3AVFA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avfA00
4KO0A 4PA1A 4CJSA 4OKKA 4HUFA 4RW7A 4EP4A 4DS4A 4LH5A 2E6LA 4AHCA 4CF8A 4ZTFA 4M41A 1WAFA 3L3UA 1BL3A 2YKNA 4CJTA 3SQ0A 1TKTA 4WE1A 3T19A 4AHRA 1SL2A 1S9EA 3SPZA 1RTHA 4Y1CA 2YHAA 4NCAA 2RN2A 1J53A 1ZBFA 1NK9A 1I39A 2OPSA 2O4GA 4J2DA 1GOCA 3V9ZA 3L2QA 3TI0A 3MAQA 4FJKA 3CFRA 1DLOA 1L3TA 1ZBIA 2HNZA 2HHWA 2ATQA 3SUOA 4B9NA 3L8BA 3O3GA 1NKBA 3LPTA 2OA8A 3DOLA 3LP1A 4FLZA 1FKPA 3QEIA 3TABA 4E0DA 4KHWA 4JLHA 3VQ4A 4KHYA 1XHZA 1NKEA 4ID1A 1RBVA 2Y1JA 4C8LA 1S1UA 2HB5A 4DTOA 3I0RA 4DF4A 1NJZA 3V6DA 1RBRA 3QINA 1C1BA 3ZSOA 2GUIA 3S3MA 1LWEA 5CYMA 4CJEA 4CJRA 4IBNA 5JS2A 4DTMA 4M3RA 2XY7A 4KAZA 4FJ5A 3RR8A 2BANA 4C8OA 3D0PA 4IFYA 3NF9A 4CGDA 3HK2A 3EY1A 5HBMA 4FLXA 4CGJA 4JS4A 4DFMA 1R0AA 4DG1A 5DK5A 1KCFA 2X74A 4IG3A 4O5BA 3VQAA 3PX6A 1XC9A 4FLWA 1JLQA 1VRUA 2G8WA 3M8QA 1HYVA 4FLTA 1KTQA 2VG5A 1SV5A 1RBSA 1S1XA 4CESA 3QEVA 2D0BA 1SKWA 1L3SA 4KI4A 5CYQA 4FCYA 4M3XA 3D45A 3SQ4A 3S3OA 1J5OA 4KFBA 1WSEA 3ZSZA 4OLAA 3K58A 1RDDA 4FW1A 4KHUA 2W42A 3CM6A 3MXIA 3WNGA 3ZSWA 1S5JA 4CFCA 2B6AA 2GV9A 3QIOA 3AVCA 3KLIA 4LD0A 4CECA 4FLVA 1BI4B 4KKOA 4R5PA 3ASMA 4I9QA 1WNSA 4N76A 4CJFA 2F96A 4IG0A 1U04A 3IAYA 3OJSA 2OZSA 3QLHA 3KLGA 1C0MA 1HNIA 1TL3A 4O44A 4OJRA 5HLFA 1W9HA 4CGFA 4CJUA 4E7KA 4F4KA 2A1RA 2PYLA 4F2SA 1HYSA 1KLNA 4ID5A 3SCXA 3CYMA 3DI6A 3OYCA 4DQQA 1TK5A 3PUFA 3TANA 3I0SA 4B9SA 3OYBA 3AVBA 2Q3SA 4E7IA 5CZ2A 3DRPA 3O3HA 1X9MA 1JLAA 4CJ3A 3SV4A 4CJQA 2G8UA 1QHTA 4I9LA 4O55A 5HRNA 3WNFA 1C6VA 4ELUA 1BIZA 1WSJA 1WSIA 2P51A 5KRTA 4DTNA 4KB0A 3L2UA 2D0CA 4TSXA 1SKSA 4DFJA 1RT5A 1JXEA 1RNHA 2XRIA 4CE9A 4CIGA 3P83D 4CJWA 2KZZA 4KRFA 5FDLA 4CFDA 1WN7A 3TAQA 3IG1A 3DLBA 3ZT4A 4PY5A 1IG9A 3QNNA 3OYIA 4Q5VA 1HJRA 4B9LA 1HQEA 3LWLA 5K14A 3MXJA 2IOCA 4OGEA 3LPUA 3K5MA 4DSKA 4IDKA 1ZYQA 4CEBA 4DSFA 1U48A 1RCHA 1DTTA 3G10A 3HVTA 3O4QA 4ICLA 3KLHA 1N5YA 3AO5A 2PY5A 4CHOA 4OPKA 3NAEA 5J2PA 1D9FA 3AVFA 3V1RA 4GVMA 5KGWA 4M3YA 1NKCA 1LV5A 1UOCA 2IAJA 3PV8A 1VSDA 4CFBA 3CQ8A 3QNOA 2ZQBA 1TKDA 2VWJA 2ITGA 3OS0A 4DSEA 1B9DA 4E89A 2RPIA 1SL1A 3AO4A 3WNEA 3ZSQA 1X1PA 3NGZA 1UWBA 4CGHA 1KVBA 2ZE2A 3U6FA 1BCMA 3OYKA 3DMJA 4GMJB 4CEZA 3LZJA 1DTQA 2HHQA 3SYZA 4B8CA 3HL8A 3NE6A 4JRPA 4M42A 4C8MA 4L8RB 4BWMA 4Z0UA 1XI1A 4FZXC 4RG8A 2EHGA 5C42A 3PX4A 3ULDA 1CZ9A 4DFKA 4DU4A 3RR7A 1TKXA 2EX3A 4PWDA 2QKBA 2HNYA 3NH2A 3RMAA 3CFPA 3AVLA 5SZTA 4DF8A 3OYAA 1FKOA 5I3UA 4DTSA 4FK2A 3KKSA 4EZ6A 3LP3A 1EXQA 5HRRA 1L5UA 3QIPA 4CK3A 4CHZA 3B6PA 3BGRA 3TAGA 1JL1A 1KVAA 2VG7A 4Z4GA 1IKVA 2AJQA 2PYJA 1O1WA 3HP6A 1TAQA 4HCCA 1YVUA 3VQ9A 3OYLA 3SQ2A 2OYQA 1ZBLA 3T1AA 1BIUA 1C0TA 1J54A 1S9GA 3MECA 3NF8A 3V9XA 2HHTA 3V9SA 1REVA 5DMRA 4B9TA 2XY6A 3AO2A 3KLFA 4DQIA 3SUPA 2X6NA 3HXMA 4OKJA 2PZSA 3KD5E 1LAVA 1IH7A 3RMBA 3UIQA 2BE2A 4FW2A 2BGGA 4Q0BA 2QXFA 3AA5X 4XIUA 4CEAA 4KHSA 4DTJA 3V9UA 1IKYA 5CZ1A 1RT7A 1TK8A 3DLEA 2IC3A 1NK0A 4NCGA 1BQNA 4DQSA 3KD1E 4J2AA 4EP5A 4N47A 1RT3A 3LANA 4DU3A 3CFOA 2KQ2A 1LW0A 3HPOA 2LSNA 4CK2A 3QEPA 1N6QA 3SJJA 4F3OA 5FROA 3VQDA 3M8SA 3ZT3A 1YT3A 2B5JA 3OS1A 2XY5A 4KHNA 3AA4A 2XY8A 3RTVA 4G1QA 4H4OA 1SKRA 1QS4A 2IGIA 1Z26A 1B9FA 3ZSYA 5KGXA 1L3UA 2P5OA 2X78A 3M8PA 2BDPA 1YTUA 1VSIA 1VRTA 2YHBA 3L2RA 1T03A 4CCHA 4B3OA 5FRMA 1JXBA 1RTJA 4DTPA 4KB1A 4E1NA 3K5LA 3NHGA 4FM1A 4RW9A 1NK6A 1Y97A 4C8NA 1VSMA 3P1GA 4CJLA 4KTQA 2Z1GA 1XHXA 4AHTA 3HYFA 1D9DA 1ZBHA 2YNHA 4RW4A 1BHLA 2OPPA 1TVRA 1D5AA 4LH4A 4NYNA 4ELVA 5HP1A 2RF2A 4HUGA 2ETJA 1KFSA 2DFHA 1NK5A 4FLUA 3V81A 4DSLA 3O3FA 2G8HA 1FK9A 2FBXA 2HVIA 1MU2A 3JYTA 4H4MA 4CJKA 3SPYA 4FJ7A 2F8TA 1HQUA 2ZD1A 1I3AA 4M45A 3OYJA 2GBZA 4CF1A 5I42A 1L3VA 1LWCA 2HW3A 3DLGA 4CFAA 4DSJA 1NK8A 3KK1A 1ITGA 2KW4A 5EU7A 4RW8A 3CG7A 4FVMA 4MQ3A 1Q9XA 3BDPA 3OVNA 1BI4A 3NH0A 3U3GA 1YTAA 4Z4CA 3HM9A 4KTZA 3HSTB 1UA1A 4BE1A 1JLBA 1U4BA 1RBUA 4ZHRA 3K2PA 2KZMA 1RDCA 4AHVA 2HHUA 2OPRA 2VG6A 3F73A 3LALA 3QERA 1ASWA 3VQQA 3KK3A 1NJXA 1JL2A 2Z1HA 3SI6A 4CHPA 3TAPA 1UA0A 4CJVA 2YNIA 1QTMA 4DFPA 4B9VA 3AVHA 3K57A 4NYFA 2Y1IA 3VA0A 3RMDA 4FK0A 4M3ZA 4DLEA 4F3TA 4CF0A 2E6MA 4AHSA 4E7JA 1CLQA 2HNDA 2D5RA 3QEWA 2DFFA 2YNFA 4M3TA 3C6UA 4BWJA 3S3NA 1Q8IA 4B8AB 1KRPA 3VQ8A 4NCBA 4OVLA 3OJUA 1WLJA 1QSLA 4F2RA 5SWMA 2RKIA 3HP9A 4E1MA 4Z4HA 1ZBUA 3AO3A 5C24A 3V1OA 2QK9A 1VSEA 3LAMA 4CGGA 4FJXA 1S6QA 4IKFA 4DTXA 1RT6A 3SNNA 5JS1A 2DTUA 1KLMA 2VWKA 1RT4A 1HYZA 3F9KA 2FBVA 4DTRA 4OKEA 3TAMA 1RBTA 1VK0A 3THVA 4KI6A 4CF2A 4CK1A 1TK0A 4W5RA 4FJ9A 2YV0X 1G15A 1VSKA 3M8RA 4W5QA 5J2QA 4DQRA 3L2WA 4DS5A 1NJYA 2HHXA 1CXQA 4FJHA 1F21A 4CERA 3SZ2A 3VQEA 3VA3A 2DY4A 3O4NA 3DYAA 3TWHA 5E41A 5FRNA 1EP4A 1D8YA 5CY4A 3G0ZA 1VSLA 2YKMA 3AVAA 3RRGA 4BE0A 1C0UA 4N56A 2G8IA 3AA2A 4K8ZA 1JLCA 2JGUA 3VQ5A 4AH9A 1T05A 4RW6A 3VN5A 1JLFA 4FLYA 3FFIA 3QETA 3V4IA 1U47A 4KPYA 1GOAA 4DTUA 4ELTA 3K5OA 3C6TA 2OPQA 3LZIA 4N5SA 4KTWA 1HNVA 1KSPA 4CF9A 1T7PA 1U49A 3RWUA 4J2EA 4FM2A 2Z1IA 5HRSA 5HROA 3KLEA 3LDSA 3ZT2A 1IO2A 1EETA 3OYGA 4HCBA 3VQBA 3WNHA 3LWMA 4B9MA 2IDOA 3OS2A 3VQCA 3C94A 1A5WA 4I2PA 1NOYA 3DRSA 3IS9A 2O4IA 1JLGA 2KFNA 1HRHA 3NF6A 3OYMA 1Q9YA 3QO9A 3SUQA 2WOMA 4Z4FA 3OYEA 4CEFA 3OYHA 3DLHA 3AVIA 3NCIA 4FJMA 2HHSA 3EZ5A 1BCOA 1KFDA 3MEEA 1CZBA 1TL1A 4Y1DA 3AVJA 4O0JA 3MEGA 2FBYA 3DRRA 4O0IA 3CM5A 3IRXA 4JS5A 3QEXA 4CHYA 3KKRA 2WONA 1RILA 1C1AA 4EZ9A 4QOZB 1S6PA 4OGCA 4FXDA 3ZT0A 1EKEA 2OZMA 3TARA 4OLBA 3PO5A 5J2NA 1TGOA 1TKZA 3NGYA 1EX4A 4FJLA 4M3WA 1ASUA 4M3UA 4UQGA 3LAKA 1WSFA 2P1JA 4CJPA 1CXUA 4E19A 2G8FA 1QQCA 2DFEA 3PO4A 2HHVA 3A2FA 3I8DA 1A5XA 4Z4IA 1J9AA 1IKXA 4AILC 1S1WA 3HJFA 4DU1A 4QAGA 4CGIA 4HVJA 3OYFA 3S9HA 4CEEA 1RT2A 2G8KA 4KV8A 3HPHA 4CIFA 1QE1A 4B9UA 4JRQA 1JKHA 1S1TA 3ALYA 5J2MA 4AHUA 5KRSA 3EYZA 4E7HA 3NBPA 4E7LA 3QESA 3AVKA 1TV6A 2NUBA 3HT3A 1ASVA 4CHQA 1NK7A 1NOZA 1WAJA 3ZSRA 3JSMA 3SQ1A 3AO1A 3TR8A 1NJWA 2F8SA 1FXXA 2E4LA 1IKWA 4I2QA 3LP2A 4CEQA 4YFUA 4W5NA 2XHBA 3ZCMA 5D3GA 4FYDA 5HRPA 1VSJA 3AVMA 3MEDA 4FK4A 2FBTA 4BDPA 3AVNA 3T3FA 3NH1A 1HMVA 3PX0A 3KTQA 3TAEA 3PY8A 1GOBA 3DM2A 4GW6A 4K8XA 1VSHA 3VQ7A 3ZT1A 4I7FA 4FJNA 3DOKA 3E01A 1A5VA 3OY9A 4DSIA 1U45A 1WSGA 1BQMA 4C8KA 3RMCA 4F8RA 5J1EA 2KTQA 3ZSVA 3NDKA 1LWFA 2X6SA 1RDAA 4N41A 4YNQA 4LSLA 1LW2A 3NFAA 1RT1A 3HVRA 3OYDA 4E3SA 1X9WA 1XWLA 4CHNA 1SUQA 4IFVA 3HPGA 3VQPA 3KK2A 4FM0A 3U3YA 4FZYA 2QKKA 4H8KA 1B92A 4FZZA 4KREA 2I5JA 4W5OA 2KFZA 3L2VA 1BGXT 1HPZA 1LAWA 3KJVA 3SUNA 3C95A 4DMNA 4HHTA 3MXMA 1C1CA 4CEOA 2A1SA 4BE2A 4Z4EA 3AV9A 1SL0A 5T7BA 2FC0A 3P5JA 4BACA 1NK4A 1W0HA 1K6YA 1T8EA 4J2BA 3K59A 2JLEA 3V1QA 2IS3A 3NGIA 4OPJA 4MFBA 5KTQA 3LP0A 4BDZA 4CJ4A 4DLGA 3KIOA 2P5GA 1BISA 3ZSXA 4FJGA 4FJJA 3TAFA 3AVGA 1RDBA 3ITHA 3DLRA 4BDYA 3HO1A 1S1VA 1RTDA 2HMIA 3L3VA 2G8VA 3VQ6A 1JLEA 1VSFA 4FJIA 1KVCA 3B6OA 1X9SA 4PQUA 4ZTJA 1WSHA 5KI6A 3DLKA 2R7YA 2YNGA 3V9WA 1TAUA 4B08A 4FJ8A 2B4JA 2D0AA 3AA3A 1RTIA 2Z1JA 5C25A 2XO7A 4PUOA 3SV3A 4CJ5A 4KHQA 2HVHA 4HUEA 1Z25A 3OYNA 1UAXA 4LY7A 3RRHA 4HTUA 4CEDA 3H08A 3ISNC 4LSNA 4CIEA 4W5TA 4DWIA 3NF7A 4O4GA 4QCLA 3K5NA 1QSSA 1QSYA 4DQPA
chains in the Genus database with same CATH superfamily
4JI7K 4DS4A 4EP4A 1VQ5N 2F9TA 4AHCA 4ZTFA 2O8CB 4WE1A 2NZTA 4B1UB 5AQXA 4DR4K 2YHAA 1I39A 2OPSA 2O4GA 3RSEB 3SBTA 1DLOA 2ATQA 4MLHA 3SUOA 1NKBA 3LPTA 3HRGA 3DOLA 1EO1A 3LP1A 4BR9A 2QWOA 3J7AP 3TABA 1N36K 4JLHA 3VQ4A 5AQTA 3U8XA 3ZX0A 4DTOA 1W7AA 3T7ZA 2YCHA 3MN6A 1C1BA 4JKAA 5KPRA 3G4SN 3S3MA 3H1QA 4IZ9A 5CYMA 4CJEA 5AQOA 4CJRA 3ZETB 2BANA 4GV6A 4IFYA 1IBMK 4FLXA 4DR5K 5KPZA 2NRRA 4CGJA 1OH7A 1VRUA 3M1FA 4I6MB 4FLTA 1L3SA 3KVGA 1HR0K 1QQNA 4FCYA 3S3OA 2DPNA 4KFBA 1WSEA 3MX5A 4K41A 1BUPA 3CM6A 3U9ZA 4FWPA 3ZSWA 4DR7K 4CFCA 2GV9A 3KLIA 4CECA 4FLVA 1YIJN 1WNSA 2F96A 4IG0A 1GLDG 3QLHA 3ID6A 1TL3A 4O44A 5HLFA 1W9HA 4CGFA 3S41A 4F2SA 1KLNA 4ID5A 3SCXA 3CYMA 3DI6A 4DQQA 5EY4A 3THWA 4BR4A 3QBXA 5CZ2A 1X9MA 4CJ3A 3WXKA 3FFKB 4I9LA 1C6VA 1BIZA 1WSJA 5CE3A 2D0CA 4TSXA 1RNHA 4CIGA 5M1OA 2YX6A 5FDLA 3G6EN 1WN7A 3IG1A 3I33A 4Q5VA 5CR4A 3F9MA 3K5MA 1YUWA 5GIOA 3EKUA 1JCEA 3HVTA 2PY5A 5AJ3K 4B1ZA 2ASOA 4CFBA 4JKEA 1KAYA 3JAMO 4H5TA 3WNEA 1RGIA 3NGZA 1KVBA 3CPWM 3U6FA 2NRWA 3J7ZO 4B8CA 3NE6A 4JRPA 2AP1A 3WXMB 4L8RB 4FWRA 3R9PA 4KH4A 4FZXC 3CJ7A 1DGKN 3WXJA 4BRKA 3ENOA 3PX4A 2HSTA 3ULDA 3RR7A 2HNYA 4QS9A 3RMAA 4B3RK 5SZTA 4DF8A 1Q18A 1L5UA 1EXQA 5HRRA 4CHZA 2CGLA 3B6PA 3BGRA 4X65K 3TAGA 1JL1A 2VG7A 4Z4GA 2AJQA 1IKVA 3JXUA 2PYJA 3VEYA 4CZLA 3VQ9A 3OYLA 2HHTA 3J7YP 3MECA 1REVA 3QICA 2XY6A 3BP8A 3SUPA 5AQMA 4PHTX 1TK8A 1TYQB 2O8EB 3DLEA 2IC3A 1NK0A 4EP5A 1N6QA 4DU3A 3CFOA 5AQNA 1LW0A 3HPOA 4CK2A 3M8SA 2XY5A 2B5JA 5F0XA 3P31A 4H4OA 1SKRA 1QS4A 3UB5A 5KGXA 1B9FA 4CCHA 1T03A 4B3OA 4C23A 1JXBA 2W40A 1RTJA 4KB1A 3NVMA 3NHGA 4FM1A 2QEXN 1NK6A 1SQKA 3VEVA 1XHXA 1BU6O 2UUAK 3CJCA 2A40A 2RF2A 4HUGA 2ETJA 4FSVA 2FBXA 3SBGA 3UKUB 1MU2A 1HQUA 1K8KB 4CF1A 3C6AA 3VENA 4B3TK 1Z6RA 2HW3A 5GIPA 1Q7YO 2ZM6K 3LM9A 4FVMA 3T1HK 3CQXA 4MQ3A 3WEEA 3BDPA 3OVNA 2E20A 1BI4A 3NH0A 4DR1K 4Z4CA 5M1PA 2Q31A 5JVGL 1RBUA 3K2PA 4XH5A 3PIOL 3BF1A 3AGRA 4JI2K 2VG6A 4DB3A 1ASWA 3FZFA 3F2KA 3H46O 3K57A 3VPZA 4F3TA 2O8BA 1HPMA 2E6MA 3EKSA 3ENHA 3QEWA 1NNEA 1JCGA 2DFFA 3VQ8A 2D0PA 5FPNA 4JK8A 4E1MA 1BG3A 4NLCA 3LAMA 3TTFA 1S6QA 2BTFA 3VF2A 3ULEA 3SNNA 5AQQA 4A2AA 1BOTO 2VWKA 3CC2N 3TAMA 3THVA 1RBTA 4LF6K 1NGJA 4W5RA 2YV0X 2HHXA 4M63C 3VOVA 1LCUA 1F21A 4JHDB 3MDQA 3O9QA 1W2BM 3WQTA 1EP4A 1D8YA 3AVAA 3LL3A 2NRXA 3RRGA 4BE0A 1NGFA 3NMUA 1JLCA 3VQ5A 3QETA 1OVYA 1GOAA 1P8ZA 3K5OA 3QB0A 3C6TA 2OPQA 4N5SA 1T7PA 3RWUA 4FM2A 5HOOA 3CJBA 3G25A 4BRNA 1N34K 1HNZK 4NXNK 3LWMA 4B9MA 2IDOA 3VQCA 1A5WA 1JLGA 1HRHA 3OYMA 1S72N 1S3XA 3SUQA 3OYEA 2HHSA 3LDLA 2W6LA 3AVJA 1Y64A 1Q86O 1HKCA 4JS5A 3IRXA 3QEXA 3MK6A 1NGGA 1RILA 3DXMB 2GX9A 4QOZB 3HOSA 3MMVA 2Q2RA 3PO5A 3D2EB 4FJLA 4M3UA 4UQGA 1RDWX 4BC2A 2DFEA 4ILHA 3A2FA 3AAQA 4JKDA 4Z4IA 1J9AA 3HJFA 2EWSA 3GG4A 2G8KA 4KV8A 4B3MK 3HPHA 4CIFA 2ZJQL 4B9UA 4WFBL 4AHUA 1D4XA 2JWKA 5KRSA 5AQGA 3EYZA 3QESA 2HBKA 2NUBA 1WAJA 3U9DA 3ZSRA 3SQ1A 3TR8A 1NJWA 1GLFO 3H3NO 4FWKA 2E4LA 5JLHA 2XHBA 4CZMA 3TSUA 3AVMA 1NGBA 1GOBA 2V51B 3C0BA 3DM2A 2D4WA 3Q7BA 4JI5K 4FJNA 3E01A 1A5VA 3DXKA 4IDHA 4CJ7A 1BQMA 3T69A 5IT9O 2E5LK 2KTQA 4A61A 1RT1A 3OYDA 4E3SA 1N33K 1XWLA 1EQYA 1SUQA 3KK2A 3HPGA 3U3YA 4FZYA 4H8KA 2KFZA 1LAWA 1NMNA 2A41A 4FL9A 1C1CA 4CEOA 3P5JA 3WT0A 1W0HA 1WBDA 4GKKK 1T6CA 1T8EA 4O8UA 4BDZA 4DLGA 3AVGA 1RDBA 3DLRA 3C6HA 2I7NA 5AZJB 4KH6A 1RFQA 1MWKA 3UKRB 1VSFA 4PQUA 1HKBA 2A5XA 1TAUA 5JICA 4FJ8A 2CH5A 5C25A 1IG8A 3SV3A 4IEIA 4KHQA 3D2FA 3OYNA 3CMEN 4LY7A 2W41A 3E66A 3H08A 4BG8A 3NF7A 4DQPA 1HLUA 1V4TA 4LH5A 2E6LA 1HX1A 1BL3A 4DR3K 2RHKA 4BC3A 5A2QO 3R1XA 1VAZA 4BRHA 2VWBA 3SPZA 1RTHA 4Y1CA 2O8FA 2QA4N 1GOCA 2IIRA 4JD2A 3MAQA 3CFRA 5BRHA 2HNZA 4DR2K 3L8BA 2NRZA 3THXB 3EO3A 2GWKA 2OA8A 1N32K 4LF9K 2ITMA 1FKPA 3O08A 1XHZA 1NKEA 3GL1A 2HB5A 1IBKK 3V6DA 1RBRA 3QINA 2GUIA 2P9LB 5JS2A 4M3RA 2XY7A 2GEMA 3RR8A 4YDUC 1U6ZA 4MO5A 4CGDA 4BRCA 5BR8K 3QFPA 3HK2A 5DK5A 1KCFA 4O5BA 3PX6A 4B1YB 2VYPA 4B1XB 4BC4A 1KTQA 1MWMA 1S1XA 5GADP 3VGLA 1YITN 4EFHA 4PKGA 3VEOA 3ZSZA 1RDDA 4KHUA 2W42A 3LM2A 3MXIA 3TTDA 5E26A 3WNGA 2P9SA 3AVCA 3GE1A 3CETA 4KKOA 4A5BA 5ADXH 4I9QA 2GWJA 5LL6Z 4H5VA 5HL7L 4OJRA 4CJUA 4F4KA 3W3DA 2PYLA 4DV1K 4BR5A 4ISGA 3OYCA 4HCBA 3I0SA 2Q3SA 3DRPA 4CD1A 1QHTA 5HRNA 1KXPA 4BRIA 4G9ZA 3L2UA 1JXEA 4DV6K 4CE9A 3P83D 2KZZA 2P9UB 3C65A 2QWRA 5JLFA 3VTIA 3TAQA 3ZT4A 4PY5A 3QNNA 3OYIA 1HQEA 4LFAK 3R3LA 3LPUA 4DSKA 4CW7B 1ZYQA 4WQ4A 1GLCG 1RCHA 3G10A 3O4QA 1N5YA 3KLHA 3ATVA 4CHOA 1H1VA 5BREA 5KGWA 4M3YA 3VETA 4DCHA 2ZJPL 5C0YA 3OS0A 3SK3A 3AARA 1B9DA 4CD3A 4DSEA 3MWPA 2RPIA 1SL1A 3AO4A 1X1PA 4K25A 1UWBA 2ZE2A 4CVNE 1BCMA 4H5WA 3ZEUA 3DMJA 3LZJA 2OTJN 1DTQA 4KHPK 4LF5K 4FPBA 1OVQA 4RG8A 5C10A 4PWDA 2EX3A 3H1VX 2YJFA 5I3UA 4FK2A 4EZ6A 3LP3A 3C7NA 4JKBA 3QIPA 1X3MA 3CCMN 1KVAA 3CXCM 1TAQA 3P4IA 4DQ8A 3IFRA 1C0TA 1J5EK 4YOYA 5DMRA 3H45C 3HI0A 2X6NA 3HXMA 3UIQA 2BE2A 5LY3A 2QXFA 3AA5X 3TTCA 4CEAA 4DTJA 3V9UA 3EZWA 5BR9A 3WXIA 4DQSA 3KD1E 4J2AA 1YF5L 4N47A 3HO1A 2KQ2A 4DHYA 2GELA 3SJJA 2PFUA 3VQDA 1YT3A 4KHNA 2YJEA 3RTVA 4G1QA 1VHXA 2IGIA 1Z26A 3B8AX 1L3UA 3VEWA 4LF4K 2X78A 3M8PA 2BDPA 1YTUA 1VRTA 5FRMA 4H03B 3ZX3A 1Y97A 4C8NA 1VSMA 3UE5A 4CJLA 1BA0A 4AHTA 3HYFA 5F1XA 3ENBA 4RW4A 3AAPA 1D5AA 4NYNA 4H0OA 4YOUA 5ELZA 2ZGYA 1NK5A 4JI8K 4X66K 1QHAA 3O3FA 1N8RO 2G8HA 4BRFA 5E84A 3VF4A 2HVIA 3FZKA 1E4FT 3JYTA 4X62K 4CJKA 1I3AA 1LWCA 5JMVA 4CFAA 2D0OA 4BRLA 3KK1A 4BRMA 3CG7A 3H6EA 1Q9XA 4DV7K 1YTAA 4KTZA 2E2QA 4BE1A 4FWMA 4AHVA 2HHUA 4PL7A 3L4IA 1P90A 3FZLA 1JL2A 2Z1HA 4GV9A 4CHPA 3TAPA 1UA0A 4A57A 3CC4N 3IUCA 4FK0A 3RMDA 4NYFA 3VA0A 3WQUA 5AZIB 1QQMA 4K43A 2YNFA 4BWJA 3S3NA 4B8AB 3CCVN 2NRHA 4GY2B 5SWMA 3CCJN 4Z4HA 4CZJA 3AO3A 5C24A 4CGGA 3K0SA 4DTXA 5BRFA 2DTUA 3F9KA 4GV3A 4KI6A 2O8DA 1TK0A 4FJ9A 3ZEUB 1VSKA 3VTHA 4DQRA 3SMSA 3L2WA 4MDBA 4DS5A 1CXQA 4CERA 3SZ2A 1IV0A 2UYTA 4JKHA 2VGMA 4A62A 2P9IA 3A5LC 3A5MC 3AA2A 3MCPA 2QWLA 4IJNA 3BZKA 1QQOA 4RW6A 3VN5A 1JLFA 4FLYA 3IMXA 4KPYA 1NM1A 4DTUA 2KKZA 4WQ5A 2WUSA 3FGUA 1ATSA 4KTWA 3THYA 4J2EA 5MLCQ 5HRSA 4L3QA 3IKMA 2VCPA 3ZT2A 3OYGA 3AY9A 3HBTA 1NOYA 1BA1A 2YI1A 2UXCK 2KFNA 3NF6A 3EL2A 3DLHA 4FJMA 1BCOA 1KFDA 3MWTA 1CZBA 4BC5A 1BDGA 2FBYA 1M1KO 3DRRA 4O0IA 3CM5A 4R79A 4CHYA 3KKRA 1C1AA 2E2PA 4EZ9A 2WC9A 5J2NA 4M3WA 1TKZA 1EX4A 3LAKA 2P1JA 1NLVA 4B9QA 2G8FA 4KH5A 4E19A 2OANA 3I8DA 4FOEA 1IKXA 5CHIA 3FLCO 4JKFA 4QAGA 2QWNA 4AF1A 3OYFA 3S9HA 5AFUH 5AQUA 3ALYA 5J2MA 3THWB 4YDUA 2YHYA 3CJ9A 1TV6A 1ASVA 2ASMA 1RDUA 4I2QA 3PLAA 3ZCMA 3SMPA 2FBTA 3OHRA 4EAHD 2YHXA 1BO5O 4IOXA 4IFEA 4JI3K 4C1NI 5GAGP 1EWRA 2QWMA 4OPHA 4DSIA 3OY9A 1U45A 4C8KA 4F8RA 1NGHA 3ZSVA 1LWFA 2X6SA 1RDAA 3BF3A 3O1BA 1NGDA 3HVRA 4CHNA 3VQPA 2IVNA 4IFVA 1GLAG 1ATRA 4KREA 2I5JA 3Q7CA 3DLLL 3L2VA 1BGXT 3J80O 3KJVA 3MXMA 3AV9A 5FPDA 1NK4A 2FC0A 1NJIO 4J2BA 3I56N 3V1QA 1GLEG 3NGIA 4MFBA 2P5GA 1ATNA 3FR0A 3LP0A 3KIOA 1GLJO 3TAFA 3EE8A 4CZEA 3GBTA 3I8BA 1S1VA 1RTDA 1JLEA 1X3NA 4FJIA 5M1KA 1BWFO 5GAEP 3AA3A 1RTIA 2Z1JA 2XO7A 4BREA 3VEZA 4HTUA 4CEDA 1OKJA 4LSNA 4CIEA 4W5TA 4DWIA 2UUBK 1XC3A 4O4GA 4QCLA 3K5NA 1QSYA 4FWNA 4PA1A 4CJSA 4OKKA 4HUFA 4CF8A 4JEPA 4M41A 1WAFA 3L3UA 2YKNA 3WUHA 1WB9A 3ZYYX 3J81O 4AHRA 4YY3K 4NO7A 1SL2A 4NCAA 2RN2A 1J53A 1ZBFA 4A59A 1HNWK 3CCLN 1K8AO 3TI0A 3V9ZA 3L2QA 1SZ2A 1VQ6N 1ZBIA 3T1YK 4YOXA 4DV0K 4FLZA 1QVGM 3QEIA 3CC7N 4KHWA 4KHYA 2P9KA 4ID1A 1RBVA 4C8LA 1S1UA 1NJZA 1LWEA 4IBNA 4DTMA 4C8OA 5AQRA 3NF9A 5C12A 4H5NA 2FF3B 3CCUN 1R0AA 1OH6A 4DG1A 2X74A 4IG3A 1XC9A 3VQAA 1JLQA 4OO1J 5LJWA 5C2DA 1XQSC 1NG9A 3P39A 4CESA 5CYQA 1J5OA 3R8EA 3K58A 4FW1A 4MDAA 1S5JA 2B6AA 2P9NA 3QIOA 3WEEB 1BI4B 5BPNA 2AA4A 4Z94A 4BRQA 1U04A 3IAYA 3OJSA 2OZSA 1C0MA 4JKGA 1HNIA 2H3GX 4WF9L 3EN9A 1NGAA 2A1RA 2HF4A 4H0XB 4EHUA 1TK5A 4O5FA 4BRAA 4B9SA 3O1WA 3AVBA 4E7IA 3O3HA 4NLBA 2G8UA 4CJQA 2O8BB 4O55A 3WNFA 4ELUA 3TU5A 2P51A 1WSIA 5KRTA 4DFJA 1RT5A 2XRIA 1C0GA 1TUUA 1KAZA 3FZMA 3PSIA 4ISEA 4KRFA 4CZHA 5AQSA 2A6AA 3L4QA 4B9LA 3HM8A 3ULEB 5K14A 4CBUA 3MXJA 4WCEL 4OGEA 4H0TB 5BPMA 4IDKA 4DSFA 1U48A 4JK7A 1NGIA 4ICLA 3AO5A 2QWQA 3NAEA 5J2PA 3SAHA 1D9FA 1C0FA 4BR0A 1NKCA 1LV5A 2IAJA 1VSDA 2P9PA 3CQ8A 3QNOA 2ZQBA 2ITGA 4QS8A 4E89A 3MN9A 3FZHA 1ILYA 5EX5A 1VQ4N 1HNXK 1NGCA 3OYKA 4CEZA 4B1VA 3SYZA 2V7ZA 1QZ5A 4DUZK 5H1SQ 1XI1A 1NGEA 4DFKA 1CZ9A 5LMNK 4DU4A 3H3OB 2QKBA 3NH2A 3CFPA 4BRDA 4U7BA 1FKOA 4DTSA 3KKSA 4H5RA 3G71N 1O1WA 3HP6A 4C1NK 1YVUA 3SQ2A 2NNWA 2OYQA 4UY8O 3T1AA 1BIUA 3V9XA 2O8CA 3V9SA 4B9TA 3AO2A 3KD5E 4JNEA 4BY9C 2BGGA 1LAVA 1IH7A 2J4RA 1ESVA 4XIUA 4KHSA 1YJNN 5CZ1A 1RT7A 1SS6A 3RSEA 4NCGA 1BQNA 4X64K 5D3GA 2LSNA 5FROA 2HBLA 3LDQA 3AA4A 1ZXOA 2P5OA 4LF7K 1VSIA 5BRDA 3L2RA 4B3SK 4DTPA 3O9UA 3P1GA 5AQPA 2Z1GA 3ZETA 1ZBHA 4CBXA 2YNHA 1BHLA 2D1KA 2OPPA 4ELVA 2FXUA 1KFSA 4JI1K 5AQLA 3D6RA 4FLUA 4DSLA 2ZF5O 3QDKA 4I6MA 1FK9A 4JI0K 3VGKA 4B1WB 2F8TA 2ZD1A 4M45A 2GUPA 4IO9L 1L3VA 4DSJA 1ITGA 4FWOA 4IEEA 5EU7A 3DXKB 4RW8A 2E2OA 3A8YA 3VGMA 3HM9A 1TUYA 2HF3A 5EOYA 3OBYA 4ZHRA 4IOAL 2KZMA 1RDCA 5GINA 2YHWA 3LALA 1NBWA 3KK3A 3SI6A 2YNIA 4KI4A 4DLEA 3QMLA 3VEXA 1YXQA 1M90O 1NMDA 5FPEA 1VQNN 2HBJA 4AM7A 1CZAN 3M6GA 1R59O 5M1NA 4LFCK 4M3TA 4AM6A 2RE2A 4Y0WA 4OVLA 1WLJA 4JKCA 3F5TA 2QK9A 1VSEA 3EEQA 5JS1A 3D2FB 1KLMA 4DTRA 2FBVA 1JCFA 4OKEA 2ZJRL 4CF2A 3KWIA 4CK1A 2NLXA 1NJYA 4F9OA 4H0YB 3VA3A 3O4NA 4LF8K 3DYAA 3TWHA 3A5NC 3L6QA 3O80A 1HJOA 5E41A 1YHQN 1WOQA 2GTDA 5CY4A 3G0ZA 1VSLA 2OTLN 3RVCA 2G8IA 2QI2A 2O8FB 2VQEK 2JGUA 1T05A 5M1FA 2F4VK 3MN7A 4JD2B 1U47A 4FPAA 1YVNA 4ELTA 1XUPO 1KSPA 1HNVA 1V4SA 2FSKA 5HROA 3KLEA 1EETA 5AQZA 3WNHA 4K0KK 2IVOA 4JI4K 4FOIA 2UXDK 3CQYA 3DRSA 2O4IA 3E9OA 1T44A 4CZKA 4DV2K 2WOMA 1K73O 4CEFA 4JK9A 3CJAA 3AVIA 4DKWA 3EZ5A 4BQZA 1TL1A 4Y1DA 1XNRK 3W0LA 1HKGA 2WONA 1S6PA 4OGCA 4FXDA 3ZT0A 3ZX2A 1EKEA 1TYQA 2O8EA 4OLBA 2Q0RA 1Q81O 1CXUA 3PO4A 2P9SB 1A5XA 5TKWA 4AILC 1VQ7N 1S1WA 2E1ZA 4CGIA 4CEEA 4BGBA 3BY5A 3M3ZA 1QE1A 1WUAA 5C2FA 4EIAA 3R6MA 4E7HA 1YI2N 4NXMK 3AVKA 3HT3A 3HZ6A 1NK7A 4FVUA 3JSMA 2F8SA 2ZGZA 1FXXA 5F2RA 4CEQA 4O8KA 3OBWA 4FYDA 4PL8A 2F9WA 3MEDA 3UKUA 4FK4A 4BDPA 1GLBG 1K8KA 3NH1A 1HMVA 1KC8O 3CCEN 4GW6A 2FF6A 2UXBK 1VSHA 3KK7A 4I7FA 2NRTA 3DOKA 3RMCA 5J1EA 4YNQA 2KHOA 4LSLA 3NFAA 3HTVA 2QXLA 1X9WA 4KAZA 4FM0A 1B92A 4W5OA 3CPEA 4JYAK 1KAXA 4BR2A 2A1SA 3OA9A 4A2BA 5T7BA 1OH5A 2WFBA 3LDOA 3K59A 1KQSM 2VQFK 2JWLA 4OPJA 4PKIA 2CGJA 2BH1A 3O9TA 4FJGA 3ZSXA 4OPAA 3L3VA 3BUZB 1KVCA 1X9SA 3O8MA 5FLXO 3DLKA 1DT9A 2YNGA 3V9WA 5EVZA 2D0AA 4IWVA 4PUOA 4CJ5A 3DAWA 3CJ1A 3GDQA 3C7NB 1MDUB 3RRHA 3O9RA 3CHWA 3ISNC 4KB0A 1E4GT 1DKGD 4DR6K 4KO0A 4RW7A 4JHDA 4K8XA 1VQ9N 3SQ0A 4CJTA 4IO8A 1TKTA 5AQJA 3T19A 1S9EA 2HOEA 3CD6N 1NK9A 4J2DA 4BR7A 4E1JA 4FJKA 1L3TA 2HHWA 4B9NA 1JJ2M 3O3GA 3O9SA 3J8AA 4LC9B 4MLEA 4E0DA 1E3MA 2Y1JA 4DF4A 3I0RA 5FPMA 5I9EB 3ZSOA 3P38A 1S22A 5LMUK 4FJ5A 3D0PA 3EY1A 5HBMA 3CCRN 2FSNA 5B8HA 4JS4A 4DFMA 1MA9B 4XEIA 4FLWA 2G8WA 3M8QA 3DXMA 1HYVA 3E9PA 1SV5A 1G99A 2VG5A 1RBSA 4M7XA 4IJAA 3QEVA 2D0BA 1SKWA 4M3XA 3D45A 5KQDA 3SQ4A 3D2EA 4OLAA 4LFBK 1Z05A 5ADXA 3SAGA 5DM7L 3LDNA 5KQ8A 3MCAB 4LD0A 4WFAL 4YOWA 4R5PA 3KZBA 3ASMA 4M7YA 4DV5K 1FJGK 3ID8A 4N76A 4CJFA 3KLGA 2E2NA 4J8FA 2FLOA 5AQHA 4E7KA 1HYSA 3VERA 3PUFA 3TANA 3OYBA 3OW2M 2ASPA 1JLAA 3SV4A 4H0PA 1U2VA 1LOTB 5KPTA 4DTNA 1SKSA 2UU9K 4WQ4C 4A5AA 3VMFB 1ZBSA 4CJWA 1O13A 4CFDA 2HMPA 2V52B 3DLBA 1IG9A 1HJRA 3I55N 4U67L 4K42A 3LWLA 1SAZA 3ZLJA 4FWQA 2IOCA 4JN4A 2Q0UA 3WXLA 2O8DB 5AR0A 4CEBA 1DTTA 4OPKA 3AVFA 3V1RA 4GVMA 4IOCL 1UOCA 4AQYK 3PV8A 2P9IB 1TKDA 4DV3K 3CI5A 2VWJA 4ILJA 3K9KA 4JI6K 5AQFA 1VQPN 3ZSQA 4CGHA 5AQVA 3BZCA 2CH6A 4GMJB 2HHQA 3THYB 3HL8A 4M42A 5AZJA 4C8MA 3UKRA 4BWMA 4Z0UA 2V7YA 2EHGA 5C42A 3N4PA 3VF6A 1IJJA 1TKXA 1QZ6A 3O4WA 3AVLA 3OYAA 1WBBA 1NU0A 3FE1A 2NRVA 4XH4A 4CK3A 4HCCA 1ZBLA 1J54A 3NF8A 1S9GA 3KLFA 4DQIA 2PZSA 4OKJA 3RMBA 4Q0BA 4FW2A 5GAHP 1XNQK 3TPQA 4OX9K 2KLAA 2A42A 1IKYA 3CMAN 2QWPA 4HTLA 1XMOK 1RT3A 2F7TA 3LANA 3QBWA 3QEPA 3THXA 1VQLN 4F3OA 3ZT3A 3OS1A 2XY8A 5AQWA 2Q1NA 3ZSYA 2YHBA 4WFNL 1VQON 3QFUA 4E1NA 3SLCA 3K5LA 4DV4K 3PIPL 4RW9A 1EWQA 1K9MO 1VQMN 2P9LA 4KTQA 1D9DA 1TVRA 4LH4A 5HP1A 1I94K 4BG9A 2A3ZA 2DFHA 4BROA 4EHTA 3V81A 1DEJA 5BN8A 4FJ7A 4H4MA 3SPYA 4YOVA 3OYJA 5LJVA 3ATUA 2GBZA 5I42A 5C15A 3TSPA 4ILGB 3DLGA 3E1YA 1NK8A 2KW4A 4BRGA 4BRPA 1U2VB 3U3GA 4FWLA 3HSTB 2HHHK 1W97L 1UA1A 1YAGA 1JLBA 1U4BA 4JV5K 2OPRA 1VQKN 3F73A 3QERA 3VQQA 5BN9A 1NJXA 2E88A 3M5RA 4CJVA 1QTMA 4B9VA 4DFPA 3AVHA 2Y1IA 4M3ZA 4CF0A 4AHSA 4E7JA 1CLQA 3BEXA 2HNDA 5JVHL 4NB4A 2D5RA 3C6UA 3CF5L 1Q8IA 2QM1A 1KRPA 4NCBA 3OJUA 1QSLA 2P9UA 4BVPA 4F2RA 2HBMA 2RKIA 3HP9A 2W6KA 1ZBUA 3V1OA 1FW6A 2PAVA 5M1QA 4FJXA 4IKFA 3MX2A 4YORA 1RT6A 3D7EO 3GOIA 3A5OC 1RT4A 1HYZA 1VK0A 3K9JA 4V19S 1G15A 3M8RA 5J2QA 4W5QA 4WQ5C 4XH1A 4FJHA 2DY4A 3JS6A 3VQEA 3MN5A 2ZWHA 5FRNA 4CBWA 4ISFA 1T3VA 1QVFM 2YKMA 5BPLA 1C0UA 1X9JA 4BQLA 4N56A 4K8ZA 5AQIA 4AH9A 1KD1O 4PKHA 4RTFD 3V4IA 3FFIA 4FO0A 4GKJK 4FWSA 3CERA 1ZC6A 4RCHA 3LZIA 2BUPA 2UUCK 3NVKA 3CIPA 3LDPA 4CF9A 1U49A 4CI6A 2Z1IA 1YJ9N 2P9KB 4IXCA 3LDSA 1IO2A 2Q97A 1HUXA 3VQBA 2CGKA 3OS2A 3C94A 3HSCA 4I2PA 3IS9A 1Q9YA 3QO9A 5EXWA 4Z4FA 3OYHA 3NCIA 3O6WA 3MEEA 4H0VB 4BGAA 4O0JA 3KWGA 3MEGA 2WBNA 4JAXA 3OTOK 1GLLO 3CCSN 1YJWN 4GVEA 2OZMA 3TARA 1TGOA 2I7PA 3NGYA 1ASUA 2VGNA 3SJHA 1WSFA 4CJPA 2HHVA 1QQCA 2P9NB 5AFUA 4BVOA 2WTUA 3N4QA 4CZIA 4DU1A 4HVJA 2IVPA 1RT2A 4JKGB 1T6DA 4JRQA 4DUYK 1JKHA 1S1TA 4YHHK 3NBPA 4E7LA 3SAFA 2FSJA 4CZGA 4CHQA 1NOZA 3AO1A 3CCQN 3TSQA 4W5NA 1IKWA 5DM6L 3LP2A 4YFUA 5HRPA 1VSJA 3AVNA 3T3FA 2Q36A 3PX0A 3PY8A 3KTQA 3TAEA 4WYBA 3VQ7A 5AQKA 3ZT1A 1WSGA 2E8AA 2OCEA 1OH8A 3DJCA 3NDKA 4N41A 1LW2A 5TKYA 3E9LA 4KBOA 2QW9A 2QKKA 1J6ZA 4FZZA 2PBDA 2P9PB 1HPZA 3SUNA 3C95A 3O5BA 4DMNA 4RWTA 4HHTA 4Z4EA 4BE2A 1SL0A 4BACA 1K6YA 3PSFA 5AZIA 2JLEA 1XMQK 2IS3A 5KTQA 4CJ4A 3A0IX 1NWKA 1BISA 4FJJA 1IBLK 2E1YA 3DWLA 3KHYA 3ITHA 4BDYA 3IDHA 3VESA 3HOTA 4CZFA 2HMIA 2QTDA 2G8VA 5IWAK 3VQ6A 3B6OA 4ZTJA 1WSHA 5KI6A 5AQYA 2R7YA 4MO4A 4GNIA 3U4LA 4B08A 2B4JA 4QS7A 2HVHA 3L0QA 4HUEA 1Z25A 1VQ8N 1UAXA 3AGKA 3EE9A 4YOTA 4HWIA 1Q82O 1QSSA
chains in the Genus database with same CATH topology
4KO0A 4PA1A 4CJSA 4OKKA 4HUFA 4RW7A 4EP4A 4DS4A 4LH5A 2E6LA 4AHCA 4CF8A 4ZTFA 4M41A 1WAFA 3L3UA 1BL3A 2YKNA 4CJTA 3SQ0A 1TKTA 4WE1A 3T19A 4AHRA 1SL2A 1S9EA 3SPZA 1RTHA 4Y1CA 2YHAA 4NCAA 2RN2A 1J53A 1ZBFA 1NK9A 1I39A 2OPSA 2O4GA 4J2DA 1GOCA 3V9ZA 3L2QA 3TI0A 3MAQA 4FJKA 3CFRA 1DLOA 1L3TA 1ZBIA 2HNZA 2HHWA 2ATQA 3SUOA 4B9NA 3L8BA 3O3GA 1NKBA 3LPTA 2OA8A 3DOLA 3LP1A 4FLZA 1FKPA 3QEIA 3TABA 4E0DA 4KHWA 4JLHA 3VQ4A 4KHYA 1XHZA 1NKEA 4ID1A 1RBVA 2Y1JA 4C8LA 1S1UA 2HB5A 4DTOA 3I0RA 4DF4A 1NJZA 3V6DA 1RBRA 3QINA 1C1BA 3ZSOA 2GUIA 3S3MA 1LWEA 5CYMA 4CJEA 4CJRA 4IBNA 5JS2A 4DTMA 4M3RA 2XY7A 4KAZA 4FJ5A 3RR8A 2BANA 4C8OA 3D0PA 4IFYA 3NF9A 4CGDA 3HK2A 3EY1A 5HBMA 4FLXA 4CGJA 4JS4A 4DFMA 1R0AA 4DG1A 5DK5A 1KCFA 2X74A 4IG3A 4O5BA 3VQAA 3PX6A 1XC9A 4FLWA 1JLQA 1VRUA 2G8WA 3M8QA 1HYVA 4FLTA 1KTQA 2VG5A 1SV5A 1RBSA 1S1XA 4CESA 3QEVA 2D0BA 1SKWA 1L3SA 4KI4A 5CYQA 4FCYA 4M3XA 3D45A 3SQ4A 3S3OA 1J5OA 4KFBA 1WSEA 3ZSZA 4OLAA 3K58A 1RDDA 4FW1A 4KHUA 2W42A 3CM6A 3MXIA 3WNGA 3ZSWA 1S5JA 4CFCA 2B6AA 2GV9A 3QIOA 3AVCA 3KLIA 4LD0A 4CECA 4FLVA 1BI4B 4KKOA 4R5PA 3ASMA 4I9QA 1WNSA 4N76A 4CJFA 2F96A 4IG0A 1U04A 3IAYA 3OJSA 2OZSA 3QLHA 3KLGA 1C0MA 1HNIA 1TL3A 4O44A 4OJRA 5HLFA 1W9HA 4CGFA 4CJUA 4E7KA 4F4KA 2A1RA 2PYLA 4F2SA 1HYSA 1KLNA 4ID5A 3SCXA 3CYMA 3DI6A 3OYCA 4DQQA 1TK5A 3PUFA 3TANA 3I0SA 4B9SA 3OYBA 3AVBA 2Q3SA 4E7IA 5CZ2A 3DRPA 3O3HA 1X9MA 1JLAA 4CJ3A 3SV4A 4CJQA 2G8UA 1QHTA 4I9LA 4O55A 5HRNA 3WNFA 1C6VA 4ELUA 1BIZA 1WSJA 1WSIA 2P51A 5KRTA 4DTNA 4KB0A 3L2UA 2D0CA 4TSXA 1SKSA 4DFJA 1RT5A 1JXEA 1RNHA 2XRIA 4CE9A 4CIGA 3P83D 4CJWA 2KZZA 4KRFA 5FDLA 4CFDA 1WN7A 3TAQA 3IG1A 3DLBA 3ZT4A 4PY5A 1IG9A 3QNNA 3OYIA 4Q5VA 1HJRA 4B9LA 1HQEA 3LWLA 5K14A 3MXJA 2IOCA 4OGEA 3LPUA 3K5MA 4DSKA 4IDKA 1ZYQA 4CEBA 4DSFA 1U48A 1RCHA 1DTTA 3G10A 3HVTA 3O4QA 4ICLA 3KLHA 1N5YA 3AO5A 2PY5A 4CHOA 4OPKA 3NAEA 5J2PA 1D9FA 3AVFA 3V1RA 4GVMA 5KGWA 4M3YA 1NKCA 1LV5A 1UOCA 2IAJA 3PV8A 1VSDA 4CFBA 3CQ8A 3QNOA 2ZQBA 1TKDA 2VWJA 2ITGA 3OS0A 4DSEA 1B9DA 4E89A 2RPIA 1SL1A 3AO4A 3WNEA 3ZSQA 1X1PA 3NGZA 1UWBA 4CGHA 1KVBA 2ZE2A 3U6FA 1BCMA 3OYKA 3DMJA 4GMJB 4CEZA 3LZJA 1DTQA 2HHQA 3SYZA 4B8CA 3HL8A 3NE6A 4JRPA 4M42A 4C8MA 4L8RB 4BWMA 4Z0UA 1XI1A 4FZXC 4RG8A 2EHGA 5C42A 3PX4A 3ULDA 1CZ9A 4DFKA 4DU4A 3RR7A 1TKXA 2EX3A 4PWDA 2QKBA 2HNYA 3NH2A 3RMAA 3CFPA 3AVLA 5SZTA 4DF8A 3OYAA 1FKOA 5I3UA 4DTSA 4FK2A 3KKSA 4EZ6A 3LP3A 1EXQA 5HRRA 1L5UA 3QIPA 4CK3A 4CHZA 3B6PA 3BGRA 3TAGA 1JL1A 1KVAA 2VG7A 4Z4GA 1IKVA 2AJQA 2PYJA 1O1WA 3HP6A 1TAQA 4HCCA 1YVUA 3VQ9A 3OYLA 3SQ2A 2OYQA 1ZBLA 3T1AA 1BIUA 1C0TA 1J54A 1S9GA 3MECA 3NF8A 3V9XA 2HHTA 3V9SA 1REVA 5DMRA 4B9TA 2XY6A 3AO2A 3KLFA 4DQIA 3SUPA 2X6NA 3HXMA 4OKJA 2PZSA 3KD5E 1LAVA 1IH7A 3RMBA 3UIQA 2BE2A 4FW2A 2BGGA 4Q0BA 2QXFA 3AA5X 4XIUA 4CEAA 4KHSA 4DTJA 3V9UA 1IKYA 5CZ1A 1RT7A 1TK8A 3DLEA 2IC3A 1NK0A 4NCGA 1BQNA 4DQSA 3KD1E 4J2AA 4EP5A 4N47A 1RT3A 3LANA 4DU3A 3CFOA 2KQ2A 1LW0A 3HPOA 2LSNA 4CK2A 3QEPA 1N6QA 3SJJA 4F3OA 5FROA 3VQDA 3M8SA 3ZT3A 1YT3A 2B5JA 3OS1A 2XY5A 4KHNA 3AA4A 2XY8A 3RTVA 4G1QA 4H4OA 1SKRA 1QS4A 2IGIA 1Z26A 1B9FA 3ZSYA 5KGXA 1L3UA 2P5OA 2X78A 3M8PA 2BDPA 1YTUA 1VSIA 1VRTA 2YHBA 3L2RA 1T03A 4CCHA 4B3OA 5FRMA 1JXBA 1RTJA 4DTPA 4KB1A 4E1NA 3K5LA 3NHGA 4FM1A 4RW9A 1NK6A 1Y97A 4C8NA 1VSMA 3P1GA 4CJLA 4KTQA 2Z1GA 1XHXA 4AHTA 3HYFA 1D9DA 1ZBHA 2YNHA 4RW4A 1BHLA 2OPPA 1TVRA 1D5AA 4LH4A 4NYNA 4ELVA 5HP1A 2RF2A 4HUGA 2ETJA 1KFSA 2DFHA 1NK5A 4FLUA 3V81A 4DSLA 3O3FA 2G8HA 1FK9A 2FBXA 2HVIA 1MU2A 3JYTA 4H4MA 4CJKA 3SPYA 4FJ7A 2F8TA 1HQUA 2ZD1A 1I3AA 4M45A 3OYJA 2GBZA 4CF1A 5I42A 1L3VA 1LWCA 2HW3A 3DLGA 4CFAA 4DSJA 1NK8A 3KK1A 1ITGA 2KW4A 5EU7A 4RW8A 3CG7A 4FVMA 4MQ3A 1Q9XA 3BDPA 3OVNA 1BI4A 3NH0A 3U3GA 1YTAA 4Z4CA 3HM9A 4KTZA 3HSTB 1UA1A 4BE1A 1JLBA 1U4BA 1RBUA 4ZHRA 3K2PA 2KZMA 1RDCA 4AHVA 2HHUA 2OPRA 2VG6A 3F73A 3LALA 3QERA 1ASWA 3VQQA 3KK3A 1NJXA 1JL2A 2Z1HA 3SI6A 4CHPA 3TAPA 1UA0A 4CJVA 2YNIA 1QTMA 4DFPA 4B9VA 3AVHA 3K57A 4NYFA 2Y1IA 3VA0A 3RMDA 4FK0A 4M3ZA 4DLEA 4F3TA 4CF0A 2E6MA 4AHSA 4E7JA 1CLQA 2HNDA 2D5RA 3QEWA 2DFFA 2YNFA 4M3TA 3C6UA 4BWJA 3S3NA 1Q8IA 4B8AB 1KRPA 3VQ8A 4NCBA 4OVLA 3OJUA 1WLJA 1QSLA 4F2RA 5SWMA 2RKIA 3HP9A 4E1MA 4Z4HA 1ZBUA 3AO3A 5C24A 3V1OA 2QK9A 1VSEA 3LAMA 4CGGA 4FJXA 1S6QA 4IKFA 4DTXA 1RT6A 3SNNA 5JS1A 2DTUA 1KLMA 2VWKA 1RT4A 1HYZA 3F9KA 2FBVA 4DTRA 4OKEA 3TAMA 1RBTA 1VK0A 3THVA 4KI6A 4CF2A 4CK1A 1TK0A 4W5RA 4FJ9A 2YV0X 1G15A 1VSKA 3M8RA 4W5QA 5J2QA 4DQRA 3L2WA 4DS5A 1NJYA 2HHXA 1CXQA 4FJHA 1F21A 4CERA 3SZ2A 3VQEA 3VA3A 2DY4A 3O4NA 3DYAA 3TWHA 5E41A 5FRNA 1EP4A 1D8YA 5CY4A 3G0ZA 1VSLA 2YKMA 3AVAA 3RRGA 4BE0A 1C0UA 4N56A 2G8IA 3AA2A 4K8ZA 1JLCA 2JGUA 3VQ5A 4AH9A 1T05A 4RW6A 3VN5A 1JLFA 4FLYA 3FFIA 3QETA 3V4IA 1U47A 4KPYA 1GOAA 4DTUA 4ELTA 3K5OA 3C6TA 2OPQA 3LZIA 4N5SA 4KTWA 1HNVA 1KSPA 4CF9A 1T7PA 1U49A 3RWUA 4J2EA 4FM2A 2Z1IA 5HRSA 5HROA 3KLEA 3LDSA 3ZT2A 1IO2A 1EETA 3OYGA 4HCBA 3VQBA 3WNHA 3LWMA 4B9MA 2IDOA 3OS2A 3VQCA 3C94A 1A5WA 4I2PA 1NOYA 3DRSA 3IS9A 2O4IA 1JLGA 2KFNA 1HRHA 3NF6A 3OYMA 1Q9YA 3QO9A 3SUQA 2WOMA 4Z4FA 3OYEA 4CEFA 3OYHA 3DLHA 3AVIA 3NCIA 4FJMA 2HHSA 3EZ5A 1BCOA 1KFDA 3MEEA 1CZBA 1TL1A 4Y1DA 3AVJA 4O0JA 3MEGA 2FBYA 3DRRA 4O0IA 3CM5A 3IRXA 4JS5A 3QEXA 4CHYA 3KKRA 2WONA 1RILA 1C1AA 4EZ9A 4QOZB 1S6PA 4OGCA 4FXDA 3ZT0A 1EKEA 2OZMA 3TARA 4OLBA 3PO5A 5J2NA 1TGOA 1TKZA 3NGYA 1EX4A 4FJLA 4M3WA 1ASUA 4M3UA 4UQGA 3LAKA 1WSFA 2P1JA 4CJPA 1CXUA 4E19A 2G8FA 1QQCA 2DFEA 3PO4A 2HHVA 3A2FA 3I8DA 1A5XA 4Z4IA 1J9AA 1IKXA 4AILC 1S1WA 3HJFA 4DU1A 4QAGA 4CGIA 4HVJA 3OYFA 3S9HA 4CEEA 1RT2A 2G8KA 4KV8A 3HPHA 4CIFA 1QE1A 4B9UA 4JRQA 1JKHA 1S1TA 3ALYA 5J2MA 4AHUA 5KRSA 3EYZA 4E7HA 3NBPA 4E7LA 3QESA 3AVKA 1TV6A 2NUBA 3HT3A 1ASVA 4CHQA 1NK7A 1NOZA 1WAJA 3ZSRA 3JSMA 3SQ1A 3AO1A 3TR8A 1NJWA 2F8SA 1FXXA 2E4LA 1IKWA 4I2QA 3LP2A 4CEQA 4YFUA 4W5NA 2XHBA 3ZCMA 5D3GA 4FYDA 5HRPA 1VSJA 3AVMA 3MEDA 4FK4A 2FBTA 4BDPA 3AVNA 3T3FA 3NH1A 1HMVA 3PX0A 3KTQA 3TAEA 3PY8A 1GOBA 3DM2A 4GW6A 4K8XA 1VSHA 3VQ7A 3ZT1A 4I7FA 4FJNA 3DOKA 3E01A 1A5VA 3OY9A 4DSIA 1U45A 1WSGA 1BQMA 4C8KA 3RMCA 4F8RA 5J1EA 2KTQA 3ZSVA 3NDKA 1LWFA 2X6SA 1RDAA 4N41A 4YNQA 4LSLA 1LW2A 3NFAA 1RT1A 3HVRA 3OYDA 4E3SA 1X9WA 1XWLA 4CHNA 1SUQA 4IFVA 3HPGA 3VQPA 3KK2A 4FM0A 3U3YA 4FZYA 2QKKA 4H8KA 1B92A 4FZZA 4KREA 2I5JA 4W5OA 2KFZA 3L2VA 1BGXT 1HPZA 1LAWA 3KJVA 3SUNA 3C95A 4DMNA 4HHTA 3MXMA 1C1CA 4CEOA 2A1SA 4BE2A 4Z4EA 3AV9A 1SL0A 5T7BA 2FC0A 3P5JA 4BACA 1NK4A 1W0HA 1K6YA 1T8EA 4J2BA 3K59A 2JLEA 3V1QA 2IS3A 3NGIA 4OPJA 4MFBA 5KTQA 3LP0A 4BDZA 4CJ4A 4DLGA 3KIOA 2P5GA 1BISA 3ZSXA 4FJGA 4FJJA 3TAFA 3AVGA 1RDBA 3ITHA 3DLRA 4BDYA 3HO1A 1S1VA 1RTDA 2HMIA 3L3VA 2G8VA 3VQ6A 1JLEA 1VSFA 4FJIA 1KVCA 3B6OA 1X9SA 4PQUA 4ZTJA 1WSHA 5KI6A 3DLKA 2R7YA 2YNGA 3V9WA 1TAUA 4B08A 4FJ8A 2B4JA 2D0AA 3AA3A 1RTIA 2Z1JA 5C25A 2XO7A 4PUOA 3SV3A 4CJ5A 4KHQA 2HVHA 4HUEA 1Z25A 3OYNA 1UAXA 4LY7A 3RRHA 4HTUA 4CEDA 3H08A 3ISNC 4LSNA 4CIEA 4W5TA 4DWIA 3NF7A 4O4GA 4QCLA 3K5NA 1QSSA 1QSYA 4DQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KO0 A;  4PA1 A;  4CJS A;  4OKK A;  4HUF A;  4RW7 A;  4EP4 A;  4DS4 A;  4LH5 A;  2E6L A;  4AHC A;  4CF8 A;  4ZTF A;  4M41 A;  1WAF A;  3L3U A;  1BL3 A;  2YKN A;  4CJT A;  3SQ0 A;  1TKT A;  4WE1 A;  3T19 A;  4AHR A;  1SL2 A;  1S9E A;  3SPZ A;  1RTH A;  4Y1C A;  2YHA A;  4NCA A;  2RN2 A;  1J53 A;  1ZBF A;  1NK9 A;  1I39 A;  2OPS A;  2O4G A;  4J2D A;  1GOC A;  3V9Z A;  3L2Q A;  3TI0 A;  3MAQ A;  4FJK A;  3CFR A;  1DLO A;  1L3T A;  1ZBI A;  2HNZ A;  2HHW A;  2ATQ A;  3SUO A;  4B9N A;  3L8B A;  3O3G A;  1NKB A;  3LPT A;  2OA8 A;  3DOL A;  3LP1 A;  4FLZ A;  1FKP A;  3QEI A;  3TAB A;  4E0D A;  4KHW A;  4JLH A;  3VQ4 A;  4KHY A;  1XHZ A;  1NKE A;  4ID1 A;  1RBV A;  2Y1J A;  4C8L A;  1S1U A;  2HB5 A;  4DTO A;  3I0R A;  4DF4 A;  1NJZ A;  3V6D A;  1RBR A;  3QIN A;  1C1B A;  3ZSO A;  2GUI A;  3S3M A;  1LWE A;  5CYM A;  4CJE A;  4CJR A;  4IBN A;  5JS2 A;  4DTM A;  4M3R A;  2XY7 A;  4KAZ A;  4FJ5 A;  3RR8 A;  2BAN A;  4C8O A;  3D0P A;  4IFY A;  3NF9 A;  4CGD A;  3HK2 A;  3EY1 A;  5HBM A;  4FLX A;  4CGJ A;  4JS4 A;  4DFM A;  1R0A A;  4DG1 A;  5DK5 A;  1KCF A;  2X74 A;  4IG3 A;  4O5B A;  3VQA A;  3PX6 A;  1XC9 A;  4FLW A;  1JLQ A;  1VRU A;  2G8W A;  3M8Q A;  1HYV A;  4FLT A;  1KTQ A;  2VG5 A;  1SV5 A;  1RBS A;  1S1X A;  4CES A;  3QEV A;  2D0B A;  1SKW A;  1L3S A;  4KI4 A;  5CYQ A;  4FCY A;  4M3X A;  3D45 A;  3SQ4 A;  3S3O A;  1J5O A;  4KFB A;  1WSE A;  3ZSZ A;  4OLA A;  3K58 A;  1RDD A;  4FW1 A;  4KHU A;  2W42 A;  3CM6 A;  3MXI A;  3WNG A;  3ZSW A;  1S5J A;  4CFC A;  2B6A A;  2GV9 A;  3QIO A;  3AVC A;  3KLI A;  4LD0 A;  4CEC A;  4FLV A;  1BI4 B;  4KKO A;  4R5P A;  3ASM A;  4I9Q A;  1WNS A;  4N76 A;  4CJF A;  2F96 A;  4IG0 A;  1U04 A;  3IAY A;  3OJS A;  2OZS A;  3QLH A;  3KLG A;  1C0M A;  1HNI A;  1TL3 A;  4O44 A;  4OJR A;  5HLF A;  1W9H A;  4CGF A;  4CJU A;  4E7K A;  4F4K A;  2A1R A;  2PYL A;  4F2S A;  1HYS A;  1KLN A;  4ID5 A;  3SCX A;  3CYM A;  3DI6 A;  3OYC A;  4DQQ A;  1TK5 A;  3PUF A;  3TAN A;  3I0S A;  4B9S A;  3OYB A;  3AVB A;  2Q3S A;  4E7I A;  5CZ2 A;  3DRP A;  3O3H A;  1X9M A;  1JLA A;  4CJ3 A;  3SV4 A;  4CJQ A;  2G8U A;  1QHT A;  4I9L A;  4O55 A;  5HRN A;  3WNF A;  1C6V A;  4ELU A;  1BIZ A;  1WSJ A;  1WSI A;  2P51 A;  5KRT A;  4DTN A;  4KB0 A;  3L2U A;  2D0C A;  4TSX A;  1SKS A;  4DFJ A;  1RT5 A;  1JXE A;  1RNH A;  2XRI A;  4CE9 A;  4CIG A;  3P83 D;  4CJW A;  2KZZ A;  4KRF A;  5FDL A;  4CFD A;  1WN7 A;  3TAQ A;  3IG1 A;  3DLB A;  3ZT4 A;  4PY5 A;  1IG9 A;  3QNN A;  3OYI A;  4Q5V A;  1HJR A;  4B9L A;  1HQE A;  3LWL A;  5K14 A;  3MXJ A;  2IOC A;  4OGE A;  3LPU A;  3K5M A;  4DSK A;  4IDK A;  1ZYQ A;  4CEB A;  4DSF A;  1U48 A;  1RCH A;  1DTT A;  3G10 A;  3HVT A;  3O4Q A;  4ICL A;  3KLH A;  1N5Y A;  3AO5 A;  2PY5 A;  4CHO A;  4OPK A;  3NAE A;  5J2P A;  1D9F A;  3AVF A;  3V1R A;  4GVM A;  5KGW A;  4M3Y A;  1NKC A;  1LV5 A;  1UOC A;  2IAJ A;  3PV8 A;  1VSD A;  4CFB A;  3CQ8 A;  3QNO A;  2ZQB A;  1TKD A;  2VWJ A;  2ITG A;  3OS0 A;  4DSE A;  1B9D A;  4E89 A;  2RPI A;  1SL1 A;  3AO4 A;  3WNE A;  3ZSQ A;  1X1P A;  3NGZ A;  1UWB A;  4CGH A;  1KVB A;  2ZE2 A;  3U6F A;  1BCM A;  3OYK A;  3DMJ A;  4GMJ B;  4CEZ A;  3LZJ A;  1DTQ A;  2HHQ A;  3SYZ A;  4B8C A;  3HL8 A;  3NE6 A;  4JRP A;  4M42 A;  4C8M A;  4L8R B;  4BWM A;  4Z0U A;  1XI1 A;  4FZX C;  4RG8 A;  2EHG A;  5C42 A;  3PX4 A;  3ULD A;  1CZ9 A;  4DFK A;  4DU4 A;  3RR7 A;  1TKX A;  2EX3 A;  4PWD A;  2QKB A;  2HNY A;  3NH2 A;  3RMA A;  3CFP A;  3AVL A;  5SZT A;  4DF8 A;  3OYA A;  1FKO A;  5I3U A;  4DTS A;  4FK2 A;  3KKS A;  4EZ6 A;  3LP3 A;  1EXQ A;  5HRR A;  1L5U A;  3QIP A;  4CK3 A;  4CHZ A;  3B6P A;  3BGR A;  3TAG A;  1JL1 A;  1KVA A;  2VG7 A;  4Z4G A;  1IKV A;  2AJQ A;  2PYJ A;  1O1W A;  3HP6 A;  1TAQ A;  4HCC A;  1YVU A;  3VQ9 A;  3OYL A;  3SQ2 A;  2OYQ A;  1ZBL A;  3T1A A;  1BIU A;  1C0T A;  1J54 A;  1S9G A;  3MEC A;  3NF8 A;  3V9X A;  2HHT A;  3V9S A;  1REV A;  5DMR A;  4B9T A;  2XY6 A;  3AO2 A;  3KLF A;  4DQI A;  3SUP A;  2X6N A;  3HXM A;  4OKJ A;  2PZS A;  3KD5 E;  1LAV A;  1IH7 A;  3RMB A;  3UIQ A;  2BE2 A;  4FW2 A;  2BGG A;  4Q0B A;  2QXF A;  3AA5 X;  4XIU A;  4CEA A;  4KHS A;  4DTJ A;  3V9U A;  1IKY A;  5CZ1 A;  1RT7 A;  1TK8 A;  3DLE A;  2IC3 A;  1NK0 A;  4NCG A;  1BQN A;  4DQS A;  3KD1 E;  4J2A A;  4EP5 A;  4N47 A;  1RT3 A;  3LAN A;  4DU3 A;  3CFO A;  2KQ2 A;  1LW0 A;  3HPO A;  2LSN A;  4CK2 A;  3QEP A;  1N6Q A;  3SJJ A;  4F3O A;  5FRO A;  3VQD A;  3M8S A;  3ZT3 A;  1YT3 A;  2B5J A;  3OS1 A;  2XY5 A;  4KHN A;  3AA4 A;  2XY8 A;  3RTV A;  4G1Q A;  4H4O A;  1SKR A;  1QS4 A;  2IGI A;  1Z26 A;  1B9F A;  3ZSY A;  5KGX A;  1L3U A;  2P5O A;  2X78 A;  3M8P A;  2BDP A;  1YTU A;  1VSI A;  1VRT A;  2YHB A;  3L2R A;  1T03 A;  4CCH A;  4B3O A;  5FRM A;  1JXB A;  1RTJ A;  4DTP A;  4KB1 A;  4E1N A;  3K5L A;  3NHG A;  4FM1 A;  4RW9 A;  1NK6 A;  1Y97 A;  4C8N A;  1VSM A;  3P1G A;  4CJL A;  4KTQ A;  2Z1G A;  1XHX A;  4AHT A;  3HYF A;  1D9D A;  1ZBH A;  2YNH A;  4RW4 A;  1BHL A;  2OPP A;  1TVR A;  1D5A A;  4LH4 A;  4NYN A;  4ELV A;  5HP1 A;  2RF2 A;  4HUG A;  2ETJ A;  1KFS A;  2DFH A;  1NK5 A;  4FLU A;  3V81 A;  4DSL A;  3O3F A;  2G8H A;  1FK9 A;  2FBX A;  2HVI A;  1MU2 A;  3JYT A;  4H4M A;  4CJK A;  3SPY A;  4FJ7 A;  2F8T A;  1HQU A;  2ZD1 A;  1I3A A;  4M45 A;  3OYJ A;  2GBZ A;  4CF1 A;  5I42 A;  1L3V A;  1LWC A;  2HW3 A;  3DLG A;  4CFA A;  4DSJ A;  1NK8 A;  3KK1 A;  1ITG A;  2KW4 A;  5EU7 A;  4RW8 A;  3CG7 A;  4FVM A;  4MQ3 A;  1Q9X A;  3BDP A;  3OVN A;  1BI4 A;  3NH0 A;  3U3G A;  1YTA A;  4Z4C A;  3HM9 A;  4KTZ A;  3HST B;  1UA1 A;  4BE1 A;  1JLB A;  1U4B A;  1RBU A;  4ZHR A;  3K2P A;  2KZM A;  1RDC A;  4AHV A;  2HHU A;  2OPR A;  2VG6 A;  3F73 A;  3LAL A;  3QER A;  1ASW A;  3VQQ A;  3KK3 A;  1NJX A;  1JL2 A;  2Z1H A;  3SI6 A;  4CHP A;  3TAP A;  1UA0 A;  4CJV A;  2YNI A;  1QTM A;  4DFP A;  4B9V A;  3AVH A;  3K57 A;  4NYF A;  2Y1I A;  3VA0 A;  3RMD A;  4FK0 A;  4M3Z A;  4DLE A;  4F3T A;  4CF0 A;  2E6M A;  4AHS A;  4E7J A;  1CLQ A;  2HND A;  2D5R A;  3QEW A;  2DFF A;  2YNF A;  4M3T A;  3C6U A;  4BWJ A;  3S3N A;  1Q8I A;  4B8A B;  1KRP A;  3VQ8 A;  4NCB A;  4OVL A;  3OJU A;  1WLJ A;  1QSL A;  4F2R A;  5SWM A;  2RKI A;  3HP9 A;  4E1M A;  4Z4H A;  1ZBU A;  3AO3 A;  5C24 A;  3V1O A;  2QK9 A;  1VSE A;  3LAM A;  4CGG A;  4FJX A;  1S6Q A;  4IKF A;  4DTX A;  1RT6 A;  3SNN A;  5JS1 A;  2DTU A;  1KLM A;  2VWK A;  1RT4 A;  1HYZ A;  3F9K A;  2FBV A;  4DTR A;  4OKE A;  3TAM A;  1RBT A;  1VK0 A;  3THV A;  4KI6 A;  4CF2 A;  4CK1 A;  1TK0 A;  4W5R A;  4FJ9 A;  2YV0 X;  1G15 A;  1VSK A;  3M8R A;  4W5Q A;  5J2Q A;  4DQR A;  3L2W A;  4DS5 A;  1NJY A;  2HHX A;  1CXQ A;  4FJH A;  1F21 A;  4CER A;  3SZ2 A;  3VQE A;  3VA3 A;  2DY4 A;  3O4N A;  3DYA A;  3TWH A;  5E41 A;  5FRN A;  1EP4 A;  1D8Y A;  5CY4 A;  3G0Z A;  1VSL A;  2YKM A;  3AVA A;  3RRG A;  4BE0 A;  1C0U A;  4N56 A;  2G8I A;  3AA2 A;  4K8Z A;  1JLC A;  2JGU A;  3VQ5 A;  4AH9 A;  1T05 A;  4RW6 A;  3VN5 A;  1JLF A;  4FLY A;  3FFI A;  3QET A;  3V4I A;  1U47 A;  4KPY A;  1GOA A;  4DTU A;  4ELT A;  3K5O A;  3C6T A;  2OPQ A;  3LZI A;  4N5S A;  4KTW A;  1HNV A;  1KSP A;  4CF9 A;  1T7P A;  1U49 A;  3RWU A;  4J2E A;  4FM2 A;  2Z1I A;  5HRS A;  5HRO A;  3KLE A;  3LDS A;  3ZT2 A;  1IO2 A;  1EET A;  3OYG A;  4HCB A;  3VQB A;  3WNH A;  3LWM A;  4B9M A;  2IDO A;  3OS2 A;  3VQC A;  3C94 A;  1A5W A;  4I2P A;  1NOY A;  3DRS A;  3IS9 A;  2O4I A;  1JLG A;  2KFN A;  1HRH A;  3NF6 A;  3OYM A;  1Q9Y A;  3QO9 A;  3SUQ A;  2WOM A;  4Z4F A;  3OYE A;  4CEF A;  3OYH A;  3DLH A;  3AVI A;  3NCI A;  4FJM A;  2HHS A;  3EZ5 A;  1BCO A;  1KFD A;  3MEE A;  1CZB A;  1TL1 A;  4Y1D A;  3AVJ A;  4O0J A;  3MEG A;  2FBY A;  3DRR A;  4O0I A;  3CM5 A;  3IRX A;  4JS5 A;  3QEX A;  4CHY A;  3KKR A;  2WON A;  1RIL A;  1C1A A;  4EZ9 A;  4QOZ B;  1S6P A;  4OGC A;  4FXD A;  3ZT0 A;  1EKE A;  2OZM A;  3TAR A;  4OLB A;  3PO5 A;  5J2N A;  1TGO A;  1TKZ A;  3NGY A;  1EX4 A;  4FJL A;  4M3W A;  1ASU A;  4M3U A;  4UQG A;  3LAK A;  1WSF A;  2P1J A;  4CJP A;  1CXU A;  4E19 A;  2G8F A;  1QQC A;  2DFE A;  3PO4 A;  2HHV A;  3A2F A;  3I8D A;  1A5X A;  4Z4I A;  1J9A A;  1IKX A;  4AIL C;  1S1W A;  3HJF A;  4DU1 A;  4QAG A;  4CGI A;  4HVJ A;  3OYF A;  3S9H A;  4CEE A;  1RT2 A;  2G8K A;  4KV8 A;  3HPH A;  4CIF A;  1QE1 A;  4B9U A;  4JRQ A;  1JKH A;  1S1T A;  3ALY A;  5J2M A;  4AHU A;  5KRS A;  3EYZ A;  4E7H A;  3NBP A;  4E7L A;  3QES A;  3AVK A;  1TV6 A;  2NUB A;  3HT3 A;  1ASV A;  4CHQ A;  1NK7 A;  1NOZ A;  1WAJ A;  3ZSR A;  3JSM A;  3SQ1 A;  3AO1 A;  3TR8 A;  1NJW A;  2F8S A;  1FXX A;  2E4L A;  1IKW A;  4I2Q A;  3LP2 A;  4CEQ A;  4YFU A;  4W5N A;  2XHB A;  3ZCM A;  5D3G A;  4FYD A;  5HRP A;  1VSJ A;  3AVM A;  3MED A;  4FK4 A;  2FBT A;  4BDP A;  3AVN A;  3T3F A;  3NH1 A;  1HMV A;  3PX0 A;  3KTQ A;  3TAE A;  3PY8 A;  1GOB A;  3DM2 A;  4GW6 A;  4K8X A;  1VSH A;  3VQ7 A;  3ZT1 A;  4I7F A;  4FJN A;  3DOK A;  3E01 A;  1A5V A;  3OY9 A;  4DSI A;  1U45 A;  1WSG A;  1BQM A;  4C8K A;  3RMC A;  4F8R A;  5J1E A;  2KTQ A;  3ZSV A;  3NDK A;  1LWF A;  2X6S A;  1RDA A;  4N41 A;  4YNQ A;  4LSL A;  1LW2 A;  3NFA A;  1RT1 A;  3HVR A;  3OYD A;  4E3S A;  1X9W A;  1XWL A;  4CHN A;  1SUQ A;  4IFV A;  3HPG A;  3VQP A;  3KK2 A;  4FM0 A;  3U3Y A;  4FZY A;  2QKK A;  4H8K A;  1B92 A;  4FZZ A;  4KRE A;  2I5J A;  4W5O A;  2KFZ A;  3L2V A;  1BGX T;  1HPZ A;  1LAW A;  3KJV A;  3SUN A;  3C95 A;  4DMN A;  4HHT A;  3MXM A;  1C1C A;  4CEO A;  2A1S A;  4BE2 A;  4Z4E A;  3AV9 A;  1SL0 A;  5T7B A;  2FC0 A;  3P5J A;  4BAC A;  1NK4 A;  1W0H A;  1K6Y A;  1T8E A;  4J2B A;  3K59 A;  2JLE A;  3V1Q A;  2IS3 A;  3NGI A;  4OPJ A;  4MFB A;  5KTQ A;  3LP0 A;  4BDZ A;  4CJ4 A;  4DLG A;  3KIO A;  2P5G A;  1BIS A;  3ZSX A;  4FJG A;  4FJJ A;  3TAF A;  3AVG A;  1RDB A;  3ITH A;  3DLR A;  4BDY A;  3HO1 A;  1S1V A;  1RTD A;  2HMI A;  3L3V A;  2G8V A;  3VQ6 A;  1JLE A;  1VSF A;  4FJI A;  1KVC A;  3B6O A;  1X9S A;  4PQU A;  4ZTJ A;  1WSH A;  5KI6 A;  3DLK A;  2R7Y A;  2YNG A;  3V9W A;  1TAU A;  4B08 A;  4FJ8 A;  2B4J A;  2D0A A;  3AA3 A;  1RTI A;  2Z1J A;  5C25 A;  2XO7 A;  4PUO A;  3SV3 A;  4CJ5 A;  4KHQ A;  2HVH A;  4HUE A;  1Z25 A;  3OYN A;  1UAX A;  4LY7 A;  3RRH A;  4HTU A;  4CED A;  3H08 A;  3ISN C;  4LSN A;  4CIE A;  4W5T A;  4DWI A;  3NF7 A;  4O4G A;  4QCL A;  3K5N A;  1QSS A;  1QSY A;  4DQP A; 
#chains in the Genus database with same CATH topology
 4JI7 K;  4DS4 A;  4EP4 A;  1VQ5 N;  2F9T A;  4AHC A;  4ZTF A;  2O8C B;  4WE1 A;  2NZT A;  4B1U B;  5AQX A;  4DR4 K;  2YHA A;  1I39 A;  2OPS A;  2O4G A;  3RSE B;  3SBT A;  1DLO A;  2ATQ A;  4MLH A;  3SUO A;  1NKB A;  3LPT A;  3HRG A;  3DOL A;  1EO1 A;  3LP1 A;  4BR9 A;  2QWO A;  3J7A P;  3TAB A;  1N36 K;  4JLH A;  3VQ4 A;  5AQT A;  3U8X A;  3ZX0 A;  4DTO A;  1W7A A;  3T7Z A;  2YCH A;  3MN6 A;  1C1B A;  4JKA A;  5KPR A;  3G4S N;  3S3M A;  3H1Q A;  4IZ9 A;  5CYM A;  4CJE A;  5AQO A;  4CJR A;  3ZET B;  2BAN A;  4GV6 A;  4IFY A;  1IBM K;  4FLX A;  4DR5 K;  5KPZ A;  2NRR A;  4CGJ A;  1OH7 A;  1VRU A;  3M1F A;  4I6M B;  4FLT A;  1L3S A;  3KVG A;  1HR0 K;  1QQN A;  4FCY A;  3S3O A;  2DPN A;  4KFB A;  1WSE A;  3MX5 A;  4K41 A;  1BUP A;  3CM6 A;  3U9Z A;  4FWP A;  3ZSW A;  4DR7 K;  4CFC A;  2GV9 A;  3KLI A;  4CEC A;  4FLV A;  1YIJ N;  1WNS A;  2F96 A;  4IG0 A;  1GLD G;  3QLH A;  3ID6 A;  1TL3 A;  4O44 A;  5HLF A;  1W9H A;  4CGF A;  3S41 A;  4F2S A;  1KLN A;  4ID5 A;  3SCX A;  3CYM A;  3DI6 A;  4DQQ A;  5EY4 A;  3THW A;  4BR4 A;  3QBX A;  5CZ2 A;  1X9M A;  4CJ3 A;  3WXK A;  3FFK B;  4I9L A;  1C6V A;  1BIZ A;  1WSJ A;  5CE3 A;  2D0C A;  4TSX A;  1RNH A;  4CIG A;  5M1O A;  2YX6 A;  5FDL A;  3G6E N;  1WN7 A;  3IG1 A;  3I33 A;  4Q5V A;  5CR4 A;  3F9M A;  3K5M A;  1YUW A;  5GIO A;  3EKU A;  1JCE A;  3HVT A;  2PY5 A;  5AJ3 K;  4B1Z A;  2ASO A;  4CFB A;  4JKE A;  1KAY A;  3JAM O;  4H5T A;  3WNE A;  1RGI A;  3NGZ A;  1KVB A;  3CPW M;  3U6F A;  2NRW A;  3J7Z O;  4B8C A;  3NE6 A;  4JRP A;  2AP1 A;  3WXM B;  4L8R B;  4FWR A;  3R9P A;  4KH4 A;  4FZX C;  3CJ7 A;  1DGK N;  3WXJ A;  4BRK A;  3ENO A;  3PX4 A;  2HST A;  3ULD A;  3RR7 A;  2HNY A;  4QS9 A;  3RMA A;  4B3R K;  5SZT A;  4DF8 A;  1Q18 A;  1L5U A;  1EXQ A;  5HRR A;  4CHZ A;  2CGL A;  3B6P A;  3BGR A;  4X65 K;  3TAG A;  1JL1 A;  2VG7 A;  4Z4G A;  2AJQ A;  1IKV A;  3JXU A;  2PYJ A;  3VEY A;  4CZL A;  3VQ9 A;  3OYL A;  2HHT A;  3J7Y P;  3MEC A;  1REV A;  3QIC A;  2XY6 A;  3BP8 A;  3SUP A;  5AQM A;  4PHT X;  1TK8 A;  1TYQ B;  2O8E B;  3DLE A;  2IC3 A;  1NK0 A;  4EP5 A;  1N6Q A;  4DU3 A;  3CFO A;  5AQN A;  1LW0 A;  3HPO A;  4CK2 A;  3M8S A;  2XY5 A;  2B5J A;  5F0X A;  3P31 A;  4H4O A;  1SKR A;  1QS4 A;  3UB5 A;  5KGX A;  1B9F A;  4CCH A;  1T03 A;  4B3O A;  4C23 A;  1JXB A;  2W40 A;  1RTJ A;  4KB1 A;  3NVM A;  3NHG A;  4FM1 A;  2QEX N;  1NK6 A;  1SQK A;  3VEV A;  1XHX A;  1BU6 O;  2UUA K;  3CJC A;  2A40 A;  2RF2 A;  4HUG A;  2ETJ A;  4FSV A;  2FBX A;  3SBG A;  3UKU B;  1MU2 A;  1HQU A;  1K8K B;  4CF1 A;  3C6A A;  3VEN A;  4B3T K;  1Z6R A;  2HW3 A;  5GIP A;  1Q7Y O;  2ZM6 K;  3LM9 A;  4FVM A;  3T1H K;  3CQX A;  4MQ3 A;  3WEE A;  3BDP A;  3OVN A;  2E20 A;  1BI4 A;  3NH0 A;  4DR1 K;  4Z4C A;  5M1P A;  2Q31 A;  5JVG L;  1RBU A;  3K2P A;  4XH5 A;  3PIO L;  3BF1 A;  3AGR A;  4JI2 K;  2VG6 A;  4DB3 A;  1ASW A;  3FZF A;  3F2K A;  3H46 O;  3K57 A;  3VPZ A;  4F3T A;  2O8B A;  1HPM A;  2E6M A;  3EKS A;  3ENH A;  3QEW A;  1NNE A;  1JCG A;  2DFF A;  3VQ8 A;  2D0P A;  5FPN A;  4JK8 A;  4E1M A;  1BG3 A;  4NLC A;  3LAM A;  3TTF A;  1S6Q A;  2BTF A;  3VF2 A;  3ULE A;  3SNN A;  5AQQ A;  4A2A A;  1BOT O;  2VWK A;  3CC2 N;  3TAM A;  3THV A;  1RBT A;  4LF6 K;  1NGJ A;  4W5R A;  2YV0 X;  2HHX A;  4M63 C;  3VOV A;  1LCU A;  1F21 A;  4JHD B;  3MDQ A;  3O9Q A;  1W2B M;  3WQT A;  1EP4 A;  1D8Y A;  3AVA A;  3LL3 A;  2NRX A;  3RRG A;  4BE0 A;  1NGF A;  3NMU A;  1JLC A;  3VQ5 A;  3QET A;  1OVY A;  1GOA A;  1P8Z A;  3K5O A;  3QB0 A;  3C6T A;  2OPQ A;  4N5S A;  1T7P A;  3RWU A;  4FM2 A;  5HOO A;  3CJB A;  3G25 A;  4BRN A;  1N34 K;  1HNZ K;  4NXN K;  3LWM A;  4B9M A;  2IDO A;  3VQC A;  1A5W A;  1JLG A;  1HRH A;  3OYM A;  1S72 N;  1S3X A;  3SUQ A;  3OYE A;  2HHS A;  3LDL A;  2W6L A;  3AVJ A;  1Y64 A;  1Q86 O;  1HKC A;  4JS5 A;  3IRX A;  3QEX A;  3MK6 A;  1NGG A;  1RIL A;  3DXM B;  2GX9 A;  4QOZ B;  3HOS A;  3MMV A;  2Q2R A;  3PO5 A;  3D2E B;  4FJL A;  4M3U A;  4UQG A;  1RDW X;  4BC2 A;  2DFE A;  4ILH A;  3A2F A;  3AAQ A;  4JKD A;  4Z4I A;  1J9A A;  3HJF A;  2EWS A;  3GG4 A;  2G8K A;  4KV8 A;  4B3M K;  3HPH A;  4CIF A;  2ZJQ L;  4B9U A;  4WFB L;  4AHU A;  1D4X A;  2JWK A;  5KRS A;  5AQG A;  3EYZ A;  3QES A;  2HBK A;  2NUB A;  1WAJ A;  3U9D A;  3ZSR A;  3SQ1 A;  3TR8 A;  1NJW A;  1GLF O;  3H3N O;  4FWK A;  2E4L A;  5JLH A;  2XHB A;  4CZM A;  3TSU A;  3AVM A;  1NGB A;  1GOB A;  2V51 B;  3C0B A;  3DM2 A;  2D4W A;  3Q7B A;  4JI5 K;  4FJN A;  3E01 A;  1A5V A;  3DXK A;  4IDH A;  4CJ7 A;  1BQM A;  3T69 A;  5IT9 O;  2E5L K;  2KTQ A;  4A61 A;  1RT1 A;  3OYD A;  4E3S A;  1N33 K;  1XWL A;  1EQY A;  1SUQ A;  3KK2 A;  3HPG A;  3U3Y A;  4FZY A;  4H8K A;  2KFZ A;  1LAW A;  1NMN A;  2A41 A;  4FL9 A;  1C1C A;  4CEO A;  3P5J A;  3WT0 A;  1W0H A;  1WBD A;  4GKK K;  1T6C A;  1T8E A;  4O8U A;  4BDZ A;  4DLG A;  3AVG A;  1RDB A;  3DLR A;  3C6H A;  2I7N A;  5AZJ B;  4KH6 A;  1RFQ A;  1MWK A;  3UKR B;  1VSF A;  4PQU A;  1HKB A;  2A5X A;  1TAU A;  5JIC A;  4FJ8 A;  2CH5 A;  5C25 A;  1IG8 A;  3SV3 A;  4IEI A;  4KHQ A;  3D2F A;  3OYN A;  3CME N;  4LY7 A;  2W41 A;  3E66 A;  3H08 A;  4BG8 A;  3NF7 A;  4DQP A;  1HLU A;  1V4T A;  4LH5 A;  2E6L A;  1HX1 A;  1BL3 A;  4DR3 K;  2RHK A;  4BC3 A;  5A2Q O;  3R1X A;  1VAZ A;  4BRH A;  2VWB A;  3SPZ A;  1RTH A;  4Y1C A;  2O8F A;  2QA4 N;  1GOC A;  2IIR A;  4JD2 A;  3MAQ A;  3CFR A;  5BRH A;  2HNZ A;  4DR2 K;  3L8B A;  2NRZ A;  3THX B;  3EO3 A;  2GWK A;  2OA8 A;  1N32 K;  4LF9 K;  2ITM A;  1FKP A;  3O08 A;  1XHZ A;  1NKE A;  3GL1 A;  2HB5 A;  1IBK K;  3V6D A;  1RBR A;  3QIN A;  2GUI A;  2P9L B;  5JS2 A;  4M3R A;  2XY7 A;  2GEM A;  3RR8 A;  4YDU C;  1U6Z A;  4MO5 A;  4CGD A;  4BRC A;  5BR8 K;  3QFP A;  3HK2 A;  5DK5 A;  1KCF A;  4O5B A;  3PX6 A;  4B1Y B;  2VYP A;  4B1X B;  4BC4 A;  1KTQ A;  1MWM A;  1S1X A;  5GAD P;  3VGL A;  1YIT N;  4EFH A;  4PKG A;  3VEO A;  3ZSZ A;  1RDD A;  4KHU A;  2W42 A;  3LM2 A;  3MXI A;  3TTD A;  5E26 A;  3WNG A;  2P9S A;  3AVC A;  3GE1 A;  3CET A;  4KKO A;  4A5B A;  5ADX H;  4I9Q A;  2GWJ A;  5LL6 Z;  4H5V A;  5HL7 L;  4OJR A;  4CJU A;  4F4K A;  3W3D A;  2PYL A;  4DV1 K;  4BR5 A;  4ISG A;  3OYC A;  4HCB A;  3I0S A;  2Q3S A;  3DRP A;  4CD1 A;  1QHT A;  5HRN A;  1KXP A;  4BRI A;  4G9Z A;  3L2U A;  1JXE A;  4DV6 K;  4CE9 A;  3P83 D;  2KZZ A;  2P9U B;  3C65 A;  2QWR A;  5JLF A;  3VTI A;  3TAQ A;  3ZT4 A;  4PY5 A;  3QNN A;  3OYI A;  1HQE A;  4LFA K;  3R3L A;  3LPU A;  4DSK A;  4CW7 B;  1ZYQ A;  4WQ4 A;  1GLC G;  1RCH A;  3G10 A;  3O4Q A;  1N5Y A;  3KLH A;  3ATV A;  4CHO A;  1H1V A;  5BRE A;  5KGW A;  4M3Y A;  3VET A;  4DCH A;  2ZJP L;  5C0Y A;  3OS0 A;  3SK3 A;  3AAR A;  1B9D A;  4CD3 A;  4DSE A;  3MWP A;  2RPI A;  1SL1 A;  3AO4 A;  1X1P A;  4K25 A;  1UWB A;  2ZE2 A;  4CVN E;  1BCM A;  4H5W A;  3ZEU A;  3DMJ A;  3LZJ A;  2OTJ N;  1DTQ A;  4KHP K;  4LF5 K;  4FPB A;  1OVQ A;  4RG8 A;  5C10 A;  4PWD A;  2EX3 A;  3H1V X;  2YJF A;  5I3U A;  4FK2 A;  4EZ6 A;  3LP3 A;  3C7N A;  4JKB A;  3QIP A;  1X3M A;  3CCM N;  1KVA A;  3CXC M;  1TAQ A;  3P4I A;  4DQ8 A;  3IFR A;  1C0T A;  1J5E K;  4YOY A;  5DMR A;  3H45 C;  3HI0 A;  2X6N A;  3HXM A;  3UIQ A;  2BE2 A;  5LY3 A;  2QXF A;  3AA5 X;  3TTC A;  4CEA A;  4DTJ A;  3V9U A;  3EZW A;  5BR9 A;  3WXI A;  4DQS A;  3KD1 E;  4J2A A;  1YF5 L;  4N47 A;  3HO1 A;  2KQ2 A;  4DHY A;  2GEL A;  3SJJ A;  2PFU A;  3VQD A;  1YT3 A;  4KHN A;  2YJE A;  3RTV A;  4G1Q A;  1VHX A;  2IGI A;  1Z26 A;  3B8A X;  1L3U A;  3VEW A;  4LF4 K;  2X78 A;  3M8P A;  2BDP A;  1YTU A;  1VRT A;  5FRM A;  4H03 B;  3ZX3 A;  1Y97 A;  4C8N A;  1VSM A;  3UE5 A;  4CJL A;  1BA0 A;  4AHT A;  3HYF A;  5F1X A;  3ENB A;  4RW4 A;  3AAP A;  1D5A A;  4NYN A;  4H0O A;  4YOU A;  5ELZ A;  2ZGY A;  1NK5 A;  4JI8 K;  4X66 K;  1QHA A;  3O3F A;  1N8R O;  2G8H A;  4BRF A;  5E84 A;  3VF4 A;  2HVI A;  3FZK A;  1E4F T;  3JYT A;  4X62 K;  4CJK A;  1I3A A;  1LWC A;  5JMV A;  4CFA A;  2D0O A;  4BRL A;  3KK1 A;  4BRM A;  3CG7 A;  3H6E A;  1Q9X A;  4DV7 K;  1YTA A;  4KTZ A;  2E2Q A;  4BE1 A;  4FWM A;  4AHV A;  2HHU A;  4PL7 A;  3L4I A;  1P90 A;  3FZL A;  1JL2 A;  2Z1H A;  4GV9 A;  4CHP A;  3TAP A;  1UA0 A;  4A57 A;  3CC4 N;  3IUC A;  4FK0 A;  3RMD A;  4NYF A;  3VA0 A;  3WQU A;  5AZI B;  1QQM A;  4K43 A;  2YNF A;  4BWJ A;  3S3N A;  4B8A B;  3CCV N;  2NRH A;  4GY2 B;  5SWM A;  3CCJ N;  4Z4H A;  4CZJ A;  3AO3 A;  5C24 A;  4CGG A;  3K0S A;  4DTX A;  5BRF A;  2DTU A;  3F9K A;  4GV3 A;  4KI6 A;  2O8D A;  1TK0 A;  4FJ9 A;  3ZEU B;  1VSK A;  3VTH A;  4DQR A;  3SMS A;  3L2W A;  4MDB A;  4DS5 A;  1CXQ A;  4CER A;  3SZ2 A;  1IV0 A;  2UYT A;  4JKH A;  2VGM A;  4A62 A;  2P9I A;  3A5L C;  3A5M C;  3AA2 A;  3MCP A;  2QWL A;  4IJN A;  3BZK A;  1QQO A;  4RW6 A;  3VN5 A;  1JLF A;  4FLY A;  3IMX A;  4KPY A;  1NM1 A;  4DTU A;  2KKZ A;  4WQ5 A;  2WUS A;  3FGU A;  1ATS A;  4KTW A;  3THY A;  4J2E A;  5MLC Q;  5HRS A;  4L3Q A;  3IKM A;  2VCP A;  3ZT2 A;  3OYG A;  3AY9 A;  3HBT A;  1NOY A;  1BA1 A;  2YI1 A;  2UXC K;  2KFN A;  3NF6 A;  3EL2 A;  3DLH A;  4FJM A;  1BCO A;  1KFD A;  3MWT A;  1CZB A;  4BC5 A;  1BDG A;  2FBY A;  1M1K O;  3DRR A;  4O0I A;  3CM5 A;  4R79 A;  4CHY A;  3KKR A;  1C1A A;  2E2P A;  4EZ9 A;  2WC9 A;  5J2N A;  4M3W A;  1TKZ A;  1EX4 A;  3LAK A;  2P1J A;  1NLV A;  4B9Q A;  2G8F A;  4KH5 A;  4E19 A;  2OAN A;  3I8D A;  4FOE A;  1IKX A;  5CHI A;  3FLC O;  4JKF A;  4QAG A;  2QWN A;  4AF1 A;  3OYF A;  3S9H A;  5AFU H;  5AQU A;  3ALY A;  5J2M A;  3THW B;  4YDU A;  2YHY A;  3CJ9 A;  1TV6 A;  1ASV A;  2ASM A;  1RDU A;  4I2Q A;  3PLA A;  3ZCM A;  3SMP A;  2FBT A;  3OHR A;  4EAH D;  2YHX A;  1BO5 O;  4IOX A;  4IFE A;  4JI3 K;  4C1N I;  5GAG P;  1EWR A;  2QWM A;  4OPH A;  4DSI A;  3OY9 A;  1U45 A;  4C8K A;  4F8R A;  1NGH A;  3ZSV A;  1LWF A;  2X6S A;  1RDA A;  3BF3 A;  3O1B A;  1NGD A;  3HVR A;  4CHN A;  3VQP A;  2IVN A;  4IFV A;  1GLA G;  1ATR A;  4KRE A;  2I5J A;  3Q7C A;  3DLL L;  3L2V A;  1BGX T;  3J80 O;  3KJV A;  3MXM A;  3AV9 A;  5FPD A;  1NK4 A;  2FC0 A;  1NJI O;  4J2B A;  3I56 N;  3V1Q A;  1GLE G;  3NGI A;  4MFB A;  2P5G A;  1ATN A;  3FR0 A;  3LP0 A;  3KIO A;  1GLJ O;  3TAF A;  3EE8 A;  4CZE A;  3GBT A;  3I8B A;  1S1V A;  1RTD A;  1JLE A;  1X3N A;  4FJI A;  5M1K A;  1BWF O;  5GAE P;  3AA3 A;  1RTI A;  2Z1J A;  2XO7 A;  4BRE A;  3VEZ A;  4HTU A;  4CED A;  1OKJ A;  4LSN A;  4CIE A;  4W5T A;  4DWI A;  2UUB K;  1XC3 A;  4O4G A;  4QCL A;  3K5N A;  1QSY A;  4FWN A;  4PA1 A;  4CJS A;  4OKK A;  4HUF A;  4CF8 A;  4JEP A;  4M41 A;  1WAF A;  3L3U A;  2YKN A;  3WUH A;  1WB9 A;  3ZYY X;  3J81 O;  4AHR A;  4YY3 K;  4NO7 A;  1SL2 A;  4NCA A;  2RN2 A;  1J53 A;  1ZBF A;  4A59 A;  1HNW K;  3CCL N;  1K8A O;  3TI0 A;  3V9Z A;  3L2Q A;  1SZ2 A;  1VQ6 N;  1ZBI A;  3T1Y K;  4YOX A;  4DV0 K;  4FLZ A;  1QVG M;  3QEI A;  3CC7 N;  4KHW A;  4KHY A;  2P9K A;  4ID1 A;  1RBV A;  4C8L A;  1S1U A;  1NJZ A;  1LWE A;  4IBN A;  4DTM A;  4C8O A;  5AQR A;  3NF9 A;  5C12 A;  4H5N A;  2FF3 B;  3CCU N;  1R0A A;  1OH6 A;  4DG1 A;  2X74 A;  4IG3 A;  1XC9 A;  3VQA A;  1JLQ A;  4OO1 J;  5LJW A;  5C2D A;  1XQS C;  1NG9 A;  3P39 A;  4CES A;  5CYQ A;  1J5O A;  3R8E A;  3K58 A;  4FW1 A;  4MDA A;  1S5J A;  2B6A A;  2P9N A;  3QIO A;  3WEE B;  1BI4 B;  5BPN A;  2AA4 A;  4Z94 A;  4BRQ A;  1U04 A;  3IAY A;  3OJS A;  2OZS A;  1C0M A;  4JKG A;  1HNI A;  2H3G X;  4WF9 L;  3EN9 A;  1NGA A;  2A1R A;  2HF4 A;  4H0X B;  4EHU A;  1TK5 A;  4O5F A;  4BRA A;  4B9S A;  3O1W A;  3AVB A;  4E7I A;  3O3H A;  4NLB A;  2G8U A;  4CJQ A;  2O8B B;  4O55 A;  3WNF A;  4ELU A;  3TU5 A;  2P51 A;  1WSI A;  5KRT A;  4DFJ A;  1RT5 A;  2XRI A;  1C0G A;  1TUU A;  1KAZ A;  3FZM A;  3PSI A;  4ISE A;  4KRF A;  4CZH A;  5AQS A;  2A6A A;  3L4Q A;  4B9L A;  3HM8 A;  3ULE B;  5K14 A;  4CBU A;  3MXJ A;  4WCE L;  4OGE A;  4H0T B;  5BPM A;  4IDK A;  4DSF A;  1U48 A;  4JK7 A;  1NGI A;  4ICL A;  3AO5 A;  2QWQ A;  3NAE A;  5J2P A;  3SAH A;  1D9F A;  1C0F A;  4BR0 A;  1NKC A;  1LV5 A;  2IAJ A;  1VSD A;  2P9P A;  3CQ8 A;  3QNO A;  2ZQB A;  2ITG A;  4QS8 A;  4E89 A;  3MN9 A;  3FZH A;  1ILY A;  5EX5 A;  1VQ4 N;  1HNX K;  1NGC A;  3OYK A;  4CEZ A;  4B1V A;  3SYZ A;  2V7Z A;  1QZ5 A;  4DUZ K;  5H1S Q;  1XI1 A;  1NGE A;  4DFK A;  1CZ9 A;  5LMN K;  4DU4 A;  3H3O B;  2QKB A;  3NH2 A;  3CFP A;  4BRD A;  4U7B A;  1FKO A;  4DTS A;  3KKS A;  4H5R A;  3G71 N;  1O1W A;  3HP6 A;  4C1N K;  1YVU A;  3SQ2 A;  2NNW A;  2OYQ A;  4UY8 O;  3T1A A;  1BIU A;  3V9X A;  2O8C A;  3V9S A;  4B9T A;  3AO2 A;  3KD5 E;  4JNE A;  4BY9 C;  2BGG A;  1LAV A;  1IH7 A;  2J4R A;  1ESV A;  4XIU A;  4KHS A;  1YJN N;  5CZ1 A;  1RT7 A;  1SS6 A;  3RSE A;  4NCG A;  1BQN A;  4X64 K;  5D3G A;  2LSN A;  5FRO A;  2HBL A;  3LDQ A;  3AA4 A;  1ZXO A;  2P5O A;  4LF7 K;  1VSI A;  5BRD A;  3L2R A;  4B3S K;  4DTP A;  3O9U A;  3P1G A;  5AQP A;  2Z1G A;  3ZET A;  1ZBH A;  4CBX A;  2YNH A;  1BHL A;  2D1K A;  2OPP A;  4ELV A;  2FXU A;  1KFS A;  4JI1 K;  5AQL A;  3D6R A;  4FLU A;  4DSL A;  2ZF5 O;  3QDK A;  4I6M A;  1FK9 A;  4JI0 K;  3VGK A;  4B1W B;  2F8T A;  2ZD1 A;  4M45 A;  2GUP A;  4IO9 L;  1L3V A;  4DSJ A;  1ITG A;  4FWO A;  4IEE A;  5EU7 A;  3DXK B;  4RW8 A;  2E2O A;  3A8Y A;  3VGM A;  3HM9 A;  1TUY A;  2HF3 A;  5EOY A;  3OBY A;  4ZHR A;  4IOA L;  2KZM A;  1RDC A;  5GIN A;  2YHW A;  3LAL A;  1NBW A;  3KK3 A;  3SI6 A;  2YNI A;  4KI4 A;  4DLE A;  3QML A;  3VEX A;  1YXQ A;  1M90 O;  1NMD A;  5FPE A;  1VQN N;  2HBJ A;  4AM7 A;  1CZA N;  3M6G A;  1R59 O;  5M1N A;  4LFC K;  4M3T A;  4AM6 A;  2RE2 A;  4Y0W A;  4OVL A;  1WLJ A;  4JKC A;  3F5T A;  2QK9 A;  1VSE A;  3EEQ A;  5JS1 A;  3D2F B;  1KLM A;  4DTR A;  2FBV A;  1JCF A;  4OKE A;  2ZJR L;  4CF2 A;  3KWI A;  4CK1 A;  2NLX A;  1NJY A;  4F9O A;  4H0Y B;  3VA3 A;  3O4N A;  4LF8 K;  3DYA A;  3TWH A;  3A5N C;  3L6Q A;  3O80 A;  1HJO A;  5E41 A;  1YHQ N;  1WOQ A;  2GTD A;  5CY4 A;  3G0Z A;  1VSL A;  2OTL N;  3RVC A;  2G8I A;  2QI2 A;  2O8F B;  2VQE K;  2JGU A;  1T05 A;  5M1F A;  2F4V K;  3MN7 A;  4JD2 B;  1U47 A;  4FPA A;  1YVN A;  4ELT A;  1XUP O;  1KSP A;  1HNV A;  1V4S A;  2FSK A;  5HRO A;  3KLE A;  1EET A;  5AQZ A;  3WNH A;  4K0K K;  2IVO A;  4JI4 K;  4FOI A;  2UXD K;  3CQY A;  3DRS A;  2O4I A;  3E9O A;  1T44 A;  4CZK A;  4DV2 K;  2WOM A;  1K73 O;  4CEF A;  4JK9 A;  3CJA A;  3AVI A;  4DKW A;  3EZ5 A;  4BQZ A;  1TL1 A;  4Y1D A;  1XNR K;  3W0L A;  1HKG A;  2WON A;  1S6P A;  4OGC A;  4FXD A;  3ZT0 A;  3ZX2 A;  1EKE A;  1TYQ A;  2O8E A;  4OLB A;  2Q0R A;  1Q81 O;  1CXU A;  3PO4 A;  2P9S B;  1A5X A;  5TKW A;  4AIL C;  1VQ7 N;  1S1W A;  2E1Z A;  4CGI A;  4CEE A;  4BGB A;  3BY5 A;  3M3Z A;  1QE1 A;  1WUA A;  5C2F A;  4EIA A;  3R6M A;  4E7H A;  1YI2 N;  4NXM K;  3AVK A;  3HT3 A;  3HZ6 A;  1NK7 A;  4FVU A;  3JSM A;  2F8S A;  2ZGZ A;  1FXX A;  5F2R A;  4CEQ A;  4O8K A;  3OBW A;  4FYD A;  4PL8 A;  2F9W A;  3MED A;  3UKU A;  4FK4 A;  4BDP A;  1GLB G;  1K8K A;  3NH1 A;  1HMV A;  1KC8 O;  3CCE N;  4GW6 A;  2FF6 A;  2UXB K;  1VSH A;  3KK7 A;  4I7F A;  2NRT A;  3DOK A;  3RMC A;  5J1E A;  4YNQ A;  2KHO A;  4LSL A;  3NFA A;  3HTV A;  2QXL A;  1X9W A;  4KAZ A;  4FM0 A;  1B92 A;  4W5O A;  3CPE A;  4JYA K;  1KAX A;  4BR2 A;  2A1S A;  3OA9 A;  4A2B A;  5T7B A;  1OH5 A;  2WFB A;  3LDO A;  3K59 A;  1KQS M;  2VQF K;  2JWL A;  4OPJ A;  4PKI A;  2CGJ A;  2BH1 A;  3O9T A;  4FJG A;  3ZSX A;  4OPA A;  3L3V A;  3BUZ B;  1KVC A;  1X9S A;  3O8M A;  5FLX O;  3DLK A;  1DT9 A;  2YNG A;  3V9W A;  5EVZ A;  2D0A A;  4IWV A;  4PUO A;  4CJ5 A;  3DAW A;  3CJ1 A;  3GDQ A;  3C7N B;  1MDU B;  3RRH A;  3O9R A;  3CHW A;  3ISN C;  4KB0 A;  1E4G T;  1DKG D;  4DR6 K;  4KO0 A;  4RW7 A;  4JHD A;  4K8X A;  1VQ9 N;  3SQ0 A;  4CJT A;  4IO8 A;  1TKT A;  5AQJ A;  3T19 A;  1S9E A;  2HOE A;  3CD6 N;  1NK9 A;  4J2D A;  4BR7 A;  4E1J A;  4FJK A;  1L3T A;  2HHW A;  4B9N A;  1JJ2 M;  3O3G A;  3O9S A;  3J8A A;  4LC9 B;  4MLE A;  4E0D A;  1E3M A;  2Y1J A;  4DF4 A;  3I0R A;  5FPM A;  5I9E B;  3ZSO A;  3P38 A;  1S22 A;  5LMU K;  4FJ5 A;  3D0P A;  3EY1 A;  5HBM A;  3CCR N;  2FSN A;  5B8H A;  4JS4 A;  4DFM A;  1MA9 B;  4XEI A;  4FLW A;  2G8W A;  3M8Q A;  3DXM A;  1HYV A;  3E9P A;  1SV5 A;  1G99 A;  2VG5 A;  1RBS A;  4M7X A;  4IJA A;  3QEV A;  2D0B A;  1SKW A;  4M3X A;  3D45 A;  5KQD A;  3SQ4 A;  3D2E A;  4OLA A;  4LFB K;  1Z05 A;  5ADX A;  3SAG A;  5DM7 L;  3LDN A;  5KQ8 A;  3MCA B;  4LD0 A;  4WFA L;  4YOW A;  4R5P A;  3KZB A;  3ASM A;  4M7Y A;  4DV5 K;  1FJG K;  3ID8 A;  4N76 A;  4CJF A;  3KLG A;  2E2N A;  4J8F A;  2FLO A;  5AQH A;  4E7K A;  1HYS A;  3VER A;  3PUF A;  3TAN A;  3OYB A;  3OW2 M;  2ASP A;  1JLA A;  3SV4 A;  4H0P A;  1U2V A;  1LOT B;  5KPT A;  4DTN A;  1SKS A;  2UU9 K;  4WQ4 C;  4A5A A;  3VMF B;  1ZBS A;  4CJW A;  1O13 A;  4CFD A;  2HMP A;  2V52 B;  3DLB A;  1IG9 A;  1HJR A;  3I55 N;  4U67 L;  4K42 A;  3LWL A;  1SAZ A;  3ZLJ A;  4FWQ A;  2IOC A;  4JN4 A;  2Q0U A;  3WXL A;  2O8D B;  5AR0 A;  4CEB A;  1DTT A;  4OPK A;  3AVF A;  3V1R A;  4GVM A;  4IOC L;  1UOC A;  4AQY K;  3PV8 A;  2P9I B;  1TKD A;  4DV3 K;  3CI5 A;  2VWJ A;  4ILJ A;  3K9K A;  4JI6 K;  5AQF A;  1VQP N;  3ZSQ A;  4CGH A;  5AQV A;  3BZC A;  2CH6 A;  4GMJ B;  2HHQ A;  3THY B;  3HL8 A;  4M42 A;  5AZJ A;  4C8M A;  3UKR A;  4BWM A;  4Z0U A;  2V7Y A;  2EHG A;  5C42 A;  3N4P A;  3VF6 A;  1IJJ A;  1TKX A;  1QZ6 A;  3O4W A;  3AVL A;  3OYA A;  1WBB A;  1NU0 A;  3FE1 A;  2NRV A;  4XH4 A;  4CK3 A;  4HCC A;  1ZBL A;  1J54 A;  3NF8 A;  1S9G A;  3KLF A;  4DQI A;  2PZS A;  4OKJ A;  3RMB A;  4Q0B A;  4FW2 A;  5GAH P;  1XNQ K;  3TPQ A;  4OX9 K;  2KLA A;  2A42 A;  1IKY A;  3CMA N;  2QWP A;  4HTL A;  1XMO K;  1RT3 A;  2F7T A;  3LAN A;  3QBW A;  3QEP A;  3THX A;  1VQL N;  4F3O A;  3ZT3 A;  3OS1 A;  2XY8 A;  5AQW A;  2Q1N A;  3ZSY A;  2YHB A;  4WFN L;  1VQO N;  3QFU A;  4E1N A;  3SLC A;  3K5L A;  4DV4 K;  3PIP L;  4RW9 A;  1EWQ A;  1K9M O;  1VQM N;  2P9L A;  4KTQ A;  1D9D A;  1TVR A;  4LH4 A;  5HP1 A;  1I94 K;  4BG9 A;  2A3Z A;  2DFH A;  4BRO A;  4EHT A;  3V81 A;  1DEJ A;  5BN8 A;  4FJ7 A;  4H4M A;  3SPY A;  4YOV A;  3OYJ A;  5LJV A;  3ATU A;  2GBZ A;  5I42 A;  5C15 A;  3TSP A;  4ILG B;  3DLG A;  3E1Y A;  1NK8 A;  2KW4 A;  4BRG A;  4BRP A;  1U2V B;  3U3G A;  4FWL A;  3HST B;  2HHH K;  1W97 L;  1UA1 A;  1YAG A;  1JLB A;  1U4B A;  4JV5 K;  2OPR A;  1VQK N;  3F73 A;  3QER A;  3VQQ A;  5BN9 A;  1NJX A;  2E88 A;  3M5R A;  4CJV A;  1QTM A;  4B9V A;  4DFP A;  3AVH A;  2Y1I A;  4M3Z A;  4CF0 A;  4AHS A;  4E7J A;  1CLQ A;  3BEX A;  2HND A;  5JVH L;  4NB4 A;  2D5R A;  3C6U A;  3CF5 L;  1Q8I A;  2QM1 A;  1KRP A;  4NCB A;  3OJU A;  1QSL A;  2P9U A;  4BVP A;  4F2R A;  2HBM A;  2RKI A;  3HP9 A;  2W6K A;  1ZBU A;  3V1O A;  1FW6 A;  2PAV A;  5M1Q A;  4FJX A;  4IKF A;  3MX2 A;  4YOR A;  1RT6 A;  3D7E O;  3GOI A;  3A5O C;  1RT4 A;  1HYZ A;  1VK0 A;  3K9J A;  4V19 S;  1G15 A;  3M8R A;  5J2Q A;  4W5Q A;  4WQ5 C;  4XH1 A;  4FJH A;  2DY4 A;  3JS6 A;  3VQE A;  3MN5 A;  2ZWH A;  5FRN A;  4CBW A;  4ISF A;  1T3V A;  1QVF M;  2YKM A;  5BPL A;  1C0U A;  1X9J A;  4BQL A;  4N56 A;  4K8Z A;  5AQI A;  4AH9 A;  1KD1 O;  4PKH A;  4RTF D;  3V4I A;  3FFI A;  4FO0 A;  4GKJ K;  4FWS A;  3CER A;  1ZC6 A;  4RCH A;  3LZI A;  2BUP A;  2UUC K;  3NVK A;  3CIP A;  3LDP A;  4CF9 A;  1U49 A;  4CI6 A;  2Z1I A;  1YJ9 N;  2P9K B;  4IXC A;  3LDS A;  1IO2 A;  2Q97 A;  1HUX A;  3VQB A;  2CGK A;  3OS2 A;  3C94 A;  3HSC A;  4I2P A;  3IS9 A;  1Q9Y A;  3QO9 A;  5EXW A;  4Z4F A;  3OYH A;  3NCI A;  3O6W A;  3MEE A;  4H0V B;  4BGA A;  4O0J A;  3KWG A;  3MEG A;  2WBN A;  4JAX A;  3OTO K;  1GLL O;  3CCS N;  1YJW N;  4GVE A;  2OZM A;  3TAR A;  1TGO A;  2I7P A;  3NGY A;  1ASU A;  2VGN A;  3SJH A;  1WSF A;  4CJP A;  2HHV A;  1QQC A;  2P9N B;  5AFU A;  4BVO A;  2WTU A;  3N4Q A;  4CZI A;  4DU1 A;  4HVJ A;  2IVP A;  1RT2 A;  4JKG B;  1T6D A;  4JRQ A;  4DUY K;  1JKH A;  1S1T A;  4YHH K;  3NBP A;  4E7L A;  3SAF A;  2FSJ A;  4CZG A;  4CHQ A;  1NOZ A;  3AO1 A;  3CCQ N;  3TSQ A;  4W5N A;  1IKW A;  5DM6 L;  3LP2 A;  4YFU A;  5HRP A;  1VSJ A;  3AVN A;  3T3F A;  2Q36 A;  3PX0 A;  3PY8 A;  3KTQ A;  3TAE A;  4WYB A;  3VQ7 A;  5AQK A;  3ZT1 A;  1WSG A;  2E8A A;  2OCE A;  1OH8 A;  3DJC A;  3NDK A;  4N41 A;  1LW2 A;  5TKY A;  3E9L A;  4KBO A;  2QW9 A;  2QKK A;  1J6Z A;  4FZZ A;  2PBD A;  2P9P B;  1HPZ A;  3SUN A;  3C95 A;  3O5B A;  4DMN A;  4RWT A;  4HHT A;  4Z4E A;  4BE2 A;  1SL0 A;  4BAC A;  1K6Y A;  3PSF A;  5AZI A;  2JLE A;  1XMQ K;  2IS3 A;  5KTQ A;  4CJ4 A;  3A0I X;  1NWK A;  1BIS A;  4FJJ A;  1IBL K;  2E1Y A;  3DWL A;  3KHY A;  3ITH A;  4BDY A;  3IDH A;  3VES A;  3HOT A;  4CZF A;  2HMI A;  2QTD A;  2G8V A;  5IWA K;  3VQ6 A;  3B6O A;  4ZTJ A;  1WSH A;  5KI6 A;  5AQY A;  2R7Y A;  4MO4 A;  4GNI A;  3U4L A;  4B08 A;  2B4J A;  4QS7 A;  2HVH A;  3L0Q A;  4HUE A;  1Z25 A;  1VQ8 N;  1UAX A;  3AGK A;  3EE9 A;  4YOT A;  4HWI A;  1Q82 O;  1QSS A; 
#chains in the Genus database with same CATH homology
 4KO0 A;  4PA1 A;  4CJS A;  4OKK A;  4HUF A;  4RW7 A;  4EP4 A;  4DS4 A;  4LH5 A;  2E6L A;  4AHC A;  4CF8 A;  4ZTF A;  4M41 A;  1WAF A;  3L3U A;  1BL3 A;  2YKN A;  4CJT A;  3SQ0 A;  1TKT A;  4WE1 A;  3T19 A;  4AHR A;  1SL2 A;  1S9E A;  3SPZ A;  1RTH A;  4Y1C A;  2YHA A;  4NCA A;  2RN2 A;  1J53 A;  1ZBF A;  1NK9 A;  1I39 A;  2OPS A;  2O4G A;  4J2D A;  1GOC A;  3V9Z A;  3L2Q A;  3TI0 A;  3MAQ A;  4FJK A;  3CFR A;  1DLO A;  1L3T A;  1ZBI A;  2HNZ A;  2HHW A;  2ATQ A;  3SUO A;  4B9N A;  3L8B A;  3O3G A;  1NKB A;  3LPT A;  2OA8 A;  3DOL A;  3LP1 A;  4FLZ A;  1FKP A;  3QEI A;  3TAB A;  4E0D A;  4KHW A;  4JLH A;  3VQ4 A;  4KHY A;  1XHZ A;  1NKE A;  4ID1 A;  1RBV A;  2Y1J A;  4C8L A;  1S1U A;  2HB5 A;  4DTO A;  3I0R A;  4DF4 A;  1NJZ A;  3V6D A;  1RBR A;  3QIN A;  1C1B A;  3ZSO A;  2GUI A;  3S3M A;  1LWE A;  5CYM A;  4CJE A;  4CJR A;  4IBN A;  5JS2 A;  4DTM A;  4M3R A;  2XY7 A;  4KAZ A;  4FJ5 A;  3RR8 A;  2BAN A;  4C8O A;  3D0P A;  4IFY A;  3NF9 A;  4CGD A;  3HK2 A;  3EY1 A;  5HBM A;  4FLX A;  4CGJ A;  4JS4 A;  4DFM A;  1R0A A;  4DG1 A;  5DK5 A;  1KCF A;  2X74 A;  4IG3 A;  4O5B A;  3VQA A;  3PX6 A;  1XC9 A;  4FLW A;  1JLQ A;  1VRU A;  2G8W A;  3M8Q A;  1HYV A;  4FLT A;  1KTQ A;  2VG5 A;  1SV5 A;  1RBS A;  1S1X A;  4CES A;  3QEV A;  2D0B A;  1SKW A;  1L3S A;  4KI4 A;  5CYQ A;  4FCY A;  4M3X A;  3D45 A;  3SQ4 A;  3S3O A;  1J5O A;  4KFB A;  1WSE A;  3ZSZ A;  4OLA A;  3K58 A;  1RDD A;  4FW1 A;  4KHU A;  2W42 A;  3CM6 A;  3MXI A;  3WNG A;  3ZSW A;  1S5J A;  4CFC A;  2B6A A;  2GV9 A;  3QIO A;  3AVC A;  3KLI A;  4LD0 A;  4CEC A;  4FLV A;  1BI4 B;  4KKO A;  4R5P A;  3ASM A;  4I9Q A;  1WNS A;  4N76 A;  4CJF A;  2F96 A;  4IG0 A;  1U04 A;  3IAY A;  3OJS A;  2OZS A;  3QLH A;  3KLG A;  1C0M A;  1HNI A;  1TL3 A;  4O44 A;  4OJR A;  5HLF A;  1W9H A;  4CGF A;  4CJU A;  4E7K A;  4F4K A;  2A1R A;  2PYL A;  4F2S A;  1HYS A;  1KLN A;  4ID5 A;  3SCX A;  3CYM A;  3DI6 A;  3OYC A;  4DQQ A;  1TK5 A;  3PUF A;  3TAN A;  3I0S A;  4B9S A;  3OYB A;  3AVB A;  2Q3S A;  4E7I A;  5CZ2 A;  3DRP A;  3O3H A;  1X9M A;  1JLA A;  4CJ3 A;  3SV4 A;  4CJQ A;  2G8U A;  1QHT A;  4I9L A;  4O55 A;  5HRN A;  3WNF A;  1C6V A;  4ELU A;  1BIZ A;  1WSJ A;  1WSI A;  2P51 A;  5KRT A;  4DTN A;  4KB0 A;  3L2U A;  2D0C A;  4TSX A;  1SKS A;  4DFJ A;  1RT5 A;  1JXE A;  1RNH A;  2XRI A;  4CE9 A;  4CIG A;  3P83 D;  4CJW A;  2KZZ A;  4KRF A;  5FDL A;  4CFD A;  1WN7 A;  3TAQ A;  3IG1 A;  3DLB A;  3ZT4 A;  4PY5 A;  1IG9 A;  3QNN A;  3OYI A;  4Q5V A;  1HJR A;  4B9L A;  1HQE A;  3LWL A;  5K14 A;  3MXJ A;  2IOC A;  4OGE A;  3LPU A;  3K5M A;  4DSK A;  4IDK A;  1ZYQ A;  4CEB A;  4DSF A;  1U48 A;  1RCH A;  1DTT A;  3G10 A;  3HVT A;  3O4Q A;  4ICL A;  3KLH A;  1N5Y A;  3AO5 A;  2PY5 A;  4CHO A;  4OPK A;  3NAE A;  5J2P A;  1D9F A;  3AVF A;  3V1R A;  4GVM A;  5KGW A;  4M3Y A;  1NKC A;  1LV5 A;  1UOC A;  2IAJ A;  3PV8 A;  1VSD A;  4CFB A;  3CQ8 A;  3QNO A;  2ZQB A;  1TKD A;  2VWJ A;  2ITG A;  3OS0 A;  4DSE A;  1B9D A;  4E89 A;  2RPI A;  1SL1 A;  3AO4 A;  3WNE A;  3ZSQ A;  1X1P A;  3NGZ A;  1UWB A;  4CGH A;  1KVB A;  2ZE2 A;  3U6F A;  1BCM A;  3OYK A;  3DMJ A;  4GMJ B;  4CEZ A;  3LZJ A;  1DTQ A;  2HHQ A;  3SYZ A;  4B8C A;  3HL8 A;  3NE6 A;  4JRP A;  4M42 A;  4C8M A;  4L8R B;  4BWM A;  4Z0U A;  1XI1 A;  4FZX C;  4RG8 A;  2EHG A;  5C42 A;  3PX4 A;  3ULD A;  1CZ9 A;  4DFK A;  4DU4 A;  3RR7 A;  1TKX A;  2EX3 A;  4PWD A;  2QKB A;  2HNY A;  3NH2 A;  3RMA A;  3CFP A;  3AVL A;  5SZT A;  4DF8 A;  3OYA A;  1FKO A;  5I3U A;  4DTS A;  4FK2 A;  3KKS A;  4EZ6 A;  3LP3 A;  1EXQ A;  5HRR A;  1L5U A;  3QIP A;  4CK3 A;  4CHZ A;  3B6P A;  3BGR A;  3TAG A;  1JL1 A;  1KVA A;  2VG7 A;  4Z4G A;  1IKV A;  2AJQ A;  2PYJ A;  1O1W A;  3HP6 A;  1TAQ A;  4HCC A;  1YVU A;  3VQ9 A;  3OYL A;  3SQ2 A;  2OYQ A;  1ZBL A;  3T1A A;  1BIU A;  1C0T A;  1J54 A;  1S9G A;  3MEC A;  3NF8 A;  3V9X A;  2HHT A;  3V9S A;  1REV A;  5DMR A;  4B9T A;  2XY6 A;  3AO2 A;  3KLF A;  4DQI A;  3SUP A;  2X6N A;  3HXM A;  4OKJ A;  2PZS A;  3KD5 E;  1LAV A;  1IH7 A;  3RMB A;  3UIQ A;  2BE2 A;  4FW2 A;  2BGG A;  4Q0B A;  2QXF A;  3AA5 X;  4XIU A;  4CEA A;  4KHS A;  4DTJ A;  3V9U A;  1IKY A;  5CZ1 A;  1RT7 A;  1TK8 A;  3DLE A;  2IC3 A;  1NK0 A;  4NCG A;  1BQN A;  4DQS A;  3KD1 E;  4J2A A;  4EP5 A;  4N47 A;  1RT3 A;  3LAN A;  4DU3 A;  3CFO A;  2KQ2 A;  1LW0 A;  3HPO A;  2LSN A;  4CK2 A;  3QEP A;  1N6Q A;  3SJJ A;  4F3O A;  5FRO A;  3VQD A;  3M8S A;  3ZT3 A;  1YT3 A;  2B5J A;  3OS1 A;  2XY5 A;  4KHN A;  3AA4 A;  2XY8 A;  3RTV A;  4G1Q A;  4H4O A;  1SKR A;  1QS4 A;  2IGI A;  1Z26 A;  1B9F A;  3ZSY A;  5KGX A;  1L3U A;  2P5O A;  2X78 A;  3M8P A;  2BDP A;  1YTU A;  1VSI A;  1VRT A;  2YHB A;  3L2R A;  1T03 A;  4CCH A;  4B3O A;  5FRM A;  1JXB A;  1RTJ A;  4DTP A;  4KB1 A;  4E1N A;  3K5L A;  3NHG A;  4FM1 A;  4RW9 A;  1NK6 A;  1Y97 A;  4C8N A;  1VSM A;  3P1G A;  4CJL A;  4KTQ A;  2Z1G A;  1XHX A;  4AHT A;  3HYF A;  1D9D A;  1ZBH A;  2YNH A;  4RW4 A;  1BHL A;  2OPP A;  1TVR A;  1D5A A;  4LH4 A;  4NYN A;  4ELV A;  5HP1 A;  2RF2 A;  4HUG A;  2ETJ A;  1KFS A;  2DFH A;  1NK5 A;  4FLU A;  3V81 A;  4DSL A;  3O3F A;  2G8H A;  1FK9 A;  2FBX A;  2HVI A;  1MU2 A;  3JYT A;  4H4M A;  4CJK A;  3SPY A;  4FJ7 A;  2F8T A;  1HQU A;  2ZD1 A;  1I3A A;  4M45 A;  3OYJ A;  2GBZ A;  4CF1 A;  5I42 A;  1L3V A;  1LWC A;  2HW3 A;  3DLG A;  4CFA A;  4DSJ A;  1NK8 A;  3KK1 A;  1ITG A;  2KW4 A;  5EU7 A;  4RW8 A;  3CG7 A;  4FVM A;  4MQ3 A;  1Q9X A;  3BDP A;  3OVN A;  1BI4 A;  3NH0 A;  3U3G A;  1YTA A;  4Z4C A;  3HM9 A;  4KTZ A;  3HST B;  1UA1 A;  4BE1 A;  1JLB A;  1U4B A;  1RBU A;  4ZHR A;  3K2P A;  2KZM A;  1RDC A;  4AHV A;  2HHU A;  2OPR A;  2VG6 A;  3F73 A;  3LAL A;  3QER A;  1ASW A;  3VQQ A;  3KK3 A;  1NJX A;  1JL2 A;  2Z1H A;  3SI6 A;  4CHP A;  3TAP A;  1UA0 A;  4CJV A;  2YNI A;  1QTM A;  4DFP A;  4B9V A;  3AVH A;  3K57 A;  4NYF A;  2Y1I A;  3VA0 A;  3RMD A;  4FK0 A;  4M3Z A;  4DLE A;  4F3T A;  4CF0 A;  2E6M A;  4AHS A;  4E7J A;  1CLQ A;  2HND A;  2D5R A;  3QEW A;  2DFF A;  2YNF A;  4M3T A;  3C6U A;  4BWJ A;  3S3N A;  1Q8I A;  4B8A B;  1KRP A;  3VQ8 A;  4NCB A;  4OVL A;  3OJU A;  1WLJ A;  1QSL A;  4F2R A;  5SWM A;  2RKI A;  3HP9 A;  4E1M A;  4Z4H A;  1ZBU A;  3AO3 A;  5C24 A;  3V1O A;  2QK9 A;  1VSE A;  3LAM A;  4CGG A;  4FJX A;  1S6Q A;  4IKF A;  4DTX A;  1RT6 A;  3SNN A;  5JS1 A;  2DTU A;  1KLM A;  2VWK A;  1RT4 A;  1HYZ A;  3F9K A;  2FBV A;  4DTR A;  4OKE A;  3TAM A;  1RBT A;  1VK0 A;  3THV A;  4KI6 A;  4CF2 A;  4CK1 A;  1TK0 A;  4W5R A;  4FJ9 A;  2YV0 X;  1G15 A;  1VSK A;  3M8R A;  4W5Q A;  5J2Q A;  4DQR A;  3L2W A;  4DS5 A;  1NJY A;  2HHX A;  1CXQ A;  4FJH A;  1F21 A;  4CER A;  3SZ2 A;  3VQE A;  3VA3 A;  2DY4 A;  3O4N A;  3DYA A;  3TWH A;  5E41 A;  5FRN A;  1EP4 A;  1D8Y A;  5CY4 A;  3G0Z A;  1VSL A;  2YKM A;  3AVA A;  3RRG A;  4BE0 A;  1C0U A;  4N56 A;  2G8I A;  3AA2 A;  4K8Z A;  1JLC A;  2JGU A;  3VQ5 A;  4AH9 A;  1T05 A;  4RW6 A;  3VN5 A;  1JLF A;  4FLY A;  3FFI A;  3QET A;  3V4I A;  1U47 A;  4KPY A;  1GOA A;  4DTU A;  4ELT A;  3K5O A;  3C6T A;  2OPQ A;  3LZI A;  4N5S A;  4KTW A;  1HNV A;  1KSP A;  4CF9 A;  1T7P A;  1U49 A;  3RWU A;  4J2E A;  4FM2 A;  2Z1I A;  5HRS A;  5HRO A;  3KLE A;  3LDS A;  3ZT2 A;  1IO2 A;  1EET A;  3OYG A;  4HCB A;  3VQB A;  3WNH A;  3LWM A;  4B9M A;  2IDO A;  3OS2 A;  3VQC A;  3C94 A;  1A5W A;  4I2P A;  1NOY A;  3DRS A;  3IS9 A;  2O4I A;  1JLG A;  2KFN A;  1HRH A;  3NF6 A;  3OYM A;  1Q9Y A;  3QO9 A;  3SUQ A;  2WOM A;  4Z4F A;  3OYE A;  4CEF A;  3OYH A;  3DLH A;  3AVI A;  3NCI A;  4FJM A;  2HHS A;  3EZ5 A;  1BCO A;  1KFD A;  3MEE A;  1CZB A;  1TL1 A;  4Y1D A;  3AVJ A;  4O0J A;  3MEG A;  2FBY A;  3DRR A;  4O0I A;  3CM5 A;  3IRX A;  4JS5 A;  3QEX A;  4CHY A;  3KKR A;  2WON A;  1RIL A;  1C1A A;  4EZ9 A;  4QOZ B;  1S6P A;  4OGC A;  4FXD A;  3ZT0 A;  1EKE A;  2OZM A;  3TAR A;  4OLB A;  3PO5 A;  5J2N A;  1TGO A;  1TKZ A;  3NGY A;  1EX4 A;  4FJL A;  4M3W A;  1ASU A;  4M3U A;  4UQG A;  3LAK A;  1WSF A;  2P1J A;  4CJP A;  1CXU A;  4E19 A;  2G8F A;  1QQC A;  2DFE A;  3PO4 A;  2HHV A;  3A2F A;  3I8D A;  1A5X A;  4Z4I A;  1J9A A;  1IKX A;  4AIL C;  1S1W A;  3HJF A;  4DU1 A;  4QAG A;  4CGI A;  4HVJ A;  3OYF A;  3S9H A;  4CEE A;  1RT2 A;  2G8K A;  4KV8 A;  3HPH A;  4CIF A;  1QE1 A;  4B9U A;  4JRQ A;  1JKH A;  1S1T A;  3ALY A;  5J2M A;  4AHU A;  5KRS A;  3EYZ A;  4E7H A;  3NBP A;  4E7L A;  3QES A;  3AVK A;  1TV6 A;  2NUB A;  3HT3 A;  1ASV A;  4CHQ A;  1NK7 A;  1NOZ A;  1WAJ A;  3ZSR A;  3JSM A;  3SQ1 A;  3AO1 A;  3TR8 A;  1NJW A;  2F8S A;  1FXX A;  2E4L A;  1IKW A;  4I2Q A;  3LP2 A;  4CEQ A;  4YFU A;  4W5N A;  2XHB A;  3ZCM A;  5D3G A;  4FYD A;  5HRP A;  1VSJ A;  3AVM A;  3MED A;  4FK4 A;  2FBT A;  4BDP A;  3AVN A;  3T3F A;  3NH1 A;  1HMV A;  3PX0 A;  3KTQ A;  3TAE A;  3PY8 A;  1GOB A;  3DM2 A;  4GW6 A;  4K8X A;  1VSH A;  3VQ7 A;  3ZT1 A;  4I7F A;  4FJN A;  3DOK A;  3E01 A;  1A5V A;  3OY9 A;  4DSI A;  1U45 A;  1WSG A;  1BQM A;  4C8K A;  3RMC A;  4F8R A;  5J1E A;  2KTQ A;  3ZSV A;  3NDK A;  1LWF A;  2X6S A;  1RDA A;  4N41 A;  4YNQ A;  4LSL A;  1LW2 A;  3NFA A;  1RT1 A;  3HVR A;  3OYD A;  4E3S A;  1X9W A;  1XWL A;  4CHN A;  1SUQ A;  4IFV A;  3HPG A;  3VQP A;  3KK2 A;  4FM0 A;  3U3Y A;  4FZY A;  2QKK A;  4H8K A;  1B92 A;  4FZZ A;  4KRE A;  2I5J A;  4W5O A;  2KFZ A;  3L2V A;  1BGX T;  1HPZ A;  1LAW A;  3KJV A;  3SUN A;  3C95 A;  4DMN A;  4HHT A;  3MXM A;  1C1C A;  4CEO A;  2A1S A;  4BE2 A;  4Z4E A;  3AV9 A;  1SL0 A;  5T7B A;  2FC0 A;  3P5J A;  4BAC A;  1NK4 A;  1W0H A;  1K6Y A;  1T8E A;  4J2B A;  3K59 A;  2JLE A;  3V1Q A;  2IS3 A;  3NGI A;  4OPJ A;  4MFB A;  5KTQ A;  3LP0 A;  4BDZ A;  4CJ4 A;  4DLG A;  3KIO A;  2P5G A;  1BIS A;  3ZSX A;  4FJG A;  4FJJ A;  3TAF A;  3AVG A;  1RDB A;  3ITH A;  3DLR A;  4BDY A;  3HO1 A;  1S1V A;  1RTD A;  2HMI A;  3L3V A;  2G8V A;  3VQ6 A;  1JLE A;  1VSF A;  4FJI A;  1KVC A;  3B6O A;  1X9S A;  4PQU A;  4ZTJ A;  1WSH A;  5KI6 A;  3DLK A;  2R7Y A;  2YNG A;  3V9W A;  1TAU A;  4B08 A;  4FJ8 A;  2B4J A;  2D0A A;  3AA3 A;  1RTI A;  2Z1J A;  5C25 A;  2XO7 A;  4PUO A;  3SV3 A;  4CJ5 A;  4KHQ A;  2HVH A;  4HUE A;  1Z25 A;  3OYN A;  1UAX A;  4LY7 A;  3RRH A;  4HTU A;  4CED A;  3H08 A;  3ISN C;  4LSN A;  4CIE A;  4W5T A;  4DWI A;  3NF7 A;  4O4G A;  4QCL A;  3K5N A;  1QSS A;  1QSY A;  4DQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...