4H4MA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
548
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, Exoribonuclease H, p66
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Picomolar Inhibitors Reveal Key Interactions for Drug Design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 135
structure length 548
sequence length 548
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4h4mA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4h4mA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4h4mA05
2HHWA 4PQUB 1BQNA 2W42A 1T3NA 1RTIA 3UR0A 3OSNA 2ATQA 5KT4A 2Z1HA 2YHBA 1U09A 4N5SA 2YNFB 3T1AA 3AO4A 2EC0A 2HHQA 2AU0A 2J6TA 4KFBB 3AV9A 4GC7A 2C2RA 4CHQA 4CJ4A 4O4RA 1FK9B 3OY9A 2V0NA 4KO0A 1IO2A 2HVIA 1C6VA 5DMRA 1J5OA 2W7OA 4FS1A 3HSTB 2WONA 2IM3A 3KK3B 1WSJA 5KFSA 4MFBA 4E3SA 2UVRA 4QWDA 1S9EA 1HYSA 1RTHA 1RT4A 1KVBA 4F2RA 1S10A 3QEXA 2ILYA 2HAIA 1DLOA 4DQPA 3MFHA 4BE1A 1I6JA 3VQQA 1LAWA 2HHVA 3OL9A 4WXWA 2R2RA 1HJRA 1W0HA 3K5NA 3SPZA 2FBVA 4FK2A 4OPJA 3FFIA 3KIOA 4FBTA 5F8JA 3H98A 2RF2A 3RAQA 1SL2A 3UDLA 3I5CA 1TK8A 2AX1A 1S4FA 3PW2A 1JXBA 1ASUA 2JGUA 3CO9A 1RT6B 5CZ2A 1HRHA 4FM0A 2W9CB 5KFVA 2IM2A 2O4GA 5DGBA 3VQPA 4CGJA 2OPPB 4I7FA 4R8UA 2AGPA 4JV1A 4M3YA 1JLQA 1T03B 1JKHB 5CZ1A 3PX0A 3V9XA 2X6SA 4OKJA 4DSLA 4ZVFA 2AJQA 2W9AA 2DY4A 4TXSA 4NYFA 2IS3A 3NAEA 2QXFA 4ELVA 4R5PB 2WRMA 3HPHA 2IAJA 4IOBA 3TWHA 1VSEA 4QOZB 1HNVA 1WN7A 3G6XA 2ZKUA 3VQ6A 4FJMA 3JSMB 3AVHA 3SQ4A 5KFMA 4RW7A 3KK1A 4ZPAA 1RDCA 1S1TB 5KFXA 4ICLB 2HWIA 4NLUA 3RBEA 1CXQA 3PX4A 1L3SA 3OYJA 2FJWA 3TANA 1NJWA 3QINA 5J2MB 5KFRA 1S1UB 1LW2A 4OJRA 3OYHA 2QKBA 4R0EA 2G8VA 1CZBA 3DYAB 4LSLB 1ASWA 3U6FA 1N48A 4M95A 5DG9A 3H5YA 4DSKA 3WNEA 3K2PA 4HTUA 2I1RA 4KBIA 2JLEA 3LP2A 2XGQA 4J9KA 3DRSA 5F8IA 2VG7B 4HCBA 1G15A 1SH2A 3VN5A 3B6OA 4K4XA 1A5VA 2GIRA 2P5GA 1JLGA 4RW9A 3PR4A 4WZQA 2G8HA 3MF5A 1WSGA 1VSFA 2ZQBA 4DFMA 1REVB 4RNOA 3LAKA 4ZHRA 4WXOA 4FS2A 4B3OA 2ZE2B 1KSPA 3C6TA 4CJPA 1NJYA 1S1WA 4HHTA 1CLQA 4DL5A 3DOLA 4NZ0A 4RNMA 3V6HA 2X6NA 4DTJA 2FBYA 4FVMA 4W5OA 4FJ7A 1C0UB 1UOCA 1BI4A 4WFYA 4KI6A 3ZSZA 3ZSRA 3EZUA 4IG0B 4TYBA 2QK9A 4OGEA 3T5JA 4TYAA 3DMJB 1IKWA 3I8DA 2ILZA 4QW8A 1JL1A 4KHWA 1TL1B 4ED1A 4C8OA 4AHCA 4O44A 3M9NB 1TKDA 1JLAA 3P1GA 4E19A 2Q3SA 4LSNA 4ID5A 4MH8A 4LH4A 3S3MA 1RT5B 2J6SA 2J6UA 1ZBHA 3I5BA 4BWMA 4CJVA 1R0AB 4G1QB 2IM1A 4DFKA 3DI6A 1L5UA 3NDKA 4TLRA 5KT6A 1EETA 1LAVA 1C0TB 1NK6A 3OL7A 4CJUA 1RDAA 4CHNA 2PYJA 1MU2B 3H08A 4B08A 4OPKA 3KK2B 1KLMA 1C1BA 4YQWA 2FLPA 5HLFB 4BDZA 1SUQB 4J9OA 1Y97A 5KI6A 1JLBB 1NK8A 4FK0A 1U4BA 4CJKA 4URSA 4DL7A 1UA0A 1S9FA 3MEGA 1QHTA 5KG2A 2D3UA 4Z4EA 1FKOB 3BJYA 4ZVEA 4QWEA 4J9QA 4EO8A 4ZMMA 3HJFA 2YNIA 1IH7A 3DLBA 3DOKA 1SV5B 2HMIB 4CIFA 2VG5A 4Y2AA 4Q8EA 3MECB 4DU1A 3MR5A 4YNQA 3SQ0A 4IRCA 1U48A 3GIKA 1S9GB 1S6PA 3DRPA 3IS9A 1XC9A 4J9NA 4Y1DA 2E4LA 3MR3A 1HYVA 2BR0A 4YMEA 4MIBA 2B6AB 3BSAA 1EXQA 1NK4A 1LWFA 4QWCA 4DF8A 3OYLA 3NBPB 3PO4A 1HNIB 2KQ2A 2XRIA 3TAQA 2I5JA 2YKMA 4WZMA 4FZZA 3NF9A 4DQSA 3QIPB 3GV5B 3PW7A 3KLGA 3DLRA 2R8HA 4JS5A 3HP9A 4OLAA 1YT3A 4Q0BA 4DSIA 3OYBA 1RA7A 4F4YA 2E6LA 4FLVA 4YFUA 4RW6A 5DG8A 3SZ2A 5SWMA 4CF0A 4O4GA 1RT7A 3NAIA 5JUMA 3P83D 3IRXB 3TABA 1TL3A 4DFJA 4O0IA 4AHUA 4CJ3A 4PWDA 1TK5A 4ED8A 3KMSA 1S0MA 1JLEA 4IFYA 2HNZB 2QKKA 1NJXA 4EBEA 5KRTA 1NK9A 3ISND 4ECWA 2HHSA 4ECVA 2BE2A 2OPSA 3CJ5A 3O4QA 2YNGA 4KTZA 3KLHB 4IQXA 2IC3B 3KLEA 3QZ7A 1RT2B 4PQUA 3M9OB 3RMDA 5KTQA 3HHKA 1W9HA 3IGNA 3DLKB 1BHLA 4DQIA 3DLGB 5KG7A 3QIDA 1JLFB 2HW3A 4IDKB 4OL8A 3OLBA 5DQHA 3NE6A 3NGDA 1ZBFA 1RT1A 3ASMA 4DTOA 3AA2A 2RKIB 3CM6A 3DRRB 1KFSA 3KOAA 4BDPA 1KLNA 4H4OB 4MKBA 1LWEB 3RR7A 3ITHB 4I9QA 5KFEA 3RMBA 2F8SA 1XWLA 4Q43A 1BL3A 1FXXA 3QEPA 3L3VA 3K5OA 3RWUA 1EP4B 3AVMA 3DLHA 5L1IA 4MK9A 3BGRB 3TAMB 1T05A 1C2PA 1GOAA 3QEVA 3TAEA 3QGGA 3KTQA 4ECTA 3L3UA 1RT3B 2DPIA 1TAQA 4CGDA 1RILA 4CGGA 4DS4A 3TAFA 4FYDA 3MXMA 2W9BA 3V6DB 3C6UB 3GV8B 4FM1A 1IKVB 1D0EA 4OKEA 3M8QB 5KT3A 4J2BA 3V81B 3JYTA 3IGVA 1KTQA 1K1SA 1Z25A 3OYEA 3MEDB 3I5AA 1WSEA 2OPPA 3SQ1A 2DTUA 1KVAA 1GX5A 3SPYA 5DGAA 3OJSA 3TQ1A 4RW4B 4CEQA 4ZPBA 4J9LA 2DPJA 1DTTA 2KTQA 1T03A 1QSSA 4CFBA 4CIEA 3SYZA 4HYKA 4ED6A 4AHTA 2IJFA 1VSIA 2KFNA 3M8SA 1N5YB 3THVA 1KFDA 2XHBA 1TKXA 1TKZA 3ZSQA 1RDDA 1S1VB 4IFVB 2HHTA 1UWBB 2FLNA 4KHQA 2VG6B 4ECXA 1N6QB 4ZPCA 5KGWA 4FZXC 2W8KA 5KG0A 3JSMA 1K6YA 5J1EA 2OPRB 4CHZA 3T19A 5I3UB 4KE5A 1J53A 4O3OA 3PHEA 1QQCA 3NH2A 3CIZA 3CWJA 4ICLA 3V1QA 1S6QB 3NFAA 2KZMA 3PX6A 2D7SA 4O3NA 3DM2B 4YP3A 4WFXA 4NCGB 5J2MA 1X1PA 1HQUB 3N6LA 1QS4A 4H4MB 1QAJA 4B9TA 4KKOA 4LSLA 3BQ1A 4IKAA 3HVTA 5HRPA 3HXMA 4Q45A 4NRUA 3MXJA 4JRQA 4ECRA 2VG7A 4X2BA 4AHVA 4HUFA 5HRNA 3SUQA 4KRFA 4MK8A 3GQCA 4FJIA 4WE1A 5KG5A 3QERA 4IH5A 3IN5A 2FBTA 2XGPA 2HVHA 4URGA 3NCIA 3I0RB 2YV0X 4FLTA 4KPYA 4FLXA 3HK2A 2ETJA 3K58A 4K4SA 4MQ3A 4EYIB 4TN2A 1SL0A 2R8IA 4N56A 1BCOA 4KTQA 1YTAA 4E7HA 3E01A 3KKSA 4QW9A 4B9UA 1KVCA 2AGQA 4DTRA 1HPZB 1RTDB 1C0UA 4GC6A 5KFTA 2FJVA 2HNYB 4QWAA 4Z4HA 1IG9A 4IG3B 4K8XA 4RG8A 4M41A 3SV4A 3V4IB 3DMJA 2OZMA 3NH0A 2HHXA 5DK5A 3OHBA 1TP7A 1IM4A 1TL1A 4I2QB 1JL2A 4PUOB 3BDPA 1RTJA 3TI0A 3V9UA 2NUBA 1DTQB 2G8IA 2E6MA 4W5QA 1WAJA 1RT5A 4ED3A 2ZD1B 2DFFA 5L1LA 1WSIA 4NLPA 1IKYB 4TY8B 5KFPA 3AVNA 3CM5A 4ZP6A 4G1QA 5CYQB 3H40A 2OYQA 3LPTA 3IG1B 1JX4A 4FJ8A 4EYHB 3Q8SB 3HVRA 2R8GA 3KJVA 4CE9A 2E9RX 4C8MA 2JC1A 3FDSA 4Q5VA 4K4VA 1RNHA 4HCCA 1SUQA 3QYYA 4C8NA 1KHWA 2XI2A 5KFKA 4L8RB 4J2DA 5K14B 4K50A 3ALYA 1Q8IA 3PY8A 1YVFA 5HP1A 1FKOA 3TVKA 3SI8A 1KHVA 1CZ9A 1SKRA 4DL6A 4FJXA 1F21A 1SV5A 2YKNB 4CFCA 4M94A 1JLCA 4CGHA 1X9WA 2IM0A 2D0BA 3SI6A 1U49A 3ZSYA 4CHOA 5KFIA 3QGIA 3OYNA 5KRSA 5C25B 1HMVB 5EDWA 3RR8A 3HKWA 4RU9A 1S9GA 3QLHA 4KV8B 3TR8A 3OYKA 3MR6A 4CEDA 4I2PA 3E51A 4M3WA 1WLJA 3BREA 3SUPA 1TGOA 1S5JA 5KG1A 2B5JB 5HROA 3GYNA 3HT3A 4YR2A 5HBMA 4NLQA 3AO3A 4KTWA 2CJQA 2E9TA 2B6AA 3D5MA 5JS1A 4G3IA 3M8PB 2R2SA 4IBNA 1BQNB 1YTUA 5J2NB 2IA6A 2IJNA 4NLVA 3MTKA 4O3PA 1RTIB 5KFCA 4K4TA 1HNIA 2AX0A 3F73A 3KHRA 2BQRA 2D0CA 4TQSA 1LWCA 4DSEA 5KFWA 2Z1IA 1ZBIA 4ECQA 5L9XA 4DSJA 5F8MA 4KO0B 2IDOA 4KHYA 2V9WA 1J5OB 2WK4A 3K5MA 4ECYA 5KFNA 3HO1A 4K4ZA 1NOZA 5EWGA 4EP5A 1D1UA 2FLLA 1RYSA 5HRSA 2VWKA 3AVKA 1S9EB 4URQU 1HYSB 3LP0B 1RT4B 4DLGA 4M3XA 1T7PA 3CG7A 4CHYA 2FVPA 3KLFA 4NLWA 1W25A 2A1RA 4B9VA 3L2QA 3VQSA 3UPFA 5KT2A 3FFIB 1Q9YA 2ALZA 1TVRB 2HNZA 3LDSA 3AVIA 3LZIA 2RF2B 1OS5A 3H5UA 4Z4FA 3GV7B 1QE1B 3ZSOA 4DS5A 3KLHA 5KFAA 1RAJA 3LP3A 2Z1JA 3CJ2A 5EWEA 1SL1A 1RT2A 3MXIA 1JIHA 2V4RA 4E89A 1TV6B 2FC0A 4R8UB 3AO5A 4J9MA 3OYMA 3DLGA 5KFUA 4IDKA 4KSEB 2UVUA 4BDYA 4NLXA 4B9SA 3NGYA 3OS1A 3RTVA 4W5RA 3PW4A 3QO9B 3DRRA 2XCPA 4H4OA 4DL2A 4Z4CA 3H5SA 2D3ZA 5JXSA 3QNOA 3G6VA 4FBUA 2AGOA 1HNVB 4CFAA 1S48A 4MK7A 1O1WA 3OYIA 4F50A 4DU3A 1EP4A 5J2PA 1BIZA 4RW7B 4QWBA 5I42B 3RRGA 4NCAA 4ZVGA 1ZTWA 4ZP7A 2B4JA 1VRUB 3TAMA 3F9KA 3A2FA 4DQRA 4IH6A 1RT3A 5KFBA 3NH1A 4RW8B 1LW2B 3UQSA 4KAZA 3O4NA 3OYFA 1BQMA 4J2EA 3RMCA 3KMQA 4IH7A 2HNDB 1CSJA 1IKXA 2VA3A 3ZCMA 5T7BA 4F2SA 3KKRA 3LP2B 3ZT2A 5C42A 3EPIA 4CJ5A 3QZ8A 3QEIA 3QNNA 1C1CB 5FROA 3AA3A 1HQEA 4DTNA 3G0ZA 4CEEA 1JLGB 3H4BA 1L3TA 2BGGA 4M3ZA 4YR0A 4EEYA 1EX4A 1NK7A 5KFFA 3N6MA 3Q8PB 3T5KA 3C6TB 3SUNA 4KI4A 3P5JA 2UVVA 2IOCA 2G8WA 3S3OA 1S1XB 4CJEA 3DOLB 1N5YA 2FVRA 3I0SB 3EZ5A 4LY7A 4Z4GA 1S1VA 2BQUA 4IFVA 3QETA 3BQ0A 3V6KA 3RB6A 2XCAA 1S0NA 4EBDA 4IRDA 4ED0A 1C0MA 2VG6A 4B8CA 1NK0A 3NMAA 2JEGA 3MEEA 2F96A 4LQ3A 4EO6A 3O3FA 5FDLA 1VSLA 4ID1A 3LP1B 3FSIA 1IKWB 5J2QB 3HL8A 4CEAA 2PYLA 1QTMA 1RA6A 3PZPA 3G86A 3LPUA 2BANA 4Y34A 3L2UA 4HUGA 3PW0A 4FJLA 1FKPB 4H54A 3DLEB 1HQUA 4CJSA 1D9DA 2YNFA 2G8FA 2WOMB 4DWIA 3DI6B 2VA2A 4KFBA 2C22A 3HM9A 2P1JA 1EETB 3KHLA 4NLSA 3H5XA 1BISA 1ZTTA 1HYZA 1FK9A 2WCXA 4RUAA 1WSHA 3C95A 3CJ4A 4CFDA 4JV0A 3EPGA 1VSJA 4FW2A 3L8BA 2GBZA 3VQ9A 4EZ6A 5KFJA 3KK3A 5C24B 4CJRA 3NHGA 1QSYA 1NOYA 3NF7A 4K4UA 4HVJA 1X9SA 3I0RA 3VQAA 3V1OA 4K8ZA 1LW0B 3MEGB 5EU7A 5F9LA 4PY5A 2YNHB 3MFIA 4DEZA 4DSFA 3AVFA 1U04A 2YNIB 1RTDA 3QIOA 4JRPA 3QESA 3SUOA 3PJWA 4CF9A 4CEOA 1QAIA 3RMAA 4IG3A 1ASVA 4J2AA 2GC8A 3HPOA 4MKAA 3L2RA 1NHVA 4I2QA 3Q8RB 2C28A 4FCYA 3S3NA 4JV2A 4PUOA 2XY5A 3LANA 4GVMA 1RT6A 1TKTB 2W9CA 1LWFB 4QPXA 3CDWA 2OZSA 3V1RA 4KHUA 5CY4A 3OYCA 4KHSA 5L1JA 4LD0A 5KFLA 4O0JA 4KHNA 4ECZA 1I3AA 1JXLA 3LAMA 3B6PA 4KHMA 2D5RA 3IG1A 2XY7A 1JKHA 3CVKA 1VRTB 4XO0A 4Q0BB 1ITGA 1B9DA 2UVWA 4NRTA 1WAFA 2IMWP 4R5PA 2EX3A 4AHRA 3TAPA 3RB0A 4CGFA 2WB4A 1A5WA 4O4GB 1RT7B 3RBDA 2X74A 1GX6A 4EP4A 4FJ5A 1VSKA 1S1TA 3LWLA 3VQEA 5C5JA 4AHSA 2HHUA 3OHAA 4NLDA 1QSLA 4CF1A 1JLEB 4ZP8A 2W7PA 5C25A 1HMVA 3CFOA 1S1UA 4KV8A 3VQDA 3AO1A 3KLIB 4CK2A 2BE2B 4GW6A 2OPSB 3O3HA 3KHGA 2B5JA 3DYAA 4CGIA 2KFZA 5FRMA 4NCBA 4F3TA 4WYWA 4RNNA 1ZBLA 4I9LA 2OH2A 1WSFA 2BQ3A 3T3FA 2KW4A 5J2NA 3AVCA 1LV5A 4JLHA 4B9MA 3GIMA 2IGIA 4F4WA 2AWZA 1REVA 4ED2A 4ED7A 3HVAA 4FJJA 3OYGA 2O4IA 4Y1CA 1RT1B 2ZE2A 3VA0A 4RZRA 2CKWA 2R2TA 3OS0A 5DG7A 1ZBUA 3LP0A 2RDJA 3UIQA 4IG0A 1QUVA 2GUIA 3BSOA 3D45A 4UQGA 2FJXA 1Z4UA 1N56A 3QEWA 1D5AA 3LZJA 3AVGA 3OSPA 2AQ4A 1RCHA 2Y1JA 1T05B 2R8JA 5KFDA 4U6PA 4QCLA 5F8GA 3NAHA 1WNEA 3U3YA 1TVRA 3TAGA 3H59A 4RUCA 2W9BB 3NKYA 4FM2A 1NKCA 4DMNA 1R0AA 5KT5A 4O3SA 1QE1A 5CYMB 1C0TA 4IRKA 4LH5A 4OVLA 3JYTB 4LQ9A 4Q44A 1MU2A 2G8UA 4CJWA 1TV6A 3KK2A 1NHUA 4M45A 1SKWA 5HLFA 2ASJA 3QGHA 2QE5A 1JLBA 4DTMA 3TARA 1U47A 4HUEA 4XPEA 1NJZA 2B43A 1DTTB 5EWFA 3KD1E 1EKEA 4IR9A 5D3GB 1HARA 3QO9A 2JC0A 3CFRA 1TKXB 1TKZB 4DTPA 3G10A 2JEFA 4E7IA 2JEIA 3SV3A 2HMIA 4N41A 1BGXT 4DG1B 3MECA 2OPQB 3VQ5A 4Y3CA 2BRLA 4ECUA 5J1EB 4PA1A 3MAQA 5I42A 3C94A 4NLGA 1VSDA 4E7KA 1VRUA 1J54A 1GOBA 4Z0UA 1J9AA 4E1NA 5KFZA 3DDKA 3NBPA 4FJ9A 4RW8A 1CXUA 3CQ8A 2GIQA 4CHPA 3KHHA 3PW5A 4YR3A 2XWYA 4BE0A 4RNFA 1TQLA 1BCMA 4F3OA 4KKOB 1RDRA 3S9HA 1JXEA 3VQ4A 3HVTB 3QIPA 4HKQA 4Z4IA 3G6YA 4F8RA 2HNDA 3PJXA 4DL3A 4DQQA 2X78A 2DFHA 3ZSXA 5F9NA 5DQIA 1YVUA 1Q9XA 1C1CA 3ZT4A 2A1SA 2C2EA 4WE1B 3H2LA 2D0AA 2WONB 2ATLA 4Y2CA 4MFBB 4O5BA 3U3GA 1RBVA 2WHOA 3PV8A 3WNFA 3SNNA 1RTHB 1N4LA 4CJFA 4NLTA 1ZYQA 3PVXA 3SJJA 3ZSWA 3AVAA 3CJ3A 3AO2A 2RDIA 1DLOB 1S1XA 2OA8A 3E01B 5KFGA 1XR5A 3I0SA 4DF4A 3GIJA 3IRXA 1XHZA 3OL8A 4F4ZA 1I39A 2VWJA 1L3UA 5KG4A 2HWHA 4FJNA 5L1KA 2E9ZA 1C1AA 4NYZA 3ICLA 1D8YA 3ZT3A 5T14A 3LP1A 3KNAA 5J2QA 3T5HA 5SZTA 4OGCA 3PR5B 4DLEA 1RTJB 1VSMA 1TAUA 4QAGA 2P5OA 3CFPA 2IC3A 5FRNA 2YHAA 3SFUA 4FLWA 4K4WA 3VQBA 1FKPA 3ZT0A 1XHXA 4ELTA 3HVWA 3DLEA 3L2WA 4I7FB 1D9FA 4ZTJA 2WTFA 4J9SA 2WOMA 4NLYA 5JS2A 4TSXA 4CEBA 3DLKA 4ZP9A 4W5NA 1JLFA 1JLQB 2XY6A 5KG3A 3OLAA 3OYDA 1B92A 2PZSA 2D41A 4JS4A 4F4KA 1RDBA 4ELUA 4DTXA 3VQCA 3KJVB 1B9FA 2RKIA 4CK1A 1RBRA 4KHRA 3GILA 2KZZA 1XR6A 3OYAA 3K57A 5C24A 1LWEA 3ITHA 3OL6A 1K1QA 1NKEA 4M3TA 2IAJB 3IAYA 1LW0A 1NK5A 4FLYA 4O3RA 3OVNA 5KGXA 2YNHA 2ASLA 3RRHA 5HP1B 3HYFA 2FBXA 3V9ZA 1XI1A 3KK1B 4E7LA 2XO7A 5HRRA 4CK3A 3BGRA 4XPCA 1UA1A 4CF2A 4DTUA 4CCHA 1JLCB 2RN2A 3VQ7A 2XY8A 2W8LA 3AA5X 1TK0A 3QLHB 4FW1A 3V6DA 4I2PB 3RB3A 2DFEA 5DLGA 4CJQA 4E7JA 3C6UA 5HROB 1IKVA 2FVCA 5HBMB 4W5TA 3PO5A 4DTSA 3AA4A 4B9LA 3M8QA 4N47A 3V81A 1TKTA 3DRSB 2F8TA 2G8KA 3MEDA 3WNHA 3D28A 4WFZA 4WYLA 3K59A 3ULDA 3AVJA 1RYRA 4RW4A 4AILC 1NNDA 4RW9B 5EUHA 5KFYA 3FQLA 1LWCB 1S49A 4ZHRB 4B3OB 1VRTA 4BWJA 4FK4A 1SH0A 1S1WB 4MIAA 3V6JA 4ZTFA 1UAXA 2F8EX 4FXDA 2QV6A 1UWBA 4FLZA 4IR1A 3KLVA 4E0DA 1BI4B 1N6QA 5KFQA 4U7CA 4C8LA 3SFGA 2OPRA 4KB0A 1ZETA 5I3UA 3KLFB 3BQ2A 1U45A 4FJHA 3N6NA 4RNHA 5KFOA 4J9RA 4O44B 1S6QA 2UUTA 1RBUA 1JLAB 3LWMA 4FJGA 3AVLA 3DM2A 4B8AB 4LSNB 4ID5B 1NKBA 1KRPA 2IBKA 1RBTA 4NCGA 3CDEA 3OJUA 3BR9A 3KLIA 3RB4A 4H8KA 2XI3A 4H4MA 3HP6A 3M9MB 3CYMA 3KD5E 4EBCA 1S97A 2UUWA 1MMLA 1VSHA 3K5LA 3VA3A 4NLRA 3MR2A 3NF6A 4EZ9A 4CECA 4TY9A 4K4YA 1C1BB 1KLMB 3AVBA 4M3UA 4CESA 2C2DA 2XC9A 4C8KA 3NL0A 3NF8A 3ZSVA 4DFPA 5KFHA 4J9PA 5F8HA 3GIIA 1Z26A 4CJTA 3FQKA 3EY1A 1T8EA 2ITGA 2O5DA 4FZYA 4B9NA 4GMJB 1HPZA 4BACA 4KREA 3DOKB 1A5XA 2EHGA 2VG5B 4OKKA 3SCXA 2HNYA 4O55A 2BDPA 3FRZA 4F4XA 5E41A 2BRKA 4XIUA 5J2PB 1S6PB 3DRPB 3IS9B 3V4IA 2FVQA 4CERA 1VK0A 4NYNA 1T94A 3OS2A 4BE2A 1DTQA 4O3QA 4CEZA 2Y1IA 1WNSA 1SH3A 3WNGA 3T5LA 2LSNA 2RPIA 2R2UA 1GOCA 4IKFA 2ASDA 5DLFA 2ZD1A 1BIUA 4ZPDA 2P51A 3L2VA 4N76A 1BQMB 1IKYA 2I5JB 2YKMB 4TY8A 3ZT1A 3RAXA 4CIGA 5CYQA 3EYZA 5F8NA 5CYMA 3SQ2A 2V4QA 5KG6A 3KLGB 1IKXB 1KCFA 4CEFA 1L3VA 3CJ0A 2R8KA 3VQ8A 5C42B 4DU4A 2JEJA 4E1MA 3HPGA 3PUFA 1HQEB 4DL4A 2Z1GA 4KAIA 3V9SA 2HB5A 1XR7A 1X9MA 4RW6B 3Q8QB 3H4DA 4FJKA 3ISNC 1S0OA 4KB7A 5K14A 3O3GA 2PY5A 3CDUA 4CF8A 4M42A 5D3GA 2FVSA 4OLBA 2R7YA 1RBSA 1SKSA 1TL3B 4JUZA 3LALA 2YKNA 3V9WA 4PWDB 5DQGA 4DG1A 2OPQA 4M3RA 3MEEB 4IFYB 5FDLB 3BSCA 2GV9A 3NGIA 4ZVHA 3NGZA 5F8LA 5KT7A 4CJLA 4KB1A 3M8RA 4AH9A 4NLOA 4ECSA 2YNGB 3BSNA 4Q8FA 2BANB 4TQRA 4FLUA 3KLEB 3D0PA 3M8PA
chains in the Genus database with same CATH superfamily
2HHWA 4PQUB 2W42A 3BPSP 3OXFA 1T3NA 3OSNA 2HK3A 4C11A 4ZN1A 4N5SA 1KQFB 2MKIA 4CHQA 1XIQA 4BG8A 1FK9B 3BZQA 2V0NA 3R3TA 4OYWA 4OHXA 3QFWA 1IO2A 4WTOB 5AXLA 2W7OA 2C3MA 1WSJA 3D3CJ 3R9LA 5D78A 3K9KA 1U1KA 1V6HA 2UVRA 4QWDA 1S9EA 3UDEA 1HYSA 3NWRA 4XAKA 1RTHA 4BCAA 1TU0B 2CPEA 3D1QA 3K5PA 4WK1A 3TWZA 3J7ZO 4BE1A 1LAWA 2GX9A 1DQAA 3UVJA 5CXTA 2OTJS 4WXWA 2GVDA 3AD7C 1P9QC 3CO0P 2FBVA 3MAAA 1QJHA 3J7YU 3FFIA 3KVGA 2QWNA 5F8JA 2DY9A 2CG8A 5GAHI 3CDAA 4CZLA 5FD1A 3UDLA 3LGHA 5ETRA 4XH1A 1S4FA 3PW2A 2NQPA 1SQGA 3QMLA 1RT6B 5CZ2A 1OPIA 2V8GA 3IBWA 1J5EF 3FSXA 2CPDA 1BUPA 5E2QA 2UXDJ 3PYFA 5IOLA 5GINA 2J9EA 5D8HB 3AOCA 4BS2A 4FDFA 5HSPA 1JKHB 3UCZP 5GADP 3CCMS 2X6SA 4IZ9A 1Y5IB 2KVQE 1RAGB 2J8SA 2DXDA 1GH8A 2NNWA 2W9AA 2GX8A 5BPLA 3D7SB 4DV2F 2IS3A 4OHYA 3BGLA 4NXNF 4ELVA 2WRMA 2QMWA 3HPHA 2ZJQQ 2QL9B 2HVZA 3NCRA 4QOZB 5F3TA 2YJFA 1YRTA 1WN7A 2ZKUA 3VQ6A 1IQZA 3CIMA 4ZDNA 4B1ZA 4RW7A 3KK1A 1NPRA 4M5LA 2ZVSA 4NLUA 3RBEA 1YX2A 1SI9A 2X7IA 1L3SA 3UO0A 2OD4A 3L4QA 5ITHA 5JLHA 1NJWA 3B54A 5H1SV 2QKBA 2AP6A 2VICA 4R0EA 3DYAB 4LSLB 5BRHA 3U6FA 1EB0A 1RFQA 2CZ9A 3BS9A 4M95A 1H1VA 5HL7Q 2ZH4A 3K2PA 5IS2A 4J9KA 2N3LA 5EX0A 1AYEA 2J4RA 5JVHQ 2HHHJ 1GLAG 1KOOA 3L09A 1JLGA 3SAFA 3LPYA 4RW9A 5AQKA 3MF5A 3TJAA 1WSGA 1VSFA 4DFMA 4CZMA 4DHYA 3LAKA 2LDYA 2ZE2B 4NZ7A 1X0FA 4CJPA 4X65J 3EVOA 4CWBA 4NZ0A 3MPYA 4ZIWA 1R8PA 2VBYA 1QHAA 4FJ7A 2XG8A 1FT8A 5AQXA 5IFMA 3LPEA 1N33J 3LA0A 1UZHA 4FOIA 3ZSZA 4QU7A 3ZSRA 3DMJB 5JVGL 3I8DA 1X4AA 3LH2S 1X5PA 1VQ6N 2M2BA 2KDOA 2NXCA 4UY8O 5LL6d 3M9NB 4Q7AA 4RX6A 5EOYA 4E19A 1X9JA 4I6MA 4ERDA 1RT5B 3ZTRA 3PM9A 4BWMA 3BDEA 2AYGA 4DV5K 1R0AB 4G1QB 1MMDA 1CQMA 3T1HJ 1I94K 3NDKA 3H7HB 4JI6K 3LDLA 4ES1A 4RTFD 1LAVA 1Z1ZA 1RLCL 4LFBJ 3OT9A 3OL7A 3EX7B 1FDAA 4CJUA 2PYJA 3GIRA 4OPKA 1U6BA 1KLMA 1C1BA 4YQWA 2XNRA 4CBWA 5HLFB 2QN6B 4BDZA 1SUQB 4J9OA 5KI6A 4LF7K 1PBUA 3MM9A 1U4BA 1R0BG 1TL7A 4BREA 3IMQJ 1QHTA 3FGUA 3H3OB 2ZBRA 4OX7A 2M70A 2PSZA 5CHIA 4ZS6A 3BN4A 4ZVEA 2UXCJ 1RWPB 2YNIA 1IH7A 2E1MC 4CIFA 4XDDA 3JAMO 1SB6A 2E5IA 2V7YA 5AR0A 3GIKA 1S9GB 3DRPA 3RYLA 1V4TA 3VEYA 2CQCA 4J9NA 4HR2A 2RHQB 3J81j 3VR1A 4QPTA 4YMEA 4MIBA 3CCLS 1CC8A 3TTCA 1NK4A 1UP1A 4QWCA 3GFXA 2M8DB 3HHDA 4G65A 1HNIB 1FESA 2YWKA 2XRIA 3WQPA 2I5JA 3AA8A 1SC3B 5ETMA 3QIPB 1TYQB 1NM1A 4FYWB 1VQ9N 3FK4A 1YT3A 4F4YA 5AQRA 2E6LA 3NNAA 1NBEB 2GJIA 3TSPA 1Q86T 1NPKA 2P6TA 2B0GA 2C2KB 1QAYA 3QFUA 1BDGA 3U4LA 3CCQN 3FMBA 4CNZA 3BKUA 2OEMA 5JUMA 4LR7A 2RQ4A 2W1BA 4ZVRB 3P83D 5H9FK 4DFJA 4JI3K 1VQOS 4X62K 2DGQA 1MDUB 3PIOL 4CJ3A 1OYEA 1S0MA 1F3VA 2DGOA 5KRTA 3N28A 2QMXA 4B02A 3PRBA 4ECVA 1YAGA 3OTDA 4YOYA 4X66J 2YNGA 4KTZA 2O66A 3VAMA 2DHXA 1RT2B 4DZDA 3RMDA 5KTQA 1KBRA 1VQNS 4NO7A 3M32A 1O8BA 2CRLA 1W9HA 3DGPA 2AP1A 3DAWA 3A8IA 3CCWA 2LVWA 3W9HA 3DLGB 5M1OA 5DQHA 1RSCA 3MX2A 1ACMB 3IM9A 1TZ0A 3J7YI 1A7GE 3MCOA 4DR4J 5AQLA 4DTOA 3CM6A 4RWTA 2CPFA 4OJ1A 3ITHB 2WFBA 1VJWA 2V63A 1XMOK 4Y2MA 1UETA 8AT1B 2MSSA 2G9OA 2C2MB 2LU1A 1C4CA 1OY6A 2RDDA 3RWUA 3AVMA 2V8PA 2Y8YA 4CM0A 2GQQA 3SAGA 5JLFA 4CIOA 3QRPA 2DNZA 1GOAA 3TAEA 1Z2ZA 3QGGA 3CCVN 1RT3B 3DXMB 4CGGA 3EKSA 2DGTA 2QLBB 2W9BA 4IWVA 1CG2A 2YVSA 1WJ9A 1YBUA 4F25A 3RG6A 3C6UB 2WW4A 3GV8B 3OFFA 4FF2A 1IKVB 2XMUA 4CO4A 5KPTA 4OKEA 1SJFA 2Q6CA 4FNIA 1K1SA 3LQVA 3J7A1 4OX8A 9ATCB 3C19A 2NUHA 4TNOA 5DGAA 2GFFA 4J9LA 3U1NA 2D69A 2YY3A 4CIEA 3SYZA 4ED6A 1F9FA 4AHTA 1RAFB 1VSIA 3M8SA 3DFEA 1KFDA 4CLLA 4ZLJA 4YB6A 2MKSA 1UVLA 3EXYA 1TMMA 3BGOP 3ZO7A 4FPAA 4B9QA 1NJIO 4ECXA 1Y0HA 3HOTA 2LXUA 3CPEA 1J5EJ 2QEXN 1FO1A 4IFEA 3AAPA 2NRXA 3H2VE 2V2KA 3Q24A 5FPEA 2P9IB 3ZC4A 2VDHA 3WXIA 4DV5F 2KZMA 2AA4A 3PX6A 1I94F 1F3FA 1CQNA 3G8SA 3NG8A 4JI6F 3PTWA 4EU0A 3GDQA 1WF2A 2EBEA 4WFXA 1UKUA 1OQ3A 3E1YA 1ITPA 3FBBA 5M1FA 4H4MB 4DV2J 2HFOA 1X5TA 5DO2A 4NXNJ 3HVTA 1X4GA 4DMZA 4LF7F 1YJ9S 3FLCO 3HXMA 4NRUA 2VG7A 3DNCA 2DGUA 5KG5A 3QERA 4ZLLA 5GADU 2AYEA 3IAS9 1WACA 4B17A 3NCIA 2OEKA 3EE9A 3FSYA 4J5OA 1VQLS 4TN2A 2CUYA 2R8IA 1BCOA 4KTQA 5AXKA 2KT5A 3E01A 4MO5A 3QRQA 1RTDB 1IG8A 1C0UA 1H2TZ 4JN4A 2HNYB 3O44A 4LFCK 1WC6A 2UUAK 2ZH3A 4LIRA 2IPOB 4K8XA 1NRKA 4RG8A 2KXNB 4YDXA 2Y0BB 3V4IB 3NH0A 2XULA 1TP7A 4I2QB 3BDPA 1UTAA 4FXVA 3GMGA 1DTQB 3DKDA 2G8IA 1A6LA 4O8UA 1YF5L 1WAJA 1YK9A 2CPXA 1WEXA 3DLJA 2DFFA 2BM0A 3CC4N 5KFPA 4ZP6A 5CYQB 3A4TA 3LPTA 1WI6A 3QBCA 2VJUA 2APOA 3DXKB 1JX4A 1QVGM 3Q8SB 3HVRA 1YUWA 4EFHA 2CDQA 4CP5A 1NDCA 1J2VA 2HK2A 3M1FA 2V9KA 4JI2K 4JHDA 3MM5B 3QYYA 1KHWA 3CD0A 1FRMA 4NA2A 4JI3F 1MG7A 5M1NA 3CB4A 3PY8A 4X62F 4YDDB 3C7NA 2HZVA 2QM1A 1FKOA 4OHZA 2HBJA 1MLAA 1KHVA 5AQHA 4BC3A 1MWMA 1SKRA 2Z2ZA 4H0YB 4FJXA 4CFCA 4CGHA 4UOCA 2D0BA 2H4YB 3SI6A 4CHOA 3OYNA 3QGIA 3OD2A 2XHWA 3ET6B 5EDWA 1PJ5A 1T02A 3MR6A 4CEDA 3E51A 2RE1A 4DHVA 2V69A 5KG1A 2B5JB 5HROA 5HBMA 4EHTA 4KTWA 2QWMA 3UNYA 4OHWA 4P74A 1LK7A 2IJNA 1HW8A 4O3PA 5EHHA 3P4IA 4NXMK 3F73A 4WFNL 4L3KA 4M5HA 2K2PA 1RUSA 2BQRA 4CD3A 2D0CA 1WORA 4TQSA 4OJGA 3O8WA 4ECQA 2LCWA 4Z94A 4DSJA 2OUGA 4KYZA 4KO0B 1XMOF 3WC2A 3THWA 4KHYA 3IWNC 1J5OB 2WK4A 3K5MA 1XMQK 1M5VC 1FCAA 5F0XA 4AYBD 4URQU 3LP0B 1RT4B 1T9WA 4DLGA 4QYRA 3GR0A 3L7UA 3C46A 1KQGB 3SBMA 3Q8UA 3TA2A 2ITMA 3E3XA 2EXUA 5AQSA 4CHYA 3HX9A 3KG4A 3KLFA 2O3DA 5JVGQ 4OYZA 1W25A 3BM7A 4B9VA 2EFGA 3C16B 2F7VA 5LXRA 2JWKA 3LDSA 4JYAK 3CJ7A 3MM6B 1ULRA 3CJRA 4PPDA 3H5UA 3DXBA 3DWLA 2CAJA 1PAEX 2AJ1A 3KLHA 1RAJA 4CO0A 2V50A 1SL1A 2V4RA 1FEHA 4E89A 3CJ9A 2GMJA 4DCJB 4LF6K 1HX1A 2KKHA 2RILA 2CPIA 3BR8A 5C2GA 2CPYA 2G4BA 4IDKA 4KSEB 1K8AO 4NLXA 3HZ6A 3OS1A 1R8BA 3RTVA 3QO9B 4KGKA 2MMYA 3N4PA 1JJCB 1YQHA 1P8ZA 4IEIA 4Z4CA 2GHPA 3H5SA 3AQPA 3N4WA 3L0QA 4I1TA 1HNVB 2VQFK 4MK7A 1O1WA 4DDFA 3CULA 2A2CA 1VMBA 4ZVGA 3TAMA 2MHEA 1UJ6A 3G71S 3E2EA 4DQRA 3M7VA 3CD5A 2GGPA 4IH6A 1Q8KA 1SQEA 3ZZOA 2P9KA 3I9ZA 1ZC6A 4AFFA 3MWTA 3GONA 2KH9A 3CCRS 3ID6A 1APSA 3O8MA 2HNDB 1FW6A 3ZCMA 1KR4A 4F2SA 2D0OA 3EPIA 1FERA 2N4CA 5FROA 3AA3A 2RIJA 3H20A 2NRRA 1RAHB 4V19X 1L3TA 4B3TK 2AZ3A 3GZ7A 4YR0A 4EEYA 3UFCX 4BVPA 3N6MA 3Q8PB 3C6TB 3P5JA 2G8WA 2O67A 4Y28C 4LFCF 5KPRA 2UUAF 5ETQA 4LY7A 3D6RA 2BQUA 3QETA 3U7JA 3RB6A 3I4PA 4EBDA 4HEA9 1VJQA 4ED0A 1C0MA 4C1NK 4BG9A 1X4BA 4LQ3A 3MCPA 2J9DE 3PIOQ 3O3FA 3X3UA 2PEBA 4ID1A 4K41A 3QPIA 4CEAA 1RCOB 1RCXB 1RA6A 5HQ8A 5GADI 1GMUA 2BANA 4FP9A 4OYPA 3EL2A 3L2UA 2ACYA 1ZXOA 1HQUA 3K17A 4B1WB 1N8RO 1D9DA 3D68A 2HBRB 2XYGB 1EETB 4OI4A 1FK9A 3H8YA 4OZ3A 4OQJA 4RUAA 4JI2F 2U2FA 1WSHA 3C95A 4FW2A 3VAGA 2AD9A 3L8BA 4CT8A 2N82B 4XH5A 3D1HA 1NOYA 2QLJB 4HVJA 1X9SA 2ROEA 4HTLA 3V1OA 1LW0B 4DV5J 5EU7A 4PY5A 4PR6A 3VENA 4AT1B 1I94J 3HI9A 4JI6J 4ITSA 3MFIA 2KXFA 4DEZA 3IXQA 4DSFA 2L41A 3POTB 1W7WA 5K9FA 1VBXA 2KVIA 5EXWA 3PJWA 2RQCA 1KQKA 3RBXA 1ZM4A 2D9OA 4LF7J 4L72B 4FWSA 2PEHA 3K2YA 4MKAA 3Q23A 4NXMF 4CLYA 2CYYA 1G6BA 3A1YG 1RT6A 1TKTB 2G2OA 3BGUA 4ZPVR 4C6AA 3SLCA 4KHUA 2BH1A 5CY4A 3MCSA 3M1VB 4ECZA 3W7BA 1I3AA 3CD6S 4BRLA 3LAMA 1XMQF 1DHMA 2CQ3A 1FFGB 3IG1A 4JI4K 2XY7A 1JKHA 4JI0K 2KLAA 1PYTA 4O0NA 5AE1A 3E8OA 4Q0BB 2HRYA 2RHSB 2HQ3A 3ZNJ1 3H1VX 2UVWA 5SUHA 4M5NA 1F1BB 2Z2MA 5AQGA 4PHTX 3ZTPA 1HJOA 1NSAA 1A5WA 1SJQA 3WHIA 5LJVA 1RT7B 3MPWA 1JCFA 4I6AA 1KN6A 4FJ5A 5AZJB 4JYAF 3FUYA 4NLDA 4R25A 1BWEA 1K47A 1AROP 2DXFA 2CJ9A 1JLEB 4FXWA 3CD6N 2BM1A 4KV8A 3KLIB 2VPXB 2BE2B 3MR7A 4N8OA 4GW6A 4LF6F 3DYAA 2KFZA 5AZIA 3FCWA 2JWLA 3FZ2A 2P9GA 1SIWB 2VB6A 4I9LA 3OXLA 5H9FJ 2JFKA 4JI3J 1VBZA 2PI5A 3T3FA 5J2NA 2KW4A 3IA0A 4X62J 2CVIA 2D0PA 3VHQA 1YZ7A 2O8DB 2OTLN 4NPOA 2GNKA 2IGIA 2AWZA 2Q0UA 2P9NA 2O4IA 4Y1CA 1RT1B 2ZE2A 2W2QP 2YKPA 5TKYA 3RSEB 3DXSX 3SCIE 3D6FB 4RZRA 2VQFF 2CKWA 1ZBUA 4YB5A 2F4FA 1VLYA 3G82B 2CH6A 5F3ZA 1CBKA 2EKNA 1QDUB 1HI0P 1H7WA 3LZJA 2P9EA 2AQ4A 1UJ5A 4EMDA 1T05B 4DOZA 2RRNA 4TU8A 5KFDA 3PRDA 4H4KA 1JNRB 3CC2S 3DU5A 1REGX 3TAGA 1XMOJ 2KI2A 5CAAA 4RUCA 3H90A 4LRCA 1YBTA 3FMWA 1R0AA 1QE1A 5CYMB 3TNVA 1SZ2A 4LQ9A 4B3TF 3ZNUA 2G8UA 5H9EK 1T9VA 1EWRA 2AW0A 5LL6Z 3N5FA 5HLFA 1VQ4N 1VYAA 5D4LA 4XPEA 2MDAA 1DTTB 4DR3K 2RT3A 3M8WA 4W98A 2P6SA 2VZ9A 3TUJC 3IAM9 3SMPA 1W97L 2JC0A 3MUMP 4NZ6A 4DTPA 4X64K 2GQ2A 3SV3A 2V7ZA 3AJ1A 1WTFA 1TUYA 3VQ5A 2ZC3A 5K8MA 4PQAA 2BRLA 3MAQA 5I42A 3C94A 4NLGA 4F26A 2MHNA 3CIPA 1VRUA 1WC0A 1J54A 1GOBA 4Z0UA 1J9AA 5A2QO 4ENOA 3LDNA 2V4JA 2K8GA 5BR9A 2RE2A 2P8IA 1XN9A 3DDKA 4FJ9A 2GIQA 2XWYA 3ZEUA 4JEPA 1YXQA 1JXEA 2A18A 3QIPA 1TYQA 1AUSL 4F8RA 4DL3A 2ZHAA 3IM8A 4IUFA 1Q9XA 2A1SA 4WE1B 2WONB 4Y2CA 3GG4A 3WNFA 3SNNA 3EVWA 5FLXY 2GW8A 4NEZA 4CO2A 2H65B 3Q86A 2MZJA 3DU6A 3GB0A 1NSPA 4PXCA 4DF4A 4F04B 3TSUA 3UD4P 5KG4A 4M7XA 3M8ZA 5L1KA 2E9ZA 3HBTA 5BN9A 3W0LA 1ZS6A 4NYZA 5C2FA 2GWJA 3R1XA 4C0BA 2Y8WA 1NDLA 2FQQB 4OGCA 1PBAA 2CNKB 4NI2A 4PRFA 3N4QA 3VAKA 1RTJB 2FPHX 3MMVA 3M2UB 2GJ2A 2B9WA 3JS9A 1FKPA 2JOQA 5A8KB 4JI4F 1UVJA 3DLEA 4JI0F 2PC6A 2NLXA 3L2WA 4I7FB 4LFCJ 1JXVA 4ZTJA 2WTFA 4PYDA 1M1KO 2UUAJ 1IJEB 3W9IA 3CERA 4W5NA 2XY6A 2E2OA 3HLUA 1HBOA 5KG3A 2WW8A 1B92A 4ID8A 1S79A 2PZSA 4F4KA 3DDNA 3BO3A 1H7XA 1S72N 1RBRA 4OI6A 3S1TA 1XR6A 3K57A 5AJ3K 3ITHA 1K1QA 2ALYB 2EC2A 1E3MA 4RWXA 4WU2A 3P38A 2FBXA 3HMJG 1B3TA 2LXIA 4ISEA 1UA1A 2DITA 3W5XA 2BOPA 4CF2A 3I55N 4CCHA 3SAHA 4GVLA 2IVPA 3BYPA 5C7PA 4JI2J 3DXMA 1TK0A 4FWMA 2GZOA 2KT3A 3GLJA 2DFEA 5DLGA 2Z56B 1O13A 3C6UA 2ZF5O 1VK3A 2EBGA 1IKVA 3PO5A 4DTSA 4B9LA 1F9HA 2F8TA 1PGZA 1FE0A 1RHQB 4TU9A 1EX8A 3CCES 4WFZA 1RYRA 1G1XA 3PYDA 4H5WA 3B8AX 3FQLA 4WP8A 4F67A 1S49A 1RXOB 4IO1A 4B3OB 4BWJA 3EGWB 4A8YA 2FGOA 1SH0A 3LW5C 1YI2N 1S1WB 3U9DA 2M7SA 4ZTFA 2ZNYA 1NO8A 3KFWX 3OXGA 4NEYA 1G99A 1BI4B 3TJ8A 4NXMJ 2D74B 1QVGR 5JJBA 1WG4A 5KFQA 4GO5X 5K8OA 1RGIA 1ZETA 3A8EA 1GMVA 5DM6L 4RNHA 2DH7A 2FYXA 1XMQJ 4ZVTB 1K8AT 4ID5B 5C0YA 2WC9A 2IBKA 1RBTA 5AFUH 3AJ2A 1VOMA 3OJUA 3BR9A 2BJ8A 4H4MA 1FDDA 4FSVA 4LREA 4B3SK 3NGTA 5CH7B 1VSHA 3K5LA 3NF6A 4HH1A 4EZ9A 3B4MA 4DR3F 1W26A 5C12A 4CESA 1RADB 2E5JA 1R8AA 4JYAJ 4CZIA 3Q89A 5F8HA 2NXNA 4X64F 2QO3A 3FQKA 4BRHA 1T8EA 3NY0A 3EGZA 2ITGA 2BX6A 2DRDA 3V2UC 2C42A 3CJ1A 4IO9Q 2B7BB 4LF6J 2F7TA 4U7UK 4OKKA 3SCXA 2HNYA 2BDPA 3FRZA 4F4XA 2KJWA 1NBWA 2DT9A 5J2PB 1IBMK 1S6PB 3IS9B 3O9UA 2O8EB 3V4IA 4NA3A 4CERA 1WD6A 2RUGA 5G0RB 4NYNA 4FO0A 2LU2A 1S4EA 1P9YA 2VC0A 1DTQA 4CEZA 2Y1IA 4P72A 2LSNA 2V2VA 3W9JA 2KRRA 4OZNA 5DLFA 1ZAWA 3T9ZA 4X4PA 2P51A 3L2VA 1NGCA 2VQFJ 5CYQA 3TEHB 3HHLC 2B9EA 2AEJA 2V4QA 5GAEP 3KLGB 3LL3A 1KCFA 1WEZA 2Y1RI 1L3VA 3CJ0A 4CEFA 4B1VA 2QJ3A 1OH7A 4YOTA 5DDQC 2B7CB 4DL4A 2Z1GA 3F9MA 3A13A 3V9SA 4MDBA 1XR7A 3CUNA 4FYXB 5EX3A 5B0EA 4BR2A 3Q8QB 3ISNC 1UZDA 1GEHA 2DVIA 4KB7A 3CCJN 3M30B 2ZDPA 3KJNB 1X4CA 5A0YA 2R7YA 3T6BA 4V19S 2Q0RA 1TL3B 1N34F 2OD6A 2WBMA 5DQGA 4DG1A 3UNGC 4R79A 4M3RA 2F8MA 4B3TJ 5FDLB 1Z05A 4ZVHA 2Z30B 3NGZA 1SXLA 5FLXO 4K8RA 3VGKA 1ATSA 3OVAA 2BW7A 4ECSA 4FLUA 1GLDG 2A2DA 4X4NA 2IVMA 2ATQA 5ETOA 2IVNA 5GMKa 5KT4A 3OFHA 2YNFB 3QQCD 2FJAB 1EWQA 1DQ8A 2HHQA 3MK6A 2C2RA 3IC1A 4A61A 5AJ3F 4O4RA 3UCUP 4KO0A 2UUBK 1M5SA 4K2JA 1C6VA 5DMRA 1J5OA 4H5NA 4FS1A 2W4DA 3HSTB 1F6TA 3KK3B 4MT1A 1GMWD 4MFBA 4FPBA 4P2SA 2GS8A 1RT4A 2MGZA 4F2RA 4K42A 2QLWA 1V5IB 2Z0GA 1FRLA 4ES3A 3SQGA 1DLOA 1ATRA 3JXUA 1I6JA 4CI0B 1IBKK 5E84A 3VQTA 1FF2A 1W0HA 1LCUA 2UXBK 1RWNB 3NNHA 1M90T 1WI8A 2XYHB 2B4UA 1T9TA 3MM6A 1YVNA 1K0VA 1SL2A 1N0UA 1JWWA 2YKAA 4CLSA 3L9ZA 2X1BA 3R6MA 4GV9A 2O4GA 3NNCA 3V4MA 5E3RA 4CRJA 2MQNA 1GT8A 3VQPA 2OPPB 1TR0A 5IT0A 3UN5A 1B0TA 4M3YA 5CD4A 2EPIA 1T03B 2HOEA 5CZ1A 2O8BB 3V9XA 4BR9A 4ZVFA 2AJQA 1R6YA 4NYFA 4ETXA 2QXFA 3CMEN 3IRWP 4R5PB 3HKZD 3BF1A 2HS0A 2IAJA 1H0HB 4I6YA 4IOBA 2NPIA 1HNVA 3Q8YA 2BE9B 1H2VZ 2MKJA 3JSMB 1V3RA 3THYB 2QWLA 4JI4J 2KG1A 5KOXA 4P75A 1U2VB 5LMNK 2OFHX 2LEBA 2OI2A 1F5BA 3BF3A 4CZGA 1CS4A 1Q7LB 4B3SF 3VGLA 5J2MB 2FDNA 2ASPA 1S1UB 4OJRA 3SDEB 3IO1A 2E1YA 3CGIA 3R5DA 3MMBB 1CZBA 4F7VA 1UVNA 3JB9k 3FZKA 5DG9A 1YITS 1GK8A 3WNEA 4KBIA 2XGQA 3DRSA 5F8IA 1UAWA 3CW2C 3I96A 3VOVA 2A6AA 1LEOA 2LQ8A 2YCHA 3PR4A 4WZQA 3MM8B 3V5RA 1P27B 1SQFA 2ZQBA 1REVB 3MMJA 4ZHRA 4WXOA 3C6TA 2P9LB 2VFVA 4WK3A 4O23A 4RNMA 3V6HA 3FZBA 4DTJA 4DPTA 1ROFA 2R9LA 4JI7K 4FWOA 1IBMF 4JB8B 3P3DA 4IG0B 4X4TA 1U25A 4U7UD 2ILZA 4QW8A 3JSRA 4A8QA 3HHEA 3WX4A 4ED1A 4C8OA 1SKUB 4O44A 1RWKB 1JLAA 3HD2A 3P1GA 4LSNA 1MWZA 4GV3A 4LH4A 3CF5L 3S3MA 2J6SA 1Y7PA 1HWIA 3OTEA 1YJWS 1L5UA 4JBCA 4PKGA 1EETA 4NA1A 2YKQA 1U8SA 2BJ1A 2LMIA 3GJSB 1U2RA 4DL0C 2HPUA 1TUWA 5FPNA 1NK8A 1DFDA 1YSJA 4JK8A 4FK0A 1P8GA 4ER8A 2BKNA 1UL3A 2D3UA 1XERA 2ROPA 3BBFA 2GWKA 3AY0A 4QWEA 4ZJOA 3POTA 3HJFA 4CLFA 4LIWA 3DLBA 3DOKA 1SV5B 2HMIB 5H9EJ 3R5JB 3C0BA 2VG5A 4P2FA 5AQOA 1OH6A 4UF4A 3MECB 3MR5A 3IR6B 4JI5K 3SQ0A 4IRCA 3C3LA 3OBYA 1QVFM 2W2PP 3Q7BA 1ZH5A 4DR3J 4Y1DA 3C6AA 2E4LA 3O6WA 4Q2LA 1HYVA 4WFAL 1RE1B 5B0FA 1WDTA 3T6JA 4X64J 4DF8A 2XSFA 3NBPB 4C3LA 4RU2A 2UUBF 3M1VA 3TAQA 4USMA 4FWRA 1K44A 3OPKA 1PJ7A 3HP9A 3E9OA 4Q0BA 3OYBA 2YXLA 4I4BA 5K8PA 3AY9A 3W5ZA 2CJAA 4JKCA 4YFUA 4RW6A 2VCPA 1IBKF 5B0DA 1RT7A 2UXBF 1DARA 3NAIA 4BC9A 3QRRA 1SJ4P 4AXJA 4HT5A 3TABA 4CNYA 1M1KT 1LOTB 4AHUA 5DM6Q 2YX1A 3HFKA 4PWDA 1TK5A 2IDEA 4MDAA 1NAQA 3KMSA 1JLEA 2HNZB 3MD3A 2DKOB 1HLWA 2I0XA 4CLZA 4ECWA 2L9WA 4DV4K 2BE2A 4X4SA 3CJ5A 1VQPS 3MGJA 2YHXA 4IQXA 3KLEA 4CO5A 4FWQA 3TUZC 4DX6A 5GAEU 1GLFO 2YBVA 3AH6A 4MIWA 3QIDA 5AQMA 3CCTA 2DHSA 3NE6A 2X3GA 1N34J 1AZSA 3Q2TC 1ZBFA 5IQ6A 1NZ8A 3LTOA 2BA9A 1RT1A 5T7LB 1CZAN 3RSEA 4CBXA 3AA2A 1O0PA 3DRRB 1KFSA 5FPDA 4BDPA 4H4OB 1Q8BA 2KKZA 5KFEA 5AXNA 3E9LA 2MYFA 3RMBA 2VC1A 4DR2K 5LMNF 3G82A 1BL3A 2GIFA 1WWHA 1XBWA 3QEPA 3M6XA 4J37A 1RACB 3DLHA 5L1IA 5AQPA 2ZKTA 1NLKL 4BGAA 1ZOTA 1T05A 1C2PA 4HT7A 5HMYA 2WVEA 5AJ3J 2DCUB 2E7VA 1TAQA 3F44A 3G4SN 2E1PA 3M6VA 4DS4A 3N01A 3V6DB 5MLCQ 3P49B 3BV8A 1D0EA 1MWKA 1O51A 2FUG9 3H42A 3T69A 5KT3A 3V81B 3SMSA 1HHTP 2R7XA 4EI2A 4JKFA 3OYEA 2W01A 3D2EB 2DEIA 2OSQA 1H6KX 3MUVP 3TQ1A 2ZVIA 1YIJS 2GVZB 4OI2A 4CW7B 3R6GB 1DTTA 1QSSA 4X4UA 2DEJA 4JI7F 5EVZA 3BY5A 1GXUA 1DKGD 2GHVC 2XHBA 2HIQA 5AQZA 4XK8C 2BJDA 1RDDA 1U2CA 3P6YC 3CJKB 2FLNA 1IXKA 1BU6O 1X4FA 1N6QB 5KGWA 4Y00A 1CJTB 3I31A 2V8HA 1K6YA 3EE3A 3AODA 2YH0A 3H2UB 5I3UB 3NEKA 3P39A 1J53A 2IDLA 3NH2A 3CIZA 4ICLA 3V1QA 3NFAA 1YJ7A 2D7SA 3DM2B 2MJNA 2J0XA 1YIJN 4EHUA 1HI1A 4A47A 4NCGB 3I56S 2GAGC 2FC9A 1HQ2A 1VC6A 3N6LA 1QAJA 3VEWA 2WSCC 6FD1A 5BPNA 5L46A 3BQ1A 1U1OA 5HRPA 4X4QA 2F4VK 4LF4K 3PEHA 2E29A 3SUQA 3GQCA 4FJIA 4WE1A 1UFWA 1OVQA 2HVHA 1UWAA 3GP9A 3FEXB 3I0RB 2YV0X 4ZJLA 4FLTA 3HK2A 4FLXA 4BR7A 5FPMA 4MQ3A 3SCJE 4EYIB 2NYHA 1RB0A 1SL0A 2CJYB 4N56A 3LF0A 4B3SJ 2HF3A 2F63A 4F0KA 1YTAA 4NLBA 3WIVA 2EFVA 4JI5F 2MKHA 1KVCA 2AGQA 1HPZB 1WHXA 4L3QA 5KFTA 4H0PA 1VQ7N 4DCOB 2XBPA 3UDVA 3IBFB 5C10A 4GVBB 3GFZA 1FRHA 3SV4A 2K7JA 4M8LA 2ZEJA 3D54A 2KB2A 1TL1A 2ZH8A 4GV6A 1PC4A 5CCLA 1JL2A 4PUOB 3EZOA 1RTJA 3NLCA 2AIRB 2BOAA 3M2UA 3SCLE 4EFAC 2E6MA 3TZWA 3JSYA 1HNWK 5BR8K 4W5QA 5ETVA 3UN2A 1VQ8N 4ED3A 1WTBA 1WOOA 1IKYB 3AVNA 1RGVA 5HK4A 5IWAK 4QIFA 2HKEA 2GTDA 2KFYA 4DR6K 2BMBA 2E9RX 2CQHA 4C8MA 2DRBA 1RWXB 2FXUA 1U0HB 4K4VA 1RNHA 5LSOA 1NSQA 4YDUC 3D7EO 4BRMA 3TJ9A 4K0KK 5KQ8A 5KFKA 4PL7A 3KJFB 5K14B 3ALYA 2B56A 3U9ZA 4JK7A 2DR9A 1RTZA 3TVKA 3GYXB 5F2RA 1RHMB 2R7SA 4CLKA 5AXMA 1CZ9A 2QIFA 3CJ8A 1WEYA 4DL6A 4AM7A 4BR5A 3I82A 3FKBA 2BKOA 1OSDA 4DV4F 2WTUA 4KRWA 2AKWB 1K73T 3IWLA 2NXUA 2HBQB 2CWXA 2A6MA 4WCEQ 2VFRA 2FF6A 3RR8A 2LXFA 4RU9A 4L73A 3MZIA 1K8KA 1OKJA 1X5SA 1TGOA 3SUPA 1UCNA 4HLBA 3GYNA 3HT3A 3AO3A 2KL8A 3GG1A 2B6AA 3D5MA 4G3IA 3M8PB 1HBUB 4IBNA 1CJKB 3WQUA 2IA6A 4A62A 1Y3JA 3IMXA 4XEIA 4NLVA 1RTIB 5KFCA 3FCVA 3MEKA 4A8KA 4DPOA 2Q66A 1OY9A 3KHRA 2R7WA 4OFZA 5HL7L 3R1HA 3QAEA 4DSEA 3CD7A 4H5TA 1HNXK 1ZBIA 5JVHL 5L9XA 1JJ2M 1ZAVA 4DR2F 2OFGX 2Z2LA 4ECYA 3WEEB 3ENVA 5EWGA 5HRSA 1SJ1A 2VWKA 3AVKA 1RP5A 5DJBA 3O9TA 1Y11A 1RWOB 2OGUA 3M6UA 4LRDA 3CJQA 2XQCA 4RO0A 4MYTA 4JK9A 5GAEI 5ETLA 2UUBJ 1P90A 2W40A 3B82A 1HWLA 3L2QA 3KHYA 2NUUG 3UPFA 3CI5A 2ALZA 1URRA 2WVDA 3AVIA 1Y5NB 3CCSN 3LZIA 2RF2B 3CF5Q 1M0SA 2E5GA 3UCGA 3GOIA 4GKJK 5KFAA 1KP6A 5EWEA 1VBYA 2DR5A 1IBKJ 3K9JA 3MXIA 1JIHA 5KQDA 1Q53A 3NMUA 2FC0A 3VAJA 2QWRA 3D2WA 2UXBJ 4R8UB 2PN6A 3F41A 3AXMA 1JJHA 3BYRA 1TUUA 2UVUA 1EAYC 2W2MP 1PJ6A 2BABA 2DGVA 2RRAA 1VQKN 4B9SA 4LF8K 3JTNA 1QQOA 4DBQA 3ELHA 3K0JA 3PW4A 2F1FA 4HVZA 3O5TB 5TKWA 3HRGA 3QNOA 4FBUA 3ZX0A 2AGOA 2DB1A 5E3QA 2IYGA 2AMCB 3OYIA 4DU7A 4DU3A 1FXDA 1EP4A 1FJGK 5J2PA 2O8EA 1PO6A 4M63A 2QSFA 3BBBA 4YB7A 3RRGA 3PACA 4J9VA 4M5DA 4ZITA 1FHTA 5HVHA 5G0RA 3F9KA 3MMAB 2X51A 5KFBA 4LBPA 4RW8B 2H4WB 3UQSA 4KAZA 4K59A 4TLQA 2J7WA 2F4VF 3O4NA 4LF4F 2YQ3A 3OYFA 3KMQA 1BC6A 1EO1A 1CSJA 2VA3A 4RL1A 5LMNJ 1WC5A 1PC5A 3T7ZA 3QZ8A 1MN9A 3F2KA 1C1CB 2QMUB 4QYZJ 2QA4S 3G0ZA 4WFBL 3H4BA 3G6EN 2PD1A 2HQDA 4LR9A 2V8VA 1IV0A 1NK7A 2P9CA 1YG0A 7FD1A 3BO2A 1ZM2A 1S1XB 4CJEA 1N5YA 4DN0A 4LC9B 3I0SB 3EZ5A 2L9NA 1S1VA 2D3O1 4IFVA 3V6KA 2HLUA 4HACB 2XCAA 4IRDA 1Y5LB 2A5XA 4IOXA 2VG6A 1VS3A 1OIAA 2QC3A 2F96A 1ZA1B 5FDLA 3CSKA 1RLDA 2NXJA 2V52B 3FSIA 5J2QB 3HL8A 2IIRA 2FJBB 1HNWF 5BR8F 1QTMA 4OJHA 3G86A 3DOMB 4Y34A 2GQCA 2M88A 2MQMA 3ZTQA 5IWAF 3PW0A 2VKZG 4JI7J 2MZSA 3VERA 4H54A 4DR6F 4FKYA 3BH7B 3WXMB 3DDIA 2YWEA 2UU9K 1MSWD 2YNFA 2WOMB 4DWIA 3DI6B 2C22A 4P7VA 3C15B 2P1JA 4NLSA 4WIIA 1HYZA 2WCXA 1N5VA 1OWXA 3MMCA 3PHTA 4JV0A 4K0KF 5HJXA 2YKOA 3HF5A 3VQ9A 5KFJA 3KK3A 4PWUA 3N5BA 4CJRA 3W61A 3I4HX 2CG4A 5F9LA 4KJIA 2OCEA 1BWFO 3MPVA 2MY7A 1CJUB 3CEDA 1U04A 2X1GA 3NS6A 4JRPA 4OMFG 3QESA 2HYIB 2OIHA 3E66A 3JQKA 3OA9A 4BRFA 4IG3A 4J2AA 2XEXA 1HD1A 3L2RA 3J80U 1VISA 2DPNA 3Q8RB 3S3NA 1S6OA 4JV2A 4ZOSA 5KPZA 1X3NA 2XY5A 4GVMA 2ASOA 4JKHA 1LWFB 4QPXA 2OZSA 4F0HA 3BKFA 3V1RA 1Q7YT 4DV3K 1HNXF 2W4CA 1RWUA 3OYCA 5BRFA 5KFLA 1JXLA 4JI5J 4NYOA 3WDOA 2CFXA 3TP2A 3QWPA 2JH3A 2O8BA 4PG7A 3CVKA 4PEOA 1VRTB 3L7PA 1NHKL 1U2FA 1KEKA 1NXIA 2DXEA 1S99A 2EVZA 2POKA 1WAFA 3A0IX 4R5PA 3QBXA 3ADAC 2K3IA 3TAPA 2E8AA 3FE1A 3RB0A 4LBHA 4IEEA 4O4GB 2JNJA 3THYA 3RBDA 2ABYA 1GX6A 1U2VA 1X31C 4EP4A 4JKAA 1IWAA 1VSKA 4WWSA 3BBCA 3VQEA 2HHUA 2RNEA 3AA9A 1Q8LA 3CT9A 3R9PA 4ZP8A 2W7PA 1CVJA 5C25A 1HMVA 4GKJF 3CFOA 4CZJA 1S1UA 1FRKA 2HIYA 3VQDA 3AO1A 4UOHA 3AB4B 2GO8A 4LMZA 1GLBG 3MMBA 3O3HA 4CGIA 5FRMA 1T3OA 3M3ZA 3IFEA 4CTAA 4P10A 3TEGA 2YPYA 1ZBLA 3ENBA 3IWXA 2BQ3A 5I4MA 1Z2LA 1QVFR 4UT4A 4LF8F 4JD2B 3F56A 2NRZA 3GIMA 3R27A 1S57A 3MM8A 1F5CA 1REVA 3M8YA 4DV4J 4ED7A 1QD1A 5AQYA 3OYGA 2CJBA 3OW2M 3BKTA 3FGVA 3SIPB 4WQ5A 2P9LA 4JKGB 2PBDA 2KM8C 5A76A 1E4FT 3MTJA 5DG7A 1FJGF 2PFFB 2O01C 1H74A 4IG0A 4UQGA 3BSOA 1Z4UA 1D5AA 2WSEC 1S77D 2OMOA 3SJHA 2Y1JA 1R89A 3OR1B 3D2FA 3W2VB 3GWCA 4KGZB 2O8FB 3ILJA 5F8GA 3MWPA 1YBAA 3U3YA 1TVRA 3QATA 3W2WA 2D4WA 4DR2J 4CZCA 1U02A 3CQXA 4C23A 1OQ6A 3ZZUA 5KT5A 3N9UC 4CZHA 2IVYA 4LH5A 5IM0B 4OPHA 2G0IA 3GSIA 3U27A 1HHSA 3RRKA 4CJWA 1TV6A 3NOCA 2P9SB 2AHOB 1SKWA 2ASJA 1P1LA 2QE5A 4DTMA 3TARA 4PG4A 4ZVUB 1PG5B 3G96A 3CXCR 3AHPA 5EWFA 1EKEA 1ZPVA 3LDPA 2OTJN 3NS7B 4GVEA 3CFRA 1TKXB 1TKZB 1GAOA 9RUBA 2ASMA 2DNYA 3G10A 3UKUA 3DLLL 1KAZA 4WYBA 2HMIA 3OV7A 2NRVA 3A3PB 3MX5A 4DU8A 1C0FA 4FKXA 1KAYA 3MECA 2CQBA 2WB1D 2DGWA 3MN9A 4MKVA 3AGRA 4E7KA 4DXLA 3DGVA 3TW0A 2UU9F 3ENQA 4ZLPA 2J9DA 4IO8A 3JSBA 4TKTA 1KWMA 3OFEA 3NBPA 4CHPA 4C11B 4BE0A 1TQLA 3CCMN 3THXA 1BCMA 4F3OA 2CA9A 3QFPA 3S9HA 4HKQA 4AD6A 2R42A 3R2CJ 1FFSB 3CC7S 4DQQA 4Z37A 2X78A 3GSDA 5IV4A 4UQTA 2DFHA 3HSDA 3K8WA 3M2RA 3ZT4A 2BJ3A 2C2EA 2D0AA 4O5BA 2KU7A 4C98A 4OI1A 4C3KA 4DR1K 2E2PA 1RTHB 2V5HG 1R43A 3BB5A 2XMVA 1NU0A 4AL5A 4YN3B 3G9CA 2K3KA 1D3WA 4B1UB 5KFGA 2M9KA 1XR5A 2F4VJ 2KO1A 4LF4J 4QS9A 2B9XA 2GVDB 4F4ZA 3TVYA 3MAAB 3AAQA 4P6QA 1JQGA 4FJNA 2EFQA 1D8YA 3ZT3A 3LP1A 4DI6A 2OJ3A 5D6GA 4P52A 5SZTA 5E7OB 4DV3F 1GMWA 1OMSA 3NCPA 3PR5B 5M2RA 3O9RA 3CFPA 1GLJO 3J80Y 5FRNA 3SFUA 1Q82O 2UP1A 4ELTA 4BRQA 1N5SA 5F41A 5EY4A 4G9ZA 3OYDA 2RUSA 2D41A 4ELUA 4OI0A 3VQCA 3KJVB 4AL6A 4IOAL 4Z7YA 5HMWA 4Y2IA 4KHRA 2AYMA 5C24A 1HNWJ 5BR8J 5AE2A 2G1DA 3OL6A 3J8AA 4M3TA 3IAYA 2LP4A 1LFWA 5IWAJ 5KGXA 2YNHA 4CQ1A 5HP1B 3PIPL 4DR6J 1XI1A 3IBCB 5A8WA 1EIYB 4L3NA 3KK1B 2BJ9A 4E7LA 2XO7A 4LF9K 5HRRA 4CK3A 1FD8A 1NGHA 1IJJA 2E20A 2CJKA 2RN2A 1R8CA 2XZWA 3HT0A 2XY8A 2W8LA 4K0KJ 3EM1A 3QLHB 3EKUA 5DDPC 3V6DA 4I2PB 3RB3A 2IBOA 3L3CA 5ADXA 3AA4A 3W66A 2ZFHA 3V81A 2JJ4D 2CDRB 1HFEL 3I8BA 3TVZA 4A8OA 5HQMA 2JHEA 3AVJA 3BEGB 4AILC 1NNDA 4RW9B 5EUHA 3MDFA 2PGCA 2GVZA 2FC8A 4WFBQ 1ZBSA 2LQJA 4FF3A 4X4RA 4FK4A 3C8YA 3GCXP 2F8EX 3A5MC 1DEJA 1FE4A 2D1KA 3KLVA 1N6QA 2IIHA 2QT7A 1CJTA 1LKZA 4LF2A 1HNXJ 3CCLN 1T9XA 5I3UA 2YJEA 5FIIA 1VCTA 3BQ2A 4AM6A 2VFSA 1U45A 2HS4A 3WIUA 1ZAXA 5KFOA 3PDNA 4J9RA 3J7AN 1RBUA 3WUHA 1WF0A 2AF6A 3LWMA 1WC3A 3DM2A 1CJVB 4DUTA 1QLNA 4NCGA 3CDEA 3C6HA 1PYSB 2LA4A 5LM7E 1GLEG 4BRIA 1UPMB 3KG1A 4CI6A 2QLFB 1RZMA 3CYMA 3KD5E 3UR3C 4DV7K 2RQKA 2AV5A 1S97A 3VTHA 2DYAA 4CECA 4TY9A 2XB2D 1C1BB 1KLMB 3D1OA 4MMOA 1NMEB 4EK2A 2HFVA 2JVRA 2VH7A 3LGNA 3NF8A 3MM9B 5KFHA 5FJ4A 4PXDA 1G7CB 1LXJA 1Z26A 1YRUA 3CETA 4H5RA 1E6VB 3NGUA 3DC2A 5L39A 1VQON 4GKJJ 2O5DA 1QQMA 3VVUA 4FZYA 4B9NA 4GMJB 1HPZA 4BACA 1A5XA 3WT0A 3O6QA 1FKAF 1PAUB 4HI1A 1IR2A 5D77A 5AQQA 3R5CA 5JICA 1JJ2R 3NGKA 3DRPB 3M2VA 3ZXWA 4AF1A 4LF8J 1VK0A 5CCMA 4H0TB 5LY3A 2G1HA 4BY9C 1NCLA 4G1PA 1VQNN 2BTFA 2XM3A 1SH3A 1A9NB 3T5LA 2NREA 2RPIA 3TZYA 1GOCA 4J9UE 3R7NB 4D3GA 2WVCA 4JKDA 4N76A 2I5JB 1IKYA 1M5KC 3ENAA 4YY3K 3RAXA 1KC8O 5F8NA 1FJGJ 2E1ZA 5KG6A 3J81U 1IKXB 3ZZPA 4ZVPB 3VESA 2R8KA 3VQ8A 4DR1F 1HBNA 2MKKA 1O6XA 4LVNP 3DCAA 4BRCA 4LRAA 2ZH2A 4HTJA 1U0HA 1V4SA 4CYUB 3P31A 3B6BA 4FZVA 4WBFA 1BWVA 2GMLA 1TMJA 3QSIA 3H25A 3H4DA 4FJKA 4WF9L 1ESVA 2DD8S 4EGLA 3R6LB 1NGJA 5K14A 3K8VA 4NOHA 5IT4A 5D3GA 3A8KA 2YHWA 1ILYA 3EJMA 5E0OA 4OLBA 4PABA 1RBSA 3QBWA 2RS2A 1HLUA 4CO3A 3V9WA 2OPQA 4QIWD 1U8WA 1Q95G 3QT6A 2F9DA 1T9UA 2FHMA 3NGIA 2ACMA 3JQMA 3DHXA 2VOPA 2QYGA 4FL9A 3M8RA 3KJQB 4AH9A 4NLOA 2YNGB 1G2EA 2MLYA 1VR6A 1SC6A 2H5IB 3M8PA 1HBUA 1CJKA 1X4EA 3KDNA 4ZCIA 1RTIA 3THPA 3T1AA 3AO4A 2EC0A 2J6TA 4KFBB 2H3EB 2RVJA 3AV9A 1WUAA 3SK3A 4GC7A 4CJ4A 3OY9A 2ERRA 1YGYA 2M8HA 4YOUA 1RBLA 2IM3A 3WEEA 1WKJA 3R3LA 3J80O 4E3SA 2V2QA 2FZKB 2J9CA 1RBAA 4HDHA 2UU9J 4LF9F 2GO9A 2K7KA 2DO0A 1CPZA 2HAIA 1VC5A 4DQPA 3ZZZA 1RAIB 2GUPA 4IOCL 4YOWA 2HHVA 4ZVQB 3BZKA 2OKQA 4Q2MA 1HJRA 3K5NA 3SPZA 4QIVA 3AOAA 1V3ZA 1WF1A 2RF2A 2R7RA 3RAQA 3CQYA 1CEZA 1YJ9N 3I5CA 1TK8A 4YB1P 1Q18A 2O8CB 1ASUA 2XYPB 2JGUA 3EXCX 1BHNA 1HRHA 1VK8A 2W9CB 1NGBA 3R5AA 1VIXA 3PEJA 2IM2A 3HI0A 3D9BA 4R8UA 3FR0A 1BG3A 1VQLN 2AGPA 4JV1A 1PKUA 2MZQA 1JLQA 5G4DA 3LM2A 4BQLA 1CC7A 4WTYA 3VPZA 5IQQA 1R27B 1SCJB 2CNOB 4A2AA 1M1GA 3SCKE 1U1LA 1HUXA 4AXIA 4DV3J 4X4VA 3DLLQ 1JNZB 3TWHA 1VSEA 1NPPA 3G6XA 1M5PC 3AVHA 3HULA 1AA1B 5LJ5Y 2Q2RA 3VGMA 1RDCA 5KFXA 2HQIA 1HA1A 3H6EA 1YJUA 2D1CA 1CXQA 3PX4A 3OYJA 2FJWA 4P2XA 3MMAA 4RBTA 5H1SQ 5CZVA 4QR0A 2ZM6K 3N79A 1XJWB 4IJAA 1DJ0A 1F2GA 3VEXA 4DV7F 2XWXA 1EQ0A 4J8FA 3LUYA 3OYHA 2H9ZA 3O9QA 4ILRA 1ASWA 4C97A 1Q0NA 2VG7B 4HCBA 3DHWC 1G15A 1SH2A 1K9MT 3VN5A 4K4XA 1FJ7A 1A5VA 3EMTA 4GO7X 3H45C 2GIRA 4M5MA 2G8HA 2MZRA 4RNOA 4LR8A 3QT7A 4FS2A 2C3PA 1KSPA 1RDUA 1SIZA 4HHTA 1NSKL 4DL5A 2VV5A 2VODA 2R3VA 4FVMA 3O08A 5AT1B 1C0UB 2VBWA 4HACA 1UOCA 3UI3A 2C3UA 4LFAK 4PWWA 2MQ8A 4WFYA 4KI6A 1KAXA 2DNNA 3T5JA 2X1AA 5BN8A 1JL1A 1I51B 2XS7A 4KHWA 3DOMA 3VF0B 4AHCA 2CGJA 1F60B 3PFOA 2E1AA 4K25A 1YHQS 4YY3F 1YRXA 2CZVC 4MH8A 2HSTA 4NB4A 4DCPB 2H5JB 1BLUA 2J6UA 1ZBHA 2NZTA 4CJVA 2VF3A 2QTDA 3ISZA 2IM1A 5ADZA 3DI6A 5KT6A 3C15A 3NGRA 1C0TB 1B7FA 4ZVSB 4I64A 1RDAA 4CHNA 3H08A 1Q1KA 4B08A 1QZ5A 3J81Y 2FLPA 2HZAA 4IOAQ 5C2DA 4NL5A 2HS3A 5IT9U 4URSA 4WIQA 4L75A 1UA0A 1S9FA 3C7NB 2ZWHA 1FKOB 1Q5VA 3PIPQ 4EO8A 4ZMMA 3CCUS 2KG0A 1VQ5S 4ILGB 4CBUA 3VF4A 4HDGA 2VU5A 1YJNS 4Y2AA 1KD1O 4DU1A 3OW2R 2LA6A 1WG5A 4I0WA 3WXLA 2IRUA 3OR2A 2BR0A 1EQMA 1XQSC 3BSAA 1EXQA 1LWFA 1ZPWX 2ZUGA 2P9UA 3OYLA 2A6OA 4QU6A 2KQ2A 5L38A 4YOXA 2YKMA 4WZMA 1TFYA 2ATCB 4FZZA 4OYIA 3NF9A 2ZC4A 3PW7A 3LM9A 2HLTA 2R8HA 4JS5A 2VDIA 4U7BA 1U24A 4OLAA 2WZ1A 1RA7A 1QQNA 4YEAA 1UPPA 2PDAA 4FLVA 1UEUA 4QBUA 3IKMA 3ULEB 4CF0A 2WUSA 4L76A 4O4GA 2COLA 1QTNB 3Q8VA 4ZCMA 3HHLD 1Q82T 2MQPA 3G71N 4WU3A 1X4DA 5E33A 5DS7A 1UFKA 3IRXB 3SSQA 3P8BB 5AE3A 1VQMS 3CCRN 2M52A 4ED8A 4IFYA 4DR1J 2QKKA 1NJXA 1NGAA 3A5OC 2N4DA 2MEWA 3ISND 3ZTSA 2IRXA 1T95A 3CMAS 3O4QA 2RS8A 4RUBA 2FY8A 3KG0A 3KLHB 1QAXA 3QZ7A 4PQUA 1IBLK 3M9OB 2F65A 3HHKA 1D8ZA 3IGNA 4J7CA 4JD2A 1OH5A 1BHLA 4DQIA 2HW3A 4IDKB 5ETKA 4A8XA 3NGDA 4ANEA 3CCZA 2QA2A 1GXTA 3F0NA 3S7RA 1FEEA 2RKIB 4JKGA 4JV5J 2AJ4A 3KOAA 1KLNA 2FHKA 4IQMA 3HSCA 4MKBA 3VF2A 1V3SA 4ILMA 1HBMB 2Y0SD 2DTJA 4USVA 2RU3A 1VHFA 1XWLA 4LBIA 4F4AA 4CO1A 3G87A 2L48A 1B4SA 5BJRA 5D0EA 2DCLA 4EAHD 1JB0C 4IO9L 2ZM6F 4WPAA 3QJJA 3ZTOA 3L7OA 2Q31A 3GJTB 3BGRB 1RBOB 3TAMB 3OR1A 4W92B 1ZA2B 4ECTA 3ZZTA 3L3UA 4MAKA 2P9KB 2ZH9A 4CGDA 1RILA 4DR7K 3E9PA 3MXMA 1KNZA 2VIHA 4A2BA 3C14B 4V1Ak 4DPXA 1DY3A 5IM0A 1KTQA 4LF9J 1GLCG 1Z25A 3CTRA 2AEFA 3MEDB 1FDNA 3I5AA 2Z4PA 2P9SA 1PSDA 1CLFA 2DTUA 5CYJA 1KVAA 1GX5A 4X4OA 3SPYA 1N5TA 3OJSA 3A3NB 4RW4B 1FWKA 4ZPBA 2V2ZA 3FFKB 2KTQA 2UUCK 4LF5K 1M90O 4WF9Q 5D0GA 4LFAF 1MROB 1WKKA 1WELA 3BN7A 3OBIA 4QIGA 3MM7B 1TKXA 1TKZA 3ZSQA 1S22A 3D0HE 2HHTA 1UWBB 2XMMA 2J7UA 1WSRA 2AT1B 4KHQA 4KH1B 2HRTA 4ZPCA 1FRXA 1Y64A 2W8KA 3BPDA 3GYGA 2OPRB 3A5NC 4KE5A 1TTHB 3PHEA 4GRSA 1VLOA 3BH6B 4O3NA 4YP3A 1M5OC 4C8YA 2E44A 3OVBA 1X1PA 5I9EB 1HQUB 4RWWA 4FOEA 4B9TA 3CJCA 4LSLA 5LSRA 1WC4A 4Q45A 4JRQA 4JNEA 4HUFA 4KRFA 4MK8A 3R5GA 3W8GA 2DISA 1MWYA 2XGPA 4URGA 2MZTA 4CH1A 2ETJA 3K58A 4K4SA 2H3GX 5IT9Y 4DV7J 2P9PB 3WX8A 1F5AA 2KHCA 4GC6A 4IOCQ 1KC8T 3J81O 2FJVA 1TELA 1GFWB 3U1LA 2Y3YA 1Q79A 1IG9A 4F0MA 2FHOB 4KC5A 1ATNA 3DMJA 2OZMA 4RR5A 2HHXA 3NVKA 5DK5A 2BUPA 4BRGA 4GMKA 2X1FA 3TI0A 2GMHA 3V9UA 2F9WA 3EICA 3PFEA 2E2NA 1RT5A 3UN3A 2ZD1B 1XK8A 2KJVA 1JJ4A 4G1QA 2OYQA 4HHJA 2XLJA 4C1NI 3GFHA 3IG1B 2G2YA 4FJ8A 4EYHB 2R8GA 4PKIA 3H46O 2HSEB 3KJVA 5B7WA 2HQGA 2C2ZB 2JC1A 1LXNA 2DR7A 3FDSA 1ELOA 1SUQA 3QT8A 2ZHBA 1IR1A 2I7NA 4A48A 4YY3J 5GAGP 2PMZD 1YVFA 5HP1A 8RUCA 4C0OC 1YWXA 2M5YA 4F02A 3CC2N 4QOTA 1DURA 1FXLA 3I33A 2BZ2A 3VTIA 4M94A 1X9WA 2IM0A 1OSCA 4KHPF 1NEEA 3CJTA 2KHOA 5LMUK 1S9GA 3QLHA 4KV8B 4UOGA 3TR8A 1RHJB 1GNKA 4I2PA 4M3WA 1WLJA 1IBLF 1S5JA 4C2MA 5AZIB 4YR2A 4NLQA 2R7TA 1VQ6S 2R2SA 2DNPA 1BQNB 4KGXB 5J2NB 5BYRA 3HHLB 3ZZ0A 2CJXB 4K4TA 2IHR1 1HNIA 2AX0A 1MMNA 1R6VA 3SSSA 3RUBL 3NS5A 2P9NB 2ZWOA 2V9WA 5GIPA 5KFNA 4K4ZA 1NOZA 4EP5A 4DUZK 1RYSA 4BRPA 3SXLA 1Q78A 5K20B 3CHWA 4M3XA 2MKYA 1T7PA 3CG7A 4ANDA 4C3MA 1Q4RA 3VCDA 1C0GA 2FVPA 3L95X 2D9PA 4NLWA 3ATVA 4DR7F 3SBTA 4K7QA 4ANCA 1Q9YA 1CJVA 1JMTA 5LXYA 3MPDA 4RBUA 1N34K 1IBCB 3QSYB 4Z4FA 3FZMA 2AJFE 2KXHA 1QE1B 3ZSOA 4DS5A 3MOJB 3W60A 4DPYA 2Z1JA 3CJ2A 2JVOA 4S0MA 5CD4H 1RT2A 3VMFB 5T41A 5C15A 2UUCF 4LF5F 4USIA 3RU0A 1HIYA 2AZ1A 3PYGA 1AT1B 3DLGA 5A6WA 3VV2B 4BDYA 3S6EA 2BW2A 4B3MK 1HL6A 1T9YA 3GFYA 2DNOA 1SBRA 3AT1B 1E6VA 4W5RA 4C0HA 3TSQA 3GJQB 2AJ2A 4BC7A 2XCPA 2I6WA 1H98A 2HWTA 1VQ9S 5B0GA 3PYEA 2FGCA 3QT5A 4FF1A 1FNMA 2ZJRL 5DETA 2OO4A 4CFAA 4F50A 1BIZA 4PXEA 2RHKA 4J90A 5I42B 3QAUA 3CCQS 3BGFA 4NCAA 5LT5A 4ZP7A 1H2UX 1VRUB 3RGIA 3AAWB 2V4JB 1DZ5A 1RT3A 4DN9A 2VOOA 1V9OA 1AFIA 1U7LA 3FZHA 1LW2B 4FPRA 4PCQA 4FPIA 3ZEUB 4J2EA 4IH7A 3ZX2A 1RU1A 7AT1B 1BOTO 1IKXA 2QL7B 2CXEA 3LP2B 1WOPA 4CJ5A 1R3NA 1R59O 2ZJPL 2KYXA 3QNNA 4OYXA 1FDBA 4O5FA 4P71A 2PFUA 1YTYA 2ZM6J 5HMZA 2YQ0A 4CYUA 2FIUA 4M3ZA 3CPWM 4E8UA 5KFFA 4K5RA 3T5KA 4KI4A 1S6UA 2RD5C 2UVVA 5IV3A 3DOLB 3HM8A 3DJCA 3NP5A 3BQ0A 4WJBA 2QX0A 4D3HA 4B8CA 2SXLA 1NK0A 2W41A 4EO6A 2EFPA 1VSLA 1IKWB 2IFXA 2PYLA 1RWWB 4NI2B 5IT9O 2P9IA 4ZK7M 4ZVOB 3CCEN 2LFVA 4OZLA 2DR8A 3WXJA 5AQNA 2IA0A 1FKPB 1LOUA