3DOKA

Crystal structure of k103n mutant hiv-1 reverse transcriptase in complex with gw678248.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
539
structure length
535
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 143
structure length 535
sequence length 539
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dokA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dokA05
4DEZA 1Q8IA 3SUQA 5KFJA 3H4BA 4IFYA 2AX1A 1HQUB 1HMVA 4O3PA 4MK9A 5EU7A 1U45A 4PA1A 1S1UA 3FFIB 1L3VA 3ZSVA 3SZ2A 2BRKA 1RDRA 1YVUA 3ZSQA 1W9HA 3TAGA 1QHTA 4M3TA 4FLTA 3ZSOA 1Z4UA 3IG1A 5KFYA 4H54A 3C94A 3OYGA 4MFBA 1RTDB 4ECWA 5J2PA 4EZ6A 5FDLB 4H8KA 3G10A 1X9MA 2KTQA 4CHZA 3C6UB 3OS2A 4J9OA 3CQ8A 5I42A 3KLGA 1RDBA 2RKIA 5KFGA 2GIQA 5J1EB 3NGZA 3AO3A 3F73A 1SL1A 1JLCB 3RAXA 5F9NA 4CJ4A 1MU2B 2VG6B 3G6VA 3IAYA 5F8IA 3QNOA 4HVJA 4KKOB 3DI6B 1X9SA 3OYDA 3D0PA 4TYBA 4OGCA 4Y1CA 1T7PA 3L8BA 3NBPA 3LDSA 4B9NA 3DOLA 1C1BB 4CJWA 5KFAA 2OPQB 2WONA 3PHEA 4JRQA 4FLUA 2G8KA 4EYHB 4Z4GA 5KFOA 2KFNA 3SV3A 3NMAA 4CESA 1W0HA 2FLPA 4IFYB 2R8JA 1KTQA 2QKKA 4QW8A 1RTHA 4K4XA 4DU3A 1NHVA 5KG1A 3MR5A 4KSEB 1HMVB 1FK9A 1VSDA 4GW6A 3S3MA 4CIGA 2AJQA 3RMBA 1S1UB 1JXEA 4MK7A 2HVHA 4EZ9A 3RAQA 1LW2A 3H2LA 5KT3A 4URSA 3D45A 1TV6B 3NKYA 1SKWA 1VSEA 4JLHA 4J2EA 4DF4A 4LY7A 4MFBB 4TY9A 4MK8A 3GIIA 4KI6A 1TK0A 5JS1A 4CK2A 1TL1A 4ED3A 1U4BA 3QGHA 4YNQA 3EYZA 5I42B 3KLGB 1K1QA 4PQUA 3RTVA 3SUNA 5HLFB 2WOMA 3DYAA 3MEDA 3PY8A 3LZJA 2RKIB 1WAFA 4MQ3A 3HVAA 3GIKA 3PVXA 3NGIA 4ICLA 3ASMA 3P1GA 3NH1A 4CJ5A 2C2DA 4B9MA 1DLOA 3T5KA 4C8LA 2AU0A 3K5OA 2ALZA 4ZPCA 1JLFA 1S9GA 3NH2A 4NLRA 4Y1DA 3DOLB 2HNYA 1UA0A 1KHWA 5KFLA 4KHSA 4XIUA 1ZETA 2WONB 3DMJA 4ZPAA 4O0JA 2IMWP 1FKPB 1S5JA 4O3OA 3CFRA 3GIJA 4Y34A 1C1CB 4CGFA 3OYBA 1TKDA 3BREA 4FJLA 3QYYA 3UR0A 4OPJA 4B08A 1FK9B 2O5DA 3V6DA 3VQBA 3BQ2A 3FQKA 2XRIA 3QEXA 4DL4A 4N47A 3NH0A 2BR0A 5SZTA 5DK5A 5HRSA 3OS0A 2I5JA 1LW2B 4E7KA 3HJFA 1ZBHA 1WSGA 3LPUA 5KFPA 3SQ0A 4BE1A 3ULDA 4FJJA 3LP0A 4M95A 4IR1A 3CDWA 1S97A 3CWJA 3D5MA 3Q8RB 5KFHA 3KIOA 5KFUA 1TL1B 2YNGA 1SH0A 4DSLA 4ED0A 3RMCA 4B9UA 1XR7A 4PY5A 2W9CB 4PQUB 3RBEA 2XY6A 2WOMB 2BANA 3MEDB 4CF0A 4O5BA 2WCXA 4ZVEA 4JS4A 4RNOA 4G1QA 2JEIA 4J2BA 3KLHA 4KAIA 1DLOB 4N56A 1Z26A 4IKAA 2GBZA 1JLFB 4LD0A 1S9GB 1VSKA 2PZSA 4O44A 1GX5A 3VQAA 2JC1A 1QE1A 2HNYB 1S48A 5DLGA 3MECB 3I8DA 4IKFA 2R2SA 4CF8A 1YT3A 3DMJB 4ID1A 1LAWA 5D3GA 1RBSA 4FJGA 3BR9A 4DQSA 2Z1IA 2R2TA 4I7FB 1W25A 4ZP8A 2KFZA 1UAXA 4QWCA 4NYZA 2W9BA 4FVMA 4CJRA 3QEPA 5KG4A 1RDCA 3RRHA 4LSLA 1KCFA 3L2QA 3BSOA 2I5JB 5KG2A 3T5JA 3JYTA 4YFUA 4ZP9A 3N6LA 2IM1A 3OYNA 1D5AA 5L1IA 3NF7A 1SL0A 3HVTA 4GC6A 1BI4A 4BACA 4YQWA 5CY4A 2ATQA 3L2VA 3DLHA 4QWDA 2X78A 4ECSA 5KFRA 3AVIA 1X9WA 2OPRA 5C42A 4WE1B 5CYQA 4HTUA 1S0OA 2OYQA 2ZKUA 4Q0BB 2YKMA 4QWAA 4F3OA 4GC7A 3RB4A 4Z4IA 3GV7B 2FBXA 4B9VA 3SUOA 2D5RA 1J53A 1EETB 5HROA 3OYKA 1U47A 3MAQA 1YVFA 1RA7A 5KG0A 3KLHB 4CEFA 4CFAA 2YNHA 1JXBA 1A5VA 3H40A 4BWJA 4CEQA 2KZZA 3TVKA 3PR4A 1BGXT 4B9LA 4O44B 5KT6A 1LWFB 3Q8QB 3UQSA 3H4DA 3V81A 5KFQA 1QE1B 4HCCA 3G0ZA 1GOCA 5J2QA 1DTQA 1CZBA 3LWLA 4Z0UA 4E3SA 2IGIA 3NGYA 5D3GB 3C95A 4BDZA 1RDDA 1LWEB 1S49A 4CGDA 3MEEA 4DQQA 4XPEA 3V1RA 3BGRA 4DG1A 4BE0A 2HAIA 3VN5A 3OLAA 2D7SA 3K57A 4WZQA 4LSLB 3A2FA 1KVAA 3V4IA 3KD5E 4DTXA 5FROA 3UPFA 4NLSA 1JX4A 3JYTB 4ECTA 3KHRA 1CLQA 3MXIA 3HVTB 1BI4B 3HKWA 3QEWA 1RAJA 1OS5A 4CJ3A 3MXMA 1HJRA 2FVRA 4GMJB 4DU1A 2HHXA 1JLAA 4C8NA 4W5OA 1S1TB 4DL5A 2XY5A 2OPRB 5C42B 3K5LA 5CYQB 2X6NA 2Z1HA 1LV5A 2YKMB 3O3GA 4TN2A 1XR6A 1SUQB 4DSEA 3ISND 2PYLA 1RNHA 4ELTA 4N5SA 3PW2A 5HROB 2IM3A 3GV5B 1CXUA 3MFIA 3VQ4A 1MMLA 5CYMB 2G8VA 3DRPA 3LAMA 5KFIA 1ITGA 2EC0A 4FZZA 2FVPA 1WN7A 3IRXA 3HVRA 3FDSA 1ASWA 4FLYA 3SCXA 2JEFA 1QTMA 3V81B 3AVKA 4ED2A 2IA6A 4DLEA 2DPJA 2D0BA 4K4WA 4CHYA 2HHTA 5J2QB 1T03A 3VA0A 1N6QA 4C8MA 4FJXA 4ZTJA 2R8GA 3MEGA 1S1XA 3DRRA 2O4IA 5JS2A 3MR2A 2D3UA 4CFBA 3LWMA 4R8UA 1UOCA 3MR6A 3RRGA 4CJSA 3PJXA 3BGRB 2B43A 5KFNA 3DOKA 1RT7A 3VQDA 5JXSA 1TAQA 4FJIA 3KKRA 4DWIA 4DSJA 2RF2A 3LP1A 2V9WA 3AVLA 3P83D 3TABA 4KHWA 4IG3B 3E51A 2YKNA 1WNSA 2OZSA 3KLIA 4WFXA 2KQ2A 4W5TA 2AWZA 2F8SA 3QIPA 4QPXA 1BIZA 5C24A 1S9FA 3LAKA 3SYZA 4JV0A 5KGXA 4ED7A 3M9OB 1D9DA 4Y2CA 2RPIA 3HPGA 4DFKA 3OJUA 3NE6A 3CM6A 2GV9A 1SH3A 4CIEA 2DY4A 4H4MA 2ZE2A 2WTFA 2P51A 2UVRA 3QGGA 3DRPB 4K8ZA 3ISNC 2E9TA 1L3UA 2IAJA 3OJSA 2ITGA 2G8FA 1ZBIA 4RW7A 1IKVA 3AVHA 3OHAA 1LW0A 4DQIA 4DTOA 1N48A 1QSYA 2QV6A 3KK3A 1S10A 4AHRA 4DF8A 1T03B 5FRNA 1N6QB 1QAIA 1KLNA 4XPCA 4J2AA 3MEGB 1S1XB 3DRRB 4CF1A 5EWEA 3CYMA 4CF9A 3O3HA 4E0DA 1JLBA 5F8GA 2FVCA 3KMSA 2V4RA 3CJ5A 4NCGB 3PW4A 4RW8A 2XCPA 3WNGA 1FKOA 2VWJA 1RT3A 3M8PA 3U3YA 4O3SA 4RW9A 1RT7B 5KG3A 4DS4A 4DTJA 1NK5A 4O3NA 1S9EA 2E9RX 2RF2B 4EO6A 4IG0A 1RYSA 4RNMA 4LQ3A 4ECYA 1XWLA 2YKNB 4CEOA 3KLIB 4FLZA 4CEAA 4OL8A 2XO7A 2DFHA 2YV0X 5HRPA 2OPPA 4NCAA 3QIPB 2VG7A 5C24B 4U6PA 4GVMA 4WZMA 3PX4A 4WYWA 4E7IA 2YNFA 4IBNA 1RTJA 2J6SA 4LH5A 3N6NA 4TY8A 4ZVHA 3L3UA 3HHKA 4FJNA 2IM2A 2FLNA 4TLRA 1F21A 2CJQA 4H4MB 4NRUA 2ZE2B 1Q9YA 4LSNA 4K4UA 4ZP7A 4FK0A 3PW0A 2D0AA 3NAEA 1BCMA 4E7JA 2KW4A 2UUTA 1D1UA 2IAJB 1GX6A 3SI8A 1QQCA 4HHTA 4RW6A 4RW7B 2B4JA 3SQ1A 1JLEA 4I2PA 4J9SA 3IG1B 3QLHA 5F8HA 4CGIA 4EBDA 5KT2A 3TWHA 4ZVGA 3SNNA 3KK3B 1N4LA 1BCOA 3AO5A 5J2PB 3QIDA 3HT3A 1HYZA 1KVCA 3ZT3A 1SKRA 4ELVA 3VQ6A 3VQCA 3CG7A 1JLBB 2W7OA 3RMAA 4OJRA 4HKQA 3HXMA 2AGPA 4FZXC 4FCYA 4HUFA 2IC3A 1LAVA 4FXDA 1TK5A 2EX3A 3MFHA 4FJMA 4KREA 2BQ3A 4DFPA 3WNEA 1FKOB 1RT3B 3M8PB 4RW9B 4JRPA 3SQ4A 1J9AA 1L5UA 3LANA 4DFMA 4DL7A 4FJ5A 5DG8A 4AHTA 3PX6A 3BSAA 4IG0B 4J9MA 1JKHA 1NJYA 1FXXA 3RB6A 4CJKA 5J2NA 2BDPA 1D8YA 3NBPB 3KHHA 3PW7A 2OPPB 4FLWA 3VQ5A 3T19A 1IH7A 2VWKA 2VG7B 2HMIA 3NFAA 3AV9A 2QE5A 4FS1A 2YNFB 4W5QA 5K14A 3AVMA 4E89A 4IH6A 1RTJB 4IRCA 1RBTA 3OY9A 3V9SA 5FRMA 4TY8B 1IKWA 5HRRA 4BWMA 3OYFA 3AA3A 5KFFA 5KRSA 4ECQA 2P5OA 1LWCA 3MF5A 5SWMA 4NLQA 1RTHB 1S4FA 3GYNA 4ZVFA 4LSNB 5KG7A 3ZSYA 4J9NA 3TQ1A 2X74A 2HNDA 1RT2A 2PYJA 2E9ZA 3DDKA 4L8RB 5DMRA 1WSEA 4RW6B 2W8KA 3V6KA 1JLEB 1NJXA 4I2PB 3KNAA 3RR7A 2HWHA 3L2UA 5L1LA 1KLMA 4DL3A 5DG7A 1EX4A 4Q45A 2HHUA 4CIFA 1RT5A 3OSPA 4CHQA 3EPGA 1I39A 4NZ0A 5C5JA 4CEZA 2OH2A 3VQ8A 2OA8A 1IKXA 4QWBA 2GIRA 1NOZA 2RDJA 3ZT0A 3AA5X 3S3OA 2IC3B 5HP1A 1CZ9A 2IM0A 2ASDA 4KHUA 4DLGA 3DYAB 1A5WA 3PZPA 2HW3A 1TK8A 3I0SA 2VA3A 1JL1A 4ICLB 4KI4A 1TL3A 3U6FA 1RBRA 3NHGA 4WFYA 4FK2A 1JKHB 4KTZA 4J9LA 2KZMA 4CJFA 4CHPA 3GV8B 3HPHA 4KHQA 1S6PA 3K5MA 5J2NB 1RBUA 4KO0A 4RNHA 1NK4A 4PUOA 5EWGA 1VRTA 1RA6A 4CJUA 1ZBLA 5KRTA 2HMIB 1U48A 1N56A 4Q8FA 3TAEA 4FYDA 4DTPA 3NCIA 1O1WA 1IKWB 3ALYA 1QUVA 3EPIA 2JLEA 5I3UA 4IQXA 3OVNA 2RN2A 1RBVA 4OKKA 4E19A 3TAMA 2VA2A 4E1NA 4DS5A 1SH2A 3V6DB 4IR9A 3LP3A 3K59A 2HNDB 1RT2B 1ZTTA 1SKSA 4URQU 2G8HA 3KHLA 4CK3A 3SUPA 5CZ1A 5JUMA 4HUEA 1NK7A 5C25A 1J5OA 5KTQA 5KFTA 3IGVA 5KFEA 5KI6A 4NLPA 1KLMB 4CFDA 5DQIA 4DL2A 1HNIA 3LP0B 4YR2A 4MKAA 3VQPA 1RT5B 1BQNA 2YNGB 3KMQA 4U7CA 1IKXB 4ZPBA 4BE2A 2DTUA 2IJNA 5HP1B 2FJXA 4OPKA 4RUCA 2IJFA 4CERA 1NK9A 1T8EA 2BANB 1UA1A 2F8TA 3TAQA 3SJJA 1JLQA 1TGOA 3I0SB 4HUGA 2OZMA 3PW5A 4HCBA 1TL3B 4O55A 4G1QB 3M8RA 4JV2A 4K4TA 4B9SA 3JSMA 4AHVA 2ETJA 3BQ1A 4CJLA 1TKZA 3KKSA 3UIQA 4KO0B 2FBTA 3BSNA 3FSIA 3Q8PB 4I2QA 3K58A 2R2UA 3QEIA 3MXJA 4Y3CA 3SQ2A 4M3WA 3O3FA 4F2RA 4RW4A 4OGEA 5DGBA 5T7BA 1HQEA 1UWBA 4WFZA 2UVUA 3AO4A 1B92A 5KT4A 3C6TA 5I3UB 4MIBA 3OYCA 3BQ0A 4URGA 2W9BB 2CKWA 2G8IA 4CGGA 4ZP6A 3TAMB 5KGWA 4K4YA 1YTAA 4MKBA 2VG5A 3LP2A 1RT1A 4CGHA 3NAIA 4ECZA 3CJ2A 1ASVA 4EBCA 3FQLA 2V0NA 1TP7A 5C25B 4N41A 4DTUA 4DFJA 4E1MA 3SPZA 2UUWA 4DSIA 3DLGA 3OSNA 5E41A 1BQNB 1KSPA 3V9UA 3O4NA 2Z1GA 4B8CA 3SFUA 4QAGA 4EP4A 1S0NA 3L2WA 1C0UA 4WXWA 3G6YA 4QCLA 3QO9A 4DMNA 5L9XA 3BDPA 1JLQB 3DM2A 5KFDA 4M94A 2F8EX 1HPZA 1RILA 2HVIA 4IRKA 3KLEA 4PWDA 3VQ9A 1S6QA 2HHSA 3CJ0A 4NLOA 3HPOA 2YNHB 1NK8A 1S1WA 3JSMB 3QZ8A 2J6UA 4FM2A 3HM9A 1TKZB 4ELUA 3U3GA 4IH7A 4TXSA 5EUHA 4O3QA 2R8KA 4I2QB 3M8QA 2XWYA 5EWFA 3QETA 2X6SA 4M3RA 4CJTA 1TKXA 4NRTA 1RYRA 1DTQB 1HQEB 1UWBB 3TI0A 3H08A 2O4GA 4NYNA 3CDEA 1KFSA 3H5UA 3C6TB 4KB1A 2W9AA 4DU4A 2ILYA 1VSFA 3MEEB 2HB5A 3ITHA 1RT6A 4RG8A 4B9TA 3V6HA 1RTDA 4DG1B 5KFSA 4CHNA 2VG5B 5DLFA 3LP2B 1RT1B 5EDWA 2E4LA 1D9FA 3V4IB 3KK1A 3C6UA 4FBTA 3ZCMA 1C0MA 2JEGA 4KB0A 4FZYA 1C6VA 2XC9A 2R7YA 3PR5B 1EKEA 1VSHA 3V1QA 3DLGB 3CJ4A 4B8AB 3M9NB 1XC9A 3PO5A 3VQ7A 1KRPA 4Z4EA 1JLAB 3AA2A 4OKEA 4TSXA 4ED8A 3OS1A 3CVKA 3KD1E 1S1VA 2XI3A 4CJQA 2EHGA 2HHWA 3M9MB 3QO9B 3SPYA 3HO1A 4Z4FA 4KV8A 1VSMA 5KFBA 3AVFA 4KBIA 1XI1A 2XY7A 4MIAA 1HPZB 2NUBA 4FJ9A 3VQSA 4PWDB 4YMEA 1S6QB 4KHNA 3SI6A 1JL2A 2OPSA 3IRXB 1NKBA 4KRFA 1S1WB 4RUAA 3AO2A 4KAZA 1ZYQA 3UDLA 4CGJA 4ZHRA 2V4QA 4KFBA 2W8LA 3M8QB 2D0CA 1TKXB 1VSJA 4K4ZA 1ZBUA 3CFOA 4K50A 3V9ZA 4R8UB 4C8KA 4J9KA 4RNFA 2XI2A 1NKEA 2AX0A 1TV6A 3ITHB 1RT6B 4KHYA 3ZT1A 1X1PA 2ASJA 4IRDA 1DTTA 3DOKB 3LPTA 4TQSA 4H4OA 5KFKA 4Q5VA 5DGAA 2QKBA 3KK1B 3LP1B 4F3TA 4DTSA 5HLFA 2PY5A 3IS9A 1G15A 4FM0A 2DFEA 4NCBA 2IS3A 1WSFA 3DLBA 4CCHA 2D3ZA 2WHOA 2HHQA 4M3ZA 3TARA 3OYAA 3TAFA 3TANA 1S1VB 3F9KA 1XR5A 1QAJA 3FRZA 1VK0A 3I0RA 2UVVA 4DQRA 5DQGA 4KV8B 4O4RA 4RZRA 3SV4A 1HYSA 4FLXA 4CEBA 3ZSRA 1TAUA 3AA4A 2AGQA 1WSJA 3L3VA 4R0EA 3NF9A 2BQUA 2OPSB 4ID5A 5KFVA 3G6XA 1FKPA 4W5NA 1IKVB 1C1CA 2RDIA 1LW0B 2FVQA 3M8SA 4ZHRB 2D41A 1CSJA 4KFBB 4OLAA 1L3SA 3TAPA 4N76A 1JLGA 1R0AA 1ASUA 4E7LA 4K4SA 3ZSZA 4IH5A 4QW9A 3KK2A 3ZT4A 4FW1A 2R8IA 2ATLA 3EZUA 3SFGA 5KFCA 2ZD1A 5L1KA 2UVWA 1VSLA 3KLVA 4RW8B 3NGDA 1TVRA 3AVJA 1K1SA 1HRHA 1DTTB 4F4WA 4QWEA 4H4OB 3V9XA 3H98A 2FC0A 3CIZA 3DRSA 2R2RA 3KLFA 1EP4A 1S9EB 4UQGA 4Q44A 4M3UA 3KOAA 4NLDA 4F4YA 2XY8A 2W9CA 2ASLA 4FS2A 4CE9A 2XCAA 3H5SA 3QINA 4KHMA 2FJVA 5F8LA 3IS9B 3OYLA 1RTIA 4R5PA 1Q9XA 2HHVA 4FJHA 1NNDA 1CXQA 1RCHA 5CZ2A 4CEEA 4IFVA 1RT4A 3K5NA 3KHGA 4ECRA 4I9LA 4I9QA 5KT5A 1SV5A 2JGUA 1NJZA 1D0EA 3I0RB 1NHUA 2BQRA 3H5XA 2ZQBA 3MECA 1ZBFA 1RDAA 3I5AA 4KPYA 1HYSB 3KJVA 4NLXA 4CEDA 4CFCA 1NKCA 2B5JA 3OL7A 3DLKA 3RB0A 4ID5B 4I7FA 1KHVA 3QGIA 2F96A 2G8WA 3GIMA 4ECUA 3N6MA 3QLHB 3V6JA 4EO8A 4C8OA 4O4GA 2R8HA 1JIHA 1JLGB 1R0AB 4ZTFA 3AVNA 3OL8A 1VRUA 3KK2B 3NAHA 3ZT2A 1U49A 1K6YA 3MTKA 4DL6A 2JC0A 3K2PA 3LZIA 3HP6A 2FJWA 2ZD1B 4F8RA 5KT7A 4CJPA 4F4XA 4OLBA 1U09A 2E6LA 2ILZA 3OL6A 3QESA 1TVRB 1EXQA 4JUZA 4JS5A 1NK6A 1WAJA 4CJVA 4W5RA 4ECVA 1QSLA 1GOBA 3DRSB 3KLFB 1IKYA 1EP4B 4TYAA 1S0MA 1C0TA 2FBVA 4WE1A 4KTWA 5HBMA 4RU9A 4Q0BA 4TQRA 1I6JA 3GQCA 1EETA 1BQMA 1RTIB 4KHRA 3QZ7A 4R5PB 4AILC 1XHXA 3E01A 1WNEA 3BSCA 1I3AA 4FM1A 3B6OA 5K14B 4IFVB 1RT4B 4O0IA 5T14A 2HNZA 1B9FA 1QS4A 4G3IA 1N5YA 4X2BA 1SV5B 1LWFA 3OYHA 5F8NA 1LWCB 4EEYA 4J9RA 4ZMMA 3T5LA 4Q8EA 4FBUA 1Y97A 1BISA 1WSIA 3PX0A 2Q3SA 3KJVB 3AVCA 2Y1JA 1HARA 2B5JB 2B6AA 3ZSWA 3DLKB 1REVA 4EYIB 4K4VA 3VQQA 4YR3A 2C28A 1LWEA 2YHBA 4KB7A 3WNFA 4EBEA 4Z4CA 3ZSXA 1XHZA 2P5GA 3CFPA 1J54A 2A1SA 3THVA 1VSIA 2IBKA 1HYVA 3V1OA 3T1AA 4O4GB 3QNNA 3MR3A 4M45A 4ECXA 1T3NA 4M41A 3EY1A 3B6PA 3HL8A 5HRNA 1VRUB 4DSKA 3I5CA 3QIOA 3HYFA 3OYIA 3WNHA 3GILA 1BHLA 3G86A 3RMDA 2LSNA 2XHBA 4B3OA 2XGQA 4ZPDA 2W7PA 4LH4A 3VQEA 1WSHA 4EP5A 1TKTA 4LQ9A 5F8MA 3O4QA 3V9WA 4KTQA 2BGGA 1S1TA 1IKYB 3HVWA 1C0TB 3CO9A 4IDKA 5HBMB 4DSFA 2QXFA 1KFDA 4CHOA 5KFZA 1SUQA 4IOBA 4BDPA 1S6PB 3DLEA 4AHCA 3BJYA 2W42A 3I5BA 4DTMA 1BQMB 4YR0A 3CDUA 3NL0A 3EZ5A 4PUOB 4FLVA 4AHSA 1VRTB 4E7HA 4J9PA 4J2DA 4NLTA 3H59A 3E01B 5CYMA 3RB3A 3DLRA 4AH9A 2AGOA 4NLUA 3OYEA 5DG9A 2WK4A 4NLVA 4FJ8A 2HNZB 1N5YB 4FJ7A 2IDOA 3OYMA 1NJWA 3NF8A 3D28A 4NLWA 4WXOA 4QOZB 1U04A 3IGNA 2WRMA 2B6AB 2FLLA 1TQLA 1REVB 4BDYA 4FJKA 3T5HA 4OKJA 1BL3A 1KVBA 1J5OB 2E6MA 1GOAA 3VA3A 4FW2A 5DQHA 1HNIB 2YHAA 4YP3A 3OYJA 3HSTB 2DFFA 1BIUA 1HNVA 1QSSA 4OVLA 4F50A 2Y1IA 3TR8A 3NDKA 4K8XA 4NYFA 4IG3A 2DPIA 3RR8A 1IM4A 4B3OB 4AHUA 5J2MA 2HWIA 4Z4HA 3QERA 1TKTB 3PJWA 3OLBA 3H5YA 5L1JA 1T05A 5F8JA 4IDKB 4DQPA 1L3TA 4HYKA 2GUIA 2YNIA 2BE2A 1ZTWA 4RNNA 3AVAA 3DLEB 1WLJA 1IO2A 1B9DA 3L2RA 3AO1A 4DTRA 2A1RA 1NK0A 2I1RA 3Q8SB 1HQUA 3CM5A 4KE5A 4F4KA 3PO4A 3IN5A 2QK9A 4RW4B 3FFIA 2C2RA 1JXLA 1YTUA 4Q43A 2XGPA 4JV1A 4ED1A 3AVGA 4FK4A 4WYLA 2C2EA 4Y2AA 4J9QA 3OL9A 2Z1JA 3HP9A 2P1JA 3AVBA 3RWUA 1T94A 5FDLA 3KTQA 1C2PA 3ICLA 4CECA 3HK2A 4NLYA 4CF2A 2FVSA 1A5XA 4XO0A 4NCGA 4MH8A 4M3YA 3PV8A 3RBDA 2J6TA 3QEVA 3T3FA 5J1EA 4CJEA 1Z25A 2AQ4A 2G8UA 4DTNA 1JLCA 1IG9A 1HNVB 1MU2A 2VG6A 4M3XA 4O3RA 4KKOA 3DI6A 5KFXA 3NF6A 5F9LA 2JEJA 2C22A 1C0UB 3OHBA 4F4ZA 4ED6A 5J2MB 2IOCA 1C1BA 5KFWA 3DM2B 3P5JA 2WB4A 1C1AA 2OPQA 4NLGA 3S9HA 2GC8A 5KFMA 3KLEB 1SL2A 4M42A 1NOYA 5KG5A 1T05B 2BRLA 5KG6A 3PUFA 3S3NA 4F2SA 3CJ3A 4CK1A 2YNIB 3LALA 2BE2B 2FBYA
chains in the Genus database with same CATH superfamily
5KFJA 1KOOA 4JI4F 1XK8A 4KIAA 2MQNA 1HQUB 3MAAA 4C0OC 5EU7A 1U45A 3BN7A 4PA1A 2QJ3A 3IA0A 4GVLA 1YWXA 4BRKA 3J7Z5 1RDRA 1LQ9A 1TU0B 3ZSOA 4N8NA 3CNQP 2VJUA 1Q86T 3S1TA 1HNWF 1AROP 1RFQA 4FYVB 1RLDA 2AA4A 2CQ3A 4H8KA 1N36K 1F9EB 4DR7J 1UKUA 1OO0B 2QTDA 2NLXA 3CQ8A 3S6EA 3GYXB 4ZS6A 4LF9F 4BVOA 5EX0A 2EG1A 4PG4A 3NGZA 2B51A 2GIFA 3K5PA 3BB5A 3GJRB 4CJ4A 1MU2B 2YJFA 3AD8C 3VENA 3IAYA 5BPNA 5F8IA 3DI6B 1X9SA 1ZM2A 5I9EB 3CJ9A 2F4VK 1TUWA 4B9NA 3O5BA 1FT8A 3FRYA 4CJWA 2DB1A 2X1FA 8AT1B 2OPQB 2QLJB 4JRQA 3CJSA 3GTYX 4CESA 4PPZA 2EVZA 5KG1A 3MR5A 1RU1A 2VBXA 4CIGA 1H98A 3A1YG 1S1UB 2OCEA 5E3QA 2EG2A 2HVHA 4HT7A 1LW2A 3H2LA 3IKMA 4JI2F 4URSA 4DUZJ 4YOTA 4JLHA 4MFBB 2QFJA 4MK8A 3GIIA 1RSCA 3VTIA 5JS1A 2NRXA 3W7BA 3UDVA 3SDEA 5I4MA 4YNQA 3EYZA 2GQ2A 5LJ3Y 3QFPA 5AQPA 5AZIB 3S41A 4PQUA 1B0PA 4L3QA 3UCGA 1WAFA 2A6AA 4MQ3A 4JEPA 3P1GA 3EVWA 2G0CA 5FPMA 2BEFA 3CE8A 1KQSR 3RW7A 3T5KA 2AU0A 3R5BA 1M5VC 3VAFA 1S9GA 2YKAA 2Y0SD 4KGKA 4JI5J 2UXDF 3CJ7A 4ISEA 1KHWA 4B3RF 5KFLA 4YY3F 4DR3K 3TNVA 2WONB 1XMOK 3D67A 3QJPA 3SK3A 3EX7B 3P4UB 2Q1LA 3R6MA 2FY1A 4BR4A 4WYBA 2ZM6K 2E5GA 3QYYA 4OPJA 1ULRA 4H5TA 2HQCA 3MDFA 2M7SA 2ACMA 4N47A 4LR8A 2NLWA 5DK5A 5HRSA 3OS0A 2I5JA 1ZBHA 4XAKA 5AFUA 3LPUA 1VQMS 5KFPA 2BJ3A 3C15A 2P9LA 4FJJA 2VPWB 3LP0A 3QPIA 2ZH3A 4M95A 2P9NA 3IMXA 2K06A 1OH7A 4AXIA 1NH8A 5KFUA 1WEZA 4X62K 4PY5A 2DGOA 2XM3A 4JN4A 4DV1J 3VF4A 3RBEA 4DUYK 3GR0A 2EFOA 1YQHA 3V5RA 3TWZA 2WCXA 4JS4A 4RNOA 3HJVA 3U8XA 1RCOB 2JEIA 4J2BA 1DLOB 3IUCA 1Z26A 1WF2A 2OMOA 1JLFB 3OBWA 4LD0A 4A47A 4YN3B 3CC2S 1NZAA 4IO9L 3CTRA 2QL7B 4AYBD 4U8VA 1S48A 2GVZA 1TUVA 3JTNA 4I6MB 2YKOA 1EKSA 2R2SA 2O8DB 5D3GA 4FJGA 1VQ9N 1NGGA 1Z6RA 2KFZA 3KKFA 1OY9A 4QWCA 3QQCD 2QWPA 5AQNA 2V5HG 3RRHA 4WKYA 4H5NA 2KXFA 3RJMB 3T5JA 3JYTA 2CQIA 1NLVA 2VOPA 1FF2A 2W4CA 1S5ZA 4EFHA 2NRTA 3HD1A 5A6WA 1ZS6A 4CDIA 4BC4A 4BACA 2EBEA 2P5VA 1NHKL 5CY4A 3FC9A 2ATQA 4DV0K 4DR1K 4QWDA 4OQJA 1U25A 3AVIA 3BDEA 2OPRA 5C42A 5HMWA 1S0OA 1HIYA 1CJKA 3ENBA 2ZKUA 3Q2TC 2F4VF 2FBXA 2YY3A 3SUOA 3R8EA 1EETB 1X4FA 5HROA 1VBYA 5DM7Q 3IFEA 4FDFA 4UZCA 1GLDG 2M88A 1RCXB 3KLHB 2CNOB 5ETRA 2G4BA 3WIUA 2HRTA 3H40A 2PDAA 3GMGA 2FZKB 1PYTA 1PSDA 3UB5A 2OTLN 5D0EA 1HD0A 3BUZB 2KT5A 4DPTA 2CPXA 1YHQN 1GLAG 4HCCA 1YX2A 1ZM4A 1Q82T 1TL5A 4I67A 1H2TZ 1CZBA 3LWLA 3AFGA 1T44A 3NGYA 4BDZA 3GPAA 1RDDA 1RAEB 2Q43A 2DXEA 3MEEA 3CERA 3MM6B 4JI1J 3UVJA 4WTOB 3JXOA 2Y1LB 1LNQA 4ZCIA 3D1QA 4ANCA 3A2FA 1NM2A 3VGKA 3ZX3A 2NZTA 5EX3A 2B9XA 2ZUGA 3KHRA 4OYOA 5AE2A 3JSRA 3HVTB 1QQMA 2ZWOA 3PIPL 3DN9A 2I7NA 3VOVA 3QEWA 1RAJA 3H1QA 2HHXA 1BMQB 1JLAA 3BBCA 1S1TB 2MJUA 4DL5A 1KQSM 1SJ1A 5CYQB 2AJ2A 4TN2A 1XR6A 1XNRK 1SUQB 4F04B 4ELTA 2X1AA 1RNHA 2J9CA 2HVDA 3GV5B 2VODA 3MFIA 1CXUA 5CYMB 2G8VA 1RBAA 1VC5A 2JX2A 4FZZA 2FVPA 1WN7A 2I7PA 2B7CB 3E1YA 3FDSA 5AZJB 4FLYA 3SCXA 4M63A 1XNQK 5DDRC 2HFUA 3V81B 2VH7A 4DLEA 2XO6A 4CHYA 1T03A 2KKZA 4C8MA 2GMLA 2HLTA 5D0HA 3DC2A 4ZTJA 2XBPA 2VQFJ 2GAGC 2R8GA 2QMXA 3DRRA 2D3UA 2P9KA 3PACA 1YJNN 4JI6J 3NXZA 2YTCA 2B43A 3DOKA 2RE1A 3VQDA 4ED5A 2BM0A 3PKMA 3C65A 2P9UB 4H03B 4FJIA 4DWIA 2PMHA 3EKUA 4DV5F 3LP1A 2EI5A 2V9WA 3P83D 3HSZA 2DGSA 1IJFB 4ILMA 3G6EN 1PYOB 4CVNE 3MMAA 3PSIA 1JCFA 3CETA 1S3XA 3PRBA 4H5RA 2AWZA 2F8SA 3QIPA 4QPXA 2CZ4A 4FF4A 3HI0A 1S9FA 2UUCJ 1FKAF 4JV0A 3PLAA 2NYIA 4ED7A 3IR7B 4Y2CA 2HMPA 2DH9A 2V68A 3G8TA 4RUBA 1HKBA 2V2QA 4DFKA 1QVFR 4M5LA 3DLLL 2JWNA 2WTFA 5ADXA 5L46A 2E9TA 1KQKA 4ZPTR 3B8AX 1B99A 1AZSB 2G8FA 1DBDA 4RW7A 2R7WA 3WEEB 3OA9A 3T1HJ 1N48A 2QV6A 1S10A 3M4XA 4DF8A 2QWMA 5FRNA 8ATCB 4UZBA 4DZ6A 1PC4A 1QAIA 5C15A 3R5CA 1JLBA 5HQLA 1KC8T 1KAXA 1VLOA 4D3HA 3EJMA 4RW8A 2XCPA 1CPZA 3WNGA 3LF0A 5HL7L 1LEOA 3D2WA 2Q66A 1HX1A 3AARA 3HHLB 3ID6A 4ZN3A 4JI3F 4HTJA 2RF2B 1N0VC 2BACA 5AQHA 2XZDB 3KLIB 2DFHA 5JVGQ 4HEA9 4A8WA 2LQBA 1F5BA 4RCHA 2VG7A 3HM8A 5C24B 4WYWA 3E8OA 4A8KA 2YNFA 5IT0A 2YVSA 1G1XA 1RTJA 4B3SK 4DV6F 3N6NA 4S0MA 3HSCA 2O8EA 4E8UA 2GJIA 4TLRA 1F21A 2YWGA 6FD1A 4IEIA 1RUSA 2H4WB 2BE9B 4H4MB 2OELA 4NRUA 2ZE2B 3R27A 3NAEA 4ES3A 1BCMA 4LF8F 3GP9A 4OJ1A 2W4PA 3BO4A 2IAJB 3TR5A 5GMEA 3U1MA 4RW6A 4KHPK 2B4JA 1JLEA 2M5YA 3IG1B 3QLHA 5BR8J 4CGIA 4FF2A 4ZVGA 4PR6A 2OI2A 5L39A 1BCOA 2HK3A 4P7VA 1VQ7N 4OYBA 3W1YC 3L3CA 3VQCA 1X0FA 5HAOA 3RMAA 4OJRA 4HKQA 4FZXC 3N4WA 1WELA 4DFPA 1CBKA 4DR4J 3TSPA 3AOCA 3WNEA 5E26A 1RT3B 4OI4A 3W8PA 4RW9B 4OFZA 3UD5A 4YUDA 2BKOA 2BUPA 1LXNA 3HD2A 3BSAA 2XYPB 4LVOP 1ZA2B 1OKJA 2YKPA 2G9OA 4FSVA 2J8AA 1OVQA 4DXLA 5G4DA 3W9JA 3B4MA 3NBPB 3KHHA 2OPPB 2DR6A 4JKCA 4FLWA 1IH7A 2VWKA 2PMZD 2HMIA 3NFAA 1B0VA 1HNXK 3AVMA 1HW9A 5FRMA 2C2MB 4TY8B 4BWMA 3F5TA 1LOUA 2QMUB 4Y2MA 2PGCA 5KRSA 1LWCA 3AXKA 4LF4J 3VMFB 5CYJA 2UYTA 3GYNA 3R7NB 2AEJA 3H1VX 2GTDA 3EM1A 2HHHF 1GLLO 3CMEN 2HNDA 2PYJA 2E9ZA 3DDKA 4L8RB 2GGPA 1RI7A 1WSEA 1AUDA 4ED4A 4YDDB 4I2PB 3KNAA 3RR7A 2HWHA 4TVAB 3WQUA 2BVZA 5DG7A 2LKZA 3ZTPA 3D9BA 2O8FB 1W2IA 4ZLNA 5C5JA 1EQMA 4QWBA 2GIRA 2K2PA 4AQYF 4PG6A 2IC3B 4ZVTB 1CZ9A 2IM0A 2ASDA 3H2UB 4C9DA 2N7YA 3R97A 1R8PA 3CCMN 4JI4J 4C1NK 3I0SA 2VA3A 1JL1A 3SLCA 1RBRA 4H4KA 3NHGA 3TZZA 4BR5A 5KPZA 1IVZA 4KTZA 2KZMA 1S57A 3I4PA 4CHPA 3GV8B 4RL1A 3KJQB 1VRTA 3O1WA 2QC3A 1HKCA 3RBZA 1ICEB 2NR0A 3T9NA 3VAJA 1HNWJ 1U48A 1E4GT 1N56A 4P9SA 4Q8FA 4BR9A 1QUVA 3FCVA 5I3UA 2HRYA 4IQXA 3Q89A 4LF9J 4OKKA 4E19A 3TAMA 2VA2A 4DS5A 4E1NA 2FSJA 3V6DB 4JAXA 4JYAF 3LP3A 3QMQA 1RT2B 4MLHA 4HHHA 1ZTTA 1SKSA 2CQPA 1N33K 3AA9A 1FRJA 4PKDB 1YJUA 4EU0A 5KI6A 3VAMA 4DL2A 4USMA 5M1PA 1XMQF 2MY8A 3H8YA 4ZPBA 4WQ5A 3I4HX 4K25A 5HP1B 3ZNJ1 4OPKA 1F9FA 2YWEA 2IJFA 1AFIA 4HUGA 1YITN 4HCBA 1GMWA 3AH6A 2F1FA 4B3SF 3BO3A 2O8BA 3ENVA 2V94A 3JSMA 3G8QA 2EC2A 4JI2J 2PA3A 3UIQA 1HWJA 3M6VA 2A10A 3FSIA 2HSEB 2R2UA 3CJKB 4YHHK 3SQ2A 4M3WA 4OZ3A 1VBZA 4RW4A 2VUGA 3ZZZA 2KHCA 4OGEA 2E2OA 2ZH1A 3KHYA 1I1GA 4WFZA 2CPJA 1B92A 5KT4A 2NZCA 4ENOA 1BOTO 5A0YB 5GVQA 1VR6A 4ZP6A 4CLSA 5KGWA 3L95X 2CYYA 4K4YA 1SXLA 3LP2A 3KYLA 1CJUB 3FMBA 2QWQA 3QBXA 3NS7B 3CJ2A 1NJIT 3FQLA 3LDQA 5D0RA 3RRKA 4ILLA 1H6KX 4E1MA 4KGVB 3QFHA 2MKHA 3K17A 4CYUA 5A2QO 1S12A 2DNLA 2UXDJ 2ZH9A 1BQNB 4B3RJ 4YY3J 4A2AA 1PG5B 1O13A 2CNNB 4QAGA 2CFXA 3R7SB 2PO4A 4OJGA 3G6YA 1BD6A 5HJYA 1FRXA 1WC3A 2ROGA 4NPOA 3DM2A 2F8EX 3JS9A 3LOUA 4IRKA 3QJJA 1PYSB 2JVRA 3VQ9A 1S79A 4NLOA 5HVGA 1U8SA 5GAHU 3WDOA 5LSRA 2E7VA 1A9NB 1TKZB 4ELUA 4IH7A 1UL3A 4O3QA 2MSSA 4I2QB 2X6SA 4C2MA 4CJTA 1HQEB 4U96A 2LXIA 3OR2B 2V63A 3N9UC 3CDEA 1WC6A 3H5UA 1MMDA 5DM7L 3MN6A 5AXKA 1KWMA 3ITHA 2J76E 4PPDA 3W3DA 5BRDA 3V6HA 4YOUA 5BREA 4CHNA 2VG5B 1BDGA 5DLFA 1VC6A 1SC1B 2FHOB 2DR9A 3KK1A 2KT2A 4ZIVA 1YJ7A 4IWVA 4OPAA 1C0MA 1T6CA 2JEGA 2DXFA 4M5IA 2EFQA 4KB0A 1YAGA 2XC9A 4CZGA 1P9YA 1U7LA 3HHDA 1VSHA 1NMEB 4B8AB 1RTZA 4M5JA 3D6MB 2V67A 3NOGA 1KAYA 4ILRA 4BCAA 2I6WA 4D3GA 3KD1E 2M9KA 2LECA 5LY3A 4DHYA 4ZITA 2FJEB 2FDNA 2ACYA 4C48A 3HT0A 3PYEA 4KV8A 1VSMA 3S7RA 1XI1A 2XY7A 1U1KA 1Y3KA 3G82B 3AB2B 4YMEA 4KHNA 4OZ0A 3R2CJ 1RGVA 4X4OA 2F4FA 4KAZA 1ZYQA 4CGJA 3MUMP 3CCWA 4QIEA 2OJ3A 4USIA 4BC7A 3CFOA 2DR5A 1I51B 4CO3A 2HS3A 2C2OB 1DJ0A 3V9ZA 5BN8A 4CLWA 1BA1A 2VL1A 2F4VJ 3D6FB 4ES2A 3DXKB 3VERA 5DGAA 2YWKA 3VEZA 4EHTA 3NNAA 4C0HA 2BA9A 4DTSA 4NYPA 5K5MA 3MUVP 2J0QD 2DFEA 3Q86A 5DRKA 2PBDA 1UFLA 4M3ZA 2LQ9A 4DPWA 3OYAA 3MD3A 4ZKAA 1S1VB 1N34F 4DQRA 4LRFA 4XH4A 2UXBF 3SV4A 3GLJA 1HBUA 1Q7YO 4DMZA 1TAUA 1MROB 2AGQA 2HFSA 4OI2A 3CT9A 3J7A1 3FSYA 2OPSB 4CIOA 4Q2MA 5IC4B 4QJVA 4W5NA 1YJNS 1WOPA 4DOZA 2RDIA 1NGIA 2FVQA 3M8SA 3NVKA 4OJHA 4ZHRB 1CSJA 4BQZA 2O66A 1HLUA 3ZEUA 1R0AA 5IS2A 1ASUA 4E7LA 4QW9A 3ZT4A 4FW1A 1W97L 3G6ES 3QRPA 3SFGA 1IBLK 4DV3K 1N54B 1ACMB 1YSJA 3NGDA 5G0RA 1K1SA 1HRHA 1ZBSA 5EOYA 4RJVA 4QWEA 5ETPA 4DV2K 2VB6A 3LL3A 4LIRA 2ABYA 1S9EB 4M3UA 2XY8A 4C11B 4F4YA 3MN9A 4JK7A 2XCAA 3QINA 4KHMA 2P9SB 1S22A 3QMLA 2ZVIA 3IS9B 1RTIA 3ZNUA 1NNDA 3PFOA 2XEXA 2WTUA 3GCXP 3MMBA 3KHGA 5KT5A 3LPEA 4LRDA 2CXEA 2W2MP 2UUBK 4I6MA 3QATA 3I5AA 2VU5A 1RDAA 3KJVA 3P5TL 4NLXA 3PEHA 3EUNA 2UV8G 3DLKA 3RB0A 1GXTA 5ETVA 4C4WA 3QGIA 5JVGL 2CPHA 4CBWA 1NB7A 2VFSA 3N6MA 4M7XA 2EPIA 3ILOA 1SKUB 4C8OA 1AB8A 2R8HA 4H0XB 2ASMA 1AUSL 4QIWD 4L72B 1VRUA 1RWWB 3GR1A 1K6YA 4PAAA 2P9CA 3U1NA 1BUXA 1S6UA 2IRYA 3IWXA 5KT7A 4OLBA 3CMAN 2ILZA 4HTLA 1EXQA 2V51B 1WAJA 2DY9A 1FXRA 3BYRA 4NASA 1F3FA 1ZOTA 3KLFB 1EP4B 1C0TA 2UXCF 4KTWA 2P9EA 4OHVA 5HBMA 5LMUK 5C0YA 1I94F 1EX8A 1YI2S 2HVZA 1EETA 4P2FA 4P2MA 4KHRA 1Z05A 1HNZK 3QZ7A 3L7PA 1XHXA 1RHKB 3PYDA 1D8ZA 3FCHA 3GYGA 2VKRA 2YJEA 1IN0A 3EDQB 2HNZA 4X2BA 1GAOA 3RGIA 2E1PA 5F8NA 1K73T 4ID8A 1Y97A 3PX0A 2Q3SA 2BJEA 3NCQA 5B8HA 1VJQA 4EYIB 4YR3A 4JI3J 2YHBA 3L0QA 4Z4CA 3ZSXA 1XHZA 5CH7B 3SIPB 1J54A 2A1SA 3LO3A 3THVA 1RAHB 4ANDA 1VSIA 3KUEA 1U1NA 4O4GB 4BRFA 4M41A 5HRNA 3GZ7A 2FHMA 3R5DA 2J0SD 1XMBA 3G86A 4DV6J 3L7OA 3RMDA 2DHAA 2XHBA 4B3OA 2XMJA 2XGQA 1LWXA 1Y64A 2HWTA 1WSHA 2OEKA 1FX4A 4J90A 4LQ9A 3M6XA 1SIWB 1S1TA 1IKYB 4LF8J 2GWJA 4IDKA 4EWTA 4RX6A 1SUQA 1HI8A 1XQSC 1RADB 1YJ9S 4BDPA 1S6PB 4AHCA 3LPYA 2W42A 3CCTA 4I64A 4AHSA 4NXMK 4J2DA 5CYMA 3SQOP 4LFBF 1YVNA 3BZCA 3CJBA 3M6GA 1HWUA 2HIQA 2AGOA 4OYIA 3ZZRA 2R4FA 5IT9O 1GXUA 4XDDA 2WK4A 4BRHA 2A40A 2IDOA 1CULB 4PABA 3OYMA 2DY1A 1NJWA 4M7YA 4NLWA 3T1YF 4NO7A 3R2DJ 1YBAA 3TVZA 2HLUA 1U04A 3ISZA 4RWTA 5FJ4A 2JJ4D 4F02A 1RK8A 2OUGA 1UTAA 4FJKA 4FYWB 4USJC 2ZFHA 2HF3A 3QRRA 5E3PA 1J5OB 3ZETB 4GKKF 4CLTA 4MDBA 1HNIB 4NZ6A 1RJJA 4YP3A 3FBBA 2BJDA 2B0GA 1RAOA 5LM7E 4KGXB 1YIJN 2DPIA 1N32F 2B4PA 1I5OB 1IBKK 2KVQE 3M30B 5J2MA 4K42A 2E5LF 1P6TA 2QWNA 3SSSA 2L9NA 1X4BA 1X4HA 3PJWA 1NBWA 4WP8A 1GMUA 2R7SA 4E98A 5L1JA 2HHHJ 1ATRA 1FJGK 4DQPA 2WVCA 1ZTWA 3C7NB 3DLEB 4LF6F 1IO2A 3L2RA 2UUBF 4ERDA 2GEMA 2E7XA 2WVBA 3SCLE 2MGZA 3Q8SB 4KE5A 3IN5A 4L6V3 2YHXA 4QU6A 3MPWA 3QWUA 4PCQA 2C2RA 1NMNA 2PN6A 3O6WA 1JXLA 1YTUA 1HR0K 2XGPA 4JV1A 3WEEA 4AQYJ 2ZWPA 1FD8A 1O8BA 4J9QA 2OO4A 2VD3A 4U67Q 2JFKA 1W7AA 5GMDA 1HBOA 1T94A 2RUGA 3Q8UA 4ZDNA 2K8GA 4FL9A 2QT7A 3ICLA 2QWLA 4M63C 4CZFA 4X4PA 4DKWA 2FVSA 3MMJA 3H42A 4M3YA 1NDLA 3PV8A 2J6TA 3QEVA 1YITS 4CJEA 2MLZA 4ES1A 3G9CA 4JI8F 2ZH5A 1JLCA 1GT8A 2PE8A 2VG6A 1FERA 5LMUF 4RU2A 1YZ6A 4KKOA 3IXQA 4CZJA 2V6AA 2C22A 3SSRA 3VALA 2ZBRA 3R5JB 1YF5L 4F4ZA 4EGLA 1HNZF 4O5FA 4H0TB 4AL7A 2PMWA 2WB4A 1FXDA 3KLEB 3ZZYA 4JYAJ 1T05B 2K1RB 4L75A 5KG6A 3PUFA 3MXHP 2YNIB 2BE2B 2FBYA 3WBZA 2FJBB 4DEZA 4Y65A 3IR6B 3H4BA 4IFYA 3J81O 2AX1A 1M5HA 4JBCA 1HMVA 1VQ8N 1FRKA 3VGLA 3DKDA 1YUWA 2MEWA 3BBFA 3FFIB 1YK9A 4P52A 4OHWA 4CRJA 3OQ2A 1XMQJ 1RGIA 3SZ2A 2BRKA 1YVUA 3ZSQA 2ATCB 1K0TA 4CNYA 2R3VA 3UE5A 4M3TA 4ILHA 1OY8A 3BKTA 3IG1A 1GLCG 4H54A 2O8CA 3FJ2A 2XULA 3MM7B 4LFAK 2B8PA 4UOGA 4PWWA 3J7AP 3M1VB 1S6OA 2VQEF 4BRPA 4B3SJ 5GADI 5I42A 2F5GA 1IXKA 4PKIA 3PIOQ 2CQBA 1X9JA 4PQAA 2RKIA 3CJCA 5KFGA 3F73A 3A8IA 3G4SS 1SJQA 5IV4A 5F9NA 3HULA 3WXMB 2PEBA 4HVJA 2F3JA 1F3VA 2XYHB 3OYDA 4KHPJ 2Z8QA 2KYXA 4ISFA 3L8BA 3NBPA 4DR2K 3LDSA 5THWA 2XLJA 2PEHA 1ZZFA 1NGHA 1W2BR 2H54B 2B3TB 1X4GA 1EHWA 3CGIA 4FLUA 4Z4GA 2KFNA 3SV3A 3MGJA 2G0JA 2FLPA 2GA7A 2DBBA 4Q7AA 2UP1A 2LEBA 1OQ3A 4QW8A 4K4XA 4DU3A 1NHVA 3MAAB 4KSEB 1FK9A 5D4LA 3MTJA 2L48A 1EB0A 3RAQA 1KKHA 3NS5A 4CZEA 3D45A 2BOAA 3UDEA 3NKYA 1SKWA 4A8QA 3CCRN 1VSEA 1SJ3P 2AJ4A 4LY7A 4TY9A 2B8QA 1TK0A 3ZX0A 4K0KK 1NXIA 1NNEA 5HN0A 1TZ0A 4TNOA 5ETKA 2MZ1A 2WW4A 3QGHA 4E2FB 3P3DA 3D3CJ 1FNMA 3THYA 2DISA 2EBGA 1K1QA 3RTVA 3MEDA 3PY8A 3HVAA 3QAEA 4A48A 2YQ0A 3AAQA 2JOQA 1RHUB 1FJGF 2XSJB 1S72S 3K5OA 2RRNA 2ALZA 2MZSA 2EFPA 1KTVA 3US5A 2A1BA 3A8YA 2N3LA 3NH2A 1T3OA 1T9XA 4NLRA 4A5BA 3O80A 1X8DA 4PYDA 1WI6A 2HNYA 1VQNN 5KOWA 4KHSA 3RAMA 1EZZB 3DMJA 1SC6A 2IMWP 2BW2A 3CCJS 1WUAA 3CFRA 2LFVA 3QSIA 1TKDA 4B08A 2V52B 3V6DA 5SUHA 3BQ2A 3FQKA 3OUYA 4DL4A 3NH0A 3F41A 4C6AA 2QEXN 1LFWA 4E7KA 3NEKA 2JHEA 1LW2B 3J7AN 2EWHA 4NB4A 1FJCA 2AYGA 2IDLA 4BC9A 3HFVA 3RSEA 1ZH5A 1MWYA 1IWGA 1OH8A 3CWJA 3HHEA 3Q8RB 3I9ZA 1SH0A 3CI5A 5K8MA 3K9KA 3SDEB 2KT3A 1NGBA 4PQUB 4OX7A 2XY6A 2AYBA 5AXMA 2E1ZA 1EWRA 4DL0C 1VQPS 5T7LA 1GMWD 2IBOA 1S9GB 1OYEA 4O44A 3WT0A 3JQKA 3OW2M 3VQAA 4DN9A 2E1AA 2JC1A 4K5SA 1QE1A 1T9TA 5DLGA 4H4KC 3I8DA 4LF5K 4NL5A 3U02A 3MOJB 1SVDA 1SC3B 1P1LA 1OH5A 3EE3A 4KH6A 1NSQA 4HVZA 3SBTA 3BR9A 4GVBB 3THXA 2R2TA 4I7FB 1OY6A 2RUSA 1IJEB 2DNHA 1UAXA 2JH3A 3J7YP 1R8HA 2OGUA 4FVMA 1WOQA 4CJRA 4DV7K 1CJUA 2GJ2A 3TYTA 3SMSA 1REGX 1KCFA 3L2QA 2I5JB 5KG2A 1L3KA 2RE2A 3CCVS 3MI7X 3NF7A 1SL0A 3C15B 5M2UA 3ATVA 2Q0RA 2P9LB 2ZDPA 2P9NB 1N34J 4YQWA 5EGYA 2UXBJ 3L2VA 5T41A 5KFRA 2IYGA 3K89A 4ECSA 1X9WA 5E84A 2ZHBA 2KFYA 3CCES 5H9FK 2X3DA 4C0BA 4F3OA 3RB4A 2RQMA 2Y1RI 1URRA 4B9VA 3EDRB 3WIVA 1WD6A 1HFEL 1ZPVA 1B70B 1W2BM 2F8HA 1P9QC 4WQ5C 4MYTA 1H38A 4C8ZA 4GNIA 1WOOA 2HRUA 4CEFA 4CFAA 4HDHA 2KZZA 1SBRA 3HFKA 3PR4A 3D2EA 3Q8QB 3UQSA 5KFQA 4BQLA 4PKGA 2GVZB 2QSFA 1K47A 2VFRA 1N0UA 5J2QA 3D0HE 3MCAB 2YX6A 3MPVA 4CLLA 4K7QA 1SI9A 4E3SA 3CJ8A 2J5AA 5D3GB 4A57A 2EFGA 2HFVA 4NA1A 2W41A 2IVPA 2IVFB 2J9EA 4LF7F 4DV4F 3BGRA 1UVIA 4BE0A 4ZVUB 3SJHA 3OLAA 2D7SA 3OXFA 3UFCX 2A6OA 4RTFD 4U7BA 3KD5E 3PG9A 1Q8BA 1EO1A 3JYTB 3TSUA 4V19X 2W2NP 3DHWC 3MXIA 4X66F 3IO1A 1VHIA 3GL1A 2UUAK 2XWXA 3EMTA 1OS5A 4J37A 4CJ3A 3MXMA 4C8NA 2J4RA 2XY5A 3KG0A 2OPRB 5C42B 2DGWA 1CJKB 2Z1HA 4OYAA 1LV5A 4DSEA 2PC6A 4M8LA 4N5SA 3K7RA 2FF6A 2AP6A 5HROB 1Y3JA 2BZ2A 3OD2A 1MMLA 1N88A 3DRPA 3TZWA 1HJOA 1ITGA 2RDDA 2W7AA 4IDHA 1TR0A 2CA9A 3TPQA 1ASWA 5LL6Z 2OEJA 4GKJK 3BGUA 4FF1A 5AQWA 3HZGA 3M8ZA 2ZH6A 2HHTA 4X84A 1N6QA 4NXNK 3IDHA 3GU0A 1S1XA 2AV5A 3LH2S 1KVIA 2UXCJ 3GB0A 1TFWA 4MO4A 4X4VA 2L41A 1I94J 1Y5IB 4XEIA 4B1VA 3UVJB 2DXDA 3DAWA 4X64F 3IMQJ 1H0HB 4DSJA 1YJVA 4Z37A 4KHWA 1VQKS 4IG3B 5LXYA 5D0GA 4AM7A 3ZZTA 5C2CA 5L8RC 3E51A 3GJQB 2OZSA 3D4JA 1PIEA 2AJ1A 4W5TA 3NLCA 4OI6A 3LAKA 3SYZA 5KGXA 4EMDA 3C46A 2V50A 2E5JA 3VVUA 4B9QA 5AJ3F 2MQPA 5GIPA 1SH3A 4LF5F 4CIEA 1VCTA 2DY4A 2DCUB 2NNWA 4WK3A 3W2WA 2E1MC 4K8ZA 5B0BA 1L3UA 3CCLS 1FO1A 2ITGA 1ZBIA 3CD0A 1CQMA 2GMJA 4OZ5A 2JDJA 3OHAA 1MSWD 4DQIA 1T95A 4JI0F 4DTOA 4B3MF 2CJBA 4P10A 3KK3A 4AHRA 1T03B 2DHGA 2IYIA 2B7BB 5J1NA 3DRRB 5EWEA 2HQGA 2VC1A 1IR1A 4DX8H 3QNWB 4E0DA 2OFHX 3O3HA 4P2SA 1Q81O 2V4RA 3M5RA 2PFDA 4NCGB 2P9KB 1SJ4P 2RHQB 3HHNB 4K59A 2VWJA 3U3YA 1U2FA 5KG3A 4DS4A 2NS1B 1JNRB 4DTJA 2LMIA 1NK5A 4LFBJ 4O3NA 1S9EA 3CC7S 3JAMY 2E9RX 4EO6A 4IG0A 1YRTA 4USVA 1RYSA 1Q53A 4RNMA 5M1OA 1VK3A 4LQ3A 2P9SA 4U67L 2RU3A 3MMAB 7AT1B 2FUG9 3AOAA 4CEAA 4PXDA 4OL8A 1AA1B 5HRPA 4NCAA 3T1YJ 1M0SA 3QIPB 4U6PA 4NX9A 3PX4A 2AZ3A 3O9UA 1KEKA 4IBNA 3AODA 4WF9Q 4ZVHA 1EQYA 2IY5B 2ASYA 4ETXA 1FWPA 1KAZA 4IJAA 3VCDA 4GKKJ 1Q9YA 4FK0A 4LSNA 3PW0A 2D0AA 4CLUA 3HZEA 3ENWA 5EX5A 2KW4A 3VAGA 1GX6A 1JMTA 2C2KB 3SI8A 2GJFA 1QQCA 3Q0AA 4RW7B 3C14A 4DX7A 1N32J 1V3ZA 2ZH7A 3SQ1A 3DWLA 2HOEA 2ZH8A 1ZAWA 2HGNA 2B9WA 3CC2N 4J9SA 3ILIA 4K2JA 5F8HA 3TWHA 3SNNA 2E5LJ 2RB7A 4TU8A 5J2PB 1OYDA 2K3KA 3HT3A 2RQ4A 1HYZA 1KVCA 3J7YU 4ELVA 4JV5F 2KN4A 1KS2A 5KQDA 1JLBB 2W7OA 2MKKA 1E6VA 1CS4B 1DGKN 4FJMA 3BM7A 2AEMA 4CH7A 4LF6J 2UUBJ 3DCAA 3JAMU 3SQ4A 2YQ1A 1L5UA 3LANA 2D0PA 4DL7A 1ZBTA 1T0TV 4AHTA 4FJ5A 5EHHA 3ULHA 1G99A 4J9MA 2EW9A 1IBMK 1JKHA 4M5MA 3SCKE 4CT9A 1M90O 1YXQA 4XH1A 5J2NA 1H2VZ 1WHXA 3PW7A 1VQ8S 1QLNA 3T19A 3MURP 2VG7B 3AV9A 2QE5A 1FDDA 3O9TA 2YNFB 4W5QA 1SB6A 3E2EA 5IQQA 5E3RA 3PIOL 4E89A 1RTJB 3OY9A 4GV3A 2BJ8A 3N5FA 3AT1B 5HRRA 4DPUA 3X1LB 3OYFA 1RWKB 3M2UA 1V5IB 4RWXA 2DNYA 2O8EB 5HO4A 1AW0A 2A3ZA 4J7CA 1GLJO 1RTHB 4ZVFA 4AE5A 2MQMA 1R27B 2XMUA 4MIWA 4J9NA 3TQ1A 2X74A 4JI8J 3GE1A 2MHEA 5DMRA 2BJ7A 3L4IA 5LMUJ 1EKRA 2PFFB 4RW6B 2R7RA 1B0TA 3V6KA 2RRAA 1JLEB 3B54A 2M4MA 1KLMA 4KH5A 1HNZJ 2HHUA 4CIFA 3CCSN 2C2NA 2LCWA 4OI3A 1RT5A 2RNEA 4CHQA 1MA9B 1I39A 1RAFB 4CEZA 3KJFB 4DQ8A 3OVSA 2RDJA 3ZT0A 4HLBA 1FJ7A 5LMNK 4DLGA 4WP9A 1A5WA 2HW3A 3DJCA 4ITSA 3KWIA 4LIWA 2KJWA 1CG2A 4DX5A 2Z58B 4KI4A 4ICLB 3HMJG 4A8OA 1R7IA 1TL3A 5K8PA 3U6FA 5CXTA 5FLXY 4WFYA 3M2RA 1U1QA 4QQBA 4FK2A 2V8GA 2DGUA 3MR7A 3GWCA 1S6PA 3K5MA 1RBUA 1TFYA 4RNHA 5C2DA 4A4JA 2HMIB 3JS6A 4LFCF 5LJWA 1X3NA 4CNZA 1PJ7A 1UFWA 4U9RA 1O1WA 2VQEJ 3ALYA 4BRAA 4WPAA 3WX8A 1HUXA 4FPIA 3VTHA 4FWRA 2C3YA 1FNXH 1VDHA 2KXNB 2HNDB 5F0UA 2LQ8A 2GGPB 2G8HA 2WSCC 3Q7BA 4LJMA 4CK3A 3SUPA 1PBAA 1J2VA 3EXYA 3SBMA 5C25A 1J5OA 3ZETA 2MQ8A 4OX9K 1M5SA 2HBQB 2RHSB 5DQIA 1HNIA 4YR2A 2W25A 3JSBA 2KVIA 1J5EF 2KLAA 2B4OA 1URNA 3D7SB 3KMQA 3LM9A 4B3TF 2DTUA 2PI5A 4UOCA 2KI2A 2Q6BA 4JK8A 3EEQA 3DXMA 2VV5A 2FJXA 3KZBA 1ROFA 1NK9A 2BANB 1UA1A 3I0SB 3W2VA 3RW6A 4G1QB 5AQXA 2X51A 4JV2A 3WXLA 4K4TA 4USUA 1W7WA 1RWUA 4CJLA 2HS4A 4L3KA 5LL6d 2KO1A 3T69A 3QEIA 2VASA 4F2RA 3O3FA 3I9V9 5DGBA 3PFEA 2XMKA 2QEXS 2FF3B 3ZZPA 2EK1A 1BC6A 3C6TA 1RP5A 5I3UB 3OYCA 1HHSA 4URGA 2W9BB 3TAMB 3D1OA 1BE4A 2XG8A 4CZMA 5JMVA 4FPRA 2V8HA 4ZLPA 1RT1A 2VKZG 1UPPA 2BM1A 1FJGJ 2QFIA 1RWOB 2CQ1A 5AQIA 2EKYA 2Z2MA 5F41A 1FTRA 4DSIA 3OSNA 5I3PA 2ZZMA 1XJWB 2DR7A 3O4NA 2QRRA 3A4TA 2Z1GA 4B8CA 3UKUA 1O5JA 1T6DA 4WU3A 4EP4A 1S0NA 3L2WA 4QCLA 1KBRA 2PIIA 2IPOB 3BR8A 2MKYA 3CO0P 3P45B 1UW9A 2V9KA 2DNPA 1UEVA 5KFDA 5K9FA 4M94A 3KLEA 5AQUA 3O3LA 1S6QA 2K1RA 2O8BB 3HPOA 1U1OA 1I3OB 2HZAA 1T9UA 2YNHB 3H3NO 3JSMB 1A0OB 1VOMA 3HM9A 5F3TA 2C42A 4W92B 3BKFA 1Q7YT 3U9DA 1UEKA 2R8KA 3M8QA 1PGZA 4M3RA 1TKXA 1RYRA 1DTQB 3TI0A 3H08A 4CD3A 2FZGB 4NEYA 4X4QA 5E0OA 4NYNA 3CD6S 3H20A 3ULEA 1KFSA 1PO6A 4KB1A 2LP4A 1VSFA 3UO0A 3D3BJ 1VYAA 1YRXA 5KQ8A 4FWLA 1RT6A 3OTOK 4OX6A 2ZJQQ 4B9TA 5IZHA 1B3TA 1FRLA 3OHRA 4DG1B 3BGFA 3A5OC 5KFSA 2QI2A 4GO7X 3LP2B 2E4LA 3ETMA 4FVCA 4O23A 1D9FA 2AP1A 3V4IB 3HSJA 2ZZTA 3DRYA 1WC0A 1NWKA 2DJWA 3ZCMA 3MPDA 2DO4A 5F3ZA 4OYZA 4OV6A 1C6VA 1RWNB 2R7YA 3OVAA 2H65B 3VHQA 4CYUB 1WBDA 3PO5A 1IWAA 4Z4EA 3W65A 4OKEA 4I1TA 2P9IB 4TSXA 3OS1A 3CVKA 2EHGA 4JB8B 3P5BP 2HHWA 3UDCA 3HO1A 4ZPWR 2B9EA 3SPYA 2BX6A 5HANA 4P75A 4E1JA 5KFBA 4LRAA 2Q31A 4KBIA 3MX2A 4CT8A 3T6BA 1N5QA 3SI6A 1JL2A 2F65A 3IRXB 2OTJS 3CJQA 2AW0A 1CQNA 3CD7A 2W8LA 4Z7CA 5BYSA 1VSJA 3ADAC 1K8AO 2QA4N 5DZ7A 5B0GA 2GELA 1RWPB 2HQFA 2E1RA 4C8KA 4J9KA 3NWRA 2DGXA 5JVHQ 2AX0A 3ITHB 4KHYA 3ZT1A 1X1PA 2J0WA 2ASJA 2HFZA 4IRDA 1DTTA 2N4CA 4FWOA 5KFKA 1A6LA 1DARA 3TUZC 3UKRA 5LJ5Y 1QZ6A 3KK1B 5LSLA 1F60B 2DNNA 3CJTA 4F3TA 4RBUA 3QBWA 1FX2A 1NUEA 2GVDA 4NCBA 1G15A 4CI6A 2CJ9A 4KT0C 2XSJA 4DR7K 5FIIA 2UU9K 3TAFA 1HWKA 3F9KA 1QAJA 3FRZA 5A8RB 1VK0A 3I0RA 4K41A 3TEGA 3TU5A 4FXWA 1TL7B 5DQGA 4LF7J 4KV8B 4DV4J 3FZLA 4B1ZA 4EAHD 4CEBA 1TYQB 3ZSRA 4FLXA 2QWOA 4R0EA 1WDTA 2BQUA 5FD1A 2CQCA 2Z2LA 3TJAA 2J9DA 3ENAA 1IKVB 2QXLA 4RLEA 1LW0B 2BKPA 2DYAA 2BW7A 2VPXB 2D41A 3FZFA 1UZHA 4X66J 3UCUP 1JLGA 3VEVA 1EAYC 4K4SA 4B1YB 3KK2A 1RHJB 2YI1A 5E2QA 2ATLA 2H51B 3QB0A 3FZBA 1P8ZA 2ZD1A 5L1KA 2UVWA 4YOVA 4QS8A 4BHQA 1KQFB 2W2PP 4YOEA 4PEOA 4WK1A 3H98A 4OJ3A 1WKJA 3DRSA 2R2RA 1IUJA 4V19S 2HAFA 1AT1B 4FS2A 4LC9B 4FYYB 2GWKA 4F4AA 5JJBA 4BRCA 4DUZK 3ZYYX 3CB4A 5F8LA 3OYLA 3A5NC 5AQRA 2CJKA 3FEYB 5B7WA 2J7KA 1RWXB 2BTFA 3FEXB 4IFVA 3K5NA 1K9MO 4I9LA 2CPYA 3WX4A 1NJZA 4CWBA 4JHDA 3CCQS 2BQRA 4HHJA 3H5XA 2ZQBA 1HBUB 4X64J 2VFUA 1NKCA 2B5JA 3BH6B 3QDKA 2C3PA 4CTAA 2FHKA 2A3JA 4GVBA 4I7FA 2M0GB 2HGLA 5IXUA 3UNGC 1WC5A 2G8WA 2FD2A 2W2QP 4JI5K 3E9OA 3GG4A 3V6JA 3ZEUB 3UN2A 3BPSP 1R0AB 2XMVA 4DU7A 4WF9L 2HSTA 4DL6A 4F8RA 3NNCA 1U09A 2N3OA 2E6LA 5G0RB 1TMJA 5AJ3J 2U1AA 2BYCA 4LF5J 3T6JA 4TYAA 1RACB 2A6MA 2HVEA 4DR6K 4TQRA 4OYWA 4NLBA 1WC1A 1NDKA 3J80Y 1BQMA 1O6XA 3ZZOA 5ITHA 1RTIB 3VAIA 4LRCA 4JI0J 4FOEA 4JKEA 3O1BA 3CIMA 3E01A 4B3MJ 4OZ2A 3BSCA 5BXIA 5IFMA 1HL6A 3B6OA 2BOPA 3GFHA 5CE3A 3MMBB 5T14A 5BPMA 4ZVPB 1QS4A 3F0NA 4ILJA 1N5YA 1YJTA 4DV1K 1TELA 4WBFA 3OYHA 3R6LB 4TLQA 4EEYA 4J9RA 1KD1O 1BISA 2DNKA 3KJVB 2Z56B 4NE9C 2Y1JA 2B6AA 1LK7A 3DLKB 1REVA 4KC5A 2QLBB 4K4VA 3VQQA 2C28A 1SQEA 3WNFA 3R1HA 2MPUA 4IZ9A 2P5GA 1ELOA 3P31A 1R43A 2K3IA 5M1FA 3N4PA 3N28A 4JNEA 3T1AA 3U4LA 2IRUA 1UCNA 1N36F 4O8KA 1VRUB 4AXJA 4L3NA 2M2BA 3QBCA 3I5CA 2HEKA 3TJ8A 5AQOA 4F7VA 3GILA 4DUTA 3M8WA 2LSNA 3W61A 4HR2A 4ZPDA 2W7PA 2L08A 1S99A 2MHNA 1T9WA 4EP5A 2BGGA 1LK5A 3V9WA 1Q79A 3HVWA 1C0TB 2EXUA 5HBMB 2UU9F 4ZA1A 3E66A 3GE9A 1GNKA 2BMBA 2XNRA 4YR0A 4FLVA 1FFWB 4GO5X 3H59A 1NGFA 1FA0A 3DLRA 1WSVA 4AH9A 3Q8YA 3EGNA 1X4CA 4BGAA 2HNZB 3E9PA 4JV5J 5M1QA 3FZHA 4C8YA 4RR5A 3NF8A 2WVEA 2WB1D 3D28A 4K8RA 1RQ0A 3CCSS 4M5HA 1VQ4S 3OR1A 2A42A 4J8FA 1FDBA 1TQLA 1LCUA 1WHVA 3T5HA 4OKJA 2WSEC 2A41A 3A5LC 2E6MA 3VA3A 5DQHA 2CPEA 1CC7A 4BROA 2V2VA 4X4TA 4P71A 1P8GA 3R6GB 4IG3A 2ZH2A 4KH4A 2KH9A 3KXDA 4B3OB 4JI1K 4ZIWA 3ILLA 2KG0A 1GFWB 5AQGA 3NRBA 3P6YC 1PBUA 5L9NA 3OLBA 5HK4A 1MWZA 2FTRA 4IDKB 2W4DA 3EGWB 2AEFA 1L3TA 4HYKA 2HGMA 2NXCA 4C23A 3OPKA 4RNNA 1X4EA 1WLJA 1HKAA 3WHIA 1V4SA 2I1RA 2LU2A 2YWWA 3CM5A 5AQMA 4DR3F 1F5CA 3WC2A 3PO4A 2ZJPQ 1QDUB 2WFBA 2V2ZA 1XMOF 1GEHA 1RAAB 3MCSA 5E3CA 1JNZB 3MD1A 3OFHA 4FK4A 3CDBA 3TVYA 2ZM6F 1VQLS 2OP5A 3TTDA 3D66A 3O4WA 3VV2B 5FDLA 4FPAA 3KTQA 1UW4A 3HK2A 4WQ4A 4XO0A 4NCGA 4MH8A 4USKA 2F9JA 5J1EA 2LA6A 2AQ4A 2G8UA 4BBYA 1U6FA 3MN7A 4X62F 5EY4A 2VQFK 1IG9A 4LFCJ 4M3XA 4O3RA 4DPYA 4DR6F 5KFXA 2XZTB 4DUYF 1C0UB 1Q0NA 3OHBA 3QSYB 4JI6K 5AQTA 3JTPA 4ED6A 2HHPA 3GFYA 5J2MB 2CPDA 1C1BA 4LRBA 1PC5A 3TJ9A 1LKZA 4F36A 1SL2A 4NLGA 1NEEA 2BRLA 2K7JA 3CJ3A 4A8MP 3HSGA 1M1KO 1JQGA 4KY3A 2IFXA 4AFFA 2OEMA 2MGZB 4MK9A 2V7ZA 2MQLA 3HSDA 2UUCK 1AYEA 1CJVA 4X65K 2WVFA 3G96A 2MKJA 1L3VA 1J5EJ 3ZSVA 2ZUAA 2MXYA 1W9HA 3A8EA 4B3TJ 2NSBA 1QHTA 2AZ1A 1FFGB 4FLTA 1Z4UA 1U2VA 5DO2A 5KFYA 3MCPA 3OYGA 1RTDB 1YGYA 5J2PA 1HBOB 2DNQA 3CMQA 4CO1A 2F9TA 3G10A 3DOMB 1X9MA 3C2PA 3C6UB 5C10A 4J9OA 5LSOA 1QVGR 1CS4A 3KLGA 1H2UX 5I3QA 2XYGB 3KFWX 4ZJOA 2B9YA 3MHYA 2V34A 3T1HK 3HKZD 1QZ5A 2GIQA 1GXLA 3AO3A 2R7OA 4DV0F 4DR1F 3NVMA 3IAM9 1JLCB 1NPPA 1CEZA 2IDEA 2VG6B 1QM9A 4KKOB 1X31C 2ZOMA 3D0PA 2ZJQL 2H9ZA 4TYBA 4OGCA 1Q5VA 3TZYA 4CW7B 2RRBA 2R7QA 3DOLA 4QPTA 1JXVA 1QQOA 1VMBA 2G8KA 4EYHB 3NMAA 4DI6A 3H6EA 5TKYA 2KL8A 2ALYB 4IFYB 1YI2N 1KTQA 2R8JA 2QKKA 1RTHA 1HMVB 4M5KA 3LQVA 1WWHA 3RMBA 1X4AA 4MK7A 5GAGP 4IUFA 2YX4A 3B78A 5KT3A 1U24A 4BRNA 1N5SA 4OPHA 2DCLA 4UOHA 4J2EA 4DF4A 2O8CB 2O01C 4PXCA 2M3DA 3ZLJA 1TL1A 4ED3A 1U4BA 2O1PA 1JJ2R 2AD9A 5I42B 2Q3PA 3VGMA 2WOMA 4CLPA 1M5KC 3RUBL 3LZJA 2RKIB 5CABA 3GIKA 5BR8K 2RSQA 3PVXA 1AFJA 1Y5NB 3NGIA 1IV0A 4ICLA 3NH1A 2CRLA 4CJ5A 2C2DA 4B9MA 5JVHL 4C8LA 1XNRF 4ZPCA 5BPLA 1NDCA 1Q95G 3L09A 1HWIA 1BG3A 4Y1DA 1V9OA 2J7UA 1UA0A 1ZETA 2QA4S 4M5DB 4A5AA 4ZPAA 4O0JA 3ET6B 1XNQF 1FKPB 1S5JA 4Y34A 1FVSA 1YJ9N 4FJLA 3MM8A 4H5VA 4XH5A 3UR0A 4M5GA 1FK9B 2O5DA 1E6YA 5D4PA 3VQBA 3JB9k 2GO9A 3QEXA 2CH6A 4F9OA 5DJBA 4CO5A 5SZTA 4QR0A 2HS0A 3HJFA 4QYZJ 1WHWA 1ZXOA 3P8BB 4LF4K 3ULDA 3W8GA 1TUYA 3HTVA 3VESA 2V8PA 4IR1A 3CDWA 4Y2IA 4F3MA 5KFHA 1UP1A 2E29A 2CPZA 3NGRA 2QA2A 4ED0A 4B1UB 4B9UA 1XR7A 4CZHA 2GUPA 3THYB 4WP3A 3O8WA 1K8KA 2DT9A 2BANA 3MEDB 2VFVA 4CF0A 3W66A 3IM8A 4O5BA 4Y2KA 2LEPA 4N77A 3AGKA 4G1QA 2VWBA 3UR3C 4KAIA 4KQZA 4N56A 4DPOA 3I56S 2GBZA 1IG8A 3SQGA 1QVFM 1ZC6A 2PZSA 1X7VA 3D7EO 1GX5A 4JI4K 2HNYB 4IKFA 4X65F 4CF8A 1YT3A 1VQ5S 3DMJB 4ID1A 1U1LA 1RBSA 5GAEI 4QIVA 2Z1IA 3FNNA 2YQ3A 1G4CA 2VHGA 1YTYA 3UCZP 3TA0A 2YBVA 4MMOA 2W9BA 3Q83A 2B56A 4BRGA 4NA2A 3QEPA 2DEIA 4B1XB 2GQQA 4CP5A 3O6QA 2LA4A 3GJTB 1RDCA 1HNWK 3OUYB 4LSLA 1VQ6N 3BSOA 3QICA 1QVGM 5CHCB 5GMKa 2DVIA 4YFUA 2IM1A 3OYNA 3CJAA 4LF9K 3EVOA 3RSEB 2GW8A 5L1IA 2QL5B 4GC6A 1BI4A 1KVJA 1HKGA 1FRMA 3CCUS 3CW2C 4J5OA 3DLHA 4IJNA 4N7TA 4BRDA 4HTUA 4OI1A 2OYQA 1BQXA 4Q0BB 2YKMA 4QWAA 4GC7A 3GV7B 3A12A 1D4XA 3VQTA 1RDWX 5B0AA 1U47A 3NY0A 3PDNA 2HG4A 1XN9A 4GMKA 1H3DA 2WC9A 1RA7A 3N01A 3VGSA 5T7LB 2YH1A 2YNHA 1JXBA 5A6PA 3C3LA 1PKUA 3TVKA 3U9ZA 4B9LA 4O44B 3PHTA 3H4DA 4NI2A 4FWQA 1QE1B 3G0ZA 3EE9A 2PFUA 4WWSA 1DTQA 4MJKA 4Z0UA 2V4JA 2IGIA 4IEEA 2CPIA 4PHTX 2GX8A 2D3OR 4KHPF 3THXB 1S49A 4CGDA 1N8RO 2BUNA 3ELHA 4JI2K 4XPEA 3AQOA 3V1RA 5ETSA 4DG1A 2HAIA 3JTOA 2E8AA 3VN5A 3ENQA 3K57A 4IO1A 2VF3A 4AD6A 1Q81T 2CGJA 4MKYA 3V4IA 1HPMA 1ESVA 1Z1ZA 1JJ2M 4ATNA 3UPFA 4NLSA 2H5JB 1JX4A 4ECTA 3O9QA 1DAXA 2JWLA 2C3OA 2RS2A 1CLQA 4CI0B 1TUUA 2CG8A 1C0GA 4K5RA 2A2CA 4WFNQ 3G2XA 1IR0A 3AD7C 2FVRA 1HJRA 4DU1A 2P9IA 2DHHA 5HVFA 3K5LA 2Z30B 2X6NA 3SMZA 5C2GA 2AKWB 3O3GA 4KGMA 4DU8A 2XSFA 2RQCA 3ISND 2Q1NA 3PW2A 4LREA 2J8SA 3VQ4A 1NGCA 3MWPA 2UXDK 4B3RK 1HNXF 2OIHA 3JSYA 3G4SN 3IRXA 1VQOS 3HVRA 3KWMA 1DY3A 4K43A 2JEFA 3D2EB 2HBRB 2ZHOA 1QTMA 3AVKA 2IA6A 1FDNA 2DPJA 5M1NA 3MAHA 4K4WA 3MPYA 5CCMA 5J2QB 5H9EJ 2Q2RA 3M6WA 3VA0A 4FJXA 3W9IA 2VOOA 3MEGA 5JS2A 3MR2A 3LWMA 4CFBA 1UOCA 3MR6A 3RRGA 5L38A 4JI7K 2VYPA 4CJSA 3S01A 3BGRB 1RT7A 4ZCKA 5D4NA 3NWGA 2OLWA 2KHOA 5JXSA 3PYFA 2QLXA 4LVNP 5CR4A 3IBWA 3M2VA 3AVLA 5IC6B 2ZZNA 2YKNA 1WNSA 2D74B 1DURA 2KQ2A 3X3UA 2ZH4A 1BIZA 2DNZA 3CJ1A 3G25A 1M90T 5AQKA 3BZKA 4KH1B 3M9OB 2LDIA 2RPIA 3HPGA 3P49B 1SQFA 1W26A 2AT1B 2FY8A 5A8RA 3C16A 3NE6A 4OO1J 1TL7A 3CM6A 2VBYA 2ZITA 3VETA 1TYQA 4QR2A 2P51A 2UVRA 3MWTA 3DRPB 4AM6A 3ISNC 1KDNA 1E3MA 1N36J 3LM2A 2BV3A 2CGLA 1S72N 1IKVA 1LW0A 2F7TA 2A2DA 5AQVA 1N6QB 4BC5A 1KLNA 4XPCA 2ITMA 3KUHA 4PKHA 4J2AA 2NPFA 4RWWA 1N33F 1S1XB 4CF1A 3CYMA 1IR2A 4JKHA 2UU9J 3CJ5A 5GADP 3CCJN 3WC0A 3PW4A 5CQGA 2MKIA 2ZJPL 1FKOA 2DRDA 3M8PA 3W5ZA 3T41A 2IVYA 3PRDA 2M8HA 4P74A 3IM9A 2JFDA 2YWHA 3LA0A 4UY85 4FLZA 2XO7A 2YV0X 4YDXA 4YB6A 1MN9A 4GVMA 3MUTP 1SJRA 4Z94A 2CQ4A 4NMXA 1GK8A 4LH5A 3L3UA 1VAZA 1U0HA 3GJSB 3IR5B 3BN4A 3TTFA 2IM2A 2FLNA 4FOIA 2MZTA 2NXEA 4YHHF 2CJQA 1SAZA 4ANEA 3W2WB 4K4UA 4ZP7A 5DETA 4CZCA 4E7JA 4FYXB 1HQ2A 1S7HA 1BA0A 2QYCA 2UUTA 4IXCA 1VQPN 2X7IA 1NMDA 4HHTA 3IAS9 3D54A 1UVKA 1QHAA 2ADBA 4HI1A 1SJFA 4EBDA 1Y5LB 3KK3B 1N4LA 3AO5A 3QIDA 5GAGI 1WBBA 2RT3A 1SKRA 2RMLA 2WW8A 3UN3A 2E1CA 2AGPA 1FI4A 3O5TB 1LAVA 1SQKA 4XDCA 4FXDA 3E3XA 4HL9A 5D4OA 4PRFA 2APOA 4KREA 2BQ3A 1PCAA 2LQ5A 2YH0A 4NLCA 1WG5A 1RABB 2XMMA 4DR3J 4EIAA 4GV6A 2MQQA 5DG8A 4IG0B 3OTCA 3IP0A 1XMOJ 2ADCA 1TL4A 2RD5C 4KBOA 3CCVN 2ZM6J 3VQ5A 1F9HA 2FHJA 5LXRA 3DXSX 4PG8A 3PRVA 2I0XA 4FS1A 2CJXB 4CBXA 2MZQA 4IRCA 2DIVA 1RBTA 3CCEN 1IKWA 4YS2A 2IVOA 5KFFA 1U8WA 4ECQA 4W98A 4MO5A 3I87A 3MF5A 5B09A 5SWMA 4NLQA 2E88A 1S4FA 2K7KA 1O0PA 1NM1A 4LSNB 5KG7A 3ZSYA 2V8VA 1BY9A 2PD1A 1WORA 1NDPA 4LT6A 4X62J 4JKAA 1U1RA 1K0VA 4JI7F 4DR6J 3C14B 2ZOFA 4I0WA 1R0CB 1NJXA 4DUYJ 3H90A 2ZJRQ 1ZZNA 3L2UA 3CPWR 4DL3A 1AXQA 1RXOB 1EX4A 4Q45A 1HI1A 1F0XA 4WU2A 4NZ0A 4QIFA 1XEZA 4BLGA 3VQ8A 2OA8A 3A8JA 1IKXA 5B0CA 4DV5K 2KXHA 3CQYA 2VZ9A 1E6VB 3AA5X 3S3OA 4JD2A 5U47A 1R59O 4KHUA 3DYAB 3PZPA 1UVJA 5BRFA 2CPFA 2FLOA 3AHPA 4X4RA 7FD1A 5HQMA 1EIYB 2C1EB 1HWLA 4FWPA 1JKHB 1YDLA 4GRSA 4KHQA 3HPHA 4CZIA 3NMUA 5J2NB 3UI3A 4KO0A 1Y0HA 5EWGA 1RE1B 4CJUA 5DDQC 4BRIA 1T11A 4C98A 2DRAA 1IQTA 3TAEA 3EZOA 5E33A 4HACA 4DTPA 2N7CA 3NCIA 4C97A 3ZXWA 3EPIA 3M2UB 4ZCLA 1A7GE 4EFAC 2ASOA 4MT1A 1HBNB 2RN2A 1RBVA 1OH6A 2BBEA 4IR9A 4DV0J 4DR1J 3K59A 3MM5A 1R0BG 4URQU 3K8WA 4Z7YA 2M8DB 4CO2A 3KHLA 3FKBA 5B08A 3GFZA 4H0PA 1ZAXA 2KYZA 5JUMA 3UD3P 5KTQA 3IGVA 1YKWA 4NLPA 1KLMB 3TSQA 2OD4A 3VQPA 1RT5B 3OVBA 3I33A 2CIMA 4PXBA 2YNGB 2NXNA 1WSRA 4U7CA 4JI3K 4BE2A 5BRHA 4F3QA 4R0JA 1HD1A 3S8SA 4RUCA 1N5VA 2HFNA 2F8TA 3SJJA 4BG8A 1JLQA 2F9DA 2OZMA 3PW5A 1M5OC 1TL3B 4O55A 5GIOA 1O51A 2Q0UA 3M2RB 3MCNA 5M1KA 4B9SA 1YZ7A 4AHVA 1VQKN 2CAJA 2ETJA 4DV6K 3KKSA 1S4EA 4LBIA 1HHTP 4B17A 4JKGA 1NZ8A 3UN5A 4WIQA 3MXJA 3C0BA 4Y3CA 2J0XA 5DS7A 4BY9C 5T7BA 1UWBA 2NSCA 4OV1A 4LF8K 1Z2LA 1C4CA 1ZM3A 4MIBA 5CZVA 3TUPA 2EK6A 3BQ0A 4ZN1A 2Q6CA 5E3AA 4CGGA 1K8AT 1YTAA 4CZKA 4MKBA 1UJ6A 4RBTA 1KXPA 1RU2A 1BHNA 2WAQD 1IBLF 1MWKA 4DV3F 1XTZA 2E5HA 4C7QA 3GSDA 4BRQA 3CCLN 5DDPC 4M1KA 1QJHA 2D9OA 4EBCA 3BS9A 1ASVA 1RDUA 1XNRJ 1PILA 1TP7A 4O8UA 5C25B 4N41A 4Z2XA 4DTUA 1SS6A 4C