1WSHA

Crystal structure of e.coli rnase hi active site mutant (e48a/k87a)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
148
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVHPENERCDELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
source organism Escherichia coli
total genus 43
structure length 148
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wshA00
4CF8A 3NH1A 3C95A 1C1CA 4G1QA 1B92A 2DFHA 2B5JA 3CFOA 4I2PA 4IG0A 1NKBA 4J2EA 4FZXC 3DRRA 3DLGA 1BIUA 4DLEA 3TR8A 2P5GA 4EP5A 3LP0A 2E4LA 5KRTA 3L3UA 1B9FA 1KVAA 4NYFA 4Z4CA 4FM0A 3TAEA 4IDKA 1ZBFA 1U47A 1Q9YA 1UA1A 2KZZA 1FXXA 3RR8A 3LZJA 3K58A 1NJYA 1IKWA 1FKPA 3AVNA 3O4QA 3MEGA 3QEWA 3K2PA 3MEEA 4FJJA 4FJNA 4FK0A 3B6PA 4QCLA 2IS3A 3DRPA 2IGIA 4E0DA 3V81A 1IH7A 2HHUA 2JLEA 3NGIA 3V9UA 4W5OA 4M3RA 1KFSA 3O4NA 3HXMA 3V6DA 2X74A 3ZT2A 3VQPA 4DTNA 1JLBA 4CFAA 3OYFA 3MAQA 4FLYA 2IAJA 3RRGA 1JL1A 3PX6A 1KVBA 1J5OA 1RDAA 4CJLA 4FXDA 3L8BA 1YTAA 3AO2A 4MQ3A 1X9SA 2G8KA 4BE1A 5CYMA 4F8RA 2O4IA 4CGDA 1U45A 1RNHA 1NK9A 4B9SA 4KREA 4CK2A 4RW8A 3LP1A 1WNSA 2F96A 3AVIA 3SQ0A 1ZBIA 4E7IA 3VQBA 4CHNA 1GOCA 4DS4A 4CJ5A 1CXQA 1HQUA 3CG7A 3OY9A 1Z26A 3WNGA 1FKOA 2YNFA 3AA4A 3AVKA 2ZE2A 3MXJA 4RW9A 1C6VA 4CJKA 4EP4A 3QO9A 4KKOA 4YFUA 3KK1A 3SUOA 4DTSA 4AHSA 1L3VA 1WSHA 3NF6A 4FCYA 3SUPA 4FJLA 1YTUA 3KLGA 3LDSA 3NH2A 1NK7A 1SV5A 1YT3A 1SUQA 3QEVA 1EX4A 4DSJA 1ITGA 4M41A 1X9WA 3SJJA 1QSYA 4CCHA 3K57A 4JLHA 1VSFA 2Y1IA 3KLIA 5C24A 3ZSZA 4BDPA 2BANA 3VQ5A 4CJ3A 1HNIA 4OGCA 2XO7A 3D0PA 2HHTA 3KLHA 3HL8A 1NOYA 1WAJA 4B8AB 1NJZA 4CEQA 1NJWA 4J2DA 3OYLA 5EU7A 3G0ZA 2QK9A 4OKJA 4KTZA 4HCBA 1C0TA 3OJSA 4Z4HA 2E6MA 2RKIA 3G10A 2DTUA 3SZ2A 1RCHA 4CF1A 5KI6A 4O44A 3OYAA 1ASUA 4CECA 3ZT1A 5FDLA 4DSFA 4CJ4A 5KTQA 5FROA 4IKFA 4FLTA 1VSIA 4TSXA 3T1AA 4XIUA 4ELVA 4KB1A 5C42A 2DFEA 3TARA 4RG8A 1N5YA 1RT5A 1VSLA 2LSNA 4CGIA 4EZ9A 1IG9A 4CFCA 3AA2A 4KAZA 4OLBA 4CJEA 4ZHRA 5E41A 2BGGA 3NF7A 3M8RA 4BE2A 3PX0A 2DFFA 4O4GA 2X6SA 5CYQA 3VQ8A 1IKXA 3HK2A 1TK0A 5FRMA 2QXFA 3AVJA 4F3OA 1HPZA 1TL3A 1YVUA 1QHTA 3TAMA 4J2AA 1IKYA 2D5RA 3EZ5A 3OVNA 1C0UA 4PWDA 2Z1JA 2B4JA 3PO4A 2ETJA 3ASMA 4LH5A 4MFBA 1KTQA 3QNOA 2KTQA 1QS4A 4AHUA 3AO3A 3NF9A 5KGXA 3K5NA 3LPUA 3U6FA 3QEPA 2HNDA 3OJUA 3NE6A 1ASWA 2HNYA 3L3VA 3RMBA 3HYFA 2PYLA 4KB0A 1RT3A 4DTMA 4DF8A 3DOLA 3VA0A 1NK0A 4DSKA 3JSMA 3OS0A 2OA8A 1JLAA 5CY4A 4LSLA 2X78A 1C0MA 3WNFA 4KTQA 3WNEA 1VSHA 1BCOA 3T19A 1KLNA 1LAVA 4FK2A 1BQMA 2HNZA 2HMIA 1RTDA 3V9SA 2PY5A 3PUFA 1KVCA 2GV9A 1ZBHA 2W42A 5FRNA 3LALA 3K59A 3V9ZA 1VK0A 3L2VA 1S9GA 1X9MA 1XWLA 2EX3A 3ZT4A 3OYHA 4CHPA 1F21A 1W0HA 5C25A 3L2QA 4JS4A 5I42A 3TWHA 2P5OA 4ID5A 2XY7A 3S9HA 3S3MA 1D9FA 2Z1GA 2DY4A 3S3NA 2E6LA 3S3OA 4FLVA 5T7BA 4E7LA 2HVHA 5HRPA 4ZTJA 3TI0A 2YKNA 1S1VA 3SQ4A 3CYMA 1EXQA 4KHWA 1RT7A 3QIOA 1MU2A 1U48A 1KFDA 2BE2A 3IRXA 4FLXA 3FFIA 4FW1A 3QEIA 1D9DA 2D0BA 3HPGA 1SKRA 1JXBA 1T05A 3PO5A 3E01A 4Z4GA 5HROA 1HQEA 3MECA 3ZSWA 2KW4A 2HHQA 1I3AA 3B6OA 1HYZA 1T8EA 3LP3A 2BDPA 4FYDA 3PY8A 4DF4A 2Z1HA 4FJMA 4DQSA 4Y1DA 3DLEA 4CF2A 2ITGA 4KV8A 4LY7A 5HRSA 2ZQBA 3CFRA 3I0RA 4PQUA 4C8NA 1B9DA 1HNVA 5HLFA 3JYTA 3MXIA 3RRHA 4M42A 3O3GA 4CJPA 4IFYA 4LD0A 1DTTA 1WLJA 3SQ1A 1S1XA 1REVA 3HPHA 3NGYA 5SWMA 1TKDA 3CQ8A 4ELUA 3QESA 1U49A 3TAQA 1BCMA 3V9XA 1VSKA 3T3FA 1Z25A 3EYZA 3CM6A 3P1GA 3DLKA 3F73A 1CZBA 1UOCA 2XRIA 4DMNA 5SZTA 4BDZA 1WSIA 4FLWA 1UA0A 3QERA 3TABA 4Z4IA 1ZYQA 1DTQA 4UQGA 5K14A 4FLZA 4AH9A 2OPRA 4FK4A 3DLRA 4N5SA 4BE0A 1TV6A 2ATQA 4OPKA 1D5AA 3OYGA 4E7JA 4BDYA 4E1NA 3QNNA 2NUBA 3HVTA 4Z4FA 3AVGA 2OPSA 3KTQA 2P51A 4F3TA 3IAYA 3SPYA 4FZYA 1RT4A 4OVLA 4QOZB 3AVAA 1WSEA 3LAMA 2XY5A 4C8LA 1QTMA 3OYKA 4F4KA 1R0AA 5CZ1A 2FBXA 4OGEA 1EETA 1W9HA 3IS9A 4O5BA 2RN2A 4CJVA 5JS1A 3MXMA 4ELTA 1LW0A 3O3HA 3DI6A 4JRQA 1RDDA 3DOKA 4GVMA 1A5WA 1RDBA 1S5JA 4NCGA 3NAEA 1NK4A 4C8KA 4CK1A 1CZ9A 4CF0A 1S6PA 1Q8IA 1IO2A 1QSLA 1S9EA 3VQDA 4EZ6A 4M3WA 3ISNC 3LANA 1U4BA 4DQQA 4N56A 3LWLA 4KHNA 1RTIA 4LH4A 3ZSRA 3ZSYA 4CJUA 1HRHA 4FJ5A 4F2SA 3DRSA 2YHAA 2YKMA 4CEEA 3U3GA 4E7HA 4DQRA 3KLEA 3VQEA 1L3TA 3K5LA 1RBVA 3LPTA 3PX4A 3OYEA 4I9LA 2YNIA 1GOAA 4Y1CA 4DLGA 1S6QA 2G8HA 4DSLA 2G8WA 4KI6A 3NDKA 1C1AA 4DU4A 2AJQA 4YNQA 1EP4A 1K6YA 4CEFA 3K5OA 1NK5A 2G8FA 4I9QA 2D0AA 3AO1A 1VSDA 4OKEA 4BWMA 4DU1A 2HW3A 4CE9A 4FJ9A 2R7YA 3V4IA 4CEBA 2A1RA 3VQQA 4N76A 2QKKA 1XI1A 3MEDA 1S1WA 1UAXA 3H08A 4CJQA 3RR7A 1FK9A 1HMVA 1HYVA 4W5TA 1LAWA 4B9UA 2KZMA 4CHQA 4FJXA 4Q0BA 3P5JA 4E7KA 4FJGA 1TK8A 1N6QA 3SV4A 1BL3A 4K8ZA 4HVJA 3ZCMA 1VSMA 5KRSA 4N41A 3AVCA 4M45A 4ICLA 4CIGA 4CHOA 3L2UA 2O4GA 2IC3A 3QINA 4HUEA 1NK8A 3L2WA 4DQPA 4FZZA 4H8KA 4CGGA 1T03A 4CFBA 4Z4EA 2Q3SA 1QQCA 4CGHA 3KKRA 1ASVA 1JLCA 4QAGA 4BWJA 3IG1A 4CFDA 3HP6A 2OZSA 4NCBA 2VWKA 3V1RA 3WNHA 4CERA 3RMCA 3KJVA 1U04A 2FC0A 2OYQA 1C1BA 1JL2A 1BI4B 1JLFA 4KHUA 2FBTA 4DSIA 3SQ2A 4B9MA 3QLHA 2RF2A 4BACA 1TL1A 3P83D 4FM1A 5KGWA 2G8VA 4M3TA 1GOBA 3DYAA 2GUIA 4CEDA 3KLFA 4ID1A 4DFMA 1HJRA 3HJFA 3SYZA 1NK6A 3KKSA 3OYIA 3ZT0A 4DFKA 3BGRA 1TK5A 1Y97A 4DTOA 3BDPA 3F9KA 4B9TA 3TANA 3OYBA 1JLGA 1WSFA 4RW4A 4CIFA 4CJRA 3OYCA 1G15A 1WSJA 4O0JA 3DMJA 1TAQA 2PZSA 2IDOA 2I5JA 2WOMA 3C94A 4ZTFA 4KHSA 4WE1A 5HBMA 3L2RA 3V1QA 3ITHA 4O0IA 3SPZA 3M8PA 1HYSA 1TKXA 3OYMA 1SKSA 1SL1A 4OJRA 1NJXA 4GW6A 1T7PA 3OYJA 1BHLA 4FJ7A 4KHQA 1CXUA 1LW2A 4AHRA 3VQ6A 1RT2A 4DTXA 3OS1A 1BIZA 4H4OA 2GBZA 4HTUA 5JS2A 4KPYA 4OLAA 3VA3A 3LP2A 3LWMA 3TAGA 4CEAA 4F2RA 1BGXT 3M8SA 4PA1A 4J2BA 2VG7A 2YHBA 3VQ7A 4FJ8A 2YNGA 1RILA 3VQAA 4OPJA 3ZT3A 4W5NA 4KRFA 1CLQA 3NF8A 4B9VA 2Z1IA 4CF9A 5I3UA 5D3GA 2F8TA 2KQ2A 1EKEA 1SL0A 4CESA 5HP1A 1J54A 3VQ4A 1RBRA 4Q5VA 4HUFA 4DFJA 4C8OA 2OPPA 3RWUA 3QIPA 3SUNA 3O3FA 4FVMA 4DQIA 1VSJA 2OPQA 2P1JA 4Z0UA 3SV3A 4CJWA 4DFPA 4KTWA 4C8MA 4M3ZA 1KLMA 1VRTA 2QKBA 3V9WA 3DLBA 4B9NA 4KI4A 4FJIA 3NCIA 4E89A 1LWCA 1NOZA 4IG3A 3SNNA 1L3UA 4OKKA 4HUGA 3EY1A 3PV8A 1WAFA 3U3YA 1BISA 1Q9XA 1BQNA 1NKCA 2EHGA 4CHZA 4PUOA 3VQCA 3DM2A 1KRPA 1ZBUA 2ZD1A 4AHVA 3HPOA 1RTHA 1RBSA 3ULDA 2RPIA 3V1OA 3NFAA 1LWFA 4KHYA 1O1WA 1TVRA 4FW2A 4DG1A 2XHBA 4E19A 4DS5A 4IBNA 1TGOA 4NCAA 3VN5A 3D45A 2OZMA 1RBUA 2A1SA 2VG6A 4PY5A 1DLOA 3KD5E 3ZSXA 3KD1E 4LSNA 3NBPA 3OYDA 3KK3A 1TKTA 3ZSOA 3OS2A 1QSSA 5DK5A 4B3OA 3ZSVA 2JGUA 2FBVA 3AO4A 3C6UA 3NGZA 1KSPA 3C6TA 2G8UA 3I0SA 4HHTA 4CGJA 2D0CA 4DWIA 3NH0A 4CGFA 4NYNA 3HO1A 1TAUA 5J2PA 1XHXA 2F8SA 4I2QA 4GMJB 3KK2A 3A2FA 1VSEA 4W5RA 3CM5A 4AILC 3AA5X 1J53A 1JLEA 4FJHA 2HB5A 4JS5A 4KFBA 3HVRA 3SI6A 1WSGA 4RW6A 3AVFA 3I8DA 1XHZA 1SL2A 3AVMA 4FJKA 5HRRA 3RMAA 1LWEA 4B08A 4R5PA 3HT3A 1LV5A 2KFZA 1JKHA 1S1TA 1VRUA 4CJTA 4FM2A 3TAFA 5J2MA 3HP9A 1L5UA 2KFNA 2XY6A 1KCFA 2YNHA 3ALYA 4W5QA 4FLUA 3AV9A 3LZIA 4CHYA 4E3SA 1A5XA 4RW7A 3K5MA 1RDCA 1SKWA 1UWBA 4DTPA 5DMRA 5HRNA 1XC9A 1RBTA 1S1UA 3AVLA 2FBYA 5J1EA 1RT1A 4AHCA 4DTJA 2X6NA 1TKZA 3SUQA 3DLHA 2WONA 3AVHA 4O55A 1X1PA 4H4MA 3QETA 1QE1A 4N47A 1L3SA 3SCXA 3HSTB 4CK3A 1RT6A 4CJSA 3RTVA 1NKEA 4M3XA 4M3UA 2XY8A 4I7FA 4AHTA 2HHXA 3VQ9A 3HM9A 3UIQA 4B9LA 2PYJA 2VG5A 4HCCA 1J9AA 1IKVA 3AO5A 4CIEA 5J2NA 4B8CA 4M3YA 1WN7A 3CFPA 4CEOA 1JLQA 1ZBLA 3ZSQA 4KO0A 2VWJA 1I39A 2YV0X 4DSEA 3QEXA 5J2QA 4L8RB 4E1MA 1A5VA 3NHGA 4K8XA 2G8IA 3LAKA 2HHSA 3AVBA 3THVA 3OYNA 4DU3A 5CZ2A 3KIOA 4CJFA 4DTUA 1BI4A 4JRPA 4CEZA 1RTJA 3RMDA 1JXEA 2B6AA 4IFVA 4DTRA 2HVIA 3M8QA 3AA3A 2HHVA 2Y1JA 1D8YA 2IOCA 3TAPA 2HHWA
chains in the Genus database with same CATH superfamily
4CF8A 5JMVA 3MN7A 2B5JA 4IEIA 1MA9B 1WBBA 2E20A 3LP0A 2D0PA 5KRTA 3L3UA 4FM0A 1KVAA 3TAEA 4IDKA 1ZBFA 2ASMA 1HKGA 3K2PA 1I94K 3B6PA 3SBGA 2IGIA 3CD6N 4JI0K 4M3RA 1KFSA 4GV9A 3ZT2A 5IWAK 4GV3A 3PX6A 1KVBA 1RDAA 4CJLA 4FXDA 1ZBSA 3L8BA 2P9NB 4FWOA 4JD2B 1YTAA 1VAZA 3AO2A 4MQ3A 2O4IA 4CZGA 3NMUA 1ILYA 4B3RK 3SMSA 2P9NA 4G9ZA 1GOCA 4DS4A 3R6MA 2YNFA 4IWVA 3AVKA 3LM9A 1C6VA 2YX6A 4EP4A 3SUOA 3NF6A 5TKYA 3SUPA 4GVEA 3AGRA 1NK7A 1SV5A 1EX4A 2NRTA 4M41A 4CCHA 2KLAA 3K57A 3KLIA 4YDUC 1DEJA 4JI3K 2BANA 5BPNA 4GY2B 4OGCA 4LF4K 3JXUA 3LDQA 1WAJA 4B8AB 2Q31A 4FWLA 2QK9A 4FWRA 4BRKA 4CI6A 2GEMA 3OA9A 4HCBA 2E6MA 5BR8K 1QQOA 4LC9B 4O44A 4JI1K 4BC3A 1KQSM 5FROA 4WQ5C 2O8EB 4A57A 4JK8A 4CFCA 3AA2A 3NVMA 4KAZA 3THYA 3M8RA 2ZGYA 3VQ8A 4BR7A 4X64K 1TK0A 1TL3A 1YVUA 2O8EA 3QDKA 4JI6K 1Q7YO 3UKUB 3PO4A 5BR9A 4MFBA 1KTQA 3AO3A 3NF9A 3K5NA 4BC2A 3NE6A 1ASWA 3L3VA 4JKGA 3GL1A 1NK0A 2Q97A 1VQ5N 5CY4A 4LSLA 1C0MA 1OKJA 4DV0K 1LOTB 1KLNA 3ZX2A 4IO8A 4FK2A 1BQMA 2HNZA 2ASPA 2PY5A 1ZBHA 2GV9A 3E66A 3LALA 3TTDA 3V9ZA 1U6ZA 3BZCA 1S9GA 1NWKA 4CHPA 1F21A 1YHQN 4ID5A 2XY7A 1D9FA 2DY4A 3ENOA 3S3NA 2E6LA 3S3OA 3O1WA 5HRPA 3BY5A 2YKNA 1VQ6N 4EHTA 5AQZA 1EXQA 4KHWA 4BRIA 2VQEK 2O8BA 4Z4GA 3AGKA 3VMFB 1YXQA 2KW4A 2HHQA 3B6OA 5KPZA 1HYZA 3LP3A 4DF4A 3AY9A 2NRHA 2QA4N 4GKJK 3VEXA 3TSPA 4KV8A 4LY7A 4CZEA 2UUCK 3W0LA 3FGUA 4M42A 3O3GA 4LD0A 5AFUA 3HPHA 2OCEA 3QESA 3V9XA 1NG9A 1RGIA 4DMNA 5SZTA 1UA0A 3QERA 1DT9A 2IIRA 1TV6A 3RSEB 4E7JA 5C0YA 4E1NA 1V4SA 2NUBA 4Z4FA 3J80O 4K25A 3T1HK 4F3TA 4WCEL 3SPYA 1VHXA 3AVAA 3RSEA 5E84A 2FBXA 1EETA 1XNQK 5BPMA 3QB0A 4O5BA 4GV6A 5JLHA 1LW0A 1NGGA 3DI6A 3EN9A 3THXB 1QSLA 3HZ6A 2VGNA 1U4BA 3GBTA 1NGEA 4LH4A 4IZ9A 4F2SA 4FJ5A 4JI7K 2Q1NA 4E7HA 3H45C 3VQEA 1S3XA 2GWJA 1RBVA 3OYEA 4DV4K 2G8HA 1GOAA 1C1AA 4DU4A 1YITN 4ISFA 5JVHL 4CEFA 3T7ZA 4A59A 4I9QA 4DU1A 4BWMA 3CJ1A 4CE9A 4FJ9A 1VQKN 3VQQA 2F9TA 4DR3K 4BGAA 1UAXA 3H08A 3RR7A 4W5TA 1HYVA 1LAWA 4FOEA 4CVNE 3P5JA 4MO5A 2E1YA 5KQDA 4DSJA 4CHOA 4HUEA 1NK8A 3HTVA 3L2WA 1P8ZA 4CFBA 4CW7B 4CGHA 3IG1A 1EWRA 2WUSA 4H5NA 2VWKA 5AQQA 4H5TA 2NRVA 5BREA 4B9MA 3QLHA 4BACA 1TL1A 3VERA 4YOWA 1M1KO 4DHYA 3BP8A 4ID1A 4CZLA 3THWA 2HMPA 1NK6A 4BVOA 4BRAA 3AAPA 4DTOA 4IOCL 1HX1A 3BDPA 4HWIA 4B9TA 3OYBA 4H5WA 2YJFA 4RW4A 1WSJA 2P9KA 1TAQA 2PZSA 2WOMA 3L2RA 5HBMA 3O8MA 3CF5L 3SPZA 3M8PA 1HYSA 1SL1A 1NJXA 3OYJA 3IMXA 3VQ6A 1RT2A 5DM6L 3P31A 1BIZA 4H4OA 3WEEB 4KPYA 5JS2A 3VA3A 3ENBA 4F2RA 4XEIA 3M8SA 4FJ8A 4H0VB 5KPTA 5MLCQ 2YNGA 1RILA 3VQAA 3ZT3A 4W5NA 4BRQA 4KRFA 5KPRA 1CLQA 1IJJA 5D3GA 4JKAA 1N8RO 2KQ2A 1SL0A 3LM2A 5HP1A 1J54A 3SJHA 5AQSA 3RWUA 3QIPA 3J7YP 4DQIA 1H1VA 2P1JA 2J4RA 2QWPA 3SV3A 4CJWA 4CJ7A 2ZJQL 3DLBA 4B9NA 2HOEA 4E89A 4HUGA 1SQKA 1SAZA 3PV8A 3U3YA 1BQNA 5LY3A 4X62K 4CHZA 4PUOA 1C0FA 1ZBUA 2ZD1A 5AQOA 3H1QA 3FZKA 3A8YA 1V4TA 2V7ZA 4DG1A 1W97L 3QFUA 4XH4A 5JICA 3EE9A 2OZMA 3I8BA 1DLOA 3KD1E 1NGDA 3OYDA 1JCEA 5BN9A 4K42A 3HO1A 4CGFA 2NRZA 1XHXA 3J7ZO 4CZKA 3MX2A 2P9PB 5C12A 3KK2A 3A2FA 4W5RA 4DR4K 4FJHA 4FWSA 3EEQA 4KFBA 3LDNA 5CR4A 3HVRA 4RW6A 3AVFA 1GLFO 3D2FB 1SL2A 3RMAA 3HT3A 3HP9A 2XY6A 4W5QA 4E3SA 1G99A 4DTPA 3D2FA 1QQMA 3SUQA 1TKZA 5FPEA 3DLHA 1X1PA 3QETA 4JHDB 2IVOA 3H1VX 4M3UA 4B1VA 4CJSA 4M3XA 2XY8A 3WXMB 1J5EK 5AQFA 4CZIA 4DR2K 3SLCA 1KAYA 4PKGA 1WN7A 2GTDA 1EO1A 1KXPA 4CEOA 5EVZA 4JHDA 3WXLA 3ZSQA 2VWJA 1I39A 2YV0X 2CGLA 4DSEA 4L8RB 2G8IA 3LAKA 1QZ5A 3AVBA 4FO0A 2UXCK 5CZ2A 4DTUA 3CCEN 1BI4A 4CEZA 3RMDA 2E2NA 2I7PA 3CJAA 1NGCA 3AA3A 4FSVA 5M1FA 3O9UA 2IOCA 5CHIA 3C95A 3CCQN 2DFHA 4J2EA 4IG0A 3CJBA 3DRRA 1BIUA 3J81O 4DLEA 5ELZA 1OVYA 3U8XA 4LF9K 3ATUA 1B9FA 4NYFA 4Z4CA 2O8FB 4DKWA 1U47A 1Q9YA 3RR8A 3K58A 2A42A 3AVNA 3O4QA 4FJJA 3MEEA 1XQSC 4QCLA 2IS3A 3DRPA 3M5RA 5GINA 4DV7K 2JLEA 3NGIA 3V9UA 3V6DA 2O8FA 3VQPA 4BR0A 3OYFA 3MAQA 4LFAK 1HR0K 2P9LB 2YCHA 1E3MA 3PSIA 3LDOA 4WQ4A 4DR5K 1OVQA 4RW8A 1GLAG 2BUPA 2F96A 3SQ0A 3EKSA 1BA1A 4CJ5A 1CXQA 4BR2A 3P39A 1FKOA 2ZJPL 2HHHK 4B3TK 1T6DA 4C1NI 5I9EB 4MDAA 2HSTA 3KK1A 3C0BA 4YFUA 4DTSA 1L3VA 1WSHA 3KZBA 3NH2A 4BREA 2AA4A 1SUQA 1NGJA 4H0PA 1ITGA 1QSYA 3Q7BA 3SMPA 2Y1IA 4K43A 5C24A 3ZSZA 4BDPA 2FF3B 3VQ5A 4I6MA 3D0PA 3KLHA 3N4QA 1NJZA 4CEQA 1Q82O 4OKJA 4KTZA 3O9QA 5FPNA 3C7NB 4Z4HA 4U67L 4WFNL 4JKCA 3G10A 2DTUA 4CF1A 3CETA 3ZLJA 4CECA 4BRNA 5FDLA 4DSFA 3C7NA 4FLTA 3T1AA 1TYQB 5C42A 4RTFD 4RG8A 3SAFA 1VSLA 2W40A 4CGIA 2NRRA 4OLBA 2PAVA 4JAXA 2CGKA 3NF7A 4BE2A 1FW6A 5CYQA 5FRMA 1TYQA 3TAMA 4PHTX 1IKYA 3EZ5A 3OVNA 1NM1A 1C0UA 3E9OA 3O80A 1WUAA 3VEVA 3E9PA 3QNOA 3DLLL 1QS4A 3SAHA 5AQRA 3OJUA 1RT3A 1GLBG 4DF8A 1W2BM 3QFPA 2YHYA 3OS0A 2OA8A 4A5AA 3L4QA 4YOTA 3WNEA 3T19A 1XC3A 3DJCA 4KHPK 2HMIA 1IG8A 3A5MC 4JKHA 3V9SA 1RTDA 2ASOA 3PUFA 1Q86O 2W42A 5FRNA 3CMEN 4X65K 4BRLA 3OYHA 5I42A 4JS4A 1YF5L 3TWHA 2QW9A 2E88A 4O8UA 4HTLA 1VQNN 3M6GA 3SQ4A 1RT7A 5BPLA 3HOSA 2YJEA 3BZKA 3QEIA 2D0BA 3HPGA 3S41A 4PL8A 3PO5A 5HROA 3MECA 5AQVA 1I3AA 3PY8A 3VETA 4Y1DA 1K9MO 5GADP 5HRSA 4PQUA 1NGHA 2ZQBA 3CFRA 4C8NA 1B9DA 4JD2A 4CJPA 3JS6A 4IFYA 4KBOA 3SQ1A 1K8KB 1REVA 1TKDA 4IEEA 3CQ8A 4MLEA 1BWFO 1VSKA 4AM7A 2I7NA 3P38A 3CM6A 3WUHA 3DLKA 1CZBA 4BDZA 4FWNA 1WSIA 3F2KA 4Z4IA 3TABA 3LDPA 4CD3A 1DTQA 4MO4A 2OPRA 4N5SA 2ATQA 1D5AA 3HVTA 3N4PA 4FL9A 3KTQA 2P51A 2V51B 4QOZB 1RT4A 4IDHA 3LAMA 5AQXA 4C8LA 1R0AA 5AQKA 3KHYA 4ELTA 3O3HA 4B1ZA 3K0SA 4JRQA 3MCPA 3DOKA 1A5WA 1YAGA 1CZ9A 1S6PA 3VQDA 4BGBA 3MN5A 3ISNC 3G6EN 2QXLA 1RTIA 3ZSYA 3ZSRA 4CJUA 4M63C 4BRFA 2H3GX 3DRSA 1X3NA 3R8EA 3U3GA 3PIPL 1L3TA 3K5LA 4I9LA 2QTDA 4Y1CA 5JLFA 3NDKA 4YNQA 1VSDA 2HW3A 1BDGA 3V4IA 4CEBA 4N76A 2QKKA 1XI1A 3MEDA 1S1WA 1FK9A 1HMVA 2KZMA 1ESVA 4AQYK 4H0YB 1TK8A 1BL3A 1QZ6A 1VSMA 3AVCA 4M45A 4ICLA 4CIGA 1BO5O 2QWLA 2IC3A 4H8KA 1T03A 1YJWN 1ASVA 4QAGA 3UKUA 2OZSA 4O5FA 3V1RA 4CERA 4JI2K 3KJVA 1U04A 2OYQA 1K8AO 1JLFA 4JKDA 2FBTA 1XUPO 2RF2A 5KQ8A 4ISGA 3CJCA 3BF3A 3SYZA 3HJFA 3KKSA 3K9JA 4DFKA 1TK5A 1Y97A 3TANA 4A2AA 4CJRA 3OYCA 4GKKK 2CH6A 3RVCA 1SZ2A 4DR1K 4CZJA 3QBWA 1N36K 4OX9K 3OBWA 4O0IA 2V7YA 3DXMB 3CCVN 5AQGA 4GW6A 2O8CB 2HBLA 1NMDA 4FJ7A 4KHQA 1CXUA 4A61A 1NBWA 4KH4A 1WOQA 4DTXA 2P9SB 3OS1A 4OLAA 4HTUA 4CBXA 4ILHA 1O13A 3LP2A 3LWMA 2NNWA 4PA1A 3VF6A 3VQ7A 3R9PA 3WXJA 4CBUA 2Z1IA 4CESA 3VQ4A 3MWPA 4Q5VA 4HUFA 4C8OA 3OTOK 2OPPA 2ZGZA 1C0GA 3O08A 4FVMA 4Z0UA 2VYPA 4KTWA 1Y64A 1GLEG 3J7AP 1IV0A 4PL7A 1LWCA 4H03B 3ID8A 4OKKA 3NVKA 2ZWHA 1BISA 4DV2K 1K73O 1Q9XA 2QWQA 3VQCA 1KRPA 3O1BA 4FPAA 1RTHA 2UUBK 4KHYA 1TVRA 1D4XA 2XHBA 4IBNA 1MWKA 1NGIA 2A40A 2A1SA 3VGLA 2VG6A 4PY5A 2VQFK 3A5LC 3GG4A 3ZSXA 3NBPA 3KK3A 5DK5A 5BN8A 1KSPA 1GLJO 5J2PA 2KZZA 2O8DB 3OW2M 4GMJB 3E9LA 4AILC 3VEZA 3THXA 1J53A 3UKRB 2F4VK 2E5LK 1WSGA 4BRGA 4JV5K 2O8DA 3AVMA 4FJKA 4R79A 1LWEA 5LMUK 2KFZA 1S1TA 4KH5A 4FM2A 1L5UA 5J2MA 1KCFA 3FE1A 4WFAL 3LZIA 2ZF5O 1A5XA 1SKWA 3TTFA 2Q0UA 3OBYA 5DMRA 3U9ZA 4WFBL 3AVLA 5J1EA 1XMOK 3EKUA 4O55A 4H4MA 3T1YK 4N47A 3MN9A 1RT6A 4AHTA 1N33K 3VQ9A 4DUZK 2PYJA 1JJ2M 2VG5A 4M7XA 3AO5A 4CIEA 3CQXA 1EQYA 5J2NA 3CFPA 4KO0A 1OH6A 3ULEB 5J2QA 2UUAK 1QVGM 4JKBA 4CD1A 3KIOA 4DR6K 2B6AA 4IFVA 2HVIA 3ULEA 2HHWA 5A2QO 2HF4A 4B9QA 3NH1A 1C1CA 5AZIB 4OPAA 3DWLA 4FZXC 3DLGA 4EP5A 4JI8K 5AZJB 5AZIA 2FSKA 2JWLA 2RHKA 1FXXA 3HBTA 3LZJA 2QWNA 1NJYA 1IKWA 1FKPA 1SS6A 4YY3K 3MEGA 4IJAA 3QEWA 4FJNA 3ZEUB 3O5BA 3BEXA 4E0DA 3V81A 4PKHA 3O4NA 4WQ4C 3ZETB 1HLUA 1M90O 1IBMK 3WEEA 4DTNA 1JLBA 4FLYA 3RRGA 3ZEUA 3SBTA 4BQLA 1J5OA 5M1QA 3MCAB 2D1KA 1X9SA 2G8KA 2FXUA 4BE1A 5CYMA 4F8RA 3TTCA 4CGDA 1U45A 1BA0A 1NK9A 1RFQA 4B9SA 1WNSA 3AVIA 1VQON 3CCLN 4E7IA 3VQBA 2A3ZA 1Z26A 2YHWA 4CJKA 4KKOA 4FCYA 4FJLA 2AP1A 3KLGA 3LDSA 1NGBA 1YTUA 2KKZA 3QEVA 1OH5A 4JLHA 4H5VA 5AQYA 3ZX0A 4UY8O 3UB5A 4CJ3A 3H46O 2XO7A 2HHTA 1LCUA 1NJWA 1YIJN 3I56N 2RKIA 3FZFA 3J8AA 2P9PA 3SZ2A 3OYAA 3SK3A 5LMNK 2D4WA 3CERA 4CJ4A 4YOVA 3KVGA 3VEWA 5FLXO 1BU6O 1VSIA 4TSXA 3A5NC 4KB1A 3TARA 1TUUA 1N5YA 1RT5A 4CJEA 5TKWA 2BGGA 2DFFA 2X6SA 4BRDA 3HK2A 3AVJA 4F3OA 1HPZA 1QHTA 4PWDA 2Z1JA 2B4JA 4LH5A 1KD1O 2KTQA 2W6LA 3H6EA 3U6FA 3U9DA 2HNDA 2HNYA 4DTMA 3VA0A 2WBNA 5FPDA 4DSKA 3D6RA 3ZYYX 5CE3A 3JSMA 5F2RA 4JYAK 3D2EB 5M1KA 1JLAA 5LJVA 3G4SN 2X78A 3WNFA 2JWKA 2CH5A 2GX9A 2P9UB 1Z05A 3AARA 3CC7N 3IFRA 1LAVA 5M1NA 3DXKB 3EE8A 3MDQA 3K59A 1X9MA 2EX3A 3ZT4A 3C6HA 5C25A 3L2QA 2HBJA 3S3MA 2Z1GA 3I55N 4ZTJA 3TI0A 1S1VA 4IO9L 4IXCA 3CPWM 3VGKA 1MU2A 1MWMA 2QWOA 1U48A 4FLXA 1NMNA 4FW1A 4YOXA 5C15A 1SKRA 1T05A 1RDUA 1T6CA 4DUYK 1W7AA 3ZSWA 1T8EA 3ID6A 5EY4A 2BDPA 4FJMA 2Z1HA 4KH6A 3KWGA 2P9LA 4CF2A 4JEPA 4LF6K 1RDWX 3JAMO 3BUZB 5HLFA 3JYTA 3MXIA 3RRHA 3O9SA 1DTTA 1IBLK 1WLJA 3NGYA 5SWMA 3GOIA 1T3VA 4A5BA 1U49A 1BCMA 2A5XA 4B3SK 5EXWA 1Z25A 3F73A 2GUPA 2XRIA 4JKEA 4XH5A 4FLWA 3FR0A 4UQGA 5BRDA 4FWPA 3DLRA 4BE0A 3OYGA 3LDLA 4BDYA 3QNNA 4EFHA 1VQ8N 3HOTA 4NXNK 4V19S 3AVGA 2A6AA 3O6WA 3QBXA 3IAYA 4FZYA 4NLCA 1WSEA 3W3DA 1QTMA 3OYKA 5CZ1A 1U2VB 4JI5K 1W9HA 5JS1A 2RN2A 4CJVA 1RDDA 2YI1A 4GVMA 2PFUA 4NCGA 5GAGP 4C8KA 2VGMA 1NGFA 4LF5K 1IO2A 4EZ6A 1GLLO 1S9EA 4M3WA 4K0KK 4DQQA 3LWLA 2YHAA 4JI4K 3BF1A 3LPTA 2YNIA 3O9TA 5C2FA 3FZLA 2G8WA 4KI6A 4M7YA 2GELA 1HUXA 3G25A 1EP4A 2G8FA 2D0AA 3AO1A 4H0OA 4OKEA 3L6QA 2R7YA 2P9IB 4CJQA 5BRFA 4B9UA 4YORA 4B1XB 4Q0BA 4FJGA 2NRXA 4E7KA 1N32K 1N6QA 3SV4A 3CCMN 3L2UA 2O4GA 2P9IA 4DQPA 4CGGA 4WYBA 2WTUA 3HP6A 3ATVA 1JLCA 4CFDA 4NCBA 3CI5A 2UXDK 3RMCA 3T69A 2FC0A 3VGMA 1C1BA 2DPNA 4EIAA 4IOAL 4DSIA 4GNIA 3SQ2A 3HM8A 4M3TA 3P83D 4FM1A 3A0IX 5KGWA 2GUIA 4CEDA 3A5OC 3KLFA 4LFBK 1HJRA 4FVUA 4CZMA 4H5RA 3C65A 4NB4A 3ZT0A 3ZX3A 4CIFA 1G15A 2E2PA 3QMLA 3C94A 4KHSA 4JNEA 1BOTO 2PBDA 3V1QA 3ITHA 3PLAA 1NLVA 2Q0RA 1HNXK 4Z94A 4OJRA 3HRGA 1T7PA 2GWKA 1LW2A 3PIOL 4AHRA 1GLCG 5B8HA 2GBZA 3O4WA 3TAGA 4DR7K 4CEAA 1BGXT 1P90A 4BG8A 2VG7A 4OPJA 3NF8A 4B9VA 4CF9A 2F8TA 1EKEA 3R1XA 3Q7CA 4DFJA 3SUNA 3O3FA 1QQNA 1VSJA 3QICA 2UU9K 1KLMA 5F1XA 1VRTA 2QKBA 4FJIA 4AM6A 1L3UA 1K8KA 5HOOA 3SNNA 3EY1A 4K41A 4L3QA 3IDHA 3DM2A 5EOYA 4AHVA 4QS8A 1RBSA 2NLXA 3CCSN 3ULDA 3V1OA 3NFAA 3CCRN 1LWFA 4F9OA 4E19A 4DS5A 4BRPA 4NCAA 3VN5A 3D45A 4FOIA 1E4GT 4B3MK 1GLDG 3SAGA 3MX5A 1OH8A 3KD5E 4LSNA 3ZSOA 3OS2A 4B3OA 3NGZA 2JGUA 2FBVA 3AO4A 4KTQA 3C6TA 3I0SA 4NYNA 1BUPA 1TAUA 5ADXH 4I2QA 1DKGD 2QI2A 1VSEA 3CM5A 1EWQA 3CCUN 5AQWA 2ZM6K 1YVNA 4B08A 4R5PA 4C23A 1ATRA 1JKHA 1VRUA 2E2QA 5AQJA 3THYB 5LJWA 2YNHA 3WQTA 5AJ3K 4DV5K 4RW7A 4BC5A 3K5MA 1RDCA 4J8FA 4DV3K 1N34K 1RBTA 1S1UA 1QVFM 1RT1A 4AHCA 1XMQK 4DTJA 3L4IA 2NZTA 2WONA 3AVHA 1TUYA 1L3SA 3SCXA 4JN4A 4MLHA 4I7FA 5AQNA 3MN6A 2HHXA 4B9LA 4HCCA 4JK9A 2IVPA 4JKGB 5C10A 1NJIO 1JLQA 5IT9O 1YJNN 3CC2N 4E1MA 1A5VA 4BQZA 4K8XA 2HHSA 3H3OB 4DU3A 4CJFA 5EX5A 1RTJA 1HNWK 3M8QA 1D8YA 5GAHP 4G1QA 1B92A 4I2PA 3CFOA 5GAEP 1NKBA 1R59O 3KWIA 3TR8A 2E8AA 2P5GA 2E4LA 1KAZA 1YUWA 2FSJA 1UA1A 3DXMA 4QS7A 4FK0A 3VEYA 2HHUA 2O8CA 1IH7A 4DV6K 2O8BB 4W5OA 4RCHA 3HXMA 1S72N 1VQLN 1ZXOA 2X74A 2P9SA 1NGAA 3FFKB 4CFAA 2D0OA 2IAJA 1JL1A 3HI0A 4Y0WA 3MWTA 5AQPA 3VOVA 5AQTA 4A2BA 1RNHA 4KREA 5AQHA 4CK2A 3LP1A 2IVNA 2A41A 3CMAN 1YI2N 1ZBIA 3CIPA 4CHNA 2ZJRL 1HQUA 3CG7A 3OY9A 4EHUA 3WNGA 1ZC6A 3AA4A 2ZE2A 3MXJA 4JK7A 4C1NK 4RW9A 2HF3A 3QO9A 4BRHA 4AHSA 5F0XA 4IJNA 1YT3A 1HPMA 1X9WA 3SJJA 4DV1K 2YHXA 3H3NO 1VSFA 4FPBA 4YHHK 1HNIA 2QEXN 3I33A 3HL8A 1NOYA 3ENHA 4QS9A 4J2DA 3R3LA 3OYLA 5EU7A 3G0ZA 1C0TA 4YDUA 3OJSA 3G71N 1RCHA 5KI6A 1ASUA 3UKRA 3ZT1A 5KTQA 4IKFA 4XIUA 4ELVA 2DFEA 2UYTA 3TU5A 2LSNA 4EZ9A 1CZAN 1IG9A 3CJ9A 4ZHRA 5E41A 4BR5A 1Z6RA 3PX0A 4O4GA 1IKXA 4B1UB 2QXFA 4WQ5A 4J2AA 3VPZA 3CC4N 1VQ9N 2D5RA 3AAQA 3VEOA 3VF2A 2E1ZA 2ETJA 3ASMA 4AHUA 4EAHD 5KGXA 3LPUA 3QEPA 2CGJA 4PKIA 3RMBA 3HYFA 2PYLA 4KB0A 3IUCA 3DOLA 2Q36A 4IFEA 1NU0A 4JKFA 1BG3A 4BRMA 1MDUB 3THWB 1VSHA 1VQPN 1BCOA 3TPQA 5M1OA 4XH1A 5E26A 1OH7A 2P9KB 3WXIA 1KVCA 2FSNA 1VK0A 3L2VA 4BRCA 1XWLA 1W0HA 2P5OA 3S9HA 2OANA 2HVHA 4FLVA 5T7BA 4E7LA 3WXKA 5AZJA 3CYMA 4BG9A 3QIOA 5M1PA 1KFDA 2BE2A 3IRXA 3M3ZA 1D9DA 3FFIA 3TSUA 1JXBA 2KHOA 3E01A 3F5TA 1HQEA 1IBKK 3ZETA 4LF7K 4FYDA 1KC8O 1WBDA 4BY9C 4B1WB 4DQSA 3DLEA 2FLOA 2ITGA 2V52B 3I0RA 1HNVA 4CBWA 5ADXA 1S1XA 3VESA 1JCFA 4ELUA 3TAQA 1HJOA 5AQUA 3T3FA 3EYZA 3P1GA 5GIOA 1UOCA 2WFBA 3U4LA 1HKCA 1ZYQA 1Q18A 3GDQA 5K14A 4AH9A 4FLZA 4FK4A 3KK7A 5FPMA 4OPKA 3D7EO 5H1SQ 5AQIA 5HL7L 2OPSA 2NRWA 1E4FT 1QHAA 4OVLA 1HNZK 3OHRA 2XY5A 4F4KA 4FWQA 3F9MA 4OGEA 3IS9A 3MXMA 3CQYA 3NAEA 1RDBA 1S5JA 1NK4A 3P4IA 4CK1A 4CF0A 1Q8IA 4LFCK 3LANA 4N56A 4KHNA 2EWSA 1HRHA 2WC9A 2YKMA 4CEEA 4DQRA 2HBMA 3KLEA 2E2OA 5C2DA 3PX4A 2W6KA 4DLGA 1S6QA 4DSLA 2AJQA 1K6YA 1NK5A 3K5OA 1VQ4N 3EO3A 3WT0A 1WB9A 2A1RA 1DGKN 1VQMN 2RE2A 4CZFA 4BROA 3WQUA 4CHQA 4FJXA 5AQMA 3IKMA 4A62A 1NNEA 4K8ZA 4HVJA 3ZCMA 4N41A 4YOUA 5KRSA 3UE5A 3B8AX 2BTFA 2HHVA 3FLCO 3QINA 2W41A 4FZZA 4Z4EA 2Q3SA 1QQCA 3KKRA 4BWJA 3WNHA 2OTJN 1JL2A 1BI4B 4KHUA 2F7TA 3HSCA 2G8VA 3TSQA 1GOBA 3D2EA 3DYAA 4DFMA 3O9RA 5JVGL 2P9UA 3OYIA 3BGRA 2F9WA 2FF6A 3F9KA 3VTIA 1JLGA 1WSFA 3DXKA 3CJ7A 3DMJA 4O0JA 2IDOA 2I5JA 4ZTFA 4WE1A 4O8KA 3CCJN 4BVPA 1TKXA 3OYMA 1SKSA 3EZWA 1BHLA 3VENA 4AF1A 5AQLA 2QWRA 3FZMA 2UXBK 4J2BA 4X66K 2YHBA 4NO7A 5I3UA 1T44A 3MMVA 3VF4A 1RBRA 1XNRK 4DQ8A 3CPEA 2OPQA 4FWKA 1ATNA 4DFPA 3LL3A 4IOXA 4C8MA 4M3ZA 3V9WA 4KI4A 3PSFA 3NCIA 3K9KA 1NOZA 4IG3A 4YOYA 4CZHA 1WAFA 4H0XB 1ATSA 2ITMA 1NKCA 2EHGA 4MDBA 4WF9L 1YJ9N 4DB3A 3HPOA 2RPIA 4NLBA 1O1WA 4FW2A 5LL6Z 3MK6A 4E1JA 2VCPA 1TGOA 1KAXA 3M1FA 1RBUA 4I6MB 5DM7L 3E1YA 2QWMA 4BR9A 1TKTA 3FZHA 1QSSA 2VWBA 4LF8K 3ZSVA 3C6UA 2G8UA 1U2VA 1HKBA 4ILGB 4CGJA 2D0CA 4HHTA 3NH0A 4DWIA 3GE1A 2F8SA 5AFUH 2BH1A 3AA5X 1JLEA 2HB5A 4JS5A 2QM1A 4U7BA 3SI6A 4ILJA 3DAWA 3I8DA 1S22A 1JCGA 1XHZA 2Q2RA 5HRRA 4NXMK 1LV5A 3EL2A 4CJTA 3TAFA 2KFNA 3ALYA 4FLUA 4BC4A 3AV9A 4CHYA 1UWBA 1XC9A 5HRNA 3CHWA 2FBYA 2OTLN 4H0TB 1X3MA 2X6NA 1QE1A 1Q81O 3HSTB 4CK3A 3RTVA 1NKEA 4BR4A 3HM9A 3UIQA 1J9AA 1IKVA 1FJGK 1X9JA 3C6AA 4B8CA 4M3YA 2HBKA 1ZBLA 4OPHA 4ISEA 4RWTA 4B1YB 1VQ7N 3QEXA 1J6ZA 3NHGA 3CXCM 3THVA 3OYNA 5AR0A 5GIPA 3VTHA 4JRPA 4FWMA 5BRHA 1JXEA 3L0QA 4DTRA 4OO1J 2Y1JA 4DCHA 3TAPA
chains in the Genus database with same CATH topology
4CF8A 3NH1A 3C95A 1C1CA 4G1QA 1B92A 2DFHA 2B5JA 3CFOA 4I2PA 4IG0A 1NKBA 4J2EA 4FZXC 3DRRA 3DLGA 1BIUA 4DLEA 3TR8A 2P5GA 4EP5A 3LP0A 2E4LA 5KRTA 3L3UA 1B9FA 1KVAA 4NYFA 4Z4CA 4FM0A 3TAEA 4IDKA 1ZBFA 1U47A 1Q9YA 1UA1A 2KZZA 1FXXA 3RR8A 3LZJA 3K58A 1NJYA 1IKWA 1FKPA 3AVNA 3O4QA 3MEGA 3QEWA 3K2PA 3MEEA 4FJJA 4FJNA 4FK0A 3B6PA 4QCLA 2IS3A 3DRPA 2IGIA 4E0DA 3V81A 1IH7A 2HHUA 2JLEA 3NGIA 3V9UA 4W5OA 4M3RA 1KFSA 3O4NA 3HXMA 3V6DA 2X74A 3ZT2A 3VQPA 4DTNA 1JLBA 4CFAA 3OYFA 3MAQA 4FLYA 2IAJA 3RRGA 1JL1A 3PX6A 1KVBA 1J5OA 1RDAA 4CJLA 4FXDA 3L8BA 1YTAA 3AO2A 4MQ3A 1X9SA 2G8KA 4BE1A 5CYMA 4F8RA 2O4IA 4CGDA 1U45A 1RNHA 1NK9A 4B9SA 4KREA 4CK2A 4RW8A 3LP1A 1WNSA 2F96A 3AVIA 3SQ0A 1ZBIA 4E7IA 3VQBA 4CHNA 1GOCA 4DS4A 4CJ5A 1CXQA 1HQUA 3CG7A 3OY9A 1Z26A 3WNGA 1FKOA 2YNFA 3AA4A 3AVKA 2ZE2A 3MXJA 4RW9A 1C6VA 4CJKA 4EP4A 3QO9A 4KKOA 4YFUA 3KK1A 3SUOA 4DTSA 4AHSA 1L3VA 1WSHA 3NF6A 4FCYA 3SUPA 4FJLA 1YTUA 3KLGA 3LDSA 3NH2A 1NK7A 1SV5A 1YT3A 1SUQA 3QEVA 1EX4A 4DSJA 1ITGA 4M41A 1X9WA 3SJJA 1QSYA 4CCHA 3K57A 4JLHA 1VSFA 2Y1IA 3KLIA 5C24A 3ZSZA 4BDPA 2BANA 3VQ5A 4CJ3A 1HNIA 4OGCA 2XO7A 3D0PA 2HHTA 3KLHA 3HL8A 1NOYA 1WAJA 4B8AB 1NJZA 4CEQA 1NJWA 4J2DA 3OYLA 5EU7A 3G0ZA 2QK9A 4OKJA 4KTZA 4HCBA 1C0TA 3OJSA 4Z4HA 2E6MA 2RKIA 3G10A 2DTUA 3SZ2A 1RCHA 4CF1A 5KI6A 4O44A 3OYAA 1ASUA 4CECA 3ZT1A 5FDLA 4DSFA 4CJ4A 5KTQA 5FROA 4IKFA 4FLTA 1VSIA 4TSXA 3T1AA 4XIUA 4ELVA 4KB1A 5C42A 2DFEA 3TARA 4RG8A 1N5YA 1RT5A 1VSLA 2LSNA 4CGIA 4EZ9A 1IG9A 4CFCA 3AA2A 4KAZA 4OLBA 4CJEA 4ZHRA 5E41A 2BGGA 3NF7A 3M8RA 4BE2A 3PX0A 2DFFA 4O4GA 2X6SA 5CYQA 3VQ8A 1IKXA 3HK2A 1TK0A 5FRMA 2QXFA 3AVJA 4F3OA 1HPZA 1TL3A 1YVUA 1QHTA 3TAMA 4J2AA 1IKYA 2D5RA 3EZ5A 3OVNA 1C0UA 4PWDA 2Z1JA 2B4JA 3PO4A 2ETJA 3ASMA 4LH5A 4MFBA 1KTQA 3QNOA 2KTQA 1QS4A 4AHUA 3AO3A 3NF9A 5KGXA 3K5NA 3LPUA 3U6FA 3QEPA 2HNDA 3OJUA 3NE6A 1ASWA 2HNYA 3L3VA 3RMBA 3HYFA 2PYLA 4KB0A 1RT3A 4DTMA 4DF8A 3DOLA 3VA0A 1NK0A 4DSKA 3JSMA 3OS0A 2OA8A 1JLAA 5CY4A 4LSLA 2X78A 1C0MA 3WNFA 4KTQA 3WNEA 1VSHA 1BCOA 3T19A 1KLNA 1LAVA 4FK2A 1BQMA 2HNZA 2HMIA 1RTDA 3V9SA 2PY5A 3PUFA 1KVCA 2GV9A 1ZBHA 2W42A 5FRNA 3LALA 3K59A 3V9ZA 1VK0A 3L2VA 1S9GA 1X9MA 1XWLA 2EX3A 3ZT4A 3OYHA 4CHPA 1F21A 1W0HA 5C25A 3L2QA 4JS4A 5I42A 3TWHA 2P5OA 4ID5A 2XY7A 3S9HA 3S3MA 1D9FA 2Z1GA 2DY4A 3S3NA 2E6LA 3S3OA 4FLVA 5T7BA 4E7LA 2HVHA 5HRPA 4ZTJA 3TI0A 2YKNA 1S1VA 3SQ4A 3CYMA 1EXQA 4KHWA 1RT7A 3QIOA 1MU2A 1U48A 1KFDA 2BE2A 3IRXA 4FLXA 3FFIA 4FW1A 3QEIA 1D9DA 2D0BA 3HPGA 1SKRA 1JXBA 1T05A 3PO5A 3E01A 4Z4GA 5HROA 1HQEA 3MECA 3ZSWA 2KW4A 2HHQA 1I3AA 3B6OA 1HYZA 1T8EA 3LP3A 2BDPA 4FYDA 3PY8A 4DF4A 2Z1HA 4FJMA 4DQSA 4Y1DA 3DLEA 4CF2A 2ITGA 4KV8A 4LY7A 5HRSA 2ZQBA 3CFRA 3I0RA 4PQUA 4C8NA 1B9DA 1HNVA 5HLFA 3JYTA 3MXIA 3RRHA 4M42A 3O3GA 4CJPA 4IFYA 4LD0A 1DTTA 1WLJA 3SQ1A 1S1XA 1REVA 3HPHA 3NGYA 5SWMA 1TKDA 3CQ8A 4ELUA 3QESA 1U49A 3TAQA 1BCMA 3V9XA 1VSKA 3T3FA 1Z25A 3EYZA 3CM6A 3P1GA 3DLKA 3F73A 1CZBA 1UOCA 2XRIA 4DMNA 5SZTA 4BDZA 1WSIA 4FLWA 1UA0A 3QERA 3TABA 4Z4IA 1ZYQA 1DTQA 4UQGA 5K14A 4FLZA 4AH9A 2OPRA 4FK4A 3DLRA 4N5SA 4BE0A 1TV6A 2ATQA 4OPKA 1D5AA 3OYGA 4E7JA 4BDYA 4E1NA 3QNNA 2NUBA 3HVTA 4Z4FA 3AVGA 2OPSA 3KTQA 2P51A 4F3TA 3IAYA 3SPYA 4FZYA 1RT4A 4OVLA 4QOZB 3AVAA 1WSEA 3LAMA 2XY5A 4C8LA 1QTMA 3OYKA 4F4KA 1R0AA 5CZ1A 2FBXA 4OGEA 1EETA 1W9HA 3IS9A 4O5BA 2RN2A 4CJVA 5JS1A 3MXMA 4ELTA 1LW0A 3O3HA 3DI6A 4JRQA 1RDDA 3DOKA 4GVMA 1A5WA 1RDBA 1S5JA 4NCGA 3NAEA 1NK4A 4C8KA 4CK1A 1CZ9A 4CF0A 1S6PA 1Q8IA 1IO2A 1QSLA 1S9EA 3VQDA 4EZ6A 4M3WA 3ISNC 3LANA 1U4BA 4DQQA 4N56A 3LWLA 4KHNA 1RTIA 4LH4A 3ZSRA 3ZSYA 4CJUA 1HRHA 4FJ5A 4F2SA 3DRSA 2YHAA 2YKMA 4CEEA 3U3GA 4E7HA 4DQRA 3KLEA 3VQEA 1L3TA 3K5LA 1RBVA 3LPTA 3PX4A 3OYEA 4I9LA 2YNIA 1GOAA 4Y1CA 4DLGA 1S6QA 2G8HA 4DSLA 2G8WA 4KI6A 3NDKA 1C1AA 4DU4A 2AJQA 4YNQA 1EP4A 1K6YA 4CEFA 3K5OA 1NK5A 2G8FA 4I9QA 2D0AA 3AO1A 1VSDA 4OKEA 4BWMA 4DU1A 2HW3A 4CE9A 4FJ9A 2R7YA 3V4IA 4CEBA 2A1RA 3VQQA 4N76A 2QKKA 1XI1A 3MEDA 1S1WA 1UAXA 3H08A 4CJQA 3RR7A 1FK9A 1HMVA 1HYVA 4W5TA 1LAWA 4B9UA 2KZMA 4CHQA 4FJXA 4Q0BA 3P5JA 4E7KA 4FJGA 1TK8A 1N6QA 3SV4A 1BL3A 4K8ZA 4HVJA 3ZCMA 1VSMA 5KRSA 4N41A 3AVCA 4M45A 4ICLA 4CIGA 4CHOA 3L2UA 2O4GA 2IC3A 3QINA 4HUEA 1NK8A 3L2WA 4DQPA 4FZZA 4H8KA 4CGGA 1T03A 4CFBA 4Z4EA 2Q3SA 1QQCA 4CGHA 3KKRA 1ASVA 1JLCA 4QAGA 4BWJA 3IG1A 4CFDA 3HP6A 2OZSA 4NCBA 2VWKA 3V1RA 3WNHA 4CERA 3RMCA 3KJVA 1U04A 2FC0A 2OYQA 1C1BA 1JL2A 1BI4B 1JLFA 4KHUA 2FBTA 4DSIA 3SQ2A 4B9MA 3QLHA 2RF2A 4BACA 1TL1A 3P83D 4FM1A 5KGWA 2G8VA 4M3TA 1GOBA 3DYAA 2GUIA 4CEDA 3KLFA 4ID1A 4DFMA 1HJRA 3HJFA 3SYZA 1NK6A 3KKSA 3OYIA 3ZT0A 4DFKA 3BGRA 1TK5A 1Y97A 4DTOA 3BDPA 3F9KA 4B9TA 3TANA 3OYBA 1JLGA 1WSFA 4RW4A 4CIFA 4CJRA 3OYCA 1G15A 1WSJA 4O0JA 3DMJA 1TAQA 2PZSA 2IDOA 2I5JA 2WOMA 3C94A 4ZTFA 4KHSA 4WE1A 5HBMA 3L2RA 3V1QA 3ITHA 4O0IA 3SPZA 3M8PA 1HYSA 1TKXA 3OYMA 1SKSA 1SL1A 4OJRA 1NJXA 4GW6A 1T7PA 3OYJA 1BHLA 4FJ7A 4KHQA 1CXUA 1LW2A 4AHRA 3VQ6A 1RT2A 4DTXA 3OS1A 1BIZA 4H4OA 2GBZA 4HTUA 5JS2A 4KPYA 4OLAA 3VA3A 3LP2A 3LWMA 3TAGA 4CEAA 4F2RA 1BGXT 3M8SA 4PA1A 4J2BA 2VG7A 2YHBA 3VQ7A 4FJ8A 2YNGA 1RILA 3VQAA 4OPJA 3ZT3A 4W5NA 4KRFA 1CLQA 3NF8A 4B9VA 2Z1IA 4CF9A 5I3UA 5D3GA 2F8TA 2KQ2A 1EKEA 1SL0A 4CESA 5HP1A 1J54A 3VQ4A 1RBRA 4Q5VA 4HUFA 4DFJA 4C8OA 2OPPA 3RWUA 3QIPA 3SUNA 3O3FA 4FVMA 4DQIA 1VSJA 2OPQA 2P1JA 4Z0UA 3SV3A 4CJWA 4DFPA 4KTWA 4C8MA 4M3ZA 1KLMA 1VRTA 2QKBA 3V9WA 3DLBA 4B9NA 4KI4A 4FJIA 3NCIA 4E89A 1LWCA 1NOZA 4IG3A 3SNNA 1L3UA 4OKKA 4HUGA 3EY1A 3PV8A 1WAFA 3U3YA 1BISA 1Q9XA 1BQNA 1NKCA 2EHGA 4CHZA 4PUOA 3VQCA 3DM2A 1KRPA 1ZBUA 2ZD1A 4AHVA 3HPOA 1RTHA 1RBSA 3ULDA 2RPIA 3V1OA 3NFAA 1LWFA 4KHYA 1O1WA 1TVRA 4FW2A 4DG1A 2XHBA 4E19A 4DS5A 4IBNA 1TGOA 4NCAA 3VN5A 3D45A 2OZMA 1RBUA 2A1SA 2VG6A 4PY5A 1DLOA 3KD5E 3ZSXA 3KD1E 4LSNA 3NBPA 3OYDA 3KK3A 1TKTA 3ZSOA 3OS2A 1QSSA 5DK5A 4B3OA 3ZSVA 2JGUA 2FBVA 3AO4A 3C6UA 3NGZA 1KSPA 3C6TA 2G8UA 3I0SA 4HHTA 4CGJA 2D0CA 4DWIA 3NH0A 4CGFA 4NYNA 3HO1A 1TAUA 5J2PA 1XHXA 2F8SA 4I2QA 4GMJB 3KK2A 3A2FA 1VSEA 4W5RA 3CM5A 4AILC 3AA5X 1J53A 1JLEA 4FJHA 2HB5A 4JS5A 4KFBA 3HVRA 3SI6A 1WSGA 4RW6A 3AVFA 3I8DA 1XHZA 1SL2A 3AVMA 4FJKA 5HRRA 3RMAA 1LWEA 4B08A 4R5PA 3HT3A 1LV5A 2KFZA 1JKHA 1S1TA 1VRUA 4CJTA 4FM2A 3TAFA 5J2MA 3HP9A 1L5UA 2KFNA 2XY6A 1KCFA 2YNHA 3ALYA 4W5QA 4FLUA 3AV9A 3LZIA 4CHYA 4E3SA 1A5XA 4RW7A 3K5MA 1RDCA 1SKWA 1UWBA 4DTPA 5DMRA 5HRNA 1XC9A 1RBTA 1S1UA 3AVLA 2FBYA 5J1EA 1RT1A 4AHCA 4DTJA 2X6NA 1TKZA 3SUQA 3DLHA 2WONA 3AVHA 4O55A 1X1PA 4H4MA 3QETA 1QE1A 4N47A 1L3SA 3SCXA 3HSTB 4CK3A 1RT6A 4CJSA 3RTVA 1NKEA 4M3XA 4M3UA 2XY8A 4I7FA 4AHTA 2HHXA 3VQ9A 3HM9A 3UIQA 4B9LA 2PYJA 2VG5A 4HCCA 1J9AA 1IKVA 3AO5A 4CIEA 5J2NA 4B8CA 4M3YA 1WN7A 3CFPA 4CEOA 1JLQA 1ZBLA 3ZSQA 4KO0A 2VWJA 1I39A 2YV0X 4DSEA 3QEXA 5J2QA 4L8RB 4E1MA 1A5VA 3NHGA 4K8XA 2G8IA 3LAKA 2HHSA 3AVBA 3THVA 3OYNA 4DU3A 5CZ2A 3KIOA 4CJFA 4DTUA 1BI4A 4JRPA 4CEZA 1RTJA 3RMDA 1JXEA 2B6AA 4IFVA 4DTRA 2HVIA 3M8QA 3AA3A 2HHVA 2Y1JA 1D8YA 2IOCA 3TAPA 2HHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CF8 A;  3NH1 A;  3C95 A;  1C1C A;  4G1Q A;  1B92 A;  2DFH A;  2B5J A;  3CFO A;  4I2P A;  4IG0 A;  1NKB A;  4J2E A;  4FZX C;  3DRR A;  3DLG A;  1BIU A;  4DLE A;  3TR8 A;  2P5G A;  4EP5 A;  3LP0 A;  2E4L A;  5KRT A;  3L3U A;  1B9F A;  1KVA A;  4NYF A;  4Z4C A;  4FM0 A;  3TAE A;  4IDK A;  1ZBF A;  1U47 A;  1Q9Y A;  1UA1 A;  2KZZ A;  1FXX A;  3RR8 A;  3LZJ A;  3K58 A;  1NJY A;  1IKW A;  1FKP A;  3AVN A;  3O4Q A;  3MEG A;  3QEW A;  3K2P A;  3MEE A;  4FJJ A;  4FJN A;  4FK0 A;  3B6P A;  4QCL A;  2IS3 A;  3DRP A;  2IGI A;  4E0D A;  3V81 A;  1IH7 A;  2HHU A;  2JLE A;  3NGI A;  3V9U A;  4W5O A;  4M3R A;  1KFS A;  3O4N A;  3HXM A;  3V6D A;  2X74 A;  3ZT2 A;  3VQP A;  4DTN A;  1JLB A;  4CFA A;  3OYF A;  3MAQ A;  4FLY A;  2IAJ A;  3RRG A;  1JL1 A;  3PX6 A;  1KVB A;  1J5O A;  1RDA A;  4CJL A;  4FXD A;  3L8B A;  1YTA A;  3AO2 A;  4MQ3 A;  1X9S A;  2G8K A;  4BE1 A;  5CYM A;  4F8R A;  2O4I A;  4CGD A;  1U45 A;  1RNH A;  1NK9 A;  4B9S A;  4KRE A;  4CK2 A;  4RW8 A;  3LP1 A;  1WNS A;  2F96 A;  3AVI A;  3SQ0 A;  1ZBI A;  4E7I A;  3VQB A;  4CHN A;  1GOC A;  4DS4 A;  4CJ5 A;  1CXQ A;  1HQU A;  3CG7 A;  3OY9 A;  1Z26 A;  3WNG A;  1FKO A;  2YNF A;  3AA4 A;  3AVK A;  2ZE2 A;  3MXJ A;  4RW9 A;  1C6V A;  4CJK A;  4EP4 A;  3QO9 A;  4KKO A;  4YFU A;  3KK1 A;  3SUO A;  4DTS A;  4AHS A;  1L3V A;  1WSH A;  3NF6 A;  4FCY A;  3SUP A;  4FJL A;  1YTU A;  3KLG A;  3LDS A;  3NH2 A;  1NK7 A;  1SV5 A;  1YT3 A;  1SUQ A;  3QEV A;  1EX4 A;  4DSJ A;  1ITG A;  4M41 A;  1X9W A;  3SJJ A;  1QSY A;  4CCH A;  3K57 A;  4JLH A;  1VSF A;  2Y1I A;  3KLI A;  5C24 A;  3ZSZ A;  4BDP A;  2BAN A;  3VQ5 A;  4CJ3 A;  1HNI A;  4OGC A;  2XO7 A;  3D0P A;  2HHT A;  3KLH A;  3HL8 A;  1NOY A;  1WAJ A;  4B8A B;  1NJZ A;  4CEQ A;  1NJW A;  4J2D A;  3OYL A;  5EU7 A;  3G0Z A;  2QK9 A;  4OKJ A;  4KTZ A;  4HCB A;  1C0T A;  3OJS A;  4Z4H A;  2E6M A;  2RKI A;  3G10 A;  2DTU A;  3SZ2 A;  1RCH A;  4CF1 A;  5KI6 A;  4O44 A;  3OYA A;  1ASU A;  4CEC A;  3ZT1 A;  5FDL A;  4DSF A;  4CJ4 A;  5KTQ A;  5FRO A;  4IKF A;  4FLT A;  1VSI A;  4TSX A;  3T1A A;  4XIU A;  4ELV A;  4KB1 A;  5C42 A;  2DFE A;  3TAR A;  4RG8 A;  1N5Y A;  1RT5 A;  1VSL A;  2LSN A;  4CGI A;  4EZ9 A;  1IG9 A;  4CFC A;  3AA2 A;  4KAZ A;  4OLB A;  4CJE A;  4ZHR A;  5E41 A;  2BGG A;  3NF7 A;  3M8R A;  4BE2 A;  3PX0 A;  2DFF A;  4O4G A;  2X6S A;  5CYQ A;  3VQ8 A;  1IKX A;  3HK2 A;  1TK0 A;  5FRM A;  2QXF A;  3AVJ A;  4F3O A;  1HPZ A;  1TL3 A;  1YVU A;  1QHT A;  3TAM A;  4J2A A;  1IKY A;  2D5R A;  3EZ5 A;  3OVN A;  1C0U A;  4PWD A;  2Z1J A;  2B4J A;  3PO4 A;  2ETJ A;  3ASM A;  4LH5 A;  4MFB A;  1KTQ A;  3QNO A;  2KTQ A;  1QS4 A;  4AHU A;  3AO3 A;  3NF9 A;  5KGX A;  3K5N A;  3LPU A;  3U6F A;  3QEP A;  2HND A;  3OJU A;  3NE6 A;  1ASW A;  2HNY A;  3L3V A;  3RMB A;  3HYF A;  2PYL A;  4KB0 A;  1RT3 A;  4DTM A;  4DF8 A;  3DOL A;  3VA0 A;  1NK0 A;  4DSK A;  3JSM A;  3OS0 A;  2OA8 A;  1JLA A;  5CY4 A;  4LSL A;  2X78 A;  1C0M A;  3WNF A;  4KTQ A;  3WNE A;  1VSH A;  1BCO A;  3T19 A;  1KLN A;  1LAV A;  4FK2 A;  1BQM A;  2HNZ A;  2HMI A;  1RTD A;  3V9S A;  2PY5 A;  3PUF A;  1KVC A;  2GV9 A;  1ZBH A;  2W42 A;  5FRN A;  3LAL A;  3K59 A;  3V9Z A;  1VK0 A;  3L2V A;  1S9G A;  1X9M A;  1XWL A;  2EX3 A;  3ZT4 A;  3OYH A;  4CHP A;  1F21 A;  1W0H A;  5C25 A;  3L2Q A;  4JS4 A;  5I42 A;  3TWH A;  2P5O A;  4ID5 A;  2XY7 A;  3S9H A;  3S3M A;  1D9F A;  2Z1G A;  2DY4 A;  3S3N A;  2E6L A;  3S3O A;  4FLV A;  5T7B A;  4E7L A;  2HVH A;  5HRP A;  4ZTJ A;  3TI0 A;  2YKN A;  1S1V A;  3SQ4 A;  3CYM A;  1EXQ A;  4KHW A;  1RT7 A;  3QIO A;  1MU2 A;  1U48 A;  1KFD A;  2BE2 A;  3IRX A;  4FLX A;  3FFI A;  4FW1 A;  3QEI A;  1D9D A;  2D0B A;  3HPG A;  1SKR A;  1JXB A;  1T05 A;  3PO5 A;  3E01 A;  4Z4G A;  5HRO A;  1HQE A;  3MEC A;  3ZSW A;  2KW4 A;  2HHQ A;  1I3A A;  3B6O A;  1HYZ A;  1T8E A;  3LP3 A;  2BDP A;  4FYD A;  3PY8 A;  4DF4 A;  2Z1H A;  4FJM A;  4DQS A;  4Y1D A;  3DLE A;  4CF2 A;  2ITG A;  4KV8 A;  4LY7 A;  5HRS A;  2ZQB A;  3CFR A;  3I0R A;  4PQU A;  4C8N A;  1B9D A;  1HNV A;  5HLF A;  3JYT A;  3MXI A;  3RRH A;  4M42 A;  3O3G A;  4CJP A;  4IFY A;  4LD0 A;  1DTT A;  1WLJ A;  3SQ1 A;  1S1X A;  1REV A;  3HPH A;  3NGY A;  5SWM A;  1TKD A;  3CQ8 A;  4ELU A;  3QES A;  1U49 A;  3TAQ A;  1BCM A;  3V9X A;  1VSK A;  3T3F A;  1Z25 A;  3EYZ A;  3CM6 A;  3P1G A;  3DLK A;  3F73 A;  1CZB A;  1UOC A;  2XRI A;  4DMN A;  5SZT A;  4BDZ A;  1WSI A;  4FLW A;  1UA0 A;  3QER A;  3TAB A;  4Z4I A;  1ZYQ A;  1DTQ A;  4UQG A;  5K14 A;  4FLZ A;  4AH9 A;  2OPR A;  4FK4 A;  3DLR A;  4N5S A;  4BE0 A;  1TV6 A;  2ATQ A;  4OPK A;  1D5A A;  3OYG A;  4E7J A;  4BDY A;  4E1N A;  3QNN A;  2NUB A;  3HVT A;  4Z4F A;  3AVG A;  2OPS A;  3KTQ A;  2P51 A;  4F3T A;  3IAY A;  3SPY A;  4FZY A;  1RT4 A;  4OVL A;  4QOZ B;  3AVA A;  1WSE A;  3LAM A;  2XY5 A;  4C8L A;  1QTM A;  3OYK A;  4F4K A;  1R0A A;  5CZ1 A;  2FBX A;  4OGE A;  1EET A;  1W9H A;  3IS9 A;  4O5B A;  2RN2 A;  4CJV A;  5JS1 A;  3MXM A;  4ELT A;  1LW0 A;  3O3H A;  3DI6 A;  4JRQ A;  1RDD A;  3DOK A;  4GVM A;  1A5W A;  1RDB A;  1S5J A;  4NCG A;  3NAE A;  1NK4 A;  4C8K A;  4CK1 A;  1CZ9 A;  4CF0 A;  1S6P A;  1Q8I A;  1IO2 A;  1QSL A;  1S9E A;  3VQD A;  4EZ6 A;  4M3W A;  3ISN C;  3LAN A;  1U4B A;  4DQQ A;  4N56 A;  3LWL A;  4KHN A;  1RTI A;  4LH4 A;  3ZSR A;  3ZSY A;  4CJU A;  1HRH A;  4FJ5 A;  4F2S A;  3DRS A;  2YHA A;  2YKM A;  4CEE A;  3U3G A;  4E7H A;  4DQR A;  3KLE A;  3VQE A;  1L3T A;  3K5L A;  1RBV A;  3LPT A;  3PX4 A;  3OYE A;  4I9L A;  2YNI A;  1GOA A;  4Y1C A;  4DLG A;  1S6Q A;  2G8H A;  4DSL A;  2G8W A;  4KI6 A;  3NDK A;  1C1A A;  4DU4 A;  2AJQ A;  4YNQ A;  1EP4 A;  1K6Y A;  4CEF A;  3K5O A;  1NK5 A;  2G8F A;  4I9Q A;  2D0A A;  3AO1 A;  1VSD A;  4OKE A;  4BWM A;  4DU1 A;  2HW3 A;  4CE9 A;  4FJ9 A;  2R7Y A;  3V4I A;  4CEB A;  2A1R A;  3VQQ A;  4N76 A;  2QKK A;  1XI1 A;  3MED A;  1S1W A;  1UAX A;  3H08 A;  4CJQ A;  3RR7 A;  1FK9 A;  1HMV A;  1HYV A;  4W5T A;  1LAW A;  4B9U A;  2KZM A;  4CHQ A;  4FJX A;  4Q0B A;  3P5J A;  4E7K A;  4FJG A;  1TK8 A;  1N6Q A;  3SV4 A;  1BL3 A;  4K8Z A;  4HVJ A;  3ZCM A;  1VSM A;  5KRS A;  4N41 A;  3AVC A;  4M45 A;  4ICL A;  4CIG A;  4CHO A;  3L2U A;  2O4G A;  2IC3 A;  3QIN A;  4HUE A;  1NK8 A;  3L2W A;  4DQP A;  4FZZ A;  4H8K A;  4CGG A;  1T03 A;  4CFB A;  4Z4E A;  2Q3S A;  1QQC A;  4CGH A;  3KKR A;  1ASV A;  1JLC A;  4QAG A;  4BWJ A;  3IG1 A;  4CFD A;  3HP6 A;  2OZS A;  4NCB A;  2VWK A;  3V1R A;  3WNH A;  4CER A;  3RMC A;  3KJV A;  1U04 A;  2FC0 A;  2OYQ A;  1C1B A;  1JL2 A;  1BI4 B;  1JLF A;  4KHU A;  2FBT A;  4DSI A;  3SQ2 A;  4B9M A;  3QLH A;  2RF2 A;  4BAC A;  1TL1 A;  3P83 D;  4FM1 A;  5KGW A;  2G8V A;  4M3T A;  1GOB A;  3DYA A;  2GUI A;  4CED A;  3KLF A;  4ID1 A;  4DFM A;  1HJR A;  3HJF A;  3SYZ A;  1NK6 A;  3KKS A;  3OYI A;  3ZT0 A;  4DFK A;  3BGR A;  1TK5 A;  1Y97 A;  4DTO A;  3BDP A;  3F9K A;  4B9T A;  3TAN A;  3OYB A;  1JLG A;  1WSF A;  4RW4 A;  4CIF A;  4CJR A;  3OYC A;  1G15 A;  1WSJ A;  4O0J A;  3DMJ A;  1TAQ A;  2PZS A;  2IDO A;  2I5J A;  2WOM A;  3C94 A;  4ZTF A;  4KHS A;  4WE1 A;  5HBM A;  3L2R A;  3V1Q A;  3ITH A;  4O0I A;  3SPZ A;  3M8P A;  1HYS A;  1TKX A;  3OYM A;  1SKS A;  1SL1 A;  4OJR A;  1NJX A;  4GW6 A;  1T7P A;  3OYJ A;  1BHL A;  4FJ7 A;  4KHQ A;  1CXU A;  1LW2 A;  4AHR A;  3VQ6 A;  1RT2 A;  4DTX A;  3OS1 A;  1BIZ A;  4H4O A;  2GBZ A;  4HTU A;  5JS2 A;  4KPY A;  4OLA A;  3VA3 A;  3LP2 A;  3LWM A;  3TAG A;  4CEA A;  4F2R A;  1BGX T;  3M8S A;  4PA1 A;  4J2B A;  2VG7 A;  2YHB A;  3VQ7 A;  4FJ8 A;  2YNG A;  1RIL A;  3VQA A;  4OPJ A;  3ZT3 A;  4W5N A;  4KRF A;  1CLQ A;  3NF8 A;  4B9V A;  2Z1I A;  4CF9 A;  5I3U A;  5D3G A;  2F8T A;  2KQ2 A;  1EKE A;  1SL0 A;  4CES A;  5HP1 A;  1J54 A;  3VQ4 A;  1RBR A;  4Q5V A;  4HUF A;  4DFJ A;  4C8O A;  2OPP A;  3RWU A;  3QIP A;  3SUN A;  3O3F A;  4FVM A;  4DQI A;  1VSJ A;  2OPQ A;  2P1J A;  4Z0U A;  3SV3 A;  4CJW A;  4DFP A;  4KTW A;  4C8M A;  4M3Z A;  1KLM A;  1VRT A;  2QKB A;  3V9W A;  3DLB A;  4B9N A;  4KI4 A;  4FJI A;  3NCI A;  4E89 A;  1LWC A;  1NOZ A;  4IG3 A;  3SNN A;  1L3U A;  4OKK A;  4HUG A;  3EY1 A;  3PV8 A;  1WAF A;  3U3Y A;  1BIS A;  1Q9X A;  1BQN A;  1NKC A;  2EHG A;  4CHZ A;  4PUO A;  3VQC A;  3DM2 A;  1KRP A;  1ZBU A;  2ZD1 A;  4AHV A;  3HPO A;  1RTH A;  1RBS A;  3ULD A;  2RPI A;  3V1O A;  3NFA A;  1LWF A;  4KHY A;  1O1W A;  1TVR A;  4FW2 A;  4DG1 A;  2XHB A;  4E19 A;  4DS5 A;  4IBN A;  1TGO A;  4NCA A;  3VN5 A;  3D45 A;  2OZM A;  1RBU A;  2A1S A;  2VG6 A;  4PY5 A;  1DLO A;  3KD5 E;  3ZSX A;  3KD1 E;  4LSN A;  3NBP A;  3OYD A;  3KK3 A;  1TKT A;  3ZSO A;  3OS2 A;  1QSS A;  5DK5 A;  4B3O A;  3ZSV A;  2JGU A;  2FBV A;  3AO4 A;  3C6U A;  3NGZ A;  1KSP A;  3C6T A;  2G8U A;  3I0S A;  4HHT A;  4CGJ A;  2D0C A;  4DWI A;  3NH0 A;  4CGF A;  4NYN A;  3HO1 A;  1TAU A;  5J2P A;  1XHX A;  2F8S A;  4I2Q A;  4GMJ B;  3KK2 A;  3A2F A;  1VSE A;  4W5R A;  3CM5 A;  4AIL C;  3AA5 X;  1J53 A;  1JLE A;  4FJH A;  2HB5 A;  4JS5 A;  4KFB A;  3HVR A;  3SI6 A;  1WSG A;  4RW6 A;  3AVF A;  3I8D A;  1XHZ A;  1SL2 A;  3AVM A;  4FJK A;  5HRR A;  3RMA A;  1LWE A;  4B08 A;  4R5P A;  3HT3 A;  1LV5 A;  2KFZ A;  1JKH A;  1S1T A;  1VRU A;  4CJT A;  4FM2 A;  3TAF A;  5J2M A;  3HP9 A;  1L5U A;  2KFN A;  2XY6 A;  1KCF A;  2YNH A;  3ALY A;  4W5Q A;  4FLU A;  3AV9 A;  3LZI A;  4CHY A;  4E3S A;  1A5X A;  4RW7 A;  3K5M A;  1RDC A;  1SKW A;  1UWB A;  4DTP A;  5DMR A;  5HRN A;  1XC9 A;  1RBT A;  1S1U A;  3AVL A;  2FBY A;  5J1E A;  1RT1 A;  4AHC A;  4DTJ A;  2X6N A;  1TKZ A;  3SUQ A;  3DLH A;  2WON A;  3AVH A;  4O55 A;  1X1P A;  4H4M A;  3QET A;  1QE1 A;  4N47 A;  1L3S A;  3SCX A;  3HST B;  4CK3 A;  1RT6 A;  4CJS A;  3RTV A;  1NKE A;  4M3X A;  4M3U A;  2XY8 A;  4I7F A;  4AHT A;  2HHX A;  3VQ9 A;  3HM9 A;  3UIQ A;  4B9L A;  2PYJ A;  2VG5 A;  4HCC A;  1J9A A;  1IKV A;  3AO5 A;  4CIE A;  5J2N A;  4B8C A;  4M3Y A;  1WN7 A;  3CFP A;  4CEO A;  1JLQ A;  1ZBL A;  3ZSQ A;  4KO0 A;  2VWJ A;  1I39 A;  2YV0 X;  4DSE A;  3QEX A;  5J2Q A;  4L8R B;  4E1M A;  1A5V A;  3NHG A;  4K8X A;  2G8I A;  3LAK A;  2HHS A;  3AVB A;  3THV A;  3OYN A;  4DU3 A;  5CZ2 A;  3KIO A;  4CJF A;  4DTU A;  1BI4 A;  4JRP A;  4CEZ A;  1RTJ A;  3RMD A;  1JXE A;  2B6A A;  4IFV A;  4DTR A;  2HVI A;  3M8Q A;  3AA3 A;  2HHV A;  2Y1J A;  1D8Y A;  2IOC A;  3TAP A;  2HHW A; 
#chains in the Genus database with same CATH topology
 4CF8 A;  5JMV A;  3MN7 A;  2B5J A;  4IEI A;  1MA9 B;  1WBB A;  2E20 A;  3LP0 A;  2D0P A;  5KRT A;  3L3U A;  4FM0 A;  1KVA A;  3TAE A;  4IDK A;  1ZBF A;  2ASM A;  1HKG A;  3K2P A;  1I94 K;  3B6P A;  3SBG A;  2IGI A;  3CD6 N;  4JI0 K;  4M3R A;  1KFS A;  4GV9 A;  3ZT2 A;  5IWA K;  4GV3 A;  3PX6 A;  1KVB A;  1RDA A;  4CJL A;  4FXD A;  1ZBS A;  3L8B A;  2P9N B;  4FWO A;  4JD2 B;  1YTA A;  1VAZ A;  3AO2 A;  4MQ3 A;  2O4I A;  4CZG A;  3NMU A;  1ILY A;  4B3R K;  3SMS A;  2P9N A;  4G9Z A;  1GOC A;  4DS4 A;  3R6M A;  2YNF A;  4IWV A;  3AVK A;  3LM9 A;  1C6V A;  2YX6 A;  4EP4 A;  3SUO A;  3NF6 A;  5TKY A;  3SUP A;  4GVE A;  3AGR A;  1NK7 A;  1SV5 A;  1EX4 A;  2NRT A;  4M41 A;  4CCH A;  2KLA A;  3K57 A;  3KLI A;  4YDU C;  1DEJ A;  4JI3 K;  2BAN A;  5BPN A;  4GY2 B;  4OGC A;  4LF4 K;  3JXU A;  3LDQ A;  1WAJ A;  4B8A B;  2Q31 A;  4FWL A;  2QK9 A;  4FWR A;  4BRK A;  4CI6 A;  2GEM A;  3OA9 A;  4HCB A;  2E6M A;  5BR8 K;  1QQO A;  4LC9 B;  4O44 A;  4JI1 K;  4BC3 A;  1KQS M;  5FRO A;  4WQ5 C;  2O8E B;  4A57 A;  4JK8 A;  4CFC A;  3AA2 A;  3NVM A;  4KAZ A;  3THY A;  3M8R A;  2ZGY A;  3VQ8 A;  4BR7 A;  4X64 K;  1TK0 A;  1TL3 A;  1YVU A;  2O8E A;  3QDK A;  4JI6 K;  1Q7Y O;  3UKU B;  3PO4 A;  5BR9 A;  4MFB A;  1KTQ A;  3AO3 A;  3NF9 A;  3K5N A;  4BC2 A;  3NE6 A;  1ASW A;  3L3V A;  4JKG A;  3GL1 A;  1NK0 A;  2Q97 A;  1VQ5 N;  5CY4 A;  4LSL A;  1C0M A;  1OKJ A;  4DV0 K;  1LOT B;  1KLN A;  3ZX2 A;  4IO8 A;  4FK2 A;  1BQM A;  2HNZ A;  2ASP A;  2PY5 A;  1ZBH A;  2GV9 A;  3E66 A;  3LAL A;  3TTD A;  3V9Z A;  1U6Z A;  3BZC A;  1S9G A;  1NWK A;  4CHP A;  1F21 A;  1YHQ N;  4ID5 A;  2XY7 A;  1D9F A;  2DY4 A;  3ENO A;  3S3N A;  2E6L A;  3S3O A;  3O1W A;  5HRP A;  3BY5 A;  2YKN A;  1VQ6 N;  4EHT A;  5AQZ A;  1EXQ A;  4KHW A;  4BRI A;  2VQE K;  2O8B A;  4Z4G A;  3AGK A;  3VMF B;  1YXQ A;  2KW4 A;  2HHQ A;  3B6O A;  5KPZ A;  1HYZ A;  3LP3 A;  4DF4 A;  3AY9 A;  2NRH A;  2QA4 N;  4GKJ K;  3VEX A;  3TSP A;  4KV8 A;  4LY7 A;  4CZE A;  2UUC K;  3W0L A;  3FGU A;  4M42 A;  3O3G A;  4LD0 A;  5AFU A;  3HPH A;  2OCE A;  3QES A;  3V9X A;  1NG9 A;  1RGI A;  4DMN A;  5SZT A;  1UA0 A;  3QER A;  1DT9 A;  2IIR A;  1TV6 A;  3RSE B;  4E7J A;  5C0Y A;  4E1N A;  1V4S A;  2NUB A;  4Z4F A;  3J80 O;  4K25 A;  3T1H K;  4F3T A;  4WCE L;  3SPY A;  1VHX A;  3AVA A;  3RSE A;  5E84 A;  2FBX A;  1EET A;  1XNQ K;  5BPM A;  3QB0 A;  4O5B A;  4GV6 A;  5JLH A;  1LW0 A;  1NGG A;  3DI6 A;  3EN9 A;  3THX B;  1QSL A;  3HZ6 A;  2VGN A;  1U4B A;  3GBT A;  1NGE A;  4LH4 A;  4IZ9 A;  4F2S A;  4FJ5 A;  4JI7 K;  2Q1N A;  4E7H A;  3H45 C;  3VQE A;  1S3X A;  2GWJ A;  1RBV A;  3OYE A;  4DV4 K;  2G8H A;  1GOA A;  1C1A A;  4DU4 A;  1YIT N;  4ISF A;  5JVH L;  4CEF A;  3T7Z A;  4A59 A;  4I9Q A;  4DU1 A;  4BWM A;  3CJ1 A;  4CE9 A;  4FJ9 A;  1VQK N;  3VQQ A;  2F9T A;  4DR3 K;  4BGA A;  1UAX A;  3H08 A;  3RR7 A;  4W5T A;  1HYV A;  1LAW A;  4FOE A;  4CVN E;  3P5J A;  4MO5 A;  2E1Y A;  5KQD A;  4DSJ A;  4CHO A;  4HUE A;  1NK8 A;  3HTV A;  3L2W A;  1P8Z A;  4CFB A;  4CW7 B;  4CGH A;  3IG1 A;  1EWR A;  2WUS A;  4H5N A;  2VWK A;  5AQQ A;  4H5T A;  2NRV A;  5BRE A;  4B9M A;  3QLH A;  4BAC A;  1TL1 A;  3VER A;  4YOW A;  1M1K O;  4DHY A;  3BP8 A;  4ID1 A;  4CZL A;  3THW A;  2HMP A;  1NK6 A;  4BVO A;  4BRA A;  3AAP A;  4DTO A;  4IOC L;  1HX1 A;  3BDP A;  4HWI A;  4B9T A;  3OYB A;  4H5W A;  2YJF A;  4RW4 A;  1WSJ A;  2P9K A;  1TAQ A;  2PZS A;  2WOM A;  3L2R A;  5HBM A;  3O8M A;  3CF5 L;  3SPZ A;  3M8P A;  1HYS A;  1SL1 A;  1NJX A;  3OYJ A;  3IMX A;  3VQ6 A;  1RT2 A;  5DM6 L;  3P31 A;  1BIZ A;  4H4O A;  3WEE B;  4KPY A;  5JS2 A;  3VA3 A;  3ENB A;  4F2R A;  4XEI A;  3M8S A;  4FJ8 A;  4H0V B;  5KPT A;  5MLC Q;  2YNG A;  1RIL A;  3VQA A;  3ZT3 A;  4W5N A;  4BRQ A;  4KRF A;  5KPR A;  1CLQ A;  1IJJ A;  5D3G A;  4JKA A;  1N8R O;  2KQ2 A;  1SL0 A;  3LM2 A;  5HP1 A;  1J54 A;  3SJH A;  5AQS A;  3RWU A;  3QIP A;  3J7Y P;  4DQI A;  1H1V A;  2P1J A;  2J4R A;  2QWP A;  3SV3 A;  4CJW A;  4CJ7 A;  2ZJQ L;  3DLB A;  4B9N A;  2HOE A;  4E89 A;  4HUG A;  1SQK A;  1SAZ A;  3PV8 A;  3U3Y A;  1BQN A;  5LY3 A;  4X62 K;  4CHZ A;  4PUO A;  1C0F A;  1ZBU A;  2ZD1 A;  5AQO A;  3H1Q A;  3FZK A;  3A8Y A;  1V4T A;  2V7Z A;  4DG1 A;  1W97 L;  3QFU A;  4XH4 A;  5JIC A;  3EE9 A;  2OZM A;  3I8B A;  1DLO A;  3KD1 E;  1NGD A;  3OYD A;  1JCE A;  5BN9 A;  4K42 A;  3HO1 A;  4CGF A;  2NRZ A;  1XHX A;  3J7Z O;  4CZK A;  3MX2 A;  2P9P B;  5C12 A;  3KK2 A;  3A2F A;  4W5R A;  4DR4 K;  4FJH A;  4FWS A;  3EEQ A;  4KFB A;  3LDN A;  5CR4 A;  3HVR A;  4RW6 A;  3AVF A;  1GLF O;  3D2F B;  1SL2 A;  3RMA A;  3HT3 A;  3HP9 A;  2XY6 A;  4W5Q A;  4E3S A;  1G99 A;  4DTP A;  3D2F A;  1QQM A;  3SUQ A;  1TKZ A;  5FPE A;  3DLH A;  1X1P A;  3QET A;  4JHD B;  2IVO A;  3H1V X;  4M3U A;  4B1V A;  4CJS A;  4M3X A;  2XY8 A;  3WXM B;  1J5E K;  5AQF A;  4CZI A;  4DR2 K;  3SLC A;  1KAY A;  4PKG A;  1WN7 A;  2GTD A;  1EO1 A;  1KXP A;  4CEO A;  5EVZ A;  4JHD A;  3WXL A;  3ZSQ A;  2VWJ A;  1I39 A;  2YV0 X;  2CGL A;  4DSE A;  4L8R B;  2G8I A;  3LAK A;  1QZ5 A;  3AVB A;  4FO0 A;  2UXC K;  5CZ2 A;  4DTU A;  3CCE N;  1BI4 A;  4CEZ A;  3RMD A;  2E2N A;  2I7P A;  3CJA A;  1NGC A;  3AA3 A;  4FSV A;  5M1F A;  3O9U A;  2IOC A;  5CHI A;  3C95 A;  3CCQ N;  2DFH A;  4J2E A;  4IG0 A;  3CJB A;  3DRR A;  1BIU A;  3J81 O;  4DLE A;  5ELZ A;  1OVY A;  3U8X A;  4LF9 K;  3ATU A;  1B9F A;  4NYF A;  4Z4C A;  2O8F B;  4DKW A;  1U47 A;  1Q9Y A;  3RR8 A;  3K58 A;  2A42 A;  3AVN A;  3O4Q A;  4FJJ A;  3MEE A;  1XQS C;  4QCL A;  2IS3 A;  3DRP A;  3M5R A;  5GIN A;  4DV7 K;  2JLE A;  3NGI A;  3V9U A;  3V6D A;  2O8F A;  3VQP A;  4BR0 A;  3OYF A;  3MAQ A;  4LFA K;  1HR0 K;  2P9L B;  2YCH A;  1E3M A;  3PSI A;  3LDO A;  4WQ4 A;  4DR5 K;  1OVQ A;  4RW8 A;  1GLA G;  2BUP A;  2F96 A;  3SQ0 A;  3EKS A;  1BA1 A;  4CJ5 A;  1CXQ A;  4BR2 A;  3P39 A;  1FKO A;  2ZJP L;  2HHH K;  4B3T K;  1T6D A;  4C1N I;  5I9E B;  4MDA A;  2HST A;  3KK1 A;  3C0B A;  4YFU A;  4DTS A;  1L3V A;  1WSH A;  3KZB A;  3NH2 A;  4BRE A;  2AA4 A;  1SUQ A;  1NGJ A;  4H0P A;  1ITG A;  1QSY A;  3Q7B A;  3SMP A;  2Y1I A;  4K43 A;  5C24 A;  3ZSZ A;  4BDP A;  2FF3 B;  3VQ5 A;  4I6M A;  3D0P A;  3KLH A;  3N4Q A;  1NJZ A;  4CEQ A;  1Q82 O;  4OKJ A;  4KTZ A;  3O9Q A;  5FPN A;  3C7N B;  4Z4H A;  4U67 L;  4WFN L;  4JKC A;  3G10 A;  2DTU A;  4CF1 A;  3CET A;  3ZLJ A;  4CEC A;  4BRN A;  5FDL A;  4DSF A;  3C7N A;  4FLT A;  3T1A A;  1TYQ B;  5C42 A;  4RTF D;  4RG8 A;  3SAF A;  1VSL A;  2W40 A;  4CGI A;  2NRR A;  4OLB A;  2PAV A;  4JAX A;  2CGK A;  3NF7 A;  4BE2 A;  1FW6 A;  5CYQ A;  5FRM A;  1TYQ A;  3TAM A;  4PHT X;  1IKY A;  3EZ5 A;  3OVN A;  1NM1 A;  1C0U A;  3E9O A;  3O80 A;  1WUA A;  3VEV A;  3E9P A;  3QNO A;  3DLL L;  1QS4 A;  3SAH A;  5AQR A;  3OJU A;  1RT3 A;  1GLB G;  4DF8 A;  1W2B M;  3QFP A;  2YHY A;  3OS0 A;  2OA8 A;  4A5A A;  3L4Q A;  4YOT A;  3WNE A;  3T19 A;  1XC3 A;  3DJC A;  4KHP K;  2HMI A;  1IG8 A;  3A5M C;  4JKH A;  3V9S A;  1RTD A;  2ASO A;  3PUF A;  1Q86 O;  2W42 A;  5FRN A;  3CME N;  4X65 K;  4BRL A;  3OYH A;  5I42 A;  4JS4 A;  1YF5 L;  3TWH A;  2QW9 A;  2E88 A;  4O8U A;  4HTL A;  1VQN N;  3M6G A;  3SQ4 A;  1RT7 A;  5BPL A;  3HOS A;  2YJE A;  3BZK A;  3QEI A;  2D0B A;  3HPG A;  3S41 A;  4PL8 A;  3PO5 A;  5HRO A;  3MEC A;  5AQV A;  1I3A A;  3PY8 A;  3VET A;  4Y1D A;  1K9M O;  5GAD P;  5HRS A;  4PQU A;  1NGH A;  2ZQB A;  3CFR A;  4C8N A;  1B9D A;  4JD2 A;  4CJP A;  3JS6 A;  4IFY A;  4KBO A;  3SQ1 A;  1K8K B;  1REV A;  1TKD A;  4IEE A;  3CQ8 A;  4MLE A;  1BWF O;  1VSK A;  4AM7 A;  2I7N A;  3P38 A;  3CM6 A;  3WUH A;  3DLK A;  1CZB A;  4BDZ A;  4FWN A;  1WSI A;  3F2K A;  4Z4I A;  3TAB A;  3LDP A;  4CD3 A;  1DTQ A;  4MO4 A;  2OPR A;  4N5S A;  2ATQ A;  1D5A A;  3HVT A;  3N4P A;  4FL9 A;  3KTQ A;  2P51 A;  2V51 B;  4QOZ B;  1RT4 A;  4IDH A;  3LAM A;  5AQX A;  4C8L A;  1R0A A;  5AQK A;  3KHY A;  4ELT A;  3O3H A;  4B1Z A;  3K0S A;  4JRQ A;  3MCP A;  3DOK A;  1A5W A;  1YAG A;  1CZ9 A;  1S6P A;  3VQD A;  4BGB A;  3MN5 A;  3ISN C;  3G6E N;  2QXL A;  1RTI A;  3ZSY A;  3ZSR A;  4CJU A;  4M63 C;  4BRF A;  2H3G X;  3DRS A;  1X3N A;  3R8E A;  3U3G A;  3PIP L;  1L3T A;  3K5L A;  4I9L A;  2QTD A;  4Y1C A;  5JLF A;  3NDK A;  4YNQ A;  1VSD A;  2HW3 A;  1BDG A;  3V4I A;  4CEB A;  4N76 A;  2QKK A;  1XI1 A;  3MED A;  1S1W A;  1FK9 A;  1HMV A;  2KZM A;  1ESV A;  4AQY K;  4H0Y B;  1TK8 A;  1BL3 A;  1QZ6 A;  1VSM A;  3AVC A;  4M45 A;  4ICL A;  4CIG A;  1BO5 O;  2QWL A;  2IC3 A;  4H8K A;  1T03 A;  1YJW N;  1ASV A;  4QAG A;  3UKU A;  2OZS A;  4O5F A;  3V1R A;  4CER A;  4JI2 K;  3KJV A;  1U04 A;  2OYQ A;  1K8A O;  1JLF A;  4JKD A;  2FBT A;  1XUP O;  2RF2 A;  5KQ8 A;  4ISG A;  3CJC A;  3BF3 A;  3SYZ A;  3HJF A;  3KKS A;  3K9J A;  4DFK A;  1TK5 A;  1Y97 A;  3TAN A;  4A2A A;  4CJR A;  3OYC A;  4GKK K;  2CH6 A;  3RVC A;  1SZ2 A;  4DR1 K;  4CZJ A;  3QBW A;  1N36 K;  4OX9 K;  3OBW A;  4O0I A;  2V7Y A;  3DXM B;  3CCV N;  5AQG A;  4GW6 A;  2O8C B;  2HBL A;  1NMD A;  4FJ7 A;  4KHQ A;  1CXU A;  4A61 A;  1NBW A;  4KH4 A;  1WOQ A;  4DTX A;  2P9S B;  3OS1 A;  4OLA A;  4HTU A;  4CBX A;  4ILH A;  1O13 A;  3LP2 A;  3LWM A;  2NNW A;  4PA1 A;  3VF6 A;  3VQ7 A;  3R9P A;  3WXJ A;  4CBU A;  2Z1I A;  4CES A;  3VQ4 A;  3MWP A;  4Q5V A;  4HUF A;  4C8O A;  3OTO K;  2OPP A;  2ZGZ A;  1C0G A;  3O08 A;  4FVM A;  4Z0U A;  2VYP A;  4KTW A;  1Y64 A;  1GLE G;  3J7A P;  1IV0 A;  4PL7 A;  1LWC A;  4H03 B;  3ID8 A;  4OKK A;  3NVK A;  2ZWH A;  1BIS A;  4DV2 K;  1K73 O;  1Q9X A;  2QWQ A;  3VQC A;  1KRP A;  3O1B A;  4FPA A;  1RTH A;  2UUB K;  4KHY A;  1TVR A;  1D4X A;  2XHB A;  4IBN A;  1MWK A;  1NGI A;  2A40 A;  2A1S A;  3VGL A;  2VG6 A;  4PY5 A;  2VQF K;  3A5L C;  3GG4 A;  3ZSX A;  3NBP A;  3KK3 A;  5DK5 A;  5BN8 A;  1KSP A;  1GLJ O;  5J2P A;  2KZZ A;  2O8D B;  3OW2 M;  4GMJ B;  3E9L A;  4AIL C;  3VEZ A;  3THX A;  1J53 A;  3UKR B;  2F4V K;  2E5L K;  1WSG A;  4BRG A;  4JV5 K;  2O8D A;  3AVM A;  4FJK A;  4R79 A;  1LWE A;  5LMU K;  2KFZ A;  1S1T A;  4KH5 A;  4FM2 A;  1L5U A;  5J2M A;  1KCF A;  3FE1 A;  4WFA L;  3LZI A;  2ZF5 O;  1A5X A;  1SKW A;  3TTF A;  2Q0U A;  3OBY A;  5DMR A;  3U9Z A;  4WFB L;  3AVL A;  5J1E A;  1XMO K;  3EKU A;  4O55 A;  4H4M A;  3T1Y K;  4N47 A;  3MN9 A;  1RT6 A;  4AHT A;  1N33 K;  3VQ9 A;  4DUZ K;  2PYJ A;  1JJ2 M;  2VG5 A;  4M7X A;  3AO5 A;  4CIE A;  3CQX A;  1EQY A;  5J2N A;  3CFP A;  4KO0 A;  1OH6 A;  3ULE B;  5J2Q A;  2UUA K;  1QVG M;  4JKB A;  4CD1 A;  3KIO A;  4DR6 K;  2B6A A;  4IFV A;  2HVI A;  3ULE A;  2HHW A;  5A2Q O;  2HF4 A;  4B9Q A;  3NH1 A;  1C1C A;  5AZI B;  4OPA A;  3DWL A;  4FZX C;  3DLG A;  4EP5 A;  4JI8 K;  5AZJ B;  5AZI A;  2FSK A;  2JWL A;  2RHK A;  1FXX A;  3HBT A;  3LZJ A;  2QWN A;  1NJY A;  1IKW A;  1FKP A;  1SS6 A;  4YY3 K;  3MEG A;  4IJA A;  3QEW A;  4FJN A;  3ZEU B;  3O5B A;  3BEX A;  4E0D A;  3V81 A;  4PKH A;  3O4N A;  4WQ4 C;  3ZET B;  1HLU A;  1M90 O;  1IBM K;  3WEE A;  4DTN A;  1JLB A;  4FLY A;  3RRG A;  3ZEU A;  3SBT A;  4BQL A;  1J5O A;  5M1Q A;  3MCA B;  2D1K A;  1X9S A;  2G8K A;  2FXU A;  4BE1 A;  5CYM A;  4F8R A;  3TTC A;  4CGD A;  1U45 A;  1BA0 A;  1NK9 A;  1RFQ A;  4B9S A;  1WNS A;  3AVI A;  1VQO N;  3CCL N;  4E7I A;  3VQB A;  2A3Z A;  1Z26 A;  2YHW A;  4CJK A;  4KKO A;  4FCY A;  4FJL A;  2AP1 A;  3KLG A;  3LDS A;  1NGB A;  1YTU A;  2KKZ A;  3QEV A;  1OH5 A;  4JLH A;  4H5V A;  5AQY A;  3ZX0 A;  4UY8 O;  3UB5 A;  4CJ3 A;  3H46 O;  2XO7 A;  2HHT A;  1LCU A;  1NJW A;  1YIJ N;  3I56 N;  2RKI A;  3FZF A;  3J8A A;  2P9P A;  3SZ2 A;  3OYA A;  3SK3 A;  5LMN K;  2D4W A;  3CER A;  4CJ4 A;  4YOV A;  3KVG A;  3VEW A;  5FLX O;  1BU6 O;  1VSI A;  4TSX A;  3A5N C;  4KB1 A;  3TAR A;  1TUU A;  1N5Y A;  1RT5 A;  4CJE A;  5TKW A;  2BGG A;  2DFF A;  2X6S A;  4BRD A;  3HK2 A;  3AVJ A;  4F3O A;  1HPZ A;  1QHT A;  4PWD A;  2Z1J A;  2B4J A;  4LH5 A;  1KD1 O;  2KTQ A;  2W6L A;  3H6E A;  3U6F A;  3U9D A;  2HND A;  2HNY A;  4DTM A;  3VA0 A;  2WBN A;  5FPD A;  4DSK A;  3D6R A;  3ZYY X;  5CE3 A;  3JSM A;  5F2R A;  4JYA K;  3D2E B;  5M1K A;  1JLA A;  5LJV A;  3G4S N;  2X78 A;  3WNF A;  2JWK A;  2CH5 A;  2GX9 A;  2P9U B;  1Z05 A;  3AAR A;  3CC7 N;  3IFR A;  1LAV A;  5M1N A;  3DXK B;  3EE8 A;  3MDQ A;  3K59 A;  1X9M A;  2EX3 A;  3ZT4 A;  3C6H A;  5C25 A;  3L2Q A;  2HBJ A;  3S3M A;  2Z1G A;  3I55 N;  4ZTJ A;  3TI0 A;  1S1V A;  4IO9 L;  4IXC A;  3CPW M;  3VGK A;  1MU2 A;  1MWM A;  2QWO A;  1U48 A;  4FLX A;  1NMN A;  4FW1 A;  4YOX A;  5C15 A;  1SKR A;  1T05 A;  1RDU A;  1T6C A;  4DUY K;  1W7A A;  3ZSW A;  1T8E A;  3ID6 A;  5EY4 A;  2BDP A;  4FJM A;  2Z1H A;  4KH6 A;  3KWG A;  2P9L A;  4CF2 A;  4JEP A;  4LF6 K;  1RDW X;  3JAM O;  3BUZ B;  5HLF A;  3JYT A;  3MXI A;  3RRH A;  3O9S A;  1DTT A;  1IBL K;  1WLJ A;  3NGY A;  5SWM A;  3GOI A;  1T3V A;  4A5B A;  1U49 A;  1BCM A;  2A5X A;  4B3S K;  5EXW A;  1Z25 A;  3F73 A;  2GUP A;  2XRI A;  4JKE A;  4XH5 A;  4FLW A;  3FR0 A;  4UQG A;  5BRD A;  4FWP A;  3DLR A;  4BE0 A;  3OYG A;  3LDL A;  4BDY A;  3QNN A;  4EFH A;  1VQ8 N;  3HOT A;  4NXN K;  4V19 S;  3AVG A;  2A6A A;  3O6W A;  3QBX A;  3IAY A;  4FZY A;  4NLC A;  1WSE A;  3W3D A;  1QTM A;  3OYK A;  5CZ1 A;  1U2V B;  4JI5 K;  1W9H A;  5JS1 A;  2RN2 A;  4CJV A;  1RDD A;  2YI1 A;  4GVM A;  2PFU A;  4NCG A;  5GAG P;  4C8K A;  2VGM A;  1NGF A;  4LF5 K;  1IO2 A;  4EZ6 A;  1GLL O;  1S9E A;  4M3W A;  4K0K K;  4DQQ A;  3LWL A;  2YHA A;  4JI4 K;  3BF1 A;  3LPT A;  2YNI A;  3O9T A;  5C2F A;  3FZL A;  2G8W A;  4KI6 A;  4M7Y A;  2GEL A;  1HUX A;  3G25 A;  1EP4 A;  2G8F A;  2D0A A;  3AO1 A;  4H0O A;  4OKE A;  3L6Q A;  2R7Y A;  2P9I B;  4CJQ A;  5BRF A;  4B9U A;  4YOR A;  4B1X B;  4Q0B A;  4FJG A;  2NRX A;  4E7K A;  1N32 K;  1N6Q A;  3SV4 A;  3CCM N;  3L2U A;  2O4G A;  2P9I A;  4DQP A;  4CGG A;  4WYB A;  2WTU A;  3HP6 A;  3ATV A;  1JLC A;  4CFD A;  4NCB A;  3CI5 A;  2UXD K;  3RMC A;  3T69 A;  2FC0 A;  3VGM A;  1C1B A;  2DPN A;  4EIA A;  4IOA L;  4DSI A;  4GNI A;  3SQ2 A;  3HM8 A;  4M3T A;  3P83 D;  4FM1 A;  3A0I X;  5KGW A;  2GUI A;  4CED A;  3A5O C;  3KLF A;  4LFB K;  1HJR A;  4FVU A;  4CZM A;  4H5R A;  3C65 A;  4NB4 A;  3ZT0 A;  3ZX3 A;  4CIF A;  1G15 A;  2E2P A;  3QML A;  3C94 A;  4KHS A;  4JNE A;  1BOT O;  2PBD A;  3V1Q A;  3ITH A;  3PLA A;  1NLV A;  2Q0R A;  1HNX K;  4Z94 A;  4OJR A;  3HRG A;  1T7P A;  2GWK A;  1LW2 A;  3PIO L;  4AHR A;  1GLC G;  5B8H A;  2GBZ A;  3O4W A;  3TAG A;  4DR7 K;  4CEA A;  1BGX T;  1P90 A;  4BG8 A;  2VG7 A;  4OPJ A;  3NF8 A;  4B9V A;  4CF9 A;  2F8T A;  1EKE A;  3R1X A;  3Q7C A;  4DFJ A;  3SUN A;  3O3F A;  1QQN A;  1VSJ A;  3QIC A;  2UU9 K;  1KLM A;  5F1X A;  1VRT A;  2QKB A;  4FJI A;  4AM6 A;  1L3U A;  1K8K A;  5HOO A;  3SNN A;  3EY1 A;  4K41 A;  4L3Q A;  3IDH A;  3DM2 A;  5EOY A;  4AHV A;  4QS8 A;  1RBS A;  2NLX A;  3CCS N;  3ULD A;  3V1O A;  3NFA A;  3CCR N;  1LWF A;  4F9O A;  4E19 A;  4DS5 A;  4BRP A;  4NCA A;  3VN5 A;  3D45 A;  4FOI A;  1E4G T;  4B3M K;  1GLD G;  3SAG A;  3MX5 A;  1OH8 A;  3KD5 E;  4LSN A;  3ZSO A;  3OS2 A;  4B3O A;  3NGZ A;  2JGU A;  2FBV A;  3AO4 A;  4KTQ A;  3C6T A;  3I0S A;  4NYN A;  1BUP A;  1TAU A;  5ADX H;  4I2Q A;  1DKG D;  2QI2 A;  1VSE A;  3CM5 A;  1EWQ A;  3CCU N;  5AQW A;  2ZM6 K;  1YVN A;  4B08 A;  4R5P A;  4C23 A;  1ATR A;  1JKH A;  1VRU A;  2E2Q A;  5AQJ A;  3THY B;  5LJW A;  2YNH A;  3WQT A;  5AJ3 K;  4DV5 K;  4RW7 A;  4BC5 A;  3K5M A;  1RDC A;  4J8F A;  4DV3 K;  1N34 K;  1RBT A;  1S1U A;  1QVF M;  1RT1 A;  4AHC A;  1XMQ K;  4DTJ A;  3L4I A;  2NZT A;  2WON A;  3AVH A;  1TUY A;  1L3S A;  3SCX A;  4JN4 A;  4MLH A;  4I7F A;  5AQN A;  3MN6 A;  2HHX A;  4B9L A;  4HCC A;  4JK9 A;  2IVP A;  4JKG B;  5C10 A;  1NJI O;  1JLQ A;  5IT9 O;  1YJN N;  3CC2 N;  4E1M A;  1A5V A;  4BQZ A;  4K8X A;  2HHS A;  3H3O B;  4DU3 A;  4CJF A;  5EX5 A;  1RTJ A;  1HNW K;  3M8Q A;  1D8Y A;  5GAH P;  4G1Q A;  1B92 A;  4I2P A;  3CFO A;  5GAE P;  1NKB A;  1R59 O;  3KWI A;  3TR8 A;  2E8A A;  2P5G A;  2E4L A;  1KAZ A;  1YUW A;  2FSJ A;  1UA1 A;  3DXM A;  4QS7 A;  4FK0 A;  3VEY A;  2HHU A;  2O8C A;  1IH7 A;  4DV6 K;  2O8B B;  4W5O A;  4RCH A;  3HXM A;  1S72 N;  1VQL N;  1ZXO A;  2X74 A;  2P9S A;  1NGA A;  3FFK B;  4CFA A;  2D0O A;  2IAJ A;  1JL1 A;  3HI0 A;  4Y0W A;  3MWT A;  5AQP A;  3VOV A;  5AQT A;  4A2B A;  1RNH A;  4KRE A;  5AQH A;  4CK2 A;  3LP1 A;  2IVN A;  2A41 A;  3CMA N;  1YI2 N;  1ZBI A;  3CIP A;  4CHN A;  2ZJR L;  1HQU A;  3CG7 A;  3OY9 A;  4EHU A;  3WNG A;  1ZC6 A;  3AA4 A;  2ZE2 A;  3MXJ A;  4JK7 A;  4C1N K;  4RW9 A;  2HF3 A;  3QO9 A;  4BRH A;  4AHS A;  5F0X A;  4IJN A;  1YT3 A;  1HPM A;  1X9W A;  3SJJ A;  4DV1 K;  2YHX A;  3H3N O;  1VSF A;  4FPB A;  4YHH K;  1HNI A;  2QEX N;  3I33 A;  3HL8 A;  1NOY A;  3ENH A;  4QS9 A;  4J2D A;  3R3L A;  3OYL A;  5EU7 A;  3G0Z A;  1C0T A;  4YDU A;  3OJS A;  3G71 N;  1RCH A;  5KI6 A;  1ASU A;  3UKR A;  3ZT1 A;  5KTQ A;  4IKF A;  4XIU A;  4ELV A;  2DFE A;  2UYT A;  3TU5 A;  2LSN A;  4EZ9 A;  1CZA N;  1IG9 A;  3CJ9 A;  4ZHR A;  5E41 A;  4BR5 A;  1Z6R A;  3PX0 A;  4O4G A;  1IKX A;  4B1U B;  2QXF A;  4WQ5 A;  4J2A A;  3VPZ A;  3CC4 N;  1VQ9 N;  2D5R A;  3AAQ A;  3VEO A;  3VF2 A;  2E1Z A;  2ETJ A;  3ASM A;  4AHU A;  4EAH D;  5KGX A;  3LPU A;  3QEP A;  2CGJ A;  4PKI A;  3RMB A;  3HYF A;  2PYL A;  4KB0 A;  3IUC A;  3DOL A;  2Q36 A;  4IFE A;  1NU0 A;  4JKF A;  1BG3 A;  4BRM A;  1MDU B;  3THW B;  1VSH A;  1VQP N;  1BCO A;  3TPQ A;  5M1O A;  4XH1 A;  5E26 A;  1OH7 A;  2P9K B;  3WXI A;  1KVC A;  2FSN A;  1VK0 A;  3L2V A;  4BRC A;  1XWL A;  1W0H A;  2P5O A;  3S9H A;  2OAN A;  2HVH A;  4FLV A;  5T7B A;  4E7L A;  3WXK A;  5AZJ A;  3CYM A;  4BG9 A;  3QIO A;  5M1P A;  1KFD A;  2BE2 A;  3IRX A;  3M3Z A;  1D9D A;  3FFI A;  3TSU A;  1JXB A;  2KHO A;  3E01 A;  3F5T A;  1HQE A;  1IBK K;  3ZET A;  4LF7 K;  4FYD A;  1KC8 O;  1WBD A;  4BY9 C;  4B1W B;  4DQS A;  3DLE A;  2FLO A;  2ITG A;  2V52 B;  3I0R A;  1HNV A;  4CBW A;  5ADX A;  1S1X A;  3VES A;  1JCF A;  4ELU A;  3TAQ A;  1HJO A;  5AQU A;  3T3F A;  3EYZ A;  3P1G A;  5GIO A;  1UOC A;  2WFB A;  3U4L A;  1HKC A;  1ZYQ A;  1Q18 A;  3GDQ A;  5K14 A;  4AH9 A;  4FLZ A;  4FK4 A;  3KK7 A;  5FPM A;  4OPK A;  3D7E O;  5H1S Q;  5AQI A;  5HL7 L;  2OPS A;  2NRW A;  1E4F T;  1QHA A;  4OVL A;  1HNZ K;  3OHR A;  2XY5 A;  4F4K A;  4FWQ A;  3F9M A;  4OGE A;  3IS9 A;  3MXM A;  3CQY A;  3NAE A;  1RDB A;  1S5J A;  1NK4 A;  3P4I A;  4CK1 A;  4CF0 A;  1Q8I A;  4LFC K;  3LAN A;  4N56 A;  4KHN A;  2EWS A;  1HRH A;  2WC9 A;  2YKM A;  4CEE A;  4DQR A;  2HBM A;  3KLE A;  2E2O A;  5C2D A;  3PX4 A;  2W6K A;  4DLG A;  1S6Q A;  4DSL A;  2AJQ A;  1K6Y A;  1NK5 A;  3K5O A;  1VQ4 N;  3EO3 A;  3WT0 A;  1WB9 A;  2A1R A;  1DGK N;  1VQM N;  2RE2 A;  4CZF A;  4BRO A;  3WQU A;  4CHQ A;  4FJX A;  5AQM A;  3IKM A;  4A62 A;  1NNE A;  4K8Z A;  4HVJ A;  3ZCM A;  4N41 A;  4YOU A;  5KRS A;  3UE5 A;  3B8A X;  2BTF A;  2HHV A;  3FLC O;  3QIN A;  2W41 A;  4FZZ A;  4Z4E A;  2Q3S A;  1QQC A;  3KKR A;  4BWJ A;  3WNH A;  2OTJ N;  1JL2 A;  1BI4 B;  4KHU A;  2F7T A;  3HSC A;  2G8V A;  3TSQ A;  1GOB A;  3D2E A;  3DYA A;  4DFM A;  3O9R A;  5JVG L;  2P9U A;  3OYI A;  3BGR A;  2F9W A;  2FF6 A;  3F9K A;  3VTI A;  1JLG A;  1WSF A;  3DXK A;  3CJ7 A;  3DMJ A;  4O0J A;  2IDO A;  2I5J A;  4ZTF A;  4WE1 A;  4O8K A;  3CCJ N;  4BVP A;  1TKX A;  3OYM A;  1SKS A;  3EZW A;  1BHL A;  3VEN A;  4AF1 A;  5AQL A;  2QWR A;  3FZM A;  2UXB K;  4J2B A;  4X66 K;  2YHB A;  4NO7 A;  5I3U A;  1T44 A;  3MMV A;  3VF4 A;  1RBR A;  1XNR K;  4DQ8 A;  3CPE A;  2OPQ A;  4FWK A;  1ATN A;  4DFP A;  3LL3 A;  4IOX A;  4C8M A;  4M3Z A;  3V9W A;  4KI4 A;  3PSF A;  3NCI A;  3K9K A;  1NOZ A;  4IG3 A;  4YOY A;  4CZH A;  1WAF A;  4H0X B;  1ATS A;  2ITM A;  1NKC A;  2EHG A;  4MDB A;  4WF9 L;  1YJ9 N;  4DB3 A;  3HPO A;  2RPI A;  4NLB A;  1O1W A;  4FW2 A;  5LL6 Z;  3MK6 A;  4E1J A;  2VCP A;  1TGO A;  1KAX A;  3M1F A;  1RBU A;  4I6M B;  5DM7 L;  3E1Y A;  2QWM A;  4BR9 A;  1TKT A;  3FZH A;  1QSS A;  2VWB A;  4LF8 K;  3ZSV A;  3C6U A;  2G8U A;  1U2V A;  1HKB A;  4ILG B;  4CGJ A;  2D0C A;  4HHT A;  3NH0 A;  4DWI A;  3GE1 A;  2F8S A;  5AFU H;  2BH1 A;  3AA5 X;  1JLE A;  2HB5 A;  4JS5 A;  2QM1 A;  4U7B A;  3SI6 A;  4ILJ A;  3DAW A;  3I8D A;  1S22 A;  1JCG A;  1XHZ A;  2Q2R A;  5HRR A;  4NXM K;  1LV5 A;  3EL2 A;  4CJT A;  3TAF A;  2KFN A;  3ALY A;  4FLU A;  4BC4 A;  3AV9 A;  4CHY A;  1UWB A;  1XC9 A;  5HRN A;  3CHW A;  2FBY A;  2OTL N;  4H0T B;  1X3M A;  2X6N A;  1QE1 A;  1Q81 O;  3HST B;  4CK3 A;  3RTV A;  1NKE A;  4BR4 A;  3HM9 A;  3UIQ A;  1J9A A;  1IKV A;  1FJG K;  1X9J A;  3C6A A;  4B8C A;  4M3Y A;  2HBK A;  1ZBL A;  4OPH A;  4ISE A;  4RWT A;  4B1Y B;  1VQ7 N;  3QEX A;  1J6Z A;  3NHG A;  3CXC M;  3THV A;  3OYN A;  5AR0 A;  5GIP A;  3VTH A;  4JRP A;  4FWM A;  5BRH A;  1JXE A;  3L0Q A;  4DTR A;  4OO1 J;  2Y1J A;  4DCH A;  3TAP A; 
#chains in the Genus database with same CATH homology
 4CF8 A;  3NH1 A;  3C95 A;  1C1C A;  4G1Q A;  1B92 A;  2DFH A;  2B5J A;  3CFO A;  4I2P A;  4IG0 A;  1NKB A;  4J2E A;  4FZX C;  3DRR A;  3DLG A;  1BIU A;  4DLE A;  3TR8 A;  2P5G A;  4EP5 A;  3LP0 A;  2E4L A;  5KRT A;  3L3U A;  1B9F A;  1KVA A;  4NYF A;  4Z4C A;  4FM0 A;  3TAE A;  4IDK A;  1ZBF A;  1U47 A;  1Q9Y A;  1UA1 A;  2KZZ A;  1FXX A;  3RR8 A;  3LZJ A;  3K58 A;  1NJY A;  1IKW A;  1FKP A;  3AVN A;  3O4Q A;  3MEG A;  3QEW A;  3K2P A;  3MEE A;  4FJJ A;  4FJN A;  4FK0 A;  3B6P A;  4QCL A;  2IS3 A;  3DRP A;  2IGI A;  4E0D A;  3V81 A;  1IH7 A;  2HHU A;  2JLE A;  3NGI A;  3V9U A;  4W5O A;  4M3R A;  1KFS A;  3O4N A;  3HXM A;  3V6D A;  2X74 A;  3ZT2 A;  3VQP A;  4DTN A;  1JLB A;  4CFA A;  3OYF A;  3MAQ A;  4FLY A;  2IAJ A;  3RRG A;  1JL1 A;  3PX6 A;  1KVB A;  1J5O A;  1RDA A;  4CJL A;  4FXD A;  3L8B A;  1YTA A;  3AO2 A;  4MQ3 A;  1X9S A;  2G8K A;  4BE1 A;  5CYM A;  4F8R A;  2O4I A;  4CGD A;  1U45 A;  1RNH A;  1NK9 A;  4B9S A;  4KRE A;  4CK2 A;  4RW8 A;  3LP1 A;  1WNS A;  2F96 A;  3AVI A;  3SQ0 A;  1ZBI A;  4E7I A;  3VQB A;  4CHN A;  1GOC A;  4DS4 A;  4CJ5 A;  1CXQ A;  1HQU A;  3CG7 A;  3OY9 A;  1Z26 A;  3WNG A;  1FKO A;  2YNF A;  3AA4 A;  3AVK A;  2ZE2 A;  3MXJ A;  4RW9 A;  1C6V A;  4CJK A;  4EP4 A;  3QO9 A;  4KKO A;  4YFU A;  3KK1 A;  3SUO A;  4DTS A;  4AHS A;  1L3V A;  1WSH A;  3NF6 A;  4FCY A;  3SUP A;  4FJL A;  1YTU A;  3KLG A;  3LDS A;  3NH2 A;  1NK7 A;  1SV5 A;  1YT3 A;  1SUQ A;  3QEV A;  1EX4 A;  4DSJ A;  1ITG A;  4M41 A;  1X9W A;  3SJJ A;  1QSY A;  4CCH A;  3K57 A;  4JLH A;  1VSF A;  2Y1I A;  3KLI A;  5C24 A;  3ZSZ A;  4BDP A;  2BAN A;  3VQ5 A;  4CJ3 A;  1HNI A;  4OGC A;  2XO7 A;  3D0P A;  2HHT A;  3KLH A;  3HL8 A;  1NOY A;  1WAJ A;  4B8A B;  1NJZ A;  4CEQ A;  1NJW A;  4J2D A;  3OYL A;  5EU7 A;  3G0Z A;  2QK9 A;  4OKJ A;  4KTZ A;  4HCB A;  1C0T A;  3OJS A;  4Z4H A;  2E6M A;  2RKI A;  3G10 A;  2DTU A;  3SZ2 A;  1RCH A;  4CF1 A;  5KI6 A;  4O44 A;  3OYA A;  1ASU A;  4CEC A;  3ZT1 A;  5FDL A;  4DSF A;  4CJ4 A;  5KTQ A;  5FRO A;  4IKF A;  4FLT A;  1VSI A;  4TSX A;  3T1A A;  4XIU A;  4ELV A;  4KB1 A;  5C42 A;  2DFE A;  3TAR A;  4RG8 A;  1N5Y A;  1RT5 A;  1VSL A;  2LSN A;  4CGI A;  4EZ9 A;  1IG9 A;  4CFC A;  3AA2 A;  4KAZ A;  4OLB A;  4CJE A;  4ZHR A;  5E41 A;  2BGG A;  3NF7 A;  3M8R A;  4BE2 A;  3PX0 A;  2DFF A;  4O4G A;  2X6S A;  5CYQ A;  3VQ8 A;  1IKX A;  3HK2 A;  1TK0 A;  5FRM A;  2QXF A;  3AVJ A;  4F3O A;  1HPZ A;  1TL3 A;  1YVU A;  1QHT A;  3TAM A;  4J2A A;  1IKY A;  2D5R A;  3EZ5 A;  3OVN A;  1C0U A;  4PWD A;  2Z1J A;  2B4J A;  3PO4 A;  2ETJ A;  3ASM A;  4LH5 A;  4MFB A;  1KTQ A;  3QNO A;  2KTQ A;  1QS4 A;  4AHU A;  3AO3 A;  3NF9 A;  5KGX A;  3K5N A;  3LPU A;  3U6F A;  3QEP A;  2HND A;  3OJU A;  3NE6 A;  1ASW A;  2HNY A;  3L3V A;  3RMB A;  3HYF A;  2PYL A;  4KB0 A;  1RT3 A;  4DTM A;  4DF8 A;  3DOL A;  3VA0 A;  1NK0 A;  4DSK A;  3JSM A;  3OS0 A;  2OA8 A;  1JLA A;  5CY4 A;  4LSL A;  2X78 A;  1C0M A;  3WNF A;  4KTQ A;  3WNE A;  1VSH A;  1BCO A;  3T19 A;  1KLN A;  1LAV A;  4FK2 A;  1BQM A;  2HNZ A;  2HMI A;  1RTD A;  3V9S A;  2PY5 A;  3PUF A;  1KVC A;  2GV9 A;  1ZBH A;  2W42 A;  5FRN A;  3LAL A;  3K59 A;  3V9Z A;  1VK0 A;  3L2V A;  1S9G A;  1X9M A;  1XWL A;  2EX3 A;  3ZT4 A;  3OYH A;  4CHP A;  1F21 A;  1W0H A;  5C25 A;  3L2Q A;  4JS4 A;  5I42 A;  3TWH A;  2P5O A;  4ID5 A;  2XY7 A;  3S9H A;  3S3M A;  1D9F A;  2Z1G A;  2DY4 A;  3S3N A;  2E6L A;  3S3O A;  4FLV A;  5T7B A;  4E7L A;  2HVH A;  5HRP A;  4ZTJ A;  3TI0 A;  2YKN A;  1S1V A;  3SQ4 A;  3CYM A;  1EXQ A;  4KHW A;  1RT7 A;  3QIO A;  1MU2 A;  1U48 A;  1KFD A;  2BE2 A;  3IRX A;  4FLX A;  3FFI A;  4FW1 A;  3QEI A;  1D9D A;  2D0B A;  3HPG A;  1SKR A;  1JXB A;  1T05 A;  3PO5 A;  3E01 A;  4Z4G A;  5HRO A;  1HQE A;  3MEC A;  3ZSW A;  2KW4 A;  2HHQ A;  1I3A A;  3B6O A;  1HYZ A;  1T8E A;  3LP3 A;  2BDP A;  4FYD A;  3PY8 A;  4DF4 A;  2Z1H A;  4FJM A;  4DQS A;  4Y1D A;  3DLE A;  4CF2 A;  2ITG A;  4KV8 A;  4LY7 A;  5HRS A;  2ZQB A;  3CFR A;  3I0R A;  4PQU A;  4C8N A;  1B9D A;  1HNV A;  5HLF A;  3JYT A;  3MXI A;  3RRH A;  4M42 A;  3O3G A;  4CJP A;  4IFY A;  4LD0 A;  1DTT A;  1WLJ A;  3SQ1 A;  1S1X A;  1REV A;  3HPH A;  3NGY A;  5SWM A;  1TKD A;  3CQ8 A;  4ELU A;  3QES A;  1U49 A;  3TAQ A;  1BCM A;  3V9X A;  1VSK A;  3T3F A;  1Z25 A;  3EYZ A;  3CM6 A;  3P1G A;  3DLK A;  3F73 A;  1CZB A;  1UOC A;  2XRI A;  4DMN A;  5SZT A;  4BDZ A;  1WSI A;  4FLW A;  1UA0 A;  3QER A;  3TAB A;  4Z4I A;  1ZYQ A;  1DTQ A;  4UQG A;  5K14 A;  4FLZ A;  4AH9 A;  2OPR A;  4FK4 A;  3DLR A;  4N5S A;  4BE0 A;  1TV6 A;  2ATQ A;  4OPK A;  1D5A A;  3OYG A;  4E7J A;  4BDY A;  4E1N A;  3QNN A;  2NUB A;  3HVT A;  4Z4F A;  3AVG A;  2OPS A;  3KTQ A;  2P51 A;  4F3T A;  3IAY A;  3SPY A;  4FZY A;  1RT4 A;  4OVL A;  4QOZ B;  3AVA A;  1WSE A;  3LAM A;  2XY5 A;  4C8L A;  1QTM A;  3OYK A;  4F4K A;  1R0A A;  5CZ1 A;  2FBX A;  4OGE A;  1EET A;  1W9H A;  3IS9 A;  4O5B A;  2RN2 A;  4CJV A;  5JS1 A;  3MXM A;  4ELT A;  1LW0 A;  3O3H A;  3DI6 A;  4JRQ A;  1RDD A;  3DOK A;  4GVM A;  1A5W A;  1RDB A;  1S5J A;  4NCG A;  3NAE A;  1NK4 A;  4C8K A;  4CK1 A;  1CZ9 A;  4CF0 A;  1S6P A;  1Q8I A;  1IO2 A;  1QSL A;  1S9E A;  3VQD A;  4EZ6 A;  4M3W A;  3ISN C;  3LAN A;  1U4B A;  4DQQ A;  4N56 A;  3LWL A;  4KHN A;  1RTI A;  4LH4 A;  3ZSR A;  3ZSY A;  4CJU A;  1HRH A;  4FJ5 A;  4F2S A;  3DRS A;  2YHA A;  2YKM A;  4CEE A;  3U3G A;  4E7H A;  4DQR A;  3KLE A;  3VQE A;  1L3T A;  3K5L A;  1RBV A;  3LPT A;  3PX4 A;  3OYE A;  4I9L A;  2YNI A;  1GOA A;  4Y1C A;  4DLG A;  1S6Q A;  2G8H A;  4DSL A;  2G8W A;  4KI6 A;  3NDK A;  1C1A A;  4DU4 A;  2AJQ A;  4YNQ A;  1EP4 A;  1K6Y A;  4CEF A;  3K5O A;  1NK5 A;  2G8F A;  4I9Q A;  2D0A A;  3AO1 A;  1VSD A;  4OKE A;  4BWM A;  4DU1 A;  2HW3 A;  4CE9 A;  4FJ9 A;  2R7Y A;  3V4I A;  4CEB A;  2A1R A;  3VQQ A;  4N76 A;  2QKK A;  1XI1 A;  3MED A;  1S1W A;  1UAX A;  3H08 A;  4CJQ A;  3RR7 A;  1FK9 A;  1HMV A;  1HYV A;  4W5T A;  1LAW A;  4B9U A;  2KZM A;  4CHQ A;  4FJX A;  4Q0B A;  3P5J A;  4E7K A;  4FJG A;  1TK8 A;  1N6Q A;  3SV4 A;  1BL3 A;  4K8Z A;  4HVJ A;  3ZCM A;  1VSM A;  5KRS A;  4N41 A;  3AVC A;  4M45 A;  4ICL A;  4CIG A;  4CHO A;  3L2U A;  2O4G A;  2IC3 A;  3QIN A;  4HUE A;  1NK8 A;  3L2W A;  4DQP A;  4FZZ A;  4H8K A;  4CGG A;  1T03 A;  4CFB A;  4Z4E A;  2Q3S A;  1QQC A;  4CGH A;  3KKR A;  1ASV A;  1JLC A;  4QAG A;  4BWJ A;  3IG1 A;  4CFD A;  3HP6 A;  2OZS A;  4NCB A;  2VWK A;  3V1R A;  3WNH A;  4CER A;  3RMC A;  3KJV A;  1U04 A;  2FC0 A;  2OYQ A;  1C1B A;  1JL2 A;  1BI4 B;  1JLF A;  4KHU A;  2FBT A;  4DSI A;  3SQ2 A;  4B9M A;  3QLH A;  2RF2 A;  4BAC A;  1TL1 A;  3P83 D;  4FM1 A;  5KGW A;  2G8V A;  4M3T A;  1GOB A;  3DYA A;  2GUI A;  4CED A;  3KLF A;  4ID1 A;  4DFM A;  1HJR A;  3HJF A;  3SYZ A;  1NK6 A;  3KKS A;  3OYI A;  3ZT0 A;  4DFK A;  3BGR A;  1TK5 A;  1Y97 A;  4DTO A;  3BDP A;  3F9K A;  4B9T A;  3TAN A;  3OYB A;  1JLG A;  1WSF A;  4RW4 A;  4CIF A;  4CJR A;  3OYC A;  1G15 A;  1WSJ A;  4O0J A;  3DMJ A;  1TAQ A;  2PZS A;  2IDO A;  2I5J A;  2WOM A;  3C94 A;  4ZTF A;  4KHS A;  4WE1 A;  5HBM A;  3L2R A;  3V1Q A;  3ITH A;  4O0I A;  3SPZ A;  3M8P A;  1HYS A;  1TKX A;  3OYM A;  1SKS A;  1SL1 A;  4OJR A;  1NJX A;  4GW6 A;  1T7P A;  3OYJ A;  1BHL A;  4FJ7 A;  4KHQ A;  1CXU A;  1LW2 A;  4AHR A;  3VQ6 A;  1RT2 A;  4DTX A;  3OS1 A;  1BIZ A;  4H4O A;  2GBZ A;  4HTU A;  5JS2 A;  4KPY A;  4OLA A;  3VA3 A;  3LP2 A;  3LWM A;  3TAG A;  4CEA A;  4F2R A;  1BGX T;  3M8S A;  4PA1 A;  4J2B A;  2VG7 A;  2YHB A;  3VQ7 A;  4FJ8 A;  2YNG A;  1RIL A;  3VQA A;  4OPJ A;  3ZT3 A;  4W5N A;  4KRF A;  1CLQ A;  3NF8 A;  4B9V A;  2Z1I A;  4CF9 A;  5I3U A;  5D3G A;  2F8T A;  2KQ2 A;  1EKE A;  1SL0 A;  4CES A;  5HP1 A;  1J54 A;  3VQ4 A;  1RBR A;  4Q5V A;  4HUF A;  4DFJ A;  4C8O A;  2OPP A;  3RWU A;  3QIP A;  3SUN A;  3O3F A;  4FVM A;  4DQI A;  1VSJ A;  2OPQ A;  2P1J A;  4Z0U A;  3SV3 A;  4CJW A;  4DFP A;  4KTW A;  4C8M A;  4M3Z A;  1KLM A;  1VRT A;  2QKB A;  3V9W A;  3DLB A;  4B9N A;  4KI4 A;  4FJI A;  3NCI A;  4E89 A;  1LWC A;  1NOZ A;  4IG3 A;  3SNN A;  1L3U A;  4OKK A;  4HUG A;  3EY1 A;  3PV8 A;  1WAF A;  3U3Y A;  1BIS A;  1Q9X A;  1BQN A;  1NKC A;  2EHG A;  4CHZ A;  4PUO A;  3VQC A;  3DM2 A;  1KRP A;  1ZBU A;  2ZD1 A;  4AHV A;  3HPO A;  1RTH A;  1RBS A;  3ULD A;  2RPI A;  3V1O A;  3NFA A;  1LWF A;  4KHY A;  1O1W A;  1TVR A;  4FW2 A;  4DG1 A;  2XHB A;  4E19 A;  4DS5 A;  4IBN A;  1TGO A;  4NCA A;  3VN5 A;  3D45 A;  2OZM A;  1RBU A;  2A1S A;  2VG6 A;  4PY5 A;  1DLO A;  3KD5 E;  3ZSX A;  3KD1 E;  4LSN A;  3NBP A;  3OYD A;  3KK3 A;  1TKT A;  3ZSO A;  3OS2 A;  1QSS A;  5DK5 A;  4B3O A;  3ZSV A;  2JGU A;  2FBV A;  3AO4 A;  3C6U A;  3NGZ A;  1KSP A;  3C6T A;  2G8U A;  3I0S A;  4HHT A;  4CGJ A;  2D0C A;  4DWI A;  3NH0 A;  4CGF A;  4NYN A;  3HO1 A;  1TAU A;  5J2P A;  1XHX A;  2F8S A;  4I2Q A;  4GMJ B;  3KK2 A;  3A2F A;  1VSE A;  4W5R A;  3CM5 A;  4AIL C;  3AA5 X;  1J53 A;  1JLE A;  4FJH A;  2HB5 A;  4JS5 A;  4KFB A;  3HVR A;  3SI6 A;  1WSG A;  4RW6 A;  3AVF A;  3I8D A;  1XHZ A;  1SL2 A;  3AVM A;  4FJK A;  5HRR A;  3RMA A;  1LWE A;  4B08 A;  4R5P A;  3HT3 A;  1LV5 A;  2KFZ A;  1JKH A;  1S1T A;  1VRU A;  4CJT A;  4FM2 A;  3TAF A;  5J2M A;  3HP9 A;  1L5U A;  2KFN A;  2XY6 A;  1KCF A;  2YNH A;  3ALY A;  4W5Q A;  4FLU A;  3AV9 A;  3LZI A;  4CHY A;  4E3S A;  1A5X A;  4RW7 A;  3K5M A;  1RDC A;  1SKW A;  1UWB A;  4DTP A;  5DMR A;  5HRN A;  1XC9 A;  1RBT A;  1S1U A;  3AVL A;  2FBY A;  5J1E A;  1RT1 A;  4AHC A;  4DTJ A;  2X6N A;  1TKZ A;  3SUQ A;  3DLH A;  2WON A;  3AVH A;  4O55 A;  1X1P A;  4H4M A;  3QET A;  1QE1 A;  4N47 A;  1L3S A;  3SCX A;  3HST B;  4CK3 A;  1RT6 A;  4CJS A;  3RTV A;  1NKE A;  4M3X A;  4M3U A;  2XY8 A;  4I7F A;  4AHT A;  2HHX A;  3VQ9 A;  3HM9 A;  3UIQ A;  4B9L A;  2PYJ A;  2VG5 A;  4HCC A;  1J9A A;  1IKV A;  3AO5 A;  4CIE A;  5J2N A;  4B8C A;  4M3Y A;  1WN7 A;  3CFP A;  4CEO A;  1JLQ A;  1ZBL A;  3ZSQ A;  4KO0 A;  2VWJ A;  1I39 A;  2YV0 X;  4DSE A;  3QEX A;  5J2Q A;  4L8R B;  4E1M A;  1A5V A;  3NHG A;  4K8X A;  2G8I A;  3LAK A;  2HHS A;  3AVB A;  3THV A;  3OYN A;  4DU3 A;  5CZ2 A;  3KIO A;  4CJF A;  4DTU A;  1BI4 A;  4JRP A;  4CEZ A;  1RTJ A;  3RMD A;  1JXE A;  2B6A A;  4IFV A;  4DTR A;  2HVI A;  3M8Q A;  3AA3 A;  2HHV A;  2Y1J A;  1D8Y A;  2IOC A;  3TAP A;  2HHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...