1WSHA

Crystal structure of e.coli rnase hi active site mutant (e48a/k87a)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
148
Chain Sequence
LKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVHPENERCDELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
source organism Escherichia coli
molecule tags Hydrolase
total genus 43
structure length 148
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wshA00
4J2BA 3RRGA 1RCHA 4CJVA 1IKWA 4DLEA 4ID1A 1HYZA 1TK5A 1U04A 4ICLA 3OYFA 1SKWA 4CJLA 3KLFA 3K5NA 3I0RA 4CJKA 3E01A 5HBMA 3LZJA 4CFDA 3OS0A 4W5QA 4F4KA 1RDAA 1VSHA 3RMAA 2YNGA 2HHWA 1KFDA 4CERA 3NGYA 4FLXA 3SYZA 4CECA 4KV8A 2X6NA 4YFUA 4O4GA 1BHLA 2VG7A 5KGXA 1L3SA 4AILC 4FYDA 4KRFA 1LAVA 3QEWA 3V1RA 2XY5A 1HNVA 3NH1A 3AO2A 4DLGA 3VA3A 5J2NA 4DQQA 3ZSZA 4AHVA 3SJJA 3MXMA 3KKSA 3VQQA 3LPTA 4H4OA 1NK0A 4L8RB 4BE0A 1TGOA 1IO2A 4KREA 1FKOA 4FM2A 4I2PA 1EETA 1Q9YA 4B3OA 4PUOA 3WNGA 4HVJA 2I5JA 2P5OA 5DK5A 2D5RA 2GUIA 4FJ9A 2HHVA 3SUNA 1TL3A 3V9ZA 4W5TA 1VRUA 1TKZA 3ZSOA 3M8RA 1RDDA 5KRTA 1BCMA 2ZQBA 3HO1A 1TKTA 3LWMA 4AHCA 2ZD1A 3AVAA 4CGFA 3KK3A 3KK2A 3QESA 1BI4A 1C0UA 1Z25A 4QAGA 1WSEA 3VA0A 4B9MA 2OZMA 3TAEA 4CJ5A 3O3GA 4RW7A 5J2QA 4W5NA 1CXQA 3SCXA 3TI0A 2R7YA 3DYAA 4KTQA 4FLVA 4B08A 2HMIA 1JKHA 3OYLA 1MU2A 3LAKA 3TAFA 1C1BA 2B4JA 3QIOA 1TKDA 3KLGA 2HHXA 3NFAA 4IG3A 3MXJA 5KGWA 1ZBHA 3SQ0A 3DMJA 4F8RA 3RMBA 4M3XA 1IKVA 4E3SA 3OYEA 3SUOA 4OGEA 3AVIA 2XY8A 3F73A 4E7KA 2VG6A 1TVRA 2Y1IA 3VQ7A 4CFBA 1D9DA 1F21A 3VQ4A 3AO1A 4CF1A 3KK1A 1GOBA 2PYLA 4E7HA 3SI6A 1UA0A 4Y1DA 3NGZA 2HNDA 4CEOA 4W5OA 4CGIA 5HLFA 4Z4EA 1Z26A 2E6MA 1CLQA 4M3UA 4H8KA 3V9UA 4QCLA 4CGDA 3B6OA 4CJ3A 5HP1A 3BGRA 4LSLA 3OYNA 4DU1A 3OYAA 4ELUA 3AO3A 3OYIA 4CGJA 3V9SA 4FJKA 1JLEA 1RNHA 1RT3A 2KFZA 1VSFA 3VQ9A 1IG9A 3PX4A 4CJUA 3O3HA 4CF8A 4F2SA 4NCAA 4CF0A 1C0MA 2XRIA 4DF4A 4E0DA 3TAGA 4DSJA 1TK0A 3U6FA 1L5UA 4FK0A 4ZTFA 2F8TA 3O3FA 1J53A 3ZSRA 3QINA 3KIOA 3QEPA 1N6QA 3ALYA 1ZBFA 4FJJA 3B6PA 1S9EA 1BGXT 4EZ9A 3AA4A 5CZ1A 1RT4A 2HHTA 3M8SA 4GMJB 4CEFA 4N41A 3AVFA 3KJVA 4AHTA 4E1NA 3AVMA 1WAJA 1SKSA 1RTIA 4FJGA 3HT3A 2Z1HA 4FZYA 1S1XA 4PA1A 4B9SA 3K57A 3DLGA 4OPKA 4DS4A 1RTDA 3RRHA 3SUQA 2PZSA 4PQUA 5HRNA 1BIZA 1CZBA 1JXEA 3CFRA 3PX0A 4K8XA 3HK2A 4FJIA 1KCFA 3VQAA 4FK2A 3L2RA 3V6DA 3QEVA 3DLBA 4CJTA 4CESA 1KLNA 3NAEA 3VQBA 4KB0A 4AH9A 2X74A 3OJSA 3DLRA 4NCBA 4KTWA 2G8IA 3AVJA 4JS5A 1RBVA 2YNHA 1N5YA 1ASUA 2KQ2A 3ZT3A 4BDYA 3NBPA 1LV5A 1NJXA 1NK7A 3T19A 3ZT1A 4CGHA 1WAFA 3DRRA 3O4NA 5J2MA 1RDCA 4DTSA 1X9WA 1RT1A 3K59A 4CHZA 4JRPA 2KZZA 4C8MA 3THVA 3OYGA 5FROA 2XO7A 5EU7A 2OPRA 1IKXA 5HRRA 1HYSA 1WSIA 5DMRA 4FLZA 4GVMA 4J2DA 2D0CA 3OS1A 4I2QA 3L2VA 3K5MA 1NJWA 1QS4A 4TSXA 3C6TA 1LWCA 4K8ZA 2O4IA 4DS5A 2KFNA 5KTQA 1WNSA 2QK9A 4EZ6A 4CF2A 3TAPA 3QERA 1L3UA 3S3MA 4HUEA 3LAMA 1TV6A 2A1SA 3VQEA 3AA3A 3HPGA 3AVBA 3TAMA 1ZBIA 4Z4CA 3OY9A 4DU4A 1B92A 1A5VA 3CM6A 1S5JA 3HPHA 3SQ1A 5I42A 3U3YA 4CGGA 3KLEA 3QLHA 1KSPA 4PWDA 2HNZA 4AHSA 3ZSYA 4OPJA 4N47A 1SL0A 3DI6A 3L8BA 3UIQA 2DY4A 1VSDA 2OYQA 4C8NA 3ZSQA 1S1TA 4FXDA 3OYKA 3QNOA 4KAZA 2VG5A 4CJPA 2G8FA 1DLOA 4FVMA 2E6LA 3TR8A 4CF9A 4DFJA 4CHNA 2BE2A 3V1QA 1NKBA 1GOAA 3DOKA 1ZBUA 1BCOA 3KKRA 3NH0A 4OVLA 4KHYA 1UAXA 4CEEA 1JLQA 4YNQA 3LALA 2BANA 5SWMA 3RR8A 3JYTA 3SNNA 4GW6A 4B8CA 5FRMA 2W42A 2KZMA 4WE1A 3JSMA 1FK9A 3D45A 3ISNC 3LP2A 3M8PA 1D5AA 1G15A 4ZHRA 3ZSVA 4DTMA 4KI6A 3HSTB 4RW6A 5I3UA 4BACA 1ZBLA 3DOLA 3IRXA 3IS9A 3MEEA 3K58A 3BDPA 4JLHA 1BIUA 2ETJA 1YTUA 1C1AA 4BDZA 3HM9A 3MECA 4MQ3A 3HVTA 1JLGA 3CYMA 3HP9A 4C8LA 3HPOA 4FM0A 3TWHA 1T8EA 3PX6A 1WLJA 3ZT0A 4B9TA 1SUQA 4M3ZA 1HRHA 4B9LA 4BDPA 4O55A 1T05A 2IS3A 2E4LA 4BE2A 1W9HA 4DQPA 1WSHA 4ELTA 1XI1A 4NYFA 4KHSA 2YHAA 4HUGA 2GV9A 4DSFA 4DSLA 4DTUA 3QIPA 4CJWA 4DSIA 4FJHA 1HYVA 4CJSA 1SV5A 2AJQA 4OLAA 3DLHA 4B8AB 4DF8A 1HPZA 2FBVA 4M3RA 2OZSA 3WNHA 4Z4HA 4HTUA 1XWLA 5KI6A 4E7LA 4DSEA 3DLEA 2XY6A 1XC9A 4FJLA 4CJRA 3DRPA 4FJMA 2P1JA 1A5WA 2YKNA 4B9VA 1KVBA 4O0JA 4FLTA 1FKPA 4FJXA 1WSGA 4EP4A 1LWFA 1NKEA 3LP1A 3LPUA 4DTOA 1S6PA 1RDBA 4B9NA 4Z4IA 4F2RA 3OYMA 4F3TA 1RT6A 4FM1A 2FBYA 4B9UA 3AO4A 4N5SA 3SV4A 5CZ2A 1VSMA 2QXFA 1RBUA 1R0AA 1NK9A 1KLMA 1VK0A 2DFEA 2HNYA 3V1OA 3VQCA 4CJFA 1YT3A 4FW1A 4KHWA 4CIEA 1KTQA 4FJ5A 2KTQA 3V9XA 1J5OA 3LZIA 1RT5A 2HHQA 3LANA 1EP4A 5C24A 4FK4A 1QE1A 1BISA 4LY7A 4CFCA 4DFPA 1VRTA 2X78A 2BDPA 2Z1GA 3VQDA 3ZSWA 3C6UA 2Z1IA 3HYFA 5HROA 1EX4A 4RW8A 4E7IA 2LSNA 4DU3A 1A5XA 3C94A 4KI4A 3OYJA 4OLBA 2IOCA 2HHSA 1J54A 1VSEA 4DTJA 2OA8A 1JLAA 4CJQA 1QHTA 4Z4FA 2B6AA 2JLEA 4FJ8A 2FC0A 5CYMA 2YNIA 3HP6A 3LP3A 3MAQA 3SPZA 2OPQA 1O1WA 3SUPA 3SPYA 3PO5A 4HHTA 3ITHA 3OYHA 2YNFA 3CM5A 3LWLA 4E89A 3ZT2A 4ELVA 4HUFA 4J2EA 3AV9A 1C0TA 3WNEA 1KFSA 1TL1A 3VQ6A 3TANA 2YHBA 2NUBA 1B9FA 1S1UA 1C6VA 1KVCA 1Y97A 2Q3SA 4M45A 4XIUA 3C95A 3DLKA 4IDKA 4CFAA 1JLCA 4HCBA 3HJFA 4FLWA 1LW0A 1WN7A 4CEZA 2G8KA 1HQEA 2HB5A 1D8YA 1RT7A 2RKIA 3OS2A 3L3UA 1RBSA 4M42A 1S9GA 3AVLA 3AVGA 1JL1A 1RTHA 4CEBA 2EHGA 4OKJA 5K14A 1VSIA 3V81A 4M41A 3QETA 5D3GA 1REVA 1NKCA 4E1MA 5C25A 1NJZA 3NDKA 4IBNA 1U45A 1U47A 2PY5A 1X9MA 3QEXA 3HL8A 4OJRA 2VWJA 1L3TA 4I9LA 3VQPA 4I7FA 1BL3A 4CJEA 3KLHA 1RBRA 3RTVA 4DTNA 4DQRA 4DTRA 1CZ9A 4CE9A 4CK3A 2HHUA 4IFYA 1NOYA 4C8OA 3K2PA 2KW4A 2JGUA 1TKXA 4R5PA 3TAQA 4FLYA 2P5GA 3AVCA 1CXUA 4KHNA 2IDOA 3K5OA 1HMVA 2DFFA 5HRPA 3RMCA 1T03A 1NK5A 3VQ8A 5J2PA 1HQUA 4PY5A 4FJNA 1X9SA 4AHRA 3LP0A 4BE1A 3O4QA 1Q8IA 4ZTJA 3CQ8A 4N76A 1S6QA 2ITGA 4OKKA 4RG8A 3NHGA 5JS1A 4E7JA 3EZ5A 3T3FA 1YVUA 3S3NA 1JXBA 5JS2A 4DQIA 4IKFA 1BQMA 1WSFA 4KKOA 1UA1A 2ATQA 3QEIA 3G10A 2ZE2A 3LDSA 1EXQA 1QSLA 1T7PA 4KO0A 2FBXA 1SL2A 3NCIA 1U48A 3V4IA 4O44A 2VWKA 1QTMA 3NF7A 4J2AA 3M8QA 3MEGA 4KPYA 2Z1JA 3T1AA 1DTQA 2D0AA 5CY4A 1YTAA 1L3VA 4CEDA 4FCYA 1UOCA 2IGIA 2WOMA 4FW2A 4I9QA 4DSKA 1I3AA 5HRSA 1ASWA 4Y1CA 1RT2A 2G8HA 4DWIA 1HNIA 4LH5A 2Y1JA 1RTJA 3ZSXA 1ASVA 3P1GA 3SQ4A 4CCHA 3RWUA 4IFVA 3SQ2A 1X1PA 1NK4A 3NGIA 2FBTA 3AO5A 4NCGA 3ULDA 3AA2A 3G0ZA 1U49A 3KD1E 4O0IA 5E41A 2OPPA 4E19A 3MXIA 2YKMA 1SKRA 1JL2A 3L2QA 1D9FA 1J9AA 4QOZB 2RN2A 4DFKA 1BI4B 2B5JA 2RPIA 1VSKA 2X6SA 5CYQA 5FDLA 4FLUA 4DTPA 1I39A 1ZYQA 4KHQA 5SZTA 4DFMA 4CHYA 4KB1A 4DMNA 2F8SA 1KRPA 4CEAA 2YV0X 3PY8A 1JLFA 2G8WA 2XHBA 4CHQA 1RBTA 1W0HA 2F96A 3L2WA 1XHXA 4M3TA 3H08A 1ITGA 3KLIA 1IKYA 1QSYA 3K5LA 3FFIA 2G8VA 4M3YA 1KVAA 2QKBA 1RILA 3ASMA 1C1CA 3ZT4A 2RF2A 4LH4A 4CIGA 5KRSA 4Z4GA 3OJUA 2DTUA 1S1VA 3L2UA 3IAYA 3QNNA 3L3VA 4LSNA 4KHUA 4CIFA 1HJRA 1Q9XA 3KD5E 4IG0A 1TK8A 3AVNA 1SL1A 3QO9A 1S1WA 3PUFA 4RW9A 3MEDA 4LD0A 4CJ4A 2HVHA 1EKEA 4CK1A 2A1RA 3V9WA 4O5BA 1U4BA 4C8KA 3VN5A 4RW4A 1K6YA 4BWJA 2XY7A 2DFHA 3F9KA 4CK2A 2D0BA 4UQGA 1B9DA 1LW2A 2IC3A 3TARA 4F3OA 2O4GA 3HVRA 3NF9A 3SV3A 4EP5A 5C42A 2EX3A 1NJYA 1IH7A 4MFBA 3NF6A 3OYCA 2OPSA 3OYDA 3U3GA 4AHUA 3S9HA 4JS4A 3HXMA 3EYZA 2QKKA 1WSJA 3AVHA 1GOCA 4G1QA 5J1EA 1NK8A 4KTZA 2HVIA 4HCCA 4Q0BA 1BQNA 2P51A 4KFBA 4DG1A 3S3OA 1TAUA 4FZZA 4OKEA 1VSJA 2BGGA 4M3WA 3TABA 2G8UA 3P5JA 3KTQA 3NE6A 3WNFA 4CHOA 1JLBA 4W5RA 2GBZA 3NH2A 3CG7A 3OYBA 3CFPA 1NK6A 4DQSA 3AA5X 1QQCA 1TAQA 3AVKA 3RR7A 3OVNA 4H4MA 3SZ2A 3PV8A 3IG1A 5FRNA 3P83D 1DTTA 1VSLA 3CFOA 4NYNA 4CEQA 5T7BA 2PYJA 4FJ7A 4FZXC 1LAWA 4CHPA 3PO4A 3NF8A 3ZCMA 3DRSA 3RMDA 2HW3A 1UWBA 3VQ5A 3EY1A 3I8DA 4BWMA 1NOZA 1XHZA 4ID5A 4DTXA 1QSSA 4Q5VA 2WONA 3DM2A 1LWEA 1FXXA 3I0SA 4Z0UA 3A2FA 4N56A 3D0PA 4OGCA 4JRQA 2IAJA
chains in the Genus database with same CATH superfamily
3PSIA 5KPRA 1N36K 3RRGA 4CJVA 5BRDA 4PL7A 4ID1A 1U04A 3OYFA 3RSEA 4CFDA 3OS0A 3CXCM 3RMAA 2YNGA 4CERA 4J8FA 3NGYA 1DEJA 2GELA 1VQ7N 4YFUA 3VERA 1BHLA 4H5RA 1L3SA 2HHHK 1G99A 4AILC 2UUAK 3QEWA 3NH1A 4DLGA 5J2NA 3SJJA 2HBJA 4AHVA 3RVCA 4L8RB 1NK0A 3LPTA 4H4OA 2W40A 1TGOA 1IO2A 2IVPA 4BE0A 4HVJA 2GUIA 2VGMA 4PKHA 3SUNA 1TL3A 1OH8A 1KAYA 1TKZA 3QICA 4KHPK 4FVUA 1RDDA 1BCMA 1WOQA 4CBXA 3LWMA 3I55N 3KHYA 3AVAA 4CGFA 1BI4A 1BG3A 4IOAL 3JAMO 1WSEA 3VA0A 4B9MA 3MN5A 5J2QA 4RW7A 3TI0A 3DYAA 4FLVA 4K42A 4A2AA 2YCHA 3R1XA 4CZKA 3H45C 1I94K 2OCEA 4DR5K 4UY8O 4M3XA 2HBLA 1TVRA 3FZKA 3O6WA 1TUUA 4CD1A 1D9DA 1F21A 3VQ4A 4KH4A 1KAZA 2CGJA 3SI6A 3NGZA 2HNDA 4CZGA 1Z26A 1CLQA 3FFKB 5HP1A 4LF4K 3BGRA 3OYNA 4IOCL 3V9SA 3VGMA 3THWB 1VSFA 3VQ9A 3VPZA 3VF6A 4CF8A 4F2SA 4CF0A 4DSJA 1NGCA 4NB4A 3D2EA 1J53A 4YOTA 3R3LA 3E9LA 3B6PA 3CQYA 4EZ9A 1YVNA 3M8SA 1H1VA 3KJVA 4FJGA 3S41A 1QQNA 1NNEA 2Z1HA 4FZYA 4M7YA 4JKGA 3K57A 3WXLA 3DLGA 3N4QA 1CZBA 4K8XA 4B3SK 4FK2A 2ZM6K 3O5BA 3DLBA 4CESA 3NAEA 3VQBA 4NCBA 1KD1O 3EE8A 1N5YA 4FWNA 2KQ2A 3ZT3A 4BDYA 1LV5A 1NK7A 3T19A 3DRRA 5FPDA 3J7ZO 3K59A 4JRPA 3THVA 5FROA 2XO7A 5LJVA 1IKXA 1HYSA 5DMRA 2D0CA 4BRHA 4I2QA 1E4FT 4K8ZA 1LWCA 1IBMK 5KTQA 4JI3K 2PBDA 1OH7A 3LAMA 4DR7K 3TAMA 3Q7BA 2VQFK 4A2BA 3KLEA 1KSPA 2O8BB 4YDUC 3UIQA 1SL0A 1D4XA 3ZSQA 1S1TA 4FXDA 3ID6A 3OYKA 3K0SA 1DLOA 2E6LA 4FSVA 3V1QA 1GOAA 3KKRA 1ZBUA 1JLQA 4YNQA 3WXIA 3RR8A 3JYTA 4B8CA 3QB0A 2KZMA 4BROA 3M8PA 3LP2A 1G15A 3HSTB 4RW6A 4DV5K 2ETJA 1GLLO 1C1AA 4B1UB 4WQ5C 4JKBA 3CETA 1JLGA 3CYMA 4FM0A 4E1JA 1SUQA 1T6DA 1HRHA 2Q0RA 2E4LA 1VQPN 1VQ4N 1EQYA 2KKZA 3VEXA 4NYFA 4KHSA 4HUGA 4DSLA 2Q1NA 4CJWA 4FJHA 1N33K 3DLHA 4B8AB 3THWA 4DB3A 4Z4HA 5C15A 1XC9A 3LDNA 4CVNE 1KVBA 3VEVA 1KAXA 5GAHP 4WFAL 1RDBA 3I8BA 1RT6A 2WTUA 3SV4A 1VSMA 3O9QA 1BA1A 3VGLA 1VK0A 2DFEA 4CJFA 2HNYA 3V1OA 4KHWA 4CIEA 1OKJA 4DR4K 3JXUA 1J5OA 3LANA 4JD2B 3GBTA 4LY7A 5C24A 1EO1A 3EZWA 4DFPA 1VRTA 2X78A 2AA4A 3ZSWA 1XQSC 1VQ5N 4E7IA 4DU3A 1YJWN 4KI4A 1VSEA 1JLAA 2B6AA 2YNIA 4XH1A 1IBKK 2OPQA 4JHDB 3SPYA 4HHTA 3ITHA 1NLVA 5F0XA 3LWLA 1N32K 3ZT2A 3AV9A 1C0TA 2QTDA 5AQSA 1KFSA 3TANA 3O8MA 1S1UA 1C6VA 4M45A 5AQWA 1KVCA 2Q3SA 5AQPA 4IO9L 4CFAA 5AJ3K 3HJFA 4JKHA 4FLWA 1WN7A 4CEZA 2G8KA 1HQEA 2HB5A 4BRQA 1WB9A 3L3UA 1S9GA 2Q36A 1RTHA 1V4TA 1JCEA 1VQNN 2O8BA 4FPBA 1U47A 4IBNA 4JI4K 2PY5A 4PKIA 3QEXA 5ELZA 3E9OA 1ZXOA 2FXUA 3VEWA 5BRFA 4BVOA 4I9LA 4I7FA 4M7XA 1RBRA 4DTNA 3SMSA 5AR0A 4DQRA 4BR4A 2KW4A 4I6MA 4R5PA 4A57A 2P5GA 3VTIA 1CXUA 2DFFA 5HRPA 1T03A 1NK5A 5AQLA 3VQ8A 4FJNA 1X9SA 3NVKA 5AFUA 4ZTJA 3K9JA 3DLLL 5JS1A 1YVUA 2NRTA 3S3NA 5JS2A 1NGIA 2UXBK 4KKOA 4LF5K 3CJ9A 4GVEA 3TTCA 1K9MO 4KO0A 2FBXA 3FLCO 1SL2A 3NCIA 3A5LC 4KPYA 3LDQA 2Z1JA 3R6MA 2D0AA 4JK8A 1XMQK 1L3VA 1NM1A 4KH6A 4I9QA 2IIRA 4LH5A 4H0TB 3ZSXA 4DR1K 1ASVA 3P1GA 4CCHA 1SS6A 1X1PA 5JLFA 4NCGA 3AA2A 3G0ZA 4YOUA 2YHXA 2YKMA 1JL2A 4QOZB 2RN2A 2W41A 2X6SA 5CYQA 2OANA 4DFMA 4CHYA 1VQKN 1KRPA 2H3GX 4CEAA 2YV0X 4CHQA 1XHXA 1QSYA 2PFUA 3FFIA 3ASMA 1C1CA 4CIGA 1J6ZA 3IAYA 3QNNA 4IFEA 4IG0A 1TK8A 3QO9A 1S1WA 1NMDA 4RW9A 4CJ4A 1EKEA 3O08A 3SK3A 4CK1A 2HOEA 4RW4A 4JHDA 2NRWA 4BWJA 4C1NI 3AY9A 4CK2A 4AM6A 2O4GA 4K0KK 1E3MA 2EX3A 4MFBA 4JYAK 4WCEL 4WQ4A 3G6EN 4BQZA 3S9HA 4F9OA 2QWRA 4JS4A 3HXMA 1VQMN 3AVHA 5J1EA 1NK8A 4KTZA 4H0YB 4HCCA 1BQNA 4DG1A 5EY4A 3FZFA 4MDAA 2HMPA 1XMOK 3TPQA 4W5RA 2GBZA 5EX5A 5C2FA 3NH2A 1NK6A 3SZ2A 3PV8A 1K8AO 3CPWM 1DTTA 3SAGA 3D7EO 4CHPA 2HW3A 3DRSA 1RDWX 1Q18A 4FWLA 4ILGB 4BREA 4WFBL 3G71N 4Q5VA 2WONA 4BRIA 1FXXA 1NJXA 3A2FA 5AQJA 4DUZK 4J2BA 1HPMA 3P39A 5HL7L 4BRMA 1TK5A 1SKWA 3KLFA 3KK7A 3LZJA 4CJKA 4JI2K 2P9PB 3CHWA 3QFPA 5MLCQ 2HHWA 1GLDG 2ASOA 3SYZA 4KV8A 3H3OB 1SQKA 4O4GA 3T1HK 1GLEG 3AO2A 2GUPA 3VA3A 2FLOA 3MXMA 3MX5A 3BZCA 1MWKA 1Q9YA 1EETA 1NGFA 4PUOA 5F1XA 2I5JA 5DK5A 5HOOA 4FJ9A 5AQZA 3M8RA 5M1PA 3OBYA 4AHCA 3KK3A 3DJCA 1RDUA 3MK6A 3KK2A 1Z25A 3F5TA 4QS8A 2OZMA 4JK7A 4CJ5A 4H5WA 3O3GA 1O13A 4W5NA 2R7YA 4C1NK 3L6QA 4KTQA 3H6EA 1JKHA 1MU2A 2B4JA 3KLGA 1VQ8N 5LMUK 4IG3A 4BQLA 1HKGA 3MCPA 3SQ0A 3DMJA 4E3SA 4OGEA 2XY8A 3LL3A 3F73A 2VG6A 2Y1IA 2UYTA 1W97L 1P8ZA 4CF1A 4NLCA 3KK1A 4E7HA 4CEOA 2VQEK 3ATVA 1YF5L 3V9UA 4CJ3A 3B6OA 4CW7B 3VEOA 3OYAA 3AO3A 4BR5A 1RNHA 4A5BA 2E5LK 2I7PA 3PX4A 4CJUA 4NCAA 1C0MA 4BR0A 4E0DA 3WT0A 3I56N 1YXQA 2F8TA 3ZSRA 3KIOA 3A8YA 5LJWA 5CZ1A 1RT4A 5EOYA 3MN6A 4RWTA 3ZETB 1SKSA 4LFBK 4PA1A 2ASMA 2PZSA 3RRHA 3PX0A 3D2FB 3V6DA 2IVOA 3HOTA 3O9RA 3O9TA 3OJSA 4FWOA 5E84A 1ASUA 1Q81O 3SBGA 3NBPA 4CGHA 1WAFA 4FWMA 5J2MA 1RDCA 4DTSA 1X9WA 2HBKA 3OYGA 2P9PA 3FGUA 2OPRA 3IKMA 3U9DA 1K8KB 2E2OA 1QS4A 3PIPL 2KFNA 4NXNK 1VQ6N 1YUWA 3TAPA 1L3UA 3S3MA 4V19S 3VQEA 1TV6A 2A1SA 3OY9A 4B3TK 4DU4A 1B92A 3CM6A 1S5JA 3U3YA 3QDKA 1N8RO 2HNZA 3ZSYA 3DI6A 3L8BA 1VSDA 5H1SQ 1IV0A 5TKYA 3QNOA 3LM2A 1DGKN 3CCRN 4DFJA 4CHNA 2BE2A 1NKBA 5BPLA 2UXCK 4OVLA 2W6KA 5AQRA 3CI5A 3ULEB 3SNNA 1RFQA 4FWRA 2W42A 3THYA 4RCHA 3JSMA 4YORA 3D45A 1D5AA 4B3MK 5AQHA 3ZSVA 4DTMA 5CR4A 4X66K 5I3UA 4BACA 3DOLA 3IS9A 3ATUA 3HM9A 3MECA 3HVTA 3ENOA 2A3ZA 2D1KA 4C8LA 5GIOA 3F9MA 1T8EA 4K43A 3PX6A 4B1WB 3OA9A 3ZT0A 1BUPA 4O55A 2IS3A 1FW6A 4YDUA 1W9HA 2KLAA 1XNQK 2UU9K 3QIPA 4EIAA 1HYVA 4CJSA 1SV5A 2AJQA 3WXKA 2FBVA 2OZSA 4M3RA 4K41A 1KQSM 4HTUA 4DSEA 3DLEA 2XY6A 4FJMA 4CJRA 3DRPA 3HBTA 2P1JA 1A5WA 5M1NA 4FLTA 4FJXA 2FSKA 1NKEA 3LP1A 3N4PA 4DTOA 4H5NA 3OYMA 2FBYA 4N5SA 5CZ2A 3FR0A 4PHTX 3TSQA 3EO3A 1KLMA 3ZETA 3ZYYX 5BN9A 1YT3A 4FJ5A 4WQ5A 2KTQA 2HF3A 2HHQA 3WXJA 1QE1A 1BISA 4B1ZA 3J81O 2BDPA 3SAHA 2NNWA 3D2FA 4IXCA 5ADXA 3CPEA 2HF4A 1EX4A 1C0FA 2LSNA 3C94A 4OLBA 2IOCA 1J54A 4DTJA 4JI0K 1QHTA 3KWIA 3ENHA 4FJ8A 1ESVA 3HP6A 3SPZA 2DPNA 1O1WA 2A42A 3SUPA 3PO5A 2QM1A 3CM5A 5LMNK 2JWKA 4J2EA 1W2BM 1TL1A 3VGKA 1K8KA 4HCBA 3DLKA 4IDKA 4QS9A 4X64K 2O8EB 3OS2A 1RBSA 4M42A 3LM9A 4DV4K 1JL1A 3H3NO 5KPZA 4H03B 4IEIA 4OKJA 3UB5A 1VSIA 5C2DA 3CCUN 3V81A 1HLUA 3NDKA 2VWJA 1ATNA 2A41A 4CJEA 5M1KA 1NGEA 4DTRA 1NOYA 4BRAA 2NRZA 3K2PA 3ULEA 3K5OA 4BRPA 2E2QA 4PY5A 1MDUB 4BE1A 4I6MB 1ATRA 1Q8IA 3CQ8A 4OKKA 4RG8A 3P31A 5BPMA 3NHGA 1WSFA 2ATQA 3P4IA 1HNZK 2ZE2A 3LDSA 2OTLN 4JKDA 1TUYA 2GTDA 1M1KO 4JAXA 3V4IA 3JS6A 3NF7A 3M8QA 3CC2N 4CZLA 4LF9K 4IWVA 1Y64A 2NLXA 4M63C 4LF8K 4FCYA 2IGIA 3I33A 4FW2A 4MLEA 5HRSA 1VQLN 4DWIA 1NMNA 5AZJA 1WBDA 1NK4A 5GADP 3T1YK 3ULDA 1U49A 3KD1E 1GLBG 5E41A 4E19A 4DFKA 4FLUA 4AM7A 1NWKA 1ZYQA 4XH5A 2QWOA 4CI6A 4DMNA 4DV2K 1K73O 3T7ZA 1JLFA 4JNEA 2F96A 4MDBA 1M90O 4M3TA 1ITGA 1IKYA 4JKAA 3K5LA 1NGHA 5KRSA 4LH4A 4Z4GA 2OTJN 3OJUA 4BRKA 3L2UA 3DXMA 4QS7A 3H46O 2HBMA 3HSCA 4KHUA 4BC2A 3WQTA 3KD5E 2QEXN 3AVNA 3PUFA 2F7TA 3MEDA 2A1RA 2UXDK 3V9WA 3G4SN 3J80O 4O5BA 4CZIA 3CCQN 4KH5A 2D0BA 4BRFA 5JVHL 3HVRA 3SV3A 4EP5A 5C42A 1NJYA 3ZX2A 1HKCA 2OPSA 3OYDA 3U3GA 3CCLN 2QKKA 3EYZA 1WSJA 1GOCA 4G1QA 3UKRB 2O8EA 4Q0BA 2P51A 5BN8A 3S3OA 1LCUA 1TAUA 4FZZA 1HUXA 2BGGA 4M3WA 3KTQA 3NE6A 3WNFA 4CHOA 1JLBA 3C0BA 1LOTB 3AVKA 3GG4A 4H4MA 3A5NC 3HM8A 1QZ5A 1VSLA 3CJCA 4FPAA 4NYNA 4FJ7A 3A0IX 1LAWA 3PO4A 1NJIO 3NF8A 3ZCMA 3RMDA 2EWSA 3EY1A 1XHZA 2D4WA 1QZ6A 4ID5A 4DTXA 2ZWHA 3ZX0A 4F3TA 1LWEA 1OVYA 2ZJPL 2IAJA 4R79A 5KPTA 1RCHA 1HYZA 5AQIA 4CJLA 3I0RA 3E01A 5HBMA 5FPEA 1RDAA 1VSHA 2FF6A 3J7YP 1KXPA 1KFDA 1DT9A 3BF1A 3WQUA 4CECA 4FOIA 4JV5K 3P38A 5KGXA 1QQMA 3TSUA 4KRFA 1LAVA 1OH5A 3VF4A 5BR9A 1HNVA 1X3NA 2F9WA 3ZSZA 4BC5A 4KREA 1WUAA 4FM2A 4B3OA 3WNGA 2P5OA 1U6ZA 2D5RA 2HHVA 1S72N 4JI1K 3V9ZA 2FSNA 3ZSOA 5C12A 4CBWA 3HO1A 1TKTA 2W6LA 3IDHA 3QESA 2QI2A 3TAEA 1IG8A 3SCXA 3SJHA 5IWAK 3OYLA 3TAFA 3U9ZA 1P90A 1TKDA 2YHWA 4BRLA 1ZBHA 4F8RA 3RMBA 4WF9L 1IKVA 2FF3B 3OYEA 3SUOA 3AVIA 4NXMK 3AO1A 3Q7CA 1GOBA 2PYLA 1UA0A 4W5OA 5A2QO 4CGIA 4M3UA 3AGKA 4QCLA 4CGDA 5I9EB 4ELUA 4CGJA 1GLFO 1JLEA 2UUCK 2KFZA 1IG9A 3O3HA 3L4IA 1TK0A 3U6FA 3EE9A 3UKRA 4ZTFA 4DCHA 5IT9O 3QEPA 4IOXA 3QBWA 3W0LA 3ALYA 1ZBFA 5TKWA 5KQDA 3MN7A 1S9EA 2HHTA 4DR2K 1VAZA 3OTOK 3OHRA 4KBOA 4CZEA 1S1XA 1Q82O 4PQUA 4OPKA 3VF2A 4DS4A 1RTDA 3SUQA 5HRNA 1BIZA 3PSFA 1JXEA 3HK2A 4FJIA 1KCFA 3VQAA 2E88A 3L2RA 4YY3K 1W7AA 4KB0A 1QQOA 4AH9A 3EEQA 3DLRA 3HI0A 4KTWA 1YITN 2G8IA 3AVJA 4JS5A 2YNHA 2A40A 3A5OC 4Z94A 3ZT1A 2CH5A 2GWJA 4JEPA 4MO5A 4C8MA 4IEEA 2P9LB 5HRRA 1WSIA 4CD3A 1SAZA 3OS1A 3IFRA 2ITMA 3L2VA 3K5MA 4TSXA 3C6TA 2O4IA 4DS5A 2QK9A 4EZ6A 3QERA 4H0OA 3HPGA 1ZBIA 3ENBA 5I42A 1N34K 4BC3A 2RE2A 4AHSA 4N47A 2DY4A 3HTVA 4GY2B 3AAPA 4CJPA 4X65K 4FVMA 3NVMA 3WXMB 4CF9A 3M1FA 1QVFM 3NH0A 4KHYA 1UAXA 4FWSA 4CEEA 2BANA 4A61A 3OW2M 2A5XA 5FRMA 4WE1A 1NGJA 4ZHRA 4BRNA 4BC4A 2V51B 4KI6A 1ZBLA 3MEEA 3ZLJA 3K58A 5AZIB 3THYB 4JLHA 3BDPA 3IMXA 4BDZA 1SZ2A 4MQ3A 4FWKA 4BR9A 5JVGL 5AFUH 3TWHA 4DV1K 4B9TA 2FSJA 1TYQA 5DM6L 1T05A 3CERA 4BE2A 1J5EK 3AGRA 1WSHA 4AQYK 4ELTA 4BG9A 4EFHA 2GV9A 3WEEB 1Z05A 1EWRA 2BTFA 4DF8A 1HPZA 3WNHA 1XWLA 5KI6A 5LL6Z 4JI8K 4B9VA 3CJAA 4O0JA 1BO5O 5AQUA 5AQXA 1WSGA 2P9UA 4EP4A 1LWFA 4Z4IA 4B9NA 4FM1A 2QXFA 1RBUA 2QWLA 1NK9A 3PLAA 3VQCA 1KTQA 3O80A 1RT5A 4C23A 1EP4A 4FK4A 2O8DB 3H1QA 3TTDA 3C6UA 4PKGA 2Z1IA 2GWKA 3E1YA 2AP1A 4YHHK 4OPAA 1A5XA 2HHSA 3OYJA 1JCGA 3LDLA 1XUPO 4CJQA 4B3RK 3BP8A 3OYHA 1GLCG 3W3DA 2YNFA 3R8EA 4E89A 2P9LA 2YHBA 3UE5A 2O8FB 5EXWA 3C95A 1JLCA 4DQ8A 1RT7A 5C10A 3B8AX 4CEBA 2EHGA 4M41A 4L3QA 1REVA 5C25A 1NU0A 2BUPA 1U45A 1X9MA 1IJJA 3HL8A 4OJRA 4CZFA 4BRGA 1L3TA 3VQPA 1BL3A 3KLHA 3RTVA 4CE9A 4CK3A 2HHUA 4IFYA 1DKGD 3M5RA 2JGUA 1MA9B 1TKXA 4FLYA 1U2VB 4GV6A 4EAHD 1HMVA 3CF5L 3RMCA 3BEXA 4FOEA 5J2PA 5LY3A 4AHRA 3LP0A 4XH4A 4E7JA 3EZ5A 4DQIA 5AZIA 3PIOL 3IUCA 1BQMA 3MDQA 1UA1A 3QEIA 3G10A 4B1YB 4LC9B 3CMEN 5F2RA 1YJNN 1U48A 1JJ2M 4YOYA 1XC3A 3CJBA 3U4LA 4JI5K 1C0GA 3T1AA 4OX9K 1T3VA 5CY4A 1YTAA 2O8CB 1I3AA 3L0QA 1ASWA 1MWMA 1RT2A 2KHOA 2G8HA 2Y1JA 3WEEA 3SQ4A 1NG9A 3RWUA 4K25A 2D0PA 3NGIA 3AO5A 2CGLA 3VEZA 1SKRA 5AZJB 1BA0A 1VSKA 5FDLA 2GX9A 1I39A 4DTPA 5AQOA 3AAQA 2XHBA 3L2WA 1RBTA 3KLIA 4ISEA 4H0XB 4FO0A 2O8DA 4YOVA 1T44A 2G8VA 3ZX3A 1NGBA 4WFNL 4H0VB 3ZT4A 2RF2A 4DUYK 4CZMA 2DTUA 1S1VA 3L3VA 1T6CA 4CIFA 1HJRA 1Q9XA 1QVGM 1RGIA 3J8AA 4HTLA 3DXMB 3VN5A 1K6YA 2A6AA 3C6AA 3KWGA 2XY7A 4JKEA 3F9KA 4EHTA 1B9DA 3TARA 4O5FA 3NF9A 4GV3A 3QMLA 4FWQA 2YI1A 2O8FA 4BGBA 2YX6A 4JKFA 5AQVA 4KFBA 3VMFB 3M6GA 1VSJA 4OKEA 4B9QA 2P9KB 3TABA 3OYBA 3KZBA 4DQSA 3AA5X 3BZKA 3IG1A 3LDOA 5FRNA 1ZC6A 3CFOA 2Q97A 4CEQA 5T7BA 4FZXC 4FWPA 3VQ5A 4B1VA 3I8DA 4BWMA 3SLCA 2P9NB 1U2VA 2YJFA 3C65A 4ISFA 3DM2A 4JRQA 4Z0UA 3D0PA 4OGCA 3O1WA 1S22A 3MCAB 5AQFA 3BY5A 1IKWA 4CZJA 4DLEA 3O1BA 3LDPA 4ICLA 3K5NA 2QW9A 2VGNA 4W5QA 4F4KA 4H0PA 3QFUA 3EN9A 2P9SB 4FLXA 2X6NA 2VG7A 4HWIA 3UKUB 5CE3A 4FYDA 3V1RA 2XY5A 3H1VX 1VQON 1XNRK 2O8CA 4JI7K 1NGGA 3O9SA 4DQQA 3KKSA 4GNIA 3VQQA 5AQGA 3SAFA 4EHUA 1FKOA 5CHIA 4I2PA 4BGAA 1Z6RA 1IBLK 2E2PA 4W5TA 1VRUA 5KRTA 2ZQBA 4ILHA 1OH6A 2ZD1A 2RHKA 5FLXO 1C0UA 4U7BA 3CIPA 4QAGA 1X3MA 2ZGYA 4BRDA 4AF1A 2Q0UA 5BRHA 1CXQA 3CJ1A 5AQQA 4B08A 4CJ7A 2HMIA 1FJGK 3DWLA 3LAKA 1C1BA 5KQ8A 3QIOA 2HHXA 3NFAA 3MXJA 5BR8K 5KGWA 4E7KA 3EL2A 3VQ7A 4CFBA 4Y1DA 3T69A 5HLFA 4Z4EA 2E6MA 4Y0WA 4H8KA 1YIJN 3QBXA 4LSLA 2I7NA 4DU1A 4FJKA 3OYIA 1RT3A 5AQMA 2XRIA 4DF4A 2VYPA 3TAGA 1L5UA 4BRCA 1YAGA 4FK0A 1BWFO 3C7NB 3O3FA 1N6QA 3QINA 2P9KA 4FJJA 3MWTA 1BGXT 3AA4A 5JLHA 4GMJB 4CEFA 4N41A 3AVFA 1JCFA 3ID8A 4AHTA 4E1NA 4DR3K 3AVMA 1WAJA 1RTIA 4A62A 4LF7K 3HT3A 4B9SA 3CD6N 3CFRA 5DM7L 3L4QA 2E1ZA 1GLAG 3QEVA 2VCPA 1R59O 4XEIA 4CJTA 1KLNA 3U8XA 2P9NA 4U67L 1CZAN 2X74A 4MO4A 4MLHA 1RBVA 3SBTA 2QA4N 3CJ7A 4GV9A 5ADXH 3O4NA 4YOWA 1RT1A 1S3XA 3THXB 2QXLA 4CHZA 4IDHA 2KZZA 1KC8O 5EU7A 2ZJQL 3OBWA 3BF3A 4GVMA 4FLZA 2UUBK 1V4SA 1BDGA 2IVNA 2ZF5O 4J2DA 4H5VA 2P9SA 1NJWA 1WNSA 2YHYA 5AQNA 4CZHA 4CF2A 3UKUA 3HOSA 4HUEA 3GOIA 3AA3A 3AVBA 1HJOA 4Z4CA 2Q2RA 1EWQA 3HPHA 1A5VA 3SQ1A 4CGGA 3QLHA 5JMVA 4PWDA 4OPJA 2WUSA 3A5MC 2OYQA 4C8NA 2VWBA 1NBWA 2QWNA 3C6HA 4KAZA 2VG5A 5BREA 2G8FA 3TR8A 5GINA 2WBNA 3DOKA 1BCOA 3LALA 5SWMA 4GW6A 1FK9A 3ISNC 1BOTO 3ZEUB 2E20A 4JK9A 3FZHA 3AARA 2QWQA 4GKJK 3IRXA 3DAWA 1BIUA 1YTUA 3CCEN 3CCMN 2NZTA 4DV0K 4O8KA 3TSPA 3HP9A 3VOVA 3HPOA 3K9KA 5M1QA 5BPNA 1WLJA 1GLJO 4M3ZA 4B9LA 4BDPA 3HRGA 3J7AP 1VHXA 3D6RA 4DQPA 2BH1A 1XI1A 1BU6O 5M1OA 2YHAA 4DSFA 2CGKA 4ILJA 4DTUA 4DSIA 4DKWA 3GL1A 1TYQB 3CCJN 4OLAA 1YJ9N 4E7LA 4FJLA 1Q7YO 2YKNA 4DV3K 5GAEP 1FKPA 4ISGA 3C7NA 4GKKK 3GDQA 3LPUA 1S6PA 4F2RA 4B9UA 3AO4A 4BVPA 4JD2A 2P9UB 1R0AA 4IZ9A 5C0YA 2P9IB 4NO7A 4FW1A 2NRVA 2NRXA 2ASPA 5GIPA 3V9XA 3LZIA 4O8UA 3DXKB 3SMPA 3G25A 4CFCA 4BY9C 1YHQN 2Z1GA 3VQDA 4BR2A 3FZLA 3HYFA 2GEMA 5HROA 4LFCK 4RW8A 3F2KA 1X9JA 4IJNA 2OA8A 1Q86O 4Z4FA 2QWPA 2JLEA 2FC0A 3MN9A 5CYMA 3MAQA 1ILYA 3LP3A 1HNWK 5E26A 3R9PA 3THXA 4ELVA 4HUFA 2YJEA 3WNEA 4G9ZA 3VQ6A 3O9UA 2NUBA 1B9FA 1QHAA 1Y97A 3GE1A 4XIUA 3EKUA 2QWMA 1LW0A 2ZGZA 1D8YA 4BR7A 2RKIA 2JWLA 3CC7N 3MX2A 3MWPA 3AVLA 3AVGA 4WYBA 5K14A 3QETA 5D3GA 3TTFA 1NKCA 4E1MA 1NJZA 3CQXA 2PAVA 3VENA 3E9PA 4JI6K 1CZ9A 4C8OA 4H5TA 3TAQA 4X62K 3AVCA 5FPNA 4LFAK 4KHNA 2IDOA 5EVZA 5M1FA 1HQUA 2WFBA 3ZEUA 3O4QA 1ATSA 2HSTA 4N76A 1S6QA 2ITGA 2V52B 4DV6K 2Q31A 3T3FA 1JXBA 4IKFA 3RSEB 2ZJRL 3VESA 1EXQA 1QSLA 1WBBA 1T7PA 4RTFD 3NMUA 2NRRA 4O44A 4FL9A 2VWKA 1QTMA 4J2AA 3MEGA 1HX1A 2CH6A 1YI2N 1DTQA 4CEDA 1HR0K 1UOCA 4A59A 2WOMA 3O4WA 3TU5A 4B1XB 4DSKA 4Y1CA 4DHYA 1HNIA 1RTJA 3VTHA 4IFVA 3SQ2A 4IO8A 3FE1A 2FBTA 2F9TA 3CC4N 4O0IA 2OPPA 3MXIA 1D9FA 4WQ4C 1NGAA 3L2QA 1J9AA 5B8HA 1BI4B 2D0OA 5AQKA 2B5JA 2RPIA 4A5AA 5AQYA 5GAGP 4KHQA 5SZTA 4KB1A 2F8SA 3MMVA 3PY8A 2P9IA 2G8WA 1W0HA 2E8AA 3H08A 4JKCA 3BUZB 3DXKA 4M3YA 2F4VK 1KVAA 2QKBA 1RILA 4NLBA 2E1YA 3FZMA 1HKBA 4LSNA 1ZBSA 3KVGA 1E4GT 3M3ZA 3E66A 1SL1A 2HVHA 4LD0A 2J4RA 1U4BA 4C8KA 4DV7K 4PL8A 2E2NA 2DFHA 2V7ZA 4BG8A 4UQGA 3VETA 1LW2A 2IC3A 3WUHA 4F3OA 4DR6K 3EKSA 1IH7A 3NF6A 3OYCA 4AHUA 1NGDA 4OPHA 3D2EB 2HVIA 2WC9A 1VQ9N 2V7YA 2G8UA 3P5JA 4LF6K 5AQTA 3CFPA 3CG7A 3HZ6A 3RR7A 1QQCA 1TAQA 2NRHA 3OVNA 3CMAN 1OVQA 3CCSN 3P83D 4JKGB 2PYJA 4CBUA 5JICA 1UWBA 3CCVN 5FPMA 4IJAA 1NOZA 4OO1J 1QSSA 4JN4A 1HNXK 3I0SA 4N56A 3VEYA 4YOXA
chains in the Genus database with same CATH topology
4J2BA 3RRGA 1RCHA 4CJVA 1IKWA 4DLEA 4ID1A 1HYZA 1TK5A 1U04A 4ICLA 3OYFA 1SKWA 4CJLA 3KLFA 3K5NA 3I0RA 4CJKA 3E01A 5HBMA 3LZJA 4CFDA 3OS0A 4W5QA 4F4KA 1RDAA 1VSHA 3RMAA 2YNGA 2HHWA 1KFDA 4CERA 3NGYA 4FLXA 3SYZA 4CECA 4KV8A 2X6NA 4YFUA 4O4GA 1BHLA 2VG7A 5KGXA 1L3SA 4AILC 4FYDA 4KRFA 1LAVA 3QEWA 3V1RA 2XY5A 1HNVA 3NH1A 3AO2A 4DLGA 3VA3A 5J2NA 4DQQA 3ZSZA 4AHVA 3SJJA 3MXMA 3KKSA 3VQQA 3LPTA 4H4OA 1NK0A 4L8RB 4BE0A 1TGOA 1IO2A 4KREA 1FKOA 4FM2A 4I2PA 1EETA 1Q9YA 4B3OA 4PUOA 3WNGA 4HVJA 2I5JA 2P5OA 5DK5A 2D5RA 2GUIA 4FJ9A 2HHVA 3SUNA 1TL3A 3V9ZA 4W5TA 1VRUA 1TKZA 3ZSOA 3M8RA 1RDDA 5KRTA 1BCMA 2ZQBA 3HO1A 1TKTA 3LWMA 4AHCA 2ZD1A 3AVAA 4CGFA 3KK3A 3KK2A 3QESA 1BI4A 1C0UA 1Z25A 4QAGA 1WSEA 3VA0A 4B9MA 2OZMA 3TAEA 4CJ5A 3O3GA 4RW7A 5J2QA 4W5NA 1CXQA 3SCXA 3TI0A 2R7YA 3DYAA 4KTQA 4FLVA 4B08A 2HMIA 1JKHA 3OYLA 1MU2A 3LAKA 3TAFA 1C1BA 2B4JA 3QIOA 1TKDA 3KLGA 2HHXA 3NFAA 4IG3A 3MXJA 5KGWA 1ZBHA 3SQ0A 3DMJA 4F8RA 3RMBA 4M3XA 1IKVA 4E3SA 3OYEA 3SUOA 4OGEA 3AVIA 2XY8A 3F73A 4E7KA 2VG6A 1TVRA 2Y1IA 3VQ7A 4CFBA 1D9DA 1F21A 3VQ4A 3AO1A 4CF1A 3KK1A 1GOBA 2PYLA 4E7HA 3SI6A 1UA0A 4Y1DA 3NGZA 2HNDA 4CEOA 4W5OA 4CGIA 5HLFA 4Z4EA 1Z26A 2E6MA 1CLQA 4M3UA 4H8KA 3V9UA 4QCLA 4CGDA 3B6OA 4CJ3A 5HP1A 3BGRA 4LSLA 3OYNA 4DU1A 3OYAA 4ELUA 3AO3A 3OYIA 4CGJA 3V9SA 4FJKA 1JLEA 1RNHA 1RT3A 2KFZA 1VSFA 3VQ9A 1IG9A 3PX4A 4CJUA 3O3HA 4CF8A 4F2SA 4NCAA 4CF0A 1C0MA 2XRIA 4DF4A 4E0DA 3TAGA 4DSJA 1TK0A 3U6FA 1L5UA 4FK0A 4ZTFA 2F8TA 3O3FA 1J53A 3ZSRA 3QINA 3KIOA 3QEPA 1N6QA 3ALYA 1ZBFA 4FJJA 3B6PA 1S9EA 1BGXT 4EZ9A 3AA4A 5CZ1A 1RT4A 2HHTA 3M8SA 4GMJB 4CEFA 4N41A 3AVFA 3KJVA 4AHTA 4E1NA 3AVMA 1WAJA 1SKSA 1RTIA 4FJGA 3HT3A 2Z1HA 4FZYA 1S1XA 4PA1A 4B9SA 3K57A 3DLGA 4OPKA 4DS4A 1RTDA 3RRHA 3SUQA 2PZSA 4PQUA 5HRNA 1BIZA 1CZBA 1JXEA 3CFRA 3PX0A 4K8XA 3HK2A 4FJIA 1KCFA 3VQAA 4FK2A 3L2RA 3V6DA 3QEVA 3DLBA 4CJTA 4CESA 1KLNA 3NAEA 3VQBA 4KB0A 4AH9A 2X74A 3OJSA 3DLRA 4NCBA 4KTWA 2G8IA 3AVJA 4JS5A 1RBVA 2YNHA 1N5YA 1ASUA 2KQ2A 3ZT3A 4BDYA 3NBPA 1LV5A 1NJXA 1NK7A 3T19A 3ZT1A 4CGHA 1WAFA 3DRRA 3O4NA 5J2MA 1RDCA 4DTSA 1X9WA 1RT1A 3K59A 4CHZA 4JRPA 2KZZA 4C8MA 3THVA 3OYGA 5FROA 2XO7A 5EU7A 2OPRA 1IKXA 5HRRA 1HYSA 1WSIA 5DMRA 4FLZA 4GVMA 4J2DA 2D0CA 3OS1A 4I2QA 3L2VA 3K5MA 1NJWA 1QS4A 4TSXA 3C6TA 1LWCA 4K8ZA 2O4IA 4DS5A 2KFNA 5KTQA 1WNSA 2QK9A 4EZ6A 4CF2A 3TAPA 3QERA 1L3UA 3S3MA 4HUEA 3LAMA 1TV6A 2A1SA 3VQEA 3AA3A 3HPGA 3AVBA 3TAMA 1ZBIA 4Z4CA 3OY9A 4DU4A 1B92A 1A5VA 3CM6A 1S5JA 3HPHA 3SQ1A 5I42A 3U3YA 4CGGA 3KLEA 3QLHA 1KSPA 4PWDA 2HNZA 4AHSA 3ZSYA 4OPJA 4N47A 1SL0A 3DI6A 3L8BA 3UIQA 2DY4A 1VSDA 2OYQA 4C8NA 3ZSQA 1S1TA 4FXDA 3OYKA 3QNOA 4KAZA 2VG5A 4CJPA 2G8FA 1DLOA 4FVMA 2E6LA 3TR8A 4CF9A 4DFJA 4CHNA 2BE2A 3V1QA 1NKBA 1GOAA 3DOKA 1ZBUA 1BCOA 3KKRA 3NH0A 4OVLA 4KHYA 1UAXA 4CEEA 1JLQA 4YNQA 3LALA 2BANA 5SWMA 3RR8A 3JYTA 3SNNA 4GW6A 4B8CA 5FRMA 2W42A 2KZMA 4WE1A 3JSMA 1FK9A 3D45A 3ISNC 3LP2A 3M8PA 1D5AA 1G15A 4ZHRA 3ZSVA 4DTMA 4KI6A 3HSTB 4RW6A 5I3UA 4BACA 1ZBLA 3DOLA 3IRXA 3IS9A 3MEEA 3K58A 3BDPA 4JLHA 1BIUA 2ETJA 1YTUA 1C1AA 4BDZA 3HM9A 3MECA 4MQ3A 3HVTA 1JLGA 3CYMA 3HP9A 4C8LA 3HPOA 4FM0A 3TWHA 1T8EA 3PX6A 1WLJA 3ZT0A 4B9TA 1SUQA 4M3ZA 1HRHA 4B9LA 4BDPA 4O55A 1T05A 2IS3A 2E4LA 4BE2A 1W9HA 4DQPA 1WSHA 4ELTA 1XI1A 4NYFA 4KHSA 2YHAA 4HUGA 2GV9A 4DSFA 4DSLA 4DTUA 3QIPA 4CJWA 4DSIA 4FJHA 1HYVA 4CJSA 1SV5A 2AJQA 4OLAA 3DLHA 4B8AB 4DF8A 1HPZA 2FBVA 4M3RA 2OZSA 3WNHA 4Z4HA 4HTUA 1XWLA 5KI6A 4E7LA 4DSEA 3DLEA 2XY6A 1XC9A 4FJLA 4CJRA 3DRPA 4FJMA 2P1JA 1A5WA 2YKNA 4B9VA 1KVBA 4O0JA 4FLTA 1FKPA 4FJXA 1WSGA 4EP4A 1LWFA 1NKEA 3LP1A 3LPUA 4DTOA 1S6PA 1RDBA 4B9NA 4Z4IA 4F2RA 3OYMA 4F3TA 1RT6A 4FM1A 2FBYA 4B9UA 3AO4A 4N5SA 3SV4A 5CZ2A 1VSMA 2QXFA 1RBUA 1R0AA 1NK9A 1KLMA 1VK0A 2DFEA 2HNYA 3V1OA 3VQCA 4CJFA 1YT3A 4FW1A 4KHWA 4CIEA 1KTQA 4FJ5A 2KTQA 3V9XA 1J5OA 3LZIA 1RT5A 2HHQA 3LANA 1EP4A 5C24A 4FK4A 1QE1A 1BISA 4LY7A 4CFCA 4DFPA 1VRTA 2X78A 2BDPA 2Z1GA 3VQDA 3ZSWA 3C6UA 2Z1IA 3HYFA 5HROA 1EX4A 4RW8A 4E7IA 2LSNA 4DU3A 1A5XA 3C94A 4KI4A 3OYJA 4OLBA 2IOCA 2HHSA 1J54A 1VSEA 4DTJA 2OA8A 1JLAA 4CJQA 1QHTA 4Z4FA 2B6AA 2JLEA 4FJ8A 2FC0A 5CYMA 2YNIA 3HP6A 3LP3A 3MAQA 3SPZA 2OPQA 1O1WA 3SUPA 3SPYA 3PO5A 4HHTA 3ITHA 3OYHA 2YNFA 3CM5A 3LWLA 4E89A 3ZT2A 4ELVA 4HUFA 4J2EA 3AV9A 1C0TA 3WNEA 1KFSA 1TL1A 3VQ6A 3TANA 2YHBA 2NUBA 1B9FA 1S1UA 1C6VA 1KVCA 1Y97A 2Q3SA 4M45A 4XIUA 3C95A 3DLKA 4IDKA 4CFAA 1JLCA 4HCBA 3HJFA 4FLWA 1LW0A 1WN7A 4CEZA 2G8KA 1HQEA 2HB5A 1D8YA 1RT7A 2RKIA 3OS2A 3L3UA 1RBSA 4M42A 1S9GA 3AVLA 3AVGA 1JL1A 1RTHA 4CEBA 2EHGA 4OKJA 5K14A 1VSIA 3V81A 4M41A 3QETA 5D3GA 1REVA 1NKCA 4E1MA 5C25A 1NJZA 3NDKA 4IBNA 1U45A 1U47A 2PY5A 1X9MA 3QEXA 3HL8A 4OJRA 2VWJA 1L3TA 4I9LA 3VQPA 4I7FA 1BL3A 4CJEA 3KLHA 1RBRA 3RTVA 4DTNA 4DQRA 4DTRA 1CZ9A 4CE9A 4CK3A 2HHUA 4IFYA 1NOYA 4C8OA 3K2PA 2KW4A 2JGUA 1TKXA 4R5PA 3TAQA 4FLYA 2P5GA 3AVCA 1CXUA 4KHNA 2IDOA 3K5OA 1HMVA 2DFFA 5HRPA 3RMCA 1T03A 1NK5A 3VQ8A 5J2PA 1HQUA 4PY5A 4FJNA 1X9SA 4AHRA 3LP0A 4BE1A 3O4QA 1Q8IA 4ZTJA 3CQ8A 4N76A 1S6QA 2ITGA 4OKKA 4RG8A 3NHGA 5JS1A 4E7JA 3EZ5A 3T3FA 1YVUA 3S3NA 1JXBA 5JS2A 4DQIA 4IKFA 1BQMA 1WSFA 4KKOA 1UA1A 2ATQA 3QEIA 3G10A 2ZE2A 3LDSA 1EXQA 1QSLA 1T7PA 4KO0A 2FBXA 1SL2A 3NCIA 1U48A 3V4IA 4O44A 2VWKA 1QTMA 3NF7A 4J2AA 3M8QA 3MEGA 4KPYA 2Z1JA 3T1AA 1DTQA 2D0AA 5CY4A 1YTAA 1L3VA 4CEDA 4FCYA 1UOCA 2IGIA 2WOMA 4FW2A 4I9QA 4DSKA 1I3AA 5HRSA 1ASWA 4Y1CA 1RT2A 2G8HA 4DWIA 1HNIA 4LH5A 2Y1JA 1RTJA 3ZSXA 1ASVA 3P1GA 3SQ4A 4CCHA 3RWUA 4IFVA 3SQ2A 1X1PA 1NK4A 3NGIA 2FBTA 3AO5A 4NCGA 3ULDA 3AA2A 3G0ZA 1U49A 3KD1E 4O0IA 5E41A 2OPPA 4E19A 3MXIA 2YKMA 1SKRA 1JL2A 3L2QA 1D9FA 1J9AA 4QOZB 2RN2A 4DFKA 1BI4B 2B5JA 2RPIA 1VSKA 2X6SA 5CYQA 5FDLA 4FLUA 4DTPA 1I39A 1ZYQA 4KHQA 5SZTA 4DFMA 4CHYA 4KB1A 4DMNA 2F8SA 1KRPA 4CEAA 2YV0X 3PY8A 1JLFA 2G8WA 2XHBA 4CHQA 1RBTA 1W0HA 2F96A 3L2WA 1XHXA 4M3TA 3H08A 1ITGA 3KLIA 1IKYA 1QSYA 3K5LA 3FFIA 2G8VA 4M3YA 1KVAA 2QKBA 1RILA 3ASMA 1C1CA 3ZT4A 2RF2A 4LH4A 4CIGA 5KRSA 4Z4GA 3OJUA 2DTUA 1S1VA 3L2UA 3IAYA 3QNNA 3L3VA 4LSNA 4KHUA 4CIFA 1HJRA 1Q9XA 3KD5E 4IG0A 1TK8A 3AVNA 1SL1A 3QO9A 1S1WA 3PUFA 4RW9A 3MEDA 4LD0A 4CJ4A 2HVHA 1EKEA 4CK1A 2A1RA 3V9WA 4O5BA 1U4BA 4C8KA 3VN5A 4RW4A 1K6YA 4BWJA 2XY7A 2DFHA 3F9KA 4CK2A 2D0BA 4UQGA 1B9DA 1LW2A 2IC3A 3TARA 4F3OA 2O4GA 3HVRA 3NF9A 3SV3A 4EP5A 5C42A 2EX3A 1NJYA 1IH7A 4MFBA 3NF6A 3OYCA 2OPSA 3OYDA 3U3GA 4AHUA 3S9HA 4JS4A 3HXMA 3EYZA 2QKKA 1WSJA 3AVHA 1GOCA 4G1QA 5J1EA 1NK8A 4KTZA 2HVIA 4HCCA 4Q0BA 1BQNA 2P51A 4KFBA 4DG1A 3S3OA 1TAUA 4FZZA 4OKEA 1VSJA 2BGGA 4M3WA 3TABA 2G8UA 3P5JA 3KTQA 3NE6A 3WNFA 4CHOA 1JLBA 4W5RA 2GBZA 3NH2A 3CG7A 3OYBA 3CFPA 1NK6A 4DQSA 3AA5X 1QQCA 1TAQA 3AVKA 3RR7A 3OVNA 4H4MA 3SZ2A 3PV8A 3IG1A 5FRNA 3P83D 1DTTA 1VSLA 3CFOA 4NYNA 4CEQA 5T7BA 2PYJA 4FJ7A 4FZXC 1LAWA 4CHPA 3PO4A 3NF8A 3ZCMA 3DRSA 3RMDA 2HW3A 1UWBA 3VQ5A 3EY1A 3I8DA 4BWMA 1NOZA 1XHZA 4ID5A 4DTXA 1QSSA 4Q5VA 2WONA 3DM2A 1LWEA 1FXXA 3I0SA 4Z0UA 3A2FA 4N56A 3D0PA 4OGCA 4JRQA 2IAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J2B A;  3RRG A;  1RCH A;  4CJV A;  1IKW A;  4DLE A;  4ID1 A;  1HYZ A;  1TK5 A;  1U04 A;  4ICL A;  3OYF A;  1SKW A;  4CJL A;  3KLF A;  3K5N A;  3I0R A;  4CJK A;  3E01 A;  5HBM A;  3LZJ A;  4CFD A;  3OS0 A;  4W5Q A;  4F4K A;  1RDA A;  1VSH A;  3RMA A;  2YNG A;  2HHW A;  1KFD A;  4CER A;  3NGY A;  4FLX A;  3SYZ A;  4CEC A;  4KV8 A;  2X6N A;  4YFU A;  4O4G A;  1BHL A;  2VG7 A;  5KGX A;  1L3S A;  4AIL C;  4FYD A;  4KRF A;  1LAV A;  3QEW A;  3V1R A;  2XY5 A;  1HNV A;  3NH1 A;  3AO2 A;  4DLG A;  3VA3 A;  5J2N A;  4DQQ A;  3ZSZ A;  4AHV A;  3SJJ A;  3MXM A;  3KKS A;  3VQQ A;  3LPT A;  4H4O A;  1NK0 A;  4L8R B;  4BE0 A;  1TGO A;  1IO2 A;  4KRE A;  1FKO A;  4FM2 A;  4I2P A;  1EET A;  1Q9Y A;  4B3O A;  4PUO A;  3WNG A;  4HVJ A;  2I5J A;  2P5O A;  5DK5 A;  2D5R A;  2GUI A;  4FJ9 A;  2HHV A;  3SUN A;  1TL3 A;  3V9Z A;  4W5T A;  1VRU A;  1TKZ A;  3ZSO A;  3M8R A;  1RDD A;  5KRT A;  1BCM A;  2ZQB A;  3HO1 A;  1TKT A;  3LWM A;  4AHC A;  2ZD1 A;  3AVA A;  4CGF A;  3KK3 A;  3KK2 A;  3QES A;  1BI4 A;  1C0U A;  1Z25 A;  4QAG A;  1WSE A;  3VA0 A;  4B9M A;  2OZM A;  3TAE A;  4CJ5 A;  3O3G A;  4RW7 A;  5J2Q A;  4W5N A;  1CXQ A;  3SCX A;  3TI0 A;  2R7Y A;  3DYA A;  4KTQ A;  4FLV A;  4B08 A;  2HMI A;  1JKH A;  3OYL A;  1MU2 A;  3LAK A;  3TAF A;  1C1B A;  2B4J A;  3QIO A;  1TKD A;  3KLG A;  2HHX A;  3NFA A;  4IG3 A;  3MXJ A;  5KGW A;  1ZBH A;  3SQ0 A;  3DMJ A;  4F8R A;  3RMB A;  4M3X A;  1IKV A;  4E3S A;  3OYE A;  3SUO A;  4OGE A;  3AVI A;  2XY8 A;  3F73 A;  4E7K A;  2VG6 A;  1TVR A;  2Y1I A;  3VQ7 A;  4CFB A;  1D9D A;  1F21 A;  3VQ4 A;  3AO1 A;  4CF1 A;  3KK1 A;  1GOB A;  2PYL A;  4E7H A;  3SI6 A;  1UA0 A;  4Y1D A;  3NGZ A;  2HND A;  4CEO A;  4W5O A;  4CGI A;  5HLF A;  4Z4E A;  1Z26 A;  2E6M A;  1CLQ A;  4M3U A;  4H8K A;  3V9U A;  4QCL A;  4CGD A;  3B6O A;  4CJ3 A;  5HP1 A;  3BGR A;  4LSL A;  3OYN A;  4DU1 A;  3OYA A;  4ELU A;  3AO3 A;  3OYI A;  4CGJ A;  3V9S A;  4FJK A;  1JLE A;  1RNH A;  1RT3 A;  2KFZ A;  1VSF A;  3VQ9 A;  1IG9 A;  3PX4 A;  4CJU A;  3O3H A;  4CF8 A;  4F2S A;  4NCA A;  4CF0 A;  1C0M A;  2XRI A;  4DF4 A;  4E0D A;  3TAG A;  4DSJ A;  1TK0 A;  3U6F A;  1L5U A;  4FK0 A;  4ZTF A;  2F8T A;  3O3F A;  1J53 A;  3ZSR A;  3QIN A;  3KIO A;  3QEP A;  1N6Q A;  3ALY A;  1ZBF A;  4FJJ A;  3B6P A;  1S9E A;  1BGX T;  4EZ9 A;  3AA4 A;  5CZ1 A;  1RT4 A;  2HHT A;  3M8S A;  4GMJ B;  4CEF A;  4N41 A;  3AVF A;  3KJV A;  4AHT A;  4E1N A;  3AVM A;  1WAJ A;  1SKS A;  1RTI A;  4FJG A;  3HT3 A;  2Z1H A;  4FZY A;  1S1X A;  4PA1 A;  4B9S A;  3K57 A;  3DLG A;  4OPK A;  4DS4 A;  1RTD A;  3RRH A;  3SUQ A;  2PZS A;  4PQU A;  5HRN A;  1BIZ A;  1CZB A;  1JXE A;  3CFR A;  3PX0 A;  4K8X A;  3HK2 A;  4FJI A;  1KCF A;  3VQA A;  4FK2 A;  3L2R A;  3V6D A;  3QEV A;  3DLB A;  4CJT A;  4CES A;  1KLN A;  3NAE A;  3VQB A;  4KB0 A;  4AH9 A;  2X74 A;  3OJS A;  3DLR A;  4NCB A;  4KTW A;  2G8I A;  3AVJ A;  4JS5 A;  1RBV A;  2YNH A;  1N5Y A;  1ASU A;  2KQ2 A;  3ZT3 A;  4BDY A;  3NBP A;  1LV5 A;  1NJX A;  1NK7 A;  3T19 A;  3ZT1 A;  4CGH A;  1WAF A;  3DRR A;  3O4N A;  5J2M A;  1RDC A;  4DTS A;  1X9W A;  1RT1 A;  3K59 A;  4CHZ A;  4JRP A;  2KZZ A;  4C8M A;  3THV A;  3OYG A;  5FRO A;  2XO7 A;  5EU7 A;  2OPR A;  1IKX A;  5HRR A;  1HYS A;  1WSI A;  5DMR A;  4FLZ A;  4GVM A;  4J2D A;  2D0C A;  3OS1 A;  4I2Q A;  3L2V A;  3K5M A;  1NJW A;  1QS4 A;  4TSX A;  3C6T A;  1LWC A;  4K8Z A;  2O4I A;  4DS5 A;  2KFN A;  5KTQ A;  1WNS A;  2QK9 A;  4EZ6 A;  4CF2 A;  3TAP A;  3QER A;  1L3U A;  3S3M A;  4HUE A;  3LAM A;  1TV6 A;  2A1S A;  3VQE A;  3AA3 A;  3HPG A;  3AVB A;  3TAM A;  1ZBI A;  4Z4C A;  3OY9 A;  4DU4 A;  1B92 A;  1A5V A;  3CM6 A;  1S5J A;  3HPH A;  3SQ1 A;  5I42 A;  3U3Y A;  4CGG A;  3KLE A;  3QLH A;  1KSP A;  4PWD A;  2HNZ A;  4AHS A;  3ZSY A;  4OPJ A;  4N47 A;  1SL0 A;  3DI6 A;  3L8B A;  3UIQ A;  2DY4 A;  1VSD A;  2OYQ A;  4C8N A;  3ZSQ A;  1S1T A;  4FXD A;  3OYK A;  3QNO A;  4KAZ A;  2VG5 A;  4CJP A;  2G8F A;  1DLO A;  4FVM A;  2E6L A;  3TR8 A;  4CF9 A;  4DFJ A;  4CHN A;  2BE2 A;  3V1Q A;  1NKB A;  1GOA A;  3DOK A;  1ZBU A;  1BCO A;  3KKR A;  3NH0 A;  4OVL A;  4KHY A;  1UAX A;  4CEE A;  1JLQ A;  4YNQ A;  3LAL A;  2BAN A;  5SWM A;  3RR8 A;  3JYT A;  3SNN A;  4GW6 A;  4B8C A;  5FRM A;  2W42 A;  2KZM A;  4WE1 A;  3JSM A;  1FK9 A;  3D45 A;  3ISN C;  3LP2 A;  3M8P A;  1D5A A;  1G15 A;  4ZHR A;  3ZSV A;  4DTM A;  4KI6 A;  3HST B;  4RW6 A;  5I3U A;  4BAC A;  1ZBL A;  3DOL A;  3IRX A;  3IS9 A;  3MEE A;  3K58 A;  3BDP A;  4JLH A;  1BIU A;  2ETJ A;  1YTU A;  1C1A A;  4BDZ A;  3HM9 A;  3MEC A;  4MQ3 A;  3HVT A;  1JLG A;  3CYM A;  3HP9 A;  4C8L A;  3HPO A;  4FM0 A;  3TWH A;  1T8E A;  3PX6 A;  1WLJ A;  3ZT0 A;  4B9T A;  1SUQ A;  4M3Z A;  1HRH A;  4B9L A;  4BDP A;  4O55 A;  1T05 A;  2IS3 A;  2E4L A;  4BE2 A;  1W9H A;  4DQP A;  1WSH A;  4ELT A;  1XI1 A;  4NYF A;  4KHS A;  2YHA A;  4HUG A;  2GV9 A;  4DSF A;  4DSL A;  4DTU A;  3QIP A;  4CJW A;  4DSI A;  4FJH A;  1HYV A;  4CJS A;  1SV5 A;  2AJQ A;  4OLA A;  3DLH A;  4B8A B;  4DF8 A;  1HPZ A;  2FBV A;  4M3R A;  2OZS A;  3WNH A;  4Z4H A;  4HTU A;  1XWL A;  5KI6 A;  4E7L A;  4DSE A;  3DLE A;  2XY6 A;  1XC9 A;  4FJL A;  4CJR A;  3DRP A;  4FJM A;  2P1J A;  1A5W A;  2YKN A;  4B9V A;  1KVB A;  4O0J A;  4FLT A;  1FKP A;  4FJX A;  1WSG A;  4EP4 A;  1LWF A;  1NKE A;  3LP1 A;  3LPU A;  4DTO A;  1S6P A;  1RDB A;  4B9N A;  4Z4I A;  4F2R A;  3OYM A;  4F3T A;  1RT6 A;  4FM1 A;  2FBY A;  4B9U A;  3AO4 A;  4N5S A;  3SV4 A;  5CZ2 A;  1VSM A;  2QXF A;  1RBU A;  1R0A A;  1NK9 A;  1KLM A;  1VK0 A;  2DFE A;  2HNY A;  3V1O A;  3VQC A;  4CJF A;  1YT3 A;  4FW1 A;  4KHW A;  4CIE A;  1KTQ A;  4FJ5 A;  2KTQ A;  3V9X A;  1J5O A;  3LZI A;  1RT5 A;  2HHQ A;  3LAN A;  1EP4 A;  5C24 A;  4FK4 A;  1QE1 A;  1BIS A;  4LY7 A;  4CFC A;  4DFP A;  1VRT A;  2X78 A;  2BDP A;  2Z1G A;  3VQD A;  3ZSW A;  3C6U A;  2Z1I A;  3HYF A;  5HRO A;  1EX4 A;  4RW8 A;  4E7I A;  2LSN A;  4DU3 A;  1A5X A;  3C94 A;  4KI4 A;  3OYJ A;  4OLB A;  2IOC A;  2HHS A;  1J54 A;  1VSE A;  4DTJ A;  2OA8 A;  1JLA A;  4CJQ A;  1QHT A;  4Z4F A;  2B6A A;  2JLE A;  4FJ8 A;  2FC0 A;  5CYM A;  2YNI A;  3HP6 A;  3LP3 A;  3MAQ A;  3SPZ A;  2OPQ A;  1O1W A;  3SUP A;  3SPY A;  3PO5 A;  4HHT A;  3ITH A;  3OYH A;  2YNF A;  3CM5 A;  3LWL A;  4E89 A;  3ZT2 A;  4ELV A;  4HUF A;  4J2E A;  3AV9 A;  1C0T A;  3WNE A;  1KFS A;  1TL1 A;  3VQ6 A;  3TAN A;  2YHB A;  2NUB A;  1B9F A;  1S1U A;  1C6V A;  1KVC A;  1Y97 A;  2Q3S A;  4M45 A;  4XIU A;  3C95 A;  3DLK A;  4IDK A;  4CFA A;  1JLC A;  4HCB A;  3HJF A;  4FLW A;  1LW0 A;  1WN7 A;  4CEZ A;  2G8K A;  1HQE A;  2HB5 A;  1D8Y A;  1RT7 A;  2RKI A;  3OS2 A;  3L3U A;  1RBS A;  4M42 A;  1S9G A;  3AVL A;  3AVG A;  1JL1 A;  1RTH A;  4CEB A;  2EHG A;  4OKJ A;  5K14 A;  1VSI A;  3V81 A;  4M41 A;  3QET A;  5D3G A;  1REV A;  1NKC A;  4E1M A;  5C25 A;  1NJZ A;  3NDK A;  4IBN A;  1U45 A;  1U47 A;  2PY5 A;  1X9M A;  3QEX A;  3HL8 A;  4OJR A;  2VWJ A;  1L3T A;  4I9L A;  3VQP A;  4I7F A;  1BL3 A;  4CJE A;  3KLH A;  1RBR A;  3RTV A;  4DTN A;  4DQR A;  4DTR A;  1CZ9 A;  4CE9 A;  4CK3 A;  2HHU A;  4IFY A;  1NOY A;  4C8O A;  3K2P A;  2KW4 A;  2JGU A;  1TKX A;  4R5P A;  3TAQ A;  4FLY A;  2P5G A;  3AVC A;  1CXU A;  4KHN A;  2IDO A;  3K5O A;  1HMV A;  2DFF A;  5HRP A;  3RMC A;  1T03 A;  1NK5 A;  3VQ8 A;  5J2P A;  1HQU A;  4PY5 A;  4FJN A;  1X9S A;  4AHR A;  3LP0 A;  4BE1 A;  3O4Q A;  1Q8I A;  4ZTJ A;  3CQ8 A;  4N76 A;  1S6Q A;  2ITG A;  4OKK A;  4RG8 A;  3NHG A;  5JS1 A;  4E7J A;  3EZ5 A;  3T3F A;  1YVU A;  3S3N A;  1JXB A;  5JS2 A;  4DQI A;  4IKF A;  1BQM A;  1WSF A;  4KKO A;  1UA1 A;  2ATQ A;  3QEI A;  3G10 A;  2ZE2 A;  3LDS A;  1EXQ A;  1QSL A;  1T7P A;  4KO0 A;  2FBX A;  1SL2 A;  3NCI A;  1U48 A;  3V4I A;  4O44 A;  2VWK A;  1QTM A;  3NF7 A;  4J2A A;  3M8Q A;  3MEG A;  4KPY A;  2Z1J A;  3T1A A;  1DTQ A;  2D0A A;  5CY4 A;  1YTA A;  1L3V A;  4CED A;  4FCY A;  1UOC A;  2IGI A;  2WOM A;  4FW2 A;  4I9Q A;  4DSK A;  1I3A A;  5HRS A;  1ASW A;  4Y1C A;  1RT2 A;  2G8H A;  4DWI A;  1HNI A;  4LH5 A;  2Y1J A;  1RTJ A;  3ZSX A;  1ASV A;  3P1G A;  3SQ4 A;  4CCH A;  3RWU A;  4IFV A;  3SQ2 A;  1X1P A;  1NK4 A;  3NGI A;  2FBT A;  3AO5 A;  4NCG A;  3ULD A;  3AA2 A;  3G0Z A;  1U49 A;  3KD1 E;  4O0I A;  5E41 A;  2OPP A;  4E19 A;  3MXI A;  2YKM A;  1SKR A;  1JL2 A;  3L2Q A;  1D9F A;  1J9A A;  4QOZ B;  2RN2 A;  4DFK A;  1BI4 B;  2B5J A;  2RPI A;  1VSK A;  2X6S A;  5CYQ A;  5FDL A;  4FLU A;  4DTP A;  1I39 A;  1ZYQ A;  4KHQ A;  5SZT A;  4DFM A;  4CHY A;  4KB1 A;  4DMN A;  2F8S A;  1KRP A;  4CEA A;  2YV0 X;  3PY8 A;  1JLF A;  2G8W A;  2XHB A;  4CHQ A;  1RBT A;  1W0H A;  2F96 A;  3L2W A;  1XHX A;  4M3T A;  3H08 A;  1ITG A;  3KLI A;  1IKY A;  1QSY A;  3K5L A;  3FFI A;  2G8V A;  4M3Y A;  1KVA A;  2QKB A;  1RIL A;  3ASM A;  1C1C A;  3ZT4 A;  2RF2 A;  4LH4 A;  4CIG A;  5KRS A;  4Z4G A;  3OJU A;  2DTU A;  1S1V A;  3L2U A;  3IAY A;  3QNN A;  3L3V A;  4LSN A;  4KHU A;  4CIF A;  1HJR A;  1Q9X A;  3KD5 E;  4IG0 A;  1TK8 A;  3AVN A;  1SL1 A;  3QO9 A;  1S1W A;  3PUF A;  4RW9 A;  3MED A;  4LD0 A;  4CJ4 A;  2HVH A;  1EKE A;  4CK1 A;  2A1R A;  3V9W A;  4O5B A;  1U4B A;  4C8K A;  3VN5 A;  4RW4 A;  1K6Y A;  4BWJ A;  2XY7 A;  2DFH A;  3F9K A;  4CK2 A;  2D0B A;  4UQG A;  1B9D A;  1LW2 A;  2IC3 A;  3TAR A;  4F3O A;  2O4G A;  3HVR A;  3NF9 A;  3SV3 A;  4EP5 A;  5C42 A;  2EX3 A;  1NJY A;  1IH7 A;  4MFB A;  3NF6 A;  3OYC A;  2OPS A;  3OYD A;  3U3G A;  4AHU A;  3S9H A;  4JS4 A;  3HXM A;  3EYZ A;  2QKK A;  1WSJ A;  3AVH A;  1GOC A;  4G1Q A;  5J1E A;  1NK8 A;  4KTZ A;  2HVI A;  4HCC A;  4Q0B A;  1BQN A;  2P51 A;  4KFB A;  4DG1 A;  3S3O A;  1TAU A;  4FZZ A;  4OKE A;  1VSJ A;  2BGG A;  4M3W A;  3TAB A;  2G8U A;  3P5J A;  3KTQ A;  3NE6 A;  3WNF A;  4CHO A;  1JLB A;  4W5R A;  2GBZ A;  3NH2 A;  3CG7 A;  3OYB A;  3CFP A;  1NK6 A;  4DQS A;  3AA5 X;  1QQC A;  1TAQ A;  3AVK A;  3RR7 A;  3OVN A;  4H4M A;  3SZ2 A;  3PV8 A;  3IG1 A;  5FRN A;  3P83 D;  1DTT A;  1VSL A;  3CFO A;  4NYN A;  4CEQ A;  5T7B A;  2PYJ A;  4FJ7 A;  4FZX C;  1LAW A;  4CHP A;  3PO4 A;  3NF8 A;  3ZCM A;  3DRS A;  3RMD A;  2HW3 A;  1UWB A;  3VQ5 A;  3EY1 A;  3I8D A;  4BWM A;  1NOZ A;  1XHZ A;  4ID5 A;  4DTX A;  1QSS A;  4Q5V A;  2WON A;  3DM2 A;  1LWE A;  1FXX A;  3I0S A;  4Z0U A;  3A2F A;  4N56 A;  3D0P A;  4OGC A;  4JRQ A;  2IAJ A; 
#chains in the Genus database with same CATH topology
 3PSI A;  5KPR A;  1N36 K;  3RRG A;  4CJV A;  5BRD A;  4PL7 A;  4ID1 A;  1U04 A;  3OYF A;  3RSE A;  4CFD A;  3OS0 A;  3CXC M;  3RMA A;  2YNG A;  4CER A;  4J8F A;  3NGY A;  1DEJ A;  2GEL A;  1VQ7 N;  4YFU A;  3VER A;  1BHL A;  4H5R A;  1L3S A;  2HHH K;  1G99 A;  4AIL C;  2UUA K;  3QEW A;  3NH1 A;  4DLG A;  5J2N A;  3SJJ A;  2HBJ A;  4AHV A;  3RVC A;  4L8R B;  1NK0 A;  3LPT A;  4H4O A;  2W40 A;  1TGO A;  1IO2 A;  2IVP A;  4BE0 A;  4HVJ A;  2GUI A;  2VGM A;  4PKH A;  3SUN A;  1TL3 A;  1OH8 A;  1KAY A;  1TKZ A;  3QIC A;  4KHP K;  4FVU A;  1RDD A;  1BCM A;  1WOQ A;  4CBX A;  3LWM A;  3I55 N;  3KHY A;  3AVA A;  4CGF A;  1BI4 A;  1BG3 A;  4IOA L;  3JAM O;  1WSE A;  3VA0 A;  4B9M A;  3MN5 A;  5J2Q A;  4RW7 A;  3TI0 A;  3DYA A;  4FLV A;  4K42 A;  4A2A A;  2YCH A;  3R1X A;  4CZK A;  3H45 C;  1I94 K;  2OCE A;  4DR5 K;  4UY8 O;  4M3X A;  2HBL A;  1TVR A;  3FZK A;  3O6W A;  1TUU A;  4CD1 A;  1D9D A;  1F21 A;  3VQ4 A;  4KH4 A;  1KAZ A;  2CGJ A;  3SI6 A;  3NGZ A;  2HND A;  4CZG A;  1Z26 A;  1CLQ A;  3FFK B;  5HP1 A;  4LF4 K;  3BGR A;  3OYN A;  4IOC L;  3V9S A;  3VGM A;  3THW B;  1VSF A;  3VQ9 A;  3VPZ A;  3VF6 A;  4CF8 A;  4F2S A;  4CF0 A;  4DSJ A;  1NGC A;  4NB4 A;  3D2E A;  1J53 A;  4YOT A;  3R3L A;  3E9L A;  3B6P A;  3CQY A;  4EZ9 A;  1YVN A;  3M8S A;  1H1V A;  3KJV A;  4FJG A;  3S41 A;  1QQN A;  1NNE A;  2Z1H A;  4FZY A;  4M7Y A;  4JKG A;  3K57 A;  3WXL A;  3DLG A;  3N4Q A;  1CZB A;  4K8X A;  4B3S K;  4FK2 A;  2ZM6 K;  3O5B A;  3DLB A;  4CES A;  3NAE A;  3VQB A;  4NCB A;  1KD1 O;  3EE8 A;  1N5Y A;  4FWN A;  2KQ2 A;  3ZT3 A;  4BDY A;  1LV5 A;  1NK7 A;  3T19 A;  3DRR A;  5FPD A;  3J7Z O;  3K59 A;  4JRP A;  3THV A;  5FRO A;  2XO7 A;  5LJV A;  1IKX A;  1HYS A;  5DMR A;  2D0C A;  4BRH A;  4I2Q A;  1E4F T;  4K8Z A;  1LWC A;  1IBM K;  5KTQ A;  4JI3 K;  2PBD A;  1OH7 A;  3LAM A;  4DR7 K;  3TAM A;  3Q7B A;  2VQF K;  4A2B A;  3KLE A;  1KSP A;  2O8B B;  4YDU C;  3UIQ A;  1SL0 A;  1D4X A;  3ZSQ A;  1S1T A;  4FXD A;  3ID6 A;  3OYK A;  3K0S A;  1DLO A;  2E6L A;  4FSV A;  3V1Q A;  1GOA A;  3KKR A;  1ZBU A;  1JLQ A;  4YNQ A;  3WXI A;  3RR8 A;  3JYT A;  4B8C A;  3QB0 A;  2KZM A;  4BRO A;  3M8P A;  3LP2 A;  1G15 A;  3HST B;  4RW6 A;  4DV5 K;  2ETJ A;  1GLL O;  1C1A A;  4B1U B;  4WQ5 C;  4JKB A;  3CET A;  1JLG A;  3CYM A;  4FM0 A;  4E1J A;  1SUQ A;  1T6D A;  1HRH A;  2Q0R A;  2E4L A;  1VQP N;  1VQ4 N;  1EQY A;  2KKZ A;  3VEX A;  4NYF A;  4KHS A;  4HUG A;  4DSL A;  2Q1N A;  4CJW A;  4FJH A;  1N33 K;  3DLH A;  4B8A B;  3THW A;  4DB3 A;  4Z4H A;  5C15 A;  1XC9 A;  3LDN A;  4CVN E;  1KVB A;  3VEV A;  1KAX A;  5GAH P;  4WFA L;  1RDB A;  3I8B A;  1RT6 A;  2WTU A;  3SV4 A;  1VSM A;  3O9Q A;  1BA1 A;  3VGL A;  1VK0 A;  2DFE A;  4CJF A;  2HNY A;  3V1O A;  4KHW A;  4CIE A;  1OKJ A;  4DR4 K;  3JXU A;  1J5O A;  3LAN A;  4JD2 B;  3GBT A;  4LY7 A;  5C24 A;  1EO1 A;  3EZW A;  4DFP A;  1VRT A;  2X78 A;  2AA4 A;  3ZSW A;  1XQS C;  1VQ5 N;  4E7I A;  4DU3 A;  1YJW N;  4KI4 A;  1VSE A;  1JLA A;  2B6A A;  2YNI A;  4XH1 A;  1IBK K;  2OPQ A;  4JHD B;  3SPY A;  4HHT A;  3ITH A;  1NLV A;  5F0X A;  3LWL A;  1N32 K;  3ZT2 A;  3AV9 A;  1C0T A;  2QTD A;  5AQS A;  1KFS A;  3TAN A;  3O8M A;  1S1U A;  1C6V A;  4M45 A;  5AQW A;  1KVC A;  2Q3S A;  5AQP A;  4IO9 L;  4CFA A;  5AJ3 K;  3HJF A;  4JKH A;  4FLW A;  1WN7 A;  4CEZ A;  2G8K A;  1HQE A;  2HB5 A;  4BRQ A;  1WB9 A;  3L3U A;  1S9G A;  2Q36 A;  1RTH A;  1V4T A;  1JCE A;  1VQN N;  2O8B A;  4FPB A;  1U47 A;  4IBN A;  4JI4 K;  2PY5 A;  4PKI A;  3QEX A;  5ELZ A;  3E9O A;  1ZXO A;  2FXU A;  3VEW A;  5BRF A;  4BVO A;  4I9L A;  4I7F A;  4M7X A;  1RBR A;  4DTN A;  3SMS A;  5AR0 A;  4DQR A;  4BR4 A;  2KW4 A;  4I6M A;  4R5P A;  4A57 A;  2P5G A;  3VTI A;  1CXU A;  2DFF A;  5HRP A;  1T03 A;  1NK5 A;  5AQL A;  3VQ8 A;  4FJN A;  1X9S A;  3NVK A;  5AFU A;  4ZTJ A;  3K9J A;  3DLL L;  5JS1 A;  1YVU A;  2NRT A;  3S3N A;  5JS2 A;  1NGI A;  2UXB K;  4KKO A;  4LF5 K;  3CJ9 A;  4GVE A;  3TTC A;  1K9M O;  4KO0 A;  2FBX A;  3FLC O;  1SL2 A;  3NCI A;  3A5L C;  4KPY A;  3LDQ A;  2Z1J A;  3R6M A;  2D0A A;  4JK8 A;  1XMQ K;  1L3V A;  1NM1 A;  4KH6 A;  4I9Q A;  2IIR A;  4LH5 A;  4H0T B;  3ZSX A;  4DR1 K;  1ASV A;  3P1G A;  4CCH A;  1SS6 A;  1X1P A;  5JLF A;  4NCG A;  3AA2 A;  3G0Z A;  4YOU A;  2YHX A;  2YKM A;  1JL2 A;  4QOZ B;  2RN2 A;  2W41 A;  2X6S A;  5CYQ A;  2OAN A;  4DFM A;  4CHY A;  1VQK N;  1KRP A;  2H3G X;  4CEA A;  2YV0 X;  4CHQ A;  1XHX A;  1QSY A;  2PFU A;  3FFI A;  3ASM A;  1C1C A;  4CIG A;  1J6Z A;  3IAY A;  3QNN A;  4IFE A;  4IG0 A;  1TK8 A;  3QO9 A;  1S1W A;  1NMD A;  4RW9 A;  4CJ4 A;  1EKE A;  3O08 A;  3SK3 A;  4CK1 A;  2HOE A;  4RW4 A;  4JHD A;  2NRW A;  4BWJ A;  4C1N I;  3AY9 A;  4CK2 A;  4AM6 A;  2O4G A;  4K0K K;  1E3M A;  2EX3 A;  4MFB A;  4JYA K;  4WCE L;  4WQ4 A;  3G6E N;  4BQZ A;  3S9H A;  4F9O A;  2QWR A;  4JS4 A;  3HXM A;  1VQM N;  3AVH A;  5J1E A;  1NK8 A;  4KTZ A;  4H0Y B;  4HCC A;  1BQN A;  4DG1 A;  5EY4 A;  3FZF A;  4MDA A;  2HMP A;  1XMO K;  3TPQ A;  4W5R A;  2GBZ A;  5EX5 A;  5C2F A;  3NH2 A;  1NK6 A;  3SZ2 A;  3PV8 A;  1K8A O;  3CPW M;  1DTT A;  3SAG A;  3D7E O;  4CHP A;  2HW3 A;  3DRS A;  1RDW X;  1Q18 A;  4FWL A;  4ILG B;  4BRE A;  4WFB L;  3G71 N;  4Q5V A;  2WON A;  4BRI A;  1FXX A;  1NJX A;  3A2F A;  5AQJ A;  4DUZ K;  4J2B A;  1HPM A;  3P39 A;  5HL7 L;  4BRM A;  1TK5 A;  1SKW A;  3KLF A;  3KK7 A;  3LZJ A;  4CJK A;  4JI2 K;  2P9P B;  3CHW A;  3QFP A;  5MLC Q;  2HHW A;  1GLD G;  2ASO A;  3SYZ A;  4KV8 A;  3H3O B;  1SQK A;  4O4G A;  3T1H K;  1GLE G;  3AO2 A;  2GUP A;  3VA3 A;  2FLO A;  3MXM A;  3MX5 A;  3BZC A;  1MWK A;  1Q9Y A;  1EET A;  1NGF A;  4PUO A;  5F1X A;  2I5J A;  5DK5 A;  5HOO A;  4FJ9 A;  5AQZ A;  3M8R A;  5M1P A;  3OBY A;  4AHC A;  3KK3 A;  3DJC A;  1RDU A;  3MK6 A;  3KK2 A;  1Z25 A;  3F5T A;  4QS8 A;  2OZM A;  4JK7 A;  4CJ5 A;  4H5W A;  3O3G A;  1O13 A;  4W5N A;  2R7Y A;  4C1N K;  3L6Q A;  4KTQ A;  3H6E A;  1JKH A;  1MU2 A;  2B4J A;  3KLG A;  1VQ8 N;  5LMU K;  4IG3 A;  4BQL A;  1HKG A;  3MCP A;  3SQ0 A;  3DMJ A;  4E3S A;  4OGE A;  2XY8 A;  3LL3 A;  3F73 A;  2VG6 A;  2Y1I A;  2UYT A;  1W97 L;  1P8Z A;  4CF1 A;  4NLC A;  3KK1 A;  4E7H A;  4CEO A;  2VQE K;  3ATV A;  1YF5 L;  3V9U A;  4CJ3 A;  3B6O A;  4CW7 B;  3VEO A;  3OYA A;  3AO3 A;  4BR5 A;  1RNH A;  4A5B A;  2E5L K;  2I7P A;  3PX4 A;  4CJU A;  4NCA A;  1C0M A;  4BR0 A;  4E0D A;  3WT0 A;  3I56 N;  1YXQ A;  2F8T A;  3ZSR A;  3KIO A;  3A8Y A;  5LJW A;  5CZ1 A;  1RT4 A;  5EOY A;  3MN6 A;  4RWT A;  3ZET B;  1SKS A;  4LFB K;  4PA1 A;  2ASM A;  2PZS A;  3RRH A;  3PX0 A;  3D2F B;  3V6D A;  2IVO A;  3HOT A;  3O9R A;  3O9T A;  3OJS A;  4FWO A;  5E84 A;  1ASU A;  1Q81 O;  3SBG A;  3NBP A;  4CGH A;  1WAF A;  4FWM A;  5J2M A;  1RDC A;  4DTS A;  1X9W A;  2HBK A;  3OYG A;  2P9P A;  3FGU A;  2OPR A;  3IKM A;  3U9D A;  1K8K B;  2E2O A;  1QS4 A;  3PIP L;  2KFN A;  4NXN K;  1VQ6 N;  1YUW A;  3TAP A;  1L3U A;  3S3M A;  4V19 S;  3VQE A;  1TV6 A;  2A1S A;  3OY9 A;  4B3T K;  4DU4 A;  1B92 A;  3CM6 A;  1S5J A;  3U3Y A;  3QDK A;  1N8R O;  2HNZ A;  3ZSY A;  3DI6 A;  3L8B A;  1VSD A;  5H1S Q;  1IV0 A;  5TKY A;  3QNO A;  3LM2 A;  1DGK N;  3CCR N;  4DFJ A;  4CHN A;  2BE2 A;  1NKB A;  5BPL A;  2UXC K;  4OVL A;  2W6K A;  5AQR A;  3CI5 A;  3ULE B;  3SNN A;  1RFQ A;  4FWR A;  2W42 A;  3THY A;  4RCH A;  3JSM A;  4YOR A;  3D45 A;  1D5A A;  4B3M K;  5AQH A;  3ZSV A;  4DTM A;  5CR4 A;  4X66 K;  5I3U A;  4BAC A;  3DOL A;  3IS9 A;  3ATU A;  3HM9 A;  3MEC A;  3HVT A;  3ENO A;  2A3Z A;  2D1K A;  4C8L A;  5GIO A;  3F9M A;  1T8E A;  4K43 A;  3PX6 A;  4B1W B;  3OA9 A;  3ZT0 A;  1BUP A;  4O55 A;  2IS3 A;  1FW6 A;  4YDU A;  1W9H A;  2KLA A;  1XNQ K;  2UU9 K;  3QIP A;  4EIA A;  1HYV A;  4CJS A;  1SV5 A;  2AJQ A;  3WXK A;  2FBV A;  2OZS A;  4M3R A;  4K41 A;  1KQS M;  4HTU A;  4DSE A;  3DLE A;  2XY6 A;  4FJM A;  4CJR A;  3DRP A;  3HBT A;  2P1J A;  1A5W A;  5M1N A;  4FLT A;  4FJX A;  2FSK A;  1NKE A;  3LP1 A;  3N4P A;  4DTO A;  4H5N A;  3OYM A;  2FBY A;  4N5S A;  5CZ2 A;  3FR0 A;  4PHT X;  3TSQ A;  3EO3 A;  1KLM A;  3ZET A;  3ZYY X;  5BN9 A;  1YT3 A;  4FJ5 A;  4WQ5 A;  2KTQ A;  2HF3 A;  2HHQ A;  3WXJ A;  1QE1 A;  1BIS A;  4B1Z A;  3J81 O;  2BDP A;  3SAH A;  2NNW A;  3D2F A;  4IXC A;  5ADX A;  3CPE A;  2HF4 A;  1EX4 A;  1C0F A;  2LSN A;  3C94 A;  4OLB A;  2IOC A;  1J54 A;  4DTJ A;  4JI0 K;  1QHT A;  3KWI A;  3ENH A;  4FJ8 A;  1ESV A;  3HP6 A;  3SPZ A;  2DPN A;  1O1W A;  2A42 A;  3SUP A;  3PO5 A;  2QM1 A;  3CM5 A;  5LMN K;  2JWK A;  4J2E A;  1W2B M;  1TL1 A;  3VGK A;  1K8K A;  4HCB A;  3DLK A;  4IDK A;  4QS9 A;  4X64 K;  2O8E B;  3OS2 A;  1RBS A;  4M42 A;  3LM9 A;  4DV4 K;  1JL1 A;  3H3N O;  5KPZ A;  4H03 B;  4IEI A;  4OKJ A;  3UB5 A;  1VSI A;  5C2D A;  3CCU N;  3V81 A;  1HLU A;  3NDK A;  2VWJ A;  1ATN A;  2A41 A;  4CJE A;  5M1K A;  1NGE A;  4DTR A;  1NOY A;  4BRA A;  2NRZ A;  3K2P A;  3ULE A;  3K5O A;  4BRP A;  2E2Q A;  4PY5 A;  1MDU B;  4BE1 A;  4I6M B;  1ATR A;  1Q8I A;  3CQ8 A;  4OKK A;  4RG8 A;  3P31 A;  5BPM A;  3NHG A;  1WSF A;  2ATQ A;  3P4I A;  1HNZ K;  2ZE2 A;  3LDS A;  2OTL N;  4JKD A;  1TUY A;  2GTD A;  1M1K O;  4JAX A;  3V4I A;  3JS6 A;  3NF7 A;  3M8Q A;  3CC2 N;  4CZL A;  4LF9 K;  4IWV A;  1Y64 A;  2NLX A;  4M63 C;  4LF8 K;  4FCY A;  2IGI A;  3I33 A;  4FW2 A;  4MLE A;  5HRS A;  1VQL N;  4DWI A;  1NMN A;  5AZJ A;  1WBD A;  1NK4 A;  5GAD P;  3T1Y K;  3ULD A;  1U49 A;  3KD1 E;  1GLB G;  5E41 A;  4E19 A;  4DFK A;  4FLU A;  4AM7 A;  1NWK A;  1ZYQ A;  4XH5 A;  2QWO A;  4CI6 A;  4DMN A;  4DV2 K;  1K73 O;  3T7Z A;  1JLF A;  4JNE A;  2F96 A;  4MDB A;  1M90 O;  4M3T A;  1ITG A;  1IKY A;  4JKA A;  3K5L A;  1NGH A;  5KRS A;  4LH4 A;  4Z4G A;  2OTJ N;  3OJU A;  4BRK A;  3L2U A;  3DXM A;  4QS7 A;  3H46 O;  2HBM A;  3HSC A;  4KHU A;  4BC2 A;  3WQT A;  3KD5 E;  2QEX N;  3AVN A;  3PUF A;  2F7T A;  3MED A;  2A1R A;  2UXD K;  3V9W A;  3G4S N;  3J80 O;  4O5B A;  4CZI A;  3CCQ N;  4KH5 A;  2D0B A;  4BRF A;  5JVH L;  3HVR A;  3SV3 A;  4EP5 A;  5C42 A;  1NJY A;  3ZX2 A;  1HKC A;  2OPS A;  3OYD A;  3U3G A;  3CCL N;  2QKK A;  3EYZ A;  1WSJ A;  1GOC A;  4G1Q A;  3UKR B;  2O8E A;  4Q0B A;  2P51 A;  5BN8 A;  3S3O A;  1LCU A;  1TAU A;  4FZZ A;  1HUX A;  2BGG A;  4M3W A;  3KTQ A;  3NE6 A;  3WNF A;  4CHO A;  1JLB A;  3C0B A;  1LOT B;  3AVK A;  3GG4 A;  4H4M A;  3A5N C;  3HM8 A;  1QZ5 A;  1VSL A;  3CJC A;  4FPA A;  4NYN A;  4FJ7 A;  3A0I X;  1LAW A;  3PO4 A;  1NJI O;  3NF8 A;  3ZCM A;  3RMD A;  2EWS A;  3EY1 A;  1XHZ A;  2D4W A;  1QZ6 A;  4ID5 A;  4DTX A;  2ZWH A;  3ZX0 A;  4F3T A;  1LWE A;  1OVY A;  2ZJP L;  2IAJ A;  4R79 A;  5KPT A;  1RCH A;  1HYZ A;  5AQI A;  4CJL A;  3I0R A;  3E01 A;  5HBM A;  5FPE A;  1RDA A;  1VSH A;  2FF6 A;  3J7Y P;  1KXP A;  1KFD A;  1DT9 A;  3BF1 A;  3WQU A;  4CEC A;  4FOI A;  4JV5 K;  3P38 A;  5KGX A;  1QQM A;  3TSU A;  4KRF A;  1LAV A;  1OH5 A;  3VF4 A;  5BR9 A;  1HNV A;  1X3N A;  2F9W A;  3ZSZ A;  4BC5 A;  4KRE A;  1WUA A;  4FM2 A;  4B3O A;  3WNG A;  2P5O A;  1U6Z A;  2D5R A;  2HHV A;  1S72 N;  4JI1 K;  3V9Z A;  2FSN A;  3ZSO A;  5C12 A;  4CBW A;  3HO1 A;  1TKT A;  2W6L A;  3IDH A;  3QES A;  2QI2 A;  3TAE A;  1IG8 A;  3SCX A;  3SJH A;  5IWA K;  3OYL A;  3TAF A;  3U9Z A;  1P90 A;  1TKD A;  2YHW A;  4BRL A;  1ZBH A;  4F8R A;  3RMB A;  4WF9 L;  1IKV A;  2FF3 B;  3OYE A;  3SUO A;  3AVI A;  4NXM K;  3AO1 A;  3Q7C A;  1GOB A;  2PYL A;  1UA0 A;  4W5O A;  5A2Q O;  4CGI A;  4M3U A;  3AGK A;  4QCL A;  4CGD A;  5I9E B;  4ELU A;  4CGJ A;  1GLF O;  1JLE A;  2UUC K;  2KFZ A;  1IG9 A;  3O3H A;  3L4I A;  1TK0 A;  3U6F A;  3EE9 A;  3UKR A;  4ZTF A;  4DCH A;  5IT9 O;  3QEP A;  4IOX A;  3QBW A;  3W0L A;  3ALY A;  1ZBF A;  5TKW A;  5KQD A;  3MN7 A;  1S9E A;  2HHT A;  4DR2 K;  1VAZ A;  3OTO K;  3OHR A;  4KBO A;  4CZE A;  1S1X A;  1Q82 O;  4PQU A;  4OPK A;  3VF2 A;  4DS4 A;  1RTD A;  3SUQ A;  5HRN A;  1BIZ A;  3PSF A;  1JXE A;  3HK2 A;  4FJI A;  1KCF A;  3VQA A;  2E88 A;  3L2R A;  4YY3 K;  1W7A A;  4KB0 A;  1QQO A;  4AH9 A;  3EEQ A;  3DLR A;  3HI0 A;  4KTW A;  1YIT N;  2G8I A;  3AVJ A;  4JS5 A;  2YNH A;  2A40 A;  3A5O C;  4Z94 A;  3ZT1 A;  2CH5 A;  2GWJ A;  4JEP A;  4MO5 A;  4C8M A;  4IEE A;  2P9L B;  5HRR A;  1WSI A;  4CD3 A;  1SAZ A;  3OS1 A;  3IFR A;  2ITM A;  3L2V A;  3K5M A;  4TSX A;  3C6T A;  2O4I A;  4DS5 A;  2QK9 A;  4EZ6 A;  3QER A;  4H0O A;  3HPG A;  1ZBI A;  3ENB A;  5I42 A;  1N34 K;  4BC3 A;  2RE2 A;  4AHS A;  4N47 A;  2DY4 A;  3HTV A;  4GY2 B;  3AAP A;  4CJP A;  4X65 K;  4FVM A;  3NVM A;  3WXM B;  4CF9 A;  3M1F A;  1QVF M;  3NH0 A;  4KHY A;  1UAX A;  4FWS A;  4CEE A;  2BAN A;  4A61 A;  3OW2 M;  2A5X A;  5FRM A;  4WE1 A;  1NGJ A;  4ZHR A;  4BRN A;  4BC4 A;  2V51 B;  4KI6 A;  1ZBL A;  3MEE A;  3ZLJ A;  3K58 A;  5AZI B;  3THY B;  4JLH A;  3BDP A;  3IMX A;  4BDZ A;  1SZ2 A;  4MQ3 A;  4FWK A;  4BR9 A;  5JVG L;  5AFU H;  3TWH A;  4DV1 K;  4B9T A;  2FSJ A;  1TYQ A;  5DM6 L;  1T05 A;  3CER A;  4BE2 A;  1J5E K;  3AGR A;  1WSH A;  4AQY K;  4ELT A;  4BG9 A;  4EFH A;  2GV9 A;  3WEE B;  1Z05 A;  1EWR A;  2BTF A;  4DF8 A;  1HPZ A;  3WNH A;  1XWL A;  5KI6 A;  5LL6 Z;  4JI8 K;  4B9V A;  3CJA A;  4O0J A;  1BO5 O;  5AQU A;  5AQX A;  1WSG A;  2P9U A;  4EP4 A;  1LWF A;  4Z4I A;  4B9N A;  4FM1 A;  2QXF A;  1RBU A;  2QWL A;  1NK9 A;  3PLA A;  3VQC A;  1KTQ A;  3O80 A;  1RT5 A;  4C23 A;  1EP4 A;  4FK4 A;  2O8D B;  3H1Q A;  3TTD A;  3C6U A;  4PKG A;  2Z1I A;  2GWK A;  3E1Y A;  2AP1 A;  4YHH K;  4OPA A;  1A5X A;  2HHS A;  3OYJ A;  1JCG A;  3LDL A;  1XUP O;  4CJQ A;  4B3R K;  3BP8 A;  3OYH A;  1GLC G;  3W3D A;  2YNF A;  3R8E A;  4E89 A;  2P9L A;  2YHB A;  3UE5 A;  2O8F B;  5EXW A;  3C95 A;  1JLC A;  4DQ8 A;  1RT7 A;  5C10 A;  3B8A X;  4CEB A;  2EHG A;  4M41 A;  4L3Q A;  1REV A;  5C25 A;  1NU0 A;  2BUP A;  1U45 A;  1X9M A;  1IJJ A;  3HL8 A;  4OJR A;  4CZF A;  4BRG A;  1L3T A;  3VQP A;  1BL3 A;  3KLH A;  3RTV A;  4CE9 A;  4CK3 A;  2HHU A;  4IFY A;  1DKG D;  3M5R A;  2JGU A;  1MA9 B;  1TKX A;  4FLY A;  1U2V B;  4GV6 A;  4EAH D;  1HMV A;  3CF5 L;  3RMC A;  3BEX A;  4FOE A;  5J2P A;  5LY3 A;  4AHR A;  3LP0 A;  4XH4 A;  4E7J A;  3EZ5 A;  4DQI A;  5AZI A;  3PIO L;  3IUC A;  1BQM A;  3MDQ A;  1UA1 A;  3QEI A;  3G10 A;  4B1Y B;  4LC9 B;  3CME N;  5F2R A;  1YJN N;  1U48 A;  1JJ2 M;  4YOY A;  1XC3 A;  3CJB A;  3U4L A;  4JI5 K;  1C0G A;  3T1A A;  4OX9 K;  1T3V A;  5CY4 A;  1YTA A;  2O8C B;  1I3A A;  3L0Q A;  1ASW A;  1MWM A;  1RT2 A;  2KHO A;  2G8H A;  2Y1J A;  3WEE A;  3SQ4 A;  1NG9 A;  3RWU A;  4K25 A;  2D0P A;  3NGI A;  3AO5 A;  2CGL A;  3VEZ A;  1SKR A;  5AZJ B;  1BA0 A;  1VSK A;  5FDL A;  2GX9 A;  1I39 A;  4DTP A;  5AQO A;  3AAQ A;  2XHB A;  3L2W A;  1RBT A;  3KLI A;  4ISE A;  4H0X B;  4FO0 A;  2O8D A;  4YOV A;  1T44 A;  2G8V A;  3ZX3 A;  1NGB A;  4WFN L;  4H0V B;  3ZT4 A;  2RF2 A;  4DUY K;  4CZM A;  2DTU A;  1S1V A;  3L3V A;  1T6C A;  4CIF A;  1HJR A;  1Q9X A;  1QVG M;  1RGI A;  3J8A A;  4HTL A;  3DXM B;  3VN5 A;  1K6Y A;  2A6A A;  3C6A A;  3KWG A;  2XY7 A;  4JKE A;  3F9K A;  4EHT A;  1B9D A;  3TAR A;  4O5F A;  3NF9 A;  4GV3 A;  3QML A;  4FWQ A;  2YI1 A;  2O8F A;  4BGB A;  2YX6 A;  4JKF A;  5AQV A;  4KFB A;  3VMF B;  3M6G A;  1VSJ A;  4OKE A;  4B9Q A;  2P9K B;  3TAB A;  3OYB A;  3KZB A;  4DQS A;  3AA5 X;  3BZK A;  3IG1 A;  3LDO A;  5FRN A;  1ZC6 A;  3CFO A;  2Q97 A;  4CEQ A;  5T7B A;  4FZX C;  4FWP A;  3VQ5 A;  4B1V A;  3I8D A;  4BWM A;  3SLC A;  2P9N B;  1U2V A;  2YJF A;  3C65 A;  4ISF A;  3DM2 A;  4JRQ A;  4Z0U A;  3D0P A;  4OGC A;  3O1W A;  1S22 A;  3MCA B;  5AQF A;  3BY5 A;  1IKW A;  4CZJ A;  4DLE A;  3O1B A;  3LDP A;  4ICL A;  3K5N A;  2QW9 A;  2VGN A;  4W5Q A;  4F4K A;  4H0P A;  3QFU A;  3EN9 A;  2P9S B;  4FLX A;  2X6N A;  2VG7 A;  4HWI A;  3UKU B;  5CE3 A;  4FYD A;  3V1R A;  2XY5 A;  3H1V X;  1VQO N;  1XNR K;  2O8C A;  4JI7 K;  1NGG A;  3O9S A;  4DQQ A;  3KKS A;  4GNI A;  3VQQ A;  5AQG A;  3SAF A;  4EHU A;  1FKO A;  5CHI A;  4I2P A;  4BGA A;  1Z6R A;  1IBL K;  2E2P A;  4W5T A;  1VRU A;  5KRT A;  2ZQB A;  4ILH A;  1OH6 A;  2ZD1 A;  2RHK A;  5FLX O;  1C0U A;  4U7B A;  3CIP A;  4QAG A;  1X3M A;  2ZGY A;  4BRD A;  4AF1 A;  2Q0U A;  5BRH A;  1CXQ A;  3CJ1 A;  5AQQ A;  4B08 A;  4CJ7 A;  2HMI A;  1FJG K;  3DWL A;  3LAK A;  1C1B A;  5KQ8 A;  3QIO A;  2HHX A;  3NFA A;  3MXJ A;  5BR8 K;  5KGW A;  4E7K A;  3EL2 A;  3VQ7 A;  4CFB A;  4Y1D A;  3T69 A;  5HLF A;  4Z4E A;  2E6M A;  4Y0W A;  4H8K A;  1YIJ N;  3QBX A;  4LSL A;  2I7N A;  4DU1 A;  4FJK A;  3OYI A;  1RT3 A;  5AQM A;  2XRI A;  4DF4 A;  2VYP A;  3TAG A;  1L5U A;  4BRC A;  1YAG A;  4FK0 A;  1BWF O;  3C7N B;  3O3F A;  1N6Q A;  3QIN A;  2P9K A;  4FJJ A;  3MWT A;  1BGX T;  3AA4 A;  5JLH A;  4GMJ B;  4CEF A;  4N41 A;  3AVF A;  1JCF A;  3ID8 A;  4AHT A;  4E1N A;  4DR3 K;  3AVM A;  1WAJ A;  1RTI A;  4A62 A;  4LF7 K;  3HT3 A;  4B9S A;  3CD6 N;  3CFR A;  5DM7 L;  3L4Q A;  2E1Z A;  1GLA G;  3QEV A;  2VCP A;  1R59 O;  4XEI A;  4CJT A;  1KLN A;  3U8X A;  2P9N A;  4U67 L;  1CZA N;  2X74 A;  4MO4 A;  4MLH A;  1RBV A;  3SBT A;  2QA4 N;  3CJ7 A;  4GV9 A;  5ADX H;  3O4N A;  4YOW A;  1RT1 A;  1S3X A;  3THX B;  2QXL A;  4CHZ A;  4IDH A;  2KZZ A;  1KC8 O;  5EU7 A;  2ZJQ L;  3OBW A;  3BF3 A;  4GVM A;  4FLZ A;  2UUB K;  1V4S A;  1BDG A;  2IVN A;  2ZF5 O;  4J2D A;  4H5V A;  2P9S A;  1NJW A;  1WNS A;  2YHY A;  5AQN A;  4CZH A;  4CF2 A;  3UKU A;  3HOS A;  4HUE A;  3GOI A;  3AA3 A;  3AVB A;  1HJO A;  4Z4C A;  2Q2R A;  1EWQ A;  3HPH A;  1A5V A;  3SQ1 A;  4CGG A;  3QLH A;  5JMV A;  4PWD A;  4OPJ A;  2WUS A;  3A5M C;  2OYQ A;  4C8N A;  2VWB A;  1NBW A;  2QWN A;  3C6H A;  4KAZ A;  2VG5 A;  5BRE A;  2G8F A;  3TR8 A;  5GIN A;  2WBN A;  3DOK A;  1BCO A;  3LAL A;  5SWM A;  4GW6 A;  1FK9 A;  3ISN C;  1BOT O;  3ZEU B;  2E20 A;  4JK9 A;  3FZH A;  3AAR A;  2QWQ A;  4GKJ K;  3IRX A;  3DAW A;  1BIU A;  1YTU A;  3CCE N;  3CCM N;  2NZT A;  4DV0 K;  4O8K A;  3TSP A;  3HP9 A;  3VOV A;  3HPO A;  3K9K A;  5M1Q A;  5BPN A;  1WLJ A;  1GLJ O;  4M3Z A;  4B9L A;  4BDP A;  3HRG A;  3J7A P;  1VHX A;  3D6R A;  4DQP A;  2BH1 A;  1XI1 A;  1BU6 O;  5M1O A;  2YHA A;  4DSF A;  2CGK A;  4ILJ A;  4DTU A;  4DSI A;  4DKW A;  3GL1 A;  1TYQ B;  3CCJ N;  4OLA A;  1YJ9 N;  4E7L A;  4FJL A;  1Q7Y O;  2YKN A;  4DV3 K;  5GAE P;  1FKP A;  4ISG A;  3C7N A;  4GKK K;  3GDQ A;  3LPU A;  1S6P A;  4F2R A;  4B9U A;  3AO4 A;  4BVP A;  4JD2 A;  2P9U B;  1R0A A;  4IZ9 A;  5C0Y A;  2P9I B;  4NO7 A;  4FW1 A;  2NRV A;  2NRX A;  2ASP A;  5GIP A;  3V9X A;  3LZI A;  4O8U A;  3DXK B;  3SMP A;  3G25 A;  4CFC A;  4BY9 C;  1YHQ N;  2Z1G A;  3VQD A;  4BR2 A;  3FZL A;  3HYF A;  2GEM A;  5HRO A;  4LFC K;  4RW8 A;  3F2K A;  1X9J A;  4IJN A;  2OA8 A;  1Q86 O;  4Z4F A;  2QWP A;  2JLE A;  2FC0 A;  3MN9 A;  5CYM A;  3MAQ A;  1ILY A;  3LP3 A;  1HNW K;  5E26 A;  3R9P A;  3THX A;  4ELV A;  4HUF A;  2YJE A;  3WNE A;  4G9Z A;  3VQ6 A;  3O9U A;  2NUB A;  1B9F A;  1QHA A;  1Y97 A;  3GE1 A;  4XIU A;  3EKU A;  2QWM A;  1LW0 A;  2ZGZ A;  1D8Y A;  4BR7 A;  2RKI A;  2JWL A;  3CC7 N;  3MX2 A;  3MWP A;  3AVL A;  3AVG A;  4WYB A;  5K14 A;  3QET A;  5D3G A;  3TTF A;  1NKC A;  4E1M A;  1NJZ A;  3CQX A;  2PAV A;  3VEN A;  3E9P A;  4JI6 K;  1CZ9 A;  4C8O A;  4H5T A;  3TAQ A;  4X62 K;  3AVC A;  5FPN A;  4LFA K;  4KHN A;  2IDO A;  5EVZ A;  5M1F A;  1HQU A;  2WFB A;  3ZEU A;  3O4Q A;  1ATS A;  2HST A;  4N76 A;  1S6Q A;  2ITG A;  2V52 B;  4DV6 K;  2Q31 A;  3T3F A;  1JXB A;  4IKF A;  3RSE B;  2ZJR L;  3VES A;  1EXQ A;  1QSL A;  1WBB A;  1T7P A;  4RTF D;  3NMU A;  2NRR A;  4O44 A;  4FL9 A;  2VWK A;  1QTM A;  4J2A A;  3MEG A;  1HX1 A;  2CH6 A;  1YI2 N;  1DTQ A;  4CED A;  1HR0 K;  1UOC A;  4A59 A;  2WOM A;  3O4W A;  3TU5 A;  4B1X B;  4DSK A;  4Y1C A;  4DHY A;  1HNI A;  1RTJ A;  3VTH A;  4IFV A;  3SQ2 A;  4IO8 A;  3FE1 A;  2FBT A;  2F9T A;  3CC4 N;  4O0I A;  2OPP A;  3MXI A;  1D9F A;  4WQ4 C;  1NGA A;  3L2Q A;  1J9A A;  5B8H A;  1BI4 B;  2D0O A;  5AQK A;  2B5J A;  2RPI A;  4A5A A;  5AQY A;  5GAG P;  4KHQ A;  5SZT A;  4KB1 A;  2F8S A;  3MMV A;  3PY8 A;  2P9I A;  2G8W A;  1W0H A;  2E8A A;  3H08 A;  4JKC A;  3BUZ B;  3DXK A;  4M3Y A;  2F4V K;  1KVA A;  2QKB A;  1RIL A;  4NLB A;  2E1Y A;  3FZM A;  1HKB A;  4LSN A;  1ZBS A;  3KVG A;  1E4G T;  3M3Z A;  3E66 A;  1SL1 A;  2HVH A;  4LD0 A;  2J4R A;  1U4B A;  4C8K A;  4DV7 K;  4PL8 A;  2E2N A;  2DFH A;  2V7Z A;  4BG8 A;  4UQG A;  3VET A;  1LW2 A;  2IC3 A;  3WUH A;  4F3O A;  4DR6 K;  3EKS A;  1IH7 A;  3NF6 A;  3OYC A;  4AHU A;  1NGD A;  4OPH A;  3D2E B;  2HVI A;  2WC9 A;  1VQ9 N;  2V7Y A;  2G8U A;  3P5J A;  4LF6 K;  5AQT A;  3CFP A;  3CG7 A;  3HZ6 A;  3RR7 A;  1QQC A;  1TAQ A;  2NRH A;  3OVN A;  3CMA N;  1OVQ A;  3CCS N;  3P83 D;  4JKG B;  2PYJ A;  4CBU A;  5JIC A;  1UWB A;  3CCV N;  5FPM A;  4IJA A;  1NOZ A;  4OO1 J;  1QSS A;  4JN4 A;  1HNX K;  3I0S A;  4N56 A;  3VEY A;  4YOX A; 
#chains in the Genus database with same CATH homology
 4J2B A;  3RRG A;  1RCH A;  4CJV A;  1IKW A;  4DLE A;  4ID1 A;  1HYZ A;  1TK5 A;  1U04 A;  4ICL A;  3OYF A;  1SKW A;  4CJL A;  3KLF A;  3K5N A;  3I0R A;  4CJK A;  3E01 A;  5HBM A;  3LZJ A;  4CFD A;  3OS0 A;  4W5Q A;  4F4K A;  1RDA A;  1VSH A;  3RMA A;  2YNG A;  2HHW A;  1KFD A;  4CER A;  3NGY A;  4FLX A;  3SYZ A;  4CEC A;  4KV8 A;  2X6N A;  4YFU A;  4O4G A;  1BHL A;  2VG7 A;  5KGX A;  1L3S A;  4AIL C;  4FYD A;  4KRF A;  1LAV A;  3QEW A;  3V1R A;  2XY5 A;  1HNV A;  3NH1 A;  3AO2 A;  4DLG A;  3VA3 A;  5J2N A;  4DQQ A;  3ZSZ A;  4AHV A;  3SJJ A;  3MXM A;  3KKS A;  3VQQ A;  3LPT A;  4H4O A;  1NK0 A;  4L8R B;  4BE0 A;  1TGO A;  1IO2 A;  4KRE A;  1FKO A;  4FM2 A;  4I2P A;  1EET A;  1Q9Y A;  4B3O A;  4PUO A;  3WNG A;  4HVJ A;  2I5J A;  2P5O A;  5DK5 A;  2D5R A;  2GUI A;  4FJ9 A;  2HHV A;  3SUN A;  1TL3 A;  3V9Z A;  4W5T A;  1VRU A;  1TKZ A;  3ZSO A;  3M8R A;  1RDD A;  5KRT A;  1BCM A;  2ZQB A;  3HO1 A;  1TKT A;  3LWM A;  4AHC A;  2ZD1 A;  3AVA A;  4CGF A;  3KK3 A;  3KK2 A;  3QES A;  1BI4 A;  1C0U A;  1Z25 A;  4QAG A;  1WSE A;  3VA0 A;  4B9M A;  2OZM A;  3TAE A;  4CJ5 A;  3O3G A;  4RW7 A;  5J2Q A;  4W5N A;  1CXQ A;  3SCX A;  3TI0 A;  2R7Y A;  3DYA A;  4KTQ A;  4FLV A;  4B08 A;  2HMI A;  1JKH A;  3OYL A;  1MU2 A;  3LAK A;  3TAF A;  1C1B A;  2B4J A;  3QIO A;  1TKD A;  3KLG A;  2HHX A;  3NFA A;  4IG3 A;  3MXJ A;  5KGW A;  1ZBH A;  3SQ0 A;  3DMJ A;  4F8R A;  3RMB A;  4M3X A;  1IKV A;  4E3S A;  3OYE A;  3SUO A;  4OGE A;  3AVI A;  2XY8 A;  3F73 A;  4E7K A;  2VG6 A;  1TVR A;  2Y1I A;  3VQ7 A;  4CFB A;  1D9D A;  1F21 A;  3VQ4 A;  3AO1 A;  4CF1 A;  3KK1 A;  1GOB A;  2PYL A;  4E7H A;  3SI6 A;  1UA0 A;  4Y1D A;  3NGZ A;  2HND A;  4CEO A;  4W5O A;  4CGI A;  5HLF A;  4Z4E A;  1Z26 A;  2E6M A;  1CLQ A;  4M3U A;  4H8K A;  3V9U A;  4QCL A;  4CGD A;  3B6O A;  4CJ3 A;  5HP1 A;  3BGR A;  4LSL A;  3OYN A;  4DU1 A;  3OYA A;  4ELU A;  3AO3 A;  3OYI A;  4CGJ A;  3V9S A;  4FJK A;  1JLE A;  1RNH A;  1RT3 A;  2KFZ A;  1VSF A;  3VQ9 A;  1IG9 A;  3PX4 A;  4CJU A;  3O3H A;  4CF8 A;  4F2S A;  4NCA A;  4CF0 A;  1C0M A;  2XRI A;  4DF4 A;  4E0D A;  3TAG A;  4DSJ A;  1TK0 A;  3U6F A;  1L5U A;  4FK0 A;  4ZTF A;  2F8T A;  3O3F A;  1J53 A;  3ZSR A;  3QIN A;  3KIO A;  3QEP A;  1N6Q A;  3ALY A;  1ZBF A;  4FJJ A;  3B6P A;  1S9E A;  1BGX T;  4EZ9 A;  3AA4 A;  5CZ1 A;  1RT4 A;  2HHT A;  3M8S A;  4GMJ B;  4CEF A;  4N41 A;  3AVF A;  3KJV A;  4AHT A;  4E1N A;  3AVM A;  1WAJ A;  1SKS A;  1RTI A;  4FJG A;  3HT3 A;  2Z1H A;  4FZY A;  1S1X A;  4PA1 A;  4B9S A;  3K57 A;  3DLG A;  4OPK A;  4DS4 A;  1RTD A;  3RRH A;  3SUQ A;  2PZS A;  4PQU A;  5HRN A;  1BIZ A;  1CZB A;  1JXE A;  3CFR A;  3PX0 A;  4K8X A;  3HK2 A;  4FJI A;  1KCF A;  3VQA A;  4FK2 A;  3L2R A;  3V6D A;  3QEV A;  3DLB A;  4CJT A;  4CES A;  1KLN A;  3NAE A;  3VQB A;  4KB0 A;  4AH9 A;  2X74 A;  3OJS A;  3DLR A;  4NCB A;  4KTW A;  2G8I A;  3AVJ A;  4JS5 A;  1RBV A;  2YNH A;  1N5Y A;  1ASU A;  2KQ2 A;  3ZT3 A;  4BDY A;  3NBP A;  1LV5 A;  1NJX A;  1NK7 A;  3T19 A;  3ZT1 A;  4CGH A;  1WAF A;  3DRR A;  3O4N A;  5J2M A;  1RDC A;  4DTS A;  1X9W A;  1RT1 A;  3K59 A;  4CHZ A;  4JRP A;  2KZZ A;  4C8M A;  3THV A;  3OYG A;  5FRO A;  2XO7 A;  5EU7 A;  2OPR A;  1IKX A;  5HRR A;  1HYS A;  1WSI A;  5DMR A;  4FLZ A;  4GVM A;  4J2D A;  2D0C A;  3OS1 A;  4I2Q A;  3L2V A;  3K5M A;  1NJW A;  1QS4 A;  4TSX A;  3C6T A;  1LWC A;  4K8Z A;  2O4I A;  4DS5 A;  2KFN A;  5KTQ A;  1WNS A;  2QK9 A;  4EZ6 A;  4CF2 A;  3TAP A;  3QER A;  1L3U A;  3S3M A;  4HUE A;  3LAM A;  1TV6 A;  2A1S A;  3VQE A;  3AA3 A;  3HPG A;  3AVB A;  3TAM A;  1ZBI A;  4Z4C A;  3OY9 A;  4DU4 A;  1B92 A;  1A5V A;  3CM6 A;  1S5J A;  3HPH A;  3SQ1 A;  5I42 A;  3U3Y A;  4CGG A;  3KLE A;  3QLH A;  1KSP A;  4PWD A;  2HNZ A;  4AHS A;  3ZSY A;  4OPJ A;  4N47 A;  1SL0 A;  3DI6 A;  3L8B A;  3UIQ A;  2DY4 A;  1VSD A;  2OYQ A;  4C8N A;  3ZSQ A;  1S1T A;  4FXD A;  3OYK A;  3QNO A;  4KAZ A;  2VG5 A;  4CJP A;  2G8F A;  1DLO A;  4FVM A;  2E6L A;  3TR8 A;  4CF9 A;  4DFJ A;  4CHN A;  2BE2 A;  3V1Q A;  1NKB A;  1GOA A;  3DOK A;  1ZBU A;  1BCO A;  3KKR A;  3NH0 A;  4OVL A;  4KHY A;  1UAX A;  4CEE A;  1JLQ A;  4YNQ A;  3LAL A;  2BAN A;  5SWM A;  3RR8 A;  3JYT A;  3SNN A;  4GW6 A;  4B8C A;  5FRM A;  2W42 A;  2KZM A;  4WE1 A;  3JSM A;  1FK9 A;  3D45 A;  3ISN C;  3LP2 A;  3M8P A;  1D5A A;  1G15 A;  4ZHR A;  3ZSV A;  4DTM A;  4KI6 A;  3HST B;  4RW6 A;  5I3U A;  4BAC A;  1ZBL A;  3DOL A;  3IRX A;  3IS9 A;  3MEE A;  3K58 A;  3BDP A;  4JLH A;  1BIU A;  2ETJ A;  1YTU A;  1C1A A;  4BDZ A;  3HM9 A;  3MEC A;  4MQ3 A;  3HVT A;  1JLG A;  3CYM A;  3HP9 A;  4C8L A;  3HPO A;  4FM0 A;  3TWH A;  1T8E A;  3PX6 A;  1WLJ A;  3ZT0 A;  4B9T A;  1SUQ A;  4M3Z A;  1HRH A;  4B9L A;  4BDP A;  4O55 A;  1T05 A;  2IS3 A;  2E4L A;  4BE2 A;  1W9H A;  4DQP A;  1WSH A;  4ELT A;  1XI1 A;  4NYF A;  4KHS A;  2YHA A;  4HUG A;  2GV9 A;  4DSF A;  4DSL A;  4DTU A;  3QIP A;  4CJW A;  4DSI A;  4FJH A;  1HYV A;  4CJS A;  1SV5 A;  2AJQ A;  4OLA A;  3DLH A;  4B8A B;  4DF8 A;  1HPZ A;  2FBV A;  4M3R A;  2OZS A;  3WNH A;  4Z4H A;  4HTU A;  1XWL A;  5KI6 A;  4E7L A;  4DSE A;  3DLE A;  2XY6 A;  1XC9 A;  4FJL A;  4CJR A;  3DRP A;  4FJM A;  2P1J A;  1A5W A;  2YKN A;  4B9V A;  1KVB A;  4O0J A;  4FLT A;  1FKP A;  4FJX A;  1WSG A;  4EP4 A;  1LWF A;  1NKE A;  3LP1 A;  3LPU A;  4DTO A;  1S6P A;  1RDB A;  4B9N A;  4Z4I A;  4F2R A;  3OYM A;  4F3T A;  1RT6 A;  4FM1 A;  2FBY A;  4B9U A;  3AO4 A;  4N5S A;  3SV4 A;  5CZ2 A;  1VSM A;  2QXF A;  1RBU A;  1R0A A;  1NK9 A;  1KLM A;  1VK0 A;  2DFE A;  2HNY A;  3V1O A;  3VQC A;  4CJF A;  1YT3 A;  4FW1 A;  4KHW A;  4CIE A;  1KTQ A;  4FJ5 A;  2KTQ A;  3V9X A;  1J5O A;  3LZI A;  1RT5 A;  2HHQ A;  3LAN A;  1EP4 A;  5C24 A;  4FK4 A;  1QE1 A;  1BIS A;  4LY7 A;  4CFC A;  4DFP A;  1VRT A;  2X78 A;  2BDP A;  2Z1G A;  3VQD A;  3ZSW A;  3C6U A;  2Z1I A;  3HYF A;  5HRO A;  1EX4 A;  4RW8 A;  4E7I A;  2LSN A;  4DU3 A;  1A5X A;  3C94 A;  4KI4 A;  3OYJ A;  4OLB A;  2IOC A;  2HHS A;  1J54 A;  1VSE A;  4DTJ A;  2OA8 A;  1JLA A;  4CJQ A;  1QHT A;  4Z4F A;  2B6A A;  2JLE A;  4FJ8 A;  2FC0 A;  5CYM A;  2YNI A;  3HP6 A;  3LP3 A;  3MAQ A;  3SPZ A;  2OPQ A;  1O1W A;  3SUP A;  3SPY A;  3PO5 A;  4HHT A;  3ITH A;  3OYH A;  2YNF A;  3CM5 A;  3LWL A;  4E89 A;  3ZT2 A;  4ELV A;  4HUF A;  4J2E A;  3AV9 A;  1C0T A;  3WNE A;  1KFS A;  1TL1 A;  3VQ6 A;  3TAN A;  2YHB A;  2NUB A;  1B9F A;  1S1U A;  1C6V A;  1KVC A;  1Y97 A;  2Q3S A;  4M45 A;  4XIU A;  3C95 A;  3DLK A;  4IDK A;  4CFA A;  1JLC A;  4HCB A;  3HJF A;  4FLW A;  1LW0 A;  1WN7 A;  4CEZ A;  2G8K A;  1HQE A;  2HB5 A;  1D8Y A;  1RT7 A;  2RKI A;  3OS2 A;  3L3U A;  1RBS A;  4M42 A;  1S9G A;  3AVL A;  3AVG A;  1JL1 A;  1RTH A;  4CEB A;  2EHG A;  4OKJ A;  5K14 A;  1VSI A;  3V81 A;  4M41 A;  3QET A;  5D3G A;  1REV A;  1NKC A;  4E1M A;  5C25 A;  1NJZ A;  3NDK A;  4IBN A;  1U45 A;  1U47 A;  2PY5 A;  1X9M A;  3QEX A;  3HL8 A;  4OJR A;  2VWJ A;  1L3T A;  4I9L A;  3VQP A;  4I7F A;  1BL3 A;  4CJE A;  3KLH A;  1RBR A;  3RTV A;  4DTN A;  4DQR A;  4DTR A;  1CZ9 A;  4CE9 A;  4CK3 A;  2HHU A;  4IFY A;  1NOY A;  4C8O A;  3K2P A;  2KW4 A;  2JGU A;  1TKX A;  4R5P A;  3TAQ A;  4FLY A;  2P5G A;  3AVC A;  1CXU A;  4KHN A;  2IDO A;  3K5O A;  1HMV A;  2DFF A;  5HRP A;  3RMC A;  1T03 A;  1NK5 A;  3VQ8 A;  5J2P A;  1HQU A;  4PY5 A;  4FJN A;  1X9S A;  4AHR A;  3LP0 A;  4BE1 A;  3O4Q A;  1Q8I A;  4ZTJ A;  3CQ8 A;  4N76 A;  1S6Q A;  2ITG A;  4OKK A;  4RG8 A;  3NHG A;  5JS1 A;  4E7J A;  3EZ5 A;  3T3F A;  1YVU A;  3S3N A;  1JXB A;  5JS2 A;  4DQI A;  4IKF A;  1BQM A;  1WSF A;  4KKO A;  1UA1 A;  2ATQ A;  3QEI A;  3G10 A;  2ZE2 A;  3LDS A;  1EXQ A;  1QSL A;  1T7P A;  4KO0 A;  2FBX A;  1SL2 A;  3NCI A;  1U48 A;  3V4I A;  4O44 A;  2VWK A;  1QTM A;  3NF7 A;  4J2A A;  3M8Q A;  3MEG A;  4KPY A;  2Z1J A;  3T1A A;  1DTQ A;  2D0A A;  5CY4 A;  1YTA A;  1L3V A;  4CED A;  4FCY A;  1UOC A;  2IGI A;  2WOM A;  4FW2 A;  4I9Q A;  4DSK A;  1I3A A;  5HRS A;  1ASW A;  4Y1C A;  1RT2 A;  2G8H A;  4DWI A;  1HNI A;  4LH5 A;  2Y1J A;  1RTJ A;  3ZSX A;  1ASV A;  3P1G A;  3SQ4 A;  4CCH A;  3RWU A;  4IFV A;  3SQ2 A;  1X1P A;  1NK4 A;  3NGI A;  2FBT A;  3AO5 A;  4NCG A;  3ULD A;  3AA2 A;  3G0Z A;  1U49 A;  3KD1 E;  4O0I A;  5E41 A;  2OPP A;  4E19 A;  3MXI A;  2YKM A;  1SKR A;  1JL2 A;  3L2Q A;  1D9F A;  1J9A A;  4QOZ B;  2RN2 A;  4DFK A;  1BI4 B;  2B5J A;  2RPI A;  1VSK A;  2X6S A;  5CYQ A;  5FDL A;  4FLU A;  4DTP A;  1I39 A;  1ZYQ A;  4KHQ A;  5SZT A;  4DFM A;  4CHY A;  4KB1 A;  4DMN A;  2F8S A;  1KRP A;  4CEA A;  2YV0 X;  3PY8 A;  1JLF A;  2G8W A;  2XHB A;  4CHQ A;  1RBT A;  1W0H A;  2F96 A;  3L2W A;  1XHX A;  4M3T A;  3H08 A;  1ITG A;  3KLI A;  1IKY A;  1QSY A;  3K5L A;  3FFI A;  2G8V A;  4M3Y A;  1KVA A;  2QKB A;  1RIL A;  3ASM A;  1C1C A;  3ZT4 A;  2RF2 A;  4LH4 A;  4CIG A;  5KRS A;  4Z4G A;  3OJU A;  2DTU A;  1S1V A;  3L2U A;  3IAY A;  3QNN A;  3L3V A;  4LSN A;  4KHU A;  4CIF A;  1HJR A;  1Q9X A;  3KD5 E;  4IG0 A;  1TK8 A;  3AVN A;  1SL1 A;  3QO9 A;  1S1W A;  3PUF A;  4RW9 A;  3MED A;  4LD0 A;  4CJ4 A;  2HVH A;  1EKE A;  4CK1 A;  2A1R A;  3V9W A;  4O5B A;  1U4B A;  4C8K A;  3VN5 A;  4RW4 A;  1K6Y A;  4BWJ A;  2XY7 A;  2DFH A;  3F9K A;  4CK2 A;  2D0B A;  4UQG A;  1B9D A;  1LW2 A;  2IC3 A;  3TAR A;  4F3O A;  2O4G A;  3HVR A;  3NF9 A;  3SV3 A;  4EP5 A;  5C42 A;  2EX3 A;  1NJY A;  1IH7 A;  4MFB A;  3NF6 A;  3OYC A;  2OPS A;  3OYD A;  3U3G A;  4AHU A;  3S9H A;  4JS4 A;  3HXM A;  3EYZ A;  2QKK A;  1WSJ A;  3AVH A;  1GOC A;  4G1Q A;  5J1E A;  1NK8 A;  4KTZ A;  2HVI A;  4HCC A;  4Q0B A;  1BQN A;  2P51 A;  4KFB A;  4DG1 A;  3S3O A;  1TAU A;  4FZZ A;  4OKE A;  1VSJ A;  2BGG A;  4M3W A;  3TAB A;  2G8U A;  3P5J A;  3KTQ A;  3NE6 A;  3WNF A;  4CHO A;  1JLB A;  4W5R A;  2GBZ A;  3NH2 A;  3CG7 A;  3OYB A;  3CFP A;  1NK6 A;  4DQS A;  3AA5 X;  1QQC A;  1TAQ A;  3AVK A;  3RR7 A;  3OVN A;  4H4M A;  3SZ2 A;  3PV8 A;  3IG1 A;  5FRN A;  3P83 D;  1DTT A;  1VSL A;  3CFO A;  4NYN A;  4CEQ A;  5T7B A;  2PYJ A;  4FJ7 A;  4FZX C;  1LAW A;  4CHP A;  3PO4 A;  3NF8 A;  3ZCM A;  3DRS A;  3RMD A;  2HW3 A;  1UWB A;  3VQ5 A;  3EY1 A;  3I8D A;  4BWM A;  1NOZ A;  1XHZ A;  4ID5 A;  4DTX A;  1QSS A;  4Q5V A;  2WON A;  3DM2 A;  1LWE A;  1FXX A;  3I0S A;  4Z0U A;  3A2F A;  4N56 A;  3D0P A;  4OGC A;  4JRQ A;  2IAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...