3KK2A

Hiv-1 reverse transcriptase-dna complex with datp bound in the nucleotide binding site
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
555
structure length
555
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 156
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk2A05
1S6PA 4M45A 3WNHA 2FVSA 3RWUA 4KB0A 5FRMA 1RTIA 1RDAA 3QINA 4H4MA 1HPZB 3VQAA 2IDOA 2QV6A 1VSFA 1UAXA 3SI8A 3DRRA 1RILA 4I7FA 3QLHB 4FXDA 3HT3A 3LAKA 2AGPA 5HRSA 4DTUA 4CJQA 1TKZA 2PYJA 3LP0A 5HLFB 1S9EA 3BQ1A 4FS1A 1C0MA 4O4GB 2BQRA 3PW5A 1X9MA 1BIZA 3QEVA 2P5GA 1YVUA 5C24A 1S49A 3LZJA 1DTTB 3MAQA 4B9UA 5F8NA 4GVMA 4M42A 2P51A 3C6UB 3MR3A 3GILA 3RMDA 4DQQA 3NGYA 5HROA 2XI3A 4WFYA 2ZKUA 3H5YA 4CIEA 3MEEB 1JXLA 4FJ8A 4I2PA 2OPQA 1L3VA 1S1WA 3V9ZA 2EC0A 1REVB 2QXFA 5KFDA 1LAVA 3GIIA 3RR7A 1WSIA 2HHWA 1TAQA 5HRRA 3EZ5A 4NCAA 2WHOA 5KI6A 2ITGA 1L3SA 4CHNA 5EWGA 4QPXA 1FKOA 5F8JA 1NK9A 3EPIA 3AVCA 2WCXA 4IG0B 2FVCA 4YMEA 4Y2CA 4Z4IA 1CZ9A 4HHTA 1VRTA 5JUMA 2V4RA 2JEFA 3K57A 2ASLA 3V1OA 3DDKA 4NLXA 3SUNA 4ZTFA 1LWFA 2YKNA 1GX5A 4B9TA 2G8IA 2R2UA 3ISNC 5T14A 1XHXA 1RT4B 2G8WA 2X78A 4O5BA 4CEDA 2V0NA 1IKWB 5DG9A 4FM2A 4I2QB 3OJSA 3VQEA 2W9BB 2BANA 5C42B 2Z1GA 5F8LA 4DL7A 4JLHA 2RPIA 1S10A 4FJXA 3GIMA 4IH6A 4OJRA 3BSNA 1TK8A 4FYDA 2XRIA 3V6HA 3OYFA 1NOZA 1B92A 1A5WA 1YVFA 3HJFA 4N47A 4CJFA 4CEAA 1JLCA 2OYQA 1RTHB 2Z1HA 3V1RA 4EEYA 4O3NA 3DRSB 1JLQA 3PVXA 3GV8B 4OVLA 1JLAB 5KFXA 4Y3CA 2KW4A 5CYMA 3C94A 1L3TA 2HAIA 3DM2B 1RT3A 5KGXA 3U3YA 2R8KA 1KSPA 3N6LA 4CJUA 4ELTA 3NF9A 3NH2A 5KG6A 1S1UA 3SPYA 1IH7A 3RMCA 1ZBHA 5KFKA 1U48A 1FXXA 1WAJA 3OS2A 4IG3B 4XO0A 4CJKA 3QNNA 3SPZA 4J9OA 1W9HA 3BDPA 3SI6A 3DOLB 3ZSWA 4ZPDA 3K58A 2VG6A 3MTKA 1RT1A 3B6OA 1EETA 1VSJA 3M8SA 3KKRA 2HNZB 1BI4B 5DG7A 4Q8FA 3EZUA 1CZBA 4MH8A 5KT6A 4ID5B 3KLFA 2JEIA 4IRKA 3AA4A 3UPFA 1IM4A 2G8UA 2JLEA 4IFVB 4CHZA 4ZVHA 4ZP8A 3LP1A 2HWIA 1KTQA 4K8XA 1RDCA 1IKXA 4DTOA 1R0AA 1C1BA 3AO3A 1K6YA 4TY8A 2Y1IA 3F73A 4NCGA 4NLQA 1JLGB 1VSMA 1S5JA 4RUAA 3LWLA 4J2DA 5L1IA 1KVAA 4BE1A 4AHTA 3O4NA 4CJTA 1KLMB 3IS9A 5F8HA 4CEFA 3KLVA 3MEDB 2HVIA 2GIRA 1GOCA 3PUFA 3D28A 1HMVA 3K59A 2IGIA 5KFPA 3L8BA 4YR3A 4WE1A 2IAJA 4J9SA 4ECXA 3HP9A 4DG1A 4MFBB 5CZ2A 1LV5A 2Q3SA 2R7YA 4KKOB 4CF1A 4QWBA 3QIPB 2YKMB 4M3YA 3TQ1A 5EUHA 4CGGA 3OY9A 1DTQA 4FW2A 3ZT3A 3LP3A 2W9CB 4DFJA 2C22A 4ZPCA 4CFBA 3KLIB 3PV8A 4C8OA 3AA5X 3OSNA 1TKDA 3CO9A 4NLDA 3TAEA 3JSMA 3G6YA 4J9MA 3QGHA 3DI6A 2X6NA 5D3GB 5KGWA 2KFZA 1VRUA 3THVA 3QO9B 3MEGA 4K50A 4FJHA 1C6VA 4J2AA 1C0UB 1N5YB 4H8KA 3CDEA 3CDWA 2GV9A 3HPGA 2YNHB 1C0TB 3M8PA 2VG5A 4EO8A 1WN7A 1JKHB 4O44A 3ZT2A 4NLSA 1QS4A 1KHWA 3ASMA 1L5UA 2F8EX 1HNIB 1OS5A 3SUPA 1X9SA 1S6QB 4LH5A 1D9DA 2I1RA 4CJ3A 3EY1A 1S1XB 3N6NA 4CF0A 2RKIA 4ECSA 4F4ZA 4K4TA 4RW9B 3G10A 3V6JA 2HW3A 5J1EB 2EHGA 3M8QA 4BACA 2VWJA 4QAGA 3U6FA 3MECB 5L1JA 4ZPAA 2HHTA 2IS3A 4NCBA 3SFUA 1RTJB 4RW6A 2ZQBA 4DWIA 1HYSB 4IFYB 1HQEB 5JXSA 1XC9A 4CK3A 1ZETA 4Y1DA 4G1QA 3WNEA 4DTSA 1TVRB 5KG7A 4TXSA 1HARA 4DL5A 3H40A 3NE6A 1RT2B 3JYTB 3V4IA 4HVJA 3QIDA 4AILC 4FJ9A 5DK5A 4NLWA 1KHVA 4M3ZA 3AVJA 2RF2B 2BDPA 3EPGA 2KFNA 3TAMB 4NYNA 5T7BA 4DS4A 4DFKA 1VSDA 4YQWA 1MU2B 4CJPA 5EU7A 4KHSA 1QQCA 3O3FA 2FLPA 4QW9A 1WSFA 3L2VA 1UWBB 3ZT1A 3KLGB 2J6TA 4ED6A 3CG7A 1S9GA 2D0CA 1NNDA 2OPPB 5KFEA 4KHQA 1WSHA 4R8UA 3QEWA 2XGPA 2E4LA 2E6MA 3KJVB 2I5JB 4DMNA 3AVIA 4CGFA 4F2SA 3FFIA 4IOBA 4E7HA 4EBDA 3OLAA 1C1CB 5K14A 2E9TA 3DLKB 2ZE2B 4BWMA 4DLEA 3AO2A 3VA0A 2WTFA 4NLPA 3DRRB 3OL6A 1S1TA 5I42A 5KT2A 3HVTB 3PZPA 2D41A 4CFCA 3OL8A 3LP0B 1S1VA 3H4BA 2OPSA 1G15A 3PW7A 5KFOA 1IG9A 4F3TA 1RBVA 2OZSA 1J5OA 1JLFA 3OSPA 4HCCA 2FVRA 4W5NA 3PW4A 3KNAA 5F9LA 1LW0B 4W5TA 3VQPA 3ZCMA 3SJJA 3IGVA 1RT5B 1W25A 4IBNA 1TKTA 4Z4CA 4DQIA 4R5PB 3E51A 4I2PB 3AVFA 3OYGA 1N48A 3PY8A 1K1SA 1RDBA 4AHRA 4FLTA 3C95A 2YHAA 1LWCA 1YTUA 1LWEA 4URSA 3VA3A 3LALA 3PW0A 3RTVA 3SQ2A 1N6QA 3GQCA 1BHLA 3QESA 3I5CA 2XWYA 3VQ9A 3S9HA 4ECZA 4O3OA 3KLHA 5DG8A 4OPKA 1EP4A 1F21A 1HNVA 3AVHA 2A1SA 4CHQA 4TQRA 4WFZA 1LWFB 2P5OA 5FRNA 5KG2A 3WNGA 5KFJA 1K1QA 5F8MA 2R2RA 4C8KA 3LP2A 2PY5A 4DQSA 1RT6A 4F3OA 3T5HA 1NK0A 3V6DA 3HYFA 1XR7A 2AX0A 1SL1A 2E9ZA 1JL2A 4ZHRA 4CECA 2BGGA 4IKAA 2QK9A 3LWMA 4FJ7A 3FSIA 4FBUA 2XCPA 3GV7B 3NBPA 4C8MA 1SH3A 1NK8A 4E7LA 4ELVA 4ED8A 3DLEA 4NLYA 5EWFA 3G86A 3S3NA 4KHYA 3BQ2A 5KFUA 3AVMA 2DPIA 3I5BA 1JLBB 3OYAA 3CM5A 1NK5A 4OL8A 1SUQA 2BE2A 2E9RX 3CM6A 4K8ZA 4ELUA 2B6AA 2FC0A 4F8RA 4EO6A 3HK2A 4FLYA 4IH5A 1HYVA 4PQUA 5KFYA 2JEGA 4CHPA 3T3FA 3M9OB 4J2BA 4XPCA 5F9NA 2HHUA 1LW2B 3OHAA 5J2PB 4N5SA 1T94A 2YNIB 3K5MA 5DGBA 4E1NA 3Q8PB 1UA1A 1N4LA 1WSJA 3G6VA 1WSGA 4AHSA 2D7SA 2YNGA 2KZZA 3UDLA 3Q8RB 4RW8A 1S48A 3KK3A 5KFFA 4YNQA 1WAFA 3RRGA 5EDWA 4YFUA 1QSLA 3CJ5A 2LSNA 5J2QB 5I3UA 4BWJA 4MIAA 2OPRB 4Q5VA 3DLRA 1XI1A 2QE5A 4HUEA 4ZVGA 2UVRA 4DU4A 1ZTTA 4KHRA 3RBDA 4B08A 4ZTJA 5FDLB 4GC6A 1IKYA 1QE1A 3EYZA 4J9PA 3A2FA 3BJYA 2HNYA 2BRKA 1C1BB 2HNDA 4IDKB 1T03B 3L2RA 3KHHA 2X6SA 3HKWA 4KBIA 2A1RA 4F4YA 2W9AA 4TY8B 4B9MA 1MMLA 1TV6A 1D5AA 4X2BA 4KFBA 1XR5A 1JXEA 4LY7A 1ZBLA 3SV3A 3FRZA 5KFLA 1QHTA 5HBMA 3FQKA 4Z4GA 5HP1B 2BR0A 3KK1B 4KTZA 2HMIB 3RAXA 4BDPA 3T5JA 1TL1B 3PR5B 2IAJB 4CIFA 3H4DA 1SKSA 1ASVA 2DTUA 2W7PA 3MFHA 1S0NA 4OLAA 4CHOA 3B6PA 4KAIA 4CEEA 4YP3A 2D5RA 4H54A 3SNNA 4M3TA 3C6TA 3DRPA 4ED1A 1TKXB 2FJWA 4M3XA 1VSHA 1VSLA 3M9MB 3QIOA 3TARA 4ICLB 1C1AA 3P1GA 3TAQA 1QTMA 2RN2A 4O0JA 1VRUB 1QAIA 3VQ7A 4FLZA 3Q8SB 3NGDA 3CJ3A 2Z1JA 1ASWA 2F8SA 1KFDA 1S4FA 4LSNA 2GBZA 4CF9A 2ZD1A 3RR8A 4J9LA 4NLGA 3NGZA 3QZ7A 3PJXA 3IRXA 1A5VA 4RW7A 5KFZA 4WYLA 3QEXA 1RCHA 2FBVA 5J2MA 3V9WA 4ECQA 3V81A 3DYAA 2D0BA 4TLRA 1RA6A 1ASUA 3OS0A 1Q8IA 3HVWA 1T05B 3AVKA 4FJJA 3I0SB 3P5JA 4ZP6A 1FKPA 1A5XA 2W42A 4K4WA 3OYCA 1HRHA 1JXBA 1B9FA 1HPZA 4Z4FA 2FBYA 2AQ4A 1RT7B 1NHUA 4CFDA 4M3UA 4R0EA 1IKVB 1S0MA 4XPEA 4CIGA 3QLHA 3MFIA 3BSOA 4LH4A 4DL3A 3QZ8A 4NRTA 2IM3A 5HLFA 1J54A 3TR8A 3MF5A 4JV2A 4RW4B 3S3MA 1I6JA 4K4UA 4O4GA 4L8RB 4DTPA 4G1QB 1DTTA 1UOCA 4H4OA 3C6UA 3UIQA 3FDSA 4CHYA 3MEEA 4CK2A 5EWEA 1RBTA 1U04A 4EBCA 1RYSA 1SKWA 2C2EA 1IO2A 2XY8A 3RB4A 4NLRA 3NH0A 1REVA 1X1PA 5C25B 2KZMA 4B9NA 4LSLB 3OYDA 4W5RA 1J53A 4DTMA 1Q9YA 4AH9A 3TAGA 4MKAA 4Q0BB 2IM0A 3IAYA 4O55A 1JLEB 1T8EA 4IG0A 3TAPA 4KV8A 5KTQA 4PWDB 5KRSA 2JC0A 2F8TA 2D3ZA 4FLUA 3DLHA 2VG7B 2G8FA 2XI2A 4PUOB 3KK2A 1BQNB 2E6LA 3FFIB 2XCAA 2AGQA 4WFXA 4B8CA 3K5NA 2UUWA 3GYNA 1RT4A 2IC3A 3NKYA 4F4XA 4BDZA 1IKWA 3O4QA 3SZ2A 3AVLA 4I2QA 4FJ5A 3PX0A 1RTDB 2W9BA 3KHGA 4NLTA 4O3SA 2WONA 4F4WA 3ALYA 3LPTA 5KFTA 4MK8A 1J5OB 3OYKA 4J2EA 2GUIA 3BQ0A 4FJNA 3DOKB 4M41A 3H98A 1WSEA 2YNFB 4GMJB 3HPHA 2O5DA 4F50A 4ZVFA 2P1JA 2KTQA 4DL6A 2DFHA 4Y2AA 4M3WA 1RTHA 2UVWA 3SUOA 4QOZB 3K5OA 3DRSA 1TL3B 3OYHA 4FLXA 3IG1B 3QGGA 3DM2A 1LWCB 4ECRA 1DLOB 4RZRA 3P83D 3I0RB 3DLBA 2RDIA 3CJ4A 4MK7A 1BL3A 4O3QA 4KHNA 3CJ0A 4IG3A 2RDJA 4IR1A 2O4GA 4HYKA 2GC8A 1XWLA 1QSSA 2OH2A 3MR5A 4NLUA 3LDSA 3DOLA 5KG1A 4E89A 4DS5A 5SWMA 2IJFA 3ITHB 5J2NA 3ZSQA 2ATLA 4AHCA 1SV5B 3LAMA 4I9LA 3NGIA 4DTRA 3NF8A 4EYHB 4M94A 2HNZA 1BI4A 2UVUA 1NKCA 1HQUB 3IGNA 3NF6A 4ID5A 4FK0A 5CYQA 1C2PA 4F2RA 1WLJA 1GOAA 3E01B 4RUCA 4FZYA 4K4ZA 4IFVA 4UQGA 3RAQA 4DQPA 1NOYA 1CXQA 4CF8A 4DFPA 4WZMA 4OGEA 5KG5A 2FJXA 5C5JA 4ECUA 4KI6A 3HPOA 3BGRB 1T7PA 3OL9A 3KHLA 3VQ4A 3TI0A 4KO0B 4FK4A 3AO4A 2FLNA 3QYYA 1JLGA 3GIJA 3OYLA 4CF2A 1NJZA 3NAIA 2IOCA 3T19A 1S6PB 4E3SA 1NK7A 2B6AB 3PJWA 4DSJA 1KLMA 2WRMA 1RTIB 2DY4A 4ECTA 4EYIB 4YR2A 1FK9A 4H4MB 4B9VA 3MEDA 4CJEA 4Z4EA 3V9XA 2G8KA 5HRPA 4I7FB 4Q8EA 1CLQA 3ZSVA 4MFBA 4QWCA 2C2DA 1TKZB 4DU3A 4KKOA 1S9EB 4DTJA 3QIPA 2YKMA 3SFGA 3V9UA 4E1MA 4TSXA 2W9CA 3PX4A 4K4VA 5C24B 3MXMA 2CJQA 3GIKA 3QEIA 2ILYA 2B5JA 3OLBA 1VSKA 3KLIA 2F96A 3TABA 1KVBA 4DSIA 2FJVA 4JRPA 5HROB 3WNFA 5D3GA 1TGOA 4IQXA 3QO9A 2OPQB 4FK2A 1S1WB 2IMWP 1N5YA 2YNHA 3I5AA 1C0TA 4KB7A 4HUFA 1JKHA 5KFBA 4FZZA 4DF4A 4J9KA 3BSAA 1YTAA 3AO5A 1RBSA 1ZBUA 1FKOB 1SKRA 1KRPA 1HNIA 1S6QA 4CESA 4OKKA 4RG8A 3MR6A 1VRTB 1S1XA 1U09A 4RW9A 3AVGA 5J1EA 1Z4UA 4E0DA 3IN5A 4IRDA 5KFCA 3S3OA 2AX1A 2R8JA 1RYRA 3MECA 1BCOA 2YKNB 4CEZA 4MKBA 1RAJA 3AVBA 3CFRA 4PY5A 3O3HA 1NK4A 1EXQA 2G8VA 1RTJA 2BANB 1HYSA 1HQEA 2IBKA 5KFIA 4EBEA 3SYZA 5KRTA 3DRPB 3L3UA 4ZP7A 3KD5E 1TVRA 3OYMA 2V9WA 4Q44A 1YT3A 4EP4A 4U6PA 4DQRA 1D1UA 3SQ1A 4ED3A 1RT2A 3JYTA 4CERA 3DLGA 3KMSA 2ASJA 4KHWA 1JLCB 2R2TA 5KFSA 3OYIA 5KFNA 2RF2A 3CVKA 3D45A 1TP7A 1WNSA 1JLQB 4O4RA 3ZSXA 1MU2A 4BE0A 5CYMB 4QW8A 1BCMA 4Z0UA 2EX3A 4FM1A 1RT3B 3GV5B 2DPJA 3D5MA 3UR0A 2W8KA 1S1UB 1UWBA 4IKFA 1BQMA 3KLGA 3CJ2A 4TQSA 1D9FA 3HO1A 3DMJA 4CK1A 3KLEA 3BR9A 1GOBA 4ED0A 3KJVA 2W8LA 2I5JA 2UUTA 3RB3A 4IRCA 4KI4A 1FKPB 3VQ5A 3VQ6A 3QERA 1C1CA 4FVMA 3DLKA 4OPJA 4ZVEA 2VG6B 2ZE2A 5KFHA 4C8NA 1RT1B 1ITGA 1EETB 2IA6A 4DTNA 4DFMA 4NYFA 4ZMMA 4ECYA 3MXIA 3KLFB 3RB0A 3HVTA 4KHMA 3CFOA 3H59A 2XY6A 4NRUA 1QAJA 2HB5A 4N76A 2IJNA 1JL1A 3QGIA 4LD0A 4KB1A 4M3RA 1LAWA 2C28A 4I9QA 4J9NA 3LP1B 5KT5A 3K5LA 4WZQA 3PO4A 1LW0A 4H4OB 3VQ8A 1IKXB 1NK6A 1RT5A 1KLNA 1R0AB 3VN5A 4R5PA 3ULDA 4KRFA 1JIHA 3AVNA 1ZYQA 3FQLA 1EKEA 4NCGB 1I39A 4NLVA 4ZP9A 3H5UA 5KFQA 1Z25A 4WYWA 4TYAA 4FJGA 2OA8A 2R8HA 5KFAA 4CCHA 4B3OA 5KFRA 3LANA 3IS9B 4RNNA 3QEPA 3HP6A 3OYEA 1HMVB 4KV8B 5JS2A 1ZTWA 3KD1E 4WE1B 3I8DA 2WK4A 4DG1B 3QETA 3KIOA 3KK2B 4OLBA 2D3UA 3T1AA 3OL7A 2J6SA 4FJKA 2UVVA 1NJYA 4MQ3A 1DTQB 4RU9A 5KG3A 2IC3B 4NYZA 3BREA 4J9QA 4KREA 2HHXA 2YV0X 3TWHA 4B9LA 4FLVA 3L2WA 4PA1A 3AA2A 1NKBA 3JSMB 3DI6B 1TAUA 2WONB 3T5LA 2ALZA 4ECWA 1VSEA 4CFAA 3MEGB 4MK9A 2XC9A 3K2PA 4E7JA 4DSFA 4KTWA 4JRQA 4CJWA 3M8PB 2VG5B 1CSJA 1HJRA 1SL2A 4O44B 3OVNA 1L3UA 3NH1A 2WOMA 4E7IA 4OKEA 1JLBA 2OZMA 2KQ2A 3BSCA 4URGA 5DMRA 4GW6A 4EZ6A 2XY7A 2RKIB 4KE5A 1EX4A 1J9AA 4DL2A 4DL4A 3ZSRA 4ZPBA 1CXUA 3M8QB 4O3RA 4O3PA 1RDDA 4JV1A 4QCLA 3NF7A 3HM9A 4B8AB 3CWJA 3G0ZA 3CFPA 1LW2A 1SL0A 1KFSA 5J2PA 2AGOA 2VA2A 2YNIA 4CE9A 1Q9XA 1NKEA 4RW6B 1Z26A 3L2UA 5J2NB 2Y1JA 1O1WA 3SQ0A 1QUVA 3NMAA 4JS5A 3LPUA 2W7OA 5KFGA 2WB4A 3VQDA 3KMQA 3ICLA 5CYQB 5J2QA 3V4IB 3ZT0A 3AA3A 4DSKA 3NAHA 3OYJA 4LQ9A 5FROA 5KFWA 1BGXT 2OPRA 2IM2A 5JS1A 3V9SA 3KTQA 3PX6A 2DFEA 4KPYA 4K4XA 5FDLA 2D0AA 3L3VA 3PO5A 3ZSZA 4CJSA 4HUGA 4QWDA 4JV0A 3HVRA 4FJLA 3MXJA 3CQ8A 1GX6A 3CDUA 3RB6A 4IDKA 3V6KA 1T03A 4C8LA 1D0EA 3OS1A 5CY4A 2J6UA 4AHUA 1S9GB 2ETJA 1Y97A 2AJQA 2CKWA 4R8UB 2PYLA 4EZ9A 4DU1A 2HVHA 4NLOA 2VA3A 5SZTA 5HP1A 4JS4A 3H08A 5K14B 1D8YA 3KK1A 1XHZA 1FK9B 3SV4A 3HHKA 2HMIA 1TL1A 4N56A 4OKJA 3RBEA 4QWAA 4DLGA 2R8IA 3PW2A 3L2QA 1S1TB 5I42B 3KKSA 1NJWA 1KVCA 4QWEA 1BISA 1S1VB 5C42A 2OPSB 3AV9A 3OYNA 1TKXA 1JLFB 1RBRA 3H2LA 3NFAA 2FLLA 5KFMA 5KT7A 2B5JB 5DQIA 2QKKA 3KOAA 3VQSA 4ICLA 4W5QA 5DLGA 1U4BA 4W5OA 5L1KA 4RNFA 1TKTB 1W0HA 3CIZA 4JUZA 2HHSA 2Z1IA 4Y1CA 1NJXA 1WNEA 3OHBA 1X9WA 1JLAA 1S0OA 2JEJA 3VQCA 1LWEB 4DSEA 1B9DA 3RMAA 3U3GA 4CEBA 4M95A 3VQBA 1N6QB 2FBTA 4CJLA 2BQ3A 3D0PA 1TK0A 3HXMA 2AU0A 1T3NA 1T05A 3I0SA 5DQHA 3KLHB 4ED7A 2DFFA 3V1QA 2BQUA 3NHGA 4U7CA 2X74A 1EP4B 3Q8QB 3H5XA 5HRNA 1HNVB 3RRHA 4OGCA 1U49A 1ZBFA 5KT3A 4HCBA 1RT7A 3PR4A 1IKVA 4FBTA 2GIQA 3PHEA 4DF8A 4FZXC 4CJ5A 3LP2B 4RW4A 4J9RA 4DSLA 1BIUA 1RT6B 2C2RA 4E19A 3NCIA 3V6DB 1U47A 4NZ0A 1ZBIA 4WXWA 3ZT4A 1I3AA 4ZHRB 2JGUA 2AWZA 3NBPB 5F8IA 3DLGB 2XGQA 2XO7A 3DLEB 2QKBA 3NL0A 4FJIA 3TAFA 4XIUA 5C25A 3UQSA 3CYMA 1SUQB 2BE2B 4LSLA 5DQGA 1TQLA 4Q0BA 2FVQA 1TK5A 1RA7A 4Y34A 4B9SA 4RNMA 1BQMB 4PQUB 5DLFA 3HVAA 1JLEA 2B43A 2R2SA 4YR0A 2XY5A 3DMJB 4PWDA 5CZ1A 3O3GA 4CEOA 3KLEB 5E41A 2VG7A 2FBXA 4CEQA 2HHVA 4PUOA 3H5SA 1BQNA 1KCFA 2G8HA 2YNGB 3ISND 3HL8A 4Z4HA 4CJ4A 4RW8B 5L9XA 4KSEB 1XR6A 3KK3B 5KG0A 1U45A 2ASDA 1RTDA 3F9KA 3OJUA 4HKQA 4CJVA 4URQU 5L1LA 5I3UB 3SQ4A 4DTXA 4ECVA 3AVAA 4F4KA 3DOKA 5KG4A 1C0UA 3AO1A 2HHQA 2YNFA 4KHUA 1HYZA 2FVPA 4RNHA 1IKYB 4GC7A 1S97A 4Q45A 1QE1B 3SCXA 2B4JA 4TN2A 4BDYA 2ILZA 2HNYB 2HNDB 4TYBA 3TANA 4HTUA 4FCYA 1JX4A 1RBUA 4CGJA 1TL3A 4K4SA 3IG1A 3MR2A 1TV6B 1SH0A 2VWKA 4KFBB 1DLOA 4MIBA 2JC1A 4RNOA 5HBMB 4N41A 3I0RA 4AHVA 3M9NB 4KTQA 2YHBA 4EP5A 4B3OB 3G6XA 4ID1A 1UA0A 3T5KA 4FW1A 2R8GA 3HSTB 1N56A 5KFVA 3RMBA 3QNOA 4FS2A 4IR9A 1SH2A 4CJRA 3N6MA 3ITHA 4IFYA 1SV5A 4FJMA 3ZSOA 3SUQA 2XHBA 4BE2A 3C6TB 3M8RA 4IH7A 2HWHA 2V4QA 4CGDA 4E7KA 1HQUA 1S9FA 3OYBA 4TY9A 1QSYA 4K4YA 3E01A 4CGIA 4Q43A 1RNHA 4DEZA 3VQQA 3NDKA 4FM0A 3TAMA 1VK0A 3NAEA 2ATQA 2O4IA 3ZSYA 2BRLA 2PZSA 1VSIA 4LQ3A 5KT4A 3TVKA 4LSNB 4WXOA 3KHRA 2ZD1B 4O0IA 3BGRA 4KAZA 3IRXB 4RW7B 5F8GA 1NHVA 5DGAA 4G3IA 2IM1A 4KO0A 5J2MB 2WOMB 2NUBA 1RDRA 4FLWA 2OPPA 3V81B 3DYAB 3LZIA 4ED2A 4CGHA
chains in the Genus database with same CATH superfamily
4ES2A 2FHMA 2VPZB 1RDAA 2FPHX 1FFGB 3VQAA 5L38A 2IDOA 2QV6A 1TUVA 5A8WA 2WSEC 2Y8YA 5HLFB 3BYPA 4A5AA 4IOCL 2BQRA 2VYPA 1BIZA 3QEVA 3IMXA 1YVUA 5C24A 3M1VB 1S3XA 2CPXA 3MAQA 2OFHX 4WKRA 3CEDA 3GILA 4DQQA 5HROA 4WFYA 3GFZA 1EQYA 2XMAA 3D7EO 4CIEA 2Z0GA 4I2PA 5D0HA 2OPQA 4IEIA 4I68A 4NLBA 3MMAA 3MDFA 1REVB 2QXFA 2VWBA 5HMZA 4LF9F 3BBFA 2DRBA 2HHWA 1TAQA 3D66A 3GSDA 3D67A 3G4SS 5IT9U 1PJ5A 2WHOA 2OO4A 1S57A 4DPXA 4QPXA 4C23A 5LSRA 4CO5A 3TA2A 2DBBA 3P5TL 2D3O1 4YMEA 2CIMA 1CZ9A 1NSQA 3MCAB 4MMOA 4HHTA 2DITA 3HZ6A 1FD8A 3TA1A 2J9EA 3SUNA 1WSVA 4B9TA 5LJ5Y 5AXMA 1XHXA 2YWWA 3EDQB 2G8WA 4CEDA 4FM2A 3DXSX 3OJSA 1KKHA 4OX9F 3SMZA 5C42B 2RPIA 4ISFA 1GQEA 4IH6A 3BSNA 2ZJRQ 1EAYC 2XRIA 1V3RA 1B92A 4TU7A 2H1YA 4CJFA 4CEAA 2JWKA 2OYQA 3V1RA 4EEYA 4IOAQ 2M88A 3DRSB 2KHDA 3R27A 2MHNA 1Y3JA 2V63A 3GV8B 4OVLA 3HHDA 5KFXA 2KW4A 2HK3A 1BHNA 4F0HA 1VQNS 3N6LA 1FNXH 2EG1A 5LMNJ 3UKRA 3SPYA 1SIWB 3MZIA 5KFKA 3HHLA 1OWXA 2EC2A 2FC9A 4LF5J 5AQSA 1WAJA 2R7SA 2VGNA 4XO0A 3J80O 3KWIA 2WB1D 4ZPDA 4BC5A 2UV8A 3CNQP 4OHWA 2YX6A 1BI4B 4Q8FA 1CZBA 4ID5B 4DBQA 4IRKA 2DRDA 2B9YA 2WBNA 4FO0A 3N4PA 1XNRK 2WW4A 3EVWA 3CCJS 3IFRA 4ZVHA 2WBMA 4RUHA 5HQLA 5B0GA 2HWIA 3N5BA 1KTQA 3AXMA 2QEXS 1UVMA 1IKXA 3Q8VA 3Q23A 5AZJB 1OQ6A 1WKLA 2K2PA 3IR7B 3BS9A 4A57A 1K6YA 4JKEA 4NCGA 4NLQA 1ZAWA 1NHKL 2CPDA 1JLGB 4F9OA 2CADA 1Q8BA 4RUAA 3CCMN 2FYXA 2RDDA 1YJWN 4M5HA 3MEDB 1YTYA 3UVJB 3A0IX 5KFPA 4YR3A 4ECXA 2IAJA 4DR5K 3ZYYX 5AXLA 5L8RC 3B82A 3HP9A 4PEOA 2ZBQA 3MOJB 2E1PA 2WC9A 4KHPJ 4CF1A 3TQ1A 2DVIA 1HLUA 4CGGA 1QVFM 2C22A 4ZPCA 2QA1A 2UP1A 4C3MA 2B4VA 3CO9A 3G6YA 3NCQA 3DI6A 5D3GB 1CZAN 1VIXA 3JSBA 2IPOB 4CJ7A 2XS2A 4OX8A 2E5LJ 3CULA 1C0UB 2ASOA 3HPGA 2YNHB 3L9ZA 1JKHB 3ZT2A 2D9OA 2OTLN 5A2QU 4WKYA 1RAEB 3O6QA 3SQGB 1F9EB 1AFJA 1OY8A 1ZBSA 1D9DA 3TO8A 4CJ3A 1PBUA 5LMNF 3EY1A 3MWTA 1S1XB 1B0VA 4R0JA 1EKRA 4RW9B 1IVZA 3G10A 2HW3A 4X66K 1X4AA 2NRZA 2EHGA 2BKNA 4LF5F 4QAGA 1IJFB 4ZPAA 2L48A 2BTFA 4P10A 2IS3A 2ZH9A 4UZBA 4BRAA 5AQHA 2ZQBA 3EXYA 4DWIA 3DKDA 1WI6A 2FB0A 2MZSA 2DNPA 5IC6B 4G1QA 1J5EJ 4DTSA 1VISA 4DL5A 3H40A 1AFIA 1RTZA 2CZVC 2W2MP 1CC8A 3Q83A 1T02A 3ZZRA 1R6VA 3ZZYA 1KHVA 3AVJA 2E5HA 1GT8A 4A5BA 2BDPA 2QW9A 1YXQA 3EJMA 4BR7A 2QA2A 4OYXA 3AD8C 5IZHA 4CJPA 2CFXA 5EU7A 3G8SA 4JI1J 4DR7J 3CJCA 4B3TJ 4JI7K 4LVOP 1F9HA 1NBWA 3ZT1A 2K7KA 3KLGB 4NL5A 2J6TA 1AB8A 2Z58B 3NGRA 1HHSA 2IVPA 4I6MB 2EFVA 1IXKA 3JXOA 3I6PA 1WSHA 3QEWA 3BGLA 2OFGX 4F2SA 4IOBA 2ZFHA 3E2EA 3SMSA 4E7HA 4EBDA 3IWNC 3MM7A 2PDAA 2ZE2B 4FPRA 2HFOA 2WTFA 1GFWB 4CZMA 1A6LA 4KHPF 3OL6A 2MGZB 3QT6A 5I42A 1SXLA 4JKGA 3GIRA 3T6BA 2M9KA 4CFCA 2LYVA 3BF4A 3C7NA 4ZITA 1OVQA 1JLFA 4AL5A 3QT8A 3BUZB 4LF8K 1IWGA 4CH1A 1B0TA 5F9LA 1CC7A 4OYPA 3SJJA 1X5PA 3IGVA 1RT5B 1S7IA 1W25A 4NWBA 1N36J 4Z4CA 4I6AA 3A3PB 4R5PB 2LQBA 1FRHA 1N48A 3TP2A 3DLLQ 3S8SA 1HNXK 1K1SA 1RDBA 4AHRA 4FLTA 2V50A 1FTRA 4IDHA 4URSA 5IT9O 1XMBA 3PW0A 1F3FA 2HPUA 2HQFA 4KGXB 3LDOA 4AM6A 1BHLA 1JMTA 3CT9A 3I5CA 2R9LA 3MCMA 1OQ3A 4O3OA 5HJYA 2X7IA 1R6YA 4OPKA 2MZRA 4H0XB 1U6FA 3MN6A 4GVBA 4TQRA 3H3OB 5LJ3Y 1LWFB 2QWOA 2P5OA 2E1ZA 3WNGA 5F8MA 2P9NA 3OD2A 2YHXA 4FWOA 2R2RA 3D6MB 3PXGa 4NXMJ 4C8KA 2FJAB 2VBWA 3OTDA 4FF2A 2PY5A 6FDRA 4BRGA 1Q7LB 1NK0A 4JI3J 3HYFA 2ZWOA 2A3JA 1SL1A 4BHQA 2Q43A 2E9ZA 1JL2A 3FSIA 4FBUA 2XCPA 4DZDA 2O8EA 2QMWA 5ETSA 2RJZA 3DLEA 4BS2A 5EWFA 1TYQB 4KHYA 4GKJK 2CPJA 4OZ5A 2LEPA 1JLBB 3CM5A 3H42A 4JI1F 4DR7F 1NJIO 2DXFA 4B3TF 2E9RX 2I8EA 3DFEA 1VK8A 4ELUA 4PG8A 3ZX2A 1IBKF 3L4BC 4IH5A 1HYVA 4PQUA 1N0UA 1AYEA 2N3LA 3M9OB 2H5EA 1ZC6A 2MDAA 4KC5A 2HHUA 4H0TB 3UDCA 3OHAA 2PFUA 1CJTA 1YJWS 5KPRA 2GVDA 4E1NA 3M6GA 1N4LA 4AHSA 3G6VA 5GADP 2D7SA 3H45C 2RHQB 3BZCA 2P9IA 3ZTRA 1H74A 4CM0A 3KK3A 3QWUA 4ZJOA 2W41A 4BR2A 4YFUA 2Y1LB 4A8WA 5CZVA 3GB0A 5F3ZA 1NZAA 3EE8A 4LT6A 2HZVA 3PCOB 1HBNA 1CULA 1OY9A 3BF1A 1ZA1B 4KHRA 1N36F 5B8HA 1NSPA 3EYZA 2DH8A 3W66A 2HNYA 4YB6A 1C1BB 2M8HA 1XK8A 2X6SA 5CQGA 3HKWA 4LF7K 4KBIA 2A1RA 1YIJN 4TY8B 1MMLA 2HHPA 2OTLS 2KT3A 1D5AA 2D0OA 3O08A 4PL7A 3S1TA 1JXEA 1ZBLA 1P8GA 1QHTA 3IUCA 2B7CB 3C66A 4Z4GA 5HVHA 3R6GB 4PKDB 2Y1RI 4KTZA 4ZK7M 3M8WA 4DU8A 3PR5B 2N7CA 4CIFA 1SKSA 2W7PA 3MFHA 2E7WA 3VAIA 2NPIA 1RGVA 1VDHA 2D5RA 3SNNA 5CABA 3C6TA 3DRPA 4NXMF 3SDEA 3F44A 3M9MB 1E4GT 5A8KB 1EARA 1KWMA 3R2CJ 2A18A 3P1GA 4JI3F 3TAQA 1KR4A 1Y10A 3BYRA 2UU9J 1QAIA 4WCEQ 3DWLA 3ZO7A 2ROEA 3TOQA 4DXLA 3WC2A 4BRMA 5C7PA 4CF9A 1JQGA 4J9LA 4JKAA 2E66A 5A2QO 3NGZA 5DO2A 5M1FA 5DDPC 3B54A 4WYLA 4AF1A 1RCHA 2JNJA 2MKSA 3HX9A 4ECQA 5AQNA 3MOZA 3VF2A 3V81A 3UE5A 4TLRA 1Q8IA 2HQIA 4AQYJ 1Y9OA 2PT0A 1T05B 1N33J 3LGNA 2E88A 3P5JA 2MZTA 2HGLA 2ZUAA 4OLPA 3MM6A 3D6TB 5JVGQ 1A5XA 3QFPA 2ROGA 3W2VA 1B9FA 2B4UA 3R3TA 4CIGA 1IKVB 1YG0A 2F8MA 3AY9A 3MFIA 3QZ8A 2JHEA 4ERDA 2IM3A 2O01C 3MF5A 4K4UA 4O4GA 1NUEA 1X4CA 4DTPA 2OKQA 5E5NA 1LK5A 3HHLD 2XLJA 3RZAA 1O8BA 3C6UA 3R97A 3B8HA 3CHWA 1D9AA 3FDSA 3HKZD 1HNWJ 3QJJA 3NMRA 2OIHA 3G6EN 4RLEA 4CHYA 2FJDB 4HI2A 4NXNJ 4EBCA 4WFAQ 1YUWA 4ILHA 3RB4A 5IXUA 3ISZA 4NLRA 4WK3A 3UD5A 1X1PA 4MDBA 4LSLB 1PYTA 1G1XA 1URNA 3CUNA 1OO0B 2BJ9A 3RU0A 4USTA 3FVYA 3MWPA 3TAPA 5KTQA 2HG4A 3DC2A 5K9FA 3QRPA 1NZ8A 2JC0A 4H0OA 2F8TA 2D3ZA 4FLUA 3AD7C 4M5DB 4PUOB 1BQNB 3FFIB 2XCAA 2UUWA 3EKUA 1CJUB 2LXUA 5HL7Q 2O67A 1Z6RA 3AVLA 3WZ0A 1GXUA 3D4JA 4I2QA 1M90T 1RTDB 2W9BA 3KHGA 4O3SA 2ZHBA 1RHQB 3GE9A 2GAGC 3CCES 1J5OB 3OYKA 4J2EA 4FJNA 3FZBA 3CCQS 4WWSA 4CZGA 1HKCA 3H98A 1TUGB 2HAFA 2RRBA 4YEAA 2UU9F 2O5DA 3OVBA 2KTQA 2QSFA 4K43A 1GLBG 2DFHA 1Y0HA 4M3WA 1JB0C 2Q6CA 4DR2J 4QOZB 2GVZB 4A4JA 1HBOA 1M5KC 1K0VA 2VKRA 3D6FB 2GV1A 3NY0A 2I9SA 1YBAA 1LWCB 4GVLA 2F9DA 3P83D 3A1YG 3I0RB 3GL1A 3SBMA 3DLBA 2RDIA 2JSXA 3CJ4A 1YRXA 4KHNA 5HMYA 4AQYF 1N33F 2DNOA 1HBMB 4IR1A 1U6ZA 1QSSA 2OH2A 3A8YA 2CQGA 3LDSA 4DS5A 5E2QA 5KQ8A 3ZTQA 1GK8A 4I56A 3LAMA 3NGIA 3NGKA 3NF8A 4TU9A 1UZHA 3R6MA 5AQZA 1PCAA 3IGNA 2C3YA 3NF6A 1K44A 4FK0A 2P6SA 1C2PA 4F2RA 1WLJA 4B3MK 1REGX 3QBCA 1N34K 2MMYA 3RAQA 5TKYA 2P9UA 1NB2A 2V34A 2W7AA 3R5GA 3ONQA 5AQIA 4NA2A 4DFPA 3VTIA 1HNWF 1ZOTA 2BE7D 2HBKA 5AQQA 4NXNF 2OEKA 4IEEA 3K2YA 2I7PA 3KHLA 1JJ2M 3TI0A 4KO0B 1SQEA 1MWKA 3CCZA 5SUHA 3QYYA 4BLGA 2DR7A 4E3SA 3MMJA 2B6AB 2V4JA 1KLMA 4P7VA 3DXMB 1RTIB 3JQJA 4EYIB 1FK9A 2HRTA 4LC9B 4I4BA 2V5HG 2H5IB 4G6VB 4ZVRB 3S41A 2G8KA 2BJ7A 2PMWA 4DV5K 4OZ2A 1A0OB 4DU7A 4Q8EA 2CQPA 4QZVB 4QWCA 4KKOA 2HBYB 1S9EB 4E1MA 3ENAA 3AQOA 4TSXA 3UO0A 5AQXA 1A7GE 3UN3A 1UETA 3RBZA 2L9DA 3MXMA 1E3MA 2RS2A 2V7ZA 2OGUA 1IN0A 4CLKA 3KLIA 4OHXA 3C0BA 1TGOA 1VQ7N 2AEFA 2HOEA 4UY8T 3QO9A 4FK2A 2IMWP 3WQPA 5GADU 3M30B 1N5YA 5ETVA 3MM5B 3E3XA 4L3NA 5KFBA 4DR2F 3PACA 4DF4A 2LXFA 2UV8G 1ZBUA 3OT9A 5AQKA 4YDXA 4UT4A 1HNZK 5LMUK 4OKKA 1NU4A 3R7SB 5FPDA 1P1TA 4A2BA 3TJ8A 3GFXA 2ZBCA 4E0DA 2P9LA 4F3QA 2AX1A 3MECA 4AM7A 1KC8O 2NXCA 1I1GA 1RAJA 3CFRA 2NRWA 3OTOK 1HLWA 2OSQA 3J80Y 3CCVS 2G8VA 1RTJA 1PC4A 2RB7A 4QIGA 3VF6A 1DEJA 1HQEA 2P9SB 4EBEA 3E9PA 3KD5E 4L76A 1AUSL 3O6WA 4M5KA 5DDOC 4IOCQ 3DLGA 3KMSA 1N52B 3H2VE 4DV1K 2RVJA 4UUWA 2R2TA 1CG2A 1QVFR 1NU0A 5KFSA 5KFNA 2DXEA 2I2YA 1IBKK 4JYAJ 1MU2A 4BE0A 2MKKA 2EX3A 1RT3B 5GIOA 2DNGA 2HWTA 5LOQA 3UR0A 3JS6A 3KG4A 4P6QA 2RAQA 2AYBA 3OTEA 5A8RA 2P9GA 5F2RA 3KJVA 2W8LA 4ZVQB 3OBYA 3L7PA 1FNOA 1SC1B 5E3RA 5CD4A 4ZVEA 4AXIA 5KFHA 3QSYB 1RT1B 1I5OB 2RUSA 1HWKA 4RTFD 4ZMMA 1HKBA 3KLFB 3RB0A 4KHMA 3D7SB 4JEPA 4DQ8A 2HB5A 4ENOA 4XH1A 1KD1T 3RW7A 2C28A 1LAWA 1M1GA 3RG6A 4J9NA 3LP1B 5KT5A 1DFDA 4H4OB 2CGKA 3K9JA 3GZ7A 1KLNA 1R0AB 4TNOA 4KRFA 2UXCJ 4JKFA 5AJ3K 2VB6A 1EKEA 1I39A 1PO6A 1H0HB 1VI7A 2EWSA 4M5IA 4WYWA 1CS4B 4TYAA 5K5MA 3AGRA 4FJGA 3D2FB 5FPNA 3BBBA 4CCHA 2J0SD 2XS5A 4HI1A 3LANA 4BGBA 1T9TA 1HMVB 4KV8B 5JS2A 3R5DA 5ETRA 3KK2B 3UNYA 2D3UA 3GJTB 4P72A 2DISA 2UVVA 2B7BB 4MQ3A 2LQ5A 1XMOJ 1YITN 3IBWA 3MM9B 2MZ1A 2XBPA 1DQ8A 4LBIA 5E26A 4KREA 1NGGA 4B9LA 1T9UA 4EU0A 3MD1A 3JSMB 3CQYA 1YLXA 3Q86A 2P9KA 1I3OB 2LQ9A 4ECWA 3MEGB 4MK9A 1Q8KA 3MXHP 4C11B 1WWHA 4DSFA 1WSRA 4KTWA 4NOHA 4QBUA 3M8PB 3CIPA 1F5CA 4O44B 2VIHA 4I0WA 3IAM9 2KU7A 4JYAF 1OYEA 2WOMA 4OKEA 2IMOA 4YUDA 2KQ2A 4PWWA 4URGA 1YJNN 2VL1A 2OEJA 3SSSA 4EZ6A 1ITPA 4KE5A 3W0LA 4B1ZA 1EX4A 3FBFA 2QA4N 1CJVB 2L41A 4QCLA 4GNIA 1CPZA 2IJRA 4B8AB 3CWJA 3G0ZA 2BM1A 4YOWA 5C2GA 4DV6K 2HVDA 2CQDA 4Y00A 1KFSA 4TVAB 4RU2A 2AGOA 3L4IA 2YJFA 5DRKA 2CWXA 5KAKA 2AJ2A 4CE9A 1Q9XA 1XQIA 3WT0A 4B3RJ 2K1RA 2BJDA 1RAGB 1O1WA 2CA9A 3GJQB 3ZX0A 1QUVA 3LPUA 2R7TA 5HI7A 5M2PA 5KFGA 1XEZA 3VQDA 2KL8A 3IDHA 5J2QA 1XTZA 4QS8A 3OYJA 1TUYA 3ULEA 2ZZTA 3BDEA 1FNMA 3C2PA 4JI4K 1A9NB 4YDDB 4BC4A 2QZ8A 2DFEA 5LL6Z 4KPYA 1PSDA 4CLUA 3M5RA 2D0AA 4UOGA 2H48B 1VBYA 2UXCF 4QWDA 3HVRA 1M1KO 3RB6A 4IDKA 5CHCB 2FJEB 1BY9A 2MTLA 3ZZ0A 4GV3A 3CF5Q 3OS1A 2W4DA 4AHUA 4HHUA 2OI2A 4LFAJ 1Y97A 2CKWA 4R8UB 5IT9Y 2RD5C 2BACA 5HP1A 3H08A 5K14B 1XHZA 4OV1A 5E3QA 1KP6A 3PIOQ 3RBEA 2B9EA 4QWAA 1ZS6A 3L2QA 1MROB 2LVWA 1NJWA 1KVCA 4LF4K 2HQDA 1XMOF 3P3DA 3CW2C 3QJPA 4QWEA 5C42A 2OPSB 3M2UB 4DV0K 4O23A 1RBRA 3H2LA 2YCHA 5F0UA 3F0NA 5KFMA 1T95A 3GJRB 4PPZA 2B5JB 3KOAA 2KVIA 3DN9A 4ICLA 4W5QA 2CQ2A 5DLGA 5ETLA 3QB0A 1HPMA 1TL7B 4IJNA 4JD2B 4OHZA 1TKTB 3CIZA 2F40A 3G82A 4CTAA 3GYGA 5H9EJ 3UCGA 4Y1CA 2NXJA 3OHBA 1WUAA 4WFBL 1NCLA 3I55N 5M1OA 3THYA 3ZTPA 4DB3A 1LWEB 1X60A 2OCEA 4HT5A 2G0CA 1FKAF 2P8IA 1VHIA 4C8YA 2QWPA 2FBTA 3FCVA 2G0IA 1BWEA 4OYWA 5IV4A 3IWXA 3HXMA 4A8QA 2ZWPA 4J90A 5IWAJ 3KLHB 4ED7A 4EHUA 1R8PA 5HRNA 3RRHA 1LXNA 1VK3A 1FERA 3GDQA 5KT3A 1RT7A 3C16A 1V5IB 3WDOA 1EZZB 3PTWA 3M05A 5A6WA 4B3RF 4JOUA 2EG2A 3CJ8A 4FZXC 3LGHA 2E5JA 4JI0J 4RW4A 4J9RA 4DSLA 3NCIA 4KQZA 1AZSB 1ATNA 3NOCA 3V6DB 4P71A 1ZBIA 4WXWA 3T69A 4ZHRB 5M1NA 4JI6J 3SSRA 5H9FK 1VQ8S 2RQMA 3PSIA 3C65A 2DB1A 2XO7A 4D3GA 3EZOA 3NL0A 4ED5A 1BE4A 1X4EA 3WIVA 5B0EA 1IR0A 4L73A 2C3PA 1SUQB 2YX7A 1JJHA 2ZOMA 4JK7A 3E8OA 3D2EA 1RA7A 2VU5A 3G8TA 2QRRA 4LFAF 1JLEA 1IBCB 1E6VA 3P6YC 4ZVTB 4ZCLA 5CZ1A 4CP5A 4U7BA 3KLEB 3PSFA 3D0HE 2VG7A 2NRVA 2HBQB 2J8AA 1WOQA 4DV4J 1OH5A 3U27A 3CPWM 2DRAA 3VALA 4Z4HA 4RW8B 2PA8D 3BGOP 4KSEB 2KXNB 4J91A 2F7TA 1RWNB 1U45A 3UD4P 1YITS 4CJVA 3TUZC 2K3KA 1OSCA 3D6HB 4X4TA 4F4KA 2VOPA 1C0UA 1YGYA 2HHQA 2X1FA 1EWQA 4U67L 1M1HA 4PHTX 2FVPA 1U6BA 2R42A 4Q45A 1QDUB 3MMVA 3THWA 4PXDA 4TYBA 2QN6B 4CGJA 2DHHA 2XS7A 1FF2A 4DX6A 4AL6A 1FHTA 3A5LC 4USKA 4MIBA 5A2QY 2JC1A 2NQPA 4QYZJ 3R1LA 2YHBA 4DCJB 4EP5A 2NUHA 5HQMA 1KQFB 1YJNS 3BF3A 4ZKAA 3ZEUA 5IWAF 5KFVA 3IC1A 3TNVA 2QA4S 3DU6A 4IR9A 1DGKN 3CO0P 3ITHA 3BH7B 3VCDA 3OUYA 4JI8J 4FJMA 1UW9A 1UMJA 2JJ4D 4JI0F 2HWHA 4ETXA 2V4QA 3T1HJ 3OYBA 4RL1A 4K4YA 1RNHA 1Q86T 2Q0UA 3RRKA 2Q97A 3SBTA 4JI6F 4K0KJ 3MMBB 2O4IA 3ZSYA 3I32A 3TVKA 1U1OA 3MPVA 2CJBA 3KHRA 4C2MA 1MMDA 4KAZA 5F8GA 3HCXA 5J2MB 3W65A 2NUBA 5B09A 3OFEA 1RDRA 1CJKB 2V52B 2D1CA 1I94J 3GONA 2WFBA 1C0GA 4ED2A 2NXUA 2QLJB 3D3BJ 5AQJA 2FVSA 1AROP 4KB0A 5FRMA 3THXA 2Q2RA 1WC6A 2VFSA 3NXZA 1HPZB 1VSFA 4DV4F 2GQQA 1UAXA 5IV3A 4I7FA 3QLHB 4FXDA 2FHKA 2HF3A 2E7XA 1N8RO 2NCKL 4ZVPB 2N4CA 3BQ1A 1ZA2B 1C0MA 1X9MA 3A5MC 4LRCA 4B9UA 1U8SA 5F8NA 1NMEB 2ASPA 3RMDA 3NGYA 4HVZA 3H8YA 1Q82T 4FJ8A 2IVOA 3ZETA 1S1WA 3X1LB 3V9ZA 4GRSA 1LAVA 2DH7A 3GIIA 3RR7A 4BROA 5KOXA 5E0OA 4NCAA 1VGYA 4NYPA 1FKOA 3AVCA 1EQ0A 3I55S 4DR3J 2FVCA 4Y2CA 1VRTA 5JUMA 1YJUA 4XDDA 1XBWA 3K57A 2JEFA 3EE3A 1FVSA 3AH6A 2ASLA 1JJ2R 3V1OA 3A4TA 2FUG9 1RE1B 1LWFA 2YKNA 3PRDA 3ISNC 5T14A 1U1PA 1X4FA 2AYGA 1EO1A 1IKWB 1M5SA 4RWTA 4JI8F 3QPIA 5HVGA 1RKJA 4JLHA 5F8LA 4CLFA 3AB4B 2YY3A 4MAKA 2ZH8A 3BKTA 3T1HF 3EO3A 4MYTA 1JWWA 3PG9A 1NM1A 4ILLA 3V6HA 2YWFA 3OYFA 3C8YA 1NG9A 3BGFA 1YVFA 4K0KF 3HJFA 3N79A 4N47A 5CR4A 1BWFO 1JLCA 3MK6A 2MYFA 2Z1HA 4O3NA 1NXIA 2EPIA 1JLQA 2XNQA 4YN3B 3DHWC 4HT7A 1EQMA 4Y3CA 5CYMA 4MTPA 3ENWA 1L3TA 3DM2B 2SXLA 4JI2K 3KJNB 4F7VA 2R8KA 1M5HA 3UKUB 2BW2A 4GV6A 2NLWA 2AZ3A 1I94F 2DNNA 3RMCA 4FPIA 1DZ5A 1T44A 1K73T 1FXXA 4IG3B 2I0XA 2O8CA 3KJQB 3QNNA 3TX0A 1W9HA 3HFZB 3DOLB 3ZLJA 1VBZA 3TTDA 5JICA 3VEWA 3SCJE 2M4MA 4M5GA 3KNGA 3HOSA 3ID6A 3O3LA 3EZUA 3TX8A 3RUBL 1GMVA 3ENBA 3AA4A 3SXLA 4ZLPA 1IM4A 1KVJA 3ILOA 2JLEA 1IR1A 2R7XA 2OTJN 2A6AA 1VQ9S 1H2UX 4ZP8A 1FRJA 1YBUA 1F3VA 3PIPQ 1RDCA 1U0HB 1C1BA 1P9YA 1Y5LB 3H0PA 1NGFA 2V7YA 4C1NK 3VTHA 2ATCB 4TY8A 3UN5A 2Y1IA 3F73A 4KY3A 4LRFA 1KVAA 4DR3F 4CJTA 5GIPA 3IS9A 5F8HA 4CEFA 3NLCA 4P74A 1GOCA 3PUFA 1QVGM 1UJ5A 3IBCB 2UUBK 3VAFA 4FN5A 4DG1A 3OR1A 1LV5A 5CZ2A 2Q3SA 5B7WA 5GADI 3B4DA 1SJ1A 5C12A 2YKMB 4M3YA 4K2JA 3SSQA 5EUHA 5H1SQ 3OY9A 4FW2A 3ZT3A 2M52A 4JK8A 1HD0A 1VQ5N 3IAS9 4DR1J 1F60B 2H54B 3PV8A 4C8OA 1N32J 3HOTA 3TTFA 2N82B 3KG0A 4LRBA 5KGWA 2YQ0A 1ESVA 4PAAA 2VCPA 4ITSA 3G87A 3OA9A 3FCWA 2GV9A 2CZ4A 3CJTA 4AD6A 3MUMP 1IBMJ 1C0TB 2VG5A 4QQBA 3T9NA 1XMQJ 2HFUA 2BX6A 5EY4A 4YOTA 1L5UA 1HNIB 3CTRA 2K3IA 2KXFA 3SUPA 1S6QB 2YHYA 2I1RA 4P9SA 2KM8C 4DMZA 2RKIA 4ECSA 4F4ZA 4K4TA 4LFBK 1NGEA 3P8BB 4ZLJA 5JVHL 2KH9A 5EX3A 3FFKB 1T9YA 4BACA 3FCHA 4QR0A 4QS7A 2HHTA 4KYZA 2Y8WA 1Y4ZB 3OFFA 3SFUA 4GVEA 2KYZA 1T3VA 3QDKA 4IFYB 3HSDA 1XC9A 3DOMA 2J9CA 1VFJA 4CK3A 1U7LA 4Y1DA 4BQLA 3CJRA 4Y0WA 2MQOA 4TXSA 1HARA 1OMSA 2OMLA 4FF4A 3JYTB 3V4IA 4KR0B 4AILC 1ACMB 3FK4A 1KQKA 4B1VA 2LP4A 2RF2B 2BV3A 3CJ9A 5IT0A 3EPGA 3TAMB 5T7BA 4YQWA 4DV7K 2DHSA 3W5YA 3SEOA 3L2VA 1UWBB 2DPNA 3AJ1A 3PHTA 2W6KA 4ED6A 3QNWB 4HACA 1T6CA 1S9GA 3G25A 4UF4A 2P2CB 2ALYB 4Q7AA 2WTUA 2EI5A 1FRKA 4F3MA 2HRUA 2I5JB 3AVIA 3FFIA 1TR0A 3LF0A 3CMAS 3MCNA 3DLKB 1CJUA 4CBWA 1WF0A 4DLEA 4F67A 3BR8A 1FT8A 3AO2A 5D0EA 1S59A 2E5LK 3VA0A 3IMQJ 4NLPA 5G0RB 3DRRB 1S1TA 3UI3A 2EXUA 4RKUC 1Q53A 5EX5A 4BREA 3HVTB 4X65K 2D41A 3OL8A 4HR2A 1S1VA 1YSJA 1G15A 3PW7A 4F3TA 4DR1F 1ZM4A 1J5OA 1N32F 1F5AA 4HCCA 4W5NA 3PW4A 4I64A 1LW0B 4XAKA 3FZKA 2XG8A 4IXCA 1LKZA 2FY8A 4QIEA 3LA0A 2IDLA 3FNNA 3GSIA 3PY8A 1EWRA 1KQSR 3CD5A 1XMQF 3P4IA 4MO4A 1WEXA 1LWCA 3UDVA 3LALA 1Z05A 3FZLA 5M1KA 1W2IA 3SQ2A 2MQMA 3CDBA 1H2TZ 3J7ZO 4DDFA 5I3PA 1GAOA 1J5EK 1HBMA 2VHGA 3UCUP 3J7YP 3S9HA 2MLXA 2M0GB 3EGWB 3D0GE 1MWQA 5DG8A 2QYGA 2E44A 2VUGA 4ETZA 1F21A 2CQBA 1HNVA 4DUZK 4CHQA 3DU5A 5J1NA 5LT5A 1P6TA 5KG2A 2M70A 2HFSA 4AT1B 1RT6A 4UZCA 4F3OA 3FC9A 1XR7A 3I4PA 2M8DB 4ZCIA 2P6TA 3T6JA 3GV7B 3I96A 4CLYA 1SI9A 2BW7A 4C8MA 1SH3A 1UP1A 3GCXP 2GELA 3CJBA 3G86A 3JTNA 1M5OC 3MAHA 3WQTA 2DPIA 2QT7A 5DS7A 5ETMA 3OYAA 3RBXA 1NK5A 1H38A 3O9QA 3ILJA 2BE2A 1Q81O 3VAMA 1IBLK 3FZHA 2B6AA 2FC0A 4F8RA 4FLYA 4FNIA 2JEGA 1FDDA 4N77A 4XPCA 3HHEA 3MCPA 5F9NA 3VAKA 2LMIA 2HBLA 4JNEA 5J2PB 4N5SA 1T94A 5AXKA 4FWMA 3K5MA 4KGMA 1XNQK 1BUXA 5CZXA 1WSJA 1WSGA 2YNGA 4PKGA 3P31A 2J4RA 3PM9A 1ILYA 1S48A 2RRAA 1WG1A 2XZDB 1R8HA 3FE1A 1WAFA 4V1Ak 1RWXB 2DKOB 3CDAA 4DN0A 2WVBA 1QSLA 3CJ5A 1X0PA 1VQ5S 1GH8A 5A0YA 3ZZTA 4MIAA 2NSCA 4Q5VA 2W24A 3MWBA 4F25A 4ZVGA 3QMLA 2UVRA 4DU4A 4L6V3 1TFYA 1HIYA 4ZTJA 5FDLB 4H4KA 4GC6A 2DEJA 1IKYA 7FDRA 2ROPA 1U2FA 2BRKA 3UB5A 2HNDA 1T03B 1RGIA 1WC3A 1XNRJ 5LJWA 3TSUA 5GMEA 4K25A 3SV3A 1BLUA 5F0WA 3FZFA 2IYGA 2BR0A 3KK1B 2HMIB 5D78A 1VQYA 2ZDPA 3ETOA 1ASVA 3SMPA 2UUAK 4CHOA 4OLAA 1HWLA 3B6PA 4YP3A 3PYDA 3J7Z5 3VGKA 4ED1A 1TKXB 2CJKA 1VSHA 1VSLA 5DM6L 2MQNA 4DR5J 2G0JA 3JB9k 3QIOA 2W01A 2V94A 2RN2A 4B3SK 1VRUB 2V51B 1S4EA 2HSEB 3HFKA 1XUPO 1R89A 2Z1JA 2F8SA 1S4FA 2ZD1A 2A2CA 4ZCMA 3RR8A 4NLGA 1B7YB 4K5RA 2QI2A 3CC4S 3LOUA 3FKBA 2FBVA 2EFOA 1VS3A 5AQTA 3V9WA 5BRFA 3UW1A 4EK2A 3TZWA 4RJVA 3VHQA 5CE3A 3I0SB 3D9BA 3DXKB 4OYMA 3ATUA 2W42A 4EUVA 3OYCA 1HRHA 1Z2ZA 4CFDA 1NHUA 4M3UA 3VF4A 1S0MA 1RKIA 1TELA 2RQKA 2FGOA 4X66J 3S3MA 2PD1A 2D74B 3ZZOA 1NBEB 1H72C 1LK7A 3V2UC 4J5OA 1N0VC 2DK2A 2E1YA 1DTTA 5AT1B 1J2VA 1UOCA 3U8XA 3W8GA 4ANDA 4AXJA 4H4OA 2DXDA 5C2DA 2P9PB 3UIQA 2KT5A 4LR9A 3MEEA 4LRDA 1U04A 4KH5A 1RYSA 2VDHA 4WFNQ 1SKWA 4M7YA 2GMHA 1IO2A 1B0PA 2QL7B 5C25B 2KZMA 2C2OB 3R9PA 2FY1A 2QM1A 4GKKK 4YOYA 3OYDA 3CJQA 1J53A 1Q9YA 1KAYA 1XNRF 4AH9A 4A2AA 4Q0BB 2YKOA 3C14B 3Q0AA 1T8EA 4IG0A 4DV3J 4KV8A 3QFUA 4PWDB 1URRA 2C2ZB 4QS9A 3NWGA 2ZNZA 3ADAC 5T7LB 3DLHA 2W4PA 1HKGA 2G8FA 3KK2A 1OIAA 1X7VA 4JI7J 2AGQA 4WFXA 4LIWA 3K5NA 1FRXA 2DIVA 3MCOA 4B1UB 5AE1A 3EL2A 1RT4A 2DJWA 3FZMA 4F4XA 4RX6A 3SZ2A 3BO4A 1JCFA 2AKWB 5HK4A 3ALYA 3LPTA 5KFTA 4DR5F 3EKSA 4FXVA 4ZPWR 1WSEA 3MPYA 4ZVUB 3EE9A 2PO4A 3HPHA 2DD8S 2DNKA 4I67A 4ZS6A 3ATVA 1RTHA 3BP8A 1Z1ZA 2UVWA 3QWPA 3K5OA 2BJ8A 4WBFA 4LF8J 1TL3B 1X3NA 2ZH7A 1S79A 4FLXA 1PYOB 4KIAA 3Q7CA 4IO1A 3IG1B 2W25A 4ECRA 1DLOB 2VQFK 3LDQA 2PN6A 3J81U 2CQ3A 3H20A 1WHWA 1G4CA 2RU9A 1XWLA 4A8XA 1GLJO 4A8OA 4E89A 1MLAA 4AHCA 1SV5B 4TKTA 2Z56B 1HR0K 2HNZA 4X66F 2LFVA 1HQUB 1T9VA 3CJKB 3J7YU 1UFLA 3A3OB 1GOAA 1V5VA 3ZZUA 3E01B 3M3ZA 4K4ZA 4IFVA 1F0XA 3BPDA 2K06A 4OIXA 2JH3A 1U1LA 4CF8A 4WU3A 2GJFA 3NNHA 3MDQA 7AT1B 4XDCA 3G71N 2FJXA 4ECUA 2CPEA 3HPOA 3BGRB 4X84A 4JKCA 3GWCA 3OL9A 3MUVP 2AYMA 4AE5A 3M32B 3CD7A 2E2PA 2IRYA 2XMKA 1NJIT 2C2NA 2FLNA 1UWAA 3KUHA 2QO3A 1NJZA 4XH5A 1KS2A 2IOCA 2BXJA 3PJWA 3C46A 1VYAA 2ZWHA 4GKJJ 2MKHA 3VZIA 5A8WB 2O3DA 3V9XA 3L95X 4IWVA 5HRPA 4JI7F 1HI1A 1MW7A 2W2NP 3N01A 4MFBA 3RSEA 2WVDA 1HJOA 5AE3A 3DGPA 4DTJA 3QIPA 3SFGA 1P90A 1IWAA 1YRUA 2W9CA 2IVFB 5C24B 3FLCO 3B78A 3A13A 1K8AO 1RAHB 2ZZMA 2ILYA 2B5JA 1VSKA 4FPAA 2Z2YB 1YKWA 3VETA 3VESA 2BH1A 5HROB 2Q36A 3WNFA 5C10A 2IIHA 2OPQB 5DZ7A 3MM8A 4CZHA 3A8KA 3MMAB 2VOOA 2G1DA 4U95A 3JSYA 4NE9C 2HBJA 2F8HA 3R5AA 4HUFA 4J9KA 2L9NA 3RYLA 4A8YA 1J6ZA 4OHVA 3W9HA 1K8KA 4LF8F 1NM2A 1SKRA 1KRPA 1HW8A 5I3QA 3W7BA 4RG8A 3MR6A 4BRIA 1BA0A 5EGYA 1T9XA 4FXWA 2PEHA 3ENOA 2BOAA 5J1EA 1UEKA 1Q18A 2LDIA 1HNXF 3IN5A 3HDSA 1H73A 3S3OA 4LFCK 2R8JA 1UJ6A 4QU7A 4DR6K 1BCOA 5AFUH 3EM1A 2MQLA 2ACYA 3AVBA 4LF7J 5K8NA 3O3HA 3H46O 1NK4A 1VJQA 1EXQA 2WSFC 3K7RA 1D3WA 4FNHA 4QIFA 1HYSA 1RWWB 2LQ8A 1QVGR 3D1OA 1LNQA 1TVRA 2PEBA 2V9WA 4Q44A 1YT3A 4EP4A 4RCHA 1W97L 4OZ3A 2ZH6A 3WX8A 1RT2A 1PJ7A 2HBRB 4KHWA 2CH5A 3VAJA 2U1AA 2ZJQL 1FJGK 1TP7A 4X4NA 3ZSXA 3CCWA 3MHYA 5LY3A 1WHXA 2MY8A 4Z0UA 1UFKA 2DYAA 3GV5B 3ZNUA 2MXYA 2KRRA 2DPJA 3OW2M 4HDHA 2Q79A 3UKRB 1IQZA 4FF1A 1MN7A 1VMBA 2ZUGA 3HHLB 4PRFA 3T41A 5C15A 3KLEA 3TUIC 4YS2A 4P2FA 4TLQA 4GKJF 4KI4A 1JK9B 4ANEA 2XQCA 4MYUA 1C1CA 2CG4A 4BCAA 2B9WA 2PMZD 3FSXA 4DTNA 4DFMA 1LOUA 5D15A 4WIQA 3FBCA 3H59A 2H5JB 3R5JB 3TJAA 1FFSB 4KB1A 3UWTA 2ZGZA 2R3VA 1YJ9N 3PO4A 5M1PA 1IKXB 3J7A1 1Q5VA 2LEAA 3UCZP 5HO4A 2CQIA 1FWKA 1QZ5A 4WK1A 4NCGB 1JJ4A 2PIIA 4A47A 4NLVA 4YORA 3ULHA 1O6XA 5KFQA 4GY2B 2GIFA 2OA8A 4QU6A 5KFAA 1B3TA 4H5NA 4HHJA 5KFRA 4RNNA 1D09B 3QEPA 3HP6A 2YPYA 3M2VA 4B02A 3KD1E 3QSIA 1KOHA 4OZ1A 2WK4A 2BUNA 1YZ6A 3VGLA 3T1YK 1R7IA 4PL8A 4KJIA 3T1AA 4LF7F 2CWKA 2M7SA 4ZIWA 3W64A 3X3UA 4A8KA 2IC3B 2UUCK 1SQFA 2O8FA 2GGPA 3TWHA 4P73A 2J7WA 4NASA 1Q95G 4NLCA 4OMFG 3DI6B 3OVAA 2ZJPL 1VSEA 3OV7A 2GA7A 2NRTA 3MMBA 5ADXA 4E7JA 2YBVA 2HVEA 2V67A 2B4PA 2F4FA 4FWKA 2J0QD 4CJWA 2E8AA 4ZCKA 1SC6A 2GWJA 4CVNE 3TWZA 2HSTA 1RHJB 2NPFA 4FWQA 1HQ2A 3G71S 3HF5A 1CJKA 3BSCA 1FW6A 2P9CA 4RWWA 1J9AA 5E33A 1SJ4P 3J81O 3ZSRA 4ZPBA 3CGIA 3R9LA 1WC1A 2Z2LA 4JV1A 3KWGA 3NF7A 3L6QA 1NGJA 2W2OP 1JNRB 3CFPA 2ZJRL 5DM7Q 1LW2A 1RFQA 2FZGB 5AQGA 2VA2A 2FZKB 2O8BB 2YNIA 1FTCA 3U4LA 1RWOB 1UJ4A 2BJ3A 2QG9B 1OPZA 3NOGA 2Y1JA 4X64K 3CPEA 2Q6BA 4CW7B 2GHWA 1OJ4A 3J7AN 2AHOB 2WB4A 3Q24A 1IUJA 1RBOB 1PC5A 1SC4B 3PJ9A 5L9NA 5JLHA 2OPRA 2DHGA 3G9CA 3V9SA 4LBHA 3KTQA 3PX6A 5B08A 1NSKL 3L3VA 5ETQA 4CJSA 2VBZA 2XZTB 3HLUA 1O0PA 1G7CB 3DDNA 3TRGA 1X4BA 2BUPA 4JV0A 3M8YA 4B3MJ 4FJLA 3MXJA 3CQ8A 1N34J 1PG5B 2M2BA 2YXLA 3R8YA 4FWSA 2FLOA 2ETJA 2AJQA 3VERA 1AW0A 4EZ9A 2PYLA 5ETKA 1F2HA 3FR0A 1Y5IB 1BUPA 3SLCA 1D8YA 4CI0B 5DDQC 2BVZA 3HT0A 1ZH5A 1TL1A 1NPRA 1DURA 3AT1B 2R8IA 1AUDA 3VGTA 1NMNA 5I42B 2ZOGA 3K9KA 1YVNA 3VENA 4ZA1A 3C7NB 3AV9A 2V8PA 5BR9A 2CXEA 2NLXA 1JLFB 3W9JA 5KT7A 3MMCA 4DV5J 4WU2A 3KJFB 1D8ZA 1U4BA 2RS8A 4LF6K 4V19S 2HFZA 9ATCB 2HHSA 2YJEA 1NJXA 1WNEA 2MKCA 2QXLA 3A5OC 1NGIA 2PE8A 5CHIA 2MZQA 5GMDA 3CMEN 3CXCM 3RMAA 2Q0RA 3VQBA 1RHMB 5BN9A 2ZH1A 2MSSA 2AU0A 1B64A 2DFFA 2X74A 1VC0A 1KC8T 1SS6A 4GVBB 2IHR1 4U9RA 5AR0A 4OGCA 4FVCA 1ZBFA 5BR8K 1HNZJ 5LMUJ 1FJ7A 2GW8A 2DR5A 2GIQA 3PHEA 2P9NB 2JRSA 2AW0A 2PC6A 1R59O 2KDOA 5E3PA 1U47A 4NZ0A 1YQHA 1RB0A 4CYUB 1SPBP 1NGCA 3OTOJ 1WC0A 2GCFA 4KGVB 1I3AA 5GAEP 3UD3P 2KHOA 2A1BA 2GWKA 2O8EB 5F8IA 3I8BA 2CJYB 2XGQA 3DLEB 1H1VA 1CEZA 4BRDA 3MPDA 4ANCA 4FJIA 3TAFA 4XIUA 3UQSA 3CYMA 4B3MF 1N34F 5DQGA 1SIZA 4O8UA 2FVQA 3ZXWA 4DV1J 4M8LA 5AQOA 4PZVA 1TUUA 4CLLA 1SQKA 4PQUB 5DLFA 1IBKJ 3DMJB 2YTCA 5HAOA 3VEOA 1CJTB 4ATNA 2V6AA 3OR2B 2GVDB 1P1LA 3Q22A 1WBBA 2E1MC 2A5XA 5K8OA 2G8HA 3ISND 3HL8A 1RWPB 4CJ4A 5L9XA 2P9IB 1KQGB 3KK3B 1NPPA 2F1FA 5D77A 2QMUB 2PBDA 2QYCA 3WC0A 3F9KA 2VQEK 3SQOP 4URQU 5L46A 2BEFA 4DTXA 2MSTA 4ECVA 4DV5F 4BQZA 1HBNB 3AVAA 4USUA 1CULB 2YH0A 4KH4A 1U1QA 3DOKA 5KG4A 2YNFA 3AHPA 4RNHA 1S97A 3O8WA 2B4JA 2ILZA 2HNYB 5AZIA 1X9JA 1N5TA 3TANA 2KVQE 4FCYA 4MLHA 1JX4A 4LJMA 2DY9A 4EFAC 1VHFA 4WJBA 2WUSA 4NMXA 3MR2A 1RU2A 1SH0A 3EGNA 4LBPA 2DTJA 4Y65A 4WF9Q 4RNOA 2O1PA 1GMWA 4KTQA 4P7TA 3O1WA 4B3OB 1GXTA 4DCOB 4ID1A 1PAUB 5AJ3J 1N56A 4H5TA 3RMBA 1Y11A 1U02A 2FSJA 1W2BM 3ZFVA 4LR8A 1RAOA 1HNZF 5LMUF 4IFYA 3GPAA 2XHBA 3C6TB 3DLLL 4GV9A 3SDEB 4X4UA 4WP9A 5LXYA 2VPXB 3CCRN 1RUSA 2E2OA 2QLBB 3W60A 5GAGP 4TY9A 1QSYA 3N4WA 4CGIA 3CCUN 3CCSN 4DEZA 3OTOF 1RACB 2ZH3A 1YK9A 3NDKA 3TAMA 3QAUA 4PWUA 2BE9B 2O8DA 2KJVA 1CVJA 5KT4A 1YBTA 1MNEA 1WC5A 4K7QA 4OFZA 2DGUA 4G3IA 1B70B 1R8BA 5DGAA 1NGBA 2IM1A 2XLKA 1JXVA 3V81B 4DV1F 3T9ZA 2ZEJA 1R27B 1S6PA 3DHXA 3TZXA 3WNHA 3MM6B 3RWUA 1Q4RA 3QINA 4H4MA 3W2VB 2FDNA 3CCMS 4FL9A 3DRRA 3HT3A 2AGPA 2HQCA 4CJQA 2C3OA 1TKZA 2PYJA 2JZ5A 4FS1A 1PKUA 4O4GB 2DNQA 4X62K 2Y0BB 4N7TA 4AFFA 2XYPB 2CQ1A 4DV6J 4AL7A 3L3CA 4GVMA 3QRRA 2D9PA 3LUYA 3C6UB 3MR3A 1E4FT 1WOSA 2XI3A 2MKIA 1NWKA 1KNZA 2KLAA 5IQ6A 1L3VA 4FWLA 3CD6N 4Q2MA 2EC0A 3HBTA 3JTOA 5DM6Q 1BMQB 2BBEA 3BH6B 3W5XA 3EZ5A 1HWUA 2V9KA 1M1KT 4PG4A 1L3SA 2ITGA 1Q7YO 3HFVA 4CHNA 1EJ7L 4QR2A 5F8JA 3EPIA 4JI4J 3IM9A 4CH0S 6FD1A 4Y2KA 3ET6A 4Z4IA 3NNCA 3CMES 1DKGD 2V4RA 2FTRA 4DPTA 4YDUA 3THPA 4NI2A 3LO3A 5AJ3F 4L75A 4NLXA 4ZTFA 1GX5A 2G8IA 2R2UA 1VQ6N 2X78A 4O5BA 2JVRA 2MQ8A 5IM0A 5DG9A 2HURA 2PFFB 2PI5A 3BEXA 4I2QB 2W9BB 2BANA 2HEKA 5CA5A 1YJ7A 2B51A 1U1RA 3O2IA 1S10A 4FJXA 2MLZA 3TW0A 4OJRA 1NH8A 1TK8A 1QQNA 1APSA 4FYVB 1NOZA 1V4SA 4LF4J 2JLGA 3FBEA 2FXUA 3KHYA 4DV0J 3CCTA 2VBYA 4XTTA 2OELA 3VAGA 1HBOB 4DX7A 1JLAB 4EI2A 2GQCA 3C94A 2HAIA 2HZAA 1KSPA 3U3YA 1V3SA 3NF9A 3NH2A 5KG6A 1S1UA 4JK9A 1IH7A 4U7UD 1QUPA 4DL0C 3GBTA 1KBRA 3J7YI 4BC7A 4CJKA 3SPZA 4J9OA 1YRTA 1X5OA 3BDPA 1NDCA 3ZSWA 4WCEL 2VG6A 3CJ7A 3B6OA 1EETA 4O8KA 8RUCA 2ZBIA 3M8SA 3KKRA 5HANA 3OBIA 5KT6A 6AT1B 1IQTA 3IO1A 2G8UA 1ZPWX 4DV6F 3CI5A 2P9UB 1GLCG 4F0MA 2RH3A 5U47A 1RHUB 2DGTA 4K8XA 4OPAA 3WHIA 1UFWA 3KXDA 4CZEA 5JVGL 2A6OA 4E8UA 5M2UA 5JLFA 3W2WA 2DHAA 3AO3A 5K8PA 3P49B 3H2UB 2XULA 3Q2TC 5ELZA 3OFGA 2A40A 5AQYA 1S5JA 3LWLA 3MX2A 5H9FJ 2ZGYA 5GAEU 4JI4F 3U9DA 5L1IA 4J2DA 1VQSA 8AT1B 4AHTA 3O4NA 2V4JB 1FXLA 1KLMB 3HRGA 1VQPN 2UZAA 2GIRA 3D28A 3VVUA 3NS5A 4MO5A 4WE1A 4J9SA 1RHRB 1V9OA 3OW2R 3HZEA 4KKOB 3POTA 1U26A 5EXWA 4JP8A 4FWNA 2I38A 5BN8A 4PYDA 4WFAL 1F6TA 1DTQA 3LP3A 4F36A 2HS0A 3BZQA 3KLIB 1TKDA 3D3CJ 3O4WA 3JXUA 1Y7PA 1OPIA 4J9MA 1YJRA 2MJUA 5FD1A 2KFZA 1VRUA 3EDRB 3QICA 3THVA 3QO9B 4FJHA 2DHXA 2F7VA 3CCRS 4J2AA 4NEZA 4LF4F 1N5YB 2WVCA 3A8JA 3CDEA 4H8KA 3CDWA 3CCUS 3CCSS 4DV0F 1VR6A 1WN7A 1VC5A 1SKUB 2MZJA 2CRLA 4NLSA 3HMJG 1SCJB 3I4HX 4HH0A 4MT1A 1TMMA 3ASMA 4M5MA 1X9SA 5HL7L 3F9MA 3N6NA 2ZKTA 4OI6A 1BO5O 4MLEA 2A3ZA 1TFWA 2R7UA 3DXKA 3M8QA 2P9LB 1VLYA 4EFHA 3MECB 1UW4A 2YKAA 4LR7A 2ACMA 1RTJB 4CZLA 4RW6A 4C1NI 3QJLA 1WF1A 3NEKA 1HQEB 4WIIA 3I9V9 1B7FA 1ZETA 1X4GA 3WNEA 3U02A 2IBOA 2ZVIA 5KG7A 1WTBA 1DT9A 3QIDA 4DHYA 1VQNN 4NLWA 7FD1A 4M3ZA 2Y3YA 4JHDA 2KFNA 1GTEA 1RDUA 3O9SA 3RAMA 4DFKA 1VSDA 4CM2A 2B8QA 1MU2B 5BREA 1P8ZA 1QQCA 4CRJA 5GAGU 5HN0A 2F4VK 2CPHA 2D4WA 4N8NA 2OPPB 1HWJA 2FD2A 2QIFA 5A8RB 2XGPA 3KJVB 3VGSA 4CGFA 3GJSB 4JKHA 1YIJS 4JBCA 5BJRA 3OLAA 1MSWD 2E9TA 2CDRB 4BWMA 5BPMA 1RWKB 2EKNA 1JJCB 2YX1A 3CCJN 1IBMK 2L08A 1N8RT 1EKSA 5KT2A 2V2KA 3PZPA 3LP0B 2QEXN 3OHRA 5KFOA 5THWA 2WVFA 4JKBA 4C0HA 1RXOB 4W5TA 4BVOA 3F2KA 2GO8A 5M2RA 4PXBA 4IBNA 4DQIA 3E51A 1W7AA 3AVFA 3GFHA 3EVOA 3OYGA 4GO7X 2VFRA 1OKJA 1FFWB 2CQHA 4CO2A 3C95A 2YHAA 3K8WA 1FX4A 2ZF5O 3R1XA 4NA3A 2C2KB 2CNLB 3Q7BA 3RTVA 1N6QA 4MIWA 3VQTA 5E84A 1RK8A 4ECZA 2CJ9A 2XMWA 1EP4A 2KI2A 2XSJA 3J81Y 4WQ5A 1OH7A 3AVHA 1WHVA 4OLOA 3PNIA 3UE2A 5FRNA 4USVA 4BC2A 2N4DA 5KFJA 3P5BP 3LP2A 5AQUA 1YZ7A 4DQSA 3AOAA 3RW6A 4U8YA 4KH1B 3E9OA 4J9VA 1RCXB 1JCEA 4CECA 3QT7A 2XSFA 3O8MA 3NBPA 1FCAA 2IIRA 1NK8A 2UXBK 4NLYA 4BRPA 4DV2K 4NO7A 2G9OA 3BQ2A 3AVMA 2JVOA 2DR9A 4OL8A 1U2VA 2WVEA 3G6ES 2ZH5A 1O51A 1Z2LA 4K8ZA 1C4CA 3HK2A 5KPTA 1WD6A 2NR0A 5KFYA 1BDGA 2OEMA 4CHPA 2LQJA 1D4XA 4DR4K 4BR0A 2HVZA 4ZVSB 2C3MA 5EN1A 2OMOA 4JI2J 3M2RA 5DGBA 3CXCR 4PG6A 3Q8PB 1UA1A 4ZJLA 2RIJA 4FYXB 1VQPS 2K1RB 1SJFA 3Q8RB 2WBRA 3KUGA 5ADXH 5KFFA 3HSZA 2CNNB 5J2QB 5I3UA 2CGJA 3ULEB 4LIRA 3VEYA 3N9UC 3DLRA 1XI1A 2QE5A 1ZTTA 3QATA 3RBDA 3WXMB 2RQ4A 1QE1A 4C4WA 3A2FA 3BJYA 2AF6A 2J8SA 2M5YA 1EIYB 4IDKB 2ZJPQ 1SVDA 2NYHA 2W9AA 3BGUA 1TV6A 4JV5K 3CERA 4KFBA 2VGMA 1XR5A 4LY7A 5KFLA 5HBMA 5LM7E 5HP1B 5T41A 2V2ZA 1I51B 2HGMA 2D0PA 2ASYA 3H4DA 1QZ6A 2DTUA 1S0NA 3HHNB 5I9EB 4CEEA 2ADCA 4H54A 3PYEA 3N4QA 3WXIA 2FJWA 4M3XA 1HD1A 5BXIA 1FI4A 3DCAA 2UUBJ 4YY3K 3O5BA 4ICLB 2ZDOA 2NXEA 3LDPA 3M6WA 1QTMA 4O0JA 2V8HA 1NLKL 2AZ1A 1AT1B 4YOUA 3G82B 3VQ7A 4CTAB 4FLZA 4HTJA 2HGNA 3NGDA 3AAQA 1ASWA 4LSNA 3MAAA 2Q31A 3THYB 5ETTA 2GO9A 2GX8A 3QZ7A 2UXDK 3EVMA 3IRXA 1A5VA 4OI0A 4RW7A 3QEXA 3OBWA 2QTDA 3RGIA 1UEVA 5HQ8A 5IT4A 3DYAA 2D0BA 2FF3B 1ASUA 3OS0A 3AVKA 4ZP6A 2JWLA 3LQVA 4Z4FA 3C6AA 1RT7B 3C16B 4JI2F 2AQ4A 1TZ0A 4R0EA 4RPFA 4XPEA 1FE4A 4HL9A 2VPYB 4WTYA 4DL3A 4LH4A 2B9XA 5IFMA 4LFBJ 4NRTA 4Z37A 2QFIA 5HLFA 2FQQB 1MG7A 5D0RA 3TEGA 4JV2A 4RW4B 5E3CA 1VQLN 3QBXA 1I6JA 3CCLN 3FJ2A 3M1VA 4X4VA 2V8GA 1LFPA 1W2BR 1RCOB 5ADZA 3HI0A 1MN9A 1NGHA 4OO1J 4BG9A 1WOOA 5EWEA 4RBTA 1RBTA 4WPAA 1WELA 3OXLA 4CIOA 2C2EA 1N5SA 1S6OA 3HD2A 3NH0A 1REVA 3CETA 4MKVA 1NGDA 1VQ7S 4DTMA 1K9MO 1WB9A 1O13A 3MUTP 4O55A 3D2EB 1YHQN 1QHAA 3TEHB 1F1BB 3D1QA 5GAHU 1JLEB 4FWRA 1E6VB 1U2CA 5KRSA 4DV7J 4A8SA 2VG7B 2XI2A 3GU0A 2E6LA 1VQMN 1QJHA 2AD9A 4JI5K 1KTVA 4BR5A 3GYNA 2MHEA 4P2MA 2IC3A 5BYQA 3O4QA 3RVCA 5CAAA 4FJ5A 3L09A 2NRXA 3PX0A 3NCPA 2E5IA 1U8WA 2C1EB 1R0BG 2UUBF 3CF5L 3BO2A 4M41A 1KVKA 2B4OA 3DNCA 1GLEG 5FJ4A 4F50A 4ZVFA 2P1JA 4RR5A 4X65J 4DL6A 4Y2AA 5BRHA 3ZNJ1 2VF3A 3THWB 3EEQA 3SUOA 4LSZB 3DRSA 3PIOL 3OYHA 1X4DA 4NZ7A 1YF5L 2EFGA 3KUEA 1Q1KA 3M8ZA 3BO3A 4RZRA 3QBWA 2L9WA 5IS2A 4OI4A 1F2GA 2ZM6K 3QRQA 2F65A 3J7ZT 3O9UA 1BL3A 4O3QA 3CJ0A 4DKWA 3ZEUB 2N3OA 2RDJA 2NSBA 2O8BA 2GC8A 3W5ZA 4USIA 1OYDA 3MR5A 4NLUA 5J1PA 2E5GA 5SWMA 2IJFA 3ITHB 2DNMA 4H4KC 2RILA 2ATLA 3OUYB 4QOTA 3G8QA 4DTRA 4FP9A 4LFBF 4M7XA 1BI4A 1NKCA 4ID5A 2APOA 5AQRA 4RUCA 2OUGA 4DUZJ 1X0FA 2DCLA 4DV3K 1CXQA 2XO6A 1WG5A 1F9FA 4Q2LA 3R5CA 1PJ6A 1VLOA 3AD9C 5AZJA 2R7OA 4KI6A 1T7PA 4DX8H 4BRNA 4CZFA 3GMGA 3IFEA 2YKPA 1X31C 4FK4A 1GLAG 3WIUA 3BN4A 1JLGA 3GIJA 1Q81T 4OHYA 1HUXA 3IR5B 1UEUA 3NAIA 3PEJA 2F9JA 2XHCA 1FJCA 3W3DA 1V6HA 1NK7A 4MJKA 3THXB 2DY1A 4DV7F 1HA1A 4B9VA 3MEDA 4CJEA 3O9TA 3UVJA 3AAPA 4I7FB 2DNRA 5HMWA 1YX2A 1IBLJ 2EFQA 2C2DA 3FEXB 2Q1LA 4CI6A 3V9UA 2B8PA 3WXJA 2YVSA 3JAMU 4K4VA 3HJVA 3QEIA 3OLBA 2F96A 2X1GA 2FJVA 1ZZNA 2EEYA 1XNQJ 1LEOA 1S72N 5D3GA 2E5LF 3ZETB 1S1WB 4CLZA 2I7NA 2HHHK 4X65F 4EHTA 2YNHA 3I5AA 3N28A 1JKHA 1R31A 4FZZA 3BSAA 1YTAA 2DIUA 1WUUA 1UVKA 1RBSA 1FKOB 3SQGA 1LXJA 4CESA