3AVFA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avfA00
4L8RB 1GOAA 1C1AA 3M8RA 3SQ2A 3ASMA 1LW2A 1RTDA 1ZBUA 2HB5A 4IFVA 1ZBHA 1BIZA 1KLNA 4CEZA 2OPPA 5HRSA 3QESA 4DSKA 2KW4A 1S1TA 4DTRA 4EZ9A 2P5OA 4CJEA 3KD5E 2HVHA 2G8VA 3KLIA 4CHOA 3NGYA 1HMVA 1BGXT 2D0BA 4M41A 3HXMA 1TV6A 4DTSA 1S5JA 1SKSA 4HCBA 3HK2A 4DSIA 4M3UA 3NHGA 2G8WA 3OYKA 1QSLA 3DLHA 4KREA 2HHWA 5HRPA 4JS5A 4BACA 3SNNA 2X74A 1RBRA 4B08A 1S1VA 1KCFA 3LWLA 3LP0A 4BDYA 4DFMA 4FK0A 4DTOA 4KHQA 1HPZA 4CEFA 3SPZA 4DLEA 3PV8A 2FBYA 1N5YA 3VQ5A 4E7HA 2BDPA 1FKOA 1RT6A 3ZSVA 2E6MA 5CYQA 1RTIA 5HBMA 1RDBA 3G10A 3V9UA 3RMCA 3OYBA 3LP1A 2YNGA 1RNHA 1EX4A 3G0ZA 1REVA 2Z1IA 4CF1A 1D9FA 2D0CA 4O44A 4PA1A 3V81A 3WNHA 4CJRA 3T19A 2GBZA 4RW6A 2IS3A 3SUOA 5HLFA 4FM1A 3PO4A 3HO1A 4Z4FA 5C24A 3V9SA 3BDPA 1NJWA 3OYHA 4I2PA 4NCAA 4G1QA 1D8YA 3SQ1A 4DQSA 2KZZA 4CGJA 3HSTB 3KTQA 2OPSA 3RWUA 4M3RA 4WE1A 3VQ6A 4HUEA 1BCMA 1SKWA 4M3WA 1I3AA 1UWBA 5DMRA 4J2DA 3O3HA 5I3UA 4OKEA 4M3XA 1S1WA 1X9SA 1NKCA 3AVNA 3L3VA 3QIOA 3F73A 3M8PA 4CIEA 1IO2A 1RDDA 1VSEA 3QETA 1TGOA 3KKSA 4CJ4A 3L2QA 1JKHA 1JXEA 4HUFA 4DTXA 2NUBA 4CFCA 4IDKA 1SL1A 1T7PA 1SV5A 3I0RA 3CM6A 1NK6A 1TVRA 1TL3A 1WSIA 3V1QA 3OS0A 3NF7A 2R7YA 1DLOA 2ZD1A 3O3GA 1HYZA 5KGWA 4F2SA 4HVJA 4RW4A 1NJXA 4DTMA 3ULDA 1Q9YA 2YV0X 3ZT0A 3MEGA 1UOCA 3AA3A 1EETA 3WNEA 4CF0A 4EP4A 2XO7A 1NJZA 4FJ9A 4E7IA 1LV5A 3HJFA 3B6OA 5J2QA 1R0AA 4FLUA 1WAJA 3ZSRA 3L2RA 1LWFA 2DFFA 3BGRA 3TR8A 2HVIA 1Q8IA 4CEQA 1IKWA 4CFDA 4GMJB 4LY7A 3VQCA 3LDSA 4KTWA 5KGXA 3S9HA 3HT3A 3K5LA 4FCYA 3H08A 3VQDA 1T05A 3VQ8A 3K57A 3AA5X 4LH4A 4W5NA 4CJUA 2RPIA 1KVAA 2JLEA 3O4NA 3RTVA 3RR7A 2IDOA 2A1RA 1Y97A 3VQ9A 4J2BA 4ICLA 1L5UA 2EX3A 4E19A 5HROA 4B9LA 4CJ3A 3NFAA 1NK0A 4M45A 3DRPA 4C8NA 3ZSQA 3LWMA 3SI6A 3DOLA 2KFNA 4AILC 1TKTA 3SPYA 2GUIA 5EU7A 4B9SA 3K5OA 4CJSA 4B8AB 4AHUA 5HRRA 2YKMA 3C94A 4Z4HA 3NGZA 2P1JA 4FM2A 2F8TA 4LSLA 4CEBA 1WSHA 4CGGA 4RW8A 4DFJA 3T3FA 3EYZA 1HNIA 4CEEA 3QNOA 4CK1A 1C0UA 4CECA 1XI1A 3LP3A 2B6AA 4FJ5A 4J2AA 2QK9A 2DY4A 1BIUA 1DTTA 1TKZA 4CFAA 1BQNA 1Z26A 2FBTA 2Z1GA 2ZE2A 4CEAA 2GV9A 1KTQA 3S3NA 4DSLA 3QLHA 3AO2A 1QS4A 3ZSXA 4M3TA 4KHWA 3SUNA 3VQ4A 3KK3A 4C8OA 3NF9A 1QQCA 4CJTA 4K8XA 3MEEA 4I9LA 1JLFA 4DWIA 3OJSA 3NCIA 1J5OA 3CYMA 4FYDA 4GVMA 4CEDA 1VSJA 4E7KA 5I42A 2X6SA 3MEDA 3RMBA 1VSFA 4LH5A 4DTNA 1TK8A 4J2EA 2F8SA 3MAQA 4N76A 1F21A 4M42A 3U6FA 3NH2A 4KTQA 3RR8A 1XWLA 1SL2A 3VQEA 1HNVA 2YKNA 1CZBA 4M3YA 3OY9A 3KJVA 4DS5A 1WSJA 1NK7A 3OYMA 3TWHA 2PY5A 1FXXA 1KSPA 1G15A 1HRHA 4H4OA 4C8MA 4BE2A 1ZBLA 1NK4A 4W5OA 4Z4GA 3VQBA 4AHRA 1CLQA 4KB0A 3QO9A 1U49A 1ASWA 3TARA 2D5RA 4E1MA 2XY5A 4RG8A 4FZXC 3I0SA 3PX6A 5D3GA 1SKRA 3V9ZA 1GOBA 1S6PA 5CZ2A 3SZ2A 1JLEA 3HM9A 1YT3A 3ITHA 1JLGA 3TAFA 4LD0A 4E7LA 1X9WA 4PY5A 2AJQA 4FK2A 4FJNA 1ASUA 3V4IA 4F8RA 3AVAA 4I2QA 2EHGA 5K14A 1D5AA 2HNZA 2VWKA 4KFBA 2O4IA 1C0MA 1J53A 1WSEA 3K2PA 1RTHA 3L2VA 3NDKA 3OJUA 4N56A 1RBVA 1FK9A 1HYSA 1LWEA 4CK2A 1VSHA 3MXIA 1U45A 1U47A 2Z1JA 5CYMA 3VQQA 2XHBA 1RBSA 1NKBA 2OZSA 1RT1A 3C6TA 4CERA 2XY6A 1N6QA 3AV9A 3TABA 3NH0A 3QEVA 1TL1A 3M8SA 4FJ8A 2FBXA 3C6UA 4TSXA 3QEPA 1VSLA 4BDPA 5FDLA 2VG6A 2OPQA 4FLXA 4CF9A 3NBPA 3AVKA 1NK8A 3VA3A 4KI6A 3ZSYA 3SCXA 3TI0A 1B9DA 3S3MA 2ITGA 1RT3A 3D0PA 1VRTA 3NH1A 3K5NA 5KRTA 3SJJA 1J54A 1WLJA 1NK9A 1C0TA 3IG1A 3ZSZA 3NE6A 1NOZA 4PWDA 4H8KA 3CFRA 1RBTA 3DM2A 4N5SA 5J2NA 3V6DA 4KAZA 1CZ9A 4BE1A 2BANA 3DLRA 1X1PA 1VSMA 3KLFA 3THVA 1RCHA 4DTJA 4B9VA 4CJQA 5E41A 4IKFA 2HHXA 2YNFA 3HPGA 1U4BA 3IRXA 4DU3A 4YFUA 4FK4A 3AVGA 1BCOA 4EP5A 1RBUA 3ZT2A 3VQAA 1B92A 3DLGA 5SZTA 3O3FA 3I8DA 3RMAA 4FJMA 4DQIA 4FZZA 4XIUA 3OYAA 4CHPA 1ASVA 4FW1A 3QNNA 1MU2A 3AA2A 3UIQA 4KO0A 4CEOA 4FW2A 2ZQBA 4ID1A 4IG0A 3KK2A 4FJIA 4HTUA 2F96A 3K58A 1JLQA 3NAEA 2O4GA 3IAYA 2KFZA 3PO5A 4DQPA 3EY1A 4DQRA 4I9QA 3V1RA 2DFHA 5CZ1A 3DOKA 4DS4A 1RILA 4DTPA 1S9GA 1VSKA 4ELVA 4CGDA 4DU4A 3TAQA 4KI4A 3OYFA 2PYLA 4HUGA 1JLBA 4UQGA 4CJVA 4DSFA 4OGCA 2G8UA 2P5GA 4FJ7A 5C25A 3M8QA 3C95A 4FJKA 3ZSOA 3LAMA 3HL8A 3DLKA 1KRPA 3HVRA 4KRFA 4BE0A 4O0JA 4ZHRA 4E89A 5J1EA 3OYCA 3NF8A 2HHTA 2DTUA 2JGUA 1X9MA 2OZMA 1B9FA 4DG1A 4JLHA 3B6PA 4OKJA 1UA1A 4OPKA 4GW6A 1TK5A 1QSYA 2QKBA 4CJ5A 3OYNA 1S9EA 3QINA 3CM5A 2W42A 4RW9A 1WNSA 4DF8A 1CXQA 4W5RA 3OS2A 1IG9A 3L2WA 4AHVA 2HHVA 2WONA 1A5VA 4W5QA 2G8KA 1TAQA 3ZSWA 4CJLA 1D9DA 3DLBA 1BQMA 3QERA 3P1GA 1S1XA 1LAVA 3AA4A 3PX0A 4FLYA 4KPYA 2G8FA 3DRSA 3CFPA 1VRUA 4JS4A 1RDAA 4CK3A 4Z4EA 4O0IA 1C1BA 2YHBA 3TAMA 3LAKA 4Q0BA 1HQEA 2Q3SA 1S1UA 3A2FA 1T03A 4E3SA 3K5MA 3AVFA 4OGEA 1LW0A 3OYGA 3LP2A 1TK0A 3IS9A 1Z25A 3E01A 4AHSA 1BHLA 4B9NA 4ELTA 1JLAA 3O4QA 3ZT1A 3KLEA 1IKYA 4QCLA 5SWMA 2OA8A 3TAPA 3LALA 4FVMA 1S6QA 2FC0A 4QAGA 4CHQA 5HP1A 4ZTJA 2FBVA 5C42A 3KIOA 1IH7A 1QTMA 2IC3A 4CE9A 3LPUA 4KV8A 3P5JA 4CHZA 2VWJA 1IKXA 1RDCA 1Q9XA 3AO3A 4B9MA 4FJGA 5KI6A 4DQQA 4CJWA 1U04A 3CG7A 3V9WA 3WNFA 4NCBA 2HNDA 2OPRA 4N41A 4RW7A 3AVLA 1SL0A 4F2RA 4CF2A 3AVMA 3OYEA 2RF2A 2HHUA 4CJKA 3HVTA 4R5PA 3SQ4A 1XC9A 2YNHA 3OS1A 2ATQA 4CIFA 4DLGA 1RT5A 4KHUA 2KQ2A 4M3ZA 1KVCA 4N47A 5T7BA 2D0AA 1O1WA 4FJHA 4I7FA 2P51A 3KD1E 2XY7A 4FJJA 1LWCA 3HPOA 5DK5A 1GOCA 4KKOA 4Z4IA 4H4MA 4MQ3A 4KHNA 3L8BA 1WSGA 4FLTA 2YNIA 3SUPA 1VSIA 3TAGA 3AVJA 3RMDA 1XHZA 1DTQA 3D45A 5FROA 4AH9A 4CCHA 1SUQA 1XHXA 3QEXA 3AO1A 3QIPA 2RKIA 3SV3A 3AO4A 4KHYA 2BGGA 4F3TA 3SQ0A 1L3TA 1ZBFA 3AO5A 3DRRA 3V1OA 4YNQA 1YVUA 2I5JA 4BWMA 3LPTA 4EZ6A 3HP9A 3QEIA 1W9HA 3ISNC 1LAWA 5HRNA 5CY4A 4BDZA 5J2PA 3TAEA 1BI4A 4PQUA 1WN7A 3OYLA 1KVBA 1NJYA 1K6YA 1BI4B 3FFIA 1RT2A 5FRNA 1T8EA 2QXFA 1NKEA 2WOMA 4NCGA 3OVNA 3ZT3A 3KLGA 1QSSA 4C8LA 1C6VA 4Y1DA 1TKXA 2YHAA 4C8KA 4K8ZA 3VA0A 3U3YA 1NK5A 4B9TA 3AVIA 1L3UA 4Y1CA 5JS2A 2RN2A 2IOCA 3LANA 4W5TA 1QHTA 4CGFA 2HMIA 2X6NA 3SUQA 4FLWA 3LZJA 4CHYA 2B5JA 1CXUA 1RT4A 4JRPA 3MXMA 4B3OA 3KLHA 4KHSA 3K59A 3ZT4A 2HNYA 2PYJA 4FZYA 1TAUA 1IKVA 4CF8A 2DFEA 1ITGA 3QEWA 2LSNA 3RRGA 1I39A 3DI6A 4O5BA 3F9KA 4CFBA 4FXDA 4CGIA 4O4GA 2IAJA 3KK1A 3SV4A 1KFDA 4IFYA 3VN5A 3DYAA 1WSFA 1VK0A 3S3OA 3WNGA 2PZSA 4KB1A 4FJLA 1EXQA 3NF6A 3ALYA 4E1NA 2OYQA 3KKRA 4MFBA 4CIGA 2E6LA 4FLZA 2VG5A 3AVBA 5KRSA 3L3UA 1ZYQA 3V9XA 1YTAA 4DMNA 3OYDA 1EP4A 4Z0UA 4JRQA 3LZIA 4DSEA 4CJPA 1KFSA 1A5XA 1L3VA 3P83D 4AHTA 1HYVA 1WAFA 3VQ7A 1RTJA 4NYNA 2G8HA 4O55A 2Z1HA 4B8CA 4OLAA 2HW3A 4OVLA 1UAXA 4DF4A 1VSDA 4DFKA 3EZ5A 1YTUA 3VQPA 4AHCA 4PUOA 3TANA 4IG3A 4DFPA 2HHQA 4LSNA 4ELUA 1A5WA 1UA0A 4OPJA 3U3GA 3JYTA 2BE2A 2XRIA 1W0HA 4DSJA 1QE1A 1HJRA 4FJXA 2QKKA 3HP6A 3HPHA 1JLCA 3SYZA 2Y1JA 4HCCA 1ZBIA 1BL3A 3OYIA 4DU1A 1TKDA 2X78A 4B9UA 4ID5A 3ZCMA 2Y1IA 3CFOA 5FRMA 1JL1A 1EKEA 5KTQA 3AVCA 2G8IA 1BISA 4IBNA 1HQUA 4QOZB 4CESA 4NYFA 3RRHA 4OKKA 2KTQA 5JS1A 1JXBA 4Z4CA 3PY8A 1C1CA 3HYFA 4CHNA 2KZMA 4BWJA 3T1AA 3JSMA 3DMJA 4E7JA 4F4KA 2HHSA 1KLMA 4Q5VA 5J2MA 3MXJA 3PUFA 3CQ8A 3OYJA 1J9AA 3NGIA 2A1SA 4ZTFA 3PX4A 2E4LA 2ETJA 1NOYA 4OJRA 2IGIA 3DLEA 4CGHA 4FLVA 3AVHA 4OLBA 4HHTA 1JL2A 4F3OA 1RT7A 1L3SA 2XY8A 4CJFA 4DTUA 2VG7A 1FKPA 2B4JA 4KTZA 3L2UA 4FM0A 1U48A 4E0DA 3MECA
chains in the Genus database with same CATH superfamily
2E2QA 1VQ5N 1RDUA 3AAQA 1LW2A 1ZBUA 3SK3A 1ZBHA 1KLNA 1IG8A 5HRSA 4DSKA 1S1TA 4DTRA 3O4WA 2P5OA 4BRDA 4CHOA 3OHRA 4LFCK 1S5JA 2NRWA 1NGHA 3OYKA 2NNWA 5HRPA 4FPBA 4JS5A 4BACA 3SNNA 4KH4A 4BDYA 3WXLA 3THWB 4DTOA 4KHQA 1N5YA 2UUCK 3SAGA 1RTIA 1RDBA 4DCHA 3SMPA 2QTDA 3P31A 3N4QA 3LP1A 1QVGM 1EX4A 2Z1IA 3A5OC 1YF5L 3WNHA 3SUOA 5C0YA 3KWGA 1VQNN 4Z4FA 3V9SA 1NJWA 3F5TA 4NCAA 3TTFA 3SQ1A 2KZZA 1K9MO 5JICA 4M3RA 3VQ6A 1BCMA 1I3AA 1UWBA 4J2DA 1ILYA 3ZYYX 3L3VA 4BG8A 1ATRA 4BR2A 1IO2A 4M63C 3QETA 2ZGZA 3KKSA 4CJ4A 4HUFA 4X66K 2NUBA 1BDGA 1T7PA 2YJFA 1SV5A 3CM6A 1TVRA 4YDUC 1K8KB 4BRAA 5BR9A 2ASMA 4DQ8A 1HYZA 5KGWA 3CCSN 5KQ8A 3AA3A 1EETA 4E7IA 5J2QA 1WAJA 3L2RA 1OKJA 2FXUA 4WFBL 4CI6A 5AQFA 3HT3A 4M7YA 4FCYA 3VQDA 3CC7N 3AY9A 4LH4A 2RPIA 4FSVA 2ZJRL 2IDOA 4CJ3A 3WQUA 1NK0A 2FSJA 3ZX0A 3WXKA 3SI6A 3DOLA 4AILC 1TKTA 3MX5A 1QVFM 4B9SA 4X65K 1HX1A 2FF6A 4B8AB 5BRDA 4AHUA 2QI2A 3C94A 2E1YA 3P39A 2P1JA 4LSLA 1X3MA 1ZXOA 4CGGA 3ENHA 4GVEA 3I56N 4CK1A 1C0UA 4LF6K 2QWOA 4J2AA 4BGAA 5AZJB 1BQNA 4H0XB 1Z26A 2NRVA 5ADXA 2HF4A 3S3NA 4DSLA 1NGEA 3ZSXA 5FPNA 3KK3A 4JI6K 3HOSA 4WQ4A 4CJTA 3MEEA 4LF4K 1JLFA 3NCIA 4CEDA 3O80A 3CPWM 3RMBA 3OA9A 1DEJA 4LH5A 3R8EA 3LDNA 5JVHL 1F21A 3U6FA 2E2NA 1HNVA 2YKNA 3KZBA 5AQRA 4DS5A 1N8RO 3TWHA 1HRHA 2E8AA 1VAZA 1ZBLA 1NK4A 1E4FT 4YY3K 1CLQA 1ASWA 3TARA 4E1MA 5D3GA 4FZXC 4IEEA 3I0SA 3SZ2A 1GLFO 3VTHA 1X9WA 4FK2A 3G71N 4F8RA 3AVAA 2EHGA 5K14A 4JK7A 4K42A 3OJUA 1RBVA 1FK9A 4BVPA 4CK2A 3MXIA 4DR1K 4X62K 4A5BA 2OZSA 3MN9A 5E26A 3AV9A 3QEVA 3M8SA 1HNXK 3VENA 2F7TA 3ZSYA 4YOYA 3R9PA 2ITGA 4IFEA 1VRTA 3NH1A 2I7NA 3IG1A 3K9JA 4H8KA 1RBTA 2P9KA 3DLRA 4B9VA 3KLFA 4IKFA 5E41A 2HBLA 5GINA 4YORA 1RBUA 5SZTA 3RMAA 2W41A 2E5LK 4DQIA 2A3ZA 2QWQA 4KO0A 1WBBA 3FGUA 4RWTA 3PO5A 2OCEA 1YXQA 3EY1A 3V1RA 4JYAK 1S9GA 1VSKA 4CGDA 1V4TA 3TAQA 1JLBA 4DSFA 3UKRB 4CW7B 4H03B 5C25A 4FJKA 3HL8A 3DLKA 4O0JA 5J1EA 3OYCA 4DR6K 3MMVA 3K0SA 2JGUA 3AGKA 3CMEN 1X9MA 4OKJA 5BR8K 1UA1A 2PBDA 2QKBA 2AA4A 3OYNA 4DF8A 3T7ZA 4HTLA 5AQXA 3L2WA 4DKWA 2HHVA 1A5VA 2G8KA 4CJLA 1T3VA 4JNEA 3QERA 3PX0A 4FLYA 1YAGA 4LF7K 3DRSA 3CFPA 3TTDA 1C1BA 1S1UA 1ZC6A 4A2AA 5I9EB 4E3SA 5EY4A 3TSPA 3OYGA 1TK0A 3IS9A 3MN5A 1BUPA 3C7NA 4B9NA 3ZT1A 4QCLA 1IKYA 2OA8A 4FVMA 3ID6A 3FZFA 5ELZA 4GV9A 4CHQA 3M1FA 5AZIA 1OVYA 3KIOA 2PAVA 3O9QA 4KV8A 3P5JA 4LF8K 3H6EA 4NCBA 4N41A 3J7ZO 2O8DA 4F2RA 4CF2A 3AVMA 2RF2A 4CJKA 2O8EB 3SQ4A 3IMXA 4DLGA 2ATQA 2GUPA 2V51B 4M3ZA 2KQ2A 2JWKA 1O1WA 5FPMA 3KD1E 5AQVA 1GOCA 4Z4IA 3TAGA 4JK9A 5BREA 1W2BM 1YITN 4A59A 3QIPA 4V19S 4F3TA 1L3TA 5C10A 4YNQA 3AO5A 3V1OA 3ZETA 2I5JA 4BWMA 2IVOA 2CH5A 3CERA 3HP9A 3QEIA 4K0KK 4BDZA 5J2PA 3A0IX 4FO0A 3FFIA 3CPEA 1T8EA 1NKEA 3ZT3A 4H0YB 1QSSA 2F4VK 1C6VA 1TKXA 2YHAA 1T44A 3VA0A 4Y1CA 2P9UA 1K8AO 3RSEB 4B3OA 4BRLA 4FZYA 4FWQA 1IKVA 5LY3A 4NXMK 3O08A 3QEWA 4BRFA 3BY5A 3TSUA 3DXKB 3WNGA 5EX5A 1J5EK 3U9ZA 2WC9A 2OYQA 2VGNA 5LMNK 2E6LA 2NRRA 2VQEK 3AVBA 3OYDA 1EP4A 4JRQA 3LZIA 2ZJPL 3P83D 5TKYA 2EWSA 3DXMA 3P38A 1VQ7N 2G8HA 4B8CA 4DF4A 4JI4K 4MO5A 3FZLA 3VQPA 4AHCA 4IG3A 3NVKA 1V4SA 2FSNA 4EHUA 2HMPA 3U3GA 4DUYK 1IBMK 2YHXA 1HJRA 2Y1JA 1JLCA 2P9PB 3LDLA 3VESA 4HCCA 5FPEA 2FF3B 1BL3A 4WCEL 3O8MA 1TKDA 3BF1A 4JV5K 2X78A 4JI2K 5AQOA 4BVOA 3ZCMA 2HHHK 4DR5K 3AVCA 2YCHA 4CESA 4NYFA 3MDQA 4OKKA 3RRHA 5JS1A 3PY8A 2VGMA 2PFUA 3HYFA 2KZMA 3T1AA 4F4KA 2HHSA 1KLMA 4Q5VA 3CQ8A 4OPAA 3O9UA 2E2OA 4ZTFA 1IJJA 1NGDA 3DXKA 2IGIA 3RSEA 4CGHA 4FLVA 5M1KA 1L3SA 2XY8A 4DTUA 2VG7A 1FKPA 2B4JA 2D0PA 1K73O 1KAZA 4B3SK 4L8RB 3SQ2A 2HB5A 2NRTA 4CZIA 4NXNK 5BPMA 4CJEA 3C6HA 3QDKA 1O13A 1TV6A 4DTSA 4HCBA 3DLHA 5BN8A 4B3TK 1RBRA 4B08A 3H46O 3LWLA 4FK0A 2P9IB 5F0XA 4DLEA 4MO4A 3PV8A 5AQNA 3VQ5A 2BDPA 3ZSVA 4C8OA 3O9RA 3V9UA 3OYBA 1D9FA 1REVA 4BRNA 4ILHA 3V81A 5HLFA 4RW6A 2IS3A 3OW2M 1HNWK 3HO1A 5C24A 3BDPA 3CC2N 5FPDA 4I2PA 4G1QA 1D8YA 1NGIA 3HSTB 2OPSA 3RWUA 4WE1A 1IV0A 1NWKA 1BA1A 4NB4A 5I3UA 3DWLA 1S1WA 3WXIA 3M8PA 4CIEA 3AGRA 1U2VA 1RDDA 2CGKA 1VSEA 5BN9A 3L2QA 2HBMA 1SL1A 1D4XA 1DKGD 1NK6A 1TL3A 3V1QA 4I6MB 3NF7A 2R7YA 1DLOA 2QW9A 1Q9YA 4DTMA 2YV0X 2A41A 2FSKA 4YHHK 3J8AA 3HJFA 1LV5A 4CZFA 4FLUA 3BGRA 4JKEA 2GTDA 1Q8IA 4JI0K 2HBJA 4GMJB 1JJ2M 2W40A 4KTWA 1YVNA 3GOIA 4IO9L 1T6DA 5AQKA 3VQ8A 1BO5O 4CJUA 2A1RA 1Y97A 3VQ9A 2UUAK 4ICLA 2EX3A 2GWKA 3DRPA 2KFNA 3K5OA 5CE3A 1WOQA 3O1BA 1HKBA 3VERA 2GX9A 2F8TA 1NMDA 4CEEA 2QK9A 1XI1A 3LP3A 2B6AA 2DY4A 4BRPA 1DTTA 5JLFA 3SLCA 1NBWA 2FBTA 2Z1GA 3CCQN 2GV9A 3IDHA 1YUWA 3QLHA 3AO2A 5AZIB 3VQ4A 3M5RA 3SAFA 3NF9A 4I9LA 1J5OA 3CYMA 1HKCA 5M1QA 4GVMA 1VSJA 2X6SA 3SBTA 2WFBA 3CJCA 2O8CB 3VQEA 1GLAG 3C7NB 3OY9A 1WSJA 4JAXA 4XH1A 4C1NI 4CZEA 4C8MA 4H4OA 4BE2A 4W5OA 3WEEB 3THWA 2XY5A 1XC3A 2A40A 3HM9A 1JCFA 1MDUB 4BRMA 4PY5A 4MLEA 2UXCK 2AJQA 1Q7YO 1Q18A 4KHPK 1D5AA 2HNZA 4KFBA 1C0MA 3BEXA 1RTHA 4N56A 1X9JA 4KH5A 4YOXA 3GG4A 4B1UB 1VSHA 4WFAL 3VQQA 3G6EN 1RBSA 3Q7BA 4CERA 4BC4A 1N6QA 5EVZA 3TABA 1TL1A 4FWOA 2E88A 4JKFA 4TSXA 2VG6A 3CHWA 4FLXA 3NBPA 1OH6A 3WT0A 1QQNA 2P9UB 5GAGP 1NK8A 3CCMN 3SCXA 3PIOL 4Z94A 2QWMA 1RT3A 3K5NA 3SJJA 2A42A 1C0TA 3NE6A 1NOZA 4PWDA 3CFRA 3UE5A 5J2NA 1CZ9A 1E4GT 3HPGA 4R79A 4YFUA 3AVGA 1BCOA 3ZT2A 3BP8A 3O3FA 4XIUA 2Q2RA 1ASVA 4U67L 1MU2A 4BG9A 4FW2A 2ZQBA 4ID1A 4FJIA 4HTUA 3K58A 1JLQA 3VTIA 4DQPA 5GIOA 1WBDA 2A5XA 2DFHA 5LL6Z 1NJIO 1RILA 1H1VA 2VYPA 4ELVA 2KLAA 4DU4A 3OBYA 4HUGA 2G8UA 3R6MA 4G9ZA 3C95A 3A5NC 3ZSOA 1P8ZA 3LAMA 5BRFA 4KRFA 4BE0A 1VQPN 1SQKA 2OZMA 4DG1A 3B6PA 2UU9K 4GW6A 1TK5A 5MLCQ 3QMLA 1S9EA 3CM5A 4RW9A 1WNSA 1CXQA 1HKGA 3OS2A 5IT9O 3D7EO 1IG9A 4AHVA 4YOUA 1TYQA 1TAQA 3TU5A 2QWNA 4B1WB 4PL8A 4JD2B 3DLBA 3E9LA 3P1GA 1S1XA 1LAVA 2E20A 2P9NA 4DV4K 1VRUA 4CK3A 2WTUA 3SMSA 3VEVA 2YHBA 3TAMA 5C12A 3O6WA 4CBXA 3AVFA 1LW0A 3LP2A 4BRCA 5BRHA 2P9KB 1BHLA 4ELTA 1JLAA 3O4QA 3EKSA 4H0TB 3PIPL 4OX9K 3KLEA 4IJNA 3LALA 3C6AA 1BWFO 4A61A 1S6QA 4QAGA 5HP1A 4ZTJA 4BRQA 3PSFA 5C42A 2O8DB 4CE9A 3LPUA 4CHZA 4DV2K 1Q9XA 4B9MA 1YJNN 3AO3A 5KI6A 4FWNA 1U04A 3WNFA 3I8BA 1XUPO 3O5BA 5AFUH 1XC9A 4JK8A 3OS1A 1KC8O 2D0AA 2CH6A 2XY7A 1LWCA 4KKOA 4FLTA 3CCEN 3F9MA 1SUQA 3D2FB 4GNIA 2RKIA 2D4WA 1IBKK 4RCHA 1YVUA 4DR7K 4DV6K 5F1XA 2OTJN 2QWRA 2E1ZA 2Q0RA 3ISNC 3EE9A 1LAWA 5HRNA 4MDAA 1BI4A 2YJEA 1NJYA 1K6YA 1RT2A 5FRNA 2QXFA 2NZTA 4C8LA 3CJ7A 4K8ZA 3E1YA 3U3YA 1C0FA 4B9TA 3AVIA 5DM7L 2IOCA 1QHTA 4CGFA 5AQSA 4WYBA 1CXUA 3MXMA 2HF3A 1FJGK 3KLHA 4KHSA 3WEEA 1ESVA 2DFEA 1ITGA 2LSNA 3BF3A 1I39A 3DI6A 4CD3A 4O5BA 4XEIA 4IZ9A 4BRGA 4A62A 4O4GA 2IAJA 3VEOA 3SV4A 4IFYA 3VN5A 4FJLA 4AM6A 4JN4A 4E1NA 5AQGA 4CVNE 4MFBA 4FLZA 3CF5L 2YHWA 1KQSM 1ZYQA 1YTAA 1LCUA 5BPLA 3VQ7A 1VQKN 3U4LA 4OLAA 2HW3A 2GWJA 1UAXA 4H5WA 4WQ5C 3EZ5A 4C23A 3VETA 4PUOA 3TANA 2V7YA 4ELUA 4PKGA 2XRIA 1E3MA 3H45C 4FWLA 3K9KA 3QFUA 3VOVA 1HJOA 2ZF5O 5AQHA 4ID5A 4Y0WA 1JL1A 1EKEA 3P4IA 4QOZB 1BISA 2NRXA 5EXWA 1WB9A 2Q31A 4GY2B 1VQ6N 1JXBA 4PL7A 1NG9A 4CHNA 4ILGB 5A2QO 3PUFA 3OYJA 3NGIA 1TUYA 4H0PA 1N34K 2E4LA 3JS6A 1C0GA 1Z6RA 3ATUA 4OLBA 4HHTA 3BUZB 4DB3A 4IXCA 4WQ5A 1U48A 2BUPA 1IBLK 4KH6A 3MECA 4ILJA 3KVGA 1GOAA 2KKZA 2YX6A 3M8RA 3ASMA 4IFVA 3G4SN 4CEZA 2OPPA 3QESA 4JEPA 4EZ9A 4IOXA 2G8VA 1HMVA 2D0BA 3HK2A 1SKSA 4DSIA 4M3UA 2G8WA 2FLOA 3HM8A 1QSLA 4KREA 3VGMA 1S1VA 4BY9C 3LP0A 1XMQK 1HPZA 3SPZA 1EO1A 2QA4N 3ULEA 4E7HA 1RT6A 5HBMA 3RMCA 1RNHA 4JHDA 3G0ZA 4CF1A 2D0CA 3MCPA 3N4PA 1Q82O 3T19A 2GBZA 4JKBA 4FM1A 3PO4A 4LFBK 4MDBA 3OYHA 3CJBA 2E2PA 3CCVN 4BRIA 4HUEA 5DMRA 4OKEA 3ENOA 4JKDA 4M3XA 3MN6A 1X9SA 1NKCA 3QIOA 3BZCA 4YDUA 4FWMA 2ZJQL 1TGOA 1GLCG 1JKHA 1JXEA 4DTXA 4CFCA 3I0RA 3CD6N 3VPZA 3OS0A 2RHKA 2ZD1A 3ZETB 4WQ4C 4F2SA 4BR0A 4RW4A 4BR5A 2GEMA 3FR0A 3ULDA 3ZT0A 3MK6A 2I7PA 3MEGA 1UOCA 4EP4A 4FJ9A 4CF0A 3B6OA 2Q1NA 1R0AA 3ZSRA 1LWFA 1YHQN 4B1YB 4BC3A 2HVIA 4CEQA 4DR4K 1IKWA 4LY7A 3VQCA 4K41A 3S9HA 1T05A 4DHYA 1TYQB 3GL1A 3K57A 3AA5X 3DXMB 3O4NA 3RTVA 3RR7A 2O8BA 4DV0K 3TTCA 4C8NA 3ZSQA 5CR4A 3T69A 3SPYA 3CCLN 1XNRK 4Z4HA 4FM2A 4CEBA 3I55N 1KXPA 3CETA 4RW8A 3T3FA 3EYZA 1HNIA 3TSQA 5AQPA 3QBWA 4EIAA 4FJ5A 4GV6A 3CMAN 2QXLA 1DGKN 5JVGL 2O8FB 4H5NA 4CJ7A 4KHWA 3SUNA 1TUUA 3U9DA 4K8XA 4JI5K 4DWIA 1HPMA 5C2DA 4FYDA 2P9LA 5I42A 1W97L 1YJWN 2UUBK 3CCUN 2F8SA 3MAQA 3LDPA 3EO3A 4M42A 4BGBA 5M1FA 1VHXA 1CZBA 1NK7A 3D2EB 1QQMA 3OYMA 4DR2K 1G15A 3VQBA 4AHRA 3QO9A 3V9ZA 4RTFD 3D2FA 1JLEA 1YT3A 1VQLN 3ITHA 3TAFA 4LD0A 4FJNA 1ASUA 4I2QA 3THXB 1J53A 1WSEA 3K2PA 3NDKA 3L2VA 1QZ5A 3FZMA 1FW6A 1LWEA 1U45A 1MA9B 3LM2A 2W6KA 1NKBA 2XY6A 3NH0A 4FJ8A 1SAZA 2FBXA 5FLXO 3IKMA 3QEPA 2OPQA 4CF9A 3AVKA 4AM7A 3WQTA 1YIJN 4KI6A 1T6CA 2IVNA 1B9DA 3M3ZA 4B1VA 2UXDK 3MWPA 3D0PA 4PKIA 3O1WA 5KRTA 1J54A 4NLCA 4CBUA 4GKJK 3DM2A 2AP1A 3V6DA 4KAZA 3J81O 4BE1A 2BANA 5AQJA 1X1PA 1NGGA 1U2VB 2V7ZA 2YNFA 4DU3A 1S3XA 3VQAA 4FJMA 3DLGA 3I8DA 3T1HK 3G25A 4FZZA 5AZJA 3AA2A 1VQMN 4IG0A 3VF6A 2F96A 4LC9B 3EEQA 3NAEA 2KFZA 4I9QA 5CZ1A 3DOKA 3A5MC 4KI4A 2PYLA 4UQGA 4OGCA 2P5GA 3M8QA 1NGFA 1KRPA 4ZHRA 2BH1A 4E89A 4XH4A 2YI1A 1W7AA 1NMNA 3J7YP 2W42A 2NRHA 2OTLN 2WONA 4PHTX 5KPRA 4W5QA 3ZSWA 3ZEUB 3F2KA 3THXA 1BQMA 1RGIA 4KPYA 2G8FA 3B8AX 2KHOA 4JI7K 4E0DA 1RDAA 1JCGA 1HQEA 3A2FA 4CZHA 3W3DA 1T03A 4YOTA 3K5MA 4BR7A 1OH5A 4OGEA 3L6QA 3ID8A 1Z25A 3E01A 4AHSA 3E9PA 5SWMA 3TAPA 3VF4A 2D0OA 2F9TA 3MN7A 3U8XA 2Q0UA 2IC3A 3FE1A 3THYA 1IKXA 4YOWA 4DQQA 4CJWA 3CG7A 2O8BB 2HNDA 2OPRA 3L0QA 1GLLO 3OYEA 3OBWA 3CXCM 3DAWA 3HVTA 4FWKA 4R5PA 1S72N 4CIFA 1RT5A 4KHUA 4FJHA 4N47A 4NO7A 5AQQA 2P9PA 4B9QA 4I7FA 3O9SA 2P51A 4FJJA 4DV3K 3L8BA 1WSGA 1NU0A 3AVJA 3RMDA 1XHZA 4O8KA 3J7AP 3SV3A 3AO4A 2BGGA 3DRRA 1U6ZA 4EZ6A 3LPTA 1W9HA 5LMUK 2NRZA 1WN7A 4CD1A 3OYLA 1KVBA 4WF9L 4GV3A 1BI4B 2P9NB 3GDQA 3KLGA 3OVNA 4J8FA 1ATSA 4Y1DA 4C8KA 3CCJN 3HTVA 3LANA 4W5TA 2HMIA 3SUQA 3LZJA 4CHYA 2B5JA 1RT4A 4JRPA 3K59A 2PYJA 5BPNA 4CGIA 3KK1A 4JI3K 4JKAA 3S41A 1BU6O 4IDHA 3DYAA 3VGKA 2PZSA 2O8CA 4KB1A 1EXQA 3ALYA 1RFQA 1NNEA 5H1SQ 3NMUA 2ASPA 3KKRA 4CIGA 3KK7A 2P9SB 3CQXA 3L3UA 1XMOK 3V9XA 3FLCO 3ZX3A 3Q7CA 4BREA 4Z0UA 1KFSA 1A5XA 1L3VA 4GKKK 4AHTA 5HOOA 1RTJA 3DLLL 4BC2A 4O55A 2Z1HA 3VEZA 4FL9A 4LF9K 1VSDA 4H0VB 1GLJO 1Q86O 4DFPA 1RDWX 3H1QA 4CBWA 1A5WA 1UA0A 3JYTA 4DSJA 5IWAK 1QE1A 4FJXA 2QKKA 1N36K 3EE8A 4EHTA 3ZX2A 3CCRN 3IFRA 4WFNL 2Y1IA 3GE1A 3CFOA 3VEXA 5KTQA 3VEWA 1Q81O 1HQUA 4HWIA 4BROA 5EOYA 1DT9A 3JSMA 3DMJA 4E7JA 3FFKB 5J2MA 5JLHA 5AQTA 4U7BA 4B3RK 1NOYA 4OJRA 4NLBA 3AVHA 3CJ1A 1JL2A 1ZBSA 4CJFA 1N32K 1KD1O 5M1OA 1GLBG 5AQLA 1C1AA 4MLHA 5TKWA 1RTDA 3EL2A 1BIZA 1EWQA 4ISEA 4YOVA 1NGBA 4IO8A 5B8HA 2KW4A 3KD5E 2UYTA 2HVHA 3KLIA 3NGYA 1BGXT 4M41A 2VCPA 3HXMA 2CGLA 1LOTB 3NHGA 2HHWA 4JKGA 2X74A 5E84A 4XH5A 1KCFA 2ASOA 4DFMA 4CEFA 4FOIA 2QM1A 2FBYA 4FWRA 3HRGA 1FKOA 1NGCA 2E6MA 5CYQA 3G10A 4O8UA 2YNGA 3D6RA 4O44A 4PA1A 1P90A 4CJRA 3I33A 1G99A 2Q36A 2ZGYA 4EFHA 1MWKA 3GBTA 4DQSA 3LM9A 4CGJA 3KTQA 4M3WA 1SKWA 3WXMB 3O3HA 5AQUA 4CZKA 4ISFA 4BR9A 3AVNA 3F73A 2JWLA 3TPQA 3R1XA 5AQYA 1SKRA 3ULEB 4IDKA 3PSIA 2ITMA 1BG3A 5M1NA 1WSIA 3T1YK 3R3LA 3O3GA 4HVJA 1NJXA 2HOEA 3UKUB 4A57A 3WNEA 2XO7A 1NJZA 3PLAA 5AQMA 2DFFA 3CJAA 3TR8A 3SAHA 2HBKA 3E66A 4CFDA 5LJVA 1QQOA 3A8YA 4H5RA 2ZWHA 5KGXA 3LDSA 4QS8A 3K5LA 3H08A 1BA0A 4W5NA 4KBOA 5C2FA 4H5TA 1KVAA 3AARA 2JLEA 4BQLA 4J2BA 1HNZK 2OANA 1L5UA 4E19A 5HROA 4B9LA 4L3QA 3NFAA 2ZM6K 4M45A 4BC5A 1Z05A 3LWMA 2GUIA 5EU7A 5KPTA 4CJSA 5HRRA 2YKMA 4BQZA 3HI0A 3NGZA 3EZWA 1WSHA 4B1XB 1OVQA 4DFJA 3LL3A 3QNOA 4IEIA 4CECA 4JI8K 1BIUA 1TKZA 4CFAA 1M1KO 2ZE2A 4CEAA 1VQ8N 4DV5K 1KTQA 1GLDG 2IIRA 1QS4A 2P9LB 4M3TA 1NGAA 3H3OB 1QQCA 4DV7K 3THYB 3OJSA 4E7KA 3MEDA 3RVCA 1VSFA 1TK8A 4DTNA 2QWPA 4J2EA 4FPAA 4N76A 4FVUA 2RE2A 4KTQA 3NH2A 1XNQK 3RR8A 1XWLA 1SL2A 4DV1K 3H3NO 3L4IA 4M3YA 3KJVA 2PY5A 1FXXA 1KSPA 4Z4GA 4KB0A 1U49A 2D5RA 4IJAA 4RG8A 1VQON 3PX6A 1GOBA 1S6PA 1QZ6A 5CZ2A 2WUSA 5KQDA 3LDQA 1JLGA 3L4QA 3M6GA 4E7LA 3V4IA 4BR4A 2VWKA 5KPZA 2O4IA 3QB0A 3UB5A 4LF5K 4E1JA 1HYSA 3WXJA 1U47A 2Z1JA 5CYMA 3J80O 3HSCA 2XHBA 3CI5A 1RT1A 3C6TA 1NGJA 3C6UA 4BDPA 1VSLA 5FDLA 3VA3A 1HLUA 3TI0A 3QICA 1YJ9N 3S3MA 3MCAB 4A5AA 1BOTO 3OTOK 1WLJA 1NK9A 3ZSZA 2YHYA 4B3MK 4N5SA 3CQYA 2O8EA 1VSMA 3THVA 1RCHA 4DTJA 3ZLJA 4CJQA 4X64K 2HHXA 1XQSC 1U4BA 3IRXA 4FK4A 4AQYK 4EP5A 1M90O 1B92A 2UXBK 5AQIA 3C65A 3OYAA 4CHPA 4FW1A 3QNNA 4QS7A 2GELA 3UIQA 4CEOA 2V52B 1CZAN 3KK2A 1WUAA 3ATVA 1I94K 2O4GA 3IAYA 2BTFA 5LJWA 4DQRA 4EAHD 5AQWA 4DS4A 1R59O 4DTPA 5AR0A 3OYFA 1KAXA 4CJVA 4FJ7A 2NLXA 1S22A 3SJHA 3HVRA 3E9OA 1HR0K 3NF8A 2HHTA 3CJ9A 4AF1A 2DTUA 4B1ZA 1B9FA 4JLHA 4OPKA 3A5LC 3BZKA 1QSYA 4IOAL 4CJ5A 3QINA 3D2EA 4O5FA 3AAPA 4W5RA 4A2BA 5AFUA 1D9DA 4LFAK 3CIPA 4CZMA 3AA4A 2WBNA 4JS4A 4Z4EA 4O0IA 4DUZK 3LAKA 4Q0BA 2Q3SA 2VQFK 3MX2A 2O8FA 3QFPA 3UKUA 2QWLA 3SBGA 1YI2N 3ZEUA 2P9IA 1NM1A 3H1VX 1HUXA 2FC0A 2FBVA 2DPNA 1IH7A 1QTMA 3HBTA 2VWJA 4FJGA 3FZHA 1RDCA 2VWBA 4CZLA 1VQ4N 3V9WA 3O9TA 3C0BA 4RW7A 3AVLA 1SL0A 4CZGA 1SS6A 4JHDB 3NVMA 2HHUA 4K43A 2D1KA 2YNHA 4FWSA 1N33K 4BRHA 4C1NK 3DJCA 1KVCA 5T7BA 5GAEP 3MWTA 3KWIA 1X3NA 3HPOA 5DK5A 2IVPA 5JMVA 4H4MA 4MQ3A 4KHNA 2YNIA 3SUPA 1VSIA 1DTQA 4JKHA 3D45A 3IUCA 5FROA 4AH9A 5HL7L 4OO1J 4CCHA 1XHXA 3QEXA 3AO1A 3CC4N 4KHYA 3SQ0A 1ZBFA 4DR3K 3VMFB 2Q97A 4JKGB 1EWRA 5CY4A 3TAEA 4PQUA 1ATNA 2HSTA 4H5VA 2W6LA 1KAYA 2WOMA 4NCGA 3KHYA 4IWVA 3JXUA 1NK5A 1L3UA 5JS2A 2RN2A 2F9WA 5F2RA 4BRKA 1MWMA 2X6NA 4FLWA 1OH8A 3VF2A 3ZT4A 2HNYA 4K25A 1TAUA 5AQZA 4CF8A 4I6MA 3RRGA 2QEXN 4CFBA 4FXDA 3F9KA 1Y64A 3EN9A 5GAHP 1KFDA 2CGJA 4JD2A 1WSFA 1VK0A 3S3OA 1OH7A 3NF6A 4F9OA 3VGLA 5ADXH 1QHAA 1GLEG 2VG5A 5KRSA 4JKCA 5C15A 4DMNA 4DSEA 3QBXA 4CZJA 4CJPA 4ISGA 2H3GX 2A6AA 3HZ6A 1HYVA 4FOEA 4UY8O 1WAFA 3LDOA 5M1PA 4NYNA 4OVLA 4PKHA 4DFKA 5CHIA 1EQYA 5AJ3K 1YTUA 3UKRA 4FWPA 5GIPA 3WUHA 2HHQA 4JI1K 4LSNA 4OPJA 1JCEA 2BE2A 1W0HA 4IOCL 3HP6A 3HPHA 3SYZA 1ZBIA 3OYIA 4DU1A 4B9UA 3W0LA 2J4RA 2P9SA 5FRMA 2G8IA 4IBNA 1NLVA 4H0OA 5DM6L 4QS9A 2KTQA 4Z4CA 1C1CA 4BWJA 1J6ZA 3ENBA 4OPHA 1SZ2A 3FZKA 3MXJA 3EKUA 1J9AA 4M7XA 2A1SA 5GADP 3JAMO 3PX4A 2ETJA 3DLEA 3HOTA 4F3OA 1RT7A 1VQ9N 4KTZA 3L2UA 4FM0A 3VEYA 1K8KA
chains in the Genus database with same CATH topology
4L8RB 1GOAA 1C1AA 3M8RA 3SQ2A 3ASMA 1LW2A 1RTDA 1ZBUA 2HB5A 4IFVA 1ZBHA 1BIZA 1KLNA 4CEZA 2OPPA 5HRSA 3QESA 4DSKA 2KW4A 1S1TA 4DTRA 4EZ9A 2P5OA 4CJEA 3KD5E 2HVHA 2G8VA 3KLIA 4CHOA 3NGYA 1HMVA 1BGXT 2D0BA 4M41A 3HXMA 1TV6A 4DTSA 1S5JA 1SKSA 4HCBA 3HK2A 4DSIA 4M3UA 3NHGA 2G8WA 3OYKA 1QSLA 3DLHA 4KREA 2HHWA 5HRPA 4JS5A 4BACA 3SNNA 2X74A 1RBRA 4B08A 1S1VA 1KCFA 3LWLA 3LP0A 4BDYA 4DFMA 4FK0A 4DTOA 4KHQA 1HPZA 4CEFA 3SPZA 4DLEA 3PV8A 2FBYA 1N5YA 3VQ5A 4E7HA 2BDPA 1FKOA 1RT6A 3ZSVA 2E6MA 5CYQA 1RTIA 5HBMA 1RDBA 3G10A 3V9UA 3RMCA 3OYBA 3LP1A 2YNGA 1RNHA 1EX4A 3G0ZA 1REVA 2Z1IA 4CF1A 1D9FA 2D0CA 4O44A 4PA1A 3V81A 3WNHA 4CJRA 3T19A 2GBZA 4RW6A 2IS3A 3SUOA 5HLFA 4FM1A 3PO4A 3HO1A 4Z4FA 5C24A 3V9SA 3BDPA 1NJWA 3OYHA 4I2PA 4NCAA 4G1QA 1D8YA 3SQ1A 4DQSA 2KZZA 4CGJA 3HSTB 3KTQA 2OPSA 3RWUA 4M3RA 4WE1A 3VQ6A 4HUEA 1BCMA 1SKWA 4M3WA 1I3AA 1UWBA 5DMRA 4J2DA 3O3HA 5I3UA 4OKEA 4M3XA 1S1WA 1X9SA 1NKCA 3AVNA 3L3VA 3QIOA 3F73A 3M8PA 4CIEA 1IO2A 1RDDA 1VSEA 3QETA 1TGOA 3KKSA 4CJ4A 3L2QA 1JKHA 1JXEA 4HUFA 4DTXA 2NUBA 4CFCA 4IDKA 1SL1A 1T7PA 1SV5A 3I0RA 3CM6A 1NK6A 1TVRA 1TL3A 1WSIA 3V1QA 3OS0A 3NF7A 2R7YA 1DLOA 2ZD1A 3O3GA 1HYZA 5KGWA 4F2SA 4HVJA 4RW4A 1NJXA 4DTMA 3ULDA 1Q9YA 2YV0X 3ZT0A 3MEGA 1UOCA 3AA3A 1EETA 3WNEA 4CF0A 4EP4A 2XO7A 1NJZA 4FJ9A 4E7IA 1LV5A 3HJFA 3B6OA 5J2QA 1R0AA 4FLUA 1WAJA 3ZSRA 3L2RA 1LWFA 2DFFA 3BGRA 3TR8A 2HVIA 1Q8IA 4CEQA 1IKWA 4CFDA 4GMJB 4LY7A 3VQCA 3LDSA 4KTWA 5KGXA 3S9HA 3HT3A 3K5LA 4FCYA 3H08A 3VQDA 1T05A 3VQ8A 3K57A 3AA5X 4LH4A 4W5NA 4CJUA 2RPIA 1KVAA 2JLEA 3O4NA 3RTVA 3RR7A 2IDOA 2A1RA 1Y97A 3VQ9A 4J2BA 4ICLA 1L5UA 2EX3A 4E19A 5HROA 4B9LA 4CJ3A 3NFAA 1NK0A 4M45A 3DRPA 4C8NA 3ZSQA 3LWMA 3SI6A 3DOLA 2KFNA 4AILC 1TKTA 3SPYA 2GUIA 5EU7A 4B9SA 3K5OA 4CJSA 4B8AB 4AHUA 5HRRA 2YKMA 3C94A 4Z4HA 3NGZA 2P1JA 4FM2A 2F8TA 4LSLA 4CEBA 1WSHA 4CGGA 4RW8A 4DFJA 3T3FA 3EYZA 1HNIA 4CEEA 3QNOA 4CK1A 1C0UA 4CECA 1XI1A 3LP3A 2B6AA 4FJ5A 4J2AA 2QK9A 2DY4A 1BIUA 1DTTA 1TKZA 4CFAA 1BQNA 1Z26A 2FBTA 2Z1GA 2ZE2A 4CEAA 2GV9A 1KTQA 3S3NA 4DSLA 3QLHA 3AO2A 1QS4A 3ZSXA 4M3TA 4KHWA 3SUNA 3VQ4A 3KK3A 4C8OA 3NF9A 1QQCA 4CJTA 4K8XA 3MEEA 4I9LA 1JLFA 4DWIA 3OJSA 3NCIA 1J5OA 3CYMA 4FYDA 4GVMA 4CEDA 1VSJA 4E7KA 5I42A 2X6SA 3MEDA 3RMBA 1VSFA 4LH5A 4DTNA 1TK8A 4J2EA 2F8SA 3MAQA 4N76A 1F21A 4M42A 3U6FA 3NH2A 4KTQA 3RR8A 1XWLA 1SL2A 3VQEA 1HNVA 2YKNA 1CZBA 4M3YA 3OY9A 3KJVA 4DS5A 1WSJA 1NK7A 3OYMA 3TWHA 2PY5A 1FXXA 1KSPA 1G15A 1HRHA 4H4OA 4C8MA 4BE2A 1ZBLA 1NK4A 4W5OA 4Z4GA 3VQBA 4AHRA 1CLQA 4KB0A 3QO9A 1U49A 1ASWA 3TARA 2D5RA 4E1MA 2XY5A 4RG8A 4FZXC 3I0SA 3PX6A 5D3GA 1SKRA 3V9ZA 1GOBA 1S6PA 5CZ2A 3SZ2A 1JLEA 3HM9A 1YT3A 3ITHA 1JLGA 3TAFA 4LD0A 4E7LA 1X9WA 4PY5A 2AJQA 4FK2A 4FJNA 1ASUA 3V4IA 4F8RA 3AVAA 4I2QA 2EHGA 5K14A 1D5AA 2HNZA 2VWKA 4KFBA 2O4IA 1C0MA 1J53A 1WSEA 3K2PA 1RTHA 3L2VA 3NDKA 3OJUA 4N56A 1RBVA 1FK9A 1HYSA 1LWEA 4CK2A 1VSHA 3MXIA 1U45A 1U47A 2Z1JA 5CYMA 3VQQA 2XHBA 1RBSA 1NKBA 2OZSA 1RT1A 3C6TA 4CERA 2XY6A 1N6QA 3AV9A 3TABA 3NH0A 3QEVA 1TL1A 3M8SA 4FJ8A 2FBXA 3C6UA 4TSXA 3QEPA 1VSLA 4BDPA 5FDLA 2VG6A 2OPQA 4FLXA 4CF9A 3NBPA 3AVKA 1NK8A 3VA3A 4KI6A 3ZSYA 3SCXA 3TI0A 1B9DA 3S3MA 2ITGA 1RT3A 3D0PA 1VRTA 3NH1A 3K5NA 5KRTA 3SJJA 1J54A 1WLJA 1NK9A 1C0TA 3IG1A 3ZSZA 3NE6A 1NOZA 4PWDA 4H8KA 3CFRA 1RBTA 3DM2A 4N5SA 5J2NA 3V6DA 4KAZA 1CZ9A 4BE1A 2BANA 3DLRA 1X1PA 1VSMA 3KLFA 3THVA 1RCHA 4DTJA 4B9VA 4CJQA 5E41A 4IKFA 2HHXA 2YNFA 3HPGA 1U4BA 3IRXA 4DU3A 4YFUA 4FK4A 3AVGA 1BCOA 4EP5A 1RBUA 3ZT2A 3VQAA 1B92A 3DLGA 5SZTA 3O3FA 3I8DA 3RMAA 4FJMA 4DQIA 4FZZA 4XIUA 3OYAA 4CHPA 1ASVA 4FW1A 3QNNA 1MU2A 3AA2A 3UIQA 4KO0A 4CEOA 4FW2A 2ZQBA 4ID1A 4IG0A 3KK2A 4FJIA 4HTUA 2F96A 3K58A 1JLQA 3NAEA 2O4GA 3IAYA 2KFZA 3PO5A 4DQPA 3EY1A 4DQRA 4I9QA 3V1RA 2DFHA 5CZ1A 3DOKA 4DS4A 1RILA 4DTPA 1S9GA 1VSKA 4ELVA 4CGDA 4DU4A 3TAQA 4KI4A 3OYFA 2PYLA 4HUGA 1JLBA 4UQGA 4CJVA 4DSFA 4OGCA 2G8UA 2P5GA 4FJ7A 5C25A 3M8QA 3C95A 4FJKA 3ZSOA 3LAMA 3HL8A 3DLKA 1KRPA 3HVRA 4KRFA 4BE0A 4O0JA 4ZHRA 4E89A 5J1EA 3OYCA 3NF8A 2HHTA 2DTUA 2JGUA 1X9MA 2OZMA 1B9FA 4DG1A 4JLHA 3B6PA 4OKJA 1UA1A 4OPKA 4GW6A 1TK5A 1QSYA 2QKBA 4CJ5A 3OYNA 1S9EA 3QINA 3CM5A 2W42A 4RW9A 1WNSA 4DF8A 1CXQA 4W5RA 3OS2A 1IG9A 3L2WA 4AHVA 2HHVA 2WONA 1A5VA 4W5QA 2G8KA 1TAQA 3ZSWA 4CJLA 1D9DA 3DLBA 1BQMA 3QERA 3P1GA 1S1XA 1LAVA 3AA4A 3PX0A 4FLYA 4KPYA 2G8FA 3DRSA 3CFPA 1VRUA 4JS4A 1RDAA 4CK3A 4Z4EA 4O0IA 1C1BA 2YHBA 3TAMA 3LAKA 4Q0BA 1HQEA 2Q3SA 1S1UA 3A2FA 1T03A 4E3SA 3K5MA 3AVFA 4OGEA 1LW0A 3OYGA 3LP2A 1TK0A 3IS9A 1Z25A 3E01A 4AHSA 1BHLA 4B9NA 4ELTA 1JLAA 3O4QA 3ZT1A 3KLEA 1IKYA 4QCLA 5SWMA 2OA8A 3TAPA 3LALA 4FVMA 1S6QA 2FC0A 4QAGA 4CHQA 5HP1A 4ZTJA 2FBVA 5C42A 3KIOA 1IH7A 1QTMA 2IC3A 4CE9A 3LPUA 4KV8A 3P5JA 4CHZA 2VWJA 1IKXA 1RDCA 1Q9XA 3AO3A 4B9MA 4FJGA 5KI6A 4DQQA 4CJWA 1U04A 3CG7A 3V9WA 3WNFA 4NCBA 2HNDA 2OPRA 4N41A 4RW7A 3AVLA 1SL0A 4F2RA 4CF2A 3AVMA 3OYEA 2RF2A 2HHUA 4CJKA 3HVTA 4R5PA 3SQ4A 1XC9A 2YNHA 3OS1A 2ATQA 4CIFA 4DLGA 1RT5A 4KHUA 2KQ2A 4M3ZA 1KVCA 4N47A 5T7BA 2D0AA 1O1WA 4FJHA 4I7FA 2P51A 3KD1E 2XY7A 4FJJA 1LWCA 3HPOA 5DK5A 1GOCA 4KKOA 4Z4IA 4H4MA 4MQ3A 4KHNA 3L8BA 1WSGA 4FLTA 2YNIA 3SUPA 1VSIA 3TAGA 3AVJA 3RMDA 1XHZA 1DTQA 3D45A 5FROA 4AH9A 4CCHA 1SUQA 1XHXA 3QEXA 3AO1A 3QIPA 2RKIA 3SV3A 3AO4A 4KHYA 2BGGA 4F3TA 3SQ0A 1L3TA 1ZBFA 3AO5A 3DRRA 3V1OA 4YNQA 1YVUA 2I5JA 4BWMA 3LPTA 4EZ6A 3HP9A 3QEIA 1W9HA 3ISNC 1LAWA 5HRNA 5CY4A 4BDZA 5J2PA 3TAEA 1BI4A 4PQUA 1WN7A 3OYLA 1KVBA 1NJYA 1K6YA 1BI4B 3FFIA 1RT2A 5FRNA 1T8EA 2QXFA 1NKEA 2WOMA 4NCGA 3OVNA 3ZT3A 3KLGA 1QSSA 4C8LA 1C6VA 4Y1DA 1TKXA 2YHAA 4C8KA 4K8ZA 3VA0A 3U3YA 1NK5A 4B9TA 3AVIA 1L3UA 4Y1CA 5JS2A 2RN2A 2IOCA 3LANA 4W5TA 1QHTA 4CGFA 2HMIA 2X6NA 3SUQA 4FLWA 3LZJA 4CHYA 2B5JA 1CXUA 1RT4A 4JRPA 3MXMA 4B3OA 3KLHA 4KHSA 3K59A 3ZT4A 2HNYA 2PYJA 4FZYA 1TAUA 1IKVA 4CF8A 2DFEA 1ITGA 3QEWA 2LSNA 3RRGA 1I39A 3DI6A 4O5BA 3F9KA 4CFBA 4FXDA 4CGIA 4O4GA 2IAJA 3KK1A 3SV4A 1KFDA 4IFYA 3VN5A 3DYAA 1WSFA 1VK0A 3S3OA 3WNGA 2PZSA 4KB1A 4FJLA 1EXQA 3NF6A 3ALYA 4E1NA 2OYQA 3KKRA 4MFBA 4CIGA 2E6LA 4FLZA 2VG5A 3AVBA 5KRSA 3L3UA 1ZYQA 3V9XA 1YTAA 4DMNA 3OYDA 1EP4A 4Z0UA 4JRQA 3LZIA 4DSEA 4CJPA 1KFSA 1A5XA 1L3VA 3P83D 4AHTA 1HYVA 1WAFA 3VQ7A 1RTJA 4NYNA 2G8HA 4O55A 2Z1HA 4B8CA 4OLAA 2HW3A 4OVLA 1UAXA 4DF4A 1VSDA 4DFKA 3EZ5A 1YTUA 3VQPA 4AHCA 4PUOA 3TANA 4IG3A 4DFPA 2HHQA 4LSNA 4ELUA 1A5WA 1UA0A 4OPJA 3U3GA 3JYTA 2BE2A 2XRIA 1W0HA 4DSJA 1QE1A 1HJRA 4FJXA 2QKKA 3HP6A 3HPHA 1JLCA 3SYZA 2Y1JA 4HCCA 1ZBIA 1BL3A 3OYIA 4DU1A 1TKDA 2X78A 4B9UA 4ID5A 3ZCMA 2Y1IA 3CFOA 5FRMA 1JL1A 1EKEA 5KTQA 3AVCA 2G8IA 1BISA 4IBNA 1HQUA 4QOZB 4CESA 4NYFA 3RRHA 4OKKA 2KTQA 5JS1A 1JXBA 4Z4CA 3PY8A 1C1CA 3HYFA 4CHNA 2KZMA 4BWJA 3T1AA 3JSMA 3DMJA 4E7JA 4F4KA 2HHSA 1KLMA 4Q5VA 5J2MA 3MXJA 3PUFA 3CQ8A 3OYJA 1J9AA 3NGIA 2A1SA 4ZTFA 3PX4A 2E4LA 2ETJA 1NOYA 4OJRA 2IGIA 3DLEA 4CGHA 4FLVA 3AVHA 4OLBA 4HHTA 1JL2A 4F3OA 1RT7A 1L3SA 2XY8A 4CJFA 4DTUA 2VG7A 1FKPA 2B4JA 4KTZA 3L2UA 4FM0A 1U48A 4E0DA 3MECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8R B;  1GOA A;  1C1A A;  3M8R A;  3SQ2 A;  3ASM A;  1LW2 A;  1RTD A;  1ZBU A;  2HB5 A;  4IFV A;  1ZBH A;  1BIZ A;  1KLN A;  4CEZ A;  2OPP A;  5HRS A;  3QES A;  4DSK A;  2KW4 A;  1S1T A;  4DTR A;  4EZ9 A;  2P5O A;  4CJE A;  3KD5 E;  2HVH A;  2G8V A;  3KLI A;  4CHO A;  3NGY A;  1HMV A;  1BGX T;  2D0B A;  4M41 A;  3HXM A;  1TV6 A;  4DTS A;  1S5J A;  1SKS A;  4HCB A;  3HK2 A;  4DSI A;  4M3U A;  3NHG A;  2G8W A;  3OYK A;  1QSL A;  3DLH A;  4KRE A;  2HHW A;  5HRP A;  4JS5 A;  4BAC A;  3SNN A;  2X74 A;  1RBR A;  4B08 A;  1S1V A;  1KCF A;  3LWL A;  3LP0 A;  4BDY A;  4DFM A;  4FK0 A;  4DTO A;  4KHQ A;  1HPZ A;  4CEF A;  3SPZ A;  4DLE A;  3PV8 A;  2FBY A;  1N5Y A;  3VQ5 A;  4E7H A;  2BDP A;  1FKO A;  1RT6 A;  3ZSV A;  2E6M A;  5CYQ A;  1RTI A;  5HBM A;  1RDB A;  3G10 A;  3V9U A;  3RMC A;  3OYB A;  3LP1 A;  2YNG A;  1RNH A;  1EX4 A;  3G0Z A;  1REV A;  2Z1I A;  4CF1 A;  1D9F A;  2D0C A;  4O44 A;  4PA1 A;  3V81 A;  3WNH A;  4CJR A;  3T19 A;  2GBZ A;  4RW6 A;  2IS3 A;  3SUO A;  5HLF A;  4FM1 A;  3PO4 A;  3HO1 A;  4Z4F A;  5C24 A;  3V9S A;  3BDP A;  1NJW A;  3OYH A;  4I2P A;  4NCA A;  4G1Q A;  1D8Y A;  3SQ1 A;  4DQS A;  2KZZ A;  4CGJ A;  3HST B;  3KTQ A;  2OPS A;  3RWU A;  4M3R A;  4WE1 A;  3VQ6 A;  4HUE A;  1BCM A;  1SKW A;  4M3W A;  1I3A A;  1UWB A;  5DMR A;  4J2D A;  3O3H A;  5I3U A;  4OKE A;  4M3X A;  1S1W A;  1X9S A;  1NKC A;  3AVN A;  3L3V A;  3QIO A;  3F73 A;  3M8P A;  4CIE A;  1IO2 A;  1RDD A;  1VSE A;  3QET A;  1TGO A;  3KKS A;  4CJ4 A;  3L2Q A;  1JKH A;  1JXE A;  4HUF A;  4DTX A;  2NUB A;  4CFC A;  4IDK A;  1SL1 A;  1T7P A;  1SV5 A;  3I0R A;  3CM6 A;  1NK6 A;  1TVR A;  1TL3 A;  1WSI A;  3V1Q A;  3OS0 A;  3NF7 A;  2R7Y A;  1DLO A;  2ZD1 A;  3O3G A;  1HYZ A;  5KGW A;  4F2S A;  4HVJ A;  4RW4 A;  1NJX A;  4DTM A;  3ULD A;  1Q9Y A;  2YV0 X;  3ZT0 A;  3MEG A;  1UOC A;  3AA3 A;  1EET A;  3WNE A;  4CF0 A;  4EP4 A;  2XO7 A;  1NJZ A;  4FJ9 A;  4E7I A;  1LV5 A;  3HJF A;  3B6O A;  5J2Q A;  1R0A A;  4FLU A;  1WAJ A;  3ZSR A;  3L2R A;  1LWF A;  2DFF A;  3BGR A;  3TR8 A;  2HVI A;  1Q8I A;  4CEQ A;  1IKW A;  4CFD A;  4GMJ B;  4LY7 A;  3VQC A;  3LDS A;  4KTW A;  5KGX A;  3S9H A;  3HT3 A;  3K5L A;  4FCY A;  3H08 A;  3VQD A;  1T05 A;  3VQ8 A;  3K57 A;  3AA5 X;  4LH4 A;  4W5N A;  4CJU A;  2RPI A;  1KVA A;  2JLE A;  3O4N A;  3RTV A;  3RR7 A;  2IDO A;  2A1R A;  1Y97 A;  3VQ9 A;  4J2B A;  4ICL A;  1L5U A;  2EX3 A;  4E19 A;  5HRO A;  4B9L A;  4CJ3 A;  3NFA A;  1NK0 A;  4M45 A;  3DRP A;  4C8N A;  3ZSQ A;  3LWM A;  3SI6 A;  3DOL A;  2KFN A;  4AIL C;  1TKT A;  3SPY A;  2GUI A;  5EU7 A;  4B9S A;  3K5O A;  4CJS A;  4B8A B;  4AHU A;  5HRR A;  2YKM A;  3C94 A;  4Z4H A;  3NGZ A;  2P1J A;  4FM2 A;  2F8T A;  4LSL A;  4CEB A;  1WSH A;  4CGG A;  4RW8 A;  4DFJ A;  3T3F A;  3EYZ A;  1HNI A;  4CEE A;  3QNO A;  4CK1 A;  1C0U A;  4CEC A;  1XI1 A;  3LP3 A;  2B6A A;  4FJ5 A;  4J2A A;  2QK9 A;  2DY4 A;  1BIU A;  1DTT A;  1TKZ A;  4CFA A;  1BQN A;  1Z26 A;  2FBT A;  2Z1G A;  2ZE2 A;  4CEA A;  2GV9 A;  1KTQ A;  3S3N A;  4DSL A;  3QLH A;  3AO2 A;  1QS4 A;  3ZSX A;  4M3T A;  4KHW A;  3SUN A;  3VQ4 A;  3KK3 A;  4C8O A;  3NF9 A;  1QQC A;  4CJT A;  4K8X A;  3MEE A;  4I9L A;  1JLF A;  4DWI A;  3OJS A;  3NCI A;  1J5O A;  3CYM A;  4FYD A;  4GVM A;  4CED A;  1VSJ A;  4E7K A;  5I42 A;  2X6S A;  3MED A;  3RMB A;  1VSF A;  4LH5 A;  4DTN A;  1TK8 A;  4J2E A;  2F8S A;  3MAQ A;  4N76 A;  1F21 A;  4M42 A;  3U6F A;  3NH2 A;  4KTQ A;  3RR8 A;  1XWL A;  1SL2 A;  3VQE A;  1HNV A;  2YKN A;  1CZB A;  4M3Y A;  3OY9 A;  3KJV A;  4DS5 A;  1WSJ A;  1NK7 A;  3OYM A;  3TWH A;  2PY5 A;  1FXX A;  1KSP A;  1G15 A;  1HRH A;  4H4O A;  4C8M A;  4BE2 A;  1ZBL A;  1NK4 A;  4W5O A;  4Z4G A;  3VQB A;  4AHR A;  1CLQ A;  4KB0 A;  3QO9 A;  1U49 A;  1ASW A;  3TAR A;  2D5R A;  4E1M A;  2XY5 A;  4RG8 A;  4FZX C;  3I0S A;  3PX6 A;  5D3G A;  1SKR A;  3V9Z A;  1GOB A;  1S6P A;  5CZ2 A;  3SZ2 A;  1JLE A;  3HM9 A;  1YT3 A;  3ITH A;  1JLG A;  3TAF A;  4LD0 A;  4E7L A;  1X9W A;  4PY5 A;  2AJQ A;  4FK2 A;  4FJN A;  1ASU A;  3V4I A;  4F8R A;  3AVA A;  4I2Q A;  2EHG A;  5K14 A;  1D5A A;  2HNZ A;  2VWK A;  4KFB A;  2O4I A;  1C0M A;  1J53 A;  1WSE A;  3K2P A;  1RTH A;  3L2V A;  3NDK A;  3OJU A;  4N56 A;  1RBV A;  1FK9 A;  1HYS A;  1LWE A;  4CK2 A;  1VSH A;  3MXI A;  1U45 A;  1U47 A;  2Z1J A;  5CYM A;  3VQQ A;  2XHB A;  1RBS A;  1NKB A;  2OZS A;  1RT1 A;  3C6T A;  4CER A;  2XY6 A;  1N6Q A;  3AV9 A;  3TAB A;  3NH0 A;  3QEV A;  1TL1 A;  3M8S A;  4FJ8 A;  2FBX A;  3C6U A;  4TSX A;  3QEP A;  1VSL A;  4BDP A;  5FDL A;  2VG6 A;  2OPQ A;  4FLX A;  4CF9 A;  3NBP A;  3AVK A;  1NK8 A;  3VA3 A;  4KI6 A;  3ZSY A;  3SCX A;  3TI0 A;  1B9D A;  3S3M A;  2ITG A;  1RT3 A;  3D0P A;  1VRT A;  3NH1 A;  3K5N A;  5KRT A;  3SJJ A;  1J54 A;  1WLJ A;  1NK9 A;  1C0T A;  3IG1 A;  3ZSZ A;  3NE6 A;  1NOZ A;  4PWD A;  4H8K A;  3CFR A;  1RBT A;  3DM2 A;  4N5S A;  5J2N A;  3V6D A;  4KAZ A;  1CZ9 A;  4BE1 A;  2BAN A;  3DLR A;  1X1P A;  1VSM A;  3KLF A;  3THV A;  1RCH A;  4DTJ A;  4B9V A;  4CJQ A;  5E41 A;  4IKF A;  2HHX A;  2YNF A;  3HPG A;  1U4B A;  3IRX A;  4DU3 A;  4YFU A;  4FK4 A;  3AVG A;  1BCO A;  4EP5 A;  1RBU A;  3ZT2 A;  3VQA A;  1B92 A;  3DLG A;  5SZT A;  3O3F A;  3I8D A;  3RMA A;  4FJM A;  4DQI A;  4FZZ A;  4XIU A;  3OYA A;  4CHP A;  1ASV A;  4FW1 A;  3QNN A;  1MU2 A;  3AA2 A;  3UIQ A;  4KO0 A;  4CEO A;  4FW2 A;  2ZQB A;  4ID1 A;  4IG0 A;  3KK2 A;  4FJI A;  4HTU A;  2F96 A;  3K58 A;  1JLQ A;  3NAE A;  2O4G A;  3IAY A;  2KFZ A;  3PO5 A;  4DQP A;  3EY1 A;  4DQR A;  4I9Q A;  3V1R A;  2DFH A;  5CZ1 A;  3DOK A;  4DS4 A;  1RIL A;  4DTP A;  1S9G A;  1VSK A;  4ELV A;  4CGD A;  4DU4 A;  3TAQ A;  4KI4 A;  3OYF A;  2PYL A;  4HUG A;  1JLB A;  4UQG A;  4CJV A;  4DSF A;  4OGC A;  2G8U A;  2P5G A;  4FJ7 A;  5C25 A;  3M8Q A;  3C95 A;  4FJK A;  3ZSO A;  3LAM A;  3HL8 A;  3DLK A;  1KRP A;  3HVR A;  4KRF A;  4BE0 A;  4O0J A;  4ZHR A;  4E89 A;  5J1E A;  3OYC A;  3NF8 A;  2HHT A;  2DTU A;  2JGU A;  1X9M A;  2OZM A;  1B9F A;  4DG1 A;  4JLH A;  3B6P A;  4OKJ A;  1UA1 A;  4OPK A;  4GW6 A;  1TK5 A;  1QSY A;  2QKB A;  4CJ5 A;  3OYN A;  1S9E A;  3QIN A;  3CM5 A;  2W42 A;  4RW9 A;  1WNS A;  4DF8 A;  1CXQ A;  4W5R A;  3OS2 A;  1IG9 A;  3L2W A;  4AHV A;  2HHV A;  2WON A;  1A5V A;  4W5Q A;  2G8K A;  1TAQ A;  3ZSW A;  4CJL A;  1D9D A;  3DLB A;  1BQM A;  3QER A;  3P1G A;  1S1X A;  1LAV A;  3AA4 A;  3PX0 A;  4FLY A;  4KPY A;  2G8F A;  3DRS A;  3CFP A;  1VRU A;  4JS4 A;  1RDA A;  4CK3 A;  4Z4E A;  4O0I A;  1C1B A;  2YHB A;  3TAM A;  3LAK A;  4Q0B A;  1HQE A;  2Q3S A;  1S1U A;  3A2F A;  1T03 A;  4E3S A;  3K5M A;  3AVF A;  4OGE A;  1LW0 A;  3OYG A;  3LP2 A;  1TK0 A;  3IS9 A;  1Z25 A;  3E01 A;  4AHS A;  1BHL A;  4B9N A;  4ELT A;  1JLA A;  3O4Q A;  3ZT1 A;  3KLE A;  1IKY A;  4QCL A;  5SWM A;  2OA8 A;  3TAP A;  3LAL A;  4FVM A;  1S6Q A;  2FC0 A;  4QAG A;  4CHQ A;  5HP1 A;  4ZTJ A;  2FBV A;  5C42 A;  3KIO A;  1IH7 A;  1QTM A;  2IC3 A;  4CE9 A;  3LPU A;  4KV8 A;  3P5J A;  4CHZ A;  2VWJ A;  1IKX A;  1RDC A;  1Q9X A;  3AO3 A;  4B9M A;  4FJG A;  5KI6 A;  4DQQ A;  4CJW A;  1U04 A;  3CG7 A;  3V9W A;  3WNF A;  4NCB A;  2HND A;  2OPR A;  4N41 A;  4RW7 A;  3AVL A;  1SL0 A;  4F2R A;  4CF2 A;  3AVM A;  3OYE A;  2RF2 A;  2HHU A;  4CJK A;  3HVT A;  4R5P A;  3SQ4 A;  1XC9 A;  2YNH A;  3OS1 A;  2ATQ A;  4CIF A;  4DLG A;  1RT5 A;  4KHU A;  2KQ2 A;  4M3Z A;  1KVC A;  4N47 A;  5T7B A;  2D0A A;  1O1W A;  4FJH A;  4I7F A;  2P51 A;  3KD1 E;  2XY7 A;  4FJJ A;  1LWC A;  3HPO A;  5DK5 A;  1GOC A;  4KKO A;  4Z4I A;  4H4M A;  4MQ3 A;  4KHN A;  3L8B A;  1WSG A;  4FLT A;  2YNI A;  3SUP A;  1VSI A;  3TAG A;  3AVJ A;  3RMD A;  1XHZ A;  1DTQ A;  3D45 A;  5FRO A;  4AH9 A;  4CCH A;  1SUQ A;  1XHX A;  3QEX A;  3AO1 A;  3QIP A;  2RKI A;  3SV3 A;  3AO4 A;  4KHY A;  2BGG A;  4F3T A;  3SQ0 A;  1L3T A;  1ZBF A;  3AO5 A;  3DRR A;  3V1O A;  4YNQ A;  1YVU A;  2I5J A;  4BWM A;  3LPT A;  4EZ6 A;  3HP9 A;  3QEI A;  1W9H A;  3ISN C;  1LAW A;  5HRN A;  5CY4 A;  4BDZ A;  5J2P A;  3TAE A;  1BI4 A;  4PQU A;  1WN7 A;  3OYL A;  1KVB A;  1NJY A;  1K6Y A;  1BI4 B;  3FFI A;  1RT2 A;  5FRN A;  1T8E A;  2QXF A;  1NKE A;  2WOM A;  4NCG A;  3OVN A;  3ZT3 A;  3KLG A;  1QSS A;  4C8L A;  1C6V A;  4Y1D A;  1TKX A;  2YHA A;  4C8K A;  4K8Z A;  3VA0 A;  3U3Y A;  1NK5 A;  4B9T A;  3AVI A;  1L3U A;  4Y1C A;  5JS2 A;  2RN2 A;  2IOC A;  3LAN A;  4W5T A;  1QHT A;  4CGF A;  2HMI A;  2X6N A;  3SUQ A;  4FLW A;  3LZJ A;  4CHY A;  2B5J A;  1CXU A;  1RT4 A;  4JRP A;  3MXM A;  4B3O A;  3KLH A;  4KHS A;  3K59 A;  3ZT4 A;  2HNY A;  2PYJ A;  4FZY A;  1TAU A;  1IKV A;  4CF8 A;  2DFE A;  1ITG A;  3QEW A;  2LSN A;  3RRG A;  1I39 A;  3DI6 A;  4O5B A;  3F9K A;  4CFB A;  4FXD A;  4CGI A;  4O4G A;  2IAJ A;  3KK1 A;  3SV4 A;  1KFD A;  4IFY A;  3VN5 A;  3DYA A;  1WSF A;  1VK0 A;  3S3O A;  3WNG A;  2PZS A;  4KB1 A;  4FJL A;  1EXQ A;  3NF6 A;  3ALY A;  4E1N A;  2OYQ A;  3KKR A;  4MFB A;  4CIG A;  2E6L A;  4FLZ A;  2VG5 A;  3AVB A;  5KRS A;  3L3U A;  1ZYQ A;  3V9X A;  1YTA A;  4DMN A;  3OYD A;  1EP4 A;  4Z0U A;  4JRQ A;  3LZI A;  4DSE A;  4CJP A;  1KFS A;  1A5X A;  1L3V A;  3P83 D;  4AHT A;  1HYV A;  1WAF A;  3VQ7 A;  1RTJ A;  4NYN A;  2G8H A;  4O55 A;  2Z1H A;  4B8C A;  4OLA A;  2HW3 A;  4OVL A;  1UAX A;  4DF4 A;  1VSD A;  4DFK A;  3EZ5 A;  1YTU A;  3VQP A;  4AHC A;  4PUO A;  3TAN A;  4IG3 A;  4DFP A;  2HHQ A;  4LSN A;  4ELU A;  1A5W A;  1UA0 A;  4OPJ A;  3U3G A;  3JYT A;  2BE2 A;  2XRI A;  1W0H A;  4DSJ A;  1QE1 A;  1HJR A;  4FJX A;  2QKK A;  3HP6 A;  3HPH A;  1JLC A;  3SYZ A;  2Y1J A;  4HCC A;  1ZBI A;  1BL3 A;  3OYI A;  4DU1 A;  1TKD A;  2X78 A;  4B9U A;  4ID5 A;  3ZCM A;  2Y1I A;  3CFO A;  5FRM A;  1JL1 A;  1EKE A;  5KTQ A;  3AVC A;  2G8I A;  1BIS A;  4IBN A;  1HQU A;  4QOZ B;  4CES A;  4NYF A;  3RRH A;  4OKK A;  2KTQ A;  5JS1 A;  1JXB A;  4Z4C A;  3PY8 A;  1C1C A;  3HYF A;  4CHN A;  2KZM A;  4BWJ A;  3T1A A;  3JSM A;  3DMJ A;  4E7J A;  4F4K A;  2HHS A;  1KLM A;  4Q5V A;  5J2M A;  3MXJ A;  3PUF A;  3CQ8 A;  3OYJ A;  1J9A A;  3NGI A;  2A1S A;  4ZTF A;  3PX4 A;  2E4L A;  2ETJ A;  1NOY A;  4OJR A;  2IGI A;  3DLE A;  4CGH A;  4FLV A;  3AVH A;  4OLB A;  4HHT A;  1JL2 A;  4F3O A;  1RT7 A;  1L3S A;  2XY8 A;  4CJF A;  4DTU A;  2VG7 A;  1FKP A;  2B4J A;  4KTZ A;  3L2U A;  4FM0 A;  1U48 A;  4E0D A;  3MEC A; 
#chains in the Genus database with same CATH topology
 2E2Q A;  1VQ5 N;  1RDU A;  3AAQ A;  1LW2 A;  1ZBU A;  3SK3 A;  1ZBH A;  1KLN A;  1IG8 A;  5HRS A;  4DSK A;  1S1T A;  4DTR A;  3O4W A;  2P5O A;  4BRD A;  4CHO A;  3OHR A;  4LFC K;  1S5J A;  2NRW A;  1NGH A;  3OYK A;  2NNW A;  5HRP A;  4FPB A;  4JS5 A;  4BAC A;  3SNN A;  4KH4 A;  4BDY A;  3WXL A;  3THW B;  4DTO A;  4KHQ A;  1N5Y A;  2UUC K;  3SAG A;  1RTI A;  1RDB A;  4DCH A;  3SMP A;  2QTD A;  3P31 A;  3N4Q A;  3LP1 A;  1QVG M;  1EX4 A;  2Z1I A;  3A5O C;  1YF5 L;  3WNH A;  3SUO A;  5C0Y A;  3KWG A;  1VQN N;  4Z4F A;  3V9S A;  1NJW A;  3F5T A;  4NCA A;  3TTF A;  3SQ1 A;  2KZZ A;  1K9M O;  5JIC A;  4M3R A;  3VQ6 A;  1BCM A;  1I3A A;  1UWB A;  4J2D A;  1ILY A;  3ZYY X;  3L3V A;  4BG8 A;  1ATR A;  4BR2 A;  1IO2 A;  4M63 C;  3QET A;  2ZGZ A;  3KKS A;  4CJ4 A;  4HUF A;  4X66 K;  2NUB A;  1BDG A;  1T7P A;  2YJF A;  1SV5 A;  3CM6 A;  1TVR A;  4YDU C;  1K8K B;  4BRA A;  5BR9 A;  2ASM A;  4DQ8 A;  1HYZ A;  5KGW A;  3CCS N;  5KQ8 A;  3AA3 A;  1EET A;  4E7I A;  5J2Q A;  1WAJ A;  3L2R A;  1OKJ A;  2FXU A;  4WFB L;  4CI6 A;  5AQF A;  3HT3 A;  4M7Y A;  4FCY A;  3VQD A;  3CC7 N;  3AY9 A;  4LH4 A;  2RPI A;  4FSV A;  2ZJR L;  2IDO A;  4CJ3 A;  3WQU A;  1NK0 A;  2FSJ A;  3ZX0 A;  3WXK A;  3SI6 A;  3DOL A;  4AIL C;  1TKT A;  3MX5 A;  1QVF M;  4B9S A;  4X65 K;  1HX1 A;  2FF6 A;  4B8A B;  5BRD A;  4AHU A;  2QI2 A;  3C94 A;  2E1Y A;  3P39 A;  2P1J A;  4LSL A;  1X3M A;  1ZXO A;  4CGG A;  3ENH A;  4GVE A;  3I56 N;  4CK1 A;  1C0U A;  4LF6 K;  2QWO A;  4J2A A;  4BGA A;  5AZJ B;  1BQN A;  4H0X B;  1Z26 A;  2NRV A;  5ADX A;  2HF4 A;  3S3N A;  4DSL A;  1NGE A;  3ZSX A;  5FPN A;  3KK3 A;  4JI6 K;  3HOS A;  4WQ4 A;  4CJT A;  3MEE A;  4LF4 K;  1JLF A;  3NCI A;  4CED A;  3O80 A;  3CPW M;  3RMB A;  3OA9 A;  1DEJ A;  4LH5 A;  3R8E A;  3LDN A;  5JVH L;  1F21 A;  3U6F A;  2E2N A;  1HNV A;  2YKN A;  3KZB A;  5AQR A;  4DS5 A;  1N8R O;  3TWH A;  1HRH A;  2E8A A;  1VAZ A;  1ZBL A;  1NK4 A;  1E4F T;  4YY3 K;  1CLQ A;  1ASW A;  3TAR A;  4E1M A;  5D3G A;  4FZX C;  4IEE A;  3I0S A;  3SZ2 A;  1GLF O;  3VTH A;  1X9W A;  4FK2 A;  3G71 N;  4F8R A;  3AVA A;  2EHG A;  5K14 A;  4JK7 A;  4K42 A;  3OJU A;  1RBV A;  1FK9 A;  4BVP A;  4CK2 A;  3MXI A;  4DR1 K;  4X62 K;  4A5B A;  2OZS A;  3MN9 A;  5E26 A;  3AV9 A;  3QEV A;  3M8S A;  1HNX K;  3VEN A;  2F7T A;  3ZSY A;  4YOY A;  3R9P A;  2ITG A;  4IFE A;  1VRT A;  3NH1 A;  2I7N A;  3IG1 A;  3K9J A;  4H8K A;  1RBT A;  2P9K A;  3DLR A;  4B9V A;  3KLF A;  4IKF A;  5E41 A;  2HBL A;  5GIN A;  4YOR A;  1RBU A;  5SZT A;  3RMA A;  2W41 A;  2E5L K;  4DQI A;  2A3Z A;  2QWQ A;  4KO0 A;  1WBB A;  3FGU A;  4RWT A;  3PO5 A;  2OCE A;  1YXQ A;  3EY1 A;  3V1R A;  4JYA K;  1S9G A;  1VSK A;  4CGD A;  1V4T A;  3TAQ A;  1JLB A;  4DSF A;  3UKR B;  4CW7 B;  4H03 B;  5C25 A;  4FJK A;  3HL8 A;  3DLK A;  4O0J A;  5J1E A;  3OYC A;  4DR6 K;  3MMV A;  3K0S A;  2JGU A;  3AGK A;  3CME N;  1X9M A;  4OKJ A;  5BR8 K;  1UA1 A;  2PBD A;  2QKB A;  2AA4 A;  3OYN A;  4DF8 A;  3T7Z A;  4HTL A;  5AQX A;  3L2W A;  4DKW A;  2HHV A;  1A5V A;  2G8K A;  4CJL A;  1T3V A;  4JNE A;  3QER A;  3PX0 A;  4FLY A;  1YAG A;  4LF7 K;  3DRS A;  3CFP A;  3TTD A;  1C1B A;  1S1U A;  1ZC6 A;  4A2A A;  5I9E B;  4E3S A;  5EY4 A;  3TSP A;  3OYG A;  1TK0 A;  3IS9 A;  3MN5 A;  1BUP A;  3C7N A;  4B9N A;  3ZT1 A;  4QCL A;  1IKY A;  2OA8 A;  4FVM A;  3ID6 A;  3FZF A;  5ELZ A;  4GV9 A;  4CHQ A;  3M1F A;  5AZI A;  1OVY A;  3KIO A;  2PAV A;  3O9Q A;  4KV8 A;  3P5J A;  4LF8 K;  3H6E A;  4NCB A;  4N41 A;  3J7Z O;  2O8D A;  4F2R A;  4CF2 A;  3AVM A;  2RF2 A;  4CJK A;  2O8E B;  3SQ4 A;  3IMX A;  4DLG A;  2ATQ A;  2GUP A;  2V51 B;  4M3Z A;  2KQ2 A;  2JWK A;  1O1W A;  5FPM A;  3KD1 E;  5AQV A;  1GOC A;  4Z4I A;  3TAG A;  4JK9 A;  5BRE A;  1W2B M;  1YIT N;  4A59 A;  3QIP A;  4V19 S;  4F3T A;  1L3T A;  5C10 A;  4YNQ A;  3AO5 A;  3V1O A;  3ZET A;  2I5J A;  4BWM A;  2IVO A;  2CH5 A;  3CER A;  3HP9 A;  3QEI A;  4K0K K;  4BDZ A;  5J2P A;  3A0I X;  4FO0 A;  3FFI A;  3CPE A;  1T8E A;  1NKE A;  3ZT3 A;  4H0Y B;  1QSS A;  2F4V K;  1C6V A;  1TKX A;  2YHA A;  1T44 A;  3VA0 A;  4Y1C A;  2P9U A;  1K8A O;  3RSE B;  4B3O A;  4BRL A;  4FZY A;  4FWQ A;  1IKV A;  5LY3 A;  4NXM K;  3O08 A;  3QEW A;  4BRF A;  3BY5 A;  3TSU A;  3DXK B;  3WNG A;  5EX5 A;  1J5E K;  3U9Z A;  2WC9 A;  2OYQ A;  2VGN A;  5LMN K;  2E6L A;  2NRR A;  2VQE K;  3AVB A;  3OYD A;  1EP4 A;  4JRQ A;  3LZI A;  2ZJP L;  3P83 D;  5TKY A;  2EWS A;  3DXM A;  3P38 A;  1VQ7 N;  2G8H A;  4B8C A;  4DF4 A;  4JI4 K;  4MO5 A;  3FZL A;  3VQP A;  4AHC A;  4IG3 A;  3NVK A;  1V4S A;  2FSN A;  4EHU A;  2HMP A;  3U3G A;  4DUY K;  1IBM K;  2YHX A;  1HJR A;  2Y1J A;  1JLC A;  2P9P B;  3LDL A;  3VES A;  4HCC A;  5FPE A;  2FF3 B;  1BL3 A;  4WCE L;  3O8M A;  1TKD A;  3BF1 A;  4JV5 K;  2X78 A;  4JI2 K;  5AQO A;  4BVO A;  3ZCM A;  2HHH K;  4DR5 K;  3AVC A;  2YCH A;  4CES A;  4NYF A;  3MDQ A;  4OKK A;  3RRH A;  5JS1 A;  3PY8 A;  2VGM A;  2PFU A;  3HYF A;  2KZM A;  3T1A A;  4F4K A;  2HHS A;  1KLM A;  4Q5V A;  3CQ8 A;  4OPA A;  3O9U A;  2E2O A;  4ZTF A;  1IJJ A;  1NGD A;  3DXK A;  2IGI A;  3RSE A;  4CGH A;  4FLV A;  5M1K A;  1L3S A;  2XY8 A;  4DTU A;  2VG7 A;  1FKP A;  2B4J A;  2D0P A;  1K73 O;  1KAZ A;  4B3S K;  4L8R B;  3SQ2 A;  2HB5 A;  2NRT A;  4CZI A;  4NXN K;  5BPM A;  4CJE A;  3C6H A;  3QDK A;  1O13 A;  1TV6 A;  4DTS A;  4HCB A;  3DLH A;  5BN8 A;  4B3T K;  1RBR A;  4B08 A;  3H46 O;  3LWL A;  4FK0 A;  2P9I B;  5F0X A;  4DLE A;  4MO4 A;  3PV8 A;  5AQN A;  3VQ5 A;  2BDP A;  3ZSV A;  4C8O A;  3O9R A;  3V9U A;  3OYB A;  1D9F A;  1REV A;  4BRN A;  4ILH A;  3V81 A;  5HLF A;  4RW6 A;  2IS3 A;  3OW2 M;  1HNW K;  3HO1 A;  5C24 A;  3BDP A;  3CC2 N;  5FPD A;  4I2P A;  4G1Q A;  1D8Y A;  1NGI A;  3HST B;  2OPS A;  3RWU A;  4WE1 A;  1IV0 A;  1NWK A;  1BA1 A;  4NB4 A;  5I3U A;  3DWL A;  1S1W A;  3WXI A;  3M8P A;  4CIE A;  3AGR A;  1U2V A;  1RDD A;  2CGK A;  1VSE A;  5BN9 A;  3L2Q A;  2HBM A;  1SL1 A;  1D4X A;  1DKG D;  1NK6 A;  1TL3 A;  3V1Q A;  4I6M B;  3NF7 A;  2R7Y A;  1DLO A;  2QW9 A;  1Q9Y A;  4DTM A;  2YV0 X;  2A41 A;  2FSK A;  4YHH K;  3J8A A;  3HJF A;  1LV5 A;  4CZF A;  4FLU A;  3BGR A;  4JKE A;  2GTD A;  1Q8I A;  4JI0 K;  2HBJ A;  4GMJ B;  1JJ2 M;  2W40 A;  4KTW A;  1YVN A;  3GOI A;  4IO9 L;  1T6D A;  5AQK A;  3VQ8 A;  1BO5 O;  4CJU A;  2A1R A;  1Y97 A;  3VQ9 A;  2UUA K;  4ICL A;  2EX3 A;  2GWK A;  3DRP A;  2KFN A;  3K5O A;  5CE3 A;  1WOQ A;  3O1B A;  1HKB A;  3VER A;  2GX9 A;  2F8T A;  1NMD A;  4CEE A;  2QK9 A;  1XI1 A;  3LP3 A;  2B6A A;  2DY4 A;  4BRP A;  1DTT A;  5JLF A;  3SLC A;  1NBW A;  2FBT A;  2Z1G A;  3CCQ N;  2GV9 A;  3IDH A;  1YUW A;  3QLH A;  3AO2 A;  5AZI B;  3VQ4 A;  3M5R A;  3SAF A;  3NF9 A;  4I9L A;  1J5O A;  3CYM A;  1HKC A;  5M1Q A;  4GVM A;  1VSJ A;  2X6S A;  3SBT A;  2WFB A;  3CJC A;  2O8C B;  3VQE A;  1GLA G;  3C7N B;  3OY9 A;  1WSJ A;  4JAX A;  4XH1 A;  4C1N I;  4CZE A;  4C8M A;  4H4O A;  4BE2 A;  4W5O A;  3WEE B;  3THW A;  2XY5 A;  1XC3 A;  2A40 A;  3HM9 A;  1JCF A;  1MDU B;  4BRM A;  4PY5 A;  4MLE A;  2UXC K;  2AJQ A;  1Q7Y O;  1Q18 A;  4KHP K;  1D5A A;  2HNZ A;  4KFB A;  1C0M A;  3BEX A;  1RTH A;  4N56 A;  1X9J A;  4KH5 A;  4YOX A;  3GG4 A;  4B1U B;  1VSH A;  4WFA L;  3VQQ A;  3G6E N;  1RBS A;  3Q7B A;  4CER A;  4BC4 A;  1N6Q A;  5EVZ A;  3TAB A;  1TL1 A;  4FWO A;  2E88 A;  4JKF A;  4TSX A;  2VG6 A;  3CHW A;  4FLX A;  3NBP A;  1OH6 A;  3WT0 A;  1QQN A;  2P9U B;  5GAG P;  1NK8 A;  3CCM N;  3SCX A;  3PIO L;  4Z94 A;  2QWM A;  1RT3 A;  3K5N A;  3SJJ A;  2A42 A;  1C0T A;  3NE6 A;  1NOZ A;  4PWD A;  3CFR A;  3UE5 A;  5J2N A;  1CZ9 A;  1E4G T;  3HPG A;  4R79 A;  4YFU A;  3AVG A;  1BCO A;  3ZT2 A;  3BP8 A;  3O3F A;  4XIU A;  2Q2R A;  1ASV A;  4U67 L;  1MU2 A;  4BG9 A;  4FW2 A;  2ZQB A;  4ID1 A;  4FJI A;  4HTU A;  3K58 A;  1JLQ A;  3VTI A;  4DQP A;  5GIO A;  1WBD A;  2A5X A;  2DFH A;  5LL6 Z;  1NJI O;  1RIL A;  1H1V A;  2VYP A;  4ELV A;  2KLA A;  4DU4 A;  3OBY A;  4HUG A;  2G8U A;  3R6M A;  4G9Z A;  3C95 A;  3A5N C;  3ZSO A;  1P8Z A;  3LAM A;  5BRF A;  4KRF A;  4BE0 A;  1VQP N;  1SQK A;  2OZM A;  4DG1 A;  3B6P A;  2UU9 K;  4GW6 A;  1TK5 A;  5MLC Q;  3QML A;  1S9E A;  3CM5 A;  4RW9 A;  1WNS A;  1CXQ A;  1HKG A;  3OS2 A;  5IT9 O;  3D7E O;  1IG9 A;  4AHV A;  4YOU A;  1TYQ A;  1TAQ A;  3TU5 A;  2QWN A;  4B1W B;  4PL8 A;  4JD2 B;  3DLB A;  3E9L A;  3P1G A;  1S1X A;  1LAV A;  2E20 A;  2P9N A;  4DV4 K;  1VRU A;  4CK3 A;  2WTU A;  3SMS A;  3VEV A;  2YHB A;  3TAM A;  5C12 A;  3O6W A;  4CBX A;  3AVF A;  1LW0 A;  3LP2 A;  4BRC A;  5BRH A;  2P9K B;  1BHL A;  4ELT A;  1JLA A;  3O4Q A;  3EKS A;  4H0T B;  3PIP L;  4OX9 K;  3KLE A;  4IJN A;  3LAL A;  3C6A A;  1BWF O;  4A61 A;  1S6Q A;  4QAG A;  5HP1 A;  4ZTJ A;  4BRQ A;  3PSF A;  5C42 A;  2O8D B;  4CE9 A;  3LPU A;  4CHZ A;  4DV2 K;  1Q9X A;  4B9M A;  1YJN N;  3AO3 A;  5KI6 A;  4FWN A;  1U04 A;  3WNF A;  3I8B A;  1XUP O;  3O5B A;  5AFU H;  1XC9 A;  4JK8 A;  3OS1 A;  1KC8 O;  2D0A A;  2CH6 A;  2XY7 A;  1LWC A;  4KKO A;  4FLT A;  3CCE N;  3F9M A;  1SUQ A;  3D2F B;  4GNI A;  2RKI A;  2D4W A;  1IBK K;  4RCH A;  1YVU A;  4DR7 K;  4DV6 K;  5F1X A;  2OTJ N;  2QWR A;  2E1Z A;  2Q0R A;  3ISN C;  3EE9 A;  1LAW A;  5HRN A;  4MDA A;  1BI4 A;  2YJE A;  1NJY A;  1K6Y A;  1RT2 A;  5FRN A;  2QXF A;  2NZT A;  4C8L A;  3CJ7 A;  4K8Z A;  3E1Y A;  3U3Y A;  1C0F A;  4B9T A;  3AVI A;  5DM7 L;  2IOC A;  1QHT A;  4CGF A;  5AQS A;  4WYB A;  1CXU A;  3MXM A;  2HF3 A;  1FJG K;  3KLH A;  4KHS A;  3WEE A;  1ESV A;  2DFE A;  1ITG A;  2LSN A;  3BF3 A;  1I39 A;  3DI6 A;  4CD3 A;  4O5B A;  4XEI A;  4IZ9 A;  4BRG A;  4A62 A;  4O4G A;  2IAJ A;  3VEO A;  3SV4 A;  4IFY A;  3VN5 A;  4FJL A;  4AM6 A;  4JN4 A;  4E1N A;  5AQG A;  4CVN E;  4MFB A;  4FLZ A;  3CF5 L;  2YHW A;  1KQS M;  1ZYQ A;  1YTA A;  1LCU A;  5BPL A;  3VQ7 A;  1VQK N;  3U4L A;  4OLA A;  2HW3 A;  2GWJ A;  1UAX A;  4H5W A;  4WQ5 C;  3EZ5 A;  4C23 A;  3VET A;  4PUO A;  3TAN A;  2V7Y A;  4ELU A;  4PKG A;  2XRI A;  1E3M A;  3H45 C;  4FWL A;  3K9K A;  3QFU A;  3VOV A;  1HJO A;  2ZF5 O;  5AQH A;  4ID5 A;  4Y0W A;  1JL1 A;  1EKE A;  3P4I A;  4QOZ B;  1BIS A;  2NRX A;  5EXW A;  1WB9 A;  2Q31 A;  4GY2 B;  1VQ6 N;  1JXB A;  4PL7 A;  1NG9 A;  4CHN A;  4ILG B;  5A2Q O;  3PUF A;  3OYJ A;  3NGI A;  1TUY A;  4H0P A;  1N34 K;  2E4L A;  3JS6 A;  1C0G A;  1Z6R A;  3ATU A;  4OLB A;  4HHT A;  3BUZ B;  4DB3 A;  4IXC A;  4WQ5 A;  1U48 A;  2BUP A;  1IBL K;  4KH6 A;  3MEC A;  4ILJ A;  3KVG A;  1GOA A;  2KKZ A;  2YX6 A;  3M8R A;  3ASM A;  4IFV A;  3G4S N;  4CEZ A;  2OPP A;  3QES A;  4JEP A;  4EZ9 A;  4IOX A;  2G8V A;  1HMV A;  2D0B A;  3HK2 A;  1SKS A;  4DSI A;  4M3U A;  2G8W A;  2FLO A;  3HM8 A;  1QSL A;  4KRE A;  3VGM A;  1S1V A;  4BY9 C;  3LP0 A;  1XMQ K;  1HPZ A;  3SPZ A;  1EO1 A;  2QA4 N;  3ULE A;  4E7H A;  1RT6 A;  5HBM A;  3RMC A;  1RNH A;  4JHD A;  3G0Z A;  4CF1 A;  2D0C A;  3MCP A;  3N4P A;  1Q82 O;  3T19 A;  2GBZ A;  4JKB A;  4FM1 A;  3PO4 A;  4LFB K;  4MDB A;  3OYH A;  3CJB A;  2E2P A;  3CCV N;  4BRI A;  4HUE A;  5DMR A;  4OKE A;  3ENO A;  4JKD A;  4M3X A;  3MN6 A;  1X9S A;  1NKC A;  3QIO A;  3BZC A;  4YDU A;  4FWM A;  2ZJQ L;  1TGO A;  1GLC G;  1JKH A;  1JXE A;  4DTX A;  4CFC A;  3I0R A;  3CD6 N;  3VPZ A;  3OS0 A;  2RHK A;  2ZD1 A;  3ZET B;  4WQ4 C;  4F2S A;  4BR0 A;  4RW4 A;  4BR5 A;  2GEM A;  3FR0 A;  3ULD A;  3ZT0 A;  3MK6 A;  2I7P A;  3MEG A;  1UOC A;  4EP4 A;  4FJ9 A;  4CF0 A;  3B6O A;  2Q1N A;  1R0A A;  3ZSR A;  1LWF A;  1YHQ N;  4B1Y B;  4BC3 A;  2HVI A;  4CEQ A;  4DR4 K;  1IKW A;  4LY7 A;  3VQC A;  4K41 A;  3S9H A;  1T05 A;  4DHY A;  1TYQ B;  3GL1 A;  3K57 A;  3AA5 X;  3DXM B;  3O4N A;  3RTV A;  3RR7 A;  2O8B A;  4DV0 K;  3TTC A;  4C8N A;  3ZSQ A;  5CR4 A;  3T69 A;  3SPY A;  3CCL N;  1XNR K;  4Z4H A;  4FM2 A;  4CEB A;  3I55 N;  1KXP A;  3CET A;  4RW8 A;  3T3F A;  3EYZ A;  1HNI A;  3TSQ A;  5AQP A;  3QBW A;  4EIA A;  4FJ5 A;  4GV6 A;  3CMA N;  2QXL A;  1DGK N;  5JVG L;  2O8F B;  4H5N A;  4CJ7 A;  4KHW A;  3SUN A;  1TUU A;  3U9D A;  4K8X A;  4JI5 K;  4DWI A;  1HPM A;  5C2D A;  4FYD A;  2P9L A;  5I42 A;  1W97 L;  1YJW N;  2UUB K;  3CCU N;  2F8S A;  3MAQ A;  3LDP A;  3EO3 A;  4M42 A;  4BGB A;  5M1F A;  1VHX A;  1CZB A;  1NK7 A;  3D2E B;  1QQM A;  3OYM A;  4DR2 K;  1G15 A;  3VQB A;  4AHR A;  3QO9 A;  3V9Z A;  4RTF D;  3D2F A;  1JLE A;  1YT3 A;  1VQL N;  3ITH A;  3TAF A;  4LD0 A;  4FJN A;  1ASU A;  4I2Q A;  3THX B;  1J53 A;  1WSE A;  3K2P A;  3NDK A;  3L2V A;  1QZ5 A;  3FZM A;  1FW6 A;  1LWE A;  1U45 A;  1MA9 B;  3LM2 A;  2W6K A;  1NKB A;  2XY6 A;  3NH0 A;  4FJ8 A;  1SAZ A;  2FBX A;  5FLX O;  3IKM A;  3QEP A;  2OPQ A;  4CF9 A;  3AVK A;  4AM7 A;  3WQT A;  1YIJ N;  4KI6 A;  1T6C A;  2IVN A;  1B9D A;  3M3Z A;  4B1V A;  2UXD K;  3MWP A;  3D0P A;  4PKI A;  3O1W A;  5KRT A;  1J54 A;  4NLC A;  4CBU A;  4GKJ K;  3DM2 A;  2AP1 A;  3V6D A;  4KAZ A;  3J81 O;  4BE1 A;  2BAN A;  5AQJ A;  1X1P A;  1NGG A;  1U2V B;  2V7Z A;  2YNF A;  4DU3 A;  1S3X A;  3VQA A;  4FJM A;  3DLG A;  3I8D A;  3T1H K;  3G25 A;  4FZZ A;  5AZJ A;  3AA2 A;  1VQM N;  4IG0 A;  3VF6 A;  2F96 A;  4LC9 B;  3EEQ A;  3NAE A;  2KFZ A;  4I9Q A;  5CZ1 A;  3DOK A;  3A5M C;  4KI4 A;  2PYL A;  4UQG A;  4OGC A;  2P5G A;  3M8Q A;  1NGF A;  1KRP A;  4ZHR A;  2BH1 A;  4E89 A;  4XH4 A;  2YI1 A;  1W7A A;  1NMN A;  3J7Y P;  2W42 A;  2NRH A;  2OTL N;  2WON A;  4PHT X;  5KPR A;  4W5Q A;  3ZSW A;  3ZEU B;  3F2K A;  3THX A;  1BQM A;  1RGI A;  4KPY A;  2G8F A;  3B8A X;  2KHO A;  4JI7 K;  4E0D A;  1RDA A;  1JCG A;  1HQE A;  3A2F A;  4CZH A;  3W3D A;  1T03 A;  4YOT A;  3K5M A;  4BR7 A;  1OH5 A;  4OGE A;  3L6Q A;  3ID8 A;  1Z25 A;  3E01 A;  4AHS A;  3E9P A;  5SWM A;  3TAP A;  3VF4 A;  2D0O A;  2F9T A;  3MN7 A;  3U8X A;  2Q0U A;  2IC3 A;  3FE1 A;  3THY A;  1IKX A;  4YOW A;  4DQQ A;  4CJW A;  3CG7 A;  2O8B B;  2HND A;  2OPR A;  3L0Q A;  1GLL O;  3OYE A;  3OBW A;  3CXC M;  3DAW A;  3HVT A;  4FWK A;  4R5P A;  1S72 N;  4CIF A;  1RT5 A;  4KHU A;  4FJH A;  4N47 A;  4NO7 A;  5AQQ A;  2P9P A;  4B9Q A;  4I7F A;  3O9S A;  2P51 A;  4FJJ A;  4DV3 K;  3L8B A;  1WSG A;  1NU0 A;  3AVJ A;  3RMD A;  1XHZ A;  4O8K A;  3J7A P;  3SV3 A;  3AO4 A;  2BGG A;  3DRR A;  1U6Z A;  4EZ6 A;  3LPT A;  1W9H A;  5LMU K;  2NRZ A;  1WN7 A;  4CD1 A;  3OYL A;  1KVB A;  4WF9 L;  4GV3 A;  1BI4 B;  2P9N B;  3GDQ A;  3KLG A;  3OVN A;  4J8F A;  1ATS A;  4Y1D A;  4C8K A;  3CCJ N;  3HTV A;  3LAN A;  4W5T A;  2HMI A;  3SUQ A;  3LZJ A;  4CHY A;  2B5J A;  1RT4 A;  4JRP A;  3K59 A;  2PYJ A;  5BPN A;  4CGI A;  3KK1 A;  4JI3 K;  4JKA A;  3S41 A;  1BU6 O;  4IDH A;  3DYA A;  3VGK A;  2PZS A;  2O8C A;  4KB1 A;  1EXQ A;  3ALY A;  1RFQ A;  1NNE A;  5H1S Q;  3NMU A;  2ASP A;  3KKR A;  4CIG A;  3KK7 A;  2P9S B;  3CQX A;  3L3U A;  1XMO K;  3V9X A;  3FLC O;  3ZX3 A;  3Q7C A;  4BRE A;  4Z0U A;  1KFS A;  1A5X A;  1L3V A;  4GKK K;  4AHT A;  5HOO A;  1RTJ A;  3DLL L;  4BC2 A;  4O55 A;  2Z1H A;  3VEZ A;  4FL9 A;  4LF9 K;  1VSD A;  4H0V B;  1GLJ O;  1Q86 O;  4DFP A;  1RDW X;  3H1Q A;  4CBW A;  1A5W A;  1UA0 A;  3JYT A;  4DSJ A;  5IWA K;  1QE1 A;  4FJX A;  2QKK A;  1N36 K;  3EE8 A;  4EHT A;  3ZX2 A;  3CCR N;  3IFR A;  4WFN L;  2Y1I A;  3GE1 A;  3CFO A;  3VEX A;  5KTQ A;  3VEW A;  1Q81 O;  1HQU A;  4HWI A;  4BRO A;  5EOY A;  1DT9 A;  3JSM A;  3DMJ A;  4E7J A;  3FFK B;  5J2M A;  5JLH A;  5AQT A;  4U7B A;  4B3R K;  1NOY A;  4OJR A;  4NLB A;  3AVH A;  3CJ1 A;  1JL2 A;  1ZBS A;  4CJF A;  1N32 K;  1KD1 O;  5M1O A;  1GLB G;  5AQL A;  1C1A A;  4MLH A;  5TKW A;  1RTD A;  3EL2 A;  1BIZ A;  1EWQ A;  4ISE A;  4YOV A;  1NGB A;  4IO8 A;  5B8H A;  2KW4 A;  3KD5 E;  2UYT A;  2HVH A;  3KLI A;  3NGY A;  1BGX T;  4M41 A;  2VCP A;  3HXM A;  2CGL A;  1LOT B;  3NHG A;  2HHW A;  4JKG A;  2X74 A;  5E84 A;  4XH5 A;  1KCF A;  2ASO A;  4DFM A;  4CEF A;  4FOI A;  2QM1 A;  2FBY A;  4FWR A;  3HRG A;  1FKO A;  1NGC A;  2E6M A;  5CYQ A;  3G10 A;  4O8U A;  2YNG A;  3D6R A;  4O44 A;  4PA1 A;  1P90 A;  4CJR A;  3I33 A;  1G99 A;  2Q36 A;  2ZGY A;  4EFH A;  1MWK A;  3GBT A;  4DQS A;  3LM9 A;  4CGJ A;  3KTQ A;  4M3W A;  1SKW A;  3WXM B;  3O3H A;  5AQU A;  4CZK A;  4ISF A;  4BR9 A;  3AVN A;  3F73 A;  2JWL A;  3TPQ A;  3R1X A;  5AQY A;  1SKR A;  3ULE B;  4IDK A;  3PSI A;  2ITM A;  1BG3 A;  5M1N A;  1WSI A;  3T1Y K;  3R3L A;  3O3G A;  4HVJ A;  1NJX A;  2HOE A;  3UKU B;  4A57 A;  3WNE A;  2XO7 A;  1NJZ A;  3PLA A;  5AQM A;  2DFF A;  3CJA A;  3TR8 A;  3SAH A;  2HBK A;  3E66 A;  4CFD A;  5LJV A;  1QQO A;  3A8Y A;  4H5R A;  2ZWH A;  5KGX A;  3LDS A;  4QS8 A;  3K5L A;  3H08 A;  1BA0 A;  4W5N A;  4KBO A;  5C2F A;  4H5T A;  1KVA A;  3AAR A;  2JLE A;  4BQL A;  4J2B A;  1HNZ K;  2OAN A;  1L5U A;  4E19 A;  5HRO A;  4B9L A;  4L3Q A;  3NFA A;  2ZM6 K;  4M45 A;  4BC5 A;  1Z05 A;  3LWM A;  2GUI A;  5EU7 A;  5KPT A;  4CJS A;  5HRR A;  2YKM A;  4BQZ A;  3HI0 A;  3NGZ A;  3EZW A;  1WSH A;  4B1X B;  1OVQ A;  4DFJ A;  3LL3 A;  3QNO A;  4IEI A;  4CEC A;  4JI8 K;  1BIU A;  1TKZ A;  4CFA A;  1M1K O;  2ZE2 A;  4CEA A;  1VQ8 N;  4DV5 K;  1KTQ A;  1GLD G;  2IIR A;  1QS4 A;  2P9L B;  4M3T A;  1NGA A;  3H3O B;  1QQC A;  4DV7 K;  3THY B;  3OJS A;  4E7K A;  3MED A;  3RVC A;  1VSF A;  1TK8 A;  4DTN A;  2QWP A;  4J2E A;  4FPA A;  4N76 A;  4FVU A;  2RE2 A;  4KTQ A;  3NH2 A;  1XNQ K;  3RR8 A;  1XWL A;  1SL2 A;  4DV1 K;  3H3N O;  3L4I A;  4M3Y A;  3KJV A;  2PY5 A;  1FXX A;  1KSP A;  4Z4G A;  4KB0 A;  1U49 A;  2D5R A;  4IJA A;  4RG8 A;  1VQO N;  3PX6 A;  1GOB A;  1S6P A;  1QZ6 A;  5CZ2 A;  2WUS A;  5KQD A;  3LDQ A;  1JLG A;  3L4Q A;  3M6G A;  4E7L A;  3V4I A;  4BR4 A;  2VWK A;  5KPZ A;  2O4I A;  3QB0 A;  3UB5 A;  4LF5 K;  4E1J A;  1HYS A;  3WXJ A;  1U47 A;  2Z1J A;  5CYM A;  3J80 O;  3HSC A;  2XHB A;  3CI5 A;  1RT1 A;  3C6T A;  1NGJ A;  3C6U A;  4BDP A;  1VSL A;  5FDL A;  3VA3 A;  1HLU A;  3TI0 A;  3QIC A;  1YJ9 N;  3S3M A;  3MCA B;  4A5A A;  1BOT O;  3OTO K;  1WLJ A;  1NK9 A;  3ZSZ A;  2YHY A;  4B3M K;  4N5S A;  3CQY A;  2O8E A;  1VSM A;  3THV A;  1RCH A;  4DTJ A;  3ZLJ A;  4CJQ A;  4X64 K;  2HHX A;  1XQS C;  1U4B A;  3IRX A;  4FK4 A;  4AQY K;  4EP5 A;  1M90 O;  1B92 A;  2UXB K;  5AQI A;  3C65 A;  3OYA A;  4CHP A;  4FW1 A;  3QNN A;  4QS7 A;  2GEL A;  3UIQ A;  4CEO A;  2V52 B;  1CZA N;  3KK2 A;  1WUA A;  3ATV A;  1I94 K;  2O4G A;  3IAY A;  2BTF A;  5LJW A;  4DQR A;  4EAH D;  5AQW A;  4DS4 A;  1R59 O;  4DTP A;  5AR0 A;  3OYF A;  1KAX A;  4CJV A;  4FJ7 A;  2NLX A;  1S22 A;  3SJH A;  3HVR A;  3E9O A;  1HR0 K;  3NF8 A;  2HHT A;  3CJ9 A;  4AF1 A;  2DTU A;  4B1Z A;  1B9F A;  4JLH A;  4OPK A;  3A5L C;  3BZK A;  1QSY A;  4IOA L;  4CJ5 A;  3QIN A;  3D2E A;  4O5F A;  3AAP A;  4W5R A;  4A2B A;  5AFU A;  1D9D A;  4LFA K;  3CIP A;  4CZM A;  3AA4 A;  2WBN A;  4JS4 A;  4Z4E A;  4O0I A;  4DUZ K;  3LAK A;  4Q0B A;  2Q3S A;  2VQF K;  3MX2 A;  2O8F A;  3QFP A;  3UKU A;  2QWL A;  3SBG A;  1YI2 N;  3ZEU A;  2P9I A;  1NM1 A;  3H1V X;  1HUX A;  2FC0 A;  2FBV A;  2DPN A;  1IH7 A;  1QTM A;  3HBT A;  2VWJ A;  4FJG A;  3FZH A;  1RDC A;  2VWB A;  4CZL A;  1VQ4 N;  3V9W A;  3O9T A;  3C0B A;  4RW7 A;  3AVL A;  1SL0 A;  4CZG A;  1SS6 A;  4JHD B;  3NVM A;  2HHU A;  4K43 A;  2D1K A;  2YNH A;  4FWS A;  1N33 K;  4BRH A;  4C1N K;  3DJC A;  1KVC A;  5T7B A;  5GAE P;  3MWT A;  3KWI A;  1X3N A;  3HPO A;  5DK5 A;  2IVP A;  5JMV A;  4H4M A;  4MQ3 A;  4KHN A;  2YNI A;  3SUP A;  1VSI A;  1DTQ A;  4JKH A;  3D45 A;  3IUC A;  5FRO A;  4AH9 A;  5HL7 L;  4OO1 J;  4CCH A;  1XHX A;  3QEX A;  3AO1 A;  3CC4 N;  4KHY A;  3SQ0 A;  1ZBF A;  4DR3 K;  3VMF B;  2Q97 A;  4JKG B;  1EWR A;  5CY4 A;  3TAE A;  4PQU A;  1ATN A;  2HST A;  4H5V A;  2W6L A;  1KAY A;  2WOM A;  4NCG A;  3KHY A;  4IWV A;  3JXU A;  1NK5 A;  1L3U A;  5JS2 A;  2RN2 A;  2F9W A;  5F2R A;  4BRK A;  1MWM A;  2X6N A;  4FLW A;  1OH8 A;  3VF2 A;  3ZT4 A;  2HNY A;  4K25 A;  1TAU A;  5AQZ A;  4CF8 A;  4I6M A;  3RRG A;  2QEX N;  4CFB A;  4FXD A;  3F9K A;  1Y64 A;  3EN9 A;  5GAH P;  1KFD A;  2CGJ A;  4JD2 A;  1WSF A;  1VK0 A;  3S3O A;  1OH7 A;  3NF6 A;  4F9O A;  3VGL A;  5ADX H;  1QHA A;  1GLE G;  2VG5 A;  5KRS A;  4JKC A;  5C15 A;  4DMN A;  4DSE A;  3QBX A;  4CZJ A;  4CJP A;  4ISG A;  2H3G X;  2A6A A;  3HZ6 A;  1HYV A;  4FOE A;  4UY8 O;  1WAF A;  3LDO A;  5M1P A;  4NYN A;  4OVL A;  4PKH A;  4DFK A;  5CHI A;  1EQY A;  5AJ3 K;  1YTU A;  3UKR A;  4FWP A;  5GIP A;  3WUH A;  2HHQ A;  4JI1 K;  4LSN A;  4OPJ A;  1JCE A;  2BE2 A;  1W0H A;  4IOC L;  3HP6 A;  3HPH A;  3SYZ A;  1ZBI A;  3OYI A;  4DU1 A;  4B9U A;  3W0L A;  2J4R A;  2P9S A;  5FRM A;  2G8I A;  4IBN A;  1NLV A;  4H0O A;  5DM6 L;  4QS9 A;  2KTQ A;  4Z4C A;  1C1C A;  4BWJ A;  1J6Z A;  3ENB A;  4OPH A;  1SZ2 A;  3FZK A;  3MXJ A;  3EKU A;  1J9A A;  4M7X A;  2A1S A;  5GAD P;  3JAM O;  3PX4 A;  2ETJ A;  3DLE A;  3HOT A;  4F3O A;  1RT7 A;  1VQ9 N;  4KTZ A;  3L2U A;  4FM0 A;  3VEY A;  1K8K A; 
#chains in the Genus database with same CATH homology
 4L8R B;  1GOA A;  1C1A A;  3M8R A;  3SQ2 A;  3ASM A;  1LW2 A;  1RTD A;  1ZBU A;  2HB5 A;  4IFV A;  1ZBH A;  1BIZ A;  1KLN A;  4CEZ A;  2OPP A;  5HRS A;  3QES A;  4DSK A;  2KW4 A;  1S1T A;  4DTR A;  4EZ9 A;  2P5O A;  4CJE A;  3KD5 E;  2HVH A;  2G8V A;  3KLI A;  4CHO A;  3NGY A;  1HMV A;  1BGX T;  2D0B A;  4M41 A;  3HXM A;  1TV6 A;  4DTS A;  1S5J A;  1SKS A;  4HCB A;  3HK2 A;  4DSI A;  4M3U A;  3NHG A;  2G8W A;  3OYK A;  1QSL A;  3DLH A;  4KRE A;  2HHW A;  5HRP A;  4JS5 A;  4BAC A;  3SNN A;  2X74 A;  1RBR A;  4B08 A;  1S1V A;  1KCF A;  3LWL A;  3LP0 A;  4BDY A;  4DFM A;  4FK0 A;  4DTO A;  4KHQ A;  1HPZ A;  4CEF A;  3SPZ A;  4DLE A;  3PV8 A;  2FBY A;  1N5Y A;  3VQ5 A;  4E7H A;  2BDP A;  1FKO A;  1RT6 A;  3ZSV A;  2E6M A;  5CYQ A;  1RTI A;  5HBM A;  1RDB A;  3G10 A;  3V9U A;  3RMC A;  3OYB A;  3LP1 A;  2YNG A;  1RNH A;  1EX4 A;  3G0Z A;  1REV A;  2Z1I A;  4CF1 A;  1D9F A;  2D0C A;  4O44 A;  4PA1 A;  3V81 A;  3WNH A;  4CJR A;  3T19 A;  2GBZ A;  4RW6 A;  2IS3 A;  3SUO A;  5HLF A;  4FM1 A;  3PO4 A;  3HO1 A;  4Z4F A;  5C24 A;  3V9S A;  3BDP A;  1NJW A;  3OYH A;  4I2P A;  4NCA A;  4G1Q A;  1D8Y A;  3SQ1 A;  4DQS A;  2KZZ A;  4CGJ A;  3HST B;  3KTQ A;  2OPS A;  3RWU A;  4M3R A;  4WE1 A;  3VQ6 A;  4HUE A;  1BCM A;  1SKW A;  4M3W A;  1I3A A;  1UWB A;  5DMR A;  4J2D A;  3O3H A;  5I3U A;  4OKE A;  4M3X A;  1S1W A;  1X9S A;  1NKC A;  3AVN A;  3L3V A;  3QIO A;  3F73 A;  3M8P A;  4CIE A;  1IO2 A;  1RDD A;  1VSE A;  3QET A;  1TGO A;  3KKS A;  4CJ4 A;  3L2Q A;  1JKH A;  1JXE A;  4HUF A;  4DTX A;  2NUB A;  4CFC A;  4IDK A;  1SL1 A;  1T7P A;  1SV5 A;  3I0R A;  3CM6 A;  1NK6 A;  1TVR A;  1TL3 A;  1WSI A;  3V1Q A;  3OS0 A;  3NF7 A;  2R7Y A;  1DLO A;  2ZD1 A;  3O3G A;  1HYZ A;  5KGW A;  4F2S A;  4HVJ A;  4RW4 A;  1NJX A;  4DTM A;  3ULD A;  1Q9Y A;  2YV0 X;  3ZT0 A;  3MEG A;  1UOC A;  3AA3 A;  1EET A;  3WNE A;  4CF0 A;  4EP4 A;  2XO7 A;  1NJZ A;  4FJ9 A;  4E7I A;  1LV5 A;  3HJF A;  3B6O A;  5J2Q A;  1R0A A;  4FLU A;  1WAJ A;  3ZSR A;  3L2R A;  1LWF A;  2DFF A;  3BGR A;  3TR8 A;  2HVI A;  1Q8I A;  4CEQ A;  1IKW A;  4CFD A;  4GMJ B;  4LY7 A;  3VQC A;  3LDS A;  4KTW A;  5KGX A;  3S9H A;  3HT3 A;  3K5L A;  4FCY A;  3H08 A;  3VQD A;  1T05 A;  3VQ8 A;  3K57 A;  3AA5 X;  4LH4 A;  4W5N A;  4CJU A;  2RPI A;  1KVA A;  2JLE A;  3O4N A;  3RTV A;  3RR7 A;  2IDO A;  2A1R A;  1Y97 A;  3VQ9 A;  4J2B A;  4ICL A;  1L5U A;  2EX3 A;  4E19 A;  5HRO A;  4B9L A;  4CJ3 A;  3NFA A;  1NK0 A;  4M45 A;  3DRP A;  4C8N A;  3ZSQ A;  3LWM A;  3SI6 A;  3DOL A;  2KFN A;  4AIL C;  1TKT A;  3SPY A;  2GUI A;  5EU7 A;  4B9S A;  3K5O A;  4CJS A;  4B8A B;  4AHU A;  5HRR A;  2YKM A;  3C94 A;  4Z4H A;  3NGZ A;  2P1J A;  4FM2 A;  2F8T A;  4LSL A;  4CEB A;  1WSH A;  4CGG A;  4RW8 A;  4DFJ A;  3T3F A;  3EYZ A;  1HNI A;  4CEE A;  3QNO A;  4CK1 A;  1C0U A;  4CEC A;  1XI1 A;  3LP3 A;  2B6A A;  4FJ5 A;  4J2A A;  2QK9 A;  2DY4 A;  1BIU A;  1DTT A;  1TKZ A;  4CFA A;  1BQN A;  1Z26 A;  2FBT A;  2Z1G A;  2ZE2 A;  4CEA A;  2GV9 A;  1KTQ A;  3S3N A;  4DSL A;  3QLH A;  3AO2 A;  1QS4 A;  3ZSX A;  4M3T A;  4KHW A;  3SUN A;  3VQ4 A;  3KK3 A;  4C8O A;  3NF9 A;  1QQC A;  4CJT A;  4K8X A;  3MEE A;  4I9L A;  1JLF A;  4DWI A;  3OJS A;  3NCI A;  1J5O A;  3CYM A;  4FYD A;  4GVM A;  4CED A;  1VSJ A;  4E7K A;  5I42 A;  2X6S A;  3MED A;  3RMB A;  1VSF A;  4LH5 A;  4DTN A;  1TK8 A;  4J2E A;  2F8S A;  3MAQ A;  4N76 A;  1F21 A;  4M42 A;  3U6F A;  3NH2 A;  4KTQ A;  3RR8 A;  1XWL A;  1SL2 A;  3VQE A;  1HNV A;  2YKN A;  1CZB A;  4M3Y A;  3OY9 A;  3KJV A;  4DS5 A;  1WSJ A;  1NK7 A;  3OYM A;  3TWH A;  2PY5 A;  1FXX A;  1KSP A;  1G15 A;  1HRH A;  4H4O A;  4C8M A;  4BE2 A;  1ZBL A;  1NK4 A;  4W5O A;  4Z4G A;  3VQB A;  4AHR A;  1CLQ A;  4KB0 A;  3QO9 A;  1U49 A;  1ASW A;  3TAR A;  2D5R A;  4E1M A;  2XY5 A;  4RG8 A;  4FZX C;  3I0S A;  3PX6 A;  5D3G A;  1SKR A;  3V9Z A;  1GOB A;  1S6P A;  5CZ2 A;  3SZ2 A;  1JLE A;  3HM9 A;  1YT3 A;  3ITH A;  1JLG A;  3TAF A;  4LD0 A;  4E7L A;  1X9W A;  4PY5 A;  2AJQ A;  4FK2 A;  4FJN A;  1ASU A;  3V4I A;  4F8R A;  3AVA A;  4I2Q A;  2EHG A;  5K14 A;  1D5A A;  2HNZ A;  2VWK A;  4KFB A;  2O4I A;  1C0M A;  1J53 A;  1WSE A;  3K2P A;  1RTH A;  3L2V A;  3NDK A;  3OJU A;  4N56 A;  1RBV A;  1FK9 A;  1HYS A;  1LWE A;  4CK2 A;  1VSH A;  3MXI A;  1U45 A;  1U47 A;  2Z1J A;  5CYM A;  3VQQ A;  2XHB A;  1RBS A;  1NKB A;  2OZS A;  1RT1 A;  3C6T A;  4CER A;  2XY6 A;  1N6Q A;  3AV9 A;  3TAB A;  3NH0 A;  3QEV A;  1TL1 A;  3M8S A;  4FJ8 A;  2FBX A;  3C6U A;  4TSX A;  3QEP A;  1VSL A;  4BDP A;  5FDL A;  2VG6 A;  2OPQ A;  4FLX A;  4CF9 A;  3NBP A;  3AVK A;  1NK8 A;  3VA3 A;  4KI6 A;  3ZSY A;  3SCX A;  3TI0 A;  1B9D A;  3S3M A;  2ITG A;  1RT3 A;  3D0P A;  1VRT A;  3NH1 A;  3K5N A;  5KRT A;  3SJJ A;  1J54 A;  1WLJ A;  1NK9 A;  1C0T A;  3IG1 A;  3ZSZ A;  3NE6 A;  1NOZ A;  4PWD A;  4H8K A;  3CFR A;  1RBT A;  3DM2 A;  4N5S A;  5J2N A;  3V6D A;  4KAZ A;  1CZ9 A;  4BE1 A;  2BAN A;  3DLR A;  1X1P A;  1VSM A;  3KLF A;  3THV A;  1RCH A;  4DTJ A;  4B9V A;  4CJQ A;  5E41 A;  4IKF A;  2HHX A;  2YNF A;  3HPG A;  1U4B A;  3IRX A;  4DU3 A;  4YFU A;  4FK4 A;  3AVG A;  1BCO A;  4EP5 A;  1RBU A;  3ZT2 A;  3VQA A;  1B92 A;  3DLG A;  5SZT A;  3O3F A;  3I8D A;  3RMA A;  4FJM A;  4DQI A;  4FZZ A;  4XIU A;  3OYA A;  4CHP A;  1ASV A;  4FW1 A;  3QNN A;  1MU2 A;  3AA2 A;  3UIQ A;  4KO0 A;  4CEO A;  4FW2 A;  2ZQB A;  4ID1 A;  4IG0 A;  3KK2 A;  4FJI A;  4HTU A;  2F96 A;  3K58 A;  1JLQ A;  3NAE A;  2O4G A;  3IAY A;  2KFZ A;  3PO5 A;  4DQP A;  3EY1 A;  4DQR A;  4I9Q A;  3V1R A;  2DFH A;  5CZ1 A;  3DOK A;  4DS4 A;  1RIL A;  4DTP A;  1S9G A;  1VSK A;  4ELV A;  4CGD A;  4DU4 A;  3TAQ A;  4KI4 A;  3OYF A;  2PYL A;  4HUG A;  1JLB A;  4UQG A;  4CJV A;  4DSF A;  4OGC A;  2G8U A;  2P5G A;  4FJ7 A;  5C25 A;  3M8Q A;  3C95 A;  4FJK A;  3ZSO A;  3LAM A;  3HL8 A;  3DLK A;  1KRP A;  3HVR A;  4KRF A;  4BE0 A;  4O0J A;  4ZHR A;  4E89 A;  5J1E A;  3OYC A;  3NF8 A;  2HHT A;  2DTU A;  2JGU A;  1X9M A;  2OZM A;  1B9F A;  4DG1 A;  4JLH A;  3B6P A;  4OKJ A;  1UA1 A;  4OPK A;  4GW6 A;  1TK5 A;  1QSY A;  2QKB A;  4CJ5 A;  3OYN A;  1S9E A;  3QIN A;  3CM5 A;  2W42 A;  4RW9 A;  1WNS A;  4DF8 A;  1CXQ A;  4W5R A;  3OS2 A;  1IG9 A;  3L2W A;  4AHV A;  2HHV A;  2WON A;  1A5V A;  4W5Q A;  2G8K A;  1TAQ A;  3ZSW A;  4CJL A;  1D9D A;  3DLB A;  1BQM A;  3QER A;  3P1G A;  1S1X A;  1LAV A;  3AA4 A;  3PX0 A;  4FLY A;  4KPY A;  2G8F A;  3DRS A;  3CFP A;  1VRU A;  4JS4 A;  1RDA A;  4CK3 A;  4Z4E A;  4O0I A;  1C1B A;  2YHB A;  3TAM A;  3LAK A;  4Q0B A;  1HQE A;  2Q3S A;  1S1U A;  3A2F A;  1T03 A;  4E3S A;  3K5M A;  3AVF A;  4OGE A;  1LW0 A;  3OYG A;  3LP2 A;  1TK0 A;  3IS9 A;  1Z25 A;  3E01 A;  4AHS A;  1BHL A;  4B9N A;  4ELT A;  1JLA A;  3O4Q A;  3ZT1 A;  3KLE A;  1IKY A;  4QCL A;  5SWM A;  2OA8 A;  3TAP A;  3LAL A;  4FVM A;  1S6Q A;  2FC0 A;  4QAG A;  4CHQ A;  5HP1 A;  4ZTJ A;  2FBV A;  5C42 A;  3KIO A;  1IH7 A;  1QTM A;  2IC3 A;  4CE9 A;  3LPU A;  4KV8 A;  3P5J A;  4CHZ A;  2VWJ A;  1IKX A;  1RDC A;  1Q9X A;  3AO3 A;  4B9M A;  4FJG A;  5KI6 A;  4DQQ A;  4CJW A;  1U04 A;  3CG7 A;  3V9W A;  3WNF A;  4NCB A;  2HND A;  2OPR A;  4N41 A;  4RW7 A;  3AVL A;  1SL0 A;  4F2R A;  4CF2 A;  3AVM A;  3OYE A;  2RF2 A;  2HHU A;  4CJK A;  3HVT A;  4R5P A;  3SQ4 A;  1XC9 A;  2YNH A;  3OS1 A;  2ATQ A;  4CIF A;  4DLG A;  1RT5 A;  4KHU A;  2KQ2 A;  4M3Z A;  1KVC A;  4N47 A;  5T7B A;  2D0A A;  1O1W A;  4FJH A;  4I7F A;  2P51 A;  3KD1 E;  2XY7 A;  4FJJ A;  1LWC A;  3HPO A;  5DK5 A;  1GOC A;  4KKO A;  4Z4I A;  4H4M A;  4MQ3 A;  4KHN A;  3L8B A;  1WSG A;  4FLT A;  2YNI A;  3SUP A;  1VSI A;  3TAG A;  3AVJ A;  3RMD A;  1XHZ A;  1DTQ A;  3D45 A;  5FRO A;  4AH9 A;  4CCH A;  1SUQ A;  1XHX A;  3QEX A;  3AO1 A;  3QIP A;  2RKI A;  3SV3 A;  3AO4 A;  4KHY A;  2BGG A;  4F3T A;  3SQ0 A;  1L3T A;  1ZBF A;  3AO5 A;  3DRR A;  3V1O A;  4YNQ A;  1YVU A;  2I5J A;  4BWM A;  3LPT A;  4EZ6 A;  3HP9 A;  3QEI A;  1W9H A;  3ISN C;  1LAW A;  5HRN A;  5CY4 A;  4BDZ A;  5J2P A;  3TAE A;  1BI4 A;  4PQU A;  1WN7 A;  3OYL A;  1KVB A;  1NJY A;  1K6Y A;  1BI4 B;  3FFI A;  1RT2 A;  5FRN A;  1T8E A;  2QXF A;  1NKE A;  2WOM A;  4NCG A;  3OVN A;  3ZT3 A;  3KLG A;  1QSS A;  4C8L A;  1C6V A;  4Y1D A;  1TKX A;  2YHA A;  4C8K A;  4K8Z A;  3VA0 A;  3U3Y A;  1NK5 A;  4B9T A;  3AVI A;  1L3U A;  4Y1C A;  5JS2 A;  2RN2 A;  2IOC A;  3LAN A;  4W5T A;  1QHT A;  4CGF A;  2HMI A;  2X6N A;  3SUQ A;  4FLW A;  3LZJ A;  4CHY A;  2B5J A;  1CXU A;  1RT4 A;  4JRP A;  3MXM A;  4B3O A;  3KLH A;  4KHS A;  3K59 A;  3ZT4 A;  2HNY A;  2PYJ A;  4FZY A;  1TAU A;  1IKV A;  4CF8 A;  2DFE A;  1ITG A;  3QEW A;  2LSN A;  3RRG A;  1I39 A;  3DI6 A;  4O5B A;  3F9K A;  4CFB A;  4FXD A;  4CGI A;  4O4G A;  2IAJ A;  3KK1 A;  3SV4 A;  1KFD A;  4IFY A;  3VN5 A;  3DYA A;  1WSF A;  1VK0 A;  3S3O A;  3WNG A;  2PZS A;  4KB1 A;  4FJL A;  1EXQ A;  3NF6 A;  3ALY A;  4E1N A;  2OYQ A;  3KKR A;  4MFB A;  4CIG A;  2E6L A;  4FLZ A;  2VG5 A;  3AVB A;  5KRS A;  3L3U A;  1ZYQ A;  3V9X A;  1YTA A;  4DMN A;  3OYD A;  1EP4 A;  4Z0U A;  4JRQ A;  3LZI A;  4DSE A;  4CJP A;  1KFS A;  1A5X A;  1L3V A;  3P83 D;  4AHT A;  1HYV A;  1WAF A;  3VQ7 A;  1RTJ A;  4NYN A;  2G8H A;  4O55 A;  2Z1H A;  4B8C A;  4OLA A;  2HW3 A;  4OVL A;  1UAX A;  4DF4 A;  1VSD A;  4DFK A;  3EZ5 A;  1YTU A;  3VQP A;  4AHC A;  4PUO A;  3TAN A;  4IG3 A;  4DFP A;  2HHQ A;  4LSN A;  4ELU A;  1A5W A;  1UA0 A;  4OPJ A;  3U3G A;  3JYT A;  2BE2 A;  2XRI A;  1W0H A;  4DSJ A;  1QE1 A;  1HJR A;  4FJX A;  2QKK A;  3HP6 A;  3HPH A;  1JLC A;  3SYZ A;  2Y1J A;  4HCC A;  1ZBI A;  1BL3 A;  3OYI A;  4DU1 A;  1TKD A;  2X78 A;  4B9U A;  4ID5 A;  3ZCM A;  2Y1I A;  3CFO A;  5FRM A;  1JL1 A;  1EKE A;  5KTQ A;  3AVC A;  2G8I A;  1BIS A;  4IBN A;  1HQU A;  4QOZ B;  4CES A;  4NYF A;  3RRH A;  4OKK A;  2KTQ A;  5JS1 A;  1JXB A;  4Z4C A;  3PY8 A;  1C1C A;  3HYF A;  4CHN A;  2KZM A;  4BWJ A;  3T1A A;  3JSM A;  3DMJ A;  4E7J A;  4F4K A;  2HHS A;  1KLM A;  4Q5V A;  5J2M A;  3MXJ A;  3PUF A;  3CQ8 A;  3OYJ A;  1J9A A;  3NGI A;  2A1S A;  4ZTF A;  3PX4 A;  2E4L A;  2ETJ A;  1NOY A;  4OJR A;  2IGI A;  3DLE A;  4CGH A;  4FLV A;  3AVH A;  4OLB A;  4HHT A;  1JL2 A;  4F3O A;  1RT7 A;  1L3S A;  2XY8 A;  4CJF A;  4DTU A;  2VG7 A;  1FKP A;  2B4J A;  4KTZ A;  3L2U A;  4FM0 A;  1U48 A;  4E0D A;  3MEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...