3TWHA

Selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain d132n mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords Ribonuclease H
publication title Novel complex MAD phasing and RNase H structural insights using selenium oligonucleotides.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 41
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3twhA00
1BCMA 1UOCA 3ISNC 4G1QA 2ETJA 4CF1A 1IG9A 1TKDA 1JKHA 2Z1IA 1RCHA 3QETA 2G8WA 1BISA 1DTTA 3K2PA 3TI0A 4C8OA 4OPJA 4DQRA 3SQ1A 1CLQA 1X9MA 2BANA 1NK7A 2G8UA 1TKXA 4E0DA 2A1RA 4OLBA 1RTIA 3LP2A 1EXQA 1C0TA 2P1JA 1WNSA 2RPIA 4BDYA 4FM1A 3QEPA 3S9HA 1L3VA 2Y1JA 3HT3A 3B6OA 1WSIA 3OYJA 1XWLA 3LAMA 4HTUA 4M3XA 2HVHA 3V9ZA 4W5NA 4CJEA 4FJGA 1DTQA 1KCFA 2HHSA 4FM0A 4I9QA 4KTQA 4PY5A 4UQGA 4OJRA 4M3ZA 1RT6A 3BDPA 4DTXA 3TWHA 4EP5A 4M41A 4BE2A 1L5UA 2G8HA 4BE1A 3D45A 2BGGA 4OPKA 4KRFA 3KLEA 2RKIA 1Z26A 3VQ5A 4B08A 4FK0A 5CYMA 1HRHA 1RT3A 1WSHA 4W5OA 2OA8A 3DLBA 2OPPA 3M8SA 4CGJA 1JL1A 2IS3A 3RMDA 4JRQA 3K57A 3M8RA 5J2NA 3QEVA 1XC9A 1NK5A 4IDKA 1QHTA 1VSDA 1XHXA 1TK8A 2XY5A 4KHSA 3C95A 1SL2A 1XHZA 1RTJA 4RW9A 3K5LA 2NUBA 4FLUA 3MEDA 2P5GA 3VQQA 4CJWA 5HP1A 2OZSA 5D3GA 2D0AA 3MECA 4RW6A 4RW8A 4CFCA 5J2PA 1TL3A 1CXUA 4CK3A 1I3AA 4FLZA 1S1VA 3NCIA 4FJNA 2YKMA 3DLEA 5J2MA 2E4LA 1BI4A 5J1EA 3V9WA 4KAZA 1UA0A 2XY7A 2VWJA 4N41A 1TKZA 2X6SA 4BWJA 4R5PA 3ZT0A 3C6TA 2YNGA 1A5XA 1QSYA 1VSJA 1RT4A 5E41A 1X9SA 3P83D 1BI4B 3CG7A 4DQQA 3QEXA 1NK6A 4C8LA 3OS2A 1LAVA 3F9KA 5HRRA 5JS2A 3VQDA 1Y97A 3K5NA 2Y1IA 5HLFA 1LWEA 3CFOA 3M8QA 3O4QA 3U3YA 3SJJA 1IKYA 2DFEA 3AA5X 2X6NA 4Z4HA 4CF9A 5C42A 4DTPA 4CHPA 3SQ4A 3AA2A 5EU7A 3M8PA 3TR8A 3AVMA 3OYEA 3QNNA 3ITHA 2R7YA 2PY5A 3T19A 1UA1A 2G8VA 4DSJA 1ASVA 4E1NA 3RR8A 1RTDA 1HYZA 3OYLA 3AO4A 3OS0A 1X9WA 4H4MA 3SYZA 4FJ9A 5DMRA 3CM6A 1YTUA 3NF8A 4DSLA 1L3TA 3WNHA 4HUFA 1NJZA 1U04A 1D9DA 4B9VA 1K6YA 3A2FA 1Q9YA 4AH9A 2DTUA 4I7FA 2PYLA 2VG6A 1L3SA 2QKKA 4Z4IA 1VSIA 4JS5A 4DLGA 1RDCA 1TV6A 2OPSA 3RMBA 1VSHA 4KHNA 4M3WA 1SV5A 4ZHRA 1T03A 5CYQA 4M3UA 4W5TA 1B9DA 1RBRA 1RDBA 4OKJA 1BL3A 4ZTFA 1SKSA 4E19A 1EETA 4CGHA 4K8XA 1RT5A 1VK0A 1IKXA 4OGCA 2D0BA 4LSNA 3KKRA 3KJVA 4KV8A 3UIQA 3NF9A 3IS9A 4Y1DA 3HPGA 5KRSA 4FJLA 1EP4A 1RDAA 3ZSQA 2A1SA 4QAGA 2HW3A 1D5AA 2HHVA 4N76A 4QOZB 4CE9A 3NF6A 4O4GA 3HVTA 3LDSA 4CFAA 4ELTA 3HYFA 3I8DA 1D9FA 4N47A 3S3NA 4GMJB 3F73A 3DRRA 2KFZA 2BE2A 1RT2A 2OPQA 1KLNA 2HVIA 2HHQA 4KB1A 3LZJA 1A5VA 3WNFA 4QCLA 1CXQA 4DTOA 4PA1A 3L2RA 2OPRA 1DLOA 4H4OA 3EYZA 1J53A 4KHWA 4IBNA 3NGZA 5KI6A 1TAQA 4HUEA 4JRPA 1I39A 5DK5A 3VN5A 4B8CA 2XHBA 3MEEA 2IDOA 4FCYA 3LP0A 1ZBHA 4RW4A 4Z4FA 1KFDA 1TK0A 4KFBA 4OVLA 1BIZA 1TKTA 4AHRA 4CGFA 2XO7A 3L2WA 3NAEA 1GOBA 4BE0A 4FW2A 4B9LA 1S9GA 4F2RA 1VRUA 2XY6A 3KIOA 4CGDA 4LH4A 4CJRA 2RN2A 2G8IA 2KTQA 1S6PA 1NK0A 1U49A 4CFBA 1QE1A 4FLXA 4GVMA 1QSLA 1HMVA 2P51A 4FW1A 2W42A 2YHBA 5C24A 4DS4A 3E01A 4CJKA 2E6LA 1SL1A 4E7JA 1LV5A 1RBSA 1ITGA 4RW7A 1C0MA 3U3GA 4DLEA 4IG3A 5HROA 3KD1E 1TAUA 1BCOA 4KPYA 1NKCA 1NJYA 4FJ5A 2D5RA 4Z4CA 1ZBIA 1VSFA 2I5JA 3NH0A 4ID5A 4BWMA 3OYFA 2ITGA 4EZ9A 1YT3A 3HPOA 2LSNA 1RNHA 3SI6A 4L8RB 5HRNA 4CHZA 4NYFA 4NCBA 4DWIA 4CEAA 4CF0A 3DLGA 1NK8A 4KHQA 3KLGA 4CFDA 4E89A 3DLKA 1QTMA 1NKBA 3O3GA 3TANA 3V1QA 1W9HA 3K58A 2E6MA 2IAJA 3OYBA 1ASUA 5SWMA 3QIPA 2F8SA 3OYHA 4I2PA 3AO1A 1SKWA 3RRGA 2ZD1A 5KGXA 4I9LA 1WSEA 1S1UA 1C1AA 1VSEA 4E7KA 1JLBA 4DSEA 1LW0A 3SNNA 4CK1A 3DM2A 3KKSA 3ZSVA 3OYMA 2KFNA 4KTWA 4KO0A 3CM5A 4E3SA 3MEGA 3K5MA 3V81A 4Q0BA 4CIFA 4CK2A 1CZBA 3V9XA 1WAFA 5HBMA 3V9UA 1RDDA 3LPTA 3P1GA 4DTMA 4JLHA 3PO4A 3U6FA 1VSMA 5SZTA 3LZIA 4CEEA 3TABA 3VQ6A 4CJVA 4J2BA 1HNVA 3OYAA 1JLFA 4ZTJA 3NBPA 2HMIA 1C1CA 2HB5A 4KTZA 3PX4A 3ZSRA 1N6QA 4E7HA 3IG1A 2HNYA 3NDKA 2FBVA 3MXIA 4C8KA 3C94A 1B92A 2EX3A 4FK4A 3VA0A 1KSPA 4FJKA 1WSGA 3NFAA 4N5SA 4O44A 4JS4A 1VSKA 3AO2A 4F3OA 4PQUA 3AO3A 2Z1GA 4CEOA 1U47A 4Z4GA 1RT7A 4LY7A 3WNGA 1KVCA 4BDZA 1KTQA 2HHUA 3ZT3A 2WONA 2XRIA 1JL2A 1BGXT 1IH7A 3WNEA 2OYQA 1TL1A 4J2DA 3SZ2A 4FM2A 1T8EA 4OLAA 1NJXA 3MXJA 4CJSA 1QSSA 3HL8A 3K5OA 2DFHA 3QNOA 3RR7A 4K8ZA 4ICLA 3O3FA 4H8KA 1NJWA 5JS1A 2DFFA 4CJLA 1JLEA 3OYCA 3HVRA 3QEIA 1SUQA 5KTQA 1HQUA 2JLEA 5C25A 1F21A 3DYAA 1C1BA 1EX4A 4B9NA 4B9SA 1LWFA 1RTHA 4CIEA 4MQ3A 3CFRA 5J2QA 3VQ8A 2KZMA 5FRNA 3CYMA 2YNIA 4NCGA 4IG0A 4RG8A 3OY9A 1TK5A 4B3OA 4CESA 4CJFA 4FJXA 4B8AB 3TAFA 2ZQBA 4OKEA 3QEWA 3THVA 3V1RA 4FLVA 1NK9A 3SUQA 3S3OA 3AVJA 1UAXA 4AHSA 3ZSZA 3AVNA 1D8YA 4KREA 3PX0A 3T3FA 3SV4A 3EZ5A 1GOAA 1WSFA 4FLWA 2HHXA 1J9AA 2DY4A 4Z0UA 2VWKA 4WE1A 4KI4A 4DQSA 4O5BA 4KI6A 3H08A 2RF2A 1WN7A 4CHYA 4NYNA 1HYVA 3T1AA 1Q9XA 4DSIA 1BQNA 1FKOA 3DMJA 4DS5A 1G15A 1XI1A 4PWDA 4PUOA 4F8RA 4F3TA 1IKVA 2AJQA 1W0HA 3NH1A 1JLGA 5K14A 4FZXC 2KZZA 3AA4A 3DOLA 1O1WA 3SUPA 3TAPA 3VQ9A 4CF8A 2F8TA 4AHTA 3L3VA 4DFKA 3L2VA 1CZ9A 3DLHA 2HHTA 3NE6A 4DF8A 1Q8IA 1IKWA 2ZE2A 3LAKA 3VQBA 3O3HA 4FZZA 3L2UA 2HNDA 3JYTA 3SPYA 3HK2A 1J54A 3PUFA 4CECA 4DQIA 3OJUA 3HPHA 2P5OA 3OS1A 3LWLA 3AVCA 3HM9A 2XY8A 2BDPA 3KK1A 2IOCA 1ZBLA 4DU1A 4F2SA 1GOCA 1U45A 1S1WA 3KK2A 3DRPA 3RTVA 3EY1A 4DTUA 1C0UA 4CERA 3RRHA 4YFUA 1NOZA 1NK4A 3TAMA 3K59A 2YHAA 3AVHA 3ASMA 1JXBA 3SPZA 4DSKA 4BACA 3KLFA 3D0PA 1JLCA 4FJIA 3TAQA 5CZ2A 1JLQA 2FC0A 4M3TA 1HYSA 3DOKA 4AHCA 3TARA 2HNZA 3NGYA 1FXXA 1WLJA 2ATQA 4C8NA 4LH5A 3SQ0A 1U48A 1L3UA 1LAWA 4HCBA 4FVMA 1RILA 3BGRA 3V9SA 2YNFA 4AHVA 4CIGA 2Z1HA 4CJPA 2YKNA 4YNQA 3AV9A 4E1MA 4DU4A 3NF7A 5FDLA 4O0IA 4ELUA 2Q3SA 3VQCA 3NHGA 4M3YA 4EP4A 1SL0A 1RBTA 2VG5A 3LP3A 2D0CA 3QLHA 3OYNA 3OYKA 3P5JA 1HJRA 4IFYA 4O55A 1YVUA 2VG7A 4DFPA 3RMCA 2KQ2A 4B9UA 1KLMA 3ZCMA 1KVAA 2B5JA 3IRXA 1RBVA 1S6QA 4CJ3A 4M45A 3AVBA 4HUGA 1NKEA 4M3RA 1NOYA 5KRTA 4ELVA 2QK9A 1ZBFA 2G8FA 4CEBA 3KTQA 3DI6A 4ID1A 5CZ1A 1BIUA 3AVKA 3G10A 1R0AA 2QKBA 3SUOA 3ZT1A 3ZSYA 4LSLA 5CY4A 4W5QA 1HQEA 4BDPA 4HHTA 4F4KA 2Z1JA 4IFVA 3SCXA 2FBXA 3QIOA 3HP6A 3MAQA 2JGUA 4XIUA 1T7PA 2YNHA 3OYGA 3SUNA 3ULDA 4CHNA 3SV3A 1BQMA 3KK3A 4CJUA 4W5RA 1WAJA 2QXFA 3AVAA 3ZT2A 2B6AA 4MFBA 4CGGA 3PX6A 3LANA 3QO9A 2FBTA 3HSTB 3FFIA 1U4BA 1KVBA 4CHOA 4KKOA 4LD0A 3TAGA 1REVA 4Q5VA 1EKEA 3LALA 1VRTA 4FJ7A 1N5YA 3S3MA 4CEQA 4Z4EA 2B4JA 4N56A 4OGEA 3PY8A 1J5OA 1ASWA 3ZSXA 3AVLA 2FBYA 1WSJA 4E7IA 4DTJA 1IO2A 2GBZA 3L2QA 4EZ6A 4HCCA 4OKKA 4CGIA 4KB0A 4J2AA 3LP1A 4FK2A 1LW2A 4DTSA 3HJFA 3AVIA 2X78A 1S1TA 1JLAA 3ZSOA 3V4IA 4B9TA 1TVRA 2OZMA 5I42A 3ZT4A 1VSLA 3I0RA 4FLTA 3KLIA 1S5JA 3QERA 5I3UA 2G8KA 5T7BA 3LPUA 1FK9A 3PO5A 3KLHA 3OYDA 3VQEA 1S9EA 4DMNA 4E7LA 4I2QA 2IC3A 4CJ5A 3ALYA 2O4IA 1T05A 3AVFA 4NCAA 4B9MA 1UWBA 5HRSA 1ZYQA 2YV0X 2IGIA 3QINA 3JSMA 4CF2A 4DFMA 1FKPA 3VQPA 4HVJA 4DF4A 4CCHA 1C6VA 1HNIA 3NGIA 4M42A 4DQPA 3V1OA 4FJMA 1MU2A 3MXMA 3AVGA 3G0ZA 1QS4A 4AILC 3V6DA 4FXDA 1X1PA 4CEZA 3C6UA 3OJSA 3CQ8A 2WOMA 3HO1A 3I0SA 4KHYA 2PYJA 4AHUA 1KRPA 4FJ8A 2EHGA 4CJ4A 4O0JA 3DRSA 4IKFA 2X74A 3OVNA 1LWCA 3OYIA 4FYDA 1TGOA 3NH2A 1ZBUA 3L8BA 3VQAA 4C8MA 4CEDA 1YTAA 4FJHA 1HPZA 4DG1A 3QESA 2HHWA 2GUIA 4CHQA 3IAYA 4FJJA 1A5WA 2KW4A 5FROA 2PZSA 4DU3A 4TSXA 1RT1A 3AO5A 3ZSWA 4CJTA 4DSFA 3SQ2A 3HXMA 4DTNA 1SKRA 4GW6A 3VQ4A 4KHUA 5HRPA 3TAEA 1JXEA 4FZYA 3VA3A 4DTRA 4DFJA 4J2EA 1BHLA 1QQCA 2F96A 2O4GA 5FRMA 4CEFA 4CJQA 1KFSA 3RWUA 3LWMA 3CFPA 1B9FA 3VQ7A 3RMAA 3KD5E 4Y1CA 1Z25A 5KGWA 3PV8A 3HP9A 1RBUA 2GV9A 3AA3A 3DLRA 3O4NA 1S1XA 3L3UA 4FLYA 3B6PA
chains in the Genus database with same CATH superfamily
1BCMA 1Y64A 4BRLA 3ISNC 2P9LB 2ETJA 2V7ZA 2Z1IA 3QETA 1MA9B 3PSIA 2G8WA 4K25A 4F9OA 5IT9O 1X9MA 2A1RA 5GIPA 2EWSA 5KPZA 3CMAN 1N36K 2NRTA 3B6OA 1Q7YO 3OYJA 3A8YA 4PKGA 3V9ZA 4W5NA 1VQON 2J4RA 3M1FA 4QS9A 1KCFA 4BGAA 4JD2A 4I9QA 4KTQA 4PY5A 4UQGA 4UY8O 3J81O 4JKAA 1L5UA 4JD2B 3VETA 4OPKA 3CCLN 4CZKA 1VHXA 4FK0A 5CYMA 1WSHA 3VTHA 3M8SA 1HNZK 4CGJA 3QB0A 4PKHA 4JRQA 1V4SA 4IDKA 5BR8K 1XHXA 4BR4A 5BR9A 1XHZA 4RW9A 3K5LA 4DUYK 5AQUA 3U9DA 2YHYA 4CJWA 5D3GA 2D0AA 3MECA 4RW8A 4AF1A 1CXUA 1I3AA 3CHWA 3NCIA 5EOYA 2YKMA 5F2RA 4FVUA 5M1KA 4N41A 1TKZA 2X6SA 1M90O 5AQPA 3ZT0A 3OW2M 1C0GA 1A5XA 1QSYA 1VSJA 2O8BA 1X9SA 3CG7A 3VTIA 4IJAA 3QEXA 4CBXA 4C8LA 1LAVA 2OANA 1NGHA 2NNWA 5JS2A 1Y97A 4BRGA 3M3ZA 4Z4HA 2DFEA 5C42A 2X6NA 5AQOA 2O8BB 5FPMA 3QNNA 3EEQA 3WXKA 4DSJA 3T19A 1ASVA 4X66K 1XNQK 4L3QA 3MX5A 3CIPA 5DMRA 4JKEA 1YTUA 3NF8A 2IIRA 1NGJA 2QWPA 5M1NA 5AQSA 1Q9YA 4EIAA 3N4PA 4W5TA 1B9DA 1RBRA 2I7PA 4ZTFA 4FWNA 4CD1A 2UUBK 3MN7A 5JMVA 3CI5A 1G99A 2D0BA 4MLEA 5JLFA 4KV8A 5C2DA 3KJVA 3P4IA 3UIQA 3HPGA 1EP4A 5E26A 1X9JA 3ZSQA 3OTOK 4N76A 2ZM6K 3NF6A 3LDSA 4CFAA 3HYFA 2ZGYA 3I8DA 3THXA 3FZKA 1BO5O 3F73A 1J6ZA 2OPQA 2HHQA 4KB1A 3THXB 4FWOA 5AQTA 1CXQA 4DR6K 1J53A 1TAQA 1ILYA 1I39A 3VN5A 3CCUN 4RW4A 1KFDA 3NAEA 5AR0A 4BE0A 4FW2A 4B9LA 1S9GA 2XY6A 1QVGM 4IEEA 4WYBA 1S6PA 5ADXH 4CFBA 2W42A 2P51A 1SL1A 3E01A 1ZBSA 4E7JA 1LV5A 1RBSA 4RW7A 3U3GA 1TAUA 4RWTA 4KPYA 1NKCA 3WXLA 1SZ2A 1YT3A 4JEPA 3BZKA 4L8RB 4KH5A 4NYFA 4DWIA 1XMQK 3V1QA 3J8AA 4DV1K 3K58A 2IAJA 3VF4A 4JI8K 1XC3A 3QIPA 1RDUA 3RRGA 4I9LA 2WUSA 4E7KA 1JLBA 3SNNA 3IFRA 3DM2A 3KKSA 4DR5K 3T1HK 3CM5A 1VQ8N 4E3SA 4BRAA 1GLBG 5HBMA 3P1GA 2FF6A 4CEEA 3VQ6A 4J2BA 1BA1A 5AQWA 4E1JA 3OYAA 1JLFA 4ZTJA 4CD3A 3O9QA 2HB5A 3ZSRA 3MXIA 3HOTA 4C8KA 2P9SA 3ZYYX 1WSGA 4N5SA 4LF9K 5AQKA 3AO3A 4CEOA 3E9OA 2KKZA 2P9SB 1IH7A 2XRIA 1TL1A 4BRPA 4AM7A 3SZ2A 5GINA 4OLAA 1QSSA 3HL8A 4H0TB 5GADP 4K8ZA 3O3FA 2KLAA 1NGIA 1S72N 4CJLA 1JLEA 3OYCA 5KTQA 2JLEA 5C25A 1C1BA 1EX4A 4CIEA 3CFRA 3VQ8A 3FZMA 5FRNA 4IG0A 3H45C 1NBWA 1NGBA 4BR5A 3TAFA 2ZQBA 3QEWA 3V1RA 4BQZA 1D8YA 3PX0A 3EZ5A 1WSFA 2DY4A 4KI6A 3H08A 1QQMA 5FPEA 3T1AA 2BH1A 1Q9XA 3DMJA 3R1XA 4PUOA 2V51B 5E84A 5K14A 4JI5K 1NU0A 3IMXA 3VQ9A 1YJWN 5HOOA 4DFKA 3NE6A 4LF5K 1IKWA 3VQBA 3L2UA 2HNDA 3SPYA 4DQIA 5M1OA 3HPHA 3OS1A 1ZBLA 3UKUA 5M1QA 1S1WA 3RTVA 4DTUA 3J7AP 1C0UA 3HBTA 3UKUB 3K59A 2YHAA 1EO1A 3FLCO 4H0YB 1JLQA 2FC0A 2QTDA 1HYSA 2YHWA 4J8FA 4Z94A 3MN5A 3NGYA 1FXXA 4C8NA 1U48A 1L3UA 4CZGA 1BDGA 4CIGA 4BR2A 1EQYA 2ASOA 4DU4A 5FDLA 4ELUA 1KAZA 2Q3SA 3NHGA 4EP4A 1YJ9N 3OYNA 4O55A 3O9TA 3D7EO 4B1UB 1YVUA 4LFAK 2E88A 3EE9A 1KVAA 2B5JA 3MX2A 4CJ3A 3TTDA 2W6LA 4BC5A 3CERA 3AVKA 5CY4A 3O4WA 4HHTA 1ZXOA 3MAQA 1VQLN 2JGUA 3FZLA 4DQ8A 4CHNA 4JI1K 4W5RA 3QO9A 3FFIA 1U4BA 4KKOA 4C1NI 1HR0K 5GIOA 3DWLA 5KQDA 4OGEA 1JCEA 1JCGA 3ZSXA 2FBYA 4E7IA 1VQ9N 3FZHA 4EZ6A 4JKGA 4RTFD 3L0QA 2A41A 3PLAA 1VSLA 1YF5L 4JKGB 3KLIA 4FL9A 1FK9A 4BROA 3VQEA 1S9EA 3T1YK 3U4LA 4CJ5A 2IC3A 2O4IA 4YOWA 3KK7A 1UWBA 2VGMA 4K43A 4GV9A 2IGIA 2NRZA 5BPMA 1C6VA 1HNIA 3V1OA 1MU2A 4CEZA 3I0SA 4GKJK 4KHYA 2PYJA 2QA4N 1DGKN 4FYDA 2CGJA 2OTJN 4FJHA 3VEYA 1NLVA 3IAYA 2E2PA 5FROA 2PZSA 4TSXA 5AQHA 4GW6A 3VA3A 1ESVA 1KC8O 1KAXA 4GY2B 2O4GA 3KD5E 3RMAA 4Y1CA 3SAFA 3WQTA 4FOIA 4QAGA 1UOCA 3M6GA 4FWQA 5AFUH 4G1QA 5F1XA 4JI6K 1WB9A 1IG9A 5TKYA 1TKDA 3WXIA 2ZJQL 1WBBA 1BISA 3SBGA 4C8OA 1VQPN 2BANA 1NK7A 1SS6A 4BREA 3LP2A 1EXQA 1WNSA 2A6AA 3TSUA 1YHQN 2NRVA 2Y1JA 5C15A 1WSIA 1XWLA 1V4TA 2UUAK 1O13A 3FZFA 1DTQA 1E4GT 2HHSA 4CZMA 4BVOA 1QZ5A 4OJRA 3MMVA 1RT6A 3BDPA 4DTXA 3C7NA 3ATVA 2NRRA 4X64K 4LF6K 4W5OA 1RT3A 2OA8A 3FE1A 2OPPA 2P9KA 3C7NB 4MDBA 3RMDA 3M8RA 5J2NA 3QEVA 4IOAL 2VQEK 1VSDA 4BC4A 2XY5A 3C95A 2P9KB 4FLUA 3MEDA 2P5GA 3VPZA 3T69A 2OZSA 3O8MA 2W6KA 4CK3A 4BRCA 4FLZA 4DR7K 1W97L 4NLBA 2E4LA 3G71N 1BI4A 5J1EA 3V9WA 1UA0A 3IUCA 1WOQA 4FWRA 5E41A 1BI4B 4IO8A 5B8HA 3OS2A 5HRRA 3K5NA 2A42A 2HHVA 5HLFA 1LWEA 4O5FA 4OO1J 1IKYA 3AA5X 4CF9A 4DTPA 4CHPA 5EU7A 3TR8A 4C23A 1K8KA 3MCPA 1P90A 1UA1A 2QWOA 3VGMA 3AO4A 3H46O 4BRQA 1K8KB 1BUPA 3G6EN 3WNHA 2UUCK 2FSNA 1K6YA 5A2QO 3A2FA 4I7FA 1TV6A 4KHNA 4ZHRA 1HKCA 1T03A 5CYQA 5CHIA 3CC7N 4OKJA 1SKSA 1BL3A 2F9WA 3ATUA 4YDUC 1EETA 4CGHA 4E19A 3SAHA 1OH5A 4K8XA 1RT5A 1VK0A 4LSNA 4R79A 4Y1DA 5KRSA 4WF9L 4DB3A 5C2FA 2A1SA 1D5AA 4O4GA 3J7ZO 1BA0A 3WT0A 3VGLA 4N47A 3B8AX 4GMJB 3R9PA 4IJNA 1BU6O 3DRRA 3L4IA 1NJIO 1KLNA 3H1VX 3LZJA 1A5VA 3WNFA 3DJCA 3D6RA 5AQZA 1DLOA 4H4OA 5FPDA 3NGZA 4JRPA 4FCYA 3LP0A 4KFBA 1MWMA 1BIZA 1TYQA 4F2RA 3KIOA 4CGDA 3RVCA 4CJRA 1IBMK 4CJ7A 3CQYA 2KTQA 1TYQB 3LDQA 3EE8A 1QSLA 4FW1A 2YHBA 1VAZA 1XUPO 4DLEA 5HROA 3KD1E 2ITMA 4PHTX 4B3RK 2D5RA 3CJBA 4DV2K 2I5JA 4BWMA 3OYFA 5GAGP 3HPOA 2LSNA 2F9TA 5HRNA 4CHZA 4NCBA 4A61A 1NK8A 3DLKA 1QTMA 1HKBA 3ENOA 1QQOA 2E6MA 2Q97A 3IDHA 3OYBA 4I2PA 3AO1A 4YOYA 2ZD1A 4BQLA 5KGXA 1T6DA 1R59O 2ZGZA 4B3TK 4GV3A 2F7TA 1GLDG 3OYMA 1YAGA 3ID6A 3VESA 3V81A 2NLXA 3AAPA 3PSFA 2Q0UA 4CK2A 1CZBA 4JYAK 1MWKA 4JAXA 3PO4A 3LZIA 3HZ6A 3TABA 3GL1A 3DLLL 1K9MO 1HNVA 1ATRA 1C1CA 4KTZA 1IG8A 1N6QA 2FBVA 3IKMA 1B92A 4FK4A 4BY9C 4FJKA 4XH4A 4PQUA 3O9RA 3AO2A 3NMUA 4H5WA 4YDUA 4LY7A 3P31A 1JL2A 5HL7L 4IOXA 1SAZA 4LF8K 1EWRA 3K9KA 2DFHA 4DV7K 4ICLA 4H8KA 1NJWA 2ASMA 1GLFO 3UB5A 1SUQA 1J5EK 1HNXK 2O8DA 1F21A 3DYAA 4CW7B 2HBKA 3AGRA 1NGAA 1RTHA 4B9SA 3C65A 1NG9A 2VWBA 2YI1A 2YNIA 2GEMA 4NCGA 2O8DB 3P38A 4B8AB 5LL6Z 3SUQA 3S3OA 3AVNA 3CJ9A 3TTFA 5EVZA 4WE1A 4KI4A 3UE5A 2OCEA 5DM6L 3CC4N 4CHYA 1FKOA 4PWDA 2JWLA 1Z6RA 3MDQA 3I56N 4F8RA 4F3TA 1U2VA 1W0HA 3NH1A 5GAEP 1BWFO 3BF1A 4QS8A 3TAPA 4CF8A 2F8TA 4GVEA 4AHTA 3L2VA 1CZ9A 1U2VB 1Q8IA 2ZE2A 3CCEN 3HK2A 3H3OB 3PUFA 3OJUA 4BRKA 1RFQA 3LWLA 1Q82O 3J7YP 3HM9A 3CETA 3HOSA 4F2SA 2V52B 3DRPA 4CERA 3ASMA 1JLCA 5IWAK 2WTUA 4FJIA 3TAQA 1M1KO 2HNZA 2ATQA 3G4SN 3SQ0A 4FVMA 1NNEA 3ZETA 3OA9A 1NMDA 4IFEA 1T6CA 4U7BA 3KZBA 3SMSA 3EKUA 5CR4A 4CZFA 3ZETB 5AQLA 1SL0A 4FXDA 3LP3A 4JN4A 3TU5A 2D0CA 2WBNA 3QICA 5AQJA 3P5JA 4BRFA 3RMCA 5LMUK 3ENHA 3ZCMA 4RCHA 4MO5A 1S6QA 3AVBA 4ELVA 1IBLK 4JI7K 2QK9A 4BR0A 3W3DA 2G8FA 5M1PA 3KTQA 3DI6A 3LM2A 4ID1A 3ZX3A 5CZ1A 1ATNA 1BIUA 3G10A 5JVHL 2F4VK 2QKBA 1SQKA 3SUOA 3CJ1A 4LSLA 1HQEA 1YIJN 4F4KA 3SCXA 3HP6A 4ISGA 2NRWA 3OYGA 4WCEL 3PIOL 3ULDA 3KK3A 3GBTA 4CJUA 4CZEA 1WAJA 2QXFA 3AVAA 3ZT2A 1N8RO 4G9ZA 4CGGA 2NRXA 2FBTA 4LD0A 1XQSC 1N5YA 4CEQA 2JWKA 2B4JA 3MCAB 4Z4EA 1ASWA 4DTJA 3L2QA 4OKKA 4CGIA 3O80A 3SBTA 3O6WA 1JLAA 2CH5A 2HOEA 3VF6A 5I42A 3TTCA 3ZT4A 4FLTA 5MLCQ 5T7BA 1NGDA 3LPUA 3PO5A 3KLHA 5BREA 3S41A 1LOTB 1IV0A 1T05A 2HF4A 4NCAA 5HRSA 4H0OA 3JSMA 4CCHA 2WFBA 4HVJA 1X3MA 4FJMA 5BPNA 4NLCA 3AVGA 3G0ZA 4NXMK 4JKCA 2WOMA 1VQNN 4AHUA 2EHGA 4O0JA 1KD1O 3DRSA 2X74A 1YUWA 1TGOA 4H5RA 3QBXA 3VQAA 5EY4A 4C8MA 1Q86O 4DG1A 2YCHA 4CHQA 4FJJA 1A5WA 4DU3A 3AO5A 4CJTA 3SQ2A 4DSFA 4PKIA 4DTNA 3TSQA 4KHUA 2V7YA 2Q1NA 3TAEA 3QDKA 1JXEA 2E2QA 3HM8A 3KWGA 4DTRA 1QQCA 1GLAG 2F96A 4CJQA 3P39A 3VEWA 3LWMA 4BG8A 3CFPA 4ISEA 4LF4K 4BRDA 3O4NA 4FLYA 3L3UA 2YHXA 3F2KA 3LM9A 3ZX0A 4CF1A 4BC3A 2BTFA 3TI0A 5KPTA 4OPJA 2Q2RA 4DQRA 3SQ1A 1CLQA 3K0SA 1CZAN 1TKXA 3NVMA 2G8UA 4OLBA 1RTIA 1HUXA 4K41A 4BDYA 3S9HA 4GNIA 4FM1A 1L3VA 3BZCA 1BOTO 3L4QA 4HTUA 4M3XA 4MO4A 4CJEA 3AARA 5AQFA 3ZX2A 3R3LA 2CH6A 3CJCA 4DV6K 4BE2A 4BE1A 3D45A 4KRFA 3KLEA 2RKIA 3VQ5A 4B08A 3VF2A 2VQFK 3MN9A 4A5AA 1NK5A 3A5NC 4KHSA 5AJ3K 1OH6A 1RTJA 4WFAL 5HP1A 1VQKN 2QWLA 2P9UA 4CFCA 3QMLA 4RW6A 2QXLA 1XMOK 1S1VA 3WXMB 3DLEA 5J2MA 2P9UB 3C6HA 2XY7A 2VWJA 1TUYA 4DR3K 2IVOA 2FF3B 4OPAA 4BWJA 4R5PA 2YNGA 3KVGA 3R8EA 1RT4A 3P83D 4DQQA 3F9KA 3VQDA 3O4QA 3O1WA 4MLHA 2I7NA 3AA2A 2PY5A 3ITHA 2R7YA 2G8VA 4OPHA 4E1NA 1GLLO 4H5NA 3DAWA 3RR8A 1OVYA 1HYZA 3TSPA 3U9ZA 3OS0A 1X9WA 4H4MA 2FSJA 3SYZA 3CM6A 1L3TA 4HUFA 4CZIA 5F0XA 3T7ZA 1D9DA 1U04A 4AH9A 3CCRN 2QKKA 1VSIA 4JS5A 1RDCA 2AP1A 3RMBA 3GDQA 1VSHA 4WFNL 1SV5A 1RDBA 3JS6A 3CCMN 4LFBK 1OH7A 1HX1A 2YJFA 1IKXA 4OGCA 2UXCK 4EHTA 4FJLA 3O08A 2HW3A 4QOZB 4CE9A 1S22A 3HVTA 1OH8A 4JV5K 2KFZA 1RT2A 3KWIA 4CBWA 3FFKB 1I94K 3L2RA 2OPRA 3EYZA 4KHWA 4IBNA 5DK5A 2XHBA 4IOCL 3MEEA 1NGFA 4OVLA 3ZEUA 4AHRA 2XO7A 1GOBA 3CXCM 2RN2A 1VQ7N 2G8IA 5AQYA 3ZEUB 1U49A 1QQNA 1QE1A 4FLXA 4GVMA 1HMVA 4DS4A 4CJKA 2UYTA 1WUAA 1ITGA 1C0MA 4IG3A 1Q81O 1NJYA 4FJ5A 4Z4CA 3AY9A 4ID5A 2ITGA 4EZ9A 3SI6A 4FPAA 5TKWA 4CEAA 1HPMA 4E89A 2E2OA 2GELA 1U6ZA 3TANA 2AA4A 4GV6A 1W7AA 1ASUA 5SWMA 3SMPA 4BR9A 4FO0A 1WSEA 1S1UA 1VSEA 4XH5A 1LW0A 4CK1A 2KFNA 2QWRA 4KO0A 4JK9A 3K5MA 4Q0BA 4CIFA 3QBWA 3LL3A 5BN8A 3U6FA 4JNEA 4WQ4C 4CJVA 1EWQA 2HMIA 1N34K 3PX4A 3F9MA 4E7HA 3NDKA 2D0PA 3VA0A 1KSPA 3A5OC 3Q7BA 4O44A 1VSKA 2Z1GA 1U47A 1RT7A 3WNGA 4BDZA 1HKGA 2HHUA 3ZT3A 2WONA 1BGXT 3WNEA 2OYQA 3BP8A 1NWKA 5BRDA 4FM2A 3TPQA 1T8EA 3K5OA 3RR7A 3JXUA 3THYA 4CZLA 1T3VA 3K9JA 3HVRA 3QEIA 4JI2K 4LFCK 1HQUA 3NVKA 1IJJA 4LF7K 1LWFA 5J2QA 5FPNA 1NMNA 2E1ZA 3THYB 3CYMA 2KZMA 3OY9A 4B3OA 4CESA 4CJFA 4FJXA 4OKEA 1E4FT 4DKWA 2O8FA 3AVJA 5BN9A 3ZSZA 4KREA 3HSCA 1HLUA 3EZWA 1HJOA 1GOAA 1J9AA 2O8FB 2VWKA 1DT9A 4DQSA 4O5BA 2RF2A 5AZJA 1ATSA 1HYVA 4DSIA 3N4QA 3HTVA 1XI1A 4DS5A 1G15A 3JAMO 2D4WA 3CF5L 4IO9L 3AAQA 1JLGA 3H3NO 5AZJB 2NRHA 2KZZA 3DOLA 1O1WA 1VQ6N 3G25A 3DLHA 3O3HA 4FZZA 3BF3A 3WUHA 4CECA 3I55N 3VEOA 1GOCA 4M7XA 1T44A 3EY1A 2ZJRL 3CD6N 3RRHA 1QHAA 3CC2N 1NK4A 1NGEA 3AVHA 1JXBA 3SPZA 4BACA 2DPNA 5LJVA 3D0PA 2NZTA 5CZ2A 3WEEA 3CPWM 3VGKA 3TARA 1WLJA 4LH5A 4JI3K 1RILA 3BGRA 4FWMA 3V9SA 2YNFA 3J80O 3WEEB 4YY3K 5AQRA 4KHPK 2YKNA 5AQNA 4JI0K 3NF7A 1LCUA 4O0IA 1GLCG 4WQ4A 3EKSA 1RBTA 2VCPA 2VG5A 3OYKA 3QLHA 3CCVN 4IFYA 2VG7A 4QS7A 2Q0RA 4DFPA 2HHHK 2HSTA 4B9UA 3IRXA 1RBVA 1KQSM 4M45A 4HUGA 3M5RA 4M3RA 1ZBFA 5BRFA 2A3ZA 3HI0A 3MWPA 1Z05A 3MWTA 4KH6A 4A2AA 2QI2A 3ZT1A 2FXUA 4DV3K 4BDPA 2Z1JA 1KXPA 4IFVA 3QIOA 4ISFA 1DKGD 2HF3A 3SV3A 4MFBA 3PX6A 3LANA 3HSTB 2ZJPL 1K8AO 4LC9B 4FJ7A 4N56A 3PY8A 1J5OA 1WSJA 4K42A 1IO2A 2ZWHA 2GBZA 3HRGA 2GUPA 4A2BA 4ILGB 4M63C 4IXCA 4J2AA 4FK2A 1S1TA 2X78A 3AVIA 4B9TA 1TVRA 3VEXA 3W0LA 2O8EA 3THWA 3QERA 3BY5A 3OYDA 4DMNA 3LDPA 2O8EB 3THWB 3MK6A 3ALYA 3AVFA 5ADXA 2YV0X 3CCQN 4DFMA 3VEVA 4B3SK 3NGIA 4M42A 4DQPA 2QWQA 4WQ5C 2GWKA 1IBKK 4AILC 3V6DA 3C6UA 3OJSA 3CQ8A 3HO1A 2Q36A 4EHUA 4CJ4A 1N33K 3A5LC 3OVNA 3OYIA 4H5TA 4BRHA 3NH2A 1ZBUA 4HTLA 3VERA 3SLCA 2HHWA 4HWIA 2GUIA 4BGBA 4FSVA 2VYPA 1RT1A 3HXMA 4XH1A 5BPLA 4DFJA 3ID8A 3I8BA 1VQ5N 5FRMA 3LDNA 4CEFA 1KFSA 2UU9K 1B9FA 4ILJA 3VQ7A 3PV8A 3HP9A 2GV9A 3DLRA 3A0IX 3B6PA 3I33A 1JKHA 1RCHA 1DTTA 3K2PA 4CVNE 3D2EA 4E0DA 4BR7A 1C0TA 2P9PA 2P1JA 2RPIA 3QEPA 4IZ9A 2UXBK 3D2EB 3HT3A 2RHKA 3BUZB 3O1BA 3LAMA 2HVHA 1FJGK 2P9PB 4FJGA 4JI4K 4FM0A 3VEZA 2PAVA 1GLJO 2IVNA 4M3ZA 3TWHA 4EP5A 4M41A 2BGGA 2G8HA 1YJNN 3MN6A 4YOTA 1TUUA 1Z26A 2W40A 1HRHA 3DLBA 1JL1A 2IS3A 3K57A 4EFHA 1XC9A 2E2NA 1QHTA 1TK8A 2CGKA 1SL2A 2NUBA 2FSKA 2HBLA 3VQQA 5J2PA 1TL3A 4KH4A 1C0FA 4FJNA 2D0OA 4KAZA 5JVGL 4JK8A 3BEXA 3CPEA 3C6TA 4DV0K 4M7YA 1NK6A 3SK3A 2Y1IA 4YORA 4DHYA 3CFOA 3M8QA 3U3YA 3SJJA 3SQ4A 4WQ5A 3QFUA 3M8PA 3AVMA 4BRNA 5M1FA 3OYEA 2E5LK 5C12A 1RTDA 3OYLA 5AQQA 3A5MC 4FJ9A 2ZF5O 4DSLA 1NJZA 4B9VA 3FGUA 4CI6A 2DTUA 2PFUA 2HMPA 2PYLA 2VG6A 1L3SA 4Z4IA 4DLGA 2OPSA 4M3WA 4M3UA 4FWPA 4JKHA 5LJWA 5AQGA 3L6QA 1NGCA 4U67L 3E9LA 3EL2A 2FLOA 5C0YA 3LDOA 3KKRA 4GKKK 3NF9A 3IS9A 1K73O 2ASPA 1NGGA 1RDAA 4DR2K 5I9EB 4H0PA 4ELTA 4NB4A 1D9FA 5LMNK 2P9NA 4FPBA 3S3NA 3EO3A 1OVQA 2BE2A 2HVIA 4B1ZA 2P9NB 1X3NA 4QCLA 4O8KA 2UXDK 4DTOA 4B1WB 1VQ4N 4PA1A 2E8AA 4JHDA 2QWMA 5KI6A 4HUEA 4B8CA 1ZBHA 2IDOA 1QZ6A 4Z4FA 4YHHK 1TK0A 2A40A 1TKTA 4CGFA 3L2WA 3CCSN 4JHDB 1VRUA 2QM1A 4LH4A 5DM7L 2YX6A 3RSEA 1NK0A 4FWKA 5ELZA 1QVFM 4A62A 4X65K 5C24A 2E6LA 3RSEB 3VOVA 1P8ZA 4I6MA 1BCOA 1ZBIA 1VSFA 3NH0A 1RNHA 4I6MB 1RDWX 3VENA 1NM1A 1JCFA 4CF0A 3DLGA 3WQUA 3KLGA 4DV4K 4CFDA 4KHQA 3ZLJA 1NKBA 3O3GA 4B1VA 2GTDA 1W9HA 3SAGA 2CGLA 2F8SA 3OYHA 5CE3A 1SKWA 3F5TA 5BRHA 1C1AA 4IDHA 4DSEA 1FW6A 3ZSVA 1JJ2M 4KTWA 1KAYA 3MEGA 3PIPL 5JICA 3V9XA 1WAFA 2PBDA 4Y0WA 4X62K 3V9UA 4DV5K 1RDDA 3LPTA 4DTMA 4JLHA 4YOXA 1VSMA 5SZTA 4BVPA 1VQMN 4A59A 4MDAA 5AQMA 3NBPA 2QEXN 4JKFA 5EX5A 4DR4K 1YVNA 4DR1K 4CZJA 3IG1A 2HNYA 3C6AA 3C94A 2EX3A 2BUPA 1OKJA 3NFAA 4JS4A 4F3OA 2W41A 4FWLA 4B3MK 1S3XA 4Z4GA 1KVCA 1KTQA 3E66A 4J2DA 4IWVA 1NJXA 3MXJA 4CJSA 3QNOA 3R6MA 4DCHA 4JKBA 5C10A 2GX9A 2QWNA 5JS1A 2DFFA 3GOIA 3KHYA 4JKDA 4IEIA 5JLHA 5AFUA 3QFPA 4CBUA 2OTLN 4B9NA 1H1VA 3E9PA 4MQ3A 1WBDA 4RG8A 1TK5A 5KPRA 1Q18A 4FWSA 3THVA 1NK9A 4FLVA 2HBMA 1UAXA 4AHSA 3OHRA 2D1KA 3T3FA 3SV4A 4FLWA 2HHXA 4BRIA 4Z0UA 1HNWK 2YJEA 2E20A 4K0KK 1WN7A 4NYNA 1BQNA 4O8UA 3CMEN 1IKVA 2AJQA 3H1QA 4FZXC 3AA4A 3SUPA 3L3VA 2HHTA 4DF8A 4ILHA 3LAKA 5AQVA 3JYTA 1J54A 4B9QA 2P5OA 3AVCA 2XY8A 2BDPA 3KK1A 4CZHA 2IOCA 4DU1A 1U45A 3KK2A 5AZIA 3O9UA 3D2FA 4XEIA 3E1YA 4YOVA 4YFUA 1NOZA 3TAMA 5AZIB 4DSKA 3KLFA 2E1YA 3D2FB 4B1YB 3CQXA 3EN9A 4M3TA 3DOKA 1MDUB 4AHCA 2H3GX 4HCBA 1LAWA 4A57A 1GLEG 2WC9A 4AHVA 3ENBA 3OBWA 2Z1HA 4CJPA 3ULEA 1RGIA 3AV9A 4C1NK 4YNQA 4E1MA 3VQCA 4WFBL 2IVPA 4M3YA 1HJRA 3H6EA 3ULEB 4YOUA 4V19S 5FLXO 2KQ2A 1KLMA 5LY3A 3O9SA 1NKEA 1NOYA 5KRTA 4CEBA 2A5XA 5EXWA 1ZC6A 1R0AA 3ZSYA 4W5QA 3OBYA 3GG4A 2FBXA 1T7PA 5H1SQ 4BC2A 2YNHA 3Q7CA 4XIUA 3SUNA 1BQMA 3O5BA 2B6AA 3GE1A 3FR0A 3C0BA 2KHOA 4FOEA 1KVBA 4CHOA 3TAGA 1REVA 4Q5VA 1EKEA 3CJAA 1VRTA 3LALA 2GWJA 3S3MA 4BG9A 3AVLA 2QW9A 4HCCA 4OX9K 1DEJA 4H5VA 3SJHA 4KB0A 3CJ7A 3LP1A 1LW2A 4DTSA 3HJFA 1N32K 2OZMA 3V4IA 3ZSOA 1E3MA 3I0RA 1YITN 1BG3A 1S5JA 5I3UA 4NO7A 2G8KA 1W2BM 3DXMA 3UKRA 1YXQA 2Q31A 4E7LA 1YI2N 4I2QA 4PL8A 4DUZK 4B9MA 3DXMB 2RE2A 3U8XA 3UKRB 1ZYQA 3LDLA 3QINA 3WXJA 4CF2A 5KQ8A 1FKPA 3VQPA 4DF4A 1XNRK 3MXMA 3CCJN 1QS4A 1X1PA 3DXKA 4NXNK 2HBJA 1KRPA 4FJ8A 4A5BA 4IKFA 1LWCA 2P9IA 3DXKB 4AM6A 4KBOA 4B1XB 3L8BA 4CEDA 1YTAA 1HPZA 3QESA 4AQYK 2KW4A 2P9IB 5AQXA 3ZSWA 4PL7A 4H0XB 3VMFB 3AGKA 1SKRA 3VQ4A 4BRMA 5HRPA 4FZYA 5AQIA 1BHLA 5GAHP 4J2EA 2O8CA 4EAHD 3RWUA 4H03B 2VGNA 4JK7A 2P9LA 2O8CB 1Z25A 5KGWA 1RBUA 3AA3A 4H0VB 1S1XA 1D4XA
chains in the Genus database with same CATH topology
1BCMA 1UOCA 3ISNC 4G1QA 2ETJA 4CF1A 1IG9A 1TKDA 1JKHA 2Z1IA 1RCHA 3QETA 2G8WA 1BISA 1DTTA 3K2PA 3TI0A 4C8OA 4OPJA 4DQRA 3SQ1A 1CLQA 1X9MA 2BANA 1NK7A 2G8UA 1TKXA 4E0DA 2A1RA 4OLBA 1RTIA 3LP2A 1EXQA 1C0TA 2P1JA 1WNSA 2RPIA 4BDYA 4FM1A 3QEPA 3S9HA 1L3VA 2Y1JA 3HT3A 3B6OA 1WSIA 3OYJA 1XWLA 3LAMA 4HTUA 4M3XA 2HVHA 3V9ZA 4W5NA 4CJEA 4FJGA 1DTQA 1KCFA 2HHSA 4FM0A 4I9QA 4KTQA 4PY5A 4UQGA 4OJRA 4M3ZA 1RT6A 3BDPA 4DTXA 3TWHA 4EP5A 4M41A 4BE2A 1L5UA 2G8HA 4BE1A 3D45A 2BGGA 4OPKA 4KRFA 3KLEA 2RKIA 1Z26A 3VQ5A 4B08A 4FK0A 5CYMA 1HRHA 1RT3A 1WSHA 4W5OA 2OA8A 3DLBA 2OPPA 3M8SA 4CGJA 1JL1A 2IS3A 3RMDA 4JRQA 3K57A 3M8RA 5J2NA 3QEVA 1XC9A 1NK5A 4IDKA 1QHTA 1VSDA 1XHXA 1TK8A 2XY5A 4KHSA 3C95A 1SL2A 1XHZA 1RTJA 4RW9A 3K5LA 2NUBA 4FLUA 3MEDA 2P5GA 3VQQA 4CJWA 5HP1A 2OZSA 5D3GA 2D0AA 3MECA 4RW6A 4RW8A 4CFCA 5J2PA 1TL3A 1CXUA 4CK3A 1I3AA 4FLZA 1S1VA 3NCIA 4FJNA 2YKMA 3DLEA 5J2MA 2E4LA 1BI4A 5J1EA 3V9WA 4KAZA 1UA0A 2XY7A 2VWJA 4N41A 1TKZA 2X6SA 4BWJA 4R5PA 3ZT0A 3C6TA 2YNGA 1A5XA 1QSYA 1VSJA 1RT4A 5E41A 1X9SA 3P83D 1BI4B 3CG7A 4DQQA 3QEXA 1NK6A 4C8LA 3OS2A 1LAVA 3F9KA 5HRRA 5JS2A 3VQDA 1Y97A 3K5NA 2Y1IA 5HLFA 1LWEA 3CFOA 3M8QA 3O4QA 3U3YA 3SJJA 1IKYA 2DFEA 3AA5X 2X6NA 4Z4HA 4CF9A 5C42A 4DTPA 4CHPA 3SQ4A 3AA2A 5EU7A 3M8PA 3TR8A 3AVMA 3OYEA 3QNNA 3ITHA 2R7YA 2PY5A 3T19A 1UA1A 2G8VA 4DSJA 1ASVA 4E1NA 3RR8A 1RTDA 1HYZA 3OYLA 3AO4A 3OS0A 1X9WA 4H4MA 3SYZA 4FJ9A 5DMRA 3CM6A 1YTUA 3NF8A 4DSLA 1L3TA 3WNHA 4HUFA 1NJZA 1U04A 1D9DA 4B9VA 1K6YA 3A2FA 1Q9YA 4AH9A 2DTUA 4I7FA 2PYLA 2VG6A 1L3SA 2QKKA 4Z4IA 1VSIA 4JS5A 4DLGA 1RDCA 1TV6A 2OPSA 3RMBA 1VSHA 4KHNA 4M3WA 1SV5A 4ZHRA 1T03A 5CYQA 4M3UA 4W5TA 1B9DA 1RBRA 1RDBA 4OKJA 1BL3A 4ZTFA 1SKSA 4E19A 1EETA 4CGHA 4K8XA 1RT5A 1VK0A 1IKXA 4OGCA 2D0BA 4LSNA 3KKRA 3KJVA 4KV8A 3UIQA 3NF9A 3IS9A 4Y1DA 3HPGA 5KRSA 4FJLA 1EP4A 1RDAA 3ZSQA 2A1SA 4QAGA 2HW3A 1D5AA 2HHVA 4N76A 4QOZB 4CE9A 3NF6A 4O4GA 3HVTA 3LDSA 4CFAA 4ELTA 3HYFA 3I8DA 1D9FA 4N47A 3S3NA 4GMJB 3F73A 3DRRA 2KFZA 2BE2A 1RT2A 2OPQA 1KLNA 2HVIA 2HHQA 4KB1A 3LZJA 1A5VA 3WNFA 4QCLA 1CXQA 4DTOA 4PA1A 3L2RA 2OPRA 1DLOA 4H4OA 3EYZA 1J53A 4KHWA 4IBNA 3NGZA 5KI6A 1TAQA 4HUEA 4JRPA 1I39A 5DK5A 3VN5A 4B8CA 2XHBA 3MEEA 2IDOA 4FCYA 3LP0A 1ZBHA 4RW4A 4Z4FA 1KFDA 1TK0A 4KFBA 4OVLA 1BIZA 1TKTA 4AHRA 4CGFA 2XO7A 3L2WA 3NAEA 1GOBA 4BE0A 4FW2A 4B9LA 1S9GA 4F2RA 1VRUA 2XY6A 3KIOA 4CGDA 4LH4A 4CJRA 2RN2A 2G8IA 2KTQA 1S6PA 1NK0A 1U49A 4CFBA 1QE1A 4FLXA 4GVMA 1QSLA 1HMVA 2P51A 4FW1A 2W42A 2YHBA 5C24A 4DS4A 3E01A 4CJKA 2E6LA 1SL1A 4E7JA 1LV5A 1RBSA 1ITGA 4RW7A 1C0MA 3U3GA 4DLEA 4IG3A 5HROA 3KD1E 1TAUA 1BCOA 4KPYA 1NKCA 1NJYA 4FJ5A 2D5RA 4Z4CA 1ZBIA 1VSFA 2I5JA 3NH0A 4ID5A 4BWMA 3OYFA 2ITGA 4EZ9A 1YT3A 3HPOA 2LSNA 1RNHA 3SI6A 4L8RB 5HRNA 4CHZA 4NYFA 4NCBA 4DWIA 4CEAA 4CF0A 3DLGA 1NK8A 4KHQA 3KLGA 4CFDA 4E89A 3DLKA 1QTMA 1NKBA 3O3GA 3TANA 3V1QA 1W9HA 3K58A 2E6MA 2IAJA 3OYBA 1ASUA 5SWMA 3QIPA 2F8SA 3OYHA 4I2PA 3AO1A 1SKWA 3RRGA 2ZD1A 5KGXA 4I9LA 1WSEA 1S1UA 1C1AA 1VSEA 4E7KA 1JLBA 4DSEA 1LW0A 3SNNA 4CK1A 3DM2A 3KKSA 3ZSVA 3OYMA 2KFNA 4KTWA 4KO0A 3CM5A 4E3SA 3MEGA 3K5MA 3V81A 4Q0BA 4CIFA 4CK2A 1CZBA 3V9XA 1WAFA 5HBMA 3V9UA 1RDDA 3LPTA 3P1GA 4DTMA 4JLHA 3PO4A 3U6FA 1VSMA 5SZTA 3LZIA 4CEEA 3TABA 3VQ6A 4CJVA 4J2BA 1HNVA 3OYAA 1JLFA 4ZTJA 3NBPA 2HMIA 1C1CA 2HB5A 4KTZA 3PX4A 3ZSRA 1N6QA 4E7HA 3IG1A 2HNYA 3NDKA 2FBVA 3MXIA 4C8KA 3C94A 1B92A 2EX3A 4FK4A 3VA0A 1KSPA 4FJKA 1WSGA 3NFAA 4N5SA 4O44A 4JS4A 1VSKA 3AO2A 4F3OA 4PQUA 3AO3A 2Z1GA 4CEOA 1U47A 4Z4GA 1RT7A 4LY7A 3WNGA 1KVCA 4BDZA 1KTQA 2HHUA 3ZT3A 2WONA 2XRIA 1JL2A 1BGXT 1IH7A 3WNEA 2OYQA 1TL1A 4J2DA 3SZ2A 4FM2A 1T8EA 4OLAA 1NJXA 3MXJA 4CJSA 1QSSA 3HL8A 3K5OA 2DFHA 3QNOA 3RR7A 4K8ZA 4ICLA 3O3FA 4H8KA 1NJWA 5JS1A 2DFFA 4CJLA 1JLEA 3OYCA 3HVRA 3QEIA 1SUQA 5KTQA 1HQUA 2JLEA 5C25A 1F21A 3DYAA 1C1BA 1EX4A 4B9NA 4B9SA 1LWFA 1RTHA 4CIEA 4MQ3A 3CFRA 5J2QA 3VQ8A 2KZMA 5FRNA 3CYMA 2YNIA 4NCGA 4IG0A 4RG8A 3OY9A 1TK5A 4B3OA 4CESA 4CJFA 4FJXA 4B8AB 3TAFA 2ZQBA 4OKEA 3QEWA 3THVA 3V1RA 4FLVA 1NK9A 3SUQA 3S3OA 3AVJA 1UAXA 4AHSA 3ZSZA 3AVNA 1D8YA 4KREA 3PX0A 3T3FA 3SV4A 3EZ5A 1GOAA 1WSFA 4FLWA 2HHXA 1J9AA 2DY4A 4Z0UA 2VWKA 4WE1A 4KI4A 4DQSA 4O5BA 4KI6A 3H08A 2RF2A 1WN7A 4CHYA 4NYNA 1HYVA 3T1AA 1Q9XA 4DSIA 1BQNA 1FKOA 3DMJA 4DS5A 1G15A 1XI1A 4PWDA 4PUOA 4F8RA 4F3TA 1IKVA 2AJQA 1W0HA 3NH1A 1JLGA 5K14A 4FZXC 2KZZA 3AA4A 3DOLA 1O1WA 3SUPA 3TAPA 3VQ9A 4CF8A 2F8TA 4AHTA 3L3VA 4DFKA 3L2VA 1CZ9A 3DLHA 2HHTA 3NE6A 4DF8A 1Q8IA 1IKWA 2ZE2A 3LAKA 3VQBA 3O3HA 4FZZA 3L2UA 2HNDA 3JYTA 3SPYA 3HK2A 1J54A 3PUFA 4CECA 4DQIA 3OJUA 3HPHA 2P5OA 3OS1A 3LWLA 3AVCA 3HM9A 2XY8A 2BDPA 3KK1A 2IOCA 1ZBLA 4DU1A 4F2SA 1GOCA 1U45A 1S1WA 3KK2A 3DRPA 3RTVA 3EY1A 4DTUA 1C0UA 4CERA 3RRHA 4YFUA 1NOZA 1NK4A 3TAMA 3K59A 2YHAA 3AVHA 3ASMA 1JXBA 3SPZA 4DSKA 4BACA 3KLFA 3D0PA 1JLCA 4FJIA 3TAQA 5CZ2A 1JLQA 2FC0A 4M3TA 1HYSA 3DOKA 4AHCA 3TARA 2HNZA 3NGYA 1FXXA 1WLJA 2ATQA 4C8NA 4LH5A 3SQ0A 1U48A 1L3UA 1LAWA 4HCBA 4FVMA 1RILA 3BGRA 3V9SA 2YNFA 4AHVA 4CIGA 2Z1HA 4CJPA 2YKNA 4YNQA 3AV9A 4E1MA 4DU4A 3NF7A 5FDLA 4O0IA 4ELUA 2Q3SA 3VQCA 3NHGA 4M3YA 4EP4A 1SL0A 1RBTA 2VG5A 3LP3A 2D0CA 3QLHA 3OYNA 3OYKA 3P5JA 1HJRA 4IFYA 4O55A 1YVUA 2VG7A 4DFPA 3RMCA 2KQ2A 4B9UA 1KLMA 3ZCMA 1KVAA 2B5JA 3IRXA 1RBVA 1S6QA 4CJ3A 4M45A 3AVBA 4HUGA 1NKEA 4M3RA 1NOYA 5KRTA 4ELVA 2QK9A 1ZBFA 2G8FA 4CEBA 3KTQA 3DI6A 4ID1A 5CZ1A 1BIUA 3AVKA 3G10A 1R0AA 2QKBA 3SUOA 3ZT1A 3ZSYA 4LSLA 5CY4A 4W5QA 1HQEA 4BDPA 4HHTA 4F4KA 2Z1JA 4IFVA 3SCXA 2FBXA 3QIOA 3HP6A 3MAQA 2JGUA 4XIUA 1T7PA 2YNHA 3OYGA 3SUNA 3ULDA 4CHNA 3SV3A 1BQMA 3KK3A 4CJUA 4W5RA 1WAJA 2QXFA 3AVAA 3ZT2A 2B6AA 4MFBA 4CGGA 3PX6A 3LANA 3QO9A 2FBTA 3HSTB 3FFIA 1U4BA 1KVBA 4CHOA 4KKOA 4LD0A 3TAGA 1REVA 4Q5VA 1EKEA 3LALA 1VRTA 4FJ7A 1N5YA 3S3MA 4CEQA 4Z4EA 2B4JA 4N56A 4OGEA 3PY8A 1J5OA 1ASWA 3ZSXA 3AVLA 2FBYA 1WSJA 4E7IA 4DTJA 1IO2A 2GBZA 3L2QA 4EZ6A 4HCCA 4OKKA 4CGIA 4KB0A 4J2AA 3LP1A 4FK2A 1LW2A 4DTSA 3HJFA 3AVIA 2X78A 1S1TA 1JLAA 3ZSOA 3V4IA 4B9TA 1TVRA 2OZMA 5I42A 3ZT4A 1VSLA 3I0RA 4FLTA 3KLIA 1S5JA 3QERA 5I3UA 2G8KA 5T7BA 3LPUA 1FK9A 3PO5A 3KLHA 3OYDA 3VQEA 1S9EA 4DMNA 4E7LA 4I2QA 2IC3A 4CJ5A 3ALYA 2O4IA 1T05A 3AVFA 4NCAA 4B9MA 1UWBA 5HRSA 1ZYQA 2YV0X 2IGIA 3QINA 3JSMA 4CF2A 4DFMA 1FKPA 3VQPA 4HVJA 4DF4A 4CCHA 1C6VA 1HNIA 3NGIA 4M42A 4DQPA 3V1OA 4FJMA 1MU2A 3MXMA 3AVGA 3G0ZA 1QS4A 4AILC 3V6DA 4FXDA 1X1PA 4CEZA 3C6UA 3OJSA 3CQ8A 2WOMA 3HO1A 3I0SA 4KHYA 2PYJA 4AHUA 1KRPA 4FJ8A 2EHGA 4CJ4A 4O0JA 3DRSA 4IKFA 2X74A 3OVNA 1LWCA 3OYIA 4FYDA 1TGOA 3NH2A 1ZBUA 3L8BA 3VQAA 4C8MA 4CEDA 1YTAA 4FJHA 1HPZA 4DG1A 3QESA 2HHWA 2GUIA 4CHQA 3IAYA 4FJJA 1A5WA 2KW4A 5FROA 2PZSA 4DU3A 4TSXA 1RT1A 3AO5A 3ZSWA 4CJTA 4DSFA 3SQ2A 3HXMA 4DTNA 1SKRA 4GW6A 3VQ4A 4KHUA 5HRPA 3TAEA 1JXEA 4FZYA 3VA3A 4DTRA 4DFJA 4J2EA 1BHLA 1QQCA 2F96A 2O4GA 5FRMA 4CEFA 4CJQA 1KFSA 3RWUA 3LWMA 3CFPA 1B9FA 3VQ7A 3RMAA 3KD5E 4Y1CA 1Z25A 5KGWA 3PV8A 3HP9A 1RBUA 2GV9A 3AA3A 3DLRA 3O4NA 1S1XA 3L3UA 4FLYA 3B6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCM A;  1UOC A;  3ISN C;  4G1Q A;  2ETJ A;  4CF1 A;  1IG9 A;  1TKD A;  1JKH A;  2Z1I A;  1RCH A;  3QET A;  2G8W A;  1BIS A;  1DTT A;  3K2P A;  3TI0 A;  4C8O A;  4OPJ A;  4DQR A;  3SQ1 A;  1CLQ A;  1X9M A;  2BAN A;  1NK7 A;  2G8U A;  1TKX A;  4E0D A;  2A1R A;  4OLB A;  1RTI A;  3LP2 A;  1EXQ A;  1C0T A;  2P1J A;  1WNS A;  2RPI A;  4BDY A;  4FM1 A;  3QEP A;  3S9H A;  1L3V A;  2Y1J A;  3HT3 A;  3B6O A;  1WSI A;  3OYJ A;  1XWL A;  3LAM A;  4HTU A;  4M3X A;  2HVH A;  3V9Z A;  4W5N A;  4CJE A;  4FJG A;  1DTQ A;  1KCF A;  2HHS A;  4FM0 A;  4I9Q A;  4KTQ A;  4PY5 A;  4UQG A;  4OJR A;  4M3Z A;  1RT6 A;  3BDP A;  4DTX A;  3TWH A;  4EP5 A;  4M41 A;  4BE2 A;  1L5U A;  2G8H A;  4BE1 A;  3D45 A;  2BGG A;  4OPK A;  4KRF A;  3KLE A;  2RKI A;  1Z26 A;  3VQ5 A;  4B08 A;  4FK0 A;  5CYM A;  1HRH A;  1RT3 A;  1WSH A;  4W5O A;  2OA8 A;  3DLB A;  2OPP A;  3M8S A;  4CGJ A;  1JL1 A;  2IS3 A;  3RMD A;  4JRQ A;  3K57 A;  3M8R A;  5J2N A;  3QEV A;  1XC9 A;  1NK5 A;  4IDK A;  1QHT A;  1VSD A;  1XHX A;  1TK8 A;  2XY5 A;  4KHS A;  3C95 A;  1SL2 A;  1XHZ A;  1RTJ A;  4RW9 A;  3K5L A;  2NUB A;  4FLU A;  3MED A;  2P5G A;  3VQQ A;  4CJW A;  5HP1 A;  2OZS A;  5D3G A;  2D0A A;  3MEC A;  4RW6 A;  4RW8 A;  4CFC A;  5J2P A;  1TL3 A;  1CXU A;  4CK3 A;  1I3A A;  4FLZ A;  1S1V A;  3NCI A;  4FJN A;  2YKM A;  3DLE A;  5J2M A;  2E4L A;  1BI4 A;  5J1E A;  3V9W A;  4KAZ A;  1UA0 A;  2XY7 A;  2VWJ A;  4N41 A;  1TKZ A;  2X6S A;  4BWJ A;  4R5P A;  3ZT0 A;  3C6T A;  2YNG A;  1A5X A;  1QSY A;  1VSJ A;  1RT4 A;  5E41 A;  1X9S A;  3P83 D;  1BI4 B;  3CG7 A;  4DQQ A;  3QEX A;  1NK6 A;  4C8L A;  3OS2 A;  1LAV A;  3F9K A;  5HRR A;  5JS2 A;  3VQD A;  1Y97 A;  3K5N A;  2Y1I A;  5HLF A;  1LWE A;  3CFO A;  3M8Q A;  3O4Q A;  3U3Y A;  3SJJ A;  1IKY A;  2DFE A;  3AA5 X;  2X6N A;  4Z4H A;  4CF9 A;  5C42 A;  4DTP A;  4CHP A;  3SQ4 A;  3AA2 A;  5EU7 A;  3M8P A;  3TR8 A;  3AVM A;  3OYE A;  3QNN A;  3ITH A;  2R7Y A;  2PY5 A;  3T19 A;  1UA1 A;  2G8V A;  4DSJ A;  1ASV A;  4E1N A;  3RR8 A;  1RTD A;  1HYZ A;  3OYL A;  3AO4 A;  3OS0 A;  1X9W A;  4H4M A;  3SYZ A;  4FJ9 A;  5DMR A;  3CM6 A;  1YTU A;  3NF8 A;  4DSL A;  1L3T A;  3WNH A;  4HUF A;  1NJZ A;  1U04 A;  1D9D A;  4B9V A;  1K6Y A;  3A2F A;  1Q9Y A;  4AH9 A;  2DTU A;  4I7F A;  2PYL A;  2VG6 A;  1L3S A;  2QKK A;  4Z4I A;  1VSI A;  4JS5 A;  4DLG A;  1RDC A;  1TV6 A;  2OPS A;  3RMB A;  1VSH A;  4KHN A;  4M3W A;  1SV5 A;  4ZHR A;  1T03 A;  5CYQ A;  4M3U A;  4W5T A;  1B9D A;  1RBR A;  1RDB A;  4OKJ A;  1BL3 A;  4ZTF A;  1SKS A;  4E19 A;  1EET A;  4CGH A;  4K8X A;  1RT5 A;  1VK0 A;  1IKX A;  4OGC A;  2D0B A;  4LSN A;  3KKR A;  3KJV A;  4KV8 A;  3UIQ A;  3NF9 A;  3IS9 A;  4Y1D A;  3HPG A;  5KRS A;  4FJL A;  1EP4 A;  1RDA A;  3ZSQ A;  2A1S A;  4QAG A;  2HW3 A;  1D5A A;  2HHV A;  4N76 A;  4QOZ B;  4CE9 A;  3NF6 A;  4O4G A;  3HVT A;  3LDS A;  4CFA A;  4ELT A;  3HYF A;  3I8D A;  1D9F A;  4N47 A;  3S3N A;  4GMJ B;  3F73 A;  3DRR A;  2KFZ A;  2BE2 A;  1RT2 A;  2OPQ A;  1KLN A;  2HVI A;  2HHQ A;  4KB1 A;  3LZJ A;  1A5V A;  3WNF A;  4QCL A;  1CXQ A;  4DTO A;  4PA1 A;  3L2R A;  2OPR A;  1DLO A;  4H4O A;  3EYZ A;  1J53 A;  4KHW A;  4IBN A;  3NGZ A;  5KI6 A;  1TAQ A;  4HUE A;  4JRP A;  1I39 A;  5DK5 A;  3VN5 A;  4B8C A;  2XHB A;  3MEE A;  2IDO A;  4FCY A;  3LP0 A;  1ZBH A;  4RW4 A;  4Z4F A;  1KFD A;  1TK0 A;  4KFB A;  4OVL A;  1BIZ A;  1TKT A;  4AHR A;  4CGF A;  2XO7 A;  3L2W A;  3NAE A;  1GOB A;  4BE0 A;  4FW2 A;  4B9L A;  1S9G A;  4F2R A;  1VRU A;  2XY6 A;  3KIO A;  4CGD A;  4LH4 A;  4CJR A;  2RN2 A;  2G8I A;  2KTQ A;  1S6P A;  1NK0 A;  1U49 A;  4CFB A;  1QE1 A;  4FLX A;  4GVM A;  1QSL A;  1HMV A;  2P51 A;  4FW1 A;  2W42 A;  2YHB A;  5C24 A;  4DS4 A;  3E01 A;  4CJK A;  2E6L A;  1SL1 A;  4E7J A;  1LV5 A;  1RBS A;  1ITG A;  4RW7 A;  1C0M A;  3U3G A;  4DLE A;  4IG3 A;  5HRO A;  3KD1 E;  1TAU A;  1BCO A;  4KPY A;  1NKC A;  1NJY A;  4FJ5 A;  2D5R A;  4Z4C A;  1ZBI A;  1VSF A;  2I5J A;  3NH0 A;  4ID5 A;  4BWM A;  3OYF A;  2ITG A;  4EZ9 A;  1YT3 A;  3HPO A;  2LSN A;  1RNH A;  3SI6 A;  4L8R B;  5HRN A;  4CHZ A;  4NYF A;  4NCB A;  4DWI A;  4CEA A;  4CF0 A;  3DLG A;  1NK8 A;  4KHQ A;  3KLG A;  4CFD A;  4E89 A;  3DLK A;  1QTM A;  1NKB A;  3O3G A;  3TAN A;  3V1Q A;  1W9H A;  3K58 A;  2E6M A;  2IAJ A;  3OYB A;  1ASU A;  5SWM A;  3QIP A;  2F8S A;  3OYH A;  4I2P A;  3AO1 A;  1SKW A;  3RRG A;  2ZD1 A;  5KGX A;  4I9L A;  1WSE A;  1S1U A;  1C1A A;  1VSE A;  4E7K A;  1JLB A;  4DSE A;  1LW0 A;  3SNN A;  4CK1 A;  3DM2 A;  3KKS A;  3ZSV A;  3OYM A;  2KFN A;  4KTW A;  4KO0 A;  3CM5 A;  4E3S A;  3MEG A;  3K5M A;  3V81 A;  4Q0B A;  4CIF A;  4CK2 A;  1CZB A;  3V9X A;  1WAF A;  5HBM A;  3V9U A;  1RDD A;  3LPT A;  3P1G A;  4DTM A;  4JLH A;  3PO4 A;  3U6F A;  1VSM A;  5SZT A;  3LZI A;  4CEE A;  3TAB A;  3VQ6 A;  4CJV A;  4J2B A;  1HNV A;  3OYA A;  1JLF A;  4ZTJ A;  3NBP A;  2HMI A;  1C1C A;  2HB5 A;  4KTZ A;  3PX4 A;  3ZSR A;  1N6Q A;  4E7H A;  3IG1 A;  2HNY A;  3NDK A;  2FBV A;  3MXI A;  4C8K A;  3C94 A;  1B92 A;  2EX3 A;  4FK4 A;  3VA0 A;  1KSP A;  4FJK A;  1WSG A;  3NFA A;  4N5S A;  4O44 A;  4JS4 A;  1VSK A;  3AO2 A;  4F3O A;  4PQU A;  3AO3 A;  2Z1G A;  4CEO A;  1U47 A;  4Z4G A;  1RT7 A;  4LY7 A;  3WNG A;  1KVC A;  4BDZ A;  1KTQ A;  2HHU A;  3ZT3 A;  2WON A;  2XRI A;  1JL2 A;  1BGX T;  1IH7 A;  3WNE A;  2OYQ A;  1TL1 A;  4J2D A;  3SZ2 A;  4FM2 A;  1T8E A;  4OLA A;  1NJX A;  3MXJ A;  4CJS A;  1QSS A;  3HL8 A;  3K5O A;  2DFH A;  3QNO A;  3RR7 A;  4K8Z A;  4ICL A;  3O3F A;  4H8K A;  1NJW A;  5JS1 A;  2DFF A;  4CJL A;  1JLE A;  3OYC A;  3HVR A;  3QEI A;  1SUQ A;  5KTQ A;  1HQU A;  2JLE A;  5C25 A;  1F21 A;  3DYA A;  1C1B A;  1EX4 A;  4B9N A;  4B9S A;  1LWF A;  1RTH A;  4CIE A;  4MQ3 A;  3CFR A;  5J2Q A;  3VQ8 A;  2KZM A;  5FRN A;  3CYM A;  2YNI A;  4NCG A;  4IG0 A;  4RG8 A;  3OY9 A;  1TK5 A;  4B3O A;  4CES A;  4CJF A;  4FJX A;  4B8A B;  3TAF A;  2ZQB A;  4OKE A;  3QEW A;  3THV A;  3V1R A;  4FLV A;  1NK9 A;  3SUQ A;  3S3O A;  3AVJ A;  1UAX A;  4AHS A;  3ZSZ A;  3AVN A;  1D8Y A;  4KRE A;  3PX0 A;  3T3F A;  3SV4 A;  3EZ5 A;  1GOA A;  1WSF A;  4FLW A;  2HHX A;  1J9A A;  2DY4 A;  4Z0U A;  2VWK A;  4WE1 A;  4KI4 A;  4DQS A;  4O5B A;  4KI6 A;  3H08 A;  2RF2 A;  1WN7 A;  4CHY A;  4NYN A;  1HYV A;  3T1A A;  1Q9X A;  4DSI A;  1BQN A;  1FKO A;  3DMJ A;  4DS5 A;  1G15 A;  1XI1 A;  4PWD A;  4PUO A;  4F8R A;  4F3T A;  1IKV A;  2AJQ A;  1W0H A;  3NH1 A;  1JLG A;  5K14 A;  4FZX C;  2KZZ A;  3AA4 A;  3DOL A;  1O1W A;  3SUP A;  3TAP A;  3VQ9 A;  4CF8 A;  2F8T A;  4AHT A;  3L3V A;  4DFK A;  3L2V A;  1CZ9 A;  3DLH A;  2HHT A;  3NE6 A;  4DF8 A;  1Q8I A;  1IKW A;  2ZE2 A;  3LAK A;  3VQB A;  3O3H A;  4FZZ A;  3L2U A;  2HND A;  3JYT A;  3SPY A;  3HK2 A;  1J54 A;  3PUF A;  4CEC A;  4DQI A;  3OJU A;  3HPH A;  2P5O A;  3OS1 A;  3LWL A;  3AVC A;  3HM9 A;  2XY8 A;  2BDP A;  3KK1 A;  2IOC A;  1ZBL A;  4DU1 A;  4F2S A;  1GOC A;  1U45 A;  1S1W A;  3KK2 A;  3DRP A;  3RTV A;  3EY1 A;  4DTU A;  1C0U A;  4CER A;  3RRH A;  4YFU A;  1NOZ A;  1NK4 A;  3TAM A;  3K59 A;  2YHA A;  3AVH A;  3ASM A;  1JXB A;  3SPZ A;  4DSK A;  4BAC A;  3KLF A;  3D0P A;  1JLC A;  4FJI A;  3TAQ A;  5CZ2 A;  1JLQ A;  2FC0 A;  4M3T A;  1HYS A;  3DOK A;  4AHC A;  3TAR A;  2HNZ A;  3NGY A;  1FXX A;  1WLJ A;  2ATQ A;  4C8N A;  4LH5 A;  3SQ0 A;  1U48 A;  1L3U A;  1LAW A;  4HCB A;  4FVM A;  1RIL A;  3BGR A;  3V9S A;  2YNF A;  4AHV A;  4CIG A;  2Z1H A;  4CJP A;  2YKN A;  4YNQ A;  3AV9 A;  4E1M A;  4DU4 A;  3NF7 A;  5FDL A;  4O0I A;  4ELU A;  2Q3S A;  3VQC A;  3NHG A;  4M3Y A;  4EP4 A;  1SL0 A;  1RBT A;  2VG5 A;  3LP3 A;  2D0C A;  3QLH A;  3OYN A;  3OYK A;  3P5J A;  1HJR A;  4IFY A;  4O55 A;  1YVU A;  2VG7 A;  4DFP A;  3RMC A;  2KQ2 A;  4B9U A;  1KLM A;  3ZCM A;  1KVA A;  2B5J A;  3IRX A;  1RBV A;  1S6Q A;  4CJ3 A;  4M45 A;  3AVB A;  4HUG A;  1NKE A;  4M3R A;  1NOY A;  5KRT A;  4ELV A;  2QK9 A;  1ZBF A;  2G8F A;  4CEB A;  3KTQ A;  3DI6 A;  4ID1 A;  5CZ1 A;  1BIU A;  3AVK A;  3G10 A;  1R0A A;  2QKB A;  3SUO A;  3ZT1 A;  3ZSY A;  4LSL A;  5CY4 A;  4W5Q A;  1HQE A;  4BDP A;  4HHT A;  4F4K A;  2Z1J A;  4IFV A;  3SCX A;  2FBX A;  3QIO A;  3HP6 A;  3MAQ A;  2JGU A;  4XIU A;  1T7P A;  2YNH A;  3OYG A;  3SUN A;  3ULD A;  4CHN A;  3SV3 A;  1BQM A;  3KK3 A;  4CJU A;  4W5R A;  1WAJ A;  2QXF A;  3AVA A;  3ZT2 A;  2B6A A;  4MFB A;  4CGG A;  3PX6 A;  3LAN A;  3QO9 A;  2FBT A;  3HST B;  3FFI A;  1U4B A;  1KVB A;  4CHO A;  4KKO A;  4LD0 A;  3TAG A;  1REV A;  4Q5V A;  1EKE A;  3LAL A;  1VRT A;  4FJ7 A;  1N5Y A;  3S3M A;  4CEQ A;  4Z4E A;  2B4J A;  4N56 A;  4OGE A;  3PY8 A;  1J5O A;  1ASW A;  3ZSX A;  3AVL A;  2FBY A;  1WSJ A;  4E7I A;  4DTJ A;  1IO2 A;  2GBZ A;  3L2Q A;  4EZ6 A;  4HCC A;  4OKK A;  4CGI A;  4KB0 A;  4J2A A;  3LP1 A;  4FK2 A;  1LW2 A;  4DTS A;  3HJF A;  3AVI A;  2X78 A;  1S1T A;  1JLA A;  3ZSO A;  3V4I A;  4B9T A;  1TVR A;  2OZM A;  5I42 A;  3ZT4 A;  1VSL A;  3I0R A;  4FLT A;  3KLI A;  1S5J A;  3QER A;  5I3U A;  2G8K A;  5T7B A;  3LPU A;  1FK9 A;  3PO5 A;  3KLH A;  3OYD A;  3VQE A;  1S9E A;  4DMN A;  4E7L A;  4I2Q A;  2IC3 A;  4CJ5 A;  3ALY A;  2O4I A;  1T05 A;  3AVF A;  4NCA A;  4B9M A;  1UWB A;  5HRS A;  1ZYQ A;  2YV0 X;  2IGI A;  3QIN A;  3JSM A;  4CF2 A;  4DFM A;  1FKP A;  3VQP A;  4HVJ A;  4DF4 A;  4CCH A;  1C6V A;  1HNI A;  3NGI A;  4M42 A;  4DQP A;  3V1O A;  4FJM A;  1MU2 A;  3MXM A;  3AVG A;  3G0Z A;  1QS4 A;  4AIL C;  3V6D A;  4FXD A;  1X1P A;  4CEZ A;  3C6U A;  3OJS A;  3CQ8 A;  2WOM A;  3HO1 A;  3I0S A;  4KHY A;  2PYJ A;  4AHU A;  1KRP A;  4FJ8 A;  2EHG A;  4CJ4 A;  4O0J A;  3DRS A;  4IKF A;  2X74 A;  3OVN A;  1LWC A;  3OYI A;  4FYD A;  1TGO A;  3NH2 A;  1ZBU A;  3L8B A;  3VQA A;  4C8M A;  4CED A;  1YTA A;  4FJH A;  1HPZ A;  4DG1 A;  3QES A;  2HHW A;  2GUI A;  4CHQ A;  3IAY A;  4FJJ A;  1A5W A;  2KW4 A;  5FRO A;  2PZS A;  4DU3 A;  4TSX A;  1RT1 A;  3AO5 A;  3ZSW A;  4CJT A;  4DSF A;  3SQ2 A;  3HXM A;  4DTN A;  1SKR A;  4GW6 A;  3VQ4 A;  4KHU A;  5HRP A;  3TAE A;  1JXE A;  4FZY A;  3VA3 A;  4DTR A;  4DFJ A;  4J2E A;  1BHL A;  1QQC A;  2F96 A;  2O4G A;  5FRM A;  4CEF A;  4CJQ A;  1KFS A;  3RWU A;  3LWM A;  3CFP A;  1B9F A;  3VQ7 A;  3RMA A;  3KD5 E;  4Y1C A;  1Z25 A;  5KGW A;  3PV8 A;  3HP9 A;  1RBU A;  2GV9 A;  3AA3 A;  3DLR A;  3O4N A;  1S1X A;  3L3U A;  4FLY A;  3B6P A; 
#chains in the Genus database with same CATH topology
 1BCM A;  1Y64 A;  4BRL A;  3ISN C;  2P9L B;  2ETJ A;  2V7Z A;  2Z1I A;  3QET A;  1MA9 B;  3PSI A;  2G8W A;  4K25 A;  4F9O A;  5IT9 O;  1X9M A;  2A1R A;  5GIP A;  2EWS A;  5KPZ A;  3CMA N;  1N36 K;  2NRT A;  3B6O A;  1Q7Y O;  3OYJ A;  3A8Y A;  4PKG A;  3V9Z A;  4W5N A;  1VQO N;  2J4R A;  3M1F A;  4QS9 A;  1KCF A;  4BGA A;  4JD2 A;  4I9Q A;  4KTQ A;  4PY5 A;  4UQG A;  4UY8 O;  3J81 O;  4JKA A;  1L5U A;  4JD2 B;  3VET A;  4OPK A;  3CCL N;  4CZK A;  1VHX A;  4FK0 A;  5CYM A;  1WSH A;  3VTH A;  3M8S A;  1HNZ K;  4CGJ A;  3QB0 A;  4PKH A;  4JRQ A;  1V4S A;  4IDK A;  5BR8 K;  1XHX A;  4BR4 A;  5BR9 A;  1XHZ A;  4RW9 A;  3K5L A;  4DUY K;  5AQU A;  3U9D A;  2YHY A;  4CJW A;  5D3G A;  2D0A A;  3MEC A;  4RW8 A;  4AF1 A;  1CXU A;  1I3A A;  3CHW A;  3NCI A;  5EOY A;  2YKM A;  5F2R A;  4FVU A;  5M1K A;  4N41 A;  1TKZ A;  2X6S A;  1M90 O;  5AQP A;  3ZT0 A;  3OW2 M;  1C0G A;  1A5X A;  1QSY A;  1VSJ A;  2O8B A;  1X9S A;  3CG7 A;  3VTI A;  4IJA A;  3QEX A;  4CBX A;  4C8L A;  1LAV A;  2OAN A;  1NGH A;  2NNW A;  5JS2 A;  1Y97 A;  4BRG A;  3M3Z A;  4Z4H A;  2DFE A;  5C42 A;  2X6N A;  5AQO A;  2O8B B;  5FPM A;  3QNN A;  3EEQ A;  3WXK A;  4DSJ A;  3T19 A;  1ASV A;  4X66 K;  1XNQ K;  4L3Q A;  3MX5 A;  3CIP A;  5DMR A;  4JKE A;  1YTU A;  3NF8 A;  2IIR A;  1NGJ A;  2QWP A;  5M1N A;  5AQS A;  1Q9Y A;  4EIA A;  3N4P A;  4W5T A;  1B9D A;  1RBR A;  2I7P A;  4ZTF A;  4FWN A;  4CD1 A;  2UUB K;  3MN7 A;  5JMV A;  3CI5 A;  1G99 A;  2D0B A;  4MLE A;  5JLF A;  4KV8 A;  5C2D A;  3KJV A;  3P4I A;  3UIQ A;  3HPG A;  1EP4 A;  5E26 A;  1X9J A;  3ZSQ A;  3OTO K;  4N76 A;  2ZM6 K;  3NF6 A;  3LDS A;  4CFA A;  3HYF A;  2ZGY A;  3I8D A;  3THX A;  3FZK A;  1BO5 O;  3F73 A;  1J6Z A;  2OPQ A;  2HHQ A;  4KB1 A;  3THX B;  4FWO A;  5AQT A;  1CXQ A;  4DR6 K;  1J53 A;  1TAQ A;  1ILY A;  1I39 A;  3VN5 A;  3CCU N;  4RW4 A;  1KFD A;  3NAE A;  5AR0 A;  4BE0 A;  4FW2 A;  4B9L A;  1S9G A;  2XY6 A;  1QVG M;  4IEE A;  4WYB A;  1S6P A;  5ADX H;  4CFB A;  2W42 A;  2P51 A;  1SL1 A;  3E01 A;  1ZBS A;  4E7J A;  1LV5 A;  1RBS A;  4RW7 A;  3U3G A;  1TAU A;  4RWT A;  4KPY A;  1NKC A;  3WXL A;  1SZ2 A;  1YT3 A;  4JEP A;  3BZK A;  4L8R B;  4KH5 A;  4NYF A;  4DWI A;  1XMQ K;  3V1Q A;  3J8A A;  4DV1 K;  3K58 A;  2IAJ A;  3VF4 A;  4JI8 K;  1XC3 A;  3QIP A;  1RDU A;  3RRG A;  4I9L A;  2WUS A;  4E7K A;  1JLB A;  3SNN A;  3IFR A;  3DM2 A;  3KKS A;  4DR5 K;  3T1H K;  3CM5 A;  1VQ8 N;  4E3S A;  4BRA A;  1GLB G;  5HBM A;  3P1G A;  2FF6 A;  4CEE A;  3VQ6 A;  4J2B A;  1BA1 A;  5AQW A;  4E1J A;  3OYA A;  1JLF A;  4ZTJ A;  4CD3 A;  3O9Q A;  2HB5 A;  3ZSR A;  3MXI A;  3HOT A;  4C8K A;  2P9S A;  3ZYY X;  1WSG A;  4N5S A;  4LF9 K;  5AQK A;  3AO3 A;  4CEO A;  3E9O A;  2KKZ A;  2P9S B;  1IH7 A;  2XRI A;  1TL1 A;  4BRP A;  4AM7 A;  3SZ2 A;  5GIN A;  4OLA A;  1QSS A;  3HL8 A;  4H0T B;  5GAD P;  4K8Z A;  3O3F A;  2KLA A;  1NGI A;  1S72 N;  4CJL A;  1JLE A;  3OYC A;  5KTQ A;  2JLE A;  5C25 A;  1C1B A;  1EX4 A;  4CIE A;  3CFR A;  3VQ8 A;  3FZM A;  5FRN A;  4IG0 A;  3H45 C;  1NBW A;  1NGB A;  4BR5 A;  3TAF A;  2ZQB A;  3QEW A;  3V1R A;  4BQZ A;  1D8Y A;  3PX0 A;  3EZ5 A;  1WSF A;  2DY4 A;  4KI6 A;  3H08 A;  1QQM A;  5FPE A;  3T1A A;  2BH1 A;  1Q9X A;  3DMJ A;  3R1X A;  4PUO A;  2V51 B;  5E84 A;  5K14 A;  4JI5 K;  1NU0 A;  3IMX A;  3VQ9 A;  1YJW N;  5HOO A;  4DFK A;  3NE6 A;  4LF5 K;  1IKW A;  3VQB A;  3L2U A;  2HND A;  3SPY A;  4DQI A;  5M1O A;  3HPH A;  3OS1 A;  1ZBL A;  3UKU A;  5M1Q A;  1S1W A;  3RTV A;  4DTU A;  3J7A P;  1C0U A;  3HBT A;  3UKU B;  3K59 A;  2YHA A;  1EO1 A;  3FLC O;  4H0Y B;  1JLQ A;  2FC0 A;  2QTD A;  1HYS A;  2YHW A;  4J8F A;  4Z94 A;  3MN5 A;  3NGY A;  1FXX A;  4C8N A;  1U48 A;  1L3U A;  4CZG A;  1BDG A;  4CIG A;  4BR2 A;  1EQY A;  2ASO A;  4DU4 A;  5FDL A;  4ELU A;  1KAZ A;  2Q3S A;  3NHG A;  4EP4 A;  1YJ9 N;  3OYN A;  4O55 A;  3O9T A;  3D7E O;  4B1U B;  1YVU A;  4LFA K;  2E88 A;  3EE9 A;  1KVA A;  2B5J A;  3MX2 A;  4CJ3 A;  3TTD A;  2W6L A;  4BC5 A;  3CER A;  3AVK A;  5CY4 A;  3O4W A;  4HHT A;  1ZXO A;  3MAQ A;  1VQL N;  2JGU A;  3FZL A;  4DQ8 A;  4CHN A;  4JI1 K;  4W5R A;  3QO9 A;  3FFI A;  1U4B A;  4KKO A;  4C1N I;  1HR0 K;  5GIO A;  3DWL A;  5KQD A;  4OGE A;  1JCE A;  1JCG A;  3ZSX A;  2FBY A;  4E7I A;  1VQ9 N;  3FZH A;  4EZ6 A;  4JKG A;  4RTF D;  3L0Q A;  2A41 A;  3PLA A;  1VSL A;  1YF5 L;  4JKG B;  3KLI A;  4FL9 A;  1FK9 A;  4BRO A;  3VQE A;  1S9E A;  3T1Y K;  3U4L A;  4CJ5 A;  2IC3 A;  2O4I A;  4YOW A;  3KK7 A;  1UWB A;  2VGM A;  4K43 A;  4GV9 A;  2IGI A;  2NRZ A;  5BPM A;  1C6V A;  1HNI A;  3V1O A;  1MU2 A;  4CEZ A;  3I0S A;  4GKJ K;  4KHY A;  2PYJ A;  2QA4 N;  1DGK N;  4FYD A;  2CGJ A;  2OTJ N;  4FJH A;  3VEY A;  1NLV A;  3IAY A;  2E2P A;  5FRO A;  2PZS A;  4TSX A;  5AQH A;  4GW6 A;  3VA3 A;  1ESV A;  1KC8 O;  1KAX A;  4GY2 B;  2O4G A;  3KD5 E;  3RMA A;  4Y1C A;  3SAF A;  3WQT A;  4FOI A;  4QAG A;  1UOC A;  3M6G A;  4FWQ A;  5AFU H;  4G1Q A;  5F1X A;  4JI6 K;  1WB9 A;  1IG9 A;  5TKY A;  1TKD A;  3WXI A;  2ZJQ L;  1WBB A;  1BIS A;  3SBG A;  4C8O A;  1VQP N;  2BAN A;  1NK7 A;  1SS6 A;  4BRE A;  3LP2 A;  1EXQ A;  1WNS A;  2A6A A;  3TSU A;  1YHQ N;  2NRV A;  2Y1J A;  5C15 A;  1WSI A;  1XWL A;  1V4T A;  2UUA K;  1O13 A;  3FZF A;  1DTQ A;  1E4G T;  2HHS A;  4CZM A;  4BVO A;  1QZ5 A;  4OJR A;  3MMV A;  1RT6 A;  3BDP A;  4DTX A;  3C7N A;  3ATV A;  2NRR A;  4X64 K;  4LF6 K;  4W5O A;  1RT3 A;  2OA8 A;  3FE1 A;  2OPP A;  2P9K A;  3C7N B;  4MDB A;  3RMD A;  3M8R A;  5J2N A;  3QEV A;  4IOA L;  2VQE K;  1VSD A;  4BC4 A;  2XY5 A;  3C95 A;  2P9K B;  4FLU A;  3MED A;  2P5G A;  3VPZ A;  3T69 A;  2OZS A;  3O8M A;  2W6K A;  4CK3 A;  4BRC A;  4FLZ A;  4DR7 K;  1W97 L;  4NLB A;  2E4L A;  3G71 N;  1BI4 A;  5J1E A;  3V9W A;  1UA0 A;  3IUC A;  1WOQ A;  4FWR A;  5E41 A;  1BI4 B;  4IO8 A;  5B8H A;  3OS2 A;  5HRR A;  3K5N A;  2A42 A;  2HHV A;  5HLF A;  1LWE A;  4O5F A;  4OO1 J;  1IKY A;  3AA5 X;  4CF9 A;  4DTP A;  4CHP A;  5EU7 A;  3TR8 A;  4C23 A;  1K8K A;  3MCP A;  1P90 A;  1UA1 A;  2QWO A;  3VGM A;  3AO4 A;  3H46 O;  4BRQ A;  1K8K B;  1BUP A;  3G6E N;  3WNH A;  2UUC K;  2FSN A;  1K6Y A;  5A2Q O;  3A2F A;  4I7F A;  1TV6 A;  4KHN A;  4ZHR A;  1HKC A;  1T03 A;  5CYQ A;  5CHI A;  3CC7 N;  4OKJ A;  1SKS A;  1BL3 A;  2F9W A;  3ATU A;  4YDU C;  1EET A;  4CGH A;  4E19 A;  3SAH A;  1OH5 A;  4K8X A;  1RT5 A;  1VK0 A;  4LSN A;  4R79 A;  4Y1D A;  5KRS A;  4WF9 L;  4DB3 A;  5C2F A;  2A1S A;  1D5A A;  4O4G A;  3J7Z O;  1BA0 A;  3WT0 A;  3VGL A;  4N47 A;  3B8A X;  4GMJ B;  3R9P A;  4IJN A;  1BU6 O;  3DRR A;  3L4I A;  1NJI O;  1KLN A;  3H1V X;  3LZJ A;  1A5V A;  3WNF A;  3DJC A;  3D6R A;  5AQZ A;  1DLO A;  4H4O A;  5FPD A;  3NGZ A;  4JRP A;  4FCY A;  3LP0 A;  4KFB A;  1MWM A;  1BIZ A;  1TYQ A;  4F2R A;  3KIO A;  4CGD A;  3RVC A;  4CJR A;  1IBM K;  4CJ7 A;  3CQY A;  2KTQ A;  1TYQ B;  3LDQ A;  3EE8 A;  1QSL A;  4FW1 A;  2YHB A;  1VAZ A;  1XUP O;  4DLE A;  5HRO A;  3KD1 E;  2ITM A;  4PHT X;  4B3R K;  2D5R A;  3CJB A;  4DV2 K;  2I5J A;  4BWM A;  3OYF A;  5GAG P;  3HPO A;  2LSN A;  2F9T A;  5HRN A;  4CHZ A;  4NCB A;  4A61 A;  1NK8 A;  3DLK A;  1QTM A;  1HKB A;  3ENO A;  1QQO A;  2E6M A;  2Q97 A;  3IDH A;  3OYB A;  4I2P A;  3AO1 A;  4YOY A;  2ZD1 A;  4BQL A;  5KGX A;  1T6D A;  1R59 O;  2ZGZ A;  4B3T K;  4GV3 A;  2F7T A;  1GLD G;  3OYM A;  1YAG A;  3ID6 A;  3VES A;  3V81 A;  2NLX A;  3AAP A;  3PSF A;  2Q0U A;  4CK2 A;  1CZB A;  4JYA K;  1MWK A;  4JAX A;  3PO4 A;  3LZI A;  3HZ6 A;  3TAB A;  3GL1 A;  3DLL L;  1K9M O;  1HNV A;  1ATR A;  1C1C A;  4KTZ A;  1IG8 A;  1N6Q A;  2FBV A;  3IKM A;  1B92 A;  4FK4 A;  4BY9 C;  4FJK A;  4XH4 A;  4PQU A;  3O9R A;  3AO2 A;  3NMU A;  4H5W A;  4YDU A;  4LY7 A;  3P31 A;  1JL2 A;  5HL7 L;  4IOX A;  1SAZ A;  4LF8 K;  1EWR A;  3K9K A;  2DFH A;  4DV7 K;  4ICL A;  4H8K A;  1NJW A;  2ASM A;  1GLF O;  3UB5 A;  1SUQ A;  1J5E K;  1HNX K;  2O8D A;  1F21 A;  3DYA A;  4CW7 B;  2HBK A;  3AGR A;  1NGA A;  1RTH A;  4B9S A;  3C65 A;  1NG9 A;  2VWB A;  2YI1 A;  2YNI A;  2GEM A;  4NCG A;  2O8D B;  3P38 A;  4B8A B;  5LL6 Z;  3SUQ A;  3S3O A;  3AVN A;  3CJ9 A;  3TTF A;  5EVZ A;  4WE1 A;  4KI4 A;  3UE5 A;  2OCE A;  5DM6 L;  3CC4 N;  4CHY A;  1FKO A;  4PWD A;  2JWL A;  1Z6R A;  3MDQ A;  3I56 N;  4F8R A;  4F3T A;  1U2V A;  1W0H A;  3NH1 A;  5GAE P;  1BWF O;  3BF1 A;  4QS8 A;  3TAP A;  4CF8 A;  2F8T A;  4GVE A;  4AHT A;  3L2V A;  1CZ9 A;  1U2V B;  1Q8I A;  2ZE2 A;  3CCE N;  3HK2 A;  3H3O B;  3PUF A;  3OJU A;  4BRK A;  1RFQ A;  3LWL A;  1Q82 O;  3J7Y P;  3HM9 A;  3CET A;  3HOS A;  4F2S A;  2V52 B;  3DRP A;  4CER A;  3ASM A;  1JLC A;  5IWA K;  2WTU A;  4FJI A;  3TAQ A;  1M1K O;  2HNZ A;  2ATQ A;  3G4S N;  3SQ0 A;  4FVM A;  1NNE A;  3ZET A;  3OA9 A;  1NMD A;  4IFE A;  1T6C A;  4U7B A;  3KZB A;  3SMS A;  3EKU A;  5CR4 A;  4CZF A;  3ZET B;  5AQL A;  1SL0 A;  4FXD A;  3LP3 A;  4JN4 A;  3TU5 A;  2D0C A;  2WBN A;  3QIC A;  5AQJ A;  3P5J A;  4BRF A;  3RMC A;  5LMU K;  3ENH A;  3ZCM A;  4RCH A;  4MO5 A;  1S6Q A;  3AVB A;  4ELV A;  1IBL K;  4JI7 K;  2QK9 A;  4BR0 A;  3W3D A;  2G8F A;  5M1P A;  3KTQ A;  3DI6 A;  3LM2 A;  4ID1 A;  3ZX3 A;  5CZ1 A;  1ATN A;  1BIU A;  3G10 A;  5JVH L;  2F4V K;  2QKB A;  1SQK A;  3SUO A;  3CJ1 A;  4LSL A;  1HQE A;  1YIJ N;  4F4K A;  3SCX A;  3HP6 A;  4ISG A;  2NRW A;  3OYG A;  4WCE L;  3PIO L;  3ULD A;  3KK3 A;  3GBT A;  4CJU A;  4CZE A;  1WAJ A;  2QXF A;  3AVA A;  3ZT2 A;  1N8R O;  4G9Z A;  4CGG A;  2NRX A;  2FBT A;  4LD0 A;  1XQS C;  1N5Y A;  4CEQ A;  2JWK A;  2B4J A;  3MCA B;  4Z4E A;  1ASW A;  4DTJ A;  3L2Q A;  4OKK A;  4CGI A;  3O80 A;  3SBT A;  3O6W A;  1JLA A;  2CH5 A;  2HOE A;  3VF6 A;  5I42 A;  3TTC A;  3ZT4 A;  4FLT A;  5MLC Q;  5T7B A;  1NGD A;  3LPU A;  3PO5 A;  3KLH A;  5BRE A;  3S41 A;  1LOT B;  1IV0 A;  1T05 A;  2HF4 A;  4NCA A;  5HRS A;  4H0O A;  3JSM A;  4CCH A;  2WFB A;  4HVJ A;  1X3M A;  4FJM A;  5BPN A;  4NLC A;  3AVG A;  3G0Z A;  4NXM K;  4JKC A;  2WOM A;  1VQN N;  4AHU A;  2EHG A;  4O0J A;  1KD1 O;  3DRS A;  2X74 A;  1YUW A;  1TGO A;  4H5R A;  3QBX A;  3VQA A;  5EY4 A;  4C8M A;  1Q86 O;  4DG1 A;  2YCH A;  4CHQ A;  4FJJ A;  1A5W A;  4DU3 A;  3AO5 A;  4CJT A;  3SQ2 A;  4DSF A;  4PKI A;  4DTN A;  3TSQ A;  4KHU A;  2V7Y A;  2Q1N A;  3TAE A;  3QDK A;  1JXE A;  2E2Q A;  3HM8 A;  3KWG A;  4DTR A;  1QQC A;  1GLA G;  2F96 A;  4CJQ A;  3P39 A;  3VEW A;  3LWM A;  4BG8 A;  3CFP A;  4ISE A;  4LF4 K;  4BRD A;  3O4N A;  4FLY A;  3L3U A;  2YHX A;  3F2K A;  3LM9 A;  3ZX0 A;  4CF1 A;  4BC3 A;  2BTF A;  3TI0 A;  5KPT A;  4OPJ A;  2Q2R A;  4DQR A;  3SQ1 A;  1CLQ A;  3K0S A;  1CZA N;  1TKX A;  3NVM A;  2G8U A;  4OLB A;  1RTI A;  1HUX A;  4K41 A;  4BDY A;  3S9H A;  4GNI A;  4FM1 A;  1L3V A;  3BZC A;  1BOT O;  3L4Q A;  4HTU A;  4M3X A;  4MO4 A;  4CJE A;  3AAR A;  5AQF A;  3ZX2 A;  3R3L A;  2CH6 A;  3CJC A;  4DV6 K;  4BE2 A;  4BE1 A;  3D45 A;  4KRF A;  3KLE A;  2RKI A;  3VQ5 A;  4B08 A;  3VF2 A;  2VQF K;  3MN9 A;  4A5A A;  1NK5 A;  3A5N C;  4KHS A;  5AJ3 K;  1OH6 A;  1RTJ A;  4WFA L;  5HP1 A;  1VQK N;  2QWL A;  2P9U A;  4CFC A;  3QML A;  4RW6 A;  2QXL A;  1XMO K;  1S1V A;  3WXM B;  3DLE A;  5J2M A;  2P9U B;  3C6H A;  2XY7 A;  2VWJ A;  1TUY A;  4DR3 K;  2IVO A;  2FF3 B;  4OPA A;  4BWJ A;  4R5P A;  2YNG A;  3KVG A;  3R8E A;  1RT4 A;  3P83 D;  4DQQ A;  3F9K A;  3VQD A;  3O4Q A;  3O1W A;  4MLH A;  2I7N A;  3AA2 A;  2PY5 A;  3ITH A;  2R7Y A;  2G8V A;  4OPH A;  4E1N A;  1GLL O;  4H5N A;  3DAW A;  3RR8 A;  1OVY A;  1HYZ A;  3TSP A;  3U9Z A;  3OS0 A;  1X9W A;  4H4M A;  2FSJ A;  3SYZ A;  3CM6 A;  1L3T A;  4HUF A;  4CZI A;  5F0X A;  3T7Z A;  1D9D A;  1U04 A;  4AH9 A;  3CCR N;  2QKK A;  1VSI A;  4JS5 A;  1RDC A;  2AP1 A;  3RMB A;  3GDQ A;  1VSH A;  4WFN L;  1SV5 A;  1RDB A;  3JS6 A;  3CCM N;  4LFB K;  1OH7 A;  1HX1 A;  2YJF A;  1IKX A;  4OGC A;  2UXC K;  4EHT A;  4FJL A;  3O08 A;  2HW3 A;  4QOZ B;  4CE9 A;  1S22 A;  3HVT A;  1OH8 A;  4JV5 K;  2KFZ A;  1RT2 A;  3KWI A;  4CBW A;  3FFK B;  1I94 K;  3L2R A;  2OPR A;  3EYZ A;  4KHW A;  4IBN A;  5DK5 A;  2XHB A;  4IOC L;  3MEE A;  1NGF A;  4OVL A;  3ZEU A;  4AHR A;  2XO7 A;  1GOB A;  3CXC M;  2RN2 A;  1VQ7 N;  2G8I A;  5AQY A;  3ZEU B;  1U49 A;  1QQN A;  1QE1 A;  4FLX A;  4GVM A;  1HMV A;  4DS4 A;  4CJK A;  2UYT A;  1WUA A;  1ITG A;  1C0M A;  4IG3 A;  1Q81 O;  1NJY A;  4FJ5 A;  4Z4C A;  3AY9 A;  4ID5 A;  2ITG A;  4EZ9 A;  3SI6 A;  4FPA A;  5TKW A;  4CEA A;  1HPM A;  4E89 A;  2E2O A;  2GEL A;  1U6Z A;  3TAN A;  2AA4 A;  4GV6 A;  1W7A A;  1ASU A;  5SWM A;  3SMP A;  4BR9 A;  4FO0 A;  1WSE A;  1S1U A;  1VSE A;  4XH5 A;  1LW0 A;  4CK1 A;  2KFN A;  2QWR A;  4KO0 A;  4JK9 A;  3K5M A;  4Q0B A;  4CIF A;  3QBW A;  3LL3 A;  5BN8 A;  3U6F A;  4JNE A;  4WQ4 C;  4CJV A;  1EWQ A;  2HMI A;  1N34 K;  3PX4 A;  3F9M A;  4E7H A;  3NDK A;  2D0P A;  3VA0 A;  1KSP A;  3A5O C;  3Q7B A;  4O44 A;  1VSK A;  2Z1G A;  1U47 A;  1RT7 A;  3WNG A;  4BDZ A;  1HKG A;  2HHU A;  3ZT3 A;  2WON A;  1BGX T;  3WNE A;  2OYQ A;  3BP8 A;  1NWK A;  5BRD A;  4FM2 A;  3TPQ A;  1T8E A;  3K5O A;  3RR7 A;  3JXU A;  3THY A;  4CZL A;  1T3V A;  3K9J A;  3HVR A;  3QEI A;  4JI2 K;  4LFC K;  1HQU A;  3NVK A;  1IJJ A;  4LF7 K;  1LWF A;  5J2Q A;  5FPN A;  1NMN A;  2E1Z A;  3THY B;  3CYM A;  2KZM A;  3OY9 A;  4B3O A;  4CES A;  4CJF A;  4FJX A;  4OKE A;  1E4F T;  4DKW A;  2O8F A;  3AVJ A;  5BN9 A;  3ZSZ A;  4KRE A;  3HSC A;  1HLU A;  3EZW A;  1HJO A;  1GOA A;  1J9A A;  2O8F B;  2VWK A;  1DT9 A;  4DQS A;  4O5B A;  2RF2 A;  5AZJ A;  1ATS A;  1HYV A;  4DSI A;  3N4Q A;  3HTV A;  1XI1 A;  4DS5 A;  1G15 A;  3JAM O;  2D4W A;  3CF5 L;  4IO9 L;  3AAQ A;  1JLG A;  3H3N O;  5AZJ B;  2NRH A;  2KZZ A;  3DOL A;  1O1W A;  1VQ6 N;  3G25 A;  3DLH A;  3O3H A;  4FZZ A;  3BF3 A;  3WUH A;  4CEC A;  3I55 N;  3VEO A;  1GOC A;  4M7X A;  1T44 A;  3EY1 A;  2ZJR L;  3CD6 N;  3RRH A;  1QHA A;  3CC2 N;  1NK4 A;  1NGE A;  3AVH A;  1JXB A;  3SPZ A;  4BAC A;  2DPN A;  5LJV A;  3D0P A;  2NZT A;  5CZ2 A;  3WEE A;  3CPW M;  3VGK A;  3TAR A;  1WLJ A;  4LH5 A;  4JI3 K;  1RIL A;  3BGR A;  4FWM A;  3V9S A;  2YNF A;  3J80 O;  3WEE B;  4YY3 K;  5AQR A;  4KHP K;  2YKN A;  5AQN A;  4JI0 K;  3NF7 A;  1LCU A;  4O0I A;  1GLC G;  4WQ4 A;  3EKS A;  1RBT A;  2VCP A;  2VG5 A;  3OYK A;  3QLH A;  3CCV N;  4IFY A;  2VG7 A;  4QS7 A;  2Q0R A;  4DFP A;  2HHH K;  2HST A;  4B9U A;  3IRX A;  1RBV A;  1KQS M;  4M45 A;  4HUG A;  3M5R A;  4M3R A;  1ZBF A;  5BRF A;  2A3Z A;  3HI0 A;  3MWP A;  1Z05 A;  3MWT A;  4KH6 A;  4A2A A;  2QI2 A;  3ZT1 A;  2FXU A;  4DV3 K;  4BDP A;  2Z1J A;  1KXP A;  4IFV A;  3QIO A;  4ISF A;  1DKG D;  2HF3 A;  3SV3 A;  4MFB A;  3PX6 A;  3LAN A;  3HST B;  2ZJP L;  1K8A O;  4LC9 B;  4FJ7 A;  4N56 A;  3PY8 A;  1J5O A;  1WSJ A;  4K42 A;  1IO2 A;  2ZWH A;  2GBZ A;  3HRG A;  2GUP A;  4A2B A;  4ILG B;  4M63 C;  4IXC A;  4J2A A;  4FK2 A;  1S1T A;  2X78 A;  3AVI A;  4B9T A;  1TVR A;  3VEX A;  3W0L A;  2O8E A;  3THW A;  3QER A;  3BY5 A;  3OYD A;  4DMN A;  3LDP A;  2O8E B;  3THW B;  3MK6 A;  3ALY A;  3AVF A;  5ADX A;  2YV0 X;  3CCQ N;  4DFM A;  3VEV A;  4B3S K;  3NGI A;  4M42 A;  4DQP A;  2QWQ A;  4WQ5 C;  2GWK A;  1IBK K;  4AIL C;  3V6D A;  3C6U A;  3OJS A;  3CQ8 A;  3HO1 A;  2Q36 A;  4EHU A;  4CJ4 A;  1N33 K;  3A5L C;  3OVN A;  3OYI A;  4H5T A;  4BRH A;  3NH2 A;  1ZBU A;  4HTL A;  3VER A;  3SLC A;  2HHW A;  4HWI A;  2GUI A;  4BGB A;  4FSV A;  2VYP A;  1RT1 A;  3HXM A;  4XH1 A;  5BPL A;  4DFJ A;  3ID8 A;  3I8B A;  1VQ5 N;  5FRM A;  3LDN A;  4CEF A;  1KFS A;  2UU9 K;  1B9F A;  4ILJ A;  3VQ7 A;  3PV8 A;  3HP9 A;  2GV9 A;  3DLR A;  3A0I X;  3B6P A;  3I33 A;  1JKH A;  1RCH A;  1DTT A;  3K2P A;  4CVN E;  3D2E A;  4E0D A;  4BR7 A;  1C0T A;  2P9P A;  2P1J A;  2RPI A;  3QEP A;  4IZ9 A;  2UXB K;  3D2E B;  3HT3 A;  2RHK A;  3BUZ B;  3O1B A;  3LAM A;  2HVH A;  1FJG K;  2P9P B;  4FJG A;  4JI4 K;  4FM0 A;  3VEZ A;  2PAV A;  1GLJ O;  2IVN A;  4M3Z A;  3TWH A;  4EP5 A;  4M41 A;  2BGG A;  2G8H A;  1YJN N;  3MN6 A;  4YOT A;  1TUU A;  1Z26 A;  2W40 A;  1HRH A;  3DLB A;  1JL1 A;  2IS3 A;  3K57 A;  4EFH A;  1XC9 A;  2E2N A;  1QHT A;  1TK8 A;  2CGK A;  1SL2 A;  2NUB A;  2FSK A;  2HBL A;  3VQQ A;  5J2P A;  1TL3 A;  4KH4 A;  1C0F A;  4FJN A;  2D0O A;  4KAZ A;  5JVG L;  4JK8 A;  3BEX A;  3CPE A;  3C6T A;  4DV0 K;  4M7Y A;  1NK6 A;  3SK3 A;  2Y1I A;  4YOR A;  4DHY A;  3CFO A;  3M8Q A;  3U3Y A;  3SJJ A;  3SQ4 A;  4WQ5 A;  3QFU A;  3M8P A;  3AVM A;  4BRN A;  5M1F A;  3OYE A;  2E5L K;  5C12 A;  1RTD A;  3OYL A;  5AQQ A;  3A5M C;  4FJ9 A;  2ZF5 O;  4DSL A;  1NJZ A;  4B9V A;  3FGU A;  4CI6 A;  2DTU A;  2PFU A;  2HMP A;  2PYL A;  2VG6 A;  1L3S A;  4Z4I A;  4DLG A;  2OPS A;  4M3W A;  4M3U A;  4FWP A;  4JKH A;  5LJW A;  5AQG A;  3L6Q A;  1NGC A;  4U67 L;  3E9L A;  3EL2 A;  2FLO A;  5C0Y A;  3LDO A;  3KKR A;  4GKK K;  3NF9 A;  3IS9 A;  1K73 O;  2ASP A;  1NGG A;  1RDA A;  4DR2 K;  5I9E B;  4H0P A;  4ELT A;  4NB4 A;  1D9F A;  5LMN K;  2P9N A;  4FPB A;  3S3N A;  3EO3 A;  1OVQ A;  2BE2 A;  2HVI A;  4B1Z A;  2P9N B;  1X3N A;  4QCL A;  4O8K A;  2UXD K;  4DTO A;  4B1W B;  1VQ4 N;  4PA1 A;  2E8A A;  4JHD A;  2QWM A;  5KI6 A;  4HUE A;  4B8C A;  1ZBH A;  2IDO A;  1QZ6 A;  4Z4F A;  4YHH K;  1TK0 A;  2A40 A;  1TKT A;  4CGF A;  3L2W A;  3CCS N;  4JHD B;  1VRU A;  2QM1 A;  4LH4 A;  5DM7 L;  2YX6 A;  3RSE A;  1NK0 A;  4FWK A;  5ELZ A;  1QVF M;  4A62 A;  4X65 K;  5C24 A;  2E6L A;  3RSE B;  3VOV A;  1P8Z A;  4I6M A;  1BCO A;  1ZBI A;  1VSF A;  3NH0 A;  1RNH A;  4I6M B;  1RDW X;  3VEN A;  1NM1 A;  1JCF A;  4CF0 A;  3DLG A;  3WQU A;  3KLG A;  4DV4 K;  4CFD A;  4KHQ A;  3ZLJ A;  1NKB A;  3O3G A;  4B1V A;  2GTD A;  1W9H A;  3SAG A;  2CGL A;  2F8S A;  3OYH A;  5CE3 A;  1SKW A;  3F5T A;  5BRH A;  1C1A A;  4IDH A;  4DSE A;  1FW6 A;  3ZSV A;  1JJ2 M;  4KTW A;  1KAY A;  3MEG A;  3PIP L;  5JIC A;  3V9X A;  1WAF A;  2PBD A;  4Y0W A;  4X62 K;  3V9U A;  4DV5 K;  1RDD A;  3LPT A;  4DTM A;  4JLH A;  4YOX A;  1VSM A;  5SZT A;  4BVP A;  1VQM N;  4A59 A;  4MDA A;  5AQM A;  3NBP A;  2QEX N;  4JKF A;  5EX5 A;  4DR4 K;  1YVN A;  4DR1 K;  4CZJ A;  3IG1 A;  2HNY A;  3C6A A;  3C94 A;  2EX3 A;  2BUP A;  1OKJ A;  3NFA A;  4JS4 A;  4F3O A;  2W41 A;  4FWL A;  4B3M K;  1S3X A;  4Z4G A;  1KVC A;  1KTQ A;  3E66 A;  4J2D A;  4IWV A;  1NJX A;  3MXJ A;  4CJS A;  3QNO A;  3R6M A;  4DCH A;  4JKB A;  5C10 A;  2GX9 A;  2QWN A;  5JS1 A;  2DFF A;  3GOI A;  3KHY A;  4JKD A;  4IEI A;  5JLH A;  5AFU A;  3QFP A;  4CBU A;  2OTL N;  4B9N A;  1H1V A;  3E9P A;  4MQ3 A;  1WBD A;  4RG8 A;  1TK5 A;  5KPR A;  1Q18 A;  4FWS A;  3THV A;  1NK9 A;  4FLV A;  2HBM A;  1UAX A;  4AHS A;  3OHR A;  2D1K A;  3T3F A;  3SV4 A;  4FLW A;  2HHX A;  4BRI A;  4Z0U A;  1HNW K;  2YJE A;  2E20 A;  4K0K K;  1WN7 A;  4NYN A;  1BQN A;  4O8U A;  3CME N;  1IKV A;  2AJQ A;  3H1Q A;  4FZX C;  3AA4 A;  3SUP A;  3L3V A;  2HHT A;  4DF8 A;  4ILH A;  3LAK A;  5AQV A;  3JYT A;  1J54 A;  4B9Q A;  2P5O A;  3AVC A;  2XY8 A;  2BDP A;  3KK1 A;  4CZH A;  2IOC A;  4DU1 A;  1U45 A;  3KK2 A;  5AZI A;  3O9U A;  3D2F A;  4XEI A;  3E1Y A;  4YOV A;  4YFU A;  1NOZ A;  3TAM A;  5AZI B;  4DSK A;  3KLF A;  2E1Y A;  3D2F B;  4B1Y B;  3CQX A;  3EN9 A;  4M3T A;  3DOK A;  1MDU B;  4AHC A;  2H3G X;  4HCB A;  1LAW A;  4A57 A;  1GLE G;  2WC9 A;  4AHV A;  3ENB A;  3OBW A;  2Z1H A;  4CJP A;  3ULE A;  1RGI A;  3AV9 A;  4C1N K;  4YNQ A;  4E1M A;  3VQC A;  4WFB L;  2IVP A;  4M3Y A;  1HJR A;  3H6E A;  3ULE B;  4YOU A;  4V19 S;  5FLX O;  2KQ2 A;  1KLM A;  5LY3 A;  3O9S A;  1NKE A;  1NOY A;  5KRT A;  4CEB A;  2A5X A;  5EXW A;  1ZC6 A;  1R0A A;  3ZSY A;  4W5Q A;  3OBY A;  3GG4 A;  2FBX A;  1T7P A;  5H1S Q;  4BC2 A;  2YNH A;  3Q7C A;  4XIU A;  3SUN A;  1BQM A;  3O5B A;  2B6A A;  3GE1 A;  3FR0 A;  3C0B A;  2KHO A;  4FOE A;  1KVB A;  4CHO A;  3TAG A;  1REV A;  4Q5V A;  1EKE A;  3CJA A;  1VRT A;  3LAL A;  2GWJ A;  3S3M A;  4BG9 A;  3AVL A;  2QW9 A;  4HCC A;  4OX9 K;  1DEJ A;  4H5V A;  3SJH A;  4KB0 A;  3CJ7 A;  3LP1 A;  1LW2 A;  4DTS A;  3HJF A;  1N32 K;  2OZM A;  3V4I A;  3ZSO A;  1E3M A;  3I0R A;  1YIT N;  1BG3 A;  1S5J A;  5I3U A;  4NO7 A;  2G8K A;  1W2B M;  3DXM A;  3UKR A;  1YXQ A;  2Q31 A;  4E7L A;  1YI2 N;  4I2Q A;  4PL8 A;  4DUZ K;  4B9M A;  3DXM B;  2RE2 A;  3U8X A;  3UKR B;  1ZYQ A;  3LDL A;  3QIN A;  3WXJ A;  4CF2 A;  5KQ8 A;  1FKP A;  3VQP A;  4DF4 A;  1XNR K;  3MXM A;  3CCJ N;  1QS4 A;  1X1P A;  3DXK A;  4NXN K;  2HBJ A;  1KRP A;  4FJ8 A;  4A5B A;  4IKF A;  1LWC A;  2P9I A;  3DXK B;  4AM6 A;  4KBO A;  4B1X B;  3L8B A;  4CED A;  1YTA A;  1HPZ A;  3QES A;  4AQY K;  2KW4 A;  2P9I B;  5AQX A;  3ZSW A;  4PL7 A;  4H0X B;  3VMF B;  3AGK A;  1SKR A;  3VQ4 A;  4BRM A;  5HRP A;  4FZY A;  5AQI A;  1BHL A;  5GAH P;  4J2E A;  2O8C A;  4EAH D;  3RWU A;  4H03 B;  2VGN A;  4JK7 A;  2P9L A;  2O8C B;  1Z25 A;  5KGW A;  1RBU A;  3AA3 A;  4H0V B;  1S1X A;  1D4X A; 
#chains in the Genus database with same CATH homology
 1BCM A;  1UOC A;  3ISN C;  4G1Q A;  2ETJ A;  4CF1 A;  1IG9 A;  1TKD A;  1JKH A;  2Z1I A;  1RCH A;  3QET A;  2G8W A;  1BIS A;  1DTT A;  3K2P A;  3TI0 A;  4C8O A;  4OPJ A;  4DQR A;  3SQ1 A;  1CLQ A;  1X9M A;  2BAN A;  1NK7 A;  2G8U A;  1TKX A;  4E0D A;  2A1R A;  4OLB A;  1RTI A;  3LP2 A;  1EXQ A;  1C0T A;  2P1J A;  1WNS A;  2RPI A;  4BDY A;  4FM1 A;  3QEP A;  3S9H A;  1L3V A;  2Y1J A;  3HT3 A;  3B6O A;  1WSI A;  3OYJ A;  1XWL A;  3LAM A;  4HTU A;  4M3X A;  2HVH A;  3V9Z A;  4W5N A;  4CJE A;  4FJG A;  1DTQ A;  1KCF A;  2HHS A;  4FM0 A;  4I9Q A;  4KTQ A;  4PY5 A;  4UQG A;  4OJR A;  4M3Z A;  1RT6 A;  3BDP A;  4DTX A;  3TWH A;  4EP5 A;  4M41 A;  4BE2 A;  1L5U A;  2G8H A;  4BE1 A;  3D45 A;  2BGG A;  4OPK A;  4KRF A;  3KLE A;  2RKI A;  1Z26 A;  3VQ5 A;  4B08 A;  4FK0 A;  5CYM A;  1HRH A;  1RT3 A;  1WSH A;  4W5O A;  2OA8 A;  3DLB A;  2OPP A;  3M8S A;  4CGJ A;  1JL1 A;  2IS3 A;  3RMD A;  4JRQ A;  3K57 A;  3M8R A;  5J2N A;  3QEV A;  1XC9 A;  1NK5 A;  4IDK A;  1QHT A;  1VSD A;  1XHX A;  1TK8 A;  2XY5 A;  4KHS A;  3C95 A;  1SL2 A;  1XHZ A;  1RTJ A;  4RW9 A;  3K5L A;  2NUB A;  4FLU A;  3MED A;  2P5G A;  3VQQ A;  4CJW A;  5HP1 A;  2OZS A;  5D3G A;  2D0A A;  3MEC A;  4RW6 A;  4RW8 A;  4CFC A;  5J2P A;  1TL3 A;  1CXU A;  4CK3 A;  1I3A A;  4FLZ A;  1S1V A;  3NCI A;  4FJN A;  2YKM A;  3DLE A;  5J2M A;  2E4L A;  1BI4 A;  5J1E A;  3V9W A;  4KAZ A;  1UA0 A;  2XY7 A;  2VWJ A;  4N41 A;  1TKZ A;  2X6S A;  4BWJ A;  4R5P A;  3ZT0 A;  3C6T A;  2YNG A;  1A5X A;  1QSY A;  1VSJ A;  1RT4 A;  5E41 A;  1X9S A;  3P83 D;  1BI4 B;  3CG7 A;  4DQQ A;  3QEX A;  1NK6 A;  4C8L A;  3OS2 A;  1LAV A;  3F9K A;  5HRR A;  5JS2 A;  3VQD A;  1Y97 A;  3K5N A;  2Y1I A;  5HLF A;  1LWE A;  3CFO A;  3M8Q A;  3O4Q A;  3U3Y A;  3SJJ A;  1IKY A;  2DFE A;  3AA5 X;  2X6N A;  4Z4H A;  4CF9 A;  5C42 A;  4DTP A;  4CHP A;  3SQ4 A;  3AA2 A;  5EU7 A;  3M8P A;  3TR8 A;  3AVM A;  3OYE A;  3QNN A;  3ITH A;  2R7Y A;  2PY5 A;  3T19 A;  1UA1 A;  2G8V A;  4DSJ A;  1ASV A;  4E1N A;  3RR8 A;  1RTD A;  1HYZ A;  3OYL A;  3AO4 A;  3OS0 A;  1X9W A;  4H4M A;  3SYZ A;  4FJ9 A;  5DMR A;  3CM6 A;  1YTU A;  3NF8 A;  4DSL A;  1L3T A;  3WNH A;  4HUF A;  1NJZ A;  1U04 A;  1D9D A;  4B9V A;  1K6Y A;  3A2F A;  1Q9Y A;  4AH9 A;  2DTU A;  4I7F A;  2PYL A;  2VG6 A;  1L3S A;  2QKK A;  4Z4I A;  1VSI A;  4JS5 A;  4DLG A;  1RDC A;  1TV6 A;  2OPS A;  3RMB A;  1VSH A;  4KHN A;  4M3W A;  1SV5 A;  4ZHR A;  1T03 A;  5CYQ A;  4M3U A;  4W5T A;  1B9D A;  1RBR A;  1RDB A;  4OKJ A;  1BL3 A;  4ZTF A;  1SKS A;  4E19 A;  1EET A;  4CGH A;  4K8X A;  1RT5 A;  1VK0 A;  1IKX A;  4OGC A;  2D0B A;  4LSN A;  3KKR A;  3KJV A;  4KV8 A;  3UIQ A;  3NF9 A;  3IS9 A;  4Y1D A;  3HPG A;  5KRS A;  4FJL A;  1EP4 A;  1RDA A;  3ZSQ A;  2A1S A;  4QAG A;  2HW3 A;  1D5A A;  2HHV A;  4N76 A;  4QOZ B;  4CE9 A;  3NF6 A;  4O4G A;  3HVT A;  3LDS A;  4CFA A;  4ELT A;  3HYF A;  3I8D A;  1D9F A;  4N47 A;  3S3N A;  4GMJ B;  3F73 A;  3DRR A;  2KFZ A;  2BE2 A;  1RT2 A;  2OPQ A;  1KLN A;  2HVI A;  2HHQ A;  4KB1 A;  3LZJ A;  1A5V A;  3WNF A;  4QCL A;  1CXQ A;  4DTO A;  4PA1 A;  3L2R A;  2OPR A;  1DLO A;  4H4O A;  3EYZ A;  1J53 A;  4KHW A;  4IBN A;  3NGZ A;  5KI6 A;  1TAQ A;  4HUE A;  4JRP A;  1I39 A;  5DK5 A;  3VN5 A;  4B8C A;  2XHB A;  3MEE A;  2IDO A;  4FCY A;  3LP0 A;  1ZBH A;  4RW4 A;  4Z4F A;  1KFD A;  1TK0 A;  4KFB A;  4OVL A;  1BIZ A;  1TKT A;  4AHR A;  4CGF A;  2XO7 A;  3L2W A;  3NAE A;  1GOB A;  4BE0 A;  4FW2 A;  4B9L A;  1S9G A;  4F2R A;  1VRU A;  2XY6 A;  3KIO A;  4CGD A;  4LH4 A;  4CJR A;  2RN2 A;  2G8I A;  2KTQ A;  1S6P A;  1NK0 A;  1U49 A;  4CFB A;  1QE1 A;  4FLX A;  4GVM A;  1QSL A;  1HMV A;  2P51 A;  4FW1 A;  2W42 A;  2YHB A;  5C24 A;  4DS4 A;  3E01 A;  4CJK A;  2E6L A;  1SL1 A;  4E7J A;  1LV5 A;  1RBS A;  1ITG A;  4RW7 A;  1C0M A;  3U3G A;  4DLE A;  4IG3 A;  5HRO A;  3KD1 E;  1TAU A;  1BCO A;  4KPY A;  1NKC A;  1NJY A;  4FJ5 A;  2D5R A;  4Z4C A;  1ZBI A;  1VSF A;  2I5J A;  3NH0 A;  4ID5 A;  4BWM A;  3OYF A;  2ITG A;  4EZ9 A;  1YT3 A;  3HPO A;  2LSN A;  1RNH A;  3SI6 A;  4L8R B;  5HRN A;  4CHZ A;  4NYF A;  4NCB A;  4DWI A;  4CEA A;  4CF0 A;  3DLG A;  1NK8 A;  4KHQ A;  3KLG A;  4CFD A;  4E89 A;  3DLK A;  1QTM A;  1NKB A;  3O3G A;  3TAN A;  3V1Q A;  1W9H A;  3K58 A;  2E6M A;  2IAJ A;  3OYB A;  1ASU A;  5SWM A;  3QIP A;  2F8S A;  3OYH A;  4I2P A;  3AO1 A;  1SKW A;  3RRG A;  2ZD1 A;  5KGX A;  4I9L A;  1WSE A;  1S1U A;  1C1A A;  1VSE A;  4E7K A;  1JLB A;  4DSE A;  1LW0 A;  3SNN A;  4CK1 A;  3DM2 A;  3KKS A;  3ZSV A;  3OYM A;  2KFN A;  4KTW A;  4KO0 A;  3CM5 A;  4E3S A;  3MEG A;  3K5M A;  3V81 A;  4Q0B A;  4CIF A;  4CK2 A;  1CZB A;  3V9X A;  1WAF A;  5HBM A;  3V9U A;  1RDD A;  3LPT A;  3P1G A;  4DTM A;  4JLH A;  3PO4 A;  3U6F A;  1VSM A;  5SZT A;  3LZI A;  4CEE A;  3TAB A;  3VQ6 A;  4CJV A;  4J2B A;  1HNV A;  3OYA A;  1JLF A;  4ZTJ A;  3NBP A;  2HMI A;  1C1C A;  2HB5 A;  4KTZ A;  3PX4 A;  3ZSR A;  1N6Q A;  4E7H A;  3IG1 A;  2HNY A;  3NDK A;  2FBV A;  3MXI A;  4C8K A;  3C94 A;  1B92 A;  2EX3 A;  4FK4 A;  3VA0 A;  1KSP A;  4FJK A;  1WSG A;  3NFA A;  4N5S A;  4O44 A;  4JS4 A;  1VSK A;  3AO2 A;  4F3O A;  4PQU A;  3AO3 A;  2Z1G A;  4CEO A;  1U47 A;  4Z4G A;  1RT7 A;  4LY7 A;  3WNG A;  1KVC A;  4BDZ A;  1KTQ A;  2HHU A;  3ZT3 A;  2WON A;  2XRI A;  1JL2 A;  1BGX T;  1IH7 A;  3WNE A;  2OYQ A;  1TL1 A;  4J2D A;  3SZ2 A;  4FM2 A;  1T8E A;  4OLA A;  1NJX A;  3MXJ A;  4CJS A;  1QSS A;  3HL8 A;  3K5O A;  2DFH A;  3QNO A;  3RR7 A;  4K8Z A;  4ICL A;  3O3F A;  4H8K A;  1NJW A;  5JS1 A;  2DFF A;  4CJL A;  1JLE A;  3OYC A;  3HVR A;  3QEI A;  1SUQ A;  5KTQ A;  1HQU A;  2JLE A;  5C25 A;  1F21 A;  3DYA A;  1C1B A;  1EX4 A;  4B9N A;  4B9S A;  1LWF A;  1RTH A;  4CIE A;  4MQ3 A;  3CFR A;  5J2Q A;  3VQ8 A;  2KZM A;  5FRN A;  3CYM A;  2YNI A;  4NCG A;  4IG0 A;  4RG8 A;  3OY9 A;  1TK5 A;  4B3O A;  4CES A;  4CJF A;  4FJX A;  4B8A B;  3TAF A;  2ZQB A;  4OKE A;  3QEW A;  3THV A;  3V1R A;  4FLV A;  1NK9 A;  3SUQ A;  3S3O A;  3AVJ A;  1UAX A;  4AHS A;  3ZSZ A;  3AVN A;  1D8Y A;  4KRE A;  3PX0 A;  3T3F A;  3SV4 A;  3EZ5 A;  1GOA A;  1WSF A;  4FLW A;  2HHX A;  1J9A A;  2DY4 A;  4Z0U A;  2VWK A;  4WE1 A;  4KI4 A;  4DQS A;  4O5B A;  4KI6 A;  3H08 A;  2RF2 A;  1WN7 A;  4CHY A;  4NYN A;  1HYV A;  3T1A A;  1Q9X A;  4DSI A;  1BQN A;  1FKO A;  3DMJ A;  4DS5 A;  1G15 A;  1XI1 A;  4PWD A;  4PUO A;  4F8R A;  4F3T A;  1IKV A;  2AJQ A;  1W0H A;  3NH1 A;  1JLG A;  5K14 A;  4FZX C;  2KZZ A;  3AA4 A;  3DOL A;  1O1W A;  3SUP A;  3TAP A;  3VQ9 A;  4CF8 A;  2F8T A;  4AHT A;  3L3V A;  4DFK A;  3L2V A;  1CZ9 A;  3DLH A;  2HHT A;  3NE6 A;  4DF8 A;  1Q8I A;  1IKW A;  2ZE2 A;  3LAK A;  3VQB A;  3O3H A;  4FZZ A;  3L2U A;  2HND A;  3JYT A;  3SPY A;  3HK2 A;  1J54 A;  3PUF A;  4CEC A;  4DQI A;  3OJU A;  3HPH A;  2P5O A;  3OS1 A;  3LWL A;  3AVC A;  3HM9 A;  2XY8 A;  2BDP A;  3KK1 A;  2IOC A;  1ZBL A;  4DU1 A;  4F2S A;  1GOC A;  1U45 A;  1S1W A;  3KK2 A;  3DRP A;  3RTV A;  3EY1 A;  4DTU A;  1C0U A;  4CER A;  3RRH A;  4YFU A;  1NOZ A;  1NK4 A;  3TAM A;  3K59 A;  2YHA A;  3AVH A;  3ASM A;  1JXB A;  3SPZ A;  4DSK A;  4BAC A;  3KLF A;  3D0P A;  1JLC A;  4FJI A;  3TAQ A;  5CZ2 A;  1JLQ A;  2FC0 A;  4M3T A;  1HYS A;  3DOK A;  4AHC A;  3TAR A;  2HNZ A;  3NGY A;  1FXX A;  1WLJ A;  2ATQ A;  4C8N A;  4LH5 A;  3SQ0 A;  1U48 A;  1L3U A;  1LAW A;  4HCB A;  4FVM A;  1RIL A;  3BGR A;  3V9S A;  2YNF A;  4AHV A;  4CIG A;  2Z1H A;  4CJP A;  2YKN A;  4YNQ A;  3AV9 A;  4E1M A;  4DU4 A;  3NF7 A;  5FDL A;  4O0I A;  4ELU A;  2Q3S A;  3VQC A;  3NHG A;  4M3Y A;  4EP4 A;  1SL0 A;  1RBT A;  2VG5 A;  3LP3 A;  2D0C A;  3QLH A;  3OYN A;  3OYK A;  3P5J A;  1HJR A;  4IFY A;  4O55 A;  1YVU A;  2VG7 A;  4DFP A;  3RMC A;  2KQ2 A;  4B9U A;  1KLM A;  3ZCM A;  1KVA A;  2B5J A;  3IRX A;  1RBV A;  1S6Q A;  4CJ3 A;  4M45 A;  3AVB A;  4HUG A;  1NKE A;  4M3R A;  1NOY A;  5KRT A;  4ELV A;  2QK9 A;  1ZBF A;  2G8F A;  4CEB A;  3KTQ A;  3DI6 A;  4ID1 A;  5CZ1 A;  1BIU A;  3AVK A;  3G10 A;  1R0A A;  2QKB A;  3SUO A;  3ZT1 A;  3ZSY A;  4LSL A;  5CY4 A;  4W5Q A;  1HQE A;  4BDP A;  4HHT A;  4F4K A;  2Z1J A;  4IFV A;  3SCX A;  2FBX A;  3QIO A;  3HP6 A;  3MAQ A;  2JGU A;  4XIU A;  1T7P A;  2YNH A;  3OYG A;  3SUN A;  3ULD A;  4CHN A;  3SV3 A;  1BQM A;  3KK3 A;  4CJU A;  4W5R A;  1WAJ A;  2QXF A;  3AVA A;  3ZT2 A;  2B6A A;  4MFB A;  4CGG A;  3PX6 A;  3LAN A;  3QO9 A;  2FBT A;  3HST B;  3FFI A;  1U4B A;  1KVB A;  4CHO A;  4KKO A;  4LD0 A;  3TAG A;  1REV A;  4Q5V A;  1EKE A;  3LAL A;  1VRT A;  4FJ7 A;  1N5Y A;  3S3M A;  4CEQ A;  4Z4E A;  2B4J A;  4N56 A;  4OGE A;  3PY8 A;  1J5O A;  1ASW A;  3ZSX A;  3AVL A;  2FBY A;  1WSJ A;  4E7I A;  4DTJ A;  1IO2 A;  2GBZ A;  3L2Q A;  4EZ6 A;  4HCC A;  4OKK A;  4CGI A;  4KB0 A;  4J2A A;  3LP1 A;  4FK2 A;  1LW2 A;  4DTS A;  3HJF A;  3AVI A;  2X78 A;  1S1T A;  1JLA A;  3ZSO A;  3V4I A;  4B9T A;  1TVR A;  2OZM A;  5I42 A;  3ZT4 A;  1VSL A;  3I0R A;  4FLT A;  3KLI A;  1S5J A;  3QER A;  5I3U A;  2G8K A;  5T7B A;  3LPU A;  1FK9 A;  3PO5 A;  3KLH A;  3OYD A;  3VQE A;  1S9E A;  4DMN A;  4E7L A;  4I2Q A;  2IC3 A;  4CJ5 A;  3ALY A;  2O4I A;  1T05 A;  3AVF A;  4NCA A;  4B9M A;  1UWB A;  5HRS A;  1ZYQ A;  2YV0 X;  2IGI A;  3QIN A;  3JSM A;  4CF2 A;  4DFM A;  1FKP A;  3VQP A;  4HVJ A;  4DF4 A;  4CCH A;  1C6V A;  1HNI A;  3NGI A;  4M42 A;  4DQP A;  3V1O A;  4FJM A;  1MU2 A;  3MXM A;  3AVG A;  3G0Z A;  1QS4 A;  4AIL C;  3V6D A;  4FXD A;  1X1P A;  4CEZ A;  3C6U A;  3OJS A;  3CQ8 A;  2WOM A;  3HO1 A;  3I0S A;  4KHY A;  2PYJ A;  4AHU A;  1KRP A;  4FJ8 A;  2EHG A;  4CJ4 A;  4O0J A;  3DRS A;  4IKF A;  2X74 A;  3OVN A;  1LWC A;  3OYI A;  4FYD A;  1TGO A;  3NH2 A;  1ZBU A;  3L8B A;  3VQA A;  4C8M A;  4CED A;  1YTA A;  4FJH A;  1HPZ A;  4DG1 A;  3QES A;  2HHW A;  2GUI A;  4CHQ A;  3IAY A;  4FJJ A;  1A5W A;  2KW4 A;  5FRO A;  2PZS A;  4DU3 A;  4TSX A;  1RT1 A;  3AO5 A;  3ZSW A;  4CJT A;  4DSF A;  3SQ2 A;  3HXM A;  4DTN A;  1SKR A;  4GW6 A;  3VQ4 A;  4KHU A;  5HRP A;  3TAE A;  1JXE A;  4FZY A;  3VA3 A;  4DTR A;  4DFJ A;  4J2E A;  1BHL A;  1QQC A;  2F96 A;  2O4G A;  5FRM A;  4CEF A;  4CJQ A;  1KFS A;  3RWU A;  3LWM A;  3CFP A;  1B9F A;  3VQ7 A;  3RMA A;  3KD5 E;  4Y1C A;  1Z25 A;  5KGW A;  3PV8 A;  3HP9 A;  1RBU A;  2GV9 A;  3AA3 A;  3DLR A;  3O4N A;  1S1X A;  3L3U A;  4FLY A;  3B6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...