GWK A;  2V7Y A;  1HKG A;  5LJW A;  4BC3 A;  3ZX0 A;  4MO5 A;  5LY3 A;  2YHX A;  1XC3 A;  1HJO A;  3J8A A;  1MDU B;  1R59 O;  2QWM A;  4BR7 A;  2D4W A;  4XH4 A;  1NGI A;  2YHY A;  4FWM A;  5JMV A;  1GLJ O;  1GLA G;  3VF6 A;  1NWK A;  4MLH A;  3CJA A;  1NGF A;  4Z94 A;  3VOV A;  3CER A;  2KHO A;  1TYQ B;  2FF6 A;  3HM8 A;  4JD2 B;  1GLC G;  4BG8 A;  3MDQ A;  4H0Y B;  4CZM A;  2BTF A;  1E4F T;  3R6M A;  4BRQ A;  5ADX A;  4B1V A;  2ITM A;  4CJ7 A;  5BPL A;  2VWB A;  4WQ4 C;  2CGL A;  3EN9 A;  3LM9 A;  2FLO A;  4I6M B;  3MK6 A;  3DXM B;  1QHA A;  3BF1 A;  3FGU A;  3R8E A;  1TUU A;  4BRL A;  3GE1 A;  3MN7 A;  3IUC A;  2YJF A;  1QQN A;  1JCG A;  3ENH A;  1C0F A;  3VGK A;  5LJV A;  3A5L C;  4AM7 A;  3UKR B;  2E2O A;  1RFQ A;  1DEJ A;  1D4X A;  3HI0 A;  3LL3 A;  5AQL A;  4DHY A;  4IXC A;  1BG3 A;  1U6Z A;  3QFP A;  3IDH A;  2PBD A;  5EXW A;  2CGK A;  4B1Y B;  4PKI A;  3GBT A;  4FWP A;  2Q31 A;  3DXK B;  4L3Q A;  4BRH A;  2P9P B;  4B1X B;  3A5N C;  3TPQ A;  5EY4 A;  4BRP A;  1SAZ A;  2GEM A;  4H5W A;  3LM2 A;  1MA9 B;  3HZ6 A;  2HF3 A;  1GLL O;  3WQU A;  1WUA A;  1RGI A;  2FXU A;  3EKS A;  2F9W A;  2QM1 A;  5B8H A;  5CE3 A;  4ISE A;  4K42 A;  4A2A A;  3JXU A; 
#chains in the Genus database with same CATH topology
 4HTU A;  3QDK A;  2CH6 A;  3MMV A;  4WYB A;  1QE1 A;  2QWP A;  1OKJ A;  2GEL A;  5TKY A;  1Y64 A;  3OA9 A;  4E7K A;  3KLG A;  3PX4 A;  4CF9 A;  3J7A P;  3VGM A;  2PYJ A;  3MAQ A;  1BL3 A;  3ULE A;  3LP2 A;  5LMU K;  2W40 A;  1WSG A;  1NKC A;  3WXI A;  3DLL L;  1D9D A;  1NK0 A;  3SI6 A;  4BE2 A;  3QER A;  4E19 A;  4CEQ A;  2XO7 A;  1QQO A;  4FWQ A;  3VEN A;  1IBL K;  3HXM A;  1ZBS A;  4ZTJ A;  4IJN A;  5AQN A;  2D5R A;  4GW6 A;  1VSE A;  2WOM A;  5FDL A;  4CEZ A;  4WQ5 C;  2NRR A;  1D5A A;  4OPA A;  4F2R A;  2HB5 A;  4FJ7 A;  3TAM A;  1QZ5 A;  3NH1 A;  3CIP A;  2XHB A;  4O55 A;  1XMO K;  3VER A;  2E20 A;  2BUP A;  5T7B A;  1BIS A;  3QEX A;  2UUB K;  4B08 A;  3QBW A;  1IKV A;  1HUX A;  4DF8 A;  3O9T A;  3ZX3 A;  1S1T A;  1JL1 A;  3VQD A;  5J2P A;  4YOT A;  2UUC K;  4HHT A;  2P9S B;  5GIP A;  3E9P A;  4CIE A;  3SNN A;  3E66 A;  2AP1 A;  4DV2 K;  2PY5 A;  4JKG B;  4E1J A;  1E4G T;  1BCO A;  4IOX A;  2QWN A;  1BGX T;  1LAV A;  4KH4 A;  3VQ8 A;  3HL8 A;  1NGH A;  3RTV A;  3UKR A;  2DY4 A;  1EET A;  3DM2 A;  1QQM A;  2BE2 A;  5C25 A;  3V9Z A;  4BC2 A;  1JLQ A;  1VSI A;  5SZT A;  3KLE A;  4ELT A;  3BF3 A;  3HYF A;  5HRN A;  3SQ1 A;  3ISN C;  2OPP A;  1L3V A;  1KCF A;  3VQP A;  3OYJ A;  4LFC K;  2GV9 A;  2D0A A;  2I5J A;  3IAY A;  4DTU A;  3HOS A;  3L0Q A;  1DKG D;  3A8Y A;  4N41 A;  3FZH A;  3MED A;  2OAN A;  5JS1 A;  4DQ8 A;  4DV3 K;  4DS5 A;  3EO3 A;  4H5R A;  4QCL A;  3V9U A;  4A2B A;  3I0S A;  2Z1J A;  1HX1 A;  1U47 A;  4KHY A;  1V4T A;  1ESV A;  3OW2 M;  3AY9 A;  3CET A;  4LF7 K;  1M1K O;  1FW6 A;  3WNG A;  1NJX A;  1D9F A;  1TL1 A;  4FL9 A;  2HW3 A;  1C1A A;  4FWN A;  5AQI A;  4AHR A;  5AZI B;  3N4Q A;  3LZJ A;  4BRM A;  1HQE A;  1YJ9 N;  4RCH A;  3EYZ A;  3NFA A;  2Q97 A;  3VQQ A;  4DU4 A;  2VWK A;  3ZSZ A;  3TU5 A;  3AVI A;  4LD0 A;  3BP8 A;  1NK8 A;  3P4I A;  1C6V A;  3WXJ A;  2X74 A;  1ITG A;  2A5X A;  3QIO A;  2V52 B;  3VET A;  4MFB A;  4GV9 A;  4J2E A;  3H3N O;  4CGG A;  2XY7 A;  2KFZ A;  5C42 A;  3T3F A;  2QW9 A;  3VQ9 A;  3H45 C;  4LSN A;  2KW4 A;  3V6D A;  1MWK A;  2P9L A;  4AQY K;  4OPH A;  5FRN A;  2UXD K;  4N76 A;  4TSX A;  1MWM A;  3FE1 A;  2VYP A;  4PWD A;  1B9F A;  4CED A;  2YNH A;  2B5J A;  2ZF5 O;  1KXP A;  1WBB A;  3AGK A;  3CQY A;  4ID5 A;  3O9U A;  2HHS A;  3L6Q A;  4B9V A;  5KTQ A;  1JXB A;  3TSQ A;  3V9X A;  3SUQ A;  3UKU B;  3NVK A;  1RTH A;  2IAJ A;  4F3T A;  2OCE A;  2VGM A;  4DV5 K;  4FPA A;  4FWO A;  1J5E K;  1VQN N;  3SK3 A;  4CEA A;  2FSN A;  1X9J A;  3NAE A;  1KRP A;  4HUE A;  4CK2 A;  5DM6 L;  3HVT A;  1W97 L;  2E8A A;  1JJ2 M;  3L2V A;  3EL2 A;  1IO2 A;  3D6R A;  1U04 A;  4EHU A;  3KD1 E;  1RCH A;  3TTF A;  4KTQ A;  5AQO A;  3IS9 A;  3HOT A;  4K41 A;  3LDO A;  3HP6 A;  3SAF A;  4JRQ A;  5HL7 L;  3NGZ A;  3K0S A;  3BGR A;  3TAP A;  1C0T A;  4K0K K;  2OTJ N;  1S1W A;  2E6M A;  4M42 A;  4FJL A;  2BH1 A;  2IIR A;  3TSP A;  1HNW K;  4BR2 A;  4CZF A;  5IWA K;  3R1X A;  3VQ6 A;  1N8R O;  5GIN A;  1NK5 A;  3RWU A;  3SMS A;  3H1V X;  3E9L A;  5AQG A;  4ZTF A;  3VEW A;  2KZZ A;  5HP1 A;  3KK2 A;  3LZI A;  4B9N A;  3VMF B;  4DSL A;  2E1Y A;  5A2Q O;  5JVG L;  2A1S A;  1LW0 A;  2VCP A;  1VHX A;  3QIC A;  4H8K A;  3SMP A;  2GUP A;  1DTQ A;  1YJW N;  1RT4 A;  1WSJ A;  3H6E A;  1YI2 N;  3SUO A;  3NF7 A;  3AO2 A;  4FSV A;  4CZL A;  4H0T B;  1SKS A;  2QKB A;  3GL1 A;  1NJY A;  1JKH A;  1SV5 A;  1VSJ A;  1LAW A;  3F9M A;  2P9I A;  2ASM A;  2Q2R A;  1SZ2 A;  4BR9 A;  4LF8 K;  1MU2 A;  3K2P A;  4N5S A;  1TAQ A;  1RDB A;  1YXQ A;  4IEE A;  3PX6 A;  1HKB A;  3S41 A;  1Q82 O;  3IFR A;  1XI1 A;  4WQ5 A;  4O0J A;  3C65 A;  4JLH A;  2QWQ A;  4LY7 A;  4N47 A;  4CHY A;  4AM6 A;  2HMP A;  1J54 A;  3SV3 A;  2WC9 A;  5AQW A;  3EY1 A;  4JI6 K;  3LP1 A;  2ZJP L;  1ZBI A;  1EKE A;  4CZG A;  2IDO A;  3S3O A;  4BRK A;  2O4I A;  4WCE L;  2OPQ A;  2YI1 A;  4E1N A;  4DV1 K;  3P83 D;  1NM1 A;  3LDQ A;  1VSD A;  3L4Q A;  2RKI A;  4E7I A;  3TAG A;  4NO7 A;  4MDB A;  1NOY A;  5F1X A;  1A5X A;  2W42 A;  1CLQ A;  3R3L A;  3TAF A;  3ZT3 A;  5M1F A;  3UKU A;  2F8T A;  1N32 K;  3VQB A;  3KZB A;  2NRV A;  1C0U A;  4J2D A;  3ZYY X;  3S3M A;  4IZ9 A;  3K5N A;  4CJ3 A;  5LJW A;  1FJG K;  2RHK A;  4JYA K;  3CM5 A;  1HJO A;  1BCM A;  4J2A A;  1N33 K;  1MDU B;  3RRH A;  2QWM A;  4BR7 A;  4CEE A;  4FYD A;  3THY A;  1NGI A;  4FCY A;  2YHY A;  1IBK K;  4CJR A;  1GLJ O;  3PSF A;  1QSL A;  3PY8 A;  4MLH A;  3PSI A;  4OGE A;  1HNV A;  3CPW M;  3CER A;  4YNQ A;  2KHO A;  1Z25 A;  1TYQ B;  1NKE A;  4DTJ A;  4DTS A;  1F21 A;  2Y1I A;  1E4F T;  5CYM A;  5ADX A;  3HM9 A;  4L8R B;  3G0Z A;  4B1V A;  2ITM A;  5BPL A;  3KKS A;  4I6M B;  1VSF A;  3SCX A;  3FGU A;  3VQ7 A;  4BRL A;  2G8F A;  3IUC A;  1JCG A;  3ENH A;  3V1O A;  4DFK A;  5LJV A;  2E2O A;  1RFQ A;  3ZLJ A;  1DEJ A;  1QS4 A;  1RDU A;  3FFI A;  3HI0 A;  3SPY A;  1VQM N;  3LL3 A;  1OH8 A;  5C15 A;  4A5A A;  4CEB A;  4IXC A;  1NKB A;  2OZM A;  1RNH A;  3IDH A;  2PBD A;  2CGK A;  4B1Y B;  4DG1 A;  3RR8 A;  4CJQ A;  2B4J A;  5EY4 A;  4FW2 A;  1KFS A;  2JGU A;  4OVL A;  2ETJ A;  3AVB A;  4CHP A;  2FXU A;  1W9H A;  1VRU A;  1ZBH A;  2QM1 A;  4BAC A;  4B3T K;  1JLA A;  3RR7 A;  4CJT A;  4ZHR A;  3V4I A;  2G8I A;  4PA1 A;  4IOC L;  4KB0 A;  1CZ9 A;  3DLE A;  4JKF A;  5BR9 A;  2KLA A;  2PAV A;  3EZW A;  4BDY A;  4JK7 A;  1FK9 A;  4IFE A;  1X9M A;  4V19 S;  4DQQ A;  1Q7Y O;  3ZSW A;  4DR3 K;  5JLF A;  2A3Z A;  3G10 A;  1YUW A;  3VGL A;  4IKF A;  2W41 A;  4H0X B;  4I2Q A;  1J6Z A;  3OYE A;  3WNE A;  3OYF A;  3VEO A;  2R7Y A;  1NJZ A;  1LWF A;  4KHN A;  3DI6 A;  3OS2 A;  5AQU A;  3AAP A;  4CCH A;  3CCU N;  3NVM A;  3L3V A;  4A62 A;  2Q0R A;  1QVF M;  3M6G A;  4CI6 A;  4OLB A;  3NMU A;  1H1V A;  3K5L A;  3OYM A;  4FXD A;  3FLC O;  3VA0 A;  2GTD A;  3VF2 A;  3E9O A;  1ZXO A;  2QI2 A;  4FJX A;  2UXB K;  5KQ8 A;  2E5L K;  2HHQ A;  3LWL A;  1GOA A;  4NYN A;  1GOC A;  5AZJ A;  4FWS A;  5HRO A;  4JS5 A;  1VQ7 N;  3LPU A;  5AJ3 K;  1ATR A;  4PUO A;  3ULD A;  4CJE A;  1JCE A;  3FR0 A;  2G8U A;  3TAQ A;  4FK2 A;  2FF3 B;  2F9T A;  4FJG A;  2O8F A;  4K8X A;  4WE1 A;  4IDH A;  3AVM A;  4CEF A;  1BDG A;  4ID1 A;  2E88 A;  4FLV A;  4AIL C;  5ELZ A;  3VPZ A;  2A1R A;  5C2D A;  4PY5 A;  3FZM A;  4AHT A;  3OBW A;  3CCS N;  3O3H A;  2AJQ A;  1N6Q A;  2HBK A;  2WFB A;  3M8S A;  3EEQ A;  1YF5 L;  5DK5 A;  5AQR A;  1K8K A;  3DXK A;  4GKJ K;  4IFY A;  4HVJ A;  3MN9 A;  3AO3 A;  2HNY A;  1NJW A;  3DLR A;  3CJ1 A;  1OVY A;  2E2N A;  5DM7 L;  3J81 O;  4LC9 B;  3PIO L;  4DSK A;  3S3N A;  1HYS A;  1NGD A;  4GY2 B;  3SYZ A;  1FXX A;  1X3N A;  3CJ7 A;  3EKU A;  1ATS A;  3U6F A;  1YT3 A;  1KVB A;  4Z0U A;  2IOC A;  4XH1 A;  5J2M A;  1S5J A;  1GLD G;  5C24 A;  1U48 A;  3IMX A;  1D8Y A;  3AVA A;  4CZK A;  4JHD A;  1K6Y A;  3SJH A;  4DLE A;  1SQK A;  1HPZ A;  2O8E A;  4PQU A;  3TTC A;  4YOY A;  2IVO A;  3JSM A;  1WN7 A;  1VQ9 N;  3H46 O;  4I6M A;  1WSF A;  4OO1 J;  1QSS A;  2HHH K;  4H4O A;  3D7E O;  4JS4 A;  5J2N A;  4CFB A;  2FSK A;  4QS7 A;  3U9D A;  4DTP A;  4J2B A;  4Y0W A;  3RSE B;  2BAN A;  4OX9 K;  3O3F A;  1XMQ K;  3VTI A;  1KSP A;  4JNE A;  3CC2 N;  5F2R A;  5AQJ A;  1B92 A;  3MWT A;  4B1W B;  4BY9 C;  2IVN A;  2OYQ A;  2P9N A;  3TTD A;  3VQC A;  1TK8 A;  1TVR A;  4ICL A;  4JKG A;  2GWJ A;  3LP3 A;  3NHG A;  3WEE A;  5TKW A;  4CF2 A;  5I3U A;  4BGB A;  3GOI A;  2O8D B;  3T1Y K;  3CM6 A;  1NGA A;  4CJS A;  4CFC A;  3SUN A;  2YCH A;  1Q18 A;  2HBM A;  4M3U A;  2XRI A;  3KLI A;  1NMD A;  4I9L A;  4UQG A;  4DR1 K;  1IBM K;  3M1F A;  1TKD A;  3DLH A;  4FZY A;  4JI1 K;  5AFU A;  5K14 A;  1KTQ A;  3L3U A;  3K59 A;  3CPE A;  4CF8 A;  3KKR A;  1X3M A;  4DB3 A;  1SKR A;  3CD6 N;  3K9J A;  2E1Z A;  3ZT1 A;  4YOU A;  1TYQ A;  3ZSR A;  2UYT A;  1U45 A;  3PO4 A;  1RTJ A;  1W7A A;  4DR7 K;  4W5Q A;  1L3U A;  5M1O A;  3CC7 N;  1Z26 A;  2P1J A;  4AHV A;  4Q5V A;  2DTU A;  1J9A A;  3WXK A;  3DWL A;  4CJU A;  4EP4 A;  3KLH A;  1TK5 A;  3KK7 A;  1HPM A;  2CH5 A;  1RBR A;  4K25 A;  4QOZ B;  3U8X A;  3OS1 A;  1VAZ A;  5J2Q A;  3BEX A;  4YFU A;  4E89 A;  1FKO A;  4H5V A;  1C1C A;  5I9E B;  1A5W A;  2QWL A;  1RDW X;  1HMV A;  5AQH A;  4BE1 A;  4F8R A;  3ALY A;  3THW B;  3CCQ N;  2KQ2 A;  3CJB A;  4RW4 A;  3QO9 A;  4JI8 K;  1C0M A;  4YHH K;  4BRF A;  4EZ6 A;  4FJ8 A;  4FJM A;  3VEX A;  4CBU A;  2OA8 A;  3V9W A;  3WXM B;  3D2E A;  2YNI A;  4CGJ A;  3OYB A;  1WSI A;  3MN5 A;  3CCL N;  3K9K A;  2P9K B;  2W6K A;  2YX6 A;  4KHQ A;  4LSL A;  4B9M A;  4GV6 A;  2YV0 X;  1T6C A;  2RPI A;  4FOE A;  1NK6 A;  2P5G A;  3O1W A;  2PFU A;  4B3O A;  4IG0 A;  4E7J A;  1G99 A;  2WUS A;  1IKW A;  4KBO A;  1K8K B;  4NXN K;  3U3Y A;  4CBW A;  2JLE A;  2XY5 A;  1RT2 A;  1NGJ A;  3ZSQ A;  4JI0 K;  1IG8 A;  1NOZ A;  1GLF O;  4CHQ A;  2ZM6 K;  2F96 A;  4LF9 K;  4K8Z A;  3CC4 N;  4CGD A;  1Q9X A;  3G6E N;  5HRP A;  2VG5 A;  4EFH A;  4DF4 A;  4FLW A;  3KIO A;  4CVN E;  3CYM A;  3OYG A;  2WTU A;  3CG7 A;  2QWO A;  2IS3 A;  1N5Y A;  1KFD A;  2Y1J A;  1JLF A;  1S9G A;  1YAG A;  1IH7 A;  4OPK A;  4DSE A;  1UWB A;  3B6O A;  1WAJ A;  1QTM A;  1X1P A;  1EXQ A;  1VQ5 N;  2IGI A;  4AHS A;  1YJN N;  1WSH A;  1DGK N;  3ZX2 A;  3JYT A;  3TAE A;  2F7T A;  4U67 L;  3G25 A;  3IKM A;  4FK4 A;  4BGA A;  2EX3 A;  3ZSY A;  4FWL A;  1BA0 A;  3ENB A;  3SV4 A;  2ASO A;  2HBL A;  2O8E B;  3M3Z A;  4QS9 A;  4MLE A;  4ISF A;  4W5R A;  3W3D A;  3O8M A;  1RBT A;  3ATU A;  4C8N A;  4XEI A;  4IOA L;  3HO1 A;  2BGG A;  2RE2 A;  4CJF A;  4FJH A;  4CJ5 A;  4JV5 K;  1SL1 A;  2NNW A;  4F4K A;  1JL2 A;  4JAX A;  3V81 A;  4FJ9 A;  1HKG A;  2Z1I A;  3MXJ A;  1T03 A;  3ZX0 A;  5LY3 A;  3QIN A;  2PYL A;  4OKK A;  1NJI O;  3O4Q A;  4ILG B;  4JI4 K;  5J1E A;  1WAF A;  4XH4 A;  5CY4 A;  2HMI A;  1RT1 A;  3OBY A;  5JMV A;  2PZS A;  3VF6 A;  1YTA A;  1I3A A;  3ZCM A;  1ILY A;  3I55 N;  3AVC A;  1VQ6 N;  4Y1D A;  5C10 A;  3LAN A;  4DV4 K;  3R6M A;  4BRQ A;  3MWP A;  3HVR A;  5H1S Q;  2VWB A;  4WQ4 C;  4AF1 A;  4MDA A;  1WSE A;  3LM9 A;  3DXM B;  4KKO A;  1TUU A;  3CCJ N;  2P51 A;  3VGK A;  4AM7 A;  3PV8 A;  4GV3 A;  3L2Q A;  3WNH A;  1NNE A;  1ZBU A;  1BQN A;  3MX5 A;  5AQL A;  3OJU A;  4DHY A;  4E0D A;  1W0H A;  3KWG A;  5C12 A;  2DFH A;  1UA0 A;  4FWP A;  3PO5 A;  4BRH A;  4LH5 A;  1BQM A;  1WLJ A;  2RN2 A;  5JVH L;  3QNO A;  4AHC A;  3BDP A;  3T69 A;  3VN5 A;  4CFA A;  3TI0 A;  2KKZ A;  3WQU A;  1RGI A;  2F9W A;  5CE3 A;  4ISE A;  5M1P A;  2RF2 A;  3NE6 A;  1YVU A;  4K42 A;  4A2A A;  3C6U A;  3JXU A;  4PHT X;  5LL6 Z;  5C0Y A;  3D2F A;  3CCV N;  4ELV A;  3ZSV A;  4DUY K;  2YHW A;  2VQF K;  4FW1 A;  3EE8 A;  3SZ2 A;  3ZT4 A;  1BWF O;  2YJE A;  5CYQ A;  3J7Z O;  3D2E B;  3U9Z A;  2DFE A;  1HQU A;  1S1U A;  1U49 A;  3MCA B;  4M3R A;  3AA2 A;  3QNN A;  1XHX A;  3HTV A;  4KTW A;  3QEV A;  4NCB A;  4CK1 A;  1K9M O;  3MCP A;  4C1N I;  4CD3 A;  1K73 O;  2FC0 A;  1T05 A;  3DLK A;  4DU3 A;  5BN8 A;  1BI4 B;  1S3X A;  1L5U A;  1DLO A;  4BWJ A;  4HWI A;  1RDA A;  4A59 A;  5BPN A;  4ILJ A;  5AQT A;  2P9I B;  3ENO A;  4BRO A;  5AQS A;  1VQ4 N;  2JWL A;  2E2Q A;  1GOB A;  4Z4C A;  3H3O B;  4FWR A;  2UUA K;  5EX5 A;  1VRT A;  3SBG A;  5BRF A;  4M3T A;  1P8Z A;  3E01 A;  4IO9 L;  2GX9 A;  3LDL A;  2VG7 A;  3O9R A;  5KQD A;  5AQF A;  5HBM A;  2F4V K;  2Z1H A;  3KD5 E;  1U2V B;  4KFB A;  1CXQ A;  4FJ5 A;  4DQR A;  4IBN A;  3AV9 A;  1N36 K;  4KHW A;  2F8S A;  3VEV A;  4JN4 A;  1U2V A;  3B6P A;  3QFU A;  1BU6 O;  2HND A;  3ZT0 A;  4KAZ A;  5IT9 O;  4NXM K;  3ASM A;  2Q1N A;  4BR5 A;  1Q81 O;  4O4G A;  1GLB G;  4DR2 K;  4DTR A;  3QEP A;  5AQZ A;  3PIP L;  1KC8 O;  2HF4 A;  3PUF A;  4PKH A;  3CCM N;  2HBJ A;  1ZBL A;  4N56 A;  2ZGZ A;  4DTO A;  1RTI A;  2HOE A;  1HJR A;  3D45 A;  3FFK B;  1BO5 O;  3LAK A;  3C94 A;  4BRE A;  1W2B M;  4DQS A;  1L3S A;  2EWS A;  4CJL A;  4AHU A;  4CZH A;  3KTQ A;  1EWQ A;  4QS8 A;  3BUZ B;  2A40 A;  3Q7B A;  4DWI A;  2KTQ A;  3AVF A;  5EOY A;  3J80 O;  1XNR K;  4F2S A;  1HKC A;  3NF8 A;  4FM0 A;  1KLN A;  1LW2 A;  2ASP A;  2BDP A;  4GKK K;  2QK9 A;  3THX B;  3NF9 A;  1WOQ A;  3C6A A;  5CZ1 A;  4KV8 A;  4BRN A;  3MN6 A;  1BHL A;  5AQM A;  5AR0 A;  3A0I X;  2H3G X;  1IG9 A;  3DLB A;  4BE0 A;  1YHQ N;  5C2F A;  2P9S A;  1DT9 A;  3ITH A;  1XUP O;  1JLG A;  2KFN A;  3P38 A;  1ASW A;  3W0L A;  5GAD P;  4RW7 A;  1EX4 A;  3OYK A;  4PL8 A;  4GNI A;  4PKG A;  4JKH A;  3T19 A;  4CJ4 A;  4YOR A;  4RWT A;  4JKC A;  4KHS A;  4CJW A;  1WBD A;  4O5F A;  2ZJQ L;  4BRA A;  4BC4 A;  1RBV A;  3QLH A;  3DRS A;  3KK1 A;  1TKX A;  3WXL A;  3LDP A;  1J53 A;  3HPH A;  3WT0 A;  5EVZ A;  4XIU A;  2FBV A;  5FPD A;  1IJJ A;  3M8Q A;  4CE9 A;  3AVK A;  2V51 B;  2HST A;  3ZET B;  4H03 B;  4BG9 A;  4CIG A;  3DAW A;  3L2U A;  1BOT O;  3OYH A;  4I2P A;  4CJP A;  3QEW A;  1TGO A;  1SL0 A;  4C8L A;  4LH4 A;  5E41 A;  4LFB K;  3I8B A;  4OGC A;  2W6L A;  4K43 A;  3HJF A;  3LAM A;  3NH2 A;  4FZZ A;  3AVG A;  3Q7C A;  3I0R A;  2O4G A;  3LPT A;  4OJR A;  4WFB L;  3AGR A;  2I7N A;  4YDU A;  4JKB A;  3RMD A;  4FM2 A;  3O80 A;  3LDS A;  1EQY A;  1C0G A;  4CZE A;  3ATV A;  3SUP A;  1HYZ A;  3C95 A;  3WNF A;  3K5M A;  3VEY A;  2ZE2 A;  3CJ9 A;  4J8F A;  2HVI A;  1BI4 A;  3CQX A;  1QZ6 A;  3P31 A;  3HK2 A;  4CIF A;  4DTM A;  2D0P A;  2VG6 A;  4Z4I A;  4JI2 K;  4HCB A;  4WFN L;  3BZC A;  1IKY A;  1J5O A;  3AA5 X;  3HPO A;  3LAL A;  2QEX N;  1QQC A;  2NRW A;  3IG1 A;  1JCF A;  4RW9 A;  1NMN A;  1TKZ A;  3QB0 A;  3A5M C;  1LWC A;  3CCE N;  3AA4 A;  3H1Q A;  4CF0 A;  1JLB A;  1NGE A;  3HBT A;  2B6A A;  2CGJ A;  4FJN A;  4H5N A;  1SL2 A;  3J7Y P;  1WB9 A;  2XY8 A;  4WQ4 A;  1I39 A;  2D1K A;  4KH5 A;  3WUH A;  4EZ9 A;  5FPE A;  1X9W A;  1U4B A;  3JAM O;  3VF4 A;  2NLX A;  3V1R A;  1KAZ A;  1ASV A;  4DKW A;  1JLC A;  1T6D A;  5AZJ B;  3TAN A;  2QWR A;  4F9O A;  5HOO A;  1T3V A;  3F5T A;  4BC5 A;  2VGN A;  1TK0 A;  4M3Y A;  3MXM A;  4IDK A;  3DXM A;  4A57 A;  1VSK A;  4MO4 A;  3ID8 A;  3P1G A;  1G15 A;  4CJK A;  1ZYQ A;  5M1N A;  3V1Q A;  4IWV A;  1OH7 A;  3I8D A;  5HLF A;  4DU1 A;  5BN9 A;  4BRD A;  2IVP A;  4CHN A;  1VQO N;  5FRO A;  1LCU A;  3OS0 A;  1C1B A;  1R0A A;  4FVU A;  4O44 A;  3A5O C;  4C23 A;  3VQ5 A;  3RMC A;  3HSC A;  3VES A;  3C6T A;  3K57 A;  3M8R A;  3JS6 A;  4NCG A;  3MXI A;  2Z1G A;  3OY9 A;  1N34 K;  1NBW A;  5KGW A;  4RG8 A;  2V7Z A;  4B1Z A;  4CES A;  3WQT A;  1V4S A;  4O0I A;  1XHZ A;  1RTD A;  3D0P A;  3QES A;  4W5T A;  4DLG A;  5BRD A;  3OYC A;  2QXF A;  3EZ5 A;  3O6W A;  4PL7 A;  4FLU A;  4B9T A;  4BQL A;  3SPZ A;  1RT5 A;  1IKX A;  2QXL A;  5I42 A;  1EP4 A;  4KH6 A;  4JI7 K;  4CF1 A;  3ID6 A;  4I9Q A;  4MO5 A;  2YHX A;  2NRX A;  4M3Z A;  3J8A A;  1R59 O;  4JK9 A;  1YTU A;  1VSH A;  2YHB A;  4Z4G A;  4FWM A;  3O9Q A;  2HHX A;  3NH0 A;  2VQE K;  1NWK A;  3CJA A;  4Z94 A;  4E1M A;  4KHU A;  3VOV A;  4JI5 K;  4JI3 K;  5KRS A;  4FLT A;  1GLC G;  2ZD1 A;  3MDQ A;  3CFP A;  4H0Y B;  4CZM A;  3I56 N;  4YY3 K;  3OJS A;  2LSN A;  3VQE A;  5GAH P;  3MK6 A;  3AA3 A;  1S1X A;  3ZSX A;  1SKW A;  3SQ2 A;  1QQN A;  1RT7 A;  1C0F A;  3A5L C;  4B9S A;  2UU9 K;  4QAG A;  2YNG A;  3NGY A;  4JKE A;  4EP5 A;  4FLZ A;  1UA1 A;  5M1K A;  4FK0 A;  3O4N A;  3M8P A;  1BG3 A;  1U6Z A;  5EXW A;  5LMN K;  1BIZ A;  1RIL A;  2OZS A;  4O5B A;  2P9P B;  3AO5 A;  3A5N C;  3TPQ A;  4DR4 K;  3LP0 A;  4BRP A;  1SAZ A;  2GEM A;  5HRR A;  5KRT A;  3LM2 A;  1MA9 B;  3HZ6 A;  4KO0 A;  3NGI A;  1GLL O;  1RBU A;  4CEO A;  5B8H A;  4LF6 K;  4JKA A;  4AH9 A;  3QEI A;  3AO1 A;  4X64 K;  2YKN A;  3VTH A;  1WNS A;  2E6L A;  1T44 A;  4EAH D;  3RRG A;  5EU7 A;  5M1Q A;  4BWM A;  4B3M K;  4M3W A;  2Q3S A;  5HRS A;  3CMA N;  2NRH A;  1E3M A;  5FPM A;  3DRP A;  4X66 K;  4CGF A;  1B9D A;  1RBS A;  1Q8I A;  2ITG A;  3QET A;  3GG4 A;  4FO0 A;  4E7L A;  4CHZ A;  1SUQ A;  1KAY A;  4DSF A;  4H4M A;  1Y97 A;  4Z4E A;  2HVH A;  3ZSO A;  4X62 K;  4FVM A;  5BRE A;  3CF5 L;  5KPZ A;  1Q86 O;  5GIO A;  4KB1 A;  2HHT A;  1S72 N;  3KHY A;  2D0O A;  3LWM A;  4I7F A;  3QBX A;  1IV0 A;  4FZX C;  4JD2 A;  5AQQ A;  3THW A;  3CHW A;  4KPY A;  5AQY A;  2YNF A;  3HT3 A;  4HUG A;  3ZT2 A;  1UAX A;  2QTD A;  2X6S A;  3CJC A;  5AQP A;  4YOW A;  3THV A;  3K5O A;  5KPT A;  4HUF A;  4EIA A;  1T8E A;  1S22 A;  3SQ0 A;  4JKD A;  2P9K A;  2P9U A;  1ZBF A;  4BRC A;  5AQK A;  2O8B A;  1XNQ K;  3CFO A;  1LV5 A;  3CQ8 A;  4XH5 A;  3GDQ A;  3F73 A;  2Q36 A;  4M63 C;  3DLG A;  1VQP N;  1Z6R A;  3QIP A;  4WF9 L;  4FLX A;  2P9L B;  1RDD A;  4NLB A;  2OPR A;  5JLH A;  4B3R K;  5BR8 K;  4OKE A;  1YIJ N;  1BA1 A;  1XQS C;  4YDU C;  5SWM A;  4ISG A;  4FLY A;  5AQV A;  1OH6 A;  1S6Q A;  4ELU A;  4DV7 K;  3ZEU A;  4EHT A;  3SAG A;  1QVG M;  3O9S A;  1XC9 A;  1UOC A;  3FZK A;  1ATN A;  3A2F A;  2FBY A;  1Q9Y A;  4DSI A;  1CZA N;  3KVG A;  2I7P A;  2YHA A;  4DMN A;  3NBP A;  4NLC A;  4KRF A;  4G1Q A;  1VK0 A;  4FJI A;  2D0B A;  3CI5 A;  3P39 A;  5D3G A;  3V9S A;  4BR0 A;  3M5R A;  4FPB A;  4NYF A;  5BPM A;  1CXU A;  4KTZ A;  2O8D A;  4BVP A;  1VSM A;  4DR5 K;  4CZJ A;  1YIT N;  3C7N B;  3O3G A;  1EWR A;  4BRI A;  4G9Z A;  4YOX A;  3KLF A;  3OHR A;  1BUP A;  2A6A A;  3BZK A;  3U4L A;  5FPN A;  1HLU A;  1HNI A;  4C8O A;  4BQZ A;  2KZM A;  5E26 A;  3MEG A;  3L4I A;  2E2P A;  4JEP A;  4KI4 A;  5E84 A;  3L2R A;  4H0O A;  3FZL A;  4R5P A;  1TUY A;  1HNZ K;  3CME N;  4LF5 K;  2GBZ A;  2O8C A;  3EE9 A;  2ZQB A;  1RDC A;  5KGX A;  3CCR N;  3HP9 A;  1P90 A;  3O4W A;  3TR8 A;  3OVN A;  3MEE A;  5KPR A;  4KI6 A;  4W5N A;  4E3S A;  1S1V A;  3F2K A;  4WFA L;  1VSL A;  3SQ4 A;  2QKK A;  4FM1 A;  1XWL A;  4BDZ A;  2NZT A;  4FOI A;  1Z05 A;  1NGG A;  3UE5 A;  1REV A;  3NF6 A;  1HNX K;  2GUI A;  4KHP K;  1M90 O;  3AVJ A;  3BY5 A;  3P5J A;  3R9P A;  3CXC M;  3L8B A;  4IJA A;  4B9Q A;  5GAG P;  4UY8 O;  3AO4 A;  3VEZ A;  4CGH A;  3H08 A;  2JWK A;  2UXC K;  1NGB A;  3AAQ A;  4CW7 B;  4CHO A;  5CZ2 A;  3OTO K;  4OKJ A;  5JS2 A;  3B8A X;  3I33 A;  3LDN A;  5CR4 A;  4U7B A;  5F0X A;  3DMJ A;  5FRM A;  4M45 A;  4JK8 A;  1NG9 A;  1VQK N;  2NRT A;  1T7P A;  4CEC A;  3SBT A;  4NB4 A;  2NUB A;  1NLV A;  3AAR A;  1LOT B;  3ZEU B;  2DPN A;  2ZGY A;  4M7X A;  2HHU A;  5BRH A;  3RMA A;  4B9U A;  2YKM A;  5AQX A;  4DFP A;  4DCH A;  4A61 A;  1KQS M;  4Z4H A;  3ULE B;  3T1A A;  4BR4 A;  3SLC A;  3PX0 A;  4CBX A;  1FKP A;  1NGC A;  3L2W A;  4MQ3 A;  4OPJ A;  4CK3 A;  2D0C A;  4BDP A;  4H0P A;  1I94 K;  2A42 A;  2XY6 A;  5AZI A;  4RW6 A;  3K58 A;  4RTF D;  4IEI A;  3VA3 A;  4W5O A;  3O08 A;  2AA4 A;  4B3S K;  4OLA A;  4DUZ K;  3AVL A;  2O8B B;  2NRZ A;  3OYD A;  2FSJ A;  3DRR A;  1ASU A;  1X9S A;  5ADX H;  1QHT A;  4X65 K;  3ZET A;  1L3T A;  4JHD B;  4O8K A;  4HTL A;  4GMJ B;  3OYI A;  1S9E A;  4CGI A;  4GVE A;  1SS6 A;  3SJJ A;  3AVH A;  1JXE A;  3MEC A;  4M41 A;  3IRX A;  4DQI A;  4CZI A;  2P9U B;  4C1N K;  5DMR A;  3RSE A;  3HST B;  1HYV A;  4H0V B;  3VQ4 A;  1TAU A;  4FWK A;  4C8K A;  1HRH A;  1KAX A;  3UB5 A;  4E7H A;  1RT6 A;  3C6H A;  1QSY A;  1NU0 A;  2ZJR L;  4FJK A;  2Q0U A;  4DV6 K;  4BVO A;  1O1W A;  3S9H A;  4M7Y A;  4B8C A;  4CD1 A;  4IO8 A;  3U3G A;  4HCC A;  3WEE B;  3N4P A;  3AVN A;  3DYA A;  1GLE G;  4H5T A;  3TWH A;  2A41 A;  3OYL A;  3QML A;  4FJJ A;  5KI6 A;  1YVN A;  1VQ8 N;  3NDK A;  4IG3 A;  2G8K A;  3DJC A;  2P9N B;  3O5B A;  1ZC6 A;  2G8H A;  2J4R A;  4BRG A;  3C7N A;  1DTT A;  2HNZ A;  2ZWH A;  1OH5 A;  2ATQ A;  4B1U B;  1JLE A;  3D2F B;  1CZB A;  3KK3 A;  1O13 A;  2P9P A;  1KD1 O;  2DFF A;  5AFU H;  3F9K A;  1LWE A;  5FLX O;  4Z4F A;  3RMB A;  3PLA A;  3FZF A;  4LFA K;  2HHV A;  4DFJ A;  4Q0B A;  4CJV A;  3DOL A;  3C0B A;  4DR6 K;  2OPS A;  4NCA A;  2OTL N;  3HRG A;  2FBT A;  4RW8 A;  2X78 A;  3SAH A;  4M3X A;  4JRP A;  3O1B A;  5JIC A;  1NK7 A;  4DS4 A;  2O8C B;  3HPG A;  3UIQ A;  2G8W A;  2GWK A;  2V7Y A;  2WBN A;  4DQP A;  4BC3 A;  4DTN A;  3E1Y A;  1XC3 A;  1HR0 K;  2IC3 A;  2WON A;  4GVM A;  2P5O A;  1A5V A;  2D4W A;  4O8U A;  2QA4 N;  2HHW A;  1S6P A;  3RVC A;  4F3O A;  1GLA G;  4CER A;  3KWI A;  3VQA A;  1NGF A;  3T1H K;  4A5B A;  2FF6 A;  3HM8 A;  4JD2 B;  3DOK A;  4BG8 A;  1BIU A;  2EHG A;  3OYA A;  1EO1 A;  3G4S N;  2BTF A;  1NK9 A;  4CJ7 A;  3TSU A;  2CGL A;  3EN9 A;  3THY B;  2FLO A;  4DTX A;  1KVA A;  1QHA A;  3BF1 A;  3R8E A;  3GE1 A;  2FBX A;  3MN7 A;  2YJF A;  1K8A O;  3UKR B;  4B9L A;  1OVQ A;  1D4X A;  5GAE P;  1NK4 A;  4YOV A;  3KJV A;  4Y1C A;  1TV6 A;  4KRE A;  5CHI A;  3QFP A;  4PKI A;  3GBT A;  1KVC A;  1KLM A;  2Q31 A;  3DXK B;  4IFV A;  4L3Q A;  3TAB A;  2E4L A;  4B8A B;  3OYN A;  2O8F B;  4B1X B;  4DFM A;  4CFD A;  3THX A;  1VQL N;  3MX2 A;  3T7Z A;  4H5W A;  4R79 A;  5MLC Q;  1TKT A;  3CFR A;  2HF3 A;  2X6N A;  1WUA A;  3TAR A;  4LF4 K;  3EKS A;  3G71 N;  4C8M A;  4ILH A;  3NCI A;  1TL3 A;  2VWJ A;  4DSJ A;  4DV0 K;  1RT3 A;  2G8V A; 
#chains in the Genus database with same CATH homology
 3QDK A;  2CH6 A;  5C0Y A;  3MMV A;  4JKF A;  3D2F A;  4WYB A;  5BR9 A;  3CCV N;  2KLA A;  2PAV A;  1T44 A;  2QWP A;  3EZW A;  4EAH D;  4JK7 A;  1OKJ A;  2GEL A;  5TKY A;  1Y64 A;  3OA9 A;  5M1Q A;  2YHW A;  4IFE A;  3CMA N;  2NRH A;  3EE8 A;  5FPM A;  3VGM A;  1Q7Y O;  1BWF O;  2YJE A;  3ULE A;  3J7Z O;  2W40 A;  3D2E B;  3U9Z A;  5JLF A;  3GG4 A;  2A3Z A;  1YUW A;  3MCA B;  4FO0 A;  2W41 A;  3VGL A;  3WXI A;  4H0X B;  3DLL L;  1KAY A;  3HTV A;  1J6Z A;  1K9M O;  3MCP A;  3VEO A;  4C1N I;  4CD3 A;  1K73 O;  1QQO A;  4FWQ A;  3VEN A;  5BRE A;  3CF5 L;  1ZBS A;  5KPZ A;  1Q86 O;  5AQU A;  5BN8 A;  3AAP A;  5GIO A;  4IJN A;  1S3X A;  5AQN A;  3CCU N;  3NVM A;  4A62 A;  2Q0R A;  1QVF M;  1S72 N;  3KHY A;  4HWI A;  2D0O A;  3M6G A;  4A59 A;  5BPN A;  4ILJ A;  4CI6 A;  3QBX A;  4WQ5 C;  3NMU A;  1H1V A;  5AQT A;  2NRR A;  4JD2 A;  2P9I B;  3ENO A;  5AQQ A;  4BRO A;  4OPA A;  5AQS A;  1VQ4 N;  2JWL A;  2E2Q A;  3CHW A;  3FLC O;  5AQY A;  3H3O B;  2GTD A;  4FWR A;  3VF2 A;  3E9O A;  1ZXO A;  5EX5 A;  3SBG A;  5BRF A;  2QI2 A;  2QTD A;  1P8Z A;  1QZ5 A;  5KQ8 A;  3CIP A;  2GX9 A;  4IO9 L;  3CJC A;  3LDL A;  5AQP A;  3O9R A;  2E20 A;  5AQF A;  2BUP A;  3VER A;  5KQD A;  4YOW A;  5KPT A;  5AZJ A;  4FWS A;  4EIA A;  1U2V B;  1S22 A;  1VQ7 N;  3QBW A;  1HUX A;  4JKD A;  1ATR A;  2P9K A;  3O9T A;  3ZX3 A;  2P9U A;  4BRC A;  5AQK A;  4XH5 A;  4YOT A;  3GDQ A;  1JCE A;  3FR0 A;  2FF3 B;  3VEV A;  2Q36 A;  2P9S B;  4M63 C;  2F9T A;  3E9P A;  5GIP A;  4JN4 A;  1VQP N;  3E66 A;  1Z6R A;  4IDH A;  1BDG A;  1U2V A;  2AP1 A;  2E88 A;  1BU6 O;  3QFU A;  4WF9 L;  2P9L B;  4JKG B;  5ELZ A;  4NLB A;  3VPZ A;  4E1J A;  5C2D A;  1E4G T;  5JLH A;  3FZM A;  2Q1N A;  4BR5 A;  1Q81 O;  1GLB G;  3OBW A;  3CCS N;  4IOX A;  1YIJ N;  1BA1 A;  1XQS C;  5AQZ A;  2HBK A;  4YDU C;  3PIP L;  1KC8 O;  2WFB A;  4ISG A;  2QWN A;  2HF4 A;  1YF5 L;  5AQV A;  4KH4 A;  4PKH A;  3CCM N;  1NGH A;  2HBJ A;  5AQR A;  1K8K A;  3UKR A;  3DXK A;  3ZEU A;  2ZGZ A;  4EHT A;  3SAG A;  1QVG M;  3O9S A;  3MN9 A;  3FZK A;  1QQM A;  2HOE A;  1ATN A;  3CJ1 A;  1OVY A;  4BC2 A;  2E2N A;  1CZA N;  3FFK B;  1BO5 O;  3KVG A;  5DM7 L;  4BRE A;  4LC9 B;  1W2B M;  3PIO L;  2EWS A;  2I7P A;  1NGD A;  4GY2 B;  3BF3 A;  1X3N A;  4CZH A;  3CJ7 A;  3EKU A;  4NLC A;  4QS8 A;  1ATS A;  3BUZ B;  2A40 A;  3Q7B A;  3CI5 A;  3P39 A;  5EOY A;  4BR0 A;  1HKC A;  3M5R A;  4FPB A;  4XH1 A;  5BPM A;  2ASP A;  4BVP A;  1GLD G;  1WOQ A;  3C6A A;  4BRN A;  4CZJ A;  3MN6 A;  1YIT N;  3C7N B;  3IMX A;  4BRI A;  4G9Z A;  4YOX A;  3L0Q A;  1DKG D;  3A8Y A;  4CZK A;  3HOS A;  5AQM A;  4JHD A;  5AR0 A;  3A0I X;  3SJH A;  3OHR A;  3FZH A;  1BUP A;  2A6A A;  2H3G X;  1SQK A;  2OAN A;  5FPN A;  3U4L A;  1HLU A;  3EO3 A;  4H5R A;  4DQ8 A;  1YHQ N;  5C2F A;  2P9S A;  4A2B A;  1DT9 A;  4BQZ A;  1HX1 A;  5E26 A;  1V4T A;  3L4I A;  2E2P A;  4JEP A;  1XUP O;  1ESV A;  3OW2 M;  3AY9 A;  3CET A;  3TTC A;  2IVO A;  5E84 A;  3P38 A;  4YOY A;  3W0L A;  5GAD P;  4H0O A;  1M1K O;  3FZL A;  1TUY A;  4FL9 A;  3CME N;  4FWN A;  1VQ9 N;  3EE9 A;  3H46 O;  5AQI A;  4PL8 A;  4GNI A;  3N4Q A;  4I6M A;  5AZI B;  4PKG A;  4JKH A;  4BRM A;  3CCR N;  1YJ9 N;  4OO1 J;  1P90 A;  4RCH A;  4YOR A;  4RWT A;  3O4W A;  3D7E O;  2Q97 A;  2FSK A;  4QS7 A;  4JKC A;  3U9D A;  4O5F A;  2ZJQ L;  5KPR A;  4BRA A;  4Y0W A;  3RSE B;  3TU5 A;  4BC4 A;  3F2K A;  3BP8 A;  3P4I A;  3WXJ A;  3VTI A;  3WXL A;  4JNE A;  3LDP A;  4WFA L;  3CC2 N;  5F2R A;  2A5X A;  2V52 B;  5AQJ A;  3VET A;  4GV9 A;  3WT0 A;  2NZT A;  4FOI A;  3H3N O;  5EVZ A;  5FPD A;  1Z05 A;  3MWT A;  1NGG A;  3UE5 A;  1IJJ A;  4B1W B;  2QW9 A;  4BY9 C;  2IVN A;  3H45 C;  2P9N A;  2V51 B;  2HST A;  3TTD A;  3ZET B;  4H03 B;  4BG9 A;  1MWK A;  2GWJ A;  2P9L A;  4JKG A;  3DAW A;  1BOT O;  4OPH A;  3WEE A;  1M90 O;  5TKW A;  3R9P A;  4BGB A;  3CXC M;  4IJA A;  3GOI A;  4B9Q A;  5GAG P;  1NGA A;  4UY8 O;  3VEZ A;  2JWK A;  1NGB A;  3I8B A;  2YCH A;  1Q18 A;  3AAQ A;  1MWM A;  3FE1 A;  2HBM A;  4K43 A;  2VYP A;  1NMD A;  3Q7C A;  3M1F A;  3B8A X;  3I33 A;  5AFU A;  2ZF5 O;  3LDN A;  4WFB L;  3CPE A;  1KXP A;  5CR4 A;  4U7B A;  3AGR A;  1X3M A;  2I7N A;  4YDU A;  4DB3 A;  5F0X A;  3AGK A;  3K9J A;  4JKB A;  3CD6 N;  4JK8 A;  3CQY A;  1VQK N;  2NRT A;  2E1Z A;  3O9U A;  1TYQ A;  4YOU A;  3SBT A;  3O80 A;  4NB4 A;  3L6Q A;  3AAR A;  1NLV A;  1EQY A;  1C0G A;  1LOT B;  3ZEU B;  3TSQ A;  3ATV A;  4CZE A;  2UYT A;  3UKU B;  2DPN A;  3NVK A;  2ZGY A;  4M7X A;  5M1O A;  2VGM A;  3VEY A;  4FPA A;  5BRH A;  3CC7 N;  4FWO A;  3CJ9 A;  4J8F A;  1VQN N;  3SK3 A;  3CQX A;  2FSN A;  1X9J A;  5AQX A;  4DCH A;  4A61 A;  5DM6 L;  1QZ6 A;  1W97 L;  3P31 A;  1KQS M;  2E8A A;  3WXK A;  3DWL A;  1JJ2 M;  3EL2 A;  2D0P A;  3D6R A;  3ULE B;  4BR4 A;  3SLC A;  3KK7 A;  4CBX A;  1HPM A;  4EHU A;  1NGC A;  2CH5 A;  4K25 A;  4WFN L;  3U8X A;  3TTF A;  1VAZ A;  3BEX A;  4H0P A;  2A42 A;  4H5V A;  5AQO A;  3HOT A;  5AZI A;  5I9E B;  2QWL A;  4K41 A;  2QEX N;  3LDO A;  4RTF D;  3SAF A;  1RDW X;  4IEI A;  2NRW A;  5AQH A;  5HL7 L;  3CCQ N;  1JCF A;  3CJB A;  3O08 A;  2AA4 A;  3QB0 A;  2OTJ N;  3A5M C;  4BRF A;  3CCE N;  3H1Q A;  2BH1 A;  2IIR A;  3TSP A;  3VEX A;  2NRZ A;  4CBU A;  1NGE A;  2FSJ A;  3HBT A;  4BR2 A;  3WXM B;  3D2E A;  4CZF A;  2CGJ A;  5ADX H;  3R1X A;  4H5N A;  3ZET A;  1N8R O;  5GIN A;  4JHD B;  3MN5 A;  3CCL N;  3K9K A;  4O8K A;  2P9K B;  4HTL A;  2YX6 A;  4WQ4 A;  2D1K A;  4KH5 A;  3H1V X;  3SMS A;  3WUH A;  5FPE A;  3E9L A;  4GVE A;  1SS6 A;  5AQG A;  4GV6 A;  3VEW A;  1T6C A;  4FOE A;  3VMF B;  3O1W A;  2E1Y A;  2PFU A;  4CZI A;  5JVG L;  3VF4 A;  2P9U B;  2NLX A;  4C1N K;  2VCP A;  1G99 A;  1KAZ A;  2WUS A;  3RSE A;  4H0V B;  4DKW A;  3QIC A;  4KBO A;  4FWK A;  1K8K B;  1T6D A;  5AZJ B;  3SMP A;  1KAX A;  2GUP A;  4CBW A;  3UB5 A;  1YJW N;  2QWR A;  3H6E A;  3C6H A;  1NGJ A;  4F9O A;  1IG8 A;  1YI2 N;  1GLF O;  5HOO A;  1T3V A;  3F5T A;  4BC5 A;  2VGN A;  4CZL A;  4FSV A;  2ZJR L;  4H0T B;  3GL1 A;  2Q0U A;  4BVO A;  3CC4 N;  4M7Y A;  3DXM A;  2P9I A;  2ASM A;  2Q2R A;  3F9M A;  3G6E N;  1SZ2 A;  4A57 A;  4BR9 A;  4CD1 A;  4EFH A;  4IO8 A;  3WEE B;  3N4P A;  4MO4 A;  3ID8 A;  1GLE G;  1YXQ A;  4H5T A;  2QWO A;  4IEE A;  5M1N A;  2A41 A;  4IWV A;  1HKB A;  3S41 A;  3QML A;  1Q82 O;  3IFR A;  1YAG A;  1YVN A;  4WQ5 A;  3C65 A;  5BN9 A;  4BRD A;  2IVP A;  2QWQ A;  1VQ8 N;  1VQO N;  4AM6 A;  3DJC A;  2HMP A;  2P9N B;  3O5B A;  1LCU A;  1ZC6 A;  2J4R A;  2WC9 A;  5AQW A;  4BRG A;  3C7N A;  1VQ5 N;  4FVU A;  2ZWH A;  1YJN N;  3A5O C;  4C23 A;  4B1U B;  3D2F B;  2ZJP L;  3HSC A;  3VES A;  1DGK N;  3ZX2 A;  1O13 A;  2P9P A;  4CZG A;  1KD1 O;  2F7T A;  4U67 L;  3G25 A;  5AFU H;  4BRK A;  3JS6 A;  3IKM A;  4WCE L;  2YI1 A;  4BGA A;  3PLA A;  3FZF A;  4FWL A;  1BA0 A;  1NM1 A;  3LDQ A;  3L4Q A;  3ENB A;  1NBW A;  4NO7 A;  4MDB A;  2ASO A;  2HBL A;  2V7Z A;  4B1Z A;  3WQT A;  1V4S A;  3M3Z A;  4QS9 A;  5F1X A;  4MLE A;  4ISF A;  3W3D A;  3C0B A;  5BRD A;  3R3L A;  3O8M A;  2OTL N;  3HRG A;  5M1F A;  3UKU A;  3O6W A;  4PL7 A;  3ATU A;  3SAH A;  3KZB A;  4XEI A;  3O1B A;  2NRV A;  5JIC A;  4IOA L;  2RE2 A;  4BQL A;  3ZYY X;  4IZ9 A;  2NNW A;  2QXL A;  4KH6 A;  4JAX A;  2GWK A;  2V7Y A;  1HKG A;  2WBN A;  3ID6 A;  5LJW A;  2RHK A;  4BC3 A;  3ZX0 A;  4MO5 A;  5LY3 A;  2YHX A;  3E1Y A;  1XC3 A;  2NRX A;  1HJO A;  3J8A A;  1NJI O;  4ILG B;  1MDU B;  1R59 O;  2QWM A;  4BR7 A;  2D4W A;  4JK9 A;  4O8U A;  2QA4 N;  4XH4 A;  1NGI A;  2YHY A;  3RVC A;  3OBY A;  4FWM A;  5JMV A;  3O9Q A;  1GLJ O;  1GLA G;  3VF6 A;  1NWK A;  3KWI A;  4MLH A;  3CJA A;  1NGF A;  4Z94 A;  1ILY A;  3VOV A;  3I55 N;  3CPW M;  1VQ6 N;  3CER A;  2KHO A;  1TYQ B;  4A5B A;  2FF6 A;  5C10 A;  3HM8 A;  4JD2 B;  1GLC G;  4BG8 A;  3MDQ A;  1EO1 A;  4H0Y B;  4CZM A;  3I56 N;  2BTF A;  1E4F T;  3R6M A;  4BRQ A;  5ADX A;  3G4S N;  3MWP A;  4B1V A;  2ITM A;  4CJ7 A;  5BPL A;  5H1S Q;  2VWB A;  4WQ4 C;  2CGL A;  4MDA A;  3TSU A;  3EN9 A;  4AF1 A;  3LM9 A;  2FLO A;  5GAH P;  4I6M B;  3MK6 A;  3DXM B;  1QHA A;  3BF1 A;  3FGU A;  3R8E A;  1TUU A;  4BRL A;  3CCJ N;  3GE1 A;  3MN7 A;  3IUC A;  2YJF A;  1K8A O;  1QQN A;  1JCG A;  1C0F A;  3ENH A;  3VGK A;  5LJV A;  3A5L C;  4AM7 A;  3UKR B;  2E2O A;  1RFQ A;  4GV3 A;  1DEJ A;  1D4X A;  1RDU A;  3HI0 A;  5GAE P;  1VQM N;  4JKE A;  3LL3 A;  3MX5 A;  5C15 A;  5M1K A;  5AQL A;  4A5A A;  4DHY A;  4YOV A;  4IXC A;  1BG3 A;  1U6Z A;  3KWG A;  3QFP A;  3IDH A;  5C12 A;  2PBD A;  5EXW A;  2CGK A;  5CHI A;  4B1Y B;  4PKI A;  3GBT A;  4FWP A;  2Q31 A;  3DXK B;  4L3Q A;  4BRH A;  2P9P B;  4B1X B;  3A5N C;  3TPQ A;  5EY4 A;  5JVH L;  1VQL N;  4BRP A;  1SAZ A;  2GEM A;  3MX2 A;  3T7Z A;  4H5W A;  3LM2 A;  3T69 A;  1MA9 B;  3HZ6 A;  4R79 A;  5MLC Q;  2HF3 A;  1GLL O;  2KKZ A;  3WQU A;  1WUA A;  1RGI A;  2FXU A;  3EKS A;  2F9W A;  2QM1 A;  5B8H A;  5CE3 A;  4ISE A;  3G71 N;  5M1P A;  4ILH A;  4JKA A;  4K42 A;  4A2A A;  3JXU A;  4PHT X;  4IOC L;  3VTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...