3KK2A

Hiv-1 reverse transcriptase-dna complex with datp bound in the nucleotide binding site
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
555
structure length
555
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 156
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk2A05
3HHKA 1NK4A 2ASLA 1WSJA 2OZMA 1LWFB 1RYSA 1JLAA 4B3OB 4FLWA 4E7IA 3K57A 4F2SA 3PV8A 2X74A 3KLGA 2HHSA 5CYQA 4PUOB 4KE5A 4DFPA 3ISNC 3C6TA 2F8SA 2YNHA 1JKHB 1LW0B 4DF8A 1RT4A 2R2RA 4CIEA 4TYBA 4ECSA 4IFVA 1JIHA 2R7YA 4IG0A 4FYDA 4EEYA 4CJSA 2AGQA 1RT7A 1RDDA 3D0PA 3L3UA 4OPKA 3NHGA 1T94A 4FW1A 4CF0A 4IDKA 3ASMA 3FDSA 3ALYA 2VG6A 3DRRA 5F8HA 4FLUA 4K4TA 3CJ0A 3MEGA 1VSKA 3AVIA 4EZ6A 5KFPA 4MKBA 4HVJA 4CJEA 2WTFA 3OHBA 3KLFA 4ED8A 1YT3A 2YNIB 5KFYA 1IG9A 3G6YA 2HHTA 4ECXA 4M3YA 5KFUA 3GILA 3DLHA 4U6PA 4O3OA 3LP0B 2Z1HA 1B9DA 5JS2A 1S49A 2F8EX 2W9CA 4DL6A 4CHQA 4BACA 3SQ4A 2HNZA 1WSEA 3E51A 4F4YA 4EBCA 4W5OA 2OPPB 5FRMA 1XWLA 3BQ0A 1HYSB 2HHUA 4ZVHA 3VQEA 3BQ1A 4CECA 1K1QA 3KLIB 4E1NA 3HM9A 4CIFA 3FQKA 5HLFA 4M3WA 1SKWA 3OL6A 1QTMA 4K8XA 3SCXA 3TABA 3GQCA 1C1CA 5KFEA 2BANB 4OKEA 4KV8A 2E4LA 2FJWA 5I3UA 2PZSA 1BI4B 4YMEA 2D5RA 4DF4A 4O4RA 3JSMB 1VSIA 3OJSA 4LSNB 2VG7B 4N56A 4LSLB 4NCGB 4KAIA 3RWUA 2HHXA 4EYHB 3SQ0A 1JLCA 2RN2A 5T7BA 1HQUB 3LP1A 2R2SA 1W25A 3MEEA 2RKIA 4CEFA 3ITHA 1BGXT 1JLQB 5CZ2A 5F9LA 1QSYA 1LWCA 4JS4A 4FJ5A 2B4JA 2B6AA 4CJ4A 4CK2A 3DM2A 3ICLA 4IRCA 1RT3A 4E7JA 4KO0B 5EU7A 1ITGA 3AVGA 3PW7A 3D5MA 3SUOA 3O3GA 1D9DA 4CHZA 2I1RA 4Y2CA 4PY5A 4FJLA 1HARA 3BR9A 2ASDA 1SL0A 3NDKA 1LV5A 4N76A 4O3QA 4HTUA 1C6VA 3I5AA 3BSAA 3ZT3A 3KLHB 5DK5A 3V4IB 5C42A 5JUMA 2IC3B 4CF2A 1RT5A 4DTOA 5KFDA 3I0RB 3HSTB 4QWEA 5T14A 4C8OA 2XCPA 3V6DB 3F9KA 4DU3A 2OPSB 2KZZA 4Z4HA 3LZIA 1QSSA 2GIQA 4J9MA 2DPIA 1WN7A 2JEJA 1RT6A 2XGQA 4TY9A 4K4XA 1F21A 3OJUA 3DOKB 3KKRA 2OA8A 2FBTA 4K4ZA 3K58A 3EY1A 3E01A 3TAFA 3HPOA 2FLNA 3VQ7A 2R2TA 4AHUA 4RG8A 4IDKB 3RTVA 3T1AA 2FVCA 1BIUA 4XO0A 2ALZA 3OL8A 3G0ZA 3LALA 5HRNA 4AH9A 2Y1IA 4IOBA 4B8CA 4ID5B 3OYIA 3MECA 3KLFB 3OYFA 2NUBA 2FC0A 2LSNA 4DL7A 5F8MA 3P83D 2AGPA 3M8QA 1I6JA 1D8YA 4CEAA 1KLMA 3WNHA 4CF1A 4CK3A 3NL0A 3TI0A 4PQUB 1ZBUA 1FKOA 4NLVA 4I2PA 3MXJA 4AILC 3AVCA 3SV4A 5CY4A 5HRSA 2FVRA 4CCHA 4RW4B 4FW2A 1NKBA 5I42B 4DTRA 1EP4A 3OYHA 2IAJB 2XY8A 1S1TA 1WSFA 3IAYA 3BREA 4Q8FA 5J2QB 3L2QA 3T5KA 3NAHA 1VSLA 1TL3B 5F8IA 3M9MB 3RB4A 1HNVB 4FK4A 4FBUA 3DMJB 3MFIA 2B43A 1RBSA 3QLHA 4J2BA 3DRSA 1TVRB 4CHPA 2V9WA 2G8KA 4F2RA 3TVKA 3NCIA 4B9NA 1IKWB 3AO2A 3ZCMA 4KHYA 3JYTA 4FS1A 3NBPB 4AHRA 5F8GA 1S0OA 2O4IA 1RDCA 5L1LA 2XGPA 1JXBA 4IG3B 4CHNA 4G1QA 4I7FB 1ASUA 5K14B 2I5JB 3SFUA 2P5GA 1CSJA 2YNFB 2ZD1B 2W8LA 2PY5A 4O5BA 3TAPA 3LPTA 3K5NA 2YHAA 3HPGA 1LW2B 4MK8A 3SNNA 1KRPA 5KFXA 3OYDA 1S1UB 1C1BB 4ZVFA 5DG8A 2XI2A 4NLOA 4ZP6A 1TKTB 5KFRA 3CJ5A 4ZVEA 2W9BB 4CEDA 4HCBA 4O44B 4C8KA 3QESA 5KT7A 1S6QB 3ISND 2ZE2A 1U49A 1RT5B 1S6PB 1TKZB 1WNSA 5F9NA 4FLZA 1HPZB 4LD0A 2RDJA 4IR9A 4ICLB 3L3VA 3CJ3A 4RW9B 1BQNA 4YR2A 2A1SA 3GYNA 2Z1IA 1T05A 1UWBB 3KLEA 3NAEA 4KHNA 5KRSA 3FSIA 3RBDA 3LWMA 4QW9A 4I2QA 3V6HA 4M3UA 4CJTA 1DTTA 4MFBA 2OPQA 4YNQA 3GV8B 4CJVA 4Z0UA 2IS3A 4O3NA 2FJXA 2O5DA 3OS1A 3KJVA 4DTPA 2IDOA 4DG1A 4O3PA 5C25A 3N6LA 2WRMA 4NLWA 1SL1A 3CDWA 4AHVA 4FK0A 1S1WA 4CEZA 2AGOA 2WB4A 2IMWP 4KKOB 4NLUA 2FLLA 3M8PB 4NLPA 1SH0A 4DTJA 4RNNA 1S1XA 5KFCA 2HAIA 3ZT1A 3LP2A 4QWBA 3O4QA 5FDLB 3AA4A 2VWKA 3SZ2A 1T7PA 3VQ9A 1Y97A 5SWMA 1TV6B 3H4BA 3HVRA 4J9SA 1KFSA 2B5JB 5SZTA 2P5OA 4URQU 4JUZA 4F3OA 4G3IA 1FK9B 3AA5X 2VG5A 3KIOA 4TY8B 4DTNA 3EPIA 1BCMA 2E9ZA 3AVJA 3HL8A 2C22A 4KHQA 3RAXA 4E7LA 1ZTTA 1NOZA 4GW6A 4TQSA 1DTQB 1NK0A 4WE1A 3CYMA 1Q9XA 1NJXA 4B9VA 1EP4B 3KHHA 4B9UA 4CJKA 1JXEA 3KK2A 3FFIA 4PWDB 3HP9A 4TLRA 4RNHA 3G10A 2DFFA 1EKEA 3OSNA 1JL1A 5J2MA 2QK9A 4J9RA 3ZSVA 4FZZA 2XY6A 4Q43A 1SKRA 2V4QA 3Q8PB 3NFAA 4E3SA 1X9SA 4GMJB 5KFSA 3B6OA 1BISA 4XPEA 1HQEB 1XHXA 1KVBA 1RDBA 5KFBA 4R8UA 4DU1A 3LDSA 2E9TA 4W5RA 3TAMB 4HUEA 3LANA 4KTWA 4FJXA 1NKCA 5KT3A 3IG1B 4CJWA 4G1QB 4ECTA 4QW8A 3BDPA 1TAUA 4E0DA 1S9GA 3H5SA 3ZSOA 4AHTA 1XHZA 4DTSA 4J9QA 2R8GA 1IO2A 3H5UA 1L3VA 3HKWA 1HRHA 3NGZA 1KFDA 1TKXB 4DQPA 3DLGB 1KVAA 4QCLA 3HVTA 3MTKA 3KHLA 2FBYA 4CGJA 5J1EB 3C6UB 4OKJA 4RW8B 2IA6A 2X78A 4CEOA 1VRUB 4DEZA 5KFJA 4DS4A 4DSLA 4CJPA 2WONA 1SV5B 4J9PA 3PO4A 4FLTA 1HMVA 2KW4A 3ZT4A 5FRNA 4YR3A 1RDRA 4FLXA 1XC9A 4OL8A 1MU2B 4FJ9A 1KHWA 3RB3A 1IKXA 1R0AB 3QEIA 3I0SB 4F4WA 3OYLA 1A5WA 4KB0A 2BQRA 3IRXA 5CYMA 4CK1A 4MFBB 3OL9A 4QOZB 2EC0A 3SQ2A 4H4MB 5KFMA 1RBTA 4O55A 4ZP7A 1BQMA 3OYMA 5J2NA 4KTZA 3PW0A 1VRTA 4CJ3A 2RF2B 3OSPA 2IGIA 4EZ9A 2ILZA 4Q8EA 2J6UA 2R8HA 4DL3A 3OYGA 3HVWA 3I5BA 2FVSA 4ZP8A 4OGEA 3LZJA 3BGRB 2X6SA 1A5VA 3TARA 1UA0A 3KTQA 1RT1A 1S5JA 4H8KA 3HYFA 3NF7A 1KLNA 1QS4A 2XRIA 5KFWA 3NAIA 2F96A 3DI6B 3CIZA 4K4WA 3DRPA 3DYAB 4ELTA 2OH2A 4CEEA 2R8IA 4LH5A 3QIPB 3KK1A 5KFTA 3BSNA 1KSPA 3M9NB 4LQ9A 5HBMA 5L1JA 2J6TA 1GX5A 4JV1A 4CF8A 4QWDA 2HMIB 1RTIA 1J5OA 1QAIA 1T3NA 3P5JA 3L2VA 4IFYB 4F4KA 4KHUA 1W9HA 2BRKA 1CXQA 3RRGA 4H4OA 2KZMA 3C95A 3TANA 3DLKB 4IRKA 3CFPA 1JLEA 3QZ8A 4W5TA 1WSGA 1RTHA 5DQGA 2Z1GA 4KPYA 3K59A 1IKYA 4WZQA 4ECYA 1N6QA 4KHWA 1BIZA 1C0UA 4DL2A 3KNAA 3PW5A 4NRTA 1KHVA 1JLFA 4CFDA 4Q0BB 1JLBB 4R5PB 3QEVA 1GOBA 1RTJA 5KT5A 4IH5A 3UR0A 4URSA 3LAMA 1BL3A 3GV5B 1D0EA 1JLGA 1NNDA 1K6YA 3RBEA 4EP5A 3QEWA 5F8NA 4RZRA 3PW2A 2DY4A 2AWZA 1S9EA 4MK9A 4DSJA 3K5MA 1RT2A 4E7KA 4E7HA 1TGOA 2IM3A 3NF6A 3HVTB 3L8BA 3KK3B 5KFFA 4Z4EA 3OS0A 2VWJA 4J9KA 1Z26A 4LQ3A 3SFGA 3PY8A 3QO9A 4O4GB 3QNOA 4TQRA 4HCCA 1EETA 5HROA 1ZBHA 2WOMB 1WSIA 1RCHA 1LWEA 1RNHA 1ZTWA 5KT4A 3VQ5A 1RDAA 4E89A 1U45A 4QAGA 1O1WA 2HVHA 1VSJA 4FS2A 2HHVA 3RMCA 1JLAB 4MKAA 1NK6A 5KFKA 3TR8A 3KLGB 5CYQB 1TP7A 2HHQA 5HP1A 3C6TB 2YNHB 3QETA 3PVXA 2D0BA 3THVA 4CFBA 1RT4B 3CDUA 3H4DA 1WLJA 1IH7A 2W8KA 4IFVB 3FQLA 4IG0B 2HNYA 4KFBA 3AA2A 1RT7B 1D1UA 1S4FA 1SH3A 1I39A 3QGHA 5DLGA 4CIGA 1BQMB 2W9AA 4TYAA 5J2NB 1RBUA 4JV0A 3KHGA 4M94A 4RNMA 2VG6B 1BCOA 3DRRB 4WFYA 4EYIB 3MEGB 5FROA 4ELVA 3QIOA 3V1OA 1RTDA 1NKEA 2Z1JA 3MR3A 1C0TA 4YR0A 5L1KA 1REVA 1SUQA 1IM4A 3MEDA 1VK0A 2EHGA 4C8MA 4ELUA 2BR0A 1TK0A 2IM0A 2D0CA 1N48A 1HJRA 4M3XA 3DRPB 1KVCA 2W9CB 1OS5A 2R8KA 4M42A 2IJFA 3KK1B 4RUCA 1U04A 3IS9A 2HNZB 4GC6A 5DGBA 3LAKA 4CFAA 2OYQA 4KI6A 5HBMB 2IJNA 4FM0A 3UQSA 3S3MA 4ZHRA 5KG6A 4NLRA 5KGXA 3DLEA 3CDEA 4DTUA 4ZVGA 2ILYA 5J2PA 1CZ9A 4E1MA 2D3UA 1S1VA 4FJ7A 5HLFB 1TK8A 1QHTA 3H5YA 1C1CB 1CLQA 3T5JA 3MXIA 5HRPA 3C94A 1RTHB 4KV8B 4DTXA 5I3UB 3B6PA 2AX0A 4GC7A 2XO7A 2HVIA 4EP4A 4FZXC 1QSLA 3IGVA 3PR4A 1FKPA 2YNGA 4CJFA 4CGGA 1JLCB 3OLAA 4C8NA 2BE2A 2ITGA 2R8JA 4BDZA 4NLTA 3LP1B 1ASWA 4IBNA 4KREA 4KBIA 3MEEB 3V81A 2C2RA 2RKIB 1NK5A 2CJQA 3ITHB 4CEQA 4RW7A 1LWCB 4NYFA 2B6AB 4W5NA 4YP3A 4M95A 4O0IA 3DM2B 1HNIA 1RT3B 5KFGA 4NLGA 4WYWA 1LAVA 3DOLA 3SUPA 3V1QA 3K5OA 1Q8IA 3NF8A 3S3NA 3KMSA 4J9NA 2QE5A 5E41A 1QE1A 2A1RA 3SUNA 4IH6A 2YKNA 4WZMA 3VQQA 1T8EA 2GUIA 4M3TA 3EZUA 4LY7A 1RAJA 3NF9A 3BSCA 4FCYA 5C42B 4J9OA 1JX4A 4B9TA 1IKVA 5KGWA 1UA1A 3UPFA 4HUGA 3NH1A 2OPRA 3KKSA 4F4ZA 1N5YA 5KG0A 3KOAA 4ZTFA 4MK7A 4OGCA 2AJQA 2F8TA 3RAQA 3DLRA 4FZYA 3ZSRA 4ECVA 3V9SA 3MAQA 5KTQA 1U4BA 3QEXA 1SL2A 1RT6B 2JLEA 3GIMA 3AVBA 1N4LA 1S97A 4B3OA 4Q44A 3TQ1A 2GV9A 4DL5A 3E01B 4PUOA 5DG7A 5F8JA 5C5JA 3ZT0A 1JKHA 4QWAA 4NRUA 1LW0A 1ASVA 3Q8SB 4B08A 4QWCA 2FJVA 2WHOA 2ATLA 4ECRA 3ZSZA 4IQXA 2IM2A 3MECB 1VSEA 3H40A 2JGUA 4NYNA 3HT3A 3KD5E 3AVMA 4B9MA 4ECZA 3M8QB 2D3ZA 5L1IA 1KLMB 5KFNA 2ATQA 1RILA 1WAFA 1FKOB 1YVFA 4I2PB 3P1GA 3NKYA 1S10A 2UUWA 1ZETA 1CXUA 4FJ8A 3QEPA 2YNIA 2R2UA 1S0MA 4LH4A 4URGA 4RNOA 3U3YA 2HNDA 1ZBIA 3NE6A 1S1TB 3DLEB 3CVKA 3LP0A 5EWFA 3PR5B 3HK2A 4ZPBA 3RMBA 1EXQA 5KFAA 1T03A 2BRLA 3T5HA 3AO5A 2AQ4A 2E9RX 1EX4A 2OPPA 1TL1A 1TAQA 3QLHB 3DRSB 1HYSA 3OYJA 3PZPA 4YFUA 4NLDA 5KG1A 3V9ZA 3V1RA 3L2WA 3KMQA 4CERA 2UVRA 3CQ8A 1ZBLA 1W0HA 4B8AB 1FKPB 3JYTB 4CGIA 2WK4A 3QNNA 2BANA 4NYZA 2DPJA 1S9FA 3V81B 1J54A 5KG4A 1BI4A 2OZSA 3AVAA 3JSMA 4ECUA 4LSNA 2VG7A 4LSLA 4NCGA 4NZ0A 1L3TA 2JC0A 1YTUA 1HQUA 3AVFA 4M3ZA 4ED2A 5KFVA 3IN5A 2FBVA 4JRPA 4MIBA 1JLQA 4FM2A 3V9UA 4HKQA 3EZ5A 4Y3CA 3SYZA 4ZMMA 4NLYA 1RA6A 3ZSXA 3ULDA 4KO0A 1B92A 3Q8RB 4AHSA 3QGIA 2FLPA 5C24A 1B9FA 2AX1A 3HJFA 2ZE2B 3PJWA 4FJMA 2Q3SA 5KG5A 4FLVA 4WFXA 1S48A 2XCAA 5KG7A 3PJXA 2DFEA 1ZBFA 1BQNB 3KLHA 1UAXA 4IR1A 2UVVA 1KCFA 3F73A 2FVQA 1T05B 3KLEB 4BE2A 2IC3A 1RBRA 3TAGA 3BQ2A 3ZSWA 4I2QB 2P51A 3K2PA 2KTQA 2GBZA 4JRQA 4WYLA 4N41A 3AVLA 4K8ZA 4NLQA 1DTTB 2OPQB 3GV7B 4EBEA 3ZSYA 3QIDA 3NGDA 3MXMA 2BDPA 1VSHA 4EBDA 4XIUA 3G6XA 3I0RA 4RW6A 3KJVB 3AVHA 4DG1B 4C8LA 5C25B 4HUFA 3L2RA 4DS5A 3V6DA 4DL4A 1S1WB 1TQLA 2HWIA 5EWEA 1NJWA 2OPSA 4YQWA 4MQ3A 4DQQA 3OL7A 1S1XB 3WNGA 3LP2B 1KTQA 2E6MA 3DLBA 3DOKA 4DQRA 4ED7A 4Y1DA 3CM5A 4DMNA 3NGYA 4E19A 2FVPA 3SI6A 4ECQA 4Q45A 3U3GA 4OLBA 4BWMA 5HRRA 3PX0A 4DTMA 5JXSA 3KD1E 4X2BA 3OYKA 3H98A 4KSEB 5CZ1A 3SJJA 2VG5B 2D41A 4IKAA 2HHWA 4OVLA 3OLBA 4ID5A 3UIQA 3CJ2A 3DDKA 3T3FA 1WNEA 2HNDB 2VA3A 4ID1A 4WE1B 2XY5A 4PA1A 4CF9A 4PQUA 1XR7A 3KK2B 4O3SA 3FFIB 3AO4A 1T03B 5J2MB 3ZT2A 1I3AA 2P1JA 1GX6A 3H59A 4RW4A 1TL1B 3HO1A 5I42A 1YTAA 2EX3A 2IAJA 4DLGA 5J2QA 4KRFA 4RUAA 1TL3A 2RDIA 4FVMA 4R8UB 1HNVA 4H54A 1ZYQA 3HPHA 1CZBA 2JEFA 3T5LA 3DMJA 4ZTJA 5DLFA 2QV6A 1MMLA 3OYNA 5L9XA 3OHAA 1TVRA 4FJIA 2UVWA 3CG7A 1S9GB 1IKWA 1NHVA 4KB7A 2JEIA 4CEBA 3M9OB 1NHUA 4FJKA 3NBPA 3KLVA 2XHBA 4NCAA 1JL2A 1RA7A 1U48A 5KG2A 4DQSA 3NH2A 4FJJA 4DFMA 1Z25A 4IG3A 1GOCA 3HXMA 4I7FA 4CESA 3U6FA 4U7CA 3QZ7A 5K14A 2I5JA 3GIJA 4NLSA 2YNFA 2ZD1A 3VQAA 1RYRA 4UQGA 4DWIA 3H5XA 3T19A 2AU0A 4CJLA 2WONB 1LW2A 4CHYA 3BJYA 5C24B 3G6VA 4OKKA 4IH7A 2PYLA 4Y1CA 3CM6A 1HMVB 1S1UA 1LAWA 1C1BA 2ZKUA 3MR2A 3L2UA 4CHOA 1TKTA 3CFRA 1SKSA 3OVNA 3GIKA 2W9BA 1IKXB 4O44A 4F4XA 3S3OA 1S6QA 3QYYA 3VQBA 3V9XA 2J6SA 3IRXB 4FM1A 1S6PA 1TKZA 2BGGA 3VQDA 4DU4A 5CYMB 1HPZA 5DMRA 2YV0X 3GIIA 4ICLA 4IRDA 4RW6B 4J2AA 3SI8A 4RW9A 4CJQA 3S9HA 1NJZA 3PW4A 5EWGA 1UWBA 2JC1A 1GOAA 3TAQA 1VRTB 2G8HA 3RB0A 2C2EA 4F50A 4DFJA 2XWYA 4FLYA 4KAZA 5KFOA 3LPUA 4Z4FA 3WNFA 4M3RA 4R0EA 1DLOA 2BQ3A 1C2PA 4IKFA 4KKOA 3AO1A 1RT1B 3M8PA 4OPJA 4J2DA 3QGGA 4BE0A 1C0MA 5F8LA 4XPCA 4ED1A 3V6JA 3KHRA 5FDLA 3HVAA 2C2DA 4KHSA 3O3FA 1TV6A 2IBKA 4JV2A 4CGDA 1D5AA 2B5JA 3SQ1A 1FXXA 1Z4UA 4KHMA 4ZP9A 1FK9A 1RTIB 3M8SA 4I9LA 1J5OB 4K50A 1A5XA 5KFZA 4TY8A 2D0AA 1NOYA 3OY9A 2E6LA 2XC9A 3EYZA 1VSDA 2KFNA 3NGIA 3LP3A 3LWLA 1SH2A 4H4OB 1JXLA 4QPXA 1BHLA 2PYJA 2W7PA 4KI4A 4K4UA 1DTQA 1WSHA 1Q9YA 1JLEB 4W5QA 4CE9A 4BWJA 1QAJA 4FJGA 3VQ6A 4B9LA 5D3GA 1IKYB 4PWDA 5EDWA 1N6QB 1C0UB 4Y2AA 1XR5A 1JLFB 5EUHA 3AV9A 2W42A 4DSKA 2UVUA 2YKMA 2RPIA 2D7SA 1RTJB 3VQ4A 3Q8QB 3N6NA 4K4YA 3EPGA 2IOCA 4JS5A 1HYVA 1X9WA 4BE1A 5KFIA 4HHTA 1JLGB 1HQEA 3VQ8A 4KTQA 3SPZA 3OS2A 1RBVA 2FBXA 5KI6A 5KRTA 5JS1A 3VN5A 4TSXA 1S9EB 3AVNA 3TAMA 2WCXA 4K4SA 1RT2B 3V9WA 2JEGA 4F8RA 3IG1A 3CWJA 3MR5A 3MR6A 3CFOA 4OJRA 4NCBA 3PHEA 1VSMA 1NK9A 3RMAA 3QO9B 5KT6A 2G8FA 2Y1JA 1EETB 5HROB 1LWEB 1TKXA 2O4GA 1L5UA 3DLGA 4L8RB 4CJ5A 3AA3A 4EO6A 4ECWA 3RR7A 2QKBA 4NLXA 1N56A 1L3SA 5J1EA 4M41A 2C28A 3C6UA 4B9SA 4RW8A 2IM1A 3FRZA 1VRUA 3HP6A 2CKWA 4KHRA 1SV5A 5HP1B 2ASJA 5DQIA 1LWFA 1D9FA 1X1PA 3O3HA 4O3RA 4CJRA 3VA3A 4FJNA 4O0JA 4M45A 4AHCA 1MU2A 4KB1A 2GC8A 2HNYB 4KFBB 3WNEA 3PUFA 1NK8A 1R0AA 3I0SA 2QXFA 2UUTA 3MF5A 3VQPA 1S0NA 3UDLA 4FBTA 3VA0A 4ED0A 4WFZA 1TKDA 1XI1A 1J53A 3TAEA 4H4MA 1RTDB 1L3UA 4WXOA 1DLOB 2W7OA 3VQCA 4HYKA 2XY7A 2XI3A 2G8UA 4Q5VA 4DSFA 5KG3A 3D45A 1C0TB 4CGFA 1REVB 1SUQB 2RF2A 3RR8A 3V6KA 1NJYA 3MEDB 2DFHA 3M8RA 2G8WA 5KFHA 3RB6A 4FJHA 1TK5A 3I8DA 2GIRA 3BGRA 3BSOA 5KT2A 3IS9B 3AVKA 3OYCA 2G8VA 4EO8A 3K5LA 4ZHRB 3TWHA 3DI6A 4N47A 3DYAA 5J2PB 4ZPCA 4BDPA 4ED3A 1S1VB 2X6NA 4I9QA 3QIPA 1X9MA 4FXDA 3SPYA 3G86A 4WXWA 2HMIA 3PX6A 1J9AA 4IFYA 3KLIA 3CO9A 4DSEA 5D3GB 4Z4GA 5DG9A 2YHBA 4J9LA 2YNGB 3MFHA 4Z4CA 4DQIA 4ED6A 2BQUA 2BE2B 2YKMB 3DLKA 3SV3A 3A2FA 4Z4IA 4J2EA 2G8IA 3H2LA 3RMDA 2ETJA 3PO5A 2VA2A 2V4RA 4RW7B 4ZPDA 1WAJA 3I5CA 1YVUA 4DFKA 2HW3A 4Q0BA 1JLBA 4R5PA 4DSIA 3QINA 1HNIB 3ZSQA 1UOCA 3CJ4A 4BDYA 3DOLB 2KQ2A 2KFZA 4CFCA 3N6MA 4CJUA 1VSFA 1HYZA 4RU9A 1U47A 4MH8A 1NK7A 3OYAA 1QE1B 1XR6A 4CGHA 2HWHA 2YKNB 3OYEA 1K1SA 3QERA 4GVMA 3OYBA 3RRHA 4JLHA 3AO3A 3VQSA 4F3TA 4K4VA 5KFLA 4FK2A 4MIAA 2HB5A 3SUQA 5DGAA 2ZQBA 1C1AA 4RNFA 4N5SA 1IKVB 5DQHA 3IGNA 3KK3A 4ZPAA 4TXSA 4TN2A 4Y34A 2OPRB 3NMAA 2QKKA 4O4GA 1QUVA 3H08A 1N5YB 4OLAA 3PX4A 1QQCA 5KFQA 3NH0A 2WOMA 1U09A 1G15A 2V0NA 3O4NA 4DLEA 2DTUA 3D28A 3V4IA
chains in the Genus database with same CATH superfamily
3HHKA 2ASLA 4HWIA 3ILLA 3JS6A 3EXYA 2Z2YB 1CZAN 1DHMA 4B3OB 2XHCA 3ULEA 2HHSA 2E5LK 5CYQA 2J0SD 3IBCB 2IMOA 2O8EA 1EX8A 2QC3A 4KYZA 1HD1A 4F04B 4B1XB 1LW0B 1FNXH 2KG0A 2R2RA 4K25A 5HMZA 4MAKA 3TPQA 4IDHA 1Q86T 4WU2A 4LIWA 1HLUA 4OPKA 4LF4K 2PFUA 3NHGA 3FMBA 4F3QA 2ZOGA 3MCAB 3FDSA 5G4DA 1BA1A 1VQ8N 2VG6A 3AODA 2L9DA 2CJAA 5HAOA 1BE4A 3OHBA 1Y5NB 4C3MA 4BS2A 1B7FA 5B0FA 3BO3A 3GILA 4CQ1A 4F02A 2F40A 3E9PA 3W61A 1IBMF 4RR5A 3LTOA 2ZHAA 3L6QA 3CPWM 3WQUA 4CHQA 5DDOC 4BACA 2F7TA 3SQ4A 3JS9A 4W5OA 3Q8YA 5DDQC 2RQCA 2OUGA 4CZGA 4CECA 4U8YA 1K1QA 2KXFA 3KLIB 3VALA 2H65B 4ZOSA 4V19S 3RAMA 2FJBB 3SLCA 3FQKA 1QTMA 3IFEA 3MCSA 5KFEA 4N7TA 4DV2F 3SBTA 3AGRA 2E4LA 5KQDA 1HI8A 2PZSA 2H4WB 2HMPA 4YMEA 4OJ3A 1XNRJ 1E6YA 1KONA 4UT4A 1I94F 1MN7A 4KAIA 4ZVQB 2VQFJ 4EYHB 4UW2A 3CMAS 1PYTA 3CT9A 2RN2A 5T7BA 3TJAA 2R2SA 3R5DA 3MEEA 4C3LA 3ITHA 1JLQB 5CZ2A 1HWKA 2B4JA 2P9PB 2B6AA 2VBXA 4CK2A 4FNHA 1T95A 4WP3A 1RWNB 3N5FA 1ITGA 3QBCA 3IC1A 2BJEA 2NXJA 2KXHA 4Y0FA 1NJIO 3OR1A 3TQEA 4Y2CA 1JJHA 4PY5A 2ZVSA 2NS1B 5LOQA 1T6CA 3KLHB 3THXA 4BRFA 1SIZA 2LXFA 4F9OA 2Z2ZA 3CJKB 1NWKA 3TZWA 3QMQA 5KFDA 2KM8C 3MMCA 4KGMA 2DPNA 1IBMK 1U6FA 4JKHA 4EU0A 3R97A 4BR7A 4EIAA 1R59O 1E6VB 2DPIA 1WN7A 3C6AA 1WACA 2JEJA 4CD1A 1RT6A 3BH6B 2OTLS 4JKAA 2ZBCA 1R27B 3QT6A 4K41A 3ONQA 2OA8A 3CCVS 3BF3A 5CHIA 1UFKA 1FI4A 4AHUA 4IDKB 4B02A 3R9LA 2ZKTA 1IWAA 2LFVA 5F41A 3J80Y 2KRBA 3HI9A 2UXCF 1IQTA 4LRDA 3G0ZA 1WOSA 4DV2K 3WT0A 2L41A 2RNEA 3HHLD 3KLFB 3CCVN 2K1RA 1I94K 2AGPA 2YX7A 3AJDA 1HHSA 5BREA 2BE7D 4CF1A 4CK3A 3NL0A 1UFLA 4TVAB 3TI0A 3NVMA 3HHNB 2ZBIA 2RE2A 4NLBA 3MD3A 4AILC 3CCSS 3SV4A 2P9SA 3PFEA 1YK9A 4UOHA 4FW2A 4PKHA 1QAYA 1S1TA 2AJ0A 1WSFA 4IUFA 3U1LA 2RRNA 3C66A 1VQKS 3QWUA 3CF5L 3CUNA 4FK4A 3MFIA 1X0FA 2PI5A 2B43A 1RBSA 3QLHA 3DRSA 1UEVA 1WC0A 4DR1F 4DDFA 1WBDA 3TVKA 2ZFHA 4B9NA 5H9FJ 1T3VA 3T6JA 1L3KA 1IKWB 1LNQA 3ZCMA 2VWBA 3JYTA 3BZKA 1FRHA 4M5IA 3NBPB 4F0HA 1S0OA 3P4UB 2O4IA 4BC2A 1Z6RA 3D2EB 3I82A 4DUZF 5M1OA 3HFZB 4ISFA 2P5GA 2UUBJ 1NSKL 5MLCV 3TAPA 3LPTA 5TKWA 1VLOA 3IKMA 3QSYB 4BC4A 1TL7A 1WELA 3TX8A 2CNNB 2E1AA 5AQZA 1S1UB 2QT7A 3I4HX 3UNYA 1EKSA 1VQPN 4NLOA 2UXCK 4ZPVR 5KFRA 3CJ5A 1RHRB 4ZVEA 3A8IA 4JI5K 4HCBA 5IM0B 2QWPA 3QESA 4J5OA 1S6QB 2DNGA 3CJ1A 2G4BA 3ISND 3SDEB 1BDGA 1U49A 3GFHA 1RBOB 1WNSA 1HPZB 3A8YA 4WFBQ 3L3VA 3KWMA 5LMUJ 5A8RA 4RW9B 1BQNA 3M1FA 2Z1IA 2QL9B 3MAAA 3KLEA 1WC1A 3V6HA 2ZH4A 3ZZUA 2N7CA 1Z2ZA 3BKFA 2OPQA 1S76D 3GV8B 4FL9A 3JSYA 2IS3A 2YWWA 2O5DA 4BR5A 4DG1A 4WP8A 5IT4A 2HVZA 2U2FA 5C25A 5BPMA 3N6LA 2WRMA 1SL1A 4YB5A 1S1WA 5B08A 4CEZA 4HI1A 4KKOB 3M8PB 3FCVA 4DTJA 3OR2B 4RNNA 4RUHA 4B3TF 2QWNA 2HAIA 1R7IA 3ZT1A 1XQSC 2HVDA 3LDNA 3T1YF 4DR1K 1RU1A 1Y97A 2CWXA 2BOPA 5GAEP 2V4JA 1GNKA 1XMOF 4F3OA 1HD0A 2KT3A 3HRGA 4TY8B 4DUZK 3MK6A 1S7HA 1BCMA 4QIFA 4ALZA 4TQSA 2Z2MA 4X4NA 5AXMA 3EVMA 1Q9XA 1EP4B 4CH7A 3KK2A 3WXLA 3FFIA 2KHCA 3G10A 1EKEA 3D9BA 4YY3J 2V4QA 1Q78A 4X4QA 2LYVA 3Q8PB 3EE3A 2V63A 4H0TB 4A8YA 1BISA 2OI2A 2V69A 2ZDOA 4FZVA 3W65A 2ZJRL 1Q8KA 4G6VB 3LPYA 2XS7A 4R8UA 3LDSA 1M1KT 2E9TA 4HUEA 4PYAA 2XWXA 2DR8A 2VFRA 3FBFA 4Y28C 4FJXA 5KT3A 4PXEA 3IA0A 3P45B 4G1QB 4ILGB 1RWUA 3BDPA 1S9GA 2I7NA 2I7PA 3H5SA 1XHZA 3H25A 2YXLA 3M2RA 3CPWR 3H5UA 2NLWA 4KH5A 1RLDA 1TKXB 5E3QA 4DQPA 3DLGB 1PO6A 4MO5A 4BGAA 1H72C 2F8MA 4CGJA 2IVNA 1U8WA 3QJJA 2GIFA 5J1EB 2RRAA 2A41A 2R7VA 1S77D 4OKJA 2WSFC 2X78A 4CEOA 1VRUB 4B3TK 4B1VA 1FDNA 4DSLA 3NS5A 4CJPA 2DHXA 3T1YK 2ROEA 3UN5A 4DU8A 1WHVA 1XMOK 3ZT4A 1CQNA 3MZIA 4YR3A 1RDRA 2AYBA 4FLXA 4WFBL 4OL8A 2XMAA 4DHVA 1KHWA 3D54A 4G9ZA 3I0SB 3OYLA 1A5WA 4KB0A 1R8CA 3IRXA 5EOYA 4MFBB 4ANCA 3R1HA 2GNKA 3C3LA 1U25A 5HATA 4LF9F 3HSJA 4QYZK 1TYQB 5J2NA 4KTZA 2IFXA 3R5JB 4R0JA 3AOBA 5G0RA 2RF2B 1JJ2M 5FPMA 2IGIA 1IV0A 2L9WA 3NY0A 3PJ9A 5M2PA 4DL3A 1V3RA 3HDSA 3KWIA 4PYDA 1A5VA 3VV2B 3D7SB 3D0GE 4AL5A 2CDQA 3FR0A 1S5JA 1VBYA 3I33A 4LRBA 4CD3A 3HI0A 3IAS9 1HBMA 9ATCB 5KFWA 2QA4S 2DIUA 5BR9A 3NAIA 2F96A 2ZGYA 3CIZA 4WCEL 2MQLA 3T1HJ 5AQGA 4CEEA 1H2UX 3QIPB 1HIYA 2K7KA 1H73A 3EX7B 4LQ9A 2P5VA 3TUIC 2KRRA 1V4SA 4QWDA 2HMIB 1RTIA 3P5JA 4F4KA 1M5HA 4FWSA 3BF1A 1W9HA 3RRGA 4H4OA 3C95A 3ENOA 4KH0B 4DQ8A 4ZKAA 1WSGA 5DQGA 3K59A 3P8BB 1XNQF 1VIOA 3KNAA 1JLFA 4Q0BB 4ENOA 3BO2A 3ILIA 1FVQA 1GOBA 1S99A 1KQFB 4IH5A 3G9CA 5IT9U 2HEKA 5C2GA 3BV8A 2CQCA 2JLFA 1K6YA 2GQQA 3ET6B 4FWLA 3HZ6A 4U7UK 4RZRA 4UOCA 2Q31A 4MK9A 2NRRA 4DSJA 2H48B 3PSFA 2GUPA 1N5QA 2IM3A 2HYIB 3NF6A 3HVTB 2CPJA 1AT1B 1BOTO 2HBQB 3KDNA 3L8BA 4LF9K 1ZAWA 3TR5A 1NUEA 4USMA 5KFFA 3OS0A 4LQ3A 3SFGA 1MNEA 2CIMA 3R6LB 4CT9A 3QNOA 3O1BA 5HROA 1ZBHA 3HM8A 1ZZNA 5AFUA 2G0CA 3VQ5A 4O8UA 3HX9A 1YBUA 5AZJB 4AXIA 3BUZB 4QAGA 4FS2A 2HHVA 2OAUA 1JLAB 4AD6A 3T41A 3IBFB 4WTYA 5KFKA 3TR8A 2VUGA 3NS7B 4FVUA 1TP7A 1KN6A 3HD2A 3QETA 2A6MA 2PD1A 4ETXA 4CFBA 1DZ5A 3CDUA 5CD4H 4C0HA 1Q7YT 2W2OP 1RWXB 4JI6J 1XTZA 2Y3YA 1EQMA 2Z4PA 4XEIA 4CVNE 1RWVB 5DLGA 2MMYA 2E7XA 4TYAA 4ATNA 3D7EO 4L76A 1TL4A 1YJ9N 5AQMA 4CZJA 2O8CA 1JJ4A 2XZTB 5HVFA 4WFYA 4EYIB 5FROA 1F1BB 4ELVA 3O2IA 1EIYB 4CBXA 1RTDA 1MN9A 2Z1JA 5AQHA 1NGFA 4CLZA 1XNQK 5KQ8A 5L1KA 5HN0A 1VQMS 3K8VA 3HSDA 3J7ZO 2HBJA 1TK0A 3UKUA 1N48A 1HJRA 4M3XA 3TX0A 3DXSX 3CCUN 3UD5A 3PYGA 1FRMA 2IJFA 2ADBA 3KK1B 4RUCA 3G6EN 1KAYA 4CFAA 2OYQA 4KI6A 5HBMB 3QBXA 4FM0A 1IUJA 4GKKJ 3CJBA 1IBLF 1ILYA 1U1PA 2WUSA 2M7SA 4DTUA 3DGPA 1VQ7S 1CZ9A 4E1MA 4X4RA 3ENAA 1QHTA 3BKTA 3GE1A 2F1FA 2B0GA 3T5JA 3VQTA 3P49B 4P2SA 4NXMF 2HVEA 3MXIA 3LA0A 1RTHB 4KV8B 4OYPA 3B6PA 2XO7A 4GC7A 1D3WA 4EP4A 1QSLA 2YBVA 4WIIA 3BDEA 1VQ7N 5KOWA 4CGGA 3HJVA 3QATA 1E4GT 1ZS6A 4FYWB 2IVMA 3LP1B 5CR4A 4NXNF 4KREA 4BY9C 2RKIB 5D4NA 1BWVA 3ID8A 1OY6A 3IR6B 3ENWA 4W5NA 4O0IA 3S1TA 4H5RA 1HI1A 4FNIA 1IBKJ 4CLSA 1NGAA 2LQJA 2AJFE 4NEZA 2JVRA 5AQTA 3S3NA 4J9NA 5L39A 2OELA 2HIYA 4WZMA 3VQQA 4U67L 4M3TA 4LY7A 2EK6A 2FGCA 3BSCA 1MROB 1WKLA 1WEXA 5KGWA 5A0YB 3NH1A 3VAMA 5H9EJ 4F4ZA 4M5NA 2VFUA 5CZVA 2K06A 1T9VA 1HW9A 4A61A 2MKCA 1NGIA 1FJGJ 2WVCA 3J8AA 1P6TA 3V9SA 2PI4A 3GIMA 3AVBA 3GB0A 2XB2D 1IBLK 1OYEA 3TQ1A 4X84A 2HBKA 2O8FA 4HT7A 1KEKA 2L9NA 1U02A 3GMGA 3R7BB 3WXKA 4NE9C 3Q8SB 1NDCA 4C98A 2NZTA 4C8ZA 4NXMK 2FPHX 3THWA 2E1YA 4GV9A 4L3NA 2JGUA 1ESVA 4CWBA 1VQLS 4QS9A 2D3ZA 1VQOS 1RILA 2XMVA 1FKOB 4NXNK 5ADXA 2F7VA 3JAMU 3NKYA 2GTDA 2YNIA 2R2UA 1G6BA 1U6BA 5JMNA 4N8NA 2YX6A 4LH4A 4URGA 4BHQA 3CCQN 1FRLA 3U3YA 1CULB 1ZBIA 1VQLN 3AD7C 3J7A1 1TUWA 3NE6A 3DLEB 3OFFA 2W2PP 3CVKA 3LP0A 2V2QA 3HK2A 4ZPBA 3W3DA 2N4DA 1T03A 3EO3A 2AQ4A 2E9RX 1EX4A 1UVLA 1N0UA 1FD8A 1O0PA 1Y64A 1JJ2R 1TAQA 3B82A 4JKEA 1HYSA 3OYJA 3MUMP 5EN1A 4CERA 1EQYA 3CQ8A 4DV0K 2NLXA 4B8AB 3DFEA 4Z2XA 1NB2A 1KD1O 2BANA 2HFNA 3EL2A 2DPJA 2DNNA 1HKBA 2UV8A 3CC7S 2ASMA 4PWWA 4RWXA 3QT5A 3MM9B 1VC0A 2NRVA 2F9WA 3DLLQ 1X4AA 3VAKA 3AVFA 1NHKL 1S3XA 3IN5A 1F9EB 2IVOA 2LVWA 4YORA 2GA7A 1R3NA 2DH7A 1CBKA 3CSKA 1GMVA 3BGFA 1APSA 5LXYA 3W9IA 1GMUA 3MMBA 1NGEA 3ZZTA 1HBNA 5BN8A 2AX1A 1SI9A 2VJUA 1YJTA 2Q3SA 5AJ3J 4X4UA 2E5HA 1VQ5S 2FF6A 2PMHA 1Q16B 4NEYA 1UAXA 4IR1A 1VGYA 2M9KA 1WF2A 2ZZTA 2P51A 2AEFA 1O6XA 3ZSYA 4NZ7A 2BDPA 4EBDA 3I0RA 1ZH5A 4KH1B 4HUFA 3V6DA 1NJWA 3D6MB 5GMDA 2QWOA 3PDNA 3MOJB 2QMXA 3WNGA 3OVBA 3EZOA 3CCES 3OQ2A 3CGIA 2GEMA 2V52B 4JHDB 1NG9A 3GFXA 3CM5A 4E19A 1DJ0A 4CZEA 2QLBB 5HRRA 2IA0A 5JXSA 3CC2N 3KD1E 2XLKA 2HBLA 4JI8J 1AZSB 2D74B 3OYKA 5CZ1A 4KSEB 1R8PA 4LC9B 2VG5B 4ID5A 5ETMA 4JK9A 3UIQA 1S0VA 1WNEA 1ZXOA 2HNDB 5BJRA 4CF9A 2RIJA 3AFGA 4NL5A 4OZLA 4DZDA 1XR7A 5CXTA 1BG3A 2NYIA 3B4DA 5ETRA 1YZ6A 4M5HA 3H59A 2ZNZA 2Y0SD 1H2TZ 5I42A 1TTHB 2CZ4A 4HHUA 1YTAA 3US5A 1JB0C 3WX8A 4PL8A 5J2QA 4RUAA 2VOOA 1ZYQA 3HPHA 2F4VF 3FUYA 2GELA 1NU4A 3M6XA 2CPZA 4Q7AA 3IRWP 4AM7A 4L6V3 2UVWA 1NHVA 3Q89A 3BY5A 4ZJQA 3U9DA 1ULRA 1U48A 4A8FA 3ZZYA 5A8WA 2UZAA 4UQTA 3W5ZA 1BC6A 1XN9A 2I5JA 4D3HA 2PGCA 2W6KA 2YNFA 3MN5A 3T19A 4GVEA 3OBWA 2CQGA 2BACA 4ZVPB 1LW2A 3BJYA 5C24B 1X9JA 1MWMA 4OZJA 4Y1CA 3K9JA 1HMVB 3MR2A 1DARA 5KPRA 4WP9A 4BROA 3QYYA 3CD6S 3Q2TC 5FPNA 1CJTA 1NLVA 3QRPA 3VQDA 4DU4A 5DMRA 4IRDA 4RW6B 3J80U 4QIWD 4J2AA 1BA0A 3PW4A 1KC8T 4CT8A 5B7WA 5D4OA 1UEKA 2ZBRA 4PG6A 2VGNA 3SAGA 3RB0A 1KQSR 5K5MA 2BJDA 2J8SA 4KR0B 2XWYA 4FLYA 1HA1A 3W63A 1RFQA 4DV6J 1C2PA 4BRLA 2BVZA 4OPJA 3QJPA 2F4VK 3EGVA 4BE0A 2ACYA 1VQ6S 3V6JA 5FDLA 2XZDB 1UW4A 5M1NA 1TV6A 2IBKA 4JV2A 2G1DA 4CLFA 1M1KO 3I8BA 2A5XA 1FXXA 1Z4UA 3A8EA 1HR0J 4KHMA 1FK9A 4JI7J 2EFQA 4I9LA 1J5OB 2HF3A 1S57A 1S6UA 2D0AA 4EAHD 3PIPL 4DX5A 2XC9A 3R5BA 3HT0A 5M1PA 3SQOP 1JXLA 2N3LA 2RD5C 1V3ZA 3P3DA 1WSHA 4W5QA 2ALYB 1K8KA 1B7YB 4G1IA 4J9UE 4PWDA 3VGSA 2FB0A 5IV4A 3VR1A 4WKRA 3CJSA 2ACMA 3H90A 3OFHA 2BMBA 3TO8A 2HQIA 3IXQA 1HBOB 3W9JA 2RSQA 4USUA 2HF4A 1X0PA 3VQ8A 4FSVA 1YSJA 3SPZA 1U1KA 1S9EB 3TAMA 3BYRA 1BXNA 3MPDA 3EVOA 1HHTP 3SQGB 4CLUA 2R9LA 3CJ7A 3CWJA 4DR3F 3MR5A 3MR6A 3CFOA 2CVEA 3WXJA 4IEEA 2LXIA 2Y1JA 1EETB 1F0XA 5L8RC 1NZAA 3BBBA 1FRIA 3GCXP 1G4CA 2XSJB 2XZWA 3NGUA 5BRHA 1MW7A 3FFKB 5JVGQ 2M88A 3AA3A 3RR7A 2KYXA 3C6UA 4WQ4A 4FVCA 3EKSA 2DJWA 3VAFA 3C7NB 5DQIA 1D9FA 4OI1A 3O3HA 5K8NA 3VA3A 1X60A 4FJNA 4O0JA 3C0BA 1MU2A 4TKTA 5B0GA 1NK8A 4AFFA 4ZVUB 2HHHJ 2UUTA 4DMZA 2A10A 2YWGA 3CIMA 3VA0A 4FBTA 1X5SA 3C65A 4JYAF 2RHKA 3GWCA 4QS8A 1YITN 3L95X 5AZIB 1WBBA 2V8HA 2ZM6J 3TAEA 4H4MA 4RBVA 1FRJA 4RBTA 1DLOB 2KH9A 3AD9C 2W7OA 4WF9Q 4DCOB 4HYKA 2G8UA 1KR4A 5KG3A 1UFWA 1C0TB 3IM9A 1K0TA 2V51B 3ZX2A 3T1HF 1GLBG 2WW4A 5KFHA 3VAIA 4FJHA 1C4CA 3EDRB 2GQCA 4KGZB 3G2XA 2B4PA 3OTEA 3VTHA 2GMHA 4DR3K 1IR0A 4A48A 4NMLA 3DYAA 2IDEA 2MSTA 4ED3A 2VV5A 1X9MA 1FE0A 3G86A 3PX6A 4JI0K 3IR7B 1RAGB 3LGMA 2K7JA 2BTFA 3KLIA 3CO9A 4DSEA 4MIWA 3RSEA 4J9LA 2YNGB 4PEOA 4Z4CA 2RMLA 4ED6A 3ZZRA 4Z4IA 3HULA 2G8IA 4OYWA 3PO5A 2YKOA 4X4PA 2FSJA 4DFKA 5IT9O 5D0RA 1JLBA 4R5PA 1NM1A 3THYB 5HL7Q 1K73O 3L9ZA 2B9EA 3H0PA 3CJ4A 5A6PA 3A5LC 4BDYA 4HACA 2KQ2A 3QDKA 3OTOF 4CJUA 3CCRS 1A6LA 1KVKA 3BO4A 4OX9J 4CNYA 4FP9A 3DKDA 1QE1B 1XR6A 1T6DA 4JYAK 2EEYA 1CC8A 3V4MA 3OYEA 3OYBA 2DNKA 1U0HB 5KFLA 1YVNA 5B0CA 2HB5A 3SUQA 5DGAA 4P9SA 2CPXA 1IKVB 4N5SA 3KK3A 4W90B 3RBXA 2OPRB 3UVJB 3NMAA 3CCRN 4DR6F 4KPCA 4O4GA 1QUVA 4HHJA 3SCIE 5CE3A 2F9TA 4CM2A 3NH0A 2WOMA 3O4NA 2XEXA 4DV1F 3OBIA 4M5LA 1MWZA 2GHVC 3G4SS 2OZMA 1NGBA 5HSPA 4JI6F 5IXUA 1NBEB 1BD6A 2XO6A 4GV6A 4E7IA 2H54B 3G71S 3PV8A 3KLGA 2QEXS 2VPYB 2XHWA 4PUOB 4DFPA 2N82B 2YNHA 1UVIA 1GTHA 1RT4A 3MUVP 4TYBA 3GR0A 4UY8T 1NCLA 1B0TA 3MN7A 1JNRB 3ISZA 4CTAA 1RT7A 4H0YB 1T94A 4FW1A 2QEXN 4IDKA 4GNIA 1FA0A 3ALYA 4WFAQ 1OYDA 3DRRA 3FC9A 4FLUA 3CJ0A 3MEGA 4DN9A 1X4GA 2DD8S 4HVJA 4CJEA 2BV3A 3KLFA 4OV6A 4Z7CA 4V19J 4GKKF 3G6YA 4LF7J 1P90A 4ECXA 1WWHA 2YH1A 1R0CB 1FESA 2DXEA 2GHPA 3OTOK 4O3OA 2B4OA 2SXLA 2QX0A 5JS2A 2F8EX 3N0VA 2UXBF 2W9CA 5D8HB 2CQDA 4BRAA 4DL6A 2HNZA 2BABA 3E51A 4EBCA 2B8QA 2A40A 3QFPA 3DWLA 2CWKA 2OPPB 4YUDA 1XWLA 4OZ3A 1U1LA 4ZVHA 3L09A 3MHYA 3R8YA 1YI2S 4DB3A 4JI4F 1LXJA 2E5LJ 3HM9A 4HR2A 4DR6K 3WIUA 5HLFA 3BZCA 1SKWA 3OL6A 4RLEA 5C2CA 3SCXA 4OYBA 8ATCB 1C1CA 1EHWA 4CH1A 4EHTA 5HJYA 4DV1K 2IPOB 3LL3A 2W2QP 3HHEA 5GAGU 5I3UA 1BI4B 2D5RA 4JI6K 3KG4A 4O4RA 3OJSA 3G8TA 4LF4J 2HHXA 3WXMB 1GXLA 3SQ0A 1R43A 1JLCA 2P6TA 2JH3A 4LREA 1HQUB 4ES3A 3BBCA 4JKGB 1S59A 3DDNA 1Z2LA 4L3KA 4FJ5A 3VPZA 1SB6A 4NI2B 2F3JA 3ICLA 4O5FA 4KO0B 1OMSA 2MSSA 5E2QA 3R9PA 3MGJA 3PW7A 3D5MA 3SUOA 3G96A 1D9DA 1RB0A 2I1RA 4E1JA 4FJLA 2VIHA 1WDDA 3UDVA 3N4QA 4O3QA 2BKOA 3BSAA 5FD1A 1RISA 1RJJA 2FJAB 2QMWA 3W5XA 3Q23A 5JUMA 2IC3B 3S01A 4GKKK 1SKUB 4Y2KA 2XMTA 2RVJA 5F3ZA 1GLFO 1RLCL 2AT1B 3HSTB 1Q18A 5T14A 4DZ6A 3BYPA 3M1VB 3TWZA 4DU3A 2HGNA 3DOMB 2OPSB 2C3PA 4Z4HA 1QSSA 2UXBK 2GIQA 2ZWOA 4J8FA 4DR2J 1RU2A 4DPXA 3M30A 2XGQA 4WKYA 3OJUA 2ZH9A 3NLCA 4K4ZA 3E01A 4QJVA 1VBXA 4FWKA 3TAFA 2R2TA 3A3NB 2J0QD 4JI4K 3I6PA 1BIUA 5LXRA 4BC9A 1BY9A 5B0EA 1U24A 3Q7CA 2K8GA 2FF3B 1CQMA 2P9NA 2Y1IA 3CQXA 4IOAL 4NA1A 2QYGA 3OYIA 3MECA 2AD9A 1REGX 2IRXA 2NUBA 3U8XA 2DISA 3ZTPA 5F8MA 5AQVA 1LFWA 4H5TA 3GU0A 3M8QA 3NCPA 3BEXA 1KLMA 3PRBA 2YPYA 3JAMO 5AQFA 4PQUB 3TZYA 2BE9B 1OSCA 2EW9A 4A5BA 4JV5F 1JCEA 3UKRA 4RW4B 4I6YA 1EP4A 2IAJB 5IWAF 3IAYA 3IBWA 1VSLA 1TL3B 1NBWA 1PG5B 3DDIA 4WFNL 4C9DA 1IBMJ 1HNVB 5JICA 1WOOA 2WBRA 1OO0B 3D6TB 2XMUA 1TVRB 3BR8A 2G8KA 4PCQA 1BWFO 4JK7A 1H74A 1W2IA 4FS1A 4DL0C 5EX0A 1Y9OA 2W1BA 2VDHA 5AQOA 1TUYA 1JXBA 4CHNA 4G1QA 4I7FB 1ASUA 2O8BB 4J9VA 2GCFA 1CSJA 4DV2J 4XTTA 1VYAA 3P96A 2QM1A 2YHAA 4NLCA 5BR8F 4RU2A 1NDKA 2HURA 1I94J 2E7VA 2EKNA 4LT6A 4MK8A 4UZBA 3SNNA 4C1NK 1KRPA 4JBCA 3F5TA 1WTBA 3R7NB 1C1BB 5DG8A 1UJ6A 4ZP6A 5JVHL 1NLKL 2W9BB 5AE3A 3ETMA 2MPUA 4H0VB 2P9UB 2ZE2A 4DCPB 1S6PB 1TKZB 3AT1B 1AXQA 2GV1A 4LD0A 4IR9A 4PG8A 2KJWA 3TP2A 3W2WA 2A1SA 3GYNA 3D0IE 1T05A 1UWBB 3NAEA 3FSIA 4JV5K 3RBDA 2LCWA 2P9KB 4IWVA 3NGSA 4P7VA 4M3UA 4C0OC 2MGZB 4MFBA 4CYUA 4OMFG 3G8QA 3W66A 1PJ5A 2FJXA 1M1GA 5E3AA 5IWAK 1NDPA 4JD2A 4JOUA 4FK0A 3A0IX 4HL9A 2IMWP 4NLUA 1NJIT 1SH0A 3GONA 4NLPA 3THTA 2IIRA 1U1QA 1S1XA 5KFCA 3LP2A 3HHLA 2DK2A 3A5MC 3FBBA 2MLYA 3SCLE 4WTOB 1HKAA 5GADU 2Q1NA 4J9SA 2B5JB 2GWKA 3U4LA 4URQU 4DR4F 4G3IA 4P6QA 3UDEA 2CPFA 1IR1A 5KAKA 1QLNA 3AA5X 2D9OA 1QAXA 2UXCJ 4YDDB 3EPIA 2E9ZA 1SZ2A 1F3VA 2RAQA 4JI5J 4E7LA 3VESA 4C4WA 4KT0C 4GW6A 1Q95G 1NPRA 1AYEA 5BR8K 1ICEB 1DTQB 1NK0A 4WE1A 1YXQA 2JWKA 1NJXA 1LFPA 2LU2A 2GZOA 2XG8A 2UXDJ 2Y0BB 4RNHA 1KVIA 4BRGA 5GAHP 4F3MA 4IO8A 4PHTX 2ERRA 4LMZA 4CO5A 4FZZA 1SKRA 2QTDA 1R8HA 1RE1B 3QAEA 2NPIA 2WSCC 3P6YC 1NEEA 4XPEA 3H1QA 4A59A 1HQEB 1A0OB 1XHXA 3X3UA 2CH5A 3ATUA 3ZNJ1 2NRZA 4W5RA 1FHTA 5CQGA 4KTWA 2X51A 1NKCA 4JKDA 2DGUA 3HFVA 5EX5A 5C7PA 3W2VB 3WEEA 2AJ4A 2DR6A 3FZ2A 3DXMB 1YHQS 1TAUA 1RCXB 4C11A 4AHTA 2B56A 2DH8A 2R8GA 2OSRA 4DR1J 1RKIA 1HRHA 1VAZA 3NGZA 2QO3A 1NSPA 1KC8O 2LU1A 1KVAA 3EWGA 3MDFA 3HVTA 3MTKA 3KHLA 3HKZD 1H0HB 4USJC 3W0LA 4Q2LA 3MM5B 1YHQN 4DUZJ 4RW8B 2RHSB 2ZNYA 1FX2A 2VBZA 2WONA 3CERA 2MHNA 2MZRA 3UFCX 4FLTA 2FTRA 2CQ2A 1YUWA 2G9OA 2J8AA 1EQ0A 1U2VB 2YQ0A 1SPBP 4DR4K 2YHXA 4ERDA 1CJVB 3RB3A 4OI6A 2PMZD 2UUAF 4JP8A 2CQ3A 2KL8A 2V8VA 4LF8F 3OFGA 2RS2A 1NU0A 2BQRA 5B8HA 3J80O 3P5TL 2Q3PA 4ED4A 2BEFA 4C6AA 2HZCA 1YBTA 1CVJA 4ZP7A 2P8IA 1RXOB 3OYMA 5B0BA 3CMES 3FZBA 2ZWPA 3NG8A 4IO9Q 2V7ZA 4Q8EA 4FPIA 1RDWX 3OYGA 3HVWA 3ZXWA 2FVSA 5HMXA 2KLAA 4ZP8A 2FUG9 5AQRA 1FRXA 1UA0A 3SMSA 4CBUA 2HLUA 3H3OB 5LY3A 4HVZA 3CJ8A 4OLPA 4I6AA 3CMEN 2XRIA 2ZH1A 5DM7Q 4K4WA 4B3TJ 3CTRA 4BBYA 4K0KF 2W7AA 4LH5A 3KK1A 5KFTA 3BSNA 3BKUA 3T1YJ 1KSPA 2V8DA 5HBMA 5L1JA 2J6TA 1GX5A 4JV1A 4CF8A 1JWWA 4BRHA 2E1RA 1QAIA 1VHIA 5AQXA 2HQFA 4OZ5A 4FXWA 1DQAA 2GW8A 2QLWA 1ITPA 3OD2A 2YKPA 2UV8G 1U1NA 3QZ8A 1RHKB 4QIGA 1RTHA 2Z1GA 4KPYA 3R6MA 2AZ3A 1IBCB 2HQCA 4IJNA 4WZQA 4ECYA 1C0UA 1KHVA 3I31A 4CFDA 2DGXA 1BHNA 3QICA 4QYZJ 4URSA 3LAMA 3KG1A 2IY5B 2UUAK 5E3PA 2EI5A 4LF8K 1VK8A 5HQLA 3QRQA 1FJCA 4OHZA 2AV5A 5CD4A 3RBEA 2VFSA 1QQNA 2WVEA 4ISGA 3R2CJ 4B1UB 2X1GA 1LQ9A 4E2FB 4E7HA 3FZMA 2VC0A 4KHPF 3QO9A 4TQRA 1ZA1B 2DVIA 4RUBA 1WSIA 1SXLA 1RCHA 1LWEA 1RNHA 1SQKA 3MM8A 1ZTWA 2ROGA 2OSQA 1H7XA 3OTDA 3CXCM 2GJFA 4DPOA 1RDAA 4MTPA 5ETOA 4E89A 1D9AA 1NNEA 4ZVTB 1VQNS 1VSJA 2HK3A 3GFZA 1NK6A 4BRDA 3S8SA 3ULEB 4BRIA 5CYQB 2HHQA 2H4YB 3AOCA 2O8EB 3PVXA 2D0BA 4K0KK 2Q2RA 3H4DA 2H5IB 1WLJA 3O9RA 2H1YA 1PC4A 1SBRA 4CO4A 2V2ZA 3AA2A 5I3QA 1W97L 1YJRA 4DX7A 2F9DA 3MX5A 2HOEA 1PCAA 4OI4A 2NRTA 5D78A 2W9AA 2KB2A 1QTNB 1RBUA 4JV0A 3KHGA 2MB0B 4M94A 2ROPA 5HVGA 2C2MB 2VG6B 2OFHX 3EKUA 2C3MA 1RABB 1BQXA 3ZC4A 3PYEA 1CJKA 1QD1A 2D3O1 1BWEA 4ZLJA 5DDPC 5D15A 1SUQA 1MG7A 3FRYA 4BLGA 4LF9J 1IM4A 2WSEC 1IJFB 2W4DA 4AM6A 2HZAA 1OWXA 2D0CA 3DRPB 3EICA 3QRRA 5AQNA 2MZQA 1NSQA 1WHYA 3F2KA 1FD2A 3IS9A 2DR9A 3LAKA 4S0MA 2IJNA 2UYTA 2EG1A 2W4PA 2VDIA 3DRYA 4ZJLA 3CCWA 3DLEA 5KGXA 4FYVB 2M2BA 4KHPK 1B3TA 4C2MA 3H5YA 2QZ8A 3RJMB 5F0WA 1CLQA 1VDHA 2L08A 2N4CA 5IOLA 3IWNC 4N8OA 4ZK7M 1E6YB 1K47A 1F5BA 2MYFA 3EE8A 4C8NA 3O9SA 2W24A 3MEEB 2C2RA 1XJWB 1NK5A 2CJQA 3ITHB 1LXNA 3SBMA 1G3OA 1VI7A 2B6AB 4Y6IA 1R0BG 4CLKA 1HNZF 2GVDA 1U26A 4GO7X 3CD5A 3DOLA 5ETNA 2CG8A 3W8PA 2DGOA 2C1EB 3OR1B 3K5OA 1C4AA 5BYQA 5T7LA 4FWRA 2COLA 1VFJA 2YKNA 1T8EA 2NSBA 1WHXA 2NQPA 2GUIA 5B0AA 3THXB 3HOSA 2R42A 3UPFA 3SMPA 2IVPA 2VFTA 3G82A 4BREA 1N5YA 1AFIA 4ZTFA 3MMCB 4YOVA 2RJZA 2AMCB 3FBCA 4OGCA 2AJQA 3UO0A 1AA1B 1Q79A 4PAAA 3P38A 3HSGA 4FZYA 3OUYA 1WUAA 1QVGM 2GGPA 5KTQA 3PFOA 1SL2A 3Q0AA 1RT6B 2HS0A 2JLEA 1UVNA 1N4LA 4QR2A 3E9LA 4WQ4C 5JLHA 2MJNA 2MZ1A 2HBZB 3D1QA 4YOEA 3TZZA 1JKHA 3OT9A 3R6GB 4CZFA 4NB4A 3U1MA 2FJEB 1EAYC 2ZBPA 2ATLA 4ECRA 4LSZB 3H2UB 2V7YA 1N5VA 4LF7F 2VGMA 2IM2A 1SJ3P 1G99A 2K1RB 3ZTSA 3KD5E 1FKAF 4DBQA 4A8SA 1X3NA 1FVSA 4B9MA 2NREA 1YJ7A 3ZYYX 2DNHA 5KFNA 2ATQA 5I4MA 4QYRA 3MOZA 2WVBA 1YVFA 2VICA 3RGIA 1CXUA 2UUWA 4FJ8A 5ETQA 3QEPA 4H0OA 2P9SB 3TNVA 3DXBA 4P10A 1KOHA 1HNZK 2HNDA 1UPPA 1S1TB 5EWFA 1KVJA 2B7BB 3U7JA 1EXQA 5KFAA 2BRLA 4FWQA 2YWKA 2QL7B 3POTA 1WC5A 3QLHB 3DRSB 2E2QA 1N33F 3PZPA 4NLDA 1HKGA 3C2PA 4JEPA 1SS6A 3V1RA 3KMQA 1DAXA 1IBLJ 3DXKA 5LJ5Y 1ZBLA 1W0HA 4FF2A 4I56A 3JYTB 4BR0A 1W7AA 4K8RA 4CGIA 4PXDA 4CO2A 3MWTA 5B0DA 1S9FA 3V81B 5GAGI 4A8QA 1J54A 5IS2A 4GVBA 4OX8A 3JSMA 3FZFA 4LSNA 2VG7A 2W25A 4LSLA 4NCGA 4NZ0A 1HWJA 3RVCA 3JSBA 4QIVA 1TL7B 1OPZA 2PAVA 4O23A 2JC0A 2JX2A 1P1LA 2PIIA 5KFVA 3PIOQ 4LFCF 1FFGB 5A2QU 2E2OA 4MIBA 2CNLB 2E1PA 4NXNJ 2DH9A 4XK8C 3QJLA 3V9UA 4HKQA 3EZ5A 2BBEA 1RA6A 2HRTA 2W4CA 5AQYA 1B92A 1XMBA 3Q8RB 4LF7K 2UU9F 3TVZA 4AHSA 2FLPA 2ZZNA 5C24A 3PJWA 4BRCA 1QHAA 3NMUA 3R5GA 5KG5A 5CAAA 2AEMA 3PJXA 5A8RB 2A6AA 1BQNB 4DR2F 4ETZA 3ZTQA 2UVVA 3F73A 2E7WA 3MAAB 3KLEB 2G2ZA 4A8MP 3ZSWA 3MURP 5AE1A 3K2PA 4WYLA 3AVLA 2XMWA 2OPQB 1GMWD 3QIDA 3R5AA 3NGDA 3MXMA 1VSHA 4DV0J 4RW6A 2QJ3A 4WK3A 2AYEA 4DG1B 3AVHA 5C25B 4J7CA 4DS5A 1S1WB 1TQLA 4KJIA 2HWIA 5EWEA 4QBUA 3NGKA 4PKIA 2FSNA 3A4TA 1SC3B 1FFWB 1KTQA 3DLBA 3DOKA 3J81Y 4ED7A 1N33K 1G2EA 3EN9A 2VH7A 1S7IA 2FVPA 3SI6A 3CXCR 4ECQA 4ZA1A 1FXLA 3U3GA 2V4JB 4OLBA 4BWMA 3NXZA 2P6SA 1H98A 3NWGA 2OMOA 1HKCA 3I32A 1GAOA 4OVLA 2DBBA 5I9EB 4IOCQ 3DDKA 4GMKA 5DDRC 3T3FA 5LJWA 4MDBA 5L46A 4K5RA 1IM6A 4ID1A 5ADZA 4LRFA 3KK2B 4LFCK 3FFIB 4OO1J 3SJHA 2DCUB 1N88A 4ANDA 2JFKA 3EJMA 2P1JA 1GX6A 1TL1B 3C16A 1X8DA 2EX3A 3CD0A 4NOHA 2UU9K 4CBWA 2A2DA 4CZHA 4KRFA 1KKHA 4JI3F 2RDIA 2FZKB 3EVWA 1RHUB 4RL1A 4R8UB 4H54A 1TUUA 1CZBA 3T5LA 3DMJA 4ZTJA 1NMEB 3N28A 2QV6A 1MMLA 2PMWA 4DR2K 2CQ1A 3OVAA 4BC7A 3LM2A 3NNHA 1S9GB 2ZH8A 2JEIA 4KB7A 3KDOA 3M2RB 3H20A 4XH5A 1NMNA 1T9XA 3SQGA 3RZAA 4FJJA 5U47A 5DM6Q 4IG3A 3HXMA 2JHEA 3U6FA 3QZ7A 5K14A 4NLSA 2ZD1A 2XM3A 3VQAA 4P2FA 2K3IA 2VKRA 2ZHOA 4ZIWA 4CJLA 2NXCA 3G8SA 2KJVA 3TUPA 3CMAN 3PG9A 4I1TA 3H42A 4IH7A 2AW0A 2CA9A 3CM6A 3H8YA 4DN0A 2ZKUA 2DNMA 4KH4A 2Q97A 2Y1RI 1TKTA 5HI7A 2IDLA 1T9YA 3GSDA 4O44A 3BS9A 1KD1T 5HMWA 3VQBA 2RQMA 1WKJA 3IRXB 2YQ1A 4LBPA 5HJXA 1XMQF 3GIIA 4ICLA 4CJQA 3S9HA 5IT0A 5EWGA 1RUSA 4HI2A 2CGKA 2CUYA 5G0RB 2C2EA 4F50A 4B3MF 3Q83A 4KAZA 4USWA 5KFOA 4IJAA 2CVIA 3WNFA 2CH6A 4M3RA 4R0EA 1TL5A 1DLOA 5IZHA 3AXMA 4JI3K 4DV7F 4J2DA 1VBKA 3ZETA 3M2UA 4M7XA 4CO3A 1HBMB 1YLXA 4JI5F 5F8LA 2FZCB 4IOCL 5DO2A 3NNCA 2OTLN 3HVAA 1OH7A 5GADI 1RDUA 3VCDA 4ID8A 4CO1A 4MJKA 3MN6A 4CGDA 1D5AA 5HMYA 5GAEU 3C8YA 2UXDF 1ROFA 1B99A 1RTIB 2JWNA 3A8JA 5A8KA 5E33A 3OY9A 2OFGX 1J6ZA 1NH7A 3BPSP 3NGIA 1SH2A 4H4OB 1VCTA 3A12A 3CJ9A 5GAGP 1GEHA 2H5JB 3KJNB 4CE9A 1JQGA 4YOTA 3VQ6A 2HSEB 2CPDA 3VWSA 5EDWA 4AF1A 2YTCA 4Y2AA 1XR5A 1JLFB 4DSKA 3AV9A 2UVUA 1T0TV 2WAQD 3CCSN 2D7SA 1BO5O 3PSIA 2IOCA 5GIPA 4K2JA 1HYVA 2JZ5A 4OIXA 2VQEF 3CE8A 3AAPA 3ENVA 1VQKN 4I68A 1W26A 4DV5F 3KVGA 1RBVA 5KRTA 3THYA 4TSXA 1XMQK 2WCXA 4K4SA 1UMJA 4M5DA 3IG1A 3UR3C 2F4VJ 1JCGA 4OJRA 4R79A 3GFYA 1GXUA 3PHEA 3MM6A 1VSMA 3IWXA 2D1CA 3RMAA 5KT6A 4B3MK 4NX9A 5HROB 3A5NC 3KZBA 2O4GA 4AXJA 1ZA2B 3FCWA 1S6OA 5I3PA 3MM7A 1S79A 2KI2A 4L8RB 4CJ5A 3GCWP 2AF6A 4ECWA 3TA1A 2QKBA 4DV7K 3LGNA 1N52B 4AQYF 1HNXF 3L7OA 2HGLA 4M41A 2IM1A 3FRZA 4HDHA 1RAHB 1YF5L 4F67A 3A3OB 3CQYA 3GOIA 1SV5A 2ASJA 2YQ3A 2DNPA 1X1PA 3MUTP 3ID6A 3FEXB 4X4SA 2NYHA 5JJBA 4CJRA 2W6LA 2W40A 2CQHA 2UXDK 4KB1A 3JXOA 4AL6A 1R0AA 1AUDA 4ZN3A 2RQKA 3M5RA 3TRGA 3JQJA 3UDLA 5MAOA 3FSXA 4LF2A 4ED0A 2O8CB 1TKDA 5SUHA 1NDLA 3AY9A 1XI1A 1J53A 1RTDB 4A2BA 5C10A 2Z56B 1L3UA 1RP5A 4WXOA 3DAWA 3W7BA 4DR5F 2XY7A 3GL1A 2X3GA 2XI3A 4Q5VA 1BUPA 2DHSA 4NWBA 3GE9A 4GY2B 1YJWS 4ILJA 1YQHA 3M8RA 3WBZA 3BGOP 3FEYB 3UKUB 3RB6A 2HFZA 4DPWA 3I8DA 2VQEK 2MQQA 2GIRA 3BGRA 5FPEA 3FZLA 1FCAA 3AVKA 5HOOA 3OYCA 4DV5K 2G8VA 1U1RA 2BH1A 2X1BA 3HHLC 1YJWN 2HFSA 3DGPB 3DI6A 1G7CB 4H4KC 3JTOA 3O6WA 3DNCA 3HLUA 4JKCA 2X6NA 1Z05A 4LF5J 3SPYA 2VBYA 2Z0GA 4WXWA 3PTWA 3TSUA 3NCRA 1HUXA 1J9AA 5B09A 1IG8A 2BUPA 4IFYA 4AQYK 1HNXK 4UF4A 2YKMB 1P8ZA 3DLKA 1RCOB 3KHYA 4P2MA 1DRZA 3A2FA 1YJNS 4J2EA 2X7IA 1O8BA 2J5AA 4ZPDA 1WAJA 4YOWA 2VF3A 3J7YU 2HW3A 2FLOA 2RT3A 2VC1A 1RK8A 1Y0HA 5CYJA 4MYTA 4DV3F 3IMXA 2KFZA 2BW7A 3I9V9 1YJNN 4RU9A 2G2YA 3V5RA 4MH8A 1NK7A 4DPYA 4C97A 1K8AT 4H5WA 4BC3A 3VQSA 4DI6A 3J7AP 4K4VA 2OD6A 1TZ0A 2ZQBA 2OEJA 4RNFA 2RU9A 5DQHA 4ZPAA 4TXSA 4TN2A 4DR5K 2GO8A 2QKKA 2LMIA 1FXRA 1X4HA 1Q7LB 4DR3J 1B0VA 5LL6Z 1YWXA 4A4JA 2DNRA 3PX4A 5KFQA 5HVHA 2M0GB 2V0NA 3TU5A 2D0PA 2I38A 3PKMA 4CRJA 1LWFB 2ZF5O 4JI0J 3CJCA 1X4FA 1UETA 1RYSA 1MDUB 2IRYA 3QGPA 2G1HA 1FXDA 1I5OB 4F2SA 2O8FB 2X74A 2V68A 5C2FA 4Y65A 1YAGA 4KE5A 4CLPA 3ISNC 4OX6A 3FE1A 3C6TA 2F8SA 3EM1A 4GV3A 4CIEA 4ECSA 4IFVA 1JIHA 1DGKN 1ELOA 4IG0A 5EHHA 5GADP 4FYDA 2AGQA 1RDDA 3D0PA 3L3UA 3THWB 4RTFD 4CF0A 3KUGA 3ZO7A 4NO7A 3TUJC 2OEKA 1HNWF 2POKA 1D4XA 2P2CB 4OFZA 3MPUB 1NAQA 3B78A 1VSKA 4PG7A 5KFPA 4MKBA 4JYAJ 2WTFA 5FPDA 2YNIB 4ILLA 1IG9A 3FGUA 4EK2A 3VF0B 2J9DE 2J9EA 3NWRA 5KFUA 4F0KA 4DV3K 1VC6A 4CI6A 3LP0B 2Z1HA 5C0YA 3VAGA 1B9DA 5IC4B 1WSRA 3D66A 2XYPB 1WSEA 3DGVA 1KWMA 5FRMA 3N5BA 1RACB 1HYSB 2HHUA 3VQEA 3BQ1A 2R7OA 4ZVSB 2DHHA 5CA5A 1MMDA 2V5HG 3VENA 1EJ7L 2QA4N 4JI1F 1RKJA 2R7UA 4M3WA 4K8XA 3U1NA 4EGLA 2BANB 2CJKA 4OKEA 2DTJA 2FJWA 4DF4A 1I3OB 1VSIA 4HH0A 1BMQB 1PKUA 3TYTA 3RWUA 5AQUA 2MLXA 3A1YG 4PG5A 1GLAG 1VS3A 4ZCKA 4L75A 1KP6A 1W25A 4DUYJ 5E0OA 4IOXA 2CFXA 4CEFA 1CS4A 2O8BA 3CCLS 1GT8A 1LWCA 2EFVA 5DZ7A 2Y1LB 4OJHA 2P9LB 3DM2A 3ZNUA 1YZ7A 1RT3A 3ZZOA 5EU7A 1V9OA 1HBNB 4Y0WA 2FY8A 3SXLA 4C1NI 4ZCMA 1WG1A 4PR6A 1HNWK 2MKKA 3WUHA 3O3GA 3OTOJ 1B4SA 4CHZA 1HARA 3NDKA 2IBOA 3I5AA 3ZT3A 2EVZA 2U1AA 5C42A 3BGLA 5BXIA 4CF2A 3QBWA 3AXKA 4DTOA 3JSRA 5FJ4A 3I0RB 2ZOMA 4QWEA 2XCPA 4DR6J 1DY3A 1K73T 2R7RA 3V6DB 1Y5IB 3H2VE 4X64F 2KZZA 3LZIA 4DV1J 4LVNP 1Y10A 1VQ9S 4OPHA 2MGZA 1Z1ZA 3L4BC 3ZTRA 2FBTA 1DBDA 1N32F 5ETLA 3BP8A 1ZAVA 2FLNA 4HLBA 3T1AA 2FVCA 4J91A 4JI1K 3M8YA 5AR0A 4QZVB 4K2XA 3T7ZA 3K7RA 1VQ9N 4YB1P 5HRNA 1FO1A 3PYFA 4ID5B 2FC0A 4NYPA 4DL7A 2ZJQQ 1I6JA 2LA6A 2P9EA 3WNHA 2OO4A 1FDDA 3D2FA 3O6QA 3PRDA 2KDOA 4I2PA 1QDUB 1F5AA 3AVCA 5HRSA 2FVRA 1HBUA 3CCMS 3P31A 1J27A 3NEKA 3M32A 5LSOA 1NKBA 5I42B 4L73A 1N34F 4DTRA 3OYHA 3WXIA 2ZBQA 3CULA 1KAXA 1VQMN 5J2QB 4FKYA 2LQ8A 3M9MB 2P9IA 3T9ZA 1R6VA 3BPDA 4LRAA 2UXBJ 4J2BA 2CQPA 4LUBA 1Q53A 2J4RA 3H6EA 4CHPA 2V9WA 4F2RA 2G2OA 4FYXB 3RW6A 3ZZPA 4AHRA 5F8GA 4JI4J 3GZ7A 1UVMA 3VGKA 1I51B 2JVOA 5A8WB 4X64K 2I5JB 3CI5A 2HQGA 2YNFB 1WKKA 3CCTA 3GLJA 3W8GA 4A8XA 1FDBA 3K5NA 2JL9A 2VBWA 3TSQA 1HJOA 1FTCA 2CYYA 3E2EA 3HPGA 5A2QO 1LW2B 1N32K 4C23A 3GP9A 4EUVA 5J1PA 3OYDA 3VF4A 4ZVFA 1X7VA 2XI2A 3AH6A 3LM9A 2C2NA 2CZ9A 1KBRA 1M5PC 2MHEA 2Q43A 3S41A 4CDIA 2IJRA 1YJUA 5A6WA 3CCJS 1RT5B 4DV0F 1CJTB 2W01A 2CDRB 5F9NA 1YIJS 4CZLA 4ITSA 2RDJA 3CJ3A 2NRWA 4OHXA 5KPTA 4YR2A 1PIEA 3FBEA 1YJVA 4KHNA 2CPYA 4QW9A 4I2QA 3O9TA 1V6HA 1ZOTA 4CJTA 1DTTA 1SJQA 3QQCD 1N34K 4O3NA 3NVKA 3KJVA 2IDOA 1F2GA 3FMWA 4NLWA 3CDWA 4AHVA 2LECA 2AGOA 1SAZA 4DV4F 1LCUA 3OFEA 1IJEB 1MA9B 3O4QA 3M8ZA 5FDLB 3AA4A 2VWKA 3SZ2A 3JQKA 3Q8VA 4ZCIA 3WIVA 2HRYA 1PBUA 1TV6B 3H4BA 3HVRA 3FSYA 1VJQA 1ZAXA 3DRXA 4K42A 2V34A 2CQIA 4KC5A 1UCNA 1FK9B 2G0IA 4A47A 3KIOA 1VQSA 5D6GA 2LDYA 2FC8A 3OXLA 3HL8A 1RWWB 3RAXA 4KHQA 1FW6A 3O9UA 5C12A 3CYMA 4B9VA 1VQON 4HDGA 3KHHA 4CJKA 1SCJB 2HQ3A 3PEHA 1J5EF 3HP9A 4PWDB 4TLRA 5DZ6A 4AUKA 5BYRA 1LOTB 2DFFA 3OSNA 5J2MA 2QK9A 3VEVA 4J9RA 1TFWA 3O5BA 1RWKB 4JV5J 1X9SA 1R31A 4GMJB 2CJYB 5KFSA 3B6OA 4B3SF 4RBUA 5E84A 5F3TA 3UNGC 1KVBA 5IWAJ 5KFBA 3K8WA 2UP1A 4DU1A 2HQDA 3FGVA 3TA0A 3TAMB 1M90O 3LANA 3CHWA 4LF6F 2RRBA 4ECTA 3M6WA 5CHCB 4I4BA 2QSWA 4NASA 4J9QA 1Q81T 3ZEUA 1IO2A 3GTYX 1X4CA 1L3VA 3E8OA 2B4VA 3MPYA 3VAJA 4CLTA 5LJ3Y 4RWTA 4QCLA 3UN3A 2QN6B 5IV3A 2RU3A 3CC7N 4DV4K 3C6UB 3IM8A 5GINA 2HS3A 1RBAA 3R1XA 2DGWA 4DS4A 1D8ZA 3UI3A 4E8UA 3PO4A 5BR8J 4IYQA 2O8DA 1U2FA 2Y9HA 1O5JA 2OKQA 3GG0A 3C15A 4OI2A 1XC9A 1MU2B 1QJHA 3QFWA 1URRA 5BPNA 1IKXA 2YVSA 3LW5C 2KVIA 3SAHA 4CJ7A 3J81U 3WC2A 4F4WA 1NMDA 1ZPVA 5AXKA 1VQ8S 2J76E 1Q8BA 4V19X 5CYMA 2QA4G 4QOZB 4UZCA 1VQYA 3WHIA 2F5GA 3SQ2A 2QTWA 4AYBD 4GKJF 4H4MB 3F9MA 5KFMA 4O55A 1VQ5N 4DPUA 1J5EK 4Y2MA 4A8OA 1T44A 3M3ZA 1FT8A 1PGZA 2ZWHA 3PW0A 1VRTA 4CJ3A 3OSPA 4EZ9A 2ILZA 2NSCA 2JJ4D 4ZS6A 4B3SK 2X6SA 3TARA 1NXIA 2QL5B 3TTDA 2O66A 3O44A 1NGDA 1RT1A 3Q24A 4H8KA 1HW8A 1YBAA 1NSAA 1C0GA 3O8MA 1N36J 4U8VA 2MKYA 4LF6K 1D09B 1ATRA 1N8RT 1MSWD 2XS5A 3DRPA 4QR1A 3CCEN 3DYAB 2ZVIA 1XQIA 2OH2A 1SC1B 2R8IA 1NGGA 1KQKA 5GAEI 4Z94A 1F9HA 5M1FA 5GMKa 1T3NA 3GBTA 4DR4J 1FWLA 3U27A 6AT1B 3RSEB 3D3BJ 4C8YA 2J7KA 1FERA 1CXQA 3AD8C 3W62A 2KZMA 3CF5Q 3TANA 4IRKA 3KKFA 1M5OC 1RAEB 3CFPA 1N0VC 3WX4A 1JLEA 3EGZA 2VD3A 1V4TA 3LQVA 4DHYA 1IKYA 1U6ZA 3KUEA 2WC9A 1FEHA 1N6QA 4KHWA 4DL2A 2VB6A 3DN9A 4NRTA 3PW5A 1JLBB 4R5PB 2EK1A 1T11A 3QEVA 1RTJA 3AY0A 4J90A 5KT5A 1PAUB 3UR0A 1BL3A 2ITMA 4HACB 1RADB 3M8WA 3EGNA 3MCPA 1JLGA 1NNDA 3DLLL 4EP5A 3V2UC 2DY4A 3JTPA 1J2VA 1MWQA 1RT2A 4GKJK 1SJ1A 3KK3B 1PJ6A 2VKZG 4Z4EA 2VWJA 1MWKA 1Z26A 4O4GB 4HCCA 3W5YA 2WOMB 1LWXA 5KT4A 2DXDA 4FXVA 3TA2A 1U7LA 2EC2A 1U45A 3ADAC 2RH3A 1O1WA 4FWNA 2RE1A 1EARA 4MKAA 2I6WA 2XULA 3BH7B 2R7WA 3KLGB 2Q66A 1SVDA 5HP1A 1M5SA 2YNHB 3KK7A 3THVA 1ATNA 1RT4B 2UUCJ 3CO0P 5AQKA 2NCKL 4DU7A 4JN4A 1IH7A 2W8KA 3AHPA 2JWLA 1P9QC 2HNYA 4CTAB 4KFBA 1RT7B 1D1UA 1YKWA 1UEUA 1S4FA 4CIGA 6FDRA 2FC9A 4Z7YA 1BQMB 2GWJA 1VISA 3CD6N 2Y8YA 1Q0NA 2V94A 2UUAJ 2E66A 1RAAB 2VCPA 1SC4B 4LF8J 2CPHA 1TR0A 4TU7A 2P9CA 1ACMB 1BCOA 3DRRB 3MEGB 3MTJA 2DRBA 3S7RA 1S72S 2EBEA 1UW9A 4IQMA 4O8KA 2EWSA 4YR0A 1REVA 2FY1A 5C2DA 3MEDA 2OCEA 2EHGA 2BR0A 4LF5F 5E5NA 3LDLA 2W9CB 4KIAA 5JMVA 2R8KA 5EY4A 3GYGA 4M42A 1U04A 2HNZB 2Q0RA 3LDOA 1S72N 4GC6A 5EGYA 3PYDA 3UQSA 3C14A 4ZHRA 4ZLNA 3R1LA 4NLRA 4OV1A 4L74A 4K7QA 3AJ1A 2ILYA 2AP6A 1VQ6N 5J2PA 2HSTA 2D3UA 1S1VA 5HLFB 1TK8A 1G1XA 2YH0A 1K8AO 1URNA 2DNYA 2NZ4A 1C1CB 2OHDA 1OJ4A 4K0KJ 2QG9B 2AKWB 3IAM9 4YHHF 2QI2A 5EX3A 5I3UB 4DTXA 2HVIA 2ZJRQ 2CQ0A 4HT5A 1BU6O 1VBZA 4CJFA 1JLCB 2BE2A 2ITGA 4BDZA 3DC2A 4NLTA 3FLCO 2AJ2A 3M7VA 4IBNA 4KBIA 3V81A 4WWSA 4UY85 4RW7A 2Z57B 1CJUA 1VQPS 3J7YI 5FLXY 4JNEA 4CIOA 4YP3A 4H5VA 1HNIA 1PC5A 2AEJA 4WYWA 2CZVC 1P27B 1B70B 2M3DA 3V1QA 3SUPA 1QM9A 2QFJA 2KM8B 3NF8A 2F8HA 2QE5A 2A18A 3N9UC 1F2HA 5LSLA 1KNZA 4JI0F 1Q1KA 1RAJA 3MN9A 3LO3A 3QPIA 1HFEL 1T02A 2J0WA 1Q5YA 3QAUA 3KKSA 3KOAA 4KHPJ 1RZMA 1NGJA 4LR9A 3D1HA 3RAQA 3DLRA 4U96A 1TMJA 2C2ZB 3ZSRA 4LF5K 3DHXA 2R7XA 4ECVA 2YY3A 1K9MT 3QEXA 3M30B 3BM7A 3TW0A 1S97A 4B3OA 4Q44A 2GV9A 3M4XA 2BJ9A 4DL5A 2VJVA 3VVTA 3E01B 3ETOA 3VVUA 5F8JA 2C42A 1FWKA 2E2NA 1LW0A 4TLQA 4RO0A 4MLHA 4QWCA 4PWUA 5AXLA 3CW2C 2P9NB 3SBGA 4YHHK 3MECB 2J9DA 1O13A 1EKRA 3VGTA 3Q22A 4M63C 3HT3A 4ECZA 3M8QB 2D1KA 5L1IA 1CEZA 1KLMB 2KVQE 1WAFA 2DHGA 2O01C 1NH8A 3I56S 3P1GA 3O3LA 2CGLA 5LMNJ 3B4MA 1S0MA 4WCEQ 3DU5A 4DCJB 2D69A 2MQNA 4RNOA 3UKRB