4H4MA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
548
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
total genus 135
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4mA05
4CJEA 1HQUB 5L9XA 4ZPDA 4ZVGA 5HROA 5HP1A 4KV8B 5J1EA 4NYZA 2FC0A 1LWEB 4DF4A 4HUFA 5F8HA 4CJKA 4KTQA 4RUAA 4CFCA 3MECB 1ASUA 2HHWA 4CJVA 1W9HA 1QAIA 3QEPA 2J6UA 2WONA 4DL7A 2ZKUA 4F2RA 3OHBA 3SUPA 3ASMA 4DLGA 2I5JA 3DLGB 4EZ6A 5DG9A 2G8WA 4QW9A 4MFBB 4W5QA 2XI2A 1YTUA 2GC8A 5I42B 3HXMA 3PX6A 3Q8PB 2WB4A 4AHVA 4CEBA 5F8IA 3OLAA 3AVIA 5KFLA 1A5XA 1SL2A 3MXJA 3DYAB 1S6PA 4CJ3A 1KTQA 3RR7A 2AJQA 4DTXA 2OPRA 3MEEA 1UOCA 5DMRA 3KK3B 5F9NA 2Z1GA 3HVTB 3TAGA 1DLOB 3DOLB 4OKKA 4F2SA 4DSIA 1TGOA 4FJGA 4JLHA 4J9RA 3IGVA 1JKHB 4NLXA 4Q0BB 3IRXB 3VQEA 1TK5A 3NH1A 4K4SA 2DFFA 5KGXA 5KFHA 3HHKA 4LH4A 3LWMA 4O3OA 3NGDA 4ICLA 1BCMA 3ITHB 4O55A 1N4LA 4CHZA 2A1SA 2Y1JA 2YNGA 5KFXA 5KFTA 1WSEA 4DQRA 4RW9A 4AHCA 4DSJA 4E7KA 3DLEB 1T8EA 4CJPA 2G8VA 2D3ZA 4CJTA 4E89A 1NOYA 1TVRA 1LW0A 1S6QA 4KAZA 5CYQA 3IS9A 2PYLA 1HJRA 3IAYA 4IRKA 1R0AB 4DTOA 5F9LA 1FXXA 5I3UA 5HRSA 1FKOB 4O0JA 1TKXB 3O4QA 3S3OA 4WZMA 2QK9A 4DFJA 1VSKA 5HRPA 3HPOA 2FLNA 4FJKA 1RA7A 3SI8A 2QE5A 5CZ2A 3H4BA 4CF9A 1QHTA 3KK3A 3T5JA 2HHSA 3KJVB 1G15A 2PYJA 2ZE2A 4M42A 2ITGA 4DTPA 4L8RB 3OL6A 3OYDA 1KLMB 4MIAA 1QSSA 4URSA 2GV9A 4HCCA 2AQ4A 3FQKA 3AVKA 1SL0A 2OPRB 4PUOA 4KTZA 5L1KA 1HRHA 3QLHB 5KGWA 3QGGA 5KT4A 5JXSA 4EZ9A 4IRDA 3SI6A 4IR1A 4E1MA 3MF5A 1HQEA 1NK9A 4LSNB 3RB0A 4H4MB 3MECA 4J9NA 3GV8B 1C0TB 4NLRA 3RMDA 4MQ3A 4FJXA 4IG3B 3L2RA 2F8TA 3EZUA 4RNFA 5KFQA 4CFDA 2KQ2A 4QWAA 4K4YA 2W9CB 2F8EX 1EXQA 3JSMA 4RNMA 3OS0A 1U48A 2JGUA 4QWDA 2C2DA 2HMIA 1KVBA 3NF9A 4ID5A 5E41A 2VG6A 1BQNB 4IG0B 4ED2A 4F4KA 4FJHA 3TQ1A 2PY5A 3U3YA 1NK4A 4DG1A 3QLHA 4XO0A 1S9FA 1FK9A 3CM6A 4K4ZA 2AGOA 3AVMA 5HBMA 3PJWA 4OKEA 3TI0A 3OVNA 3PV8A 3AO3A 4LSLB 3VA3A 2IAJB 3IS9B 3O3FA 4FM2A 3KLHA 3OYFA 2DPIA 4CK2A 4ZMMA 5JS2A 5FRMA 1C6VA 3GV5B 5F8GA 5J2MA 3O3HA 2OPQA 3KD5E 1JLQB 1IKWA 5EUHA 3H5YA 1WNSA 1HNIA 1BIZA 1CZBA 4Z4EA 3QETA 1RAJA 1VK0A 1JLAA 2DY4A 5DLGA 2BANA 4I9QA 5F8JA 1SUQA 4J9KA 3M8QA 4YR0A 4E0DA 1YVFA 3O3GA 4CF0A 2KZZA 1K6YA 3V9WA 4RW8A 3N6NA 3L2QA 2HB5A 2YNHA 4CJFA 3VQCA 1A5VA 3TAMB 4U7CA 3THVA 3CDWA 4FZZA 1JX4A 4M41A 4U6PA 1RT5B 4OJRA 3VQ7A 4Y1DA 4IKFA 2UVVA 2X6NA 4B9VA 3HPGA 4KI4A 1FKOA 1UA0A 3K59A 3OYMA 3LZJA 3HVAA 2BE2B 4K4VA 2YNFA 4CF8A 3P5JA 4M3XA 1RBVA 3PUFA 2R7YA 4J9MA 4CFBA 4URQU 4JRQA 1NHUA 4CJ5A 1VSJA 2BQUA 4OLBA 4NYNA 4XPCA 4B9TA 4CEQA 4DU3A 1S9EB 2UUTA 3K2PA 1NK8A 1U49A 3ZSQA 2E9TA 4M95A 4CGJA 4CERA 2WONB 1S6PB 4KHYA 3RBDA 4B3OB 3G6VA 2BQ3A 3DRRA 4IQXA 1BIUA 4H8KA 4KB1A 1RCHA 1TAUA 3CFOA 1JLAB 1IKVA 3CM5A 2KFZA 4DSFA 1HYSA 1QUVA 5DG7A 3DRSA 4LSNA 2RDIA 5KFJA 1RTDA 3DM2B 4RZRA 2YHAA 4CJQA 2XGQA 1JLCB 2YNHB 2R8JA 5HROB 2AU0A 1HPZA 1SV5A 3ZSXA 5KT3A 1JL1A 4RNNA 1ZTTA 1RA6A 1RT4A 4FCYA 1ZBIA 5KFYA 4QWEA 3AVGA 4CIGA 4B08A 3DLRA 3EY1A 2B6AA 1NKCA 4FJ8A 4KPYA 4O3NA 3D0PA 2FBYA 2P51A 4FYDA 1IKWB 2ILZA 3UQSA 3CO9A 5CYMB 1JXBA 1BQMB 2GIQA 3KKSA 5KFKA 3T1AA 4EBCA 1RBTA 1LAVA 4FXDA 4J2AA 5C25A 2F96A 1F21A 1RDAA 4AH9A 4QAGA 4E7JA 4M3WA 3GYNA 1WSGA 2Z1JA 4FJ5A 4WXOA 1VSLA 4RNOA 4K50A 3TAMA 3ZT2A 1TKTA 5KFUA 4FJIA 4DS5A 5J2PA 1D0EA 2WCXA 4GC6A 4YNQA 1EP4A 3QZ8A 3AVNA 4O4GA 3SUQA 3CWJA 3HL8A 4DTNA 3M8PA 4FJMA 1C0MA 4C8NA 4CK3A 1S1WA 3V9XA 4J9OA 3I0SA 1CLQA 2IBKA 3PR5B 2ASJA 4PQUB 4KHMA 4FJNA 1JLEB 5CYQB 4J2BA 4PA1A 4W5NA 2R8IA 1L3SA 1WAFA 2Z1HA 4WFXA 2WRMA 3RAXA 2FVCA 5KFZA 2G8FA 3GQCA 4TY8A 4CHOA 1REVA 1JKHA 4YFUA 1JLBA 3NL0A 5I3UB 4IR9A 2HNYB 4CJLA 4BE0A 1GX6A 3DI6B 1RDDA 5CY4A 4LY7A 4KHNA 3NMAA 3GIMA 4NLGA 3ZT3A 2QXFA 3KK2B 2FVPA 3DLKB 5HLFB 4O3SA 3QIOA 4XPEA 4CJRA 3OYAA 3VA0A 3EYZA 2KW4A 3C94A 4CGDA 4K4UA 1BQNA 1VSIA 4WE1A 5C25B 1LWFA 1IKYA 4F8RA 4CHYA 1NJYA 4NLUA 4CCHA 3D45A 3KLGB 4F4XA 3DOKB 2UVUA 4ECUA 3PJXA 3VQAA 4DL4A 1XR6A 4M45A 2WTFA 1KLNA 3RR8A 3NH2A 1J53A 2OZMA 2VG6B 4ZTJA 4BWJA 3NF8A 4HUEA 4Q45A 1SKRA 4KHQA 5C42B 1HYZA 4IG3A 5J2NA 4NCAA 3JSMB 4IFYA 1SH0A 3QEIA 3MEEB 2WHOA 3SFUA 2W9CA 4KRFA 4NLDA 2IAJA 3OY9A 1RT4B 2OPSA 4RU9A 2KZMA 1CXQA 4FZXC 4MIBA 2BGGA 3VQDA 3BSOA 4PUOB 2ZQBA 2HVIA 2D0BA 4ECXA 1LWCA 1J9AA 3FDSA 1Z25A 3CFPA 3HK2A 4ZHRA 1BI4B 4G3IA 4CK1A 3HP6A 3A2FA 1RTJB 3HT3A 3MAQA 2XHBA 3N6LA 3ICLA 4QWCA 4O3PA 1S1UA 1EX4A 4E7HA 1T03B 4LQ9A 3AVLA 4KHRA 2HW3A 4JS5A 3K5LA 4YMEA 1N56A 4B9NA 4IFYB 3OS1A 3V9SA 5J1EB 4HVJA 4IKAA 4OPKA 1NK0A 1HQEB 2ETJA 3LPTA 3KNAA 5KFFA 3KHLA 1WSJA 3CFRA 1CXUA 1HARA 2XGPA 3B6OA 4ELVA 4ELUA 4QOZB 2O4GA 4EYIB 3ZSYA 3RRHA 3AVHA 3HVWA 2IJFA 4I2PB 3BQ1A 3VQSA 2HWIA 3T5HA 4CGHA 2V0NA 2C2RA 4NLTA 4DWIA 2A1RA 4TYAA 4AHRA 3BSAA 3KJVA 3I0RA 1NHVA 1RBUA 1X9MA 5KFCA 3ZT0A 1ITGA 3RB4A 2YKNB 3QGIA 1YT3A 4DL5A 4K8XA 1TL1A 3FQLA 4GVMA 3AA4A 3SFGA 3M9NB 4EEYA 5CZ1A 3B6PA 1L3TA 4IDKA 1S9EA 2X6SA 4FJ9A 4B9LA 4E7IA 2W8KA 3HPHA 3LANA 3LAMA 1TAQA 3Q8RB 4LQ3A 3LZIA 3WNGA 2Y1IA 1ZBFA 4W5OA 3ZSVA 3KK2A 2R8GA 3VQ5A 1D1UA 1KFSA 2IM0A 5SZTA 2ATQA 3VQ9A 3FFIA 3I5BA 2OPPA 3CDEA 5KG6A 2JEGA 2IA6A 1RT1B 1RTIA 4KBIA 3H5UA 1J5OB 4DEZA 4KSEB 1W25A 4RW4A 3NBPB 3MEGB 4AILC 5DGBA 1RBSA 1D9FA 2IDOA 4CHNA 2UVWA 2VG7A 3BREA 1BI4A 3KLFA 4B9SA 3DRPA 1N6QB 4Z0UA 3BSCA 3QNNA 3QESA 3KLIB 1LV5A 3AO1A 4NLYA 4E19A 4RW9B 1S97A 3MTKA 3UDLA 1NK7A 1C1CA 4FBUA 4FBTA 3E01B 2G8HA 4NLSA 3V1RA 4DG1B 4CGFA 1KRPA 3V4IB 4R8UB 2HNZA 2HNDB 4KO0A 4KV8A 2XCPA 3DMJB 2FJVA 4NLPA 4CJWA 2ASLA 1XI1A 4EO8A 4TSXA 4Y1CA 3K57A 1A5WA 1XR5A 4MK8A 1JLGB 4B3OA 5KG0A 4FK0A 4Q44A 3E01A 1WAJA 3H2LA 1TL3B 4ZVFA 2YHBA 2EX3A 2YKMB 3PO5A 2FVRA 3G6YA 2VA3A 4FLVA 2HHVA 1RYSA 3MXMA 1W0HA 4CEAA 2VWJA 5I42A 1RDRA 3I5CA 3KMSA 1ZBLA 3S3MA 3HYFA 4CGGA 3UPFA 3QEVA 4TY9A 4FLUA 4MK7A 4CEDA 2RN2A 3S9HA 3LP0B 1VSMA 4B9MA 3KHRA 4GC7A 3RWUA 2R2TA 5KTQA 3PO4A 1S1TA 3C6UA 3QO9B 4RUCA 2LSNA 3V6DA 5KFPA 2Z1IA 3AVJA 3AA5X 3ZSWA 4CEOA 5KFBA 4BDPA 3V1OA 3HP9A 4TYBA 3LALA 1TKDA 1JLQA 1J5OA 1U47A 4KKOB 5FDLB 2QKBA 1NK6A 1RT2B 3GIIA 3SPYA 2W9BA 1ZBHA 2JC1A 2J6TA 4PQUA 1VSDA 1KVCA 3DRRB 4DTMA 3NF7A 1VRUA 5L1JA 2DFHA 4NYFA 4B8CA 3BGRA 4BDYA 3TR8A 3OYKA 3HM9A 3OYHA 2W8LA 1NJWA 3KMQA 3V81B 4ECSA 3DLKA 2HNZB 3L2VA 4ZP7A 2AX0A 4H54A 3KK1A 3QO9A 3KD1E 3IG1A 2CJQA 3EPIA 3M8PB 3U3GA 1HMVB 1YTAA 3I5AA 2JC0A 3V9UA 5HBMB 4YR3A 5J2MB 1RT2A 5J2QA 4IOBA 2R8KA 1S4FA 4X2BA 2C2EA 1LW0B 5KFEA 1HNVB 1VSFA 3KIOA 3LDSA 2WOMB 2RPIA 3TAEA 2OA8A 5KT7A 2B4JA 2ALZA 4E1NA 1BQMA 3K5NA 1X9WA 2FVSA 4NCBA 1S1TB 1B9DA 2X78A 3WNHA 1QTMA 2BRKA 4BACA 4OLAA 3RB6A 3SV3A 3KOAA 4NRUA 3UIQA 3PW5A 5KG2A 3CQ8A 4CIFA 4ZP8A 3G10A 3PX4A 3KLEB 3WNEA 3SUOA 2FBXA 1YVUA 3KLIA 1BHLA 1RBRA 3LAKA 5KI6A 1IM4A 1LWCB 1B92A 3Q8QB 2ZE2B 1IO2A 1VSEA 1KCFA 3PR4A 1D8YA 1RTDB 3RB3A 4MKBA 2HMIB 3V4IA 2XC9A 1MU2A 5J2QB 4HUGA 3DDKA 4WFYA 1HPZB 5JS1A 2VWKA 3PW7A 3QIPB 2VA2A 4O44B 3OSPA 3SJJA 4M94A 5KG5A 5JUMA 1LWEA 4ECWA 4M3UA 3OYIA 4QCLA 4ECQA 1WNEA 3OHAA 1RT1A 2XWYA 2B5JA 4F4YA 3NBPA 3NHGA 3MR5A 1CZ9A 1GOBA 3T5KA 2IM3A 4AHUA 4CECA 4GW6A 1O1WA 1HMVA 3ZSRA 2JEJA 2QKKA 5T14A 5EWGA 2YKNA 3QYYA 1IH7A 5DLFA 4OKJA 4RW4B 1SUQB 2RKIA 5KRTA 2ZD1A 1SH2A 1S6QB 1SL1A 4DLEA 1L5UA 3TAQA 5KFDA 4DFMA 1U4BA 2EC0A 1HQUA 1TKZA 4ZPCA 4EBDA 3PW2A 3ULDA 1EETB 1KSPA 4M3ZA 1IKXA 4OGCA 5EU7A 1JLFB 1S49A 4QW8A 1LW2A 4HTUA 1N5YB 4CEEA 4LH5A 4IH6A 2O4IA 2F8SA 2FBVA 2D0CA 4PWDA 2ZD1B 4B9UA 4KO0B 1SKSA 5EDWA 2IOCA 5L1LA 2E6LA 3SYZA 4AHSA 2HWHA 2HAIA 4F3OA 2W7PA 2OPSB 4I2PA 4RW7A 3RMBA 3KLHB 3MR3A 4TY8B 1XWLA 4ZPAA 1ZYQA 3VQPA 4ICLB 3SPZA 3K58A 3HJFA 4DFKA 3NGYA 4O5BA 3LWLA 3OS2A 3JYTA 3OYNA 5FROA 2R8HA 1D9DA 4IG0A 2FVQA 2D0AA 1SKWA 2HNDA 4OPJA 4JRPA 3CJ4A 1RYRA 3LP3A 5SWMA 3SZ2A 5J2PB 4H4OA 3DRPB 4WYWA 4WXWA 1HNIB 5KT6A 2W42A 1QAJA 1BISA 4EO6A 4JV2A 4QWBA 4PY5A 4ZP6A 2AX1A 2I1RA 4BE2A 3FRZA 1T03A 1KLMA 5KRSA 2BQRA 4DQSA 5EWFA 3NFAA 3LP1B 4UQGA 1DLOA 3DOLA 4WZQA 2V4QA 3SQ2A 4C8KA 1R0AA 4HHTA 1RTJA 3MEDA 4LD0A 4YP3A 2AGQA 4DL2A 1UWBA 4J9QA 3SQ4A 1LAWA 3V1QA 1X9SA 3ZT4A 5F8MA 4EP5A 3DLBA 1GX5A 4FJLA 1XC9A 1QSYA 2IGIA 2XY7A 3CYMA 3V6HA 4CE9A 1HNVA 4IFVA 3HKWA 3VQ4A 4BWMA 3IG1B 1VRUB 4N76A 4KHSA 3C95A 4FLZA 4W5RA 3GV7B 4F4ZA 3CG7A 1MMLA 3KHHA 3NCIA 4J2DA 3SNNA 3DLEA 5KT5A 3ZCMA 3MR6A 4OGEA 4G1QB 3RRGA 1TP7A 4HCBA 3KLGA 1TL1B 3NGZA 1VRTB 1FKPA 3H5XA 4Y2CA 4I2QB 4DTJA 4OVLA 5KFNA 1WLJA 4TQRA 2YNIB 4IDKB 3NDKA 3H08A 3C6UB 3CJ0A 1L3UA 1TV6A 3IRXA 3CIZA 2B43A 4DFPA 4K4WA 4I7FB 4DL3A 3TARA 4CJUA 3BGRB 3D28A 3OL8A 4NCGA 4IRCA 4O0IA 4I9LA 4RW6A 3TABA 4BE1A 2XY6A 4CJ4A 2ILYA 2IC3A 5C24B 1FKPB 4DSLA 1S9GA 1I3AA 4ZVEA 1RT7B 4R5PA 1S1VA 4KHUA 4DQIA 3LP2A 4IH5A 4M3RA 2D41A 1TKTB 1NKEA 1RDCA 4RG8A 3QINA 4ELTA 2IM1A 1WSHA 4Z4GA 1ASWA 4O4GB 3G0ZA 2IM2A 1RT3A 3T5LA 3RMAA 3M8SA 3D5MA 4W5TA 1RT6A 4YQWA 4ID5B 1KHWA 5KG4A 2UUWA 4OL8A 1B9FA 1DTTA 3OYGA 4O4RA 1C0UA 4DU4A 4K4XA 2O5DA 4FLWA 4ECVA 4CHQA 2E4LA 3SV4A 1HYVA 1RDBA 1EP4B 1WSFA 3G86A 4FM1A 4DSEA 2HHQA 4Z4CA 4LSLA 1S0OA 3LPUA 3OSNA 1QS4A 2Q3SA 4F4WA 4ZP9A 3KLEA 4B8AB 4CIEA 3AA3A 5FRNA 5KFWA 2EHGA 4E3SA 1VSHA 3DLHA 2CKWA 3BJYA 5K14A 1NJZA 4C8LA 5EWEA 3H59A 2PZSA 1C1BB 3EZ5A 4MH8A 3BR9A 4DMNA 2B5JB 1EKEA 4J9SA 2XY5A 1Q9YA 3FSIA 3NAIA 2FLLA 4CGIA 4Z4IA 2FJWA 1VRTA 2BDPA 1U09A 3V9ZA 3IN5A 3CJ2A 4FLYA 1TK8A 2OPPB 1GOAA 3T19A 3O4NA 4M3YA 3NAHA 2P5OA 5K14B 3H4DA 2HHUA 3AVCA 5KT2A 1S10A 2QV6A 1TKXA 1C1CB 5KFOA 2GBZA 1RT6B 4ED7A 1TQLA 3VN5A 4ECRA 3T3FA 4DL6A 3NKYA 3CDUA 2JLEA 1T3NA 4KFBA 5HRRA 2IC3B 1N6QA 1XHXA 1WN7A 1S9GB 3MFIA 3ZT1A 4QPXA 3SQ0A 1CSJA 2VG5B 3OYJA 3OYBA 4KTWA 4KKOA 4DU1A 2YNFB 3RAQA 4R0EA 2OH2A 1EETA 3OJSA 5C24A 4FJ7A 3F73A 3G6XA 4DQPA 3QEXA 1RT5A 2G8UA 1JIHA 5KFMA 3RBEA 1TK0A 4EYHB 1N5YA 3PY8A 2C22A 2W7OA 1TVRB 3P83D 2BE2A 1DTTB 3TAPA 4ZTFA 3TAFA 4XIUA 3AO4A 1ZTWA 3QERA 2HHXA 3NAEA 3RTVA 3V81A 1JLCA 2W9BB 1S1VB 2FJXA 4AHTA 2IJNA 4O3RA 4IFVB 4FJJA 4FVMA 1JLEA 3NE6A 2IS3A 1LW2B 3KKRA 3AA2A 4G1QA 3K5MA 3VQ8A 1K1QA 1Y97A 1IKXB 3PVXA 1RNHA 3LP1A 5F8NA 1JLFA 2XY8A 4GMJB 1Q9XA 2YNIA 2OZSA 3IGNA 2KFNA 4CESA 1NJXA 3QGHA 4KB0A 3C6TA 3AVAA 4J9LA 2OPQB 1NNDA 1L3VA 4DS4A 4NCGB 4H4OB 2OYQA 3QIPA 5HP1B 2P5GA 1HYSB 4FW2A 1SH3A 5KFAA 3CVKA 4F50A 2J6SA 4FM0A 1C1BA 3EPGA 3OL7A 3QIDA 4KE5A 3UR0A 1QE1A 3L3VA 4N41A 4TN2A 1JLGA 3OYEA 2R2SA 5KFIA 3L3UA 4FZYA 4IH7A 3H98A 3VQBA 3HVRA 3RMCA 2VG7B 3QEWA 3ZSOA 2DTUA 4KB7A 1S1XA 1D5AA 3CJ3A 1X1PA 3MEGA 3AV9A 1N48A 1NOZA 5T7BA 2BR0A 1RTIB 2HVHA 3GIKA 4J2EA 1XHZA 1Q8IA 4N56A 1MU2B 4FK4A 2E6MA 5DQGA 4FS1A 5KFRA 1S0MA 2WOMA 3I0RB 3PX0A 5KFVA 4ID1A 5HLFA 4NZ0A 3BQ2A 2ASDA 5D3GB 3MEDB 4RNHA 5DQHA 3BSNA 4KI6A 1I39A 4ED1A 2D7SA 2D3UA 4RW6B 3M9MB 2HHTA 1C2PA 3DOKA 2FLPA 3DI6A 5KFSA 2P1JA 4DTRA 3ZSZA 1IKYB 4CEFA 3P1GA 1T7PA 1QQCA 3ITHA 1S0NA 4ZVHA 3PW0A 2FBTA 4O3QA 4ECYA 2BANB 4Y34A 4Q5VA 3MFHA 1RTHA 3TVKA 3HSTB 4DF8A 5D3GA 1LWFB 3I0SB 1Z4UA 4ED3A 3MR2A 4KHWA 1QSLA 3LP2B 3FFIB 4NLWA 3AO5A 3HVTA 4I2QA 4J9PA 3AO2A 3VQQA 3ISND 3OLBA 3S3NA 2G8IA 1TV6B 3HO1A 3H40A 1RT3B 3VQ6A 1ZBUA 3L2UA 1T05B 3SUNA 4WE1B 2RKIB 3OYLA 3GILA 3AVBA 4YR2A 3F9KA 4FK2A 3BQ0A 1U45A 5C5JA 4M3TA 4O44A 3AVFA 5DK5A 1KHVA 1OS5A 2V9WA 1JXEA 4Z4HA 4ED6A 1S1XB 1QE1B 4DQQA 1C0TA 1UWBB 4ED8A 3L2WA 3C6TB 5C42A 4FLXA 3TANA 4PWDB 3OJUA 3DMJA 1DTQA 4KAIA 1WSIA 2R2RA 4ZHRB 4URGA 2WK4A 1TL3A 4ZPBA 4HKQA 3ISNC 2YKMA 2G8KA 4TLRA 2UVRA 1IKVB 4Q8EA 3CJ5A 1SV5B 4MKAA 2ATLA 4FS2A 4FLTA 4MK9A 4ED0A 3OL9A 2VG5A 4C8OA 4Y2AA 4Z4FA 5KG3A 3PW4A 4CF1A 4BDZA 4DSKA 4K8ZA 3Q8SB 2DPJA 1I6JA 4N47A 2XO7A 4TXSA 1JXLA 1DTQB 1JL2A 1T94A 4NLQA 4Y3CA 3NH0A 2NUBA 4CHPA 1BGXT 3M9OB 3DRSB 1S1UB 4NLOA 3QZ7A 4Q43A 1C0UB 3U6FA 1NKBA 2AWZA 4HYKA 1Z26A 1UA1A 2V4RA 3KLFB 4CJSA 2W9AA 5DQIA 3KK1B 1C1AA 5KG1A 3JYTB 4ECTA 3QNOA 4NLVA 4KREA 4RW7B 1GOCA 1RTHB 4JS4A 1KVAA 3DM2A 2B6AB 2RDJA 1K1SA 2D5RA 4DTSA 3ALYA 3V6KA 4F3TA 2HNYA 2DFEA 1S48A 3V6JA 2XI3A 1BL3A 3MXIA 3PHEA 4NRTA 4WYLA 4CF2A 3H5SA 1RT7A 4R5PB 1JLBB 3I8DA 1T05A 4Q0BA 4H4MA 2YV0X 4CFAA 3WNFA 2IMWP 3NGIA 5F8LA 4N5SA 2I5JB 3DLGA 3N6MA 4R8UA 2KTQA 1RILA 2RF2B 4DTUA 3BDPA 1ZETA 1NK5A 2C28A 3KTQA 4Q8FA 4WFZA 4TQSA 1J54A 4EP4A 2JEIA 3GIJA 4JV1A 5KG7A 3M8RA 3M8QB 4KFBB 2XRIA 5L1IA 3NF6A 1ASVA 4K4TA 1BCOA 4RW8B 4FW1A 5FDLA 5DGAA 3L8BA 2AGPA 3SCXA 2R2UA 4ECZA 2RF2A 3SQ1A 4MFBA 3E51A 3V6DB 2YNGB 5KFGA 2BRLA 1S1WB 1S5JA 4CEZA 1REVB 2GUIA 1FK9B 1TKZB 5J2NB 2X74A 2JEFA 3DYAA 3OYCA 4E7LA 1IG9A 4EBEA 3KHGA 5DG8A 5CYMA 1XR7A 3K5OA 4C8MA 4JUZA 2E9RX 3PZPA 5HRNA 2E9ZA 1U04A 2GIRA 2XCAA 4IBNA 4I7FA 3TWHA 3LP0A 1UAXA 3KLVA 1KFDA 4JV0A
chains in the Genus database with same CATH superfamily
5L9XA 4ZVPB 2Y0SD 2DRDA 4XH4A 5A0YB 2ZJPL 4OJ3A 2YKOA 5C2CA 1TYQB 4QIVA 4CJKA 1U1OA 3CHWA 3VAFA 1W97L 4CFCA 3MECB 4CJVA 9RUBA 1RBAA 4B1VA 3QEPA 1NLKL 2MLXA 1GFWB 2HQGA 2CIMA 3DLGB 1SQEA 2UP1A 4EZ6A 2EBGA 2ZOMA 3UE2A 2G8WA 4QW9A 5LMNK 2CG4A 2ZM6F 2GC8A 3Q8PB 5F8IA 3H46O 3AVIA 2GHVC 3FGUA 5T7LA 4DTXA 2K2PA 4R79A 5DMRA 3OTDA 2YY3A 5G4DA 2WFBA 1SS6A 4IWVA 1TGOA 1HR0K 2CJXB 1N34J 3E66A 3OFEA 1WI8A 4J9RA 3IGVA 1JKHB 4Q0BB 1ZM9A 4K4SA 2DFFA 5KFHA 3HHKA 4LH4A 1X8DA 3OA9A 4O3OA 1B0TA 3A1YG 1XQIA 5AQTA 5KFTA 4DQRA 3DLEB 4DN9A 3QT8A 1T8EA 4WFBL 4DPUA 2G8VA 2D3ZA 1ZAXA 4CJTA 4ZCLA 2UXCK 1NOYA 1TVRA 5K5MA 4LF5J 1S6QA 1EIYB 3DGPB 2XBPA 2Q6BA 1U24A 2HRUA 3SDEB 2PYLA 2ZH8A 4DTOA 1NU4A 5F9LA 2V8PA 1RU1A 3IBWA 3THXA 2QLXA 2BACA 3O4QA 3S3OA 4WZMA 1VSKA 2BM0A 3TPQA 2ROEA 1KVKA 1RK8A 2HHSA 4WBFA 5DM6L 4A46A 2ITGA 2CNKB 1FJGJ 5GAGP 2OTJN 1VQ5N 3G8TA 1WHWA 1ZAVA 3FQKA 1BXNA 2BV3A 1FJGF 2HBJA 2OPRB 4USHA 4F25A 2DHSA 2XMTA 2AKWB 2Z0GA 2E5GA 5KGWA 2W2OP 4NL5A 3THYA 2GA7A 4IR1A 3K9KA 4YOUA 4C3LA 2GHWA 3RB0A 4J9NA 4TLQA 3GV8B 4NLRA 3VALA 4IG3B 2F8TA 3EZUA 5LMUJ 2QWPA 3IM9A 3CDAA 4QWAA 2DGUA 1U0SA 3PEHA 1NG9A 2W9CB 2F8EX 3ENVA 2MY7A 3PFEA 2J9EA 2ZZMA 4QU7A 5ITHA 1V6HA 3OS0A 2AZ3A 1U48A 2C2DA 1OIAA 3NF9A 4ID5A 3TQ1A 1T9UA 3H2VE 2MKCA 3CTRA 3QLHA 1S9FA 3CM6A 4K4ZA 1CBKA 2AGOA 4JI4K 1IBLK 5HBMA 2O8EB 3CPWR 5HI7A 1X4AA 2Z2ZA 3VA3A 2IAJB 1KDNA 3MOZA 3IS9B 4KH4A 3O3FA 4CYUB 4FM2A 2R4FA 4K5RA 3RSEA 5A8KA 5J2MA 5MAOA 3O3HA 3KD5E 2B0GA 4C4WA 3WC2A 1FTCA 1HNIA 5DDOC 1BIZA 3RJMB 4ZLLA 4KH6A 1VK0A 4KHPK 2VZ9A 4ANCA 1SUQA 4RUBA 4YHHK 2W4PA 3UNYA 4WFNQ 5BREA 4LF1A 1NGBA 3VQCA 1CQNA 4QYZK 4PKHA 4DR4J 3C14A 3CDWA 4U6PA 1PSDA 1RT5B 5CZVA 4X66J 4G9ZA 4C2MA 2X6NA 5ETOA 2RRBA 3HPGA 1FKOA 4M8LA 1RLDA 2GX9A 2OHDA 1RHJB 4K4VA 2YNFA 1FDDA 1UJ6A 2UUCJ 5GAEI 4PABA 3P5JA 3P6YC 4CFBA 4ANEA 4JKHA 4EHTA 5CHIA 4DN0A 1N33F 4TU7A 1S9EB 2Q36A 3CJ1A 2A3ZA 3SCJE 4X4PA 3K2PA 5DDRC 2E9TA 4HTLA 1LFPA 3DKDA 3J81U 4B3SJ 1VQLN 4C3KA 2LXIA 3G6VA 5BXIA 1BIUA 4H8KA 3CFOA 4Y2IA 3GMGA 2O8EA 1S79A 2OTLS 4KHPJ 3O08A 1HYSA 4JI8J 1QUVA 3DRSA 2RDIA 1XMBA 3DRYA 3NEKA 3PRBA 5KFJA 3FZ2A 2YH0A 3R7NB 2HGNA 2GJ2A 4ZIWA 4DX6A 4MDBA 1NH7A 1SC1B 1AA1B 5HROB 1HPZA 2G1DA 3UD4P 4RNNA 2I2YA 1ZBIA 2HQ3A 4B08A 3EY1A 3O8WA 1NKCA 2BJ3A 1W26A 1NU0A 1IKWB 4CLLA 2QL5B 1JXBA 2GIQA 5KFKA 3GJQB 3RU0A 3R3LA 3H1QA 1LAVA 5H1SQ 3FK4A 1RDAA 4JI1K 3E2EA 2BJ1A 3AAPA 3CMEN 1R8HA 3GYNA 4CLTA 4H03B 4WXOA 3M6XA 2RT3A 4RL1A 1RWMB 4DS5A 3HOSA 1D0EA 1EARA 4DR6F 2RJZA 3CQYA 3R7BB 3U7JA 2BJ8A 3AVNA 1F1BB 2C3PA 5MLCV 5LL6Z 1C0MA 4NXMF 1QZ5A 4BVOA 3DCAA 3HKZD 1JLEB 2R8IA 1WAFA 2KXFA 2LYVA 4JI6J 3FMWA 1E4GT 2G8FA 1NAQA 1JKHA 2P9KA 4CJLA 1RI7A 3ETMA 1RDDA 3ZT3A 2Z57B 1O51A 2CQGA 1S0VA 3DLKB 4O3SA 2P9IB 2ADBA 4K41A 1DQ9A 4KRWA 2KW4A 1HKBA 4DHVA 1X0FA 1VJQA 2OANA 4DV6K 1KVIA 1NGFA 3Q2TC 1YUWA 5DZ6A 4F4XA 2KG1A 4IZ9A 3BKTA 4ZVUB 1MWQA 1L3KA 4M45A 2YQ1A 2WTFA 2QA4S 1PC5A 1KLNA 4X4UA 2OZMA 3ENOA 2IIHA 4AUKA 4RWTA 4HUEA 4Q45A 4RWWA 4IG3A 5J2NA 2VD3A 4NCAA 3JSMB 1VQ8N 3QEIA 1RKJA 4E1JA 3E8OA 4KRFA 2IAJA 4FOEA 1RT4B 1Q5VA 1Q81T 2M9KA 2OP5A 2KZMA 2DGXA 5AFUH 3BSOA 2HVIA 4M5HA 4C9DA 2ZHOA 4ECXA 3CO0P 4PZVA 4N7TA 4DV4K 4G3IA 4CK1A 1RTJB 2BJ7A 4QOTA 5AQFA 3HT3A 2KRRA 1T9TA 3VGVA 4X62K 4E7HA 1T03B 4LQ9A 4DR6K 5CE3A 1R0BG 4KHRA 3MTJA 4ILJA 2GWJA 3SSQA 2DO4A 2WVEA 4YMEA 4IFYB 4PG7A 2FGOA 3U27A 4KH1B 5HL7L 2V4JA 3VGKA 3QWPA 3VTHA 1SIWB 3J81j 4JI0F 3KHLA 2APOA 1HPMA 4DX5A 1R31A 2DCLA 3CE8A 4CT8A 4ELUA 4EYIB 3ZSYA 4LRBA 3RRHA 4X4RA 1N34F 2HQFA 3D2WA 4I2PB 3BQ1A 3EGZA 5EOYA 1MN7A 3TTCA 1Q16B 4USTA 4C0BA 2K1RA 4NLTA 1TTHB 3H1VX 4TYAA 4NXMK 4AHRA 3BSAA 1WC0A 2OEMA 3A4TA 3TZYA 2CQBA 2DNPA 2LMIA 1Y9OA 1JJ4A 3TTFA 4K8XA 2KHDA 2RUSA 2V8GA 1YK9A 2IRUA 2AJ2A 2LLZA 4UY8T 4GVMA 3O9UA 5ETPA 1JK9B 3B6PA 4DL0C 3ENWA 1N5VA 2Z2MA 3WX4A 4IDKA 5KPRA 2X6SA 1RWNB 3HPHA 3LANA 2CPZA 3V4MA 1T3OA 1TAQA 3LZIA 3D2FA 1U2RA 1YX2A 1U2CA 3ZSVA 3KK2A 5GADU 4A8OA 4PL7A 2IM0A 2UV8G 5AQWA 2KHOA 5IOLA 2ATQA 4JKGA 1X0PA 4YB1P 2OPPA 3CDEA 1UETA 2BM1A 1M90T 3CC7S 2IA6A 3RRKA 4BGAA 4V19J 4P71A 3MD1A 4OI4A 1U6BA 2HBQB 1UPMB 1J5OB 4DEZA 1RBSA 1ZPWX 2IDOA 2VKRA 3SMZA 2UVWA 1K0VA 5K8MA 2M2BA 4FWKA 3SLCA 3KLFA 4X62J 1N6QB 1OH8A 5BN9A 3AARA 3KLIB 2DRAA 2A2DA 3EDQB 4RW9B 1YITS 3UDLA 3PHTA 2ZZNA 1XNQK 4J90A 4FBUA 3V1RA 3EGNA 1KRPA 3V4IB 2EFNA 2LQ8A 2HNZA 5E3AA 4Y6IA 2NSBA 4KV8A 4UOGA 2ZKTA 4CJWA 4NLPA 3IC1A 1BUXA 3K57A 1N5TA 1A5WA 4MK8A 1JLGB 2KL8A 1V4SA 2OFGX 5LT5A 3AJDA 2ZJQL 4HDHA 3ZTOA 1ZC6A 1HWKA 2F7VA 3F44A 4ZVFA 2CQPA 3QRQA 3P5BP 2FVRA 4FLVA 2A6MA 3MXMA 1KC8O 2J0WA 3W3SA 3KMSA 1ZBLA 3DDIA 3S3MA 3HYFA 4TY9A 2F7TA 3CETA 2CVEA 1VQON 2YPZA 3J7YU 1VRQC 2R2TA 2RS2A 3ENBA 1T9WA 3DWLA 4GVBB 1UTAA 5KFPA 3AA5X 4CEOA 2O8BA 4JK7A 4BDPA 3HJVA 2V8DA 5H9EJ 2F1FA 3R1HA 1RT2B 3HD1A 3KWMA 4BC3A 2J6TA 1PYTA 3LM9A 3RUBL 3NF7A 1R8BA 1BA0A 4M7YA 5F3ZA 3AXMA 4FVCA 2MZSA 4YDXA 1YRXA 3NXZA 2BZ2A 3PYDA 3V81B 3DLKA 2HNZB 2XSJB 4ZP7A 2AX0A 4B3TF 3QO9A 4ZOSA 3EPIA 3GP9A 2Z56B 1QVGM 1HJOA 4IDHA 3M6WA 3V9UA 5HBMB 1LFWA 4KR0B 4NASA 5J2QA 2O01C 2C2EA 5KFEA 2HHHK 1HNVB 3EMTA 3KIOA 2CGJA 2OA8A 4CNZA 3GFYA 3SEOA 4CYUA 3CSKA 4E1NA 2EWHA 3IWNC 1YITN 1F9HA 4BACA 3RB6A 3KOAA 4F04B 3UIQA 3RAMA 3MWBA 3KLEB 1NUEA 5ADXA 1N8RT 5LMNF 4KPCA 1BHLA 4OJHA 5KI6A 2RQ4A 2AP1A 1MROA 2LP4A 2WTUA 4H5WA 2LEPA 1IO2A 3R5AA 1RUSA 1KCFA 1P6TA 3PR4A 3RB3A 3EGVA 3EWGA 4JHDA 2HMIB 3OW2R 4Q7AA 1Y3KA 4ZPWR 3M1FA 3OPKA 3DDKA 2B8PA 1HPZB 2F5GA 2MQNA 3PW7A 3MN5A 1RSCA 2HFOA 1V5VA 5KG5A 1D9AA 5JUMA 1TL7B 3GE1A 4FKYA 3OYIA 4PQAA 2KM8B 3J80U 4C8ZA 4RKUC 3OHAA 4ZIVA 3NBPA 1YBAA 1B64A 3R5DA 3VAMA 4AHUA 3L0QA 4CECA 3P45B 1O1WA 4B3RJ 1HMVA 2JEJA 5HAOA 3QMLA 4B1UB 5T14A 5EWGA 2ZWPA 5FD1A 1SUQB 2OSQA 2C2NA 1SH2A 2BE7D 4DFMA 1V3SA 1TKZA 2AA4A 4FPAA 3ULDA 2HG4A 1KSPA 4TU9A 1IKXA 3EX7B 1HNXF 2POKA 3S1TA 4JI7K 4OGCA 5EU7A 3NVKA 1JLFB 1S49A 1B7YB 1DZ5A 1N5YB 1N52B 2OELA 3CCMN 3TOQA 1X4CA 4I6YA 2D0CA 4PWDA 3AB4B 1VQKN 3IA0A 2IOCA 2BJ9A 2LKZA 2EPIA 4FYVB 3LM2A 1TMMA 2XZWA 2HAIA 4F3OA 1P27B 2XEXA 3RMBA 3MR3A 2YTCA 2CDRB 1XWLA 2CPJA 4ZPAA 1ZYQA 1F2GA 3VQPA 4CO2A 1R3NA 3SPZA 2XNQA 3C14B 3DXKA 4M7XA 2GHPA 2FSNA 4WF9Q 1NMDA 2VWBA 1NZ8A 2DB1A 3OYNA 1RZMA 2DNYA 2DXEA 2R8HA 4GKKJ 4IG0A 1OVYA 4U7BA 2W01A 4LF2A 5E2QA 1XMOJ 2GQCA 5C0YA 3GCXP 4C97A 3T6BA 3TW0A 3R2DJ 2MKIA 5SWMA 3C0BA 3VZHA 3ZTQA 4QWBA 4PY5A 1BY9A 4DZ6A 1C4AA 1RAFB 1KLMA 5KRSA 3M8WA 4C23A 2G13A 2ZJRL 3NFAA 3UWTA 2NRRA 4ZDNA 4UQGA 3I87A 3DOLA 4I67A 5BPNA 2V4QA 2KU7A 3R97A 4C8KA 1E6YA 4DL2A 4A5BA 1UWBA 3TVYA 4J9QA 3CEDA 5BPMA 4CO4A 1VQ9S 4EP5A 2LQJA 3DLBA 5HMXA 3MCAB 2J7KA 5CCMA 2OO4A 5GADP 2IIRA 4CE9A 3OR2A 3HKWA 2J8SA 3MAAA 1A6LA 3CJSA 2C3UA 1VRUB 4YS2A 4FLZA 3PG9A 1NO8A 3VEOA 1MMLA 4J2DA 2KI2A 3DLEA 3LPYA 3AGKA 2QX0A 1YJNN 4H0TB 3D1OA 4CTAA 3M1VA 4ZPTR 2Q2RA 1CJUA 3UR3C 3CJ0A 4YDUC 2DGWA 3VEWA 2Z58B 1I3OB 3TARA 4ZK7M 3HULA 5IS2A 5EHHA 4IRCA 4GRSA 1VQLS 5IT9U 2XY6A 2QWQA 1VBZA 2DPNA 1IR1A 1FKPB 1AZSA 2NRVA 1S9GA 2H65B 1MSWD 1I3AA 1I94K 2KKZA 3PEJA 1S1VA 4QS7A 1KOOA 5C7PA 3MM9A 3EE3A 2BKPA 4CZFA 2C2OB 2FZCB 4IH5A 1OMSA 2QWLA 1WWHA 4QPTA 3TQEA 1U2FA 4UTGA 4WP8A 1FDNA 1VQ9N 4O4GB 3G0ZA 1P90A 1WJ9A 3L3CA 3LF0A 5CD4A 3DXBA 4W5TA 1RT6A 4CO3A 4YQWA 1H3DA 2VODA 4U96A 5KG4A 2H5JB 1DTTA 3OYGA 4U9RA 4HL9A 5H1SV 5KOWA 2MXYA 4ECVA 1PJ7A 1F3FA 2E4LA 1RDBA 5F0WA 4C0HA 2ATCB 4LSLA 1S0OA 3LPUA 2Q3SA 3CCRS 1B3TA 4F4WA 5AQQA 2G0CA 2FD2A 2C2KB 5ETTA 4DUYF 3KLEA 2NZ4A 4CIEA 3AA3A 3C6HA 5KFWA 3MM6B 1YJ7A 3QPIA 1VSHA 2CKWA 3S01A 3H59A 2PZSA 3NG8A 4Z94A 4MH8A 3MMAA 4HACA 4J9SA 1Q9YA 3FSIA 3IMQJ 4CW7B 4QU6A 4Z4IA 1RABB 2PDAA 4RWXA 4FLYA 2CZ4A 4OX7A 2EKNA 2QWNA 2DNGA 3I56S 2NR0A 2QV6A 1IQZA 2I9SA 1C1CB 2QWOA 1HW8A 1RT6B 1TQLA 3VN5A 3T3FA 4OZJA 4OZ0A 1RP5A 3QT7A 2JLEA 1T3NA 4KFBA 3UD5A 2IC3B 2BUPA 4OZ2A 1WN7A 5LXYA 2N7YA 2HK3A 3MAHA 3QAEA 4QPXA 1V3ZA 1IWAA 1RQ0A 1HHTP 2FPHX 2N3LA 3JTOA 2YNFB 4CI6A 1EETA 2F9TA 2HS0A 3DXMA 3S7RA 2QFJA 3AAQA 5HJYA 3QNWB 5KFMA 3RBEA 3H25A 2G2ZA 1N5YA 5HN0A 2EWSA 2XB2D 1PYOB 2W7OA 3NMUA 2DITA 2BE2A 4ZTFA 3ILJA 3AO4A 2JDJA 4CLWA 2W9BB 2FJXA 4JI8K 4FJJA 3MUMP 1RWUA 1WUUA 2WSFC 2M8DB 4DR7K 3CJ9A 3JQJA 1T11A 2XULA 2YX1A 5AQHA 1JLFA 4DUZJ 3HCXA 2QSWA 1DY3A 1B7FA 3PYEA 2A42A 1HLUA 3IGNA 4CESA 1FO1A 3N4QA 4ZCKA 5SUHA 4J9LA 1L3VA 3HHLA 2V52B 1FDAA 4NXNF 4IOCL 3MHYA 4LRDA 3QIPA 3J7YI 2OKQA 1HYSB 1DURA 2GIFA 2J6SA 3R1LA 1FVSA 1C1BA 2W2PP 3OL7A 1ROFA 4FDFA 5GAGU 4CD1A 2HBYB 1PBAA 2RE2A 1SB6A 4B3SK 3M2VB 1JLGA 2KJVA 2R2SA 5KFIA 4IH7A 3VQBA 5HVGA 1UP1A 1VK3A 3ZSOA 2DTUA 1NSKL 4KB7A 1S1XA 2NRXA 2IY5B 4WFNL 3CCUS 5LXRA 1X1PA 1OY9A 2H54B 1KAZA 1HD0A 1J2VA 4ISGA 1NOZA 1WEZA 4PL8A 1VISA 6FDRA 4J2EA 4X64J 3UKRB 4EAHD 1ZM2A 1SKUB 2EW9A 2D1KA 5KFRA 4DV3J 1ZA1B 2WOMA 3JSYA 5J1NA 2QIFA 3PX0A 4LF8J 4PG4A 3BQ2A 2ASDA 4KI6A 4OX9J 1HI0P 1I39A 2UXDK 4MLHA 4ED1A 2VFRA 3WQUA 3M9MB 2ZJQQ 1N33J 3CD0A 2ZBIA 3CMQA 2FLPA 2CH6A 5KFSA 2P1JA 3MN6A 1TFWA 5KOXA 4USKA 2HS3A 4NE9C 3MM8B 1QQCA 3JS9A 4BR7A 4O3QA 1VHIA 4GO7X 3W62A 4X65F 2C42A 1RTHA 3W3DA 4DF8A 5D3GA 1LWFB 1RAIB 1RAGB 1YJVA 1Z4UA 1WEYA 3MR2A 5AR0A 3FFIB 4ZCIA 4G6VB 4NLWA 3R5CA 3AO5A 3HVTA 1A7GE 1RXOB 1EAYC 4RTFD 2G8IA 4ZN1A 2J4RA 1UW9A 3HO1A 3BDEA 3VQ6A 3L2UA 3GBTA 4WE1B 5B09A 2NPIA 3N5BA 3GILA 3OYLA 5IM0A 2BJEA 3ZTSA 2VOOA 3B8HA 1IBKK 5HL7Q 4FK2A 2DR8A 5C5JA 1CULB 2DH9A 5DK5A 2K1RB 3D1HA 1OS5A 3A8IA 1X5OA 4OIXA 3W9JA 1S1XB 5AQVA 5FPNA 1K73O 1HX1A 3G82A 1YJRA 4ED8A 3L2WA 4KHPF 1VQNS 4DR3K 4KAIA 1WSIA 3KG0A 4JYAJ 2D69A 4UZCA 2WK4A 1TL3A 1ESVA 2G8KA 2IMOA 3M4XA 1Y11A 2W7AA 4Y2MA 4DCJB 4C8OA 2HVDA 5AQRA 1J5EK 3PW4A 4CF1A 3Q8SB 1ZBSA 4EWTA 3UCZP 4N47A 1JXLA 3Q89A 1UFKA 3GYGA 2DO0A 2XZDB 4JI3J 2ERRA 2DGOA 2GVZA 3QBCA 3QZ7A 4Q43A 1C0UB 3KDOA 3PACA 3R9PA 2HBRB 3MMCA 2U2FA 2ZVSA 3KLFB 1QZ6A 4CJSA 3UCGA 5DQIA 3KK1B 3JYTB 3QNOA 2JVOA 2GGPB 4DR7J 4EK2A 4GVEA 4MO5A 2Q1NA 4F4AA 3CMAN 4UT4A 4F3TA 2I7PA 2C3OA 3VF0B 3V6JA 2VL1A 1UVKA 3MPVA 5A8WA 2V2KA 5AQMA 1H98A 2DNOA 3JTPA 4AF1A 5E5NA 3H5SA 3CXCM 1WG5A 2E88A 2YV0X 2CAJA 4UY85 1HNZF 4K0KJ 1N32K 3ZX3A 2EK1A 3WNFA 3NGIA 1YI2N 2I5JB 2AMCB 1D4XA 4JI2J 5ETKA 4DTUA 3CCSS 2HZCA 1ZETA 2C28A 4WFZA 3A5LC 1ZA2B 1M1KO 4DR2K 2UUAJ 2JEIA 3GIJA 2P9PB 3M8QB 1FD2A 4ZVRB 3R1XA 1WOPA 4KGKA 4KFBB 2BW7A 3NF6A 5L1IA 5M2RA 2A2CA 4ZLPA 5FDLA 2AGPA 4DR4F 1YQHA 3GR0A 3WXIA 4ECZA 4A47A 4HT5A 3CC4S 3J7AN 2RUGA 1WACA 3E51A 5IV4A 2ZH7A 1Q86T 2CNNB 1DQ8A 2G9OA 2GUIA 3OUYB 1UFLA 1CEZA 1Q86O 3W0LA 3UW1A 3TRGA 5DG8A 1BC6A 4DUYK 2E9RX 1ZM3A 4I0WA 2E9ZA 1U04A 4I7FA 3IAM9 4DFPA 1N5QA 4LREA 1HQUB 4CJEA 3OBWA 2JFKA 3CD5A 4ZVGA 5HROA 4XDCA 1IJJA 1U1RA 3I55N 2FC0A 3WBZA 4DF4A 3C2PA 3FKBA 1J5EF 4NZ6A 4H0XB 3GFXA 4ZJLA 4BC9A 2HHWA 1ASUA 3OTOK 3ZC4A 1Q79A 2WONA 4F0KA 1VQ4S 3TSUA 3BYRA 3PXGa 1HI1A 1OY6A 2JWLA 3OHBA 1GMVA 5AQJA 2VGNA 4X64K 3ASMA 4DLGA 2I5JA 1GTHA 3WHIA 4DV7K 4LR8A 3UDEA 1QJHA 3IUCA 5I42B 3HXMA 3BBCA 3NCQA 4CEBA 2IDLA 2CYYA 1SL2A 3MXJA 3EE9A 2VU5A 1KTQA 2QA1A 5F9NA 2Z1GA 1Q1KA 3DOLB 3O6QA 1MNEA 4JD2A 5CABA 4JLHA 2H4WB 3CCRN 4G1PA 4DR1J 1VBKA 1TK5A 4RJVA 4MKYA 5U47A 5KGXA 1IWGA 1WOOA 3UN2A 4B1ZA 3LWMA 3O1WA 5AZJA 3ITHB 4BHQA 1R8PA 2V51B 1PJ6A 1WSEA 2YQ0A 2ZBCA 4AHCA 4LRCA 1RACB 2XHCA 2JL9A 2GX8A 4E89A 3DOMA 3H20A 1YJ9S 1VYAA 4DR2F 3BZCA 4A8MP 1YJWN 1I51B 2HOEA 3IS9A 3IAYA 3NNCA 4IRKA 2RAQA 1R0AB 2WZ1A 4KH5A 3Q0AA 2GAGC 2V9KA 1NSAA 2PI4A 5A8KB 4FWQA 3JB9k 1URRA 1FKOB 3R5BA 4YY3J 3P4UB 3ZZUA 3PRDA 3VF4A 2FHOB 2FLNA 4B3RK 1RA7A 3SI8A 2B9XA 3CUNA 1LK7A 4OO1J 2XHWA 4CF9A 4JN4A 1Q82T 3KJVB 1IN0A 3SXLA 4M42A 3OYDA 2QM1A 1PIEA 5AXMA 4MIAA 3R9LA 1QSSA 2UYTA 3RSEB 1NMEB 3VGLA 1U1NA 4IO9L 1SL0A 4QQBA 4XTTA 4PUOA 1X4HA 4CO5A 1HRHA 3QLHB 3DLJA 2M88A 3QGGA 1VQPS 5KT4A 4EZ9A 3Q8UA 2V2ZA 2L9DA 2C3MA 2JOQA 1H1VA 4QIGA 4X64F 3O6WA 3QBXA 4LBPA 1NK9A 3ZZZA 1HD1A 4LSNB 3DN9A 2W6KA 2QO3A 3RMDA 1WF1A 2KQ2A 1R89A 2EFPA 3F9MA 4BRPA 4K4YA 4CRJA 2IJRA 4H5NA 2R7UA 3J7A1 4IO9Q 3JSMA 3BGLA 1F60B 3BZKA 4QWDA 2HMIA 1KVBA 4R25A 3T1HJ 3IBCB 2QC3A 2Q79A 3W60A 4OHYA 2GMHA 4FJHA 2PY5A 2CNOB 3MPDA 2ZJPQ 3U3YA 3CDBA 5M1QA 4OX9K 1G1XA 4XO0A 4OKEA 2KN4A 3VGTA 3QICA 3A3NB 3AO3A 2VQEK 2P9UA 3KLHA 3ZX2A 2WVFA 2LQ5A 5JS2A 3D9BA 2OPQA 1IKWA 2ASPA 2LU1A 3SQOP 2CGKA 1CZBA 3KUGA 3HZEA 1JB0C 1I5OB 2DY4A 3ID6A 2DCUB 5F8JA 3M8QA 1Y4ZB 1YVFA 4CF0A 1K6YA 3N6NA 4NYOA 4C7QA 2HB5A 1YLXA 4CJFA 3L6QA 2HKEA 4QS8A 3THVA 4M41A 2QMWA 3W61A 5H9EK 4IKFA 4V19S 1QVGR 3UO0A 4NXNK 4KI4A 3LO3A 2GVDB 3OYMA 3POTA 2RU3A 4C8YA 3NOCA 1RBVA 4FYYB 3PUFA 2XSJA 1NHUA 3EVWA 4CJ5A 1SJ1A 1VSJA 4OLBA 4HHJA 4CEQA 2PT0A 3WEEB 2A3JA 1NK8A 2DKOB 1U49A 3UI3A 1XNQJ 1YRUA 4OHVA 1XNRF 2KJWA 4M95A 4MYUA 3UKRA 5A8RB 4DV1F 3RBDA 4IQXA 4KB1A 1GMUA 1IBMF 1RLCL 4OZNA 4I6AA 1EO1A 1JLAB 2R9LA 3CM5A 1U1PA 3R5JB 4ZS6A 2RRAA 2QWRA 2FYXA 5DG7A 4LVNP 1Q0NA 4PAAA 3GOIA 1M90O 2RIJA 3CNQP 2R8JA 4EHUA 1WDTA 3ZSXA 4OX9F 5EY4A 1RT4A 5F3TA 4QWEA 4B17A 5IQ6A 3LA0A 4JKDA 4O3NA 2CZVC 2FBYA 2MYFA 3DOMB 3AOAA 3HZ6A 1V5IB 1NDPA 2QT7A 3CO9A 3BF3A 4CLYA 1NGEA 3SSRA 2KT5A 5BRHA 1UW4A 2XMKA 1RBTA 3AJ1A 2K8GA 5D0EA 5FLXY 5JVGL 4W4MA 3O5BA 2FF6A 4PG8A 2MKHA 2O1PA 2B9YA 4YEAA 3I96A 4RNOA 2PI5A 2XSFA 3I55S 2QZ8A 3TAMA 4YOTA 1TKTA 2GJFA 4FJIA 1W2BM 4YNQA 2MQQA 3QZ8A 3SUQA 4ILGB 5BRDA 3THXB 4DV4F 4JI2F 3JTNA 4CK3A 3V9XA 2ZH3A 3EICA 2P9NA 3FMBA 1GXUA 4O8UA 4PA1A 2Z1HA 2WRMA 3PRVA 4NPOA 1WKKA 3VR1A 1JLBA 2IVOA 3GSDA 2WVCA 4BE0A 2O3DA 1A0OB 2FVPA 1LQ9A 1U6ZA 1WTFA 3MM6A 2CADA 5HLFB 1CULA 2VASA 1OPZA 2AP6A 3H90A 1FRKA 3VA0A 3OQ2A 3TP2A 2PIIA 3EYZA 3PKMA 2ZUAA 1HR0J 1FRLA 4K4UA 1JNRB 1BQNA 1FNOA 1LWFA 1NB2A 4CCHA 4NZ7A 1UJ4A 3M6UA 3L7OA 3VQAA 4I6MA 4JNEA 2PEBA 1JCGA 3MCNA 2AYBA 3P4IA 4UOFA 4UW2A 2P9LB 3NH2A 2W6LA 4TVAB 3SAFA 5LJVA 3O80A 4AXIA 4YUDA 3LUYA 4KHQA 1NMNA 5C42B 1HYZA 1SZ2A 1QM9A 4OZ3A 4IFYA 3ZZ0A 3MEEB 4XH5A 2W9CA 4NLDA 2FHMA 2VH7A 2NXJA 4CBWA 2M7SA 3SCKE 2WSCC 1F0XA 5CXTA 3SMSA 2GNKA 1LEOA 4PUOB 3BYPA 4KC5A 3DLLQ 2ZFHA 3MZIA 1BI4B 3MDFA 2E5LK 3P8BB 1IQTA 1KC8T 3IXQA 2E1PA 2HWTA 1EX4A 3AVLA 2HW3A 2XZTB 1WOQA 3HHEA 1NBEB 1IBMJ 5A6WA 2ASOA 3I82A 3OS1A 3V9SA 4HVJA 3OW2M 3TX0A 2ETJA 1GQEA 1FRMA 1VIOA 3KNAA 2E2PA 4CZLA 1WSJA 3CFRA 1HARA 3LW5C 2MKJA 3CXCR 4QOZB 2ZHAA 5EX5A 2VQFK 2IJFA 2CXEA 5ETSA 1BHNA 3T5HA 1CJUB 3M8YA 3SDEA 1S7IA 3AQOA 1Z05A 2DEJA 2AT1B 1KAXA 3I0RA 1X9MA 1RBUA 2LU2A 1RCOB 5KFCA 3ZT0A 2VKZG 3RB4A 2YKNB 4HH0A 3QGIA 1YT3A 1AUSL 2H3EB 3R8EA 3C15B 1C4CA 2XYGB 1DEJA 3CJ7A 3FQLA 3PLAA 1FD8A 2LA4A 4DR5J 5CZ1A 2CUYA 2RHQB 1OSDA 1L3TA 4JD2B 2W2NP 4B9LA 3LAMA 3J80Y 4PEOA 3WNGA 1KEKA 1SIZA 1ZBFA 3M1VB 4DV0J 2VICA 1KFSA 2MJNA 1M1HA 3MPUB 3IDHA 3FBCA 1EWQA 4L6V3 5KG6A 2JEGA 1KD1T 2VCPA 1RT1B 3VF6A 2HF4A 4P75A 3BKUA 2MEWA 4RW4A 3MEGB 4FN5A 1WC1A 4ZVQB 2N3OA 5DGBA 5E3RA 4OFZA 4CHNA 4DV5J 4B9SA 2B4VA 3A3PB 3QNNA 3W9IA 3QESA 3AO1A 4AQYK 3GIRA 4NLYA 4NA2A 2IRXA 5D0RA 2E2NA 4PRFA 2KYXA 2YHYA 5ELZA 4KY3A 3T1HF 4OI3A 4NLSA 3RG6A 5AZJB 3ET6A 4YHHF 2VJUA 3P39A 1DFDA 1IV0A 2XCPA 3DMJB 4CDIA 3VETA 3M2RA 2RHSB 4Y1CA 4LF8F 2G4BA 3NS5A 2M5YA 4JYAF 4C11A 2NREA 5IWAK 2YWEA 4Q44A 4K42A 3LGNA 3H2LA 4FWPA 3VWSA 3UKUA 2YHBA 2EX3A 5FLXO 3PO5A 3G6YA 5AQOA 4H4KA 4QIWD 1NZAA 2YQ3A 1RDRA 1WD6A 4CGGA 3UPFA 3QEVA 2GS8A 4X4SA 5GAHI 3EZWA 4FLUA 2Z2YB 3K2YA 3S9HA 2E5IA 1VSMA 4BRKA 3KHRA 3CCLN 4M5MA 4HDGA 4PXCA 2N7CA 4X4OA 5KPZA 5BYRA 3ZETA 3PO4A 4AQYJ 3V6DA 2Z1IA 2CPDA 3HT0A 3TJ8A 1X60A 4IXCA 4MKVA 3TZZA 1U6FA 1V9OA 5BRFA 1YIJS 4TYBA 3LALA 1TFYA 4S0MA 1LCUA 1NK6A 2QKBA 4B3MJ 3TJAA 4LFCJ 1O0PA 2D4WA 2J7UA 1VSDA 1OH6A 1KVCA 1G99A 3DRRB 4DTMA 1SC4B 4NYFA 4HEA9 4B8CA 3BGRA 5C10A 1XTZA 4BDYA 2KFYA 3HM9A 3OYHA 3EKUA 2FDNA 3QRPA 1U26A 2OD6A 2ZWHA 1Z2LA 3KK1A 1MDUB 2CJQA 3DDNA 1HMVB 2E1MC 3I5AA 3RZAA 1GXTA 5E33A 1IBMK 2BA9A 2KT2A 1BU6O 4YR3A 2R8KA 4IOBA 1PILA 1LW0B 2O8DB 5AJ3K 1OVQA 1H6KX 4DU8A 2BOAA 5KT7A 1BQMA 1X9WA 5DS7A 3M05A 4HHUA 2X78A 3WNHA 1QTMA 1UJ5A 5CH7B 3SV3A 5JVHL 2E66A 3PFOA 3PW5A 5KG2A 2CNLB 3CQ8A 2UXDJ 2V7ZA 3G4SS 4H5RA 4CIOA 3GG0A 1GT8A 1YVUA 4FSVA 4LRFA 5LY3A 3D7SB 5G0RB 4FWLA 4U67L 1S77D 2V8HA 2I8EA 3V4IA 2XC9A 2FSKA 1CJTB 1FW6A 4XAKA 4HUGA 1Q8KA 4WFYA 3MMBA 1SCJB 5JS1A 3VAGA 2HMPA 1T0TV 3DHXA 3HOTA 2F9DA 4F9OA 4NMXA 3S8SA 1Q7YT 5AQLA 4ECWA 4OMFG 4M3UA 1VMBA 2XWYA 3AH6A 2VPXB 3MR5A 1CZ9A 1GOBA 3T5KA 1Q7LB 4QR0A 3ZSRA 3NY0A 1P9YA 3OD2A 2J9DA 4UUXA 3M3ZA 2YKNA 3R27A 4PR6A 3QYYA 4OKJA 4RW4B 2D3O1 2E29A 2IPOB 1IXKA 5EXWA 4DLEA 4B1YB 2R7SA 3BN7A 4EBDA 2L3MA 2ZBRA 4E98A 1EETB 2CFXA 2ZVIA 2VHGA 3LL3A 1HNWF 3MM7B 3F0NA 1UEUA 1XEZA 5BPLA 1S4EA 3NWRA 4CEEA 4HH1A 1HR0F 2A41A 3NGSA 1BE4A 4WQ4A 4B9UA 2HIYA 1SKSA 3GDQA 3T1YJ 3CMES 5A76A 5EDWA 2F63A 4CH0S 2VFSA 2HWHA 4CWBA 4LIRA 2OPSB 4LIWA 3KLHB 5JVHQ 5HMYA 3MR7A 4YB5A 2ROPA 3KJFB 5J1PA 4JI3K 3PIPL 3D6RA 3JSRA 3K0SA 2K7JA 3B82A 4DFKA 3OHRA 3OV7A 3NGYA 1YBTA 3FBBA 4PKGA 3LWLA 1GH8A 1QQNA 2FGCA 2E1ZA 1E6VA 3SQGA 2LDYA 4OPJA 2BE9B 3O9TA 4JRPA 4BRFA 2XS7A 1LOTB 5L8RC 2P2CB 1YJUA 2DYAA 1XC3A 4GMKA 3DRPB 2I38A 3AOBA 3C8YA 5KT6A 5T7LB 2CGLA 2W42A 3T41A 4JV2A 1BISA 3UCUP 2F4VJ 1VC0A 4BE2A 2BQRA 2PN6A 2B8QA 2UUBF 3TZWA 4LF4J 2E2OA 1Q18A 3GYXB 5LMUK 1UEVA 4DV2F 5GIOA 4F02A 1DLOA 4WZQA 4HI2A 1P1LA 3VVUA 1ATRA 2W40A 1K8AO 3MEDA 1C0FA 3SQ4A 1LAWA 3V1QA 1MWZA 4NMLA 1PKUA 2VIHA 3ET6B 2IGIA 3CJ8A 3KDNA 3UKUB 1HKGA 2O8CB 1HNVA 1T6DA 2HFNA 4N76A 4W5RA 3GV7B 5EX0A 1FXLA 4G1QB 5LJWA 3RRGA 4QR1A 2GMLA 2ZH2A 4HCBA 2HEKA 4ZA1A 1TL1B 1YVNA 3NGZA 5D4NA 1VRTB 2AJ0A 2ZC4A 4K2XA 1FKPA 1UVMA 2OI2A 2JRSA 4Y2CA 2LQBA 4OVLA 4OYMA 4TQRA 4DV1J 4QJVA 3NDKA 3CPEA 3C6UB 2BH1A 1L3UA 3Q8VA 3EEQA 1B4SA 2JX2A 3U1LA 3CC2S 2R7QA 4K4WA 3VAIA 1LWXA 4BCAA 1GMWD 5IV3A 3AAWB 1IR2A 3QWUA 1XNQF 2WVBA 1ILYA 5E0OA 1APSA 1NWKA 1RT7B 4R5PA 3H6EA 5HSPA 3C65A 4Y0FA 4I6WA 4JV5K 2MPUA 4R0JA 1EZZB 3MCPA 4M3RA 3PNIA 2IA0A 1U8SA 1WSHA 3NLCA 3WXJA 2JSXA 3RMAA 3T7ZA 3C3LA 2Z2LA 5IXUA 3C46A 1YF5L 4NX9A 3DU6A 4W90B 3G71N 2HS4A 3GPAA 4ID5B 3M7VA 4BLGA 1HHQA 4OL8A 3UD3P 5ADZA 1FI4A 2JLFA 1WC6A 1C0UA 1TL5A 3S41A 4K4XA 2DH7A 2O5DA 2V50A 2FXUA 4N8NA 2DR6A 3CT9A 1RDUA 3T1HK 1S6UA 1WSFA 3G86A 2HHQA 1OPIA 4UOCA 4Z4CA 2NYIA 4ZP9A 5B0AA 1CZAN 4B8AB 2ZM6J 5FRNA 1AROP 5C12A 3L95X 1E3MA 1CJTA 3CCJS 2XS5A 4C3MA 2XG8A 4LF7K 3NVMA 4C8LA 1HNWJ 3EZ5A 3OUYA 4ZVOB 5BYQA 4DMNA 1EKEA 4MMOA 4OPAA 1TUYA 4CGIA 4Y0WA 1RWKB 1X9JA 1FRIA 5B08A 3GL1A 2FJWA 3SBGA 3KK7A 1U09A 3V9ZA 2Y0BB 4U8VA 2EKYA 2EXUA 1TK8A 4P74A 3VENA 3OFGA 4JKCA 2OPPB 4OI0A 3O4NA 5K14B 4ZVSB 1VCTA 1ZOTA 3WEEA 2QTDA 3DGVA 2GBZA 1RBOB 3UVJB 1I94J 3GU0A 2RQMA 1M0SA 1TZ0A 5HQ8A 4LJMA 3B8AX 1R8CA 4LF6F 1N6QA 4PXEA 3G4SN 1XHXA 3A5NC 4I68A 3MFIA 2MGZB 5AQYA 1H2VZ 5E84A 4ILRA 2VFTA 4P2FA 2CDQA 4KKOA 4DU1A 2BVZA 4R0EA 4DOZA 4AM7A 2P5VA 1VI7A 4JI1F 3D54A 5C24A 4DQPA 3AB2B 4FPRA 1RT5A 4CH1A 2UU9J 1TK0A 2GFFA 4JI6K 2C22A 1KKHA 1TVRB 1HI8A 4XIUA 3FEZA 3QERA 2F9JA 3RTVA 4LF9K 2CQDA 4FOIA 1S1VB 4AHTA 1RU2A 4USUA 4O23A 1HUXA 2F9WA 3NE6A 4OX6A 3KKRA 4FXWA 3UDCA 3M8ZA 4EFAC 4A57A 4X4TA 4DHYA 4DV0F 5HVHA 1K1QA 1Y97A 4LF8K 1HWUA 4FPBA 4BS2A 1Y5IB 1FCAA 4GVLA 4AYBD 2LA6A 2KFNA 1Q8BA 3O2IA 3G6ES 3C6TA 3HF5A 4YOWA 5HP1B 4AL7A 2P5GA 1NH8A 3MK6A 2E1CA 4FW2A 1SH3A 3CVKA 1YXQA 2HPUA 3EPGA 3QIDA 3A5OC 2NRWA 1NGGA 4C1NI 2ZJRQ 3A8EA 3ETOA 1Q95G 2BJDA 3OYEA 2F8HA 2EFVA 1N36J 1ATSA 3QJJA 3L3UA 3NP5A 4FZYA 5C2DA 1HHSA 3RMCA 1SBRA 1NDCA 4QS9A 2JWNA 2AJFE 4WCEQ 4DUYJ 4BRLA 4JP8A 1Z1ZA 3GIKA 4MYTA 1VAZA 2MDAA 3H8YA 2XWXA 1MU2B 3TTDA 2E6MA 5DQGA 4FS1A 2CA9A 2UXBF 1FNMA 3H42A 4ID1A 5D3GB 1X3MA 1M5PC 1P1TA 3K8VA 2D7SA 3ULHA 3NGUA 2HSEB 2QL7B 4LF6K 3ZSZA 1B99A 4IJAA 3TA2A 3QSYB 1T7PA 4A48A 3ITHA 2L9WA 4ZVHA 3PW0A 4GKKK 1U8WA 1Q78A 2I0XA 1NCLA 4Y34A 4Q5VA 3MFHA 1VLYA 3D6HB 3W7BA 2RD5C 3BP8A 3VGUA 5M1OA 1QD1A 4OYBA 3HX9A 4WIQA 3GG4A 3AGRA 2CQCA 5LOQA 3G9CA 4K0KK 4M5LA 3AO2A 4LF4F 3ZLJA 3VQQA 4L73A 3ISND 2ZBQA 2LQ9A 3H40A 2P8IA 3MOJB 3W2VB 4YR2A 3Q83A 1S6OA 3HFVA 2E5LF 3BQ0A 3NRBA 3A8JA 1SXLA 2A10A 4AFFA 1H74A 3QMQA 4ED6A 2X3GA 2OIHA 5KPTA 1QE1B 1NPPA 2QGFB 2M70A 1G7CB 4DUZF 5C42A 4FLXA 4PWDB 2CJBA 3JXUA 3J7Z5 1DTQA 5B7WA 4URGA 2MZJA 4ZPBA 5GIPA 2YKMA 3W8PA 4WFBQ 5TKWA 2IHR1 4TLRA 3CJ5A 2HFZA 1WI6A 2CQ4A 1XMQK 4ED0A 4BBYA 2N4DA 1ZH5A 3JQMA 4CLKA 4P9SA 4X4QA 3A8YA 2E44A 2XO7A 1DTQB 1TYQA 2WBRA 4YHHJ 3NS6A 2JHEA 1BWFO 4FPIA 3NH0A 1NSPA 3UNGC 3DRSB 3J7ZT 4B02A 4DPOA 2EG2A 5CQGA 2XMJA 2ZM6K 2AWZA 3U6FA 1N32J 4NB4A 1VQSA 3CW2C 2V4RA 4BRAA 3WXKA 1X4GA 2GTDA 2D9OA 1C1AA 3TU5A 4L76A 4NLVA 1XMOF 4ZPVR 4JS4A 1KVAA 3JSBA 2ACMA 1BO5O 2P9PA 4P52A 2D5RA 2HNYA 3VEXA 1QAXA 1S48A 1BL3A 2GVDA 1KN6A 3R6GB 3Q86A 3PHEA 4NRTA 1HBNB 2F8MA 2FHKA 4CLUA 4AT1B 1WDDA 3CJKB 1T05A 3I8DA 1KQFB 4Q0BA 2AEFA 5T41A 1OY8A 4ZJQA 1K47A 3ZFVA 7FD1A 2IMWP 5F8LA 4N5SA 3N6MA 5JJBA 2MZTA 2P9IA 3FSYA 5D15A 1DT9A 2ZH5A 1NK5A 4C98A 1J54A 2ZC3A 1HNXJ 4EP4A 2KVQE 2DY9A 2QTWA 1OO0B 4JV1A 1IUJA 3IR5B 2DHGA 4M5DA 1F9FA 1ASVA 2H1YA 4RW8B 3K89A 5DGAA 1IVZA 3MGJA 2MKSA 5GMDA 2RF2A 4WTOB 4ES1A 2ZUGA 1CC7A 1FJCA 1AZSB 2HRYA 4P7VA 4CEZA 1REVB 2VFUA 2MKYA 2WAQD 5ETNA 5J2NB 1NDLA 4FKXA 4DU7A 4CD3A 4E7LA 4EI2A 4QYZJ 4E8UA 4P73A 3CCMS 1XR7A 2ZH4A 3FUYA 4C8MA 2DXFA 1FFGB 2NCKL 1H73A 3P49B 2DGTA 2P6SA 3LP0A 4I69A 3BZQA 3H7HB 1UMJA 1HNZJ 4ZPDA 5HP1A 4KV8B 5J1EA 4NYZA 2HBLA 4UZBA 1LWEB 2QA4N 1FF2A 5LJ3Y 1Q4RA 5F8HA 3L4QA 2OEKA 4DR5K 1QQOA 1BLUA 4JKFA 3SCLE 4AM6A 1W9HA 4FYWB 2J6UA 3BUZB 1R27B 3EXYA 7FDRA 2BTFA 1UKUA 4M5NA 3SUPA 1RAHB 1G3OA 5ETQA 2X1GA 3FCWA 5DG9A 4MFBB 2NZCA 2PMZD 2Q97A 2XI2A 4KQZA 2RNEA 4W5QA 1YTUA 3ILIA 4K59A 3FBEA 2D0PA 1A5XA 1OKJA 2Y8YA 5LL6d 2OPRA 2UXCJ 1UOCA 5IC6B 4J9VA 3KK3B 4CO1A 3KWGA 3HVTB 1DLOB 4OKKA 1N8RO 4F2SA 1T02A 3LDOA 4FJGA 2KLAA 4NLXA 2OTJS 3B4MA 2MMYA 4BRGA 1ZXOA 1HWIA 4DPWA 1QDUB 2HK2A 2J0SD 4ICLA 1BCMA 1N4LA 4CHZA 3MWPA 2LEAA 5GMEA 4JI6F 2Y1JA 2A1SA 5KFXA 4RW9A 3KZBA 4RBUA 1JWWA 4LR9A 4CJPA 3LDLA 2VQEF 1LW0A 3OVBA 1O6XA 4KAZA 5HMZA 3VZIA 2KG0A 1HJRA 1HBOA 2FF3B 3LDQA 1SJFA 5I3UA 5HRSA 5DZ7A 4CZIA 4GY2B 4O0JA 1TKXB 1S99A 1MWMA 3C16A 4USVA 4DFJA 5HRPA 3HPOA 4A8YA 2WSEC 5A6PA 2QE5A 5CZ2A 3H4BA 1RWVB 2DNHA 3KK3A 2VONA 5AE1A 3W63A 4PWUA 2ZE2A 1H7XA 2VJVA 2U1AA 3OL6A 1KLMB 2V63A 4QR2A 3G8QA 4ZLNA 4URSA 2CRLA 4HCCA 2AQ4A 3AVKA 1WC3A 5IQQA 2PFFB 2D1CA 1BOTO 2HHPA 5JXSA 2V7YA 1S7HA 3SI6A 1G6BA 3KWIA 3ZX0A 2OMOA 2MHNA 3GFZA 3HLUA 4E1MA 2CVIA 3MF5A 1HQEA 4H4MB 3MECA 4JEPA 4KYZA 4PPZA 4FJXA 4MQ3A 5K8OA 4RNFA 1H2TZ 3ULEB 5KFQA 4CFDA 3G8SA 3Q7BA 4X65K 4PHTX 5KAKA 3TEHB 4CM2A 5HOOA 2CJKA 2DR9A 3TSQA 3M30A 2JGUA 3RGIA 5IT9Y 1F5CA 1CC8A 5E41A 2VG6A 2KKHA 1BQNB 4IG0B 4ED2A 4F4KA 4RO0A 4DG1A 1FK9A 3AVMA 3LGHA 3PJWA 3IP0A 3OVNA 2FY1A 3QJPA 4BRMA 1UVNA 1F2HA 2KT3A 2GUPA 2LXUA 3CCJN 4CK2A 4JKAA 2MB0B 2CJ9A 1Z6RA 3GV5B 1T3VA 5F8GA 2UUCF 4M5DB 5D4LA 4CLPA 3CD6N 2L41A 4AQYF 1JLQB 1VQPN 5I3QA 2O66A 4F36A 1WNSA 3FCHA 3QETA 4ILLA 2V69A 1JLAA 4DR3F 3M2UA 4J9KA 1XJWB 4E0DA 1BG3A 2KZZA 3MMVA 1FEEA 3V9WA 2NYHA 4RW8A 1K9MT 3L2QA 5ETLA 3ZTRA 1A5VA 3R6LB 3TAMB 4U7CA 5C15A 4DV6J 1WTBA 1JX4A 1FFWB 4OJRA 4Y1DA 1ELOA 2J0XA 4B9VA 4DV3K 1FFSB 4KIAA 3PCOB 3K59A 3HVAA 1U1MA 1QQMA 4CF8A 3G96A 4M3XA 3JS6A 4J9MA 3M6VA 3O4WA 2RU9A 1B0VA 3U1MA 2ITMA 2BQUA 2OJ3A 4NYNA 4B9TA 3D7EO 5A2QU 4ZJOA 4CBUA 4EMDA 3ZSQA 2IYGA 5CAAA 2WONB 2DGQA 1S6PB 3O8MA 2PA3A 2KH9A 3B78A 3DRRA 1QAYA 1MWKA 1TAUA 3OVSA 1Y00A 1IKVA 4X84A 2W24A 4FF3A 4DSFA 3DNCA 2LEBA 1ZZNA 1SPBP 3OTOJ 4WK1A 3DM2B 4RZRA 1M5OC 4MIWA 3OXGA 3LDNA 2YHAA 2XGQA 1JLCB 2YNHB 2Y1RI 1UCNA 3THYB 1DBDA 2AU0A 1HBMB 4F7VA 2O8CA 1JXVA 4WKRA 1RA6A 2QLBB 2N82B 4CIGA 3K9JA 2B6AA 4FJ8A 1MA9B 3D0PA 3CCEN 2HVZA 2ILZA 5CYMB 4I6MB 3KKSA 5CZXA 3T1AA 4DR7F 4BR9A 4EBCA 3BBBA 4FXDA 2YWWA 2QA2A 4J2AA 2DHXA 4DR1F 3GJSB 5AJ3F 1OWXA 4L3KA 5D77A 5CR4A 4WU2A 4E7JA 4M3WA 1MLAA 1LXNA 2Z1JA 4LF4K 1BUPA 1VSLA 4P72A 4QIFA 3ZT2A 4X62F 1GLLO 5KFUA 5J2PA 4GC6A 2PFUA 3THPA 5IZHA 3PIPQ 2M8HA 4O4GA 2VQFJ 2GQQA 3CWJA 3HL8A 1ZAWA 3QAUA 4DTNA 3M8PA 4FJMA 3D0GE 4C8NA 1S1WA 2RSQA 3TJ9A 4J9OA 2KVIA 2IBKA 1YWXA 3O1LA 4WWSA 5KQ8A 4M1KA 4JKBA 3D67A 1UVIA 4WFXA 4H5TA 2HBZB 3K5PA 2QMUB 2FVCA 5KFZA 1KBRA 4XDDA 4TY8A 4DI6A 4JI1J 1Y64A 1RHRB 3ATVA 1R6YA 4YFUA 5I3UB 4IR9A 5CY4A 4LY7A 4KHNA 2V2VA 3GIMA 4NLGA 3NMAA 3NOGA 3KK2B 1Y0HA 2Q43A 3QT6A 4XPEA 3U9ZA 4N77A 3C94A 1RAAB 1M1GA 2G2YA 5C25B 3AHPA 3MMCB 1IKYA 4L75A 4XK8C 4F8RA 4NLUA 3D45A 2MZQA 2I6WA 3N9UC 2Y8WA 2YH1A 1U2VA 8ATCB 4ECUA 3PJXA 3TO8A 4LFCF 5H9FJ 4MLEA 1XR6A 2YI1A 2C2ZB 4RLEA 2IVFB 1MMNA 2VG6B 4ZTJA 4BWJA 4A8XA 3NF8A 5L9NA 1YI2S 5ETVA 1CVJA 2HFUA 1UVLA 2IRYA 1SH0A 5A0YA 4LF5K 1JJHA 3I6PA 3CIMA 3SFUA 3R2CJ 2OGUA 1GLBG 3CIPA 4Q2LA 2QMXA 4HTIA 3OY9A 2NRHA 4RU9A 5DRKA 5FPEA 1HKAA 4MIBA 4JOUA 2PGCA 2X1FA 2ZQBA 3EE8A 1LWCA 1CS4A 3W5YA 3FDSA 1Z25A 3DXKB 1SQGA 2DIUA 3CFPA 5K8PA 4A62A 1UFWA 1V3RA 4B3MK 2LFVA 3HP6A 1R59O 4I56A 4KGVB 5L38A 2XHBA 3N6LA 4O3PA 1S1UA 5HMWA 5M1PA 4LF9F 1U1LA 2G1HA 4P2SA 4OLPA 5A8RA 1N56A 4B9NA 5J1EB 4OPKA 1RGIA 3AFGA 1HQEB 4X66K 2UU9K 4MDAA 5M1KA 1S12A 3BGFA 1CXUA 4FF1A 3BF1A 2W2MP 3B6OA 4ALZA 3F56A 2GV1A 3AVHA 3HVWA 2EC2A 4CQ1A 2DVIA 1HWJA 2V0NA 1BDGA 3J7ZO 4DWIA 2FJEB 5IWAJ 3LQVA 2A1RA 2HZAA 2MQ8A 3DXMB 2VBXA 3E9PA 4K25A 5IWAF 1SJ4P 4NYPA 4L3QA 1VQOS 4DL5A 1PO6A 5HANA 4KGXB 2UXDF 1VBXA 2QRRA 1VIXA 1NGDA 3AA4A 4BRIA 3R3TA 4I64A 1Q7YO 2JZ5A 2W8KA 5DO2A 2A6OA 3Q8RB 4LQ3A 1VR6A 2ZOFA 1YG0A 1D1UA 1M5HA 3BO4A 2Y9HA 5SZTA 1GXLA 4DR5F 1QY7A 2EFQA 3FFIA 5E3PA 2KO1A 3TWZA 4FWOA 3I9V9 2HHHF 2GELA 3HMJG 5D6GA 3OXFA 5L46A 1PYSB 5AQZA 5D8HB 3H45C 2YWGA 3BREA 3WUHA 3DRPA 5D4PA 2W1BA 4WQ4C 3J80O 3MTKA 1S97A 4OI6A 4CM0A 5EGYA 4NA3A 3CGIA 4CGFA 1BWVA 4R8UB 3CJCA 3QJLA 2W2QP 4Z7CA 2ASLA 2VQFF 2R7WA 1XI1A 4EO8A 4TSXA 2K3KA 5GADI 1R43A 1KXPA 4IYQA 3WZ0A 4D3GA 2UU9F 3MM5B 3E01A 4P10A 1GNKA 5GMKa 1TL3B 5AFUA 3MN9A 2YKMB 2GZOA 3CCTA 1RGVA 2VA3A 1W0HA 4CEAA 1WSRA 2JLGA 3QFUA 4GV3A 3I5CA 4OYOA 2COLA 2X51A 1J6ZA 2V94A 2HGMA 4CEDA 3LP0B 1Y7PA 2BUNA 4ETXA 2CQ0A 5KTQA 1VQ7S 1JMTA 3C6UA 3QO9B 4RUCA 2LSNA 4C48A 3KYLA 2DK2A 3VEVA 3ZSWA 3MCMA 5KFBA 5E7OB 2XNRA 5BR8K 3V1OA 1TKDA 1JLQA 1H72C 1U47A 5K20B 3GIIA 1PGZA 1GEHA 3OTOF 4FWSA 2AJ1A 3VAKA 1ZBHA 2JC1A 2XYPB 4F0HA 5A8WB 3AD9C 1SC6A 3CCVS 1T95A 1FE4A 5L1JA 3IKMA 1PBUA 2DFHA 2KM8C 3T69A 3CC7N 3OYKA 2HF3A 2W8LA 2IVMA 1NJWA 4DX7A 1WG4A 2HZVA 4F3QA 3L2VA 4M63A 2XLJA 2QSFA 1X5PA 3IG1A 3M8PB 2V6AA 1WF2A 3SIPB 2FJAB 3TX8A 2JC0A 2XMAA 5I9EB 4JI8F 4GO5X 2E1YA 5J2MB 4LR7A 4X2BA 1S4FA 4OZLA 2LVWA 2G0JA 1VSFA 1NPRA 3KFWX 1QUPA 2WOMB 2KHCA 2DJWA 3NWGA 4P2XA 2RPIA 1SJ3P 3K5NA 3U02A 2JFDA 2FVSA 4NCBA 1S1TB 1JJCB 1CG2A 1B9DA 5IFMA 4OLAA 3WXMB 1T9YA 2ALYB 2NXCA 3MMBB 5LMNJ 3UDVA 4ID8A 3WNEA 4CZGA 4DBQA 3KLIA 1FEHA 3FEXB 1RBRA 3LAKA 4FZVA 2YCHA 3D2EB 1IM4A 2M4MA 4MT1A 4PPDA 5JMNA 1VJWA 3CJKA 2ZE2B 3FCVA 3A5MC 3UB5A 1HBUA 3K7RA 3ZXWA 5TKYA 4RBVA 5GAGI 1SC3B 1RCXB 3QFHA 5IT9O 4USJC 5J2QB 3C16B 4RU2A 3QIPB 4DR1K 4O44B 5E3QA 3SJJA 2C2MB 4M94A 4RUHA 2RHKA 1N36K 2WBNA 3EXCX 5LSLA 4QCLA 5B0GA 4B1XB 1H2UX 1QVFM 3NHGA 5BR8F 4BRDA 3MPYA 4IOXA 2PA8D 3HSDA 2Y3YA 2QKKA 1JCFA 3AA9A 3CI5A 1IH7A 3M2UB 2AF6A 1RADB 5KRTA 1BQXA 3IFEA 1SJQA 1S6QB 3UN5A 3TAQA 5KFDA 1FJEB 3SAGA 2V8VA 2EC0A 1HQUA 1OJ4A 2DHAA 4ZPCA 3PW2A 2IDEA 4DV4J 3F5TA 3I8BA 3HHLC 1RJJA 2ZGYA 4M3ZA 3VAHA 1F6TA 3L7PA 1U0HA 2DGSA 1LW2A 4HTUA 3SQGB 3MM9B 2CG8A 4LH5A 2F8SA 2GEMA 4KO0B 1S22A 1ZS6A 5L1LA 4DJBA 4OV1A 2QJ3A 2YWFA 2NUHA 4CZMA 2DTJA 4RW7A 3NS7B 2ZF5O 3L4IA 4KBOA 3MM5A 3L4BC 3AY0A 1CJVA 2QLFB 1VS3A 3QGPA 1NGJA 3K58A 3HJFA 1FESA 1GAOA 1YZ6A 1RAOA 4WP9A 3JYTA 1J5EJ 5L39A 4NXMJ 4CJ7A 4YDUA 1D9DA 2FJBB 2R3VA 2V2QA 4V1Ak 2FZKB 3ILLA 3EJMA 3O44A 2RMLA 2DT9A 1F5BA 1ZPVA 1VQ8S 3LP3A 3ID8A 1FHTA 3QRRA 2HAFA 4H4OA 2J9CA 4WYWA 4JI5K 1HNIB 4DZDA 3OR2B 1QAJA 2A0FB 4JV5F 4EO6A 3OVAA