4H4MA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
548
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
total genus 135
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4mA05
3DYAB 3PX6A 4KB7A 4KI4A 4G3IA 3QZ8A 1N5YB 2CJQA 1ASWA 4PWDA 3VQCA 1KCFA 5DLGA 4CGFA 3H5SA 2IS3A 1VSHA 1HNVB 3TQ1A 3ITHA 2F8TA 2JGUA 3JYTA 4E89A 4Z4HA 1FKPB 1CXQA 3NFAA 1UA0A 3LZJA 1T8EA 3IG1A 4PQUA 2HHWA 3MR5A 3B6OA 4ED7A 1G15A 5KG2A 1VSEA 3ULDA 2WTFA 2IC3A 2RKIA 4IOBA 3V9SA 2JEFA 4OPKA 4IDKB 1S1UB 1T3NA 3LAKA 2Z1IA 4CIFA 1GX5A 1ZTWA 4CK1A 1TQLA 4CK3A 4CEZA 4RNMA 1TK8A 4DTRA 4NLPA 4AHVA 1JXBA 3HPOA 5KFWA 1JLFB 4E7KA 4MFBA 2ITGA 5DG8A 2XY8A 4KKOA 5SZTA 2WK4A 3HJFA 2LSNA 1RT2A 4OJRA 4HYKA 5KG3A 1RDBA 4W5RA 3IN5A 3RMDA 1HQEA 3G0ZA 3I0SB 2WOMA 3WNHA 3GYNA 3AVMA 2YNGA 5T14A 4YR0A 4CGJA 4Y1DA 2E9ZA 1IKYB 4G1QB 3VN5A 4CCHA 4IFVA 2ILYA 3GILA 3OYLA 4ZVHA 3KMSA 3HVAA 4J9MA 2XCPA 3L3UA 5FDLB 2E6MA 4B9LA 2AX0A 3HKWA 1C2PA 1WAFA 3VQ7A 1QUVA 2W8LA 1JLEA 3RR7A 4OGCA 2ALZA 4Z4CA 4FZXC 1VSDA 4Z4EA 2UVVA 4RU9A 2HHUA 2YNIA 2ASJA 1RT5B 1BI4A 4OL8A 4WZMA 5KFAA 3OYAA 4BACA 4FJ8A 3RMBA 4I9QA 4FW1A 4E3SA 3G6XA 3RR8A 1YTAA 3NF9A 2ZQBA 1UWBA 4TYAA 1HYVA 4FBUA 3U3GA 4B08A 2KW4A 1HNVA 3ZT0A 1REVA 2YV0X 3QEIA 3L8BA 4Y3CA 4FJMA 1KLMA 4NLUA 5KG7A 4FJ5A 4O0JA 4J9RA 3DRSA 3F9KA 3AVCA 4EYHB 1TK5A 4ICLB 1EP4B 3KJVB 3KLEA 4KTWA 5KGXA 3I5CA 1SKSA 3QGGA 4DSFA 4ZVEA 1BQMA 3LP3A 4FM0A 3UQSA 4B8CA 3OYMA 2HNZB 3I0SA 1HNIB 1TL3A 4IQXA 4XIUA 3MAQA 3FFIA 2Y1JA 4I7FA 3DDKA 4URQU 5E41A 2KZMA 4K4ZA 1Z25A 3OYFA 1C0UB 1L3TA 4ED3A 4KSEB 3QGHA 5KT6A 3NGDA 3P1GA 3BGRA 1JLAB 1EKEA 3NGIA 3QEPA 3KJVA 2OZMA 1UWBB 4E1NA 3O3FA 1DTTA 5CYMB 3SUQA 2OPPB 4B9UA 3SUOA 3V4IA 4B3OB 3PW7A 3TABA 1SUQB 3V9ZA 4YQWA 4QW9A 4DTUA 3RRHA 3TAFA 1BHLA 4M3YA 1RT5A 3VA0A 3HVRA 1IKXB 1UAXA 3LP1A 4KHRA 3V6DA 2UVUA 4JLHA 1A5VA 3NDKA 3OYHA 1J53A 3SQ1A 5KT4A 1SL0A 1FXXA 4GC7A 4WYWA 4DQSA 1TP7A 1I3AA 1R0AB 1YTUA 1WSFA 1RBVA 3S3MA 3RMAA 4ECUA 1WLJA 4DFPA 4G1QA 2OPPA 3GV8B 4BDZA 4YR2A 3DLRA 4LD0A 4FK0A 5CZ1A 1N48A 2IAJB 3VQBA 3M9OB 1UOCA 2QKKA 3V9UA 3LDSA 5DG7A 1B9DA 3CM6A 4CJ4A 3AO4A 4DFKA 2BANA 1QAJA 3OL9A 1NK0A 4U6PA 2QE5A 2IGIA 3LP1B 3LWMA 3TAEA 1RYSA 3RAQA 1J54A 2HWIA 4KAIA 5KG1A 1WN7A 4IH7A 4TYBA 2F8EX 1N6QB 3IGVA 3C6UB 4HTUA 3QEXA 4E19A 5J2PB 5K14A 1IO2A 1XR5A 4EP5A 3MXIA 1JX4A 4W5QA 1RBSA 4ED6A 4ZP7A 3TAMB 3V6HA 2HVIA 3D28A 2FJXA 4KTZA 4CGIA 2P5OA 1L5UA 2KZZA 3S3NA 3H08A 5SWMA 3HVTB 4YMEA 3OYKA 1BISA 3ZSZA 1JLCA 2B43A 2Z1JA 4CECA 3CJ0A 4DQQA 1HNIA 3RAXA 3SNNA 2OPRA 1TAQA 4CEBA 3MECB 4O0IA 1FKOB 3ZSVA 3H5UA 4RNNA 2BDPA 3MEGA 3AVHA 2XY5A 3ASMA 3MXJA 2HWHA 4K4VA 3AO1A 2PY5A 4NYFA 5KFEA 4DU1A 4LH5A 1U09A 4WFXA 3VA3A 4IFVB 1WSJA 3TAQA 4K4UA 1LWCB 2X6SA 2XHBA 2C22A 3T5LA 2J6TA 4J2BA 2DTUA 2VG7A 1RTIB 2E9RX 3TARA 1RT1A 1S6PA 5HLFA 3KTQA 4C8MA 4LY7A 4M41A 3I5AA 4CHQA 2X78A 3HM9A 4DSKA 4TXSA 3TAPA 4DL4A 3NBPB 4FLVA 1VSMA 5KFQA 2OYQA 1T94A 2HNDB 3KLGB 3CQ8A 3QEWA 1O1WA 3JYTB 4FYDA 4TN2A 1ZBHA 4NRTA 2D0CA 3ZSXA 4RNOA 2YNIB 3BSAA 1WAJA 4KHYA 4RUAA 1NOYA 3K5NA 3SUPA 4K4SA 3ISNC 3AVJA 1YVUA 5KFBA 4CF1A 4FJHA 5KFMA 3AVBA 3AA3A 1TK0A 5KI6A 4RW8B 3P5JA 3TAGA 4KB0A 4ED1A 3Q8SB 5DQIA 1TL3B 4DL6A 2X6NA 3MFHA 4PUOA 3KK3B 1CXUA 4MQ3A 1SH2A 1TKXB 3LPUA 4DFJA 3RTVA 3NGZA 3IRXB 4F8RA 4GMJB 4WXWA 5HRSA 3V6DB 3T5JA 3PVXA 1GOAA 2NUBA 3OYNA 4R8UA 1IKWB 2R8IA 2G8HA 5EWEA 3I5BA 5HRNA 3NAHA 2O4GA 3K58A 1S10A 3SPZA 4RW6A 3PUFA 4CF9A 2G8WA 2FVRA 3OL6A 5I42A 3PJWA 2UVWA 1S0NA 4ZHRB 2F8SA 4H54A 4DQPA 1TV6A 3E51A 3HT3A 2IBKA 3K2PA 2VG5B 4K4XA 1NKBA 1S97A 1RTJA 2ILZA 4FJJA 1MMLA 5HROA 4DWIA 3UPFA 4JV2A 3ZSQA 2FVQA 1RILA 4HUEA 1WSIA 5J2NB 4NYZA 4ECVA 1ZYQA 3D0PA 1TL1A 4CERA 4Q8FA 4J9LA 4NLSA 2VA3A 3SCXA 1BGXT 4NRUA 3DLGB 3I0RA 2D0BA 4NYNA 3NF7A 1GX6A 3DRRB 3ISND 4LH4A 1NHVA 4CEAA 3OLBA 3LWLA 1RTHB 3VQEA 3RB6A 3ZT2A 1SV5B 3CJ5A 2HNDA 3KHRA 4KB1A 1BQNB 1NKEA 2IOCA 2G8UA 4I2QB 3NH2A 3AV9A 3T5HA 3CDUA 2C28A 1QSSA 4I2QA 4CEQA 4EEYA 1TAUA 3EZ5A 2WCXA 3SFUA 3C94A 2V4QA 1S9EB 2AQ4A 2XWYA 2O5DA 5DGAA 4KI6A 4DTMA 3ICLA 4CEOA 3H5XA 1KTQA 1DLOA 1W0HA 3HO1A 4J2DA 3ZCMA 2C2DA 2FLNA 5DGBA 4KO0B 1KHVA 2HMIB 4CJKA 1HQEB 5F8JA 4F4YA 2FBTA 4TLRA 1L3VA 2BQRA 1KRPA 1IKYA 4Z4GA 1SV5A 1BCMA 1RT1B 1S6PB 1TL1B 4FJGA 4M3TA 4I2PA 5J1EA 3DRPA 1UA1A 4DSLA 3BQ0A 3PR4A 1U48A 3GIKA 4EZ9A 1L3UA 3AA4A 1LWFA 1S1VB 5F8LA 2IAJA 1DLOB 3HK2A 4HCBA 1RNHA 1JL2A 3NAIA 3QO9B 3M9NB 1KHWA 3OJSA 2J6UA 1VSJA 3RB3A 3CJ4A 1RTDA 4OVLA 4F3OA 2AU0A 4MIAA 4ECQA 5KFZA 2ETJA 5I3UB 1VSIA 4DFMA 4IH6A 3OYGA 5KFJA 1D0EA 4YR3A 4H8KA 1YT3A 4FW2A 1T03B 4NLXA 3M8PA 4LQ3A 1C0TB 1WNSA 2B4JA 4O5BA 3MR3A 2I5JA 2WONA 3C6UA 3BSNA 4J9KA 4DG1A 4AHUA 4BWMA 1RA6A 3PW0A 2HHTA 4FZYA 1BQNA 3OYIA 1TKDA 5CY4A 1X9MA 1NK4A 4FJXA 3KK2B 2V4RA 3V9WA 1RDDA 1TKXA 3DOLB 4UQGA 1KFSA 4LQ9A 3GV7B 1S1XA 4ZVFA 2JEGA 2C2RA 2IM1A 1WSGA 4I7FB 1C6VA 2YNFB 3MEDA 1ZTTA 3K57A 3M9MB 5KFLA 3EY1A 4DLEA 1XWLA 3DOLA 2XY7A 1VRUB 4HUGA 3DRPB 4O55A 1TKTB 4NLGA 2F96A 2KFZA 4M3WA 4CGGA 3C6TB 3H98A 5C42B 2XC9A 1KFDA 2PYJA 1ZETA 5DK5A 4IDKA 4F4WA 4ICLA 1NK5A 5FRMA 4CJWA 4KHSA 4CEEA 1ITGA 5HP1A 2W8KA 1GOCA 3KLGA 3OJUA 2PZSA 3K59A 3O4NA 1U4BA 1RCHA 1XHZA 4CJLA 1BI4B 3L2UA 1D1UA 4WFYA 4CJ3A 1NK8A 4JV1A 1JLQB 1S5JA 5CYQB 3OY9A 5KRSA 3CVKA 1C1AA 3H4BA 1RTIA 3DLHA 4FM2A 5KFHA 5KT3A 2JC0A 2X74A 3KMQA 3VQ8A 3K5LA 3AO5A 3HP6A 4CFBA 4AILC 2D5RA 5KT2A 4RW7A 3KHHA 1NK7A 4RW8A 3OYDA 3M8RA 4DTPA 3PV8A 3BGRB 3DRRA 3OYCA 5DMRA 3AO2A 5L9XA 2HAIA 4DEZA 3NE6A 4RW6B 3PO4A 2OPQB 3DOKB 4Y2AA 4AHCA 2Q3SA 2YNHB 4CFCA 3FFIB 3AVKA 3NH1A 4URSA 3ZT1A 3HXMA 4KHNA 2FLPA 4FS1A 3PJXA 4Q43A 3ALYA 3QNNA 1X9WA 5KFCA 3AVGA 3VQ4A 5J2QB 3H2LA 4ZP6A 5KG0A 2FC0A 2HHXA 4EO8A 2HB5A 3DLBA 1REVB 1XR7A 3OYEA 1CZ9A 4FJKA 4XPEA 2G8FA 4MH8A 2QK9A 1LW2A 2RDIA 3IGNA 4N5SA 4ECTA 3H59A 1B92A 5DG9A 3T19A 3G10A 1SUQA 3ZSWA 3M8QA 5KFUA 4CHZA 2OH2A 4CJVA 4ZPBA 4RNHA 4KTQA 4E7JA 3HYFA 3QNOA 4O3NA 3DOKA 3K5MA 4DL2A 4ECSA 3Q8RB 3IRXA 4K8ZA 3TAMA 4J9SA 2FLLA 1RDCA 1LWEB 4WE1A 2YNFA 3MEDB 5J1EB 2FBVA 4LSNA 1XHXA 4CE9A 3AVIA 1N6QA 1CLQA 3BSOA 1QS4A 4R0EA 2YKMB 4CJ5A 5C25A 3CDEA 3HL8A 4K4WA 4O3PA 1VSLA 3PO5A 4LSNB 4W5OA 2FVPA 4KFBA 3QERA 3G86A 2EHGA 1S6QB 4C8NA 3MXMA 1NJWA 4Z0UA 1XI1A 5JUMA 3L2WA 4ZTJA 4ZPAA 3D45A 4AHRA 1C0MA 5HBMA 5EWGA 3OYJA 2GIQA 3CYMA 4QWDA 3KK1B 1C1CB 4CJRA 3DI6B 2AJQA 1QSYA 2IJNA 3QINA 1IKVB 4IG0B 4NLRA 3DI6A 4B8AB 4DU3A 1T03A 4CIGA 5C24B 1XR6A 5HBMB 1S1WB 4MKAA 3D5MA 1QSLA 2HNYB 2KFNA 2CKWA 5J2PA 1RT4A 4IFYB 3RMCA 2R8HA 4EBDA 1S0OA 3SV3A 4N56A 3H5YA 2IM3A 2RF2B 1YVFA 3FSIA 2W9CA 1RA7A 4M3XA 1S1TA 3NCIA 3KD5E 4W5TA 3PW4A 1S4FA 2IC3B 5D3GA 1LWCA 1I39A 1K6YA 3ZT4A 1FK9A 4C8OA 2W42A 4CJUA 2Y1IA 3C6TA 4ZTFA 4FLUA 3HPHA 2YNGB 4WFZA 4O4GB 2VG7B 4O3QA 5KFGA 3G6VA 3GQCA 3LANA 5KFOA 3KKSA 2XY6A 1I6JA 4HUFA 3L2QA 1NJYA 2GV9A 1ZBIA 4B9TA 3FDSA 1JLCB 3TI0A 4CJTA 2V9WA 4IBNA 2E6LA 4Y1CA 1NK9A 2ZKUA 3LP2B 4IR1A 2HVHA 5FRNA 2HNYA 5KFKA 2IA6A 5C5JA 3V1RA 2G8KA 4M95A 3EYZA 1NJZA 3SPYA 2HHQA 1S9FA 1JKHB 3MTKA 4TQSA 4CF0A 3SUNA 3O3HA 3FRZA 3KIOA 4CHYA 1S0MA 2Z1HA 4H4MB 1JLBA 1TV6B 3AA5X 1JIHA 4FVMA 3LP2A 4ECXA 3OS1A 4AHTA 3V6JA 2XGPA 1S1WA 4M3RA 4IH5A 4KRFA 1JLAA 3CFPA 4MK8A 5EWFA 2ATQA 5KFPA 3KHLA 4MKBA 1RTHA 2Z1GA 4NLQA 1QE1A 5FDLA 2D0AA 4DTOA 2KQ2A 2RPIA 4J9OA 3WNGA 2BR0A 4CK2A 1EETB 1JXLA 3BR9A 1RTDB 4DL7A 2JEIA 4NCGA 4KHWA 5J2NA 3HP9A 3SYZA 5D3GB 2OPQA 3AVLA 1S1XB 1S6QA 2WRMA 4TY9A 4MFBB 1N5YA 4BE0A 1ZBLA 1EETA 5L1KA 1IH7A 4O4GA 3CJ3A 3KHGA 3T3FA 2UUTA 3QESA 5DLFA 2OPSA 4KV8B 1LV5A 3PX4A 1IM4A 2EC0A 5DQGA 5HRPA 2P5GA 2GUIA 3M8QB 3V1QA 2WHOA 2E4LA 4ID5B 5JS2A 5HP1B 4BE1A 1S48A 2IM2A 2AGPA 4TSXA 1S1UA 4YNQA 4BWJA 1IKXA 5F9NA 5F8GA 1W25A 4CGDA 4NLWA 2FBYA 1S9EA 4FZZA 5KT7A 3CM5A 4DTSA 2QV6A 3MR2A 4JUZA 1RT6A 4KV8A 4DS4A 2RN2A 4OPJA 4KHMA 3PW2A 1U47A 1EXQA 4FJIA 1HPZA 1T7PA 1U04A 4NLYA 2P1JA 3QIOA 2ZD1B 1BQMB 2QXFA 3SV4A 4QCLA 4KE5A 1BIUA 1DTTB 5CYMA 4B9VA 2YNHA 2YKMA 4DL3A 3VQ5A 3NF6A 4Q0BA 3RWUA 1NNDA 5JS1A 1VRTA 5F8IA 1C1BA 3CO9A 4B9NA 2B5JB 3HSTB 2W9BA 4CJEA 4EP4A 4ZVGA 4ZMMA 1LAVA 4RZRA 1KVAA 1DTQA 2VG5A 3NAEA 1KLMB 3SI8A 3OVNA 1JLBB 4H4MA 2D3ZA 3KK2A 5KG4A 1J5OA 2HMIA 4RNFA 2AGQA 3SQ2A 3RRGA 1TVRA 4OGEA 4ID1A 4URGA 2I5JB 1A5WA 1NHUA 3WNEA 4DU4A 3I8DA 1SKRA 4E7HA 4I9LA 3M8SA 2W9BB 2FBXA 1IG9A 1HMVA 4O44A 4CHOA 4LSLB 5EDWA 3QIDA 4KBIA 4Q8EA 3SFGA 1S1VA 1F21A 3CIZA 3LZIA 1SH3A 3DLEA 2BANB 2A1SA 1U45A 4BDPA 2R8GA 1RBTA 2BQUA 2XRIA 4RW7B 5T7BA 2HNZA 2A1RA 4JS5A 4DQIA 1TKTA 3H4DA 5KFVA 1BIZA 2JEJA 2RF2A 2R2TA 3ZSRA 5FROA 4KHQA 4FJNA 4M94A 3BQ2A 4TY8A 3HPGA 3OHBA 3VQAA 4DG1B 3TWHA 3EPIA 4QWAA 3DLEB 1XC9A 4PA1A 1Q9XA 1ZBUA 3V4IB 3RBEA 2XGQA 5EU7A 5KFXA 4OKEA 3FQKA 1FKOA 4IG0A 1IKVA 3VQ9A 3P83D 4HVJA 1C0UA 5CYQA 1D9DA 4DS5A 2W7PA 1LW0A 4O3OA 2XI2A 3SZ2A 1JLFA 4QWEA 4QW8A 4PQUB 3S3OA 5F8HA 4DL5A 3CG7A 2FVCA 4TY8B 2ASDA 1JLGA 3KLHA 3V1OA 1RBRA 4F4XA 1VRUA 2BGGA 2ZE2A 4RW4A 3ZT3A 1HQUB 3AA2A 1JLEB 3CDWA 3OHAA 3KLIA 4C8LA 4WXOA 4Y2CA 1N4LA 1KVBA 4EZ6A 4IG3B 4NCGB 3GV5B 4PWDB 2IDOA 2OPSB 1RDRA 2XCAA 2R7YA 4K8XA 3CFOA 1HARA 2AWZA 4C8KA 4CIEA 2JLEA 1EX4A 4ECZA 2GC8A 3HVWA 3DM2A 1LAWA 1RBUA 2VWJA 2WOMB 1ASVA 4PUOB 4O44B 3V6KA 5J2MA 4FLXA 3VQSA 3IAYA 5HRRA 3QLHA 1SL2A 4F50A 4CFDA 3THVA 3V9XA 4GVMA 2KTQA 1VK0A 1FK9B 5J2MB 3V81A 4DTNA 2YHAA 3KOAA 4QAGA 5I42B 3RBDA 2W9CB 2W7OA 4F2RA 1S1TB 4O4RA 1JL1A 4KAZA 3MECA 3UR0A 4ELVA 3GIMA 1D8YA 4CF8A 2VG6B 1TKZA 1JXEA 5KFTA 3BDPA 4K50A 4JV0A 3OL7A 3IG1B 2VG6A 3Q8PB 4M42A 4F4KA 3AVAA 3QLHB 4B3OA 3LP0A 1HYSA 3O3GA 1VSKA 4CEFA 4ZPCA 3QEVA 1JLGB 3KLHB 3ZSYA 2VWKA 3OSPA 2J6SA 4FK2A 4NLDA 4ECWA 3KK3A 3DLGA 3I0RB 4O3RA 4DF4A 1NOZA 4EO6A 4Q5VA 3QETA 2D3UA 1KLNA 3SQ0A 3GIIA 1RT7B 4R5PB 4HKQA 4IRCA 3VQ6A 4YFUA 1Z4UA 4FXDA 3H40A 4NLTA 3LAMA 1TGOA 4ZP9A 4TQRA 2AX1A 1JLQA 4ZPDA 4IFYA 4J2EA 2QKBA 1R0AA 4F3TA 3DRSB 4IR9A 1RT3B 1S9GB 4XO0A 4DF8A 3L3VA 4CGHA 3U6FA 1QE1B 5C24A 3JSMA 1RT7A 4R5PA 3MEEB 1A5XA 3PY8A 4CFAA 1QTMA 4NCAA 1WSHA 4F4ZA 1W9HA 4OLAA 2RKIB 1KVCA 1RTJB 2B6AA 2YKNA 3BQ1A 4HHTA 3F73A 1TKZB 2OZSA 3L2RA 4J9PA 1QQCA 4CEDA 4W5NA 4QWCA 1IKWA 2DPJA 4ECRA 1KSPA 4KFBB 2HHVA 2R2UA 1RT3A 1S9GA 3ITHB 4BDYA 1D9FA 4O3SA 3BSCA 4WZQA 4E0DA 2W9AA 1EP4A 1SL1A 3DMJB 3E01B 2R2RA 5KG6A 4L8RB 3BJYA 4ED0A 4IRDA 1SKWA 5KRTA 4ECYA 3OS0A 4HCCA 3UDLA 3PX0A 4F2SA 4NCBA 1LWEA 4WE1B 1VRTB 3RB0A 3QGIA 3T5KA 2BRLA 4KO0A 3IS9B 4DSJA 4M3ZA 4OKKA 4CESA 2YHBA 5F8NA 1L3SA 3HVTA 3DLKB 2ATLA 1CSJA 3M8PB 1WNEA 3OS2A 2BRKA 4ED8A 4X2BA 5JXSA 4KHUA 2WONB 2DY4A 4QOZB 4Z4IA 4RW9A 4KKOB 4K4TA 3K5OA 2DFEA 3KLVA 1X1PA 2ZD1A 2IJFA 3KLIB 3QO9A 4BE2A 3N6LA 2R8KA 3QIPA 4FLWA 4E1MA 2C2EA 1J9AA 5F8MA 1LWFB 1J5OB 1K1SA 4DQRA 4CHPA 1QAIA 3DLKA 3NBPA 5KFDA 2R8JA 4AHSA 4DMNA 4CF2A 4GW6A 1LW0B 3WNFA 4NLOA 3IS9A 3KLFB 1Z26A 3MEEA 3NL0A 4E7LA 4QPXA 3C95A 4CJSA 3A2FA 3B6PA 4MK7A 5L1JA 2FJVA 3QYYA 4DTJA 3N6MA 1QHTA 1N56A 3OL8A 3LPTA 5KFIA 3KLFA 2E9TA 4MIBA 2UUWA 2IMWP 2OA8A 2JC1A 3KLEB 4J2AA 3DYAA 5KFSA 4FJLA 1C0TA 3SI6A 2GBZA 4Q45A 4LSLA 4EYIB 4FLZA 1Q9YA 1TVRB 5EUHA 4AH9A 4KPYA 4B9SA 1ASUA 1MU2A 3KNAA 5K14B 3N6NA 2PYLA 4DTXA 3V81B 1ZBFA 3S9HA 2DFFA 2G8VA 3Q8QB 1HYSB 1HMVB 4ELUA 5I3UA 4EBEA 3SQ4A 3EPGA 3LALA 4M45A 5J2QA 4Q44A 4Q0BB 3VQDA 5C42A 4ED2A 2VA2A 4J9QA 2R2SA 4RG8A 2EX3A 2FJWA 4JS4A 4DLGA 4I2PB 3TANA 3NH0A 5HROB 4K4YA 4CHNA 4QWBA 5L1IA 5CZ2A 4IKAA 3O4QA 3TVKA 2IM0A 3G6YA 4NZ0A 4FM1A 1MU2B 1BL3A 3U3YA 1HQUA 1T05A 1NJXA 1HPZB 4FJ7A 3LP0B 3AVFA 2XI3A 3VQQA 1S49A 3QIPB 3CWJA 3RB4A 4IRKA 4CJFA 4RUCA 2FVSA 4IG3A 1U49A 5KFRA 1C1CA 5KFYA 1RT6B 3QZ7A 4ZHRA 2B6AB 2YKNB 4GC6A 4FK4A 3OSNA 4R8UB 4FCYA 1LW2B 3KD1E 2GIRA 3MFIA 4EBCA 4MK9A 2HHSA 1SH0A 5KFFA 4CJQA 1OS5A 3JSMB 3BREA 2DPIA 3VQPA 1RT4B 4NLVA 1RYRA 5KG5A 1T05B 2BQ3A 1DTQB 3ZSOA 1X9SA 2DFHA 4H4OB 4WYLA 3PHEA 2AGOA 5DQHA 2WB4A 4DSEA 4H4OA 3HHKA 2D41A 3GIJA 1HRHA 3CFRA 2P51A 1K1QA 4FLYA 4ID5A 4OKJA 2B5JA 3NGYA 4Z4FA 4Y34A 3AO3A 4ZP8A 2HW3A 5KGWA 4FBTA 1GOBA 3CJ2A 1HJRA 3TR8A 1NK6A 1RT2B 4B9MA 2UVRA 3L2VA 2OPRB 3OYBA 1Q8IA 3MF5A 1BCOA 1RAJA 3DMJA 3E01A 2I1RA 3NKYA 5KT5A 3AVNA 4RW9B 3MR6A 4RW4B 2ZE2B 3MEGB 4E7IA 4N76A 1B9FA 3NHGA 1VSFA 3UIQA 3KKRA 4ELTA 4PY5A 4N47A 2D7SA 2O4IA 1D5AA 5KFNA 4DSIA 4FJ9A 4CJPA 4JRPA 3NF8A 4N41A 4IKFA 1FKPA 3SJJA 2BE2B 1HYZA 4XPCA 4KREA 3PR5B 1NKCA 3T1AA 3KK1A 2BE2A 4JRQA 2G8IA 1CZBA 4OLBA 2V0NA 3PW5A 3EZUA 5HLFB 4U7CA 3NMAA 5KTQA 4M3UA 1C1BB 2XO7A 1JKHA 4FLTA 2ASLA 5L1LA 2RDJA 1RDAA 3DM2B 3OLAA 1WSEA 1Y97A 3PZPA 3FQLA 4FS2A 4J9NA 5C25B 5F9LA 4YP3A
chains in the Genus database with same CATH superfamily
4USUA 4ZCMA 4KB7A 3P39A 3QZ8A 3GCXP 4WFAQ 2XULA 1M5PC 1D4XA 4OHVA 2MYFA 1GMUA 1VK3A 1YAGA 3TQ1A 1X3NA 4NB4A 3BYRA 3CE8A 2FGOA 1NAQA 4YORA 5JICA 2BVZA 2ZWPA 4HVZA 4RBUA 1T8EA 3MR5A 3CETA 3FRYA 3CEDA 3ULDA 2IC3A 3AD7C 2AHOB 4IOBA 3TZYA 2EK1A 3OFHA 1T9VA 1FJGK 5F41A 1EQMA 5DZ7A 4C97A 3SDEA 4CDIA 3TJ9A 4B1VA 2J0SD 2POKA 1UPMB 1SXLA 2Z1IA 2CQ1A 4G1IA 4NLPA 3AJ1A 3HPOA 4X65F 1JLFB 4A62A 2ITGA 5DG8A 4KKOA 3IBWA 2WK4A 3NWGA 5D8HB 4OJRA 3PXGa 1RDBA 3G0ZA 3I0SB 4DU7A 3WNHA 1B0VA 3AVMA 2EWHA 2NRTA 3KDOA 3H7HB 4DR1K 3ZX3A 4CD1A 4OX9K 3A3PB 3OTDA 3GILA 3D1HA 1ZAVA 3Q22A 1RBLA 4PG4A 2M8DB 1PSDA 2XCPA 5DS7A 3C16A 3RSEB 3HKWA 1WAFA 1QUVA 2W8LA 2KKHA 1BOTO 1JLEA 2FB0A 4ES2A 4PL7A 4FZXC 1RWOB 1WTBA 1VSDA 1AXQA 2UVVA 4Z4EA 1VQ4S 4TU7A 2M2BA 5AQPA 4X4VA 4OL8A 1HBOA 2BJ9A 3OYAA 4ANEA 3RMBA 2IVYA 3RR8A 3VGTA 2ZQBA 3THYA 3TSPA 1HYVA 3U3GA 3OXLA 2KW4A 2D0PA 2YKAA 1SB6A 2QWOA 5HMWA 3L8BA 1FDDA 3FZ2A 4FJ5A 2F8MA 5A2QU 4A46A 1TK5A 3CXCM 3KJVB 4S0MA 1SKSA 1BQMA 1VFJA 2DHXA 3LP3A 2Z58B 2P6TA 3UQSA 3OYMA 3M8WA 4U67Q 4LR7A 1UZHA 4LVOP 3QJPA 3MAQA 3I87A 3NLCA 1NDLA 4C8YA 2MKSA 4JHDA 5K5MA 2KZMA 4K4ZA 1Z25A 2QJ3A 3L7UA 3Q24A 2O8EA 4ED3A 3BZKA 3QGHA 3P1GA 1EKEA 2K1RA 2BYCA 3WXKA 1GLBG 3KJVA 5AQZA 4BC4A 3F9MA 2R7OA 4B9UA 4LF7F 3TABA 3WT0A 4B3MF 3TAFA 1RT5A 3VA0A 3HVRA 1Z05A 2RU3A 1F0XA 4KHRA 1NSQA 1N0VC 1A5VA 1TELA 3OYHA 1NM2A 2QYGA 5T7LA 4JI4J 4JKEA 3SBTA 3MMJA 4DQSA 1I3AA 2J5AA 3N28A 2YQ0A 3HHLA 1YTUA 3S3MA 1Q82O 1N5QA 2ZNYA 1WLJA 3MMCA 2HBLA 4G1QA 3GV8B 4BDZA 4YR2A 2O3DA 3DLRA 1FHTA 3AY0A 1CJUA 2IAJB 3TR5A 4DV0K 1FT8A 1S0VA 2HFOA 1UOCA 4FOIA 3LDSA 2CXEA 3WQTA 3T9ZA 3D2EB 3NMRA 4K25A 2IGIA 2MKJA 2MQLA 4HT7A 2VBYA 2BACA 2VPZB 3LP1B 3LWMA 3MUVP 1RYSA 5FPDA 2IY5B 3LGNA 3H0PA 2HWIA 2Q6BA 4TYBA 4OYAA 2MJNA 3DXKB 4BG8A 4C48A 1YJTA 3T1YF 2O8BA 3Q23A 5K14A 4EP5A 4W5QA 3QRQA 4ED6A 4ZP7A 4GVEA 1PAUB 2VHGA 3BH7B 2FJXA 3D28A 4WBFA 5GAGP 4X4OA 2Y1LB 4CGIA 1OYEA 3BKTA 2HLUA 2P5OA 3S3NA 4A48A 3OVAA 2HGMA 1AW0A 4CH7A 4LF8F 3OYKA 3POTB 1JLCA 2B43A 4ITSA 3RAXA 3DLLL 4ISFA 5BR8K 3MECB 3HFKA 3THWA 5EX3A 1UJ5A 4KY3A 3ZSVA 2OFGX 5DDQC 4LF6J 3A8YA 3U02A 5AQTA 4X66J 3D68A 2DPNA 1F9FA 1S77D 1NPPA 3K17A 1V9OA 3O08A 3QBXA 5HMZA 1YJNS 4DV7K 3T5LA 2AIRB 4ZDNA 4J2BA 3ZX2A 2VG7A 2CPEA 3OVSA 4F25A 4BR0A 1QVFM 3HM8A 3I5AA 4CHQA 2HVDA 4DSKA 2A40A 5BYRA 2FF6A 4TXSA 1Y3JA 3TAPA 3NBPB 1VSMA 3CCMS 3CQ8A 3CIMA 2HBRB 4OX9F 3JYTB 4DR2F 4NRTA 2ZH6A 1K9MT 4CZJA 5A2QO 4JI5F 1F3FA 4DR2J 1C4AA 3BEGB 3UKUB 2E7XA 3MN9A 2CQ3A 3EXYA 4JI5K 4CF1A 2UXDF 2ZEJA 1UJ4A 4WF9Q 3AA3A 5IWAF 2YPZA 1TK0A 4P7TA 1Q1KA 5THWA 4PUOA 2FJEB 1RKJA 1SH2A 1TKXB 2ZWHA 2E1RA 2IFXA 3LPUA 3NGZA 3MMVA 4F8RA 4JKBA 3F41A 3V6DB 4CZGA 2AJFE 2N4DA 1GOAA 1RHUB 2D9OA 2R8IA 3SAHA 2BA9A 4H0XB 5EWEA 4BVPA 2NZTA 2MKKA 1SQGA 3O1WA 2DXDA 3LW5C 3BUZB 3PUFA 5CXTA 5AQLA 1NGDA 5I42A 2K7KA 2UVWA 4B3RK 4JKGB 1EX8A 2XMMA 1EQ0A 1HNZJ 2KDOA 1R8BA 2ZNZA 4H54A 3MD3A 4DQPA 3K5PA 1TYQB 3HT3A 1VQ5S 3K2PA 2Z4PA 1RTJA 2ILZA 1MMLA 1WI8A 3UN2A 2VBZA 4KH5A 5E7OB 5GADU 1KWMA 3ZZPA 4LRAA 1WSIA 4DPOA 4A8XA 2XM3A 4BRIA 1GNKA 1IXKA 5J2NB 4K5RA 3ZZTA 4DV0F 4ECVA 4DV6F 2GMLA 2VA3A 1Q0NA 1BGXT 3PJ9A 2AP6A 3R6GB 1DKGD 1M0SA 4CEAA 3LWLA 4LBIA 1VQ7S 3DGPA 3L4IA 3ZT2A 1HD0A 2X7IA 2HNDA 3KHRA 2Q31A 3Q86A 4M7YA 3MPUB 2IOCA 4C23A 1HHQA 1I5OB 3G87A 3AV9A 2HFUA 3HHLB 4I2QA 4YDXA 3EDQB 3NG8A 2P9SA 3C94A 2E1PA 4USMA 2NRXA 2O5DA 4KI6A 1A0OB 4QIEA 1VQLN 4DTMA 4MLHA 1KTQA 2P9NB 3NY0A 4J2DA 3QB0A 2C2DA 2VQFF 4DPYA 1HHTP 2YVSA 4CJKA 3IWXA 4DR4J 1HQEB 2O8EB 1FDNA 2WSCC 1H6KX 2FBTA 2RNEA 1YUWA 3PYEA 3G82B 1IKYA 4U9RA 1RT1B 2RILA 4M3TA 4WFBL 1U0HA 4ENOA 3BQ0A 1LWFA 5F8LA 3T69A 3C19A 4HCBA 1EARA 2Q3PA 3NAIA 4BCAA 3M9NB 3CTRA 3QRRA 2J6UA 4P2SA 1M5KC 4OVLA 2DT9A 5RUBA 2AU0A 2HGNA 2BTFA 2P9IA 3P31A 4ECQA 1ZZFA 4H5RA 2NCKL 2SXLA 1VRQC 4DFMA 1VSIA 2QL9B 5KFJA 1D0EA 1YT3A 5K8MA 1T03B 4AQYF 2DNGA 4BRHA 2AJ0A 3T41A 3M8PA 4LQ3A 2DD8S 1C0TB 3IKMA 1WNSA 1OQ3A 1VC6A 3D0GE 2Q2RA 1VGYA 4BC5A 3H42A 1RGVA 2NYHA 3MR3A 3C6UA 4OFZA 2CZ9A 4AHUA 1RA6A 2YWKA 1VHFA 2HHTA 4FZYA 3OYIA 2H48B 2G1DA 2CNLB 3VEYA 3D67A 4FJXA 2V4RA 4ILRA 2MJUA 3UD3P 2GW8A 1VQON 2EG2A 3MWTA 1RDDA 2CDRB 2GV1A 4UQGA 2UXDK 1KFSA 2CRLA 2EFPA 5E3QA 4LQ9A 3GV7B 1TMJA 4DXLA 2BKNA 2VQEF 4I7FB 1WSGA 1C6VA 4EIAA 2YNFB 3O1BA 1Q5VA 3M9MB 5KFLA 4IO1A 3EY1A 4DLEA 3G4SN 3DOLA 1U24A 4WF9L 4CGGA 2E7VA 3EM1A 2VQEJ 3C6TB 3H98A 1T9XA 1O6XA 1KFDA 1VDHA 2PYJA 5DK5A 1EKRA 2CPXA 4F4WA 2NRWA 2DRDA 3GB0A 2XG8A 4CJWA 2NXEA 5LSLA 4CEEA 4PYAA 3CCZA 4CLPA 1ITGA 3J81U 1WOSA 2HFNA 1LXNA 2KG0A 1RCHA 2IRYA 1D1UA 4WFYA 4JI8F 3L4BC 1KONA 5CYQB 4KGXB 3OY9A 3HSCA 4DN0A 3CJAA 1MWQA 4E8UA 4DR5J 4BGBA 3PIOL 1MN9A 5HMXA 3ZZOA 4ZPTR 3EMTA 3DLJA 2MDAA 3UDEA 2GNKA 4DPXA 3PEHA 3K5LA 3AO5A 2I6WA 4AILC 2D5RA 3AGKA 2MZSA 4RW7A 2GQ2A 1ZPWX 1EWRA 4LF4J 3RW6A 1WI6A 3OYDA 3FR0A 2B51A 2C2NA 3MM6A 3BGRB 4CD3A 4NXMK 4RPFA 3VAIA 2CQCA 1RCXB 3HI9A 3DRRA 3J7ZT 5DMRA 2HAIA 4DEZA 1A7GE 5IZHA 2OPQB 3HHDA 3DOKB 1NEEA 2YNHB 2B3TB 4WQ5A 3R9LA 1VQ6N 3OTEA 2A18A 3PJXA 4BLGA 4Q43A 4EMDA 1Z2LA 5KFCA 3AVGA 3TTCA 4ZP6A 2LEPA 1R31A 4D3GA 1CZ9A 3FSYA 1HNXK 4XPEA 3U1LA 5CA5A 2QI2A 2G8FA 1R7IA 4ECTA 4DHVA 1B92A 8ATCB 3G10A 1N5VA 3VAKA 3M8QA 2NPFA 5KFUA 2GAGC 3D2EA 3CPWR 4J8FA 2B4PA 5HSPA 3DOKA 2GO8A 3K5MA 3K8VA 2RQ4A 9ATCB 1UCNA 1YHQN 2FLLA 2DNYA 3CCLS 3N4PA 1RDCA 3VETA 3MEDB 5J1EB 4NMLA 3W64A 4CE9A 1QS4A 4R0EA 4WKYA 4CJ5A 3QT6A 4QU7A 2UUCK 2VICA 4JYAF 2WB1D 2D4WA 1CS4A 3ZZZA 1VSLA 1PG5B 4M63C 4W5OA 1WBDA 5ETNA 1OVQA 2EFNA 3QERA 3EVWA 3G86A 4C8NA 2JWNA 2H3GX 3BDEA 5JUMA 4B3TJ 5EWGA 2GIQA 2V2QA 3ILLA 3M1VA 1AZSB 3WX8A 5IC4B 2MQ8A 4NLRA 4DU3A 4I0WA 2HEKA 2J9DE 4CIGA 3EUNA 2LP4A 2Z2LA 2OCEA 1S1WB 1UEUA 1QSLA 3TA0A 4DR3K 2CKWA 2B9WA 2PC6A 1NMNA 4DV2J 4QR1A 3IRWP 3SQOP 3SV3A 4N56A 3FJ2A 3Q0AA 2IM3A 3CCEN 3TTDA 1RFQA 1RA7A 3NCIA 2VBWA 2YJEA 2KM8B 2IC3B 4DPWA 4JHDB 3EGVA 1K6YA 1FK9A 1U1LA 1CBKA 1RWNB 5K8PA 2Y1IA 3K7RA 2YNGB 4USJC 1KAXA 3M7VA 4ILGB 1WF1A 4MTPA 2VQEK 1M5HA 3A8EA 4DV3F 3G6VA 2DO4A 3ZEUB 3FCVA 4DUYJ 2F4VK 2Y0SD 4B9TA 3D3BJ 3JXUA 1T9TA 3A13A 3FZMA 3T1YJ 3N5FA 2MSTA 3NP5A 5DM6Q 1NK9A 2VPYB 1RWWB 2HVHA 2HNYA 2ZJRL 1U7LA 4WK3A 2GIFA 3V1RA 4M95A 3SPYA 1F5BA 3MTKA 4TQSA 3SUNA 1SJ1A 3C15A 3O3HA 4BRCA 3FRZA 4KH1B 3TJAA 2Z1HA 2V6AA 3FCWA 3ENHA 4ECXA 1CG2A 3CCES 1S1WA 3VQTA 3K8WA 4IH5A 1UL3A 1UEVA 1JLAA 4M5DB 5E3PA 1JJ2M 1RTHA 5FDLA 1Y5IB 2NXNA 1KQFB 2XLJA 2V69A 2RPIA 3BR9A 4DL7A 4NCGA 1YSJA 3AVLA 4TY9A 3SQGA 2OTLS 3FZFA 3EVOA 2K2PA 4AUKA 5G0RB 1B7YB 1GH8A 3V4MA 4CP5A 1IM4A 3QPIA 5GVQA 3CIPA 4JKDA 5DQGA 3VGMA 5HRPA 4GKJK 4TVAB 3ZFVA 5LMUK 3D6MB 1CJUB 5EXWA 3S6EA 4JI0F 5A0YB 4PG5A 1AYEA 3F2KA 5HP1B 2GCFA 3U1NA 3OR1B 4A8FA 4TSXA 3EXCX 3M2VA 2Y1RI 1IKXA 5F9NA 1NSPA 3VENA 1NDPA 4AYBD 4FZZA 2ZHBA 1RT6A 1KN6A 4CNYA 2RN2A 4KHMA 4YB6A 3PW2A 3OUYB 2HSTA 3EL2A 4FJIA 2RQCA 2NYIA 3MD1A 2P1JA 3QIOA 1URRA 2ZD1B 3VEXA 4HR2A 1YJNN 1DTTB 4B9VA 2YNHA 2DGWA 4DL3A 3WQUA 4DV1K 1M1HA 5CHIA 3FZKA 1NNDA 1VRTA 1YKWA 5F8IA 3D2FA 4MAKA 2EWSA 3W3DA 4K42A 4EP4A 2CYYA 4ZVGA 4GV6A 1LAVA 1KVAA 1DTQA 2VG5A 1FERA 2P9NA 1KLMB 3N79A 5H1SQ 3SI8A 3QAEA 1KVKA 4ES3A 1EWQA 5LJWA 4Z7YA 3EEQA 1J5OA 3D6RA 4QYZJ 3SQ2A 3PYFA 4OGEA 4PG7A 1VQ5N 4URGA 2ZOFA 1A5WA 3WNEA 1SS6A 4BGAA 3I8DA 4YOVA 2YBVA 1IWGA 3SMZA 3FFKB 2QSWA 2L3MA 1R8HA 4BRFA 2IA0A 4CHOA 3QIDA 1SQFA 4KBIA 5JMNA 4LJMA 3SFGA 4PWUA 4CO3A 5AZIB 3KUEA 2D74B 3MMBA 1K8KA 1U45A 2R8GA 2C2KB 2NR0A 2BQUA 3WHIA 4RW7B 2QFJA 3BGLA 3C46A 3N4WA 3FZHA 5FLXU 4ZVSB 1TKTA 1JJHA 3AY9A 1HKAA 1BIZA 2JEJA 1DJ0A 2HVEA 2R2TA 4IFEA 4DJBA 3HPGA 2D1KA 1O51A 3HULA 4CM0A 4DG1B 3TWHA 3EPIA 3AGRA 2QA4N 1ZBUA 2XGQA 2Q1LA 4PG6A 3Q7CA 5KFXA 2EG1A 4QQBA 3CJSA 3TUIC 3P83D 1D9DA 4DS5A 2GGPB 4O3OA 2XI2A 1JNZB 1JLFA 4P2FA 3WXMB 4PQUB 1RSCA 1HKGA 4UZCA 2ASDA 3KLHA 4USWA 3DU6A 5LMNK 2NRHA 4KC5A 2BGGA 3NCRA 3ZT3A 3BF4A 1JLEB 3CDWA 3ISZA 3M1FA 4IG3B 4BROA 4MIWA 3PKMA 2ABYA 2IDOA 1RDRA 2XCAA 4AFFA 3AB4B 1BWEA 4K8XA 4C8KA 1NRKA 5E3RA 3QFWA 2VWJA 4CO5A 2YWEA 4O44B 5HRRA 2QA4S 4LRCA 4GVMA 3UKUA 1FRLA 3V81A 3EVMA 3KOAA 5KOWA 1VYAA 2V4JB 4FWRA 4QIWD 2W7OA 4F2RA 1S1TB 2CPDA 3SDEB 1NMDA 1JL1A 3DGVA 5IOLA 4XK8C 2LFVA 4P71A 4CF8A 1IBLF 1TKZA 5EVZA 3OL7A 4R25A 4BR9A 3GBTA 3EWGA 1YTYA 4F4KA 3QLHB 4B3OA 4P73A 1U2CA 3KLHB 4RR5A 3G25A 2PMZD 4LIRA 4NLDA 4ECWA 5CCMA 3GR0A 2C3MA 2Z8QA 4YY3K 1BD6A 4DF4A 1RT7B 2FJBB 1EQYA 3H1VX 3MN6A 1Z4UA 3Q83A 5GINA 3LAMA 5ETQA 1T02A 3UO0A 4ZP9A 2AKWB 3K2YA 1JLQA 4HTJA 4ZPDA 2VBXA 2E2QA 4F3TA 4NLCA 4UW2A 1DQAA 4DF8A 4I64A 5D0GA 4CGHA 5C24A 1J27A 1DARA 4ISGA 1E6VA 3KUGA 3CO0P 3MEEB 4NCAA 4CFAA 1APSA 2KH9A 2Z2ZA 4OLAA 2RKIB 3LDNA 3BQ1A 3F73A 2DGVA 3EO3A 3CCWA 4W5NA 5IQQA 4LF4K 2YWGA 4PKDB 1IKWA 2WVEA 2Q0UA 3PM9A 4NZ6A 4ECRA 1KSPA 5MLCQ 4HDGA 3Q7BA 4KFBB 3GYXB 3OPKA 2AP1A 3MCPA 2RMLA 4FL9A 4AD6A 4I6MA 1D9FA 4LUBA 2K8GA 2P9IB 4CLUA 3VR1A 5HO4A 2IVNA 3C0BA 4HCCA 3BBBA 3WXJA 4DI6A 1GXTA 4F2SA 1Y5NB 1LWEA 4OI6A 5AQSA 2CGJA 4LFBJ 1UW9A 5AJ3K 4DSJA 1N8RO 4M3ZA 3FZLA 4X62F 3NEKA 2YHBA 1HNZF 2J9CA 2D3O1 1U02A 5BXIA 1XC3A 1CSJA 3QT7A 2PA8D 3M8PB 3OS2A 1RK8A 4WP9A 2BRKA 1ATSA 2XLIA 5JXSA 4X62K 3I31A 4Q2MA 1RHQB 2MKHA 4QOZB 4Z4IA 2DY4A 1BA1A 3A5OC 2ZD1A 2IJFA 3JTPA 3N6LA 4B1ZA 4E1MA 1FFSB 2C2EA 4F0MA 3SK3A 4L3KA 4N8OA 3OTOK 1YF5L 1HWJA 5IC6B 2VKZG 1QAIA 2M8HA 3NBPA 1KS2A 5KFDA 5JLHA 1D09B 2NPIA 3CCRS 2WVBA 2GVDA 1RP5A 4CT9A 3WNFA 3LUYA 1Z26A 3NL0A 4E7LA 4BR4A 4CJSA 3A2FA 2FJVA 1O5JA 4NL5A 3MM5B 4BR7A 2AV5A 2U1AA 3QJLA 5KFIA 5IWAK 1ATNA 2IMWP 4CZEA 3RGIA 1VBKA 5A8RA 1RWVB 3JAMU 2YKQA 1R8CA 1KVJA 2GVDB 4JI5J 3R2DJ 1I51B 3CJCA 2Z57B 2GBZA 2W1BA 2DR5A 4LSLA 4EYIB 3A12A 1Q9YA 1NHKL 2JLFA 1RAAB 4KPYA 4B9SA 4U8VA 1MWZA 4PKHA 1ASUA 3KNAA 2VC1A 1U26A 1ITPA 4GO5X 4BQZA 1HR0F 2RQKA 4X64F 2JNJA 4IOXA 2E2PA 2CWXA 2A6MA 2HMPA 4BREA 5JVGQ 4OYPA 1FF2A 5C2GA 5I3UA 3SQ4A 3P38A 4C3MA 2H54B 3EPGA 2VUGA 2DHSA 1KAZA 1H72C 1X4EA 3CJQA 1P27B 2XYGB 3PIOQ 1HNWK 4M5IA 2OD4A 3TVZA 2VOOA 2ZWOA 1S72S 2WAQD 2Q97A 4UOFA 4GMKA 3HLUA 1CJKB 4P75A 2WFBA 4O8UA 1W7WA 3G6YA 4ILHA 4NZ0A 2BXJA 3J8AA 1NGCA 1BL3A 1T05A 4ED5A 1UKUA 2IIHA 3AVFA 4DR6K 4RWXA 3QIPB 4ZPVR 4IRKA 3B8AX 4RU2A 3FBEA 1U49A 1S79A 1C1CA 5KFYA 3HMJG 4IO8A 5GAHP 4MJKA 2FHKA 2G2YA 3CNQP 4R8UB 4DX7A 3MFIA 3NGRA 1WBBA 1OS5A 1QLNA 4A4JA 3JSMB 2DEJA 2OGUA 3L09A 2B7CB 1F2HA 2LEAA 1T05B 2BQ3A 2QN6B 3MM6B 3AT1B 1CJVB 5GIPA 4LSZB 4JYAK 2UV8G 3H6EA 3CFRA 5LMUJ 3LF0A 3A0IX 5HVHA 2HW3A 4FBTA 3CJ2A 1S99A 3MF5A 1RAJA 2JZ5A 3DMJA 3E01A 2I1RA 3NKYA 4BHQA 3E8OA 5KT5A 4QYRA 5CCLA 4CNZA 3QATA 1VMBA 3FBCA 1HPMA 3K89A 4N76A 3NHGA 1U25A 3R27A 1VSFA 5I9EB 1Z1ZA 2QWPA 4ELTA 2A10A 4ZVTB 4PY5A 4N47A 2APOA 3TEHB 4NYOA 5KFNA 3FKBA 3ADAC 1NH7A 1T6DA 5KQ8A 3NF8A 3SJJA 1HYZA 5IXUA 4DV1J 4XPCA 1VI7A 1BUPA 3CJTA 4PQAA 1NKCA 3M4XA 2I7NA 4LRBA 5EN1A 1NWKA 3HRGA 1VBYA 3PW5A 3EZUA 4CTAA 4G6VB 5HLFB 4J7CA 1L3KA 1Y0HA 3RJMB 4C11A 2UXCK 2DGTA 3Q2TC 4EFHA 2XO7A 1JKHA 4FLTA 1I94F 2BM1A 2R9LA 2RDJA 3DM2B 1VLOA 1WSEA 4J9NA 5F9LA 3DYAB 2BKPA 1QZ6A 2KXNB 1Q86O 3CC7S 1ATRA 1ASWA 1PC5A 3UD4P 2IJRA 2F4FA 3VQCA 5DLGA 2CQBA 2YWFA 2IS3A 1NDCA 4OI0A 4WFNQ 1M1KO 4FNIA 1X8DA 5HAOA 3THXB 2YCHA 1U1NA 2F8TA 1FKPB 1YK9A 3D6HB 3US5A 3N01A 2RKIA 2JEFA 1PO6A 1N0UA 4IDKB 4OPKA 3LAKA 4CM2A 1K9MO 3L4QA 4RNMA 4I69A 1V3SA 1NCLA 4AHVA 1JXBA 5AZJB 4MFBA 4NYPA 2XY8A 2D1CA 2RHQB 1T0TV 1VJQA 3HDSA 5C7PA 4HYKA 3IN5A 1HQEA 2BJ1A 1BHNA 2F7VA 3GYNA 2NRVA 3G8QA 3UNYA 4X64J 3C14B 3ZO7A 2OLWA 4CGJA 5LJ5Y 3J7A1 4LF6K 2XSJB 1PJ6A 3MCMA 4G1QB 4RTFD 1RHRB 4CCHA 4Z2XA 4KR0B 1Q78A 4ZVHA 4JI3J 5FDLB 4K8RA 4B9LA 1NDKA 1RBAA 2E6MA 1C2PA 3VQ7A 2D9PA 1BUXA 2WBNA 5DM7Q 3RR7A 2LECA 1WC3A 5AQGA 4LF2A 1RZMA 3UW1A 1ROFA 3I96A 1OKJA 2V5HG 5AXKA 2HHUA 2ASJA 5KFAA 4ZVQB 1U2FA 4FJ8A 5ETKA 3NVMA 4E3SA 4BRLA 4V1Ak 1Y3KA 2GHWA 5BYQA 3BPSP 5IQ6A 3EN9A 4B08A 1HNVA 1IVZA 3ELHA 4ALZA 3AD8C 2R7UA 5KG7A 4BC7A 4O0JA 4J9RA 2F5GA 5A8KA 4KTWA 4NX9A 3CCVN 5L39A 3JAMY 4FM0A 5H9FJ 2KJWA 1TL4A 4BRNA 2MMYA 3RSEA 3I0SA 2AMCB 3KWIA 1DFDA 3FNNA 4RWTA 1IWAA 3FFIA 2K7JA 4I7FA 3CCSS 2V2ZA 2V94A 1Q16B 5AQKA 3VERA 1MDUB 3I33A 2RRAA 4OLOA 1NO8A 4ERDA 1JCEA 5KT6A 3NGIA 4M5MA 4OLPA 2DGUA 1RAIB 3O3FA 4IO9L 1S6OA 2OHDA 3SUOA 3V4IA 4B3OB 4OJGA 2AJ2A 4YDDB 3VHQA 1R27B 4M3YA 1FTRA 1IKXB 1UAXA 2DNRA 5ETOA 3Q8YA 5H9EJ 1VCTA 1J53A 2PBDA 4HEA9 3PYDA 2P9PA 1X60A 1WOPA 4GC7A 1MLAA 4B3TK 5FD1A 3KWGA 1X3MA 4B3RJ 2YQ1A 1UTAA 1RBVA 4BR5A 2XZDB 4YOTA 4YS2A 2OTJS 4MDAA 2D3OR 3M1VB 4HHHA 1EZZB 4X4UA 3VQBA 3R5BA 3AD9C 5DJBA 4DR6F 1NNEA 1B9DA 1IBKJ 1QVFR 1JJ4A 3MMBB 1NGFA 5EHHA 4DFKA 2IBOA 1FW6A 2ASMA 1P8ZA 5HVGA 1H98A 4ED4A 1FXRA 1VC5A 3BO4A 4U67L 1YDLA 3O6QA 2O8CA 1YRUA 2QYCA 1V3RA 1J54A 2ZOMA 3IGVA 2W2OP 3QEXA 2VF3A 4E19A 1R0CB 2ZC3A 3PACA 5EX0A 3DXKA 1KQGB 3CERA 4QR0A 1RBSA 4XEIA 1GXUA 3D2WA 4DUYK 1NBEB 2CZVC 2JRSA 3AJDA 2MQQA 2A41A 3KUHA 4KTZA 5B8HA 2YH0A 1HWLA 5DO2A 2KZZA 3H08A 5AQFA 2VOPA 3FC9A 5HVFA 4IOCQ 4KPCA 4YMEA 5BPLA 1HWKA 2IHR1 4CECA 4JV5J 1TAQA 4CEBA 3NOGA 1HNWF 2MKYA 3BGUA 4X64K 1FKOB 1LQ9A 2MLYA 4K43A 3HHLC 3KXDA 2XY5A 3THWB 2KYXA 3MXJA 2HWHA 4ZJLA 4NYFA 1RAHB 1ZM2A 4ATNA 1P9YA 3VA3A 2GJFA 4IFVB 3TAQA 1LWCB 3FCHA 3UDCA 1NGJA 1HWUA 2BE7D 1GFWB 3TUPA 2J6TA 2AF6A 2DTUA 1RTIB 2E9RX 4JI6J 3KWMA 2DGXA 3QRPA 3CCMN 1UETA 2X78A 4L6V3 2MPUA 4YHHJ 5KFQA 1T94A 2J0QD 2HNDB 1GXLA 1W2IA 3MHYA 3EJMA 3C3LA 1UFWA 1Q8LA 4X65K 5ETLA 3QSYB 4FYDA 3M05A 1CZAN 2FC9A 2O8DB 3M30B 2EFGA 3BSAA 4KHYA 1X4FA 4WKRA 1X5TA 4PHTX 1NOYA 4G9ZA 4K4SA 1K8KB 3VEWA 1YVUA 5D6GA 4DV4J 3TX0A 4KT0C 3EDRB 3HZEA 3AVBA 4OZJA 3TAGA 1F9EB 4OHWA 4ED1A 1TL3B 4DL6A 3VGKA 2X6NA 3MFHA 1CXUA 1D8ZA 4MQ3A 4CBXA 3SMPA 3IRXB 4GMJB 4U7UD 2XMTA 1Q81T 2CJBA 3M2RA 4FYVB 2A3ZA 1MN7A 2CDQA 1KOOA 2NUBA 1IKWB 4PXCA 3MUMP 2XTJP 4YB7A 3I5BA 2YKOA 5HRNA 3K58A 1OY8A 2OKQA 4LT6A 2VD3A 4I6MB 3F56A 1S10A 3SPZA 4RW6A 4ETXA 2FVRA 1X4DA 3MM7A 3D2FB 4ZPWR 1FNOA 1QY7A 1REGX 3U7JA 3H3OB 2F8SA 3PDNA 3E51A 2VFVA 3FEZA 2IBKA 2VG5B 4K4XA 4FJJA 1I94K 3PEJA 2OELA 4DWIA 2M5YA 1VQ4N 1GMVA 3UPFA 4JV2A 3ZSQA 4LIWA 4HUEA 3UR3C 2CJYB 2PFDA 4NLSA 3SCXA 2BJDA 3CW2C 3DLGB 3I0RA 2N7YA 1LKZA 3ISND 4LH4A 3QSIA 3DDNA 1NHVA 3BBFA 2AW0A 5GAEI 5BRFA 3R5JB 1RTHB 2ZBCA 3CJ5A 1QZ5A 4YHHF 3A4TA 4OHZA 3NH2A 3T5HA 3WC0A 1QSSA 3KHYA 4Y28C 2J8SA 2JFKA 2JJ4D 4CZLA 3R7NB 1TR0A 3KG4A 3EZ5A 2ZM6K 2V4QA 1RWMB 2B9YA 1HIYA 2AQ4A 5DGAA 2VC0A 3W66A 3G71N 3ICLA 3H5XA 4FDFA 1W0HA 3HO1A 3ZCMA 5JLFA 4EGLA 3A8JA 3NXZA 4KO0B 3ZTQA 5IS2A 5BN9A 2ALYB 3VGVA 4F4YA 2HBMA 4TLRA 1F6TA 4FNHA 1PCAA 2G0CA 4K5SA 3BH6B 1KRPA 1S6PB 2CPZA 5C0YA 4QS9A 1P1LA 2HF3A 3PR4A 1U48A 1ZA2B 1MMNA 2P9GA 2IAJA 5KPTA 4QJVA 4GVLA 1RNHA 2N7CA 1JL2A 1WB9A 2IMOA 4A8SA 1VSJA 1RTDA 2AD9A 5KFZA 2IVMA 4A8YA 4X65J 4IH6A 1HR0K 1XNRK 4C7QA 2H5IB 3N5BA 4NLXA 1IM6A 4CBUA 5GMKa 2HK3A 2AZ1A 4HHJA 3H8YA 4C0HA 2B4JA 2FPHX 2NXUA 2E5IA 1Q4RA 2I5JA 3BZCA 4J9KA 4DG1A 3CMAS 1LK7A 4BWMA 3KFWX 2XQCA 4NASA 1X9MA 1NK4A 4UTGA 2V8GA 1N5TA 4MMOA 1LWXA 3M32A 1WHYA 1I1GA 1B0PA 2C2RA 2PD1A 1IBMF 3MEDA 4ISEA 1ZTTA 1XWLA 2DH7A 4JI1F 4O55A 2UUAJ 1NJIT 3FEXB 2L9NA 3SCJE 3S1TA 5M1FA 1CJVA 4IDKA 3N0VA 2NS1B 4LF5K 4ICLA 1NK5A 1AFJA 2GS8A 4BRAA 1FJEB 4V19S 4KHSA 1KD1T 1T95A 3H46O 1GOCA 2W8KA 5D4PA 1FJ7A 5F0WA 3RYLA 2PZSA 2DNPA 3K59A 3MOZA 2LA6A 4P52A 1LNQA 5D15A 1U4BA 4EWTA 3IDHA 1XHZA 1LFWA 4CJ3A 4JV1A 1JLQB 1T11A 3UWTA 3Q8UA 2DNHA 5H1SV 3H4BA 4AT1B 3GE1A 1U1KA 5KFHA 5D78A 1JJ2R 4MO5A 4I6AA 2J7WA 2KVQE 1IQTA 3VOVA 1NK7A 2EC2A 1RHKB 1GTHA 4MKYA 2GJ2A 3I4HX 2OFHX 1RJJA 1QAYA 1PYTA 4MLEA 3EKSA 1LXJA 2UU9K 3PO4A 2G1HA 1BLUA 4Y2AA 1JXVA 2ZHOA 3FFIB 3AVKA 3NH1A 4URSA 1RWUA 1TTHB 4M5JA 2FLPA 3DCAA 4FS1A 2AYGA 3QNNA 5B08A 3R6MA 2XS7A 3CUNA 2QEXN 2VFRA 3U1MA 1XJWB 3J7Z5 4EO8A 3DLBA 2HB5A 3OYEA 4FJKA 2YX7A 2J9EA 4MH8A 1VC0A 2GTDA 1VR6A 1WC6A 4IDHA 4N5SA 1Y11A 3IGNA 3J81j 3U27A 2HZAA 5AJ3F 3OBIA 3W2WA 1HLWA 4CHZA 1ZH5A 4RNHA 3SLCA 3QNOA 4O3NA 4DR7J 2CQPA 4ECSA 4CT8A 4K8ZA 4DN9A 1OWXA 2I7PA 2QX0A 1RWXB 4K41A 2CNOB 1LWEB 3CF5L 2XZTB 1S7HA 3HCXA 2FBVA 4LSNA 1XHXA 3AVIA 3CCTA 4ZCLA 4CLYA 4K2JA 3QDKA 4K4WA 3PO5A 3C7NB 4CQ1A 1RE1B 2XMKA 1LOUA 1ZZNA 1HBUA 4WIQA 4KFBA 4EUVA 3PKYA 3QJJA 1Q5YA 2VYPA 4LF6F 3MXMA 2V7YA 4JI4K 1X0PA 3L2WA 4ZPAA 2CQ0A 3OYJA 1C1CB 4CJRA 2R7WA 2AJQA 1QSYA 2IJNA 3BR8A 4QBUA 2CH6A 1IKVB 3LTOA 4GKJF 5IWAJ 2XHCA 4B8AB 2FGCA 1XR6A 4ILLA 5HBMB 4MKAA 3D5MA 2HS3A 2KFNA 5F3ZA 4WYBA 4Y2MA 5MLCV 4YDUA 2L9WA 3AB2B 3RMCA 4EBDA 2AEJA 5EX5A 2UYTA 3PRBA 3B78A 2W2MP 1YVFA 3D0IE 3FSIA 1T9UA 2GJIA 2W9CA 2E5LJ 2ASOA 5ELZA 2XYPB 1S1TA 3AARA 1IBLK 1RU1A 3D9BA 4HTIA 2MQOA 4N77A 3QBWA 2H1YA 3I56N 3ZT4A 3CPWM 4ZLPA 2I2YA 2A2DA 3OQ2A 4CJUA 1H2TZ 4FLUA 4CLFA 3HPHA 4LFCK 4O3QA 5KFGA 4ZITA 1CS4B 3MAAB 1O8BA 3D4JA 5KFOA 4QIGA 1I6JA 1NJYA 1ZBIA 3GSDA 3R8EA 4CJTA 4F7VA 2R4FA 4IBNA 1SJ3P 4JI2K 2ZKUA 5D0EA 5A76A 2QWLA 1FVSA 1SC1B 5KFKA 5C5JA 5BR8F 1VQPN 3HD1A 4CZKA 5LL6Z 1QM9A 5D4LA 3HFVA 4CF0A 4W4MA 4B3MJ 4OQJA 3KIOA 2U2FA 4CHYA 3LDPA 2HHHK 1Y00A 2PSZA 2EBEA 2XGPA 1GQEA 1RAOA 2MY7A 4KRFA 3CFPA 2ATQA 3B6BA 3KHLA 4MKBA 1VQYA 2UP1A 4NLQA 4LRFA 2E1YA 3MM5A 2D0AA 4IWVA 2BR0A 1UAWA 3BEXA 4HACA 1FRIA 4KHWA 1K47A 1UEKA 1IV0A 2OPQA 2EW9A 3JS6A 1S1XB 1S6QA 2DR9A 4Y2KA 4H5WA 4FPAA 3R2CJ 4FWQA 1EETA 2DIVA 1IH7A 3CMEN 3GU0A 4NA3A 5DLFA 4UT4A 2V34A 1X9JA 1IJEB 1IBCB 4ZLNA 1K8AO 4L76A 2EC0A 1UZDA 3P45B 3UKRA 1X4BA 3M8QB 4JI7F 1A9NB 2GUPA 3SEOA 4XDDA 4NE9C 2OIHA 1S57A 3J7AN 4YNQA 3W2VA 2FXUA 2KXFA 3ID6A 4FO0A 2VPWB 1S9EA 2QA2A 3C6HA 2QV6A 3MR2A 4C0OC 4DS4A 2JL9A 4DCOB 1RAEB 2CUYA 3NOCA 1U47A 2QWNA 1WF0A 2QFIA 5HOOA 4XH5A 3ZTPA 1BQMB 1R8PA 3SV4A 4KE5A 3JQKA 5CYMA 2YKMA 2AEFA 3B54A 3NF6A 4Q0BA 4EFAC 1VQ6S 4KH4A 4BRQA 2VQFJ 1FDAA 4WK1A 4IOAL 4B9NA 2B5JB 4A8MP 2A0FB 2W9BA 3C2PA 3BN7A 1FI4A 3ZX0A 2HBQB 4RZRA 2OP5A 1HBMA 2B4OA 3SCIE 4BVOA 4H4KC 4H4MA 4FXVA 2VGMA 1YJWS 1MWMA 1D3WA 2NREA 3KK2A 2ASPA 2GX9A 4RNFA 1TVRA 1T9YA 1I94J 4ID1A 3ENWA 3CCQS 3NGTA 1F1BB 2EK6A 1MNEA 1SKRA 2KI2A 4E7HA 4I9LA 2W2PP 3C8YA 3W2VB 3RW7A 2W9BB 2FBXA 1YX2A 4LSLB 3H2UB 3CIZA 5JVGL 2HIYA 1KP6A 1H2UX 4LFCJ 3CCVS 4BDPA 1RBTA 2XRIA 5ETSA 1M90O 2A1RA 4DQIA 1NM1A 3IWLA 1C4CA 3GYGA 4YY3F 3CCUS 3CJ9A 1XMOK 2F4VJ 2RF2A 3HBTA 5FROA 1B3TA 2MHEA 2DCUB 4TY8A 3BQ2A 3ETMA 2UUBJ 4QWAA 3DLEB 3I8BA 1XC9A 1MA9B 1Q9XA 3V4IB 1WDDA 2DRBA 4IG0A 1AROP 2JHEA 1KXPA 2QLJB 1M1GA 3KVGA 4HVJA 3T9NA 2W7PA 2GA7A 3W5YA 1HI1A 1RKIA 3AA9A 3W2WB 2W4CA 2FVCA 4TY8B 2OJ3A 1YGYA 3HSGA 2DIUA 4H4KA 3AA2A 2MHNA 2NSBA 1TMMA 3OD2A 4C98A 4Y2CA 3VALA 1OQ6A 3GV5B 4PWDB 4CLTA 2OPSB 2R7YA 2ZH5A 1Q82T 2RUGA 1HARA 1O13A 4C4WA 4MT1A 2PIIA 4ECZA 2GC8A 4B1XB 1RBUA 2WOMB 1ASVA 3V6KA 3E9PA 3IAYA 3VQSA 3QLHA 3I4PA 4CFDA 3THVA 5J2MB 2RQMA 3OTCA 1VQOS 4DTNA 2KB2A 2HOEA 2P9LB 5I42B 3RBDA 5H9FK 4JI0J 2YI1A 2I8EA 2ZUAA 4ELVA 3K9JA 2KO1A 4IEIA 1KQKA 1D8YA 3HSDA 2VG6B 1JXEA 3BDPA 4FXWA 4JV0A 4X84A 3UCUP 3IG1B 1OVYA 3NWRA 1H73A 2K3KA 3SBMA 2NUHA 3PRDA 3QGPA 1HYSA 3H45C 2J9DA 3O3GA 3CMAN 1VSKA 5F2RA 3ZZ0A 4B3TF 1Q7YO 2OANA 3OSPA 2VWKA 3ZTRA 1CJTB 1RADB 2VJUA 3O44A 3IP0A 1NPRA 3W5XA 3J7YI 4P72A 4O3RA 4M5LA 1TU0B 4UY85 2LDIA 1PBAA 3IXQA 2MQNA 2QGFB 4B17A 2LCWA 3RBXA 1JCGA 3DHWC 4DR3F 4NLTA 1TGOA 1R89A 3VF0B 2ZM6F 4AXJA 3CC4S 2V8HA 4IFYA 2DBBA 4J2EA 2QKBA 4I4BA 4DDFA 3SSRA 4IR9A 4XO0A 3L3VA 4LVNP 1QE1B 2KKZA 4A8WA 2GHVC 1TUYA 5FJ4A 2H5JB 4L75A 3TPQA 2A42A 3M8YA 1A5XA 4DKWA 1QTMA 2HRUA 5FLXO 3PHTA 1FE0A 1TKZB 2OZSA 2AYMA 3CCLN 1QQCA 4CEDA 4MO4A 5AXNA 4FN5A 2R42A 4QWCA 1JJCB 4CI0B 1JMTA 2DPJA 4C9DA 4NXMJ 2HHVA 2R2UA 1S9GA 3Q8VA 4BDYA 1WC0A 4WTYA 3FBFA 3BSCA 2F65A 3GSIA 3EX7B 3ENBA 4L73A 4YUDA 3DMJB 3E01B 1WEZA 3DXSX 1VQ7N 1P1TA 3AQOA 1U2VA 5HN0A 3C66A 5L38A 3PX0A 1YJVA 5HQMA 4WE1B 3RB0A 3HZGA 3D1QA 3WXIA 1WUUA 4KO0A 1N5SA 2DGSA 2JH3A 4OKKA 4CESA 5F8NA 4RWWA 3UFCX 3TWZA 3DLKB 4LF4F 4DX8H 2ATLA 3BPDA 2RJZA 3A5NC 1WNEA 4JI8K 2DB1A 5FIIA 4CO0A 3DXMA 1N34K 4X2BA 2LLZA 1OSDA 2NRRA 3O8WA 4LF7J 3K5OA 3P8BB 4JI3F 4F02A 4D3HA 3QO9A 5LMNJ 4BE2A 3DNCA 3MMAB 3QIPA 1NXIA 2V51B 4FLWA 3BN4A 4WQ4A 5F8MA 1LWFB 1X7VA 1K1SA 3DLKA 4XH4A 5K8NA 1VQSA 4AHSA 5D4NA 5F3TA 3ZTOA 1RGIA 2PGCA 3IS9A 2QC3A 4H5VA 4A2AA 4U7UK 3CI5A 3L6QA 3RUBL 3CJ8A 2UXCJ 3UNGC 4ZIVA 3QYYA 2VFTA 3N6MA 5F0XA 1PGZA 1FCAA 1N56A 3OL8A 3LPTA 2JVRA 2E9TA 3KLFA 4MIBA 3ULEA 2UUWA 4DV5J 4DR2K 2KG1A 4DMZA 3R97A 3LDOA 5KFSA 3O9UA 2BJEA 4Q45A 2DY1A 3JB9k 4ZJQA 1TUWA 4FLZA 1TVRB 4LFAF 1YJRA 4AH9A 1G4CA 4LREA 4PABA 1IBLJ 1MU2A 1YG0A 5K14B 3N6NA 1CEZA 3BYPA 2YJFA 1TFWA 2FJDB 1VQ9S 3EICA 4GRSA 3Q8QB 3TSQA 3I32A 1HMVB 1PJ7A 4ELUA 4P6QA 5BPMA 3LALA 3CXCR 3TX8A 4MYUA 4Q44A 2FIUA 5C42A 3M8ZA 2C3UA 2IDEA 3KDNA 2VA2A 3W62A 5C2DA 3T1YK 4E98A 3DRXA 1UVIA 5ETTA 3G6EN 9RUBA 2CPFA 2MSSA 4DLGA 2WBRA 3T6JA 1WC5A 3JSYA 3NNHA 3O9QA 5AQWA 4CHNA 4C11B 1FE4A 1HBNA 4OI1A 2ACYA 5CZ2A 1ILYA 4N7TA 4I67A 3O4QA 2IDLA 2NXCA 1HQUA 1NJXA 5DETA 3FGUA 1HPZB 3TO8A 4FJ7A 4PWWA 2XI3A 1VQMS 1B70B 2X3DA 2FVSA 1QHAA 1VQ9N 4ZHRA 2KHDA 1FRMA 2B6AB 1KAYA 1LW2B 2KHOA 3KD1E 2GIRA 4HLBA 2DTJA 3I55S 5KFFA 5LOQA 1T9WA 2I9SA 3BREA 3MCSA 1RT4B 2R3VA 4NLVA 2G2ZA 3ZSOA 1X9SA 2DFHA 4H4OB 1XQSC 5ADZA 2AGOA 3S7RA 3CMES 1WSRA 4O23A 2D41A 3GP9A 3EKUA 4ID5A 3NGYA 1RTZA 1NGEA 2K1RB 2VODA 1SZ2A 1WC1A 4Y34A 2FC8A 3AO3A 2DKOB 5KGWA 1U6ZA 2XMJA 4B9MA 1ZBTA 4J5OA 3JQJA 1Q8IA 2RB7A 2FJAB 4IJNA 2G9OA 3MR6A 4AQYJ 4RW4B 2ZE2B 5JVHL 5E26A 3S41A 4OYIA 2B9XA 5BN8A 3CDBA 1HD1A 3R5AA 1FWKA 1DT9A 3NS6A 2LEBA 4BRPA 4X4RA 2CJXB 5A8WA 4FJ9A 4O8KA 1QAXA 4DUZF 2E66A 3IFRA 3P4IA 2C1EB 2BE2B 1OO0B 3FE1A 1SBRA 2P5VA 2F40A 4G65A 2QA4G 1B0TA 4OLBA 5HL7L 2CPIA 4A8OA 2A3JA 3QMLA 3DLLQ 4ZA1A 2DRAA 5AQUA 2B8QA 1KOHA 1UVJA 1RDAA 3OLAA 2PMHA 1Y97A 3FQLA 2QA1A 4CH0S 3EE9A 4FZVA 1RLDA 2VU5A 4UY8T 4CLSA 4KI4A 2RU9A 1N5YB 5M1PA 1YZ7A 2CJQA 4HH1A 5D0HA 4PWDA 1KCFA 3H5SA 3SAGA 1W26A 1VSHA 1HNVB 1OH8A 2DK2A 3IM9A 5HJYA 2JOQA 3JYTA 4Z4HA 1EB0A 3OVBA 1CXQA 5A8KB 1UA0A 1VBZA 4PQUA 3V2UC 3B6OA 3PCOB 4ED7A 1G15A 5KG2A 1VSEA 2WTFA 3MWBA 5AE3A 1NB7A 2YX4A 1UW4A 4AF1A 5B0EA 4DV1F 4CK1A 4CK3A 3LO3A 1M5OC 2YKPA 3ENQA 5KFWA 4E7KA 3DU5A 3MDQA 5SZTA 3OW2M 2XSJA 1X4AA 2LSNA 5KG3A 2W6KA 4V19X 3LQVA 1YZ6A 1WF2A 1K44A 2YNGA 4IOAQ 3CCSN 2EI5A 5T14A 4YR0A 4DQ8A 3HI0A 4H5NA 1IKYB 1TZ0A 4IFVA 1TL7A 4ZOSA 1WHWA 2V7ZA 4HACB 3KMSA 4LR9A 1U6FA 3L3UA 1HA1A 4DR6J 2ACMA 5J1NA 4ZLLA 4DB3A 4RU9A 1WHXA 4OIXA 2O67A 2ZDPA 1DQ9A 5K8OA 2C3OA 4BACA 4K0KF 4FW1A 5CR4A 1EAYC 4DV7F 5CAAA 1UWBA 2WVFA 4FBUA 3LA0A 3N4QA 2HKEA 3WX4A 2PEHA 3ZT0A 3M5RA 4A8KA 4Y3CA 4FJMA 1XNQK 1KLMA 1BDGA 4OJ1A 4KGZB 4DUYF 4JYAJ 3UKRB 4DUZJ 1J5EF 2VKRA 3CCJS 5D4OA 4EYHB 4ICLB 1N54B 1EP4B 4DR7F 3KLEA 5KGXA 4LFBF 4DSFA 2FHJD 5A2QY 4CJ7A 4TU8A 2RAQA 4FWKA 2HNZB 4JOUA 4JKAA 4XIUA 3DDKA 4AQYK 4B1WB 4AL7A 4OZ1A 5E41A 3W63A 1QVGR 4KSEB 1FRKA 2L48A 3BGRA 2HS4A 2WZ1A 3QEPA 4JB8B 2OZMA 3BF3A 1DTTA 3SUQA 2CJAA 4W98A 3PW7A 4R0JA 3W61A 1SUQB 4FF2A 4OZ0A 1RDUA 2ZZNA 1F3VA 2ZVSA 1IR0A 4YY3J 1T6CA 1CPZA 3LDQA 2R7TA 1XERA 2UVUA 2W25A 3D7EO 2XEXA 2DJWA 5KT4A 4J37A 1IJJA 4WYWA 1TP7A 4CO2A 1R43A 2OEKA 3SIPB 4KHPF 4FYXB 4DFPA 3VWSA 4LF9F 4FK0A 1N48A 2FHOB 5BJRA 3V5RA 3M9OB 3SQGB 2C2OB 2HPUA 2BV3A 3V9UA 5DG7A 4B1YB 3CM6A 4PXBA 4CJ4A 1FEHA 1DEJA 3OT9A 2BANA 3OL9A 2ZH8A 4ZN3A 2ADCA 4AM6A 3CD0A 5JVHQ 2M70A 1J6ZA 2G13A 4M8LA 1N33K 4KAIA 5KG1A 3MGJA 4IH7A 1F5CA 2F8EX 1P6TA 1FJGJ 4HTUA 2LXFA 1IO2A 3MXIA 1JX4A 4M5HA 3V6HA 5GAHU 4DL0C 1XK8A 3TSUA 4QR2A 2HQCA 3HVTB 2LU1A 2OMLA 4JI2J 3FLCO 1BISA 2ZBIA 3QFPA 3ID8A 5CQGA 3R7BB 1HNIA 2F3JA 3SNNA 2OPRA 2PAVA 3MM7B 1I3OB 1H3DA 1HW8A 4X4TA 2HHHJ 3CQYA 1HBUB 1A6LA 3AVHA 2LMIA 3A5LC 4A5BA 4KYZA 3ASMA 2ZF5O 3AO1A 3WBZA 1M1KT 2PY5A 5KFEA 3VCDA 1TUVA 1GT8A 1ZAWA 4Q2LA 4WFXA 3ATVA 4K4UA 1NJIO 1NG9A 2CQ2A 2R7RA 3OXGA 1WELA 3A8KA 5M1QA 3W3SA 3ET6B 1V6HA 1RT1A 1WG5A 5AZJA 1HBOB 3CSKA 4OHYA 2ZKTA 4DL4A 2D69A 2OYQA 1VOMA 1DGKN 2ZJRQ 3R6LB 1O1WA 2GZOA 1HR0J 4TN2A 5A6PA 1ZBHA 2EBGA 4ZJOA 3CJKB 4RNOA 3CCUN 1SAZA 1YJ9N 2YNIB 1FNXH 4RUAA 3K5NA 3DGPB 4CZIA 3AVJA 2E5HA 5GADP 4ES1A 4ER8A 1CULB 2XZWA 5KFBA 2XMVA 5FPMA 1VQLS 3D1OA 3M6UA 4KB0A 1GLCG 1X4HA 4WIIA 3O1LA 2HZVA 3KK3B 4DV4F 4M7XA 2BBEA 4QU6A 4DFJA 3RTVA 2M0GB 4BRKA 2AYEA 1VLYA 3OYNA 2ZC4A 3ZC4A 4R8UA 3B82A 1N34F 2G8HA 2WC9A 4U8YA 5GIOA 2CG4A 3M30A 4DZDA 4LF5J 2RE1A 3NAHA 5E0OA 4YOEA 1S3XA 1OMSA 2YPYA 3C15B 2X1FA 1NGAA 4YB5A 3OL6A 3PJWA 1VJWA 3UCGA 3HOSA 2DEIA 4Q7AA 3GOIA 2YWHA 4ZHRB 4DUTA 4JI7J 3MZIA 1TV6A 1BMQB 2VZ9A 1NKBA 2GMHA 4ZLJA 3UD5A 2PDAA 4DV0J 5HROA 1RWKB 1NU0A 1MG7A 1IR2A 3OA9A 4A2BA 1RILA 2FSNA 2W7AA 3G6ES 1SJFA 2WW8A 4CERA 2RIJA 3E2EA 4PCQA 3LGHA 4NRUA 4FPRA 1X31C 2W2NP 3DRRB 1AB8A 1N32F 3MR7A 2P9UB 3VQEA 1SV5B 3DN9A 2QW9A 3LM2A 4KB1A 1NKEA 4OYXA 2G8UA 4I2QB 1S12A 2PEBA 1WJ9A 1C0GA 5GAEP 1N88A 1HW9A 1DURA 2LXIA 2MZJA 4OI2A 4EEYA 3SFUA 1VHIA 3M2VB 5AQYA 2HQ3A 2QLBB 2E2NA 2FLNA 5JJBA 3QT8A 3CJBA 5LMUF 4PAAA 1TFYA 1VHXA 1E4FT 2NLXA 1KQSR 3W5ZA 3L95X 1HWIA 2IYGA 3DC2A 1L3VA 2BM0A 1BCMA 1UVKA 4I2PA 4OX8A 2DGQA 1DQ8A 1X4CA 2LU2A 5T7LB 2ZUGA 1HKCA 1Q18A 3GIKA 4EZ9A 3IA0A 3AA4A 1S1VB 2NLWA 3VPZA 1DLOB 4IO9Q 2QXLA 2VFUA 1NB2A 3QO9B 3IR7B 1KHWA 3OJSA 1NH8A 2RHSB 2P9KA 1RQ0A 3SAFA 1T3OA 2KYZA 4UF4A 1WG4A 5I3UB 1YLXA 5LM7E 1WG1A 3DOMB 3UN3A 5CYJA 4YR3A 4H8KA 5HI7A 2DHHA 2M4MA 4FWLA 3PNIA 3J7YP 3G96A 3D66A 2OTLN 1KNZA 2WONA 2GGPA 2XBPA 1B64A 1WUAA 2HBYB 1BQNA 2RE2A 2BJ3A 5K20B 5CY4A 1S76D 3MAAA 3KK2B 1SJ4P 3V9WA 4JK9A 1TKXA 3DOLB 2PFFB 4Z94A 2W4PA 2XNRA 2HBZB 2L08A 1MWYA 2BOPA 5HMYA 1RI7A 2JEGA 3Q89A 2IM1A 1ZBSA 1X5OA 3ULEB 2RRBA 3H90A 3K57A 4JI4F 1VRUB 4HUGA 2J8AA 1TKTB 4NLGA 3NGKA 2KFZA 4M3WA 2IIRA 2XC9A 1ZETA 3MM9A 3MUTP 3GJSB 3ILIA 5FRMA 1F2GA 3SBGA 2QL5B 2QLWA 3TRGA 3TQEA 2RUSA 5HP1A 3P4UB 3KLGA 1QTNB 2MY8A 2MLZA 4KQZA 2DGOA 3CF5Q 4DHYA 1E6YA 1BI4B 2GWJA 4PEOA 1NK8A 5KPRA 2DH8A 5KRSA 3CVKA 1C1AA 3F5TA 4JI3K 1SCJB 3DLHA 4RL1A 3HP6A 4CFBA 2LQ5A 1URNA 2CIMA 4RW8A 1FRHA 2HRTA 4UY8O 1KVIA 4KH0B 3PV8A 2EPIA 3OYCA 3FVYA 2RS2A 5E33A 3AO2A 5L9XA 3ZZYA 3E1YA 3ZETA 2B4VA 3U9ZA 4RW6B 2HBJA 1FJCA 2Q3SA 3HXMA 3ZT1A 4ETZA 4EK2A 2OUGA 3ALYA 1XNQJ 1X9WA 1OH7A 5KG0A 4DUZK 2HHXA 2FC0A 1REVB 1XR7A 2CQHA 3QAUA 3OV7A 1YITS 2QK9A 1U1RA 1LW2A 3H59A 2J0WA 5DG9A 3T19A 4L3QA 2VH7A 1GMWD 1SUQA 4CYUA 3L3CA 1Q81O 4CJVA 2QTWA 2PN6A 4ZPBA 3OFGA 4KTQA 3GG4A 4DL2A 2VONA 4LC9B 4OO1J 1U1OA 1U6BA 3G8SA 2HFVA 3OR2A 3TAMA 3TUJC 5AXLA 3VESA 1IG8A 4NI2A 1QQNA 1M90T 4FPBA 4WE1A 4GNIA 5IT9O 3A1YG 3RG6A 4IYQA 1ELOA 3HHLD 2HYIB 1N6QA 1CLQA 3OFFA 2YKMB 5M1NA 4IEEA 2QMXA 1FD2A 2AEMA 1NSKL 3G82A 4DCHA 3ZLJA 4WWSA 4O3PA 1WKJA 2Z2MA 2BUPA 1FWLA 4RLEA 2EHGA 3OR2B 2IRXA 5IT4A 3U8XA 1NJWA 2FD2A 4W90B 1NSAA 1XI1A 4ZTJA 1UP1A 4AHRA 5HBMA 3CYMA 4QWDA 3DI6B 3MOJB 3FGVA 3QINA 2ZBQA 2YHXA 4QYZK 3CCJN 2NZ4A 4R79A 5KQDA 3THYB 1EHWA 3TYTA 1K73T 5J2PA 4IFYB 5C2CA 2GVZB 2R8HA 1S0OA 1IBKK 5E3AA 2OAUA 5GAHI 4LF8K 3TZXA 4MKVA 4JKHA 3PFOA 2KT5A 4M3XA 4F04B 3W8PA 3KD5E 3M6WA 4E1JA 1SVDA 3PW4A 1S4FA 4F3MA 5D3GA 1UJ6A 1I39A 3CD6N 1HI0P 3C6TA 4OJHA 3EGNA 4ANDA 2VG7B 1TL5A 2BW2A 2VL1A 1ZOTA 3VEOA 4OHXA 2ZDOA 2XY6A 3PYGA 4HUFA 3L2QA 4UQTA 1JLCB 2FYXA 3TI0A 5LMNF 2H65B 2NSCA 1BQXA 4IR1A 5FRNA 2UXCF 5B7WA 2G8KA 2UUBK 4JKGA 5MAOA 2CPHA 1FDBA 3CDAA 3IUCA 5CH7B 4H4MB 6AT1B 4QIVA 2X1AA 4FVMA 3LP2A 3ENVA 4WP3A 5IM0A 4PR6A 3OS1A 2R7QA 4H0YB 1Q7YT 2UUBF 4NO7A 4U96A 5EWFA 1SQKA 3GG1A 2NRZA 3P3DA 2M52A 5SUHA 1QE1A 2KQ2A 4J9OA 1NGIA 3WNGA 4DV5F 2F4VF 3W65A 1Y7PA 2JEIA 5ETPA 3OBWA 5D3GB 1GLAG 2CH5A 3HHEA 3E9OA 1N5YA 4DU8A 2KL8A 1ZBLA 3QFUA 5L1KA 3CJ3A 3KHGA 5DM7L 3T3FA 2UUTA 3QESA 3AH6A 1LV5A 1W2BR 3RVCA 3PX4A 3W9HA 5A8RB 4WU2A 3GTYX 4USTA 3GL1A 1S7IA 2P5GA 2GUIA 4PG8A 4LF9K 3V1QA 3A3OB 2Z56B 4ID5B 1JB0C 2KM8C 4DV2F 5A0YA 2ZJQL 1S48A 2E1ZA 2AGPA 3W9JA 2B8PA 1W25A 4CGDA 3QT5A