3KK2A

Hiv-1 reverse transcriptase-dna complex with datp bound in the nucleotide binding site
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
555
structure length
555
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 156
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk2A05
3OYFA 4H4OA 3FSIA 3P1GA 3HVRA 4M3ZA 2R2TA 3D45A 3CFPA 1G15A 1BQNB 4TQSA 1Q9YA 3HM9A 4QW9A 3OYMA 5DQGA 5J2QB 3CFOA 3GIJA 1IKXA 2C28A 1RT6B 2JGUA 4CJLA 2EC0A 4BE2A 1YTUA 1HNVA 4O4GB 5CYQA 4CESA 2IAJA 4DLGA 2VA2A 4FS2A 4Z4CA 2GIQA 5C24B 3A2FA 1J5OA 3AVBA 4H54A 2D0CA 4FJKA 3ZSWA 4CK3A 2YHBA 4WE1A 4LQ9A 4NLQA 2G8HA 4KB1A 1S10A 4ECXA 3HT3A 3O4NA 1JLAA 4DSFA 5KTQA 1RYRA 3RWUA 5CZ1A 3VA3A 3K5NA 1LW0A 1S1WB 2DFFA 4ELVA 4DL3A 2HNZA 4CJTA 4AHVA 1ZBUA 3KK3B 5I42B 3NE6A 4FK2A 3V9WA 2JEIA 2HNDB 1N6QA 3KIOA 4CIFA 5C25B 4CEQA 4FK0A 4AILC 1JXBA 3H4BA 4E7JA 3ISNC 5K14B 2OA8A 1I6JA 2FLLA 4DTNA 3UIQA 3KLEA 5DLFA 1ZTWA 1RT5A 4KHYA 2D0BA 1SL0A 4NLYA 2BE2A 3LPTA 5HROA 1JLQB 3DOKA 3QGGA 5J1EA 4XO0A 5KFJA 3L2VA 1JLCA 4QW8A 3B6PA 3NHGA 4RG8A 3ZT2A 4TY8B 2UUTA 4ZP8A 1EP4B 4DTMA 5C42B 4JV2A 3RB3A 3C6UA 3QETA 5KGXA 3DOLA 3SI8A 1K6YA 4CF0A 1WN7A 4R5PA 4PWDA 2FVPA 4ZP6A 4QWDA 1XHXA 5KFVA 4B9VA 4K8XA 1JLBA 3DI6B 4I9LA 5F9NA 3HPOA 4NCBA 5KFQA 4KTWA 5J2PB 3CIZA 1C2PA 3O3HA 4F4ZA 2C2EA 1QSYA 1FXXA 3PR4A 3KLFB 1HYSB 3OLAA 5F8IA 2RPIA 1EETA 1TKDA 2W9CB 4CGJA 3T19A 3NAHA 4ELTA 2HWIA 1S1UA 1KCFA 4FZYA 2P5OA 1JLGA 4M3WA 4Q0BB 4NLGA 1SV5A 1ZETA 4K4UA 2A1SA 4IFYA 5SZTA 3DRPB 4JRQA 3H4DA 3LPUA 3KD5E 3ZCMA 1QQCA 4MK8A 4KHQA 2EX3A 4FK4A 1W25A 3ITHB 3V6HA 3CJ5A 4Z4EA 3BSCA 2D7SA 5KFHA 1L3UA 1S9EB 1TL1B 3CDWA 3V81B 4NLWA 3ICLA 2D3ZA 4DG1B 3OL8A 2KQ2A 3ZT0A 2IS3A 3QIDA 4CFAA 4OLBA 1TAUA 4IR9A 4MKAA 5EWFA 3ZSOA 2OZSA 3PJWA 4KRFA 4F4YA 4GMJB 5J2MA 2E4LA 1SL1A 4DFJA 4TY9A 3V6DA 1RYSA 2J6SA 3MXMA 3DRRA 4TYAA 4OPJA 3AVJA 3MTKA 3PW4A 1LAWA 3I5BA 3LP1A 3RB0A 1UWBB 4DU3A 3AVHA 5L1JA 2UVRA 1T03A 3M8SA 2XY6A 3AA5X 4N5SA 1C1AA 2OPQA 1KLMB 2YNFA 4EBEA 4KSEB 3MEEB 4O3OA 2IC3A 4DQPA 1S6QA 3DLGB 3ZSZA 4DTOA 5KFDA 4OPKA 4KHNA 3L8BA 1RAJA 2QV6A 3TAQA 3SPZA 3U6FA 2R2SA 3FRZA 4BDZA 1LW2B 4EEYA 3IAYA 4QWEA 3GV7B 3L2RA 4TQRA 3JSMA 4O55A 5KG7A 4W5TA 4DL2A 4M3RA 3M9MB 1J9AA 4R0EA 5HRSA 2HNYB 3KHHA 1LV5A 4DU1A 3VQ6A 4ZHRA 3OYAA 5KFMA 4Q5VA 4RW9A 1VSEA 1IKVA 1BQMA 2BANB 1TVRA 4KKOB 3D28A 2CKWA 4IDKA 4JLHA 4CJVA 5KFKA 2YV0X 4NLXA 5C5JA 3E51A 2Z1HA 4DTRA 1RT7B 2YKMB 2W7OA 1ZBLA 2VG5B 4KV8B 1C0TB 4ECRA 5F8NA 4QAGA 4IBNA 4F8RA 4QPXA 3OYIA 1S9GA 1B9FA 4CEBA 5DQIA 4DSJA 3G6YA 4Y1CA 4FJXA 1HPZB 4KHRA 4ED0A 3VQ8A 1Z26A 4AHRA 3AV9A 4JS4A 4FLXA 1X9WA 3IRXA 5KT2A 1QUVA 3RRHA 4B3OA 3V1QA 4YP3A 4CEEA 1X9MA 3DMJB 4Z4IA 3NDKA 3ZSQA 3EYZA 2DY4A 3SZ2A 2IBKA 4CGGA 3Q8RB 4KTZA 4EZ6A 3H40A 3RB4A 3F9KA 4F4WA 4DSLA 1U09A 5KFNA 2OPPA 1ZBIA 1XC9A 1BIZA 3IS9A 4QOZB 4QWAA 4Z4HA 4G1QA 1NJZA 4KB0A 4FJGA 3NF9A 1RBUA 4W5RA 4KB7A 3Q8PB 3BSNA 4DU4A 2WOMA 4NRUA 4Z4GA 3SUQA 2WRMA 1O1WA 3QIOA 2OYQA 1WAFA 2HW3A 5KT7A 1IKWA 1S48A 1C1BB 3OYBA 2KZZA 3T5KA 4B8CA 2IDOA 5KFLA 3PO5A 4I9QA 1MU2B 3VQQA 3PZPA 1NK0A 1U48A 4RW6A 5KRSA 2ITGA 2G8FA 4KHMA 2W9AA 3ZSXA 4E7HA 3AA2A 4RU9A 2O5DA 1BGXT 1EXQA 4JV1A 4M41A 2ATQA 5F9LA 4CEAA 3K59A 1HQEA 4MK7A 3SUNA 2IMWP 2FJVA 3PW0A 3H5SA 3SNNA 3VQAA 5CYMA 1K1QA 1QE1B 1RT3B 3E01B 2GUIA 4N47A 3H5XA 3B6OA 2D0AA 3LP3A 4K50A 5KT4A 4YMEA 1NK4A 1HNIA 3ALYA 1RT2B 1EKEA 2BRKA 4R8UB 4IRDA 4HUEA 5HBMB 3NGZA 4HCBA 1REVB 5KRTA 3TR8A 4H4OB 3K58A 1VRUA 3BJYA 2V0NA 5HLFB 1RBSA 1WLJA 4CE9A 1NJXA 4DEZA 2KZMA 3PO4A 3SV3A 3TAMA 5F8HA 4FLVA 2WONB 4PQUB 3DM2A 3NF7A 4CFBA 2HHQA 3MEDB 5KFOA 2Z1JA 4O44B 4O0JA 4CJ4A 1QHTA 1DLOA 3M8PB 5DK5A 4FZZA 3MFIA 5EU7A 4CHZA 1IKYA 1GOAA 4O5BA 3IG1B 3QEXA 4KPYA 1DTQB 1TAQA 4HVJA 1B92A 3OY9A 3OYGA 3HO1A 3HVTB 1BI4A 1JXLA 4CIEA 4DMNA 4F50A 4BWMA 3U3GA 1U47A 1NK7A 3HL8A 2FVQA 1KLNA 4URSA 4MK9A 1T05A 1WSIA 4E7IA 2BRLA 3VQEA 5KFIA 2ASJA 1D9DA 2B6AB 1TKTA 1UOCA 1D1UA 3LP2A 3KMQA 2E9TA 4ZP9A 3K57A 1RT4A 3HXMA 4O3RA 3PY8A 4ZP7A 4I7FB 3KLGB 4YQWA 2FC0A 4BACA 4J2BA 4FJ7A 4PA1A 3NCIA 1NKBA 2FJWA 4J9LA 4Z0UA 1VSMA 1NK9A 1XR5A 2GIRA 1U49A 1LWCB 2HHUA 1S0NA 4LSNA 1KFDA 4CJFA 3H5YA 3SQ1A 5FROA 2JLEA 2KFNA 4J9PA 3GV8B 4TLRA 3UDLA 2UVVA 3RAQA 4XPEA 2E9ZA 3H08A 2J6UA 2FBTA 3DRSA 4CHYA 4B8AB 2YNIB 3MXIA 4J2AA 1NHUA 4K4VA 2P1JA 2AX1A 1C0UA 3EPIA 2GV9A 1TQLA 2E6MA 5FDLB 2ZE2A 1I39A 4ZVHA 4FJ9A 5L9XA 4B9SA 3SCXA 1JLBB 3V9UA 2RKIB 1RA7A 3Q8QB 3VQPA 1QSSA 2VG6B 4RUAA 4DTJA 4DQIA 4B9UA 4KHUA 1RTHB 3BQ0A 4E7LA 3SYZA 3L2QA 4CFDA 3JYTA 3LANA 4U6PA 1WNSA 4KHSA 2AWZA 2B4JA 4ICLB 3LZIA 2OH2A 4Y2CA 1TL3B 4YR3A 1FKOB 4IFYB 1DTTA 4FCYA 3BQ2A 3HHKA 4RNHA 2RN2A 3TABA 1FKPA 3FFIA 3U3YA 3O4QA 5FRNA 3C95A 4Q8EA 2XCAA 3TQ1A 4O3NA 5KFWA 4RNOA 3CJ2A 3L2UA 3DLKA 1X1PA 2IA6A 5F8LA 3ISND 4LSLB 2E6LA 2FJXA 1T94A 1XR7A 2WB4A 4X2BA 4CERA 3OYHA 4TYBA 1LWEA 3AA4A 4IG3A 4NCGB 4TN2A 2YKNB 1JKHB 2AQ4A 3M8QA 5I3UB 3BSOA 3QNNA 2HHSA 3AO4A 1WAJA 3TWHA 3AVAA 4IH5A 1J53A 2PYLA 3NBPB 3QO9A 5HP1B 5KFCA 3V9SA 2YNGB 4ZPCA 1TK5A 1VSKA 4KI4A 4OLAA 4ECQA 1HARA 4ECYA 3VQCA 4RW7B 1NK6A 1JIHA 1A5VA 4B9TA 3V6KA 1S6PB 3AVIA 1WSHA 4M95A 1BCOA 5KFGA 3TAGA 1HYVA 2IJFA 2R8GA 1OS5A 1S0MA 3ZSYA 3C6TB 1CLQA 2R8KA 1RILA 3NGYA 2B5JA 4MIAA 3OYLA 2XY5A 2G8IA 2WCXA 3I0RB 2HHTA 4F2SA 1S1VB 1CXQA 1RTDB 4ZPAA 4CF1A 2R8IA 4ELUA 2FLPA 3QYYA 4ED2A 4NYNA 3P5JA 2XI2A 3LZJA 4YFUA 2BQ3A 3KK1B 2GBZA 2OPSA 3O3GA 2JC1A 3Q8SB 2YNHB 1RTJA 4IFVB 3MEGA 2F8EX 3V4IB 3RRGA 1WNEA 1XR6A 3H59A 4W5QA 5D3GA 4Y3CA 4WXWA 2BR0A 3HP9A 3H98A 4MIBA 1KHWA 4FM2A 3SUOA 2GC8A 3PW2A 3RTVA 3NFAA 1BQNA 1D5AA 2ZD1B 3N6MA 3RBDA 4E1NA 4DL5A 4E7KA 4CHQA 3AVCA 5J2QA 2X78A 3KLIB 2OPRB 5KFUA 1JLFB 4I2QB 1RT6A 3H5UA 4O4GA 2B43A 3DLEB 5DG8A 4DWIA 3QLHB 2AU0A 1WSGA 1S1TB 5C24A 1F21A 3TAEA 4EO8A 1TP7A 2AGQA 2QE5A 5KI6A 3CM6A 1T7PA 2G8KA 3CJ0A 4EBCA 4B3OB 4CGFA 5KFAA 2W8KA 3K5OA 3D0PA 3PV8A 4FM1A 4E3SA 1JL2A 3KK2B 1GX5A 2F8TA 1HMVB 3RR8A 1ASUA 4J9QA 3S3MA 4FJMA 1S1WA 4CF9A 4KTQA 2JEFA 4Q44A 3PX4A 1JX4A 1JLEB 4MFBB 1HQUB 4B08A 3KK3A 1ITGA 5I42A 3H2LA 4O4RA 1NK5A 3BDPA 5KFBA 4ZMMA 4W5OA 4ZTJA 1K1SA 2HNDA 2XWYA 4M3UA 5C25A 2X6SA 2Q3SA 2DFEA 4YR0A 4DTXA 2IJNA 5T14A 5K14A 4ID5B 4J9KA 4FM0A 4FLTA 1X9SA 2QKKA 4YR2A 3BREA 5DG7A 5JS1A 4KHWA 1LWFB 4KAIA 1IKWB 3I0SB 5J2NB 4WYWA 1JLQA 2AGOA 2XGQA 2Z1GA 4CJ3A 2C2DA 2IM0A 3OL6A 1RBVA 3BGRB 3DYAB 3WNGA 4RNFA 4TY8A 1B9DA 1EP4A 1S1XB 3GIMA 1VRTB 5C42A 5E41A 4DTUA 2Z1IA 5DG9A 4DL7A 4CJSA 4FJLA 2RF2B 3SUPA 3G6VA 3RMBA 1RT1B 4KFBB 4HTUA 2C2RA 1TKXB 4PUOB 2KFZA 1SH3A 3DI6A 1WSFA 3F73A 1XHZA 5J2PA 4RW8B 2FVRA 1SUQB 1C1CB 1WSEA 3FQLA 4RW4B 5KT3A 3C94A 2X74A 2BDPA 1RTIB 3KLFA 1HYSA 5KFXA 2IM2A 1NKEA 3TANA 2R2RA 1XWLA 2W9CA 5FRMA 1S97A 2I1RA 1N56A 3MECB 4H4MB 2ASLA 3KJVB 1JL1A 5DGAA 3LP0B 4XPCA 3VA0A 3KHLA 4Q0BA 4DLEA 3MR3A 1TV6B 4WZQA 4O3QA 3ZT3A 2IOCA 4WFXA 5EWEA 4F4XA 1QS4A 2Y1IA 4O3PA 4DFPA 2WHOA 3OS2A 3ITHA 1UAXA 4Y2AA 3GILA 1UA1A 1S9EA 1TL1A 1RNHA 2E9RX 2I5JB 3V81A 3M9OB 3PW7A 4ECZA 5SWMA 4IG0B 4DG1A 2VA3A 4CK1A 5HRNA 4KO0B 3RBEA 2VG7B 4ED1A 3NF6A 2V4QA 4BDPA 3GIKA 4FZXC 1R0AA 3FQKA 3KKSA 5KFSA 2HMIB 4IH7A 4C8LA 3KOAA 4LD0A 4I2PB 4N41A 4BDYA 4FBTA 3KLHB 4EO6A 2CJQA 1SL2A 3OVNA 1KSPA 2FBXA 1EX4A 4EP4A 4WXOA 4DFKA 1RCHA 3D5MA 1UWBA 1FK9B 1IO2A 1NOZA 1KVAA 2QKBA 4DQRA 1KLMA 3OLBA 2BGGA 3HSTB 4Y1DA 2XY7A 3NAIA 2R2UA 3PHEA 4NYFA 3DLGA 1NJWA 2HHWA 3KHGA 4LQ3A 4DFMA 2F8SA 2PYJA 1BISA 3AO2A 4JS5A 3SI6A 4NCAA 1LW2A 3WNHA 3S3OA 2D5RA 1TKZB 2ILYA 4QWBA 3LWMA 3OYKA 1N48A 3RMCA 2W42A 3QIPB 2HNYA 2HVHA 4O3SA 4MKBA 3G10A 2BANA 4KKOA 3HJFA 2AX0A 4CFCA 5EUHA 1GOCA 2RDIA 3QEWA 5L1KA 4RZRA 4ED6A 1RT7A 2YKMA 5T7BA 1U45A 4Q45A 1YVUA 1C6VA 2VG5A 3UR0A 4RNNA 3MR5A 4KV8A 2UVUA 3CQ8A 4DSIA 4DS4A 3NH1A 1C0TA 3MF5A 2Y1JA 4ZVEA 1SKSA 1IKXB 4GW6A 1NK8A 1HNVB 5CYQB 1HPZA 2IAJB 5KG2A 4RUCA 3AO5A 3BSAA 1J5OB 4HUFA 4AHSA 4HYKA 4URGA 4DQQA 4ED8A 1JXEA 3CDUA 2ALZA 4WE1B 4AH9A 3SQ4A 4CGIA 3TAPA 3CM5A 1D9FA 3DMJA 4ECSA 1JLAB 2HHVA 2C22A 4LY7A 2G8UA 4FJNA 5L1LA 1Y97A 3L3UA 1ASVA 1GOBA 1LW0B 4NLSA 1Q9XA 2HNZB 1NKCA 2QK9A 2ATLA 1NHVA 3ZT1A 2KTQA 3RB6A 3DLRA 4WFZA 1CXUA 3EZUA 2P5GA 4ECTA 1N6QB 1Z25A 3M9NB 4FJHA 4U7CA 2X6NA 3BR9A 2XGPA 2RDJA 1RDDA 3ZT4A 4F4KA 2G8VA 3RMAA 2ZQBA 1YTAA 3HP6A 3PVXA 3KLEB 1N5YA 3ULDA 3OYCA 1HRHA 4PY5A 1RT5B 3HYFA 1C1BA 3QERA 3TARA 1CSJA 4F2RA 2YHAA 2BE2B 5HROB 1HYZA 5KG1A 3NKYA 3DOKB 4M94A 5J1EB 4ZVFA 1MU2A 3BQ1A 4CHOA 4QWCA 1JLCB 3CJ3A 5DMRA 4DQSA 2FLNA 4B9NA 3AO3A 3T3FA 4HCCA 3C6UB 4CJQA 2ASDA 3SQ2A 4CEZA 4M45A 4J9NA 1VK0A 4GC7A 4HUGA 3AVNA 3SFGA 3DOLB 4C8NA 4R5PB 4PWDB 2W9BA 1U4BA 1QE1A 3AA3A 4K4YA 1RT3A 3E01A 1NNDA 3OYDA 2IGIA 1YT3A 2QXFA 3CWJA 1RT2A 4ED7A 3SV4A 1U04A 3HK2A 3K5MA 4CEOA 4KAZA 4R8UA 3S3NA 4HKQA 1KHVA 1EETB 2V4RA 3PR5B 5HBMA 4TSXA 1REVA 4UQGA 1S1UB 3S9HA 4NYZA 5KG3A 1JLGB 5HLFA 1UA0A 1ZTTA 1HJRA 3EZ5A 1SV5B 2UVWA 1XI1A 4AHCA 2D41A 1Z4UA 3T5LA 4ZVGA 4NLRA 4NLPA 2WONA 4PQUA 4K4SA 4XIUA 3MEDA 4O44A 3HKWA 1T3NA 3OS0A 4DL6A 3M8PA 4L8RB 3RR7A 3LWLA 3QINA 3IG1A 4JUZA 2G8WA 1DTQA 2DFHA 2HAIA 3V9XA 3P83D 4HHTA 3HVTA 3GQCA 2A1RA 1QAIA 3UPFA 2OZMA 1SH2A 4JRPA 2IM3A 4K8ZA 5JUMA 4M3XA 4ED3A 5J2MB 2R8HA 3I5AA 4NLDA 1RDRA 3VQ7A 4FLUA 2B6AA 4F3OA 3V6DB 4B9LA 5DQHA 3DRRB 3HPGA 4CK2A 2AJQA 1YVFA 2F96A 3NH0A 2HVIA 3SPYA 3CYMA 3LP1B 3OL9A 3PX6A 1L3SA 4I7FA 3OJSA 3AVKA 3KLGA 1T03B 4H8KA 2EHGA 2OPQB 3OSNA 3PUFA 3QZ7A 2YNFB 2WTFA 1LWCA 4ECUA 2IC3B 1S6QB 4CJUA 3OYJA 5KFFA 2R8JA 3OHBA 1CZBA 1QTMA 3L2WA 3N6LA 4DTSA 1VSIA 2YNIA 3IGVA 1ZYQA 3JSMB 2JC0A 5FDLA 3SJJA 1L3VA 1ASWA 4ZHRB 3SFUA 1D0EA 3QEIA 4RW9B 2RKIA 1IKVB 1BQMB 4C8MA 1TVRB 2NUBA 3I8DA 4IDKB 3ZSRA 4TXSA 4CJKA 4J9MA 2VG6A 2BQUA 4E19A 3NMAA 1RTHA 4NLTA 4FLYA 4ECWA 1KTQA 4FJIA 1GX6A 1S9GB 2FVSA 3ZSVA 3K5LA 3V1OA 3VQ4A 4ICLA 4ZPBA 3SQ0A 4M42A 5DLGA 4CJEA 4F3TA 1IG9A 1TL3A 3VQ5A 1S0OA 5HRRA 4CF2A 1FKOA 3IRXB 2VWJA 4DSKA 3KKRA 3TI0A 1BL3A 4IKAA 3QNOA 4DF4A 1A5XA 1S5JA 3VN5A 4OVLA 5KT6A 4LSLA 3DLHA 2FBVA 3QGHA 3K2PA 1S4FA 4ZPDA 4NCGA 4K4ZA 4J2DA 2OPPB 2YKNA 3NGDA 1JKHA 3OYNA 3NF8A 5I3UA 1A5WA 3IS9B 4FW2A 4G1QB 2HB5A 4IOBA 3MR2A 3T5HA 3CJ4A 1RBTA 1R0AB 1BCMA 4AHUA 3MFHA 3NBPA 5DGBA 4WZMA 4CIGA 3TVKA 5HP1A 2JEGA 2WOMB 2YNGA 5F8GA 1ZBFA 2BQRA 4OGCA 1L5UA 4RW7A 4FJ8A 3CDEA 1S6PA 4OL8A 4E1MA 4K4TA 3KTQA 4CECA 4FJ5A 5KT5A 4EZ9A 4GVMA 2JEJA 3HPHA 2XC9A 4JV0A 3C6TA 3OHAA 4RW6B 5HRPA 4FXDA 4FLZA 3I0RA 1KVCA 1NOYA 4RNMA 1S1VA 1RTDA 2VWKA 3THVA 4OKEA 1RA6A 1HQEB 2D3UA 3UQSA 4NLVA 3OJUA 3OS1A 5JS2A 4IRKA 5CYMB 3T1AA 2XHBA 3KK1A 4CJ5A 2YNHA 4IFVA 3ASMA 3V4IA 3G0ZA 3QGIA 3HVAA 4CHNA 3KD1E 4FBUA 4CF8A 1HNIB 4O0IA 4FJJA 5KFTA 2DPJA 3NAEA 3T5JA 1L3TA 1SH0A 5KGWA 4ECVA 1VSFA 3WNEA 1QAJA 4B9MA 2HHXA 2ZD1A 1VRUB 2O4IA 3OL7A 4BWJA 4LH4A 4NZ0A 2ZKUA 3DRPA 4CEFA 3KLIA 2OPRA 4CHPA 1JLFA 4I2QA 3TAMB 4GC6A 5CZ2A 5KFPA 3DM2B 3GIIA 3DLEA 3QLHA 4LH5A 1TK0A 3M8RA 1S1TA 3KMSA 4DSEA 1C0MA 1DLOB 1WSJA 2W7PA 1SKWA 3FDSA 1W0HA 1IKYB 2O4GA 4CJPA 1I3AA 3KK2A 4DS5A 5KG5A 1HMVA 5KFZA 1BI4B 5JXSA 5KG4A 4MQ3A 1KRPA 1JLEA 4C8KA 2AGPA 4MFBA 1HQUA 4IH6A 3V6JA 1T05B 3CO9A 4J9RA 3VQBA 1VSLA 1TKTB 2XCPA 1VSJA 3CG7A 3I5CA 4C8OA 3NH2A 4FLWA 3LP2B 2FBYA 2FVCA 3CVKA 4CJWA 4YNQA 1RT4B 3L3VA 2P51A 1NJYA 3DDKA 4ID5A 4EP5A 3EY1A 3CFRA 4J9OA 1LWFA 4Q8FA 3MEEA 5KFEA 1N5YB 3I0SA 5J2NA 1RDCA 5CY4A 4EBDA 3AVFA 1ZBHA 1S49A 3O3FA 4LSNB 3BGRA 2KW4A 3QEPA 3KLVA 4E89A 3DYAA 4DTPA 1S1XA 2PY5A 1VRTA 4OJRA 3VQSA 4EYHB 3DRSB 1VSHA 5EDWA 2RF2A 3OYEA 4OKJA 3PW5A 1C0UB 4E0DA 1RT1A 4KFBA 3OSPA 1TKXA 2ZE2B 4PUOA 3VQDA 3KHRA 3AVGA 1MMLA 2W9BB 3VQ9A 2ILZA 4RW8A 5L1IA 4NRTA 1SUQA 1C1CA 3EPGA 4RW4A 2HWHA 4KREA 3IN5A 3QESA 1RTIA 4Q43A 4WYLA 3LDSA 5KFRA 3MECA 3NL0A 3RAXA 3HVWA 3MXJA 1TGOA 4H4MA 3KJVA 1CZ9A 3MR6A 3JYTB 3LP0A 2XI3A 3PJXA 4IQXA 1TV6A 4IKFA 3N6NA 1BHLA 3RMDA 4IRCA 1DTTB 4IR1A 1J54A 4W5NA 1FKPB 3FFIB 4Y34A 3TAFA 3V9ZA 1KVBA 4BE1A 3G6XA 2I5JA 1N4LA 3DLKB 4KI6A 1QSLA 3QZ8A 1RDBA 4G3IA 1RBRA 1KFSA 1BIUA 2UUWA 3GV5B 4N76A 4IG0A 2J6TA 1SKRA 1D8YA 4KO0A 2VG7A 1LWEB 3LAKA 4IG3B 4K4WA 4ZTFA 4CGDA 3M8QB 1IH7A 3GYNA 4DF8A 4NLUA 4NLOA 1IM4A 2HMIA 1T8EA 4CEDA 4J9SA 2WK4A 4KBIA 5EWGA 4I2PA 3QEVA 4M3YA 3QO9B 2XY8A 4CGHA 4J2EA 4OKKA 3KLHA 4MH8A 2LSNA 3DLBA 4URQU 2ETJA 2XO7A 2PZSA 4CJRA 4AHTA 4EYIB 2XRIA 1W9HA 3LAMA 2W8LA 5KG0A 2DPIA 3V1RA 1FK9A 2IM1A 4ID1A 4Z4FA 1LAVA 4N56A 3WNFA 5KG6A 4KE5A 4DL4A 3IGNA 4FS1A 1RDAA 3AVMA 3LALA 3PX0A 4OGEA 4M3TA 2B5JB 1TK8A 3AO1A 3MAQA 3NGIA 4QCLA 2R7YA 4CCHA 2DTUA 2V9WA 3KNAA 1Q8IA 4BE0A 3AVLA 4FYDA 1TKZA 4K4XA 5F8JA 5KFYA 2OPSB 1RTJB 3MEGB 3G86A 4FW1A 4WFYA 5F8MA 3QIPA 1S9FA 5D3GB 4FVMA 1VSDA
chains in the Genus database with same CATH superfamily
3EXYA 4PG5A 2A0FB 3FSIA 1KAXA 5LL6Z 1FJGF 2GAGC 1IUJA 2P9KA 4QW9A 3AA8A 3OYMA 4FYYB 4JKDA 1SAZA 1V4TA 4FWMA 1RT6B 2VBZA 1HNVA 2UXBJ 5AXLA 4WQ4C 4NL5A 4FS2A 2W4CA 4IO1A 5C24B 4DU8A 1J5OA 1ZPVA 4JI6J 3OTOF 5E3AA 3ENVA 2D0CA 3ZSWA 1LK5A 2YHBA 3P4IA 4WE1A 1WKKA 3CJ9A 2QEXS 1HA1A 2ACMA 2DNLA 5M2RA 1JLAA 5KTQA 1RYRA 3W5ZA 4NMLA 5CZ1A 1KQSM 3K5NA 2UV8A 2WVEA 4ELVA 4DL3A 3LW5C 1YJRA 1ZBUA 3KK3B 1Q81O 1B0PA 1UZHA 2VB6A 1WG1A 4KPCA 3NNCA 4M1KA 5DZ7A 3GPAA 3MN9A 1XC3A 2UUAF 3H4BA 5EX0A 2MGZA 4E7JA 1MN7A 2OA8A 2K3IA 4DTNA 3KLEA 5DLFA 4A59A 1ZTWA 2Q79A 1F3FA 4KHYA 3SAHA 3NVKA 3W63A 3EN9A 4M5NA 3QGGA 5A8KB 3NHGA 4RG8A 4TY8B 4ZP8A 4Y2MA 3LO3A 5C42B 2FGOA 4LVOP 4JV2A 3RB3A 3HSJA 3C46A 1WF1A 4G1IA 4YDUC 3DOLA 4ID8A 5E5NA 3QJLA 5DS7A 2P2CB 3AT1B 4B9VA 4K8XA 4ILHA 1JLBA 5IQ6A 2V94A 4KGVB 4KTWA 2DGOA 1R8BA 4F4ZA 3FVYA 1P27B 3ENOA 4YOYA 2GMHA 2W9CB 4C3MA 3NAHA 2KHCA 2HWIA 1S1UA 4FZYA 2K1RB 1BU6O 4RWWA 1BUPA 3E3XA 1ZETA 4JI2K 4IFYA 1EQMA 3DRPB 4JRQA 3LPUA 2OTJS 3KD5E 3KWIA 1X3MA 3ZCMA 4CM0A 1QQCA 2QYGA 2ZITA 1BOTO 3SBMA 2BMBA 2D7SA 1RWNB 5GADI 3HSCA 1AA1B 2D3ZA 4L3KA 4DG1B 1UVNA 3OL8A 3O3LA 3ZT0A 3IMQJ 3QIDA 3D9BA 3WC2A 3J7AP 3R7BB 3QT5A 4KRFA 4F4YA 4WIQA 5LJ3Y 1HNWF 2APOA 2QW9A 4DFJA 1BXNA 3V6DA 1P1LA 4YHHF 2VIHA 3PW4A 2HQCA 3G2XA 3C15B 1VQSA 1P90A 4BR5A 1X5SA 2WW4A 1FKAF 2UVRA 2GS8A 2XY6A 1WTBA 4X4VA 2PAVA 2DO4A 2OPQA 3UCZP 4EBEA 4OI3A 1KEKA 1S6QA 3DLGB 2EW9A 1BC6A 3VGSA 4KHNA 3L8BA 2G0IA 3UKUB 4YN3B 3EVMA 3RRKA 1IV0A 1NWKA 1EKRA 3FRZA 3WBZA 1N5VA 3IAYA 5AQZA 2QO3A 4DI6A 3W5YA 4W5TA 1R0CB 2VGNA 1J9AA 2XZWA 2AA4A 2BW7A 1OYEA 4DV7K 4Q5VA 4Y00A 4RW9A 4KKOB 3VAMA 4FOEA 2NZ4A 3W65A 3O1BA 3BP8A 4O0NA 4BRGA 5KFKA 3CJBA 2E5IA 4DTRA 2W7OA 2VG5B 1AFIA 1GXTA 5G0RA 3ISZA 1C0TB 4IBNA 4F8RA 2P9PA 1TFWA 4CEBA 4C48A 5DQIA 1Z2ZA 2KO1A 1FJCA 3VQ8A 2H3EB 3JS9A 4AHRA 1RP5A 4FLXA 2OEMA 1X9WA 3LQVA 4B3OA 1KAZA 2V8VA 2FDNA 1X9MA 1CC7A 1IBKJ 4BVOA 4X64F 2DY4A 3SZ2A 4DUZK 4ISFA 3H40A 1RFQA 2CFXA 2F3JA 3F9KA 3ZZRA 2NUUG 1WD6A 2PEHA 4LF2A 4WKYA 4LF5K 2OPPA 1FRKA 3KVGA 1XC9A 1BIZA 3A1YG 4QWAA 4G1QA 2XZDB 1K73O 4X65J 2QA1A 3OVAA 2DIUA 3CJ7A 5AT1B 4KB7A 4B1XB 2WOMA 4WWSA 1WC3A 2O67A 2YKAA 3QICA 1EO1A 4JV5F 1V5IB 3BF4A 1UKUA 4LFBF 3CMAS 3GBTA 2KZZA 3J7YP 2BJDA 4UY85 4B8CA 4C0OC 2IJRA 4DV6K 1WHXA 5THWA 4I9QA 3PZPA 1U48A 4RO0A 1HUXA 2HBRB 3HFKA 3J81U 1RKIA 4E7HA 4RU9A 2O5DA 4DKWA 3PYGA 4M41A 5F9LA 2ZUGA 3M6XA 4F36A 1VK8A 2FJVA 2QWMA 3SNNA 3N9UC 1YUWA 1K1QA 1QE1B 4DR3K 2LEPA 2W2MP 1DARA 1Q82T 3H5XA 2D0AA 3CJRA 3P5TL 3LP3A 2ASYA 2DB1A 5KT4A 2MHNA 1VBYA 1EKEA 5AXKA 4DUYJ 2HK3A 4HUEA 3W3SA 1FF2A 5KRTA 4GKJK 3BJYA 5AZJB 2GW8A 4CE9A 3OXGA 5BRFA 2KM8C 2KZMA 4A8QA 1Y3JA 1V3RA 5IWAK 2IVFB 1QHTA 3IR5B 4AQYF 4JK8A 4YORA 3PIOQ 5EU7A 1K9MO 2MQLA 3M32A 1GOAA 4KPYA 3THWB 1YJ7A 1P9YA 3HO1A 2VL1A 3MN7A 4OZ3A 2ZWPA 1X60A 4CIEA 3C3LA 1VBXA 2IIHA 3HSGA 2DISA 4KQZA 4P6QA 3BN4A 1T05A 3A5OC 4QJVA 2GQQA 2XHWA 2QWRA 4JD2B 3VCDA 3LTOA 2QLXA 2E9TA 4OFZA 4ZP9A 3HXMA 4CLTA 3Q24A 4ZP7A 4I7FB 3TVZA 3AARA 3TA1A 5BXIA 5TKWA 4FJ7A 4PAAA 2UUCJ 4J9LA 2ZH2A 1GNKA 3Q8VA 2HHUA 1TL7A 4KHPK 2U2FA 1XMOK 1ZPWX 3ZZUA 2KFNA 4J9PA 3GV8B 5D8HB 1NUEA 4LFAF 1Q8BA 4A46A 4E2FB 2UVVA 3RAQA 4XPEA 4K0KJ 2FBTA 2QWQA 3DRSA 3O08A 4CHYA 2YNIB 4PWWA 3CC2N 1NHUA 1GH8A 1NEEA 2DGTA 3EPIA 4C3LA 3K89A 4ZVHA 1WOQA 5L9XA 4B9SA 4UY8O 1JLBB 4ZVUB 2RKIB 2EK1A 2ZVSA 2CNLB 1EQYA 3TNVA 4Y65A 3Q8QB 2HFNA 4F02A 1QSSA 2Z8QA 1HNXK 2RU9A 2R7WA 3CD6S 3AODA 4JKCA 2EVZA 4ES1A 3W2VA 3BQ0A 3VZHA 2FY1A 3LDQA 2RILA 4NE9C 4LF1A 2QA4S 3SSRA 2B4JA 4ICLB 3LZIA 4GKKK 4QIFA 2OH2A 4Y2CA 4FWLA 4YR3A 4FYWB 2CJXB 2PSZA 2N3OA 4M5KA 4IFYB 3JTOA 4OYWA 4B3TK 3TABA 3FFIA 3U3YA 2WSFC 5AXMA 1UW4A 2HG4A 1HX1A 1DQ8A 3E8OA 6FDRA 1GAOA 4B1UB 4BREA 4C3KA 2WB4A 1T0TV 2MKIA 4CERA 3NOGA 4CZKA 1KQKA 4WKRA 2ZEJA 3CEDA 3OUYA 2HIQA 1HBUA 2V2KA 4BG8A 4CBWA 4UZBA 3SQGB 1J53A 2MZQA 3PACA 1R3NA 1GEHA 3MURP 4RBUA 5KFCA 3UKRB 3V9SA 5H1SQ 4ZPCA 2J0WA 4WU3A 1UETA 3FZBA 1N8RO 3GMGA 4BRMA 3CCRS 2GELA 4B9TA 1S6PB 4WJBA 1GTHA 4V19X 5KFGA 2R8GA 3RSEA 3NXZA 1UFWA 2R8KA 4DR1J 4KH1B 3G87A 4WFAL 3NGYA 3C66A 4C9DA 2G8IA 2QLFB 2CQPA 5M1PA 1S1VB 2JDJA 3I56N 2R8IA 2QN6B 3QGPA 2MZ1A 2R9LA 2F9TA 2XI2A 3LZJA 4FKYA 4BR9A 4YFUA 1OVQA 4AM7A 2BQ3A 4LR7A 2VPZB 2W2PP 2JC1A 3Q8SB 2Z2YB 3RRGA 1PJ6A 1EKSA 3GIRA 3H59A 2JWNA 2DVIA 4GVEA 4XH5A 3QAUA 1PCAA 2CNNB 2BR0A 4ERDA 4JKGA 1YI2N 3GLJA 3P8BB 3KNGA 2YHXA 3KJQB 3SUOA 2GC8A 1D5AA 2B8PA 1GLFO 3RBDA 2X7IA 5HQ8A 4CHQA 3MMCA 3AVCA 2WC9A 2EXUA 2R7OA 2QA4G 1S22A 2G2OA 4OYOA 3O9UA 4YUDA 1ROFA 4FPAA 5A6WA 1F21A 3TAEA 2AGQA 2ZBIA 1BHNA 3CM6A 2HRUA 4EBCA 4B3OB 4CGFA 2WBNA 4EFHA 3GR0A 3K5OA 2DNMA 3HMJG 3UD3P 2F8TA 1ASUA 2X3GA 2JEFA 1V9OA 4HI2A 3BBCA 4C1NK 1JLEB 3JAMU 2UUBF 1GK8A 2CQDA 3NY0A 3RAMA 4O4RA 3QBCA 1NK5A 4W5OA 4KGKA 3TR5A 5AR0A 5C25A 2X6SA 2MKYA 2CPDA 3E1YA 2V68A 4HLBA 4YR0A 1OPIA 4DPTA 2MQNA 3C16A 5T14A 5K14A 4DV1J 3QRQA 2QKKA 4JKFA 5JS1A 1Q7YO 2DTJA 1Y3KA 2A5XA 5FJ4A 4WYWA 3THPA 3ZTOA 3ZZOA 2C2DA 2IM0A 3OL6A 1RBVA 1FEEA 3GG4A 1VQON 2F63A 3DYAB 3WNGA 3H42A 1B9DA 3N79A 1VRTB 3AJ1A 2M3DA 1FD8A 1FA0A 5DG9A 4B3MJ 1YZ7A 4FJLA 3WXKA 3SUPA 3G6VA 1Z05A 4MAKA 4KRWA 1RT1B 4KFBB 4PUOB 2WUSA 2KFZA 1SH3A 3NEKA 2Q6BA 5A2QO 4RW8B 5EGYA 4YOEA 3CULA 1SUQB 1WSEA 1ATNA 2OSQA 3C94A 2X74A 1RTIB 3KLFA 1NKEA 2M7SA 4C11A 3IA0A 2DRDA 1XNQJ 2I1RA 1N56A 2GVZA 4PXBA 3MWBA 2ASLA 2ZH7A 3O8WA 4KGZB 2CH6A 3C8YA 4Q0BA 5LMNJ 4DPYA 2LQ9A 4WFBL 3ZT3A 2Q36A 4WFXA 4ZITA 1HBMB 3W62A 2PD1A 1VYAA 2UUAJ 2Z2ZA 1R6VA 2E2QA 4A8FA 2E9RX 4FYXB 2EC2A 3M32B 2VH7A 4CK1A 5AE2A 2B4OA 4KO0B 3RBEA 4JYAJ 3TEGA 3NF6A 2V4QA 2MZSA 2CJ9A 2B56A 5CD4H 3GIKA 5TKYA 1OYDA 2L41A 2RUGA 2OD4A 2HMIB 1FRHA 1H3DA 4IYQA 3B4MA 2DNRA 4FBTA 1N32K 2NLXA 4EO6A 1SL2A 2QMWA 3TSUA 1RCHA 4FL9A 5FPEA 1AROP 4USHA 3IP0A 4PL8A 4X84A 2QKBA 4P52A 2AT1B 1LNQA 5HANA 2E2OA 4AL5A 4FF4A 3OLBA 4Y1DA 2GHVC 4FF3A 5J1NA 4OV1A 1R8PA 4NYFA 1NJWA 4ER8A 5DO2A 2JSXA 4DFMA 2LVWA 1JCEA 2NRHA 3AO2A 5L39A 4NCAA 2MMYA 3D2EB 4JK7A 1WI6A 1M1GA 2QSWA 3LWMA 2C2ZB 1DJ0A 3Q83A 3RMCA 2HVHA 1JK9B 4JKEA 1KOHA 2YQ1A 3C14B 2DHAA 2LXFA 3FZLA 1GOCA 5SUHA 5L1KA 4RZRA 1RT7A 3MPUB 4V19S 2UVUA 3NH1A 2Z30B 2Y8WA 2Y1JA 4ZVEA 2R4FA 3KWMA 1HPZA 2DNZA 1WKJA 3BSAA 1K8KA 1KC8T 1T3VA 4AHSA 1JXEA 4ED8A 1B4SA 5HMYA 2QWOA 4AH9A 1RE1B 1YXQA 4HI1A 2UXDF 4ECSA 5A0YB 2M52A 2HHVA 1FE0A 2BW2A 1VQNS 1CEZA 1YJTA 3AD8C 2DH8A 1VS3A 3HHLA 4NX9A 2KT2A 4DV2J 2ATLA 3DRXA 2EBGA 1AT1B 1TUVA 1Y11A 1BLUA 4ZCMA 3EZUA 4ECTA 1N6QB 2IHR1 4OX7A 4OZJA 4UTGA 1CLFA 5LMUK 4KJIA 2UU9F 3OVSA 1NPKA 2RT3A 3BR9A 4USVA 4G6VB 4CT8A 4F67A 2DR5A 1S59A 3G4SN 4IZ9A 1RSCA 1PBUA 2CZ9A 1HNZJ 4A47A 1QZ5A 1YZ6A 4ZVFA 4JHDA 4E98A 4ED5A 2NSBA 4HCCA 3X3UA 4QR0A 3GYGA 4J9NA 2HBYB 1IG8A 3AVNA 4HUGA 3KJNB 5L9NA 1NDPA 4MJKA 1VQ8N 4R5PB 4PWDB 1B70B 1U26A 3MM7A 2W9BA 1OPZA 3AA3A 3E01A 1NPRA 4ZCIA 5IV4A 1K47A 3EKUA 3OYDA 2F65A 5B0FA 5M1NA 5ADXA 1GLEG 2Q1NA 2QGFB 2W24A 3CWJA 3EKSA 3FNNA 1CPZA 3K5MA 2XMJA 4KAZA 4AXIA 2VBWA 4TSXA 3FKBA 3H8YA 1UA0A 3FZHA 3I9V9 1ZTTA 3T1YK 4B3RK 1NMNA 5M1QA 1VHIA 1SV5B 1VCTA 3PFOA 1U1QA 2GWJA 3MX2A 4AHCA 3HSZA 3J80U 2WONA 1RQ0A 1ATRA 3MEDA 3W9IA 3HKWA 3FCWA 1HLWA 4NPOA 3T1HF 5AZIB 4KH4A 3RR7A 5DDOC 1J5EK 3GJRB 1DTQA 2DFHA 3D2FA 2BE7D 3V9XA 1R89A 3HVTA 5A6PA 4DR7K 2CG8A 2OZMA 2WSEC 4ISGA 2YWFA 2YY3A 4K8ZA 1LK7A 4M3XA 5J2MB 3I5AA 5HATA 1AZSA 2FHMA 4GV3A 3VQ7A 4E1JA 2B6AA 4NI2B 1JJHA 4QIVA 3MCOA 1XMQJ 4CK2A 2HOEA 1F5AA 3EVOA 3DNCA 2RE1A 2MDAA 4LRDA 1C0FA 5A2QY 2HVIA 3NH0A 2FB0A 3L95X 3LP1B 3HKZD 3D6TB 3KLGA 3M30B 3WX8A 3PUFA 1KR4A 3QZ7A 2YNFB 5ITHA 3MPDA 2VQEF 4DV0F 4ANEA 1FRLA 2IC3B 3EE8A 4LF7F 1IBLK 3CMEN 5E3CA 3R9LA 4NEYA 4OPHA 3L2WA 4JI1J 1S72N 5KOXA 4OJ1A 1FJ7A 2B4PA 2BJ3A 4JKBA 2XNQA 4I6WA 2CDRB 1ZYQA 3JSMB 3SDEB 3SJJA 3MCAB 1L3VA 3PSFA 1N33K 4JI5K 1Y9OA 1ASWA 2IVYA 4X66F 4OYIA 2E1YA 2XMAA 2ZH1A 4ZS6A 1BQMB 3LM9A 4MYTA 5E3RA 1TL4A 4TXSA 5FPMA 1X5OA 4BQLA 4OI0A 3OA9A 2I0XA 1GLJO 4E19A 4NLTA 2QL5B 3O2IA 4JI7J 4FLYA 1FX2A 2HFUA 7AT1B 3CETA 1VQ5S 2NRVA 2FVSA 2UV8G 1VBKA 6AT1B 2JNJA 1O51A 1A9NB 1TL3A 1S0OA 4CF2A 5D0EA 3R9PA 4DR5K 4GV6A 5ETNA 4ATNA 2BKNA 2Z4PA 2PMWA 4B3SF 1B0TA 4DBQA 3OTCA 4LSLA 2FBVA 4RU2A 4LREA 3HULA 1X31C 3K2PA 4ZVRB 4LF8F 4ZPDA 3ETOA 4NCGA 4A8SA 3NGDA 2XLKA 3NF8A 2DEIA 1OH8A 2HB5A 3VAHA 2E7WA 4LF4J 1FWPA 1RBTA 1BCMA 1UVJA 2NQPA 4AHUA 2YVSA 3NBPA 3US5A 2Q0RA 2PDAA 3L6QA 3AOCA 3RW7A 2WVDA 2V5HG 4UOFA 3OR2A 1XERA 5HVHA 1VLYA 4RW7A 3CDEA 2ZH9A 1T9WA 4F3QA 3KTQA 4I0WA 1CJKA 4FJ5A 2FF3B 2DXEA 3CF5Q 3CCMS 2ZJPL 1WSVA 2DR9A 3HPHA 1EWQA 3C6TA 4I69A 3AFGA 3CCUS 5HRPA 5JJBA 3NMRA 4FLZA 1WEYA 3UE2A 1KVCA 1RTDA 1VIOA 2VWKA 1CJVA 3H6EA 2D3UA 3UQSA 1N5SA 4BRNA 5ADZA 1P9QC 2XHBA 3HHDA 4CJ5A 2YNHA 3ASMA 4BCAA 2VUGA 3QGIA 1B3TA 1EJ7L 2QLBB 4NA2A 4O0IA 2J0QD 2D0OA 5KFTA 2V63A 2DPJA 1SH0A 4I6AA 5M2PA 2GJ2A 1VSFA 3WNEA 2NNWA 2HHXA 2B51A 4NZ0A 2ASMA 4WBFA 1HKCA 2ZKUA 3FCHA 4RL1A 4CEFA 4IOAL 2RQMA 3LF0A 2C2NA 1S1TA 2B9YA 1C0MA 5GMDA 2D9OA 4BC2A 2LQJA 2I8EA 2BJ9A 1FVQA 1NAQA 4Z7CA 1IKYB 2XYHB 3DWLA 5GIPA 4CYUB 3KK2A 2DY1A 2XHCA 1BI4B 1PYOB 5JXSA 3GJQB 1U1PA 4C8KA 1G6BA 4MFBA 1HQUA 2AGPA 2Q97A 2J7UA 1RDWX 4J9RA 3VQBA 1FHTA 4OZNA 1CC8A 4DOZA 4BRPA 1U2FA 3FEXB 1NSPA 2VV5A 5IT0A 1R8HA 5H9EK 2P51A 2VPWB 4EP5A 4J9OA 1PC4A 2DBBA 1RDCA 5CY4A 3AVFA 1S49A 2KW4A 4WQ4A 3QEPA 4WFAQ 4DTPA 3RW6A 1S1XA 1SXLA 2E88A 3VQSA 2CXEA 3DXBA 4QZVB 1RHJB 5LT5A 1DZ5A 1D3WA 2M2BA 4RPFA 5EDWA 4LF6K 1PG5B 3DDIA 3OYEA 4KH5A 2QFIA 4E0DA 5HAOA 4ZLLA 1R8CA 3AVGA 1T6DA 3WXMB 2W9BB 4JI4J 2I7PA 2ILZA 3F9MA 3A12A 1U1KA 4NRTA 4RW4A 5IOLA 5DJBA 3I87A 3FLCO 2EWHA 1VQNN 4Q43A 2CQHA 2GX8A 3IR6B 4FO0A 2CQ1A 3EICA 3LDSA 3PSIA 5KFRA 1NGIA 4TKTA 3RAXA 3PRVA 3KJVA 1TMJA 3MR6A 2DHGA 2DYAA 4IO8A 5AQVA 2XI3A 3GU0A 2MHEA 1SJ1A 2LQ8A 4HTJA 4USMA 3NG8A 3RMDA 1DTTB 1M5SA 2BJ8A 5GMEA 3DXKA 1FEHA 1E3MA 5CZXA 4W5NA 1UVIA 1FKPB 4DPUA 3HF5A 8AT1B 3TX8A 2I5JA 3DLKB 1WEZA 1RBRA 1BIUA 2UUWA 2YBVA 3GV5B 5M2UA 4N76A 4IG0A 4OPAA 2I7NA 1SKRA 2DNHA 4IEEA 2VG7A 4YDUA 2LLZA 1V3SA 2M5YA 4OX9K 3U27A 1IH7A 1LCUA 1IM4A 4CEDA 1X3NA 5HMZA 4I2PA 4J2EA 3KLHA 2V50A 2XO7A 1WOPA 3DU5A 1LQ9A 1K8AO 4BQZA 1MROA 2LFVA 4MDBA 2B7CB 1K44A 3J7YI 1FK9A 1NBEB 4NLCA 1U7LA 4MKVA 4Z4FA 1S12A 4W92B 3AVMA 3OXLA 4LUBA 1RWMB 4NB4A 1TK8A 4IO9L 4JI0J 3AO1A 4USKA 5AQUA 3NGIA 2R7YA 2BBEA 4NLBA 4RLEA 2EI5A 3D67A 2D0PA 4BE0A 3AVLA 3BEGB 5F8JA 3VGTA 2UYTA 1XNRK 2OPSB 1RTJB 3MEGB 2O8EB 3MM8A 3ULHA 5F8MA 3PKMA 1S9FA 3W2WA 2QYCA 1LFWA 1HLUA 4IOXA 3A8KA 2R2TA 3QMQA 4U9RA 3D45A 1BQNB 5AQQA 5F0UA 3HM9A 1RAHB 1CJUA 1TR0A 5MLCV 4OYBA 3VESA 3NLCA 1IKXA 5EY4A 2EC0A 4P7TA 5CYQA 3NRBA 1ACMB 2J8AA 4WFBQ 2ZNZA 3QSYB 1YF5L 3N4PA 3C2PA 3AVBA 1YJWS 1UPPA 4H54A 2HQIA 5GAHU 4FJKA 4CK3A 3IWLA 1YJ9N 2G8HA 3IBCB 3FMWA 3PYDA 3SIPB 1U0HA 3HT3A 3O4NA 4YOTA 2ASOA 3RWUA 5EOYA 2E2PA 4C8ZA 2V69A 1LW0A 1S1WB 2QX0A 3GWCA 3MM6A 3WT0A 2P9SA 4CJTA 2VJVA 1VR6A 2ZBPA 2V4JB 5I42B 3NE6A 4FK2A 2QG9B 4P2FA 2GAHC 4ZPVR 4JK9A 3FGVA 4AF1A 4OHWA 4BR0A 4BC7A 4UT4A 1K0TA 5A8RA 2ZJRQ 2C3UA 3OV7A 3VENA 3ISNC 3HHLD 3TZWA 2FLLA 2KVQE 3OR2B 4LIWA 2OMOA 3D4JA 2GX9A 2BE2A 3LPTA 4UOGA 4CZLA 1JLQB 4DHYA 2A3ZA 3WEEA 3L2VA 1JLCA 5IZHA 1UEVA 2I9SA 2FXUA 5F2RA 2P9IA 3C6UA 4R0JA 1DURA 2COLA 4DR2J 1RK8A 1X8DA 3SI8A 1K6YA 1WN7A 3O4WA 1E6VA 3LH2S 4PG4A 4LF9J 1XHXA 4DV3J 1YIJS 5KFVA 2MQPA 5F9NA 3HPOA 5HQMA 4DV4J 1FE4A 2DNYA 4I6MA 2MEWA 3PR4A 1HYSB 3OLAA 5F8IA 4IJAA 2I2YA 4CGJA 1IBMF 1NG9A 2KVIA 2OO4A 4QBUA 3WIVA 1PKUA 3LOUA 4K4UA 2ROGA 5SZTA 4FVUA 2D69A 3H4DA 2V9KA 1YK9A 2KLAA 4ISEA 4TU8A 4PL7A 2NXUA 3KXDA 2HYIB 1RWWB 4YY3J 1GXLA 1W25A 3O44A 3CJ5A 2MQQA 1Q81T 1S6UA 1U6BA 3JTNA 1OIAA 1TL1B 1WWHA 4NXMF 3CDWA 4NLWA 1NPPA 4AT1B 2VPYB 3EVWA 2UXCK 2QL7B 4B1YB 4GVBB 4BR4A 5EWFA 1ZXOA 2W6LA 3PEHA 3MM9B 3AQOA 3NWGA 5BPLA 3DXMA 1SL1A 2VQFF 1FRIA 3MD3A 4TY9A 4A8OA 2K7KA 2J6SA 1HI8A 2RRNA 4GVLA 2J0SD 3MMBB 1U02A 3MTKA 1KBRA 1PYSB 3V4MA 1LAWA 1PILA 1NH7A 3BZCA 2CQCA 3HSDA 1F60B 3AVHA 2VPXB 1FNMA 4F26A 1KLMB 5JLHA 4KSEB 1JNZB 1QUPA 3W60A 4ZIWA 2YI1A 3C7NA 2ROEA 4H4KC 3ZSZA 2OIHA 5KFDA 4OPKA 1SS6A 2DHSA 1WC6A 3SPZA 4ZCKA 3U6FA 2K2PA 1FXDA 1LW2B 2E5LJ 3GV7B 3ENQA 5BYRA 3L2RA 4ZJLA 4F0HA 5GVQA 5KG7A 2O8CA 4D3HA 2HHHJ 4IWVA 2RUSA 1JXVA 2PA3A 3H45C 5C2DA 5HRSA 4R0EA 2HNYB 3T1HJ 3CPWR 1RZMA 3KHHA 1LV5A 4ZHRA 1SJQA 1TVRA 3D28A 1WACA 4WP3A 3VEYA 4NLXA 3E51A 2YKMB 1TYQA 3CCJN 4KV8B 3ET6A 5DM7Q 4QAGA 4QPXA 4KR0B 2J76E 1Q16B 3CCSS 1LOTB 1PYTA 1AYEA 2MZJA 3EL2A 3RRHA 1YBUA 3P4UB 1RACB 4CEEA 3DXKB 3DMJB 1YSJA 3M4XA 3M8ZA 2IBKA 3CCWA 4CZFA 2GVDB 2ZWOA 3FZKA 2VQEJ 2PT0A 3Q86A 5D0GA 2ZKTA 1ZBIA 3VQTA 2XLIA 2YTCA 1G2EA 2M0GB 3IS9A 4QOZB 3A8YA 2MSTA 4DV5K 4NMXA 4KB0A 4OZ1A 3KKFA 3R5AA 3NF9A 3Q8PB 1H6KX 5JMVA 1F9FA 2UXBF 4NRUA 4LR9A 1GLCG 3SUQA 1OMSA 5KT7A 4H5WA 3AH6A 2VONA 4Z2XA 1C1BB 3CD7A 1J6ZA 1NGAA 4EK2A 5KFLA 3HZGA 1IM6A 1YITN 2F7VA 1N88A 1X4EA 8ATCB 4ETXA 3I4PA 2O8BA 2AEJA 5EHHA 1EXQA 4JV1A 2NRXA 3ZC4A 1HQEA 2IMWP 2FPHX 3H5SA 3CJ1A 4FWRA 5CYMA 2E7XA 3DFEA 4CD1A 3G71S 2GUIA 3TUZC 4OQJA 3TVYA 2RHQB 2OTLN 2YWKA 1RU1A 1WG5A 4YMEA 3NGUA 4B3SJ 1HNIA 3ALYA 4NXNJ 4YDDB 4IRDA 3DGPA 4JBCA 5HBMB 2IRUA 3NGZA 3L7PA 3TR8A 2Z0GA 1UVMA 4EGLA 3MCMA 1VRUA 5HLFB 2N7YA 2BOAA 4DEZA 2H5IB 3SV3A 3TAMA 3ZO7A 4A8YA 4I1TA 3DM2A 5IC6B 5AQIA 3CC7S 4O44B 2LDYA 3Q22A 2FQQB 4CJ4A 3CJCA 3Q7CA 4N8OA 3M8PB 4BRIA 1UEKA 1K73T 3F41A 1N34J 2YKPA 3IG1B 1WUUA 2ZVIA 4O5BA 3QEXA 2XMWA 4HVJA 1XQSC 3OY9A 3J8AA 4DMNA 1KQSR 2M70A 4F50A 3U3GA 1H38A 1U47A 5IT9O 1C4CA 3CC4S 3AJDA 4URSA 5KPTA 1WSIA 4E7IA 5ETSA 2ZM6J 4O8UA 3VQEA 5KFIA 4G9ZA 3AQPA 2ASJA 4C1NI 2DXFA 4WYBA 1KONA 3OR1A 2M88A 3C65A 2XM3A 1VFJA 1OO0B 4X4RA 1RT4A 1FJGK 4OYMA 3RGIA 4DR4J 3FZMA 4YQWA 4J2BA 3GB0A 2H51B 2FJWA 4Z0UA 4LFCJ 4X4UA 2J9CA 1LWCB 5AQTA 1S0NA 4LSNA 3MAAA 3OTOK 3SQ1A 2JLEA 4HDHA 2WBRA 5BRHA 4TLRA 4GV9A 3UDLA 2H5JB 3H08A 5ETOA 4FKXA 2FSJA 4J2AA 1UMJA 4K4VA 3GONA 2PBDA 2AX1A 1C0UA 2GV9A 4CZHA 1TQLA 2F9DA 3AY0A 2ZE2A 4FJ9A 4H5NA 3VEXA 2YWHA 1MG7A 1VQ4N 1W26A 2VG6B 2MPUA 4RUAA 5FPNA 4B1ZA 4A8KA 3EO3A 1RGVA 4UZCA 4KHUA 1RTHB 3TZXA 3N0VA 1VISA 2C42A 4HT5A 4NYPA 3SYZA 3P31A 2GA7A 4ZPWR 3EUNA 3SMSA 3RBZA 4U6PA 1WNSA 4KHSA 4PHTX 2DH7A 2EWSA 2NLWA 3K8WA 1T44A 1FKOB 3BZKA 2V67A 2RN2A 3C95A 4Q8EA 4RCHA 2XCAA 3TQ1A 1JQGA 4RNOA 2NZTA 4P7VA 2E6LA 2FJXA 1T94A 5H9FK 4X2BA 4A2BA 3OYHA 2EKNA 4OX8A 1OY8A 1LWEA 3AA4A 1ZAWA 2IBOA 3M8QA 3QNNA 2HHSA 3HFVA 1WAJA 2F4VJ 1NDLA 2FZGB 2PYLA 1HBNB 4CBXA 5HP1B 3M1FA 3DXMB 3W61A 1I5OB 5T7LA 4KYZA 3TPQA 4GKKF 4OLAA 4ECYA 1NK6A 3QFPA 3SBGA 3IC1A 3UVJB 2A6AA 4F4AA 3THYA 4M95A 2DJWA 2IJFA 1IBKF 2Q0UA 5CAAA 3BR8A 1SJRA 2OMLA 4HDGA 4UY8T 5ETVA 2XY5A 3I0RB 2QTWA 4U7BA 2CQGA 3VAKA 3NOCA 1KVIA 1Y5LB 2C2OB 4NA1A 4X65F 2GO8A 1A0OB 3DOMA 2DGSA 5AE1A 4IFVB 2AYGA 3V4IB 4J7CA 2XG8A 4EFAC 1VQYA 3AAWB 2Q66A 2X1BA 1WSRA 3L09A 5D3GA 3O80A 4Y3CA 4X62J 4MIBA 1HNWK 4CLKA 4W4MA 2HURA 3W64A 4YHHK 3CO0P 5KOWA 4ZN1A 3RTVA 3SSQA 2ZJQQ 2F9JA 2ZD1B 3OTEA 2VKRA 2L08A 4E7KA 2DY9A 1TYQB 3KLIB 2OPRB 5KFUA 4I2QB 1RT6A 3H5UA 5A2QU 3DLEB 1KXPA 2BKPA 2ZHAA 4DWIA 3QLHB 1HWKA 1WSGA 4IFEA 5C24A 3IMXA 3I33A 2CJAA 2ZUAA 2QE5A 3M2RB 4FWSA 4YB1P 3CJ0A 3GCWP 5KFAA 1DGKN 3D0PA 3PV8A 4FM1A 4RWTA 4JI3J 1JL2A 3RVCA 1ZZNA 2MYFA 4K2JA 1HMVB 3RR8A 1EWRA 2P9LB 3J7AN 3HFZB 1N8RT 4Q44A 1WEXA 2AJ4A 2ALYB 2YX1A 1YRXA 3KK3A 1ITGA 1F6TA 3H2LA 3BDPA 3LDOA 1SJ4P 2G1HA 2Q3SA 2DFEA 2BJEA 3MWTA 1F5BA 1M5VC 1VQKN 4WF9L 2CRLA 2F8MA 4J9KA 1DQAA 4FLTA 4DR6K 2OJ3A 5DG7A 2CAJA 2Y1LB 4YS2A 4KAIA 3CSKA 5J2NB 2XGQA 1HHSA 2VGMA 2Z1GA 4HHHA 4CJ3A 2P9GA 5GAGU 3CERA 5A8KA 1OVYA 4RNFA 4TY8A 2CUYA 4IO9Q 4HHJA 3GIMA 5C42A 2WVBA 5E41A 2E8AA 4ALZA 5LM7E 4K43A 4X64K 3TU5A 2J9DE 1T02A 3UN2A 9RUBA 4ZPTR 2R7UA 3RMBA 2FY8A 2N7CA 1VQLN 3IKMA 5K9FA 4HTUA 3CCQS 1TKXB 2W4DA 3MGJA 2LQBA 4KGMA 3F73A 2FVRA 3GSIA 1NGJA 1C1CB 3GG0A 3FQLA 1FDAA 2UUCF 5KFXA 2IM2A 3TANA 1IVZA 4P72A 3UO0A 2R2RA 4QYZJ 2W9CA 5FRMA 1S97A 2O3DA 3QFHA 5IT9Y 1UZDA 1JL1A 1ZAVA 2O01C 1HR0K 2K1RA 1MW7A 4JV5K 1SQFA 2YX7A 4O3QA 4LFBK 3HZEA 1QZ6A 2KRBA 2HGMA 3W66A 5EWEA 4H0OA 1KD1T 2WHOA 2XLJA 3EZWA 2W2QP 2HQGA 2PI5A 2YX4A 3R5CA 3GILA 1UA1A 1RNHA 2HQDA 1QLNA 3HTVA 2QI2A 1F9HA 2DITA 4DG1A 1SQEA 1RHMB 3DU6A 2Y3YA 3D1HA 2OP5A 4BDPA 4UUXA 3MCSA 3MMAA 3GJSB 5FLXY 5KFSA 3KOAA 3U9DA 1X9JA 4LD0A 2P5VA 2RQCA 2RS8A 1NGFA 3SEOA 1KSPA 2FBXA 4WXOA 3C15A 1NOZA 1KVAA 3NMUA 1FVSA 1DBDA 2BA9A 4EI2A 2BGGA 4L76A 1HW9A 2R2UA 5F0XA 3DLGA 1YJVA 5L46A 4AQYK 5BYSA 2BKOA 3CCLN 2HVDA 3UKUA 3QWPA 2F8SA 1R27B 1EB0A 3S3OA 2GTDA 3SMPA 2IY5B 3QIPB 2NYIA 2DK2A 1X4FA 2IYIA 3O9QA 4U8YA 3G10A 2R7XA 3L4BC 4KKOA 3HJFA 5EUHA 1YJNN 2DH9A 1VQ9N 4AM6A 2VG5A 3UR0A 1Q95G 1MSWD 4DSIA 2IDEA 1C0TA 3MF5A 4DR1F 2VFSA 3MR7A 1VQ6N 3I55N 4GW6A 5F1XA 1NK8A 4JI8K 2M4MA 2Q6CA 3Q23A 2IAJB 1RAEB 2LEAA 2A3JA 2VASA 2DNPA 3AO5A 4FP9A 5C12A 4URGA 4DQQA 3CDUA 4JI2J 2ALZA 4CGIA 2K06A 1BA1A 1TELA 3MMJA 4LFAK 4LY7A 3ONQA 4F0MA 1Y97A 3L3UA 1QTNB 1GOBA 3DAWA 2QC3A 1UFKA 4EIAA 1SVDA 1Q9XA 2HNZB 1NKCA 2QK9A 1X5PA 1WB9A 3BO3A 4CO4A 1NHVA 2KTQA 2VDHA 3RB6A 3NP5A 1NCLA 2AJFE 3J81O 2D3O1 3O6QA 4P2SA 3G8SA 3ZT4A 3PVXA 1RWVB 3GZ7A 1OH7A 1KS2A 1VQPN 1RT5B 4E8UA 5D15A 3TARA 1CSJA 3Q8YA 4TU9A 5IQQA 5HROB 5KG1A 2ZF5O 3DOKB 5J1EB 1RAAB 3BQ1A 2FC9A 3K9JA 3KDOA 5DMRA 3BGUA 4DN0A 2LXIA 4AYBD 2R7RA 3AO3A 1T9TA 3R27A 3GE9A 4X4OA 3DLLQ 2DR6A 2RVJA 4C8NA 3ID6A 3VWSA 3U4LA 2G0CA 3PYEA 2K3KA 1QE1A 4K4YA 1VHXA 1SC4B 1N36K 4ED4A 2IGIA 4DV1F 1YT3A 3N5BA 1SIWB 3SV4A 1U04A 2YHWA 3S3NA 4HKQA 1KHVA 1N54B 1EETB 2GGPB 2HQFA 4DV7J 1L3KA 3MCPA 4M63C 1HBOB 5AZJA 1JLGB 5LL6d 1HJRA 1KVKA 3EZ5A 4CNZA 3M1VB 2UVWA 3HD2A 3SAFA 1NB2A 1Z4UA 3T5LA 2O8FB 4NLPA 4K4SA 5CA5A 4BRLA 2AW0A 2BM0A 2DGXA 2KN4A 4B3MF 1PJ7A 4U8VA 2OAUA 5AQYA 2ZBCA 4DJBA 2HS3A 2NXEA 2MJUA 2F9WA 4TLQA 2PE8A 4PXEA 2YX6A 3LWLA 4CM2A 2OSRA 4JUZA 4DX5A 5T41A 3THWA 2HAIA 1U1LA 5GAEU 3TTCA 3GQCA 1NLVA 3CCZA 2X1AA 1NZ8A 3D3BJ 1SH2A 2NRZA 4JRPA 1XNQF 5JUMA 4DUZJ 4ED3A 3CCES 1EQ0A 1DT9A 4HH0A 4FLUA 4F3OA 5LMNF 4L73A 4LF5J 4JD2A 4HHUA 3T1YF 3DRRB 2PMHA 3FEZA 2AJQA 1IQZA 1VJWA 1YVFA 2F96A 2KXHA 1ZS6A 3CYMA 3OL9A 2A10A 4UW2A 1L3SA 4I7FA 1OKJA 2HHPA 3AVKA 1FTCA 2D4WA 1KOOA 1T03B 2U1AA 4X4NA 3PIPL 2EHGA 2D1CA 1IWGA 3I31A 4J37A 4OYXA 4DPXA 1HQ2A 2R8JA 4RBVA 3OHBA 4JYAF 2V2ZA 2XULA 4DV6J 5AQSA 4FXVA 4PPDA 2IIRA 3TX0A 4DTSA 1FFSB 2XS2A 3BH7B 4C98A 2YNIA 2GCFA 1EHWA 5AFUH 2DGUA 2JC0A 4U95A 4UF4A 3UD5A 2DT9A 4ILJA 4H0PA 3OHRA 4CW7B 2UUBK 3P38A 1UAWA 4CLYA 1D0EA 5BPNA 3QEIA 2RKIA 1IKVB 1VC0A 2NUBA 4DZDA 4DR3J 4IDKB 4OZLA 3ZSRA 1RCXB 4J9MA 2X3DA 3QSIA 3HZ6A 4FJIA 4ZVSB 1S9GB 3K5LA 1TUWA 3V1OA 3ZSVA 2VBYA 4ICLA 3EM1A 3VQ5A 4GKJJ 2ATCB 2W7AA 3OBWA 1IJEB 3VR1A 3IRXB 2CPHA 1XJWB 5DRKA 4F04B 4M5GA 5IWAJ 1A5XA 2DNKA 1T11A 3D6RA 3LGNA 1SZ2A 1RLCL 3VN5A 3VGMA 2XSJB 4DCPB 3DKDA 5KT6A 3ELHA 2LA6A 3CB4A 1MNEA 1BWFO 1GTEA 4B1WB 5IM0B 2OHDA 4J2DA 2D1KA 1A5WA 1FX4A 4FW2A 4IOBA 3MMAB 3SQGA 3MFHA 5LJVA 4YOUA 4WPAA 3ZZPA 2JEGA 3UKRA 1T95A 2MJNA 1KAYA 1NMDA 2BQRA 3ZTQA 1RBOB 1S6PA 4A4JA 5KT5A 1Y5IB 5BR8K 1VQ7S 3R8YA 3THXB 2XC9A 4LMZA 4RW6B 1EIYB 2E1CA 2VFVA 4R25A 4CWBA 4DV2F 3CMQA 1S1VA 2NRWA 4KHPJ 1XMOJ 1X5TA 4FNHA 3OJUA 4LC9B 4J9UE 4AL6A 3L3CA 3BGFA 3P49B 2ROPA 4QIEA 2CQ4A 4CH1A 3G6EN 2G0JA 4CF8A 3NGKA 4ZN3A 4CZGA 4YOWA 3D1QA 3T5JA 1L3TA 1HNZF 1N0VC 4B9MA 3BPSP 2B9XA 2O4IA 3OL7A 3IM8A 5LSRA 3TOQA 3RU0A 1HNXJ 2QWPA 2FHJA 4GC6A 5CZ2A 4GY2B 5AJ3K 4HH1A 1VMBA 1VQMN 2I6WA 1U2VB 1WHYA 1RHUB 5RUBA 1DLOB 4GKKJ 2DHXA 1U2RA 3FDSA 1I3AA 4B3TJ 5IV3A 2J7KA 3FCVA 3BV8A 4MQ3A 5ETQA 2HPUA 1KRPA 1JLEA 1U24A 5AQXA 1QJHA 1VSLA 3R97A 2FZCB 1TKTB 1VSJA 3I5CA 3KG4A 4C8OA 3LP2B 2FBYA 2FVCA 3CVKA 4CJWA 1XUPO 3DN9A 3TQEA 3HI9A 4K2XA 4OJ3A 1NJYA 3DDKA 3EY1A 3CFRA 2J8SA 2WVFA 1Q79A 2RMLA 2F4FA 3CJAA 3H2VE 3DYAA 4K5SA 4QYRA 3SLCA 1YAGA 5K8MA 1VRTA 1FWLA 2UXDK 1V6HA 4L72B 4OKJA 3PW5A 4JAXA 4B9QA 1RT1A 4KFBA 1JB0C 3CNQP 3K8VA 4PUOA 3P45B 3KHRA 3A13A 2EKYA 1XMQF 3EZOA 4CQ1A 4RW8A 4BG9A 1SUQA 1H0HB 2HWHA 4KREA 3IN5A 3QESA 1RTIA 5C10A 4J9VA 2HF4A 4WYLA 2DIVA 1QVGR 4YDXA 2UU9K 2NRRA 4EAHD 3NL0A 4FWPA 3MXJA 1TGOA 2DNQA 4Y6IA 4OZ2A 2NXCA 3JYTB 2RD5C 2KJWA 1KP6A 3N6NA 4JI1F 1BHLA 2GQCA 1YVNA 1HBMA 2JH3A 2CA9A 2RHKA 1J54A 3VETA 2MY8A 2SXLA 4UQTA 4Y34A 4LF6F 1ITPA 3UI3A 5CD4A 1V3ZA 5D0HA 2ZH5A 2L9DA 4NWBA 7FD1A 1UVLA 4KI6A 3M5RA 2ZNYA 1RUSA 3QZ8A 1RDBA 4G3IA 1EAYC 4DCOB 1HHQA 1HIYA 5IFMA 2J6TA 4XEIA 4KO0A 3C6AA 4IG3B 1FESA 4K4WA 3UNGC 1VC6A 4JI7F 4NLOA 2HMIA 1T8EA 3R8EA 4J9SA 2LU1A 4KBIA 5EWGA 3QEVA 2GUPA 5HOOA 4M3YA 3QO9B 4A5BA 1VOMA 3H3OB 4KT0C 5LJWA 4MH8A 2A6OA 1REGX 4MMOA 4WF9Q 2HBQB 2HZAA 4ZLJA 3P6YC 4LRBA 3HRGA 4ID1A 1LAVA 2BACA 5A8WB 3IGNA 2E29A 1S4EA 3IBFB 4CZCA 1ZBSA 5AQLA 2KT5A 3CF5L 3FC9A 3PX0A 2BH1A 2B5JB 5BJRA 4NEZA 2GIFA 3IO1A 4J8FA 3MAQA 4CCHA 2V9WA 1CG2A 1W7WA 3D2EA 4FNIA 4LF4F 1RWKB 1YHQS 5CQGA 4LRCA 2H9ZA 2EEYA 1H2UX 3ZTPA 3UCGA 4OIXA 4FVMA 3C14A 5M1OA 3BYRA 2QEXN 3OYFA 4H4OA 1WHWA 3P1GA 3BF1A 1G15A 4TQSA 4OZ0A 1UL3A 2GZOA 1KQFB 3CCVS 4FN5A 5DQGA 5J2QB 1MA9B 3CFOA 3LA0A 4XAKA 1X4HA 2P6TA 3GIJA 2C28A 2AJ0A 3NNHA 4CJLA 3UNYA 4BE2A 4O4GB 4CESA 4DLGA 2IYGA 2VA2A 4Z4CA 2GIQA 3A2FA 3CTRA 1LEOA 4DV0K 2CNOB 1JJ4A 4LQ9A 4LF7K 4NLQA 3VGVA 4H4KA 1S10A 4ECXA 5A0YA 5A76A 3VA3A 1W7AA 4FYVB 2ITMA 1O5JA 2CJBA 2DFFA 5E7OB 1ATSA 1K8AT 2GJFA 3MHYA 1SQKA 1OY9A 3VMFB 5M1FA 4AHVA 3L7UA 2JEIA 4X66K 5K5MA 2HNDB 1N6QA 1Y4ZB 2ZZTA 4CEQA 3CDAA 3T6JA 4EUVA 4C2MA 3JSYA 4CO0A 3UIQA 4AL7A 1FRXA 2YQ3A 1N32J 1E6YB 1SL0A 2D0BA 4CZMA 3U1MA 5K8NA 2KU7A 3FSXA 4QW8A 1URRA 3B6PA 2UUTA 3AD7C 3TSQA 1EP4B 2B9EA 4DTMA 1H72C 3M6GA 1MN9A 4QQBA 1NU0A 1BUXA 3J7Z5 3HT0A 4CLZA 5AQWA 5G4DA 2V8HA 4HT7A 3B8HA 4R5PA 4PWDA 4QWDA 5GAHP 3DI6B 4I9LA 4LF8K 2DD8S 2HBMA 2OTJN 5KFQA 5J2PB 3CIZA 3R1XA 4GO7X 3O3HA 3VEZA 1QSYA 2MB0B 3D54A 1RAIB 2RPIA 3M7VA 3T19A 5C7PA 1NSQA 4PR6A 3CXCR 1SV5A 2A1SA 4XDCA 2CPEA 4MK8A 4KHQA 2E44A 2MXYA 4A8WA 3ITHB 3V6HA 4YOVA 3FZ2A 2F40A 1X4GA 4Z4EA 3P5BP 5AZIA 1SI9A 5KFHA 1L3UA 1S9EB 3V81B 3ICLA 3CCTA 4JI4F 2M8DB 2KQ2A 2AZ3A 1NHKL 4IR9A 3ZSOA 3U1NA 1Q86T 5CE3A 4XDDA 2M9KA 1KD1O 1QVFR 5J2MA 2VFRA 5HL7Q 4A5AA 1B7YB 4NI2A 1NMEB 2V8DA 2H5EA 2MLYA 4BRCA 3MXMA 2XO6A 4OPJA 3AVJA 2P9CA 2NXNA 4OYZA 2PO4A 2KHOA 5K20B 3I5BA 4RUBA 3LP1A 2QMUB 4ZLNA 1UWBB 4DU3A 5LMUJ 3M30A 5L1JA 2CYYA 3AA5X 4X4PA 3KYLA 1C1AA 3OT9A 3CGIA 2YNFA 4KBOA 4O3OA 4DQPA 2IC3A 3ZEUA 1H98A 4UOCA 4DTOA 2BUPA 2QV6A 3G25A 2CZVC 2NCKL 3BS9A 2R2SA 3F5TA 4EEYA 2GFFA 3HHNB 2HZVA 4U7UD 3QWUA 3JSMA 4O55A 5M1KA 5JVHL 2ZDOA 4M3RA 3SDEA 5B0BA 3M9MB 1WTFA 3VQ6A 3OYAA 2KHDA 2WBMA 3UDCA 1BQMA 2BANB 3QJPA 2AHOB 2CKWA 1M1HA 3VEVA 3U1LA 3JXOA 4X4TA 4CJVA 2E20A 2QWNA 1ZBLA 3UN5A 5MAOA 3BKTA 3W9HA 2WFBA 4ECRA 3A4TA 5F8NA 4PABA 3OYIA 4JI0F 3H25A 2MZTA 4IUFA 1B9FA 2J7WA 2WB1D 4PWUA 2JZ5A 3G6YA 4FJXA 1JJ2R 2QXLA 3AV9A 3T1YJ 3JSRA 4B3RJ 1WF0A 4KH0B 4YP3A 3V1QA 4ILMA 3BKUA 3NDKA 3ZSQA 2C3MA 3EYZA 2V7YA 2HBJA 1DEJA 4CLWA 3A5LC 4CGGA 3Q8RB 4EZ6A 2GMJA 3RB4A 4MYUA 3FSYA 4N77A 3CMAN 3IWXA 4DSLA 1U09A 1J5EJ 5KFNA 2OUGA 3OPKA 5LY3A 2VCPA 3R7NB 3IR7B 5F3ZA 1NJZA 4DR7J 2NR0A 2DGWA 2PFFB 4FJGA 1RBUA 1A6LA 2CQ3A 2CPIA 1RWUA 2YXLA 3CQXA 4Z4GA 2KRRA 3VVUA 1O1WA 3QIOA 2QZ8A 2OYQA 3DC2A 2HW3A 2FC8A 3R2DJ 2ZJRL 2YH1A 2ZGYA 3KFWX 1KVJA 3LDPA 5CCMA 3A5NC 5IT9U 2CPFA 3W1YC 3PIPQ 3PO5A 2CWKA 1MU2B 3T41A 1NGCA 2RB7A 1RAFB 5KRSA 2ITGA 3CPEA 4KHMA 2W9AA 3MOJB 3TJ9A 4JEPA 2HBLA 4YB6A 5LSOA 2V2QA 2ATQA 5F3TA 3K59A 1IBLJ 4MK7A 3DXSX 3PW0A 3W9JA 4L75A 3UFCX 2R7TA 2NYHA 1TFYA 1RT3B 2P9EA 3ZZYA 4BY9C 3G82B 1DHMA 4FDFA 2B7BB 4K50A 3W7BA 1RT2B 4FXWA 4WCEL 4R8UB 5FLXU 1N33J 4JI5J 4LSZB 1N52B 2HS4A 1NGDA 1REVB 2BXJA 4H4OB 1XTZA 1TTHB 2V0NA 1RI7A 1RBSA 3VVTA 1RABB 2ACYA 2L9WA 2HBZB 3J81j 3OW2M 4PQUB 1F2HA 2AF6A 3W0LA 3NF7A 4CFBA 2HHQA 5KFOA 4O0JA 3ZFVA 1RJJA 2WZ1A 4DR2F 1FXLA 1IQTA 1S7IA 1HD0A 5MLCQ 1GLBG 4FZVA 2GHWA 3MFIA 4LF9F 2O8DB 2H54B 4DV3F 3MMVA 4CHZA 2W41A 1IKYA 3BUZB 2X1GA 1B92A 4DR5J 4CYUA 4MO4A 4DV4F 2FHJD 3H0PA 3MK6A 2WW8A 3H7HB 4MLEA 1BI4A 3AAQA 4ZLPA 4WP8A 4BWMA 1AUSL 2W2NP 2FVQA 1HWJA 1KLNA 4CZEA 3I8BA 1NSAA 2BRLA 3MM5B 2ZFHA 2Q2RA 1D9DA 4J91A 4KY3A 2POKA 3BPDA 1FW6A 2ZH4A 3K57A 1CULB 3T9ZA 4YY3F 2JRSA 5BREA 2FC0A 3GOIA 4BACA 4PA1A 5GADU 3NCIA 3ZX2A 1NKBA 3MWPA 3D2WA 1QY7A 3MN6A 1NK9A 1XR5A 2HFSA 2GIRA 2V7ZA 2XWXA 3BBBA 1KFDA 3H5YA 2ZHOA 5FROA 2IDLA 4Z7YA 2MSSA 3CD6N 2E9ZA 2J6UA 1HPMA 1FERA 3MXIA 5C15A 4NZ6A 2QA4N 5FDLB 1I39A 3SCXA 4RUHA 4QU6A 1HWUA 4KIAA 3SCIE 1RA7A 1LXNA 2PN6A 2G1DA 1CJTB 2B9WA 1ZA1B 4M5DB 5D78A 4M5LA 4DU7A 1HI0P 4B9UA 4RR5A 4DN9A 2XBPA 2Z2LA 2AKWB 3CC2S 1NNEA 4CFDA 4ES3A 5AQRA 2KI2A 1ZZFA 3LANA 5JLFA 1APSA 1RHKB 4USWA 3CJKB 2J9DA 5DM7L 3F44A 3EDQB 1HKGA 4OZ5A 2E2NA 3EDRB 3K7RA 1DTTA 1SKUB 2E5LF 3S41A 3HHKA 3X1LB 4PXDA 1WI8A 1PAEX 1FKPA 4M5IA 3E66A 2HHHF 1NB7A 1CS4B 3L2UA 3DLKA 2IA6A 3ISND 4WP9A 3CCRN 3NCQA 1XR7A 1C4AA 3FRYA 4TYBA 1YRTA 2R7QA 1I94K 4TNOA 1KQGB 4TN2A 2YKNB 4LIRA 1JKHB 3S8SA 4ZJOA 1SBRA 5I3UB 2UP1A 3OFFA 4WK1A 3BSOA 4WTYA 1T9XA 4QS7A 5E26A 3TWHA 2GMLA 2CNKB 2DNOA 4NZ7A 2YNGB 4PQAA 1JNRB 1TK5A 5J1PA 1VSKA 4KI4A 1IBMK 4ECQA 1HARA 3NS6A 3VQCA 1JIHA 3V6KA 1HWIA 2IMOA 3AVIA 4YOXA 3VAGA 4O8KA 1WSHA 5H9EJ 1HYVA 2ABYA 2RQKA 2P9NB 1S0MA 2JVOA 3ZSYA 4HACB 2V8GA 4F25A 1NDKA 5AQGA 2G2ZA 4WTOB 2LECA 1RILA 4NA3A 3OYLA 4PEOA 2ZH6A 2DR8A 3ZEUB 2HHTA 3I96A 4H5TA 3BZQA 4F2SA 3GTYX 4CF1A 4NXMK 3QYYA 4Z94A 1W2IA 4NYNA 3P5JA 5E3QA 3WX4A 4XH4A 1H2VZ 3KK1B 2OPSA 1RTJA 3MEGA 2O8EA 2F8EX 2FHKA 3I82A 1WNEA 1Q5YA 3E2EA 4KGXB 4LF6J 3OQ2A 1N0UA 4W5QA 2MKHA 4WXWA 3HP9A 3OBYA 1N5TA 1KHWA 2VQFK 2AZ1A 4PG7A 1NSKL 4FM2A 1HKAA 3PW2A 4L3QA 4RTFD 3I56S 3NFAA 1BQNA 1SIZA 5B0CA 3KUHA 4E1NA 2PGCA 4S0MA 2FYXA 3ZNUA 4X4QA 3MD1A 3EMTA 1QAYA 2H65B 2BVZA 1JLFB 3NCPA 4ZDNA 2HAFA 1NGEA 5DG8A 1TZ0A 2AU0A 1UJ6A 4RBTA 3AY9A 4R79A 1XMBA 3UD4P 4EO8A 2V51B 1YI2S 2FHOB 1G1XA 1WBDA 5KI6A 1A7GE 1T7PA 2G8KA 5DDRC 2W8KA 2Q3PA 3R3TA 3R5JB 4C8YA 4E3SA 4FF1A 2YJEA 3A3NB 3HCXA 4NXNF 2DRAA 3S3MA 1S1WA 4CF9A 4KTQA 5E84A 4CIOA 2RH3A 3PX4A 1WBBA 4PKHA 2MLXA 4B08A 2V4JA 5I42A 4LVNP 5KFBA 2GWKA 1K1SA 4HVZA 2XTJP 5HN0A 4OX9J 1ELOA 4PG6A 3TZZA 1ULRA 3HHEA 4CLSA 4FSVA 3KG0A 1RLDA 2MKCA 2X1FA 1G7CB 3FFKB 4DTXA 2IJNA 2EFPA 4ID5B 4FM0A 1X9SA 1ZM4A 4YR2A 2ZHBA 3BREA 4KHWA 1PAUB 1PJ5A 1LWFB 3ULEB 4USUA 3I0SB 2ADBA 4G1PA 1JLQA 2AGOA 1N34F 1E4FT 5AQKA 3BGRB 1AFJA 2G13A 3QT6A 4IQMA 1H1VA 4NO7A 1UTAA 3PDNA 2IRYA 4CT9A 3LUYA 2ZM6F 2RF2B 2ZH3A 2BTFA 4ES2A 3PFEA 3R6GB 1PC5A 2KH9A 2ZZNA 3R5GA 1WSFA 3B6BA 5E2QA 2CVEA 4DR4F 1VQOS 4EMDA 1XEZA 1XNRJ 2P9UB 1HYSA 1IWAA 1S57A 2PIIA 4BBYA 4DR6F 1X4CA 4P2MA 4LFCF 4W98A 3MECB 2UXBK 4H4MB 2H1YA 3BGOP 1RKJA 1MWYA 3ENHA 3LP0B 4XPCA 2FJDB 4JI6K 3KHLA 4DLEA 2CPYA 2R3VA 3MR3A 3ATVA 1SC1B 1TV6B 3UR3C 5B0DA 1Y7PA 3POTB 4USTA 5LXRA 2VWBA 4F4XA 1QS4A 2Y1IA 4DFPA 1LKZA 1BMQB 3OS2A 1U2CA 1M90O 5CR4A 3BH6B 4LRFA 1TL1A 4K59A 1S77D 2AIRB 3M9OB 3PW7A 5SWMA 1BQXA 2BZ2A 2CGJA 4GVBA 4ED1A 5GAGP 5KAKA 2MQOA 3CIMA 1MMNA 2RIJA 3PHTA 4FZXC 3FQKA 4OI1A 3M8YA 3KKSA 3MM9A 1DAXA 4N41A 3JTPA 1I3OB 4BDYA 1NM2A 3TUJC 1HR0F 3MMBA 1VAZA 2A18A 4LBPA 3DRYA 3PNIA 4M5MA 4EP4A 3MUTP 4DFKA 4M63A 4BRQA 2C2KB 4OJHA 1FDDA 1IO2A 4K42A 3M2VB 3PKYA 2CPXA 1KLMA 1EARA 3PTWA 1GMUA 3ENAA 1FNOA 4LQ3A 4F7VA 4CTAA 3WDOA 4JS5A 2EG2A 1LW2A 2KDOA 1TKZB 2ILYA 4QWBA 2F4VF 1YTYA 1N48A 4EWTA 3GFHA 4OV6A 2HNYA 2B8QA 3I4HX 4MKBA 4F0KA 4C0BA 2AX0A 3MOZA 2KFYA 3NWRA 2F8HA 3VAFA 2YKMA 1U45A 4Q45A 1YVUA 1C6VA 4RNNA 3CQ8A 4KV8A 3TTDA 2P9KB 4DS4A 1GQEA 3VF4A 2ZJQL 4OLPA 4ZOSA 3OD2A 3U9ZA 1HNVB 2VBXA 1UWAA 3DLJA 4H0XB 5ETKA 1J5OB 3C0BA 2MY7A 1RAGB 4WE1B 1BDGA 1D9FA 3DMJA 1JLAB 5EN1A 5B08A 3TEHB 2C22A 4FJNA 1U25A 2OEKA 5L1LA 4F9O