3N4QA

Human cytomegalovirus terminase nuclease domain, mn soaked
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
246
structure length
216
Chain Sequence
LITDQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAGTGVAAVGAYRHQFLIYGLEHFFLSESSEVAIAECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTLIRVLFYHTPDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQIQNLHRSDDLIIAVIMATYLCDDIHAIRFRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords TERMINASE SUBUNIT UL89 PROTEIN
publication title Structure and inhibition of herpesvirus DNA packaging terminase nuclease domain.
pubmed doi rcsb
source organism Human herpesvirus 5
total genus 70
structure length 216
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.320 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3n4qA00
3N4QA 3N4PA 4IOXA
chains in the Genus database with same CATH superfamily
4CJ4A 1SKRA 4K25A 2F9TA 4B1YB 5HOOA 3ITHA 3M5RA 2EHGA 4CHPA 1RT3A 1S6PA 4BG9A 3MX5A 1XNQK 3CYMA 4DQQA 3AA4A 1NGCA 3O4NA 4Q5VA 1L3UA 4E1MA 4O5FA 5HROA 2YNGA 3NHGA 2QWLA 4MO4A 4DTPA 1BCMA 4CEEA 3L2VA 3HRGA 5FRNA 4R5PA 5CY4A 2W6LA 3I55N 1HYSA 4RW9A 2I5JA 3WXKA 1YIJN 4F4KA 1I3AA 4CF8A 1KQSM 3VTHA 4W5TA 1RTIA 1L3TA 3DXMB 4JK9A 4A5AA 5KQDA 4JKDA 3LAKA 3PSFA 1YJWN 3ALYA 4EFHA 5AQLA 5FPEA 3DXKA 3ISNC 3THXB 3ATUA 4BRDA 3GE1A 4FK2A 4C1NK 2F8TA 3JSMA 4C8LA 1VSIA 1FKPA 4FJJA 2A3ZA 5JS2A 5JICA 2O8EA 4CJLA 3FZFA 4F8RA 5AQXA 4KH5A 3QNNA 2A6AA 3JAMO 1Z25A 4YOTA 3SV3A 3UKRB 4W5QA 4HVJA 3L2QA 3A0IX 3R1XA 2XO7A 3O5BA 4F2SA 4FJ5A 4CBWA 3T1AA 1KTQA 1YI2N 4DF4A 1S6QA 1CZBA 4LY7A 5HRNA 4EZ6A 1T6CA 1RTDA 3U9DA 3CPEA 2HSTA 1WN7A 4JLHA 3RRHA 1TYQA 3HP9A 3VF2A 3RR7A 4B3MK 2P9PB 4ELVA 1RTJA 3AO4A 3RMDA 1NKEA 4DV0K 2P9NB 4AHCA 2E2OA 5M1KA 3K2PA 3K5NA 1HX1A 2OZMA 1TK0A 2O4IA 3QBWA 3E1YA 4H5TA 3TTCA 2P9UA 4Y0WA 3ZSWA 3L0QA 4XH1A 3NGZA 4CJUA 1ATRA 3UKUB 5C10A 1VHXA 4ID1A 4RG8A 1D9FA 1KXPA 1ZC6A 1SQKA 4YORA 3OYDA 1HQEA 4FVUA 3IG1A 4FLZA 4DU4A 3I56N 4JK7A 4B8CA 5C15A 3ULEA 1GLLO 3VPZA 1VQMN 5IT9O 1RT1A 4Y1CA 4JK8A 4B08A 1N33K 3CD6N 4K41A 2ITGA 3FGUA 4IJAA 2Q31A 5J2QA 5BN9A 1SS6A 3ENOA 3SYZA 5M1NA 2FBVA 3A5LC 4DQPA 2X78A 1IJJA 3KLGA 4DV2K 4DV4K 3QEVA 3KLEA 3KK1A 3MCAB 2HVIA 3MECA 2XY8A 4FWQA 1WAJA 2BTFA 5KRSA 4W5NA 2A5XA 3AVFA 3R3LA 4CEFA 3L2RA 1C1CA 2HHXA 3OY9A 1ILYA 3CIPA 1QQOA 2Q36A 3QETA 3HI0A 4DU1A 3C6UA 4AQYK 4KAZA 1IBMK 4A5BA 2IDOA 1VSEA 4PA1A 4BG8A 2WONA 5FPDA 1Y97A 2ASOA 2AA4A 3PUFA 3QBXA 5AQHA 2HF4A 1W2BM 4DFJA 2F7TA 2PY5A 1NK6A 5AQMA 4CHQA 4CIFA 1K8AO 4B9NA 1KAZA 4E19A 5M1FA 4KH4A 2YI1A 1RFQA 4IKFA 1NJWA 3IRXA 4OJRA 1NWKA 1HUXA 2FSJA 2OPPA 3J81O 5IWAK 1HKGA 2P9IA 4KHPK 1X9WA 2FLOA 3LZIA 4KO0A 1LOTB 4DR6K 5SZTA 5SWMA 1DTTA 1UAXA 2F4VK 2W6KA 1BUPA 2GX9A 3M1FA 1GLBG 3O9SA 1TKZA 4QAGA 4LC9B 1VRUA 3O1WA 3QLHA 3F5TA 3FZKA 4BR5A 4MQ3A 4BVOA 2P1JA 1IBLK 1J9AA 3SAFA 4DQSA 4C8MA 4NCAA 3LPTA 1X9JA 1YHQN 4Z0UA 4DSFA 1Q18A 4LH4A 1RDCA 4IEEA 5CE3A 3VOVA 2FBTA 4HWIA 3IS9A 2E2PA 4H4MA 2DY4A 3SUPA 3LDLA 3VGLA 1QSSA 2EWSA 4BY9C 4BC2A 4B9UA 4IWVA 3WNEA 4CJSA 4BDPA 2O8BA 3VEYA 1L3VA 3DWLA 3O08A 3KKRA 5AR0A 4DFMA 2DFEA 4H0XB 3VN5A 2YHXA 1J5EK 3NF9A 1D4XA 4IOAL 2GWJA 4DR4K 2HHSA 2FBYA 4CJ7A 2O8FB 1VQ7N 4Z4FA 1RT5A 4CHYA 4FLVA 4CI6A 1YVNA 1QE1A 3VTIA 1MU2A 1CLQA 3TTFA 3VEOA 2D0PA 4DV6K 4DTMA 5D3GA 2OCEA 4FW1A 3VQ8A 1NK9A 4B8AB 3L4IA 3A5OC 4KB1A 3H3OB 5E26A 5DM7L 4U7BA 3R8EA 4FLXA 1XMQK 1RBRA 5BR8K 3O4WA 3C6AA 3TARA 1HNIA 3LP2A 1KAYA 3CMAN 3J7AP 3B8AX 2BGGA 2ITMA 1T3VA 3SJJA 4DLGA 2ZE2A 3SQ2A 1KRPA 4FJLA 3SCXA 2NUBA 4FPBA 4JI4K 2HHWA 1ITGA 4CF9A 4L8RB 4DHYA 5AQPA 2E6LA 5EY4A 4I6MB 4ISEA 3C6HA 3S9HA 3MMVA 1QQMA 2YHYA 4CD3A 1YAGA 2E1ZA 1J54A 1XUPO 4M3ZA 4ISFA 1VQ6N 2G8VA 2A41A 4KFBA 3VENA 3DXMA 1NK4A 4AHVA 3VEWA 1WUAA 1TAQA 3L2UA 1NNEA 1HNXK 1E4GT 1I39A 4FLTA 4IEIA 3KVGA 3KD1E 4A59A 3GL1A 1N32K 1NLVA 5FPNA 3TANA 4M3WA 3THXA 3WXJA 4FVMA 4DFKA 3U8XA 4BROA 2P9KB 5A2QO 1HPZA 4YOWA 2YHWA 3CJAA 2W41A 1QZ5A 3SJHA 3VMFB 2NNWA 3A5MC 4MFBA 1EX4A 3P38A 4DTRA 2ZF5O 3OYAA 1EO1A 1KVBA 1DT9A 3E9LA 3V1OA 4EIAA 3VQAA 1S1XA 3KHYA 4EHUA 3F9MA 4DQIA 1RT4A 3R6MA 5CHIA 4OPKA 3EE9A 4ELUA 4WF9L 1ZBHA 2QWMA 3J80O 2KW4A 4FJIA 4WYBA 4JYAK 4CFAA 2VG6A 3QB0A 4DTXA 3I0RA 3VQPA 4FO0A 4GKKK 3HTVA 3OW2M 2E5LK 3RWUA 3ZEUA 3K9KA 1SL0A 1S9EA 5HL7L 4DUZK 5FDLA 4BACA 3SUNA 1E3MA 2ETJA 1EQYA 4DV1K 2GWKA 1GOAA 4DTJA 2P9PA 3BEXA 2ATQA 1RILA 1WSHA 4MDBA 3DOLA 2D4WA 2P9NA 5EX5A 2XY6A 5EU7A 3KJVA 1SAZA 1X3MA 5F1XA 3HYFA 4FM2A 4BGBA 4DV7K 3AVNA 3HXMA 4CK2A 3M8PA 3AVMA 3PLAA 4FK4A 4AHRA 3K5MA 2PZSA 1NGFA 1YJNN 1WLJA 3L6QA 3WXLA 1N6QA 3J7YP 3I0SA 3DOKA 3SK3A 1WNSA 3A2FA 3K9JA 3AY9A 4KB0A 1WOQA 4A57A 3RMBA 3UKUA 4CECA 2KLAA 1NGHA 4M41A 2FBXA 4X65K 1QSYA 1U2VA 4O44A 3EEQA 3CQYA 4OO1J 1K8KB 4B9LA 1ZBUA 1RT6A 4O5BA 1LW2A 4DUYK 4CFCA 1YTAA 2F8SA 3VQDA 4CCHA 4ZTJA 1U49A 2QW9A 5KPTA 3QIPA 1QSLA 4BRFA 1Q8IA 1SKSA 1RBTA 3THWB 1XC3A 1LWCA 2ZJQL 4PL8A 5JLHA 1OH7A 3HBTA 3U3YA 3VQ4A 1Q86O 1RTHA 1VSJA 1UOCA 4OPHA 3EZ5A 3MK6A 5LJVA 3CCVN 4E7HA 1JCEA 3RSEB 4WFBL 4GY2B 3THYB 1TUUA 3IMXA 4AHUA 2O8DA 2F9WA 1JXEA 1TK5A 1S1VA 4ILGB 3LDPA 5CZ2A 4Z4EA 4K43A 4J2EA 3BZCA 2V51B 3SNNA 5BPLA 3CJ1A 3QESA 4LF6K 1WSEA 3L3VA 1IG8A 3A8YA 1VQPN 3EL2A 1NKCA 3O9TA 3LPUA 1V4TA 4CJ3A 4TSXA 3MXMA 3HPHA 1U6ZA 5M1OA 4BVPA 4AHTA 4OKJA 3OYEA 1GLJO 3NGIA 3OS1A 2YKMA 3VEZA 2ZGZA 5DM6L 5AFUA 1I94K 3ZYYX 1BGXT 4L3QA 2A1RA 2CGKA 3TU5A 5TKWA 2IVNA 3QEPA 4A2BA 2G8WA 4LFBK 5C24A 2X74A 5F0XA 1Q7YO 4ICLA 3GBTA 2WFBA 1Z05A 4BRMA 1ASUA 4RW7A 4CJ5A 1JLGA 3K57A 2YJFA 5JMVA 1M1KO 1YF5L 2YKNA 4CF1A 3L4QA 3VF4A 4JI5K 3QMLA 3OS0A 1TUYA 4CGHA 3DLHA 1ZYQA 2O4GA 4DR3K 4JS5A 4KHYA 1A5WA 3PIPL 4M7YA 3OYFA 2G8UA 3NH1A 4KKOA 3EYZA 3C94A 3KIOA 4H5RA 3ZT4A 3DM2A 5EOYA 3UIQA 4FW2A 1OH8A 1KLNA 4OLAA 4JI0K 5AQNA 4CZJA 4RTFD 3DLLL 3NFAA 1NK7A 2ASPA 3LL3A 1VQ8N 3E01A 3BP8A 4CD1A 3VGKA 4KHNA 2IVOA 3OA9A 1XWLA 1EETA 2ZJPL 2KFZA 1ASVA 5TKYA 2HNZA 3RMCA 2WC9A 4BDYA 1L3SA 3VERA 4FWPA 3MN9A 4NYFA 4KHUA 4DG1A 5AQTA 1TKTA 1RNHA 2XY5A 4E7JA 5I3UA 4AHSA 4FJXA 1NOZA 4CGDA 1NJXA 3G25A 3PO5A 2AP1A 5LL6Z 3OBWA 3IUCA 1M90O 1LWFA 1FKOA 2GELA 3QINA 3CPWM 1U47A 1RDAA 3NH0A 2O8CB 2YJEA 4B9MA 1C1BA 4BRIA 2G8KA 1KCFA 1U48A 4AM6A 4FSVA 3B6OA 3C6TA 4NLCA 3OS2A 4FYDA 4JD2A 1BHLA 3MEGA 3QIOA 4F3TA 2P9SA 3CETA 2Z1GA 3HSTB 1B9DA 2GBZA 3T1HK 5H1SQ 3AVIA 1VQ4N 3V9XA 4JI1K 3NDKA 3QNOA 2UXDK 3FZMA 4GV6A 2UXCK 5CZ1A 1IO2A 4JKFA 1Z6RA 4CHOA 4EP5A 4FWMA 3WNHA 3QFUA 3ZETB 1S5JA 2E2NA 3C95A 3L8BA 1XQSC 5AQGA 5JLFA 1D8YA 1NGEA 5AZIB 1X3NA 4I9QA 3NMUA 3ZSQA 4CZHA 3AV9A 2YCHA 3SI6A 4I6MA 3S41A 3ZSOA 1QZ6A 4DCHA 3E66A 5M1QA 2G8FA 4V19S 3M8RA 4FXDA 4K42A 3AAQA 2YNIA 1OH5A 1ZBLA 4K8XA 3T7ZA 1N8RO 4DV3K 4OX9K 4DQ8A 1BISA 4B3SK 3LDOA 1RDDA 4ILHA 3WXIA 4GW6A 1E4FT 1U45A 4X64K 2E4LA 2QTDA 3G6EN 3I8DA 4PQUA 4BQZA 2PBDA 1TAUA 1R59O 3AVHA 3CC7N 4ZTFA 1S22A 4FZXC 2GUIA 3K5LA 4KREA 1LCUA 3AVJA 5KRTA 5AQWA 5CYQA 4HTUA 2JGUA 5C2FA 1Q81O 3HM8A 3K0SA 4A61A 2FF3B 4LF4K 1DKGD 2FSNA 2VGNA 4C23A 3NE6A 3PV8A 4CEZA 3EE8A 1UA1A 3U4LA 1ASWA 2EX3A 5HBMA 2ZJRL 4Y1DA 1Q82O 4IDHA 1Q9YA 4IOXA 4CZKA 4G9ZA 3HL8A 4NO7A 4DMNA 3HOSA 2IS3A 2HHVA 3WEEB 3N4PA 2UU9K 4CIEA 4JHDB 2OPSA 4CE9A 1FJGK 2B4JA 2P5GA 5AQIA 2HHHK 2X6NA 3AVCA 3D2EA 4FM1A 3V1QA 2NRXA 3EO3A 3ZT0A 3VEVA 3ZX2A 3UE5A 1A5VA 2OYQA 1ATNA 1VQ9N 2HBLA 3QICA 3TR8A 5JS1A 2D5RA 1KAXA 1LWEA 3M8SA 4AF1A 2HBJA 4CJFA 4EP4A 5AQJA 3ID6A 4DF8A 1YT3A 2ZQBA 1QVFM 3OYCA 1IKYA 4FWKA 4FJ9A 1VRTA 4IFYA 3CCSN 1YJ9N 2IGIA 1WBBA 3TAMA 3CFOA 4AH9A 1BI4A 4KH6A 3SMSA 3VQ7A 3LZJA 1LAVA 3CMEN 3O4QA 1FXXA 4PKGA 3SBGA 3ZX3A 4C8NA 1K8KA 3RTVA 4CZLA 4XH5A 4O4GA 3AVGA 1LW0A 3MDQA 3OYBA 2Q97A 1ZBFA 4BR7A 1IKXA 2KTQA 4QS7A 1TK8A 1BQNA 2BANA 4PY5A 1NGGA 3SQ4A 2KQ2A 2VQFK 3THWA 4CGJA 3VGMA 1T03A 5DK5A 1S72N 4CBXA 3SV4A 3ZT3A 3QEXA 4CJPA 1VSMA 1O13A 3O3FA 4CZFA 5GINA 2X6SA 1YVUA 4FPAA 3S3OA 3V9UA 1Q9XA 4U67L 1B92A 5EXWA 3AVKA 2PFUA 1N34K 4XIUA 4GKJK 1KLMA 1G15A 3NGYA 3CXCM 4DFPA 1BA1A 1EWQA 1NMNA 4M3TA 3NF7A 3ZCMA 4CFDA 1NK5A 4JKGB 1ZBIA 5ELZA 3MN5A 5FPMA 3VQBA 3DI6A 4B3TK 5GAGP 4QS9A 1HNWK 4H0TB 3V1RA 1F21A 3AO5A 1UA0A 4ELTA 2HNDA 4YNQA 3OYNA 3O9RA 1NJYA 4DWIA 5KGWA 3SPYA 4HUGA 1NM1A 4BDZA 1JLFA 3A5NC 4I2PA 5M1PA 4UQGA 2QWOA 3OHRA 4R79A 3BGRA 2I7PA 4LD0A 3ULDA 2HMIA 4H5NA 2B6AA 1RDWX 1HJRA 4RW4A 4C8OA 4OPJA 3O9UA 4FZZA 1C1AA 4Z94A 3OVNA 5BPNA 5AQQA 4BC4A 1EP4A 4CJKA 3NAEA 5BRDA 2WUSA 2E1YA 3ZX0A 4CGIA 4PWDA 3BUZB 3W0LA 1W7AA 4CF0A 3AGRA 4FJHA 2P9LB 4LF5K 4CK3A 1RBUA 1XI1A 4DR7K 2HB5A 2QWNA 1C0MA 2NRRA 5GIPA 1EWRA 3DLGA 3TAPA 5C0YA 1K6YA 3U3GA 3SUQA 4K0KK 5FLXO 4JKAA 1VK0A 5AFUH 1JLQA 2H3GX 3ENHA 3WNGA 1VQON 1JCFA 2Z1HA 3LALA 3QEWA 3V9WA 3CCUN 3OBYA 5J2MA 3CC2N 4BWMA 3KK7A 3ASMA 4I9LA 4CFBA 1T44A 3MX2A 1A5XA 1L5UA 2HBKA 4LF9K 3CG7A 3LDSA 1VQLN 3LANA 3K58A 3HPGA 4GNIA 3DMJA 4B1WB 2Z1IA 1X9SA 2Z1JA 1VSLA 2FF6A 3JXUA 3Q7CA 4RW8A 4O0JA 1SKWA 3ZLJA 3CF5L 4O55A 4DLEA 2YHAA 3DLBA 1KSPA 5K14A 3G71N 3OYGA 3AO2A 3VA0A 4FLUA 2ASMA 3UKRA 1GLEG 2CH6A 4CGFA 4IG0A 2QA4N 4BRCA 1KVCA 3QEIA 3TAGA 4H0VB 3HT3A 2HBMA 3O3GA 2D0OA 5E84A 2VCPA 2GV9A 3F2KA 3MCPA 1WBDA 1NGBA 1ESVA 4DS5A 3FFKB 2VG5A 1NGAA 4YFUA 3H3NO 4YOXA 2I7NA 4A2AA 5J2NA 2W40A 4NXNK 4MLHA 3HVRA 1HLUA 3OJUA 1N5YA 1HKBA 1REVA 2A40A 1J6ZA 4FOIA 3CJBA 2QI2A 3IKMA 5HRSA 3WXMB 5LJWA 2UUAK 2AJQA 3WT0A 1GLDG 4OGCA 4I2QA 1NJZA 2D0BA 4X66K 2OTLN 4O8UA 5AZIA 1JCGA 3ZSZA 4CEDA 4FWNA 2XY7A 2G8HA 4WQ5C 2HW3A 2KZZA 4BRNA 4Z4CA 4FK0A 3H1QA 4FCYA 3NVKA 1NMDA 3JS6A 4DV5K 4FJNA 4JI2K 4JRPA 4IG3A 3KLFA 4KHWA 4E3SA 1JJ2M 3NF8A 4LH5A 1K73O 2BUPA 1T6DA 1T8EA 5C25A 2HHUA 5KGXA 3WUHA 1W97L 4DTNA 3LDQA 3T69A 3F9KA 4H8KA 4DTOA 3C7NB 1QQNA 2E88A 3CM5A 4M45A 3PY8A 2E8AA 3CM6A 3KD5E 1JLBA 3ZSXA 3AGKA 4FWRA 3DRPA 3O1BA 5BR9A 1N36K 1C6VA 2F96A 4ISGA 5AZJB 2R7YA 3TABA 3CCMN 1RDUA 3P83D 4WE1A 2YNFA 3OYJA 3QFPA 3CC4N 3GOIA 4J2BA 4N76A 3V6DA 1T05A 5AQVA 3WEEA 1FK9A 4J2DA 3VA3A 3HP6A 2BE2A 3HSCA 4NXMK 3AARA 4JV5K 4HCBA 2OA8A 2LSNA 3VQCA 1NK8A 2QXFA 1VAZA 4NYNA 2VWKA 3F73A 3FZHA 4IOCL 4F3OA 1K9MO 1JKHA 2OANA 5ADXA 3SUOA 2NRWA 3VQ9A 3MN7A 2UXBK 4PUOA 4M3YA 4JI7K 4DSEA 1OVYA 2QWQA 1RGIA 2HOEA 1HMVA 4W5OA 1SV5A 4XH4A 4E7KA 3MXJA 1U4BA 1TL1A 2HHTA 3AVLA 3CCQN 4N41A 4Z4IA 3CJ9A 3FR0A 5EVZA 3SQ0A 3O6WA 3FLCO 1WSFA 1X9MA 1SZ2A 5CYMA 2QKKA 1WAFA 1TKDA 4H0PA 3TAQA 1YXQA 4OLBA 5KI6A 4CVNE 1P90A 3VF6A 2QWRA 2ZM6K 3CCJN 3P1GA 4ID5A 4A62A 1ATSA 1HYVA 5CR4A 3RVCA 1JLEA 5I42A 2HVHA 3N4QA 3IFRA 1RT7A 2NRHA 5AQUA 1YTUA 4LFCK 3KWIA 1NBWA 4JAXA 1VQ5N 3BF3A 3J8AA 4B1ZA 4PKHA 4ZHRA 2OZSA 2PYLA 5HRRA 4FJ7A 3FFIA 4O8KA 1SL1A 3OYMA 3JYTA 1NGJA 4BR0A 3RR8A 3HVTA 3P39A 4MDAA 1MWMA 1JXBA 1TL3A 3CI5A 5AQKA 4B1VA 4FWSA 5KTQA 4LF8K 4BRPA 4WQ5A 1VSKA 3DLRA 3QDKA 4Z4HA 1BOTO 1RDBA 3GG4A 3D0PA 4LSNA 4PKIA 5BRHA 2E20A 4CHZA 4H5WA 4CBUA 3E9OA 4JKCA 1C0TA 5LMNK 2WOMA 2JWLA 4IJNA 2O8FA 1ZBSA 3FZLA 4JKGA 1HNZK 4QCLA 1KC8O 3RRGA 4EZ9A 4JI6K 1JL2A 5LY3A 4JKHA 4IO9L 1BO5O 1S1UA 2KKZA 5FRMA 3ID8A 4Q0BA 2OPRA 4DSKA 3D7EO 3P31A 4F9OA 1BA0A 3HOTA 1TVRA 4C1NI 3OYKA 2Q0UA 1VQKN 2CGLA 2JLEA 1MA9B 2NRTA 3CJ7A 3K5OA 1KD1O 4CF2A 3SQ1A 4F2RA 4CEAA 1HYZA 1IV0A 4WCEL 2Q2RA 4Z4GA 3BY5A 3V4IA 4J8FA 2FSKA 1J53A 1NKBA 3DLEA 4GV9A 3CFPA 4OKKA 2A1SA 3ZEUB 2HF3A 1NG9A 4KI4A 1BIUA 1RBSA 3AA2A 3LWMA 4DU3A 2Q1NA 4MO5A 2G8IA 3AVAA 3H46O 4FZYA 1HJOA 5BPMA 3ENBA 1G99A 4KI6A 2P9LA 4JI8K 4BR2A 4KPYA 1BIZA 3QO9A 3CJCA 1WSIA 4LFAK 2CH5A 4YDUC 4JRQA 1JL1A 3VQ6A 4DS4A 1GOCA 2IOCA 4JEPA 4B3OA 1IH7A 2RHKA 3KTQA 4CHNA 5KPRA 3G4SN 1NK0A 3VQ5A 4H4OA 2IAJA 1NU0A 4KTZA 3HPOA 3VETA 3LP3A 3OYLA 3T19A 3KKSA 3CERA 3W3DA 3Q7BA 2NRZA 2KZMA 3GDQA 4QS8A 3B6PA 2V7YA 3MWTA 1UWBA 2P9KA 4BE2A 3KLIA 1U2VB 3MWPA 4BR4A 3EKUA 1DTQA 2YHBA 4CJQA 4N5SA 4OVLA 4FL9A 4NB4A 4HUEA 1HR0K 3NVMA 1OH6A 4OPAA 1XMOK 2RKIA 4ILJA 3EY1A 4LSLA 3TSPA 5FROA 4AM7A 4EAHD 4M3RA 4IBNA 1KVAA 3TSUA 3IAYA 2YV0X 2NZTA 3IDHA 3D2FB 3BDPA 4DB3A 5BN8A 3PX4A 3PIOL 3SMPA 4B9QA 4BRQA 4I7FA 1P8ZA 4JI3K 2UYTA 2A42A 4UY8O 3VESA 3AVBA 3CCLN 3TWHA 4QOZB 1JLCA 3KLHA 4IXCA 2PYJA 3MEEA 1IG9A 1SL2A 2Y1JA 2O8DB 3I8BA 4K8ZA 2HNYA 2RPIA 1B9FA 4CEBA 4BRHA 4BE0A 1QHTA 2XHBA 3O3HA 3E9PA 1TV6A 3DRRA 1SUQA 2YX6A 4DSIA 3DYAA 1VQNN 3LM9A 1NGDA 4W5RA 2RE2A 2BDPA 3O9QA 2OPQA 2OTJN 1HPMA 4YY3K 3V9SA 4MLEA 4DTUA 1XC9A 1JLAA 1U04A 3V9ZA 1KFDA 2J4RA 2D1KA 1C0UA 4KBOA 2Q0RA 3AA5X 4IZ9A 1CXUA 1Z26A 2VWBA 1WSJA 1LAWA 4X62K 3TPQA 3PX6A 5B8HA 3EZWA 4CJRA 1VSFA 3HJFA 3T1YK 3LP1A 3C7NA 4BR9A 4HHTA 4FJ8A 4BRAA 2IVPA 4DR2K 2E2QA 1DGKN 2UUBK 2XRIA 1O1WA 3NF6A 2NLXA 2ZWHA 4BREA 4BQLA 4N47A 3VQQA 5AZJA 4CEQA 3G0ZA 3OJSA 3QERA 4B1XB 3CFRA 5BRFA 2W42A 2GTDA 3DRSA 3RSEA 3TAEA 3ZSYA 3THYA 3H6EA 1RCHA 4NCBA 3PO4A 1XHXA 3ZSVA 1QHAA 3S3NA 1S9GA 4BC3A 2D0AA 4WQ4C 3NH2A 3T3FA 1YUWA 2RF2A 5MLCQ 4RWTA 1FW6A 4CW7B 4CZMA 3HM9A 3DXKB 4CJEA 3SZ2A 4YDUA 2KFNA 3FE1A 2Y1IA 3THVA 4B9SA 4CESA 5J1EA 3LP0A 1GLFO 2WTUA 1V4SA 4HTLA 3U6FA 1OVQA 1QTMA 2O8EB 3VQEA 2QM1A 1GLAG 4FM0A 3C65A 4H03B 3L2WA 4GMJB 4DSJA 1ZXOA 3P5JA 5C2DA 3O8MA 3H1VX 3SPZA 3SAGA 1VSDA 1D5AA 4YHHK 2NRVA 1S3XA 1IKVA 2PAVA 2Q3SA 4DSLA 2QXLA 4B9VA 4B1UB 4M3XA 2GUPA 4E0DA 3ZT2A 4M42A 5HLFA 1MDUB 4CJTA 4M7XA 4JD2B 1BWFO 4KTQA 4E7IA 4KRFA 3CCEN 3D45A 2P9SB 1Y64A 1TYQB 3AA3A 3S3MA 1YITN 2IC3A 1W9HA 4CZEA 2V7ZA 3M3ZA 2VQEK 4E7LA 4GVEA 1WSGA 1BDGA 5AQYA 4FLWA 3CHWA 4FWLA 3VEXA 5GADP 3ZSRA 4E1JA 3KWGA 1RT2A 5ADXH 4H0YB 4DTSA 2P9UB 3EKSA 5T7BA 1BCOA 5AQOA 1XHZA 1OKJA 5AQRA 5GIOA 4IDKA 4NLBA 3AAPA 3LAMA 2RN2A 4IO8A 4GVMA 1R0AA 3BZKA 1HRHA 4CK1A 5C12A 3TAFA 3TSQA 4BRGA 4AILC 5AQSA 4KHQA 4JKBA 4H5VA 4FWOA 4J2AA 4M63C 1LV5A 3TTDA 3ULEB 4FJGA 1CXQA 1H1VA 5E41A 5KQ8A 2HHQA 4KHSA 2P5OA 3ZT1A 4KTWA 4BC5A 3CQ8A 3P4IA 4JN4A 4YOVA 1IBKK 3M8QA 2JWKA 2O8CA 2ZD1A 4NCGA 3RMAA 2IIRA 1BQMA 5F2RA 3KZBA 4G1QA 3MAQA 4RW6A 2D0CA 4EHTA 2VG7A 3I33A 3DLKA 1QVGM 1S1TA 1HNVA 3KK2A 1HQUA 3M6GA 2DFHA 3WQUA 2ZGYA 5HRPA 3HO1A 1C0FA 5AQFA 3ZETA 2CGJA 1WB9A 3WNFA 4YOYA 3MXIA 4BE1A 2WBNA 4XEIA 1IKWA 2DPNA 4DR1K 3V81A 2UUCK 1KFSA 4GV3A 2DFFA 1TGOA 3KK3A 5AQZA 3D2EB 1TKXA 4FJMA 4WQ4A 1QQCA 3HK2A 3C0BA 3LDNA 5C42A 3R9PA 3WQTA 5JVHL 5AJ3K 3OTOK 1BG3A 3U9ZA 3O80A 3H45C 3NCIA 4N56A 1NJIO 3AO1A 3HZ6A 4BRLA 5JVGL 2HMPA 4FLYA 4CEOA 3ATVA 2GEMA 3LM2A 1EKEA 2DTUA 4DR5K 1BI4B 2P9IB 4WFNL 3K59A 3SAHA 4DKWA 3EN9A 3PSIA 2V52B 2P51A 1BU6O 5DMRA 4BRKA 3UB5A 4CZIA 1RBVA 4HCCA 5HP1A 5KPZA 1W0HA 4CJVA 3CCRN 2FXUA 2VGMA 1VSHA 2KHOA 3LWLA 4PHTX 1DLOA 1BL3A 2QKBA 3CQXA 5GAEP 4IFEA 3D2FA 4DQRA 4OGEA 4BGAA 1NGIA 4H0OA 4CIGA 3H08A 4JKEA 3AO3A 1HKCA 2VWJA 3L3UA 4YOUA 2QEXN 1MWKA 3MEDA 4FOEA 1D9DA 4LF7K 3J7ZO 4CGGA 1EXQA 4E1NA 2YNHA 4E89A 4WFAL 4JHDA 4O0IA 4HUFA 3D6RA 3DJCA 3TI0A 5J2PA 1CZAN 5LMUK 3OYHA 1CZ9A 2FC0A 5GAHP 3BF1A 4OKEA 2BH1A 2VYPA 1T7PA 2B5JA 4IFVA 2E6MA 2O8BB 4JS4A 3MN6A 2QK9A 4FJKA 4M3UA 4CZGA 3SLCA 1QS4A 1GLCG 1NOYA 3PX0A 4B9TA 1C0GA 4BWJA 5BREA 4RCHA 4C8KA 4CERA 4PL7A 4KV8A 1GOBA 1XNRK 1S1WA 3G10A 4B3RK 1J5OA 3NBPA 3SBTA 3DAWA 1X1PA 1DEJA 5I9EB 4CJWA 2QWPA 4JNEA 3OYIA
chains in the Genus database with same CATH topology
3GDQA 4QS8A 5EXWA 2PFUA 4K25A 2V7YA 3MWTA 2P9KA 2F9TA 4B1YB 5HL7L 1U2VB 3MWPA 5HOOA 4BR4A 1EQYA 3M5RA 3EKUA 2GWKA 2P9PA 3CXCM 3BEXA 4BG9A 1BA1A 4MDBA 3MX5A 2D4WA 2P9NA 5EX5A 4FL9A 4NB4A 1NGCA 1SAZA 1X3MA 5F1XA 4JKGB 3NVMA 5ELZA 4OPAA 4BGBA 3MN5A 5FPMA 4O5FA 4ILJA 5GAGP 4QS9A 3TSPA 3PLAA 4AM7A 4H0TB 4EAHD 2QWLA 4MO4A 3TSUA 1NGFA 1YJNN 2NZTA 3HRGA 3IDHA 3L6QA 3WXLA 3D2FB 3I55N 3O9RA 4DB3A 5BN8A 3PIOL 1NM1A 3SK3A 3SMPA 3K9JA 3WXKA 1YIJN 3A5NC 4B9QA 5M1PA 4BRQA 2QWOA 3AY9A 3OHRA 3VTHA 1WOQA 4A57A 1KQSM 3UKUA 1P8ZA 2KLAA 2UYTA 4R79A 1NGHA 2I7PA 2A42A 3DXMB 4JK9A 4A5AA 4H5NA 3VESA 5KQDA 3CCLN 4UY8O 4JKDA 1YJWN 1U2VA 1RDWX 4IXCA 3CQYA 3O9UA 4EFHA 4OO1J 4Z94A 5AQLA 5FPEA 1K8KB 3DXKA 3I8BA 5BPNA 5AQQA 4BC4A 3ATUA 4BRDA 3GE1A 5BRDA 2WUSA 2E1YA 4BRHA 3ZX0A 4C1NK 3BUZB 3W0LA 2QW9A 3E9PA 5KPTA 2YX6A 4BRFA 1VQNN 3AGRA 3LM9A 2P9LB 2A3ZA 1XC3A 5JICA 2ZJQL 4PL8A 5JLHA 1NGDA 2RE2A 3FZFA 5AQXA 2QWNA 4KH5A 3O9QA 2A6AA 2NRRA 3HBTA 5GIPA 4YOTA 3UKRB 2OTJN 1Q86O 1HPMA 5C0YA 4MLEA 4JKAA 2J4RA 3A0IX 3R1XA 5AFUH 4OPHA 3O5BA 3MK6A 5LJVA 3CCVN 2H3GX 1JCEA 2D1KA 3ENHA 4CBWA 1VQON 3RSEB 1JCFA 4KBOA 4GY2B 2Q0RA 4IZ9A 4WFBL 3CCUN 1TUUA 3IMXA 3OBYA 1YI2N 3CC2N 3KK7A 2VWBA 1T44A 3MX2A 1T6CA 2HBKA 3U9DA 2F9WA 3CPEA 2HSTA 3TPQA 5B8HA 3EZWA 1VQLN 4ILGB 3LDPA 4K43A 3C7NA 4BR9A 1TYQA 2V51B 4GNIA 5BPLA 3CJ1A 4B1WB 4BRAA 3VF2A 2P9PB 2FF6A 2IVPA 3JXUA 3Q7CA 2E2QA 1DGKN 2P9NB 3CF5L 2E2OA 5M1KA 1IG8A 3A8YA 1VQPN 3EL2A 3O9TA 3G71N 2NLXA 1HX1A 2ZWHA 4BQLA 4BREA 1V4TA 2ASMA 3UKRA 5AZJA 1GLEG 2CH6A 1U6ZA 5M1OA 2QA4N 4BRCA 4BVPA 1GLJO 4B1XB 4H0VB 2HBMA 3QBWA 5BRFA 3E1YA 4H5TA 3VEZA 2ZGZA 3TTCA 2GTDA 2P9UA 2D0OA 5E84A 2VCPA 4Y0WA 3RSEA 5AFUA 3ZYYX 4L3QA 3F2KA 3MCPA 3H6EA 2CGKA 3L0QA 1NGBA 4XH1A 3TU5A 1ESVA 5TKWA 2IVNA 1ATRA 3UKUB 5C10A 3FFKB 4A2BA 1QHAA 1NGAA 1KXPA 1ZC6A 1SQKA 4YORA 3H3NO 4YOXA 5F0XA 4BC3A 1Q7YO 4WQ4C 3GBTA 4FVUA 1YUWA 2I7NA 4A2AA 2W40A 4MLHA 5MLCQ 2WFBA 1HLUA 1Z05A 4BRMA 4CZMA 1HKBA 4RWTA 3I56N 2A40A 1J6ZA 4FOIA 3CJBA 3DXKB 4JK7A 4YDUA 2QI2A 2YJFA 5JMVA 1M1KO 1YF5L 3FE1A 3L4QA 3IKMA 3ULEA 5C15A 3VF4A 3QMLA 1GLLO 3WXMB 5LJWA 3VPZA 1VQMN 3WT0A 1GLDG 4JK8A 1TUYA 3CD6N 2OTLN 1GLFO 4K41A 4O8UA 3FGUA 4IJAA 5AZIA 1V4SA 2Q31A 4HTLA 1JCGA 5BN9A 3PIPL 4M7YA 4FWNA 2QM1A 1SS6A 1GLAG 3ENOA 4WQ5C 3C65A 5M1NA 4H03B 4BRNA 4H5RA 3H1QA 3NVKA 3A5LC 1ZXOA 5EOYA 1NMDA 3JS6A 3O8MA 5C2DA 3H1VX 1IJJA 3SAGA 5AQNA 4CZJA 4RTFD 1JJ2M 2NRVA 3DLLL 1K73O 1S3XA 2BUPA 2PAVA 1T6DA 3MCAB 2ASPA 2QXLA 3LL3A 1VQ8N 4B1UB 3BP8A 4CD1A 4FWQA 3VGKA 2BTFA 2GUPA 2IVOA 3OA9A 1MDUB 4M7XA 2ZJPL 3WUHA 1W97L 4JD2B 2A5XA 1BWFO 5TKYA 3R3LA 3LDQA 3T69A 3CCEN 2P9SB 2WC9A 1Y64A 3VERA 3C7NB 4FWPA 1TYQB 3MN9A 1YITN 1QQNA 2E88A 4CZEA 1ILYA 2V7ZA 2E8AA 3CIPA 3M3ZA 5AQTA 1QQOA 3AGKA 2Q36A 4FWRA 3O1BA 5BR9A 3HI0A 4GVEA 1BDGA 5AQYA 3G25A 4A5BA 3CHWA 2AP1A 4FWLA 3OBWA 3VEXA 5GADP 4ISGA 3IUCA 4E1JA 3KWGA 1M90O 5AZJB 4BG8A 5ADXH 2GELA 5FPDA 3CPWM 2YJEA 3CCMN 1RDUA 4H0YB 4BRIA 2ASOA 2AA4A 2P9UB 3QBXA 3EKSA 5AQHA 3QFPA 3CC4N 2HF4A 3GOIA 4AM6A 4FSVA 5AQOA 1W2BM 2F7TA 5AQMA 1K8AO 1KAZA 1OKJA 4NLCA 5AQRA 5M1FA 5GIOA 4JD2A 2YI1A 4KH4A 1RFQA 3AAPA 4NLBA 2P9SA 3CETA 5AQVA 4IO8A 3WEEA 1NWKA 2QEXN 1HUXA 2FSJA 5DM6L 5H1SQ 1VQ4N 3HSCA 5C12A 1HKGA 2P9IA 3TSQA 4BRGA 3FZMA 5AQSA 4GV6A 2FLOA 4JKBA 4H5VA 3AARA 1LOTB 4FWOA 4JKFA 4M63C 1Z6RA 3TTDA 3ULEB 3Q7BA 4FWMA 1H1VA 1BUPA 2GX9A 3QFUA 3ZETB 1VAZA 3M1FA 1GLBG 3O9SA 5KQ8A 2E2NA 3FZHA 4LC9B 4BC5A 3P4IA 4JN4A 3O1WA 4YOVA 4IOCL 3F5TA 2JWKA 1XQSC 5AQGA 5JLFA 1K9MO 3FZKA 1NGEA 5AZIB 2OANA 4BR5A 5ADXA 1X3NA 3NMUA 2IIRA 4CZHA 2NRWA 3MN7A 5F2RA 4BVOA 3KZBA 3SAFA 2YCHA 1OVYA 4I6MA 2QWQA 1X9JA 1YHQN 1RGIA 2HOEA 3S41A 1QZ6A 4DCHA 3E66A 5M1QA 1Q18A 4XH4A 4EHTA 4K42A 3AAQA 3I33A 3CCQN 4IEEA 1QVGM 3T7ZA 3CJ9A 3FR0A 5EVZA 5CE3A 1N8RO 3VOVA 3M6GA 4HWIA 3WQUA 2E2PA 4DQ8A 2ZGYA 3O6WA 3FLCO 3LDOA 1SZ2A 4ILHA 1C0FA 3LDLA 3VGLA 3WXIA 2EWSA 4BY9C 1E4FT 5AQFA 3ZETA 2CGJA 4BC2A 4H0PA 4YOYA 2QTDA 4IWVA 3G6EN 1YXQA 3CCJN 2WBNA 1P90A 4XEIA 2QWRA 3VEYA 2PBDA 3VF6A 4BQZA 2DPNA 3DWLA 1R59O 3CC7N 3O08A 4A62A 5AR0A 1S22A 1ATSA 5CR4A 3RVCA 4H0XB 2YHXA 1LCUA 4GV3A 3N4QA 1D4XA 3IFRA 5AQZA 3D2EB 2NRHA 5AQUA 4IOAL 5AQWA 2GWJA 4CJ7A 4WQ4A 1VQ7N 3KWIA 1NBWA 4JAXA 1VQ5N 3BF3A 5C2FA 3J8AA 1Q81O 3C0BA 3HM8A 1YVNA 3LDNA 4PKHA 3R9PA 3WQTA 3VTIA 4A61A 4B1ZA 5JVHL 3TTFA 3VEOA 2D0PA 2FF3B 1DKGD 2VGNA 2FSNA 4C23A 4O8KA 3EE8A 1BG3A 3U9ZA 3U4LA 3L4IA 1NGJA 3A5OC 3O80A 3H45C 4BR0A 3H3OB 5E26A 5DM7L 2ZJRL 1Q82O 1NJIO 4IDHA 3HZ6A 4IOXA 3R8EA 3P39A 4MDAA 4BRLA 4CZKA 4U7BA 5JVGL 2HMPA 4G9ZA 4NO7A 1MWMA 3HOSA 3ATVA 3CI5A 5AQKA 3WEEB 2GEMA 4B1VA 3LM2A 3O4WA 4FWSA 3N4PA 3C6AA 4BRPA 4JHDB 4WQ5A 2P9IB 4WFNL 1KAYA 3SAHA 3QDKA 4DKWA 3EN9A 3CMAN 1BOTO 3GG4A 5AQIA 3B8AX 4PKIA 5BRHA 2E20A 4H5WA 4CBUA 2V52B 3E9OA 3D2EA 4JKCA 1BU6O 2NRXA 3EO3A 4BRKA 2ITMA 1T3VA 2JWLA 3UB5A 3UE5A 3VEVA 4IJNA 3ZX2A 4CZIA 1ZBSA 1ATNA 3FZLA 4JKGA 1VQ9N 2HBLA 3QICA 1KC8O 5KPZA 1KAXA 3CCRN 4AF1A 5LY3A 2FXUA 2HBJA 4FPBA 4JKHA 2VGMA 2KHOA 4PHTX 4IO9L 1BO5O 3CQXA 4DHYA 5AQJA 3ID6A 5AQPA 5GAEP 4IFEA 3D2FA 4I6MB 5EY4A 4BGAA 1NGIA 2KKZA 3C6HA 4H0OA 4ISEA 1QVFM 3ID8A 3MMVA 4JKEA 1QQMA 4JNEA 1HKCA 2YHYA 4YOUA 1YAGA 3D7EO 3P31A 1MWKA 1BA0A 2E1ZA 4FWKA 4FOEA 4CD3A 4F9OA 4C1NI 3HOTA 2Q0UA 1XUPO 3J7ZO 1VQKN 3CCSN 1YJ9N 4ISFA 1VQ6N 2CGLA 1MA9B 2A41A 3VENA 4WFAL 2NRTA 3DXMA 3CJ7A 4JHDA 1KD1O 3VEWA 4KH6A 3D6RA 1WUAA 3DJCA 3SMSA 1CZAN 4WCEL 2Q2RA 1E4GT 3CMEN 4J8FA 4IEIA 3KVGA 2FSKA 4PKGA 3SBGA 3ZX3A 4GV9A 4A59A 5GAHP 3BF1A 3GL1A 1K8KA 1NLVA 5FPNA 3ZEUB 3WXJA 2HF3A 2BH1A 2VYPA 3U8XA 4BROA 4CZLA 2P9KB 3MN6A 2Q1NA 4XH5A 4MO5A 3MDQA 4YOWA 2YHWA 2Q97A 3H46O 3SLCA 3CJAA 2W41A 1QZ5A 3SJHA 3VMFB 4CZGA 4BR7A 4QS7A 1GLCG 1HJOA 2NNWA 5BPMA 3A5MC 1G99A 3ENBA 1NGGA 2P9LA 3P38A 1C0GA 5BREA 4RCHA 4BR2A 2ZF5O 3VGMA 1EO1A 1DT9A 3CJCA 3E9LA 4EIAA 3KHYA 4EHUA 3F9MA 4CBXA 4CI6A 4PL7A 1S72N 2CH5A 3R6MA 5CHIA 4YDUC 3EE9A 4WF9L 1O13A 2QWMA 4JEPA 4CZFA 2RHKA 4WYBA 5KPRA 5GINA 3G4SN 3SBTA 3QB0A 3DAWA 4FPAA 3VETA 1DEJA 4FO0A 5I9EB 2QWPA 3CERA 4U67L 3HTVA 3OW2M 3W3DA 2NRZA 3ZEUA 3K9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Q A;  3N4P A;  4IOX A; 
#chains in the Genus database with same CATH topology
 4CJ4 A;  1SKR A;  4K25 A;  2F9T A;  4B1Y B;  5HOO A;  3ITH A;  3M5R A;  2EHG A;  4CHP A;  1RT3 A;  1S6P A;  4BG9 A;  3MX5 A;  1XNQ K;  3CYM A;  4DQQ A;  3AA4 A;  1NGC A;  3O4N A;  4Q5V A;  1L3U A;  4E1M A;  4O5F A;  5HRO A;  2YNG A;  3NHG A;  2QWL A;  4MO4 A;  4DTP A;  1BCM A;  4CEE A;  3L2V A;  3HRG A;  5FRN A;  4R5P A;  5CY4 A;  2W6L A;  3I55 N;  1HYS A;  4RW9 A;  2I5J A;  3WXK A;  1YIJ N;  4F4K A;  1I3A A;  4CF8 A;  1KQS M;  3VTH A;  4W5T A;  1RTI A;  1L3T A;  3DXM B;  4JK9 A;  4A5A A;  5KQD A;  4JKD A;  3LAK A;  3PSF A;  1YJW N;  3ALY A;  4EFH A;  5AQL A;  5FPE A;  3DXK A;  3ISN C;  3THX B;  3ATU A;  4BRD A;  3GE1 A;  4FK2 A;  4C1N K;  2F8T A;  3JSM A;  4C8L A;  1VSI A;  1FKP A;  4FJJ A;  2A3Z A;  5JS2 A;  5JIC A;  2O8E A;  4CJL A;  3FZF A;  4F8R A;  5AQX A;  4KH5 A;  3QNN A;  2A6A A;  3JAM O;  1Z25 A;  4YOT A;  3SV3 A;  3UKR B;  4W5Q A;  4HVJ A;  3L2Q A;  3A0I X;  3R1X A;  2XO7 A;  3O5B A;  4F2S A;  4FJ5 A;  4CBW A;  3T1A A;  1KTQ A;  1YI2 N;  4DF4 A;  1S6Q A;  1CZB A;  4LY7 A;  5HRN A;  4EZ6 A;  1T6C A;  1RTD A;  3U9D A;  3CPE A;  2HST A;  1WN7 A;  4JLH A;  3RRH A;  1TYQ A;  3HP9 A;  3VF2 A;  3RR7 A;  4B3M K;  2P9P B;  4ELV A;  1RTJ A;  3AO4 A;  3RMD A;  1NKE A;  4DV0 K;  2P9N B;  4AHC A;  2E2O A;  5M1K A;  3K2P A;  3K5N A;  1HX1 A;  2OZM A;  1TK0 A;  2O4I A;  3QBW A;  3E1Y A;  4H5T A;  3TTC A;  2P9U A;  4Y0W A;  3ZSW A;  3L0Q A;  4XH1 A;  3NGZ A;  4CJU A;  1ATR A;  3UKU B;  5C10 A;  1VHX A;  4ID1 A;  4RG8 A;  1D9F A;  1KXP A;  1ZC6 A;  1SQK A;  4YOR A;  3OYD A;  1HQE A;  4FVU A;  3IG1 A;  4FLZ A;  4DU4 A;  3I56 N;  4JK7 A;  4B8C A;  5C15 A;  3ULE A;  1GLL O;  3VPZ A;  1VQM N;  5IT9 O;  1RT1 A;  4Y1C A;  4JK8 A;  4B08 A;  1N33 K;  3CD6 N;  4K41 A;  2ITG A;  3FGU A;  4IJA A;  2Q31 A;  5J2Q A;  5BN9 A;  1SS6 A;  3ENO A;  3SYZ A;  5M1N A;  2FBV A;  3A5L C;  4DQP A;  2X78 A;  1IJJ A;  3KLG A;  4DV2 K;  4DV4 K;  3QEV A;  3KLE A;  3KK1 A;  3MCA B;  2HVI A;  3MEC A;  2XY8 A;  4FWQ A;  1WAJ A;  2BTF A;  5KRS A;  4W5N A;  2A5X A;  3AVF A;  3R3L A;  4CEF A;  3L2R A;  1C1C A;  2HHX A;  3OY9 A;  1ILY A;  3CIP A;  1QQO A;  2Q36 A;  3QET A;  3HI0 A;  4DU1 A;  3C6U A;  4AQY K;  4KAZ A;  1IBM K;  4A5B A;  2IDO A;  1VSE A;  4PA1 A;  4BG8 A;  2WON A;  5FPD A;  1Y97 A;  2ASO A;  2AA4 A;  3PUF A;  3QBX A;  5AQH A;  2HF4 A;  1W2B M;  4DFJ A;  2F7T A;  2PY5 A;  1NK6 A;  5AQM A;  4CHQ A;  4CIF A;  1K8A O;  4B9N A;  1KAZ A;  4E19 A;  5M1F A;  4KH4 A;  2YI1 A;  1RFQ A;  4IKF A;  1NJW A;  3IRX A;  4OJR A;  1NWK A;  1HUX A;  2FSJ A;  2OPP A;  3J81 O;  5IWA K;  1HKG A;  2P9I A;  4KHP K;  1X9W A;  2FLO A;  3LZI A;  4KO0 A;  1LOT B;  4DR6 K;  5SZT A;  5SWM A;  1DTT A;  1UAX A;  2F4V K;  2W6K A;  1BUP A;  2GX9 A;  3M1F A;  1GLB G;  3O9S A;  1TKZ A;  4QAG A;  4LC9 B;  1VRU A;  3O1W A;  3QLH A;  3F5T A;  3FZK A;  4BR5 A;  4MQ3 A;  4BVO A;  2P1J A;  1IBL K;  1J9A A;  3SAF A;  4DQS A;  4C8M A;  4NCA A;  3LPT A;  1X9J A;  1YHQ N;  4Z0U A;  4DSF A;  1Q18 A;  4LH4 A;  1RDC A;  4IEE A;  5CE3 A;  3VOV A;  2FBT A;  4HWI A;  3IS9 A;  2E2P A;  4H4M A;  2DY4 A;  3SUP A;  3LDL A;  3VGL A;  1QSS A;  2EWS A;  4BY9 C;  4BC2 A;  4B9U A;  4IWV A;  3WNE A;  4CJS A;  4BDP A;  2O8B A;  3VEY A;  1L3V A;  3DWL A;  3O08 A;  3KKR A;  5AR0 A;  4DFM A;  2DFE A;  4H0X B;  3VN5 A;  2YHX A;  1J5E K;  3NF9 A;  1D4X A;  4IOA L;  2GWJ A;  4DR4 K;  2HHS A;  2FBY A;  4CJ7 A;  2O8F B;  1VQ7 N;  4Z4F A;  1RT5 A;  4CHY A;  4FLV A;  4CI6 A;  1YVN A;  1QE1 A;  3VTI A;  1MU2 A;  1CLQ A;  3TTF A;  3VEO A;  2D0P A;  4DV6 K;  4DTM A;  5D3G A;  2OCE A;  4FW1 A;  3VQ8 A;  1NK9 A;  4B8A B;  3L4I A;  3A5O C;  4KB1 A;  3H3O B;  5E26 A;  5DM7 L;  4U7B A;  3R8E A;  4FLX A;  1XMQ K;  1RBR A;  5BR8 K;  3O4W A;  3C6A A;  3TAR A;  1HNI A;  3LP2 A;  1KAY A;  3CMA N;  3J7A P;  3B8A X;  2BGG A;  2ITM A;  1T3V A;  3SJJ A;  4DLG A;  2ZE2 A;  3SQ2 A;  1KRP A;  4FJL A;  3SCX A;  2NUB A;  4FPB A;  4JI4 K;  2HHW A;  1ITG A;  4CF9 A;  4L8R B;  4DHY A;  5AQP A;  2E6L A;  5EY4 A;  4I6M B;  4ISE A;  3C6H A;  3S9H A;  3MMV A;  1QQM A;  2YHY A;  4CD3 A;  1YAG A;  2E1Z A;  1J54 A;  1XUP O;  4M3Z A;  4ISF A;  1VQ6 N;  2G8V A;  2A41 A;  4KFB A;  3VEN A;  3DXM A;  1NK4 A;  4AHV A;  3VEW A;  1WUA A;  1TAQ A;  3L2U A;  1NNE A;  1HNX K;  1E4G T;  1I39 A;  4FLT A;  4IEI A;  3KVG A;  3KD1 E;  4A59 A;  3GL1 A;  1N32 K;  1NLV A;  5FPN A;  3TAN A;  4M3W A;  3THX A;  3WXJ A;  4FVM A;  4DFK A;  3U8X A;  4BRO A;  2P9K B;  5A2Q O;  1HPZ A;  4YOW A;  2YHW A;  3CJA A;  2W41 A;  1QZ5 A;  3SJH A;  3VMF B;  2NNW A;  3A5M C;  4MFB A;  1EX4 A;  3P38 A;  4DTR A;  2ZF5 O;  3OYA A;  1EO1 A;  1KVB A;  1DT9 A;  3E9L A;  3V1O A;  4EIA A;  3VQA A;  1S1X A;  3KHY A;  4EHU A;  3F9M A;  4DQI A;  1RT4 A;  3R6M A;  5CHI A;  4OPK A;  3EE9 A;  4ELU A;  4WF9 L;  1ZBH A;  2QWM A;  3J80 O;  2KW4 A;  4FJI A;  4WYB A;  4JYA K;  4CFA A;  2VG6 A;  3QB0 A;  4DTX A;  3I0R A;  3VQP A;  4FO0 A;  4GKK K;  3HTV A;  3OW2 M;  2E5L K;  3RWU A;  3ZEU A;  3K9K A;  1SL0 A;  1S9E A;  5HL7 L;  4DUZ K;  5FDL A;  4BAC A;  3SUN A;  1E3M A;  2ETJ A;  1EQY A;  4DV1 K;  2GWK A;  1GOA A;  4DTJ A;  2P9P A;  3BEX A;  2ATQ A;  1RIL A;  1WSH A;  4MDB A;  3DOL A;  2D4W A;  2P9N A;  5EX5 A;  2XY6 A;  5EU7 A;  3KJV A;  1SAZ A;  1X3M A;  5F1X A;  3HYF A;  4FM2 A;  4BGB A;  4DV7 K;  3AVN A;  3HXM A;  4CK2 A;  3M8P A;  3AVM A;  3PLA A;  4FK4 A;  4AHR A;  3K5M A;  2PZS A;  1NGF A;  1YJN N;  1WLJ A;  3L6Q A;  3WXL A;  1N6Q A;  3J7Y P;  3I0S A;  3DOK A;  3SK3 A;  1WNS A;  3A2F A;  3K9J A;  3AY9 A;  4KB0 A;  1WOQ A;  4A57 A;  3RMB A;  3UKU A;  4CEC A;  2KLA A;  1NGH A;  4M41 A;  2FBX A;  4X65 K;  1QSY A;  1U2V A;  4O44 A;  3EEQ A;  3CQY A;  4OO1 J;  1K8K B;  4B9L A;  1ZBU A;  1RT6 A;  4O5B A;  1LW2 A;  4DUY K;  4CFC A;  1YTA A;  2F8S A;  3VQD A;  4CCH A;  4ZTJ A;  1U49 A;  2QW9 A;  5KPT A;  3QIP A;  1QSL A;  4BRF A;  1Q8I A;  1SKS A;  1RBT A;  3THW B;  1XC3 A;  1LWC A;  2ZJQ L;  4PL8 A;  5JLH A;  1OH7 A;  3HBT A;  3U3Y A;  3VQ4 A;  1Q86 O;  1RTH A;  1VSJ A;  1UOC A;  4OPH A;  3EZ5 A;  3MK6 A;  5LJV A;  3CCV N;  4E7H A;  1JCE A;  3RSE B;  4WFB L;  4GY2 B;  3THY B;  1TUU A;  3IMX A;  4AHU A;  2O8D A;  2F9W A;  1JXE A;  1TK5 A;  1S1V A;  4ILG B;  3LDP A;  5CZ2 A;  4Z4E A;  4K43 A;  4J2E A;  3BZC A;  2V51 B;  3SNN A;  5BPL A;  3CJ1 A;  3QES A;  4LF6 K;  1WSE A;  3L3V A;  1IG8 A;  3A8Y A;  1VQP N;  3EL2 A;  1NKC A;  3O9T A;  3LPU A;  1V4T A;  4CJ3 A;  4TSX A;  3MXM A;  3HPH A;  1U6Z A;  5M1O A;  4BVP A;  4AHT A;  4OKJ A;  3OYE A;  1GLJ O;  3NGI A;  3OS1 A;  2YKM A;  3VEZ A;  2ZGZ A;  5DM6 L;  5AFU A;  1I94 K;  3ZYY X;  1BGX T;  4L3Q A;  2A1R A;  2CGK A;  3TU5 A;  5TKW A;  2IVN A;  3QEP A;  4A2B A;  2G8W A;  4LFB K;  5C24 A;  2X74 A;  5F0X A;  1Q7Y O;  4ICL A;  3GBT A;  2WFB A;  1Z05 A;  4BRM A;  1ASU A;  4RW7 A;  4CJ5 A;  1JLG A;  3K57 A;  2YJF A;  5JMV A;  1M1K O;  1YF5 L;  2YKN A;  4CF1 A;  3L4Q A;  3VF4 A;  4JI5 K;  3QML A;  3OS0 A;  1TUY A;  4CGH A;  3DLH A;  1ZYQ A;  2O4G A;  4DR3 K;  4JS5 A;  4KHY A;  1A5W A;  3PIP L;  4M7Y A;  3OYF A;  2G8U A;  3NH1 A;  4KKO A;  3EYZ A;  3C94 A;  3KIO A;  4H5R A;  3ZT4 A;  3DM2 A;  5EOY A;  3UIQ A;  4FW2 A;  1OH8 A;  1KLN A;  4OLA A;  4JI0 K;  5AQN A;  4CZJ A;  4RTF D;  3DLL L;  3NFA A;  1NK7 A;  2ASP A;  3LL3 A;  1VQ8 N;  3E01 A;  3BP8 A;  4CD1 A;  3VGK A;  4KHN A;  2IVO A;  3OA9 A;  1XWL A;  1EET A;  2ZJP L;  2KFZ A;  1ASV A;  5TKY A;  2HNZ A;  3RMC A;  2WC9 A;  4BDY A;  1L3S A;  3VER A;  4FWP A;  3MN9 A;  4NYF A;  4KHU A;  4DG1 A;  5AQT A;  1TKT A;  1RNH A;  2XY5 A;  4E7J A;  5I3U A;  4AHS A;  4FJX A;  1NOZ A;  4CGD A;  1NJX A;  3G25 A;  3PO5 A;  2AP1 A;  5LL6 Z;  3OBW A;  3IUC A;  1M90 O;  1LWF A;  1FKO A;  2GEL A;  3QIN A;  3CPW M;  1U47 A;  1RDA A;  3NH0 A;  2O8C B;  2YJE A;  4B9M A;  1C1B A;  4BRI A;  2G8K A;  1KCF A;  1U48 A;  4AM6 A;  4FSV A;  3B6O A;  3C6T A;  4NLC A;  3OS2 A;  4FYD A;  4JD2 A;  1BHL A;  3MEG A;  3QIO A;  4F3T A;  2P9S A;  3CET A;  2Z1G A;  3HST B;  1B9D A;  2GBZ A;  3T1H K;  5H1S Q;  3AVI A;  1VQ4 N;  3V9X A;  4JI1 K;  3NDK A;  3QNO A;  2UXD K;  3FZM A;  4GV6 A;  2UXC K;  5CZ1 A;  1IO2 A;  4JKF A;  1Z6R A;  4CHO A;  4EP5 A;  4FWM A;  3WNH A;  3QFU A;  3ZET B;  1S5J A;  2E2N A;  3C95 A;  3L8B A;  1XQS C;  5AQG A;  5JLF A;  1D8Y A;  1NGE A;  5AZI B;  1X3N A;  4I9Q A;  3NMU A;  3ZSQ A;  4CZH A;  3AV9 A;  2YCH A;  3SI6 A;  4I6M A;  3S41 A;  3ZSO A;  1QZ6 A;  4DCH A;  3E66 A;  5M1Q A;  2G8F A;  4V19 S;  3M8R A;  4FXD A;  4K42 A;  3AAQ A;  2YNI A;  1OH5 A;  1ZBL A;  4K8X A;  3T7Z A;  1N8R O;  4DV3 K;  4OX9 K;  4DQ8 A;  1BIS A;  4B3S K;  3LDO A;  1RDD A;  4ILH A;  3WXI A;  4GW6 A;  1E4F T;  1U45 A;  4X64 K;  2E4L A;  2QTD A;  3G6E N;  3I8D A;  4PQU A;  4BQZ A;  2PBD A;  1TAU A;  1R59 O;  3AVH A;  3CC7 N;  4ZTF A;  1S22 A;  4FZX C;  2GUI A;  3K5L A;  4KRE A;  1LCU A;  3AVJ A;  5KRT A;  5AQW A;  5CYQ A;  4HTU A;  2JGU A;  5C2F A;  1Q81 O;  3HM8 A;  3K0S A;  4A61 A;  2FF3 B;  4LF4 K;  1DKG D;  2FSN A;  2VGN A;  4C23 A;  3NE6 A;  3PV8 A;  4CEZ A;  3EE8 A;  1UA1 A;  3U4L A;  1ASW A;  2EX3 A;  5HBM A;  2ZJR L;  4Y1D A;  1Q82 O;  4IDH A;  1Q9Y A;  4IOX A;  4CZK A;  4G9Z A;  3HL8 A;  4NO7 A;  4DMN A;  3HOS A;  2IS3 A;  2HHV A;  3WEE B;  3N4P A;  2UU9 K;  4CIE A;  4JHD B;  2OPS A;  4CE9 A;  1FJG K;  2B4J A;  2P5G A;  5AQI A;  2HHH K;  2X6N A;  3AVC A;  3D2E A;  4FM1 A;  3V1Q A;  2NRX A;  3EO3 A;  3ZT0 A;  3VEV A;  3ZX2 A;  3UE5 A;  1A5V A;  2OYQ A;  1ATN A;  1VQ9 N;  2HBL A;  3QIC A;  3TR8 A;  5JS1 A;  2D5R A;  1KAX A;  1LWE A;  3M8S A;  4AF1 A;  2HBJ A;  4CJF A;  4EP4 A;  5AQJ A;  3ID6 A;  4DF8 A;  1YT3 A;  2ZQB A;  1QVF M;  3OYC A;  1IKY A;  4FWK A;  4FJ9 A;  1VRT A;  4IFY A;  3CCS N;  1YJ9 N;  2IGI A;  1WBB A;  3TAM A;  3CFO A;  4AH9 A;  1BI4 A;  4KH6 A;  3SMS A;  3VQ7 A;  3LZJ A;  1LAV A;  3CME N;  3O4Q A;  1FXX A;  4PKG A;  3SBG A;  3ZX3 A;  4C8N A;  1K8K A;  3RTV A;  4CZL A;  4XH5 A;  4O4G A;  3AVG A;  1LW0 A;  3MDQ A;  3OYB A;  2Q97 A;  1ZBF A;  4BR7 A;  1IKX A;  2KTQ A;  4QS7 A;  1TK8 A;  1BQN A;  2BAN A;  4PY5 A;  1NGG A;  3SQ4 A;  2KQ2 A;  2VQF K;  3THW A;  4CGJ A;  3VGM A;  1T03 A;  5DK5 A;  1S72 N;  4CBX A;  3SV4 A;  3ZT3 A;  3QEX A;  4CJP A;  1VSM A;  1O13 A;  3O3F A;  4CZF A;  5GIN A;  2X6S A;  1YVU A;  4FPA A;  3S3O A;  3V9U A;  1Q9X A;  4U67 L;  1B92 A;  5EXW A;  3AVK A;  2PFU A;  1N34 K;  4XIU A;  4GKJ K;  1KLM A;  1G15 A;  3NGY A;  3CXC M;  4DFP A;  1BA1 A;  1EWQ A;  1NMN A;  4M3T A;  3NF7 A;  3ZCM A;  4CFD A;  1NK5 A;  4JKG B;  1ZBI A;  5ELZ A;  3MN5 A;  5FPM A;  3VQB A;  3DI6 A;  4B3T K;  5GAG P;  4QS9 A;  1HNW K;  4H0T B;  3V1R A;  1F21 A;  3AO5 A;  1UA0 A;  4ELT A;  2HND A;  4YNQ A;  3OYN A;  3O9R A;  1NJY A;  4DWI A;  5KGW A;  3SPY A;  4HUG A;  1NM1 A;  4BDZ A;  1JLF A;  3A5N C;  4I2P A;  5M1P A;  4UQG A;  2QWO A;  3OHR A;  4R79 A;  3BGR A;  2I7P A;  4LD0 A;  3ULD A;  2HMI A;  4H5N A;  2B6A A;  1RDW X;  1HJR A;  4RW4 A;  4C8O A;  4OPJ A;  3O9U A;  4FZZ A;  1C1A A;  4Z94 A;  3OVN A;  5BPN A;  5AQQ A;  4BC4 A;  1EP4 A;  4CJK A;  3NAE A;  5BRD A;  2WUS A;  2E1Y A;  3ZX0 A;  4CGI A;  4PWD A;  3BUZ B;  3W0L A;  1W7A A;  4CF0 A;  3AGR A;  4FJH A;  2P9L B;  4LF5 K;  4CK3 A;  1RBU A;  1XI1 A;  4DR7 K;  2HB5 A;  2QWN A;  1C0M A;  2NRR A;  5GIP A;  1EWR A;  3DLG A;  3TAP A;  5C0Y A;  1K6Y A;  3U3G A;  3SUQ A;  4K0K K;  5FLX O;  4JKA A;  1VK0 A;  5AFU H;  1JLQ A;  2H3G X;  3ENH A;  3WNG A;  1VQO N;  1JCF A;  2Z1H A;  3LAL A;  3QEW A;  3V9W A;  3CCU N;  3OBY A;  5J2M A;  3CC2 N;  4BWM A;  3KK7 A;  3ASM A;  4I9L A;  4CFB A;  1T44 A;  3MX2 A;  1A5X A;  1L5U A;  2HBK A;  4LF9 K;  3CG7 A;  3LDS A;  1VQL N;  3LAN A;  3K58 A;  3HPG A;  4GNI A;  3DMJ A;  4B1W B;  2Z1I A;  1X9S A;  2Z1J A;  1VSL A;  2FF6 A;  3JXU A;  3Q7C A;  4RW8 A;  4O0J A;  1SKW A;  3ZLJ A;  3CF5 L;  4O55 A;  4DLE A;  2YHA A;  3DLB A;  1KSP A;  5K14 A;  3G71 N;  3OYG A;  3AO2 A;  3VA0 A;  4FLU A;  2ASM A;  3UKR A;  1GLE G;  2CH6 A;  4CGF A;  4IG0 A;  2QA4 N;  4BRC A;  1KVC A;  3QEI A;  3TAG A;  4H0V B;  3HT3 A;  2HBM A;  3O3G A;  2D0O A;  5E84 A;  2VCP A;  2GV9 A;  3F2K A;  3MCP A;  1WBD A;  1NGB A;  1ESV A;  4DS5 A;  3FFK B;  2VG5 A;  1NGA A;  4YFU A;  3H3N O;  4YOX A;  2I7N A;  4A2A A;  5J2N A;  2W40 A;  4NXN K;  4MLH A;  3HVR A;  1HLU A;  3OJU A;  1N5Y A;  1HKB A;  1REV A;  2A40 A;  1J6Z A;  4FOI A;  3CJB A;  2QI2 A;  3IKM A;  5HRS A;  3WXM B;  5LJW A;  2UUA K;  2AJQ A;  3WT0 A;  1GLD G;  4OGC A;  4I2Q A;  1NJZ A;  2D0B A;  4X66 K;  2OTL N;  4O8U A;  5AZI A;  1JCG A;  3ZSZ A;  4CED A;  4FWN A;  2XY7 A;  2G8H A;  4WQ5 C;  2HW3 A;  2KZZ A;  4BRN A;  4Z4C A;  4FK0 A;  3H1Q A;  4FCY A;  3NVK A;  1NMD A;  3JS6 A;  4DV5 K;  4FJN A;  4JI2 K;  4JRP A;  4IG3 A;  3KLF A;  4KHW A;  4E3S A;  1JJ2 M;  3NF8 A;  4LH5 A;  1K73 O;  2BUP A;  1T6D A;  1T8E A;  5C25 A;  2HHU A;  5KGX A;  3WUH A;  1W97 L;  4DTN A;  3LDQ A;  3T69 A;  3F9K A;  4H8K A;  4DTO A;  3C7N B;  1QQN A;  2E88 A;  3CM5 A;  4M45 A;  3PY8 A;  2E8A A;  3CM6 A;  3KD5 E;  1JLB A;  3ZSX A;  3AGK A;  4FWR A;  3DRP A;  3O1B A;  5BR9 A;  1N36 K;  1C6V A;  2F96 A;  4ISG A;  5AZJ B;  2R7Y A;  3TAB A;  3CCM N;  1RDU A;  3P83 D;  4WE1 A;  2YNF A;  3OYJ A;  3QFP A;  3CC4 N;  3GOI A;  4J2B A;  4N76 A;  3V6D A;  1T05 A;  5AQV A;  3WEE A;  1FK9 A;  4J2D A;  3VA3 A;  3HP6 A;  2BE2 A;  3HSC A;  4NXM K;  3AAR A;  4JV5 K;  4HCB A;  2OA8 A;  2LSN A;  3VQC A;  1NK8 A;  2QXF A;  1VAZ A;  4NYN A;  2VWK A;  3F73 A;  3FZH A;  4IOC L;  4F3O A;  1K9M O;  1JKH A;  2OAN A;  5ADX A;  3SUO A;  2NRW A;  3VQ9 A;  3MN7 A;  2UXB K;  4PUO A;  4M3Y A;  4JI7 K;  4DSE A;  1OVY A;  2QWQ A;  1RGI A;  2HOE A;  1HMV A;  4W5O A;  1SV5 A;  4XH4 A;  4E7K A;  3MXJ A;  1U4B A;  1TL1 A;  2HHT A;  3AVL A;  3CCQ N;  4N41 A;  4Z4I A;  3CJ9 A;  3FR0 A;  5EVZ A;  3SQ0 A;  3O6W A;  3FLC O;  1WSF A;  1X9M A;  1SZ2 A;  5CYM A;  2QKK A;  1WAF A;  1TKD A;  4H0P A;  3TAQ A;  1YXQ A;  4OLB A;  5KI6 A;  4CVN E;  1P90 A;  3VF6 A;  2QWR A;  2ZM6 K;  3CCJ N;  3P1G A;  4ID5 A;  4A62 A;  1ATS A;  1HYV A;  5CR4 A;  3RVC A;  1JLE A;  5I42 A;  2HVH A;  3N4Q A;  3IFR A;  1RT7 A;  2NRH A;  5AQU A;  1YTU A;  4LFC K;  3KWI A;  1NBW A;  4JAX A;  1VQ5 N;  3BF3 A;  3J8A A;  4B1Z A;  4PKH A;  4ZHR A;  2OZS A;  2PYL A;  5HRR A;  4FJ7 A;  3FFI A;  4O8K A;  1SL1 A;  3OYM A;  3JYT A;  1NGJ A;  4BR0 A;  3RR8 A;  3HVT A;  3P39 A;  4MDA A;  1MWM A;  1JXB A;  1TL3 A;  3CI5 A;  5AQK A;  4B1V A;  4FWS A;  5KTQ A;  4LF8 K;  4BRP A;  4WQ5 A;  1VSK A;  3DLR A;  3QDK A;  4Z4H A;  1BOT O;  1RDB A;  3GG4 A;  3D0P A;  4LSN A;  4PKI A;  5BRH A;  2E20 A;  4CHZ A;  4H5W A;  4CBU A;  3E9O A;  4JKC A;  1C0T A;  5LMN K;  2WOM A;  2JWL A;  4IJN A;  2O8F A;  1ZBS A;  3FZL A;  4JKG A;  1HNZ K;  4QCL A;  1KC8 O;  3RRG A;  4EZ9 A;  4JI6 K;  1JL2 A;  5LY3 A;  4JKH A;  4IO9 L;  1BO5 O;  1S1U A;  2KKZ A;  5FRM A;  3ID8 A;  4Q0B A;  2OPR A;  4DSK A;  3D7E O;  3P31 A;  4F9O A;  1BA0 A;  3HOT A;  1TVR A;  4C1N I;  3OYK A;  2Q0U A;  1VQK N;  2CGL A;  2JLE A;  1MA9 B;  2NRT A;  3CJ7 A;  3K5O A;  1KD1 O;  4CF2 A;  3SQ1 A;  4F2R A;  4CEA A;  1HYZ A;  1IV0 A;  4WCE L;  2Q2R A;  4Z4G A;  3BY5 A;  3V4I A;  4J8F A;  2FSK A;  1J53 A;  1NKB A;  3DLE A;  4GV9 A;  3CFP A;  4OKK A;  2A1S A;  3ZEU B;  2HF3 A;  1NG9 A;  4KI4 A;  1BIU A;  1RBS A;  3AA2 A;  3LWM A;  4DU3 A;  2Q1N A;  4MO5 A;  2G8I A;  3AVA A;  3H46 O;  4FZY A;  1HJO A;  5BPM A;  3ENB A;  1G99 A;  4KI6 A;  2P9L A;  4JI8 K;  4BR2 A;  4KPY A;  1BIZ A;  3QO9 A;  3CJC A;  1WSI A;  4LFA K;  2CH5 A;  4YDU C;  4JRQ A;  1JL1 A;  3VQ6 A;  4DS4 A;  1GOC A;  2IOC A;  4JEP A;  4B3O A;  1IH7 A;  2RHK A;  3KTQ A;  4CHN A;  5KPR A;  3G4S N;  1NK0 A;  3VQ5 A;  4H4O A;  2IAJ A;  1NU0 A;  4KTZ A;  3HPO A;  3VET A;  3LP3 A;  3OYL A;  3T19 A;  3KKS A;  3CER A;  3W3D A;  3Q7B A;  2NRZ A;  2KZM A;  3GDQ A;  4QS8 A;  3B6P A;  2V7Y A;  3MWT A;  1UWB A;  2P9K A;  4BE2 A;  3KLI A;  1U2V B;  3MWP A;  4BR4 A;  3EKU A;  1DTQ A;  2YHB A;  4CJQ A;  4N5S A;  4OVL A;  4FL9 A;  4NB4 A;  4HUE A;  1HR0 K;  3NVM A;  1OH6 A;  4OPA A;  1XMO K;  2RKI A;  4ILJ A;  3EY1 A;  4LSL A;  3TSP A;  5FRO A;  4AM7 A;  4EAH D;  4M3R A;  4IBN A;  1KVA A;  3TSU A;  3IAY A;  2YV0 X;  2NZT A;  3IDH A;  3D2F B;  3BDP A;  4DB3 A;  5BN8 A;  3PX4 A;  3PIO L;  3SMP A;  4B9Q A;  4BRQ A;  4I7F A;  1P8Z A;  4JI3 K;  2UYT A;  2A42 A;  4UY8 O;  3VES A;  3AVB A;  3CCL N;  3TWH A;  4QOZ B;  1JLC A;  3KLH A;  4IXC A;  2PYJ A;  3MEE A;  1IG9 A;  1SL2 A;  2Y1J A;  2O8D B;  3I8B A;  4K8Z A;  2HNY A;  2RPI A;  1B9F A;  4CEB A;  4BRH A;  4BE0 A;  1QHT A;  2XHB A;  3O3H A;  3E9P A;  1TV6 A;  3DRR A;  1SUQ A;  2YX6 A;  4DSI A;  3DYA A;  1VQN N;  3LM9 A;  1NGD A;  4W5R A;  2RE2 A;  2BDP A;  3O9Q A;  2OPQ A;  2OTJ N;  1HPM A;  4YY3 K;  3V9S A;  4MLE A;  4DTU A;  1XC9 A;  1JLA A;  1U04 A;  3V9Z A;  1KFD A;  2J4R A;  2D1K A;  1C0U A;  4KBO A;  2Q0R A;  3AA5 X;  4IZ9 A;  1CXU A;  1Z26 A;  2VWB A;  1WSJ A;  1LAW A;  4X62 K;  3TPQ A;  3PX6 A;  5B8H A;  3EZW A;  4CJR A;  1VSF A;  3HJF A;  3T1Y K;  3LP1 A;  3C7N A;  4BR9 A;  4HHT A;  4FJ8 A;  4BRA A;  2IVP A;  4DR2 K;  2E2Q A;  1DGK N;  2UUB K;  2XRI A;  1O1W A;  3NF6 A;  2NLX A;  2ZWH A;  4BRE A;  4BQL A;  4N47 A;  3VQQ A;  5AZJ A;  4CEQ A;  3G0Z A;  3OJS A;  3QER A;  4B1X B;  3CFR A;  5BRF A;  2W42 A;  2GTD A;  3DRS A;  3RSE A;  3TAE A;  3ZSY A;  3THY A;  3H6E A;  1RCH A;  4NCB A;  3PO4 A;  1XHX A;  3ZSV A;  1QHA A;  3S3N A;  1S9G A;  4BC3 A;  2D0A A;  4WQ4 C;  3NH2 A;  3T3F A;  1YUW A;  2RF2 A;  5MLC Q;  4RWT A;  1FW6 A;  4CW7 B;  4CZM A;  3HM9 A;  3DXK B;  4CJE A;  3SZ2 A;  4YDU A;  2KFN A;  3FE1 A;  2Y1I A;  3THV A;  4B9S A;  4CES A;  5J1E A;  3LP0 A;  1GLF O;  2WTU A;  1V4S A;  4HTL A;  3U6F A;  1OVQ A;  1QTM A;  2O8E B;  3VQE A;  2QM1 A;  1GLA G;  4FM0 A;  3C65 A;  4H03 B;  3L2W A;  4GMJ B;  4DSJ A;  1ZXO A;  3P5J A;  5C2D A;  3O8M A;  3H1V X;  3SPZ A;  3SAG A;  1VSD A;  1D5A A;  4YHH K;  2NRV A;  1S3X A;  1IKV A;  2PAV A;  2Q3S A;  4DSL A;  2QXL A;  4B9V A;  4B1U B;  4M3X A;  2GUP A;  4E0D A;  3ZT2 A;  4M42 A;  5HLF A;  1MDU B;  4CJT A;  4M7X A;  4JD2 B;  1BWF O;  4KTQ A;  4E7I A;  4KRF A;  3CCE N;  3D45 A;  2P9S B;  1Y64 A;  1TYQ B;  3AA3 A;  3S3M A;  1YIT N;  2IC3 A;  1W9H A;  4CZE A;  2V7Z A;  3M3Z A;  2VQE K;  4E7L A;  4GVE A;  1WSG A;  1BDG A;  5AQY A;  4FLW A;  3CHW A;  4FWL A;  3VEX A;  5GAD P;  3ZSR A;  4E1J A;  3KWG A;  1RT2 A;  5ADX H;  4H0Y B;  4DTS A;  2P9U B;  3EKS A;  5T7B A;  1BCO A;  5AQO A;  1XHZ A;  1OKJ A;  5AQR A;  5GIO A;  4IDK A;  4NLB A;  3AAP A;  3LAM A;  2RN2 A;  4IO8 A;  4GVM A;  1R0A A;  3BZK A;  1HRH A;  4CK1 A;  5C12 A;  3TAF A;  3TSQ A;  4BRG A;  4AIL C;  5AQS A;  4KHQ A;  4JKB A;  4H5V A;  4FWO A;  4J2A A;  4M63 C;  1LV5 A;  3TTD A;  3ULE B;  4FJG A;  1CXQ A;  1H1V A;  5E41 A;  5KQ8 A;  2HHQ A;  4KHS A;  2P5O A;  3ZT1 A;  4KTW A;  4BC5 A;  3CQ8 A;  3P4I A;  4JN4 A;  4YOV A;  1IBK K;  3M8Q A;  2JWK A;  2O8C A;  2ZD1 A;  4NCG A;  3RMA A;  2IIR A;  1BQM A;  5F2R A;  3KZB A;  4G1Q A;  3MAQ A;  4RW6 A;  2D0C A;  4EHT A;  2VG7 A;  3I33 A;  3DLK A;  1QVG M;  1S1T A;  1HNV A;  3KK2 A;  1HQU A;  3M6G A;  2DFH A;  3WQU A;  2ZGY A;  5HRP A;  3HO1 A;  1C0F A;  5AQF A;  3ZET A;  2CGJ A;  1WB9 A;  3WNF A;  4YOY A;  3MXI A;  4BE1 A;  2WBN A;  4XEI A;  1IKW A;  2DPN A;  4DR1 K;  3V81 A;  2UUC K;  1KFS A;  4GV3 A;  2DFF A;  1TGO A;  3KK3 A;  5AQZ A;  3D2E B;  1TKX A;  4FJM A;  4WQ4 A;  1QQC A;  3HK2 A;  3C0B A;  3LDN A;  5C42 A;  3R9P A;  3WQT A;  5JVH L;  5AJ3 K;  3OTO K;  1BG3 A;  3U9Z A;  3O80 A;  3H45 C;  3NCI A;  4N56 A;  1NJI O;  3AO1 A;  3HZ6 A;  4BRL A;  5JVG L;  2HMP A;  4FLY A;  4CEO A;  3ATV A;  2GEM A;  3LM2 A;  1EKE A;  2DTU A;  4DR5 K;  1BI4 B;  2P9I B;  4WFN L;  3K59 A;  3SAH A;  4DKW A;  3EN9 A;  3PSI A;  2V52 B;  2P51 A;  1BU6 O;  5DMR A;  4BRK A;  3UB5 A;  4CZI A;  1RBV A;  4HCC A;  5HP1 A;  5KPZ A;  1W0H A;  4CJV A;  3CCR N;  2FXU A;  2VGM A;  1VSH A;  2KHO A;  3LWL A;  4PHT X;  1DLO A;  1BL3 A;  2QKB A;  3CQX A;  5GAE P;  4IFE A;  3D2F A;  4DQR A;  4OGE A;  4BGA A;  1NGI A;  4H0O A;  4CIG A;  3H08 A;  4JKE A;  3AO3 A;  1HKC A;  2VWJ A;  3L3U A;  4YOU A;  2QEX N;  1MWK A;  3MED A;  4FOE A;  1D9D A;  4LF7 K;  3J7Z O;  4CGG A;  1EXQ A;  4E1N A;  2YNH A;  4E89 A;  4WFA L;  4JHD A;  4O0I A;  4HUF A;  3D6R A;  3DJC A;  3TI0 A;  5J2P A;  1CZA N;  5LMU K;  3OYH A;  1CZ9 A;  2FC0 A;  5GAH P;  3BF1 A;  4OKE A;  2BH1 A;  2VYP A;  1T7P A;  2B5J A;  4IFV A;  2E6M A;  2O8B B;  4JS4 A;  3MN6 A;  2QK9 A;  4FJK A;  4M3U A;  4CZG A;  3SLC A;  1QS4 A;  1GLC G;  1NOY A;  3PX0 A;  4B9T A;  1C0G A;  4BWJ A;  5BRE A;  4RCH A;  4C8K A;  4CER A;  4PL7 A;  4KV8 A;  1GOB A;  1XNR K;  1S1W A;  3G10 A;  4B3R K;  1J5O A;  3NBP A;  3SBT A;  3DAW A;  1X1P A;  1DEJ A;  5I9E B;  4CJW A;  2QWP A;  4JNE A;  3OYI A; 
#chains in the Genus database with same CATH homology
 3GDQ A;  4QS8 A;  5EXW A;  2PFU A;  4K25 A;  2V7Y A;  3MWT A;  2P9K A;  2F9T A;  4B1Y B;  5HL7 L;  1U2V B;  3MWP A;  5HOO A;  4BR4 A;  1EQY A;  3M5R A;  3EKU A;  2GWK A;  2P9P A;  3CXC M;  3BEX A;  4BG9 A;  1BA1 A;  4MDB A;  3MX5 A;  2D4W A;  2P9N A;  5EX5 A;  4FL9 A;  4NB4 A;  1NGC A;  1SAZ A;  1X3M A;  5F1X A;  4JKG B;  3NVM A;  5ELZ A;  4OPA A;  4BGB A;  3MN5 A;  5FPM A;  4O5F A;  4ILJ A;  5GAG P;  4QS9 A;  3TSP A;  3PLA A;  4AM7 A;  4H0T B;  4EAH D;  2QWL A;  4MO4 A;  3TSU A;  1NGF A;  1YJN N;  2NZT A;  3HRG A;  3IDH A;  3L6Q A;  3WXL A;  3D2F B;  3I55 N;  3O9R A;  4DB3 A;  5BN8 A;  3PIO L;  1NM1 A;  3SK3 A;  3SMP A;  3K9J A;  3WXK A;  1YIJ N;  3A5N C;  4B9Q A;  5M1P A;  4BRQ A;  2QWO A;  3AY9 A;  3OHR A;  3VTH A;  1WOQ A;  4A57 A;  1KQS M;  3UKU A;  1P8Z A;  2KLA A;  2UYT A;  4R79 A;  1NGH A;  2I7P A;  2A42 A;  3DXM B;  4JK9 A;  4A5A A;  4H5N A;  3VES A;  5KQD A;  3CCL N;  4UY8 O;  4JKD A;  1YJW N;  1U2V A;  1RDW X;  4IXC A;  3CQY A;  3O9U A;  4EFH A;  4OO1 J;  4Z94 A;  5AQL A;  5FPE A;  1K8K B;  3DXK A;  3I8B A;  5BPN A;  5AQQ A;  4BC4 A;  3ATU A;  4BRD A;  3GE1 A;  5BRD A;  2WUS A;  2E1Y A;  4BRH A;  3ZX0 A;  4C1N K;  3BUZ B;  3W0L A;  2QW9 A;  3E9P A;  5KPT A;  2YX6 A;  4BRF A;  1VQN N;  3AGR A;  3LM9 A;  2P9L B;  2A3Z A;  1XC3 A;  5JIC A;  2ZJQ L;  4PL8 A;  5JLH A;  1NGD A;  2RE2 A;  3FZF A;  5AQX A;  2QWN A;  4KH5 A;  3O9Q A;  2A6A A;  2NRR A;  3HBT A;  5GIP A;  4YOT A;  3UKR B;  2OTJ N;  1Q86 O;  1HPM A;  5C0Y A;  4MLE A;  4JKA A;  2J4R A;  3A0I X;  3R1X A;  5AFU H;  4OPH A;  3O5B A;  3MK6 A;  5LJV A;  3CCV N;  2H3G X;  1JCE A;  2D1K A;  3ENH A;  4CBW A;  1VQO N;  3RSE B;  1JCF A;  4KBO A;  4GY2 B;  2Q0R A;  4IZ9 A;  4WFB L;  3CCU N;  1TUU A;  3IMX A;  3OBY A;  1YI2 N;  3CC2 N;  3KK7 A;  2VWB A;  1T44 A;  3MX2 A;  1T6C A;  2HBK A;  3U9D A;  2F9W A;  3CPE A;  2HST A;  3TPQ A;  5B8H A;  3EZW A;  1VQL N;  4ILG B;  3LDP A;  4K43 A;  3C7N A;  4BR9 A;  1TYQ A;  2V51 B;  4GNI A;  5BPL A;  3CJ1 A;  4B1W B;  4BRA A;  3VF2 A;  2P9P B;  2FF6 A;  2IVP A;  3JXU A;  3Q7C A;  2E2Q A;  1DGK N;  2P9N B;  3CF5 L;  2E2O A;  5M1K A;  1IG8 A;  3A8Y A;  1VQP N;  3EL2 A;  3O9T A;  3G71 N;  2NLX A;  1HX1 A;  2ZWH A;  4BQL A;  4BRE A;  1V4T A;  2ASM A;  3UKR A;  5AZJ A;  1GLE G;  2CH6 A;  1U6Z A;  5M1O A;  2QA4 N;  4BRC A;  4BVP A;  1GLJ O;  4B1X B;  4H0V B;  2HBM A;  3QBW A;  5BRF A;  3E1Y A;  4H5T A;  3VEZ A;  2ZGZ A;  3TTC A;  2GTD A;  2P9U A;  2D0O A;  5E84 A;  2VCP A;  4Y0W A;  3RSE A;  5AFU A;  3ZYY X;  4L3Q A;  3F2K A;  3MCP A;  3H6E A;  2CGK A;  3L0Q A;  1NGB A;  4XH1 A;  3TU5 A;  1ESV A;  5TKW A;  2IVN A;  1ATR A;  3UKU B;  5C10 A;  3FFK B;  4A2B A;  1QHA A;  1NGA A;  1KXP A;  1ZC6 A;  1SQK A;  4YOR A;  3H3N O;  4YOX A;  5F0X A;  4BC3 A;  1Q7Y O;  4WQ4 C;  3GBT A;  4FVU A;  1YUW A;  2I7N A;  4A2A A;  2W40 A;  4MLH A;  5MLC Q;  2WFB A;  1HLU A;  1Z05 A;  4BRM A;  4CZM A;  1HKB A;  4RWT A;  3I56 N;  2A40 A;  1J6Z A;  4FOI A;  3CJB A;  3DXK B;  4JK7 A;  4YDU A;  2QI2 A;  2YJF A;  5JMV A;  1M1K O;  1YF5 L;  3FE1 A;  3L4Q A;  3IKM A;  3ULE A;  5C15 A;  3VF4 A;  3QML A;  1GLL O;  3WXM B;  5LJW A;  3VPZ A;  1VQM N;  3WT0 A;  1GLD G;  4JK8 A;  1TUY A;  3CD6 N;  2OTL N;  1GLF O;  4K41 A;  4O8U A;  3FGU A;  4IJA A;  5AZI A;  1V4S A;  2Q31 A;  4HTL A;  1JCG A;  5BN9 A;  3PIP L;  4M7Y A;  4FWN A;  2QM1 A;  1SS6 A;  1GLA G;  3ENO A;  4WQ5 C;  3C65 A;  5M1N A;  4H03 B;  4BRN A;  4H5R A;  3H1Q A;  3NVK A;  3A5L C;  1ZXO A;  5EOY A;  1NMD A;  3JS6 A;  3O8M A;  5C2D A;  3H1V X;  1IJJ A;  3SAG A;  5AQN A;  4CZJ A;  4RTF D;  1JJ2 M;  2NRV A;  3DLL L;  1K73 O;  1S3X A;  2BUP A;  2PAV A;  1T6D A;  3MCA B;  2ASP A;  2QXL A;  3LL3 A;  1VQ8 N;  4B1U B;  3BP8 A;  4CD1 A;  4FWQ A;  3VGK A;  2BTF A;  2GUP A;  2IVO A;  3OA9 A;  1MDU B;  4M7X A;  2ZJP L;  3WUH A;  1W97 L;  4JD2 B;  2A5X A;  1BWF O;  5TKY A;  3R3L A;  3LDQ A;  3T69 A;  3CCE N;  2P9S B;  2WC9 A;  1Y64 A;  3VER A;  3C7N B;  4FWP A;  1TYQ B;  3MN9 A;  1YIT N;  1QQN A;  2E88 A;  4CZE A;  1ILY A;  2V7Z A;  2E8A A;  3CIP A;  3M3Z A;  5AQT A;  1QQO A;  3AGK A;  2Q36 A;  4FWR A;  3O1B A;  5BR9 A;  3HI0 A;  4GVE A;  1BDG A;  5AQY A;  3G25 A;  4A5B A;  3CHW A;  2AP1 A;  4FWL A;  3OBW A;  3VEX A;  5GAD P;  4ISG A;  3IUC A;  4E1J A;  3KWG A;  1M90 O;  5AZJ B;  4BG8 A;  5ADX H;  2GEL A;  5FPD A;  3CPW M;  2YJE A;  3CCM N;  1RDU A;  4H0Y B;  4BRI A;  2ASO A;  2AA4 A;  2P9U B;  3QBX A;  3EKS A;  5AQH A;  3QFP A;  3CC4 N;  2HF4 A;  3GOI A;  4AM6 A;  4FSV A;  5AQO A;  1W2B M;  2F7T A;  5AQM A;  1K8A O;  1KAZ A;  1OKJ A;  4NLC A;  5AQR A;  5M1F A;  5GIO A;  4JD2 A;  2YI1 A;  4KH4 A;  1RFQ A;  3AAP A;  4NLB A;  2P9S A;  3CET A;  5AQV A;  4IO8 A;  3WEE A;  1NWK A;  2QEX N;  1HUX A;  2FSJ A;  5DM6 L;  5H1S Q;  1VQ4 N;  3HSC A;  5C12 A;  1HKG A;  2P9I A;  3TSQ A;  4BRG A;  3FZM A;  5AQS A;  4GV6 A;  2FLO A;  4JKB A;  4H5V A;  3AAR A;  1LOT B;  4FWO A;  4JKF A;  4M63 C;  1Z6R A;  3TTD A;  3ULE B;  3Q7B A;  4FWM A;  1H1V A;  1BUP A;  2GX9 A;  3QFU A;  3ZET B;  1VAZ A;  3M1F A;  1GLB G;  3O9S A;  5KQ8 A;  2E2N A;  3FZH A;  4LC9 B;  4BC5 A;  3P4I A;  4JN4 A;  3O1W A;  4YOV A;  4IOC L;  3F5T A;  2JWK A;  1XQS C;  5AQG A;  5JLF A;  1K9M O;  3FZK A;  1NGE A;  5AZI B;  2OAN A;  4BR5 A;  5ADX A;  1X3N A;  3NMU A;  2IIR A;  4CZH A;  2NRW A;  3MN7 A;  5F2R A;  4BVO A;  3KZB A;  3SAF A;  2YCH A;  1OVY A;  4I6M A;  2QWQ A;  1X9J A;  1YHQ N;  1RGI A;  2HOE A;  3S41 A;  1QZ6 A;  4DCH A;  3E66 A;  5M1Q A;  1Q18 A;  4XH4 A;  4EHT A;  4K42 A;  3AAQ A;  3I33 A;  3CCQ N;  4IEE A;  1QVG M;  3T7Z A;  3CJ9 A;  3FR0 A;  5EVZ A;  5CE3 A;  1N8R O;  3VOV A;  3M6G A;  4HWI A;  3WQU A;  2E2P A;  4DQ8 A;  2ZGY A;  3O6W A;  3FLC O;  3LDO A;  1SZ2 A;  4ILH A;  1C0F A;  3LDL A;  3VGL A;  3WXI A;  2EWS A;  4BY9 C;  1E4F T;  5AQF A;  3ZET A;  2CGJ A;  4BC2 A;  4H0P A;  4YOY A;  2QTD A;  4IWV A;  3G6E N;  1YXQ A;  3CCJ N;  2WBN A;  1P90 A;  4XEI A;  2QWR A;  3VEY A;  2PBD A;  3VF6 A;  4BQZ A;  2DPN A;  3DWL A;  1R59 O;  3CC7 N;  3O08 A;  4A62 A;  5AR0 A;  1S22 A;  1ATS A;  5CR4 A;  3RVC A;  4H0X B;  2YHX A;  1LCU A;  4GV3 A;  3N4Q A;  1D4X A;  3IFR A;  5AQZ A;  3D2E B;  2NRH A;  5AQU A;  4IOA L;  5AQW A;  2GWJ A;  4CJ7 A;  4WQ4 A;  1VQ7 N;  3KWI A;  1NBW A;  4JAX A;  1VQ5 N;  3BF3 A;  5C2F A;  3J8A A;  1Q81 O;  3C0B A;  3HM8 A;  1YVN A;  3LDN A;  4PKH A;  3R9P A;  3WQT A;  3VTI A;  4A61 A;  4B1Z A;  5JVH L;  3TTF A;  3VEO A;  2D0P A;  2FF3 B;  1DKG D;  2VGN A;  2FSN A;  4C23 A;  4O8K A;  3EE8 A;  1BG3 A;  3U9Z A;  3U4L A;  3L4I A;  1NGJ A;  3A5O C;  3O80 A;  3H45 C;  4BR0 A;  3H3O B;  5E26 A;  5DM7 L;  2ZJR L;  1Q82 O;  1NJI O;  4IDH A;  3HZ6 A;  4IOX A;  3R8E A;  3P39 A;  4MDA A;  4BRL A;  4CZK A;  4U7B A;  5JVG L;  2HMP A;  4G9Z A;  4NO7 A;  1MWM A;  3HOS A;  3ATV A;  3CI5 A;  5AQK A;  3WEE B;  2GEM A;  4B1V A;  3LM2 A;  3O4W A;  4FWS A;  3N4P A;  3C6A A;  4BRP A;  4JHD B;  4WQ5 A;  2P9I B;  4WFN L;  1KAY A;  3SAH A;  3QDK A;  4DKW A;  3EN9 A;  3CMA N;  1BOT O;  3GG4 A;  5AQI A;  3B8A X;  4PKI A;  5BRH A;  2E20 A;  4H5W A;  4CBU A;  2V52 B;  3E9O A;  3D2E A;  4JKC A;  1BU6 O;  2NRX A;  3EO3 A;  4BRK A;  2ITM A;  1T3V A;  2JWL A;  3UB5 A;  3UE5 A;  3VEV A;  4IJN A;  3ZX2 A;  4CZI A;  1ZBS A;  1ATN A;  3FZL A;  4JKG A;  1VQ9 N;  2HBL A;  3QIC A;  1KC8 O;  5KPZ A;  1KAX A;  3CCR N;  4AF1 A;  5LY3 A;  2FXU A;  2HBJ A;  4FPB A;  4JKH A;  2VGM A;  2KHO A;  4PHT X;  4IO9 L;  1BO5 O;  3CQX A;  4DHY A;  5AQJ A;  3ID6 A;  5AQP A;  5GAE P;  4IFE A;  3D2F A;  4I6M B;  5EY4 A;  4BGA A;  1NGI A;  2KKZ A;  3C6H A;  4H0O A;  4ISE A;  1QVF M;  3ID8 A;  3MMV A;  4JKE A;  1QQM A;  4JNE A;  1HKC A;  2YHY A;  4YOU A;  1YAG A;  3D7E O;  3P31 A;  1MWK A;  1BA0 A;  2E1Z A;  4FWK A;  4FOE A;  4CD3 A;  4F9O A;  4C1N I;  3HOT A;  2Q0U A;  1XUP O;  3J7Z O;  1VQK N;  3CCS N;  1YJ9 N;  4ISF A;  1VQ6 N;  2CGL A;  1MA9 B;  2A41 A;  3VEN A;  4WFA L;  2NRT A;  3DXM A;  3CJ7 A;  4JHD A;  1KD1 O;  3VEW A;  4KH6 A;  3D6R A;  1WUA A;  3DJC A;  3SMS A;  1CZA N;  4WCE L;  2Q2R A;  1E4G T;  3CME N;  4J8F A;  4IEI A;  3KVG A;  2FSK A;  4PKG A;  3SBG A;  3ZX3 A;  4GV9 A;  4A59 A;  5GAH P;  3BF1 A;  3GL1 A;  1K8K A;  1NLV A;  5FPN A;  3ZEU B;  3WXJ A;  2HF3 A;  2BH1 A;  2VYP A;  3U8X A;  4BRO A;  4CZL A;  2P9K B;  3MN6 A;  2Q1N A;  4XH5 A;  4MO5 A;  3MDQ A;  4YOW A;  2YHW A;  2Q97 A;  3H46 O;  3SLC A;  3CJA A;  2W41 A;  1QZ5 A;  3SJH A;  3VMF B;  4CZG A;  4BR7 A;  4QS7 A;  1GLC G;  1HJO A;  2NNW A;  5BPM A;  3A5M C;  1G99 A;  3ENB A;  1NGG A;  2P9L A;  3P38 A;  1C0G A;  5BRE A;  4RCH A;  4BR2 A;  2ZF5 O;  3VGM A;  1EO1 A;  1DT9 A;  3CJC A;  3E9L A;  4EIA A;  3KHY A;  4EHU A;  3F9M A;  4CBX A;  4CI6 A;  4PL7 A;  1S72 N;  2CH5 A;  3R6M A;  5CHI A;  4YDU C;  3EE9 A;  4WF9 L;  1O13 A;  2QWM A;  4JEP A;  4CZF A;  2RHK A;  4WYB A;  5KPR A;  5GIN A;  3G4S N;  3SBT A;  3QB0 A;  3DAW A;  4FPA A;  3VET A;  1DEJ A;  4FO0 A;  5I9E B;  2QWP A;  3CER A;  4U67 L;  3HTV A;  3OW2 M;  3W3D A;  2NRZ A;  3ZEU A;  3K9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...