3TWHA

Selenium derivatized rna/dna hybrid in complex with rnase h catalytic domain d132n mutant
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Novel complex MAD phasing and RNase H structural insights using selenium oligonucleotides.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 41
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2011-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3twhA00
5EU7A 2XY7A 4DU1A 4OGEA 3L2RA 2F96A 1NKBA 4DSEA 2XY5A 1BHLA 3OY9A 4I9QA 1WSEA 3QO9A 3U6FA 3ZT0A 3AO3A 4CGIA 4E7JA 2B6AA 3QNNA 1TAUA 4CK3A 3L2UA 1SKSA 1QQCA 1EP4A 1VRTA 1JLQA 1KCFA 3HPHA 4PA1A 1WSHA 4W5RA 3L3VA 4KV8A 3NH0A 1CXUA 3IRXA 1HYVA 3KLIA 1JL2A 3DM2A 3MEEA 4WE1A 2YNHA 4CGDA 3LZIA 4K8XA 2YKNA 1KVAA 4O4GA 4OPJA 4DTNA 1J9AA 3SI6A 2P5GA 3SUPA 1L3TA 5J2NA 2PZSA 3KK1A 3DLEA 3NE6A 1RBVA 3TAMA 3AVHA 3ZT2A 4HTUA 3P1GA 4CHQA 2D5RA 1RBUA 3NBPA 2RN2A 3C95A 3RMCA 1QSYA 4PUOA 4CJLA 4E1MA 3PV8A 4DMNA 2PYJA 1SL2A 1XI1A 3DI6A 1JLBA 3ZT4A 2HNZA 4CFCA 4JS4A 4M45A 4KI4A 1KFDA 3HJFA 4CCHA 4CIEA 3DLKA 4R5PA 3MEGA 4KHUA 4DFJA 4FJ5A 4CEEA 4FJ9A 1FKOA 1LW0A 1TKXA 4FJNA 3KKRA 3LALA 4OGCA 4DSFA 3SQ1A 3ZSOA 2HHXA 1WSGA 1S9GA 3KK3A 1X9WA 3PUFA 4IKFA 5K14A 1KLNA 1S1UA 4LSNA 2P5OA 4CF1A 3L8BA 1RTDA 3DRSA 2G8HA 4FZXC 4NCBA 3AVJA 1VSMA 3S3NA 1NK5A 4DQQA 1L3VA 3VQ9A 3ZSQA 1WAJA 1RILA 1NJXA 2FBTA 3LANA 4O5BA 3O3FA 3MXMA 1NK6A 2QXFA 1QTMA 4OKJA 2A1SA 3M8PA 3MAQA 2KZZA 4CERA 3JYTA 4H4MA 3I8DA 4FM1A 4B8CA 3U3YA 1BGXT 4KTQA 4HCBA 2Q3SA 3T3FA 1GOAA 4FJKA 1KFSA 4M3UA 3QIPA 1NOYA 2QK9A 3DLGA 3NHGA 4DLEA 3V1OA 3SUQA 3LAMA 1NK7A 3LP3A 4W5TA 3RMAA 3OYHA 4IFYA 5CYQA 3IAYA 3HPGA 1KRPA 3V4IA 1BIUA 1O1WA 5DMRA 2YKMA 5HROA 4Z4EA 4DU3A 3AA5X 1YTUA 4BWJA 3DRRA 3AVMA 1RT2A 1YT3A 5FDLA 2Y1JA 4DS5A 3LP1A 1JLFA 4PWDA 4GMJB 3RWUA 4KFBA 4DU4A 5HBMA 4EP4A 5HRRA 1KVCA 3AVGA 4XIUA 4M3XA 3TAEA 2EHGA 1X9MA 5KTQA 4QOZB 1TKTA 1TL1A 1G15A 2RF2A 3HXMA 4ZTJA 1DTQA 1NKCA 1SL1A 4I2PA 4LH5A 4CGJA 4YNQA 3SCXA 1RNHA 1RTJA 3ULDA 4LD0A 3WNHA 3OS0A 3CFPA 1N5YA 4E89A 1Y97A 2G8WA 2E6MA 3NH2A 3V9WA 3L2VA 3TWHA 4KB0A 3LPUA 2ITGA 3LDSA 5I3UA 3AVLA 2IGIA 3HPOA 2OPRA 4DTUA 4Z0UA 1N6QA 1U04A 4N41A 3NCIA 2B5JA 1IKWA 4RW9A 3OYKA 2KFNA 4FK2A 3K5OA 1VSJA 1JLAA 4C8LA 3K58A 3I0SA 1C1CA 2EX3A 3QNOA 3HO1A 3RMDA 3NGIA 5T7BA 3RR8A 3NF7A 4I7FA 4KPYA 4F3OA 1LWCA 4CHPA 3OVNA 4FJ8A 2Z1HA 5J2QA 4LSLA 4BDPA 4F2RA 3RMBA 1VSKA 4KHYA 1IH7A 3MEDA 3V1RA 3OYBA 2FBVA 4M3YA 4AHTA 1FK9A 2VG6A 3AO1A 3LPTA 1RBSA 4FJJA 1C6VA 2OZSA 3OYLA 2BDPA 3NGZA 4OLBA 3DOLA 1XWLA 3WNFA 5HLFA 3RRHA 3AVFA 1W0HA 4L8RB 4B9TA 2E4LA 4F3TA 4JS5A 4AHUA 4HCCA 3VQBA 3TR8A 3K5LA 1IG9A 2PYLA 1C1AA 3VQ4A 3LAKA 1I3AA 3VQ5A 3ZT1A 2F8TA 4NYNA 4KHQA 1S1WA 4ELVA 5J1EA 1LWFA 4DF4A 1NOZA 2HNYA 1ZBLA 4FLZA 2RKIA 2YNFA 3QERA 2G8KA 1HJRA 1JLGA 1NJYA 4FK4A 4HUEA 5KGWA 4ZHRA 4FYDA 4CJRA 3T1AA 1X9SA 4OKEA 3SZ2A 2DY4A 1RT6A 2G8FA 2DFHA 4M41A 3O4NA 1Q9YA 1B9DA 3HVTA 4CEBA 4CF9A 4IG3A 3AVIA 4AILC 1KVBA 3OYEA 3TI0A 1L3SA 3L3UA 2A1RA 4I9LA 4KREA 4YFUA 4HHTA 4DWIA 1UAXA 1VRUA 3VQDA 3QEVA 3EYZA 3D0PA 2BE2A 4B3OA 1IKVA 4IG0A 3SYZA 1I39A 3HK2A 2OYQA 4E7LA 4B9MA 1RT7A 4KAZA 4CJTA 4DQIA 3CM5A 4ZTFA 4Z4FA 4DF8A 4CECA 3QEPA 2JLEA 1VSDA 3S3MA 3AVAA 1UOCA 2IAJA 2AJQA 1QS4A 3F9KA 4E19A 4CGGA 4OPKA 1B92A 4FJXA 4QCLA 5HP1A 3T19A 1QE1A 1KSPA 2ZQBA 4FJ7A 3VN5A 3L2QA 4CJQA 1WAFA 4N56A 3IG1A 1LWEA 4RG8A 4TSXA 3ALYA 1HQEA 3TAPA 2Y1IA 1FKPA 3OYMA 2F8SA 1RDCA 3TAGA 1LAWA 4F4KA 4M3ZA 3NDKA 3AO2A 1WNSA 3SV4A 1HRHA 4CJKA 1SUQA 1HNIA 3DYAA 4ID1A 1NKEA 5J2MA 4E7KA 3HYFA 4PY5A 3AA4A 3VA0A 1ITGA 3B6PA 3P5JA 3CFRA 3V9XA 1A5VA 4ELTA 1NJZA 4M3TA 4OJRA 3ZSWA 1R0AA 2YNGA 2HHTA 3NH1A 1D9FA 2KFZA 4DTPA 1RBRA 3THVA 1VSLA 2OA8A 5CZ2A 4Y1DA 2X6SA 5JS1A 3KD5E 3HL8A 2VWKA 3G10A 1L3UA 1XC9A 2KTQA 4CJSA 5CZ1A 4J2EA 3DLRA 4ELUA 5KI6A 1GOBA 3JSMA 5FRMA 4GW6A 4OKKA 4KHWA 4H4OA 4JRQA 3NF8A 3DLHA 3HVRA 3OYIA 3O4QA 3NF6A 4B08A 4F2SA 2I5JA 2HHUA 5CYMA 3VQPA 1X1PA 5DK5A 4AHVA 5KGXA 4Z4IA 3VA3A 2X6NA 4DG1A 4CE9A 1F21A 1BCMA 4BACA 1FXXA 3AO5A 4FLYA 2XY6A 3TAFA 1A5XA 1BCOA 2JGUA 4N5SA 4FLVA 3KLEA 4LH4A 1UA0A 3L2WA 1KTQA 3ZSXA 2GUIA 4HVJA 5HRNA 4BE2A 1JXEA 2O4IA 3V81A 1XHZA 4HUFA 2IS3A 4EZ6A 4O0JA 3VQ6A 3EZ5A 4DTSA 4Y1CA 5KRTA 1A5WA 4C8MA 3K5NA 4CJPA 1TKZA 1TGOA 4KO0A 3TAQA 4JLHA 2VWJA 3QIOA 3VQQA 4J2DA 1RBTA 4E3SA 4CEOA 4W5QA 4GVMA 2LSNA 4CGHA 2XHBA 2HHVA 1RTIA 2YHAA 3QETA 3VQAA 1BI4A 1HPZA 1L5UA 1CLQA 2DTUA 5C24A 3ASMA 4C8OA 1ZBUA 1QHTA 2GV9A 4B8AB 1RT3A 4CJ3A 4CJFA 1TKDA 4B9LA 2HVIA 3K59A 3K5MA 3S3OA 2KQ2A 2HHWA 4BE0A 4DSIA 5HRPA 4CJUA 3LP0A 3CG7A 1T03A 4CJEA 2G8IA 1NK4A 3HT3A 1U45A 4CHOA 5J2PA 4CFDA 4CJVA 1S1XA 1BL3A 2HB5A 4DFMA 3H08A 3IS9A 1K6YA 4E1NA 3AVBA 3PX6A 3SQ0A 1T7PA 1SKWA 2VG5A 1JLCA 1LAVA 1IKYA 1GOCA 1S6PA 1VK0A 2HNDA 2O4GA 2NUBA 2XY8A 4CGFA 1LV5A 4MQ3A 3ZSVA 3OYCA 3G0ZA 4O0IA 3DOKA 4QAGA 1C1BA 2ZE2A 3AVCA 4OLAA 2YV0X 1WSFA 1S5JA 3QEIA 1HYSA 1ZYQA 2B4JA 4DTMA 4B9NA 3QLHA 4W5OA 3SUOA 2FBXA 1NK0A 2X78A 4FLTA 4AHRA 1ASWA 1J54A 1D5AA 2IOCA 4KHNA 2HMIA 2P1JA 1TL3A 4B9VA 4DTJA 4DTRA 4E7IA 3QEXA 1MU2A 3V1QA 3SQ2A 3NF9A 4FLUA 4CFAA 5HRSA 2YHBA 3AVNA 5FROA 3AO4A 3WNEA 2FBYA 3KLHA 1WN7A 1C0UA 1WLJA 3M8RA 4FM0A 3VQEA 5KRSA 4O55A 1UWBA 4FM2A 2FC0A 4Z4HA 3RR7A 2Z1GA 2R7YA 4FJIA 4KKOA 1TAQA 3TANA 4K8ZA 2ZD1A 1S9EA 4CHNA 3VQCA 3FFIA 3OYNA 1JL1A 1TV6A 2WOMA 4HUGA 3QINA 1D9DA 1WSIA 1ZBHA 1VSFA 4OVLA 1TK5A 3D45A 4BDZA 3KTQA 3NGYA 2XRIA 4CEFA 3HP6A 5I42A 4KHSA 1SKRA 2Z1IA 1T8EA 2GBZA 4DLGA 1HMVA 3O3HA 4CJ4A 1UA1A 2RPIA 4E7HA 3ZT3A 1EXQA 3M8QA 1RTHA 3CFOA 1KLMA 1REVA 2OPPA 4CEZA 4I2QA 3LWLA 4JRPA 4B9UA 1EX4A 1XHXA 3ZSYA 3K57A 1ZBFA 4DTXA 3PO5A 3MXIA 1JKHA 3HSTB 2OPQA 1ASUA 1IO2A 3KLFA 4NCGA 2HVHA 3EY1A 4BWMA 3P83D 3K2PA 2ATQA 1VSEA 1RDAA 4CIFA 3KK2A 3RRGA 2D0CA 2KW4A 3QESA 1U4BA 1D8YA 3PY8A 3CM6A 4ICLA 1U49A 2HHQA 3OYAA 3HM9A 3ISNC 3A2FA 4FJGA 3NAEA 4AHCA 4CJ5A 1SV5A 2DFFA 1QSLA 3BDPA 4FZYA 1T05A 3B6OA 3NFAA 1NK9A 4DSJA 1HNVA 1NJWA 1HYZA 4DFPA 5FRNA 1BQNA 4PQUA 1J53A 3OYJA 4Z4GA 5E41A 4KRFA 3C94A 4G1QA 1YTAA 4FW1A 3ZSZA 2OPSA 2Z1JA 1CZBA 1DLOA 4IDKA 3VQ7A 4CEDA 2X74A 4CEQA 5SZTA 4Q5VA 3PX4A 4AHSA 2HW3A 3ZSRA 1EKEA 3S9HA 3CYMA 3AV9A 3KJVA 3E01A 1Q9XA 2VG7A 1RDBA 4RW4A 3PO4A 4EZ9A 2D0BA 4EP5A 4CJWA 2QKKA 3MECA 2OZMA 1RT4A 1DTTA 4W5NA 4FJLA 3KLGA 4NYFA 3KIOA 3LP2A 4N47A 4AH9A 3OYFA 1NK8A 2DFEA 1U48A 1S1VA 4B9SA 4J2AA 2BGGA 2IDOA 4CF0A 3OS2A 4RW6A 4CIGA 1B9FA 3I0RA 3LZJA 2YNIA 4DTOA 3HP9A 2PY5A 4J2BA 4RW7A 4NCAA 4KI6A 3V9ZA 4C8NA 1JXBA 5C25A 4CK1A 3OS1A 3DMJA 2QKBA 2D0AA 4CEAA 2KZMA 3C6UA 3SV3A 2W42A 4FCYA 1VSIA 3ZCMA 4ID5A 4FXDA 4CHZA 2P51A 4KTWA 4CF2A 4FW2A 4IBNA 4CFBA 3PX0A 3ITHA 4M3WA 3OJUA 3TABA 1C0MA 1CZ9A 2BANA 5SWMA 2G8VA 2G8UA 3SJJA 4CF8A 3M8SA 4CHYA 4FLWA 4KTZA 4CESA 4Z4CA 3OYGA 3DLBA 4DQPA 4O44A 3SUNA 5C42A 1TK0A 1CXQA 4FK0A 1JLEA 1Q8IA 3F73A 4FLXA 4FJHA 3BGRA 5JS2A 1IKXA 3OJSA 1EETA 4RW8A 4C8KA 1RT5A 5D3GA 1J5OA 3TARA 3V9SA 1YVUA 1BIZA 1WSJA 4IFVA 4FZZA 4M42A 2HHSA 4UQGA 3O3GA 3MXJA 1Z25A 4E0DA 4CK2A 3C6TA 1W9HA 4DS4A 2XO7A 4DSKA 4N76A 3KD1E 3AA2A 3U3GA 3SPZA 3DRPA 4KB1A 1Z26A 3KKSA 4LY7A 4DSLA 2ETJA 3WNGA 3OYDA 5CY4A 1S6QA 3CQ8A 1RT1A 4BDYA 4DFKA 1RDDA 4FJMA 1SL0A 2E6LA 2IC3A 1BISA 4BE1A 4DQRA 3AVKA 3SQ4A 4FVMA 4H8KA 3SNNA 1S1TA 1U47A 1ASVA 3SPYA 1QSSA 1TVRA 4F8RA 4DQSA 4MFBA 4M3RA 1TK8A 1BI4B 1HQUA 3V9UA 3RTVA 1BQMA 3UIQA 1LW2A 1RCHA 1ZBIA 4Q0BA 1VSHA 3LWMA 1C0TA 2WONA 3QEWA 3VQ8A 3V6DA 3AA3A
chains in the Genus database with same CATH superfamily
2XY7A 4NLCA 5AQMA 2XY5A 1WSEA 3NVMA 3QO9A 1TAUA 1SKSA 4K25A 1KCFA 4KV8A 3IRXA 4CGDA 2YKNA 1KVAA 5BN8A 5J2NA 3KK1A 3DLEA 4IWVA 2HF3A 1QSYA 2RN2A 4BRNA 3KHYA 4CJLA 4E1MA 1HX1A 1XI1A 3ZEUA 1JLBA 4CFCA 4X62K 3CJBA 4DR7K 3DLKA 4CEEA 4JK7A 4FSVA 1NMNA 4CZFA 4OGCA 3SQ1A 2Q0RA 1IV0A 3PUFA 2ZJRL 5K14A 1S1UA 1RTDA 4FZXC 2QTDA 3VERA 1YAGA 1L3VA 2J4RA 3VQ9A 2YHYA 5BRDA 4JI2K 2FF3B 1RILA 2KKZA 3LANA 3O3FA 2P9KB 3MXMA 2ZF5O 3LDPA 4OKJA 3A5LC 3WEEA 2W6KA 3JYTA 3E9PA 5FPEA 1ATNA 3RMAA 3OYHA 5CYQA 2UUAK 2UUCK 1YVNA 1O1WA 4NB4A 4BWJA 1J5EK 3TTCA 5AFUA 3LP1A 4GMJB 4KFBA 4DU4A 4CBXA 5HRRA 2A42A 4JAXA 1X9MA 5KTQA 1RGIA 1C0FA 4H5WA 1DTQA 4IO8A 2GELA 4CGJA 3SCXA 4YNQA 2UU9K 4Z94A 1NGCA 3WNHA 3CFPA 1ATRA 3R6MA 2CGLA 4GVEA 1N5YA 4BRKA 3NH2A 3V9WA 4KB0A 2ITGA 2IGIA 4DV1K 4DTUA 4WQ5C 1D4XA 3CXCM 1IKWA 3OYKA 1VSJA 4BRAA 5ADXH 1VQNN 5EVZA 3PLAA 3NF7A 5M1OA 4I7FA 4KPYA 1HKBA 1VSKA 2V7ZA 4BR5A 4NXMK 4YOWA 3V1RA 1FK9A 1C6VA 4AM7A 4BC4A 2BDPA 1YUWA 1XWLA 5HLFA 4WFNL 4L8RB 3D2FA 3K5LA 5BRFA 3CJ7A 2YJFA 3VQ5A 2F8TA 1EWQA 5J1EA 1LWFA 3C6HA 4YOUA 4DF4A 1NOZA 1ZBLA 2G8KA 4CZHA 4B1ZA 4BRGA 3ENHA 3PIPL 2OTJN 1Q82O 2A6AA 4LFAK 1J6ZA 1RT6A 4I6MA 4O8KA 3A5MC 4YDUC 2QEXN 1B9DA 4CEBA 1VQMN 1KVBA 3TI0A 2NZTA 4NXNK 4I9LA 3ZLJA 4HHTA 2E20A 5AQWA 3DAWA 4M63C 3JS6A 4IG0A 2RHKA 3HK2A 3I8BA 1DEJA 4KAZA 1RT7A 4CJTA 3CM5A 4DF8A 5JLFA 1NGHA 4CECA 1VSDA 3F9KA 4FWPA 3ZYYX 4CGGA 5IT9O 2YCHA 1KD1O 4QCLA 1QQNA 1KSPA 3MCAB 1DKGD 2FSKA 4N56A 4BRQA 3IG1A 5GIOA 2ZM6K 5HOOA 3NVKA 1HQEA 3ULEA 5IWAK 1RDCA 3TAGA 1H1VA 1WNSA 1HNIA 3MWTA 4ID1A 3HYFA 3AA4A 4IXCA 4BVOA 3P5JA 3VA0A 3V9XA 3ID6A 3FLCO 5M1PA 4B3RK 4PL8A 4M3TA 3ZEUB 2QWMA 2YNGA 2HHTA 3NH1A 4A5BA 2KFZA 3GDQA 2A40A 3THVA 4A2BA 2E2QA 3CQYA 2HBLA 3G10A 3SMPA 4H0XB 4ELUA 4BR9A 5FRMA 4GW6A 5AQLA 3DLLL 1X1PA 3HSCA 4B1XB 3VA3A 3HRGA 1BDGA 1DT9A 3AO5A 3CD6N 1NWKA 1KTQA 3BZKA 2GUIA 3FZHA 4BE2A 1JXEA 3V81A 1NG9A 2IS3A 2EWSA 3VQ6A 4DHYA 3J80O 3CIPA 4HWIA 2OCEA 3QIOA 4H03B 1RBTA 4E3SA 4GVMA 2XHBA 3QETA 3VQAA 1YHQN 3O80A 4C8OA 3UE5A 1QHTA 3CJ9A 2QA4N 4FWMA 3THWA 4M7XA 2HHWA 1LOTB 3RSEA 1T03A 3H1VX 4CJEA 3VMFB 4CHOA 2UUBK 5J2PA 2HB5A 3BUZB 1VQLN 4CZKA 4DR2K 1T7PA 1SKWA 1JLCA 1GOCA 3O5BA 2QWLA 2NUBA 2XY8A 2W41A 5GAEP 1TYQA 3G0ZA 4DV2K 4BR4A 5AZJA 2YV0X 3KVGA 4GKJK 1WSFA 1ZYQA 4B9NA 3K0SA 3HBTA 1NNEA 2X78A 4FLTA 4AHRA 2P1JA 3MMVA 4DTJA 3SQ2A 5LMNK 1Y64A 4AF1A 5FROA 4FM0A 2FSNA 4Z4HA 3ATUA 2Z1GA 2R7YA 3D2FB 5AQFA 1ZXOA 4K8ZA 1SS6A 4OPAA 4AM6A 4B1YB 2NRWA 2DPNA 1TK5A 3NGYA 4CEFA 1HNZK 5C2FA 1T6CA 3E66A 4DLGA 3QDKA 3J7AP 1EXQA 1REVA 4I6MB 3CHWA 4I2QA 3VGLA 1HR0K 3MXIA 3ATVA 1JKHA 1IO2A 3I33A 4LC9B 3EY1A 4B1UB 1RDAA 2D1KA 1U4BA 3HI0A 3HM9A 3AARA 4RWTA 4CJ5A 1E4FT 3R3LA 1T05A 3NFAA 1NK9A 1I94K 5AFUH 1QQOA 3C0BA 1HYZA 4DFPA 5FRNA 4PQUA 2QXLA 3LM2A 4B1WB 4G1QA 2OPSA 3VQ7A 3PX4A 2X74A 4CEQA 3W0LA 4BQLA 1KC8O 1MWMA 2VG7A 2D0BA 1RT4A 1Q81O 1JJ2M 4FJLA 4NYFA 2VGMA 2VQFK 4CBUA 3ULEB 3OS2A 4LF4K 4DTOA 3HP9A 2P9UA 3ENBA 1NLVA 4RW7A 4KI6A 2CH6A 1JXBA 3O9QA 5AQTA 3IMXA 3DMJA 4K41A 2QKBA 2KZMA 4DKWA 3C6UA 3SV3A 4WFAL 2P9PA 4ID5A 3ZCMA 4WQ5A 2P51A 4BG9A 2FF6A 4M3WA 3OJUA 4K0KK 5SWMA 2UXCK 1ATSA 4CESA 1HKGA 4Z4CA 3DLBA 4O44A 3SUNA 2F9WA 3BP8A 3CPEA 3I56N 3AAPA 2PAVA 4WYBA 4LF7K 3LDOA 3D2EA 1Z25A 3MWPA 3C6TA 3PSFA 4DSKA 2XO7A 4GKKK 3SPZA 5FLXO 3WUHA 5I9EB 3WNGA 3OYDA 4FWKA 2O8CA 4BDYA 1C0GA 1LCUA 4DFKA 5C2DA 2NRHA 3FZFA 2YJEA 4DQRA 4BE1A 4GV3A 3V9UA 4IO9L 2HHVA 1BQMA 1RCHA 3VF4A 1C0TA 2WONA 3VQ8A 3N4QA 3V6DA 1NGJA 4DU1A 3THWB 3L2RA 4YDUA 1HKCA 1NKBA 1N34K 4DSEA 3OY9A 3ZT0A 4XH5A 2B6AA 4BR7A 4CK3A 3HPHA 1YF5L 1WSHA 2ASOA 3NH0A 2P5GA 3CJAA 3KLIA 1JL2A 4K8XA 1YXQA 2YNHA 3SI6A 1Q7YO 3GBTA 4FWQA 4NLBA 4HTUA 3CC2N 4PUOA 3CQXA 1WB9A 3PV8A 4DMNA 1TYQB 1YJWN 5AZJB 3HJFA 4R5PA 4DFJA 4L3QA 3VESA 1FKOA 4FJNA 3ZSOA 1S9GA 1HUXA 1X9WA 5JLHA 2P5OA 4BG8A 3DRSA 2G8HA 4NCBA 3AVJA 1VSMA 1NK5A 3ZX3A 1NK6A 2QXFA 3M8PA 3MAQA 4CERA 4FM1A 3I8DA 3U3YA 1NU0A 1KAYA 1GOAA 1VQKN 1KFSA 3M6GA 3NHGA 1YIJN 2AP1A 3SUQA 3LAMA 1NK7A 3THYA 4IFYA 3IAYA 3V4IA 2YKMA 3CMEN 3CETA 3A5NC 1YTUA 3DRRA 5KPZA 3MN9A 3AVMA 3VOVA 4F9OA 3VEXA 3CERA 3TSUA 4JEPA 4YOTA 4BRPA 1KVCA 1KAXA 2Q36A 2RF2A 3HXMA 4OX9K 3HOSA 3U4LA 1SL1A 4LH5A 5JVHL 4AQYK 4JKGA 4LD0A 3OS0A 4E89A 5F1XA 2G8WA 4JK9A 3VENA 3L2VA 3TWHA 1NGDA 2OPRA 4Z0UA 1U04A 4N41A 3NCIA 4HTLA 2KFNA 4RW9A 3K5OA 1HPMA 4BRMA 3O9RA 4JKCA 1C1CA 1NGEA 3RMDA 1X3MA 3CCJN 4YOVA 3FE1A 3OVNA 1QZ5A 3EO3A 2P9SB 4BDPA 2P9UB 3RMBA 2VQEK 4KHYA 1IH7A 4LFCK 4M3YA 4AHTA 1RBSA 3NGZA 4OLBA 2P9PB 3DOLA 3RRHA 5C15A 4LF6K 2BUPA 2E4LA 2PYLA 1C1AA 3ZT1A 4KHQA 4JKDA 2NLXA 1GLDG 1IBLK 3QERA 4MDBA 1NJYA 4FK4A 5KGWA 3SBGA 2GWJA 3SZ2A 4YY3K 2G8FA 5KPTA 3VEYA 4DV4K 1XMOK 4CF9A 3QBXA 1L3SA 2O8CB 3L3UA 2A5XA 4DWIA 1CZAN 3VQDA 3QEVA 3EYZA 3D0PA 4JHDA 3VEWA 1IKVA 2O8EA 1P8ZA 3D6RA 4ZTFA 5E26A 3S3MA 1GLAG 1UOCA 3O1WA 3CJCA 3LL3A 3T19A 4EIAA 2ZQBA 4FJ7A 4CJQA 4XH1A 4YORA 2O8DA 1Z6RA 1FKPA 2E88A 3CPWM 1JCGA 1XQSC 3NDKA 3SV4A 1HRHA 1NKEA 4PY5A 4BRIA 4CD1A 3B6PA 3DXMA 1A5VA 4ELTA 1R0AA 1SQKA 3H3OB 4DV3K 3L0QA 2KLAA 3HL8A 2KTQA 3A0IX 4CJSA 4JI5K 1GOBA 4CW7B 3JSMA 4H4OA 3NF8A 3O4QA 2HHUA 2P9IA 5CYMA 5C10A 3VQPA 4AHVA 4H0YB 4QS9A 4CE9A 1FXXA 3VF2A 3TAFA 1K8AO 1A5XA 1BCOA 2JGUA 1QVGM 4BY9C 3KLEA 2UXDK 1UA0A 3L2WA 4JI7K 2GUPA 2E8AA 1XHZA 4HUFA 4O0JA 4CJPA 3THYB 1TKZA 4KO0A 2VWJA 4CVNE 4W5QA 2LSNA 1BI4A 5AR0A 3F2KA 1JCFA 2GV9A 4B8AB 4JV5K 4MO5A 4CJ3A 1TKDA 1TUUA 4DSIA 2NRXA 2NRRA 5HRPA 3W3DA 3TPQA 3LP0A 1S72N 2G8IA 4FWNA 3MK6A 1NK4A 4CJVA 4DFMA 3IS9A 4JKAA 3BEXA 1GLBG 3SQ0A 3OTOK 3AY9A 1S6PA 3QB0A 3C65A 3HM8A 5F0XA 1LV5A 2PFUA 4MQ3A 2CGJA 3VETA 3WXKA 3HZ6A 3AVCA 4DR1K 4B3MK 1S5JA 1HYSA 5JVGL 4DTMA 3IDHA 2A41A 3MCPA 4IOXA 4KH5A 4W5OA 4H0TB 1TL3A 2GEMA 3EN9A 4BRCA 1ZBSA 4FLUA 3P38A 3KLHA 3CMAN 3AO4A 3WNEA 2FBYA 1WN7A 2FC0A 1RFQA 4FJIA 4KKOA 3TANA 1P90A 3OYNA 4BC5A 3QINA 1WBBA 2PBDA 3HP6A 3MX2A 5I42A 1SKRA 2Z1IA 2GBZA 1JCEA 1HMVA 4CJ4A 3TSQA 1UA1A 4E7HA 4ISFA 3M8QA 1KLMA 2OPPA 4CEZA 2BTFA 1XHXA 3C6AA 2V51B 1ZBFA 4JI3K 3ZX2A 3PO5A 2Q1NA 2ZJPL 3HSTB 2E2OA 4NCGA 1W97L 3K2PA 2ATQA 5M1FA 3VEZA 4JHDB 5LJWA 2O8EB 4IEIA 1U49A 3OYAA 4DUYK 3A2FA 5AQVA 4DSJA 1DGKN 1NJWA 4FWRA 5BRHA 3EL2A 4CEDA 1CZBA 1DLOA 1Q9XA 4IDHA 4RW4A 4EZ9A 2OANA 4BROA 4R79A 2QKKA 3MECA 2O8BA 5KPRA 1DTTA 4W5NA 3QBWA 2HBMA 4KH4A 4B9SA 3WXMB 1U48A 2O8DB 3WEEB 4RW6A 5M1QA 2YNIA 2PY5A 4J2BA 4JI1K 4NCAA 3TTFA 3OS1A 3DXMB 3F5TA 5AQPA 4FCYA 1FJGK 1T44A 1HJOA 4FOIA 3PX0A 4IBNA 4CFBA 3TABA 1C0MA 4CF8A 2I7PA 1S22A 4DQPA 1TK0A 1JLEA 1Q8IA 1BA1A 5JS2A 1IKXA 3OJSA 4H0PA 3L6QA 2P9IB 3VTHA 3TARA 4GV9A 2HOEA 1WSJA 2P9NA 4M42A 2HHSA 3O3GA 2YHXA 3MXJA 3CCQN 3T69A 1VAZA 1W9HA 4DS4A 4CD3A 3CQ8A 1RT1A 2FXUA 4FWOA 1SL0A 2E6LA 2IC3A 4H8KA 1U47A 4G9ZA 1ASVA 3SPYA 1TVRA 3VTIA 4M3RA 1BI4B 1HQUA 3UB5A 3UIQA 2NRTA 1R59O 2Q0UA 1VSHA 3LWMA 3J8AA 4JI0K 4OGEA 3SAHA 1BHLA 4NO7A 5LMUK 3AO3A 4CGIA 3QNNA 1EP4A 4IOAL 1CXUA 3MN5A 4BC2A 1WBDA 2ASMA 2VCPA 3LZIA 4DTNA 1J9AA 1X9JA 3ID8A 1GLEG 3L4IA 3TAMA 3ZT2A 3P1GA 5TKWA 2D5RA 1RBUA 1KQSM 3CCEN 3RMCA 3HOTA 3A5OC 3BZCA 4EHUA 1SL2A 3QMLA 4JKEA 4JS4A 3ZT4A 2HNZA 4M45A 4CCHA 3KZBA 3K9JA 4CIEA 2ZJQL 3MEGA 3OBYA 1LW0A 1TKXA 4A62A 3IKMA 2HHXA 2E1ZA 4FWSA 5M1KA 3KK3A 1VQ9N 4BGAA 1KLNA 3P4IA 5EOYA 4BVPA 3S3NA 3M3ZA 5AQUA 2H3GX 3O9SA 1QTMA 5GINA 4B9QA 2A1SA 2HBKA 2KZZA 4H4MA 4B8CA 2IVNA 1BGXT 4HCBA 3EE8A 2Q3SA 3GOIA 3QIPA 2ITMA 2QK9A 3DLGA 4DLEA 5B8HA 4W5TA 4JKFA 5AQHA 1KRPA 5DMRA 4WCEL 4Z4EA 3AA5X 4IFEA 2AA4A 4BC3A 1RT2A 5FDLA 4DS5A 4PWDA 5HBMA 4EP4A 3AVGA 4M3XA 1TKTA 4RCHA 4ZTJA 1NMDA 5AQKA 2QWRA 1NKCA 5GADP 2D0OA 3T1YK 3ULDA 1Q86O 5AQXA 1VQ8N 2E6MA 3LPUA 3LDSA 3AVLA 3HPOA 3ZETA 4ILHA 2Q2RA 1JLAA 4Y0WA 5CE3A 2EX3A 2FSJA 3QNOA 4MLHA 2O8BB 3JXUA 4A2AA 2BH1A 3NGIA 3RR8A 4FJ8A 3I55N 2QWNA 2UYTA 3MEDA 2FBVA 3CI5A 3FZMA 3M5RA 3LPTA 2OZSA 3OYLA 5BPLA 5GAHP 1U2VA 3KWIA 2QM1A 2NNWA 3CF5L 4JD2A 4AHUA 4HCCA 3TR8A 5AQSA 1IG9A 3LAKA 1I3AA 4NYNA 1S1WA 5BN9A 2HNYA 3RSEB 4FLZA 2RKIA 1YI2N 2YNFA 1JLGA 4CZJA 4ZHRA 5FPDA 4M7YA 4FPBA 3T1AA 1X9SA 4OKEA 2DY4A 2P9NB 2DFHA 4M41A 1OH6A 3O4NA 1Q9YA 4IG3A 3AVIA 1HNWK 2A1RA 4WFBL 1NBWA 4YFUA 4BREA 1BWFO 5H1SQ 2BE2A 4B3OA 5E84A 1BG3A 5JMVA 1I39A 2E2PA 2OYQA 4B9MA 4EFHA 4BR0A 4DQIA 5LL6Z 1OH7A 1N33K 3H1QA 3O08A 2JLEA 3AVAA 2IAJA 3WXJA 1QS4A 4E19A 3CC7N 4JN4A 4FJXA 1OVQA 3BF3A 3L2QA 3MN7A 5EX5A 1WAFA 2W40A 3F9MA 1VHXA 1LWEA 4RG8A 4LF9K 3ALYA 4IZ9A 4CZGA 3TAPA 4LFBK 4DV0K 1GLJO 2Y1IA 3OYMA 2F8SA 2IVPA 2QWQA 3VF6A 1LAWA 4M3ZA 2IIRA 3T7ZA 3AO2A 4CJKA 2HSTA 3DYAA 5J2MA 4E7KA 1ITGA 3CFRA 5BPNA 1NJZA 4OJRA 3ZSWA 4DV6K 1D9FA 4DTPA 2YHWA 1RBRA 4ILGB 2JWLA 1M1KO 4Y1DA 2X6SA 3KD5E 3H46O 1L3UA 1ESVA 1VQPN 1QVFM 4JYAK 4J2EA 1VQ7N 3G4SN 1EWRA 3HVRA 2F4VK 3NF6A 2E5LK 1IBMK 4F2SA 2I5JA 3JAMO 3C7NA 5KGXA 4DG1A 1BCMA 2XY6A 4N5SA 4FLVA 5F2RA 3AAQA 5DM7L 3ZSXA 4HVJA 2O4IA 5MLCQ 4CJ7A 3FGUA 4DTSA 3EZ5A 4C8MA 3LDQA 3K5NA 1TGOA 4JLHA 3VQQA 3CCMN 4CGHA 1RTIA 1HPZA 3P31A 3U8XA 3O9UA 1CLQA 2DTUA 5C24A 3ASMA 1ZBUA 4CJFA 2HVIA 3K5MA 1HNXK 4A61A 2KQ2A 4IOCL 2WFBA 4BGBA 3RVCA 1Q18A 4U67L 3E1YA 3HT3A 4CFDA 1S1XA 3S41A 1K6YA 3NMUA 4E1NA 1IG8A 3ZETB 1IKYA 1X3NA 2HNDA 2O4GA 3MN6A 3SAFA 5AQJA 3ZSVA 5HL7L 3D2EB 4X65K 3DOKA 1HLUA 4JNEA 2D4WA 1C1BA 2ZE2A 4OPHA 4OLAA 3QEIA 1RDUA 3UKUA 4J8FA 3L4QA 3QLHA 4X64K 2FBXA 5LJVA 3CCLN 1ASWA 1D5AA 2HMIA 5C0YA 4B9VA 4DTRA 3QEXA 1MU2A 3BF1A 3V1QA 3NF9A 4CFAA 3LM9A 2YHBA 2RE2A 1L5UA 1U2VB 1WLJA 1NGIA 3VQEA 4O55A 3EEQA 3RR7A 4JD2B 5GIPA 1K8KA 1V4SA 2ZD1A 1S9EA 3QFPA 4CHNA 3FFIA 1JL1A 1TV6A 2WOMA 4BR2A 4HUGA 4EAHD 1V4TA 2HHHK 4OVLA 4BDZA 4KHSA 5AQNA 2XRIA 4BRFA 3O3HA 3GG4A 1GLLO 1XMQK 2RPIA 3ZT3A 3CFOA 3G6EN 4B9UA 3ZSYA 3K57A 1N8RO 3QICA 4C1NK 2HVHA 3E9LA 1WOQA 3P83D 1VSEA 4CIFA 3KK2A 3RRGA 1NM1A 3PY8A 3CM6A 4ICLA 1EO1A 5CHIA 3ISNC 5AQIA 3NAEA 4A5AA 1SV5A 2DFFA 4FZYA 3B6OA 4DV5K 3CJ1A 4OO1J 3PIOL 1S3XA 1J53A 4BRDA 3OYJA 4Z4GA 4KRFA 3SMSA 3C94A 3QESA 4FW1A 3ZSZA 4IDKA 2Z1JA 1W7AA 4Q5VA 3R8EA 2CGKA 3S9HA 2Q31A 3AV9A 3CYMA 3KK7A 2VGNA 4GY2B 4EP5A 3MDQA 4JI6K 1NK8A 3LP2A 4AH9A 1U6ZA 2DFEA 1S1VA 4J2AA 2BGGA 2O8FA 2IDOA 4XEIA 4CIGA 1B9FA 3I0RA 3LZJA 4FL9A 3GE1A 3V9ZA 4C8NA 4QS7A 2V52B 5C25A 2D0AA 2NRVA 5A2QO 4PKIA 2W42A 1VSIA 1EQYA 4FXDA 4KTWA 5AQQA 4FW2A 4CF2A 1CZ9A 2BANA 2G8VA 2G8UA 3SJJA 4CHYA 4KTZA 5M1NA 3GL1A 1NJIO 1CXQA 4FK0A 1TUYA 3SLCA 4FLXA 4FJHA 3KWGA 3BGRA 1EETA 4FOEA 2ZWHA 1RT5A 1G99A 1YVUA 3C7NB 3O4WA 4JKGB 1BIZA 3BY5A 4IFVA 4FZZA 1KAZA 2Q97A 2ZGYA 4N76A 2CH5A 3AA2A 4B3TK 4KB1A 4LY7A 4DQ8A 4DSLA 3SJHA 3VGKA 1BISA 3AVKA 4FVMA 3SNNA 1S1TA 1QSSA 3CC4N 3EKUA 5KQ8A 4Q0BA 2HF4A 3AA3A 2V7YA 4V19S 5EU7A 1FW6A 2F96A 4PL7A 3OBWA 4I9QA 3U6FA 4PHTX 3DJCA 2WUSA 4E7JA 3L2UA 1QQCA 1VRTA 4PA1A 1JLQA 4W5RA 3L3VA 1MA9B 4WE1A 1HYVA 1ILYA 3DM2A 4IJNA 3MEEA 1BA0A 4O4GA 4OPJA 4PKHA 4UY8O 3SUPA 1L3TA 2PZSA 4IJAA 1RBVA 5DM6L 3AVHA 4ISEA 3NE6A 4CHQA 3NBPA 4DB3A 3C95A 3DXKA 2PYJA 3H6EA 3DI6A 3IFRA 3FZLA 4KI4A 1KFDA 3ZX0A 4KHUA 4FJ5A 3D7EO 4CZLA 3UKUB 4FJ9A 4DV7K 3IUCA 3KKRA 3LALA 4DSFA 1WSGA 4IKFA 4LSNA 1N36K 4CF1A 3L8BA 1YJ9N 4WQ4C 4DQQA 4DR5K 3ZSQA 1WAJA 3TTDA 1BOTO 4KHPK 1NJXA 2FBTA 3OW2M 4O5BA 2IVOA 2QW9A 1K8KB 3R1XA 5AQYA 3CCVN 4KTQA 3T3FA 4FJKA 4M3UA 3SBTA 1NOYA 2GWKA 3V1OA 3LP3A 2YX6A 1RDWX 3HPGA 1BIUA 5HROA 4DU3A 1NGFA 2JWKA 1XNRK 4O5FA 1YT3A 4DCHA 2Y1JA 1JLFA 3RWUA 1NGAA 4XIUA 1ZC6A 3TAEA 2EHGA 4QOZB 1TL1A 1G15A 4CZIA 4CZEA 3U9ZA 4MO4A 4I2PA 1RNHA 1RTJA 2E2NA 4KBOA 1QZ6A 1Y97A 5I3UA 4DR6K 3UKRA 1N6QA 2B5JA 4FK2A 4C8LA 3K58A 2QWOA 3I0SA 1QQMA 1XC3A 4BQZA 3HO1A 5GAGP 5T7BA 2O8FB 4F3OA 1LWCA 4CHPA 3SAGA 2Z1HA 4DR3K 4LSLA 5J2QA 4F2RA 4YHHK 3AGRA 5EY4A 3OYBA 1XUPO 3AO1A 2VG6A 4H0VB 4FJJA 3EE9A 4FO0A 3WNFA 3AVFA 1W0HA 1T3VA 4B9TA 4F3TA 4JS5A 3VQBA 4A59A 3J7YP 3VQ4A 4K43A 4ELVA 4MLEA 4K42A 2NRZA 3M1FA 4RTFD 1HJRA 4HUEA 4ISGA 4FYDA 2VYPA 4CJRA 3HVTA 1M90O 3THXA 2ASPA 4AILC 3OYEA 4KREA 1K9MO 1UAXA 1VRUA 3WQTA 3SYZA 3R9PA 2HBJA 4E7LA 3A8YA 5FPMA 4U7BA 1QHAA 4Z4FA 3QEPA 3VEVA 3FFKB 2AJQA 4YOYA 4JI8K 4OPKA 1B92A 2P9LA 2WC9A 5TKYA 5HP1A 3Q7CA 1QE1A 3VN5A 1SAZA 4DUZK 3FR0A 4TSXA 3EKSA 2A3ZA 3FZKA 3T1HK 4CZMA 3P39A 4F4KA 3DWLA 2E1YA 1SUQA 4CI6A 3H45C 3DXKB 3U9DA 2KHOA 4H5NA 3WQUA 1VQ4N 2QI2A 1VSLA 2OA8A 5CZ2A 5JS1A 2VWKA 1XC9A 4XH4A 5CZ1A 3DLRA 5KI6A 4OKKA 4KHWA 4JRQA 3DLHA 5AZIA 3OYIA 4B08A 1NGBA 1SZ2A 2FLOA 4JK8A 3WT0A 5DK5A 1BU6O 4Z4IA 2X6NA 5AQGA 1F21A 4BACA 3G25A 4FLYA 5FPNA 4LH4A 5HRNA 2P9SA 2F9TA 2WTUA 1OKJA 3EZWA 4EZ6A 1VQON 4Y1CA 5KRTA 3CCUN 5BPMA 1A5WA 2ZGZA 3TAQA 4J2DA 2GTDA 4CEOA 4CBWA 2YHAA 1WUAA 1BO5O 2VWBA 1RT3A 4H5VA 3AGKA 4IEEA 1E3MA 4B9LA 1YJNN 3K59A 3S3OA 1OH5A 4A57A 4BE0A 3OA9A 1IBKK 3SK3A 1MWKA 4CJUA 3MX5A 5BREA 5ADXA 3CG7A 3WXLA 1YITN 2OTLN 1U45A 1VQ5N 1BL3A 3H08A 4JKBA 3AVBA 3PX6A 1MDUB 2VG5A 1LAVA 3UKRB 4C1NI 4B3SK 3G71N 1VK0A 5AJ3K 4BRHA 4CGFA 1KXPA 3OYCA 3PSIA 4O0IA 3HTVA 3OHRA 2WBNA 4QAGA 2F7TA 2B4JA 3O1BA 2GX9A 1IJJA 3VPZA 3SUOA 1NK0A 3Q7BA 1J54A 2IOCA 4KHNA 1T6DA 4E7IA 4H0OA 4E1JA 4LF8K 3WXIA 4X66K 5HRSA 3AVNA 4LF5K 1C0UA 3M8RA 1VQ6N 5KRSA 1UWBA 4FM2A 5CR4A 2P9KA 3LDLA 3QFUA 1TAQA 4FVUA 3VQCA 5ELZA 4H5RA 4O8UA 4WF9L 1D9DA 4YOXA 1WSIA 1ZBHA 1VSFA 3D45A 3KTQA 3J7ZO 1T8EA 3N4PA 4QS8A 4BRLA 4FPAA 5BR8K 1RTHA 3LWLA 4JRPA 3H3NO 1EX4A 4WQ4A 4DTXA 5EXWA 1OH8A 3THXB 3B8AX 3LDNA 2OPQA 1ASUA 3KLFA 4BWMA 4EHTA 1W2BM 2HMPA 2W6LA 2D0CA 2KW4A 1D8YA 2HHQA 5AQOA 4FJGA 1NGGA 4AHCA 4PKGA 3BDPA 1QSLA 1GLCG 1HNVA 2QWPA 1BQNA 5E41A 1YTAA 2P9LB 2HW3A 5SZTA 4AHSA 1GLFO 3ZSRA 1EKEA 3KJVA 3E01A 1RDBA 3VEOA 3PO4A 4ILJA 4CJWA 2OZMA 3KLGA 3KIOA 4N47A 3OYFA 2YI1A 3CCRN 4CF0A 2UXBK 1OVYA 3O9TA 2D0PA 5JICA 4CK1A 5C12A 4CEAA 4JI4K 5BR9A 3O6WA 4JKHA 4CHZA 4B1VA 3CCSN 3ITHA 4GNIA 3M8SA 5AQRA 1E4GT 4FLWA 3OYGA 5C42A 1N32K 4C23A 3J81O 3F73A 5AZIB 5KQDA 3E9OA 4RW8A 4C8KA 5D3GA 1J5OA 3V9SA 1BUPA 3VGMA 3O8MA 4UQGA 4E0DA 4CK2A 4MDAA 2I7NA 4KH6A 3KD1E 3U3GA 3DRPA 1Z26A 3KKSA 4FWLA 2ETJA 5CY4A 1O13A 5AQZA 1S6QA 1Z05A 1RDDA 3TU5A 4FJMA 3K9KA 3TSPA 3SQ4A 5LY3A 4DR4K 1XNQK 4F8RA 1K73O 4DQSA 4MFBA 1TK8A 1ZBIA 3RTVA 1LW2A 4H5TA 3QEWA 3ENOA 4GV6A
chains in the Genus database with same CATH topology
5EU7A 2XY7A 4DU1A 4OGEA 3L2RA 2F96A 1NKBA 4DSEA 2XY5A 1BHLA 3OY9A 4I9QA 1WSEA 3QO9A 3U6FA 3ZT0A 3AO3A 4CGIA 4E7JA 2B6AA 3QNNA 1TAUA 4CK3A 3L2UA 1SKSA 1QQCA 1EP4A 1VRTA 1JLQA 1KCFA 3HPHA 4PA1A 1WSHA 4W5RA 3L3VA 4KV8A 3NH0A 1CXUA 3IRXA 1HYVA 3KLIA 1JL2A 3DM2A 3MEEA 4WE1A 2YNHA 4CGDA 3LZIA 4K8XA 2YKNA 1KVAA 4O4GA 4OPJA 4DTNA 1J9AA 3SI6A 2P5GA 3SUPA 1L3TA 5J2NA 2PZSA 3KK1A 3DLEA 3NE6A 1RBVA 3TAMA 3AVHA 3ZT2A 4HTUA 3P1GA 4CHQA 2D5RA 1RBUA 3NBPA 2RN2A 3C95A 3RMCA 1QSYA 4PUOA 4CJLA 4E1MA 3PV8A 4DMNA 2PYJA 1SL2A 1XI1A 3DI6A 1JLBA 3ZT4A 2HNZA 4CFCA 4JS4A 4M45A 4KI4A 1KFDA 3HJFA 4CCHA 4CIEA 3DLKA 4R5PA 3MEGA 4KHUA 4DFJA 4FJ5A 4CEEA 4FJ9A 1FKOA 1LW0A 1TKXA 4FJNA 3KKRA 3LALA 4OGCA 4DSFA 3SQ1A 3ZSOA 2HHXA 1WSGA 1S9GA 3KK3A 1X9WA 3PUFA 4IKFA 5K14A 1KLNA 1S1UA 4LSNA 2P5OA 4CF1A 3L8BA 1RTDA 3DRSA 2G8HA 4FZXC 4NCBA 3AVJA 1VSMA 3S3NA 1NK5A 4DQQA 1L3VA 3VQ9A 3ZSQA 1WAJA 1RILA 1NJXA 2FBTA 3LANA 4O5BA 3O3FA 3MXMA 1NK6A 2QXFA 1QTMA 4OKJA 2A1SA 3M8PA 3MAQA 2KZZA 4CERA 3JYTA 4H4MA 3I8DA 4FM1A 4B8CA 3U3YA 1BGXT 4KTQA 4HCBA 2Q3SA 3T3FA 1GOAA 4FJKA 1KFSA 4M3UA 3QIPA 1NOYA 2QK9A 3DLGA 3NHGA 4DLEA 3V1OA 3SUQA 3LAMA 1NK7A 3LP3A 4W5TA 3RMAA 3OYHA 4IFYA 5CYQA 3IAYA 3HPGA 1KRPA 3V4IA 1BIUA 1O1WA 5DMRA 2YKMA 5HROA 4Z4EA 4DU3A 3AA5X 1YTUA 4BWJA 3DRRA 3AVMA 1RT2A 1YT3A 5FDLA 2Y1JA 4DS5A 3LP1A 1JLFA 4PWDA 4GMJB 3RWUA 4KFBA 4DU4A 5HBMA 4EP4A 5HRRA 1KVCA 3AVGA 4XIUA 4M3XA 3TAEA 2EHGA 1X9MA 5KTQA 4QOZB 1TKTA 1TL1A 1G15A 2RF2A 3HXMA 4ZTJA 1DTQA 1NKCA 1SL1A 4I2PA 4LH5A 4CGJA 4YNQA 3SCXA 1RNHA 1RTJA 3ULDA 4LD0A 3WNHA 3OS0A 3CFPA 1N5YA 4E89A 1Y97A 2G8WA 2E6MA 3NH2A 3V9WA 3L2VA 3TWHA 4KB0A 3LPUA 2ITGA 3LDSA 5I3UA 3AVLA 2IGIA 3HPOA 2OPRA 4DTUA 4Z0UA 1N6QA 1U04A 4N41A 3NCIA 2B5JA 1IKWA 4RW9A 3OYKA 2KFNA 4FK2A 3K5OA 1VSJA 1JLAA 4C8LA 3K58A 3I0SA 1C1CA 2EX3A 3QNOA 3HO1A 3RMDA 3NGIA 5T7BA 3RR8A 3NF7A 4I7FA 4KPYA 4F3OA 1LWCA 4CHPA 3OVNA 4FJ8A 2Z1HA 5J2QA 4LSLA 4BDPA 4F2RA 3RMBA 1VSKA 4KHYA 1IH7A 3MEDA 3V1RA 3OYBA 2FBVA 4M3YA 4AHTA 1FK9A 2VG6A 3AO1A 3LPTA 1RBSA 4FJJA 1C6VA 2OZSA 3OYLA 2BDPA 3NGZA 4OLBA 3DOLA 1XWLA 3WNFA 5HLFA 3RRHA 3AVFA 1W0HA 4L8RB 4B9TA 2E4LA 4F3TA 4JS5A 4AHUA 4HCCA 3VQBA 3TR8A 3K5LA 1IG9A 2PYLA 1C1AA 3VQ4A 3LAKA 1I3AA 3VQ5A 3ZT1A 2F8TA 4NYNA 4KHQA 1S1WA 4ELVA 5J1EA 1LWFA 4DF4A 1NOZA 2HNYA 1ZBLA 4FLZA 2RKIA 2YNFA 3QERA 2G8KA 1HJRA 1JLGA 1NJYA 4FK4A 4HUEA 5KGWA 4ZHRA 4FYDA 4CJRA 3T1AA 1X9SA 4OKEA 3SZ2A 2DY4A 1RT6A 2G8FA 2DFHA 4M41A 3O4NA 1Q9YA 1B9DA 3HVTA 4CEBA 4CF9A 4IG3A 3AVIA 4AILC 1KVBA 3OYEA 3TI0A 1L3SA 3L3UA 2A1RA 4I9LA 4KREA 4YFUA 4HHTA 4DWIA 1UAXA 1VRUA 3VQDA 3QEVA 3EYZA 3D0PA 2BE2A 4B3OA 1IKVA 4IG0A 3SYZA 1I39A 3HK2A 2OYQA 4E7LA 4B9MA 1RT7A 4KAZA 4CJTA 4DQIA 3CM5A 4ZTFA 4Z4FA 4DF8A 4CECA 3QEPA 2JLEA 1VSDA 3S3MA 3AVAA 1UOCA 2IAJA 2AJQA 1QS4A 3F9KA 4E19A 4CGGA 4OPKA 1B92A 4FJXA 4QCLA 5HP1A 3T19A 1QE1A 1KSPA 2ZQBA 4FJ7A 3VN5A 3L2QA 4CJQA 1WAFA 4N56A 3IG1A 1LWEA 4RG8A 4TSXA 3ALYA 1HQEA 3TAPA 2Y1IA 1FKPA 3OYMA 2F8SA 1RDCA 3TAGA 1LAWA 4F4KA 4M3ZA 3NDKA 3AO2A 1WNSA 3SV4A 1HRHA 4CJKA 1SUQA 1HNIA 3DYAA 4ID1A 1NKEA 5J2MA 4E7KA 3HYFA 4PY5A 3AA4A 3VA0A 1ITGA 3B6PA 3P5JA 3CFRA 3V9XA 1A5VA 4ELTA 1NJZA 4M3TA 4OJRA 3ZSWA 1R0AA 2YNGA 2HHTA 3NH1A 1D9FA 2KFZA 4DTPA 1RBRA 3THVA 1VSLA 2OA8A 5CZ2A 4Y1DA 2X6SA 5JS1A 3KD5E 3HL8A 2VWKA 3G10A 1L3UA 1XC9A 2KTQA 4CJSA 5CZ1A 4J2EA 3DLRA 4ELUA 5KI6A 1GOBA 3JSMA 5FRMA 4GW6A 4OKKA 4KHWA 4H4OA 4JRQA 3NF8A 3DLHA 3HVRA 3OYIA 3O4QA 3NF6A 4B08A 4F2SA 2I5JA 2HHUA 5CYMA 3VQPA 1X1PA 5DK5A 4AHVA 5KGXA 4Z4IA 3VA3A 2X6NA 4DG1A 4CE9A 1F21A 1BCMA 4BACA 1FXXA 3AO5A 4FLYA 2XY6A 3TAFA 1A5XA 1BCOA 2JGUA 4N5SA 4FLVA 3KLEA 4LH4A 1UA0A 3L2WA 1KTQA 3ZSXA 2GUIA 4HVJA 5HRNA 4BE2A 1JXEA 2O4IA 3V81A 1XHZA 4HUFA 2IS3A 4EZ6A 4O0JA 3VQ6A 3EZ5A 4DTSA 4Y1CA 5KRTA 1A5WA 4C8MA 3K5NA 4CJPA 1TKZA 1TGOA 4KO0A 3TAQA 4JLHA 2VWJA 3QIOA 3VQQA 4J2DA 1RBTA 4E3SA 4CEOA 4W5QA 4GVMA 2LSNA 4CGHA 2XHBA 2HHVA 1RTIA 2YHAA 3QETA 3VQAA 1BI4A 1HPZA 1L5UA 1CLQA 2DTUA 5C24A 3ASMA 4C8OA 1ZBUA 1QHTA 2GV9A 4B8AB 1RT3A 4CJ3A 4CJFA 1TKDA 4B9LA 2HVIA 3K59A 3K5MA 3S3OA 2KQ2A 2HHWA 4BE0A 4DSIA 5HRPA 4CJUA 3LP0A 3CG7A 1T03A 4CJEA 2G8IA 1NK4A 3HT3A 1U45A 4CHOA 5J2PA 4CFDA 4CJVA 1S1XA 1BL3A 2HB5A 4DFMA 3H08A 3IS9A 1K6YA 4E1NA 3AVBA 3PX6A 3SQ0A 1T7PA 1SKWA 2VG5A 1JLCA 1LAVA 1IKYA 1GOCA 1S6PA 1VK0A 2HNDA 2O4GA 2NUBA 2XY8A 4CGFA 1LV5A 4MQ3A 3ZSVA 3OYCA 3G0ZA 4O0IA 3DOKA 4QAGA 1C1BA 2ZE2A 3AVCA 4OLAA 2YV0X 1WSFA 1S5JA 3QEIA 1HYSA 1ZYQA 2B4JA 4DTMA 4B9NA 3QLHA 4W5OA 3SUOA 2FBXA 1NK0A 2X78A 4FLTA 4AHRA 1ASWA 1J54A 1D5AA 2IOCA 4KHNA 2HMIA 2P1JA 1TL3A 4B9VA 4DTJA 4DTRA 4E7IA 3QEXA 1MU2A 3V1QA 3SQ2A 3NF9A 4FLUA 4CFAA 5HRSA 2YHBA 3AVNA 5FROA 3AO4A 3WNEA 2FBYA 3KLHA 1WN7A 1C0UA 1WLJA 3M8RA 4FM0A 3VQEA 5KRSA 4O55A 1UWBA 4FM2A 2FC0A 4Z4HA 3RR7A 2Z1GA 2R7YA 4FJIA 4KKOA 1TAQA 3TANA 4K8ZA 2ZD1A 1S9EA 4CHNA 3VQCA 3FFIA 3OYNA 1JL1A 1TV6A 2WOMA 4HUGA 3QINA 1D9DA 1WSIA 1ZBHA 1VSFA 4OVLA 1TK5A 3D45A 4BDZA 3KTQA 3NGYA 2XRIA 4CEFA 3HP6A 5I42A 4KHSA 1SKRA 2Z1IA 1T8EA 2GBZA 4DLGA 1HMVA 3O3HA 4CJ4A 1UA1A 2RPIA 4E7HA 3ZT3A 1EXQA 3M8QA 1RTHA 3CFOA 1KLMA 1REVA 2OPPA 4CEZA 4I2QA 3LWLA 4JRPA 4B9UA 1EX4A 1XHXA 3ZSYA 3K57A 1ZBFA 4DTXA 3PO5A 3MXIA 1JKHA 3HSTB 2OPQA 1ASUA 1IO2A 3KLFA 4NCGA 2HVHA 3EY1A 4BWMA 3P83D 3K2PA 2ATQA 1VSEA 1RDAA 4CIFA 3KK2A 3RRGA 2D0CA 2KW4A 3QESA 1U4BA 1D8YA 3PY8A 3CM6A 4ICLA 1U49A 2HHQA 3OYAA 3HM9A 3ISNC 3A2FA 4FJGA 3NAEA 4AHCA 4CJ5A 1SV5A 2DFFA 1QSLA 3BDPA 4FZYA 1T05A 3B6OA 3NFAA 1NK9A 4DSJA 1HNVA 1NJWA 1HYZA 4DFPA 5FRNA 1BQNA 4PQUA 1J53A 3OYJA 4Z4GA 5E41A 4KRFA 3C94A 4G1QA 1YTAA 4FW1A 3ZSZA 2OPSA 2Z1JA 1CZBA 1DLOA 4IDKA 3VQ7A 4CEDA 2X74A 4CEQA 5SZTA 4Q5VA 3PX4A 4AHSA 2HW3A 3ZSRA 1EKEA 3S9HA 3CYMA 3AV9A 3KJVA 3E01A 1Q9XA 2VG7A 1RDBA 4RW4A 3PO4A 4EZ9A 2D0BA 4EP5A 4CJWA 2QKKA 3MECA 2OZMA 1RT4A 1DTTA 4W5NA 4FJLA 3KLGA 4NYFA 3KIOA 3LP2A 4N47A 4AH9A 3OYFA 1NK8A 2DFEA 1U48A 1S1VA 4B9SA 4J2AA 2BGGA 2IDOA 4CF0A 3OS2A 4RW6A 4CIGA 1B9FA 3I0RA 3LZJA 2YNIA 4DTOA 3HP9A 2PY5A 4J2BA 4RW7A 4NCAA 4KI6A 3V9ZA 4C8NA 1JXBA 5C25A 4CK1A 3OS1A 3DMJA 2QKBA 2D0AA 4CEAA 2KZMA 3C6UA 3SV3A 2W42A 4FCYA 1VSIA 3ZCMA 4ID5A 4FXDA 4CHZA 2P51A 4KTWA 4CF2A 4FW2A 4IBNA 4CFBA 3PX0A 3ITHA 4M3WA 3OJUA 3TABA 1C0MA 1CZ9A 2BANA 5SWMA 2G8VA 2G8UA 3SJJA 4CF8A 3M8SA 4CHYA 4FLWA 4KTZA 4CESA 4Z4CA 3OYGA 3DLBA 4DQPA 4O44A 3SUNA 5C42A 1TK0A 1CXQA 4FK0A 1JLEA 1Q8IA 3F73A 4FLXA 4FJHA 3BGRA 5JS2A 1IKXA 3OJSA 1EETA 4RW8A 4C8KA 1RT5A 5D3GA 1J5OA 3TARA 3V9SA 1YVUA 1BIZA 1WSJA 4IFVA 4FZZA 4M42A 2HHSA 4UQGA 3O3GA 3MXJA 1Z25A 4E0DA 4CK2A 3C6TA 1W9HA 4DS4A 2XO7A 4DSKA 4N76A 3KD1E 3AA2A 3U3GA 3SPZA 3DRPA 4KB1A 1Z26A 3KKSA 4LY7A 4DSLA 2ETJA 3WNGA 3OYDA 5CY4A 1S6QA 3CQ8A 1RT1A 4BDYA 4DFKA 1RDDA 4FJMA 1SL0A 2E6LA 2IC3A 1BISA 4BE1A 4DQRA 3AVKA 3SQ4A 4FVMA 4H8KA 3SNNA 1S1TA 1U47A 1ASVA 3SPYA 1QSSA 1TVRA 4F8RA 4DQSA 4MFBA 4M3RA 1TK8A 1BI4B 1HQUA 3V9UA 3RTVA 1BQMA 3UIQA 1LW2A 1RCHA 1ZBIA 4Q0BA 1VSHA 3LWMA 1C0TA 2WONA 3QEWA 3VQ8A 3V6DA 3AA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EU7 A;  2XY7 A;  4DU1 A;  4OGE A;  3L2R A;  2F96 A;  1NKB A;  4DSE A;  2XY5 A;  1BHL A;  3OY9 A;  4I9Q A;  1WSE A;  3QO9 A;  3U6F A;  3ZT0 A;  3AO3 A;  4CGI A;  4E7J A;  2B6A A;  3QNN A;  1TAU A;  4CK3 A;  3L2U A;  1SKS A;  1QQC A;  1EP4 A;  1VRT A;  1JLQ A;  1KCF A;  3HPH A;  4PA1 A;  1WSH A;  4W5R A;  3L3V A;  4KV8 A;  3NH0 A;  1CXU A;  3IRX A;  1HYV A;  3KLI A;  1JL2 A;  3DM2 A;  3MEE A;  4WE1 A;  2YNH A;  4CGD A;  3LZI A;  4K8X A;  2YKN A;  1KVA A;  4O4G A;  4OPJ A;  4DTN A;  1J9A A;  3SI6 A;  2P5G A;  3SUP A;  1L3T A;  5J2N A;  2PZS A;  3KK1 A;  3DLE A;  3NE6 A;  1RBV A;  3TAM A;  3AVH A;  3ZT2 A;  4HTU A;  3P1G A;  4CHQ A;  2D5R A;  1RBU A;  3NBP A;  2RN2 A;  3C95 A;  3RMC A;  1QSY A;  4PUO A;  4CJL A;  4E1M A;  3PV8 A;  4DMN A;  2PYJ A;  1SL2 A;  1XI1 A;  3DI6 A;  1JLB A;  3ZT4 A;  2HNZ A;  4CFC A;  4JS4 A;  4M45 A;  4KI4 A;  1KFD A;  3HJF A;  4CCH A;  4CIE A;  3DLK A;  4R5P A;  3MEG A;  4KHU A;  4DFJ A;  4FJ5 A;  4CEE A;  4FJ9 A;  1FKO A;  1LW0 A;  1TKX A;  4FJN A;  3KKR A;  3LAL A;  4OGC A;  4DSF A;  3SQ1 A;  3ZSO A;  2HHX A;  1WSG A;  1S9G A;  3KK3 A;  1X9W A;  3PUF A;  4IKF A;  5K14 A;  1KLN A;  1S1U A;  4LSN A;  2P5O A;  4CF1 A;  3L8B A;  1RTD A;  3DRS A;  2G8H A;  4FZX C;  4NCB A;  3AVJ A;  1VSM A;  3S3N A;  1NK5 A;  4DQQ A;  1L3V A;  3VQ9 A;  3ZSQ A;  1WAJ A;  1RIL A;  1NJX A;  2FBT A;  3LAN A;  4O5B A;  3O3F A;  3MXM A;  1NK6 A;  2QXF A;  1QTM A;  4OKJ A;  2A1S A;  3M8P A;  3MAQ A;  2KZZ A;  4CER A;  3JYT A;  4H4M A;  3I8D A;  4FM1 A;  4B8C A;  3U3Y A;  1BGX T;  4KTQ A;  4HCB A;  2Q3S A;  3T3F A;  1GOA A;  4FJK A;  1KFS A;  4M3U A;  3QIP A;  1NOY A;  2QK9 A;  3DLG A;  3NHG A;  4DLE A;  3V1O A;  3SUQ A;  3LAM A;  1NK7 A;  3LP3 A;  4W5T A;  3RMA A;  3OYH A;  4IFY A;  5CYQ A;  3IAY A;  3HPG A;  1KRP A;  3V4I A;  1BIU A;  1O1W A;  5DMR A;  2YKM A;  5HRO A;  4Z4E A;  4DU3 A;  3AA5 X;  1YTU A;  4BWJ A;  3DRR A;  3AVM A;  1RT2 A;  1YT3 A;  5FDL A;  2Y1J A;  4DS5 A;  3LP1 A;  1JLF A;  4PWD A;  4GMJ B;  3RWU A;  4KFB A;  4DU4 A;  5HBM A;  4EP4 A;  5HRR A;  1KVC A;  3AVG A;  4XIU A;  4M3X A;  3TAE A;  2EHG A;  1X9M A;  5KTQ A;  4QOZ B;  1TKT A;  1TL1 A;  1G15 A;  2RF2 A;  3HXM A;  4ZTJ A;  1DTQ A;  1NKC A;  1SL1 A;  4I2P A;  4LH5 A;  4CGJ A;  4YNQ A;  3SCX A;  1RNH A;  1RTJ A;  3ULD A;  4LD0 A;  3WNH A;  3OS0 A;  3CFP A;  1N5Y A;  4E89 A;  1Y97 A;  2G8W A;  2E6M A;  3NH2 A;  3V9W A;  3L2V A;  3TWH A;  4KB0 A;  3LPU A;  2ITG A;  3LDS A;  5I3U A;  3AVL A;  2IGI A;  3HPO A;  2OPR A;  4DTU A;  4Z0U A;  1N6Q A;  1U04 A;  4N41 A;  3NCI A;  2B5J A;  1IKW A;  4RW9 A;  3OYK A;  2KFN A;  4FK2 A;  3K5O A;  1VSJ A;  1JLA A;  4C8L A;  3K58 A;  3I0S A;  1C1C A;  2EX3 A;  3QNO A;  3HO1 A;  3RMD A;  3NGI A;  5T7B A;  3RR8 A;  3NF7 A;  4I7F A;  4KPY A;  4F3O A;  1LWC A;  4CHP A;  3OVN A;  4FJ8 A;  2Z1H A;  5J2Q A;  4LSL A;  4BDP A;  4F2R A;  3RMB A;  1VSK A;  4KHY A;  1IH7 A;  3MED A;  3V1R A;  3OYB A;  2FBV A;  4M3Y A;  4AHT A;  1FK9 A;  2VG6 A;  3AO1 A;  3LPT A;  1RBS A;  4FJJ A;  1C6V A;  2OZS A;  3OYL A;  2BDP A;  3NGZ A;  4OLB A;  3DOL A;  1XWL A;  3WNF A;  5HLF A;  3RRH A;  3AVF A;  1W0H A;  4L8R B;  4B9T A;  2E4L A;  4F3T A;  4JS5 A;  4AHU A;  4HCC A;  3VQB A;  3TR8 A;  3K5L A;  1IG9 A;  2PYL A;  1C1A A;  3VQ4 A;  3LAK A;  1I3A A;  3VQ5 A;  3ZT1 A;  2F8T A;  4NYN A;  4KHQ A;  1S1W A;  4ELV A;  5J1E A;  1LWF A;  4DF4 A;  1NOZ A;  2HNY A;  1ZBL A;  4FLZ A;  2RKI A;  2YNF A;  3QER A;  2G8K A;  1HJR A;  1JLG A;  1NJY A;  4FK4 A;  4HUE A;  5KGW A;  4ZHR A;  4FYD A;  4CJR A;  3T1A A;  1X9S A;  4OKE A;  3SZ2 A;  2DY4 A;  1RT6 A;  2G8F A;  2DFH A;  4M41 A;  3O4N A;  1Q9Y A;  1B9D A;  3HVT A;  4CEB A;  4CF9 A;  4IG3 A;  3AVI A;  4AIL C;  1KVB A;  3OYE A;  3TI0 A;  1L3S A;  3L3U A;  2A1R A;  4I9L A;  4KRE A;  4YFU A;  4HHT A;  4DWI A;  1UAX A;  1VRU A;  3VQD A;  3QEV A;  3EYZ A;  3D0P A;  2BE2 A;  4B3O A;  1IKV A;  4IG0 A;  3SYZ A;  1I39 A;  3HK2 A;  2OYQ A;  4E7L A;  4B9M A;  1RT7 A;  4KAZ A;  4CJT A;  4DQI A;  3CM5 A;  4ZTF A;  4Z4F A;  4DF8 A;  4CEC A;  3QEP A;  2JLE A;  1VSD A;  3S3M A;  3AVA A;  1UOC A;  2IAJ A;  2AJQ A;  1QS4 A;  3F9K A;  4E19 A;  4CGG A;  4OPK A;  1B92 A;  4FJX A;  4QCL A;  5HP1 A;  3T19 A;  1QE1 A;  1KSP A;  2ZQB A;  4FJ7 A;  3VN5 A;  3L2Q A;  4CJQ A;  1WAF A;  4N56 A;  3IG1 A;  1LWE A;  4RG8 A;  4TSX A;  3ALY A;  1HQE A;  3TAP A;  2Y1I A;  1FKP A;  3OYM A;  2F8S A;  1RDC A;  3TAG A;  1LAW A;  4F4K A;  4M3Z A;  3NDK A;  3AO2 A;  1WNS A;  3SV4 A;  1HRH A;  4CJK A;  1SUQ A;  1HNI A;  3DYA A;  4ID1 A;  1NKE A;  5J2M A;  4E7K A;  3HYF A;  4PY5 A;  3AA4 A;  3VA0 A;  1ITG A;  3B6P A;  3P5J A;  3CFR A;  3V9X A;  1A5V A;  4ELT A;  1NJZ A;  4M3T A;  4OJR A;  3ZSW A;  1R0A A;  2YNG A;  2HHT A;  3NH1 A;  1D9F A;  2KFZ A;  4DTP A;  1RBR A;  3THV A;  1VSL A;  2OA8 A;  5CZ2 A;  4Y1D A;  2X6S A;  5JS1 A;  3KD5 E;  3HL8 A;  2VWK A;  3G10 A;  1L3U A;  1XC9 A;  2KTQ A;  4CJS A;  5CZ1 A;  4J2E A;  3DLR A;  4ELU A;  5KI6 A;  1GOB A;  3JSM A;  5FRM A;  4GW6 A;  4OKK A;  4KHW A;  4H4O A;  4JRQ A;  3NF8 A;  3DLH A;  3HVR A;  3OYI A;  3O4Q A;  3NF6 A;  4B08 A;  4F2S A;  2I5J A;  2HHU A;  5CYM A;  3VQP A;  1X1P A;  5DK5 A;  4AHV A;  5KGX A;  4Z4I A;  3VA3 A;  2X6N A;  4DG1 A;  4CE9 A;  1F21 A;  1BCM A;  4BAC A;  1FXX A;  3AO5 A;  4FLY A;  2XY6 A;  3TAF A;  1A5X A;  1BCO A;  2JGU A;  4N5S A;  4FLV A;  3KLE A;  4LH4 A;  1UA0 A;  3L2W A;  1KTQ A;  3ZSX A;  2GUI A;  4HVJ A;  5HRN A;  4BE2 A;  1JXE A;  2O4I A;  3V81 A;  1XHZ A;  4HUF A;  2IS3 A;  4EZ6 A;  4O0J A;  3VQ6 A;  3EZ5 A;  4DTS A;  4Y1C A;  5KRT A;  1A5W A;  4C8M A;  3K5N A;  4CJP A;  1TKZ A;  1TGO A;  4KO0 A;  3TAQ A;  4JLH A;  2VWJ A;  3QIO A;  3VQQ A;  4J2D A;  1RBT A;  4E3S A;  4CEO A;  4W5Q A;  4GVM A;  2LSN A;  4CGH A;  2XHB A;  2HHV A;  1RTI A;  2YHA A;  3QET A;  3VQA A;  1BI4 A;  1HPZ A;  1L5U A;  1CLQ A;  2DTU A;  5C24 A;  3ASM A;  4C8O A;  1ZBU A;  1QHT A;  2GV9 A;  4B8A B;  1RT3 A;  4CJ3 A;  4CJF A;  1TKD A;  4B9L A;  2HVI A;  3K59 A;  3K5M A;  3S3O A;  2KQ2 A;  2HHW A;  4BE0 A;  4DSI A;  5HRP A;  4CJU A;  3LP0 A;  3CG7 A;  1T03 A;  4CJE A;  2G8I A;  1NK4 A;  3HT3 A;  1U45 A;  4CHO A;  5J2P A;  4CFD A;  4CJV A;  1S1X A;  1BL3 A;  2HB5 A;  4DFM A;  3H08 A;  3IS9 A;  1K6Y A;  4E1N A;  3AVB A;  3PX6 A;  3SQ0 A;  1T7P A;  1SKW A;  2VG5 A;  1JLC A;  1LAV A;  1IKY A;  1GOC A;  1S6P A;  1VK0 A;  2HND A;  2O4G A;  2NUB A;  2XY8 A;  4CGF A;  1LV5 A;  4MQ3 A;  3ZSV A;  3OYC A;  3G0Z A;  4O0I A;  3DOK A;  4QAG A;  1C1B A;  2ZE2 A;  3AVC A;  4OLA A;  2YV0 X;  1WSF A;  1S5J A;  3QEI A;  1HYS A;  1ZYQ A;  2B4J A;  4DTM A;  4B9N A;  3QLH A;  4W5O A;  3SUO A;  2FBX A;  1NK0 A;  2X78 A;  4FLT A;  4AHR A;  1ASW A;  1J54 A;  1D5A A;  2IOC A;  4KHN A;  2HMI A;  2P1J A;  1TL3 A;  4B9V A;  4DTJ A;  4DTR A;  4E7I A;  3QEX A;  1MU2 A;  3V1Q A;  3SQ2 A;  3NF9 A;  4FLU A;  4CFA A;  5HRS A;  2YHB A;  3AVN A;  5FRO A;  3AO4 A;  3WNE A;  2FBY A;  3KLH A;  1WN7 A;  1C0U A;  1WLJ A;  3M8R A;  4FM0 A;  3VQE A;  5KRS A;  4O55 A;  1UWB A;  4FM2 A;  2FC0 A;  4Z4H A;  3RR7 A;  2Z1G A;  2R7Y A;  4FJI A;  4KKO A;  1TAQ A;  3TAN A;  4K8Z A;  2ZD1 A;  1S9E A;  4CHN A;  3VQC A;  3FFI A;  3OYN A;  1JL1 A;  1TV6 A;  2WOM A;  4HUG A;  3QIN A;  1D9D A;  1WSI A;  1ZBH A;  1VSF A;  4OVL A;  1TK5 A;  3D45 A;  4BDZ A;  3KTQ A;  3NGY A;  2XRI A;  4CEF A;  3HP6 A;  5I42 A;  4KHS A;  1SKR A;  2Z1I A;  1T8E A;  2GBZ A;  4DLG A;  1HMV A;  3O3H A;  4CJ4 A;  1UA1 A;  2RPI A;  4E7H A;  3ZT3 A;  1EXQ A;  3M8Q A;  1RTH A;  3CFO A;  1KLM A;  1REV A;  2OPP A;  4CEZ A;  4I2Q A;  3LWL A;  4JRP A;  4B9U A;  1EX4 A;  1XHX A;  3ZSY A;  3K57 A;  1ZBF A;  4DTX A;  3PO5 A;  3MXI A;  1JKH A;  3HST B;  2OPQ A;  1ASU A;  1IO2 A;  3KLF A;  4NCG A;  2HVH A;  3EY1 A;  4BWM A;  3P83 D;  3K2P A;  2ATQ A;  1VSE A;  1RDA A;  4CIF A;  3KK2 A;  3RRG A;  2D0C A;  2KW4 A;  3QES A;  1U4B A;  1D8Y A;  3PY8 A;  3CM6 A;  4ICL A;  1U49 A;  2HHQ A;  3OYA A;  3HM9 A;  3ISN C;  3A2F A;  4FJG A;  3NAE A;  4AHC A;  4CJ5 A;  1SV5 A;  2DFF A;  1QSL A;  3BDP A;  4FZY A;  1T05 A;  3B6O A;  3NFA A;  1NK9 A;  4DSJ A;  1HNV A;  1NJW A;  1HYZ A;  4DFP A;  5FRN A;  1BQN A;  4PQU A;  1J53 A;  3OYJ A;  4Z4G A;  5E41 A;  4KRF A;  3C94 A;  4G1Q A;  1YTA A;  4FW1 A;  3ZSZ A;  2OPS A;  2Z1J A;  1CZB A;  1DLO A;  4IDK A;  3VQ7 A;  4CED A;  2X74 A;  4CEQ A;  5SZT A;  4Q5V A;  3PX4 A;  4AHS A;  2HW3 A;  3ZSR A;  1EKE A;  3S9H A;  3CYM A;  3AV9 A;  3KJV A;  3E01 A;  1Q9X A;  2VG7 A;  1RDB A;  4RW4 A;  3PO4 A;  4EZ9 A;  2D0B A;  4EP5 A;  4CJW A;  2QKK A;  3MEC A;  2OZM A;  1RT4 A;  1DTT A;  4W5N A;  4FJL A;  3KLG A;  4NYF A;  3KIO A;  3LP2 A;  4N47 A;  4AH9 A;  3OYF A;  1NK8 A;  2DFE A;  1U48 A;  1S1V A;  4B9S A;  4J2A A;  2BGG A;  2IDO A;  4CF0 A;  3OS2 A;  4RW6 A;  4CIG A;  1B9F A;  3I0R A;  3LZJ A;  2YNI A;  4DTO A;  3HP9 A;  2PY5 A;  4J2B A;  4RW7 A;  4NCA A;  4KI6 A;  3V9Z A;  4C8N A;  1JXB A;  5C25 A;  4CK1 A;  3OS1 A;  3DMJ A;  2QKB A;  2D0A A;  4CEA A;  2KZM A;  3C6U A;  3SV3 A;  2W42 A;  4FCY A;  1VSI A;  3ZCM A;  4ID5 A;  4FXD A;  4CHZ A;  2P51 A;  4KTW A;  4CF2 A;  4FW2 A;  4IBN A;  4CFB A;  3PX0 A;  3ITH A;  4M3W A;  3OJU A;  3TAB A;  1C0M A;  1CZ9 A;  2BAN A;  5SWM A;  2G8V A;  2G8U A;  3SJJ A;  4CF8 A;  3M8S A;  4CHY A;  4FLW A;  4KTZ A;  4CES A;  4Z4C A;  3OYG A;  3DLB A;  4DQP A;  4O44 A;  3SUN A;  5C42 A;  1TK0 A;  1CXQ A;  4FK0 A;  1JLE A;  1Q8I A;  3F73 A;  4FLX A;  4FJH A;  3BGR A;  5JS2 A;  1IKX A;  3OJS A;  1EET A;  4RW8 A;  4C8K A;  1RT5 A;  5D3G A;  1J5O A;  3TAR A;  3V9S A;  1YVU A;  1BIZ A;  1WSJ A;  4IFV A;  4FZZ A;  4M42 A;  2HHS A;  4UQG A;  3O3G A;  3MXJ A;  1Z25 A;  4E0D A;  4CK2 A;  3C6T A;  1W9H A;  4DS4 A;  2XO7 A;  4DSK A;  4N76 A;  3KD1 E;  3AA2 A;  3U3G A;  3SPZ A;  3DRP A;  4KB1 A;  1Z26 A;  3KKS A;  4LY7 A;  4DSL A;  2ETJ A;  3WNG A;  3OYD A;  5CY4 A;  1S6Q A;  3CQ8 A;  1RT1 A;  4BDY A;  4DFK A;  1RDD A;  4FJM A;  1SL0 A;  2E6L A;  2IC3 A;  1BIS A;  4BE1 A;  4DQR A;  3AVK A;  3SQ4 A;  4FVM A;  4H8K A;  3SNN A;  1S1T A;  1U47 A;  1ASV A;  3SPY A;  1QSS A;  1TVR A;  4F8R A;  4DQS A;  4MFB A;  4M3R A;  1TK8 A;  1BI4 B;  1HQU A;  3V9U A;  3RTV A;  1BQM A;  3UIQ A;  1LW2 A;  1RCH A;  1ZBI A;  4Q0B A;  1VSH A;  3LWM A;  1C0T A;  2WON A;  3QEW A;  3VQ8 A;  3V6D A;  3AA3 A; 
#chains in the Genus database with same CATH topology
 2XY7 A;  4NLC A;  5AQM A;  2XY5 A;  1WSE A;  3NVM A;  3QO9 A;  1TAU A;  1SKS A;  4K25 A;  1KCF A;  4KV8 A;  3IRX A;  4CGD A;  2YKN A;  1KVA A;  5BN8 A;  5J2N A;  3KK1 A;  3DLE A;  4IWV A;  2HF3 A;  1QSY A;  2RN2 A;  4BRN A;  3KHY A;  4CJL A;  4E1M A;  1HX1 A;  1XI1 A;  3ZEU A;  1JLB A;  4CFC A;  4X62 K;  3CJB A;  4DR7 K;  3DLK A;  4CEE A;  4JK7 A;  4FSV A;  1NMN A;  4CZF A;  4OGC A;  3SQ1 A;  2Q0R A;  1IV0 A;  3PUF A;  2ZJR L;  5K14 A;  1S1U A;  1RTD A;  4FZX C;  2QTD A;  3VER A;  1YAG A;  1L3V A;  2J4R A;  3VQ9 A;  2YHY A;  5BRD A;  4JI2 K;  2FF3 B;  1RIL A;  2KKZ A;  3LAN A;  3O3F A;  2P9K B;  3MXM A;  2ZF5 O;  3LDP A;  4OKJ A;  3A5L C;  3WEE A;  2W6K A;  3JYT A;  3E9P A;  5FPE A;  1ATN A;  3RMA A;  3OYH A;  5CYQ A;  2UUA K;  2UUC K;  1YVN A;  1O1W A;  4NB4 A;  4BWJ A;  1J5E K;  3TTC A;  5AFU A;  3LP1 A;  4GMJ B;  4KFB A;  4DU4 A;  4CBX A;  5HRR A;  2A42 A;  4JAX A;  1X9M A;  5KTQ A;  1RGI A;  1C0F A;  4H5W A;  1DTQ A;  4IO8 A;  2GEL A;  4CGJ A;  3SCX A;  4YNQ A;  2UU9 K;  4Z94 A;  1NGC A;  3WNH A;  3CFP A;  1ATR A;  3R6M A;  2CGL A;  4GVE A;  1N5Y A;  4BRK A;  3NH2 A;  3V9W A;  4KB0 A;  2ITG A;  2IGI A;  4DV1 K;  4DTU A;  4WQ5 C;  1D4X A;  3CXC M;  1IKW A;  3OYK A;  1VSJ A;  4BRA A;  5ADX H;  1VQN N;  5EVZ A;  3PLA A;  3NF7 A;  5M1O A;  4I7F A;  4KPY A;  1HKB A;  1VSK A;  2V7Z A;  4BR5 A;  4NXM K;  4YOW A;  3V1R A;  1FK9 A;  1C6V A;  4AM7 A;  4BC4 A;  2BDP A;  1YUW A;  1XWL A;  5HLF A;  4WFN L;  4L8R B;  3D2F A;  3K5L A;  5BRF A;  3CJ7 A;  2YJF A;  3VQ5 A;  2F8T A;  1EWQ A;  5J1E A;  1LWF A;  3C6H A;  4YOU A;  4DF4 A;  1NOZ A;  1ZBL A;  2G8K A;  4CZH A;  4B1Z A;  4BRG A;  3ENH A;  3PIP L;  2OTJ N;  1Q82 O;  2A6A A;  4LFA K;  1J6Z A;  1RT6 A;  4I6M A;  4O8K A;  3A5M C;  4YDU C;  2QEX N;  1B9D A;  4CEB A;  1VQM N;  1KVB A;  3TI0 A;  2NZT A;  4NXN K;  4I9L A;  3ZLJ A;  4HHT A;  2E20 A;  5AQW A;  3DAW A;  4M63 C;  3JS6 A;  4IG0 A;  2RHK A;  3HK2 A;  3I8B A;  1DEJ A;  4KAZ A;  1RT7 A;  4CJT A;  3CM5 A;  4DF8 A;  5JLF A;  1NGH A;  4CEC A;  1VSD A;  3F9K A;  4FWP A;  3ZYY X;  4CGG A;  5IT9 O;  2YCH A;  1KD1 O;  4QCL A;  1QQN A;  1KSP A;  3MCA B;  1DKG D;  2FSK A;  4N56 A;  4BRQ A;  3IG1 A;  5GIO A;  2ZM6 K;  5HOO A;  3NVK A;  1HQE A;  3ULE A;  5IWA K;  1RDC A;  3TAG A;  1H1V A;  1WNS A;  1HNI A;  3MWT A;  4ID1 A;  3HYF A;  3AA4 A;  4IXC A;  4BVO A;  3P5J A;  3VA0 A;  3V9X A;  3ID6 A;  3FLC O;  5M1P A;  4B3R K;  4PL8 A;  4M3T A;  3ZEU B;  2QWM A;  2YNG A;  2HHT A;  3NH1 A;  4A5B A;  2KFZ A;  3GDQ A;  2A40 A;  3THV A;  4A2B A;  2E2Q A;  3CQY A;  2HBL A;  3G10 A;  3SMP A;  4H0X B;  4ELU A;  4BR9 A;  5FRM A;  4GW6 A;  5AQL A;  3DLL L;  1X1P A;  3HSC A;  4B1X B;  3VA3 A;  3HRG A;  1BDG A;  1DT9 A;  3AO5 A;  3CD6 N;  1NWK A;  1KTQ A;  3BZK A;  2GUI A;  3FZH A;  4BE2 A;  1JXE A;  3V81 A;  1NG9 A;  2IS3 A;  2EWS A;  3VQ6 A;  4DHY A;  3J80 O;  3CIP A;  4HWI A;  2OCE A;  3QIO A;  4H03 B;  1RBT A;  4E3S A;  4GVM A;  2XHB A;  3QET A;  3VQA A;  1YHQ N;  3O80 A;  4C8O A;  3UE5 A;  1QHT A;  3CJ9 A;  2QA4 N;  4FWM A;  3THW A;  4M7X A;  2HHW A;  1LOT B;  3RSE A;  1T03 A;  3H1V X;  4CJE A;  3VMF B;  4CHO A;  2UUB K;  5J2P A;  2HB5 A;  3BUZ B;  1VQL N;  4CZK A;  4DR2 K;  1T7P A;  1SKW A;  1JLC A;  1GOC A;  3O5B A;  2QWL A;  2NUB A;  2XY8 A;  2W41 A;  5GAE P;  1TYQ A;  3G0Z A;  4DV2 K;  4BR4 A;  5AZJ A;  2YV0 X;  3KVG A;  4GKJ K;  1WSF A;  1ZYQ A;  4B9N A;  3K0S A;  3HBT A;  1NNE A;  2X78 A;  4FLT A;  4AHR A;  2P1J A;  3MMV A;  4DTJ A;  3SQ2 A;  5LMN K;  1Y64 A;  4AF1 A;  5FRO A;  4FM0 A;  2FSN A;  4Z4H A;  3ATU A;  2Z1G A;  2R7Y A;  3D2F B;  5AQF A;  1ZXO A;  4K8Z A;  1SS6 A;  4OPA A;  4AM6 A;  4B1Y B;  2NRW A;  2DPN A;  1TK5 A;  3NGY A;  4CEF A;  1HNZ K;  5C2F A;  1T6C A;  3E66 A;  4DLG A;  3QDK A;  3J7A P;  1EXQ A;  1REV A;  4I6M B;  3CHW A;  4I2Q A;  3VGL A;  1HR0 K;  3MXI A;  3ATV A;  1JKH A;  1IO2 A;  3I33 A;  4LC9 B;  3EY1 A;  4B1U B;  1RDA A;  2D1K A;  1U4B A;  3HI0 A;  3HM9 A;  3AAR A;  4RWT A;  4CJ5 A;  1E4F T;  3R3L A;  1T05 A;  3NFA A;  1NK9 A;  1I94 K;  5AFU H;  1QQO A;  3C0B A;  1HYZ A;  4DFP A;  5FRN A;  4PQU A;  2QXL A;  3LM2 A;  4B1W B;  4G1Q A;  2OPS A;  3VQ7 A;  3PX4 A;  2X74 A;  4CEQ A;  3W0L A;  4BQL A;  1KC8 O;  1MWM A;  2VG7 A;  2D0B A;  1RT4 A;  1Q81 O;  1JJ2 M;  4FJL A;  4NYF A;  2VGM A;  2VQF K;  4CBU A;  3ULE B;  3OS2 A;  4LF4 K;  4DTO A;  3HP9 A;  2P9U A;  3ENB A;  1NLV A;  4RW7 A;  4KI6 A;  2CH6 A;  1JXB A;  3O9Q A;  5AQT A;  3IMX A;  3DMJ A;  4K41 A;  2QKB A;  2KZM A;  4DKW A;  3C6U A;  3SV3 A;  4WFA L;  2P9P A;  4ID5 A;  3ZCM A;  4WQ5 A;  2P51 A;  4BG9 A;  2FF6 A;  4M3W A;  3OJU A;  4K0K K;  5SWM A;  2UXC K;  1ATS A;  4CES A;  1HKG A;  4Z4C A;  3DLB A;  4O44 A;  3SUN A;  2F9W A;  3BP8 A;  3CPE A;  3I56 N;  3AAP A;  2PAV A;  4WYB A;  4LF7 K;  3LDO A;  3D2E A;  1Z25 A;  3MWP A;  3C6T A;  3PSF A;  4DSK A;  2XO7 A;  4GKK K;  3SPZ A;  5FLX O;  3WUH A;  5I9E B;  3WNG A;  3OYD A;  4FWK A;  2O8C A;  4BDY A;  1C0G A;  1LCU A;  4DFK A;  5C2D A;  2NRH A;  3FZF A;  2YJE A;  4DQR A;  4BE1 A;  4GV3 A;  3V9U A;  4IO9 L;  2HHV A;  1BQM A;  1RCH A;  3VF4 A;  1C0T A;  2WON A;  3VQ8 A;  3N4Q A;  3V6D A;  1NGJ A;  4DU1 A;  3THW B;  3L2R A;  4YDU A;  1HKC A;  1NKB A;  1N34 K;  4DSE A;  3OY9 A;  3ZT0 A;  4XH5 A;  2B6A A;  4BR7 A;  4CK3 A;  3HPH A;  1YF5 L;  1WSH A;  2ASO A;  3NH0 A;  2P5G A;  3CJA A;  3KLI A;  1JL2 A;  4K8X A;  1YXQ A;  2YNH A;  3SI6 A;  1Q7Y O;  3GBT A;  4FWQ A;  4NLB A;  4HTU A;  3CC2 N;  4PUO A;  3CQX A;  1WB9 A;  3PV8 A;  4DMN A;  1TYQ B;  1YJW N;  5AZJ B;  3HJF A;  4R5P A;  4DFJ A;  4L3Q A;  3VES A;  1FKO A;  4FJN A;  3ZSO A;  1S9G A;  1HUX A;  1X9W A;  5JLH A;  2P5O A;  4BG8 A;  3DRS A;  2G8H A;  4NCB A;  3AVJ A;  1VSM A;  1NK5 A;  3ZX3 A;  1NK6 A;  2QXF A;  3M8P A;  3MAQ A;  4CER A;  4FM1 A;  3I8D A;  3U3Y A;  1NU0 A;  1KAY A;  1GOA A;  1VQK N;  1KFS A;  3M6G A;  3NHG A;  1YIJ N;  2AP1 A;  3SUQ A;  3LAM A;  1NK7 A;  3THY A;  4IFY A;  3IAY A;  3V4I A;  2YKM A;  3CME N;  3CET A;  3A5N C;  1YTU A;  3DRR A;  5KPZ A;  3MN9 A;  3AVM A;  3VOV A;  4F9O A;  3VEX A;  3CER A;  3TSU A;  4JEP A;  4YOT A;  4BRP A;  1KVC A;  1KAX A;  2Q36 A;  2RF2 A;  3HXM A;  4OX9 K;  3HOS A;  3U4L A;  1SL1 A;  4LH5 A;  5JVH L;  4AQY K;  4JKG A;  4LD0 A;  3OS0 A;  4E89 A;  5F1X A;  2G8W A;  4JK9 A;  3VEN A;  3L2V A;  3TWH A;  1NGD A;  2OPR A;  4Z0U A;  1U04 A;  4N41 A;  3NCI A;  4HTL A;  2KFN A;  4RW9 A;  3K5O A;  1HPM A;  4BRM A;  3O9R A;  4JKC A;  1C1C A;  1NGE A;  3RMD A;  1X3M A;  3CCJ N;  4YOV A;  3FE1 A;  3OVN A;  1QZ5 A;  3EO3 A;  2P9S B;  4BDP A;  2P9U B;  3RMB A;  2VQE K;  4KHY A;  1IH7 A;  4LFC K;  4M3Y A;  4AHT A;  1RBS A;  3NGZ A;  4OLB A;  2P9P B;  3DOL A;  3RRH A;  5C15 A;  4LF6 K;  2BUP A;  2E4L A;  2PYL A;  1C1A A;  3ZT1 A;  4KHQ A;  4JKD A;  2NLX A;  1GLD G;  1IBL K;  3QER A;  4MDB A;  1NJY A;  4FK4 A;  5KGW A;  3SBG A;  2GWJ A;  3SZ2 A;  4YY3 K;  2G8F A;  5KPT A;  3VEY A;  4DV4 K;  1XMO K;  4CF9 A;  3QBX A;  1L3S A;  2O8C B;  3L3U A;  2A5X A;  4DWI A;  1CZA N;  3VQD A;  3QEV A;  3EYZ A;  3D0P A;  4JHD A;  3VEW A;  1IKV A;  2O8E A;  1P8Z A;  3D6R A;  4ZTF A;  5E26 A;  3S3M A;  1GLA G;  1UOC A;  3O1W A;  3CJC A;  3LL3 A;  3T19 A;  4EIA A;  2ZQB A;  4FJ7 A;  4CJQ A;  4XH1 A;  4YOR A;  2O8D A;  1Z6R A;  1FKP A;  2E88 A;  3CPW M;  1JCG A;  1XQS C;  3NDK A;  3SV4 A;  1HRH A;  1NKE A;  4PY5 A;  4BRI A;  4CD1 A;  3B6P A;  3DXM A;  1A5V A;  4ELT A;  1R0A A;  1SQK A;  3H3O B;  4DV3 K;  3L0Q A;  2KLA A;  3HL8 A;  2KTQ A;  3A0I X;  4CJS A;  4JI5 K;  1GOB A;  4CW7 B;  3JSM A;  4H4O A;  3NF8 A;  3O4Q A;  2HHU A;  2P9I A;  5CYM A;  5C10 A;  3VQP A;  4AHV A;  4H0Y B;  4QS9 A;  4CE9 A;  1FXX A;  3VF2 A;  3TAF A;  1K8A O;  1A5X A;  1BCO A;  2JGU A;  1QVG M;  4BY9 C;  3KLE A;  2UXD K;  1UA0 A;  3L2W A;  4JI7 K;  2GUP A;  2E8A A;  1XHZ A;  4HUF A;  4O0J A;  4CJP A;  3THY B;  1TKZ A;  4KO0 A;  2VWJ A;  4CVN E;  4W5Q A;  2LSN A;  1BI4 A;  5AR0 A;  3F2K A;  1JCF A;  2GV9 A;  4B8A B;  4JV5 K;  4MO5 A;  4CJ3 A;  1TKD A;  1TUU A;  4DSI A;  2NRX A;  2NRR A;  5HRP A;  3W3D A;  3TPQ A;  3LP0 A;  1S72 N;  2G8I A;  4FWN A;  3MK6 A;  1NK4 A;  4CJV A;  4DFM A;  3IS9 A;  4JKA A;  3BEX A;  1GLB G;  3SQ0 A;  3OTO K;  3AY9 A;  1S6P A;  3QB0 A;  3C65 A;  3HM8 A;  5F0X A;  1LV5 A;  2PFU A;  4MQ3 A;  2CGJ A;  3VET A;  3WXK A;  3HZ6 A;  3AVC A;  4DR1 K;  4B3M K;  1S5J A;  1HYS A;  5JVG L;  4DTM A;  3IDH A;  2A41 A;  3MCP A;  4IOX A;  4KH5 A;  4W5O A;  4H0T B;  1TL3 A;  2GEM A;  3EN9 A;  4BRC A;  1ZBS A;  4FLU A;  3P38 A;  3KLH A;  3CMA N;  3AO4 A;  3WNE A;  2FBY A;  1WN7 A;  2FC0 A;  1RFQ A;  4FJI A;  4KKO A;  3TAN A;  1P90 A;  3OYN A;  4BC5 A;  3QIN A;  1WBB A;  2PBD A;  3HP6 A;  3MX2 A;  5I42 A;  1SKR A;  2Z1I A;  2GBZ A;  1JCE A;  1HMV A;  4CJ4 A;  3TSQ A;  1UA1 A;  4E7H A;  4ISF A;  3M8Q A;  1KLM A;  2OPP A;  4CEZ A;  2BTF A;  1XHX A;  3C6A A;  2V51 B;  1ZBF A;  4JI3 K;  3ZX2 A;  3PO5 A;  2Q1N A;  2ZJP L;  3HST B;  2E2O A;  4NCG A;  1W97 L;  3K2P A;  2ATQ A;  5M1F A;  3VEZ A;  4JHD B;  5LJW A;  2O8E B;  4IEI A;  1U49 A;  3OYA A;  4DUY K;  3A2F A;  5AQV A;  4DSJ A;  1DGK N;  1NJW A;  4FWR A;  5BRH A;  3EL2 A;  4CED A;  1CZB A;  1DLO A;  1Q9X A;  4IDH A;  4RW4 A;  4EZ9 A;  2OAN A;  4BRO A;  4R79 A;  2QKK A;  3MEC A;  2O8B A;  5KPR A;  1DTT A;  4W5N A;  3QBW A;  2HBM A;  4KH4 A;  4B9S A;  3WXM B;  1U48 A;  2O8D B;  3WEE B;  4RW6 A;  5M1Q A;  2YNI A;  2PY5 A;  4J2B A;  4JI1 K;  4NCA A;  3TTF A;  3OS1 A;  3DXM B;  3F5T A;  5AQP A;  4FCY A;  1FJG K;  1T44 A;  1HJO A;  4FOI A;  3PX0 A;  4IBN A;  4CFB A;  3TAB A;  1C0M A;  4CF8 A;  2I7P A;  1S22 A;  4DQP A;  1TK0 A;  1JLE A;  1Q8I A;  1BA1 A;  5JS2 A;  1IKX A;  3OJS A;  4H0P A;  3L6Q A;  2P9I B;  3VTH A;  3TAR A;  4GV9 A;  2HOE A;  1WSJ A;  2P9N A;  4M42 A;  2HHS A;  3O3G A;  2YHX A;  3MXJ A;  3CCQ N;  3T69 A;  1VAZ A;  1W9H A;  4DS4 A;  4CD3 A;  3CQ8 A;  1RT1 A;  2FXU A;  4FWO A;  1SL0 A;  2E6L A;  2IC3 A;  4H8K A;  1U47 A;  4G9Z A;  1ASV A;  3SPY A;  1TVR A;  3VTI A;  4M3R A;  1BI4 B;  1HQU A;  3UB5 A;  3UIQ A;  2NRT A;  1R59 O;  2Q0U A;  1VSH A;  3LWM A;  3J8A A;  4JI0 K;  4OGE A;  3SAH A;  1BHL A;  4NO7 A;  5LMU K;  3AO3 A;  4CGI A;  3QNN A;  1EP4 A;  4IOA L;  1CXU A;  3MN5 A;  4BC2 A;  1WBD A;  2ASM A;  2VCP A;  3LZI A;  4DTN A;  1J9A A;  1X9J A;  3ID8 A;  1GLE G;  3L4I A;  3TAM A;  3ZT2 A;  3P1G A;  5TKW A;  2D5R A;  1RBU A;  1KQS M;  3CCE N;  3RMC A;  3HOT A;  3A5O C;  3BZC A;  4EHU A;  1SL2 A;  3QML A;  4JKE A;  4JS4 A;  3ZT4 A;  2HNZ A;  4M45 A;  4CCH A;  3KZB A;  3K9J A;  4CIE A;  2ZJQ L;  3MEG A;  3OBY A;  1LW0 A;  1TKX A;  4A62 A;  3IKM A;  2HHX A;  2E1Z A;  4FWS A;  5M1K A;  3KK3 A;  1VQ9 N;  4BGA A;  1KLN A;  3P4I A;  5EOY A;  4BVP A;  3S3N A;  3M3Z A;  5AQU A;  2H3G X;  3O9S A;  1QTM A;  5GIN A;  4B9Q A;  2A1S A;  2HBK A;  2KZZ A;  4H4M A;  4B8C A;  2IVN A;  1BGX T;  4HCB A;  3EE8 A;  2Q3S A;  3GOI A;  3QIP A;  2ITM A;  2QK9 A;  3DLG A;  4DLE A;  5B8H A;  4W5T A;  4JKF A;  5AQH A;  1KRP A;  5DMR A;  4WCE L;  4Z4E A;  3AA5 X;  4IFE A;  2AA4 A;  4BC3 A;  1RT2 A;  5FDL A;  4DS5 A;  4PWD A;  5HBM A;  4EP4 A;  3AVG A;  4M3X A;  1TKT A;  4RCH A;  4ZTJ A;  1NMD A;  5AQK A;  2QWR A;  1NKC A;  5GAD P;  2D0O A;  3T1Y K;  3ULD A;  1Q86 O;  5AQX A;  1VQ8 N;  2E6M A;  3LPU A;  3LDS A;  3AVL A;  3HPO A;  3ZET A;  4ILH A;  2Q2R A;  1JLA A;  4Y0W A;  5CE3 A;  2EX3 A;  2FSJ A;  3QNO A;  4MLH A;  2O8B B;  3JXU A;  4A2A A;  2BH1 A;  3NGI A;  3RR8 A;  4FJ8 A;  3I55 N;  2QWN A;  2UYT A;  3MED A;  2FBV A;  3CI5 A;  3FZM A;  3M5R A;  3LPT A;  2OZS A;  3OYL A;  5BPL A;  5GAH P;  1U2V A;  3KWI A;  2QM1 A;  2NNW A;  3CF5 L;  4JD2 A;  4AHU A;  4HCC A;  3TR8 A;  5AQS A;  1IG9 A;  3LAK A;  1I3A A;  4NYN A;  1S1W A;  5BN9 A;  2HNY A;  3RSE B;  4FLZ A;  2RKI A;  1YI2 N;  2YNF A;  1JLG A;  4CZJ A;  4ZHR A;  5FPD A;  4M7Y A;  4FPB A;  3T1A A;  1X9S A;  4OKE A;  2DY4 A;  2P9N B;  2DFH A;  4M41 A;  1OH6 A;  3O4N A;  1Q9Y A;  4IG3 A;  3AVI A;  1HNW K;  2A1R A;  4WFB L;  1NBW A;  4YFU A;  4BRE A;  1BWF O;  5H1S Q;  2BE2 A;  4B3O A;  5E84 A;  1BG3 A;  5JMV A;  1I39 A;  2E2P A;  2OYQ A;  4B9M A;  4EFH A;  4BR0 A;  4DQI A;  5LL6 Z;  1OH7 A;  1N33 K;  3H1Q A;  3O08 A;  2JLE A;  3AVA A;  2IAJ A;  3WXJ A;  1QS4 A;  4E19 A;  3CC7 N;  4JN4 A;  4FJX A;  1OVQ A;  3BF3 A;  3L2Q A;  3MN7 A;  5EX5 A;  1WAF A;  2W40 A;  3F9M A;  1VHX A;  1LWE A;  4RG8 A;  4LF9 K;  3ALY A;  4IZ9 A;  4CZG A;  3TAP A;  4LFB K;  4DV0 K;  1GLJ O;  2Y1I A;  3OYM A;  2F8S A;  2IVP A;  2QWQ A;  3VF6 A;  1LAW A;  4M3Z A;  2IIR A;  3T7Z A;  3AO2 A;  4CJK A;  2HST A;  3DYA A;  5J2M A;  4E7K A;  1ITG A;  3CFR A;  5BPN A;  1NJZ A;  4OJR A;  3ZSW A;  4DV6 K;  1D9F A;  4DTP A;  2YHW A;  1RBR A;  4ILG B;  2JWL A;  1M1K O;  4Y1D A;  2X6S A;  3KD5 E;  3H46 O;  1L3U A;  1ESV A;  1VQP N;  1QVF M;  4JYA K;  4J2E A;  1VQ7 N;  3G4S N;  1EWR A;  3HVR A;  2F4V K;  3NF6 A;  2E5L K;  1IBM K;  4F2S A;  2I5J A;  3JAM O;  3C7N A;  5KGX A;  4DG1 A;  1BCM A;  2XY6 A;  4N5S A;  4FLV A;  5F2R A;  3AAQ A;  5DM7 L;  3ZSX A;  4HVJ A;  2O4I A;  5MLC Q;  4CJ7 A;  3FGU A;  4DTS A;  3EZ5 A;  4C8M A;  3LDQ A;  3K5N A;  1TGO A;  4JLH A;  3VQQ A;  3CCM N;  4CGH A;  1RTI A;  1HPZ A;  3P31 A;  3U8X A;  3O9U A;  1CLQ A;  2DTU A;  5C24 A;  3ASM A;  1ZBU A;  4CJF A;  2HVI A;  3K5M A;  1HNX K;  4A61 A;  2KQ2 A;  4IOC L;  2WFB A;  4BGB A;  3RVC A;  1Q18 A;  4U67 L;  3E1Y A;  3HT3 A;  4CFD A;  1S1X A;  3S41 A;  1K6Y A;  3NMU A;  4E1N A;  1IG8 A;  3ZET B;  1IKY A;  1X3N A;  2HND A;  2O4G A;  3MN6 A;  3SAF A;  5AQJ A;  3ZSV A;  5HL7 L;  3D2E B;  4X65 K;  3DOK A;  1HLU A;  4JNE A;  2D4W A;  1C1B A;  2ZE2 A;  4OPH A;  4OLA A;  3QEI A;  1RDU A;  3UKU A;  4J8F A;  3L4Q A;  3QLH A;  4X64 K;  2FBX A;  5LJV A;  3CCL N;  1ASW A;  1D5A A;  2HMI A;  5C0Y A;  4B9V A;  4DTR A;  3QEX A;  1MU2 A;  3BF1 A;  3V1Q A;  3NF9 A;  4CFA A;  3LM9 A;  2YHB A;  2RE2 A;  1L5U A;  1U2V B;  1WLJ A;  1NGI A;  3VQE A;  4O55 A;  3EEQ A;  3RR7 A;  4JD2 B;  5GIP A;  1K8K A;  1V4S A;  2ZD1 A;  1S9E A;  3QFP A;  4CHN A;  3FFI A;  1JL1 A;  1TV6 A;  2WOM A;  4BR2 A;  4HUG A;  4EAH D;  1V4T A;  2HHH K;  4OVL A;  4BDZ A;  4KHS A;  5AQN A;  2XRI A;  4BRF A;  3O3H A;  3GG4 A;  1GLL O;  1XMQ K;  2RPI A;  3ZT3 A;  3CFO A;  3G6E N;  4B9U A;  3ZSY A;  3K57 A;  1N8R O;  3QIC A;  4C1N K;  2HVH A;  3E9L A;  1WOQ A;  3P83 D;  1VSE A;  4CIF A;  3KK2 A;  3RRG A;  1NM1 A;  3PY8 A;  3CM6 A;  4ICL A;  1EO1 A;  5CHI A;  3ISN C;  5AQI A;  3NAE A;  4A5A A;  1SV5 A;  2DFF A;  4FZY A;  3B6O A;  4DV5 K;  3CJ1 A;  4OO1 J;  3PIO L;  1S3X A;  1J53 A;  4BRD A;  3OYJ A;  4Z4G A;  4KRF A;  3SMS A;  3C94 A;  3QES A;  4FW1 A;  3ZSZ A;  4IDK A;  2Z1J A;  1W7A A;  4Q5V A;  3R8E A;  2CGK A;  3S9H A;  2Q31 A;  3AV9 A;  3CYM A;  3KK7 A;  2VGN A;  4GY2 B;  4EP5 A;  3MDQ A;  4JI6 K;  1NK8 A;  3LP2 A;  4AH9 A;  1U6Z A;  2DFE A;  1S1V A;  4J2A A;  2BGG A;  2O8F A;  2IDO A;  4XEI A;  4CIG A;  1B9F A;  3I0R A;  3LZJ A;  4FL9 A;  3GE1 A;  3V9Z A;  4C8N A;  4QS7 A;  2V52 B;  5C25 A;  2D0A A;  2NRV A;  5A2Q O;  4PKI A;  2W42 A;  1VSI A;  1EQY A;  4FXD A;  4KTW A;  5AQQ A;  4FW2 A;  4CF2 A;  1CZ9 A;  2BAN A;  2G8V A;  2G8U A;  3SJJ A;  4CHY A;  4KTZ A;  5M1N A;  3GL1 A;  1NJI O;  1CXQ A;  4FK0 A;  1TUY A;  3SLC A;  4FLX A;  4FJH A;  3KWG A;  3BGR A;  1EET A;  4FOE A;  2ZWH A;  1RT5 A;  1G99 A;  1YVU A;  3C7N B;  3O4W A;  4JKG B;  1BIZ A;  3BY5 A;  4IFV A;  4FZZ A;  1KAZ A;  2Q97 A;  2ZGY A;  4N76 A;  2CH5 A;  3AA2 A;  4B3T K;  4KB1 A;  4LY7 A;  4DQ8 A;  4DSL A;  3SJH A;  3VGK A;  1BIS A;  3AVK A;  4FVM A;  3SNN A;  1S1T A;  1QSS A;  3CC4 N;  3EKU A;  5KQ8 A;  4Q0B A;  2HF4 A;  3AA3 A;  2V7Y A;  4V19 S;  5EU7 A;  1FW6 A;  2F96 A;  4PL7 A;  3OBW A;  4I9Q A;  3U6F A;  4PHT X;  3DJC A;  2WUS A;  4E7J A;  3L2U A;  1QQC A;  1VRT A;  4PA1 A;  1JLQ A;  4W5R A;  3L3V A;  1MA9 B;  4WE1 A;  1HYV A;  1ILY A;  3DM2 A;  4IJN A;  3MEE A;  1BA0 A;  4O4G A;  4OPJ A;  4PKH A;  4UY8 O;  3SUP A;  1L3T A;  2PZS A;  4IJA A;  1RBV A;  5DM6 L;  3AVH A;  4ISE A;  3NE6 A;  4CHQ A;  3NBP A;  4DB3 A;  3C95 A;  3DXK A;  2PYJ A;  3H6E A;  3DI6 A;  3IFR A;  3FZL A;  4KI4 A;  1KFD A;  3ZX0 A;  4KHU A;  4FJ5 A;  3D7E O;  4CZL A;  3UKU B;  4FJ9 A;  4DV7 K;  3IUC A;  3KKR A;  3LAL A;  4DSF A;  1WSG A;  4IKF A;  4LSN A;  1N36 K;  4CF1 A;  3L8B A;  1YJ9 N;  4WQ4 C;  4DQQ A;  4DR5 K;  3ZSQ A;  1WAJ A;  3TTD A;  1BOT O;  4KHP K;  1NJX A;  2FBT A;  3OW2 M;  4O5B A;  2IVO A;  2QW9 A;  1K8K B;  3R1X A;  5AQY A;  3CCV N;  4KTQ A;  3T3F A;  4FJK A;  4M3U A;  3SBT A;  1NOY A;  2GWK A;  3V1O A;  3LP3 A;  2YX6 A;  1RDW X;  3HPG A;  1BIU A;  5HRO A;  4DU3 A;  1NGF A;  2JWK A;  1XNR K;  4O5F A;  1YT3 A;  4DCH A;  2Y1J A;  1JLF A;  3RWU A;  1NGA A;  4XIU A;  1ZC6 A;  3TAE A;  2EHG A;  4QOZ B;  1TL1 A;  1G15 A;  4CZI A;  4CZE A;  3U9Z A;  4MO4 A;  4I2P A;  1RNH A;  1RTJ A;  2E2N A;  4KBO A;  1QZ6 A;  1Y97 A;  5I3U A;  4DR6 K;  3UKR A;  1N6Q A;  2B5J A;  4FK2 A;  4C8L A;  3K58 A;  2QWO A;  3I0S A;  1QQM A;  1XC3 A;  4BQZ A;  3HO1 A;  5GAG P;  5T7B A;  2O8F B;  4F3O A;  1LWC A;  4CHP A;  3SAG A;  2Z1H A;  4DR3 K;  4LSL A;  5J2Q A;  4F2R A;  4YHH K;  3AGR A;  5EY4 A;  3OYB A;  1XUP O;  3AO1 A;  2VG6 A;  4H0V B;  4FJJ A;  3EE9 A;  4FO0 A;  3WNF A;  3AVF A;  1W0H A;  1T3V A;  4B9T A;  4F3T A;  4JS5 A;  3VQB A;  4A59 A;  3J7Y P;  3VQ4 A;  4K43 A;  4ELV A;  4MLE A;  4K42 A;  2NRZ A;  3M1F A;  4RTF D;  1HJR A;  4HUE A;  4ISG A;  4FYD A;  2VYP A;  4CJR A;  3HVT A;  1M90 O;  3THX A;  2ASP A;  4AIL C;  3OYE A;  4KRE A;  1K9M O;  1UAX A;  1VRU A;  3WQT A;  3SYZ A;  3R9P A;  2HBJ A;  4E7L A;  3A8Y A;  5FPM A;  4U7B A;  1QHA A;  4Z4F A;  3QEP A;  3VEV A;  3FFK B;  2AJQ A;  4YOY A;  4JI8 K;  4OPK A;  1B92 A;  2P9L A;  2WC9 A;  5TKY A;  5HP1 A;  3Q7C A;  1QE1 A;  3VN5 A;  1SAZ A;  4DUZ K;  3FR0 A;  4TSX A;  3EKS A;  2A3Z A;  3FZK A;  3T1H K;  4CZM A;  3P39 A;  4F4K A;  3DWL A;  2E1Y A;  1SUQ A;  4CI6 A;  3H45 C;  3DXK B;  3U9D A;  2KHO A;  4H5N A;  3WQU A;  1VQ4 N;  2QI2 A;  1VSL A;  2OA8 A;  5CZ2 A;  5JS1 A;  2VWK A;  1XC9 A;  4XH4 A;  5CZ1 A;  3DLR A;  5KI6 A;  4OKK A;  4KHW A;  4JRQ A;  3DLH A;  5AZI A;  3OYI A;  4B08 A;  1NGB A;  1SZ2 A;  2FLO A;  4JK8 A;  3WT0 A;  5DK5 A;  1BU6 O;  4Z4I A;  2X6N A;  5AQG A;  1F21 A;  4BAC A;  3G25 A;  4FLY A;  5FPN A;  4LH4 A;  5HRN A;  2P9S A;  2F9T A;  2WTU A;  1OKJ A;  3EZW A;  4EZ6 A;  1VQO N;  4Y1C A;  5KRT A;  3CCU N;  5BPM A;  1A5W A;  2ZGZ A;  3TAQ A;  4J2D A;  2GTD A;  4CEO A;  4CBW A;  2YHA A;  1WUA A;  1BO5 O;  2VWB A;  1RT3 A;  4H5V A;  3AGK A;  4IEE A;  1E3M A;  4B9L A;  1YJN N;  3K59 A;  3S3O A;  1OH5 A;  4A57 A;  4BE0 A;  3OA9 A;  1IBK K;  3SK3 A;  1MWK A;  4CJU A;  3MX5 A;  5BRE A;  5ADX A;  3CG7 A;  3WXL A;  1YIT N;  2OTL N;  1U45 A;  1VQ5 N;  1BL3 A;  3H08 A;  4JKB A;  3AVB A;  3PX6 A;  1MDU B;  2VG5 A;  1LAV A;  3UKR B;  4C1N I;  4B3S K;  3G71 N;  1VK0 A;  5AJ3 K;  4BRH A;  4CGF A;  1KXP A;  3OYC A;  3PSI A;  4O0I A;  3HTV A;  3OHR A;  2WBN A;  4QAG A;  2F7T A;  2B4J A;  3O1B A;  2GX9 A;  1IJJ A;  3VPZ A;  3SUO A;  1NK0 A;  3Q7B A;  1J54 A;  2IOC A;  4KHN A;  1T6D A;  4E7I A;  4H0O A;  4E1J A;  4LF8 K;  3WXI A;  4X66 K;  5HRS A;  3AVN A;  4LF5 K;  1C0U A;  3M8R A;  1VQ6 N;  5KRS A;  1UWB A;  4FM2 A;  5CR4 A;  2P9K A;  3LDL A;  3QFU A;  1TAQ A;  4FVU A;  3VQC A;  5ELZ A;  4H5R A;  4O8U A;  4WF9 L;  1D9D A;  4YOX A;  1WSI A;  1ZBH A;  1VSF A;  3D45 A;  3KTQ A;  3J7Z O;  1T8E A;  3N4P A;  4QS8 A;  4BRL A;  4FPA A;  5BR8 K;  1RTH A;  3LWL A;  4JRP A;  3H3N O;  1EX4 A;  4WQ4 A;  4DTX A;  5EXW A;  1OH8 A;  3THX B;  3B8A X;  3LDN A;  2OPQ A;  1ASU A;  3KLF A;  4BWM A;  4EHT A;  1W2B M;  2HMP A;  2W6L A;  2D0C A;  2KW4 A;  1D8Y A;  2HHQ A;  5AQO A;  4FJG A;  1NGG A;  4AHC A;  4PKG A;  3BDP A;  1QSL A;  1GLC G;  1HNV A;  2QWP A;  1BQN A;  5E41 A;  1YTA A;  2P9L B;  2HW3 A;  5SZT A;  4AHS A;  1GLF O;  3ZSR A;  1EKE A;  3KJV A;  3E01 A;  1RDB A;  3VEO A;  3PO4 A;  4ILJ A;  4CJW A;  2OZM A;  3KLG A;  3KIO A;  4N47 A;  3OYF A;  2YI1 A;  3CCR N;  4CF0 A;  2UXB K;  1OVY A;  3O9T A;  2D0P A;  5JIC A;  4CK1 A;  5C12 A;  4CEA A;  4JI4 K;  5BR9 A;  3O6W A;  4JKH A;  4CHZ A;  4B1V A;  3CCS N;  3ITH A;  4GNI A;  3M8S A;  5AQR A;  1E4G T;  4FLW A;  3OYG A;  5C42 A;  1N32 K;  4C23 A;  3J81 O;  3F73 A;  5AZI B;  5KQD A;  3E9O A;  4RW8 A;  4C8K A;  5D3G A;  1J5O A;  3V9S A;  1BUP A;  3VGM A;  3O8M A;  4UQG A;  4E0D A;  4CK2 A;  4MDA A;  2I7N A;  4KH6 A;  3KD1 E;  3U3G A;  3DRP A;  1Z26 A;  3KKS A;  4FWL A;  2ETJ A;  5CY4 A;  1O13 A;  5AQZ A;  1S6Q A;  1Z05 A;  1RDD A;  3TU5 A;  4FJM A;  3K9K A;  3TSP A;  3SQ4 A;  5LY3 A;  4DR4 K;  1XNQ K;  4F8R A;  1K73 O;  4DQS A;  4MFB A;  1TK8 A;  1ZBI A;  3RTV A;  1LW2 A;  4H5T A;  3QEW A;  3ENO A;  4GV6 A; 
#chains in the Genus database with same CATH homology
 5EU7 A;  2XY7 A;  4DU1 A;  4OGE A;  3L2R A;  2F96 A;  1NKB A;  4DSE A;  2XY5 A;  1BHL A;  3OY9 A;  4I9Q A;  1WSE A;  3QO9 A;  3U6F A;  3ZT0 A;  3AO3 A;  4CGI A;  4E7J A;  2B6A A;  3QNN A;  1TAU A;  4CK3 A;  3L2U A;  1SKS A;  1QQC A;  1EP4 A;  1VRT A;  1JLQ A;  1KCF A;  3HPH A;  4PA1 A;  1WSH A;  4W5R A;  3L3V A;  4KV8 A;  3NH0 A;  1CXU A;  3IRX A;  1HYV A;  3KLI A;  1JL2 A;  3DM2 A;  3MEE A;  4WE1 A;  2YNH A;  4CGD A;  3LZI A;  4K8X A;  2YKN A;  1KVA A;  4O4G A;  4OPJ A;  4DTN A;  1J9A A;  3SI6 A;  2P5G A;  3SUP A;  1L3T A;  5J2N A;  2PZS A;  3KK1 A;  3DLE A;  3NE6 A;  1RBV A;  3TAM A;  3AVH A;  3ZT2 A;  4HTU A;  3P1G A;  4CHQ A;  2D5R A;  1RBU A;  3NBP A;  2RN2 A;  3C95 A;  3RMC A;  1QSY A;  4PUO A;  4CJL A;  4E1M A;  3PV8 A;  4DMN A;  2PYJ A;  1SL2 A;  1XI1 A;  3DI6 A;  1JLB A;  3ZT4 A;  2HNZ A;  4CFC A;  4JS4 A;  4M45 A;  4KI4 A;  1KFD A;  3HJF A;  4CCH A;  4CIE A;  3DLK A;  4R5P A;  3MEG A;  4KHU A;  4DFJ A;  4FJ5 A;  4CEE A;  4FJ9 A;  1FKO A;  1LW0 A;  1TKX A;  4FJN A;  3KKR A;  3LAL A;  4OGC A;  4DSF A;  3SQ1 A;  3ZSO A;  2HHX A;  1WSG A;  1S9G A;  3KK3 A;  1X9W A;  3PUF A;  4IKF A;  5K14 A;  1KLN A;  1S1U A;  4LSN A;  2P5O A;  4CF1 A;  3L8B A;  1RTD A;  3DRS A;  2G8H A;  4FZX C;  4NCB A;  3AVJ A;  1VSM A;  3S3N A;  1NK5 A;  4DQQ A;  1L3V A;  3VQ9 A;  3ZSQ A;  1WAJ A;  1RIL A;  1NJX A;  2FBT A;  3LAN A;  4O5B A;  3O3F A;  3MXM A;  1NK6 A;  2QXF A;  1QTM A;  4OKJ A;  2A1S A;  3M8P A;  3MAQ A;  2KZZ A;  4CER A;  3JYT A;  4H4M A;  3I8D A;  4FM1 A;  4B8C A;  3U3Y A;  1BGX T;  4KTQ A;  4HCB A;  2Q3S A;  3T3F A;  1GOA A;  4FJK A;  1KFS A;  4M3U A;  3QIP A;  1NOY A;  2QK9 A;  3DLG A;  3NHG A;  4DLE A;  3V1O A;  3SUQ A;  3LAM A;  1NK7 A;  3LP3 A;  4W5T A;  3RMA A;  3OYH A;  4IFY A;  5CYQ A;  3IAY A;  3HPG A;  1KRP A;  3V4I A;  1BIU A;  1O1W A;  5DMR A;  2YKM A;  5HRO A;  4Z4E A;  4DU3 A;  3AA5 X;  1YTU A;  4BWJ A;  3DRR A;  3AVM A;  1RT2 A;  1YT3 A;  5FDL A;  2Y1J A;  4DS5 A;  3LP1 A;  1JLF A;  4PWD A;  4GMJ B;  3RWU A;  4KFB A;  4DU4 A;  5HBM A;  4EP4 A;  5HRR A;  1KVC A;  3AVG A;  4XIU A;  4M3X A;  3TAE A;  2EHG A;  1X9M A;  5KTQ A;  4QOZ B;  1TKT A;  1TL1 A;  1G15 A;  2RF2 A;  3HXM A;  4ZTJ A;  1DTQ A;  1NKC A;  1SL1 A;  4I2P A;  4LH5 A;  4CGJ A;  4YNQ A;  3SCX A;  1RNH A;  1RTJ A;  3ULD A;  4LD0 A;  3WNH A;  3OS0 A;  3CFP A;  1N5Y A;  4E89 A;  1Y97 A;  2G8W A;  2E6M A;  3NH2 A;  3V9W A;  3L2V A;  3TWH A;  4KB0 A;  3LPU A;  2ITG A;  3LDS A;  5I3U A;  3AVL A;  2IGI A;  3HPO A;  2OPR A;  4DTU A;  4Z0U A;  1N6Q A;  1U04 A;  4N41 A;  3NCI A;  2B5J A;  1IKW A;  4RW9 A;  3OYK A;  2KFN A;  4FK2 A;  3K5O A;  1VSJ A;  1JLA A;  4C8L A;  3K58 A;  3I0S A;  1C1C A;  2EX3 A;  3QNO A;  3HO1 A;  3RMD A;  3NGI A;  5T7B A;  3RR8 A;  3NF7 A;  4I7F A;  4KPY A;  4F3O A;  1LWC A;  4CHP A;  3OVN A;  4FJ8 A;  2Z1H A;  5J2Q A;  4LSL A;  4BDP A;  4F2R A;  3RMB A;  1VSK A;  4KHY A;  1IH7 A;  3MED A;  3V1R A;  3OYB A;  2FBV A;  4M3Y A;  4AHT A;  1FK9 A;  2VG6 A;  3AO1 A;  3LPT A;  1RBS A;  4FJJ A;  1C6V A;  2OZS A;  3OYL A;  2BDP A;  3NGZ A;  4OLB A;  3DOL A;  1XWL A;  3WNF A;  5HLF A;  3RRH A;  3AVF A;  1W0H A;  4L8R B;  4B9T A;  2E4L A;  4F3T A;  4JS5 A;  4AHU A;  4HCC A;  3VQB A;  3TR8 A;  3K5L A;  1IG9 A;  2PYL A;  1C1A A;  3VQ4 A;  3LAK A;  1I3A A;  3VQ5 A;  3ZT1 A;  2F8T A;  4NYN A;  4KHQ A;  1S1W A;  4ELV A;  5J1E A;  1LWF A;  4DF4 A;  1NOZ A;  2HNY A;  1ZBL A;  4FLZ A;  2RKI A;  2YNF A;  3QER A;  2G8K A;  1HJR A;  1JLG A;  1NJY A;  4FK4 A;  4HUE A;  5KGW A;  4ZHR A;  4FYD A;  4CJR A;  3T1A A;  1X9S A;  4OKE A;  3SZ2 A;  2DY4 A;  1RT6 A;  2G8F A;  2DFH A;  4M41 A;  3O4N A;  1Q9Y A;  1B9D A;  3HVT A;  4CEB A;  4CF9 A;  4IG3 A;  3AVI A;  4AIL C;  1KVB A;  3OYE A;  3TI0 A;  1L3S A;  3L3U A;  2A1R A;  4I9L A;  4KRE A;  4YFU A;  4HHT A;  4DWI A;  1UAX A;  1VRU A;  3VQD A;  3QEV A;  3EYZ A;  3D0P A;  2BE2 A;  4B3O A;  1IKV A;  4IG0 A;  3SYZ A;  1I39 A;  3HK2 A;  2OYQ A;  4E7L A;  4B9M A;  1RT7 A;  4KAZ A;  4CJT A;  4DQI A;  3CM5 A;  4ZTF A;  4Z4F A;  4DF8 A;  4CEC A;  3QEP A;  2JLE A;  1VSD A;  3S3M A;  3AVA A;  1UOC A;  2IAJ A;  2AJQ A;  1QS4 A;  3F9K A;  4E19 A;  4CGG A;  4OPK A;  1B92 A;  4FJX A;  4QCL A;  5HP1 A;  3T19 A;  1QE1 A;  1KSP A;  2ZQB A;  4FJ7 A;  3VN5 A;  3L2Q A;  4CJQ A;  1WAF A;  4N56 A;  3IG1 A;  1LWE A;  4RG8 A;  4TSX A;  3ALY A;  1HQE A;  3TAP A;  2Y1I A;  1FKP A;  3OYM A;  2F8S A;  1RDC A;  3TAG A;  1LAW A;  4F4K A;  4M3Z A;  3NDK A;  3AO2 A;  1WNS A;  3SV4 A;  1HRH A;  4CJK A;  1SUQ A;  1HNI A;  3DYA A;  4ID1 A;  1NKE A;  5J2M A;  4E7K A;  3HYF A;  4PY5 A;  3AA4 A;  3VA0 A;  1ITG A;  3B6P A;  3P5J A;  3CFR A;  3V9X A;  1A5V A;  4ELT A;  1NJZ A;  4M3T A;  4OJR A;  3ZSW A;  1R0A A;  2YNG A;  2HHT A;  3NH1 A;  1D9F A;  2KFZ A;  4DTP A;  1RBR A;  3THV A;  1VSL A;  2OA8 A;  5CZ2 A;  4Y1D A;  2X6S A;  5JS1 A;  3KD5 E;  3HL8 A;  2VWK A;  3G10 A;  1L3U A;  1XC9 A;  2KTQ A;  4CJS A;  5CZ1 A;  4J2E A;  3DLR A;  4ELU A;  5KI6 A;  1GOB A;  3JSM A;  5FRM A;  4GW6 A;  4OKK A;  4KHW A;  4H4O A;  4JRQ A;  3NF8 A;  3DLH A;  3HVR A;  3OYI A;  3O4Q A;  3NF6 A;  4B08 A;  4F2S A;  2I5J A;  2HHU A;  5CYM A;  3VQP A;  1X1P A;  5DK5 A;  4AHV A;  5KGX A;  4Z4I A;  3VA3 A;  2X6N A;  4DG1 A;  4CE9 A;  1F21 A;  1BCM A;  4BAC A;  1FXX A;  3AO5 A;  4FLY A;  2XY6 A;  3TAF A;  1A5X A;  1BCO A;  2JGU A;  4N5S A;  4FLV A;  3KLE A;  4LH4 A;  1UA0 A;  3L2W A;  1KTQ A;  3ZSX A;  2GUI A;  4HVJ A;  5HRN A;  4BE2 A;  1JXE A;  2O4I A;  3V81 A;  1XHZ A;  4HUF A;  2IS3 A;  4EZ6 A;  4O0J A;  3VQ6 A;  3EZ5 A;  4DTS A;  4Y1C A;  5KRT A;  1A5W A;  4C8M A;  3K5N A;  4CJP A;  1TKZ A;  1TGO A;  4KO0 A;  3TAQ A;  4JLH A;  2VWJ A;  3QIO A;  3VQQ A;  4J2D A;  1RBT A;  4E3S A;  4CEO A;  4W5Q A;  4GVM A;  2LSN A;  4CGH A;  2XHB A;  2HHV A;  1RTI A;  2YHA A;  3QET A;  3VQA A;  1BI4 A;  1HPZ A;  1L5U A;  1CLQ A;  2DTU A;  5C24 A;  3ASM A;  4C8O A;  1ZBU A;  1QHT A;  2GV9 A;  4B8A B;  1RT3 A;  4CJ3 A;  4CJF A;  1TKD A;  4B9L A;  2HVI A;  3K59 A;  3K5M A;  3S3O A;  2KQ2 A;  2HHW A;  4BE0 A;  4DSI A;  5HRP A;  4CJU A;  3LP0 A;  3CG7 A;  1T03 A;  4CJE A;  2G8I A;  1NK4 A;  3HT3 A;  1U45 A;  4CHO A;  5J2P A;  4CFD A;  4CJV A;  1S1X A;  1BL3 A;  2HB5 A;  4DFM A;  3H08 A;  3IS9 A;  1K6Y A;  4E1N A;  3AVB A;  3PX6 A;  3SQ0 A;  1T7P A;  1SKW A;  2VG5 A;  1JLC A;  1LAV A;  1IKY A;  1GOC A;  1S6P A;  1VK0 A;  2HND A;  2O4G A;  2NUB A;  2XY8 A;  4CGF A;  1LV5 A;  4MQ3 A;  3ZSV A;  3OYC A;  3G0Z A;  4O0I A;  3DOK A;  4QAG A;  1C1B A;  2ZE2 A;  3AVC A;  4OLA A;  2YV0 X;  1WSF A;  1S5J A;  3QEI A;  1HYS A;  1ZYQ A;  2B4J A;  4DTM A;  4B9N A;  3QLH A;  4W5O A;  3SUO A;  2FBX A;  1NK0 A;  2X78 A;  4FLT A;  4AHR A;  1ASW A;  1J54 A;  1D5A A;  2IOC A;  4KHN A;  2HMI A;  2P1J A;  1TL3 A;  4B9V A;  4DTJ A;  4DTR A;  4E7I A;  3QEX A;  1MU2 A;  3V1Q A;  3SQ2 A;  3NF9 A;  4FLU A;  4CFA A;  5HRS A;  2YHB A;  3AVN A;  5FRO A;  3AO4 A;  3WNE A;  2FBY A;  3KLH A;  1WN7 A;  1C0U A;  1WLJ A;  3M8R A;  4FM0 A;  3VQE A;  5KRS A;  4O55 A;  1UWB A;  4FM2 A;  2FC0 A;  4Z4H A;  3RR7 A;  2Z1G A;  2R7Y A;  4FJI A;  4KKO A;  1TAQ A;  3TAN A;  4K8Z A;  2ZD1 A;  1S9E A;  4CHN A;  3VQC A;  3FFI A;  3OYN A;  1JL1 A;  1TV6 A;  2WOM A;  4HUG A;  3QIN A;  1D9D A;  1WSI A;  1ZBH A;  1VSF A;  4OVL A;  1TK5 A;  3D45 A;  4BDZ A;  3KTQ A;  3NGY A;  2XRI A;  4CEF A;  3HP6 A;  5I42 A;  4KHS A;  1SKR A;  2Z1I A;  1T8E A;  2GBZ A;  4DLG A;  1HMV A;  3O3H A;  4CJ4 A;  1UA1 A;  2RPI A;  4E7H A;  3ZT3 A;  1EXQ A;  3M8Q A;  1RTH A;  3CFO A;  1KLM A;  1REV A;  2OPP A;  4CEZ A;  4I2Q A;  3LWL A;  4JRP A;  4B9U A;  1EX4 A;  1XHX A;  3ZSY A;  3K57 A;  1ZBF A;  4DTX A;  3PO5 A;  3MXI A;  1JKH A;  3HST B;  2OPQ A;  1ASU A;  1IO2 A;  3KLF A;  4NCG A;  2HVH A;  3EY1 A;  4BWM A;  3P83 D;  3K2P A;  2ATQ A;  1VSE A;  1RDA A;  4CIF A;  3KK2 A;  3RRG A;  2D0C A;  2KW4 A;  3QES A;  1U4B A;  1D8Y A;  3PY8 A;  3CM6 A;  4ICL A;  1U49 A;  2HHQ A;  3OYA A;  3HM9 A;  3ISN C;  3A2F A;  4FJG A;  3NAE A;  4AHC A;  4CJ5 A;  1SV5 A;  2DFF A;  1QSL A;  3BDP A;  4FZY A;  1T05 A;  3B6O A;  3NFA A;  1NK9 A;  4DSJ A;  1HNV A;  1NJW A;  1HYZ A;  4DFP A;  5FRN A;  1BQN A;  4PQU A;  1J53 A;  3OYJ A;  4Z4G A;  5E41 A;  4KRF A;  3C94 A;  4G1Q A;  1YTA A;  4FW1 A;  3ZSZ A;  2OPS A;  2Z1J A;  1CZB A;  1DLO A;  4IDK A;  3VQ7 A;  4CED A;  2X74 A;  4CEQ A;  5SZT A;  4Q5V A;  3PX4 A;  4AHS A;  2HW3 A;  3ZSR A;  1EKE A;  3S9H A;  3CYM A;  3AV9 A;  3KJV A;  3E01 A;  1Q9X A;  2VG7 A;  1RDB A;  4RW4 A;  3PO4 A;  4EZ9 A;  2D0B A;  4EP5 A;  4CJW A;  2QKK A;  3MEC A;  2OZM A;  1RT4 A;  1DTT A;  4W5N A;  4FJL A;  3KLG A;  4NYF A;  3KIO A;  3LP2 A;  4N47 A;  4AH9 A;  3OYF A;  1NK8 A;  2DFE A;  1U48 A;  1S1V A;  4B9S A;  4J2A A;  2BGG A;  2IDO A;  4CF0 A;  3OS2 A;  4RW6 A;  4CIG A;  1B9F A;  3I0R A;  3LZJ A;  2YNI A;  4DTO A;  3HP9 A;  2PY5 A;  4J2B A;  4RW7 A;  4NCA A;  4KI6 A;  3V9Z A;  4C8N A;  1JXB A;  5C25 A;  4CK1 A;  3OS1 A;  3DMJ A;  2QKB A;  2D0A A;  4CEA A;  2KZM A;  3C6U A;  3SV3 A;  2W42 A;  4FCY A;  1VSI A;  3ZCM A;  4ID5 A;  4FXD A;  4CHZ A;  2P51 A;  4KTW A;  4CF2 A;  4FW2 A;  4IBN A;  4CFB A;  3PX0 A;  3ITH A;  4M3W A;  3OJU A;  3TAB A;  1C0M A;  1CZ9 A;  2BAN A;  5SWM A;  2G8V A;  2G8U A;  3SJJ A;  4CF8 A;  3M8S A;  4CHY A;  4FLW A;  4KTZ A;  4CES A;  4Z4C A;  3OYG A;  3DLB A;  4DQP A;  4O44 A;  3SUN A;  5C42 A;  1TK0 A;  1CXQ A;  4FK0 A;  1JLE A;  1Q8I A;  3F73 A;  4FLX A;  4FJH A;  3BGR A;  5JS2 A;  1IKX A;  3OJS A;  1EET A;  4RW8 A;  4C8K A;  1RT5 A;  5D3G A;  1J5O A;  3TAR A;  3V9S A;  1YVU A;  1BIZ A;  1WSJ A;  4IFV A;  4FZZ A;  4M42 A;  2HHS A;  4UQG A;  3O3G A;  3MXJ A;  1Z25 A;  4E0D A;  4CK2 A;  3C6T A;  1W9H A;  4DS4 A;  2XO7 A;  4DSK A;  4N76 A;  3KD1 E;  3AA2 A;  3U3G A;  3SPZ A;  3DRP A;  4KB1 A;  1Z26 A;  3KKS A;  4LY7 A;  4DSL A;  2ETJ A;  3WNG A;  3OYD A;  5CY4 A;  1S6Q A;  3CQ8 A;  1RT1 A;  4BDY A;  4DFK A;  1RDD A;  4FJM A;  1SL0 A;  2E6L A;  2IC3 A;  1BIS A;  4BE1 A;  4DQR A;  3AVK A;  3SQ4 A;  4FVM A;  4H8K A;  3SNN A;  1S1T A;  1U47 A;  1ASV A;  3SPY A;  1QSS A;  1TVR A;  4F8R A;  4DQS A;  4MFB A;  4M3R A;  1TK8 A;  1BI4 B;  1HQU A;  3V9U A;  3RTV A;  1BQM A;  3UIQ A;  1LW2 A;  1RCH A;  1ZBI A;  4Q0B A;  1VSH A;  3LWM A;  1C0T A;  2WON A;  3QEW A;  3VQ8 A;  3V6D A;  3AA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...