3AVFA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avfA00
3AVCA 5EU7A 1NK8A 2X6NA 4CEBA 1JL2A 1O1WA 5DK5A 3KKSA 1A5WA 4CEQA 3AO2A 5HRNA 4BWMA 3OYGA 1RT3A 3HL8A 1RBSA 2ZQBA 5C24A 4KV8A 1J54A 4LD0A 3VQ8A 1C0TA 2OPRA 3OS2A 4DSFA 4CJSA 2OPQA 3L3UA 2P5OA 2D0CA 1EXQA 3PUFA 3VN5A 3O3HA 3LP1A 5KRSA 4OKJA 3S3MA 4FCYA 3AA5X 1KFDA 1TV6A 2G8VA 3U3YA 1JLQA 3L2RA 3O3FA 2IAJA 3SUQA 2YHBA 4FLUA 4W5QA 2KFNA 4M3UA 4FJMA 2DY4A 3EY1A 4CIFA 3HT3A 1JXEA 1BCOA 3C6UA 4HHTA 2NUBA 1JXBA 4BDPA 4KB0A 4KHUA 1NKEA 3AVHA 4ICLA 2OZMA 4OLBA 2F8TA 2AJQA 1BL3A 4CCHA 3RTVA 3EZ5A 4FLVA 1S1UA 3SV3A 1WSGA 3ZCMA 4AHVA 3NH2A 5FRMA 4FXDA 3AVFA 4K8XA 3SJJA 3PX4A 2G8IA 4M45A 4BWJA 1NJYA 4CHOA 3RMBA 4RW6A 4AILC 5HRPA 1QSYA 4PY5A 3ZSQA 3LWLA 1TGOA 4CGDA 1TKTA 4CEAA 5KGWA 1TK8A 5J2PA 2KQ2A 4CHZA 3OYHA 1NK7A 1D9DA 4R5PA 3NE6A 1KRPA 1LV5A 4PUOA 3AVIA 4CJWA 4Z0UA 5HRRA 4Z4HA 3F73A 2FBYA 5FDLA 1R0AA 2X6SA 5C25A 1KTQA 1VRTA 2B6AA 2GV9A 4CEOA 3ZSZA 3HPGA 4FLXA 4CFBA 1JKHA 1TVRA 3ZT0A 2XY8A 3LPTA 3LZIA 1HPZA 3AO4A 1FKPA 1VSEA 1C1AA 1WAFA 2YKNA 1RTJA 1RDAA 4F4KA 4FZYA 4KTQA 4M3WA 3QLHA 1C0MA 1UA1A 1QQCA 3DLGA 3NCIA 4O4GA 5C42A 5CZ1A 3AVGA 2XRIA 1IO2A 1LWEA 3QERA 4CK2A 4E19A 4KHSA 4FZZA 3ZT3A 5JS2A 4CEDA 4AHTA 1IKVA 4QAGA 1JLEA 3K5OA 5KTQA 4ELVA 3NF7A 3TWHA 4LY7A 2E6LA 4CHQA 5E41A 5I42A 4FJHA 3FFIA 4IKFA 1RTDA 4GMJB 1VSIA 3AO3A 3P5JA 1RBUA 1CZBA 3QETA 5HRSA 4M3RA 3B6PA 3OYKA 4RW9A 3CQ8A 4KFBA 2ETJA 3DYAA 3K57A 1S6PA 1Z26A 1BQNA 1S9EA 4O44A 3VQEA 4CK3A 1CXUA 4AHSA 3CM6A 3QINA 4B9UA 2HHSA 3NGIA 2KFZA 3V81A 2R7YA 4ZTJA 1ZBHA 4FM0A 1TAQA 4M41A 1JLBA 1A5XA 1LAVA 4DMNA 5CZ2A 1J9AA 4DU4A 2A1RA 2HHWA 2Z1JA 2ATQA 1I3AA 4H8KA 1TK0A 4J2AA 3C95A 4HUGA 1BIUA 2D0BA 3AVKA 3CFRA 4DLEA 2KZZA 4C8KA 1ASWA 3JYTA 1ITGA 1CLQA 3KLEA 4FJNA 1ASVA 3AA4A 3VQBA 5SWMA 4DTRA 2VG7A 1IKXA 3HP9A 5DMRA 5D3GA 4IG0A 4CFCA 3HO1A 4E7LA 3PO4A 4CJ4A 1RT7A 3WNHA 4Z4GA 1QE1A 2HNYA 4DG1A 3ULDA 3OYFA 1NK5A 4I2QA 4B9MA 1GOCA 3ZSRA 4B9LA 2PZSA 3BDPA 1DTTA 3AO5A 3CYMA 2XY7A 1U48A 2HVHA 2FBTA 3DM2A 1WSHA 3MXMA 3L2VA 2HHXA 1Q8IA 4IG3A 4CJQA 3SPYA 1DTQA 1EETA 3IG1A 3VQQA 5KRTA 3MEDA 1RNHA 1XC9A 3PY8A 3A2FA 3K5NA 3VQ6A 1SKRA 1SUQA 4XIUA 4DQQA 4CJKA 3OY9A 3QIOA 3TARA 4CHYA 3T19A 1NJZA 2KW4A 2WONA 1YVUA 2VG6A 3LP3A 1VSMA 5HLFA 1NOYA 3KTQA 4FJIA 1RTIA 1C6VA 4DSLA 1QSLA 3KLFA 4Z4EA 4EZ6A 4FJ9A 2E6MA 2HVIA 4LSLA 3VA3A 1L3TA 4CE9A 3PO5A 3SQ0A 4M42A 3F9KA 4B3OA 2Q3SA 3I0SA 4CJFA 4FM2A 3SV4A 3RMCA 4RW7A 1KCFA 1J5OA 1XI1A 4PA1A 3LDSA 1BGXT 4GVMA 4CESA 3ZT1A 4DTJA 4KI6A 1FXXA 1QHTA 3ITHA 4CF9A 4J2EA 4OVLA 4GW6A 2HHVA 4E7HA 2E4LA 4CF0A 5J2MA 3V6DA 4M3TA 1BHLA 4OLAA 4CFDA 3OYBA 3VQCA 3OYJA 1WNSA 3AV9A 4CEFA 3VQ5A 2YNFA 3HPOA 4CJ5A 1NOZA 3SUOA 1T8EA 4FLTA 1N6QA 1TKDA 3M8PA 2G8WA 4KKOA 2B5JA 1NJWA 4NCBA 4DF4A 4HVJA 1U45A 2O4IA 3AVMA 3DRPA 3NF9A 3KLHA 3I8DA 1HNIA 4DS5A 4KRFA 1D5AA 4DTMA 1WSFA 3QNOA 4WE1A 4FK0A 4BDYA 2D5RA 2G8UA 3S3OA 2GBZA 1TKXA 3CG7A 3OS0A 1JLFA 4E1MA 1UWBA 3KK1A 3PX0A 4FJ7A 1ZBIA 4W5OA 3QO9A 1VSKA 3ZSYA 4CGFA 4IDKA 1VRUA 4DFKA 3L8BA 4M3XA 4AHRA 3QEPA 3RRGA 4CJEA 2F8SA 4W5NA 3SQ2A 3DLKA 1C0UA 4ZTFA 1ZBUA 5T7BA 3NGZA 4DQRA 3L3VA 2VG5A 3DOKA 4ID5A 4AHCA 1RT1A 2XO7A 3VQPA 1WSEA 2HNZA 2IOCA 4E7IA 4BE2A 2Z1GA 3RMDA 2XHBA 3D45A 3AA2A 1QS4A 2HNDA 3O4QA 2P1JA 4CF1A 5HROA 2BANA 2WOMA 1FKOA 1KLMA 3NF8A 2FC0A 3HXMA 1NK6A 2YNIA 3HVTA 1A5VA 1S9GA 4CHPA 3MEEA 1VSLA 1Q9XA 3AVLA 3EYZA 2QKKA 4CEZA 1HMVA 4JS4A 4FZXC 1IKWA 4B9VA 3DRSA 4EP5A 1UAXA 3LPUA 2BGGA 4Z4FA 1S5JA 4QOZB 4DF8A 4ELUA 4E7JA 1ZBLA 1UA0A 2VWJA 4F2SA 4FJXA 4CGJA 2IDOA 2B4JA 1IH7A 3QNNA 4O55A 5K14A 1VSFA 4Z4IA 4G1QA 2QK9A 3OYLA 4F2RA 1GOBA 3L2UA 1BCMA 4HCCA 2ITGA 2Y1JA 3OS1A 3SPZA 3LAKA 3U3GA 4DQSA 3QEWA 4AHUA 2OPPA 3OYIA 4NYFA 2W42A 4F8RA 4RW8A 1C1CA 1KVBA 1NK0A 4O0IA 3OYDA 3D0PA 3G10A 3IRXA 3OJUA 5KI6A 4E3SA 1VK0A 3HPHA 2YHAA 1SL0A 4ID1A 3QEIA 4QCLA 4DTOA 1TAUA 1U47A 4F3TA 1RCHA 3G0ZA 2X74A 1Y97A 4Y1CA 4YFUA 3NGYA 3NFAA 1SKSA 3KD1E 1HJRA 3AVJA 4C8MA 1VSJA 2EHGA 4DQIA 3K2PA 3OYAA 2HMIA 4KPYA 2YNHA 3LANA 3M8QA 4IBNA 3HP6A 3HM9A 1RBVA 3DLRA 3V1QA 3OYMA 4DFMA 1D9FA 4CF8A 1S6QA 1LWFA 2ZD1A 3OVNA 1C1BA 3SQ1A 5J1EA 2RF2A 4OKKA 4YNQA 4BE0A 3THVA 1KSPA 4BACA 1BQMA 5CYQA 1T03A 5SZTA 3TAMA 4I7FA 1HYZA 4CERA 2I5JA 2DFFA 2BE2A 4KAZA 1REVA 4KTZA 4NCAA 1RDCA 4CEEA 3QEVA 4JRPA 3TI0A 3KKRA 3RR7A 3LAMA 4JS5A 1RBRA 1LAWA 1U49A 2QXFA 3DLEA 3AVNA 3E01A 4DSKA 2G8KA 3PX6A 1TK5A 1WLJA 1WAJA 2FBXA 3I0RA 5I3UA 3BGRA 3ASMA 4OPJA 2GUIA 4JRQA 4O5BA 4FLZA 4M3YA 3S9HA 3UIQA 4FW1A 4B8AB 1KFSA 3O3GA 4CJ3A 4L8RB 2Z1IA 4DTPA 4CECA 4B9TA 3QESA 1J53A 2LSNA 1EP4A 3P1GA 4DLGA 3KLIA 3ZSWA 2Y1IA 3RR8A 1SKWA 2P51A 1YTUA 2OPSA 4O0JA 1BISA 1S1TA 1RTHA 3K5LA 4B9NA 3KK3A 4LSNA 2OA8A 2DTUA 1KVAA 4DU1A 4CGIA 2FBVA 2G8HA 4CFAA 4HUEA 1F21A 3MEGA 3SI6A 4UQGA 3S3NA 3NDKA 3LP2A 3ZT4A 1SL1A 3V9WA 4AH9A 4DQPA 4I2PA 4MFBA 4DU3A 4PQUA 4N47A 4I9QA 5CYMA 3LZJA 3CFPA 2X78A 3VA0A 1D8YA 2XY6A 3IS9A 3P83D 3KIOA 1EKEA 4B08A 4DSJA 2HB5A 4DSIA 4N76A 4EP4A 4FLYA 3VQ7A 1VSHA 4CJUA 4Z4CA 5CY4A 4FJGA 1JL1A 3DLBA 5JS1A 3NAEA 3IAYA 1HYVA 4DS4A 3SCXA 1LWCA 4KO0A 1ZYQA 4OGEA 1JLAA 1RT5A 1Q9YA 4E0DA 1HRHA 2KTQA 3LWMA 5J2QA 2JGUA 1U04A 3ISNC 3VQAA 1IG9A 4DTUA 1NJXA 1S1WA 3ZSXA 3HJFA 2DFHA 4NYNA 2O4GA 4W5TA 1T05A 4FM1A 4ELTA 3TANA 4ZHRA 3H08A 4RW4A 3O4NA 2RN2A 3V9XA 4FW2A 1NK4A 1X9SA 3V9SA 3OJSA 1G15A 4DFJA 3HK2A 3SYZA 4CJTA 4CK1A 1LW0A 3LALA 4TSXA 4HTUA 1XHZA 1HQEA 1I39A 1RT6A 3KLGA 1IKYA 4CHNA 3OYEA 4KB1A 3NF6A 4IFYA 4N5SA 3L2WA 1BI4B 4DTXA 1S1XA 4OKEA 4KHQA 4K8ZA 1X9MA 4MQ3A 1W0HA 4PWDA 1EX4A 1SV5A 4RG8A 1ZBFA 3DOLA 4W5RA 3RRHA 3K59A 1CZ9A 1T7PA 4J2DA 1K6YA 2JLEA 2YV0X 4CJRA 3MXIA 3KD5E 3DRRA 3ZSVA 3AVBA 1BIZA 4KHYA 4KHWA 3HSTB 2EX3A 4FJ8A 1FK9A 5KGXA 1N5YA 2QKBA 2A1SA 1RT2A 4CJVA 4DFPA 3WNFA 2P5GA 3U6FA 4H4OA 2BDPA 4EZ9A 4Q5VA 2KZMA 1S1VA 2HHTA 1GOAA 4OJRA 1Z25A 1B9FA 1RBTA 3DMJA 3V1OA 3PV8A 1NKBA 1QTMA 5J2NA 1TKZA 3AO1A 3V9UA 4Y1DA 3MECA 4F3OA 3HVRA 4N56A 4BDZA 4DSEA 3QIPA 4LH5A 3TAFA 2G8FA 2DFEA 1L3SA 3RWUA 3K5MA 3TABA 3ALYA 2IGIA 1ASUA 4CF2A 4CIGA 3NH1A 3NBPA 4DTNA 1CXQA 3MXJA 4IFVA 2YNGA 4M3ZA 1KLNA 2XY5A 3SUNA 4CGGA 1XHXA 3LP0A 3ZSOA 3DLHA 4I9LA 4E89A 1L3VA 1QSSA 3M8SA 2D0AA 3K58A 4BE1A 3V9ZA 3M8RA 1WSIA 1RILA 4H4MA 4OPKA 1YT3A 1RDBA 4B8CA 4HUFA 3RMAA 1RT4A 5HP1A 4DWIA 3V1RA 4Q0BA 2HW3A 1HQUA 1KVCA 4KHNA 1MU2A 1X1PA 2OZSA 2HHQA 1W9HA 3HYFA 3OYCA 1B9DA 3WNEA 1TL3A 1WSJA 3CM5A 1RDDA 1BI4A 1JLCA 1L3UA 2PYLA 1NKCA 4DTSA 1HNVA 3NHGA 4C8OA 4FJJA 1JLGA 3VQDA 4KREA 4FJ5A 2RPIA 2OYQA 4HCBA 1WN7A 2IS3A 3L2QA 1HYSA 3ZT2A 4NCGA 3JSMA 4CJLA 3VQ9A 4FJKA 1NK9A 3TR8A 4N41A 3SZ2A 3DI6A 3KJVA 3TAPA 3VQ4A 4E7KA 4B9SA 3V4IA 3SNNA 4FK2A 2PYJA 1B92A 3TAEA 5FRNA 4FVMA 4KTWA 1DLOA 4OGCA 4FJLA 1YTAA 4C8NA 1L5UA 1X9WA 4J2BA 4FLWA 3SQ4A 2ZE2A 3QEXA 4CJPA 2F96A 3TAQA 4JLHA 1SL2A 4KI4A 4CGHA 4FYDA 4E1NA 3WNGA 4FK4A 4C8LA 3TAGA 3B6OA 2RKIA 3T1AA 1U4BA 2Z1HA 1LW2A 2IC3A 5HBMA 2YKMA 1TL1A 5FROA 4CIEA 3OYNA 3C6TA 1UOCA 2HHUA 3SUPA 3AA3A 3C94A 1VSDA 4LH4A 3MAQA 2VWKA 3NH0A 3KK2A 1XWLA 2PY5A 3AVAA 3T3FA 3CFOA
chains in the Genus database with same CATH superfamily
3AVCA 4B9QA 3GL1A 5TKYA 1T6DA 3OYGA 3CXCM 3VQ8A 3OS2A 4BR0A 4CJSA 2E1YA 2D0CA 2VGNA 3DAWA 3BP8A 1ESVA 4HTLA 1TV6A 3L2RA 4PKGA 2F7TA 4FPBA 3HT3A 3A5MC 1BCOA 2NUBA 3EKUA 3T7ZA 4ICLA 2OZMA 4M63C 2FF3B 3RTVA 4B1YB 3NH2A 4FXDA 3AVFA 2G8IA 4M45A 5HL7L 4FWQA 4RW6A 1QSYA 1U2VA 3FFKB 5KGWA 4CHZA 1D9DA 3NE6A 5HRRA 2FBYA 5C25A 1VRTA 4YOUA 4JYAK 2GV9A 3ZT0A 3HOSA 2XY8A 3LPTA 1HPZA 2HBLA 1WAFA 1C1AA 2YKNA 1GLEG 4FZYA 1VQ5N 3FR0A 3UE5A 1UA1A 2Q0UA 1IO2A 4WQ4A 4E19A 3ZT3A 2QXLA 1IKVA 1NGEA 1JLEA 5KTQA 4ELVA 5BR8K 4CHQA 2VQEK 5E41A 3I55N 5I42A 3C6HA 1VSIA 2CGLA 5BR9A 1CZBA 5GAGP 5HRSA 3B6PA 1V4SA 1TUYA 4RW9A 2HF3A 3CJ7A 1W97L 3K57A 3EE8A 1J5EK 1Z26A 4O44A 1CXUA 3CM6A 3NGIA 3CCRN 4ZTJA 4FM0A 3ZX2A 1LAVA 4DMNA 5CZ2A 4DU4A 2A1RA 5GINA 2HHWA 2Z1JA 2ATQA 3THWA 4JK7A 1TK0A 1M90O 2D0BA 3AVKA 4DLEA 3VMFB 2O8BB 1DT9A 3JYTA 1CLQA 3KLEA 1ASVA 3AA4A 3VQBA 4DTRA 1T3VA 2UYTA 1IKXA 5DMRA 1KD1O 3HO1A 4E7LA 3O4WA 3R3LA 1QE1A 4FWRA 3ULDA 1GOCA 4B9LA 3CYMA 1Y64A 3H3NO 5KQ8A 1U48A 4JI0K 3ZYYX 2FBTA 3L2VA 1Q8IA 2YJEA 4CJQA 3IG1A 2D1KA 3VQQA 1K9MO 3P31A 5AQRA 3A2FA 4XIUA 2Q36A 3SAGA 2P9SB 3A8YA 4EHTA 3T19A 2VG6A 3QBWA 1NOYA 5AQSA 1C6VA 3O9QA 3KLFA 4Z4EA 3C65A 1N32K 2E5LK 3SQ0A 4M42A 3F9KA 3SBGA 3SMPA 2FSNA 1YAGA 4I6MB 4RW7A 1KCFA 1J5OA 3CHWA 5AQHA 3SJHA 3OBWA 3WQTA 1BGXT 1FXXA 4GW6A 2HHVA 4E7HA 4M3TA 3TTCA 3SUOA 3DXMB 2UUCK 3CERA 5AQYA 1N6QA 2QA4N 1NJWA 5LY3A 4DF4A 4JKGA 4FOIA 5M1NA 2O4IA 1D5AA 4DTMA 1WSFA 4WE1A 3VGMA 3HM8A 3MWTA 2YHYA 2D5RA 2GBZA 1TKXA 4FO0A 3CG7A 1JLFA 4E1MA 3PX0A 4DR1K 4DR3K 3DLLL 3L8BA 4M3XA 3UKRA 3QEPA 4FWLA 3VESA 4CJEA 4H5RA 3ZLJA 4XH4A 1W2BM 1ZBUA 3EN9A 3L3VA 3DOKA 4ID5A 4AHCA 2XO7A 3UKUA 2P9KA 5AQWA 3VQPA 4DKWA 2PFUA 2KKZA 3E9OA 4CD3A 5C15A 1K8KB 2XHBA 3AA2A 4CF1A 2QI2A 2P1JA 4H5VA 3A5NC 2BANA 2WOMA 1KLMA 4MDAA 3DWLA 1X3NA 3CJBA 1S9GA 3EYZA 4PHTX 1OH8A 2NRTA 4FWSA 3MN5A 1S5JA 4QOZB 4JK8A 4E7JA 1UA0A 1IH7A 1VSFA 4Z4IA 4G1QA 3E66A 1YXQA 2W6KA 3MX5A 1TYQA 4JD2B 3CQXA 2W42A 1KVBA 3D0PA 3OJUA 4E3SA 4QCLA 5KI6A 3ULEB 1VK0A 3HPHA 4ID1A 4DTOA 4BVOA 3NFAA 4C8MA 4KPYA 4IBNA 3M6GA 3V1QA 3OYMA 3KK7A 1S6QA 3OVNA 4OKKA 4BE0A 4BRGA 4O8KA 4A62A 1KSPA 5CYQA 4I7FA 1XQSC 2WFBA 5AQTA 3QEVA 4JS5A 1LAWA 3GDQA 1XMQK 1WLJA 4FWNA 5H1SQ 4M3YA 3UIQA 4B3RK 5AZJB 4MLHA 1GLJO 4AQYK 3M1FA 1KAYA 3HOTA 3QESA 4BRQA 3P1GA 2Y1IA 3ATUA 2GEMA 3QMLA 2O8EA 1BISA 3QBXA 2OANA 1RTHA 4B9NA 3CC2N 4BC5A 2DTUA 1QQOA 1HNXK 3SI6A 3MEGA 3MN6A 3S3NA 3LP2A 2O8FB 2FSKA 1BDGA 4AM7A 4N47A 1HJOA 3VEYA 2RHKA 3O1WA 3AARA 3CFPA 3IS9A 1EKEA 4N76A 1VSHA 4FPAA 4HWIA 3DLBA 2GWJA 1Q86O 1LWCA 4PKHA 3DJCA 3TSPA 1Q9YA 4C23A 2KTQA 3LWMA 5J2QA 2VQFK 4WQ5C 1S1WA 3NVMA 1EWRA 4JKAA 4W5TA 1HNWK 3ID6A 1GLFO 4JI4K 3OJSA 1G15A 3HK2A 3SYZA 4YOXA 1MWKA 1I39A 3E9LA 1IKYA 3OYEA 4KBOA 3NF6A 4CZKA 4DV2K 2GELA 1X9MA 1EX4A 1ZBFA 3CMAN 4ILHA 1XNRK 3FZMA 4E1JA 3DRRA 3ZSVA 1BIZA 3HSTB 3BF1A 1N5YA 1NGFA 2A1SA 4CJVA 4DFPA 5AQMA 3WNFA 3U6FA 3IUCA 4Q5VA 2O8CB 4O5FA 4MO4A 1GOAA 3KWIA 1RBTA 5JMVA 1TKZA 3AO1A 4Y1DA 3MECA 4LF4K 4N56A 3TSQA 1QVFM 3RWUA 3ALYA 2IGIA 4CIGA 2IVNA 4EIAA 2EWSA 3NH1A 4DTNA 3MXJA 4CZIA 5HOOA 1KLNA 3SUNA 1XHXA 3AAQA 3JS6A 4E89A 1QSSA 4YOWA 3K58A 3V9ZA 3WEEA 1WSIA 4H4MA 1KAXA 4HUFA 3RMAA 4ILGB 1MU2A 1X1PA 5AZIA 2P9PA 4LF7K 1RDDA 1BI4A 3C7NA 2V51B 3ZX3A 3VQDA 4FJ5A 3H1VX 1NK9A 3MWPA 3TR8A 3VQ4A 4E7KA 3VEWA 5C0YA 3QDKA 1DLOA 4JAXA 1X9WA 4DR2K 4J2BA 1MDUB 3QEXA 1P8ZA 3O08A 5GAHP 4KI4A 4CGHA 5GAEP 3TAGA 3B6OA 1U4BA 1LW2A 2IC3A 5HBMA 2YKMA 1TL1A 4CIEA 1BU6O 3OBYA 3ID8A 2Q1NA 3AA3A 2VWKA 3NH0A 3QB0A 3CETA 2PY5A 4KH4A 2KHOA 3VENA 4J8FA 1R59O 1NK8A 4KHPK 4CEBA 1A5WA 5HRNA 1GLCG 4BWMA 3G25A 4BR4A 4F9OA 2ZQBA 4KV8A 2Q97A 2P5OA 5BRDA 1EXQA 3PUFA 3O3HA 1ATNA 4OKJA 2UU9K 3SUQA 2IAJA 2YHBA 2KFNA 3C0BA 2ZM6K 1OH6A 4CIFA 3C6UA 4YOVA 4H0OA 4BDPA 4KB0A 2AJQA 1BL3A 4CCHA 2OTJN 4M7XA 3EZ5A 2WTUA 4RTFD 1OH5A 1WSGA 2I7PA 5FRMA 4GV6A 4GY2B 4CZGA 4BWJA 1VQON 1GLBG 5HRPA 3ZSQA 1EO1A 3WXKA 2KQ2A 1QQNA 1NK7A 1DGKN 2YCHA 4Z4HA 5AQFA 1KTQA 3HBTA 4AF1A 3ZSZA 5JICA 3AO4A 4BRLA 3CCQN 1WB9A 1VSEA 2NRHA 4KTQA 4MDBA 3AY9A 1C0MA 3QLHA 1IBKK 4O4GA 5C42A 3AVGA 4PL8A 3S41A 4KHSA 3CCMN 4FZZA 5JS2A 2QWOA 3OHRA 3NF7A 3TWHA 4LY7A 2E6LA 5BREA 4DR7K 1RTDA 1U6ZA 3AO3A 4CJ7A 1RBUA 1V4TA 5JLFA 1QQMA 3CCVN 3BF3A 3O9SA 3A0IX 1BQNA 1KQSM 4B9UA 5ADXA 2KFZA 3V81A 1YF5L 2P9UB 1I3AA 3R6MA 4OPHA 4G9ZA 3CFRA 2HMPA 3LDQA 1ITGA 4BRCA 2VG7A 3HP9A 3K9JA 4CFCA 2P9NA 2QWNA 3T1HK 4LF9K 3DXKA 4B9MA 1DTTA 3AO5A 2XY7A 4IG3A 1DTQA 3F5TA 1XC9A 3PY8A 3O1BA 4CJKA 3G4SN 4XH1A 3QIOA 1WUAA 4B1ZA 2KW4A 3LP3A 4BRMA 3KTQA 1C0FA 1RTIA 4DSLA 3HSCA 2HVIA 4LSLA 3TPQA 3ZEUB 1YJWN 4CE9A 4B3OA 3MDQA 2Q3SA 3PIOL 4FM2A 3SV4A 3RMCA 4PA1A 4C1NK 4GVMA 1E4GT 5JVHL 2HF4A 3ITHA 2E4LA 4CF0A 4OLAA 3VQCA 1WNSA 2YNFA 4CJ5A 1NOZA 1VAZA 2G8WA 1IV0A 4FOEA 4KKOA 2B5JA 3SBTA 1C0GA 3THYA 3NF9A 4KRFA 4FWKA 3QNOA 1IBMK 4FK0A 2P9IA 5AQVA 3CCLN 1G99A 2QWQA 2V52B 4YDUA 3KK1A 3CC4N 4ISGA 1VSKA 3ZSYA 1NGDA 4IDKA 4AHRA 4LFAK 5IT9O 3EKSA 4A2BA 4ZTFA 4DQRA 5IWAK 1YHQN 1RT1A 4IEEA 1WSEA 3U8XA 2IOCA 3BY5A 2E2PA 2NZTA 3RSEB 4IOCL 1FJGK 4BGAA 1KC8O 3BUZB 5AZIB 3D45A 1QS4A 5HROA 3KVGA 4DV3K 1NK6A 3HVTA 3RVCA 1A5VA 3D2FA 5LL6Z 1Q9XA 3AVLA 4CEZA 4DV6K 1IKWA 4B9VA 3DRSA 4JHDA 1GLAG 4EP5A 3LPUA 1RDUA 3AGRA 1OVYA 5KPZA 1Z6RA 2NRZA 4F2SA 2E2QA 4CGJA 1NGAA 2B4JA 3QNNA 5K14A 4LFCK 1OKJA 3SAHA 4F2RA 4BVPA 3TTFA 2Y1JA 3SPZA 3OS1A 3LAKA 3QEWA 1C1CA 3O6WA 1NK0A 2Q0RA 4DR4K 4O0IA 3OYDA 3G10A 1BA1A 3QEIA 2ZGYA 3MCPA 1MWMA 3G0ZA 3ENOA 3LM9A 4YFUA 4R79A 3NGYA 3KD1E 4DQIA 1GLDG 2IIRA 3OYAA 3M8QA 3HP6A 1ATRA 4CF8A 1LWFA 5J1EA 1SAZA 3I8BA 5EY4A 3TAMA 4GV9A 4CERA 2UXDK 2DFFA 2VCPA 3EL2A 4JRPA 4FVUA 4GNIA 1XUPO 3AVNA 3E01A 4FWPA 4DSKA 5ADXH 1NGGA 2FBXA 3OW2M 3ASMA 4JRQA 3N4PA 4FW1A 4H0TB 1KFSA 3J8AA 2Z1IA 4DTPA 4CECA 1YI2N 2BTFA 3ZX0A 1J53A 1CZAN 3RR8A 2YX6A 1SKWA 4O0JA 3K5LA 5BPMA 4LSNA 4CZHA 4DU1A 2G8HA 4HUEA 1F21A 2D4WA 3NDKA 3PSFA 3ZT4A 2HHHK 3V9WA 4DQPA 4MLEA 5B8HA 3L4QA 1NJIO 2WBNA 4IOAL 4I9QA 3VA0A 5EXWA 4GKJK 3P83D 4GV3A 2HB5A 4DSIA 4EP4A 4C1NI 5F1XA 3ENBA 3IAYA 4JK9A 1YVNA 3U9ZA 3MCAB 4KO0A 3N4QA 4DR5K 1RT5A 4LF5K 1HRHA 1VQMN 3CC7N 1U04A 3VQAA 3LL3A 3HJFA 2IVOA 1NU0A 3TANA 3J81O 4K0KK 2O8DA 3U9DA 3H08A 2ZJRL 3V9XA 3V9SA 2W41A 4CJTA 1HQEA 4DV4K 1RT6A 3KLGA 1HKCA 4KB1A 4DR6K 4IFYA 3L2WA 4DTXA 4A59A 4MQ3A 1W0HA 4PWDA 3F2KA 3DOLA 2FXUA 1CZ9A 4NLCA 3FLCO 2JLEA 2YV0X 4CJRA 3KD5E 3AVBA 4KHYA 4KHWA 2E8AA 1FK9A 5KGXA 2QKBA 4EZ9A 4DUYK 2KZMA 1S1VA 2JWLA 1VQNN 4JI1K 1Z25A 4H03B 4BG8A 1B9FA 4YHHK 3EEQA 1NKBA 1QTMA 2P9LB 5J2NA 3V9UA 1HR0K 4YOYA 4DSEA 2YJFA 3TAFA 4DV1K 5F0XA 3K5MA 4CF2A 1XMOK 3NBPA 3CQYA 4IFVA 2YNGA 4CGGA 3FZLA 3GBTA 3LP0A 3CJAA 3DLHA 5CHIA 3VTHA 4OPKA 1YT3A 1RDBA 1DKGD 3MK6A 4DWIA 4Q0BA 1HQUA 2CH6A 3CCEN 2OZSA 3HYFA 1VQ7N 2ITMA 5FLXO 3L4IA 4IO8A 1ZC6A 3THXA 4H5WA 1NKCA 4DTSA 3NHGA 5BRHA 4A5BA 2RPIA 4HCBA 1HYSA 4ISEA 3L2QA 4CJLA 3R9PA 1ATSA 4N41A 3KJVA 2WUSA 3VEOA 3ZETA 2QEXN 4K41A 2FLOA 3SNNA 5FRNA 1B92A 4QS8A 2YHWA 4FVMA 4FJLA 4C8NA 1L5UA 4FLWA 4JV5K 2ZE2A 3LM2A 4CJPA 4JLHA 1BOTO 2OCEA 1SL2A 4E1NA 3WNGA 2RKIA 1U2VB 2Z1HA 1S22A 3VPZA 2UUBK 3C6TA 2HHUA 3SUPA 4RCHA 4BRPA 4IOXA 4Y0WA 3T3FA 2OA8A 5EU7A 4A57A 5DK5A 3KKSA 3AO2A 3VF2A 3CJ1A 1RT3A 5C24A 1RBSA 4LD0A 1N36K 1C0TA 1XNQK 2OPQA 3L3UA 3VERA 2A42A 3VN5A 5KRSA 3EE9A 4FL9A 4BROA 3CCSN 3AA5X 1KFDA 2G8VA 1K8AO 4W5QA 4M3UA 4FJMA 2DY4A 3D2EA 1JXBA 4OO1J 4KHUA 1BO5O 3AVHA 1NKEA 4OLBA 2F8TA 1S1UA 1QZ6A 3SJJA 3SMSA 3PX4A 4EHUA 1HLUA 4PY5A 3LWLA 3THWB 1TKTA 1SS6A 4BGBA 1O13A 1LV5A 1QVGM 1YJNN 1WOQA 3H6EA 2BUPA 3J7YP 5FPDA 1JKHA 1TVRA 4XEIA 4GVEA 4YY3K 4OPAA 3LZIA 5ELZA 1FKPA 1RDAA 2NNWA 3GOIA 4M3WA 3O9UA 3CD6N 1QQCA 3DLGA 4JKEA 2GTDA 3H1QA 1IBLK 1N33K 4QS9A 3QERA 4CK2A 4CEDA 4AHTA 4QAGA 1WBBA 3K5OA 3FZHA 3IFRA 5BPLA 4FJHA 4GKKK 1Q18A 1KXPA 4M3RA 3D6RA 3OYKA 3WXJA 4KFBA 1S6PA 1S9EA 4CK3A 3VQEA 4AHSA 3QINA 1X3MA 2R7YA 3P4IA 4LF8K 4M41A 3CF5L 4JI2K 4J2AA 4IO9L 3C95A 1BIUA 3CIPA 3QFUA 2KZZA 4C8KA 1ASWA 4FJNA 5SWMA 4JKGB 4IG0A 1T6CA 3LDPA 4CJ4A 1RT7A 4CZFA 2HNYA 4DG1A 3OYFA 4I2QA 3ZSRA 1BWFO 5CR4A 2PZSA 2F9WA 3DM2A 2HHXA 2H3GX 3UKRB 1FW6A 5M1KA 1NGJA 3K5NA 3VQ6A 2HBJA 1SKRA 1SUQA 3UKUB 2P9KB 4DQQA 3WXIA 3TARA 1NMNA 4CHYA 3EO3A 1NJZA 1YVUA 2WONA 5C2DA 1VSMA 1Z05A 4BR5A 4BR7A 1QHAA 4CBUA 4FJ9A 1S3XA 3T69A 3VA3A 1L3TA 1NWKA 3PO5A 3I0SA 5M1FA 4CJFA 5AQXA 3H46O 2NRXA 1NNEA 3LDNA 4DTJA 4KI6A 1QHTA 4CF9A 5C2FA 3IMXA 4MO5A 1BHLA 1VQPN 3OYBA 2OTLN 2O8BA 1T8EA 3MN9A 3HPOA 2WC9A 2YI1A 4WCEL 4FLTA 4KH6A 4NCBA 1VQKN 1TYQB 3KLHA 3CPEA 1Q81O 5AQUA 5C12A 3S3OA 1BA0A 3OS0A 4FJ7A 4W5OA 3QO9A 3W3DA 4DFKA 1NG9A 4BRHA 3MN7A 4W5NA 3SQ2A 3DLKA 1NGIA 5T7BA 2VG5A 1BG3A 5F2RA 2P9SA 4E7IA 4YDUC 1NGCA 4JI6K 4B3SK 1MA9B 1NLVA 2NRRA 4CBWA 3HXMA 2CGKA 2YNIA 4JS4A 3J7ZO 2D0PA 5AQIA 2QW9A 2BGGA 4DF8A 5DM6L 2HOEA 2VWJA 3ENHA 4FJXA 2ASOA 2FF6A 2IDOA 4O55A 2F9TA 3DXMA 1EQYA 3OYLA 4HCCA 4WQ4C 2ITGA 5FPNA 2NRVA 4H5NA 5GADP 2OPPA 2O8EB 3BEXA 2IVPA 4NYFA 1LOTB 4NO7A 4RW8A 1SL0A 5JVGL 2YHAA 5LJVA 4DV0K 1TAUA 4CVNE 3W0LA 1RDWX 4H0YB 3SK3A 1SKSA 1VSJA 2EHGA 3VEZA 3K2PA 3FGUA 2E2OA 2I7NA 4L3QA 1RBVA 4DFMA 3BZCA 3SQ1A 1C1BA 2RF2A 1K8KA 4IXCA 4BR2A 1TUUA 3E9PA 1BQMA 4YOTA 5SZTA 3O80A 2I5JA 2BE2A 1REVA 4KTZA 3J80O 1QZ5A 3R8EA 4CEEA 3TI0A 3RR7A 3KKRA 2QXFA 4U67L 3PX6A 1TK5A 3BGRA 4OPJA 4O5BA 1M1KO 3S9HA 4BC4A 4DCHA 3M5RA 2V7ZA 4L8RB 3G6EN 4JNEA 2LSNA 3J7AP 1EP4A 4DLGA 2P51A 4JD2A 1S1TA 3KK3A 3AAPA 3TU5A 2FBVA 3OA9A 3ULEA 4UQGA 2VWBA 2E1ZA 4I2PA 4MFBA 4PQUA 4A5AA 1J6ZA 3LZJA 2X78A 4JKDA 3IDHA 2QWRA 4FLYA 3VQ7A 2CGJA 4CJUA 4Z4CA 5CY4A 5JS1A 2YHXA 5I9EB 4DS4A 4JEPA 3CPWM 1ZYQA 2W40A 2Q31A 1LCUA 2ZJQL 3ISNC 5AJ3K 1IG9A 4DTUA 4NYNA 3WEEB 3L6QA 4FM1A 3WXLA 1HKBA 4RW4A 3FZFA 2RN2A 3O4NA 4FW2A 4BREA 4CD1A 3I56N 2UXCK 4CK1A 1LW0A 3VGLA 4TSXA 5AZJA 4HTUA 4CHNA 2P9PB 4B1VA 1BI4B 4EFHA 1S1XA 4OKEA 3C7NB 4KHQA 1SV5A 4RG8A 4W5RA 4CZJA 4J2DA 1K6YA 1RGIA 1E3MA 4IDHA 4FJ8A 2EX3A 1T44A 2P5GA 2O8FA 2BDPA 2HHTA 3H45C 4OJRA 1IG8A 3V1OA 3PV8A 3FE1A 4A61A 4CW7B 4F3OA 3HVRA 3VTIA 3CJCA 4BDZA 3CCUN 5AQJA 4LH5A 2DFEA 5KPRA 1L3SA 3TABA 5TKWA 5E84A 5FPMA 1YIJN 4B1UB 4M3ZA 1NGBA 5CE3A 4I9LA 1L3VA 3M8SA 2D0AA 4BE1A 4LFBK 3M8RA 4B3TK 5M1PA 4B8CA 3SAFA 1N8RO 3WUHA 1VHXA 2HSTA 5JLHA 2HW3A 1KVCA 1NM1A 2A6AA 3PLAA 3WNEA 1TL3A 4BC2A 3CM5A 5MLCQ 1L3UA 1JLCA 3NVKA 2PYLA 1JLGA 3VF6A 1WN7A 2IS3A 3ZT2A 1VQ6N 4FJKA 5AQGA 3SZ2A 3TAPA 3WT0A 4JKFA 3TAEA 4V19S 2O8CA 1YTAA 4FYDA 2QWLA 3T1AA 2F4VK 3M3ZA 3OYNA 1ZXOA 2GWKA 3C94A 4BRFA 4LH4A 4BY9C 3KK2A 3AVAA 3CFOA 3HZ6A 2X6NA 4NLBA 1JL2A 1O1WA 1HKGA 4CEQA 1OVQA 3HL8A 1J54A 2KLAA 2OPRA 4DSFA 3LP1A 4YORA 4DB3A 3S3MA 4FCYA 4X62K 3U3YA 1JLQA 3O3FA 5FPEA 4FLUA 1P90A 2ZF5O 3EY1A 5EX5A 5AR0A 2W6LA 1JXEA 4H0XB 4HHTA 4WYBA 4H5TA 5AQZA 3O8MA 4FLVA 4DV5K 3SV3A 3ZCMA 4AHVA 5DM7L 4K8XA 4BQLA 1NJYA 4K43A 4CHOA 3RMBA 4AILC 1I94K 3CCJN 1TGOA 3KZBA 3JAMO 4CGDA 4Z94A 4WF9L 4CEAA 1TK8A 5J2PA 4DQ8A 3OYHA 3TTDA 4R5PA 5M1OA 3VOVA 1KRPA 4NXMK 4PUOA 4JKCA 3AVIA 4CJWA 4Z0UA 3F73A 3ATVA 5FDLA 1R0AA 2X6SA 1EWQA 2B6AA 4CI6A 1KAZA 4CEOA 1X9JA 2P9NB 2PBDA 3HPGA 3A5LC 4FLXA 3R1XA 4CFBA 1VQLN 1E4FT 3DXKB 2DPNA 1HUXA 4K42A 5AQQA 1RTJA 1VQ4N 4F4KA 4JI5K 3VEXA 3HRGA 3NCIA 3BZKA 3LDOA 5CZ1A 2XRIA 1LWEA 4H0PA 5AQKA 3EZWA 3FFIA 2ZJPL 4IKFA 4GMJB 3E1YA 3O5BA 3P5JA 3QETA 1RFQA 3VGKA 3O9TA 3CQ8A 4DUZK 2ETJA 3DYAA 4B1XB 4JN4A 3PSIA 2HHSA 1ZBHA 1TAQA 1JLBA 1A5XA 1J9AA 3UB5A 4H8KA 3FZKA 4DV7K 4HUGA 3L0QA 5KQDA 1OH7A 5D3GA 4JKBA 4BC3A 5LMNK 3PO4A 3WNHA 4Z4GA 3THYB 5LMUK 1NK5A 2A40A 2P9IB 1JJ2M 3BDPA 4JKHA 3OTOK 2HVHA 1WSHA 3MXMA 3SPYA 3VF4A 1EETA 3TSUA 5KRTA 3MEDA 1RNHA 1WBDA 3OY9A 2V7YA 5HLFA 4FJIA 4X66K 4M7YA 1JCGA 1Q7YO 1QSLA 3CJ9A 3MMVA 4EZ6A 4AM6A 2E6MA 3VEVA 3GG4A 3D2FB 3WXMB 4X64K 4JHDB 4BR9A 1D4XA 2P9UA 4BG9A 4WFNL 1XI1A 5EOYA 2A3ZA 2A5XA 5AFUA 4JI3K 3LDSA 4CESA 3ZT1A 4LF6K 2GUPA 4J2EA 4OVLA 5J2MA 3V6DA 2HBMA 4CFDA 3OYJA 3AV9A 4CEFA 3VQ5A 1TKDA 3M8PA 3CMEN 4HVJA 1U45A 3AVMA 4FWOA 3DRPA 3I8DA 1HNIA 4DS5A 4FWMA 4BRAA 2NRWA 4BDYA 2ASMA 2G8UA 5BRFA 4PKIA 1UWBA 1ZBIA 4CGFA 1VRUA 4IZ9A 1YITN 1IJJA 3RRGA 2F8SA 2ZWHA 1C0UA 3NGZA 3GE1A 1NBWA 2HNZA 1JCFA 4BE2A 2Z1GA 3RMDA 4CZLA 5C10A 2HNDA 3O4QA 4WFBL 3NF8A 1FKOA 2FC0A 5AQNA 2A41A 3ZEUA 4CHPA 4U7BA 3MEEA 1VSLA 2QKKA 3D7EO 1HMVA 1HNZK 4FZXC 4CBXA 4K25A 1UAXA 3F9MA 3MX2A 5BPNA 4Z4FA 4ELUA 1ZBLA 2D0OA 1ZBSA 2QK9A 5GIOA 4UY8O 1GOBA 3L2UA 1BCMA 2VYPA 2QTDA 3U3GA 2FSJA 4DQSA 4AHUA 3OYIA 3Q7BA 4F8RA 3LDLA 3IRXA 3HTVA 1U47A 4F3TA 1RCHA 3IKMA 2X74A 1Y97A 5BN9A 4A2AA 4Y1CA 3JXUA 1HJRA 3AVJA 3I33A 2HMIA 1W7AA 2YNHA 3LANA 3HM9A 3DLRA 1D9FA 4CZMA 2ZD1A 1K73O 3THVA 4YNQA 3RSEA 3HI0A 4X65K 2QWPA 4XH5A 4EAHD 4BACA 5LJWA 1T03A 4B3MK 2QM1A 1HYZA 1VQ8N 4KAZA 2E88A 3AGKA 4NCAA 1RDCA 2E2NA 3LAMA 1RBRA 1U49A 3DLEA 4RWTA 2O8DB 1VQ9N 3CI5A 2G8KA 1WAJA 3I0RA 5I3UA 1NMDA 2GUIA 4FLZA 2ASPA 3QICA 4ISFA 4B8AB 3O3GA 4CJ3A 4BRNA 4BRIA 3SLCA 4OX9K 1NGHA 4B9TA 3KLIA 3ZSWA 5EVZA 1YTUA 2OPSA 2GX9A 2ZGZA 1KVAA 4CGIA 3VETA 4CFAA 1SL1A 1Q82O 3Q7CA 4AH9A 4DU3A 3A5OC 1GLLO 4ILJA 2E20A 5CYMA 2RE2A 1D8YA 2QWMA 3K9KA 4NB4A 2XY6A 4B08A 3KIOA 4DSJA 2UXBK 4WQ5A 4FJGA 2PAVA 1JL1A 5AQPA 4IWVA 3NAEA 3P38A 1HYVA 3SCXA 4LC9B 4JI7K 4BRDA 4OGEA 1JLAA 1DEJA 5GIPA 4E0DA 1SZ2A 1N34K 2JGUA 3C6AA 3P39A 2J4RA 4O8UA 1NJXA 3ZSXA 2DFHA 2HBKA 2O4GA 1T05A 4ELTA 4ZHRA 5BN8A 1X9SA 1JCEA 1NK4A 5AQOA 2JWKA 4DFJA 3H3OB 3LALA 1XHZA 5AFUH 4H0VB 4FSVA 4N5SA 3THXB 5KPTA 1S72N 4K8ZA 2NLXA 4KH5A 1T7PA 3RRHA 3K59A 3G71N 2UUAK 4JI8K 3MXIA 2BH1A 4I6MA 3ZETB 4QS7A 5E26A 1RT2A 4BRKA 1H1VA 4H4OA 4WFAL 3DMJA 3O9RA 1YUWA 1SQKA 4IEIA 4CZEA 5A2QO 3QIPA 2G8FA 4IJNA 1ASUA 1HX1A 2Q2RA 1CXQA 2XY5A 3ZSOA 5M1QA 4BQZA 1RILA 3KWGA 5HP1A 2AA4A 1RT4A 3V1RA 4IJAA 4KHNA 2HHQA 1W9HA 3OYCA 1B9DA 1XC3A 4B1WB 1WSJA 3U4LA 3NMUA 1HNVA 4C8OA 4FJJA 3WQUA 4KREA 4DHYA 2OYQA 3T1YK 4NCGA 3JSMA 2VGMA 3D2EB 3VQ9A 3DI6A 4FK2A 4B9SA 3V4IA 2PYJA 1BUPA 3KHYA 4KTWA 4OGCA 2CH5A 4IFEA 1ILYA 1HPMA 3SQ4A 1YJ9N 3QFPA 2F96A 3TAQA 4FK4A 3B8AX 4C8LA 2P9LA 4NXNK 2AP1A 3PIPL 5FROA 3K0SA 1UOCA 1VSDA 3MAQA 1XWLA 5AQLA 4PL7A
chains in the Genus database with same CATH topology
3AVCA 5EU7A 1NK8A 2X6NA 4CEBA 1JL2A 1O1WA 5DK5A 3KKSA 1A5WA 4CEQA 3AO2A 5HRNA 4BWMA 3OYGA 1RT3A 3HL8A 1RBSA 2ZQBA 5C24A 4KV8A 1J54A 4LD0A 3VQ8A 1C0TA 2OPRA 3OS2A 4DSFA 4CJSA 2OPQA 3L3UA 2P5OA 2D0CA 1EXQA 3PUFA 3VN5A 3O3HA 3LP1A 5KRSA 4OKJA 3S3MA 4FCYA 3AA5X 1KFDA 1TV6A 2G8VA 3U3YA 1JLQA 3L2RA 3O3FA 2IAJA 3SUQA 2YHBA 4FLUA 4W5QA 2KFNA 4M3UA 4FJMA 2DY4A 3EY1A 4CIFA 3HT3A 1JXEA 1BCOA 3C6UA 4HHTA 2NUBA 1JXBA 4BDPA 4KB0A 4KHUA 1NKEA 3AVHA 4ICLA 2OZMA 4OLBA 2F8TA 2AJQA 1BL3A 4CCHA 3RTVA 3EZ5A 4FLVA 1S1UA 3SV3A 1WSGA 3ZCMA 4AHVA 3NH2A 5FRMA 4FXDA 3AVFA 4K8XA 3SJJA 3PX4A 2G8IA 4M45A 4BWJA 1NJYA 4CHOA 3RMBA 4RW6A 4AILC 5HRPA 1QSYA 4PY5A 3ZSQA 3LWLA 1TGOA 4CGDA 1TKTA 4CEAA 5KGWA 1TK8A 5J2PA 2KQ2A 4CHZA 3OYHA 1NK7A 1D9DA 4R5PA 3NE6A 1KRPA 1LV5A 4PUOA 3AVIA 4CJWA 4Z0UA 5HRRA 4Z4HA 3F73A 2FBYA 5FDLA 1R0AA 2X6SA 5C25A 1KTQA 1VRTA 2B6AA 2GV9A 4CEOA 3ZSZA 3HPGA 4FLXA 4CFBA 1JKHA 1TVRA 3ZT0A 2XY8A 3LPTA 3LZIA 1HPZA 3AO4A 1FKPA 1VSEA 1C1AA 1WAFA 2YKNA 1RTJA 1RDAA 4F4KA 4FZYA 4KTQA 4M3WA 3QLHA 1C0MA 1UA1A 1QQCA 3DLGA 3NCIA 4O4GA 5C42A 5CZ1A 3AVGA 2XRIA 1IO2A 1LWEA 3QERA 4CK2A 4E19A 4KHSA 4FZZA 3ZT3A 5JS2A 4CEDA 4AHTA 1IKVA 4QAGA 1JLEA 3K5OA 5KTQA 4ELVA 3NF7A 3TWHA 4LY7A 2E6LA 4CHQA 5E41A 5I42A 4FJHA 3FFIA 4IKFA 1RTDA 4GMJB 1VSIA 3AO3A 3P5JA 1RBUA 1CZBA 3QETA 5HRSA 4M3RA 3B6PA 3OYKA 4RW9A 3CQ8A 4KFBA 2ETJA 3DYAA 3K57A 1S6PA 1Z26A 1BQNA 1S9EA 4O44A 3VQEA 4CK3A 1CXUA 4AHSA 3CM6A 3QINA 4B9UA 2HHSA 3NGIA 2KFZA 3V81A 2R7YA 4ZTJA 1ZBHA 4FM0A 1TAQA 4M41A 1JLBA 1A5XA 1LAVA 4DMNA 5CZ2A 1J9AA 4DU4A 2A1RA 2HHWA 2Z1JA 2ATQA 1I3AA 4H8KA 1TK0A 4J2AA 3C95A 4HUGA 1BIUA 2D0BA 3AVKA 3CFRA 4DLEA 2KZZA 4C8KA 1ASWA 3JYTA 1ITGA 1CLQA 3KLEA 4FJNA 1ASVA 3AA4A 3VQBA 5SWMA 4DTRA 2VG7A 1IKXA 3HP9A 5DMRA 5D3GA 4IG0A 4CFCA 3HO1A 4E7LA 3PO4A 4CJ4A 1RT7A 3WNHA 4Z4GA 1QE1A 2HNYA 4DG1A 3ULDA 3OYFA 1NK5A 4I2QA 4B9MA 1GOCA 3ZSRA 4B9LA 2PZSA 3BDPA 1DTTA 3AO5A 3CYMA 2XY7A 1U48A 2HVHA 2FBTA 3DM2A 1WSHA 3MXMA 3L2VA 2HHXA 1Q8IA 4IG3A 4CJQA 3SPYA 1DTQA 1EETA 3IG1A 3VQQA 5KRTA 3MEDA 1RNHA 1XC9A 3PY8A 3A2FA 3K5NA 3VQ6A 1SKRA 1SUQA 4XIUA 4DQQA 4CJKA 3OY9A 3QIOA 3TARA 4CHYA 3T19A 1NJZA 2KW4A 2WONA 1YVUA 2VG6A 3LP3A 1VSMA 5HLFA 1NOYA 3KTQA 4FJIA 1RTIA 1C6VA 4DSLA 1QSLA 3KLFA 4Z4EA 4EZ6A 4FJ9A 2E6MA 2HVIA 4LSLA 3VA3A 1L3TA 4CE9A 3PO5A 3SQ0A 4M42A 3F9KA 4B3OA 2Q3SA 3I0SA 4CJFA 4FM2A 3SV4A 3RMCA 4RW7A 1KCFA 1J5OA 1XI1A 4PA1A 3LDSA 1BGXT 4GVMA 4CESA 3ZT1A 4DTJA 4KI6A 1FXXA 1QHTA 3ITHA 4CF9A 4J2EA 4OVLA 4GW6A 2HHVA 4E7HA 2E4LA 4CF0A 5J2MA 3V6DA 4M3TA 1BHLA 4OLAA 4CFDA 3OYBA 3VQCA 3OYJA 1WNSA 3AV9A 4CEFA 3VQ5A 2YNFA 3HPOA 4CJ5A 1NOZA 3SUOA 1T8EA 4FLTA 1N6QA 1TKDA 3M8PA 2G8WA 4KKOA 2B5JA 1NJWA 4NCBA 4DF4A 4HVJA 1U45A 2O4IA 3AVMA 3DRPA 3NF9A 3KLHA 3I8DA 1HNIA 4DS5A 4KRFA 1D5AA 4DTMA 1WSFA 3QNOA 4WE1A 4FK0A 4BDYA 2D5RA 2G8UA 3S3OA 2GBZA 1TKXA 3CG7A 3OS0A 1JLFA 4E1MA 1UWBA 3KK1A 3PX0A 4FJ7A 1ZBIA 4W5OA 3QO9A 1VSKA 3ZSYA 4CGFA 4IDKA 1VRUA 4DFKA 3L8BA 4M3XA 4AHRA 3QEPA 3RRGA 4CJEA 2F8SA 4W5NA 3SQ2A 3DLKA 1C0UA 4ZTFA 1ZBUA 5T7BA 3NGZA 4DQRA 3L3VA 2VG5A 3DOKA 4ID5A 4AHCA 1RT1A 2XO7A 3VQPA 1WSEA 2HNZA 2IOCA 4E7IA 4BE2A 2Z1GA 3RMDA 2XHBA 3D45A 3AA2A 1QS4A 2HNDA 3O4QA 2P1JA 4CF1A 5HROA 2BANA 2WOMA 1FKOA 1KLMA 3NF8A 2FC0A 3HXMA 1NK6A 2YNIA 3HVTA 1A5VA 1S9GA 4CHPA 3MEEA 1VSLA 1Q9XA 3AVLA 3EYZA 2QKKA 4CEZA 1HMVA 4JS4A 4FZXC 1IKWA 4B9VA 3DRSA 4EP5A 1UAXA 3LPUA 2BGGA 4Z4FA 1S5JA 4QOZB 4DF8A 4ELUA 4E7JA 1ZBLA 1UA0A 2VWJA 4F2SA 4FJXA 4CGJA 2IDOA 2B4JA 1IH7A 3QNNA 4O55A 5K14A 1VSFA 4Z4IA 4G1QA 2QK9A 3OYLA 4F2RA 1GOBA 3L2UA 1BCMA 4HCCA 2ITGA 2Y1JA 3OS1A 3SPZA 3LAKA 3U3GA 4DQSA 3QEWA 4AHUA 2OPPA 3OYIA 4NYFA 2W42A 4F8RA 4RW8A 1C1CA 1KVBA 1NK0A 4O0IA 3OYDA 3D0PA 3G10A 3IRXA 3OJUA 5KI6A 4E3SA 1VK0A 3HPHA 2YHAA 1SL0A 4ID1A 3QEIA 4QCLA 4DTOA 1TAUA 1U47A 4F3TA 1RCHA 3G0ZA 2X74A 1Y97A 4Y1CA 4YFUA 3NGYA 3NFAA 1SKSA 3KD1E 1HJRA 3AVJA 4C8MA 1VSJA 2EHGA 4DQIA 3K2PA 3OYAA 2HMIA 4KPYA 2YNHA 3LANA 3M8QA 4IBNA 3HP6A 3HM9A 1RBVA 3DLRA 3V1QA 3OYMA 4DFMA 1D9FA 4CF8A 1S6QA 1LWFA 2ZD1A 3OVNA 1C1BA 3SQ1A 5J1EA 2RF2A 4OKKA 4YNQA 4BE0A 3THVA 1KSPA 4BACA 1BQMA 5CYQA 1T03A 5SZTA 3TAMA 4I7FA 1HYZA 4CERA 2I5JA 2DFFA 2BE2A 4KAZA 1REVA 4KTZA 4NCAA 1RDCA 4CEEA 3QEVA 4JRPA 3TI0A 3KKRA 3RR7A 3LAMA 4JS5A 1RBRA 1LAWA 1U49A 2QXFA 3DLEA 3AVNA 3E01A 4DSKA 2G8KA 3PX6A 1TK5A 1WLJA 1WAJA 2FBXA 3I0RA 5I3UA 3BGRA 3ASMA 4OPJA 2GUIA 4JRQA 4O5BA 4FLZA 4M3YA 3S9HA 3UIQA 4FW1A 4B8AB 1KFSA 3O3GA 4CJ3A 4L8RB 2Z1IA 4DTPA 4CECA 4B9TA 3QESA 1J53A 2LSNA 1EP4A 3P1GA 4DLGA 3KLIA 3ZSWA 2Y1IA 3RR8A 1SKWA 2P51A 1YTUA 2OPSA 4O0JA 1BISA 1S1TA 1RTHA 3K5LA 4B9NA 3KK3A 4LSNA 2OA8A 2DTUA 1KVAA 4DU1A 4CGIA 2FBVA 2G8HA 4CFAA 4HUEA 1F21A 3MEGA 3SI6A 4UQGA 3S3NA 3NDKA 3LP2A 3ZT4A 1SL1A 3V9WA 4AH9A 4DQPA 4I2PA 4MFBA 4DU3A 4PQUA 4N47A 4I9QA 5CYMA 3LZJA 3CFPA 2X78A 3VA0A 1D8YA 2XY6A 3IS9A 3P83D 3KIOA 1EKEA 4B08A 4DSJA 2HB5A 4DSIA 4N76A 4EP4A 4FLYA 3VQ7A 1VSHA 4CJUA 4Z4CA 5CY4A 4FJGA 1JL1A 3DLBA 5JS1A 3NAEA 3IAYA 1HYVA 4DS4A 3SCXA 1LWCA 4KO0A 1ZYQA 4OGEA 1JLAA 1RT5A 1Q9YA 4E0DA 1HRHA 2KTQA 3LWMA 5J2QA 2JGUA 1U04A 3ISNC 3VQAA 1IG9A 4DTUA 1NJXA 1S1WA 3ZSXA 3HJFA 2DFHA 4NYNA 2O4GA 4W5TA 1T05A 4FM1A 4ELTA 3TANA 4ZHRA 3H08A 4RW4A 3O4NA 2RN2A 3V9XA 4FW2A 1NK4A 1X9SA 3V9SA 3OJSA 1G15A 4DFJA 3HK2A 3SYZA 4CJTA 4CK1A 1LW0A 3LALA 4TSXA 4HTUA 1XHZA 1HQEA 1I39A 1RT6A 3KLGA 1IKYA 4CHNA 3OYEA 4KB1A 3NF6A 4IFYA 4N5SA 3L2WA 1BI4B 4DTXA 1S1XA 4OKEA 4KHQA 4K8ZA 1X9MA 4MQ3A 1W0HA 4PWDA 1EX4A 1SV5A 4RG8A 1ZBFA 3DOLA 4W5RA 3RRHA 3K59A 1CZ9A 1T7PA 4J2DA 1K6YA 2JLEA 2YV0X 4CJRA 3MXIA 3KD5E 3DRRA 3ZSVA 3AVBA 1BIZA 4KHYA 4KHWA 3HSTB 2EX3A 4FJ8A 1FK9A 5KGXA 1N5YA 2QKBA 2A1SA 1RT2A 4CJVA 4DFPA 3WNFA 2P5GA 3U6FA 4H4OA 2BDPA 4EZ9A 4Q5VA 2KZMA 1S1VA 2HHTA 1GOAA 4OJRA 1Z25A 1B9FA 1RBTA 3DMJA 3V1OA 3PV8A 1NKBA 1QTMA 5J2NA 1TKZA 3AO1A 3V9UA 4Y1DA 3MECA 4F3OA 3HVRA 4N56A 4BDZA 4DSEA 3QIPA 4LH5A 3TAFA 2G8FA 2DFEA 1L3SA 3RWUA 3K5MA 3TABA 3ALYA 2IGIA 1ASUA 4CF2A 4CIGA 3NH1A 3NBPA 4DTNA 1CXQA 3MXJA 4IFVA 2YNGA 4M3ZA 1KLNA 2XY5A 3SUNA 4CGGA 1XHXA 3LP0A 3ZSOA 3DLHA 4I9LA 4E89A 1L3VA 1QSSA 3M8SA 2D0AA 3K58A 4BE1A 3V9ZA 3M8RA 1WSIA 1RILA 4H4MA 4OPKA 1YT3A 1RDBA 4B8CA 4HUFA 3RMAA 1RT4A 5HP1A 4DWIA 3V1RA 4Q0BA 2HW3A 1HQUA 1KVCA 4KHNA 1MU2A 1X1PA 2OZSA 2HHQA 1W9HA 3HYFA 3OYCA 1B9DA 3WNEA 1TL3A 1WSJA 3CM5A 1RDDA 1BI4A 1JLCA 1L3UA 2PYLA 1NKCA 4DTSA 1HNVA 3NHGA 4C8OA 4FJJA 1JLGA 3VQDA 4KREA 4FJ5A 2RPIA 2OYQA 4HCBA 1WN7A 2IS3A 3L2QA 1HYSA 3ZT2A 4NCGA 3JSMA 4CJLA 3VQ9A 4FJKA 1NK9A 3TR8A 4N41A 3SZ2A 3DI6A 3KJVA 3TAPA 3VQ4A 4E7KA 4B9SA 3V4IA 3SNNA 4FK2A 2PYJA 1B92A 3TAEA 5FRNA 4FVMA 4KTWA 1DLOA 4OGCA 4FJLA 1YTAA 4C8NA 1L5UA 1X9WA 4J2BA 4FLWA 3SQ4A 2ZE2A 3QEXA 4CJPA 2F96A 3TAQA 4JLHA 1SL2A 4KI4A 4CGHA 4FYDA 4E1NA 3WNGA 4FK4A 4C8LA 3TAGA 3B6OA 2RKIA 3T1AA 1U4BA 2Z1HA 1LW2A 2IC3A 5HBMA 2YKMA 1TL1A 5FROA 4CIEA 3OYNA 3C6TA 1UOCA 2HHUA 3SUPA 3AA3A 3C94A 1VSDA 4LH4A 3MAQA 2VWKA 3NH0A 3KK2A 1XWLA 2PY5A 3AVAA 3T3FA 3CFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVC A;  5EU7 A;  1NK8 A;  2X6N A;  4CEB A;  1JL2 A;  1O1W A;  5DK5 A;  3KKS A;  1A5W A;  4CEQ A;  3AO2 A;  5HRN A;  4BWM A;  3OYG A;  1RT3 A;  3HL8 A;  1RBS A;  2ZQB A;  5C24 A;  4KV8 A;  1J54 A;  4LD0 A;  3VQ8 A;  1C0T A;  2OPR A;  3OS2 A;  4DSF A;  4CJS A;  2OPQ A;  3L3U A;  2P5O A;  2D0C A;  1EXQ A;  3PUF A;  3VN5 A;  3O3H A;  3LP1 A;  5KRS A;  4OKJ A;  3S3M A;  4FCY A;  3AA5 X;  1KFD A;  1TV6 A;  2G8V A;  3U3Y A;  1JLQ A;  3L2R A;  3O3F A;  2IAJ A;  3SUQ A;  2YHB A;  4FLU A;  4W5Q A;  2KFN A;  4M3U A;  4FJM A;  2DY4 A;  3EY1 A;  4CIF A;  3HT3 A;  1JXE A;  1BCO A;  3C6U A;  4HHT A;  2NUB A;  1JXB A;  4BDP A;  4KB0 A;  4KHU A;  1NKE A;  3AVH A;  4ICL A;  2OZM A;  4OLB A;  2F8T A;  2AJQ A;  1BL3 A;  4CCH A;  3RTV A;  3EZ5 A;  4FLV A;  1S1U A;  3SV3 A;  1WSG A;  3ZCM A;  4AHV A;  3NH2 A;  5FRM A;  4FXD A;  3AVF A;  4K8X A;  3SJJ A;  3PX4 A;  2G8I A;  4M45 A;  4BWJ A;  1NJY A;  4CHO A;  3RMB A;  4RW6 A;  4AIL C;  5HRP A;  1QSY A;  4PY5 A;  3ZSQ A;  3LWL A;  1TGO A;  4CGD A;  1TKT A;  4CEA A;  5KGW A;  1TK8 A;  5J2P A;  2KQ2 A;  4CHZ A;  3OYH A;  1NK7 A;  1D9D A;  4R5P A;  3NE6 A;  1KRP A;  1LV5 A;  4PUO A;  3AVI A;  4CJW A;  4Z0U A;  5HRR A;  4Z4H A;  3F73 A;  2FBY A;  5FDL A;  1R0A A;  2X6S A;  5C25 A;  1KTQ A;  1VRT A;  2B6A A;  2GV9 A;  4CEO A;  3ZSZ A;  3HPG A;  4FLX A;  4CFB A;  1JKH A;  1TVR A;  3ZT0 A;  2XY8 A;  3LPT A;  3LZI A;  1HPZ A;  3AO4 A;  1FKP A;  1VSE A;  1C1A A;  1WAF A;  2YKN A;  1RTJ A;  1RDA A;  4F4K A;  4FZY A;  4KTQ A;  4M3W A;  3QLH A;  1C0M A;  1UA1 A;  1QQC A;  3DLG A;  3NCI A;  4O4G A;  5C42 A;  5CZ1 A;  3AVG A;  2XRI A;  1IO2 A;  1LWE A;  3QER A;  4CK2 A;  4E19 A;  4KHS A;  4FZZ A;  3ZT3 A;  5JS2 A;  4CED A;  4AHT A;  1IKV A;  4QAG A;  1JLE A;  3K5O A;  5KTQ A;  4ELV A;  3NF7 A;  3TWH A;  4LY7 A;  2E6L A;  4CHQ A;  5E41 A;  5I42 A;  4FJH A;  3FFI A;  4IKF A;  1RTD A;  4GMJ B;  1VSI A;  3AO3 A;  3P5J A;  1RBU A;  1CZB A;  3QET A;  5HRS A;  4M3R A;  3B6P A;  3OYK A;  4RW9 A;  3CQ8 A;  4KFB A;  2ETJ A;  3DYA A;  3K57 A;  1S6P A;  1Z26 A;  1BQN A;  1S9E A;  4O44 A;  3VQE A;  4CK3 A;  1CXU A;  4AHS A;  3CM6 A;  3QIN A;  4B9U A;  2HHS A;  3NGI A;  2KFZ A;  3V81 A;  2R7Y A;  4ZTJ A;  1ZBH A;  4FM0 A;  1TAQ A;  4M41 A;  1JLB A;  1A5X A;  1LAV A;  4DMN A;  5CZ2 A;  1J9A A;  4DU4 A;  2A1R A;  2HHW A;  2Z1J A;  2ATQ A;  1I3A A;  4H8K A;  1TK0 A;  4J2A A;  3C95 A;  4HUG A;  1BIU A;  2D0B A;  3AVK A;  3CFR A;  4DLE A;  2KZZ A;  4C8K A;  1ASW A;  3JYT A;  1ITG A;  1CLQ A;  3KLE A;  4FJN A;  1ASV A;  3AA4 A;  3VQB A;  5SWM A;  4DTR A;  2VG7 A;  1IKX A;  3HP9 A;  5DMR A;  5D3G A;  4IG0 A;  4CFC A;  3HO1 A;  4E7L A;  3PO4 A;  4CJ4 A;  1RT7 A;  3WNH A;  4Z4G A;  1QE1 A;  2HNY A;  4DG1 A;  3ULD A;  3OYF A;  1NK5 A;  4I2Q A;  4B9M A;  1GOC A;  3ZSR A;  4B9L A;  2PZS A;  3BDP A;  1DTT A;  3AO5 A;  3CYM A;  2XY7 A;  1U48 A;  2HVH A;  2FBT A;  3DM2 A;  1WSH A;  3MXM A;  3L2V A;  2HHX A;  1Q8I A;  4IG3 A;  4CJQ A;  3SPY A;  1DTQ A;  1EET A;  3IG1 A;  3VQQ A;  5KRT A;  3MED A;  1RNH A;  1XC9 A;  3PY8 A;  3A2F A;  3K5N A;  3VQ6 A;  1SKR A;  1SUQ A;  4XIU A;  4DQQ A;  4CJK A;  3OY9 A;  3QIO A;  3TAR A;  4CHY A;  3T19 A;  1NJZ A;  2KW4 A;  2WON A;  1YVU A;  2VG6 A;  3LP3 A;  1VSM A;  5HLF A;  1NOY A;  3KTQ A;  4FJI A;  1RTI A;  1C6V A;  4DSL A;  1QSL A;  3KLF A;  4Z4E A;  4EZ6 A;  4FJ9 A;  2E6M A;  2HVI A;  4LSL A;  3VA3 A;  1L3T A;  4CE9 A;  3PO5 A;  3SQ0 A;  4M42 A;  3F9K A;  4B3O A;  2Q3S A;  3I0S A;  4CJF A;  4FM2 A;  3SV4 A;  3RMC A;  4RW7 A;  1KCF A;  1J5O A;  1XI1 A;  4PA1 A;  3LDS A;  1BGX T;  4GVM A;  4CES A;  3ZT1 A;  4DTJ A;  4KI6 A;  1FXX A;  1QHT A;  3ITH A;  4CF9 A;  4J2E A;  4OVL A;  4GW6 A;  2HHV A;  4E7H A;  2E4L A;  4CF0 A;  5J2M A;  3V6D A;  4M3T A;  1BHL A;  4OLA A;  4CFD A;  3OYB A;  3VQC A;  3OYJ A;  1WNS A;  3AV9 A;  4CEF A;  3VQ5 A;  2YNF A;  3HPO A;  4CJ5 A;  1NOZ A;  3SUO A;  1T8E A;  4FLT A;  1N6Q A;  1TKD A;  3M8P A;  2G8W A;  4KKO A;  2B5J A;  1NJW A;  4NCB A;  4DF4 A;  4HVJ A;  1U45 A;  2O4I A;  3AVM A;  3DRP A;  3NF9 A;  3KLH A;  3I8D A;  1HNI A;  4DS5 A;  4KRF A;  1D5A A;  4DTM A;  1WSF A;  3QNO A;  4WE1 A;  4FK0 A;  4BDY A;  2D5R A;  2G8U A;  3S3O A;  2GBZ A;  1TKX A;  3CG7 A;  3OS0 A;  1JLF A;  4E1M A;  1UWB A;  3KK1 A;  3PX0 A;  4FJ7 A;  1ZBI A;  4W5O A;  3QO9 A;  1VSK A;  3ZSY A;  4CGF A;  4IDK A;  1VRU A;  4DFK A;  3L8B A;  4M3X A;  4AHR A;  3QEP A;  3RRG A;  4CJE A;  2F8S A;  4W5N A;  3SQ2 A;  3DLK A;  1C0U A;  4ZTF A;  1ZBU A;  5T7B A;  3NGZ A;  4DQR A;  3L3V A;  2VG5 A;  3DOK A;  4ID5 A;  4AHC A;  1RT1 A;  2XO7 A;  3VQP A;  1WSE A;  2HNZ A;  2IOC A;  4E7I A;  4BE2 A;  2Z1G A;  3RMD A;  2XHB A;  3D45 A;  3AA2 A;  1QS4 A;  2HND A;  3O4Q A;  2P1J A;  4CF1 A;  5HRO A;  2BAN A;  2WOM A;  1FKO A;  1KLM A;  3NF8 A;  2FC0 A;  3HXM A;  1NK6 A;  2YNI A;  3HVT A;  1A5V A;  1S9G A;  4CHP A;  3MEE A;  1VSL A;  1Q9X A;  3AVL A;  3EYZ A;  2QKK A;  4CEZ A;  1HMV A;  4JS4 A;  4FZX C;  1IKW A;  4B9V A;  3DRS A;  4EP5 A;  1UAX A;  3LPU A;  2BGG A;  4Z4F A;  1S5J A;  4QOZ B;  4DF8 A;  4ELU A;  4E7J A;  1ZBL A;  1UA0 A;  2VWJ A;  4F2S A;  4FJX A;  4CGJ A;  2IDO A;  2B4J A;  1IH7 A;  3QNN A;  4O55 A;  5K14 A;  1VSF A;  4Z4I A;  4G1Q A;  2QK9 A;  3OYL A;  4F2R A;  1GOB A;  3L2U A;  1BCM A;  4HCC A;  2ITG A;  2Y1J A;  3OS1 A;  3SPZ A;  3LAK A;  3U3G A;  4DQS A;  3QEW A;  4AHU A;  2OPP A;  3OYI A;  4NYF A;  2W42 A;  4F8R A;  4RW8 A;  1C1C A;  1KVB A;  1NK0 A;  4O0I A;  3OYD A;  3D0P A;  3G10 A;  3IRX A;  3OJU A;  5KI6 A;  4E3S A;  1VK0 A;  3HPH A;  2YHA A;  1SL0 A;  4ID1 A;  3QEI A;  4QCL A;  4DTO A;  1TAU A;  1U47 A;  4F3T A;  1RCH A;  3G0Z A;  2X74 A;  1Y97 A;  4Y1C A;  4YFU A;  3NGY A;  3NFA A;  1SKS A;  3KD1 E;  1HJR A;  3AVJ A;  4C8M A;  1VSJ A;  2EHG A;  4DQI A;  3K2P A;  3OYA A;  2HMI A;  4KPY A;  2YNH A;  3LAN A;  3M8Q A;  4IBN A;  3HP6 A;  3HM9 A;  1RBV A;  3DLR A;  3V1Q A;  3OYM A;  4DFM A;  1D9F A;  4CF8 A;  1S6Q A;  1LWF A;  2ZD1 A;  3OVN A;  1C1B A;  3SQ1 A;  5J1E A;  2RF2 A;  4OKK A;  4YNQ A;  4BE0 A;  3THV A;  1KSP A;  4BAC A;  1BQM A;  5CYQ A;  1T03 A;  5SZT A;  3TAM A;  4I7F A;  1HYZ A;  4CER A;  2I5J A;  2DFF A;  2BE2 A;  4KAZ A;  1REV A;  4KTZ A;  4NCA A;  1RDC A;  4CEE A;  3QEV A;  4JRP A;  3TI0 A;  3KKR A;  3RR7 A;  3LAM A;  4JS5 A;  1RBR A;  1LAW A;  1U49 A;  2QXF A;  3DLE A;  3AVN A;  3E01 A;  4DSK A;  2G8K A;  3PX6 A;  1TK5 A;  1WLJ A;  1WAJ A;  2FBX A;  3I0R A;  5I3U A;  3BGR A;  3ASM A;  4OPJ A;  2GUI A;  4JRQ A;  4O5B A;  4FLZ A;  4M3Y A;  3S9H A;  3UIQ A;  4FW1 A;  4B8A B;  1KFS A;  3O3G A;  4CJ3 A;  4L8R B;  2Z1I A;  4DTP A;  4CEC A;  4B9T A;  3QES A;  1J53 A;  2LSN A;  1EP4 A;  3P1G A;  4DLG A;  3KLI A;  3ZSW A;  2Y1I A;  3RR8 A;  1SKW A;  2P51 A;  1YTU A;  2OPS A;  4O0J A;  1BIS A;  1S1T A;  1RTH A;  3K5L A;  4B9N A;  3KK3 A;  4LSN A;  2OA8 A;  2DTU A;  1KVA A;  4DU1 A;  4CGI A;  2FBV A;  2G8H A;  4CFA A;  4HUE A;  1F21 A;  3MEG A;  3SI6 A;  4UQG A;  3S3N A;  3NDK A;  3LP2 A;  3ZT4 A;  1SL1 A;  3V9W A;  4AH9 A;  4DQP A;  4I2P A;  4MFB A;  4DU3 A;  4PQU A;  4N47 A;  4I9Q A;  5CYM A;  3LZJ A;  3CFP A;  2X78 A;  3VA0 A;  1D8Y A;  2XY6 A;  3IS9 A;  3P83 D;  3KIO A;  1EKE A;  4B08 A;  4DSJ A;  2HB5 A;  4DSI A;  4N76 A;  4EP4 A;  4FLY A;  3VQ7 A;  1VSH A;  4CJU A;  4Z4C A;  5CY4 A;  4FJG A;  1JL1 A;  3DLB A;  5JS1 A;  3NAE A;  3IAY A;  1HYV A;  4DS4 A;  3SCX A;  1LWC A;  4KO0 A;  1ZYQ A;  4OGE A;  1JLA A;  1RT5 A;  1Q9Y A;  4E0D A;  1HRH A;  2KTQ A;  3LWM A;  5J2Q A;  2JGU A;  1U04 A;  3ISN C;  3VQA A;  1IG9 A;  4DTU A;  1NJX A;  1S1W A;  3ZSX A;  3HJF A;  2DFH A;  4NYN A;  2O4G A;  4W5T A;  1T05 A;  4FM1 A;  4ELT A;  3TAN A;  4ZHR A;  3H08 A;  4RW4 A;  3O4N A;  2RN2 A;  3V9X A;  4FW2 A;  1NK4 A;  1X9S A;  3V9S A;  3OJS A;  1G15 A;  4DFJ A;  3HK2 A;  3SYZ A;  4CJT A;  4CK1 A;  1LW0 A;  3LAL A;  4TSX A;  4HTU A;  1XHZ A;  1HQE A;  1I39 A;  1RT6 A;  3KLG A;  1IKY A;  4CHN A;  3OYE A;  4KB1 A;  3NF6 A;  4IFY A;  4N5S A;  3L2W A;  1BI4 B;  4DTX A;  1S1X A;  4OKE A;  4KHQ A;  4K8Z A;  1X9M A;  4MQ3 A;  1W0H A;  4PWD A;  1EX4 A;  1SV5 A;  4RG8 A;  1ZBF A;  3DOL A;  4W5R A;  3RRH A;  3K59 A;  1CZ9 A;  1T7P A;  4J2D A;  1K6Y A;  2JLE A;  2YV0 X;  4CJR A;  3MXI A;  3KD5 E;  3DRR A;  3ZSV A;  3AVB A;  1BIZ A;  4KHY A;  4KHW A;  3HST B;  2EX3 A;  4FJ8 A;  1FK9 A;  5KGX A;  1N5Y A;  2QKB A;  2A1S A;  1RT2 A;  4CJV A;  4DFP A;  3WNF A;  2P5G A;  3U6F A;  4H4O A;  2BDP A;  4EZ9 A;  4Q5V A;  2KZM A;  1S1V A;  2HHT A;  1GOA A;  4OJR A;  1Z25 A;  1B9F A;  1RBT A;  3DMJ A;  3V1O A;  3PV8 A;  1NKB A;  1QTM A;  5J2N A;  1TKZ A;  3AO1 A;  3V9U A;  4Y1D A;  3MEC A;  4F3O A;  3HVR A;  4N56 A;  4BDZ A;  4DSE A;  3QIP A;  4LH5 A;  3TAF A;  2G8F A;  2DFE A;  1L3S A;  3RWU A;  3K5M A;  3TAB A;  3ALY A;  2IGI A;  1ASU A;  4CF2 A;  4CIG A;  3NH1 A;  3NBP A;  4DTN A;  1CXQ A;  3MXJ A;  4IFV A;  2YNG A;  4M3Z A;  1KLN A;  2XY5 A;  3SUN A;  4CGG A;  1XHX A;  3LP0 A;  3ZSO A;  3DLH A;  4I9L A;  4E89 A;  1L3V A;  1QSS A;  3M8S A;  2D0A A;  3K58 A;  4BE1 A;  3V9Z A;  3M8R A;  1WSI A;  1RIL A;  4H4M A;  4OPK A;  1YT3 A;  1RDB A;  4B8C A;  4HUF A;  3RMA A;  1RT4 A;  5HP1 A;  4DWI A;  3V1R A;  4Q0B A;  2HW3 A;  1HQU A;  1KVC A;  4KHN A;  1MU2 A;  1X1P A;  2OZS A;  2HHQ A;  1W9H A;  3HYF A;  3OYC A;  1B9D A;  3WNE A;  1TL3 A;  1WSJ A;  3CM5 A;  1RDD A;  1BI4 A;  1JLC A;  1L3U A;  2PYL A;  1NKC A;  4DTS A;  1HNV A;  3NHG A;  4C8O A;  4FJJ A;  1JLG A;  3VQD A;  4KRE A;  4FJ5 A;  2RPI A;  2OYQ A;  4HCB A;  1WN7 A;  2IS3 A;  3L2Q A;  1HYS A;  3ZT2 A;  4NCG A;  3JSM A;  4CJL A;  3VQ9 A;  4FJK A;  1NK9 A;  3TR8 A;  4N41 A;  3SZ2 A;  3DI6 A;  3KJV A;  3TAP A;  3VQ4 A;  4E7K A;  4B9S A;  3V4I A;  3SNN A;  4FK2 A;  2PYJ A;  1B92 A;  3TAE A;  5FRN A;  4FVM A;  4KTW A;  1DLO A;  4OGC A;  4FJL A;  1YTA A;  4C8N A;  1L5U A;  1X9W A;  4J2B A;  4FLW A;  3SQ4 A;  2ZE2 A;  3QEX A;  4CJP A;  2F96 A;  3TAQ A;  4JLH A;  1SL2 A;  4KI4 A;  4CGH A;  4FYD A;  4E1N A;  3WNG A;  4FK4 A;  4C8L A;  3TAG A;  3B6O A;  2RKI A;  3T1A A;  1U4B A;  2Z1H A;  1LW2 A;  2IC3 A;  5HBM A;  2YKM A;  1TL1 A;  5FRO A;  4CIE A;  3OYN A;  3C6T A;  1UOC A;  2HHU A;  3SUP A;  3AA3 A;  3C94 A;  1VSD A;  4LH4 A;  3MAQ A;  2VWK A;  3NH0 A;  3KK2 A;  1XWL A;  2PY5 A;  3AVA A;  3T3F A;  3CFO A; 
#chains in the Genus database with same CATH topology
 3AVC A;  4B9Q A;  3GL1 A;  5TKY A;  1T6D A;  3OYG A;  3CXC M;  3VQ8 A;  3OS2 A;  4BR0 A;  4CJS A;  2E1Y A;  2D0C A;  2VGN A;  3DAW A;  3BP8 A;  1ESV A;  4HTL A;  1TV6 A;  3L2R A;  4PKG A;  2F7T A;  4FPB A;  3HT3 A;  3A5M C;  1BCO A;  2NUB A;  3EKU A;  3T7Z A;  4ICL A;  2OZM A;  4M63 C;  2FF3 B;  3RTV A;  4B1Y B;  3NH2 A;  4FXD A;  3AVF A;  2G8I A;  4M45 A;  5HL7 L;  4FWQ A;  4RW6 A;  1QSY A;  1U2V A;  3FFK B;  5KGW A;  4CHZ A;  1D9D A;  3NE6 A;  5HRR A;  2FBY A;  5C25 A;  1VRT A;  4YOU A;  4JYA K;  2GV9 A;  3ZT0 A;  3HOS A;  2XY8 A;  3LPT A;  1HPZ A;  2HBL A;  1WAF A;  1C1A A;  2YKN A;  1GLE G;  4FZY A;  1VQ5 N;  3FR0 A;  3UE5 A;  1UA1 A;  2Q0U A;  1IO2 A;  4WQ4 A;  4E19 A;  3ZT3 A;  2QXL A;  1IKV A;  1NGE A;  1JLE A;  5KTQ A;  4ELV A;  5BR8 K;  4CHQ A;  2VQE K;  5E41 A;  3I55 N;  5I42 A;  3C6H A;  1VSI A;  2CGL A;  5BR9 A;  1CZB A;  5GAG P;  5HRS A;  3B6P A;  1V4S A;  1TUY A;  4RW9 A;  2HF3 A;  3CJ7 A;  1W97 L;  3K57 A;  3EE8 A;  1J5E K;  1Z26 A;  4O44 A;  1CXU A;  3CM6 A;  3NGI A;  3CCR N;  4ZTJ A;  4FM0 A;  3ZX2 A;  1LAV A;  4DMN A;  5CZ2 A;  4DU4 A;  2A1R A;  5GIN A;  2HHW A;  2Z1J A;  2ATQ A;  3THW A;  4JK7 A;  1TK0 A;  1M90 O;  2D0B A;  3AVK A;  4DLE A;  3VMF B;  2O8B B;  1DT9 A;  3JYT A;  1CLQ A;  3KLE A;  1ASV A;  3AA4 A;  3VQB A;  4DTR A;  1T3V A;  2UYT A;  1IKX A;  5DMR A;  1KD1 O;  3HO1 A;  4E7L A;  3O4W A;  3R3L A;  1QE1 A;  4FWR A;  3ULD A;  1GOC A;  4B9L A;  3CYM A;  1Y64 A;  3H3N O;  5KQ8 A;  1U48 A;  4JI0 K;  3ZYY X;  2FBT A;  3L2V A;  1Q8I A;  2YJE A;  4CJQ A;  3IG1 A;  2D1K A;  3VQQ A;  1K9M O;  3P31 A;  5AQR A;  3A2F A;  4XIU A;  2Q36 A;  3SAG A;  2P9S B;  3A8Y A;  4EHT A;  3T19 A;  2VG6 A;  3QBW A;  1NOY A;  5AQS A;  1C6V A;  3O9Q A;  3KLF A;  4Z4E A;  3C65 A;  1N32 K;  2E5L K;  3SQ0 A;  4M42 A;  3F9K A;  3SBG A;  3SMP A;  2FSN A;  1YAG A;  4I6M B;  4RW7 A;  1KCF A;  1J5O A;  3CHW A;  5AQH A;  3SJH A;  3OBW A;  3WQT A;  1BGX T;  1FXX A;  4GW6 A;  2HHV A;  4E7H A;  4M3T A;  3TTC A;  3SUO A;  3DXM B;  2UUC K;  3CER A;  5AQY A;  1N6Q A;  2QA4 N;  1NJW A;  5LY3 A;  4DF4 A;  4JKG A;  4FOI A;  5M1N A;  2O4I A;  1D5A A;  4DTM A;  1WSF A;  4WE1 A;  3VGM A;  3HM8 A;  3MWT A;  2YHY A;  2D5R A;  2GBZ A;  1TKX A;  4FO0 A;  3CG7 A;  1JLF A;  4E1M A;  3PX0 A;  4DR1 K;  4DR3 K;  3DLL L;  3L8B A;  4M3X A;  3UKR A;  3QEP A;  4FWL A;  3VES A;  4CJE A;  4H5R A;  3ZLJ A;  4XH4 A;  1W2B M;  1ZBU A;  3EN9 A;  3L3V A;  3DOK A;  4ID5 A;  4AHC A;  2XO7 A;  3UKU A;  2P9K A;  5AQW A;  3VQP A;  4DKW A;  2PFU A;  2KKZ A;  3E9O A;  4CD3 A;  5C15 A;  1K8K B;  2XHB A;  3AA2 A;  4CF1 A;  2QI2 A;  2P1J A;  4H5V A;  3A5N C;  2BAN A;  2WOM A;  1KLM A;  4MDA A;  3DWL A;  1X3N A;  3CJB A;  1S9G A;  3EYZ A;  4PHT X;  1OH8 A;  2NRT A;  4FWS A;  3MN5 A;  1S5J A;  4QOZ B;  4JK8 A;  4E7J A;  1UA0 A;  1IH7 A;  1VSF A;  4Z4I A;  4G1Q A;  3E66 A;  1YXQ A;  2W6K A;  3MX5 A;  1TYQ A;  4JD2 B;  3CQX A;  2W42 A;  1KVB A;  3D0P A;  3OJU A;  4E3S A;  4QCL A;  5KI6 A;  3ULE B;  1VK0 A;  3HPH A;  4ID1 A;  4DTO A;  4BVO A;  3NFA A;  4C8M A;  4KPY A;  4IBN A;  3M6G A;  3V1Q A;  3OYM A;  3KK7 A;  1S6Q A;  3OVN A;  4OKK A;  4BE0 A;  4BRG A;  4O8K A;  4A62 A;  1KSP A;  5CYQ A;  4I7F A;  1XQS C;  2WFB A;  5AQT A;  3QEV A;  4JS5 A;  1LAW A;  3GDQ A;  1XMQ K;  1WLJ A;  4FWN A;  5H1S Q;  4M3Y A;  3UIQ A;  4B3R K;  5AZJ B;  4MLH A;  1GLJ O;  4AQY K;  3M1F A;  1KAY A;  3HOT A;  3QES A;  4BRQ A;  3P1G A;  2Y1I A;  3ATU A;  2GEM A;  3QML A;  2O8E A;  1BIS A;  3QBX A;  2OAN A;  1RTH A;  4B9N A;  3CC2 N;  4BC5 A;  2DTU A;  1QQO A;  1HNX K;  3SI6 A;  3MEG A;  3MN6 A;  3S3N A;  3LP2 A;  2O8F B;  2FSK A;  1BDG A;  4AM7 A;  4N47 A;  1HJO A;  3VEY A;  2RHK A;  3O1W A;  3AAR A;  3CFP A;  3IS9 A;  1EKE A;  4N76 A;  1VSH A;  4FPA A;  4HWI A;  3DLB A;  2GWJ A;  1Q86 O;  1LWC A;  4PKH A;  3DJC A;  3TSP A;  1Q9Y A;  4C23 A;  2KTQ A;  3LWM A;  5J2Q A;  2VQF K;  4WQ5 C;  1S1W A;  3NVM A;  1EWR A;  4JKA A;  4W5T A;  1HNW K;  3ID6 A;  1GLF O;  4JI4 K;  3OJS A;  1G15 A;  3HK2 A;  3SYZ A;  4YOX A;  1MWK A;  1I39 A;  3E9L A;  1IKY A;  3OYE A;  4KBO A;  3NF6 A;  4CZK A;  4DV2 K;  2GEL A;  1X9M A;  1EX4 A;  1ZBF A;  3CMA N;  4ILH A;  1XNR K;  3FZM A;  4E1J A;  3DRR A;  3ZSV A;  1BIZ A;  3HST B;  3BF1 A;  1N5Y A;  1NGF A;  2A1S A;  4CJV A;  4DFP A;  5AQM A;  3WNF A;  3U6F A;  3IUC A;  4Q5V A;  2O8C B;  4O5F A;  4MO4 A;  1GOA A;  3KWI A;  1RBT A;  5JMV A;  1TKZ A;  3AO1 A;  4Y1D A;  3MEC A;  4LF4 K;  4N56 A;  3TSQ A;  1QVF M;  3RWU A;  3ALY A;  2IGI A;  4CIG A;  2IVN A;  4EIA A;  2EWS A;  3NH1 A;  4DTN A;  3MXJ A;  4CZI A;  5HOO A;  1KLN A;  3SUN A;  1XHX A;  3AAQ A;  3JS6 A;  4E89 A;  1QSS A;  4YOW A;  3K58 A;  3V9Z A;  3WEE A;  1WSI A;  4H4M A;  1KAX A;  4HUF A;  3RMA A;  4ILG B;  1MU2 A;  1X1P A;  5AZI A;  2P9P A;  4LF7 K;  1RDD A;  1BI4 A;  3C7N A;  2V51 B;  3ZX3 A;  3VQD A;  4FJ5 A;  3H1V X;  1NK9 A;  3MWP A;  3TR8 A;  3VQ4 A;  4E7K A;  3VEW A;  5C0Y A;  3QDK A;  1DLO A;  4JAX A;  1X9W A;  4DR2 K;  4J2B A;  1MDU B;  3QEX A;  1P8Z A;  3O08 A;  5GAH P;  4KI4 A;  4CGH A;  5GAE P;  3TAG A;  3B6O A;  1U4B A;  1LW2 A;  2IC3 A;  5HBM A;  2YKM A;  1TL1 A;  4CIE A;  1BU6 O;  3OBY A;  3ID8 A;  2Q1N A;  3AA3 A;  2VWK A;  3NH0 A;  3QB0 A;  3CET A;  2PY5 A;  4KH4 A;  2KHO A;  3VEN A;  4J8F A;  1R59 O;  1NK8 A;  4KHP K;  4CEB A;  1A5W A;  5HRN A;  1GLC G;  4BWM A;  3G25 A;  4BR4 A;  4F9O A;  2ZQB A;  4KV8 A;  2Q97 A;  2P5O A;  5BRD A;  1EXQ A;  3PUF A;  3O3H A;  1ATN A;  4OKJ A;  2UU9 K;  3SUQ A;  2IAJ A;  2YHB A;  2KFN A;  3C0B A;  2ZM6 K;  1OH6 A;  4CIF A;  3C6U A;  4YOV A;  4H0O A;  4BDP A;  4KB0 A;  2AJQ A;  1BL3 A;  4CCH A;  2OTJ N;  4M7X A;  3EZ5 A;  2WTU A;  4RTF D;  1OH5 A;  1WSG A;  2I7P A;  5FRM A;  4GV6 A;  4GY2 B;  4CZG A;  4BWJ A;  1VQO N;  1GLB G;  5HRP A;  3ZSQ A;  1EO1 A;  3WXK A;  2KQ2 A;  1QQN A;  1NK7 A;  1DGK N;  2YCH A;  4Z4H A;  5AQF A;  1KTQ A;  3HBT A;  4AF1 A;  3ZSZ A;  5JIC A;  3AO4 A;  4BRL A;  3CCQ N;  1WB9 A;  1VSE A;  2NRH A;  4KTQ A;  4MDB A;  3AY9 A;  1C0M A;  3QLH A;  1IBK K;  4O4G A;  5C42 A;  3AVG A;  4PL8 A;  3S41 A;  4KHS A;  3CCM N;  4FZZ A;  5JS2 A;  2QWO A;  3OHR A;  3NF7 A;  3TWH A;  4LY7 A;  2E6L A;  5BRE A;  4DR7 K;  1RTD A;  1U6Z A;  3AO3 A;  4CJ7 A;  1RBU A;  1V4T A;  5JLF A;  1QQM A;  3CCV N;  3BF3 A;  3O9S A;  3A0I X;  1BQN A;  1KQS M;  4B9U A;  5ADX A;  2KFZ A;  3V81 A;  1YF5 L;  2P9U B;  1I3A A;  3R6M A;  4OPH A;  4G9Z A;  3CFR A;  2HMP A;  3LDQ A;  1ITG A;  4BRC A;  2VG7 A;  3HP9 A;  3K9J A;  4CFC A;  2P9N A;  2QWN A;  3T1H K;  4LF9 K;  3DXK A;  4B9M A;  1DTT A;  3AO5 A;  2XY7 A;  4IG3 A;  1DTQ A;  3F5T A;  1XC9 A;  3PY8 A;  3O1B A;  4CJK A;  3G4S N;  4XH1 A;  3QIO A;  1WUA A;  4B1Z A;  2KW4 A;  3LP3 A;  4BRM A;  3KTQ A;  1C0F A;  1RTI A;  4DSL A;  3HSC A;  2HVI A;  4LSL A;  3TPQ A;  3ZEU B;  1YJW N;  4CE9 A;  4B3O A;  3MDQ A;  2Q3S A;  3PIO L;  4FM2 A;  3SV4 A;  3RMC A;  4PA1 A;  4C1N K;  4GVM A;  1E4G T;  5JVH L;  2HF4 A;  3ITH A;  2E4L A;  4CF0 A;  4OLA A;  3VQC A;  1WNS A;  2YNF A;  4CJ5 A;  1NOZ A;  1VAZ A;  2G8W A;  1IV0 A;  4FOE A;  4KKO A;  2B5J A;  3SBT A;  1C0G A;  3THY A;  3NF9 A;  4KRF A;  4FWK A;  3QNO A;  1IBM K;  4FK0 A;  2P9I A;  5AQV A;  3CCL N;  1G99 A;  2QWQ A;  2V52 B;  4YDU A;  3KK1 A;  3CC4 N;  4ISG A;  1VSK A;  3ZSY A;  1NGD A;  4IDK A;  4AHR A;  4LFA K;  5IT9 O;  3EKS A;  4A2B A;  4ZTF A;  4DQR A;  5IWA K;  1YHQ N;  1RT1 A;  4IEE A;  1WSE A;  3U8X A;  2IOC A;  3BY5 A;  2E2P A;  2NZT A;  3RSE B;  4IOC L;  1FJG K;  4BGA A;  1KC8 O;  3BUZ B;  5AZI B;  3D45 A;  1QS4 A;  5HRO A;  3KVG A;  4DV3 K;  1NK6 A;  3HVT A;  3RVC A;  1A5V A;  3D2F A;  5LL6 Z;  1Q9X A;  3AVL A;  4CEZ A;  4DV6 K;  1IKW A;  4B9V A;  3DRS A;  4JHD A;  1GLA G;  4EP5 A;  3LPU A;  1RDU A;  3AGR A;  1OVY A;  5KPZ A;  1Z6R A;  2NRZ A;  4F2S A;  2E2Q A;  4CGJ A;  1NGA A;  2B4J A;  3QNN A;  5K14 A;  4LFC K;  1OKJ A;  3SAH A;  4F2R A;  4BVP A;  3TTF A;  2Y1J A;  3SPZ A;  3OS1 A;  3LAK A;  3QEW A;  1C1C A;  3O6W A;  1NK0 A;  2Q0R A;  4DR4 K;  4O0I A;  3OYD A;  3G10 A;  1BA1 A;  3QEI A;  2ZGY A;  3MCP A;  1MWM A;  3G0Z A;  3ENO A;  3LM9 A;  4YFU A;  4R79 A;  3NGY A;  3KD1 E;  4DQI A;  1GLD G;  2IIR A;  3OYA A;  3M8Q A;  3HP6 A;  1ATR A;  4CF8 A;  1LWF A;  5J1E A;  1SAZ A;  3I8B A;  5EY4 A;  3TAM A;  4GV9 A;  4CER A;  2UXD K;  2DFF A;  2VCP A;  3EL2 A;  4JRP A;  4FVU A;  4GNI A;  1XUP O;  3AVN A;  3E01 A;  4FWP A;  4DSK A;  5ADX H;  1NGG A;  2FBX A;  3OW2 M;  3ASM A;  4JRQ A;  3N4P A;  4FW1 A;  4H0T B;  1KFS A;  3J8A A;  2Z1I A;  4DTP A;  4CEC A;  1YI2 N;  2BTF A;  3ZX0 A;  1J53 A;  1CZA N;  3RR8 A;  2YX6 A;  1SKW A;  4O0J A;  3K5L A;  5BPM A;  4LSN A;  4CZH A;  4DU1 A;  2G8H A;  4HUE A;  1F21 A;  2D4W A;  3NDK A;  3PSF A;  3ZT4 A;  2HHH K;  3V9W A;  4DQP A;  4MLE A;  5B8H A;  3L4Q A;  1NJI O;  2WBN A;  4IOA L;  4I9Q A;  3VA0 A;  5EXW A;  4GKJ K;  3P83 D;  4GV3 A;  2HB5 A;  4DSI A;  4EP4 A;  4C1N I;  5F1X A;  3ENB A;  3IAY A;  4JK9 A;  1YVN A;  3U9Z A;  3MCA B;  4KO0 A;  3N4Q A;  4DR5 K;  1RT5 A;  4LF5 K;  1HRH A;  1VQM N;  3CC7 N;  1U04 A;  3VQA A;  3LL3 A;  3HJF A;  2IVO A;  1NU0 A;  3TAN A;  3J81 O;  4K0K K;  2O8D A;  3U9D A;  3H08 A;  2ZJR L;  3V9X A;  3V9S A;  2W41 A;  4CJT A;  1HQE A;  4DV4 K;  1RT6 A;  3KLG A;  1HKC A;  4KB1 A;  4DR6 K;  4IFY A;  3L2W A;  4DTX A;  4A59 A;  4MQ3 A;  1W0H A;  4PWD A;  3F2K A;  3DOL A;  2FXU A;  1CZ9 A;  4NLC A;  3FLC O;  2JLE A;  2YV0 X;  4CJR A;  3KD5 E;  3AVB A;  4KHY A;  4KHW A;  2E8A A;  1FK9 A;  5KGX A;  2QKB A;  4EZ9 A;  4DUY K;  2KZM A;  1S1V A;  2JWL A;  1VQN N;  4JI1 K;  1Z25 A;  4H03 B;  4BG8 A;  1B9F A;  4YHH K;  3EEQ A;  1NKB A;  1QTM A;  2P9L B;  5J2N A;  3V9U A;  1HR0 K;  4YOY A;  4DSE A;  2YJF A;  3TAF A;  4DV1 K;  5F0X A;  3K5M A;  4CF2 A;  1XMO K;  3NBP A;  3CQY A;  4IFV A;  2YNG A;  4CGG A;  3FZL A;  3GBT A;  3LP0 A;  3CJA A;  3DLH A;  5CHI A;  3VTH A;  4OPK A;  1YT3 A;  1RDB A;  1DKG D;  3MK6 A;  4DWI A;  4Q0B A;  1HQU A;  2CH6 A;  3CCE N;  2OZS A;  3HYF A;  1VQ7 N;  2ITM A;  5FLX O;  3L4I A;  4IO8 A;  1ZC6 A;  3THX A;  4H5W A;  1NKC A;  4DTS A;  3NHG A;  5BRH A;  4A5B A;  2RPI A;  4HCB A;  1HYS A;  4ISE A;  3L2Q A;  4CJL A;  3R9P A;  1ATS A;  4N41 A;  3KJV A;  2WUS A;  3VEO A;  3ZET A;  2QEX N;  4K41 A;  2FLO A;  3SNN A;  5FRN A;  1B92 A;  4QS8 A;  2YHW A;  4FVM A;  4FJL A;  4C8N A;  1L5U A;  4FLW A;  4JV5 K;  2ZE2 A;  3LM2 A;  4CJP A;  4JLH A;  1BOT O;  2OCE A;  1SL2 A;  4E1N A;  3WNG A;  2RKI A;  1U2V B;  2Z1H A;  1S22 A;  3VPZ A;  2UUB K;  3C6T A;  2HHU A;  3SUP A;  4RCH A;  4BRP A;  4IOX A;  4Y0W A;  3T3F A;  2OA8 A;  5EU7 A;  4A57 A;  5DK5 A;  3KKS A;  3AO2 A;  3VF2 A;  3CJ1 A;  1RT3 A;  5C24 A;  1RBS A;  4LD0 A;  1N36 K;  1C0T A;  1XNQ K;  2OPQ A;  3L3U A;  3VER A;  2A42 A;  3VN5 A;  5KRS A;  3EE9 A;  4FL9 A;  4BRO A;  3CCS N;  3AA5 X;  1KFD A;  2G8V A;  1K8A O;  4W5Q A;  4M3U A;  4FJM A;  2DY4 A;  3D2E A;  1JXB A;  4OO1 J;  4KHU A;  1BO5 O;  3AVH A;  1NKE A;  4OLB A;  2F8T A;  1S1U A;  1QZ6 A;  3SJJ A;  3SMS A;  3PX4 A;  4EHU A;  1HLU A;  4PY5 A;  3LWL A;  3THW B;  1TKT A;  1SS6 A;  4BGB A;  1O13 A;  1LV5 A;  1QVG M;  1YJN N;  1WOQ A;  3H6E A;  2BUP A;  3J7Y P;  5FPD A;  1JKH A;  1TVR A;  4XEI A;  4GVE A;  4YY3 K;  4OPA A;  3LZI A;  5ELZ A;  1FKP A;  1RDA A;  2NNW A;  3GOI A;  4M3W A;  3O9U A;  3CD6 N;  1QQC A;  3DLG A;  4JKE A;  2GTD A;  3H1Q A;  1IBL K;  1N33 K;  4QS9 A;  3QER A;  4CK2 A;  4CED A;  4AHT A;  4QAG A;  1WBB A;  3K5O A;  3FZH A;  3IFR A;  5BPL A;  4FJH A;  4GKK K;  1Q18 A;  1KXP A;  4M3R A;  3D6R A;  3OYK A;  3WXJ A;  4KFB A;  1S6P A;  1S9E A;  4CK3 A;  3VQE A;  4AHS A;  3QIN A;  1X3M A;  2R7Y A;  3P4I A;  4LF8 K;  4M41 A;  3CF5 L;  4JI2 K;  4J2A A;  4IO9 L;  3C95 A;  1BIU A;  3CIP A;  3QFU A;  2KZZ A;  4C8K A;  1ASW A;  4FJN A;  5SWM A;  4JKG B;  4IG0 A;  1T6C A;  3LDP A;  4CJ4 A;  1RT7 A;  4CZF A;  2HNY A;  4DG1 A;  3OYF A;  4I2Q A;  3ZSR A;  1BWF O;  5CR4 A;  2PZS A;  2F9W A;  3DM2 A;  2HHX A;  2H3G X;  3UKR B;  1FW6 A;  5M1K A;  1NGJ A;  3K5N A;  3VQ6 A;  2HBJ A;  1SKR A;  1SUQ A;  3UKU B;  2P9K B;  4DQQ A;  3WXI A;  3TAR A;  1NMN A;  4CHY A;  3EO3 A;  1NJZ A;  1YVU A;  2WON A;  5C2D A;  1VSM A;  1Z05 A;  4BR5 A;  4BR7 A;  1QHA A;  4CBU A;  4FJ9 A;  1S3X A;  3T69 A;  3VA3 A;  1L3T A;  1NWK A;  3PO5 A;  3I0S A;  5M1F A;  4CJF A;  5AQX A;  3H46 O;  2NRX A;  1NNE A;  3LDN A;  4DTJ A;  4KI6 A;  1QHT A;  4CF9 A;  5C2F A;  3IMX A;  4MO5 A;  1BHL A;  1VQP N;  3OYB A;  2OTL N;  2O8B A;  1T8E A;  3MN9 A;  3HPO A;  2WC9 A;  2YI1 A;  4WCE L;  4FLT A;  4KH6 A;  4NCB A;  1VQK N;  1TYQ B;  3KLH A;  3CPE A;  1Q81 O;  5AQU A;  5C12 A;  3S3O A;  1BA0 A;  3OS0 A;  4FJ7 A;  4W5O A;  3QO9 A;  3W3D A;  4DFK A;  1NG9 A;  4BRH A;  3MN7 A;  4W5N A;  3SQ2 A;  3DLK A;  1NGI A;  5T7B A;  2VG5 A;  1BG3 A;  5F2R A;  2P9S A;  4E7I A;  4YDU C;  1NGC A;  4JI6 K;  4B3S K;  1MA9 B;  1NLV A;  2NRR A;  4CBW A;  3HXM A;  2CGK A;  2YNI A;  4JS4 A;  3J7Z O;  2D0P A;  5AQI A;  2QW9 A;  2BGG A;  4DF8 A;  5DM6 L;  2HOE A;  2VWJ A;  3ENH A;  4FJX A;  2ASO A;  2FF6 A;  2IDO A;  4O55 A;  2F9T A;  3DXM A;  1EQY A;  3OYL A;  4HCC A;  4WQ4 C;  2ITG A;  5FPN A;  2NRV A;  4H5N A;  5GAD P;  2OPP A;  2O8E B;  3BEX A;  2IVP A;  4NYF A;  1LOT B;  4NO7 A;  4RW8 A;  1SL0 A;  5JVG L;  2YHA A;  5LJV A;  4DV0 K;  1TAU A;  4CVN E;  3W0L A;  1RDW X;  4H0Y B;  3SK3 A;  1SKS A;  1VSJ A;  2EHG A;  3VEZ A;  3K2P A;  3FGU A;  2E2O A;  2I7N A;  4L3Q A;  1RBV A;  4DFM A;  3BZC A;  3SQ1 A;  1C1B A;  2RF2 A;  1K8K A;  4IXC A;  4BR2 A;  1TUU A;  3E9P A;  1BQM A;  4YOT A;  5SZT A;  3O80 A;  2I5J A;  2BE2 A;  1REV A;  4KTZ A;  3J80 O;  1QZ5 A;  3R8E A;  4CEE A;  3TI0 A;  3RR7 A;  3KKR A;  2QXF A;  4U67 L;  3PX6 A;  1TK5 A;  3BGR A;  4OPJ A;  4O5B A;  1M1K O;  3S9H A;  4BC4 A;  4DCH A;  3M5R A;  2V7Z A;  4L8R B;  3G6E N;  4JNE A;  2LSN A;  3J7A P;  1EP4 A;  4DLG A;  2P51 A;  4JD2 A;  1S1T A;  3KK3 A;  3AAP A;  3TU5 A;  2FBV A;  3OA9 A;  3ULE A;  4UQG A;  2VWB A;  2E1Z A;  4I2P A;  4MFB A;  4PQU A;  4A5A A;  1J6Z A;  3LZJ A;  2X78 A;  4JKD A;  3IDH A;  2QWR A;  4FLY A;  3VQ7 A;  2CGJ A;  4CJU A;  4Z4C A;  5CY4 A;  5JS1 A;  2YHX A;  5I9E B;  4DS4 A;  4JEP A;  3CPW M;  1ZYQ A;  2W40 A;  2Q31 A;  1LCU A;  2ZJQ L;  3ISN C;  5AJ3 K;  1IG9 A;  4DTU A;  4NYN A;  3WEE B;  3L6Q A;  4FM1 A;  3WXL A;  1HKB A;  4RW4 A;  3FZF A;  2RN2 A;  3O4N A;  4FW2 A;  4BRE A;  4CD1 A;  3I56 N;  2UXC K;  4CK1 A;  1LW0 A;  3VGL A;  4TSX A;  5AZJ A;  4HTU A;  4CHN A;  2P9P B;  4B1V A;  1BI4 B;  4EFH A;  1S1X A;  4OKE A;  3C7N B;  4KHQ A;  1SV5 A;  4RG8 A;  4W5R A;  4CZJ A;  4J2D A;  1K6Y A;  1RGI A;  1E3M A;  4IDH A;  4FJ8 A;  2EX3 A;  1T44 A;  2P5G A;  2O8F A;  2BDP A;  2HHT A;  3H45 C;  4OJR A;  1IG8 A;  3V1O A;  3PV8 A;  3FE1 A;  4A61 A;  4CW7 B;  4F3O A;  3HVR A;  3VTI A;  3CJC A;  4BDZ A;  3CCU N;  5AQJ A;  4LH5 A;  2DFE A;  5KPR A;  1L3S A;  3TAB A;  5TKW A;  5E84 A;  5FPM A;  1YIJ N;  4B1U B;  4M3Z A;  1NGB A;  5CE3 A;  4I9L A;  1L3V A;  3M8S A;  2D0A A;  4BE1 A;  4LFB K;  3M8R A;  4B3T K;  5M1P A;  4B8C A;  3SAF A;  1N8R O;  3WUH A;  1VHX A;  2HST A;  5JLH A;  2HW3 A;  1KVC A;  1NM1 A;  2A6A A;  3PLA A;  3WNE A;  1TL3 A;  4BC2 A;  3CM5 A;  5MLC Q;  1L3U A;  1JLC A;  3NVK A;  2PYL A;  1JLG A;  3VF6 A;  1WN7 A;  2IS3 A;  3ZT2 A;  1VQ6 N;  4FJK A;  5AQG A;  3SZ2 A;  3TAP A;  3WT0 A;  4JKF A;  3TAE A;  4V19 S;  2O8C A;  1YTA A;  4FYD A;  2QWL A;  3T1A A;  2F4V K;  3M3Z A;  3OYN A;  1ZXO A;  2GWK A;  3C94 A;  4BRF A;  4LH4 A;  4BY9 C;  3KK2 A;  3AVA A;  3CFO A;  3HZ6 A;  2X6N A;  4NLB A;  1JL2 A;  1O1W A;  1HKG A;  4CEQ A;  1OVQ A;  3HL8 A;  1J54 A;  2KLA A;  2OPR A;  4DSF A;  3LP1 A;  4YOR A;  4DB3 A;  3S3M A;  4FCY A;  4X62 K;  3U3Y A;  1JLQ A;  3O3F A;  5FPE A;  4FLU A;  1P90 A;  2ZF5 O;  3EY1 A;  5EX5 A;  5AR0 A;  2W6L A;  1JXE A;  4H0X B;  4HHT A;  4WYB A;  4H5T A;  5AQZ A;  3O8M A;  4FLV A;  4DV5 K;  3SV3 A;  3ZCM A;  4AHV A;  5DM7 L;  4K8X A;  4BQL A;  1NJY A;  4K43 A;  4CHO A;  3RMB A;  4AIL C;  1I94 K;  3CCJ N;  1TGO A;  3KZB A;  3JAM O;  4CGD A;  4Z94 A;  4WF9 L;  4CEA A;  1TK8 A;  5J2P A;  4DQ8 A;  3OYH A;  3TTD A;  4R5P A;  5M1O A;  3VOV A;  1KRP A;  4NXM K;  4PUO A;  4JKC A;  3AVI A;  4CJW A;  4Z0U A;  3F73 A;  3ATV A;  5FDL A;  1R0A A;  2X6S A;  1EWQ A;  2B6A A;  4CI6 A;  1KAZ A;  4CEO A;  1X9J A;  2P9N B;  2PBD A;  3HPG A;  3A5L C;  4FLX A;  3R1X A;  4CFB A;  1VQL N;  1E4F T;  3DXK B;  2DPN A;  1HUX A;  4K42 A;  5AQQ A;  1RTJ A;  1VQ4 N;  4F4K A;  4JI5 K;  3VEX A;  3HRG A;  3NCI A;  3BZK A;  3LDO A;  5CZ1 A;  2XRI A;  1LWE A;  4H0P A;  5AQK A;  3EZW A;  3FFI A;  2ZJP L;  4IKF A;  4GMJ B;  3E1Y A;  3O5B A;  3P5J A;  3QET A;  1RFQ A;  3VGK A;  3O9T A;  3CQ8 A;  4DUZ K;  2ETJ A;  3DYA A;  4B1X B;  4JN4 A;  3PSI A;  2HHS A;  1ZBH A;  1TAQ A;  1JLB A;  1A5X A;  1J9A A;  3UB5 A;  4H8K A;  3FZK A;  4DV7 K;  4HUG A;  3L0Q A;  5KQD A;  1OH7 A;  5D3G A;  4JKB A;  4BC3 A;  5LMN K;  3PO4 A;  3WNH A;  4Z4G A;  3THY B;  5LMU K;  1NK5 A;  2A40 A;  2P9I B;  1JJ2 M;  3BDP A;  4JKH A;  3OTO K;  2HVH A;  1WSH A;  3MXM A;  3SPY A;  3VF4 A;  1EET A;  3TSU A;  5KRT A;  3MED A;  1RNH A;  1WBD A;  3OY9 A;  2V7Y A;  5HLF A;  4FJI A;  4X66 K;  4M7Y A;  1JCG A;  1Q7Y O;  1QSL A;  3CJ9 A;  3MMV A;  4EZ6 A;  4AM6 A;  2E6M A;  3VEV A;  3GG4 A;  3D2F B;  3WXM B;  4X64 K;  4JHD B;  4BR9 A;  1D4X A;  2P9U A;  4BG9 A;  4WFN L;  1XI1 A;  5EOY A;  2A3Z A;  2A5X A;  5AFU A;  4JI3 K;  3LDS A;  4CES A;  3ZT1 A;  4LF6 K;  2GUP A;  4J2E A;  4OVL A;  5J2M A;  3V6D A;  2HBM A;  4CFD A;  3OYJ A;  3AV9 A;  4CEF A;  3VQ5 A;  1TKD A;  3M8P A;  3CME N;  4HVJ A;  1U45 A;  3AVM A;  4FWO A;  3DRP A;  3I8D A;  1HNI A;  4DS5 A;  4FWM A;  4BRA A;  2NRW A;  4BDY A;  2ASM A;  2G8U A;  5BRF A;  4PKI A;  1UWB A;  1ZBI A;  4CGF A;  1VRU A;  4IZ9 A;  1YIT N;  1IJJ A;  3RRG A;  2F8S A;  2ZWH A;  1C0U A;  3NGZ A;  3GE1 A;  1NBW A;  2HNZ A;  1JCF A;  4BE2 A;  2Z1G A;  3RMD A;  4CZL A;  5C10 A;  2HND A;  3O4Q A;  4WFB L;  3NF8 A;  1FKO A;  2FC0 A;  5AQN A;  2A41 A;  3ZEU A;  4CHP A;  4U7B A;  3MEE A;  1VSL A;  2QKK A;  3D7E O;  1HMV A;  1HNZ K;  4FZX C;  4CBX A;  4K25 A;  1UAX A;  3F9M A;  3MX2 A;  5BPN A;  4Z4F A;  4ELU A;  1ZBL A;  2D0O A;  1ZBS A;  2QK9 A;  5GIO A;  4UY8 O;  1GOB A;  3L2U A;  1BCM A;  2VYP A;  2QTD A;  3U3G A;  2FSJ A;  4DQS A;  4AHU A;  3OYI A;  3Q7B A;  4F8R A;  3LDL A;  3IRX A;  3HTV A;  1U47 A;  4F3T A;  1RCH A;  3IKM A;  2X74 A;  1Y97 A;  5BN9 A;  4A2A A;  4Y1C A;  3JXU A;  1HJR A;  3AVJ A;  3I33 A;  2HMI A;  1W7A A;  2YNH A;  3LAN A;  3HM9 A;  3DLR A;  1D9F A;  4CZM A;  2ZD1 A;  1K73 O;  3THV A;  4YNQ A;  3RSE A;  3HI0 A;  4X65 K;  2QWP A;  4XH5 A;  4EAH D;  4BAC A;  5LJW A;  1T03 A;  4B3M K;  2QM1 A;  1HYZ A;  1VQ8 N;  4KAZ A;  2E88 A;  3AGK A;  4NCA A;  1RDC A;  2E2N A;  3LAM A;  1RBR A;  1U49 A;  3DLE A;  4RWT A;  2O8D B;  1VQ9 N;  3CI5 A;  2G8K A;  1WAJ A;  3I0R A;  5I3U A;  1NMD A;  2GUI A;  4FLZ A;  2ASP A;  3QIC A;  4ISF A;  4B8A B;  3O3G A;  4CJ3 A;  4BRN A;  4BRI A;  3SLC A;  4OX9 K;  1NGH A;  4B9T A;  3KLI A;  3ZSW A;  5EVZ A;  1YTU A;  2OPS A;  2GX9 A;  2ZGZ A;  1KVA A;  4CGI A;  3VET A;  4CFA A;  1SL1 A;  1Q82 O;  3Q7C A;  4AH9 A;  4DU3 A;  3A5O C;  1GLL O;  4ILJ A;  2E20 A;  5CYM A;  2RE2 A;  1D8Y A;  2QWM A;  3K9K A;  4NB4 A;  2XY6 A;  4B08 A;  3KIO A;  4DSJ A;  2UXB K;  4WQ5 A;  4FJG A;  2PAV A;  1JL1 A;  5AQP A;  4IWV A;  3NAE A;  3P38 A;  1HYV A;  3SCX A;  4LC9 B;  4JI7 K;  4BRD A;  4OGE A;  1JLA A;  1DEJ A;  5GIP A;  4E0D A;  1SZ2 A;  1N34 K;  2JGU A;  3C6A A;  3P39 A;  2J4R A;  4O8U A;  1NJX A;  3ZSX A;  2DFH A;  2HBK A;  2O4G A;  1T05 A;  4ELT A;  4ZHR A;  5BN8 A;  1X9S A;  1JCE A;  1NK4 A;  5AQO A;  2JWK A;  4DFJ A;  3H3O B;  3LAL A;  1XHZ A;  5AFU H;  4H0V B;  4FSV A;  4N5S A;  3THX B;  5KPT A;  1S72 N;  4K8Z A;  2NLX A;  4KH5 A;  1T7P A;  3RRH A;  3K59 A;  3G71 N;  2UUA K;  4JI8 K;  3MXI A;  2BH1 A;  4I6M A;  3ZET B;  4QS7 A;  5E26 A;  1RT2 A;  4BRK A;  1H1V A;  4H4O A;  4WFA L;  3DMJ A;  3O9R A;  1YUW A;  1SQK A;  4IEI A;  4CZE A;  5A2Q O;  3QIP A;  2G8F A;  4IJN A;  1ASU A;  1HX1 A;  2Q2R A;  1CXQ A;  2XY5 A;  3ZSO A;  5M1Q A;  4BQZ A;  1RIL A;  3KWG A;  5HP1 A;  2AA4 A;  1RT4 A;  3V1R A;  4IJA A;  4KHN A;  2HHQ A;  1W9H A;  3OYC A;  1B9D A;  1XC3 A;  4B1W B;  1WSJ A;  3U4L A;  3NMU A;  1HNV A;  4C8O A;  4FJJ A;  3WQU A;  4KRE A;  4DHY A;  2OYQ A;  3T1Y K;  4NCG A;  3JSM A;  2VGM A;  3D2E B;  3VQ9 A;  3DI6 A;  4FK2 A;  4B9S A;  3V4I A;  2PYJ A;  1BUP A;  3KHY A;  4KTW A;  4OGC A;  2CH5 A;  4IFE A;  1ILY A;  1HPM A;  3SQ4 A;  1YJ9 N;  3QFP A;  2F96 A;  3TAQ A;  4FK4 A;  3B8A X;  4C8L A;  2P9L A;  4NXN K;  2AP1 A;  3PIP L;  5FRO A;  3K0S A;  1UOC A;  1VSD A;  3MAQ A;  1XWL A;  5AQL A;  4PL7 A; 
#chains in the Genus database with same CATH homology
 3AVC A;  5EU7 A;  1NK8 A;  2X6N A;  4CEB A;  1JL2 A;  1O1W A;  5DK5 A;  3KKS A;  1A5W A;  4CEQ A;  3AO2 A;  5HRN A;  4BWM A;  3OYG A;  1RT3 A;  3HL8 A;  1RBS A;  2ZQB A;  5C24 A;  4KV8 A;  1J54 A;  4LD0 A;  3VQ8 A;  1C0T A;  2OPR A;  3OS2 A;  4DSF A;  4CJS A;  2OPQ A;  3L3U A;  2P5O A;  2D0C A;  1EXQ A;  3PUF A;  3VN5 A;  3O3H A;  3LP1 A;  5KRS A;  4OKJ A;  3S3M A;  4FCY A;  3AA5 X;  1KFD A;  1TV6 A;  2G8V A;  3U3Y A;  1JLQ A;  3L2R A;  3O3F A;  2IAJ A;  3SUQ A;  2YHB A;  4FLU A;  4W5Q A;  2KFN A;  4M3U A;  4FJM A;  2DY4 A;  3EY1 A;  4CIF A;  3HT3 A;  1JXE A;  1BCO A;  3C6U A;  4HHT A;  2NUB A;  1JXB A;  4BDP A;  4KB0 A;  4KHU A;  1NKE A;  3AVH A;  4ICL A;  2OZM A;  4OLB A;  2F8T A;  2AJQ A;  1BL3 A;  4CCH A;  3RTV A;  3EZ5 A;  4FLV A;  1S1U A;  3SV3 A;  1WSG A;  3ZCM A;  4AHV A;  3NH2 A;  5FRM A;  4FXD A;  3AVF A;  4K8X A;  3SJJ A;  3PX4 A;  2G8I A;  4M45 A;  4BWJ A;  1NJY A;  4CHO A;  3RMB A;  4RW6 A;  4AIL C;  5HRP A;  1QSY A;  4PY5 A;  3ZSQ A;  3LWL A;  1TGO A;  4CGD A;  1TKT A;  4CEA A;  5KGW A;  1TK8 A;  5J2P A;  2KQ2 A;  4CHZ A;  3OYH A;  1NK7 A;  1D9D A;  4R5P A;  3NE6 A;  1KRP A;  1LV5 A;  4PUO A;  3AVI A;  4CJW A;  4Z0U A;  5HRR A;  4Z4H A;  3F73 A;  2FBY A;  5FDL A;  1R0A A;  2X6S A;  5C25 A;  1KTQ A;  1VRT A;  2B6A A;  2GV9 A;  4CEO A;  3ZSZ A;  3HPG A;  4FLX A;  4CFB A;  1JKH A;  1TVR A;  3ZT0 A;  2XY8 A;  3LPT A;  3LZI A;  1HPZ A;  3AO4 A;  1FKP A;  1VSE A;  1C1A A;  1WAF A;  2YKN A;  1RTJ A;  1RDA A;  4F4K A;  4FZY A;  4KTQ A;  4M3W A;  3QLH A;  1C0M A;  1UA1 A;  1QQC A;  3DLG A;  3NCI A;  4O4G A;  5C42 A;  5CZ1 A;  3AVG A;  2XRI A;  1IO2 A;  1LWE A;  3QER A;  4CK2 A;  4E19 A;  4KHS A;  4FZZ A;  3ZT3 A;  5JS2 A;  4CED A;  4AHT A;  1IKV A;  4QAG A;  1JLE A;  3K5O A;  5KTQ A;  4ELV A;  3NF7 A;  3TWH A;  4LY7 A;  2E6L A;  4CHQ A;  5E41 A;  5I42 A;  4FJH A;  3FFI A;  4IKF A;  1RTD A;  4GMJ B;  1VSI A;  3AO3 A;  3P5J A;  1RBU A;  1CZB A;  3QET A;  5HRS A;  4M3R A;  3B6P A;  3OYK A;  4RW9 A;  3CQ8 A;  4KFB A;  2ETJ A;  3DYA A;  3K57 A;  1S6P A;  1Z26 A;  1BQN A;  1S9E A;  4O44 A;  3VQE A;  4CK3 A;  1CXU A;  4AHS A;  3CM6 A;  3QIN A;  4B9U A;  2HHS A;  3NGI A;  2KFZ A;  3V81 A;  2R7Y A;  4ZTJ A;  1ZBH A;  4FM0 A;  1TAQ A;  4M41 A;  1JLB A;  1A5X A;  1LAV A;  4DMN A;  5CZ2 A;  1J9A A;  4DU4 A;  2A1R A;  2HHW A;  2Z1J A;  2ATQ A;  1I3A A;  4H8K A;  1TK0 A;  4J2A A;  3C95 A;  4HUG A;  1BIU A;  2D0B A;  3AVK A;  3CFR A;  4DLE A;  2KZZ A;  4C8K A;  1ASW A;  3JYT A;  1ITG A;  1CLQ A;  3KLE A;  4FJN A;  1ASV A;  3AA4 A;  3VQB A;  5SWM A;  4DTR A;  2VG7 A;  1IKX A;  3HP9 A;  5DMR A;  5D3G A;  4IG0 A;  4CFC A;  3HO1 A;  4E7L A;  3PO4 A;  4CJ4 A;  1RT7 A;  3WNH A;  4Z4G A;  1QE1 A;  2HNY A;  4DG1 A;  3ULD A;  3OYF A;  1NK5 A;  4I2Q A;  4B9M A;  1GOC A;  3ZSR A;  4B9L A;  2PZS A;  3BDP A;  1DTT A;  3AO5 A;  3CYM A;  2XY7 A;  1U48 A;  2HVH A;  2FBT A;  3DM2 A;  1WSH A;  3MXM A;  3L2V A;  2HHX A;  1Q8I A;  4IG3 A;  4CJQ A;  3SPY A;  1DTQ A;  1EET A;  3IG1 A;  3VQQ A;  5KRT A;  3MED A;  1RNH A;  1XC9 A;  3PY8 A;  3A2F A;  3K5N A;  3VQ6 A;  1SKR A;  1SUQ A;  4XIU A;  4DQQ A;  4CJK A;  3OY9 A;  3QIO A;  3TAR A;  4CHY A;  3T19 A;  1NJZ A;  2KW4 A;  2WON A;  1YVU A;  2VG6 A;  3LP3 A;  1VSM A;  5HLF A;  1NOY A;  3KTQ A;  4FJI A;  1RTI A;  1C6V A;  4DSL A;  1QSL A;  3KLF A;  4Z4E A;  4EZ6 A;  4FJ9 A;  2E6M A;  2HVI A;  4LSL A;  3VA3 A;  1L3T A;  4CE9 A;  3PO5 A;  3SQ0 A;  4M42 A;  3F9K A;  4B3O A;  2Q3S A;  3I0S A;  4CJF A;  4FM2 A;  3SV4 A;  3RMC A;  4RW7 A;  1KCF A;  1J5O A;  1XI1 A;  4PA1 A;  3LDS A;  1BGX T;  4GVM A;  4CES A;  3ZT1 A;  4DTJ A;  4KI6 A;  1FXX A;  1QHT A;  3ITH A;  4CF9 A;  4J2E A;  4OVL A;  4GW6 A;  2HHV A;  4E7H A;  2E4L A;  4CF0 A;  5J2M A;  3V6D A;  4M3T A;  1BHL A;  4OLA A;  4CFD A;  3OYB A;  3VQC A;  3OYJ A;  1WNS A;  3AV9 A;  4CEF A;  3VQ5 A;  2YNF A;  3HPO A;  4CJ5 A;  1NOZ A;  3SUO A;  1T8E A;  4FLT A;  1N6Q A;  1TKD A;  3M8P A;  2G8W A;  4KKO A;  2B5J A;  1NJW A;  4NCB A;  4DF4 A;  4HVJ A;  1U45 A;  2O4I A;  3AVM A;  3DRP A;  3NF9 A;  3KLH A;  3I8D A;  1HNI A;  4DS5 A;  4KRF A;  1D5A A;  4DTM A;  1WSF A;  3QNO A;  4WE1 A;  4FK0 A;  4BDY A;  2D5R A;  2G8U A;  3S3O A;  2GBZ A;  1TKX A;  3CG7 A;  3OS0 A;  1JLF A;  4E1M A;  1UWB A;  3KK1 A;  3PX0 A;  4FJ7 A;  1ZBI A;  4W5O A;  3QO9 A;  1VSK A;  3ZSY A;  4CGF A;  4IDK A;  1VRU A;  4DFK A;  3L8B A;  4M3X A;  4AHR A;  3QEP A;  3RRG A;  4CJE A;  2F8S A;  4W5N A;  3SQ2 A;  3DLK A;  1C0U A;  4ZTF A;  1ZBU A;  5T7B A;  3NGZ A;  4DQR A;  3L3V A;  2VG5 A;  3DOK A;  4ID5 A;  4AHC A;  1RT1 A;  2XO7 A;  3VQP A;  1WSE A;  2HNZ A;  2IOC A;  4E7I A;  4BE2 A;  2Z1G A;  3RMD A;  2XHB A;  3D45 A;  3AA2 A;  1QS4 A;  2HND A;  3O4Q A;  2P1J A;  4CF1 A;  5HRO A;  2BAN A;  2WOM A;  1FKO A;  1KLM A;  3NF8 A;  2FC0 A;  3HXM A;  1NK6 A;  2YNI A;  3HVT A;  1A5V A;  1S9G A;  4CHP A;  3MEE A;  1VSL A;  1Q9X A;  3AVL A;  3EYZ A;  2QKK A;  4CEZ A;  1HMV A;  4JS4 A;  4FZX C;  1IKW A;  4B9V A;  3DRS A;  4EP5 A;  1UAX A;  3LPU A;  2BGG A;  4Z4F A;  1S5J A;  4QOZ B;  4DF8 A;  4ELU A;  4E7J A;  1ZBL A;  1UA0 A;  2VWJ A;  4F2S A;  4FJX A;  4CGJ A;  2IDO A;  2B4J A;  1IH7 A;  3QNN A;  4O55 A;  5K14 A;  1VSF A;  4Z4I A;  4G1Q A;  2QK9 A;  3OYL A;  4F2R A;  1GOB A;  3L2U A;  1BCM A;  4HCC A;  2ITG A;  2Y1J A;  3OS1 A;  3SPZ A;  3LAK A;  3U3G A;  4DQS A;  3QEW A;  4AHU A;  2OPP A;  3OYI A;  4NYF A;  2W42 A;  4F8R A;  4RW8 A;  1C1C A;  1KVB A;  1NK0 A;  4O0I A;  3OYD A;  3D0P A;  3G10 A;  3IRX A;  3OJU A;  5KI6 A;  4E3S A;  1VK0 A;  3HPH A;  2YHA A;  1SL0 A;  4ID1 A;  3QEI A;  4QCL A;  4DTO A;  1TAU A;  1U47 A;  4F3T A;  1RCH A;  3G0Z A;  2X74 A;  1Y97 A;  4Y1C A;  4YFU A;  3NGY A;  3NFA A;  1SKS A;  3KD1 E;  1HJR A;  3AVJ A;  4C8M A;  1VSJ A;  2EHG A;  4DQI A;  3K2P A;  3OYA A;  2HMI A;  4KPY A;  2YNH A;  3LAN A;  3M8Q A;  4IBN A;  3HP6 A;  3HM9 A;  1RBV A;  3DLR A;  3V1Q A;  3OYM A;  4DFM A;  1D9F A;  4CF8 A;  1S6Q A;  1LWF A;  2ZD1 A;  3OVN A;  1C1B A;  3SQ1 A;  5J1E A;  2RF2 A;  4OKK A;  4YNQ A;  4BE0 A;  3THV A;  1KSP A;  4BAC A;  1BQM A;  5CYQ A;  1T03 A;  5SZT A;  3TAM A;  4I7F A;  1HYZ A;  4CER A;  2I5J A;  2DFF A;  2BE2 A;  4KAZ A;  1REV A;  4KTZ A;  4NCA A;  1RDC A;  4CEE A;  3QEV A;  4JRP A;  3TI0 A;  3KKR A;  3RR7 A;  3LAM A;  4JS5 A;  1RBR A;  1LAW A;  1U49 A;  2QXF A;  3DLE A;  3AVN A;  3E01 A;  4DSK A;  2G8K A;  3PX6 A;  1TK5 A;  1WLJ A;  1WAJ A;  2FBX A;  3I0R A;  5I3U A;  3BGR A;  3ASM A;  4OPJ A;  2GUI A;  4JRQ A;  4O5B A;  4FLZ A;  4M3Y A;  3S9H A;  3UIQ A;  4FW1 A;  4B8A B;  1KFS A;  3O3G A;  4CJ3 A;  4L8R B;  2Z1I A;  4DTP A;  4CEC A;  4B9T A;  3QES A;  1J53 A;  2LSN A;  1EP4 A;  3P1G A;  4DLG A;  3KLI A;  3ZSW A;  2Y1I A;  3RR8 A;  1SKW A;  2P51 A;  1YTU A;  2OPS A;  4O0J A;  1BIS A;  1S1T A;  1RTH A;  3K5L A;  4B9N A;  3KK3 A;  4LSN A;  2OA8 A;  2DTU A;  1KVA A;  4DU1 A;  4CGI A;  2FBV A;  2G8H A;  4CFA A;  4HUE A;  1F21 A;  3MEG A;  3SI6 A;  4UQG A;  3S3N A;  3NDK A;  3LP2 A;  3ZT4 A;  1SL1 A;  3V9W A;  4AH9 A;  4DQP A;  4I2P A;  4MFB A;  4DU3 A;  4PQU A;  4N47 A;  4I9Q A;  5CYM A;  3LZJ A;  3CFP A;  2X78 A;  3VA0 A;  1D8Y A;  2XY6 A;  3IS9 A;  3P83 D;  3KIO A;  1EKE A;  4B08 A;  4DSJ A;  2HB5 A;  4DSI A;  4N76 A;  4EP4 A;  4FLY A;  3VQ7 A;  1VSH A;  4CJU A;  4Z4C A;  5CY4 A;  4FJG A;  1JL1 A;  3DLB A;  5JS1 A;  3NAE A;  3IAY A;  1HYV A;  4DS4 A;  3SCX A;  1LWC A;  4KO0 A;  1ZYQ A;  4OGE A;  1JLA A;  1RT5 A;  1Q9Y A;  4E0D A;  1HRH A;  2KTQ A;  3LWM A;  5J2Q A;  2JGU A;  1U04 A;  3ISN C;  3VQA A;  1IG9 A;  4DTU A;  1NJX A;  1S1W A;  3ZSX A;  3HJF A;  2DFH A;  4NYN A;  2O4G A;  4W5T A;  1T05 A;  4FM1 A;  4ELT A;  3TAN A;  4ZHR A;  3H08 A;  4RW4 A;  3O4N A;  2RN2 A;  3V9X A;  4FW2 A;  1NK4 A;  1X9S A;  3V9S A;  3OJS A;  1G15 A;  4DFJ A;  3HK2 A;  3SYZ A;  4CJT A;  4CK1 A;  1LW0 A;  3LAL A;  4TSX A;  4HTU A;  1XHZ A;  1HQE A;  1I39 A;  1RT6 A;  3KLG A;  1IKY A;  4CHN A;  3OYE A;  4KB1 A;  3NF6 A;  4IFY A;  4N5S A;  3L2W A;  1BI4 B;  4DTX A;  1S1X A;  4OKE A;  4KHQ A;  4K8Z A;  1X9M A;  4MQ3 A;  1W0H A;  4PWD A;  1EX4 A;  1SV5 A;  4RG8 A;  1ZBF A;  3DOL A;  4W5R A;  3RRH A;  3K59 A;  1CZ9 A;  1T7P A;  4J2D A;  1K6Y A;  2JLE A;  2YV0 X;  4CJR A;  3MXI A;  3KD5 E;  3DRR A;  3ZSV A;  3AVB A;  1BIZ A;  4KHY A;  4KHW A;  3HST B;  2EX3 A;  4FJ8 A;  1FK9 A;  5KGX A;  1N5Y A;  2QKB A;  2A1S A;  1RT2 A;  4CJV A;  4DFP A;  3WNF A;  2P5G A;  3U6F A;  4H4O A;  2BDP A;  4EZ9 A;  4Q5V A;  2KZM A;  1S1V A;  2HHT A;  1GOA A;  4OJR A;  1Z25 A;  1B9F A;  1RBT A;  3DMJ A;  3V1O A;  3PV8 A;  1NKB A;  1QTM A;  5J2N A;  1TKZ A;  3AO1 A;  3V9U A;  4Y1D A;  3MEC A;  4F3O A;  3HVR A;  4N56 A;  4BDZ A;  4DSE A;  3QIP A;  4LH5 A;  3TAF A;  2G8F A;  2DFE A;  1L3S A;  3RWU A;  3K5M A;  3TAB A;  3ALY A;  2IGI A;  1ASU A;  4CF2 A;  4CIG A;  3NH1 A;  3NBP A;  4DTN A;  1CXQ A;  3MXJ A;  4IFV A;  2YNG A;  4M3Z A;  1KLN A;  2XY5 A;  3SUN A;  4CGG A;  1XHX A;  3LP0 A;  3ZSO A;  3DLH A;  4I9L A;  4E89 A;  1L3V A;  1QSS A;  3M8S A;  2D0A A;  3K58 A;  4BE1 A;  3V9Z A;  3M8R A;  1WSI A;  1RIL A;  4H4M A;  4OPK A;  1YT3 A;  1RDB A;  4B8C A;  4HUF A;  3RMA A;  1RT4 A;  5HP1 A;  4DWI A;  3V1R A;  4Q0B A;  2HW3 A;  1HQU A;  1KVC A;  4KHN A;  1MU2 A;  1X1P A;  2OZS A;  2HHQ A;  1W9H A;  3HYF A;  3OYC A;  1B9D A;  3WNE A;  1TL3 A;  1WSJ A;  3CM5 A;  1RDD A;  1BI4 A;  1JLC A;  1L3U A;  2PYL A;  1NKC A;  4DTS A;  1HNV A;  3NHG A;  4C8O A;  4FJJ A;  1JLG A;  3VQD A;  4KRE A;  4FJ5 A;  2RPI A;  2OYQ A;  4HCB A;  1WN7 A;  2IS3 A;  3L2Q A;  1HYS A;  3ZT2 A;  4NCG A;  3JSM A;  4CJL A;  3VQ9 A;  4FJK A;  1NK9 A;  3TR8 A;  4N41 A;  3SZ2 A;  3DI6 A;  3KJV A;  3TAP A;  3VQ4 A;  4E7K A;  4B9S A;  3V4I A;  3SNN A;  4FK2 A;  2PYJ A;  1B92 A;  3TAE A;  5FRN A;  4FVM A;  4KTW A;  1DLO A;  4OGC A;  4FJL A;  1YTA A;  4C8N A;  1L5U A;  1X9W A;  4J2B A;  4FLW A;  3SQ4 A;  2ZE2 A;  3QEX A;  4CJP A;  2F96 A;  3TAQ A;  4JLH A;  1SL2 A;  4KI4 A;  4CGH A;  4FYD A;  4E1N A;  3WNG A;  4FK4 A;  4C8L A;  3TAG A;  3B6O A;  2RKI A;  3T1A A;  1U4B A;  2Z1H A;  1LW2 A;  2IC3 A;  5HBM A;  2YKM A;  1TL1 A;  5FRO A;  4CIE A;  3OYN A;  3C6T A;  1UOC A;  2HHU A;  3SUP A;  3AA3 A;  3C94 A;  1VSD A;  4LH4 A;  3MAQ A;  2VWK A;  3NH0 A;  3KK2 A;  1XWL A;  2PY5 A;  3AVA A;  3T3F A;  3CFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...