3DOKA

Crystal structure of k103n mutant hiv-1 reverse transcriptase in complex with gw678248.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
539
structure length
535
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 143
structure length 535
sequence length 539
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dokA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dokA05
3QEVA 4N56A 4RW9B 4FM2A 4EO6A 1RT2B 5D3GB 2E6LA 1YT3A 1C6VA 5L1LA 1HMVA 5T7BA 4C8OA 4Y34A 4KHRA 4NLTA 5F8NA 5KFRA 4FLZA 4QWAA 3PV8A 2AJQA 3KK2A 2JEFA 3AVIA 2IAJA 3IRXB 3A2FA 2V4RA 4HKQA 3VQ9A 4ZPDA 4FM1A 1RT7B 4DFJA 4KB1A 4ED8A 3JYTB 3C94A 1CSJA 2IDOA 5J2PA 4M3WA 1LAVA 3DRPB 3H40A 3CFOA 2VG6B 1N6QB 1S1TB 5C25A 3AA4A 1JLAA 3CDUA 3QEWA 4Z4EA 3BGRB 4IDKB 4F4ZA 3IAYA 1WSJA 4KHNA 2OPPB 2EX3A 1C2PA 4RW7A 3AO3A 4KV8B 1EP4A 1RT6B 4I9QA 2R2RA 3QIPA 1J9AA 3CM6A 1ZBHA 3HVTA 4R0EA 5KI6A 3RAXA 3H5XA 3SQ0A 4RNMA 4ED6A 2AWZA 1RDBA 2LSNA 4DTOA 1TKZA 2HHSA 1CZ9A 4I7FB 2IJFA 3DM2A 2YKNA 1TVRB 4YQWA 3DRSA 5KFJA 3M8PB 5EWFA 4IOBA 4Z4FA 1SUQA 4KO0A 1SV5A 1RTJA 1HPZB 3TAPA 2XGPA 1RT1B 1D9FA 2E4LA 3LAKA 3HYFA 4N47A 1QAIA 3HPOA 1IKWA 1S6QA 4AHVA 1FKPA 3RAQA 3VQQA 3BSOA 3L3UA 4NLYA 3OYKA 1FK9A 3ZSOA 3NH1A 3VN5A 5DG7A 2AGQA 4JRPA 5FROA 5L1IA 4ZVEA 3RB3A 3LPTA 4ICLB 1C1CB 3I0SB 5K14B 2D3UA 4CJSA 1IKVB 4OKJA 4KFBA 3DOLA 4IG3A 2OPQB 1VRTA 2OA8A 4CIFA 4J9RA 3AA2A 2BGGA 3BQ0A 1TGOA 4Y3CA 2R2TA 1S0OA 4L8RB 3G6XA 4HUGA 4FBUA 3S3OA 2ASJA 5DGAA 4B9TA 4OVLA 3G6VA 4MK9A 3V9UA 4IR1A 1WN7A 4FCYA 2YNHB 3C6TA 4DQRA 4Z4GA 3OYGA 2W9AA 4OL8A 3PO4A 4IG0B 1SL1A 2DFFA 3DMJA 4FZYA 4E1MA 2I5JB 1T05B 1ASVA 3T5KA 1SKSA 1T03B 3VQ6A 2VA3A 1L3UA 1S1WA 2B6AB 3M8QA 4OJRA 3HHKA 2QXFA 3L2QA 4J2DA 2A1SA 3S9HA 5KTQA 4NLOA 4CK2A 4RNHA 4F8RA 2ZKUA 4DL5A 3MFHA 4M95A 3IN5A 1VSHA 2C22A 4LH4A 3KTQA 1J5OA 1QAJA 3OYEA 4QPXA 1LWFA 2YNIB 3DLEA 4CGGA 3O3FA 4PQUB 1L3TA 1LWEB 1LW2B 4Q5VA 4JRQA 3SI6A 1JLBB 1WSEA 4RW8A 3V4IB 1RTIB 3PW4A 1N5YB 3U3GA 1KVCA 2XHBA 1RDAA 1ASUA 2W8LA 1KCFA 2FVRA 2GUIA 3MEDA 3ZT3A 4KTZA 3AA5X 3AVMA 3CO9A 3ZSRA 4CGDA 4RUAA 3UIQA 1Z25A 2C2DA 4CE9A 1TAUA 3N6NA 4WYLA 1S1XB 4IRKA 3V9WA 3CDEA 3S3NA 3IGNA 3THVA 3KHRA 2D0AA 3NGZA 4ZMMA 2BANA 4DU4A 2R2SA 3SQ2A 4NLQA 3C6UB 4E3SA 1K1QA 3QNNA 1S1UB 1MU2A 4O3RA 4GC7A 2HMIA 1MMLA 4TLRA 4HCBA 4R8UA 1S4FA 5DQIA 1X1PA 5KT3A 3SQ1A 4DL6A 1JXLA 1NJWA 2DPJA 4FLXA 2XC9A 3NCIA 4B9NA 1Z26A 2E9RX 1TK5A 4KTQA 3NF7A 1JKHA 4TSXA 5C24A 5KT6A 4F2SA 4IH5A 3HPGA 4FK0A 3RMDA 3O4NA 2WONA 3CQ8A 3K5LA 2ASLA 3ITHA 3MECB 1L5UA 5KFDA 3B6PA 4Q8EA 3ZSQA 2HW3A 2AQ4A 4IRCA 2RF2B 4H4MB 5CYQA 2XGQA 2W7PA 4FJ8A 5T14A 5CYMA 3RMBA 4Q8FA 4DG1B 3M8RA 4XIUA 3RMCA 3KNAA 5KFGA 2Z1HA 1F21A 4KHYA 1RTDB 4OLBA 5FDLA 4MKBA 3OL9A 1ITGA 4PA1A 2IC3A 4CJQA 1XR5A 1JLQB 1BI4B 2W9BA 1HYSA 4ZP9A 1HJRA 4ZTJA 3CJ2A 3KD1E 1RILA 4O44A 4E7LA 4TY9A 3PO5A 3E01A 4H8KA 2V0NA 4CGIA 2HHWA 3AV9A 4TYAA 1D8YA 4F50A 4URSA 2B5JA 2ZQBA 3EYZA 1N4LA 3DLBA 4W5TA 4YP3A 5KT5A 3L3VA 4Z4IA 4YNQA 3N6LA 5I3UA 4G1QA 3FSIA 4NRTA 3P83D 4NYZA 2GC8A 1VSMA 1U49A 3AVHA 2OZMA 1NHVA 1T7PA 2XRIA 4BDPA 4Y2AA 4F2RA 1IG9A 4E0DA 5HP1B 1RT3A 4QW9A 1C1BA 2EC0A 1T3NA 4CF9A 2RDIA 1KFSA 1LAWA 3OYBA 2ZD1B 2AGPA 1U45A 1GX5A 4FJMA 2O5DA 3VQ5A 3MR6A 3ICLA 1KFDA 4WYWA 4F4WA 4TY8B 2UVRA 4O0IA 4CJ3A 4ZP6A 4J2AA 3CYMA 4GVMA 3B6OA 1VSFA 2OPSB 4C8NA 1GX6A 2IM3A 4NLXA 2HNDA 2RKIB 4ELTA 2XY6A 3KK3B 4FK2A 3V1RA 2IM1A 4IRDA 2ETJA 1S9EA 3NGIA 1S6PB 3DRRB 2ILZA 1ZBIA 3RTVA 3QIDA 2D0CA 4RG8A 4N76A 3IS9A 1R0AA 1SH2A 5KFIA 1JXEA 2G8HA 1IKYA 1VRUB 4IFYB 2OPRB 4URQU 4AHRA 1DTTA 3PX6A 4B9UA 4I9LA 4O4GA 3T5JA 1C0TB 2ZE2A 3FRZA 4CHYA 3T1AA 4DLGA 1RT4A 1S48A 3GYNA 3I0RB 2WOMB 4YMEA 3TABA 4MK7A 5DLGA 3OLBA 3GIJA 3P5JA 5KFYA 2ILYA 4BWJA 2KTQA 4ED3A 4CCHA 4FJJA 4EO8A 2HB5A 1HNIB 3HVAA 3OSNA 3OYNA 4O55A 3ZSYA 4DTJA 1BGXT 3OHAA 2I1RA 4M41A 4CHPA 3K5NA 1DTQA 4WFXA 3DI6B 3HM9A 3AO5A 1KLNA 5F8LA 3KLGB 5HRRA 3DOKA 3PJWA 3V6JA 4Q45A 3CJ5A 2Q3SA 1RTHB 4AHCA 1XR6A 4ZPBA 1X9SA 5HRNA 4LQ9A 3S3MA 4I2PB 2FLNA 3QLHA 2AX1A 4K4SA 5F8IA 3NAEA 1TKXA 4Z0UA 4OPKA 1Q9XA 1S9GA 4KKOA 4ID5A 2F8SA 5DLFA 4DWIA 1BCMA 4MK8A 1J53A 3OL8A 1HARA 1BL3A 2QKBA 3AVNA 3N6MA 4LSNB 5KG7A 3GIKA 1ZTWA 3V6DA 4Q0BB 3SUNA 2IAJB 2HNZA 3E51A 4HTUA 4R5PB 3ZSVA 2UVVA 3NL0A 5J2PB 3VQCA 1ZTTA 3TANA 4PUOA 3MXJA 1UOCA 3MEGA 3KJVB 2G8KA 5C25B 4FS1A 3K59A 1JLAB 4ECRA 1BQMA 3KK1A 3HP6A 1FKOA 3MR3A 4KHUA 1I39A 3KIOA 5F8HA 4NCGA 5J2NA 5KFHA 1WSGA 2XCAA 2FVCA 2WHOA 3OYFA 3ALYA 4CFDA 4DSEA 3ZSZA 5KFKA 5KFVA 3SV3A 3PR5B 5KFCA 5F8GA 3GIIA 2UUWA 3HVTB 4XPCA 2BRKA 4EZ6A 3G0ZA 1D1UA 4CEBA 1RBSA 4DEZA 4FLWA 3V9ZA 2IM0A 2CJQA 2CKWA 1SUQB 2FJVA 3KLVA 1JLGA 3H5YA 2E9TA 4BWMA 2PY5A 1SV5B 3LP0B 4M94A 2QV6A 2HHUA 2KQ2A 3QEXA 4ZPAA 4DFPA 1S6QB 4K4UA 1FKPB 3HO1A 2HHVA 4F4XA 4KB0A 4RW6A 2VG5B 4RW9A 1TV6B 1X9WA 4DSLA 1RT2A 3D0PA 4KRFA 1XHXA 2W42A 3MFIA 3TQ1A 4JS5A 5J2MB 3LWLA 3CJ3A 1Q8IA 1RBVA 4HCCA 4KFBB 3DOLB 3DLKA 4IG3B 1VRTB 2DPIA 2FBYA 2ATQA 2XO7A 4RZRA 2DY4A 3IRXA 3MR2A 1JLEB 3OL6A 3RBEA 4F4YA 3K57A 3AVJA 1GOBA 3DRPA 4I2QA 2VG6A 4CJKA 1N6QA 2PZSA 3BSCA 4LSLB 2X74A 3C6TB 4W5RA 4FJGA 4CJFA 3O3HA 2XCPA 1VSJA 3BREA 1OS5A 4DTSA 4MIAA 3H5SA 3PVXA 3D45A 4TQRA 2NUBA 1QQCA 4B8CA 3BGRA 3DMJB 3H59A 4MFBA 4HUFA 3ZT4A 4QWDA 1RT6A 3BQ2A 3PX4A 1S1WB 3M8QB 4J9NA 5JS2A 4B9LA 4Y2CA 3LAMA 1BQNB 3DLGA 1A5XA 3Q8SB 4QAGA 2UVWA 5E41A 5F8JA 2R2UA 3OHBA 4I7FA 2O4IA 1VSIA 4QWEA 1TL1A 3HPHA 4IR9A 3M8PA 3I5CA 3T5HA 4N5SA 3KLIA 1LWFB 3DLEB 1HPZA 2JEJA 2RN2A 4CEEA 4NCAA 2RPIA 4CJVA 2ITGA 1G15A 5DG9A 1NHUA 2R8JA 5C42B 3MEDB 3QEPA 4CERA 1GOAA 4BDZA 4LH5A 4TN2A 2YKMB 2P51A 4Z4CA 4DL2A 3BSNA 2DTUA 4CEDA 4ZHRB 1K1SA 3SV4A 1RBTA 1REVB 1QSYA 4EBEA 1C1CA 3I0SA 5K14A 3SUQA 1IKVA 3TVKA 4WZMA 1Q9YA 2OPQA 4DQSA 3TR8A 3H2LA 3QO9A 5I42B 1WSHA 1QE1B 3AVBA 1QTMA 3GILA 5HBMA 1L3VA 1BHLA 4JUZA 1NK4A 4NLDA 1X9MA 3M9NB 2J6UA 3OL7A 4B08A 4BE1A 4QWBA 3CFRA 1HYZA 3NAIA 3H08A 4WFYA 2HMIB 1UAXA 1ZBUA 2XI2A 2YNHA 1IKXB 4R8UB 3V1QA 4WXOA 2YHAA 1EETA 1HQEB 2BE2B 3CM5A 4CEAA 3MAQA 4CIGA 4AHSA 1RA6A 3TAGA 2HHTA 4KE5A 2D5RA 2I5JA 5C24B 1T03A 1KVBA 1NK9A 2F8TA 3FQKA 3QESA 2WONB 4NYFA 2FBTA 4CJWA 1NOZA 1EXQA 3M9MB 5CYQB 1HRHA 4KREA 3U6FA 1K6YA 3OYDA 1RA7A 3TAEA 1S1VB 2WCXA 4FZZA 2YNIA 3QIOA 1XC9A 3K5OA 4PQUA 3SCXA 4CGFA 1LWEA 4MH8A 2R8IA 1RTIA 4CJPA 4ZTFA 3LZIA 4CEQA 3TAMA 1N5YA 4BDYA 4F3TA 3L2RA 2WK4A 2IC3B 4DQPA 1VSDA 3AA3A 4ZPCA 2W9BB 2KW4A 4IFVB 1HYSB 5CZ1A 4O44B 1RDRA 2FLLA 3TI0A 3WNHA 1LW0B 4NLSA 2JC0A 1VSKA 1SKRA 4NLUA 4X2BA 4OPJA 3MR5A 1JL1A 3HT3A 2WB4A 5HLFA 3V81B 1TK8A 1S1XA 4RUCA 3NMAA 5HROB 3OYIA 5EWEA 1TP7A 1NK8A 3SYZA 3RB0A 5I3UB 4EYIB 1QSSA 1FXXA 2HNYB 2HWIA 1I6JA 3NKYA 4WZQA 3K58A 1C0UA 3LPUA 3C6UA 1U48A 5L1JA 1SH3A 1RT5B 3AVLA 1RYRA 3OY9A 4G3IA 3K5MA 4OGEA 2JGUA 3SQ4A 3Q8QB 4YR0A 2FVQA 3QYYA 4ELUA 4XPEA 2PYLA 4FJHA 5KFOA 2OYQA 4DS4A 2J6TA 4RNOA 1HQUA 3FDSA 5CZ2A 3D28A 4M42A 3G86A 4FJNA 3KLFA 4O3PA 3SPYA 2Z1GA 3MECA 4Q44A 3LP1B 3DLRA 3VQAA 4H4MA 4DTNA 5FRMA 4DL4A 4CF0A 4E19A 4CEZA 2R8GA 1JIHA 3CJ4A 2W9CB 2G8WA 1S9EB 5KGWA 4K4WA 4LQ3A 4DG1A 5DGBA 3PR4A 3O3GA 2FVPA 1JL2A 4MIBA 5KT4A 1EX4A 3PZPA 1QHTA 1U04A 4CJ5A 3ISNC 3IG1A 5KFUA 2DFHA 1D5AA 1DTTB 3V1OA 3L2VA 2HHXA 4JV2A 1JLQA 1NJZA 1BI4A 4O4GB 1S10A 4DSFA 3F9KA 3QETA 4M3XA 1KLMB 4K4XA 2FJWA 2HVIA 2AX0A 4HVJA 1N48A 4DF8A 1KVAA 4K4VA 1RCHA 2F96A 3CVKA 4ZP8A 4N41A 1XWLA 4E7KA 3F73A 1NKBA 3HL8A 3MXIA 5L9XA 1D0EA 3D5MA 4DS5A 4QCLA 2YHBA 2G8IA 4QWCA 4MQ3A 4CJ4A 3LDSA 3V9SA 5F8MA 3PW5A 3PJXA 4ECUA 1S0MA 3AVFA 3EPIA 4K50A 3LZJA 2QK9A 4AHTA 1XHZA 3NAHA 4Z4HA 1DLOB 4IBNA 1B92A 3MTKA 4O5BA 3MEEA 3HXMA 1UWBB 3LP2A 3DOKB 1QUVA 1RBRA 3BR9A 3RRGA 2ZD1A 1ZETA 4Y1DA 3NBPA 4WE1A 4DSKA 3VQ8A 1WNSA 4J2EA 2YV0X 2WRMA 3I8DA 4DFKA 3ZT1A 1KHWA 5KFSA 3SNNA 4AHUA 4KPYA 1TKXB 4TY8A 4EP4A 4IH7A 1S9GB 4KKOB 1TL3A 1KRPA 1JLFA 5KFFA 2DFEA 5J1EA 1U09A 4PWDB 5DQGA 2OPSA 3CWJA 3V6KA 4M45A 4DSIA 2VA2A 3SUOA 3KLHA 3HVWA 3V6DB 2PYJA 3KMSA 2JEGA 4DL7A 3OYLA 2HNZB 2BQRA 3DRRA 2WTFA 4NRUA 3JSMA 3SJJA 4ID1A 1JLCB 2G8UA 4PUOB 4IFYA 4B3OB 3PHEA 3MEGB 2OPRA 4J9MA 3AVAA 4YR3A 4ED1A 4FW1A 2KFZA 2YNFB 3AO1A 2YNGA 3KHLA 2Y1JA 1LWCA 3KK1B 5KFBA 4CF1A 1NJYA 4J9QA 4LY7A 1D9DA 1WAFA 4ECYA 2A1RA 1HMVB 3I0RA 4NCGB 1SH0A 5J2NB 5KFQA 2WOMA 2C2EA 1WLJA 3FFIA 1TKTA 3I5AA 4J9SA 5KG3A 2XY8A 4FJKA 2D41A 3KK2B 5KFZA 3T3FA 4GMJB 4Q43A 3PW0A 3AVCA 1JX4A 2IGIA 2FVSA 3EZ5A 1HNIA 5JUMA 3U3YA 4NLVA 3L8BA 2Z1IA 3RB4A 1WSIA 4DTXA 4CF2A 4DMNA 2VG7A 4H4OA 3G6YA 3PX0A 4F3OA 3DI6A 1JLGB 4NZ0A 3AO2A 2BDPA 4DTMA 3DYAA 4IKFA 4J9KA 4FW2A 4K8XA 4KTWA 4FLYA 4ED0A 4RW7B 4BE2A 1EP4B 2HHQA 4TXSA 4W5NA 3QNOA 3QIPB 4KHWA 5KFEA 4E7JA 4ECTA 3NHGA 3KOAA 3ASMA 3H4BA 1TKZB 3RMAA 3ZSXA 4J9OA 2ALZA 3DM2B 3NE6A 3TWHA 4LSNA 1C1AA 2YKNB 4M3ZA 3DRSB 3DLKB 3OYJA 1QS4A 4Q0BA 4KO0B 5KG0A 5KT2A 3RRHA 1RTJB 4IQXA 4R5PA 4KBIA 1VK0A 1RAJA 3VQEA 4FVMA 1RDCA 2VWJA 1HNVA 2O4GA 1IKWB 3KLEA 4I2QB 2GV9A 5J2QA 4NLGA 4RW4A 3KJVA 4DU3A 4DSJA 4M3YA 3H5UA 4F4KA 3NDKA 1FK9B 2UUTA 5D3GA 4KI6A 4ECVA 3VQDA 4EZ9A 3HJFA 4EYHB 4CGJA 3MF5A 3T5LA 1NJXA 1YVUA 5F9NA 1RNHA 3BQ1A 4MFBB 4BE0A 4FJ7A 4KI4A 4OKKA 4E7IA 3QINA 1HYVA 3QERA 4CGHA 4GW6A 2C2RA 1RT7A 1CXUA 5EDWA 3DLGB 3JYTA 3ZSWA 2FBXA 5SZTA 4IKAA 4J9LA 3LANA 4TYBA 4E89A 3VA0A 1YTUA 3EZUA 1TL1B 3RBDA 1TAQA 3RB6A 1S1TA 2BQUA 4CJLA 2ASDA 3VQSA 4KSEB 3KLIB 2J6SA 3KHHA 3LP0A 4IDKA 3GIMA 4ZVHA 5EUHA 3KKRA 2OPPA 4FJ5A 4KV8A 1SKWA 3QGGA 4EBDA 1W0HA 2IM2A 2VG5A 5KFPA 4B8AB 1TV6A 3HP9A 3QEIA 1W25A 3EY1A 3UQSA 2W8KA 1RYSA 4YFUA 4DL3A 3ULDA 5EU7A 3VQ7A 5J2MA 3UR0A 2E6MA 2HAIA 2IJNA 4E1NA 1TVRA 3VQBA 5KRTA 3GV7B 1J5OB 4EBCA 3QO9B 1JLEA 2JC1A 3Q8RB 5HBMB 4FBTA 1J54A 1RT1A 1TKDA 3CIZA 4RW8B 1U47A 1S97A 4M3UA 2BRLA 4ED2A 1IO2A 4CFCA 4ECXA 1S5JA 1NKCA 4O0JA 3L2WA 5KFMA 4E7HA 4LSLA 1YVFA 2XWYA 4ECZA 4K4ZA 2BQ3A 1EETB 2D3ZA 3SZ2A 3BJYA 2UVUA 1BISA 2B4JA 4RNFA 4ICLA 1ZYQA 4K4TA 1XI1A 5HRPA 2OZSA 4DU1A 2R8HA 1KTQA 3VQPA 2P5OA 1BQNA 1RBUA 4HHTA 4CESA 2BANB 3OSPA 3H98A 4H54A 4AILC 4CHZA 1MU2B 3IGVA 5KG4A 5KGXA 4FLTA 3ISND 3SPZA 5JS1A 4UQGA 4IG0A 3OYCA 1JXBA 3O4QA 3OJUA 1S9FA 4CJRA 4U6PA 4NCBA 5KG5A 3TAMB 1UA1A 1T05A 1JKHB 2HWHA 4W5QA 3OYMA 4ZVGA 5C42A 5C5JA 4O3SA 5JXSA 3WNGA 2B6AA 3AO4A 3ITHB 4FM0A 4DTUA 3ZT2A 1BIZA 3T19A 4PY5A 2YKMA 4FJIA 2JLEA 5KT7A 4ZHRA 4CFBA 1SL2A 1REVA 4WFZA 4EEYA 3OYHA 4ZVFA 1W9HA 3SI8A 5HLFB 5CYMB 1XR7A 3CG7A 2BR0A 2AGOA 1VSLA 5I42A 1QE1A 4M3RA 4TQSA 4DF4A 1LW2A 4Y1CA 1JLBA 4QW8A 3DLHA 2IS3A 5DK5A 4B9VA 1C0UB 3V4IA 1O1WA 4CEOA 5FDLB 4NYNA 5HRSA 4CJUA 3QGIA 4U7CA 1T8EA 1L3SA 3PUFA 4KHSA 2W7OA 1IKXA 2ATLA 2D0BA 2R7YA 3UDLA 1HQEA 2BE2A 5DG8A 3WNEA 3ZT0A 1ASWA 4FLVA 2VWKA 2R8KA 3E01B 3QZ7A 4ED7A 4RNNA 3Q8PB 4OLAA 1HQUB 4FLUA 2B5JB 3SUPA 3AVGA 4KAIA 3G10A 2RDJA 3OLAA 3KLFB 3EPGA 1Y97A 3I5BA 4G1QB 4O3QA 2FC0A 3UPFA 5KFWA 4CFAA 5EWGA 1TK0A 1S1UA 5KFTA 2QKKA 5FRNA 1S0NA 3HVRA 1S1VA 4C8MA 3NFAA 1RT3B 4K8ZA 3PW7A 1C1BB 4DFMA 3KMQA 5SWMA 4FZXC 3IG1B 3LWMA 1KSPA 1CLQA 2D7SA 4DTPA 2V4QA 4HUEA 4KHMA 1UA0A 2GBZA 1IM4A 1I3AA 4IFVA 4XO0A 1CXQA 2IOCA 3OYAA 3NF9A 5KG2A 3NF8A 4C8KA 1Z4UA 1LW0A 4CECA 2XI3A 3CJ0A 4OKEA 4NLRA 2RF2A 3KHGA 2XY7A 3AVKA 1A5WA 4DQIA 1WNEA 3GQCA 1C0MA 2HNDB 4NLPA 2P5GA 4CK3A 4ECSA 3V81A 4CJEA 4M3TA 4FS2A 4O3NA 2QE5A 5HROA 1SL0A 3OJSA 3OVNA 2V9WA 3L2UA 3BSAA 4CIEA 2FJXA 3IS9B 1R0AB 2HNYA 1YTAA 2GIRA 1IKYB 4CK1A 4ELVA 1RTDA 4DLEA 4LD0A 2G8VA 4FJLA 1RT5A 4EP5A 3KD5E 3TARA 4CHNA 3LP3A 2C28A 3PY8A 5KRSA 3K2PA 3BDPA 4KHQA 2ZE2B 3MEEB 1RDDA 3LP2B 3HKWA 4RU9A 1RT4B 4K4YA 3M9OB 3NH0A 4WXWA 3P1GA 3NBPB 4WE1B 1BCOA 4CEFA 1VSEA 1NK5A 5KFAA 1N56A 5KG1A 5KFNA 3C95A 4FK4A 1WSFA 3MXMA 3PW2A 4ZP7A 2JEIA 3DDKA 4FXDA 1QSLA 3LALA 4AH9A 4C8LA 1TL3B 3LP1A 1JLFB 2Y1IA 3OS1A 5J1EB 1WAJA 4CJTA 3VA3A 5KG6A 1S49A 3KLHB 1DTQB 2GIQA 4O3OA 2W9CA 3SFGA 4HYKA 4J2BA 1NNDA 3NF6A 2FLPA 3OS0A 5HP1A 1LV5A 4ECQA 3CDWA 5DQHA 3JSMB 2P1JA 3ZCMA 1CZBA 4DQQA 4DTRA 4J9PA 5KFLA 2Z1JA 4CF8A 3NGDA 2YNGB 2AU0A 3QLHB 2IA6A 1LWCB 3V6HA 4QOZB 1NK6A 4B9MA 1KLMA 4OGCA 3NH2A 4ID5B 4JLHA 5L1KA 1T94A 4CHOA 3FFIB 5DMRA 1TKTB 2RKIA 1NKEA 4KAZA 3M8SA 3KK3A 4FJXA 4URGA 3QGHA 2X78A 1S6PA 4FYDA 4O4RA 2HVHA 3TAQA 1U4BA 2G8FA 2EHGA 3TAFA 2B43A 2X6SA 4B9SA 1VRUA 2VG7B 4IH6A 4FJ9A 4JV1A 4H4OB 4YR2A 5CY4A 4NLWA 1DLOA 1BQMB 1FKOB 3WNFA 1C0TA 2IMWP 3KKSA 1UWBA 3DYAB 1IH7A 2FBVA 4W5OA 1ZBFA 1EKEA 3OS2A 3HSTB 1GOCA 1NK7A 2KFNA 1KHVA 3NGYA 1B9DA 1ZBLA 1NOYA 4ECWA 2IBKA 3CFPA 2F8EX 3H4DA 4BACA 2KZMA 2KZZA 2OH2A 3RR7A 3RR8A 5F9LA 5KFXA 4PWDA 1A5VA 4JS4A 3V9XA 1BIUA 4CHQA 3QZ8A 3GV8B 3VQ4A 2XY5A 3FQLA 4MKAA 3GV5B 2X6NA 1NK0A 3RWUA 3KLGA 2E9ZA 1HNVB 4JV0A 1JLCA 3KLEB 1RTHA 4GC6A 1TQLA 4KB7A 5J2QB 4B3OA 4RW4B 3SFUA 4I2PA 3HK2A 1B9FA 4RW6B 2YNFA
chains in the Genus database with same CATH superfamily
4N56A 1RLDA 5RUBA 4QYRA 1WBDA 3CDBA 3DC2A 2WVBA 1C6VA 2MZSA 3H3OB 4YN3B 2F9TA 2E5LJ 3GCWP 1R43A 5KFRA 2QLFB 4QWAA 1U24A 3PV8A 3D7SB 4QPTA 2F40A 1RKJA 4JI4K 5EVZA 4Z2XA 2E2QA 4YB5A 4KB1A 3C94A 3FGUA 4LF7F 3CJTA 5J2PA 1LAVA 3DRPB 3A4TA 3WX4A 3V5RA 4GV3A 2VG6B 2M4MA 2G4BA 1S1TB 3QFUA 3CCMS 2ZBQA 3MN7A 2XS5A 3CDUA 1S6OA 5D0RA 3X3UA 1GXTA 1HI0P 4KHNA 2OPPB 1HR0F 1N36F 1EP4A 3VF4A 4I9QA 3ZEUB 5GADP 1ZBHA 4R0EA 3MTJA 2HZCA 2RIJA 1JCGA 4A5BA 4RNMA 3M5RA 4CTAA 1RDBA 2HHSA 4WF9L 2IJFA 3DM2A 4MLHA 3MDQA 3SEOA 2YKNA 5KFJA 3M8PB 3CCLS 1DKGD 2LEBA 4L74A 1LK5A 1RTJA 3TAPA 2ZDPA 2E4LA 2CQIA 3LAKA 5U47A 4DR7J 4YDDB 1IKWA 3GZ7A 1CZAN 1VQ6N 1Q82O 4PPZA 3OYKA 1FK9A 1YBAA 1HL6A 3SAFA 3P31A 1XMQK 1M5SA 4ZVEA 3LGMA 5AQTA 4X4QA 2F4FA 4IG3A 1P9YA 3Q2SC 3QBWA 4I68A 2WFBA 3MMBA 3BBBA 3VQTA 1JB0C 2APOA 2I7PA 4F36A 5DGAA 4NE9C 2VPYB 1CG2A 2J8SA 4FPRA 4DQRA 2YNHB 3C6TA 4M5MA 2ZKTA 4NO7A 1URNA 4I67A 4IG0B 1SL1A 2RQCA 2DFFA 3CCTA 5LSOA 3VGVA 3IBFB 1KNZA 1T05B 1ASVA 2ZWPA 1T03B 2HBMA 4JI8K 2B6AB 1RTZA 3HHKA 3ZTRA 4J2DA 5JICA 2A1SA 5KTQA 4NLOA 3TA0A 4G65A 2ZKUA 1HD1A 2PD1A 3QMQA 3A8KA 3MFHA 2MJUA 1W26A 2ALYB 4CO5A 3IN5A 3QSIA 4JI2F 1VSHA 2QL5B 3KTQA 3OYEA 1G6BA 5F0WA 4QPXA 1LWFA 4LFAF 3O3FA 4Q5VA 1NDPA 3SI6A 1WSEA 5CH7B 3PW4A 1KVCA 4ZJQA 2GEMA 3TJAA 3CCES 2EI5A 2FVRA 1H7XA 1LOTB 4GNIA 1FTCA 3FBEA 2EWHA 1SIZA 2VPXB 4CGDA 2RILA 1FWPA 3RAMA 1RGIA 3UIQA 2ADBA 2BVZA 1TAUA 1VQKN 3N6NA 1QVFM 1UZHA 2XNRA 1X7VA 3D9BA 2O8EA 3WDOA 3PKYA 1SJQA 2DJWA 2R2SA 3G71S 3CC7N 2IIRA 2FY1A 1ATSA 5D0HA 5E3CA 3QT7A 1MU2A 4GC7A 3MHYA 1WF0A 3WQPA 4R8UA 4BREA 5IWAJ 5DQIA 3ID6A 1K8KB 4B3RJ 2DPJA 4LSZB 2JH3A 3TUIC 2MGZA 3S7RA 1V5IB 2E9RX 5BN8A 3IAM9 3NF7A 2W01A 2NPFA 3QFPA 3ZTSA 2W41A 3IFEA 2PDAA 4FK0A 3RMDA 3O4NA 2WONA 1Z2LA 2ABYA 3ITHA 3MECB 3NS7B 4J7CA 4LF6K 1GNKA 1HBMB 3ZZRA 2HKEA 1X4CA 2AQ4A 4IRCA 5CYQA 2XGQA 3QAUA 2VCPA 2OEMA 2UU9K 4PXEA 5GADI 3NNCA 4A48A 1NBEB 2C2ZB 3M8RA 3A0IX 1AA1B 4BR5A 2E1AA 2VBWA 5KFGA 5LMNK 5AQVA 4KHYA 1RTDB 2KYXA 2BTFA 4MKBA 8ATCB 3OL9A 1ITGA 2LQJA 4RCHA 4B9QA 1RHMB 4HI2A 4CJQA 5EX5A 4FDFA 3CCVS 4DV3F 1OWXA 4ZP9A 4P73A 5HQLA 4E7LA 3PO5A 2W2PP 3E01A 4CGIA 1HKBA 3AV9A 1AXQA 2FF3B 2OJ3A 3OD2A 4F50A 3EYZA 1N4LA 4WQ5A 2CPHA 5KT5A 3MWTA 3W66A 4YNQA 1QUPA 3CI5A 1BD6A 3C15A 1WOOA 4NRTA 2GC8A 4A8KA 4LF8F 4W92B 3A5MC 2NLXA 1T7PA 3E66A 4BDPA 2BMBA 1FRMA 4Y2AA 4F2RA 3OFEA 4DX7A 3BZQA 1RT3A 4QW9A 2EC0A 1B7FA 2ZDOA 2AGPA 1GX5A 3NMUA 4L6V3 2CADA 2O5DA 3MR6A 4A8QA 3ICLA 2MB0B 3I31A 5A8RB 4LIWA 2OGUA 3UB5A 1AUDA 1NGCA 1RAAB 2KJVA 4CJ3A 3JAMY 4W98A 4J2AA 4P52A 4GVMA 1NMNA 4DKWA 3FZBA 2ROEA 3B6OA 2N4DA 3L0QA 3DCAA 1FFSB 1U25A 2F3JA 1BU6O 3G8SA 2HNDA 3BGFA 3OBWA 1H74A 3V1RA 2IM1A 1SBRA 2VV5A 1S9EA 1T3OA 3NLCA 4C9DA 3PSFA 3DRRB 2ILZA 2Q6CA 3RTVA 3QIDA 3GJTB 3I4PA 3IS9A 1VRUB 2VASA 2ZWHA 1IJFB 4URQU 3JB9k 1DTTA 3I32A 4DR3K 3EJMA 4I9LA 2JWKA 2M88A 2CPIA 4QS8A 2D1CA 2ZE2A 3FRZA 3N4WA 4CHYA 3T1AA 4H4KC 1H1VA 1ELOA 4DV7F 3GYNA 1NM2A 2WOMB 2FHJA 2BOPA 1R59O 5DLGA 1XNQJ 2NRRA 2N4CA 5KFYA 5M2UA 4CJ7A 2EC2A 3TQEA 1QDUB 4CCHA 4FJJA 3GMGA 2HB5A 1HBOA 3OSNA 2BXJA 2Y8WA 4AT1B 4DTJA 3AOAA 1YJVA 4MDAA 4YUDA 4WFXA 1VQKS 3DI6B 2E20A 1RUSA 4JKDA 3IR6B 1KS2A 3LUYA 1H7WA 3KLGB 2JFDA 5HRRA 2I2YA 5AR0A 2UXBJ 3CJ5A 2Q3SA 1ZM2A 4KBOA 4HACB 4DR6F 4AHCA 1XR6A 3BZCA 5HRNA 3G6EN 4LQ9A 1NMEB 3UWTA 3CC7S 4UUWA 3TSUA 5L9NA 2XMKA 2FLNA 4IJAA 3QLHA 1SQKA 2P9GA 3PYEA 5F8IA 3NAEA 1RKIA 1HWUA 2WTUA 4KKOA 2F5GA 3TZYA 4ZVTB 4MK8A 3KG4A 4BR0A 3N6MA 2OP5A 1JJHA 2J9EA 5KG7A 2UUAJ 1ZTWA 3W0LA 2IAJB 3N0VA 4HTUA 1U02A 1IBKF 4X65J 2BUPA 2XZDB 3CD6N 1YJWN 1VIOA 4FS1A 1HWLA 1JLAB 1BQMA 3KK1A 4KHUA 3I8BA 1GK8A 3ENHA 1NNEA 3KIOA 3VCDA 1X31C 3MN9A 3SAHA 1CC8A 2UV8A 3N79A 5F8HA 2HBLA 4NCGA 5IM0B 5I3QA 4IOXA 4ENOA 3ZSZA 2LQ8A 5KFKA 2BZ2A 3EWGA 3PR5B 4XH1A 3GIIA 1UEVA 4EZ6A 2OI2A 4CEBA 1RACB 4X66F 2GW8A 4OX9K 4DEZA 1UVIA 2IM0A 2OHDA 2P9UA 1RSCA 1SUQB 2FLOA 2E9TA 4BWMA 2PY5A 3LP0B 2QV6A 1IN0A 4FWRA 4K43A 1VRQC 3IBCB 1NJIT 2UXCF 1P1LA 3ULEA 2GJIA 2BE7D 2QL7B 4FSVA 1VQLS 3C2PA 4KB0A 5IC6B 4RW9A 1TV6B 5J1NA 2AJ1A 2VYPA 1XHXA 3Q7BA 1E6YA 3MFIA 3TQ1A 1M5KC 1OH8A 1WF1A 3THYB 1RBVA 4KFBB 2IVOA 3H7HB 3VF0B 4ED4A 2RD5C 3QATA 3IRXA 4FOIA 2BUNA 1GXLA 3RBEA 4C97A 3N28A 1GOBA 3MMCA 5IS2A 4A57A 1N6QA 2HWTA 4LSLB 4W5RA 4CM2A 2GMLA 4CJFA 3DXMA 1QLNA 1N33K 3B82A 3ZC4A 4LREA 1JJ2M 3BGRA 4ZDNA 3DMJB 3H59A 4M1KA 4EFHA 4MFBA 4BRHA 1DQ8A 2AKWB 5E0OA 3BQ2A 2E5LF 2DNZA 4I6MB 3M8QB 5AQZA 3CERA 3UI3A 5JS2A 3VGSA 1BQNB 4GMKA 4QAGA 1QM9A 2UVWA 5F8JA 3ZZYA 3OHBA 1N32K 2O4IA 2HYIB 3JTNA 4N8OA 4DOZA 1HFEL 3T5HA 4N5SA 3KLIA 4ISEA 5AQSA 3DLLL 2JEJA 2RN2A 3U1NA 4K0KK 1GFWB 1NHUA 3W9HA 1AZSA 2IMOA 5C42B 2ATCB 1YRUA 3MEDB 1WOQA 4P2MA 3OFGA 5ETMA 5DM6L 4F0HA 3ET6A 2KDOA 4ZHRB 3KWIA 1QZ5A 4JI6K 1REVB 1S6UA 3I0SA 3TVKA 3G6ES 1Q9YA 4DQSA 2XQCA 3QGPA 2EK1A 3QO9A 3BF4A 1HNXJ 1UVJA 1QE1B 1WSHA 1UW9A 3FEZA 1Q5VA 3TEHB 3ZTPA 4JUZA 3LL3A 2DHGA 1X9MA 2GELA 1N8RT 2MQOA 4DR7F 2I6WA 2XZWA 4B08A 1HBNA 3NAIA 3ILOA 3WX8A 4OZ3A 2HMIB 3AJ1A 4JEPA 1IKXB 3SMZA 1R3NA 4CO2A 3Q83A 1J6ZA 3CJ8A 4OZ2A 2D5RA 1SC4B 4U96A 2I5JA 5HAOA 4DB3A 4HLBA 3T9NA 3OVAA 3FQKA 1W2IA 2A6AA 1YJWS 1E6VA 2Q6BA 3CCUN 2IVPA 2GZOA 1PYTA 1U2VA 2UV8G 4JKGA 1A9NB 3OW2M 2YX7A 4USVA 4ZVQB 1FJGJ 3OYDA 1RA7A 1O6XA 3W5ZA 1RAIB 4CO3A 4FF4A 4JI1J 2X1GA 5ETLA 5I9EB 3I6PA 1UJ6A 3MK6A 4DUYK 1VJQA 4BC9A 1N5YA 1P90A 1FX4A 3TSQA 4YDUC 1Y4ZB 4WIQA 2IC3B 2QSFA 3R9LA 4DV6J 5CZ1A 1HNWK 2Z2MA 3BH6B 2FLLA 3DLLQ 3UD4P 2JC0A 1MWQA 4NLUA 3C7NA 3HFVA 1S7HA 3HT3A 5HLFA 4RUCA 3E9LA 3NMAA 2PMWA 5AZJB 1TP7A 4AM6A 3O8WA 2HNYB 1N0VC 2HWIA 4RBUA 3K58A 3LPUA 5IT4A 1SH3A 3AVLA 4OGEA 3UVJB 2DGQA 3SBGA 1GXUA 4DCOB 5DZ6A 4KYZA 2FVQA 2FZCB 4FPIA 1R8PA 3EM1A 3U02A 3NEKA 1JJ4A 5CZ2A 3OTEA 2LDIA 3G86A 3KLFA 4O3PA 1VFJA 5LMUK 4JB8B 4Q44A 3VQAA 2CIMA 4H4MA 3AT1B 2ACMA 4CF0A 3TA1A 3WXIA 4K4WA 2DKOB 2MQQA 2VC0A 5DGBA 5IWAF 3U1LA 1NPPA 2NNWA 1U1RA 2FVPA 4B3RF 1JL2A 3DXKA 2VQFK 1N8RO 1U04A 4CJ5A 3ISNC 2DFHA 1CBKA 1D5AA 2HHXA 3L2VA 4JV2A 3EKSA 5M1OA 1JWWA 1BI4A 4O4GB 1SJ4P 4YOYA 1M5PC 2J0QD 2HVIA 1KVAA 4K4VA 1RCHA 3MUMP 2F96A 4XH5A 3TZWA 2DO4A 2CNNB 5A8KA 5HMXA 1X3MA 1IXKA 5LJWA 1CJKB 3IM8A 4QCLA 2KO1A 4QWCA 4MQ3A 4L72B 4GKJJ 2OD4A 5K8PA 4PYDA 3SBMA 4K50A 2ASPA 2QK9A 3IFRA 4EUVA 1XHZA 4CNZA 1B92A 2RHSB 2HIYA 2QA4N 2GAHC 1RBRA 4BGBA 1NG9A 4D3GA 3CHWA 1ZETA 3THXA 4WE1A 3HHLA 4DSKA 2CPEA 3VQ8A 1FHTA 1S99A 2WRMA 2HVDA 3Q2TC 1RU1A 3ZT1A 2A6OA 3HDSA 4EP4A 3NOCA 3FZ2A 1UKUA 1KRPA 4CD1A 1JLFA 2AMCB 5J1EA 2OPSA 3KLHA 3W60A 2P9KA 4NYPA 4LT6A 3CCUS 2MQNA 3SJJA 4ID1A 2V68A 1JLCB 1V6HA 4CT8A 4ZA1A 4PUOB 4X4PA 2HHPA 3MEGB 3VAFA 4YR3A 2KFZA 4FWLA 2MQLA 5JVGQ 3POTA 1U6FA 2ZVSA 1WAFA 4BGAA 4ECYA 2WBMA 3I0RA 2A1RA 1H2TZ 4TU7A 3RYLA 2DGVA 3T6JA 3ZTQA 1ICEB 4J8FA 2D41A 3PW0A 1JX4A 2IGIA 3MN6A 1BWEA 1TUVA 2QN6B 1KP6A 3W9IA 2Z1IA 3P5TL 1PJ5A 3F9MA 3T1HJ 2VG7A 2H3GX 4ANEA 2A40A 1OPIA 3G6YA 1JLGB 2LEAA 4GV6A 2BDPA 4DTMA 4BR9A 3TA2A 3GG0A 1EP4B 2AW0A 2J8AA 4ZN3A 2HHQA 2GGPB 1XNQF 1IQTA 4B3SK 3QNOA 1VQ5N 4KHWA 1CJUA 4J9UE 3VEVA 1Q0NA 2QW9A 2V5HG 3ASMA 4CTAB 1XUPO 2FYXA 3H4BA 2IJRA 2PSZA 2QYGA 3DM2B 1KAYA 3NE6A 1FXRA 4WFBL 3UN2A 1FVSA 2YKNB 3CTRA 1RAOA 3DLKB 3QDKA 2DRBA 3VGMA 3VTHA 3M30A 3RRHA 1RTJB 4R5PA 1FE4A 3VQEA 3WT0A 3GDQA 1T9TA 2OIHA 1IKWB 2UXBF 4WCEL 4NLGA 3KJVA 4DSJA 4IDHA 1IM6A 1FK9B 5D3GA 4KI6A 2JLGA 4ECVA 2CQ0A 4EZ9A 5BPLA 1VDHA 3FR0A 4DR4K 4HHJA 3BQ1A 4BE0A 4OX6A 2P9IB 3A3OB 3QINA 3SCLE 2UUAF 3P38A 1YZ7A 3BEGB 3MMBB 3D54A 1TL7B 2D0PA 3DLGB 1PJ7A 3ZSWA 4X65F 1KQGB 5SZTA 4OHZA 1QQNA 1X0FA 1TL1B 2BX6A 3RBDA 4CJLA 3VQSA 4DPUA 1HHQA 5H1SQ 3MPVA 3UFCX 5EN1A 3PYGA 2P9NA 1G2EA 2J6SA 1DFDA 2PI5A 4IDKA 2CA9A 3JTOA 3GIMA 4ZVHA 3DNCA 3CJKA 5EUHA 3QJJA 2GHPA 4FJ5A 2VFVA 1U0SA 1WEXA 4I64A 2HRTA 1SKWA 1W0HA 2CH6A 2IM2A 3CDAA 2DEIA 2KT2A 4B8AB 4LFBJ 1ACMB 1W25A 1RWUA 4ALZA 3VEYA 1HD0A 3UQSA 2KT3A 2RQMA 3CQXA 2UXDJ 3ENBA 4UF4A 2W8KA 3WEEA 3UR0A 2QA4S 4BRMA 3EDQB 3ZETB 4BC2A 4QYZK 3VQBA 4B1VA 4BC7A 1Q8KA 4PQAA 1JLEA 4U95A 4DCHA 2JC1A 2DHXA 2DH8A 3M2VA 1O0PA 3CIZA 3PEJA 2BRLA 3HM8A 4GVBA 4X62J 4O0JA 3L2WA 4WFBQ 1Y5IB 5JMNA 3IMQJ 3WQTA 2JRSA 4K7QA 4K4ZA 2BQ3A 1EETB 2FPHX 1APSA 3GB0A 1TUUA 1K47A 1Z05A 1RAGB 2UVUA 5DDOC 5C0YA 1ZZFA 1M1GA 2M70A 1KTQA 3JSYA 3ID8A 3VQPA 2P5OA 4O23A 4F26A 1RBUA 5F0UA 3CJ7A 4X4VA 3OSPA 4OYZA 2L9DA 4WKRA 1MU2B 2AP1A 4LR8A 2CGJA 4F02A 4FLTA 1UVMA 2DNNA 3O3LA 2J0XA 1X8DA 4UQGA 1WC5A 1JXBA 3TVZA 3EE9A 3O4QA 2MGZB 1S9FA 4CJRA 1NUEA 3TAMB 1RWXB 2HWHA 1QQOA 1ZA2B 3LDQA 5E3QA 3OYMA 2JWNA 4ZVGA 4O3SA 5JXSA 1FTRA 1MNEA 3AO4A 3ITHB 4DTUA 1FA0A 2W1BA 1T11A 2YKMA 1ATRA 1S12A 3L4BC 4NEZA 5KT7A 1WSRA 4B17A 5BJRA 4EEYA 2HHHJ 1W9HA 5KAKA 4Q2LA 4BRAA 2BR0A 1GLCG 4O8KA 1FEEA 1X4BA 4IOAL 4TQSA 3G4SN 2CQ3A 1MWZA 3QT8A 3CCQS 1GMUA 1Z2ZA 3BKUA 4PHTX 4QR2A 3V4IA 1BC6A 4QR1A 5CR4A 4JK9A 3QGIA 3PRVA 1L3SA 2DGUA 1C0GA 3K8VA 1T3VA 1HQEA 3ZT0A 3IUCA 3J81Y 3E01B 3QZ7A 1IV0A 4PCQA 1EZZB 4ED7A 2QO3A 4XAKA 1WKJA 1C4AA 4FLUA 3MM8A 3N5BA 4NOHA 3EO3A 4DHYA 3EXYA 1P8GA 1HNXF 3D0IE 3I5BA 4C23A 4O3QA 1Y5LB 3QMLA 4CFAA 5EWGA 1UZDA 1TK0A 2GWJA 4LFCK 2CVEA 5LSRA 1S1UA 2JX2A 5FRNA 1S0NA 1S1VA 2Q1NA 4C8MA 3NFAA 1RT3B 2YWGA 4AXIA 4DFMA 2XG8A 2FQQB 4FZXC 4JI4J 4AL7A 3HRGA 3IO1A 3IG1B 4USJC 1VLYA 5FLXY 2CZVC 1CXQA 3O44A 2RU9A 2M5YA 2IRYA 5AT1B 1NGDA 3HBTA 4CECA 4CZJA 1NU0A 3KHGA 4V19J 4ZLPA 2XY7A 2MEWA 4I6AA 3L7PA 1WNEA 3ZZUA 3G2XA 2HNDB 4NLPA 2JFKA 2P5GA 1NB2A 4ECSA 3V81A 1IBMJ 1FJGF 5HROA 1SL0A 1WC6A 3OVNA 1HW8A 4JI1F 3BSAA 1N52B 1PC4A 2LQBA 1MG7A 3IS9B 4M5IA 4ZPWR 4C11B 1NGJA 5CD4H 3IWNC 6FD1A 1OVYA 3RSEA 1CJVA 4P2FA 2G8VA 4EP5A 3VZHA 2KHCA 4O8UA 2YXLA 2C28A 2Q66A 2K2PA 4OJHA 4DV6F 2YWEA 3BDPA 2ZE2B 1KVKA 4CBXA 4IOAQ 4RU9A 4K4YA 5AE2A 3TWZA 4MO5A 5GMKa 2GTDA 4WXWA 1Y64A 3R6GB 1BCOA 3X1LB 4CEFA 1VQ9S 1RXOB 1VSEA 1W7AA 5HMWA 3CJ1A 4DUZJ 3LGNA 3DDKA 4FXDA 5A6PA 1RE1B 1QSLA 4K2XA 5ADXH 1HBOB 3PACA 1U0HA 2V2KA 3PCOB 3IRWP 2FIUA 3VENA 4CJTA 3TUPA 2DXDA 1XMQJ 1S49A 2GIQA 2VJVA 2GJFA 3NF6A 5HP1A 1D8ZA 3OVBA 2CQGA 2KLAA 2V67A 3MZIA 2X3GA 3UN5A 4BC4A 3A8IA 3L3CA 2Z1JA 2XMMA 2ZM6K 3QLHB 2B4OA 3V6HA 2H54B 1KLMA 4WQ5C 3MM6A 1VAZA 3WXJA 1VC6A 4JLHA 2YJFA 3ZX3A 5DMRA 3Q89A 3HHDA 4CZEA 1NGEA 1U1QA 3QGHA 1JJ2R 4JI8J 1Q16B 3SLCA 2HVHA 3TAQA 1U4BA 2NR0A 3H45C 3TAFA 2B43A 2X6SA 1HWJA 4OLPA 2A3ZA 2W2NP 3CCSN 2RS2A 5JVHL 4H4OB 1OH7A 3R5DA 3VETA 3TEGA 1BQMB 3WNFA 1C0TA 3BDEA 4KH0B 3K5PA 4NYOA 3ENVA 3AB2B 4W5OA 1E4FT 1L3KA 3G4SS 3BGLA 5AZIB 2DHAA 3OS2A 3HSTB 7FDRA 4X84A 3MUVP 2QI2A 3NGYA 2UYTA 4WP3A 1NOYA 2F8EX 1NU4A 5E33A 2ZH1A 1OKJA 2KZZA 3RR8A 3H1VX 3TUJC 4PWDA 2RAQA 4GKJF 2XSJB 3NGTA 3CCZA 3BB5A 2XLKA 5GVQA 4CIOA 2P9UB 1BQXA 3VQ4A 4B1UB 2XY5A 4FN5A 2GHWA 2QTWA 1PCAA 2CGKA 4K5RA 2PAVA 1NGHA 3GP9A 3L9ZA 3KLEB 4V19X 1RTHA 3MPDA 2BJDA 4B3OA 1O51A 3SFUA 3HK2A 2D1KA 4TVAB 1B9FA 2YNFA 2J9CA 4RW9B 4FM2A 3E1YA 1YT3A 1GT8A 1E6YB 5LM7E 1HMVA 4NLCA 2CWKA 2YKAA 4KHRA 4NLTA 1ZZNA 2A18A 4OI3A 1GLEG 3SMPA 4ZITA 1NPRA 1M5HA 2AJQA 1XEZA 3KK2A 3AVIA 1EB0A 1RHRB 3IRXB 3LO3A 3I55S 3ZNUA 3VQ9A 4ZPDA 1RT7B 3HMJG 3OR2A 3JYTB 3MMAA 4M3WA 3MMCB 2BJ1A 3M05A 3MOZA 5GIPA 3EVOA 1N6QB 5C25A 3I82A 3DXMB 4AL6A 3H8YA 3KHYA 2X51A 3BGRB 5SUHA 3QSYB 4F4ZA 1HPMA 3M6WA 3IAYA 1F2HA 2NSCA 4JKBA 3EUNA 5JVHQ 1GAOA 3LDOA 5LMNJ 4BRNA 1J9AA 2XHCA 3MCOA 3HVTA 3H5XA 2AWZA 1MWMA 2LSNA 2P2CB 2QA4G 1X4HA 4KGKA 1Q7LB 2R7VA 2W24A 3T1HF 4YQWA 3DRSA 1QJHA 2VFRA 2NXNA 4M5GA 5L46A 1RDWX 1RT1B 1DAXA 4HHHA 5C2GA 1QAIA 3HPOA 3RBZA 1S6QA 4OHVA 2PA3A 2BKOA 3HD1A 1FKPA 1AZSB 1Z1ZA 2GO9A 5CZXA 3RAQA 3C16A 1FXDA 2HOEA 2O8FA 2ROGA 4NI2A 3ET6B 3VN5A 2AYMA 3HSGA 3CC4N 5BR8K 3KG1A 4ICLB 3I0SB 4E98A 1VRTA 1B0PA 4CIFA 2ZOGA 2BGGA 2OKQA 3CSKA 3OXLA 2R2TA 1Q53A 4DR1F 3G6XA 1LXNA 3GE1A 3S3OA 2FUG9 2ASJA 4OVLA 4Y2IA 3R5JB 2QA1A 1WN7A 4UW2A 4F25A 1NPKA 1ZC6A 5C2CA 4JP8A 2NXUA 2RB7A 3KDOA 4YEAA 2FJEB 4Y6IA 4E1MA 4C0OC 2I5JB 4CBUA 1PG5B 1T9YA 3GFXA 4CWBA 1RBLA 3CCSS 2HBJA 1L3UA 1S1WA 1RBOB 1X9JA 4LF7K 1E6VB 2B7CB 4RU2A 2QXFA 4CLYA 4OJ3A 3IMXA 3NNHA 1SPBP 4DR3J 4YY3K 3S9HA 4JKGB 4CK2A 3D7EO 4DPWA 1LNQA 1Y00A 4DL5A 2NRZA 2RRBA 2VKZG 2P9SB 2O8CB 2YQ3A 4LBHA 1KVJA 2VU5A 1TZ0A 1YDLA 4EIAA 1J5OA 1QAJA 4DV2J 4BRKA 1N5TA 2NRWA 2CNKB 3DLEA 4JI5J 2QXLA 4CGGA 3TSPA 4F9OA 1N36K 2ZOMA 3WC2A 4JRQA 1SS6A 3MN5A 1JLBB 2NREA 4RW8A 1S0VA 4JKCA 1N5YB 3W62A 2XHBA 1AYEA 3Q8UA 3ETOA 1VQSA 4H03B 3JXUA 2LA4A 4KTZA 1OQ6A 3AA5X 3TVYA 4LFBF 2NUHA 2ZEJA 4KPCA 3ZSRA 2UXDF 3Q86A 2I0XA 2C2NA 2C2DA 1Z25A 4XK8C 3UE2A 3NVMA 4CE9A 1RHQB 4IRKA 3V9WA 3CDEA 2HQCA 3IGNA 2FSKA 3THVA 1QD1A 5GAHP 4LRFA 4C8ZA 5K8OA 1R8AA 1DEJA 3MOJB 3AXMA 2YKPA 4LUBA 4X62F 3QNNA 3W5XA 2DNKA 3A1YG 4ILGB 3B54A 4HCBA 1WDDA 4OI6A 1JXLA 2XYHB 3R8YA 5D78A 4FLXA 2XC9A 4LRCA 1JKHA 3C65A 5C24A 2D9PA 2P9PA 2YH1A 3KXDA 2PI4A 2QMUB 3CJAA 2F9WA 1D09B 2CVIA 3CQ8A 3EE3A 3K5LA 2GCFA 1L5UA 5KFDA 4FNIA 4QS7A 2HW3A 3T7ZA 2OEJA 2E2PA 4H4MB 2EW9A 2W7PA 2NYHA 5T14A 1XIQA 5A2QY 5CYMA 1OY9A 4NEYA 1ZA1B 4XIUA 3RMCA 1F21A 5FDLA 2N7YA 2CQBA 1MN7A 5T41A 1NDLA 2H5JB 2VOOA 2D3OR 1BI4B 1YK9A 4OX9J 4OZNA 1HYSA 1HJRA 5HL7L 4O44A 4PWWA 5D8HB 2DITA 4JI2K 4WPAA 3VAIA 2OANA 4F3MA 2IRXA 4TYAA 2JVOA 3DOMB 4BCAA 2HHHF 5H9FJ 2F65A 1H3DA 5IV4A 2XB2D 4G6VB 1XNRK 4DV1J 4J37A 1GLFO 2E5GA 4NXMK 3LPYA 2VGNA 3BP8A 3CC4S 3P83D 1U49A 1VSMA 3AVHA 2OZMA 1IVZA 1XQIA 2P8IA 3CMEN 5M1QA 2QMXA 4E0DA 2DB1A 1D3WA 4IWVA 4X64K 3HHLB 4FJMA 1M90T 3VQ5A 1J2VA 4UY8T 3BR8A 4USMA 4F4WA 3M2UB 1XJWB 1REGX 1ZBSA 2CQ2A 3PHTA 3CYMA 2HFUA 2KHOA 3CD7A 2OPSB 3EKUA 4C8NA 3SIPB 1GX6A 2IM3A 2RKIB 4ELTA 3S6EA 3KK3B 2PMZD 1SAZA 1NHKL 4IRDA 5KQDA 1WI6A 3MI7X 3NGIA 1S6PB 2QRRA 2QLJB 2AZ1A 2LQ5A 2LEPA 2VGMA 3FBFA 2QJ3A 1VQ8N 4N76A 1R0AA 1SH2A 5KFIA 3A8YA 1CJTA 4JI4F 2EBGA 3J7ZT 3F0NA 3FSYA 4J90A 3MM9A 3BPDA 4AHRA 2QG9B 3D2FA 4OZJA 1N32J 3T5JA 3HZ6A 2CH5A 4DLGA 1RT4A 1S48A 3I0RB 1HKAA 2B8QA 2GVDA 3L6QA 4K0KJ 2KTQA 1MMDA 1IBMF 2YKQA 3TJ8A 3VWSA 5HL7Q 5ETOA 1T6CA 3ZSYA 4FNHA 1BGXT 3Q23A 1S77D 2YKOA 5H9EK 4HT7A 3VALA 1K44A 4OMFG 2J9DE 1SC3B 2V34A 4JI6J 2I7NA 3HM9A 5GAHI 1KLNA 4BY9C 5B0FA 4E2FB 3DOKA 3V6JA 2JDJA 4Q45A 1H6KX 3B8AX 3UW1A 4GKKK 1RGVA 3KDNA 5A0YA 3BPSP 4OPAA 4NZ7A 1H98A 2OAUA 4K4SA 1CJUB 4DUZF 4C0HA 4ID5A 4ES2A 4A2AA 1BCMA 1J53A 2GNKA 2QKBA 4DV5K 4PG4A 1EX8A 1XMQF 1SC6A 3M30B 2HNZA 3VVUA 2C3PA 4R5PB 1ZM4A 2HGMA 5B0BA 1DARA 2UVVA 3NL0A 1MLAA 3VQCA 3TANA 3MXJA 1UOCA 5FLXU 3KJVB 3MGJA 2KFYA 4CI0B 4ECRA 4FXVA 2VIHA 1BLUA 5BYSA 5J2NA 5KFHA 3EGZA 3M8WA 3GONA 2FVCA 4LF9K 5AQRA 1M90O 1Q1KA 4DUYJ 1BA1A 4UY8O 3CO0P 2OTJN 3J7Z5 2UUWA 4BVPA 3VAGA 3R6LB 4JI8F 4KC5A 1D1UA 1QQMA 1RBSA 3W63A 4FLWA 3WUHA 2WSEC 2CJQA 4DV7K 5AQXA 4OZLA 3H5YA 1FDDA 2P9NB 1PKUA 1SV5B 4ZCKA 2XYPB 4M94A 3J7YU 2KQ2A 3QEXA 1OH5A 4ZPTR 3UNGC 3J7ZO 1RISA 4UT4A 4F4XA 3FK4A 2RRAA 4RW6A 1RT2A 4OYPA 2VBYA 2CFXA 2DPNA 3WEEB 3CJ3A 1LQ9A 3O80A 4DR2J 3DOLB 2FBYA 4P10A 2ATQA 3MR2A 1JLEB 1HJOA 3VGTA 3M2VB 5CCMA 3K57A 1R89A 3SQOP 2BYCA 5LMUJ 4HVZA 5ETKA 4I2QA 5E3RA 3HHNB 4CJKA 1V5VA 5D0EA 2XEXA 1VSJA 1U1PA 1OS5A 4DTSA 2V2VA 2QGFB 4MIAA 3H5SA 3PVXA 3D45A 1SZ2A 1QQCA 3NP5A 5BRFA 2XMWA 5HN0A 5DM7L 4B3TK 4QIGA 5LJVA 2DO0A 2PC6A 2VQFJ 4RX6A 1FJCA 4J9NA 1VK3A 1FNMA 1S72S 4B9LA 3IWLA 1X4FA 1FDNA 2EWSA 3SCIE 1A0OB 3HPHA 3I5CA 4M5DA 2RNEA 2FJDB 3KJFB 2HIQA 4CLPA 1RAEB 4EGLA 3GSIA 4CEEA 1PJ6A 4K41A 4RWXA 3GJQB 2D74B 2ZVIA 2DNQA 2R8JA 3CJSA 5LMNF 4CERA 4X66K 4LH5A 1R8BA 4RBTA 4CO0A 2YKMB 2HQIA 3VERA 2P51A 4Z4CA 4KIAA 3BSNA 4CEDA 3ILJA 3ONQA 3QAEA 4RWWA 1K1SA 1RBTA 2BJEA 3SUQA 2X1BA 1KKHA 5HMYA 2OPQA 4A4JA 2Q3PA 3M8YA 4JKFA 3VGKA 2YX6A 1H0HB 5HBMA 2E44A 1L3VA 2V7YA 3CCRS 1VHXA 1NK4A 3I56S 5L8RC 3LGHA 1BHNA 2U2FA 2J6UA 3OL7A 5CABA 3GWCA 2MKJA 4BE1A 4QWBA 1HYZA 3W3SA 4UZBA 3V1QA 2Z30B 4WXOA 2YHAA 1HQEB 3I9V9 2POKA 3MAQA 2A41A 4CYUB 7AT1B 3GR0A 4LF5K 3AJ2A 4KE5A 3R1XA 4P72A 4AQYJ 4KH4A 3MM8B 1KVBA 1HI8A 3ISZA 2RHKA 4ZIWA 2OELA 2OMOA 4C3MA 3M9MB 1WTFA 8RUCA 4OJGA 2CYYA 2QWPA 5JJBA 5GAHU 1HI1A 3FKBA 4IFEA 1S1VB 1QAXA 3W2VA 3UE5A 5CA5A 4F3QA 2YNIA 1XC9A 2OTJS 1FNXH 2LXUA 1LWEA 3DXSX 4MH8A 2R8IA 1RTIA 2VKRA 4CJPA 3LZIA 4BDYA 5GIOA 2PE8A 3L2RA 2WK4A 1NDKA 4UZCA 3AA3A 2W9BB 2KW4A 5IQQA 3TI0A 2C3MA 3D2EA 2AF6A 4DR3F 5AQUA 1YHQN 3NNAA 3TZZA 4P74A 3V81B 1TK8A 3PEHA 1S1XA 2IVYA 1G4CA 1T9XA 4DV2F 5HROB 5AXNA 2EFQA 5EWEA 3SYZA 3RB0A 4JI5F 5I3UB 4EYIB 1DY3A 4B3SJ 4BS2A 2FZKB 2V8VA 3H6EA 1I6JA 3NKYA 3CNQP 1C0UA 5FLXO 3C6UA 1WC1A 2ZJPL 5D77A 2QFJA 3OY9A 1WUAA 3K5MA 1G99A 1GEHA 2JGUA 4YR0A 3QYYA 4ELUA 1IJJA 2OYQA 1ITPA 2DIUA 2JWLA 1XC3A 2LXIA 2OFHX 5I4MA 4M42A 2BOAA 3NCRA 4OJ1A 3SPYA 3SCJE 3DDNA 4LIRA 4DR7K 2J5AA 3UD5A 3EN9A 3UKRB 1X60A 5E3AA 4DTNA 4EHUA 4DR5K 1PGZA 4DR4J 2XYGB 4LQ3A 2DNPA 3SDEA 3O3GA 4DUTA 3W65A 3BO2A 1EX4A 1OYEA 1SJRA 3PZPA 3VGUA 1QHTA 5KFUA 3OQ2A 3R7BB 3V1OA 1RLCL 2J9DA 1T02A 2RT3A 3C46A 3QETA 3MM7A 5B0AA 3CF5L 1KLMB 1S3XA 2AX0A 9RUBA 2EFPA 1NBWA 3DGPA 4Y0WA 4KJIA 3JXOA 4WKYA 4N41A 4IXCA 3QB0A 1YXQA 2XMTA 4QU6A 9ATCB 1XWLA 1ZAVA 3MXIA 3DHXA 1D0EA 2G2ZA 2P6SA 1OYDA 1KQKA 4CLTA 2YHBA 4GO7X 2XBPA 3LDSA 3AVFA 3LZJA 4AHTA 4IBNA 4OX9F 3MTKA 3HXMA 3LP2A 2QEXN 2DH7A 1GQEA 3EMTA 3WBZA 3SQGA 3MX2A 4K25A 1TTHB 1VJWA 3RRGA 4Y1DA 2ZJPQ 4ZVPB 3NBPA 3M1FA 3BN4A 2YV0X 3HLUA 2U1AA 1VISA 3W9JA 4AHUA 1TKXB 4DV1F 1S9GB 1WBBA 3BH7B 2ZH9A 5KFFA 2IYIA 4MYUA 4PWDB 3V6KA 2HBYB 4LJMA 4DSIA 4M45A 2WUSA 3SUOA 2Q0RA 2Z2YB 1FRHA 4ZVSB 3V6DB 5HSPA 2PYJA 3KMSA 2JEGA 2JOQA 3UR3C 1YIJN 2R7XA 4JOUA 3AHPA 2UZAA 2BQRA 1EWQA 2V4JA 4FWOA 3JSMA 2Q97A 2FJBB 4BRFA 2G8UA 2W6KA 3F5TA 4B3OB 3PHEA 2H65B 3AVAA 3H0PA 4ED1A 2DH9A 4BRLA 3TPQA 2YNFB 2M8DB 3O08A 4JI7J 5KFBA 1NJYA 3PM9A 4CF1A 3AXKA 2K3IA 1HMVB 4NA2A 5KFQA 3FFIA 5HANA 2NS1B 1TKTA 1Q5YA 2M7SA 5A2QU 5GAGI 5IWAK 3EXCX 2GQCA 1YKWA 4Y65A 4W90B 4B3RK 4FJKA 4ES1A 2GA7A 2W7AA 3KK2B 3T3FA 4GMJB 3CF5Q 2G2OA 3OR2B 2RVJA 3L8BA 1WSIA 3MMAB 2QWOA 4DTXA 3D6MB 1YHQS 4CF2A 2HRUA 4DMNA 1HA1A 4CZLA 2GX8A 4C7QA 4F3OA 1N32F 3DYAA 1F3FA 4J9KA 4FW2A 2MXYA 5B7WA 3K89A 1X3NA 4P7TA 1X5OA 4FLYA 1IBLJ 4TKTA 3G25A 4K0KF 2AT1B 3CC2N 5E5NA 3FCWA 2ZH6A 1QVGR 3VPZA 1C4CA 2MY7A 5KFEA 3O9UA 1B4SA 1P1TA 2QWRA 5DJBA 2BKNA 4ATNA 3ZSXA 1ZM3A 1UVNA 2KM8C 2ALZA 5ADXA 3TWHA 1NEEA 4LSNA 5I3PA 4DPOA 1C1AA 4R25A 4M3ZA 2DNLA 3DRSB 4Z7YA 3M2RB 4Q0BA 4JI6F 1LEOA 4ER8A 1YSJA 4KBIA 3BF1A 4FVMA 1RDCA 1GLBG 4RPFA 2GV9A 3S8SA 4DU3A 2MKHA 4M3YA 3H5UA 2ZBRA 2OTLN 3NDKA 3BBCA 4EYHB 4L3NA 1VBXA 1NJXA 3NRBA 1YUWA 2ASOA 4FJ7A 4YORA 4OKKA 3P4UB 4X4RA 2QT7A 3QERA 3H46O 4CGHA 1O13A 3EVMA 2C2RA 3QFHA 1CXUA 1SQEA 2XO6A 1VBZA 3VA0A 2HFOA 4QBUA 3EZUA 3RB6A 1S1TA 2Y8YA 2W4DA 4HHUA 4KY3A 2DK2A 2CRLA 4Q7AA 5D4LA 1Y10A 2CNOB 4BR2A 2H9ZA 2W40A 3O5TB 3KKRA 2IY5B 2OPPA 1U7LA 2Z57B 2FXUA 4CLLA 3GCXP 2VG5A 3G9CA 4DUYF 3HP9A 3ZEUA 3BEXA 4ISFA 5IC4B 1RYSA 2MLXA 4DL3A 2QEXS 3ULDA 3ZNJ1 1K73T 2V50A 4ZJOA 1IWAA 1J5OB 4LR9A 2BEFA 3FUYA 4XDCA 1SQGA 1WKKA 1T44A 4DJBA 2IA0A 2Y1LB 3IXQA 1TKDA 2N3OA 4RW8B 4IO9Q 3BBFA 1S97A 4M3UA 1RABB 5KFMA 5EGYA 1KN6A 3LA0A 1RAFB 4A8YA 1YVFA 3ILLA 3ENAA 1HLWA 2B8PA 5A8WA 3SZ2A 5DO2A 3BJYA 2ZFHA 4X4NA 1MWKA 4CM0A 5HJXA 2LDYA 1BISA 4KGMA 3R97A 4WIIA 1ZYQA 4K4TA 5HRPA 4DR2F 1A7GE 3Q7CA 1OSDA 2ZM6J 4QQBA 5B0EA 5BXIA 3H98A 3E9OA 5LMUF 4TU8A 3H2UB 4H54A 3SK3A 3IGVA 5KG4A 4ZCLA 1IR2A 5KGXA 3ISND 5JS1A 4IG0A 5K20B 2HLUA 3DAWA 2YY3A 2UUAK 1U2RA 1UA1A 1T05A 3N9UC 1VQON 1JKHB 1HX1A 2MHNA 1YWXA 4DU7A 3QT5A 1CEZA 4I56A 2VQFF 2B6AA 2VFSA 1Q95G 1G7CB 5HI7A 3T19A 1TUYA 3Q22A 3N5FA 5BR9A 1N34K 2JLEA 5D0GA 3OFHA 3OYHA 5AQQA 2DCUB 2Y3YA 3FC9A 3WXMB 5CYMB 2ZH2A 2AGOA 1HHSA 5I42A 1YITN 3DLHA 4QW8A 5DK5A 2HAFA 4CEOA 5FDLB 5HRSA 5E7OB 1VLOA 3OXFA 4U7CA 3CPEA 3GTYX 1RWMB 2W7OA 2ATLA 2V8HA 2D0BA 5DG8A 4RTFD 1ASWA 3ILIA 5HMZA 4M7XA 1IWGA 2GQ2A 2YPYA 2R8KA 2P9EA 5A2QO 5LL6Z 5GAGU 3DLJA 1TU0B 4OLAA 1HQUB 2O8DA 2BACA 4Y00A 3SUPA 3P8BB 3OLAA 4ZS6A 3TTFA 1Y97A 2KXFA 4NXNK 4N8NA 1F2GA 5KFWA 3RW7A 2FHKA 1K73O 2MYFA 2CPYA 5L38A 1KXPA 2VQEK 3T6BA 2Y0SD 4K8ZA 1K8KA 3PW7A 3FBCA 5SWMA 1RHJB 2LQ9A 3J80Y 3EE8A 3K0SA 1KSPA 1WOSA 3QRQA 2YJEA 4AQYF 1AT1B 3G87A 4A47A 2V4QA 4CH0S 3WIUA 4FYYB 3NF9A 4AE5A 4QOTA 4C8KA 2MZRA 1Z4UA 1LW0A 2XI3A 4DV0K 2ADCA 4ZVRB 3L7UA 4M5JA 1NDCA 1VHFA 3NGKA 4DQIA 3GQCA 1PC5A 1NSPA 3FZLA 4MKYA 2ZC4A 2AJ4A 1PBUA 3JQMA 4M3TA 1VQ6S 1Q8LA 4LRAA 3BKFA 2QE5A 2ZJQL 1KQSM 2V9WA 4K42A 2VFTA 4CIEA 2FJXA 3MX5A 1R0AB 1YTAA 1CJTB 2I8EA 1RTDA 4OPHA 3THPA 4DLEA 3OBYA 4LD0A 4FJLA 3MM9B 4OZ0A 1RT5A 4YS2A 3KD5E 3D2FB 4YHHK 2Z56B 3TARA 4CHNA 5KRSA 3MEEB 2Q0UA 1VQMN 1RDDA 1RT4B 3AY0A 3OHRA 3M9OB 2YWWA 3NH0A 3AAQA 2AZ3A 3P1GA 2ZNYA 3KUHA 1XMOJ 2YCHA 4F0KA 4B1XB 2C1EB 1NK5A 5KFAA 1N56A 4BC3A 5KG1A 4OHWA 2GV1A 3SSRA 1WSFA 3MCMA 3QWUA 4V19S 4BQZA 3UNYA 2FF6A 4AH9A 2BJ9A 1TL3B 3LP1A 4B3SF 3OS1A 4KRWA 1OMSA 5H1SV 1NLVA 4QS9A 5BR8J 1NNDA 5TKWA 3OS0A 2UUCJ 4ECQA 3CDWA 2P1JA 3DN9A 2PN6A 1CZBA 1S79A 2HS0A 3AH6A 3T1YK 4YOXA 1OY6A 3RUBL 4D3HA 5A0YB 3M8ZA 2E8AA 1HBUB 3NGDA 2YNGB 5BYRA 4PG6A 3TO8A 1LWCB 4A8SA 4FWSA 4JI0K 4QOZB 1K0TA 5ADZA 4ID5B 1T94A 4NPOA 5F3ZA 4PXBA 5AQNA 1NKEA 1VQOS 3D1HA 2C2KB 4FJXA 4URGA 2ZGZA 4DR4F 1VC5A 2X78A 5K8MA 1LXJA 3ZFVA 4FYDA 2IVFB 2UUBK 1J27A 4KGXB 1JK9B 4B9SA 1VRUA 4YY3J 3F41A 1RK8A 4JBCA 2P5VA 2LLZA 1N5VA 2PIIA 1RJJA 3FEYB 2FHMA 1UWBA 3L7OA 2JVRA 2ZJQQ 5B0DA 1IH7A 1YITS 2DGSA 2E5JA 3QPIA 4FF2A 1FO1A 1GOCA 1F60B 1TR0A 3E3XA 1SKUB 1B9DA 4PG8A 1ZBLA 2QIFA 2Z8QA 2CJ9A 3W2WA 4BACA 4MMOA 5AJ3K 4FYVB 2KZMA 2KKHA 3HHEA 4WFAL 4PG7A 2XLIA 5KFXA 1A5VA 4HR2A 4JV5K 1OY8A 2CAJA 3FQLA 4MKAA 2MKIA 3SCKE 3KLGA 5T7LA 3QRPA 1HNVB 2K8GA 4HACA 5J2QB 5E2QA 4RW4B 3QWPA 2BM1A 7FD1A 4RW6B 2FB0A 1N5SA 2MSTA 3H20A 2E5HA 4EO6A 1RT2B 2E6LA 3CMAN 1HKCA 2KB2A 2LFVA 4F0MA 2HMPA 1I51B 3ULHA 1DT9A 5T7BA 2YHWA 4Y34A 1PYOB 5F8NA 2JEFA 2IAJA 2QX0A 2V4RA 4HKQA 2ZBCA 4FM1A 4DFJA 3CUNA 3M6XA 1CSJA 1MSWD 4LC9B 2IDOA 5AQMA 2CUYA 3CFOA 4OZ1A 4ES3A 4JHDB 3D2WA 1CQMA 4ZVOB 3AA4A 1JLAA 1PYSB 2PEHA 4JI7F 4A61A 3QEWA 4Z4EA 4A2BA 5K9FA 1K9MT 1A6LA 1WSJA 3KYLA 4B3MJ 1HLUA 2EX3A 3AO3A 4RW7A 4KV8B 2AD9A 2MZ1A 3VEZA 1HUXA 2Z58B 2RS8A 2SXLA 1I94K 2HSEB 3CM6A 2AYGA 3UDVA 1RU2A 2QLWA 3DDIA 2EFOA 2HURA 2M52A 3SQ0A 1OVQA 3HZGA 5HJYA 4DTOA 1CZ9A 3K8WA 3L95X 5GADU 1TVRB 4Z4FA 4UQTA 1SUQA 2FTRA 2EG2A 4WFAQ 1J5EK 4L75A 1XNRJ 4NXMJ 1IBLF 3EGWB 4HH0A 3BSOA 3L3UA 4NLYA 4OYAA 2KG0A 3ZSOA 1OO0B 1TUGB 2DBBA 4DCPB 2V2QA 2AGQA 1DHMA 5FPMA 3WQUA 2IVNA 5FROA 2K1RB 3RB3A 4A62A 3NY0A 4DV4K 5MLCQ 1YJ9N 1EHWA 5ETPA 2AIRB 4CJSA 4KFBA 4X64J 2OPQB 2OA8A 4ISGA 4MAKA 3BQ0A 1TGOA 2H51B 2PGCA 3O2IA 1Q86T 2WZ1A 1S0OA 4L8RB 1UJ5A 1FF2A 4HUGA 3Q0AA 4DU8A 2GS8A 4XTTA 4ILHA 4B9TA 3MD3A 4UOFA 2NZ4A 3G6VA 3EX7B 4MK9A 2B3TB 3V9UA 4IR1A 2E7WA 4Z4GA 3OYGA 2W9AA 5A76A 2PT0A 3SAGA 3IC1A 4CO1A 5EY4A 3DMJA 4FZYA 2MJNA 1MA9B 5AQKA 3GIRA 2F7TA 3VQ6A 2VA3A 1M0SA 3Q8VA 3BM7A 4P7VA 3M8QA 1FDBA 4HWIA 3G82A 3IBWA 4F8RA 3OTBA 3DHWC 3P96A 5IT0A 2HVEA 2C22A 3NXZA 2IRUA 4OYXA 3W2VB 4DZ6A 2YNIB 3OA9A 2Z2LA 2E1CA 3PFEA 1U2FA 1LWEB 1LW2B 1L3TA 1U8SA 3AD7C 1RTIB 2OO4A 1YJNN 3TUZC 3U3GA 1WC3A 2KH9A 4BRDA 4NZ6A 2W8LA 4F4AA 5H9EJ 3MEDA 3ZT3A 2Q2RA 3CO9A 2HQ3A 3D2EB 1K9MO 3CCJN 5LOQA 2IDEA 1NJIO 2CNLB 2WSFC 4CW7B 1W2BR 3MAAB 4RUBA 4WYLA 1S1XB 3CD6S 4GKKJ 3ZZOA 4JK8A 4GY2B 3S3NA 3HFZB 5AQYA 3FFKB 3KHRA 3EGNA 3NGZA 4ZMMA 1E4GT 3FMWA 1T0TV 2VUGA 2MLYA 2BANA 2W4CA 2LU2A 4NLQA 3C6UB 1EQMA 4JN4A 4E3SA 1K1QA 4O3RA 2HMIA 4TLRA 4DV5J 1GTHA 2VOPA 4RKUC 4HL9A 4QJVA 5KT3A 1NJWA 4DL6A 2MZQA 3VHQA 4CBWA 3C14A 5ETRA 4B9NA 3CETA 3ZYYX 3CB4A 1Z26A 5FIIA 4TSXA 5KT6A 2DNRA 1R0CB 4DR1K 3B8HA 2ASLA 2G0IA 4ZOSA 2R7UA 1NSAA 2ZM6F 3CGIA 3D67A 3ZSQA 2RF2B 2PMHA 3O1BA 4EAHD 4WWSA 4LF9J 1U1NA 1IBCB 2ZHOA 1Q86O 1RI7A 2Q43A 3W8PA 3KNAA 2HPUA 4DPXA 4CH1A 4Y2KA 4MLEA 2IC3A 1M1KT 3VESA 3AFGA 3W3DA 1WG5A 3UDEA 4WK1A 4ZTJA 3E9PA 3CJ2A 1BA0A 2IHR1 3KD1E 2YWHA 1G3OA 5IT9U 3GFYA 1MWYA 4H8KA 1S57A 2HHWA 2GFFA 3MMJA 1D9AA 1EKRA 3HSZA 5C10A 1D8YA 4URSA 4C1NK 4GVEA 3W8GA 3L3VA 4Z4IA 5IFMA 3N6LA 2J4RA 6AT1B 4ERDA 4FVUA 4CLZA 5HVGA 1NHVA 4LFBK 4DXLA 1WEZA 2XRIA 2UXDK 4U7BA 2XS2A 2RDDA 3R9PA 2FHJD 5JVGL 2AYBA 4CF9A 4EU0A 3OYBA 3K2YA 2R42A 1NGFA 5BPMA 1YBUA 3OXGA 1KFDA 4WYWA 4EMDA 2UVRA 4X62K 2WC9A 1P6TA 3PFOA 4ZP6A 4B1YB 3TX8A 4PRFA 5HOOA 3GLJA 3A5NC 2L48A 4NLXA 2DGOA 1NZAA 5KOWA 1HNZK 4FK2A 2ETJA 1P8ZA 4B1ZA 4B3TJ 2D0CA 4RG8A 4LF2A 2G8HA 1IKYA 1F3VA 3DWLA 2CWXA 2M3DA 3R7NB 2B0GA 3PX6A 4O4GA 2O66A 3ATUA 1IR1A 3OTOK 1HKGA 1AW0A 4YMEA 1U6ZA 2ZHBA 1YJNS 3MCAB 3ZX2A 3GIJA 2A6MA 3AA8A 4BWJA 4ED3A 2LMIA 1T9UA 4M5LA 3R8EA 4EO8A 3D66A 2KKZA 2VPWB 1OIAA 1ROFA 3OYNA 3CCJS 3OHAA 2I1RA 3CULA 2YHXA 4CHPA 2NQPA 3CQYA 4OI0A 3AO5A 1B64A 4FVCA 1NCLA 1XN9A 2HHHK 3PJWA 3P4IA 4IYQA 4ZLLA 4ZPBA 1X9SA 3S3MA 5M1PA 1XMOF 4I2PB 3AOCA 1M1KO 4UTGA 3NVKA 3D0HE 4UOCA 4L76A 2MPUA 5E84A 4Z0UA 4OPKA 1FWKA 5EOYA 1V4SA 2A2DA 3AVNA 5LSLA 4LSNB 1YGYA 4LF5J 4XDDA 3GIKA 5BR8F 4Q0BB 3SUNA 2QSWA 3C66A 3E51A 2YQ0A 1X4GA 3ZO7A 3QBCA 1FKAF 2UUCF 3J80U 1KAXA 5J2PB 1AFJA 2RQ4A 3QJLA 3TJ9A 2NCKL 4PUOA 2C3UA 3MEGA 1R8CA 2G8KA 3US5A 3K59A 1V4TA 2ZH3A 3PDNA 1WJ9A 4PAAA 4FYXB 4CZHA 1UEUA 3ZXWA 2QM1A 3G71N 1UL3A 4USUA 1VS3A 4RLEA 3LQVA 4K5SA 1WSGA 4PKGA 3VTIA 2WHOA 4BQLA 3ALYA 2HF3A 4ZVUB 3TYTA 1NZ8A 2V51B 2V94A 4I6WA 4ZCMA 5KFCA 5F8GA 3M6VA 4M5KA 2WW8A 4XPCA 2BRKA 4WJBA 3WC0A 3G0ZA 3A12A 3ZZ0A 1JNZB 5DZ7A 4YY3F 3CPWR 3FMBA 3V9ZA 5HQMA 4WBFA 1PO6A 1VK8A 2E66A 4I6YA 4OX8A 3KLVA 2FJVA 1JLGA 1I3OB 4YB1P 3UKUA 3R3TA 5AE3A 1NGAA 1IBMK 2JLFA 5KOXA 2A10A 1VIXA 3HO1A 2HHVA 2GGPA 2VG5B 1X9WA 4DSLA 4YOUA 1SC1B 4TNOA 5LL6d 1UFWA 2W42A 4GVLA 2BKPA 2HEKA 4JYAK 4CQ1A 3LWLA 1Y3JA 3CCVN 3EZOA 3DLKA 4IG3B 2XO7A 2FSNA 1RAHB 2DY4A 2DNMA 3I33A 2ZH8A 2V69A 4AD6A 4F4YA 3AVJA 1ESVA 1FXLA 4DUZK 4LVNP 3HOTA 2PZSA 3C6TB 4FJGA 2HVZA 3O3HA 2XCPA 4ANDA 5A8WB 3BREA 1HWKA 2GVZA 5IT9O 4DR5J 5AQPA 4TQRA 4B8CA 3RW6A 4H5NA 1EQ0A 4OZ5A 4PL8A 2EFNA 4QIWD 2P9IA 4HUFA 3ZT4A 4QWDA 1RT6A 3PX4A 1AB8A 4QIEA 2G2YA 4BROA 3P49B 4Y2CA 3LAMA 3A3NB 4FF1A 5CCLA 1TL7A 3DLGA 2ACYA 3F44A 2E1RA 2FSJA 5E41A 5ELZA 5AXKA 2R2UA 1B0VA 2I9SA 4I7FA 4OYIA 4QWEA 1TL1A 2VC1A 1YJTA 4LRBA 1LWFB 5LJ3Y 4JI3J 1HPZA 4NCAA 2RPIA 4DZDA 3FCVA 3P39A 1G15A 4B3MF 5HQ8A 4WTOB 4LF4K 2HS4A 2WBNA 1X4AA 3VOVA 1UMJA 1KQSR 5AQGA 4BDZA 4TN2A 1Z6RA 2ZNZA 1C0FA 4DL2A 1OPZA 2DTUA 1WTBA 5BYQA 1AROP 1R6VA 1C1CA 5K14A 3ZETA 1IKVA 2DGTA 4WZMA 5FPEA 3TR8A 3H2LA 5I42B 2ASYA 2OCEA 3AVBA 1QTMA 2E2OA 2HSTA 2HFZA 1NB7A 2O8EB 3GILA 1RWKB 4NLDA 3ELHA 4IEIA 3R7SB 4WF9Q 3M9NB 1XNRF 3A13A 4NXMF 3H08A 3PKMA 4WFYA 2MQPA 2F7VA 3LTOA 2BW7A 4AM7A 4R8UB 1Q79A 1EETA 5F1XA 4AHSA 3R5CA 1OQ3A 2F8MA 3AGKA 3BV8A 2KRRA 4C3LA 2FZGB 3M6GA 2O8DB 3MAHA 3C3LA 1NK9A 2F8TA 3QESA 4X64F 2WONB 4JAXA 4WP9A 1X5TA 4F7VA 1NOZA 1EXQA 3ADAC 1PBAA 3L09A 1WELA 2Q1LA 5CYQB 3MWBA 3KG0A 1HRHA 5F2RA 4KREA 5D4NA 2JHEA 2G0JA 1PIEA 1NWKA 2X3DA 3L4IA 1VQ5S 2NRXA 3QIOA 3K5OA 3HSCA 2RMLA 4PQUA 4CGFA 4N77A 2F4VK 1EIYB 4ZTFA 4CEQA 3TAMA 4HTIA 4R79A 2J7WA 1V3RA 1SXLA 2W2OP 1VSDA 3ZZTA 1F5CA 4U8YA 1RDRA 4C6AA 1LW0B 4NLSA 1UW4A 3ZZZA 1H72C 4HI1A 2RHQB 4X2BA 4OPJA 3LM9A 2DRAA 1JL1A 2BBEA 4FWNA 2Z0GA 3OYIA 3J80O 1QSSA 4ZIVA 2Z4PA 3C15B 4HT5A 4WZQA 1Q7YT 1U48A 5L1JA 4C0BA 1RT5B 1RWPB 1RYRA 3NMRA 3D3CJ 2KXNB 3N01A 4HTJA 2VPZB 2PYLA 4J5OA 1P27B 4L73A 4DS4A 1VMBA 2J6TA 4RNOA 2ZZMA 3FDSA 3DXBA 2J7KA 1BWVA 1WKLA 2QWMA 4FJNA 4CZMA 5IXUA 4GKKF 1XERA 1FESA 3LP1B 5CZVA 1XBWA 1FFWB 1VQLN 2DR7A 5FRMA 4DL4A 4E19A 4CEZA 3UCUP 4KGVB 1JIHA 3CJ4A 2ZJRL 3HJVA 1S9EB 5KGWA 4DV5F 4DG1A 3LH2S 3KJQB 4JK7A 3FZMA 2NSBA 3HHLD 1GMVA 4ZKAA 1FERA 4NLBA 3MEKA 3IG1A 2BJ8A 1DTTB 2LXFA 1VCTA 1JLQA 3LOUA 3J7AN 4CZCA 3WHIA 4DSFA 1S10A 1SQFA 2XWXA 3HD2A 3KWMA 2DGXA 4K4XA 4YOTA 4KHPK 2YWKA 4DF8A 1N48A 4USI