3DOKA

Crystal structure of k103n mutant hiv-1 reverse transcriptase in complex with gw678248.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
539
structure length
535
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 143
structure length 535
sequence length 539
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dokA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dokA05
4DFJA 1GOBA 1C1CB 4CJWA 3K5OA 2G8KA 2Q3SA 1XC9A 3NFAA 1C0UA 2O5DA 3DOKB 1RYSA 3NH2A 4ID5B 3B6PA 1IG9A 4KI4A 4XO0A 1ASUA 2AGOA 3GIMA 3C94A 3CM6A 3K59A 5KFKA 1Q8IA 2IA6A 3NE6A 3S3MA 2BR0A 1SUQB 1JLGB 3QLHB 4IRCA 4M3WA 4WE1B 1KVAA 3CO9A 3QEIA 3L2UA 3SQ0A 4FJ5A 1S1UA 4IH7A 3KJVB 2HHSA 4DG1B 5JXSA 2X78A 2WOMB 3H5YA 3KNAA 3KK1B 3GILA 4G1QB 4ZPCA 1S1VB 2IAJA 4OL8A 3AA5X 3ZSXA 1QS4A 4CJQA 4F4KA 3KLHA 3VA3A 2D3ZA 1MU2A 4HUFA 1JKHB 2R8KA 3KLFA 1FKOA 3CM5A 5C24B 2QV6A 1HPZA 2AGPA 4YR2A 2NUBA 1KLMA 4QPXA 4G3IA 3QO9B 1WSEA 1QTMA 5SZTA 1JLEA 4KO0B 4KKOB 1R0AB 4E0DA 3EZUA 4E7JA 4RW7B 2AQ4A 3KKSA 4O4GA 2IOCA 3OYIA 1IKYB 1IKWA 3P83D 4RNNA 3I0RA 2Y1JA 2OPSA 4RW9A 3V6JA 4EYHB 5FDLA 3HPHA 2D0BA 4DLEA 4CJVA 2PYJA 4E7IA 3RWUA 2D3UA 3DDKA 5KT4A 3KHHA 1HQEB 4MFBB 3CJ4A 4OGCA 2UVVA 4RU9A 3M9NB 1FK9B 4F8RA 2IC3B 4JV2A 4KB7A 5EU7A 1NK8A 3VA0A 1LW2A 3LDSA 4EO6A 4BDPA 3E01A 2W42A 4YNQA 5J2PA 4CEQA 4IG3B 1FKPB 1HNVB 4CEFA 1XI1A 3P1GA 4PWDA 2HVHA 3V9SA 3CVKA 5DGAA 4WZMA 2AGQA 2RKIB 3SZ2A 4KHMA 4CGDA 4BE0A 2WK4A 4ECQA 2FVCA 3FDSA 3IN5A 1WSFA 2F8TA 1S0MA 4LSLB 1WNEA 3OYJA 1C6VA 1VRUB 3LZIA 3C6UA 2IM0A 1DTQB 1QAJA 1NOZA 1T05A 3NGYA 1T03A 2HW3A 3H4DA 4TQSA 3TI0A 3BJYA 3AA2A 3OVNA 3MEDB 4NRUA 2JC1A 1TVRB 1VRTB 4DQQA 1W25A 4NRTA 3OYGA 3H4BA 3DYAB 1C1AA 4FM0A 2BANA 3KK2A 2R2RA 5EWFA 4L8RB 1N5YA 5KG3A 2AX1A 2BDPA 4H4MA 4KRFA 3UIQA 3M8PA 2BQUA 1QUVA 1JLAB 4MKBA 3ZSQA 3IRXB 3FSIA 3WNFA 4C8MA 4EZ9A 4WFYA 2XO7A 3MR3A 3MR5A 4CCHA 1TKTB 3AVNA 1BQMB 1LWEB 4OKKA 3DLBA 5F8LA 2OPRB 4DTRA 4I7FA 1IKVA 2CKWA 1JIHA 3TR8A 2FBXA 2OPQB 3L3VA 1XR7A 3M8QB 4F4WA 4LY7A 2BRLA 2VA2A 5KFXA 3ISND 2GV9A 1JLBA 2UVUA 4ELVA 5FRNA 3QGHA 1ZBIA 1TV6A 4N41A 5KFFA 3AVJA 4RW8A 2OH2A 5KGWA 4W5QA 3T1AA 2ILZA 5JS1A 4ED8A 2D7SA 4J2DA 4KHNA 4M3ZA 4YR0A 1EP4A 2JEIA 1WAJA 4ZTFA 3ZT2A 2I1RA 3DOKA 4ZVEA 4ID5A 4ECUA 4AH9A 1HNIB 5KFTA 5L9XA 4ZP8A 4CJEA 2YKMA 5DQIA 1RDCA 4ECTA 1SUQA 2EHGA 1QSSA 2RDJA 3QLHA 4NLWA 2BQRA 4Q5VA 4CFAA 3OS2A 3VQ6A 4Z4IA 3KLEB 1RT7A 4BWJA 2W9AA 2ATLA 3KJVA 4CJ3A 4DG1A 3VQBA 3RB4A 4K4YA 2WOMA 2UUTA 4Z4HA 3KK1A 2FLNA 4G1QA 3V6DA 4FJLA 4FLVA 3MR6A 1S1VA 4AHSA 3MEGB 3B6OA 1U45A 1DLOB 3MECA 4J9MA 4DFMA 4J9QA 2E6LA 2RF2B 1K6YA 1S1UB 3QO9A 2R2TA 3KTQA 4ZP9A 2KZMA 5C5JA 4KKOA 1R0AA 1NK9A 4TN2A 1D9FA 2IAJB 3QIPB 4ZHRA 4H4OB 1IKYA 4Q43A 3ZT3A 2HNYB 4DU1A 3OYKA 4KB0A 2R2UA 4DSLA 2ZE2B 3VQQA 4Z4GA 1FKOB 1HQUB 3HYFA 3LALA 4B08A 2IBKA 4Z4FA 3IGNA 5DLGA 1VSMA 3QINA 4DFPA 2XI2A 3QEVA 2BRKA 3RMBA 4KE5A 4URSA 2QKKA 3VQ8A 4EBCA 4FZYA 4KREA 4CEZA 1X9SA 1N6QB 2F8EX 3AVMA 4FJ7A 4QWEA 1HRHA 3PUFA 3T5HA 3LWMA 3H5SA 4MFBA 1JLQB 5KT3A 3NAHA 3AVGA 3PX4A 5KFSA 4ED2A 1CXUA 1SKRA 3I0RB 3F9KA 1FK9A 3JSMB 3HVWA 4CJLA 4O3SA 2KW4A 3S9HA 4U7CA 4NLOA 4E19A 5F8MA 4QAGA 1U09A 3ASMA 4FJJA 4M45A 2C2EA 4IG3A 4DQPA 4RW6A 4IR1A 4CGGA 1BGXT 1FKPA 1HNVA 3VQCA 3TABA 1L3SA 3MTKA 4I2QB 3TAMB 2RKIA 4CHNA 3CJ3A 5KFLA 1TKXB 2E9TA 4E7HA 3AVHA 4EP4A 4ZPAA 5HLFB 4R8UA 4JUZA 4LSLA 3D45A 4Y2AA 4TYBA 4ICLB 1RT1A 3LAMA 4PWDB 3ZT0A 2IS3A 3ITHB 1JL1A 4E89A 1NK5A 3RR7A 3TWHA 4OKJA 4DL5A 4LSNB 1MMLA 3MEDA 3DOLB 1TVRA 1VRTA 2AU0A 2DFHA 5KT7A 3NF7A 3KIOA 3L2VA 3E51A 4IQXA 4M3YA 1RBTA 4BDYA 3NCIA 4DQRA 4BE1A 2HVIA 3MXJA 3V1QA 1W9HA 4ECRA 1ZTWA 3H59A 1T03B 4PUOA 1B9DA 2X6SA 3HJFA 2AWZA 3OL6A 4FLZA 4HUGA 3PX6A 3K5LA 1NK6A 4K4TA 2YKNB 4CEBA 3LP0A 1TKTA 1GX5A 4F4YA 1LWEA 4QWDA 4IDKB 2OPRA 2E4LA 4MK7A 3H5XA 1RT6B 3RRHA 3M8PB 2YHAA 2OPQA 3M8QA 4NLUA 3HP9A 4DL4A 3M9OB 3TVKA 4FJ9A 3RBEA 3QERA 2ITGA 2FBTA 1G15A 1RBVA 3ISNC 4CJTA 2X6NA 4IR9A 4OVLA 5JUMA 1RDDA 3DLKA 3MEEA 1LAWA 3SCXA 2WB4A 3VQ9A 5KFDA 4EO8A 3CJ2A 4Q44A 4RUAA 2J6UA 1X9WA 4K4SA 2R8HA 4F4XA 1RDRA 1JLBB 3CJ5A 3AO4A 1HNIA 1X9MA 1LWFB 4TSXA 3GIKA 3NKYA 3PR5B 4AHUA 4MH8A 4F4ZA 1C0TA 4FK4A 1CLQA 3Q8RB 1RA6A 3TAEA 3TQ1A 2HHVA 1LW0A 5DQGA 4NLVA 3BSNA 3OL8A 1HJRA 3AVAA 3KLEA 1EP4B 5K14A 4OLAA 2AX0A 5CZ2A 3BSAA 1TGOA 4CF1A 4B9MA 2HNZB 4GMJB 3WNGA 1NK0A 4FK0A 2HWIA 3AVKA 4GW6A 3RR8A 3NF8A 1UOCA 3T5JA 1J5OB 3FFIA 1TKZA 3MEGA 1L3UA 2W9CA 4KHUA 2YKMB 3G6YA 5KFJA 4MIBA 1DLOA 4DQSA 3HL8A 4RW4A 3ZSYA 4CF0A 1QQCA 3NH1A 2EC0A 5KFBA 2RF2A 2FLLA 1TL1A 4DEZA 5KT5A 3SV3A 1RT7B 3HO1A 5F9NA 3I0SA 5J2NB 4CJ4A 3LP2B 2QXFA 3V6DB 4ZP7A 2XGQA 2OPPB 2V9WA 2KFZA 3QIPA 3QZ8A 3MECB 4H4OA 3GV7B 4IRKA 2HNYA 5KFYA 4F3OA 2ZE2A 4NLGA 1HQUA 3MR2A 2G8HA 1RAJA 2LSNA 3G10A 3GV5B 1SKSA 3OYAA 4BE2A 4Q0BB 1N6QA 4URQU 1TKDA 3OYFA 2D5RA 1S9FA 1JLQA 4ZHRB 1Y97A 3AVCA 4M42A 4HKQA 4K4VA 3NDKA 4W5NA 4CIFA 3JSMA 4CIEA 4KBIA 4AHCA 2OYQA 3Q8QB 5L1IA 4OJRA 3L2QA 3EPIA 2YNIB 3KLGB 4LQ9A 3OJUA 4J9KA 3HHKA 4TY8A 1RTJA 3PVXA 2ZQBA 1C1BB 4B9UA 1CSJA 3TAPA 4IKFA 4I2QA 3TAMA 1RTDA 4J9PA 1VSJA 1XWLA 5CYMA 2B43A 2C28A 2WCXA 3AV9A 1HMVA 1TKXA 3KD5E 5KFVA 2IMWP 3DRPA 5HLFA 1S5JA 4WXOA 1SH3A 3OYBA 3AO1A 1QAIA 4CJ5A 1ZTTA 4M95A 4QW9A 2VG7B 4ICLA 4RW6B 3QESA 3T3FA 1SH2A 3RB3A 4PA1A 5EWEA 3V81A 5DG7A 2XY8A 3ITHA 1RT2B 4IKAA 4K4UA 4LSNA 3KMQA 3DOLA 3SI6A 5KT2A 3QEPA 5KI6A 3DM2A 3T5KA 2D0CA 4CGIA 1KHVA 1KFDA 3Q8PB 4R8UB 1T7PA 1S49A 2OZMA 4K50A 2V4QA 1BQNB 1RT1B 2PYLA 1GOAA 1TL3A 1REVB 4CK1A 3KLVA 3NF6A 3UPFA 1K1QA 3WNEA 2QKBA 1KSPA 2YKNA 2WONB 3K57A 3CG7A 3UQSA 3M8SA 4RUCA 2BQ3A 1LWCB 2ASDA 4IDKA 4RNOA 4ZPBA 4W5TA 4WXWA 4IRDA 1WN7A 3MXMA 2W8KA 1T94A 2JLEA 1RT6A 4CFBA 3UDLA 3OYNA 1S48A 4PUOB 3FQLA 3CDUA 4FJNA 2X74A 4ECYA 4H54A 4CGHA 2KQ2A 5F8NA 1Q9YA 3LP0B 1RT3B 3DLEB 3O3GA 4KTZA 4DTSA 4NLSA 1VSEA 4NYZA 5T7BA 4FBTA 3NGZA 3CDWA 4E1MA 4FJMA 3PR4A 1OS5A 2IM1A 2GUIA 1U04A 3O3FA 5DMRA 1HYVA 1VSKA 2W8LA 2XY6A 1U49A 4KHYA 3NGDA 3F73A 5EDWA 4FJXA 3SNNA 2HHQA 3NMAA 2G8FA 2D0AA 2YHBA 5HRSA 1LWFA 2F8SA 5C42B 5KFQA 2XCPA 4HHTA 3QETA 2FJWA 4DU3A 4CF9A 3DLKB 3MEEB 1TQLA 2Z1GA 3VQDA 4B9NA 1Z25A 1NKBA 4EYIB 3PW4A 2XY5A 1JLCB 4QW8A 1RDBA 3MXIA 3RMAA 1ASWA 5DGBA 2HNZA 4KHWA 4DQIA 5DLFA 4O0JA 3GV8B 1FXXA 2HHXA 1UWBA 1J5OA 5HRRA 4LQ3A 4DLGA 5KRTA 1C0TB 3LPTA 2VA3A 1NHUA 4O55A 5I3UB 1LW0B 4ECVA 4I2PA 5KFHA 4JRQA 3I5CA 3C6TA 4OPKA 3OYHA 2W7OA 3L2RA 3O3HA 1SL2A 5K14B 1KHWA 3CIZA 2YV0X 5HRNA 5J2NA 4R5PA 3SFGA 1U47A 3AA4A 2VWJA 3TAFA 3SUPA 4FJ8A 2QK9A 3LP2A 5KFCA 4IBNA 3OYLA 3FFIB 2OPPA 1TKZB 4FZZA 4FK2A 2W9CB 1J9AA 4M3RA 2G8WA 4RG8A 3LP3A 4W5OA 2VG6B 2R8IA 5FROA 4CF2A 5J2QB 4RW4B 4CEEA 1D8YA 2ALZA 5FRMA 3EZ5A 4E1NA 1S9GB 3VN5A 1U48A 5E41A 3DI6A 1TL1B 2FJVA 4XPEA 5DK5A 1UA0A 4FW2A 3I0SB 5JS2A 2C2RA 2VWKA 4CECA 4HYKA 3SFUA 4GC7A 4ED0A 1TAQA 4Q0BA 1S1TA 5I42A 1S0OA 4FLTA 2HB5A 5KG6A 3V1RA 3OL7A 4OGEA 1DTTA 3IGVA 1J53A 3OYMA 4O3QA 1GX6A 2FBVA 5KFUA 1RBSA 4IG0B 2JEJA 4LD0A 1WSJA 2B5JB 4YFUA 4Y3CA 4Z0UA 2D41A 4LH5A 3OSNA 4CEDA 2G8UA 2YNIA 3KLGA 1ZBHA 4Y34A 2QE5A 1S6QB 1S1XB 4EBDA 3HVTA 3PW2A 1NKCA 4HTUA 1C1BA 4O44A 2DPIA 1VSLA 3AVBA 1RTIA 2KTQA 4BDZA 5J1EB 3LZJA 4CK3A 1SV5A 3K58A 4M3XA 3LP1B 2CJQA 1A5VA 3OJSA 5KG2A 4IH5A 2P5OA 1IO2A 1KRPA 1NJWA 1ZBLA 2VG7A 4MIAA 3OHAA 4TY8B 1RTJB 5HBMB 5SWMA 2R2SA 4DTJA 3BQ2A 3Q8SB 4O3RA 2DFFA 1LV5A 4ED1A 3BDPA 1RT2A 3ZT1A 5F9LA 1RTDB 3BREA 2XY7A 3D0PA 3DLRA 5CYMB 1TP7A 4C8OA 4FVMA 3K2PA 1EXQA 2P1JA 4Z4EA 2I5JB 4CHOA 5CYQA 1HMVB 3ULDA 4DFKA 4JV1A 3WNHA 3OL9A 3DRPB 2O4GA 3MFIA 4CK2A 1NJZA 4K8ZA 1YTUA 3KLIA 4CHZA 3N6LA 1TK8A 4ZPDA 3SQ4A 3RB6A 1BQNA 4BWMA 1KVCA 4E3SA 5KT6A 3OYCA 3AVLA 3THVA 4XIUA 1REVA 3V81B 3V6HA 3SPYA 5KFWA 3BSCA 3BGRB 3M8RA 1ASVA 4QWCA 4O0IA 2JC0A 3NAEA 2WONA 3BQ1A 3DM2B 4AHRA 3LANA 1JLFB 1S1WB 1JX4A 1BIZA 3ZSWA 1LWCA 3L8BA 2EX3A 2AJQA 1JXEA 5CZ1A 4TY9A 4WYWA 3V9UA 4N47A 1JXBA 2ATQA 1TL3B 4NLPA 1RNHA 1S0NA 4YMEA 1HYZA 1JL2A 3BSOA 4MKAA 3C95A 4X2BA 2JEFA 3QIDA 1RT3A 3DLEA 1YT3A 3DRRA 4KAIA 3OY9A 4K4ZA 3TAQA 4ZVHA 4CFDA 5KG0A 5KFIA 1VK0A 2FVPA 3ZSVA 4C8KA 4MK9A 3SUOA 3QIOA 4TQRA 3KOAA 3SI8A 2FVRA 3UR0A 4Y2CA 3GIIA 2P51A 1YVFA 4KFBB 3S3NA 1WLJA 1EETA 5C42A 5KFPA 2HWHA 4ZVFA 4CE9A 1WSGA 5DQHA 3CYMA 3VQPA 3U6FA 1D5AA 4HVJA 5L1LA 3EPGA 3QGGA 4IFYB 4O3PA 1JLCA 4Z4CA 4ECZA 3VQSA 4AHVA 4E7KA 4CJSA 4E7LA 3K5NA 4ELUA 1S4FA 3BQ0A 4B9VA 3ZSRA 4QOZB 4B3OB 5KG1A 4PY5A 5I3UA 4C8NA 1C2PA 3G6XA 4DF8A 3U3GA 3SQ1A 3JYTA 4LH4A 4EZ6A 2ASLA 2J6TA 2RN2A 5F8HA 4KI6A 2WTFA 3N6NA 3SYZA 1SKWA 3HK2A 1EX4A 4DSIA 3HKWA 3PX0A 1UWBB 3VQ4A 4I9LA 3HXMA 4ECXA 2VG6A 5J2QA 4CJFA 3TANA 1B92A 4Y1DA 4I2PB 1RT5B 3KHLA 1S9GA 2FC0A 4IOBA 3EYZA 3FQKA 4CJPA 3QNOA 3C6TB 3H2LA 2OA8A 1S9EA 4RNFA 1F21A 4QWBA 3GYNA 3M9MB 3DLGB 4ZTJA 2ZD1A 1N56A 4R5PB 3I5AA 1ZBUA 4M3TA 2HMIB 3P5JA 4CGFA 4FJGA 4O3OA 4NCAA 1XR5A 3OS1A 2WHOA 1NHVA 3V6KA 3IAYA 4DTMA 5KFAA 4DTUA 4DU4A 3V9ZA 1TAUA 4DTOA 1S97A 3VQ7A 4IG0A 2F96A 4IFVA 4EEYA 3DI6B 2B5JA 3KKRA 1RBRA 4TXSA 1KLNA 1S10A 3AVFA 2IJFA 3GQCA 2IGIA 4OKEA 3HSTB 1S1TB 5KG7A 5I42B 1NJXA 3BR9A 4RNMA 2BE2B 1S6QA 1BI4B 1ZBFA 1S1XA 4KSEB 2FVSA 3IS9B 4NLXA 3NGIA 3H08A 1DTTB 4B9SA 1K1SA 4I9QA 5J1EA 1J54A 2YNFA 2C22A 2XCAA 4EBEA 3PZPA 3LP1A 1VSIA 3QNNA 4OPJA 5KFGA 3OYDA 4B8AB 3CFRA 4WFZA 4NZ0A 3O4QA 4FM2A 3RMCA 1N4LA 1C0MA 4N5SA 5L1JA 3ZT4A 3HVTB 5HBMA 2W9BA 4J9LA 2DPJA 3CJ0A 3G0ZA 3PY8A 1A5XA 1QE1B 4O44B 2G8IA 1Z4UA 1IKXB 1RTIB 4DS5A 3KD1E 5EWGA 1SV5B 1S6PA 1YVUA 5D3GB 4AILC 2ILYA 2I5JA 4FXDA 2IJNA 3DRSA 4FLYA 3CDEA 2DFEA 4FJHA 5HROA 5KFRA 4XPCA 3ZCMA 3AO3A 2Z1JA 4ED3A 4CHPA 1RYRA 4DWIA 3HP6A 2B6AB 1A5WA 3BGRA 1BL3A 2VG5B 3HPOA 4DSFA 4B9LA 2XI3A 1WSHA 1Z26A 4JS4A 3DMJB 5CYQB 1JLFA 1S1WA 4YQWA 4K4WA 4FBUA 2GBZA 3QZ7A 4ECSA 4FCYA 3HT3A 3KLIB 4KV8A 3GIJA 2HNDA 1I39A 3AA3A 1O1WA 3QGIA 1CZBA 3I8DA 3LWLA 1UA1A 5HP1A 3MAQA 4KHQA 5C25A 4KHSA 4IH6A 5KFZA 1HYSB 1L3TA 4CIGA 3RB0A 4EP5A 1HARA 1QSLA 4WYLA 2FLPA 1I3AA 4B8CA 2E9ZA 3V4IA 4JRPA 3PV8A 4JLHA 2R8GA 3OLBA 4CJRA 4TLRA 4NCGA 3G86A 4Q8EA 4RNHA 3RAQA 3HM9A 3NH0A 4CEAA 5F8IA 4FLWA 3QEWA 2UVWA 1RTHB 2R7YA 1VSDA 2JGUA 4NCBA 3PJWA 3LPUA 4KFBA 3OHBA 1NK7A 3MFHA 4NYFA 1T8EA 3DRRB 4FS1A 3CQ8A 4J2AA 3PW7A 1RILA 1JXLA 4WZQA 3OLAA 3KMSA 4FZXC 4IFYA 3KHRA 3KK3B 3NAIA 4KHRA 2JEGA 1XR6A 4N56A 5KTQA 4CHQA 4HUEA 1RT4B 4DTNA 4J9RA 4DSKA 3H98A 2XRIA 1EETB 4KTWA 4B3OA 1IH7A 1YTAA 1SH0A 1KTQA 4MQ3A 1QSYA 1BIUA 4ED7A 4ECWA 3G6VA 2E9RX 1BCOA 1KCFA 1NK4A 2KFNA 4R0EA 2GC8A 4DMNA 5HRPA 2IM2A 3H40A 2IM3A 4DSJA 1N48A 3NBPA 5J2MA 2YNGB 1KVBA 1QHTA 3N6MA 3VQAA 2YNHA 4ED6A 3QEXA 3RAXA 4K4XA 4ZVGA 2WRMA 3IG1B 1C1CA 3V9XA 2DY4A 2W7PA 3TAGA 5F8JA 1RT5A 2Z1HA 4NLDA 5KFEA 4PQUB 3JYTB 3AO2A 3V1OA 2FVQA 4B9TA 3FRZA 3PJXA 4TYAA 2V4RA 4WFXA 3DLGA 2BGGA 2G8VA 2HMIA 2V0NA 3OS0A 4NLQA 1JLGA 3NHGA 4WE1A 3NF9A 3HVRA 4ID1A 2OZSA 3D28A 4ELTA 4DL6A 3PW0A 1BISA 1CZ9A 1RA7A 1C0UB 2RPIA 1NJYA 3SPZA 1S9EB 4DL7A 5F8GA 3V9WA 4QWAA 4DTXA 3T19A 2ZD1B 3TARA 5L1KA 2ZKUA 4AHTA 4DSEA 1WNSA 1ITGA 2A1RA 2BE2A 1BHLA 1BI4A 4FYDA 1LAVA 3IS9A 4UQGA 3I5BA 1JKHA 3LAKA 1NOYA 5C24A 2ETJA 3S3OA 3L3UA 4J9OA 4M94A 2GIRA 1IM4A 4IFVB 5DG8A 2P5GA 2HHWA 5CY4A 4KO0A 1WSIA 3PW5A 4F3TA 5KFMA 3AO5A 4RW7A 4J2EA 4CGJA 1TK0A 1RDAA 4CFCA 2HHTA 3H5UA 2E6MA 3KLHB 3A2FA 5KRSA 1MU2B 1B9FA 4HCCA 3KLFB 1QE1A 4O4RA 4NYNA 1IKXA 1HPZB 1KLMB 2YNFB 4J9NA 1D1UA 5D3GA 3KHGA 3RBDA 3CFOA 2B4JA 1JLEB 4FW1A 5KGXA 1BCMA 5KFNA 1HQEA 4CEOA 4O4GB 5KG4A 1GOCA 1L5UA 1IKWB 4GVMA 4DF4A 4FS2A 2OPSB 4RW9B 4FJKA 2W9BB 2IC3A 1L3VA 1D9DA 3HVAA 5FDLB 2B6AA 1S6PB 2VG5A 3SUQA 4CERA 3DMJA 2XC9A 3ZSOA 3ICLA 3DRSB 4J9SA 2Z1IA 1NNDA 5KFOA 1D0EA 3MF5A 5HROB 4F2SA 4C8LA 3RTVA 4DL2A 3ZSZA 4YP3A 2DTUA 4NLYA 5DG9A 4DTPA 1SL0A 1HYSA 4QCLA 1LW2B 3RRGA 3O4NA 4NLTA 3E01B 4CHYA 2FJXA 4DS4A 1CXQA 3VQ5A 5J2PB 3SJJA 2Y1IA 4MK8A 4O5BA 1VRUA 1ZETA 3CFPA 1DTQA 1NKEA 4KV8B 4F2RA 3T5LA 2HNDB 2O4IA 4KPYA 4CESA 5HP1B 5KG5A 4O3NA 5C25B 2UUWA 1RTHA 3ALYA 3DYAA 4URGA 4Q8FA 3U3YA 3EY1A 2XGPA 3DLHA 4JS5A 2R8JA 1ZYQA 2RDIA 2ASJA 3V4IB 4OLBA 4YR3A 3OYEA 3PHEA 3QYYA 3C6UB 1WAFA 4BACA 1T05B 3D5MA 2KZZA 4NCGB 4W5RA 2IDOA 1VSHA 1SL1A 1JLAA 5T14A 4M3UA 3IRXA 3KK3A 4FM1A 4KTQA 3SV4A 2A1SA 3L2WA 1T3NA 4F50A 4ZP6A 2J6SA 4Q45A 1RT4A 1XHXA 1BQMA 5EUHA 2BANB 3KK2B 1N5YB 4HCBA 4ZMMA 1U4BA 4H4MB 2C2DA 2FBYA 3RMDA 2HAIA 2PZSA 3VQEA 4K8XA 1I6JA 1RCHA 4FJIA 3SQ2A 1Q9XA 4M41A 4CF8A 4CJKA 3PO4A 4KB1A 1KFSA 2YNGA 1XHZA 2XHBA 4FLUA 4RZRA 2HHUA 4DL3A 4I7FB 1IKVB 1EKEA 3IG1A 1RBUA 3K5MA 2UVRA 3CWJA 4GC6A 1UAXA 1VSFA 4NLRA 3AVIA 2PY5A 3SUNA 4N76A 3HPGA 4PQUA 3NL0A 2GIQA 4U6PA 3OSPA 1W0HA 3NBPB 5J2MB 1TV6B 3PO5A 2XWYA 4JV0A 4FLXA 4RW8B 1X1PA 4J2BA 4H8KA 2YNHB 4CJUA 4KAZA 1TK5A 4Y1CA
chains in the Genus database with same CATH superfamily
4DFJA 2QRRA 2FGCA 4CH7A 5ETQA 1OSCA 2QT7A 3CDAA 3CPWM 3BGLA 4LF8K 3IM8A 3RW6A 2G13A 3H1QA 3O6WA 4XO0A 2CYYA 3LDQA 2FZGB 5IS2A 5KFKA 1NDKA 3TTDA 4YOXA 3NE6A 1XN9A 1JLGB 3QLHB 4IRCA 4A2AA 3GG0A 3L2UA 3SQ0A 5D6GA 1I94J 4IEEA 4FJ5A 2V52B 4ZOSA 4RCHA 2HFOA 2CQHA 2HHSA 3D7SB 2HURA 4IO9L 2WOMB 1WC6A 3VR1A 4GO7X 4NB4A 2NR0A 3W60A 1XQIA 2HG4A 3OT9A 2IAJA 3KWIA 1NGEA 1FHTA 3CCZA 3KG1A 3AA5X 3ZSXA 3G25A 5AQHA 4ISFA 3WT0A 4CJQA 2NCKL 1NBEB 2LXFA 4YR2A 3E1YA 4DDFA 4G3IA 2KRRA 4QIFA 4KO0B 1MDUB 2QEXN 3KUHA 4E7JA 4RW7B 1YLXA 1RUSA 3CW2C 2P9PA 1NGHA 4HI2A 1RHJB 5LL6d 3P83D 1YVNA 3FJ2A 3I0RA 3OXLA 4USKA 5GAGP 4EYHB 2E1AA 2HVEA 1DT9A 1IBCB 4WWSA 1Y9OA 3QPIA 1D8ZA 2YX6A 2AJ4A 1M5OC 2C2NA 2D0BA 2QIFA 5AE2A 4YHHK 3SBGA 4CJVA 4E7IA 2DGQA 2N7CA 1Y10A 2R7OA 4DR2F 4MFBB 1CBKA 2X1GA 3GE9A 4OMFG 4OGCA 2WVBA 3M9NB 4JB8B 4WQ5C 1FK9B 2F65A 2IC3B 4JV2A 2VQEK 3MMJA 3TZYA 1NK8A 3VA0A 2W40A 3RSEA 1HLWA 5BYQA 1WSVA 4BDPA 4AF1A 1YQHA 4YNQA 4CEQA 1MN7A 2MYFA 1F3FA 1VIXA 1WUUA 2MQMA 2O8FA 4PWDA 2RVJA 5AQQA 2JOQA 3CVKA 5DGAA 1WJ9A 4NLCA 2E1RA 3SZ2A 2E88A 2W2OP 3Q89A 4CGDA 2CGKA 5D0HA 5FD1A 1B70B 4P52A 2FVCA 3FDSA 1YBUA 3G4SS 1H1VA 5EY4A 1F5BA 2VV5A 1C6VA 1UETA 1LQ9A 1T05A 1OY6A 3LF0A 2HW3A 3BB5A 4HACB 3BJYA 4B1XB 5LXYA 3Q7BA 5BPMA 5LMNK 2JC1A 1V4TA 2KXFA 3UCZP 1W7AA 1ZAWA 2BANA 5EWFA 4L8RB 3CJCA 4B1UB 2VB6A 2NRRA 4RWTA 4EHUA 4KRFA 2E1CA 3NOGA 3C7NA 4L73A 1B3TA 3DHWC 3M8PA 1YIJS 1QUVA 1E4FT 4BR2A 2Q1NA 4C8MA 2OLWA 4M1KA 1N33J 3U1NA 3J7Z5 2Y1LB 2ZJQQ 3CF5Q 5E5NA 2G0CA 1BQMB 2ZBQA 4LMZA 3HT0A 2DIVA 3DLBA 4BRQA 4DTRA 1HNXK 3UKRB 4I7FA 1IKVA 1NPPA 2FBXA 3R6LB 1N8RO 5ELZA 2VPYB 1VIOA 3M8QB 1SQKA 4LY7A 2BRLA 2VA2A 2RDDA 4ILJA 1YWXA 3H3OB 4N41A 3AVJA 2BUNA 5K5MA 2QA4N 4ZLLA 4GKKJ 2HAFA 4U96A 4ED8A 1FDBA 4IOAQ 4IDHA 1U1PA 1VQMN 4YR0A 4DV5J 3G8TA 3UDEA 1WAJA 5A8WA 1RAFB 2YJEA 4ED5A 2V63A 2DNGA 4ECUA 1KVJA 4TU8A 2VD3A 4K5SA 2HZAA 4J9UE 1Z05A 3L7OA 3FFKB 1RU2A 3DU6A 3F44A 2BABA 1X4HA 3QLHA 4BVPA 4PWWA 2KI2A 4Q5VA 4PXBA 2MQNA 2G0JA 3J81j 4PEOA 4K4YA 2WOMA 4OJ3A 4Z4HA 1MA9B 4QS8A 1IQZA 4GVBB 3B6OA 1U45A 4NMXA 2QZ8A 2DY1A 2PEHA 1HD1A 4BC2A 2K3IA 2RF2B 3EX7B 1Y3KA 1NZ8A 4DUYK 5HJXA 1YITN 1WG1A 1S1UB 2HHHJ 3LM9A 1JCFA 4ZP9A 2KZMA 4HI1A 4TN2A 2NSBA 3IWNC 4QIGA 2CJKA 1P8ZA 4Q43A 3ZT3A 4EFAC 2R2UA 1Q81O 3UI3A 3LALA 4B08A 2IBKA 5DLGA 3QINA 1QJHA 2NS1B 3QEVA 1U25A 2BRKA 4KE5A 4URSA 3D1HA 3ID8A 5I3PA 5AQYA 4FZYA 2H4YB 1N6QB 2F8EX 3SCKE 1TZ0A 3PUFA 3T5HA 2C3PA 4LF1A 3ATVA 4MFBA 1IBLK 3NAHA 1SKRA 1SIWB 5ETKA 3F9KA 4K0KF 2LU2A 1SJ3P 1FK9A 2QL7B 1RWVB 3HVWA 2V4JB 4DR6K 1S77D 3ZTQA 5ETRA 2E44A 5H9EJ 2W6KA 4EFHA 2KT5A 3KDOA 4RW6A 4IR1A 4USMA 4QPTA 4UOFA 2VWBA 1L3SA 1N52B 2Y9HA 3W3DA 3IUCA 4Q7AA 1XNQF 2BZ2A 2LQ8A 2H48B 1ZM2A 3CJ3A 5E3RA 4A8XA 4LSZB 3CC4N 1VQLS 2UU9K 4OI6A 1N36J 4HACA 2IS3A 4LF5K 3TWHA 4J5OA 3UNYA 2XSJA 2NREA 1MMLA 4PWUA 4JV5K 3EE8A 4AL5A 3DOLB 3P4UB 5KT7A 3KIOA 4K5RA 5HVFA 1RBTA 3Q0AA 4YY3F 4BE1A 2EW9A 4ECRA 3H59A 2OKQA 2AWZA 5AQZA 3D6FB 5I9EB 1TTHB 2G2YA 5E3AA 3PX6A 4ERDA 4JNEA 4A46A 3IR7B 5AZJB 4JAXA 3M8YA 1FJ7A 2MY8A 4QIEA 2FZKB 3R1XA 2FXUA 2E4LA 3UKRA 2EBGA 4MK7A 3H5XA 1FWLA 3RRHA 2GV1A 2YHAA 3M8QA 2I7PA 2NYHA 4LF8F 4C8ZA 2MJUA 3TUJC 3RBEA 2H54B 4BR0A 2FBTA 1RBVA 1VMBA 4UF4A 2FHKA 4KQZA 3W2WA 1LAWA 1DY3A 2WB4A 2V2ZA 5KFDA 5M1QA 2HQDA 2HF3A 3SAFA 5AQNA 3GOIA 1X9WA 2OTJN 4A8OA 1RDRA 2XWXA 3AO4A 3E66A 2FUG9 4F4ZA 1C0TA 3TAEA 1DBDA 1LW0A 5DQGA 4OYXA 1S12A 2PN6A 4LREA 1U0HB 1EP4B 4ANEA 2CZ4A 1L3KA 3SMSA 3BSAA 5AQJA 3P3DA 4PABA 3WNGA 1LNQA 1HQ2A 1TKZA 1Q18A 3I96A 4KHUA 1B0TA 3A0IX 4GVBA 3QATA 3HL8A 2F4VK 4WP8A 4CF0A 2RF2A 1OH7A 1S5ZA 1M1HA 2K3KA 2QM1A 2ZEJA 2FB0A 1MWQA 4DPUA 2WBNA 4YHHF 5AXKA 3ILLA 3FCVA 3H42A 2XGQA 2OPPB 3PG9A 2B4UA 2FHJD 1NO8A 3QZ8A 1R8BA 3GV7B 4MLHA 2P9UB 4OYWA 2VQEF 3AAQA 3D1QA 1RAJA 2YX1A 3OYAA 1VQ4N 5KPRA 3CC2S 1N6QA 4UY8O 4R25A 2D5RA 3VAFA 4LRAA 4PHTX 1J2VA 4DCOB 3GJTB 3A8IA 4ZHRB 2IYGA 1T6CA 3AVCA 4LUBA 3R8EA 4FDFA 2ZWHA 1X4GA 4X4TA 2V4JA 2OTLS 3UKUA 4CIEA 1MWZA 2DEJA 4AHCA 4J90A 1CG2A 2YY3A 1VHFA 2IDEA 2LKZA 3HHKA 2WSEC 1RTJA 3PVXA 3GJSB 3RYLA 3D2FB 1KOHA 4B9UA 2M8DB 4LFAK 4V19J 5GIPA 2NRXA 1VSJA 1XWLA 5LMNF 4I64A 4WTOB 3HHLD 3I9V9 5M1PA 3VQTA 5B0GA 1HMVA 2CNLB 2DHXA 3KD5E 1ROFA 2A6OA 3R5AA 3M6GA 3UW1A 1MW7A 1SH3A 2I6WA 3GR1A 2VG7B 5M1OA 2DNNA 3MD3A 4KGXB 5EWEA 1VQYA 2XY8A 3NGSA 3G8SA 1KONA 2LA6A 3HDSA 2EG1A 1QHAA 3DOLA 3QEPA 3DM2A 2D0CA 2BH1A 4WFNQ 1SJ4P 4CGIA 3R5JB 4L6V3 3CPEA 1KHVA 1T95A 3B8HA 1HNXF 5JMVA 1T7PA 4LT6A 1S49A 2QJ3A 3EN9A 1J27A 1RT1B 2LU1A 1RWMB 3A8YA 2KM8C 2A6MA 1FNXH 3TWZA 4F0MA 2FF3B 3ZLJA 1HR0F 4EHTA 1S79A 3UQSA 4DPOA 2VQFF 3G96A 3DC2A 3CCMS 1IBKJ 3PHTA 2ASDA 4RNOA 2RU9A 3ID6A 3MTJA 5G4DA 3MXMA 4DUZJ 3GBTA 3HSCA 1Q1KA 1NGIA 3CDUA 5CHIA 3QJPA 1IBMJ 2AF6A 2Q0RA 5AT1B 3JSBA 1SQEA 1KTVA 2JJ4D 4DCHA 2IVYA 1F9HA 1LFWA 5T7BA 4FBTA 4JI6J 3NGZA 3CDWA 3H2VE 9ATCB 2IM1A 3THYB 2NYIA 2CWKA 4CBXA 1VI7A 1U49A 4BRDA 1GLAG 1UFLA 2W1BA 1HWIA 1RCOB 4HVZA 3ISZA 1E3MA 4USUA 4HHTA 3QETA 2FJWA 3R5GA 3CERA 4CF9A 3DLKB 3MEEB 1HW8A 2HFSA 2MQQA 5MAOA 2Z1GA 1CQNA 4DHYA 4WF9L 4LFCK 3TOQA 1U0HA 2XYGB 4DUYF 2KKZA 3MXIA 5DGBA 4DN9A 4FVUA 2C3UA 3BGOP 2QLFB 2ZUAA 5DLFA 3WXLA 1FXXA 2J4RA 4GV6A 4MMOA 3ZTSA 1YBTA 5IQQA 4DLGA 4LQ3A 2ACYA 3LPTA 3K0SA 1HBMB 3GONA 1KD1T 3JQJA 3QWUA 4FF4A 2BX6A 1FNOA 4KHPK 4R5PA 1U47A 4FJ8A 2PFFB 3SUPA 4M63A 3FCHA 4IBNA 4YS2A 3CETA 2I8EA 3IWLA 2OPPA 1FX2A 3J7YI 4RG8A 3HI0A 4WQ4A 2LP4A 4W5OA 2Y0BB 1RAIB 2R8IA 1IBLF 4KC5A 1SQGA 5FROA 4CF2A 5J2QB 3L7UA 1MLAA 2P9UA 1S9GB 3VN5A 2HRUA 5E41A 4DR6F 5GAHP 1NJIO 2GIFA 1W2IA 3HJVA 5JS2A 3FEZA 5FPNA 4ED0A 1TAQA 4DV1F 4FYXB 1S1TA 1S0OA 1P8GA 2A10A 2IVNA 4L3KA 4CM0A 4FYWB 3CMES 3IGVA 3OYMA 2HQ3A 3EEQA 2W6LA 2FBVA 5KFUA 5B0AA 1RBSA 5JVHL 2EPIA 4LD0A 2ZHAA 4X65F 1RHMB 2Y8YA 3ZNUA 4JK7A 3UE2A 2R7VA 2HBLA 2MZQA 1KVKA 2CVIA 1ZBHA 2OEMA 1H7WA 2UU9F 4V19X 2DH8A 4OZ2A 1XMQJ 3BGUA 1S1XB 4EBDA 1NH8A 3D2FA 3PW2A 1RWKB 2DR9A 5AQKA 4BG8A 3VGUA 3LZJA 4CK3A 4JV5F 3L6QA 4R79A 2CJQA 2RQMA 4H4KA 1A5VA 3P5BP 3KG4A 1NJWA 3U1MA 4CO2A 1ZBLA 2VG7A 3OHAA 1FDAA 2P9SB 2CJYB 3MGJA 4RX6A 2R2SA 3VALA 3BQ2A 2DFFA 2A42A 2JVOA 3BDPA 3ZT1A 5F9LA 1RTDB 2XY7A 3CD6N 3D0PA 2YKPA 4FVMA 1S99A 2B51A 2I5JB 2FSKA 4CHOA 4GKJK 2PC6A 3ULDA 1VQSA 2O4GA 4K8ZA 4ZPDA 4LVOP 1H72C 3OYCA 3AVLA 2CPXA 3ZEUB 4JI4J 1H3DA 2GHWA 4DHVA 3V6HA 2BM0A 3VZIA 3M8RA 4QWCA 2VZ9A 4O0IA 5A6PA 4IUFA 3LANA 1JX4A 3AT1B 4Y00A 1BIZA 1RHUB 2UXBJ 2CNOB 3ZSWA 1OPZA 3L8BA 4C11B 2AA4A 3A3PB 3VESA 4N47A 3HFZB 1TL3B 2JWLA 1RNHA 2EFNA 3HFKA 4BCAA 4YMEA 1JL2A 3KKFA 5G0RB 1NB2A 5L38A 2F7VA 4JI0K 3QIDA 1SC3B 4YUDA 4BRCA 3HM8A 5AQFA 2QWPA 4P2SA 2J9CA 4ZVHA 2GMHA 4P73A 4CFDA 2FVPA 3ZSVA 3THYA 4MK9A 4BR7A 3SUOA 4JYAJ 2D9PA 4TQRA 5DZ7A 3HBTA 2LDYA 1A6LA 3O80A 1HKAA 4WJBA 2DGTA 3GIIA 3S3NA 4NWBA 2FLOA 2O8EA 2F4VF 4JKCA 3CYMA 4OPAA 4N77A 3U27A 1D5AA 2OUGA 2HOEA 3B8AX 2ALYB 3G82B 1EQMA 4YB6A 2QC3A 5IXUA 3O4WA 2V2VA 3RU0A 3TR5A 4ELUA 1X0PA 3BQ0A 3QJLA 3P49B 1JNRB 3CO0P 4DV4K 1X7VA 5HQMA 2IVMA 2BW7A 4DF8A 3SQ1A 2GS8A 2VICA 2RN2A 5F8HA 1K8AT 2MKYA 4ZA1A 2WTFA 2VYPA 3U9DA 3MCAB 5CZVA 3DLLL 1YTYA 2MKIA 2ZITA 4ZCLA 3C6AA 3PX0A 3VQ4A 2VPWB 3QWPA 3NWRA 3HXMA 3CSKA 1WEYA 3GPAA 2QLBB 5HMZA 3T1YJ 3CJ1A 5J2QA 1B92A 4OQJA 5GAEP 1S9GA 3AY0A 5BREA 3M30B 2GCFA 2MZTA 4QWBA 3M9MB 3DLGB 4ZTJA 3O5TB 3QT5A 1VQKN 4DV0K 2WFBA 2L41A 4NCAA 1G2EA 1XR5A 2QX0A 2LVWA 4LFAF 3JSRA 3A5LC 2R3VA 4DU4A 4DXLA 1IN0A 2F96A 2C2ZB 1IM6A 1R31A 2NRVA 1ZPVA 3MR7A 4CBUA 4B3SJ 3AVFA 3L7PA 3K17A 1LKZA 5GMEA 3GQCA 2IGIA 4JI1F 3S7RA 2ZM6F 2WBMA 2RUSA 2OELA 4QU6A 5KG7A 1ZM4A 3PIOQ 4C0BA 2BE2B 1S1XA 4KSEB 1ZBFA 2Z2ZA 1FT8A 1T6DA 1K1SA 4I9QA 1QVGR 5DDPC 1J54A 1GLJO 3E3XA 4OPJA 2GJ2A 3POTB 4MKVA 3OYDA 4PKGA 3CFRA 1BLUA 5GADP 2XYHB 1N4LA 2RMLA 3HZ6A 1RISA 3FC9A 2P9SA 4PKDB 3ZT4A 1TR0A 3ENBA 3PY8A 3OFGA 1Z4UA 5ETOA 1PYSB 1YBAA 1RAHB 5D3GB 2I5JA 3C3LA 1RWWB 5CXTA 5RUBA 4C4WA 1DHMA 1BQXA 4FJHA 2UP1A 4OFZA 4XPCA 5DM7Q 3ZEUA 7AT1B 3KXDA 1RYRA 4AQYJ 2ACMA 1NM1A 3LM2A 2QWNA 2CPEA 2E29A 3BH7B 2QEXS 5CYQB 1FRXA 3H1VX 5HO4A 4C11A 4OZJA 1TMMA 1VLOA 1CZBA 3OR1B 5HL7Q 2MKCA 5G0RA 4ZVPB 3HD2A 4LF7K 3PXGa 3W64A 4JRPA 3PV8A 2R8GA 5CD4H 1FCAA 3G86A 4LFCF 2NZCA 1X5OA 4RNHA 5AQIA 1CEZA 2R42A 4YY3J 1N5QA 5F8IA 2UVWA 2R7YA 3TU5A 1OKJA 2ZNYA 1ZPWX 5CCLA 5BRDA 1G99A 3MFHA 4DUTA 1T8EA 3CCRN 1K9MO 1YKWA 3KMSA 3M32A 1NPKA 3K7RA 1M5HA 3NAIA 4KHRA 3CJ9A 3G82A 4KHPF 4N56A 3BZCA 4J9RA 4DSKA 4ITSA 2YI1A 1IR2A 1IH7A 2DHHA 1SH0A 2YWEA 3MK6A 3SBMA 5K8NA 1BCOA 4CO5A 3T1HK 4R0EA 3LPEA 2GC8A 4DMNA 3H40A 2BM1A 2IM3A 4DSJA 1N48A 5BPLA 1WG5A 3CJ8A 2BYCA 2O8CA 2CZVC 1NAQA 2OI2A 3VQAA 2M88A 3JAMO 2XZDB 2DGUA 4K4XA 3W9JA 1J6ZA 1C1CA 4C1NI 5HVHA 2Z1HA 2NPIA 3GB0A 5KFEA 1FVQA 2QXLA 3V1OA 3M30A 4B9TA 2J7UA 2VH7A 4TYAA 3DLGA 3IWXA 2GO9A 1IWAA 2V0NA 3DRXA 5IM0B 1AZSB 2OIHA 4A8WA 1NGDA 4WE1A 1F5CA 3ILJA 2VDHA 3D28A 4ELTA 3AA8A 1RE1B 3S6EA 2C1EB 4C23A 3NS6A 1C0UB 4KGMA 3SPZA 5EN1A 2DH9A 2KHOA 4QWAA 3AA9A 2ZD1B 3TARA 5L1KA 3OA9A 1XTZA 2V2QA 1ZAVA 2ZH8A 1TUUA 2D0OA 5LSRA 2BE2A 3FR0A 1VQMS 5IZHA 4CIOA 2DK2A 3FMWA 3UO0A 1K73T 1WF0A 2E2NA 2ETJA 3S3OA 4J9OA 3K8WA 4IFVB 2FJAB 1YHQN 5CY4A 2VQEJ 3POTA 4GKJF 2LEPA 3PW5A 3K2YA 3NGTA 5LSOA 4DCPB 4GNIA 4PXEA 2HHTA 3H5UA 1OY9A 2Z58B 4QR1A 1G1XA 2E6MA 5KRSA 3NNCA 2Q66A 1HPZB 2YHYA 2DR8A 5D3GA 1X4CA 1MROB 1NH7A 5KGXA 4DR5J 3DNCA 1HQEA 4CEOA 4YOTA 3VAJA 5KOXA 1IKWB 4GVMA 3VGTA 1JCGA 2OPSB 4NPOA 4FJKA 2H65B 1Q8KA 1WKKA 1L3VA 2A6AA 1D9DA 1YZ6A 3JTNA 1YITS 1S6PB 3M5RA 3SUQA 4JI0F 1MMDA 2KHDA 2C3YA 2WB1D 3ZSOA 4FYYB 3SCJE 1KKHA 2Z1IA 4ZPTR 5KFOA 5HI7A 3RVCA 1D0EA 2J7WA 2RHSB 2VASA 4Y0WA 3N4WA 2YWFA 3ZSZA 3OR1A 2KVIA 4ILGB 4FOIA 1KP6A 4A61A 1SL0A 4CO3A 3O4NA 2G1HA 2XMMA 2JLGA 3E01B 2FJXA 1CXQA 3R7BB 2OEKA 2B7CB 2E7WA 4CESA 2E5LJ 2MGZB 2AD9A 3ALYA 4URGA 2R8JA 4KPCA 3DRYA 3V4IB 1KNZA 1WAFA 2BVZA 1VOMA 2MLZA 3EGZA 3WXJA 4DPYA 2FQQB 2G9OA 3VF2A 1JLAA 3QGPA 4FM1A 2B4PA 1H2VZ 2J6SA 4QU7A 2YJFA 3K5PA 1GLDG 3KK2B 1UEUA 3A8JA 3CC4S 4ZMMA 4KH5A 4BQZA 2HIYA 5AQPA 2W41A 4B1ZA 3LGMA 2HAIA 5GAHU 4FJIA 3OTOK 4CF8A 4KB1A 3PO4A 4P71A 1R0CB 2U1AA 2XS5A 4FLUA 3C6HA 2HHUA 2IYIA 3HSGA 4CZKA 1RBUA 3K5MA 4OLPA 3CWJA 2E2QA 3LDNA 4GC6A 2PY5A 4NLRA 2V94A 2PGCA 4C2MA 1HWKA 3D2EB 2MDAA 2GIQA 3THWB 4U6PA 4DUYJ 3OSPA 1VK8A 4B3TJ 2RD5C 2KXHA 3NBPB 5J2MB 2D74B 4JV0A 3M6XA 1X1PA 4USTA 5IM0A 1KD1O 1AZSA 3PYFA 1GOBA 3EVWA 4CJWA 3K5OA 2AT1B 2G8KA 2ZJRL 2Q3SA 2RT3A 4JHDB 4HT7A 3NFAA 1C0UA 2YBVA 3HCXA 3A1YG 3NH2A 3B6PA 1SAZA 2HF4A 3C94A 4CLYA 1Q8IA 3PDNA 3S3MA 3D0HE 1WEZA 2BR0A 3QRRA 3TSUA 4JI5J 4M3WA 3O1BA 3H25A 4HR2A 3QEIA 3P8BB 1IBLJ 3KJVB 5B8HA 5JXSA 3QAUA 5D78A 4FWLA 3KK1B 2L9WA 2PEBA 5DJBA 4ZPCA 3VGKA 4WFBL 1QS4A 3BKUA 3PIPQ 4CLPA 4FVCA 2D3ZA 1Z1ZA 2R8KA 4KGKA 2QV6A 1HPZA 2AGPA 4FPIA 2NUBA 4NZ6A 1S59A 1VYAA 2DGVA 3W7BA 2DY9A 5SZTA 3CCVS 4KKOB 5HVGA 1Y5LB 4CT8A 3KKSA 2Q43A 3IR5B 1IKWA 4RR5A 2BJ3A 4RNNA 4RU2A 2OPSA 2UU9J 1FFWB 3H8YA 4DV6J 3O1WA 1TYQB 1NGCA 4LF5J 4LF7F 1XNRK 4DV7F 4RWXA 5AE3A 5DM6L 3RWUA 2OGUA 2D3UA 3P6YC 3FLCO 4BGAA 5C7PA 4OX9J 4BREA 4OLOA 2PFUA 2J9DE 2HBYB 4WKYA 1MWYA 5EU7A 4DCJB 5HQ8A 2YXLA 3LDSA 4EO6A 3JB9k 3E01A 5D0EA 1VQ4S 1GXTA 5IT9U 2K7KA 2QYCA 5GAGI 3RAMA 3HZEA 3P1GA 2W4DA 2UZAA 4BRLA 2HVHA 1N34K 1NM2A 4UOHA 1R8CA 1DGKN 2OAUA 1BMQB 2UUBF 4Y65A 4WU2A 3JAMY 3M2VB 2DNRA 1CJKB 1S0MA 2IRXA 3OYJA 3LZIA 4DZDA 1VQ5N 2IM0A 4Z2XA 1QAJA 3AQOA 1CVJA 3NGYA 3R1LA 3T1HF 2DEIA 3CB4A 1BUXA 3IAS9 2KO1A 3BDEA 4X4NA 2E1PA 4X62K 1TVRB 1W25A 2JFKA 3OYGA 3H4BA 2DR5A 4FYVB 4FM0A 3TA0A 3KK2A 2R2RA 3SDEB 2BDPA 2I0XA 3M6WA 1HIYA 1YF5L 1BD6A 3MPVA 4CH0S 2BQUA 3GE1A 2CQIA 1UWAA 2QWMA 1YGYA 4EZ9A 5CABA 4WFYA 3BV8A 3L09A 2BMBA 4CCHA 1TKTB 4EWTA 4ZJQA 5HN0A 3DXSX 1SVDA 2OFGX 2HS3A 2JFDA 3ZZTA 3H20A 5F8LA 5E33A 1Q86T 5BR9A 1JJ2R 4BBYA 2IIHA 4AT1B 4KH6A 3ZO7A 5J1NA 3BO3A 2O3DA 2OPQB 3L3VA 3EGVA 5BXIA 3D1OA 3D2EA 1HX1A 4ELVA 2V7YA 3QGHA 1ZBIA 3MM6B 1OQ6A 1SKUB 2OH2A 2H4WB 4F4AA 4J2DA 1K8AO 3IFEA 4CO1A 1BHNA 4JHDA 2JEIA 2PMZD 3MUMP 4ZVEA 5FPDA 3PACA 4NXNK 2POKA 1HNIB 3LGHA 5KFTA 5GADU 4CJEA 2YKMA 2AJFE 3AB2B 3R97A 5LT5A 2EHGA 1W2BR 5AXNA 2BQRA 2O8BB 4ED4A 4Z4IA 4BWJA 1BE4A 1VK3A 2CQDA 3KJVA 1S0VA 1SJRA 4V1Ak 3KK1A 1WC3A 1RJJA 2FSJA 3V6DA 3TUIC 4FLVA 5TKYA 3MEGB 1WC0A 4A57A 1FRHA 3MECA 3O6QA 4ES3A 1XBWA 3Q8VA 2OSQA 4J9QA 1NGGA 5ADXH 1K6YA 1BWEA 2K06A 2BOAA 4KKOA 1YG0A 5HANA 3TZWA 1NK9A 5DDRC 1UMJA 2FSNA 2WBRA 3EE3A 4NXMJ 3OYKA 4LF6K 4DSLA 4CLSA 4WIIA 3VQQA 3Q2TC 4Z4GA 1FKOB 1HQUB 3HYFA 4Z4FA 1U2CA 4C9DA 3UD4P 2XI2A 2DPNA 5E3QA 2K2PA 3MN5A 2ATCB 4EBCA 4KREA 3AVMA 4FJ7A 5H9FK 3IXQA 3AFGA 3LWMA 1ZC6A 1ZBTA 3W62A 4P2XA 5BPNA 4F36A 2HGNA 3SSRA 3JSMB 4OX7A 4O3SA 2VUGA 2K1RB 1R8AA 4H5NA 3U4LA 3S9HA 4C3MA 4HTIA 5F8MA 1EX8A 1U09A 4M45A 4LRFA 2C2EA 4DQPA 3NY0A 2HBKA 1BGXT 1KBRA 1U2VA 1JJCB 1AUDA 3CJKB 3T9NA 5E84A 3MTKA 1S7HA 3HFVA 2YVSA 1EZZB 3TAMB 4YOWA 5E3PA 3CJQA 5CE3A 4U7BA 4BC9A 3M2VA 4EP4A 1CJKA 4R8UA 5IT4A 2Q36A 2UXCJ 3UN5A 1T11A 4TYBA 3THTA 5IOLA 2FY1A 2RH3A 1XMOK 3LAMA 5C2GA 1NK5A 1NNEA 4OKJA 1Q8LA 1FVSA 2NXJA 3C2PA 2COLA 1TVRA 1EAYC 3V4MA 3E51A 1BA1A 4IQXA 3NNHA 3SDEA 3PTWA 4BDYA 2HVIA 3O08A 3V1QA 5D4LA 3E9PA 4DR4K 4ATNA 1T03B 1B9DA 1FWPA 3R1HA 2DT9A 3CD6S 4HUGA 3K5LA 2ZH9A 1T9WA 1TUWA 4CD3A 2YHXA 5D0RA 1LXNA 1TKTA 2IVOA 1MN9A 2HBJA 2LQJA 4IDKB 4B1WB 1RT6B 5BYRA 2OPQA 2CDQA 3CJSA 4F04B 2VKZG 4FJ9A 3QERA 5T41A 3EWGA 3QSIA 5IC4B 4GVEA 2DGOA 3ISNC 3MM6A 4IR9A 4KHPJ 3W5ZA 1FE4A 2IHR1 4NEZA 2CRLA 4OVLA 1RDDA 3DLJA 4WK3A 5DS7A 1PKUA 2HKEA 1PO6A 2ZFHA 2QFIA 4EO8A 3GLJA 5B0BA 4Q44A 4MDAA 4BR9A 1A9NB 4RUAA 2NXNA 4K4SA 2HQFA 2R8HA 1N32F 4F4XA 1KXPA 1JLBB 1HPMA 3UD5A 1HNIA 1X9MA 4TSXA 3PR5B 3W66A 4OZ5A 4AHUA 2BUPA 1ZM3A 4FK4A 1CULA 4FKYA 1X4BA 2DVIA 1PJ5A 2RS2A 1F1BB 2LXUA 4U7UK 2HHVA 3CJ7A 3Q83A 3PJ9A 4JI2K 4BRNA 2O8BA 2PO4A 3AVAA 5K14A 2V50A 2AX0A 5CZ2A 4CF1A 4FPBA 3MOJB 1V3RA 4FK0A 2KB2A 4BLGA 4DPTA 1TL5A 5AE1A 1QZ5A 3AVKA 1FKAF 1HI8A 4U67Q 3NF8A 4EIAA 1J5OB 3FFIA 2BJEA 3MEGA 2W9CA 2CQBA 3G6YA 5KFJA 2QW9A 4M63C 2DRBA 5LJ5Y 1NDPA 2XG8A 4RW4A 2FIUA 3NH1A 3TYTA 1XMBA 3D4JA 1RT7B 2ASPA 4LIWA 2VDIA 4IJNA 2GFFA 4B3MF 1EWRA 3VVTA 2CQPA 3MM7B 5BR8J 3TTCA 2RIJA 2CJXB 1V9OA 2QFJA 5L39A 1UTAA 2YPZA 4IRKA 5GMDA 1F9EB 4NLGA 1UZDA 1HQUA 2YH0A 3U9ZA 3GV5B 1BXNA 4URQU 1TKDA 4GKJJ 2LECA 3QDKA 3O9UA 1N34F 2Y3YA 3IC1A 1Y97A 1UPMB 3B4DA 1CJUB 1UVLA 4CIFA 4QBUA 3JSMA 1UEKA 3ULHA 4WCEQ 2K1RA 4ETXA 4KBIA 1Q81T 3WEEB 5L1IA 4CDIA 5H1SQ 4DR1J 3VAGA 3OW2R 1CSJA 4Z94A 3CJKA 3B4MA 1XEZA 3AD7C 4NL5A 3UWTA 1W7WA 3MM9B 4K42A 3TAMA 4PG7A 4X62F 2ZOMA 1UAWA 5CYMA 2EKYA 2P9CA 2B43A 2C28A 5KFVA 3ETMA 1U1RA 1S5JA 1YRTA 1ZTTA 2WVEA 3QESA 3N01A 3T3FA 2P5VA 1U1LA 3RB3A 1WC5A 1ZZNA 4K4UA 4A8YA 1Q78A 3KMQA 2QMUB 3MURP 3SI6A 1Q82T 3AJ1A 4OPHA 4X4SA 5LJWA 3Q8PB 1X5TA 3MM5A 2VGMA 3DDNA 2MHNA 3WC2A 1N54B 5LSLA 1BQNB 2E2PA 4ZPVR 3KLVA 5M1KA 1ZXOA 3UPFA 1AT1B 2QKBA 4YORA 4MT1A 5A8RB 4QYRA 2V8GA 2YKQA 4RUCA 2B9EA 4MO5A 1GMUA 4IDKA 2F3JA 4W5TA 3SAHA 2CGJA 2MJNA 2XTJP 1WN7A 4DV4J 2JLEA 1RT6A 1FTRA 4CFBA 3UDLA 3R2CJ 4PUOB 4FJNA 4G1IA 4DX7A 4H54A 4NXNF 3I55N 2PIIA 5F8NA 1Q9YA 1BO5O 3EZWA 1YJVA 3LP0B 2W2PP 3O3GA 1UEVA 1VQ8S 4DTSA 4NYZA 1OS5A 1RADB 2DKOB 1QVFR 4DR7J 2GUIA 1U04A 4BVOA 4CLFA 1PILA 3NGDA 5EDWA 2ZVSA 2R7WA 3SSQA 3CQYA 3NMAA 4GVLA 2YHBA 5HRSA 5C42B 2F8MA 5KFQA 2XCPA 4HWIA 4DV0J 1WBDA 1TQLA 3VQDA 4B9NA 1NKBA 1Z25A 4JD2A 3PW4A 2RJZA 2UUAK 2XY5A 4QW8A 2E5IA 3RMAA 4UOCA 3IM9A 4KHWA 3CD0A 4DQIA 3W8PA 1HBNB 4O0JA 3GV8B 3VGLA 1NMDA 1J5OA 4LFBK 1SJ1A 2P8IA 2MZ1A 3CCRS 4O55A 2UUCF 2JL9A 4LF6F 4IYQA 2ZH3A 4CZMA 3TVZA 4JI7J 3C6TA 3L2RA 3O3HA 3D6RA 3ZYYX 1UJ4A 1HW9A 3I56S 1FJGK 2VWJA 5KFCA 2QO3A 2IA0A 3MM7A 1M90T 2G8WA 1RHQB 3LP3A 2RRNA 2ALZA 4FKXA 2F4FA 1U48A 3GYXB 3VEWA 1TL1B 3MN7A 2FJVA 4FXWA 2H9ZA 1HNZK 5DK5A 3I0SB 2VWKA 2GHPA 4HYKA 4GC7A 3FGVA 4JN4A 2HEKA 3QFWA 3LQVA 1T44A 4FLTA 2HB5A 5KG6A 3SCIE 3OL7A 4OGEA 3OVBA 3OFHA 1YJTA 2RHQB 4O3QA 1F9FA 3QNWB 4HHHA 1CJUA 2BKPA 1MNEA 4Y3CA 1GEHA 4C97A 4LH5A 4X4VA 2CXEA 3CJBA 1URNA 3WEEA 4NYPA 2HBZB 3BGFA 4CEDA 3D0IE 2NUHA 1SC6A 1XMOF 3BR8A 2ZDOA 5GAHI 3HVTA 4FO0A 3MZIA 1LFPA 1I94K 4HTJA 3OHRA 4O44A 3AVBA 3PEJA 1NGBA 2XHWA 4BDZA 3MM9A 1SS6A 3SMPA 1JQGA 2BE9B 3LP1B 5CAAA 1WHWA 3EDQB 2X3DA 3JXUA 4LF9J 2Y1RI 5KG2A 1IO2A 2VPZB 1F2GA 4OYPA 4MIAA 4TY8B 2A18A 4O0NA 4DR4F 1DEJA 3CD7A 3Q8SB 3O2IA 5E2QA 3BREA 2Q6CA 1YHQS 3HHLB 2P1JA 3GMGA 3WNHA 3DRPB 3MFIA 1G3OA 4USVA 3EKUA 1YTUA 1TK8A 3N4QA 1QZ6A 2ABYA 1BQNA 4E3SA 1KVCA 4XIUA 3V81B 2YQ0A 2D3O1 5HJYA 2E5JA 5KFWA 3LL3A 4KGZB 5K8OA 4L76A 3VZHA 1WHVA 4CJ7A 2JC0A 1XJWB 4CRJA 1S1WB 5A8KA 1FA0A 4RJVA 3GJQB 5SUHA 3MN6A 2V8DA 1X4FA 1JXEA 2AJQA 1JXBA 2ATQA 1BG3A 4CZEA 3ZC4A 5JMNA 2C2MB 3T1HJ 3BSOA 3MD1A 4MKAA 3BKTA 4X2BA 1OPIA 4J7CA 1YT3A 4A62A 3J7A1 4P2MA 1VQPN 5CD4A 4X66J 3OY9A 4K4ZA 2O1PA 1QVGM 1RWXB 4JI2F 4FOEA 3QIOA 4BC3A 1Z2LA 2GA7A 4M5GA 1XNQK 3SI8A 2FVRA 3UR0A 4Y2CA 2EWHA 3WQTA 3D68A 1YVFA 4KFBB 3FZLA 1Q86O 5C42A 1RABB 1CJTB 1O51A 2HWHA 4QOTA 2M7SA 4ZVFA 4M5DB 2KJWA 1WSGA 5DQHA 3ATUA 3KJNB 3Q7CA 1K0TA 1VC0A 5L1LA 3EPGA 3VETA 3QGGA 3D54A 2RUGA 3PFEA 4E7KA 5B7WA 1JNZB 4CI6A 2Z2YB 1VQ7N 1QD1A 4H5RA 2CIMA 5JLHA 3M1FA 1NLKL 3BBCA 4B3OB 5KG1A 4PY5A 2NNWA 2P9IA 1M1KT 4BR5A 1NGJA 3U3GA 3J7ZT 3RRKA 3JYTA 4EZ6A 4BC5A 4ANCA 2WW4A 1X0FA 3N6NA 4ZVTB 3CULA 4A8FA 3LDPA 3VVUA 1RWUA 3FRYA 4WBFA 4CLUA 3D67A 1KN6A 3HKWA 1UWBB 4M5IA 1IR1A 1H2UX 1XQSC 4I9LA 3JS9A 4ECXA 5KQ8A 4M8LA 4CJFA 3TANA 4I2PB 3UD3P 4IOBA 4C6AA 2EK6A 1T9TA 3I4HX 4CJPA 3VOVA 4OI3A 2OA8A 1F21A 3GYNA 3CCSS 4YOYA 3EXCX 3AHPA 3C16B 3C19A 1DQ9A 3P5JA 4O3OA 3WC0A 1VLYA 2XM3A 4FXVA 2FHJA 3OS1A 2WHOA 2QSFA 4IWVA 3P38A 2HQGA 1S97A 2DXEA 1HNWJ 3DI6B 4TXSA 3RG6A 4O8UA 2H3GX 3T6BA 1NJIT 1KLNA 2IJFA 2XMAA 2AJ1A 2QN6B 2ZBPA 5LMUF 1FDNA 4ZCMA 5I42B 4LR9A 2WTUA 3IS9B 4ZN3A 3H08A 1DTTB 1PCAA 3N79A 2YX7A 2YNFA 3LP1A 3NCPA 5KFGA 3BBFA 3E9OA 4AD6A 4FM2A 4K43A 1C0MA 1T3VA 2NRZA 3R7NB 5FLXU 4N5SA 4PZVA 3VEVA 5L1JA 5EX3A 3OV7A 1U26A 3A5MC 3NGUA 2DPJA 2UXDF 4I1TA 1A5XA 4Q2MA 1RTIB 2HHHK 1CS4B 3PM9A 1SV5B 5B0FA 1H74A 4AILC 3HHLA 3OBYA 5FLXO 4WYBA 5K8PA 3DRSA 2NLWA 2WZ1A 4K25A 3JXOA 5AR0A 1D4XA 3ZCMA 1YIJN 2Z1JA 5M2RA 3TVYA 4DWIA 1A5WA 5GADI 4X4QA 1BL3A 2GW8A 2Z4PA 4B9LA 2XI3A 1WSHA 1Z26A 1R6VA 2G1DA 2VGNA 2FHMA 4H0PA 1S1WA 3L9ZA 5I3QA 4YQWA 4K4WA 2GBZA 1DZ5A 4ECSA 4FCYA 3HT3A 3KLIB 5GINA 1PBUA 1OQ3A 4BRKA 2HNDA 3AA3A 1O1WA 4LVNP 4OYBA 2A5XA 2XLKA 4ID8A 4JKAA 1VR6A 5HP1A 3IRWP 2CJBA 4KHSA 3G6ES 5KFZA 4MJKA 5H9EK 4CIGA 3OTOJ 4L3QA 1QSLA 3MMVA 4EP5A 1WOPA 2FLPA 2DR6A 3CIPA 4K2JA 4PG8A 1RWOB 3BZQA 4JLHA 4C3LA 1RWPB 2VOPA 4NCGA 4Q8EA 2UUAF 5IWAJ 3NH0A 4CEAA 4P7VA 3X3UA 3QEWA 3GL1A 1RTHB 4XTTA 3C15B 2JGUA 3LPUA 3JTOA 3NG8A 4KFBA 4LFBF 4NX9A 3OHBA 1CJTA 4FZVA 3DRRB 5HMXA 4DR3J 4FS1A 3FEXB 3CQ8A 5D15A 3TSQA 4M5DA 2NSCA 1N36K 4J91A 1JJHA 3OQ2A 4MAKA 4NLBA 2CQ1A 3AAWB 2JEGA 2GWKA 2V51B 1FJGF 1UL3A 1RT4B 4DTNA 1VQON 4F7VA 1RQ0A 2XULA 4TU9A 1EETB 2XRIA 3TJ9A 4B3OA 4P9SA 4ZLJA 1YTAA 4ZIVA 1DKGD 1KTQA 3R3LA 2NRWA 4ED7A 4CD1A 3W0LA 3QRQA 3CCES 2KFNA 4Y28C 1AUSL 1HNZF 1VCTA 3MMBB 3OBWA 4FPRA 2NQPA 4XK8C 2CPYA 1BWVA 2HRTA 3FZKA 1HR0K 2VQFK 1YAGA 3GTYX 1QHTA 2YNHA 4ED6A 3TTFA 3RAXA 1CLFA 1U1MA 4A8QA 2VBWA 2XMKA 3KK7A 4NLDA 4UUXA 2NXCA 3MPUB 5FJ4A 4J9VA 3PJXA 1WELA 2WAQD 2QWLA 1S6OA 4DL0C 2CG4A 2G8VA 4JKHA 2Z8QA 4WP3A 5JVGL 1JLGA 2YQ1A 3NHGA 2ZOGA 3W2VB 1JJ4A 3NF9A 3BF3A 1I94F 1ELOA 3O8WA 5CCMA 4ID1A 2LQ9A 1PC4A 4QYZJ 1BISA 1TMJA 1NJYA 4I4BA 3GYGA 1S9EB 4OHWA 5F8GA 4DTXA 4IO9Q 2M9KA 1FERA 1FD2A 2ZKUA 1VC5A 4AHTA 1GLBG 1XNRJ 1WNSA 1ITGA 3MMCB 4FYDA 3IS9A 3I32A 1AFJA 4ISGA 3HSDA 4YDDB 4PPDA 4DV2J 3SLCA 3F41A 3L3UA 4M94A 4DZ6A 2FC9A 4A5AA 3VTIA 1M0SA 3CC7S 4KO0A 2LEBA 2MEWA 4RW7A 4CW7B 2D1CA 4J2EA 1FTCA 1I1GA 1TK0A 3KFWX 2BV3A 2Z0GA 4CFCA 4RBVA 1MU2B 1KWMA 3KLFB 3UVJB 4HDGA 1N34J 1KLMB 1RAOA 1CS4A 5M2UA 1WDTA 1VHXA 2B4JA 1VDHA 4JI8J 5KFNA 3KJFB 2QA4G 4ZJOA 3CUNA 1RGVA 2DRDA 5KG4A 1R8HA 4N8OA 1GOCA 3W65A 2KH9A 2J7KA 4FS2A 2RRBA 2W9BB 2IC3A 1ZA1B 2JWNA 5H1SV 3B82A 3J80U 5AQOA 4DB3A 4C98A 1LCUA 2LXIA 4K59A 4ISEA 1H0HB 3AODA 1S6UA 4DV1K 2XC9A 5AQTA 4IO1A 1K8KB 1WTBA 2GTDA 3ICLA 4FWOA 4WFAL 1NNDA 2MMYA 2FHOB 3MF5A 3J80O 1WOSA 4BC7A 5HROB 2FJEB 3NP5A 3VHQA 1Q82O 3ILIA 4X65K 4DTPA 4Z7YA 1LW2B 3KG0A 1KQKA 4NLTA 3R8YA 3KHYA 2P9LB 5J2PB 1FRKA 2L48A 2Y1IA 4MK8A 1ZETA 1M5VC 2A0FB 1NKEA 4X64J 4KV8B 2B9WA 3T5LA 2J0QD 4F2RA 2O4IA 4KPYA 5ETTA 2DNZA 5KG5A 1F3VA 4UZCA 5C25B 2UUWA 1RTHA 3C15A 2R7TA 4Q8FA 3U3YA 1J5EJ 2MLYA 4N7TA 4I6WA 4PPZA 1ATRA 1ZYQA 2GJFA 2RDIA 2ASJA 4YR3A 3OYEA 4ETZA 4ZJLA 3AH6A 4W5RA 1VSHA 4AM7A 1TL7B 4NI2B 2J8SA 4MLEA 1QUPA 5T14A 1KAZA 4UOGA 4KTQA 2ZH1A 1FF2A 2ROEA 4F50A 3UCGA 1RT4A 2QSWA 4O5FA 5AJ3K 1BQMA 2WVCA 4NXNJ 1PG5B 1U4BA 4H4MB 4H5WA 3RMDA 3QFHA 3PRVA 3LOUA 1K9MT 3EMTA 1UVNA 2I2YA 2V9KA 1I6JA 2B0GA 3SQ2A 4M41A 3JQMA 4EAHD 2VCPA 4GKKF 1XHZA 3MX5A 2OD6A 2CPHA 2WC9A 1W26A 3OBIA 3OD2A 1H98A 4DV5F 5JJBA 3TA2A 1WSRA 1UAXA 3AVIA 3ETOA 3NMUA 3HPGA 1S7IA 3EL2A 2KHCA 3EDRB 1PAUB 1W0HA 3PO5A 1QY7A 3CE8A 4JI6K 4LBIA 1TK5A 1JK9B 1VQ9N 3W2VA 3T9ZA 1QQOA 1EKSA 2OSRA 2JWKA 2Z2MA 2ZF5O 3GWCA 4I6MB 2W2QP 4YB1P 4JI3J 1EWQA 1IG9A 5FLXY 2CWXA 1M90O 4KI4A 1I3OB 5AQRA 3NCQA 1YJ7A 3CM6A 3K59A 1HI0P 2RQCA 2F1FA 1I51B 3MMCA 5CR4A 3I6PA 1AROP 2HHHF 4KGVB 1IVZA 1S1UA 2GGPB 2YWKA 4IH7A 5LM7E 4EMDA 3TW0A 4DG1B 2X78A 4B3RK 2XS7A 3H5YA 3KNAA 1MSWD 2XZWA 1S1VB 3TPQA 3CCUN 1LOUA 4I0WA 2IDLA 3N5FA 2DR7A 2XMWA 4F4KA 3VA3A 1MU2A 1JKHB 3KLFA 2HQIA 4JKGB 4OHYA 5C24B 5ADXA 3UVJA 1KLMA 4LRCA 3GDQA 3QO9B 4YB7A 2XBPA 1WSEA 1JJ2M 4E0DA 3HSZA 3NCRA 2GX8A 4AL7A 2IOCA 1FXDA 2W01A 4D3HA 3L4IA 3RJMB 1IKYB 1WKJA 1F5AA 4OHVA 3V6JA 5AZIB 5E26A 4CVNE 1TUYA 1R27B 2VONA 1BWFO 2LMIA 2BKNA 4DLEA 5C2CA 1K8KA 3CCMN 3PEHA 5KT4A 3W9IA 2J0XA 3KHHA 4C1NK 3BF4A 4C7QA 1Q79A 2UVVA 4RU9A 1VQ6N 1WI6A 1H7XA 4M7XA 4C48A 2F9DA 2M2BA 3R6MA 2CVEA 1LW2A 1HBUB 4KH0B 4K7QA 3MUTP 5CZXA 5A6WA 2CPDA 3EO3A 1PC5A 1W2BM 4RWWA 3ET6B 5J2PA 2GQQA 3O3LA 4JI1K 2ZM6K 4IG3B 1MG7A 5E0OA 3DDIA 1HNVB 4PL7A 1N36F 2OD4A 1VGYA 3V9SA 4NA3A 2LFVA 3IBCB 4K41A 4MTPA 2AGQA 2YKAA 4KHMA 1IXKA 5A0YB 2DNKA 2WK4A 2J9DA 3CHWA 3WQPA 3HF5A 1WSFA 2F8TA 4LRBA 1WNEA 4A2BA 4BR4A 5JLFA 3CCLS 3ZX3A 1VRUB 1DTQB 2AEJA 1RHRB 1TL7A 4NI2A 3H4DA 3TI0A 2P6TA 2PMWA 3P45B 5AZJA 1QQMA 1VRTB 3DYAB 1TFYA 1PGZA 1HHSA 2AX1A 3MPWA 3G71N 4H4MA 1ICEB 3CXCM 2DGSA 3UIQA 3BBBA 4OYOA 1GK8A 2LDIA 4FP9A 4PG6A 1Q53A 4MKBA 3ZSQA 3IRXB 3WNFA 4X4UA 4JI2J 2XO7A 2IPOB 1A7GE 4YDUC 1A0OB 3MR5A 5ETMA 3US5A 4IOCL 2EFQA 3AVNA 1RZMA 1X4AA 2UXBK 3DXKB 1LWEB 2HLTA 4OKKA 3IO1A 2ZJPL 2OPRB 2AZ1A 2CKWA 1U02A 5B0DA 4XH4A 1U2FA 2GQ2A 2QA1A 2HFVA 4M5HA 3LA0A 3MPYA 4F4WA 2Y8WA 1X5PA 3PFOA 2GELA 3X1LB 2XYPB 1M1KO 5KFFA 5KGWA 1HKCA 3J7ZO 1GMVA 3T1AA 5JS1A 2D7SA 1Z6RA 4JYAK 1LEOA 1EP4A 3JQKA 4PL8A 2GJIA 2G2ZA 3ZT2A 4I6MA 2I1RA 2BE7D 4WTYA 1H38A 3I55S 4AH9A 1XK8A 1TU0B 1FO1A 3OPKA 4ZP8A 1RDCA 1DFDA 1P1LA 5HATA 2E5HA 4ECTA 3HI9A 2RDJA 2VU5A 4G6VB 5GAGU 1Y11A 4CFAA 3OS2A 2E1YA 3VQ6A 3KLEB 2W9AA 3PYDA 2VC0A 2MKSA 4CJ3A 4DG1A 3VQBA 3RB4A 1X4DA 2HQCA 1YJ9N 2FLNA 4FJLA 3MR6A 5LY3A 1S1VA 3AB4B 3GIRA 5AXMA 3J80Y 2ZBCA 4X84A 4QIVA 4DFMA 4JEPA 3KUEA 1YJUA 4JKGA 1B0PA 3QO9A 2R2TA 3KTQA 3CCTA 4GO5X 3DN9A 3FMBA 1KQFB 4IO8A 3A13A 1D9FA 3T1YK 2PSZA 2IAJB 4IFEA 3QIPB 4ZHRA 1IKYA 4DU1A 2NPFA 4KB0A 3FVYA 5AZIA 3ZXWA 4ZCKA 1EO1A 3RMBA 2QKKA 5K9FA 2KYZA 3A5OC 4CEZA 1X9SA 3D3BJ 4PG5A 3TSPA 1HRHA 4H03B 2B9XA 3H5SA 2FC8A 5KT3A 3AVGA 1ZA2B 4ED2A 1CXUA 3I0RB 3HRGA 4CJLA 2I7NA 3CNQP 3W5XA 2KG0A 1HBUA 2ZH6A 2ZNZA 1GLCG 5AFUH 1YJWS 3ASMA 4FJJA 1UW4A 5EOYA 4RL1A 4NZ7A 4IG3A 1HNVA 5F3TA 5C2DA 1AW0A 2P9NB 1ITPA 2BJ9A 3AOAA 2KT2A 3QRPA 4DR2J 2F63A 5D4PA 2JSXA 1R43A 2RAQA 5D4OA 3WXKA 5AJ3F 5KFLA 1TKXB 4E7HA 1ZS6A 2HSEB 3G8QA 3CJTA 4JUZA 4OV6A 1X4EA 4F67A 1YDLA 1RHKB 4ICLB 3PKYA 1RT1A 2O8FB 3KZBA 4PWDB 1U8WA 3ZT0A 1Q95G 4E89A 5FPMA 3WHIA 4DL5A 4LSNB 3QICA 3MAHA 2PI5A 4BY9C 2DD8S 2VFVA 2CAJA 1VRTA 1IBKF 2GAGC 2DFHA 3TJAA 1ZM9A 3L2VA 3F5TA 1ATNA 5KPTA 4M3YA 4JKDA 4RLEA 1WF1A 2CNKB 1QDUB 1OH8A 1IBMF 4AQYK 3M8ZA 3OL6A 1YRXA 2B9YA 1NK6A 4K4TA 2YKNB 4H0YB 1GX5A 4JI6F 1URRA 2EFVA 3DXKA 1LWEA 2V7ZA 2OPRA 2L3MA 1KEKA 2LQBA 2YPYA 5HK4A 4CO0A 3M8PB 3VAMA 4DU7A 3P31A 1Y00A 2F40A 4NLUA 3HP9A 4DL4A 2JVRA 1WTFA 2GEMA 1G15A 2ZJQL 2IMOA 3CF5L 2X6NA 3FBFA 1REGX 3QB0A 3CCJN 1Y5NB 3OW2M 3MWBA 3THPA 1KC8O 4FWKA 3DLKA 3MEEA 4X4PA 3SCXA 3VQ9A 4PRFA 1RSCA 3O1LA 3SAGA 4FWRA 1QTNB 3ZZRA 1YI2N 4WF9Q 3S8SA 4B3RF 5D4NA 3IDHA 3CTRA 1SPBP 4CLLA 1HWJA 4A59A 1G7CB 2FJBB 3CJ5A 1W97L 3GIKA 2BW2A 4MH8A 1M5PC 3EVMA 4OHXA 1RAEB 4IOAL 3Q8RB 1RA6A 1HBMA 1ULRA 3I82A 1TL4A 4NASA 4NLVA 4QQBA 1IV0A 3VAKA 4CZIA 3OL8A 2GZOA 5EHHA 3KLEA 3BO2A 5A8WB 4GMJB 1NK0A 3SQOP 1NWKA 3M3ZA 3NXZA 3RR8A 4GW6A 4BRMA 8AT1B 2Z56B 3QSYB 2X1BA 1SZ2A 1VBKA 1G4CA 2KN4A 4RKUC 2EC0A 5KFBA 4F3MA 3UFCX 4ES1A 4DEZA 1VFJA 3SV3A 3DKDA 3HO1A 1NGFA 5F9NA 1WHYA 2H3EB 2B4VA 5J2NB 4UY85 2ADBA 1EQYA 4CJ4A 3LP2B 1VQ7S 3WQUA 2VF3A 2V9WA 2EVZA 2B7BB 2KFZA 3QIPA 3VAIA 2W7AA 2FD2A 2FPHX 2C42A 2BBEA 5KFYA 1PAEX 2MKKA 5JVHQ 1FFSB 4NE9C 1DAXA 2RS8A 3SMZA 3CDBA 4BE2A 2KDOA 1XMQF 4Q0BB 3OXGA 1QVFM 3OFEA 4R0JA 2MLXA 4Y2KA 1S9FA 1FEEA 1Q4RA 4HKQA 1YJRA 5BRFA 2DJWA 2B3TB 2VKRA 4HH1A 2YX4A 2AMCB 2OP5A 3M6UA 3Q8QB 3L2QA 4M7YA 3VTHA 2YNIB 3KLGB 2FYXA 3EZOA 3DOMB 2W2MP 3DGPB 4EGLA 3DHXA 2P9NA 5AQLA 1Y64A 2XSFA 4IKFA 2HSTA 1HUXA 2ZWPA 4CWBA 4J9PA 1RTDA 2DHSA 5ETVA 3OTDA 3U02A 4K0KJ 2MQOA 3AV9A 1TKXA 3ZZPA 1JCEA 2DNPA 2IMWP 4OYZA 3OYBA 2Q6BA 1FRLA 3AO1A 3EE9A 4I6AA 2VHGA 4M95A 4QW9A 4ICLA 2QGFB 4RW6B 4JI4F 3T41A 5KQDA 4DX6A 4IKAA 4LSNA 1NG9A 3MDFA 2EI5A 3AQPA 2QLJB 1XNQJ 3T5KA 1YJNN 2UXBF 4JKFA 4DR5K 3ZX2A 1U2RA 1KFDA 4OZLA 3AXKA 4NMLA 2XNRA 4L3NA 4IOXA 1TL3A 3O9QA 2XMVA 1OSDA 3A5NC 2F5GA 4IXCA 1KSPA 2XSJB 3Q8UA 2YKNA 4ZLPA 4DX8H 5DO2A 4C3KA 4DV7K 3AJ2A 2CPFA 1LWCB 2ZVIA 3DCAA 4ZPBA 4JYAF 3GCXP 1NU4A 2VFUA 1U6ZA 4WXWA 1K47A 2MHEA 2W8KA 4M5JA 4BRPA 2ZDPA 1IUJA 4A8MP 3OYNA 3UNGC 2UV8G 5AQMA 3FQLA 3QQCD 2GMJA 3BN4A 1GMWD 4CGHA 4HHUA 2KQ2A 3WX4A 2L08A 4RPFA 4ANDA 1V5IB 4XEIA 1RT3B 4CI0B 3DLEB 4DQ8A 4NLSA 3WX8A 2IRYA 2ROGA 1HWUA 4E1MA 4ILHA 4FJMA 2Q3PA 1U1KA 2KKHA 3O3FA 2H51B 1HYVA 2E5LK 1VSKA 2XY6A 3O8MA 4KHYA 3F73A 2E5GA 4CNZA 2UUBK 4LF8J 3SNNA 2HHQA 4FJXA 3ENQA 4XH1A 4PR6A 2F8SA 1R3NA 5LOQA 4DU3A 5E7OB 3JAMU 3W2WB 4IEIA 3OTEA 3IMXA 2H5IB 5B0CA 1PYTA 2M4MA 4P74A 3F56A 1JLCB 1TFWA 1RDBA 3W5YA 2QL9B 3OR2B 4A4JA 1AXQA 2ZBIA 1OMSA 2HHXA 3DLLQ 1PYOB 3T1YF 5KRTA 1C0TB 2ZH2A 2VA3A 5I3UB 2IVPA 1LW0B 3IMQJ 5KFHA 2HYIB 6AT1B 3OYHA 4OPKA 2IJRA 1SL2A 3CIZA 4DOZA 3WBZA 5HRNA 5J2NA 3GFHA 3SFGA 1VQOS 3AA4A 3TAFA 2QK9A 3LP2A 3D6TB 3IKMA 1FRMA 2BJDA 4FZZA 1TKZB 4FK2A 4M3RA 1J9AA 1EKRA 2VG6B 1EHWA 1FWKA 2RQ4A 5FRMA 3CEDA 1N5VA 3EZ5A 1VAZA 2CDRB 4E1NA 2VFRA 4B3SF 1DJ0A 3O9TA 1UPPA 4B3TK 4XPEA 4YOVA 1UA0A 5IT0A 3N5BA 5DETA 4CECA 1RAAB 2GAHC 4Q0BA 5EGYA 2QA4S 4DPXA 4W98A 2CQ4A 1HKBA 4YHHJ 1S3XA 4CH1A 3I33A 2CFXA 3FCWA 3NWGA 1BC6A 1J53A 4QR2A 1AA1B 1SXLA 3H3NO 1N5SA 4IG0B 9RUBA 4YFUA 1WSJA 1NXIA 2WVDA 1RKIA 5IV4A 2BKOA 4WU3A 1FJEB 2G4BA 1HKGA 5F0WA 1P27B 2AYEA 2YNIA 3KLGA 5L9NA 3DOMA 4JI5K 3SCLE 4CLWA 3DGPA 4DN0A 1DQAA 1NKCA 3CCQN 2V5HG 4MO4A 2DPIA 2YQ3A 4OV1A 2KTQA 5J1EB 3K58A 3UKUB 2D0PA 4M3XA 3GJRB 4H5TA 3AD9C 1KQSR 2A3ZA 4FF1A 3HHLC 4IH5A 3VF0B 1KS2A 3WXMB 5DDQC 2FJDB 4LBPA 2DNLA 1I5OB 4HDHA 1RTJB 4LR8A 5SWMA 4AQYF 4DTJA 4ED1A 3TJ8A 1GQEA 3I9ZA 3UDVA 3DFEA 1EXQA 5LMNJ 4Z4EA 1VS3A 4E8UA 5CYQA 1HMVB 3TX0A 2VFTA 4FN5A 3ZZ0A 3TUPA 1NJZA 3EM1A 4V19S 3BYPA 4CZHA 5KT6A 4B02A 2EWSA 5TKWA 4DV6K 2QTWA 3BSCA 3L3CA 1ASVA 4ZIWA 4WFNL 4KRWA 3DM2B 4OX9K 2DNMA