3KK2A

Hiv-1 reverse transcriptase-dna complex with datp bound in the nucleotide binding site
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
555
structure length
555
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
total genus 156
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk2A05
2FVCA 3NBPB 5DLFA 3KLFB 3BQ2A 3AVCA 2IBKA 1ZYQA 4NLGA 3KHRA 2KTQA 1LW0A 4RW4B 4ELUA 2W7OA 1FXXA 1WSJA 4HTUA 1SKWA 2P51A 4KHYA 5KG7A 2Y1JA 3CFPA 1UA0A 3LDSA 4YR2A 4I2PB 1XR5A 3LPTA 1NK0A 3MXIA 3HVAA 4WFZA 1DLOB 2VG5B 3OYKA 3SQ0A 3VN5A 2DFEA 1BISA 5JXSA 4BE2A 1X9SA 3M9OB 3S3MA 3AVGA 1FKPB 4DG1B 4QWEA 5KT7A 5CYQB 5J2NB 5F8HA 5KFQA 3VQPA 4CJWA 4WZQA 1JLEA 4DS5A 2YV0X 1YTUA 4JRQA 4FLYA 4EEYA 5J2QA 3QESA 2B5JA 3SV3A 4EYHB 3ICLA 3NF8A 3TAMA 4DTMA 4FK2A 2GUIA 4N76A 4C8NA 2HNZA 3GIKA 2RN2A 4O0IA 1BGXT 2RF2B 3OYFA 3HP9A 5KFUA 1KLNA 3V9ZA 4FS2A 3O3GA 1WSGA 4I9QA 3I5BA 4OGEA 4Z4HA 3SQ2A 1A5WA 4O3SA 3NGZA 3G6YA 4CFAA 1NJZA 3I0SA 1S1VB 4K4SA 3I0SB 1KVBA 1I6JA 3OYBA 2ASJA 1QHTA 4Z4EA 1NK6A 4OLAA 2EC0A 4DL4A 3VQAA 2WONB 1BCOA 4J9NA 3OLBA 2X74A 2HNZB 5I3UB 3WNEA 3M8QA 2XY5A 3DRSA 4FLWA 1T03B 3OSNA 3AVJA 1IKWB 2ATLA 4GMJB 4ZP8A 2FLNA 1U45A 4CJRA 3DM2B 1QAIA 3NF6A 4CEBA 1IKYA 4EO6A 4NLYA 2IOCA 3H5XA 3SZ2A 1JLEB 1U4BA 4CJVA 2Y1IA 2P5GA 1XHZA 4FJ7A 4ZHRA 4MQ3A 1T3NA 3UR0A 4E1MA 3OYCA 3OYLA 3BSAA 3PHEA 5KFAA 4TQSA 5C25B 1S49A 3DLKA 1U09A 2XO7A 4ED1A 1KHWA 1XR7A 4CEFA 1LWEA 3L2RA 3WNFA 4ID1A 4ICLB 3PV8A 2B43A 3KMSA 3KIOA 3KNAA 2D41A 4Z4FA 3RRGA 3CIZA 4CEEA 3C6UB 3BQ0A 2R2SA 4LSLB 1JIHA 2OPSA 1D9DA 3T5LA 4FLUA 4CIGA 4M41A 3QETA 4H4OB 3PJXA 4B9SA 3OL7A 1Z26A 2E6MA 1ZTWA 1D0EA 1WSFA 3CO9A 3QINA 1S1WB 4DQRA 2HWIA 3VQBA 3CG7A 3VA3A 2UUWA 5KFPA 5EUHA 5E41A 4FJMA 1TV6A 3K58A 3KLIB 4I2QA 1RYSA 1ZETA 4W5TA 3HJFA 3DLGA 4IG0B 3QIPB 2R2UA 4IH5A 3N6NA 4ZVGA 1ASUA 5KFEA 4WE1A 2XC9A 4M3ZA 4H4MA 4NYZA 4R5PB 1HARA 1B9FA 2IA6A 2E9TA 5CY4A 4K4XA 3ZSVA 3NCIA 3SI8A 1TV6B 3NKYA 3ULDA 3DLEA 4CERA 4LQ3A 1C1CB 1RTDB 3AA3A 2BE2A 2AGOA 4K4WA 4M45A 3VQ6A 1IO2A 5KFYA 2KQ2A 4IKFA 3L2QA 4KKOA 5HRNA 1D8YA 1KCFA 3KLEA 3QGIA 4O5BA 1LW2A 3T5KA 4MKBA 4CHZA 3P5JA 4WXWA 1T05A 1VK0A 1VSKA 1S1TB 2WHOA 1JKHA 1NOYA 1KHVA 3HYFA 1S4FA 2W9CB 3FSIA 3VQCA 4DMNA 4QW8A 3CJ0A 4BWMA 1ZBFA 5KFVA 1SKSA 1KLMB 4NLQA 1C2PA 4K4UA 4NYFA 3M9MB 5C25A 1L5UA 1WNEA 4B9LA 3V4IB 4KFBB 3RRHA 1S97A 2W9BA 4NLOA 1HMVB 2VG7A 4FJGA 3ISND 4KPYA 4GC6A 4KRFA 2XY6A 2OPRB 4TYBA 3FDSA 1IH7A 4IDKB 4CF9A 3AVAA 4ECTA 4MK9A 4RNNA 4RU9A 2XI3A 4PY5A 4NZ0A 4NLWA 4CEAA 1NK5A 4CEDA 4KHSA 1S9EA 3L2VA 2YNHB 3NL0A 3FQKA 3H40A 3DLKB 5D3GB 3S3NA 4ECQA 5F9LA 3V81A 4J9KA 4CJ4A 4E3SA 4CGGA 4NLPA 1QQCA 4FJJA 3LZIA 4O3QA 3KHGA 1VSEA 4CE9A 4KE5A 3OYMA 1EX4A 3QGGA 2Z1GA 4JLHA 5KFKA 1S0MA 3OYJA 1S1TA 1BQMB 1JLBA 1TVRB 5KFJA 3ZSQA 4IBNA 3MFIA 1RT2A 1L3VA 1RTJB 2FC0A 1S1UB 2R2RA 2ILYA 1VRTB 1XR6A 4ID5B 4O4GB 2OYQA 2ZQBA 4ED2A 4O44B 1RBSA 4PQUB 4YP3A 2W9BB 3ITHB 4JS5A 1NK9A 3H2LA 3AVFA 3QEWA 2BE2B 3V4IA 1QTMA 2D7SA 2J6TA 1LWFA 3DOKA 2G8WA 1KFDA 1L3TA 3QO9B 3QZ7A 2OH2A 4ZVEA 2XCPA 2AGPA 3HVTB 1EKEA 3NAIA 1TL1B 4PUOB 3RB6A 5L1IA 4DTOA 3JSMA 4N41A 3SNNA 4CK3A 4NCAA 5HLFA 2FVSA 1QS4A 4ED0A 3QIDA 3TAMB 1S10A 1TAUA 3PVXA 1Z4UA 4DQSA 2D3UA 3G86A 4KI4A 4Y1CA 1U04A 4ED6A 4ELTA 2HNYB 4FJKA 3DLRA 3GV8B 1BQNA 1R0AA 1N5YA 1XWLA 5SZTA 3KK2A 3AVBA 3LWLA 3BDPA 4RW4A 2WOMA 1TP7A 5KGWA 4DTXA 2ETJA 2W9AA 4MIBA 3NBPA 3PUFA 2KFNA 1HYSB 4FZYA 4Z0UA 3MFHA 2FJVA 2IAJA 3ZSYA 5F8MA 3NHGA 5K14A 3H5SA 1IKVA 4QW9A 3DOLA 1TKXB 3E01B 4CK1A 4J9SA 3QIPA 1S1XA 3PW2A 1RTIA 1TK5A 3QEPA 2FJXA 4TY9A 4ZTJA 3DLHA 2V9WA 1N6QB 1IG9A 3SQ4A 2F8TA 1UA1A 3VQSA 4Z4CA 4NLTA 4E7IA 4DSKA 2XGPA 3CWJA 3RMBA 4BE1A 4FLTA 3ZSZA 1KFSA 1W0HA 4IFYA 1C0TB 4F4XA 4KO0B 3KKRA 2BRLA 2X78A 1TKDA 4Z4GA 2VWKA 4B9TA 3K5OA 5F8LA 4B8CA 5DMRA 3BGRA 4MK8A 4C8KA 4KTWA 2C2DA 1WNSA 5KT4A 2VA2A 1KVAA 1LWCA 4R8UA 1D1UA 2I5JA 1LWEB 3U3GA 3OYAA 4DL6A 1VSFA 4TN2A 3TAQA 4EBDA 3TR8A 2WONA 2P1JA 4FBTA 3IGNA 2O5DA 2WOMB 3N6MA 3GQCA 4URGA 3MR3A 1Q9XA 1BHLA 4RW6B 3M8RA 4F50A 3T1AA 1VSDA 2OPPA 5CZ1A 3DM2A 3VA0A 2JC1A 4DLEA 1SV5B 3RB0A 1IKWA 4M3YA 4Y2AA 3ZSWA 3QGHA 1T03A 3LALA 3L8BA 2KW4A 4F2RA 2Z1IA 1NOZA 4J9RA 1RT2B 3V9UA 4LSNB 4B9MA 3L2UA 1S6QB 1MU2B 1RNHA 4DFKA 5J2QB 4QOZB 3KJVB 1TGOA 3ZSXA 1J53A 1TL1A 1RBRA 4FM2A 4TLRA 4DTUA 3T19A 4FJIA 3DRPB 5EWEA 2CKWA 4N47A 1LWFB 3DOKB 3M8PA 4B3OB 4E7HA 3CJ4A 4W5OA 3CJ2A 4FLXA 2HVIA 2XWYA 3DI6B 1TL3A 3ITHA 5DGBA 2D0BA 1KRPA 3JYTA 2IM1A 3SFUA 4RW9A 4W5QA 3HVWA 2FVRA 1TQLA 1TKTA 1XHXA 4FJ9A 1BQMA 1KVCA 1JLBB 4RW8A 1I3AA 3N6LA 3EPGA 3K59A 1RBUA 2UVVA 1JLQA 1JXBA 4RW6A 3B6PA 2HHWA 3QNOA 4WYWA 1NJXA 4I7FB 3RWUA 2HHSA 1L3UA 3TARA 2DPIA 2VG6A 4NYNA 3LP2B 1O1WA 3AO1A 4FM1A 3ZT1A 3DRRB 3AVIA 3FFIA 3HSTB 3QEVA 3QIOA 5HROA 4JV1A 3TVKA 3U6FA 2I5JB 1W9HA 3BR9A 2DY4A 1TKXA 4BACA 3LP3A 3U3YA 4O3PA 2C2EA 3VQ8A 3AA2A 3AVHA 2RKIB 3PW4A 2J6UA 3V1QA 4CGIA 2YNIB 2OPQA 1I39A 4KI6A 2YHAA 3HXMA 2JEIA 4PWDA 1SL0A 5DQGA 2VG7B 1HMVA 4OPJA 3KD1E 4CJ3A 3NH2A 2E9ZA 2I1RA 3AO3A 4ZPBA 3DYAB 2O4GA 2KZMA 4KB7A 3CDUA 1RTHB 3ZT3A 4OVLA 2IDOA 5KG6A 3OYEA 1RTIB 1HQEA 4RUAA 4Q8FA 1JKHB 2KFZA 2BANA 1J5OB 3RMDA 1IKVB 4DL3A 5DK5A 3LP1A 3LP0B 3NAHA 1TKZB 5DQIA 3H4BA 1RT4B 3TAFA 3PZPA 2A1RA 4LQ9A 1NJYA 1QSLA 2PY5A 1ASVA 4Y3CA 3K5MA 2B6AA 3V6DA 2GIQA 2IJFA 3MECB 3IG1A 4FJ5A 3ZSOA 4HUFA 2IM2A 3HPGA 4QWDA 4DTRA 4CJSA 3GILA 4CJEA 3V9XA 2QKKA 3EZ5A 3KLGB 4ZP7A 3RB3A 1VRTA 1RT4A 1QE1A 2FBXA 3LP0A 2XY8A 5F9NA 4HUEA 1RDCA 3T5JA 4BE0A 5KGXA 3M9NB 5FRNA 4E1NA 4CFBA 4K4VA 4J9OA 3DDKA 1U49A 1FKOB 5T7BA 3ZT2A 4CJ5A 3RAXA 2W7PA 1RDAA 1K1SA 1RT6B 4FZXC 4NLVA 1NHUA 1QSYA 4H4OA 3TAEA 1YTAA 2G8HA 4ID5A 1X1PA 3GYNA 1RDBA 1RTJA 5KFRA 4CGFA 1NK7A 3THVA 4U6PA 1UWBA 4DQPA 3ZCMA 5C24A 1UWBB 3RTVA 1VSJA 2AX1A 5FRMA 5HP1B 4BDYA 1JLCB 4EP4A 5KFDA 3SV4A 5KFBA 3SUOA 3UQSA 3AO5A 3LP2A 2D0CA 4CGHA 1ITGA 2R8HA 1YT3A 4DS4A 3H5UA 4KTQA 3T3FA 3K57A 3HKWA 1VRUA 2OA8A 2W8KA 1S6QA 3SUQA 3V6HA 5I3UA 5KFIA 4FJHA 4O3RA 1EXQA 4HHTA 3F9KA 3CFOA 2B5JB 4MIAA 1SUQA 2PYJA 4KHWA 1JXEA 2JEJA 1RBVA 3DI6A 1HNVA 2YNGB 1GX6A 3FRZA 3H5YA 2BQ3A 3V6DB 5L9XA 3G6XA 3DRPA 4CEZA 1S1VA 1FKOA 2FBVA 3OVNA 5KFSA 3V9WA 5KG5A 2BR0A 5KFNA 5KRTA 4DSIA 3KJVA 2ZE2A 2WCXA 4ECRA 1C1BB 4RNOA 3PX4A 1LAWA 2YKNA 3MTKA 4DU1A 1RA7A 3I0RA 2AQ4A 3V1OA 3AVNA 4CHPA 4YQWA 1RT7A 3HP6A 1S6PA 3IG1B 2HHQA 4N5SA 3BGRB 1HPZB 4FS1A 4K8ZA 2QV6A 5DGAA 3KD5E 5SWMA 5CYQA 3O3FA 5J2PA 3TAGA 4DG1A 4J9LA 3BSNA 3QZ8A 3KK3A 5HBMA 5KFOA 5JUMA 2ITGA 3DLBA 4ELVA 1TKZA 3EZUA 1RAJA 2RKIA 5JS2A 2ZD1A 1HNIB 2R8IA 3TANA 3G0ZA 3PX6A 3TABA 3O4QA 3K2PA 1W25A 2O4IA 4DSEA 5KFWA 4RW7B 3CJ3A 2NUBA 1RYRA 4FLVA 4NRUA 3DLGB 4IG0A 4DFPA 5I42A 2HMIB 3KMQA 4NLUA 4CF0A 2BDPA 4C8LA 2GBZA 2OZSA 2UVRA 4F2SA 1JLFB 4FXDA 1NK8A 3PO4A 5KFLA 2V4RA 4IFYB 2RPIA 4DTPA 4CIEA 1LAVA 3Q8QB 1TK8A 3RMCA 3HL8A 5J2MB 2E4LA 2HNYA 5HRSA 4Y34A 3SFGA 4FJNA 4RW8B 3OHBA 1QUVA 4IRCA 4OKKA 1S9GA 4AHTA 4ED8A 3IS9B 3KKSA 4FM0A 3E01A 4ICLA 1RCHA 3K5LA 3I0RB 1D5AA 4RW9B 4BDZA 1JLAA 5HLFB 4CJTA 5KFGA 4Y2CA 2IAJB 3KTQA 3SYZA 2G8KA 1RT1A 1TAQA 4WYLA 2C22A 4IQXA 4DU3A 1T7PA 3M8PB 5J2PB 4TY8B 3QO9A 1HRHA 4ZVHA 4LY7A 4B9NA 4FJ8A 4M3WA 5KT3A 1JLQB 2R8JA 4O3NA 4F4YA 1CZ9A 1K1QA 3PW0A 3M8QB 5DQHA 1RT3B 4J2EA 1RT3A 3H08A 2JGUA 3MEGA 4DLGA 2G8IA 5J1EA 3MXJA 1TL3B 3OLAA 4DL2A 3QEXA 4DQQA 4J2BA 4NLSA 4KHNA 3ZT0A 4E19A 1ZBIA 2X6SA 4F3TA 2ALZA 3LPUA 3VQ5A 4K50A 3Q8SB 3NF9A 1NKBA 1X9WA 4M94A 2HVHA 5KG4A 3V81B 4OPKA 4IRDA 3HPOA 2RF2A 4FW2A 4U7CA 4DTJA 1Q9YA 1Q8IA 3G6VA 1EETA 3OY9A 1D9FA 4HCCA 1B92A 3K5NA 3HPHA 1BIZA 5FDLA 1DTQA 5C24B 1VRUB 1SV5A 3HT3A 3QLHA 3RBDA 1K6YA 4LD0A 4KSEB 2XY7A 3SPYA 2XI2A 3AVKA 3GIIA 5J2MA 5KFXA 4KBIA 3MXMA 3ASMA 2FLPA 4CEQA 4NCGA 3LWMA 4ZPAA 5JS1A 4KFBA 1KTQA 1JL1A 2W42A 4CF2A 4YR3A 4IR1A 3NMAA 4CFDA 5D3GA 2GIRA 5L1JA 3LANA 4DWIA 1CLQA 1KLMA 2P5OA 1JLCA 1DLOA 4H54A 3UPFA 3CJ5A 4RNFA 1S9GB 4F8RA 5L1KA 3DOLB 3IAYA 4DSJA 4F3OA 4GVMA 2YNFB 4EBEA 2ATQA 4KHRA 2XGQA 3MEEB 1LW0B 1RDRA 3KK3B 4JV0A 1HYVA 1GOBA 1ZBLA 1G15A 3SCXA 1A5XA 4FJXA 2OZMA 1R0AB 1BQNB 2W8LA 3AVMA 4O0JA 3I5AA 5DG8A 5I42B 2HMIA 3C94A 4NCBA 4KAZA 1IKXA 3TQ1A 4IFVA 1RT7B 4G1QA 5KRSA 4FCYA 4M42A 3D28A 4WE1B 1T05B 5K14B 1NNDA 2UUTA 1C6VA 4YMEA 3Q8PB 1NKEA 3KLGA 4CCHA 3WNHA 1HJRA 4CJLA 3M8SA 1T8EA 2EHGA 3HVRA 4EBCA 3H98A 1VSHA 3RMAA 5F8NA 3AO4A 1N5YB 3KK1A 4K4TA 1WSHA 1N4LA 1S1WA 1ZTTA 3D5MA 4MFBB 1NKCA 2FVPA 3BQ1A 4CJFA 2OPQB 1Y97A 2Z1HA 3C6UA 3L2WA 4M3RA 3LP1B 3GV7B 4I9LA 1JL2A 3CDWA 1C1BA 3IGVA 1TVRA 2BQUA 4ECUA 4AHRA 3JSMB 2JLEA 4KAIA 3I8DA 2FVQA 3EY1A 3SUNA 4J9QA 3PR4A 3KLIA 4I2QB 4CK2A 3OYGA 2AX0A 3VQDA 2PYLA 4UQGA 1CZBA 1C0UB 4ZVFA 1ASWA 1NHVA 4ED3A 4DL7A 2Q3SA 3I5CA 3PW5A 2JEGA 3IRXA 3SPZA 3QERA 3EPIA 1B9DA 5HP1A 4URQU 4M95A 4RUCA 4HYKA 3RR8A 3L3VA 2XHBA 4FZZA 5DG7A 1Z25A 4AILC 2WB4A 4DSLA 3C6TA 4Q43A 1GOCA 5FDLB 2DPJA 4IDKA 2IM0A 1HQUA 3MAQA 1ZBUA 3AA4A 2EX3A 4NRTA 4AH9A 3H59A 3RB4A 2XRIA 4DTSA 2G8UA 3OSPA 1WSIA 5KFZA 5KFCA 3AV9A 4CJKA 1NJWA 4KB1A 4B3OA 3KLVA 3VQEA 2VWJA 4QWBA 4ECWA 3QLHB 4IRKA 3T5HA 4Q5VA 3D0PA 4EZ6A 3OS1A 3NDKA 2HNDA 4KB0A 1QE1B 4BWJA 1EETB 1U48A 2BQRA 2F8SA 1UOCA 3GIJA 4E89A 4CF8A 2HHXA 4GC7A 2OPPB 3BREA 1REVB 4QWCA 2FJWA 2JEFA 3VQ4A 1WAFA 3MR2A 2HAIA 4WXOA 1GOAA 4Q0BA 1FK9B 2X6NA 3G10A 3QYYA 5DLGA 4B9UA 3TAPA 2WK4A 5KG0A 3V6KA 4JS4A 5KFFA 4J2AA 4FJLA 1VSLA 4ED7A 2E6LA 2YKMA 2IMWP 3AA5X 3NH0A 4CFCA 3KLEB 4YR0A 2FBYA 4Q8EA 3KLHA 4OGCA 1C1CA 1RTDA 3KK1B 3LAKA 4KO0A 3L3UA 1S0NA 4HCBA 5J2NA 4N56A 4CJUA 1BCMA 4PWDB 5KT2A 4DTNA 4FK0A 4LSLA 3KHHA 4NLDA 3CDEA 2QK9A 1S5JA 4OJRA 3GIMA 2IGIA 3VQ7A 4AHSA 2DFFA 3NGDA 1WAJA 4G1QB 3QNNA 1LWCB 3CM6A 1J54A 3V6JA 3MEDB 3H4DA 4HVJA 4W5NA 3AO2A 3OHAA 4CESA 4MK7A 4E7KA 2HB5A 3DMJB 3DRRA 3PR5B 3CYMA 2GV9A 3TWHA 1HYZA 4B08A 4ZHRB 3HHKA 5KFTA 4W5RA 5F8GA 4ECYA 1RA6A 2WRMA 2E9RX 4FLZA 5EWFA 1YVFA 4AHVA 4FYDA 2C2RA 5FROA 4TQRA 1BL3A 2LSNA 4HKQA 4IOBA 1DTQB 3QEIA 1GX5A 4B8AB 4CJPA 3E51A 1EP4A 3PX0A 4CHNA 4K4ZA 3PO5A 4KV8A 1DTTA 2YKNB 3MR6A 4DSFA 4IG3A 2HWHA 1SH2A 2IM3A 3BJYA 4JUZA 4CGDA 3C95A 1MMLA 5DG9A 3HVTA 2G8VA 1S0OA 1F21A 1JLGA 4FW1A 3SUPA 4F4KA 3O4NA 3KK2B 3VQ9A 3BSOA 3RR7A 1U47A 1HPZA 4FBUA 4QPXA 1HNVB 1RBTA 2RDJA 4EYIB 3OYNA 4PQUA 1S6PB 1RT5B 1LV5A 4LSNA 3S9HA 1CXQA 4LH4A 4OL8A 4F4ZA 1NK4A 4XPCA 3JYTB 1VSMA 4CEOA 4YFUA 4QWAA 4ECZA 4X2BA 4XPEA 2ILZA 1JXLA 4Q0BB 4ECSA 2DTUA 1VSIA 3OYDA 1JLGB 2J6SA 2AGQA 1SL2A 2QKBA 4IKAA 2XCAA 1FKPA 4E0DA 4RNHA 5EDWA 2D5RA 5J1EB 2KZZA 1C1AA 3V9SA 4URSA 2ASLA 3TI0A 4O4GA 3LAMA 1EP4B 1YVUA 4FK4A 2IS3A 3OJUA 2GC8A 1HQUB 4AHCA 2FBTA 4DL5A 4DFMA 3C6TB 1N48A 5L1LA 5EWGA 5KT5A 2R7YA 4OLBA 1RILA 1C0TA 3IRXB 3A2FA 1JX4A 3ZT4A 4JRPA 3OL9A 5C5JA 2F96A 4MKAA 4EO8A 1JLFA 3PY8A 1RT6A 1JLAB 5T14A 4YNQA 1DTTB 2YNHA 1N6QA 2ASDA 4IH6A 3WNGA 4KHMA 3IS9A 4LH5A 2W9CA 4DFJA 1XI1A 4O4RA 4O55A 2ZD1B 3ISNC 4KREA 1BI4A 2JC0A 1HYSA 4OKJA 3NE6A 1KSPA 5KG2A 4DF4A 3HM9A 1SH0A 4K8XA 4WZMA 3ALYA 3KLHB 4H8KA 2BGGA 1S1XB 3KHLA 3CM5A 4CHYA 2YKMB 4GW6A 3UDLA 3NGIA 2R8GA 5C42A 1HNIA 2HHUA 2ZE2B 2FLLA 3CFRA 4PUOA 2ZKUA 5HBMB 4QCLA 3CQ8A 1HQEB 5KFHA 2HHTA 4KKOB 4CHQA 4CGJA 2UVWA 2Z1JA 4EZ9A 1REVA 2R2TA 4M3UA 2B6AB 2IC3B 1QSSA 2YNGA 5KFMA 3OS2A 4FVMA 5CYMA 2AWZA 4C8OA 2RDIA 3OJSA 4H4MB 2YNFA 4EP5A 1S1UA 3LZJA 1BIUA 2HNDB 4Z4IA 3NF7A 3BSCA 3MR5A 1CSJA 2V0NA 2BANB 2D3ZA 2R8KA 1J9AA 5HRPA 4DU4A 1A5VA 4CHOA 1FK9A 1IKXB 5HROB 4CIFA 3FFIB 4F4WA 4WFYA 3DYAA 1WN7A 4Q45A 5KI6A 3NH1A 3NAEA 4E7JA 5KG1A 4TSXA 4RG8A 4OKEA 4ECXA 2VG6B 2VA3A 4NCGB 1SUQB 4O44A 3PJWA 1N56A 4DF8A 4C8MA 4ECVA 2OPSB 4IH7A 1QAJA 3GV5B 1S9EB 2YNIA 2DFHA 1IKYB 3OL8A 4ZP6A 3OYIA 3HK2A 3S3OA 2BRKA 4J9PA 5F8IA 4Y1DA 4M3XA 3O3HA 3RBEA 5EU7A 4R0EA 3HO1A 4XIUA 3FQLA 4CECA 4RNMA 3ZSRA 2HHVA 4I7FA 3SI6A 4E7LA 2V4QA 3IN5A 4M3TA 2D0AA 2AJQA 4QAGA 3SQ1A 1T94A 1TKTB 4ZPCA 1TK0A 3DRSB 2OPRA 1LW2B 3P1GA 4G3IA 1S48A 2G8FA 2YHBA 4KHUA 4WFXA 1RT5A 4MFBA 5KTQA 2B4JA 1C0UA 3Q8RB 2IC3A 3DLEB 1L3SA 1CXUA 3NFAA 1IM4A 4CJQA 4DEZA 2F8EX 4TYAA 1RT1B 3UIQA 2PZSA 2C28A 1MU2A 2UVUA 1J5OA 4AHUA 3MEGB 4ZP9A 5C42B 3VQQA 4XO0A 3OL6A 1SH3A 1ZBHA 1WLJA 1WSEA 4ZPDA 4CF1A 4I2PA 5CYMB 2QE5A 3MECA 2AU0A 4JV2A 1RTHA 1SKRA 2HW3A 1RDDA 4KTZA 4BDPA 4TXSA 1C0MA 4ZMMA 4NLXA 3OYHA 3OS0A 3PW7A 4O3OA 4L8RB 4HUGA 4TY8A 5F8JA 4Q44A 3CVKA 3AVLA 2QXFA 4KHQA 3KLFA 4R5PA 3MEEA 5HRRA 1X9MA 4RZRA 5KG3A 3DMJA 1BI4B 4IG3B 3D45A 4DQIA 2CJQA 3NGYA 4PA1A 3B6OA 4KV8B 2VG5A 5KT6A 2A1SA 4IR9A 1UAXA 3MEDA 4R8UB 1S9FA 3MF5A 5CZ2A 4RW7A 4IFVB 4MH8A 1OS5A 3SJJA 4J9MA 4ZTFA 3KOAA 3P83D 3F73A 4J2DA 4B9VA 4K4YA 3V1RA 1XC9A 3RAQA 1SL1A 2WTFA 4NLRA 3EYZA 2IJNA
chains in the Genus database with same CATH superfamily
5DLFA 3J7A1 3AVCA 3MI7X 4J37A 5DZ6A 2W7OA 1FXXA 1WSJA 4HTUA 3W2VA 1R0CB 3CFPA 1KR4A 4JI8F 1WELA 1ZH5A 3LDSA 1YGYA 1VISA 5CR4A 3MXIA 5D0EA 4OIXA 2VASA 3O6QA 5LSLA 4FWKA 5BRFA 3GBTA 1DLOB 4OLPA 2DFEA 1BISA 1D9AA 1T3VA 5JXSA 4BE2A 1VHFA 3AVGA 2OEJA 5CQGA 3O44A 4MO4A 5KT7A 5IT4A 3KG1A 1X4EA 2K8GA 2IMOA 3CCVS 1FKAF 4FLYA 2FZGB 1N54B 5B8HA 4CP5A 3GJTB 3HZ6A 2B9WA 1RCOB 1UKUA 2WW8A 3OW2R 1IJJA 4MYTA 2D0OA 3CE8A 2D1KA 2RF2B 2PE8A 5IC6B 4DR6J 2GX8A 1XUPO 2ZJQQ 4FS2A 3V9ZA 3I5BA 3HHLA 1T11A 3O1LA 3CC4S 2E5IA 5JVHL 1RAOA 1YI2S 1RSCA 2VQEJ 1KVBA 3OYBA 4CLYA 1EQYA 4CTAA 2V7ZA 5KOWA 4DL4A 3VQAA 1Z2LA 2E5LJ 4J9NA 4OZ1A 3TTFA 2BM1A 2CNOB 5LMUK 2X74A 1YJRA 5GINA 5I3UB 3MOZA 3NVMA 4ZP8A 1U45A 2VCPA 3NF6A 3LGHA 4JV5F 4CEBA 1Q81O 3N4PA 4NLYA 4IO8A 5BR8F 4CZMA 1OKJA 3U1NA 1XHZA 2BKNA 3MD1A 4MQ3A 1UEUA 4E1MA 3OYLA 2K3KA 3VTHA 1U1MA 2XO7A 4LMZA 2I7NA 1KHWA 4CEFA 3UN2A 5EN1A 4ID1A 3PV8A 4M7YA 1SB6A 1R43A 5HAOA 4KR0B 3HFVA 2KKHA 2GO8A 4CYUB 4CEEA 4QS8A 1X5TA 2FHMA 4CIGA 2BOAA 4M41A 3QETA 4H4OB 2YKQA 2XSFA 3QINA 3VQBA 4KGZB 2RHSB 3GR0A 2M9KA 5KFPA 4RWWA 3GSDA 5EUHA 5IT0A 4FJMA 3K58A 1RAIB 4USKA 2FDNA 1I94K 4IG0B 3GLJA 2GAHC 2WC9A 3NGTA 3LM9A 3QAEA 2K7KA 5A8KB 2XSJA 4GV3A 4M3ZA 2YHXA 5C12A 2QMUB 4KHPK 1B9FA 2IA6A 2WTUA 1IVZA 5CY4A 3ZSVA 1U2VB 2K3IA 1DAXA 1ZPWX 1C1CB 3AA3A 2BE2A 2AGOA 4ISFA 2GMHA 3VQ6A 3FCVA 5KFYA 1NGDA 5HRNA 3W8GA 1D8YA 1KCFA 3QGIA 3B82A 4MKBA 4CHZA 4WXWA 1V5VA 1T05A 4LRFA 4KT0C 2GVDB 2KHOA 3UI3A 1WTBA 2O67A 3M6XA 2GX9A 3TTDA 3GE9A 3UVJB 1HQ2A 4BWMA 3UB5A 2GVZA 2QN6B 2GGPB 5KFVA 5CE3A 4LREA 3THYB 1C2PA 4JP8A 4K4UA 1UTAA 5C2CA 2CWXA 1XNRJ 3TUPA 1VQNS 3P96A 3CJ7A 1NGIA 3RRHA 2MQPA 4ZJQA 2VG7A 1XJWB 4GC6A 4KRFA 4ZVTB 4C0HA 2L48A 4CF9A 3LO3A 5IFMA 4RU9A 2QX0A 4M8LA 2J5AA 1GEHA 5F3ZA 1RWVB 5LSOA 4CEDA 4M5MA 4B3TJ 3MUMP 1NDKA 3S3NA 3LGNA 1R7IA 3EKUA 2WSCC 4CJ4A 2YX7A 4E3SA 3R6LB 1EJ7L 4O3QA 3D54A 3ZFVA 4CE9A 1EX4A 1S0VA 3AY9A 1Y5LB 3QGGA 2Z1GA 2NCKL 1HD0A 1Z2ZA 3HKZD 5KQ8A 5AE3A 3ZSQA 2AYBA 2NLXA 2ZVIA 1VRTB 3ZTQA 4DX7A 1XR6A 4ID5B 3PKMA 2CG8A 4O44B 2C3PA 4P2SA 4QJVA 3H2LA 2E2OA 1QTMA 4KRWA 4X64J 2CGLA 2D7SA 2CVEA 2EFOA 1DARA 2HSTA 1LWFA 3P45B 2G8WA 3QO9B 2OH2A 1J27A 2VGMA 1ZOTA 1B3TA 2AGPA 3NAIA 4DDFA 3DXKB 3MM6A 5L1IA 3JSMA 2VBYA 3T6BA 4CK3A 2QLWA 1QS4A 5F0UA 2RQMA 3QIDA 2KYZA 2ZHOA 1Z4UA 3G4SN 4Y1CA 3CPWR 4ED6A 3DLRA 2LLZA 5B0GA 3MUVP 3OTEA 1S3XA 2FC9A 2ETJA 4I69A 2W9AA 4WYBA 2DNLA 2HQIA 3NBPA 3VEZA 1RABB 2RDDA 2KFNA 1PG5B 2FJVA 3MFHA 1VQ5S 5F8MA 1WEZA 2VC0A 5K14A 3H5SA 2DTJA 4QW9A 3QBWA 1ZM2A 4A47A 1UJ5A 4CK1A 3PW2A 1TK5A 5JVHQ 3I56S 1N6QB 4JKFA 4FSVA 3VQSA 5HMYA 2PIIA 4LF5F 4OYAA 3MCMA 2XGPA 3RMBA 1Q53A 3EE3A 3D1HA 3ZSZA 3NCRA 1M1HA 1W0HA 1EHWA 2PI4A 2VWKA 2DNYA 4B8CA 5BPMA 4MK8A 2DR6A 1K47A 3A8EA 2W1BA 3NVKA 2C2DA 4B3SK 5KT4A 2ZM6K 2DGXA 4KQZA 3M8WA 2N4CA 2IVMA 3N01A 2B8PA 1HW8A 4BRLA 2RQKA 1APSA 1XEZA 3TR8A 2P1JA 4DJBA 1CVJA 1YBAA 2HF4A 1RADB 3VERA 3VGMA 3L7PA 1WKKA 2CPHA 3GFHA 1P90A 2KO1A 3N6MA 3GQCA 4FF3A 2PAVA 4F50A 2O8DA 3CCWA 3DM2A 3R2CJ 1SC1B 4DLEA 1SV5B 2VPYB 4HTJA 1G3OA 4M3YA 2H54B 4Y2AA 3ZSWA 4CT8A 1VJWA 2Z1IA 1RT2B 1LNQA 1S6QB 4LF4J 3LF0A 1RNHA 2AZ1A 4QOZB 5J2QB 5BRHA 3KJVB 1N36J 4JNEA 2NUUG 3T41A 2BZ2A 2V51B 4FM2A 3CC2S 1HBUA 4FJIA 4MO5A 2DNKA 1LWFB 2YVSA 2Y9HA 3CJ4A 4JI4K 4W5OA 2HVZA 4CO0A 3MMVA 3I8BA 4ES2A 1TL3A 1AUSL 1YJTA 2BW7A 5HN0A 3SFUA 4RW9A 2GHWA 4MIWA 3HVWA 3VMFB 1OSDA 1TKTA 3FCHA 4OZ5A 1IBMK 2UVVA 3HBTA 1JXBA 1NAQA 3QNOA 5DZ7A 2G0JA 3RWUA 3VCDA 1GTHA 3TARA 5GAEU 4OZ2A 4FKYA 4TLQA 4B3RF 2R7VA 3WC2A 3K8VA 1MMDA 1WHWA 3D6HB 3QIOA 4RBVA 3TVKA 2PC6A 4P75A 2QLBB 2W2PP 2E5HA 2P2CB 4BACA 3O2IA 4O3PA 2C2EA 3AA2A 4YOTA 1RHUB 3AVHA 2IBOA 1Q79A 5U47A 4CBUA 1I39A 2ZHBA 2YHAA 3CCMS 2IVPA 5DQGA 2VG7B 2L9DA 1Q82T 1Q86T 4CJ3A 4DV1J 1RHMB 3NH2A 4JD2B 2I1RA 3DYAB 2F9DA 4DCHA 4KB7A 1EIYB 4DV2J 2LU2A 3ID6A 4G1PA 2ZBIA 3OYEA 3HSZA 1HQEA 4DMZA 3UVJA 1ESVA 2CRLA 2Z2LA 4PKDB 1CJKB 3O5TB 4Q8FA 2KFZA 1BWVA 1IKVB 1WWHA 4DL3A 3LP1A 2M2BA 1TKZB 3H4BA 4P73A 1RT4B 1K8KA 5M1NA 4CLTA 3PZPA 4LQ9A 4M5LA 1NJYA 4JKGA 5ETVA 2P9LA 4BRIA 3V6DA 4BC9A 2V7YA 2M4MA 1MW7A 1Q1KA 4LT6A 4HHJA 2IM2A 4HUFA 4DTRA 3GILA 4CJEA 2ZH7A 3V9XA 2CPFA 3SXLA 2QKKA 3RB3A 1VRTA 4Q7AA 2X51A 3B4MA 2FBXA 3LP0A 2XY8A 2QWNA 4BE0A 2ZOFA 3D7EO 1MROA 3H2UB 1HKAA 3EX7B 3K7RA 4PXBA 2W7PA 1K1SA 1Q0NA 3JAMY 1RT6B 3WBZA 4YB1P 2BBEA 4NLVA 5DRKA 2CJ9A 4H4OA 3VGVA 3TAEA 2YWKA 1S72S 1YTAA 3SMZA 2A40A 3ISZA 4NXMJ 4LF8K 1NK7A 4U6PA 4ITSA 2QSFA 1HNZF 1UWBB 4NI2A 3RTVA 5A0YA 1RQ0A 3RW6A 3CPWM 2E5LK 3OTOF 3W9IA 1IR0A 1QUPA 1JLCB 4F4AA 3S8SA 5KFDA 4X65F 2N7CA 4ZOSA 2LXFA 3CJSA 2Q0RA 3L3CA 4ZCLA 4XEIA 3H1VX 2YI1A 2V4JA 4CGHA 1ITGA 5ETKA 2VGNA 2GVZB 5H9FJ 1YT3A 3H5UA 3HDSA 3T1HF 3TU5A 1LK7A 5I3UA 3W2WA 1X0PA 1NSQA 4F7VA 3F9KA 4MIAA 4WU2A 3AXKA 2JEJA 3DI6A 3HCXA 2YNGB 3FRZA 1T9WA 4DXLA 2HIYA 4DX8H 4CTAB 2BQ3A 3G6XA 1ICEB 1WSRA 3DRPA 3QQCD 3ZZTA 2O8EA 3KJQB 4OX8A 2E5LF 1CBKA 4QU7A 1V4SA 3V9WA 1T9TA 1MNEA 3ZZYA 3Q83A 4BRMA 2ZE2A 2WCXA 4ECRA 1JJ2M 4RNOA 3MTKA 4AL6A 1E6VB 3NXZA 5HVFA 4L6V3 4FP9A 1S6PA 1RAFB 4V1Ak 1GLEG 4DN0A 3BGRB 2OSRA 1MN9A 5T7LB 1VIOA 4FS1A 4JI1J 5DGAA 4OYOA 3EGZA 4LF6K 2HAFA 3O3FA 5J2PA 3TAGA 3BSNA 3KK3A 2IA0A 5HBMA 5KFOA 2ITGA 1FT8A 3H2VE 1TKZA 3EZUA 1GMWD 2E1AA 3TANA 4KH6A 3G0ZA 1YRUA 3I55N 3F56A 3K2PA 2O4IA 2FHKA 4DSEA 4IEEA 3CJ3A 5E7OB 2F9WA 4FLVA 4NRUA 2J0XA 4HDHA 4ZJOA 5I42A 4BLGA 3GSIA 4LFCK 2ZUGA 3PO4A 4IFYB 1WF2A 2RPIA 1LAVA 3Q8QB 1TK8A 3RMCA 2EKNA 1HWKA 4U7BA 3SBMA 3VVTA 4BR9A 3VF4A 4X4RA 4B02A 4JKEA 5AQNA 4ZCMA 1FEHA 3IS9B 3MM7B 3KKSA 1UVKA 3ZEUA 3E01A 3O1WA 1RCHA 3K5LA 1WKJA 1D5AA 4NLBA 2BX6A 2KXNB 1JLAA 4M5JA 1N33F 4Y2CA 3KTQA 3SYZA 1EKRA 1NSPA 1TAQA 4WYLA 2A0FB 2MB0B 2HQGA 3CDBA 2YY3A 2K1RB 3VETA 4CO5A 3ZC4A 3OVAA 1PKUA 1U26A 5ETRA 2OANA 1RWOB 3GOIA 2QA2A 4O3NA 4A8WA 4EFAC 1SJ1A 5GAHU 3JTPA 2DNMA 4S0MA 1TTHB 1VDHA 3ZZPA 3M8QB 5DQHA 3KXDA 1RT3A 2MDAA 4AM6A 1FX2A 1NGBA 3M2VA 4YHHF 4DLGA 3KFWX 1OQ6A 1TL3B 2KG1A 2HF3A 4X62F 4NLSA 4KHNA 4FYXB 5ITHA 4E19A 4F9OA 2RAQA 1RBAA 5AQWA 3FZBA 3OTBA 4KJIA 2DKOB 1X9WA 4M94A 1Y7PA 3V81B 4OPKA 2GMLA 3C7NA 2KG0A 1Q8IA 3OY9A 1D9FA 2OTLN 3VVUA 3HPHA 5FDLA 1DTQA 1SV5A 1AFJA 3K8WA 3QLHA 3RBDA 4OPAA 4JI4F 2O8DB 2XI2A 2HFNA 2IVFB 4FVUA 3NCPA 2UZAA 1RE1B 1FWPA 4CEQA 2B4PA 4KFBA 5E26A 3U4LA 4IR1A 3NMAA 4KY3A 4K0KJ 1YI2N 2LDYA 3K17A 4MDAA 4FF1A 3UPFA 2E8AA 1Q8KA 3CJ5A 4KBOA 4X66K 1S9GB 3DOMB 2RSQA 2FHOB 3CCMN 3C0BA 2OMLA 2YNFB 3Q8YA 2ATQA 3H45C 2JFDA 3MWPA 3ENQA 2NLWA 2KT3A 1GXLA 1SXLA 2ZEJA 3OPKA 5D4OA 1FCAA 4F0HA 3MPVA 3SCXA 4J90A 4FJXA 1BQNB 1F5CA 3MEKA 3C94A 2DY1A 4OMFG 2WVCA 1IKXA 4KAZA 2E1ZA 1E4FT 2C2NA 3TQ1A 4C97A 4IFVA 1RT7B 1RHQB 2F65A 3VV2B 4FCYA 4M42A 1FFWB 2HBJA 5JLHA 5K14B 1H73A 4BRKA 4LRBA 3KG4A 1C6VA 1NKEA 4CDIA 4JI6J 4CCHA 1RHJB 2W7AA 1HJRA 3AGKA 1T8EA 4OYMA 4OJGA 4EBCA 2E20A 2CQ0A 2YKPA 1X4HA 1NMDA 1N4LA 4NE9C 1MLAA 5A8WB 4DU8A 1HWLA 1GT8A 2XHCA 4MFBB 4JI2J 4UW2A 2GWKA 4DPOA 1H2UX 3LPEA 3C6UA 4FNIA 4CLKA 3R27A 1JL2A 2R4FA 1TVRA 2PMZD 4AHRA 4LF5J 2ZM6F 3JSMB 2JLEA 3MM6B 1E3MA 2FVQA 1WJ9A 3SUNA 3PR4A 1XBWA 3KLIA 3W9JA 3CCVN 2XG8A 4JI6F 2V63A 1C0UB 3D6MB 1N5SA 1NHVA 3PW5A 3NG8A 4GRSA 3EPIA 1B9DA 1EARA 3P38A 1ATNA 2CQPA 4URQU 4HYKA 4BR5A 3TA0A 5D0RA 1Z25A 4HTLA 2WB4A 3C6TA 3OQ2A 4DPUA 4IDKA 5LOQA 3EL2A 1VHIA 2OAUA 2EX3A 3D2FA 1D8ZA 4DR5F 3RB4A 2XRIA 4OI0A 4DTSA 2BABA 3AV9A 4BG9A 1VQMS 5LMNJ 1AT1B 5GADP 3DU6A 4ECWA 5E3AA 2MQMA 3RSEA 3K9KA 3QLHB 3BH6B 3T5HA 2D9OA 3D0PA 3HLUA 2HNDA 4KB0A 1QE1B 2IPOB 2L9NA 2E2NA 3S41A 4E89A 3RVCA 2H48B 4CF8A 2BJDA 4USJC 4LR9A 1HA1A 3BREA 1PSDA 1REVB 2V2QA 2JEFA 1FE4A 2EKYA 2ABYA 4P2FA 1AW0A 1J6ZA 2AA4A 2G0CA 1R6VA 4Q0BA 1FK9B 3J80U 5KOXA 2AJ2A 3V4MA 4B9UA 1BC6A 5H1SQ 5KFFA 4FJLA 4ZLLA 1MDUB 1B0TA 4LVNP 3RG6A 2E6LA 4DR3K 1XNQJ 3SBGA 2YKMA 2IMWP 5G4DA 4B3TF 2QGFB 3L4QA 5K8NA 4OGCA 5B0EA 1C1CA 2VL1A 2R7OA 4HCBA 4YEAA 5J2NA 2E1MC 4RLEA 1Y4ZB 1ZXOA 4LSLA 1ULRA 4NLDA 1YRTA 2E5GA 2IGIA 3VQ7A 3MAAB 1IBLJ 4X4NA 1XNRF 4USMA 3DNCA 3NGDA 2APOA 4LF2A 3V2UC 5A2QO 3CM6A 2BUPA 1J54A 3NGKA 3JSBA 4FWQA 3FGVA 2VHGA 4WIIA 4CESA 3SEOA 4E7KA 3DRRA 4J8FA 1FJEB 3J7YP 1T6CA 2MQOA 2P9IB 3J81U 3C19A 5AZIB 4ECYA 1RA6A 1UCNA 1NBWA 4FLZA 4BHQA 1YVFA 4YDUA 4FPAA 1BL3A 2M70A 4HKQA 3QEIA 1DTQB 2FSKA 1WG5A 1HNXJ 5ETNA 2HHHJ 2Z2MA 1KAZA 3BGLA 1FD8A 4WWSA 3PX0A 2FSNA 2FTRA 1DTTA 1XQSC 1MWMA 4AUKA 4IG3A 2IM3A 1IWAA 1K0VA 4JUZA 4WIQA 1GLJO 3B8AX 1MMLA 3HVTA 1NB7A 4CLFA 2P5VA 4CBXA 5M1FA 2DXFA 3SUPA 2HHHK 1VQON 2MY7A 3AA9A 5T7LA 3BDEA 3BBFA 1HNVB 3J81O 1S6PB 1LV5A 4LSNA 2DBBA 2ASYA 3HOTA 4LH4A 3TTCA 3QB0A 3JYTB 1RAEB 2B56A 4C23A 4YFUA 4WTYA 4ECZA 4X2BA 2QWOA 2ILZA 2X1BA 3TA1A 2IYGA 1UPMB 2H1YA 3J7Z5 3RBZA 5D4NA 1RACB 5IWAJ 4JI2F 2XCAA 1WC5A 1NGJA 1FRJA 5EDWA 4H4KC 2AW0A 2DH7A 4G65A 1NM1A 1NWKA 1C1AA 3JQJA 3R9PA 3V9SA 4URSA 3TI0A 3VAKA 2ZDOA 1EP4B 1YVUA 5FPMA 3QT5A 3NRBA 4AHCA 2C3MA 3H6EA 6AT1B 1N5QA 3CDAA 1FRLA 3JS6A 5EWGA 3KWMA 5CXTA 3CJTA 3LGMA 2J7UA 3A2FA 4ILMA 2XTJP 3N5FA 3FZLA 3ZT4A 3PFEA 3R6GB 2F96A 5GADI 3DLLQ 5T14A 1DTTB 2YNHA 2CQHA 2ASDA 2FY8A 3W9HA 4KHMA 3VHQA 5AQKA 3V5RA 3VQTA 5B08A 2EFVA 2G1HA 4PXDA 5B09A 2W9CA 4DFJA 5A0YB 3WXKA 1BI4A 5AQFA 2DISA 5AT1B 1KQGB 4OKJA 3C6HA 5KG2A 3AFGA 2ZH4A 3W5YA 1IR1A 3MM5B 2QFIA 1EQ0A 3E9LA 1KONA 3D0HE 3OR1A 3ZZUA 1SH0A 3POTB 4CNZA 4EWTA 2F1FA 4OJ1A 1RP5A 3ALYA 4FF4A 2P9SA 4ZITA 3J7ZO 3KHLA 4ZVRB 3CM5A 3UDLA 5CABA 5C42A 2DNGA 3MN9A 4JEPA 2HHUA 2ZE2B 2BJ3A 4PUOA 4QCLA 1RAGB 3LW5C 2MTLA 4FYWB 2GV1A 1WHXA 4DR2F 2LMIA 4EZ9A 3ENVA 4I6WA 1BUPA 4HH0A 1QSSA 2YNGA 3OR1B 4CLSA 1PJ5A 3ILJA 5CYMA 2O66A 4HI2A 5K9FA 1B0VA 1CEZA 2JRSA 4AFFA 4C8OA 2XMUA 1S1UA 2J9DE 3LZJA 4CLZA 4JI8J 2DO4A 2KVIA 1BA1A 2Z4PA 4BCAA 3IFRA 1CSJA 1GLCG 1VQ8N 2D3ZA 2R8KA 1GAOA 5KPZA 4A57A 1FK9A 4YHHJ 2MQ8A 3BH7B 2VBXA 2AJ1A 5JMNA 1YBUA 4DKWA 3J7YI 3DYAA 5KI6A 3KUHA 3BGFA 2EI5A 2J76E 2EFGA 1SUQB 3C66A 2FJAB 3C3LA 4DF8A 4ECVA 1ELOA 2ZDPA 1S9EB 2YH0A 4ZP6A 2JWKA 3D1OA 3N9UC 1FDBA 4JI3J 3KJNB 3U7JA 3RBEA 4R0EA 4P2MA 1SJ4P 1KEKA 9RUBA 4QBUA 3PTWA 4CECA 4E7LA 1G7CB 2V4QA 3IN5A 3VF6A 2D0AA 2AJQA 3GG4A 1S72N 5TKWA 4UF4A 4ATNA 4K0KF 1TUYA 1TKTB 2HGMA 3CCSN 4KHUA 3NOCA 2ZVSA 5IZHA 1C0UA 1KBRA 4JI3F 1H2VZ 4OZ3A 2DGUA 3DXBA 1L3SA 2W4CA 2XMWA 3TWZA 3NFAA 4CZLA 4JKGB 3D2EB 4TYAA 3CC4N 1RT1B 3VAJA 2PZSA 2C3YA 5AXLA 2ZH8A 1S57A 1BDGA 4V19X 4NMXA 1K8AO 2UVUA 1Q16B 3ENAA 2DO0A 3OL6A 1SH3A 1WLJA 4CF1A 2WFBA 1W26A 5F3TA 4JHDB 3PNIA 3R7BB 5DDQC 1T3OA 1XN9A 1PILA 1RDDA 4KTZA 4ZMMA 2OSQA 1TUWA 3LM2A 2YWHA 2NRWA 3FK4A 3PW7A 4O3OA 2WBMA 3CVKA 2QXFA 4JKBA 1NG9A 3AODA 1X9MA 2OGUA 3VPZA 5KG3A 1FVSA 1U6BA 2CJQA 2VUGA 3MMJA 4PKGA 3NGYA 2NNWA 2VG5A 2A1SA 2OFGX 5E33A 3MF5A 4RW7A 2O8CA 1WEXA 4IFVB 1X4AA 4J9MA 3I31A 3TW0A 3F73A 3W3DA 1N36F 3V1RA 4YB5A 3QFWA 3EYZA 3M4XA 3BQ2A 1MN7A 2IBKA 4USHA 3KHRA 1VMBA 2F9TA 5CAAA 3CCLS 2Y1JA 2ATCB 1UA0A 2DIUA 3PSFA 4YR2A 3LPTA 2HRYA 3JQMA 3TSQA 4WFZA 5AR0A 3UE2A 1RGVA 4C3MA 2HFUA 2VG5B 2FLOA 3M30A 4QIVA 4LRAA 1SVDA 3MM9A 4OZJA 1X4BA 3ZTRA 1FKPB 3A5MC 4QWEA 3VOVA 1HBUB 4WZQA 1JLEA 1GXTA 4B1UB 1ZC6A 4JRQA 5AQJA 2JZ5A 4EEYA 5J2QA 5L8RC 2KB2A 1M5SA 4B1VA 4FK2A 4N76A 2HNZA 5LMNK 1L3KA 2KT5A 3CNQP 1RXOB 1SIWB 3T1HJ 1U0HB 1QVFR 4X66F 4ZPVR 3BPSP 4ZA1A 4OGEA 4Z4HA 1F9EB 3SQ2A 2DRBA 3NGZA 3JS9A 4EMDA 3G6YA 4CFAA 1NJZA 3I0SA 1S1VB 5GMEA 4CI6A 3GONA 4GNIA 3HHDA 1IBMJ 3MMBB 4OLAA 3AJ1A 1RLDA 3GPAA 1BCOA 4JK8A 3OLBA 1WDTA 2KJVA 2GAGC 2DGVA 5LJ3Y 4P72A 3WNEA 3M8QA 1T03B 1Z1ZA 3U1LA 4DV3F 2AYMA 4FZVA 2Y1RI 3NOGA 4DBQA 1NSAA 3O4WA 3D4JA 1IKYA 2IOCA 4CJVA 2XZWA 1FJGF 4X4VA 1PBAA 4B1ZA 2P5GA 2CNNB 2J9DA 3CCRS 4FJ7A 4ZHRA 3SQOP 2AZ3A 1TFYA 4YOEA 2OEKA 3BSAA 5KFAA 1LOTB 4TQSA 5C25B 3U9DA 1XR7A 1P1TA 4B17A 3UFCX 4NYOA 5DO2A 3MR7A 3KMSA 3UE5A 5DDOC 3KNAA 3SDEB 3J80O 3IMXA 4M5IA 3GCWP 3RRGA 3C6UB 3QSYB 3MHYA 4DOZA 2R2SA 1D9DA 2VFSA 3GYGA 4FLUA 3WIUA 3CCUN 4C0BA 1RFQA 3PJXA 2E6MA 1ZTWA 2EK1A 3CO9A 2HWIA 3PKYA 3CG7A 4A5BA 1XNQK 2UUWA 3IRWP 5E41A 1TV6A 3KG0A 1RYSA 2V2VA 4W5TA 4LBHA 1URNA 1NGAA 4CD1A 3N6NA 4ZVGA 3NCQA 4USTA 2XC9A 1T9XA 5DM6L 4NYZA 4R5PB 4DR7J 2GS8A 1RKIA 3W63A 2LQ5A 5L46A 4A2BA 3OUYB 4UZCA 2MQNA 2OJ3A 1Q7YT 1UVIA 2CZVC 4K4WA 2KQ2A 3L2QA 2VFUA 5IT9O 3KLEA 4O5BA 1Q78A 2QL5B 3HM8A 2W01A 5A8KA 4CNYA 4DR2J 4IUFA 1VK0A 1JKHA 3P49B 1YTYA 1OY8A 5LJWA 1KHVA 3HYFA 4CLUA 3R3TA 3FSIA 3VQCA 4EU0A 4QW8A 4DMNA 3M32A 3MWBA 2QWRA 1ZM3A 4NLQA 3TX8A 3TQEA 1Y00A 1WNEA 4DHYA 4KFBB 5H9EJ 1OY9A 2MKIA 1T95A 2QJ3A 2QEXN 2JSXA 3ZYYX 4BY9C 1M90O 4AQYF 3IR7B 5GVQA 1IH7A 1MSWD 4MK9A 4PY5A 3QJPA 2B7CB 2GJIA 3IWNC 1NK5A 2I0XA 2XWXA 3A8YA 1S9EA 4ED4A 3L2VA 1KQSR 1JCEA 4DV0F 2YNHB 5KPRA 4C11A 4NEYA 3NWRA 1RK8A 3FQKA 2OCEA 5D3GB 2VFRA 2HGLA 3V81A 5F9LA 1CQMA 3OHRA 3RJMB 1H3DA 4FJJA 4L3NA 3OYMA 5HL7L 1S0MA 5KFJA 4IBNA 2VDIA 1HKGA 1L3VA 2FC0A 1S1UB 2UXCF 5LSRA 3LL3A 4P74A 2OYQA 4ED2A 2E44A 4YP3A 2W9BB 1NK9A 4ZVOB 2BE2B 3V4IA 1P27B 4ZJLA 1FWLA 2J6TA 2ZGYA 1KFDA 3QZ7A 4DR5K 2XCPA 3WC0A 3WXLA 1DT9A 3VAGA 1TL1B 4PUOB 1UETA 3ILLA 4N41A 4F0KA 2M0GB 1XMQF 4LF6J 2RMLA 4OLOA 4OZNA 2F7TA 1GQEA 1G1XA 1KAYA 1VQKN 3Q2TC 2P6TA 1S10A 1YQHA 2D3UA 2MEWA 3C65A 4JI5K 2F5GA 2QRRA 1U04A 4ELTA 4IOCQ 3ULHA 4C98A 1Z05A 2KM8B 1R0AA 3EKSA 2CQIA 3LWLA 3J8AA 4RW4A 4YY3J 4CM0A 1TP7A 4DTXA 2V68A 4JI6K 4Z7YA 4CI0B 4Z0UA 5ADXH 5AJ3J 1IKVA 3T7ZA 2AV5A 3AD8C 3QIPA 3QEPA 4TY9A 4ZTJA 1ZM9A 5AE1A 1IG9A 3VZIA 4U96A 4E7IA 4BE1A 4FLTA 4KGVB 3H1QA 4HTIA 4FYVB 1BLUA 4KO0B 2BRLA 1ZS6A 4W98A 1RU2A 2F4FA 4TNOA 4Z4GA 1S59A 4B9TA 5F8LA 2CDRB 2OFHX 3BGRA 5CZVA 4KHPJ 4KTWA 1WNSA 4DR1K 2PMWA 5AQGA 1BHNA 2FIUA 1LWEB 3U3GA 3TAQA 3CD6S 2HQ3A 2QWQA 4OHZA 2CPYA 4JK9A 4CZHA 1LKZA 3D7SB 1BUXA 1ZM4A 4C7QA 3E3XA 3AAPA 5AQRA 4WFBL 3IGNA 2AJ4A 3DXSX 5C2FA 2O5DA 3JAMU 2WOMB 1BD6A 2V67A 2GHPA 3LDLA 2C1EB 3UD3P 1BHLA 2V8DA 1OSCA 5CZ1A 4K7QA 1UFKA 1IKWA 5KPTA 2OIHA 3H3OB 4OPHA 1E6YA 3U8XA 3LALA 3L8BA 4F2RA 4J9RA 4LSNB 2C42A 2K06A 2QLFB 3MMAA 2FXUA 1M5PC 1J53A 4K59A 4TLRA 4CZKA 4X4TA 5EWEA 2CKWA 3DOKB 4B3OB 4DV7K 1GLBG 1FI4A 3CJ2A 4RU2A 1KRPA 2DHGA 3GYXB 5ETPA 4I56A 1FHTA 1YK9A 1S76D 1LXJA 3FNNA 3IKMA 4FJ9A 2G4BA 4PG7A 4A62A 1BXNA 3AH6A 3TR5A 4BR7A 2UUBJ 3IM8A 2VU5A 4DV3J 4JKCA 5A2QY 2VG6A 4IZ9A 4P71A 3LP2B 5EGYA 5H1SV 3NLCA 4FM1A 3ZT1A 3EDQB 3DRRB 3PIPL 3PYEA 4DUZF 3FFIA 1WTFA 5HROA 4JV1A 2WAQD 3U6FA 5THWA 5FLXU 3D2FB 1YJNN 2G13A 4DV1K 2DY4A 2CPEA 1TKXA 1KP6A 2UP1A 2RKIB 3PW4A 2J6UA 2CNKB 2OPQA 1LK5A 4KI6A 3FEZA 1WI8A 2ZBRA 1ZA2B 4DPXA 5HOOA 1AA1B 4OPJA 2U2FA 3IA0A 1U8WA 3SSQA 5E84A 2E9ZA 4ZPBA 1RTHB 1M1KT 3QNWB 4OVLA 4HL9A 2CJKA 4IO1A 5KG6A 3WDOA 1YJVA 3EVOA 3BGOP 2YTCA 4ER8A 2Z56B 5LJVA 4FO0A 3FFKB 5BR8J 3C16B 5DK5A 1X3MA 1VHXA 3R9LA 2UUCK 2A1RA 1QSLA 1ASVA 5A8WA 4A8KA 2FC8A 2B6AA 2DEIA 4JD2A 2GIQA 4DHVA 2IJFA 2W25A 5A6WA 3MPYA 3MECB 2NS1B 2X3DA 4FJ5A 3H8YA 4GKJJ 5DM6Q 2QC3A 2RIJA 3HZGA 3DC2A 1QE1A 3G9CA 4DV5F 2E1PA 3CPEA 2XYHB 3ZNUA 1M1GA 4WP8A 2V50A 5AXMA 3E1YA 2W6LA 4E1NA 4J9OA 4IOCL 3O8MA 1U49A 2CG4A 1FKOB 1FRHA 3ZT2A 4YDUC 3A5NC 3M6GA 1Q7LB 4JOUA 1NPKA 5ADZA 4DUYJ 4ZN1A 2Q2RA 2MGZB 2G8HA 4ID5A 1X1PA 2SXLA 4MKVA 1T44A 8ATCB 4Y2IA 3THVA 5IT9U 3ZCMA 2K7JA 2CFXA 2DYAA 4IEIA 3TEGA 1VSJA 3PFOA 1GLAG 4BDYA 3MCNA 5KQDA 2DGOA 1HBMB 4DV4F 3AO5A 3LP2A 4LFAF 2D0CA 2HK2A 3HX9A 3U27A 3OTOJ 4DPTA 2R8HA 1I1GA 1WC3A 2VQFF 3T1HK 2I2YA 2UXDF 1CPZA 3CCES 4KTQA 3J80Y 3HKWA 1FNMA 1X4FA 2W8KA 1S6QA 1X4CA 3V6HA 4NEZA 1UVJA 3G6ES 4FJHA 2IHR1 3F2KA 4HHTA 3WQUA 2PYJA 5HI7A 1LEOA 1RBVA 4Y6IA 3F5TA 4QYZK 2JX2A 2CQDA 3T1YK 1HNWJ 1AB8A 2GFFA 3QFPA 3FGUA 2DCUB 4CIOA 3R5DA 3BBCA 4ETZA 3CF5L 1HWJA 1WOPA 5KFSA 2VH7A 5KFNA 3ZX3A 4NYPA 1OYDA 3W61A 1C1BB 2CQBA 2YKNA 3AOBA 5M1QA 1RA7A 3P3DA 2AQ4A 3D68A 1LOUA 4YQWA 3JB9k 1MWQA 1RT7A 3HP6A 2JL9A 2ZH1A 3IG1B 2DJWA 2LA6A 2HHQA 3FLCO 2HURA 1IJFB 2UUAJ 2OTLS 1RCXB 3KD5E 3MCAB 3OV7A 3BZKA 4WFAQ 1J5EF 5SWMA 2N7YA 2K1RA 4DG1A 4Y0FA 3PJ9A 2CGJA 2RKIA 1CC7A 2CJAA 5JS2A 2ZD1A 1MMNA 1R6YA 2VJVA 2XS7A 1DKGD 4H5NA 4JI0F 3TABA 3O4QA 2QZ8A 4PPDA 5KFWA 4RW7B 4N7TA 2O8CB 1RYRA 2GMJA 4IG0A 2G2YA 2MZ1A 4Z2XA 3EZWA 4CF0A 3TVZA 4LUBA 3RGIA 1MA9B 2NZTA 2I8EA 2HS4A 2V4RA 1V3ZA 1VQOS 2FF3B 3IWXA 4DTPA 3RU0A 4CIEA 4PG4A 3HL8A 1O0PA 3VESA 2MQQA 1KVKA 3JAMO 1RUSA 5HRSA 3L4IA 1Y3KA 1GK8A 5EY4A 1YXQA 4FJNA 3OHBA 1QUVA 4JHDA 4P9SA 4IRCA 4AHTA 4ED8A 2DRDA 3I0RB 1VQ5N 4BDZA 2ZBQA 3MCPA 5IV3A 4JYAK 3C7NB 1RB0A 3PIOL 2G8KA 1RT1A 4P52A 1T7PA 6FDRA 5J2PB 3CQXA 4TY8B 5CCLA 3QO9A 3EN9A 1HRHA 4ZVHA 4U67Q 2DR7A 1J5EK 3GB0A 5E0OA 1NDCA 3BO2A 3ENWA 2DD8S 4JI7F 1TL7A 4MMOA 5KT3A 4WF9L 3QBXA 2QWPA 2CAJA 1DJ0A 2MKHA 1DEJA 3M2VB 1K1QA 2Z2YB 1RT3B 4J2EA 3MDQA 4MYUA 2HZAA 1UW4A 5F1XA 3MEGA 2QTWA 1J5EJ 4RJVA 2FY1A 2G8IA 5J1EA 4NA3A 2JJ4D 2DH9A 3PYDA 1XMOK 1CS4A 2D69A 3HZEA 5A8RA 3ZT0A 2G2OA 2N3LA 2ALZA 3LPUA 4K50A 3TJ9A 4RL1A 2A5XA 2DR8A 4JKAA 3AJDA 5KG4A 4LF4F 3HPOA 2J9CA 2RF2A 2Q31A 1KXPA 1RZMA 4U7CA 1NH7A 3B54A 3EWGA 3OFFA 3K0JA 4I64A 2GJ2A 4K5SA 4RWTA 1CQNA 4HCCA 4OHXA 1B92A 1IBMF 5G0RA 1IBKK 5K8MA 8AT1B 1WDDA 5C24B 4K42A 5I3QA 2QLXA 5A2QU 1K6YA 4LD0A 1SJQA 4GMKA 3AVKA 3ADAC 3ASMA 2FLPA 3FBCA 2OKQA 3LWMA 1KTQA 2I6WA 3BZCA 4YR3A 2D3O1 4CFDA 2BTFA 5D3GA 2GIRA 2BKOA 1VQ9N 4JI5J 4CT9A 4C11B 1LQ9A 5F2RA 1CLQA 1JLCA 1DLOA 1FO1A 3M6VA 2JWLA 4NL5A 2GEMA 4R0JA 4ISGA 2GCFA 3AOAA 4QQBA 4F3OA 4CH1A 1Y5NB 3CIPA 4EBEA 2XGQA 1U1PA 3OVBA 3MEEB 3KK3B 3Q8VA 2OMOA 4JV0A 2RS8A 3WQPA 1HYVA 1ZBLA 5KAKA 4EK2A 4LC9B 1R0AB 3AVMA 2PN6A 5DG8A 2HMIA 5CCMA 4NCBA 2UU9K 4DX6A 1OYEA 1R31A 5IS2A 1NMEB 4G1QA 1YJUA 1OJ4A 2W4PA 2DVIA 4HACA 3OW2M 1NNDA 1UP1A 4RPFA 1N32J 4YMEA 2ERRA 1FTCA 4CJLA 4ZKAA 4DR1J 5ADXA 4LIWA 2O8EB 2Q97A 1GLLO 4LR7A 4OX7A 3RMAA 5F8NA 3AO4A 4EGLA 1RWMB 4K4TA 4BC5A 1ZTTA 1SS6A 2Q36A 4CJFA 3WT0A 5AQYA 5DJBA 4M3RA 3LP1B 3TUIC 5B0BA 4I6MB 3IGVA 2BQUA 4F36A 4ECUA 3B8HA 4M5GA 5ELZA 1A7GE 4LR8A 2I9SA 3FEYB 1YJ7A 1X0FA 5M1PA 2KN4A 2EG2A 4HT7A 2PYLA 4UQGA 4BREA 4OYXA 3O9UA 1CZBA 4LF4K 1H74A 1PAEX 4ZVFA 1ASWA 4KH4A 1CJTB 3N0VA 4QS7A 2VB6A 2ZJRQ 1C0FA 2RT3A 4GO5X 1S22A 4M95A 4G6VB 2B3TB 3L3VA 4UOFA 4M63A 4UUWA 5FD1A 4DSLA 1GOCA 4RO0A 2DPJA 3W66A 2IM0A 2CQ4A 4NRTA 3CULA 3VENA 1H0HB 4DPWA 3DDIA 4U8YA 1VQ7N 2CJYB 4LF9J 3J81Y 4WCEQ 4DUZK 2XMKA 1WEYA 1SPBP 1NJWA 3VQEA 4IFEA 2BOPA 4EI2A 5E3CA 2EFPA 4FWRA 1RDWX 1MROB 3WXMB 5A8RB 2D74B 2NXJA 4MJKA 1EZZB 2QWLA 4XH1A 4ZPWR 4LF9K 2D4WA 3OS1A 4I6AA 4DUZJ 2X1AA 2DR9A 2UXBK 1EETB 4BWJA 2F8SA 4A8FA 5BYRA 1S12A 1UOCA 2G2ZA 4USWA 5HSPA 3EE8A 2RHKA 3CIMA 4QIWD 5D15A 2OPPB 2V2ZA 2FJWA 3VQ4A 4BC7A 1WAFA 2V8GA 2R42A 5C2DA 4WKRA 1GOAA 3AQOA 2RE2A 2IRXA 3QYYA 5DLGA 3TAPA 2WK4A 4WPAA 3V6KA 1YRXA 5D77A 4J2AA 1WOSA 2ZZTA 3LDQA 1G4CA 2NREA 1CJKA 2O3DA 3ATVA 5CYJA 4BRAA 3NH0A 2OO4A 4L76A 3JTOA 3FZFA 4YR0A 2Q6BA 3Q22A 3HRGA 3KLHA 1VK8A 1IBLK 1RTDA 1RBOB 1OVQA 5GAHP 3LAKA 1H7WA 3WHIA 4EHUA 5KT2A 4FK0A 2WSFC 3GIMA 3EGVA 4WTOB 4DZ6A 4AHSA 3M30B 2HBRB 2P9KB 3ENBA 3HTVA 4G1QB 1N32F 1NDLA 4DV4J 3QNNA 4BVPA 1VAZA 3FR0A 3H4DA 4HVJA 3CETA 3AO2A 4MK7A 1NHKL 1KWMA 2BYCA 2OD6A 2HB5A 3H25A 4HR2A 1OH7A 2NRTA 4B3SJ 3CYMA 1NM2A 1UZHA 4KHPF 4X84A 4ZHRB 3HHKA 5KFTA 2H9ZA 3UN5A 2K2PA 2KKZA 2GA7A 4PEOA 2VIHA 5EWFA 3VEWA 4AHVA 4F67A 1YX2A 2C2RA 3ZZOA 1EB0A 1T02A 2VBWA 3CC7N 1FE0A 4CJPA 3E51A 4CHNA 3PO5A 2YKNB 3CC2N 4LFBF 2HWHA 2QTDA 3C95A 1FDAA 2G8VA 4NMLA 3G25A 1JLGA 4FW1A 5AE2A 1EWQA 1U7LA 3VQ9A 4PL8A 1JB0C 3BSOA 2Q6CA 1U47A 1HPZA 4QPXA 3PLAA 3S6EA 3TUZC 4PQUA 4UT4A 4QZVB 1ATSA 4GVBB 4OL8A 3C14B 1UZDA 1NK4A 2V5HG 4JK7A 1XMQK 4CEOA 3WXIA 4JI7K 4XPEA 3FE1A 3IR5B 5EX0A 4HWIA 5K5MA 4ECSA 2DTUA 1VSIA 4WK1A 4DX5A 1TYQB 1R3NA 2O8FA 1FKPA 1KDNA 4QR0A 2FJDB 3GP9A 1H72C 3MM9B 3BY5A 5J1EB 4OJHA 3NNCA 3VEXA 1U02A 2EXUA 2GQCA 4FK4A 4JV5K 2IS3A 3OJUA 2QL7B 2GC8A 2J0WA 2DEJA 4GKKF 3C6TB 2YH1A 3MM8A 4NOHA 5L1LA 9ATCB 1TL7B 5KT5A 3CHWA 3O6WA 2UU9F 4KC5A 1S6OA 4DR6F 1N34F 2MGZA 1WI6A 1JX4A 1TELA 5CA5A 1HNZJ 5HJXA 3OVSA 3PY8A 2CADA 4GKJF 2DNNA 3W7BA 1BE4A 1N6QA 2VJUA 1NBEB 4IH6A 3WNGA 2O8BA 4FOEA 2MHEA 2Q43A 4LH5A 2VWBA 1XI1A 1I51B 3EICA 1VK3A 4PPZA 4WKYA 5GAGI 2BE7D 3GMGA 2OHDA 1KVIA 4WZMA 2IVYA 4H8KA 4NA1A 3G8QA 2BGGA 2MJUA 1S1XB 4L73A 4AQYJ 4GW6A 3Q24A 2R8GA 2GVDA 2OP5A 4XAKA 1RI7A 5D0HA 3IO1A 2ZKUA 4OV6A 4A8MP 2BVZA 2LQ9A 2U1AA 3TA2A 4JI8K 3MMCB 2YCHA 2UVWA 3THWA 2Z1JA 2BMBA 1ZAVA 2R2TA 4M3UA 5KFMA 3OS2A 2E7WA 3TEHB 1WF0A 3BO4A 1OQ3A 4X62K 2AWZA 2GELA 2A10A 2RDIA 3OJSA 1HR0F 2DCLA 2YNFA 5E2QA 1BIUA 2DPNA 3MR5A 2V0NA 1J9AA 5HRPA 3A8KA 3MUTP 4CZEA 2VQFK 1NNEA 1NPRA 2HBZB 4LF7J 5HROB 3FFIB 4WFYA 3FC9A 3NAEA 3NH1A 2ZH3A 4E98A 4TSXA 2A2CA 2NRXA 2VG6B 2EEYA 5AQMA 1K73O 3MM5A 3GV5B 4OI3A 4KPCA 2D3OR 2DFHA 7FD1A 2A3ZA 2VQEK 3HK2A 3HI0A 2AIRB 2BRKA 1VQ7S 2HOEA 1SAZA 1EAYC 5E3PA 5F8IA 3QRRA 2XMTA 1HWUA 4YOXA 5J1PA 3IFEA 3G8TA 2QXLA 1WB9A 4OX6A 4XIUA 4EAHD 5M1OA 3I56N 2JLGA 1GXUA 1OWXA 4I7FA 4YOVA 4YOWA 4DR6K 4LFCF 2GIFA 4U7UK 2E1RA 4J9VA 2M88A 1N33K 4ZPCA 1GLDG 2OPRA 3DCAA 1S48A 3QRPA 4WFXA 1RT5A 2B4JA 2W2NP 5LMUJ 3M8ZA 3RW7A 3DAWA 3GCXP 1IBKJ 4DEZA 2F8EX 5BN9A 1YF5L 2XHWA 4PAAA 2XMMA 2LFVA 4JI1F 3WUHA 1MU2A 4YY3K 1Z6RA 5C42B 1B7YB 2PGCA 3UCUP 1IQTA 4BRNA 4DU7A 1W2IA 4Y2MA 3KNGA 4I2PA 3A8IA 2QE5A 3BKUA 3MECA 1SKRA 2HW3A 2F4VK 2LEBA 3OS0A 1NUEA 5F8JA 3CCTA 3KLFA 2UUCJ 2H3GX 1QZ6A 1VFJA 1BI4B 4IG3B 4DQIA 3C16A 4PA1A 3B6OA 3BKFA 2F4VJ 5KT6A 1CC8A 3P4IA 3BEXA 3ZLJA 3CQYA 1S7IA 4R8UB 1WD6A 4LSZB 1WBBA 1LCUA 1GMUA 5BJRA 3BF3A 1PBUA 3P83D 2ZITA 4KH0B 1XC9A 1ZPVA 5AQPA 3TO8A 2VF3A 2IJNA 4R79A 1CULB 2A18A 3KLFB 1ZYQA 3B6BA 1VQYA 1LW0A 4RW4B 4ELUA 1SKWA 2P51A 1HBOA 5LT5A 4KHYA 4BBYA 2VYPA 2RH3A 2NRHA 2AT1B 4I2PB 1XR5A 2VPWB 1NK0A 2R7UA 1OH6A 2LQJA 4H5VA 3BF4A 2FD2A 4PG5A 3SQ0A 3C6AA 1KKHA 3VN5A 3T6JA 4QOTA 1G99A 4F26A 1X9SA 3M9OB 3S3MA 3PRDA 4YOYA 3CJBA 1S6UA 3FBFA 4UY85 5AFUA 5CYQB 5K8PA 1UWAA 5J2NB 5KFQA 3VQPA 4CJWA 3OT9A 2NRVA 4K8RA 1K9MO 2Z58B 2YV0X 1YTUA 3I32A 5LXYA 3HSCA 2VOOA 5IQQA 5HO4A 1PYTA 1FRMA 4CVNE 4YHHK 4K2XA 2MMYA 4EYHB 3ICLA 3NF8A 2MKJA 3TAMA 3C8YA 3IC1A 2GUIA 1TMMA 4C8NA 1DBDA 1REGX 2RN2A 2XYPB 3OTOK 1KLNA 2W2MP 4X4SA 1SQGA 1A5WA 4DL0C 2HMPA 4O3SA 2NZ4A 1M5HA 3FEXB 4K4SA 1HR0J 1I6JA 3OFHA 2ASJA 2QIFA 1XC3A 2RB7A 1N88A 4Z4EA 2EC0A 4ZCIA 4A8SA 2OTJN 3CJAA 3KUGA 3HSJA 2HFOA 4ZIVA 4NASA 2YWEA 4FLWA 3OSNA 3AVJA 1IKWB 3A13A 4GMJB 4O8KA 4CJRA 1QAIA 1XK8A 4QPTA 4EO6A 3DFEA 1Y9OA 3H5XA 3E9PA 2Y1IA 2IDEA 2RE1A 3GG0A 5D4PA 1HBNB 2KLAA 4AT1B 3THXB 4ILGB 4Y0WA 3PHEA 1TUUA 1FJGK 3DLKA 1U09A 2L41A 1NPPA 4ED1A 2EFNA 1LWEA 4WP3A 4ICLB 2B43A 4MLEA 3KIOA 1QAXA 2R7WA 4DV1F 4Z4FA 3L9ZA 2NXEA 3BQ0A 4LSLB 2CJXB 5D0GA 1KQSM 4B9SA 4HDGA 3OL7A 1Z26A 1WSFA 2AYEA 3VA3A 2B4OA 2KJWA 4DQ8A 3CJQA 1XNQF 2HHPA 3KLIB 1ZETA 3HJFA 1T6DA 3QIPB 1VGYA 1O5JA 2E5JA 3B4DA 1ASUA 3P39A 3KDOA 2P6SA 3Q7BA 4IOAQ 2YWGA 3DLLL 1HARA 3UKRB 5GMKa 4PG8A 4K4XA 3I6PA 3G71N 3NCIA 3D1QA 2HRTA 3SI8A 1TV6B 2B9YA 3ULDA 4DV7F 5BYSA 5GAGU 4LQ3A 5JJBA 3ATUA 4IKFA 3CD0A 1KS2A 3W5XA 3ID8A 4M7XA 3C46A 2MHNA 4TKTA 2HBQB 5LMNF 3CD7A 2PBDA 3QSIA 3EGNA 1S4FA 5HL7Q 2MLYA 3CJ0A 3HFZB 3I55S 1SKSA 2AYGA 3W8PA 5C25A 3M9MB 1L5UA 4B9LA 3V4IB 2A6MA 1K73T 2W9BA 1S97A 4E2FB 4NLOA 1HMVB 4KPYA 3EE9A 4RCHA 2XY6A 4IO9Q 2OPRB 1PCAA 4TYBA 2MKYA 3CJ1A 4IDKB 2CPIA 3UCGA 4PKIA 5BYQA 1WHVA 2CPDA 5L38A 4ECTA 2XI3A 4NZ0A 4CEAA 3UNYA 3BO3A 4KHSA 2HG4A 4FWSA 1WSVA 5HQLA 4IYQA 5GIOA 2DB1A 1JK9B 5BN8A 1NCLA 4WFNQ 5JVGQ 2YWWA 4JV5J 4ECQA 4LF8J 3TJAA 4J9KA 3A5OC 1D09B 1QAYA 4F3MA 2FYXA 4CGGA 2KRRA 1V4TA 3C15A 3ZXWA 3HHEA 1XMQJ 4OI1A 4CBWA 1W97L 4F25A 3DHWC 3OYJA 1U0HA 1S1TA 1BQMB 1JLBA 1TVRB 1TUGB 2KYXA 1Y64A 1RT2A 3UWTA 5MAOA 2R2RA 3C14A 2CQCA 1X3NA 4O4GB 1VYAA 4RTFD 1RBSA 4PQUB 3ZX0A 3ITHB 2DNZA 3AXMA 2E1YA 5MLCQ 2YJEA 2ASOA 3PG9A 1X7VA 3QWUA 3VGSA 3CJ9A 3GDQA 1NH8A 3QJJA 1EKEA 2YXLA 2QO3A 4EFHA 1XMOF 4B1WB 3SNNA 4NCAA 5HLFA 3IBCB 4ED0A 4CQ1A 1HNWK 2ZUAA 4WFBQ 1VQPN 3CI5A 3G86A 4KI4A 3CCJS 5E3QA 5LJ5Y 2W2QP 2HNYB 4FJKA 1BQNA 1N5YA 1XWLA 5SZTA 1HW9A 4ZK7M 3KK2A 1EKSA 3GJSB 3G82B 3O1BA 5BPLA 1GTEA 4DZDA 1CJVB 4MIBA 1SQKA 2KH9A 3LDNA 3J81j 1UAWA 2C3UA 4FZYA 3N79A 5EHHA 2R7SA 4X64F 3DOMA 3WXJA 3SSSA 3E01B 3CXCR 1SZ2A 3ZZ0A 4ZLPA 1S1XA 4C1NI 2FJXA 2P9KA 4MTPA 3QT7A 5D4LA 3DLHA 2KM8C 2V9WA 3T69A 3BZQA 1WHYA 1UA1A 3UDCA 4Z4CA 1U1QA 1HNXK 4NLTA 4DSKA 3CWJA 1KFSA 2M3DA 3VGKA 3R3LA 4IFYA 1D3WA 1Q18A 3KKRA 3ELHA 2D0PA 2BJ1A 2F8MA 2X78A 1VC5A 1TKDA 3K5OA 1HUXA 3PACA 4MAKA 5DMRA 3PEHA 3AQPA 4HEA9 4YN3B 3VEYA 2DXEA 4LIRA 4C8KA 1KVAA 1RU1A 3GFYA 1LWCA 1VI7A 3VWSA 3J7ZT 2I5JA 1OH8A 2ROGA 2O8BB 4A2AA 3OYAA 1VSFA 4TN2A 3MWTA 1C4AA 1TFWA 3P4UB 3CTRA 4EBDA 2WONA 2DHXA 3HT0A 4FBTA 1J2VA 2ZH2A 3BYPA 2YQ3A 3G82A 3SQGA 3G8SA 3M8RA 3I33A 2VKZG 2OPPA 2CGKA 2GJFA 3M1VA 3RB0A 1IBLF 1T03A 5GAGP 5AXNA 1NOZA 5F0WA 3V9UA 3L2UA 1S99A 1IBCB 5J1NA 1B99A 4DFKA 3ZSXA 1RBRA 2Q66A 4K5RA 4DTUA 4BRHA 1N33J 4MT1A 3DRPB 4N47A 3I4PA 4GKKJ 1VLOA 4A4JA 3CJ8A 3BS9A 4E7HA 3L6QA 2N3OA 4B3RK 4I6YA 4FLXA 3UKUA 3R5AA 5AJ3F 3DI6B 3ITHA 5DGBA 2D0BA 2LU1A 1R8PA 4LJMA 5AQZA 1OY6A 4GVBA 3FVYA 2J9EA 4DR5J 1XHXA 1V3RA 1BQMA 1JLBB 1I3AA 1KVCA 3N6LA 3F41A 1RBUA 2MLZA 1JLQA 5I3PA 4RW6A 3B6PA 2IJRA 1NJXA 1UFLA 1MG7A 1UPPA 2DPIA 4V19J 1RDUA 1O1WA 3ULEA 1SJFA 2BV3A 2DIVA 2L08A 5HATA 1DFDA 1CJUA 1JNRB 2GGPA 2CIMA 1IR2A 4A8QA 1F6TA 3OBWA 1R89A 2ZBPA 3PDNA 3LP3A 3ENHA 1KC8O 2WB1D 4IJAA 3V1QA 4CGIA 5LM7E 3SSRA 2YNIB 3K2YA 2ZJRL 4C1NK 1NLVA 1CJVA 4E1JA 4PWDA 1HMVA 1FFSB 1RLCL 4A5AA 5CHIA 2NYIA 1KD1T 3AO3A 2KZMA 3CDUA 1N0VC 2HZCA 1N34K 1JXVA 1AYEA 5FIIA 1RTIB 5IQ6A 2JFKA 2I7PA 3ZTSA 2MZJA 2BANA 1J5OB 2V8VA 3RMDA 5AQSA 4FWOA 3LP0B 5M2RA 4F04B 3G71S 1X5PA 1BG3A 4X4QA 3TAFA 2H5EA 2P9SB 2CA9A 4A8OA 4Y3CA 3R1LA 3U9ZA 3QMLA 3K5MA 1F5AA 1RGIA 1VQ4S 2OELA 3POTA 2EWSA 2CQGA 1N32K 3HPGA 4QWDA 4ZP7A 4BRFA 4U7UD 3KWIA 1K8KB 1RT4A 3IR6B 2FSJA 4KGKA 3N4QA 4RUHA 3O9SA 4HUEA 2HBLA 4NA2A 1RDCA 4OFZA 5KGXA 3M9NB 5FRNA 4I68A 3DJCA 4K4VA 5T7BA 4L74A 4CO3A 4CJ5A 3RAXA 2V4JB 2GWJA 1WORA 4HT5A 2AP6A 2LP4A 2WVEA 2HRUA 4ZVPB 1NHUA 1QSYA 1NEEA 2ADCA 1FDDA 2YQ1A 1ZBSA 3GYNA 2F3JA 2HS0A 1RTJA 2XZTB 1BY9A 3SBTA 1UWBA 4NI2B 1WC0A 5C24A 2KHDA 4ANEA 2LKZA 5FRMA 2AX1A 3A4TA 1RKJA 4AF1A 4A61A 3CCZA 1T9VA 3SV4A 5KFBA 3SUOA 3UQSA 1QDUB 4YB7A 4NZ6A 5B0CA 1N36K 4YB6A 4B3TK 3ETOA 4DS4A 4QR2A 3IDHA 4Y2KA 2FQQB 4IDHA 2OA8A 2NYHA 2CPJA 3LUYA 5KFIA 5LL6Z 1EXQA 3SK3A 4WFNL 3CFOA 5JVGL 1CJTA 1HKBA 1SUQA 2CYYA 1N0UA 1UW9A 1JXEA 4KHWA 2COLA 1HNVA 1SQFA 5IXUA 2IYIA 4MKYA 3US5A 3V6DB 2FGOA 2LXUA 1HI8A 1ZAWA 1VBKA 1XIQA 2P8IA 2ZWOA 3PYFA 1JJ4A 4FWPA 2NXCA 5B0DA 4DSIA 3KJVA 4DV6J 3PX4A 4BG8A 1LAWA 2UUAF 1VBYA 1NRKA 3BB5A 3I4HX 3I0RA 1NGFA 3V1OA 4P10A 3AVNA 4CHPA 1DQ8A 4NXNK 1T9YA 1FJGJ 3MURP 1G6BA 4N5SA 1I3OB 5GMDA 2ZBCA 2HFSA 2HLTA 4LFAK 2GHVC 2PEBA 2WVBA 4X4UA 5CYQA 4YDDB 4J9LA 3NNHA 5IOLA 5JUMA 3DLBA 4ELVA 1QZ5A 5GADU 1T9UA 3SCKE 3GU0A 2UXBF 3OXFA 1W25A 2A6OA 2H5IB 3DLGB 2BXJA 2HMIB 3KWGA 3KMQA 4NLUA 2BDPA 2R7XA 3MAAA 4C8LA 1F60B 2GBZA 5F0XA 2JNJA 1JLFB 2ROPA 5KFLA 1YWXA 4CH7A 4CO1A 3CCLN 1H38A 5BR8K 3AT1B 2PT0A 2ZZNA 2J7KA 2E4LA 1PJ7A 2MLXA 3X1LB 2FZCB 4Y34A 3SFGA 1QLNA 1YSJA 2BUNA 4DV5K 1CLFA 2XBPA 4RW9B 2MZQA 4CJTA 5KFGA 1VQSA 2AJFE 1P1LA 3ULEB 3TRGA 3RBXA 2C22A 3MGJA 2CQ2A 5HMXA 4RBUA 3PIOQ 4LY7A 4B9NA 4FJ8A 4M3WA 3A3PB 1JLQB 3D6TB 1XMOJ 2R8JA 3KHYA 2UUCF 1EQMA 3AA8A 2HSEB 3PW0A 2YPYA 1GLFO 2DY9A 3H08A 2JGUA 4OYBA 3AGRA 2YHYA 3VGUA 1IM6A 3MXJA 3M8YA 3ZTPA 3E66A 3OLAA 3UKUB 1PGZA 3L0QA 4DQQA 2AF6A 3RSEB 1YKWA 5IT9Y 1A0OB 3CD5A 3VQ5A 1VC0A 3CD6N 3AD9C 3NF9A 2HVHA 4DI6A 3QT8A 4IRDA 1IBKF 2PFFB 3R1XA 1NGGA 4FW2A 4BROA 4Q2MA 1Q9YA 4C6AA 3UW1A 1X4DA 3D6RA 2F40A 2PFUA 3K5NA 3S1TA 4C0OC 1VRUB 3LA0A 4KSEB 1NGHA 4Q2LA 3GIIA 2E1CA 5J2MA 1FERA 3O5BA 5KFXA 2LEAA 4KBIA 2RRAA