3AVFA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avfA00
3LZIA 3SPZA 4Y1DA 4PQUA 4H4MA 4J2EA 3D45A 3SUNA 2IS3A 4MQ3A 1TKXA 1NJXA 3RMCA 1DTQA 3DLRA 3V81A 3NCIA 3NH1A 1HJRA 4O0IA 3K5NA 4ICLA 1VSLA 4M3RA 1Z26A 4CIFA 4HCBA 2D0AA 5KTQA 2P1JA 4KKOA 4CJTA 4W5OA 1RBRA 1TL3A 3K5MA 1Q9YA 1SUQA 1VRTA 5KGXA 1X9WA 3VQQA 3I0RA 2IDOA 1B92A 3AO5A 4KTWA 5C42A 1NK0A 2XY7A 2KTQA 1RNHA 1JLGA 4DFKA 2YNHA 3ITHA 4FZZA 1TVRA 3LP0A 1JLCA 4GW6A 3VQ7A 5FRNA 4CEFA 4DSIA 1IKYA 1TGOA 4CK2A 3OYMA 3HP6A 3L2UA 3SCXA 4AHCA 1U49A 2HNZA 1NK7A 3TWHA 3SUQA 4FCYA 4F2SA 3PX4A 1WSJA 2X74A 3SPYA 2RKIA 3SQ0A 3BGRA 1JXBA 3TI0A 4LY7A 1HNIA 3SQ2A 3KLEA 1CXQA 3TABA 3QEVA 3SUOA 1TK8A 5J2PA 3DI6A 1VSHA 4CGGA 4CIEA 1U45A 5KI6A 2A1RA 4FYDA 3ZSXA 3K2PA 3NGIA 4Z4GA 3I8DA 3K58A 3NAEA 3G10A 1L3TA 2GV9A 2FBTA 3L2QA 4I9LA 4EP4A 4DTJA 5J2MA 1LW0A 1WSEA 4B9LA 4KI4A 4DF8A 2R7YA 3QIOA 1RTIA 1I39A 3S3MA 2G8VA 3KLIA 3PX6A 3TAEA 4K8XA 4B9NA 4J2BA 4F8RA 3U3YA 3MEDA 3VQPA 1NK5A 1D9DA 2HMIA 3NFAA 4EZ6A 3NHGA 4DU4A 4CFBA 4O0JA 3AO4A 1WLJA 3U6FA 4CE9A 1VSMA 3EY1A 4M3ZA 2XO7A 3DLEA 2VG5A 4F4KA 3VQDA 1KVCA 1RBTA 2P51A 4DLGA 5D3GA 1BIUA 3MXIA 1KTQA 4OKKA 3CFPA 4Q0BA 3ISNC 1LWCA 4B8CA 3PO4A 4DTRA 1JLAA 5KGWA 1QE1A 1JKHA 4DTPA 3AA4A 4R5PA 4CGHA 2XY6A 2Y1IA 3RMAA 4IFYA 4M3TA 1C0MA 1W0HA 4LD0A 4LSLA 3MEEA 3DRPA 2D0CA 1MU2A 2X6SA 4E7JA 4DTUA 3VQ6A 2QKBA 3AVGA 3CFOA 1FKOA 4FJXA 1TK0A 2DY4A 4OPJA 4OGCA 2E6MA 1RTDA 4ELVA 2HVIA 1RTJA 4C8NA 3QETA 3ZT1A 1S1XA 3V6DA 5CY4A 3K59A 3AVMA 4CHPA 1BL3A 1GOAA 4CJRA 3OYLA 1BCMA 3AA3A 3F73A 4CJKA 4CFCA 1QSYA 1D5AA 1HNVA 4DTOA 3OYGA 3ZSZA 4DMNA 3O3GA 3JSMA 3RR7A 1XHZA 4DS5A 1BI4B 3KKSA 4FLXA 3QO9A 2YHAA 4F3OA 1RDCA 1L3UA 4DSKA 1JL2A 4PA1A 1RT2A 4RW9A 4O44A 1HYVA 3ZSRA 3O3FA 4FLUA 4DWIA 1ITGA 1NJZA 4M45A 3IAYA 3VQBA 1KSPA 3RTVA 4KTQA 3L2VA 4CK3A 3AVAA 3P1GA 5DK5A 4DSEA 2DTUA 1C1BA 4KHUA 5HRPA 4KHSA 5J2NA 2FC0A 4O4GA 1TK5A 2XRIA 3MEGA 3CFRA 1Z25A 4RW8A 1TAQA 3S9HA 1HYZA 2FBYA 3PV8A 3OYBA 2OPRA 1HPZA 4DLEA 4DU3A 3WNHA 1SKSA 4ELTA 4PUOA 4FK4A 3OJSA 1XHXA 3AVBA 4FJHA 3HT3A 3RR8A 4HUEA 4GMJB 2HHUA 4W5NA 1WAFA 3NH2A 1RDBA 2WONA 2KZMA 5C24A 2QKKA 3AO3A 3ZT3A 1X1PA 4CJ4A 3LP2A 4Y1CA 4E89A 3MXJA 1IH7A 4JS5A 3I0SA 2BANA 2FBXA 4E7LA 4YNQA 4FLVA 3CM5A 4FJLA 5SZTA 3RWUA 3G0ZA 3O4NA 5JS2A 3EYZA 4C8OA 1XC9A 3QIPA 1T7PA 4FZYA 5CYMA 4K8ZA 4FW1A 4BDYA 1WSFA 1EX4A 3QLHA 2G8UA 2PYJA 4F2RA 3QINA 3OYFA 2IOCA 2OPPA 2O4GA 1KLMA 4HVJA 4N56A 1CZBA 2GBZA 4ZTFA 1SL0A 3WNEA 1KVBA 1UAXA 3RRHA 3LWMA 4WE1A 1NKBA 3M8RA 2F8SA 4DTSA 3LAKA 3KJVA 3LP1A 1BHLA 3P83D 2OPSA 4CGDA 5KRTA 1L5UA 4B9TA 3ZSQA 1ZBFA 2G8IA 4M3WA 3L3VA 4DQRA 4CGFA 1N6QA 2EHGA 4AHUA 4I2QA 3SV4A 3VA3A 3SJJA 4CHNA 4M3YA 1NOZA 1O1WA 2XY8A 1G15A 4FK0A 1NK4A 2RN2A 5EU7A 3WNGA 3E01A 4CF8A 4CECA 3ZT2A 3OYKA 1WN7A 1R0AA 4C8LA 1FXXA 3DM2A 4J2AA 2G8FA 1C0TA 3SQ4A 4AHRA 2IGIA 3HSTB 4NCBA 4Q5VA 3DRSA 4FM1A 1A5WA 3WNFA 1NK8A 4FJMA 1TV6A 3TAMA 1WSGA 2OA8A 3HK2A 1ASWA 4CJFA 3HVRA 3L3UA 5CZ1A 3V9SA 1VSDA 1U47A 2HHWA 1KRPA 4DG1A 5I3UA 4CJVA 1RT4A 1GOCA 4W5RA 3ALYA 1N5YA 3OY9A 3ZCMA 3V9UA 2A1SA 4CK1A 3MAQA 4LH4A 4CEQA 1SL1A 2W42A 1U04A 2DFHA 2LSNA 2VG7A 2FBVA 5T7BA 4FJ5A 1YTUA 1KFSA 1W9HA 1YT3A 3VQCA 2HHTA 2HHXA 1TAUA 3OVNA 3VQ5A 4N5SA 2PYLA 1CZ9A 1J9AA 4ELUA 3NBPA 4NYFA 3QEPA 1KLNA 3AVCA 1Q9XA 2P5GA 4CJLA 1C1CA 1RILA 3IRXA 3PX0A 3ZSVA 3KLHA 2QK9A 4JRPA 4OLAA 1QHTA 4KHYA 3LALA 4NYNA 4CHZA 4XIUA 1HQUA 3AVJA 4CFDA 5FROA 3TAGA 4QOZB 4KB1A 4PY5A 3DLGA 4ZTJA 4PWDA 4JS4A 3KIOA 3QESA 4DSLA 3LANA 4OGEA 4BWJA 3KK2A 3SZ2A 2G8WA 4FJKA 2HW3A 2BGGA 2BDPA 4B8AB 5FRMA 4HHTA 4KB0A 4HUGA 2E4LA 1BISA 1J54A 3B6OA 3O3HA 4CGIA 3HM9A 5SWMA 4E1NA 1I3AA 3OS2A 4CJPA 3AVNA 3NF9A 1LAVA 3HJFA 2Q3SA 4ID1A 4CJ3A 2XY5A 1IG9A 1RCHA 3HPOA 1FK9A 2GUIA 4W5QA 1SV5A 2OZMA 3NH0A 4Z4EA 3VQ8A 4HTUA 2KW4A 3SNNA 4AHVA 1VSIA 3NF8A 2F8TA 5C25A 2RPIA 3QERA 3KD5E 3ZT4A 4FJGA 4BE0A 4B9UA 4DFPA 2DFFA 3HYFA 4OJRA 5KRSA 3OS0A 3H08A 4FLZA 4L8RB 1HYSA 4CF9A 4IG3A 3NGYA 2OZSA 4LH5A 1WNSA 1C1AA 2X78A 4H8KA 4NCGA 3OYHA 4DTMA 4OLBA 1RDDA 1S9GA 3DLKA 2AJQA 3SYZA 1D9FA 2PY5A 1C6VA 4KO0A 3NF7A 3F9KA 4J2DA 4CJ5A 1TL1A 1VRUA 3V1RA 2HHQA 1CLQA 3KK3A 1BCOA 4IBNA 4OPKA 1NKCA 3TAFA 2P5OA 4C8KA 5HROA 1VK0A 1RBVA 4FLYA 3AVKA 3P5JA 4CJWA 1UOCA 1VSKA 3QEXA 3VQEA 1T05A 3LAMA 1ZBIA 3MECA 1U48A 4KTZA 2YKNA 4DF4A 1L3VA 4KHQA 3VQ4A 4DQPA 1QS4A 4AH9A 2QXFA 1UA1A 4O5BA 4M3XA 1WAJA 1LV5A 2X6NA 1XWLA 2HB5A 4GVMA 4CEOA 4E7IA 1WSIA 3T1AA 1RT6A 1DTTA 3B6PA 5HBMA 3DOKA 4FJJA 4Z4FA 5K14A 3DLBA 3QNOA 1RT5A 3RRGA 3ASMA 3OJUA 4CJSA 1QTMA 1BIZA 2ITGA 4M41A 5HRRA 1NOYA 4CEEA 3VA0A 4DU1A 2EX3A 4OKEA 1IKXA 1NJYA 3LZJA 4QCLA 2ATQA 1D8YA 4N76A 2OYQA 4NCAA 3M8PA 3TAPA 1KFDA 1J5OA 2HHSA 4KREA 2KFNA 4B08A 3PO5A 2HNYA 2Z1JA 4HCCA 4KRFA 1TKTA 2VWKA 1S1TA 2JGUA 3V1QA 3OYIA 4TSXA 3VQAA 3TAQA 1Y97A 4LSNA 1KCFA 3CYMA 1EETA 1CXUA 5DMRA 4CJUA 3KK1A 4FJNA 2Y1JA 3K5OA 3OYNA 3AVIA 1ASVA 2ZE2A 4KHNA 4Z4IA 1QQCA 3DMJA 2ZQBA 4Z4CA 3JYTA 4E7HA 1DLOA 2YNGA 3D0PA 4CEDA 1NK9A 4FZXC 5CZ2A 5HLFA 2VWJA 4BDZA 4KPYA 1IKWA 4BE2A 1RBSA 3M8SA 5CYQA 3OYCA 3THVA 3S3NA 4B9SA 1HQEA 3LPTA 3AO2A 4JLHA 3L2WA 3QEWA 4DFMA 2BE2A 2WOMA 3BDPA 4KFBA 2YNIA 3AA2A 4I7FA 3OYEA 4DTXA 1REVA 1C0UA 4MFBA 2G8KA 4DTNA 4KHWA 4E7KA 1QSSA 1A5VA 3DOLA 1RDAA 2KQ2A 2Z1IA 1VSFA 3V9ZA 3IG1A 4CJEA 3PUFA 1JL1A 4FM0A 3S3OA 4I2PA 1B9DA 1ASUA 4CESA 1NK6A 4IFVA 3K5LA 4F3TA 3OS1A 4AHSA 3L2RA 3QEIA 4E1MA 3AA5X 3AVFA 1S6QA 3EZ5A 3ZSWA 3OYDA 4FLTA 1JLQA 2VG6A 5J1EA 3VN5A 2D0BA 2HHVA 4FK2A 1RT1A 4FJIA 4BACA 2ZD1A 1ZBHA 3C6UA 5FDLA 1SKRA 2YNFA 3AO1A 1A5XA 4IDKA 3TR8A 3LWLA 4N41A 2B6AA 2XHBA 4DSJA 2D5RA 1L3SA 4FXDA 3AVLA 4E19A 3HPGA 4CHQA 4H4OA 4CEBA 4B9VA 4CFAA 1LW2A 2IC3A 3TARA 2KFZA 4Z4HA 3LDSA 1S9EA 1S6PA 1RTHA 1YTAA 4BWMA 1LWEA 4ZHRA 1ZBUA 4CHOA 4W5TA 4FLWA 4E0DA 1S1WA 4I9QA 2HNDA 1T8EA 1SKWA 4OVLA 2IAJA 3O4QA 3ZSYA 4CHYA 3MXMA 1NKEA 1K6YA 1T03A 1BI4A 3C94A 3AVHA 3HL8A 4DSFA 3T3FA 4FJ7A 3VQ9A 4C8MA 1NJWA 3CQ8A 4DFJA 5J2QA 1ZYQA 3NE6A 3ZT0A 4RW7A 4EZ9A 4N47A 3K57A 1HRHA 3IS9A 4CERA 4DQSA 3FFIA 4Z0UA 4FW2A 1BGXT 1S1UA 4RG8A 4EP5A 3CG7A 2RF2A 2KZZA 2E6LA 3M8QA 3OYJA 3T19A 3V9WA 5E41A 3V4IA 1FKPA 3KLFA 1EXQA 1JXEA 1S5JA 2ETJA 1B9FA 3HPHA 4KV8A 4JRQA 3DYAA 1IO2A 4FVMA 1TKDA 2YKMA 3SV3A 1YVUA 4CCHA 3KD1E 4M42A 5HRNA 4BE1A 5JS1A 1BQMA 3V9XA 4FJ8A 3OYAA 3KLGA 1RT7A 4FM2A 4CGJA 3DRRA 4HUFA 4M3UA 1QSLA 2O4IA 2F96A 1JLBA 4AILC 3SUPA 2I5JA 1EKEA 1Q8IA 4IG0A 1JLFA 4DS4A 3DLHA 3UIQA 3NGZA 1IKVA 3LP3A 4CF1A 3KKRA 4O55A 3ZSOA 2PZSA 4OKJA 3PY8A 4CF0A 1KVAA 1VSJA 3HP9A 1EP4A 1LAWA 1TKZA 2NUBA 3U3GA 3LPUA 4CJQA 1J53A 2YV0X 4DQQA 4ID5A 1HMVA 4QAGA 1UWBA 2DFEA 1BQNA 3RMDA 5I42A 1SL2A 3SI6A 1XI1A 3AV9A 3SQ1A 3V1OA 1RT3A 3TANA 4KAZA 4RW4A 4UQGA 1F21A 2YHBA 3C95A 5HP1A 4B3OA 3C6TA 4CF2A 3RMBA 1U4BA 3QNNA 4BDPA 5HRSA 1UA0A 1WSHA 4RW6A 3NF6A 2G8HA 3CM6A 1GOBA 4B9MA 3KTQA 4E3SA 4KI6A 4IKFA 2B5JA 2Z1GA 1RBUA 1ZBLA 4DQIA 2JLEA 3HVTA 3L8BA 1X9SA 3A2FA 2B4JA 4G1QA 1X9MA 4AHTA 1LWFA 4CIGA 3HO1A 2Z1HA 4CEZA 4YFUA 3NDKA 1VSEA 3ULDA 2HVHA 4CEAA 2OPQA 1JLEA 4FJ9A 3HXMA 1S1VA
chains in the Genus database with same CATH superfamily
4Y1DA 4H4MA 4LF8K 2GEMA 3CCEN 2UUBK 3DLRA 3V81A 3NCIA 1NU0A 3NH1A 2UXCK 2IIRA 3GG4A 3M3ZA 4M3RA 3MCAB 1BG3A 2BTFA 4CIFA 5KTQA 4FJ8A 1SUQA 3VQQA 1B92A 2KTQA 1JLGA 2VWBA 3ITHA 4A5AA 3VF4A 3JS6A 4KBOA 4GW6A 1U2VB 4EIAA 3E9PA 1CZAN 4CK2A 3CCMN 5ELZA 4LFBK 3L2UA 3TPQA 3CQXA 2HNZA 3PIPL 3EO3A 3SUQA 3E9OA 3PX4A 1TUYA 3TI0A 4LF9K 3BGRA 4LY7A 3WT0A 3KLEA 3TABA 1QQOA 3SUOA 3C6HA 4CGGA 5KI6A 3I8DA 5BREA 4KH6A 1L3TA 4YOXA 1WBDA 5AQUA 4I9LA 2P9NB 1S72N 4B9LA 4KI4A 3QIOA 4JKHA 1I39A 3S3MA 2G8VA 3KLIA 3TAEA 4B9NA 3RVCA 1N33K 3MEDA 1NK5A 2HMIA 4GVEA 2ASOA 3AO4A 4MLHA 5AQZA 3EKUA 4LC9B 2XO7A 2VG5A 4JI6K 5D3GA 2IVPA 4HTLA 1K73O 2CH6A 4FWKA 4NXNK 4ILJA 4CGHA 3CXCM 4FWRA 3H3NO 3MEEA 1GLCG 3SMSA 4E7JA 3ULEA 4DTUA 2QKBA 2QEXN 1ZXOA 5EVZA 4FJXA 1NGAA 1VQ8N 2DY4A 4BG8A 2HHHK 4C8NA 3LDLA 4DHYA 3FGUA 2O8DA 1GOAA 4CJRA 1QSYA 1BA1A 4DV0K 3RR7A 1HKCA 2ZM6K 4FWOA 3KKSA 4H03B 4F3OA 4C1NI 2ZJRL 3AARA 4BGAA 1JL2A 1RT2A 4IJAA 1XMQK 1E4FT 4YORA 1GLDG 4DWIA 1FJGK 1ITGA 1NJZA 2UUAK 3IAYA 4FPAA 5F2RA 5BN8A 3L2VA 5DK5A 4DSEA 2DTUA 4RTFD 4KHUA 3T1YK 4KHSA 5J2NA 3A5NC 3CFRA 1OVYA 2F9WA 4RW8A 5AQHA 2OPRA 4JD2A 3BZCA 1QVGM 3G71N 4H5VA 1XHXA 3AVBA 4DR2K 4GMJB 5CHIA 2KZMA 4L3QA 5C24A 3CPWM 2QKKA 2UYTA 1X1PA 3CHWA 3MXJA 2FBXA 3E9LA 1V4SA 5SZTA 3O4NA 4C8OA 1XC9A 4K8ZA 4FW1A 1WSFA 3QLHA 1NGDA 4JK7A 4F2RA 3RSEB 2O4GA 5LJWA 1CZBA 4ZTFA 1SL0A 4G9ZA 3FR0A 4WE1A 1S3XA 2QXLA 3LP1A 4CGDA 2A41A 1L5UA 5AQMA 2NRXA 4M3WA 4IO9L 3U4LA 3SV4A 4CHNA 3ZETA 1O1WA 4FK0A 4B3MK 2NLXA 4CF8A 1R0AA 2NRRA 1C0TA 4H5WA 4K0KK 4Q5VA 4H0XB 3DXMA 3G25A 4IOAL 1SAZA 4FJMA 5KPRA 1WSGA 1ASWA 1QVFM 4W5RA 1N5YA 4NLCA 4CK1A 3MAQA 2DFHA 2FBVA 2BUPA 2KKZA 4IEIA 1TAUA 1KQSM 2PYLA 1CZ9A 3OBYA 4B1ZA 3NBPA 4NYFA 2P9UA 1Q9XA 2NNWA 2QK9A 3CCVN 3LALA 2W40A 1U6ZA 4XIUA 3D2EA 3CJ7A 4BR2A 3HBTA 1X3NA 4KB1A 1BUPA 4PY5A 3DLGA 4ZTJA 4JS4A 3KIOA 4DSLA 4BWJA 5F0XA 1O13A 2E4LA 2E1YA 1J54A 3O3HA 4CGIA 3HM9A 3L0QA 1I3AA 3OS2A 1VQKN 3AVNA 3FLCO 4WCEL 4CJ3A 3HPOA 2GUIA 4WQ4A 3NH0A 1NMDA 3SNNA 4C1NK 5JLFA 5C25A 3QERA 4FJGA 1BDGA 4BE0A 4DFPA 3H08A 4CF9A 4LH5A 5EXWA 3OBWA 1C1AA 5AZJB 2GELA 3OYHA 4H0PA 3VTIA 1RDDA 3DLKA 4FO0A 3SYZA 3P39A 3CMAN 4JI7K 3I56N 2HHQA 3KK3A 1BCOA 3LDQA 4C8KA 3TAFA 3CPEA 5EX5A 3LAMA 1ZBIA 1U48A 4DF4A 4KHQA 4PL8A 5AQWA 4AH9A 1UA1A 1WSIA 1RT6A 3B6PA 3DOKA 4Z4FA 3DLBA 3RRGA 3ASMA 3OJUA 1QTMA 2YCHA 2ITGA 3AY9A 2EX3A 1V4TA 3LZJA 4NCAA 3TAPA 2HHSA 1KFDA 3N4PA 4KREA 1HKBA 3A5OC 5E26A 4B08A 3PO5A 2Z1JA 4QS9A 2VWKA 4H0VB 3EE8A 3O9SA 3CYMA 5DMRA 2E2NA 4FJNA 3K5OA 5AQLA 4JKGB 1ASVA 1QQCA 2ZQBA 1DLOA 1IKWA 3SBTA 3M8SA 5CYQA 2GWKA 2E20A 3LPTA 3O08A 4CW7B 2WOMA 4DV7K 3DXKB 4KFBA 3OYEA 3ZYYX 2Q0UA 5AQJA 3H45C 3HOSA 4DTNA 1XNQK 1YJNN 4BRPA 1QSSA 3DOLA 3V9ZA 4JV5K 4CJEA 1ASUA 4IFVA 2P9IA 4UY8O 4F3TA 4AHSA 2WUSA 5DM6L 3EZ5A 3VOVA 4WQ5C 4BACA 4H5RA 1ZBHA 3C6UA 4MO5A 1SKRA 1Y64A 4N41A 4GV3A 2D5RA 3KWIA 4FXDA 3EEQA 3T1HK 2IC3A 4WFAL 4Z4HA 3LDSA 3VESA 1S9EA 1LWEA 4ZHRA 3CQYA 1SKWA 3O4QA 1K6YA 1T03A 3SJHA 3Q7CA 4FWQA 4DFJA 3VGMA 4RW7A 4N47A 2HBMA 3K57A 3D7EO 3NVMA 4Z0UA 1S1UA 4RG8A 3CG7A 2RF2A 3G6EN 2KZZA 3M8QA 5AQRA 4GV6A 3OYJA 4JKAA 4BG9A 3T19A 5AZIA 1OH6A 1NGJA 3EL2A 3ZEUB 3V4IA 1JXEA 1B9FA 3HPHA 3DYAA 1TKDA 5JS1A 4BVOA 3OYAA 3GE1A 3DRRA 3LL3A 4BREA 4AILC 1EKEA 3MN7A 4DS4A 1JLFA 4K43A 1KAYA 3S41A 2IVOA 2W6KA 2OANA 2PZSA 3O9RA 4CF0A 1VSJA 1QQNA 3MN6A 4EHUA 4FPBA 1TKZA 3U3GA 4DB3A 1VQPN 1XI1A 3R6MA 3BZKA 3SQ1A 3TANA 1U4BA 5HRSA 1UA0A 3W0LA 3JAMO 1Z6RA 1KC8O 5GAHP 5GADP 4IKFA 2B5JA 1ZBLA 2JLEA 4K42A 2B4JA 4H5NA 2Z1HA 4X62K 1VSEA 3I8BA 3ULDA 2OPQA 4FJ9A 1RGIA 1WBBA 4PQUA 2E2PA 3VGLA 1XC3A 3D45A 4MQ3A 1NGIA 4BQLA 1NJXA 4H5TA 4CJ7A 3RMCA 4PKHA 3CF5L 4DR1K 4CBWA 2QWOA 4ICLA 3LDOA 2YJFA 3K5MA 2P1JA 2E1ZA 2JWKA 3AO5A 5C42A 2PAVA 1W97L 1RNHA 3MDQA 4DFKA 2QWMA 5AQNA 3LP0A 2P9SB 4PKIA 1ATSA 2VGMA 4DR6K 3VQ7A 2AA4A 1IBMK 3HP6A 3C7NB 3VGKA 2RE2A 3SCXA 4AHCA 3TWHA 4FCYA 5I9EB 2RKIA 1XUPO 2ITMA 1HNIA 2DPNA 3QEVA 5J2PA 1VSHA 4CD1A 3NGIA 4BROA 4K41A 3P38A 3L2QA 3THWA 1WSEA 3HI0A 3HRGA 1RTIA 4K8XA 1SQKA 4YDUC 4EFHA 4J2BA 4DR5K 3NFAA 4M7YA 3NHGA 2HBJA 3VMFB 4DU4A 3CCJN 1WLJA 3U6FA 3EY1A 4IZ9A 4WYBA 4F4KA 4Z94A 1KVCA 1RBTA 4O8UA 5C10A 4FVUA 3CFPA 4Q0BA 3ISNC 4B8CA 4FOIA 1DEJA 2XY6A 3QBXA 4DTPA 3RMAA 4BR9A 2Y1IA 4M3TA 4IFYA 3SAFA 1C0MA 1T6CA 4YOWA 1HLUA 4IXCA 1MU2A 2X6SA 4B1VA 2F9TA 4IO8A 3VQ6A 3GL1A 1TK0A 3THXA 1RTDA 2E6MA 3O1BA 4JKDA 3K59A 4OPHA 1VQ6N 4CFCA 1HNVA 4DTOA 3LM2A 3JSMA 2HBKA 3W3DA 5KQDA 3HOTA 3QO9A 4RW9A 1BWFO 3J8AA 4M45A 3VQBA 1VAZA 1KSPA 4KTQA 3KWGA 3QDKA 3P1GA 4CK3A 3CCSN 1VQMN 1C1BA 5HRPA 5C2FA 2FC0A 3PSIA 3MEGA 3WQUA 1Z25A 1TAQA 3S9HA 1QHAA 4DU3A 3WNHA 4FK4A 4CZJA 3P31A 3RR8A 4HUEA 4W5NA 3CMEN 2E8AA 3G4SN 1RDBA 2WONA 4DKWA 2FSKA 4B3SK 2H3GX 2A1RA 2E2OA 2ASPA 4Y1CA 1EWRA 4JS5A 3I0SA 4YNQA 4FJLA 3CM5A 3G0ZA 4DV3K 5CYMA 3FFKB 4JI8K 1EX4A 4DR4K 2VCPA 3GBTA 2QWQA 4B1YB 2PYJA 2IOCA 3UKRA 2GBZA 3WNEA 4BQZA 4BRKA 3RRHA 1NKBA 2F8SA 4AM7A 3PIOL 3M8RA 2P9KA 3VPZA 2G8IA 1ZBFA 3THYB 3H1VX 4CGFA 4E1JA 1JCFA 4M3YA 2NRWA 4JD2B 3WNGA 3E01A 3OYKA 4JI4K 3ZT2A 3DM2A 4J2AA 4BRQA 3SQ4A 4BRHA 3HM8A 4FM1A 2V7ZA 4CD3A 3HK2A 5BRDA 4A61A 3HVRA 1VSDA 4CJVA 3ALYA 3H1QA 5GIOA 3IKMA 3EE9A 5CE3A 5T7BA 2O8FA 2LSNA 2VG7A 4FJ5A 5JLHA 2HHTA 3VQCA 2HHXA 3OVNA 3VQ5A 3FZFA 3UKUA 3QEPA 4CJLA 1C1CA 1RILA 2UXBK 3KLHA 4JRPA 4OLAA 4CHZA 1HQUA 3AVJA 4CFDA 3TAGA 1WB9A 3KHYA 2G8WA 4IWVA 3O8MA 5FRMA 4A5BA 4HHTA 5SWMA 3CCQN 1GLLO 1K8AO 1XQSC 1VQLN 1RCHA 1FK9A 2D0OA 4JI2K 1SV5A 3D6RA 2J4RA 4BRLA 2F8TA 2RPIA 1YVNA 3ZT4A 4B9UA 3HYFA 1RDWX 4L8RB 1HYSA 2P9LB 2W6LA 1Q82O 2E5LK 2OZSA 1N34K 4H0TB 4H8KA 5BPLA 2UUCK 4NCGA 4OLBA 2AJQA 2PY5A 1NGFA 3O6WA 4J2DA 5LMNK 4M63C 1ZBSA 4OPKA 2P5OA 5HROA 4FLYA 3AVKA 3P5JA 1P8ZA 1UOCA 3QEXA 3VQEA 5M1QA 3VQ4A 2UXDK 2QXFA 1WAJA 1LV5A 2X6NA 5GINA 1XWLA 4GVMA 4CEOA 5BR8K 4E7IA 3T1AA 1DTTA 1K8KB 1BIZA 4QS7A 4M41A 5HRRA 4JYAK 4OKEA 1IKXA 2P9PB 1D8YA 4N76A 2HNYA 4HCCA 4DR3K 2JGUA 3FZLA 1J6ZA 5CR4A 1Y97A 5A2QO 4BRMA 1KCFA 1CXUA 4CJUA 1KD1O 2VGNA 4Y0WA 2ZE2A 4E7HA 4BR7A 5CZ2A 5HLFA 5KPZA 4BRIA 3JXUA 3ENOA 3R3LA 4KPYA 4JI1K 2ZF5O 1RBSA 3OYCA 3THVA 1GLEG 2V51B 4A62A 3L2WA 3QEWA 2P9NA 3J7AP 3BDPA 4KH4A 2WFBA 5BRHA 1C0UA 2G8KA 1RDAA 1VSFA 3K9JA 1MWKA 2CGJA 1J5EK 4YOUA 3CIPA 3CC2N 3OS1A 1E3MA 4E1MA 3AVFA 3ZSWA 4FLTA 5J1EA 3VN5A 3A5MC 3MN5A 5ADXA 1RT1A 5B8HA 4FK2A 4CI6A 2ZD1A 1MWMA 5FDLA 3NVKA 5IWAK 1W7AA 3AGRA 3TR8A 5H1SQ 3LWLA 1DGKN 2B6AA 4GY2B 1VQ4N 4DSJA 2O8BB 4YOYA 3HPGA 4CHQA 4CEBA 3WXIA 4CFAA 4XH5A 1ZBUA 4CHOA 1WOQA 3WXJA 1S1WA 4JK9A 1OH8A 4OVLA 4CHYA 3VTHA 3O9UA 3T7ZA 3WEEB 1N36K 4GKJK 2F7TA 3HL8A 1T3VA 4FJ7A 2I7NA 3PLAA 1Q86O 4DQSA 4LFAK 3HTVA 1T44A 3MX5A 4B3RK 2GUPA 1EXQA 4JRQA 4KV8A 2YKMA 3C0BA 4M42A 1YVUA 4XH1A 4I6MB 3KD1E 1BQMA 3EZWA 4FM2A 1ZC6A 4HUFA 2O4IA 2F96A 1JLBA 1I94K 1Q8IA 4CF1A 3ZSOA 4OKJA 3HP9A 2D1KA 1EP4A 1LAWA 2NUBA 3LPUA 4DQQA 4QAGA 3MWPA 3RMDA 3Q7BA 1SL2A 3SI6A 4CZIA 3OW2M 3AV9A 3V1OA 4KAZA 4UQGA 1F21A 1M90O 4B3OA 4CF2A 2QW9A 1WSHA 4RW6A 2Z1GA 4YHHK 4ILHA 3OA9A 1X9MA 2WBNA 4AHTA 3HO1A 1Z05A 2FSJA 4YFUA 2HVHA 4CEAA 2D4WA 1R59O 1JLEA 3HXMA 2A6AA 3GDQA 4A2BA 4BVPA 2FF6A 1GLBG 4JI3K 1TKXA 1DTQA 1Z26A 4HCBA 4CJTA 1TL3A 1X9WA 4JKEA 2IDOA 4LF6K 2FLOA 4BR5A 4GNIA 2XY7A 1HUXA 2YNHA 3ATVA 3I55N 1TVRA 1JLCA 1HNXK 4CEFA 1GLJO 1TGOA 3OYMA 1X9JA 1YUWA 4IOXA 4PKGA 5BN9A 1NBWA 4F2SA 1WSJA 2X74A 3SPYA 3SQ0A 3SQ2A 1CXQA 2YHYA 1TK8A 3DI6A 1U45A 4FYDA 3ENBA 3K2PA 2YX6A 3K58A 3G10A 2GV9A 3FE1A 4EP4A 3J7YP 5J2MA 1LW0A 5BR9A 2R7YA 1H1VA 1JJ2M 4R79A 4BGBA 4DUZK 1D9DA 5E84A 2A40A 2VQFK 4CFBA 4BRDA 4O0JA 3IMXA 1VSMA 5AZJA 2YI1A 5DM7L 4QS8A 5GIPA 2O8CB 5TKYA 4DV2K 2P51A 2PFUA 3MXIA 1BA0A 5KGWA 1QE1A 3AA4A 4R5PA 5M1NA 2KHOA 1W0HA 4LD0A 1XMOK 3DRPA 3SK3A 3AVGA 4OPJA 4OGCA 2HVIA 3ZX0A 4CZMA 1RTJA 3THWB 3QETA 3IFRA 3AVMA 4CHPA 1BL3A 3OYLA 3EN9A 3F73A 3AA3A 3CC7N 3O3GA 1TYQB 1XHZA 2V52B 1BI4B 2YHAA 4DSKA 3KZBA 4JAXA 3U9ZA 4O8KA 3O3FA 4BC5A 4JHDB 3BY5A 3DJCA 3AVAA 4FSVA 3D2FB 3A8YA 3VEYA 4JKGA 4O4GA 5BPNA 2VYPA 5AQYA 1HYZA 3ZX3A 5ADXH 3K0SA 1HPZA 5IT9O 1SKSA 4ELTA 1KAZA 3OJSA 4FJHA 2Q1NA 3HT3A 2HHUA 3MMVA 4B9QA 1D4XA 3DXKA 3NH2A 3AO3A 4E89A 1IH7A 3UB5A 4E7LA 3QB0A 3J81O 5JS2A 1FW6A 4BY9C 1T7PA 4FZYA 3K9KA 4BDYA 4C23A 3QINA 3OYFA 1ILYA 4BC2A 4HVJA 3LWMA 4DTSA 3KJVA 3P83D 3WUHA 5KRTA 3H46O 3L3VA 4DQRA 1N6QA 4AHUA 3VA3A 1VQ9N 2RHKA 3SJJA 1XNRK 1NOZA 2FF3B 1G15A 5FPMA 2RN2A 5EU7A 3ZX2A 3MWTA 1FXXA 4AHRA 2EWSA 4NXMK 3DRSA 3J80O 3WNFA 1NK8A 3QMLA 2ZWHA 3TAMA 3L3UA 5CZ1A 1U47A 2HHWA 5GAGP 1VQ7N 1GOCA 3ZCMA 3V9UA 3CD6N 2A1SA 3FZMA 4CEQA 2W42A 1U04A 3O4WA 4CZLA 3TTDA 1YT3A 2NRHA 1NGHA 4ELUA 1NM1A 2NRTA 1KLNA 3R8EA 4DV5K 2GWJA 3IRXA 4DQ8A 4F9OA 1C0FA 3ZSVA 3VERA 3AGKA 4KHYA 2F4VK 4JKCA 5FROA 4QOZB 4LFCK 4IJNA 5M1PA 3BUZB 4FJKA 3LANA 3KK2A 1VHXA 3VEWA 2BGGA 2BDPA 4NLBA 1E4GT 1BISA 4E1NA 4J8FA 5LY3A 3HJFA 1IG9A 4ID1A 2XY5A 4AM6A 3VEOA 2NRVA 5BRFA 4W5QA 4Z4EA 2KW4A 4AHVA 1VSIA 1RDUA 3F5TA 4OJRA 3OS0A 5AQGA 3ENHA 3C6AA 1WNSA 4B3TK 4OO1J 2X78A 2ZGYA 4DTMA 3T69A 4WF9L 1D9FA 4A2AA 1C6VA 4KO0A 3NF7A 3B8AX 1VRUA 3V1RA 3WXLA 1CLQA 1IV0A 2FSNA 4YY3K 5MLCQ 3VENA 4IBNA 1VQON 3CCLN 2QTDA 1YHQN 1NKCA 1IJJA 1YITN 4CJWA 3TSPA 4FWPA 3ULEB 3MECA 2YJEA 4KTZA 2YKNA 2D0PA 1QS4A 4U7BA 1OKJA 4M3XA 4RCHA 2OCEA 4FJJA 3KK7A 2O8DB 5HBMA 5K14A 1RT5A 4WQ5A 4CJSA 4IFEA 4O5FA 1NOYA 3OHRA 1NJYA 2E2QA 2P9SA 5EOYA 3M6GA 2KFNA 3BEXA 3WQTA 4WQ4C 4KRFA 3C7NA 3V1QA 4TSXA 3VQAA 3TAQA 4LSNA 1EWQA 3KK1A 2QWNA 2Y1JA 3OYNA 4KHNA 4BRFA 4ISFA 4Z4CA 4PL7A 3JYTA 3D0PA 1NK9A 4CEDA 4FZXC 1NWKA 3BF3A 3EKSA 4B1WB 4BE2A 3U9DA 4DFMA 3C65A 1BU6O 1REVA 5AQPA 5M1OA 3SMPA 2ZJQL 4KHWA 4E7KA 3TU5A 5M1FA 2KQ2A 2HBLA 2WTUA 4XH4A 5AQXA 4FM0A 4I2PA 1B9DA 1NK6A 3L2RA 4MO4A 4PHTX 3AA5X 5LMUK 3QEIA 1S6QA 4AQYK 2A42A 3OYDA 1JLQA 2VG6A 2HHVA 1Q7YO 4CZGA 2YNFA 3AO1A 3ZETB 4WFNL 1YJWN 1L3SA 4NO7A 3AVLA 1VQ5N 2Q97A 4B9VA 3VEZA 1LW2A 1HJOA 3TARA 3OTOK 3DXMB 4W5TA 4E0DA 4FLWA 1LOTB 2HNDA 4BR0A 1IBLK 1T8EA 2IAJA 1NKEA 3MXMA 5C12A 2OTJN 1ATNA 3AVHA 4BR4A 4LF4K 2HF4A 3VQ9A 1NJWA 3CQ8A 5J2QA 3NE6A 3ZT0A 3R1XA 1NGCA 3O9TA 4MDBA 2P9UB 4FWMA 1BGXT 2HF3A 5EY4A 1W2BM 1GLFO 1YAGA 4DCHA 4BRAA 3ID6A 3HSCA 3LDPA 1T6DA 3D2EB 5TKWA 3H3OB 5E41A 3KLFA 4DV1K 1S5JA 2O8EA 3FZKA 4CCHA 4BE1A 3V9XA 5JICA 3UE5A 1OVQA 4A57A 3IUCA 3SUPA 2I5JA 4IG0A 3UIQA 3NGZA 3KKRA 4O55A 1YIJN 3TTFA 2E88A 3TTCA 2CGKA 3QFUA 4CJQA 1J53A 3CJ9A 2ZJPL 1HMVA 1UWBA 1BQNA 4FL9A 5I42A 3DWLA 1Q81O 2ZGZA 3M1FA 1RT3A 3THYA 2YHBA 3C95A 3ID8A 5LJVA 5HP1A 1HKGA 3C6TA 1BOTO 3RMBA 4BDPA 4ISGA 1U2VA 2JWLA 3CM6A 1GOBA 4JKFA 2G8HA 4KI6A 5FPDA 4DQIA 3L8BA 1X9SA 2QA4N 1WUAA 4YOTA 4CIGA 3AAQA 3QFPA 3L4QA 3NDKA 1NGBA 1M1KO 1JCEA 3U8XA 3CERA 4YDUA 5KQ8A 2CGLA 3LZIA 3SPZA 4J2EA 3SUNA 2IS3A 2HMPA 4FWLA 1HJRA 4O0IA 3K5NA 4BRCA 3KVGA 2GTDA 1VSLA 3I33A 3MK6A 2D0AA 1Q9YA 4KKOA 4W5OA 4X66K 1RBRA 1VRTA 5KGXA 3I0RA 4KTWA 2UU9K 1NK0A 3O1WA 4FZZA 3L6QA 5FRNA 4DSIA 1IKYA 2KLAA 5AQOA 3VF6A 4OX9K 1U49A 1NK7A 4X64K 2CH5A 1Q18A 1JXBA 3R9PA 4CIEA 1NJIO 3ZSXA 4Z4GA 3NAEA 3CCUN 2FBTA 3CCRN 4DTJA 3E66A 4H0OA 4DF8A 3PX6A 4CZEA 1P90A 4F8RA 3U3YA 1QZ6A 3VQPA 4EZ6A 2ASMA 4CVNE 2P9LA 4CE9A 4M3ZA 2P9IB 3DLEA 3VQDA 4DLGA 1BIUA 3GOIA 4MDAA 4V19S 4BC4A 1KTQA 4EAHD 4OKKA 1LWCA 3PO4A 4DTRA 1JLAA 1JKHA 1YI2N 1YF5L 4LSLA 1NGEA 2D0CA 3CFOA 1FKOA 4ELVA 5M1KA 3ZT1A 1S1XA 3V6DA 5CY4A 1BCMA 4CJKA 1D5AA 4BRGA 1K8KA 3OYGA 3ZSZA 4DMNA 5KPTA 4DS5A 4B1UB 4FLXA 2P9PA 1RDCA 1QZ5A 3NMUA 1L3UA 3QBWA 4PA1A 5FPEA 4O44A 1HYVA 3ZSRA 4FLUA 5AQQA 3RSEA 3SBGA 3RTVA 1HX1A 3TSUA 4WFBL 1NGGA 1TK5A 2XRIA 3LM9A 3E1YA 2FBYA 3PV8A 5AZIB 3OYBA 1NLVA 4JNEA 4DLEA 4PUOA 4JI5K 2GX9A 3ZLJA 1NMNA 5FLXO 2BH1A 4DUYK 1WAFA 3SAGA 5BPMA 3ZT3A 4CJ4A 3LP2A 1HPMA 2BANA 4FLVA 1DKGD 3HZ6A 3RWUA 3EYZA 3QIPA 1JCGA 1NNEA 2G8UA 2OPPA 1KLMA 4N56A 5F1XA 5JVHL 5AR0A 1KVBA 1UAXA 3LAKA 1BHLA 4B9TA 2OPSA 5HOOA 1NG9A 3ZSQA 2EHGA 4I2QA 5HL7L 3QICA 2XY8A 1NK4A 4JKBA 5LL6Z 3VEXA 4CECA 1WN7A 4C8LA 2O8BA 2G8FA 3BF1A 3O9QA 2IGIA 3HSTB 3F2KA 4NCBA 1A5WA 1TV6A 2OA8A 4CJFA 1HNZK 3V9SA 3LDNA 1KRPA 4DG1A 5I3UA 3IDHA 1RT4A 3OY9A 5AFUA 3WEEA 4LH4A 1SL1A 1YTUA 1X3MA 1RFQA 1W9HA 1KFSA 4N5SA 4MLEA 3O80A 1J9AA 1EO1A 3AVCA 2P5GA 3ATUA 3PX0A 2W41A 1QHTA 4IEEA 3H6EA 4NYNA 1IBKK 3A5LC 4PWDA 2Q2RA 1IG8A 3QESA 2HW3A 4OGEA 3SZ2A 4OPAA 3FZHA 4B8AB 4I6MA 5AJ3K 4KB0A 4HUGA 1G99A 4AF1A 3B6OA 3VEVA 1KAXA 3VF2A 4LF5K 3P4IA 3BP8A 4CJPA 4GV9A 3NF9A 1OH7A 1LAVA 2Q3SA 1C0GA 2Q31A 2OZMA 3VQ8A 4HTUA 3NF8A 3KD5E 4BRNA 4LF7K 1HR0K 2DFFA 5KRSA 3O5BA 4FLZA 4XEIA 4IG3A 1BO5O 3NGYA 4RWTA 4H0YB 5JVGL 1S9GA 3MN9A 4DR7K 3F9KA 4CJ5A 1TL1A 1S22A 1ATRA 2Q36A 3AAPA 4K25A 4CZHA 3MCPA 1MDUB 1LCUA 4IDHA 4DV4K 1VK0A 1RBVA 3SAHA 4CZKA 1VSKA 5AQFA 3L4IA 1T05A 5AQIA 1L3VA 3THXB 2QM1A 4DQPA 3CI5A 1GLAG 4O5BA 2HB5A 3SLCA 2NZTA 2HSTA 3QNOA 2QI2A 4CZFA 4JEPA 2YHXA 4CEEA 3VA0A 1YXQA 4DU1A 5FPNA 4GKKK 3CJBA 4QCLA 2ATQA 2OYQA 1K9MO 3M8PA 1J5OA 2FXUA 1TKTA 1S1TA 4ISEA 4NB4A 3OYIA 1EETA 3DAWA 3AVIA 4Z4IA 3DMJA 2YNGA 2VWJA 1HNWK 2QWPA 1MA9B 4BDZA 4B9SA 2PBDA 3PSFA 3S3NA 1HQEA 3AO2A 4JLHA 2A3ZA 2BE2A 4DTXA 2YNIA 3AA2A 4I7FA 4MFBA 1A5VA 3TSQA 2Z1IA 2NRZA 3IG1A 3PUFA 1JL1A 3MX2A 3S3OA 1EQYA 4CESA 1YJ9N 3K5LA 3UKRB 1VQNN 2O8CA 2I7PA 2D0BA 4FJIA 2P9KB 3WXKA 4ILGB 1QQMA 2OTLN 1A5XA 4IDKA 3CJCA 2QWRA 4U67L 2XHBA 4BC3A 1N32K 4IOCL 3ZEUA 4E19A 4X65K 4H4OA 2KFZA 3VETA 5C2DA 5AQKA 1S6PA 4BWMA 1RTHA 1YTAA 4HWIA 4B1XB 4CBXA 2HOEA 4FWSA 3CJ1A 4I9QA 2QWLA 2V7YA 3ZSYA 1TYQA 1BI4A 3C94A 2AP1A 4DSFA 5JMVA 3T3FA 2O8FB 1DT9A 4C8MA 1ZYQA 4EZ9A 1HRHA 3IS9A 4CERA 4EHTA 3UKUB 3FFIA 4JHDA 4FW2A 3D2FA 4EP5A 5GAEP 4FWNA 2Q0RA 2E6LA 1KXPA 1N8RO 3J7ZO 1OH5A 2IVNA 3V9WA 1FKPA 2ETJA 1IO2A 4FVMA 3SV3A 1SZ2A 4FOEA 5HRNA 4A59A 3KLGA 1RT7A 2WC9A 4CGJA 1TUUA 3DLLL 4M3UA 1QSLA 3DLHA 4KHPK 1IKVA 3LP3A 2A5XA 3PY8A 3CETA 1KVAA 4DV6K 2YV0X 4ID5A 4YOVA 2DFEA 1SS6A 5AFUH 4CBUA 5C0YA 4JK8A 2VQEK 5AQSA 5AQTA 4RW4A 4JI0K 3CJAA 3QNNA 5AQVA 3CC4N 3NF6A 3A0IX 4JN4A 4B9MA 3KTQA 4E3SA 4KH5A 5C15A 1RBUA 1ESVA 3M5RA 3HVTA 3N4QA 3A2FA 2O8EB 4G1QA 1LWFA 4CEZA 4M7XA 3WXMB 2YHWA 3F9MA 1S1VA
chains in the Genus database with same CATH topology
3LZIA 3SPZA 4Y1DA 4PQUA 4H4MA 4J2EA 3D45A 3SUNA 2IS3A 4MQ3A 1TKXA 1NJXA 3RMCA 1DTQA 3DLRA 3V81A 3NCIA 3NH1A 1HJRA 4O0IA 3K5NA 4ICLA 1VSLA 4M3RA 1Z26A 4CIFA 4HCBA 2D0AA 5KTQA 2P1JA 4KKOA 4CJTA 4W5OA 1RBRA 1TL3A 3K5MA 1Q9YA 1SUQA 1VRTA 5KGXA 1X9WA 3VQQA 3I0RA 2IDOA 1B92A 3AO5A 4KTWA 5C42A 1NK0A 2XY7A 2KTQA 1RNHA 1JLGA 4DFKA 2YNHA 3ITHA 4FZZA 1TVRA 3LP0A 1JLCA 4GW6A 3VQ7A 5FRNA 4CEFA 4DSIA 1IKYA 1TGOA 4CK2A 3OYMA 3HP6A 3L2UA 3SCXA 4AHCA 1U49A 2HNZA 1NK7A 3TWHA 3SUQA 4FCYA 4F2SA 3PX4A 1WSJA 2X74A 3SPYA 2RKIA 3SQ0A 3BGRA 1JXBA 3TI0A 4LY7A 1HNIA 3SQ2A 3KLEA 1CXQA 3TABA 3QEVA 3SUOA 1TK8A 5J2PA 3DI6A 1VSHA 4CGGA 4CIEA 1U45A 5KI6A 2A1RA 4FYDA 3ZSXA 3K2PA 3NGIA 4Z4GA 3I8DA 3K58A 3NAEA 3G10A 1L3TA 2GV9A 2FBTA 3L2QA 4I9LA 4EP4A 4DTJA 5J2MA 1LW0A 1WSEA 4B9LA 4KI4A 4DF8A 2R7YA 3QIOA 1RTIA 1I39A 3S3MA 2G8VA 3KLIA 3PX6A 3TAEA 4K8XA 4B9NA 4J2BA 4F8RA 3U3YA 3MEDA 3VQPA 1NK5A 1D9DA 2HMIA 3NFAA 4EZ6A 3NHGA 4DU4A 4CFBA 4O0JA 3AO4A 1WLJA 3U6FA 4CE9A 1VSMA 3EY1A 4M3ZA 2XO7A 3DLEA 2VG5A 4F4KA 3VQDA 1KVCA 1RBTA 2P51A 4DLGA 5D3GA 1BIUA 3MXIA 1KTQA 4OKKA 3CFPA 4Q0BA 3ISNC 1LWCA 4B8CA 3PO4A 4DTRA 1JLAA 5KGWA 1QE1A 1JKHA 4DTPA 3AA4A 4R5PA 4CGHA 2XY6A 2Y1IA 3RMAA 4IFYA 4M3TA 1C0MA 1W0HA 4LD0A 4LSLA 3MEEA 3DRPA 2D0CA 1MU2A 2X6SA 4E7JA 4DTUA 3VQ6A 2QKBA 3AVGA 3CFOA 1FKOA 4FJXA 1TK0A 2DY4A 4OPJA 4OGCA 2E6MA 1RTDA 4ELVA 2HVIA 1RTJA 4C8NA 3QETA 3ZT1A 1S1XA 3V6DA 5CY4A 3K59A 3AVMA 4CHPA 1BL3A 1GOAA 4CJRA 3OYLA 1BCMA 3AA3A 3F73A 4CJKA 4CFCA 1QSYA 1D5AA 1HNVA 4DTOA 3OYGA 3ZSZA 4DMNA 3O3GA 3JSMA 3RR7A 1XHZA 4DS5A 1BI4B 3KKSA 4FLXA 3QO9A 2YHAA 4F3OA 1RDCA 1L3UA 4DSKA 1JL2A 4PA1A 1RT2A 4RW9A 4O44A 1HYVA 3ZSRA 3O3FA 4FLUA 4DWIA 1ITGA 1NJZA 4M45A 3IAYA 3VQBA 1KSPA 3RTVA 4KTQA 3L2VA 4CK3A 3AVAA 3P1GA 5DK5A 4DSEA 2DTUA 1C1BA 4KHUA 5HRPA 4KHSA 5J2NA 2FC0A 4O4GA 1TK5A 2XRIA 3MEGA 3CFRA 1Z25A 4RW8A 1TAQA 3S9HA 1HYZA 2FBYA 3PV8A 3OYBA 2OPRA 1HPZA 4DLEA 4DU3A 3WNHA 1SKSA 4ELTA 4PUOA 4FK4A 3OJSA 1XHXA 3AVBA 4FJHA 3HT3A 3RR8A 4HUEA 4GMJB 2HHUA 4W5NA 1WAFA 3NH2A 1RDBA 2WONA 2KZMA 5C24A 2QKKA 3AO3A 3ZT3A 1X1PA 4CJ4A 3LP2A 4Y1CA 4E89A 3MXJA 1IH7A 4JS5A 3I0SA 2BANA 2FBXA 4E7LA 4YNQA 4FLVA 3CM5A 4FJLA 5SZTA 3RWUA 3G0ZA 3O4NA 5JS2A 3EYZA 4C8OA 1XC9A 3QIPA 1T7PA 4FZYA 5CYMA 4K8ZA 4FW1A 4BDYA 1WSFA 1EX4A 3QLHA 2G8UA 2PYJA 4F2RA 3QINA 3OYFA 2IOCA 2OPPA 2O4GA 1KLMA 4HVJA 4N56A 1CZBA 2GBZA 4ZTFA 1SL0A 3WNEA 1KVBA 1UAXA 3RRHA 3LWMA 4WE1A 1NKBA 3M8RA 2F8SA 4DTSA 3LAKA 3KJVA 3LP1A 1BHLA 3P83D 2OPSA 4CGDA 5KRTA 1L5UA 4B9TA 3ZSQA 1ZBFA 2G8IA 4M3WA 3L3VA 4DQRA 4CGFA 1N6QA 2EHGA 4AHUA 4I2QA 3SV4A 3VA3A 3SJJA 4CHNA 4M3YA 1NOZA 1O1WA 2XY8A 1G15A 4FK0A 1NK4A 2RN2A 5EU7A 3WNGA 3E01A 4CF8A 4CECA 3ZT2A 3OYKA 1WN7A 1R0AA 4C8LA 1FXXA 3DM2A 4J2AA 2G8FA 1C0TA 3SQ4A 4AHRA 2IGIA 3HSTB 4NCBA 4Q5VA 3DRSA 4FM1A 1A5WA 3WNFA 1NK8A 4FJMA 1TV6A 3TAMA 1WSGA 2OA8A 3HK2A 1ASWA 4CJFA 3HVRA 3L3UA 5CZ1A 3V9SA 1VSDA 1U47A 2HHWA 1KRPA 4DG1A 5I3UA 4CJVA 1RT4A 1GOCA 4W5RA 3ALYA 1N5YA 3OY9A 3ZCMA 3V9UA 2A1SA 4CK1A 3MAQA 4LH4A 4CEQA 1SL1A 2W42A 1U04A 2DFHA 2LSNA 2VG7A 2FBVA 5T7BA 4FJ5A 1YTUA 1KFSA 1W9HA 1YT3A 3VQCA 2HHTA 2HHXA 1TAUA 3OVNA 3VQ5A 4N5SA 2PYLA 1CZ9A 1J9AA 4ELUA 3NBPA 4NYFA 3QEPA 1KLNA 3AVCA 1Q9XA 2P5GA 4CJLA 1C1CA 1RILA 3IRXA 3PX0A 3ZSVA 3KLHA 2QK9A 4JRPA 4OLAA 1QHTA 4KHYA 3LALA 4NYNA 4CHZA 4XIUA 1HQUA 3AVJA 4CFDA 5FROA 3TAGA 4QOZB 4KB1A 4PY5A 3DLGA 4ZTJA 4PWDA 4JS4A 3KIOA 3QESA 4DSLA 3LANA 4OGEA 4BWJA 3KK2A 3SZ2A 2G8WA 4FJKA 2HW3A 2BGGA 2BDPA 4B8AB 5FRMA 4HHTA 4KB0A 4HUGA 2E4LA 1BISA 1J54A 3B6OA 3O3HA 4CGIA 3HM9A 5SWMA 4E1NA 1I3AA 3OS2A 4CJPA 3AVNA 3NF9A 1LAVA 3HJFA 2Q3SA 4ID1A 4CJ3A 2XY5A 1IG9A 1RCHA 3HPOA 1FK9A 2GUIA 4W5QA 1SV5A 2OZMA 3NH0A 4Z4EA 3VQ8A 4HTUA 2KW4A 3SNNA 4AHVA 1VSIA 3NF8A 2F8TA 5C25A 2RPIA 3QERA 3KD5E 3ZT4A 4FJGA 4BE0A 4B9UA 4DFPA 2DFFA 3HYFA 4OJRA 5KRSA 3OS0A 3H08A 4FLZA 4L8RB 1HYSA 4CF9A 4IG3A 3NGYA 2OZSA 4LH5A 1WNSA 1C1AA 2X78A 4H8KA 4NCGA 3OYHA 4DTMA 4OLBA 1RDDA 1S9GA 3DLKA 2AJQA 3SYZA 1D9FA 2PY5A 1C6VA 4KO0A 3NF7A 3F9KA 4J2DA 4CJ5A 1TL1A 1VRUA 3V1RA 2HHQA 1CLQA 3KK3A 1BCOA 4IBNA 4OPKA 1NKCA 3TAFA 2P5OA 4C8KA 5HROA 1VK0A 1RBVA 4FLYA 3AVKA 3P5JA 4CJWA 1UOCA 1VSKA 3QEXA 3VQEA 1T05A 3LAMA 1ZBIA 3MECA 1U48A 4KTZA 2YKNA 4DF4A 1L3VA 4KHQA 3VQ4A 4DQPA 1QS4A 4AH9A 2QXFA 1UA1A 4O5BA 4M3XA 1WAJA 1LV5A 2X6NA 1XWLA 2HB5A 4GVMA 4CEOA 4E7IA 1WSIA 3T1AA 1RT6A 1DTTA 3B6PA 5HBMA 3DOKA 4FJJA 4Z4FA 5K14A 3DLBA 3QNOA 1RT5A 3RRGA 3ASMA 3OJUA 4CJSA 1QTMA 1BIZA 2ITGA 4M41A 5HRRA 1NOYA 4CEEA 3VA0A 4DU1A 2EX3A 4OKEA 1IKXA 1NJYA 3LZJA 4QCLA 2ATQA 1D8YA 4N76A 2OYQA 4NCAA 3M8PA 3TAPA 1KFDA 1J5OA 2HHSA 4KREA 2KFNA 4B08A 3PO5A 2HNYA 2Z1JA 4HCCA 4KRFA 1TKTA 2VWKA 1S1TA 2JGUA 3V1QA 3OYIA 4TSXA 3VQAA 3TAQA 1Y97A 4LSNA 1KCFA 3CYMA 1EETA 1CXUA 5DMRA 4CJUA 3KK1A 4FJNA 2Y1JA 3K5OA 3OYNA 3AVIA 1ASVA 2ZE2A 4KHNA 4Z4IA 1QQCA 3DMJA 2ZQBA 4Z4CA 3JYTA 4E7HA 1DLOA 2YNGA 3D0PA 4CEDA 1NK9A 4FZXC 5CZ2A 5HLFA 2VWJA 4BDZA 4KPYA 1IKWA 4BE2A 1RBSA 3M8SA 5CYQA 3OYCA 3THVA 3S3NA 4B9SA 1HQEA 3LPTA 3AO2A 4JLHA 3L2WA 3QEWA 4DFMA 2BE2A 2WOMA 3BDPA 4KFBA 2YNIA 3AA2A 4I7FA 3OYEA 4DTXA 1REVA 1C0UA 4MFBA 2G8KA 4DTNA 4KHWA 4E7KA 1QSSA 1A5VA 3DOLA 1RDAA 2KQ2A 2Z1IA 1VSFA 3V9ZA 3IG1A 4CJEA 3PUFA 1JL1A 4FM0A 3S3OA 4I2PA 1B9DA 1ASUA 4CESA 1NK6A 4IFVA 3K5LA 4F3TA 3OS1A 4AHSA 3L2RA 3QEIA 4E1MA 3AA5X 3AVFA 1S6QA 3EZ5A 3ZSWA 3OYDA 4FLTA 1JLQA 2VG6A 5J1EA 3VN5A 2D0BA 2HHVA 4FK2A 1RT1A 4FJIA 4BACA 2ZD1A 1ZBHA 3C6UA 5FDLA 1SKRA 2YNFA 3AO1A 1A5XA 4IDKA 3TR8A 3LWLA 4N41A 2B6AA 2XHBA 4DSJA 2D5RA 1L3SA 4FXDA 3AVLA 4E19A 3HPGA 4CHQA 4H4OA 4CEBA 4B9VA 4CFAA 1LW2A 2IC3A 3TARA 2KFZA 4Z4HA 3LDSA 1S9EA 1S6PA 1RTHA 1YTAA 4BWMA 1LWEA 4ZHRA 1ZBUA 4CHOA 4W5TA 4FLWA 4E0DA 1S1WA 4I9QA 2HNDA 1T8EA 1SKWA 4OVLA 2IAJA 3O4QA 3ZSYA 4CHYA 3MXMA 1NKEA 1K6YA 1T03A 1BI4A 3C94A 3AVHA 3HL8A 4DSFA 3T3FA 4FJ7A 3VQ9A 4C8MA 1NJWA 3CQ8A 4DFJA 5J2QA 1ZYQA 3NE6A 3ZT0A 4RW7A 4EZ9A 4N47A 3K57A 1HRHA 3IS9A 4CERA 4DQSA 3FFIA 4Z0UA 4FW2A 1BGXT 1S1UA 4RG8A 4EP5A 3CG7A 2RF2A 2KZZA 2E6LA 3M8QA 3OYJA 3T19A 3V9WA 5E41A 3V4IA 1FKPA 3KLFA 1EXQA 1JXEA 1S5JA 2ETJA 1B9FA 3HPHA 4KV8A 4JRQA 3DYAA 1IO2A 4FVMA 1TKDA 2YKMA 3SV3A 1YVUA 4CCHA 3KD1E 4M42A 5HRNA 4BE1A 5JS1A 1BQMA 3V9XA 4FJ8A 3OYAA 3KLGA 1RT7A 4FM2A 4CGJA 3DRRA 4HUFA 4M3UA 1QSLA 2O4IA 2F96A 1JLBA 4AILC 3SUPA 2I5JA 1EKEA 1Q8IA 4IG0A 1JLFA 4DS4A 3DLHA 3UIQA 3NGZA 1IKVA 3LP3A 4CF1A 3KKRA 4O55A 3ZSOA 2PZSA 4OKJA 3PY8A 4CF0A 1KVAA 1VSJA 3HP9A 1EP4A 1LAWA 1TKZA 2NUBA 3U3GA 3LPUA 4CJQA 1J53A 2YV0X 4DQQA 4ID5A 1HMVA 4QAGA 1UWBA 2DFEA 1BQNA 3RMDA 5I42A 1SL2A 3SI6A 1XI1A 3AV9A 3SQ1A 3V1OA 1RT3A 3TANA 4KAZA 4RW4A 4UQGA 1F21A 2YHBA 3C95A 5HP1A 4B3OA 3C6TA 4CF2A 3RMBA 1U4BA 3QNNA 4BDPA 5HRSA 1UA0A 1WSHA 4RW6A 3NF6A 2G8HA 3CM6A 1GOBA 4B9MA 3KTQA 4E3SA 4KI6A 4IKFA 2B5JA 2Z1GA 1RBUA 1ZBLA 4DQIA 2JLEA 3HVTA 3L8BA 1X9SA 3A2FA 2B4JA 4G1QA 1X9MA 4AHTA 1LWFA 4CIGA 3HO1A 2Z1HA 4CEZA 4YFUA 3NDKA 1VSEA 3ULDA 2HVHA 4CEAA 2OPQA 1JLEA 4FJ9A 3HXMA 1S1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZI A;  3SPZ A;  4Y1D A;  4PQU A;  4H4M A;  4J2E A;  3D45 A;  3SUN A;  2IS3 A;  4MQ3 A;  1TKX A;  1NJX A;  3RMC A;  1DTQ A;  3DLR A;  3V81 A;  3NCI A;  3NH1 A;  1HJR A;  4O0I A;  3K5N A;  4ICL A;  1VSL A;  4M3R A;  1Z26 A;  4CIF A;  4HCB A;  2D0A A;  5KTQ A;  2P1J A;  4KKO A;  4CJT A;  4W5O A;  1RBR A;  1TL3 A;  3K5M A;  1Q9Y A;  1SUQ A;  1VRT A;  5KGX A;  1X9W A;  3VQQ A;  3I0R A;  2IDO A;  1B92 A;  3AO5 A;  4KTW A;  5C42 A;  1NK0 A;  2XY7 A;  2KTQ A;  1RNH A;  1JLG A;  4DFK A;  2YNH A;  3ITH A;  4FZZ A;  1TVR A;  3LP0 A;  1JLC A;  4GW6 A;  3VQ7 A;  5FRN A;  4CEF A;  4DSI A;  1IKY A;  1TGO A;  4CK2 A;  3OYM A;  3HP6 A;  3L2U A;  3SCX A;  4AHC A;  1U49 A;  2HNZ A;  1NK7 A;  3TWH A;  3SUQ A;  4FCY A;  4F2S A;  3PX4 A;  1WSJ A;  2X74 A;  3SPY A;  2RKI A;  3SQ0 A;  3BGR A;  1JXB A;  3TI0 A;  4LY7 A;  1HNI A;  3SQ2 A;  3KLE A;  1CXQ A;  3TAB A;  3QEV A;  3SUO A;  1TK8 A;  5J2P A;  3DI6 A;  1VSH A;  4CGG A;  4CIE A;  1U45 A;  5KI6 A;  2A1R A;  4FYD A;  3ZSX A;  3K2P A;  3NGI A;  4Z4G A;  3I8D A;  3K58 A;  3NAE A;  3G10 A;  1L3T A;  2GV9 A;  2FBT A;  3L2Q A;  4I9L A;  4EP4 A;  4DTJ A;  5J2M A;  1LW0 A;  1WSE A;  4B9L A;  4KI4 A;  4DF8 A;  2R7Y A;  3QIO A;  1RTI A;  1I39 A;  3S3M A;  2G8V A;  3KLI A;  3PX6 A;  3TAE A;  4K8X A;  4B9N A;  4J2B A;  4F8R A;  3U3Y A;  3MED A;  3VQP A;  1NK5 A;  1D9D A;  2HMI A;  3NFA A;  4EZ6 A;  3NHG A;  4DU4 A;  4CFB A;  4O0J A;  3AO4 A;  1WLJ A;  3U6F A;  4CE9 A;  1VSM A;  3EY1 A;  4M3Z A;  2XO7 A;  3DLE A;  2VG5 A;  4F4K A;  3VQD A;  1KVC A;  1RBT A;  2P51 A;  4DLG A;  5D3G A;  1BIU A;  3MXI A;  1KTQ A;  4OKK A;  3CFP A;  4Q0B A;  3ISN C;  1LWC A;  4B8C A;  3PO4 A;  4DTR A;  1JLA A;  5KGW A;  1QE1 A;  1JKH A;  4DTP A;  3AA4 A;  4R5P A;  4CGH A;  2XY6 A;  2Y1I A;  3RMA A;  4IFY A;  4M3T A;  1C0M A;  1W0H A;  4LD0 A;  4LSL A;  3MEE A;  3DRP A;  2D0C A;  1MU2 A;  2X6S A;  4E7J A;  4DTU A;  3VQ6 A;  2QKB A;  3AVG A;  3CFO A;  1FKO A;  4FJX A;  1TK0 A;  2DY4 A;  4OPJ A;  4OGC A;  2E6M A;  1RTD A;  4ELV A;  2HVI A;  1RTJ A;  4C8N A;  3QET A;  3ZT1 A;  1S1X A;  3V6D A;  5CY4 A;  3K59 A;  3AVM A;  4CHP A;  1BL3 A;  1GOA A;  4CJR A;  3OYL A;  1BCM A;  3AA3 A;  3F73 A;  4CJK A;  4CFC A;  1QSY A;  1D5A A;  1HNV A;  4DTO A;  3OYG A;  3ZSZ A;  4DMN A;  3O3G A;  3JSM A;  3RR7 A;  1XHZ A;  4DS5 A;  1BI4 B;  3KKS A;  4FLX A;  3QO9 A;  2YHA A;  4F3O A;  1RDC A;  1L3U A;  4DSK A;  1JL2 A;  4PA1 A;  1RT2 A;  4RW9 A;  4O44 A;  1HYV A;  3ZSR A;  3O3F A;  4FLU A;  4DWI A;  1ITG A;  1NJZ A;  4M45 A;  3IAY A;  3VQB A;  1KSP A;  3RTV A;  4KTQ A;  3L2V A;  4CK3 A;  3AVA A;  3P1G A;  5DK5 A;  4DSE A;  2DTU A;  1C1B A;  4KHU A;  5HRP A;  4KHS A;  5J2N A;  2FC0 A;  4O4G A;  1TK5 A;  2XRI A;  3MEG A;  3CFR A;  1Z25 A;  4RW8 A;  1TAQ A;  3S9H A;  1HYZ A;  2FBY A;  3PV8 A;  3OYB A;  2OPR A;  1HPZ A;  4DLE A;  4DU3 A;  3WNH A;  1SKS A;  4ELT A;  4PUO A;  4FK4 A;  3OJS A;  1XHX A;  3AVB A;  4FJH A;  3HT3 A;  3RR8 A;  4HUE A;  4GMJ B;  2HHU A;  4W5N A;  1WAF A;  3NH2 A;  1RDB A;  2WON A;  2KZM A;  5C24 A;  2QKK A;  3AO3 A;  3ZT3 A;  1X1P A;  4CJ4 A;  3LP2 A;  4Y1C A;  4E89 A;  3MXJ A;  1IH7 A;  4JS5 A;  3I0S A;  2BAN A;  2FBX A;  4E7L A;  4YNQ A;  4FLV A;  3CM5 A;  4FJL A;  5SZT A;  3RWU A;  3G0Z A;  3O4N A;  5JS2 A;  3EYZ A;  4C8O A;  1XC9 A;  3QIP A;  1T7P A;  4FZY A;  5CYM A;  4K8Z A;  4FW1 A;  4BDY A;  1WSF A;  1EX4 A;  3QLH A;  2G8U A;  2PYJ A;  4F2R A;  3QIN A;  3OYF A;  2IOC A;  2OPP A;  2O4G A;  1KLM A;  4HVJ A;  4N56 A;  1CZB A;  2GBZ A;  4ZTF A;  1SL0 A;  3WNE A;  1KVB A;  1UAX A;  3RRH A;  3LWM A;  4WE1 A;  1NKB A;  3M8R A;  2F8S A;  4DTS A;  3LAK A;  3KJV A;  3LP1 A;  1BHL A;  3P83 D;  2OPS A;  4CGD A;  5KRT A;  1L5U A;  4B9T A;  3ZSQ A;  1ZBF A;  2G8I A;  4M3W A;  3L3V A;  4DQR A;  4CGF A;  1N6Q A;  2EHG A;  4AHU A;  4I2Q A;  3SV4 A;  3VA3 A;  3SJJ A;  4CHN A;  4M3Y A;  1NOZ A;  1O1W A;  2XY8 A;  1G15 A;  4FK0 A;  1NK4 A;  2RN2 A;  5EU7 A;  3WNG A;  3E01 A;  4CF8 A;  4CEC A;  3ZT2 A;  3OYK A;  1WN7 A;  1R0A A;  4C8L A;  1FXX A;  3DM2 A;  4J2A A;  2G8F A;  1C0T A;  3SQ4 A;  4AHR A;  2IGI A;  3HST B;  4NCB A;  4Q5V A;  3DRS A;  4FM1 A;  1A5W A;  3WNF A;  1NK8 A;  4FJM A;  1TV6 A;  3TAM A;  1WSG A;  2OA8 A;  3HK2 A;  1ASW A;  4CJF A;  3HVR A;  3L3U A;  5CZ1 A;  3V9S A;  1VSD A;  1U47 A;  2HHW A;  1KRP A;  4DG1 A;  5I3U A;  4CJV A;  1RT4 A;  1GOC A;  4W5R A;  3ALY A;  1N5Y A;  3OY9 A;  3ZCM A;  3V9U A;  2A1S A;  4CK1 A;  3MAQ A;  4LH4 A;  4CEQ A;  1SL1 A;  2W42 A;  1U04 A;  2DFH A;  2LSN A;  2VG7 A;  2FBV A;  5T7B A;  4FJ5 A;  1YTU A;  1KFS A;  1W9H A;  1YT3 A;  3VQC A;  2HHT A;  2HHX A;  1TAU A;  3OVN A;  3VQ5 A;  4N5S A;  2PYL A;  1CZ9 A;  1J9A A;  4ELU A;  3NBP A;  4NYF A;  3QEP A;  1KLN A;  3AVC A;  1Q9X A;  2P5G A;  4CJL A;  1C1C A;  1RIL A;  3IRX A;  3PX0 A;  3ZSV A;  3KLH A;  2QK9 A;  4JRP A;  4OLA A;  1QHT A;  4KHY A;  3LAL A;  4NYN A;  4CHZ A;  4XIU A;  1HQU A;  3AVJ A;  4CFD A;  5FRO A;  3TAG A;  4QOZ B;  4KB1 A;  4PY5 A;  3DLG A;  4ZTJ A;  4PWD A;  4JS4 A;  3KIO A;  3QES A;  4DSL A;  3LAN A;  4OGE A;  4BWJ A;  3KK2 A;  3SZ2 A;  2G8W A;  4FJK A;  2HW3 A;  2BGG A;  2BDP A;  4B8A B;  5FRM A;  4HHT A;  4KB0 A;  4HUG A;  2E4L A;  1BIS A;  1J54 A;  3B6O A;  3O3H A;  4CGI A;  3HM9 A;  5SWM A;  4E1N A;  1I3A A;  3OS2 A;  4CJP A;  3AVN A;  3NF9 A;  1LAV A;  3HJF A;  2Q3S A;  4ID1 A;  4CJ3 A;  2XY5 A;  1IG9 A;  1RCH A;  3HPO A;  1FK9 A;  2GUI A;  4W5Q A;  1SV5 A;  2OZM A;  3NH0 A;  4Z4E A;  3VQ8 A;  4HTU A;  2KW4 A;  3SNN A;  4AHV A;  1VSI A;  3NF8 A;  2F8T A;  5C25 A;  2RPI A;  3QER A;  3KD5 E;  3ZT4 A;  4FJG A;  4BE0 A;  4B9U A;  4DFP A;  2DFF A;  3HYF A;  4OJR A;  5KRS A;  3OS0 A;  3H08 A;  4FLZ A;  4L8R B;  1HYS A;  4CF9 A;  4IG3 A;  3NGY A;  2OZS A;  4LH5 A;  1WNS A;  1C1A A;  2X78 A;  4H8K A;  4NCG A;  3OYH A;  4DTM A;  4OLB A;  1RDD A;  1S9G A;  3DLK A;  2AJQ A;  3SYZ A;  1D9F A;  2PY5 A;  1C6V A;  4KO0 A;  3NF7 A;  3F9K A;  4J2D A;  4CJ5 A;  1TL1 A;  1VRU A;  3V1R A;  2HHQ A;  1CLQ A;  3KK3 A;  1BCO A;  4IBN A;  4OPK A;  1NKC A;  3TAF A;  2P5O A;  4C8K A;  5HRO A;  1VK0 A;  1RBV A;  4FLY A;  3AVK A;  3P5J A;  4CJW A;  1UOC A;  1VSK A;  3QEX A;  3VQE A;  1T05 A;  3LAM A;  1ZBI A;  3MEC A;  1U48 A;  4KTZ A;  2YKN A;  4DF4 A;  1L3V A;  4KHQ A;  3VQ4 A;  4DQP A;  1QS4 A;  4AH9 A;  2QXF A;  1UA1 A;  4O5B A;  4M3X A;  1WAJ A;  1LV5 A;  2X6N A;  1XWL A;  2HB5 A;  4GVM A;  4CEO A;  4E7I A;  1WSI A;  3T1A A;  1RT6 A;  1DTT A;  3B6P A;  5HBM A;  3DOK A;  4FJJ A;  4Z4F A;  5K14 A;  3DLB A;  3QNO A;  1RT5 A;  3RRG A;  3ASM A;  3OJU A;  4CJS A;  1QTM A;  1BIZ A;  2ITG A;  4M41 A;  5HRR A;  1NOY A;  4CEE A;  3VA0 A;  4DU1 A;  2EX3 A;  4OKE A;  1IKX A;  1NJY A;  3LZJ A;  4QCL A;  2ATQ A;  1D8Y A;  4N76 A;  2OYQ A;  4NCA A;  3M8P A;  3TAP A;  1KFD A;  1J5O A;  2HHS A;  4KRE A;  2KFN A;  4B08 A;  3PO5 A;  2HNY A;  2Z1J A;  4HCC A;  4KRF A;  1TKT A;  2VWK A;  1S1T A;  2JGU A;  3V1Q A;  3OYI A;  4TSX A;  3VQA A;  3TAQ A;  1Y97 A;  4LSN A;  1KCF A;  3CYM A;  1EET A;  1CXU A;  5DMR A;  4CJU A;  3KK1 A;  4FJN A;  2Y1J A;  3K5O A;  3OYN A;  3AVI A;  1ASV A;  2ZE2 A;  4KHN A;  4Z4I A;  1QQC A;  3DMJ A;  2ZQB A;  4Z4C A;  3JYT A;  4E7H A;  1DLO A;  2YNG A;  3D0P A;  4CED A;  1NK9 A;  4FZX C;  5CZ2 A;  5HLF A;  2VWJ A;  4BDZ A;  4KPY A;  1IKW A;  4BE2 A;  1RBS A;  3M8S A;  5CYQ A;  3OYC A;  3THV A;  3S3N A;  4B9S A;  1HQE A;  3LPT A;  3AO2 A;  4JLH A;  3L2W A;  3QEW A;  4DFM A;  2BE2 A;  2WOM A;  3BDP A;  4KFB A;  2YNI A;  3AA2 A;  4I7F A;  3OYE A;  4DTX A;  1REV A;  1C0U A;  4MFB A;  2G8K A;  4DTN A;  4KHW A;  4E7K A;  1QSS A;  1A5V A;  3DOL A;  1RDA A;  2KQ2 A;  2Z1I A;  1VSF A;  3V9Z A;  3IG1 A;  4CJE A;  3PUF A;  1JL1 A;  4FM0 A;  3S3O A;  4I2P A;  1B9D A;  1ASU A;  4CES A;  1NK6 A;  4IFV A;  3K5L A;  4F3T A;  3OS1 A;  4AHS A;  3L2R A;  3QEI A;  4E1M A;  3AA5 X;  3AVF A;  1S6Q A;  3EZ5 A;  3ZSW A;  3OYD A;  4FLT A;  1JLQ A;  2VG6 A;  5J1E A;  3VN5 A;  2D0B A;  2HHV A;  4FK2 A;  1RT1 A;  4FJI A;  4BAC A;  2ZD1 A;  1ZBH A;  3C6U A;  5FDL A;  1SKR A;  2YNF A;  3AO1 A;  1A5X A;  4IDK A;  3TR8 A;  3LWL A;  4N41 A;  2B6A A;  2XHB A;  4DSJ A;  2D5R A;  1L3S A;  4FXD A;  3AVL A;  4E19 A;  3HPG A;  4CHQ A;  4H4O A;  4CEB A;  4B9V A;  4CFA A;  1LW2 A;  2IC3 A;  3TAR A;  2KFZ A;  4Z4H A;  3LDS A;  1S9E A;  1S6P A;  1RTH A;  1YTA A;  4BWM A;  1LWE A;  4ZHR A;  1ZBU A;  4CHO A;  4W5T A;  4FLW A;  4E0D A;  1S1W A;  4I9Q A;  2HND A;  1T8E A;  1SKW A;  4OVL A;  2IAJ A;  3O4Q A;  3ZSY A;  4CHY A;  3MXM A;  1NKE A;  1K6Y A;  1T03 A;  1BI4 A;  3C94 A;  3AVH A;  3HL8 A;  4DSF A;  3T3F A;  4FJ7 A;  3VQ9 A;  4C8M A;  1NJW A;  3CQ8 A;  4DFJ A;  5J2Q A;  1ZYQ A;  3NE6 A;  3ZT0 A;  4RW7 A;  4EZ9 A;  4N47 A;  3K57 A;  1HRH A;  3IS9 A;  4CER A;  4DQS A;  3FFI A;  4Z0U A;  4FW2 A;  1BGX T;  1S1U A;  4RG8 A;  4EP5 A;  3CG7 A;  2RF2 A;  2KZZ A;  2E6L A;  3M8Q A;  3OYJ A;  3T19 A;  3V9W A;  5E41 A;  3V4I A;  1FKP A;  3KLF A;  1EXQ A;  1JXE A;  1S5J A;  2ETJ A;  1B9F A;  3HPH A;  4KV8 A;  4JRQ A;  3DYA A;  1IO2 A;  4FVM A;  1TKD A;  2YKM A;  3SV3 A;  1YVU A;  4CCH A;  3KD1 E;  4M42 A;  5HRN A;  4BE1 A;  5JS1 A;  1BQM A;  3V9X A;  4FJ8 A;  3OYA A;  3KLG A;  1RT7 A;  4FM2 A;  4CGJ A;  3DRR A;  4HUF A;  4M3U A;  1QSL A;  2O4I A;  2F96 A;  1JLB A;  4AIL C;  3SUP A;  2I5J A;  1EKE A;  1Q8I A;  4IG0 A;  1JLF A;  4DS4 A;  3DLH A;  3UIQ A;  3NGZ A;  1IKV A;  3LP3 A;  4CF1 A;  3KKR A;  4O55 A;  3ZSO A;  2PZS A;  4OKJ A;  3PY8 A;  4CF0 A;  1KVA A;  1VSJ A;  3HP9 A;  1EP4 A;  1LAW A;  1TKZ A;  2NUB A;  3U3G A;  3LPU A;  4CJQ A;  1J53 A;  2YV0 X;  4DQQ A;  4ID5 A;  1HMV A;  4QAG A;  1UWB A;  2DFE A;  1BQN A;  3RMD A;  5I42 A;  1SL2 A;  3SI6 A;  1XI1 A;  3AV9 A;  3SQ1 A;  3V1O A;  1RT3 A;  3TAN A;  4KAZ A;  4RW4 A;  4UQG A;  1F21 A;  2YHB A;  3C95 A;  5HP1 A;  4B3O A;  3C6T A;  4CF2 A;  3RMB A;  1U4B A;  3QNN A;  4BDP A;  5HRS A;  1UA0 A;  1WSH A;  4RW6 A;  3NF6 A;  2G8H A;  3CM6 A;  1GOB A;  4B9M A;  3KTQ A;  4E3S A;  4KI6 A;  4IKF A;  2B5J A;  2Z1G A;  1RBU A;  1ZBL A;  4DQI A;  2JLE A;  3HVT A;  3L8B A;  1X9S A;  3A2F A;  2B4J A;  4G1Q A;  1X9M A;  4AHT A;  1LWF A;  4CIG A;  3HO1 A;  2Z1H A;  4CEZ A;  4YFU A;  3NDK A;  1VSE A;  3ULD A;  2HVH A;  4CEA A;  2OPQ A;  1JLE A;  4FJ9 A;  3HXM A;  1S1V A; 
#chains in the Genus database with same CATH topology
 4Y1D A;  4H4M A;  4LF8 K;  2GEM A;  3CCE N;  2UUB K;  3DLR A;  3V81 A;  3NCI A;  1NU0 A;  3NH1 A;  2UXC K;  2IIR A;  3GG4 A;  3M3Z A;  4M3R A;  3MCA B;  1BG3 A;  2BTF A;  4CIF A;  5KTQ A;  4FJ8 A;  1SUQ A;  3VQQ A;  1B92 A;  2KTQ A;  1JLG A;  2VWB A;  3ITH A;  4A5A A;  3VF4 A;  3JS6 A;  4KBO A;  4GW6 A;  1U2V B;  4EIA A;  3E9P A;  1CZA N;  4CK2 A;  3CCM N;  5ELZ A;  4LFB K;  3L2U A;  3TPQ A;  3CQX A;  2HNZ A;  3PIP L;  3EO3 A;  3SUQ A;  3E9O A;  3PX4 A;  1TUY A;  3TI0 A;  4LF9 K;  3BGR A;  4LY7 A;  3WT0 A;  3KLE A;  3TAB A;  1QQO A;  3SUO A;  3C6H A;  4CGG A;  5KI6 A;  3I8D A;  5BRE A;  4KH6 A;  1L3T A;  4YOX A;  1WBD A;  5AQU A;  4I9L A;  2P9N B;  1S72 N;  4B9L A;  4KI4 A;  3QIO A;  4JKH A;  1I39 A;  3S3M A;  2G8V A;  3KLI A;  3TAE A;  4B9N A;  3RVC A;  1N33 K;  3MED A;  1NK5 A;  2HMI A;  4GVE A;  2ASO A;  3AO4 A;  4MLH A;  5AQZ A;  3EKU A;  4LC9 B;  2XO7 A;  2VG5 A;  4JI6 K;  5D3G A;  2IVP A;  4HTL A;  1K73 O;  2CH6 A;  4FWK A;  4NXN K;  4ILJ A;  4CGH A;  3CXC M;  4FWR A;  3H3N O;  3MEE A;  1GLC G;  3SMS A;  4E7J A;  3ULE A;  4DTU A;  2QKB A;  2QEX N;  1ZXO A;  5EVZ A;  4FJX A;  1NGA A;  1VQ8 N;  2DY4 A;  4BG8 A;  2HHH K;  4C8N A;  3LDL A;  4DHY A;  3FGU A;  2O8D A;  1GOA A;  4CJR A;  1QSY A;  1BA1 A;  4DV0 K;  3RR7 A;  1HKC A;  2ZM6 K;  4FWO A;  3KKS A;  4H03 B;  4F3O A;  4C1N I;  2ZJR L;  3AAR A;  4BGA A;  1JL2 A;  1RT2 A;  4IJA A;  1XMQ K;  1E4F T;  4YOR A;  1GLD G;  4DWI A;  1FJG K;  1ITG A;  1NJZ A;  2UUA K;  3IAY A;  4FPA A;  5F2R A;  5BN8 A;  3L2V A;  5DK5 A;  4DSE A;  2DTU A;  4RTF D;  4KHU A;  3T1Y K;  4KHS A;  5J2N A;  3A5N C;  3CFR A;  1OVY A;  2F9W A;  4RW8 A;  5AQH A;  2OPR A;  4JD2 A;  3BZC A;  1QVG M;  3G71 N;  4H5V A;  1XHX A;  3AVB A;  4DR2 K;  4GMJ B;  5CHI A;  2KZM A;  4L3Q A;  5C24 A;  3CPW M;  2QKK A;  2UYT A;  1X1P A;  3CHW A;  3MXJ A;  2FBX A;  3E9L A;  1V4S A;  5SZT A;  3O4N A;  4C8O A;  1XC9 A;  4K8Z A;  4FW1 A;  1WSF A;  3QLH A;  1NGD A;  4JK7 A;  4F2R A;  3RSE B;  2O4G A;  5LJW A;  1CZB A;  4ZTF A;  1SL0 A;  4G9Z A;  3FR0 A;  4WE1 A;  1S3X A;  2QXL A;  3LP1 A;  4CGD A;  2A41 A;  1L5U A;  5AQM A;  2NRX A;  4M3W A;  4IO9 L;  3U4L A;  3SV4 A;  4CHN A;  3ZET A;  1O1W A;  4FK0 A;  4B3M K;  2NLX A;  4CF8 A;  1R0A A;  2NRR A;  1C0T A;  4H5W A;  4K0K K;  4Q5V A;  4H0X B;  3DXM A;  3G25 A;  4IOA L;  1SAZ A;  4FJM A;  5KPR A;  1WSG A;  1ASW A;  1QVF M;  4W5R A;  1N5Y A;  4NLC A;  4CK1 A;  3MAQ A;  2DFH A;  2FBV A;  2BUP A;  2KKZ A;  4IEI A;  1TAU A;  1KQS M;  2PYL A;  1CZ9 A;  3OBY A;  4B1Z A;  3NBP A;  4NYF A;  2P9U A;  1Q9X A;  2NNW A;  2QK9 A;  3CCV N;  3LAL A;  2W40 A;  1U6Z A;  4XIU A;  3D2E A;  3CJ7 A;  4BR2 A;  3HBT A;  1X3N A;  4KB1 A;  1BUP A;  4PY5 A;  3DLG A;  4ZTJ A;  4JS4 A;  3KIO A;  4DSL A;  4BWJ A;  5F0X A;  1O13 A;  2E4L A;  2E1Y A;  1J54 A;  3O3H A;  4CGI A;  3HM9 A;  3L0Q A;  1I3A A;  3OS2 A;  1VQK N;  3AVN A;  3FLC O;  4WCE L;  4CJ3 A;  3HPO A;  2GUI A;  4WQ4 A;  3NH0 A;  1NMD A;  3SNN A;  4C1N K;  5JLF A;  5C25 A;  3QER A;  4FJG A;  1BDG A;  4BE0 A;  4DFP A;  3H08 A;  4CF9 A;  4LH5 A;  5EXW A;  3OBW A;  1C1A A;  5AZJ B;  2GEL A;  3OYH A;  4H0P A;  3VTI A;  1RDD A;  3DLK A;  4FO0 A;  3SYZ A;  3P39 A;  3CMA N;  4JI7 K;  3I56 N;  2HHQ A;  3KK3 A;  1BCO A;  3LDQ A;  4C8K A;  3TAF A;  3CPE A;  5EX5 A;  3LAM A;  1ZBI A;  1U48 A;  4DF4 A;  4KHQ A;  4PL8 A;  5AQW A;  4AH9 A;  1UA1 A;  1WSI A;  1RT6 A;  3B6P A;  3DOK A;  4Z4F A;  3DLB A;  3RRG A;  3ASM A;  3OJU A;  1QTM A;  2YCH A;  2ITG A;  3AY9 A;  2EX3 A;  1V4T A;  3LZJ A;  4NCA A;  3TAP A;  2HHS A;  1KFD A;  3N4P A;  4KRE A;  1HKB A;  3A5O C;  5E26 A;  4B08 A;  3PO5 A;  2Z1J A;  4QS9 A;  2VWK A;  4H0V B;  3EE8 A;  3O9S A;  3CYM A;  5DMR A;  2E2N A;  4FJN A;  3K5O A;  5AQL A;  4JKG B;  1ASV A;  1QQC A;  2ZQB A;  1DLO A;  1IKW A;  3SBT A;  3M8S A;  5CYQ A;  2GWK A;  2E20 A;  3LPT A;  3O08 A;  4CW7 B;  2WOM A;  4DV7 K;  3DXK B;  4KFB A;  3OYE A;  3ZYY X;  2Q0U A;  5AQJ A;  3H45 C;  3HOS A;  4DTN A;  1XNQ K;  1YJN N;  4BRP A;  1QSS A;  3DOL A;  3V9Z A;  4JV5 K;  4CJE A;  1ASU A;  4IFV A;  2P9I A;  4UY8 O;  4F3T A;  4AHS A;  2WUS A;  5DM6 L;  3EZ5 A;  3VOV A;  4WQ5 C;  4BAC A;  4H5R A;  1ZBH A;  3C6U A;  4MO5 A;  1SKR A;  1Y64 A;  4N41 A;  4GV3 A;  2D5R A;  3KWI A;  4FXD A;  3EEQ A;  3T1H K;  2IC3 A;  4WFA L;  4Z4H A;  3LDS A;  3VES A;  1S9E A;  1LWE A;  4ZHR A;  3CQY A;  1SKW A;  3O4Q A;  1K6Y A;  1T03 A;  3SJH A;  3Q7C A;  4FWQ A;  4DFJ A;  3VGM A;  4RW7 A;  4N47 A;  2HBM A;  3K57 A;  3D7E O;  3NVM A;  4Z0U A;  1S1U A;  4RG8 A;  3CG7 A;  2RF2 A;  3G6E N;  2KZZ A;  3M8Q A;  5AQR A;  4GV6 A;  3OYJ A;  4JKA A;  4BG9 A;  3T19 A;  5AZI A;  1OH6 A;  1NGJ A;  3EL2 A;  3ZEU B;  3V4I A;  1JXE A;  1B9F A;  3HPH A;  3DYA A;  1TKD A;  5JS1 A;  4BVO A;  3OYA A;  3GE1 A;  3DRR A;  3LL3 A;  4BRE A;  4AIL C;  1EKE A;  3MN7 A;  4DS4 A;  1JLF A;  4K43 A;  1KAY A;  3S41 A;  2IVO A;  2W6K A;  2OAN A;  2PZS A;  3O9R A;  4CF0 A;  1VSJ A;  1QQN A;  3MN6 A;  4EHU A;  4FPB A;  1TKZ A;  3U3G A;  4DB3 A;  1VQP N;  1XI1 A;  3R6M A;  3BZK A;  3SQ1 A;  3TAN A;  1U4B A;  5HRS A;  1UA0 A;  3W0L A;  3JAM O;  1Z6R A;  1KC8 O;  5GAH P;  5GAD P;  4IKF A;  2B5J A;  1ZBL A;  2JLE A;  4K42 A;  2B4J A;  4H5N A;  2Z1H A;  4X62 K;  1VSE A;  3I8B A;  3ULD A;  2OPQ A;  4FJ9 A;  1RGI A;  1WBB A;  4PQU A;  2E2P A;  3VGL A;  1XC3 A;  3D45 A;  4MQ3 A;  1NGI A;  4BQL A;  1NJX A;  4H5T A;  4CJ7 A;  3RMC A;  4PKH A;  3CF5 L;  4DR1 K;  4CBW A;  2QWO A;  4ICL A;  3LDO A;  2YJF A;  3K5M A;  2P1J A;  2E1Z A;  2JWK A;  3AO5 A;  5C42 A;  2PAV A;  1W97 L;  1RNH A;  3MDQ A;  4DFK A;  2QWM A;  5AQN A;  3LP0 A;  2P9S B;  4PKI A;  1ATS A;  2VGM A;  4DR6 K;  3VQ7 A;  2AA4 A;  1IBM K;  3HP6 A;  3C7N B;  3VGK A;  2RE2 A;  3SCX A;  4AHC A;  3TWH A;  4FCY A;  5I9E B;  2RKI A;  1XUP O;  2ITM A;  1HNI A;  2DPN A;  3QEV A;  5J2P A;  1VSH A;  4CD1 A;  3NGI A;  4BRO A;  4K41 A;  3P38 A;  3L2Q A;  3THW A;  1WSE A;  3HI0 A;  3HRG A;  1RTI A;  4K8X A;  1SQK A;  4YDU C;  4EFH A;  4J2B A;  4DR5 K;  3NFA A;  4M7Y A;  3NHG A;  2HBJ A;  3VMF B;  4DU4 A;  3CCJ N;  1WLJ A;  3U6F A;  3EY1 A;  4IZ9 A;  4WYB A;  4F4K A;  4Z94 A;  1KVC A;  1RBT A;  4O8U A;  5C10 A;  4FVU A;  3CFP A;  4Q0B A;  3ISN C;  4B8C A;  4FOI A;  1DEJ A;  2XY6 A;  3QBX A;  4DTP A;  3RMA A;  4BR9 A;  2Y1I A;  4M3T A;  4IFY A;  3SAF A;  1C0M A;  1T6C A;  4YOW A;  1HLU A;  4IXC A;  1MU2 A;  2X6S A;  4B1V A;  2F9T A;  4IO8 A;  3VQ6 A;  3GL1 A;  1TK0 A;  3THX A;  1RTD A;  2E6M A;  3O1B A;  4JKD A;  3K59 A;  4OPH A;  1VQ6 N;  4CFC A;  1HNV A;  4DTO A;  3LM2 A;  3JSM A;  2HBK A;  3W3D A;  5KQD A;  3HOT A;  3QO9 A;  4RW9 A;  1BWF O;  3J8A A;  4M45 A;  3VQB A;  1VAZ A;  1KSP A;  4KTQ A;  3KWG A;  3QDK A;  3P1G A;  4CK3 A;  3CCS N;  1VQM N;  1C1B A;  5HRP A;  5C2F A;  2FC0 A;  3PSI A;  3MEG A;  3WQU A;  1Z25 A;  1TAQ A;  3S9H A;  1QHA A;  4DU3 A;  3WNH A;  4FK4 A;  4CZJ A;  3P31 A;  3RR8 A;  4HUE A;  4W5N A;  3CME N;  2E8A A;  3G4S N;  1RDB A;  2WON A;  4DKW A;  2FSK A;  4B3S K;  2H3G X;  2A1R A;  2E2O A;  2ASP A;  4Y1C A;  1EWR A;  4JS5 A;  3I0S A;  4YNQ A;  4FJL A;  3CM5 A;  3G0Z A;  4DV3 K;  5CYM A;  3FFK B;  4JI8 K;  1EX4 A;  4DR4 K;  2VCP A;  3GBT A;  2QWQ A;  4B1Y B;  2PYJ A;  2IOC A;  3UKR A;  2GBZ A;  3WNE A;  4BQZ A;  4BRK A;  3RRH A;  1NKB A;  2F8S A;  4AM7 A;  3PIO L;  3M8R A;  2P9K A;  3VPZ A;  2G8I A;  1ZBF A;  3THY B;  3H1V X;  4CGF A;  4E1J A;  1JCF A;  4M3Y A;  2NRW A;  4JD2 B;  3WNG A;  3E01 A;  3OYK A;  4JI4 K;  3ZT2 A;  3DM2 A;  4J2A A;  4BRQ A;  3SQ4 A;  4BRH A;  3HM8 A;  4FM1 A;  2V7Z A;  4CD3 A;  3HK2 A;  5BRD A;  4A61 A;  3HVR A;  1VSD A;  4CJV A;  3ALY A;  3H1Q A;  5GIO A;  3IKM A;  3EE9 A;  5CE3 A;  5T7B A;  2O8F A;  2LSN A;  2VG7 A;  4FJ5 A;  5JLH A;  2HHT A;  3VQC A;  2HHX A;  3OVN A;  3VQ5 A;  3FZF A;  3UKU A;  3QEP A;  4CJL A;  1C1C A;  1RIL A;  2UXB K;  3KLH A;  4JRP A;  4OLA A;  4CHZ A;  1HQU A;  3AVJ A;  4CFD A;  3TAG A;  1WB9 A;  3KHY A;  2G8W A;  4IWV A;  3O8M A;  5FRM A;  4A5B A;  4HHT A;  5SWM A;  3CCQ N;  1GLL O;  1K8A O;  1XQS C;  1VQL N;  1RCH A;  1FK9 A;  2D0O A;  4JI2 K;  1SV5 A;  3D6R A;  2J4R A;  4BRL A;  2F8T A;  2RPI A;  1YVN A;  3ZT4 A;  4B9U A;  3HYF A;  1RDW X;  4L8R B;  1HYS A;  2P9L B;  2W6L A;  1Q82 O;  2E5L K;  2OZS A;  1N34 K;  4H0T B;  4H8K A;  5BPL A;  2UUC K;  4NCG A;  4OLB A;  2AJQ A;  2PY5 A;  1NGF A;  3O6W A;  4J2D A;  5LMN K;  4M63 C;  1ZBS A;  4OPK A;  2P5O A;  5HRO A;  4FLY A;  3AVK A;  3P5J A;  1P8Z A;  1UOC A;  3QEX A;  3VQE A;  5M1Q A;  3VQ4 A;  2UXD K;  2QXF A;  1WAJ A;  1LV5 A;  2X6N A;  5GIN A;  1XWL A;  4GVM A;  4CEO A;  5BR8 K;  4E7I A;  3T1A A;  1DTT A;  1K8K B;  1BIZ A;  4QS7 A;  4M41 A;  5HRR A;  4JYA K;  4OKE A;  1IKX A;  2P9P B;  1D8Y A;  4N76 A;  2HNY A;  4HCC A;  4DR3 K;  2JGU A;  3FZL A;  1J6Z A;  5CR4 A;  1Y97 A;  5A2Q O;  4BRM A;  1KCF A;  1CXU A;  4CJU A;  1KD1 O;  2VGN A;  4Y0W A;  2ZE2 A;  4E7H A;  4BR7 A;  5CZ2 A;  5HLF A;  5KPZ A;  4BRI A;  3JXU A;  3ENO A;  3R3L A;  4KPY A;  4JI1 K;  2ZF5 O;  1RBS A;  3OYC A;  3THV A;  1GLE G;  2V51 B;  4A62 A;  3L2W A;  3QEW A;  2P9N A;  3J7A P;  3BDP A;  4KH4 A;  2WFB A;  5BRH A;  1C0U A;  2G8K A;  1RDA A;  1VSF A;  3K9J A;  1MWK A;  2CGJ A;  1J5E K;  4YOU A;  3CIP A;  3CC2 N;  3OS1 A;  1E3M A;  4E1M A;  3AVF A;  3ZSW A;  4FLT A;  5J1E A;  3VN5 A;  3A5M C;  3MN5 A;  5ADX A;  1RT1 A;  5B8H A;  4FK2 A;  4CI6 A;  2ZD1 A;  1MWM A;  5FDL A;  3NVK A;  5IWA K;  1W7A A;  3AGR A;  3TR8 A;  5H1S Q;  3LWL A;  1DGK N;  2B6A A;  4GY2 B;  1VQ4 N;  4DSJ A;  2O8B B;  4YOY A;  3HPG A;  4CHQ A;  4CEB A;  3WXI A;  4CFA A;  4XH5 A;  1ZBU A;  4CHO A;  1WOQ A;  3WXJ A;  1S1W A;  4JK9 A;  1OH8 A;  4OVL A;  4CHY A;  3VTH A;  3O9U A;  3T7Z A;  3WEE B;  1N36 K;  4GKJ K;  2F7T A;  3HL8 A;  1T3V A;  4FJ7 A;  2I7N A;  3PLA A;  1Q86 O;  4DQS A;  4LFA K;  3HTV A;  1T44 A;  3MX5 A;  4B3R K;  2GUP A;  1EXQ A;  4JRQ A;  4KV8 A;  2YKM A;  3C0B A;  4M42 A;  1YVU A;  4XH1 A;  4I6M B;  3KD1 E;  1BQM A;  3EZW A;  4FM2 A;  1ZC6 A;  4HUF A;  2O4I A;  2F96 A;  1JLB A;  1I94 K;  1Q8I A;  4CF1 A;  3ZSO A;  4OKJ A;  3HP9 A;  2D1K A;  1EP4 A;  1LAW A;  2NUB A;  3LPU A;  4DQQ A;  4QAG A;  3MWP A;  3RMD A;  3Q7B A;  1SL2 A;  3SI6 A;  4CZI A;  3OW2 M;  3AV9 A;  3V1O A;  4KAZ A;  4UQG A;  1F21 A;  1M90 O;  4B3O A;  4CF2 A;  2QW9 A;  1WSH A;  4RW6 A;  2Z1G A;  4YHH K;  4ILH A;  3OA9 A;  1X9M A;  2WBN A;  4AHT A;  3HO1 A;  1Z05 A;  2FSJ A;  4YFU A;  2HVH A;  4CEA A;  2D4W A;  1R59 O;  1JLE A;  3HXM A;  2A6A A;  3GDQ A;  4A2B A;  4BVP A;  2FF6 A;  1GLB G;  4JI3 K;  1TKX A;  1DTQ A;  1Z26 A;  4HCB A;  4CJT A;  1TL3 A;  1X9W A;  4JKE A;  2IDO A;  4LF6 K;  2FLO A;  4BR5 A;  4GNI A;  2XY7 A;  1HUX A;  2YNH A;  3ATV A;  3I55 N;  1TVR A;  1JLC A;  1HNX K;  4CEF A;  1GLJ O;  1TGO A;  3OYM A;  1X9J A;  1YUW A;  4IOX A;  4PKG A;  5BN9 A;  1NBW A;  4F2S A;  1WSJ A;  2X74 A;  3SPY A;  3SQ0 A;  3SQ2 A;  1CXQ A;  2YHY A;  1TK8 A;  3DI6 A;  1U45 A;  4FYD A;  3ENB A;  3K2P A;  2YX6 A;  3K58 A;  3G10 A;  2GV9 A;  3FE1 A;  4EP4 A;  3J7Y P;  5J2M A;  1LW0 A;  5BR9 A;  2R7Y A;  1H1V A;  1JJ2 M;  4R79 A;  4BGB A;  4DUZ K;  1D9D A;  5E84 A;  2A40 A;  2VQF K;  4CFB A;  4BRD A;  4O0J A;  3IMX A;  1VSM A;  5AZJ A;  2YI1 A;  5DM7 L;  4QS8 A;  5GIP A;  2O8C B;  5TKY A;  4DV2 K;  2P51 A;  2PFU A;  3MXI A;  1BA0 A;  5KGW A;  1QE1 A;  3AA4 A;  4R5P A;  5M1N A;  2KHO A;  1W0H A;  4LD0 A;  1XMO K;  3DRP A;  3SK3 A;  3AVG A;  4OPJ A;  4OGC A;  2HVI A;  3ZX0 A;  4CZM A;  1RTJ A;  3THW B;  3QET A;  3IFR A;  3AVM A;  4CHP A;  1BL3 A;  3OYL A;  3EN9 A;  3F73 A;  3AA3 A;  3CC7 N;  3O3G A;  1TYQ B;  1XHZ A;  2V52 B;  1BI4 B;  2YHA A;  4DSK A;  3KZB A;  4JAX A;  3U9Z A;  4O8K A;  3O3F A;  4BC5 A;  4JHD B;  3BY5 A;  3DJC A;  3AVA A;  4FSV A;  3D2F B;  3A8Y A;  3VEY A;  4JKG A;  4O4G A;  5BPN A;  2VYP A;  5AQY A;  1HYZ A;  3ZX3 A;  5ADX H;  3K0S A;  1HPZ A;  5IT9 O;  1SKS A;  4ELT A;  1KAZ A;  3OJS A;  4FJH A;  2Q1N A;  3HT3 A;  2HHU A;  3MMV A;  4B9Q A;  1D4X A;  3DXK A;  3NH2 A;  3AO3 A;  4E89 A;  1IH7 A;  3UB5 A;  4E7L A;  3QB0 A;  3J81 O;  5JS2 A;  1FW6 A;  4BY9 C;  1T7P A;  4FZY A;  3K9K A;  4BDY A;  4C23 A;  3QIN A;  3OYF A;  1ILY A;  4BC2 A;  4HVJ A;  3LWM A;  4DTS A;  3KJV A;  3P83 D;  3WUH A;  5KRT A;  3H46 O;  3L3V A;  4DQR A;  1N6Q A;  4AHU A;  3VA3 A;  1VQ9 N;  2RHK A;  3SJJ A;  1XNR K;  1NOZ A;  2FF3 B;  1G15 A;  5FPM A;  2RN2 A;  5EU7 A;  3ZX2 A;  3MWT A;  1FXX A;  4AHR A;  2EWS A;  4NXM K;  3DRS A;  3J80 O;  3WNF A;  1NK8 A;  3QML A;  2ZWH A;  3TAM A;  3L3U A;  5CZ1 A;  1U47 A;  2HHW A;  5GAG P;  1VQ7 N;  1GOC A;  3ZCM A;  3V9U A;  3CD6 N;  2A1S A;  3FZM A;  4CEQ A;  2W42 A;  1U04 A;  3O4W A;  4CZL A;  3TTD A;  1YT3 A;  2NRH A;  1NGH A;  4ELU A;  1NM1 A;  2NRT A;  1KLN A;  3R8E A;  4DV5 K;  2GWJ A;  3IRX A;  4DQ8 A;  4F9O A;  1C0F A;  3ZSV A;  3VER A;  3AGK A;  4KHY A;  2F4V K;  4JKC A;  5FRO A;  4QOZ B;  4LFC K;  4IJN A;  5M1P A;  3BUZ B;  4FJK A;  3LAN A;  3KK2 A;  1VHX A;  3VEW A;  2BGG A;  2BDP A;  4NLB A;  1E4G T;  1BIS A;  4E1N A;  4J8F A;  5LY3 A;  3HJF A;  1IG9 A;  4ID1 A;  2XY5 A;  4AM6 A;  3VEO A;  2NRV A;  5BRF A;  4W5Q A;  4Z4E A;  2KW4 A;  4AHV A;  1VSI A;  1RDU A;  3F5T A;  4OJR A;  3OS0 A;  5AQG A;  3ENH A;  3C6A A;  1WNS A;  4B3T K;  4OO1 J;  2X78 A;  2ZGY A;  4DTM A;  3T69 A;  4WF9 L;  1D9F A;  4A2A A;  1C6V A;  4KO0 A;  3NF7 A;  3B8A X;  1VRU A;  3V1R A;  3WXL A;  1CLQ A;  1IV0 A;  2FSN A;  4YY3 K;  5MLC Q;  3VEN A;  4IBN A;  1VQO N;  3CCL N;  2QTD A;  1YHQ N;  1NKC A;  1IJJ A;  1YIT N;  4CJW A;  3TSP A;  4FWP A;  3ULE B;  3MEC A;  2YJE A;  4KTZ A;  2YKN A;  2D0P A;  1QS4 A;  4U7B A;  1OKJ A;  4M3X A;  4RCH A;  2OCE A;  4FJJ A;  3KK7 A;  2O8D B;  5HBM A;  5K14 A;  1RT5 A;  4WQ5 A;  4CJS A;  4IFE A;  4O5F A;  1NOY A;  3OHR A;  1NJY A;  2E2Q A;  2P9S A;  5EOY A;  3M6G A;  2KFN A;  3BEX A;  3WQT A;  4WQ4 C;  4KRF A;  3C7N A;  3V1Q A;  4TSX A;  3VQA A;  3TAQ A;  4LSN A;  1EWQ A;  3KK1 A;  2QWN A;  2Y1J A;  3OYN A;  4KHN A;  4BRF A;  4ISF A;  4Z4C A;  4PL7 A;  3JYT A;  3D0P A;  1NK9 A;  4CED A;  4FZX C;  1NWK A;  3BF3 A;  3EKS A;  4B1W B;  4BE2 A;  3U9D A;  4DFM A;  3C65 A;  1BU6 O;  1REV A;  5AQP A;  5M1O A;  3SMP A;  2ZJQ L;  4KHW A;  4E7K A;  3TU5 A;  5M1F A;  2KQ2 A;  2HBL A;  2WTU A;  4XH4 A;  5AQX A;  4FM0 A;  4I2P A;  1B9D A;  1NK6 A;  3L2R A;  4MO4 A;  4PHT X;  3AA5 X;  5LMU K;  3QEI A;  1S6Q A;  4AQY K;  2A42 A;  3OYD A;  1JLQ A;  2VG6 A;  2HHV A;  1Q7Y O;  4CZG A;  2YNF A;  3AO1 A;  3ZET B;  4WFN L;  1YJW N;  1L3S A;  4NO7 A;  3AVL A;  1VQ5 N;  2Q97 A;  4B9V A;  3VEZ A;  1LW2 A;  1HJO A;  3TAR A;  3OTO K;  3DXM B;  4W5T A;  4E0D A;  4FLW A;  1LOT B;  2HND A;  4BR0 A;  1IBL K;  1T8E A;  2IAJ A;  1NKE A;  3MXM A;  5C12 A;  2OTJ N;  1ATN A;  3AVH A;  4BR4 A;  4LF4 K;  2HF4 A;  3VQ9 A;  1NJW A;  3CQ8 A;  5J2Q A;  3NE6 A;  3ZT0 A;  3R1X A;  1NGC A;  3O9T A;  4MDB A;  2P9U B;  4FWM A;  1BGX T;  2HF3 A;  5EY4 A;  1W2B M;  1GLF O;  1YAG A;  4DCH A;  4BRA A;  3ID6 A;  3HSC A;  3LDP A;  1T6D A;  3D2E B;  5TKW A;  3H3O B;  5E41 A;  3KLF A;  4DV1 K;  1S5J A;  2O8E A;  3FZK A;  4CCH A;  4BE1 A;  3V9X A;  5JIC A;  3UE5 A;  1OVQ A;  4A57 A;  3IUC A;  3SUP A;  2I5J A;  4IG0 A;  3UIQ A;  3NGZ A;  3KKR A;  4O55 A;  1YIJ N;  3TTF A;  2E88 A;  3TTC A;  2CGK A;  3QFU A;  4CJQ A;  1J53 A;  3CJ9 A;  2ZJP L;  1HMV A;  1UWB A;  1BQN A;  4FL9 A;  5I42 A;  3DWL A;  1Q81 O;  2ZGZ A;  3M1F A;  1RT3 A;  3THY A;  2YHB A;  3C95 A;  3ID8 A;  5LJV A;  5HP1 A;  1HKG A;  3C6T A;  1BOT O;  3RMB A;  4BDP A;  4ISG A;  1U2V A;  2JWL A;  3CM6 A;  1GOB A;  4JKF A;  2G8H A;  4KI6 A;  5FPD A;  4DQI A;  3L8B A;  1X9S A;  2QA4 N;  1WUA A;  4YOT A;  4CIG A;  3AAQ A;  3QFP A;  3L4Q A;  3NDK A;  1NGB A;  1M1K O;  1JCE A;  3U8X A;  3CER A;  4YDU A;  5KQ8 A;  2CGL A;  3LZI A;  3SPZ A;  4J2E A;  3SUN A;  2IS3 A;  2HMP A;  4FWL A;  1HJR A;  4O0I A;  3K5N A;  4BRC A;  3KVG A;  2GTD A;  1VSL A;  3I33 A;  3MK6 A;  2D0A A;  1Q9Y A;  4KKO A;  4W5O A;  4X66 K;  1RBR A;  1VRT A;  5KGX A;  3I0R A;  4KTW A;  2UU9 K;  1NK0 A;  3O1W A;  4FZZ A;  3L6Q A;  5FRN A;  4DSI A;  1IKY A;  2KLA A;  5AQO A;  3VF6 A;  4OX9 K;  1U49 A;  1NK7 A;  4X64 K;  2CH5 A;  1Q18 A;  1JXB A;  3R9P A;  4CIE A;  1NJI O;  3ZSX A;  4Z4G A;  3NAE A;  3CCU N;  2FBT A;  3CCR N;  4DTJ A;  3E66 A;  4H0O A;  4DF8 A;  3PX6 A;  4CZE A;  1P90 A;  4F8R A;  3U3Y A;  1QZ6 A;  3VQP A;  4EZ6 A;  2ASM A;  4CVN E;  2P9L A;  4CE9 A;  4M3Z A;  2P9I B;  3DLE A;  3VQD A;  4DLG A;  1BIU A;  3GOI A;  4MDA A;  4V19 S;  4BC4 A;  1KTQ A;  4EAH D;  4OKK A;  1LWC A;  3PO4 A;  4DTR A;  1JLA A;  1JKH A;  1YI2 N;  1YF5 L;  4LSL A;  1NGE A;  2D0C A;  3CFO A;  1FKO A;  4ELV A;  5M1K A;  3ZT1 A;  1S1X A;  3V6D A;  5CY4 A;  1BCM A;  4CJK A;  1D5A A;  4BRG A;  1K8K A;  3OYG A;  3ZSZ A;  4DMN A;  5KPT A;  4DS5 A;  4B1U B;  4FLX A;  2P9P A;  1RDC A;  1QZ5 A;  3NMU A;  1L3U A;  3QBW A;  4PA1 A;  5FPE A;  4O44 A;  1HYV A;  3ZSR A;  4FLU A;  5AQQ A;  3RSE A;  3SBG A;  3RTV A;  1HX1 A;  3TSU A;  4WFB L;  1NGG A;  1TK5 A;  2XRI A;  3LM9 A;  3E1Y A;  2FBY A;  3PV8 A;  5AZI B;  3OYB A;  1NLV A;  4JNE A;  4DLE A;  4PUO A;  4JI5 K;  2GX9 A;  3ZLJ A;  1NMN A;  5FLX O;  2BH1 A;  4DUY K;  1WAF A;  3SAG A;  5BPM A;  3ZT3 A;  4CJ4 A;  3LP2 A;  1HPM A;  2BAN A;  4FLV A;  1DKG D;  3HZ6 A;  3RWU A;  3EYZ A;  3QIP A;  1JCG A;  1NNE A;  2G8U A;  2OPP A;  1KLM A;  4N56 A;  5F1X A;  5JVH L;  5AR0 A;  1KVB A;  1UAX A;  3LAK A;  1BHL A;  4B9T A;  2OPS A;  5HOO A;  1NG9 A;  3ZSQ A;  2EHG A;  4I2Q A;  5HL7 L;  3QIC A;  2XY8 A;  1NK4 A;  4JKB A;  5LL6 Z;  3VEX A;  4CEC A;  1WN7 A;  4C8L A;  2O8B A;  2G8F A;  3BF1 A;  3O9Q A;  2IGI A;  3HST B;  3F2K A;  4NCB A;  1A5W A;  1TV6 A;  2OA8 A;  4CJF A;  1HNZ K;  3V9S A;  3LDN A;  1KRP A;  4DG1 A;  5I3U A;  3IDH A;  1RT4 A;  3OY9 A;  5AFU A;  3WEE A;  4LH4 A;  1SL1 A;  1YTU A;  1X3M A;  1RFQ A;  1W9H A;  1KFS A;  4N5S A;  4MLE A;  3O80 A;  1J9A A;  1EO1 A;  3AVC A;  2P5G A;  3ATU A;  3PX0 A;  2W41 A;  1QHT A;  4IEE A;  3H6E A;  4NYN A;  1IBK K;  3A5L C;  4PWD A;  2Q2R A;  1IG8 A;  3QES A;  2HW3 A;  4OGE A;  3SZ2 A;  4OPA A;  3FZH A;  4B8A B;  4I6M A;  5AJ3 K;  4KB0 A;  4HUG A;  1G99 A;  4AF1 A;  3B6O A;  3VEV A;  1KAX A;  3VF2 A;  4LF5 K;  3P4I A;  3BP8 A;  4CJP A;  4GV9 A;  3NF9 A;  1OH7 A;  1LAV A;  2Q3S A;  1C0G A;  2Q31 A;  2OZM A;  3VQ8 A;  4HTU A;  3NF8 A;  3KD5 E;  4BRN A;  4LF7 K;  1HR0 K;  2DFF A;  5KRS A;  3O5B A;  4FLZ A;  4XEI A;  4IG3 A;  1BO5 O;  3NGY A;  4RWT A;  4H0Y B;  5JVG L;  1S9G A;  3MN9 A;  4DR7 K;  3F9K A;  4CJ5 A;  1TL1 A;  1S22 A;  1ATR A;  2Q36 A;  3AAP A;  4K25 A;  4CZH A;  3MCP A;  1MDU B;  1LCU A;  4IDH A;  4DV4 K;  1VK0 A;  1RBV A;  3SAH A;  4CZK A;  1VSK A;  5AQF A;  3L4I A;  1T05 A;  5AQI A;  1L3V A;  3THX B;  2QM1 A;  4DQP A;  3CI5 A;  1GLA G;  4O5B A;  2HB5 A;  3SLC A;  2NZT A;  2HST A;  3QNO A;  2QI2 A;  4CZF A;  4JEP A;  2YHX A;  4CEE A;  3VA0 A;  1YXQ A;  4DU1 A;  5FPN A;  4GKK K;  3CJB A;  4QCL A;  2ATQ A;  2OYQ A;  1K9M O;  3M8P A;  1J5O A;  2FXU A;  1TKT A;  1S1T A;  4ISE A;  4NB4 A;  3OYI A;  1EET A;  3DAW A;  3AVI A;  4Z4I A;  3DMJ A;  2YNG A;  2VWJ A;  1HNW K;  2QWP A;  1MA9 B;  4BDZ A;  4B9S A;  2PBD A;  3PSF A;  3S3N A;  1HQE A;  3AO2 A;  4JLH A;  2A3Z A;  2BE2 A;  4DTX A;  2YNI A;  3AA2 A;  4I7F A;  4MFB A;  1A5V A;  3TSQ A;  2Z1I A;  2NRZ A;  3IG1 A;  3PUF A;  1JL1 A;  3MX2 A;  3S3O A;  1EQY A;  4CES A;  1YJ9 N;  3K5L A;  3UKR B;  1VQN N;  2O8C A;  2I7P A;  2D0B A;  4FJI A;  2P9K B;  3WXK A;  4ILG B;  1QQM A;  2OTL N;  1A5X A;  4IDK A;  3CJC A;  2QWR A;  4U67 L;  2XHB A;  4BC3 A;  1N32 K;  4IOC L;  3ZEU A;  4E19 A;  4X65 K;  4H4O A;  2KFZ A;  3VET A;  5C2D A;  5AQK A;  1S6P A;  4BWM A;  1RTH A;  1YTA A;  4HWI A;  4B1X B;  4CBX A;  2HOE A;  4FWS A;  3CJ1 A;  4I9Q A;  2QWL A;  2V7Y A;  3ZSY A;  1TYQ A;  1BI4 A;  3C94 A;  2AP1 A;  4DSF A;  5JMV A;  3T3F A;  2O8F B;  1DT9 A;  4C8M A;  1ZYQ A;  4EZ9 A;  1HRH A;  3IS9 A;  4CER A;  4EHT A;  3UKU B;  3FFI A;  4JHD A;  4FW2 A;  3D2F A;  4EP5 A;  5GAE P;  4FWN A;  2Q0R A;  2E6L A;  1KXP A;  1N8R O;  3J7Z O;  1OH5 A;  2IVN A;  3V9W A;  1FKP A;  2ETJ A;  1IO2 A;  4FVM A;  3SV3 A;  1SZ2 A;  4FOE A;  5HRN A;  4A59 A;  3KLG A;  1RT7 A;  2WC9 A;  4CGJ A;  1TUU A;  3DLL L;  4M3U A;  1QSL A;  3DLH A;  4KHP K;  1IKV A;  3LP3 A;  2A5X A;  3PY8 A;  3CET A;  1KVA A;  4DV6 K;  2YV0 X;  4ID5 A;  4YOV A;  2DFE A;  1SS6 A;  5AFU H;  4CBU A;  5C0Y A;  4JK8 A;  2VQE K;  5AQS A;  5AQT A;  4RW4 A;  4JI0 K;  3CJA A;  3QNN A;  5AQV A;  3CC4 N;  3NF6 A;  3A0I X;  4JN4 A;  4B9M A;  3KTQ A;  4E3S A;  4KH5 A;  5C15 A;  1RBU A;  1ESV A;  3M5R A;  3HVT A;  3N4Q A;  3A2F A;  2O8E B;  4G1Q A;  1LWF A;  4CEZ A;  4M7X A;  3WXM B;  2YHW A;  3F9M A;  1S1V A; 
#chains in the Genus database with same CATH homology
 3LZI A;  3SPZ A;  4Y1D A;  4PQU A;  4H4M A;  4J2E A;  3D45 A;  3SUN A;  2IS3 A;  4MQ3 A;  1TKX A;  1NJX A;  3RMC A;  1DTQ A;  3DLR A;  3V81 A;  3NCI A;  3NH1 A;  1HJR A;  4O0I A;  3K5N A;  4ICL A;  1VSL A;  4M3R A;  1Z26 A;  4CIF A;  4HCB A;  2D0A A;  5KTQ A;  2P1J A;  4KKO A;  4CJT A;  4W5O A;  1RBR A;  1TL3 A;  3K5M A;  1Q9Y A;  1SUQ A;  1VRT A;  5KGX A;  1X9W A;  3VQQ A;  3I0R A;  2IDO A;  1B92 A;  3AO5 A;  4KTW A;  5C42 A;  1NK0 A;  2XY7 A;  2KTQ A;  1RNH A;  1JLG A;  4DFK A;  2YNH A;  3ITH A;  4FZZ A;  1TVR A;  3LP0 A;  1JLC A;  4GW6 A;  3VQ7 A;  5FRN A;  4CEF A;  4DSI A;  1IKY A;  1TGO A;  4CK2 A;  3OYM A;  3HP6 A;  3L2U A;  3SCX A;  4AHC A;  1U49 A;  2HNZ A;  1NK7 A;  3TWH A;  3SUQ A;  4FCY A;  4F2S A;  3PX4 A;  1WSJ A;  2X74 A;  3SPY A;  2RKI A;  3SQ0 A;  3BGR A;  1JXB A;  3TI0 A;  4LY7 A;  1HNI A;  3SQ2 A;  3KLE A;  1CXQ A;  3TAB A;  3QEV A;  3SUO A;  1TK8 A;  5J2P A;  3DI6 A;  1VSH A;  4CGG A;  4CIE A;  1U45 A;  5KI6 A;  2A1R A;  4FYD A;  3ZSX A;  3K2P A;  3NGI A;  4Z4G A;  3I8D A;  3K58 A;  3NAE A;  3G10 A;  1L3T A;  2GV9 A;  2FBT A;  3L2Q A;  4I9L A;  4EP4 A;  4DTJ A;  5J2M A;  1LW0 A;  1WSE A;  4B9L A;  4KI4 A;  4DF8 A;  2R7Y A;  3QIO A;  1RTI A;  1I39 A;  3S3M A;  2G8V A;  3KLI A;  3PX6 A;  3TAE A;  4K8X A;  4B9N A;  4J2B A;  4F8R A;  3U3Y A;  3MED A;  3VQP A;  1NK5 A;  1D9D A;  2HMI A;  3NFA A;  4EZ6 A;  3NHG A;  4DU4 A;  4CFB A;  4O0J A;  3AO4 A;  1WLJ A;  3U6F A;  4CE9 A;  1VSM A;  3EY1 A;  4M3Z A;  2XO7 A;  3DLE A;  2VG5 A;  4F4K A;  3VQD A;  1KVC A;  1RBT A;  2P51 A;  4DLG A;  5D3G A;  1BIU A;  3MXI A;  1KTQ A;  4OKK A;  3CFP A;  4Q0B A;  3ISN C;  1LWC A;  4B8C A;  3PO4 A;  4DTR A;  1JLA A;  5KGW A;  1QE1 A;  1JKH A;  4DTP A;  3AA4 A;  4R5P A;  4CGH A;  2XY6 A;  2Y1I A;  3RMA A;  4IFY A;  4M3T A;  1C0M A;  1W0H A;  4LD0 A;  4LSL A;  3MEE A;  3DRP A;  2D0C A;  1MU2 A;  2X6S A;  4E7J A;  4DTU A;  3VQ6 A;  2QKB A;  3AVG A;  3CFO A;  1FKO A;  4FJX A;  1TK0 A;  2DY4 A;  4OPJ A;  4OGC A;  2E6M A;  1RTD A;  4ELV A;  2HVI A;  1RTJ A;  4C8N A;  3QET A;  3ZT1 A;  1S1X A;  3V6D A;  5CY4 A;  3K59 A;  3AVM A;  4CHP A;  1BL3 A;  1GOA A;  4CJR A;  3OYL A;  1BCM A;  3AA3 A;  3F73 A;  4CJK A;  4CFC A;  1QSY A;  1D5A A;  1HNV A;  4DTO A;  3OYG A;  3ZSZ A;  4DMN A;  3O3G A;  3JSM A;  3RR7 A;  1XHZ A;  4DS5 A;  1BI4 B;  3KKS A;  4FLX A;  3QO9 A;  2YHA A;  4F3O A;  1RDC A;  1L3U A;  4DSK A;  1JL2 A;  4PA1 A;  1RT2 A;  4RW9 A;  4O44 A;  1HYV A;  3ZSR A;  3O3F A;  4FLU A;  4DWI A;  1ITG A;  1NJZ A;  4M45 A;  3IAY A;  3VQB A;  1KSP A;  3RTV A;  4KTQ A;  3L2V A;  4CK3 A;  3AVA A;  3P1G A;  5DK5 A;  4DSE A;  2DTU A;  1C1B A;  4KHU A;  5HRP A;  4KHS A;  5J2N A;  2FC0 A;  4O4G A;  1TK5 A;  2XRI A;  3MEG A;  3CFR A;  1Z25 A;  4RW8 A;  1TAQ A;  3S9H A;  1HYZ A;  2FBY A;  3PV8 A;  3OYB A;  2OPR A;  1HPZ A;  4DLE A;  4DU3 A;  3WNH A;  1SKS A;  4ELT A;  4PUO A;  4FK4 A;  3OJS A;  1XHX A;  3AVB A;  4FJH A;  3HT3 A;  3RR8 A;  4HUE A;  4GMJ B;  2HHU A;  4W5N A;  1WAF A;  3NH2 A;  1RDB A;  2WON A;  2KZM A;  5C24 A;  2QKK A;  3AO3 A;  3ZT3 A;  1X1P A;  4CJ4 A;  3LP2 A;  4Y1C A;  4E89 A;  3MXJ A;  1IH7 A;  4JS5 A;  3I0S A;  2BAN A;  2FBX A;  4E7L A;  4YNQ A;  4FLV A;  3CM5 A;  4FJL A;  5SZT A;  3RWU A;  3G0Z A;  3O4N A;  5JS2 A;  3EYZ A;  4C8O A;  1XC9 A;  3QIP A;  1T7P A;  4FZY A;  5CYM A;  4K8Z A;  4FW1 A;  4BDY A;  1WSF A;  1EX4 A;  3QLH A;  2G8U A;  2PYJ A;  4F2R A;  3QIN A;  3OYF A;  2IOC A;  2OPP A;  2O4G A;  1KLM A;  4HVJ A;  4N56 A;  1CZB A;  2GBZ A;  4ZTF A;  1SL0 A;  3WNE A;  1KVB A;  1UAX A;  3RRH A;  3LWM A;  4WE1 A;  1NKB A;  3M8R A;  2F8S A;  4DTS A;  3LAK A;  3KJV A;  3LP1 A;  1BHL A;  3P83 D;  2OPS A;  4CGD A;  5KRT A;  1L5U A;  4B9T A;  3ZSQ A;  1ZBF A;  2G8I A;  4M3W A;  3L3V A;  4DQR A;  4CGF A;  1N6Q A;  2EHG A;  4AHU A;  4I2Q A;  3SV4 A;  3VA3 A;  3SJJ A;  4CHN A;  4M3Y A;  1NOZ A;  1O1W A;  2XY8 A;  1G15 A;  4FK0 A;  1NK4 A;  2RN2 A;  5EU7 A;  3WNG A;  3E01 A;  4CF8 A;  4CEC A;  3ZT2 A;  3OYK A;  1WN7 A;  1R0A A;  4C8L A;  1FXX A;  3DM2 A;  4J2A A;  2G8F A;  1C0T A;  3SQ4 A;  4AHR A;  2IGI A;  3HST B;  4NCB A;  4Q5V A;  3DRS A;  4FM1 A;  1A5W A;  3WNF A;  1NK8 A;  4FJM A;  1TV6 A;  3TAM A;  1WSG A;  2OA8 A;  3HK2 A;  1ASW A;  4CJF A;  3HVR A;  3L3U A;  5CZ1 A;  3V9S A;  1VSD A;  1U47 A;  2HHW A;  1KRP A;  4DG1 A;  5I3U A;  4CJV A;  1RT4 A;  1GOC A;  4W5R A;  3ALY A;  1N5Y A;  3OY9 A;  3ZCM A;  3V9U A;  2A1S A;  4CK1 A;  3MAQ A;  4LH4 A;  4CEQ A;  1SL1 A;  2W42 A;  1U04 A;  2DFH A;  2LSN A;  2VG7 A;  2FBV A;  5T7B A;  4FJ5 A;  1YTU A;  1KFS A;  1W9H A;  1YT3 A;  3VQC A;  2HHT A;  2HHX A;  1TAU A;  3OVN A;  3VQ5 A;  4N5S A;  2PYL A;  1CZ9 A;  1J9A A;  4ELU A;  3NBP A;  4NYF A;  3QEP A;  1KLN A;  3AVC A;  1Q9X A;  2P5G A;  4CJL A;  1C1C A;  1RIL A;  3IRX A;  3PX0 A;  3ZSV A;  3KLH A;  2QK9 A;  4JRP A;  4OLA A;  1QHT A;  4KHY A;  3LAL A;  4NYN A;  4CHZ A;  4XIU A;  1HQU A;  3AVJ A;  4CFD A;  5FRO A;  3TAG A;  4QOZ B;  4KB1 A;  4PY5 A;  3DLG A;  4ZTJ A;  4PWD A;  4JS4 A;  3KIO A;  3QES A;  4DSL A;  3LAN A;  4OGE A;  4BWJ A;  3KK2 A;  3SZ2 A;  2G8W A;  4FJK A;  2HW3 A;  2BGG A;  2BDP A;  4B8A B;  5FRM A;  4HHT A;  4KB0 A;  4HUG A;  2E4L A;  1BIS A;  1J54 A;  3B6O A;  3O3H A;  4CGI A;  3HM9 A;  5SWM A;  4E1N A;  1I3A A;  3OS2 A;  4CJP A;  3AVN A;  3NF9 A;  1LAV A;  3HJF A;  2Q3S A;  4ID1 A;  4CJ3 A;  2XY5 A;  1IG9 A;  1RCH A;  3HPO A;  1FK9 A;  2GUI A;  4W5Q A;  1SV5 A;  2OZM A;  3NH0 A;  4Z4E A;  3VQ8 A;  4HTU A;  2KW4 A;  3SNN A;  4AHV A;  1VSI A;  3NF8 A;  2F8T A;  5C25 A;  2RPI A;  3QER A;  3KD5 E;  3ZT4 A;  4FJG A;  4BE0 A;  4B9U A;  4DFP A;  2DFF A;  3HYF A;  4OJR A;  5KRS A;  3OS0 A;  3H08 A;  4FLZ A;  4L8R B;  1HYS A;  4CF9 A;  4IG3 A;  3NGY A;  2OZS A;  4LH5 A;  1WNS A;  1C1A A;  2X78 A;  4H8K A;  4NCG A;  3OYH A;  4DTM A;  4OLB A;  1RDD A;  1S9G A;  3DLK A;  2AJQ A;  3SYZ A;  1D9F A;  2PY5 A;  1C6V A;  4KO0 A;  3NF7 A;  3F9K A;  4J2D A;  4CJ5 A;  1TL1 A;  1VRU A;  3V1R A;  2HHQ A;  1CLQ A;  3KK3 A;  1BCO A;  4IBN A;  4OPK A;  1NKC A;  3TAF A;  2P5O A;  4C8K A;  5HRO A;  1VK0 A;  1RBV A;  4FLY A;  3AVK A;  3P5J A;  4CJW A;  1UOC A;  1VSK A;  3QEX A;  3VQE A;  1T05 A;  3LAM A;  1ZBI A;  3MEC A;  1U48 A;  4KTZ A;  2YKN A;  4DF4 A;  1L3V A;  4KHQ A;  3VQ4 A;  4DQP A;  1QS4 A;  4AH9 A;  2QXF A;  1UA1 A;  4O5B A;  4M3X A;  1WAJ A;  1LV5 A;  2X6N A;  1XWL A;  2HB5 A;  4GVM A;  4CEO A;  4E7I A;  1WSI A;  3T1A A;  1RT6 A;  1DTT A;  3B6P A;  5HBM A;  3DOK A;  4FJJ A;  4Z4F A;  5K14 A;  3DLB A;  3QNO A;  1RT5 A;  3RRG A;  3ASM A;  3OJU A;  4CJS A;  1QTM A;  1BIZ A;  2ITG A;  4M41 A;  5HRR A;  1NOY A;  4CEE A;  3VA0 A;  4DU1 A;  2EX3 A;  4OKE A;  1IKX A;  1NJY A;  3LZJ A;  4QCL A;  2ATQ A;  1D8Y A;  4N76 A;  2OYQ A;  4NCA A;  3M8P A;  3TAP A;  1KFD A;  1J5O A;  2HHS A;  4KRE A;  2KFN A;  4B08 A;  3PO5 A;  2HNY A;  2Z1J A;  4HCC A;  4KRF A;  1TKT A;  2VWK A;  1S1T A;  2JGU A;  3V1Q A;  3OYI A;  4TSX A;  3VQA A;  3TAQ A;  1Y97 A;  4LSN A;  1KCF A;  3CYM A;  1EET A;  1CXU A;  5DMR A;  4CJU A;  3KK1 A;  4FJN A;  2Y1J A;  3K5O A;  3OYN A;  3AVI A;  1ASV A;  2ZE2 A;  4KHN A;  4Z4I A;  1QQC A;  3DMJ A;  2ZQB A;  4Z4C A;  3JYT A;  4E7H A;  1DLO A;  2YNG A;  3D0P A;  4CED A;  1NK9 A;  4FZX C;  5CZ2 A;  5HLF A;  2VWJ A;  4BDZ A;  4KPY A;  1IKW A;  4BE2 A;  1RBS A;  3M8S A;  5CYQ A;  3OYC A;  3THV A;  3S3N A;  4B9S A;  1HQE A;  3LPT A;  3AO2 A;  4JLH A;  3L2W A;  3QEW A;  4DFM A;  2BE2 A;  2WOM A;  3BDP A;  4KFB A;  2YNI A;  3AA2 A;  4I7F A;  3OYE A;  4DTX A;  1REV A;  1C0U A;  4MFB A;  2G8K A;  4DTN A;  4KHW A;  4E7K A;  1QSS A;  1A5V A;  3DOL A;  1RDA A;  2KQ2 A;  2Z1I A;  1VSF A;  3V9Z A;  3IG1 A;  4CJE A;  3PUF A;  1JL1 A;  4FM0 A;  3S3O A;  4I2P A;  1B9D A;  1ASU A;  4CES A;  1NK6 A;  4IFV A;  3K5L A;  4F3T A;  3OS1 A;  4AHS A;  3L2R A;  3QEI A;  4E1M A;  3AA5 X;  3AVF A;  1S6Q A;  3EZ5 A;  3ZSW A;  3OYD A;  4FLT A;  1JLQ A;  2VG6 A;  5J1E A;  3VN5 A;  2D0B A;  2HHV A;  4FK2 A;  1RT1 A;  4FJI A;  4BAC A;  2ZD1 A;  1ZBH A;  3C6U A;  5FDL A;  1SKR A;  2YNF A;  3AO1 A;  1A5X A;  4IDK A;  3TR8 A;  3LWL A;  4N41 A;  2B6A A;  2XHB A;  4DSJ A;  2D5R A;  1L3S A;  4FXD A;  3AVL A;  4E19 A;  3HPG A;  4CHQ A;  4H4O A;  4CEB A;  4B9V A;  4CFA A;  1LW2 A;  2IC3 A;  3TAR A;  2KFZ A;  4Z4H A;  3LDS A;  1S9E A;  1S6P A;  1RTH A;  1YTA A;  4BWM A;  1LWE A;  4ZHR A;  1ZBU A;  4CHO A;  4W5T A;  4FLW A;  4E0D A;  1S1W A;  4I9Q A;  2HND A;  1T8E A;  1SKW A;  4OVL A;  2IAJ A;  3O4Q A;  3ZSY A;  4CHY A;  3MXM A;  1NKE A;  1K6Y A;  1T03 A;  1BI4 A;  3C94 A;  3AVH A;  3HL8 A;  4DSF A;  3T3F A;  4FJ7 A;  3VQ9 A;  4C8M A;  1NJW A;  3CQ8 A;  4DFJ A;  5J2Q A;  1ZYQ A;  3NE6 A;  3ZT0 A;  4RW7 A;  4EZ9 A;  4N47 A;  3K57 A;  1HRH A;  3IS9 A;  4CER A;  4DQS A;  3FFI A;  4Z0U A;  4FW2 A;  1BGX T;  1S1U A;  4RG8 A;  4EP5 A;  3CG7 A;  2RF2 A;  2KZZ A;  2E6L A;  3M8Q A;  3OYJ A;  3T19 A;  3V9W A;  5E41 A;  3V4I A;  1FKP A;  3KLF A;  1EXQ A;  1JXE A;  1S5J A;  2ETJ A;  1B9F A;  3HPH A;  4KV8 A;  4JRQ A;  3DYA A;  1IO2 A;  4FVM A;  1TKD A;  2YKM A;  3SV3 A;  1YVU A;  4CCH A;  3KD1 E;  4M42 A;  5HRN A;  4BE1 A;  5JS1 A;  1BQM A;  3V9X A;  4FJ8 A;  3OYA A;  3KLG A;  1RT7 A;  4FM2 A;  4CGJ A;  3DRR A;  4HUF A;  4M3U A;  1QSL A;  2O4I A;  2F96 A;  1JLB A;  4AIL C;  3SUP A;  2I5J A;  1EKE A;  1Q8I A;  4IG0 A;  1JLF A;  4DS4 A;  3DLH A;  3UIQ A;  3NGZ A;  1IKV A;  3LP3 A;  4CF1 A;  3KKR A;  4O55 A;  3ZSO A;  2PZS A;  4OKJ A;  3PY8 A;  4CF0 A;  1KVA A;  1VSJ A;  3HP9 A;  1EP4 A;  1LAW A;  1TKZ A;  2NUB A;  3U3G A;  3LPU A;  4CJQ A;  1J53 A;  2YV0 X;  4DQQ A;  4ID5 A;  1HMV A;  4QAG A;  1UWB A;  2DFE A;  1BQN A;  3RMD A;  5I42 A;  1SL2 A;  3SI6 A;  1XI1 A;  3AV9 A;  3SQ1 A;  3V1O A;  1RT3 A;  3TAN A;  4KAZ A;  4RW4 A;  4UQG A;  1F21 A;  2YHB A;  3C95 A;  5HP1 A;  4B3O A;  3C6T A;  4CF2 A;  3RMB A;  1U4B A;  3QNN A;  4BDP A;  5HRS A;  1UA0 A;  1WSH A;  4RW6 A;  3NF6 A;  2G8H A;  3CM6 A;  1GOB A;  4B9M A;  3KTQ A;  4E3S A;  4KI6 A;  4IKF A;  2B5J A;  2Z1G A;  1RBU A;  1ZBL A;  4DQI A;  2JLE A;  3HVT A;  3L8B A;  1X9S A;  3A2F A;  2B4J A;  4G1Q A;  1X9M A;  4AHT A;  1LWF A;  4CIG A;  3HO1 A;  2Z1H A;  4CEZ A;  4YFU A;  3NDK A;  1VSE A;  3ULD A;  2HVH A;  4CEA A;  2OPQ A;  1JLE A;  4FJ9 A;  3HXM A;  1S1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...