4H4MA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
548
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
total genus 135
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4mA05
4O3RA 3DMJB 2G8WA 4Y34A 1WNSA 2OPPB 3MXIA 3LP2B 1HNIB 1KLNA 4ZHRA 4CF9A 5HLFB 4CEQA 4NZ0A 2W9CA 1J53A 3QGHA 5KFZA 1S5JA 2UUTA 1JKHA 1HYSA 3KK3A 3THVA 4N76A 3BSOA 2AX1A 4NLQA 2ZKUA 1D8YA 4ICLA 4DL7A 4CJFA 4RUAA 3T5LA 3MECB 2I5JB 1JLGA 4RW6A 5KT2A 1T03B 3V6KA 3QNOA 3TARA 3TAGA 4WYWA 2IJFA 3JYTB 5HBMA 2ILZA 1RT6A 4TYAA 4OKKA 2LSNA 1J54A 4CJQA 3DOLB 1Y97A 4EP5A 4JV0A 3GV5B 1ZTTA 2GC8A 3FQLA 4FJ7A 2IM3A 1S1WA 2DY4A 1N56A 2D5RA 4K4VA 4CFDA 3ZSQA 5HLFA 2OA8A 3VN5A 5DQGA 3QEWA 5CYQA 4IOBA 2YNGB 4ED6A 1IKXA 4EYHB 5L1LA 2B43A 4B8CA 2XI2A 3MECA 2R7YA 4WXOA 3KHGA 4KTQA 1S0MA 1TP7A 5KFJA 5CYMB 3SUQA 4B3OB 1SKRA 3VQ5A 4YP3A 4K8XA 2HHVA 2KFNA 2XWYA 3K5LA 3MR3A 4CHNA 1EX4A 4CEBA 4LSLB 4XPCA 4CJRA 1NJWA 1RTIB 2JGUA 1YTAA 4RW4B 1JLBB 4HCCA 3KK3B 4DSFA 4IBNA 4ICLB 2VG6A 5JUMA 2IAJB 1IM4A 5JS1A 2IM2A 1VRTA 3CVKA 3HHKA 5I42B 3AVBA 4Q45A 4AHRA 3VA3A 4JRQA 3A2FA 4K4YA 4DTJA 2EHGA 1N48A 4NLPA 5HBMB 5CYMA 3RB3A 1A5WA 4MH8A 3QGIA 3BSAA 5KFEA 2DPJA 4X2BA 1QTMA 4KKOA 4QWBA 1EKEA 5DK5A 1T05A 4KHSA 4KTWA 5I42A 4YR2A 3K59A 5KT7A 3KLHA 3NF9A 3VQCA 4C8KA 3V9WA 2WOMB 4FK4A 2Y1IA 2DTUA 2IJNA 3HVAA 3NBPB 3LWLA 5F9LA 5KT6A 5KI6A 4FCYA 1RTHA 4OPKA 1S1UB 4NLVA 4EBDA 4BE1A 4EZ6A 4YNQA 3RMBA 1BQMB 4CHQA 4O3QA 3KMQA 2OPSA 2YKNA 1T3NA 1KHWA 2RN2A 2FBTA 1JLEB 2V4RA 1S10A 4H4MB 4CE9A 4B9TA 3TAPA 1FKOA 3KK2B 3QO9A 2YHAA 1VSMA 3LP1B 4DL3A 2WONB 4F8RA 1IKVA 4CGIA 5J2QA 1IO2A 1XR5A 1A5XA 4E19A 2XCAA 1VRTB 4IRKA 5KGWA 3HYFA 2ITGA 3UPFA 3SFGA 2JLEA 5KT5A 3PW7A 4TY9A 3PVXA 3QEVA 2OH2A 2IM1A 3KLEB 1LW2A 1C0TB 4MQ3A 3OJSA 5EWEA 2FVCA 4B9NA 4DTMA 3TQ1A 2RKIA 5L1KA 3AA2A 5DG8A 2XY7A 4JV1A 3H40A 3M9MB 4N56A 5C24A 2D41A 3ZT2A 2C22A 4WYLA 4ECVA 3VA0A 4GC7A 1UA0A 2ASJA 3OYAA 3SZ2A 1G15A 3CFOA 2JEJA 3DMJA 2HWHA 1JLCB 4O3SA 3VQEA 1LWFA 3Q8PB 3PX6A 3MEDA 4MK9A 1RT2B 1JLAB 4BDPA 4ECQA 2EC0A 3H4BA 2BQRA 5EWFA 4IH5A 2P1JA 1UA1A 3BQ2A 1VRUA 5J2NB 4MK7A 4N5SA 4TN2A 4CHOA 3LP0A 1TQLA 3NHGA 2C2EA 1LAWA 2O4IA 1RDAA 4RW7B 4YQWA 3OS2A 4W5QA 4DQRA 1S6QB 4ED8A 1S9GB 4E89A 1U04A 3NGDA 4HUGA 1WSFA 4EO8A 5KRSA 4N47A 2JC0A 3MEDB 4CECA 4B9LA 3CDWA 2HMIA 1SH2A 4FJKA 4ELUA 4DQSA 4IH7A 1LAVA 4GW6A 2GBZA 5L9XA 4W5RA 2ZQBA 1ITGA 3TAMB 3OL7A 3GQCA 1DLOA 4CGFA 1K6YA 4H4OB 3DLEB 4O4GB 3KK1B 4J9OA 4F4ZA 4GVMA 3KIOA 2IMWP 3EZUA 2AGPA 3JSMB 3I0RB 1D1UA 5C25A 3H5YA 4OGCA 2GIRA 2DFEA 4JRPA 4QW9A 2YV0X 4NRTA 5KT3A 2OZSA 5C42B 3LP2A 1S4FA 4NLOA 5KFIA 4FW1A 1SL1A 3ZT4A 4CJVA 4O3PA 1GX6A 1L3UA 3AVAA 4RUCA 1FKOB 1QSYA 3K58A 3KHHA 3ZSZA 4AHVA 2FJVA 1S9FA 3VQ6A 3I0RA 3L2RA 3AV9A 2ZE2B 4FJIA 3ISNC 3RAQA 3EZ5A 3ZT3A 3OL9A 1XR6A 3TAEA 1RBRA 2OPQB 4HVJA 4F4KA 3KJVB 3AVNA 1FKPA 4E3SA 3OYFA 4EZ9A 1RA6A 4M45A 2WK4A 1QAJA 3KKRA 4RNFA 5EWGA 1QHTA 4FW2A 4NYNA 1CLQA 2BANB 1HPZA 3QESA 4ZTJA 2E6LA 3DRSA 4M3TA 2IS3A 1U4BA 1HQUA 1TL1A 3OYBA 1LWCB 2P5OA 4I7FB 2VA3A 4F3OA 3V4IA 3M8RA 4KHYA 1HMVA 1NNDA 5DGAA 1WSGA 2X74A 1WSHA 1C1BB 4L8RB 1KVCA 1NHUA 3EY1A 3QZ7A 3ZSXA 4YMEA 4FJHA 3DLHA 3TANA 3OHBA 4EO6A 4ZP6A 3HP9A 2VG5B 3KTQA 4C8MA 5D3GA 3DRRB 3M8QB 1J5OB 5I3UA 3AA5X 3QIPA 3H5XA 2YNFB 2AGQA 3V6JA 4PQUA 2QKKA 3KLVA 1GOCA 3G6VA 3QO9B 1RT4A 2B5JB 4LQ3A 1S6QA 2HNDB 4LSNB 4BDZA 3HVWA 3AVJA 2O4GA 3RMDA 1JLQB 3LWMA 4QOZB 3SQ0A 3V1OA 4KHMA 4F2SA 3BQ1A 1IKXB 1BCMA 4Q44A 1D0EA 4B9SA 3M8PA 1HQEA 3KD1E 3IRXB 3FRZA 1ZETA 4RG8A 4PA1A 3TAQA 2ASLA 3F9KA 2E9ZA 4CF2A 3C95A 1CZBA 2VG5A 1TV6A 4KHWA 4H4OA 2IC3B 4J2DA 3OL8A 4O0JA 2WOMA 2FLPA 2YNIB 4NLTA 4KPYA 3NF7A 3QLHA 2F8EX 2R2TA 3FFIB 4M3RA 2UUWA 5C42A 3QIOA 3N6LA 4WXWA 3OHAA 4EYIB 4U7CA 4J9NA 3AA4A 1C0UA 4NLRA 1HMVB 2VG6B 5KFRA 3TVKA 3UDLA 4AH9A 1ASWA 2YNGA 4NLXA 1RILA 4J9KA 1T05B 4I2QA 3SPZA 4F4XA 1S1VB 1LWFB 3KLIA 3OYJA 3M8QA 2B6AB 5DG7A 3VQ9A 3QEXA 4CEZA 2E9RX 5F8JA 1ZBFA 3CDUA 1RTHB 1LV5A 2KZMA 1JLGB 4DF8A 4KRFA 4LSLA 3PW2A 3KLFA 3V6DA 4HTUA 4C8NA 1EP4B 5F9NA 2FVPA 4ED7A 2J6SA 3ICLA 3TWHA 4FZYA 1S0OA 4J9SA 3SUOA 5JXSA 1C1CA 1X9SA 3SV4A 4ZPCA 4BWJA 1L5UA 3LZIA 2D3UA 4FLXA 2IA6A 3O3GA 1HYZA 3AVFA 4DSKA 4NLGA 4IR9A 4DU3A 4AHTA 4QAGA 4DSIA 4LD0A 5DLGA 3MEEB 2XGPA 3JSMA 1WN7A 3PX4A 1XC9A 3KHLA 4IFVA 3PR5B 3I0SA 2JEFA 1KRPA 4E7HA 1Z26A 2HHTA 1NK6A 3HKWA 4B3OA 4CIGA 2F8SA 3L2QA 1K1QA 3HPHA 4I2QB 1NJXA 2HHXA 2XY8A 2Y1JA 1UAXA 2FVQA 1RTJA 3RB6A 2QKBA 3PW5A 4M3YA 3NAHA 2DFFA 4PWDB 3QERA 3KD5E 1KHVA 2AU0A 3H5UA 2HHWA 4CJWA 4J2EA 4MK8A 1S6PA 1TK5A 2CJQA 5KFVA 4HUFA 1BQNA 4DMNA 4DLEA 1HQEB 3DI6A 1RT3B 5CZ1A 5KG6A 3SQ4A 3BJYA 4LQ9A 4JS4A 4FJMA 3LP1A 4TQSA 3CIZA 4MIBA 3HVTA 3TAMA 5KFDA 3K2PA 1VSJA 2GV9A 4NLUA 4ZP8A 3AVLA 4Y3CA 1SUQB 3WNGA 5JS2A 2D0CA 3RR8A 3SNNA 3EYZA 1ZBUA 3LAMA 2VG7A 1GOAA 1S1TB 1HRHA 3CG7A 3HSTB 3DOKA 2P5GA 3KLEA 2HNYA 2XRIA 1S1UA 1NK5A 1SKSA 5KFSA 4ECTA 5F8HA 3C6UA 4IFVB 5J2NA 3UR0A 4GC6A 2WCXA 1TKXA 2JC1A 4B9MA 5EDWA 2XO7A 3QGGA 1XWLA 4BE2A 2XI3A 2F8TA 3PUFA 4G1QB 3N6MA 4ECUA 3NH2A 3E01A 2RPIA 4DTUA 1U47A 1S48A 3CYMA 2GIQA 3L3VA 3T1AA 1SH0A 3FDSA 3BREA 4M3XA 4TSXA 4NLYA 2RF2B 5KTQA 2B5JA 4CEFA 5KG2A 1NKEA 1S97A 3S3NA 3HL8A 3H5SA 3H4DA 3RAXA 4I2PB 3CO9A 1Q8IA 4ZPBA 3ALYA 5KFLA 2OZMA 4WE1A 2G8IA 4WZQA 3V9ZA 3IG1B 1BGXT 4FK2A 4F50A 3I5CA 2ZD1B 5HRSA 3G0ZA 2W42A 1HJRA 4E7JA 4OKJA 3IGVA 3PV8A 4F3TA 4AHSA 3BSNA 3VQQA 2KQ2A 2DFHA 4FBUA 5K14A 2JEGA 3DLBA 5KFPA 3RRHA 1S1TA 1EETA 4Q43A 2KW4A 2ZD1A 2IAJA 4CFBA 3DOKB 1U45A 2QV6A 1R0AA 4KFBA 4K8ZA 4CK3A 2G8HA 2BE2A 3HVRA 1T7PA 3MFIA 1ZYQA 3QIPB 1FKPB 1JLCA 2WTFA 3NE6A 4QWAA 3KKSA 5C25B 3HO1A 4CJUA 1C1AA 1EETB 4N41A 1IKVB 3V81A 3TI0A 3NAIA 1RT2A 5F8GA 1LWCA 3T5HA 3DLKA 3VQDA 5KG4A 2UVUA 1S6PB 3DDKA 1TL3A 3OYEA 1WSJA 4DL4A 3NF6A 1JLQA 4FM2A 1TVRA 4EP4A 4CJLA 1VSDA 4FJLA 4AHUA 1HNIA 1TL1B 4DS5A 4HUEA 4AHCA 3D28A 4OPJA 1EP4A 2J6TA 3CM6A 2OPRA 2VWKA 3K57A 3TR8A 3OVNA 3AVKA 4KHQA 4PQUB 4Z4FA 2FBYA 4RNNA 4DF4A 4FXDA 1NHVA 5EU7A 4FJXA 3DRRA 1J5OA 3KLHB 1OS5A 4QCLA 1S1XA 2HW3A 2W9BA 4FS2A 2WONA 1FXXA 4IG3A 2UVVA 1MU2A 4KHRA 3NF8A 3HK2A 1TKZA 2BR0A 1QSSA 5KFUA 3LP3A 3I0SB 2BRLA 3CDEA 3GIKA 4ECSA 1JLEA 1IKYA 1S9EA 3VQAA 3PX0A 3RTVA 3SQ1A 4DFPA 4NCAA 3AVMA 1VRUB 4FYDA 3PHEA 3KK2A 3L3UA 4ZPDA 3NKYA 4I2PA 1TV6B 3OS1A 2IDOA 1YT3A 2BQUA 5FDLB 1KVAA 1REVB 3KHRA 2X6SA 2IGIA 4BDYA 1TAQA 4ELTA 2KTQA 1KVBA 2D0AA 3NGYA 3MF5A 4R8UB 1RTIA 3KOAA 3SQ2A 5KFNA 2B6AA 4WFZA 3OYKA 4F4WA 3DLGA 1BHLA 3AO2A 4O55A 1IKYB 3MFHA 1NJZA 2HHSA 4E0DA 4CF0A 3SV3A 1RYSA 3M8SA 5T7BA 1RT5A 1HNVA 2VA2A 4O44A 4O3OA 2HAIA 3C6TA 3GV8B 3G6XA 1ASVA 4KFBB 3S3MA 4FLYA 5F8MA 5KG0A 4MFBB 2RDJA 3K5MA 2PYJA 3BDPA 4KB7A 4CJTA 4PY5A 2KFZA 2VWJA 4WZMA 3RBDA 3DRPA 2AQ4A 4IFYB 1JL2A 4CJ3A 3O3HA 4RU9A 2ETJA 5SWMA 1U48A 1I6JA 2W7OA 1U09A 4O3NA 3LZJA 4ECWA 3T19A 4EEYA 3P83D 2GUIA 3OLBA 1N5YB 1BQNB 3RR7A 2AWZA 2V9WA 4ZVHA 3OL6A 3MXJA 3DRPB 1IKWA 4QW8A 4KB1A 1VSFA 1BCOA 1RDBA 4K50A 3T3FA 1N4LA 3AVHA 1LWEB 1JXEA 4BACA 2HVHA 1ASUA 3L2WA 1ZBHA 4FLVA 1S1WB 3U6FA 2O5DA 5F8LA 4CCHA 1SV5A 1RDCA 2X6NA 3BR9A 4U6PA 1YVUA 2OPPA 1IKWB 3WNHA 1XR7A 4FM0A 2AX0A 1D5AA 4CFAA 1QE1B 2FLNA 3C6TB 4DL6A 4FS1A 4Z4EA 2FVSA 4FJ8A 3MR6A 1TKTB 5KG7A 4KO0A 5KFBA 2C28A 3SCXA 3OYNA 3I5BA 2W7PA 3PJXA 4CJEA 3E01B 3NH0A 4J9MA 3AVIA 5CY4A 2OPSB 3CJ0A 1JLBA 3SPYA 1TKTA 1UOCA 5KFKA 4M3ZA 4ED0A 4M3WA 2R8JA 3DM2B 1KLMB 1RTDA 4KI6A 2V4QA 2FBXA 4Y1CA 3M8PB 3ITHB 5J2PB 4E1MA 4RW9A 4ED2A 1TKXB 4E1NA 3GIJA 2PYLA 3P5JA 4BE0A 3U3YA 2X78A 4KAIA 1T94A 5KFTA 1RBVA 4URSA 1NK8A 1D9DA 1FK9B 5J2QB 1C0MA 3G10A 2AGOA 2OPRB 4DTRA 4FJGA 4G3IA 5DLFA 3B6OA 4DSEA 1VSHA 3D5MA 2CKWA 3MEGB 4O44B 1N6QA 3NFAA 5DG9A 3ASMA 4IDKA 4LH5A 4ECZA 4BWMA 1JX4A 4DQIA 2PY5A 2C2RA 2UVWA 1SKWA 4M94A 3ZSYA 3NGIA 1FK9A 2W9BB 4RW6B 3UIQA 4O5BA 4I9QA 1KSPA 4RZRA 3ZSVA 4FLWA 1KCFA 2YKNB 3HXMA 3JYTA 4H54A 1C1BA 3DLRA 4ZPAA 1X1PA 4R0EA 1S0NA 2Z1GA 3I8DA 3AA3A 3HP6A 3OYDA 4MIAA 3IG1A 2G8FA 1RBSA 1TL3B 2KZZA 2YNFA 1KFDA 3MEGA 3CFRA 2BGGA 3AO3A 3E51A 4YR3A 4Q8FA 3V1RA 3OS0A 3BGRA 4K4UA 2HNDA 1KLMA 4LSNA 3T5KA 1LWEA 1U49A 4FJ9A 4ZP7A 2R2RA 4K4TA 4OKEA 3SUNA 3F73A 3PW4A 3ITHA 5K14B 4DQPA 4NLSA 3QEIA 3RMAA 4B9VA 1UWBB 1W9HA 1C0TA 5KG3A 3BGRB 3V9XA 3SFUA 4RW7A 4J9QA 2HHQA 4QPXA 4R5PB 4NRUA 2QE5A 3RMCA 3ZT1A 4Y1DA 4Z4CA 4I9LA 3KLGB 1XHZA 1W0HA 2P51A 4Z4GA 1MU2B 1HNVB 4CIFA 2F96A 3N6NA 4DTSA 3DLKB 1J9AA 4CEOA 4IRDA 4Q0BA 1SH3A 4KB0A 4W5NA 4DFMA 1EXQA 4FVMA 3T5JA 3KMSA 3DRSB 3M9NB 4XO0A 3V9SA 1Q9XA 3PY8A 4ZVEA 4ID1A 5HP1B 2FJXA 4PWDA 1SL2A 4KI4A 2B4JA 4DS4A 3V4IB 3G86A 5FDLA 2ILYA 4FBTA 3V9UA 5KFOA 3CQ8A 4KBIA 4URGA 2ALZA 3S9HA 5HROB 4WFYA 4DU4A 2RDIA 3RWUA 1DTQB 4WE1B 2G8VA 1QQCA 5KFXA 1ZBIA 1DTTB 5KG1A 2HVIA 4Z0UA 3VQ4A 5KFQA 4ID5A 3Q8RB 4DFJA 4YR0A 1NKBA 4DTPA 1RT4B 2R8GA 3ZSRA 3DLEA 4O4GA 1L3SA 2HB5A 3CM5A 3CJ2A 1A5VA 3S3OA 3AO5A 1RT1A 5DGBA 1REVA 4B08A 3OYCA 1DTTA 4ZTFA 5KFGA 2R2UA 3ULDA 4OLAA 2D3ZA 2XY5A 3VQ7A 2OYQA 4J9PA 4OJRA 3PW0A 1JXLA 2W8LA 1YVFA 4G1QA 2E9TA 2Q3SA 3H98A 5HRRA 3QLHB 1MMLA 3D45A 5FRNA 1SUQA 1QS4A 2XHBA 3RRGA 5KFYA 4ED1A 3HPGA 4AILC 2VG7B 1D9FA 3GILA 4B9UA 3WNFA 2YNHB 2XC9A 3VQBA 2W9AA 4DSJA 2HNYB 1RT3A 3OYHA 4FK0A 4HKQA 3QZ8A 4C8LA 3KLIB 4MFBA 4Y2CA 4NCGB 4QWCA 5J2MA 3HM9A 5KT4A 4DL5A 1X9MA 1QUVA 4FZZA 2YNHA 4ECXA 4LH4A 4DWIA 2R8IA 3NH1A 3OSNA 3VQ8A 4IFYA 4OL8A 4I7FA 3CFPA 1TGOA 1RDDA 4IG0B 1NK9A 3B6PA 2XGQA 4O4RA 1RT7A 4CJ5A 2W9CB 5I3UB 3G6YA 2R8HA 5D3GB 1C6VA 4FLUA 3QIDA 4IRCA 5KG5A 4CK1A 1C0UB 2FJWA 3MR2A 2BQ3A 3FSIA 3O4QA 3LPTA 2E6MA 4CESA 1WSEA 3AO4A 1RT7B 1S1VA 3MR5A 1O1WA 1GOBA 3DOLA 4ZP9A 4B8AB 5HRPA 4JS5A 1YTUA 4IG0A 4KHNA 1R0AB 4ED3A 4FZXC 3GV7B 3EPGA 4KTZA 1RTJB 4KE5A 3WNEA 1X9WA 4KO0B 3CWJA 3KLFB 4FJ5A 1VSLA 5SZTA 4NCBA 1RBUA 3P1GA 4H8KA 4ELVA 4W5OA 4IG3B 5DQIA 4CEEA 3AVCA 4JV2A 3RB0A 1KFSA 2AJQA 4K4WA 4RW8A 5KFMA 2IOCA 4J2BA 4EBCA 4F4YA 4ZMMA 2HHUA 1LW0B 3IS9B 5KGXA 4DFKA 4RNOA 3QNNA 1GX5A 3LDSA 4CEAA 4QWDA 3LALA 1Z4UA 3HPOA 3C94A 2XY6A 4KV8B 1RT6B 3EPIA 4RW8B 5HP1A 4DLGA 4K4ZA 4C8OA 4TY8A 1LW0A 3IS9A 2ATQA 4CFCA 4URQU 1N6QB 3MTKA 2YNIA 1I39A 3V6HA 1CSJA 3PR4A 2Z1JA 1CXUA 2ATLA 1VSEA 4O0IA 4WFXA 3VQSA 1DTQA 3OYLA 3ZCMA 3OY9A 3TABA 1JLAA 1QSLA 4ZHRB 2J6UA 4J9LA 1RTDB 3BQ0A 5F8IA 3LAKA 1RT5B 4CF8A 3ZT0A 1JKHB 1HYSB 4Q5VA 1B9FA 3H59A 1ZBLA 5DMRA 2RKIB 4CK2A 3PJWA 4TQRA 4M95A 2JEIA 1S1XB 3HVTB 1TK8A 4TY8B 1RT1B 2EX3A 4RW4A 2G8UA 3OJUA 2UVRA 1TKZB 3Q8SB 2FC0A 4DTOA 1NK0A 5FRMA 1VK0A 3V1QA 2NUBA 4J9RA 5J1EA 4QWEA 4E7LA 3KLGA 4W5TA 1S49A 2ASDA 3UQSA 3QETA 1BISA 3FQKA 3AO1A 3VQPA 3DYAA 4IR1A 3OYMA 4KKOB 3SYZA 3MXMA 3ZSOA 1T03A 3GIMA 3FFIA 3NDKA 2G8KA 5DQHA 3OLAA 2IBKA 3PO4A 3D0PA 5J1EB 1RDRA 4CJSA 4CJKA 4LY7A 4NLWA 3Q8QB 4ECYA 2Z1IA 3MAQA 4FJNA 1W25A 2HNZA 1VSKA 3OSPA 1WNEA 4OVLA 2V0NA 4FLTA 2C2DA 2R8KA 4FM1A 4CF1A 2BDPA 3LANA 4E7IA 4DTXA 2YKMA 5KFHA 2R2SA 4GMJB 1NOZA 5KFWA 3O4NA 3RB4A 2BRKA 1WAFA 3C6UB 4TXSA 4HHTA 4RNMA 3IAYA 1B92A 3V6DB 3IN5A 3L2UA 4CERA 2WHOA 4K4SA 4M42A 5C5JA 1C1CB 5F8NA 1RA7A 1CZ9A 3O3FA 4CGDA 3KNAA 2I5JA 1JLFA 4Y2AA 5KFFA 2ZE2A 3QYYA 4IQXA 1LW2B 4ID5B 1NKCA 4RW9B 3H2LA 5HRNA 4RNHA 1TKDA 3CJ4A 4PUOA 4CGHA 4Z4IA 2FBVA 2WB4A 1CXQA 2HMIB 4DL2A 2A1SA 1L3TA 3HJFA 3GIIA 1HYVA 1JLFB 1ZTWA 5J2MB 4DTNA 3K5NA 3PZPA 1NJYA 2E4LA 1Z25A 4H4MA 5FROA 5KRTA 4IDKB 4K4XA 5HROA 1RCHA 3ZSWA 2A1RA 4OLBA 1RBTA 1BIZA 3SUPA 1VSIA 3NL0A 1B9DA 3NMAA 2D7SA 2YKMB 4NYFA 3I5AA 1JL1A 3DM2A 1WAJA 4Z4HA 5E41A 3IRXA 1K1SA 4CHPA 4UQGA 4DG1B 4JLHA 1F21A 1C2PA 4FLZA 5CZ2A 4Q0BB 1XI1A 5J2PA 2FVRA 2IC3A 3LP0B 3DLGB 1TAUA 3HT3A 1L3VA 1S9GA 4TYBA 1HARA 3SI8A 4YFUA 1Q9YA 5KFCA 5L1JA 4JUZA 1JXBA 1RNHA 1WLJA 3ISND 3M9OB 4KSEB 1TVRB 4IH6A 4XPEA 2YHBA 1S9EB 3K5OA 4EBEA 4M41A 3KK1A 3CJ5A 4CGGA 4NLDA 1BIUA 3NCIA 3CJ3A 4CHZA 2HWIA 2Z1HA 4E7KA 2BANA 4CJ4A 2I1RA 1XHXA 4CGJA 4CIEA 3SJJA 2PZSA 4TLRA 4J2AA 2DPIA 2FLLA 4CJPA 1QAIA 2BE2B 3NBPA 3SI6A 3L8BA 3MEEA 4XIUA 1T8EA 1BQMA 4R8UA 1NK4A 3L2VA 4KREA 4HCBA 5C24B 2RF2A 4DEZA 4DG1A 1TK0A 4CHYA 1SL0A 4MKAA 3KJVA 4Q8EA 3NGZA 4ECRA 3OYIA 4KAZA 1JIHA 1UWBA 1BL3A 1KTQA 4MKBA 4R5PA 1QE1A 5L1IA 3IGNA 4ZVGA 4PUOB 1RAJA 1HPZB 4HYKA 3OYGA 4OGEA 5EUHA 3DYAB 2IM0A 4KHUA 2WRMA 3NAEA 2QK9A 1HQUB 4F2RA 5KFAA 5T14A 2W8KA 3AVGA 3H08A 4M3UA 4DU1A 1BI4B 1N5YA 3GYNA 2QXFA 5CYQB 2OPQA 4CEDA 4NCGA 2HNZB 1I3AA 1WSIA 1IG9A 2D0BA 3BSCA 2XCPA 3RBEA 3QEPA 4FJJA 3TAFA 4NYZA 3PO5A 1DLOB 3V81B 3QINA 3U3GA 3LPUA 4IKAA 1IH7A 3DI6B 4KV8A 4ZVFA 1RYRA 1BI4A 4DQQA 4IKFA 1SV5B 1NK7A 4DSLA 1NOYA
chains in the Genus database with same CATH superfamily
4LRDA 3DMJB 3LP2B 4ZHRA 2G2YA 2PD1A 3UCUP 4R0JA 2GZOA 4BGBA 1WD6A 4CEQA 1S6OA 2W9CA 4F02A 1J53A 1FNXH 1S5JA 1JKHA 3KK3A 3EMTA 3THVA 3BSOA 3DJCA 1W2BM 4OHVA 4USMA 4M7YA 2E5JA 4RUAA 2I0XA 4GMKA 7AT1B 2A10A 4C0OC 1Q7LB 4NWBA 3V6KA 5AQIA 4NEYA 5GAEI 3TUPA 1MROA 4K2XA 1BU6O 3JYTB 4JI1K 2W2PP 2ILZA 1RT6A 4TYAA 2GO8A 4CJQA 5E7OB 5AQUA 4GVEA 3GV5B 3ZZ0A 4KGVB 2M9KA 1U02A 2HVEA 2D9OA 5HLFA 2OA8A 1UFLA 3VN5A 5DQGA 2VQFF 1E3MA 4L73A 1IKXA 3BEXA 4FWPA 3O9RA 3KHGA 1QVFR 2M8HA 5KFJA 1ZM4A 2UZAA 2DCUB 3ZFVA 3CDAA 1SKRA 2WBNA 3HI0A 2VKRA 2KFNA 1ATRA 2XWYA 3SAFA 3H8YA 5LXRA 5HN0A 1RTIB 4HDHA 4RW4B 2ZC3A 4HCCA 1HW8A 1YJ9S 4TU7A 2FTRA 2K2PA 3D0GE 2IAJB 5JS1A 4RJVA 2PAVA 1VRTA 3CVKA 1N88A 4Q45A 4B3RF 4AHRA 3CPWR 3IXQA 3NRBA 4WWSA 2VICA 2WBRA 3VZHA 2LMIA 1VIXA 2EHGA 4NLPA 3POTA 2XYGB 3BBCA 1YITN 3RB3A 2DPJA 3A5OC 3E9OA 5I42A 4JKBA 5M1OA 4OYPA 3R3TA 3KLHA 3NF9A 1E4FT 2R7TA 1VC6A 5IZHA 4JKCA 2IJNA 2OTJS 4PG7A 3FGVA 5A2QU 3M8ZA 3J81O 4YNQA 3RMBA 1BQMB 4LFAF 3ZETB 3A1YG 2F7VA 5MLCQ 2OPSA 2RN2A 4ANDA 2FBTA 2HFSA 1JLEB 4H4MB 1X4FA 2UXDJ 3TAPA 4YOWA 1RAAB 3VAMA 2PEHA 5D4PA 4QS7A 2MKHA 3N5BA 1OIAA 2QN6B 3H6EA 2CJAA 1RACB 1XR5A 4DV3J 2CPJA 2RD5C 1WUAA 1U2VB 3HYFA 1VYAA 2ITGA 2YPYA 3SFGA 3SEOA 5JMNA 1TL7A 4TY9A 3SSQA 3QEVA 2OKQA 1LW2A 3Q7CA 3HFZB 1F6TA 2NUUG 2UUBK 1WELA 2HIQA 4DTMA 4P2SA 3D66A 1CJUB 3BB5A 2ZBQA 4F7VA 1VIOA 4Z37A 1Y5NB 4ILJA 2J7WA 2XY7A 3CGIA 1YBTA 4GNIA 1TYQA 5C24A 1FNMA 4BBYA 2UUAK 4JI6K 2QLFB 2P6TA 4OX9J 4GC7A 1G15A 3CFOA 2F9JA 4P75A 3UDVA 3VQEA 1RB0A 2FSNA 6FD1A 1QD1A 1YJ9N 2DRDA 2RHQB 2Y8YA 5LMNK 2MHEA 4FKXA 2GGPA 2XO6A 1R0BG 4ECQA 5EWFA 2DR6A 4DV5J 3PG9A 4MK7A 4LSZB 1T02A 4CHOA 1ZM3A 4DR2K 4YQWA 4CO3A 4DQRA 1PKUA 4OIXA 1RU2A 4EO8A 3PRBA 2CDQA 1VQKS 5AQOA 2ZVIA 4UF4A 4IH7A 4WFBQ 3PRVA 5L9XA 2DNRA 4QIGA 5A0YA 4CGFA 1K6YA 4JK7A 4M5MA 4H4OB 2ZH1A 3KIOA 2ZH5A 1YRUA 4BY9C 3I0RB 3CJQA 2DFEA 4QW9A 1WEZA 4NRTA 2HRUA 5E33A 2LKZA 1RHRB 3LP2A 4NLOA 1U1PA 5H9EK 3NNCA 3P31A 1SL1A 4CJVA 3GE9A 4JN4A 2E44A 4FZVA 2BEFA 4LREA 3I0RA 5AJ3J 3AV9A 3MM9B 3ISNC 2OFHX 4AYBD 3ZT3A 3OL9A 2CQ0A 2EKYA 4A8FA 1RBRA 2V2KA 5AXMA 3M32B 2LCWA 2K7JA 1YZ6A 3DDNA 1RA6A 4M45A 1QAJA 2PFUA 2HF4A 4RNFA 5EWGA 1AZSB 2LXIA 1Z2ZA 2ZVSA 2BANB 4ZTJA 2E6LA 4M3TA 1U4BA 1HKAA 1OVYA 5HQLA 4ZK7M 1HQUA 3NOGA 3MWPA 3SMSA 2LQ8A 2QSFA 2P5OA 1XNRK 3M8RA 2B9XA 4KHYA 1HMVA 1NG9A 3OQ2A 3K0JA 4YOYA 1RAHB 3QNWB 5DDQC 1NUEA 3EY1A 3H2VE 3DLHA 2ZJPQ 5E3PA 5FJ4A 4C8MA 1J5OB 3M8QB 1U1QA 3KKFA 4UOCA 5ADZA 4DZ6A 3VOVA 4CH0S 3V6JA 3O3LA 3KLVA 1GOCA 3G6VA 3MUTP 2UV8A 4F0KA 1S6QA 4LSNB 3CMQA 3HVWA 4B3SK 3V4MA 3LWMA 1FJ7A 2P9UB 4F2SA 3R8YA 3NCPA 3LH2S 4QYZK 4OYXA 5F3ZA 3SSRA 2A6MA 3IRXB 3N28A 3CF5L 3ZO7A 1ZETA 2HLTA 4PA1A 3F9KA 2E9ZA 4CF2A 2VG5A 3HT0A 2DYAA 1GLLO 4H4OA 5AJ3K 4J2DA 3FLCO 4O0JA 2WOMA 2FLPA 4CO1A 2DGOA 4NLTA 4ZVTB 1HKBA 4Y28C 5KAKA 2R2TA 4M3RA 1LKZA 1H2VZ 2UUWA 3QIOA 3VAIA 3N6LA 4WKYA 4EYIB 4U7CA 5TKWA 3AA4A 1NGDA 2XMWA 3OW2R 2KM8B 5KFRA 3TVKA 1ASWA 1NMNA 3VERA 4I2QA 2A5XA 1BQXA 2M4MA 3EE8A 3KLIA 3DLLQ 1WB9A 2B6AB 4WF9Q 1FRIA 5F8JA 1ZBFA 5F1XA 4H0VB 9RUBA 2IVYA 3HI9A 3ZZRA 3MN7A 2QLBB 1ZM9A 2KZMA 2A40A 3QMLA 1HR0K 3PW2A 2YHXA 3NOCA 2ZOFA 4DR2J 2FXUA 3KLFA 3V6DA 4OYZA 2J6SA 2FVPA 3ICLA 1X4GA 3TWHA 2KLAA 1S0OA 2ZH9A 2F9WA 4MKVA 4UOHA 4DV6F 1X9SA 1RHMB 3SV4A 4NXNF 4LF4F 2QLWA 4KHPF 5LMNJ 2DXEA 2D3UA 4FLXA 2QL9B 4ZCKA 2W1BA 2IY5B 3O3GA 4D3GA 1HYZA 1H7XA 4DSKA 3AVFA 4IR9A 3W64A 4K42A 2P9GA 3QBWA 2Q3PA 1UEUA 4U7UD 4M5LA 4JI6J 4IFVA 2UUAJ 2HHTA 1Z26A 4NXMF 4DR6J 3ZTPA 3NVKA 1OQ6A 3HPHA 2BKNA 2KH9A 2ZBCA 3KK7A 3TTDA 2Y1JA 2YY3A 2DIVA 1VQPS 2FVQA 1RTJA 2UUBJ 1K8AO 1WC5A 3I33A 3RB6A 4M3YA 2YHWA 3QERA 2AU0A 2CPFA 1HNZJ 4B1WB 1QZ5A 3CCMN 4JYAJ 4DV3K 4FJMA 4YB6A 3EJMA 2CPHA 2QWLA 3UN3A 4MIBA 3CSKA 1FE0A 2GMJA 1FWPA 4Z94A 4JI7F 1WOSA 4YHHF 1F60B 3AGRA 4ZP8A 1VISA 1BO5O 3CUNA 2C3YA 2D0CA 2UXDK 4JEPA 3L7OA 1JK9B 2GVZA 2DEIA 2KO1A 1GOAA 4FDFA 1HRHA 1GLEG 4ZVPB 2P5GA 4EI2A 3WUHA 2M52A 2HNYA 1FI4A 3GZ7A 2FDNA 4DI6A 5J2NA 4GC6A 2O3DA 2JC1A 4B9MA 3KUHA 5EDWA 3RZAA 4N8NA 3QGGA 1XWLA 2F8TA 2XG8A 1M0SA 2PO4A 3IKMA 1R31A 4JI0J 2RPIA 3L3VA 4DR5J 1SH0A 4JI5F 3BREA 2WC9A 3U7JA 5KTQA 2B5JA 4CEFA 5KG2A 3HL8A 3H5SA 1T9WA 4M63C 1Q8IA 3CD6N 3DAWA 4FVUA 5KFLA 2OZMA 4ZS6A 3DLJA 3V9ZA 3IG1B 4QS8A 1RHQB 3KFWX 2G2OA 2GO9A 4F50A 2XSJA 1HJRA 4E7JA 2HOEA 4AD6A 3IFEA 1WSRA 4JKGB 2QSWA 2DR9A 5DM6L 2JEGA 5KFPA 2NUHA 1GQEA 1FWKA 4DQ8A 4Q43A 1SS6A 2KW4A 3W62A 3RU0A 3AD8C 4KFBA 5BYRA 4K8ZA 2JOQA 3WZ0A 3WXJA 4PKIA 1V9OA 3MFIA 2F9TA 1H2UX 2XNQA 1FKPB 3M6VA 3Q23A 4HTIA 3HO1A 3JSYA 1G3OA 5LSLA 3C19A 3TI0A 3NAIA 1FRMA 1XQIA 2GGPB 3T5HA 3DLKA 5DJBA 5B0CA 2QYCA 3JTNA 2C1EB 3M1FA 2QG9B 4FJLA 1FKAF 2EK6A 2XMUA 2G9OA 1YGYA 3W2WB 3D6HB 2OPRA 1RGVA 3EGNA 3SMZA 4CRJA 2FBYA 2MLYA 1F5BA 3IMQJ 4QCLA 1S1XA 4C3LA 3MM8B 5C12A 3VCDA 2YQ1A 4E2FB 2UVVA 1MU2A 1VLOA 1QSSA 3A8YA 1SZ2A 5E84A 2KJWA 1AFJA 3HHDA 4ANEA 5KOXA 3PX0A 4CBWA 3RTVA 1QHAA 4NCAA 1VRUB 4Y65A 2MKYA 4JKAA 3BKFA 4CLUA 2Z8QA 1BUPA 2DT9A 4ZPDA 4I2PA 3OS1A 3N01A 2VPYB 3OBIA 2HK2A 1Y3JA 3LO3A 3GB0A 3JTOA 3J7A1 1REVB 3KHRA 1TAQA 2OELA 2D0AA 3T1YJ 3GSIA 1ZC6A 1L3KA 3A8KA 4R8UB 3SQ2A 3QJPA 1NB7A 3OYKA 1N34F 3AO2A 3FZ2A 1IKYB 1DURA 4QJVA 2QT7A 3PFEA 3HHLB 1YKWA 4OO1J 2DY9A 4X66K 3C6TA 2K1RA 1OJ4A 3A8JA 4FLYA 2B9YA 2MJNA 1DQ8A 2B51A 1JNRB 2RDJA 4B3MK 4CLYA 3HZEA 3K5MA 3BDPA 2PYJA 3C16A 3NS5A 1M5PC 2VWJA 4WZMA 2AQ4A 4CJ3A 1BY9A 1XMQF 5SWMA 2W7OA 2H51B 4CYUA 2GUIA 4OI6A 1BQNB 5G4DA 3HKZD 4ZVHA 1HWIA 4QW8A 2HFZA 1FJGK 2NPFA 3K8VA 3B54A 1BCOA 3OFGA 4BACA 2HVHA 3L7PA 1S1WB 2O5DA 2MSSA 1NXIA 3H3OB 4U6PA 2PBDA 2NRTA 1TL5A 1LFWA 1YVUA 3WNHA 1SKUB 3HSCA 1S76D 1FJEB 4CFAA 2A3JA 4DPTA 4CZCA 1MA9B 4KYZA 1KVJA 2VCPA 2C28A 1PBAA 3I5BA 3FJ2A 3TWZA 4F4AA 4F67A 3NH0A 1R0CB 5C7PA 5CY4A 2OPSB 3CJ0A 5CCMA 3J7AN 3E1YA 4R25A 4M3ZA 1AUSL 2CH6A 2R8JA 3X3UA 2JFDA 3CJAA 5LJ3Y 1RTDA 4KI6A 3ISZA 4AFFA 3PLAA 4HH0A 2J0WA 2GJIA 2HS0A 5J2PB 4E1MA 4RW9A 4ED2A 3DLLL 1DJ0A 3P5JA 2D3O1 3MCAB 3U3YA 4AQYJ 4KAIA 2XTJP 2AIRB 1T94A 4J5OA 4BR5A 1FK9B 2HVZA 4RCHA 3VGTA 4FJGA 4BQLA 3R2DJ 4DSEA 2HYIB 3Q89A 5B0DA 3W5XA 3GR0A 3CJ7A 2WSEC 1GLDG 2M5YA 1P9YA 1N6QA 3NFAA 5DG9A 7FDRA 3AGKA 2XMKA 1JX4A 1KNZA 1KONA 3NGIA 1FK9A 4I9QA 1J5EK 1H1VA 1KCFA 2M2BA 2XYHB 2Y1LB 2EFGA 3JYTA 4L75A 4ZPAA 1X1PA 1X5TA 2GVDB 4HHHA 4ID8A 4RX6A 1RBSA 1E6YA 3FKBA 3QQCD 5BN9A 4NLCA 2KZZA 5LSOA 1KFDA 1V3SA 3M2RA 2GHWA 4KY3A 4Q8FA 2WVEA 3BGRA 3D0IE 2HQIA 1U6FA 4LSNA 1KLMA 1RHUB 4FJ9A 4K4TA 1UJ6A 3F73A 4DQPA 4HLBA 4I1TA 2YWFA 1RUSA 4ZPWR 3T7ZA 3D1QA 3RMAA 1UWBB 4FPIA 3BGRB 2HFNA 2FHMA 4NI2A 1UVIA 3J81Y 4QPXA 4OYBA 4R5PB 3IC1A 2VL1A 2DCLA 2VFUA 3ILLA 1TYQB 3QDKA 1RBOB 4CIFA 2IDLA 2F96A 2CG8A 4CD1A 4DTSA 1DARA 4CEOA 1J9AA 1YVNA 1Q7YT 3BYPA 1SH3A 2C2ZB 2YBVA 4DFMA 1E6VA 4FVMA 4X65F 1CEZA 5D8HB 2HSTA 3VPZA 2NXNA 3V9SA 1WDTA 3L9ZA 2HQGA 3DGPB 3SIPB 3VGVA 3B4MA 5HP1B 4RUHA 4FVCA 2RVJA 1SL2A 1WC6A 4KI4A 4BRKA 3BDEA 3G86A 3JTPA 3CCEN 3OTOJ 3NLCA 4KBIA 4URGA 1JNZB 1Q18A 2GV1A 4X4TA 2LA4A 4USWA 2WSCC 5LT5A 2D0OA 1WG4A 2G8VA 5HQ8A 1ZBIA 4DR2F 1A9NB 1YSJA 3CCSS 5KFQA 3VQ4A 4ID5A 5B0EA 1DY3A 5D77A 3JQMA 3CJ1A 2R8GA 2KT3A 4DV6J 3DXMA 5LMNF 4DV4J 4KH5A 1REVA 4B08A 3VEZA 2CPYA 4CH1A 1PILA 1QZ6A 3ULDA 2D3ZA 2AEMA 2O8CA 4DV7J 4J9PA 1JXLA 2W8LA 3TTCA 1VQ9S 4G1QA 4ATNA 1B64A 2Q3SA 1TL7B 4NEZA 4DPXA 2E7WA 1OY9A 5LJ5Y 3UKUA 3T6BA 3D45A 4PABA 3FRYA 5KFYA 4PKDB 4ZLPA 3B8AX 2VG7B 3LA0A 5F3TA 4B9UA 1YAGA 3R1HA 2YNHB 3VQBA 3L3CA 1CG2A 2I9SA 5IM0A 1RT3A 5BYSA 3OYHA 1U0HA 4HKQA 2AYEA 2GCFA 2KRRA 1JCGA 2HBLA 1KC8O 4NCGB 4QWCA 3KUGA 1QUVA 1N36K 2ZUGA 3UCGA 3L6QA 4K0KK 4YHHJ 2PIIA 2R8IA 2W01A 3FZKA 4PHTX 2MTLA 3G6EN 1TGOA 3J8AA 2Y1RI 4MIWA 4HTJA 3B6PA 2XGQA 5I3UB 2R8HA 3IR5B 3R97A 2AMCB 3JB9k 4IRCA 2MZ1A 4BG9A 3CJRA 3MEKA 2BJ1A 3FSIA 1IXKA 3JSBA 1F1BB 3Q2TC 2VHGA 3AO4A 4JI0F 1VJQA 3GYXB 3HJVA 1RABB 3OUYB 2HGLA 2H9ZA 5GAGP 3WC2A 1YTUA 3UR3C 3GV7B 1Y64A 4KTZA 3MPUB 3IDHA 3WNEA 3O44A 1X9WA 5G0RB 3CWJA 3KLFB 2ACYA 3PIOQ 5D0GA 1IBMJ 3P1GA 2P9SA 4IG3B 1KQFB 4CEEA 3LM9A 2L9WA 1KFSA 2Q66A 1O5JA 4K4WA 2MKCA 5KFMA 2IOCA 1HPMA 8ATCB 1KS2A 5LXYA 1ROFA 4ZMMA 1GX5A 3FZHA 2PC6A 3LDSA 2QFJA 4CEAA 4R79A 5D15A 3LALA 3LDOA 1RISA 3HPOA 2XY6A 5AQHA 1VC0A 1RT6B 3ENAA 2NPIA 4DLGA 4JV5K 4LR7A 5ETSA 4C8OA 3LOUA 2RDDA 4TY8A 1FWLA 4ER8A 4CFCA 2OP5A 4URQU 3CD0A 3MTKA 1LK7A 4DR1J 2YNIA 2XMMA 4LR8A 3FZFA 3CF5Q 3PR4A 1CXUA 3H0PA 2MXYA 3LTOA 2GS8A 1GLFO 4O0IA 1DTQA 3O9UA 2QMXA 3ZCMA 3OY9A 3QT5A 1P1LA 3TABA 1JLAA 3GSDA 1QSLA 2C3UA 2ASPA 1U6ZA 2DKOB 3OFHA 3M2RB 1FHTA 1ZBLA 2HS4A 1URNA 2OTLN 4TQRA 4M95A 1TK8A 4BC2A 2EX3A 3TUJC 4JI5K 5AFUH 2DVIA 3SXLA 3A0IX 1NK0A 3V1QA 4C11A 4NX9A 2DNOA 2DEJA 1FJCA 1D09B 4FWOA 1QJHA 4J9RA 3ZTRA 3KLGA 4W5TA 2M3DA 2ASDA 4BRPA 4W98A 2KU7A 1BISA 3QETA 2A2CA 4X4RA 3AO1A 1E4GT 3DYAA 1GTEA 5EN1A 4FF3A 3ZSOA 2DIUA 1VBZA 1VC5A 4DUZK 4JV5F 1QQNA 3OLAA 2IBKA 3ZNUA 1ZM2A 1RWMB 1RDRA 4M5NA 3DGPA 4NOHA 3MR7A 3RGIA 3HX9A 1WNEA 4RTFD 4A2AA 2V0NA 4M63A 2C2DA 5DO2A 2FZCB 2RAQA 3I9V9 3WDOA 1UFKA 2R2SA 4RU2A 2K06A 5KFWA 3O4NA 2EFOA 3RB4A 2ZNYA 1MWYA 3C6UB 5L8RC 3WQTA 4I68A 1NGCA 1O8BA 3CJSA 3V6DB 1B3TA 4X4OA 2XB2D 4C8ZA 2G0IA 2K7KA 2F4VF 4K4SA 2ZGYA 3TA0A 5C5JA 3DN9A 3KG0A 2Z58B 1HBUA 3BY5A 2KVQE 3DXMB 2DNPA 4CGDA 4DV2F 2I5JA 1F2HA 1RBLA 4Y2AA 5KFFA 2ZE2A 3QYYA 4J90A 1DEJA 1LW2B 2RIJA 3H42A 3EGWB 4C0BA 2QWRA 3PKMA 1MN9A 3BS9A 4PUOA 2V51B 4Z4IA 1U2CA 2WB4A 2HMIB 2A1SA 3HJFA 4RR5A 4ZOSA 1SVDA 1HYVA 5FLXO 1N8RT 4AUKA 4DTNA 1YBAA 3K5NA 4DPUA 5ETQA 1Z25A 5FROA 1BWVA 4K4XA 1WTBA 3CD5A 4B3MF 1RCHA 1BWEA 3ZSWA 2E7VA 1CJTA 3D9BA 3T9NA 2D7SA 1IBLJ 4HT7A 1JL1A 1WAJA 4ILGB 3IRXA 4KH4A 4UQGA 4DG1B 2N7CA 4FLZA 5CZ2A 3J7YP 4LF7K 2DNLA 5ETTA 3EXCX 2DNQA 3RRKA 3SBGA 5M1NA 1HARA 2POKA 3U1LA 3RUBL 1FXLA 2PT0A 5MAOA 5MLCV 3HTVA 1GXTA 5FPNA 5KFCA 1N0UA 2F63A 1RNHA 2YQ3A 3ISND 3ZLJA 1M1KO 2CJYB 2OSQA 2G0JA 3S1TA 3J7ZT 4KSEB 4GKKJ 5BXIA 4IH6A 1YUWA 5BRDA 2YHBA 4ZN3A 3ID6A 2C3MA 2OAUA 4EBEA 4M41A 3KK1A 3GFHA 3CJ5A 3W2WA 1EO1A 3ZZUA 1CS4B 3CJ3A 2J5AA 3PSIA 1SJRA 4NE9C 3KWMA 4CJ4A 1YI2N 4CBXA 2Y8WA 2I1RA 1XNQF 3PEJA 4AQYF 4CGJA 3SJJA 5T41A 4TLRA 2GQ2A 1QAIA 2VBXA 4F36A 2HGMA 2JWNA 2J0XA 1YRXA 3IM9A 2YX6A 4XIUA 4Y00A 1T8EA 1T9VA 1BQMA 3JS6A 4R8UA 2HF3A 1P6TA 4HVZA 4KREA 3ULEB 4DR3F 3E2EA 1I5OB 1V4SA 1WJ9A 1R8CA 3ID8A 1S3XA 3AAQA 4DR7J 2D3OR 2J76E 3NGZA 4ECRA 3O9SA 4BC5A 2V63A 3SCLE 4QQBA 1S7HA 3BO3A 1KTQA 1N8RO 4BRAA 5GINA 3D3BJ 5L1IA 4ZVGA 2D1KA 5M1PA 1QVGR 3EUNA 3VETA 3HD2A 4WKRA 3TSQA 2RE2A 1ZZFA 2IM0A 1FX4A 1U7LA 4KGXB 3NAEA 1HQUB 1Y9OA 4U8VA 3KG4A 3VVUA 5ADXH 3M1VA 4IFEA 2V4JB 5T14A 4DCOB 2V34A 2NSBA 1XNRF 2L3MA 4CO4A 4DU1A 1BI4B 2QXFA 5AZIA 2M88A 1DQAA 4CEDA 2HNZB 3DDIA 3GWCA 3OD2A 2OD4A 3QEPA 4TU8A 3QINA 4CZHA 3U3GA 3LPUA 3DI6B 4JI8J 1MROB 1XMBA 5DDRC 2O66A 1BI4A 1NK7A 3C14B 1NOYA 2B4UA 5B7WA 4QBUA 1D9AA 4Y34A 4LBIA 2FJAB 3RG6A 1WNSA 1HWJA 3MXIA 1KLNA 3MPVA 3C6AA 1CJKA 4B3SF 5HLFB 1UJ5A 2DH9A 5KFZA 1HYSA 4WYBA 1UEKA 2AX1A 1D8YA 3ONQA 4K5SA 4M7XA 4CJFA 3T5LA 4H0XB 1JLGA 3NXZA 4ED5A 3QNOA 4BHQA 3TAGA 2HBQB 2IJFA 1FXRA 1AB8A 5HBMA 4LMZA 2GUPA 3BPDA 1FRLA 3BUZB 3TQEA 2IM3A 1S1WA 2ZHBA 2DY4A 4JI1F 2D5RA 4QZVB 3MM5B 4K4VA 3QPIA 4ZVOB 2ZH2A 4IDHA 2PN6A 2IIRA 3QEWA 4PL8A 1XBWA 3P45B 1IWAA 1FRHA 4IOBA 3US5A 3O6WA 4ED6A 3HCXA 4IOCL 4EYHB 1K9MT 3VAHA 2P9IA 4IEEA 5EHHA 2XI2A 2V5HG 2ZJRQ 4HH1A 4PYAA 3OT9A 2MQQA 1TP7A 3UD5A 2QWQA 1R8HA 1SAZA 1LNQA 5DM7L 1R3NA 4MDBA 4GV6A 2HHVA 1WF2A 5FIIA 4USVA 2ASOA 2KN4A 2E66A 1EX4A 1X9JA 3N4QA 4LSLB 4JKGA 4XPCA 4CEBA 4CVNE 1HLUA 3R5BA 2AJ4A 2BUPA 2JGUA 2MQ8A 1W26A 4B1XB 2PGCA 1JLBB 3IRWP 3CCVS 2LQJA 1IM4A 1HNWK 3R7NB 2IM2A 1X4EA 1OKJA 3HHKA 3AAPA 3AVBA 3OFEA 3A2FA 1I51B 2E2PA 3R7BB 3SQOP 2DGSA 2XQCA 2P9KB 3R9LA 4WP8A 3LDNA 1AYEA 1QUPA 1QTMA 2GMLA 1VQ7S 1EKEA 4KHSA 4TVAB 4KTWA 4WCEQ 5JJBA 3Q83A 5KT7A 2HBRB 1Q8BA 1MWMA 3MCPA 3V9WA 1VLYA 2MQOA 4FK4A 2CRLA 1H6KX 2Z56B 3LWLA 3O08A 5KT6A 4KR0B 4FCYA 4P7VA 4A46A 1S1UB 4EBDA 4EZ6A 5FD1A 2IMOA 4W92B 3Q2SC 2ZH7A 2IRUA 2GQCA 4JI2K 2EEYA 3PIOL 2NZ4A 2PSZA 3KK2B 1M1GA 4LRCA 4USUA 3QO9A 3DKDA 4CT9A 1S12A 3C7NB 1Q86O 2QL5B 4NB4A 1X4AA 3MM7B 1A5XA 2V69A 1VRTB 2MLXA 3FZLA 2KJVA 4RL1A 3ZTOA 3UPFA 1VMBA 2IBOA 2V52B 3TYTA 4LFBJ 4BC4A 1HWLA 2DHGA 3TTFA 3IR7B 4B9NA 3ZEUB 3TQ1A 2RKIA 3SBTA 5L1KA 3CC4S 1VOMA 1NCLA 3FCWA 4LT6A 2NREA 4Y2MA 3H40A 2H54B 2NRWA 4L76A 2D41A 5IT4A 4IEIA 1Y00A 4WYLA 2ASJA 4DUYF 5AQYA 4DCPB 3SZ2A 2ZZMA 2QA4G 2LU1A 5C2CA 4ISFA 3M2UA 1GEHA 4L74A 1SQEA 4JKDA 3OW2M 3O2IA 3CCLS 2ZNZA 3MEDA 3I87A 4K5RA 4MK9A 2BQRA 2CJBA 3BPSP 1H7WA 1ZAXA 4TN2A 3LP0A 1TQLA 1LAWA 2O4IA 1EWRA 2DHHA 1S9GB 2BACA 3CD7A 3PKYA 2B56A 5KRSA 4B9LA 3MEDB 4CECA 2LP4A 2LYVA 2VQFJ 3A3NB 3HZ6A 4BROA 4PWUA 1LAVA 2ZQBA 3PIPQ 4WQ5C 3TAMB 3KDOA 2L9DA 5GVQA 3X1LB 4O4GB 1GK8A 4GVMA 2MZQA 1P90A 3PYDA 2AGPA 2WTUA 2NRZA 3FEZA 2YV0X 3VAFA 4BC9A 4J8FA 4UTGA 1S4FA 5KFIA 1N0VC 4ZJLA 4EK2A 3ZT4A 4PXDA 2RE1A 3EWGA 4RUCA 1FKOB 1QSYA 3K58A 3CB4A 2V8DA 3OPKA 4OX6A 3L2RA 4XH4A 4ETZA 3RAQA 3EZ5A 3TAEA 1A0OB 4BR7A 3W8GA 4F4KA 2UYTA 5A8RB 4LF8F 4EZ9A 3OTEA 1NPRA 4OMFG 3MTJA 5B08A 1QHTA 3GJQB 3G8QA 1HPZA 3QESA 3O8WA 4ZVQB 5DZ6A 3DRSA 2IS3A 4JI3J 3TEGA 1S72N 5CAAA 3MMVA 1KR4A 3NP5A 3CJKB 4LFAJ 2AP6A 4FYWB 2VA3A 2H3GX 3VEYA 2YH1A 3V4IA 1B0VA 1WSGA 2X74A 3QICA 1WSHA 1KTVA 4L8RB 3MZIA 1KVCA 3WXLA 4C98A 4FJHA 2CWXA 4EO6A 4ZP6A 3DCAA 3HP9A 2HGNA 5D4NA 2VG5B 3KTQA 4BC3A 2NQPA 3DRRB 4LF9K 3P38A 3QIPA 4AXJA 1C0FA 1UTAA 4A47A 1EWQA 2P9LB 2YNFB 5CQGA 3CCUN 1I94F 1RT4A 3P96A 5ADXA 3UNGC 4LQ3A 2HNDB 4BDZA 1Q78A 3GBTA 1N33K 1NBWA 4DV2J 3MMCB 3AVJA 2AJFE 3RMDA 4QOZB 3F41A 3O1WA 3Q8UA 1F9HA 1Q81T 4PG8A 4Q44A 2AV5A 2O8DB 3ULHA 1S79A 1TELA 3I9ZA 3D7SB 3C95A 1SQFA 1CZBA 4GKJJ 4IJAA 3CCRN 4DBQA 2YNIB 2V50A 3FMBA 2A2DA 2G1HA 2QLXA 2E5LK 4IYQA 2NNWA 3FFIB 2DGXA 2CQ1A 2PA8D 4WXWA 1WUUA 1YG0A 1B7FA 1C0UA 1IR0A 4X4NA 2VG6B 4AH9A 2VFVA 4NLXA 1RILA 4J9KA 1IJJA 4X4PA 3VMFB 4C6AA 3SPZA 2IJRA 3KXDA 4BRNA 3THXB 1LWFB 3F5TA 2XM3A 2ZKTA 1Q82T 2FPHX 3MUVP 5DG7A 4CEZA 1A7GE 3H1VX 3CDUA 1BC6A 1RTHB 1LV5A 5AE3A 1S59A 1JLGB 3HULA 2YXLA 2K3IA 1E6VB 4GVLA 2F65A 1FRXA 2CVEA 4ED7A 4LFCK 4PL7A 3ZZTA 4X65K 2QWOA 4J9SA 3LPYA 5JXSA 2MEWA 1C1CA 3ZETA 1ZAWA 2ATCB 3HBTA 2VYPA 2RJZA 1H38A 4LBPA 4QR2A 4A8QA 4NLGA 4DMZA 2FZGB 5IQ6A 1T9UA 1W97L 4QAGA 2MY7A 4DSIA 1R89A 4LD0A 5DLGA 3LUYA 3PX4A 2QTDA 4E7HA 2KVIA 3LDQA 1NK6A 1EHWA 3HKWA 3OUYA 5AQPA 4LF6F 2R9LA 2G0CA 3R27A 4WFAQ 3O4WA 4I2QB 4DV5F 1N32J 3I56N 2UU9J 2GVZB 3U9ZA 2GA7A 2DFFA 2K3KA 2FHOB 4J2EA 3TUIC 5KFVA 3MHYA 2W2OP 4DMNA 4DLEA 2OTLS 1X31C 5KG6A 4ZN1A 4LQ9A 1OH7A 1URRA 3CIZA 2UUCK 3TAMA 1U1MA 5KFDA 5CD4A 1VSJA 2GV9A 5CH7B 1IR1A 1SUQB 1DZ5A 3RR8A 1YF5L 5B0FA 2EG1A 3EYZA 3QRRA 2PE8A 2FC8A 2FHJA 2IFXA 3D68A 5AQXA 3HSTB 3JS9A 3KLEA 1WF0A 4X84A 1NK5A 1LOTB 5F8HA 2CPDA 3CEDA 1TUUA 2QFIA 4HACB 5HMXA 3KWGA 3RW7A 1BG3A 3E9LA 3CMES 2XI3A 1BHNA 2H5JB 3PUFA 4G1QB 1RE1B 2OCEA 3KJFB 2M8DB 5LY3A 3M05A 5B8HA 4ECUA 3CYMA 3T1AA 1OO0B 4KIAA 1X5PA 4YY3K 2RQCA 4NLYA 2RF2B 1NKEA 2L08A 3RAXA 3CO9A 3TR5A 4ZPBA 4WE1A 1JB0C 3ZZZA 4WZQA 4UY8T 2ZZTA 1BGXT 4PG4A 3I5CA 3LW5C 5H9FK 4B1UB 2R4FA 3TJ9A 3G0ZA 5ETNA 4FO0A 4F3TA 4HHJA 2F8HA 1RWVB 3VQQA 2KQ2A 4HT5A 3DLBA 4F3QA 1S1TA 2BOAA 3ETOA 1VQ5N 1FO1A 2DNMA 4CNZA 2QV6A 2RQMA 1RWKB 1SJ4P 4CK3A 3MAAA 2G8HA 1MDUB 3VAGA 5AXKA 5F0XA 1T7PA 2YCHA 4OHYA 3CC2N 4NYOA 4J7CA 3NE6A 4M5GA 2UXCF 1RKIA 1EETB 4N41A 1IKVB 3V81A 1RAFB 1N54B 1RT2A 5F8GA 1LWCA 3VQDA 5KG4A 2EWHA 1DKGD 1S6PB 3BYRA 3DDKA 1TL3A 3QT6A 3NF6A 1PJ7A 4LIWA 4FM2A 4CLPA 1UVLA 5KPTA 1XNQK 1CQNA 1HNIA 4DS5A 3C0BA 4NZ6A 4HUEA 1U1OA 4LF4J 1WHVA 4OJGA 2J6TA 3IFRA 4JK8A 3GIRA 1S22A 3K57A 2VWKA 4CO5A 5LMUK 3QWPA 3TR8A 2XYPB 1U2RA 3WT0A 3RAMA 3A4TA 4Z4FA 3BO4A 4BLGA 4WQ4C 3AOCA 1RGIA 4RNNA 4DF4A 3SAGA 1VQKN 4FJXA 1UETA 1OS5A 2UUAF 2HW3A 5LMUJ 3CC4N 4NXMJ 4YDDB 4FS2A 3L4QA 1FXXA 4IG3A 1WG5A 1NU4A 2IRXA 1RDUA 1X4DA 5IV4A 2LDIA 4L3QA 2EFVA 1NMDA 3GIKA 4K8RA 2F4VK 5H1SV 3SQ1A 2M70A 4J91A 2P2CB 3QWUA 1EQYA 3MWBA 1K0TA 3NKYA 3EO3A 1BXNA 4ELTA 1KVBA 4JI7J 1Y11A 3W61A 2CAJA 3GG1A 4KHPJ 1KDNA 3KOAA 5L39A 3HF5A 4JP8A 5KFNA 1LFPA 4F4WA 3PM9A 4OZ1A 4XH1A 4O55A 3A3PB 2H48B 3MFHA 3CE8A 1NJZA 5CABA 2GHVC 2DHSA 4X64K 2CQ3A 4O44A 2HAIA 1ASVA 5HATA 1QLNA 3W1YC 4ILLA 2N4CA 1HD1A 3E66A 1EQMA 4MFBB 3OBYA 3PHTA 1HWUA 4PZVA 4KB7A 4U8YA 1RWUA 2HPUA 2E29A 3RBDA 4DUYJ 3TZWA 4L6V3 2Z0GA 3JXUA 4Y6IA 2ETJA 3LL3A 1U09A 4ECWA 1RWNB 4BG8A 4DV1J 1N5YB 3RR7A 3CI5A 4K43A 2LFVA 4YOXA 1IKWA 2HSEB 4B1VA 4KB1A 1RDBA 1NZAA 1QQMA 4FSVA 1ASUA 1F9FA 1SC6A 3L2WA 1ZBHA 3CCES 1QVFM 3U6FA 2DNGA 5F8LA 4JOUA 3CCWA 3BR9A 1XN9A 4OZ2A 2OPPA 2UUCJ 1RWWB 3K9KA 1GNKA 3H2UB 4DL6A 4Z4EA 2DTJA 2FVSA 2G13A 3THPA 3MR6A 1NZ8A 4H5RA 1TKTB 5KG7A 5G0RA 1NJIO 2LEPA 2MZJA 3SCXA 1IBCB 1YJNN 3D54A 3U02A 1IBKK 2EC2A 3FFKB 3OVSA 4DR3K 4CZGA 1U24A 1TKTA 1UOCA 5KFKA 4ED0A 4M3WA 1S57A 1KLMB 2YWEA 2V4QA 1M90O 4X62J 4JI2F 5AFUA 3M8PB 3ILIA 4YDUA 1C0GA 4LF6K 1TKXB 5KPRA 4EMDA 4ITSA 2X78A 4HWIA 3MM7A 2ZH6A 1C0MA 2AGOA 4Q2MA 5DLFA 3JAMU 3W63A 1F0XA 5E0OA 3WXKA 2P8IA 3MEGB 4KQZA 3A3OB 1FRJA 2EBEA 3ZC4A 2QI2A 3ENHA 2KKZA 1UL3A 2VWBA 1J5EF 2ZM6J 3JSRA 1T44A 3SMPA 3EGVA 5HANA 1SKWA 2VBYA 2A6OA 2W9BB 4RW6B 3UIQA 4LFCJ 3VEXA 1OVQA 3OHRA 3W60A 4BR4A 2X3DA 3HXMA 4FL9A 1WDDA 4H54A 4QIEA 5BR8K 4H03B 3CDBA 4WIQA 4I6MA 2CADA 5DRKA 2Z1GA 3AA3A 5AXNA 4MIAA 2G8FA 2V7YA 3R1XA 2H4YB 3CULA 1VQ7N 3CFRA 1Y3KA 3E51A 1KBRA 2N4DA 2Q97A 1U1KA 3FCHA 1U49A 3HD1A 3SUNA 1OWXA 3PW4A 4B3TJ 4FWLA 2C2OB 4NLSA 5IT9U 5KOWA 4UZBA 3QEIA 2E5LJ 2MDAA 3CTRA 3PYFA 4ZITA 3FBEA 1LXJA 5KG3A 3V9XA 3N0VA 2YJEA 1DFDA 4BRFA 4RW7A 2B8QA 1KD1T 1K8KB 4JNEA 3WX8A 4NXNJ 4DJBA 4NASA 1RWOB 5IV3A 1W0HA 2P51A 1JJHA 1M5VC 4IZ9A 1Q4RA 2Y9HA 4KPCA 4Y0FA 3VGMA 3CXCR 4IRDA 1RQ0A 4Q0BA 2ACMA 4W5NA 2GEMA 2FD2A 3W65A 1ZPWX 3DGVA 3T5JA 4FWSA 2DB1A 4XO0A 3DHWC 4AL5A 4DR6F 1K47A 2C2NA 3CJ9A 1X4BA 2EFQA 3H7HB 3ETMA 2AJ2A 2UUBF 2ILYA 4ILRA 4FBTA 1N5VA 1RAIB 2MGZA 3V9UA 3DXKB 2HBKA 4H5NA 3EN9A 3C3LA 4DX7A 2ALZA 3PFOA 1KQKA 4DU4A 4YDXA 2RQKA 4WE1B 4EUVA 3DXBA 4ANCA 1DTTB 5GAEP 5KG1A 1S77D 2HVIA 3SSSA 4PWWA 3T9ZA 3Q8RB 1JXVA 4DFJA 1NKBA 4DTPA 3NCRA 1UAWA 3ZSRA 3DLEA 4HR2A 1L3SA 1CBKA 4I0WA 1T95A 3KJQB 3CM5A 2ZM6K 4H5VA 2RHKA 3WQPA 3OYCA 1DTTA 4DX5A 5KPZA 3VALA 4CBUA 5KFGA 2R2UA 2WW8A 3I55S 4IOXA 3CJCA 1GFWB 3CJTA 3IWXA 4OJRA 4P71A 2ADCA 2AJ0A 2H5IB 3ZX0A 3D6MB 3CCSN 3H98A 2X1FA 2MJUA 3AD9C 4LF6J 2OTJN 4QU6A 2BH1A 1MMLA 2V67A 2JWKA 5FRNA 1GMUA 3HPGA 4WQ4A 3FR0A 1SJ3P 4AILC 4P2MA 1VQ6S 3GLJA 3M32A 5CD4H 1D9FA 4X4SA 2LA6A 4WK3A 2Z57B 2HNYB 1KAZA 2RUSA 4F0HA 2VC1A 1EB0A 4U7BA 5J2MA 5A8WB 4DL5A 1X9MA 1NSPA 3EE3A 3DRYA 3P6YC 2P9EA 4KBOA 1S72S 4DWIA 2GJFA 4IFYA 2XS5A 3SLCA 2VGMA 4A8OA 1MN7A 3G82A 2NYHA 3W7BA 4O4RA 1UW9A 3W5YA 2W9CB 2JLGA 4WBFA 1EKSA 4YOUA 2GVDA 2X1AA 5KG5A 1C0UB 2VH7A 4AXIA 1WWHA 4DCJB 3UKUB 3TZXA 3RJMB 2ZDOA 3TVZA 2U2FA 3FCVA 3D6FB 1V5VA 1GOBA 4IO9L 2XMVA 4M1KA 1BA0A 4IO8A 2O8EB 4JKEA 1YJWS 4FYYB 2DRAA 4KE5A 2DK2A 5E3RA 2JH3A 4WIIA 3MCMA 3TVYA 1C4AA 5HMZA 3UCZP 3C66A 1B0PA 1RBUA 4ELVA 2BV3A 4W5OA 1AXQA 5BN8A 1AA1B 3IO1A 4JV2A 5JLHA 2DBBA 3F56A 3I31A 3M2VB 1WTFA 3H3NO 1TUVA 3MAAB 4F4YA 2GQQA 4ZCLA 3G9CA 3QJLA 3W3SA 5KGXA 3AXMA 4QWDA 1Z4UA 4JI7K 1ZAVA 1KXPA 3OTOF 4U96A 3C94A 3EPIA 3LQVA 4RW8B 2JDJA 4MT1A 4DX8H 2KI2A 2IVPA 2VQEK 1Z2LA 1LW0A 3TJAA 3Q8VA 5BREA 1B7YB 2W25A 4QIWD 1RDWX 1I39A 1YX2A 3V6HA 4YS2A 1M90T 1NLKL 4Y2IA 4CTAB 4ZHRB 2NR0A 5M2UA 2FSJA 3MX2A 1V5IB 1AW0A 4DV4F 1HBMA 3KDNA 1N34J 4NXMK 4ISGA 4OI0A 3LM2A 2JEIA 4CH7A 1WI6A 4DV7F 4IOCQ 3HFKA 3BEGB 1OYEA 3EZWA 1TKZB 1FX2A 3F2KA 3KUEA 4A57A 3QB0A 5CE3A 2B0GA 3PACA 2VJUA 3M2UB 3S01A 4WFNQ 3L4BC 5CXTA 4X64F 5HO4A 3FUYA 1HNXJ 4E7LA 1S49A 3UQSA 1XMQJ 4HI1A 4P2XA 3QGPA 4AM6A 3SYZA 3FSYA 1GLJO 4BRCA 1T03A 3J81j 3FFIA 1HUXA 3NDKA 4OX7A 3PO4A 2Q31A 3MK6A 5D0HA 4LY7A 3Q8QB 3MAQA 1W25A 3TO8A 4PKHA 3GJTB 2ZGZA 4C48A 4A4JA 2R8KA 2A18A 4CF1A 4CO0A 2BDPA 2UXCK 1U6BA 2BKOA 3G96A 2YKMA 3TX0A 1PC4A 3GFYA 4GMJB 4YN3B 2WZ1A 3ZZPA 2F3JA 5BR8J 4TXSA 4HHTA 3R5AA 3WX4A 5JVHL 5HI7A 2QJ3A 2QRRA 3WIVA 4CERA 1FFWB 2AW0A 2E1PA 4NXNK 2R7UA 3AD7C 1RA7A 1JLFA 2EBGA 3ZZOA 4ID5B 4PQAA 1X0PA 4RNHA 1TKDA 4B3TK 1WSVA 1M1HA 2DH8A 4DV1F 1CXQA 4EWTA 3AQPA 4OZNA 4QIFA 1NHKL 1WEYA 4PEOA 2Z2ZA 1ZTWA 3C8YA 1IR2A 4OQJA 1LWXA 4IO1A 4IDKB 4WCEL 3O5BA 2CDRB 4DCHA 3P5TL 2A1RA 4OLBA 1KOOA 3JXOA 3K89A 3SUPA 3NMAA 1VQ6N 2ZITA 1N5TA 2O01C 4GRSA 3I5AA 2DR5A 3DM2A 1VQMN 1D8ZA 1OY6A 2UUCF 1F21A 3J7ZO 4M5HA 2IC3A 3LP0B 3QRQA 4NYPA 1KAXA 2EG2A 1OSDA 2AZ3A 3HHNB 3OVAA 3SI8A 4KJIA 1T11A 1OH6A 1VAZA 1ZA1B 4Z7CA 4BR0A 2BABA 4P52A 2WSFC 4BRLA 3B82A 1PCAA 4XPEA 5FPMA 1S9EB 5CZXA 3BH7B 4AL7A 3TRGA 4DX6A 4CLTA 4X62F 1BIUA 4C3MA 2A0FB 4E7KA 3GFXA 2XHCA 3NVMA 1UP1A 2CQDA 4FF1A 2GAHC 2NXJA 2PZSA 1O51A 2DPIA 4CJPA 4OI1A 3L2VA 4ZCMA 2LDYA 3AFGA 3PNIA 2RF2A 1KQGB 4L3KA 4V19X 2ZM6F 3M6GA 2A1BA 1CQMA 1UVJA 4DG1A 1PJ5A 3TUZC 4GKKK 3U4LA 4CHYA 1SL0A 5BRHA 3MDFA 1YJUA 4Z2XA 2PA3A 4K25A 4Q8EA 2CIMA 4X65J 1BL3A 4LF1A 4ZLNA 4LBHA 4R5PA 4A8KA 3IGNA 1B99A 1YJ7A 3ZXWA 3CC7S 2X1BA 1HPZB 2H4WB 4LJMA 4LF7J 5EUHA 3DYAB 3EICA 4F2RA 1WEXA 2E2OA 3ULEA 3UD3P 2WVDA 3GDQA 3H08A 2QIFA 5FPEA 4I6WA 5AE1A 2KXNB 3QBXA 1R8PA 1N5YA 5FLXU 3SBMA 4C23A 2RRAA 2BJ8A 2XMAA 1OPIA 4E1JA 4WFAL 4YOVA 1IG9A 2XCPA 3MM9A 4DUYK 5FLXY 3FMWA 5GADU 3PO5A 1FJGF 4P9SA 1F9EB 1U8WA 4GO7X 1MLAA 4KV8A 1RYRA 4IKFA 1SV5B 3UVJA 3P5BP 2F4VJ 1SJ1A 4O3RA 2A3ZA 4JK9A 2OPPB 5HAOA 5AQSA 1HNIB 4CF9A 4A8XA 2CYYA 1HNXK 1GTHA 4FPBA 4NZ0A 2UUTA 3CCTA 4A8MP 1QY7A 4N76A 4NLQA 5E3AA 4KH1B 2B8PA 3E9PA 2YX1A 2I5JB 1N5QA 1TUWA 1T03B 5I3QA 4HI2A 1XUPO 3TARA 5C2FA 2YKPA 2MGZB 2PI5A 4USIA 3IBCB 5IWAJ 3QFUA 2MQPA 4OKKA 1CPZA 3QAEA 1J54A 2LQBA 1U2VA 4JV0A 4FJ7A 1ZTTA 2GC8A 3FQLA 2FB0A 3ZSQA 5CYQA 3NMRA 1RP5A 3OXFA 2YNGB 5IC4B 1MG7A 3G6ES 3A13A 1CJUA 5L1LA 3M3ZA 2B43A 2VZ9A 4B8CA 1XMQK 3MECA 5I3PA 4M5KA 2R7YA 1NO8A 1SJFA 2BJ9A 1OMSA 2AYGA 1Q0NA 2XWXA 1S0MA 2HLUA 5CYMB 3SUQA 4B3OB 4HL9A 3VQ5A 4YP3A 3K5LA 1T3VA 4CHNA 1U1RA 4Q7AA 4CJRA 1NJWA 5IWAK 2UV8G 4HACA 1RAOA 2LU2A 1YTAA 1YK9A 2BTFA 5C15A 4ICLB 2VG6A 5JUMA 3CC2S 5I42B 3VA3A 2VDIA 4M5DA 4FOEA 4JRQA 4I6YA 3DXSX 3OVBA 4M8LA 1XNQJ 3KG1A 5D78A 2RMLA 5AQKA 4FN5A 5HBMB 3JAMY 3D2FA 2YKOA 4MH8A 3BSAA 5KFEA 1MWQA 4QWBA 2DGWA 2WVBA 2J7KA 1FRKA 4YR2A 3K59A 1ESVA 4C8KA 2WOMB 2VQEJ 2DTUA 3HVAA 3NBPB 5F9LA 5KI6A 4A5BA 4OV1A 2QWPA 4BE1A 3HDSA 6FDRA 2OEJA 5AXLA 3VF2A 4CHQA 2V9KA 4O3QA 3KMQA 2QMUB 1BDGA 3CCJN 3VTHA 1KHWA 1FNOA 1VI7A 4CQ1A 2OSRA 1S10A 2MZTA 4CE9A 3FK4A 4B9TA 4CLWA 4FPRA 1VSMA 2ZWHA 4GKKF 4DL3A 4F8RA 1IKVA 4CGIA 1SBRA 1IO2A 3VGSA 1UKUA 3B4DA 4E19A 4RWXA 1HKCA 1FESA 4IRKA 3G25A 2O8FB 2JLEA 3I8BA 2OEMA 5F0WA 3PVXA 1NGFA 2IM1A 5DM6Q 3KLEB 3CO0P 1C0TB 4MQ3A 3OJSA 1ZA2B 2DNNA 4A62A 1G2EA 4RUBA 2MPUA 1R27B 4DR4K 5DG8A 4ZJQA 1UVKA 4JV1A 2FQQB 2W7AA 4QYRA 3M9MB 2B3TB 3ZT2A 1JJ2R 2V2VA 2C22A 1FXDA 2J9DA 3UKRA 3OYAA 2J9CA 2JEJA 2JFKA 2RNEA 3EDQB 4O3SA 2I2YA 3O9TA 1W2IA 3M6XA 1LWFA 3Q8PB 3CIPA 1CJKB 2CGJA 2R7XA 3PX6A 1JLAB 3WEEB 2EC0A 2W4PA 3H4BA 1HL6A 1UA1A 3BQ2A 3PDNA 5ETPA 4N5SA 1LCUA 1HWKA 1K44A 1KN6A 1RDAA 4C1NK 4W5QA 1S6QB 4ED8A 4E89A 1U04A 2OI2A 4GVBB 3NGDA 4HUGA 2KFYA 4N47A 2JC0A 2GHPA 1SH2A 1GLCG 3MOJB 4KGMA 3MN6A 4KC5A 2BE7D 4ELUA 4DQSA 4TKTA 2GAGC 4W5RA 1ITGA 2O67A 3VHQA 2ZZNA 3OL7A 5L9NA 3EM1A 1DLOA 2RUGA 3KK1B 2IMWP 1HKGA 2ZF5O 3JSMB 4OGCA 5C25A 2HEKA 4PXBA 2OZSA 2ZUAA 5C42B 1GMVA 1RCOB 5ETRA 3UDEA 1GX6A 1NNEA 3ZSZA 4AHVA 2FJVA 4G1PA 3VQ6A 3NNAA 2ZE2B 5AQWA 5CZVA 1HX1A 3IR6B 4WU3A 1WOQA 2R7VA 2ZEJA 4H5WA 1VQMS 1NEEA 2PFDA 3KJVB 3OYFA 3NEKA 2ROPA 4B1ZA 2P9KA 3HSZA 1HD0A 3CIMA 4ES1A 4NYNA 1CLQA 2Q1LA 4EAHD 5ELZA 3R1LA 2GX8A 1HW9A 1TL1A 4PXEA 1HBUB 1VHIA 4NA1A 4F3OA 5B0AA 3T1HF 3FSXA 1TFYA 1B0TA 2DNYA 5DGAA 2NLWA 4K0KF 1C1BB 2X1GA 1X3NA 1NHUA 8AT1B 4WFBL 3ENOA 2UXBF 2DH7A 5I3UA 2JVRA 4ZJOA 1F5AA 5LL6Z 2AGQA 2OGUA 4GKJK 3N9UC 1OH5A 3QO9B 4C4WA 4KH0B 2KG0A 5AQVA 2MQMA 1FA0A 1M5KC 2XLKA 4QU7A 3SQ0A 3BQ1A 4I64A 4X66F 1BCMA 4FF2A 2XMTA 4B9SA 4O8KA 3M8PA 4DV2K 1UPPA 1N33J 3KD1E 4WTOB 4RG8A 1TZ0A 3THXA 2VOOA 1VBYA 4DV0F 3HZGA 4CLFA 4YEAA 1TV6A 4Z7YA 3G4SN 4OPHA 3AB4B 4L72B 2VIHA 2J0SD 2P9UA 2HVDA 2MB0B 3THTA 4KPYA 3ET6A 3BKTA 1N34K 3QLHA 1WKLA 2F8EX 1WBDA 5C42A 4ZA1A 2J8AA 3OHAA 2HKEA 4J9NA 4CIOA 2E20A 4NLRA 4E8UA 3UDLA 1YDLA 2PMZD 3NG8A 4V19J 3OA9A 4DR3J 3TSUA 1GMWD 4F4XA 1S1VB 2WAQD 2RILA 1WC1A 4IQMA 3HM8A 3OYJA 4KT0C 3VQ9A 5GMKa 3QEXA 2E9RX 3VF6A 5A8WA 3AARA 1ZPVA 2VPXB 2CQCA 1X5OA 1Q5YA 4DF8A 3CPWM 4KRFA 4LSLA 2MKKA 2N7YA 1NGIA 1J2VA 4C8NA 5F9NA 2H5EA 3R5CA 1APSA 4DR7K 4BCAA 3G82B 2DD8S 1EIYB 4ZPCA 1L5UA 1QDUB 1FDDA 4J9UE 3LZIA 2J8SA 4DPOA 2IA6A 2Z2MA 4X62K 3TU5A 1MSWD 3MEEB 1WKJA 3MMAA 1HHTP 1FCAA 1V3RA 1WN7A 3KHLA 4NLBA 4DU8A 5CR4A 3PR5B 3I0SA 2JEFA 1KRPA 3TW0A 4U7UK 3VR1A 4B3OA 1HJOA 1RSCA 4DR4J 2F8SA 3CPEA 4J9VA 6AT1B 2CNNB 4EGLA 2HHXA 3MMAB 2UP1A 2E5IA 1E6YB 3N5FA 1UAXA 1VQ8S 4OYAA 2QKBA 3PW5A 3NAHA 1YJWN 1KHVA 4CJWA 2VQFK 4MK8A 3S7RA 1TK5A 2CJQA 1PO6A 5ETVA 3TA1A 1BQNA 3DI6A 1RT3B 5CZ1A 1TMJA 3SQ4A 4O5FA 3BJYA 3P49B 4LF7F 4JS4A 3LP1A 4TQSA 1EX8A 4JI3F 3MXHP 3VQTA 2VV5A 3HVTA 2XHWA 3MD1A 5HL7Q 3R8EA 1LK5A 2QX0A 1KD1O 2QXLA 4AE5A 3AVLA 4Y3CA 5JS2A 2YPZA 3TJ8A 3GG0A 3KJNB 2W6KA 1ZBUA 4QR0A 3LAMA 3Q86A 2B4OA 3WBZA 1SC1B 2HQCA 2OO4A 1S1TB 4DV1K 3DOKA 2XRIA 1UWAA 1CS4A 4TU9A 1Q53A 4IJNA 3UR0A 2YVSA 4RO0A 3W9HA 1DGKN 3LDLA 2CQPA 3ENVA 3PTWA 3R5DA 2XBPA 3CCVN 3HOTA 2PEBA 2QWMA 3N6MA 2ZFHA 3NH2A 2W2MP 4DTUA 1S48A 3NGUA 3GU0A 4M3XA 2XSJB 1TR0A 3HOSA 4TSXA 3DRXA 3RYLA 3S3NA 5D4OA 3H4DA 4I2PB 3ALYA 1ZZNA 4MO5A 1JWWA 1PSDA 1T9TA 5IWAF 2ZD1B 2DGQA 4KHPK 5HRSA 4C9DA 2CZVC 4A5AA 2W42A 1RADB 1FW6A 1FF2A 3TEHB 5DS7A 3IGVA 3DOMA 3R5JB 5M1FA 3Q22A 5A8KB 1HNWJ 2V8GA 3MOZA 1KQSR 2DFHA 1JJ4A 5K14A 3W3DA 2B7CB 4LF4K 4OX8A 3U27A 1PG5B 2ZD1A 2V4JA 3PYGA 2PDAA 1U45A 5HK4A 1R0AA 3FC9A 4RPFA 1LEOA 2BE2A 2MQLA 1N36F 5A8RA 1Z6RA 1X0FA 3ZNJ1 2WW4A 1C1AA 3AA8A 1UVMA 2E5HA 3I6PA 2HZCA 4DUZJ 2HHPA 4P2FA 2UVUA 3OYEA 1WSJA 5A76A 1TVRA 4CJLA 1VSDA 4LVOP 1VQ5S 3OXLA 1G4CA 4ILHA 3QRPA 1U0HB 3D28A 1G1XA 1EP4A 4W4MA 3M4XA 1JJCB 4LFBF 3W2VB 3FBFA 3AVKA 3GYGA 4M5JA 1NGHA 3MI7X 3ZZYA 3UE2A 4FXDA 2IPOB 4NMLA 1NHVA 3DRRA 3KLHB 2N82B 5T7LA 3LPEA 2W9BA 3GJSB 1JCFA 2WONA 1TUYA 2FJDB 4KHRA 3NF8A 2AKWB 1KAYA 2D74B 3BGFA 2QMWA 5M1KA 2VPZB 1WHXA 3VV2B 2BRLA 2HRYA 3CDEA 4ECSA 2BJDA 1JLEA 2BYCA 3QT8A 3CJBA 2YHYA 2R7RA 4DFPA 1S99A 4FYDA 3PHEA 4JHDA 2XLIA 5K8NA 2DPNA 4H0OA 3VEWA 1VS3A 3WIUA 2VJVA 2BQUA 3FE1A 2E88A 2IGIA 2KTQA 4YUDA 2RU3A 2KG1A 3MF5A 1NB2A 4CD3A 2B6AA 2BE9B 4WFZA 4F26A 2XULA 1ZOTA 2ZWPA 2ZHOA 3CNQP 2HHSA 3SV3A 1RYSA 1YJRA 2BXJA 3M8SA 1Q86T 1HNVA 3CCZA 4YY3J 3D2EB 4O3OA 3GV8B 2QA4S 3G6XA 4KFBB 3S3MA 2RH3A 5F8MA 5KG0A 3I55N 2ALYB 5IS2A 1T9YA 2XZTB 4ZDNA 2X7IA 3M8WA 4PY5A 1N32F 2KFZA 3FEXB 3CHWA 2OMLA 3LGHA 3DRPA 3B8HA 4IFYB 1JL2A 3O3HA 2WB1D 1KVIA 1GXUA 1U48A 1H98A 1I6JA 4O3NA 1Q8KA 1U2FA 3LZJA 2IVNA 1JQGA 5EX5A 1B4SA 2LXUA 5HQMA 2V9WA 3OL6A 4U67Q 3DRPB 1EARA 4X4VA 1IBKJ 1VSFA 4K50A 3T3FA 1N4LA 3AVHA 1LWEB 1JXEA 4CZMA 2NZTA 1UZHA 2ROGA 2BJEA 5JVHQ 4FNIA 4CCHA 2CGLA 4OYMA 2X6NA 1CJTB 4Y2KA 5GAEU 2W40A 4FM0A 1XR7A 2JWLA 2AX0A 1D5AA 4DUTA 3BGUA 1Q16B 2FLNA 2CPZA 4B1YB 4FJ8A 2GWKA 2VOPA 3ENWA 5KFBA 2DHAA 3SQGA 3EKUA 3GCXP 2W6LA 4CZLA 2ROEA 4IXCA 2QM1A 1JLBA 3IBWA 1B70B 3B6BA 1ULRA 3DM2B 2FBXA 2E1ZA 3T6JA 3IAM9 1PYOB 4S0MA 3ITHB 4LRBA 3GIJA 2PYLA 2GWJA 3D2FB 1IUJA 5KFTA 1RBVA 4URSA 5A6WA 3VAKA 1HBNA 5IFMA 1VFJA 3U8XA 3G10A 3EDRB 4DTRA 4ZPVR 4I56A 2E8AA 3B6OA 3E8OA 3NGKA 3F44A 2FUG9 4USHA 4GKJF 3SCIE 1YITS 3CCQS 4IDKA 2HFUA 3MN9A 4AL6A 4BWMA 4ECZA