3DOKA

Crystal structure of k103n mutant hiv-1 reverse transcriptase in complex with gw678248.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
539
structure length
535
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 143
structure length 535
sequence length 539
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dokA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dokA05
3K5NA 3HVAA 3OHBA 1RT1A 4QWDA 4MKBA 2R7YA 2JC0A 3H08A 3H2LA 4J2BA 4IH7A 2HNYB 4FCYA 4R8UA 4Z4CA 5C24A 4O3QA 3MR5A 1TK0A 1D9DA 4KE5A 1QTMA 4Z0UA 3OS1A 4W5RA 3BSNA 2I1RA 2IC3B 4DTNA 4ED1A 5HRSA 1RYRA 3RAXA 1ZBUA 4NLQA 1ITGA 3OJUA 3QEPA 3C95A 1L3UA 4ECZA 2XRIA 3ITHA 2Z1IA 3LAKA 1S1VA 4Q8FA 4I2QB 4C8LA 4H4MA 3TQ1A 4IR9A 4CFBA 3M8RA 3TAEA 3ALYA 3AV9A 2QXFA 4QPXA 3DLGB 2R8KA 4MK8A 4CJVA 1QSLA 4LY7A 1HMVA 3U3GA 5CYMA 3L3UA 4CF1A 4NLVA 1HARA 4OKEA 3V1RA 1WAFA 3IS9A 1FK9B 4NLDA 3B6PA 3PZPA 3VQEA 3D28A 4TQSA 2OPQA 3BGRB 3CVKA 1TKZB 4M94A 3AVGA 3SUQA 4RNHA 4K4SA 3K59A 1JLBA 2AGOA 4CFCA 2RKIB 2YNGB 1BIUA 3GQCA 1ZBHA 3DM2B 1WSIA 5CZ2A 1NJXA 3OYHA 4ED0A 4O44A 2QK9A 3LALA 2HVHA 3WNEA 3L2VA 4DTJA 5KFRA 3KHRA 4EZ6A 4LSNB 2FBVA 3CO9A 1B9DA 2VG6B 1JKHA 4RW7B 2WRMA 4QWEA 4IRCA 1RTHA 3MFHA 3SZ2A 3SV4A 2UVRA 4CK2A 3NF6A 4DMNA 1S0MA 2ITGA 2B4JA 4N47A 3DI6A 1C0UA 5KRTA 3MR2A 4R5PB 3BREA 3IG1B 4FW2A 4J9SA 3L2RA 4EYHB 3VQ6A 3GV5B 5KG4A 4FLWA 1VSDA 2QKKA 4CGGA 2BDPA 5KT2A 1MU2A 3EYZA 4K8XA 4CJQA 4K4YA 3OHAA 1S9GB 4DSEA 1KVBA 4FK2A 4EEYA 1ZYQA 4E89A 3PW5A 4ED3A 3OLBA 4ZP9A 3Q8PB 4OJRA 4R5PA 3O4NA 2KTQA 3QO9A 1J5OA 4RNOA 3KIOA 4BWJA 5KFJA 3CJ2A 5D3GA 4ED8A 3V81B 4YR3A 3KK2B 4M45A 1JLAA 4J9QA 2J6SA 2JGUA 4M42A 3EPGA 4B9VA 4LH5A 5L1IA 3NDKA 1XHXA 1U45A 2Z1HA 3Q8QB 3VQ9A 3NGZA 4JV0A 3RR8A 3QYYA 5EWFA 3OS2A 1Z4UA 4O55A 4CJ5A 3ZCMA 4FJ9A 4TLRA 3GYNA 3H5XA 4IKAA 4JS4A 3OYMA 5FRNA 2D0BA 4FXDA 3CDWA 1KCFA 3DM2A 3ZSRA 1S9EA 4H4MB 4URSA 1K6YA 2XGPA 3I0RB 1S1VB 3A2FA 3IGNA 3HVTA 3ZSQA 4NZ0A 3AA2A 3E01A 4CFDA 3TARA 5HROB 3AVFA 4CJTA 3IN5A 3BGRA 2OPQB 3KNAA 2YHAA 1CLQA 3TANA 3IS9B 1I6JA 3LPUA 2HWIA 1WSEA 2KW4A 5E41A 3OL9A 1TL1A 3FDSA 3T1AA 3LZIA 4CJ4A 1HPZB 3C94A 3KD1E 3DLGA 3DLEB 2RN2A 3KK1B 1C1BA 3G6VA 3QETA 4CHOA 1S6PA 4DFPA 4F3OA 2AU0A 4IFVB 1DLOA 3QESA 3VQSA 4ZHRA 4FJIA 4KRFA 3CWJA 3VA0A 4JS5A 2Z1JA 3QINA 3PY8A 3O4QA 4NRTA 4UQGA 4DSLA 1ASUA 4IG3A 5EU7A 4HHTA 4YMEA 3GIMA 4NCGB 2G8IA 3MTKA 2PYLA 1LW2A 5JUMA 2G8UA 1VSEA 2DTUA 1VSMA 1WSGA 4MIAA 3THVA 2OPRB 1MU2B 1RT3B 1K1SA 2IGIA 5I3UA 5I42B 2FVCA 4E7JA 1JLQA 2IA6A 4HUGA 1IG9A 4OLBA 2EC0A 1KVAA 3CFPA 1U47A 1C0UB 1LW0A 2OZSA 1EX4A 1FKPA 4EO6A 1RT2B 2OPSB 3LP1A 2IM0A 5KFPA 4ZPDA 2YNIB 3HM9A 3KK1A 4BWMA 2DFFA 1NK9A 1RCHA 3HYFA 5DGAA 4FS2A 3LANA 4R0EA 3NF9A 4J9MA 4FLXA 3PV8A 5HRPA 3E01B 4F4ZA 2YNIA 1BQNB 3WNHA 4NLPA 1A5VA 4DU3A 4Y3CA 3LP1B 2WB4A 2FJWA 3LPTA 4CJRA 2XY7A 3PW4A 1RDDA 4RW4B 2D41A 3OYAA 1GOCA 3PX4A 3RMCA 3S9HA 3RAQA 4DSKA 1FKOB 2B6AB 1JLQB 4RW4A 3PX0A 3FSIA 3SJJA 4MQ3A 5KFFA 1BQNA 2X78A 1XWLA 2CJQA 1J9AA 1WLJA 4EYIB 2ZKUA 5DG7A 1XR5A 3CM6A 4ZP7A 1TV6A 4PWDA 2QE5A 3DMJB 3FFIA 4I7FA 1JLAB 1IKVA 3LWLA 2P5GA 4ECUA 2HHUA 1HYSA 3RRGA 4DL5A 1KHVA 3GIKA 3RMDA 1CXQA 4ZPCA 1UAXA 3AO5A 1RDRA 1C1CA 3CIZA 5CZ1A 1RT5A 3MR3A 3AVHA 2XCAA 1TP7A 4F4XA 4ZVEA 3DYAA 1Z26A 4CHNA 3RB3A 3WNGA 4RNMA 4CGFA 4K4ZA 1Q9XA 4ELUA 1LW2B 2OH2A 3TABA 3RR7A 4FJHA 4M3UA 1LV5A 3GV7B 4DTRA 1I39A 3I0RA 1NHVA 1C0TB 5FDLB 4YFUA 4B9LA 1CZBA 4ICLB 3VQ4A 5KFXA 1T7PA 4HCCA 2VG7A 2BANA 3TAPA 1NK4A 1WNSA 3PUFA 3ZSOA 2GBZA 3QEVA 3BJYA 2RF2B 4MFBB 2VWJA 5EWGA 3H4BA 1NOZA 4ZTFA 1C1BB 5J1EA 5HLFA 2VWKA 4CJUA 2YNFA 2DFEA 3VQ5A 1SL2A 1LWFA 1BCOA 2V9WA 4CK3A 4CEEA 4TY8B 1TKXB 1WSFA 3ISNC 3CDUA 4MKAA 1JX4A 1RTIA 4HTUA 4MK7A 4F8RA 3QGGA 2P1JA 1TKDA 3NGDA 4ZPAA 4FM1A 2IAJA 5KFOA 2JEIA 3HL8A 1RTIB 4CJ3A 1W25A 4KHYA 4ZP6A 4EBCA 4B3OB 1D5AA 1BQMB 1D1UA 4KBIA 3OL6A 4J2EA 4KV8A 1TAUA 4FW1A 4LH4A 4XPEA 1EP4B 3RB4A 3T5JA 3IRXA 2XHBA 3MEDA 1BI4B 3V9SA 5KFEA 2BQUA 1VSFA 4AHRA 1RNHA 3K5LA 5HRNA 4URQU 1JLEA 3VQAA 4FLVA 4DQIA 3MEGB 3KLEA 2ILZA 4F3TA 2A1RA 5EUHA 4FZXC 3KK2A 2XY6A 4M3TA 1TKTA 3V81A 4EP4A 4QWCA 3LP2B 4RW6A 5DQIA 3LDSA 1N48A 2KQ2A 1RBRA 3S3OA 2WONB 1NK5A 1HYZA 2FLNA 3I8DA 4IH6A 4O3PA 4DL7A 4Q8EA 1S9GA 4LQ9A 4E19A 4O3SA 3K57A 4RNFA 1LAVA 4Z4EA 4KHWA 3QIOA 2WONA 4G1QA 4F4YA 4BE1A 5DG9A 5KT6A 3V1OA 3AVIA 1RT1B 4KKOB 1HYVA 2YKMA 4NYZA 3ZSWA 1T03B 2IOCA 2W9AA 1O1WA 5KG7A 4FJJA 4YQWA 3HKWA 2JC1A 3QLHB 3JSMA 3GIIA 3NF7A 3LWMA 4CF0A 1TK5A 1TKZA 5JS2A 2GC8A 3ICLA 1EKEA 2RDJA 4Q43A 3AO2A 2ZD1B 1IO2A 4ZPBA 4IOBA 3KHHA 1VK0A 1JLGB 1QSSA 3KLGA 4Z4HA 3E51A 4YR0A 4CJLA 3V6JA 4J9OA 4FJKA 2YNHB 4ED6A 1TL3B 2XY5A 1SL0A 3NFAA 1RT2A 4DF8A 3OYGA 1KFSA 4RG8A 1T94A 1KLMB 1KTQA 3CM5A 3IAYA 3CJ3A 4KFBB 4OLAA 3PW7A 4WZMA 5CY4A 5CYQB 1SH3A 2UVUA 4C8OA 3BQ1A 3PJXA 5HBMA 5KFMA 3HO1A 3QLHA 2XY8A 3QEXA 2OPSA 1ZTWA 4NCGA 1WSJA 3ZT1A 3MXMA 4KO0B 3PR5B 3WNFA 4KHQA 1HQUA 4URGA 5KT4A 3K5OA 2Y1JA 4E3SA 3G6XA 5I3UB 2D5RA 5KFAA 5J2MB 2OPRA 1SUQA 2C2DA 4FLZA 1VSJA 3JYTA 2A1SA 4QW9A 1UOCA 4NLRA 5C42B 4KB1A 4TN2A 3SUOA 4FM2A 1S1TB 1R0AB 2F96A 4HVJA 1TL1B 4ZP8A 4E7LA 1C1AA 3AVCA 2R8HA 4DQSA 3LP0B 5F8JA 2P51A 3F9KA 4KPYA 3DRSA 5L1LA 2IS3A 2V0NA 1JXEA 3AVLA 1C1CB 1VSHA 4JUZA 3HVTB 4K4WA 1TKTB 3I0SA 5KFHA 2ZQBA 3OLAA 4DTUA 4FBUA 3OL7A 2O4IA 3DLHA 5DQGA 4YR2A 1F21A 1REVB 4TSXA 1JLEB 4CHYA 3OJSA 1TV6B 4QW8A 1SH0A 3K58A 2I5JA 3HXMA 4F4KA 1B92A 4OPKA 1QUVA 2YV0X 5C25B 4DU4A 5CYQA 4AHVA 3OSNA 5T14A 2NUBA 2JLEA 4KFBA 1S1WA 3MAQA 4B8AB 2XO7A 2W7OA 1X1PA 3VQDA 3VQQA 1HNVB 1RA6A 4Q45A 4JRQA 1VSKA 5KT5A 3CYMA 5KFKA 1Q9YA 4CK1A 3RTVA 4NLGA 1TVRB 3TAGA 2G8WA 3O3GA 2R2TA 2HMIA 4KAZA 3DOLA 4I2PA 4CIEA 3NAHA 1RBVA 1ZBIA 3V6DB 1LWFB 4NRUA 2ZD1A 4TY9A 2E9TA 2R2RA 1IKWB 4HKQA 2C22A 3DOKA 4GC7A 3NE6A 3JSMB 2YNHA 3OL8A 2VA3A 4KTZA 2FVSA 1LAWA 4DU1A 4DLEA 1BCMA 1VRUA 4FJNA 2IM1A 3P5JA 4ECYA 4QAGA 3AVMA 5KFVA 2F8TA 4MIBA 1RTDA 4QOZB 5J2NA 1S1UA 3QIPB 2D3ZA 5JS1A 5F8NA 4FJ5A 4ID5A 3K5MA 4JRPA 4DFMA 1RTHB 1S1XA 1UWBB 4NLTA 4CJSA 4CF2A 1JKHB 4NYNA 4DL3A 3NAIA 3IGVA 2E9RX 4JLHA 4DTOA 2UVVA 1HQEA 4PY5A 2D0AA 3UDLA 4IH5A 4KHMA 4CHQA 5DG8A 4ZHRB 4IR1A 4WXOA 4H54A 4AHSA 1K1QA 4Y2CA 5L1KA 4WXWA 3DOKB 4E1NA 1RILA 5K14A 3CG7A 3I5BA 3L2WA 3B6OA 2B5JA 1S1XB 3H5UA 4RW7A 1S97A 1XC9A 2E4LA 2G8KA 4IFYB 2E6MA 4PQUA 1RT6A 4H4OB 2C2RA 3KOAA 3NHGA 4DSFA 2DY4A 3LP2A 4RW6B 3NH1A 1BIZA 3V4IB 1S49A 2AX1A 2XGQA 2C28A 3NH2A 4O3NA 3MEGA 4O3OA 1J53A 3QGHA 3P1GA 2E9ZA 1Y97A 3V9WA 4PUOB 4Z4GA 2ALZA 5J2PB 3V9XA 3IRXB 3HJFA 4I9QA 1S6QA 1GX6A 3V6DA 4CERA 1GX5A 4Q44A 2B5JB 2PYJA 1EETB 1NKBA 4N76A 4ED7A 3D5MA 4O4GB 1TVRA 1BHLA 4CFAA 3MEEB 1CSJA 1TK8A 5KFDA 2KZZA 2RF2A 4MFBA 4BDZA 4M3RA 4RW9B 3TWHA 3PX6A 3KLHA 4TYBA 3LP0A 4DL4A 5FDLA 4OKJA 3OYCA 4U7CA 5C25A 2KFNA 4CECA 4EBEA 3RBDA 1RDCA 4ID5B 3BR9A 3M8PB 1RT4B 4CIGA 4CCHA 1W9HA 4AHUA 3H5YA 3HP9A 3KKRA 3PO5A 3OYJA 4KI6A 1RT5B 4HCBA 4NLSA 2IM3A 2XI2A 1RAJA 1JL2A 2YKNB 3TAQA 2YHBA 4RW9A 2HNDA 4FZZA 3KHLA 1DLOB 1X9SA 3AA4A 3SPYA 1G15A 1HYSB 3MXIA 3RB0A 1HJRA 5F8MA 3S3MA 3KD5E 3OYBA 4K4XA 2C2EA 4W5QA 5KFLA 2OZMA 1S1TA 1R0AA 3VQBA 5KFZA 3QERA 2WK4A 2XC9A 4ECTA 2DPJA 1IKXB 4FJ7A 3KJVA 2G8HA 5KFGA 2FBTA 1SV5A 1B9FA 3CFOA 2IDOA 2OPPB 3OSPA 2XWYA 3KK3A 1KSPA 4CJPA 1N6QA 1U49A 3VQ7A 4Q0BA 2HHVA 2D0CA 4DTXA 3CFRA 4KO0A 4O0IA 1RDAA 1YVUA 2W9BA 4K8ZA 2Q3SA 3LP3A 1RYSA 3PW0A 3NMAA 5F8GA 4N56A 5L9XA 3HT3A 3KLIB 4JV2A 4AILC 4RNNA 1SV5B 4M3YA 1NKEA 1D0EA 2D3UA 2BRLA 4CF9A 3EZUA 3RMAA 1TQLA 1QE1A 3GIJA 1YT3A 4DTPA 5K14B 1HMVB 1REVA 1L3TA 2YKMB 1QAIA 5C5JA 1SKRA 3HPHA 1KLNA 4IKFA 4DS5A 3I0SB 5KRSA 3ZSYA 4I2QA 1TL3A 4IG0B 4KTQA 3ITHB 4KREA 2UVWA 3SNNA 3SI6A 1NK7A 1HNIA 4DSJA 2KFZA 1W0HA 4ECXA 4CJFA 3LZJA 2ASDA 4W5TA 3HVWA 1Z25A 4BE2A 4B08A 2G8VA 4KHSA 4ZVFA 1MMLA 3C6UA 2HHSA 3SUPA 3JYTB 4JV1A 4CGDA 2BE2A 1N5YA 4KHRA 4CEFA 1VRTA 2HWHA 1D9FA 2GV9A 3KLFA 4J9KA 3SFGA 2FVPA 2YKNA 3AVJA 3NBPA 3BSCA 3AVKA 3H40A 1BISA 2QKBA 4EP5A 4G1QB 4I9LA 5HRRA 1RBSA 3MEEA 1LWEB 3M8PA 1TAQA 5KG2A 1XI1A 1LWCB 1IKWA 3M9NB 3OYEA 2FVQA 1JLFA 2RDIA 3CJ5A 4DQRA 4ECRA 3AO1A 2IM2A 3ISND 4AHTA 2R8IA 1CZ9A 3ZSZA 4IG3B 4RUCA 1ASVA 3TI0A 2W8KA 2AWZA 3V6HA 4NLWA 5J2PA 1HNIB 3S3NA 3NGIA 4C8KA 5L1JA 3TAFA 4IFVA 3QZ8A 4DFJA 4PA1A 4RZRA 3QEWA 1S6PB 4M3WA 4GMJB 3EZ5A 2F8SA 1RDBA 4B9SA 1TKXA 3V4IA 5F9LA 4IRDA 1RT7B 3VQPA 2RKIA 2YNGA 3SV3A 1JLBB 1UA1A 5KG1A 3BQ2A 4K4VA 4DFKA 1WAJA 3DRPA 3T5LA 2JEFA 2X6SA 2YNFB 4NLYA 3AA5X 3OYKA 4ZTJA 2O5DA 3VQCA 3SPZA 3RB6A 3KTQA 5DGBA 2GIQA 1Q8IA 3OYNA 2KZMA 1RT7A 2W9BB 4NYFA 4F2RA 2FJXA 4EBDA 3M9MB 4CF8A 5SWMA 3LAMA 2QV6A 1TGOA 1IKYB 1L5UA 2BGGA 3L3VA 4Q0BB 4Y34A 2IAJB 3QNNA 1N6QB 3BQ0A 5HP1B 5D3GB 3O3HA 4DEZA 3BSOA 3H59A 3M8SA 3QZ7A 1RT6B 2OPPA 4H4OA 4CHZA 5KGWA 1JXBA 4IFYA 1QQCA 4FJ8A 4TY8A 2AX0A 1S48A 1T05B 2IC3A 4NLUA 1C0MA 1T05A 2V4QA 2FJVA 3V1QA 1LWCA 1U09A 3ZT3A 3GILA 5FROA 4Z4FA 1YTUA 3PW2A 3V6KA 2OYQA 4QCLA 4ED2A 3G10A 1L3VA 5KT3A 1J5OB 2Z1GA 4FVMA 4ZVHA 3NBPB 5DQHA 4CIFA 4HUEA 3KLFB 4CJKA 2HHXA 1VRTB 4PWDB 1DTTA 3HPGA 3KHGA 1JLCA 2R2SA 2VG5A 5KFQA 2XCPA 3Q8RB 1WSHA 3AO3A 2Y1IA 2R2UA 4XPCA 2IBKA 2W42A 2XI3A 3AVNA 1BI4A 3OYIA 1RA7A 2ATLA 3EY1A 3MR6A 4L8RB 2R8GA 3MXJA 2DPIA 4NCBA 3KLHB 5KI6A 3TR8A 4NCAA 4MH8A 4WFZA 3AVAA 3OS0A 4XIUA 4FJLA 1J54A 3NAEA 4O3RA 5F8LA 3FRZA 3BDPA 4O4GA 4CGHA 4B9NA 3KMQA 3DMJA 3FFIB 1EETA 1QS4A 4DWIA 3UQSA 2F8EX 3FQLA 2FC0A 4I2PB 1S6QB 2BQRA 1S5JA 3VQ8A 1JLFB 4GVMA 5J1EB 5HLFB 1LWEA 1FK9A 3DRPB 4O44B 5KFWA 2AQ4A 5CYMB 2HAIA 1T03A 3N6NA 4FJGA 2ZE2B 2HB5A 4KI4A 1X9WA 2AJQA 1HNVA 1WNEA 2VG7B 4M95A 1C2PA 4ZVGA 2BQ3A 1NK0A 3G6YA 5DMRA 2ILYA 1RT3A 1RTJB 3SQ2A 1SL1A 3RBEA 3NL0A 4RW8A 3HSTB 1NNDA 1SH2A 2FLPA 4M3ZA 5EWEA 3KJVB 3P83D 1IKXA 4MK9A 4FYDA 1XHZA 2WOMA 3F73A 1S9FA 5KG5A 2JEJA 1SUQB 4GW6A 4RW8B 1FXXA 5KG0A 4DTSA 3O3FA 4ECSA 2W7PA 3ZSVA 3MFIA 5J2MA 5KG6A 2FBYA 4Y1CA 4J9RA 5KFYA 2HNDB 1EXQA 3NGYA 1S4FA 3QEIA 4WYWA 3DLEA 1BGXT 4KHNA 5F9NA 1ZETA 2WOMB 3BSAA 1A5XA 5I42A 5DLFA 4ELVA 1KVCA 3G86A 4DL2A 1QE1B 2PY5A 3T5HA 4E0DA 5HBMB 3MEDB 2J6UA 3RRHA 2AGPA 1DTQA 1S1UB 3QIPA 3KLIA 2DFHA 5KFNA 2HNYA 4CEAA 1NJWA 4RU9A 1NK6A 4DQPA 1XR6A 3SQ1A 4NLXA 1RBUA 2W9CA 3EPIA 4H8KA 1FKOA 1KLMA 4W5OA 4F4WA 3RMBA 4IRKA 3U3YA 2CKWA 3DRRA 3V9UA 2ASJA 3M8QA 4ID1A 4CEOA 2D7SA 1NKCA 3MECA 1UA0A 4E7IA 3L2QA 3HPOA 4F2SA 2ETJA 3CDEA 4KAIA 3L2UA 4ECWA 3KLVA 4BDYA 5EDWA 2AGQA 4NLOA 3ZT0A 4J9PA 3DOLB 1ZTTA 4PUOA 4IDKA 1T8EA 3SI8A 2E6LA 3PHEA 3QNOA 3D0PA 3AA3A 2HNZA 1N56A 4ICLA 5KFIA 1JLGA 3H98A 4FLUA 4KKOA 1C0TA 2W9CB 4Y2AA 3VA3A 4O5BA 2WTFA 5SZTA 3OVNA 4ELTA 1ZBLA 2R8JA 1BL3A 4E1MA 4PQUB 4CE9A 3KKSA 3DYAB 5KFTA 1ASWA 4YP3A 4FLYA 4KSEB 4WFYA 1JLCB 4WE1B 3I5AA 5KT7A 1QHTA 1QAJA 2GIRA 4DL6A 3ZT4A 3IG1A 5JXSA 4BACA 4OPJA 3PO4A 2OA8A 3OY9A 4FK0A 4CGJA 4DG1B 3DLKA 3DLKB 2HW3A 4DG1A 3SQ4A 3H4DA 4K4UA 4I7FB 3AO4A 4OGEA 3ZSXA 4FJXA 3KLEB 3TVKA 4QWAA 1HPZA 1RBTA 4QWBA 1U4BA 3KMSA 1A5WA 2EX3A 5C42A 4B8CA 3QGIA 1RT4A 4OL8A 5J2NB 4K4TA 1RTDB 2IJFA 4CJEA 1RTJA 4J9NA 3ZT2A 1JXLA 4ECQA 5HP1A 4CEQA 3L8BA 3CJ0A 4J2DA 2GUIA 1VRUB 2B6AA 4Y1DA 1IKYA 4GC6A 2BRKA 2WCXA 3I5CA 2X6NA 3DI6B 3DDKA 4FS1A 2W8LA 3SQ0A 2ZE2A 4FM0A 5J2QA 3K2PA 5T7BA 4E7KA 4IDKB 2J6TA 3C6TB 1T3NA 2ATQA 1NHUA 4N5SA 4M41A 1NJZA 3OYFA 4U6PA 4TXSA 2UUTA 3UIQA 1C6VA 3U6FA 3HVRA 3T19A 2VG6A 4O4RA 5KFUA 3DLBA 4CEDA 3TAMA 4B9MA 1QSYA 2FBXA 3MECB 3UPFA 3C6TA 4DF4A 4M3XA 1D8YA 1SKSA 3CQ8A 1LW0B 5KGXA 1KRPA 4CGIA 3SUNA 3QO9B 4Z4IA 3FQKA 3KLGB 3ULDA 3TAMB 2HHQA 4C8MA 5DK5A 4J2AA 4CESA 1UWBA 3NKYA 4FBTA 3OYLA 2BE2B 1N5YB 4B9UA 3PJWA 4AHCA 2FLLA 5C24B 4C8NA 4HUFA 4XO0A 3PR4A 1OS5A 1I3AA 1VSIA 1ZBFA 4CEZA 5J2QB 3N6MA 4HYKA 4YNQA 4FK4A 4TQRA 2ASLA 2BANB 4FZYA 3SYZA 3HK2A 2O4GA 4G3IA 4KTWA 5KFCA 3OYDA 4IG0A 1GOAA 2HVIA 2LSNA 2V4RA 4WZQA 4W5NA 4ZMMA 3DRSB 1JL1A 2B43A 1HQEB 3C6UB 1IM4A 3RWUA 2X74A 5DLGA 4OGCA 1S0NA 3ASMA 3N6LA 3T5KA 1CXUA 2JEGA 3AVBA 4EO8A 4IQXA 1NK8A 4LSNA 3MF5A 3H5SA 5HROA 4CEBA 1JIHA 4TYAA 4LD0A 4DS4A 4WFXA 2HHWA 1L3SA 1SKWA 3PVXA 4KB7A 1N4LA 3HHKA 1S9EB 4DQQA 4J9LA 1IKVB 4LSLA 2G8FA 1HQUB 2EHGA 5KG3A 4RUAA 4LQ3A 3VN5A 4WE1A 1VSLA 4BDPA 4EZ9A 2HNZB 3UR0A 4CHPA 5KFSA 4Q5VA 4E7HA 3D45A 4CJWA 2WHOA 4KB0A 2RPIA 4KHUA 1YTAA 1U04A 1GOBA 4AH9A 1S0OA 3G0ZA 3V9ZA 1S10A 1EP4A 3NF8A 4DTMA 3T3FA 4O0JA 1X9MA 1IH7A 4FJMA 3HP6A 4OKKA 4KV8B 4LSLB 2HMIB 1BQMA 2BR0A 4B3OA 2PZSA 4OVLA 2HHTA 1XR7A 1WN7A 2IJNA 2UUWA 3KK3B 5KTQA 4FLTA 4DLGA 1KFDA 2P5OA 1NOYA 3DRRB 4WYLA 4IBNA 3QIDA 3SCXA 3NCIA 2IMWP 4X2BA 1HRHA 5FRMA 1S1WB 5F8IA 2FVRA 3DLRA 1KHWA 4ECVA 3SFUA 3GV8B 1DTQB 4K50A 1U48A 3Q8SB 5F8HA 4BE0A 2VA2A 3M9OB 3NH0A 2I5JB 4R8UB 2VG5B 3M8QB 4F50A 1NJYA 4N41A 1DTTB 1FKPB 1YVFA 3CJ4A 5KFBA 4B9TA 4DSIA
chains in the Genus database with same CATH superfamily
3K5NA 1RT1A 5F0UA 4QWDA 1ACMB 4A5AA 4ANCA 4IH7A 1CS4B 1QTNB 3IBFB 3DFEA 4X62F 3RBXA 2VF3A 4FCYA 4UUXA 4Z4CA 1FT8A 2WSCC 2G0IA 3NGRA 2HS0A 4Z0UA 4RBTA 5A76A 3BSNA 5C7PA 3HSZA 4DTNA 1RYRA 1XMBA 5JVGL 3RAXA 3IP0A 1QAYA 3OJUA 1L3UA 2I0XA 3LAKA 1S1VA 4Q8FA 4EAHD 2HQDA 1VQ8S 3A5OC 4JI8K 3U3GA 1EWQA 1YF5L 5D8HB 3L3UA 4CF1A 3V1RA 1RLDA 1N34F 3C15A 1FK9B 3TX0A 4Q7AA 3B6PA 3DJCA 3SDEA 3BGRB 1FD2A 2QL5B 3SUQA 4RNHA 5HMWA 1GLAG 2RKIB 4U8YA 4M7YA 1CJUB 4EIAA 1WSIA 5AQUA 1KKHA 2XNQA 3M7VA 1TYQB 1WSVA 3MM9B 3VAJA 2QK9A 3LALA 2LKZA 2A41A 4DTJA 2OFGX 1XQSC 1FRJA 4LSNB 2QRRA 1MN9A 2VG6B 3P8BB 3HZ6A 2Q2RA 4QWEA 2M8HA 4HTLA 4PABA 1RTHA 1EB0A 3HBTA 3SV4A 1NNEA 3B82A 4CK2A 4KGZB 1UFLA 1HA1A 3E3XA 2RQCA 2DBBA 2AJ2A 2ZEJA 1QJHA 1L3KA 3LDOA 2ITGA 2NRRA 3TEGA 4ER8A 3FC9A 4OV1A 2N3OA 1C0UA 3MR2A 3KG1A 2LA6A 4J9SA 2OEJA 2Q66A 2Y0SD 3VQ6A 3GV5B 2YX4A 4FLWA 1FJGK 1VSDA 2MQQA 3CCMN 4NYOA 4K0KJ 3W5YA 4FK2A 3I33A 3OLBA 4TLQA 1EX8A 1B0PA 3O4NA 3FGUA 2DCLA 3Q7BA 2YWGA 2RS8A 3Q2TC 2I7PA 4RNOA 4BGBA 3W9HA 1WC4A 5KFJA 1V3SA 1O6XA 2HBJA 5FJ4A 4J9QA 2G1DA 4M42A 4I69A 3EPGA 4IO1A 2BE9B 2KM8B 1I94F 5B0AA 1XHXA 1UEKA 4QIVA 3T9NA 4AYBD 4J90A 2OMLA 4JV0A 2Z2MA 5EWFA 2PMHA 5ADXH 2XS2A 1RZMA 3GCWP 1BWFO 4O55A 3ZCMA 5BR8J 2PIIA 1Y7PA 2MKCA 2NPFA 1N32J 2Y1RI 1R27B 2XO6A 2CQHA 3VGMA 1NH7A 4B3TK 4KGVB 3HHLA 1VQ8N 1N5SA 4WQ4C 2CH5A 2YHAA 3TANA 2P9IB 3IS9B 2W2PP 1WSEA 2I9SA 4PXEA 3M30B 3OL9A 5E2QA 4RUBA 1KNZA 3T1AA 3KZBA 2D3O1 3GG0A 2OJ3A 4BROA 2RN2A 4P72A 5LL6d 3QETA 1G2EA 1W7AA 5IV3A 4JKCA 2Z8QA 3VQSA 3CHWA 4FJIA 3CWJA 4QOTA 4JS5A 4DX5A 3PY8A 2DRAA 4A8YA 3QJJA 4YOEA 1FVSA 1HI1A 2EXUA 2W01A 4FPIA 4NCGB 5D15A 4H0OA 3C14A 1HKBA 1LW2A 5JUMA 1XK8A 2G8UA 1VSMA 2CPEA 4MIAA 2WVBA 2FVCA 4E7JA 4BRMA 1IG9A 4PAAA 4MAKA 3DOMA 4AFFA 1U47A 3A8JA 4CLLA 2DNGA 1FKPA 4EO6A 5B09A 1KAXA 2OPSB 1OQ3A 4ZPDA 3HM9A 2KU7A 2BYCA 4BWMA 2DFFA 1SB6A 1UJ5A 2UXBJ 1JJ2R 4FS2A 3KWGA 4CI6A 2FGOA 3M6XA 4BRLA 1IBLJ 4UQTA 1LNQA 4LFCJ 4J9MA 1X7VA 4JI0J 2CJ9A 3E01B 2YNIA 2IPOB 2OMOA 3LP1B 2XY7A 2GZOA 2D41A 4LF8F 4ZCIA 3NVMA 2KXNB 4USWA 3S9HA 4DSKA 1FKOB 1T9UA 1JLQB 1NH8A 2C3OA 4YHHF 3FSIA 2O8CA 4QIEA 4CZGA 1B64A 4BR7A 2HVDA 2DRDA 4PG8A 1WLJA 1V4SA 3C0BA 4LF5J 4EYIB 3CQXA 1E6YA 4PKHA 1WACA 1XR5A 4DV3F 3DMJB 1BE4A 1P1TA 1WF1A 1WG4A 1FTCA 5BPMA 3OR2A 3VVTA 2HHUA 4DL5A 3CJ8A 4HT5A 1UAXA 3U9ZA 4K5SA 1TUWA 3CJAA 4NWBA 1LK7A 2MYFA 1FCAA 3IR6B 1XNRK 4FYXB 2HFZA 1RJJA 3VZIA 1U1QA 3MN7A 3UCGA 2ASPA 3F0NA 3P39A 1TP7A 3NGUA 1JJ4A 1UVIA 1PC5A 3J7Z5 4ZVEA 2KG0A 3HHLD 4DR5F 3BF3A 1Q9XA 4C48A 4ELUA 4NA2A 2PI4A 3R5CA 3GV7B 4CLTA 1RHRB 4PL7A 1NHVA 4ZCKA 1CZBA 3JSRA 4AL7A 3VERA 2JOQA 1NK4A 4MFBB 5A2QU 4JKGB 1WWHA 5AQKA 4L3QA 4ZTFA 4F9OA 4LF6J 1C1BB 5HLFA 4ILGB 4JI4K 2P9EA 3AJDA 1SL2A 1HFEL 1PYOB 4CK3A 3Q8YA 2P9GA 3HHEA 2NSCA 1WSFA 2VODA 1JX4A 4YDUC 1YJVA 4WCEQ 3R5BA 5HK4A 3GPAA 4LR7A 2DHXA 1KN6A 3M4XA 3CF5L 2CNNB 1V5VA 2H5JB 1ICEB 4ZP6A 3THWA 5IT0A 4K59A 1D1UA 1TAUA 1Q86T 4FW1A 1WELA 4XPEA 2XHWA 4I64A 3T5JA 1VYAA 3A4TA 2XHBA 4CO1A 1VSFA 2XHCA 1FRXA 3G6EN 3BS9A 2J0WA 1JLEA 3VQAA 3MEGB 3KLEA 1FJGF 4X66F 1Q86O 1KEKA 3TSPA 2CPYA 3A5MC 4QWCA 2Y8WA 4DV0K 2DGVA 1NK5A 3VEOA 2RIJA 3SAHA 4EK2A 4LF2A 1UPMB 3R2CJ 1GNKA 4IH6A 2OSRA 1UVKA 4Q8EA 5EX5A 4CBUA 1S9GA 3ETMA 2NPIA 4YOVA 3EVWA 3QIOA 4G1QA 3N01A 4PPZA 4JD2A 2HBZB 2OIHA 4FWLA 2WC9A 4AF1A 2YKMA 1VQYA 4NYZA 1T03B 4UT4A 3NS7B 2WZ1A 1TELA 2WW4A 2ZKTA 4WU2A 4UZBA 3HKWA 4BRGA 2E1MC 4FWQA 3GIIA 5CHCB 1VHFA 1NGHA 1TKZA 2P9UB 1HKGA 1VQNN 3AO2A 2GQ2A 4B3MK 2ZD1B 2Z2YB 3NWRA 2G4BA 1IBMK 5HAOA 2Q97A 4CJLA 3V6JA 7FDRA 2XY5A 3SSQA 2Q1LA 3G8QA 3OYGA 2VBXA 1RAAB 3CM5A 3CJ3A 4KFBB 1MROA 3QT5A 2GO9A 3PW7A 2MZJA 5LOQA 4CZHA 3BQ1A 4A61A 3SDEB 5M1PA 5ELZA 5HBMA 4KC5A 3CJKA 1YITS 3B8AX 2MKYA 3MXMA 2EWSA 2MZSA 3VGVA 3EE3A 4JI6K 5H9FJ 1H7WA 5ETSA 3G6XA 1U8SA 2D5RA 4JI7J 5KFAA 1W97L 2HFNA 3D1OA 1VQ5S 3R6GB 3D2EA 3HSGA 1WOOA 4FLZA 1I94J 3JYTA 2NQPA 4QW9A 3FNNA 4FM2A 4ZN1A 3MM7A 4BRFA 3D0HE 1C1AA 3ONQA 2R8HA 2QWRA 1FFSB 1HUXA 1N32F 2G2ZA 4CO2A 4CTAB 2V52B 3G82A 3FCVA 2ZQBA 3OLAA 4DTUA 4FBUA 3D68A 3HFKA 5K8MA 3J8AA 1NB2A 5DQGA 4YR2A 1JWWA 1F21A 4CBXA 1MMNA 4GRSA 3OJSA 3QT8A 1E6YB 2B4PA 1HD1A 3K58A 2I5JA 3HXMA 1FF2A 3RW7A 4OJGA 3SXLA 4F4KA 4OPKA 3WIVA 3GMGA 2UUBF 5C25B 2JWLA 4DU4A 3WX4A 4DJBA 3EKSA 2NUBA 2R7UA 4PKIA 1S1WA 3MAQA 2W7OA 1X1PA 4PRFA 1HNVB 4JHDA 2COLA 1HW8A 1FX4A 1VSKA 5KT5A 1OKJA 5KFKA 1Q9YA 3TNVA 2PD1A 4EU0A 5A2QO 4DCOB 2G8WA 1YIJS 3PRBA 2HMIA 3DOLA 1TL5A 4CIEA 3NAHA 2J0XA 1YBTA 3MTJA 4B1UB 1MLAA 2ACMA 4OYAA 2E9TA 4LF6K 1GXUA 2R2RA 1IKWB 3U27A 1MWMA 1QVFR 5LMNJ 3H1QA 3IBWA 3AA8A 3NE6A 3CCUN 3BR8A 2DGWA 2WUSA 4KTZA 1O8BA 4C3LA 4KQZA 3R7SB 3ZLJA 4IOCL 4FPAA 2IVYA 3P5JA 4QAGA 1Y10A 3AVMA 3O8WA 3E9LA 2HHHJ 4A47A 2UUCK 5HMZA 1RTDA 3QIPB 5ADXA 5JS1A 2FJEB 1QQNA 1H38A 1YQHA 4DFMA 3FBFA 1ZPVA 3ZEUA 1S1XA 4JI2J 3IO1A 4NYNA 4BR9A 4BG8A 3VPZA 4QPTA 1HQEA 4PY5A 2D0AA 3UDLA 3CDBA 2DB1A 1OH6A 1BOTO 2PT0A 1WOPA 4ZHRB 2YWWA 1NSPA 2OCEA 1RU1A 1NSKL 2K8GA 3LDPA 3KYLA 1K1QA 2KT2A 2QX0A 1RILA 5K14A 3SCJE 4A57A 3I5BA 3L2WA 3BBCA 5E84A 1V3RA 3AOCA 2E4LA 1HR0F 2BA9A 2AW0A 2DR8A 2V8HA 3TYTA 4FWMA 2IRUA 5EN1A 2ZDOA 5GADI 1IJFB 4RW6B 2DY4A 2OI2A 3VENA 1B70B 3O3LA 1NGEA 3VR1A 4I6MB 4U7UD 3NH2A 1UVNA 3UVJA 4O3NA 3CF5Q 3MEGA 1TFYA 1T9YA 2ZWPA 3QGHA 3H7HB 1X4AA 5HVFA 3D6RA 4Z4GA 1CC7A 5AQRA 3IRXB 3HJFA 4I9QA 2YHWA 1S6QA 1GX6A 4CERA 4CZFA 3MI7X 2DIVA 2CNLB 1Y4ZB 2HFUA 1RISA 1TVRA 1RAIB 4Z7YA 4H5NA 3QB0A 1TK8A 1LKZA 4I6YA 5KFDA 2KZZA 4PKDB 2DNPA 3D0GE 1RSCA 4USHA 1YRTA 1UFWA 3PX6A 3KLHA 4TYBA 4LRBA 3LP0A 4DL4A 2N7YA 1GMUA 2HQCA 4DR7K 1VR6A 1RHKB 5C25A 2KFNA 2MTLA 4ID5B 3BR9A 3AAWB 5CYJA 4CCHA 3HP9A 4JKGA 2KLAA 2Y0BB 3IDHA 3BO4A 3IWLA 1DHMA 1RT5B 3SMSA 5BN8A 4FVUA 1O51A 4RW9A 4FZZA 1DLOB 3AA4A 2Y8YA 1G15A 1HYSB 3P31A 1HJRA 4DR7F 3S3MA 3FZMA 2ROEA 3KD5E 3OYBA 4XAKA 5T41A 1T95A 2I7NA 2UXCK 1IV0A 1UEVA 2AJFE 4HR2A 2Z4PA 3MMBB 5BRFA 4ECTA 3WEEB 4USMA 3KJVA 2JWKA 1K9MO 4Z94A 3H8YA 5BPNA 1H6KX 2OPPB 1VQPS 2XWYA 2GMJA 1RI7A 1KSPA 2AKWB 1Q16B 1RWXB 4AM7A 4L76A 1R31A 2RILA 3OFHA 1Y00A 4RWWA 4DX8H 5D0GA 2UUAJ 3P5BP 1VQSA 3LP3A 4BRDA 3PW0A 1WEZA 4RNNA 3AD9C 2MGZA 3R7NB 1D0EA 1SAZA 4H0YB 4O8KA 1TQLA 3GJSB 3BY5A 4AT1B 3GIJA 1REVA 2KG1A 1L3TA 1SKRA 2VC0A 3G71S 1Q82T 2OFHX 4KH1B 1PC4A 3WBZA 3TJAA 2WB1D 3A0IX 4HEA9 3SI6A 2PSZA 2DY1A 4X4RA 3OTDA 1W0HA 4ECXA 4F04B 1CJKB 1D09B 2FC8A 4W5TA 3OR1B 3SUPA 3D1HA 4JV1A 4CLSA 3BGFA 1N36K 3PFOA 1N5YA 3GU0A 2YWFA 2RE1A 4KHRA 3POTA 2EFNA 3DLLL 3WXLA 4A8FA 2GV9A 2FVPA 1U25A 1WKKA 3OW2M 3VWSA 1BISA 2QKBA 4EP5A 1E6VA 1YJNS 3BO3A 4I9LA 2CYYA 3FGVA 1NMDA 3MEEA 3DHWC 3L4BC 1N8RT 4OZJA 3HZGA 1TAQA 1Q7YT 1HBMB 2AP6A 3M9NB 4DHVA 3CJ5A 1CBKA 2QA4N 5AQIA 1QY7A 3TO8A 3QBXA 2R8IA 1Y3KA 1ITPA 1CZ9A 1TZ0A 4RUCA 3S41A 4M5MA 2YXLA 1V4TA 4C8KA 1O13A 4OZ5A 4IFVA 3D0IE 1S6PB 3N4PA 2VFUA 1KQFB 4NPOA 2FUG9 3TTCA 1U2CA 4B9SA 5F9LA 3C6AA 5AQPA 2RKIA 3SV3A 4BC3A 4MKVA 4G6VB 2GHWA 5KG1A 1FWPA 1K8KB 4D3GA 3FZLA 1WAJA 3VMFB 2JEFA 1EQYA 4NLYA 3OYKA 3W64A 1DKGD 3VVUA 1OMSA 3RB6A 1CJTB 3OYNA 4V19X 2KZMA 2HS3A 1S76D 5CR4A 3WIUA 4OPHA 4EBDA 3C8YA 1FD8A 1Q53A 2NYHA 2OTLN 2QV6A 1P90A 3KNGA 3EVOA 4LVOP 3QNNA 3BQ0A 1R8PA 5D3GB 5DDPC 2F7TA 1TR0A 4H4OA 3VEWA 3CCJS 4WIIA 2KT5A 5AQWA 3CJ1A 4FJ8A 4TY8A 1U6BA 1M90T 1T05B 3K9JA 1T05A 4QIWD 1HHTP 1HBMA 3PIPL 3LF0A 4YDDB 4F4AA 4QZVB 5H1SQ 3GILA 3W63A 2B7BB 2JFKA 4FL9A 5AXLA 4QCLA 5KT3A 3G6ES 4CIFA 3QAEA 2P8IA 4CJKA 4QU7A 2RDDA 1DTTA 1JLCA 2Z2ZA 3MAHA 5KFQA 2XCPA 3AO3A 2XSFA 2XI3A 4DN0A 1Q81O 1LXJA 2B8PA 1H72C 1FO1A 4PKGA 1RA7A 2ATLA 1AZSB 3NEKA 3EY1A 4MDBA 4C11A 4USUA 4YOTA 4ZVSB 3TR8A 4ZLNA 4NXMF 3DCAA 5GAHU 4MH8A 1WKJA 3J7AP 4H5VA 3OS0A 4FJLA 4P7TA 3AGRA 4FXWA 2C2MB 2XMVA 2A3JA 3BDPA 5HVHA 1HBUA 3M32A 4O4GA 3W65A 3KMQA 3FFIB 1CC8A 2W6LA 3U8XA 2FC0A 4I2PB 2BQRA 4I68A 4DR6J 5LJWA 2M8DB 1NU4A 1EKSA 4GVMA 1FK9A 2DD8S 4HT7A 5KFWA 4JV5J 2GX8A 1UETA 5CYMB 1T03A 4KI4A 3OUYA 4Q2LA 1WNEA 2VG7B 4M95A 2XG8A 3O4WA 2IMOA 1BC6A 2BQ3A 3CDAA 2B9WA 3IUCA 4NB4A 3LA0A 2IYGA 3VV2B 3NL0A 3FJ2A 6AT1B 2FLPA 3KJVB 3P83D 4FZVA 2RUSA 4M1KA 3SJHA 1MMDA 3F73A 4XDCA 2DHGA 2PEBA 2XZTB 2JSXA 4GW6A 4RW8B 1TUGB 2XYPB 4NMLA 4ECSA 3ZSVA 4B17A 2BKNA 3MX5A 1YDLA 4GVEA 4J9RA 5LT5A 4CZEA 1EJ7L 3BYRA 1IBMJ 1S4FA 2O66A 4EFHA 3DLEA 2NR0A 1BGXT 1ZETA 2L3MA 3BSAA 3UCZP 2DHSA 5DLFA 2I6WA 3G86A 2QXLA 3PLAA 1F1BB 3CCJN 1FTRA 9RUBA 1EAYC 2J6UA 3GWCA 2AGPA 5AR0A 1S1UB 3OA9A 3S1TA 3KLIA 2DFHA 4BC9A 3EWGA 4RU9A 2HK3A 4LF8J 1XR6A 5GIPA 4NLXA 1ZAWA 4Y2KA 3ZZZA 3EPIA 3OFGA 3PTWA 1AUDA 2D74B 4W5OA 3CIPA 3V9UA 4CO4A 3M8QA 3TUIC 2D7SA 2K3IA 3MECA 1UA0A 3L2QA 3CO0P 1JNRB 1IBKK 1OPIA 1M5PC 3CDEA 3LGMA 1AB8A 4BDYA 1RWWB 2MLXA 5EDWA 3HOSA 2ZUAA 3ZT0A 3QNWB 4J9PA 4HACB 2D4WA 1WTFA 3NY0A 4YOXA 1NPPA 5DM7Q 2CQIA 3BB5A 3DXKA 1VBZA 1EZZB 3D0PA 4JHDB 2IHR1 1C0TA 4Y2AA 3VA3A 4ELTA 3PRVA 2J7KA 2CG4A 4QBUA 4PQUB 2KXHA 3QATA 1HPMA 3KKSA 4PXDA 1HW9A 3I87A 4FLYA 1FRLA 3TW0A 4B1YB 1KQSR 5KT7A 2GIRA 4DL6A 2E5LJ 1URNA 3ZT4A 3IG1A 4BACA 4OPJA 3DLKA 3L3CA 4DUYF 3H4DA 3IR7B 3FBBA 4DCPB 3CJRA 1D3WA 2CXEA 3AO4A 2HQ3A 4QS7A 4FJXA 3TVKA 1A0OB 4RUHA 1HPZA 3DAWA 2HFSA 1HLUA 2XB2D 2O8BA 3QGIA 4ES2A 4K4TA 4B3TJ 4BLGA 2IJFA 2NXCA 1X0PA 2ZJQQ 4J9NA 4DUTA 2XNRA 4J2DA 2GUIA 2AT1B 4DPXA 3CMAN 2BRKA 3VGUA 1X31C 5I4MA 1DJ0A 3DI6B 1G7CB 2W8LA 2QTWA 2ZE2A 5BYQA 3K2PA 1S0VA 3T1YK 1WHXA 3ZTOA 1T3NA 1KP6A 2ACYA 4M41A 4X66K 3UDVA 2UUTA 5IT9O 1C6VA 3U6FA 4LBPA 2VG6A 1RCOB 4B9MA 2EKYA 2B4UA 8ATCB 2UU9J 2FBXA 1QQMA 3C6TA 2P9LA 3EEQA 3LH2S 3DXSX 1LK5A 1YWXA 1PILA 4Y00A 4L72B 1U1MA 1VQMN 5LSLA 2MKSA 1OJ4A 3AOAA 1LFWA 3THXA 1UPPA 4E2FB 4BVOA 4BHQA 4CESA 3OYLA 4B9UA 4AHCA 4A8WA 1NGJA 1D4XA 2K3KA 2LQ9A 2HQFA 1I3AA 1VSIA 1CQMA 2H65B 4C0OC 4BGAA 3HK2A 2O4GA 3W62A 5KFCA 3I55N 3P96A 2OTJS 2CQ2A 2V4RA 4GVLA 3KUEA 3HFVA 1RGVA 2V2ZA 3C6UB 2DCUB 4DOZA 1GMWA 3T5KA 2B9EA 4YORA 2HRYA 2EK6A 4C98A 1IUJA 3MAAB 3O1WA 4IQXA 1QVGM 3WX8A 3MK6A 4CEBA 3JS6A 1WEXA 4F3MA 3PYFA 3UO0A 4CT8A 1L3SA 2X3DA 2QZ8A 3NNAA 4IEIA 4P9SA 2ERRA 1YAGA 4LSLA 2G8FA 3CT9A 4CRJA 4LQ3A 4HWIA 1WTBA 2HNZB 3UR0A 2GQQA 3FEYB 1R0BG 2R7VA 2E5IA 1CJTA 4FKYA 2O1PA 2WHOA 2NRXA 4KB0A 2RPIA 4JI7K 5GAGP 1YTAA 2A40A 1EP4A 2OLWA 3NF8A 2L9DA 1X9MA 1IH7A 1SI9A 2J7UA 3HP6A 4OKKA 2HMIB 3FE1A 1BXNA 4OLOA 3VZHA 1XR7A 4JI3F 3KK3B 5KTQA 2QI2A 2BJ9A 2GIFA 5AQTA 4UTGA 3IR5B 3DRRB 1QM9A 4DR4F 3M2VA 1MWKA 1RGIA 5AJ3F 3LDNA 1GXTA 1XMOF 2N82B 2M52A 1H2VZ 2X1FA 3UDCA 5FRMA 1N32K 5A6WA 2W1BA 4AUKA 1ESVA 4LF7K 1Q82O 1QQOA 3B78A 2F1FA 3Q8SB 8RUCA 5F8HA 4DR1J 3SQOP 3NGKA 2HKEA 3M9OB 3AD8C 3V5RA 4JV5K 2VG5B 2XLIA 4ID8A 1NJYA 1DTTB 1YVFA 3CJ4A 4DUZK 1OVQA 2QL7B 2F9DA 4OO1J 1IWGA 3CCVS 5RUBA 2FGCA 2R7YA 2JC0A 3H08A 1Y5LB 1YJRA 5AJ3K 2ZM6F 3CJCA 4R8UA 2H4WB 1UAWA 1DRZA 2H5EA 3MR5A 1TK0A 1D9DA 3MUVP 2DJWA 3A1YG 5AZJB 3FVYA 4W5RA 4Q2MA 4LF4J 4C9DA 3THXB 2YWHA 5HRSA 2V94A 1W7WA 5B08A 2U1AA 4JV5F 2DXEA 3C95A 1N52B 3ITHA 2Z1IA 4C8LA 4I2QB 1R6YA 4CFBA 3AV9A 1OYEA 1REGX 2WBNA 1RABB 1X5SA 2UXDK 4DR7J 3T1HF 1RHUB 5FLXY 3H0PA 2GEMA 1VK8A 1WAFA 2CQ4A 3IS9A 4NLDA 3VQEA 1N54B 3D28A 2VC1A 1F9FA 1LWXA 4R25A 3W5ZA 1K8KA 4M94A 3AVGA 3K59A 1WG1A 4CFCA 3I55S 4NI2A 3DM2B 1WC0A 2CPXA 3SCIE 2N3LA 2O01C 1Y11A 3FZHA 4O44A 2MJUA 5AT1B 4KH0B 2HVHA 1SQKA 3WNEA 1HBNA 1NDPA 1YVNA 3FEXB 4JEPA 4EZ6A 3JTPA 3K89A 3NLCA 1A9NB 2FBVA 1B9DA 3HHNB 2FHJA 1JKHA 2QM1A 4CZMA 4LRAA 4IRCA 2RHQB 3MN6A 4P10A 3E9OA 2E5HA 3GG1A 4K25A 5IFMA 3H45C 1FNMA 3MX2A 5E26A 1KVJA 4Z2XA 4N47A 1S79A 4CD1A 4R5PB 4X62J 1WHVA 3IG1B 3L2RA 3CCQN 1PKUA 2MQNA 4ILHA 2YPZA 2ZZTA 2QKKA 2BDPA 3EXYA 5EX0A 2RAQA 1YJUA 3EYZA 5LMUK 2FXUA 2DKOB 3OHAA 2ZWHA 4OI0A 1KVBA 2XWXA 3CCSS 3ZZUA 4F36A 2ZNYA 3PW5A 3T1YF 4ED3A 2GVDA 3PYGA 4ZP9A 3Q8PB 2ZH9A 5C2DA 4G1IA 5L38A 2VDIA 2FDNA 1YJTA 4USTA 4K2JA 3IBCB 1OIAA 4YR3A 1H73A 3UNGC 4DV6J 2JGUA 3E66A 4BCAA 2FB0A 1VBYA 3C65A 5F0XA 4TNOA 4ZPTR 5LMUF 3TZZA 2F65A 3EGVA 2ZBRA 3RR8A 2GJFA 3ET6B 2Q0UA 1JXVA 4CJ5A 3C15B 1ELOA 4TLRA 3JS9A 3KUGA 3GYNA 5ETVA 4JS4A 5FRNA 4FXDA 3CDWA 4N7TA 4NXMK 3DM2A 4DUYJ 1YI2S 3MM5B 2ZH5A 4H4MB 1K6YA 2XGPA 2HHHK 4FWNA 3I56N 3K7RA 2FZCB 4NZ0A 3ZZPA 3AA2A 3R3TA 2P9KA 4CJTA 3FMBA 3KNAA 1W2IA 3IMQJ 2OELA 3MN5A 4FYWB 2LP4A 3IFEA 3LZIA 4CJ4A 3C94A 2DH9A 3KK1B 2NXNA 5EY4A 3ILIA 3G6VA 5D4LA 1S6PA 2HF4A 4IFVB 2G13A 3QESA 4ZHRA 5ETOA 4NMXA 5C10A 1K8AT 1VK3A 3R97A 2R9LA 3O4QA 3G8SA 5JMVA 1U7LA 3D6HB 2UU9K 2G8IA 3FBEA 3UE5A 2V2KA 4ED5A 1VSEA 3QRPA 3ZZOA 4DPOA 4YS2A 4LSZB 1HD0A 2OPRB 1FDNA 1M1KO 2DNYA 4GVBB 1S12A 4YB6A 1P8ZA 3QJPA 5I42B 5LSRA 2AD9A 2E7VA 1PJ6A 4OJHA 3VAGA 1LW0A 5DZ7A 5ETKA 2IM0A 4O23A 5KFPA 1KQGB 4FF3A 5A8RB 4CW7B 2YNIB 3E2EA 3KK1A 1OQ6A 4DV1K 1NK9A 1RCHA 1K8AO 4HACA 3BPSP 3JSYA 3HYFA 2QEXS 4LFAK 1NMNA 2V67A 4R0EA 3G71N 1Q1KA 2ZHBA 4JI6J 4H0PA 4K43A 2DNNA 2AP1A 3PV8A 4LBHA 1BQNB 4NLPA 2G0CA 3MWPA 2V6AA 1A5VA 3US5A 2AJ4A 3PW4A 4CVNE 3GJQB 3WQUA 1I5OB 1YJ9N 1GOCA 3RJMB 3RMCA 3RAQA 5HQ8A 4RW4A 3MD1A 5ETQA 2GHVC 3PX0A 2V63A 2PMZD 2W2MP 1PBUA 4ALZA 2X78A 3BDEA 1XWLA 4OHWA 4UY8O 4K0KK 3FFKB 2NUUG 1VC6A 1J9AA 3I82A 4ED4A 1KOHA 2LDYA 3NNHA 2MKIA 4ECUA 2VQFF 3N4WA 3FZFA 1HYSA 3RRGA 2C2KB 3GIKA 1KOOA 5IT4A 4ZPCA 2FSNA 4JK7A 1WG5A 4BC2A 3F56A 1X3NA 6FD1A 2Z30B 1YJ7A 3OBWA 3HSDA 2XCAA 4F4XA 1NDCA 2BOAA 3DYAA 3OTOJ 3W2VA 3WNGA 4K4ZA 1LW2B 2OH2A 3OXGA 4FNHA 3THYA 3R8YA 4ANDA 2V50A 4M3UA 3JQKA 5HN0A 2YHXA 4DTRA 3K17A 3NWGA 1I39A 4FSVA 2VONA 1J6ZA 4ICLB 3VQ4A 2QWMA 4FWSA 2BANA 3LM2A 1CG2A 3OUYB 2Q31A 3ZSOA 2F3JA 1N33K 1FJ7A 4KHPK 2MMYA 1QUPA 3A12A 2VWJA 2MHNA 1R6VA 4AXIA 5J1EA 5IWAJ 1JJCB 1B0TA 2VWKA 3AAPA 2A2DA 2DFEA 3VQ5A 4PYDA 1CULA 1BCOA 2H48B 5FPNA 4TY8B 4X64K 1F0XA 4DV5K 1VQ6S 1U1PA 3GFHA 3TU5A 3ISNC 4DR3J 2YVSA 2Z0GA 3VAFA 2P1JA 1TKDA 4ZPAA 4WP8A 5KFOA 2J7WA 2D3OR 4U67L 1RTIB 4KHYA 5ETTA 4EBCA 4B3OB 2XLJA 1BQMB 3BZCA 3OL6A 1H7XA 4FF4A 1HI0P 3F41A 1VAZA 2CGLA 5AQVA 3MUMP 1BI4B 4I67A 1GLJO 1RNHA 3JTOA 5HRNA 4DV5F 4URQU 1F2GA 4DQIA 3P45B 4IOAL 1S99A 1SC1B 4BG9A 4EUVA 5GAGU 2KRRA 2XY6A 1UWAA 4UY85 3E1YA 4M3TA 3V81A 2FJAB 3J7ZO 1N48A 3S3OA 3R5AA 1RAGB 1HYZA 2ZJPQ 1UZHA 3IAS9 3MMAA 3AT1B 2YX1A 3I4HX 3P6YC 4OZLA 4YY3F 2CQGA 3D66A 5CA5A 4E19A 2H3GX 4RNFA 2WTUA 4KHWA 2HWTA 5AFUH 2CAJA 4F4YA 1P1LA 4ZVUB 2Q36A 2Q1NA 4USIA 3IWXA 2VFSA 3V1OA 5IT9Y 3AVIA 4OYBA 2KH9A 2ZH2A 1RWUA 3TA2A 1O1WA 5KG7A 3D2FA 4YQWA 1JCFA 3QAUA 3ZEUB 4CF0A 2EI5A 3RVCA 1U02A 3D67A 3ISZA 4DUZJ 2GC8A 2LDIA 4X4SA 3SQGA 3OR1A 1VQMS 1IO2A 4ZPBA 4IOBA 4KH5A 5CE3A 3SAGA 4P75A 4UW2A 4PWUA 1NZAA 1HBUB 3KHHA 1JLGB 3E51A 2PFFB 1X4FA 4J9OA 1MDUB 1TL3B 1SL0A 1KFSA 4RG8A 1T94A 2C2ZB 1KLMB 3CD6N 2BTFA 1AYEA 3VGLA 2BJ1A 5CYQB 4LRDA 4C8OA 4GVBA 1WEYA 4DR2F 2FC9A 3MPUB 1NRKA 1VQ9S 3OTOK 3CCES 5KFMA 3QLHA 3P4IA 2UU9F 3PR5B 1HQUA 4URGA 5KT4A 2ZBCA 2G1HA 5CD4A 5M2RA 3DWLA 2YTCA 3G82B 2ZZNA 3W0LA 5CXTA 2OPRA 1S7HA 1Q4RA 2AEFA 3UD3P 4U7BA 2FPHX 2QA1A 2DGXA 4NLRA 5C42B 4M63C 3MMCA 1S1TB 1R0AB 4HVJA 1PAUB 1TL1B 4FWKA 3MMCB 4DQSA 3LP0B 5F8JA 2P51A 3F9KA 3PHTA 3DRSA 4WQ5A 2IS3A 2V0NA 2MZ1A 1FNXH 1YIJN 2DTJA 1TKTB 1BG3A 3I0SA 5KFHA 2VBYA 4OZ3A 2O4IA 1KS2A 1RTZA 4KT0C 1NO8A 3M05A 4TSXA 1JLEB 2PC6A 4ATNA 4F67A 3GP9A 1UMJA 5E7OB 4JI0F 4WKRA 2E1YA 3CCUS 2QYCA 1B92A 4LJMA 2VJUA 1XMQF 1K44A 1NLVA 8AT1B 4X62K 5CYQA 2ZWOA 4LIWA 2JLEA 1OO0B 3PYEA 4JNEA 4B8AB 3EKUA 3VQQA 4JRQA 4DDFA 2B51A 2QWLA 4NLGA 3TJ9A 5CH7B 4JP8A 3V6DB 1LWFB 2BMBA 4KGMA 4C0HA 3ZETB 4U8VA 2RQKA 4GV9A 4GC7A 2A1BA 3O1BA 4XH4A 3IRWP 3JSMB 3MWBA 1HX1A 5D6GA 2E1CA 2EWHA 1VGYA 3H25A 5DETA 3C6HA 1FJEB 2DNQA 4DBQA 3GSDA 2IM1A 4ECYA 1XMOJ 4H0VB 2WAQD 3EX7B 4ETXA 2BW2A 4BRPA 4LFAJ 4QOZB 5J2NA 1S1UA 1QZ6A 2D3ZA 4FJ5A 5C15A 4IO9L 3EDRB 2OO4A 2ZVSA 2B9XA 1UWBB 3FCWA 4CF2A 3B8HA 4DL3A 3IGVA 5FLXU 2E9RX 4JLHA 2CPDA 1YZ7A 3KG4A 5DG8A 4IR1A 4WK1A 3R2DJ 4H54A 4C23A 4AHSA 4Y2CA 2JFDA 3DOKB 2EFVA 4W4MA 1C0GA 2B5JA 1VQ9N 1S1XB 3O8MA 3H5UA 1S97A 4WFBL 4IFYB 1T3VA 1U1OA 3E8OA 1RT6A 3S01A 2J8SA 1WKLA 4KH6A 1F6TA 3NH1A 2B4VA 2RRBA 3FZ2A 4DV2F 3V4IB 1S49A 2DY9A 2V2VA 2C28A 2IA0A 1RBAA 5F1XA 2OD6A 4JI5J 1R89A 2E9ZA 2AHOB 1Y97A 3V9WA 2WVCA 5GADU 4GKKF 3JSBA 2YQ0A 2ALZA 1J5EJ 1U6ZA 2PE8A 4WIQA 3SSRA 3V6DA 3NGTA 3MM8B 5HQMA 4B3SJ 4Q44A 2GVZB 4ED7A 4H0XB 4O4GB 4BC7A 3J81O 4A8KA 2ZOMA 5IWAK 1CSJA 2RF2A 1BUXA 4BDZA 4M3RA 4CO5A 4RCHA 4PG5A 2V4JB 3R7BB 2E29A 2P9NA 1G3OA 1VHXA 4IQMA 4L73A 1C4CA 1EWRA 1U0SA 2F8HA 4U7CA 2HFVA 4M7XA 1NMEB 3G25A 3THTA 3ILJA 2O8BB 1W9HA 3SBGA 3H5YA 3KKRA 3PO5A 3OYJA 2VHGA 2Y3YA 4NLSA 2IM3A 2XI2A 3OBYA 1RAJA 1JL2A 2YKNB 1IBKJ 4MLHA 2YHBA 4PG4A 1RAOA 4ES1A 3D3CJ 5M1FA 3BPDA 2E2NA 1ZM4A 5IOLA 4QJVA 3RB0A 4CQ1A 3FZBA 4HH1A 3MN9A 2CFXA 4W5QA 2JL9A 2OZMA 4IOAQ 3ZTQA 5EGYA 5AXNA 4FWOA 3FZKA 5KFZA 5BR8K 4X84A 2JDJA 2NCKL 3ETOA 3O9RA 3JAMY 2F4VJ 4BBYA 4FJ7A 1BHNA 2HVEA 3QGPA 3QMLA 2YKAA 4M5NA 3CFOA 2AZ1A 2IDOA 3HD1A 2FZGB 4BRHA 5LY3A 4C0BA 1U1RA 1ZAXA 3MPYA 3M2RB 3U1LA 1NUEA 4KPCA 2EBGA 4DTXA 3CNQP 5A6PA 3M2UA 3D7EO 1RYSA 1WSRA 5JVHL 5L9XA 3HT3A 3KLIB 3ET6A 5D78A 4C3MA 1IR0A 2O8FA 2W4CA 4DB3A 3PRDA 3S7RA 1CLFA 2BRLA 2E7XA 2PGCA 2FIUA 3HFZB 2ZH8A 1X8DA 1YT3A 1KVKA 2IFXA 1XIQA 4HDHA 2RNEA 1QAIA 1KC8O 2KRBA 1GFWB 1VC5A 3R3LA 2XMKA 3O9TA 5KRSA 4I2QA 4DR6K 1XNQJ 3ITHB 1Z05A 5IC4B 3ENHA 1HNIA 4BRAA 2HBMA 3Q8UA 3LZJA 3EXCX 5ETPA 1N0VC 2G8VA 2CUYA 2VL1A 4KHSA 4ZVFA 1VQOS 3H3OB 4A62A 4EI2A 3QQCD 2BE2A 3NCPA 2JH3A 1WI6A 1Q7LB 2HWHA 1S77D 3WQTA 2P9PB 2YKNA 4JI1K 5BYRA 4JI8F 3MM6A 3F5TA 5HRRA 1RBSA 5TKWA 2ITMA 1Z6RA 2NS1B 1HNXJ 3M8PA 3QFPA 3QJLA 3CCRS 1LWCB 2YBVA 2IDEA 3IWNC 5HSPA 1EQ0A 2FVQA 4NO7A 2RDIA 2IM2A 4AHTA 4EHUA 3TI0A 2HAFA 2J0SD 1HNIB 1Q8LA 4RPFA 1VHIA 3NGIA 3M2VB 5L1JA 1PIEA 3TAFA 3QZ8A 3ZZ0A 4PA1A 3NXZA 3QEWA 2DXFA 4M8LA 3J81U 1U0HA 3DU5A 5GINA 4M3WA 1TL7A 2F8SA 5L9NA 1RDBA 1TKXA 4BS2A 2Z57B 1RT7B 5E3CA 1NGFA 3DRPA 4JAXA 3J80O 3SPZA 3KTQA 5DGBA 1Q8IA 2GIQA 4M5DB 2W9BB 3ENBA 4NXNK 2C3PA 4Q0BB 3PNIA 4F26A 1UKUA 1N6QB 1UW9A 4DEZA 4A48A 3H59A 3QZ7A 1DURA 2Z58B 1A7GE 2R3VA 3A8KA 1ZC6A 4ITSA 1S48A 4NLUA 3ENAA 2V4QA 2FHOB 1RQ0A 1LWCA 3I6PA 1U09A 5FROA 3V6KA 3GE9A 2OYQA 3K5PA 2DO4A 1Q81T 2HLUA 2Z1GA 2E20A 3KLFB 2HHXA 2BUPA 4PWDB 3HPGA 1VS3A 4BREA 3Q8RB 1BQXA 1WSHA 5LXYA 5IT9U 3J7ZT 1FWLA 2LU1A 4CH1A 3MR6A 4L8RB 2XMTA 1KR4A 4DR4J 3HKZD 2R8GA 3MXJA 4IXCA 1OY6A 4ISFA 1FFWB 4RX6A 2MPUA 3KLHB 3KJFB 1VQ4N 3EM1A 2LECA 4WFZA 5GAEI 4DX7A 2HRTA 4OX9F 4XIUA 1PAEX 4OI4A 4I0WA 5F8LA 3FSXA 2OGUA 2CGKA 4YB1P 4CGHA 4B9NA 4LRCA 5BR9A 1VRQC 4H4KA 1QS4A 5IWAF 1I3OB 2F8EX 1S6QB 1S5JA 1JLFB 2OKQA 1ZM2A 2HBYB 1Q0NA 4O8UA 3IFRA 2AQ4A 2W4PA 4DR3F 2R7OA 2MZTA 1UL3A 1OSCA 1HNVA 1UTAA 3H1VX 2LXFA 2FLOA 2OSQA 1NK0A 3PKYA 1UVMA 2X51A 1RT3A 3DDIA 1RTJB 3SQ2A 3PXGa 4RW8A 1NNDA 1SH2A 3GONA 5F0WA 1JK9B 2SXLA 1RHQB 2CVIA 2I38A 5A8WA 1S9FA 1FA0A 3A5NC 2HMPA 2JEJA 4HDGA 4EFAC 2GWKA 3M6WA 2BVZA 2W7PA 5AQNA 3R9PA 5J2MA 3KDNA 4CYUA 4UOHA 4Y1CA 2V8PA 1T0TV 5KFYA 1M1KT 2HNDB 3NGYA 4USVA 1TMJA 4DV5J 2FZKB 5AQJA 4ELVA 1KVCA 3SBMA 1W26A 4JI6F 3VF0B 4E0DA 3O08A 2XQCA 1M1GA 3MEDB 1RCXB 3GOIA 3R8EA 1ULRA 1DTQA 4X65K 4EGLA 4CEAA 2HNYA 2NZ4A 1NJWA 1NK6A 3CD6S 3M1VB 3EJMA 1CJKA 1ZA2B 1FKOA 1FWKA 1WBBA 4K0KF 3O1LA 3O6QA 3DRRA 2ASJA 1HJOA 3MHYA 2ZH7A 4ID1A 4CEOA 3QBWA 3MPDA 3ZZTA 3HPOA 2ETJA 4MT1A 3ZETA 3L2UA 4ECWA 3KLVA 4DI6A 4NLOA 2ZJRL 1APSA 2MLYA 4J37A 4DV3K 2GNKA 1ZTTA 1XC3A 4L74A 5C0YA 1R59O 5ITHA 1T8EA 3GE1A 4X64J 3PHEA 5LM7E 5KFIA 3H98A 4FLUA 1N88A 4I1TA 4KKOA 2OEKA 2HF3A 2HGLA 3VHQA 2F4FA 1GLDG 3OVNA 3AY0A 1ZBLA 5D0HA 1HKAA 1BL3A 1FJGJ 3HZEA 1WOQA 4NE9C 3K0JA 5HQLA 4BQZA 3W2WB 4OI2A 2VFRA 4FWPA 4U95A 2DGOA 4WE1B 5AQXA 1UP1A 1QAJA 1HWIA 5JXSA 2GQCA 5FPDA 1CVJA 2OA8A 3OY9A 4FK0A 4OZ1A 2MZQA 3PIOQ 3AGKA 1DEJA 2O8EA 5GVQA 4XK8C 1HNZF 1BY9A 2MB0B 3I56S 3PSIA 4QWAA 1RBTA 4QWBA 2EFQA 2A3ZA 4OHXA 1ZZNA 2EX3A 1WF0A 2BJEA 4OL8A 5J2NB 1RTDB 1DBDA 2HFOA 3Q22A 3ULEB 2IRXA 5B0FA 4BRQA 3ZT2A 3L8BA 3CJ0A 4GV6A 1NM1A 1IQZA 2WFBA 1IKYA 1I51B 3VGTA 1WDDA 3RW6A 1FXRA 4FS1A 2GS8A 4NZ7A 2MLZA 3SQ0A 3UN5A 2HIQA 1NJIO 5T7BA 4WTOB 4E7KA 4IDKB 2V51B 3V2UC 1S57A 4ZIWA 3OYFA 4MMOA 4U6PA 3P4UB 3M8WA 4QYZK 1ZBTA 3HVRA 4C4WA 3T19A 4O4RA 1LOUA 1S4EA 3JAMU 3TAMA 4FYVB 1NJIT 2VPXB 5JICA 2R7TA 3UPFA 4HHHA 4CZKA 3SSSA 1D8YA 1KRPA 4YY3K 1SJ1A 2JLGA 1IBLF 3KLGB 4JKDA 3ULDA 2XYGB 3SK3A 4NEYA 3TA0A 5GAHI 4IOXA 3R1HA 5D0RA 1AZSA 1G99A 3NKYA 1N5YB 3SMZA 3PJWA 2FLLA 2PO4A 1T9VA 4C8NA 1ZBFA 4AQYK 1P6TA 2CQBA 3IAM9 4YNQA 2QIFA 4FK4A 3G8TA 1RACB 2ASLA 2BANB 1F5AA 3KJQB 4G3IA 5IV4A 4LF5F 1DQ9A 2HVIA 2LSNA 3EL2A 3TVZA 1XERA 1RDUA 5GMKa 1JL1A 2B43A 1HQEB 1M5HA 4CO3A 2X74A 3VETA 5DLGA 2LQ8A 4OGCA 4NX9A 3ASMA 3N6LA 4YOUA 4J9UE 5K9FA 1M5VC 2QMUB 4JK9A 4OX9K 4LFBF 1CXUA 3R1XA 1GLEG 3AHPA 3CC7N 2ZNZA 3MF5A 1S22A 3TZXA 1XNQK 3H5SA 4UOCA 5CHIA 4DS4A 3ZNJ1 2O8EB 1U24A 4WFXA 3TZYA 4WQ5C 1N36J 3NRBA 4LRFA 5GADP 1SKWA 2X3GA 3VALA 1ZXOA 3PVXA 1BUPA 1LOTB 1YG0A 1HQUB 4M63A 1YXQA 1RAHB 2W4DA 4CHPA 2RU9A 2YWKA 3U4LA 1VCTA 5B0CA 5DM7L 2E5JA 3D2WA 3O5BA 4KHUA 1U04A 1GOBA 1YRUA 4GV3A 2HIYA 3WEEA 4ZITA 4DTMA 3T3FA 3Q89A 2DRBA 4EMDA 1WN7A 2CQ3A 4FLTA 1KFDA 5LJ5Y 2YKQA 4WYLA 4AL5A 4IBNA 2H1YA 4CTAA 3QIDA 1ATNA 3SCXA 1O5JA 2Q6BA 2P6SA 1GK8A 3AB4B 3T1HJ 5F8IA 1HHQA 3VQTA 2APOA 3DLRA 1KHWA 4A59A 4LF8K 4BR4A 4K50A 4BE0A 2E44A 2GFFA 2VA2A 2QL9B 4P2FA 1FEEA 3D2EB 2EG2A 4R8UB 1NZ8A 5KFBA 3R9LA 4B9TA 1NHKL 4DSIA 3PSFA 2CJKA 4QS9A 3PJ9A 3C46A 2HHPA 3OHBA 2ZBQA 4MKBA 4JOUA 2VPZB 3H2LA 4J2BA 4FDFA 1OVYA 4ANEA 1XMQK 2HZCA 2HNYB 1RAEB 3L7UA 2GHPA 4X66J 5C24A 4O3QA 1R8BA 4KE5A 2BJ7A 1QTMA 1X5OA 3OS1A 1RWOB 1EO1A 3U02A 2POKA 3MOZA 1SC4B 3TX8A 1ZBUA 4NLQA 1ITGA 3QEPA 4ECZA 2QWQA 2XRIA 3NVKA 4H4MA 3TQ1A 2OANA 4I4BA 2QXFA 2R8KA 3ZYYX 1J2VA 1XQIA 3OR2B 1OY9A 2VICA 1G4CA 1UZDA 1QSLA 4CJVA 1V5IB 4KR0B 5CYMA 3MM8A 1HARA 4OKEA 1MW7A 3W66A 2R42A 1UVJA 1N8RO 3Q23A 2F7VA 1JLBA 2AGOA 2YNGB 3QFHA 3RU0A 2QLWA 3PACA 1BIUA 3GQCA 4JI4F 3GJTB 1ZBHA 3C2PA 1T3OA 1AXQA 2RU3A 1KAYA 3WC0A 3OYHA 3L4QA 4ED0A 3TWZA 2OP5A 1YHQN 1IVZA 3AQOA 4JI4J 3M6GA 3ATUA 3KHRA 3TOQA 4BR2A 4IWVA 3P49B 2GO8A 4U7UK 2WRMA 4LT6A 4OZ2A 2EG1A 5F3TA 4MLEA 3HI0A 3DXMA 3SZ2A 3D1QA 1KD1O 2UVRA 3KHYA 1U1NA 3NF6A 4DMNA 3T6BA 4FP9A 1F3VA 3R5GA 2LXUA 4NXNF 1H98A 1RWNB 4J7CA 2W25A 2ZH6A 1N0UA 3B4DA 4FW2A 4ZS6A 4EYHB 3MCNA 5ETRA 3QT6A 1X4EA 3QFWA 5KG4A 3HT0A 3CCZA 5KT2A 1MU2A 3ID6A 1Y0HA 2HRUA 5AFUA 1B4SA 1N5QA 3A8EA 1M5KC 1NGGA 1S9GB 4DSEA 4DU7A 3VGSA 3CXCR 4EEYA 1ZYQA 4E89A 4DCJB 2BABA 2RT3A 1VDHA 4PG6A 4OJRA 3BZQA 2XS7A 2KTQA 3G9CA 1J5OA 3HF5A 3PIOL 1F3FA 5JVHQ 4BWJA 3CJ2A 2QLFB 2EFGA 2VDHA 4B3TF 4ED8A 5GIOA 3KK7A 3KK2B 4M45A 1JLAA 1NCLA 4X4OA 1CJUA 4DZ6A 4ZLLA 5L1IA 1U45A 1R0CB 1P8GA 3Q8QB 3VQ9A 3QYYA 1SJRA 2DNMA 1Z4UA 3G87A 3H5XA 2CADA 2EVZA 1VQLN 5LXRA 1HWJA 1KCFA 1BWEA 3ZSRA 3MM5A 1S9EA 1RXOB 4B3MF 4URSA 1R8HA 4PL8A 3I0RB 2FY1A 1S1VB 3A2FA 5A8KA 3ZSQA 4WF9L 4AQYF 4FNIA 3E01A 3QWUA 3TARA 5HROB 4FO0A 3AVFA 2QLBB 3BGRA 1FEHA 2OPQB 1U2VA 1B3TA 1CLQA 4LF9J 1NBEB 2WBRA 2KW4A 3HDSA 2JJ4D 1RB0A 1HPZB 4QR1A 2NRZA 3KD1E 2X7IA 3MURP 2XMJA 4W92B 1KVIA 3S8SA 4DR3K 4DFPA 5L8RC 2AU0A 4AL6A 4KRFA 1G1XA 1SVDA 2Z1JA 3DOMB 5B0BA 3I96A 4H03B 4UQGA 3LO3A 1EKRA 1ASUA 4IG3A 3MM7B 3GIMA 4CP5A 4LFCF 3PEJA 3TZWA 3MTKA 2PYLA 4M5JA 1YK9A 3N79A 5B7WA 2DTUA 3ILLA 2VD3A 4YDUA 4F0HA 2QSWA 3THVA 2ZH4A 1MU2B 1RT3B 3DGPB 2IGIA 1T11A 2E88A 1WC1A 2IA6A 1YUWA 1N5VA 1KVAA 3CFPA 2VQFJ 1EX4A 3EUNA 1YKWA 4CLYA 4MO5A 3H20A 1RT2B 1YITN 4YHHK 4FYYB 1IG8A 2AJ1A 2UUCJ 4OPAA 5DGAA 3LANA 5JJBA 2M3DA 3A3NB 1C0FA 2KO1A 2MY8A 1U2VB 3NF9A 3D7SB 2QMXA 2H51B 4V19J 4FLXA 2H3EB 5HRPA 4F4ZA 5A8RA 3WNHA 2CH6A 3N9UC 4DU3A 2HS4A 4CJRA 3D2FB 4RW4B 3OFEA 3PX4A 3X3UA 4AE5A 4OJ3A 2KVQE 2LEPA 2DHHA 3SJJA 4ZVPB 4MQ3A 1HL6A 1BQNA 4IZ9A 4ES3A 5DG7A 3CM6A 4ZP7A 2QE5A 3FFIA 2DNLA 4I7FA 4TVAB 3P5TL 3CCLN 1IKVA 3WT0A 1VQLS 2P5GA 2ZM6J 2HPUA 2LEBA 3DXBA 4LF6F 3T9ZA 3K8VA 4OZ0A 1EHWA 3CIZA 5CZ1A 2RH3A 3OBIA 3MR3A 4IO8A 3AVHA 5IC6B 3AH6A 3HJVA 1JQGA 4ZKAA 4FOEA 1Z26A 4HI2A 2V68A 3TABA 2CVEA 1NGDA 3HD2A 1LV5A 2O8DA 5FDLB 4YFUA 4R0JA 2NXEA 5ETMA 4HCCA 5KFXA 4B1ZA 2F9JA 4FN5A 4P74A 3PUFA 2BJ3A 1DQ8A 5D0EA 3BJYA 3QEVA 2RF2B 1HNZK 3F2KA 4N8OA 5EWGA 4OX7A 1KONA 4DCHA 2C42A 3B4MA 3DXMB 3PKMA 1LWFA 1JMTA 5E5NA 2HBQB 4CEEA 5KPRA 2PA3A 3D9BA 2L9NA 2A10A 3CDUA 1RTIA 4F8RA 1PSDA 4OI6A 4GKJK 4FM1A 2IAJA 3MCOA 2JEIA 3PDNA 5AE1A 2CJBA 1D5AA 4KBIA 4KV8A 4M5DA 3FKBA 4B3MJ 3CW2C 1EP4B 2RJZA 3DRYA 3RB4A 2BM1A 5LL6Z 2VGNA 1RWPB 3MEDA 2N4DA 5KFEA 2YX7A 2BQUA 3K5LA 2ALYB 4N77A 3VOVA 3I8BA 2ZGYA 4FLVA 2E1ZA 3GR0A 4F3TA 1PG5B 2A1RA 3GLJA 2DK2A 3CC4N 2BJDA 3KK2A 3QMQA 4N8NA 2A6MA 2LU2A 4EP4A 3LP2B 4DQ8A 5DQIA 1IBLK 3LDSA 2KQ2A 1TUYA 1RBRA 2VPYB 2WONB 1NAQA 3ZXWA 3CETA 1SBRA 4E98A 2L08A 4WP9A 4OYIA 3FLCO 2AZ3A 2UZAA 3K57A 3B54A 4UOFA 2KKZA 2C1EB 3L9ZA 2VYPA 3L7PA 2EFOA 2DR6A 3MM9A 5DG9A 4BE1A 4NEZA 2BV3A 2IVOA 2KJVA 1MN7A 5CQGA 3ZSWA 2IOCA 4FJJA 4OIXA 2JC1A 3QLHB 3JSMA 1Q8KA 1C4AA 1YBUA 3LWMA 5EVZA 3CCEN 5JS2A 3ICLA 3MMJA 1EKEA 1J27A 4Q43A 4P71A 4YDXA 3CCTA 4DV6F 3VTHA 4PG7A 4OHVA 1XNQF 2QGFB 4Z7CA 1QSSA 4CH7A 1TL7B 3I4PA 3NP5A 2ADBA 2YNHB 2DEIA 2V8DA 1UJ4A 3GSIA 4KGXB 4DF8A 2W7AA 1HQ2A 2V69A 1KTQA 2M7SA 2RRNA 5SUHA 2ZHAA 1XTZA 1R7IA 4NA3A 3PEHA 4OLAA 4GY2B 4WZMA 5CY4A 2UVUA 1SH3A 1RWMB 1T9XA 3HSJA 4C8YA 1I1GA 3PJXA 1NDLA 2NXJA 3J81Y 2ZOGA 3JB9k 3HO1A 3AJ1A 4HVZA 3TA1A 1NGIA 1ZTWA 1Z1ZA 5CCLA 3BO2A 5IS2A 2QO3A 4KHQA 3J7AN 3G4SN 2BW7A 3R5DA 1CJVA 2Y1JA 2G2YA 3GR1A 4E3SA 4D3HA 1SZ2A 3H6EA 5I3UB 3DGPA 2A2CA 3VEYA 4TU8A 3BYPA 1SUQA 2C2DA 1B7FA 1G6BA 2A1SA 5IQ6A 2D0PA 1UOCA 4JN4A 5AQHA 3ADAC 4KB1A 1VBKA 4E7LA 2LQBA 2RRAA 1BMQB 2UUBK 4YB7A 2JRSA 2P9NB 4KPYA 4P2XA 5THWA 4RKUC 3V4MA 2BJ8A 1C1CB 4JUZA 3HVTB 2HG4A 3K0SA 1NPRA 2HQIA 3OL7A 3DLHA 4FF2A 1HNWK 3D3BJ 1ZAVA 3CCWA 4I56A 5LJVA 4DUZF 1U1KA 5KPTA 1TV6B 4QW8A 1SH0A 3MCAB 4WFAL 2HEKA 1IN0A 3KXDA 2DEJA 4ILLA 2D1KA 1RLCL 2HBRB 1XJWB 4G65A 1YX2A 1RUSA 1ZZFA 4KFBA 4UZCA 3VQDA 4MKYA 1RA6A 3CMEN 3CYMA 2E1AA 4CZJA 4BRKA 4DX6A 1TVRB 3TAGA 2C2NA 1HI8A 4KAZA 5M2UA 1NBWA 3FRYA 3TVYA 1ZBIA 4YOWA 3D54A 2ZD1A 4TY9A 2QEXN 2VQEJ 3DOKA 1V6HA 4HI1A 2GA7A 1RWVB 2YNHA 3OL8A 2ZF5O 2FF3B 4C97A 4RBUA 2FVSA 1LAWA 1HNZJ 2MKHA 2A6OA 1W2BR 1BCMA 2R7XA 3IMXA 4A8OA 5F41A 2CQ0A 2AYBA 4FJNA 3CD0A 1MSWD 5KFVA 2AA4A 2AIRB 1YHQS 3UE2A 2DXDA 1RE1B 1TUVA 3AXMA 4ID5A 4EWTA 1RTHB 2E2QA 4GKJJ 1JKHB 4RJVA 2IVMA 2CJYB 1P27B 4CLKA 4KRWA 3DNCA 1K73T 1QVFM 1FFGB 4IH5A 4KHMA 2RD5C 2FHJD 4CHQA 3LGHA 5KPZA 2ZITA 2JVRA 1PBAA 2E2OA 2HZVA 3FUYA 4IEEA 5GMDA 4E1NA 2C3YA 4UF4A 3EN9A 3CG7A 2BEFA 3B6OA 2ZZMA 3CTRA 3PCOB 4RW7A 1HBOB 2O8FB 2GV1A 5D77A 1NGCA 3UNYA 2E6MA 4H4OB 1PYSB 2C2RA 3C7NB 4DSFA 3D4JA 1N34J 4C1NI 1MA9B 2XGQA 3VEZA 4HL9A 3CPEA 3HSCA 4O3OA 3OXLA 5DZ6A 1J53A 4WFNQ 2P9LB 2DISA 4QQBA 4A5BA 2IVFB 1GLBG 3TUPA 5B8HA 5GMEA 5TKYA 3AB2B 1LCUA 4K7QA 2B5JB 2PYJA 4ZVQB 3T69A 2UXDJ 1RBOB 4CFAA 3MEEB 5KOWA 3KUHA 4A8SA 1E6VB 1NLKL 5C2GA 3FMWA 2C3UA 5HO4A 3JXOA 2KM8C 4OKJA 3OYCA 3WQPA 3T7ZA 4JYAJ 4EBEA 3RZAA 1RDCA 1WC6A 4FVCA 3M8PB 1RT4B 1ZOTA 1K0TA 1FRIA 2HSEB 2GCFA 3OT9A 4H4KC 4LF9K 5BN9A 4Y0FA 2XMMA 3CMES 3W8PA 2E5LF 2Q43A 3TAQA 4YY3J 1RADB 1VFJA 3KHLA 1X9SA 3UDEA 3SPYA 1ZH5A 3MXIA 1Y9OA 4K4XA 4P2MA 1S3XA 4JI7F 2MQPA 2K1RA 2ZJPL 2HSTA 1S1TA 1R0AA 3VQBA 3QERA 2WK4A 3WXIA 3OXFA 3W9IA 2DPJA 1IKXB 5AQGA 2QFJA 2FBTA 4OYPA 1SV5A 1KDNA 3CD5A 2IIRA 3OSPA 1X4DA 2E5LK 1TYQA 1TL4A 4CJPA 4A2AA 4Q0BA 3UVJB 2OAUA 3UN3A 1Y5NB 2OHDA 2HHVA 5D4PA 2D0CA 4JI2K 3CFRA 4O0IA 1YVUA 2Q3SA 5J1PA 4ENOA 4ILRA 5HVGA 2LYVA 4AILC 1FDAA 4M3YA 1NKEA 3BV8A 2UV8A 4M5HA 2D3UA 2CJAA 4CF9A 3EZUA 3RMAA 4DPTA 1FRHA 4X4QA 2LQJA 5K14B 4DTPA 1HMVB 1RK8A 1QZ5A 2UUBJ 2YKMB 5C5JA 3NOGA 3HPHA 1IR2A 3BN4A 4MJKA 3A13A 3KG0A 3ZSYA