3AVFA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avfA00
1VSHA 3CM6A 1ASVA 2YNIA 4QAGA 4FK0A 1HYVA 2Z1GA 3LP3A 3EZ5A 3S3NA 1TL1A 3JSMA 1FK9A 3M8SA 3ZSOA 4EP5A 1U47A 2JLEA 2Q3SA 1TK0A 2OZMA 4ICLA 4O44A 4O0IA 3NAEA 5JS2A 3OYMA 4DWIA 4FJ9A 2YNHA 5C24A 3MEGA 4BWJA 5CYMA 3RR7A 2WOMA 4DSLA 4N47A 3S3OA 4F3OA 1U04A 2FBYA 3MXMA 4IFYA 1WSHA 4HUFA 3KD5E 4CK1A 4FJHA 3LAKA 4KHSA 5FRMA 1WSEA 4DS5A 3IAYA 1K6YA 3RTVA 2OZSA 4FJ5A 2O4IA 3HM9A 1BIZA 3B6PA 3UIQA 5KGWA 2D0AA 4M3RA 4DFKA 4DTNA 2HNDA 4B9SA 1HRHA 1RTHA 4CJTA 1YT3A 4EP4A 2HNZA 1IKWA 4AHUA 3SUOA 3QLHA 4FJXA 2G8IA 3MXJA 1Z25A 4IBNA 3ASMA 4I7FA 5DMRA 4DLGA 3TAEA 2XY8A 1JKHA 4C8MA 1SKWA 5SZTA 3IS9A 1Y97A 4CK3A 1ZBLA 1GOCA 3AVKA 3TABA 2HHUA 5JS1A 2NUBA 3JYTA 1SKSA 2XO7A 4FJIA 4CJRA 1TL3A 1KFDA 3CFOA 1GOBA 1HNIA 4CF0A 3QERA 3CYMA 3VA3A 1NK9A 1NJWA 3P83D 4G1QA 4J2AA 1FKPA 3VQEA 3RMDA 2G8VA 1HQEA 1C0MA 4IDKA 4ID1A 1L5UA 3F9KA 1MU2A 3KD1E 4R5PA 1U49A 3KKRA 4DFMA 4O5BA 1TKTA 1VSFA 4FJJA 2G8HA 2P5OA 5DK5A 4M3UA 1REVA 1X9WA 1Q9YA 4N76A 4PQUA 4FYDA 1D5AA 3VQAA 1ITGA 3OYLA 2G8UA 3T19A 3MXIA 1QSYA 3DOKA 4FJ8A 3DLRA 2XHBA 1NOZA 2DY4A 4M3ZA 3DOLA 1FKOA 4OGEA 2BGGA 3PO4A 4CF8A 4FZZA 3T1AA 2GV9A 3TAGA 4FW1A 1I3AA 4BE0A 2HHVA 1EKEA 4DQSA 2KFNA 2E4LA 4DSIA 1ZBHA 3ZSXA 3AVBA 3SJJA 3PUFA 1A5XA 2BE2A 4CF2A 3NH0A 1RDDA 1S1WA 4CGHA 5SWMA 3V9SA 4J2DA 1KRPA 3NGIA 1D9FA 3V4IA 2QKKA 3ITHA 2KTQA 4FK4A 3MECA 3KLFA 4Z4IA 2YKNA 3DRRA 3VQ9A 3HSTB 3WNHA 3ZSZA 4FLYA 4FJMA 4CECA 1EXQA 3K5MA 3LALA 3TAFA 3O3FA 5J2MA 3RRHA 3AA3A 4FJKA 4MQ3A 4F8RA 1U48A 4I9QA 4CJ5A 4CJQA 3SQ2A 1SKRA 1C0TA 1IG9A 2DFFA 4F4KA 3SI6A 1LAVA 5K14A 3OYKA 4DQQA 4CHPA 1IH7A 4NYFA 4YFUA 4CEEA 3OYAA 1NKBA 3NFAA 3KK2A 4DQIA 4CGFA 1WSIA 2HHTA 1VSDA 2OPPA 3SV4A 1YVUA 2X6SA 1X9MA 1L3SA 4W5NA 4KKOA 5C25A 4OKEA 1GOAA 4CJ3A 1IKXA 1CLQA 5CZ1A 2QKBA 4E7LA 4DTJA 1BQNA 3MEDA 3L8BA 4HTUA 4DQPA 2Z1IA 3DRSA 1WNSA 2IS3A 3VN5A 4DSFA 4LH4A 4ELVA 3I0SA 4HCBA 3OYDA 2B4JA 4O0JA 1SL2A 3AVMA 3LAMA 2FBXA 3E01A 4OJRA 1JLBA 4RW7A 4CE9A 4GMJB 4FLZA 3TAQA 1NK7A 1RDCA 1KVCA 3AO1A 4BDYA 3U3YA 4FM0A 5HROA 5I3UA 4FW2A 4DTXA 3O4QA 4FLVA 5J2QA 4B9MA 4JLHA 1B9DA 4CJEA 1LWCA 4KTWA 1U45A 1C1CA 4H8KA 4DS4A 3QO9A 3HVRA 2HMIA 5HRNA 2IC3A 2R7YA 2A1RA 2QK9A 2KZMA 1F21A 5CYQA 3DMJA 2BDPA 2HVIA 1FXXA 1RTIA 1KLNA 2ZE2A 3H08A 5T7BA 4QCLA 1XWLA 4CEFA 4DG1A 3EYZA 4DTOA 1QE1A 1S9EA 3IG1A 3U3GA 4N5SA 3SCXA 4EZ6A 4KO0A 4Z4GA 4DTMA 5HRSA 4DU4A 1UWBA 1W0HA 4Y1CA 1RBSA 2DFHA 4KHWA 2X6NA 3L2UA 1LV5A 4W5RA 4JS4A 4CEOA 2ITGA 4WE1A 3AO5A 3K57A 3DLGA 1A5VA 3AVCA 3ZT0A 4CGIA 2DTUA 3I0RA 3ZT3A 4CIGA 4CHNA 2PZSA 3QEPA 3NF7A 1KFSA 3OYNA 1S1TA 4C8NA 3LP2A 3KLGA 4CGDA 3NF6A 1DLOA 4Z0UA 2HHWA 1JLGA 4EZ9A 3OYHA 3QEXA 1SL0A 1NK5A 3U6FA 4CEBA 4E1MA 3I8DA 4M3YA 3G0ZA 4CFBA 1N6QA 4B9VA 4BACA 1LW2A 2FBVA 5HBMA 4JS5A 3TI0A 4KI6A 1RTDA 4W5QA 1BCMA 4AHVA 1A5WA 3LWMA 1D9DA 3O4NA 2HHQA 3V81A 1C1AA 3BDPA 4HUEA 1ZBFA 1S5JA 3QINA 3OYJA 4CJVA 3VQBA 3SZ2A 1WAFA 2G8KA 4CJPA 1N5YA 2OPSA 2KQ2A 2LSNA 4OGCA 1VSKA 1Q8IA 3V1OA 3DLKA 4FM1A 3AVNA 3AA5X 3QIOA 3NGYA 4GVMA 3C6TA 1S6PA 1R0AA 2JGUA 3S9HA 1X9SA 2A1SA 3AVFA 2PY5A 2Z1HA 1KVBA 1RCHA 4H4MA 3K58A 1CZ9A 4HHTA 3VQ4A 3DLBA 4RW9A 4M42A 5HRPA 5KI6A 1DTQA 2GBZA 3TARA 3SNNA 4B9TA 3OS1A 1JLAA 3TAMA 4CIEA 1QQCA 4FVMA 3LANA 2YKMA 4OKKA 3CQ8A 1WSFA 4PUOA 4F2RA 4KHQA 4DU3A 3AA2A 1RT3A 1C0UA 2E6MA 1TKDA 4CCHA 1YTUA 1UOCA 2I5JA 3OY9A 3KLHA 1TAQA 1YTAA 2YHAA 1LW0A 3QEVA 1KVAA 3AA4A 1WAJA 4JRQA 1LWEA 4DF8A 2VG7A 3S3MA 3OYFA 1WSGA 4M3XA 5KTQA 3NHGA 4PWDA 4UQGA 1IKYA 3TAPA 5KGXA 4OLBA 2KZZA 2ZD1A 3SUNA 2B6AA 4BE1A 4K8ZA 3LPUA 1EX4A 4FK2A 1SV5A 2AJQA 2OPRA 4I2QA 3OJSA 3LZIA 3QESA 5KRTA 2VWJA 3VQ8A 1LWFA 4LD0A 3B6OA 3HP9A 3DLEA 3HP6A 1IO2A 3NBPA 4ZTFA 3K2PA 3V6DA 3VQDA 1JL2A 1UA1A 3AO4A 3OVNA 2RKIA 2YNGA 3WNEA 4IKFA 2KFZA 3PO5A 2F8TA 4BE2A 4KREA 4FJLA 4M3TA 4LSLA 1WLJA 3RWUA 4I2PA 4CHQA 3AVLA 4CJ4A 1JL1A 3LP1A 4DTSA 4E3SA 4AH9A 1U4BA 1HYSA 2E6LA 3ZCMA 1D8YA 4Q0BA 2XY5A 1RT2A 1S6QA 1RILA 2VG6A 4HUGA 1T7PA 4E89A 1X1PA 4FLXA 4PY5A 4J2BA 4Z4FA 1VSIA 1G15A 4DSKA 1BCOA 3HPOA 3M8RA 1ASWA 3LWLA 4FCYA 1NK8A 2XY7A 3PX4A 4H4OA 4CF1A 4Z4CA 3HJFA 3THVA 1BIUA 1SL1A 4CJSA 4B3OA 3HO1A 3V9UA 4LY7A 4M3WA 1TK8A 2G8FA 2F8SA 2F96A 4DTPA 1VK0A 1NJYA 3VQ6A 1KTQA 4CFDA 4XIUA 5J2PA 3L3UA 4ID5A 2YNFA 3DYAA 4M41A 4CERA 3AV9A 1JXEA 4AHRA 1HNVA 1QS4A 1VRUA 2D0CA 3DI6A 3WNFA 3BGRA 4DLEA 4ELUA 3HL8A 3ISNC 1TGOA 4DSEA 2FBTA 3O3HA 4MFBA 4CJWA 3SPZA 1VSJA 4F3TA 5EU7A 2GUIA 4NCAA 4E7KA 3ULDA 3DLHA 4HCCA 3KLEA 4DFPA 1BHLA 2G8WA 4B9UA 3FFIA 1BQMA 3DRPA 4CF9A 1W9HA 3OS2A 1TK5A 1WN7A 1XC9A 1HMVA 2W42A 3L2RA 1S1VA 4CJFA 3VA0A 3QNNA 3LPTA 2RPIA 3K5OA 1QSSA 3RMAA 1XHZA 1BI4A 1TKXA 5FDLA 4DF4A 4B8CA 1J9AA 3RMBA 4L8RB 1C1BA 2WONA 3MEEA 4N56A 1VSEA 4HVJA 3SYZA 2YV0X 4FLWA 1KCFA 1HYZA 5CY4A 3NF9A 1I39A 1O1WA 4TSXA 4KB1A 4FJ7A 3ALYA 3ZSQA 3VQ7A 2OA8A 4KHYA 4ZHRA 4Q5VA 3L2QA 3L2VA 1HQUA 3SUQA 3V9WA 2IDOA 4AILC 5J1EA 4KHNA 1CXUA 4YNQA 2XRIA 4E7JA 3ZSVA 2ZQBA 3M8QA 4DFJA 4I9LA 4B9NA 5D3GA 4IG0A 4RW6A 2QXFA 1BL3A 2FC0A 3P5JA 1EETA 3NGZA 3OYCA 3CFPA 3LP0A 4DTRA 1ASUA 2ATQA 3VQPA 1RDBA 3AVIA 3KLIA 2EHGA 5FROA 3ZT2A 4CEDA 3NH1A 4BDPA 4KTQA 3SQ1A 4CFCA 3HT3A 1C6VA 1RBTA 3CM5A 5J2NA 4E1NA 4FLTA 1T03A 1BISA 2RF2A 3NH2A 4DMNA 3QETA 3K59A 2D0BA 3K5LA 3TANA 4CEQA 3NCIA 4CEAA 3VQCA 1CZBA 2VWKA 1JLQA 5HLFA 1NK4A 4RG8A 4FZYA 2Y1JA 4KPYA 2KW4A 4CHOA 1XI1A 1NKCA 2HW3A 3AO2A 1S1UA 2P1JA 1JLFA 3SPYA 2RN2A 1RBVA 1WSJA 4KAZA 4CEZA 3CG7A 5C42A 4FXDA 3QEWA 5E41A 4N41A 3C95A 3DM2A 3NF8A 4RW8A 3ZSRA 3O3GA 4PA1A 3NDKA 1NKEA 1L3VA 3HVTA 2IAJA 3MAQA 3V9XA 4F2SA 4O4GA 3HXMA 1JLEA 1TKZA 5KRSA 3T3FA 4DSJA 1QHTA 4B08A 4CJLA 3ZSYA 1XHXA 4E19A 1EP4A 4CHYA 5I42A 1QSLA 3C94A 1T8EA 2PYLA 3AO3A 1HPZA 1RT4A 4FJGA 4BWMA 4FJNA 3AVGA 2P5GA 4AHCA 3NE6A 4OLAA 1RDAA 3ZT1A 2OYQA 1RBRA 2IOCA 3KKSA 4ZTJA 2DFEA 3AVAA 1NK0A 2ETJA 3CFRA 4E7IA 3LDSA 3OYIA 1J5OA 1B9FA 1S9GA 5HRRA 1Q9XA 2HB5A 4RW4A 1UAXA 3TR8A 1ZYQA 4CHZA 4OPJA 3HYFA 1LAWA 3EY1A 3RR8A 1JXBA 4CESA 3ZT4A 4OPKA 3PV8A 3LZJA 4W5OA 1RT5A 2Z1JA 3D0PA 1KLMA 2PYJA 2YHBA 1VRTA 3OYBA 1RT6A 2EX3A 4CGJA 3SV3A 4B9LA 1DTTA 2HVHA 3G10A 4ELTA 3AVHA 4NCGA 1NJZA 1KSPA 1QTMA 2XY6A 4Z4EA 3TWHA 3VQ5A 2VG5A 3KK3A 5FRNA 4KRFA 4M45A 3PX0A 5HP1A 4DU1A 3SUPA 1B92A 4C8OA 3QNOA 3F73A 4OVLA 3WNGA 3C6UA 4DTUA 2P51A 2IGIA 1IKVA 4O55A 3KK1A 4FM2A 4KB0A 4J2EA 3A2FA 4CJKA 1BI4B 4CK2A 1ZBUA 4W5TA 4K8XA 1S1XA 4BDZA 3SQ4A 1VSMA 4CIFA 1RTJA 4B8AB 2X74A 4Y1DA 4OKJA 4CGGA 4E7HA 4KV8A 3AVJA 3OYGA 4C8KA 4CFAA 3SQ0A 1ZBIA 1VSLA 4FLUA 1TV6A 2OPQA 5CZ2A 3M8PA 3VQQA 1UA0A 2B5JA 4QOZB 3QEIA 4E0DA 3D45A 3L3VA 4GW6A 1L3TA 1NK6A 1BGXT 2HHSA 2X78A 2HNYA 3OS0A 1Z26A 4JRPA 2BANA 1JLCA 4DQRA 3ZSWA 1RT1A 4KFBA 3RRGA 1SUQA 4FZXC 3V1QA 4Z4HA 4KHUA 4LSNA 4CJUA 3OJUA 3HPHA 4IG3A 1TVRA 3V9ZA 2Y1IA 2HHXA 3KIOA 1J53A 1J54A 1RBUA 1CXQA 1RNHA 1RT7A 2O4GA 3HPGA 3IRXA 3KTQA 4C8LA 4NYNA 1HJRA 3L2WA 3PY8A 1NJXA 1T05A 1NOYA 2D5RA 4NCBA 3OYEA 3PX6A 3K5NA 4LH5A 4AHTA 3RMCA 3KJVA 3V1RA 1L3UA 1TAUA 3HK2A 4KTZA 3QIPA 4KI4A 3P1GA 4IFVA 4AHSA
chains in the Genus database with same CATH superfamily
4QAGA 4H0PA 1FK9A 3M8SA 4C23A 3R8EA 1NGAA 2CH6A 2W6LA 1VQON 4O0IA 3DLLL 1EWRA 4J8FA 5C24A 2CGKA 4BWJA 5CYMA 1Q86O 2WOMA 4DSLA 4F3OA 3KWGA 4CK1A 3LAKA 1NNEA 1K6YA 3L4QA 2OZSA 3TSUA 4F9OA 3G4SN 2HNDA 1K9MO 4B9SA 1HRHA 4CJTA 1YT3A 2JWKA 2HNZA 4YOVA 2G8IA 4YOTA 3TAEA 4C8MA 1XMOK 3IS9A 5JS1A 1GOCA 3AVKA 3MK6A 2HHUA 4BRCA 5BPMA 4YOWA 2UYTA 4BQZA 1ESVA 3RMDA 1HQEA 1C0MA 3KK7A 4IDKA 2E2PA 4ID1A 2NZTA 3RSEA 4O5BA 1P8ZA 2F9WA 4FJJA 1HX1A 2P5OA 1X9WA 1Q9YA 3VQAA 1ITGA 2G8UA 1QSYA 5BRFA 1QQNA 3DOLA 2BGGA 1RGIA 3T1AA 4LF4K 3U9ZA 1EKEA 4DQSA 4DSIA 3D2EB 3AVBA 5IWAK 5SWMA 2QKKA 4FK4A 3MECA 3QB0A 2E5LK 4Z4IA 3VQ9A 3HSTB 1HNXK 2Q2RA 4CECA 3LALA 3J81O 5I9EB 3TAFA 3O3FA 5J2MA 4CI6A 4FJKA 2UXBK 3HSCA 1DKGD 3SI6A 1LAVA 2NRZA 5K14A 4L3QA 1IH7A 1NKBA 3DAWA 1DEJA 3NFAA 3KK2A 4CGFA 1VSDA 4FL9A 1K8KB 2X6SA 4B1ZA 1XNRK 4FOIA 4DKWA 3ENBA 4XH1A 2QKBA 1BQNA 4HTUA 3CC2N 3DRSA 3PIPL 3VN5A 4LH4A 2VQFK 3TPQA 3KVGA 3J7AP 2B4JA 4O0JA 4CZIA 1SL2A 2FBXA 2FSKA 3E01A 4RW7A 4GMJB 2GEMA 4WQ5C 1RDCA 4ILGB 3M5RA 3U3YA 4CBUA 4DTXA 3O4QA 5J2QA 4CZLA 4CJEA 2VQEK 4JEPA 3HVRA 5M1PA 1MA9B 3DMJA 1FXXA 3OBYA 4FSVA 4DTOA 5M1OA 1S9EA 3U3GA 2ZWHA 4H5WA 4MO5A 4H0YB 4A61A 3FGUA 1TYQB 4WFAL 5HRSA 4DTMA 2NNWA 4WQ4C 3WXMB 4DU4A 1UWBA 3L4IA 4Y1CA 2X6NA 4GV6A 1JCEA 4CEOA 4IZ9A 3SAFA 2DTUA 2V7YA 1W97L 4MO4A 3HOTA 3G71N 3NF7A 1KFSA 2E2OA 1S1TA 4C8NA 4JI4K 3NVKA 3KLGA 4H5RA 1JLGA 5ELZA 1YJ9N 3IUCA 4EZ9A 1U2VB 3UKUB 3U6FA 3CCJN 4E1MA 1NK5A 1SL0A 3I8DA 3MX2A 2FLOA 3G0ZA 1N6QA 4B9VA 1I94K 2FBVA 5HBMA 4W5QA 1A5WA 4BRAA 1Y64A 1C1AA 3BDPA 5AQGA 5EY4A 2G8KA 5JVGL 3OYJA 3SZ2A 3VQBA 1WAFA 4CJPA 2OPSA 1QZ6A 2LSNA 1VSKA 3AVNA 3QIOA 1VQPN 4V19S 1S6PA 1R0AA 2JGUA 4JI7K 2Z1HA 4HHTA 2HBJA 3BF1A 3EN9A 1JJ2M 2ZF5O 3TARA 2GBZA 1QQCA 3LANA 3CQ8A 1WSFA 3K9KA 4DU3A 5EX5A 1UOCA 1KVAA 3AA4A 4JRQA 4M3XA 1S3XA 2E88A 2YJEA 1IKYA 3DXMB 5AQKA 5KGXA 4OLBA 3SUNA 2YJFA 1XUPO 3LPUA 1SV5A 2KKZA 3E9LA 4LD0A 1IBLK 1WBDA 5C2DA 3DLEA 1GLDG 3HP6A 1GLBG 4X64K 3VQDA 1UA1A 3ZLJA 1D4XA 3OVNA 3WNEA 4IKFA 4FJLA 4M3TA 4LSLA 4CHQA 3LP1A 1D8YA 1RT2A 4PY5A 4J2BA 3QICA 3VEXA 4DSKA 5HL7L 2E2NA 1T44A 3LWLA 3PX4A 4H4OA 4Z4CA 3HJFA 3I56N 3HO1A 4LY7A 4M3WA 2ZJRL 4FWMA 2VGNA 4XIUA 5J2PA 4M41A 3DYAA 2E2QA 4CZMA 3A5MC 3UKRA 3AV9A 3WNFA 1ATRA 1BOTO 1TGOA 3T7ZA 5LJWA 3O3HA 3I33A 4HCCA 5BR8K 2G8WA 1BQMA 1HJOA 3OS2A 3A5NC 1QHAA 1TK5A 4AQYK 2BUPA 1NGDA 4CJFA 3IDHA 3LPTA 3RMAA 3CJ9A 4JKAA 1TKXA 1J9AA 4CW7B 1VSEA 4FLWA 3NF9A 1I39A 1O1WA 4KB1A 3H46O 1KAXA 1OKJA 3VQ7A 4KHYA 2UUAK 5BPNA 4ZHRA 4Q5VA 3SUQA 3V9WA 5M1KA 1U6ZA 1Q7YO 3P39A 4LFAK 3Q7CA 1N32K 4IG0A 3MX5A 2GELA 4BRPA 2V52B 4KTQA 3KLIA 3ZT2A 2EHGA 1K8AO 4BR9A 1T03A 1BISA 3NH2A 3QETA 3K59A 2QWLA 4CEQA 2Q36A 5HLFA 4GVEA 1QZ5A 1LOTB 1S1UA 3LDPA 3SPYA 1WSJA 4JHDB 4CEZA 4HTLA 5AQIA 3D2FB 3QEWA 1YITN 3C95A 3NF8A 1L3VA 1NGJA 3IFRA 2OTLN 3VMFB 3HXMA 5KRSA 4YOXA 3VEWA 4DSJA 1QHTA 4E19A 2NRHA 3CQXA 5I42A 3G6EN 4BWMA 4BRNA 5DM7L 5E84A 3KKSA 3UE5A 4RWTA 2NRTA 2ETJA 3CFRA 3OYIA 1JCGA 4JI1K 3HOSA 1Q9XA 4BY9C 3TR8A 4CHZA 4OPJA 3RR8A 3ZT4A 4OPKA 3PV8A 2ZJQL 4ISGA 1RT5A 3ULEA 1VRTA 1RT6A 1DTTA 3CPEA 3G10A 1KSPA 1NJZA 4H03B 3CETA 2VG5A 5FRNA 4KRFA 3PX0A 5HP1A 2P9KA 3SUPA 3LM2A 4Y0WA 3ZX3A 3QNOA 3CXCM 2O8FA 1LCUA 2P51A 4O55A 4BRKA 3A2FA 4BR4A 1E4GT 1S72N 4CIFA 3K0SA 1RTJA 3QFUA 4Y1DA 5LMNK 4DV1K 4IDHA 1VSLA 5JLHA 4FLUA 5BRDA 5CZ2A 3VETA 1UA0A 4QOZB 3P4IA 3D45A 3L3VA 4GW6A 3OS0A 2Q97A 3ZSWA 1RT1A 1SUQA 1ATNA 3VEZA 4JAXA 4BC4A 3LDQA 3RSEB 1N34K 4C8LA 5GAHP 3H6EA 4NYNA 3L2WA 4UY8O 1NOYA 3PX6A 3RMCA 2NRWA 3V1RA 3QBWA 4FOEA 1G99A 3QIPA 3VTIA 2YNIA 4CZEA 4FK0A 4KHPK 4BC2A 3EKSA 3JSMA 2OTJN 3CJBA 2PBDA 3DXKA 1TK0A 4EP5A 1V4SA 2OZMA 3U9DA 2Q1NA 4O44A 3NAEA 5LMUK 3MEGA 2HBLA 3RR7A 2FSNA 4N47A 3MXMA 4HUFA 4FJHA 3ATVA 4CD1A 4KHSA 1BUPA 5FRMA 1WSEA 3IAYA 3RTVA 2GTDA 2P9UA 3B6PA 3FZKA 4DFKA 2NRXA 1IKWA 2YX6A 4IEEA 4AHUA 4FJXA 4B1YB 3T1YK 4DUYK 3EE9A 5LL6Z 3VF2A 2XY8A 3TABA 2VCPA 4DV0K 2FXUA 4OPHA 2XO7A 1KFDA 3CFOA 1NK9A 3QERA 2PYJA 2HVHA 3VA3A 3P83D 2OCEA 1FKPA 3VQEA 2G8VA 3C6AA 1GLLO 1NGHA 4R5PA 4B1XB 1MDUB 1BDGA 2G8HA 5AQFA 4M3UA 1REVA 4FYDA 2GUPA 3OYLA 4I6MB 3KHYA 3MXIA 3DOKA 4FJ8A 3H45C 4OGEA 3PO4A 4CF8A 4FZZA 2P9SB 1JCFA 4FW1A 4BE0A 4BR5A 2HHVA 4NXMK 3ZSXA 1Q18A 3SJJA 2Q0UA 2YHXA 3NH0A 3CCLN 4C1NK 1KRPA 3NGIA 4JK9A 5CE3A 3ITHA 2KTQA 3KLFA 1M90O 4YOYA 4CZJA 3WEEB 3B8AX 3RRHA 1U48A 4BRIA 5CR4A 3JAMO 1SKRA 1K8KA 4LF8K 4LFBK 4DQQA 4NYFA 2A6AA 2W41A 4RCHA 4EIAA 4FWRA 2HHTA 1WSIA 5EVZA 2OPPA 4JI6K 3GDQA 4CD3A 4DHYA 5AQXA 5C25A 4OKEA 3SMSA 3D7EO 1H1VA 3R1XA 1OVYA 1CLQA 2IVNA 4DTJA 3FZHA 3GL1A 3MN5A 3CD6N 2Z1IA 4DSFA 4ELVA 3OBWA 5KQDA 4HCBA 3LAMA 4OJRA 5C2FA 1KVCA 4FM0A 1CZAN 2W6KA 1B9DA 3WQTA 3O1BA 2PAVA 3AGRA 4IXCA 3MDQA 3QO9A 2HMIA 2IC3A 4LF6K 4H0TB 4NB4A 2ZM6K 4WCEL 3ENHA 1KLNA 3H08A 5T7BA 4QCLA 3I55N 1XWLA 4JI2K 4DG1A 3A5LC 3MCAB 3SCXA 5LJVA 4BQLA 4ISFA 4EZ6A 4BVPA 3C7NB 1KAYA 2P9LB 1LV5A 5GINA 2P9IA 1Q81O 2ITGA 4WE1A 2QI2A 3AO5A 3K57A 3ZT3A 3F9MA 4CHNA 5AQNA 5H1SQ 2F9TA 3QEPA 1T3VA 3CJ7A 4QS8A 4YDUC 4DV3K 4CGDA 3P38A 5AQOA 3OYHA 4CEBA 4FPBA 2J4RA 4CFBA 2ZGYA 1LW2A 1RFQA 4JS5A 4JNEA 4KI6A 4AHVA 4FWNA 3LWMA 2HHQA 4O5FA 1ZBFA 3QINA 3PSFA 1N5YA 2KQ2A 4JI3K 3DLKA 3AA5X 3C6TA 2PY5A 4H5NA 3H3OB 2A42A 4H4MA 4X62K 3BZCA 4RW9A 3RVCA 3QMLA 4M42A 3KZBA 5KI6A 5JLFA 3L0QA 1JLAA 3TAMA 4XH5A 4CIEA 1XMQK 4KHQA 2ASPA 3N4QA 4CCHA 4NLCA 2I5JA 1YTAA 1XQSC 3J8AA 3ZX0A 2VG7A 3OYFA 1VHXA 3TAPA 2O8DB 1V4TA 2B6AA 1EX4A 1GLJO 4I2QA 3CPWM 4K0KK 3CCEN 3WXLA 3D2EA 1NGBA 1EQYA 1IBKK 1SS6A 3BF3A 5AQVA 1IO2A 5FPNA 5TKWA 1J6ZA 3M6GA 1JL2A 1C0FA 2RKIA 5AQJA 2KFZA 5JVHL 4BE2A 1WLJA 3RWUA 1JL1A 4E3SA 3WXKA 1BU6O 1U4BA 4XEIA 1T7PA 4MLEA 4HUGA 1VQ9N 3NMUA 1VSIA 4MDBA 1ASWA 2QWQA 3O9QA 4AM7A 4CF1A 2UXCK 2GX9A 1SL1A 4WYBA 4CJSA 4BR2A 3V9UA 1TK8A 2G8FA 4DTPA 1VK0A 3A0IX 4CFDA 2YNFA 1Z05A 4CERA 1N8RO 1JXEA 4FWKA 1QS4A 1VRUA 2D0CA 3BGRA 1HPMA 3S41A 4OO1J 1E4FT 2QWNA 4CJWA 4F3TA 5EU7A 1YAGA 4DFPA 5AFUH 4B9UA 4I6MA 2KHOA 3DRPA 4CF9A 1W9HA 2UUBK 1HMVA 2W42A 2ASMA 3QNNA 3VA0A 1QSSA 3TTCA 1XHZA 1BI4A 3RMBA 5FDLA 2HHHK 4XH4A 4N56A 2PFUA 4HVJA 3SYZA 2YV0X 1HYZA 3E9PA 4IJNA 3ALYA 4WQ4A 3THYB 4BG8A 2HBMA 2P9PB 1VQ5N 2O8CA 4BRLA 1HQUA 1J5EK 4KHNA 4E7JA 4YNQA 2ZQBA 4DFJA 1BL3A 3TAQA 3CCRN 4DTRA 3CMEN 4ZTFA 1ASUA 3VQPA 3AVIA 3F2KA 3G25A 2E1YA 1RBTA 5J2NA 4A62A 4FLTA 2RF2A 4DMNA 2FF6A 5AQTA 5GADP 3NCIA 4NXNK 3VQCA 1CZBA 4FZYA 4RG8A 2Y1JA 2KW4A 5AQPA 4CHOA 4FVUA 3AO2A 4DV7K 2P1JA 3VGKA 5KQ8A 4OPAA 3OTOK 4RW8A 3ZSRA 3DXMA 3MAQA 1JLEA 1TKZA 1ZC6A 1WB9A 4NO7A 4B08A 3UKRB 4FPAA 4IEIA 1QSLA 2F4VK 1T8EA 2PYLA 4FJNA 1RDAA 3ZT1A 2IOCA 4ZTJA 3MCPA 3LDSA 2WC9A 1J5OA 1B9FA 1S9GA 1VAZA 2HB5A 4RW4A 1ZYQA 2CGLA 5BN8A 3HYFA 1LAWA 3I8BA 1YIJN 1YVNA 4GV9A 3D0PA 3N4PA 2YHBA 3OYBA 4B9LA 4CGJA 1QVFM 3WT0A 1SZ2A 4ELTA 3R6MA 1QTMA 4Z4EA 4CZHA 1K73O 4X65K 3F5TA 3MN6A 4FM2A 1IKVA 2OANA 3FZFA 3CC4N 4CK2A 1ZBUA 4W5TA 4DR6K 4B8AB 4OKJA 4CGGA 4E7HA 3AGKA 3AVJA 4CFAA 1N36K 3SBTA 2VGMA 4JK7A 5C0YA 4E0DA 3CCMN 1NK6A 2HHSA 2IVPA 5C12A 1X3NA 3O80A 2BANA 2WTUA 3E9OA 1FW6A 4CJUA 3OJUA 3ID6A 1TVRA 2O8BA 3KIOA 3IRXA 3HPGA 1WBBA 3KTQA 2O4GA 3HBTA 2O8CB 4HWIA 2P9NB 4JD2A 1T05A 4NCBA 3H1QA 3MN7A 4LH5A 4AHTA 3KJVA 1TAUA 3BUZB 4A59A 4BRFA 2QTDA 3WXJA 1VSHA 3CM6A 2RE2A 3EZWA 2O8EA 3WEEA 3S3NA 1TL1A 1WOQA 3ZSOA 1U47A 2JLEA 2Q3SA 3CI5A 4C1NI 1KC8O 5JS2A 3OYMA 4FJ9A 2YNHA 5IT9O 4DR2K 1WSHA 3KD5E 2BTFA 4DS5A 2O4IA 5KGWA 4DTNA 4DR4K 4EP4A 3SUOA 4WQ5A 1Z25A 3OW2M 4IBNA 3ASMA 4I7FA 3CJ1A 5DMRA 4DLGA 1JKHA 2V7ZA 4KBOA 5SZTA 4B3TK 4CK3A 1ZBLA 3BY5A 4KH5A 3AAQA 3SLCA 4B9QA 1SKSA 4FJIA 1BO5O 1GOBA 1HNIA 4CF0A 3CYMA 3VPZA 4CZGA 3VEOA 4M63C 1RDWX 1L5UA 3KD1E 4GV3A 4KH4A 3KKRA 4DFMA 1TUYA 1TKTA 1VSFA 3FR0A 4WFNL 1OH5A 4K41A 5DK5A 4PQUA 1D5AA 3ZETA 4BRQA 3CCUN 1QVGM 3DLRA 2XHBA 1FKOA 1FJGK 3HZ6A 5GIOA 2FF3B 4FO0A 3H1VX 2YCHA 2HMPA 2KFNA 2E4LA 3E66A 5F2RA 4GKJK 1S1WA 3V9SA 1D9FA 4NLBA 3V4IA 2YKNA 3DRRA 3ZSZA 1VQLN 4FJMA 1EWQA 3K5MA 1EXQA 2I7PA 3LL3A 3AA3A 4I9QA 2Q0RA 4DV2K 3SQ2A 1X3MA 4JD2B 4F4KA 1NG9A 5AZJB 4JKGA 4YFUA 4CEEA 1KAZA 3SV4A 1L3SA 4W5NA 4KKOA 1OH7A 2CGJA 1GOAA 4DV6K 3SAGA 4BROA 1IKXA 3SBGA 4E7LA 3MEDA 5ADXA 4BC5A 2IS3A 3I0SA 2NLXA 3OYDA 3AVMA 1JLBA 1NK7A 5HROA 3U4LA 5I3UA 1NGEA 4B9MA 1LWCA 5M1FA 2O8DA 3O4WA 4KTWA 1U45A 4H0XB 2R7YA 2KZMA 2BDPA 2HVIA 2ZE2A 4DR1K 4CEFA 1QE1A 4U67L 4N5SA 4B3RK 4Z4GA 3J80O 1W0HA 4KHWA 3DXKB 3FFKB 4CIGA 4BR0A 3D6RA 1YJWN 3VESA 3GBTA 3THXB 1P90A 3LP2A 2HHWA 4Z0UA 1DLOA 4IO9L 3QEXA 3UB5A 4EFHA 4M3YA 3OA9A 3VENA 4FWQA 4Z94A 1BCMA 1D9DA 4H0VB 1BA1A 2JWLA 2UU9K 1NGFA 1GLEG 4FM1A 3NGYA 3CHWA 3HI0A 1X9SA 5AZIB 4PHTX 2A1SA 1KVBA 3K58A 4DV4K 1CZ9A 3DLBA 3L6QA 1O13A 4CJ7A 1T6DA 1VQKN 2UXDK 5F0XA 3T1HK 4B9TA 3E1YA 4FVMA 2YKMA 4F2RA 1RT3A 1C0UA 2E6MA 1YTUA 3TTDA 3KLHA 1TAQA 2YHAA 1LW0A 3QEVA 5LY3A 1WAJA 4DF8A 4LF7K 2A5XA 3M3ZA 1OH8A 4BGAA 4JKDA 2KZZA 4BE1A 4FK2A 2A3ZA 2AJQA 4E1JA 3LZIA 1OVQA 5BN9A 2VWJA 3VQ8A 1LWFA 1S22A 3M1FA 4JI0K 4BRDA 2D0PA 3V6DA 3AO4A 4JN4A 3PO5A 2F8TA 4KREA 4JHDA 4I2PA 3MN9A 3QDKA 4AH9A 1HYSA 3ZCMA 5KPRA 4Q0BA 1S6QA 1RILA 1NU0A 4K42A 4FLXA 4Z4FA 1VQNN 2WUSA 4EHUA 3M8RA 3CMAN 4FCYA 2XY7A 3TTFA 3ENOA 1BIUA 3NVMA 3THVA 2ZGZA 5AQLA 3W3DA 3IMXA 4LFCK 2FSJA 2QM1A 5AQRA 3VEVA 1YF5L 4JI8K 1HNVA 1VQ8N 5EXWA 4OX9K 4ELUA 4QS9A 4MFBA 3PIOL 1VSJA 1HLUA 3CCSN 2GUIA 3R9PA 4E7KA 3KLEA 1SAZA 3JS6A 2RPIA 4DF4A 4B8CA 3DWLA 1C1BA 2WONA 4CVNE 3ZEUB 5CY4A 1KCFA 1IJJA 2VWBA 2QXLA 2O8EB 2QEXN 3MWPA 2OA8A 3MWTA 4ISEA 3L2VA 4AILC 3CJAA 1CXUA 3ZSVA 4B9NA 1MWKA 4GNIA 5D3GA 4RW6A 2QXFA 3TU5A 3P5JA 5AZJA 1EETA 3NGZA 3CFPA 2ATQA 4CEDA 5FROA 3NH1A 3SQ1A 4CFCA 1C6VA 3CM5A 4E1NA 4JV5K 3K5LA 4WFBL 3TANA 4MLHA 4CEAA 2VWKA 4H0OA 1XI1A 1XC3A 1JLFA 2RN2A 1YXQA 1RBVA 1Z6RA 1BWFO 2AA4A 2IIRA 2I7NA 3CG7A 5C42A 3VTHA 3O9RA 3DJCA 3O3GA 1NKEA 4F2SA 3MMVA 1KXPA 3C6HA 4O4GA 1KQSM 5FPMA 1NLVA 3D2FA 3ZX2A 3C0BA 1XHXA 4CZFA 1EP4A 3C94A 3AO3A 1HPZA 3BP8A 2P5GA 4OLAA 4WF9L 2OYQA 4IWVA 1NK0A 2DFEA 3AVAA 4E7IA 5HRRA 5FPDA 5KPZA 3CCVN 1UAXA 3TSQA 3EY1A 1JXBA 3LZJA 1TYQA 3LDOA 3PLAA 1KLMA 2RHKA 5TKYA 4NCGA 3T69A 2XY6A 3TWHA 4BREA 3VQ5A 4YHHK 1NJIO 5AZIA 5M1QA 4DCHA 3F73A 3ATUA 4OVLA 3WNGA 2IGIA 4J2EA 3KK1A 4CJKA 1BI4B 1S1XA 3SQ4A 1VSMA 3C65A 3THWB 2X74A 3OYGA 5A2QO 2P9UB 2GWJA 3SQ0A 1TV6A 5AQQA 3LM9A 1L3TA 1BGXT 2DPNA 2X78A 2HNYA 4DQRA 3H3NO 3V1QA 4Z4HA 4LSNA 3VEYA 4IG3A 3V9ZA 2Y1IA 1RBUA 3FLCO 5AFUA 1HJRA 3PY8A 5BR9A 1NJXA 1L3UA 1QQMA 3HK2A 3P1GA 4J2DA 4IFVA 3FZLA 1ASVA 1HYVA 2Z1GA 3LP3A 3EZ5A 1NBWA 2E1ZA 4FWSA 4B1UB 3SAHA 1QQOA 2P9LA 3J7YP 2ZJPL 5FPEA 4ICLA 4DB3A 3ZEUA 4DWIA 1YUWA 3EEQA 3ZYYX 5AR0A 4LF9K 2NRRA 2V51B 3S3OA 1U04A 2FBYA 4IFYA 5BPLA 3SJHA 5DM6L 4FJ5A 4DR7K 3Q7BA 3HM9A 1BIZA 5B8HA 3UIQA 4M3RA 2D0AA 2WBNA 1C0GA 1N33K 2QW9A 1RTHA 4PKIA 3LDLA 4LC9B 3QLHA 3IKMA 3MXJA 3EL2A 5M1NA 4K43A 1SKWA 1EO1A 1Y97A 2O8FB 2NUBA 3PSIA 3O1WA 2IVOA 3JYTA 3THXA 4CJRA 1GLFO 1TL3A 4BRGA 1NJWA 5C15A 4G1QA 4J2AA 4LF5K 1HKCA 3F9KA 1MU2A 1HNWK 1U49A 3CIPA 3AY9A 3VGLA 2WFBA 5AQSA 4N76A 3HM8A 5C10A 3T19A 4CBWA 1W7AA 1NOZA 2DY4A 4M3ZA 4H5VA 3WQUA 2GV9A 3TAGA 1I3AA 4FWLA 4H5TA 4PL8A 2YHYA 1ZBHA 3UKUA 3PUFA 1A5XA 2BE2A 4CF2A 1RDDA 4CGHA 5GIPA 4FLYA 3O8MA 3WNHA 3VOVA 4MQ3A 4F8RA 3EO3A 4CJ5A 4CJQA 3EE8A 1C0TA 1IG9A 2DFFA 4M7YA 3OYKA 4CHPA 3OYAA 1DGKN 4DQIA 2D4WA 3O08A 1YVUA 1X9MA 4O8UA 4CJ3A 4BG9A 3U8XA 5CZ1A 3AARA 4DQPA 3L8BA 1WUAA 4BRHA 1WNSA 2E20A 5AQYA 1VQMN 3AAPA 3CERA 5E26A 1YI2N 2CH5A 4FLZA 4CE9A 3AO1A 4BVOA 4BDYA 1U2VA 2A41A 4FW2A 4U7BA 4FLVA 1HKBA 4JLHA 1MWMA 1XNQK 2HOEA 1C1CA 4H8KA 2BH1A 4IOCL 4DS4A 5HRNA 2A1RA 2QK9A 1F21A 5CYQA 1RTIA 1ZXOA 1X9JA 3EYZA 5AQZA 5MLCQ 3IG1A 2E8AA 4ILJA 4PKGA 4KO0A 2A40A 3R3LA 4YORA 1RBSA 2DFHA 3L2UA 4W5RA 4JS4A 4R79A 3DLGA 1A5VA 1NGGA 3AVCA 3ZT0A 4CGIA 3I0RA 1HNZK 2ASOA 2PZSA 4BGBA 2P9IB 1NMDA 3OYNA 4DR5K 3NF6A 5BREA 5HOOA 1E3MA 2Q31A 3THYA 1ATSA 1GLCG 2YI1A 4BC3A 4PKHA 4BACA 3TI0A 1RTDA 2P9SA 3O4NA 3V81A 4JYAK 4HUEA 5FLXO 1KD1O 3ID8A 1S5JA 4CJVA 5EOYA 3P31A 2HSTA 2QWPA 4OGCA 1Q8IA 2VYPA 3V1OA 4GVMA 3GE1A 4X66K 3S9HA 3AVFA 4JKHA 3BZKA 3VGMA 1RCHA 4JKEA 4MDAA 3VQ4A 4CBXA 2QWRA 5HRPA 1DTQA 2P9PA 4K25A 3SNNA 3OS1A 4A2BA 3K9JA 3CCQN 4AF1A 4OKKA 4PUOA 3EKUA 3AA2A 4B3MK 1TKDA 3O9UA 3OY9A 4KH6A 3S3MA 1LWEA 1WSGA 5KTQA 3NHGA 4PWDA 4UQGA 2AP1A 2ZD1A 2W40A 4RTFD 4JI5K 4K8ZA 2GWKA 2OPRA 3OJSA 3QESA 1YHQN 5KRTA 3CC7N 1Q82O 3B6OA 3W0LA 1M1KO 3HP9A 4AM6A 3THWA 3NBPA 1NMNA 3K2PA 2YNGA 4DTSA 3AVLA 4CJ4A 2F7TA 1R59O 2E6LA 4CZKA 2XY5A 2VG6A 3FE1A 4E89A 1X1PA 3C7NA 1G15A 1VQ7N 1HR0K 1BCOA 1HUXA 3O9TA 3HPOA 2EWSA 1NK8A 3O9SA 3GOIA 5CHIA 4B3OA 4IOXA 2ITMA 2F8SA 2F96A 1NJYA 3VQ6A 1KTQA 2HBKA 3L3UA 4ID5A 3CF5L 4FWPA 4AHRA 3DI6A 2H3GX 4DLEA 4B1VA 3HL8A 3HRGA 3ISNC 4DSEA 2FBTA 3SPZA 2D1KA 4JK8A 4NCAA 3ULDA 3DLHA 4DUZK 1BHLA 3CQYA 3FFIA 4M7XA 1NGIA 4IFEA 2HF3A 1WN7A 1XC9A 5GAGP 3L2RA 1S1VA 3VF4A 5AQUA 3K5OA 4L8RB 1T6CA 3A5OC 3SK3A 3MEEA 4YOUA 4JKGB 1HKGA 4A5BA 4TSXA 4FJ7A 2P9KB 3ZSQA 3TSPA 3L2QA 1GLAG 2D0OA 4A57A 1W2BM 1IBMK 2IDOA 1BA0A 2P9NA 3QBXA 5J1EA 1TUUA 2XRIA 3M8QA 4I9LA 4IOAL 1NM1A 4BR7A 4PL7A 4QS7A 4IJAA 3FZMA 2FC0A 3OYCA 1ILYA 3LP0A 4DR3K 1RDBA 4BDPA 1VQ4N 3WUHA 4FWOA 2HF4A 5KPTA 3HT3A 5JMVA 2D0BA 1YJNN 1NK4A 1JLQA 4KPYA 1NKCA 2HW3A 2QA4N 4EAHD 1SQKA 3VERA 4KAZA 5GAEP 4FXDA 4N41A 5E41A 3HTVA 3DM2A 3NDKA 4GKKK 4PA1A 3WXIA 3HVTA 2IAJA 5AQMA 3V9XA 3KWIA 3T3FA 3VF6A 1IV0A 4CHYA 4CJLA 3ZSYA 5ADXH 4JKFA 4FJGA 1RT4A 3AVGA 4YY3K 4AHCA 3NE6A 1DT9A 1RBRA 3GG4A 3SMPA 4B1WB 1OH6A 3CJCA 2QWOA 4O8KA 4CESA 3QFPA 2NRVA 3O6WA 2UUCK 4W5OA 2Z1JA 4DQ8A 3OHRA 1BG3A 2EX3A 3SV3A 3LDNA 3AVHA 1NGCA 4A2AA 3KK3A 4M45A 4DU1A 4C8OA 1B92A 1VQ6N 3A8YA 3C6UA 4DTUA 4KB0A 4EHTA 4G9ZA 4GY2B 4K8XA 4BDZA 4ILHA 5AQWA 3O5BA 4KV8A 4C8KA 4JKCA 3J7ZO 1ZBIA 1ZBSA 1IG8A 2OPQA 3M8PA 3VQQA 5F1XA 2B5JA 3QEIA 2YHWA 1RDUA 1Z26A 4JRPA 5AQHA 3JXUA 3ZETB 1JLCA 2QWMA 4KFBA 3RRGA 4FZXC 3BEXA 3ULEB 4KHUA 5BRHA 3HPHA 4A5AA 5JICA 2HHXA 4B3SK 1NWKA 1J53A 1J54A 4DV5K 1CXQA 1RNHA 1RT7A 4IO8A 2D5RA 2O8BB 3OYEA 2KLAA 3K5NA 4BRMA 4JKBA 4KTZA 4YDUA 4KI4A 5AJ3K 4AHSA
chains in the Genus database with same CATH topology
1VSHA 3CM6A 1ASVA 2YNIA 4QAGA 4FK0A 1HYVA 2Z1GA 3LP3A 3EZ5A 3S3NA 1TL1A 3JSMA 1FK9A 3M8SA 3ZSOA 4EP5A 1U47A 2JLEA 2Q3SA 1TK0A 2OZMA 4ICLA 4O44A 4O0IA 3NAEA 5JS2A 3OYMA 4DWIA 4FJ9A 2YNHA 5C24A 3MEGA 4BWJA 5CYMA 3RR7A 2WOMA 4DSLA 4N47A 3S3OA 4F3OA 1U04A 2FBYA 3MXMA 4IFYA 1WSHA 4HUFA 3KD5E 4CK1A 4FJHA 3LAKA 4KHSA 5FRMA 1WSEA 4DS5A 3IAYA 1K6YA 3RTVA 2OZSA 4FJ5A 2O4IA 3HM9A 1BIZA 3B6PA 3UIQA 5KGWA 2D0AA 4M3RA 4DFKA 4DTNA 2HNDA 4B9SA 1HRHA 1RTHA 4CJTA 1YT3A 4EP4A 2HNZA 1IKWA 4AHUA 3SUOA 3QLHA 4FJXA 2G8IA 3MXJA 1Z25A 4IBNA 3ASMA 4I7FA 5DMRA 4DLGA 3TAEA 2XY8A 1JKHA 4C8MA 1SKWA 5SZTA 3IS9A 1Y97A 4CK3A 1ZBLA 1GOCA 3AVKA 3TABA 2HHUA 5JS1A 2NUBA 3JYTA 1SKSA 2XO7A 4FJIA 4CJRA 1TL3A 1KFDA 3CFOA 1GOBA 1HNIA 4CF0A 3QERA 3CYMA 3VA3A 1NK9A 1NJWA 3P83D 4G1QA 4J2AA 1FKPA 3VQEA 3RMDA 2G8VA 1HQEA 1C0MA 4IDKA 4ID1A 1L5UA 3F9KA 1MU2A 3KD1E 4R5PA 1U49A 3KKRA 4DFMA 4O5BA 1TKTA 1VSFA 4FJJA 2G8HA 2P5OA 5DK5A 4M3UA 1REVA 1X9WA 1Q9YA 4N76A 4PQUA 4FYDA 1D5AA 3VQAA 1ITGA 3OYLA 2G8UA 3T19A 3MXIA 1QSYA 3DOKA 4FJ8A 3DLRA 2XHBA 1NOZA 2DY4A 4M3ZA 3DOLA 1FKOA 4OGEA 2BGGA 3PO4A 4CF8A 4FZZA 3T1AA 2GV9A 3TAGA 4FW1A 1I3AA 4BE0A 2HHVA 1EKEA 4DQSA 2KFNA 2E4LA 4DSIA 1ZBHA 3ZSXA 3AVBA 3SJJA 3PUFA 1A5XA 2BE2A 4CF2A 3NH0A 1RDDA 1S1WA 4CGHA 5SWMA 3V9SA 4J2DA 1KRPA 3NGIA 1D9FA 3V4IA 2QKKA 3ITHA 2KTQA 4FK4A 3MECA 3KLFA 4Z4IA 2YKNA 3DRRA 3VQ9A 3HSTB 3WNHA 3ZSZA 4FLYA 4FJMA 4CECA 1EXQA 3K5MA 3LALA 3TAFA 3O3FA 5J2MA 3RRHA 3AA3A 4FJKA 4MQ3A 4F8RA 1U48A 4I9QA 4CJ5A 4CJQA 3SQ2A 1SKRA 1C0TA 1IG9A 2DFFA 4F4KA 3SI6A 1LAVA 5K14A 3OYKA 4DQQA 4CHPA 1IH7A 4NYFA 4YFUA 4CEEA 3OYAA 1NKBA 3NFAA 3KK2A 4DQIA 4CGFA 1WSIA 2HHTA 1VSDA 2OPPA 3SV4A 1YVUA 2X6SA 1X9MA 1L3SA 4W5NA 4KKOA 5C25A 4OKEA 1GOAA 4CJ3A 1IKXA 1CLQA 5CZ1A 2QKBA 4E7LA 4DTJA 1BQNA 3MEDA 3L8BA 4HTUA 4DQPA 2Z1IA 3DRSA 1WNSA 2IS3A 3VN5A 4DSFA 4LH4A 4ELVA 3I0SA 4HCBA 3OYDA 2B4JA 4O0JA 1SL2A 3AVMA 3LAMA 2FBXA 3E01A 4OJRA 1JLBA 4RW7A 4CE9A 4GMJB 4FLZA 3TAQA 1NK7A 1RDCA 1KVCA 3AO1A 4BDYA 3U3YA 4FM0A 5HROA 5I3UA 4FW2A 4DTXA 3O4QA 4FLVA 5J2QA 4B9MA 4JLHA 1B9DA 4CJEA 1LWCA 4KTWA 1U45A 1C1CA 4H8KA 4DS4A 3QO9A 3HVRA 2HMIA 5HRNA 2IC3A 2R7YA 2A1RA 2QK9A 2KZMA 1F21A 5CYQA 3DMJA 2BDPA 2HVIA 1FXXA 1RTIA 1KLNA 2ZE2A 3H08A 5T7BA 4QCLA 1XWLA 4CEFA 4DG1A 3EYZA 4DTOA 1QE1A 1S9EA 3IG1A 3U3GA 4N5SA 3SCXA 4EZ6A 4KO0A 4Z4GA 4DTMA 5HRSA 4DU4A 1UWBA 1W0HA 4Y1CA 1RBSA 2DFHA 4KHWA 2X6NA 3L2UA 1LV5A 4W5RA 4JS4A 4CEOA 2ITGA 4WE1A 3AO5A 3K57A 3DLGA 1A5VA 3AVCA 3ZT0A 4CGIA 2DTUA 3I0RA 3ZT3A 4CIGA 4CHNA 2PZSA 3QEPA 3NF7A 1KFSA 3OYNA 1S1TA 4C8NA 3LP2A 3KLGA 4CGDA 3NF6A 1DLOA 4Z0UA 2HHWA 1JLGA 4EZ9A 3OYHA 3QEXA 1SL0A 1NK5A 3U6FA 4CEBA 4E1MA 3I8DA 4M3YA 3G0ZA 4CFBA 1N6QA 4B9VA 4BACA 1LW2A 2FBVA 5HBMA 4JS5A 3TI0A 4KI6A 1RTDA 4W5QA 1BCMA 4AHVA 1A5WA 3LWMA 1D9DA 3O4NA 2HHQA 3V81A 1C1AA 3BDPA 4HUEA 1ZBFA 1S5JA 3QINA 3OYJA 4CJVA 3VQBA 3SZ2A 1WAFA 2G8KA 4CJPA 1N5YA 2OPSA 2KQ2A 2LSNA 4OGCA 1VSKA 1Q8IA 3V1OA 3DLKA 4FM1A 3AVNA 3AA5X 3QIOA 3NGYA 4GVMA 3C6TA 1S6PA 1R0AA 2JGUA 3S9HA 1X9SA 2A1SA 3AVFA 2PY5A 2Z1HA 1KVBA 1RCHA 4H4MA 3K58A 1CZ9A 4HHTA 3VQ4A 3DLBA 4RW9A 4M42A 5HRPA 5KI6A 1DTQA 2GBZA 3TARA 3SNNA 4B9TA 3OS1A 1JLAA 3TAMA 4CIEA 1QQCA 4FVMA 3LANA 2YKMA 4OKKA 3CQ8A 1WSFA 4PUOA 4F2RA 4KHQA 4DU3A 3AA2A 1RT3A 1C0UA 2E6MA 1TKDA 4CCHA 1YTUA 1UOCA 2I5JA 3OY9A 3KLHA 1TAQA 1YTAA 2YHAA 1LW0A 3QEVA 1KVAA 3AA4A 1WAJA 4JRQA 1LWEA 4DF8A 2VG7A 3S3MA 3OYFA 1WSGA 4M3XA 5KTQA 3NHGA 4PWDA 4UQGA 1IKYA 3TAPA 5KGXA 4OLBA 2KZZA 2ZD1A 3SUNA 2B6AA 4BE1A 4K8ZA 3LPUA 1EX4A 4FK2A 1SV5A 2AJQA 2OPRA 4I2QA 3OJSA 3LZIA 3QESA 5KRTA 2VWJA 3VQ8A 1LWFA 4LD0A 3B6OA 3HP9A 3DLEA 3HP6A 1IO2A 3NBPA 4ZTFA 3K2PA 3V6DA 3VQDA 1JL2A 1UA1A 3AO4A 3OVNA 2RKIA 2YNGA 3WNEA 4IKFA 2KFZA 3PO5A 2F8TA 4BE2A 4KREA 4FJLA 4M3TA 4LSLA 1WLJA 3RWUA 4I2PA 4CHQA 3AVLA 4CJ4A 1JL1A 3LP1A 4DTSA 4E3SA 4AH9A 1U4BA 1HYSA 2E6LA 3ZCMA 1D8YA 4Q0BA 2XY5A 1RT2A 1S6QA 1RILA 2VG6A 4HUGA 1T7PA 4E89A 1X1PA 4FLXA 4PY5A 4J2BA 4Z4FA 1VSIA 1G15A 4DSKA 1BCOA 3HPOA 3M8RA 1ASWA 3LWLA 4FCYA 1NK8A 2XY7A 3PX4A 4H4OA 4CF1A 4Z4CA 3HJFA 3THVA 1BIUA 1SL1A 4CJSA 4B3OA 3HO1A 3V9UA 4LY7A 4M3WA 1TK8A 2G8FA 2F8SA 2F96A 4DTPA 1VK0A 1NJYA 3VQ6A 1KTQA 4CFDA 4XIUA 5J2PA 3L3UA 4ID5A 2YNFA 3DYAA 4M41A 4CERA 3AV9A 1JXEA 4AHRA 1HNVA 1QS4A 1VRUA 2D0CA 3DI6A 3WNFA 3BGRA 4DLEA 4ELUA 3HL8A 3ISNC 1TGOA 4DSEA 2FBTA 3O3HA 4MFBA 4CJWA 3SPZA 1VSJA 4F3TA 5EU7A 2GUIA 4NCAA 4E7KA 3ULDA 3DLHA 4HCCA 3KLEA 4DFPA 1BHLA 2G8WA 4B9UA 3FFIA 1BQMA 3DRPA 4CF9A 1W9HA 3OS2A 1TK5A 1WN7A 1XC9A 1HMVA 2W42A 3L2RA 1S1VA 4CJFA 3VA0A 3QNNA 3LPTA 2RPIA 3K5OA 1QSSA 3RMAA 1XHZA 1BI4A 1TKXA 5FDLA 4DF4A 4B8CA 1J9AA 3RMBA 4L8RB 1C1BA 2WONA 3MEEA 4N56A 1VSEA 4HVJA 3SYZA 2YV0X 4FLWA 1KCFA 1HYZA 5CY4A 3NF9A 1I39A 1O1WA 4TSXA 4KB1A 4FJ7A 3ALYA 3ZSQA 3VQ7A 2OA8A 4KHYA 4ZHRA 4Q5VA 3L2QA 3L2VA 1HQUA 3SUQA 3V9WA 2IDOA 4AILC 5J1EA 4KHNA 1CXUA 4YNQA 2XRIA 4E7JA 3ZSVA 2ZQBA 3M8QA 4DFJA 4I9LA 4B9NA 5D3GA 4IG0A 4RW6A 2QXFA 1BL3A 2FC0A 3P5JA 1EETA 3NGZA 3OYCA 3CFPA 3LP0A 4DTRA 1ASUA 2ATQA 3VQPA 1RDBA 3AVIA 3KLIA 2EHGA 5FROA 3ZT2A 4CEDA 3NH1A 4BDPA 4KTQA 3SQ1A 4CFCA 3HT3A 1C6VA 1RBTA 3CM5A 5J2NA 4E1NA 4FLTA 1T03A 1BISA 2RF2A 3NH2A 4DMNA 3QETA 3K59A 2D0BA 3K5LA 3TANA 4CEQA 3NCIA 4CEAA 3VQCA 1CZBA 2VWKA 1JLQA 5HLFA 1NK4A 4RG8A 4FZYA 2Y1JA 4KPYA 2KW4A 4CHOA 1XI1A 1NKCA 2HW3A 3AO2A 1S1UA 2P1JA 1JLFA 3SPYA 2RN2A 1RBVA 1WSJA 4KAZA 4CEZA 3CG7A 5C42A 4FXDA 3QEWA 5E41A 4N41A 3C95A 3DM2A 3NF8A 4RW8A 3ZSRA 3O3GA 4PA1A 3NDKA 1NKEA 1L3VA 3HVTA 2IAJA 3MAQA 3V9XA 4F2SA 4O4GA 3HXMA 1JLEA 1TKZA 5KRSA 3T3FA 4DSJA 1QHTA 4B08A 4CJLA 3ZSYA 1XHXA 4E19A 1EP4A 4CHYA 5I42A 1QSLA 3C94A 1T8EA 2PYLA 3AO3A 1HPZA 1RT4A 4FJGA 4BWMA 4FJNA 3AVGA 2P5GA 4AHCA 3NE6A 4OLAA 1RDAA 3ZT1A 2OYQA 1RBRA 2IOCA 3KKSA 4ZTJA 2DFEA 3AVAA 1NK0A 2ETJA 3CFRA 4E7IA 3LDSA 3OYIA 1J5OA 1B9FA 1S9GA 5HRRA 1Q9XA 2HB5A 4RW4A 1UAXA 3TR8A 1ZYQA 4CHZA 4OPJA 3HYFA 1LAWA 3EY1A 3RR8A 1JXBA 4CESA 3ZT4A 4OPKA 3PV8A 3LZJA 4W5OA 1RT5A 2Z1JA 3D0PA 1KLMA 2PYJA 2YHBA 1VRTA 3OYBA 1RT6A 2EX3A 4CGJA 3SV3A 4B9LA 1DTTA 2HVHA 3G10A 4ELTA 3AVHA 4NCGA 1NJZA 1KSPA 1QTMA 2XY6A 4Z4EA 3TWHA 3VQ5A 2VG5A 3KK3A 5FRNA 4KRFA 4M45A 3PX0A 5HP1A 4DU1A 3SUPA 1B92A 4C8OA 3QNOA 3F73A 4OVLA 3WNGA 3C6UA 4DTUA 2P51A 2IGIA 1IKVA 4O55A 3KK1A 4FM2A 4KB0A 4J2EA 3A2FA 4CJKA 1BI4B 4CK2A 1ZBUA 4W5TA 4K8XA 1S1XA 4BDZA 3SQ4A 1VSMA 4CIFA 1RTJA 4B8AB 2X74A 4Y1DA 4OKJA 4CGGA 4E7HA 4KV8A 3AVJA 3OYGA 4C8KA 4CFAA 3SQ0A 1ZBIA 1VSLA 4FLUA 1TV6A 2OPQA 5CZ2A 3M8PA 3VQQA 1UA0A 2B5JA 4QOZB 3QEIA 4E0DA 3D45A 3L3VA 4GW6A 1L3TA 1NK6A 1BGXT 2HHSA 2X78A 2HNYA 3OS0A 1Z26A 4JRPA 2BANA 1JLCA 4DQRA 3ZSWA 1RT1A 4KFBA 3RRGA 1SUQA 4FZXC 3V1QA 4Z4HA 4KHUA 4LSNA 4CJUA 3OJUA 3HPHA 4IG3A 1TVRA 3V9ZA 2Y1IA 2HHXA 3KIOA 1J53A 1J54A 1RBUA 1CXQA 1RNHA 1RT7A 2O4GA 3HPGA 3IRXA 3KTQA 4C8LA 4NYNA 1HJRA 3L2WA 3PY8A 1NJXA 1T05A 1NOYA 2D5RA 4NCBA 3OYEA 3PX6A 3K5NA 4LH5A 4AHTA 3RMCA 3KJVA 3V1RA 1L3UA 1TAUA 3HK2A 4KTZA 3QIPA 4KI4A 3P1GA 4IFVA 4AHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSH A;  3CM6 A;  1ASV A;  2YNI A;  4QAG A;  4FK0 A;  1HYV A;  2Z1G A;  3LP3 A;  3EZ5 A;  3S3N A;  1TL1 A;  3JSM A;  1FK9 A;  3M8S A;  3ZSO A;  4EP5 A;  1U47 A;  2JLE A;  2Q3S A;  1TK0 A;  2OZM A;  4ICL A;  4O44 A;  4O0I A;  3NAE A;  5JS2 A;  3OYM A;  4DWI A;  4FJ9 A;  2YNH A;  5C24 A;  3MEG A;  4BWJ A;  5CYM A;  3RR7 A;  2WOM A;  4DSL A;  4N47 A;  3S3O A;  4F3O A;  1U04 A;  2FBY A;  3MXM A;  4IFY A;  1WSH A;  4HUF A;  3KD5 E;  4CK1 A;  4FJH A;  3LAK A;  4KHS A;  5FRM A;  1WSE A;  4DS5 A;  3IAY A;  1K6Y A;  3RTV A;  2OZS A;  4FJ5 A;  2O4I A;  3HM9 A;  1BIZ A;  3B6P A;  3UIQ A;  5KGW A;  2D0A A;  4M3R A;  4DFK A;  4DTN A;  2HND A;  4B9S A;  1HRH A;  1RTH A;  4CJT A;  1YT3 A;  4EP4 A;  2HNZ A;  1IKW A;  4AHU A;  3SUO A;  3QLH A;  4FJX A;  2G8I A;  3MXJ A;  1Z25 A;  4IBN A;  3ASM A;  4I7F A;  5DMR A;  4DLG A;  3TAE A;  2XY8 A;  1JKH A;  4C8M A;  1SKW A;  5SZT A;  3IS9 A;  1Y97 A;  4CK3 A;  1ZBL A;  1GOC A;  3AVK A;  3TAB A;  2HHU A;  5JS1 A;  2NUB A;  3JYT A;  1SKS A;  2XO7 A;  4FJI A;  4CJR A;  1TL3 A;  1KFD A;  3CFO A;  1GOB A;  1HNI A;  4CF0 A;  3QER A;  3CYM A;  3VA3 A;  1NK9 A;  1NJW A;  3P83 D;  4G1Q A;  4J2A A;  1FKP A;  3VQE A;  3RMD A;  2G8V A;  1HQE A;  1C0M A;  4IDK A;  4ID1 A;  1L5U A;  3F9K A;  1MU2 A;  3KD1 E;  4R5P A;  1U49 A;  3KKR A;  4DFM A;  4O5B A;  1TKT A;  1VSF A;  4FJJ A;  2G8H A;  2P5O A;  5DK5 A;  4M3U A;  1REV A;  1X9W A;  1Q9Y A;  4N76 A;  4PQU A;  4FYD A;  1D5A A;  3VQA A;  1ITG A;  3OYL A;  2G8U A;  3T19 A;  3MXI A;  1QSY A;  3DOK A;  4FJ8 A;  3DLR A;  2XHB A;  1NOZ A;  2DY4 A;  4M3Z A;  3DOL A;  1FKO A;  4OGE A;  2BGG A;  3PO4 A;  4CF8 A;  4FZZ A;  3T1A A;  2GV9 A;  3TAG A;  4FW1 A;  1I3A A;  4BE0 A;  2HHV A;  1EKE A;  4DQS A;  2KFN A;  2E4L A;  4DSI A;  1ZBH A;  3ZSX A;  3AVB A;  3SJJ A;  3PUF A;  1A5X A;  2BE2 A;  4CF2 A;  3NH0 A;  1RDD A;  1S1W A;  4CGH A;  5SWM A;  3V9S A;  4J2D A;  1KRP A;  3NGI A;  1D9F A;  3V4I A;  2QKK A;  3ITH A;  2KTQ A;  4FK4 A;  3MEC A;  3KLF A;  4Z4I A;  2YKN A;  3DRR A;  3VQ9 A;  3HST B;  3WNH A;  3ZSZ A;  4FLY A;  4FJM A;  4CEC A;  1EXQ A;  3K5M A;  3LAL A;  3TAF A;  3O3F A;  5J2M A;  3RRH A;  3AA3 A;  4FJK A;  4MQ3 A;  4F8R A;  1U48 A;  4I9Q A;  4CJ5 A;  4CJQ A;  3SQ2 A;  1SKR A;  1C0T A;  1IG9 A;  2DFF A;  4F4K A;  3SI6 A;  1LAV A;  5K14 A;  3OYK A;  4DQQ A;  4CHP A;  1IH7 A;  4NYF A;  4YFU A;  4CEE A;  3OYA A;  1NKB A;  3NFA A;  3KK2 A;  4DQI A;  4CGF A;  1WSI A;  2HHT A;  1VSD A;  2OPP A;  3SV4 A;  1YVU A;  2X6S A;  1X9M A;  1L3S A;  4W5N A;  4KKO A;  5C25 A;  4OKE A;  1GOA A;  4CJ3 A;  1IKX A;  1CLQ A;  5CZ1 A;  2QKB A;  4E7L A;  4DTJ A;  1BQN A;  3MED A;  3L8B A;  4HTU A;  4DQP A;  2Z1I A;  3DRS A;  1WNS A;  2IS3 A;  3VN5 A;  4DSF A;  4LH4 A;  4ELV A;  3I0S A;  4HCB A;  3OYD A;  2B4J A;  4O0J A;  1SL2 A;  3AVM A;  3LAM A;  2FBX A;  3E01 A;  4OJR A;  1JLB A;  4RW7 A;  4CE9 A;  4GMJ B;  4FLZ A;  3TAQ A;  1NK7 A;  1RDC A;  1KVC A;  3AO1 A;  4BDY A;  3U3Y A;  4FM0 A;  5HRO A;  5I3U A;  4FW2 A;  4DTX A;  3O4Q A;  4FLV A;  5J2Q A;  4B9M A;  4JLH A;  1B9D A;  4CJE A;  1LWC A;  4KTW A;  1U45 A;  1C1C A;  4H8K A;  4DS4 A;  3QO9 A;  3HVR A;  2HMI A;  5HRN A;  2IC3 A;  2R7Y A;  2A1R A;  2QK9 A;  2KZM A;  1F21 A;  5CYQ A;  3DMJ A;  2BDP A;  2HVI A;  1FXX A;  1RTI A;  1KLN A;  2ZE2 A;  3H08 A;  5T7B A;  4QCL A;  1XWL A;  4CEF A;  4DG1 A;  3EYZ A;  4DTO A;  1QE1 A;  1S9E A;  3IG1 A;  3U3G A;  4N5S A;  3SCX A;  4EZ6 A;  4KO0 A;  4Z4G A;  4DTM A;  5HRS A;  4DU4 A;  1UWB A;  1W0H A;  4Y1C A;  1RBS A;  2DFH A;  4KHW A;  2X6N A;  3L2U A;  1LV5 A;  4W5R A;  4JS4 A;  4CEO A;  2ITG A;  4WE1 A;  3AO5 A;  3K57 A;  3DLG A;  1A5V A;  3AVC A;  3ZT0 A;  4CGI A;  2DTU A;  3I0R A;  3ZT3 A;  4CIG A;  4CHN A;  2PZS A;  3QEP A;  3NF7 A;  1KFS A;  3OYN A;  1S1T A;  4C8N A;  3LP2 A;  3KLG A;  4CGD A;  3NF6 A;  1DLO A;  4Z0U A;  2HHW A;  1JLG A;  4EZ9 A;  3OYH A;  3QEX A;  1SL0 A;  1NK5 A;  3U6F A;  4CEB A;  4E1M A;  3I8D A;  4M3Y A;  3G0Z A;  4CFB A;  1N6Q A;  4B9V A;  4BAC A;  1LW2 A;  2FBV A;  5HBM A;  4JS5 A;  3TI0 A;  4KI6 A;  1RTD A;  4W5Q A;  1BCM A;  4AHV A;  1A5W A;  3LWM A;  1D9D A;  3O4N A;  2HHQ A;  3V81 A;  1C1A A;  3BDP A;  4HUE A;  1ZBF A;  1S5J A;  3QIN A;  3OYJ A;  4CJV A;  3VQB A;  3SZ2 A;  1WAF A;  2G8K A;  4CJP A;  1N5Y A;  2OPS A;  2KQ2 A;  2LSN A;  4OGC A;  1VSK A;  1Q8I A;  3V1O A;  3DLK A;  4FM1 A;  3AVN A;  3AA5 X;  3QIO A;  3NGY A;  4GVM A;  3C6T A;  1S6P A;  1R0A A;  2JGU A;  3S9H A;  1X9S A;  2A1S A;  3AVF A;  2PY5 A;  2Z1H A;  1KVB A;  1RCH A;  4H4M A;  3K58 A;  1CZ9 A;  4HHT A;  3VQ4 A;  3DLB A;  4RW9 A;  4M42 A;  5HRP A;  5KI6 A;  1DTQ A;  2GBZ A;  3TAR A;  3SNN A;  4B9T A;  3OS1 A;  1JLA A;  3TAM A;  4CIE A;  1QQC A;  4FVM A;  3LAN A;  2YKM A;  4OKK A;  3CQ8 A;  1WSF A;  4PUO A;  4F2R A;  4KHQ A;  4DU3 A;  3AA2 A;  1RT3 A;  1C0U A;  2E6M A;  1TKD A;  4CCH A;  1YTU A;  1UOC A;  2I5J A;  3OY9 A;  3KLH A;  1TAQ A;  1YTA A;  2YHA A;  1LW0 A;  3QEV A;  1KVA A;  3AA4 A;  1WAJ A;  4JRQ A;  1LWE A;  4DF8 A;  2VG7 A;  3S3M A;  3OYF A;  1WSG A;  4M3X A;  5KTQ A;  3NHG A;  4PWD A;  4UQG A;  1IKY A;  3TAP A;  5KGX A;  4OLB A;  2KZZ A;  2ZD1 A;  3SUN A;  2B6A A;  4BE1 A;  4K8Z A;  3LPU A;  1EX4 A;  4FK2 A;  1SV5 A;  2AJQ A;  2OPR A;  4I2Q A;  3OJS A;  3LZI A;  3QES A;  5KRT A;  2VWJ A;  3VQ8 A;  1LWF A;  4LD0 A;  3B6O A;  3HP9 A;  3DLE A;  3HP6 A;  1IO2 A;  3NBP A;  4ZTF A;  3K2P A;  3V6D A;  3VQD A;  1JL2 A;  1UA1 A;  3AO4 A;  3OVN A;  2RKI A;  2YNG A;  3WNE A;  4IKF A;  2KFZ A;  3PO5 A;  2F8T A;  4BE2 A;  4KRE A;  4FJL A;  4M3T A;  4LSL A;  1WLJ A;  3RWU A;  4I2P A;  4CHQ A;  3AVL A;  4CJ4 A;  1JL1 A;  3LP1 A;  4DTS A;  4E3S A;  4AH9 A;  1U4B A;  1HYS A;  2E6L A;  3ZCM A;  1D8Y A;  4Q0B A;  2XY5 A;  1RT2 A;  1S6Q A;  1RIL A;  2VG6 A;  4HUG A;  1T7P A;  4E89 A;  1X1P A;  4FLX A;  4PY5 A;  4J2B A;  4Z4F A;  1VSI A;  1G15 A;  4DSK A;  1BCO A;  3HPO A;  3M8R A;  1ASW A;  3LWL A;  4FCY A;  1NK8 A;  2XY7 A;  3PX4 A;  4H4O A;  4CF1 A;  4Z4C A;  3HJF A;  3THV A;  1BIU A;  1SL1 A;  4CJS A;  4B3O A;  3HO1 A;  3V9U A;  4LY7 A;  4M3W A;  1TK8 A;  2G8F A;  2F8S A;  2F96 A;  4DTP A;  1VK0 A;  1NJY A;  3VQ6 A;  1KTQ A;  4CFD A;  4XIU A;  5J2P A;  3L3U A;  4ID5 A;  2YNF A;  3DYA A;  4M41 A;  4CER A;  3AV9 A;  1JXE A;  4AHR A;  1HNV A;  1QS4 A;  1VRU A;  2D0C A;  3DI6 A;  3WNF A;  3BGR A;  4DLE A;  4ELU A;  3HL8 A;  3ISN C;  1TGO A;  4DSE A;  2FBT A;  3O3H A;  4MFB A;  4CJW A;  3SPZ A;  1VSJ A;  4F3T A;  5EU7 A;  2GUI A;  4NCA A;  4E7K A;  3ULD A;  3DLH A;  4HCC A;  3KLE A;  4DFP A;  1BHL A;  2G8W A;  4B9U A;  3FFI A;  1BQM A;  3DRP A;  4CF9 A;  1W9H A;  3OS2 A;  1TK5 A;  1WN7 A;  1XC9 A;  1HMV A;  2W42 A;  3L2R A;  1S1V A;  4CJF A;  3VA0 A;  3QNN A;  3LPT A;  2RPI A;  3K5O A;  1QSS A;  3RMA A;  1XHZ A;  1BI4 A;  1TKX A;  5FDL A;  4DF4 A;  4B8C A;  1J9A A;  3RMB A;  4L8R B;  1C1B A;  2WON A;  3MEE A;  4N56 A;  1VSE A;  4HVJ A;  3SYZ A;  2YV0 X;  4FLW A;  1KCF A;  1HYZ A;  5CY4 A;  3NF9 A;  1I39 A;  1O1W A;  4TSX A;  4KB1 A;  4FJ7 A;  3ALY A;  3ZSQ A;  3VQ7 A;  2OA8 A;  4KHY A;  4ZHR A;  4Q5V A;  3L2Q A;  3L2V A;  1HQU A;  3SUQ A;  3V9W A;  2IDO A;  4AIL C;  5J1E A;  4KHN A;  1CXU A;  4YNQ A;  2XRI A;  4E7J A;  3ZSV A;  2ZQB A;  3M8Q A;  4DFJ A;  4I9L A;  4B9N A;  5D3G A;  4IG0 A;  4RW6 A;  2QXF A;  1BL3 A;  2FC0 A;  3P5J A;  1EET A;  3NGZ A;  3OYC A;  3CFP A;  3LP0 A;  4DTR A;  1ASU A;  2ATQ A;  3VQP A;  1RDB A;  3AVI A;  3KLI A;  2EHG A;  5FRO A;  3ZT2 A;  4CED A;  3NH1 A;  4BDP A;  4KTQ A;  3SQ1 A;  4CFC A;  3HT3 A;  1C6V A;  1RBT A;  3CM5 A;  5J2N A;  4E1N A;  4FLT A;  1T03 A;  1BIS A;  2RF2 A;  3NH2 A;  4DMN A;  3QET A;  3K59 A;  2D0B A;  3K5L A;  3TAN A;  4CEQ A;  3NCI A;  4CEA A;  3VQC A;  1CZB A;  2VWK A;  1JLQ A;  5HLF A;  1NK4 A;  4RG8 A;  4FZY A;  2Y1J A;  4KPY A;  2KW4 A;  4CHO A;  1XI1 A;  1NKC A;  2HW3 A;  3AO2 A;  1S1U A;  2P1J A;  1JLF A;  3SPY A;  2RN2 A;  1RBV A;  1WSJ A;  4KAZ A;  4CEZ A;  3CG7 A;  5C42 A;  4FXD A;  3QEW A;  5E41 A;  4N41 A;  3C95 A;  3DM2 A;  3NF8 A;  4RW8 A;  3ZSR A;  3O3G A;  4PA1 A;  3NDK A;  1NKE A;  1L3V A;  3HVT A;  2IAJ A;  3MAQ A;  3V9X A;  4F2S A;  4O4G A;  3HXM A;  1JLE A;  1TKZ A;  5KRS A;  3T3F A;  4DSJ A;  1QHT A;  4B08 A;  4CJL A;  3ZSY A;  1XHX A;  4E19 A;  1EP4 A;  4CHY A;  5I42 A;  1QSL A;  3C94 A;  1T8E A;  2PYL A;  3AO3 A;  1HPZ A;  1RT4 A;  4FJG A;  4BWM A;  4FJN A;  3AVG A;  2P5G A;  4AHC A;  3NE6 A;  4OLA A;  1RDA A;  3ZT1 A;  2OYQ A;  1RBR A;  2IOC A;  3KKS A;  4ZTJ A;  2DFE A;  3AVA A;  1NK0 A;  2ETJ A;  3CFR A;  4E7I A;  3LDS A;  3OYI A;  1J5O A;  1B9F A;  1S9G A;  5HRR A;  1Q9X A;  2HB5 A;  4RW4 A;  1UAX A;  3TR8 A;  1ZYQ A;  4CHZ A;  4OPJ A;  3HYF A;  1LAW A;  3EY1 A;  3RR8 A;  1JXB A;  4CES A;  3ZT4 A;  4OPK A;  3PV8 A;  3LZJ A;  4W5O A;  1RT5 A;  2Z1J A;  3D0P A;  1KLM A;  2PYJ A;  2YHB A;  1VRT A;  3OYB A;  1RT6 A;  2EX3 A;  4CGJ A;  3SV3 A;  4B9L A;  1DTT A;  2HVH A;  3G10 A;  4ELT A;  3AVH A;  4NCG A;  1NJZ A;  1KSP A;  1QTM A;  2XY6 A;  4Z4E A;  3TWH A;  3VQ5 A;  2VG5 A;  3KK3 A;  5FRN A;  4KRF A;  4M45 A;  3PX0 A;  5HP1 A;  4DU1 A;  3SUP A;  1B92 A;  4C8O A;  3QNO A;  3F73 A;  4OVL A;  3WNG A;  3C6U A;  4DTU A;  2P51 A;  2IGI A;  1IKV A;  4O55 A;  3KK1 A;  4FM2 A;  4KB0 A;  4J2E A;  3A2F A;  4CJK A;  1BI4 B;  4CK2 A;  1ZBU A;  4W5T A;  4K8X A;  1S1X A;  4BDZ A;  3SQ4 A;  1VSM A;  4CIF A;  1RTJ A;  4B8A B;  2X74 A;  4Y1D A;  4OKJ A;  4CGG A;  4E7H A;  4KV8 A;  3AVJ A;  3OYG A;  4C8K A;  4CFA A;  3SQ0 A;  1ZBI A;  1VSL A;  4FLU A;  1TV6 A;  2OPQ A;  5CZ2 A;  3M8P A;  3VQQ A;  1UA0 A;  2B5J A;  4QOZ B;  3QEI A;  4E0D A;  3D45 A;  3L3V A;  4GW6 A;  1L3T A;  1NK6 A;  1BGX T;  2HHS A;  2X78 A;  2HNY A;  3OS0 A;  1Z26 A;  4JRP A;  2BAN A;  1JLC A;  4DQR A;  3ZSW A;  1RT1 A;  4KFB A;  3RRG A;  1SUQ A;  4FZX C;  3V1Q A;  4Z4H A;  4KHU A;  4LSN A;  4CJU A;  3OJU A;  3HPH A;  4IG3 A;  1TVR A;  3V9Z A;  2Y1I A;  2HHX A;  3KIO A;  1J53 A;  1J54 A;  1RBU A;  1CXQ A;  1RNH A;  1RT7 A;  2O4G A;  3HPG A;  3IRX A;  3KTQ A;  4C8L A;  4NYN A;  1HJR A;  3L2W A;  3PY8 A;  1NJX A;  1T05 A;  1NOY A;  2D5R A;  4NCB A;  3OYE A;  3PX6 A;  3K5N A;  4LH5 A;  4AHT A;  3RMC A;  3KJV A;  3V1R A;  1L3U A;  1TAU A;  3HK2 A;  4KTZ A;  3QIP A;  4KI4 A;  3P1G A;  4IFV A;  4AHS A; 
#chains in the Genus database with same CATH topology
 4QAG A;  4H0P A;  1FK9 A;  3M8S A;  4C23 A;  3R8E A;  1NGA A;  2CH6 A;  2W6L A;  1VQO N;  4O0I A;  3DLL L;  1EWR A;  4J8F A;  5C24 A;  2CGK A;  4BWJ A;  5CYM A;  1Q86 O;  2WOM A;  4DSL A;  4F3O A;  3KWG A;  4CK1 A;  3LAK A;  1NNE A;  1K6Y A;  3L4Q A;  2OZS A;  3TSU A;  4F9O A;  3G4S N;  2HND A;  1K9M O;  4B9S A;  1HRH A;  4CJT A;  1YT3 A;  2JWK A;  2HNZ A;  4YOV A;  2G8I A;  4YOT A;  3TAE A;  4C8M A;  1XMO K;  3IS9 A;  5JS1 A;  1GOC A;  3AVK A;  3MK6 A;  2HHU A;  4BRC A;  5BPM A;  4YOW A;  2UYT A;  4BQZ A;  1ESV A;  3RMD A;  1HQE A;  1C0M A;  3KK7 A;  4IDK A;  2E2P A;  4ID1 A;  2NZT A;  3RSE A;  4O5B A;  1P8Z A;  2F9W A;  4FJJ A;  1HX1 A;  2P5O A;  1X9W A;  1Q9Y A;  3VQA A;  1ITG A;  2G8U A;  1QSY A;  5BRF A;  1QQN A;  3DOL A;  2BGG A;  1RGI A;  3T1A A;  4LF4 K;  3U9Z A;  1EKE A;  4DQS A;  4DSI A;  3D2E B;  3AVB A;  5IWA K;  5SWM A;  2QKK A;  4FK4 A;  3MEC A;  3QB0 A;  2E5L K;  4Z4I A;  3VQ9 A;  3HST B;  1HNX K;  2Q2R A;  4CEC A;  3LAL A;  3J81 O;  5I9E B;  3TAF A;  3O3F A;  5J2M A;  4CI6 A;  4FJK A;  2UXB K;  3HSC A;  1DKG D;  3SI6 A;  1LAV A;  2NRZ A;  5K14 A;  4L3Q A;  1IH7 A;  1NKB A;  3DAW A;  1DEJ A;  3NFA A;  3KK2 A;  4CGF A;  1VSD A;  4FL9 A;  1K8K B;  2X6S A;  4B1Z A;  1XNR K;  4FOI A;  4DKW A;  3ENB A;  4XH1 A;  2QKB A;  1BQN A;  4HTU A;  3CC2 N;  3DRS A;  3PIP L;  3VN5 A;  4LH4 A;  2VQF K;  3TPQ A;  3KVG A;  3J7A P;  2B4J A;  4O0J A;  4CZI A;  1SL2 A;  2FBX A;  2FSK A;  3E01 A;  4RW7 A;  4GMJ B;  2GEM A;  4WQ5 C;  1RDC A;  4ILG B;  3M5R A;  3U3Y A;  4CBU A;  4DTX A;  3O4Q A;  5J2Q A;  4CZL A;  4CJE A;  2VQE K;  4JEP A;  3HVR A;  5M1P A;  1MA9 B;  3DMJ A;  1FXX A;  3OBY A;  4FSV A;  4DTO A;  5M1O A;  1S9E A;  3U3G A;  2ZWH A;  4H5W A;  4MO5 A;  4H0Y B;  4A61 A;  3FGU A;  1TYQ B;  4WFA L;  5HRS A;  4DTM A;  2NNW A;  4WQ4 C;  3WXM B;  4DU4 A;  1UWB A;  3L4I A;  4Y1C A;  2X6N A;  4GV6 A;  1JCE A;  4CEO A;  4IZ9 A;  3SAF A;  2DTU A;  2V7Y A;  1W97 L;  4MO4 A;  3HOT A;  3G71 N;  3NF7 A;  1KFS A;  2E2O A;  1S1T A;  4C8N A;  4JI4 K;  3NVK A;  3KLG A;  4H5R A;  1JLG A;  5ELZ A;  1YJ9 N;  3IUC A;  4EZ9 A;  1U2V B;  3UKU B;  3U6F A;  3CCJ N;  4E1M A;  1NK5 A;  1SL0 A;  3I8D A;  3MX2 A;  2FLO A;  3G0Z A;  1N6Q A;  4B9V A;  1I94 K;  2FBV A;  5HBM A;  4W5Q A;  1A5W A;  4BRA A;  1Y64 A;  1C1A A;  3BDP A;  5AQG A;  5EY4 A;  2G8K A;  5JVG L;  3OYJ A;  3SZ2 A;  3VQB A;  1WAF A;  4CJP A;  2OPS A;  1QZ6 A;  2LSN A;  1VSK A;  3AVN A;  3QIO A;  1VQP N;  4V19 S;  1S6P A;  1R0A A;  2JGU A;  4JI7 K;  2Z1H A;  4HHT A;  2HBJ A;  3BF1 A;  3EN9 A;  1JJ2 M;  2ZF5 O;  3TAR A;  2GBZ A;  1QQC A;  3LAN A;  3CQ8 A;  1WSF A;  3K9K A;  4DU3 A;  5EX5 A;  1UOC A;  1KVA A;  3AA4 A;  4JRQ A;  4M3X A;  1S3X A;  2E88 A;  2YJE A;  1IKY A;  3DXM B;  5AQK A;  5KGX A;  4OLB A;  3SUN A;  2YJF A;  1XUP O;  3LPU A;  1SV5 A;  2KKZ A;  3E9L A;  4LD0 A;  1IBL K;  1WBD A;  5C2D A;  3DLE A;  1GLD G;  3HP6 A;  1GLB G;  4X64 K;  3VQD A;  1UA1 A;  3ZLJ A;  1D4X A;  3OVN A;  3WNE A;  4IKF A;  4FJL A;  4M3T A;  4LSL A;  4CHQ A;  3LP1 A;  1D8Y A;  1RT2 A;  4PY5 A;  4J2B A;  3QIC A;  3VEX A;  4DSK A;  5HL7 L;  2E2N A;  1T44 A;  3LWL A;  3PX4 A;  4H4O A;  4Z4C A;  3HJF A;  3I56 N;  3HO1 A;  4LY7 A;  4M3W A;  2ZJR L;  4FWM A;  2VGN A;  4XIU A;  5J2P A;  4M41 A;  3DYA A;  2E2Q A;  4CZM A;  3A5M C;  3UKR A;  3AV9 A;  3WNF A;  1ATR A;  1BOT O;  1TGO A;  3T7Z A;  5LJW A;  3O3H A;  3I33 A;  4HCC A;  5BR8 K;  2G8W A;  1BQM A;  1HJO A;  3OS2 A;  3A5N C;  1QHA A;  1TK5 A;  4AQY K;  2BUP A;  1NGD A;  4CJF A;  3IDH A;  3LPT A;  3RMA A;  3CJ9 A;  4JKA A;  1TKX A;  1J9A A;  4CW7 B;  1VSE A;  4FLW A;  3NF9 A;  1I39 A;  1O1W A;  4KB1 A;  3H46 O;  1KAX A;  1OKJ A;  3VQ7 A;  4KHY A;  2UUA K;  5BPN A;  4ZHR A;  4Q5V A;  3SUQ A;  3V9W A;  5M1K A;  1U6Z A;  1Q7Y O;  3P39 A;  4LFA K;  3Q7C A;  1N32 K;  4IG0 A;  3MX5 A;  2GEL A;  4BRP A;  2V52 B;  4KTQ A;  3KLI A;  3ZT2 A;  2EHG A;  1K8A O;  4BR9 A;  1T03 A;  1BIS A;  3NH2 A;  3QET A;  3K59 A;  2QWL A;  4CEQ A;  2Q36 A;  5HLF A;  4GVE A;  1QZ5 A;  1LOT B;  1S1U A;  3LDP A;  3SPY A;  1WSJ A;  4JHD B;  4CEZ A;  4HTL A;  5AQI A;  3D2F B;  3QEW A;  1YIT N;  3C95 A;  3NF8 A;  1L3V A;  1NGJ A;  3IFR A;  2OTL N;  3VMF B;  3HXM A;  5KRS A;  4YOX A;  3VEW A;  4DSJ A;  1QHT A;  4E19 A;  2NRH A;  3CQX A;  5I42 A;  3G6E N;  4BWM A;  4BRN A;  5DM7 L;  5E84 A;  3KKS A;  3UE5 A;  4RWT A;  2NRT A;  2ETJ A;  3CFR A;  3OYI A;  1JCG A;  4JI1 K;  3HOS A;  1Q9X A;  4BY9 C;  3TR8 A;  4CHZ A;  4OPJ A;  3RR8 A;  3ZT4 A;  4OPK A;  3PV8 A;  2ZJQ L;  4ISG A;  1RT5 A;  3ULE A;  1VRT A;  1RT6 A;  1DTT A;  3CPE A;  3G10 A;  1KSP A;  1NJZ A;  4H03 B;  3CET A;  2VG5 A;  5FRN A;  4KRF A;  3PX0 A;  5HP1 A;  2P9K A;  3SUP A;  3LM2 A;  4Y0W A;  3ZX3 A;  3QNO A;  3CXC M;  2O8F A;  1LCU A;  2P51 A;  4O55 A;  4BRK A;  3A2F A;  4BR4 A;  1E4G T;  1S72 N;  4CIF A;  3K0S A;  1RTJ A;  3QFU A;  4Y1D A;  5LMN K;  4DV1 K;  4IDH A;  1VSL A;  5JLH A;  4FLU A;  5BRD A;  5CZ2 A;  3VET A;  1UA0 A;  4QOZ B;  3P4I A;  3D45 A;  3L3V A;  4GW6 A;  3OS0 A;  2Q97 A;  3ZSW A;  1RT1 A;  1SUQ A;  1ATN A;  3VEZ A;  4JAX A;  4BC4 A;  3LDQ A;  3RSE B;  1N34 K;  4C8L A;  5GAH P;  3H6E A;  4NYN A;  3L2W A;  4UY8 O;  1NOY A;  3PX6 A;  3RMC A;  2NRW A;  3V1R A;  3QBW A;  4FOE A;  1G99 A;  3QIP A;  3VTI A;  2YNI A;  4CZE A;  4FK0 A;  4KHP K;  4BC2 A;  3EKS A;  3JSM A;  2OTJ N;  3CJB A;  2PBD A;  3DXK A;  1TK0 A;  4EP5 A;  1V4S A;  2OZM A;  3U9D A;  2Q1N A;  4O44 A;  3NAE A;  5LMU K;  3MEG A;  2HBL A;  3RR7 A;  2FSN A;  4N47 A;  3MXM A;  4HUF A;  4FJH A;  3ATV A;  4CD1 A;  4KHS A;  1BUP A;  5FRM A;  1WSE A;  3IAY A;  3RTV A;  2GTD A;  2P9U A;  3B6P A;  3FZK A;  4DFK A;  2NRX A;  1IKW A;  2YX6 A;  4IEE A;  4AHU A;  4FJX A;  4B1Y B;  3T1Y K;  4DUY K;  3EE9 A;  5LL6 Z;  3VF2 A;  2XY8 A;  3TAB A;  2VCP A;  4DV0 K;  2FXU A;  4OPH A;  2XO7 A;  1KFD A;  3CFO A;  1NK9 A;  3QER A;  2PYJ A;  2HVH A;  3VA3 A;  3P83 D;  2OCE A;  1FKP A;  3VQE A;  2G8V A;  3C6A A;  1GLL O;  1NGH A;  4R5P A;  4B1X B;  1MDU B;  1BDG A;  2G8H A;  5AQF A;  4M3U A;  1REV A;  4FYD A;  2GUP A;  3OYL A;  4I6M B;  3KHY A;  3MXI A;  3DOK A;  4FJ8 A;  3H45 C;  4OGE A;  3PO4 A;  4CF8 A;  4FZZ A;  2P9S B;  1JCF A;  4FW1 A;  4BE0 A;  4BR5 A;  2HHV A;  4NXM K;  3ZSX A;  1Q18 A;  3SJJ A;  2Q0U A;  2YHX A;  3NH0 A;  3CCL N;  4C1N K;  1KRP A;  3NGI A;  4JK9 A;  5CE3 A;  3ITH A;  2KTQ A;  3KLF A;  1M90 O;  4YOY A;  4CZJ A;  3WEE B;  3B8A X;  3RRH A;  1U48 A;  4BRI A;  5CR4 A;  3JAM O;  1SKR A;  1K8K A;  4LF8 K;  4LFB K;  4DQQ A;  4NYF A;  2A6A A;  2W41 A;  4RCH A;  4EIA A;  4FWR A;  2HHT A;  1WSI A;  5EVZ A;  2OPP A;  4JI6 K;  3GDQ A;  4CD3 A;  4DHY A;  5AQX A;  5C25 A;  4OKE A;  3SMS A;  3D7E O;  1H1V A;  3R1X A;  1OVY A;  1CLQ A;  2IVN A;  4DTJ A;  3FZH A;  3GL1 A;  3MN5 A;  3CD6 N;  2Z1I A;  4DSF A;  4ELV A;  3OBW A;  5KQD A;  4HCB A;  3LAM A;  4OJR A;  5C2F A;  1KVC A;  4FM0 A;  1CZA N;  2W6K A;  1B9D A;  3WQT A;  3O1B A;  2PAV A;  3AGR A;  4IXC A;  3MDQ A;  3QO9 A;  2HMI A;  2IC3 A;  4LF6 K;  4H0T B;  4NB4 A;  2ZM6 K;  4WCE L;  3ENH A;  1KLN A;  3H08 A;  5T7B A;  4QCL A;  3I55 N;  1XWL A;  4JI2 K;  4DG1 A;  3A5L C;  3MCA B;  3SCX A;  5LJV A;  4BQL A;  4ISF A;  4EZ6 A;  4BVP A;  3C7N B;  1KAY A;  2P9L B;  1LV5 A;  5GIN A;  2P9I A;  1Q81 O;  2ITG A;  4WE1 A;  2QI2 A;  3AO5 A;  3K57 A;  3ZT3 A;  3F9M A;  4CHN A;  5AQN A;  5H1S Q;  2F9T A;  3QEP A;  1T3V A;  3CJ7 A;  4QS8 A;  4YDU C;  4DV3 K;  4CGD A;  3P38 A;  5AQO A;  3OYH A;  4CEB A;  4FPB A;  2J4R A;  4CFB A;  2ZGY A;  1LW2 A;  1RFQ A;  4JS5 A;  4JNE A;  4KI6 A;  4AHV A;  4FWN A;  3LWM A;  2HHQ A;  4O5F A;  1ZBF A;  3QIN A;  3PSF A;  1N5Y A;  2KQ2 A;  4JI3 K;  3DLK A;  3AA5 X;  3C6T A;  2PY5 A;  4H5N A;  3H3O B;  2A42 A;  4H4M A;  4X62 K;  3BZC A;  4RW9 A;  3RVC A;  3QML A;  4M42 A;  3KZB A;  5KI6 A;  5JLF A;  3L0Q A;  1JLA A;  3TAM A;  4XH5 A;  4CIE A;  1XMQ K;  4KHQ A;  2ASP A;  3N4Q A;  4CCH A;  4NLC A;  2I5J A;  1YTA A;  1XQS C;  3J8A A;  3ZX0 A;  2VG7 A;  3OYF A;  1VHX A;  3TAP A;  2O8D B;  1V4T A;  2B6A A;  1EX4 A;  1GLJ O;  4I2Q A;  3CPW M;  4K0K K;  3CCE N;  3WXL A;  3D2E A;  1NGB A;  1EQY A;  1IBK K;  1SS6 A;  3BF3 A;  5AQV A;  1IO2 A;  5FPN A;  5TKW A;  1J6Z A;  3M6G A;  1JL2 A;  1C0F A;  2RKI A;  5AQJ A;  2KFZ A;  5JVH L;  4BE2 A;  1WLJ A;  3RWU A;  1JL1 A;  4E3S A;  3WXK A;  1BU6 O;  1U4B A;  4XEI A;  1T7P A;  4MLE A;  4HUG A;  1VQ9 N;  3NMU A;  1VSI A;  4MDB A;  1ASW A;  2QWQ A;  3O9Q A;  4AM7 A;  4CF1 A;  2UXC K;  2GX9 A;  1SL1 A;  4WYB A;  4CJS A;  4BR2 A;  3V9U A;  1TK8 A;  2G8F A;  4DTP A;  1VK0 A;  3A0I X;  4CFD A;  2YNF A;  1Z05 A;  4CER A;  1N8R O;  1JXE A;  4FWK A;  1QS4 A;  1VRU A;  2D0C A;  3BGR A;  1HPM A;  3S41 A;  4OO1 J;  1E4F T;  2QWN A;  4CJW A;  4F3T A;  5EU7 A;  1YAG A;  4DFP A;  5AFU H;  4B9U A;  4I6M A;  2KHO A;  3DRP A;  4CF9 A;  1W9H A;  2UUB K;  1HMV A;  2W42 A;  2ASM A;  3QNN A;  3VA0 A;  1QSS A;  3TTC A;  1XHZ A;  1BI4 A;  3RMB A;  5FDL A;  2HHH K;  4XH4 A;  4N56 A;  2PFU A;  4HVJ A;  3SYZ A;  2YV0 X;  1HYZ A;  3E9P A;  4IJN A;  3ALY A;  4WQ4 A;  3THY B;  4BG8 A;  2HBM A;  2P9P B;  1VQ5 N;  2O8C A;  4BRL A;  1HQU A;  1J5E K;  4KHN A;  4E7J A;  4YNQ A;  2ZQB A;  4DFJ A;  1BL3 A;  3TAQ A;  3CCR N;  4DTR A;  3CME N;  4ZTF A;  1ASU A;  3VQP A;  3AVI A;  3F2K A;  3G25 A;  2E1Y A;  1RBT A;  5J2N A;  4A62 A;  4FLT A;  2RF2 A;  4DMN A;  2FF6 A;  5AQT A;  5GAD P;  3NCI A;  4NXN K;  3VQC A;  1CZB A;  4FZY A;  4RG8 A;  2Y1J A;  2KW4 A;  5AQP A;  4CHO A;  4FVU A;  3AO2 A;  4DV7 K;  2P1J A;  3VGK A;  5KQ8 A;  4OPA A;  3OTO K;  4RW8 A;  3ZSR A;  3DXM A;  3MAQ A;  1JLE A;  1TKZ A;  1ZC6 A;  1WB9 A;  4NO7 A;  4B08 A;  3UKR B;  4FPA A;  4IEI A;  1QSL A;  2F4V K;  1T8E A;  2PYL A;  4FJN A;  1RDA A;  3ZT1 A;  2IOC A;  4ZTJ A;  3MCP A;  3LDS A;  2WC9 A;  1J5O A;  1B9F A;  1S9G A;  1VAZ A;  2HB5 A;  4RW4 A;  1ZYQ A;  2CGL A;  5BN8 A;  3HYF A;  1LAW A;  3I8B A;  1YIJ N;  1YVN A;  4GV9 A;  3D0P A;  3N4P A;  2YHB A;  3OYB A;  4B9L A;  4CGJ A;  1QVF M;  3WT0 A;  1SZ2 A;  4ELT A;  3R6M A;  1QTM A;  4Z4E A;  4CZH A;  1K73 O;  4X65 K;  3F5T A;  3MN6 A;  4FM2 A;  1IKV A;  2OAN A;  3FZF A;  3CC4 N;  4CK2 A;  1ZBU A;  4W5T A;  4DR6 K;  4B8A B;  4OKJ A;  4CGG A;  4E7H A;  3AGK A;  3AVJ A;  4CFA A;  1N36 K;  3SBT A;  2VGM A;  4JK7 A;  5C0Y A;  4E0D A;  3CCM N;  1NK6 A;  2HHS A;  2IVP A;  5C12 A;  1X3N A;  3O80 A;  2BAN A;  2WTU A;  3E9O A;  1FW6 A;  4CJU A;  3OJU A;  3ID6 A;  1TVR A;  2O8B A;  3KIO A;  3IRX A;  3HPG A;  1WBB A;  3KTQ A;  2O4G A;  3HBT A;  2O8C B;  4HWI A;  2P9N B;  4JD2 A;  1T05 A;  4NCB A;  3H1Q A;  3MN7 A;  4LH5 A;  4AHT A;  3KJV A;  1TAU A;  3BUZ B;  4A59 A;  4BRF A;  2QTD A;  3WXJ A;  1VSH A;  3CM6 A;  2RE2 A;  3EZW A;  2O8E A;  3WEE A;  3S3N A;  1TL1 A;  1WOQ A;  3ZSO A;  1U47 A;  2JLE A;  2Q3S A;  3CI5 A;  4C1N I;  1KC8 O;  5JS2 A;  3OYM A;  4FJ9 A;  2YNH A;  5IT9 O;  4DR2 K;  1WSH A;  3KD5 E;  2BTF A;  4DS5 A;  2O4I A;  5KGW A;  4DTN A;  4DR4 K;  4EP4 A;  3SUO A;  4WQ5 A;  1Z25 A;  3OW2 M;  4IBN A;  3ASM A;  4I7F A;  3CJ1 A;  5DMR A;  4DLG A;  1JKH A;  2V7Z A;  4KBO A;  5SZT A;  4B3T K;  4CK3 A;  1ZBL A;  3BY5 A;  4KH5 A;  3AAQ A;  3SLC A;  4B9Q A;  1SKS A;  4FJI A;  1BO5 O;  1GOB A;  1HNI A;  4CF0 A;  3CYM A;  3VPZ A;  4CZG A;  3VEO A;  4M63 C;  1RDW X;  1L5U A;  3KD1 E;  4GV3 A;  4KH4 A;  3KKR A;  4DFM A;  1TUY A;  1TKT A;  1VSF A;  3FR0 A;  4WFN L;  1OH5 A;  4K41 A;  5DK5 A;  4PQU A;  1D5A A;  3ZET A;  4BRQ A;  3CCU N;  1QVG M;  3DLR A;  2XHB A;  1FKO A;  1FJG K;  3HZ6 A;  5GIO A;  2FF3 B;  4FO0 A;  3H1V X;  2YCH A;  2HMP A;  2KFN A;  2E4L A;  3E66 A;  5F2R A;  4GKJ K;  1S1W A;  3V9S A;  1D9F A;  4NLB A;  3V4I A;  2YKN A;  3DRR A;  3ZSZ A;  1VQL N;  4FJM A;  1EWQ A;  3K5M A;  1EXQ A;  2I7P A;  3LL3 A;  3AA3 A;  4I9Q A;  2Q0R A;  4DV2 K;  3SQ2 A;  1X3M A;  4JD2 B;  4F4K A;  1NG9 A;  5AZJ B;  4JKG A;  4YFU A;  4CEE A;  1KAZ A;  3SV4 A;  1L3S A;  4W5N A;  4KKO A;  1OH7 A;  2CGJ A;  1GOA A;  4DV6 K;  3SAG A;  4BRO A;  1IKX A;  3SBG A;  4E7L A;  3MED A;  5ADX A;  4BC5 A;  2IS3 A;  3I0S A;  2NLX A;  3OYD A;  3AVM A;  1JLB A;  1NK7 A;  5HRO A;  3U4L A;  5I3U A;  1NGE A;  4B9M A;  1LWC A;  5M1F A;  2O8D A;  3O4W A;  4KTW A;  1U45 A;  4H0X B;  2R7Y A;  2KZM A;  2BDP A;  2HVI A;  2ZE2 A;  4DR1 K;  4CEF A;  1QE1 A;  4U67 L;  4N5S A;  4B3R K;  4Z4G A;  3J80 O;  1W0H A;  4KHW A;  3DXK B;  3FFK B;  4CIG A;  4BR0 A;  3D6R A;  1YJW N;  3VES A;  3GBT A;  3THX B;  1P90 A;  3LP2 A;  2HHW A;  4Z0U A;  1DLO A;  4IO9 L;  3QEX A;  3UB5 A;  4EFH A;  4M3Y A;  3OA9 A;  3VEN A;  4FWQ A;  4Z94 A;  1BCM A;  1D9D A;  4H0V B;  1BA1 A;  2JWL A;  2UU9 K;  1NGF A;  1GLE G;  4FM1 A;  3NGY A;  3CHW A;  3HI0 A;  1X9S A;  5AZI B;  4PHT X;  2A1S A;  1KVB A;  3K58 A;  4DV4 K;  1CZ9 A;  3DLB A;  3L6Q A;  1O13 A;  4CJ7 A;  1T6D A;  1VQK N;  2UXD K;  5F0X A;  3T1H K;  4B9T A;  3E1Y A;  4FVM A;  2YKM A;  4F2R A;  1RT3 A;  1C0U A;  2E6M A;  1YTU A;  3TTD A;  3KLH A;  1TAQ A;  2YHA A;  1LW0 A;  3QEV A;  5LY3 A;  1WAJ A;  4DF8 A;  4LF7 K;  2A5X A;  3M3Z A;  1OH8 A;  4BGA A;  4JKD A;  2KZZ A;  4BE1 A;  4FK2 A;  2A3Z A;  2AJQ A;  4E1J A;  3LZI A;  1OVQ A;  5BN9 A;  2VWJ A;  3VQ8 A;  1LWF A;  1S22 A;  3M1F A;  4JI0 K;  4BRD A;  2D0P A;  3V6D A;  3AO4 A;  4JN4 A;  3PO5 A;  2F8T A;  4KRE A;  4JHD A;  4I2P A;  3MN9 A;  3QDK A;  4AH9 A;  1HYS A;  3ZCM A;  5KPR A;  4Q0B A;  1S6Q A;  1RIL A;  1NU0 A;  4K42 A;  4FLX A;  4Z4F A;  1VQN N;  2WUS A;  4EHU A;  3M8R A;  3CMA N;  4FCY A;  2XY7 A;  3TTF A;  3ENO A;  1BIU A;  3NVM A;  3THV A;  2ZGZ A;  5AQL A;  3W3D A;  3IMX A;  4LFC K;  2FSJ A;  2QM1 A;  5AQR A;  3VEV A;  1YF5 L;  4JI8 K;  1HNV A;  1VQ8 N;  5EXW A;  4OX9 K;  4ELU A;  4QS9 A;  4MFB A;  3PIO L;  1VSJ A;  1HLU A;  3CCS N;  2GUI A;  3R9P A;  4E7K A;  3KLE A;  1SAZ A;  3JS6 A;  2RPI A;  4DF4 A;  4B8C A;  3DWL A;  1C1B A;  2WON A;  4CVN E;  3ZEU B;  5CY4 A;  1KCF A;  1IJJ A;  2VWB A;  2QXL A;  2O8E B;  2QEX N;  3MWP A;  2OA8 A;  3MWT A;  4ISE A;  3L2V A;  4AIL C;  3CJA A;  1CXU A;  3ZSV A;  4B9N A;  1MWK A;  4GNI A;  5D3G A;  4RW6 A;  2QXF A;  3TU5 A;  3P5J A;  5AZJ A;  1EET A;  3NGZ A;  3CFP A;  2ATQ A;  4CED A;  5FRO A;  3NH1 A;  3SQ1 A;  4CFC A;  1C6V A;  3CM5 A;  4E1N A;  4JV5 K;  3K5L A;  4WFB L;  3TAN A;  4MLH A;  4CEA A;  2VWK A;  4H0O A;  1XI1 A;  1XC3 A;  1JLF A;  2RN2 A;  1YXQ A;  1RBV A;  1Z6R A;  1BWF O;  2AA4 A;  2IIR A;  2I7N A;  3CG7 A;  5C42 A;  3VTH A;  3O9R A;  3DJC A;  3O3G A;  1NKE A;  4F2S A;  3MMV A;  1KXP A;  3C6H A;  4O4G A;  1KQS M;  5FPM A;  1NLV A;  3D2F A;  3ZX2 A;  3C0B A;  1XHX A;  4CZF A;  1EP4 A;  3C94 A;  3AO3 A;  1HPZ A;  3BP8 A;  2P5G A;  4OLA A;  4WF9 L;  2OYQ A;  4IWV A;  1NK0 A;  2DFE A;  3AVA A;  4E7I A;  5HRR A;  5FPD A;  5KPZ A;  3CCV N;  1UAX A;  3TSQ A;  3EY1 A;  1JXB A;  3LZJ A;  1TYQ A;  3LDO A;  3PLA A;  1KLM A;  2RHK A;  5TKY A;  4NCG A;  3T69 A;  2XY6 A;  3TWH A;  4BRE A;  3VQ5 A;  4YHH K;  1NJI O;  5AZI A;  5M1Q A;  4DCH A;  3F73 A;  3ATU A;  4OVL A;  3WNG A;  2IGI A;  4J2E A;  3KK1 A;  4CJK A;  1BI4 B;  1S1X A;  3SQ4 A;  1VSM A;  3C65 A;  3THW B;  2X74 A;  3OYG A;  5A2Q O;  2P9U B;  2GWJ A;  3SQ0 A;  1TV6 A;  5AQQ A;  3LM9 A;  1L3T A;  1BGX T;  2DPN A;  2X78 A;  2HNY A;  4DQR A;  3H3N O;  3V1Q A;  4Z4H A;  4LSN A;  3VEY A;  4IG3 A;  3V9Z A;  2Y1I A;  1RBU A;  3FLC O;  5AFU A;  1HJR A;  3PY8 A;  5BR9 A;  1NJX A;  1L3U A;  1QQM A;  3HK2 A;  3P1G A;  4J2D A;  4IFV A;  3FZL A;  1ASV A;  1HYV A;  2Z1G A;  3LP3 A;  3EZ5 A;  1NBW A;  2E1Z A;  4FWS A;  4B1U B;  3SAH A;  1QQO A;  2P9L A;  3J7Y P;  2ZJP L;  5FPE A;  4ICL A;  4DB3 A;  3ZEU A;  4DWI A;  1YUW A;  3EEQ A;  3ZYY X;  5AR0 A;  4LF9 K;  2NRR A;  2V51 B;  3S3O A;  1U04 A;  2FBY A;  4IFY A;  5BPL A;  3SJH A;  5DM6 L;  4FJ5 A;  4DR7 K;  3Q7B A;  3HM9 A;  1BIZ A;  5B8H A;  3UIQ A;  4M3R A;  2D0A A;  2WBN A;  1C0G A;  1N33 K;  2QW9 A;  1RTH A;  4PKI A;  3LDL A;  4LC9 B;  3QLH A;  3IKM A;  3MXJ A;  3EL2 A;  5M1N A;  4K43 A;  1SKW A;  1EO1 A;  1Y97 A;  2O8F B;  2NUB A;  3PSI A;  3O1W A;  2IVO A;  3JYT A;  3THX A;  4CJR A;  1GLF O;  1TL3 A;  4BRG A;  1NJW A;  5C15 A;  4G1Q A;  4J2A A;  4LF5 K;  1HKC A;  3F9K A;  1MU2 A;  1HNW K;  1U49 A;  3CIP A;  3AY9 A;  3VGL A;  2WFB A;  5AQS A;  4N76 A;  3HM8 A;  5C10 A;  3T19 A;  4CBW A;  1W7A A;  1NOZ A;  2DY4 A;  4M3Z A;  4H5V A;  3WQU A;  2GV9 A;  3TAG A;  1I3A A;  4FWL A;  4H5T A;  4PL8 A;  2YHY A;  1ZBH A;  3UKU A;  3PUF A;  1A5X A;  2BE2 A;  4CF2 A;  1RDD A;  4CGH A;  5GIP A;  4FLY A;  3O8M A;  3WNH A;  3VOV A;  4MQ3 A;  4F8R A;  3EO3 A;  4CJ5 A;  4CJQ A;  3EE8 A;  1C0T A;  1IG9 A;  2DFF A;  4M7Y A;  3OYK A;  4CHP A;  3OYA A;  1DGK N;  4DQI A;  2D4W A;  3O08 A;  1YVU A;  1X9M A;  4O8U A;  4CJ3 A;  4BG9 A;  3U8X A;  5CZ1 A;  3AAR A;  4DQP A;  3L8B A;  1WUA A;  4BRH A;  1WNS A;  2E20 A;  5AQY A;  1VQM N;  3AAP A;  3CER A;  5E26 A;  1YI2 N;  2CH5 A;  4FLZ A;  4CE9 A;  3AO1 A;  4BVO A;  4BDY A;  1U2V A;  2A41 A;  4FW2 A;  4U7B A;  4FLV A;  1HKB A;  4JLH A;  1MWM A;  1XNQ K;  2HOE A;  1C1C A;  4H8K A;  2BH1 A;  4IOC L;  4DS4 A;  5HRN A;  2A1R A;  2QK9 A;  1F21 A;  5CYQ A;  1RTI A;  1ZXO A;  1X9J A;  3EYZ A;  5AQZ A;  5MLC Q;  3IG1 A;  2E8A A;  4ILJ A;  4PKG A;  4KO0 A;  2A40 A;  3R3L A;  4YOR A;  1RBS A;  2DFH A;  3L2U A;  4W5R A;  4JS4 A;  4R79 A;  3DLG A;  1A5V A;  1NGG A;  3AVC A;  3ZT0 A;  4CGI A;  3I0R A;  1HNZ K;  2ASO A;  2PZS A;  4BGB A;  2P9I B;  1NMD A;  3OYN A;  4DR5 K;  3NF6 A;  5BRE A;  5HOO A;  1E3M A;  2Q31 A;  3THY A;  1ATS A;  1GLC G;  2YI1 A;  4BC3 A;  4PKH A;  4BAC A;  3TI0 A;  1RTD A;  2P9S A;  3O4N A;  3V81 A;  4JYA K;  4HUE A;  5FLX O;  1KD1 O;  3ID8 A;  1S5J A;  4CJV A;  5EOY A;  3P31 A;  2HST A;  2QWP A;  4OGC A;  1Q8I A;  2VYP A;  3V1O A;  4GVM A;  3GE1 A;  4X66 K;  3S9H A;  3AVF A;  4JKH A;  3BZK A;  3VGM A;  1RCH A;  4JKE A;  4MDA A;  3VQ4 A;  4CBX A;  2QWR A;  5HRP A;  1DTQ A;  2P9P A;  4K25 A;  3SNN A;  3OS1 A;  4A2B A;  3K9J A;  3CCQ N;  4AF1 A;  4OKK A;  4PUO A;  3EKU A;  3AA2 A;  4B3M K;  1TKD A;  3O9U A;  3OY9 A;  4KH6 A;  3S3M A;  1LWE A;  1WSG A;  5KTQ A;  3NHG A;  4PWD A;  4UQG A;  2AP1 A;  2ZD1 A;  2W40 A;  4RTF D;  4JI5 K;  4K8Z A;  2GWK A;  2OPR A;  3OJS A;  3QES A;  1YHQ N;  5KRT A;  3CC7 N;  1Q82 O;  3B6O A;  3W0L A;  1M1K O;  3HP9 A;  4AM6 A;  3THW A;  3NBP A;  1NMN A;  3K2P A;  2YNG A;  4DTS A;  3AVL A;  4CJ4 A;  2F7T A;  1R59 O;  2E6L A;  4CZK A;  2XY5 A;  2VG6 A;  3FE1 A;  4E89 A;  1X1P A;  3C7N A;  1G15 A;  1VQ7 N;  1HR0 K;  1BCO A;  1HUX A;  3O9T A;  3HPO A;  2EWS A;  1NK8 A;  3O9S A;  3GOI A;  5CHI A;  4B3O A;  4IOX A;  2ITM A;  2F8S A;  2F96 A;  1NJY A;  3VQ6 A;  1KTQ A;  2HBK A;  3L3U A;  4ID5 A;  3CF5 L;  4FWP A;  4AHR A;  3DI6 A;  2H3G X;  4DLE A;  4B1V A;  3HL8 A;  3HRG A;  3ISN C;  4DSE A;  2FBT A;  3SPZ A;  2D1K A;  4JK8 A;  4NCA A;  3ULD A;  3DLH A;  4DUZ K;  1BHL A;  3CQY A;  3FFI A;  4M7X A;  1NGI A;  4IFE A;  2HF3 A;  1WN7 A;  1XC9 A;  5GAG P;  3L2R A;  1S1V A;  3VF4 A;  5AQU A;  3K5O A;  4L8R B;  1T6C A;  3A5O C;  3SK3 A;  3MEE A;  4YOU A;  4JKG B;  1HKG A;  4A5B A;  4TSX A;  4FJ7 A;  2P9K B;  3ZSQ A;  3TSP A;  3L2Q A;  1GLA G;  2D0O A;  4A57 A;  1W2B M;  1IBM K;  2IDO A;  1BA0 A;  2P9N A;  3QBX A;  5J1E A;  1TUU A;  2XRI A;  3M8Q A;  4I9L A;  4IOA L;  1NM1 A;  4BR7 A;  4PL7 A;  4QS7 A;  4IJA A;  3FZM A;  2FC0 A;  3OYC A;  1ILY A;  3LP0 A;  4DR3 K;  1RDB A;  4BDP A;  1VQ4 N;  3WUH A;  4FWO A;  2HF4 A;  5KPT A;  3HT3 A;  5JMV A;  2D0B A;  1YJN N;  1NK4 A;  1JLQ A;  4KPY A;  1NKC A;  2HW3 A;  2QA4 N;  4EAH D;  1SQK A;  3VER A;  4KAZ A;  5GAE P;  4FXD A;  4N41 A;  5E41 A;  3HTV A;  3DM2 A;  3NDK A;  4GKK K;  4PA1 A;  3WXI A;  3HVT A;  2IAJ A;  5AQM A;  3V9X A;  3KWI A;  3T3F A;  3VF6 A;  1IV0 A;  4CHY A;  4CJL A;  3ZSY A;  5ADX H;  4JKF A;  4FJG A;  1RT4 A;  3AVG A;  4YY3 K;  4AHC A;  3NE6 A;  1DT9 A;  1RBR A;  3GG4 A;  3SMP A;  4B1W B;  1OH6 A;  3CJC A;  2QWO A;  4O8K A;  4CES A;  3QFP A;  2NRV A;  3O6W A;  2UUC K;  4W5O A;  2Z1J A;  4DQ8 A;  3OHR A;  1BG3 A;  2EX3 A;  3SV3 A;  3LDN A;  3AVH A;  1NGC A;  4A2A A;  3KK3 A;  4M45 A;  4DU1 A;  4C8O A;  1B92 A;  1VQ6 N;  3A8Y A;  3C6U A;  4DTU A;  4KB0 A;  4EHT A;  4G9Z A;  4GY2 B;  4K8X A;  4BDZ A;  4ILH A;  5AQW A;  3O5B A;  4KV8 A;  4C8K A;  4JKC A;  3J7Z O;  1ZBI A;  1ZBS A;  1IG8 A;  2OPQ A;  3M8P A;  3VQQ A;  5F1X A;  2B5J A;  3QEI A;  2YHW A;  1RDU A;  1Z26 A;  4JRP A;  5AQH A;  3JXU A;  3ZET B;  1JLC A;  2QWM A;  4KFB A;  3RRG A;  4FZX C;  3BEX A;  3ULE B;  4KHU A;  5BRH A;  3HPH A;  4A5A A;  5JIC A;  2HHX A;  4B3S K;  1NWK A;  1J53 A;  1J54 A;  4DV5 K;  1CXQ A;  1RNH A;  1RT7 A;  4IO8 A;  2D5R A;  2O8B B;  3OYE A;  2KLA A;  3K5N A;  4BRM A;  4JKB A;  4KTZ A;  4YDU A;  4KI4 A;  5AJ3 K;  4AHS A; 
#chains in the Genus database with same CATH homology
 1VSH A;  3CM6 A;  1ASV A;  2YNI A;  4QAG A;  4FK0 A;  1HYV A;  2Z1G A;  3LP3 A;  3EZ5 A;  3S3N A;  1TL1 A;  3JSM A;  1FK9 A;  3M8S A;  3ZSO A;  4EP5 A;  1U47 A;  2JLE A;  2Q3S A;  1TK0 A;  2OZM A;  4ICL A;  4O44 A;  4O0I A;  3NAE A;  5JS2 A;  3OYM A;  4DWI A;  4FJ9 A;  2YNH A;  5C24 A;  3MEG A;  4BWJ A;  5CYM A;  3RR7 A;  2WOM A;  4DSL A;  4N47 A;  3S3O A;  4F3O A;  1U04 A;  2FBY A;  3MXM A;  4IFY A;  1WSH A;  4HUF A;  3KD5 E;  4CK1 A;  4FJH A;  3LAK A;  4KHS A;  5FRM A;  1WSE A;  4DS5 A;  3IAY A;  1K6Y A;  3RTV A;  2OZS A;  4FJ5 A;  2O4I A;  3HM9 A;  1BIZ A;  3B6P A;  3UIQ A;  5KGW A;  2D0A A;  4M3R A;  4DFK A;  4DTN A;  2HND A;  4B9S A;  1HRH A;  1RTH A;  4CJT A;  1YT3 A;  4EP4 A;  2HNZ A;  1IKW A;  4AHU A;  3SUO A;  3QLH A;  4FJX A;  2G8I A;  3MXJ A;  1Z25 A;  4IBN A;  3ASM A;  4I7F A;  5DMR A;  4DLG A;  3TAE A;  2XY8 A;  1JKH A;  4C8M A;  1SKW A;  5SZT A;  3IS9 A;  1Y97 A;  4CK3 A;  1ZBL A;  1GOC A;  3AVK A;  3TAB A;  2HHU A;  5JS1 A;  2NUB A;  3JYT A;  1SKS A;  2XO7 A;  4FJI A;  4CJR A;  1TL3 A;  1KFD A;  3CFO A;  1GOB A;  1HNI A;  4CF0 A;  3QER A;  3CYM A;  3VA3 A;  1NK9 A;  1NJW A;  3P83 D;  4G1Q A;  4J2A A;  1FKP A;  3VQE A;  3RMD A;  2G8V A;  1HQE A;  1C0M A;  4IDK A;  4ID1 A;  1L5U A;  3F9K A;  1MU2 A;  3KD1 E;  4R5P A;  1U49 A;  3KKR A;  4DFM A;  4O5B A;  1TKT A;  1VSF A;  4FJJ A;  2G8H A;  2P5O A;  5DK5 A;  4M3U A;  1REV A;  1X9W A;  1Q9Y A;  4N76 A;  4PQU A;  4FYD A;  1D5A A;  3VQA A;  1ITG A;  3OYL A;  2G8U A;  3T19 A;  3MXI A;  1QSY A;  3DOK A;  4FJ8 A;  3DLR A;  2XHB A;  1NOZ A;  2DY4 A;  4M3Z A;  3DOL A;  1FKO A;  4OGE A;  2BGG A;  3PO4 A;  4CF8 A;  4FZZ A;  3T1A A;  2GV9 A;  3TAG A;  4FW1 A;  1I3A A;  4BE0 A;  2HHV A;  1EKE A;  4DQS A;  2KFN A;  2E4L A;  4DSI A;  1ZBH A;  3ZSX A;  3AVB A;  3SJJ A;  3PUF A;  1A5X A;  2BE2 A;  4CF2 A;  3NH0 A;  1RDD A;  1S1W A;  4CGH A;  5SWM A;  3V9S A;  4J2D A;  1KRP A;  3NGI A;  1D9F A;  3V4I A;  2QKK A;  3ITH A;  2KTQ A;  4FK4 A;  3MEC A;  3KLF A;  4Z4I A;  2YKN A;  3DRR A;  3VQ9 A;  3HST B;  3WNH A;  3ZSZ A;  4FLY A;  4FJM A;  4CEC A;  1EXQ A;  3K5M A;  3LAL A;  3TAF A;  3O3F A;  5J2M A;  3RRH A;  3AA3 A;  4FJK A;  4MQ3 A;  4F8R A;  1U48 A;  4I9Q A;  4CJ5 A;  4CJQ A;  3SQ2 A;  1SKR A;  1C0T A;  1IG9 A;  2DFF A;  4F4K A;  3SI6 A;  1LAV A;  5K14 A;  3OYK A;  4DQQ A;  4CHP A;  1IH7 A;  4NYF A;  4YFU A;  4CEE A;  3OYA A;  1NKB A;  3NFA A;  3KK2 A;  4DQI A;  4CGF A;  1WSI A;  2HHT A;  1VSD A;  2OPP A;  3SV4 A;  1YVU A;  2X6S A;  1X9M A;  1L3S A;  4W5N A;  4KKO A;  5C25 A;  4OKE A;  1GOA A;  4CJ3 A;  1IKX A;  1CLQ A;  5CZ1 A;  2QKB A;  4E7L A;  4DTJ A;  1BQN A;  3MED A;  3L8B A;  4HTU A;  4DQP A;  2Z1I A;  3DRS A;  1WNS A;  2IS3 A;  3VN5 A;  4DSF A;  4LH4 A;  4ELV A;  3I0S A;  4HCB A;  3OYD A;  2B4J A;  4O0J A;  1SL2 A;  3AVM A;  3LAM A;  2FBX A;  3E01 A;  4OJR A;  1JLB A;  4RW7 A;  4CE9 A;  4GMJ B;  4FLZ A;  3TAQ A;  1NK7 A;  1RDC A;  1KVC A;  3AO1 A;  4BDY A;  3U3Y A;  4FM0 A;  5HRO A;  5I3U A;  4FW2 A;  4DTX A;  3O4Q A;  4FLV A;  5J2Q A;  4B9M A;  4JLH A;  1B9D A;  4CJE A;  1LWC A;  4KTW A;  1U45 A;  1C1C A;  4H8K A;  4DS4 A;  3QO9 A;  3HVR A;  2HMI A;  5HRN A;  2IC3 A;  2R7Y A;  2A1R A;  2QK9 A;  2KZM A;  1F21 A;  5CYQ A;  3DMJ A;  2BDP A;  2HVI A;  1FXX A;  1RTI A;  1KLN A;  2ZE2 A;  3H08 A;  5T7B A;  4QCL A;  1XWL A;  4CEF A;  4DG1 A;  3EYZ A;  4DTO A;  1QE1 A;  1S9E A;  3IG1 A;  3U3G A;  4N5S A;  3SCX A;  4EZ6 A;  4KO0 A;  4Z4G A;  4DTM A;  5HRS A;  4DU4 A;  1UWB A;  1W0H A;  4Y1C A;  1RBS A;  2DFH A;  4KHW A;  2X6N A;  3L2U A;  1LV5 A;  4W5R A;  4JS4 A;  4CEO A;  2ITG A;  4WE1 A;  3AO5 A;  3K57 A;  3DLG A;  1A5V A;  3AVC A;  3ZT0 A;  4CGI A;  2DTU A;  3I0R A;  3ZT3 A;  4CIG A;  4CHN A;  2PZS A;  3QEP A;  3NF7 A;  1KFS A;  3OYN A;  1S1T A;  4C8N A;  3LP2 A;  3KLG A;  4CGD A;  3NF6 A;  1DLO A;  4Z0U A;  2HHW A;  1JLG A;  4EZ9 A;  3OYH A;  3QEX A;  1SL0 A;  1NK5 A;  3U6F A;  4CEB A;  4E1M A;  3I8D A;  4M3Y A;  3G0Z A;  4CFB A;  1N6Q A;  4B9V A;  4BAC A;  1LW2 A;  2FBV A;  5HBM A;  4JS5 A;  3TI0 A;  4KI6 A;  1RTD A;  4W5Q A;  1BCM A;  4AHV A;  1A5W A;  3LWM A;  1D9D A;  3O4N A;  2HHQ A;  3V81 A;  1C1A A;  3BDP A;  4HUE A;  1ZBF A;  1S5J A;  3QIN A;  3OYJ A;  4CJV A;  3VQB A;  3SZ2 A;  1WAF A;  2G8K A;  4CJP A;  1N5Y A;  2OPS A;  2KQ2 A;  2LSN A;  4OGC A;  1VSK A;  1Q8I A;  3V1O A;  3DLK A;  4FM1 A;  3AVN A;  3AA5 X;  3QIO A;  3NGY A;  4GVM A;  3C6T A;  1S6P A;  1R0A A;  2JGU A;  3S9H A;  1X9S A;  2A1S A;  3AVF A;  2PY5 A;  2Z1H A;  1KVB A;  1RCH A;  4H4M A;  3K58 A;  1CZ9 A;  4HHT A;  3VQ4 A;  3DLB A;  4RW9 A;  4M42 A;  5HRP A;  5KI6 A;  1DTQ A;  2GBZ A;  3TAR A;  3SNN A;  4B9T A;  3OS1 A;  1JLA A;  3TAM A;  4CIE A;  1QQC A;  4FVM A;  3LAN A;  2YKM A;  4OKK A;  3CQ8 A;  1WSF A;  4PUO A;  4F2R A;  4KHQ A;  4DU3 A;  3AA2 A;  1RT3 A;  1C0U A;  2E6M A;  1TKD A;  4CCH A;  1YTU A;  1UOC A;  2I5J A;  3OY9 A;  3KLH A;  1TAQ A;  1YTA A;  2YHA A;  1LW0 A;  3QEV A;  1KVA A;  3AA4 A;  1WAJ A;  4JRQ A;  1LWE A;  4DF8 A;  2VG7 A;  3S3M A;  3OYF A;  1WSG A;  4M3X A;  5KTQ A;  3NHG A;  4PWD A;  4UQG A;  1IKY A;  3TAP A;  5KGX A;  4OLB A;  2KZZ A;  2ZD1 A;  3SUN A;  2B6A A;  4BE1 A;  4K8Z A;  3LPU A;  1EX4 A;  4FK2 A;  1SV5 A;  2AJQ A;  2OPR A;  4I2Q A;  3OJS A;  3LZI A;  3QES A;  5KRT A;  2VWJ A;  3VQ8 A;  1LWF A;  4LD0 A;  3B6O A;  3HP9 A;  3DLE A;  3HP6 A;  1IO2 A;  3NBP A;  4ZTF A;  3K2P A;  3V6D A;  3VQD A;  1JL2 A;  1UA1 A;  3AO4 A;  3OVN A;  2RKI A;  2YNG A;  3WNE A;  4IKF A;  2KFZ A;  3PO5 A;  2F8T A;  4BE2 A;  4KRE A;  4FJL A;  4M3T A;  4LSL A;  1WLJ A;  3RWU A;  4I2P A;  4CHQ A;  3AVL A;  4CJ4 A;  1JL1 A;  3LP1 A;  4DTS A;  4E3S A;  4AH9 A;  1U4B A;  1HYS A;  2E6L A;  3ZCM A;  1D8Y A;  4Q0B A;  2XY5 A;  1RT2 A;  1S6Q A;  1RIL A;  2VG6 A;  4HUG A;  1T7P A;  4E89 A;  1X1P A;  4FLX A;  4PY5 A;  4J2B A;  4Z4F A;  1VSI A;  1G15 A;  4DSK A;  1BCO A;  3HPO A;  3M8R A;  1ASW A;  3LWL A;  4FCY A;  1NK8 A;  2XY7 A;  3PX4 A;  4H4O A;  4CF1 A;  4Z4C A;  3HJF A;  3THV A;  1BIU A;  1SL1 A;  4CJS A;  4B3O A;  3HO1 A;  3V9U A;  4LY7 A;  4M3W A;  1TK8 A;  2G8F A;  2F8S A;  2F96 A;  4DTP A;  1VK0 A;  1NJY A;  3VQ6 A;  1KTQ A;  4CFD A;  4XIU A;  5J2P A;  3L3U A;  4ID5 A;  2YNF A;  3DYA A;  4M41 A;  4CER A;  3AV9 A;  1JXE A;  4AHR A;  1HNV A;  1QS4 A;  1VRU A;  2D0C A;  3DI6 A;  3WNF A;  3BGR A;  4DLE A;  4ELU A;  3HL8 A;  3ISN C;  1TGO A;  4DSE A;  2FBT A;  3O3H A;  4MFB A;  4CJW A;  3SPZ A;  1VSJ A;  4F3T A;  5EU7 A;  2GUI A;  4NCA A;  4E7K A;  3ULD A;  3DLH A;  4HCC A;  3KLE A;  4DFP A;  1BHL A;  2G8W A;  4B9U A;  3FFI A;  1BQM A;  3DRP A;  4CF9 A;  1W9H A;  3OS2 A;  1TK5 A;  1WN7 A;  1XC9 A;  1HMV A;  2W42 A;  3L2R A;  1S1V A;  4CJF A;  3VA0 A;  3QNN A;  3LPT A;  2RPI A;  3K5O A;  1QSS A;  3RMA A;  1XHZ A;  1BI4 A;  1TKX A;  5FDL A;  4DF4 A;  4B8C A;  1J9A A;  3RMB A;  4L8R B;  1C1B A;  2WON A;  3MEE A;  4N56 A;  1VSE A;  4HVJ A;  3SYZ A;  2YV0 X;  4FLW A;  1KCF A;  1HYZ A;  5CY4 A;  3NF9 A;  1I39 A;  1O1W A;  4TSX A;  4KB1 A;  4FJ7 A;  3ALY A;  3ZSQ A;  3VQ7 A;  2OA8 A;  4KHY A;  4ZHR A;  4Q5V A;  3L2Q A;  3L2V A;  1HQU A;  3SUQ A;  3V9W A;  2IDO A;  4AIL C;  5J1E A;  4KHN A;  1CXU A;  4YNQ A;  2XRI A;  4E7J A;  3ZSV A;  2ZQB A;  3M8Q A;  4DFJ A;  4I9L A;  4B9N A;  5D3G A;  4IG0 A;  4RW6 A;  2QXF A;  1BL3 A;  2FC0 A;  3P5J A;  1EET A;  3NGZ A;  3OYC A;  3CFP A;  3LP0 A;  4DTR A;  1ASU A;  2ATQ A;  3VQP A;  1RDB A;  3AVI A;  3KLI A;  2EHG A;  5FRO A;  3ZT2 A;  4CED A;  3NH1 A;  4BDP A;  4KTQ A;  3SQ1 A;  4CFC A;  3HT3 A;  1C6V A;  1RBT A;  3CM5 A;  5J2N A;  4E1N A;  4FLT A;  1T03 A;  1BIS A;  2RF2 A;  3NH2 A;  4DMN A;  3QET A;  3K59 A;  2D0B A;  3K5L A;  3TAN A;  4CEQ A;  3NCI A;  4CEA A;  3VQC A;  1CZB A;  2VWK A;  1JLQ A;  5HLF A;  1NK4 A;  4RG8 A;  4FZY A;  2Y1J A;  4KPY A;  2KW4 A;  4CHO A;  1XI1 A;  1NKC A;  2HW3 A;  3AO2 A;  1S1U A;  2P1J A;  1JLF A;  3SPY A;  2RN2 A;  1RBV A;  1WSJ A;  4KAZ A;  4CEZ A;  3CG7 A;  5C42 A;  4FXD A;  3QEW A;  5E41 A;  4N41 A;  3C95 A;  3DM2 A;  3NF8 A;  4RW8 A;  3ZSR A;  3O3G A;  4PA1 A;  3NDK A;  1NKE A;  1L3V A;  3HVT A;  2IAJ A;  3MAQ A;  3V9X A;  4F2S A;  4O4G A;  3HXM A;  1JLE A;  1TKZ A;  5KRS A;  3T3F A;  4DSJ A;  1QHT A;  4B08 A;  4CJL A;  3ZSY A;  1XHX A;  4E19 A;  1EP4 A;  4CHY A;  5I42 A;  1QSL A;  3C94 A;  1T8E A;  2PYL A;  3AO3 A;  1HPZ A;  1RT4 A;  4FJG A;  4BWM A;  4FJN A;  3AVG A;  2P5G A;  4AHC A;  3NE6 A;  4OLA A;  1RDA A;  3ZT1 A;  2OYQ A;  1RBR A;  2IOC A;  3KKS A;  4ZTJ A;  2DFE A;  3AVA A;  1NK0 A;  2ETJ A;  3CFR A;  4E7I A;  3LDS A;  3OYI A;  1J5O A;  1B9F A;  1S9G A;  5HRR A;  1Q9X A;  2HB5 A;  4RW4 A;  1UAX A;  3TR8 A;  1ZYQ A;  4CHZ A;  4OPJ A;  3HYF A;  1LAW A;  3EY1 A;  3RR8 A;  1JXB A;  4CES A;  3ZT4 A;  4OPK A;  3PV8 A;  3LZJ A;  4W5O A;  1RT5 A;  2Z1J A;  3D0P A;  1KLM A;  2PYJ A;  2YHB A;  1VRT A;  3OYB A;  1RT6 A;  2EX3 A;  4CGJ A;  3SV3 A;  4B9L A;  1DTT A;  2HVH A;  3G10 A;  4ELT A;  3AVH A;  4NCG A;  1NJZ A;  1KSP A;  1QTM A;  2XY6 A;  4Z4E A;  3TWH A;  3VQ5 A;  2VG5 A;  3KK3 A;  5FRN A;  4KRF A;  4M45 A;  3PX0 A;  5HP1 A;  4DU1 A;  3SUP A;  1B92 A;  4C8O A;  3QNO A;  3F73 A;  4OVL A;  3WNG A;  3C6U A;  4DTU A;  2P51 A;  2IGI A;  1IKV A;  4O55 A;  3KK1 A;  4FM2 A;  4KB0 A;  4J2E A;  3A2F A;  4CJK A;  1BI4 B;  4CK2 A;  1ZBU A;  4W5T A;  4K8X A;  1S1X A;  4BDZ A;  3SQ4 A;  1VSM A;  4CIF A;  1RTJ A;  4B8A B;  2X74 A;  4Y1D A;  4OKJ A;  4CGG A;  4E7H A;  4KV8 A;  3AVJ A;  3OYG A;  4C8K A;  4CFA A;  3SQ0 A;  1ZBI A;  1VSL A;  4FLU A;  1TV6 A;  2OPQ A;  5CZ2 A;  3M8P A;  3VQQ A;  1UA0 A;  2B5J A;  4QOZ B;  3QEI A;  4E0D A;  3D45 A;  3L3V A;  4GW6 A;  1L3T A;  1NK6 A;  1BGX T;  2HHS A;  2X78 A;  2HNY A;  3OS0 A;  1Z26 A;  4JRP A;  2BAN A;  1JLC A;  4DQR A;  3ZSW A;  1RT1 A;  4KFB A;  3RRG A;  1SUQ A;  4FZX C;  3V1Q A;  4Z4H A;  4KHU A;  4LSN A;  4CJU A;  3OJU A;  3HPH A;  4IG3 A;  1TVR A;  3V9Z A;  2Y1I A;  2HHX A;  3KIO A;  1J53 A;  1J54 A;  1RBU A;  1CXQ A;  1RNH A;  1RT7 A;  2O4G A;  3HPG A;  3IRX A;  3KTQ A;  4C8L A;  4NYN A;  1HJR A;  3L2W A;  3PY8 A;  1NJX A;  1T05 A;  1NOY A;  2D5R A;  4NCB A;  3OYE A;  3PX6 A;  3K5N A;  4LH5 A;  4AHT A;  3RMC A;  3KJV A;  3V1R A;  1L3U A;  1TAU A;  3HK2 A;  4KTZ A;  3QIP A;  4KI4 A;  3P1G A;  4IFV A;  4AHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...