3DOKA

Crystal structure of k103n mutant hiv-1 reverse transcriptase in complex with gw678248.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
539
structure length
535
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 143
structure length 535
sequence length 539
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dokA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dokA05
5KFYA 3QO9B 3NGZA 3OL7A 4ED8A 4RW9A 3TARA 2HHSA 3C94A 1W0HA 3O3GA 2XY8A 3LAKA 1RTDA 1X9SA 3S3NA 3DLKB 4RZRA 3M8QB 1RT5A 4KPYA 4ICLB 4U6PA 2J6UA 4BDPA 4M3YA 1RTJB 3QGHA 2XWYA 3MAQA 3BR9A 4CJ4A 2IBKA 4HVJA 2HNYA 4Q0BA 4EBCA 4CF8A 4CHNA 3SI6A 3KKRA 1C0TB 3BSAA 4OGCA 1LWFB 5L1KA 4DLGA 2BDPA 4Z4GA 2JEJA 2UUTA 1HYVA 2V9WA 4N47A 3PW2A 3MXIA 1WSEA 3Q8PB 2EX3A 3ZT1A 4BE1A 3HP6A 3AVMA 4CERA 1VSLA 4CEDA 4O3SA 4HHTA 2IC3B 2E9TA 4ECQA 5L9XA 1WLJA 1YTAA 4I9QA 4CEFA 1VK0A 2B6AA 1HJRA 3KHLA 4KI6A 1B92A 1QS4A 5KT6A 3DLEB 1Y97A 1TK0A 2R8HA 4FJJA 1JLFB 4CF0A 3OSNA 1S0OA 4ZPCA 1JKHA 2ETJA 4MKAA 1NOZA 3BQ2A 3EY1A 4K4XA 3K57A 3PVXA 1ZETA 4GC7A 3MFIA 4DG1B 1NHUA 3OYCA 1NK9A 4FLZA 3I5AA 3DOLA 4U7CA 4CEBA 1DTQA 1UAXA 1DTTA 2QE5A 1S1VB 4QCLA 2HVIA 3AVKA 1ZTWA 4CFBA 3QIOA 4FJHA 3FQKA 2XCPA 1I39A 3CIZA 5KFJA 4QWBA 2HHUA 1RYRA 3VQDA 2G8KA 1T3NA 3CYMA 2W8KA 4BWMA 2Z1GA 1NKCA 4FJLA 3NL0A 4EBEA 3DRRA 1J53A 4HKQA 4M95A 1N5YA 2PYJA 3LP2A 1XR7A 4J9LA 3CO9A 5DGBA 4ID1A 2FJVA 1TL3B 3TAEA 3DM2B 5KFSA 4FCYA 5KFRA 3I0SB 1NJZA 2UVUA 4C8MA 3T1AA 4URGA 4J9RA 3I8DA 1IKYA 1QE1A 3ITHA 4IG0B 3PW7A 4NLTA 4CJSA 1U49A 1RA6A 4MIAA 3AO4A 4KTQA 3OL8A 1TKZA 2HNDA 3TI0A 4KO0B 1GX5A 4ED2A 2IJFA 2FLNA 1BISA 3HPOA 1J5OB 3H4BA 4WYWA 4O3RA 4DQPA 3SZ2A 3VQEA 3M8RA 3KKSA 5DMRA 4DQRA 1YVFA 1QSLA 2X74A 2KTQA 1TL1B 4C8LA 1VRUB 3LP1B 2ZQBA 2BRLA 3KLIB 2ZKUA 5T14A 4F50A 5KT7A 3ISND 1XC9A 5C24B 2DFHA 1YT3A 3CJ0A 2Z1HA 1NJXA 4KB0A 3ICLA 2LSNA 2C2DA 3M9OB 3ALYA 2ZD1A 2ATQA 2OPRA 4DL2A 5D3GB 3MXJA 4QWEA 1ZBUA 3LPUA 1RT1A 5KI6A 4R5PB 3DLHA 4E0DA 4I2PA 1EETA 3KLEA 3OYEA 2FBVA 3RMAA 3L2WA 4ZP6A 4WXWA 3OL6A 3G6YA 3LDSA 4CHYA 3ZSVA 3KLGB 2BE2A 1RA7A 2DPJA 4FLVA 3SUPA 4LQ9A 1TKTA 3M8PB 3MF5A 4CHZA 3RBDA 1HRHA 5KFPA 3RR8A 4DU4A 4RNNA 2NUBA 1TK5A 4TY8B 5CY4A 3OY9A 3I0RB 4BE2A 4E7IA 3QEXA 1LW2A 3GIJA 2R2UA 4O0JA 4RUCA 5L1JA 4TN2A 4ZP7A 5L1IA 1KVAA 4O55A 1RT3A 1ASWA 3QETA 3TAPA 4F2RA 3AVIA 2DFEA 1JLGA 1REVB 2FVRA 4IR9A 4TYAA 4RW7B 1NOYA 3KK3B 1T03B 3PR4A 4ECSA 4ZHRA 4NLPA 3PX0A 3VQCA 2W9BA 3JYTA 1JXEA 5KG3A 2YNHA 4KHSA 3H5SA 4J9SA 3ZT0A 3CFOA 1TV6A 3ASMA 5KFNA 2DY4A 3FFIB 2D41A 2VG7A 1L3UA 4F3TA 3BGRB 4M3ZA 3V6HA 4FBTA 4G3IA 3OYHA 4AHTA 4Q43A 3KLVA 1S1TA 2AU0A 2GBZA 4E7JA 2VWKA 4FZZA 1XHXA 1RDBA 3UIQA 2FC0A 1DLOB 4J2AA 2FBTA 1JXBA 3WNGA 4NLDA 5J2PB 1NKBA 4FK0A 4XPCA 4FJGA 1VSKA 5HP1B 3LWMA 4FJMA 4JS4A 3IS9B 1SV5B 4AHUA 3MFHA 2JGUA 2AGQA 2WONB 2ZE2A 1WSJA 3ZSQA 4CJQA 4OJRA 4MK8A 2BGGA 2WK4A 1KHVA 3F9KA 1JLQB 4O4GA 1KVCA 4NLYA 5HBMA 3H2LA 3PY8A 3QLHB 4CEZA 3H59A 5I42B 2VA3A 1BQMA 4ECRA 3GIKA 1OS5A 3FRZA 2RKIB 2HMIA 1CLQA 2D3UA 1R0AA 3OHBA 2GV9A 5HROA 3NAHA 3TAGA 2UVWA 4PQUB 4M3TA 4KB7A 4B3OA 1WSIA 4OKEA 3NCIA 2HWIA 1VRTB 3NF7A 4NCBA 1FK9A 4CEQA 4JRQA 3CJ3A 3V4IA 1B9FA 4H4MB 1RDRA 4F4WA 4DSKA 3CDEA 3WNFA 5FDLB 3KLFA 3SUQA 4W5TA 1C1BA 4CK1A 4K4VA 5EWEA 1TKXB 4CJKA 1CXQA 3SNNA 4KV8A 2Z1JA 4CE9A 4O4RA 4YQWA 1S10A 3VA3A 1ASUA 3DLBA 3G6VA 3CWJA 4FXDA 3C6UB 2CKWA 2YNFB 3KHGA 3LALA 2Q3SA 4Z4FA 3O3FA 1I3AA 4FVMA 4G1QB 1LAWA 1B9DA 1RBTA 3PX4A 3DYAB 1JLBA 2E6MA 2DPIA 4FLWA 4C8KA 1S9EB 3QNNA 1D9DA 4IG3A 3CFRA 1ZBIA 1IKXB 2QKKA 1WN7A 3E01B 3HP9A 3S9HA 4FLTA 4WE1A 4M42A 3EZUA 4ECUA 1RBVA 3SV3A 3OYBA 1YTUA 5J2MB 3HVTA 4Z4CA 2R2RA 3SCXA 4DQIA 4DTOA 4XPEA 4CIGA 2AWZA 1C0MA 2CJQA 4ZMMA 1HYSB 5CYQA 1BCMA 2FLPA 3OYIA 3DMJB 4QW8A 2OZSA 2IS3A 3NFAA 4E89A 1F21A 3KK1B 4DFKA 4J9NA 3VQPA 1HNVB 5I3UB 4JUZA 3V6JA 3HVRA 2IAJA 1JLEA 1RILA 3RR7A 2XCAA 1RT7B 5HRPA 3QO9A 2AX1A 4DFJA 3ZT3A 2HW3A 3QINA 3WNEA 1VSMA 3VA0A 3CFPA 3MXMA 1NK8A 2W9CB 1S6QB 4MFBA 1RT2B 1TGOA 2Z1IA 1EP4B 5L1LA 3K5OA 3ZSZA 2G8VA 1HARA 4CJWA 3DLKA 3OYFA 1XR6A 4ECZA 1TP7A 1FXXA 3RRHA 3O3HA 3RAXA 1A5WA 1L3VA 2X6NA 4YMEA 4JRPA 4CJTA 2R2TA 2OPSA 3U3GA 3G10A 3JSMA 4K4WA 4CJPA 2HAIA 3IGVA 3C6TA 3KHRA 4NCAA 2HHQA 2YHBA 4O5BA 3KK2A 3PUFA 4JV2A 4ZTJA 3AVAA 3MEDB 1J9AA 4K4TA 5J2NB 4KKOB 4ECWA 5C25B 4OL8A 3HVWA 1EX4A 4DEZA 4NYNA 2PY5A 1KTQA 4TY9A 1S1UB 5DG7A 4KHMA 3L3VA 3QIPA 1S1WA 1JLCA 3TAMB 2HB5A 4NRUA 4NYZA 1T05A 1FKPA 4O3QA 1RDAA 5EWFA 3SPYA 3PZPA 4OPJA 1S97A 4I2QA 2FLLA 3KD5E 2WHOA 4CHOA 3DLEA 4XIUA 3HM9A 5K14A 4FS2A 1Z26A 2IOCA 4IH6A 1C0UA 3OYNA 1IM4A 4HYKA 3IRXB 2G8HA 1T7PA 5KFKA 3TR8A 3KTQA 3LANA 4F4XA 4PUOB 4HCBA 4DG1A 5CYMB 5JS2A 2P51A 4CJFA 4Z4EA 2FVCA 3KMSA 4DMNA 1TVRB 2AX0A 1Q9YA 3K5MA 4H4OB 2O4IA 4FYDA 1LW0B 4JV1A 4R8UB 2KZZA 1S1VA 3QNOA 4YR0A 3NF8A 4JLHA 3IG1B 2XC9A 3QESA 4WZQA 4K4ZA 4HUFA 4CIFA 1HQUB 2C22A 4Z0UA 3MR2A 2BQ3A 4YR2A 1RTDB 3AO5A 4W5QA 1RDDA 2YKNB 4NLQA 1RT5B 5KG6A 4FK4A 1SKWA 2XY7A 3V1QA 4K50A 1S0NA 4ELUA 4O3PA 1TL3A 1NK0A 1RTHA 1KHWA 4DFPA 1NJYA 3RTVA 3OJSA 3DRSA 1TK8A 1VSHA 4CJ5A 2E4LA 3UPFA 2HNYB 4Q0BB 4HTUA 3VQ7A 4BDYA 1U48A 4NLUA 4DSEA 1RTIA 2JEFA 4IKAA 4NZ0A 4O0IA 1NJWA 5C5JA 1TAQA 3MEEA 3U6FA 1BIUA 3T5HA 4LQ3A 4GMJB 4J9QA 3S3MA 3V9WA 4AH9A 4KI4A 3PV8A 2XI2A 2QKBA 3OYLA 1VSIA 5KTQA 4E7LA 1G15A 3OYMA 3DRPA 5F9NA 3NH1A 4RW6B 4J9MA 5HLFA 1VRUA 2QK9A 1Q8IA 4KREA 4KHYA 3KLIA 2WRMA 4I7FB 2B6AB 5J1EB 1MU2B 5C24A 1HMVA 4NLRA 4NCGA 4FZYA 3RB6A 1SL1A 2OZMA 1JKHB 3AO1A 3OLBA 4EP4A 1WNEA 4R5PA 1TKDA 4CF1A 4IQXA 3LPTA 2VWJA 3OSPA 2D0BA 1LWCB 4W5RA 2F8SA 1D1UA 4NLVA 1ITGA 2W7OA 5KFCA 1DTQB 3MR3A 1QUVA 3D5MA 4KFBB 1VSJA 4PWDB 3EYZA 3OYGA 4Z4HA 4RW4A 4F2SA 3TQ1A 3M8PA 4ID5B 3H5UA 3ZSXA 1IG9A 2VG5B 3HPHA 1NK5A 5HRNA 2ASJA 1SH3A 2R8GA 3WNHA 4IDKA 3DI6B 4Y3CA 3DLGA 2XGPA 3LP2B 1JLAB 4TY8A 4CJUA 4DS4A 1FKOA 3T5KA 1BI4A 3RWUA 4ZVEA 2ILYA 5KGWA 1NK6A 4M41A 3IGNA 1CZ9A 5J2QA 1MMLA 2HNDB 4RW7A 4EEYA 4URSA 1T03A 2R7YA 3CJ4A 4CHPA 2WOMA 4IOBA 1GOCA 1KCFA 4E1MA 3VQ4A 5F8HA 3ZCMA 4E1NA 4IH7A 3HO1A 4KTZA 3QEWA 4ZVGA 2JEGA 1BCOA 2OPPA 3H08A 1RT4A 3NH2A 1NK7A 3BGRA 3AVNA 5KT3A 4B9LA 1JL2A 4KRFA 1L3TA 1GOBA 2ZD1B 5T7BA 2G8WA 2OPRB 2KFZA 4M94A 3NAEA 2B4JA 3PO4A 1K1SA 3G86A 2E6LA 4CJVA 2ASDA 3SJJA 2A1RA 1RT1B 1JXLA 1DLOA 1SUQB 3AA4A 4XO0A 4DF4A 2WTFA 5DGAA 3BSOA 3KD1E 1HPZB 5FROA 3NKYA 4FJNA 4GW6A 1HNIA 2IA6A 1SV5A 3K5NA 2YNGA 1XI1A 3NMAA 2F8EX 4YFUA 3GQCA 1JLQA 1RBUA 3QGIA 2HNZA 1RBSA 1ZTTA 1UA1A 2G8IA 3QLHA 4OPKA 4TLRA 2HHVA 5C42A 3P5JA 4J2BA 1U45A 3QIDA 3HJFA 2BANA 2ITGA 4CFCA 5SWMA 4OVLA 3KMQA 1IKWB 5KFDA 4E7KA 2XGQA 4KHRA 2O4GA 1HQEB 3RB3A 1K1QA 3NF9A 1WSHA 4ED1A 3V1OA 3ZSWA 2W9AA 4PQUA 2I5JB 3LWLA 4ECXA 1IKVB 3KLHA 4IFYB 5KFGA 3FSIA 1K6YA 1QQCA 1RT3B 1SL2A 1D5AA 1S1XB 2YV0X 3DLRA 4H4MA 3OS0A 4ZVHA 4CJRA 5FDLA 2KFNA 3L2VA 3OL9A 3TWHA 3VQ8A 3SQ1A 4IRKA 4ZVFA 4IFVA 2PYLA 1BQNB 3NBPA 1JX4A 2XI3A 4FW2A 3RAQA 4Q44A 1QHTA 3OYKA 4HUEA 5KG4A 1U4BA 3PJXA 4LD0A 2W42A 4B9TA 3ZSRA 4ECTA 3LAMA 2BQRA 2VG7B 3VQQA 2YNFA 1CXUA 2JC1A 3V81A 4ZTFA 5DQHA 1RT6A 3AA5X 4G1QA 5KFIA 3CG7A 1ZBFA 4B9MA 1WAFA 4RG8A 4K4UA 1S9EA 5KFXA 1ZBLA 4EZ6A 4CFDA 1IKXA 4DSIA 4KHUA 2O5DA 5KFMA 3RMBA 3KJVB 3DOKB 4CK2A 3C95A 4RW8B 4ZPBA 1VSFA 2JEIA 2HVHA 4FM1A 2ZE2B 2WB4A 3QZ8A 1SH0A 4UQGA 4Q5VA 3DMJA 2IM3A 2D5RA 1RAJA 4QWCA 4WYLA 4TYBA 1NNDA 3KK1A 2Y1JA 3D45A 1C1CA 1HNVA 3MEGB 1S9GA 5I3UA 1BQMB 4Q8EA 3PW5A 3P83D 2QV6A 2HMIB 2QXFA 2P1JA 4WZMA 3L2RA 3T5LA 4CGIA 4KSEB 4B9VA 4Y2CA 1RT7A 4J2EA 5HROB 1SH2A 4EO6A 2C2EA 4N76A 3SQ2A 4B3OB 3NE6A 4MK9A 3QEPA 1EXQA 1UWBB 2W9CA 4AHCA 1S6QA 1RT2A 1XHZA 1EP4A 3SUNA 1SKRA 3L8BA 2I1RA 1HYZA 3KLFB 3HVAA 3AO3A 1C1BB 3SFUA 3M8SA 3SQ4A 2AGPA 3T5JA 1QAIA 1KFDA 2RN2A 4ELTA 5EU7A 2VG6A 2RF2A 4LSLB 1GX6A 4KE5A 4GC6A 4YP3A 5KFTA 2FJWA 5KG0A 4KBIA 4FM0A 5CZ2A 1N4LA 4J2DA 2D7SA 2RPIA 3GIMA 5KFFA 3OYAA 5J2NA 5C25A 4DF8A 1GOAA 4EP5A 2X6SA 1Q9XA 5CZ1A 3BREA 4H54A 4IG3B 4EZ9A 1ASVA 3M8QA 1XWLA 4ICLA 2B43A 3TAMA 2RDJA 1LWEB 5KT5A 1RTJA 5KFAA 3CJ5A 4O44B 3ZT2A 3HXMA 1N48A 2YNIB 3TAQA 1C1AA 5KRTA 3VQAA 4MK7A 1C0TA 3H40A 2UVVA 1LWFA 3AO2A 4F4KA 4NLWA 1RNHA 4K8XA 3UR0A 1C2PA 4IR1A 1WSGA 4R0EA 3KHHA 4EBDA 4PUOA 5KT4A 1S6PB 4AHVA 3VQ6A 4MKBA 4M3UA 4KAZA 2EC0A 4QAGA 2GIQA 4DTPA 1KLMB 2IAJB 4RNFA 4H4OA 1LW0A 4R8UA 4EO8A 4QW9A 4J9OA 4AHRA 1ZYQA 2WCXA 2IC3A 2YKMB 3GV7B 3B6OA 3IG1A 4BWJA 3QEIA 3V6KA 1RCHA 3HSTB 3VQSA 4DTJA 1KSPA 1BGXT 4NLXA 1HQUA 5KG2A 4MFBB 4RNOA 1RYSA 1BIZA 1JLFA 3LP0B 3V6DB 3KOAA 3P1GA 3LZIA 2YKNA 5KFLA 2X78A 2FVPA 3QERA 4LSNB 3MECB 2IM1A 3Q8SB 5F9LA 2OPQB 3IAYA 4F3OA 3PO5A 4FK2A 2B5JB 1D9FA 4DQQA 4Z4IA 4DU3A 2OPSB 4CGGA 2EHGA 3BSCA 4TXSA 3JSMB 1N6QB 3SYZA 3UDLA 1X1PA 3C6TB 3HHKA 4M3XA 4KB1A 3TABA 3KK2B 4IRDA 4ECVA 4RW9B 5JUMA 1U09A 2JC0A 2XHBA 4DTSA 3GV8B 5KFWA 4RW6A 2IDOA 4K4SA 1ZBHA 3QIPB 3DDKA 1KLNA 3QYYA 3RRGA 1S1WB 1JLCB 3BDPA 3HYFA 4CHQA 1UOCA 1T05B 3BSNA 1FKPB 4DFMA 3CQ8A 4YR3A 2W8LA 5SZTA 3E51A 2C28A 4I7FA 4URQU 3DM2A 2P5OA 5J1EA 4I2QB 1MU2A 3I0SA 4FM2A 5K14B 3H5YA 4DTXA 4FJKA 4KAIA 3EPGA 1KFSA 4W5OA 4WXOA 4RNHA 1C0UB 4CGJA 3RB4A 4CECA 2IJNA 4IG0A 1WNSA 4CJ3A 1I6JA 5F8LA 3V9XA 4DLEA 2F96A 3GYNA 4BE0A 3OS2A 4KO0A 2HHTA 4WFYA 4OKJA 2D3ZA 4M45A 2BRKA 1LWCA 1J5OA 3Q8RB 5KG5A 3I5CA 5F8JA 2XY5A 1TQLA 4MIBA 4CJLA 5KFEA 4J9KA 3CM5A 4KFBA 4DL7A 4PWDA 5JS1A 1TL1A 1S49A 4K4YA 3ZSOA 3PJWA 1X9WA 4C8OA 3LP1A 4F4ZA 3M9MB 5JXSA 2DFFA 3SPZA 4ED3A 4FJ8A 4ID5A 3L2UA 4TQSA 3NH0A 2VG5A 4WFZA 3AA3A 2BQUA 1VSEA 3FQLA 2VA2A 3CM6A 3DI6A 4CIEA 5D3GA 4E19A 4L8RB 3NAIA 1JLAA 4QWDA 1T94A 5KRSA 3TVKA 4LH5A 1RTHB 5F8NA 1S48A 3H5XA 3ZSYA 3DRSB 2OA8A 2A1SA 2F8TA 2IM0A 3DOLB 4OKKA 1UA0A 1RTIB 2AGOA 3KNAA 3KIOA 1DTTB 3O4NA 2J6SA 2R8KA 3MEEB 4CCHA 1W25A 5KFQA 3KLGA 1BL3A 4PY5A 3VN5A 4NLGA 5EWGA 4Q45A 3V9SA 3S3OA 4OLAA 3ZT4A 1A5VA 4FJ9A 4I9LA 3D0PA 3OYJA 3SV4A 5FRMA 2FVSA 4DSFA 3CVKA 3DRPB 2R2SA 3DRRB 2V0NA 2XO7A 1N5YB 4KHNA 5HLFB 4HCCA 1EKEA 4AHSA 4F8RA 4IBNA 4CESA 3I0RA 1D0EA 1C6VA 3AVJA 4N5SA 1BHLA 1HMVB 4NCGB 3AVLA 3LZJA 5F8IA 3EPIA 2KW4A 1IKYB 1QE1B 3PR5B 3OVNA 4DSLA 4B9UA 3ITHB 5HRSA 1T8EA 3K59A 1REVA 4M3WA 3PX6A 2D0AA 1SUQA 4ELVA 1TKZB 5DQIA 4C8NA 3KK3A 3CDUA 1NKEA 4LY7A 3TAFA 1HPZA 4NLOA 3T3FA 3BQ0A 3OLAA 4WFXA 4B8CA 4DTNA 1TAUA 3HK2A 4NRTA 3ISNC 4RW4B 4IRCA 2FBYA 1SKSA 2P5GA 4Y1CA 3FFIA 3T19A 4DU1A 3OS1A 1L5UA 4CFAA 3NGIA 1L3SA 4RNMA 4ED0A 3GIIA 3L2QA 1CZBA 2HHWA 2D0CA 4B9NA 1IKWA 1RDCA 4IDKB 3L3UA 2ALZA 4DL3A 4FJIA 3DLGB 1HQEA 2G8UA 1O1WA 4OGEA 2DTUA 2ASLA 4I2PB 1EETB 3KLEB 1FKOB 3GV5B 5EUHA 5J2PA 4FBUA 2I5JA 3K58A 1IKVA 5HP1A 3N6MA 1BI4B 4IFYA 1KRPA 2E9ZA 2Y1IA 1NK4A 5KFHA 4DSJA 3IS9A 2XRIA 4BDZA 3BQ1A 1QSSA 4IH5A 1S1XA 2JLEA 4FJ5A 2WONA 5J2QB 2BE2B 4X2BA 3RMDA 2V4QA 1S9FA 3NDKA 3N6LA 4CF9A 1TKTB 2YHAA 3MR6A 4ZP9A 4MH8A 3QGGA 5DG8A 2WOMB 3O4QA 5I42A 3AVHA 1BQNA 3MTKA 3B6PA 4B08A 4NYFA 3V9ZA 5KFOA 4CGDA 4CEAA 2RKIA 4M3RA 1U04A 1WAJA 3OHAA 3V9UA 4RUAA 3G0ZA 2OPPB 3ULDA 1RT4B 4O3NA 1LW2B 1IO2A 4FLUA 4O3OA 2ILZA 1D8YA 4Y2AA 3AVGA 4IKFA 4DWIA 1Z25A 5KFZA 4E7HA 4FZXC 1VRTA 3RB0A 4CGHA 3NHGA 3Q8QB 4ZPDA 1JLGB 3M9NB 2HWHA 4KHWA 3UQSA 2OH2A 2GIRA 3RBEA 4ZHRB 4DL6A 3NF6A 4FLYA 4GVMA 2AJQA 1S0MA 1XR5A 4J9PA 3KJVA 2GC8A 1TKXA 3DOKA 4N56A 1HNIB 1S4FA 4FS1A 2W9BB 3JYTB 4ZP8A 5KFBA 4ZPAA 5KG1A 1CSJA 5DLGA 3VQBA 4RW8A 2YNGB 2YNHB 1TV6B 3QEVA 4Y34A 4DTRA 3C6UA 3NGDA 3V1RA 1SL0A 4E3SA 4Y1DA 2HNZB 2GUIA 4KHQA 5KG7A 3N6NA 3EZ5A 5KFUA 3K2PA 5C42B 4NLSA 4JV0A 4ED6A 2BANB 2FVQA 5DLFA 3MEGA 4DL5A 1S1TB 2UVRA 3DYAA 4CK3A 5EDWA 3LP3A 3K5LA 4K8ZA 3PW0A 3QZ7A 5HRRA 2C2RA 1WSFA 2UUWA 3PHEA 4AILC 3U3YA 1RBRA 4W5NA 3E01A 2HHXA 3D28A 3KLHB 4EYIB 4DTMA 4HUGA 5J2MA 4DQSA 1UWBA 3HL8A 3NGYA 2R8JA 1U47A 3H4DA 2E9RX 5DQGA 2W7PA 4QPXA 1HYSA 4O4GB 1X9MA 5HBMB 2J6TA 3HPGA 4EYHB 4IFVB 2FJXA 3NBPB 1JL1A 4B8AB 4FW1A 4TQRA 4LSLA 4MQ3A 2BR0A 1VSDA 1LAVA 5E41A 1KVBA 1Z4UA 1R0AB 3H98A 3BJYA 3CDWA 3V81B 4LH4A 4Q8FA 4QWAA 4F4YA 1RT6B 4RU9A 5F8GA 3SUOA 3AV9A 4PA1A 5KFVA 4KTWA 3A2FA 4TSXA 3VQ9A 4ECYA 3RMCA 3OYDA 1FK9B 4FLXA 1YVUA 3V4IB 3CJ2A 4JS5A 3AVCA 1LV5A 3VQ5A 4B9SA 1LWEA 4O44A 2AQ4A 1QAJA 3IN5A 1S5JA 2YNIA 3SQ0A 4ED7A 5DG9A 3SI8A 4KV8B 2ATLA 2KZMA 3MR5A 5KT2A 5F8MA 3HKWA 3AVBA 2FBXA 4QOZB 3MEDA 4YNQA 1S6PA 4KKOA 5KGXA 1NHVA 1C1CB 1S9GB 2PZSA 1IH7A 1JLBB 2V4RA 4DS5A 1KLMA 1S1UA 4DTUA 1J54A 2KQ2A 3SFGA 2IGIA 3AVFA 4CF2A 4OLBA 2YKMA 2R8IA 4WE1B 3PW4A 2RDIA 3HVTB 4FJ7A 2XY6A 3FDSA 2IM2A 5FRNA 3LP0A 3V6DA 1QTMA 4DL4A 1A5XA 5CYQB 3GILA 4CGFA 3HT3A 4N41A 3I5BA 3IRXA 4LSNA 3MECA 3AA2A 4CEEA 1N56A 4BACA 1W9HA 4CEOA 4H8KA 2OYQA 2OPQA 3OJUA 2G8FA 2IMWP 1JIHA 5CYMA 2B5JA 4FJXA 1TVRA 2VG6B 2RF2B 1JLEB 3G6XA 4CJEA 5DK5A 3TANA 3THVA 1QSYA 1N6QA 3F73A
chains in the Genus database with same CATH superfamily
5KFYA 2BV3A 2IVNA 3K2YA 4B02A 4RW9A 1EWQA 2XY8A 4FPRA 1KEKA 3ELHA 2IIRA 1X9SA 4DV4F 3DLKB 3M6VA 4RZRA 4U7UD 4ALZA 4NPOA 4ICLB 2CGJA 4U6PA 4P6QA 2JL9A 4Z2XA 3BR9A 3LDQA 2HNYA 4Q0BA 4CF8A 4CHNA 3HHLA 3SI6A 3MMCA 1U2RA 4YB6A 2DYAA 2DHHA 1LWFB 3KUGA 4IOCQ 1U1LA 1NB7A 2FJEB 2UUTA 1N34J 3DXMA 2NYHA 4WP8A 2AD9A 3K7RA 1PYTA 3TJ8A 3HP6A 3ENVA 2QM1A 4ZPVR 2GW8A 1SJFA 4HHTA 2IC3B 2NPFA 3T9ZA 4ES1A 4G65A 4ECQA 4LF8F 1YTAA 4CEFA 4RKUC 1VK0A 2UUBF 1WI6A 1EQYA 5D0RA 4FJJA 4MMOA 4J91A 3OSNA 4JI6J 4ZPCA 1KBRA 3UB5A 3QT5A 3BQ2A 3EY1A 5C2CA 2YH0A 5CYJA 1BD6A 1NK9A 3RW7A 1FRJA 4YB7A 3J7YI 3D6TB 5HK4A 4J37A 1DTTA 2MQQA 4DU8A 3HSGA 2Y0BB 2L48A 3FQKA 3CIZA 4J5OA 2DNMA 1T3NA 3VEVA 4I69A 3CYMA 3ILLA 3JAMO 2EFPA 1Z2LA 3D7SB 3TX8A 2K1RA 1N0VC 2IPOB 4XAKA 4HKQA 1N5YA 3KG0A 2Z2MA 3GFZA 3LP2A 3N79A 5CCMA 1N36J 2L9NA 1CQMA 3A4TA 2AEJA 2RRBA 5KFSA 4FCYA 4JI5J 3J8AA 4C8MA 3TP2A 3G25A 3I8DA 1IKYA 3MCPA 2HHPA 1QE1A 7AT1B 3UNYA 5IZHA 3MOZA 4EGLA 5ADZA 3AO4A 1VQKS 5C7PA 3TI0A 4B3TK 3ZETA 3CCTA 4ED2A 2CPDA 4RO0A 2HFZA 2VDHA 3H4BA 5E3AA 3CPWM 2ZJQQ 2OKQA 4AM6A 2L08A 4Y2KA 1GLEG 2F1FA 1WUAA 1TL1B 3VPZA 5LY3A 4JV5J 2HK2A 2ZKUA 2DVIA 3CMAS 3ISND 4BRMA 4GVBA 5C24B 1YT3A 3E66A 3ICLA 2LSNA 1VC0A 3ALYA 4FNHA 1FFSB 2DR5A 3MXJA 3DLHA 3GOIA 2FY8A 1FWKA 3R1LA 3KNGA 1OH5A 2HHHJ 3SQGA 2BJ8A 3CTRA 2RH3A 2G2OA 2DCUB 3L2WA 1XNQJ 1MROB 4I6YA 3LDSA 4CHYA 2HLUA 2ZDOA 1UVLA 3KLGB 1GLLO 4FLVA 2PI5A 3SUPA 1UFLA 1QDUB 4LQ9A 1DZ5A 2PEHA 3M8PB 3RBDA 3D0IE 3RR8A 4LIWA 5KFPA 5CE3A 5M2UA 4ZLJA 1HI8A 4YS2A 4TY8B 4GKKK 3I0RB 5IV3A 2KH9A 3C2PA 1LW2A 1QQNA 1KQSM 3FSYA 4BGBA 1IBLK 4JD2A 3R8YA 4TN2A 2KHDA 2XLJA 2Q2RA 5IT9U 2DGUA 3TAPA 2O8BB 5LXRA 3AVIA 3H8YA 3CCEN 3TZZA 3THXA 4RW7B 4YY3F 1WC6A 3KK3B 1T03B 1HBNA 2XULA 2JRSA 5EX0A 1UFWA 2E2OA 4A8KA 1JXEA 2YKAA 2OANA 4DN9A 1TV6A 4ZIWA 2AP1A 3ASMA 1VJQA 2LP4A 2R7RA 2F7VA 2V5HG 1R27B 1TR0A 2XYGB 3C15B 1CJUA 2HSTA 2A18A 4JK8A 3BGRB 4ZN3A 1X3NA 2PSZA 3OYHA 4AHTA 2B4OA 4Q43A 2AU0A 3M2VB 4OX9K 3IMQJ 3LDOA 1TMMA 2FC0A 4J2AA 3J7ZO 2E1PA 5J2PB 2HFSA 1VSKA 3LWMA 1VQPN 1V5IB 2M70A 3SXLA 1SV5B 1FD8A 1X4BA 4AHUA 2OHDA 5AQSA 1GH8A 2LFVA 1HNZF 2BGGA 3W9JA 2WK4A 1KHVA 4UUXA 4NLYA 1K0VA 1VK8A 3QLHB 4CEZA 2EFQA 1FXLA 4HI2A 1VCTA 4M63C 3MN5A 2QYCA 3UCGA 2GQ2A 3J80Y 1ATNA 3A1YG 1WJ9A 2EVZA 4DHYA 5HROA 5AQYA 2CIMA 3KG1A 3TAGA 1F2HA 2UVWA 3DXBA 4PQUB 1NLKL 4M3TA 1RLDA 3US5A 3NCIA 2GO8A 3SBMA 1FK9A 4JRQA 3FK4A 1WHWA 2MZRA 1RDRA 4F4WA 4DSKA 2VHGA 3EGNA 4CBXA 2VQEK 1F5AA 3SUQA 4CK1A 1U1RA 2ASYA 1TKXB 2Z0GA 3N0VA 3SNNA 1N33K 1ZAVA 3CJRA 3VA3A 2BJEA 1NMDA 3C16B 2YWKA 4CIOA 2DNPA 3DLBA 3SEOA 3GPAA 3CMQA 1Y3JA 4FXDA 2ZC3A 4IEEA 3JTPA 4NXNK 4A5AA 2LQBA 2EFGA 1R8BA 2UXBF 2GJFA 4NE9C 4HACA 4G1QB 1LAWA 1VIOA 3TSUA 1RBTA 3CJAA 5A6WA 4RWTA 4RBTA 1ZBIA 1IKXB 3OR2B 3RG6A 2ZKTA 3M05A 2DITA 3S9HA 1P27B 2QWLA 4JI1K 3OYBA 5AZJB 1YTUA 2OTLN 3W2VB 4DQIA 4CIGA 2MY7A 5F0UA 2HZAA 2CQ2A 2CJQA 4ZMMA 3BYRA 3DHWC 2AV5A 1VQ7S 2A42A 1NMEB 5AQLA 5L46A 3U1LA 2IS3A 3NFAA 4DFKA 4OYOA 4ES2A 3VQPA 2AF6A 3VMFB 3HVRA 5AXNA 5K8OA 4H0TB 1RILA 3U7JA 2B9EA 2FGOA 2XYPB 1RT7B 5DS7A 1Q82O 5IC4B 2HW3A 3QINA 2P9LB 2HQFA 5DDPC 3WNEA 1U1OA 2ZHOA 3VA0A 2F4VF 3CFPA 3MXMA 4YB5A 1NK8A 4EFHA 3DGPB 4MFBA 2G8VA 4LF2A 3DLKA 3OYFA 1XR6A 1YK9A 5IT0A 1TP7A 3RBZA 4ECZA 2W4DA 1L3VA 3F5TA 3U8XA 2KXFA 3VEZA 2R2TA 2RB7A 2I38A 2RQ4A 1S99A 3C6TA 4DR6J 1NMNA 3KHRA 1WOPA 2HHQA 4JV2A 3MEDB 1SC1B 4K42A 2P8IA 3CIMA 5C25B 3C46A 2B0GA 3L7OA 2PY5A 2O8DA 4BRHA 1KTQA 2VQFK 4BQLA 3OT9A 2C2MB 3QIPA 3TA2A 1AW0A 4NRUA 2QX0A 3HFVA 2EK1A 1RDAA 5KOXA 3PZPA 5GADP 1J5EJ 5DO2A 2RJZA 1DQ9A 3JQKA 4I2QA 4JI7F 1ZZNA 1TELA 4XIUA 3KJNB 2GFFA 2CJKA 4FYXB 4W4MA 3Q2SC 2QWQA 3OYNA 1H3DA 1VAZA 3IRXB 3FEYB 3O9RA 5KFKA 4F4XA 4KGZB 4C2MA 4KGMA 1I1GA 1FNOA 4ANDA 4CLYA 5JS2A 1Y11A 1Q9YA 3MOJB 3HT0A 4NOHA 3K5MA 3VEXA 4FYDA 1AZSB 3OTBA 4JV1A 4R8UB 2KM8C 2YKQA 2CNOB 4LFBJ 4JLHA 3QESA 1CQNA 1Y5LB 2A5XA 3DGVA 1LXJA 1HQUB 4XDCA 1Q86O 4MTPA 2QWRA 2JDJA 2OTJS 5AR0A 3AJ1A 1V5VA 2CQDA 2KKHA 1RTDB 3NVMA 4W5QA 2O01C 4DUZJ 4OHXA 3ZX0A 1N34F 3V1QA 5A2QY 4GO7X 3O80A 4ELUA 4O3PA 4YN3B 3W5ZA 1NJYA 3RTVA 3OJSA 1VSHA 3D3BJ 1TL5A 2N3OA 4NLUA 2ZEJA 1RTIA 3VGTA 3QFPA 2DNLA 4IKAA 4WIIA 2HRTA 2MGZA 5C5JA 1A6LA 1CULB 3U6FA 4LQ3A 4GMJB 3Q0AA 3A8KA 3JTOA 1BLUA 1P9QC 4AH9A 5F0XA 3PV8A 3CQYA 4BRQA 3OYLA 3MMVA 4DPTA 4JI6F 5EY4A 4BRCA 1TL4A 3OUYB 4RW6B 4J9MA 2UUAJ 2QK9A 4KREA 4KHYA 4OZ2A 1QZ5A 4NL5A 1SJ4P 3MURP 3UD3P 1ITPA 1V4SA 5C24A 2XSFA 3I82A 5K20B 1JQGA 1UEKA 4CZEA 2OZMA 4ZS6A 2MZJA 1YG0A 2AJ1A 4FWPA 2HGMA 1RU1A 2OEJA 5AE1A 4IQXA 3TZYA 4IJAA 4WFNL 2A6OA 2P9UB 3JQJA 4LF7K 4DL0C 1MROA 1TUVA 5B0FA 1DTQB 3MR3A 4Y28C 5DDRC 4MLEA 4QS8A 1N36F 5ETKA 2OMLA 1ATRA 3TQ1A 4JI5F 3M8PA 5LT5A 2MSTA 5FPMA 2BVZA 3VZIA 2VODA 4KYZA 4NO7A 2V8PA 3FC9A 3WNHA 1VGYA 1P6TA 4KH5A 3P4IA 1NDPA 3LO3A 3LGHA 2QFJA 4TY8A 3J7YU 4OI4A 4ZIVA 2E20A 4DS4A 1B4SA 4ZVOB 1T9TA 3W2WA 3BDEA 1BI4A 2AJ2A 2DGQA 1VQNN 1OH6A 1RK8A 1N36K 2O8BA 2L3MA 1R8CA 1CZ9A 4CZLA 5J2QA 1U8WA 5IT4A 2HNDB 4RW7A 2KG0A 5BR9A 1T03A 2WAQD 4DV0J 4K2XA 2WOMA 4WKRA 2DRBA 3KVGA 4IOBA 2P9PB 1YJ7A 2ZBRA 3MM6B 4E1NA 3W60A 3PEJA 4NA1A 2HWTA 1BCOA 3C15A 2RRNA 4OYMA 5AFUH 3BGRA 3AVNA 4LF5K 2V6AA 4Q2LA 2G8WA 2B4JA 2E6LA 3M2VA 1WBBA 3SJJA 4GVLA 2A1RA 4B1XB 1RT1B 2HGNA 4JV5K 4NA3A 4I64A 4XO0A 2WTFA 3OTEA 2L9WA 2EI5A 3OBYA 1HPZB 3H6EA 2KM8B 1YRXA 5AXKA 4GW6A 4U8VA 3V2UC 3CJKB 1SV5A 2YNGA 1FXDA 1NWKA 3CCQS 2EBGA 1VQ4S 2F8EX 3TTFA 2HHHK 3QGIA 4C9DA 3FGVA 1ZTTA 3MM5B 3EM1A 4LRAA 3VENA 3QLHA 2YWFA 1XNQK 2EXUA 1T9VA 2P9CA 3CB4A 1R8HA 4OHYA 1HNWJ 4UTGA 1VQ8N 1IKWB 5KFDA 4BROA 1FEHA 3DNCA 2B9YA 3R1HA 3RB3A 1K73T 1K1QA 1WSHA 3IKMA 3TPQA 1L3KA 3ZSWA 4HH0A 4PQUA 3O1WA 3AGRA 4ECXA 1IKVB 3KLHA 5F0WA 5GIOA 1WKKA 1RT3B 5G0RA 2EC2A 4JK9A 2OMOA 2Q0UA 2YV0X 3DLRA 4ZVHA 5H1SQ 1RU2A 4IRKA 1H7XA 2GIFA 4OYIA 3NWRA 3NBPA 1JX4A 3RAQA 3CJQA 3SBTA 4Q44A 3OYKA 3C16A 3SBGA 1OMSA 5BYQA 4LD0A 4GV9A 3ZSRA 4ECTA 3LAMA 2KYXA 4B1UB 2JHEA 2P9SB 4OZ5A 2VG7B 1NEEA 2ZH4A 1NAQA 3V81A 4ZTFA 3CW2C 4WCEQ 1JNRB 4B17A 5A8RA 1M5HA 4G1QA 4ISFA 3VAMA 4FPIA 4CH0S 1WAFA 4K4UA 4ILLA 3MCOA 3QAEA 1VIXA 4TNOA 2HEKA 1ZBLA 4DJBA 2QLBB 4F25A 1IKXA 3I55S 3BEGB 1N8RT 5KFMA 2XMKA 3RMBA 2X1BA 1IBKK 3KJVB 2U1AA 3UI3A 3ENAA 2C2NA 1YAGA 4OI6A 2VU5A 4CO4A 1NJIO 2ZE2B 2WB4A 4ZK7M 4EIAA 4Q5VA 3PIPQ 1AUDA 3FEZA 4QIGA 3SCJE 2D5RA 2WSEC 2A40A 4FNIA 4FSVA 4TYBA 4U67Q 2XS2A 2Y1JA 2J9EA 2RE2A 1S9GA 4USVA 1XJWB 1OPZA 2QV6A 2HMIB 3BF4A 3L2RA 4PAAA 4B9VA 1I5OB 3UR3C 1RT7A 1RB0A 4J2EA 1WC5A 2HBLA 4EO6A 3Q8YA 2C2EA 4ZDNA 3L3CA 4ERDA 3SQ2A 4C0OC 4CZMA 3DGPA 4WQ5C 1SKRA 1RAEB 1YJWS 6FD1A 4CO2A 1HYZA 3JSRA 3MWPA 4USMA 2ITMA 1EO1A 2MHNA 3N9UC 2PA3A 3M8SA 2AGPA 3ZZUA 4DX7A 1ULRA 5EU7A 2ATCB 4LSLB 2VKRA 2P9EA 4GC6A 2Q79A 5KFTA 4L75A 2D7SA 4PWWA 1EHWA 1EKSA 3OTOK 2Z8QA 3H7HB 5C25A 1Z2ZA 4WIQA 1Q9XA 1JB0C 3VV2B 3ENHA 5J1PA 1H72C 1ASVA 4TLQA 3MM8B 2B43A 2DH7A 3S7RA 2YHWA 4K0KJ 2RSQA 2E44A 4O44B 1ZM9A 3HXMA 2AKWB 4Z7YA 1OPIA 1W97L 2YNIB 1VLYA 2W2QP 5KRTA 4WKYA 3K9KA 4XTTA 1HLUA 1SPBP 1MMDA 4M5MA 3H40A 4YOEA 3UR0A 1REGX 1WSGA 1NSKL 1FDAA 3KHHA 2V51B 3A3OB 4M63A 4EBDA 3VVTA 3RBXA 5KT4A 4MKBA 2DRAA 3BGUA 2R7VA 3T41A 4OI0A 1WG5A 1SKUB 3IR5B 3MN7A 1PILA 4R8UA 2JWKA 3O8MA 5E33A 3B6OA 1UKUA 3QEIA 1KSPA 1HQUA 5KG2A 5AQZA 2V9KA 3ZO7A 1BIZA 3IWNC 2FZGB 3HMJG 3UFCX 4DR6F 1MG7A 2FVPA 3QERA 3MECB 5CA5A 3Q8SB 4RU2A 5F9LA 2OPQB 1FDDA 1SQGA 2C3OA 2B5JB 4LR7A 1VQ6N 4BRDA 4C8ZA 4JKGA 2CH5A 4TXSA 1WC3A 3UDLA 4TU9A 2NPIA 1ZS6A 3TABA 2DHGA 5HSPA 3QSYB 5GAGU 4KR0B 5AQMA 2FC8A 2PEBA 4CBWA 4AM7A 2COLA 1HNXJ 5KFWA 3OUYA 4RW6A 3DHXA 5IQ6A 4K4SA 5A0YB 1YIJS 4DR6K 3RRGA 2RHKA 2B56A 3VETA 3AODA 4CHQA 4CZJA 3DM2A 1NB2A 2DNKA 3GCWP 3I0SA 4DPOA 5K14B 3R5JB 1HI0P 3GP9A 2C3PA 1KVIA 1QHAA 4LFBF 4JI4F 2IJNA 2YPZA 1J5EK 2W6KA 2F96A 4BE0A 3OS2A 1S76D 4WFYA 3MAHA 4M45A 2R7SA 1J5OA 4UY8O 4RR5A 4OHZA 2H9ZA 3D1OA 3NCRA 4DUZF 5KFEA 3A3PB 1RCXB 2JJ4D 1VK3A 2A6AA 2BA9A 1S49A 2M8DB 4W98A 4F4ZA 3M9MB 5JXSA 4RTFD 1H2UX 3EGZA 3D6FB 4ED3A 1FFWB 3L7PA 3CERA 3SSSA 2Z58B 2PC6A 1VSEA 4V19J 2E5LK 3H90A 3DCAA 3X3UA 4RLEA 1P8GA 4CIEA 5JVHQ 4A8QA 5D3GA 4E19A 3FUYA 4L8RB 3NAIA 2HQGA 3TVKA 3D2WA 1RTHB 2OA8A 4RPFA 4OKKA 4JKEA 4ES3A 5D6GA 3KIOA 1OSDA 3LM2A 3CF5Q 2HBQB 8ATCB 5KFQA 4WTYA 1H2VZ 4JEPA 2FXUA 5EWGA 4Q45A 3L4BC 3S3OA 3D0PA 2MQMA 3FZMA 2P9PA 1CC8A 3CVKA 2UXCJ 3DRRB 3NGSA 4H4KC 4P9SA 1VFJA 5HLFB 4FPBA 2LU1A 4AHSA 3BB5A 4F8RA 1FX4A 3P45B 1Q81T 2ZOMA 1LOTB 1CPZA 3PFEA 1OY9A 1BOTO 2DXFA 4NCGB 3AVLA 3LZJA 2E5JA 4EHTA 2KW4A 4QJVA 2UUAK 1GK8A 1FWPA 3U9ZA 4DR5K 1J2VA 5LXYA 1HPMA 2V2ZA 3LGMA 3P49B 1TYQA 1TKZB 2D3O1 1HPZA 1QTNB 3T3FA 4DX5A 1SQEA 3OLAA 3OBWA 4KH6A 1ZM3A 4IYQA 2Z2YB 1TAUA 1WKJA 4NRTA 1RBLA 5E26A 4RW4B 2HS0A 3EN9A 1RHUB 1SKSA 2P5GA 3FFIA 3T19A 4RNMA 3MM5A 1CZBA 1SIZA 4CZHA 4B9NA 3THWB 1IKWA 3CJ1A 4IDKB 3L3UA 1NM2A 4FJIA 2N7YA 4M5LA 2HLTA 1F5CA 4HLBA 1Q7YT 2BJ1A 2PMWA 3QMLA 1JCEA 1HW8A 4I2PB 1EETB 4DV0F 1FKOB 4Y0FA 2DNNA 4RX6A 4JAXA 3OFGA 4ED4A 3K58A 1IKVA 3CMES 2QXLA 4DSJA 3IS9A 4IH5A 2R7UA 4H03B 1MWKA 3G71S 2V4QA 1S9FA 4GNIA 1Y0HA 2A2CA 2YHAA 3MR6A 4MH8A 3E9PA 3O4QA 5I42A 4X4PA 4FF1A 4WP9A 1OJ4A 2RKIA 1HD0A 3EICA 1U04A 5ETSA 1WACA 3G82B 4CLUA 3G0ZA 2OPPB 2YKPA 1F9EB 2WZ1A 1KOOA 5CZVA 3VEWA 4Y2AA 4DWIA 2GMHA 4E7HA 4FZXC 4ZKAA 3RB0A 4JYAF 4CGHA 2R7XA 3NHGA 2JNJA 2HWHA 1WEXA 2LXIA 3PJ9A 2ZOFA 4P74A 2JVOA 2AJQA 4PYDA 2UUCJ 3GL1A 3KJVA 1HNWF 5IFMA 1HNIB 2W9BB 5KFBA 4ZPAA 2ZOGA 3VQBA 1QAXA 2DGXA 2YNHB 3ZNUA 4H0VB 4Z7CA 3NGDA 4E3SA 2HNZB 2QT7A 4MT1A 2QJ3A 5HN0A 4AFFA 4X64F 3VGLA 1P1TA 1XK8A 4JV0A 2GWJA 3JTNA 2R7TA 2BANB 5DLFA 2XYHB 2UVRA 2W2NP 1U26A 3IFEA 1G7CB 4K2JA 1WSFA 2PN6A 5BN9A 1Z05A 3PHEA 4X62F 1RBRA 1UW4A 1GXLA 5LSLA 3LDNA 3D28A 2VBWA 2DRDA 4DTMA 5J2MA 4OYZA 3WHIA 3HL8A 1RGVA 3EE8A 3WX4A 1U47A 3HSCA 4BRKA 1GLDG 1RAIB 1FRKA 1X9MA 3AQOA 1V6HA 3HRGA 3NNAA 4EYHB 1KOHA 4IFVB 3UWTA 4ID8A 5A8KB 3T1HK 1Q95G 5AE3A 4FW1A 4TQRA 4LSLA 3LW5C 1F9HA 4LF6K 5LSOA 3S41A 1D3WA 1LAVA 2PMZD 4B1WB 1RKJA 1ZAXA 1Q5VA 3I32A 2V50A 4LH4A 1IR2A 3GBTA 1VYAA 4F4YA 1RT6B 1QQOA 4RU9A 3IFRA 1O8BA 2IRXA 3VQ9A 4KT0C 2I7NA 3HULA 1KR4A 3AVCA 3MM8A 1CJVB 4I1TA 4B9SA 5M1OA 2JLGA 4WPAA 4O44A 1NGCA 1RBOB 1QAJA 2ZM6J 2YNIA 2M52A 1FT8A 5DG9A 2NZTA 4ZVUB 1B64A 5I3QA 4V19S 3BPSP 4M5IA 4CO3A 5EX3A 5F8MA 4FWQA 2H54B 1NGIA 4HR2A 5A8WB 4EK2A 2F5GA 4QOZB 1C1CB 1JLBB 2B7BB 4DTUA 3MI7X 2KQ2A 3MM9A 3FNNA 3AVFA 2MKJA 4OLBA 3WQPA 2XNRA 1UMJA 3QRRA 3CCVN 3PW4A 2RDIA 1Y7PA 3HVTB 3CCSS 4C8YA 1V3SA 2Z30B 3Q7BA 1MN7A 3EUNA 1DHMA 3KDOA 3GILA 4DL4A 3HT3A 3I5BA 3MECA 3FMWA 4CEEA 1N56A 2OYQA 2OPQA 2WTUA 2G8FA 1NGDA 3VAFA 5AJ3K 5CYMA 2B5JA 2RS8A 3D0HE 4ZLLA 3JSBA 1WWHA 3KWGA 1VHXA 2IVPA 1JLEB 3MWBA 2GAHC 4DV2J 1S3XA 2KYZA 3NGZA 2AJ4A 2KXHA 2CDQA 4NWBA 5A0YA 4IO9Q 3SSRA 4KPYA 4OYXA 2DIVA 4BDPA 4M3YA 1RTJB 2XWYA 2UV8A 3CPWR 4KGKA 4BRLA 3AJ2A 1DURA 5GAEI 3KKRA 1C0TB 4A8SA 4WBFA 2NSCA 4K0KK 2ZJRL 4DLGA 2JEJA 1HYVA 1OY6A 4N47A 3PW2A 1ZXOA 4QR2A 3Q8PB 1WI8A 2V4JB 4DZ6A 2EX3A 2CADA 2DK2A 2H48B 1NU0A 4BE1A 1FRIA 4BHQA 2DR9A 4YHHF 5C0YA 4CTAB 1UVNA 2VWBA 4O3SA 3PKMA 1YWXA 4NXMF 4X4TA 2FHKA 2W4CA 2EPIA 1WLJA 2HBKA 2B6AA 2QIFA 4DV7K 4KI6A 1IQTA 1QS4A 1K8KA 4A48A 3VF4A 1X4DA 3DLEB 4H0PA 2HQIA 1JLFB 4Z37A 3J7ZT 5HANA 3IDHA 1W7AA 4MKAA 2GX9A 5IS2A 1NOZA 3C0BA 4ZLPA 1JJCB 5EN1A 4K4XA 4LSZB 3MFIA 1R7IA 1G6BA 3OYCA 3WBZA 4FLZA 3I5AA 1HNXF 4CEBA 9RUBA 4NI2B 1UAXA 1Y4ZB 5IT9O 2QE5A 1FERA 2NZCA 4QCLA 3EL2A 2HMPA 1KQSR 4FYYB 1URNA 3QIOA 5BPNA 4FJHA 2XHCA 2XCPA 1I39A 2AHOB 3VHQA 1JNZB 5KFJA 3EGVA 2BE7D 3W62A 2PFFB 2IIHA 3NL0A 1TUYA 3DRRA 1J53A 4LBPA 4M95A 2GWKA 1VQPS 1XR7A 4J9LA 2Q6CA 1UPMB 1TL3B 1LCUA 4CO0A 2YX7A 1TTHB 3R5BA 1VS3A 1HBUA 2ZWHA 4OV1A 1NJZA 3ZTOA 4FXVA 4URGA 3VR1A 2PBDA 3J81j 3HHNB 2FSNA 2A10A 3ENBA 4IG0B 1OWXA 3UVJA 4CJSA 4X4QA 4MIAA 4KTQA 3ULHA 1TKZA 3VGUA 5GAHI 3T9NA 3N4PA 3AT1B 2XS5A 2MKHA 4O3RA 4O5FA 1FNMA 1K44A 3HZ6A 3M8RA 5DMRA 4XH4A 4WYBA 2HAFA 2KTQA 4C8LA 1U1MA 1OO0B 4A8WA 1U25A 5KT7A 1RUSA 3UN2A 1XC9A 4LFAK 1RAOA 1GLCG 2C2DA 2ZD1A 4C48A 3WIUA 2QL9B 3P3DA 4DL2A 1ZBUA 1X4CA 4R5PB 4I2PA 1EETA 1IVZA 3OYEA 1HHTP 3NXZA 2UXCF 1Y00A 4ZP6A 4LF1A 4LFCJ 3ZSVA 2P9NB 1RA7A 2V67A 2B4UA 3P8BB 4LF4K 2GAGC 4DPXA 1HRHA 1W2IA 3R5CA 1QVGR 3PSIA 4DU4A 4RBUA 1Q82T 5C2DA 2PMHA 2OTLS 3G82A 4JN4A 4E7IA 2J0QD 3J7YP 2XTJP 3K8WA 2MMYA 2QWNA 1R6YA 2FHOB 5L1JA 4ZP7A 3VF2A 4HVZA 3VTHA 4LF9J 1KVAA 1EQ0A 1ASWA 2OSRA 4F2RA 2HOEA 3FMBA 3W5XA 4WFBL 4IR9A 1HFEL 5B0DA 3PR4A 4ECSA 1XMOK 3PX0A 1BA0A 4EI2A 5ETLA 5DJBA 2NZ4A 3SQOP 2W9BA 2VICA 3KUEA 1Q1KA 1W7WA 5T7LB 2CPZA 4DR4J 2YNHA 3ENWA 4KHSA 1KXPA 1KAXA 2F8MA 2Q97A 1PAUB 1QQMA 2D41A 3TJAA 3OD2A 1L3UA 2UXDK 4GMKA 2QTWA 1SJ3P 4BG9A 4DBQA 1MWMA 4G3IA 3M4XA 1YF5L 1XMQK 1H98A 2QA2A 2VOOA 2VWKA 1LK5A 2FHJA 1DRZA 1DLOB 2VC1A 2DHSA 3WNGA 4CWBA 4FK0A 4FJGA 4PEOA 2FQQB 5HP1B 1CS4B 3QRPA 4JS4A 3HD2A 2AGQA 3D68A 2R4FA 4C6AA 2IVMA 3ZSQA 2D69A 2DGWA 2FC9A 3GFXA 1FDNA 3F9KA 2KU7A 1KD1O 3DOMB 4JI0J 1UVJA 3PY8A 1WSVA 4F02A 4DN0A 1WBDA 5A8KA 1AROP 1R8AA 3GIKA 3NVKA 2KJWA 4DXLA 1BG3A 1PGZA 3AARA 4U9RA 1Q86T 3OHBA 2CQPA 3MPYA 2UUCF 2LQ8A 4B3OA 5KQ8A 1A9NB 1WSIA 1DARA 1YBTA 4OKEA 2F4FA 4AD6A 3NF7A 1RWVB 2EG2A 4NCBA 3RW6A 4H5NA 2MSSA 3CJ3A 4A47A 1C4AA 1G1XA 1CLFA 3KLFA 1KS2A 3GSIA 5LMUJ 2Z56B 1ZAWA 4CJKA 1X5TA 2Z1JA 1X0FA 3QICA 4ED5A 3GJTB 2HG4A 3CT9A 3G6VA 3D9BA 3CWJA 3HHLC 5FLXY 2UP1A 3C6UB 5KOWA 3KHGA 5A8WA 1JJ4A 2Q3SA 1B7FA 4FVMA 1NPRA 1OVYA 3PX4A 3DYAB 3ATVA 1JLBA 5U47A 4C8KA 3Q86A 3SAFA 3P4UB 1IQZA 2H3EB 4IG3A 1IUJA 2CG4A 3IWXA 1WG1A 2A1BA 3NG8A 5E5NA 1WN7A 4FDFA 3E01B 2AYBA 1FRLA 1RFQA 2HQDA 3M1VB 3UKUB 3N4WA 4M42A 3SV3A 4I6WA 4YOVA 3HVTA 3IP0A 2R2RA 3UN5A 3SCXA 2Y1RI 3T1YF 2HVDA 3AD9C 1BO5O 3ISZA 2PE8A 4EUVA 5B8HA 2JWNA 2NR0A 1D4XA 5AFUA 1HYSB 2FLPA 4PZVA 4B3RK 5HQLA 4E89A 1F21A 4HDHA 1U2FA 3EMTA 5AQRA 2BW7A 4JUZA 4RUBA 3V6JA 2IAJA 4KC5A 1JLEA 2Z2LA 2GHPA 2K06A 5HRPA 2C2ZB 5DM7L 5T41A 2ZM6F 2ZH8A 1O51A 3GG4A 3CCQN 1VQ4N 1FWLA 4N8NA 1S6QB 1RT2B 1EP4B 3K5OA 1IBCB 4CJWA 1K47A 5J1NA 1X9JA 4PG4A 1OYEA 4JKCA 3RRHA 3O3HA 3RAXA 1YJTA 2D9PA 1RDUA 4BCAA 3F56A 4YMEA 2MZTA 1WEYA 5H9EK 2MQNA 4NYOA 2C2KB 2IMOA 2OPSA 4NLBA 2GHWA 3U3GA 4ILMA 2V63A 2EBEA 4KHPK 2HAIA 4OZ3A 1BWVA 3K5PA 3KK2A 2ZJPL 3ZEUB 1Y9OA 3W61A 1J9AA 5J2NB 1Q5YA 1EX4A 2ZHBA 4YOTA 3JS9A 4TY9A 1HIYA 4DV1J 4CTAA 4KHMA 3L3VA 4AQYJ 5DZ7A 3TAMB 2HB5A 3DXKA 1T05A 4C3MA 4O3QA 3B4MA 4WF9Q 1VQNS 1K9MO 2FLLA 3KD5E 4CHOA 3DLEA 3QFWA 3W66A 4DV2F 4FP9A 2DY9A 1Z26A 4IH6A 3EWGA 2AEMA 1QD1A 1T7PA 1BC6A 1UWAA 3TR8A 2J5AA 3KTQA 3LANA 1VLOA 1TU0B 4LF8J 3V4MA 1YZ7A 2P51A 2VGMA 3LTOA 3KMSA 4Z4EA 1TVRB 2B4VA 2C2OB 5EHHA 2ZWOA 4H4OB 5M1NA 4NI2A 2DHXA 2KZZA 1NGBA 4YR0A 1PO6A 1GXTA 3NF8A 3IG1B 5IWAJ 4IZ9A 4ZVTB 3RZAA 2Q3PA 1S4EA 2C22A 4Z0UA 4C0BA 2CGKA 4PXEA 1RKIA 1RE1B 1RDDA 4FK4A 4KY3A 1IBMK 5I4MA 4YDDB 1TL3A 1NK0A 4DFPA 3DRSA 1TK8A 3J81Y 4OZNA 1RDWX 2HNYB 4Q0BB 4HTUA 3VQ7A 4USHA 3HHLB 4DSEA 2JEFA 3R7NB 4NZ0A 5HL7L 4K25A 1JCFA 3MEEA 4OYPA 3DXMB 4LT6A 1VQ8S 2CQ4A 3V9WA 2XI2A 2G9OA 3SMZA 1VSIA 4HTJA 5KTQA 4E7LA 2MKCA 1G15A 4DUYJ 2HZVA 3NH1A 5AQIA 1GMWD 1DQ8A 5GAEU 2RNEA 1Q8IA 4MKYA 2IRYA 3PIOL 3BZKA 3LGNA 3BKTA 1R31A 2WRMA 2HF4A 1MU2B 2XMVA 1Y5IB 5CHCB 1U6FA 2JZ5A 1I51B 2ZGYA 2ZWPA 4OPHA 3AO1A 2FSJA 2WVFA 5FD1A 4R5PA 3EE3A 4CVNE 2RQCA 4CF1A 3LPTA 3DAWA 4OZJA 4WFAL 1YI2S 1NJIT 1TFWA 1CZAN 3A8YA 1QUVA 3D5MA 1VSJA 3JSYA 4PWDB 1UJ6A 3EYZA 5C15A 4Z4HA 5K5MA 4ZCLA 3SCLE 3I9V9 4NMLA 3O4WA 2CQ1A 2VG5B 5HRNA 2ZBPA 1SH3A 3X1LB 2R8GA 2K1RB 5DM6Q 1XQIA 3DLGA 2WSFC 3LP2B 4DR7J 1N5QA 4MJKA 4CJUA 2AYMA 3G6ES 1U24A 3T5KA 5B09A 4GRSA 3OHRA 1S72N 2W2OP 1XBWA 5KGWA 1T9YA 3AA9A 2WBRA 3IGNA 3GYGA 1NGEA 4FPAA 1MMLA 3ZETB 2R7YA 4PKGA 5AXMA 1SS6A 4AE5A 1T3VA 4E1MA 3KKFA 3ZCMA 5F8HA 3HO1A 5G4DA 4KTZA 1SZ2A 2ROEA 2CVIA 4ZVGA 3JAMY 4CI6A 2W41A 1RT4A 4YY3J 2FJAB 4GVBB 4DI6A 3SJHA 5GAHU 1L3TA 3A12A 3M8WA 4M94A 1VQ5N 3PO4A 4MLHA 5AXLA 5F41A 3W63A 3C7NA 4HI1A 1DLOA 4DF4A 5DGAA 2F40A 3R6MA 3KD1E 3QT7A 3N5BA 5K9FA 2ERRA 2IA6A 5JLHA 1ROFA 1IG8A 2JFDA 2LA4A 3NMAA 1XQSC 3GQCA 1RBUA 3DOMA 1K0TA 5TKYA 3A5MC 2K8GA 4OLOA 2MYFA 2G8IA 3TO8A 3QRQA 2HHVA 1WELA 5C42A 2RD5C 3PYEA 4J2BA 1OYDA 3PRBA 4CFCA 4LFCK 4OVLA 3KMQA 2G1DA 3AD7C 2XGQA 4J90A 2DTJA 2N7CA 2O4GA 3QJLA 5CCLA 5BJRA 3M1FA 4ATNA 1T0TV 2CJXB 1FJGF 2YI1A 4BR5A 3OA9A 2OELA 2W9AA 3VEYA 4M5NA 4UZCA 3ETMA 2VF3A 1SAZA 3DLLL 5LJ5Y 1SL2A 1D5AA 1FRHA 2J4RA 3D4JA 2DKOB 2O8CA 2A2DA 3THXB 5D0HA 4CJRA 3TA1A 2CPIA 1PG5B 3GR0A 3SQ1A 1Y3KA 2PFUA 4LF9K 2PYLA 3TOQA 4UOHA 4FW2A 1QHTA 4U7BA 2LU2A 1U4BA 1WC4A 4BRNA 3PJXA 3TTDA 3BKUA 3HBTA 2J9CA 1CJUB 3VQQA 2CGLA 3AY9A 3HSZA 5DQHA 3L9ZA 1PJ7A 3WT0A 3CG7A 4DR4K 3VWSA 4RG8A 5M1FA 3M32A 3IRWP 4LR8A 4EZ6A 4DSIA 4JI0F 4JI3J 1VQ6S 2O5DA 3M1VA 3AXMA 3UKUA 2LQJA 3SSQA 4YEAA 4S0MA 1VSFA 4NASA 2HPUA 2HFUA 2WVDA 3FCVA 1S12A 3QZ8A 1SH0A 3E2EA 3GFYA 4UY8T 3M2UB 4BREA 1Q18A 4QWCA 2QMXA 4AXJA 4DPYA 1NNDA 2CH6A 4OHVA 3D45A 1PJ5A 3MEGB 2B8PA 4CLFA 1RBAA 2QXFA 3K8VA 4WZMA 2BM1A 3T5LA 4Y2CA 2PI4A 1MMNA 1H1VA 4JI2K 5HROB 2Z57B 3R9LA 3AXKA 1EXQA 3MX5A 1S6QA 4X66K 1RT2A 1RP5A 3HOTA 1EP4A 5F2RA 1RHJB 1HR0K 2QW9A 2I1RA 2BABA 3DDNA 1FD2A 2CJ9A 2NCKL 2HGLA 2BJ3A 3T5JA 2B7CB 2RN2A 3R3LA 3VERA 2VG6A 3BP8A 1EIYB 4L72B 1CBKA 1EQMA 4KE5A 4YP3A 3J7Z5 1FW6A 5KG0A 4NLCA 5LMUK 5CZ2A 3CMEN 1N4LA 4J2DA 2RPIA 3GIMA 3UCZP 3T6JA 3ZEUA 5KFFA 5J2NA 5B7WA 2RS2A 3DXSX 1I3OB 1UZHA 5CZ1A 2J9DE 3TZWA 3MDQA 3M8QA 3QWPA 1UEUA 3TAMA 3TTCA 3L6QA 3R2CJ 5KT5A 1SC3B 2E5IA 4CLZA 3CJ5A 1BDGA 1FESA 1N48A 4BR7A 2VZ9A 2VFTA 2QYGA 1C1AA 2WUSA 4IO1A 2XMAA 3HZEA 1JK9B 5THWA 2IHR1 4NLWA 4FOIA 1U2CA 4K8XA 1C2PA 1T9WA 3WXKA 2ZH2A 3OW2M 2YWWA 2PFDA 2P2CB 5BR8J 5HATA 4J9UE 2O8FA 1RCOB 3GJQB 1S6PB 4M3UA 2DO4A 4KAZA 4QAGA 4ER8A 3KWMA 2GIQA 4DTPA 4K41A 4H4OA 4KH4A 2AIRB 2AYEA 3BZCA 4AHRA 3ZTQA 4K43A 1KN6A 3IG1A 4BWJA 3HSTB 3VQSA 4P2FA 2F65A 4NA2A 1HI1A 2G0JA 4FVCA 4MFBB 1RYSA 4DR3J 3LP0B 2OFGX 3P1GA 2D0PA 4LUBA 5KFLA 4PL8A 1A0OB 2AJFE 4ANEA 5HJYA 1ICEB 1SBRA 3QT8A 4PG6A 3EZWA 3IAYA 2DCLA 3PO5A 2NRXA 4JI8F 1SJ1A 2ZUGA 2KVIA 3GE9A 3NGRA 4DV1F 8RUCA 2EHGA 4AQYF 3BSCA 3ET6B 4KJIA 3SYZA 3C6TB 3HHKA 3LUYA 4E98A 3P6YC 3M6GA 4ECVA 3TNVA 4OJ3A 2A0FB 2Q31A 2O8DB 3IAS9 3TRGA 4DV4K 4IDHA 3QIPB 3DDKA 5KPTA 3QYYA 3ULEB 3BDPA 4W92B 3HYFA 5DRKA 3BSNA 4UW2A 3CQ8A 4UOFA 3GU0A 2C28A 1NRKA 2HS3A 2QL5B 4Y65A 4OFZA 4I2QB 4WP3A 1MU2A 4NZ6A 1PJ6A 3MDFA 2ZNYA 2ZZNA 4CBUA 4FJKA 3EPGA 4AQYK 2OJ3A 4W5OA 4RNHA 5IWAF 4CJ3A 5CHIA 2VIHA 5F8LA 4DLEA 4KO0A 2HHTA 2D3ZA 3UE5A 2BRKA 1ZM2A 4LVNP 4B3SF 4MIBA 5AQQA 2HBJA 5TKWA 3CM5A 4PWDA 3CJ9A 5AQJA 5JS1A 1GT8A 1X9WA 4C8OA 3LP1A 4JOUA 4LF8K 4L73A 2ZUAA 2DFFA 2UUBK 5FPDA 4HWIA 4TQSA 3NH0A 2VG5A 4H5WA 3AA3A 3TSQA 2BQUA 2ZBQA 3MPDA 3CM6A 2DNQA 3ZZTA 5LMNF 1G99A 4JKFA 2GNKA 5IWAK 2RHQB 1BWFO 2DEJA 3OTCA 1T94A 1YBAA 3D1HA 2J0WA 1FTRA 1U1QA 1VC6A 2A1SA 4YOYA 4DUYF 2F8TA 4DR1J 3DOLB 3CCUS 1RTIB 4KH0B 1R3NA 4P10A 4DCJB 2MGZB 2CPXA 2J6SA 3PCOB 3CCSN 2BW2A 3HD1A 4NLGA 1W26A 1NM1A 1YRUA 3VF0B 4OLAA 2Q0RA 4FJ9A 4I9LA 5FRMA 2FVSA 2HFVA 1FEEA 3BS9A 3L0QA 2VGNA 2KDOA 1XUPO 5MLCQ 4DCOB 4ETXA 3L09A 3OFHA 4YORA 5F3ZA 3R7SB 3NMRA 1NSPA 4Q7AA 4DUYK 1BHLA 2ALYB 3EPIA 2XLKA 3E3XA 4FYVB 1RHQB 4C23A 4DSLA 3OVNA 4LJMA 1T8EA 1RWMB 1REVA 3PX6A 2RUSA 1SJQA 5DQIA 1VRQC 4LY7A 2AYGA 4WFXA 4YDUC 4DTNA 3CJ7A 4RUHA 3C19A 4DR7F 3HK2A 2QEXN 3ETOA 5D0GA 1H7WA 4M5HA 4Y1CA 4DHVA 1L5UA 3OS1A 3M30A 4LC9B 4ZPWR 2MLXA 3MK6A 2MHEA 1RDCA 3J7AP 2HSEB 4GO5X 3E1YA 2G8UA 3MPUB 3QWUA 3HHDA 4OGEA 4BQZA 3MMAB 1IXKA 4WQ4C 1MN9A 3GV5B 3MAAA 2UU9J 3W2WB 4FBUA 3HX9A 3N6MA 4OZ0A 1BI4B 1NH8A 4DV3J 2XRIA 3K17A 2JLEA 4BVPA 4FJ5A 2WONA 5J2QB 2N4CA 4NB4A 3MUMP 3SDEB 1TKTB 4ZP9A 2GELA 2WOMB 4ZCIA 3OR1A 3ZXWA 2F9DA 3AVHA 5M1PA 1F0XA 3MTKA 3TZXA 3R6LB 3UDCA 2FPHX 4B08A 5KFOA 2G13A 1KDNA 1WSRA 3CCVS 2Q43A 4M3RA 1WAJA 3OHAA 3GCXP 2G4BA 3CHWA 5BRHA 3ULDA 1UTAA 2ASPA 1S22A 5AQUA 2V94A 4O3OA 2FF6A 4IKFA 3I6PA 2QA1A 1VRTA 3HI9A 3Q8QB 3BN7A 1JLGB 4ZPDA 3M9NB 1BXNA 4PPZA 4KHWA 1AXQA 1X7VA 3E8OA 5HMXA 4YY3K 3UQSA 1P8ZA 5IOLA 2OH2A 2GIRA 3RBEA 4ZHRB 3JS6A 4FLYA 2M5YA 4GVMA 1XR5A 5E0OA 4J9PA 5FIIA 4N56A 1S4FA 4FS1A 3JYTB 5DLGA 2NREA 3ZZ0A 2DB1A 2YNGB 1R89A 2LLZA 2ADCA 3M2UA 4Y1DA 4F26A 5KG7A 2CPHA 4ED6A 2E7WA 1ZPVA 4Y6IA 3MEGA 2KVQE 1VDHA 4X65J 3QZ7A 4PRFA 4OO1J 2NQPA 2GO9A 1XIQA 2DBBA 4DCPB 3FBEA 4W5NA 2KI2A 5L8RC 4ZJQA 3O9TA 1CJKB 3BBFA 2DJWA 3KLHB 4EYIB 2BUNA 4DQSA 1MDUB 1YGYA 2F8HA 5G0RB 4Q2MA 2HIYA 1U1KA 2W7PA 1HNZK 3QSIA 4O4GB 4DR2J 5HBMB 2R3VA 1N5VA 2ACYA 3J80U 2AA4A 3TVZA 3HPGA 2MQPA 2GMJA 1FE4A 3NBPB 1JL1A 4B8AB 1HBOA 3NOGA 4MQ3A 2BR0A 1VSDA 1KVBA 2X3DA 4JI3F 4OX8A 1N32F 1R0AB 4F7VA 3V81B 4QWAA 1ZBSA 3C6HA 3Q8UA 1TUWA 2LVWA 3MMJA 5A8RB 2CUYA 2YWEA 4KTWA 3BR8A 3I8BA 4TSXA 4QR0A 4X4VA 1LOUA 3W0LA 2YH1A 2KXNB 4Y00A 2IJRA 3NMUA 2CAJA 2AQ4A 3IN5A 1S5JA 4ED7A 3C6AA 4LMZA 4KV8B 2CPJA 1B99A 2MLYA 2H4YB 3HKWA 4QYZK 1VHFA 2HIQA 4AL5A 3QDKA 2UXBK 3WQUA 1S6PA 4KKOA 2LCWA 5KGXA 3CCMS 1S9GB 2PZSA 1IH7A 3R7BB 1U0SA 3HZGA 2V4RA 3JXUA 4FF4A 1S1UA 1R59O 1MA9B 3N28A 5K8MA 2PIIA 1WUUA 4WE1B 2KG1A 1YJVA 1E6YB 3AB4B 3CCRN 4CH1A 3FDSA 3LP0A 5C2GA 1HWJA 2J7UA 4Z94A 1BQXA 1WF2A 3MCMA 4WFNQ 1A5XA 4PG7A 5CYQB 1KKHA 1FJEB 1W9HA 3CJSA 1D8ZA 1N54B 3R5AA 2RQMA 1JWWA 2JOQA 4PXBA 3ET6A 1PYOB 3P39A 2UV8G 2WBMA 3PEHA 1OQ6A 3QO9B 2E88A 3T6BA 1ESVA 1RWWB 3BUZB 2F4VK 1R6VA 3O3GA 2V2QA 3LAKA 1RACB 3TWZA 2I0XA 1PSDA 4JNEA 1RT5A 4DUTA 3ULEA 5BR8F 5KAKA 4W90B 2XHWA 3MAQA 1HKGA 4CJ4A 5HVHA 2XZTB 4EBCA 1NDCA 2BYCA 4J8FA 2Y1LB 3BSAA 5L1KA 3PYGA 5D0EA 2E66A 2BDPA 1N5SA 2AJ0A 2GS8A 2V9WA 5D15A 4ZVPB 1WSEA 4PG8A 2XO6A 2NLXA 1VMBA 2E1YA 4BRAA 4DR3F 4JBCA 4CERA 2CRLA 5K8PA 4CEDA 5BR8K 4JI4J 4XH5A 3CD5A 1WOOA 2E9TA 5L9XA 1N52B 4P73A 3RYLA 5AZIB 3QBWA 1HJRA 4JI7K 3KHLA 1X5OA 4B3TJ 5KT6A 1TK0A 2G0CA 1Y97A 3D0GE 4CF0A 5FJ4A 1JKHA 2FD2A 4CLLA 3G87A 2OEMA 3S1TA 2R42A 3NOCA 1UJ4A 3GMGA 3K57A 1ZETA 4GC7A 3OPKA 1NHUA 3DOLA 4U7CA 2YCHA 3CCLN 4JKGB 1KD1T 1S1VB 5HJXA 3FZFA 4CFBA 3CJ8A 1D09B 2DH9A 2BX6A 3H2VE 4QWBA 4MDBA 5CAAA 1RYRA 3VQDA 2G8KA 4BRFA 5A2QU 2W8KA 1F3FA 2Z1GA 1NKCA 5I9EB 2HRYA 4EBEA 3Q89A 1RWNB 2MJNA 3D1QA 4OIXA 1SC6A 2FHMA 1N34K 2RU9A 2FJBB 5IXUA 3CO9A 1N5TA 2FJVA 8AT1B 1CC7A 3DM2B 1M90O 4IOAL 3SK3A 2BMBA 4FXWA 3I0SB 3WXMB 3ILIA 2UVUA 3AD8C 3T1AA 3FZLA 3UW1A 4J9RA 5JLFA 4FVUA 3CUNA 4CLKA 4WWSA 5D77A 4NLTA 2R7WA 1U49A 1AFIA 2J9DA 3OL8A 4GKKJ 1VBXA 2VCPA 2FLNA 1J5OB 2RT3A 4JI6K 3KG4A 4WYWA 2C3MA 3VAHA 3SZ2A 3VQEA 1YVNA 1IBLJ 3R27A 4CW7B 2X74A 4I6MA 2K7KA 5M1QA 5GAEP 3KLIB 4F50A 4A61A 2LA6A 4DR1F 3TUJC 2CZVC 2GV1A 3D54A 2Z1HA 2FDNA 2DNHA 3CJBA 2POKA 2MB0B 2OPRA 1NSQA 2LKZA 1B0VA 5D3GB 2V8GA 2DGTA 3LPUA 5L39A 3MMAA 1RI7A 3NGUA 2V7YA 1GMUA 3EXCX 2ZBIA 1V3ZA 3BGFA 4IXCA 1RHKB 2CWXA 3OL6A 3G6YA 2F9TA 2AT1B 4EMDA 2KHCA 3EZOA 2M9KA 3SDEA 4OX9J 4JI5K 4P7TA 3I4PA 1TKTA 4USIA 5E3PA 3DRXA 3CETA 1JXVA 2I7PA 4FF3A 1HWUA 4GVEA 3AQPA 2DNZA 1TK5A 3B8AX 2XEXA 1GLBG 3OY9A 3K0JA 4BE2A 3QEXA 2QWOA 4UY85 2R2UA 1X5SA 2CZ9A 3CC4N 3WXLA 3KJFB 2VFRA 3I87A 3KUHA 4AUKA 4O55A 2DFEA 3G8SA 1JLGA 1TYQB 3OV7A 4TYAA 4PKDB 2QLJB 1NOYA 1NGHA 4ZHRA 3KWIA 1YHQN 3VQCA 1UJ5A 3JYTA 2NYIA 2MY8A 4A5BA 3GFHA 4C1NI 4WTOB 7FD1A 5AQGA 3ZFVA 3CFOA 3FZBA 4JYAJ 2UU9F 3FFIB 3MHYA 4LRCA 4F3TA 4M3ZA 1N0UA 4FBTA 2P9KB 2DNOA 5H1SV 4DV3F 3KLVA 2GBZA 2XWXA 4DKWA 5GAHP 2O3DA 1XHXA 5F3TA 2YJEA 1RDBA 1GTEA 4CH7A 3UIQA 3M5RA 1K9MT 2FBTA 4PR6A 1JXBA 4F0MA 1CJKA 2XMUA 4NXNJ 4XPCA 4QQBA 2ZF5O 4X64J 2HZCA 1RZMA 3IS9B 1IJEB 2A41A 3BYPA 1Q53A 3MFHA 4QPTA 1QJHA 2JGUA 4F0HA 3LDPA 3HSDA 3P31A 1WSJA 3ENOA 4CJQA 3NP5A 1JLQB 4O4GA 4X62J 1KVCA 1W2BM 5HBMA 3H2LA 4CLTA 1GLAG 1RTZA 1M5KC 2APOA 2V34A 3H59A 5I42B 1Q79A 4JI1J 1BQMA 1LK7A 4ECRA 1OS5A 3U1MA 3FRZA 1YI2N 2RKIB 1CLQA 3PRVA 3MUTP 3MXHP 2OUGA 1R0AA 3VGMA 5DZ6A 2GV9A 3D2EB 4M5GA 3QAUA 5E7OB 1EB0A 2CPFA 1HWLA 3W64A 1HKCA 2HWIA 2HBYB 4BR4A 1D9AA 4MO4A 4OJGA 3AOAA 4FKXA 3WNFA 3ZX2A 3TUZC 3BH7B 4W5TA 1C1BA 2FYXA 5EWEA 1Y64A 2DISA 4PQAA 4YDUA 1CXQA 4KV8A 4X65F 4CE9A 4O4RA 4YQWA 1S10A 4G1IA 3W8GA 3G6EN 1VQON 4FWOA 4ILGB 1ASUA 2ZNZA 2VBXA 4CZFA 2XG8A 3HDSA 3H25A 2CKWA 2QZ8A 3LALA 3O3FA 1Q16B 4HDGA 1B9DA 2F63A 3Q22A 2E6MA 4WQ4A 3PTWA 3QNNA 3AAQA 4GKJJ 1D9DA 2QKKA 1I94F 4DR2F 4EWTA 3HP9A 1OY8A 4FLTA 4WE1A 3EZUA 4ECUA 1RBVA 1E6YA 3QFUA 2G2ZA 5J2MB 4Z4CA 2QA4N 4DTOA 4L3QA 4XPEA 2AWZA 1C0MA 4JHDA 2VQFJ 5C2FA 5JVGL 5CYQA 5D78A 3DMJB 2ZH6A 2E1RA 3F44A 3PG9A 2IYIA 3H46O 1FF2A 4J9NA 5I3UB 1V4TA 2ZZTA 1RADB 3M3ZA 2CNNB 4X4NA 1HLWA 3RR7A 3AAWB 3IBWA 2XZWA 1FHTA 3QO9A 1EX8A 1FKAF 3ZT3A 2LDIA 3W65A 1VSMA 1FO1A 2NXEA 2W9CB 2Z1IA 4H0OA 5L1LA 4DX8H 4A8MP 2E8AA 2FSKA 2V69A 1X8DA 3UCUP 2LDYA 2J0SD 5KPRA 4QIEA 3ZZYA 2OGUA 1A7GE 5AQHA 1SJRA 4CJTA 2RAQA 2GVDB 3AJDA 3GIRA 2GQCA 3G10A 2AEFA 3GZ7A 4H0XB 1NG9A 3JSMA 3QB0A 3IGVA 3CC7S 2Y8YA 2DT9A 3GR1A 2YHBA 4O5BA 3PUFA 1VISA 3SMSA 3AVAA 2A3ZA 2NXNA 4K4TA 4ECWA 4OL8A 1FVSA 2GJ2A 1IJJA 4NYNA 5AE2A 3QBXA 4FWNA 4BG8A 1TFYA 2KRBA 3SMPA 3MM9B 4QZVB 4F67A 3GE1A 1S1WA 1JLCA 4LR9A 4D3GA 1S72S 1FKPA 5EWFA 3SPYA 1FXRA 4A59A 3CXCM 5AZIA 3FEXB 4OPJA 3QFHA 3NS6A 4AL6A 2D3OR 2GGPB 3HM9A 4N77A 2BOAA 4YHHJ 2H51B 1C0UA 1IM4A 1RJJA 4CLPA 4NXMJ 3FVYA 3U02A 3T7ZA 4K5SA 4HCBA 1R0CB 2OAUA 5CYMB 3ONQA 4I68A 5E2QA 4CJFA 4BBYA 2AX0A 1DQAA 2O4IA 3I96A 2VYPA 1S1VA 4BC9A 1RHMB 2IY5B 4FWLA 1C4CA 2CVEA 3OBIA 2XC9A 3WX8A 2YX6A 2DXEA 1VQ5S 3SCKE 4CIFA 4U96A 5JMNA 2GUPA 3MR2A 2VOPA 1NDLA 5CD4H 4L76A 4MDAA 1KC8O 1QVFM 4YR2A 2Q6BA 3AO5A 1RAHB 4LF7J 2VASA 2YX1A 4NLQA 1OVQA 2XY7A 3Q23A 3WIVA 1FNXH 1AT1B 3PXGa 2VV5A 2HS4A 4OMFG 4CJ5A 2HBRB 2DR7A 2E4LA 3UPFA 4BDYA 1U48A 1SQFA 4O0IA 1HKBA 1TAQA 1BIUA 4J9QA 4YDXA 5B0CA 2WVBA 4B3TF 2QKBA 3DU5A 3KZBA 2BM0A 3OYMA 1E6VB 4BR9A 4NEZA 3DRPA 5ETQA 1VBKA 2AMCB 4F0KA 3VF6A 1T02A 2ZHAA 1FI4A 1HL6A 4HHHA 5B08A 3KLIA 2B6AB 4A2BA 1K8KB 3NS7B 2QMUB 4BC4A 1HMVA 4FZYA 5CABA 2IBOA 1SL1A 3L95X 4LFBK 4JI4K 3OLBA 1B0TA 1DY3A 4ZOSA 1FRXA 2GMLA 2YHYA 1TKDA 1T9UA 5D8HB 2W1BA 3W7BA 2VWJA 2KT2A 3BN4A 4FWSA 3OSPA 3QJPA 1LWCB 1AYEA 4W5RA 5HVFA 4DUZK 4NLVA 2W7OA 5KFCA 1AUSL 4LF5J 3UKRB 1UEVA 3GSDA 3LM9A 4KQZA 2LEAA 2VD3A 1YZ6A 3H5UA 3ZSXA 1IG9A 1NK5A 2RU3A 2ASJA 2R9LA 1X3MA 1ACMB 3RSEA 3DI6B 1FE0A 4Y3CA 2XGPA 4HTIA 4GKKF 3E9LA 3FJ2A 3UNGC 2VBYA 3R8EA 3O9SA 1HBUB 3ENQA 4LRFA 1ZH5A 1IBLF 2QI2A 4ZVEA 2RIJA 1CJTA 4KIAA 2K3IA 4M41A 2O1PA 3UVJB 1WTFA 3EVOA 1RHRB 1F5BA 3CJ4A 5IT9Y 4IOCL 2E29A 5E3QA 4J9VA 3ILOA 4U7UK 2YHXA 4IH7A 3WZ0A 3ID6A 1MSWD 4ILHA 3H08A 2UZAA 3F2KA 4P7VA 3EVMA 1IWAA 2ZVSA 2P9KA 5KT3A 3ADAC 4B9LA 1S6UA 2IA0A 4KRFA 2JSXA 1DJ0A 2X1AA 4DV5J 1GOBA 3H45C 3S01A 2ZD1B 2KFZA 2DD8S 3NAEA 1K1SA 4OX9F 1SUQB 3AA4A 5AQVA 3MCAB 4CT8A 5FROA 4M5KA 5FPNA 1Q7LB 5GMEA 3NKYA 5ADXH 3GLJA 4EAHD 3R3TA 3BO3A 2I6WA 5B0BA 3W3SA 3EDRB 5DDQC 1OQ3A 4YFUA 1JLQA 1RBSA 4IJNA 4OPKA 3OVSA 1U45A 3QIDA 3HJFA 1IBKJ 2ITGA 5SWMA 2QWPA 4KHRA 2NRHA 2KT3A 1HQEB 4CD3A 5CZXA 4ED1A 4DV0K 1XTZA 3D2EA 4L74A 1S77D 4QS9A 3H2UB 4TU8A 4F9OA 1M1GA 5KFGA 1K6YA 3VEOA 3THYB 1QZ6A 1UCNA 3HLUA 3OS0A 1B3TA 2VQEF 2KFNA 3EKUA 3L2VA 3CSKA 4ZVFA 2BZ2A 1Z6RA 1N33F 2XI3A 2Z2ZA 2CXEA 3QBCA 1U8SA 4USJC 1XEZA 2W42A 4V1Ak 3DJCA 3CCUN 2ROGA 3CIPA 4O8UA 2WSCC 1MWZA 4NXNF 1CXUA 2ZJQL 2BBEA 3HHLD 1M1KO 2O8EA 5KFIA 1ZBFA 3THTA 3OW2R 4MIWA 1HKAA 4JYAK 4USWA 2B51A 2FB0A 4M5DA 4CFDA 4KHUA 1H0HB 1QVGM 3S8SA 5EXWA 1HNWK 3ZZOA 2ZJRQ 4JI1F 3DOKB 2MZQA 3C95A 2U2FA 2QSFA 3LL3A 4ZJLA 3OTOJ 3VZHA 4RW8B 4XDDA 4OLPA 2IRUA 3WEEB 2YWGA 1H74A 3RU0A 2Q1LA 4UQGA 3DMJA 3IR6B 3OQ2A 2IM3A 3CCZA 1RAJA 3BZQA 3ZC4A 4ZN1A 4H5RA 4X64K 2K2PA 2VFSA 5I3UA 1GNKA 3D2FB 4C11A 1PC5A 3T1YJ 4I0WA 2QG9B 4X62K 4U95A 1SQKA 4KSEB 1YITN 4O0NA