3KK2A

Hiv-1 reverse transcriptase-dna complex with datp bound in the nucleotide binding site
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
555
structure length
555
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
total genus 156
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kk2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kk2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kk2A05
3HKWA 5DQGA 2HVIA 1VSHA 3OYIA 2BRLA 3TANA 3IGNA 3HPGA 1RTHB 5DK5A 2QV6A 3MR6A 2VA2A 4K4ZA 1EETB 2AQ4A 2Y1IA 3AV9A 4RW7B 1QSLA 3P5JA 5E41A 4ZTJA 4O3NA 3M9MB 4YFUA 4HVJA 3MR5A 3QIDA 4IRDA 1LWFB 3UQSA 3PW5A 1NK4A 4O3SA 3V6DA 4KTQA 1RDCA 4F3OA 3M8SA 4ED1A 3KK1B 4M3TA 1ASVA 2B5JA 4ECUA 5L1LA 1JXEA 3LAKA 3NF8A 3C6TB 4QWBA 4RNNA 3PW7A 4Q5VA 4RW8B 3PO4A 2W7OA 3OYHA 4FJMA 3MECA 2OA8A 3CYMA 4WZQA 1RBRA 1S1UA 4CJKA 1TVRA 4ZHRA 2RF2A 3KK3A 2D7SA 4IRKA 1RT7B 3MTKA 2OH2A 4OLBA 3CDEA 3UIQA 2BGGA 4CJ3A 3K5LA 4CJEA 4E7HA 5KG0A 2YV0X 3ISND 5KFHA 4RNFA 1BQMB 3MFHA 4BWJA 1GX6A 4BWMA 1C0TA 3PHEA 3VN5A 4I2QA 4R8UB 3WNHA 2HWIA 1X1PA 2GIQA 2BE2B 2F8EX 4IDKB 3OS0A 2WK4A 3QESA 1KHVA 2E9ZA 4CE9A 1BI4A 4NCBA 4OGEA 3DI6A 1BCOA 2BQ3A 4C8NA 4M3UA 2KQ2A 3ZSRA 5J2MB 4I2QB 3P83D 4CK1A 3LWMA 4E1MA 2YNIA 3LPTA 3HXMA 4CEZA 4DS4A 2D0CA 1R0AB 3RBDA 1WSIA 4CHOA 4KE5A 3D45A 2B4JA 3DMJA 4ECSA 4DQSA 5EWFA 3KLFA 4JRPA 3HP9A 3KK2B 4MIBA 3QETA 1TK5A 5KFYA 4O3RA 4XPEA 2IAJB 1T03B 3NKYA 4Q45A 1VSIA 2IDOA 3M8QA 4IFYB 1VSKA 1L3SA 4H4MB 1T05B 4O4GB 1WSGA 1KLMB 3DRRB 1W0HA 2X74A 3MEGA 1ZTWA 2C2EA 1TKZA 3KHHA 2X6SA 2UUWA 4RW8A 1TL3B 4NLXA 2EC0A 1J53A 2G8KA 4HTUA 4Z4CA 4G1QA 3ALYA 4MFBB 5HRSA 4ELTA 4CEOA 5C24A 2O5DA 5DLFA 3BQ2A 1U04A 4MKAA 4TLRA 3F9KA 3DDKA 4DFMA 4HHTA 2HHWA 2BANB 3VQ6A 2BR0A 1S6PB 4DSIA 4BDPA 3V9SA 4JRQA 4ID5A 2HNDB 1DTTA 4FJ7A 3IS9A 3H5XA 4CHPA 2XHBA 4CHYA 1LW0B 5F8NA 4ED3A 2NUBA 1RTHA 2JEJA 3RB4A 2V4QA 4F50A 3SUQA 2ILYA 2WHOA 3T5JA 3QINA 1RCHA 3O3HA 3CWJA 4ECZA 4ICLB 5I42A 4EBEA 4RG8A 2GC8A 3CM6A 4AHUA 3N6LA 1SH3A 2FJXA 1VRUA 3IGVA 3FQKA 2W9BA 3RAXA 4RW6B 2D41A 3CIZA 1NKCA 3ZSZA 4CEFA 1T94A 2FJWA 3LALA 3V4IB 3RTVA 3PX0A 1SL2A 4EYHB 4K8XA 1WLJA 1WSJA 2KFZA 3NBPA 3OSNA 1BIZA 4O5BA 3EPGA 3TARA 4QPXA 1S6QB 5JS1A 1BQNB 4W5QA 1SL1A 3SCXA 2R2SA 5KG4A 1DTTB 1U48A 3SUNA 4KHUA 1U4BA 1S9GB 2IC3B 1JL1A 3BREA 3DOLA 1IKXB 3GILA 4CF8A 2A1SA 3RMBA 1JL2A 3I5AA 1NKEA 2R8HA 1B92A 3THVA 5T14A 3ITHB 3N6NA 5KFDA 3OHBA 4AH9A 1S1TA 4K8ZA 3RRHA 4J9SA 2IC3A 1SUQB 1TKTB 5KFMA 1ZBFA 3QGHA 2JGUA 3DLBA 3MXJA 3T5HA 4ZVGA 2VG5A 1S5JA 4NLQA 4KHSA 1BQMA 1NHVA 4W5TA 2OPQB 2ZQBA 2E9RX 4M3YA 3GIIA 3KD1E 3LP2A 2YKNB 3KLVA 1LWEB 3KK2A 4RUCA 4G1QB 4CHZA 1B9DA 3PZPA 3G0ZA 2G8IA 1JLFA 4GW6A 1BHLA 3A2FA 4M45A 3E01B 1VSDA 1RT5A 4RW6A 1TVRB 4O4GA 2W9BB 2ALZA 1YT3A 4FK0A 4QCLA 1SKRA 3T5KA 4N56A 1A5WA 3KKRA 1N5YA 3NFAA 4O44B 2XO7A 4M3XA 4DLEA 3EPIA 2B5JB 1BI4B 3BSNA 4O0IA 5I42B 4YR2A 2DPJA 4RZRA 4F4XA 3K58A 4J9MA 3QO9A 1KCFA 1S1XA 2AX0A 1TQLA 1TK8A 4DSEA 1CXQA 4WYLA 1RT6A 2Z1GA 2YNIB 3UR0A 4J9NA 4NLOA 1J5OB 4M41A 4CF0A 1C1AA 1CSJA 2HB5A 3G10A 1FXXA 4E19A 4DSKA 3VQEA 3L2VA 2HNDA 3KD5E 4NYFA 4OVLA 1JIHA 4WFYA 1DTQB 5C42B 3TI0A 4J2AA 3HPHA 4FJNA 2WRMA 2ZE2B 1RT7A 4FVMA 2BANA 2BDPA 3HJFA 4N47A 3OYJA 1MU2B 4DTOA 3U3GA 3JYTA 3HHKA 3V9ZA 3Q8SB 3HSTB 4CFAA 4BE2A 3P1GA 4IH7A 2OZMA 3MR3A 1U45A 3K5MA 5DG7A 3SFUA 1HYSB 1XI1A 1HQEB 3LP0A 4TYAA 5J1EA 3T3FA 3ULDA 3OYKA 3LP2B 2FBVA 4F4YA 4QWDA 3BQ0A 4RNOA 4H4MA 2VWJA 5KFPA 4XO0A 1NNDA 3CDUA 3ZSOA 3BGRA 4CESA 4FK2A 4TY8A 4CIGA 1WSHA 4CF9A 5CYQB 2HHQA 4FBUA 1KRPA 4FJLA 3KK1A 5KFAA 3FQLA 4OGCA 5KFFA 2OPSA 4ZP9A 3DLHA 2J6TA 4NRUA 4Y1DA 1HJRA 2BQUA 1TKDA 1KSPA 4CIEA 5F9NA 3ZSQA 2P5GA 4KAZA 4KHNA 3ICLA 4F4ZA 2E6LA 1ZBHA 4FZZA 4KHQA 4FK4A 1W9HA 1Q8IA 2BE2A 4YP3A 1EETA 4Z4EA 2YKMB 4NLDA 2Z1IA 3KMSA 1IKVA 4FW1A 2JEIA 1NK0A 1NK9A 4Q0BB 4DEZA 4M3WA 3AVJA 4B9LA 5J2NB 2R8IA 3AO5A 2R7YA 2HNZB 1S1VB 2JEFA 3QO9B 1KHWA 1X9SA 3OL6A 1N6QA 4ZVFA 4DQQA 4DTXA 4ZPAA 1N5YB 4I9LA 2XGPA 2HHSA 3VQPA 2IM3A 4E7JA 1QQCA 2RPIA 2P1JA 5F8JA 4HUFA 4PUOB 1RT4A 4CJSA 3DRSB 5HLFA 3WNGA 3VQDA 1KTQA 4F2RA 3ZT0A 2YKNA 5L1KA 4KHMA 1GOCA 1RT1A 2HAIA 1VSJA 1VSMA 3SI6A 4EYIB 5JXSA 1JLBA 3T19A 5JUMA 3QEWA 2IM2A 3MEDB 5J2QB 2XY6A 3SQ2A 4MQ3A 1Q9YA 2GUIA 3TABA 3VQBA 3KLIA 1KVCA 4B8AB 4B9UA 3C95A 3G6XA 4I9QA 1N48A 3L3UA 1REVA 2OZSA 2HMIB 3BSAA 4CGDA 4B3OA 3TVKA 2IJFA 3OSPA 4CF1A 5D3GA 3PX6A 1CZBA 5C25B 3CDWA 1TL3A 2EX3A 2IBKA 5DGBA 1JLFB 3KLGB 4WE1A 5I3UA 4CK2A 5CY4A 4QOZB 1QAIA 3IAYA 4R5PA 2W9CA 1ITGA 3DOKA 4O3QA 1ASUA 4CFBA 1JLQA 3I0SB 2IGIA 5KFUA 3GV5B 3DOKB 4CJTA 4Z4FA 3UDLA 3KJVA 1RTJA 4PWDB 3GQCA 3D0PA 3GIJA 3S9HA 4ECVA 1RAJA 1L3VA 3DMJB 4J2BA 4B9NA 2CJQA 2B43A 3NGYA 3PR4A 2LSNA 2AX1A 4IQXA 3DYAA 3ZT2A 4E7IA 4M3RA 1FK9A 1D1UA 4B3OB 3TAMB 2D3UA 5DG9A 5JS2A 5KT2A 1WSFA 3PR5B 4FJHA 1ASWA 3OYNA 4HUEA 1DLOA 1VSLA 4PQUB 3DRPA 4JUZA 2X6NA 4IR1A 4CJRA 4R8UA 3V81A 3LPUA 2YHBA 4JV0A 5HP1A 2C28A 2RDIA 4FYDA 3LDSA 2BRKA 2JC0A 1S6QA 4J9KA 3OJSA 2JC1A 4JV2A 1BISA 4ID5B 3DRSA 3NF9A 4RUAA 2RKIB 1RNHA 5FRNA 4Q8EA 2O4IA 4FW2A 4DQIA 2VWKA 3K57A 3IG1A 4NLPA 3SUOA 3HVTA 4OKJA 4EO8A 5J2QA 4FJ8A 4GC7A 2PZSA 4Z4IA 3RR7A 1UAXA 2ZD1B 5DMRA 3EZ5A 2XC9A 1NK7A 3H4DA 1QTMA 3V6DB 1TV6B 3M8PB 3M8RA 5KFRA 3Q8PB 3I5CA 4QWEA 2KZMA 4CFDA 4KV8B 3AO2A 2ITGA 5KFJA 4FBTA 1J54A 4LQ3A 1BL3A 4NCGB 3OYMA 4FLVA 3H5YA 4NLUA 1L3UA 4AHRA 3NH2A 3S3NA 4DMNA 5DLGA 3GIKA 4MK7A 4AHSA 2HHTA 4KO0A 2FLPA 3VQ9A 1RTDA 4CJLA 4C8LA 1S9GA 3PJXA 3DI6B 3WNFA 4DG1A 4OKEA 2HWHA 1S0OA 5CYQA 3KTQA 5FDLA 2DFFA 4EZ9A 4EBCA 4O0JA 3G6YA 4KHWA 2DFHA 3MEGB 3DLEA 1LWCA 1UA1A 1U47A 3IN5A 3H98A 1JKHB 1RT3A 1HYZA 4KB0A 3M8QB 4IFYA 3SPYA 5CYMA 5KRTA 2Y1JA 3H2LA 4B9MA 1RYRA 3KLFB 4J9PA 4ECRA 2F8SA 3GV7B 1R0AA 4KREA 1S1WB 2PY5A 3HVAA 2JLEA 1RTIB 1C6VA 4KSEB 1RBVA 4ED6A 4N41A 3RMCA 4WYWA 3TQ1A 1JLGA 3AVMA 5KFKA 3M8PA 5FRMA 1TV6A 4CGJA 4IFVA 2D0BA 4FJJA 3MXMA 1YVFA 1SL0A 1JLEA 3BJYA 3VQ7A 1UOCA 2WONB 3VQ4A 1J5OA 4RW4A 2HHXA 1QAJA 4MKBA 1K1SA 3QEXA 4LSLB 4HYKA 4LD0A 4FXDA 4IBNA 1HYVA 1RT2B 4C8MA 3KLHB 1RDDA 3FFIA 4CJQA 4KO0B 2E6MA 2XI3A 5CZ1A 3OYCA 1X9WA 4KHYA 1EXQA 3SI8A 4IR9A 4DSJA 4FJIA 3VQCA 5KG2A 3FRZA 3QLHA 5KFWA 1QUVA 4TXSA 1TAQA 1FKOB 4DL6A 2KW4A 4FJ9A 3PVXA 2YNFB 3OL9A 4NLGA 1CZ9A 3SQ0A 4F8RA 1F21A 4CJVA 1HMVB 1S1XB 1IKWB 3Q8QB 3CJ0A 1LAWA 3NF7A 2DTUA 1DLOB 4CCHA 1D9FA 2Q3SA 4I7FA 1L3TA 1JLGB 2VG7B 3ZSXA 5CZ2A 1LWFA 1S9EA 4MK9A 4IG3A 2XY5A 3NF6A 4I2PB 1D0EA 4H4OA 1TGOA 1JLCA 2ASLA 2W8KA 3E01A 4QW9A 5KFBA 4WXWA 4W5NA 4DU4A 3PJWA 2I5JA 1CXUA 2QE5A 4KI6A 5CYMB 4FCYA 3DOLB 4KPYA 1I39A 2DY4A 4CIFA 4WZMA 2HNYB 2G8UA 1A5VA 3AVHA 1LWCB 4NZ0A 1J9AA 5KFOA 5L9XA 2FVSA 3TR8A 4K4XA 3F73A 4IH5A 1VK0A 3EY1A 4LH4A 5K14B 3IRXB 4URSA 4RW9A 3CO9A 3AVKA 5KFSA 1HNVB 3GV8B 4TQSA 1HQUB 5KT7A 5KT4A 4NLRA 4FZYA 3TAMA 4BE1A 3QNNA 3NGDA 2YNGA 3CJ5A 5L1IA 3V1QA 4FM2A 2IA6A 5F9LA 3K5NA 2Z1JA 4CEEA 4ZPBA 3KIOA 5F8GA 3RWUA 2X78A 3E51A 1RBUA 2QXFA 4IH6A 2ASDA 3MEEB 1HMVA 1JXLA 3T5LA 2V4RA 2GV9A 3AA2A 3ZT3A 3KMQA 2R8KA 3BR9A 3DM2B 4WE1B 1QSYA 3L2RA 1FKOA 3KHRA 1S10A 1XR5A 3KOAA 3IS9B 4AHVA 2V9WA 1B9FA 3OL7A 4K4TA 3UPFA 3SYZA 5KG3A 1LV5A 4K4VA 1RA7A 2EHGA 3IG1B 3OY9A 5KFXA 3CFPA 1RT2A 4E3SA 5KFGA 2CKWA 4KHRA 4C8OA 4LSNB 3QGIA 2YHAA 4QW8A 3VQ8A 1QE1B 4FM1A 2VA3A 3CJ4A 2XCPA 4DSLA 3OYEA 4FM0A 3U3YA 4L8RB 3L2WA 1K6YA 4H4OB 3V81B 2B6AA 3OYAA 1S9EB 5EWEA 3KHLA 4EZ6A 4CJ4A 3NE6A 4PQUA 3H5UA 2W7PA 3V1RA 2VG6B 1D8YA 4IRCA 1S0MA 3AO4A 1CLQA 3QEIA 1S1WA 1C1CA 2QK9A 4ZP7A 1FK9B 4W5RA 3AA5X 1S49A 1SH2A 5J2PA 1X9MA 3LP1B 4KAIA 4ED7A 5KGXA 1WNEA 4QWCA 4FJKA 2XWYA 1KLMA 3DRRA 3KNAA 4DTJA 3FDSA 4O4RA 1NK6A 5F8LA 2FBXA 5K14A 4OKKA 1NKBA 1EKEA 5HBMB 1IKWA 3HT3A 1JLQB 4CJUA 2FJVA 1YTAA 3VQQA 3OJUA 4KTZA 3OVNA 3N6MA 4GVMA 1D5AA 1C0TB 4HUGA 1S9FA 4EBDA 3C94A 3AA3A 3PY8A 3C6UA 3RB3A 4CF2A 1XR6A 4URQU 2ZE2A 1XWLA 3AVCA 4WFZA 1O1WA 5F8MA 3RB0A 2YNHB 5KT5A 4K4SA 3V6JA 2WTFA 1I3AA 2E4LA 4XPCA 1RILA 4NYZA 3TWHA 3BQ1A 3I0RA 4KKOA 1NOZA 4DTMA 1JLAB 5KG5A 3HVWA 3VQ5A 4K4YA 3QIPB 4IG3B 2UVWA 3SJJA 4TY9A 4NLVA 4CECA 1RYSA 4Z4HA 3V9WA 4DTPA 3TAFA 1RDBA 2OPRB 4DTNA 3CJ2A 4KKOB 1JLEB 3HPOA 4DTRA 4ZVEA 2HVHA 2ETJA 4BE0A 4Q8FA 1RBSA 3OS1A 1HYSA 4E1NA 2R8JA 4NRTA 5KFTA 3PUFA 4BACA 1HNIB 3JSMA 3K2PA 3HVTB 2KTQA 2G8FA 3O3GA 4PA1A 3AO3A 2D0AA 2RDJA 2BQRA 1NJWA 1FKPB 2UVUA 3LWLA 2RKIA 4FJGA 2IJNA 1NK8A 1VSFA 4FLUA 1TP7A 4KRFA 4ED0A 3ASMA 3EYZA 2HHVA 4CJFA 1EP4B 1SV5A 4J9OA 1IG9A 1RTDB 1LW2A 2RN2A 2WB4A 2G8HA 2FBTA 4LSLA 3V6KA 4CGGA 3OYGA 1NJYA 2IM0A 3KLEB 4ECWA 4PY5A 5J2PB 3NDKA 4JS5A 4O3OA 2WONA 3M9NB 4CJ5A 1TKTA 3VA0A 2AGOA 4DTSA 3PV8A 4Z0UA 4ZP8A 4B08A 1NK5A 3BSCA 4FLYA 4QWAA 3CFRA 4KV8A 2P51A 5DQIA 3D28A 3GIMA 4GMJB 4Q44A 3LP1A 1IH7A 1RT5B 3DLKB 2AJQA 4N76A 1JXBA 4KFBB 1C0UB 1T7PA 3BSOA 3NGZA 4AHTA 3TAPA 3QNOA 4RU9A 1LWEA 3H40A 2W8LA 3MR2A 3U6FA 4TYBA 3BGRB 3AVFA 1WAJA 3NBPB 5KFZA 1A5XA 4J2EA 2C2RA 5I3UB 3KLGA 1KFDA 4ED2A 2G8VA 4O3PA 4FLWA 1HQEA 3IRXA 3S3OA 5KG7A 1NOYA 3CG7A 2R2UA 3VQAA 4UQGA 1N4LA 2D5RA 3OYBA 5KGWA 4WXOA 1WAFA 5HP1B 3L2UA 4OL8A 1RDRA 1LAVA 4IKAA 3DRPB 1TL1B 3KLIB 4FS1A 1ZBIA 1UWBB 3SQ1A 1JLBB 4B9TA 2C2DA 4CEAA 4M42A 1HPZA 4DL5A 4ZVHA 3AVBA 1C0UA 4NLTA 5HRPA 1QHTA 2HHUA 4GC6A 4K4UA 3ZSVA 1OS5A 1YVUA 2IOCA 4E89A 1ZBLA 4FLTA 2ATQA 3MEEA 3QGGA 1RT4B 3MF5A 2VG7A 1VSEA 4KTWA 4QAGA 1HNVA 5KG1A 2VG6A 1T3NA 4CEDA 3PW2A 4J2DA 1Z26A 4F4WA 2WCXA 3RB6A 2IS3A 4EEYA 4FZXC 3I0SA 4AHCA 1RBTA 2R8GA 4DQRA 4Y34A 1D9DA 3GYNA 3RR8A 4R0EA 2UVVA 5EDWA 4KB7A 5F8HA 1T05A 4ELVA 3SFGA 4RW9B 1MMLA 3G6VA 1IM4A 3L8BA 1UWBA 3T1AA 3LAMA 1REVB 4CGHA 5HROB 3B6OA 2OPPA 5C5JA 1ZBUA 2Z1HA 4RNHA 2AGQA 1XHZA 1QS4A 4X2BA 2XI2A 4IKFA 2ILZA 1S6PA 4RW4B 1G15A 3ITHA 4I7FB 3QZ7A 4EO6A 4DFKA 1RT1B 2HMIA 5FROA 3DM2A 5HRNA 4E7LA 2I1RA 4E7KA 4CEBA 2WOMB 4MFBA 3G86A 3OYLA 1NJXA 2OPRA 1JLCB 4PUOA 5SWMA 3QIPA 3RAQA 3LZIA 4DF8A 1BQNA 4TN2A 3NH0A 3QLHB 4ED8A 4FS2A 5KRSA 4C8KA 3QEVA 3DLKA 3DLRA 1TL1A 4OJRA 3O4QA 2AU0A 4ECYA 2W42A 3MAQA 2F8TA 4DSFA 3QYYA 2PYLA 3SPZA 3OLBA 3AVAA 1HQUA 1QSSA 3AO1A 2FVRA 3B6PA 2ASJA 3DLEB 3H08A 3MECB 1IKYA 4TSXA 3K59A 2YKMA 3C6TA 1DTQA 4Y2AA 2C22A 1UA0A 4DG1B 3FFIB 4IG0B 2XY7A 1EP4A 1SV5B 1KVAA 2QKBA 1C1BB 4H8KA 4URGA 2HNZA 2ATLA 4K4WA 3PO5A 1Y97A 1HRHA 4FLZA 4Q0BA 4CGIA 2I5JB 2D3ZA 1GX5A 4RNMA 2FVQA 4M3ZA 1FKPA 1WSEA 4NCGA 4K50A 3NHGA 3H59A 2DPIA 4JV1A 4DLGA 2R2TA 3NMAA 1HNIA 4LH5A 2XY8A 1ZETA 3SV3A 3PW0A 3RRGA 4ZPDA 1Z4UA 3TAQA 2FVCA 1RTIA 4LQ9A 1NHUA 2RF2B 3KK3B 5KFEA 3PW4A 3SQ4A 5L1JA 4ID1A 3ZCMA 1KFSA 4M94A 4AILC 2FLNA 2V0NA 3LZJA 1S0NA 4J9RA 2ZD1A 4B9VA 3TAEA 1QE1A 4HCBA 4LSNA 3JYTB 4TY8B 1W25A 1LW2B 1SKWA 2R2RA 1Q9XA 3OYDA 1JLAA 5F8IA 3RMAA 3ZT4A 4W5OA 4JS4A 5C42A 5KFIA 1N56A 5J1EB 1IKVB 2G8WA 3QERA 2AWZA 5EU7A 4DL3A 4RW7A 5DG8A 3NL0A 2FLLA 2OYQA 3JSMB 1MU2A 2IM1A 4DFJA 4NLSA 4CK3A 4BDYA 4EP4A 2W9AA 5KFCA 2P5OA 1GOAA 4J9LA 4B8CA 5J2MA 3CVKA 4M95A 5EWGA 3QEPA 1KLNA 5T7BA 4CFCA 1C1BA 2OPSB 4XIUA 4IG0A 2XCAA 1U09A 4IDKA 3L3VA 4DWIA 3HK2A 4YMEA 4O44A 4OPJA 5DQHA 2FVPA 1IKYB 3QZ8A 3I5BA 5DGAA 5KFQA 4YNQA 4Z4GA 1HARA 2YNGB 2WOMA 3I0RB 4CGFA 3OS2A 3SZ2A 3ZSWA 4NCAA 3RBEA 4E0DA 3NGIA 1C0MA 5KFLA 2YNHA 4MIAA 3MFIA 3OLAA 4CJWA 3EZUA 5EUHA 3NCIA 3NH1A 3NAIA 4FLXA 3NAHA 3C6UB 2O4GA 3V1OA 2B6AB 1SH0A 4OLAA 4LY7A 2J6UA 4JLHA 1XC9A 4ZHRB 2OPPB 1XHXA 1S1UB 3CFOA 2VG5B 2KFNA 5KT6A 4CEQA 1BIUA 4EP5A 5KT3A 3HM9A 4F2SA 5HROA 3Q8RB 5FDLB 2PYJA 5HBMA 3M9OB 1S1TB 3MXIA 4NLWA 4B9SA 4DFPA 1ZYQA 3DLGB 1WN7A 4DU1A 3OHAA 3WNEA 4J9QA 4DQPA 4ZP6A 3K5OA 3SUPA 1LW0A 4DL2A 2OPQA 3LANA 2FC0A 3AVLA 4ZMMA 4I2PA 5HRRA 1RT6B 2J6SA 1IO2A 1S48A 1C1CB 3NAEA 3V9XA 3HO1A 3KJVB 3V9UA 1S4FA 3ISNC 1TKXA 5KI6A 1K1QA 4KBIA 4YR3A 3CM5A 1KVBA 3O3FA 4DF4A 2F96A 2UUTA 5HLFB 1IKXA 1U49A 3L2QA 3H4BA 3I8DA 3BDPA 2GBZA 2YNFA 1Z25A 2QKKA 1VRTA 3CJ3A 2AGPA 4OPKA 4NLYA 5KG6A 1EX4A 3KKSA 3CQ8A 4ZTFA 4HCCA 4CJPA 4FJXA 4YR0A 4DTUA 4CERA 4DL4A 2IAJA 1T8EA 4U6PA 3TAGA 1TKXB 4ECTA 1TAUA 1RA6A 4MK8A 3AA4A 3RMDA 4Y2CA 2W9CB 2FBYA 4R5PB 3KLHA 3AVNA 3V4IA 3OYFA 2E9TA 5J2NA 1YTUA 1SUQA 5C25A 3LP3A 4IOBA 4TQRA 3SV4A 1BGXT 1RDAA 3ZSYA 1HPZB 1ZTTA 4IFVB 4Y1CA 4KB1A 5SZTA 3DLGA 1JX4A 3HP6A 4DL7A 1SKSA 4CHNA 3HYFA 3SNNA 4O55A 3FSIA 3HL8A 4F4KA 4ELUA 5KTQA 3KHGA 3MEDA 1NJZA 3VA3A 4NYNA 3HVRA 3O4NA 4Y3CA 1S97A 4DS5A 4Q43A 4KFBA 3QIOA 4H54A 1I6JA 2XGQA 3D5MA 5KFVA 2KZZA 4ECXA 1XR7A 3DYAB 2HW3A 3ZT1A 4DU3A 4YQWA 3VQSA 1N6QB 1TKZB 2A1RA 4U7CA 4ZPCA 1TK0A 3S3MA 2DFEA 1JKHA 1RT3B 4MH8A 3OL8A 1GOBA 1RTJB 4PWDA 5KFNA 1L5UA 2IMWP 1BCMA 4CHQA 2XRIA 4WFXA 4HKQA 4ECQA 1T03A 4F3TA 5C24B 1WNSA 4BDZA 1VRUB 3LP0B 1C2PA 4G3IA 4KI4A 3KLEA 1VRTB 2UVRA 3PX4A 2HNYA 2GIRA 3H5SA 4FJ5A 3AVIA 4ICLA 2JEGA 5D3GB 3AVGA 4N5SA 1S1VA 2ZKUA 3V6HA
chains in the Genus database with same CATH superfamily
4WKYA 3OYIA 2JH3A 3TANA 5I9EB 2GQQA 1WOQA 1RTHB 3BYPA 4XTTA 4DBQA 2QV6A 3MR6A 3R8EA 1YI2N 1EETB 4BVOA 4XK8C 3H46O 1P8ZA 3AV9A 4RW7B 3P5JA 4NMLA 4HVJA 2J4RA 3EVOA 1B7FA 1LWFB 5KOWA 2BE9B 2LXUA 2OJ3A 1XQSC 3G2XA 1NK4A 3PIOL 2RQKA 3DC2A 3L7OA 2KVQE 4O3SA 4KTQA 3R5DA 3M8SA 4ED1A 1NCLA 1ASVA 2YJEA 4ANCA 4MKVA 5EX5A 2KH9A 4RNNA 2Q6CA 4F7VA 3PO4A 2A41A 3MECA 4DV6J 5HVHA 4LFAF 2NSCA 1TVRA 2FZGB 4ES3A 2AYBA 1FNXH 4YDUA 4DR1J 1AFJA 1J6ZA 4JKFA 2OFHX 3CDEA 1H73A 4NL5A 2R7RA 4BQZA 4YDDB 2QWMA 4CJ3A 3K5LA 1VQPN 5KPRA 4E7HA 2ZH3A 3ISND 1Q5VA 3MFHA 1GX6A 1K8KA 1WELA 4WP8A 3VN5A 1RAIB 1ZAWA 5AQIA 3WNHA 1X1PA 2RQMA 3OS0A 3AOAA 2RUGA 3G82A 3W7BA 2E9ZA 3CUNA 2BM1A 1GLFO 2W41A 2BQ3A 5J2MB 2RVJA 2YNIA 4LF5J 1UVMA 2YWWA 3HXMA 4CEZA 2EFQA 3L9ZA 2J7KA 3EGNA 1WF0A 1WSIA 4CHOA 1MG7A 1RB0A 3CJRA 3KLFA 1BOTO 3C7NA 3KK2B 3QETA 1QVFR 1MN9A 1TK5A 5KFYA 1T03B 5A8WB 4IFYB 3TX0A 1L3SA 1Y64A 3N28A 2FHJA 3GL1A 4O4GB 3DRRB 2J7WA 1TKZA 3KHHA 1RWUA 4Y65A 1YHQS 4GKKK 1G6BA 4NLXA 3N4QA 4GNIA 4DPUA 4DV2F 2F4VF 2PT0A 3HULA 1J5EJ 5M1QA 2H65B 4ALZA 4I6WA 4H0PA 4K5RA 1U04A 2CADA 4TLRA 4UUXA 2Q2RA 4H0VB 5HQ8A 4DFMA 5IV4A 4CH1A 2ZJPL 3IAS9 1ZBTA 2BR0A 2DHGA 3V9SA 5FPMA 1G2EA 3MN6A 1V4SA 4EI2A 3IS9A 1NGDA 3KJNB 4CHPA 4ZPTR 4LR7A 2V4QA 1F3FA 5EX0A 5BRFA 3SUQA 1Q8KA 1CVJA 2WHOA 2AV5A 1RCHA 2HGLA 5I42A 2XZWA 3MGJA 2GC8A 1DGKN 3CM6A 3L3CA 4UTGA 2A6OA 1Q82T 1SH3A 1VRUA 2NZ4A 2OMLA 3T1HF 3RAXA 3CC7S 2MEWA 4OI3A 3SDEB 2FQQB 2W4CA 2A6AA 3RTVA 1SL2A 2Z30B 5IZHA 1ZC6A 4K8XA 5DZ6A 3JS9A 2KFZA 2K06A 3OSNA 4O5BA 3DHXA 1NBEB 3W3DA 5ETOA 2HSEB 2QWQA 3VETA 4M5JA 3SUNA 3CF5L 4KHUA 5A6PA 1WTBA 3GILA 3RMBA 1Z2LA 1NKEA 1NGBA 4UW2A 4OI1A 1B92A 2CG8A 4BRFA 1FJGK 3R6GB 2HF3A 1IBLK 1DARA 5KFDA 2BYCA 2VASA 4BR7A 3RZAA 4IWVA 1J5EK 2WVFA 5KFMA 3QGHA 3H3NO 1S5JA 1HWIA 3FVYA 1N32K 1BQMA 3D66A 2OPQB 3U27A 2E9RX 3TUZC 2M88A 5M2RA 4BR4A 3S41A 5DRKA 7AT1B 1LWEB 5LXYA 4RUCA 3FMWA 2G8IA 1TUWA 1HNWK 4BVPA 2OELA 3CCEN 4MMOA 4RW6A 5CCMA 2W9BB 1YT3A 2VDHA 3KKRA 4O44B 2XO7A 4DV7K 3KWMA 4RBVA 4CLYA 4I64A 4J9MA 2AX0A 2YQ3A 4WYLA 4DR4F 3L09A 1S79A 3UR0A 4J9NA 1J5OB 4M41A 4YB6A 1WKKA 2V50A 2F7TA 3M2UA 3G10A 2NUHA 4S0MA 2ZH8A 2NRTA 1R7IA 4NYFA 1JIHA 3SQGB 2IRUA 1ACMB 3EMTA 1FTRA 2BANA 3PYDA 4B1VA 2BJDA 2BDPA 1YI2S 4Q2LA 3HHKA 3V9ZA 3HSTB 2HPUA 1NZAA 4GKJJ 4BE2A 2F4FA 3P1GA 1TFWA 2WBMA 1XNQF 3SFUA 1IR0A 2DNOA 3LP0A 3EEQA 1CBKA 2HHHK 3OPKA 3OVBA 3GTYX 3MPUB 3LP2B 2RE1A 3BQ0A 4YOUA 5KFPA 1K9MO 4FF4A 2IY5B 3CDUA 3ZSOA 1I3OB 3GJRB 1XERA 1HLWA 2Y8WA 4FK2A 1RHRB 1SJ3P 3LDQA 1HNXJ 4ISEA 5CYQB 1KRPA 1RBAA 1RDWX 2DBBA 3MPWA 3BV8A 4OJ3A 3H90A 4Y1DA 4YEAA 2ATCB 5G0RA 4L3QA 2N82B 2GZOA 2B9WA 2QLWA 4YN3B 4KHQA 4BRLA 3VWSA 3C8YA 2BVZA 4CLTA 4Z4EA 2MKJA 2APOA 4ZLLA 2ASYA 2FHJD 1NMDA 4Q0BB 4M3WA 1SQFA 3AVJA 3CCUS 3PHTA 3VF4A 2CVIA 3UNGC 2JEFA 1N36F 5F0XA 1N6QA 3F44A 1X5TA 4B9QA 2LLZA 4DQQA 1VQKS 4YDUC 1R8BA 3ILLA 3TUIC 4ZPAA 3VQPA 3DLLQ 3FZMA 2IM3A 3LA0A 3HBTA 2PIIA 3VERA 4WIQA 3LDNA 4J5OA 1QVGM 4A47A 2DHSA 5AQZA 4PUOB 5LJWA 4DXLA 2C2OB 2BEFA 2K3KA 2DHXA 1GOCA 1RT1A 4HH1A 3IDHA 3TA2A 2GQCA 1VSMA 5JXSA 2GUIA 2CGJA 2ZJQQ 4DV2J 2F4VJ 1KVCA 1S22A 4B9UA 3PIPL 3CQXA 2XO6A 3L3UA 1FJGJ 2DPNA 3SAFA 4CGDA 4JKEA 3N4PA 1HR0F 3CDWA 5CR4A 1HNWF 2IBKA 3VF6A 4OZ2A 4GV9A 3VTHA 5I3UA 4L75A 1LK5A 1QAIA 5F0UA 5AQLA 2W9CA 1ITGA 4DV3K 1O0PA 3W65A 1KVJA 3I0SB 3TX8A 5D0EA 2IGIA 2O01C 5KFUA 4OX7A 3GPAA 4H5VA 4JK9A 3O80A 3DOKB 2E88A 2RHKA 2W6KA 4Z4FA 2HKEA 3D0PA 4B1XB 3GIJA 1E3MA 1RAJA 1L3VA 2YBVA 2C3PA 4IEIA 4BC2A 4L73A 2FJDB 4H0TB 3CPWM 3CD5A 2QC3A 2AX1A 3VR1A 5ETMA 4M3RA 4B3OB 5DG9A 5KT2A 4LREA 4YDXA 3L7UA 3KWGA 2D3O1 2ZJRL 4LF4F 3WBZA 2CNLB 4ID8A 2XHWA 4R8UA 1NM2A 2BJ3A 2C28A 2RHSB 3GG1A 3LDSA 3J80O 2BRKA 2DGTA 1APSA 1S6QA 4NZ7A 4Z7YA 2EC2A 3HZEA 3P31A 3OJSA 2JC1A 1BISA 4RJVA 4C7QA 3FSYA 3IP0A 3M8YA 2GFFA 4DV5K 2O8EB 2FD2A 4XDDA 4FW2A 4DQIA 1R8CA 4OJGA 1S4EA 3O44A 3NOGA 5KQDA 4OKJA 4GC7A 5ETRA 2V67A 2PZSA 1UAXA 2XEXA 2HBLA 2IRXA 3NLCA 3QSIA 4NPOA 5D6GA 3VAMA 4P9SA 1QTMA 1VYAA 4NA1A 1TV6B 3PYFA 2HS3A 5GAEI 4BG8A 3BEGB 5IT0A 4M5GA 5A76A 4KV8B 4YOEA 2D0PA 1WEZA 2H1YA 2XTJP 3I9ZA 3LOUA 2KG0A 1HPMA 1BL3A 1FT8A 1S72S 4FXWA 2KB2A 3R7SB 1F1BB 3I96A 2DNYA 4ATNA 3W63A 3J7A1 4LF4J 3IBCB 1N0UA 5C2GA 3S3NA 4AHSA 2X3GA 1RTDA 4C8LA 4OKEA 3KTQA 3JXUA 5FDLA 5D0HA 1U0SA 3KDNA 4U9RA 2D0OA 4BR5A 1P6TA 3G6YA 4JN4A 3MEGB 1TZ0A 3DLEA 1LWCA 1UA1A 1NO8A 1PSDA 1W2BR 2EFPA 1B64A 1HYZA 4KB0A 4YOTA 5KRTA 3PXGa 3GP9A 1RYRA 3VEYA 2HRYA 2F8SA 2LQBA 4CLUA 1V3ZA 1R0AA 2PSZA 1S1WB 4BR9A 1LFWA 2JLEA 2KL8A 1TMJA 4N41A 2UXBJ 4ZDNA 3TQ1A 2RSQA 4M63C 4KGZB 2J0WA 2RJZA 3AVMA 3QT7A 2BJ7A 2IA0A 2CPHA 2XLIA 2D0BA 2XSFA 1BHNA 1JLEA 4ILJA 3VQ4A 2HHXA 3W5YA 5EXWA 4EU0A 1EO1A 2DO4A 4G1IA 5H9FJ 4LD0A 2B51A 1HYVA 4LF9J 4C8MA 2DIVA 3ILJA 5LSRA 1X9WA 1BA1A 1EXQA 4IR9A 4DSJA 1WSVA 2MZQA 3O9QA 3QLHA 5KFWA 4DL6A 4A59A 4FJ9A 5DM6L 2YNFB 4NLGA 2M4MA 1F21A 4CJVA 3Q8QB 3NF7A 4H4KC 1D9FA 1Q7LB 4B3TF 2WBNA 1XIQA 1HD1A 1FDAA 2AEMA 3ZSXA 2GIFA 4MK9A 1RXOB 2QL5B 2GQ2A 4UQTA 4I2PB 4HI1A 4DKWA 2ASLA 4NB4A 1FTCA 5KFBA 1F6TA 3TR5A 2E2QA 3MAAB 3OT9A 1Y11A 1CXUA 3LO3A 3IFEA 5CYMB 4M63A 2R9LA 4PRFA 4LF7K 2HNYB 3HOSA 2G8UA 1A5VA 4Y0FA 1J9AA 4FKXA 5ETKA 3D1OA 4OLPA 3CQYA 5KFOA 4FOIA 1T3OA 3TR8A 3DGPA 1RHKB 1NSKL 4CI6A 2KXNB 3QRRA 4JI7K 1VK0A 3EY1A 4LH4A 1MWQA 3MEKA 1NPKA 1WC4A 1O51A 3AD8C 3FZ2A 2WBRA 4TQSA 5IWAK 3TAMA 3QNNA 3NGDA 4JI5F 4BS2A 2EPIA 2YTCA 2GJ2A 4F0HA 3MM9B 2IA6A 5JJBA 2DJWA 2JRSA 2XQCA 1RGIA 4PQAA 2P9NB 2IVOA 2W2PP 4CEEA 4IFEA 3W9HA 5F8GA 2V2QA 3D2FB 4JI0K 1JJ2M 5ETNA 2IDLA 9RUBA 4X62J 4LR9A 5DDRC 4IH6A 1CJKB 5IM0B 4JI8J 2Y1RI 1X5SA 1RKIA 2CQBA 4CT9A 2MQOA 4WE1B 3D2FA 3KHRA 4B3MK 3VVUA 1S7IA 4C0OC 2V9WA 3OBIA 3QFPA 3M6WA 3UPFA 5KG3A 2DY9A 1RA7A 3MDFA 1X4AA 2EHGA 3IG1B 2HWTA 3L0QA 3CFPA 3TA1A 4E3SA 2ZZMA 3OTEA 2CJBA 4QW8A 3VQ8A 1QE1B 3GE9A 2NRZA 3CJ4A 3FEZA 2XCPA 4DUZK 1VISA 1NB7A 1JNZB 3CCRS 4JD2B 3HHDA 4PXBA 1FI4A 1YG0A 2F1FA 3THWB 3CCVS 2RRBA 3WEEA 3V81B 4BRCA 3THYA 4YY3K 3TP2A 2ASPA 3NE6A 1RAFB 4DR4J 4M7YA 3H5UA 2W7PA 3V1RA 5HMXA 3A5LC 2O8FB 5K9FA 3CIMA 2E5LJ 4ZP7A 4ZVSB 3IM9A 5J2PA 2ZBIA 4KAIA 3VESA 2QFIA 4QWCA 5ETSA 4HACA 1URRA 3DRRA 5H9FK 3KNAA 4QYZJ 1NK6A 4C0BA 4LUBA 1OY8A 2V8DA 1NKBA 2MSSA 4R0JA 1EKEA 2CPDA 4CD1A 4PPDA 4NLCA 4WYBA 2FJVA 1WHWA 1YTAA 4PG7A 3N6MA 1D5AA 1C0TB 2BKOA 1Y3JA 5DM7L 4HUGA 3SK3A 3JAMO 4F4AA 1HKGA 1EKRA 1OSCA 5SUHA 4GVLA 4JI3K 4BC3A 4JI5K 4BRNA 4URQU 2ZE2A 2MZ1A 1R0BG 3KK7A 2XG8A 2DGOA 2WTFA 2E4LA 4XPCA 3TYTA 4NYZA 3VEXA 3TWHA 3BQ1A 4WFAL 4BRKA 3FBBA 3CPWR 4X66K 3HVWA 2XMTA 2FZCB 2UVWA 2ZM6K 4CECA 1RYSA 3MK6A 3TAFA 2ZH9A 4CTAA 2NLXA 1JLEB 1EB0A 1YBAA 2X7IA 2HVHA 3C3LA 2FY8A 1S5ZA 2XZDB 4CO5A 1HYSA 5AQUA 4OX8A 1IBCB 5LY3A 4BACA 1HNIB 2V2KA 2UUAJ 2YI1A 2QGFB 1XJWB 3FC9A 4X4TA 3THWA 3O3GA 4PA1A 3AO3A 3BZCA 2RDJA 2BQRA 1NJWA 1N33J 2UVUA 2GJFA 2RKIA 4FJGA 2K7JA 5L39A 3MM8A 3T1YF 3ASMA 4USTA 1J27A 3GONA 2HHVA 1EP4B 4CJFA 3D0IE 1KKHA 1HBMA 2FHMA 1H2TZ 1FNMA 3EN9A 3BGUA 2IM0A 1XMQJ 4ECWA 5AQHA 1UVLA 4JS5A 1YBTA 3OXFA 4IOAL 3VA0A 4B08A 4LRCA 3BSCA 2LU2A 4KH6A 2EXUA 4PHTX 1VBXA 4JI2J 1VRQC 1DQAA 1E4FT 4Q44A 4CJ7A 3OFFA 3MCAB 3BEXA 4UY85 1ZM9A 1D9AA 2ZITA 4J8FA 1K47A 4KR0B 3BSOA 2JZ5A 3TJ9A 3CCJN 4PWWA 2LXFA 2FC9A 3SAHA 3MR2A 1YIJN 2QA1A 4YORA 1BE4A 1FWKA 3BZKA 3IR7B 3ZYYX 5IC6B 2G8VA 3NVMA 1WJ9A 4DV7F 2LVWA 1HUXA 2R7TA 1FFWB 2AP1A 4UQGA 1BA0A 1XMOK 2C1EB 5KGWA 1N5SA 3PDNA 5HP1B 2BKPA 3HX9A 3CCQN 1LAVA 4YOXA 1KC8O 4IKAA 4UOGA 3T9NA 4FS1A 4C6AA 1ZBIA 1U2FA 2DNNA 1HBNA 4DR1F 1Q78A 1N34K 2DK2A 1SC1B 3SSQA 5AQSA 1KAZA 4LBHA 4CW7B 1QHAA 3MM6A 4NLTA 5AJ3J 2HHUA 4AFFA 2DXDA 2V4JB 4K4UA 2EG2A 2J76E 1F2HA 3BP8A 1ZBLA 2ATQA 3MEEA 1RT4B 4U8VA 4WQ4C 3MF5A 4QAGA 2VG6A 4CEDA 3PW2A 1OWXA 4KYZA 1Z26A 1RU2A 3JS6A 5AR0A 3RB6A 5KOXA 1UZHA 1ATRA 1RBTA 4Q7AA 4CBWA 3N0VA 3TA0A 4DQRA 4GV6A 1WI8A 4Y34A 1FJCA 4R0EA 5HN0A 4KT0C 3THXB 4Y2KA 1QDUB 4YB7A 5AZIB 2JWKA 1M90T 4LF5F 1T05A 4ELVA 3SFGA 3BBFA 1WEYA 2UU9K 1IM4A 3JTPA 4H4KA 1REVB 4CGHA 3K17A 2GGPB 5HROB 4LF2A 4X4SA 2DITA 3AOBA 2Z1HA 2P9IA 3S01A 1UEKA 2PGCA 4FVCA 1CJVB 4X2BA 3DU6A 2ILZA 1S6PA 3DXBA 4I7FB 3QZ7A 1OVYA 2DH8A 1A7GE 3I9V9 5FROA 4EGLA 2MHEA 2I1RA 2NXNA 4CEBA 4MFBA 1NJXA 2OPRA 2IDEA 2VHGA 1CULA 4OI2A 5BRDA 3LZIA 4X62K 1BQNA 5AT1B 4TN2A 5AXLA 5C2CA 3DLRA 3VTIA 1GTHA 1JK9B 2F9DA 2WC9A 1RHQB 2P9EA 1XNQK 1G1XA 3AVAA 1HQUA 3AO1A 3TJAA 2MZRA 1VLOA 2ASJA 5E0OA 1RAEB 2VD3A 3DLEB 2HS4A 1D09B 3H08A 3MUMP 2P9KA 1IKYA 3TSQA 1QQOA 4TSXA 4V19J 5DDPC 4KIAA 4QIEA 3M32B 5AQNA 3MMBA 3P4IA 3FFIB 4L3NA 3DXMB 4ZJQA 1SV5B 1KVAA 4WTYA 1C1BB 3NGSA 2RDDA 3C14B 1PYSB 1HRHA 4Q0BA 3ZTOA 2D3ZA 3ETMA 4FDFA 3W60A 4RNMA 5EX3A 1PYOB 2UXDK 4NI2B 2YX7A 2CJYB 3TRGA 2NSBA 2JL9A 5J1PA 3SMPA 3NMAA 1E6VB 2GW8A 3QJLA 4WKRA 2XY8A 3H3OB 3AY9A 3LH2S 3Q8YA 1VQ4S 3K0SA 4LQ9A 3M2RA 2RF2B 2LDIA 2CYYA 3VGVA 5L1JA 1KFSA 1NGIA 2D9OA 3G4SS 3LZJA 5HVFA 3R5BA 4DUZF 2PD1A 4OHYA 5AFUH 1HBMB 2R2RA 2KJWA 3K0JA 1RBLA 3H45C 3OBWA 3RMAA 2MHNA 3LL3A 4EHUA 5C42A 3DNCA 1EIYB 3EVMA 4WPAA 2Z2YB 1IKVB 5A2QO 3QERA 4DL3A 4HVZA 4RX6A 2R7SA 2FLLA 3D2WA 2IM1A 4CK3A 4CRJA 2P5OA 2PA8D 4J9LA 4B8CA 2V2ZA 5EWGA 1KLNA 4LT6A 1U8SA 4CFCA 1HBUA 4XIUA 1P27B 2XSJB 3BPDA 5AQXA 3N5BA 1S6OA 4IDKA 2CRLA 3HK2A 5LMNK 4OPJA 5ITHA 4DX7A 3HSJA 4NCAA 5HOOA 3NGIA 4KH4A 4QU6A 3WQTA 2IMOA 1EARA 3J81O 3NCIA 3NAIA 3BKUA 1SVDA 4X84A 2B6AB 1RBOB 4WFNQ 3FZBA 1Q86O 1XHXA 3DKDA 3EL2A 4ZIVA 4HDGA 3CD6N 1I94F 1BIUA 3C0BA 4RWWA 2PYJA 1S1TB 3ZX0A 3MXIA 4DFPA 3DLGB 5LSLA 4FPAA 5E33A 4YOWA 4DU1A 3OHAA 1VJQA 4WIIA 5K20B 2OANA 4ZP6A 3VAKA 4DL2A 2OPQA 4BC5A 1RCXB 2FC0A 1M90O 1U8WA 4ZMMA 1OPZA 1RT6B 5FPNA 4E8UA 2D1KA 2V52B 1U1PA 5HO4A 4JI4J 3L95X 1IR2A 1EQ0A 3V9UA 1S4FA 3ZNUA 1TKXA 3J81U 2PFUA 3GFZA 1V3SA 3UWTA 3CM5A 1F9HA 2UUTA 2D69A 5A8KB 3L2QA 2CUYA 2HLTA 2DH9A 2QKKA 3CJ3A 2AGPA 1HKAA 4NO7A 5AQJA 4OPKA 3O6WA 5KG6A 3AAPA 2VKRA 3KKSA 2RILA 3ET6B 3JAMU 4KQZA 2C42A 4B1YB 2IAJA 4U6PA 4ECTA 3QFHA 1P1LA 1S59A 5HJXA 4R5PB 3DHWC 3HT0A 5FLXU 3VPZA 1M5SA 4ZPVR 5GMKa 1ZPWX 2YWHA 1YTUA 5C25A 2RU3A 1NAQA 2UXBF 4IOBA 1BGXT 3ZSYA 1HPZB 1ZTTA 2VODA 1U7LA 2KT5A 4DL7A 4K43A 3B54A 3CIPA 4RBUA 1UJ5A 1K0TA 3MEDA 1UCNA 1PKUA 1S97A 4PXCA 4Q43A 4BROA 1UFWA 4LF9F 4KFBA 3ZETB 1Q5YA 5F1XA 1UVJA 4LRFA 5KFVA 2KZZA 2B4UA 3TOQA 4JV5J 3DYAB 2P9SA 2HK2A 2HW3A 1ROFA 2GCFA 4DU3A 1DAXA 1RKJA 1NGGA 1UMJA 3VGKA 1KP6A 1U1KA 4ZPCA 1TK0A 4X66J 1VQ8S 3E1YA 3TZWA 1GOBA 4PWDA 1VC0A 2ZGYA 2YHXA 3ATVA 1OH6A 2XRIA 4WFXA 4HKQA 2MPUA 2RE2A 3AJ1A 4RTFD 2OIHA 4BC4A 4F3TA 2LECA 4WK3A 3LP0B 4CNZA 2HNYA 2GIRA 4TU9A 1NWKA 4ICLA 2MKKA 2JEGA 5D3GB 2M8DB 1VQON 2ZKUA 1S9GB 8RUCA 2A6MA 5LJ5Y 4AQYK 2BRLA 2MLYA 3X1LB 4BRAA 3IR5B 4XH1A 5DK5A 3MN7A 2VA2A 4JNEA 1GXLA 1B0TA 5E41A 4O3NA 2ZH5A 4IRDA 2Y8YA 2ITMA 3BO4A 2C2ZB 4CZKA 3V6DA 3H6EA 2E7XA 2MQPA 3GJQB 4CO2A 1KEKA 5IT9U 5GADP 1FE0A 4M3TA 3MM5A 2E5HA 2HBYB 4ECUA 2I9SA 3NF8A 2LMIA 3JSBA 1HWJA 4FJMA 3CYMA 5F3TA 1S1UA 1IN0A 3KK3A 2D7SA 4GMKA 4IRKA 4PR6A 1MWYA 5D4PA 4OLBA 2Q31A 3TZZA 3F2KA 2RB7A 4CZGA 3SSSA 1VC5A 3Q89A 4OPHA 4JYAK 5E84A 1BQMB 3GYGA 2L3MA 1GH8A 3BO2A 3GB0A 1FHTA 1XQIA 4DV6F 1FJEB 4JI8F 1CJUB 2GIQA 2F8EX 5DM7Q 5T41A 1PO6A 3QESA 2Y1LB 3AXKA 1BI4A 4OGEA 4PG6A 3DI6A 3I31A 2V8PA 2QFJA 4KH0B 5E2QA 1W7WA 2KQ2A 1KNZA 3ZSRA 4E1MA 4NA2A 8AT1B 4DS4A 3WX8A 3OFEA 4PKGA 3ULHA 1M1KO 1R0AB 4CO3A 4EWTA 2B4JA 4ILHA 1CS4A 4JRPA 4IEEA 3JSRA 3NRBA 4BREA 3BGLA 3KYLA 2DR9A 1U25A 4XPEA 2NUUG 2C2MB 3CDBA 3CO0P 1WHVA 2ZWPA 2ZJQL 2P9LB 2W2NP 2YH1A 1VQLS 2DNQA 1T05B 2CNNB 1WSGA 1W0HA 3DRXA 4L74A 3MEGA 3VAJA 3DLLL 2NS1B 1WUAA 4C1NK 4GY2B 1VQ5S 2G8KA 4JI7J 4Z4CA 4G1QA 2JVRA 2UXBK 4GRSA 4BRDA 2ZOMA 3J80U 2Y0SD 3KNGA 3F9KA 3MCPA 2PFFB 2KXFA 2H51B 1RAAB 1KQKA 2UUCJ 5HL7L 2HNDB 3TWZA 3ZZRA 1DTTA 2VGNA 4B3RF 1GQEA 3H5XA 2ZUGA 2XHBA 4CHYA 3ADAC 1LW0B 4ZVQB 4ED3A 2JEJA 3RB4A 2LEPA 2ERRA 3H8YA 1G4CA 2J7UA 1B70B 2HZCA 4LF6F 3QINA 5AQKA 4ECZA 3CPEA 1WTFA 4ICLB 2Z2LA 4YHHJ 3TTCA 4AHUA 2F8MA 4GO5X 2FJXA 3QBXA 4DUYK 3BN7A 3UVJB 1ATNA 5AQPA 3HDSA 1RABB 3ZSZA 2FJWA 2GNKA 4JI1F 1NGEA 5IWAF 5T7LB 3L7PA 5A2QU 3MCSA 2X1BA 4OV6A 3TARA 2VB6A 2D74B 2ZWOA 1S6QB 2GVZB 3QGPA 2DGUA 3QSYB 1EWRA 4W5QA 1SL1A 4ED5A 1DTTB 1IUJA 1JB0C 2A42A 2LDYA 3H7HB 2DO0A 1U4BA 2ZFHA 3AQPA 2ZH6A 2IC3B 1UWAA 1JL1A 2V7YA 1NM1A 4AXJA 1IKXB 3CW2C 3E3XA 5E3PA 1U2VB 3I5AA 4L3KA 1N32F 3QB0A 1TL7A 4EHTA 2NPIA 1H2VZ 1TUGB 4AH9A 4JI7F 2KYZA 2EBEA 3RRHA 3L4QA 1Q7YT 3OR2B 2JGUA 4DV0J 3MXJA 4ZVGA 2VG5A 4NLQA 3HFKA 2DNLA 1I51B 1NHVA 4W5TA 2Z58B 2P9LA 2ZQBA 1QUPA 1LNQA 5B09A 1NU0A 3GR1A 4BGBA 1K8AO 4D3GA 1AZSB 5A8RB 3D2EB 5JVGL 1B9DA 3WDOA 3O9TA 4JI1K 3NGUA 4CZJA 3WX4A 1TVRB 5AQRA 1PAEX 3UD3P 3T5KA 2ZHAA 4N56A 3EO3A 1N5YA 2XMWA 4DLEA 3EPIA 3O3LA 1YSJA 2R4FA 1BI4B 1TU0B 2PMHA 3OFGA 1FRJA 3K58A 3QO9A 1KCFA 3A5OC 1CJTA 2Q66A 4RWXA 3TEHB 5ETTA 1RT6A 2ZUAA 3NNHA 4OJ1A 3KFWX 2Z1GA 1TFYA 2R7WA 1M5KC 3ZZTA 4H0YB 4X62F 4A8KA 1UW9A 1C1AA 1RWXB 1DY3A 4DSKA 3DJCA 5LL6d 4OVLA 4DN9A 4WFYA 1DTQB 4DZDA 3UE5A 3HPHA 3ZTRA 2WRMA 5AJ3F 2ZE2B 3MDQA 3HHLA 2V34A 4JB8B 4DV1F 3QJJA 4N47A 3U3GA 3JYTA 2MYFA 3W2VA 4CFAA 4AL6A 3MR3A 1U45A 2W2MP 1XI1A 2HBMA 2IYGA 1HQEB 4MTPA 4MJKA 1ITPA 2VWBA 3FZKA 1YIJS 3UDCA 3ULDA 4F4YA 1E6YB 4H4MA 3CD0A 2FJAB 2HFOA 1KC8T 2M3DA 2J0QD 2ZEJA 2NPFA 4TY8A 1WSHA 3L4IA 3X3UA 4CF9A 2GMJA 4FBUA 3KK1A 1WORA 5MAOA 4OGCA 5AQVA 1WB9A 2XS2A 2GEMA 4NRUA 1HJRA 1TKDA 4CIEA 2ZZNA 5F9NA 2P5GA 4FWKA 2E6LA 1UKUA 4FZZA 1VQYA 2VBZA 2BE2A 2YKMB 4WFNL 1IKVA 3W1YC 1NH7A 2HBKA 4TNOA 2LEBA 1WC5A 4DEZA 2NYHA 5D15A 3MTJA 3AO5A 2PI5A 3CJ8A 3GDQA 1KHWA 5LT5A 3GZ7A 4A2BA 4NA3A 3U02A 4I9LA 4UOCA 2XGPA 3K8VA 1VK8A 1MA9B 1YAGA 2P1JA 5F8JA 3R1HA 4HUFA 2KRBA 4CJSA 5HLFA 2MZTA 2GAHC 3VQDA 1RUSA 2YKNA 4LMZA 2OAUA 3NGKA 4V19X 1T9WA 3G6EN 1VSJA 2FPHX 2Q0RA 4EYIB 3A8IA 4JKGB 1MSWD 1JLBA 3T19A 2BABA 2F5GA 4FNHA 2YPYA 5J2QB 1Q9YA 4I56A 1T6CA 3R5GA 3UN3A 2IVPA 3KLIA 3VQBA 3TABA 2BJEA 2KT2A 4B8AB 1RI7A 3W62A 2P9UA 3C95A 3O9RA 3G6XA 1IM6A 2HVZA 2CH5A 3NS7B 5D4NA 3ZEUB 1OH7A 2HMIB 3Q0AA 4LF6J 2PA3A 3A8KA 3E9LA 3MZIA 4LFCF 1TL3A 3NWRA 3IM8A 4IOCL 5A8KA 2CPIA 4NMXA 2QEXN 3PEJA 4CFBA 3PM9A 4M5MA 4J91A 2D9PA 3GV5B 3HKZD 4CJTA 1VQLN 2O67A 4HHJA 3S9HA 4ECVA 3DMJB 4B9NA 1FRXA 2CJQA 4JK8A 1Y7PA 2H9ZA 1JQGA 3NGYA 4JKHA 3QMLA 3IR6B 1V6HA 4IQXA 4K0KK 3JSYA 3POTB 4XDCA 1JMTA 4BC9A 1SKUB 3FEXB 2P2CB 1VQ8N 4FWMA 4FJHA 2ZZTA 2ZDOA 4C0HA 1VSLA 2X6NA 4PKIA 3BKTA 4DOZA 4CJRA 2NYIA 2G4BA 5EOYA 1SZ2A 3HHNB 1EQMA 4JBCA 2JC0A 2CFXA 4J9KA 2GGPA 1VCTA 3WQUA 3CJ9A 4ID5B 4DUYJ 1Y00A 4F36A 1VHIA 3NF9A 1YRTA 2QW9A 4RUAA 1N33K 3VAHA 4GKJF 5FRNA 4FWRA 3SDEA 2O4IA 1HD0A 4OZNA 1R89A 4NLPA 3B8AX 3SUOA 3HVTA 4FXVA 5K8PA 1FESA 2QLXA 4EO8A 4FJ8A 1Q81T 3MR7A 1AYEA 2JFDA 2ZD1B 2LU1A 1VQPS 3MUTP 4JI5J 2GHWA 1B0PA 3SIPB 1NK7A 4UZCA 3CEDA 1T9YA 3Q8PB 3I5CA 2ZM6J 5LL6Z 2H5EA 5KFJA 4FBTA 4LQ3A 1N5QA 2LQ9A 2HFZA 1HBNB 5L38A 4PEOA 4RO0A 2MMYA 4J90A 3TTFA 3M2VA 4DMNA 3NH2A 3GIKA 2OGUA 2E1MC 3GJSB 4KO0A 3EE3A 2C3YA 1RCOB 5D0RA 1CG2A 3O08A 5D4LA 2A2CA 3D9BA 1W2IA 4HL9A 3OV7A 4DG1A 1S0OA 5GAHU 4JV5K 4DV3F 2MKIA 4O0JA 3R2DJ 1RWVB 5D8HB 1UFLA 5E3QA 1BWVA 2XS7A 1RZMA 1JKHB 3KJQB 4IFYA 5B0AA 3SPYA 2YJFA 2Y1JA 4YOYA 1VIOA 2OEMA 3KLFB 1OIAA 4J9PA 2UXCJ 4KC5A 4P72A 5AXMA 3Q7BA 4DU8A 3ETOA 1RTIB 2DGVA 1RBVA 4ED6A 2O3DA 3THTA 4WYWA 1VQMN 3EJMA 3DXMA 1OSDA 4IZ9A 3MMBB 5KFKA 1TV6A 4DX5A 4FJJA 3PFEA 1YJNN 1V5VA 1KONA 2MGZA 3BJYA 1T02A 3F5TA 4RW4A 2Q36A 1QAJA 4MKBA 1VQ5N 2MJNA 3K9JA 3QEXA 4N7TA 3OXGA 3SCJE 2CQ1A 1FJ7A 3AFGA 1RT2B 1RDDA 5HI7A 3TVZA 4CJQA 1I1GA 2HURA 4KO0B 3HD2A 4ZVPB 1WD6A 3M2VB 2VKZG 3GSIA 3IWXA 3R5AA 2VFSA 1H0HB 5G4DA 1YITN 4NYOA 4PCQA 1W26A 4IO8A 1JCFA 3UKUB 2QWOA 2NCKL 1QUVA 1TAQA 1FKOB 2ZOGA 2KW4A 2LKZA 3H25A 2B8PA 3PVXA 4OHZA 3JTNA 1RJJA 1FRHA 3SQ0A 2P6SA 1HMVB 1DQ9A 1IV0A 3CJ0A 3EVWA 1LAWA 1D3WA 4CCHA 4B3SK 4C1NI 5D0GA 2Q3SA 4I7FA 1LEOA 3FK4A 2ZH2A 1JLGB 2VG7B 1TELA 1HNXK 4LFAJ 4M7XA 1LWFA 4C11A 4QZVB 4H4OA 1IG8A 3E01A 2ZDPA 2DGXA 4JI1J 3AGKA 2D3OR 1VLYA 4ENOA 2I5JA 1FRLA 5HATA 2GELA 2UV8G 1TUYA 1DEJA 4CIFA 2KYXA 4CT8A 2DD8S 2HZAA 4JI0F 4BHQA 1QVGR 1CQMA 3EWGA 1ZM3A 2J0XA 4K4XA 3QFWA 1NXIA 4URSA 5AQMA 3MWPA 1VMBA 3CO9A 3H0PA 1UW4A 1ZOTA 5KFSA 3HTVA 3OTOF 4NLRA 4BE1A 2XS5A 2JLFA 3DXKA 2YNGA 3CJ5A 4U8YA 3UW1A 2VJUA 3H42A 5ELZA 3K5NA 3FLCO 2AEFA 4ZPBA 4JAXA 4OYMA 3CULA 4WFAQ 2X78A 1D8ZA 1K73O 3MOZA 3W2WB 1RWWB 3SQOP 2V4RA 2OEKA 3AA2A 2JX2A 3T69A 2QWRA 4ZPWR 3IA0A 2B9XA 2FHOB 3BR9A 2O8DA 1QSYA 3L2RA 2CZ4A 1ZZFA 3L6QA 1B4SA 3BM7A 2G0IA 4AHVA 1B9FA 4P7VA 4EK2A 3J7ZO 2FSNA 4CLZA 4LBPA 1LV5A 1RAGB 3GG0A 5AJ3K 3MMAA 3OY9A 4DR7F 3QFUA 1LOUA 4AQYF 1YBUA 2CKWA 2DR6A 4C8OA 2G13A 3PJ9A 2RS2A 4FM1A 2ZWHA 2NQPA 5GINA 3U3YA 3L2WA 1K6YA 1T6DA 1NJIO 1NMEB 1FWLA 1H7WA 2XULA 1S9EB 3DAWA 2XMUA 4A8MP 3F9MA 2MLZA 1RWOB 4PQUA 1X31C 1D8YA 3AO4A 2HQGA 5GMDA 1C1CA 1FK9B 4OZJA 4W5RA 1S49A 2X51A 3LP1B 1R43A 1FA0A 3BY5A 4ED7A 4DV0K 3EKUA 1WNEA 4FJKA 3FDSA 4O4RA 3MM8B 2MQNA 2FBXA 1BUXA 3KUGA 3A5MC 5HBMB 1IKWA 1X4FA 1JLQB 1CJUA 1Q8BA 1U0HB 1Q16B 3D7SB 4DR7K 4GVMA 5AXKA 1S9FA 3FE1A 5JICA 3HM8A 3RB3A 3U1MA 4ZVRB 1XWLA 3AVCA 3ZC4A 4A8SA 5D77A 5F8MA 5KT5A 1VQSA 1BO5O 1S57A 2QIFA 2VBWA 3PNIA 2SXLA 5JMVA 1I94J 2PEHA 4M5DA 4LJMA 3VQ5A 1QD1A 4K4YA 4RUHA 4NLVA 1FD8A 4Z4HA 3V9WA 3CJ2A 1PILA 5TKWA 3HPOA 1X0FA 5DO2A 3QDKA 3DOMB 4BE0A 1OQ6A 5M2UA 3OS1A 4H0OA 5IT9Y 4QPTA 4E1NA 2R8JA 3Q8UA 1AROP 4JI2F 3C6HA 3G71N 3PUFA 3GE1A 3VENA 2KXHA 2X3DA 3A12A 4W4MA 2KTQA 5CHCB 2BBEA 2G8FA 2D0AA 3EX7B 1FKPB 2DCLA 4GKKF 1XK8A 2KN4A 1TR0A 4JK7A 2MLXA 5BYSA 5H9EK 1WG1A 4QR0A 2R7QA 4FLUA 2M8HA 4KRFA 4ED0A 1BC6A 1CC7A 3AD9C 2VQFJ 2G0JA 2FBTA 4I67A 1NJYA 3V6KA 5J2PB 1NSPA 1HI1A 4O3OA 4CJ5A 4J9VA 4O5FA 2N3OA 4HTLA 3D1HA 4FLYA 2UUAF 2Q79A 2K1RB 1HL6A 2AIRB 4GMJB 1YRUA 2P9CA 3CCTA 3LP1A 1IH7A 3DOMA 2A5XA 4CBXA 1JXBA 2UXDF 3BF4A 2AJ4A 4KFBB 1C0UB 1ZZNA 1T7PA 2MZSA 4WF9Q 2FSKA 1UL3A 5BRHA 4Q2MA 2KJVA 1O5JA 4NXMF 3U6FA 2ZBRA 3RVCA 3BGRB 1WAJA 4J2EA 2Q0UA 4LBIA 4DV6K 3KLGA 1OJ4A 4ED2A 3OXLA 3IRXA 3S3OA 1KQFB 1N4LA 5GIPA 3CJ7A 1WC1A 2V6AA 3QAUA 3BS9A 3LPEA 1U2VA 5LMNF 2FDNA 5GAGU 2M9KA 3DRPB 4J7CA 4CZHA 1UWBB 4B9TA 2C2DA 1UFKA 1C0UA 4I68A 1QHTA 4AXIA 4O8KA 2NXEA 2DHAA 1OS5A 4BRIA 4OYZA 2HMPA 4FLTA 3W2WA 2MY8A 1FVQA 2K1RA 2ROPA 3SXLA 1N36K 2PMZD 4YUDA 2WCXA 4FZXC 5DJBA 2YHWA 1M1HA 2YQ1A 2F63A 3VAFA 2DNZA 4NYPA 2AHOB 3GYNA 4ZJOA 3HFVA 4YB5A 5EDWA 4KB7A 1X4DA 2WVEA 5BYQA 2WVCA 2EW9A 1RLDA 3FRYA 1O8BA 1GLJO 2JLGA 3LAMA 4AL7A 4ETXA 2QA4G 4ZLNA 3VCDA 4ES1A 3EKSA 2CIMA 3C7NB 2QLFB 3B6OA 5C5JA 5AQTA 4JI6J 2E44A 1ZBUA 2AGQA 1QS4A 2FIUA 1YJRA 2IBOA 3CJSA 3HZ6A 4NEYA 3ITHA 3VF2A 2UYTA 3DDNA 5HRNA 3WQPA 1JJHA 3NG8A 4CLWA 3M8WA 3G86A 2QWLA 4DPYA 4ZLJA 5SWMA 1P8GA 3ATUA 2V5HG 3SBTA 4TLQA 2FHKA 3QLHB 5KRSA 1S12A 1OY6A 5HSPA 4DUZJ 3DLKA 4OZ5A 1TL1A 3O4QA 4OJRA 2V8HA 2AU0A 4ECYA 2F8TA 5DZ7A 3R1LA 3QYYA 2BW7A 4I6MA 1TUVA 2GA7A 1QSSA 1S99A 3B6PA 3US5A 4WCEL 3O1WA 2R7UA 3MHYA 3MECB 3AODA 4DX6A 4KH5A 2DNGA 2DNMA 3PYGA 1SIZA 4OI0A 4BY9C 4AM6A 4IG0B 1VR6A 1OH5A 3LF0A 2QKBA 1NDLA 4FN5A 2AF6A 4K4WA 3IBWA 3MMJA 3PO5A 4H0XB 4L72B 2MJUA 2I5JB 2ZM6F 1GX5A 2VBYA 2EWHA 3MCMA 4CO1A 4M3ZA 4QQBA 3NCPA 3KJFB 3AD7C 2UXCF 4LF8K 4ANEA 2DPIA 4JV1A 5GAHP 3VALA 3UCGA 2V8GA 3PW0A 1PC4A 4FPBA 2A3ZA 4ZPDA 1QAXA 1RTIA 3MN9A 1NHUA 3KK3B 4B3SJ 3SQ4A 2BX6A 3ZCMA 1M5OC 2MQMA 2FLNA 4CH0S 2RRAA 3WXKA 4ILLA 1S0NA 3NEKA 1NEEA 1CZAN 2YX1A 4HCBA 2JHEA 3Q22A 1LW2B 1SKWA 4HT5A 3N9UC 1JLAA 5F8IA 3ZT4A 4W5OA 3Q83A 5M2PA 3M32A 4FSVA 1Q8LA 5J1EB 3BYRA 2G8WA 3OR1A 4ZJLA 3NVKA 3VHQA 4CO4A 4FVUA 2OYQA 1VQOS 2FC8A 4EP4A 1PYTA 3LM9A 2ZH1A 4NZ6A 3RU0A 3KUHA 3QEPA 5T7BA 4OJHA 4DB3A 2C2NA 2XCAA 1X4CA 4DWIA 1VQNS 2E7WA 4P52A 4WBFA 3I5BA 1SCJB 1DZ5A 4YNQA 1RFQA 2YNGB 3VVTA 3I0RB 1FXDA 4QS9A 4CGFA 3SZ2A 3KG0A 3ZSWA 3KG1A 3A3NB 4F04B 5KFLA 2YNHA 2MB0B 4WU3A 2WFBA 5M1KA 1Q82O 4CJWA 3GFXA 5D78A 2HQCA 4FLXA 3C6UB 3ENWA 2CWKA 1KS2A 2HQ3A 1U1RA 1SH0A 2EG1A 5BJRA 1WSRA 4H5WA 3ZETA 4ZHRB 2KFNA 3CFOA 3ULEB 5BPLA 2HFSA 3A5NC 4EP5A 3HM9A 3KVGA 1HWLA 4F2SA 5HROA 4AYBD 3M9OB 2XMJA 3ZLJA 3D3CJ 2GO8A 3GFYA 1WN7A 2HIQA 3H2UB 4J9QA 4CIOA 4DQPA 4UZBA 2LQJA 1X5OA 2NRXA 4EFHA 2GX8A 1G3OA 2QJ3A 1DFDA 1S48A 3HO1A 3V9XA 4GVBB 2ZHOA 2HBQB 4NWBA 2VQFF 3IRWP 5DDQC 3U4LA 1ZM4A 3HCXA 4DR6K 1WBBA 2UUAK 5IC4B 4ILGB 2W6LA 5KI6A 3SSRA 4YR3A 5A0YB 3O3FA 4DF4A 1VQ7N 5GADI 3T1YK 3AA9A 1DRZA 3KKFA 1N5TA 1UAWA 4PL8A 3GSDA 1GMWD 1ZH5A 3AQOA 4NLYA 5BREA 2NLWA 3LGNA 3CQ8A 4ZTFA 4HCCA 1ZS6A 4CJPA 3HJVA 5BR8J 4FJXA 4DTUA 4CERA 1IWGA 1TKXB 3EZWA 3AA4A 4LF1A 4Y2CA 2FBYA 1EQYA 4X4VA 3V4IA 3TSUA 5J2NA 2QTWA 1Z05A 3FCHA 3KZBA 3LP3A 4PL7A 2DVIA 1RDAA 2CQ4A 4KB1A 3CD7A 1SBRA 2YQ0A 3DLGA 1JX4A 2HGMA 3HP6A 4LF7J 1MWKA 1EX8A 5JVHL 3CCSS 4CHNA 2OEJA 2L9DA 3HL8A 1LQ9A 4PPZA 3AOCA 1HQ2A 4Y3CA 4DS5A 4H54A 4PKHA 3D5MA 3KXDA 4JI4F 2V69A 4BRPA 4ECXA 1XR7A 1YLXA 1FFGB 5BN8A 1ELOA 1MNEA 4OPAA 4YQWA 3VQSA 2HK3A 3T41A 1N6QB 3G8SA 3CCES 1VHXA 1NSAA 3S3MA 1JKHA 3OL8A 3CJBA 4ZVOB 1BCMA 4CHQA 4K0KF 3VQTA 1QAYA 2L41A 5H1SQ 1VRUB 3PRBA 3P38A 3M6VA 2ZH4A 4IOXA 3WUHA 1T9TA 4PZVA 2UVRA 3PX4A 2B4VA 2KRRA 3H5SA 5AFUA 4FJ5A 4OV1A 4ZKAA 3AVGA 2AYMA 2HVIA 1VSHA 5A0YA 3CJQA 3UB5A 3IGNA 3HPGA 4OI4A 3R9LA 3RRKA 3M1VA 1XC3A 4C98A 3J80Y 4K4ZA 2BOPA 3NS6A 2AQ4A 2Y1IA 2EWSA 4GVBA 1IQZA 1YVNA 3MR5A 4OMFG 6FD1A 1YZ7A 2YCHA 5F41A 4JKGA 3B8HA 1OYDA 3UQSA 3WT0A 1X4EA 3MPDA 1KOHA 3F41A 4PXDA 1N52B 1RDCA 1H6KX 4F3OA 3G6ES 1T44A 4LF5K 3KK1B 4YB1P 1FRKA 2GMHA 2B5JA 1YJ7A 1KAXA 3O5TB 1JXEA 3LAKA 3PW7A 1BG3A 2W7OA 4M1KA 3CE8A 1PC5A 3MAHA 2J8SA 4V1Ak 4LFCK 4WQ4A 1RSCA 4ZHRA 2RF2A 1KAYA 4LFBF 4CZLA 1SC3B 2OH2A 1FRIA 2GMLA 1IBMJ 3MX2A 3VGTA 3HSDA 3GFHA 4NE9C 3UIQA 4Z7CA 4CJEA 4ZIWA 1YK9A 4GVEA 4M5KA 4ERDA 2VL1A 5KFHA 1BQXA 1ZPVA 4BWJA 1C0TA 2M70A 3HHLB 2VCPA 2BE2B 4LF7F 1W7AA 3R8YA 1KHVA 4CE9A 5GAGP 3G82B 2ASOA 3D68A 3CCLN 1RWPB 4I6AA 4IOCQ 4M3UA 1OVQA 4FWOA 5EVZA 3LWMA 1IQTA 3LPTA 4F67A 4R25A 2D0CA 3W64A 3CERA 2COLA 1VS3A 3RBDA 4KE5A 3MX5A 3DMJA 3UKRB 2XWXA 3HP9A 1MROB 2C3OA 3NKYA 4Q45A 1VSIA 2IDOA 5LMUF 2DT9A 4RR5A 4RCHA 3CC4S 2NRRA 1WHYA 2BUPA 4H4MB 1KLMB 3AAQA 3CMES 2HHHF 2C2EA 1ZTWA 1H74A 3T6BA 1TL3B 1EHWA 2PE8A 4HTUA 1AZSA 5A8RA 3ALYA 3D2EA 4MFBB 3U1NA 4ELTA 5C24A 5DLFA 3C66A 2JDJA 3BQ2A 4LFBJ 3QPIA 3E2EA 3ZEUA 2HRUA 1G7CB 3M05A 4WFBQ 4HHTA 2CPEA 3H20A 1S6PB 2I0XA 4OIXA 4J37A 3DCAA 4FL9A 2K8GA 2CPZA 4HHHA 4JRQA 4BLGA 2WUSA 3WXJA 4ANDA 3TPQA 4LF9K 5J1NA 5F8NA 4JKDA 2NUBA 1RTHA 3M30A 4F50A 2HFUA 2V51B 5IM0A 4QIGA 5B8HA 2R7OA 1ZAXA 1B3TA 4UT4A 4BRGA 3D6HB 5ADXH 4RG8A 4UUWA 3RW6A 5CH7B 5AE3A 1Y10A 5DDOC 5HAOA 1I5OB 1GMWA 4ER8A 2HS0A 4TVAB 2YPZA 1DJ0A 2YWEA 3IGVA 4K2JA 3CIZA 1NKCA 2HYIB 4PYAA 4CEFA 1VC6A 1ZAVA 2QMWA 3LALA 4EYHB 1WLJA 5CCLA 1WSJA 2VC1A 2CVEA 1VFJA 1R59O 4USUA 3AB2B 4CZCA 1HIYA 2P8IA 2U2FA 2P5VA 3TUPA 3L4BC 5C2FA 2H4WB 3SCXA 2R2SA 4H03B 1U6FA 3G96A 4N8OA 4NXNK 4LFCJ 1XUPO 1ATSA 5B0CA 2XBPA 3BREA 2ADBA 4C2MA 3AXMA 4CF8A 2A1SA 4P73A 3ZFVA 1TL7B 2R8HA 2HHHJ 4WWSA 3BGFA 4RLEA 3THVA 4KBOA 1BLUA 2A18A 3ITHB 3J81Y 4K8ZA 4WF9L 2IC3A 3KHYA 4CLFA 1SUQB 2AJ1A 2OTJN 4DV7J 2O8BB 3C16A 4N8NA 4DV2K 2F4VK 1Y4ZB 3ULEA 3EICA 3CETA 1F2GA 3KG4A 2GVZA 1NH8A 5HVGA 4A8QA 3GIIA 1E6YA 3KD1E 2ZKTA 2AJFE 3IWLA 4USVA 2HQDA 4QYRA 5LMUK 2KKHA 3KK2A 3GG4A 4G1QB 4CHZA 1RHJB 1XN9A 1P9YA 3W5ZA 4CH7A 4GW6A 3A2FA 1XTZA 4OQJA 2CQHA 3PACA 1YQHA 4M45A 2DGWA 2UXCK 4X64K 4PKDB 3A3OB 2ALZA 3M8ZA 4FK0A 1SKRA 2FF6A 1A5WA 3BBCA 2MZJA 4M3XA 2A1BA 5JVHQ 4X4NA 4U95A 4AF1A 3VF0B 3BSNA 1JWWA 4YR2A 2DPJA 4RZRA 1Y9OA 1S1XA 2FB0A 4DSEA 2HGNA 4CDIA 2VQEJ 1CXQA 1TL4A 2W40A 1VK3A 2I8EA 1EKSA 4NLOA 4CF0A 2GUPA 3OVAA 3S1TA 3BZQA 4DUTA 5FPDA 2Q97A 4H5RA 3MM7A 4DV4J 3L2VA 2QXLA 2HNDA 1U1NA 1GMUA 1XBWA 1YWXA 1WG4A 1GK8A 4B1ZA 3I4PA 2W1BA 4YY3J 3TI0A 1YF5L 3IC1A 4KHPF 4C97A 3UDEA 3TZYA 1HA1A 4AQYJ 3UDVA 1C4CA 1FKAF 3HJFA 3OYJA 1MU2B 4A48A 4DQ8A 4DR7J 1WKLA 5M1OA 4MYTA 1NDPA 3K5MA 4F26A 2V9KA 1HYSB 1GFWB 2DNPA 4TYAA 3D0GE 4IJNA 3OYKA 4QWDA 4RNOA 4CTAB 2M2BA 3BGRA 4A57A 1QY7A 4CESA 2XMAA 1K73T 5E3AA 4F3MA 2YH0A 4P71A 2GO9A 2OKQA 4PG5A 2VOOA 4MO4A 3D0HE 3FQLA 5KFFA 3DLHA 2J6TA 2E2PA 4I1TA 3JQJA 2BOAA 3ZSQA 5IT4A 4KAZA 4Y0WA 4KRWA 4ILMA 1S0VA 2VONA 4FK4A 1W9HA 1Q8IA 4YP3A 2XZTB 4NLDA 3KMSA 4FW1A 2KI2A 2JEIA 1NK9A 1GLLO 4JV5F 3LUYA 1ICEB 2NREA 3T6JA 2HVEA 4JP8A 5DETA 2HNZB 3ZX3A 2HFNA 3S8SA 3OL6A 2AYGA 4ZVFA 1NJIT 2UU9J 3HZGA 4FF3A 2A40A 2EK6A 3C65A 3FJ2A 5HL7Q 3RUBL 2CPYA 1FJGF 4YHHF 3O8WA 2RPIA 4KJIA 4OX9F 5L9NA 3JB9k 2HLUA 2JVOA 2H4YB 3UCZP 1RDUA 3THYB 3ISZA 1S6UA 4DR5F 4DMZA 4F2RA 4O0NA 4DR5K 2XNRA 1Q4RA 1YJVA 2HAIA 1X9JA 3CT9A 3SI6A 2DXEA 2BA9A 4Y6IA 3MEDB 4M8LA 2CQ0A 3C16B 3T7ZA 1AA1B 4C3MA 3FSXA 3MOJB 5ETPA 1N48A 4I9QA 5M1PA 2OZSA 3BSAA 1U6ZA 2FYXA 4B3OA 2IJFA 4KPCA 4CF1A 2ZNZA 3FUYA 2XNQA 5D3GA 2RU9A 5C25B 1Y3KA 1P90A 3AA8A 1KD1O 1JLFB 3KLGB 4WE1A 4CK2A 5CY4A 1P1TA 4QOZB 4RUBA 4Y00A 3IAYA 4R5PA 4DR2K 4G1PA 3UR3C 1XMOJ 3HRGA 2M0GB 5F2RA 3DOKA 4O3QA 1WF1A 2F7VA 1JLQA 3CCSN 3M5RA 2QTDA 1TYQA 3KJVA 4PWDB 3GQCA 1AUDA 4F02A 1JJCB 1A9NB 3ZZZA 3CD6S 2B43A 3MM9A 1J5EF 2DR8A 1NGCA 3PR4A 2LSNA 1RISA 2DRDA 3DYAA 2P9SB 3ZT2A 4E7IA 1FK9A 2B0GA 1D1UA 3TAMB 5JS2A 1OKJA 2LXIA 3DU5A 1C0FA 4O8UA 3OYNA 2VICA 4HUEA 1VOMA 1DLOA 4PQUB 2YKPA 2GJIA 3DRPA 4M5IA 2LA6A 2MDAA 2FZKB 1N36J 2XB2D 1VDHA 2RDIA 2N7YA 4M5LA 4FYDA 4ETZA 3LDLA 2ZC3A 3TQEA 3OW2M 4JV2A 4AUKA 2GWKA 3FZHA 3CCMS 1UVNA 4DV4K 2FJEB 3G71S 5L8RC 3R6LB 4C9DA 4OYAA 2OO4A 4PAAA 2OP5A 5E3RA 2VWKA 3K57A 1SC4B 1HW9A 1ZXOA 3TZXA 1UETA 4Z4IA 3E66A 3RR7A 3IMQJ 1M1KT 3CXCM 2JWLA 5DMRA 4P74A 3EZ5A 3ZTPA 4FYYB 4BCAA 3V6DB 1SQGA 5AQGA 2K2PA 5KFRA 1GLDG 5BXIA 4QWEA 4CFDA 3AO2A 2CQIA 3IWNC 2ITGA 1MROA 1J54A 4M5DB 2KVIA 2CG4A 4NCGB 3M6UA 5FPEA 4FLVA 1SJRA 1CPZA 1WOOA 1KQSR 4NLUA 1L3UA 4MK7A 1SI9A 3OTOK 3VQ9A 4Y28C 2KM8B 4CJLA 1S9GA 1U1OA 4E98A 4V19S 3WNFA 1R8HA 1VBKA 5CYQA 4EZ9A 2DFFA 2DGSA 4EBCA 5DM6Q 1SJ4P 4X4UA 1LXNA 4KHWA 2DNKA 5ETLA 2ZBPA 4QIVA 2WAQD 4OHWA 3CNQP 5F3ZA 2PFDA 2V63A 3M8QB 4P6QA 2AZ1A 5CE3A 1F9FA 4K7QA 2BJ8A 1DHMA 3QMQA 2EKYA 4KGMA 4NOHA 4BQLA 3V5RA 4HH0A 2R42A 2AP6A 2O1PA 5KQ8A 3MMVA 2DTJA 4DI6A 1JLGA 2PEBA 1OMSA 1FF2A 5EY4A 3M8PA 4CGJA 1T11A 3MXMA 2G0CA 1YJWS 1SL0A 1UOCA 2VV5A 1J5OA 2RRNA 3W9IA 2DY1A 5BR8F 3D7EO 1IVZA 3VZIA 4QIWD 3IAM9 4IBNA 1FNOA 2E1ZA 2QYGA 3FFIA 2YKOA 2E6MA 2XI3A 4IYQA 3C2PA 4KHYA 3MMAB 1BU6O 3QT8A 3ZZ0A 4JI3F 4CLSA 3VQCA 3FRZA 4UY8T 3ELHA 2VFRA 3MM7B 2IRYA 4MDBA 2PBDA 2NRHA 3PTWA 4QR1A 4KY3A 1R6YA 1NPRA 4FWQA 3FKBA 1WDTA 3OL9A 4BR0A 4JKAA 3QJPA 4F8RA 4PXEA 5CABA 2UUBJ 3LPYA 4LF6K 3EUNA 1S1XB 4FF2A 1Q18A 5IV3A 1MMDA 2DTUA 1HBOA 1KOOA 3ZX2A 1L3TA 4DV1J 3LW5C 2QO3A 5CZ2A 1S72N 1S9EA 2HF4A 4OYIA 2ZOFA 1JCGA 2XY5A 1EJ7L 1WACA 1D0EA 2VPWB 3BR8A 4ISGA 2YHYA 4WXWA 3PG9A 3AARA 4W5NA 3JXOA 2Y0BB 3G8TA 1FXLA 2LEAA 2QE5A 3BO3A 3QBWA 4KI6A 5A2QY 1B0VA 2CDQA 3V2UC 4KPYA 1I39A 2QLBB 2NXUA 1QM9A 2Q1NA 2BW2A 1NMNA 1HNZJ 2ZNYA 2RH3A 4NZ0A 1M5VC 3E9PA 2H3GX 1VQKN 5L9XA 2FVSA 1FO1A 4IH5A 3CDAA 4AT1B 3P5BP 3QNWB 1UJ4A 3AVKA 4DL0C 3GV8B 4RL1A 2VQFK 1HQUB 5KT7A 5C10A 5AZIA 2DH7A 5L1IA 3NWGA 3V1QA 3Q2TC 1Y5IB 4FM2A 2W01A 2OTJS 1PIEA 2RNEA 4LFAK 4C11B 2EFVA 4CZIA 2QT7A 3KIOA 3UNYA 4ISFA 4CZFA 3AT1B 2U1AA 4Y2IA 2CZVC 2UU9F 2ASDA 3MEEB 1HMVA 3Q23A 1JXLA 2GV9A 4P2MA 2XYHB 3ZT3A 3KMQA 2XMVA 2R8KA 1YX2A 3TEGA 4R79A 3BH7B 5HMYA 2WW4A 2AD9A 1FKOA 1S10A 1XR5A 3IS9B 5M1FA 1FX2A 3OL7A 4K4TA 2LYVA 1SXLA 4X4OA 3SYZA 4P10A 4JYAF 1F5AA 3HD1A 4K4VA 3GOIA 2P9IB 2CQCA 2QL9B 2QX0A 5U47A 1N33F 4UOHA 2B7BB 3BBBA 3R6MA 1RT2A 3M7VA 1JXVA 3FEYB 1X3NA 3M30B 3NNCA 1TUUA 4U67Q 3R1XA 5K8OA 1NSQA 2VA3A 4CWBA 1URNA 4DSLA 2NR0A 4U7UD 3QWPA 4L8RB 4BG9A