4H4MA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
548
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 135
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4mA05
4IKAA 4EZ9A 3TQ1A 4ECVA 4O4GA 4KHSA 2W8KA 4R8UB 4F2SA 4O3QA 4RNFA 1ZETA 3CO9A 1S1UA 1S10A 1U04A 1TQLA 3VA0A 3T5KA 4RG8A 4O4GB 4ZPDA 1RA6A 4ZP6A 1S1UB 4DLEA 1HARA 4CK1A 5KRSA 1U09A 4LSNB 2J6TA 3KMSA 1FKOB 4FLYA 4E7LA 3L2VA 3PX6A 1JKHB 4DQIA 1YTUA 3JYTB 4EO6A 2ILYA 2ZQBA 3QEWA 4E1MA 2YKNA 1BQMB 1BIZA 2FVRA 4MKAA 1D9DA 3NH1A 3I0SB 5KT2A 2IBKA 2G8KA 2RPIA 4BE1A 3DLHA 3K58A 4GMJB 3NGZA 1IKXB 1IKWA 4NLUA 5F8LA 3D5MA 4O44A 5CYMA 2B4JA 3QLHA 4M3TA 1IKWB 4F3TA 4K8XA 4Q45A 3T5LA 1LAWA 4F8RA 4CEQA 4O44B 5CYMB 4ED0A 4K4SA 3B6PA 3OJUA 1REVB 3PW7A 1IH7A 3MXJA 2OH2A 4FJXA 1KHVA 4DFJA 3K5NA 3DRSB 4KKOB 2HHXA 2E9TA 1S1VB 4KB1A 4B9VA 2G8IA 4ECUA 4NRUA 4YR0A 4B9MA 1S0OA 3CYMA 4FLTA 1WSEA 3GIKA 4O5BA 2VWKA 2R7YA 3AV9A 4K50A 3SV3A 4K8ZA 2QV6A 4RW9B 4MH8A 4NLVA 3TAQA 4CHOA 1NOYA 1EETA 4CEFA 1TK8A 2PY5A 3ULDA 4FJLA 1HMVB 4TSXA 3AO4A 3CDEA 4DFPA 3IRXB 3HVRA 1QSSA 4W5OA 4RUAA 3TAPA 4Z4GA 1HNIB 3M9NB 1HRHA 4K4TA 1KVCA 1JLGA 2QE5A 2VWJA 3ZT3A 4ZPAA 2G8VA 3HYFA 2O5DA 3UIQA 3DLEA 4M3XA 1TKTA 1Q9XA 1JLGB 1RT2A 4RUCA 3HPOA 1EXQA 4OJRA 3LZJA 4G3IA 4FXDA 4DTXA 2I1RA 4HYKA 4J9NA 1C0UB 4FK0A 2D0AA 1TKTB 5HRPA 2BR0A 1S0NA 4HHTA 1GX6A 1VSLA 3NBPB 1DTQA 2V0NA 5KFIA 4WXWA 3QEXA 4FJHA 2OZSA 3QZ7A 3AA2A 4CJ4A 3ITHB 3T3FA 1ITGA 4B8CA 1NK5A 1D5AA 3H08A 2OPSA 1RT7A 1T94A 1GOBA 3DYAA 3HL8A 3L3UA 1U45A 1RDRA 2WHOA 4WYWA 1XI1A 1LW0B 2B6AA 4HTUA 1FKPA 2OPSB 3KKSA 1RT7B 2G8UA 2R8IA 3DYAB 5HBMA 1UWBB 4FCYA 5HRNA 4RU9A 3KLVA 1B9FA 3DLGA 4ID5B 3OYHA 3FQKA 2PYLA 3QGIA 4FJMA 2GIQA 2UVRA 5KGWA 3HHKA 5CZ1A 1TGOA 2VG5A 2CJQA 2IGIA 3C6UA 1QTMA 3KMQA 3MR5A 2YKMB 1S9EB 1LWCB 5EU7A 4H4OB 3SI8A 3C6TB 2IMWP 2VG5B 4IOBA 4QOZB 4BWJA 4CF0A 3V6KA 4H4MB 4O3SA 3AVIA 4TYBA 3LAMA 3NGIA 5F8MA 1NJXA 1T7PA 3OL7A 3QIPA 4HUEA 2KFNA 1WNEA 4ZPCA 3WNEA 4OGCA 1C2PA 4ECXA 3S9HA 5F8NA 1S6PB 2WRMA 3KD5E 2Q3SA 4M45A 1GOAA 4JV1A 1I3AA 4TY8A 3CM5A 4FW1A 5FROA 3SNNA 3GV7B 4DTPA 3PX4A 4ID1A 1S9GA 4MIBA 1RTJA 2BE2A 4TY8B 4ED7A 4IRKA 1UA0A 5FRNA 3VQSA 4CEZA 3BQ0A 4EBCA 3VQ5A 1T03A 2BGGA 2BE2B 4O3OA 2C2EA 3HVTA 1Y97A 2FVPA 2WK4A 4LSLA 4PWDA 4EBDA 4CFBA 3CIZA 3BJYA 2FJVA 4K4WA 4ZVFA 2XY8A 4CEOA 4Q0BA 3E01B 3EY1A 4ECSA 3HKWA 5KG1A 3S3NA 3GV8B 3EZ5A 4Q0BB 4O3PA 4CEDA 4RZRA 3TR8A 3OJSA 4KBIA 3EPGA 3V6DB 4NLSA 2ETJA 2AQ4A 3EZUA 3KK2A 1C1AA 4KHUA 4RNNA 2DY4A 3GYNA 3Q8PB 3EPIA 4FLZA 3DDKA 2ZD1A 3KK2B 2R2UA 1NJWA 3QO9B 3RWUA 1JIHA 3NGDA 2YNHA 4ICLA 1KRPA 5J1EA 1B9DA 3V9UA 5HLFA 2Z1IA 1WSIA 3KLIA 3DLKB 4CCHA 5J1EB 4CEEA 5HRRA 1GOCA 4C8OA 3CM6A 4JRPA 3CFRA 2HNDB 3KLHA 4FYDA 4MIAA 3OYIA 1SL1A 3AO5A 1KHWA 1JX4A 2IA6A 4O0JA 1SKSA 5T7BA 2RN2A 4DSJA 4MQ3A 3ALYA 5DG9A 2F8SA 1X1PA 4DS4A 1SH0A 3NF7A 4BWMA 2VA3A 4N41A 1TKXB 2F8EX 4BDZA 3JSMA 2ZE2A 4ZP7A 4CJPA 4F4ZA 4FJ5A 3IG1A 4K4VA 4U7CA 2DFEA 4I7FA 1ZBFA 1JLFB 4EP4A 2QKKA 1S9FA 3V4IA 3H4BA 3V1QA 1TP7A 4GVMA 2WOMB 2R8JA 2G8HA 4KHQA 3MEEA 3DRPA 2YNGA 3VQ9A 4CGIA 3V9WA 1XHZA 4WXOA 4YQWA 5K14B 5F8IA 3QNNA 2ILZA 3MEEB 3DRPB 5J2MB 4IH5A 4DU3A 3CVKA 2D7SA 5KFDA 3MEGA 1TKZA 3PV8A 3I0RA 3M8PA 5KFVA 4U6PA 3L2QA 3TAGA 3HP9A 2ALZA 1NJYA 1TKZB 3I0RB 5JS2A 1QUVA 3CFPA 3U6FA 3QINA 3G10A 2HHQA 3TARA 4K4YA 2R8GA 1D9FA 4OKKA 2IC3A 3L2WA 1JXLA 3QNOA 5KRTA 1S49A 4ECQA 3PR5B 4M94A 4OKEA 4J9OA 3B6OA 4CJ3A 2HMIA 1RYRA 4CJWA 3SUPA 4J2EA 4Z4IA 2HMIB 3FQLA 3NGYA 3OYDA 2HNYA 5EWEA 4DQSA 1HJRA 4J2BA 1L5UA 4KTZA 1RTHA 2AU0A 2JEJA 5C42A 3UDLA 2HNZA 4ED2A 3BSNA 1S6QB 3LZIA 4M95A 2FJWA 4OLBA 1LWEA 3I5CA 4PY5A 4J9QA 1RTHB 3AVMA 4YMEA 3RMDA 3SQ0A 2D5RA 4DL5A 5I42A 4J9SA 4FZZA 4QWEA 1JLAA 4NZ0A 3DOLA 1K1SA 2FLPA 4PA1A 3IN5A 4CECA 2W9AA 3NHGA 1DTTB 5KG6A 4IFVA 2YV0X 3HM9A 2OPPB 3F73A 4NLDA 4FJGA 2XWYA 5FDLA 2BRLA 1X9MA 4Y1DA 4F4KA 3BREA 4AILC 2VG6A 5DLGA 3VA3A 3KK3A 4RW6A 1TL3B 2B5JA 5KFOA 1S1WB 1VSMA 3ISNC 5FDLB 2UVUA 4B9UA 3QEIA 3VQ7A 4R8UA 4EO8A 4FLWA 1YVUA 3DMJB 4FZYA 4YP3A 2B5JB 1BHLA 4I9LA 1JL1A 2C22A 4R0EA 5DQGA 4XPEA 2J6UA 3IGVA 3ZSOA 4LSNA 3H5SA 1CSJA 3CDUA 1FKOA 4BE0A 3KLEB 3SYZA 3BDPA 5T14A 3PX0A 1JKHA 1FK9B 4Y3CA 2YHAA 3QEVA 4CGDA 3ZT1A 3JYTA 4KFBB 5KFFA 3RRHA 4WZMA 3PW0A 1BQMA 4QPXA 1J5OB 4IBNA 4NLTA 2FBVA 3I0SA 3LP2B 1QHTA 1JXBA 1A5WA 5JS1A 5KG2A 1QE1A 1IKXA 1T3NA 2JGUA 4QWBA 4JS4A 3TAMB 4CEBA 1QE1B 4YFUA 3TANA 4J9KA 3U3YA 1C6VA 5J2PA 1TV6B 4EYIB 1REVA 3U3GA 5J2PB 4EEYA 1QAIA 2Z1GA 2WB4A 1T8EA 4N47A 4ED8A 3I8DA 3DRSA 4KKOA 1S1VA 2W8LA 4KHNA 3OVNA 1NK6A 3KOAA 1N6QA 4N5SA 3NMAA 3KHRA 3H59A 1VK0A 3CFOA 4RW9A 1N6QB 4IDKB 4WFYA 4HUFA 3LP0B 4G1QB 4FBTA 4OPJA 1D8YA 3H5XA 4TN2A 3QGHA 3LPTA 2E4LA 2DTUA 1ASUA 4AHTA 1HMVA 5KFQA 3ZSRA 4CHZA 3SQ2A 4TYAA 4WZQA 4CGJA 4E89A 3IRXA 4KHMA 1RT3A 4KPYA 3DM2A 4CJTA 5KFSA 1UOCA 2YNIB 2AWZA 2XCPA 1WSFA 4KO0A 1HNIA 4FM1A 3AVFA 3MXMA 1RT3B 4O4RA 3DM2B 4DF4A 1TK0A 4OLAA 4CJUA 4I2PA 2JEFA 3RTVA 2WONA 4KO0B 4M41A 3VQQA 2GUIA 4AH9A 3PVXA 4DTNA 3NF8A 4B8AB 1SV5B 3H98A 4I2PB 2IM3A 2WONB 4NLXA 4C8NA 4HCBA 4XIUA 1C0UA 3H4DA 1BCOA 4Y1CA 3K5OA 4KI4A 4NLQA 4FK4A 1RT6B 1RBSA 2BQ3A 4E1NA 3BSAA 3NBPA 3FFIA 1D1UA 3NAHA 3G86A 4YNQA 4E7KA 4NCBA 1ZBUA 3GILA 3OYFA 5DLFA 4CHNA 4DTRA 3FFIB 4O3RA 4CJ5A 3ITHA 4EZ6A 3O3FA 3SV4A 3V9SA 2IAJB 3H5UA 4JLHA 2C2RA 3AVHA 4Z0UA 4ELVA 4W5QA 2QXFA 3LALA 2DFHA 2UVVA 2IM1A 3SCXA 2C2DA 2HWHA 5HP1A 4JRQA 4MFBA 4W5NA 1LW0A 3D45A 3AVJA 1OS5A 3M9MB 4KRFA 1UWBA 4CJKA 1W25A 3DI6B 1A5VA 5HP1B 4MFBB 4DQPA 4Q5VA 1BISA 1L3UA 4ID5A 3HPHA 4NLWA 1HQUB 1RTIA 3OHBA 3BSOA 5I3UB 1HYZA 2FBTA 2AX0A 4KAZA 3BGRA 3QIDA 1XR6A 4DL7A 1RTIB 4K4ZA 3L8BA 1SL0A 2YKMA 1S9EA 2KFZA 1ASWA 1LWCA 5KFBA 4H4OA 1QSLA 3C6TA 4OPKA 4NLRA 4IH6A 3BGRB 1S1TA 2AGPA 4OVLA 4H4MA 2CKWA 3RMAA 1L3TA 2OA8A 2HVIA 1SL2A 1KVBA 3HJFA 1C1BB 2HHVA 4FLXA 4FJ7A 4ZVGA 1S1TB 3VQ6A 1N48A 2PZSA 4CHQA 3RR7A 3ZT0A 3MEDA 2KQ2A 4EP5A 4NCGB 3M8QA 5J2NB 1XC9A 5C24A 1BIUA 1VSJA 1S6PA 4LH4A 2W9CA 4ZPBA 3MEDB 3HVWA 5KG4A 3FSIA 3M8QB 4HVJA 4QW8A 3T5HA 4O3NA 4CESA 5C24B 2F8TA 1X9WA 4NLPA 2W9CB 4CK3A 3PR4A 1QS4A 4TQSA 1U47A 2R2SA 3AVKA 4DMNA 3P83D 3BQ1A 3PJWA 5EWGA 3G6XA 1S5JA 4CERA 1N4LA 2HW3A 3UR0A 2YNFA 4JUZA 2FVCA 2HHSA 1QAJA 4DG1B 3NCIA 3KK1B 2JC1A 3WNHA 3SUNA 2E9RX 2XGQA 1JXEA 4ZVEA 2YNFB 4CHYA 5CZ2A 4CE9A 3ZSZA 2RKIB 3OYBA 5KT3A 4RW4A 3ISND 4O0IA 2XGPA 3E01A 4F4YA 3QETA 2RF2B 4NCAA 4KE5A 5C25B 2QK9A 2IM2A 4QWDA 4E7HA 4RW4B 3I5AA 4YR3A 3WNGA 1HYVA 4RW7B 3MFIA 1XHXA 5L1IA 3N6LA 3V6DA 2XY6A 4KTWA 4TLRA 4Q8EA 3IGNA 4E19A 3SPZA 4CJVA 1NOZA 3VQEA 4DL3A 4Z4HA 4B9TA 3T19A 3RBEA 5J2QB 4ZTFA 3QO9A 2OZMA 1ZYQA 4DS5A 1KLMB 5C5JA 1U4BA 4ECWA 3DLKA 5D3GA 1K1QA 1WN7A 2X78A 4NLYA 2HNDA 4W5RA 4URSA 4ZP9A 2LSNA 4BDPA 3RB6A 2KZZA 5D3GB 5KFRA 4DSLA 2OPQA 3V1RA 4JV2A 4OL8A 3MR2A 3CWJA 3ZSVA 4DL4A 3SFUA 3BSCA 5KFCA 2OPQB 1VSIA 1TKXA 1Z25A 2GC8A 4IG0B 4QW9A 3KIOA 3ZT2A 1DLOB 3RB3A 4FW2A 2V4RA 2BANB 1T05A 4I2QB 3NAIA 5DGBA 1XR5A 3ICLA 4OGEA 1RTDA 4F50A 3SZ2A 3GV5B 5HROA 4FZXC 1BQNA 1JLFA 3KTQA 4CF8A 2ASJA 1T05B 1LW2A 1WAFA 1JLBA 1RTDB 2WOMA 1N5YB 1BI4B 1WLJA 4CJRA 5HROB 1BQNB 3PZPA 3ASMA 3NH2A 2BQUA 2ASLA 4CFCA 2W42A 1LW2B 1JLBB 3C95A 1TKDA 2R8KA 4IG3B 3TAEA 2HHUA 3ZSQA 2C28A 5K14A 5J2MA 1HQEA 3TAFA 1VSEA 4ZP8A 1JLCA 1QSYA 4NYFA 5L1KA 4Y34A 2IJFA 4RW8A 3CJ0A 5E41A 4O55A 2FLLA 1HQEB 1NK4A 4NLGA 3HK2A 4CF2A 2FC0A 3E51A 3LDSA 4N76A 2P5GA 1JLCB 4CGGA 4CF9A 1I6JA 5HRSA 1MMLA 4RW8B 3TI0A 4PQUB 1ZBIA 3N6MA 3LAKA 4IFYA 3PW5A 4L8RB 1TAUA 3O4NA 3VN5A 1RT5A 4C8LA 3GIIA 4IFYB 4RNOA 4KI6A 4NYNA 3I5BA 1RT5B 2X6NA 1Z4UA 3LANA 3NH0A 1WSHA 3VQ8A 2JEGA 4URGA 3THVA 2E9ZA 5KFKA 2JC0A 2XHBA 5KFXA 4GC6A 4LH5A 1KFSA 4AHCA 3Q8RB 1NK9A 1XWLA 1SH3A 1KTQA 3AVNA 5SWMA 3N6NA 1RBRA 2AX1A 1S6QA 3OS1A 4RNMA 1S0MA 1HNVB 1NHVA 4IRCA 4TQRA 1LWFB 4CGFA 3A2FA 2FJXA 1FXXA 1U49A 3KHGA 3RAXA 4CIGA 4PUOA 3NF9A 1U48A 4DTJA 3SUQA 4ZHRA 4CFDA 1DTTA 4PUOB 5KT7A 2OPPA 4B3OA 4CJSA 3H5YA 4LD0A 3VQBA 4ZHRB 1S1XB 5DG7A 3HT3A 4B3OB 1I39A 2BRKA 3K2PA 5KFGA 4CIEA 1NHUA 2V4QA 3MAQA 1TL3A 2UVWA 1S1WA 5F8HA 5KFPA 1RDAA 1RNHA 3SI6A 3DMJA 1A5XA 1RT1B 2EX3A 4B9NA 4K4UA 1NK0A 3P5JA 1RT4B 4DTOA 4BACA 4WFZA 1S48A 3T1AA 2ATQA 1VSKA 3HVAA 3QESA 1B92A 1JLEA 3K5LA 3OL8A 1ZBLA 4Q43A 3KLEA 3GQCA 2XY5A 1FK9A 1JLEB 3AVLA 4W5TA 4F2RA 3AA5X 3AO3A 4GW6A 3OYGA 3K57A 4KFBA 4XO0A 3CJ2A 2PYJA 3T5JA 1NKEA 1CXQA 3MECB 2I5JA 1J5OA 3LP2A 4TY9A 3AA3A 2EC0A 1ZTTA 2JEIA 5KT4A 2I5JB 1D0EA 4FK2A 4KREA 1F21A 3DLBA 3VQ4A 3TAMA 5KI6A 1W0HA 4ECTA 4C8KA 3Q8QB 1RDDA 2QKBA 1VRUA 2RDIA 4YR2A 2WTFA 3VQCA 3NFAA 1VRUB 3CDWA 4HCCA 1TV6A 3MR6A 3PHEA 4CF1A 1EKEA 3TABA 3OLAA 3OYMA 3OYCA 1NNDA 2UUWA 4OKJA 1XR7A 2IJNA 1WAJA 3HSTB 2YKNB 4XPCA 2AJQA 1SH2A 4QWCA 5F8GA 1WSJA 4AHRA 2R8HA 4DWIA 2E6LA 1JL2A 3S3OA 3DOKA 3O3HA 2KW4A 1KCFA 1J53A 2HHWA 1RAJA 3G0ZA 4IDKA 2R2TA 2XC9A 3LP0A 4MKBA 3DOKB 1Z26A 4FJNA 4G1QA 2UUTA 4DL2A 5KT6A 4DEZA 2OPRA 3LWLA 3V6JA 1RCHA 4WE1A 3QLHB 2A1RA 3HXMA 1ASVA 4LY7A 1TK5A 1L3SA 4DTSA 2OPRB 1YT3A 4KHWA 4WE1B 2HB5A 4J9RA 4DTUA 3DLRA 4FLVA 2A1SA 3CG7A 2W7PA 2OYQA 3NE6A 4CJFA 2Y1IA 4M3ZA 3NKYA 2YNIA 5CY4A 4FJ8A 5EWFA 4FJIA 4UQGA 1R0AA 4N56A 4M3UA 3ZT4A 5KGXA 4ECRA 3TWHA 2XCAA 4DFMA 5DG8A 1R0AB 4KB7A 1RA7A 1SV5A 1LV5A 4M3YA 3RAQA 2JLEA 5KG3A 3LWMA 5KFYA 4URQU 4J9LA 1IO2A 1EETB 3QEPA 1RT6A 1O1WA 1RILA 1VSHA 2ITGA 3LP3A 4LQ3A 1G15A 3H40A 3HO1A 5DMRA 3PW4A 4Y2AA 2FLNA 1CZBA 3AA4A 3RRGA 4QAGA 4CK2A 3AVCA 2IAJA 1NKCA 4KSEB 3KLGA 3OYKA 4HKQA 5DK5A 3HP6A 4NYZA 5KFUA 4ELUA 4ED6A 2R2RA 3KJVA 3V81A 3DLEB 3GIJA 1IM4A 3KLGB 2HVHA 1RT2B 3BR9A 3SPYA 1RDBA 3DI6A 3PO4A 3RR8A 3KJVB 3V81B 1NK8A 2VA2A 1HQUA 4QWAA 1J54A 3AVAA 5I3UA 4FS1A 2GIRA 4DFKA 3OS2A 1DTQB 3OL6A 4I9QA 3V1OA 3Q8SB 1LAVA 5EUHA 2Z1HA 4WYLA 4DL6A 4C8MA 3AVGA 4J2AA 2P1JA 4DTMA 1X9SA 4E0DA 3S3MA 3IAYA 1C1BA 3PO5A 3LPUA 4IQXA 2B43A 1C0TA 3ZSWA 4Z4EA 2D3ZA 3OSNA 5JUMA 4KHRA 3RBDA 1KVAA 2HHTA 2B6AB 4NCGA 5J2NA 2Y1JA 1FKPB 4IR9A 3NL0A 5HBMB 5KFAA 1C0TB 5KFMA 4Z4FA 4DLGA 1YVFA 4ZTJA 3DLGB 3MR3A 3SQ4A 4AHVA 4M3WA 4KV8A 3OLBA 3MFHA 3QGGA 5KFZA 4CJEA 1SUQA 3QYYA 4NLOA 2IOCA 4AHSA 2ZKUA 4RNHA 2J6SA 1W9HA 4KV8B 4DSKA 3C6UB 2XO7A 1SUQB 4J2DA 5DQIA 4ED3A 1RDCA 3UPFA 2G8FA 3KNAA 5KG0A 4DG1A 2DPJA 3KK1A 2W7OA 1JLQA 4CJLA 1TVRA 3WNFA 4CFAA 3QIPB 1SKWA 3NDKA 2XI2A 1WSGA 4DSIA 2RKIA 2FVSA 2V9WA 1JLQB 1TVRB 1BGXT 2IM0A 4FBUA 2GV9A 4FJ9A 2W9BA 5CYQA 1HYSA 3PY8A 5F8JA 3OY9A 3G6VA 2RF2A 5C25A 4J9MA 1Q8IA 1S4FA 2D0BA 2W9BB 5CYQB 3QIOA 1HYSB 4RW7A 2HWIA 2AGQA 3VQAA 2NUBA 3NF6A 2D41A 3OS0A 1S9GB 1RTJB 5KTQA 5DGAA 1J9AA 2AGOA 4GC7A 3RB0A 4QCLA 2VG7A 4Z4CA 1T03B 2GBZA 5J2QA 3F9KA 3OYAA 1IG9A 4BDYA 3SQ1A 1BCMA 1KLMA 1GX5A 3V6HA 2VG7B 3CJ3A 3HVTB 4IR1A 3O3GA 1RBVA 3HPGA 1UAXA 4LSLB 5DQHA 1VSDA 4PWDB 3KHHA 1EX4A 5KFTA 3OL9A 1VRTA 3RB4A 2D0CA 4F4XA 4E7JA 1KFDA 1VRTB 1C0MA 3OYJA 4IH7A 3SFGA 4HUGA 3ZSXA 4F4WA 3LP1A 3PW2A 2HAIA 4IG0A 4IRDA 5SZTA 4CJQA 1DLOA 4FM0A 2BANA 4I2QA 4DSEA 3LP1B 4ZMMA 2ZD1B 3V9ZA 3KLFA 2YHBA 3MXIA 1RBTA 5L1JA 3OYEA 2EHGA 2YNHB 4ICLB 1KLNA 1IKVA 5KFHA 3K5MA 3KLFB 4CEAA 1N5YA 2ASDA 1BI4A 5HLFB 4CIFA 3M8RA 4Q44A 3PUFA 3KLIB 4MK7A 2KTQA 1NK7A 4FM2A 1IKVB 4DQRA 3KKRA 2DPIA 2BQRA 3UQSA 4IG3A 3KLHB 5F9LA 4AHUA 2KZMA 3OSPA 3V9XA 4DQQA 3L3VA 4MK8A 4NRTA 4Q8FA 2WCXA 4M42A 1CXUA 4Y2CA 4ECYA 3G6YA 1NJZA 3MF5A 1UA1A 3O4QA 5KG7A 5JXSA 2DFFA 1RBUA 4DSFA 5KFNA 4J9PA 2X74A 3IS9A 1BL3A 3JSMB 2ZE2B 3QZ8A 4F3OA 2X6SA 3IG1B 1YTAA 3DRRA 4KAIA 4PQUA 3IS9B 1NKBA 3D28A 4EYHB 4FJJA 3MTKA 2IS3A 4BE2A 3CJ4A 4I7FB 4FJKA 5F9NA 3DRRB 1TL1A 4MK9A 3V4IB 3SUOA 3RMCA 5KFEA 3BQ2A 3QERA 2E6MA 4K4XA 4LQ9A 2IDOA 1ZBHA 1TL1B 2YNGB 3AO1A 2Z1JA 4JS5A 1C1CA 1K6YA 3MEGB 4IKFA 1RYSA 3AVBA 3M8PB 1IKYA 1C1CB 3FRZA 3H2LA 4H54A 3OYNA 3VQPA 5EDWA 4EBEA 4B08A 4B9LA 4X2BA 1HNVA 1WNSA 3KD1E 2F96A 1IKYB 1LWFA 2O4GA 2G8WA 4E3SA 1Q9YA 2IC3B 3GIMA 3NAEA 4FLUA 5KFLA 4ED1A 3D0PA 5KG5A 1KSPA 5KFJA 4FS2A 1EP4A 2P51A 4DU1A 1HPZA 4H8KA 1S1XA 1S97A 5KFWA 3FDSA 3EYZA 1MU2A 5KT5A 1CLQA 3L2UA 1EP4B 4ECZA 2O4IA 2FVQA 5L9XA 1HPZB 2HNYB 4R5PA 2XY7A 1MU2B 4DU4A 3SJJA 2ATLA 2FBXA 5FRMA 4B9SA 2FBYA 3OHAA 5C42B 2HNZB 4R5PB 3M8SA 1L3VA 1RT1A 3C94A 4JV0A 1RT4A 4M3RA 2RDJA 3RMBA 2BDPA 3ZSYA 1VSFA 1LWEB 3PJXA 1QQCA 4ELTA 5I42B 1TAQA 4KB0A 1SKRA 3L2RA 3K59A 2P5OA 3VQDA 4TXSA 3AO2A 1JLAB 4KTQA 3DOLB 3ZCMA 4CGHA 5L1LA 4KHYA 1CZ9A 4E7IA 1N56A 2D3UA 3M9OB 4IFVB 2XI3A 3KHLA 3P1GA 2XRIA 4CHPA 1ZTWA 4WFXA 4FVMA 3CQ8A 4ZVHA 3OYLA 3CJ5A 3MECA 2VG6B 3TVKA 3KK3B 4RW6B 4DF8A
chains in the Genus database with same CATH superfamily
4BREA 3NCRA 4ECVA 1RP5A 2NXJA 4O4GA 4R8UB 3BB5A 4RNFA 4P9SA 3CO9A 3BP8A 3EUNA 4NXMK 2E1ZA 1C0FA 5C15A 3VA0A 4HR2A 3US5A 5IS2A 4O4GB 4FYXB 4X65J 4MLEA 4DLEA 4DR2K 1HARA 3SCIE 1U09A 4LSNB 1VQ9S 2J6TA 4ZCIA 2UUAJ 1FKOB 2YQ0A 3PX6A 3W2VA 1DT9A 3JQJA 1DQ8A 1YTUA 4QR0A 4CZGA 3J81O 1SIWB 3QEWA 3MM8A 2K8GA 3CCUS 4JI1J 4E1MA 1DQ9A 2YKNA 1BQMB 3I0SB 5KT2A 3OTOJ 3J80U 2E5LJ 3HSDA 2NRVA 1G4CA 2HBMA 1VGYA 2MQQA 1IKXB 1R59O 1DURA 3UNYA 5HMXA 1VQPS 4O44A 5CYMA 2YPYA 1H38A 4DV5F 3ZX0A 2B4JA 5LMNJ 4NEZA 1ZPWX 3T5LA 4O44B 5CYMB 1H72C 3GE1A 3B6PA 3JXOA 4TKTA 3MXJA 5GADI 2OH2A 3K5NA 1SS6A 2VWBA 1Q5VA 4B9VA 2K1RA 4YR0A 3W9JA 4FLTA 3MURP 1XMOJ 5E26A 3AV9A 1CG2A 3MGJA 3J81Y 1QZ5A 3J81j 2YKQA 3TAQA 3O3LA 4USHA 1ZAXA 3U4LA 4YOTA 2X1GA 3IFRA 1BLUA 1MG7A 4DU8A 3NRBA 2MKIA 4I6AA 1SJ1A 1U2CA 3IRXB 3HVRA 4M5NA 2HHHJ 2Y0SD 4DR3F 2KT5A 1XMQJ 5GAGI 4W5OA 4LSZB 2C2ZB 3B4DA 1FRKA 1WKJA 4K4TA 2Q66A 1KVCA 1CJUB 1JLGA 5ELZA 1Y5LB 3WZ0A 3ZT3A 4OZ0A 3BKTA 2O5DA 4GVBA 4LF5K 1QQMA 3TSUA 1TKTA 3PKMA 1JLGB 4M5IA 1RT2A 1EXQA 2HZAA 2XS2A 2JWLA 4HYKA 3BKFA 1TKTB 4ZLNA 1DKGD 3RSEA 3M1FA 2AYBA 4HHTA 1PO6A 1S22A 2VBZA 1DTQA 5KFIA 3RSEB 3A5OC 5CCLA 3GMGA 1VQON 3ITHB 4X4UA 4A8OA 2RQCA 1NK5A 1I3OB 3M2UB 5FPMA 2J9DA 3I33A 2OPSA 1RT7A 2VONA 3L3UA 1NNEA 1XI1A 2N82B 1YJWS 3CJRA 1CVJA 4HTUA 2OPSB 1RT7B 5HBMA 1VQ9N 3IWXA 1OH5A 4JYAJ 2QZ8A 2DR5A 5EX5A 3OV7A 4N8NA 3QGIA 5CZ1A 3ZC4A 1H7XA 2RQ4A 1SJ3P 2VG5A 5AQKA 2CJQA 2LCWA 4Z7YA 3M05A 4X84A 3MR5A 2GMHA 3CCUN 3TVZA 1S9EB 1RXOB 5AXLA 4H4OB 1N33K 2VC1A 2VG5B 4IOBA 3VV2B 4H4MB 3GJQB 4USVA 4CLFA 3QIPA 4HUEA 4E1JA 1SI9A 4Y28C 3DN9A 4ZPCA 4B3TK 1C2PA 5LY3A 9ATCB 3CF5L 1NU4A 4J37A 4YORA 1HR0K 1S6PB 2F8HA 2BOAA 2YBVA 3M7VA 3TWZA 6AT1B 4PXEA 3BBFA 2YWWA 4NZ7A 3TX0A 4FW1A 3CEDA 2HYIB 5FROA 2RU9A 1UFKA 3GV7B 1VHFA 4DMZA 4DV3F 4PYAA 2DR7A 4CVNE 3FLCO 4BRLA 4CEZA 4RUHA 3BQ0A 4EBCA 1DARA 5HN0A 1CULA 2J0XA 2BGGA 4PYDA 3DLJA 3I55S 5DRKA 4O3OA 4FXWA 1CBKA 3M8YA 1Y97A 4B1YB 1CULB 4GO7X 5DDQC 2GWKA 4EBDA 1W7AA 4K4WA 2GVZA 2A18A 5IWAK 4ECSA 3IBFB 5LT5A 3N01A 3L7OA 3OUYB 3GV8B 3D3CJ 2UV8G 4GV3A 3EZ5A 2NYHA 3UO0A 3OJSA 4NLSA 2RVJA 1M5HA 2DY4A 3Q8PB 2YY3A 2IVNA 4P2FA 1FF2A 2R2UA 4QYRA 2DH9A 2C3OA 4ICLA 3ADAC 4TU9A 4GVEA 5J1EA 2AJ0A 4LRCA 3BGFA 3I4PA 3GJRB 4WU2A 1ROFA 2Z1IA 3KLIA 3DLKB 4WFNL 4CCHA 3HHEA 2F63A 5J1EB 1GOCA 2P6SA 1H2UX 2WSCC 1UJ6A 3AODA 3UVJA 3N5BA 2IA6A 1JX4A 3AO5A 4O0JA 3P8BB 5DG9A 2F8SA 1X1PA 5B0BA 2HQFA 2QMUB 4U96A 4BDZA 4ZP7A 1HW9A 4FJ5A 3IG1A 2YWKA 3U1MA 2CQ2A 1RBOB 3F41A 3I32A 3HSJA 2BABA 2WVBA 5HVHA 4LF8J 1S9FA 1Q7YT 3V4IA 1O6XA 1YJWN 3V1QA 3TZZA 4GVMA 3S8SA 3Q8VA 3MPYA 4H5NA 1ACMB 4GRSA 5A6WA 3VQ9A 3THTA 2GQQA 4CGIA 4QIVA 5M1FA 1KXPA 4KGKA 4YQWA 1HUXA 1S4EA 2BMBA 5IV3A 1WDDA 2PMWA 2D7SA 1MWMA 3VR1A 3BPDA 1I94K 1R8BA 2AIRB 1ZZFA 4M63A 3MN6A 3L2QA 1YLXA 3TAGA 2RMLA 1RAGB 1NJYA 2CUYA 4EIAA 2VOPA 1QUVA 4YB1P 4CJ7A 3G10A 1IV0A 2DITA 1D9FA 3VTIA 4OKKA 1RE1B 4WFAL 1OQ6A 3MAAA 3SBGA 4OKEA 2OMOA 3JSRA 4CJ3A 3BM7A 2LDYA 3GYGA 4CJWA 3T9ZA 1N36J 2KB2A 4A8MP 2UXDF 3NGYA 4LC9B 2ROGA 4KGXB 5EWEA 5C12A 4RR5A 1WELA 4KTZA 1NB2A 3GZ7A 2HRYA 3UDLA 1KOHA 2AEMA 4OYBA 3BSNA 3BUZB 2QL7B 4M95A 2FJWA 2GEMA 3I55N 1LWEA 3I5CA 4C4WA 1FRMA 4NZ6A 4YMEA 3FSXA 3AD7C 1RHJB 1IBLJ 2CQDA 1OY9A 3I82A 4NZ0A 3DOLA 4PA1A 1PSDA 3R2DJ 2PN6A 3EVOA 3E1YA 2CQ1A 2YV0X 5GVQA 1NZ8A 3EXYA 3NEKA 3F73A 5A2QO 3FEYB 4FJGA 2XWYA 4FF4A 1QQNA 3DHXA 2ZOGA 1YF5L 4AILC 3VA3A 4RW6A 3UE5A 3ATUA 2VZ9A 1N34K 2B5JA 1S1WB 1VSMA 2UVUA 3QEIA 4U67Q 3QGPA 4YP3A 3ZO7A 4CP5A 3A1YG 2B5JB 2VUGA 4P7VA 5IC6B 1LOTB 4H5WA 4ITSA 5KQDA 3QMLA 4WTYA 1UETA 4BR7A 1CJVA 4OYPA 1IJFB 1NDLA 3W3SA 1JKHA 3PSIA 4Y3CA 2YWGA 2ATCB 1DHMA 3W63A 3QT6A 5AQMA 4PXBA 4XDCA 3FEZA 3HCXA 1GMWA 5T7LB 3O9SA 2CDQA 1KBRA 1RDWX 2VQEF 1N54B 3VENA 4JI7K 3RU0A 3LH2S 2YXLA 2JWNA 1P8ZA 3V4MA 2IYGA 2VYPA 3TAMB 4NI2B 1MA9B 3TANA 1X4CA 5ETPA 5CE3A 3CULA 1T95A 4JI4K 3CD6S 1V3RA 1QDUB 2Q31A 1NEEA 1RKJA 1UVIA 3PSFA 4JI5K 4EYIB 1IJEB 5TKWA 2AJFE 1BMQB 3ZTQA 2WB4A 3NS6A 5EX3A 1MN9A 3I8DA 3EN9A 4KKOA 3TA0A 2F9WA 2LA4A 3KOAA 3O80A 4N5SA 3NMAA 5HATA 4JV5J 2GWJA 3CD5A 2F4VK 3KHRA 2CRLA 2EC2A 2XLJA 1VK0A 5AJ3J 3JXUA 4HUFA 3PRVA 3LP0B 3R5BA 3QJJA 1EARA 5KPTA 3VAHA 3AD8C 1T44A 2IDLA 1KS2A 3FZBA 2JX2A 2DR9A 3ZSRA 3VGTA 4WZQA 4CGJA 3TNVA 4E89A 3BF3A 4I6MA 2AWZA 5HMWA 1XC3A 1NSAA 3W8PA 2IIHA 4IWVA 5F3ZA 3HHLD 4O4RA 1RWMB 1R3NA 1TK0A 1M5PC 1LKZA 3VCDA 3KJFB 4CJUA 4LF9K 2JEFA 4ES2A 2MQLA 4AH9A 1LXNA 4DPYA 3PVXA 4DTNA 3NF8A 2CJBA 3N4QA 2W2MP 3BV8A 2GHVC 2H4WB 7FD1A 4CRJA 1RHRB 4H4KA 3A8JA 4WIIA 5JVGQ 1NGBA 2OELA 2XEXA 3WQPA 1X3MA 3O44A 3G86A 2G2YA 1YITS 3I4HX 4WCEQ 1IM6A 4EZ6A 3PXGa 2IAJB 2BJ3A 2QIFA 1X0PA 1ZA1B 2DFHA 1KD1T 3POTB 2HWHA 4JRQA 2GX8A 2Z2LA 1FRIA 2ZOFA 3VAGA 3B8AX 1UFWA 4DUZF 4CJKA 1W25A 3DI6B 1A5VA 4DB3A 4DQPA 1PBUA 4FPRA 3UDVA 1Q81O 4O23A 4ID5A 1YSJA 3CMES 1X31C 3SMPA 1B0PA 1B0TA 3BSOA 2E8AA 5GADP 2FJBB 4H0TB 2AX0A 3HZEA 4BHQA 4KAZA 3QIDA 4QYZJ 1XNQK 1XR6A 1R8CA 4ZJLA 4DL7A 3L8BA 2X51A 2OD6A 2YKMA 1LWCA 2UUCF 7AT1B 1QSLA 1S1TA 3ZX2A 3PJ9A 1KVBA 3ZZZA 4FJ7A 1OH7A 2HRTA 1S1TB 2E1AA 1DGKN 1YBAA 3LPYA 5BYSA 1S6UA 5C24A 3QATA 2PAVA 2A40A 1EB0A 2FUG9 3HVWA 2VBXA 3ZEUB 3CD6N 3FSIA 4HVJA 4O3NA 4CESA 5C24B 2YQ3A 4NLPA 3PACA 2CPYA 5GAGP 5CABA 4A61A 3B4MA 3VF4A 3BQ1A 4FXVA 4Q2MA 4CERA 3M2VA 3UR0A 3H46O 4JUZA 3KK1B 3ID8A 5HL7Q 5MLCV 3SUNA 2BW7A 3UB5A 3ZSZA 4JI8K 3OYBA 2L48A 5KT3A 4O0IA 4YHHF 3CCMS 2XGPA 1UZHA 2AYGA 1KC8O 2D1KA 1KAXA 3L7PA 2RF2B 2HEKA 3I5AA 4YR3A 4H0YB 4LFCJ 4AQYK 1HYVA 1FKAF 2LXFA 1M5KC 3BGUA 4E19A 3SPZA 4CJVA 4DL3A 2R7UA 4Z4HA 2E2QA 2V63A 2HIQA 2GO8A 4ZTFA 3SK3A 2HQCA 2W25A 4DS5A 5ADXH 2FPHX 5C5JA 5GIOA 4B3RF 4DR5J 2I8EA 3OVBA 4ISFA 4IDHA 4A8XA 4NASA 2JRSA 2VPWB 1RTZA 4H0PA 2KZZA 4BDPA 3RB6A 2OPQA 2GJIA 1KKHA 5CYJA 2VHGA 4WF9Q 3BSCA 3D0GE 3MZIA 4H5TA 3C3LA 2OPQB 1Z25A 4AL5A 1ATSA 1YITN 2ZH4A 1DLOB 3RB3A 3BN7A 3ICLA 4OGEA 3GV5B 5HROA 4FZXC 3H0PA 1RAHB 3CJ9A 2VKRA 3OBIA 4BRMA 1S79A 4EWTA 5IC4B 5HROB 3P5BP 1W7WA 3ASMA 2J9EA 4K0KK 5L46A 2DGWA 1TKDA 2HHUA 3CMEN 1IG8A 2UXCF 2DNYA 1OYDA 1TMMA 1QSYA 4NYFA 4BS2A 2IJFA 4WKRA 5E41A 4X62J 4O55A 2ZJRQ 3FZKA 5AQUA 1YJ7A 1WACA 2HG4A 3LDSA 3OHRA 2IJRA 4CGGA 2WSFC 1I6JA 2AZ1A 2K3KA 3VEWA 2R7QA 3TI0A 4QS9A 1HLUA 3LDOA 2V7ZA 1TAUA 1UAWA 3O4NA 3VN5A 2LEBA 1RT5A 1SPBP 2A0FB 2E88A 3NGKA 1URNA 4K5RA 1RT5B 2X6NA 1Z4UA 3NGUA 3OQ2A 2EI5A 2JEGA 4URGA 2E9ZA 3DXMB 5GINA 4GC6A 4LH5A 4AHCA 2YX6A 1KTQA 4JKCA 4YOVA 4QIGA 3OS1A 1S0MA 3FZFA 4IRCA 4TQRA 1F5AA 1NGAA 5K9FA 5CHIA 3RAXA 4CIGA 5AQIA 3D2FB 7FDRA 5E0OA 1D3WA 2EG2A 4X4PA 4ZHRA 4I68A 2H3GX 4QR1A 3CCMN 3QAUA 2DNHA 4YDXA 3H5YA 2YCHA 3D67A 4ZHRB 1S1XB 4CNZA 3G6ES 1PIEA 2BRKA 5KFGA 3QT8A 3CERA 2LMIA 1TL3A 3ZZPA 2CGJA 1VQKS 3O9QA 2HLTA 1BC6A 1U0SA 1MMNA 2EX3A 4X66K 3P5JA 1RT4B 2LXUA 4LF4F 4BACA 2J7UA 1IBMK 1D9AA 3MD1A 3T1AA 3Q7BA 4DCHA 2XB2D 3D2WA 3GJSB 1B92A 2PBDA 2MKSA 3IM9A 2V34A 2ZHAA 4ZIWA 3ILOA 3KLEA 1HNXK 1TTHB 2M3DA 3GCXP 1FK9A 2DHGA 5LJWA 3TOQA 3AVLA 2FHMA 4W5TA 1F3VA 2DXDA 2D3O1 5BR8F 4NWBA 3PFOA 1UVKA 2I5JA 1FEEA 2ZWPA 5H9FK 4YDUA 3JQMA 2EC0A 1CJTA 2CVIA 3AJDA 1HD1A 2I5JB 3CXCR 1VBZA 4M5HA 3IR6B 3UKUA 1CJTB 2YH0A 3M6VA 1F21A 5D0GA 1ZBTA 4ZITA 2HS3A 1CS4B 4MIWA 2B9XA 3UKUB 3ZNUA 2B9WA 4OHYA 3Q8YA 3NFAA 4F0MA 3J7YI 2P9NA 3ETMA 1EKEA 3OYCA 4OKJA 4LBPA 1WAJA 3HSTB 4QWCA 2QTDA 2ZH2A 1C4AA 3ETOA 2QL5B 1JL2A 3T69A 1U8WA 1GMVA 3RW7A 4DR1K 4JAXA 2M2BA 1KCFA 2V5HG 4DV4K 2HHWA 2ZUGA 4IDKA 2XNQA 2XC9A 4CZCA 3S6EA 4LBIA 4FJNA 3EZWA 1RACB 3H2UB 4DEZA 2Q1LA 2PO4A 4WPAA 4C9DA 3ID6A 1YT3A 4KHWA 2APOA 4J9RA 2K7JA 1XEZA 2W7PA 1WBBA 1EWRA 4DPUA 4CJFA 2M70A 5LMNK 5CY4A 4P72A 5EWFA 3R2CJ 4Q2LA 4N56A 4M3UA 5KGXA 5AQXA 4KRWA 4U9RA 4C97A 5AQNA 2MLYA 2ZGZA 2D3OR 4MLHA 5DG8A 4KB7A 1RB0A 3PTWA 3A8IA 3LQVA 2RE2A 3W7BA 4ES3A 2U1AA 4I6YA 2UYTA 4URQU 1HI1A 2FY8A 3NNHA 3O8MA 1B70B 5BJRA 3QEPA 2WAQD 3G6EN 4OX9K 4LQ3A 3H40A 2QL9B 4CBUA 3SEOA 4ZDNA 2MKCA 3AA4A 2LU2A 5DO2A 3RRGA 2AYEA 4QAGA 4CK2A 1VQKN 1VHIA 3AVCA 4HH1A 3LDPA 2JNJA 2RUSA 3LM9A 2ZF5O 4DL0C 3H1QA 5C0YA 4NYPA 3N9UC 3BYPA 3HP6A 1NGDA 4NYZA 4ELUA 4ED6A 3KJVA 3V81A 3DLEB 2HHHK 4C0OC 1OY6A 2EK6A 1XTZA 5B0FA 1Z1ZA 5D4OA 3RR8A 3KJVB 3V81B 4DV2F 2IMOA 1YKWA 1NK8A 4JKDA 3KJNB 1HQUA 4NPOA 4QWAA 3THWA 3FCHA 4DX6A 2QRRA 4PWUA 8RUCA 2GIRA 1F9EB 3LPEA 3KG0A 4CH1A 1ZZNA 4I9QA 3THYA 3THWB 2QMWA 2O8DA 1CC7A 4F36A 2YTCA 3G8TA 2GQ2A 4J2AA 3UN5A 2P1JA 3QFHA 4DTMA 1BY9A 2BZ2A 2QA4S 1C1BA 1Q4RA 3PLAA 4Y0WA 1C0TA 1X9JA 2LQ9A 3ZSWA 1FJGJ 2D3ZA 4KHRA 1KVAA 1KQKA 1VISA 5J2NA 1JNRB 3VTHA 1V5VA 2FDNA 3NL0A 4HI2A 4A62A 1C0TB 5KFMA 4CYUA 3QDKA 4PL8A 2FHKA 3DLGB 4YOUA 2F3JA 3MR3A 3SQ4A 4C11B 4KV8A 3MFHA 4CYUB 1WEXA 5KFZA 5JVGL 4ZOSA 4CJEA 4OI6A 3UI3A 3IAS9 4G1IA 4AHSA 4UOFA 4KV8B 3C6UB 4WCEL 2CJXB 4LFBJ 3EDRB 2QLXA 4J2DA 5DQIA 4ED3A 3UPFA 3KNAA 1U0HB 5D77A 3NLCA 1F3FA 3KG4A 1Q86T 3TUJC 2UUBK 2MZSA 1E4GT 4LBHA 1UEKA 5GAEI 3IBCB 3O9UA 3ZZUA 5F8JA 3R9LA 3OY9A 1YJVA 3G6VA 2EVZA 4OFZA 4AM6A 5K8NA 1RBLA 1S4FA 2W7AA 3JS6A 4RW7A 1FTRA 2FY1A 2HWIA 2QG9B 4HDHA 3VVUA 3OS0A 4A59A 1RTJB 2XSFA 2VPZB 2A2DA 2ZM6F 3I87A 4DV6J 1FCAA 3OYAA 3GFXA 3J80Y 4OIXA 1KLMA 1WHXA 3CJ3A 4CO4A 1RDUA 4IR1A 2QO3A 1NZAA 1VSDA 4PWDB 3R1XA 3GFHA 1EX4A 5KFTA 3OL9A 4CO0A 4FOEA 2BJ8A 3PNIA 1X5SA 4IH7A 2FIUA 1NDKA 5AQFA 4HUGA 2D4WA 1TUVA 1RWWB 3SXLA 2NNWA 1FX2A 3M6XA 4FM0A 4I2QA 4OX8A 2G2OA 3V9ZA 2VQFF 1AFJA 4WQ5C 1REGX 3FGVA 2OO4A 1RBTA 3SJHA 5HL7L 4X64F 3D6TB 4WFBQ 3F56A 4CEAA 1BO5O 4OYXA 3LDQA 1MSWD 1V3SA 4LMZA 1OIAA 1NK7A 3UQSA 3C7NA 4IG3A 3V9XA 1RGIA 1NJZA 4JI0J 3ENBA 3MF5A 3C7NB 3O4QA 4NMLA 4DV5K 4DSFA 2RIJA 2Z2MA 2X74A 2H3EB 3SCKE 4LFAJ 2X6SA 3F2KA 1Q82O 4CI6A 3DRRA 1H0HB 4PQUA 4K2JA 2V67A 4ID8A 2QA4N 1R8AA 2DNMA 5F9NA 1P90A 4F25A 3DRRB 1N32F 1LFPA 3CT9A 3KWGA 4NXNF 3W3DA 2E6MA 2XLIA 4BRFA 3Q83A 1SC3B 2R7VA 2XS5A 1T3VA 2EEYA 3P45B 1FJEB 4LF8K 4WF9L 3L4QA 1K6YA 3CQYA 3Q89A 4B3SJ 3LGMA 1RYSA 2UXBF 3KJQB 2VL1A 1T0TV 1NB7A 2O8BA 3SQGB 1PYOB 2DCLA 1HNVA 1MW7A 2KN4A 1VQLS 3KD1E 4MDAA 1T6CA 4OV1A 3MX2A 3CXCM 5G0RA 5EN1A 4IQMA 4E3SA 2O8BB 1IN0A 2H5IB 4DR3K 2IC3B 3GIMA 3G71S 2JVOA 5L39A 4QS7A 2HQ3A 4DU1A 3HDSA 3CCES 5FLXY 2VOOA 5IT4A 3EDQB 5KFWA 1MU2A 1FDDA 5KT5A 1CLQA 2IHR1 4ECZA 2DNPA 2U2FA 4BRGA 4R5PA 2XY7A 1EAYC 3BZCA 1MU2B 2ZJRL 4FWRA 2ATLA 4B9SA 1FESA 3CMAS 2P9PA 1L3KA 4R5PB 3M8SA 1L3VA 4C98A 5CQGA 1HI8A 1NGJA 1Q86O 4DR7F 1RLCL 5I42B 2OEJA 3ENAA 2CQ4A 2Q0RA 3AO2A 1VBKA 3ZCMA 4GKJF 2LQ8A 1BUPA 1Q18A 4A8WA 4NXMJ 4LF1A 2AKWB 3N5FA 3HTVA 1IBLK 3BBCA 5J1NA 1TYQA 3MN7A 2DNKA 3M8WA 1VJQA 1QAYA 3FZLA 2Q79A 2R42A 4C0HA 4EZ9A 3MM6A 3TQ1A 4KPCA 4F2SA 5A8KA 3CC2S 4O3QA 4PAAA 2O66A 1ZETA 3TP2A 2MJNA 4GV9A 3T5KA 4RG8A 5A8KB 1O13A 2B9YA 4BC9A 1KP6A 4FF1A 5M1NA 5KRSA 3KMSA 1N5SA 8AT1B 4FLYA 1AROP 3L2VA 3VVTA 2QWQA 4DX5A 4WK3A 4LF7F 1TU0B 3JYTB 2ILYA 2ZQBA 3C19A 3D0HE 3TTDA 1HBMB 3NH1A 3FZHA 1IJJA 2G8KA 1N8RT 9RUBA 3DLHA 3F5TA 3BF1A 4MKYA 4JKEA 4FWKA 2L41A 4DV3K 5T41A 1KAZA 4PKGA 4NLUA 3D5MA 4BRCA 1B64A 3AQOA 1XN9A 3RAMA 4DV1F 2EFPA 1VQ4S 1RCOB 4LRBA 2CQGA 1LAWA 4BRIA 4F8RA 2A3ZA 4JI2F 3D6MB 4K4SA 1BHNA 3D54A 1Y3JA 5CD4A 1KHVA 4DFJA 5AT1B 2F9TA 1FD2A 3HF5A 2G0JA 2IBOA 3DRSB 1WF2A 4BCAA 1S1VB 2G8IA 4ECUA 2NXNA 4NRUA 3OVAA 2BV3A 1WSEA 3NG8A 3GIKA 4O5BA 1VQLN 4K8ZA 2QV6A 4RW9B 4NLVA 3UD3P 3G71N 2X1AA 4CHOA 4HT7A 2ZBIA 1PGZA 1E6VA 4YOEA 1EETA 3JSBA 4CEFA 4LF5J 3CCEN 2PY5A 4FJLA 1PILA 3FK4A 4TSXA 1CJKA 1E6VB 3CCRN 1AZSB 1F1BB 4FPBA 3H25A 3KUGA 4QBUA 4FWOA 1QSSA 1W26A 2FYXA 1OSDA 1CJKB 4RO0A 4RUAA 3TAPA 3PFEA 4JKGA 4GVLA 3M9NB 1HRHA 2RRBA 4S0MA 5JMVA 3CMAN 2VWJA 2QE5A 4CT9A 3GE9A 2G8VA 3TZWA 3UIQA 3EX7B 5IT0A 4PABA 1FJCA 5A8RA 1Q9XA 3HSZA 3LUYA 2XMMA 4RUCA 3O9RA 3FSYA 4FXDA 2I1RA 1B4SA 3EO3A 1WORA 1C0UB 1SJQA 3FRYA 3J7YP 5LXYA 4L73A 3GBTA 1GX6A 2HVZA 1VSLA 3NBPB 4ZLPA 1WHYA 4UY85 2J0QD 3QEXA 2XHCA 3WDOA 2UXBJ 2LKZA 3R6GB 2OZSA 1IWAA 3AA2A 4CJ4A 3T3FA 4B8CA 1UW9A 2NZCA 3H08A 2BM1A 3CCJS 2HZVA 3DYAA 3EM1A 4E98A 4DUYF 2CZ4A 2WHOA 2EBGA 1FKPA 1N33J 2BTFA 2W1BA 3DYAB 1HX1A 1UWBB 4PPDA 1FDAA 2FSNA 1TUWA 4RU9A 4UY8O 3KLVA 5IQQA 1GLJO 1ZM3A 1HNZJ 2L9DA 2GMLA 2XMUA 4OX7A 3OYHA 4FJMA 1PJ6A 5KGWA 2UVRA 3SBMA 4B3TJ 3SMZA 2IGIA 4BRAA 2F1FA 4HI1A 2Z0GA 4C23A 3C6TB 1FXRA 2Y8WA 2HFSA 2PGCA 4BWJA 3JQKA 2WB1D 2UXDK 3PIOQ 4TYBA 3NGIA 2FF3B 5F8MA 1NXIA 1NJXA 1T7PA 3OL7A 1ULRA 1WNEA 2XZTB 3LGHA 3FCVA 5JMNA 3WNEA 1S3XA 1RSCA 1IBCB 1AYEA 3KVGA 5F8NA 2WRMA 3VERA 4PEOA 2PT0A 4I4BA 2GW8A 2BE7D 3SNNA 5BRFA 2RS2A 1T6DA 3PX4A 1S9GA 4I67A 3H8YA 2Q0UA 5IWAJ 4IRKA 4BVPA 1UA0A 2CH5A 4CBWA 3VQSA 1VCTA 2V8DA 3NWGA 4RKUC 3FMWA 1FVQA 1WI8A 2YI1A 3HVTA 4LF6F 1QVFM 1UVJA 3GR1A 3EKSA 3QPIA 4Q0BA 4EU0A 2V9KA 1ZS6A 1HJOA 5KG1A 2QLFB 3C6HA 5LXRA 1R0BG 3D2EA 4Q0BB 1VLYA 4CEDA 5LL6d 1OVQA 4KBIA 3V6DB 2ETJA 1MWYA 3TZXA 1C1AA 3KWMA 1NSPA 3EJMA 4FWLA 3EPIA 1GXLA 5B8HA 3DU6A 5DZ7A 2PDAA 2ZD1A 5BN9A 2GJFA 3LTOA 3RWUA 3QO9B 1JIHA 1PYSB 2YNHA 1BOTO 1YZ7A 4I64A 5HLFA 3CD7A 1WSIA 4LR7A 4F9OA 4CEEA 1VQ5S 5HRRA 2VQEK 3ATVA 3CM6A 2HNDB 4FYDA 4MIAA 2MZ1A 3OYIA 3KUEA 3K9KA 4JI2J 3D6FB 4FN5A 2QI2A 4DSJA 4MQ3A 2BJEA 3T7ZA 4DS4A 3PM9A 4U8VA 4BWMA 3TO8A 2V6AA 2VA3A 1TKXB 3EZOA 4JI6F 4GNIA 3JSMA 2MEWA 4CJPA 4F4ZA 1H2VZ 3AOAA 3AHPA 3AT1B 2EFQA 2NS1B 2BOPA 4F67A 3AXMA 2DFEA 1HA1A 1RLDA 1I94J 3VAFA 1JLFB 4HWIA 5GAEP 4E8UA 5M1QA 2WOMB 2R8JA 1HBUA 1Z05A 2YNGA 4CH7A 2KG0A 2KRBA 1RK8A 1XHZA 4CD1A 4WXOA 1U26A 3QRPA 2GNKA 3QNNA 4IH5A 4DU3A 2QA1A 2WBMA 1J5EF 3CCZA 1WEYA 3M8PA 5KFVA 4XH4A 4W98A 2JVRA 2ALZA 1FI4A 2Q3PA 2WW4A 5JS2A 2PFFB 5D0EA 3CFPA 3U6FA 3LW5C 3QINA 3FCWA 3TARA 4K4YA 3VAJA 5DDOC 3L2WA 3P96A 2BM0A 2VFVA 5HJXA 3R6LB 2Q97A 3QNOA 1S49A 3PR5B 4JD2A 1VQ7S 2XULA 2I0XA 4RCHA 1S5ZA 3CQXA 1ESVA 1KDNA 2OSQA 4RBUA 1AA1B 4LIWA 2FGCA 3OYDA 4B02A 5F41A 4C1NK 4DQSA 2DGVA 1L5UA 3OW2M 1VC0A 3PEJA 4I69A 1S6QB 1SC6A 3OR2A 4OLBA 1R6VA 3S7RA 2DJWA 3GPAA 4QWEA 1JLAA 3OR2B 3BH6B 4KJIA 3NHGA 2XWXA 3CHWA 1DTTB 2M8DB 4JI3J 4IFVA 1WDTA 5GADU 2OPPB 2Y1LB 1SQFA 2YKAA 4NLDA 4L74A 2UU9F 2BRLA 3CJSA 4DUZK 4Y1DA 2CPJA 3BREA 4FVCA 2VG6A 4DX8H 3P6YC 4Y00A 1HI0P 5KFOA 2JHEA 4B9UA 2W4PA 5L9NA 4JBCA 1HWIA 1W2BM 3VQ7A 4EO8A 3DMJB 2KL8A 1EQMA 4I9LA 1M5SA 4R0EA 5DQGA 4B3MF 2UUCK 3IGVA 3H5SA 4QIFA 4JI7J 1VQ5N 2ZVSA 4I0WA 2EK1A 3ZT1A 5GAGU 3F0NA 3DNCA 2AA4A 1Y3KA 5F1XA 4JI4J 1S7HA 1J5OB 4IBNA 4NLTA 1HWKA 4DX7A 1A5WA 5JS1A 1WHVA 4JI5J 5B0GA 5KG2A 1HLWA 2KU7A 1T3NA 2JGUA 4B1ZA 4JS4A 2ZGYA 2MQPA 4BC5A 4LIRA 4J9KA 3U3YA 2F4VJ 2V8HA 2RE1A 4X4SA 4B1XB 1TV6B 2G0IA 1REVA 2ALYB 1QAIA 1T8EA 5A8WA 4ED8A 4YHHK 5AQTA 1UEUA 1X4EA 2W8LA 4KHNA 2CNLB 1Q5YA 5FD1A 4LR8A 1Y64A 1FRLA 4FYVB 1X0FA 3H59A 3PIPQ 3RW6A 3CFOA 1M90O 3W5XA 2MQOA 4K43A 2Z8QA 4WFYA 3CCWA 3MCAB 4LVOP 2K06A 1FTCA 4G1QB 5AQLA 3MXHP 3TR5A 2MHNA 2C2OB 2ZZMA 4LF9J 4TN2A 3T1YF 4B3RK 4AHTA 2XNRA 3CJKA 1HMVA 2RHKA 5HI7A 1R7IA 1RJJA 1U2FA 4NO7A 3O9TA 1NU0A 1UOCA 1B7FA 3DCAA 1JJ2R 1WSFA 4KO0A 1HNIA 4FM1A 4FOIA 4PHTX 1K73O 4DF4A 4AE5A 3RTVA 5HANA 4KO0B 5HVGA 2GUIA 3LM2A 3UCUP 3EL2A 4CBXA 3H98A 3LL3A 2IM3A 4A2BA 4NLXA 4C8NA 4NL5A 4XIUA 2VGMA 1X7VA 1BCOA 4Y1CA 2GGPA 4K2XA 3L6QA 2Z4PA 1DZ5A 1RT6B 4E1NA 1NGEA 4UUWA 4JKBA 1D1UA 4FO0A 2QWOA 1J5EJ 2YHYA 1FE4A 3CIMA 1LCUA 3GILA 5FIIA 5DLFA 1V6HA 3VGLA 2CNKB 3SV4A 3V9SA 2NQPA 3MM9B 2UXCK 1D8ZA 4I56A 3AVHA 1T9VA 5D78A 2QXFA 2UVVA 2IM1A 1XNQJ 2C2DA 4DR6F 2HHPA 2KRRA 1LW0A 3D45A 3KDOA 1N5VA 3M9MB 4KRFA 4FF2A 5IT9U 1BISA 2ZBPA 1VI7A 3HPHA 2G4BA 1RTIA 2HQIA 1RFQA 5I3UB 3DJCA 4HL9A 1N88A 3BGRA 2JZ5A 4A46A 1P1TA 1RTIB 1SL0A 2KFZA 3TW0A 3C15B 4IH6A 3BGRB 3GYXB 3SSSA 3IMQJ 1SKUB 1YUWA 2E5HA 4DR2F 2RU3A 2J8AA 4ZVGA 1RADB 1FNMA 3RBZA 3M30A 2AJ2A 1BG3A 3RR7A 1XC9A 3L09A 1NRKA 1W2IA 1BIUA 1U2VB 4JK7A 4G65A 3EE9A 1X9WA 2AEFA 1FJGK 3AA9A 2JH3A 4JI8J 1U47A 4DMNA 3PJWA 1SXLA 4OJ1A 3B6BA 5EWGA 2H54B 3G6XA 4ANCA 1S5JA 2RD5C 2HW3A 4AQYJ 2YNFA 2FVCA 4LVNP 2XG8A 2P9LA 4DG1B 3D7EO 4GMKA 2W41A 3WNHA 4K7QA 4OLPA 2FZKB 5M2PA 2WUSA 2YNFB 2P9LB 5CZ2A 3WXIA 4ZVPB 3E01A 1HKCA 2L3MA 3W8GA 1HBOB 2HVEA 1NMDA 4NCAA 2B4PA 1DEJA 4LF4K 3P4UB 4QWDA 2QC3A 3AAQA 4PKHA 1N52B 2E5GA 5L1IA 3BPSP 3MMVA 1U25A 2IDEA 4KTWA 4BG8A 2UZAA 2ITMA 2O8EA 4OI0A 1SJ4P 4B9TA 1EHWA 3H2VE 1N0VC 5J2QB 2OZMA 2XZWA 5BR8K 4FYWB 2XZDB 5F3TA 4DJBA 1VQNS 2DBBA 1WG5A 5C2DA 4JHDA 4FSVA 1U4BA 1W97L 1K1QA 4JHDB 4W5RA 5IM0A 2LSNA 1U1PA 2VPXB 5KFRA 3M8ZA 2V52B 4K42A 4CZJA 2HBQB 3Q7CA 3MR2A 3Q24A 4BBYA 5IM0B 3ZSVA 2M52A 3V2UC 1WUAA 1YAGA 1VSIA 3MUVP 2C2NA 4K0KJ 1TL7B 3QWUA 4CIOA 3R1LA 3ZT2A 4UW2A 2V4RA 1T05A 5DGBA 3RJMB 3PDNA 3X3UA 3D9BA 3CJ7A 1BQNA 4WFAQ 2ZH8A 3UKRA 3MD3A 1T05B 1LW2A 1P9YA 1JLBA 3R7BB 4CM2A 1BI4B 4DV0F 1X4FA 3HHNB 1BQNB 2CJKA 3PZPA 3PRDA 2DISA 1LW2B 5AXMA 1JLBB 1AUSL 5LJ5Y 2VASA 5K14A 5JVHQ 5J2MA 3NGSA 2EFNA 3TAFA 1VSEA 4ZP8A 2CPDA 2M4MA 3LGNA 3DAWA 2BXJA 2C3PA 4LREA 2FLLA 1FFWB 1WKKA 3HK2A 4N76A 3M6WA 2FC0A 4GKKF 1EIYB 3AB2B 1HNWF 4Y2MA 1FNXH 1VOMA 2YX1A 4KH1B 1ZBIA 2OMLA 1Q53A 4YOWA 4UF4A 2IVPA 5DM7Q 4C8LA 3SMSA 1YRXA 2RQMA 5MLCQ 3NNCA 4U7BA 4RNOA 4KI6A 4NYNA 4QR2A 2L08A 5CCMA 3ZZYA 3VEOA 1TUYA 2AMCB 1RISA 4YY3F 2XHBA 5KFXA 1NK9A 4N77A 2O8CB 4F0KA 3KUHA 2E1RA 5SWMA 2MZTA 2VB6A 2MQNA 4LR9A 3OXLA 2YWEA 4CFDA 1UWAA 4X66J 4M63C 4CJSA 1UW4A 2C3YA 1JMTA 4LD0A 3VQBA 4IO1A 3GP9A 3K2PA 4CZFA 2CG4A 1NHUA 3H42A 3KG1A 2V4QA 2XTJP 3E3XA 2YQ1A 1TELA 4HDGA 4WU3A 3HZGA 3D6RA 4DV2K 4G1PA 3A3OB 1RDAA 1RNHA 3THXA 4N7TA 2CQPA 1BU6O 1NK0A 4ILRA 4DTOA 4WFZA 3TA1A 4C8YA 4HACA 3THXB 1VQNN 4DCJB 1Q0NA 3HVAA 4LUBA 5H9FJ 1H6KX 3K5LA 3OL8A 3CDAA 4TLQA 2P9IB 2DRDA 2AZ3A 2EKYA 4WP8A 2E1PA 3W9HA 2DD8S 4DBQA 4GW6A 2WVFA 4ZN3A 2MMYA 4KFBA 5DM6L 4GO5X 5HVFA 4ILGB 3MECB 3LOUA 3LP2A 4TY9A 2FJAB 1JJ2M 2JEIA 4P75A 1D0EA 4LT6A 4DN0A 4HLBA 3A3NB 1AB8A 1Q78A 1NGGA 4M5JA 5U47A 4C8ZA 3IMXA 2EKNA 3Q2TC 1YJ9N 4C8KA 1VRUA 1X4BA 4DR1J 3EGWB 3W2VB 2CAJA 1YBUA 3VQCA 4DV4J 4KH5A 1VRUB 1H1VA 1GXUA 3U9ZA 4HCCA 1WG4A 4P2XA 1N5QA 3FGUA 3TABA 3OLAA 3OYMA 4B17A 3MM8B 3IR5B 4TU7A 2IJNA 2YKNB 4ZA1A 4H5VA 2DGQA 1UP1A 2E6LA 1DY3A 3C2PA 4BGBA 3O3HA 4BRQA 3ET6A 4FF3A 4OMFG 1RAJA 2R2TA 4MKBA 2O8FA 5M1PA 2ZM6K 2OPRA 1H98A 2VFTA 3V6JA 1RCHA 2DT9A 3BKUA 2J0WA 3HXMA 3EVMA 2E5JA 2O8FB 3A5LC 2OPRB 5I3QA 4DTUA 4FLVA 4ZPVR 2CPEA 3CG7A 4CH0S 1E4FT 4P10A 3VEYA 3NCQA 3K17A 1RHKB 3CI5A 1G99A 4OYZA 3NKYA 2YNIA 2VGNA 1B3TA 4QPTA 3IWLA 2WZ1A 2FJEB 1EO1A 4HHJA 1R0AA 2K1RB 4G9ZA 5RUBA 1LWXA 4OX9J 4ECRA 3TWHA 2CQIA 2CZVC 3NS7B 2WSEC 3IP0A 4OZ3A 1R0AB 3GWCA 1SV5A 2B7CB 3G9CA 2HBZB 4CZEA 5ETNA 2RSQA 4J9LA 2VQFK 4CLZA 3E9LA 1IO2A 3R8EA 4K8RA 4L75A 3R5CA 4ZVUB 3JAMY 1O1WA 2OUGA 3LP3A 4KGMA 1VS3A 1CZAN 1HW8A 5AE1A 4OZLA 2NLWA 1CZBA 3E9OA 3DC2A 2AHOB 2V2QA 1CPZA 4C3LA 1NKCA 2MQ8A 2OEMA 2DEJA 2FTRA 1YXQA 3KLGA 3OYKA 2IVMA 3MTJA 2GFFA 4HKQA 4J9UE 5DK5A 4YUDA 1P6TA 3PIPL 3R97A 4GVBB 3M4XA 3GIJA 1IM4A 2LVWA 3IAM9 4ZPTR 2OANA 3KLGB 1RT2B 3SPYA 4ZCKA 1UL3A 4LF2A 1VBYA 2QGFB 2DRAA 4X4RA 1PBAA 3CUNA 3FBBA 1J54A 3AVAA 4FS1A 3DOMA 3C14A 1IWGA 1U7LA 1N34F 1NPRA 4DFKA 3MN5A 3OS2A 1N32K 1DTQB 3WXMB 1H7WA 3EICA 3DOMB 4NXNK 3K89A 4A8FA 4DL6A 3SQOP 3WIVA 1K8KA 4NOHA 2C2KB 3IAYA 2E7XA 2PA8D 3J8AA 2B43A 5AFUH 1K8KB 2UXBK 5FLXU 4H4KC 2AEJA 3RBDA 4NCGA 3D6HB 3T1HF 4IR9A 5HBMB 4RX6A 4WJBA 2J8SA 8ATCB 5ETSA 3WUHA 1Y10A 3CJCA 1JK9B 4M3WA 3ENVA 3QGGA 2DXFA 2UUBJ 3QYYA 4NLOA 1XJWB 2IOCA 2ZKUA 1S57A 4B1WB 4DSKA 2HLUA 4QS8A 4PKDB 4JK8A 1RDCA 1KTVA 4X4TA 4M5DA 2I7PA 1HNZK 2DGOA 1S99A 2KHDA 2JFDA 2W7OA 1JLQA 1TVRA 5CZVA 1ZM9A 3DRYA 3WNFA 3GONA 4M5DB 1VQPN 4OYAA 3QIPB 2O3DA 2XI2A 2RKIA 2ZUAA 1JLQB 1TVRB 4QIWD 4FJ9A 1VIXA 1HYSA 3RUBL 1TMJA 2W24A 5C25A 2I6WA 5AXKA 4J9MA 1Q8IA 2O1PA 4UOCA 4DR7K 3QSYB 1HYSB 5D0RA 2DHSA 3VQAA 3NF6A 3VQTA 4DR4F 4GKJK 5KTQA 1J9AA 1RABB 3HHLA 2VBYA 2LEAA 3QJPA 2X1BA 1LFWA 2CVEA 1BCMA 1NSKL 1GX5A 3FBEA 5A2QU 4A8SA 3O3GA 5G4DA 3J7Z5 2XHWA 5BRDA 2CQCA 4PG7A 2VFSA 5BPLA 2RT3A 2GVZB 4JKHA 3MCMA 2IVFB 3RB4A 2D0CA 1VQYA 1KFDA 2VDIA 1BWFO 1RKIA 2HK2A 3OYJA 1HKAA 3SFGA 4F4WA 2FC8A 3LP1A 3MWTA 3PW2A 3MWBA 2HAIA 4IG0A 5SZTA 3J7ZO 2DNRA 2BANA 2UP1A 3LP1B 4ZMMA 3KLFA 4LF7K 3JTPA 1JJCB 5C7PA 4ICLB 1IKVA 3ZTOA 4USKA 4DV5J 3KLFB 3QMQA 1NHKL 1N5YA 2ASDA 1WC6A 4Q44A 3PUFA 3KLIB 1EQYA 4FM2A 1IKVB 3T41A 5CD4H 4OI3A 3FBCA 1QVGM 2DK2A 3UVJB 3BBBA 4DQQA 2LEPA 2LDIA 2PIIA 4Q8FA 2CDRB 4Y2CA 3H7HB 2HFVA 5JXSA 3CCSS 1RBUA 4DV1K 1PC5A 4J9PA 3R9PA 3L7UA 2NRTA 2X3DA 4OZJA 4PQAA 4JI2K 3HKZD 3IXQA 4RWXA 3IG1B 3RG6A 1YTAA 4EYHB 4FJJA 1EWQA 1QJHA 3CJ4A 4A8KA 4FJKA 1WOQA 3O1LA 1TL1A 2VU5A 3V4IB 1RGVA 4RU2A 3NXZA 3OVSA 3SUOA 2MGZA 1IBKF 2HFNA 3BQ2A 4DDFA 3QERA 1ZBHA 1TL1B 1SZ2A 4CLLA 1GTEA 2MGZB 2CA9A 3WXJA 3AGRA 4RLEA 4JS5A 4DR3J 2DNZA 1UPPA 2GAHC 4MKVA 3AVBA 4O8UA 2H9ZA 2G13A 5LJ3Y 3FRZA 1HWUA 5F0WA 2HGLA 2H5EA 3I56S 1YJUA 4USUA 4EBEA 2YX7A 1WNSA 2R3VA 1LWFA 4FNIA 4BGAA 1Q9YA 5AQHA 5BPNA 2OJ3A 2Q6CA 1GEHA 5KFLA 4ED1A 1ELOA 3MCNA 3J7YU 3MAAB 3TSQA 5LMUF 4FS2A 1U1KA 3VHQA 2Y0BB 5JVHL 4J9VA 2H5JB 1JJHA 1UKUA 3PYDA 2F5GA 1ZPVA 1R89A 5JICA 2FBXA 2JLFA 5FRMA 4FWQA 3OHAA 2Z56B 4NB4A 3R5AA 1RT1A 3GL1A 2FZGB 2K2PA 4JV0A 4M3RA 1XNRF 2BDPA 3W64A 1ZM4A 1LWEB 4OYMA 1K8AO 2OGUA 3PJXA 1QQCA 2VH7A 3VAMA 1Q81T 5DM7L 1U6ZA 3TJAA 3DOLB 5L1LA 3BZKA 3FE1A 3CCTA 2D3UA 3PKYA 5ETQA 5LSOA 4OX6A 4I1TA 2KO1A 4DUYK 3H90A 4WFXA 2Z30B 3MCSA 3SSQA 4ZVHA 3OYLA 5KOXA 3CJ5A 1OPIA 1FWKA 1GLCG 2KJWA 4Y2IA 4RW6B 4DF8A 2DIUA 4JI3K 4DV7F 3PRBA 2QWNA 1LOUA 2A10A 1KWMA 2W8KA 3K0JA 2A41A 1U04A 1TQLA 2QJ3A 1DQAA 3O08A 5GAHI 3NNAA 1RA6A 2E29A 4ZP6A 5M2RA 4DPTA 1CJVB 4FZVA 3CCVS 3C16A 2JWKA 4E7LA 1IXKA 4C2MA 1JKHB 1WWHA 4ER8A 4DV3J 3K8VA 5A6PA 4DQIA 2MB0B 3KXDA 2GCFA 3GSDA 4DHYA 3MMCA 5BREA 4DR4J 4FP9A 1BIZA 3CCSN 3M32A 4U95A 2BBEA 4YB6A 2VKZG 2IBKA 3MMCB 2RPIA 3KZBA 5LM7E 3K58A 3BY5A 2DGXA 4IEIA 2CIMA 4GMJB 3NGZA 3NP5A 3VZIA 2QEXS 2I38A 4K41A 1KC8T 3DWLA 4A47A 2BA9A 3QLHA 4M3TA 3NMUA 4OYOA 4K8XA 4Q45A 4UUXA 1A0OB 3R5GA 4CEQA 4YDUC 3TPQA 5DETA 4LF6K 5DS7A 1MWKA 2VFUA 5HO4A 4FJXA 1UJ5A 3HSCA 3OT9A 4XH5A 3EMTA 4JP8A 2EWSA 4KKOB 2HHXA 2FJDB 1GLAG 2F40A 4L3QA 3I56N 4OPHA 3CYMA 2GS8A 3WBZA 4R25A 3FUYA 1K0TA 5ETRA 4U7UK 4AFFA 2VWKA 2R7YA 2F9DA 2M0GB 4K50A 3SV3A 4BROA 4D3HA 4MH8A 1HFEL 2CGKA 3E9PA 2PMHA 1OJ4A 3UCGA 4DN9A 1VYAA 1TK8A 1YTYA 3ULDA 2XQCA 4OZ1A 3HBTA 3AO4A 3CDEA 4DFPA 3NGRA 4DKWA 3WEEA 4CLPA 4P7TA 4I6MB 2LXIA 3WEEB 3U27A 3VETA 1VLOA 5GAEU 3HYFA 2VODA 1SQEA 4JEPA 1HBNA 4M3XA 4G6VB 2V51B 2HSTA 4JI6K 3HPOA 4OJRA 1VAZA 4J9NA 4MJKA 4FK0A 2D0AA 2E5IA 5HRPA 1WBDA 4MYTA 3C8YA 1WTBA 4Y65A 3G87A 4ZN1A 2M7SA 4WXWA 1Q1KA 4FJHA 2LQBA 4L3KA 1WC4A 3QZ7A 4IOXA 1IBMF 3CMQA 2QA2A 1X60A 1ZC6A 1GOBA 3G96A 2NSBA 1HNXF 1J5EK 1RDRA 4WYWA 2B6AA 5ETMA 3KKSA 3EKUA 2G8UA 2V7YA 2R8IA 5HRNA 2HBKA 2UXDJ 3CCVN 4RBTA 1X8DA 4ID5B 1GH8A 1SIZA 4KY3A 1F5CA 3FQKA 3R6MA 2GIQA 2R4FA 3HHKA 2LFVA 3R5JB 3DXBA 3S01A 2HURA 1GLLO 1TGOA 1LNQA 1WHWA 3G2XA 2YKMB 2FB0A 1LWCB 2V68A 5EU7A 3SI8A 4ALZA 1T9UA 5D4PA 2IMWP 4QOZB 2QLBB 2CWXA 2V8PA 5KQ8A 4O3SA 4CZLA 3AVIA 5BN8A 3AAWB 3LAMA 2OI2A 1KN6A 2OLWA 2KFNA 3L95X 3GG0A 1WG1A 2QEXN 4QJVA 3MMBA 3A8KA 4NA1A 1QUPA 4X65F 2IYIA 1KOOA 4Y6IA 3QSIA 1U1MA 2W6LA 2YHXA 2EWHA 3UN2A 2UUAF 4ILMA 3CM5A 2AV5A 1WOPA 3MCOA 5E3AA 2FD2A 1XQSC 3T6BA 2KG1A 2OD4A 4DTPA 1WC0A 4ID1A 1G3OA 2VFRA 2BE2A 4ED7A 3N0VA 2Z58B 3TRGA 1OVYA 3VQ5A 4JI1F 1T03A 2BE2B 3M2VB 2KDOA 3OTOF 2UU9K 2FVPA 2E5LF 3J7A1 4LSLA 4CDIA 4WIQA 3FJ2A 2HVDA 4CFBA 3CIZA 2FJVA 1VQ8S 4ZVFA 2XY8A 4CEOA 3EY1A 1VC5A 3HKWA 2OFHX 1X5OA 3S3NA 2WC9A 1ZXOA 1A9NB 3MPUB 5LMNF 1HWJA 4B3MK 3EPGA 1N5TA 2VQEJ 3EZUA 1FW6A 1WOSA 4KHUA 4RNNA 2J9DE 2E7VA 3Q22A 3GYNA 5HQLA 1B7YB 2V2ZA 4WKYA 1M5OC 4FLZA 4OZ5A 3RZAA 2KLAA 3OFHA 3OTEA 1NJIO 1FRHA 3NOGA 3R5DA 2MSSA 3NGDA 1R6YA 1D09B 2OKQA 3H45C 3VF0B 3VGKA 3V9UA 1XMOF 4BR9A 3CC4S 4C8OA 1RWNB 3CFRA 3KLHA 3DDNA 1AXQA 1BUXA 3DXKA 5BYQA 2DH8A 5T7BA 4DZ6A 2RN2A 2KYZA 3ALYA 5M1KA 2NXCA 4PR6A 3WC2A 2AP1A 1SH0A 4OO1J 1X5TA 3P31A 2QSWA 2ZE2A 5AE3A 3C6AA 2B56A 5LOQA 5IT9O 2HHHF 3G82A 1H74A 1XMQF 2KKHA 3M2RA 4K4VA 4U7CA 4I7FA 3MN9A 3HZ6A 1QQOA 3HT0A 4EP4A 3H4BA 3VEZA 3ZZ0A 4ZVTB 1TP7A 3M2RB 4BY9C 3GU0A 3W1YC 3MOJB 2G8HA 3ZZTA 3DRPA 4KH4A 3HHDA 3V9WA 1VDHA 5F8IA 2ILZA 3DRPB 4AYBD 4IO9Q 3BEXA 4YB5A 3MEGA 3H3NO 1TKZA 3MM7A 1HHSA 4U6PA 4Q7AA 1URRA 2P9KA 1TKZB 3T1YK 2I9SA 1YRUA 2ZC3A 2P9KB 2COLA 2HHQA 3CNQP 2R8GA 3TTCA 1Q8BA 2P6TA 2VD3A 3HI0A 5KRTA 2EW9A 3A13A 1YQHA 2WVDA 4J9OA 5IT9Y 3QBWA 4FPAA 3SUPA 4IUFA 4J2EA 4Z4IA 3A3PB 4DZDA 5CXTA 3FQLA 1Q8LA 3CCLS 4JYAF 2HNYA 2HRUA 5I3PA 4V19J 2HGMA 1HIYA 2KT2A 2KI2A 1RTHA 2KVIA 2JEJA 5C42A 2E1YA 2HNZA 4CM0A 5AQQA 3L4IA 2CPFA 4DUZJ 5IFMA 4PY5A 1RTHB 3SLCA 3AVMA 4BR4A 3SQ0A 3BGOP 1MWZA 4FZZA 1K1SA 1PJ5A 2FLPA 3DHWC 3IN5A 3ZLJA 2W9AA 2DNOA 2W2NP 3ZZRA 1VQ8N 3U9DA 5KG6A 3HM9A 2H48B 1BA1A 1UFLA 4DR6K 2QWRA 3G8SA 4U7UD 3L0QA 3PYEA 2UUCJ 4ZCMA 1LK7A 1XBWA 1X9MA 4F4KA 2CWKA 3PYGA 2V4JA 5DLGA 3KK3A 4EHUA 5GMDA 1TL3B 2RH3A 5EOYA 1OWXA 3ISNC 4YS2A 2CG8A 5A0YA 4R8UA 2CH6A 4FLWA 1YVUA 4FZYA 2CJYB 4BR0A 1SJFA 1Y5NB 4BVOA 2AJ4A 1EKRA 5A0YB 2C22A 1JL1A 1N0UA 4CO2A 3GR0A 2HBJA 5C2GA 4ZVSB 1YI2S 2J6UA 2EBEA 3ZSOA 4LSNA 4J5OA 1TFYA 1FKOA 4BE0A 2ZH1A 1MLAA 3KLEB 3SYZA 2RDDA 3CC4N 4YEAA 4ZJOA 1FK9B 3VF6A 1X4AA 4C6AA 2YHAA 1BA0A 3OA9A 3AXKA 2AP6A 3W2WA 4KYZA 4DUTA 1M1GA 3RRHA 4WZMA 2NUHA 3PW0A 1BQMA 3W2WB 3I0SA 1QHTA 3QRQA 2IVOA 3KDNA 2R7XA 1I5OB 5H9EK 1AFIA 1GQEA 4AT1B 2QW9A 2WTUA 1QE1A 1MDUB 4CLSA 1IKXA 4ETZA 4QWBA 2DNNA 4YHHJ 1ZAWA 3PEHA 2MKJA 1Z6RA 4J7CA 4CEBA 1QE1B 3CGIA 3TVYA 2KT3A 5C2CA 4UOHA 4YFUA 2IRXA 3HJVA 3C46A 4QQBA 1RAAB 2V50A 1YG0A 1C6VA 5J2PA 3DRXA 3I6PA 3SIPB 2P9NB 3U3GA 5J2PB 2Z1GA 3AOBA 1NPPA 2N7CA 3MEKA 1P1LA 1S76D 4ISGA 3THPA 2CZ9A 2DHAA 6FDRA 4WK1A 1NGFA 4B3RJ 2PFUA 2ASOA 1N6QA 4D3GA 1ITPA 2A5XA 3MUMP 2FGOA 1LXJA 5I4MA 1N6QB 4IDKB 3KWIA 2P5VA 4DXLA 5GMEA 2RNEA 1OSCA 4LF8F 4FBTA 2DY9A 2OEKA 1NLKL 3H5XA 3QGHA 2DB1A 2E4LA 2Z2YB 1ASUA 4PL7A 3EXCX 5KFQA 3UR3C 1RQ0A 4CHZA 1YJRA 4TYAA 4WQ4A 3IRXA 3ILJA 3CCLN 1RT3A 3DM2A 1U1OA 5KFSA 2OFGX 1NGHA 1GLFO 3O6WA 2XCPA 1XQIA 1V4SA 3AVFA 2ZITA 3MXMA 1RT3B 2LECA 3DM2B 1CJUA 5GAHP 4OLAA 3H1VX 3QJLA 5AQVA 3VAKA 4ZPWR 3VQQA 2ZH3A 1LEOA 3S41A 1VC6A 5EXWA 4AL7A 4OHVA 2UXCJ 4HCBA 2XMJA 5E3PA 3NVMA 3H4DA 3K5OA 4NLQA 4FK4A 3W61A 2ZZNA 1RBSA 2BQ3A 4B9QA 3FFIA 2VJVA 2YWHA 1RHMB 4DV0K 2KYXA 1N36F 4YNQA 4E7KA 4FVUA 4WWSA 4NCBA 4JOUA 2BJ7A 1Q82T 4DTRA 3FFIB 4J91A 4O3RA 3ITHA 3O3FA 3M2UA 2JSXA 1Y11A 1HWLA 4ELVA 2RHSB 5HP1A 2IA0A 4MFBA 4DCOB 3AVJA 1R43A 3VALA 4ZLJA 1YI2N 4EFHA 4FKXA 5HP1B 4MFBB 4IFEA 4Q5VA 3MHYA 4GKKK 1IBLF 3HM8A 1WJ9A 1L3UA 1ZOTA 2DVIA 1HNWK 3RBXA 3MM5A 4NLWA 1HQUB 3OHBA 3TX8A 2FLOA 2ZHOA 2ZHBA 1HYZA 3CC7S 3K2YA 3ONQA 4H5RA 3MM5B 3THYB 2W2QP 4TVAB 2O8DB 1S9EA 1Q7LB 2H4YB 2YWFA 4H4OA 4NLRA 1OH6A 5ADZA 4OVLA 3HRGA 4H4MA 3RMAA 4MAKA 1L3TA 4A2AA 2OA8A 2HVIA 1C1BB 1K0VA 4YY3K 5D6GA 1MWQA 1V4TA 1N48A 4CHQA 3AQPA 2B7BB 2RUGA 2KQ2A 4JN4A 5J2NB 4P73A 4ZLLA 1UMJA 3I9ZA 4B1VA 3J80O 4OYIA 1VSJA 1S6PA 1O51A 2W9CA 5FPEA 2J76E 5KG4A 3U02A 2JL9A 3B82A 4ILHA 3OPKA 1DFDA 2KH9A 2W9CB 3PR4A 1RWVB 1MROA 1RCXB 2MTLA 1HPMA 2R2SA 3AVKA 1VRQC 4CLYA 5F0XA 4LF4J 1MROB 2DNQA 1S59A 1X4HA 1QAJA 1T9WA 2WW8A 1JXEA 4ZVEA 5AZJA 4HTLA 4CE9A 3TEGA 4RW4A 2P9CA 2AT1B 5B0EA 3ILLA 4OHXA 5BR8J 1FJ7A 3QETA 5AZJB 2CJAA 2W2PP 2D9PA 2QWMA 4KE5A 2EFVA 3OUYA 2QK9A 1C4CA 4RW4B 2AYMA 5LJVA 3WNGA 2G2ZA 2VDHA 4MO5A 4RW7B 3MFIA 1RAFB 2XY6A 4TLRA 3IGNA 5KAKA 1T02A 3HD2A 1BD6A 3O4WA 3ENQA 2XM3A 1KONA 3RBEA 1PCAA 3CPWR 1CQMA 1ZYQA 4AXIA 2SXLA 3EGNA 1KLMB 2RRNA 2QXLA 3J7AP 4JV5F 2HBYB 3DLKA 5D3GA 1WN7A 5AJ3F 2M5YA 5M2UA 1PAEX 5ETTA 5D3GB 4EMDA 2QN6B 2Q43A 2M8HA 1XIQA 3DU5A 4JV2A 4OL8A 4IXCA 3CWJA 4DL4A 4KBOA 2AF6A 1AT1B 2DO4A 2D0OA 3HFKA 2ZZTA