3LM2A

Crystal structure of putative kinase. (17743352) from agrobacterium tumefaciens str. c58 (dupont) at 1.70 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
225
structure length
225
Chain Sequence
MAEDQTVLAIDIGGSHVKIGLSTDGEERKVESGKTMTGPEMVAAVTAMAKDMTYDVIAMGYPGPVVHNKPLREPVNLGEGWVGYDYEGAFGRPVRIVNDALMQAIGSYNGGRMLFLGLGTGLGAAMIVENVAQPMEIAHLPYRKGKTYEHYVSEAYREKKGNAKWQKRVQDVVERLSAALEPDEVVIGGGNVERLENLPPKCRRGDNAMAFEGGFRLWKNADLIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative kinase
publication title Crystal structure of Putative kinase. (17743352) from AGROBACTERIUM TUMEFACIENS str. C58 (Dupont) at 1.70 A resolution
rcsb
source organism Agrobacterium tumefaciens
total genus 58
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3lm2A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3lm2A01
1NGGA 4FWKA 4BR4A 3MN6A 4BR9A 4B1ZA 1HX1A 2ZF5O 1T6CA 3ATVA 4H5VA 2FSJA 2FLOA 2HMPA 3CETA 3UKUB 3VF2A 2YHYA 2P9UB 4BC4A 2E1YA 2KHOA 1NBWA 5EX5A 2GTDA 5JMVA 2E20A 3CJ9A 3FZHA 3J8AA 3MN7A 3UKRB 4NB4A 2A3ZA 2ASPA 2FSNA 4CBXA 3FZMA 5AQVA 2GUPA 4WYBA 3O1WA 4BREA 2P9SA 1DKGD 5AQKA 1QQNA 2P9LB 4MLHA 2A41A 1QHAA 1GLLO 4CZIA 2V52B 2ASMA 2YJEA 3UKUA 3MN9A 4GNIA 5KPTA 1YUWA 2P9UA 1NLVA 2NLXA 1BDGA 3A5LC 3UKRA 2NRHA 4BVPA 2D0PA 4MLEA 3RSEB 3LDQA 3P4IA 1CZAN 4BRFA 3WT0A 4B1XB 4RWTA 1GLDG 4CZGA 1NMDA 4YDUA 4CBWA 4K42A 1J6ZA 4BC3A 5BR9A 2P9LA 5FPDA 5ADXA 3M1FA 4A62A 1X3MA 4FWNA 1BUPA 4F9OA 2IVNA 1MWKA 2NZTA 5F2RA 4EIAA 1U2VB 4H0PA 2P9PB 4FWSA 1KXPA 5EOYA 2P9NB 3GOIA 3OHRA 1T6DA 1IJJA 4FWQA 1HKGA 3G25A 5AQXA 4JD2B 2BTFA 3RSEA 3CHWA 1EQYA 3O80A 3HTVA 3GL1A 3I8BA 2P9KA 4H0TB 4BRNA 1Z6RA 1NWKA 3FZFA 4IJAA 2Q0UA 1QQMA 1GLEG 3IFRA 3HM8A 3IDHA 3CQXA 3ZX0A 3BF1A 4JN4A 3MDQA 5I9EB 1NGCA 3VOVA 1U2VA 1MDUB 4IXCA 5TKYA 3D2FB 4A61A 2P9PA 2Q31A 2AP1A 3GDQA 4BR2A 4CZKA 4EFHA 3B8AX 2GWKA 1NGAA 5EY4A 3R8EA 4FWMA 4QS8A 4PKGA 2HF4A 4XH1A 3A5OC 4JD2A 3HSCA 4FOEA 3SMPA 3EO3A 1C0FA 5AQRA 1BOTO 4K43A 5BRHA 3FE1A 4BGAA 3I33A 2A6AA 2I7NA 4E1JA 5EXWA 4FPAA 1NGDA 4FO0A 5BPLA 4FWPA 1ATSA 1U6ZA 3AAPA 1H1VA 2YCHA 4HTLA 5JICA 4B1YB 4PKIA 1X3NA 3A5MC 3VERA 1JCFA 2P9IA 3D2FA 4H5RA 4BRDA 4FPBA 1NGHA 2E2QA 1DGKN 3ZETB 4I6MB 3MCPA 2A42A 2QWLA 1ZC6A 3FR0A 3O4WA 4CI6A 3HZ6A 2QWNA 1GLBG 3LDOA 2QWRA 3SK3A 4B1VA 3CQYA 3EKSA 4RTFD 4IO8A 4BR7A 1NGIA 1YAGA 5BPNA 1BA1A 4B9QA 2YHWA 2QW9A 4AM7A 5AR0A 3LM2A 3EZWA 4BRIA 1NGJA 5AQIA 1SAZA 4BC2A 3U9ZA 4BRMA 2D0OA 4M63C 5AQPA 3TU5A 5AZIB 1GLCG 5F1XA 3ZX2A 2F9WA 5AQGA 3MK6A 3WQUA 3QFUA 3ZETA 4I6MA 2H3GX 2VWBA 3H3OB 4BRKA 2QXLA 3ENOA 1NM1A 4QS9A 1TUYA 3GE1A 5KPRA 1BO5O 4O8KA 3VGKA 3O5BA 4FWOA 5JLHA 3FFKB 5AQZA 3VEOA 1KAYA 2P9KB 3UE5A 1NGBA 4EHTA 1BA0A 2CGLA 2F9TA 5AZIA 4BG8A 4CZHA 1RFQA 2CH6A 3WQTA 4QS7A 3KZBA 3U8XA 3VF4A 4ISGA 3FZLA 4PKHA 3ULEB 4PL8A 5FPEA 3H3NO 2VCPA 1R59O 2QWPA 3WXIA 2E2PA 3EL2A 2V7YA 3BEXA 4LC9B 4BVOA 2D4WA 3DAWA 2DPNA 2Q2RA 4K41A 4J8FA 3WXJA 4CD3A 3SLCA 3ENHA 4KBOA 5AQOA 3SJHA 3CJCA 5EVZA 4H0OA 4BRAA 2QWMA 3VF6A 2QWOA 1ZXOA 1Y64A 1XQSC 3QBWA 4RCHA 3W0LA 4H0XB 1QZ5A 1XC3A 5BN9A 3H1QA 3W3DA 4L3QA 5E26A 3FLCO 3VGLA 3VGMA 3H46O 2FSKA 1DEJA 3VETA 3ULEA 2A5XA 5F0XA 5AQLA 3JXUA 4BRLA 5BRFA 2P9IB 3KHYA 1GLAG 1QZ6A 4BRGA 2WUSA 3LL3A 1Q18A 1BG3A 1RDWX 2EWSA 2ASOA 4CZEA 4EHUA 4DB3A 3CJAA 3DXKB 3QBXA 3H1VX 3VPZA 4GY2B 1E4GT 4IZ9A 2GEMA 3WXLA 1JCGA 3DWLA 2ZWHA 1ZBSA 5AQTA 5AFUH 3D7EO 3WXKA 5FPMA 5BRDA 3EKUA 2ZGZA 3O6WA 4JNEA 4BG9A 2UYTA 4A2AA 2E8AA 3KVGA 4MO4A 3FGUA 3MMVA 3MN5A 1ATNA 4HWIA 2ITMA 2Q0RA 2QWQA 1HPMA 2GWJA 3WUHA 4BRQA 4H5NA 4CZMA 2YHXA 4XEIA 3R9PA 3C7NA 4Y0WA 5AQQA 4CJ7A 5KQDA 2W40A 5LJVA 4B1UB 2I7PA 1RGIA 2GELA 3WEEB 2A40A 3DXKA 4B1WB 2FXUA 3U4LA 3L4IA 4CD1A 3ID8A 3L0QA 2W41A 5BN8A 1MA9B 1MWMA 2OANA 3JS6A 4ISFA 3C0BA 4FWRA 1YXQA 3O08A 2E2OA 3ZX3A 4CZJA 3HBTA 3CJ1A 1K8KA 3VESA 4WQ5C 3LDPA 5AQHA 4C23A 4WQ4C 4DHYA 1C0GA 1QQOA 2Q1NA 3CERA 3WEEA 1LOTB 1JCEA 1TYQB 4IWVA 5KPZA 2YI1A 4CBUA 4NO7A 3VENA 2E2NA 4BR5A 3DXMB 3BUZB 4BRHA 4JHDB 4A2BA 3QICA 4DCHA 4BQZA 1BU6O 2FF6A 3VEZA 4K25A 4M7XA 3M6GA 3BP8A 5FPNA 2CGKA 3QB0A 5AQMA 1HUXA 5AQWA 1V4TA 3UB5A 3U9DA 3H45C 1S22A 3SMSA 3QMLA 1HLUA 3GBTA 1SQKA 3EN9A 4H0YB 4BC5A 1TYQA 5AQUA 1WOQA 5B8HA 4BROA 4Z94A 4H5TA 1T44A 1XUPO 3GG4A 4BGBA 3HI0A 3DXMA 4JHDA 3CI5A 3QFPA 1P8ZA 3ZEUB 4EAHD 3A8YA 1X9JA 3D2EB 2PAVA 5AQNA 2IVOA 5AFUA 5BPMA 1E4FT 3M3ZA 1WUAA 2E88A 1NGEA 5CE3A 2PBDA 1Z05A 2VYPA 3AAQA 1NGFA 1HJOA 1ATRA 3H6EA 3IUCA 1S3XA 4CZLA 4AM6A 4JAXA 1OKJA 4MO5A 3TPQA 3C7NB 2HOEA 4M7YA 4FL9A 1BWFO 3QDKA 4XH4A 1D4XA 2J4RA 2IIRA 2Q36A 3VEXA 4FSVA 2V7ZA 3LDLA 4ISEA 3DJCA 4DQ8A 1LCUA 2D1KA 3F9MA 2AA4A 4WQ5A 3VEWA 3ZEUA 4WQ4A 1HKBA 5AZJB 5ADXH 4CZFA 3D2EA 1HKCA 4FWLA 3LM9A 1K8KB 5AQFA 4YDUC 1YVNA 5LY3A 2BUPA 3VEVA 4H03B 1KAXA 1GLFO 2P9NA 3CJ7A 3BF3A 4BRCA 3L6QA 2E1ZA 2V51B 1G99A 1IG8A 4PL7A 5AQYA 4BRPA 2ZGYA 4BQLA 3AARA 3A0IX 1TUUA 3AY9A 2IVPA 5AQJA 3VEYA 1KAZA 3FZKA 3CJBA 5ELZA 3CIPA 3R6MA 3A5NC 5BREA 4XH5A 2FF3B 5JLFA 2YJFA 5KQ8A 2QM1A 5E84A 4FOIA 4H0VB 1SZ2A 4H5WA 4BR0A 3ATUA 3O8MA 5AZJA 2Q97A 3LDNA 4O5FA 1ESVA 3S41A 2P9SB 3O1BA 1V4SA 4IJNA 5LJWA 1GLJO 3IMXA 2CGJA 2HF3A 2CH5A 5AQSA
chains in the Genus database with same CATH superfamily
1HR0K 4BR4A 3MN6A 4IEIA 1J9AA 4B1ZA 4HUGA 3F2KA 3OYLA 4L8RB 1C1CA 1S6QA 1LAWA 4YOXA 4JYAK 1XHZA 2E1YA 4U7BA 1WSIA 3MN7A 3J8AA 4AHCA 1TL3A 4DKWA 2FSNA 4CBXA 2GUPA 3V81A 3OYNA 1S1UA 4CJTA 3NCIA 4CHNA 1QVFM 4BDYA 1KSPA 3U3YA 4KREA 1QQNA 1CZ9A 2KKZA 1QHAA 1O13A 4DLGA 4CGJA 4DSJA 2YJEA 3UKUA 2O8BA 1YUWA 4CEQA 4CFDA 2NLXA 3QNOA 2HNYA 3HVTA 4FZZA 2D0PA 3ZT1A 1E3MA 1LWEA 3TAMA 2PY5A 3AVIA 4K8XA 1NNEA 2O8DA 3O4QA 4BRFA 1GLDG 4CESA 4CZGA 4Z4GA 1HYZA 4DR7K 4CF1A 1J6ZA 4DQPA 3NE6A 5ADXA 4A62A 1X3MA 1U49A 3KKSA 3JSMA 4EIAA 4N76A 4ILHA 3C6TA 4IG0A 4FWSA 4BWMA 5J2QA 2F4VK 5HP1A 1KXPA 2OPRA 3GOIA 1KQSM 2WBNA 4KB0A 1BISA 3G25A 5AQXA 3O80A 3HTVA 3V9UA 2ATQA 2GV9A 3PLAA 4WE1A 1HJRA 1TAUA 4H0TB 2YNHA 4CGGA 5LMUK 1NWKA 1LWCA 2FBXA 3C95A 3P38A 3J7YP 3ZX0A 3DRPA 4JN4A 3MEGA 4DR6K 3VOVA 1U2VA 1RBTA 1MDUB 1Z26A 3D2FB 1HQEA 2AP1A 4EFHA 3HM9A 3J81O 2KLAA 3LP1A 4LD0A 4DV3K 3OYBA 3L2RA 4PKGA 2HF4A 4JD2A 2KQ2A 3HSCA 3MWTA 1QVGM 1XWLA 3EO3A 3ZT0A 1BOTO 4M3RA 4E1JA 5EXWA 4FPAA 4OPHA 1NGDA 1EXQA 2YKNA 4E7IA 1U6ZA 1H1VA 3VERA 3M8SA 1QSSA 4R79A 1JL2A 3IKMA 5DMRA 2OA8A 1VQ8N 2E2QA 3ZETB 4CEOA 4I6MB 1TK5A 2QWLA 4CI6A 1GLBG 3LDOA 4CIEA 1L3UA 2IAJA 4AHVA 4PA1A 5BPNA 4KAZA 2VGNA 3PSIA 2KW4A 3EZWA 1KFDA 2VQEK 4W5RA 4DU4A 1NGJA 3CCMN 4BRMA 2D0OA 4OKKA 5AQPA 3SUPA 1EWQA 4DS4A 4KTZA 4M3XA 4Y1DA 1GLCG 4ID5A 1YHQN 3QIOA 5M1PA 2VWBA 1NK9A 1S5JA 3CC7N 1J53A 4DFMA 4JV5K 4B3RK 5KPRA 4O8KA 2KZZA 4FWOA 4O0IA 4FCYA 3FFKB 4CF0A 1QHTA 5DK5A 3NHGA 3HT3A 3THVA 5C42A 1NGBA 1S9GA 2F9TA 5AZIA 5C24A 4CZHA 1D8YA 1RBRA 1RCHA 5EU7A 1OH5A 3AVHA 3U8XA 3VF4A 3RRGA 1OVYA 4PL8A 2VCPA 1R59O 3ID6A 3RMBA 4KTWA 3OYMA 4CECA 4DFKA 1VRTA 2VG7A 3QIPA 2WONA 2Q2RA 3WXJA 4YNQA 3NH0A 3ENHA 5AQOA 4YFUA 4Q5VA 4ZHRA 5EVZA 4H0OA 4BRAA 1XMQK 2B4JA 2QWMA 1ZXOA 1VQPN 2HSTA 5GINA 4WFBL 4HCBA 4DG1A 3PIOL 2O8EA 3KD5E 3FLCO 3VGMA 1K8AO 1HNVA 1DEJA 3NMUA 4FM2A 2O8CA 5F0XA 4DTXA 3J7ZO 2P9IB 3SZ2A 4BRGA 1QTMA 1RDWX 4CK2A 4CZEA 4RW6A 4DB3A 3QBXA 4CEFA 4I9LA 3EE9A 3CC4N 1C0TA 1NK0A 3QEXA 4NCBA 1JCGA 4CCHA 2ZWHA 1YT3A 3I0SA 1P90A 4EZ6A 4JNEA 1RT2A 4BG9A 5D3GA 3KVGA 3FGUA 3MMVA 1K6YA 3MN5A 4HWIA 2GWJA 3WUHA 4JLHA 3CPWM 4H5NA 3DRRA 3WNFA 4XEIA 4GV9A 3C7NA 2BDPA 3I55N 4YOTA 5KQDA 3NF6A 2GELA 3WEEB 4CD1A 4B9NA 4W5NA 5M1KA 1KLMA 5C12A 2W41A 1HNXK 2QEXN 3AA4A 4ISFA 3KK1A 4YOUA 5LMNK 4FWRA 1YXQA 3THWB 3E1YA 3ZX3A 2VG5A 4CZJA 3CCSN 1A5WA 3HBTA 3CJ1A 5K14A 4H4OA 4IFVA 3VESA 2KFZA 2D0CA 1YF5L 4DHYA 2KTQA 1FKOA 2QK9A 4YOVA 1JL1A 4DQRA 3V4IA 2OYQA 3V9WA 3M8RA 4KI4A 3CERA 2UXCK 4CGFA 3CYMA 3LZJA 1TYQB 4KB1A 4IWVA 3B6OA 1ZBLA 4AHSA 2HBLA 1YJNN 2A1SA 3F9KA 1SS6A 5CYMA 2UXDK 4CE9A 3DXMB 1NMNA 4BRHA 4JHDB 4A2BA 4DR3K 4ID1A 4BQZA 2QXFA 4IG3A 1VSKA 4M3WA 4RG8A 1RBSA 3G10A 3OJSA 3NFAA 3QB0A 4CGIA 3J80O 1S22A 1IKWA 1VQ6N 3AVCA 3G71N 4BC5A 3K57A 1RBVA 1WOQA 2Y1IA 3L3VA 3PV8A 4BDPA 3E9PA 3QLHA 5GIOA 3JYTA 3HI0A 4CGDA 3C94A 3K5MA 1LW2A 3CI5A 4W5TA 1ZBIA 3B6PA 3QFPA 1VQ4N 4U67L 3ZEUB 3OYJA 1MU2A 3CFOA 5HBMA 1Q82O 4I2PA 5AFUA 3PO5A 3BZKA 1LV5A 1NGEA 2O4IA 5CE3A 4DR2K 1NGFA 4B08A 1ATRA 1S3XA 5HROA 4KHWA 4JAXA 2Z1IA 3DLBA 4OGCA 1YTAA 3LP3A 4M7YA 4FL9A 1D9DA 2ITGA 4M3UA 3VEXA 4ISEA 4AH9A 3WXMB 4GV6A 3D2EA 4KFBA 1HKCA 2G8VA 2HMIA 3LPUA 4B9SA 5J2MA 3OYKA 1K8KB 5M1NA 5LY3A 3CQ8A 4FJKA 1GLFO 1SKRA 3S3MA 2E1ZA 4IDKA 1IG8A 1TL1A 4PL7A 4CJFA 1REVA 2ZGYA 3VEYA 3AARA 1TUUA 3A2FA 2DTUA 1HYVA 1KAZA 4JKGB 3L4QA 1VQON 1SL1A 3MCAB 4XH5A 4ZTFA 4DTUA 4H0VB 3ATUA 1KC8O 3QEPA 4C8LA 1TKZA 5FLXO 3CM5A 4O5FA 3CCJN 1ESVA 3S41A 3I8DA 1TAQA 2HNZA 2P9SB 3QERA 3CCUN 3IMXA 3M8QA 4KHNA 3WQUA 2CH5A 3V9ZA 3THXA 1NGGA 4A57A 1IBMK 1NK4A 4V19S 2ZF5O 1HNWK 3HYFA 5CZ2A 4FJHA 4FJ8A 3G4SN 2W42A 3DI6A 3DOLA 4FJGA 3F73A 2P9UB 4FJ9A 5EX5A 1Z25A 2GTDA 4FJNA 3CJ9A 3VQ8A 4NB4A 4OJRA 1YIJN 1L3SA 3NVKA 5A2QO 5I42A 3K5OA 4FJ7A 4KKOA 3O1WA 4BREA 1DKGD 4CIFA 1CXQA 5JVGL 1DTTA 3KIOA 1RDAA 2D0AA 4O55A 3DM2A 3DLGA 4CZIA 4IFEA 2ASMA 3EE8A 3NGZA 2GX9A 3J7AP 4CHOA 1NLVA 4B3MK 1BDGA 1KVAA 3UKRA 2NRHA 4WF9L 3RSEB 4DTNA 3P31A 3F5TA 3P4IA 1S72N 1Q8IA 4B1XB 3KLIA 4B3SK 3WNGA 1NMDA 4YDUA 5JVHL 3OBYA 4CJSA 3VQ6A 2P9LA 5FPDA 3M1FA 4FWNA 4F9OA 3AA2A 3AO1A 4H0PA 2P9PB 4FJXA 4YHHK 4BACA 3VQ4A 4NXMK 3I8BA 4FK2A 4N56A 4BRNA 2LSNA 4DTRA 1SKWA 1Q7YO 3ISNC 3FZFA 4JKCA 1QQMA 1GLEG 3IFRA 1OH6A 3HM8A 4UQGA 1RBUA 4CJ4A 3BY5A 4C1NK 4WFAL 4DTJA 4IXCA 4A61A 4BR2A 4H4MA 3NF7A 5EY4A 4AHUA 3N4PA 4QS8A 4JS4A 4AF1A 4K8ZA 4CW7B 4FLXA 4CJVA 4CJPA 4YOWA 5BRHA 2UUBK 1WSJA 1U45A 3I33A 4E89A 5GAEP 1HQUA 1KTQA 2NNWA 1Q86O 5IWAK 4FWPA 3LAKA 3THYA 2YCHA 4HTLA 5KRSA 3ZYYX 3A5MC 3EY1A 2X6NA 2P9IA 4H5RA 4BRDA 4FPBA 4N5SA 1YI2N 4YOYA 1NJIO 2A42A 1HYSA 3FR0A 3HZ6A 2QWNA 3DLKA 3L2VA 1I39A 1B92A 1VHXA 4IO8A 4BR7A 4YY3K 4DV2K 4M3TA 5CR4A 5M1OA 2BE2A 4B9QA 1TKTA 2QW9A 2E6LA 1IG9A 4PUOA 1YVUA 3HO1A 4DV6K 4FZXC 5AQIA 1SAZA 3KWGA 3U9ZA 4BC2A 3PO4A 1N32K 2HHWA 1WSFA 5F1XA 3MWPA 5DM7L 1VQMN 3MK6A 3RRHA 3AO5A 3SBTA 1QS4A 4BRKA 4IDHA 1X9WA 5KRTA 2RHKA 3TAPA 2BANA 3O9QA 1KVCA 4DUZK 4OLBA 1TUYA 4B3OA 4DQIA 3GE1A 4B9UA 3NH2A 4E7KA 3CPEA 3WNEA 4FJMA 3MXMA 4KH5A 1KAYA 2P5OA 3UE5A 2PYLA 4GVEA 2BGGA 4XIUA 1J54A 1VSIA 4NLCA 3ZT4A 5C15A 4HTUA 5JS2A 3NGIA 4ISGA 4PKHA 3ULEB 2G8UA 4MDBA 5SZTA 5FPEA 1VSEA 1T3VA 3H3NO 2QWPA 4B8CA 2O8FA 2E2PA 3BEXA 4A5BA 4BVOA 2D4WA 4DSKA 3DAWA 4IOAL 1EO1A 1DT9A 3SLCA 1XI1A 3MEDA 1CXUA 3ZSXA 1ZBHA 4QCLA 4GKKK 3SAFA 3RTVA 4JKHA 2HHXA 1JLBA 4KV8A 4RCHA 1OH7A 3VQEA 1ITGA 3DOKA 4L3QA 5E26A 3VGLA 3MEEA 4FM0A 1VQLN 1N33K 1BGXT 3H46O 4F4KA 2FSKA 1F21A 3VETA 1YITN 4GW6A 5AQLA 3JXUA 4BRLA 3VTIA 5BRFA 4NYFA 3LL3A 1RNHA 2EWSA 4EHUA 3CJAA 3DXKB 3VQ5A 4DTPA 4X64K 4ZTJA 4OVLA 4KRFA 3AVAA 1D9FA 3P1GA 3BDPA 3I56N 4CHQA 3DWLA 5J2NA 1ASUA 1RT5A 3D7EO 5BRDA 3EKUA 2ZGZA 4J2AA 2UYTA 1WN7A 4E7LA 4OPJA 4DFPA 1ATNA 4BE2A 2QWQA 4E19A 1BIUA 3R9PA 1RT6A 1GOAA 3TR8A 5LJVA 4AQYK 3OJUA 1GOBA 3ID8A 3L0QA 3T1YK 1MWMA 3MXIA 5FROA 3O08A 2E2OA 3V6DA 4JKFA 3OA9A 1K8KA 4AHRA 3D6RA 4O0JA 4WQ5C 4LFBK 3KK3A 5GAGP 3JAMO 2G8WA 2YKMA 1C1AA 1RILA 4IFYA 2FBTA 3SQ0A 1JXBA 4CJWA 3HOTA 3SYZA 2GBZA 3VENA 2E2NA 3T1AA 3BUZB 4MDAA 2OZMA 1RT7A 1BU6O 1XHXA 2D5RA 5FRMA 2NUBA 4CHZA 4K25A 3NGYA 4CF2A 2CGKA 2VG6A 3VMFB 3UB5A 3SJJA 3AO2A 3QMLA 2KZMA 4WFNL 3O9UA 5BR8K 2F8SA 1VSMA 5AQUA 5B8HA 4FJLA 4BROA 4Z94A 4BGBA 1XUPO 4N41A 4PHTX 3MXJA 4C8NA 4CEEA 3OYFA 3KJVA 3Q7BA 3OS2A 5I3UA 3AVBA 3P39A 2PAVA 1E4FT 3DLHA 1EP4A 2E88A 3ZSWA 2HBKA 2VQFK 4KTQA 1N34K 3PX6A 3TTFA 3H6EA 2HHUA 1BIZA 3TSPA 1VRUA 1OKJA 1BQMA 1S1WA 1WSHA 3NF8A 4OX9K 4FXDA 2J4RA 2QKBA 2RKIA 2Q36A 2V7ZA 3K0SA 3PUFA 3F9MA 2AA4A 3U6FA 3VEWA 1QE1A 4GV3A 5AZJB 1N36K 3HSTB 4RW4A 1BQNA 4GVMA 3LM9A 4JK7A 3ZSZA 3L2QA 2DFFA 1UA1A 2HHQA 4FM1A 4JK8A 4JI8K 5KI6A 3CJ7A 3C6AA 4B9TA 4CJKA 3V1QA 3L6QA 5IT9O 2G8FA 1TGOA 4UY8O 4MFBA 4BQLA 4DTOA 2Q3SA 1LW0A 4KH6A 3CJBA 3A5NC 3T1HK 1T8EA 2FF3B 4EZ9A 4CJRA 5KQ8A 4QOZB 2YNGA 4NYNA 4FOIA 3KK2A 1GOCA 4JK9A 1NKCA 2Q97A 4IO9L 4JI2K 4Z4FA 3CCRN 3AA3A 5LJWA 3L2WA 2CGJA 1X9SA 4FWKA 1KRPA 1TKDA 3K2PA 3ATVA 4H5VA 2FSJA 2HMPA 1ZBUA 3CETA 4J2EA 3UKUB 2O8BB 1NOZA 4LF5K 1JLCA 1NBWA 2KHOA 3VA0A 5JMVA 3FZHA 1XC9A 2X74A 4LH4A 2A3ZA 2ASPA 3TAFA 1QSLA 2ZM6K 3FZMA 5AQVA 3QEVA 1IBLK 5C2DA 1VQNN 2NRVA 2O8DB 3OYDA 4C8OA 5AQKA 3AV9A 3LANA 2NRWA 3CMEN 2W6KA 4KHQA 2B5JA 3AO4A 4LY7A 4HHTA 4CF9A 1RT3A 2V52B 4O4GA 3MN9A 3C6UA 2PYJA 4GNIA 5KPTA 4DSLA 4FK0A 5SWMA 4I9QA 1W2BM 3A5LC 1IV0A 3ZSYA 4BVPA 4MLEA 3V9XA 3LDQA 3CM6A 2NRZA 1UAXA 1CZAN 5TKWA 4R5PA 1S9EA 4RWTA 3DLLL 1KVBA 4DTMA 1NG9A 4K42A 1NK5A 2YHBA 1T03A 3L3UA 2XY6A 4Y1CA 2IVNA 1MWKA 1U2VB 2NRRA 1EWRA 4FJ5A 1NJWA 1RDBA 2P9NB 2W6LA 3OHRA 3SUNA 4FWQA 3KD1E 3CCEN 4JD2B 3ZSVA 3CHWA 4HUFA 2R7YA 4OKJA 1TVRA 4IBNA 1Z6RA 2HHVA 1TK8A 1U48A 3AO3A 2Q0UA 3IDHA 3CQXA 2YV0X 3E01A 3AGKA 1NGCA 4PY5A 1M90O 3H08A 4CZKA 3DLEA 3B8AX 2GWKA 1NGAA 3AVMA 4FWMA 3PY8A 1OVQA 2P51A 1VQ9N 3A5OC 3T19A 3SMPA 1C6VA 4KHPK 3LZIA 2OPPA 3SCXA 4K43A 4H8KA 4DV5K 3FE1A 3O9RA 1WAJA 3CCVN 1K73O 3CFRA 4FO0A 3O3GA 3WNHA 4O5BA 4DMNA 1X3NA 1JCFA 3D2FA 3D0PA 1NGHA 3K5NA 1ZC6A 3O4WA 3TTDA 2QWRA 1LAVA 3SK3A 3EZ5A 3CQYA 4RTFD 4FVMA 4DV0K 1BA1A 4FJIA 3LM2A 4A5AA 3VTHA 3ZSOA 1HRHA 4BRIA 2OPSA 3RMCA 3TU5A 1SV5A 5AZIB 4CEZA 3VQ7A 3ZX2A 4I7FA 1HMVA 4J2BA 3C65A 3QFUA 3OY9A 3ZETA 3IRXA 4I6MA 4KI6A 5GADP 4ICLA 4DWIA 1NM1A 4DSIA 4LF7K 1BI4B 2A1RA 3QEWA 1RTDA 2JWKA 3DLRA 3VGKA 4IOXA 1SUQA 3ZSRA 3O3FA 3HXMA 1XNQK 5JLHA 5AQZA 1FXXA 3VEOA 4CJ5A 2P9KB 4OKEA 3BGRA 1BCMA 4CHPA 3HJFA 2CGLA 3TSUA 4BG8A 2O8EB 4LFCK 1RFQA 2CH6A 3WQTA 3KZBA 1RTIA 2YHAA 2Y1JA 2O8CB 3WXIA 1LWFA 4LC9B 1HNZK 3MAQA 4K41A 4J8FA 4K0KK 3R3LA 5CHIA 3SJHA 3CJCA 3VF6A 2F8TA 2QWOA 1Y64A 1XQSC 3QBWA 2HBMA 3S9HA 3OYCA 4KHYA 3RVCA 1QZ5A 5BN9A 3H1QA 5HRPA 4NCAA 2G8HA 1QSYA 1L5UA 2P1JA 1RDDA 4FLTA 4LSNA 3OYEA 5CZ1A 4G9ZA 1Q18A 3AVGA 2ASOA 1K9MO 1S1VA 3VPZA 4FW2A 4BE0A 3QESA 4EP4A 4IZ9A 4X62K 2GEMA 4FYDA 4BWJA 3KLGA 3WXLA 4LFAK 5AQTA 2QKKA 3TAEA 3WXKA 5FPMA 3O6WA 4A2AA 2E8AA 2VWKA 4Z4IA 2Q0RA 4NLBA 2HHTA 3OYAA 1HPMA 3CF5L 4ELUA 4CZMA 1WSEA 2YHXA 2YX6A 5AQQA 4CJ7A 3TWHA 4E7HA 4B1UB 2I7PA 2G8IA 4B1WB 2FXUA 4KHSA 1RT4A 4ILJA 3VQCA 3O3HA 2OANA 1NJYA 1EX4A 1HPZA 2EX3A 5DM6L 4CHYA 1ASWA 2AJQA 1VSJA 1IO2A 4WQ4C 2UUAK 3SQ2A 1YJ9N 3LALA 3ZCMA 3O9TA 3K59A 1Y97A 1VQ7N 1IKXA 4IEEA 4M42A 2YNIA 4HUEA 3PX0A 2JGUA 3KTQA 3WEEA 4JI6K 1FK9A 1LOTB 4CJ3A 1XNRK 3HRGA 4CBUA 3HPGA 3OVNA 1DTQA 4G1QA 3S3OA 4NO7A 3Q7CA 1W7AA 3ZT2A 4OPAA 4E1MA 4OPKA 4X66K 2IC3A 1WAFA 2ZQBA 3THWA 1B9FA 4DCHA 2FF6A 3UIQA 4JI3K 3M6GA 5FPNA 4CFBA 4O8UA 5AQMA 4OGEA 4C1NI 5AQWA 3L8BA 1V4TA 2XO7A 3U9DA 2QI2A 3H45C 5E41A 1HLUA 4BE1A 3GBTA 1SQKA 4H0YB 1WB9A 1TYQA 2ZJPL 4LF4K 1JXEA 3QO9A 2RPIA 3DRSA 4CIGA 5CYQA 3DYAA 3AVJA 5M1FA 4MQ3A 1T44A 4M45A 3DXMA 4J2DA 4JHDA 3VA3A 4N47A 3P5JA 2ZJRL 1Q81O 3MECA 1HNIA 3D2EB 2E4LA 3NH1A 5AQNA 2IVOA 3M3ZA 1WUAA 4DSFA 2PBDA 3AAQA 4FZYA 1HJOA 2WFBA 1UWBA 3IUCA 4AM6A 4MO5A 3CCLN 3SUOA 1W97L 1WLJA 2UUCK 5LL6Z 1BWFO 1WNSA 3QDKA 2B6AA 1D4XA 2IIRA 4DQQA 2JWLA 4X65K 3O9SA 1JLQA 3V1RA 3ZLJA 3LDLA 4JKAA 3K9JA 1LCUA 1BL3A 2HB5A 4LH5A 2D1KA 3KK7A 4WQ5A 3ZEUA 1HKBA 2WOMA 3EYZA 5ADXH 4CZFA 3AVLA 1NK8A 4RW7A 3OYHA 4F2SA 5MLCQ 3LP0A 4KHUA 3THXB 1A5XA 2HW3A 2BUPA 3IAYA 2P9NA 3NVMA 4B9VA 5HRSA 4QAGA 4BRCA 3QETA 1G99A 5C25A 1EETA 3A0IX 2IVPA 1VQ5N 1VSLA 4F2RA 5ELZA 3CIPA 3R6MA 5BREA 3SAHA 5JLFA 1T7PA 2QM1A 5E84A 3SQ4A 4H5WA 3CG7A 2UU9K 2PZSA 4DF8A 4FLZA 3ZSQA 1V4SA 4IJNA 4FLWA 1GLJO 4DR4K 3RWUA 4MLHA 3VN5A 1S1TA 3EEQA 3TSQA 1JLAA 3VQDA 4BR9A 5GAHP 1HX1A 3CXCM 1TKXA 3RMAA 2BH1A 1T6CA 4NXNK 4EP5A 2FLOA 4DUYK 4FLUA 1CLQA 3G0ZA 3VF2A 2YHYA 3OBWA 2OZSA 4BC4A 4JKGA 4CJLA 2E20A 3PSFA 3UKRB 3AVKA 4DV1K 4CFCA 3CMAN 3AVFA 4B9MA 4WYBA 1T05A 3SBGA 4CJUA 4DQSA 1X1PA 2P9SA 3T3FA 2HNDA 3SV3A 2DFEA 2P9LB 3NBPA 5C10A 1UA0A 1C1BA 3VQAA 2F96A 2YNFA 2A41A 4A59A 4CF8A 3QEIA 3SI6A 1C0UA 2DFHA 1GLLO 2HBJA 5FDLA 4JI1K 1IBKK 4GKJK 2P9UA 4JI5K 4PWDA 2NRXA 1NJZA 4ILGB 2FBVA 2PFUA 1S1XA 1C0MA 2RE2A 3TAGA 3WT0A 4PQUA 2EHGA 4CBWA 4CEDA 2WC9A 3KKRA 4BC3A 5CY4A 3ZT3A 5BR9A 2QTDA 5AJ3K 3CFPA 1BUPA 2NZTA 5F2RA 4B8AB 2QA4N 1BI4A 1KCFA 3HPOA 2VGMA 5J1EA 1B9DA 5EOYA 4C8KA 3BZCA 1NKBA 1T6DA 1IJJA 3AA5X 3LP2A 1HKGA 1R0AA 4HVJA 4DV4K 5JS1A 2F7TA 2BTFA 3RSEA 1EQYA 3GL1A 2P9KA 1WBBA 2FC0A 4NCGA 3SNNA 4AHTA 4JRQA 4IJAA 3TANA 3LDSA 3THYB 3BF1A 1I94K 3MDQA 5I9EB 1JJ2M 1VSHA 5TKYA 4DU3A 2P9PA 2Q31A 3GDQA 1NJXA 1FW6A 2OPQA 4DR1K 3R8EA 4E0DA 4KO0A 4WCEL 1BHLA 4XH1A 5FRNA 5HRNA 5T7BA 4FLVA 4FOEA 1U04A 1C0FA 2RN2A 5AQRA 3SAGA 3C6HA 4DU1A 4BGAA 1TK0A 4CVNE 2A6AA 2I7NA 1N6QA 3KWIA 5BPLA 1ATSA 1M1KO 1VQKN 3AAPA 3P83D 5JICA 4B1YB 3K58A 4PKIA 4DF4A 2E6MA 5M1QA 3MX5A 1VSFA 1ASVA 3M5RA 1FJGK 1DGKN 1YJWN 3MCPA 2G8KA 2HVIA 4B1VA 3EKSA 3T69A 5KGWA 1NGIA 1YAGA 4OLAA 2XY7A 4JKBA 4FK4A 2YHWA 3HOSA 4AM7A 5AR0A 4Z4EA 2FBYA 3TABA 4CK1A 3NAEA 4M63C 1JLGA 3I0RA 1EKEA 1RTHA 4C8MA 1NU0A 2ZJQL 2HHSA 3SPZA 2F9WA 3DMJA 5AQGA 1L3TA 2ZD1A 1RDUA 1NK7A 2H3GX 3H3OB 2O8FB 2QXLA 3ENOA 3KLEA 3U3GA 2Z1HA 3AGRA 4QS9A 5HL7L 2OTLN 1W0HA 1A5VA 3IG1A 1JKHA 1BO5O 3O5BA 4BY9C 5C2FA 3TAQA 1VAZA 4RW8A 3LPTA 5GIPA 4EHTA 1BA0A 2E5LK 1O1WA 4FVUA 4DLEA 3OYGA 4QS7A 4AILC 4TSXA 2WTUA 3FZLA 3VQQA 3EL2A 3ULDA 4M3YA 4DTSA 2V7YA 4E3SA 4E1NA 2DPNA 4CD3A 4KBOA 4JI4K 5H1SQ 4Z4CA 3N4QA 3S3NA 5HLFA 3O4NA 3SPYA 4CERA 3L2UA 3VQ9A 1RDCA 3NDKA 2RF2A 2X78A 3W0LA 3OS1A 4H0XB 1XC3A 1JLEA 4CJEA 3W3DA 4JI0K 3HVRA 2P5GA 4CJQA 4JKEA 4CK3A 5KTQA 3RR7A 1N5YA 3ULEA 2A5XA 1IKVA 4O44A 4W5QA 4JEPA 1OH8A 3NF9A 3KHYA 1GLAG 1QZ6A 3VQBA 4ELVA 2WUSA 3TARA 1WSGA 3SUQA 1BG3A 3ITHA 3V9SA 4E7JA 2IS3A 5KGXA 3H1VX 4GY2B 1RTJA 1E4GT 1QQCA 4Q0BA 1ZBSA 1ZYQA 2O4GA 5AFUH 3HPHA 3CCQN 1SL2A 1J5OA 1NOYA 4MO4A 1SL0A 4OO1J 2ITMA 3E9LA 1JLFA 4BRQA 1U47A 2IDOA 2I5JA 4Y0WA 3TTCA 4CEAA 5C0YA 3QINA 2W40A 1RGIA 1BCOA 2A40A 3DXKA 3RMDA 2NRTA 3KLFA 3U4LA 3L4IA 3V1OA 4LF9K 3SV4A 1WBDA 4LSLA 2HHHK 5BN8A 1MA9B 5HOOA 3PIPL 3JS6A 4F8RA 3C0BA 3E66A 5HRRA 3ASMA 3AVNA 3CD6N 3LDPA 5AQHA 4CGHA 3OW2M 4C23A 1DLOA 3TI0A 4F3TA 2XRIA 1C0GA 1QQOA 3T7ZA 3HP6A 1W9HA 1SKSA 4Z0UA 1D5AA 2Q1NA 3HK2A 1J5EK 4F3OA 1U4BA 4I2QA 1S6PA 4CFAA 1JCEA 2JLEA 3G6EN 5KPZA 2YI1A 3R1XA 3OTOK 4BR5A 3K5LA 4JS5A 3HL8A 1I3AA 3QICA 1X9MA 2Z1JA 4FW1A 4KPYA 3SQ1A 2D0BA 3VEZA 3LAMA 4M3ZA 4M7XA 3BP8A 3VQPA 3LWLA 2XY5A 1ILYA 2ETJA 1HUXA 3OS0A 1UOCA 3LWMA 2HVHA 4B9LA 3SMSA 1YTUA 3EN9A 1KLNA 1ZBFA 4W5OA 3FFIA 1N8RO 1NK6A 4H5TA 4RW9A 3GG4A 1G15A 1RT1A 4Z4HA 2DY4A 2GUIA 1VSDA 4YORA 1P8ZA 2XHBA 4DFJA 4EAHD 2IOCA 3A8YA 1X9JA 4DR5K 3IS9A 4FLYA 5BPMA 1NKEA 2X6SA 3RR8A 4JRPA 3QNNA 4LF8K 1Z05A 2VYPA 4IOCL 4JI7K 3ALYA 4M41A 4CZLA 4LF6K 3TPQA 2UXBK 1Q9XA 3C7NB 1IKYA 3OYIA 4B3TK 2HOEA 4XH4A 1XMOK 4JKDA 4FSVA 1L3VA 4DQ8A 3DJCA 3PX4A 2XY8A 4BDZA 3MX2A 4WQ4A 4FJJA 1TV6A 4FWLA 3M8PA 4IKFA 5AQFA 3E9OA 4KH4A 1YVNA 4YDUC 4DS5A 5J2PA 3VEVA 4H03B 1KAXA 3KLHA 1KFSA 2KFNA 4CEBA 3BF3A 1IH7A 2V51B 4ELTA 5AQYA 4BRPA 3HP9A 5AQJA 3AY9A 1FKPA 1VK0A 3FZKA 1Q9YA 4HCCA 1KD1O 2YJFA 1CZBA 2IGIA 3ENBA 1SZ2A 4BR0A 4DV7K 3O8MA 3K9KA 2OCEA 4GMJB 5AZJA 2OTJN 3LDNA 3CC2N 2Z1GA 3O1BA 2VWJA 3D45A 4DSEA 2HF3A 2ZE2A 5AQSA
chains in the Genus database with same CATH topology
3TSQA 1NGGA 4A57A 4FWKA 4BR4A 3MN6A 4IEIA 4BR9A 4B1ZA 5GAHP 1HX1A 3CXCM 2ZF5O 2BH1A 1T6CA 3ATVA 4H5VA 3F2KA 2FSJA 2FLOA 2HMPA 3G4SN 3CETA 3UKUB 3VF2A 4YOXA 2YHYA 3OBWA 2P9UB 4BC4A 2E1YA 2KHOA 1NBWA 4JKGA 5EX5A 2GTDA 5JMVA 2E20A 4U7BA 3CJ9A 3FZHA 3J8AA 3MN7A 3UKRB 4NB4A 1YIJN 2A3ZA 2ASPA 4DKWA 2FSNA 3NVKA 4CBXA 3CMAN 3FZMA 5AQVA 2GUPA 4WYBA 3SBGA 5C2DA 1VQNN 2NRVA 1QVFM 3O1WA 4BREA 2P9SA 1DKGD 5AQKA 1QQNA 5JVGL 2P9LB 5C10A 2KKZA 2NRWA 3CMEN 4MLHA 2A41A 1QHAA 4A59A 1O13A 1GLLO 4CZIA 2V52B 2HBJA 2ASMA 2YJEA 4IFEA 3MN9A 3UKUA 3EE8A 2GX9A 4GNIA 5KPTA 1YUWA 2P9UA 1NLVA 2NRXA 2NLXA 1BDGA 1W2BM 3A5LC 4ILGB 3UKRA 2PFUA 2NRHA 4BVPA 4WF9L 2D0PA 4MLEA 3RSEB 3LDQA 3P31A 2NRZA 2RE2A 3F5TA 3P4IA 1S72N 1CZAN 5TKWA 4BRFA 3WT0A 4B1XB 4RWTA 1GLDG 4CZGA 1NMDA 4YDUA 5JVHL 3DLLL 4CBWA 3OBYA 4K42A 2WC9A 1J6ZA 4BC3A 5BR9A 2P9LA 5FPDA 5ADXA 3M1FA 2QTDA 1X3MA 4A62A 4FWNA 1BUPA 4F9OA 2IVNA 1MWKA 2NZTA 5F2RA 4EIAA 4ILHA 1U2VB 4H0PA 2QA4N 2NRRA 2P9PB 4FWSA 1KXPA 2VGMA 5EOYA 2P9NB 3GOIA 3OHRA 1KQSM 1T6DA 1IJJA 2WBNA 4FWQA 1HKGA 3CCEN 3G25A 5AQXA 4JD2B 2F7TA 2BTFA 3RSEA 3CHWA 1EQYA 3O80A 3HTVA 3GL1A 3I8BA 2P9KA 3PLAA 4H0TB 4BRNA 1Z6RA 1NWKA 1Q7YO 3FZFA 4IJAA 2Q0UA 1QQMA 1GLEG 4JKCA 3IFRA 3P38A 3HM8A 3IDHA 3CQXA 3ZX0A 3BF1A 4JN4A 3MDQA 5I9EB 3AGKA 1NGCA 4C1NK 4WFAL 3VOVA 1U2VA 1M90O 1MDUB 1JJ2M 4IXCA 5TKYA 3D2FB 4A61A 2P9PA 2Q31A 2AP1A 3GDQA 4BR2A 4CZKA 4EFHA 3B8AX 2GWKA 1NGAA 5EY4A 3R8EA 4FWMA 2KLAA 3N4PA 4QS8A 4PKGA 4WCEL 2HF4A 1VQ9N 4XH1A 4AF1A 3A5OC 4JD2A 3HSCA 3MWTA 4FOEA 3SMPA 1QVGM 3EO3A 1C0FA 5AQRA 3SAGA 1BOTO 4K43A 4YOWA 5BRHA 3C6HA 3FE1A 4BGAA 3I33A 2A6AA 3O9RA 2I7NA 4E1JA 2NNWA 4FPAA 4OPHA 1NGDA 5EXWA 5GAEP 4FO0A 3CCVN 1Q86O 1K73O 3KWIA 4FWPA 5BPLA 1ATSA 1U6ZA 1M1KO 1VQKN 3AAPA 1H1VA 2YCHA 4HTLA 5JICA 4B1YB 3ZYYX 4PKIA 1X3NA 3A5MC 3VERA 5M1QA 3MX5A 1JCFA 2P9IA 3D2FA 4H5RA 4R79A 4BRDA 3M5RA 3IKMA 4FPBA 1YI2N 4YOYA 1NGHA 2E2QA 1NJIO 1DGKN 3ZETB 4I6MB 3MCPA 1YJWN 1VQ8N 2A42A 2QWLA 1ZC6A 3FR0A 3O4WA 4CI6A 3HZ6A 2QWNA 1GLBG 3LDOA 3TTDA 2QWRA 3SK3A 4B1VA 3CQYA 3EKSA 4RTFD 4IO8A 4BR7A 3T69A 1NGIA 1YAGA 5BPNA 1BA1A 5CR4A 4JKBA 5M1OA 4B9QA 2YHWA 2VGNA 2QW9A 4AM7A 3HOSA 5AR0A 3LM2A 3EZWA 4A5AA 3VTHA 4BRIA 1NGJA 3CCMN 5AQIA 1SAZA 3KWGA 3U9ZA 4BC2A 4BRMA 2D0OA 4M63C 5AQPA 3TU5A 5AZIB 2ZJQL 1GLCG 5F1XA 1YHQN 3MWPA 3ZX2A 5DM7L 2F9WA 5AQGA 1VQMN 1RDUA 3MK6A 3C65A 3QFUA 5M1PA 3WQUA 3SBTA 3ZETA 4I6MA 2H3GX 2VWBA 5GADP 3H3OB 4BRKA 2QXLA 3CC7N 3ENOA 4IDHA 1NM1A 2RHKA 3AGRA 3O9QA 4QS9A 5HL7L 1TUYA 2OTLN 2JWKA 3GE1A 5KPRA 1BO5O 4O8KA 3CPEA 4IOXA 3O5BA 3VGKA 5C2FA 4FWOA 4BY9C 5JLHA 1VAZA 3FFKB 5AQZA 4KH5A 3VEOA 1KAYA 2P9KB 3UE5A 4GVEA 5GIPA 1NGBA 4EHTA 1BA0A 2CGLA 2F9TA 4NLCA 5AZIA 3TSUA 4BG8A 4CZHA 4FVUA 5C15A 1RFQA 2CH6A 3WQTA 4QS7A 3KZBA 3U8XA 3VF4A 4ISGA 3FZLA 4PKHA 3ULEB 1OVYA 4MDBA 4PL8A 5FPEA 3H3NO 1T3VA 2VCPA 1R59O 2QWPA 3ID6A 3WXIA 2E2PA 3EL2A 2V7YA 3BEXA 4LC9B 4A5BA 4BVOA 2D4WA 3DAWA 4IOAL 1EO1A 2DPNA 2Q2RA 4K41A 4J8FA 1DT9A 3R3LA 3WXJA 4CD3A 3SLCA 3ENHA 4KBOA 5AQOA 5CHIA 3SJHA 5H1SQ 3CJCA 3N4QA 5EVZA 4H0OA 4BRAA 3SAFA 2QWMA 3VF6A 4JKHA 2QWOA 1ZXOA 1Y64A 1XQSC 3QBWA 1VQPN 2HBMA 4RCHA 2HSTA 3W0LA 5GINA 4WFBL 4H0XB 3RVCA 1QZ5A 1XC3A 5BN9A 3PIOL 3H1QA 3W3DA 4L3QA 5E26A 3FLCO 3VGLA 4JKEA 1VQLN 3VGMA 1K8AO 3H46O 2FSKA 1DEJA 3VETA 3NMUA 3ULEA 2A5XA 1YITN 4JEPA 5F0XA 5AQLA 3JXUA 4BRLA 3VTIA 5BRFA 2P9IB 3J7ZO 3KHYA 1GLAG 1QZ6A 4BRGA 4G9ZA 2WUSA 3LL3A 1Q18A 1BG3A 1RDWX 2EWSA 2ASOA 4CZEA 1K9MO 4EHUA 4DB3A 3CJAA 3DXKB 3QBXA 3H1VX 3VPZA 4GY2B 3EE9A 3CC4N 1E4GT 4IZ9A 2GEMA 3I56N 3WXLA 1JCGA 3DWLA 2ZWHA 1ZBSA 5AQTA 5AFUH 3D7EO 3WXKA 1P90A 5FPMA 3EKUA 5BRDA 2ZGZA 3O6WA 4JNEA 4BG9A 2UYTA 4A2AA 2E8AA 3KVGA 4MO4A 3FGUA 3MMVA 3MN5A 4OO1J 1ATNA 4HWIA 2ITMA 2Q0RA 3E9LA 2QWQA 4NLBA 1HPMA 2GWJA 3WUHA 4BRQA 3CF5L 3CPWM 4H5NA 4CZMA 2YHXA 4XEIA 3R9PA 4GV9A 3C7NA 4Y0WA 3TTCA 2YX6A 5AQQA 5C0YA 4CJ7A 4YOTA 5KQDA 3I55N 2W40A 5LJVA 4B1UB 2I7PA 1RGIA 2GELA 3WEEB 2A40A 3DXKA 4B1WB 2NRTA 2FXUA 3U4LA 3L4IA 4CD1A 4ILJA 3ID8A 3L0QA 5M1KA 5C12A 2W41A 2QEXN 5BN8A 1MA9B 1MWMA 2OANA 5HOOA 3PIPL 3JS6A 4ISFA 3C0BA 3E66A 4YOUA 4FWRA 5DM6L 1YXQA 3E1YA 3O08A 2E2OA 3ZX3A 4CZJA 3CCSN 3HBTA 4JKFA 3CJ1A 3OA9A 1K8KA 3CD6N 3VESA 3D6RA 4WQ5C 3LDPA 5AQHA 3OW2M 4C23A 1YF5L 4WQ4C 4DHYA 1YJ9N 1C0GA 5GAGP 1QQOA 3T7ZA 3O9TA 4YOVA 1VQ7N 4IEEA 2Q1NA 3CERA 3WEEA 1LOTB 1JCEA 1TYQB 4IWVA 3G6EN 5KPZA 2YI1A 3HRGA 2HBLA 4CBUA 3HOTA 1YJNN 3R1XA 4NO7A 3Q7CA 1SS6A 4OPAA 3VENA 2E2NA 4BR5A 3DXMB 3BUZB 3CCQN 4BRHA 4JHDB 4MDAA 4A2BA 3QICA 4DCHA 4BQZA 1BU6O 2FF6A 3VEZA 4K25A 4M7XA 3M6GA 3BP8A 5FPNA 4O8UA 2CGKA 3QB0A 1ILYA 5AQMA 1HUXA 4C1NI 5AQWA 1V4TA 3VMFB 3UB5A 3U9DA 2QI2A 3H45C 1S22A 3SMSA 3QMLA 1VQ6N 3G71N 1HLUA 3GBTA 1SQKA 3EN9A 4H0YB 4BC5A 3O9UA 4WFNL 1TYQA 2ZJPL 5AQUA 1WOQA 5B8HA 1N8RO 4BROA 3E9PA 5GIOA 4Z94A 4H5TA 1T44A 1XUPO 3GG4A 4BGBA 5M1FA 3HI0A 3DXMA 4PHTX 4JHDA 3CI5A 2ZJRL 1Q81O 3QFPA 1VQ4N 3Q7BA 4YORA 1P8ZA 4U67L 3ZEUB 4EAHD 3A8YA 1X9JA 3P39A 3D2EB 2PAVA 1Q82O 5AQNA 2IVOA 5AFUA 5BPMA 1E4FT 3M3ZA 1WUAA 2E88A 2HBKA 1NGEA 5CE3A 2PBDA 1Z05A 2VYPA 3AAQA 1NGFA 1HJOA 2WFBA 1ATRA 3H6EA 3IUCA 3TTFA 1S3XA 3TSPA 4CZLA 4AM6A 4JAXA 1OKJA 4MO5A 3TPQA 3C7NB 3CCLN 1W97L 2HOEA 4M7YA 4FL9A 1BWFO 3QDKA 4XH4A 1D4XA 2J4RA 2IIRA 2JWLA 4JKDA 2Q36A 3O9SA 4IOCL 3VEXA 4FSVA 2V7ZA 3LDLA 3K9JA 3DJCA 4ISEA 1LCUA 4JKAA 4DQ8A 2D1KA 3F9MA 2AA4A 3KK7A 4WQ5A 3VEWA 3MX2A 3ZEUA 4WQ4A 1HKBA 3WXMB 4GV3A 5AZJB 4GV6A 5ADXH 4CZFA 3D2EA 1HKCA 4FWLA 3LM9A 4JK7A 5MLCQ 1K8KB 5M1NA 5AQFA 3E9OA 4KH4A 1YVNA 4JK8A 4YDUC 5LY3A 2BUPA 3VEVA 4H03B 1KAXA 1GLFO 2P9NA 3CJ7A 3NVMA 3C6AA 3BF3A 4BRCA 3L6QA 2E1ZA 2V51B 1G99A 1IG8A 4PL7A 5AQYA 4BRPA 4UY8O 2ZGYA 4BQLA 3AARA 3A0IX 1TUUA 3AY9A 2IVPA 5AQJA 3VEYA 1KAZA 3FZKA 4KH6A 1VQ5N 4JKGB 3CJBA 3L4QA 5ELZA 3CIPA 1VQON 3R6MA 3A5NC 5BREA 3MCAB 1KD1O 4XH5A 3SAHA 2FF3B 5JLFA 2YJFA 5KQ8A 2QM1A 5E84A 4FOIA 3ENBA 1SZ2A 4H0VB 4H5WA 3ATUA 4BR0A 3O8MA 3K9KA 1KC8O 2OTJN 4JK9A 5AZJA 2Q97A 3LDNA 4O5FA 1ESVA 3S41A 3CCJN 4IO9L 3CC2N 2P9SB 3CCRN 3O1BA 1V4SA 4IJNA 3CCUN 5LJWA 1GLJO 3IMXA 2CGJA 2HF3A 2CH5A 5AQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGG A;  4FWK A;  4BR4 A;  3MN6 A;  4BR9 A;  4B1Z A;  1HX1 A;  2ZF5 O;  1T6C A;  3ATV A;  4H5V A;  2FSJ A;  2FLO A;  2HMP A;  3CET A;  3UKU B;  3VF2 A;  2YHY A;  2P9U B;  4BC4 A;  2E1Y A;  2KHO A;  1NBW A;  5EX5 A;  2GTD A;  5JMV A;  2E20 A;  3CJ9 A;  3FZH A;  3J8A A;  3MN7 A;  3UKR B;  4NB4 A;  2A3Z A;  2ASP A;  2FSN A;  4CBX A;  3FZM A;  5AQV A;  2GUP A;  4WYB A;  3O1W A;  4BRE A;  2P9S A;  1DKG D;  5AQK A;  1QQN A;  2P9L B;  4MLH A;  2A41 A;  1QHA A;  1GLL O;  4CZI A;  2V52 B;  2ASM A;  2YJE A;  3UKU A;  3MN9 A;  4GNI A;  5KPT A;  1YUW A;  2P9U A;  1NLV A;  2NLX A;  1BDG A;  3A5L C;  3UKR A;  2NRH A;  4BVP A;  2D0P A;  4MLE A;  3RSE B;  3LDQ A;  3P4I A;  1CZA N;  4BRF A;  3WT0 A;  4B1X B;  4RWT A;  1GLD G;  4CZG A;  1NMD A;  4YDU A;  4CBW A;  4K42 A;  1J6Z A;  4BC3 A;  5BR9 A;  2P9L A;  5FPD A;  5ADX A;  3M1F A;  4A62 A;  1X3M A;  4FWN A;  1BUP A;  4F9O A;  2IVN A;  1MWK A;  2NZT A;  5F2R A;  4EIA A;  1U2V B;  4H0P A;  2P9P B;  4FWS A;  1KXP A;  5EOY A;  2P9N B;  3GOI A;  3OHR A;  1T6D A;  1IJJ A;  4FWQ A;  1HKG A;  3G25 A;  5AQX A;  4JD2 B;  2BTF A;  3RSE A;  3CHW A;  1EQY A;  3O80 A;  3HTV A;  3GL1 A;  3I8B A;  2P9K A;  4H0T B;  4BRN A;  1Z6R A;  1NWK A;  3FZF A;  4IJA A;  2Q0U A;  1QQM A;  1GLE G;  3IFR A;  3HM8 A;  3IDH A;  3CQX A;  3ZX0 A;  3BF1 A;  4JN4 A;  3MDQ A;  5I9E B;  1NGC A;  3VOV A;  1U2V A;  1MDU B;  4IXC A;  5TKY A;  3D2F B;  4A61 A;  2P9P A;  2Q31 A;  2AP1 A;  3GDQ A;  4BR2 A;  4CZK A;  4EFH A;  3B8A X;  2GWK A;  1NGA A;  5EY4 A;  3R8E A;  4FWM A;  4QS8 A;  4PKG A;  2HF4 A;  4XH1 A;  3A5O C;  4JD2 A;  3HSC A;  4FOE A;  3SMP A;  3EO3 A;  1C0F A;  5AQR A;  1BOT O;  4K43 A;  5BRH A;  3FE1 A;  4BGA A;  3I33 A;  2A6A A;  2I7N A;  4E1J A;  5EXW A;  4FPA A;  1NGD A;  4FO0 A;  5BPL A;  4FWP A;  1ATS A;  1U6Z A;  3AAP A;  1H1V A;  2YCH A;  4HTL A;  5JIC A;  4B1Y B;  4PKI A;  1X3N A;  3A5M C;  3VER A;  1JCF A;  2P9I A;  3D2F A;  4H5R A;  4BRD A;  4FPB A;  1NGH A;  2E2Q A;  1DGK N;  3ZET B;  4I6M B;  3MCP A;  2A42 A;  2QWL A;  1ZC6 A;  3FR0 A;  3O4W A;  4CI6 A;  3HZ6 A;  2QWN A;  1GLB G;  3LDO A;  2QWR A;  3SK3 A;  4B1V A;  3CQY A;  3EKS A;  4RTF D;  4IO8 A;  4BR7 A;  1NGI A;  1YAG A;  5BPN A;  1BA1 A;  4B9Q A;  2YHW A;  2QW9 A;  4AM7 A;  5AR0 A;  3LM2 A;  3EZW A;  4BRI A;  1NGJ A;  5AQI A;  1SAZ A;  4BC2 A;  3U9Z A;  4BRM A;  2D0O A;  4M63 C;  5AQP A;  3TU5 A;  5AZI B;  1GLC G;  5F1X A;  3ZX2 A;  2F9W A;  5AQG A;  3MK6 A;  3WQU A;  3QFU A;  3ZET A;  4I6M A;  2H3G X;  2VWB A;  3H3O B;  4BRK A;  2QXL A;  3ENO A;  1NM1 A;  4QS9 A;  1TUY A;  3GE1 A;  5KPR A;  1BO5 O;  4O8K A;  3VGK A;  3O5B A;  4FWO A;  5JLH A;  3FFK B;  5AQZ A;  3VEO A;  1KAY A;  2P9K B;  3UE5 A;  1NGB A;  4EHT A;  1BA0 A;  2CGL A;  2F9T A;  5AZI A;  4BG8 A;  4CZH A;  1RFQ A;  2CH6 A;  3WQT A;  4QS7 A;  3KZB A;  3U8X A;  3VF4 A;  4ISG A;  3FZL A;  4PKH A;  3ULE B;  4PL8 A;  5FPE A;  3H3N O;  2VCP A;  1R59 O;  2QWP A;  3WXI A;  2E2P A;  3EL2 A;  2V7Y A;  3BEX A;  4LC9 B;  4BVO A;  2D4W A;  3DAW A;  2DPN A;  2Q2R A;  4K41 A;  4J8F A;  3WXJ A;  4CD3 A;  3SLC A;  3ENH A;  4KBO A;  5AQO A;  3SJH A;  3CJC A;  5EVZ A;  4H0O A;  4BRA A;  2QWM A;  3VF6 A;  2QWO A;  1ZXO A;  1Y64 A;  1XQS C;  3QBW A;  4RCH A;  3W0L A;  4H0X B;  1QZ5 A;  1XC3 A;  5BN9 A;  3H1Q A;  3W3D A;  4L3Q A;  5E26 A;  3FLC O;  3VGL A;  3VGM A;  3H46 O;  2FSK A;  1DEJ A;  3VET A;  3ULE A;  2A5X A;  5F0X A;  5AQL A;  3JXU A;  4BRL A;  5BRF A;  2P9I B;  3KHY A;  1GLA G;  1QZ6 A;  4BRG A;  2WUS A;  3LL3 A;  1Q18 A;  1BG3 A;  1RDW X;  2EWS A;  2ASO A;  4CZE A;  4EHU A;  4DB3 A;  3CJA A;  3DXK B;  3QBX A;  3H1V X;  3VPZ A;  4GY2 B;  1E4G T;  4IZ9 A;  2GEM A;  3WXL A;  1JCG A;  3DWL A;  2ZWH A;  1ZBS A;  5AQT A;  5AFU H;  3D7E O;  3WXK A;  5FPM A;  5BRD A;  3EKU A;  2ZGZ A;  3O6W A;  4JNE A;  4BG9 A;  2UYT A;  4A2A A;  2E8A A;  3KVG A;  4MO4 A;  3FGU A;  3MMV A;  3MN5 A;  1ATN A;  4HWI A;  2ITM A;  2Q0R A;  2QWQ A;  1HPM A;  2GWJ A;  3WUH A;  4BRQ A;  4H5N A;  4CZM A;  2YHX A;  4XEI A;  3R9P A;  3C7N A;  4Y0W A;  5AQQ A;  4CJ7 A;  5KQD A;  2W40 A;  5LJV A;  4B1U B;  2I7P A;  1RGI A;  2GEL A;  3WEE B;  2A40 A;  3DXK A;  4B1W B;  2FXU A;  3U4L A;  3L4I A;  4CD1 A;  3ID8 A;  3L0Q A;  2W41 A;  5BN8 A;  1MA9 B;  1MWM A;  2OAN A;  3JS6 A;  4ISF A;  3C0B A;  4FWR A;  1YXQ A;  3O08 A;  2E2O A;  3ZX3 A;  4CZJ A;  3HBT A;  3CJ1 A;  1K8K A;  3VES A;  4WQ5 C;  3LDP A;  5AQH A;  4C23 A;  4WQ4 C;  4DHY A;  1C0G A;  1QQO A;  2Q1N A;  3CER A;  3WEE A;  1LOT B;  1JCE A;  1TYQ B;  4IWV A;  5KPZ A;  2YI1 A;  4CBU A;  4NO7 A;  3VEN A;  2E2N A;  4BR5 A;  3DXM B;  3BUZ B;  4BRH A;  4JHD B;  4A2B A;  3QIC A;  4DCH A;  4BQZ A;  1BU6 O;  2FF6 A;  3VEZ A;  4K25 A;  4M7X A;  3M6G A;  3BP8 A;  5FPN A;  2CGK A;  3QB0 A;  5AQM A;  1HUX A;  5AQW A;  1V4T A;  3UB5 A;  3U9D A;  3H45 C;  1S22 A;  3SMS A;  3QML A;  1HLU A;  3GBT A;  1SQK A;  3EN9 A;  4H0Y B;  4BC5 A;  1TYQ A;  5AQU A;  1WOQ A;  5B8H A;  4BRO A;  4Z94 A;  4H5T A;  1T44 A;  1XUP O;  3GG4 A;  4BGB A;  3HI0 A;  3DXM A;  4JHD A;  3CI5 A;  3QFP A;  1P8Z A;  3ZEU B;  4EAH D;  3A8Y A;  1X9J A;  3D2E B;  2PAV A;  5AQN A;  2IVO A;  5AFU A;  5BPM A;  1E4F T;  3M3Z A;  1WUA A;  2E88 A;  1NGE A;  5CE3 A;  2PBD A;  1Z05 A;  2VYP A;  3AAQ A;  1NGF A;  1HJO A;  1ATR A;  3H6E A;  3IUC A;  1S3X A;  4CZL A;  4AM6 A;  4JAX A;  1OKJ A;  4MO5 A;  3TPQ A;  3C7N B;  2HOE A;  4M7Y A;  4FL9 A;  1BWF O;  3QDK A;  4XH4 A;  1D4X A;  2J4R A;  2IIR A;  2Q36 A;  3VEX A;  4FSV A;  2V7Z A;  3LDL A;  4ISE A;  3DJC A;  4DQ8 A;  1LCU A;  2D1K A;  3F9M A;  2AA4 A;  4WQ5 A;  3VEW A;  3ZEU A;  4WQ4 A;  1HKB A;  5AZJ B;  5ADX H;  4CZF A;  3D2E A;  1HKC A;  4FWL A;  3LM9 A;  1K8K B;  5AQF A;  4YDU C;  1YVN A;  5LY3 A;  2BUP A;  3VEV A;  4H03 B;  1KAX A;  1GLF O;  2P9N A;  3CJ7 A;  3BF3 A;  4BRC A;  3L6Q A;  2E1Z A;  2V51 B;  1G99 A;  1IG8 A;  4PL7 A;  5AQY A;  4BRP A;  2ZGY A;  4BQL A;  3AAR A;  3A0I X;  1TUU A;  3AY9 A;  2IVP A;  5AQJ A;  3VEY A;  1KAZ A;  3FZK A;  3CJB A;  5ELZ A;  3CIP A;  3R6M A;  3A5N C;  5BRE A;  4XH5 A;  2FF3 B;  5JLF A;  2YJF A;  5KQ8 A;  2QM1 A;  5E84 A;  4FOI A;  4H0V B;  1SZ2 A;  4H5W A;  4BR0 A;  3ATU A;  3O8M A;  5AZJ A;  2Q97 A;  3LDN A;  4O5F A;  1ESV A;  3S41 A;  2P9S B;  3O1B A;  1V4S A;  4IJN A;  5LJW A;  1GLJ O;  3IMX A;  2CGJ A;  2HF3 A;  2CH5 A;  5AQS A; 
#chains in the Genus database with same CATH topology
 1HR0 K;  4BR4 A;  3MN6 A;  4IEI A;  1J9A A;  4B1Z A;  4HUG A;  3F2K A;  3OYL A;  4L8R B;  1C1C A;  1S6Q A;  1LAW A;  4YOX A;  4JYA K;  1XHZ A;  2E1Y A;  4U7B A;  1WSI A;  3MN7 A;  3J8A A;  4AHC A;  1TL3 A;  4DKW A;  2FSN A;  4CBX A;  2GUP A;  3V81 A;  3OYN A;  1S1U A;  4CJT A;  3NCI A;  4CHN A;  1QVF M;  4BDY A;  1KSP A;  3U3Y A;  4KRE A;  1QQN A;  1CZ9 A;  2KKZ A;  1QHA A;  1O13 A;  4DLG A;  4CGJ A;  4DSJ A;  2YJE A;  3UKU A;  2O8B A;  1YUW A;  4CEQ A;  4CFD A;  2NLX A;  3QNO A;  2HNY A;  3HVT A;  4FZZ A;  2D0P A;  3ZT1 A;  1E3M A;  1LWE A;  3TAM A;  2PY5 A;  3AVI A;  4K8X A;  1NNE A;  2O8D A;  3O4Q A;  4BRF A;  1GLD G;  4CES A;  4CZG A;  4Z4G A;  1HYZ A;  4DR7 K;  4CF1 A;  1J6Z A;  4DQP A;  3NE6 A;  5ADX A;  4A62 A;  1X3M A;  1U49 A;  3KKS A;  3JSM A;  4EIA A;  4N76 A;  4ILH A;  3C6T A;  4IG0 A;  4FWS A;  4BWM A;  5J2Q A;  2F4V K;  5HP1 A;  1KXP A;  2OPR A;  3GOI A;  1KQS M;  2WBN A;  4KB0 A;  1BIS A;  3G25 A;  5AQX A;  3O80 A;  3HTV A;  3V9U A;  2ATQ A;  2GV9 A;  3PLA A;  4WE1 A;  1HJR A;  1TAU A;  4H0T B;  2YNH A;  4CGG A;  5LMU K;  1NWK A;  1LWC A;  2FBX A;  3C95 A;  3P38 A;  3J7Y P;  3ZX0 A;  3DRP A;  4JN4 A;  3MEG A;  4DR6 K;  3VOV A;  1U2V A;  1RBT A;  1MDU B;  1Z26 A;  3D2F B;  1HQE A;  2AP1 A;  4EFH A;  3HM9 A;  3J81 O;  2KLA A;  3LP1 A;  4LD0 A;  4DV3 K;  3OYB A;  3L2R A;  4PKG A;  2HF4 A;  4JD2 A;  2KQ2 A;  3HSC A;  3MWT A;  1QVG M;  1XWL A;  3EO3 A;  3ZT0 A;  1BOT O;  4M3R A;  4E1J A;  5EXW A;  4FPA A;  4OPH A;  1NGD A;  1EXQ A;  2YKN A;  4E7I A;  1U6Z A;  1H1V A;  3VER A;  3M8S A;  1QSS A;  4R79 A;  1JL2 A;  3IKM A;  5DMR A;  2OA8 A;  1VQ8 N;  2E2Q A;  3ZET B;  4CEO A;  4I6M B;  1TK5 A;  2QWL A;  4CI6 A;  1GLB G;  3LDO A;  4CIE A;  1L3U A;  2IAJ A;  4AHV A;  4PA1 A;  5BPN A;  4KAZ A;  2VGN A;  3PSI A;  2KW4 A;  3EZW A;  1KFD A;  2VQE K;  4W5R A;  4DU4 A;  1NGJ A;  3CCM N;  4BRM A;  2D0O A;  4OKK A;  5AQP A;  3SUP A;  1EWQ A;  4DS4 A;  4KTZ A;  4M3X A;  4Y1D A;  1GLC G;  4ID5 A;  1YHQ N;  3QIO A;  5M1P A;  2VWB A;  1NK9 A;  1S5J A;  3CC7 N;  1J53 A;  4DFM A;  4JV5 K;  4B3R K;  5KPR A;  4O8K A;  2KZZ A;  4FWO A;  4O0I A;  4FCY A;  3FFK B;  4CF0 A;  1QHT A;  5DK5 A;  3NHG A;  3HT3 A;  3THV A;  5C42 A;  1NGB A;  1S9G A;  2F9T A;  5AZI A;  5C24 A;  4CZH A;  1D8Y A;  1RBR A;  1RCH A;  5EU7 A;  1OH5 A;  3AVH A;  3U8X A;  3VF4 A;  3RRG A;  1OVY A;  4PL8 A;  2VCP A;  1R59 O;  3ID6 A;  3RMB A;  4KTW A;  3OYM A;  4CEC A;  4DFK A;  1VRT A;  2VG7 A;  3QIP A;  2WON A;  2Q2R A;  3WXJ A;  4YNQ A;  3NH0 A;  3ENH A;  5AQO A;  4YFU A;  4Q5V A;  4ZHR A;  5EVZ A;  4H0O A;  4BRA A;  1XMQ K;  2B4J A;  2QWM A;  1ZXO A;  1VQP N;  2HST A;  5GIN A;  4WFB L;  4HCB A;  4DG1 A;  3PIO L;  2O8E A;  3KD5 E;  3FLC O;  3VGM A;  1K8A O;  1HNV A;  1DEJ A;  3NMU A;  4FM2 A;  2O8C A;  5F0X A;  4DTX A;  3J7Z O;  2P9I B;  3SZ2 A;  4BRG A;  1QTM A;  1RDW X;  4CK2 A;  4CZE A;  4RW6 A;  4DB3 A;  3QBX A;  4CEF A;  4I9L A;  3EE9 A;  3CC4 N;  1C0T A;  1NK0 A;  3QEX A;  4NCB A;  1JCG A;  4CCH A;  2ZWH A;  1YT3 A;  3I0S A;  1P90 A;  4EZ6 A;  4JNE A;  1RT2 A;  4BG9 A;  5D3G A;  3KVG A;  3FGU A;  3MMV A;  1K6Y A;  3MN5 A;  4HWI A;  2GWJ A;  3WUH A;  4JLH A;  3CPW M;  4H5N A;  3DRR A;  3WNF A;  4XEI A;  4GV9 A;  3C7N A;  2BDP A;  3I55 N;  4YOT A;  5KQD A;  3NF6 A;  2GEL A;  3WEE B;  4CD1 A;  4B9N A;  4W5N A;  5M1K A;  1KLM A;  5C12 A;  2W41 A;  1HNX K;  2QEX N;  3AA4 A;  4ISF A;  3KK1 A;  4YOU A;  5LMN K;  4FWR A;  1YXQ A;  3THW B;  3E1Y A;  3ZX3 A;  2VG5 A;  4CZJ A;  3CCS N;  1A5W A;  3HBT A;  3CJ1 A;  5K14 A;  4H4O A;  4IFV A;  3VES A;  2KFZ A;  2D0C A;  1YF5 L;  4DHY A;  2KTQ A;  1FKO A;  2QK9 A;  4YOV A;  1JL1 A;  4DQR A;  3V4I A;  2OYQ A;  3V9W A;  3M8R A;  4KI4 A;  3CER A;  2UXC K;  4CGF A;  3CYM A;  3LZJ A;  1TYQ B;  4KB1 A;  4IWV A;  3B6O A;  1ZBL A;  4AHS A;  2HBL A;  1YJN N;  2A1S A;  3F9K A;  1SS6 A;  5CYM A;  2UXD K;  4CE9 A;  3DXM B;  1NMN A;  4BRH A;  4JHD B;  4A2B A;  4DR3 K;  4ID1 A;  4BQZ A;  2QXF A;  4IG3 A;  1VSK A;  4M3W A;  4RG8 A;  1RBS A;  3G10 A;  3OJS A;  3NFA A;  3QB0 A;  4CGI A;  3J80 O;  1S22 A;  1IKW A;  1VQ6 N;  3AVC A;  3G71 N;  4BC5 A;  3K57 A;  1RBV A;  1WOQ A;  2Y1I A;  3L3V A;  3PV8 A;  4BDP A;  3E9P A;  3QLH A;  5GIO A;  3JYT A;  3HI0 A;  4CGD A;  3C94 A;  3K5M A;  1LW2 A;  3CI5 A;  4W5T A;  1ZBI A;  3B6P A;  3QFP A;  1VQ4 N;  4U67 L;  3ZEU B;  3OYJ A;  1MU2 A;  3CFO A;  5HBM A;  1Q82 O;  4I2P A;  5AFU A;  3PO5 A;  3BZK A;  1LV5 A;  1NGE A;  2O4I A;  5CE3 A;  4DR2 K;  1NGF A;  4B08 A;  1ATR A;  1S3X A;  5HRO A;  4KHW A;  4JAX A;  2Z1I A;  3DLB A;  4OGC A;  1YTA A;  3LP3 A;  4M7Y A;  4FL9 A;  1D9D A;  2ITG A;  4M3U A;  3VEX A;  4ISE A;  4AH9 A;  3WXM B;  4GV6 A;  3D2E A;  4KFB A;  1HKC A;  2G8V A;  2HMI A;  3LPU A;  4B9S A;  5J2M A;  3OYK A;  1K8K B;  5M1N A;  5LY3 A;  3CQ8 A;  4FJK A;  1GLF O;  1SKR A;  3S3M A;  2E1Z A;  4IDK A;  1IG8 A;  1TL1 A;  4PL7 A;  4CJF A;  1REV A;  2ZGY A;  3VEY A;  3AAR A;  1TUU A;  3A2F A;  2DTU A;  1HYV A;  1KAZ A;  4JKG B;  3L4Q A;  1VQO N;  1SL1 A;  3MCA B;  4XH5 A;  4ZTF A;  4DTU A;  4H0V B;  3ATU A;  1KC8 O;  3QEP A;  4C8L A;  1TKZ A;  5FLX O;  3CM5 A;  4O5F A;  3CCJ N;  1ESV A;  3S41 A;  3I8D A;  1TAQ A;  2HNZ A;  2P9S B;  3QER A;  3CCU N;  3IMX A;  3M8Q A;  4KHN A;  3WQU A;  2CH5 A;  3V9Z A;  3THX A;  1NGG A;  4A57 A;  1IBM K;  1NK4 A;  4V19 S;  2ZF5 O;  1HNW K;  3HYF A;  5CZ2 A;  4FJH A;  4FJ8 A;  3G4S N;  2W42 A;  3DI6 A;  3DOL A;  4FJG A;  3F73 A;  2P9U B;  4FJ9 A;  5EX5 A;  1Z25 A;  2GTD A;  4FJN A;  3CJ9 A;  3VQ8 A;  4NB4 A;  4OJR A;  1YIJ N;  1L3S A;  3NVK A;  5A2Q O;  5I42 A;  3K5O A;  4FJ7 A;  4KKO A;  3O1W A;  4BRE A;  1DKG D;  4CIF A;  1CXQ A;  5JVG L;  1DTT A;  3KIO A;  1RDA A;  2D0A A;  4O55 A;  3DM2 A;  3DLG A;  4CZI A;  4IFE A;  2ASM A;  3EE8 A;  3NGZ A;  2GX9 A;  3J7A P;  4CHO A;  1NLV A;  4B3M K;  1BDG A;  1KVA A;  3UKR A;  2NRH A;  4WF9 L;  3RSE B;  4DTN A;  3P31 A;  3F5T A;  3P4I A;  1S72 N;  1Q8I A;  4B1X B;  3KLI A;  4B3S K;  3WNG A;  1NMD A;  4YDU A;  5JVH L;  3OBY A;  4CJS A;  3VQ6 A;  2P9L A;  5FPD A;  3M1F A;  4FWN A;  4F9O A;  3AA2 A;  3AO1 A;  4H0P A;  2P9P B;  4FJX A;  4YHH K;  4BAC A;  3VQ4 A;  4NXM K;  3I8B A;  4FK2 A;  4N56 A;  4BRN A;  2LSN A;  4DTR A;  1SKW A;  1Q7Y O;  3ISN C;  3FZF A;  4JKC A;  1QQM A;  1GLE G;  3IFR A;  1OH6 A;  3HM8 A;  4UQG A;  1RBU A;  4CJ4 A;  3BY5 A;  4C1N K;  4WFA L;  4DTJ A;  4IXC A;  4A61 A;  4BR2 A;  4H4M A;  3NF7 A;  5EY4 A;  4AHU A;  3N4P A;  4QS8 A;  4JS4 A;  4AF1 A;  4K8Z A;  4CW7 B;  4FLX A;  4CJV A;  4CJP A;  4YOW A;  5BRH A;  2UUB K;  1WSJ A;  1U45 A;  3I33 A;  4E89 A;  5GAE P;  1HQU A;  1KTQ A;  2NNW A;  1Q86 O;  5IWA K;  4FWP A;  3LAK A;  3THY A;  2YCH A;  4HTL A;  5KRS A;  3ZYY X;  3A5M C;  3EY1 A;  2X6N A;  2P9I A;  4H5R A;  4BRD A;  4FPB A;  4N5S A;  1YI2 N;  4YOY A;  1NJI O;  2A42 A;  1HYS A;  3FR0 A;  3HZ6 A;  2QWN A;  3DLK A;  3L2V A;  1I39 A;  1B92 A;  1VHX A;  4IO8 A;  4BR7 A;  4YY3 K;  4DV2 K;  4M3T A;  5CR4 A;  5M1O A;  2BE2 A;  4B9Q A;  1TKT A;  2QW9 A;  2E6L A;  1IG9 A;  4PUO A;  1YVU A;  3HO1 A;  4DV6 K;  4FZX C;  5AQI A;  1SAZ A;  3KWG A;  3U9Z A;  4BC2 A;  3PO4 A;  1N32 K;  2HHW A;  1WSF A;  5F1X A;  3MWP A;  5DM7 L;  1VQM N;  3MK6 A;  3RRH A;  3AO5 A;  3SBT A;  1QS4 A;  4BRK A;  4IDH A;  1X9W A;  5KRT A;  2RHK A;  3TAP A;  2BAN A;  3O9Q A;  1KVC A;  4DUZ K;  4OLB A;  1TUY A;  4B3O A;  4DQI A;  3GE1 A;  4B9U A;  3NH2 A;  4E7K A;  3CPE A;  3WNE A;  4FJM A;  3MXM A;  4KH5 A;  1KAY A;  2P5O A;  3UE5 A;  2PYL A;  4GVE A;  2BGG A;  4XIU A;  1J54 A;  1VSI A;  4NLC A;  3ZT4 A;  5C15 A;  4HTU A;  5JS2 A;  3NGI A;  4ISG A;  4PKH A;  3ULE B;  2G8U A;  4MDB A;  5SZT A;  5FPE A;  1VSE A;  1T3V A;  3H3N O;  2QWP A;  4B8C A;  2O8F A;  2E2P A;  3BEX A;  4A5B A;  4BVO A;  2D4W A;  4DSK A;  3DAW A;  4IOA L;  1EO1 A;  1DT9 A;  3SLC A;  1XI1 A;  3MED A;  1CXU A;  3ZSX A;  1ZBH A;  4QCL A;  4GKK K;  3SAF A;  3RTV A;  4JKH A;  2HHX A;  1JLB A;  4KV8 A;  4RCH A;  1OH7 A;  3VQE A;  1ITG A;  3DOK A;  4L3Q A;  5E26 A;  3VGL A;  3MEE A;  4FM0 A;  1VQL N;  1N33 K;  1BGX T;  3H46 O;  4F4K A;  2FSK A;  1F21 A;  3VET A;  1YIT N;  4GW6 A;  5AQL A;  3JXU A;  4BRL A;  3VTI A;  5BRF A;  4NYF A;  3LL3 A;  1RNH A;  2EWS A;  4EHU A;  3CJA A;  3DXK B;  3VQ5 A;  4DTP A;  4X64 K;  4ZTJ A;  4OVL A;  4KRF A;  3AVA A;  1D9F A;  3P1G A;  3BDP A;  3I56 N;  4CHQ A;  3DWL A;  5J2N A;  1ASU A;  1RT5 A;  3D7E O;  5BRD A;  3EKU A;  2ZGZ A;  4J2A A;  2UYT A;  1WN7 A;  4E7L A;  4OPJ A;  4DFP A;  1ATN A;  4BE2 A;  2QWQ A;  4E19 A;  1BIU A;  3R9P A;  1RT6 A;  1GOA A;  3TR8 A;  5LJV A;  4AQY K;  3OJU A;  1GOB A;  3ID8 A;  3L0Q A;  3T1Y K;  1MWM A;  3MXI A;  5FRO A;  3O08 A;  2E2O A;  3V6D A;  4JKF A;  3OA9 A;  1K8K A;  4AHR A;  3D6R A;  4O0J A;  4WQ5 C;  4LFB K;  3KK3 A;  5GAG P;  3JAM O;  2G8W A;  2YKM A;  1C1A A;  1RIL A;  4IFY A;  2FBT A;  3SQ0 A;  1JXB A;  4CJW A;  3HOT A;  3SYZ A;  2GBZ A;  3VEN A;  2E2N A;  3T1A A;  3BUZ B;  4MDA A;  2OZM A;  1RT7 A;  1BU6 O;  1XHX A;  2D5R A;  5FRM A;  2NUB A;  4CHZ A;  4K25 A;  3NGY A;  4CF2 A;  2CGK A;  2VG6 A;  3VMF B;  3UB5 A;  3SJJ A;  3AO2 A;  3QML A;  2KZM A;  4WFN L;  3O9U A;  5BR8 K;  2F8S A;  1VSM A;  5AQU A;  5B8H A;  4FJL A;  4BRO A;  4Z94 A;  4BGB A;  1XUP O;  4N41 A;  4PHT X;  3MXJ A;  4C8N A;  4CEE A;  3OYF A;  3KJV A;  3Q7B A;  3OS2 A;  5I3U A;  3AVB A;  3P39 A;  2PAV A;  1E4F T;  3DLH A;  1EP4 A;  2E88 A;  3ZSW A;  2HBK A;  2VQF K;  4KTQ A;  1N34 K;  3PX6 A;  3TTF A;  3H6E A;  2HHU A;  1BIZ A;  3TSP A;  1VRU A;  1OKJ A;  1BQM A;  1S1W A;  1WSH A;  3NF8 A;  4OX9 K;  4FXD A;  2J4R A;  2QKB A;  2RKI A;  2Q36 A;  2V7Z A;  3K0S A;  3PUF A;  3F9M A;  2AA4 A;  3U6F A;  3VEW A;  1QE1 A;  4GV3 A;  5AZJ B;  1N36 K;  3HST B;  4RW4 A;  1BQN A;  4GVM A;  3LM9 A;  4JK7 A;  3ZSZ A;  3L2Q A;  2DFF A;  1UA1 A;  2HHQ A;  4FM1 A;  4JK8 A;  4JI8 K;  5KI6 A;  3CJ7 A;  3C6A A;  4B9T A;  4CJK A;  3V1Q A;  3L6Q A;  5IT9 O;  2G8F A;  1TGO A;  4UY8 O;  4MFB A;  4BQL A;  4DTO A;  2Q3S A;  1LW0 A;  4KH6 A;  3CJB A;  3A5N C;  3T1H K;  1T8E A;  2FF3 B;  4EZ9 A;  4CJR A;  5KQ8 A;  4QOZ B;  2YNG A;  4NYN A;  4FOI A;  3KK2 A;  1GOC A;  4JK9 A;  1NKC A;  2Q97 A;  4IO9 L;  4JI2 K;  4Z4F A;  3CCR N;  3AA3 A;  5LJW A;  3L2W A;  2CGJ A;  1X9S A;  4FWK A;  1KRP A;  1TKD A;  3K2P A;  3ATV A;  4H5V A;  2FSJ A;  2HMP A;  1ZBU A;  3CET A;  4J2E A;  3UKU B;  2O8B B;  1NOZ A;  4LF5 K;  1JLC A;  1NBW A;  2KHO A;  3VA0 A;  5JMV A;  3FZH A;  1XC9 A;  2X74 A;  4LH4 A;  2A3Z A;  2ASP A;  3TAF A;  1QSL A;  2ZM6 K;  3FZM A;  5AQV A;  3QEV A;  1IBL K;  5C2D A;  1VQN N;  2NRV A;  2O8D B;  3OYD A;  4C8O A;  5AQK A;  3AV9 A;  3LAN A;  2NRW A;  3CME N;  2W6K A;  4KHQ A;  2B5J A;  3AO4 A;  4LY7 A;  4HHT A;  4CF9 A;  1RT3 A;  2V52 B;  4O4G A;  3MN9 A;  3C6U A;  2PYJ A;  4GNI A;  5KPT A;  4DSL A;  4FK0 A;  5SWM A;  4I9Q A;  1W2B M;  3A5L C;  1IV0 A;  3ZSY A;  4BVP A;  4MLE A;  3V9X A;  3LDQ A;  3CM6 A;  2NRZ A;  1UAX A;  1CZA N;  5TKW A;  4R5P A;  1S9E A;  4RWT A;  3DLL L;  1KVB A;  4DTM A;  1NG9 A;  4K42 A;  1NK5 A;  2YHB A;  1T03 A;  3L3U A;  2XY6 A;  4Y1C A;  2IVN A;  1MWK A;  1U2V B;  2NRR A;  1EWR A;  4FJ5 A;  1NJW A;  1RDB A;  2P9N B;  2W6L A;  3OHR A;  3SUN A;  4FWQ A;  3KD1 E;  3CCE N;  4JD2 B;  3ZSV A;  3CHW A;  4HUF A;  2R7Y A;  4OKJ A;  1TVR A;  4IBN A;  1Z6R A;  2HHV A;  1TK8 A;  1U48 A;  3AO3 A;  2Q0U A;  3IDH A;  3CQX A;  2YV0 X;  3E01 A;  3AGK A;  1NGC A;  4PY5 A;  1M90 O;  3H08 A;  4CZK A;  3DLE A;  3B8A X;  2GWK A;  1NGA A;  3AVM A;  4FWM A;  3PY8 A;  1OVQ A;  2P51 A;  1VQ9 N;  3A5O C;  3T19 A;  3SMP A;  1C6V A;  4KHP K;  3LZI A;  2OPP A;  3SCX A;  4K43 A;  4H8K A;  4DV5 K;  3FE1 A;  3O9R A;  1WAJ A;  3CCV N;  1K73 O;  3CFR A;  4FO0 A;  3O3G A;  3WNH A;  4O5B A;  4DMN A;  1X3N A;  1JCF A;  3D2F A;  3D0P A;  1NGH A;  3K5N A;  1ZC6 A;  3O4W A;  3TTD A;  2QWR A;  1LAV A;  3SK3 A;  3EZ5 A;  3CQY A;  4RTF D;  4FVM A;  4DV0 K;  1BA1 A;  4FJI A;  3LM2 A;  4A5A A;  3VTH A;  3ZSO A;  1HRH A;  4BRI A;  2OPS A;  3RMC A;  3TU5 A;  1SV5 A;  5AZI B;  4CEZ A;  3VQ7 A;  3ZX2 A;  4I7F A;  1HMV A;  4J2B A;  3C65 A;  3QFU A;  3OY9 A;  3ZET A;  3IRX A;  4I6M A;  4KI6 A;  5GAD P;  4ICL A;  4DWI A;  1NM1 A;  4DSI A;  4LF7 K;  1BI4 B;  2A1R A;  3QEW A;  1RTD A;  2JWK A;  3DLR A;  3VGK A;  4IOX A;  1SUQ A;  3ZSR A;  3O3F A;  3HXM A;  1XNQ K;  5JLH A;  5AQZ A;  1FXX A;  3VEO A;  4CJ5 A;  2P9K B;  4OKE A;  3BGR A;  1BCM A;  4CHP A;  3HJF A;  2CGL A;  3TSU A;  4BG8 A;  2O8E B;  4LFC K;  1RFQ A;  2CH6 A;  3WQT A;  3KZB A;  1RTI A;  2YHA A;  2Y1J A;  2O8C B;  3WXI A;  1LWF A;  4LC9 B;  1HNZ K;  3MAQ A;  4K41 A;  4J8F A;  4K0K K;  3R3L A;  5CHI A;  3SJH A;  3CJC A;  3VF6 A;  2F8T A;  2QWO A;  1Y64 A;  1XQS C;  3QBW A;  2HBM A;  3S9H A;  3OYC A;  4KHY A;  3RVC A;  1QZ5 A;  5BN9 A;  3H1Q A;  5HRP A;  4NCA A;  2G8H A;  1QSY A;  1L5U A;  2P1J A;  1RDD A;  4FLT A;  4LSN A;  3OYE A;  5CZ1 A;  4G9Z A;  1Q18 A;  3AVG A;  2ASO A;  1K9M O;  1S1V A;  3VPZ A;  4FW2 A;  4BE0 A;  3QES A;  4EP4 A;  4IZ9 A;  4X62 K;  2GEM A;  4FYD A;  4BWJ A;  3KLG A;  3WXL A;  4LFA K;  5AQT A;  2QKK A;  3TAE A;  3WXK A;  5FPM A;  3O6W A;  4A2A A;  2E8A A;  2VWK A;  4Z4I A;  2Q0R A;  4NLB A;  2HHT A;  3OYA A;  1HPM A;  3CF5 L;  4ELU A;  4CZM A;  1WSE A;  2YHX A;  2YX6 A;  5AQQ A;  4CJ7 A;  3TWH A;  4E7H A;  4B1U B;  2I7P A;  2G8I A;  4B1W B;  2FXU A;  4KHS A;  1RT4 A;  4ILJ A;  3VQC A;  3O3H A;  2OAN A;  1NJY A;  1EX4 A;  1HPZ A;  2EX3 A;  5DM6 L;  4CHY A;  1ASW A;  2AJQ A;  1VSJ A;  1IO2 A;  4WQ4 C;  2UUA K;  3SQ2 A;  1YJ9 N;  3LAL A;  3ZCM A;  3O9T A;  3K59 A;  1Y97 A;  1VQ7 N;  1IKX A;  4IEE A;  4M42 A;  2YNI A;  4HUE A;  3PX0 A;  2JGU A;  3KTQ A;  3WEE A;  4JI6 K;  1FK9 A;  1LOT B;  4CJ3 A;  1XNR K;  3HRG A;  4CBU A;  3HPG A;  3OVN A;  1DTQ A;  4G1Q A;  3S3O A;  4NO7 A;  3Q7C A;  1W7A A;  3ZT2 A;  4OPA A;  4E1M A;  4OPK A;  4X66 K;  2IC3 A;  1WAF A;  2ZQB A;  3THW A;  1B9F A;  4DCH A;  2FF6 A;  3UIQ A;  4JI3 K;  3M6G A;  5FPN A;  4CFB A;  4O8U A;  5AQM A;  4OGE A;  4C1N I;  5AQW A;  3L8B A;  1V4T A;  2XO7 A;  3U9D A;  2QI2 A;  3H45 C;  5E41 A;  1HLU A;  4BE1 A;  3GBT A;  1SQK A;  4H0Y B;  1WB9 A;  1TYQ A;  2ZJP L;  4LF4 K;  1JXE A;  3QO9 A;  2RPI A;  3DRS A;  4CIG A;  5CYQ A;  3DYA A;  3AVJ A;  5M1F A;  4MQ3 A;  1T44 A;  4M45 A;  3DXM A;  4J2D A;  4JHD A;  3VA3 A;  4N47 A;  3P5J A;  2ZJR L;  1Q81 O;  3MEC A;  1HNI A;  3D2E B;  2E4L A;  3NH1 A;  5AQN A;  2IVO A;  3M3Z A;  1WUA A;  4DSF A;  2PBD A;  3AAQ A;  4FZY A;  1HJO A;  2WFB A;  1UWB A;  3IUC A;  4AM6 A;  4MO5 A;  3CCL N;  3SUO A;  1W97 L;  1WLJ A;  2UUC K;  5LL6 Z;  1BWF O;  1WNS A;  3QDK A;  2B6A A;  1D4X A;  2IIR A;  4DQQ A;  2JWL A;  4X65 K;  3O9S A;  1JLQ A;  3V1R A;  3ZLJ A;  3LDL A;  4JKA A;  3K9J A;  1LCU A;  1BL3 A;  2HB5 A;  4LH5 A;  2D1K A;  3KK7 A;  4WQ5 A;  3ZEU A;  1HKB A;  2WOM A;  3EYZ A;  5ADX H;  4CZF A;  3AVL A;  1NK8 A;  4RW7 A;  3OYH A;  4F2S A;  5MLC Q;  3LP0 A;  4KHU A;  3THX B;  1A5X A;  2HW3 A;  2BUP A;  3IAY A;  2P9N A;  3NVM A;  4B9V A;  5HRS A;  4QAG A;  4BRC A;  3QET A;  1G99 A;  5C25 A;  1EET A;  3A0I X;  2IVP A;  1VQ5 N;  1VSL A;  4F2R A;  5ELZ A;  3CIP A;  3R6M A;  5BRE A;  3SAH A;  5JLF A;  1T7P A;  2QM1 A;  5E84 A;  3SQ4 A;  4H5W A;  3CG7 A;  2UU9 K;  2PZS A;  4DF8 A;  4FLZ A;  3ZSQ A;  1V4S A;  4IJN A;  4FLW A;  1GLJ O;  4DR4 K;  3RWU A;  4MLH A;  3VN5 A;  1S1T A;  3EEQ A;  3TSQ A;  1JLA A;  3VQD A;  4BR9 A;  5GAH P;  1HX1 A;  3CXC M;  1TKX A;  3RMA A;  2BH1 A;  1T6C A;  4NXN K;  4EP5 A;  2FLO A;  4DUY K;  4FLU A;  1CLQ A;  3G0Z A;  3VF2 A;  2YHY A;  3OBW A;  2OZS A;  4BC4 A;  4JKG A;  4CJL A;  2E20 A;  3PSF A;  3UKR B;  3AVK A;  4DV1 K;  4CFC A;  3CMA N;  3AVF A;  4B9M A;  4WYB A;  1T05 A;  3SBG A;  4CJU A;  4DQS A;  1X1P A;  2P9S A;  3T3F A;  2HND A;  3SV3 A;  2DFE A;  2P9L B;  3NBP A;  5C10 A;  1UA0 A;  1C1B A;  3VQA A;  2F96 A;  2YNF A;  2A41 A;  4A59 A;  4CF8 A;  3QEI A;  3SI6 A;  1C0U A;  2DFH A;  1GLL O;  2HBJ A;  5FDL A;  4JI1 K;  1IBK K;  4GKJ K;  2P9U A;  4JI5 K;  4PWD A;  2NRX A;  1NJZ A;  4ILG B;  2FBV A;  2PFU A;  1S1X A;  1C0M A;  2RE2 A;  3TAG A;  3WT0 A;  4PQU A;  2EHG A;  4CBW A;  4CED A;  2WC9 A;  3KKR A;  4BC3 A;  5CY4 A;  3ZT3 A;  5BR9 A;  2QTD A;  5AJ3 K;  3CFP A;  1BUP A;  2NZT A;  5F2R A;  4B8A B;  2QA4 N;  1BI4 A;  1KCF A;  3HPO A;  2VGM A;  5J1E A;  1B9D A;  5EOY A;  4C8K A;  3BZC A;  1NKB A;  1T6D A;  1IJJ A;  3AA5 X;  3LP2 A;  1HKG A;  1R0A A;  4HVJ A;  4DV4 K;  5JS1 A;  2F7T A;  2BTF A;  3RSE A;  1EQY A;  3GL1 A;  2P9K A;  1WBB A;  2FC0 A;  4NCG A;  3SNN A;  4AHT A;  4JRQ A;  4IJA A;  3TAN A;  3LDS A;  3THY B;  3BF1 A;  1I94 K;  3MDQ A;  5I9E B;  1JJ2 M;  1VSH A;  5TKY A;  4DU3 A;  2P9P A;  2Q31 A;  3GDQ A;  1NJX A;  1FW6 A;  2OPQ A;  4DR1 K;  3R8E A;  4E0D A;  4KO0 A;  4WCE L;  1BHL A;  4XH1 A;  5FRN A;  5HRN A;  5T7B A;  4FLV A;  4FOE A;  1U04 A;  1C0F A;  2RN2 A;  5AQR A;  3SAG A;  3C6H A;  4DU1 A;  4BGA A;  1TK0 A;  4CVN E;  2A6A A;  2I7N A;  1N6Q A;  3KWI A;  5BPL A;  1ATS A;  1M1K O;  1VQK N;  3AAP A;  3P83 D;  5JIC A;  4B1Y B;  3K58 A;  4PKI A;  4DF4 A;  2E6M A;  5M1Q A;  3MX5 A;  1VSF A;  1ASV A;  3M5R A;  1FJG K;  1DGK N;  1YJW N;  3MCP A;  2G8K A;  2HVI A;  4B1V A;  3EKS A;  3T69 A;  5KGW A;  1NGI A;  1YAG A;  4OLA A;  2XY7 A;  4JKB A;  4FK4 A;  2YHW A;  3HOS A;  4AM7 A;  5AR0 A;  4Z4E A;  2FBY A;  3TAB A;  4CK1 A;  3NAE A;  4M63 C;  1JLG A;  3I0R A;  1EKE A;  1RTH A;  4C8M A;  1NU0 A;  2ZJQ L;  2HHS A;  3SPZ A;  2F9W A;  3DMJ A;  5AQG A;  1L3T A;  2ZD1 A;  1RDU A;  1NK7 A;  2H3G X;  3H3O B;  2O8F B;  2QXL A;  3ENO A;  3KLE A;  3U3G A;  2Z1H A;  3AGR A;  4QS9 A;  5HL7 L;  2OTL N;  1W0H A;  1A5V A;  3IG1 A;  1JKH A;  1BO5 O;  3O5B A;  4BY9 C;  5C2F A;  3TAQ A;  1VAZ A;  4RW8 A;  3LPT A;  5GIP A;  4EHT A;  1BA0 A;  2E5L K;  1O1W A;  4FVU A;  4DLE A;  3OYG A;  4QS7 A;  4AIL C;  4TSX A;  2WTU A;  3FZL A;  3VQQ A;  3EL2 A;  3ULD A;  4M3Y A;  4DTS A;  2V7Y A;  4E3S A;  4E1N A;  2DPN A;  4CD3 A;  4KBO A;  4JI4 K;  5H1S Q;  4Z4C A;  3N4Q A;  3S3N A;  5HLF A;  3O4N A;  3SPY A;  4CER A;  3L2U A;  3VQ9 A;  1RDC A;  3NDK A;  2RF2 A;  2X78 A;  3W0L A;  3OS1 A;  4H0X B;  1XC3 A;  1JLE A;  4CJE A;  3W3D A;  4JI0 K;  3HVR A;  2P5G A;  4CJQ A;  4JKE A;  4CK3 A;  5KTQ A;  3RR7 A;  1N5Y A;  3ULE A;  2A5X A;  1IKV A;  4O44 A;  4W5Q A;  4JEP A;  1OH8 A;  3NF9 A;  3KHY A;  1GLA G;  1QZ6 A;  3VQB A;  4ELV A;  2WUS A;  3TAR A;  1WSG A;  3SUQ A;  1BG3 A;  3ITH A;  3V9S A;  4E7J A;  2IS3 A;  5KGX A;  3H1V X;  4GY2 B;  1RTJ A;  1E4G T;  1QQC A;  4Q0B A;  1ZBS A;  1ZYQ A;  2O4G A;  5AFU H;  3HPH A;  3CCQ N;  1SL2 A;  1J5O A;  1NOY A;  4MO4 A;  1SL0 A;  4OO1 J;  2ITM A;  3E9L A;  1JLF A;  4BRQ A;  1U47 A;  2IDO A;  2I5J A;  4Y0W A;  3TTC A;  4CEA A;  5C0Y A;  3QIN A;  2W40 A;  1RGI A;  1BCO A;  2A40 A;  3DXK A;  3RMD A;  2NRT A;  3KLF A;  3U4L A;  3L4I A;  3V1O A;  4LF9 K;  3SV4 A;  1WBD A;  4LSL A;  2HHH K;  5BN8 A;  1MA9 B;  5HOO A;  3PIP L;  3JS6 A;  4F8R A;  3C0B A;  3E66 A;  5HRR A;  3ASM A;  3AVN A;  3CD6 N;  3LDP A;  5AQH A;  4CGH A;  3OW2 M;  4C23 A;  1DLO A;  3TI0 A;  4F3T A;  2XRI A;  1C0G A;  1QQO A;  3T7Z A;  3HP6 A;  1W9H A;  1SKS A;  4Z0U A;  1D5A A;  2Q1N A;  3HK2 A;  1J5E K;  4F3O A;  1U4B A;  4I2Q A;  1S6P A;  4CFA A;  1JCE A;  2JLE A;  3G6E N;  5KPZ A;  2YI1 A;  3R1X A;  3OTO K;  4BR5 A;  3K5L A;  4JS5 A;  3HL8 A;  1I3A A;  3QIC A;  1X9M A;  2Z1J A;  4FW1 A;  4KPY A;  3SQ1 A;  2D0B A;  3VEZ A;  3LAM A;  4M3Z A;  4M7X A;  3BP8 A;  3VQP A;  3LWL A;  2XY5 A;  1ILY A;  2ETJ A;  1HUX A;  3OS0 A;  1UOC A;  3LWM A;  2HVH A;  4B9L A;  3SMS A;  1YTU A;  3EN9 A;  1KLN A;  1ZBF A;  4W5O A;  3FFI A;  1N8R O;  1NK6 A;  4H5T A;  4RW9 A;  3GG4 A;  1G15 A;  1RT1 A;  4Z4H A;  2DY4 A;  2GUI A;  1VSD A;  4YOR A;  1P8Z A;  2XHB A;  4DFJ A;  4EAH D;  2IOC A;  3A8Y A;  1X9J A;  4DR5 K;  3IS9 A;  4FLY A;  5BPM A;  1NKE A;  2X6S A;  3RR8 A;  4JRP A;  3QNN A;  4LF8 K;  1Z05 A;  2VYP A;  4IOC L;  4JI7 K;  3ALY A;  4M41 A;  4CZL A;  4LF6 K;  3TPQ A;  2UXB K;  1Q9X A;  3C7N B;  1IKY A;  3OYI A;  4B3T K;  2HOE A;  4XH4 A;  1XMO K;  4JKD A;  4FSV A;  1L3V A;  4DQ8 A;  3DJC A;  3PX4 A;  2XY8 A;  4BDZ A;  3MX2 A;  4WQ4 A;  4FJJ A;  1TV6 A;  4FWL A;  3M8P A;  4IKF A;  5AQF A;  3E9O A;  4KH4 A;  1YVN A;  4YDU C;  4DS5 A;  5J2P A;  3VEV A;  4H03 B;  1KAX A;  3KLH A;  1KFS A;  2KFN A;  4CEB A;  3BF3 A;  1IH7 A;  2V51 B;  4ELT A;  5AQY A;  4BRP A;  3HP9 A;  5AQJ A;  3AY9 A;  1FKP A;  1VK0 A;  3FZK A;  1Q9Y A;  4HCC A;  1KD1 O;  2YJF A;  1CZB A;  2IGI A;  3ENB A;  1SZ2 A;  4BR0 A;  4DV7 K;  3O8M A;  3K9K A;  2OCE A;  4GMJ B;  5AZJ A;  2OTJ N;  3LDN A;  3CC2 N;  2Z1G A;  3O1B A;  2VWJ A;  3D45 A;  4DSE A;  2HF3 A;  2ZE2 A;  5AQS A; 
#chains in the Genus database with same CATH homology
 3TSQ A;  1NGG A;  4A57 A;  4FWK A;  4BR4 A;  3MN6 A;  4IEI A;  4BR9 A;  4B1Z A;  5GAH P;  1HX1 A;  3CXC M;  2ZF5 O;  2BH1 A;  1T6C A;  3ATV A;  4H5V A;  3F2K A;  2FSJ A;  2FLO A;  2HMP A;  3G4S N;  3CET A;  3UKU B;  3VF2 A;  4YOX A;  2YHY A;  3OBW A;  2P9U B;  4BC4 A;  2E1Y A;  2KHO A;  1NBW A;  4JKG A;  5EX5 A;  2GTD A;  5JMV A;  2E20 A;  4U7B A;  3CJ9 A;  3FZH A;  3J8A A;  3MN7 A;  3UKR B;  4NB4 A;  1YIJ N;  2A3Z A;  2ASP A;  4DKW A;  2FSN A;  3NVK A;  4CBX A;  3CMA N;  3FZM A;  5AQV A;  2GUP A;  4WYB A;  3SBG A;  5C2D A;  1VQN N;  2NRV A;  1QVF M;  3O1W A;  4BRE A;  2P9S A;  1DKG D;  5AQK A;  1QQN A;  5JVG L;  2P9L B;  5C10 A;  2KKZ A;  2NRW A;  3CME N;  4MLH A;  2A41 A;  1QHA A;  4A59 A;  1O13 A;  1GLL O;  4CZI A;  2V52 B;  2HBJ A;  2ASM A;  2YJE A;  4IFE A;  3MN9 A;  3UKU A;  3EE8 A;  2GX9 A;  4GNI A;  5KPT A;  1YUW A;  2P9U A;  1NLV A;  2NRX A;  2NLX A;  1BDG A;  1W2B M;  3A5L C;  4ILG B;  3UKR A;  2PFU A;  2NRH A;  4BVP A;  4WF9 L;  2D0P A;  4MLE A;  3RSE B;  3LDQ A;  3P31 A;  2NRZ A;  2RE2 A;  3F5T A;  3P4I A;  1S72 N;  1CZA N;  5TKW A;  4BRF A;  3WT0 A;  4B1X B;  4RWT A;  1GLD G;  4CZG A;  1NMD A;  4YDU A;  5JVH L;  3DLL L;  4CBW A;  3OBY A;  4K42 A;  2WC9 A;  1J6Z A;  4BC3 A;  5BR9 A;  2P9L A;  5FPD A;  5ADX A;  3M1F A;  2QTD A;  1X3M A;  4A62 A;  4FWN A;  1BUP A;  4F9O A;  2IVN A;  1MWK A;  2NZT A;  5F2R A;  4EIA A;  4ILH A;  1U2V B;  4H0P A;  2QA4 N;  2NRR A;  2P9P B;  4FWS A;  1KXP A;  2VGM A;  5EOY A;  2P9N B;  3GOI A;  3OHR A;  1KQS M;  1T6D A;  1IJJ A;  2WBN A;  4FWQ A;  1HKG A;  3CCE N;  3G25 A;  5AQX A;  4JD2 B;  2F7T A;  2BTF A;  3RSE A;  3CHW A;  1EQY A;  3O80 A;  3HTV A;  3GL1 A;  3I8B A;  2P9K A;  3PLA A;  4H0T B;  4BRN A;  1Z6R A;  1NWK A;  1Q7Y O;  3FZF A;  4IJA A;  2Q0U A;  1QQM A;  1GLE G;  4JKC A;  3IFR A;  3P38 A;  3HM8 A;  3IDH A;  3CQX A;  3ZX0 A;  3BF1 A;  4JN4 A;  3MDQ A;  5I9E B;  3AGK A;  1NGC A;  4C1N K;  4WFA L;  3VOV A;  1U2V A;  1M90 O;  1MDU B;  1JJ2 M;  4IXC A;  5TKY A;  3D2F B;  4A61 A;  2P9P A;  2Q31 A;  2AP1 A;  3GDQ A;  4BR2 A;  4CZK A;  4EFH A;  3B8A X;  2GWK A;  1NGA A;  5EY4 A;  3R8E A;  4FWM A;  2KLA A;  3N4P A;  4QS8 A;  4PKG A;  4WCE L;  2HF4 A;  1VQ9 N;  4XH1 A;  4AF1 A;  3A5O C;  4JD2 A;  3HSC A;  3MWT A;  4FOE A;  3SMP A;  1QVG M;  3EO3 A;  1C0F A;  5AQR A;  3SAG A;  1BOT O;  4K43 A;  4YOW A;  5BRH A;  3C6H A;  3FE1 A;  4BGA A;  3I33 A;  2A6A A;  3O9R A;  2I7N A;  4E1J A;  2NNW A;  4FPA A;  4OPH A;  1NGD A;  5EXW A;  5GAE P;  4FO0 A;  3CCV N;  1Q86 O;  1K73 O;  3KWI A;  4FWP A;  5BPL A;  1ATS A;  1U6Z A;  1M1K O;  1VQK N;  3AAP A;  1H1V A;  2YCH A;  4HTL A;  5JIC A;  4B1Y B;  3ZYY X;  4PKI A;  1X3N A;  3A5M C;  3VER A;  5M1Q A;  3MX5 A;  1JCF A;  2P9I A;  3D2F A;  4H5R A;  4R79 A;  4BRD A;  3M5R A;  3IKM A;  4FPB A;  1YI2 N;  4YOY A;  1NGH A;  2E2Q A;  1NJI O;  1DGK N;  3ZET B;  4I6M B;  3MCP A;  1YJW N;  1VQ8 N;  2A42 A;  2QWL A;  1ZC6 A;  3FR0 A;  3O4W A;  4CI6 A;  3HZ6 A;  2QWN A;  1GLB G;  3LDO A;  3TTD A;  2QWR A;  3SK3 A;  4B1V A;  3CQY A;  3EKS A;  4RTF D;  4IO8 A;  4BR7 A;  3T69 A;  1NGI A;  1YAG A;  5BPN A;  1BA1 A;  5CR4 A;  4JKB A;  5M1O A;  4B9Q A;  2YHW A;  2VGN A;  2QW9 A;  4AM7 A;  3HOS A;  5AR0 A;  3LM2 A;  3EZW A;  4A5A A;  3VTH A;  4BRI A;  1NGJ A;  3CCM N;  5AQI A;  1SAZ A;  3KWG A;  3U9Z A;  4BC2 A;  4BRM A;  2D0O A;  4M63 C;  5AQP A;  3TU5 A;  5AZI B;  2ZJQ L;  1GLC G;  5F1X A;  1YHQ N;  3MWP A;  3ZX2 A;  5DM7 L;  2F9W A;  5AQG A;  1VQM N;  1RDU A;  3MK6 A;  3C65 A;  3QFU A;  5M1P A;  3WQU A;  3SBT A;  3ZET A;  4I6M A;  2H3G X;  2VWB A;  5GAD P;  3H3O B;  4BRK A;  2QXL A;  3CC7 N;  3ENO A;  4IDH A;  1NM1 A;  2RHK A;  3AGR A;  3O9Q A;  4QS9 A;  5HL7 L;  1TUY A;  2OTL N;  2JWK A;  3GE1 A;  5KPR A;  1BO5 O;  4O8K A;  3CPE A;  4IOX A;  3O5B A;  3VGK A;  5C2F A;  4FWO A;  4BY9 C;  5JLH A;  1VAZ A;  3FFK B;  5AQZ A;  4KH5 A;  3VEO A;  1KAY A;  2P9K B;  3UE5 A;  4GVE A;  5GIP A;  1NGB A;  4EHT A;  1BA0 A;  2CGL A;  2F9T A;  4NLC A;  5AZI A;  3TSU A;  4BG8 A;  4CZH A;  4FVU A;  5C15 A;  1RFQ A;  2CH6 A;  3WQT A;  4QS7 A;  3KZB A;  3U8X A;  3VF4 A;  4ISG A;  3FZL A;  4PKH A;  3ULE B;  1OVY A;  4MDB A;  4PL8 A;  5FPE A;  3H3N O;  1T3V A;  2VCP A;  1R59 O;  2QWP A;  3ID6 A;  3WXI A;  2E2P A;  3EL2 A;  2V7Y A;  3BEX A;  4LC9 B;  4A5B A;  4BVO A;  2D4W A;  3DAW A;  4IOA L;  1EO1 A;  2DPN A;  2Q2R A;  4K41 A;  4J8F A;  1DT9 A;  3R3L A;  3WXJ A;  4CD3 A;  3SLC A;  3ENH A;  4KBO A;  5AQO A;  5CHI A;  3SJH A;  5H1S Q;  3CJC A;  3N4Q A;  5EVZ A;  4H0O A;  4BRA A;  3SAF A;  2QWM A;  3VF6 A;  4JKH A;  2QWO A;  1ZXO A;  1Y64 A;  1XQS C;  3QBW A;  1VQP N;  2HBM A;  4RCH A;  2HST A;  3W0L A;  5GIN A;  4WFB L;  4H0X B;  3RVC A;  1QZ5 A;  1XC3 A;  5BN9 A;  3PIO L;  3H1Q A;  3W3D A;  4L3Q A;  5E26 A;  3FLC O;  3VGL A;  4JKE A;  1VQL N;  3VGM A;  1K8A O;  3H46 O;  2FSK A;  1DEJ A;  3VET A;  3NMU A;  3ULE A;  2A5X A;  1YIT N;  4JEP A;  5F0X A;  5AQL A;  3JXU A;  4BRL A;  3VTI A;  5BRF A;  2P9I B;  3J7Z O;  3KHY A;  1GLA G;  1QZ6 A;  4BRG A;  4G9Z A;  2WUS A;  3LL3 A;  1Q18 A;  1BG3 A;  1RDW X;  2EWS A;  2ASO A;  4CZE A;  1K9M O;  4EHU A;  4DB3 A;  3CJA A;  3DXK B;  3QBX A;  3H1V X;  3VPZ A;  4GY2 B;  3EE9 A;  3CC4 N;  1E4G T;  4IZ9 A;  2GEM A;  3I56 N;  3WXL A;  1JCG A;  3DWL A;  2ZWH A;  1ZBS A;  5AQT A;  5AFU H;  3D7E O;  3WXK A;  1P90 A;  5FPM A;  3EKU A;  5BRD A;  2ZGZ A;  3O6W A;  4JNE A;  4BG9 A;  2UYT A;  4A2A A;  2E8A A;  3KVG A;  4MO4 A;  3FGU A;  3MMV A;  3MN5 A;  4OO1 J;  1ATN A;  4HWI A;  2ITM A;  2Q0R A;  3E9L A;  2QWQ A;  4NLB A;  1HPM A;  2GWJ A;  3WUH A;  4BRQ A;  3CF5 L;  3CPW M;  4H5N A;  4CZM A;  2YHX A;  4XEI A;  3R9P A;  4GV9 A;  3C7N A;  4Y0W A;  3TTC A;  2YX6 A;  5AQQ A;  5C0Y A;  4CJ7 A;  4YOT A;  5KQD A;  3I55 N;  2W40 A;  5LJV A;  4B1U B;  2I7P A;  1RGI A;  2GEL A;  3WEE B;  2A40 A;  3DXK A;  4B1W B;  2NRT A;  2FXU A;  3U4L A;  3L4I A;  4CD1 A;  4ILJ A;  3ID8 A;  3L0Q A;  5M1K A;  5C12 A;  2W41 A;  2QEX N;  5BN8 A;  1MA9 B;  1MWM A;  2OAN A;  5HOO A;  3PIP L;  3JS6 A;  4ISF A;  3C0B A;  3E66 A;  4YOU A;  4FWR A;  5DM6 L;  1YXQ A;  3E1Y A;  3O08 A;  2E2O A;  3ZX3 A;  4CZJ A;  3CCS N;  3HBT A;  4JKF A;  3CJ1 A;  3OA9 A;  1K8K A;  3CD6 N;  3VES A;  3D6R A;  4WQ5 C;  3LDP A;  5AQH A;  3OW2 M;  4C23 A;  1YF5 L;  4WQ4 C;  4DHY A;  1YJ9 N;  1C0G A;  5GAG P;  1QQO A;  3T7Z A;  3O9T A;  4YOV A;  1VQ7 N;  4IEE A;  2Q1N A;  3CER A;  3WEE A;  1LOT B;  1JCE A;  1TYQ B;  4IWV A;  3G6E N;  5KPZ A;  2YI1 A;  3HRG A;  2HBL A;  4CBU A;  3HOT A;  1YJN N;  3R1X A;  4NO7 A;  3Q7C A;  1SS6 A;  4OPA A;  3VEN A;  2E2N A;  4BR5 A;  3DXM B;  3BUZ B;  3CCQ N;  4BRH A;  4JHD B;  4MDA A;  4A2B A;  3QIC A;  4DCH A;  4BQZ A;  1BU6 O;  2FF6 A;  3VEZ A;  4K25 A;  4M7X A;  3M6G A;  3BP8 A;  5FPN A;  4O8U A;  2CGK A;  3QB0 A;  1ILY A;  5AQM A;  1HUX A;  4C1N I;  5AQW A;  1V4T A;  3VMF B;  3UB5 A;  3U9D A;  2QI2 A;  3H45 C;  1S22 A;  3SMS A;  3QML A;  1VQ6 N;  3G71 N;  1HLU A;  3GBT A;  1SQK A;  3EN9 A;  4H0Y B;  4BC5 A;  3O9U A;  4WFN L;  1TYQ A;  2ZJP L;  5AQU A;  1WOQ A;  5B8H A;  1N8R O;  4BRO A;  3E9P A;  5GIO A;  4Z94 A;  4H5T A;  1T44 A;  1XUP O;  3GG4 A;  4BGB A;  5M1F A;  3HI0 A;  3DXM A;  4PHT X;  4JHD A;  3CI5 A;  2ZJR L;  1Q81 O;  3QFP A;  1VQ4 N;  3Q7B A;  4YOR A;  1P8Z A;  4U67 L;  3ZEU B;  4EAH D;  3A8Y A;  1X9J A;  3P39 A;  3D2E B;  2PAV A;  1Q82 O;  5AQN A;  2IVO A;  5AFU A;  5BPM A;  1E4F T;  3M3Z A;  1WUA A;  2E88 A;  2HBK A;  1NGE A;  5CE3 A;  2PBD A;  1Z05 A;  2VYP A;  3AAQ A;  1NGF A;  1HJO A;  2WFB A;  1ATR A;  3H6E A;  3IUC A;  3TTF A;  1S3X A;  3TSP A;  4CZL A;  4AM6 A;  4JAX A;  1OKJ A;  4MO5 A;  3TPQ A;  3C7N B;  3CCL N;  1W97 L;  2HOE A;  4M7Y A;  4FL9 A;  1BWF O;  3QDK A;  4XH4 A;  1D4X A;  2J4R A;  2IIR A;  2JWL A;  4JKD A;  2Q36 A;  3O9S A;  4IOC L;  3VEX A;  4FSV A;  2V7Z A;  3LDL A;  3K9J A;  3DJC A;  4ISE A;  1LCU A;  4JKA A;  4DQ8 A;  2D1K A;  3F9M A;  2AA4 A;  3KK7 A;  4WQ5 A;  3VEW A;  3MX2 A;  3ZEU A;  4WQ4 A;  1HKB A;  3WXM B;  4GV3 A;  5AZJ B;  4GV6 A;  5ADX H;  4CZF A;  3D2E A;  1HKC A;  4FWL A;  3LM9 A;  4JK7 A;  5MLC Q;  1K8K B;  5M1N A;  5AQF A;  3E9O A;  4KH4 A;  1YVN A;  4JK8 A;  4YDU C;  5LY3 A;  2BUP A;  3VEV A;  4H03 B;  1KAX A;  1GLF O;  2P9N A;  3CJ7 A;  3NVM A;  3C6A A;  3BF3 A;  4BRC A;  3L6Q A;  2E1Z A;  2V51 B;  1G99 A;  1IG8 A;  4PL7 A;  5AQY A;  4BRP A;  4UY8 O;  2ZGY A;  4BQL A;  3AAR A;  3A0I X;  1TUU A;  3AY9 A;  2IVP A;  5AQJ A;  3VEY A;  1KAZ A;  3FZK A;  4KH6 A;  1VQ5 N;  4JKG B;  3CJB A;  3L4Q A;  5ELZ A;  3CIP A;  1VQO N;  3R6M A;  3A5N C;  5BRE A;  3MCA B;  1KD1 O;  4XH5 A;  3SAH A;  2FF3 B;  5JLF A;  2YJF A;  5KQ8 A;  2QM1 A;  5E84 A;  4FOI A;  3ENB A;  1SZ2 A;  4H0V B;  4H5W A;  3ATU A;  4BR0 A;  3O8M A;  3K9K A;  1KC8 O;  2OTJ N;  4JK9 A;  5AZJ A;  2Q97 A;  3LDN A;  4O5F A;  1ESV A;  3S41 A;  3CCJ N;  4IO9 L;  3CC2 N;  2P9S B;  3CCR N;  3O1B A;  1V4S A;  4IJN A;  3CCU N;  5LJW A;  1GLJ O;  3IMX A;  2CGJ A;  2HF3 A;  2CH5 A;  5AQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...