3DOKA

Crystal structure of k103n mutant hiv-1 reverse transcriptase in complex with gw678248.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
539
structure length
535
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 143
structure length 535
sequence length 539
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dokA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dokA05
1JLGA 2HMIB 5KFFA 4FS2A 3OYLA 2C2RA 4DU4A 3JYTB 2YV0X 3GQCA 4XPCA 4CJRA 3QIPB 1NK6A 4CHQA 2BANB 4WYWA 4CK3A 1SUQB 1JXEA 2IGIA 4TY8B 5HP1B 3KLHA 1KVCA 1ASWA 3DOKB 1WAFA 5D3GA 4K50A 3AVJA 5L9XA 3L2WA 1U49A 3KOAA 1VSJA 3VQQA 3TQ1A 4LSLB 1CZBA 1JKHA 2FVSA 4RW8A 4HYKA 1KVAA 1QE1B 3PO5A 4DMNA 3SNNA 2XY5A 1J5OB 3LPUA 4BE1A 3P5JA 4K4UA 2HHQA 3OL7A 5F8NA 3O3GA 1ZBIA 4ECQA 1TL3A 2VWKA 2I5JA 5HLFA 4L8RB 1HMVA 2R8IA 1S4FA 2AQ4A 3CG7A 4OLAA 2UUTA 5J1EA 3PR5B 1W9HA 5HRRA 5HP1A 2FVQA 4O4GB 3VQ4A 2LSNA 2D3ZA 5C42B 4KHMA 4EZ6A 4Q43A 3WNFA 3GYNA 4R0EA 3IGVA 2JC1A 1MU2A 3LZIA 4LQ9A 1KRPA 4IFVB 4H8KA 1RDBA 5T7BA 4NZ0A 3QZ8A 3PW2A 4OJRA 3ULDA 2HNZA 1S0OA 3LP2A 1TKXA 1JLFB 4M42A 3I0SA 4DU3A 4DL7A 3JYTA 4E1NA 3PW4A 2ILYA 2B6AA 3ZT4A 3HPHA 4CEZA 4CERA 5EUHA 1FK9A 3FQKA 3FSIA 1LW0B 3V1QA 1HMVB 1JXLA 5JS1A 5HRPA 3KK3A 3RAQA 4DTJA 5KT3A 4CJSA 5KFPA 3IN5A 5KFKA 1WN7A 4O0JA 4DLGA 3KLVA 5KFZA 1D8YA 1N6QA 5KGXA 4EZ9A 2QKKA 1BGXT 4KB7A 1L3UA 4I9QA 3SFGA 3V9SA 4LH5A 1GX6A 3EYZA 1JL1A 2OPSB 3QO9B 4FXDA 1J5OA 3K2PA 2G8HA 3GIMA 2W9AA 1XHXA 3CO9A 4FYDA 2EX3A 5KFEA 4MFBB 3V9XA 1IKXA 4KTWA 3OSNA 4Z4EA 3F9KA 1LWFA 2D0BA 2W7PA 4EYHB 4FJ5A 4FJ9A 4N56A 2OZSA 3PR4A 3MEEA 4K4TA 3LP0A 1NKBA 4O55A 4BACA 3HVWA 4M3RA 4B9TA 1VSFA 1D9DA 4I2PA 4CESA 1X1PA 1ZYQA 4YMEA 1D5AA 3KHLA 2C28A 1RT3A 4CJ5A 4WXWA 1S1TA 5JXSA 3LP2B 5F9LA 3IRXB 2GC8A 4Q0BA 4ED8A 2IJNA 4K4ZA 1I39A 3KD5E 3RMBA 3HVRA 3SI8A 1IO2A 2XO7A 2UUWA 2FBTA 4ZVGA 1BQMB 3P83D 5DK5A 3RBEA 2A1SA 4DTOA 4NLGA 4NLXA 5EDWA 1B92A 3O3FA 3PZPA 3OSPA 2P1JA 1SL0A 4M3TA 4DF8A 4YFUA 3ISND 5I3UB 4MKBA 3TVKA 4CHNA 3KD1E 1NK8A 2JC0A 2YKMA 1JLEB 3KLFB 3SQ0A 5KFYA 4KB0A 1JXBA 4FZXC 1RTHA 3VQ7A 3PJXA 4JRQA 4DTUA 1IKYA 3H5YA 2UVUA 3T19A 4GW6A 1QAJA 4EBDA 3CWJA 5DG9A 3I5AA 5KT2A 2JEFA 3AVNA 3H5SA 4ECVA 3SZ2A 1S5JA 3V4IB 4NYFA 5KFCA 3KJVA 5J2QA 2XCAA 4MH8A 3FQLA 3DLRA 1HNIB 1B9DA 4R8UB 4DQSA 4EBCA 1S6QB 3I5BA 3ZT2A 4CGIA 4ZPCA 3SI6A 3E01B 3MEDA 2UVVA 2E6MA 4Z0UA 1CLQA 4X2BA 1IM4A 4CK2A 3TR8A 4O44A 3SUPA 4J2BA 1RCHA 4F8RA 4ZTFA 4O3NA 2XY7A 3MEGA 2FJXA 1U47A 2D0CA 3IS9B 5F8IA 5E41A 2W9CB 3AVFA 2F8SA 3AVKA 3DRPB 2XGPA 4EBEA 3HVAA 3SPYA 4Q5VA 1VRTB 3RBDA 1VRUA 3MEDB 2PZSA 5KTQA 1KLMA 3SJJA 2HVHA 2YNGB 2FBVA 3EPIA 5I42B 3OS0A 4KRFA 2BRLA 1UOCA 4RW4B 4B3OA 2ATQA 1TV6A 3ZSRA 4CJQA 1EP4A 1UWBB 2R8JA 1XC9A 1D9FA 3KLEB 3HHKA 3MR3A 3SUQA 4J9LA 3K59A 5KFJA 4HKQA 4OLBA 3NGZA 3C6TA 4FM2A 5HBMA 2HWIA 2DFFA 4URSA 1GOCA 5F8LA 1U48A 3UPFA 3THVA 3TI0A 3OYCA 2WRMA 2FJWA 2G8VA 4IRKA 4OKKA 1NK0A 5FDLB 3V6JA 1NHUA 5DQGA 4ID5B 2KQ2A 2X74A 4M3XA 4QWCA 1FXXA 3KK2A 3A2FA 2CJQA 2AJQA 4CIEA 2XWYA 3KMQA 3SV4A 1LWCA 4XPEA 2HHSA 3IS9A 4WXOA 5T14A 2UVWA 4N41A 5C25B 4KHSA 4FLWA 4LSNB 4LSLA 3Q8RB 2E9ZA 3AO5A 4CJWA 3NH2A 3T1AA 3C6UA 3G6YA 4BWJA 2HHTA 2R8GA 3C6TB 4NRTA 2WOMA 4XO0A 1TK5A 4DWIA 2IM0A 1SKRA 1ITGA 3L2VA 5FRMA 4IOBA 3OVNA 4NCBA 3QIPA 4FJ7A 1KFDA 5FDLA 4B9LA 4FLZA 2XHBA 4IH6A 3VQ6A 1LW2B 3AVIA 5EWFA 1HJRA 4NLPA 3NBPA 3KLIA 2P51A 3GIIA 1MMLA 1TVRA 4J9SA 2OZMA 3NL0A 1NJYA 1S0NA 3EPGA 4C8MA 1HNVA 3NMAA 3BREA 5KFQA 3ZT0A 4W5OA 1WAJA 3LANA 5KFVA 5KFDA 3WNGA 4E7IA 2D41A 3BJYA 1SH2A 1IKVA 4FZZA 3EZ5A 2E6LA 1A5VA 2OPPA 4NYNA 5KFAA 3DLHA 1EKEA 1X9WA 3NAIA 4BE0A 4ID5A 4ZVHA 1K1SA 4FK4A 4FJKA 2F8EX 4RNNA 4E3SA 3JSMA 1QTMA 2BE2A 1T8EA 1RYRA 3OYJA 4ZMMA 4ECUA 2B43A 5C25A 4RW6A 4DL3A 4IFVA 3DM2A 3D28A 4NLYA 4ED1A 2B5JA 1KHWA 4OPJA 2XCPA 1VSKA 4K4SA 2W7OA 2Z1IA 4ZPDA 3AO2A 3RR7A 4DSKA 4WE1A 1KLNA 3NH0A 1Z4UA 4KO0B 4NLQA 2DPIA 2IA6A 4C8NA 1S1XB 1NOZA 2BGGA 2G8FA 3TAMA 2FBXA 4DQPA 2V4QA 4XIUA 5DLFA 1T05A 1LWFB 2G8KA 5CYMB 1S9GA 2BE2B 1RA7A 4Y2AA 5CZ1A 2YNFB 1C1BB 4KPYA 1JKHB 3NE6A 2J6SA 5KGWA 2FC0A 3NGYA 4W5QA 3KK1A 1JLBB 3QO9A 1RDRA 2AU0A 4DQRA 3PVXA 4Z4FA 2HMIA 4FVMA 4Y1DA 4ZHRA 3HP9A 4IDKB 4F2SA 1BIUA 2XI2A 1TL3B 4CEFA 5KRTA 4FLTA 3VQ5A 4TY8A 2VG5B 4U6PA 3H59A 4DFMA 4ZP6A 3KKRA 1J54A 4ZP9A 3L2RA 2BQRA 1SV5A 4ZVEA 2UVRA 4AHCA 1C0UA 3N6LA 1N56A 2O4GA 5JUMA 3DMJA 1O1WA 4CJTA 4DS4A 2HNZB 4M3ZA 3QNNA 3K5LA 3VQ8A 4GC6A 4FBUA 1JLFA 4FJJA 3HVTB 5K14B 3MXIA 2GBZA 4IH5A 3IAYA 3M9NB 4H4OB 4IDKA 1G15A 5C24B 5F8JA 2HHUA 1KVBA 4KREA 4HUEA 4B9VA 3OLBA 4J9NA 2BR0A 2RPIA 1NKEA 2VG5A 4IBNA 2WCXA 3NAHA 1CSJA 3UIQA 1LV5A 4FK2A 4QCLA 2CKWA 4N47A 1NK7A 1S10A 4JS5A 3KJVB 4JV0A 1S1UA 3PJWA 5KFTA 3RMAA 3KLFA 2XI3A 2AX1A 4YNQA 4Q8EA 1C0UB 3KK1B 4RNHA 1HYVA 3E51A 4ZP7A 1S0MA 4KTQA 4KKOB 4CEQA 3OYKA 2G8WA 1QSLA 2B6AB 4CGFA 2RKIA 2IM3A 5KT5A 2X6NA 3VQBA 4YP3A 3G6XA 3SCXA 4O3QA 4ELTA 1ZETA 3KLGA 3V4IA 1YT3A 3OS2A 1FKOB 1CZ9A 4AHSA 2Q3SA 5KFMA 3L2UA 3V9ZA 1NOYA 1GX5A 4KHNA 3LP0B 3KTQA 2XGQA 3RWUA 1S6PB 2ZD1A 3RB3A 1CXUA 4URQU 1S6QA 1VSMA 4MIAA 3I8DA 4DL2A 5L1KA 4KAIA 5KG4A 3VA0A 4O3PA 3G6VA 3TWHA 5KFLA 4KFBB 1VRUB 2DY4A 4CF1A 4I2QA 3FFIA 4KB1A 4EP4A 4ECSA 3EY1A 3N6MA 1TKDA 3QLHB 4PUOB 3DLKA 1R0AA 4JLHA 4CJ3A 1S9FA 4KHRA 3H40A 3GV7B 3H4BA 4J9MA 1RTJB 3MFHA 4DLEA 2R8KA 1C1CA 3KLEA 4CE9A 2R2SA 4WFZA 4DTNA 4QWDA 5HBMB 3MXJA 2B4JA 4KHUA 3K5OA 3BSNA 3MXMA 3CJ5A 5J2NB 4F50A 1JLEA 5DG7A 3S3MA 1RYSA 5HRSA 4CEAA 1NNDA 5F9NA 1TAUA 2QK9A 3KK2B 3LZJA 2XRIA 2EHGA 4PUOA 1C0TB 3OYIA 3V9UA 3PO4A 4NLDA 4JS4A 1RNHA 2IC3B 2FLLA 4KHYA 3OLAA 4I7FA 3OJUA 4ICLB 2IBKA 4RUAA 3AVAA 1NK5A 1S6PA 1EETA 1HQEB 3H5UA 2FLPA 2JEJA 3ITHA 1YTAA 3NAEA 3TAGA 4G3IA 4TLRA 3HL8A 4FJMA 4N76A 4ELUA 4ECWA 4IQXA 4K4WA 1WSGA 3E01A 5KT7A 1UAXA 1WLJA 3ASMA 1L3TA 5KG6A 3NKYA 4RW9B 1HQUA 3CJ2A 3V1OA 1VK0A 2BDPA 1ASUA 4QPXA 1VSHA 3AVLA 1TKZB 5J2QB 4DS5A 4DEZA 4QAGA 3CIZA 3PV8A 3T5LA 4LQ3A 3O4QA 4CF2A 1S1VA 3DRPA 5HROB 3KHRA 4J9RA 3IG1A 2OPRB 4CFDA 5CZ2A 4H54A 1QQCA 4IG3B 2P5OA 2Z1GA 4FK0A 3DLGA 4MIBA 1C6VA 5F8MA 3MR6A 3DLEB 2WONB 2YHBA 4OGCA 5DGBA 3NGDA 3V9WA 1S1WB 4BDYA 1BIZA 3HT3A 4IRCA 5KFXA 5L1LA 2IC3A 3M9MB 4DTXA 4NCGA 4RNMA 3ZSWA 4Z4IA 4NYZA 4TN2A 1S97A 4QW9A 3ZT1A 2C2EA 3DRRA 5J2MA 4CIGA 4K8XA 2FVRA 5KG5A 1RT2A 3CFOA 1QE1A 3G86A 4B08A 4F4KA 4LY7A 4CJ4A 4CEBA 1JLGB 4CECA 4CGDA 4MKAA 2FJVA 3AA5X 1SH3A 3IG1B 4FW1A 1T7PA 3RR8A 4CJLA 4IH7A 1IG9A 4CEOA 3TARA 3DLGB 5KFRA 1RT7B 3DLBA 2P5GA 2GIRA 2OA8A 3AO4A 4ED3A 5J1EB 3JSMB 3NF6A 5KT6A 1ZBLA 4IKFA 1S1WA 1RBTA 2R8HA 1J53A 4NLRA 5DMRA 2Y1IA 1KSPA 1C0MA 1I3AA 4BDZA 3NHGA 2FLNA 4CHYA 1VSEA 4F2RA 3BQ2A 1L5UA 4DFPA 3VA3A 3MFIA 3CJ3A 1DLOA 1VSIA 4TXSA 1JLBA 5HROA 1BISA 2W8KA 1Z26A 3GILA 1HPZB 3I0SB 3FDSA 4KO0A 3GV5B 3OYNA 1XWLA 5HLFB 1U4BA 2D3UA 3TAMB 4LH4A 3I0RA 4FS1A 1RILA 1LW0A 3DLEA 2ETJA 3SQ1A 4ECYA 3VQ9A 4B8AB 3RRGA 1RT5B 1T94A 3QZ7A 2VG7A 4FM0A 1Q9YA 5KG3A 2IM1A 4O3SA 1DTQB 3BGRB 4I9LA 3NF8A 1UA0A 3K5MA 3D45A 4KI4A 1ZBHA 2HW3A 1GOBA 1S9EA 1TKXB 1BQNB 3ICLA 2QKBA 4HCBA 2EC0A 4FZYA 1FK9B 3CDWA 1RBUA 2X78A 1EXQA 3LDSA 4DSJA 1RT7A 4WYLA 1QSYA 3PUFA 3KK3B 1D1UA 1TK8A 2ZE2A 3QERA 2HNDA 5KG7A 5KFWA 4CJFA 1FKPB 3KLIB 4CHOA 4RW7B 4RUCA 2IM2A 3QEIA 1Q9XA 1SV5B 4CGJA 3K57A 1S48A 1WSHA 4KV8B 1S1UB 4PQUA 1N6QB 3AA4A 2V4RA 1RBSA 4AHTA 3QNOA 2OPQB 2AX0A 1A5WA 4O4RA 4ZTJA 3IGNA 1NJWA 4J9QA 1EX4A 5DLGA 4WFXA 3MF5A 4M3YA 1BQNA 2DFEA 3S9HA 5FRNA 4DFKA 2R2UA 4AH9A 2KFNA 1SH0A 2KW4A 2YKNB 3AVMA 4CJKA 3I0RB 4J9OA 3OL6A 1XI1A 5CY4A 3PW5A 2PYJA 4NRUA 3SQ2A 4FJNA 2WTFA 3G0ZA 4RW7A 3MEEB 4O4GA 3GV8B 1BCOA 4CCHA 2A1RA 2HNYA 4R5PA 2BQUA 4CHZA 4Y1CA 5DG8A 1MU2B 2GUIA 1JLAA 2YKMB 3MTKA 3N6NA 3GIKA 4RG8A 4K4YA 1BHLA 3LWLA 3OJSA 2FVPA 4RZRA 2HHVA 4IR9A 2RKIB 1TKTA 5SZTA 1B9FA 1TQLA 1CXQA 3DOLA 2I5JB 4PWDB 4M45A 3OL8A 2YKNA 3TABA 2PY5A 4RNOA 2AGOA 3KLGB 1TAQA 3HO1A 4FJGA 4GMJB 1S9GB 4F3TA 4CJPA 3UDLA 2AGQA 3VQDA 4HUGA 2F8TA 1JLCB 4F4ZA 3V6HA 1RBRA 3VQAA 2YHAA 5KFSA 1UA1A 3GIJA 1ZBUA 3U3YA 4F4WA 1JLAB 1RT6A 1RTHB 4ZVFA 5KFUA 3SUNA 2BRKA 3TAPA 4QWEA 3TAEA 3SUOA 4ED2A 1S49A 2I1RA 4IFYB 1Y97A 3FFIB 3ZCMA 4ZHRB 4QW8A 3CFRA 5F8GA 1BL3A 4H4OA 1RTJA 4E7HA 2WHOA 3S3OA 5KFIA 2JEGA 4I7FB 3NDKA 3OYAA 1DTTB 5L1JA 4KBIA 3PX4A 1YVFA 2HHWA 1BCMA 3CDEA 1JLCA 4R8UA 1EETB 3OYFA 4CJUA 1LAWA 3CQ8A 4YQWA 4MQ3A 2O4IA 4NLOA 2ALZA 4Y34A 4E89A 5KFBA 4KKOA 4CGGA 4EP5A 1RA6A 3TAFA 1IKXB 1XR7A 3C94A 2YNGA 3ZSVA 3PX6A 3CFPA 2RDJA 3L3VA 1RTIB 3CJ0A 3MAQA 3BSCA 2E9TA 3SPZA 3PHEA 4HUFA 3B6PA 4FLVA 1EP4B 4M3WA 5L1IA 3AO1A 4CF8A 2QV6A 4IR1A 1VSLA 1SKWA 1WSEA 1F21A 2Z1HA 1J9AA 3BSOA 1QAIA 4G1QA 3HPGA 1KHVA 4QWBA 3L3UA 1S1TB 5KRSA 4QOZB 4KHQA 4HCCA 2GV9A 5KFGA 2OH2A 5KFHA 1KTQA 4I2QB 1TL1B 4KI6A 4JRPA 3RB4A 1GOAA 2IS3A 1BI4A 4J2DA 2DFHA 4CGHA 2O5DA 4E7LA 4IRDA 4KTZA 1XR5A 4N5SA 3HPOA 1TKZA 3SV3A 2ASJA 3QEWA 3SFUA 4NCGB 2JGUA 4W5NA 4KSEB 5KFOA 3V6DA 1DTTA 3B6OA 4YR0A 4QWAA 1WSIA 3AVHA 3Q8QB 1SL1A 3OHAA 1IKWA 2X6SA 4J9PA 3M8PA 2ASLA 3RMCA 4RNFA 1RDCA 4ID1A 1TL1A 5DGAA 2V9WA 4JV1A 1SKSA 2HB5A 5CYQA 1WNEA 4DSLA 4Z4HA 4F4YA 4TQSA 1LWEB 4DL5A 3T5HA 3QESA 4E19A 1RDDA 3VQCA 3MEGB 4URGA 4B9UA 5DQIA 2G8IA 3RAXA 1RT2B 3O4NA 3LWMA 4WZMA 3D5MA 1NK4A 2D5RA 1IKVB 2KZZA 1IKWB 2IMWP 2OPPB 4JUZA 3QETA 5EWEA 3ZSZA 1WSJA 4CIFA 4RW9A 1C0TA 2HAIA 1QHTA 1RDAA 4OGEA 4NLSA 1LWEA 1HQUB 3H2LA 2ASDA 4Z4CA 1U09A 4F3OA 3M8QA 3ZSYA 4Q44A 3OYBA 4ED7A 1D0EA 1QUVA 4B9NA 1HQEA 1S9EB 4GC7A 4CEDA 4KAZA 2D7SA 1HPZA 4TYAA 3AV9A 1VRTA 4RU9A 4DQQA 2XY6A 3OYEA 3BQ1A 5J2PA 2V0NA 3M8PB 3D0PA 3I5CA 3K58A 1A5XA 3SQ4A 2RDIA 1SUQA 4CJEA 4ECZA 4RW4A 4KE5A 4MK8A 1N5YA 5EWGA 2BQ3A 1UWBA 2AGPA 3H98A 3WNEA 4ECRA 3V81B 3BGRA 5HRNA 1WSFA 3C95A 3HXMA 4PQUB 4M41A 4CFAA 4LSNA 1C1BA 3U6FA 3DYAA 3DRRB 5J2MB 4UQGA 1K6YA 1S1VB 3NCIA 4MK9A 3M8RA 3VQPA 2OPRA 1YTUA 1JLQA 4TYBA 4CJVA 4OKEA 3PW7A 2R2RA 3M9OB 2DTUA 5CYMA 3NBPB 4CFCA 5C42A 1RT4A 3ZSOA 2NUBA 4B9SA 1TVRB 5C5JA 2VWJA 4KV8A 2HVIA 3M8QB 4WFYA 3NFAA 3OY9A 4E7JA 1K1QA 2W9BA 2HNYB 4R5PB 2OPQA 2ITGA 1HNVB 2WB4A 3EZUA 1RT1B 1RTDA 3WNHA 1NKCA 3LPTA 3LP1B 3LAKA 3KNAA 2DPJA 1N48A 3HVTA 5K14A 3OHBA 3OYDA 3HM9A 3PX0A 4Y3CA 4U7CA 2VG6A 1LW2A 4FCYA 4PWDA 3UR0A 4DQIA 4OL8A 4HTUA 2IDOA 3LALA 1WNSA 3DOKA 2XC9A 1RT5A 1RBVA 3V81A 4J2AA 1VSDA 3AVCA 3AO3A 4RW6B 2PYLA 3PY8A 3QGHA 4RW8B 4E1MA 3DDKA 1RT1A 1DLOB 3OYHA 3HJFA 3U3GA 2R2TA 3KKSA 2RF2A 4HHTA 5C24A 2VA3A 2BANA 5KG2A 1S1XA 3HYFA 2QE5A 3AA3A 2IAJA 5KFNA 2JLEA 3QEPA 4Z4GA 3DI6B 2HNDB 4AHRA 5D3GB 5EU7A 4M95A 2VG7B 4DG1A 3QGIA 2FBYA 5I3UA 2W9BB 1DTQA 4I2PB 4DL4A 4CF0A 3FRZA 2YNFA 3LP1A 1RT3B 3OS1A 4IFYA 2XY8A 4NCAA 4EYIB 1U45A 3DRSB 1T03B 4WE1B 4DSEA 3AVGA 3ZSXA 1IKYB 1QSSA 1KFSA 2RF2B 3DLKB 3AVBA 2VG6B 2YNHB 1X9SA 1HYSA 3QYYA 4MK7A 1XR6A 1T05B 2IAJB 1N4LA 2FVCA 4HVJA 1FKPA 4NLTA 3H08A 1NJZA 1KCFA 1QS4A 1Z25A 3VQEA 3RB0A 1TK0A 4FM1A 1XHZA 2ZD1B 3BSAA 3ALYA 1HARA 3P1GA 2KFZA 3F73A 4K4XA 5J2NA 2KTQA 5KT4A 3T3FA 4KFBA 3DMJB 5JS2A 3HKWA 3QLHA 1JIHA 1Q8IA 2C2DA 1NK9A 4W5TA 1TGOA 3DOLB 1C1AA 1NJXA 1IH7A 1HYSB 4EO8A 4PY5A 3ZSQA 4J9KA 3DI6A 3H5XA 4IG0A 4FJLA 4FJXA 4GVMA 3K5NA 4DG1B 3BQ0A 5F8HA 4O5BA 2E4LA 4FLXA 1HNIA 2ZQBA 1YVUA 3KHGA 2D0AA 4DU1A 3UQSA 4C8OA 4G1QB 2ZKUA 1U04A 4FJIA 3CM6A 2RN2A 3T5JA 3RB6A 5FROA 2OPSA 1OS5A 2KZMA 4C8KA 3IRXA 3QEVA 4DSIA 3CVKA 3DRSA 1T03A 1REVB 1C2PA 1TKTB 2AWZA 4Y2CA 4MFBA 2YNHA 3MR5A 4O44B 3RTVA 4YR3A 3LP3A 4W5RA 4J2EA 2J6TA 4EO6A 2HWHA 3VQSA 3O3HA 1BQMA 1TV6B 4AILC 3NF7A 3L2QA 4KHWA 5DQHA 1FKOA 4OKJA 4M94A 1W25A 1ASVA 3KMSA 2ILZA 4WZQA 3BDPA 3MR2A 3TANA 1ZTTA 3CDUA 4DTRA 2WK4A 4BWMA 1RT6B 2G8UA 4ED0A 3CJ4A 4DF4A 2E9RX 4IG3A 4Q0BB 2F96A 2W42A 2IOCA 4NLWA 4FW2A 4OPKA 1JL2A 3VN5A 4YR2A 4H4MB 4EEYA 3ZT3A 1T3NA 4B3OB 4JV2A 3LAMA 4ED6A 1I6JA 4CK1A 4Q45A 4IG0B 3L8BA 2HHXA 3OYGA 4FLYA 1C1CB 5KG1A 4AHUA 2W8LA 5KI6A 3MECB 4Q8FA 2QXFA 1TP7A 4K8ZA 4M3UA 2R7YA 3RRHA 3QEXA 4ZPAA 5J2PB 4IKAA 3Q8PB 4B8CA 3NF9A 1REVA 3NGIA 4DTPA 4DL6A 4TSXA 4FJ8A 1R0AB 2WONA 5KG0A 3Q8SB 4H4MA 4CFBA 1RTIA 4ECTA 3TAQA 1LAVA 3S3NA 1BI4B 2J6UA 3BR9A 1N5YB 2VA2A 1LWCB 3M8SA 4O3RA 3H4DA 2YNIB 4FLUA 4DTMA 3OL9A 3MECA 4BE2A 4ZPBA 4ICLA 3DYAB 4DTSA 2GIQA 4FBTA 3ITHB 1W0HA 3G10A 3T5KA 4DSFA 4AHVA 3V6KA 4F4XA 3QGGA 4NLUA 4TQRA 3HP6A 3ISNC 1ZTWA 3OYMA 2Z1JA 4DFJA 4NLVA 3V6DB 5SWMA 1HRHA 2JEIA 2W9CA 2C22A 1RTDB 2IJFA 2B5JB 4E7KA 2ATLA 1X9MA 3CM5A 4C8LA 1JX4A 1ZBFA 4LD0A 3KIOA 4ZP8A 4CEEA 4E0DA 4CF9A 1JLQB 4PA1A 3NH1A 3QIDA 1KLMB 1L3SA 3PW0A 4ECXA 2OYQA 3SYZA 1SL2A 4TY9A 4O3OA 1L3VA 1HYZA 4ELVA 5I42A 4OVLA 5CYQB 3KLHB 2ZE2B 1RT4B 3RMDA 1RAJA 3QIOA 2YNIA 1NHVA 3AA2A 4CHPA 3HSTB 3HK2A 3DM2B 4K4VA 4B9MA 4FJHA 4O0IA 3C6UB 3KHHA 4BDPA 3CYMA 3V1RA 2WOMB 3QINA 2Y1JA
chains in the Genus database with same CATH superfamily
2C2RA 3GQCA 3NS6A 1XMOK 2AJ0A 2N4CA 4CHQA 2BANB 3T69A 1JXEA 4WIQA 1KVCA 1GLFO 1ASWA 4C11A 3AVJA 3C7NA 1N32J 1U49A 2YWHA 4LF6K 3VQQA 1VSJA 2X1FA 4HYKA 3GDQA 1KVAA 5BPMA 3PO5A 2H51B 4DMNA 3PIOL 1OYDA 2PEHA 2XY5A 3NWRA 3CMAS 4X62J 2HHQA 4JN4A 3OL7A 2P9PB 2EC2A 4ECQA 1U1RA 2I5JA 5HLFA 1H2UX 2R8IA 4HI2A 5HP1A 5C42B 4USMA 2E8AA 2P8IA 5D15A 3FKBA 3WNFA 4R0EA 3LZIA 4GO7X 3O8MA 2CQBA 2F7TA 4WF9L 2E66A 2O3DA 2UXBJ 3LP2A 2KYXA 2Q2RA 3R5DA 4BRNA 3AJ2A 2B6AA 3QATA 1ZBTA 2ZKTA 4DMZA 3HPHA 4JK9A 4CERA 1WSRA 3CCRN 4DV2K 2CQ1A 5A0YB 3M5RA 1SQFA 4CIOA 4LF1A 1WN7A 4RX6A 2DNLA 1FRKA 1XMOJ 1DGKN 4H4KA 2DXEA 4DV5K 4X64K 3QO9B 4R0JA 4A8QA 4FYDA 2A3JA 3VTHA 5KFEA 2XLIA 5JMNA 4KTWA 4GKKF 4Z4EA 3HHLD 2C3YA 2D0BA 1XTZA 3DDNA 2W7PA 4BGBA 4EYHB 2OZSA 3PR4A 4LMZA 4O55A 3UFCX 2O1PA 3G4SS 2YKOA 4BG9A 1S4EA 1PJ7A 5B8HA 2P9SA 1X1PA 4C7QA 4YMEA 1D5AA 1JNZB 4P2SA 4CP5A 1VR6A 2GC8A 4Y2MA 1U7LA 2VJVA 1EWRA 4PL8A 2YX4A 3JTNA 3N9UC 3CC2S 3D7SB 1I39A 3QSIA 1KQKA 3I87A 3RMBA 3HVRA 3SI8A 2UUWA 2P9LB 2FBTA 2NRTA 3P83D 2ZM6K 3MHYA 3RBEA 2GELA 5ETQA 1M1GA 3K89A 2HVZA 3DU5A 1SL0A 2Q31A 4XH4A 2UXBK 4ZIWA 4V19X 4ZVPB 5I3UB 3CJKA 3KD1E 1NK8A 5AXLA 4X4TA 4FWSA 3MM8A 3U8XA 4DR3K 4AF1A 4FZXC 2UV8G 3D66A 2QGFB 5A8RB 3PJXA 4JRQA 1Y10A 3ZX3A 2B9WA 4DTUA 1IKYA 1GNKA 3MMBA 1QAJA 3R8YA 1WACA 4JI6K 2JEFA 3AVNA 3H5SA 4PWUA 4DUTA 3POTA 4CZFA 2UV8A 1S5JA 1KTVA 3V4IB 3IAS9 3AOBA 1XEZA 3R9LA 3G2XA 3KJVA 5J2QA 3UB5A 1PILA 3DLRA 4GVLA 4O0NA 1UKUA 1MW7A 2E5IA 3ZT2A 3AA9A 4ZPCA 3IFEA 1JJ4A 4WFNQ 3ZNUA 5IV3A 1VQNS 1IM4A 1KWMA 4NEYA 1N54B 3TR8A 5D8HB 2KG0A 4O44A 4A8XA 3FZFA 3SUPA 4NL5A 1RCHA 1X31C 3U7JA 1VQ6S 3GONA 3VPZA 3L4BC 3IS9B 3T9NA 5F8IA 3KG0A 4GKJK 4MLEA 2W9CB 3AVFA 5B0CA 2ZH6A 3AVKA 2XGPA 3H46O 2HBQB 4Q5VA 2KL8A 3RBDA 3LDPA 1Q95G 3NLCA 1VRUA 4DN0A 4CYUA 3TQEA 2OUGA 1J5EF 4BREA 1HBOB 2HVHA 4DPUA 3EPIA 2FIUA 2BRLA 4JI3F 4RW4B 4DV3K 2DRBA 1FRIA 2B4UA 2ATQA 4WFAQ 3ZSRA 1FXDA 4CJQA 5IT9Y 2YWEA 4GV3A 5C0YA 1OO0B 3HKZD 3NGZA 3J7A1 1VK3A 4JI6F 1GOCA 4IEEA 2ZZNA 2P9UB 1U48A 1CJKA 3TUZC 2RRBA 3K2YA 2OMLA 3VOVA 2WRMA 1N34F 1RI7A 2G8VA 3A3PB 3V6JA 4ID5B 2X74A 4M3XA 1FXXA 3KK2A 2AJQA 1YZ7A 1AB8A 4M63A 2W2MP 4C3KA 2ROGA 2UVWA 4ILGB 5AJ3F 4CJWA 2NPIA 3AO5A 1Q86O 3NH2A 1WC5A 4ZJOA 3C6UA 2R8GA 4YEAA 2XMJA 1TK5A 4DWIA 1ITGA 3L2VA 2EW9A 4IOBA 5KAKA 4NCBA 3PM9A 1VGYA 3VENA 1KFDA 1ZS6A 1VQ9S 2XHBA 4IH6A 1QQMA 1LW2B 3ENWA 3M05A 4H5RA 5DZ6A 3NBPA 5C2DA 3TUIC 3MWBA 3KLIA 3ZZTA 1MMLA 3UCZP 4J9SA 2VU5A 3VTIA 1HFEL 1WWHA 1S0NA 3EPGA 1HNVA 3NMAA 2DNHA 3BREA 4FWQA 1RU1A 2IDEA 1SH2A 5L38A 2W01A 3JTPA 1PG5B 1A5VA 5LJVA 4NWBA 1X9WA 3KJFB 3EICA 3CEDA 4LF4J 2MKIA 4U95A 3JAMO 4OX6A 4QR0A 3JSMA 3W9IA 3WUHA 4ZMMA 2ZZTA 4DU8A 4RW6A 2POKA 1F60B 4X62F 4IYQA 2F9JA 4LF5K 1VSKA 1N8RO 2GO9A 2Z1IA 4ZPDA 3AO2A 3O9UA 4WE1A 5CHIA 2BGGA 3TAMA 5EX5A 4DQPA 2JH3A 1IBKJ 1HWLA 2B4OA 1C4CA 2BE2B 4JV5K 4MDBA 2RT3A 1YI2S 3HHLB 4Y2IA 4OYWA 3NGYA 2HBYB 2BJDA 4MLHA 4OLOA 4JI3K 5B0EA 4DQRA 3P45B 4FVMA 3K5PA 1VC5A 1S72S 1KEKA 2GMJA 2M5YA 1TMMA 1R89A 1NXIA 3CMQA 2XI2A 4XAKA 2RRAA 2BW2A 5KRTA 1CVJA 4B3TJ 1FTRA 1U6FA 4AL6A 2QLXA 3H59A 4KT0C 4DFMA 4ZP6A 4DCOB 2VQFJ 3L2RA 3BZCA 1NGDA 1SV5A 4ZVEA 5BRFA 2UVRA 1FI4A 1SZ2A 3N6LA 3LL3A 2ZJPQ 2DHHA 5DO2A 3HHNB 3GE9A 1NZ8A 4CJTA 2HNZB 2EK1A 3K5LA 4FJJA 1UEUA 4HACA 1VQMN 1VBZA 5AQZA 3NVKA 1S5ZA 4W98A 3M8YA 2BR0A 2VWBA 3POTB 2FDNA 2WCXA 3VEXA 2E1YA 1RAOA 1Q8BA 1ZZNA 1TR0A 1LV5A 4QCLA 4CBUA 2CKWA 4DV1K 2CNKB 1DY3A 3FNNA 4A4JA 3U9ZA 2F7VA 3PJWA 4A59A 3KLFA 2XI3A 2AX1A 4OZJA 2P6TA 4Q8EA 2LQ8A 1HYVA 4KTQA 1YJWN 3K9KA 1Q86T 3MCOA 3I6PA 3OVBA 1QSLA 1IBKK 3PXGa 3C3LA 3R6MA 4RLEA 5AQYA 1K8KB 3BDEA 1Z1ZA 5E5NA 2BACA 1YT3A 3HHDA 1FKOB 4AHSA 1NOYA 3ET6B 5IQQA 4LF9F 3RWUA 1S6PB 4URQU 1S6QA 5L1KA 4KAIA 5KG4A 5IT4A 4O3PA 3G6VA 5E3AA 3O1BA 4NB4A 1VRUB 2CH5A 2DY4A 3FFIA 2GX8A 2M7SA 2GEMA 4R25A 2G9OA 4YY3F 4PUOB 3DLKA 4I64A 5T7LA 1S9FA 3O44A 1RK8A 2N7YA 1X5PA 4JI1J 3MFHA 4DLEA 3FCVA 1CJUA 3VF0B 4H0VB 1RSCA 2ZBPA 1OSDA 2WSCC 4QWDA 1S7HA 4IWVA 4KHUA 3MXMA 3G8TA 3W2WA 1JLEA 5JVHQ 3S3MA 4UY8T 1N5TA 4HLBA 1U1PA 3W63A 4BR4A 2PI5A 1TAUA 4M5DA 5HAOA 1TL5A 1YUWA 1IXKA 1H1VA 3PO4A 3I55S 2XMAA 4JYAJ 2DNMA 4WK1A 4KHYA 4PXEA 3OLAA 5IC6B 2MLXA 3SK3A 1SCJB 3DAWA 4WQ5C 4TU7A 1EETA 8ATCB 2CH6A 2FLPA 3SSSA 1YTAA 2H9ZA 3IUCA 4ECWA 4IQXA 1WSGA 5KT7A 1E4GT 4UW2A 1WLJA 1ZH5A 3U27A 1KQSR 3LPEA 3L0QA 4ZKAA 1DEJA 3OBYA 3ZZZA 2F9DA 3WX8A 3OTEA 1U2CA 1WORA 3CPWM 4DR4F 4CLYA 4FPAA 2BDPA 3O9SA 1XC3A 3AVLA 3QGPA 1M1HA 4DS5A 4FF4A 2B7BB 4CF2A 2WBMA 1S1VA 1LQ9A 5A8WB 1KD1T 3MM5B 4DR6F 4H54A 5CZ2A 1B7FA 1QQCA 4IG3B 2P5OA 2Z1GA 3OR1A 4FK0A 3LDOA 2NQPA 2QW9A 4IZ9A 2D74B 2JFKA 2YQ1A 3PRDA 3MR6A 2PC6A 5DGBA 3NGDA 1T9VA 1KD1O 1KAYA 1VQ6N 3C7NB 1WHXA 1FT8A 2IC3A 3N5BA 2A5XA 5CA5A 5G0RB 3AD8C 4RNMA 4LBHA 4NYZA 2ZM6J 1KKHA 5LJ3Y 2HBMA 3R5CA 1EIYB 3DRRA 5CQGA 2FVRA 3R1HA 2ABYA 4CJ4A 4CECA 4MKAA 2FJVA 3AA5X 1YAGA 4KH0B 4CJLA 1UJ4A 4Y0FA 3WEEB 4CEOA 3DLGB 3DLBA 1UVLA 1TL7A 4ZA1A 2P5GA 1IBMK 4A8KA 1F5BA 4OV6A 1ZBLA 1S1WA 3E1YA 4ISFA 4PG6A 1C0MA 1VSEA 1RAEB 1G7CB 4F2RA 2QFJA 3FZ2A 1Q78A 2IY5B 1VSIA 1Q82T 3NCPA 4J9VA 3GILA 4Y28C 1HPZB 2BTFA 3GV5B 2A1BA 3OYNA 3E8OA 2AIRB 2D3UA 3T1HK 4KY3A 3SQ1A 4ECYA 3P31A 5GIPA 3RRGA 1T94A 1PC5A 5KG3A 4PG5A 2F9TA 3HI0A 1OPZA 4QZVB 3PACA 3C65A 3VGTA 2H3GX 1XIQA 3CO0P 3BGRB 3HM8A 3D3CJ 1Q81T 1GOBA 1S99A 1EJ7L 3PHTA 2XMUA 5GMKa 1CS4A 5F1XA 1QZ5A 1OH8A 4ZVTB 1FK9B 3CDWA 1H73A 3D0GE 3FBBA 3BY5A 1D1UA 5L46A 3KLIB 4CHOA 4RW7B 2CGJA 1F5AA 2XZWA 3EXCX 2N7CA 3R7SB 2E1CA 3CCZA 1RBSA 1U6ZA 4AHTA 2QWNA 4K25A 1A5WA 4ZTJA 1CLFA 4HT5A 5DLGA 4WFXA 5IQ6A 3O9TA 5FRNA 3GG4A 2RNEA 2XMTA 1HHQA 4QR2A 2KT5A 4ZCIA 2KW4A 4O23A 4AQYJ 2YKNB 3A12A 3B8AX 3QRRA 4J9OA 3OL6A 5ADXH 5CY4A 2CJBA 5GAEI 3UKUB 2PYJA 4NRUA 3M4XA 2WTFA 2MYFA 3G0ZA 2DEIA 1UL3A 4CCHA 2JDJA 1HLWA 2RH3A 4GVBA 3OTOF 4GV9A 4R5PA 4H4KC 1OJ4A 4CHZA 4Y1CA 1MU2B 3N6NA 3GIKA 1A6LA 3ZYYX 4K4YA 1QHAA 1MN7A 1TMJA 1IBLJ 2E5HA 3OJSA 3CETA 1P6TA 3NRBA 2BMBA 2BZ2A 4ZVOB 3U4LA 5SZTA 2Z4PA 4LRFA 4IDHA 3WXIA 4GO5X 1YLXA 1QD1A 2YKQA 5AQOA 3P4IA 2ZGZA 3TABA 2PY5A 2V67A 3KLGB 2DK2A 4HVZA 3HO1A 2GJFA 1QZ6A 4F3TA 3UDLA 4PYAA 3CIMA 1JLCB 4F4ZA 3MM8B 1RHQB 1EB0A 2ZVIA 3GIJA 4JI2K 5M1KA 3Q7CA 4B3SJ 3TAPA 5A8RA 1U1NA 2Q36A 3TR5A 4IFYB 1Y97A 1DHMA 3CULA 4P71A 3ZCMA 4IO9Q 2R4FA 2HOEA 4JI8F 3FZHA 1BL3A 4JNEA 4MT1A 1RTJA 3CMES 2M8DB 2AYMA 2WHOA 3T1YK 4GY2B 5K8MA 3S3OA 1X9JA 2IVYA 4OI6A 1KN6A 4I7FB 5MAOA 4LFCJ 2O8FB 4KBIA 4DR1K 4ANDA 2KJVA 3CDEA 4LSZB 1U2VA 4FYYB 1U1LA 2QLBB 4P9SA 1VS3A 2GA7A 1G3OA 5JVGQ 4Y34A 3WHIA 2YKPA 2UUAF 1RZMA 1B64A 1DAXA 4CGGA 2YKAA 1YJUA 3ZSVA 2O67A 3CFPA 3D6TB 1YIJN 1D9AA 3SPZA 1U2RA 2L9NA 2EXUA 3PHEA 5B0GA 3AQOA 5L8RC 4X65K 4M3WA 1KVKA 4IR1A 3A5NC 3R5BA 2OI2A 5IT0A 1SKWA 4HL9A 3D3BJ 2J7KA 3GB0A 3BF4A 1F21A 3MN7A 1J9AA 4EMDA 2HIQA 1J27A 2EKYA 1KHVA 3L3UA 3MM5A 1NGEA 4CNYA 2GO8A 2E1PA 4U7UD 4ZPTR 2HBRB 1LXNA 5ETVA 3VZHA 3VAHA 4C48A 1BI4A 4NXMJ 3UW1A 4JI4F 2O5DA 2IVMA 3DRXA 4E7LA 4DCHA 4J7CA 4YB6A 4KH6A 4N5SA 3C8YA 4DUYJ 2JGUA 3SFUA 4NCGB 1VISA 5EHHA 1DTTA 2KM8C 5ETOA 2JX2A 2D9OA 4QWAA 4ZIVA 3AVHA 5FPDA 1GFWB 2OELA 3AHPA 2FB0A 3ULEA 2DH9A 2G0IA 4PG7A 4J9PA 3M8PA 1YKWA 4RNFA 4YORA 1TL1A 1YJ9N 1HW9A 2FY8A 4M5DB 4JV1A 1SKSA 4A8OA 5CYQA 1WC4A 2F40A 3D68A 4TQSA 3W8GA 3O5TB 4LFCF 1E6YB 4BR2A 3MEGB 2P9IA 2RU3A 1HWKA 4WZMA 3D5MA 2KZZA 1S3XA 1IKWB 5F2RA 4L3QA 4JEPA 4DPYA 2B3TB 1WI8A 2Z2YB 3GSIA 3OFEA 3THTA 1QHTA 5H1SQ 4IJAA 1LWEA 4Z4CA 3IM8A 5HJXA 4KH5A 3NVMA 1UFKA 4FWPA 3ZO7A 4OJHA 4GC7A 4U96A 3OR2B 3DHXA 1CG2A 1HKBA 3AV9A 1VRTA 1M1KO 5B0AA 3D0PA 1S57A 1ZM2A 4NI2A 1A5XA 3SQ4A 4DR1F 2KT2A 4PPDA 4ECZA 2YX7A 4CZCA 4KE5A 3B82A 4OYBA 2E29A 3WNEA 5EX3A 2O01C 5HRNA 3HXMA 4EU0A 3SQOP 3DRRB 2DBBA 3FK4A 1K6YA 3AGKA 1S1VB 2QZ8A 3R5JB 3M8RA 1RWUA 3VQPA 1WSVA 3W7BA 2HQCA 3Q8YA 1NMEB 4B3MF 3B4MA 1JLQA 3NNCA 3VVTA 2OANA 4DR7K 2Q6BA 2FHOB 4CO3A 4CFCA 4C4WA 2QLWA 5F0UA 3M6WA 4B9SA 5C2GA 4L74A 4GVBB 2VWJA 2WSEC 3GJRB 4R5PB 1AUSL 4JYAK 1RAHB 1Y5IB 3EZUA 1RT1B 2APOA 3HHEA 5IS2A 3D1HA 3GYGA 3MEKA 3PX0A 2GJIA 1B0VA 1WUUA 1QUPA 2KO1A 1Q79A 2MGZA 1PJ5A 3UR0A 3VGVA 2X1AA 2O8EB 4L6V3 2MKYA 2AP1A 1WNSA 2OEJA 2XC9A 1NJIO 1RBVA 3V81A 4JK8A 4J2AA 2CJ9A 1MWQA 2JRSA 2NSCA 1MWMA 3DXKB 5AQSA 3W1YC 3S6EA 4CLZA 1SXLA 3U3GA 4ISGA 1HNZJ 3WC2A 5F0WA 4HHTA 2QL7B 2YWGA 4C0OC 5C24A 4ES3A 1QAXA 2VA3A 3BP8A 2IIHA 4KGVB 1S1XA 3DI6B 4KYZA 3DLLQ 1IBCB 3G6ES 2YX6A 3MM6B 5EU7A 4M95A 3PNIA 5C2FA 2R7WA 1NM2A 3D2EB 2HGNA 1JJHA 2XHCA 3ET6A 2HQIA 2MZRA 5BYRA 2QTWA 4I6MB 4H5NA 3AQPA 2YNFA 4QQBA 2QX0A 1RUSA 2EPIA 2OFHX 2XY8A 4WBFA 2R42A 2DR9A 1WHWA 3FSXA 1C0FA 2C3PA 3AVGA 4KHPF 1QVFM 3CIPA 3DLKB 1KS2A 1X9SA 1HYSA 1T9UA 1HL6A 1UFLA 1DBDA 1RP5A 3N28A 1RAIB 4BBYA 1AXQA 1NJZA 3J8AA 1BG3A 4DU7A 4IEIA 3UN2A 1XHZA 1HARA 3L4QA 3P1GA 2KFZA 1T3OA 3TSQA 5J2NA 2KTQA 1T6CA 4PG4A 5KT4A 3TUJC 5DS7A 3ENQA 2CJKA 1KC8O 1E6VB 1X4DA 1LWXA 3TZZA 1ELOA 1KOOA 1NK9A 2K1RB 3DOLB 1IH7A 1FEEA 4EO8A 4PY5A 3ZSQA 4J9KA 2HIYA 1AZSA 2IHR1 5HQMA 1WTBA 3AODA 2OSQA 4GVMA 4M63C 3BQ0A 2QA2A 1NWKA 5F8HA 2VGMA 4O5BA 1M90O 4FLXA 3CCJS 4QJVA 1HNIA 3BYPA 2XSFA 3UQSA 4C8OA 2ZKUA 3D2WA 5FPNA 2RN2A 5AT1B 3E9OA 6AT1B 2ZHOA 3H3NO 4OZ2A 3AD9C 4B3RK 4DBQA 3QEVA 4DSIA 3DRSA 1T03A 1C2PA 3ZEUB 2QC3A 2HHHJ 4CZGA 2YHYA 3MR5A 3RTVA 3BN4A 3LP3A 3L4IA 3UDCA 3VQSA 2DD8S 3ZC4A 3Q24A 2A10A 1NDPA 2Y1RI 4AILC 1RU2A 2CZVC 3NF7A 3L2QA 4M94A 4BR0A 1Q8LA 1Q1KA 1ASVA 3DGVA 5L39A 3CCSS 3BDPA 3SBGA 5GADI 2F9WA 3CDUA 3P38A 2WK4A 1SJ4P 1I94J 3Q8VA 1S79A 2CPDA 2QL9B 2FSNA 4DR5F 5BR8K 2YQ0A 1NB7A 1FFWB 2W42A 5AQNA 4OPKA 1H7WA 4H4MB 3MUVP 1GMUA 4WK3A 3SAGA 4B3OB 4CK1A 3J81j 5KPZA 3CSKA 4MTPA 4M5JA 2K7JA 2KVQE 1C1CB 2W8LA 3ENVA 4Q8FA 2F4FA 1NAQA 2NLWA 4M5NA 4CLLA 4X4OA 5J1PA 5GMEA 4ETZA 1H6KX 3CCES 4JI4K 4K8ZA 4M3UA 2GVZA 2GV1A 3U9DA 3C2PA 4JV5F 1YTYA 2R7VA 3OR1B 1FX2A 5DM7Q 4BC2A 3NF9A 4A8MP 2PN6A 4X64F 3I9ZA 1R0AB 4KHPJ 3OTOJ 4DV4K 4CFBA 4ECTA 3TAQA 1LAVA 4LF7K 1BI4B 3F41A 5AQHA 5GAHU 2J6UA 1N5YB 4O3RA 3H4DA 4KPCA 3CPEA 2WBNA 1HR0K 5BPLA 2V2VA 2ZUGA 3Q0AA 4WPAA 4DTSA 2W7AA 2GIQA 5JICA 2VZ9A 1G1XA 1RHRB 2NSBA 3IBWA 4B17A 1X60A 2J0XA 4B3TK 2DHAA 3ILOA 3AY0A 5AQWA 4AHVA 3KG1A 3V6KA 2AMCB 3M3ZA 4JKFA 1FDBA 3GFXA 4X62K 2J8AA 2C2MB 3OVAA 2E5JA 1U6BA 3ISNC 2O8DB 3T1YJ 3OYMA 4DFJA 4QIEA 3UN3A 4ZJQA 4KJIA 2VDIA 4K2XA 2PMWA 3TA2A 3F2KA 2DNPA 2VCPA 4B1ZA 1WC3A 4CF9A 4A2BA 2P9EA 2XS5A 4FYWB 5M2PA 3PW0A 5DM6L 4ECXA 1L3VA 2HZAA 4K43A 3I56S 3EUNA 3D2FA 3W5ZA 1V3ZA 4OZNA 1NO8A 3H90A 2YNIA 1NHVA 1F9EB 4DCJB 3DM2B 1R8HA 4FJHA 3C6UB 3KHHA 3CYMA 2ASPA 3V1RA 3T9ZA 5JLFA 1RBAA 2QWQA 3Q86A 2HMIB 5KFFA 4FS2A 3OYLA 3EKUA 4DU4A 4XPCA 4YS2A 3ILLA 1YWXA 1WELA 4CK3A 3PYEA 2IGIA 4TY8B 3I33A 5HP1B 1V3RA 2GGPB 5D0GA 1YZ6A 1WAFA 2GQQA 3L2WA 4KGKA 5IC4B 3EJMA 2E88A 1K8AT 1SJ3P 3D6FB 5E0OA 1QE1B 2ASOA 3O6QA 1TUGB 5LSRA 1FNXH 4BE1A 2OAUA 4ZVRB 2QEXN 3O3GA 3LUYA 1TL3A 1UMJA 5AQLA 5LMUJ 3U1MA 3T6JA 3CG7A 3GE1A 1QDUB 2UUTA 2O66A 2CVEA 3T7ZA 1FDAA 2LSNA 2D3ZA 2BJ1A 2YWFA 2R7QA 3TYTA 5LMUF 4OZ5A 3GYNA 1MU2A 4LQ9A 3KZBA 4H8KA 5T7BA 4NZ0A 3TZYA 3PW2A 4OJRA 2LDYA 1TKXA 3MOZA 4CLKA 3D0IE 3JTOA 1JLFB 1CJVB 3I0SA 2DGTA 4DL7A 1PCAA 2NZ4A 3JYTA 1SJ1A 4M42A 2AEFA 2VHGA 2YI1A 3TVZA 3O3LA 1N36J 1BA1A 3VEOA 4H0TB 1JXLA 3VWSA 2VQEK 2PE8A 1T44A 3KK3A 1FRLA 2HLTA 3AOCA 6FD1A 3VHQA 5KT3A 1JNRB 5KFPA 2IFXA 3CJCA 1NG9A 2KT3A 3JQJA 3KLVA 1M1KT 2CQGA 1VHXA 1N6QA 3K7RA 1BGXT 1L3UA 3V9SA 4DUZJ 3EYZA 1XJWB 3G71S 3K2PA 2G8HA 5I3PA 4QPTA 3GIMA 2W9AA 2G4BA 4MFBB 4QYZK 1GMWD 2VGNA 2QA1A 3F9KA 2YJEA 1LWFA 1MA9B 3TP2A 4OJ1A 4FJ5A 4J37A 4FJ9A 4ED5A 3NXZA 1NKBA 3LP0A 1P9YA 1ZM4A 4LFAF 4XH1A 1RT3A 5LMUK 3IRXB 3MMJA 1W26A 1U0HB 4Q0BA 4YB1P 2CFXA 2L9WA 2GVDA 3HFKA 3Q22A 2ZJQQ 1IO2A 4KH1B 3I56N 5DK5A 4DTOA 2QSFA 3M2VB 4NLXA 4JI1F 1MNEA 1BWEA 1K47A 4A8YA 3ISND 3TVKA 5CCMA 1MN9A 2ASMA 1CC8A 5LJWA 3SQ0A 4HHJA 5A2QY 5LL6Z 2RD5C 2J9DA 1RTHA 2P9NA 2D1CA 3VQ7A 2DO4A 2GFFA 4P7VA 2VQEJ 1IBMJ 3H3OB 3UI3A 4NEZA 4RUHA 3H5YA 2CQHA 1I94F 4EBDA 5DG9A 1VLYA 1RWNB 1T02A 3I5AA 1F6TA 3MPYA 1Q5VA 2OD6A 1NNEA 1E6YA 3IR7B 3PKMA 2FSJA 3RG6A 3ZTRA 4X66F 1CC7A 4A61A 1NGJA 3ISZA 1RISA 5AQXA 5GAEP 1HNIB 3W2VA 3T1YF 4OIXA 3GP9A 4EBCA 4USUA 4NA2A 2WW8A 3R7NB 2XB2D 1B0PA 3MEDA 3I55N 2LXUA 2SXLA 1OMSA 2KXFA 3H0PA 2CNLB 3VGSA 3WX4A 2CZ4A 4NYPA 3A5LC 3VF4A 3MEGA 1U47A 2D0CA 3S01A 3V5RA 5LSLA 4C8ZA 5FPMA 1Y7PA 1UP1A 5E41A 1UPMB 3FJ2A 1CZAN 2QWLA 5ELZA 4FF1A 3A0IX 1N32F 2F8SA 3DRPB 2BA9A 5AQPA 2VPZB 3MOJB 3ENAA 1VRTB 1O8BA 4K8RA 2NCKL 5AQMA 5I4MA 2ZZMA 3SMZA 2QWPA 3LTOA 1RBLA 3SJJA 4A8FA 3WC0A 2B0GA 3OS0A 4KRFA 5B7WA 3W8PA 1G6BA 4B3OA 2E2NA 2FHJD 3Q7BA 4DR3J 1UWBB 2R8JA 2RRNA 3HHKA 2BJ7A 3TA1A 3SUQA 2B9YA 3M2RB 5GADP 4KGZB 2HYIB 4UOGA 1WTFA 3BH7B 3JS6A 2NRRA 3A8IA 3THVA 3EGWB 3TI0A 3EZOA 3OYCA 3ATUA 2FJWA 2CQ4A 1NK0A 1UCNA 4IOCL 4JI7J 3OUYA 3FUYA 3A2FA 1U1KA 2F4VF 4ISEA 1IR2A 3SV4A 3W0LA 1YJWS 2MJUA 1ZPWX 4N41A 4CI6A 4FLWA 1H98A 3OTBA 3Q8RB 3G6YA 4BWJA 4NRTA 4FXVA 4XO0A 1H0HB 2IM0A 4JV5J 4UQTA 2FZCB 2YCHA 2PEBA 2NRVA 5FRMA 1VIOA 3LDQA 3N4QA 3VCDA 3TO8A 1WUAA 3QRPA 4JI3J 2MGZB 3HSJA 4I69A 5EWFA 1NLKL 4NLPA 4HEA9 3J7ZT 2DGUA 5EGYA 3M32B 5D4OA 1TVRA 3GIIA 1VQPN 1FWKA 2OZMA 2FJAB 3US5A 5BRHA 1NJYA 1S76D 3VQTA 4OJ3A 1ATRA 3ZT0A 4M5KA 1S0VA 2D41A 3JQKA 4FZZA 2BE7D 2ROPA 4NYNA 1RTZA 5KFAA 3NAIA 1CJTA 1QLNA 2BM1A 4ID5A 4ZVHA 4LR8A 2K7KA 3S41A 1SC4B 2VFTA 1TL7B 2R3VA 3GR0A 4RNNA 3PFEA 4E3SA 2BE2A 3CCVN 1TTHB 1T8EA 4K0KF 3OYJA 1FF2A 2JSXA 3CQXA 2I0XA 4DL3A 2KKZA 4DX7A 3MUMP 2HF3A 2BUPA 4F0HA 4ED1A 1YBTA 4C1NI 4OHVA 3L6QA 1V3SA 1KHWA 4JKBA 3NOGA 3W5XA 4K4SA 5G4DA 3KJQB 2DPIA 3X1LB 1NRKA 4X4SA 1VK8A 3P8BB 2P9GA 3FFKB 2FBXA 3WQPA 2V4QA 5DLFA 1MROA 5CYMB 1S9GA 1XBWA 4BVPA 1RKJA 4CTAA 2YNFB 4DR4K 4KPYA 1JKHB 5KGWA 5ETPA 4XK8C 3TTFA 2FC0A 2QO3A 1FJGF 3KK1A 1Q0NA 4FF2A 1RDRA 3PVXA 4Z4FA 3AJDA 1AROP 4L3NA 1CS4B 1M0SA 3H2UB 1YSJA 4ZN1A 5AQTA 1TL3B 3TWZA 4J90A 4K2JA 3OQ2A 3VQ5A 1APSA 3CCQS 4U6PA 4L76A 1LXJA 3RZAA 4O5FA 1J54A 4ZP9A 3BBBA 2C42A 4H0OA 2IIRA 1C0UA 3DRYA 4UY8O 2RQMA 3U1NA 4JKCA 3DMJA 1P9QC 3QNNA 4FBUA 3A8KA 4RPFA 4WU2A 2HSEB 4DX6A 4IH5A 2E1AA 1VLOA 4QIFA 2KU7A 4H4OB 1NMDA 4HTJA 4U7UK 5T7LB 3BKUA 5F8JA 2V34A 3P4UB 3L7PA 3ZXWA 4HUEA 4B9VA 3OLBA 4J9NA 2VG5A 4ES2A 2XULA 2V8VA 2QMUB 3CJKB 2YPZA 4JS5A 4FOEA 5KFTA 2EWHA 5FJ4A 4TVAB 1N5VA 1SQEA 4RNHA 3E51A 4HT7A 3M8WA 2KDOA 2MHEA 1WEXA 5D0HA 3BBCA 4YHHF 3MM9B 5DDRC 2HFUA 4DJBA 2IM3A 2JL9A 3JAMU 1K73T 3BB5A 3L7UA 4LF8J 2CJYB 3GZ7A 3ZZRA 4YP3A 3G6XA 5LY3A 1CJUB 2J76E 3CD5A 3V4IA 4LVOP 1CZ9A 2Q3SA 3V9ZA 4RKUC 4RO0A 4OJGA 3LP0B 3KTQA 1BDGA 3EM1A 3NGUA 3GG1A 2ZD1A 2VONA 3PLAA 1VSMA 4DL2A 3DN9A 1VRQC 2Z2MA 3ZETB 4JAXA 1HI1A 2X1BA 4KFBB 4NXNK 4CF1A 4I2QA 4K0KK 4MO5A 4EP4A 2XNRA 4ECSA 2RE2A 3QLHB 1R0AA 4BRCA 2KJWA 4CJ3A 3CJTA 4KHRA 1YITN 4J9MA 3H4BA 5HMZA 1RTJB 5BJRA 3GMGA 2R8KA 3QFPA 2RDDA 3G4SN 2R2SA 2F3JA 4WFZA 3QB0A 4DTNA 1PYOB 3K5OA 5H9EJ 3CJ5A 1WC6A 5M1OA 4X4UA 4JI0F 1WDDA 4B1VA 1A7GE 2X3GA 1NNDA 4DR7J 2AYGA 3PIOQ 2R7UA 3ILIA 1W2BM 2MY8A 1WC0A 2DGWA 1C0TB 3ELHA 1K73O 3KFWX 4JS4A 2JWLA 2IC3B 1FNMA 4DV2J 2JVOA 1RGIA 4IOAL 2B4PA 4KQZA 3AVAA 2MQLA 3NOCA 4USHA 2YJFA 4FJMA 4N76A 5IZHA 4ELUA 4OHYA 4K4WA 3E01A 1NM1A 3I31A 1DRZA 3F56A 4DI6A 4H5TA 1L3TA 5KG6A 3DOMA 3NKYA 4RW9B 3J7YU 4G6VB 4WP9A 2CPIA 3GYXB 1HQUA 3P5TL 4QPXA 3M1FA 1VFJA 1TKZB 2ZH2A 4CZHA 4QAGA 5E2QA 3PV8A 1W7AA 4WQ5A 5AE2A 5DDPC 3W9JA 5D77A 1PGZA 3MCNA 3KHRA 4ER8A 1U2FA 2QXLA 5CXTA 2NXCA 1C6VA 1CPZA 2YHBA 2WONB 2OO4A 3ZLJA 4BDYA 4I0WA 1BIZA 1BC6A 4IRCA 2MQOA 3I96A 5ETTA 3KHYA 3H8YA 1U1OA 3HSDA 4TN2A 1NGGA 2CUYA 2I9SA 2FTRA 3EGVA 3CFOA 2XBPA 1QE1A 1R8BA 2M9KA 4LY7A 4CEBA 3CPWR 1JLGB 1U1MA 1T7PA 1T11A 3C16B 2W41A 4IH7A 1IG9A 3TARA 5KFRA 1Q7YT 3RW6A 3AO4A 3PTWA 3JSMB 3W62A 3NF6A 4IKFA 1RBTA 2R8HA 2VBZA 1NGCA 2OTLN 3GOIA 3DGPB 4B3TF 2LQBA 1KSPA 1I3AA 1V5IB 4USJC 2RS8A 3SAHA 3BQ2A 2Y0BB 5IWAF 4DFPA 5A8WA 4TXSA 1RAAB 5HROA 3HRGA 1GK8A 1O0PA 3FDSA 3E3XA 5DJBA 1P8GA 1XWLA 1GLBG 2LU1A 3G87A 3I0RA 1LW0A 2ETJA 3IMXA 3SMSA 2U2FA 4B8AB 1BWVA 3J7ZO 4B3SF 2VG7A 4FZVA 3PIPQ 1Q9YA 3R6GB 4NASA 2G2OA 1DTQB 3M6XA 1VQPS 1UA0A 3D45A 1ZBHA 3QBXA 3HDSA 2UUCF 3J7AP 1X5SA 5CE3A 2NRWA 2ERRA 3J7YP 2EC0A 2X78A 2G1HA 3LDSA 1RT7A 2CQCA 3ZTOA 1O6XA 1U8SA 1TK8A 1FKPB 3FCWA 9ATCB 1F2HA 4A8SA 2FZGB 1SV5B 1VQ9N 4PYDA 3C14B 3IRWP 4CJ7A 4KV8B 1N6QB 3AA4A 4RBUA 2GQCA 1ZC6A 5CD4A 4J9QA 1EX4A 5EX0A 2Q1LA 3MF5A 4WTYA 2UXCF 2QWOA 4G9ZA 1U0HA 3MGJA 2M2BA 1SKUB 2MY7A 2U1AA 3WIUA 2P9PA 2E44A 3UDEA 2AD9A 3VR1A 3HOTA 2V8HA 1WKJA 1XI1A 1TZ0A 5GAHI 3SQ2A 2N4DA 4FJNA 3GBTA 2O8EA 3EDRB 4RW7A 1RHKB 1BCOA 2GIFA 5HVFA 2A1RA 5HVHA 2BQUA 3ULHA 2YKMB 1DZ5A 3CCSN 1QTNB 2RHQB 3T1HJ 5CZXA 5IWAJ 2J5AA 3W60A 3FZMA 2HHVA 4DQ8A 4IR9A 3OTOK 2RKIB 2QA4S 4MAKA 1B9FA 1TQLA 1NMNA 2I5JB 4M45A 2YKNA 4RNOA 1X3MA 3CQYA 4FJGA 4B3MJ 2ZWHA 4OZ1A 3QJPA 3ZTSA 2UXDK 3CCTA 4CJPA 2AGQA 2IJRA 4K59A 4CTAB 3VQDA 3VQAA 3V6HA 4HUGA 2QWMA 5KFSA 2MQPA 2A2DA 4I6MA 3W2VB 1ZBUA 2ZH1A 4ZVFA 2X3DA 1HBMA 2BRKA 3J81O 1F3VA 3SUOA 4ED2A 3FFIB 3MMCB 3R5GA 3CFRA 4BCAA 1RB0A 2CGLA 3TRGA 2YHWA 4CH1A 3NGSA 4DV0F 4TLQA 4K41A 3CTRA 2ZEJA 3CD6S 2JEGA 2AJ1A 2MKCA 3OYAA 2QN6B 2ZNYA 1PO6A 7FDRA 3PX4A 1YVFA 3SXLA 4B02A 2L41A 4X4VA 3K9JA 2RIJA 3R5AA 3PSFA 5BXIA 2CNOB 3WXMB 1LAWA 3CQ8A 3BBFA 4YQWA 3O6WA 2UU9F 4NLOA 4WTOB 3ID6A 1KQSM 5KFBA 4AL7A 4KKOA 1HJOA 2LP4A 4Z7CA 4EP5A 2CGKA 1T9XA 5LL6d 5LJ5Y 3C94A 2YNGA 3PX6A 3OPKA 2RDJA 3I8BA 3L3VA 3BS9A 2EKNA 2RQCA 5CR4A 1D8ZA 4HUFA 1EP4B 4E1JA 4CO2A 2ZJQL 2GUPA 4CF8A 3UD5A 1JCGA 3CERA 2X1GA 2Z1HA 4ZOSA 4CDIA 1RDUA 4QOZB 5LXRA 3O80A 3ZETA 3GPAA 1VBXA 3VEVA 1YRTA 2COLA 2OH2A 5AZJB 4I2QB 1ZM3A 1J5EJ 1AFJA 1UZDA 5C2CA 4J2DA 1HNXJ 2ZBQA 4CGHA 2BBEA 4XH5A 1HI0P 4OLPA 3LM2A 1V4SA 1WJ9A 3HPOA 3NS5A 2IVFB 1VOMA 4G1IA 3V6DA 1RADB 1UVMA 4YR0A 3B6OA 3M2UA 1P90A 2EFVA 4JHDA 3OHAA 4DUYF 5KQ8A 5ETRA 1KQGB 5ETLA 1XMQF 2LA6A 2DTJA 3P39A 2ASLA 3EXYA 3KDOA 1F5CA 1NJIT 3DLJA 3DXSX 4F4YA 4CO4A 2HZVA 2GW8A 3GWCA 4LFBF 3HBTA 3VQCA 3PRBA 3M1VA 2VOOA 2JLFA 2LQJA 3DHWC 2BOPA 2G2ZA 1ATSA 1IJEB 2RQKA 5DQIA 1RT2B 3O4NA 3LWMA 1K9MT 3N4WA 2C2NA 2ZWPA 2D5RA 1IKVB 2IMWP 2L48A 4CM2A 4JUZA 1EX8A 3ZSZA 1RABB 2QWRA 2UUBF 3PEHA 2JWNA 3WZ0A 5E3CA 3DOMB 4CIFA 4QS9A 3CB4A 4NLSA 1HQUB 2UUAJ 4USVA 1U09A 4F3OA 1IUJA 1YVNA 3M8QA 2KN4A 4RWXA 4ED7A 1HQEA 2B7CB 2M70A 1BO5O 2HKEA 4YDDB 4RU9A 3J81Y 4IO1A 3GTYX 4CWBA 4FOIA 2V0NA 4CBWA 1HNXK 3M8PB 3K58A 1FJCA 2RDIA 1RGVA 1AT1B 1KVJA 3KUGA 2PFDA 2VPXB 4U67L 4MMOA 5D4PA 2G2YA 4MK8A 5EWGA 4ZLLA 2AGPA 5DM7L 3VGLA 4CRJA 3V81B 3THPA 3BGRA 5T41A 3OFGA 2A40A 1EQYA 5M1PA 4PQUB 4M41A 4CFAA 4LSNA 1C1BA 3CC7N 3F0NA 4UQGA 4ZLPA 3NP5A 3CE8A 4MK9A 3H20A 2OPRA 4USIA 1YTUA 5LXYA 1H7XA 4JI5J 4UUXA 3TA0A 4A57A 2R7XA 5IXUA 3VALA 5CYMA 1OY8A 3NBPB 3CJQA 3IDHA 1RT4A 3ZSOA 1HNWK 3DKDA 2W4CA 3BZKA 5M2UA 2JLGA 2EK6A 2HVIA 1HW8A 2X7IA 2MZJA 1K1QA 5D0RA 4E7JA 2DIUA 2OPQA 2OIHA 1HA1A 2WB4A 1RTDA 1H38A 2QIFA 2DR7A 4Z37A 2IDLA 1SI9A 3KNAA 2DPJA 4BC7A 2WVDA 2IVPA 5K14A 4LF6F 4Y3CA 4U7CA 4KH4A 1LW2A 4RTFD 1N5SA 3PFOA 5A8KB 5AXNA 4DQIA 2UUBJ 4HTUA 3JSRA 3DOKA 2DNNA 4GMKA 3QSYB 2DISA 2MB0B 2QA4N 1FKAF 4LRDA 2WAQD 4OV1A 3OVSA 4E1MA 3DDKA 5A6PA 1FRHA 1RXOB 3HJFA 1J2VA 2PMHA 3OW2M 1VQ8N 3MM9A 2R2TA 1HHTP 1NB2A 3KKSA 2MQNA 2NR0A 1QY7A 2OGUA 3QAUA 1ROFA 4GRSA 4UY85 4FNIA 4OYZA 3HYFA 2DGXA 5BRDA 2IAJA 2HURA 1VHIA 4H0PA 4R79A 2BE9B 2KVIA 3UE2A 3QGIA 2FBYA 3NMRA 4I2PB 3KNGA 4BRKA 3FRZA 3PRVA 3LP1A 3S7RA 3GR1A 3QNWB 2XLJA 4JI5F 4BHQA 2J9DE 2MSSA 5F3TA 3FZLA 3CMAN 1U45A 4F7VA 4DV3J 4JKDA 2E1MC 1KFSA 3RJMB 2N3LA 4HVJA 2QYGA 1QS4A 3RB0A 4IOXA 5GAGU 2RU9A 3BH6B 5EY4A 2V8GA 4RR5A 2BM0A 4F26A 3F73A 3MD1A 2BUNA 4KFBA 3VF2A 5JS2A 1W2BR 3KG4A 3CXCR 2WZ1A 4YOWA 4BG8A 1JIHA 1Q8IA 2XHWA 3AXKA 4F3QA 1GQEA 4Y0WA 1TGOA 1NJXA 1KOHA 2CDQA 4DPXA 1KAXA 5AR0A 3V4MA 1SPBP 2HFNA 2AKWB 4FDFA 3K5NA 3D2EA 4JI0J 1WOSA 4YY3K 1MWZA 3KHGA 3C15B 1NPPA 1TYQA 3O5BA 3BUZB 1U04A 4FJIA 1IG8A 3T5JA 5FROA 2W24A 3ETOA 2H3EB 2E2QA 1I51B 1RJJA 4KR0B 3IRXA 3D6RA 2MKKA 1REVB 1TKTB 2AWZA 3VAGA 2H4WB 4C3MA 3FGUA 4DR3F 4W5RA 4EO6A 4B1WB 1YI2N 3HFVA 2V4JA 1FNOA 1TV6B 3V2UC 2LCWA 3P96A 6FDRA 1YBAA 7FD1A 1FKOA 4LF4F 3D6MB 1VQOS 4WZQA 3MR2A 2G0CA 2LLZA 4DTRA 1DARA 2KFYA 3EGNA 3TJ9A 2E9RX 1D3WA 3CUNA 2HF4A 4YR2A 3ZEUA 2FJDB 3KWIA 3ZT3A 1T3NA 1PBAA 1K8KA 1VYAA 1WOQA 2RAQA 4ED6A 1I6JA 2DVIA 2HHXA 3RSEB 1T9YA 3TZWA 4FLYA 5KG1A 4LF5J 2W6LA 3MECB 4DV0J 2QXFA 1TP7A 4O8UA 3PEJA 4HTLA 3RU0A 4P10A 1AFIA 3A4TA 3BO2A 4DUZF 3BM7A 1IN0A 2FPHX 2XWXA 5ADXA 4V19S 3R27A 4B8CA 4DL6A 4WFBQ 3K0SA 2JFDA 2BVZA 2WONA 2C3OA 4CNZA 5E7OB 1RTIA 4OZLA 5LMNF 2V8PA 5GAEU 3BR9A 5HATA 2VA2A 1LWCB 3M8SA 1WI6A 4DR4J 2YNIB 1X0PA 2EBEA 1PBUA 3MPWA 4LJMA 2RQ4A 1RLDA 4ZPBA 1BA0A 1YK9A 2HVEA 2J0WA 1HR0F 4OYXA 4H5VA 5CD4H 3T5KA 4DSFA 4U8YA 4BR5A 4HDHA 4PG8A 3JQMA 3AARA 4F4XA 5LM7E 2E5GA 1WF0A 1FTCA 2KI2A 1ZTWA 3IMQJ 5ETNA 4B1XB 1SC6A 3X3UA 2FQQB 2Y8WA 2QJ3A 3OT9A 1U02A 4NLVA 2KXHA 2WVCA 4N7TA 2W9CA 4X4PA 4DPOA 4E7KA 2ATLA 4JHDB 3CM5A 4C8LA 1JX4A 2V69A 4LD0A 1FFGB 3CJRA 3D1OA 4CEEA 5IM0A 4E0DA 2XMMA 1JLQB 1N36F 4FWOA 4PA1A 2E2OA 1KLMB 1TFYA 3SYZA 2B56A 1SL2A 4O3OA 1X4GA 1DT9A 3TSUA 4OVLA 3KLHB 2KXNB 4Z2XA 4MJKA 1RAJA 3QIOA 1M5KC 2P9KA 3AA2A 4JI4J 4AUKA 4K4VA 3UO0A 4B9MA 4FSVA 1VQ5N 1UVNA 4IO9L 1U1QA 3EDQB 2WOMB 1VQKS 5K5MA 3JYTB 1JQGA 3RBXA 4EAHD 5M2RA 1NK6A 4WYWA 2ACYA 3Q83A 1AYEA 1IR0A 4E2FB 4DZDA 4K50A 2XG8A 2VASA 5L9XA 4NXMK 1NHKL 3TQ1A 4LSLB 1CZBA 2FVSA 4RW8A 3QAEA 2CRLA 4NXNJ 3EO3A 4LR9A 2V5HG 2QFIA 4DR2J 3SNNA 1J5OB 2E20A 1NEEA 3IP0A 1R59O 3P5JA 2DEJA 3OD2A 5F8NA 5IV4A 3UNGC 5BPNA 2VWKA 2OHDA 4V1Ak 1S4FA 1LK5A 2AQ4A 4OLAA 4CQ1A 3PR5B 1W9HA 5HRRA 1URRA 4O4GB 3VQ4A 4WIIA 4EZ6A 2R9LA 3DXMA 2HFVA 3IA0A 2JC1A 1Q5YA 4U8VA 2CQDA 2QLJB 5M1FA 4IFVB 2OEMA 3MURP 1RDBA 3F44A 5HMYA 2HFZA 2FGOA 1HBMB 2F63A 3ULDA 2HNZA 4YOUA 1VBKA 2XO6A 1S0OA 4V19J 3PG9A 3SCIE 3PW4A 2ILYA 3HJVA 3ZT4A 2D69A 1FK9A 2V94A 3FSIA 2WBRA 1HMVB 1IJJA 5JS1A 1KR4A 2GGPA 3BF3A 3TUPA 4B1UB 3L9ZA 3IN5A 4IO8A 4O0JA 1BU6O 5FD1A 2RHSB 1D8YA 5KGXA 4EZ9A 4KB7A 4ILJA 5DM6Q 3SFGA 1GX6A 2W4DA 2VH7A 1E6VA 1R6VA 2EX3A 2HSTA 3QT6A 4TNOA 4BRAA 1IKXA 1S72N 4ED4A 3VV2B 2JNJA 3MDQA 4NA3A 2FC9A 4WU3A 2IPOB 1N33F 3O9QA 2VFSA 3MEEA 4K4TA 1ESVA 2RB7A 4QIGA 2HAFA 1FEHA 3LDLA 1D9DA 4I2PA 2HS3A 4CJ5A 4WXWA 1S1TA 5JXSA 5F9LA 1VCTA 2P6SA 4GKJJ 5JJBA 4OYPA 4LVNP 2H5IB 2A42A 2XO7A 1VQ7S 3W65A 1SQGA 3VGKA 1BQMB 4WFBL 1OVYA 1DFDA 3T1HF 4NLGA 5EDWA 3PZPA 2P1JA 2EG1A 2NUUG 5C15A 3JB9k 4YFUA 1NH8A 4QYRA 4MKBA 2J4RA 3KK7A 4MKVA 2ZITA 3M2UB 2JC0A 2F4VK 2XYHB 1JLEB 5KFYA 4P52A 4P7TA 1FFSB 1S77D 2E2PA 2XZDB 2YPYA 1KQFB 1PAUB 3CCJN 1CBKA 2FHKA 5HK4A 2UVUA 1R0CB 3T19A 4GW6A 2L9DA 1M5HA 1GXTA 4HWIA 5KT2A 4ECVA 3SZ2A 2NZCA 1WOPA 3MCPA 4NYFA 2PSZA 3TZXA 3D0HE 4YHHJ 2UXCK 4X64J 2FD2A 2ZHBA 2O8CA 4MH8A 3BF1A 3M6GA 1ZBSA 1NH7A 4AM6A 3I5BA 3UD4P 2HQFA 5K9FA 3SI6A 1EQ0A 1B99A 4Z0UA 3U1LA 2PAVA 2MLYA 2GMHA 1BOTO 4CK2A 1QVGR 4ZTFA 2FJXA 2GHVC 3NGTA 3TU5A 2YWWA 2NXNA 2WB1D 3OTCA 3C15A 4IOAQ 3HVAA 1NDCA 3SPYA 1FJEB 2ZH3A 4LIWA 2E7XA 2DRAA 4BS2A 3MEDB 1FESA 2PZSA 2PDAA 1KLMA 2UXDF 1DQAA 2LQ9A 2FBVA 1FD2A 5I42B 1NGFA 3MAHA 2CXEA 1TV6A 4CD1A 5B0BA 2P9KB 3KLEB 1SAZA 1NSQA 4J9LA 5KFJA 4HKQA 1YGYA 1XNQK 3H42A 3C6TA 4FM2A 5HBMA 2DFFA 3WT0A 5E84A 4DV2F 2IRYA 2J0SD 2PI4A 1WEZA 3CC4S 2OTJS 3JAMY 5ADZA 4CLFA 1FRJA 1N33K 2C3UA 1NHUA 2QM1A 5DQGA 2D0PA 1X4FA 4QWCA 2CJQA 2ZUAA 3DNCA 2XWYA 3JXOA 3UVJA 3O8WA 4I4BA 3FBCA 1HKAA 1IV0A 3AFGA 3U02A 4ZITA 3UKRB 1LWCA 3FCHA 2HHSA 2CADA 4WXOA 1PC4A 5C25B 3MI7X 4LSNB 1YX2A 4LSLA 4I67A 1HWUA 1IBLK 3T1AA 3OBIA 3KKFA 3CJ8A 1VI7A 2HMPA 2DCLA 3GFHA 3HSCA 1JK9B 1IWGA 4YY3J 4D3GA 1ZPVA 3R97A 3VETA 3QIPA 4OQJA 4FJ7A 4F36A 1RWOB 5FDLA 4DHYA 4FLZA 3SBMA 3AVIA 2B9EA 1HJRA 4QOTA 2VL1A 2CWXA 1WC1A 4CT8A 3Q2TC 3NL0A 3G8SA 3D1QA 4C8MA 2CQ0A 1RKIA 2H54B 4DDFA 5D78A 3OV7A 4W5OA 3QINA 1WAJA 4DR7F 1GTEA 2J8SA 3M7VA 2OSRA 4E7IA 1BY9A 5EVZA 4RBVA 3EZ5A 2W25A 3DLHA 4X4NA 1HKGA 1D09B 4FK4A 4Y2KA 5BR8J 1MROB 4DV7F 2ATCB 3QFUA 3OW2R 1QTMA 1RYRA 2HGLA 3G8QA 2BOAA 2IYIA 3FBEA 3D28A 2KM8B 4NLYA 1OQ3A 1QM9A 1B7YB 3W3DA 2CPZA 3MZIA 2W7OA 2ZBIA 3NGRA 4DSKA 1KLNA 1Z4UA 4KO0B 3WEEA 2V50A 2B4VA 4C8NA 1UW4A 4X65J 5DDOC 4XIUA 1T05A 3EVOA 7AT1B 4OHZA 5FIIA 4J8FA 4DV4J 4QS7A 4DHVA 4LF7J 1RA7A 2R7RA 1OIAA 1M5OC 2YXLA 1MDUB 5BYSA 3NE6A 2P9SB 2XTJP 4NPOA 2K8GA 4BLGA 2DNQA 1JLBB 2DR5A 4ZVSB 2RHKA 3GJTB 1OSCA 2F5GA 1RWXB 1NGHA 4F25A 4Y1DA 2BX6A 1GXLA 1FCAA 4IDKB 4F2SA 1BIUA 4CEFA 1OVQA 2M4MA 4DUYK 1YJ7A 2VG5B 2BJ3A 4K0KJ 4DV5F 2NUHA 3QDKA 2YY3A 2B9XA 2V7YA 3MMAB 3TEHB 2LYVA 4FP9A 1BUXA 3HD1A 4Q2LA 1P1TA 3O2IA 5AE3A 1HIYA 1RACB 4RU2A 1QVFR 4AHCA 1N56A 1N52B 5FLXO 1S22A 3HZGA 5JUMA 2HZCA 3ILJA 1O1WA 3DXKA 4DS4A 3E9PA 4LF4K 4M3ZA 1FRXA 3VQ8A 1GXUA 3IAYA 1CQNA 3M9NB 1G15A 5IOLA 3C66A 5C24B 1KVBA 4KREA 4M1KA 4JK7A 2CQ3A 4K7QA 3M2VA 3NAHA 3BEXA 1CSJA 1Y11A 4FK2A 2CQIA 2N82B 3WDOA 2A41A 3JSBA 3OXFA 1Q18A 4N47A 2AJ2A 3KJVB 2MZ1A 1FHTA 3NNHA 3RMAA 4KIAA 1C0UB 3KK1B 4YDXA 3BKTA 1FX4A 3CD0A 4CEQA 2G8WA 2VBXA 2B6AB 2RKIA 1KBRA 5KT5A 2X6NA 4C9DA 3VQBA 2A6MA 2DNGA 1ZAXA 4WCEQ 4ELTA 5BN9A 3FZBA 4A48A 3IWNC 3OS2A 2ZC4A 4GVEA 5KFMA 5AQKA 1GX5A 2XGQA 1CULA 4MIAA 4LF6J 4IQMA 4WQ4A 3TWHA 3R9PA 1SC1B 3EZWA 1FDDA 3N6MA 1GLLO 1TKDA 1J6ZA 4JLHA 1YHQN 3H40A 3H25A 2CA9A 3PYDA 4YOXA 2BKPA 2O8BA 1KONA 3KLEA 4CE9A 2RILA 2J9EA 4K5RA 4BC9A 5D6GA 1BWFO 3VEWA 3VF6A 5HBMB 5HJYA 3BSNA 3JXUA 5J2NB 4F50A 3A3OB 4KBOA 4DN9A 1RYSA 1ZAWA 4CEAA 1IBMF 4DCPB 5F9NA 3FC9A 4ILHA 2UZAA 3KK2B 3LZJA 2XRIA 3G82B 3UVJB 3QFHA 3V9UA 1RE1B 2NNWA 4A8WA 2X51A 4FL9A 3C46A 1N36K 3MM7B 3CCRS 2H48B 2FLLA 4I7FA 3R7BB 3OJUA 3W3SA 4FN5A 1FXRA 5ETSA 4EI2A 1NK5A 4E8UA 1R43A 4DX5A 2VD3A 4CLWA 3H5UA 2MEWA 4DB3A 4DV7J 3SDEA 4TLRA 2WVBA 5AQRA 1YXQA 2V68A 4CI0B 1R8CA 4E98A 1YRXA 5M1NA 3GJSB 2Z8QA 3ASMA 2QYCA 2F65A 2W1BA 2Q0UA 4ZJLA 3A3NB 4ALZA 4OI4A 3PKYA 3V1OA 2E5LK 5AQVA 1ASUA 1VSHA 1SS6A 5J2QB 2WC9A 3CIZA 1WKLA 5E33A 4LQ3A 3O4QA 3CI5A 4X65F 4WFNL 1HNZK 5HROB 2WTUA 1YIJS 3IG1A 4CFDA 4YDUA 3FR0A 3HX9A 4HI1A 4MIBA 3EMTA 2FY1A 4YB5A 3J80U 4EGLA 5F8MA 4OGCA 5IT9U 3V9WA 2ZF5O 2D3OR 5KFXA 3VAKA 5L1LA 1R8PA 2HPUA 4N8NA 5BN8A 5IFMA 4NCGA 3ZSWA 4Z4IA 2A6AA 4QW9A 1NGAA 2C2EA 5J2MA 1PAEX 4NLBA 1RT2A 3G86A 4B08A 3LGHA 4DPTA 1RBOB 4LRCA 3UWTA 1XN9A 3Q2SC 4FW1A 2XNQA 2WVEA 5HSPA 2KHOA 1ULRA 1RT7B 1UW9A 3AY9A 4ANEA 2NREA 3RUBL 4ED3A 4ZCLA 4D3HA 4NLRA 5DMRA 2VKRA 2Y1IA 4BDZA 5BREA 4QBUA 2RJZA 5EOYA 4JOUA 1L5UA 5JVGL 2DH8A 3VA3A 2RUSA 2MZTA 1JLBA 1BISA 2HRYA 1Z26A 2Q97A 1PJ6A 1BLUA 2G0JA 2E5LJ 5HLFB 1U4BA 2ZOMA 2Y8YA 5IWAK 5BR8F 5AFUA 2DNZA 3L3CA 3DLEA 1EZZB 3VQ9A 4JI0K 1RCOB 1XMQJ 1XQSC 4BRFA 3QZ7A 3MAAB 3C14A 2Z2LA 3TPQA 3C6HA 4I9LA 1NBEB 2M0GB 1HUXA 3L95X 2NYIA 2PD1A 5B0DA 2QKBA 5HQ8A 3QMQA 4FZYA 1TL4A 1JWWA 4DSJA 4BC3A 1QSYA 3NMUA 1XNRF 2RS2A 4PXCA 1SBRA 3C6AA 3OHRA 2HNDA 1LCUA 4CJFA 4XDCA 2IM2A 1X4EA 3K57A 4HR2A 2HQ3A 2V4RA 2L08A 4LFBK 2OPQB 1H72C 4PRFA 4PHTX 4U67Q 4O4RA 3CJBA 3UNYA 4M3YA 2BJ8A 1BQNA 5ETMA 4LFCK 2DFEA 1GLAG 3PYFA 2P5VA 4BC4A 3CT9A 3MPVA 1SH0A 3J7YI 3I0RB 4OZ0A 3QWUA 1RHUB 3PW5A 2DGSA 3W5YA 1BUPA 2ZNZA 1URNA 3MEEB 1W7WA 1X4AA 3GV8B 1FWPA 1RWMB 3MXHP 1R27B 2HNYA 3BO3A 5FLXY 1S59A 2GUIA 4M5HA 4NZ7A 1CULB 1UPPA 5I3QA 1Y64A 4RG8A 1BHLA 2MZSA 3CCMS 3ID8A 1DKGD 1YQHA 4G65A 4C0HA 1TFWA 1EWQA 3VESA 3DOLA 3O1LA 4CLUA 3TEGA 2VIHA 3OTDA 1VQSA 4PWDB 3MR7A 5TKYA 2AGOA 2J0QD 3QQCD 1IQZA 3D6HB 4DZ6A 1TAQA 2XSJB 1ZZFA 4GMJB 1UTAA 3CJ9A 1FE4A 2W2NP 2YH0A 1OY9A 2GCFA 4EFAC 2HRTA 2VBWA 4CZIA 2F8TA 1UVKA 2YHAA 4BGAA 4OPAA 2GJ2A 3EEQA 3U3YA 4FPRA 4PKIA 1JLAB 1RT6A 4LUBA 1Y4ZB 3SUNA 1T95A 4RJVA 4QWEA 3TAEA