3TWHA

Selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain d132n mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Novel complex MAD phasing and RNase H structural insights using selenium oligonucleotides.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 41
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3twhA00
1I39A 1HYZA 2YNHA 1IKXA 1RT2A 1BIUA 3G0ZA 1ZYQA 1RTHA 4CCHA 1RT4A 1U04A 3ZT0A 4KTWA 3NGIA 4DSFA 3CYMA 4F8RA 1VSMA 5HRPA 3OY9A 4I9LA 3NE6A 3HVTA 4QAGA 2HHTA 4JRQA 1KSPA 1NJYA 1TK5A 4FLYA 3ZSZA 3ZSOA 1QSYA 4F2RA 3RMAA 4M3RA 3ZT1A 1C1BA 5C42A 4DU4A 1W0HA 3AO2A 3IRXA 3PUFA 5HBMA 4CFCA 1CXQA 2A1SA 1MU2A 1UWBA 3L3VA 4PA1A 4E3SA 4BDYA 4E7KA 2ZQBA 3OYIA 3KD5E 4I9QA 4M3ZA 1QS4A 3E01A 1J54A 3QLHA 3U3GA 2PY5A 3CG7A 2X6NA 2NUBA 4AHVA 4DU1A 4TSXA 4E7HA 1RT7A 1WAFA 3K57A 2XY6A 1UAXA 1NK0A 4FW2A 4FJJA 2HNZA 3M8SA 2RKIA 1A5VA 1RT3A 1U49A 2O4IA 1S5JA 3AVKA 3V1QA 3OJSA 1W9HA 3TI0A 4FK4A 1CLQA 2P51A 1LWCA 2GUIA 3I0SA 2PZSA 4HUGA 3KJVA 1QSLA 1RTDA 3RR7A 2IC3A 2VWKA 4M3XA 3O3GA 1RDBA 2P5OA 2HHSA 4CFAA 4RW7A 1RT1A 5SZTA 1Q9YA 4K8ZA 1RT6A 3AO4A 3MEGA 3MXJA 3QEXA 5C25A 2YKMA 3TABA 1WSHA 2DFHA 4CF0A 3RMDA 2KZMA 2D5RA 1HQUA 1JL2A 1WSFA 3ASMA 1BCMA 2ITGA 3HSTB 3NGYA 4FXDA 1NK7A 1VSEA 1S1UA 3KLHA 5KGWA 3PX6A 1KCFA 3AVNA 4ZTJA 4BDZA 1RDAA 1ASUA 4ID5A 4IG0A 1BQNA 1RDCA 4GVMA 2DFFA 3V4IA 2X74A 4FM0A 3LPUA 4MQ3A 2WOMA 1U45A 2Z1HA 4B9TA 2VG5A 4HTUA 4NYNA 2BANA 1UA1A 4N41A 4RG8A 1KLNA 4FJHA 1BISA 1KVAA 1REVA 2P5GA 3ZT4A 4KO0A 1D5AA 3AVJA 1JLQA 4BWJA 2P1JA 4Z0UA 3BGRA 1T03A 3VQQA 1EP4A 3A2FA 1YVUA 4AHRA 3TAGA 3HVRA 4DQRA 1C1CA 3V81A 1L3SA 1L3UA 4PWDA 1NKEA 1YT3A 4H4MA 3WNFA 1Z26A 4J2EA 4CJSA 4J2AA 3OYEA 2YNGA 2Z1JA 4RW8A 1S1WA 1RCHA 2HNYA 3KK1A 3BDPA 2HMIA 2DTUA 2OYQA 3NF8A 2VG6A 3KLGA 2FBVA 1DLOA 1NOYA 4XIUA 3NGZA 5KI6A 2ZE2A 3DM2A 4OLBA 4BE1A 4CK1A 3VA3A 4DTJA 2ATQA 3OYLA 1KVCA 1N5YA 3DYAA 4BDPA 4CGGA 4CIFA 3OYDA 3AVIA 2ETJA 1S6PA 3VQDA 2D0AA 4AHUA 3ALYA 2G8HA 4KB0A 4FK0A 4UQGA 4DTRA 1TK0A 1RBRA 3SV4A 3KK2A 1KRPA 4F4KA 3SQ2A 2HHWA 1IKWA 1JLGA 4N47A 1HJRA 3OYFA 1QSSA 1ASWA 4DQIA 4IDKA 1U48A 4CFBA 3CFPA 2G8VA 3OS0A 3PV8A 4PUOA 4DTOA 2FC0A 3G10A 3NDKA 3S9HA 2HHUA 4C8LA 4N5SA 2E4LA 3KIOA 1QQCA 1WAJA 3P83D 4Z4HA 4CEEA 1BI4B 4DWIA 5FDLA 4YNQA 4LSNA 4AH9A 4I2PA 1HMVA 3KKRA 1SL0A 3ZT2A 4IFYA 3OYGA 3MXIA 4J2BA 4CGDA 3DLKA 1WN7A 2HVHA 4AILC 3NCIA 3AVAA 4O4GA 3LDSA 3V9SA 1B9DA 1EKEA 1O1WA 3AVCA 3NH2A 3NF7A 2Z1IA 4CGJA 3L2VA 2G8UA 3OYHA 4E1NA 4CF1A 3SZ2A 2AJQA 2HB5A 3VQ8A 2F8SA 3HPGA 1VK0A 3DRSA 4E89A 3EY1A 3PO4A 2W42A 1RBVA 3NBPA 4C8OA 1NKCA 3VQ9A 1HRHA 3TAPA 1L3VA 2A1RA 3OJUA 1ASVA 3C94A 4W5RA 2R7YA 4E0DA 4CE9A 4H8KA 1BGXT 2YNFA 3AVGA 3C6UA 1VSLA 4OPKA 1WSIA 2YV0X 3AA5X 2F96A 1SL2A 2HW3A 1RDDA 4GMJB 1LAWA 1T8EA 1LW2A 1JLBA 2FBYA 4KPYA 1BQMA 4RW4A 4OGEA 3KLIA 3UIQA 4KHNA 2IGIA 4CEQA 3RWUA 3VN5A 1ZBFA 4CJFA 4DQQA 1VSHA 4FLUA 3ZSRA 3WNGA 4J2DA 3C6TA 4E7JA 4F3OA 4QOZB 3SUQA 1BCOA 4DG1A 4CECA 2E6MA 4ELTA 3K5MA 1C1AA 3HP9A 3LP1A 3F9KA 4HHTA 5J2QA 3SYZA 5FRMA 2X78A 1U47A 1TL1A 4DSEA 3K5NA 1FKPA 3L2WA 1T05A 1A5XA 4CGHA 5J2PA 3SCXA 5I3UA 4HUFA 1QHTA 3QERA 4DU3A 3AA3A 2HNDA 4MFBA 3PX0A 1J5OA 4Z4IA 1GOBA 2B5JA 4PQUA 3MEEA 2G8WA 2PYJA 5SWMA 3KKSA 4CERA 1TL3A 3L2RA 4KV8A 4ELVA 5KRSA 3SUNA 2QKBA 4KRFA 3NHGA 3AV9A 4W5TA 4NCAA 4M3WA 4C8NA 4DTMA 2KFZA 3LALA 4CF9A 4CEBA 4DS5A 3O3FA 1T7PA 4KHUA 3ULDA 5HRSA 2XY8A 4CJLA 3AA4A 5HRRA 4DSJA 3B6PA 1D9DA 4DTPA 1HYSA 1JXBA 2JGUA 4W5QA 4FJIA 4NYFA 3DRPA 2KFNA 1BHLA 2OPRA 4FLWA 3V6DA 1HQEA 2LSNA 5KRTA 3L8BA 1YTUA 1VSIA 2OPQA 3QNOA 3RMCA 2F8TA 2HHQA 4B9NA 2OZSA 4B9VA 3T1AA 4CJTA 4R5PA 4KHSA 3V9ZA 2B6AA 1HPZA 3M8RA 1Q9XA 1Q8IA 4CEFA 1EXQA 3HT3A 3I8DA 3TAMA 3SQ0A 1CXUA 4LY7A 3KK3A 3F73A 4CFDA 5DK5A 2HHXA 3LWLA 3I0RA 3V1OA 4LH4A 4CGFA 4E1MA 5J2MA 3P5JA 2QK9A 4H4OA 2YKNA 4KFBA 4B8AB 1TV6A 3ZSVA 4CHOA 3C95A 3NH1A 5HRNA 1C0UA 4OPJA 4EP5A 3DLGA 3K58A 1XWLA 1WLJA 3PY8A 4FJLA 2ZD1A 3V9WA 4Q5VA 1NK9A 3QEPA 3VQEA 2OPPA 3B6OA 1F21A 3SPYA 1SKSA 2IDOA 3MEDA 1TKDA 4KTZA 1J53A 2PYLA 2YHAA 4CJ5A 3VQAA 1JLAA 4M42A 1BIZA 4DFKA 2G8FA 5D3GA 3SQ4A 4Z4EA 3D0PA 1X9SA 3DMJA 1BI4A 4DTUA 1UOCA 4BWMA 3AVHA 2FBXA 3OYBA 4WE1A 4HCBA 3O4QA 4FJNA 4KKOA 4O0JA 1NKBA 5DMRA 2HVIA 3U6FA 1ZBHA 1C0MA 3LZJA 4BE0A 3QETA 1TKTA 4CHYA 4FJ9A 3LP0A 1FKOA 4OGCA 4E7LA 1VSFA 4FYDA 4DMNA 3K5LA 3SV3A 3SNNA 4OKJA 5C24A 3AO5A 4F2SA 3ZSXA 3THVA 4CEDA 5K14A 4CJPA 2RPIA 5T7BA 1S9EA 5CYMA 3O3HA 3VA0A 3MECA 1S1XA 1VSKA 1GOCA 3VQ7A 4FM1A 4CJ3A 4JS4A 5J2NA 1NK6A 3RRGA 3VQ6A 1JXEA 3TAFA 4O55A 3HJFA 3LP3A 1XI1A 1NK4A 4CJQA 3NH0A 4ICLA 3LZIA 4DFJA 1CZBA 1XC9A 1FXXA 3HXMA 3MAQA 4Z4GA 4AHCA 1S9GA 4KHYA 2XO7A 2D0BA 1TK8A 4FK2A 4I2QA 4ZTFA 4Z4CA 1IKYA 3OYJA 4CJVA 4CESA 2HHVA 1RTIA 2EX3A 3KD1E 3OS2A 4EZ9A 3H08A 1NOZA 1RT5A 1C6VA 1QE1A 1IO2A 4RW6A 1JLCA 4I7FA 1CZ9A 3O4NA 4C8MA 4KI6A 3AO1A 3CM6A 4DF8A 5HLFA 3DLEA 4DQSA 2Z1GA 1L3TA 3D45A 3PX4A 1WSGA 3QIPA 3DI6A 4DTSA 3AA2A 2Q3SA 2RN2A 1BL3A 1S1VA 4ZHRA 2E6LA 3HM9A 3FFIA 4DS4A 3SUPA 3KLEA 1NK5A 1KTQA 5CYQA 1G15A 4EP4A 1KFSA 4ELUA 4QCLA 3K59A 1B9FA 3OYAA 4DFPA 1L5UA 4KREA 4C8KA 5FROA 2VWJA 5KTQA 1EX4A 3S3OA 4FLTA 1NJWA 1LV5A 5FRNA 4GW6A 4FLZA 4YFUA 1RNHA 1ITGA 4IG3A 4FLVA 4FJ7A 3ISNC 1D9FA 4M45A 3HO1A 3QO9A 3V1RA 3LAKA 4B3OA 1X1PA 1S1TA 3CFOA 4DSLA 2XHBA 2RF2A 1TVRA 3M8PA 4AHTA 4FJ5A 3HYFA 5KGXA 4HUEA 1SL1A 4DFMA 4KTQA 2X6SA 3AVMA 4Z4FA 4OKKA 4DF4A 3TAEA 4LH5A 4KI4A 1S6QA 4NCGA 3PO5A 3JYTA 4CJKA 1U4BA 2BDPA 1YTAA 1TAQA 3TWHA 1TGOA 2G8IA 3NAEA 3U3YA 4OLAA 3T19A 2IAJA 1C0TA 1SV5A 4B08A 4CK3A 4CJEA 1FK9A 4CEOA 4RW9A 1EETA 1I3AA 3DOKA 3NFAA 2BE2A 4OKEA 4CF2A 3CFRA 3QEIA 3TARA 1UA0A 3OYNA 3NF6A 4DTXA 4CJWA 4PY5A 4B9LA 1TKXA 3VQCA 4FJXA 4CJUA 2GBZA 2KQ2A 3CM5A 2WONA 3LPTA 4N56A 1WNSA 3DRRA 3KTQA 3RR8A 5JS1A 4Y1CA 3SJJA 4Y1DA 3DOLA 3K5OA 3IG1A 4IFVA 4BE2A 3V9UA 3MXMA 4JS5A 3AO3A 4Q0BA 3L2QA 1IH7A 1WSJA 4DLGA 4CHZA 3EYZA 3SPZA 4NCBA 4O5BA 1NJXA 1Y97A 1N6QA 4M3TA 4DSKA 3VQBA 4CHQA 4KB1A 1JL1A 3L3UA 4OVLA 2FBTA 5JS2A 3OS1A 2I5JA 3OYMA 4IBNA 4FM2A 1DTQA 3LP2A 1RTJA 2DFEA 4E19A 3HPOA 3ZSQA 4CEZA 2KZZA 1WSEA 3CQ8A 5I42A 4FJ8A 4FJGA 2B4JA 4M3UA 5E41A 1Z25A 3QIOA 3S3MA 2OA8A 3LAMA 1RBUA 1RILA 3S3NA 3RTVA 4B8CA 3IAYA 1RBSA 1JKHA 2YHBA 1RBTA 3OVNA 3OYKA 2KW4A 3RRHA 2KTQA 4FW1A 1K6YA 3DLRA 3VQ4A 4EZ6A 2OPSA 1HYVA 3P1GA 3L2UA 2IS3A 4W5OA 2JLEA 1KFDA 4CJ4A 2QXFA 4CJRA 3TANA 3TAQA 4FZXC 4W5NA 2XY7A 4DTNA 4F3TA 1SKRA 3ZCMA 4FJKA 2DY4A 4LSLA 3M8QA 5HROA 4O0IA 3SI6A 1SKWA 1VRTA 2EHGA 3K2PA 4FLXA 1IG9A 4N76A 1VRUA 2Y1IA 4IKFA 3HK2A 4LD0A 4KHQA 1LWFA 3EZ5A 3AVBA 1TAUA 3SUOA 3ZSWA 2Y1JA 4JLHA 2QKKA 3RMBA 1IKVA 1VSJA 1LW0A 2XRIA 1ZBLA 3WNHA 3V9XA 3QEWA 1ZBUA 1NJZA 3QESA 3DLHA 4B9UA 3QNNA 1B92A 4FVMA 2VG7A 1A5WA 4KHWA 4G1QA 2BGGA 1ZBIA 5HP1A 1JLEA 5EU7A 1VSDA 3ZT3A 4CK2A 4ID1A 3T3FA 1KLMA 4DQPA 4CHNA 4B9SA 4HVJA 4CGIA 4E7IA 3JSMA 1QTMA 2XY5A 4B9MA 1XHZA 5CZ1A 3VQ5A 4JRPA 1X9WA 4HCCA 3VQPA 4M3YA 1HNIA 3DLBA 4FCYA 4CIGA 1LWEA 1NK8A 4CIEA 4FZYA 4FZZA 1HNVA 3SQ1A 2YNIA 1SUQA 2GV9A 3NF9A 4DSIA 4OJRA 4CHPA 4DLEA 2G8KA 3WNEA 3QINA 1XHXA 3LWMA 1TKZA 4CF8A 3KLFA 3QEVA 1R0AA 5J1EA 3HPHA 1LAVA 3IS9A 2OZMA 3AVLA 1J9AA 3ZSYA 2O4GA 3OYCA 4M41A 1D8YA 3TR8A 4K8XA 1DTTA 3ITHA 4AHSA 4KAZA 4FJMA 1JLFA 3AVFA 4BACA 1KVBA 5CY4A 1GOAA 5CZ2A 4CEAA 3HL8A 2D0CA 1X9MA 3LANA 2IOCA 3HP6A 4L8RB 4O44A
chains in the Genus database with same CATH superfamily
2O8CB 4B1XB 1RT2A 5HL7L 4YOWA 1DGKN 3OY9A 3HVTA 2HHTA 1KSPA 1NJYA 1NGEA 2YJEA 4FPBA 4O5FA 1HKBA 3QFPA 1CXQA 3OYIA 4CBXA 4I9QA 4Y0WA 3HOSA 5JLFA 2NUBA 1NK0A 4TSXA 2XY6A 1U49A 1A5VA 2O4IA 4BRPA 3V1QA 1CLQA 1W9HA 2P51A 3THXB 4HUGA 3LDNA 3VGLA 2ZGZA 4M3XA 3VEWA 4CFAA 3AO4A 3WEEB 3RSEA 2YKMA 1WSHA 3FGUA 1JL2A 2ITGA 3IKMA 1NK7A 2WUSA 3DJCA 5BPNA 4M7YA 3PX6A 4ZTJA 3VEVA 2YHXA 3WXJA 4ID5A 1JCFA 2DFFA 2QWLA 4FM0A 1TYQB 5BRFA 1O13A 4CZGA 1YHQN 4WQ5A 2P5GA 4KO0A 1Q81O 1D5AA 1EO1A 1JLQA 4FWSA 4BQLA 4BWJA 3FE1A 4PKGA 3CJ1A 1V4SA 1KAXA 1T03A 1YVUA 3HVRA 4DQRA 1VQ7N 3ZEUA 3I55N 5JVGL 5AQUA 1NKEA 1YT3A 4H4MA 3WNFA 4CJSA 4J2AA 4UY8O 1N33K 1RCHA 2HMIA 4JHDB 4ILJA 2OYQA 3BP8A 1DLOA 1NOYA 5KI6A 2QEXN 1X3NA 5LMNK 4KH6A 4BE1A 3VA3A 1KVCA 3CJ7A 2IVNA 3WQTA 2KHOA 3SMSA 4FK0A 4DCHA 3SV4A 1VQKN 1KRPA 4F4KA 3C6HA 1D4XA 1JLGA 3B8AX 1HJRA 3OYFA 5AQXA 3MWPA 4LFBK 2G8VA 2GTDA 4BC4A 1EWRA 3NDKA 2HHUA 4NLCA 4C8LA 4N5SA 3J7YP 4H5TA 1BI4B 4CEEA 4DWIA 1U2VB 4I2PA 1HMVA 5C15A 3ZT2A 4RWTA 1J5EK 3NCIA 3V9SA 2Q97A 3AVCA 2Z1IA 4E1NA 3SZ2A 3ATUA 2F8SA 4C23A 5IWAK 1RBVA 1NKCA 1HRHA 1ZC6A 3EEQA 4W5RA 2R7YA 4H8KA 2YNFA 1SL2A 4YOVA 5GAGP 3VEXA 1JLBA 4RW4A 2IGIA 4CEQA 3VN5A 1ZBFA 4JI6K 2QTDA 4FLUA 3U8XA 2V7ZA 4QOZB 2WC9A 4CECA 2E6MA 4ELTA 5J2QA 3SYZA 1XUPO 1U47A 3K5NA 5AQRA 5J2PA 4HUFA 1QHTA 1W97L 4X64K 2E2NA 4PQUA 2HNDA 2G8WA 3KKSA 2A42A 1K8AO 2P9IA 5M1OA 5JMVA 4W5TA 4DTMA 3CJ9A 1T7PA 4FWQA 4DTPA 1JXBA 3THWB 3CF5L 3DRPA 2OPRA 3SAFA 3PIOL 4L3QA 4B9NA 4LF6K 4KHSA 3DXKA 2B6AA 2QXLA 3A5OC 1Q9XA 4A5AA 3I8DA 1YAGA 2AA4A 4LY7A 2E2QA 4BRCA 4JI4K 3F73A 1XMQK 3DWLA 3K9JA 3CXCM 3P5JA 4H4OA 2YKNA 2E20A 3LDQA 1XNQK 1C0UA 4OPJA 3DLGA 1VQLN 1XWLA 3CPWM 2ZD1A 1ESVA 2P9PB 3L4QA 4CW7B 1KQSM 1TKDA 3SBGA 4LFCK 4JKEA 2YHYA 2YHAA 3CERA 3VQAA 3ZLJA 2O8DA 5D3GA 4Z4EA 3DMJA 3LDLA 1GLFO 4HCBA 1HPMA 2GEMA 4KKOA 4O0JA 4BRDA 1ZBHA 3LZJA 1HR0K 4KBOA 4XH1A 1FKOA 4OGCA 3ZETB 4DMNA 1T44A 3K5LA 4K43A 4F2SA 5K14A 4CJPA 2NRTA 5T7BA 1XQSC 1S1XA 4JYAK 3VQ7A 1NK6A 4JS4A 3BY5A 5LY3A 3VQ6A 3TAFA 2CH6A 2E8AA 1NK4A 4KH4A 2ZM6K 3NH0A 4JKBA 4ICLA 4KHYA 3O1WA 4FK2A 4Z4CA 2OANA 2P9SB 2HHVA 2EX3A 1QE1A 4FWNA 4RW6A 3D45A 1RGIA 3PX4A 1WSGA 1VQ5N 2Q3SA 1BL3A 3O9RA 4ZHRA 1NK5A 3KLEA 1B9FA 2VWJA 3Q7BA 4MO5A 4FJ7A 3ISNC 3OBYA 3CJCA 2XHBA 3M8PA 2YCHA 4HUEA 1SL1A 1BWFO 1QQNA 4Z4FA 3KHYA 4KI4A 4LF5K 1S6QA 3GOIA 1JJ2M 2OTLN 2QWNA 2G8IA 5C2DA 2IAJA 3GL1A 4PL8A 3O8MA 4CEOA 4RW9A 5FPDA 3DOKA 4OKEA 3ZYYX 3VENA 3T1HK 2YX6A 1VQON 4CJWA 5FPMA 3NVMA 3ZX2A 5GIOA 2WONA 3GDQA 3L4IA 3VEYA 3J8AA 4Y1CA 4FWRA 3DOLA 4JS5A 2QWQA 4CZKA 4V19S 3EYZA 2H3GX 4IOAL 3VQBA 4CHQA 3N4QA 5IT9O 4FM2A 2P9KA 3OYMA 3EO3A 3HPOA 1WSEA 3QB0A 4FJ8A 4FJGA 4GV9A 4JKGA 4BRAA 3LAMA 3S3NA 3RTVA 4BR4A 1RBSA 3ATVA 2IIRA 2KW4A 2KTQA 3THYB 2RE2A 3DLRA 1HYVA 2IS3A 4CZJA 1KFDA 4CJ4A 2QXFA 3TANA 5GAEP 4ISFA 4FZXC 4DTNA 5TKWA 1HLUA 4LSLA 4DV2K 4FOIA 3I33A 1SKWA 1IG9A 3TU5A 4CI6A 4IXCA 4K25A 2HOEA 4JLHA 1Y64A 1IKVA 2XRIA 3QEWA 3DLHA 3QESA 1B92A 4H0YB 1M1KO 2P9LA 1ZBIA 1KAYA 3ZT3A 4CK2A 2O8BA 1V4TA 3T3FA 1KLMA 4DQPA 4B9SA 4CGIA 4JN4A 4E7IA 3AGKA 4CZEA 5BR9A 3SK3A 5CZ1A 1XMOK 1X9WA 4M7XA 4B9QA 4HCCA 3DLBA 1LWEA 4BR9A 4CIEA 4DR4K 3SQ1A 4H0VB 4DLEA 1R0AA 3MWTA 1M90O 3HPHA 1LAVA 3IS9A 2VWBA 1YJ9N 3ENBA 3O9QA 4M41A 2V51B 3TR8A 4KAZA 3AAPA 4I6MB 3HL8A 3LANA 3J80O 2FSJA 3HP6A 1E3MA 4O44A 1VQPN 1W2BM 2YNHA 4KH5A 1RTHA 1RT4A 4ISGA 1U04A 2QI2A 5AZJB 3ZT0A 5C2FA 3NGIA 1VSMA 3GE1A 5HRPA 4I9LA 4JRQA 3QMLA 1TK5A 4FLYA 1QSYA 1VQ6N 1TUYA 3M5RA 1WBBA 3BZKA 4M3RA 3ZT1A 1W0HA 3IRXA 3PUFA 4CFCA 2F4VK 2E1ZA 2A1SA 3L3VA 1S3XA 1UWBA 5AQOA 4E3SA 2ZQBA 4CBUA 3KD5E 3E01A 1J54A 4K42A 4JI0K 3U3GA 4EFHA 3CG7A 3R1XA 4AHVA 1WAFA 3K57A 1NGJA 1UAXA 3E66A 3C0BA 4FW2A 4FK4A 2QWPA 3KK7A 4ILHA 3R6MA 4LC9B 5CE3A 2GUIA 3I0SA 3AY9A 2PZSA 4CZMA 1RTDA 2IC3A 3O3GA 3BZCA 5AQNA 1MWMA 2P5OA 4RW7A 3CCJN 3CJAA 3TABA 4JD2A 5C25A 3D2FB 3RMDA 2KZMA 1WSFA 3HSTB 3SAHA 4FXDA 3MX5A 3KLHA 3AVNA 4BDZA 1RDAA 1ASUA 1BQNA 1RDCA 2NNWA 1IV0A 3E9LA 3LPUA 2WOMA 2VG5A 4EAHD 2P9UA 5TKYA 3K9KA 1KVAA 1REVA 3ENHA 2P1JA 2P9NA 3WT0A 3A2FA 1L3UA 3V81A 2CGJA 3H3NO 3EZWA 3FZMA 4J2EA 4O8KA 3WXIA 2HNYA 3BDPA 3NF8A 4DV7K 4XIUA 3NGZA 4FVUA 4CK1A 3VF4A 4U7BA 1I94K 2ATQA 1NWKA 3DYAA 4CGGA 4F9OA 1BA0A 3O9TA 4CIFA 1HNXK 3AVIA 1S6PA 4X66K 3O9SA 2D0AA 3ALYA 4IOXA 1N36K 4JI2K 4DTRA 3UE5A 1RBRA 1TK0A 1P90A 3FR0A 3SQ2A 2HHWA 1QZ5A 1ASWA 3P38A 1RFQA 4JAXA 1U48A 4CFBA 3CFPA 1GLJO 4OPAA 5AQVA 3LDOA 4DTOA 5M1PA 3BUZB 1VQ9N 1WAJA 5LL6Z 4Z4HA 2D0OA 4IOCL 4AILC 4WQ5C 5M1KA 3AVAA 5B8HA 3O9UA 5BN9A 3IUCA 1RDWX 3L2VA 3OYHA 4CF1A 2UXBK 3LM9A 4LF4K 1VK0A 3D6RA 2PBDA 5AR0A 3NBPA 4C8OA 1J6ZA 3THXA 2A1RA 3C94A 1YJNN 4DV1K 1E4GT 3C6UA 1VSLA 4OPKA 3AA5X 4A59A 2O8EB 3H45C 1T8EA 4A62A 1LW2A 5EOYA 5C12A 1BQMA 3G4SN 5HOOA 3CCSN 4KHNA 3CI5A 3D2EB 4CJFA 3WEEA 1YF5L 1FJGK 3UKUB 3ZSRA 4J2DA 3C6TA 4F3OA 5M1FA 3SUQA 2IVPA 5BREA 4DR1K 3TSUA 2WTUA 1C1AA 3F9KA 2VQEK 1QVGM 2X78A 4FWPA 3O5BA 5CR4A 4DV3K 3SMPA 5BRDA 5I3UA 4CGHA 1TYQA 3QERA 4FWKA 3PX0A 4MFBA 1GOBA 3MEEA 4CERA 4ELVA 4BRKA 3CMAN 3VTHA 1NG9A 3H1QA 3LALA 4JKAA 1HJOA 3O3FA 4KHUA 5HRSA 3R8EA 5HRRA 5BRHA 3B6PA 1D9DA 4NYFA 1WBDA 1XC3A 1BHLA 1NGHA 2J4RA 2V7YA 3I8BA 4FLWA 5KRTA 3LL3A 1VSIA 4DR3K 1ATNA 4QS7A 2FSNA 3T1AA 4CJTA 4R5PA 3M8RA 4JHDA 3HT3A 3TTCA 1ATRA 2HHXA 4CGFA 5J2MA 1N34K 2QK9A 4AM7A 1Q18A 4KFBA 1TV6A 3FZKA 4CZFA 5EX5A 1VAZA 1YXQA 3E9OA 4JKHA 3V9WA 2VYPA 1SKSA 1F21A 3MEDA 3R9PA 1JLAA 4M42A 4DFKA 3P4IA 3DAWA 2W40A 1U6ZA 1EWQA 3WQUA 1BI4A 1UOCA 1VQNN 1YIJN 1U2VA 2FBXA 1Q86O 3H6EA 3O4QA 1NKBA 5DMRA 4WFNL 2HVIA 3U6FA 4BE0A 3QETA 1TKTA 4CHYA 3VESA 3LP0A 4GNIA 4BG8A 1VSFA 4OKJA 3AO5A 2BUPA 3THVA 2RPIA 3CMEN 4NXNK 5AQLA 1VSKA 1JXEA 1BG3A 5C0YA 1XI1A 3G25A 5EXWA 3LZIA 3CD6N 1S9GA 3HZ6A 4BC3A 3DXMB 4H0XB 5DM7L 5M1QA 1TK8A 4MLHA 4ZTFA 5KQDA 2UYTA 2ZF5O 3OYJA 1YI2N 3IMXA 4CESA 1RTIA 1MWKA 4HWIA 3KD1E 3H08A 1JLCA 5AQYA 4I7FA 1CZ9A 3O4NA 3DLEA 4DQSA 5BPMA 2Z1GA 3C7NB 3DI6A 3CETA 3AA2A 2E2OA 2E6LA 4DR6K 1NLVA 1KFSA 4KREA 4C8KA 5FROA 3S3OA 4FLTA 3G71N 4YFUA 1RNHA 5KPRA 1WB9A 5GADP 4IG3A 1D9FA 2ZJQL 3V1RA 2F7TA 3LAKA 1X1PA 4JKCA 4IEEA 3CC4N 1K9MO 4DSLA 3THWA 3PSFA 4KTQA 4CJ7A 2X6SA 4DUYK 4DF4A 5ELZA 2GX9A 4LH5A 4FWOA 1KAZA 3PO5A 4ILGB 4CJKA 1U4BA 5E84A 1TAQA 2HBLA 4OLAA 3T19A 1NGGA 4CK3A 2HSTA 4CJEA 1FK9A 3GG4A 3NF6A 1TKXA 3VQCA 4DV5K 1NMNA 4FJXA 3BF1A 4A57A 2GBZA 2KQ2A 3T7ZA 3DRRA 3F5TA 5JS1A 2GUPA 2P9PA 4IFVA 4BE2A 3AO3A 4Q0BA 4BRQA 1WSJA 4J8FA 5A2QO 4NCBA 1Y97A 3AAQA 3KWIA 3HBTA 1JL1A 1MA9B 3QEIA 4F8RA 2I5JA 4JNEA 4E19A 3CQ8A 2B4JA 1XNRK 4M3UA 1GLEG 3MK6A 5E41A 3S3MA 2OA8A 1RBUA 1RILA 2BH1A 1CZAN 4H03B 2NRWA 3ZETA 1X9JA 4JK9A 3RRHA 4JKDA 3VQ4A 2OPSA 4RCHA 4C1NK 2JLEA 4AQYK 2XY7A 3VPZA 4O0IA 1VRTA 3K2PA 1NJIO 1HUXA 1VQMN 4N76A 1VRUA 4CBWA 3F9MA 3HK2A 1TAUA 3L6QA 2P9SA 3JAMO 2Y1JA 3RMBA 2IVOA 3QNNA 4KHWA 4G1QA 1RDUA 1JLEA 5EU7A 1VSDA 4ID1A 4JKFA 1OKJA 1BUPA 3QBWA 1XHZA 3VQ5A 3EE9A 4M3YA 1HNIA 4JI5K 2EWSA 3CPEA 4FZYA 4FZZA 4MO4A 2GV9A 3NF9A 4DSIA 4OJRA 4CHPA 2G8KA 3WNEA 2OTJN 1XHXA 3LWMA 3QICA 1C0FA 3C65A 1DTTA 3ITHA 4AHSA 2HF4A 3AVFA 4CEAA 1GOAA 5CZ2A 1BIUA 3G0ZA 3O08A 1ZYQA 3J7ZO 4CZLA 4CCHA 4KTWA 3CCLN 4BR2A 3A0IX 3CYMA 1JCEA 3ZSZA 4F2RA 3RMAA 2O8FB 5C42A 4DU4A 4PA1A 4E7KA 3FLCO 2PY5A 2HF3A 4E7HA 1RT7A 4FO0A 3W3DA 4FJJA 5BPLA 2RKIA 1RT3A 1S5JA 3AVKA 4LF7K 3OJSA 3G6EN 1LWCA 4GY2B 3QFUA 4YOXA 3KJVA 4B3MK 1T3VA 2VWKA 4NO7A 3CJBA 2HHSA 5SZTA 1RT1A 4B3SK 4OX9K 1OVYA 4IO9L 3QEXA 3ULEB 5AQSA 1GLLO 1HQUA 3VGMA 3U9ZA 1VSEA 3UKRB 2KLAA 5KGWA 1N32K 4DV6K 4IG0A 5AQPA 2VGNA 3V4IA 2QA4N 3H1VX 4NYNA 2BANA 3K0SA 1X3MA 1UA1A 3P31A 1Q82O 4N41A 4RG8A 1KLNA 1OH7A 1IBLK 5H1SQ 3ZT4A 4CVNE 5FPEA 2QWOA 2A41A 5F2RA 4AHRA 3CC2N 4CD3A 2D1KA 1HKGA 2HHQA 3OYEA 2Z1JA 4BC2A 3EKUA 3MN7A 3MX2A 2ZE2A 4OLBA 4DTJA 3N4PA 1WUAA 3OYDA 4LFAK 3VQDA 4R79A 3M6GA 4AHUA 4BR7A 2G8HA 2E1YA 4I6MA 3KK2A 2A40A 2Q31A 3IFRA 4N47A 4IDKA 4WQ4A 5C10A 3OS0A 5GIPA 4AF1A 3OTOK 2UUBK 4PUOA 2E4LA 1QQCA 4H5WA 5FDLA 4YNQA 4LSNA 3P39A 1NNEA 2VCPA 5AQQA 1SL0A 3OYGA 4IFYA 3MXIA 1YJWN 3DLKA 1WN7A 4WCEL 1GLBG 4B1YB 4O4GA 1B9DA 2F9TA 1ZXOA 4BRMA 4JI1K 5GINA 4NXMK 1Z6RA 4K41A 3EY1A 3PO4A 2AP1A 2A6AA 4IO8A 3VQ9A 1ASVA 1T6CA 1OVQA 3AGRA 1BGXT 3AVGA 1NGCA 1RDDA 4GMJB 1LAWA 2FBYA 3A5NC 5AQWA 3KLIA 3UIQA 4DQQA 5AFUH 1QQOA 4YOUA 4BR0A 3D2FA 2V52B 3WNGA 4E7JA 4X62K 4DG1A 3WUHA 3HP9A 3LP1A 4HHTA 1TL1A 3O1BA 1T05A 4X65K 3OW2M 2DPNA 3AA3A 4Z4IA 3VF2A 5SWMA 2QKBA 4KV8A 5KRSA 3SUNA 3SLCA 3MCPA 2A3ZA 4M3WA 4C8NA 1YITN 2NRVA 4PL7A 3VERA 2KFZA 2HBJA 4CEBA 4CF9A 3ULDA 2XY8A 5CHIA 3AA4A 3A8YA 4BR5A 4W5QA 2A5XA 3CIPA 3ZX3A 3L8BA 1IG8A 3RMCA 2QWMA 2OZSA 3V9ZA 1HPZA 1Q8IA 4CEFA 1EXQA 3CCQN 1CXUA 3KK3A 5DK5A 3I0RA 3V1OA 4GKKK 2OCEA 2CGLA 4B8AB 3ZSVA 4CHOA 4PKHA 3NH1A 5AQFA 4FPAA 4JV5K 4EP5A 1WLJA 2ASPA 3PY8A 2I7NA 3GBTA 3B6OA 3SPYA 4DR7K 3T69A 4KTZA 1J53A 1IBMK 2PYLA 1S22A 3EKSA 1BIZA 2E2PA 3D7EO 1QZ6A 4FWLA 3SQ4A 2G8FA 4GV6A 3BF3A 3D0PA 3NMUA 1WOQA 1S72N 2VQFK 1JCGA 4YHHK 4FJNA 1C0MA 2Q0RA 4FJ9A 3VETA 3ID6A 2O8CA 4FYDA 3SV3A 5C24A 3E9PA 2FXUA 2VGMA 1DT9A 5ADXH 1S9EA 5CYMA 1Z05A 3VMFB 3WXMB 2ZJRL 4CJ3A 2PAVA 3HJFA 4O55A 2O8EA 1CZBA 1LOTB 1XC9A 4Z4GA 4AHCA 1NBWA 2D0BA 4CZHA 3D2EA 4CJVA 3MN6A 5GAHP 4EZ9A 4CD1A 3UKUA 1NOZA 1RT5A 4IZ9A 5LMUK 4C8MA 4KI6A 4KHPK 3CM6A 4DF8A 5HLFA 1KD1O 1OH6A 3HM9A 1S1VA 4DS4A 1KTQA 5CYQA 1G15A 2WFBA 4EP4A 1L5UA 3OYAA 3EL2A 1EX4A 1P8ZA 1GLCG 4GW6A 4FLZA 1ITGA 4M45A 4JK7A 1YUWA 1NGFA 4B3OA 3CFOA 5AZIB 4MDAA 5KGXA 3DLLL 5AQMA 3WXKA 4DFMA 2NZTA 3AVMA 2JWKA 3SJHA 1K8KB 4NCGA 4JI3K 1BU6O 2BDPA 1YTAA 2D4WA 4Z94A 1TGOA 3TWHA 1FW6A 3NAEA 5AQTA 4XEIA 3TSQA 1EETA 3W0LA 1I3AA 4CF2A 2BE2A 3H46O 3CFRA 1UA0A 1QHAA 4WF9L 4DTXA 2ZWHA 1DEJA 2HHHK 4CJUA 3CM5A 3LPTA 3KWGA 1WNSA 3RR8A 3SJJA 4IWVA 2KKZA 3CCEN 4IJAA 1HX1A 1IH7A 4DLGA 1NJXA 1N6QA 4DSKA 3J81O 4DR2K 4HTLA 4MLEA 5JS2A 2PYJA 5AQIA 1NU0A 3LP2A 2DFEA 4BG9A 2KZZA 3J7AP 4DR5K 5I42A 4A5BA 3CHWA 4H5NA 1Z25A 3JS6A 3QIOA 4NLBA 3OVNA 3RSEB 5EY4A 3OYKA 3VEOA 4BQZA 5JICA 4WFAL 4EZ6A 3L2UA 3P1GA 3PLAA 4H0OA 1OH8A 3TAQA 1OH5A 4QS8A 1SKRA 4FJKA 1SQKA 4YORA 3SI6A 4FLXA 4FSVA 4BRNA 1NGBA 2Y1IA 4IKFA 3DXMA 4LD0A 3AVBA 3SUOA 1VSJA 1LW0A 1ZBLA 4BGAA 5I9EB 5MLCQ 2VG7A 5KQ8A 4A61A 3E1YA 2BGGA 2Q0UA 2HBKA 3FZFA 3ZEUB 1NMDA 1BOTO 3C7NA 4CHNA 2F9WA 4HVJA 3JSMA 1ATSA 4JRPA 3IDHA 1HNZK 1SZ2A 3VQPA 3ZX0A 3VEZA 1W7AA 4FCYA 3VTIA 4CIGA 1NK8A 1HNVA 2YNIA 1SUQA 5KPTA 3QINA 4GVEA 3KLFA 4CF8A 3QEVA 3CQXA 2W41A 5J1EA 3TTDA 4CZIA 3TTFA 3OYCA 4XH5A 1D8YA 3A5MC 1JLFA 2I7PA 4BRIA 4BACA 2Q2RA 2D0CA 2IOCA 4EHTA 1R59O 5E26A 4LF8K 1I39A 2RHKA 1HYZA 2ZGYA 1IKXA 1N8RO 4DSFA 2YJFA 3NE6A 3HSCA 4QAGA 4BREA 1MDUB 3ZSOA 4JI7K 1C1BA 5HBMA 3AO2A 1MU2A 4IFEA 4BDYA 4OO1J 4M3ZA 1QS4A 4YY3K 3QLHA 5M1NA 3VGKA 2X6NA 4DU1A 4YOTA 4IJNA 2HNZA 3M8SA 3TI0A 2QM1A 2YHWA 1QSLA 3RR7A 5AQJA 3CQYA 1BDGA 1RDBA 4LF9K 2NRHA 4WFBL 4K8ZA 1Q9YA 1GLDG 1LCUA 4M63C 1RT6A 3MEGA 3MXJA 2DFHA 4CF0A 2D5RA 2DTUA 3ASMA 1BCMA 3NGYA 2GWKA 1S1UA 3TPQA 2UUAK 1KCFA 4B1UB 3QBXA 4GVMA 2X74A 3CC7N 3CCMN 4MQ3A 4FOEA 1BO5O 2Z1HA 3BEXA 4HTUA 1U45A 4B9TA 4H5RA 5DM6L 4FJHA 1BISA 2P9IB 3AVJA 4DV4K 4GV3A 4BVOA 4Z0UA 3BGRA 3VQQA 1EP4A 3TAGA 5AQHA 4PWDA 1C1CA 1L3SA 4QS9A 1K73O 3R3LA 1Z26A 4B3TK 4IDHA 2YNGA 4RW8A 1S1WA 3DXKB 4BGBA 3KK1A 2VG6A 3KLGA 2FBVA 4FL9A 3DM2A 4B1WB 2ZJPL 3OYLA 1N5YA 4BDPA 2ETJA 4KB0A 2W6LA 3JXUA 5FLXO 4UQGA 3KVGA 4K0KK 4YDUC 1DKGD 1IKWA 1QSSA 3O80A 4FWMA 4DQIA 4YOYA 2D0PA 3PV8A 2FC0A 3G10A 4DQ8A 2O8DB 3S9HA 1KXPA 3KIOA 3P83D 1SS6A 2GELA 4AH9A 1HKCA 2O8FA 2CGKA 4EIAA 3HM8A 1ZBSA 3KKRA 3CCVN 4J2BA 4CGDA 3Q7CA 1NGDA 2HVHA 3LDSA 1VQ4N 1EKEA 1O1WA 3NH2A 5AQZA 3NF7A 1HNWK 4CGJA 2G8UA 2AJQA 2HB5A 3VQ8A 3HPGA 4XH4A 3DRSA 4E89A 5BN8A 2W42A 4JK8A 4BRGA 3TAPA 1L3VA 3OJUA 4E0DA 3CCUN 4CE9A 4DUZK 1WSIA 2YV0X 2F96A 4BRFA 3F2KA 4B1VA 4EHUA 4KPYA 1IJJA 4OGEA 3RWUA 1GLAG 2FSKA 1VSHA 2QWRA 3ULEA 2PFUA 1KC8O 2NRZA 5AJ3K 1BCOA 3UKRA 5LJWA 3FZLA 3K5MA 1SAZA 5FRMA 2ASMA 4DSEA 1FKPA 3L2WA 1A5XA 3HOTA 3SCXA 3PIPL 4WQ4C 4DU3A 1J5OA 3FFKB 2B5JA 4B1ZA 5BR8K 3L2RA 1TL3A 5F1XA 4YDUA 4KRFA 3U4LA 3MCAB 3NHGA 3AV9A 4NCAA 2WBNA 3THYA 4DS5A 2YI1A 2UXDK 4CJLA 4DSJA 4A2AA 4DB3A 1YVNA 1HYSA 2JGUA 4FJIA 3HTVA 3V6DA 1HQEA 2LSNA 1YTUA 2F8TA 2OPQA 3QNOA 4B9VA 1TUUA 3LM2A 3TSPA 3L0QA 2HBMA 5FPNA 3TAMA 3SQ0A 1VQ8N 4CFDA 3T1YK 3LWLA 2JWLA 3A5LC 1VHXA 3ENOA 3QDKA 4LH4A 4E1MA 3O4WA 4BROA 2W6KA 5AFUA 3C95A 4DHYA 5HRNA 3MN5A 3K58A 4U67L 4FJLA 1QVFM 2NLXA 4Q5VA 2FLOA 3QEPA 3VQEA 1NK9A 2OPPA 2E88A 2IDOA 3U9DA 4CJ5A 1X9SA 3WXLA 4DTUA 2P9KB 4BWMA 3AVHA 4PHTX 3OYBA 4WE1A 3EN9A 4A2BA 4JKGB 5JVHL 4E7LA 3SNNA 3ZSXA 4CEDA 4BY9C 5AZJA 4O8UA 3O3HA 3HRGA 3VA0A 3MECA 4FM1A 1GOCA 5J2NA 3RRGA 2UXCK 3HI0A 3LP3A 4CJQA 3LDPA 4DFJA 1FXXA 3HXMA 3MAQA 4DV0K 2Q36A 3H3OB 2E5LK 2XO7A 3MDQA 4I2QA 1IKYA 4WYBA 3EE8A 3OS2A 4GKJK 1C6VA 1IO2A 2P9LB 4MDBA 3AO1A 2NRRA 2O8BB 3OHRA 2UUCK 1L3TA 3O6WA 3QIPA 3C6AA 1E4FT 1Q7YO 4DTSA 2RN2A 4K8XA 3FFIA 3SUPA 4BRLA 4QCLA 4ELUA 3K59A 4DFPA 5KTQA 1LV5A 1G99A 1NJWA 2GWJA 5FRNA 4JEPA 4G9ZA 4FLVA 3PSIA 3VOVA 3HO1A 3QO9A 3S41A 3RVCA 1S1TA 2RF2A 1TVRA 3OBWA 4AHTA 4FJ5A 3HYFA 4BRHA 2ASOA 4ISEA 4OKKA 5ADXA 4OPHA 3TAEA 2QW9A 3JYTA 3U3YA 2Q1NA 1C0TA 1SV5A 4B08A 3M3ZA 3NFAA 3TARA 3MMVA 3MN9A 3OYNA 2NRXA 2HMPA 4IEIA 5AQKA 4RTFD 4B9LA 4PY5A 4N56A 3KZBA 1C0GA 3UB5A 3KTQA 1NGIA 2FF6A 4Y1DA 3V9UA 3K5OA 3IG1A 3MXMA 4DKWA 3L2QA 3SPZA 4CHZA 4M3TA 4O5BA 3SAGA 4H0PA 4KB1A 3L3UA 2FF3B 4OVLA 2FBTA 3OS1A 2KFNA 4IBNA 3NVKA 1DTQA 1RTJA 1H1VA 3ZSQA 4CEZA 3CCRN 3FZHA 4JI8K 5JLHA 1QQMA 4B8CA 3IAYA 1JKHA 1NM1A 1RBTA 2YHBA 4H5VA 1ILYA 4JD2B 1IBKK 5F0XA 5AQGA 4FW1A 1K6YA 3VF6A 4W5OA 4E1JA 2ITMA 4CJRA 4W5NA 4F3TA 3ZCMA 2DY4A 3M8QA 5HROA 2EHGA 3SBTA 4PKIA 2BTFA 3ID8A 4C1NI 2P9UB 4AM6A 4KHQA 1EQYA 1LWFA 3EZ5A 3ZSWA 1NGAA 2QKKA 3WNHA 3V9XA 1ZBUA 1NJZA 4B9UA 3I56N 4B3RK 2P9NB 4FVMA 5EVZA 1A5WA 5KPZA 5HP1A 3AARA 3M1FA 1QTMA 2XY5A 4B9MA 1BA1A 3OA9A 5LJVA 1TKZA 4BC5A 2OZMA 3AVLA 1J9AA 3ZSYA 1T6DA 2O4GA 5AZIA 2UU9K 4H0TB 4FJMA 4NB4A 1KVBA 5CY4A 1K8KA 1X9MA 4BVPA 2HW3A 2CH5A 4L8RB
chains in the Genus database with same CATH topology
1I39A 1HYZA 2YNHA 1IKXA 1RT2A 1BIUA 3G0ZA 1ZYQA 1RTHA 4CCHA 1RT4A 1U04A 3ZT0A 4KTWA 3NGIA 4DSFA 3CYMA 4F8RA 1VSMA 5HRPA 3OY9A 4I9LA 3NE6A 3HVTA 4QAGA 2HHTA 4JRQA 1KSPA 1NJYA 1TK5A 4FLYA 3ZSZA 3ZSOA 1QSYA 4F2RA 3RMAA 4M3RA 3ZT1A 1C1BA 5C42A 4DU4A 1W0HA 3AO2A 3IRXA 3PUFA 5HBMA 4CFCA 1CXQA 2A1SA 1MU2A 1UWBA 3L3VA 4PA1A 4E3SA 4BDYA 4E7KA 2ZQBA 3OYIA 3KD5E 4I9QA 4M3ZA 1QS4A 3E01A 1J54A 3QLHA 3U3GA 2PY5A 3CG7A 2X6NA 2NUBA 4AHVA 4DU1A 4TSXA 4E7HA 1RT7A 1WAFA 3K57A 2XY6A 1UAXA 1NK0A 4FW2A 4FJJA 2HNZA 3M8SA 2RKIA 1A5VA 1RT3A 1U49A 2O4IA 1S5JA 3AVKA 3V1QA 3OJSA 1W9HA 3TI0A 4FK4A 1CLQA 2P51A 1LWCA 2GUIA 3I0SA 2PZSA 4HUGA 3KJVA 1QSLA 1RTDA 3RR7A 2IC3A 2VWKA 4M3XA 3O3GA 1RDBA 2P5OA 2HHSA 4CFAA 4RW7A 1RT1A 5SZTA 1Q9YA 4K8ZA 1RT6A 3AO4A 3MEGA 3MXJA 3QEXA 5C25A 2YKMA 3TABA 1WSHA 2DFHA 4CF0A 3RMDA 2KZMA 2D5RA 1HQUA 1JL2A 1WSFA 3ASMA 1BCMA 2ITGA 3HSTB 3NGYA 4FXDA 1NK7A 1VSEA 1S1UA 3KLHA 5KGWA 3PX6A 1KCFA 3AVNA 4ZTJA 4BDZA 1RDAA 1ASUA 4ID5A 4IG0A 1BQNA 1RDCA 4GVMA 2DFFA 3V4IA 2X74A 4FM0A 3LPUA 4MQ3A 2WOMA 1U45A 2Z1HA 4B9TA 2VG5A 4HTUA 4NYNA 2BANA 1UA1A 4N41A 4RG8A 1KLNA 4FJHA 1BISA 1KVAA 1REVA 2P5GA 3ZT4A 4KO0A 1D5AA 3AVJA 1JLQA 4BWJA 2P1JA 4Z0UA 3BGRA 1T03A 3VQQA 1EP4A 3A2FA 1YVUA 4AHRA 3TAGA 3HVRA 4DQRA 1C1CA 3V81A 1L3SA 1L3UA 4PWDA 1NKEA 1YT3A 4H4MA 3WNFA 1Z26A 4J2EA 4CJSA 4J2AA 3OYEA 2YNGA 2Z1JA 4RW8A 1S1WA 1RCHA 2HNYA 3KK1A 3BDPA 2HMIA 2DTUA 2OYQA 3NF8A 2VG6A 3KLGA 2FBVA 1DLOA 1NOYA 4XIUA 3NGZA 5KI6A 2ZE2A 3DM2A 4OLBA 4BE1A 4CK1A 3VA3A 4DTJA 2ATQA 3OYLA 1KVCA 1N5YA 3DYAA 4BDPA 4CGGA 4CIFA 3OYDA 3AVIA 2ETJA 1S6PA 3VQDA 2D0AA 4AHUA 3ALYA 2G8HA 4KB0A 4FK0A 4UQGA 4DTRA 1TK0A 1RBRA 3SV4A 3KK2A 1KRPA 4F4KA 3SQ2A 2HHWA 1IKWA 1JLGA 4N47A 1HJRA 3OYFA 1QSSA 1ASWA 4DQIA 4IDKA 1U48A 4CFBA 3CFPA 2G8VA 3OS0A 3PV8A 4PUOA 4DTOA 2FC0A 3G10A 3NDKA 3S9HA 2HHUA 4C8LA 4N5SA 2E4LA 3KIOA 1QQCA 1WAJA 3P83D 4Z4HA 4CEEA 1BI4B 4DWIA 5FDLA 4YNQA 4LSNA 4AH9A 4I2PA 1HMVA 3KKRA 1SL0A 3ZT2A 4IFYA 3OYGA 3MXIA 4J2BA 4CGDA 3DLKA 1WN7A 2HVHA 4AILC 3NCIA 3AVAA 4O4GA 3LDSA 3V9SA 1B9DA 1EKEA 1O1WA 3AVCA 3NH2A 3NF7A 2Z1IA 4CGJA 3L2VA 2G8UA 3OYHA 4E1NA 4CF1A 3SZ2A 2AJQA 2HB5A 3VQ8A 2F8SA 3HPGA 1VK0A 3DRSA 4E89A 3EY1A 3PO4A 2W42A 1RBVA 3NBPA 4C8OA 1NKCA 3VQ9A 1HRHA 3TAPA 1L3VA 2A1RA 3OJUA 1ASVA 3C94A 4W5RA 2R7YA 4E0DA 4CE9A 4H8KA 1BGXT 2YNFA 3AVGA 3C6UA 1VSLA 4OPKA 1WSIA 2YV0X 3AA5X 2F96A 1SL2A 2HW3A 1RDDA 4GMJB 1LAWA 1T8EA 1LW2A 1JLBA 2FBYA 4KPYA 1BQMA 4RW4A 4OGEA 3KLIA 3UIQA 4KHNA 2IGIA 4CEQA 3RWUA 3VN5A 1ZBFA 4CJFA 4DQQA 1VSHA 4FLUA 3ZSRA 3WNGA 4J2DA 3C6TA 4E7JA 4F3OA 4QOZB 3SUQA 1BCOA 4DG1A 4CECA 2E6MA 4ELTA 3K5MA 1C1AA 3HP9A 3LP1A 3F9KA 4HHTA 5J2QA 3SYZA 5FRMA 2X78A 1U47A 1TL1A 4DSEA 3K5NA 1FKPA 3L2WA 1T05A 1A5XA 4CGHA 5J2PA 3SCXA 5I3UA 4HUFA 1QHTA 3QERA 4DU3A 3AA3A 2HNDA 4MFBA 3PX0A 1J5OA 4Z4IA 1GOBA 2B5JA 4PQUA 3MEEA 2G8WA 2PYJA 5SWMA 3KKSA 4CERA 1TL3A 3L2RA 4KV8A 4ELVA 5KRSA 3SUNA 2QKBA 4KRFA 3NHGA 3AV9A 4W5TA 4NCAA 4M3WA 4C8NA 4DTMA 2KFZA 3LALA 4CF9A 4CEBA 4DS5A 3O3FA 1T7PA 4KHUA 3ULDA 5HRSA 2XY8A 4CJLA 3AA4A 5HRRA 4DSJA 3B6PA 1D9DA 4DTPA 1HYSA 1JXBA 2JGUA 4W5QA 4FJIA 4NYFA 3DRPA 2KFNA 1BHLA 2OPRA 4FLWA 3V6DA 1HQEA 2LSNA 5KRTA 3L8BA 1YTUA 1VSIA 2OPQA 3QNOA 3RMCA 2F8TA 2HHQA 4B9NA 2OZSA 4B9VA 3T1AA 4CJTA 4R5PA 4KHSA 3V9ZA 2B6AA 1HPZA 3M8RA 1Q9XA 1Q8IA 4CEFA 1EXQA 3HT3A 3I8DA 3TAMA 3SQ0A 1CXUA 4LY7A 3KK3A 3F73A 4CFDA 5DK5A 2HHXA 3LWLA 3I0RA 3V1OA 4LH4A 4CGFA 4E1MA 5J2MA 3P5JA 2QK9A 4H4OA 2YKNA 4KFBA 4B8AB 1TV6A 3ZSVA 4CHOA 3C95A 3NH1A 5HRNA 1C0UA 4OPJA 4EP5A 3DLGA 3K58A 1XWLA 1WLJA 3PY8A 4FJLA 2ZD1A 3V9WA 4Q5VA 1NK9A 3QEPA 3VQEA 2OPPA 3B6OA 1F21A 3SPYA 1SKSA 2IDOA 3MEDA 1TKDA 4KTZA 1J53A 2PYLA 2YHAA 4CJ5A 3VQAA 1JLAA 4M42A 1BIZA 4DFKA 2G8FA 5D3GA 3SQ4A 4Z4EA 3D0PA 1X9SA 3DMJA 1BI4A 4DTUA 1UOCA 4BWMA 3AVHA 2FBXA 3OYBA 4WE1A 4HCBA 3O4QA 4FJNA 4KKOA 4O0JA 1NKBA 5DMRA 2HVIA 3U6FA 1ZBHA 1C0MA 3LZJA 4BE0A 3QETA 1TKTA 4CHYA 4FJ9A 3LP0A 1FKOA 4OGCA 4E7LA 1VSFA 4FYDA 4DMNA 3K5LA 3SV3A 3SNNA 4OKJA 5C24A 3AO5A 4F2SA 3ZSXA 3THVA 4CEDA 5K14A 4CJPA 2RPIA 5T7BA 1S9EA 5CYMA 3O3HA 3VA0A 3MECA 1S1XA 1VSKA 1GOCA 3VQ7A 4FM1A 4CJ3A 4JS4A 5J2NA 1NK6A 3RRGA 3VQ6A 1JXEA 3TAFA 4O55A 3HJFA 3LP3A 1XI1A 1NK4A 4CJQA 3NH0A 4ICLA 3LZIA 4DFJA 1CZBA 1XC9A 1FXXA 3HXMA 3MAQA 4Z4GA 4AHCA 1S9GA 4KHYA 2XO7A 2D0BA 1TK8A 4FK2A 4I2QA 4ZTFA 4Z4CA 1IKYA 3OYJA 4CJVA 4CESA 2HHVA 1RTIA 2EX3A 3KD1E 3OS2A 4EZ9A 3H08A 1NOZA 1RT5A 1C6VA 1QE1A 1IO2A 4RW6A 1JLCA 4I7FA 1CZ9A 3O4NA 4C8MA 4KI6A 3AO1A 3CM6A 4DF8A 5HLFA 3DLEA 4DQSA 2Z1GA 1L3TA 3D45A 3PX4A 1WSGA 3QIPA 3DI6A 4DTSA 3AA2A 2Q3SA 2RN2A 1BL3A 1S1VA 4ZHRA 2E6LA 3HM9A 3FFIA 4DS4A 3SUPA 3KLEA 1NK5A 1KTQA 5CYQA 1G15A 4EP4A 1KFSA 4ELUA 4QCLA 3K59A 1B9FA 3OYAA 4DFPA 1L5UA 4KREA 4C8KA 5FROA 2VWJA 5KTQA 1EX4A 3S3OA 4FLTA 1NJWA 1LV5A 5FRNA 4GW6A 4FLZA 4YFUA 1RNHA 1ITGA 4IG3A 4FLVA 4FJ7A 3ISNC 1D9FA 4M45A 3HO1A 3QO9A 3V1RA 3LAKA 4B3OA 1X1PA 1S1TA 3CFOA 4DSLA 2XHBA 2RF2A 1TVRA 3M8PA 4AHTA 4FJ5A 3HYFA 5KGXA 4HUEA 1SL1A 4DFMA 4KTQA 2X6SA 3AVMA 4Z4FA 4OKKA 4DF4A 3TAEA 4LH5A 4KI4A 1S6QA 4NCGA 3PO5A 3JYTA 4CJKA 1U4BA 2BDPA 1YTAA 1TAQA 3TWHA 1TGOA 2G8IA 3NAEA 3U3YA 4OLAA 3T19A 2IAJA 1C0TA 1SV5A 4B08A 4CK3A 4CJEA 1FK9A 4CEOA 4RW9A 1EETA 1I3AA 3DOKA 3NFAA 2BE2A 4OKEA 4CF2A 3CFRA 3QEIA 3TARA 1UA0A 3OYNA 3NF6A 4DTXA 4CJWA 4PY5A 4B9LA 1TKXA 3VQCA 4FJXA 4CJUA 2GBZA 2KQ2A 3CM5A 2WONA 3LPTA 4N56A 1WNSA 3DRRA 3KTQA 3RR8A 5JS1A 4Y1CA 3SJJA 4Y1DA 3DOLA 3K5OA 3IG1A 4IFVA 4BE2A 3V9UA 3MXMA 4JS5A 3AO3A 4Q0BA 3L2QA 1IH7A 1WSJA 4DLGA 4CHZA 3EYZA 3SPZA 4NCBA 4O5BA 1NJXA 1Y97A 1N6QA 4M3TA 4DSKA 3VQBA 4CHQA 4KB1A 1JL1A 3L3UA 4OVLA 2FBTA 5JS2A 3OS1A 2I5JA 3OYMA 4IBNA 4FM2A 1DTQA 3LP2A 1RTJA 2DFEA 4E19A 3HPOA 3ZSQA 4CEZA 2KZZA 1WSEA 3CQ8A 5I42A 4FJ8A 4FJGA 2B4JA 4M3UA 5E41A 1Z25A 3QIOA 3S3MA 2OA8A 3LAMA 1RBUA 1RILA 3S3NA 3RTVA 4B8CA 3IAYA 1RBSA 1JKHA 2YHBA 1RBTA 3OVNA 3OYKA 2KW4A 3RRHA 2KTQA 4FW1A 1K6YA 3DLRA 3VQ4A 4EZ6A 2OPSA 1HYVA 3P1GA 3L2UA 2IS3A 4W5OA 2JLEA 1KFDA 4CJ4A 2QXFA 4CJRA 3TANA 3TAQA 4FZXC 4W5NA 2XY7A 4DTNA 4F3TA 1SKRA 3ZCMA 4FJKA 2DY4A 4LSLA 3M8QA 5HROA 4O0IA 3SI6A 1SKWA 1VRTA 2EHGA 3K2PA 4FLXA 1IG9A 4N76A 1VRUA 2Y1IA 4IKFA 3HK2A 4LD0A 4KHQA 1LWFA 3EZ5A 3AVBA 1TAUA 3SUOA 3ZSWA 2Y1JA 4JLHA 2QKKA 3RMBA 1IKVA 1VSJA 1LW0A 2XRIA 1ZBLA 3WNHA 3V9XA 3QEWA 1ZBUA 1NJZA 3QESA 3DLHA 4B9UA 3QNNA 1B92A 4FVMA 2VG7A 1A5WA 4KHWA 4G1QA 2BGGA 1ZBIA 5HP1A 1JLEA 5EU7A 1VSDA 3ZT3A 4CK2A 4ID1A 3T3FA 1KLMA 4DQPA 4CHNA 4B9SA 4HVJA 4CGIA 4E7IA 3JSMA 1QTMA 2XY5A 4B9MA 1XHZA 5CZ1A 3VQ5A 4JRPA 1X9WA 4HCCA 3VQPA 4M3YA 1HNIA 3DLBA 4FCYA 4CIGA 1LWEA 1NK8A 4CIEA 4FZYA 4FZZA 1HNVA 3SQ1A 2YNIA 1SUQA 2GV9A 3NF9A 4DSIA 4OJRA 4CHPA 4DLEA 2G8KA 3WNEA 3QINA 1XHXA 3LWMA 1TKZA 4CF8A 3KLFA 3QEVA 1R0AA 5J1EA 3HPHA 1LAVA 3IS9A 2OZMA 3AVLA 1J9AA 3ZSYA 2O4GA 3OYCA 4M41A 1D8YA 3TR8A 4K8XA 1DTTA 3ITHA 4AHSA 4KAZA 4FJMA 1JLFA 3AVFA 4BACA 1KVBA 5CY4A 1GOAA 5CZ2A 4CEAA 3HL8A 2D0CA 1X9MA 3LANA 2IOCA 3HP6A 4L8RB 4O44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I39 A;  1HYZ A;  2YNH A;  1IKX A;  1RT2 A;  1BIU A;  3G0Z A;  1ZYQ A;  1RTH A;  4CCH A;  1RT4 A;  1U04 A;  3ZT0 A;  4KTW A;  3NGI A;  4DSF A;  3CYM A;  4F8R A;  1VSM A;  5HRP A;  3OY9 A;  4I9L A;  3NE6 A;  3HVT A;  4QAG A;  2HHT A;  4JRQ A;  1KSP A;  1NJY A;  1TK5 A;  4FLY A;  3ZSZ A;  3ZSO A;  1QSY A;  4F2R A;  3RMA A;  4M3R A;  3ZT1 A;  1C1B A;  5C42 A;  4DU4 A;  1W0H A;  3AO2 A;  3IRX A;  3PUF A;  5HBM A;  4CFC A;  1CXQ A;  2A1S A;  1MU2 A;  1UWB A;  3L3V A;  4PA1 A;  4E3S A;  4BDY A;  4E7K A;  2ZQB A;  3OYI A;  3KD5 E;  4I9Q A;  4M3Z A;  1QS4 A;  3E01 A;  1J54 A;  3QLH A;  3U3G A;  2PY5 A;  3CG7 A;  2X6N A;  2NUB A;  4AHV A;  4DU1 A;  4TSX A;  4E7H A;  1RT7 A;  1WAF A;  3K57 A;  2XY6 A;  1UAX A;  1NK0 A;  4FW2 A;  4FJJ A;  2HNZ A;  3M8S A;  2RKI A;  1A5V A;  1RT3 A;  1U49 A;  2O4I A;  1S5J A;  3AVK A;  3V1Q A;  3OJS A;  1W9H A;  3TI0 A;  4FK4 A;  1CLQ A;  2P51 A;  1LWC A;  2GUI A;  3I0S A;  2PZS A;  4HUG A;  3KJV A;  1QSL A;  1RTD A;  3RR7 A;  2IC3 A;  2VWK A;  4M3X A;  3O3G A;  1RDB A;  2P5O A;  2HHS A;  4CFA A;  4RW7 A;  1RT1 A;  5SZT A;  1Q9Y A;  4K8Z A;  1RT6 A;  3AO4 A;  3MEG A;  3MXJ A;  3QEX A;  5C25 A;  2YKM A;  3TAB A;  1WSH A;  2DFH A;  4CF0 A;  3RMD A;  2KZM A;  2D5R A;  1HQU A;  1JL2 A;  1WSF A;  3ASM A;  1BCM A;  2ITG A;  3HST B;  3NGY A;  4FXD A;  1NK7 A;  1VSE A;  1S1U A;  3KLH A;  5KGW A;  3PX6 A;  1KCF A;  3AVN A;  4ZTJ A;  4BDZ A;  1RDA A;  1ASU A;  4ID5 A;  4IG0 A;  1BQN A;  1RDC A;  4GVM A;  2DFF A;  3V4I A;  2X74 A;  4FM0 A;  3LPU A;  4MQ3 A;  2WOM A;  1U45 A;  2Z1H A;  4B9T A;  2VG5 A;  4HTU A;  4NYN A;  2BAN A;  1UA1 A;  4N41 A;  4RG8 A;  1KLN A;  4FJH A;  1BIS A;  1KVA A;  1REV A;  2P5G A;  3ZT4 A;  4KO0 A;  1D5A A;  3AVJ A;  1JLQ A;  4BWJ A;  2P1J A;  4Z0U A;  3BGR A;  1T03 A;  3VQQ A;  1EP4 A;  3A2F A;  1YVU A;  4AHR A;  3TAG A;  3HVR A;  4DQR A;  1C1C A;  3V81 A;  1L3S A;  1L3U A;  4PWD A;  1NKE A;  1YT3 A;  4H4M A;  3WNF A;  1Z26 A;  4J2E A;  4CJS A;  4J2A A;  3OYE A;  2YNG A;  2Z1J A;  4RW8 A;  1S1W A;  1RCH A;  2HNY A;  3KK1 A;  3BDP A;  2HMI A;  2DTU A;  2OYQ A;  3NF8 A;  2VG6 A;  3KLG A;  2FBV A;  1DLO A;  1NOY A;  4XIU A;  3NGZ A;  5KI6 A;  2ZE2 A;  3DM2 A;  4OLB A;  4BE1 A;  4CK1 A;  3VA3 A;  4DTJ A;  2ATQ A;  3OYL A;  1KVC A;  1N5Y A;  3DYA A;  4BDP A;  4CGG A;  4CIF A;  3OYD A;  3AVI A;  2ETJ A;  1S6P A;  3VQD A;  2D0A A;  4AHU A;  3ALY A;  2G8H A;  4KB0 A;  4FK0 A;  4UQG A;  4DTR A;  1TK0 A;  1RBR A;  3SV4 A;  3KK2 A;  1KRP A;  4F4K A;  3SQ2 A;  2HHW A;  1IKW A;  1JLG A;  4N47 A;  1HJR A;  3OYF A;  1QSS A;  1ASW A;  4DQI A;  4IDK A;  1U48 A;  4CFB A;  3CFP A;  2G8V A;  3OS0 A;  3PV8 A;  4PUO A;  4DTO A;  2FC0 A;  3G10 A;  3NDK A;  3S9H A;  2HHU A;  4C8L A;  4N5S A;  2E4L A;  3KIO A;  1QQC A;  1WAJ A;  3P83 D;  4Z4H A;  4CEE A;  1BI4 B;  4DWI A;  5FDL A;  4YNQ A;  4LSN A;  4AH9 A;  4I2P A;  1HMV A;  3KKR A;  1SL0 A;  3ZT2 A;  4IFY A;  3OYG A;  3MXI A;  4J2B A;  4CGD A;  3DLK A;  1WN7 A;  2HVH A;  4AIL C;  3NCI A;  3AVA A;  4O4G A;  3LDS A;  3V9S A;  1B9D A;  1EKE A;  1O1W A;  3AVC A;  3NH2 A;  3NF7 A;  2Z1I A;  4CGJ A;  3L2V A;  2G8U A;  3OYH A;  4E1N A;  4CF1 A;  3SZ2 A;  2AJQ A;  2HB5 A;  3VQ8 A;  2F8S A;  3HPG A;  1VK0 A;  3DRS A;  4E89 A;  3EY1 A;  3PO4 A;  2W42 A;  1RBV A;  3NBP A;  4C8O A;  1NKC A;  3VQ9 A;  1HRH A;  3TAP A;  1L3V A;  2A1R A;  3OJU A;  1ASV A;  3C94 A;  4W5R A;  2R7Y A;  4E0D A;  4CE9 A;  4H8K A;  1BGX T;  2YNF A;  3AVG A;  3C6U A;  1VSL A;  4OPK A;  1WSI A;  2YV0 X;  3AA5 X;  2F96 A;  1SL2 A;  2HW3 A;  1RDD A;  4GMJ B;  1LAW A;  1T8E A;  1LW2 A;  1JLB A;  2FBY A;  4KPY A;  1BQM A;  4RW4 A;  4OGE A;  3KLI A;  3UIQ A;  4KHN A;  2IGI A;  4CEQ A;  3RWU A;  3VN5 A;  1ZBF A;  4CJF A;  4DQQ A;  1VSH A;  4FLU A;  3ZSR A;  3WNG A;  4J2D A;  3C6T A;  4E7J A;  4F3O A;  4QOZ B;  3SUQ A;  1BCO A;  4DG1 A;  4CEC A;  2E6M A;  4ELT A;  3K5M A;  1C1A A;  3HP9 A;  3LP1 A;  3F9K A;  4HHT A;  5J2Q A;  3SYZ A;  5FRM A;  2X78 A;  1U47 A;  1TL1 A;  4DSE A;  3K5N A;  1FKP A;  3L2W A;  1T05 A;  1A5X A;  4CGH A;  5J2P A;  3SCX A;  5I3U A;  4HUF A;  1QHT A;  3QER A;  4DU3 A;  3AA3 A;  2HND A;  4MFB A;  3PX0 A;  1J5O A;  4Z4I A;  1GOB A;  2B5J A;  4PQU A;  3MEE A;  2G8W A;  2PYJ A;  5SWM A;  3KKS A;  4CER A;  1TL3 A;  3L2R A;  4KV8 A;  4ELV A;  5KRS A;  3SUN A;  2QKB A;  4KRF A;  3NHG A;  3AV9 A;  4W5T A;  4NCA A;  4M3W A;  4C8N A;  4DTM A;  2KFZ A;  3LAL A;  4CF9 A;  4CEB A;  4DS5 A;  3O3F A;  1T7P A;  4KHU A;  3ULD A;  5HRS A;  2XY8 A;  4CJL A;  3AA4 A;  5HRR A;  4DSJ A;  3B6P A;  1D9D A;  4DTP A;  1HYS A;  1JXB A;  2JGU A;  4W5Q A;  4FJI A;  4NYF A;  3DRP A;  2KFN A;  1BHL A;  2OPR A;  4FLW A;  3V6D A;  1HQE A;  2LSN A;  5KRT A;  3L8B A;  1YTU A;  1VSI A;  2OPQ A;  3QNO A;  3RMC A;  2F8T A;  2HHQ A;  4B9N A;  2OZS A;  4B9V A;  3T1A A;  4CJT A;  4R5P A;  4KHS A;  3V9Z A;  2B6A A;  1HPZ A;  3M8R A;  1Q9X A;  1Q8I A;  4CEF A;  1EXQ A;  3HT3 A;  3I8D A;  3TAM A;  3SQ0 A;  1CXU A;  4LY7 A;  3KK3 A;  3F73 A;  4CFD A;  5DK5 A;  2HHX A;  3LWL A;  3I0R A;  3V1O A;  4LH4 A;  4CGF A;  4E1M A;  5J2M A;  3P5J A;  2QK9 A;  4H4O A;  2YKN A;  4KFB A;  4B8A B;  1TV6 A;  3ZSV A;  4CHO A;  3C95 A;  3NH1 A;  5HRN A;  1C0U A;  4OPJ A;  4EP5 A;  3DLG A;  3K58 A;  1XWL A;  1WLJ A;  3PY8 A;  4FJL A;  2ZD1 A;  3V9W A;  4Q5V A;  1NK9 A;  3QEP A;  3VQE A;  2OPP A;  3B6O A;  1F21 A;  3SPY A;  1SKS A;  2IDO A;  3MED A;  1TKD A;  4KTZ A;  1J53 A;  2PYL A;  2YHA A;  4CJ5 A;  3VQA A;  1JLA A;  4M42 A;  1BIZ A;  4DFK A;  2G8F A;  5D3G A;  3SQ4 A;  4Z4E A;  3D0P A;  1X9S A;  3DMJ A;  1BI4 A;  4DTU A;  1UOC A;  4BWM A;  3AVH A;  2FBX A;  3OYB A;  4WE1 A;  4HCB A;  3O4Q A;  4FJN A;  4KKO A;  4O0J A;  1NKB A;  5DMR A;  2HVI A;  3U6F A;  1ZBH A;  1C0M A;  3LZJ A;  4BE0 A;  3QET A;  1TKT A;  4CHY A;  4FJ9 A;  3LP0 A;  1FKO A;  4OGC A;  4E7L A;  1VSF A;  4FYD A;  4DMN A;  3K5L A;  3SV3 A;  3SNN A;  4OKJ A;  5C24 A;  3AO5 A;  4F2S A;  3ZSX A;  3THV A;  4CED A;  5K14 A;  4CJP A;  2RPI A;  5T7B A;  1S9E A;  5CYM A;  3O3H A;  3VA0 A;  3MEC A;  1S1X A;  1VSK A;  1GOC A;  3VQ7 A;  4FM1 A;  4CJ3 A;  4JS4 A;  5J2N A;  1NK6 A;  3RRG A;  3VQ6 A;  1JXE A;  3TAF A;  4O55 A;  3HJF A;  3LP3 A;  1XI1 A;  1NK4 A;  4CJQ A;  3NH0 A;  4ICL A;  3LZI A;  4DFJ A;  1CZB A;  1XC9 A;  1FXX A;  3HXM A;  3MAQ A;  4Z4G A;  4AHC A;  1S9G A;  4KHY A;  2XO7 A;  2D0B A;  1TK8 A;  4FK2 A;  4I2Q A;  4ZTF A;  4Z4C A;  1IKY A;  3OYJ A;  4CJV A;  4CES A;  2HHV A;  1RTI A;  2EX3 A;  3KD1 E;  3OS2 A;  4EZ9 A;  3H08 A;  1NOZ A;  1RT5 A;  1C6V A;  1QE1 A;  1IO2 A;  4RW6 A;  1JLC A;  4I7F A;  1CZ9 A;  3O4N A;  4C8M A;  4KI6 A;  3AO1 A;  3CM6 A;  4DF8 A;  5HLF A;  3DLE A;  4DQS A;  2Z1G A;  1L3T A;  3D45 A;  3PX4 A;  1WSG A;  3QIP A;  3DI6 A;  4DTS A;  3AA2 A;  2Q3S A;  2RN2 A;  1BL3 A;  1S1V A;  4ZHR A;  2E6L A;  3HM9 A;  3FFI A;  4DS4 A;  3SUP A;  3KLE A;  1NK5 A;  1KTQ A;  5CYQ A;  1G15 A;  4EP4 A;  1KFS A;  4ELU A;  4QCL A;  3K59 A;  1B9F A;  3OYA A;  4DFP A;  1L5U A;  4KRE A;  4C8K A;  5FRO A;  2VWJ A;  5KTQ A;  1EX4 A;  3S3O A;  4FLT A;  1NJW A;  1LV5 A;  5FRN A;  4GW6 A;  4FLZ A;  4YFU A;  1RNH A;  1ITG A;  4IG3 A;  4FLV A;  4FJ7 A;  3ISN C;  1D9F A;  4M45 A;  3HO1 A;  3QO9 A;  3V1R A;  3LAK A;  4B3O A;  1X1P A;  1S1T A;  3CFO A;  4DSL A;  2XHB A;  2RF2 A;  1TVR A;  3M8P A;  4AHT A;  4FJ5 A;  3HYF A;  5KGX A;  4HUE A;  1SL1 A;  4DFM A;  4KTQ A;  2X6S A;  3AVM A;  4Z4F A;  4OKK A;  4DF4 A;  3TAE A;  4LH5 A;  4KI4 A;  1S6Q A;  4NCG A;  3PO5 A;  3JYT A;  4CJK A;  1U4B A;  2BDP A;  1YTA A;  1TAQ A;  3TWH A;  1TGO A;  2G8I A;  3NAE A;  3U3Y A;  4OLA A;  3T19 A;  2IAJ A;  1C0T A;  1SV5 A;  4B08 A;  4CK3 A;  4CJE A;  1FK9 A;  4CEO A;  4RW9 A;  1EET A;  1I3A A;  3DOK A;  3NFA A;  2BE2 A;  4OKE A;  4CF2 A;  3CFR A;  3QEI A;  3TAR A;  1UA0 A;  3OYN A;  3NF6 A;  4DTX A;  4CJW A;  4PY5 A;  4B9L A;  1TKX A;  3VQC A;  4FJX A;  4CJU A;  2GBZ A;  2KQ2 A;  3CM5 A;  2WON A;  3LPT A;  4N56 A;  1WNS A;  3DRR A;  3KTQ A;  3RR8 A;  5JS1 A;  4Y1C A;  3SJJ A;  4Y1D A;  3DOL A;  3K5O A;  3IG1 A;  4IFV A;  4BE2 A;  3V9U A;  3MXM A;  4JS5 A;  3AO3 A;  4Q0B A;  3L2Q A;  1IH7 A;  1WSJ A;  4DLG A;  4CHZ A;  3EYZ A;  3SPZ A;  4NCB A;  4O5B A;  1NJX A;  1Y97 A;  1N6Q A;  4M3T A;  4DSK A;  3VQB A;  4CHQ A;  4KB1 A;  1JL1 A;  3L3U A;  4OVL A;  2FBT A;  5JS2 A;  3OS1 A;  2I5J A;  3OYM A;  4IBN A;  4FM2 A;  1DTQ A;  3LP2 A;  1RTJ A;  2DFE A;  4E19 A;  3HPO A;  3ZSQ A;  4CEZ A;  2KZZ A;  1WSE A;  3CQ8 A;  5I42 A;  4FJ8 A;  4FJG A;  2B4J A;  4M3U A;  5E41 A;  1Z25 A;  3QIO A;  3S3M A;  2OA8 A;  3LAM A;  1RBU A;  1RIL A;  3S3N A;  3RTV A;  4B8C A;  3IAY A;  1RBS A;  1JKH A;  2YHB A;  1RBT A;  3OVN A;  3OYK A;  2KW4 A;  3RRH A;  2KTQ A;  4FW1 A;  1K6Y A;  3DLR A;  3VQ4 A;  4EZ6 A;  2OPS A;  1HYV A;  3P1G A;  3L2U A;  2IS3 A;  4W5O A;  2JLE A;  1KFD A;  4CJ4 A;  2QXF A;  4CJR A;  3TAN A;  3TAQ A;  4FZX C;  4W5N A;  2XY7 A;  4DTN A;  4F3T A;  1SKR A;  3ZCM A;  4FJK A;  2DY4 A;  4LSL A;  3M8Q A;  5HRO A;  4O0I A;  3SI6 A;  1SKW A;  1VRT A;  2EHG A;  3K2P A;  4FLX A;  1IG9 A;  4N76 A;  1VRU A;  2Y1I A;  4IKF A;  3HK2 A;  4LD0 A;  4KHQ A;  1LWF A;  3EZ5 A;  3AVB A;  1TAU A;  3SUO A;  3ZSW A;  2Y1J A;  4JLH A;  2QKK A;  3RMB A;  1IKV A;  1VSJ A;  1LW0 A;  2XRI A;  1ZBL A;  3WNH A;  3V9X A;  3QEW A;  1ZBU A;  1NJZ A;  3QES A;  3DLH A;  4B9U A;  3QNN A;  1B92 A;  4FVM A;  2VG7 A;  1A5W A;  4KHW A;  4G1Q A;  2BGG A;  1ZBI A;  5HP1 A;  1JLE A;  5EU7 A;  1VSD A;  3ZT3 A;  4CK2 A;  4ID1 A;  3T3F A;  1KLM A;  4DQP A;  4CHN A;  4B9S A;  4HVJ A;  4CGI A;  4E7I A;  3JSM A;  1QTM A;  2XY5 A;  4B9M A;  1XHZ A;  5CZ1 A;  3VQ5 A;  4JRP A;  1X9W A;  4HCC A;  3VQP A;  4M3Y A;  1HNI A;  3DLB A;  4FCY A;  4CIG A;  1LWE A;  1NK8 A;  4CIE A;  4FZY A;  4FZZ A;  1HNV A;  3SQ1 A;  2YNI A;  1SUQ A;  2GV9 A;  3NF9 A;  4DSI A;  4OJR A;  4CHP A;  4DLE A;  2G8K A;  3WNE A;  3QIN A;  1XHX A;  3LWM A;  1TKZ A;  4CF8 A;  3KLF A;  3QEV A;  1R0A A;  5J1E A;  3HPH A;  1LAV A;  3IS9 A;  2OZM A;  3AVL A;  1J9A A;  3ZSY A;  2O4G A;  3OYC A;  4M41 A;  1D8Y A;  3TR8 A;  4K8X A;  1DTT A;  3ITH A;  4AHS A;  4KAZ A;  4FJM A;  1JLF A;  3AVF A;  4BAC A;  1KVB A;  5CY4 A;  1GOA A;  5CZ2 A;  4CEA A;  3HL8 A;  2D0C A;  1X9M A;  3LAN A;  2IOC A;  3HP6 A;  4L8R B;  4O44 A; 
#chains in the Genus database with same CATH topology
 2O8C B;  4B1X B;  1RT2 A;  5HL7 L;  4YOW A;  1DGK N;  3OY9 A;  3HVT A;  2HHT A;  1KSP A;  1NJY A;  1NGE A;  2YJE A;  4FPB A;  4O5F A;  1HKB A;  3QFP A;  1CXQ A;  3OYI A;  4CBX A;  4I9Q A;  4Y0W A;  3HOS A;  5JLF A;  2NUB A;  1NK0 A;  4TSX A;  2XY6 A;  1U49 A;  1A5V A;  2O4I A;  4BRP A;  3V1Q A;  1CLQ A;  1W9H A;  2P51 A;  3THX B;  4HUG A;  3LDN A;  3VGL A;  2ZGZ A;  4M3X A;  3VEW A;  4CFA A;  3AO4 A;  3WEE B;  3RSE A;  2YKM A;  1WSH A;  3FGU A;  1JL2 A;  2ITG A;  3IKM A;  1NK7 A;  2WUS A;  3DJC A;  5BPN A;  4M7Y A;  3PX6 A;  4ZTJ A;  3VEV A;  2YHX A;  3WXJ A;  4ID5 A;  1JCF A;  2DFF A;  2QWL A;  4FM0 A;  1TYQ B;  5BRF A;  1O13 A;  4CZG A;  1YHQ N;  4WQ5 A;  2P5G A;  4KO0 A;  1Q81 O;  1D5A A;  1EO1 A;  1JLQ A;  4FWS A;  4BQL A;  4BWJ A;  3FE1 A;  4PKG A;  3CJ1 A;  1V4S A;  1KAX A;  1T03 A;  1YVU A;  3HVR A;  4DQR A;  1VQ7 N;  3ZEU A;  3I55 N;  5JVG L;  5AQU A;  1NKE A;  1YT3 A;  4H4M A;  3WNF A;  4CJS A;  4J2A A;  4UY8 O;  1N33 K;  1RCH A;  2HMI A;  4JHD B;  4ILJ A;  2OYQ A;  3BP8 A;  1DLO A;  1NOY A;  5KI6 A;  2QEX N;  1X3N A;  5LMN K;  4KH6 A;  4BE1 A;  3VA3 A;  1KVC A;  3CJ7 A;  2IVN A;  3WQT A;  2KHO A;  3SMS A;  4FK0 A;  4DCH A;  3SV4 A;  1VQK N;  1KRP A;  4F4K A;  3C6H A;  1D4X A;  1JLG A;  3B8A X;  1HJR A;  3OYF A;  5AQX A;  3MWP A;  4LFB K;  2G8V A;  2GTD A;  4BC4 A;  1EWR A;  3NDK A;  2HHU A;  4NLC A;  4C8L A;  4N5S A;  3J7Y P;  4H5T A;  1BI4 B;  4CEE A;  4DWI A;  1U2V B;  4I2P A;  1HMV A;  5C15 A;  3ZT2 A;  4RWT A;  1J5E K;  3NCI A;  3V9S A;  2Q97 A;  3AVC A;  2Z1I A;  4E1N A;  3SZ2 A;  3ATU A;  2F8S A;  4C23 A;  5IWA K;  1RBV A;  1NKC A;  1HRH A;  1ZC6 A;  3EEQ A;  4W5R A;  2R7Y A;  4H8K A;  2YNF A;  1SL2 A;  4YOV A;  5GAG P;  3VEX A;  1JLB A;  4RW4 A;  2IGI A;  4CEQ A;  3VN5 A;  1ZBF A;  4JI6 K;  2QTD A;  4FLU A;  3U8X A;  2V7Z A;  4QOZ B;  2WC9 A;  4CEC A;  2E6M A;  4ELT A;  5J2Q A;  3SYZ A;  1XUP O;  1U47 A;  3K5N A;  5AQR A;  5J2P A;  4HUF A;  1QHT A;  1W97 L;  4X64 K;  2E2N A;  4PQU A;  2HND A;  2G8W A;  3KKS A;  2A42 A;  1K8A O;  2P9I A;  5M1O A;  5JMV A;  4W5T A;  4DTM A;  3CJ9 A;  1T7P A;  4FWQ A;  4DTP A;  1JXB A;  3THW B;  3CF5 L;  3DRP A;  2OPR A;  3SAF A;  3PIO L;  4L3Q A;  4B9N A;  4LF6 K;  4KHS A;  3DXK A;  2B6A A;  2QXL A;  3A5O C;  1Q9X A;  4A5A A;  3I8D A;  1YAG A;  2AA4 A;  4LY7 A;  2E2Q A;  4BRC A;  4JI4 K;  3F73 A;  1XMQ K;  3DWL A;  3K9J A;  3CXC M;  3P5J A;  4H4O A;  2YKN A;  2E20 A;  3LDQ A;  1XNQ K;  1C0U A;  4OPJ A;  3DLG A;  1VQL N;  1XWL A;  3CPW M;  2ZD1 A;  1ESV A;  2P9P B;  3L4Q A;  4CW7 B;  1KQS M;  1TKD A;  3SBG A;  4LFC K;  4JKE A;  2YHY A;  2YHA A;  3CER A;  3VQA A;  3ZLJ A;  2O8D A;  5D3G A;  4Z4E A;  3DMJ A;  3LDL A;  1GLF O;  4HCB A;  1HPM A;  2GEM A;  4KKO A;  4O0J A;  4BRD A;  1ZBH A;  3LZJ A;  1HR0 K;  4KBO A;  4XH1 A;  1FKO A;  4OGC A;  3ZET B;  4DMN A;  1T44 A;  3K5L A;  4K43 A;  4F2S A;  5K14 A;  4CJP A;  2NRT A;  5T7B A;  1XQS C;  1S1X A;  4JYA K;  3VQ7 A;  1NK6 A;  4JS4 A;  3BY5 A;  5LY3 A;  3VQ6 A;  3TAF A;  2CH6 A;  2E8A A;  1NK4 A;  4KH4 A;  2ZM6 K;  3NH0 A;  4JKB A;  4ICL A;  4KHY A;  3O1W A;  4FK2 A;  4Z4C A;  2OAN A;  2P9S B;  2HHV A;  2EX3 A;  1QE1 A;  4FWN A;  4RW6 A;  3D45 A;  1RGI A;  3PX4 A;  1WSG A;  1VQ5 N;  2Q3S A;  1BL3 A;  3O9R A;  4ZHR A;  1NK5 A;  3KLE A;  1B9F A;  2VWJ A;  3Q7B A;  4MO5 A;  4FJ7 A;  3ISN C;  3OBY A;  3CJC A;  2XHB A;  3M8P A;  2YCH A;  4HUE A;  1SL1 A;  1BWF O;  1QQN A;  4Z4F A;  3KHY A;  4KI4 A;  4LF5 K;  1S6Q A;  3GOI A;  1JJ2 M;  2OTL N;  2QWN A;  2G8I A;  5C2D A;  2IAJ A;  3GL1 A;  4PL8 A;  3O8M A;  4CEO A;  4RW9 A;  5FPD A;  3DOK A;  4OKE A;  3ZYY X;  3VEN A;  3T1H K;  2YX6 A;  1VQO N;  4CJW A;  5FPM A;  3NVM A;  3ZX2 A;  5GIO A;  2WON A;  3GDQ A;  3L4I A;  3VEY A;  3J8A A;  4Y1C A;  4FWR A;  3DOL A;  4JS5 A;  2QWQ A;  4CZK A;  4V19 S;  3EYZ A;  2H3G X;  4IOA L;  3VQB A;  4CHQ A;  3N4Q A;  5IT9 O;  4FM2 A;  2P9K A;  3OYM A;  3EO3 A;  3HPO A;  1WSE A;  3QB0 A;  4FJ8 A;  4FJG A;  4GV9 A;  4JKG A;  4BRA A;  3LAM A;  3S3N A;  3RTV A;  4BR4 A;  1RBS A;  3ATV A;  2IIR A;  2KW4 A;  2KTQ A;  3THY B;  2RE2 A;  3DLR A;  1HYV A;  2IS3 A;  4CZJ A;  1KFD A;  4CJ4 A;  2QXF A;  3TAN A;  5GAE P;  4ISF A;  4FZX C;  4DTN A;  5TKW A;  1HLU A;  4LSL A;  4DV2 K;  4FOI A;  3I33 A;  1SKW A;  1IG9 A;  3TU5 A;  4CI6 A;  4IXC A;  4K25 A;  2HOE A;  4JLH A;  1Y64 A;  1IKV A;  2XRI A;  3QEW A;  3DLH A;  3QES A;  1B92 A;  4H0Y B;  1M1K O;  2P9L A;  1ZBI A;  1KAY A;  3ZT3 A;  4CK2 A;  2O8B A;  1V4T A;  3T3F A;  1KLM A;  4DQP A;  4B9S A;  4CGI A;  4JN4 A;  4E7I A;  3AGK A;  4CZE A;  5BR9 A;  3SK3 A;  5CZ1 A;  1XMO K;  1X9W A;  4M7X A;  4B9Q A;  4HCC A;  3DLB A;  1LWE A;  4BR9 A;  4CIE A;  4DR4 K;  3SQ1 A;  4H0V B;  4DLE A;  1R0A A;  3MWT A;  1M90 O;  3HPH A;  1LAV A;  3IS9 A;  2VWB A;  1YJ9 N;  3ENB A;  3O9Q A;  4M41 A;  2V51 B;  3TR8 A;  4KAZ A;  3AAP A;  4I6M B;  3HL8 A;  3LAN A;  3J80 O;  2FSJ A;  3HP6 A;  1E3M A;  4O44 A;  1VQP N;  1W2B M;  2YNH A;  4KH5 A;  1RTH A;  1RT4 A;  4ISG A;  1U04 A;  2QI2 A;  5AZJ B;  3ZT0 A;  5C2F A;  3NGI A;  1VSM A;  3GE1 A;  5HRP A;  4I9L A;  4JRQ A;  3QML A;  1TK5 A;  4FLY A;  1QSY A;  1VQ6 N;  1TUY A;  3M5R A;  1WBB A;  3BZK A;  4M3R A;  3ZT1 A;  1W0H A;  3IRX A;  3PUF A;  4CFC A;  2F4V K;  2E1Z A;  2A1S A;  3L3V A;  1S3X A;  1UWB A;  5AQO A;  4E3S A;  2ZQB A;  4CBU A;  3KD5 E;  3E01 A;  1J54 A;  4K42 A;  4JI0 K;  3U3G A;  4EFH A;  3CG7 A;  3R1X A;  4AHV A;  1WAF A;  3K57 A;  1NGJ A;  1UAX A;  3E66 A;  3C0B A;  4FW2 A;  4FK4 A;  2QWP A;  3KK7 A;  4ILH A;  3R6M A;  4LC9 B;  5CE3 A;  2GUI A;  3I0S A;  3AY9 A;  2PZS A;  4CZM A;  1RTD A;  2IC3 A;  3O3G A;  3BZC A;  5AQN A;  1MWM A;  2P5O A;  4RW7 A;  3CCJ N;  3CJA A;  3TAB A;  4JD2 A;  5C25 A;  3D2F B;  3RMD A;  2KZM A;  1WSF A;  3HST B;  3SAH A;  4FXD A;  3MX5 A;  3KLH A;  3AVN A;  4BDZ A;  1RDA A;  1ASU A;  1BQN A;  1RDC A;  2NNW A;  1IV0 A;  3E9L A;  3LPU A;  2WOM A;  2VG5 A;  4EAH D;  2P9U A;  5TKY A;  3K9K A;  1KVA A;  1REV A;  3ENH A;  2P1J A;  2P9N A;  3WT0 A;  3A2F A;  1L3U A;  3V81 A;  2CGJ A;  3H3N O;  3EZW A;  3FZM A;  4J2E A;  4O8K A;  3WXI A;  2HNY A;  3BDP A;  3NF8 A;  4DV7 K;  4XIU A;  3NGZ A;  4FVU A;  4CK1 A;  3VF4 A;  4U7B A;  1I94 K;  2ATQ A;  1NWK A;  3DYA A;  4CGG A;  4F9O A;  1BA0 A;  3O9T A;  4CIF A;  1HNX K;  3AVI A;  1S6P A;  4X66 K;  3O9S A;  2D0A A;  3ALY A;  4IOX A;  1N36 K;  4JI2 K;  4DTR A;  3UE5 A;  1RBR A;  1TK0 A;  1P90 A;  3FR0 A;  3SQ2 A;  2HHW A;  1QZ5 A;  1ASW A;  3P38 A;  1RFQ A;  4JAX A;  1U48 A;  4CFB A;  3CFP A;  1GLJ O;  4OPA A;  5AQV A;  3LDO A;  4DTO A;  5M1P A;  3BUZ B;  1VQ9 N;  1WAJ A;  5LL6 Z;  4Z4H A;  2D0O A;  4IOC L;  4AIL C;  4WQ5 C;  5M1K A;  3AVA A;  5B8H A;  3O9U A;  5BN9 A;  3IUC A;  1RDW X;  3L2V A;  3OYH A;  4CF1 A;  2UXB K;  3LM9 A;  4LF4 K;  1VK0 A;  3D6R A;  2PBD A;  5AR0 A;  3NBP A;  4C8O A;  1J6Z A;  3THX A;  2A1R A;  3C94 A;  1YJN N;  4DV1 K;  1E4G T;  3C6U A;  1VSL A;  4OPK A;  3AA5 X;  4A59 A;  2O8E B;  3H45 C;  1T8E A;  4A62 A;  1LW2 A;  5EOY A;  5C12 A;  1BQM A;  3G4S N;  5HOO A;  3CCS N;  4KHN A;  3CI5 A;  3D2E B;  4CJF A;  3WEE A;  1YF5 L;  1FJG K;  3UKU B;  3ZSR A;  4J2D A;  3C6T A;  4F3O A;  5M1F A;  3SUQ A;  2IVP A;  5BRE A;  4DR1 K;  3TSU A;  2WTU A;  1C1A A;  3F9K A;  2VQE K;  1QVG M;  2X78 A;  4FWP A;  3O5B A;  5CR4 A;  4DV3 K;  3SMP A;  5BRD A;  5I3U A;  4CGH A;  1TYQ A;  3QER A;  4FWK A;  3PX0 A;  4MFB A;  1GOB A;  3MEE A;  4CER A;  4ELV A;  4BRK A;  3CMA N;  3VTH A;  1NG9 A;  3H1Q A;  3LAL A;  4JKA A;  1HJO A;  3O3F A;  4KHU A;  5HRS A;  3R8E A;  5HRR A;  5BRH A;  3B6P A;  1D9D A;  4NYF A;  1WBD A;  1XC3 A;  1BHL A;  1NGH A;  2J4R A;  2V7Y A;  3I8B A;  4FLW A;  5KRT A;  3LL3 A;  1VSI A;  4DR3 K;  1ATN A;  4QS7 A;  2FSN A;  3T1A A;  4CJT A;  4R5P A;  3M8R A;  4JHD A;  3HT3 A;  3TTC A;  1ATR A;  2HHX A;  4CGF A;  5J2M A;  1N34 K;  2QK9 A;  4AM7 A;  1Q18 A;  4KFB A;  1TV6 A;  3FZK A;  4CZF A;  5EX5 A;  1VAZ A;  1YXQ A;  3E9O A;  4JKH A;  3V9W A;  2VYP A;  1SKS A;  1F21 A;  3MED A;  3R9P A;  1JLA A;  4M42 A;  4DFK A;  3P4I A;  3DAW A;  2W40 A;  1U6Z A;  1EWQ A;  3WQU A;  1BI4 A;  1UOC A;  1VQN N;  1YIJ N;  1U2V A;  2FBX A;  1Q86 O;  3H6E A;  3O4Q A;  1NKB A;  5DMR A;  4WFN L;  2HVI A;  3U6F A;  4BE0 A;  3QET A;  1TKT A;  4CHY A;  3VES A;  3LP0 A;  4GNI A;  4BG8 A;  1VSF A;  4OKJ A;  3AO5 A;  2BUP A;  3THV A;  2RPI A;  3CME N;  4NXN K;  5AQL A;  1VSK A;  1JXE A;  1BG3 A;  5C0Y A;  1XI1 A;  3G25 A;  5EXW A;  3LZI A;  3CD6 N;  1S9G A;  3HZ6 A;  4BC3 A;  3DXM B;  4H0X B;  5DM7 L;  5M1Q A;  1TK8 A;  4MLH A;  4ZTF A;  5KQD A;  2UYT A;  2ZF5 O;  3OYJ A;  1YI2 N;  3IMX A;  4CES A;  1RTI A;  1MWK A;  4HWI A;  3KD1 E;  3H08 A;  1JLC A;  5AQY A;  4I7F A;  1CZ9 A;  3O4N A;  3DLE A;  4DQS A;  5BPM A;  2Z1G A;  3C7N B;  3DI6 A;  3CET A;  3AA2 A;  2E2O A;  2E6L A;  4DR6 K;  1NLV A;  1KFS A;  4KRE A;  4C8K A;  5FRO A;  3S3O A;  4FLT A;  3G71 N;  4YFU A;  1RNH A;  5KPR A;  1WB9 A;  5GAD P;  4IG3 A;  1D9F A;  2ZJQ L;  3V1R A;  2F7T A;  3LAK A;  1X1P A;  4JKC A;  4IEE A;  3CC4 N;  1K9M O;  4DSL A;  3THW A;  3PSF A;  4KTQ A;  4CJ7 A;  2X6S A;  4DUY K;  4DF4 A;  5ELZ A;  2GX9 A;  4LH5 A;  4FWO A;  1KAZ A;  3PO5 A;  4ILG B;  4CJK A;  1U4B A;  5E84 A;  1TAQ A;  2HBL A;  4OLA A;  3T19 A;  1NGG A;  4CK3 A;  2HST A;  4CJE A;  1FK9 A;  3GG4 A;  3NF6 A;  1TKX A;  3VQC A;  4DV5 K;  1NMN A;  4FJX A;  3BF1 A;  4A57 A;  2GBZ A;  2KQ2 A;  3T7Z A;  3DRR A;  3F5T A;  5JS1 A;  2GUP A;  2P9P A;  4IFV A;  4BE2 A;  3AO3 A;  4Q0B A;  4BRQ A;  1WSJ A;  4J8F A;  5A2Q O;  4NCB A;  1Y97 A;  3AAQ A;  3KWI A;  3HBT A;  1JL1 A;  1MA9 B;  3QEI A;  4F8R A;  2I5J A;  4JNE A;  4E19 A;  3CQ8 A;  2B4J A;  1XNR K;  4M3U A;  1GLE G;  3MK6 A;  5E41 A;  3S3M A;  2OA8 A;  1RBU A;  1RIL A;  2BH1 A;  1CZA N;  4H03 B;  2NRW A;  3ZET A;  1X9J A;  4JK9 A;  3RRH A;  4JKD A;  3VQ4 A;  2OPS A;  4RCH A;  4C1N K;  2JLE A;  4AQY K;  2XY7 A;  3VPZ A;  4O0I A;  1VRT A;  3K2P A;  1NJI O;  1HUX A;  1VQM N;  4N76 A;  1VRU A;  4CBW A;  3F9M A;  3HK2 A;  1TAU A;  3L6Q A;  2P9S A;  3JAM O;  2Y1J A;  3RMB A;  2IVO A;  3QNN A;  4KHW A;  4G1Q A;  1RDU A;  1JLE A;  5EU7 A;  1VSD A;  4ID1 A;  4JKF A;  1OKJ A;  1BUP A;  3QBW A;  1XHZ A;  3VQ5 A;  3EE9 A;  4M3Y A;  1HNI A;  4JI5 K;  2EWS A;  3CPE A;  4FZY A;  4FZZ A;  4MO4 A;  2GV9 A;  3NF9 A;  4DSI A;  4OJR A;  4CHP A;  2G8K A;  3WNE A;  2OTJ N;  1XHX A;  3LWM A;  3QIC A;  1C0F A;  3C65 A;  1DTT A;  3ITH A;  4AHS A;  2HF4 A;  3AVF A;  4CEA A;  1GOA A;  5CZ2 A;  1BIU A;  3G0Z A;  3O08 A;  1ZYQ A;  3J7Z O;  4CZL A;  4CCH A;  4KTW A;  3CCL N;  4BR2 A;  3A0I X;  3CYM A;  1JCE A;  3ZSZ A;  4F2R A;  3RMA A;  2O8F B;  5C42 A;  4DU4 A;  4PA1 A;  4E7K A;  3FLC O;  2PY5 A;  2HF3 A;  4E7H A;  1RT7 A;  4FO0 A;  3W3D A;  4FJJ A;  5BPL A;  2RKI A;  1RT3 A;  1S5J A;  3AVK A;  4LF7 K;  3OJS A;  3G6E N;  1LWC A;  4GY2 B;  3QFU A;  4YOX A;  3KJV A;  4B3M K;  1T3V A;  2VWK A;  4NO7 A;  3CJB A;  2HHS A;  5SZT A;  1RT1 A;  4B3S K;  4OX9 K;  1OVY A;  4IO9 L;  3QEX A;  3ULE B;  5AQS A;  1GLL O;  1HQU A;  3VGM A;  3U9Z A;  1VSE A;  3UKR B;  2KLA A;  5KGW A;  1N32 K;  4DV6 K;  4IG0 A;  5AQP A;  2VGN A;  3V4I A;  2QA4 N;  3H1V X;  4NYN A;  2BAN A;  3K0S A;  1X3M A;  1UA1 A;  3P31 A;  1Q82 O;  4N41 A;  4RG8 A;  1KLN A;  1OH7 A;  1IBL K;  5H1S Q;  3ZT4 A;  4CVN E;  5FPE A;  2QWO A;  2A41 A;  5F2R A;  4AHR A;  3CC2 N;  4CD3 A;  2D1K A;  1HKG A;  2HHQ A;  3OYE A;  2Z1J A;  4BC2 A;  3EKU A;  3MN7 A;  3MX2 A;  2ZE2 A;  4OLB A;  4DTJ A;  3N4P A;  1WUA A;  3OYD A;  4LFA K;  3VQD A;  4R79 A;  3M6G A;  4AHU A;  4BR7 A;  2G8H A;  2E1Y A;  4I6M A;  3KK2 A;  2A40 A;  2Q31 A;  3IFR A;  4N47 A;  4IDK A;  4WQ4 A;  5C10 A;  3OS0 A;  5GIP A;  4AF1 A;  3OTO K;  2UUB K;  4PUO A;  2E4L A;  1QQC A;  4H5W A;  5FDL A;  4YNQ A;  4LSN A;  3P39 A;  1NNE A;  2VCP A;  5AQQ A;  1SL0 A;  3OYG A;  4IFY A;  3MXI A;  1YJW N;  3DLK A;  1WN7 A;  4WCE L;  1GLB G;  4B1Y B;  4O4G A;  1B9D A;  2F9T A;  1ZXO A;  4BRM A;  4JI1 K;  5GIN A;  4NXM K;  1Z6R A;  4K41 A;  3EY1 A;  3PO4 A;  2AP1 A;  2A6A A;  4IO8 A;  3VQ9 A;  1ASV A;  1T6C A;  1OVQ A;  3AGR A;  1BGX T;  3AVG A;  1NGC A;  1RDD A;  4GMJ B;  1LAW A;  2FBY A;  3A5N C;  5AQW A;  3KLI A;  3UIQ A;  4DQQ A;  5AFU H;  1QQO A;  4YOU A;  4BR0 A;  3D2F A;  2V52 B;  3WNG A;  4E7J A;  4X62 K;  4DG1 A;  3WUH A;  3HP9 A;  3LP1 A;  4HHT A;  1TL1 A;  3O1B A;  1T05 A;  4X65 K;  3OW2 M;  2DPN A;  3AA3 A;  4Z4I A;  3VF2 A;  5SWM A;  2QKB A;  4KV8 A;  5KRS A;  3SUN A;  3SLC A;  3MCP A;  2A3Z A;  4M3W A;  4C8N A;  1YIT N;  2NRV A;  4PL7 A;  3VER A;  2KFZ A;  2HBJ A;  4CEB A;  4CF9 A;  3ULD A;  2XY8 A;  5CHI A;  3AA4 A;  3A8Y A;  4BR5 A;  4W5Q A;  2A5X A;  3CIP A;  3ZX3 A;  3L8B A;  1IG8 A;  3RMC A;  2QWM A;  2OZS A;  3V9Z A;  1HPZ A;  1Q8I A;  4CEF A;  1EXQ A;  3CCQ N;  1CXU A;  3KK3 A;  5DK5 A;  3I0R A;  3V1O A;  4GKK K;  2OCE A;  2CGL A;  4B8A B;  3ZSV A;  4CHO A;  4PKH A;  3NH1 A;  5AQF A;  4FPA A;  4JV5 K;  4EP5 A;  1WLJ A;  2ASP A;  3PY8 A;  2I7N A;  3GBT A;  3B6O A;  3SPY A;  4DR7 K;  3T69 A;  4KTZ A;  1J53 A;  1IBM K;  2PYL A;  1S22 A;  3EKS A;  1BIZ A;  2E2P A;  3D7E O;  1QZ6 A;  4FWL A;  3SQ4 A;  2G8F A;  4GV6 A;  3BF3 A;  3D0P A;  3NMU A;  1WOQ A;  1S72 N;  2VQF K;  1JCG A;  4YHH K;  4FJN A;  1C0M A;  2Q0R A;  4FJ9 A;  3VET A;  3ID6 A;  2O8C A;  4FYD A;  3SV3 A;  5C24 A;  3E9P A;  2FXU A;  2VGM A;  1DT9 A;  5ADX H;  1S9E A;  5CYM A;  1Z05 A;  3VMF B;  3WXM B;  2ZJR L;  4CJ3 A;  2PAV A;  3HJF A;  4O55 A;  2O8E A;  1CZB A;  1LOT B;  1XC9 A;  4Z4G A;  4AHC A;  1NBW A;  2D0B A;  4CZH A;  3D2E A;  4CJV A;  3MN6 A;  5GAH P;  4EZ9 A;  4CD1 A;  3UKU A;  1NOZ A;  1RT5 A;  4IZ9 A;  5LMU K;  4C8M A;  4KI6 A;  4KHP K;  3CM6 A;  4DF8 A;  5HLF A;  1KD1 O;  1OH6 A;  3HM9 A;  1S1V A;  4DS4 A;  1KTQ A;  5CYQ A;  1G15 A;  2WFB A;  4EP4 A;  1L5U A;  3OYA A;  3EL2 A;  1EX4 A;  1P8Z A;  1GLC G;  4GW6 A;  4FLZ A;  1ITG A;  4M45 A;  4JK7 A;  1YUW A;  1NGF A;  4B3O A;  3CFO A;  5AZI B;  4MDA A;  5KGX A;  3DLL L;  5AQM A;  3WXK A;  4DFM A;  2NZT A;  3AVM A;  2JWK A;  3SJH A;  1K8K B;  4NCG A;  4JI3 K;  1BU6 O;  2BDP A;  1YTA A;  2D4W A;  4Z94 A;  1TGO A;  3TWH A;  1FW6 A;  3NAE A;  5AQT A;  4XEI A;  3TSQ A;  1EET A;  3W0L A;  1I3A A;  4CF2 A;  2BE2 A;  3H46 O;  3CFR A;  1UA0 A;  1QHA A;  4WF9 L;  4DTX A;  2ZWH A;  1DEJ A;  2HHH K;  4CJU A;  3CM5 A;  3LPT A;  3KWG A;  1WNS A;  3RR8 A;  3SJJ A;  4IWV A;  2KKZ A;  3CCE N;  4IJA A;  1HX1 A;  1IH7 A;  4DLG A;  1NJX A;  1N6Q A;  4DSK A;  3J81 O;  4DR2 K;  4HTL A;  4MLE A;  5JS2 A;  2PYJ A;  5AQI A;  1NU0 A;  3LP2 A;  2DFE A;  4BG9 A;  2KZZ A;  3J7A P;  4DR5 K;  5I42 A;  4A5B A;  3CHW A;  4H5N A;  1Z25 A;  3JS6 A;  3QIO A;  4NLB A;  3OVN A;  3RSE B;  5EY4 A;  3OYK A;  3VEO A;  4BQZ A;  5JIC A;  4WFA L;  4EZ6 A;  3L2U A;  3P1G A;  3PLA A;  4H0O A;  1OH8 A;  3TAQ A;  1OH5 A;  4QS8 A;  1SKR A;  4FJK A;  1SQK A;  4YOR A;  3SI6 A;  4FLX A;  4FSV A;  4BRN A;  1NGB A;  2Y1I A;  4IKF A;  3DXM A;  4LD0 A;  3AVB A;  3SUO A;  1VSJ A;  1LW0 A;  1ZBL A;  4BGA A;  5I9E B;  5MLC Q;  2VG7 A;  5KQ8 A;  4A61 A;  3E1Y A;  2BGG A;  2Q0U A;  2HBK A;  3FZF A;  3ZEU B;  1NMD A;  1BOT O;  3C7N A;  4CHN A;  2F9W A;  4HVJ A;  3JSM A;  1ATS A;  4JRP A;  3IDH A;  1HNZ K;  1SZ2 A;  3VQP A;  3ZX0 A;  3VEZ A;  1W7A A;  4FCY A;  3VTI A;  4CIG A;  1NK8 A;  1HNV A;  2YNI A;  1SUQ A;  5KPT A;  3QIN A;  4GVE A;  3KLF A;  4CF8 A;  3QEV A;  3CQX A;  2W41 A;  5J1E A;  3TTD A;  4CZI A;  3TTF A;  3OYC A;  4XH5 A;  1D8Y A;  3A5M C;  1JLF A;  2I7P A;  4BRI A;  4BAC A;  2Q2R A;  2D0C A;  2IOC A;  4EHT A;  1R59 O;  5E26 A;  4LF8 K;  1I39 A;  2RHK A;  1HYZ A;  2ZGY A;  1IKX A;  1N8R O;  4DSF A;  2YJF A;  3NE6 A;  3HSC A;  4QAG A;  4BRE A;  1MDU B;  3ZSO A;  4JI7 K;  1C1B A;  5HBM A;  3AO2 A;  1MU2 A;  4IFE A;  4BDY A;  4OO1 J;  4M3Z A;  1QS4 A;  4YY3 K;  3QLH A;  5M1N A;  3VGK A;  2X6N A;  4DU1 A;  4YOT A;  4IJN A;  2HNZ A;  3M8S A;  3TI0 A;  2QM1 A;  2YHW A;  1QSL A;  3RR7 A;  5AQJ A;  3CQY A;  1BDG A;  1RDB A;  4LF9 K;  2NRH A;  4WFB L;  4K8Z A;  1Q9Y A;  1GLD G;  1LCU A;  4M63 C;  1RT6 A;  3MEG A;  3MXJ A;  2DFH A;  4CF0 A;  2D5R A;  2DTU A;  3ASM A;  1BCM A;  3NGY A;  2GWK A;  1S1U A;  3TPQ A;  2UUA K;  1KCF A;  4B1U B;  3QBX A;  4GVM A;  2X74 A;  3CC7 N;  3CCM N;  4MQ3 A;  4FOE A;  1BO5 O;  2Z1H A;  3BEX A;  4HTU A;  1U45 A;  4B9T A;  4H5R A;  5DM6 L;  4FJH A;  1BIS A;  2P9I B;  3AVJ A;  4DV4 K;  4GV3 A;  4BVO A;  4Z0U A;  3BGR A;  3VQQ A;  1EP4 A;  3TAG A;  5AQH A;  4PWD A;  1C1C A;  1L3S A;  4QS9 A;  1K73 O;  3R3L A;  1Z26 A;  4B3T K;  4IDH A;  2YNG A;  4RW8 A;  1S1W A;  3DXK B;  4BGB A;  3KK1 A;  2VG6 A;  3KLG A;  2FBV A;  4FL9 A;  3DM2 A;  4B1W B;  2ZJP L;  3OYL A;  1N5Y A;  4BDP A;  2ETJ A;  4KB0 A;  2W6L A;  3JXU A;  5FLX O;  4UQG A;  3KVG A;  4K0K K;  4YDU C;  1DKG D;  1IKW A;  1QSS A;  3O80 A;  4FWM A;  4DQI A;  4YOY A;  2D0P A;  3PV8 A;  2FC0 A;  3G10 A;  4DQ8 A;  2O8D B;  3S9H A;  1KXP A;  3KIO A;  3P83 D;  1SS6 A;  2GEL A;  4AH9 A;  1HKC A;  2O8F A;  2CGK A;  4EIA A;  3HM8 A;  1ZBS A;  3KKR A;  3CCV N;  4J2B A;  4CGD A;  3Q7C A;  1NGD A;  2HVH A;  3LDS A;  1VQ4 N;  1EKE A;  1O1W A;  3NH2 A;  5AQZ A;  3NF7 A;  1HNW K;  4CGJ A;  2G8U A;  2AJQ A;  2HB5 A;  3VQ8 A;  3HPG A;  4XH4 A;  3DRS A;  4E89 A;  5BN8 A;  2W42 A;  4JK8 A;  4BRG A;  3TAP A;  1L3V A;  3OJU A;  4E0D A;  3CCU N;  4CE9 A;  4DUZ K;  1WSI A;  2YV0 X;  2F96 A;  4BRF A;  3F2K A;  4B1V A;  4EHU A;  4KPY A;  1IJJ A;  4OGE A;  3RWU A;  1GLA G;  2FSK A;  1VSH A;  2QWR A;  3ULE A;  2PFU A;  1KC8 O;  2NRZ A;  5AJ3 K;  1BCO A;  3UKR A;  5LJW A;  3FZL A;  3K5M A;  1SAZ A;  5FRM A;  2ASM A;  4DSE A;  1FKP A;  3L2W A;  1A5X A;  3HOT A;  3SCX A;  3PIP L;  4WQ4 C;  4DU3 A;  1J5O A;  3FFK B;  2B5J A;  4B1Z A;  5BR8 K;  3L2R A;  1TL3 A;  5F1X A;  4YDU A;  4KRF A;  3U4L A;  3MCA B;  3NHG A;  3AV9 A;  4NCA A;  2WBN A;  3THY A;  4DS5 A;  2YI1 A;  2UXD K;  4CJL A;  4DSJ A;  4A2A A;  4DB3 A;  1YVN A;  1HYS A;  2JGU A;  4FJI A;  3HTV A;  3V6D A;  1HQE A;  2LSN A;  1YTU A;  2F8T A;  2OPQ A;  3QNO A;  4B9V A;  1TUU A;  3LM2 A;  3TSP A;  3L0Q A;  2HBM A;  5FPN A;  3TAM A;  3SQ0 A;  1VQ8 N;  4CFD A;  3T1Y K;  3LWL A;  2JWL A;  3A5L C;  1VHX A;  3ENO A;  3QDK A;  4LH4 A;  4E1M A;  3O4W A;  4BRO A;  2W6K A;  5AFU A;  3C95 A;  4DHY A;  5HRN A;  3MN5 A;  3K58 A;  4U67 L;  4FJL A;  1QVF M;  2NLX A;  4Q5V A;  2FLO A;  3QEP A;  3VQE A;  1NK9 A;  2OPP A;  2E88 A;  2IDO A;  3U9D A;  4CJ5 A;  1X9S A;  3WXL A;  4DTU A;  2P9K B;  4BWM A;  3AVH A;  4PHT X;  3OYB A;  4WE1 A;  3EN9 A;  4A2B A;  4JKG B;  5JVH L;  4E7L A;  3SNN A;  3ZSX A;  4CED A;  4BY9 C;  5AZJ A;  4O8U A;  3O3H A;  3HRG A;  3VA0 A;  3MEC A;  4FM1 A;  1GOC A;  5J2N A;  3RRG A;  2UXC K;  3HI0 A;  3LP3 A;  4CJQ A;  3LDP A;  4DFJ A;  1FXX A;  3HXM A;  3MAQ A;  4DV0 K;  2Q36 A;  3H3O B;  2E5L K;  2XO7 A;  3MDQ A;  4I2Q A;  1IKY A;  4WYB A;  3EE8 A;  3OS2 A;  4GKJ K;  1C6V A;  1IO2 A;  2P9L B;  4MDB A;  3AO1 A;  2NRR A;  2O8B B;  3OHR A;  2UUC K;  1L3T A;  3O6W A;  3QIP A;  3C6A A;  1E4F T;  1Q7Y O;  4DTS A;  2RN2 A;  4K8X A;  3FFI A;  3SUP A;  4BRL A;  4QCL A;  4ELU A;  3K59 A;  4DFP A;  5KTQ A;  1LV5 A;  1G99 A;  1NJW A;  2GWJ A;  5FRN A;  4JEP A;  4G9Z A;  4FLV A;  3PSI A;  3VOV A;  3HO1 A;  3QO9 A;  3S41 A;  3RVC A;  1S1T A;  2RF2 A;  1TVR A;  3OBW A;  4AHT A;  4FJ5 A;  3HYF A;  4BRH A;  2ASO A;  4ISE A;  4OKK A;  5ADX A;  4OPH A;  3TAE A;  2QW9 A;  3JYT A;  3U3Y A;  2Q1N A;  1C0T A;  1SV5 A;  4B08 A;  3M3Z A;  3NFA A;  3TAR A;  3MMV A;  3MN9 A;  3OYN A;  2NRX A;  2HMP A;  4IEI A;  5AQK A;  4RTF D;  4B9L A;  4PY5 A;  4N56 A;  3KZB A;  1C0G A;  3UB5 A;  3KTQ A;  1NGI A;  2FF6 A;  4Y1D A;  3V9U A;  3K5O A;  3IG1 A;  3MXM A;  4DKW A;  3L2Q A;  3SPZ A;  4CHZ A;  4M3T A;  4O5B A;  3SAG A;  4H0P A;  4KB1 A;  3L3U A;  2FF3 B;  4OVL A;  2FBT A;  3OS1 A;  2KFN A;  4IBN A;  3NVK A;  1DTQ A;  1RTJ A;  1H1V A;  3ZSQ A;  4CEZ A;  3CCR N;  3FZH A;  4JI8 K;  5JLH A;  1QQM A;  4B8C A;  3IAY A;  1JKH A;  1NM1 A;  1RBT A;  2YHB A;  4H5V A;  1ILY A;  4JD2 B;  1IBK K;  5F0X A;  5AQG A;  4FW1 A;  1K6Y A;  3VF6 A;  4W5O A;  4E1J A;  2ITM A;  4CJR A;  4W5N A;  4F3T A;  3ZCM A;  2DY4 A;  3M8Q A;  5HRO A;  2EHG A;  3SBT A;  4PKI A;  2BTF A;  3ID8 A;  4C1N I;  2P9U B;  4AM6 A;  4KHQ A;  1EQY A;  1LWF A;  3EZ5 A;  3ZSW A;  1NGA A;  2QKK A;  3WNH A;  3V9X A;  1ZBU A;  1NJZ A;  4B9U A;  3I56 N;  4B3R K;  2P9N B;  4FVM A;  5EVZ A;  1A5W A;  5KPZ A;  5HP1 A;  3AAR A;  3M1F A;  1QTM A;  2XY5 A;  4B9M A;  1BA1 A;  3OA9 A;  5LJV A;  1TKZ A;  4BC5 A;  2OZM A;  3AVL A;  1J9A A;  3ZSY A;  1T6D A;  2O4G A;  5AZI A;  2UU9 K;  4H0T B;  4FJM A;  4NB4 A;  1KVB A;  5CY4 A;  1K8K A;  1X9M A;  4BVP A;  2HW3 A;  2CH5 A;  4L8R B; 
#chains in the Genus database with same CATH homology
 1I39 A;  1HYZ A;  2YNH A;  1IKX A;  1RT2 A;  1BIU A;  3G0Z A;  1ZYQ A;  1RTH A;  4CCH A;  1RT4 A;  1U04 A;  3ZT0 A;  4KTW A;  3NGI A;  4DSF A;  3CYM A;  4F8R A;  1VSM A;  5HRP A;  3OY9 A;  4I9L A;  3NE6 A;  3HVT A;  4QAG A;  2HHT A;  4JRQ A;  1KSP A;  1NJY A;  1TK5 A;  4FLY A;  3ZSZ A;  3ZSO A;  1QSY A;  4F2R A;  3RMA A;  4M3R A;  3ZT1 A;  1C1B A;  5C42 A;  4DU4 A;  1W0H A;  3AO2 A;  3IRX A;  3PUF A;  5HBM A;  4CFC A;  1CXQ A;  2A1S A;  1MU2 A;  1UWB A;  3L3V A;  4PA1 A;  4E3S A;  4BDY A;  4E7K A;  2ZQB A;  3OYI A;  3KD5 E;  4I9Q A;  4M3Z A;  1QS4 A;  3E01 A;  1J54 A;  3QLH A;  3U3G A;  2PY5 A;  3CG7 A;  2X6N A;  2NUB A;  4AHV A;  4DU1 A;  4TSX A;  4E7H A;  1RT7 A;  1WAF A;  3K57 A;  2XY6 A;  1UAX A;  1NK0 A;  4FW2 A;  4FJJ A;  2HNZ A;  3M8S A;  2RKI A;  1A5V A;  1RT3 A;  1U49 A;  2O4I A;  1S5J A;  3AVK A;  3V1Q A;  3OJS A;  1W9H A;  3TI0 A;  4FK4 A;  1CLQ A;  2P51 A;  1LWC A;  2GUI A;  3I0S A;  2PZS A;  4HUG A;  3KJV A;  1QSL A;  1RTD A;  3RR7 A;  2IC3 A;  2VWK A;  4M3X A;  3O3G A;  1RDB A;  2P5O A;  2HHS A;  4CFA A;  4RW7 A;  1RT1 A;  5SZT A;  1Q9Y A;  4K8Z A;  1RT6 A;  3AO4 A;  3MEG A;  3MXJ A;  3QEX A;  5C25 A;  2YKM A;  3TAB A;  1WSH A;  2DFH A;  4CF0 A;  3RMD A;  2KZM A;  2D5R A;  1HQU A;  1JL2 A;  1WSF A;  3ASM A;  1BCM A;  2ITG A;  3HST B;  3NGY A;  4FXD A;  1NK7 A;  1VSE A;  1S1U A;  3KLH A;  5KGW A;  3PX6 A;  1KCF A;  3AVN A;  4ZTJ A;  4BDZ A;  1RDA A;  1ASU A;  4ID5 A;  4IG0 A;  1BQN A;  1RDC A;  4GVM A;  2DFF A;  3V4I A;  2X74 A;  4FM0 A;  3LPU A;  4MQ3 A;  2WOM A;  1U45 A;  2Z1H A;  4B9T A;  2VG5 A;  4HTU A;  4NYN A;  2BAN A;  1UA1 A;  4N41 A;  4RG8 A;  1KLN A;  4FJH A;  1BIS A;  1KVA A;  1REV A;  2P5G A;  3ZT4 A;  4KO0 A;  1D5A A;  3AVJ A;  1JLQ A;  4BWJ A;  2P1J A;  4Z0U A;  3BGR A;  1T03 A;  3VQQ A;  1EP4 A;  3A2F A;  1YVU A;  4AHR A;  3TAG A;  3HVR A;  4DQR A;  1C1C A;  3V81 A;  1L3S A;  1L3U A;  4PWD A;  1NKE A;  1YT3 A;  4H4M A;  3WNF A;  1Z26 A;  4J2E A;  4CJS A;  4J2A A;  3OYE A;  2YNG A;  2Z1J A;  4RW8 A;  1S1W A;  1RCH A;  2HNY A;  3KK1 A;  3BDP A;  2HMI A;  2DTU A;  2OYQ A;  3NF8 A;  2VG6 A;  3KLG A;  2FBV A;  1DLO A;  1NOY A;  4XIU A;  3NGZ A;  5KI6 A;  2ZE2 A;  3DM2 A;  4OLB A;  4BE1 A;  4CK1 A;  3VA3 A;  4DTJ A;  2ATQ A;  3OYL A;  1KVC A;  1N5Y A;  3DYA A;  4BDP A;  4CGG A;  4CIF A;  3OYD A;  3AVI A;  2ETJ A;  1S6P A;  3VQD A;  2D0A A;  4AHU A;  3ALY A;  2G8H A;  4KB0 A;  4FK0 A;  4UQG A;  4DTR A;  1TK0 A;  1RBR A;  3SV4 A;  3KK2 A;  1KRP A;  4F4K A;  3SQ2 A;  2HHW A;  1IKW A;  1JLG A;  4N47 A;  1HJR A;  3OYF A;  1QSS A;  1ASW A;  4DQI A;  4IDK A;  1U48 A;  4CFB A;  3CFP A;  2G8V A;  3OS0 A;  3PV8 A;  4PUO A;  4DTO A;  2FC0 A;  3G10 A;  3NDK A;  3S9H A;  2HHU A;  4C8L A;  4N5S A;  2E4L A;  3KIO A;  1QQC A;  1WAJ A;  3P83 D;  4Z4H A;  4CEE A;  1BI4 B;  4DWI A;  5FDL A;  4YNQ A;  4LSN A;  4AH9 A;  4I2P A;  1HMV A;  3KKR A;  1SL0 A;  3ZT2 A;  4IFY A;  3OYG A;  3MXI A;  4J2B A;  4CGD A;  3DLK A;  1WN7 A;  2HVH A;  4AIL C;  3NCI A;  3AVA A;  4O4G A;  3LDS A;  3V9S A;  1B9D A;  1EKE A;  1O1W A;  3AVC A;  3NH2 A;  3NF7 A;  2Z1I A;  4CGJ A;  3L2V A;  2G8U A;  3OYH A;  4E1N A;  4CF1 A;  3SZ2 A;  2AJQ A;  2HB5 A;  3VQ8 A;  2F8S A;  3HPG A;  1VK0 A;  3DRS A;  4E89 A;  3EY1 A;  3PO4 A;  2W42 A;  1RBV A;  3NBP A;  4C8O A;  1NKC A;  3VQ9 A;  1HRH A;  3TAP A;  1L3V A;  2A1R A;  3OJU A;  1ASV A;  3C94 A;  4W5R A;  2R7Y A;  4E0D A;  4CE9 A;  4H8K A;  1BGX T;  2YNF A;  3AVG A;  3C6U A;  1VSL A;  4OPK A;  1WSI A;  2YV0 X;  3AA5 X;  2F96 A;  1SL2 A;  2HW3 A;  1RDD A;  4GMJ B;  1LAW A;  1T8E A;  1LW2 A;  1JLB A;  2FBY A;  4KPY A;  1BQM A;  4RW4 A;  4OGE A;  3KLI A;  3UIQ A;  4KHN A;  2IGI A;  4CEQ A;  3RWU A;  3VN5 A;  1ZBF A;  4CJF A;  4DQQ A;  1VSH A;  4FLU A;  3ZSR A;  3WNG A;  4J2D A;  3C6T A;  4E7J A;  4F3O A;  4QOZ B;  3SUQ A;  1BCO A;  4DG1 A;  4CEC A;  2E6M A;  4ELT A;  3K5M A;  1C1A A;  3HP9 A;  3LP1 A;  3F9K A;  4HHT A;  5J2Q A;  3SYZ A;  5FRM A;  2X78 A;  1U47 A;  1TL1 A;  4DSE A;  3K5N A;  1FKP A;  3L2W A;  1T05 A;  1A5X A;  4CGH A;  5J2P A;  3SCX A;  5I3U A;  4HUF A;  1QHT A;  3QER A;  4DU3 A;  3AA3 A;  2HND A;  4MFB A;  3PX0 A;  1J5O A;  4Z4I A;  1GOB A;  2B5J A;  4PQU A;  3MEE A;  2G8W A;  2PYJ A;  5SWM A;  3KKS A;  4CER A;  1TL3 A;  3L2R A;  4KV8 A;  4ELV A;  5KRS A;  3SUN A;  2QKB A;  4KRF A;  3NHG A;  3AV9 A;  4W5T A;  4NCA A;  4M3W A;  4C8N A;  4DTM A;  2KFZ A;  3LAL A;  4CF9 A;  4CEB A;  4DS5 A;  3O3F A;  1T7P A;  4KHU A;  3ULD A;  5HRS A;  2XY8 A;  4CJL A;  3AA4 A;  5HRR A;  4DSJ A;  3B6P A;  1D9D A;  4DTP A;  1HYS A;  1JXB A;  2JGU A;  4W5Q A;  4FJI A;  4NYF A;  3DRP A;  2KFN A;  1BHL A;  2OPR A;  4FLW A;  3V6D A;  1HQE A;  2LSN A;  5KRT A;  3L8B A;  1YTU A;  1VSI A;  2OPQ A;  3QNO A;  3RMC A;  2F8T A;  2HHQ A;  4B9N A;  2OZS A;  4B9V A;  3T1A A;  4CJT A;  4R5P A;  4KHS A;  3V9Z A;  2B6A A;  1HPZ A;  3M8R A;  1Q9X A;  1Q8I A;  4CEF A;  1EXQ A;  3HT3 A;  3I8D A;  3TAM A;  3SQ0 A;  1CXU A;  4LY7 A;  3KK3 A;  3F73 A;  4CFD A;  5DK5 A;  2HHX A;  3LWL A;  3I0R A;  3V1O A;  4LH4 A;  4CGF A;  4E1M A;  5J2M A;  3P5J A;  2QK9 A;  4H4O A;  2YKN A;  4KFB A;  4B8A B;  1TV6 A;  3ZSV A;  4CHO A;  3C95 A;  3NH1 A;  5HRN A;  1C0U A;  4OPJ A;  4EP5 A;  3DLG A;  3K58 A;  1XWL A;  1WLJ A;  3PY8 A;  4FJL A;  2ZD1 A;  3V9W A;  4Q5V A;  1NK9 A;  3QEP A;  3VQE A;  2OPP A;  3B6O A;  1F21 A;  3SPY A;  1SKS A;  2IDO A;  3MED A;  1TKD A;  4KTZ A;  1J53 A;  2PYL A;  2YHA A;  4CJ5 A;  3VQA A;  1JLA A;  4M42 A;  1BIZ A;  4DFK A;  2G8F A;  5D3G A;  3SQ4 A;  4Z4E A;  3D0P A;  1X9S A;  3DMJ A;  1BI4 A;  4DTU A;  1UOC A;  4BWM A;  3AVH A;  2FBX A;  3OYB A;  4WE1 A;  4HCB A;  3O4Q A;  4FJN A;  4KKO A;  4O0J A;  1NKB A;  5DMR A;  2HVI A;  3U6F A;  1ZBH A;  1C0M A;  3LZJ A;  4BE0 A;  3QET A;  1TKT A;  4CHY A;  4FJ9 A;  3LP0 A;  1FKO A;  4OGC A;  4E7L A;  1VSF A;  4FYD A;  4DMN A;  3K5L A;  3SV3 A;  3SNN A;  4OKJ A;  5C24 A;  3AO5 A;  4F2S A;  3ZSX A;  3THV A;  4CED A;  5K14 A;  4CJP A;  2RPI A;  5T7B A;  1S9E A;  5CYM A;  3O3H A;  3VA0 A;  3MEC A;  1S1X A;  1VSK A;  1GOC A;  3VQ7 A;  4FM1 A;  4CJ3 A;  4JS4 A;  5J2N A;  1NK6 A;  3RRG A;  3VQ6 A;  1JXE A;  3TAF A;  4O55 A;  3HJF A;  3LP3 A;  1XI1 A;  1NK4 A;  4CJQ A;  3NH0 A;  4ICL A;  3LZI A;  4DFJ A;  1CZB A;  1XC9 A;  1FXX A;  3HXM A;  3MAQ A;  4Z4G A;  4AHC A;  1S9G A;  4KHY A;  2XO7 A;  2D0B A;  1TK8 A;  4FK2 A;  4I2Q A;  4ZTF A;  4Z4C A;  1IKY A;  3OYJ A;  4CJV A;  4CES A;  2HHV A;  1RTI A;  2EX3 A;  3KD1 E;  3OS2 A;  4EZ9 A;  3H08 A;  1NOZ A;  1RT5 A;  1C6V A;  1QE1 A;  1IO2 A;  4RW6 A;  1JLC A;  4I7F A;  1CZ9 A;  3O4N A;  4C8M A;  4KI6 A;  3AO1 A;  3CM6 A;  4DF8 A;  5HLF A;  3DLE A;  4DQS A;  2Z1G A;  1L3T A;  3D45 A;  3PX4 A;  1WSG A;  3QIP A;  3DI6 A;  4DTS A;  3AA2 A;  2Q3S A;  2RN2 A;  1BL3 A;  1S1V A;  4ZHR A;  2E6L A;  3HM9 A;  3FFI A;  4DS4 A;  3SUP A;  3KLE A;  1NK5 A;  1KTQ A;  5CYQ A;  1G15 A;  4EP4 A;  1KFS A;  4ELU A;  4QCL A;  3K59 A;  1B9F A;  3OYA A;  4DFP A;  1L5U A;  4KRE A;  4C8K A;  5FRO A;  2VWJ A;  5KTQ A;  1EX4 A;  3S3O A;  4FLT A;  1NJW A;  1LV5 A;  5FRN A;  4GW6 A;  4FLZ A;  4YFU A;  1RNH A;  1ITG A;  4IG3 A;  4FLV A;  4FJ7 A;  3ISN C;  1D9F A;  4M45 A;  3HO1 A;  3QO9 A;  3V1R A;  3LAK A;  4B3O A;  1X1P A;  1S1T A;  3CFO A;  4DSL A;  2XHB A;  2RF2 A;  1TVR A;  3M8P A;  4AHT A;  4FJ5 A;  3HYF A;  5KGX A;  4HUE A;  1SL1 A;  4DFM A;  4KTQ A;  2X6S A;  3AVM A;  4Z4F A;  4OKK A;  4DF4 A;  3TAE A;  4LH5 A;  4KI4 A;  1S6Q A;  4NCG A;  3PO5 A;  3JYT A;  4CJK A;  1U4B A;  2BDP A;  1YTA A;  1TAQ A;  3TWH A;  1TGO A;  2G8I A;  3NAE A;  3U3Y A;  4OLA A;  3T19 A;  2IAJ A;  1C0T A;  1SV5 A;  4B08 A;  4CK3 A;  4CJE A;  1FK9 A;  4CEO A;  4RW9 A;  1EET A;  1I3A A;  3DOK A;  3NFA A;  2BE2 A;  4OKE A;  4CF2 A;  3CFR A;  3QEI A;  3TAR A;  1UA0 A;  3OYN A;  3NF6 A;  4DTX A;  4CJW A;  4PY5 A;  4B9L A;  1TKX A;  3VQC A;  4FJX A;  4CJU A;  2GBZ A;  2KQ2 A;  3CM5 A;  2WON A;  3LPT A;  4N56 A;  1WNS A;  3DRR A;  3KTQ A;  3RR8 A;  5JS1 A;  4Y1C A;  3SJJ A;  4Y1D A;  3DOL A;  3K5O A;  3IG1 A;  4IFV A;  4BE2 A;  3V9U A;  3MXM A;  4JS5 A;  3AO3 A;  4Q0B A;  3L2Q A;  1IH7 A;  1WSJ A;  4DLG A;  4CHZ A;  3EYZ A;  3SPZ A;  4NCB A;  4O5B A;  1NJX A;  1Y97 A;  1N6Q A;  4M3T A;  4DSK A;  3VQB A;  4CHQ A;  4KB1 A;  1JL1 A;  3L3U A;  4OVL A;  2FBT A;  5JS2 A;  3OS1 A;  2I5J A;  3OYM A;  4IBN A;  4FM2 A;  1DTQ A;  3LP2 A;  1RTJ A;  2DFE A;  4E19 A;  3HPO A;  3ZSQ A;  4CEZ A;  2KZZ A;  1WSE A;  3CQ8 A;  5I42 A;  4FJ8 A;  4FJG A;  2B4J A;  4M3U A;  5E41 A;  1Z25 A;  3QIO A;  3S3M A;  2OA8 A;  3LAM A;  1RBU A;  1RIL A;  3S3N A;  3RTV A;  4B8C A;  3IAY A;  1RBS A;  1JKH A;  2YHB A;  1RBT A;  3OVN A;  3OYK A;  2KW4 A;  3RRH A;  2KTQ A;  4FW1 A;  1K6Y A;  3DLR A;  3VQ4 A;  4EZ6 A;  2OPS A;  1HYV A;  3P1G A;  3L2U A;  2IS3 A;  4W5O A;  2JLE A;  1KFD A;  4CJ4 A;  2QXF A;  4CJR A;  3TAN A;  3TAQ A;  4FZX C;  4W5N A;  2XY7 A;  4DTN A;  4F3T A;  1SKR A;  3ZCM A;  4FJK A;  2DY4 A;  4LSL A;  3M8Q A;  5HRO A;  4O0I A;  3SI6 A;  1SKW A;  1VRT A;  2EHG A;  3K2P A;  4FLX A;  1IG9 A;  4N76 A;  1VRU A;  2Y1I A;  4IKF A;  3HK2 A;  4LD0 A;  4KHQ A;  1LWF A;  3EZ5 A;  3AVB A;  1TAU A;  3SUO A;  3ZSW A;  2Y1J A;  4JLH A;  2QKK A;  3RMB A;  1IKV A;  1VSJ A;  1LW0 A;  2XRI A;  1ZBL A;  3WNH A;  3V9X A;  3QEW A;  1ZBU A;  1NJZ A;  3QES A;  3DLH A;  4B9U A;  3QNN A;  1B92 A;  4FVM A;  2VG7 A;  1A5W A;  4KHW A;  4G1Q A;  2BGG A;  1ZBI A;  5HP1 A;  1JLE A;  5EU7 A;  1VSD A;  3ZT3 A;  4CK2 A;  4ID1 A;  3T3F A;  1KLM A;  4DQP A;  4CHN A;  4B9S A;  4HVJ A;  4CGI A;  4E7I A;  3JSM A;  1QTM A;  2XY5 A;  4B9M A;  1XHZ A;  5CZ1 A;  3VQ5 A;  4JRP A;  1X9W A;  4HCC A;  3VQP A;  4M3Y A;  1HNI A;  3DLB A;  4FCY A;  4CIG A;  1LWE A;  1NK8 A;  4CIE A;  4FZY A;  4FZZ A;  1HNV A;  3SQ1 A;  2YNI A;  1SUQ A;  2GV9 A;  3NF9 A;  4DSI A;  4OJR A;  4CHP A;  4DLE A;  2G8K A;  3WNE A;  3QIN A;  1XHX A;  3LWM A;  1TKZ A;  4CF8 A;  3KLF A;  3QEV A;  1R0A A;  5J1E A;  3HPH A;  1LAV A;  3IS9 A;  2OZM A;  3AVL A;  1J9A A;  3ZSY A;  2O4G A;  3OYC A;  4M41 A;  1D8Y A;  3TR8 A;  4K8X A;  1DTT A;  3ITH A;  4AHS A;  4KAZ A;  4FJM A;  1JLF A;  3AVF A;  4BAC A;  1KVB A;  5CY4 A;  1GOA A;  5CZ2 A;  4CEA A;  3HL8 A;  2D0C A;  1X9M A;  3LAN A;  2IOC A;  3HP6 A;  4L8R B;  4O44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...