1N33K

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1n33K00
5IT9O 4JI7K 4JYAK 4LF8K 3J80O 3JAMO 1HR0K 1I94K 4B3MK 4DR3K 1HNZK 4JI3K 4LF4K 5A2QO 4DV7K 5AJ3K 4LFAK 4YY3K 4GKJK 4B3TK 4GKKK 4LFBK 1N33K 4JI8K 1XNRK 4JI6K 4DV4K 4DV3K 4YHHK 4DV2K 2E5LK 4X64K 4LF7K 2UUAK 1IBLK 4NXNK 4B3RK 3OTOK 1XNQK 4LF5K 3J7YP 4LF9K 4CW7B 4DR5K 4OX9K 5BR8K 1FJGK 4DR1K 1HNWK 4DR7K 5LL6Z 2VQEK 4JI5K 2F4VK 2UUBK 1HNXK 4DV6K 2UXDK 4DR2K 4JI1K 4JI4K 4V19S 4DR6K 4DUYK 2UUCK 4B3SK 1IBKK 4JI2K 4X62K 4NXMK 4JI0K 4KHPK 4DV1K 2UXBK 2ZM6K 1N34K 1N32K 3T1YK 4CVNE 4DR4K 3J7AP 1IBMK 2HHHK 4K0KK 4X66K 4LF6K 2VQFK 4AQYK 4X65K 1XMQK 2UU9K 5FLXO 1XMOK 1N36K 3T1HK 4LFCK 5IWAK 5LMNK 4DV5K 4DUZK 3J81O 1J5EK 4DV0K 2UXCK 4JV5K 5LMUK
chains in the Genus database with same CATH superfamily
1TAUA 3RR7A 2QKBA 4CK3A 2Z1GA 3KTQA 3O9RA 2G8VA 3P83D 4DSIA 2P9KB 3DLEA 1SL0A 4H4MA 2ATQA 3WXLA 4B8AB 1QQNA 3R6MA 4BROA 3LDPA 2O8DB 3AVAA 3GBTA 3OYNA 1WLJA 2O8CB 3QIPA 4IJAA 4DLGA 3BUZB 4DSJA 4QS8A 1WB9A 4FOEA 4PKIA 2AJQA 4H0VB 4PKGA 4DU1A 1JLBA 1TK5A 3AA3A 4M3WA 1CZ9A 3OTOK 1LW2A 3J7YP 5BR8K 5C42A 2QK9A 1FJGK 1VQMN 2W6KA 1JLGA 5FROA 4HUEA 4EAHD 3PX6A 2D0CA 2HNYA 4JI5K 1NGHA 4JS4A 3CG7A 4OO1J 2F7TA 3VEXA 2G8IA 4CEDA 1ZYQA 5TKYA 5LJWA 3CD6N 4BG8A 3LP0A 4PQUA 1BUPA 3P4IA 3CF5L 3D2FB 4FWRA 1GLBG 1S1VA 4CCHA 3KWGA 2OZMA 3SZ2A 1P90A 1IO2A 2IOCA 2HHSA 2QWNA 5FPNA 3DMJA 1U49A 1K8KA 5JS1A 3CHWA 4BR0A 1Z05A 3HP9A 1X9WA 2D0PA 1FK9A 2E2QA 3P39A 2HBJA 1YXQA 4IBNA 2Q0RA 1GLDG 3L2UA 3DRPA 4IEEA 4BRCA 4W5NA 1SZ2A 3B6PA 3JS6A 4OKEA 4CHOA 4FLTA 3NHGA 1C0UA 3NDKA 3PX0A 3VOVA 4M3YA 1HKGA 4DV0K 4CHYA 5LMUK 3SAFA 1NWKA 2Q0UA 3E66A 3R1XA 1T3VA 4CBXA 3LDQA 3D2EA 2G8UA 5I3UA 5FPEA 1HNZK 4YNQA 4FLZA 3FZLA 3OYFA 3AAQA 5HBMA 4DV3K 3GL1A 4FCYA 5GADP 3CI5A 3NVMA 3OW2M 1VQ8N 4LF7K 4FWLA 1ITGA 2AA4A 3AVFA 1SAZA 1B9DA 3CMAN 1REVA 4H0YB 4I9LA 3HYFA 4B3RK 5EU7A 1HJRA 4Z4GA 3FLCO 1RT2A 2LSNA 2P9IB 4LF9K 3E9LA 1GLLO 2CH5A 3EKSA 3C6TA 4JEPA 5KGWA 5BRHA 1Q7YO 2O4GA 4C1NI 3PY8A 3DWLA 3OA9A 2PYJA 1RNHA 5C2DA 1YF5L 4CHZA 4DR2K 2GEMA 4UQGA 3DLGA 1ZXOA 3DLRA 2RHKA 1KAXA 1U48A 5CYMA 4Z0UA 2F9WA 1NJYA 2UUCK 5LY3A 4ILJA 1GLCG 4NCGA 1DLOA 2IIRA 3ZSXA 4XH4A 4JI0K 3GG4A 4DV1K 3ZCMA 4DTUA 2WBNA 1MWKA 2NRZA 3N4PA 3BF3A 1S1XA 4H0TB 3TPQA 1I3AA 3ZT2A 1X9SA 2OTJN 2UU9K 2GBZA 3MN9A 4LD0A 4A61A 3H45C 4JHDA 3O9QA 4IFYA 2DFEA 3THYA 2BUPA 4DSFA 1WUAA 2ZF5O 4K8XA 1HYSA 4QAGA 3O1BA 2JLEA 3EZ5A 4B1VA 2WUSA 2QI2A 1LAVA 1TYQA 2YHBA 4IJNA 3DM2A 4B9MA 2YKMA 3SUNA 1G99A 4DS4A 5A2QO 4BACA 3TAFA 1I39A 4BRQA 4KREA 4WQ5A 4R5PA 2YI1A 4K8ZA 3K5OA 5M1PA 4DTXA 4DQIA 4X64K 2YHYA 2KKZA 2QW9A 4DTNA 2X6SA 3KLEA 4FWQA 1IH7A 5JLFA 3NF7A 4BR2A 4OPHA 1JLEA 2QA4N 4Y1DA 4WCEL 3QFPA 3C6HA 3G10A 4PL8A 2W41A 4J2EA 3AGKA 2FF6A 4OX9K 2ITGA 2WC9A 2YNHA 3IAYA 4ISGA 4JKHA 1KCFA 3ITHA 1GLAG 4DR7K 4BQLA 5H1SQ 3TAQA 4DTOA 2NZTA 3ALYA 3OS1A 4Z4EA 2QWMA 5AZJA 4CIGA 4JKBA 4QS9A 4A57A 3CJ7A 4LC9B 2ZQBA 4CEAA 3CIPA 4QS7A 3CCLN 4M3XA 4FWPA 1VQ6N 4DUYK 4JD2B 4B1ZA 3P5JA 3K9KA 4CJFA 2QTDA 3D6RA 1S6QA 1YJWN 1QTMA 2PY5A 1TUYA 4IEIA 3ZT1A 3WNHA 1LV5A 3VERA 2V7YA 4X62K 4HUFA 3ZT0A 3K5LA 4OPKA 1V4TA 4FLXA 3LAMA 4C8LA 3OYKA 4BDPA 1JCGA 1XQSC 4DR4K 1M1KO 4H0PA 1QZ6A 4U67L 4B9LA 4IFEA 4CHPA 4CJTA 5JMVA 4X65K 4E89A 4M45A 2IC3A 3ULEA 3O3HA 2KZZA 5FLXO 4CZEA 1FW6A 1VQ4N 3SCXA 3SJJA 3ZX2A 3A5MC 2KZMA 3O1WA 3CFRA 3ATUA 3ENHA 3TAGA 2O8BB 4BC5A 2W42A 1J5OA 4EZ9A 1EQYA 2QWPA 3QNOA 4FW1A 3NF6A 3JAMO 2XY6A 5KRSA 3ZX0A 1JKHA 2PAVA 4NYNA 5JS2A 4CBUA 2NRVA 4KRFA 1S22A 2G8HA 5AJ3K 1HPZA 1X3MA 1MDUB 4G9ZA 3PIPL 1BISA 3C65A 2A1RA 1JLFA 4F2SA 3NH2A 2QWOA 3IUCA 5DMRA 3DOLA 4I6MB 3C6AA 2FBTA 5M1OA 4ELTA 4H8KA 2WOMA 1HQUA 1J6ZA 3L4QA 1RDAA 2BH1A 2YKNA 1SL1A 4DSKA 4I2QA 3AO5A 4OPJA 4C23A 3AVJA 2DTUA 3VENA 1ASUA 1HUXA 1VQ9N 2ASMA 3D2FA 3UKUB 5C2FA 1NK0A 4RW8A 4OVLA 1OH7A 1RT5A 1QVFM 4OKKA 2BDPA 1TL1A 3QESA 4ELVA 2W6LA 1HQEA 2GELA 4HTLA 1LWCA 1IV0A 3DLLL 3E9PA 3L3UA 5AQQA 3VEWA 3DRSA 3TWHA 1HNIA 3BGRA 3KK7A 4ZTJA 3OYHA 3RR8A 2HW3A 4E7JA 1BIZA 3BDPA 3FZHA 1S1WA 3M1FA 4YOTA 3V9WA 1K6YA 5AQIA 4GNIA 1O1WA 2VGMA 1KD1O 1C0MA 4KHPK 1KVCA 4EZ6A 3VQ8A 3T7ZA 3FR0A 3T1YK 1UWBA 1UA0A 4X66K 3KZBA 3UKRB 2P9SB 1XMQK 4FK4A 1NKEA 2XHBA 3MXMA 5F1XA 3THWB 3AA2A 3H1VX 3LALA 3FE1A 3SYZA 4KTQA 3VF2A 1SV5A 5HRRA 5AFUH 2VG6A 5J1EA 4KHQA 3K58A 2ZGYA 1DGKN 4I2PA 4CI6A 1WSJA 1TK8A 3FGUA 3T69A 4DB3A 1VQ5N 1T7PA 4CEFA 2HHWA 3NBPA 4M3RA 4B1WB 1RBSA 3F9MA 5AQUA 5KI6A 3ZSRA 2HHXA 5JVHL 4WQ5C 2D0BA 3SUOA 4KTZA 4C8OA 3T19A 3ZT3A 1RILA 4RWTA 1NK7A 1S9EA 1NJIO 3NH0A 3M3ZA 1YIJN 3NMUA 4DV7K 4GV9A 4PKHA 5CYQA 3L2WA 1EXQA 5FPDA 1OH5A 5HROA 1XNRK 1L5UA 4H5TA 1S5JA 1Q82O 2WTUA 1NGEA 4H5NA 2P9PA 3LP3A 1J53A 4FWNA 4FW2A 1YVNA 3T1AA 4F8RA 1WSFA 2Q31A 1NGJA 5KGXA 3CJCA 5J2QA 4ILHA 2O8EA 1VRTA 1ATNA 4E3SA 3NGYA 3C95A 2P9UA 3T3FA 1RDBA 3I8BA 1RTIA 1NJXA 5EVZA 4ICLA 4FLVA 4ID5A 3CJ9A 5ADXH 3K57A 2HF3A 4HHTA 2UYTA 4CJPA 2IGIA 4JKAA 1CZBA 2YJFA 2HHQA 4WYBA 4G1QA 3KLIA 4XH5A 5B8HA 3V9UA 3HT3A 5DK5A 4M41A 2R7YA 1ZBUA 1CXQA 3O4WA 4BGAA 5BR9A 1T05A 4ISFA 2UXBK 2ZM6K 2OCEA 1KLMA 3IS9A 2OPRA 1H1VA 4K42A 1JXEA 1NK9A 3DRRA 3DXMA 3CCQN 2HBLA 4Q0BA 4BR4A 3OS2A 4FJ9A 4BDYA 2NRXA 3K9JA 3WT0A 4FLWA 2IS3A 3QMLA 3WXMB 1KAZA 4FVUA 2VG5A 4O5FA 1D5AA 4OLBA 4YOUA 2E1YA 2F8TA 3R9PA 2V51B 1KVBA 3TAEA 1Z25A 4CGFA 4ZHRA 3SQ4A 5AQJA 1YTUA 3ZLJA 1Q18A 3TR8A 1BA0A 5C12A 3QEIA 4MQ3A 1X9JA 3ID6A 4CF9A 2JGUA 3DYAA 3VPZA 2HMIA 3SBTA 3ID8A 2P51A 4DFMA 1BCOA 4BWJA 1EP4A 1VSLA 3NGZA 4HWIA 2Q3SA 2E5LK 1JCEA 3QBWA 3IG1A 3G0ZA 1U4BA 1U2VB 5CZ1A 4DTMA 1BDGA 3G4SN 4Y1CA 2NLXA 1IBLK 1RT7A 2FBVA 3ZSOA 3D45A 4O44A 3VQ6A 3I0RA 4FJGA 3MX5A 3HPGA 4ELUA 1WOQA 4W5RA 4AILC 3HO1A 4IOXA 1U6ZA 1VSIA 5KTQA 5GAEP 1VQLN 3E1YA 4CJ7A 3SAGA 4DFKA 4DV6K 1C1AA 4CFDA 1N8RO 1BHLA 4CHNA 5HLFA 1NGBA 3BF1A 1XHXA 2P9LB 1TKDA 3NE6A 3HBTA 3WNEA 3MEDA 3WQUA 3C0BA 1U04A 2I5JA 1RT6A 3C6UA 1HJOA 4NXMK 1BIUA 5C25A 4IKFA 4JAXA 4EHTA 3HJFA 4GV3A 1RTHA 5CR4A 5KRTA 1N34K 2O8BA 1R59O 1ASWA 1RT1A 3TABA 1JL1A 5HRSA 4FXDA 2HHHK 3BEXA 4AH9A 3RWUA 3LM2A 1NGCA 5BPLA 4GV6A 4KH6A 2YV0X 4AQYK 4CZFA 4CZGA 1LWEA 1EX4A 1ZBLA 5BRDA 4FM1A 3O6WA 4FL9A 4MDAA 4IDHA 3CPEA 3S9HA 5IWAK 3L3VA 1OKJA 4DUZK 1VSFA 3OYGA 3VQQA 2UXCK 5DM7L 3ASMA 3ZYYX 5HRNA 1SL2A 2ZD1A 4AHRA 1BO5O 2JWLA 4I6MA 3CQ8A 1I94K 3A5OC 3VGLA 4DF8A 3HI0A 4YOXA 3MAQA 4B3MK 4M7XA 4BRKA 4BE2A 1VQ7N 3SNNA 3HZ6A 3BP8A 1JJ2M 4OKJA 5AQZA 1FKOA 2PBDA 4L8RB 2GWJA 3RSEB 3OYDA 1TVRA 1A5WA 4AF1A 1B9FA 4CGDA 3SV3A 1TK0A 2ZGZA 3MWTA 4DQQA 4B1XB 1QQOA 4CEBA 2O8FB 4IDKA 1XC9A 1W7AA 2E88A 2A42A 4NCBA 5AQPA 4C1NK 3FFKB 1OH6A 1RFQA 1JCFA 3MN7A 3EO3A 3A0IX 1KTQA 3PIOL 3SUQA 3K59A 1C0TA 3CXCM 4EIAA 2YNFA 5C0YA 1TL3A 3A5NC 1SKSA 2Z1IA 3V4IA 2UUBK 4AHUA 1NKCA 4M3UA 1T8EA 4IZ9A 3CC2N 3HPHA 4CJEA 4WE1A 5AQNA 4F9OA 2A5XA 3DI6A 5GIOA 1RGIA 3IDHA 5E84A 2HNDA 4N47A 4DR6K 3RMCA 4DTSA 3VETA 3UKRA 4DG1A 2VCPA 4CF1A 4AM7A 2FLOA 2Q1NA 3THWA 4Z4FA 1VQKN 4XIUA 1UOCA 1RDUA 4DTJA 3EYZA 2E2PA 5AQYA 4MO4A 3WXIA 3W3DA 2A41A 4CVNE 2YHWA 1ZBSA 3I0SA 4CEZA 3O08A 3OY9A 4DSEA 3THVA 1MA9B 2A3ZA 3J7AP 1NU0A 3F9KA 4CJQA 3MCPA 4FWMA 1J54A 1D4XA 1GOAA 4IG3A 1D9FA 5KPRA 5J2PA 2DFHA 5AQMA 3SMPA 4QCLA 1ATSA 5FDLA 3M8RA 2D4WA 4JKGA 4B1UB 4JKCA 4JKDA 4CECA 5ADXA 3OVNA 3ENOA 5LMNK 1Q9XA 3K5NA 4FWKA 3P31A 3KIOA 3M8PA 1SQKA 4CJ4A 4CK1A 3GE1A 3HOTA 2GWKA 3AO2A 4BR9A 3J80O 3V9SA 1CXUA 3A5LC 4CERA 1BOTO 3AVLA 3ZETB 4YY3K 4B3TK 4QOZB 3K5MA 4B9TA 3TI0A 4CEQA 3MWPA 1JLQA 4RW4A 2FXUA 4PA1A 4EP4A 3SMSA 1WBDA 1ZC6A 4FWOA 3SQ0A 4JRQA 4FJLA 4DFJA 4H5RA 5EX5A 2P9NB 3ATVA 3RTVA 2IAJA 4DQ8A 2HMPA 3ENBA 1XI1A 4IFVA 2I7PA 2ZWHA 4I7FA 3BZKA 4FJ8A 3U8XA 4JK8A 2AP1A 5MLCQ 1KQSM 3ISNC 3DXKB 3NGIA 5BPNA 3L2QA 3DLHA 3SPYA 3LZIA 3WQTA 5C15A 1YHQN 2ZE2A 2HOEA 3KK3A 2RPIA 4JI1K 3J8AA 1L3TA 4C8KA 3C7NA 2E2OA 1IG8A 4KB1A 1B92A 2Y1JA 4B9NA 3QLHA 1EETA 2ETJA 4FJMA 1N6QA 2XY8A 4M3ZA 1Z6RA 5I42A 1E4GT 1TV6A 1RBTA 3NH1A 1Y97A 2E6MA 2KLAA 1KAYA 4LSNA 4DFPA 4NLBA 4IWVA 3THXB 1QZ5A 1SKWA 1NOZA 1WSGA 3MDQA 4CJ3A 1J9AA 2D0AA 3M8SA 4LFCK 3NF9A 1XC3A 1RT4A 3HM8A 3OJSA 4DV5K 4M42A 3TTDA 4CF2A 2ITMA 1J5EK 1N5YA 1YT3A 4LF8K 4CIEA 3V1QA 3AA5X 4WFBL 4FPBA 3CQXA 1JLCA 3KKRA 3OHRA 4LF4K 2P9KA 2FC0A 3AVBA 4FJIA 2V7ZA 4LFAK 4GKJK 5AR0A 4E1NA 3TTFA 3DJCA 4DQRA 3HOSA 1ZBFA 4BR5A 3B6OA 1DTTA 2IDOA 3KWIA 2O8DA 4J2AA 3OS0A 2HHUA 2Z1JA 4MO5A 2O8CA 4B3OA 1CLQA 1QS4A 1HYVA 4FJKA 4H0OA 5FRMA 2UUAK 1W9HA 1GOBA 1S9GA 2EX3A 2RF2A 1L3UA 2GUPA 4YOWA 3L2VA 2Y1IA 3LWLA 4CEEA 4TSXA 3LWMA 1NK4A 4DR1K 3V9XA 4W5TA 3QNNA 1VAZA 3QDKA 4KBOA 4AHVA 1TKZA 2UXDK 4A5BA 3I8DA 5AQRA 1QQCA 5AZIB 5HL7L 1YJNN 3TSPA 3VEZA 5BREA 1VSMA 4CIFA 4CF8A 4IXCA 1C6VA 4YDUA 5AQXA 4FLUA 3M5RA 3UIQA 2E2NA 3AO1A 4DTPA 3CM6A 4J2DA 4DQSA 3PO5A 2NUBA 2O4IA 1K8KB 4E19A 5BN9A 3EN9A 4CFCA 3WUHA 2I7NA 3SBGA 4BE1A 3EZWA 1NGAA 2E1ZA 2PYLA 3VQ9A 1VSEA 1IKWA 3TSQA 1TGOA 4HVJA 2XY5A 3CM5A 4BRLA 4W5QA 3AVHA 1R0AA 3TAMA 3T1HK 5F0XA 1YUWA 5JVGL 1JLAA 3L6QA 4PL7A 5DM6L 3RSEA 4CGGA 3VGKA 3KLHA 3RMBA 3OYAA 4JV5K 3MEGA 3D2EB 5ELZA 4JYAK 4F2RA 2O8FA 3S41A 1EWQA 1U45A 1NK6A 1KXPA 1Q8IA 1JXBA 3LPUA 4BWMA 3OBYA 3PLAA 3OYMA 4U7BA 3HRGA 3QEWA 4CE9A 2GUIA 4GKKK 3FZKA 4DWIA 1BL3A 4YORA 3K2PA 3S3MA 3KLFA 3CCMN 5SZTA 3L8BA 4C8MA 4LY7A 4RW9A 4CZKA 2P5GA 2FSKA 3RVCA 3AVCA 3KHYA 3H3OB 4FJJA 4NXNK 1UAXA 4H4OA 5AQVA 4A2BA 2FBYA 1XNQK 2P9IA 4JS5A 2HBMA 1DKGD 1YTAA 4FZXC 4HCBA 1IJJA 1FKPA 4KHYA 1XHZA 4KAZA 2J4RA 4XEIA 3O9TA 5AQWA 5E41A 2ASOA 3IFRA 5SWMA 4FVMA 5FRNA 5GAGP 3ZT4A 3BZCA 2OPSA 4YOVA 2QXLA 3LDNA 1RBRA 1DEJA 1NJZA 4B1YB 3U9ZA 5AQTA 4E1MA 2HNZA 3RMAA 4WFAL 1NGIA 2Q2RA 1S6PA 3VEOA 4JHDB 3I33A 4FJNA 2FBXA 3THYB 2E8AA 5I9EB 2YCHA 3MN5A 3PV8A 4C8NA 4CFBA 5M1NA 4N5SA 3QEPA 3P38A 4E0DA 1WN7A 5KQDA 3CCSN 4MLHA 3EL2A 5IT9O 1K9MO 4CGIA 4KPYA 1NNEA 3ULDA 4MFBA 2F8SA 4Z4HA 4N41A 3HSCA 1P8ZA 2BTFA 3ZSWA 1Q9YA 4WFNL 1NKBA 1HLUA 2XO7A 3DXKA 3LL3A 3FZFA 4JI6K 4ID1A 4PUOA 1VQPN 4YHHK 4XH1A 2ZJQL 2HVHA 4AM6A 3LM9A 5BPMA 2RE2A 4IOCL 3KVGA 1BU6O 4GMJB 4GY2B 4F3TA 3WEEB 3NAEA 3NFAA 1SS6A 4B9QA 2VWBA 2X6NA 2KTQA 1MWMA 3R8EA 5AZJB 4KHWA 4YDUC 1VSDA 5T7BA 1ZBHA 4LSLA 1S72N 4AHSA 4Z4IA 3U6FA 1SUQA 3DOKA 3OJUA 4FYDA 1Q86O 4B9SA 4KI4A 3HTVA 1ILYA 3G71N 4FO0A 4LH5A 1U47A 4B3SK 4BVPA 4I9QA 4JD2A 3KK1A 3MEEA 1KRPA 2FF3B 3SV4A 3MCAB 3MX2A 1O13A 1LAWA 3SQ1A 3SUPA 2XRIA 3VF6A 1WSHA 2QXFA 3SAHA 4DS5A 1VQON 4CEOA 2CGJA 1L3VA 1RCHA 3HP6A 2GTDA 3V1OA 1IBMK 4KH5A 3ULEB 4N56A 3QICA 1Z26A 3OYCA 4BY9C 3AVNA 4CBWA 2RKIA 2YHXA 3HVTA 2NRTA 1NGDA 5AQSA 3D7EO 3NVKA 1GOCA 4JKFA 3KLGA 3VF4A 1RBUA 4FSVA 1NG9A 4GW6A 5CZ2A 2GX9A 4IO9L 3CCRN 3V81A 4KHSA 4W5OA 3PSFA 1E3MA 4NO7A 4JI7K 2VGNA 2HSTA 2YNIA 2V52B 1HR0K 2KFNA 4CZMA 1OVQA 5EXWA 3TTCA 1RTJA 4BRPA 3GDQA 4JK7A 4O4GA 3EKUA 1C1BA 1NLVA 3UE5A 5AQOA 3ZSZA 3L4IA 1QSYA 3PO4A 2EWSA 1IKXA 1NBWA 3P1GA 3CCUN 4O0IA 3U3YA 4E7KA 4HCCA 5AZIA 2YJEA 2A6AA 4JRPA 2VG7A 3VEYA 4KHUA 2E4LA 1TUUA 4GVMA 2OPPA 2KW4A 3OBWA 5EY4A 3DAWA 3O4NA 4WQ4A 4DQPA 4DR5K 3AVGA 2D0OA 3TU5A 3UKUA 1VSKA 3SPZA 2QWQA 5LL6Z 1LW0A 3VQ5A 3HM9A 4L3QA 4YOYA 3LPTA 4CJUA 2BANA 2IVNA 5AFUA 5KPZA 4NLCA 3H6EA 5AQKA 4BC4A 2D1KA 4CFAA 3KK2A 1QQMA 3QINA 3CPWM 4FZYA 3I56N 2OZSA 5J2NA 3CCJN 4FPAA 4KFBA 4ZTFA 4BRHA 2BE2A 4FJ7A 4OLAA 4K25A 3TANA 1Y64A 4BRIA 4BRMA 5LJVA 1YAGA 1QE1A 2DFFA 4O8UA 3FFIA 2QWRA 4BR7A 4Z94A 1FXXA 3VQ7A 3ZEUB 4O5BA 3E9OA 4KV8A 2P9SA 4CJKA 4B9UA 1KSPA 3N4QA 2YHAA 2ZJRL 1WSEA 4MDBA 4CJRA 3LP2A 5AQHA 4AHCA 1S1UA 3OYJA 3MK6A 3CJ1A 4CGHA 3J7ZO 1KC8O 1MU2A 1VSJA 1HKCA 1EKEA 3VMFB 4CGJA 3AY9A 1KLNA 5EOYA 3S3OA 2OTLN 2PZSA 4E7HA 3IMXA 3ZSYA 2DY4A 2YNGA 5KPTA 4JI8K 2P9PB 2B6AA 1BA1A 4BDZA 1QVGM 4DV4K 5HP1A 2HVIA 4DV2K 2IVPA 2Q36A 4H0XB 4O55A 1HYZA 4CHQA 4FJ5A 2O8EB 1BCMA 3VESA 4PWDA 4BRFA 3L0QA 5CHIA 2FSNA 2P9UB 1KVAA 1VQNN 1HMVA 5BN8A 4Y0WA 4CW7B 3MMVA 1HNVA 3VQAA 1T03A 4IO8A 1NK5A 1BGXT 3PUFA 2VQEK 3VA0A 1E4FT 1K8AO 4CJLA 4B08A 3ZSQA 1WAFA 1HKBA 2QM1A 4FM2A 3H1QA 2NRRA 3CCEN 3VQBA 3CJAA 3H08A 4CZIA 3G25A 3O5BA 5C10A 3OYBA 4CJWA 1NGGA 4DTRA 3U9DA 3HL8A 2A1SA 4MLEA 3OYLA 1NK8A 3CCVN 2KHOA 1X1PA 4CD3A 3DXMB 4J2BA 5C24A 1EWRA 3AV9A 1F21A 3VA3A 4KB0A 1WSIA 2HF4A 1RDWX 2VQFK 3SI6A 1G15A 3M6GA 4JLHA 1ZBIA 4JKEA 2QEXN 1TKXA 3RMDA 4M63C 5JICA 2VYPA 2P1JA 4BRAA 1GLJO 1HPMA 1XWLA 2IVOA 1S1TA 3AA4A 3HSTB 4BRGA 1LOTB 3V6DA 5J2MA 2G8KA 1ESVA 1BI4B 1DT9A 4LH4A 3OYEA 4DU4A 2CH6A 3HK2A 5KQ8A 3M8QA 3V1RA 3WEEA 3O3GA 3TAPA 5AQLA 3DLKA 1ASVA 3RRGA 3F2KA 4KKOA 1OH8A 4IOAL 3OYIA 3EEQA 4WQ4C 4PHTX 4DMNA 1OVYA 2ZJPL 3EY1A 3C94A 1GLFO 1U2VA 4WF9L 5AQGA 3VQ4A 3QEVA 3WNFA 4FLYA 1C0FA 4M7YA 5HRPA 3AVKA 3TARA 4O0JA 2E20A 2VWKA 3L2RA 4FK2A 4DKWA 3QO9A 4CESA 5F2RA 4CK2A 5D3GA 4CZJA 2RN2A 4JNEA 3QERA 5CY4A 4JI4K 4A2AA 4V19S 3MXJA 3DLBA 2F9TA 1WAJA 4KTWA 2ASPA 3AGRA 3VQCA 4Q5VA 4FOIA 4AHTA 3QEXA 4CF0A 2P9LA 4JI2K 5GINA 3Q7CA 3UB5A 4KHNA 3LDLA 3CFPA 1D9DA 4RW6A 4N76A 1L3SA 2YX6A 3QB0A 3F73A 5GIPA 3V9ZA 1RDDA 2JWKA 1NM1A 4F3OA 4RW7A 4CJ5A 3ZSVA 1XMOK 1YITN 2OPQA 1N36K 3LANA 2QWLA 3R3LA 3QBXA 1QSLA 4OGCA 2GV9A 4OPAA 4DLEA 2Q97A 4BC2A 3J81O 5TKWA 1BWFO 2D5RA 3LP1A 2EHGA 3RRHA 1SKRA 4CJSA 2X74A 4DCHA 1C1CA 3AVIA 3HXMA 4FJXA 3S3NA 1TAQA 3AAPA 5JLHA 3ZX3A 3HPOA 1NJWA 5E26A 1RDCA 4LFBK 3NCIA 4FK0A 4EP5A 1YVUA 1ATRA 2KQ2A 2CGLA 3B8AX 4RTFD 1DTQA 5FPMA 3AO3A 1QHTA 2HBKA 1X9MA 3CQYA 3SK3A 3K0SA 4H03B 1IG9A 2HHVA 3VN5A 3LAKA 3VEVA 3MXIA 2DPNA 2X78A 2Z1HA 4BE0A 2NRHA 3CERA 1NMDA 3O80A 4DF4A 3CYMA 3LDOA 3EE9A 4E1JA 1HNWK 3CC7N 3U4LA 1W97L 2OANA 2F4VK 4O8KA 3HVRA 1BG3A 1WNSA 3PSIA 2B5JA 2F96A 1NOYA 3KD5E 4ISEA 1XUPO 1VK0A 3AARA 3EE8A 1D8YA 4NYFA 2OA8A 1KFDA 4A5AA 3PX4A 2CGKA 4BVOA 3ZEUA 3QFUA 3SQ2A 3CC4N 4KI6A 3VQDA 1RT3A 1CZAN 1IBKK 1HRHA 4HUGA 4A59A 3JSMA 5M1FA 3VQEA 4K43A 4FJHA 3MN6A 1A5XA 1S3XA 1N32K 1VSHA 2HB5A 3KJVA 3KD1E 3VTHA 4CZLA 4BQZA 2FSJA 4B9VA 1C0GA 4K0KK 4ILGB 5AQFA 3W0LA 1JL2A 3CETA 4LF6K 4RCHA 4NB4A 3VQPA 4DSLA 3I55N 3JXUA 5CE3A 4JKGB 3QETA 1BQNA 4H5WA 3KKSA 1YI2N 2NNWA 1VRUA 1V4SA 4B8CA 1EO1A 5K14A 2OYQA 3WNGA 4HTUA 5BRFA 4DR3K 3LDSA 1LWFA 2XY7A 2G8FA 4JI3K 1GLEG 1WBBA 3VTIA 5M1QA 3A8YA 3QIOA 3ZETA 3AO4A 3SLCA 2NRWA 3H3NO 1N33K 4JK9A 2KFZA 3O9UA 1NMNA 4JN4A 3VGMA 1T6DA 1UA1A 4A62A 4E7IA 4BG9A 3G6EN 4RG8A 4J8FA 4YFUA 3FZMA 1NGFA 1QSSA 3Q7BA 1TYQB 2WFBA 3F5TA 2HHTA 3O8MA 3CFOA 4EFHA 2P9NA 1LCUA 2BGGA 1VHXA 3IRXA 3O3FA 3WXJA 1RTDA 4LF5K 1TKTA 2QKKA 3JYTA 3NF8A 4BREA 4DU3A 4R79A 4K41A 4IG0A 4KO0A 1RBVA 5GAHP 3LZJA 4BGBA 2VWJA 3O9SA 1T44A 3C7NB 1HNXK 1T6CA 4CD1A 1W2BM 1Q81O 1A5VA 3MECA 3SJHA 2W40A 3A2FA 3U3GA 4Z4CA 2P5OA 2PFUA 4CJVA 4H5VA 5M1KA 2WONA 1IKYA 4FWSA 1YJ9N 3H46O 4OGEA 2E6LA 1K73O 4PY5A 3CJBA 4DHYA 4OJRA 4EHUA 1BI4A 4M3TA 1HX1A 4UY8O 3AVMA 3THXA 1W0HA 3IKMA 3TSUA 2G8WA 4KH4A 3O4QA 4BC3A 3BY5A 3E01A 1KFSA 1M90O 4GVEA 1BQMA 3CMEN 2H3GX 4BRNA 4BRDA 2B4JA 4CZHA 1X3NA 4F4KA 3WXKA 3GOIA 4NCAA 4FZZA 3D0PA 2A40A 4FM0A 4E7LA 1IKVA 5HOOA 1QHAA
chains in the Genus database with same CATH topology
5IT9O 4JI7K 4JYAK 4LF8K 3J80O 3JAMO 1HR0K 1I94K 4B3MK 4DR3K 1HNZK 4JI3K 4LF4K 5A2QO 4DV7K 5AJ3K 4LFAK 4YY3K 4GKJK 4B3TK 4GKKK 4LFBK 1N33K 4JI8K 1XNRK 4JI6K 4DV4K 4DV3K 4YHHK 4DV2K 2E5LK 4X64K 4LF7K 2UUAK 1IBLK 4NXNK 4B3RK 3OTOK 1XNQK 4LF5K 3J7YP 4LF9K 4CW7B 4DR5K 4OX9K 5BR8K 1FJGK 4DR1K 1HNWK 4DR7K 5LL6Z 2VQEK 4JI5K 2F4VK 2UUBK 1HNXK 4DV6K 2UXDK 4DR2K 4JI1K 4JI4K 4V19S 4DR6K 4DUYK 2UUCK 4B3SK 1IBKK 4JI2K 4X62K 4NXMK 4JI0K 4KHPK 4DV1K 2UXBK 2ZM6K 1N34K 1N32K 3T1YK 4CVNE 4DR4K 3J7AP 1IBMK 2HHHK 4K0KK 4X66K 4LF6K 2VQFK 4AQYK 4X65K 1XMQK 2UU9K 5FLXO 1XMOK 1N36K 3T1HK 4LFCK 5IWAK 5LMNK 4DV5K 4DUZK 3J81O 1J5EK 4DV0K 2UXCK 4JV5K 5LMUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 O;  4JI7 K;  4JYA K;  4LF8 K;  3J80 O;  3JAM O;  1HR0 K;  1I94 K;  4B3M K;  4DR3 K;  1HNZ K;  4JI3 K;  4LF4 K;  5A2Q O;  4DV7 K;  5AJ3 K;  4LFA K;  4YY3 K;  4GKJ K;  4B3T K;  4GKK K;  4LFB K;  1N33 K;  4JI8 K;  1XNR K;  4JI6 K;  4DV4 K;  4DV3 K;  4YHH K;  4DV2 K;  2E5L K;  4X64 K;  4LF7 K;  2UUA K;  1IBL K;  4NXN K;  4B3R K;  3OTO K;  1XNQ K;  4LF5 K;  3J7Y P;  4LF9 K;  4CW7 B;  4DR5 K;  4OX9 K;  5BR8 K;  1FJG K;  4DR1 K;  1HNW K;  4DR7 K;  5LL6 Z;  2VQE K;  4JI5 K;  2F4V K;  2UUB K;  1HNX K;  4DV6 K;  2UXD K;  4DR2 K;  4JI1 K;  4JI4 K;  4V19 S;  4DR6 K;  4DUY K;  2UUC K;  4B3S K;  1IBK K;  4JI2 K;  4X62 K;  4NXM K;  4JI0 K;  4KHP K;  4DV1 K;  2UXB K;  2ZM6 K;  1N34 K;  1N32 K;  3T1Y K;  4CVN E;  4DR4 K;  3J7A P;  1IBM K;  2HHH K;  4K0K K;  4X66 K;  4LF6 K;  2VQF K;  4AQY K;  4X65 K;  1XMQ K;  2UU9 K;  5FLX O;  1XMO K;  1N36 K;  3T1H K;  4LFC K;  5IWA K;  5LMN K;  4DV5 K;  4DUZ K;  3J81 O;  1J5E K;  4DV0 K;  2UXC K;  4JV5 K;  5LMU K; 
#chains in the Genus database with same CATH topology
 1TAU A;  3RR7 A;  2QKB A;  4CK3 A;  2Z1G A;  3KTQ A;  3O9R A;  2G8V A;  3P83 D;  4DSI A;  2P9K B;  3DLE A;  1SL0 A;  4H4M A;  2ATQ A;  3WXL A;  4B8A B;  1QQN A;  3R6M A;  4BRO A;  3LDP A;  2O8D B;  3AVA A;  3GBT A;  3OYN A;  1WLJ A;  2O8C B;  3QIP A;  4IJA A;  4DLG A;  3BUZ B;  4DSJ A;  4QS8 A;  1WB9 A;  4FOE A;  4PKI A;  2AJQ A;  4H0V B;  4PKG A;  4DU1 A;  1JLB A;  1TK5 A;  3AA3 A;  4M3W A;  1CZ9 A;  3OTO K;  1LW2 A;  3J7Y P;  5BR8 K;  5C42 A;  2QK9 A;  1FJG K;  1VQM N;  2W6K A;  1JLG A;  5FRO A;  4HUE A;  4EAH D;  3PX6 A;  2D0C A;  2HNY A;  4JI5 K;  1NGH A;  4JS4 A;  3CG7 A;  4OO1 J;  2F7T A;  3VEX A;  2G8I A;  4CED A;  1ZYQ A;  5TKY A;  5LJW A;  3CD6 N;  4BG8 A;  3LP0 A;  4PQU A;  1BUP A;  3P4I A;  3CF5 L;  3D2F B;  4FWR A;  1GLB G;  1S1V A;  4CCH A;  3KWG A;  2OZM A;  3SZ2 A;  1P90 A;  1IO2 A;  2IOC A;  2HHS A;  2QWN A;  5FPN A;  3DMJ A;  1U49 A;  1K8K A;  5JS1 A;  3CHW A;  4BR0 A;  1Z05 A;  3HP9 A;  1X9W A;  2D0P A;  1FK9 A;  2E2Q A;  3P39 A;  2HBJ A;  1YXQ A;  4IBN A;  2Q0R A;  1GLD G;  3L2U A;  3DRP A;  4IEE A;  4BRC A;  4W5N A;  1SZ2 A;  3B6P A;  3JS6 A;  4OKE A;  4CHO A;  4FLT A;  3NHG A;  1C0U A;  3NDK A;  3PX0 A;  3VOV A;  4M3Y A;  1HKG A;  4DV0 K;  4CHY A;  5LMU K;  3SAF A;  1NWK A;  2Q0U A;  3E66 A;  3R1X A;  1T3V A;  4CBX A;  3LDQ A;  3D2E A;  2G8U A;  5I3U A;  5FPE A;  1HNZ K;  4YNQ A;  4FLZ A;  3FZL A;  3OYF A;  3AAQ A;  5HBM A;  4DV3 K;  3GL1 A;  4FCY A;  5GAD P;  3CI5 A;  3NVM A;  3OW2 M;  1VQ8 N;  4LF7 K;  4FWL A;  1ITG A;  2AA4 A;  3AVF A;  1SAZ A;  1B9D A;  3CMA N;  1REV A;  4H0Y B;  4I9L A;  3HYF A;  4B3R K;  5EU7 A;  1HJR A;  4Z4G A;  3FLC O;  1RT2 A;  2LSN A;  2P9I B;  4LF9 K;  3E9L A;  1GLL O;  2CH5 A;  3EKS A;  3C6T A;  4JEP A;  5KGW A;  5BRH A;  1Q7Y O;  2O4G A;  4C1N I;  3PY8 A;  3DWL A;  3OA9 A;  2PYJ A;  1RNH A;  5C2D A;  1YF5 L;  4CHZ A;  4DR2 K;  2GEM A;  4UQG A;  3DLG A;  1ZXO A;  3DLR A;  2RHK A;  1KAX A;  1U48 A;  5CYM A;  4Z0U A;  2F9W A;  1NJY A;  2UUC K;  5LY3 A;  4ILJ A;  1GLC G;  4NCG A;  1DLO A;  2IIR A;  3ZSX A;  4XH4 A;  4JI0 K;  3GG4 A;  4DV1 K;  3ZCM A;  4DTU A;  2WBN A;  1MWK A;  2NRZ A;  3N4P A;  3BF3 A;  1S1X A;  4H0T B;  3TPQ A;  1I3A A;  3ZT2 A;  1X9S A;  2OTJ N;  2UU9 K;  2GBZ A;  3MN9 A;  4LD0 A;  4A61 A;  3H45 C;  4JHD A;  3O9Q A;  4IFY A;  2DFE A;  3THY A;  2BUP A;  4DSF A;  1WUA A;  2ZF5 O;  4K8X A;  1HYS A;  4QAG A;  3O1B A;  2JLE A;  3EZ5 A;  4B1V A;  2WUS A;  2QI2 A;  1LAV A;  1TYQ A;  2YHB A;  4IJN A;  3DM2 A;  4B9M A;  2YKM A;  3SUN A;  1G99 A;  4DS4 A;  5A2Q O;  4BAC A;  3TAF A;  1I39 A;  4BRQ A;  4KRE A;  4WQ5 A;  4R5P A;  2YI1 A;  4K8Z A;  3K5O A;  5M1P A;  4DTX A;  4DQI A;  4X64 K;  2YHY A;  2KKZ A;  2QW9 A;  4DTN A;  2X6S A;  3KLE A;  4FWQ A;  1IH7 A;  5JLF A;  3NF7 A;  4BR2 A;  4OPH A;  1JLE A;  2QA4 N;  4Y1D A;  4WCE L;  3QFP A;  3C6H A;  3G10 A;  4PL8 A;  2W41 A;  4J2E A;  3AGK A;  2FF6 A;  4OX9 K;  2ITG A;  2WC9 A;  2YNH A;  3IAY A;  4ISG A;  4JKH A;  1KCF A;  3ITH A;  1GLA G;  4DR7 K;  4BQL A;  5H1S Q;  3TAQ A;  4DTO A;  2NZT A;  3ALY A;  3OS1 A;  4Z4E A;  2QWM A;  5AZJ A;  4CIG A;  4JKB A;  4QS9 A;  4A57 A;  3CJ7 A;  4LC9 B;  2ZQB A;  4CEA A;  3CIP A;  4QS7 A;  3CCL N;  4M3X A;  4FWP A;  1VQ6 N;  4DUY K;  4JD2 B;  4B1Z A;  3P5J A;  3K9K A;  4CJF A;  2QTD A;  3D6R A;  1S6Q A;  1YJW N;  1QTM A;  2PY5 A;  1TUY A;  4IEI A;  3ZT1 A;  3WNH A;  1LV5 A;  3VER A;  2V7Y A;  4X62 K;  4HUF A;  3ZT0 A;  3K5L A;  4OPK A;  1V4T A;  4FLX A;  3LAM A;  4C8L A;  3OYK A;  4BDP A;  1JCG A;  1XQS C;  4DR4 K;  1M1K O;  4H0P A;  1QZ6 A;  4U67 L;  4B9L A;  4IFE A;  4CHP A;  4CJT A;  5JMV A;  4X65 K;  4E89 A;  4M45 A;  2IC3 A;  3ULE A;  3O3H A;  2KZZ A;  5FLX O;  4CZE A;  1FW6 A;  1VQ4 N;  3SCX A;  3SJJ A;  3ZX2 A;  3A5M C;  2KZM A;  3O1W A;  3CFR A;  3ATU A;  3ENH A;  3TAG A;  2O8B B;  4BC5 A;  2W42 A;  1J5O A;  4EZ9 A;  1EQY A;  2QWP A;  3QNO A;  4FW1 A;  3NF6 A;  3JAM O;  2XY6 A;  5KRS A;  3ZX0 A;  1JKH A;  2PAV A;  4NYN A;  5JS2 A;  4CBU A;  2NRV A;  4KRF A;  1S22 A;  2G8H A;  5AJ3 K;  1HPZ A;  1X3M A;  1MDU B;  4G9Z A;  3PIP L;  1BIS A;  3C65 A;  2A1R A;  1JLF A;  4F2S A;  3NH2 A;  2QWO A;  3IUC A;  5DMR A;  3DOL A;  4I6M B;  3C6A A;  2FBT A;  5M1O A;  4ELT A;  4H8K A;  2WOM A;  1HQU A;  1J6Z A;  3L4Q A;  1RDA A;  2BH1 A;  2YKN A;  1SL1 A;  4DSK A;  4I2Q A;  3AO5 A;  4OPJ A;  4C23 A;  3AVJ A;  2DTU A;  3VEN A;  1ASU A;  1HUX A;  1VQ9 N;  2ASM A;  3D2F A;  3UKU B;  5C2F A;  1NK0 A;  4RW8 A;  4OVL A;  1OH7 A;  1RT5 A;  1QVF M;  4OKK A;  2BDP A;  1TL1 A;  3QES A;  4ELV A;  2W6L A;  1HQE A;  2GEL A;  4HTL A;  1LWC A;  1IV0 A;  3DLL L;  3E9P A;  3L3U A;  5AQQ A;  3VEW A;  3DRS A;  3TWH A;  1HNI A;  3BGR A;  3KK7 A;  4ZTJ A;  3OYH A;  3RR8 A;  2HW3 A;  4E7J A;  1BIZ A;  3BDP A;  3FZH A;  1S1W A;  3M1F A;  4YOT A;  3V9W A;  1K6Y A;  5AQI A;  4GNI A;  1O1W A;  2VGM A;  1KD1 O;  1C0M A;  4KHP K;  1KVC A;  4EZ6 A;  3VQ8 A;  3T7Z A;  3FR0 A;  3T1Y K;  1UWB A;  1UA0 A;  4X66 K;  3KZB A;  3UKR B;  2P9S B;  1XMQ K;  4FK4 A;  1NKE A;  2XHB A;  3MXM A;  5F1X A;  3THW B;  3AA2 A;  3H1V X;  3LAL A;  3FE1 A;  3SYZ A;  4KTQ A;  3VF2 A;  1SV5 A;  5HRR A;  5AFU H;  2VG6 A;  5J1E A;  4KHQ A;  3K58 A;  2ZGY A;  1DGK N;  4I2P A;  4CI6 A;  1WSJ A;  1TK8 A;  3FGU A;  3T69 A;  4DB3 A;  1VQ5 N;  1T7P A;  4CEF A;  2HHW A;  3NBP A;  4M3R A;  4B1W B;  1RBS A;  3F9M A;  5AQU A;  5KI6 A;  3ZSR A;  2HHX A;  5JVH L;  4WQ5 C;  2D0B A;  3SUO A;  4KTZ A;  4C8O A;  3T19 A;  3ZT3 A;  1RIL A;  4RWT A;  1NK7 A;  1S9E A;  1NJI O;  3NH0 A;  3M3Z A;  1YIJ N;  3NMU A;  4DV7 K;  4GV9 A;  4PKH A;  5CYQ A;  3L2W A;  1EXQ A;  5FPD A;  1OH5 A;  5HRO A;  1XNR K;  1L5U A;  4H5T A;  1S5J A;  1Q82 O;  2WTU A;  1NGE A;  4H5N A;  2P9P A;  3LP3 A;  1J53 A;  4FWN A;  4FW2 A;  1YVN A;  3T1A A;  4F8R A;  1WSF A;  2Q31 A;  1NGJ A;  5KGX A;  3CJC A;  5J2Q A;  4ILH A;  2O8E A;  1VRT A;  1ATN A;  4E3S A;  3NGY A;  3C95 A;  2P9U A;  3T3F A;  1RDB A;  3I8B A;  1RTI A;  1NJX A;  5EVZ A;  4ICL A;  4FLV A;  4ID5 A;  3CJ9 A;  5ADX H;  3K57 A;  2HF3 A;  4HHT A;  2UYT A;  4CJP A;  2IGI A;  4JKA A;  1CZB A;  2YJF A;  2HHQ A;  4WYB A;  4G1Q A;  3KLI A;  4XH5 A;  5B8H A;  3V9U A;  3HT3 A;  5DK5 A;  4M41 A;  2R7Y A;  1ZBU A;  1CXQ A;  3O4W A;  4BGA A;  5BR9 A;  1T05 A;  4ISF A;  2UXB K;  2ZM6 K;  2OCE A;  1KLM A;  3IS9 A;  2OPR A;  1H1V A;  4K42 A;  1JXE A;  1NK9 A;  3DRR A;  3DXM A;  3CCQ N;  2HBL A;  4Q0B A;  4BR4 A;  3OS2 A;  4FJ9 A;  4BDY A;  2NRX A;  3K9J A;  3WT0 A;  4FLW A;  2IS3 A;  3QML A;  3WXM B;  1KAZ A;  4FVU A;  2VG5 A;  4O5F A;  1D5A A;  4OLB A;  4YOU A;  2E1Y A;  2F8T A;  3R9P A;  2V51 B;  1KVB A;  3TAE A;  1Z25 A;  4CGF A;  4ZHR A;  3SQ4 A;  5AQJ A;  1YTU A;  3ZLJ A;  1Q18 A;  3TR8 A;  1BA0 A;  5C12 A;  3QEI A;  4MQ3 A;  1X9J A;  3ID6 A;  4CF9 A;  2JGU A;  3DYA A;  3VPZ A;  2HMI A;  3SBT A;  3ID8 A;  2P51 A;  4DFM A;  1BCO A;  4BWJ A;  1EP4 A;  1VSL A;  3NGZ A;  4HWI A;  2Q3S A;  2E5L K;  1JCE A;  3QBW A;  3IG1 A;  3G0Z A;  1U4B A;  1U2V B;  5CZ1 A;  4DTM A;  1BDG A;  3G4S N;  4Y1C A;  2NLX A;  1IBL K;  1RT7 A;  2FBV A;  3ZSO A;  3D45 A;  4O44 A;  3VQ6 A;  3I0R A;  4FJG A;  3MX5 A;  3HPG A;  4ELU A;  1WOQ A;  4W5R A;  4AIL C;  3HO1 A;  4IOX A;  1U6Z A;  1VSI A;  5KTQ A;  5GAE P;  1VQL N;  3E1Y A;  4CJ7 A;  3SAG A;  4DFK A;  4DV6 K;  1C1A A;  4CFD A;  1N8R O;  1BHL A;  4CHN A;  5HLF A;  1NGB A;  3BF1 A;  1XHX A;  2P9L B;  1TKD A;  3NE6 A;  3HBT A;  3WNE A;  3MED A;  3WQU A;  3C0B A;  1U04 A;  2I5J A;  1RT6 A;  3C6U A;  1HJO A;  4NXM K;  1BIU A;  5C25 A;  4IKF A;  4JAX A;  4EHT A;  3HJF A;  4GV3 A;  1RTH A;  5CR4 A;  5KRT A;  1N34 K;  2O8B A;  1R59 O;  1ASW A;  1RT1 A;  3TAB A;  1JL1 A;  5HRS A;  4FXD A;  2HHH K;  3BEX A;  4AH9 A;  3RWU A;  3LM2 A;  1NGC A;  5BPL A;  4GV6 A;  4KH6 A;  2YV0 X;  4AQY K;  4CZF A;  4CZG A;  1LWE A;  1EX4 A;  1ZBL A;  5BRD A;  4FM1 A;  3O6W A;  4FL9 A;  4MDA A;  4IDH A;  3CPE A;  3S9H A;  5IWA K;  3L3V A;  1OKJ A;  4DUZ K;  1VSF A;  3OYG A;  3VQQ A;  2UXC K;  5DM7 L;  3ASM A;  3ZYY X;  5HRN A;  1SL2 A;  2ZD1 A;  4AHR A;  1BO5 O;  2JWL A;  4I6M A;  3CQ8 A;  1I94 K;  3A5O C;  3VGL A;  4DF8 A;  3HI0 A;  4YOX A;  3MAQ A;  4B3M K;  4M7X A;  4BRK A;  4BE2 A;  1VQ7 N;  3SNN A;  3HZ6 A;  3BP8 A;  1JJ2 M;  4OKJ A;  5AQZ A;  1FKO A;  2PBD A;  4L8R B;  2GWJ A;  3RSE B;  3OYD A;  1TVR A;  1A5W A;  4AF1 A;  1B9F A;  4CGD A;  3SV3 A;  1TK0 A;  2ZGZ A;  3MWT A;  4DQQ A;  4B1X B;  1QQO A;  4CEB A;  2O8F B;  4IDK A;  1XC9 A;  1W7A A;  2E88 A;  2A42 A;  4NCB A;  5AQP A;  4C1N K;  3FFK B;  1OH6 A;  1RFQ A;  1JCF A;  3MN7 A;  3EO3 A;  3A0I X;  1KTQ A;  3PIO L;  3SUQ A;  3K59 A;  1C0T A;  3CXC M;  4EIA A;  2YNF A;  5C0Y A;  1TL3 A;  3A5N C;  1SKS A;  2Z1I A;  3V4I A;  2UUB K;  4AHU A;  1NKC A;  4M3U A;  1T8E A;  4IZ9 A;  3CC2 N;  3HPH A;  4CJE A;  4WE1 A;  5AQN A;  4F9O A;  2A5X A;  3DI6 A;  5GIO A;  1RGI A;  3IDH A;  5E84 A;  2HND A;  4N47 A;  4DR6 K;  3RMC A;  4DTS A;  3VET A;  3UKR A;  4DG1 A;  2VCP A;  4CF1 A;  4AM7 A;  2FLO A;  2Q1N A;  3THW A;  4Z4F A;  1VQK N;  4XIU A;  1UOC A;  1RDU A;  4DTJ A;  3EYZ A;  2E2P A;  5AQY A;  4MO4 A;  3WXI A;  3W3D A;  2A41 A;  4CVN E;  2YHW A;  1ZBS A;  3I0S A;  4CEZ A;  3O08 A;  3OY9 A;  4DSE A;  3THV A;  1MA9 B;  2A3Z A;  3J7A P;  1NU0 A;  3F9K A;  4CJQ A;  3MCP A;  4FWM A;  1J54 A;  1D4X A;  1GOA A;  4IG3 A;  1D9F A;  5KPR A;  5J2P A;  2DFH A;  5AQM A;  3SMP A;  4QCL A;  1ATS A;  5FDL A;  3M8R A;  2D4W A;  4JKG A;  4B1U B;  4JKC A;  4JKD A;  4CEC A;  5ADX A;  3OVN A;  3ENO A;  5LMN K;  1Q9X A;  3K5N A;  4FWK A;  3P31 A;  3KIO A;  3M8P A;  1SQK A;  4CJ4 A;  4CK1 A;  3GE1 A;  3HOT A;  2GWK A;  3AO2 A;  4BR9 A;  3J80 O;  3V9S A;  1CXU A;  3A5L C;  4CER A;  1BOT O;  3AVL A;  3ZET B;  4YY3 K;  4B3T K;  4QOZ B;  3K5M A;  4B9T A;  3TI0 A;  4CEQ A;  3MWP A;  1JLQ A;  4RW4 A;  2FXU A;  4PA1 A;  4EP4 A;  3SMS A;  1WBD A;  1ZC6 A;  4FWO A;  3SQ0 A;  4JRQ A;  4FJL A;  4DFJ A;  4H5R A;  5EX5 A;  2P9N B;  3ATV A;  3RTV A;  2IAJ A;  4DQ8 A;  2HMP A;  3ENB A;  1XI1 A;  4IFV A;  2I7P A;  2ZWH A;  4I7F A;  3BZK A;  4FJ8 A;  3U8X A;  4JK8 A;  2AP1 A;  5MLC Q;  1KQS M;  3ISN C;  3DXK B;  3NGI A;  5BPN A;  3L2Q A;  3DLH A;  3SPY A;  3LZI A;  3WQT A;  5C15 A;  1YHQ N;  2ZE2 A;  2HOE A;  3KK3 A;  2RPI A;  4JI1 K;  3J8A A;  1L3T A;  4C8K A;  3C7N A;  2E2O A;  1IG8 A;  4KB1 A;  1B92 A;  2Y1J A;  4B9N A;  3QLH A;  1EET A;  2ETJ A;  4FJM A;  1N6Q A;  2XY8 A;  4M3Z A;  1Z6R A;  5I42 A;  1E4G T;  1TV6 A;  1RBT A;  3NH1 A;  1Y97 A;  2E6M A;  2KLA A;  1KAY A;  4LSN A;  4DFP A;  4NLB A;  4IWV A;  3THX B;  1QZ5 A;  1SKW A;  1NOZ A;  1WSG A;  3MDQ A;  4CJ3 A;  1J9A A;  2D0A A;  3M8S A;  4LFC K;  3NF9 A;  1XC3 A;  1RT4 A;  3HM8 A;  3OJS A;  4DV5 K;  4M42 A;  3TTD A;  4CF2 A;  2ITM A;  1J5E K;  1N5Y A;  1YT3 A;  4LF8 K;  4CIE A;  3V1Q A;  3AA5 X;  4WFB L;  4FPB A;  3CQX A;  1JLC A;  3KKR A;  3OHR A;  4LF4 K;  2P9K A;  2FC0 A;  3AVB A;  4FJI A;  2V7Z A;  4LFA K;  4GKJ K;  5AR0 A;  4E1N A;  3TTF A;  3DJC A;  4DQR A;  3HOS A;  1ZBF A;  4BR5 A;  3B6O A;  1DTT A;  2IDO A;  3KWI A;  2O8D A;  4J2A A;  3OS0 A;  2HHU A;  2Z1J A;  4MO5 A;  2O8C A;  4B3O A;  1CLQ A;  1QS4 A;  1HYV A;  4FJK A;  4H0O A;  5FRM A;  2UUA K;  1W9H A;  1GOB A;  1S9G A;  2EX3 A;  2RF2 A;  1L3U A;  2GUP A;  4YOW A;  3L2V A;  2Y1I A;  3LWL A;  4CEE A;  4TSX A;  3LWM A;  1NK4 A;  4DR1 K;  3V9X A;  4W5T A;  3QNN A;  1VAZ A;  3QDK A;  4KBO A;  4AHV A;  1TKZ A;  2UXD K;  4A5B A;  3I8D A;  5AQR A;  1QQC A;  5AZI B;  5HL7 L;  1YJN N;  3TSP A;  3VEZ A;  5BRE A;  1VSM A;  4CIF A;  4CF8 A;  4IXC A;  1C6V A;  4YDU A;  5AQX A;  4FLU A;  3M5R A;  3UIQ A;  2E2N A;  3AO1 A;  4DTP A;  3CM6 A;  4J2D A;  4DQS A;  3PO5 A;  2NUB A;  2O4I A;  1K8K B;  4E19 A;  5BN9 A;  3EN9 A;  4CFC A;  3WUH A;  2I7N A;  3SBG A;  4BE1 A;  3EZW A;  1NGA A;  2E1Z A;  2PYL A;  3VQ9 A;  1VSE A;  1IKW A;  3TSQ A;  1TGO A;  4HVJ A;  2XY5 A;  3CM5 A;  4BRL A;  4W5Q A;  3AVH A;  1R0A A;  3TAM A;  3T1H K;  5F0X A;  1YUW A;  5JVG L;  1JLA A;  3L6Q A;  4PL7 A;  5DM6 L;  3RSE A;  4CGG A;  3VGK A;  3KLH A;  3RMB A;  3OYA A;  4JV5 K;  3MEG A;  3D2E B;  5ELZ A;  4JYA K;  4F2R A;  2O8F A;  3S41 A;  1EWQ A;  1U45 A;  1NK6 A;  1KXP A;  1Q8I A;  1JXB A;  3LPU A;  4BWM A;  3OBY A;  3PLA A;  3OYM A;  4U7B A;  3HRG A;  3QEW A;  4CE9 A;  2GUI A;  4GKK K;  3FZK A;  4DWI A;  1BL3 A;  4YOR A;  3K2P A;  3S3M A;  3KLF A;  3CCM N;  5SZT A;  3L8B A;  4C8M A;  4LY7 A;  4RW9 A;  4CZK A;  2P5G A;  2FSK A;  3RVC A;  3AVC A;  3KHY A;  3H3O B;  4FJJ A;  4NXN K;  1UAX A;  4H4O A;  5AQV A;  4A2B A;  2FBY A;  1XNQ K;  2P9I A;  4JS5 A;  2HBM A;  1DKG D;  1YTA A;  4FZX C;  4HCB A;  1IJJ A;  1FKP A;  4KHY A;  1XHZ A;  4KAZ A;  2J4R A;  4XEI A;  3O9T A;  5AQW A;  5E41 A;  2ASO A;  3IFR A;  5SWM A;  4FVM A;  5FRN A;  5GAG P;  3ZT4 A;  3BZC A;  2OPS A;  4YOV A;  2QXL A;  3LDN A;  1RBR A;  1DEJ A;  1NJZ A;  4B1Y B;  3U9Z A;  5AQT A;  4E1M A;  2HNZ A;  3RMA A;  4WFA L;  1NGI A;  2Q2R A;  1S6P A;  3VEO A;  4JHD B;  3I33 A;  4FJN A;  2FBX A;  3THY B;  2E8A A;  5I9E B;  2YCH A;  3MN5 A;  3PV8 A;  4C8N A;  4CFB A;  5M1N A;  4N5S A;  3QEP A;  3P38 A;  4E0D A;  1WN7 A;  5KQD A;  3CCS N;  4MLH A;  3EL2 A;  5IT9 O;  1K9M O;  4CGI A;  4KPY A;  1NNE A;  3ULD A;  4MFB A;  2F8S A;  4Z4H A;  4N41 A;  3HSC A;  1P8Z A;  2BTF A;  3ZSW A;  1Q9Y A;  4WFN L;  1NKB A;  1HLU A;  2XO7 A;  3DXK A;  3LL3 A;  3FZF A;  4JI6 K;  4ID1 A;  4PUO A;  1VQP N;  4YHH K;  4XH1 A;  2ZJQ L;  2HVH A;  4AM6 A;  3LM9 A;  5BPM A;  2RE2 A;  4IOC L;  3KVG A;  1BU6 O;  4GMJ B;  4GY2 B;  4F3T A;  3WEE B;  3NAE A;  3NFA A;  1SS6 A;  4B9Q A;  2VWB A;  2X6N A;  2KTQ A;  1MWM A;  3R8E A;  5AZJ B;  4KHW A;  4YDU C;  1VSD A;  5T7B A;  1ZBH A;  4LSL A;  1S72 N;  4AHS A;  4Z4I A;  3U6F A;  1SUQ A;  3DOK A;  3OJU A;  4FYD A;  1Q86 O;  4B9S A;  4KI4 A;  3HTV A;  1ILY A;  3G71 N;  4FO0 A;  4LH5 A;  1U47 A;  4B3S K;  4BVP A;  4I9Q A;  4JD2 A;  3KK1 A;  3MEE A;  1KRP A;  2FF3 B;  3SV4 A;  3MCA B;  3MX2 A;  1O13 A;  1LAW A;  3SQ1 A;  3SUP A;  2XRI A;  3VF6 A;  1WSH A;  2QXF A;  3SAH A;  4DS5 A;  1VQO N;  4CEO A;  2CGJ A;  1L3V A;  1RCH A;  3HP6 A;  2GTD A;  3V1O A;  1IBM K;  4KH5 A;  3ULE B;  4N56 A;  3QIC A;  1Z26 A;  3OYC A;  4BY9 C;  3AVN A;  4CBW A;  2RKI A;  2YHX A;  3HVT A;  2NRT A;  1NGD A;  5AQS A;  3D7E O;  3NVK A;  1GOC A;  4JKF A;  3KLG A;  3VF4 A;  1RBU A;  4FSV A;  1NG9 A;  4GW6 A;  5CZ2 A;  2GX9 A;  4IO9 L;  3CCR N;  3V81 A;  4KHS A;  4W5O A;  3PSF A;  1E3M A;  4NO7 A;  4JI7 K;  2VGN A;  2HST A;  2YNI A;  2V52 B;  1HR0 K;  2KFN A;  4CZM A;  1OVQ A;  5EXW A;  3TTC A;  1RTJ A;  4BRP A;  3GDQ A;  4JK7 A;  4O4G A;  3EKU A;  1C1B A;  1NLV A;  3UE5 A;  5AQO A;  3ZSZ A;  3L4I A;  1QSY A;  3PO4 A;  2EWS A;  1IKX A;  1NBW A;  3P1G A;  3CCU N;  4O0I A;  3U3Y A;  4E7K A;  4HCC A;  5AZI A;  2YJE A;  2A6A A;  4JRP A;  2VG7 A;  3VEY A;  4KHU A;  2E4L A;  1TUU A;  4GVM A;  2OPP A;  2KW4 A;  3OBW A;  5EY4 A;  3DAW A;  3O4N A;  4WQ4 A;  4DQP A;  4DR5 K;  3AVG A;  2D0O A;  3TU5 A;  3UKU A;  1VSK A;  3SPZ A;  2QWQ A;  5LL6 Z;  1LW0 A;  3VQ5 A;  3HM9 A;  4L3Q A;  4YOY A;  3LPT A;  4CJU A;  2BAN A;  2IVN A;  5AFU A;  5KPZ A;  4NLC A;  3H6E A;  5AQK A;  4BC4 A;  2D1K A;  4CFA A;  3KK2 A;  1QQM A;  3QIN A;  3CPW M;  4FZY A;  3I56 N;  2OZS A;  5J2N A;  3CCJ N;  4FPA A;  4KFB A;  4ZTF A;  4BRH A;  2BE2 A;  4FJ7 A;  4OLA A;  4K25 A;  3TAN A;  1Y64 A;  4BRI A;  4BRM A;  5LJV A;  1YAG A;  1QE1 A;  2DFF A;  4O8U A;  3FFI A;  2QWR A;  4BR7 A;  4Z94 A;  1FXX A;  3VQ7 A;  3ZEU B;  4O5B A;  3E9O A;  4KV8 A;  2P9S A;  4CJK A;  4B9U A;  1KSP A;  3N4Q A;  2YHA A;  2ZJR L;  1WSE A;  4MDB A;  4CJR A;  3LP2 A;  5AQH A;  4AHC A;  1S1U A;  3OYJ A;  3MK6 A;  3CJ1 A;  4CGH A;  3J7Z O;  1KC8 O;  1MU2 A;  1VSJ A;  1HKC A;  1EKE A;  3VMF B;  4CGJ A;  3AY9 A;  1KLN A;  5EOY A;  3S3O A;  2OTL N;  2PZS A;  4E7H A;  3IMX A;  3ZSY A;  2DY4 A;  2YNG A;  5KPT A;  4JI8 K;  2P9P B;  2B6A A;  1BA1 A;  4BDZ A;  1QVG M;  4DV4 K;  5HP1 A;  2HVI A;  4DV2 K;  2IVP A;  2Q36 A;  4H0X B;  4O55 A;  1HYZ A;  4CHQ A;  4FJ5 A;  2O8E B;  1BCM A;  3VES A;  4PWD A;  4BRF A;  3L0Q A;  5CHI A;  2FSN A;  2P9U B;  1KVA A;  1VQN N;  1HMV A;  5BN8 A;  4Y0W A;  4CW7 B;  3MMV A;  1HNV A;  3VQA A;  1T03 A;  4IO8 A;  1NK5 A;  1BGX T;  3PUF A;  2VQE K;  3VA0 A;  1E4F T;  1K8A O;  4CJL A;  4B08 A;  3ZSQ A;  1WAF A;  1HKB A;  2QM1 A;  4FM2 A;  3H1Q A;  2NRR A;  3CCE N;  3VQB A;  3CJA A;  3H08 A;  4CZI A;  3G25 A;  3O5B A;  5C10 A;  3OYB A;  4CJW A;  1NGG A;  4DTR A;  3U9D A;  3HL8 A;  2A1S A;  4MLE A;  3OYL A;  1NK8 A;  3CCV N;  2KHO A;  1X1P A;  4CD3 A;  3DXM B;  4J2B A;  5C24 A;  1EWR A;  3AV9 A;  1F21 A;  3VA3 A;  4KB0 A;  1WSI A;  2HF4 A;  1RDW X;  2VQF K;  3SI6 A;  1G15 A;  3M6G A;  4JLH A;  1ZBI A;  4JKE A;  2QEX N;  1TKX A;  3RMD A;  4M63 C;  5JIC A;  2VYP A;  2P1J A;  4BRA A;  1GLJ O;  1HPM A;  1XWL A;  2IVO A;  1S1T A;  3AA4 A;  3HST B;  4BRG A;  1LOT B;  3V6D A;  5J2M A;  2G8K A;  1ESV A;  1BI4 B;  1DT9 A;  4LH4 A;  3OYE A;  4DU4 A;  2CH6 A;  3HK2 A;  5KQ8 A;  3M8Q A;  3V1R A;  3WEE A;  3O3G A;  3TAP A;  5AQL A;  3DLK A;  1ASV A;  3RRG A;  3F2K A;  4KKO A;  1OH8 A;  4IOA L;  3OYI A;  3EEQ A;  4WQ4 C;  4PHT X;  4DMN A;  1OVY A;  2ZJP L;  3EY1 A;  3C94 A;  1GLF O;  1U2V A;  4WF9 L;  5AQG A;  3VQ4 A;  3QEV A;  3WNF A;  4FLY A;  1C0F A;  4M7Y A;  5HRP A;  3AVK A;  3TAR A;  4O0J A;  2E20 A;  2VWK A;  3L2R A;  4FK2 A;  4DKW A;  3QO9 A;  4CES A;  5F2R A;  4CK2 A;  5D3G A;  4CZJ A;  2RN2 A;  4JNE A;  3QER A;  5CY4 A;  4JI4 K;  4A2A A;  4V19 S;  3MXJ A;  3DLB A;  2F9T A;  1WAJ A;  4KTW A;  2ASP A;  3AGR A;  3VQC A;  4Q5V A;  4FOI A;  4AHT A;  3QEX A;  4CF0 A;  2P9L A;  4JI2 K;  5GIN A;  3Q7C A;  3UB5 A;  4KHN A;  3LDL A;  3CFP A;  1D9D A;  4RW6 A;  4N76 A;  1L3S A;  2YX6 A;  3QB0 A;  3F73 A;  5GIP A;  3V9Z A;  1RDD A;  2JWK A;  1NM1 A;  4F3O A;  4RW7 A;  4CJ5 A;  3ZSV A;  1XMO K;  1YIT N;  2OPQ A;  1N36 K;  3LAN A;  2QWL A;  3R3L A;  3QBX A;  1QSL A;  4OGC A;  2GV9 A;  4OPA A;  4DLE A;  2Q97 A;  4BC2 A;  3J81 O;  5TKW A;  1BWF O;  2D5R A;  3LP1 A;  2EHG A;  3RRH A;  1SKR A;  4CJS A;  2X74 A;  4DCH A;  1C1C A;  3AVI A;  3HXM A;  4FJX A;  3S3N A;  1TAQ A;  3AAP A;  5JLH A;  3ZX3 A;  3HPO A;  1NJW A;  5E26 A;  1RDC A;  4LFB K;  3NCI A;  4FK0 A;  4EP5 A;  1YVU A;  1ATR A;  2KQ2 A;  2CGL A;  3B8A X;  4RTF D;  1DTQ A;  5FPM A;  3AO3 A;  1QHT A;  2HBK A;  1X9M A;  3CQY A;  3SK3 A;  3K0S A;  4H03 B;  1IG9 A;  2HHV A;  3VN5 A;  3LAK A;  3VEV A;  3MXI A;  2DPN A;  2X78 A;  2Z1H A;  4BE0 A;  2NRH A;  3CER A;  1NMD A;  3O80 A;  4DF4 A;  3CYM A;  3LDO A;  3EE9 A;  4E1J A;  1HNW K;  3CC7 N;  3U4L A;  1W97 L;  2OAN A;  2F4V K;  4O8K A;  3HVR A;  1BG3 A;  1WNS A;  3PSI A;  2B5J A;  2F96 A;  1NOY A;  3KD5 E;  4ISE A;  1XUP O;  1VK0 A;  3AAR A;  3EE8 A;  1D8Y A;  4NYF A;  2OA8 A;  1KFD A;  4A5A A;  3PX4 A;  2CGK A;  4BVO A;  3ZEU A;  3QFU A;  3SQ2 A;  3CC4 N;  4KI6 A;  3VQD A;  1RT3 A;  1CZA N;  1IBK K;  1HRH A;  4HUG A;  4A59 A;  3JSM A;  5M1F A;  3VQE A;  4K43 A;  4FJH A;  3MN6 A;  1A5X A;  1S3X A;  1N32 K;  1VSH A;  2HB5 A;  3KJV A;  3KD1 E;  3VTH A;  4CZL A;  4BQZ A;  2FSJ A;  4B9V A;  1C0G A;  4K0K K;  4ILG B;  5AQF A;  3W0L A;  1JL2 A;  3CET A;  4LF6 K;  4RCH A;  4NB4 A;  3VQP A;  4DSL A;  3I55 N;  3JXU A;  5CE3 A;  4JKG B;  3QET A;  1BQN A;  4H5W A;  3KKS A;  1YI2 N;  2NNW A;  1VRU A;  1V4S A;  4B8C A;  1EO1 A;  5K14 A;  2OYQ A;  3WNG A;  4HTU A;  5BRF A;  4DR3 K;  3LDS A;  1LWF A;  2XY7 A;  2G8F A;  4JI3 K;  1GLE G;  1WBB A;  3VTI A;  5M1Q A;  3A8Y A;  3QIO A;  3ZET A;  3AO4 A;  3SLC A;  2NRW A;  3H3N O;  1N33 K;  4JK9 A;  2KFZ A;  3O9U A;  1NMN A;  4JN4 A;  3VGM A;  1T6D A;  1UA1 A;  4A62 A;  4E7I A;  4BG9 A;  3G6E N;  4RG8 A;  4J8F A;  4YFU A;  3FZM A;  1NGF A;  1QSS A;  3Q7B A;  1TYQ B;  2WFB A;  3F5T A;  2HHT A;  3O8M A;  3CFO A;  4EFH A;  2P9N A;  1LCU A;  2BGG A;  1VHX A;  3IRX A;  3O3F A;  3WXJ A;  1RTD A;  4LF5 K;  1TKT A;  2QKK A;  3JYT A;  3NF8 A;  4BRE A;  4DU3 A;  4R79 A;  4K41 A;  4IG0 A;  4KO0 A;  1RBV A;  5GAH P;  3LZJ A;  4BGB A;  2VWJ A;  3O9S A;  1T44 A;  3C7N B;  1HNX K;  1T6C A;  4CD1 A;  1W2B M;  1Q81 O;  1A5V A;  3MEC A;  3SJH A;  2W40 A;  3A2F A;  3U3G A;  4Z4C A;  2P5O A;  2PFU A;  4CJV A;  4H5V A;  5M1K A;  2WON A;  1IKY A;  4FWS A;  1YJ9 N;  3H46 O;  4OGE A;  2E6L A;  1K73 O;  4PY5 A;  3CJB A;  4DHY A;  4OJR A;  4EHU A;  1BI4 A;  4M3T A;  1HX1 A;  4UY8 O;  3AVM A;  3THX A;  1W0H A;  3IKM A;  3TSU A;  2G8W A;  4KH4 A;  3O4Q A;  4BC3 A;  3BY5 A;  3E01 A;  1KFS A;  1M90 O;  4GVE A;  1BQM A;  3CME N;  2H3G X;  4BRN A;  4BRD A;  2B4J A;  4CZH A;  1X3N A;  4F4K A;  3WXK A;  3GOI A;  4NCA A;  4FZZ A;  3D0P A;  2A40 A;  4FM0 A;  4E7L A;  1IKV A;  5HOO A;  1QHA A; 
#chains in the Genus database with same CATH homology
 5IT9 O;  4JI7 K;  4JYA K;  4LF8 K;  3J80 O;  3JAM O;  1HR0 K;  1I94 K;  4B3M K;  4DR3 K;  1HNZ K;  4JI3 K;  4LF4 K;  5A2Q O;  4DV7 K;  5AJ3 K;  4LFA K;  4YY3 K;  4GKJ K;  4B3T K;  4GKK K;  4LFB K;  1N33 K;  4JI8 K;  1XNR K;  4JI6 K;  4DV4 K;  4DV3 K;  4YHH K;  4DV2 K;  2E5L K;  4X64 K;  4LF7 K;  2UUA K;  1IBL K;  4NXN K;  4B3R K;  3OTO K;  1XNQ K;  4LF5 K;  3J7Y P;  4LF9 K;  4CW7 B;  4DR5 K;  4OX9 K;  5BR8 K;  1FJG K;  4DR1 K;  1HNW K;  4DR7 K;  5LL6 Z;  2VQE K;  4JI5 K;  2F4V K;  2UUB K;  1HNX K;  4DV6 K;  2UXD K;  4DR2 K;  4JI1 K;  4JI4 K;  4V19 S;  4DR6 K;  4DUY K;  2UUC K;  4B3S K;  1IBK K;  4JI2 K;  4X62 K;  4NXM K;  4JI0 K;  4KHP K;  4DV1 K;  2UXB K;  2ZM6 K;  1N34 K;  1N32 K;  3T1Y K;  4CVN E;  4DR4 K;  3J7A P;  1IBM K;  2HHH K;  4K0K K;  4X66 K;  4LF6 K;  2VQF K;  4AQY K;  4X65 K;  1XMQ K;  2UU9 K;  5FLX O;  1XMO K;  1N36 K;  3T1H K;  4LFC K;  5IWA K;  5LMN K;  4DV5 K;  4DUZ K;  3J81 O;  1J5E K;  4DV0 K;  2UXC K;  4JV5 K;  5LMU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...