4H4MA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
548
structure length
548
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 135
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4mA05
3H4DA 4F4KA 1JLQB 4C8NA 4RNNA 4ED0A 4FLZA 2IGIA 3L2QA 3AVHA 3T5LA 3WNEA 4EO8A 2GIRA 4HYKA 4B9VA 4ECUA 3DI6B 4IDKA 4RW8A 1LAWA 4ELVA 2IS3A 3UR0A 5J2MA 4AHSA 1HNVA 3NH1A 4M41A 3VQQA 5DQIA 1CXQA 2O5DA 4LSLA 3KIOA 2HB5A 1WNEA 5KGXA 2E6LA 2HNDA 2AGQA 4KB7A 3D0PA 3LP3A 5C24A 3KOAA 3LPUA 4B9LA 2RPIA 4FJNA 4CJSA 4IH7A 1VK0A 1IKWA 4KE5A 2G8IA 2Y1IA 4Q8EA 3SFGA 4M3TA 1NK9A 4MIBA 2B5JB 1KVAA 2V0NA 1K6YA 3RMAA 1JX4A 4K4TA 4Q45A 1OS5A 1FK9B 4O55A 2J6SA 1RT4A 3TANA 4Y2CA 4CJEA 4IFYB 4FLUA 3V1OA 3DYAB 4FW2A 3RB3A 5D3GA 3IS9B 4LH5A 4E7KA 1LV5A 1RDBA 1GOBA 3LWLA 4F50A 1RT2B 5FRMA 5C25A 3NKYA 3NF9A 1HPZB 4O3RA 1BIUA 1BCMA 1KLMB 3KHRA 3CJ2A 3CJ5A 5KFVA 3CYMA 5DLGA 2HHWA 4O5BA 1NOYA 4ELTA 2E9ZA 4IH6A 2IA6A 2B6AB 1BIZA 5HROA 4URQU 3N6NA 3P83D 3HJFA 4TQSA 3JYTA 3GIIA 4DL4A 1NNDA 1CLQA 4OKKA 4DSKA 4J2EA 3I0SA 4TSXA 3MECA 2W9CA 3RB6A 4CFCA 3T5JA 1C1BA 3ZT2A 4KV8B 1S1XB 4GW6A 4IOBA 1S9EB 3I5BA 1SV5B 3OYBA 3HVTB 3UPFA 5KG4A 1RTHB 2V4QA 3S3OA 4ZP7A 2YNHA 3KNAA 4ED2A 1D9FA 3DDKA 4OKEA 2GC8A 3RRGA 3L3UA 4OL8A 3RR7A 3OYFA 4QWBA 1LW2B 2BGGA 1ZYQA 1XR7A 2W42A 3SFUA 4WFZA 3U6FA 2ATLA 5EWGA 2W8KA 4O3PA 3QERA 3ZSWA 1REVB 1J53A 2XO7A 4J9NA 1B92A 1T8EA 1RT3A 4CGGA 2OPRB 4DS5A 3MEEA 1HMVB 2GBZA 4K4XA 4NYNA 4KHQA 3TAEA 3K2PA 2EC0A 4DEZA 3V81B 2F8SA 2ZD1B 4NYFA 4DTPA 4FM0A 3BR9A 4B3OA 3IRXA 5JS2A 3GV8B 1LWFB 2RF2B 5CYMA 4CJ3A 4DL7A 1UOCA 4QWEA 4FJXA 3HK2A 3KLGB 3DLGA 1X9WA 4YR2A 4RUAA 3DRRA 3VQSA 3HP9A 3I0RA 1L5UA 4DSFA 3OYMA 4Y34A 3WNFA 3NH2A 5DGBA 4TY8A 3MFIA 2X74A 1N5YA 4ZHRB 4M3WA 3NMAA 5KT2A 4CESA 4JLHA 3ICLA 5JXSA 5L9XA 4CIEA 4ED1A 4FJMA 4ECRA 4EYHB 2D3ZA 1CZBA 2C2EA 4ED8A 1A5WA 1TV6B 1BQNB 1VRUB 1BI4B 2ILYA 4EBEA 1QAIA 4Z4IA 1S1UB 5KRTA 2F8EX 4B8CA 1VSEA 4H4MA 4FJIA 2BE2B 2QE5A 3LWMA 4I2QA 1T05A 4KTWA 3ZSOA 1Z26A 1NJZA 4BWJA 4NLVA 3MR5A 4ECSA 3IGNA 4WE1A 4IKAA 5DQHA 5KFNA 4IDKB 4RW8B 3RRHA 1S6PA 3EPIA 1XI1A 2BQ3A 5DQGA 1TK0A 2FVSA 3TQ1A 5J2MB 3QEIA 4FLYA 4IR9A 5J2PA 4CJTA 4HVJA 1T94A 2D0AA 4FBUA 3TAPA 1NK4A 2HNDB 2GV9A 2R2RA 1J9AA 3EPGA 5C24B 3BGRB 3ZSXA 3L8BA 4DG1A 1X9SA 4KI4A 3FDSA 1KCFA 4ECYA 1WSHA 3AVCA 2IM2A 2FC0A 2KFZA 4CJ4A 1ZTTA 4LY7A 3VA3A 5HBMA 3V6JA 2R2UA 1MU2B 3KLFA 3OL9A 5FROA 4DU4A 4ZVFA 4RU9A 3MEDB 1C6VA 1S1TA 4F4WA 3S3NA 3C6TA 1SKRA 2KQ2A 5HRSA 4CEZA 4H54A 5C25B 3SZ2A 2P5OA 4DS4A 1NKBA 3RBDA 3ZSYA 2HNZA 1ZBLA 1VSDA 3OYIA 4MIAA 2YKNA 5KFGA 3NFAA 5HROB 4QPXA 2PY5A 4YMEA 1ZBFA 3MFHA 4EO6A 4AHUA 4FK4A 1XR5A 2IJNA 4JV0A 3TAMA 3QLHA 3MECB 3ISND 2W9CB 1RILA 1C1BB 1KTQA 2XI2A 1UWBA 4CK1A 5HP1B 4TXSA 4OGCA 4AILC 3AVKA 3QEXA 3OL6A 2Q3SA 2XCAA 2XGPA 1GX6A 2FLPA 3DRPB 2YNHB 3VQPA 1L3SA 3RMCA 1JKHB 2E6MA 2CJQA 3E01A 2QKBA 3DYAA 1QSLA 3WNGA 3D5MA 4IRCA 1WSGA 4MK8A 3DMJA 3ZT4A 1RT2A 1VSKA 1JLAB 3HP6A 3MXMA 2XWYA 1TAQA 3V6KA 3AVIA 2BR0A 1RA7A 3LZJA 2AGOA 3OYEA 1RT3B 3OS1A 3MEEB 4HUFA 4J9QA 3Q8SB 4RNMA 1EETA 4IQXA 4DFPA 3FFIB 4J9KA 3OHAA 1DTQA 1A5VA 3NF7A 4NLYA 2JEGA 4FBTA 1FXXA 1WAFA 3PV8A 4DLGA 4EP5A 4MK9A 1RNHA 4B3OB 2E9TA 4DF8A 4EZ9A 3IRXB 5KFPA 1WNSA 3NL0A 2D0CA 3GIJA 3MR3A 3NHGA 3HVTA 3RMDA 3G6XA 4IG0A 3DLGB 1K1SA 4EBDA 2UVUA 4DTRA 1N48A 3DRRB 3ZSVA 3I0RB 4W5RA 4NLSA 2FJWA 4TY8B 3AVGA 3DOKA 1N5YB 3P1GA 3QEWA 3ASMA 3BJYA 4I9LA 4ECXA 1IG9A 3VQCA 4NCAA 4K4WA 1T03B 4PA1A 4KHNA 4G3IA 2PYJA 2AGPA 5F8NA 1GOAA 3QZ8A 1BGXT 3CIZA 2D5RA 4WZQA 1MMLA 3HHKA 4Z4FA 2F96A 4J9RA 4J2BA 5HLFA 2G8UA 4KHMA 4H4MB 3CDWA 1B9FA 1NK8A 4I2QB 3GYNA 4CEAA 4J9PA 2P51A 2O4IA 4CHQA 4WE1B 4ZVEA 4KHRA 2G8WA 1NJXA 2UVWA 1S6PB 2ALZA 2BRKA 4DTJA 3V9SA 4E3SA 4MH8A 4CGIA 4LQ9A 3HSTB 4O3NA 1ZBUA 5J2PB 1JL1A 5JUMA 2X6NA 2XY7A 3UIQA 4W5QA 3AO3A 4CHZA 3MEGB 3H5XA 4ZHRA 1SKSA 2DPJA 4KB0A 4CGDA 4EBCA 4CEBA 1RDAA 4HUEA 3NE6A 2RDJA 3OLBA 3KKRA 1UA0A 1RYRA 4CJVA 1I6JA 1JLEA 3RBEA 4ED3A 3KD5E 5HBMB 1VRUA 3KJVA 4FVMA 3KLFB 4QW8A 4QCLA 2IC3A 4RW6A 3PW2A 2DTUA 1NJYA 3CO9A 1S1TB 2XY6A 4CJFA 1S1WA 3ZT3A 1QTMA 3EY1A 3C6TB 3HT3A 3QEPA 1U47A 2HWIA 4GC6A 4NCBA 1YT3A 5KGWA 3SCXA 5JS1A 1KSPA 4FXDA 1IKVA 4IRKA 2HNZB 4FJ7A 4Z4HA 3RMBA 2YKNB 3IN5A 3N6LA 2Y1JA 1RYSA 2ZE2A 3V9WA 3SPYA 1QSYA 3FRZA 5KT6A 3BGRA 3ISNC 4XO0A 1HYVA 1Z4UA 4EYIB 1IKXA 3PUFA 4L8RB 1IKYA 1HRHA 2HWHA 3HVWA 1RT6A 1L3TA 3TAMB 3QLHB 1IH7A 1SH0A 5KTQA 4C8LA 3NBPA 1UWBB 3PO5A 4KB1A 3K5LA 4O4GA 1EP4A 3KHLA 1MU2A 2IM0A 1RBTA 3F73A 1S97A 4TQRA 1QS4A 1NHUA 4DSJA 2Z1IA 3MEDA 3IG1A 2WOMB 3OYDA 3T19A 4K50A 3E01B 4EZ6A 3SQ4A 4ID1A 2R7YA 4C8OA 4G1QA 4FJJA 3DMJB 1EX4A 1SL2A 5F8GA 4KRFA 3KLEA 5KT4A 4DWIA 3BQ2A 5I42A 1WSEA 4YQWA 2YNGA 2FBXA 5HRNA 3D28A 3SUNA 4FJ5A 5KFIA 2FJXA 1TKTA 2OPSA 2FBTA 4WFXA 1EETB 1SUQA 3OL8A 4KAIA 2I1RA 3KKSA 2HHQA 1DTQB 1HYSA 2IM1A 1W0HA 2O4GA 4CGFA 3KK1A 1N56A 4WYWA 3SI6A 2IJFA 4K4VA 3H5YA 4JRQA 2PYLA 1SH2A 1WLJA 1NJWA 5HP1A 3AO1A 3VA0A 1J54A 4AHRA 5HRRA 4IG0B 3V6DA 2C28A 4R0EA 1CXUA 3DRPA 1JKHA 4HCCA 3FSIA 4BDYA 2YHBA 4M3UA 3CJ4A 2FVQA 3DOKB 3GIKA 1WSFA 2J6UA 3PR5B 2HHXA 3H5UA 4WXOA 1JLAA 3TR8A 2IDOA 3QIPB 1S9FA 4RG8A 3AO5A 4ZTJA 3TARA 3SYZA 3CFPA 2AX0A 4TYBA 1VSFA 4YP3A 3P5JA 4DL3A 1XWLA 2HAIA 5DGAA 4K8XA 3KMSA 3NGIA 3K5NA 3TVKA 5HLFB 2EX3A 1TKZA 3PR4A 3KTQA 2ASDA 3FFIA 2WK4A 2R2TA 3H40A 2OZSA 1BCOA 3NF6A 4CJPA 3QYYA 4M45A 2G8FA 4DL6A 1TKXB 2Z1JA 4DQSA 4PY5A 1IO2A 3NGYA 5KFHA 3NCIA 3AA4A 3O4NA 4KTQA 3N6MA 4E7IA 3KLVA 1ITGA 1RTJA 1JLBA 4DF4A 2BRLA 2GIQA 4FJLA 4W5TA 1S48A 4FJKA 4MFBA 5KFLA 3SQ1A 1GOCA 4TY9A 1T03A 1WSIA 1UA1A 4Q43A 1WN7A 4QOZB 2FLLA 3LALA 1Q9XA 1N4LA 2YKMA 1JLEB 3V9ZA 3ZCMA 3LP0B 4ZMMA 4O3SA 2ASJA 3KJVB 4EP4A 3HVAA 3DLBA 3SV3A 2Z1GA 2IC3B 4RW6B 3O3GA 2UVVA 3AVBA 3M8RA 1ZBHA 3IGVA 4FCYA 1FKOA 4RW9A 4CEDA 1S1WB 3FQLA 3OS2A 2DFFA 1N6QA 2P5GA 1JLFA 4CF0A 5J1EA 4XIUA 5DMRA 4XPEA 1RT7A 3DLKA 3DRSA 1IKVB 4PWDB 5F8JA 3CG7A 1TVRA 4FZYA 4ECVA 2XRIA 3VQ6A 3RAQA 1RBSA 2KFNA 3AO2A 3FQKA 2DY4A 4B9UA 3RAXA 5DG9A 4DFMA 2YNFA 2ZE2B 1RDRA 1JXBA 4IH5A 3OYKA 1JLGA 3SV4A 3AVAA 4JS5A 3MEGA 5DLFA 3PW0A 1QE1A 4CIFA 3BSAA 2ATQA 1S0OA 5EU7A 1IKXB 3HVRA 1IKYB 5EWFA 1C0MA 2F8TA 1RT6B 5EUHA 5T7BA 3PW7A 4IR1A 5T14A 4WXWA 3NGZA 3PJWA 4CFDA 3NGDA 3NBPB 1NK5A 4DU3A 4O4GB 1EP4B 3QESA 4FW1A 1TK5A 4Q44A 4ZPDA 1SKWA 1LAVA 3QINA 2B4JA 3V9UA 3THVA 3HO1A 1RA6A 3IG1B 4ZP6A 3PZPA 4N41A 1RBUA 5KI6A 2NUBA 3KMQA 2X78A 4G1QB 3PX4A 4R8UB 1VSLA 4HKQA 3G86A 5CZ2A 1JXEA 1VRTA 1S1VA 1O1WA 3KLEB 3LDSA 5I42B 4NLTA 4CJKA 2YNGB 3CM5A 4O3QA 2OA8A 3QGHA 4QWAA 1XHZA 4OPJA 2R8KA 2R8IA 1TKTB 5KG7A 3M9MB 4LQ3A 4I9QA 2OPSB 4QWCA 4K4ZA 3DM2A 4PQUA 2XY8A 1SUQB 1YVUA 3QIOA 1BQMA 1RBVA 1VSHA 1QQCA 1HYSB 4DTNA 3KK1B 3VQEA 3OVNA 1IM4A 4CHOA 2R8JA 2PZSA 3LP2A 1NK6A 4Q0BA 1VSIA 3NH0A 1ZETA 3C94A 3V6DB 2IAJA 3TABA 4ZP9A 1S9GA 2WOMA 2OPQA 4NRUA 4XPCA 3SJJA 3B6OA 2A1SA 4M94A 3EYZA 1EXQA 2WHOA 3ZSQA 3DLHA 2XCPA 4KHUA 1NHVA 4GMJB 3KK2A 1RDDA 4CF9A 4NRTA 5KFFA 5SWMA 5KG5A 3SQ0A 4U7CA 4NLRA 3G0ZA 1TL3B 2W7PA 2QXFA 2A1RA 3AVJA 5KG3A 4OLBA 4AHCA 4JUZA 1U4BA 1TKZB 4E7JA 4X2BA 5KFZA 3VQ9A 2WB4A 3MF5A 3M9OB 2ILZA 1HQUA 3GIMA 3A2FA 2R8GA 4N47A 4FM1A 1YTUA 3B6PA 3S3MA 3AV9A 1FKPB 3PX0A 4CJQA 4QW9A 1RTJB 2YNIA 4LSNA 4QWDA 1JLBB 3BQ1A 3KHHA 1S49A 1CZ9A 3L2RA 3CFOA 5K14A 3VQAA 3NAHA 3LP1A 3V4IA 4N56A 1QHTA 4DQRA 4F4XA 4FJGA 2W9AA 1BISA 3K5MA 2G8KA 2I5JA 4MFBB 3QZ7A 3HKWA 1TAUA 4ECZA 3QEVA 4KFBA 1C1AA 1RAJA 3QIPA 4FK2A 4JS4A 2ZKUA 1U04A 2R2SA 4CFAA 2YKMB 3NF8A 3OSPA 4E1NA 3M8QB 1L3VA 2YV0X 4DFJA 3RTVA 4DMNA 3UQSA 4BWMA 3QGIA 5F8LA 3L2WA 2BQRA 4F8RA 5L1KA 3K58A 1FKOB 4RW9B 4ED7A 4DLEA 5CYQA 2OPPA 3C6UA 1L3UA 4RUCA 4FS2A 3RB4A 5EDWA 1N6QB 4ECQA 4KKOA 1HJRA 2OYQA 1JLFB 3LPTA 1TKXA 5J1EB 1GX5A 4OJRA 1ASVA 1RT7B 3DLKB 1WAJA 4ZTFA 1U48A 3BSNA 3DRSB 2R8HA 4YNQA 3ALYA 3WNHA 1TVRB 4URSA 4YFUA 3DLEA 4N76A 4AHVA 4BACA 4CCHA 3KHGA 5I3UB 2YNFB 3OYNA 2XI3A 1JLGB 1YVFA 3E51A 2D7SA 2KTQA 4QAGA 4FM2A 3SI8A 1QE1B 4NLPA 4CFBA 4E19A 4AH9A 4DSIA 3K5OA 1QAJA 3TAFA 2IOCA 4M3YA 4LH4A 4Z4CA 2WCXA 3OY9A 3QGGA 1HARA 2XGQA 4H8KA 4I7FA 3LP0A 3SQ2A 1NKEA 3V1RA 4I2PB 4IKFA 2BANB 2UUTA 4EEYA 4ZP8A 3KK3A 2V4RA 3CJ0A 3AVMA 4CECA 4H4OA 3H08A 3H98A 4RW4A 1T3NA 2VWKA 4F2RA 1D5AA 4FJ9A 4R5PB 4M95A 4GVMA 2G8HA 5J2NA 5DK5A 2AJQA 1VRTB 1S1VB 3NAIA 4IFVA 4PWDA 4FJ8A 5CZ1A 2HNYA 4B9MA 2HHSA 1D9DA 3DM2B 4YR0A 2LSNA 2Z1HA 4PQUB 3MR2A 3VQ7A 5KFYA 4E7HA 2RKIB 1BQMB 3GV7B 1SL0A 1Y97A 4ELUA 3G6YA 5F9NA 2VA2A 2DPIA 3TI0A 4GC7A 3LAMA 3LP2B 4NLUA 4Q0BB 3O3FA 4DFKA 3BDPA 5KG2A 4E1MA 1R0AA 1Z25A 2IAJB 1RTDA 2EHGA 3D45A 4JV1A 3OS0A 1S9GB 3OYJA 2OPQB 5DG7A 3RWUA 4CJRA 4B9NA 3OYLA 3GQCA 2VWJA 4CF8A 3LANA 4R8UA 4RZRA 2C22A 2XC9A 1SL1A 3KK2B 3AA3A 4NCGB 1TKDA 3O3HA 4F3TA 4DSLA 4FLWA 1XHXA 4Y1CA 4CK3A 3QETA 3F9KA 4NLGA 3KLHA 5EWEA 1S5JA 3QNNA 5F8MA 4CHPA 3AVLA 1RT1A 4CJUA 3CWJA 4JRPA 1DLOA 4RW7A 3IAYA 2ETJA 1HQUB 1C1CA 5KFTA 4Z0UA 1HQEA 4B9SA 5KFRA 2IBKA 3U3YA 4N5SA 1LWCA 3VQ4A 3PW4A 4DQIA 3AVNA 3L2VA 4CEOA 1TL1A 3O4QA 2VG6A 4ECTA 1W9HA 1VSMA 4KO0A 2QV6A 4ID5B 2YNIB 4PUOA 4LSNB 3PO4A 3CFRA 4O3OA 1NK7A 4WYLA 5K14B 3LP1B 3V4IB 2ZQBA 1S0MA 2J6TA 3QNOA 1F21A 3ZT0A 4CE9A 2I5JB 4WFYA 2JEFA 4DQPA 4KFBB 3CM6A 1BL3A 4J9SA 4BE2A 4KPYA 1TL3A 1S6QA 5KFSA 4FYDA 2V9WA 3CJ3A 4IG3B 4CJ5A 3SNNA 4ED6A 3AVFA 4O44A 4W5NA 5KFUA 4FLTA 5CYQB 4B8AB 2OPPB 3C6UB 2VG7A 3HXMA 5HRPA 5KFXA 1ASWA 1TP7A 4NLQA 4CGJA 1KFSA 4KKOB 3OHBA 2P1JA 2HHUA 2E9RX 3VQBA 4M3ZA 1U09A 4FLVA 3KLIA 1FKPA 4AHTA 4DTSA 3ITHA 3DLEB 4F4ZA 3BSOA 1QSSA 4ICLA 3EZ5A 1XC9A 1S4FA 5SZTA 3M8SA 1TQLA 3HM9A 4M42A 1KRPA 3PVXA 2VG5B 1D8YA 4HHTA 4W5OA 2JC0A 3PW5A 1KFDA 1X1PA 1CSJA 3S9HA 1J5OA 5L1IA 3T3FA 3NDKA 2JC1A 1JL2A 4DQQA 2OH2A 5E41A 2FVCA 4CHYA 1NKCA 2C2DA 1C0UA 4O4RA 4I7FB 5J2QB 5FDLA 2RDIA 3UDLA 3M8QA 3M9NB 2QKKA 2HHVA 4Y3CA 4J9OA 2HW3A 1DTTA 1RT5A 4BE1A 4C8MA 4OVLA 4F4YA 2HVHA 3KK3B 3HYFA 3ZT1A 4FZXC 4FS1A 3ULDA 4BDZA 2IMWP 5KG6A 4IRDA 1RDCA 4H4OB 1JLCA 4RW4B 4DL5A 2GUIA 4CIGA 2UUWA 1ZTWA 4C8KA 3DOLA 1D1UA 3K59A 3GILA 4B9TA 2B43A 3QO9A 5J2NB 4ZVHA 5KFEA 2WONA 4IBNA 4IFVB 3CDUA 3RR8A 5KFJA 4Z4EA 4WZMA 2HNYB 4NZ0A 3T1AA 4M3XA 2UVRA 4K4UA 4NLDA 5I3UA 2FLNA 1C0TA 4NYZA 4B08A 4HCBA 1KVCA 1TK8A 2HMIA 4KI6A 4CERA 4ZPAA 3M8PA 1HNVB 2XHBA 2FJVA 1LWEA 2BDPA 4HUGA 4LSLB 1BHLA 5KFQA 4J2AA 1HNIA 3TWHA 2JGUA 3OYGA 4I2PA 4OPKA 1EKEA 2BANA 1G15A 3TAGA 1R0AB 2C2RA 3JSMA 1RTDB 4BE0A 4MK7A 3OJUA 3TAQA 1IKWB 2FVPA 3I8DA 5C42A 3SUOA 3HPOA 1LW0A 2AWZA 4R5PA 5FRNA 4ZPBA 3OLAA 3OSNA 5DG8A 2W9BA 3I5AA 3Q8QB 1RTIA 5KFMA 1U45A 4BDPA 3H4BA 1RBRA 4CF1A 5F8HA 3VN5A 3U3GA 1RT4B 1JIHA 1X9MA 4DTMA 2D41A 2HHTA 4JV2A 2IM3A 5KT7A 3MXIA 2FBVA 1JLQA 2D3UA 5D3GB 5L1LA 5F8IA 1NOZA 4K8ZA 3KLHB 5L1JA 2KZZA 3OYAA 4J2DA 1RT1B 3MTKA 3DI6A 1DLOB 4RW7B 2RKIA 4MQ3A 3GV5B 2WRMA 1C1CB 4KBIA 2YHAA 1HQEB 5KG0A 4E0DA 1LWCB 5KFCA 5KFDA 2OZMA 4HTUA 3V6HA 3AO4A 3G6VA 5KT3A 4O0JA 2JEIA 1TL1B 1KHWA 2VG6B 3V1QA 4J9MA 1Q9YA 3JYTB 4KO0B 2FBYA 1XR6A 4TYAA 4PUOB 1TGOA 3V9XA 1S0NA 3I0SB 3OYCA 4DTUA 4KHYA 3H5SA 3PY8A 2CKWA 1Q8IA 2B5JA 4KHSA 4KHWA 4E7LA 3AA5X 2D0BA 3C95A 3VQ5A 4O0IA 3HPHA 1FK9A 2ASLA 3K57A 4K4SA 3KD1E 4F3OA 2AU0A 4K4YA 3SUQA 4NCGA 4NLOA 2KW4A 4IFYA 2QK9A 4CJWA 1B9DA 4OKJA 1S6QB 3IS9A 4DL2A 1JXLA 1WSJA 3I5CA 4TLRA 2G8VA 5KRSA 5KFOA 3SUPA 2X6SA 1KHVA 4O44B 1HPZA 1W25A 1KLMA 1I3AA 2VG7B 1VSJA 4CEQA 4MKAA 4RNHA 2E4LA 1ZBIA 3Q8RB 2W8LA 2HVIA 2B6AA 3KLIB 4UQGA 3BQ0A 1D0EA 3CVKA 4KREA 3H59A 3ITHB 3QIDA 3MAQA 1NK0A 4ICLB 3CDEA 4M3RA 4ID5A 3OYHA 3BREA 3T5KA 3MR6A 4Z4GA 1ASUA 1K1QA 4KTZA 4DSEA 4CEFA 4KV8A 4TN2A 1S1XA 5CYMB 3HL8A 1J5OB 1S9EA 3OL7A 2RN2A 4Q5VA 1SV5A 1C2PA 2JEJA 5KFAA 1RTHA 4LD0A 4Q8FA 1C0UB 5FDLB 3L3VA 1HYZA 2JLEA 5KT5A 3LAKA 3CQ8A 1DTTB 1RT5B 1UAXA 2WTFA 4OLAA 3PJXA 4Y2AA 4IG3A 1LW2A 4KAZA 2FVRA 4F2SA 1JLCB 4DTXA 3H2LA 1KLNA 3Q8PB 3RB0A 4ZPCA 3T5HA 3DOLB 2AX1A 4ECWA 1REVA 5KFBA 2ITGA 3EZUA 5CY4A 4FK0A 1S10A 3QO9B 2OPRA 4E89A 3VQ8A 2WONB 1HMVA 1U49A 1SH3A 4FJHA 4Y1DA 4FLXA 3V81A 2DFHA 4NLXA 1T05B 2ZD1A 4CK2A 1I39A 2W7OA 5KG1A 4CF2A 1C0TB 2BQUA 4CJLA 4CHNA 3NAEA 3BSCA 3PHEA 1RCHA 2VG5A 1KVBA 4RNOA 2HMIB 3VQDA 1LWFA 2RF2A 3M8PB 1LWEB 3KLGA 3LZIA 1A5XA 4FZZA 4MKBA 4ZVGA 4J9LA 5J2QA 4YR3A 2AQ4A 2VA3A 4U6PA 3G10A 4CGHA 1HNIB 5F9LA 4DU1A 4DG1B 5KFKA 3JSMB 5C5JA 4URGA 4RNFA 3OJSA 5C42B 3PX6A 3SPZA 3ZSRA 1LW0B 5KFWA 4DTOA 2XY5A 1TV6A 2KZMA 1BQNA 2W9BB 1BI4A 3ZSZA 1RTIB 1T7PA 1QUVA 4KSEB 3L2UA 3DLRA 3MXJA 4CEEA 2DFEA 4OGEA 1S1UA 4NLWA 3AA2A 3HPGA 2BE2A 1YTAA
chains in the Genus database with same CATH superfamily
4U8YA 4UZBA 1YJWS 2XS5A 1VQ8N 4ED0A 4PABA 3FZMA 2FXUA 3I82A 3CCVN 2AJ1A 2SXLA 2GIRA 4HYKA 1X4HA 4IDKA 2W40A 2IS3A 2Q6CA 2QJ3A 3B8AX 1M0SA 2ZHAA 2R42A 3NH1A 5ETTA 2E6LA 5AXKA 2HNDA 2AGQA 4KB7A 2UXCJ 5GIPA 2RPIA 4FJNA 2DGOA 4CJSA 1VK0A 2BMBA 2WUSA 3SFGA 4DR2F 3FZKA 2D69A 1WI6A 3LPEA 1KQKA 1JX4A 3P4IA 4FXVA 4CTAB 3R5BA 4B1XB 1MG7A 3GFYA 1ATRA 2J6SA 3HSDA 3WX8A 2XYGB 4CJEA 2LDIA 4IFYB 4LBPA 4FLUA 2ZDOA 2VBWA 2XHCA 3CCSS 4L74A 4LH5A 4CNZA 4F50A 1S76D 4USIA 3NKYA 3P6YC 1RWVB 4FYVB 4M63C 3KHRA 5JVGL 2GAHC 1YWXA 3TZWA 3AAPA 4FWMA 2E9ZA 3IMQJ 3PIPQ 1WC6A 1EWQA 1VHXA 2OEKA 3N6NA 4C11B 5BRFA 3T1YK 4WP9A 3BGFA 1F2GA 4TQSA 1NB2A 1PYTA 4HHHA 4DL4A 4DSKA 2QA4S 5IXUA 4TSXA 3MECA 1RP5A 2HRUA 2W9CA 1CLFA 4D3GA 1N54B 3A5OC 2QMWA 4CFCA 1NG9A 2G0JA 3ZT2A 3PFEA 1VQKN 4KV8B 4GW6A 4IOBA 1CJKA 3I5BA 1SV5B 1SXLA 1WSVA 2APOA 2H4WB 3B6BA 3S6EA 5KG4A 2Q0UA 2KXHA 3TZZA 2GC8A 2V7ZA 1PAUB 2E1ZA 5LL6Z 2Z58B 5JMVA 3CTRA 2Z56B 3SDEB 3QNWB 4LF5J 5D4NA 3SFUA 3U6FA 4O3PA 5AXNA 1ZM3A 4OZJA 1J53A 1YJWN 4DXLA 3IWNC 1GMUA 4CGGA 2MZRA 4DS5A 1HMVB 3P31A 2IHR1 3BF3A 4F25A 4YOEA 4K4XA 2UUAK 1LFWA 3UCZP 1K8KB 1DJ0A 2MEWA 4DCHA 2ZWOA 4L76A 1TELA 4DEZA 3GJRB 2F8SA 3B4MA 4ZVQB 4NYFA 4IJNA 2HQ3A 2RQ4A 2AIRB 2QG9B 3C3LA 5LM7E 4CYUB 4CJ3A 2CG8A 4GY2B 4QWEA 4FJXA 3KLGB 2GIFA 1IQTA 4PAAA 5A2QY 3HP9A 2DGQA 4OYMA 3WNFA 3TTDA 3ENAA 4USMA 3ICLA 4DV1J 3HFZB 4X62F 4CIEA 2YCHA 1JNRB 4YDUA 4ED8A 3G71S 1S5ZA 1VRUB 3ELHA 3CCSN 1R8HA 2UXCK 1QAIA 4M5NA 2BBEA 5KRTA 2F8EX 4ZVOB 1YJRA 4H0PA 3M8YA 3IFRA 2BE2B 3CJSA 1VQNS 4I2QA 4CD1A 1NJZA 4ZVTB 3G4SN 3MR5A 2XMWA 5KFNA 3RRHA 1AT1B 2VIHA 5DQGA 2R7RA 1RU2A 1ZAXA 3QEIA 4FLYA 1J5EJ 1GEHA 4OYXA 4H0XB 3W2VB 4HVJA 2DTJA 3TAPA 4FBUA 2QA4N 2AEJA 4U7UD 3O8WA 1M5HA 5C24B 2BKPA 3OTOF 3D1QA 3FDSA 4A46A 3C6AA 4ECYA 1WSHA 3AVCA 3THPA 3O8MA 3FLCO 1S3XA 1ZTTA 2FF6A 5M2UA 3LH2S 5HBMA 5EVZA 3MM6A 3OL9A 2COLA 1R3NA 3K7RA 2HQDA 2GVDB 4F4WA 4B3RK 4EFHA 3C6TA 1SKRA 4CZIA 4B3TK 4USKA 2PA3A 1UW9A 5GINA 4CEZA 5C25B 2C2NA 2JRSA 3M6VA 4H0TB 1NKBA 5DS7A 1GT8A 1X60A 1ZPWX 1BU6O 4ZCIA 1BY9A 3Q0AA 4QPXA 3JB9k 1ZBFA 2BE7D 3MFHA 4EO6A 4I6MB 3QLHA 2OHDA 2MQQA 4F0MA 2J8AA 4USHA 3TA1A 1QQNA 1HLWA 3OL6A 2VQEK 3AAWB 2J7UA 3JSBA 2XCAA 1F5AA 4U96A 3AOCA 3I56S 1NDKA 3BO4A 3DYAA 3GR1A 1EQMA 2A10A 3G71N 3D5MA 4C1NI 1WSGA 3QT5A 4CBWA 3ZT4A 1VSKA 3OXLA 2P9NA 1D3WA 2H1YA 1XMQJ 1V9OA 2BR0A 1VQNN 2B7CB 2AGOA 1WWHA 4FDFA 1HBUA 4J9QA 4DV1K 1XJWB 3T1HF 3Q8SB 5A6PA 1R43A 1AYEA 1OPZA 3NF7A 1RWKB 1FXXA 4ETXA 2E1CA 4EP5A 4MK9A 1RNHA 3RJMB 1TYQA 1MWZA 4IO1A 1OYEA 4DV4J 3UKRA 3ZEUA 3O08A 2A40A 2HWTA 4QS9A 1KONA 1NDLA 3RMDA 3M2VA 4IG0A 3DLGB 1K1SA 4EBDA 2JHEA 3THYA 1N48A 4RBVA 3ZSVA 3MMVA 3I0RB 3Q83A 3HSZA 4JI5K 4TY8B 5ETNA 4WFAQ 3TZYA 2HFSA 2AZ3A 1S12A 3ASMA 4YS2A 4E8UA 4NCAA 3VQCA 2KJVA 4G3IA 5F8NA 2O66A 4HTJA 4BRGA 3HCXA 5AXLA 2MHEA 1JWWA 3CPWM 1MMLA 4Z4FA 5ADXA 4HDHA 5MLCQ 4JI1F 1WC5A 3NNAA 3J7Z5 3CDWA 1B9FA 4QIEA 3WBZA 4EIAA 2P51A 4CHQA 4KHRA 1S0VA 2G8WA 2FZGB 3A5LC 1S6PB 4E3SA 4JD2B 1NPKA 4FWOA 4DUYF 4JI0K 4JI8F 4USJC 1ATSA 2E2QA 3UIQA 4DOZA 3H5XA 2GO9A 4KB0A 4CEBA 4FF4A 4LFBK 1YJ9S 3CJTA 2MKIA 3OLBA 1M1GA 1RYRA 1I6JA 3RBEA 3EE9A 3BPDA 4WKYA 4JI4F 4K59A 2QLBB 5HATA 4QCLA 5DZ6A 3AFGA 2DNPA 1V5IB 3PW2A 2F65A 1NJYA 4N77A 3IR6B 1JCEA 4PQAA 2RRBA 3S1TA 1SAZA 1U1KA 3H20A 1S1TB 4JV5J 2QX0A 2OO4A 3A5NC 4WJBA 4GC6A 4ISGA 1IBCB 1H3DA 2P9LA 4DPTA 4WU2A 2DGSA 4F0HA 5JS1A 1TUVA 2ACYA 3W0LA 2HNZB 4FJ7A 3MOJB 2CGKA 2D9OA 3L6QA 4Z4HA 3N6LA 3N79A 2WVCA 1W26A 3SPYA 1V6HA 2DGXA 2ZJRL 3FC9A 1VC5A 1NH8A 3BGRA 1GFWB 3ILOA 4XO0A 4DR3J 1HYVA 4X4PA 3TWZA 1IKXA 1XMQK 4L8RB 3B4DA 1IKYA 1HRHA 3HVWA 5A8RA 1L3TA 3N28A 4LRCA 4IFEA 1EO1A 1SH0A 1RFQA 4C8LA 3NBPA 3MMAB 2LU1A 1MW7A 4YOWA 2V4JB 2MKCA 4GRSA 2DGUA 5GAEP 4X4SA 1SJ4P 5D4PA 4DSJA 2Z1IA 3MEDA 3IG1A 4Z37A 4DDFA 3E01B 4IJAA 4EZ6A 4RBUA 3CJBA 4AQYJ 1JNZB 3R27A 3DMJB 3O5TB 2LDYA 3U02A 1SL2A 1SVDA 1SCJB 5F8GA 2QZ8A 5ETMA 4DWIA 3PNIA 1WSEA 1RWMB 3KDOA 3VEOA 1XMBA 4FOEA 1SBRA 5JMNA 1TUYA 2QA1A 5KFIA 2AYEA 3GL1A 1TKTA 4K2XA 2OPSA 1ZAVA 2FBTA 2M52A 3FNNA 1YJTA 5LMNJ 3OL8A 1XBWA 3AAQA 3LO3A 3P49B 2IM1A 1VQ5S 2CFXA 2O4GA 3CXCR 2QFIA 1Q86O 3E66A 1I3OB 3H5YA 2IDEA 4FYXB 4HACB 1WLJA 2KG1A 2D3OR 2LCWA 3EWGA 4DKWA 3V6DA 2C28A 3DXBA 3EZWA 3DRPA 1YJ9N 4HCCA 3FSIA 5DDPC 4BDYA 4M3UA 1LXJA 2XHWA 3CJ4A 1FJCA 2HHXA 1A7GE 2IDOA 3AO5A 4ZTJA 5LL6d 3FCWA 4LF9K 4AF1A 2E1RA 2UU9K 2R7VA 2HS4A 1N33J 2HAIA 4K8XA 1CZAN 2DRAA 3FFIA 2CNLB 3GTYX 3H40A 2OZSA 1BWEA 1FX2A 4WCEL 2A1BA 4M45A 2G8FA 1TKXB 4DR5J 4YOXA 4DQSA 4PY5A 3DOMA 1Z1ZA 4JV5K 2KH9A 2ERRA 4BS2A 1A9NB 1MLAA 2AEFA 4E7IA 2DR8A 2DRDA 1ITGA 4WFNL 1VIOA 1JLBA 1FWKA 1TTHB 3BY5A 1S22A 1W7WA 5HK4A 4ZIWA 2VZ9A 3W5YA 4MFBA 2POKA 5KFLA 3CCLS 4TY9A 2PIIA 2J9DE 1WN7A 3SLCA 2YJFA 3LALA 2CWKA 2IRUA 3ZCMA 4O3SA 5DZ7A 1DURA 4PG6A 3HVAA 3FEZA 1S77D 1WOSA 3CJKB 4DR4F 5M1PA 4LF6J 3CCWA 2ZWHA 3M8RA 1ZBHA 2QC3A 4XK8C 5JJBA 4CI6A 5CCMA 2NRXA 1S1WB 1FFSB 2QYGA 2ZZTA 4KGKA 3TVYA 3R2CJ 3K2YA 1X7VA 2QN6B 4NXNK 1EZZB 1Q4RA 1RT7A 2LA4A 5F8JA 4FZYA 3MCNA 3VQ6A 5E84A 3RAQA 2XTJP 4BC2A 2KFNA 2EW9A 4B9UA 1VQ5N 2ASYA 2YNFA 4TU8A 1N88A 4M8LA 1JXBA 1JLGA 1AXQA 1NBEB 4JS5A 3MEGA 2DNNA 4OHZA 5IC4B 4CIFA 2XM3A 1S0OA 2GELA 8RUCA 2ADCA 3QT6A 1LFPA 1RT6B 3D2FA 5T7BA 4P71A 2J8SA 5A8KB 3NGDA 3U7JA 4K25A 4DU3A 4O4GB 1EP4B 3L7UA 2HSTA 3BN7A 4ZLJA 2ZOFA 4FW1A 1TK5A 1EQYA 1SKWA 4AE5A 3QINA 1R8BA 2GMHA 3BYPA 3CDAA 2P9PA 4J8FA 2X78A 4H0YB 1QVGR 3GR0A 1KP6A 2FTRA 3W65A 4G1QB 2ZM6J 4R8UB 3G86A 1Y5NB 1IXKA 2LYVA 3VPZA 3G82B 1S1VA 4OX9F 3KLEB 1WJ9A 3LDSA 4NLTA 1CJUA 5LJ3Y 2YNGB 4HH0A 1TZ0A 4MMOA 4OPJA 1MA9B 3M9MB 4I9QA 3A5MC 5AT1B 2HZAA 4GKKJ 5AQKA 2I7NA 3QIOA 4CLYA 1EQ0A 1BQMA 3K0JA 4JKAA 3ENBA 5A2QO 3OVNA 3EXCX 4C48A 5GADP 2JWKA 4M5JA 1B0VA 1NK6A 3CSKA 1VSIA 1UMJA 3UFCX 3R8YA 1VBYA 3U9ZA 1EIYB 3CCLN 2C2MB 1Y3KA 4ZPTR 3TABA 4DPWA 4JI3J 2WOMA 3MMCA 2OPQA 1MN7A 3ETOA 4DR5K 1DARA 2P2CB 1KNZA 4UOHA 3B6OA 4CVNE 4M94A 1NDPA 1NHVA 2XMTA 1ZC6A 2P9CA 4P7VA 3A8JA 2Q1LA 2V8VA 3AB4B 5GADU 4FKXA 5KFFA 4ISFA 5BN8A 2RH3A 1MN9A 5KG5A 5C2GA 4U7CA 3G0ZA 1TL3B 2W7PA 3FEYB 1FX4A 3AVJA 2R7TA 4AHCA 2ROEA 1U4BA 1TKZB 4RTFD 3MF5A 1GK8A 2ILZA 1HNZK 2LVWA 3A2FA 3PIOL 1B0PA 4DHVA 2ZBQA 3NNHA 1YTUA 4LF6K 1ZBSA 3S3MA 4N8OA 3ATUA 3QAEA 4HH1A 1UFLA 2X51A 3BH6B 2DNRA 2D3O1 2Z8QA 1D09B 1RTJB 1UZDA 3HZ6A 3BQ1A 4B3TF 4AXJA 3VQAA 4N56A 4F4XA 8ATCB 5AQVA 3G6EN 1BISA 3K5MA 4X65J 2NXEA 4QYZK 1TAUA 4MO5A 2FHMA 2BJEA 3EL2A 2XMJA 4IOXA 4Y2KA 1PILA 1U04A 4DCOB 3NF8A 4DV7J 2XG8A 3VALA 2FPHX 2HK3A 2H48B 5IWAJ 3RTVA 4A8KA 3D66A 2R7QA 1FKOB 4ZS6A 2MDAA 3TUJC 1W2IA 4RUCA 2MB0B 1N6QB 2E1AA 2PC6A 2YQ1A 1VBZA 1ACMB 4H03B 2EG1A 3KNGA 4FZVA 1WAJA 4ZTFA 4D3HA 3BSNA 3DRSB 2R8HA 4DV2F 3ZX0A 3WNHA 1TVRB 3PDNA 1TFYA 3DLEA 4N76A 2EKNA 4JI2K 4AHVA 1J27A 4CCHA 1YI2S 5I3UB 4U9RA 1PO6A 4UOFA 3SI8A 1QE1B 1JJHA 1RBLA 4E19A 4CZLA 3TAFA 3IAS9 1Q18A 2W41A 4LC9B 5AQNA 4ZCMA 5AJ3J 3TUPA 3NMRA 2Z2LA 4B3MF 2G2YA 2D4WA 5EX0A 3FGVA 4FOIA 3SQ2A 2R7XA 3V1RA 5LY3A 2BANB 1K8AT 1B4SA 3KK3A 3PEHA 4DV3K 3CJ0A 1F5BA 1IBLJ 3JS6A 1T3NA 1NUEA 1NAQA 4NXMF 1D5AA 2JVOA 2JWLA 3MCAB 5J2NA 3M1FA 3ENHA 3BO3A 1DAXA 2AJQA 5DK5A 1VRTB 2RQCA 1CULB 5IS2A 4PWDA 4NEZA 4JI3K 4P9SA 4FF3A 4WQ4C 3HF5A 3PM9A 2HHSA 1PCAA 3AA9A 2AYGA 2CPYA 4YR0A 2Z1HA 4PQUB 4E7HA 2G4BA 3ENQA 2R7SA 2VQFK 5HVGA 3H1QA 4PKDB 3G6YA 4NI2B 1HWLA 1ZH5A 1NSKL 2LEBA 1WUUA 4GC7A 3LAMA 3OTDA 4EHTA 1IBKF 4ZCLA 5KG2A 3WXLA 2KG0A 3FGUA 4BC7A 1RTDA 2EHGA 2F9WA 1DGKN 1S9GB 3OYJA 4BCAA 3GQCA 5ITHA 1SL1A 3KK2B 2IVPA 2QL7B 3OTEA 2A3JA 2VC0A 4DR7F 1XHXA 4Y1CA 3QETA 1S5JA 3G96A 1LOUA 3QNNA 4CHPA 2XMMA 4CJUA 3CJQA 3IAYA 4ES3A 1KXPA 5KFTA 4DV7K 2YKAA 5KFRA 1U26A 2IBKA 1YI2N 4N5SA 1FJGJ 3V5RA 2UP1A 5IWAK 4NLBA 3AVNA 4NA1A 1TL1A 1SPBP 3D68A 2J9DA 4Z2XA 4OI1A 4ECTA 1NJIO 5AQTA 1HNXJ 4LSNB 3PO4A 2DGTA 4OZ0A 3LP1B 1R6YA 1OH5A 1S0MA 2HF3A 2J6TA 3QB0A 4JP8A 3QNOA 4E98A 2I5JB 1B3TA 3N5FA 4DQPA 3GONA 4KFBB 2HMPA 1C4CA 2YJEA 1Q8KA 2R7UA 2Z2MA 1L3KA 1VR6A 4J9SA 4RU2A 3Q86A 3TTFA 1H73A 4O8KA 4X64F 5KFSA 3CJ3A 1N34J 5CYJA 3TW0A 4CJ5A 3MUVP 1OH6A 3J7YP 4W5NA 4OJGA 1PAEX 3SEOA 5KFUA 2VWBA 4FLTA 4B8AB 5BR8K 3KFWX 4R79A 1X4CA 4A4JA 1ASWA 5D4OA 2EBEA 4BG9A 1MWMA 4CGJA 4KKOB 4C2MA 1ESVA 2HBZB 1CJTA 3MM9A 3KG0A 5GAGP 3E1YA 3KLIA 3CC7S 2H9ZA 1XC9A 2J5AA 4Y2IA 2WSCC 3PSFA 4FWPA 2HGNA 4BRHA 4I1TA 2KLAA 1K73O 2JC0A 3ADAC 3PW5A 1KD1T 1Z2ZA 1KFDA 1CSJA 4LFCJ 4FF2A 3T3FA 4WPAA 1JL2A 4I69A 2A41A 4DQQA 4LFAJ 2FVCA 1NKCA 2C2DA 5GAGU 5J2QB 2RDIA 3NRBA 3UDLA 3M8QA 2VPZB 1OQ6A 2KYXA 3C16A 2HVHA 4HI2A 3O44A 3ULDA 5KG6A 2E44A 2GUIA 4CIGA 2P6TA 2V34A 4OZ5A 4BRNA 2NCKL 3K59A 3GILA 4MJKA 4XEIA 3ZO7A 2AD9A 2WONA 3C14A 4PYAA 3SBTA 4IFVB 1CS4B 4NZ0A 4MKVA 3DNCA 1OPIA 4M3XA 4K4UA 2F5GA 1YIJS 4B08A 1JCGA 1KEKA 2HMIA 2NS1B 1HW8A 4LF7K 4ZPAA 1HBOA 4H5RA 4BR0A 2FJVA 4HUGA 2MMYA 1P9YA 4WK1A 4I2PA 4OPKA 1FJEB 3VAIA 1G15A 1R0AB 3BGOP 4ES1A 2NLWA 4MK7A 1FERA 4RR5A 1IKWB 2QWRA 2FZKB 2ASOA 3HPOA 2AWZA 4R5PA 2FC9A 2DO4A 1PIEA 3GCXP 2W9BA 4JI7K 1RTIA 1RBRA 2P9IB 3H90A 4JHDB 3U3GA 2VKRA 2DHSA 4YB5A 1X9MA 2D41A 4G1PA 5BPNA 4JV2A 4BREA 2IM3A 1N5VA 1JLQA 3QT8A 1KOHA 3DHXA 3KLHB 2OTJS 5L1JA 4J2DA 1RT1B 2CUYA 1GNKA 1U25A 1WG4A 5K20B 2WRMA 1VQOS 2MXYA 4KHPJ 5KFDA 2V2ZA 2MZQA 5L38A 1N34K 5KT3A 3KUGA 2N3OA 4JEPA 3ZNUA 3V1QA 4FL9A 4PXCA 1Q9YA 1E6VA 3ILIA 1AROP 4GMKA 4PUOB 3V9XA 3CF5L 1RACB 4GKJK 3HHNB 5E5NA 4EFAC 3PY8A 1Q8IA 2B5JA 4E7LA 5D0RA 3C95A 4O0IA 1S7HA 2VJVA 2F3JA 3E8OA 5T7LB 4S0MA 4NCGA 5D8HB 5GMDA 2KW4A 4CZFA 2A42A 2QK9A 4G1IA 2KT2A 1JXLA 5D78A 2WB1D 3I5CA 5D0GA 5KRSA 2RHSB 5C0YA 4LFAK 1W25A 2VG7B 1T9UA 2C3YA 5FD1A 1VC0A 3TSUA 2UXBK 5E3CA 1FDNA 5DDOC 1A0OB 2VGMA 4YHHK 5HO4A 4IXCA 3Q8RB 4K0KF 1OY8A 2B6AA 2IRXA 3SCKE 3HRGA 1BC6A 3LDLA 4ID5A 3BREA 4Z4GA 3GMGA 2DIUA 1YAGA 4ILHA 1B64A 4KTZA 5AZJA 4I68A 2RDDA 2VBYA 4DV0K 2CJAA 3WQUA 3K0SA 5MAOA 4CO0A 5CYMB 2AHOB 1J5OB 3OL7A 4Q5VA 2GQCA 3RSEB 4BR9A 1C2PA 2JEJA 2GJIA 5IM0A 3ZZUA 1WD6A 5KFAA 1RTHA 4B3SJ 4Q8FA 1C0UB 3L3VA 3LAKA 3BDEA 5E3PA 1DTTB 5A8WA 4X66F 5MLCV 3OTCA 1UAXA 1KWMA 2WTFA 5RUBA 3PJXA 4Y2AA 1LW2A 4KAZA 2FVRA 4F2SA 2YWHA 4WFBL 1KLNA 3Q8PB 2KXFA 1KR4A 3DLLQ 3RB0A 3VGVA 4ECWA 2AX1A 1REVA 2ITGA 4RX6A 3C7NB 3EZUA 1NGDA 3QO9B 3Q24A 2OTJN 1S4EA 1RAHB 3K9JA 2YX4A 4FJHA 3JXOA 3V81A 1IG8A 5KG1A 4CF2A 2H5EA 2PA8D 1XNRF 1VQON 3A3OB 3OFEA 3P39A 5CZVA 3JAMY 1U0HA 4RO0A 3PHEA 1RCHA 4LF8K 2VG5A 5HQLA 4OYIA 1LWFA 1D8ZA 4FVUA 3LZIA 5IV4A 2IIRA 4MKBA 4J9LA 3IWLA 2VA3A 1OH7A 4N7TA 1YTYA 3F41A 2QA4G 1F3VA 4DG1B 3MPVA 5KFKA 5M1NA 3JSMB 2IVFB 5AZIB 4XH5A 4KH6A 3M8WA 2V50A 4U67L 3OJSA 5C42B 4KHPK 3O80A 1RTZA 5KFWA 4DTOA 1TV6A 4NZ7A 1BI4A 1QZ5A 1T7PA 3CCTA 3MK6A 3L2UA 3MXJA 3HSJA 3OUYA 1OVQA 3ULHA 2CAJA 1YXQA 3E9LA 4OGEA 3WC2A 1U02A 3BBFA 2OKQA 3FBBA 1HLUA 3AA2A 4FYWB 1SZ2A 2C3UA 3NWGA 4C8NA 4RNNA 4FLZA 1RXOB 2IGIA 1HBMA 2L9NA 1FRXA 3T5LA 2QI2A 3WNEA 1Y4ZB 2NSCA 4ECUA 4RW8A 4ELVA 1LAWA 4H5NA 2HHHK 1NBWA 2V9KA 1HNVA 2CJBA 2LQ5A 1RBOB 1WF1A 4OIXA 3FZ2A 4LSLA 3KIOA 2HFOA 4IQMA 2B7BB 3LF0A 3LPUA 3R8EA 1E6YA 3L0QA 5I9EB 3F9MA 2VGNA 1RDWX 2PMWA 4IH7A 4Q8EA 3GSDA 4WQ4A 3DC2A 1ZBTA 2F4VK 1JXVA 1NK9A 2L9WA 2V0NA 1T95A 1IR0A 1FFWB 1GXLA 5B08A 4K4TA 1OS5A 1BXNA 1FTCA 1FK9B 3Q22A 3CJ9A 4O55A 1T9XA 3TUZC 1RT4A 3TANA 3AD8C 4Y2CA 3NOCA 2ZUAA 3V1OA 2CQ3A 5HVHA 3IS9B 4E7KA 4HVZA 5EN1A 1RDBA 1GOBA 3R7BB 1VFJA 4NA2A 5LOQA 3QFPA 3PYEA 1RT2B 3B82A 5ETOA 5FRMA 3NF9A 4O3RA 3TVZA 1KLMB 2YPZA 4DV5F 4O5BA 1NOYA 2ZBPA 4ELTA 3HHLC 2CQHA 4IH6A 4JI6K 3O1BA 2W4CA 2MGZA 2C2ZB 3U1MA 5HROA 2FZCB 3R6MA 2GVZB 5KAKA 1BQXA 3JYTA 1NM2A 1MDUB 2NPFA 2NZCA 3I0SA 3SCLE 2RUSA 2B9EA 3Q89A 3THXB 2HS3A 3UCUP 3GG1A 3FBFA 1V4SA 1S1XB 5FJ4A 3VGKA 2O8EA 4P52A 1XMOK 2IIHA 4G65A 2V4QA 3ID6A 5FPEA 4ED2A 2HFNA 3FMWA 3VAMA 2UXDJ 3DDKA 4BRQA 3I9V9 2W01A 3RRGA 3L3UA 2XNRA 1C4AA 2CIMA 4QWBA 2BGGA 1ZYQA 1LCUA 2CJYB 5EWGA 3QERA 3ZSWA 2XO7A 1B92A 3Q2TC 2OPRB 1RU1A 2E5LK 4BR5A 1S6OA 4NYNA 3K8VA 3K5PA 5AFUA 3DHWC 4ZDNA 2NZTA 4BVPA 4FM0A 1I94F 1RB0A 4I4BA 4DN0A 3IRXA 1RWWB 3UDEA 1CVJA 1UOCA 2XSJA 1SJFA 4YR2A 1Q7YO 1WBBA 2KYZA 4QIWD 3DRRA 4OJHA 3N4PA 3OYMA 1XQIA 1N5YA 2BOPA 1O51A 3UN3A 4ECRA 3FBCA 2D3ZA 1CZBA 2O8FB 1CC7A 5D77A 1BQNB 1FI4A 4MDBA 5K8OA 1WTFA 4H4MA 4AL7A 1G2EA 2QE5A 3LWMA 2NUHA 1T05A 4P2SA 3CEDA 1Z26A 4DUZJ 2UUCK 4BWJA 2CPJA 3HM8A 5AE1A 3OVAA 3HMJG 4IDKB 3EPIA 4FPRA 2BQ3A 3BKTA 2FVSA 4DQ8A 1U1NA 4TVAB 3J80Y 1XQSC 4IR9A 3P5BP 1SC4B 5J2PA 5IFMA 1N32J 3CCJS 4C7QA 1IQZA 2HNDB 2R2RA 2W7AA 3EPGA 4MTPA 5D15A 1RKIA 3MPDA 3UD4P 2DNHA 5JLHA 2ZJQL 2X1AA 2IM2A 3I96A 3OR1A 3WEEB 5AQJA 3IR7B 3KJQB 3BO2A 3DGVA 4DR2J 1MU2B 3EDQB 3KLFA 5ADXH 3ZZ0A 5FROA 2PBDA 3QFUA 4ZVFA 3W7BA 4NE9C 2MLYA 2EK6A 1C6VA 2PFDA 4PYDA 4ILMA 2OSQA 3PRDA 2FSKA 4CZEA 4AXIA 5AQQA 3ZZOA 3WT0A 5HRSA 2YI1A 1VLOA 4H54A 3M3ZA 5B7WA 3SZ2A 3TNVA 4DS4A 3CPEA 4M5GA 2J7KA 3RBDA 1ZBLA 2UXDK 3OYIA 2YKNA 4ZITA 2ZVIA 5E2QA 2NR0A 4QU7A 2PY5A 3BEGB 1HPMA 2JFDA 3QWUA 1FVSA 2BJ7A 3GSIA 3VF4A 3FZLA 5F0XA 1NSPA 3AGRA 2XS7A 2K2PA 1WDDA 4MYUA 3MECB 1HHSA 1RILA 2W9CB 2ZKTA 2XI2A 3X1LB 1VJWA 4CLLA 2ATCB 2UUBJ 1CJKB 4OGCA 4KH0B 1GX6A 2FLPA 4ZJLA 2IYIA 1L3SA 3RMCA 2CJQA 1K9MO 3CCRS 2QKBA 1QSLA 3UE5A 4IRCA 2A18A 2YWWA 4RWXA 1ZZFA 1YBAA 3V6KA 3AVIA 2E5GA 1YZ7A 1HUXA 2RD5C 3ZZRA 3S41A 4QYRA 2QW9A 3OS1A 4H4KC 5KOWA 3BBBA 5IT9U 2IVMA 4RNMA 4DFPA 4LF1A 3HHDA 1U8WA 3D6HB 1Q53A 2I8EA 4WFNQ 4J9KA 1GQEA 1XEZA 1A5VA 3PV8A 3GDQA 3AJ1A 1SQFA 3UVJA 4A5AA 2F8MA 2PI5A 2RS2A 1WNSA 3NL0A 2ZC3A 3GFXA 2O8DA 4UOCA 3AQOA 4UY8O 3SIPB 5FIIA 3AVGA 3DOKA 3M32A 1S72S 3CC2N 4CRJA 4K7QA 2CQ0A 2GGPA 3W5ZA 4KHNA 2PYJA 2U1AA 2X3GA 1I5OB 3EXYA 4IOAL 2MYFA 1GOAA 1KBRA 1LKZA 3CIZA 4ZIVA 2MQOA 2F96A 2ZH5A 4ZA1A 4J2BA 2G8UA 4PWUA 4OI4A 4I2QB 4K41A 3CW2C 1W2BM 3ZTSA 3AXKA 3BM7A 4DR2K 2DNGA 1CJVB 3UN2A 3WXKA 5IT4A 1T6CA 2ALZA 2BRKA 2OEJA 4CGIA 1X5SA 4LQ9A 5BPMA 2MZSA 4O3NA 1ZBUA 3ENVA 1JL1A 2GHWA 1ITPA 1C0GA 4NX9A 5JUMA 2X6NA 2YWKA 2XY7A 3MN9A 2Q1NA 1SKSA 2H65B 1NU0A 1RDAA 1KAZA 4EGLA 4NB4A 2J76E 4XH1A 1GTHA 3ZZYA 1JLEA 1M1KO 3CCRN 5HBMB 1VRUA 4WTOB 2DD8S 3MM6B 4JKGA 2DO0A 4QW8A 2HLUA 4RW6A 2MJNA 2CDRB 3CO9A 2HOEA 1YJ7A 5D0HA 2ZJPL 1Q5VA 3ZT3A 3EY1A 3C6TB 3HT3A 4ZPWR 1U47A 2E5JA 2MKJA 4LREA 4EU0A 2GHPA 3W9IA 1J5EF 1KSPA 4IRKA 3SXLA 3U4LA 4B1YB 1T02A 3W2VA 1H0HB 3MN6A 1T6DA 3V9WA 4AL6A 2H5IB 2UZAA 2OEMA 3O2IA 3ISNC 4ANDA 2OI2A 1Z4UA 2V8PA 1Y0HA 2HRYA 3QLHB 2M9KA 3D54A 3K5LA 1HIYA 3KHLA 3J81U 2IM0A 1S72N 2EG2A 2OELA 3F73A 1S97A 4TQRA 1RGIA 3J81Y 4LR8A 1HFEL 1X8DA 4A2AA 2W2MP 3T19A 3IM9A 1VJQA 1M1HA 3SQ4A 1U2VB 1G1XA 2DNMA 2AW0A 2GWKA 4FJJA 1EX4A 2A5XA 1YSJA 2P9NB 3B8HA 1YJVA 5KT4A 2NRHA 5I42A 2X1BA 4YQWA 1NGHA 4NYPA 2FBXA 2MKHA 3JAMO 3SUNA 3VGUA 1FTRA 3CCES 1HBUB 1M90T 1HA1A 4ZK7M 2ZH7A 2R7OA 3D7EO 4IOCQ 4WFXA 4DR6J 2RRNA 1F6TA 1H7WA 4X62K 1MMNA 4B1UB 3H42A 1HYSA 1W0HA 4WF9L 4I6MA 3KK1A 2OCEA 2OANA 2NXNA 3SI6A 1TYQB 4K4VA 3UKRB 3ZEUB 2RMLA 1DQ8A 1F9FA 3M2VB 4IG0B 4ILRA 3A8IA 2BM1A 3THYB 3EMTA 4M5DA 2DR7A 1XNQF 3HHLA 4E1JA 1NGBA 3FSYA 4BG8A 2XYHB 5HN0A 4DU8A 5KOXA 3HOTA 4UF4A 1S9FA 1FF2A 3CFPA 2AX0A 3H2UB 4TYBA 4YP3A 5A76A 3OTBA 3KMSA 3K5NA 4BRPA 3MN7A 3OTOK 2CADA 1WOQA 1UAWA 4JI1J 4YOYA 2V63A 4DV4F 1NDCA 3OBIA 4DL6A 3FUYA 1AZSA 3QWPA 2HBQB 3H2VE 3QFHA 3GJQB 3HI0A 5EY4A 3UI3A 4GV3A 3N6MA 4P2XA 4JKDA 4Y28C 3KLVA 2NRWA 2QWPA 3W8GA 4KR0B 4DUYJ 2GEMA 2GIQA 3KZBA 5CZXA 4F7VA 1S48A 3A3NB 2ZUGA 1QLNA 1GOCA 3CQYA 5IQ6A 1WSIA 1UA1A 3T6BA 4QOZB 2CJXB 2DY1A 2YKMA 4IEEA 3LP0B 2HQIA 2DEJA 3MX2A 1NXIA 2Z1GA 4NEYA 3QBXA 3MD1A 1IBMF 5H9EJ 1X5PA 3D6FB 2E66A 1VQ4S 5M2RA 5EXWA 3FQLA 5CA5A 3OS2A 2DFFA 3H7HB 2R3VA 3HI9A 5ETQA 4JKFA 5AQHA 2ADBA 3US5A 1JLFA 4CF0A 5J1EA 1VYAA 4XPEA 3DLKA 4ISEA 3TP2A 3R5GA 2XRIA 2WFBA 2DNOA 1RHRB 1XK8A 4BRFA 1P6TA 3PEJA 4DFMA 2NRRA 3VGLA 1BLUA 1BA1A 5AQUA 3OBWA 3BSAA 2V67A 5SUHA 1UPMB 3JQJA 1IKXB 1IKYB 1C0MA 2O67A 5A8RB 1G3OA 3BBCA 1CC8A 4WXWA 3NGZA 1Q1KA 2QLFB 3KG1A 2MY8A 3U1LA 2D74B 1FWPA 3NBPB 2MQPA 3X3UA 1X0FA 4UTGA 4QU6A 3T1HK 4Q44A 1LAVA 3CCQS 4IO9Q 2GUPA 3V9UA 3DLJA 2JX2A 3IG1B 4N41A 5AQYA 3KMQA 3VZHA 4RPFA 3BF4A 5AQIA 5A6WA 4HKQA 5CZ2A 1O1WA 2DNKA 4CJKA 1NRKA 4DJBA 1J6ZA 3H46O 4O3QA 4F02A 2G2OA 2W2PP 3RAMA 4QWAA 4IZ9A 3MPUB 1XHZA 1DRZA 4JK8A 1TKTB 2OPSB 4DR3F 3UDCA 2GJFA 2N82B 2XY8A 4KT0C 1VSHA 3MPYA 1UJ6A 4CHOA 4X4TA 1QAXA 1WF0A 2NYHA 4PWWA 3LP2A 4XTTA 4YY3J 1Q8BA 3FCVA 4JKBA 5B0GA 4JI1K 3V6DB 1C0FA 3RBZA 2IAJA 1OY9A 4ZP9A 5T41A 3VVTA 3ZC4A 4L72B 3SJJA 3BZQA 3KK7A 3RG6A 1UJ5A 3UCGA 2XCPA 3VGTA 5ETVA 2IYGA 2HZCA 2Z30B 2DNYA 4FN5A 4CF9A 4QR1A 4LR9A 4NRTA 2DISA 3QAUA 1VQ4N 1IWAA 4DUYK 2UV8A 4NLRA 4JI8K 2W2OP 1YRTA 2QXFA 5LMNF 4OLBA 4ED4A 2Y9HA 4BROA 2N4DA 4JUZA 5HJYA 4NPOA 3J80O 5KFZA 1B99A 4FXWA 4C98A 2NQPA 3N9UC 2Y1RI 3CCVS 3NCRA 4JI4K 3OFFA 4FM1A 3L95X 1KQSR 3DOMB 3PIPL 3PX0A 3MWTA 2H3GX 4MLEA 4DZ6A 4QW9A 2YKPA 2YNIA 2CPFA 1JLBB 3KHHA 3L2RA 1VS3A 3V4IA 3R9PA 4FJGA 4H4KA 2W9AA 1SJ3P 2G8KA 3BGLA 2IVOA 4MFBB 2KDOA 1V5VA 1RABB 1WEZA 2HK2A 2CNNB 1HWKA 4FK2A 3OBYA 3CCQN 2UYTA 4JS4A 1H2UX 1VHIA 2PE8A 1N33F 2R7WA 5KQDA 1L3VA 4W92B 3TA2A 2LMIA 4DMNA 1NPPA 4BWMA 3QGIA 4JKHA 2BQRA 4F8RA 3PKYA 1X4FA 3T1YJ 2OPPA 1L3UA 1RWXB 1Z05A 1GMVA 3RB4A 3I55S 1N5SA 3AY0A 3IAM9 3MCOA 3ZETA 1ZM4A 1TKXA 1GX5A 2HPUA 3VCDA 1WC4A 1PSDA 4OJRA 1ASVA 1RT7B 3U1NA 3M30A 1E4FT 2MSTA 1QQOA 2JLGA 4FWRA 4ANCA 2YNFB 3W66A 4OHYA 3OYNA 4J91A 1JLGB 4KH1B 5I3PA 3E51A 2D7SA 3A4TA 3D7SB 1SB6A 2FGOA 3TUIC 3TX0A 4NO7A 3K5OA 1QAJA 3ZXWA 2OIHA 3D2FB 5TKWA 2HYIB 2XGQA 4I7FA 1OSDA 2V2VA 2AP1A 5K8MA 1RAGB 3NGSA 2IVNA 2EFGA 2WC9A 2UUAJ 5CD4A 3H08A 2RQKA 2P9PB 1YKWA 2YBVA 2VWKA 1FT8A 3PXGa 3W2WA 4FJ9A 4M95A 1RWUA 2G8HA 1S1VB 3NAIA 1HNWF 1Q95G 4DZDA 4DCJB 1CJUB 5CZ1A 2Z2YB 3CCZA 4B9MA 2QLXA 2DJWA 2DKOB 2A6OA 2E88A 3MM5A 1N0UA 2CQBA 4KPCA 5B0AA 2GWJA 3TZXA 1Y5LB 2RNEA 5DETA 1W97L 1D9DA 1NCLA 2LSNA 5KFYA 1FKAF 2RKIB 1BQMB 3GV7B 1SL0A 1RBAA 3TX8A 4EHUA 2K06A 2JZ5A 3M2UB 4OZ2A 5CCLA 3CETA 1UVKA 4LT6A 3OS0A 3MMCB 2OPQB 4PXEA 3PACA 2ZM6F 4B9NA 4OJ1A 3CJ7A 4JBCA 4R8UA 3DGPA 2C22A 2XC9A 3AA3A 3WXMB 1UEUA 4DV6F 4F3TA 4NYOA 4OQJA 2G0CA 3CCMS 3I55N 1Q81T 4CK3A 3F9KA 4NLGA 2BW7A 5EWEA 2M7SA 3J7A1 4GKKF 2Z57B 2BABA 4RW7A 3HSCA 3GYXB 2ETJA 3WHIA 2M70A 3G8SA 1DQ9A 4I6YA 4CZJA 3G4SS 3NS7B 1KQFB 4BRMA 1UVMA 3L09A 3L2VA 1UVJA 2E2NA 3MAAB 4DR4K 2FGCA 3GOIA 3O4QA 2VG6A 4KO0A 3OR2A 2HQGA 3EKSA 4O3OA 2KVQE 1NK7A 4WYLA 4B3RJ 2ZH4A 5CABA 4B3TJ 2O01C 3OW2R 1VBXA 1YF5L 3ZT0A 4CE9A 2D9PA 3ZZTA 3W5XA 5HMZA 4WFBQ 1JJ2R 1BUXA 1S57A 3CM6A 2YH0A 4QR2A 1SJQA 3H6EA 1FJ7A 5IQQA 1TL3A 3LPYA 4FYDA 1QZ6A 5F3ZA 2V9WA 4IG3B 1YRUA 3AVFA 2FDNA 2HGLA 5KFXA 1TP7A 4NLQA 2K8GA 4O8UA 4WIQA 5F0UA 3RW6A 1RKJA 1QUPA 4U7BA 3Q8UA 4AHTA 2V68A 2QWNA 3ITHA 4PG7A 3DLEB 2VQEJ 1NB7A 4H0OA 4DV2J 3BSOA 2VFTA 4ZN1A 2BYCA 1LWXA 4IEIA 3GG0A 3OV7A 4X65F 5DDRC 2VB6A 4HHTA 4H5TA 3J81O 3S9HA 4OX9K 3SQGB 5B0EA 1N8RT 3D6MB 3QSYB 4FPAA 3MMJA 4CHYA 4OHWA 1YVNA 3M9NB 2QKKA 3G2XA 3TEHB 4B3MJ 4Y3CA 2HW3A 2ASPA 3RW7A 3G8TA 1RT5A 5A0YA 4WFAL 4OVLA 4WKRA 3KK3B 3DJCA 4GO5X 4IRDA 1RDCA 3SAGA 2GNKA 3OW2M 4PG4A 3RGIA 3DOLA 3FCHA 3CCMN 2QIFA 3KJNB 1JJ2M 4B9TA 5J2NB 4ZVHA 4F3QA 3KDNA 4NASA 3RR8A 4WZMA 2DK2A 5EX5A 2UVRA 1NMEB 4C1NK 5I3UA 3SMZA 3ZZPA 4HCBA 2V7YA 2M4MA 4JI5J 1TK8A 1WHWA 2RIJA 2EI5A 2KHDA 4DL0C 2FLOA 3GJSB 4X4OA 4BBYA 5AJ3F 4OYWA 4CWBA 4X4UA 4CM0A 1HNIA 2JGUA 2BANA 1IBLF 2ZITA 4UY85 3DXMA 1RTDB 2RS8A 2B8QA 2MKYA 3SUOA 1LW0A 2AMCB 5DG8A 1XUPO 3HTVA 3Q8QB 3NS5A 3VN5A 1SC3B 3RUBL 3AJ2A 4LJMA 3MI7X 5KT7A 3MXIA 3R5AA 5D3GB 4JI0J 5L1LA 4PZVA 2J0QD 2YY3A 1NOZA 3OYAA 2ABYA 3HFKA 3S01A 3D67A 3DI6A 1N0VC 4MQ3A 3VEVA 4KBIA 3VGSA 4LFBJ 1Q5YA 5KG0A 4CO5A 3NOGA 3VAKA 4CD3A 3V6HA 3G6VA 4O0JA 2JEIA 1TL1B 1KHWA 1WELA 3MURP 2C3MA 4J9MA 2NRTA 3I4HX 3DU5A 3OXGA 3O9SA 3OYCA 1U6BA 5IV3A 2CKWA 4KHWA 3VF6A 2BZ2A 1Y64A 3VQ5A 3S8SA 4F3OA 3KD1E 2AU0A 3NG8A 4K4YA 4DV2K 4CLZA 3CPWR 1V3ZA 4NLOA 1DHMA 2FHJA 1GXTA 3DRYA 2DRBA 4CJWA 2KI2A 1V3RA 1RWPB 4DL2A 4TLRA 2Z4PA 3VMFB 5CHCB 1WOPA 2YWFA 2G8VA 5DM7Q 1HPZA 4HLBA 1FJGF 3A8KA 1CJTB 3WXJA 4B3MK 4BLGA 3MM9B 2B4UA 3KLIB 4UQGA 3MAQA 1HNXF 1WEXA 2DIVA 2YH1A 3T5KA 3HFVA 1T9YA 4NXMK 2ZGYA 3L3CA 3POTA 2MY7A 4TN2A 2IBOA 1S9EA 3QJLA 3VWSA 3EGZA 1HYZA 2JLEA 3CQ8A 1BA0A 4JAXA 3C16B 2JNJA 4OLAA 3P8BB 1V3SA 2J0XA 3R6GB 1TR0A 2ALYB 2NRZA 3T5HA 5KFBA 3SSRA 5BRDA 1RAFB 5CY4A 4FK0A 1S10A 2HQCA 2WONB 3C14B 1U49A 1IBKK 2QSFA 2MHNA 2VDIA 4P72A 1SH3A 4Y1DA 5L9NA 2AJ2A 4FLXA 2X1GA 2OMLA 4NLXA 4QIVA 2ZD1A 1I39A 1G6BA 1NLKL 3BSCA 2VHGA 2HMIB 4LFCF 2NNWA 1X5TA 1BWFO 1HBOB 2RF2A 3VEYA 3CO0P 2PEBA 1X4DA 2W2NP 1EKSA 2KJWA 1A5XA 4DR7K 4LF9J 5J2QA 4YR3A 2HIQA 2UU9J 3G10A 4DU1A 4BGAA 1K8AO 3OVBA 4J5OA 2A2CA 1WHVA 4U7UK 3THTA 4DN9A 2XY5A 9ATCB 2GA7A 2W9BB 1RTIB 4LVOP 1QUVA 3C19A 2JL9A 2MPUA 2DFEA 1S1UA 2OTLS 5AFUH 1EWRA 1HI0P 1P8GA 2DH7A 4RL1A 2P9KA 3MAHA 3TJ9A 5GADI 2JFKA 3H4DA 1JLQB 3SCJE 4AM6A 4LF4F 2AV5A 2JH3A 4B9VA 2ZBIA 5B0DA 3UR0A 3TEGA 4ZVSB 4B02A 5J2MA 1PYOB 3VQQA 3GE9A 5DQIA 4PG8A 5HQ8A 2HB5A 3F2KA 5KGXA 2C3PA 4X64K 1O6XA 3D0PA 3LP3A 1U6FA 3KOAA 4YDDB 4DBQA 4B9LA 1E6VB 5GAHP 4CW7B 1OQ3A 1P1TA 1IKWA 2G8IA 2B5JB 4OHXA 1LOTB 3RMAA 1GMWA 5LSLA 4Q45A 1TU0B 5J1NA 2P9IA 4NXNJ 2ZH6A 1HW9A 2GX8A 5M1KA 3CB4A 5HQMA 3RB3A 1LV5A 3R9LA 4BR4A 3LWLA 5GAHU 3BGUA 5AQSA 1FCAA 1B7YB 5IC6B 2GW8A 1BIUA 1BCMA 3OT9A 3BKUA 3CJ5A 2CPEA 3MM8A 4MDAA 2M5YA 1NMNA 4CI0B 5GAEU 2IA6A 2B6AB 4KGVB 1BIZA 1OY6A 2PD1A 1VBKA 1FDAA 4XDDA 2KO1A 2QXLA 4YN3B 1T3VA 4ETZA 2VASA 3HJFA 3PRVA 4OX8A 1G4CA 1CLQA 4A59A 3R5CA 4DU7A 3SBMA 3T5JA 1C1BA 1NGJA 5AZJB 4CH7A 2CWXA 4CZHA 4C3KA 4GVBB 3HVTB 1SIZA 5IM0B 1RTHB 2FY1A 1D9AA 3OHRA 2YNHA 4DUTA 3KNAA 2P9SA 1D9FA 4OKEA 1ZA2B 5A8WB 3OYFA 3GU0A 3HJVA 3F44A 1LW2B 3LDOA 1OIAA 2OTLN 2W42A 3D3CJ 2DHGA 4OYAA 2NPIA 4ZLNA 2VONA 2ATLA 3M2RA 2NZ4A 1REVB 2HFZA 2W24A 1T8EA 2IDLA 1RT3A 3MEEA 2JLFA 4PXDA 3TAEA 3K2PA 2EC0A 4EMDA 3LA0A 3V81B 3AOBA 5LJWA 1PKUA 3I4PA 4ILLA 1KVKA 3QT7A 3SAFA 1U0HB 4B3OA 4RCHA 3LGNA 1Y3JA 5JS2A 1LWFB 3W3SA 5CYMA 5AQMA 4CBUA 1Y00A 4B3SF 4HDGA 1KD1O 5BR9A 2QWLA 2IA0A 3HK2A 1K47A 2YXLA 3R5DA 4RUAA 1DKGD 1FESA 1X4GA 3VQSA 3BF1A 1L5UA 3NWRA 5DGBA 1WB9A 4ZHRB 1RDUA 5ETKA 4JLHA 2ZJPQ 6FD1A 3Q8VA 4A8XA 4DB3A 1UEVA 4EYHB 4JYAF 4ZKAA 2C2EA 1DZ5A 1HNZJ 3VEXA 1A5WA 1TV6B 1WC1A 4C6AA 1BI4B 1YUWA 4DR1F 2N4CA 3C7NA 3G25A 1CQNA 2NXUA 2J9CA 4L73A 3CHWA 3OUYB 1MROA 4HT7A 4B8CA 3IKMA 1VSEA 1DQAA 1HWUA 3HZGA 2OFGX 2P9UA 4FJIA 4U8VA 5ETSA 1NHKL 5BXIA 4KTWA 3A12A 1HBMB 4HR2A 1QVFM 3JS9A 4WE1A 2E20A 4IKAA 5DQHA 4RW8B 4I56A 1XI1A 2KHOA 3VOVA 4NMLA 3TQ1A 4LIWA 4QYZJ 3M05A 1UWAA 4CM2A 1NK4A 1U24A 2CGLA 4YUDA 1OSCA 1RGVA 3OFGA 1WEYA 4M5LA 1E6YB 2RHQB 4DG1A 1X9SA 4KI4A 1KCFA 5AZIA 5DJBA 5KPRA 2KFZA 4CJ4A 3JTPA 3JQKA 4U95A 1YDLA 2WSFC 4LY7A 4K43A 3VA3A 1QJHA 2DGVA 4K0KK 3V6JA 3DAWA 3IO1A 3G6ES 4FWSA 1PG5B 2AA4A 4DU4A 5E7OB 4ZLPA 2CQ2A 4RU9A 4UQTA 2D1CA 2N7YA 2VFUA 4JI2J 3D0HE 3S3NA 2KQ2A 1FO1A 1DY3A 2GTDA 2M0GB 4C0HA 2WVDA 3N01A 2ZC4A 2Y3YA 3ZSYA 2MQLA 4MIAA 2W6KA 4DV5J 2MGZB 3NFAA 5HROB 4JK9A 4X66K 4FP9A 2H51B 1HR0F 3EGVA 4AHUA 4FK4A 1NNEA 3K8WA 4CLPA 4DV3J 3F0NA 1WTBA 3OPKA 4MYTA 4JV0A 3TAMA 1GLEG 2A3ZA 1O5JA 3D6RA 5EOYA 1KTQA 1UWBA 1KTVA 4CZGA 5HP1B 3PFOA 4AILC 2O8EB 2WVFA 4WWSA 1U1QA 5AE2A 5K5MA 2Q3SA 3TRGA 3O5BA 2XGPA 1HBNB 3O9TA 2ZBRA 2Y0BB 1JKHB 2YWGA 5GAGI 3CJAA 2HVEA 3SK3A 1XNRK 2FSNA 1Q82T 5BYRA 1ZOTA 2ZNZA 3BKFA 1VQMN 1RT2A 1JLAB 3IA0A 3HP6A 3MXMA 2XWYA 4ITSA 2VQFJ 1TAQA 1RWOB 1VQLS 3D2EB 4QJVA 3T6JA 1TL5A 2ACMA 3OYEA 3FZHA 7FD1A 1EETA 1H6KX 1M5PC 1DTQA 4J9UE 4CO4A 1WAFA 3CGIA 2E9TA 3WX4A 4EZ9A 3IRXB 2R9LA 2B0GA 5HL7Q 2MTLA 3AD7C 4USVA 3GYGA 3MR3A 2XSJB 2V8HA 3G6XA 4Q2LA 3WC0A 3DU6A 2P6SA 4DTRA 3DRRB 2Q79A 2LECA 4P7TA 2BUNA 1VI7A 2LQ9A 3OXFA 1SQEA 1N5YB 2RAQA 2DPNA 3BJYA 5FPNA 4G9ZA 4K4WA 1T03B 2ZNYA 2A0FB 3NVMA 1PJ5A 1MWYA 2QL9B 4J9RA 1BMQB 5HLFA 3WDOA 4KHMA 4H4MB 3O6WA 3GYNA 5JVHQ 2WW4A 4CEAA 2Y8YA 3HBTA 2O4IA 1M5OC 3GZ7A 1URNA 4ZVEA 4JKEA 4PKGA 2GFFA 1FDDA 2HFUA 1NJXA 1FNXH 2UVWA 1DEJA 2F9TA 4DTJA 2ITMA 4AM7A 1R0BG 1QTNB 3ZX2A 2D0PA 2BOAA 2PI4A 3RRKA 5J2PB 2L08A 3UW1A 5B0CA 3HDSA 4NA3A 2BACA 4CLWA 4W5QA 3AO3A 2DPJA 4CGDA 3THWA 4HUEA 2H5JB 3M6XA 3NE6A 4DI6A 2LU2A 2KU7A 3KKRA 5BR8J 4DV5K 5HJXA 4ED3A 3Q2SC 3KJVA 3KLFB 2IC3A 1M5SA 4YORA 1LXNA 3N0VA 1RSCA 4DUZF 1VQLN 2B8PA 1VQPN 4CJ7A 2BVZA 5H9FK 3MM7A 1YT3A 5KGWA 2VFRA 3SJHA 1IKVA 4HTLA 4A5BA 1N32F 3M6GA 3D2WA 4CO3A 3RMBA 2YKNB 3L4IA 2Y1JA 2BV3A 1RYSA 2ZE2A 1HD0A 2EBGA 1IJFB 5KT6A 2RJZA 2V2QA 1UCNA 3GB0A 1GLBG 2HWHA 3WEEA 5KTQA 4KB1A 1P27B 1WKJA 1MU2A 4K5RA 4M5MA 1UW4A 1YK9A 1RBTA 2HSEB 1GXUA 1HQ2A 2RVJA 1NHUA 3OYDA 1UETA 1UP1A 4M5IA 1ZM9A 3DRXA 2R7YA 5LMUF 2H3EB 3C2PA 1I94K 3EJMA 2HRTA 4KRFA 4EAHD 2E2OA 3E2EA 4LF7J 3BQ2A 1KS2A 3J7ZT 3C6HA 2HBRB 2O8CA 2C3OA 1JJ4A 3FK4A 2C2KB 3UD5A 4FJ5A 4PG5A 3TOQA 4RBTA 2KM8B 5TKYA 1KKHA 1SUQA 2NXJA 4KAIA 2I1RA 4R25A 3L4QA 4CGFA 1N56A 3UVJB 1WHYA 2UUBF 4JRQA 1HI1A 2DB1A 2KHCA 4JI7J 1NJWA 1IVZA 4ATNA 2O8DB 3VA0A 1J54A 1ELOA 1NMDA 3FBEA 4AHRA 5HRRA 2BA9A 5AQFA 4A8OA 1CXUA 2PO4A 2AYMA 4ES2A 2HBKA 3W9JA 5C2FA 2P5VA 2FVQA 3DOKB 3GIKA 3M32B 1VOMA 3CIPA 3VAGA 2GGPB 3GP9A 3ILJA 2PN6A 3QIPB 1ZZNA 2H4YB 4UUWA 1VSFA 2GAGC 3P5JA 4E2FB 4YOVA 1XWLA 5DGAA 2QRRA 3I33A 3TVKA 2D1KA 3BB5A 3TR5A 1VCTA 1WHXA 2ASDA 2R2TA 4OI2A 4X4VA 2E2PA 3AHPA 3VENA 1FRHA 3MUTP 1URRA 3HSGA 2LFVA 4GKJJ 3EGNA 3QYYA 2Z1JA 3ULEA 1KC8T 1IO2A 2UV8G 5KFHA 2VL1A 3AA4A 3O4NA 3JTNA 3FR0A 5A2QU 1FE4A 3VEWA 2YX7A 4CDIA 5DM6Q 3NGTA 5C7PA 3J7YU 4G6VB 2VYPA 3C15B 4FJLA 1V4TA 2VPYB 2QO3A 4FJKA 1FXRA 2DR6A 2NREA 4RJVA 4Q43A 2DXFA 3EUNA 3A13A 3H3NO 1JLEB 2UXBJ 2FC8A 4ZMMA 1WKKA 2ASJA 4YHHJ 4JKGB 3SV3A 4RW6B 1DFDA 2QA2A 3Q8YA 3ZTPA 5M1FA 3DXKA 4FCYA 4CEDA 4RW9A 2CPIA 3DLLL 1RUSA 4PCQA 1CJVA 2YX6A 3JXUA 2CYYA 3GFZA 4TKTA 4DX6A 5BN9A 4CLUA 4DV0J 5DMRA 2RB7A 1R6VA 1RLCL 4ECVA 5KQ8A 1RBSA 3AO2A 3RAXA 3GLJA 4IH5A 3OYKA 2PEHA 2G9OA 3GG4A 3AVAA 2E1YA 5DLFA 3PW0A 3RZAA 1NSAA 5EU7A 3HVRA 5CXTA 1NWKA 5EWFA 1Q8LA 2F8TA 2YHXA 2RILA 3UWTA 3PW7A 4IR1A 5T14A 1T11A 4CFDA 4QOTA 4NL5A 2JSXA 1OVYA 4BC3A 1FHTA 3WQPA 1YITS 3AD9C 3THVA 1RA6A 4A8SA 4KY3A 5KI6A 3QJJA 2NUBA 2HZVA 2KN4A 3EICA 2ZOMA 3SCIE 3PX4A 1TL7B 2J0WA 1VSLA 3CC4S 2C42A 4LF8J 4WBFA 2KL8A 3BS9A 5JVGQ 2HBJA 5I42B 2F9DA 4Z94A 3PRBA 4OZ3A 3MR7A 4BHQA 4K8RA 2J9EA 3QGHA 2XZWA 2R8KA 5JLFA 2R8IA 5KG7A 4DPXA 5M1QA 1F60B 4X4RA 4QWCA 4K4ZA 5KPTA 3DM2A 4LF5K 1YVUA 3IFEA 3M1VA 2CNKB 1RBVA 3IC1A 1VQ7S 1HYSB 4DTNA 3KK1B 2B9XA 2FY8A 1IM4A 2JJ4D 2E7WA 1T44A 2PZSA 1AB8A 3ZTOA 2OMOA 4FPIA 4F9OA 4Q0BA 1ZETA 4W90B 1BUPA 5CD4H 3QICA 3C94A 4H5VA 4ANEA 2B51A 2K1RA 2VBZA 2I7PA 4M5DB 1R8CA 1U2VA 4XPCA 3HHLB 4BRKA 2HFVA 2V69A 2A1SA 4L3NA 1XNQJ 1EXQA 2KM8C 2WHOA 3DLHA 3KYLA 1RDDA 2HHHJ 2XULA 1BE4A 2LKZA 4DCPB 4B1WB 5SWMA 2BTFA 3SQ0A 5HMWA 2G0IA 4ZCKA 4DR6F 5C2DA 1J2VA 5KG3A 4CBXA 5I4MA 2OSRA 3L7PA 3VQ9A 2WB4A 3M9OB 1HQUA 2PDAA 3GIMA 2R8GA 2AJ0A 4N47A 2F4VJ 1AZSB 2EFQA 3KWMA 4MIWA 3B6PA 1FKPB 3I8BA 3UKUA 3G87A 3AJDA 2MJUA 5G0RB 2MQMA 4YOTA 2FJDB 1RQ0A 4IYQA 1CZ9A 3CFOA 5K14A 3NAHA 2I6WA 2E1MC 4C8YA 3MCSA 3UB5A 3HKWA 1VQ9S 1J5EK 1YITN 2VCPA 3QEVA 1C1AA 1RAJA 1AUSL 2ZKUA 3DDIA 4CFAA 2YKMB 1F2HA 3H25A 3WIUA 4BRCA 2YV0X 3SMPA 3N5BA 4JI6J 3CC4N 5F8LA 3L2WA 2YVSA 1IBMJ 4LIRA 5L1KA 4ED7A 1O13A 5CYQA 3C6UA 3ZYYX 4CP5A 4OHVA 1HJRA 2OYQA 3DFEA 3P38A 1JLFB 3LPTA 5J1EB 3MCPA 3DLKB 2HBMA 1XC3A 4DX8H 4I67A 1XMOJ 4V19J 3O4WA 2MSSA 1VQ7N 2NRVA 5K8NA 5LT5A 4Q7AA 2JWNA 1UTAA 2HBYB 4PHTX 2YQ3A 2KTQA 4NLPA 2EKYA 4A61A 2B56A 4WYBA 3RYLA 2M3DA 4DPUA 2X7IA 2LQ8A 4M3YA 1BO5O 3KJFB 4LH4A 2DT9A 4XAKA 4Z4CA 1FE0A 2WCXA 3OY9A 3I56N 4H8KA 1A6LA 3LP0A 3ZNJ1 4EEYA 4ZP8A 2PGCA 4I64A