4DV2K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv2K00
5LL6Z 2UXBK 1XNQK 4KHPK 2UXDK 3J81O 1IBLK 5IWAK 4LF9K 4LFAK 4DR3K 1XNRK 4LF5K 4GKKK 5LMNK 4GKJK 4V19S 4B3SK 2UU9K 4DV3K 4X65K 4X62K 5LMUK 4DUYK 2VQFK 3J80O 4DR5K 2E5LK 2F4VK 5IT9O 1I94K 3J7YP 1IBMK 4DR6K 5FLXO 3T1HK 1HNXK 4K0KK 4JI1K 4B3TK 4DV6K 3JAMO 3T1YK 4CW7B 4DR4K 4JI3K 3J7AP 4JI0K 1IBKK 1J5EK 1HNWK 1HNZK 1XMQK 1XMOK 4JI2K 2UUBK 4JI8K 2UUAK 1N36K 2UXCK 5A2QO 4JYAK 4CVNE 1HR0K 4LFCK 4AQYK 4DV0K 4JV5K 1N34K 4JI7K 4JI4K 4DV4K 4LFBK 4B3RK 4B3MK 4DR2K 2VQEK 4DV1K 4DV2K 4YHHK 1N32K 4NXMK 2ZM6K 4DV7K 4JI5K 4DR1K 4LF4K 2UUCK 4JI6K 4DUZK 4LF7K 1FJGK 4LF8K 4DR7K 5BR8K 4DV5K 4LF6K 4OX9K 2HHHK 3OTOK 4X64K 4YY3K 4X66K 5AJ3K 1N33K 4NXNK
chains in the Genus database with same CATH superfamily
3RMCA 5BRFA 1C1BA 1T8EA 1E3MA 1TKDA 2O8FB 2HF4A 4H0YB 1LWFA 2Q97A 3VERA 5F1XA 5SZTA 4EAHD 2A1SA 3VQ4A 5EX5A 2KW4A 2O8FA 2DPNA 4JS5A 3PO4A 5BN8A 5AZJB 3CFOA 2Q3SA 1SKWA 3TAMA 3LZIA 3CJ9A 3HPGA 4H5RA 3SBGA 3AO4A 3R9PA 4DF8A 3D2EB 3VQ6A 3P83D 1S1TA 3NGIA 3HP9A 3GOIA 2FSNA 3CJAA 4CJLA 2QWRA 2QA4N 4FXDA 1SZ2A 2ZQBA 1NGCA 2CGLA 3K57A 2HNYA 4EZ9A 3JAMO 3H3OB 1SL1A 2JGUA 3OY9A 1KAZA 2FF3B 4B9UA 2HSTA 1BO5O 1QS4A 3MWTA 4DSKA 1RTHA 4BE0A 3MEGA 4H5TA 3WXLA 3TAPA 1GLFO 2UXCK 2QKBA 1QSYA 4FJKA 1YAGA 3QLHA 3SMSA 4JI7K 1HPZA 4BDPA 4BRPA 3VENA 3O6WA 1OH8A 4BRGA 5BPLA 1QQOA 3VA0A 3CCQN 5FRNA 3HPOA 3HO1A 4DV7K 4FWQA 1L3TA 4CJRA 3CYMA 3E1YA 2GBZA 4LF7K 3VF4A 4KB1A 2KZZA 3AVJA 4FPAA 4DV5K 4FLXA 4E7IA 4EFHA 2P9NA 4A2AA 1NK7A 4B9VA 3TSUA 4LY7A 4FJ8A 1RDDA 1OKJA 3OYEA 3VQEA 3FZFA 4ELTA 4PUOA 2XHBA 3SMPA 1XNQK 3SPZA 2UXDK 4EHTA 2VG7A 2P5GA 4DWIA 1QHTA 1RNHA 2P9LB 1JL1A 2YHBA 3R6MA 4YDUA 4YFUA 3PUFA 4N76A 3OYHA 1E4FT 2DY4A 5EU7A 1IH7A 2Z1HA 3AARA 4CJVA 3CCRN 1U48A 2P9LA 1ATRA 4JLHA 5HBMA 1CLQA 4K25A 1YJNN 1VQ8N 3FZLA 5KRSA 3D2FA 3U4LA 1ZC6A 4CHYA 3DXMB 3O1WA 3H46O 3RR7A 4I2QA 3QEXA 3K5MA 1BISA 2F8SA 4YORA 2P9KB 1BDGA 1X9WA 1MU2A 2FF6A 1VSMA 4BR0A 3AVFA 3V9XA 1R0AA 3CJBA 3CM5A 1SV5A 2NRTA 3QETA 1WUAA 4BC4A 1IBKK 4JKFA 2XO7A 2FXUA 4G9ZA 4AILC 3H08A 3P4IA 2QXLA 4ID1A 1D4XA 3PO5A 1FKOA 3AVMA 4GMJB 3VEXA 3MCAB 1HLUA 4CZLA 5A2QO 3J7ZO 4U67L 3VQ5A 1G99A 3L2UA 4FOIA 4PQUA 1T3VA 1HQUA 3ZX2A 1ZYQA 3DWLA 4FWPA 5LJVA 2ASMA 3J8AA 3NCIA 2HNDA 2NRWA 4JI6K 3MAQA 5AZIB 1DLOA 4KHUA 4BR2A 1P8ZA 3ZETB 4B1WB 1EKEA 4E0DA 1P90A 4PY5A 4M42A 4OX9K 4HUEA 1KCFA 3FZHA 3B6PA 5M1QA 4YOWA 4B9MA 1LAWA 3ZETA 1K8KB 2ZGZA 3U9ZA 3JYTA 2DFFA 1IBLK 3KK3A 4BVPA 4PL8A 4N47A 3ZSQA 1XNRK 1CZ9A 3O80A 1IV0A 3DRRA 4M3XA 4V19S 2H3GX 3MN7A 1XC9A 2UU9K 3KKRA 4CJWA 2A1RA 1NJZA 4H5VA 1HMVA 3A5NC 4YNQA 2XY5A 3KVGA 3DLBA 3M3ZA 2PFUA 2Z1JA 4KBOA 1YIJN 1EXQA 5GAHP 3V9SA 2QWNA 2V7ZA 4JK7A 4Z0UA 4K41A 4J2DA 1MA9B 1U6ZA 4JI1K 2V7YA 2GEMA 3PIPL 1TK5A 4FJ7A 4QOZB 3SK3A 3O9RA 1QVGM 1TGOA 2GWJA 3ZSOA 3OHRA 3KWGA 1NOYA 3HSCA 1TKZA 4UQGA 4OJRA 1TYQA 4BGBA 4JI2K 2HNZA 3QDKA 2E1YA 3ZSWA 5GADP 3SUQA 1RT5A 2P9IA 4B8CA 4IJAA 4LFCK 4YOYA 1GLDG 1VSLA 3I56N 3U3YA 4BGAA 4BDZA 2F8TA 3VQCA 4XH5A 3CHWA 5KPTA 1W0HA 2JWKA 4E3SA 3S41A 4CEOA 4DV2K 5EY4A 5AQMA 2P9SA 1QQNA 3ATVA 3PIOL 4BROA 3O9UA 2IVPA 1YTAA 1DTTA 2I7NA 4H4OA 2QWPA 4LF8K 1WBDA 4PL7A 3OYCA 4LSNA 4DQRA 3QEIA 4O8KA 3V81A 2X6NA 4FLUA 1RCHA 2Q36A 2NZTA 3IAYA 4FVUA 3K5OA 5J2QA 5CR4A 4B8AB 3B8AX 3NGZA 3LDLA 4LD0A 3R3LA 3F73A 1BCOA 2B4JA 2G8UA 4LF9K 2YJEA 3T19A 4B08A 2W42A 4KH5A 3M8QA 3TTDA 4DFPA 2IOCA 5J2PA 3ZCMA 4BQZA 3QEVA 5JS1A 4X65K 1VQ9N 2F96A 2RPIA 1JLCA 1D9FA 4N5SA 4FJLA 5FPMA 2VQFK 3EKUA 3K5LA 1VQMN 2WONA 4K8XA 3NHGA 1L3VA 3TABA 1ESVA 1YUWA 3G10A 3WEEB 3JXUA 3QFUA 1RFQA 3S9HA 4C1NK 1JJ2M 3DOKA 3O3HA 4IOAL 3ATUA 1EWQA 3OYJA 4JKHA 1NKBA 4AHSA 4WFAL 4AHRA 1EWRA 3EY1A 4IJNA 1TL1A 3IKMA 4CHPA 1T7PA 2YNHA 3DXKA 1UOCA 3QEPA 4IKFA 3O4NA 1IKYA 2YNIA 1U49A 1W9HA 3W0LA 1ITGA 4A62A 1BA1A 1WLJA 5KGWA 3C94A 3C95A 4DV4K 3RMBA 4CEDA 3SAFA 1IG8A 4DR2K 3AO3A 1RBRA 4BRDA 1N32K 1T6CA 3I55N 4MFBA 3HPHA 4MLHA 1CXQA 3CI5A 1GOCA 4B1YB 1JLBA 4OLBA 3MECA 4DUZK 2WUSA 3CC2N 1MWMA 3G6EN 1BI4A 3AVAA 1S72N 5FPEA 2YHXA 1NGHA 4DFMA 5C42A 3LDSA 4NXNK 4CFCA 4E7JA 2HHXA 4BQLA 1U2VA 2G8VA 2UXBK 1L3UA 4I6MB 4KHYA 2OANA 3BEXA 5MLCQ 4IFYA 2QEXN 3KD5E 4IWVA 1ZXOA 4CHNA 4W5TA 3IS9A 3K5NA 3GDQA 4CE9A 4B3SK 1Q18A 3NF6A 2O8DB 4FJNA 3RRGA 4O0JA 3TAQA 1OH5A 2PY5A 3V1OA 4OGEA 2D0BA 5C12A 3SCXA 4OLAA 4JRPA 4H5WA 1NJYA 4CIEA 4DR6K 4TSXA 3VF2A 4C8KA 2X6SA 3IRXA 1ATNA 3HVTA 1BGXT 2ITGA 2IC3A 1SKSA 3A0IX 2FSKA 3MN6A 2HOEA 4FW1A 5E26A 3AV9A 4C8LA 1RT1A 1W97L 3QERA 1BU6O 3WNEA 1J5EK 4AM6A 4FZXC 1EP4A 4J2BA 2E8AA 2RN2A 3VQ9A 2A6AA 2HBJA 1J53A 1YJ9N 4BRLA 1BA0A 1I39A 2HHTA 3AVLA 3DJCA 3V6DA 4FYDA 1EO1A 4JYAK 4FJMA 4CIFA 5LY3A 3AAPA 2YV0X 3HZ6A 4DU3A 4B9NA 4IOXA 1B9FA 3EL2A 3TSPA 5JICA 5BPNA 2VGMA 2O8EB 2HBKA 3MMVA 2ASPA 4CZGA 2O8CA 3AVKA 2XY7A 2PBDA 4JI5K 3FR0A 4IXCA 2Q0UA 4BWJA 4H0TB 1RT4A 3KIOA 4PA1A 2PYLA 3LP0A 1UA0A 1M90O 2O8EA 5BR8K 2E2NA 3SI6A 4K43A 3CFPA 3L4QA 3CIPA 4HUGA 3RWUA 1U45A 3PV8A 3MN5A 3O3GA 1ZBSA 4LC9B 2HVIA 1JXBA 2X78A 4J2AA 4ICLA 1GLEG 1HQEA 3CCVN 3L3UA 3P5JA 5AQFA 4KHWA 3KLGA 2FBVA 3QINA 1KRPA 3CQXA 1NJIO 3KK1A 1C0MA 1NMDA 3BZCA 4Z4GA 3MX5A 3UKUB 4QS7A 4ID5A 4RG8A 1NGEA 4JD2B 3UB5A 1KAXA 4CIGA 4E19A 1HYSA 4M63C 1OVYA 4FCYA 3UKUA 4JD2A 2E5LK 3KK7A 2Q2RA 1GOBA 3I33A 3P1GA 1NK5A 3VQ8A 1OH7A 3T1HK 1VRUA 3JS6A 4EZ6A 4M7YA 3SQ2A 1F21A 3LWLA 3ZSVA 1SUQA 4KV8A 2ZD1A 3UIQA 3IUCA 4EP5A 1LOTB 5DK5A 3SAGA 1XI1A 1A5XA 1QQMA 5I42A 3QIOA 2QXFA 3NF9A 3EZWA 2WOMA 2UYTA 3L0QA 3QO9A 3OYGA 1YXQA 4UY8O 4DQ8A 4DSFA 3FGUA 3N4PA 1O1WA 1IG9A 4H0VB 3C6HA 1VSIA 1Z6RA 4GVMA 4DG1A 4I9QA 4GNIA 4FWOA 3WQUA 2KHOA 3D45A 3NE6A 3UE5A 3LP3A 3MCPA 1ASUA 2ZM6K 3PX6A 1IKXA 3FE1A 1J6ZA 2W41A 1NJWA 1LWCA 1KVCA 3CCMN 1VQON 2Z1IA 3E9PA 1ATSA 1S1UA 3L3VA 3A5OC 3EYZA 1RTJA 4BC5A 5LJWA 4DTSA 1Y64A 3CJCA 4FVMA 2VGNA 4JKGA 3M8SA 2IIRA 4Z4CA 3H45C 1BIUA 1VSEA 4B9TA 2P9NB 2CH5A 2V52B 5AQRA 5M1KA 1JLFA 4IZ9A 3AVCA 2FLOA 5GINA 4HTUA 5BR9A 4E7KA 4BACA 3OS2A 4RW4A 4BR5A 1MWKA 1ZBIA 4Y0WA 5BRHA 4DTRA 3C6UA 1VSDA 3J80O 4FJ9A 1VQLN 2OTJN 3J7YP 1VQ6N 4OO1J 2XY6A 2OZSA 2PAVA 1IJJA 4JKEA 4M3UA 4W5OA 2KFZA 4YOTA 4FK0A 4CEBA 5AQTA 5AQIA 3CCEN 3D2FB 2VYPA 4DQSA 4B1XB 3MEDA 3SUNA 2B5JA 3I0SA 3TTCA 3KLIA 2HHWA 3G4SN 1VK0A 4CEZA 4CJEA 2ZJPL 1U47A 4CF8A 1JCEA 2YX6A 3OYFA 5AQNA 4XH1A 4Z4HA 4BRKA 2GELA 3HBTA 3C7NA 4OKKA 1Q7YO 1KC8O 3DRPA 1QSLA 3G0ZA 3CCLN 4LSLA 2P9UA 1HR0K 2JWLA 1V4SA 3HT3A 1TK8A 2KZMA 3VOVA 3CPWM 5J1EA 4E1MA 1Q81O 1ASVA 4FSVA 1JLEA 3HSTB 3OYAA 3OYNA 3V9ZA 1JCGA 4KTQA 3OYIA 3PLAA 5I3UA 1BQMA 4C8MA 3WXMB 3O9SA 1C1AA 3OW2M 1VSFA 4ISGA 5AQPA 4FJIA 3WXIA 4M41A 1C1CA 1BG3A 3AA3A 5M1OA 1KXPA 3BUZB 3JSMA 1S9EA 5JLHA 3P39A 4WFNL 3DLEA 4F3OA 1T03A 4LFAK 2D5RA 3W3DA 2BTFA 2OA8A 3VQ7A 2E2QA 2BUPA 3AO1A 3ULEB 4GKKK 4M3ZA 3P31A 2QTDA 5AQZA 4Z94A 1VQPN 1YHQN 1E4GT 3QNNA 4JK8A 3CXCM 2E2PA 2OPPA 1A5WA 4CFDA 1FXXA 1MDUB 3VMFB 3ULEA 3CCSN 3CMEN 5AQKA 1RT6A 3HRGA 4M45A 3E9OA 4FWSA 5AQGA 3VQAA 4ZHRA 5KRTA 2GV9A 3DLRA 5AQVA 1RTIA 4B9LA 2B6AA 1QTMA 4KREA 1RT3A 4FK2A 4RW8A 2HHQA 3ENOA 1YVUA 5SWMA 4H0XB 4CD1A 3PX0A 3VEZA 4KFBA 1VQ5N 4CW7B 3LPTA 4N41A 4DSLA 4XH4A 2I7PA 3CERA 2CGJA 2E20A 4JNEA 3S3OA 1X9MA 4W5RA 1CZBA 1WB9A 4BR4A 1C0FA 4CJSA 5AFUH 4OPKA 1XHXA 3ZEUA 1HPMA 4PKGA 3VQPA 3OYMA 1KLNA 3SUPA 4LH5A 1TYQB 2BANA 3BY5A 1Q86O 1C0UA 5BPMA 4LH4A 3E66A 1K9MO 3WT0A 4DTPA 1LCUA 2P9IB 3IFRA 1NK9A 4DSEA 1U04A 1VRTA 4DQPA 4HCBA 3M8RA 1CZAN 3L6QA 5CHIA 1YI2N 3CPEA 3T69A 4KO0A 5GAGP 2P9SB 1NLVA 4QS8A 2G8HA 3VETA 2O8BB 2EHGA 2OPSA 1EX4A 3PSIA 4CF2A 3LDPA 4JKBA 2D0OA 3CC4N 3CQYA 5M1NA 4KKOA 1RGIA 1Z25A 2O8BA 2QM1A 2O4IA 4OKJA 2BGGA 4FWRA 4FK4A 4DR3K 1XC3A 1A5VA 1H1VA 2YNFA 3UKRA 1I3AA 2AP1A 3L2QA 1ZBLA 5BN9A 1L3SA 4CF0A 4DV3K 3LAKA 4CEQA 1BHLA 2QW9A 4AHTA 1KAYA 1VHXA 3WUHA 4MQ3A 3QIPA 4A2BA 4BRIA 4CERA 5GIPA 3ZSXA 5HRPA 2OZMA 1S6QA 4JRQA 5C0YA 4BR7A 3ID6A 1S6PA 3K58A 4BDYA 2G8KA 1VSKA 1N6QA 2HBLA 3AGRA 2G8IA 3DLKA 1L5UA 2ZGYA 4GY2B 3TAGA 2V51B 3NAEA 2P9PB 4IO8A 3OS1A 3NH2A 1NJXA 1X9JA 4CZEA 1XQSC 1YVNA 5F0XA 4KHNA 2E1ZA 3PSFA 3M5RA 2P9PA 4CGGA 2R7YA 3C6AA 3LZJA 3O4QA 3FFKB 4F2RA 5EOYA 3EKSA 5JVHL 1RDWX 5KGXA 2GX9A 1NU0A 1RDUA 5C10A 5D3GA 4DTXA 5HLFA 3HTVA 2QWOA 4ELVA 5ADXA 3DXKB 4LFBK 4B3RK 3DYAA 3THWA 2DFHA 4IO9L 4DV1K 4CGHA 4NXMK 2GUIA 2E6LA 4DKWA 4FLYA 1WN7A 1XHZA 1NOZA 4NCBA 1QE1A 2A3ZA 2IGIA 3ITHA 3OS0A 2KKZA 3NVMA 5AQQA 1QZ6A 3ZSZA 4JKAA 4LF6K 4CZFA 5HRSA 3OBYA 4CEAA 5C2DA 4FZYA 1N8RO 4EP4A 3LP2A 4KI6A 3OJUA 2RHKA 3EE8A 3HP6A 2OCEA 1BI4B 1O13A 5FDLA 3BP8A 4YDUC 1NGGA 4IDKA 4RW9A 4WQ4A 4DHYA 3PX4A 4GKJK 2Q31A 1U2VB 1B92A 4ISFA 1WSFA 2HMPA 4KPYA 4M3TA 3QB0A 4MDAA 1TL3A 1NK8A 2FBXA 5LMUK 1HKGA 4DR5K 4IBNA 4Y1CA 1I94K 3CCUN 1YITN 4BRNA 3VEVA 3CF5L 5FLXO 3SV3A 3CC7N 4O5BA 5C24A 2E88A 3IMXA 4KTZA 4FO0A 2YHAA 4CGFA 3VGMA 1GLBG 4DTOA 1SQKA 3PY8A 3T1YK 4FW2A 2ZJQL 2QWMA 3N4QA 1C6VA 1HUXA 4OVLA 4CFAA 3B6OA 1EQYA 5EVZA 3VQBA 1KLMA 3E01A 1S5JA 3SZ2A 4F4KA 4CBUA 4J2EA 3MXMA 3QFPA 1RT2A 4CF1A 5HRNA 4IG0A 1NMNA 4CJTA 4CI6A 3NDKA 1KSPA 4WFBL 3FZMA 3P38A 4NCGA 1IO2A 3A2FA 3QEWA 3LDQA 2YHYA 4BE1A 1N34K 4YOVA 1S22A 3U9DA 4L3QA 3G71N 3L2VA 5HP1A 2VQEK 3V1RA 3ZYYX 4YHHK 1YTUA 1QQCA 3LL3A 3THXA 5CY4A 1JLGA 4BY9C 1NBWA 4CJKA 3VQDA 1Q9YA 1KVAA 5ELZA 5AQYA 4FWLA 1B9DA 1TV6A 1NK4A 1NM1A 4HVJA 3VPZA 5M1PA 4B1VA 1RDBA 3VEYA 1D9DA 4X64K 2O8CB 1ZBFA 1K73O 2IVNA 3AVIA 4L8RB 3RR8A 5TKYA 2HHVA 1OH6A 5AQHA 1X9SA 4ZTJA 4B3OA 2QWQA 3VTHA 4Z4IA 4ISEA 3E9LA 3RSEA 3FFIA 1YF5L 3HJFA 4CJUA 2HW3A 3RMAA 3GG4A 1LV5A 4ZTFA 4NYNA 1NGIA 3U6FA 4CECA 3IG1A 4RW6A 3CD6N 1KTQA 1JLQA 4H8KA 2HVHA 1LW2A 1S9GA 2OTLN 1SKRA 3AVHA 5K14A 4DUYK 4M3YA 1HX1A 3SNNA 5AFUA 2F4VK 5IT9O 2X74A 1UWBA 1WAFA 3O9TA 4A5BA 2KQ2A 3KD1E 3VA3A 4O55A 4FLVA 3OYDA 1EETA 4K0KK 1NG9A 1GLAG 4C1NI 5JMVA 2IS3A 1D8YA 1WSJA 2IVOA 5AQWA 3ZSYA 4CBXA 3J7AP 4DS5A 2A40A 4JI0K 3OVNA 4RCHA 1VAZA 3MXIA 5KPRA 2VWBA 4KHSA 4H4MA 2ZF5O 1BUPA 3H1QA 1RBSA 2UUAK 1V4TA 4CVNE 4CK2A 4O4GA 3EO3A 2WFBA 4NLCA 1NGFA 3NMUA 2DFEA 4C23A 4CGDA 4FWMA 3THYA 1RDCA 2VG6A 2CGKA 3HI0A 1BL3A 1X3MA 4DSIA 5GIOA 3LPUA 3THVA 3S3NA 1HKCA 4DTNA 4CZKA 4FM0A 4CZIA 4DTMA 4KTWA 4E89A 1Z26A 4IDHA 4FLZA 4FZZA 1BCMA 1RBUA 4BG9A 2VG5A 3R8EA 1TUYA 3TAFA 1NKEA 5AR0A 3LM2A 1VQKN 3F2KA 3QBWA 4C8NA 3TPQA 4HUFA 3ASMA 4BRQA 4KHPK 3J81O 1BWFO 3AY9A 4FLTA 5AZJA 1YJWN 3C0BA 4AHCA 4G1QA 3D2EA 3O3FA 2BE2A 4B9QA 3NH1A 3DI6A 4JKGB 1VSHA 4HHTA 3SBTA 1S1XA 1REVA 3KTQA 3HOSA 3O08A 4O5FA 3MK6A 3D6RA 5DMRA 1DEJA 3HYFA 4X62K 4HCCA 4Y1DA 1J54A 1TVRA 5ADXH 5AQJA 4B9SA 4AM7A 3K9KA 4B1UB 4I2PA 1HJOA 1W7AA 1SAZA 3VESA 1Q8IA 2LSNA 4MLEA 4WE1A 1NGBA 2GWKA 3LM9A 4FPBA 4DLGA 1VQ7N 4B3TK 2NRHA 4WF9L 4HWIA 2O4GA 2QI2A 1JCFA 2P5OA 4CZHA 3RVCA 3AO5A 2XY8A 4BWMA 2F9WA 4IOCL 4F8RA 4FLWA 4W5NA 2AA4A 2F7TA 3HM9A 3AA5X 1XMQK 4A57A 1XMOK 4BRFA 1SL2A 4O0IA 3TANA 4WCEL 4KH4A 3VN5A 1N36K 1T6DA 1NWKA 4R79A 1DKGD 1RBTA 4AQYK 1WOQA 2YCHA 2HHSA 3I8BA 3LANA 3C7NB 4JKCA 4K42A 1BQNA 4CBWA 2NRRA 3C65A 4N56A 1C0TA 1D5AA 1WSGA 3K2PA 5J2MA 1KD1O 1NGDA 5EXWA 2FBYA 3U8XA 4ILHA 4GW6A 2P9UB 2G8FA 3ZT0A 2XRIA 5KTQA 4LF4K 3WXKA 2UUCK 1FW6A 4WQ4C 3GL1A 4CK3A 1QSSA 3O9QA 3ID8A 4HTLA 1TKXA 1WBBA 1FJGK 2EX3A 2QKKA 3KKSA 1ZBUA 4DR7K 4DQQA 3A5MC 2E2OA 4RWTA 4X66K 1ILYA 2QK9A 4PKHA 2YI1A 3F5TA 4DTUA 3NH0A 3ZX3A 2VCPA 3AA4A 3L8BA 3CM6A 2HHUA 3AO2A 2ITMA 2J4RA 4O44A 3SQ1A 1HNIA 4BRHA 4ILGB 3C6TA 4LF5K 3DXMA 4A59A 2E4LA 3HVRA 1Y97A 4CHOA 4KI4A 3OYKA 1HKBA 5HOOA 4MO4A 2HMIA 4DFKA 1WNSA 4CJ3A 4CJFA 3MDQA 2P9KA 4GV9A 2D0PA 2W6KA 5AQLA 4BE2A 3HOTA 4F3TA 2D0CA 1SS6A 3HXMA 2YJFA 4CJQA 3MN9A 1VSJA 3EN9A 5FPNA 3TU5A 1NKCA 4ELUA 1WSHA 3KWIA 3O8MA 3Q7CA 5I9EB 3H6EA 2G8WA 2KFNA 1HNVA 3R1XA 1HYVA 5KI6A 1FK9A 4DV6K 3FLCO 5HRRA 5BREA 4BREA 3KLHA 2YHWA 2IAJA 3OYBA 1T44A 3BF3A 4U7BA 1T05A 1NK6A 4BVOA 1WAJA 4OKEA 4FJHA 1KFSA 4BRAA 3VGKA 4XIUA 3RRHA 4DMNA 4GV6A 3L2WA 2NLXA 2ETJA 3TR8A 4FM2A 4OGCA 4JV5K 4IFEA 5AZIA 3OBWA 3ZSRA 4B3MK 1GLLO 5AQSA 1OVQA 5AQOA 3ZT2A 3V9UA 4Z4FA 1KVBA 3Q7BA 3OJSA 4H5NA 3ZEUB 3I8DA 1HYZA 2NRVA 3MEEA 3DM2A 1BOTO 5HL7L 1NGJA 1K8KA 2ZWHA 5DM7L 2Q0RA 5CZ2A 1VQ4N 1JL2A 3QICA 2YKNA 4B1ZA 4CF9A 3FZKA 3GBTA 4JHDB 1N33K 4WQ5A 4CEFA 1WSIA 4KRFA 3EZ5A 5LL6Z 3HM8A 4GV3A 4OPHA 4JKDA 3TARA 2D0AA 3A5LC 2NRZA 4JHDA 4AF1A 4ILJA 3ZX0A 1QZ5A 1TAUA 2GTDA 4KAZA 4NCAA 1HJRA 3L4IA 3TAEA 1GOAA 2FC0A 2Q1NA 3NVKA 1BIZA 3RMDA 1FKPA 3LAMA 3DLLL 2HF3A 3LDOA 4QS9A 2FSJA 2P51A 4KH6A 5CYMA 4FWKA 3SV4A 3M8PA 4CGJA 4PWDA 3UKRB 1IBMK 2OPQA 1X3NA 1W2BM 4AHVA 3ULDA 4K8ZA 5E84A 4M3WA 3QESA 3ENBA 4CHQA 4GVEA 3H1VX 3BF1A 1TAQA 3MX2A 3AVBA 1JLAA 1GLJO 2OYQA 2E6MA 3F9MA 3AGKA 2ZE2A 3DRSA 1UAXA 3D0PA 4E7HA 1NGAA 3SYZA 5M1FA 2ATQA 3NF8A 3HL8A 4FJ5A 1DGKN 4YOXA 3M6GA 4H03B 5CE3A 3WNFA 4Q5VA 4QAGA 3SUOA 4DB3A 3K0SA 4DF4A 3NGYA 3RTVA 2NUBA 3EE9A 4JI8K 2AJQA 4CJ7A 3CJ1A 1X1PA 3S3MA 4CEEA 2NRXA 4PHTX 2RF2A 1CXUA 3CMAN 1UA1A 3BZKA 4CGIA 4IEIA 4FM1A 3CG7A 4W5QA 1GLCG 2A5XA 1JXEA 4KHQA 2Y1JA 4H0PA 3BGRA 2BH1A 3AA2A 2KTQA 4FWNA 4JK9A 4JN4A 3KK2A 1QHAA 4QCLA 4IG3A 3M1FA 2W40A 5TKWA 2NNWA 1NK0A 3ISNC 4CJ5A 4RTFD 5JVGL 3O5BA 3HK2A 3SJHA 3TTFA 4F9OA 2Y1IA 3VEOA 3ZT1A 3KZBA 3THWB 3ZT3A 1VQNN 4BC3A 3SQ4A 4J8FA 3OTOK 2RKIA 3KJVA 2KLAA 1ASWA 1Z05A 1M1KO 1XWLA 2VWJA 3AAQA 3DLGA 4Q0BA 1NNEA 5DM6L 4F2SA 5IWAK 4DTJA 1RILA 4YOUA 1DT9A 4RW7A 3VEWA 5LMNK 5BRDA 3H3NO 3T7ZA 1Q9XA 3WNHA 4R5PA 1ZBHA 3MXJA 3WEEA 4WYBA 3SJJA 1RDAA 4CZJA 4CJ4A 4CK1A 3MWPA 2ASOA 2D1KA 3CETA 3OA9A 3V1QA 2A42A 3CCJN 3NBPA 4BC2A 3QNOA 4NLBA 4Z4EA 4I9LA 1S1WA 1HNXK 4A5AA 3K59A 4FJJA 4DR4K 2CH6A 3NFAA 5T7BA 3TI0A 1Q82O 3T3FA 2RE2A 3WNGA 5H1SQ 3CFRA 1JKHA 2I5JA 2FBTA 2WC9A 4CCHA 1K8AO 1KFDA 3DOLA 1HNZK 3VGLA 4DSJA 1U4BA 1J9AA 4OPJA 2QWLA 4C8OA 1QVFM 2ZJRL 3O4WA 4FOEA 1LW0A 4M3RA 3I0RA 4KB0A 1RBVA 3IDHA 4DV0K 4JI4K 2Z1GA 3WXJA 2A41A 4EIAA 4JAXA 3V9WA 1SL0A 3A8YA 4NYFA 1RTDA 3KHYA 4XEIA 4DR1K 2D4WA 4M7XA 4E1NA 4OPAA 3SLCA 5CYQA 1K6YA 1IKWA 2P1JA 4CESA 5AQXA 2OPRA 1J5OA 3DAWA 3DLHA 4CFBA 4I6MA 4FJGA 3ZT4A 3THXB 4JEPA 3LALA 4YY3K 5AJ3K 1HRHA 3V4IA 3K9JA 3O1BA 3D7EO 4BG8A 1LWEA 3LDNA 2O8DA 3QBXA 1DTQA 4PKIA 3G25A 5FRMA 3BDPA 5GAEP 5E41A 3CJ7A 1R59O 1N5YA 3WQTA 2JLEA 5C15A 1LAVA 3TWHA 2YNGA 1C0GA 3CQ8A 3U3GA 3L2RA 3RSEB 2WBNA 5FPDA 3ENHA 2YKMA 1KQSM 3EEQA 4IFVA 4DU4A 5C25A 5B8HA 5KPZA 3QMLA 4EHUA 4BRMA 3TSQA 5HROA 5CZ1A 1IKVA 4E7LA 5JS2A 5KQDA 4A61A 4DFJA 3SQ0A 2BDPA 4JI3K 4H0OA 5AQUA 3AVNA 4CZMA 3OYLA 4BR9A 1HNWK 4BRCA 4AH9A 2EWSA 2UUBK 4IEEA 3ZLJA 4NB4A 3F9KA 4DQIA 4FL9A 4DS4A 3SPYA 5C2FA 4CHZA 1TUUA 3LP1A 3GE1A 2PZSA 3T1AA 2HBMA 3VQQA 4CJPA 1RT7A 4WQ5C 1G15A 4JS4A 2WTUA 5JLFA 3SAHA 2PYJA 2F9TA 2VWKA 4DLEA 1S3XA 2W6LA 4I7FA 1XUPO 1YT3A 3NF7A 5FROA 4NO7A 3VF6A 5KQ8A 2DTUA 5J2NA 1TKTA 2GUPA 3ALYA 4MDBA 1WSEA 2IDOA 4CD3A 4O8UA 2HB5A 4DCHA 3AVGA 1TK0A 5F2RA 4AHUA 3THYB 3VTIA 4DU1A 1S1VA 2HHHK 4E1JA 3KLEA 4FJXA 4MO5A 3LWMA 3KLFA 3DMJA
chains in the Genus database with same CATH topology
5LL6Z 2UXBK 1XNQK 4KHPK 2UXDK 3J81O 1IBLK 5IWAK 4LF9K 4LFAK 4DR3K 1XNRK 4LF5K 4GKKK 5LMNK 4GKJK 4V19S 4B3SK 2UU9K 4DV3K 4X65K 4X62K 5LMUK 4DUYK 2VQFK 3J80O 4DR5K 2E5LK 2F4VK 5IT9O 1I94K 3J7YP 1IBMK 4DR6K 5FLXO 3T1HK 1HNXK 4K0KK 4JI1K 4B3TK 4DV6K 3JAMO 3T1YK 4CW7B 4DR4K 4JI3K 3J7AP 4JI0K 1IBKK 1J5EK 1HNWK 1HNZK 1XMQK 1XMOK 4JI2K 2UUBK 4JI8K 2UUAK 1N36K 2UXCK 5A2QO 4JYAK 4CVNE 1HR0K 4LFCK 4AQYK 4DV0K 4JV5K 1N34K 4JI7K 4JI4K 4DV4K 4LFBK 4B3RK 4B3MK 4DR2K 2VQEK 4DV1K 4DV2K 4YHHK 1N32K 4NXMK 2ZM6K 4DV7K 4JI5K 4DR1K 4LF4K 2UUCK 4JI6K 4DUZK 4LF7K 1FJGK 4LF8K 4DR7K 5BR8K 4DV5K 4LF6K 4OX9K 2HHHK 3OTOK 4X64K 4YY3K 4X66K 5AJ3K 1N33K 4NXNK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 Z;  2UXB K;  1XNQ K;  4KHP K;  2UXD K;  3J81 O;  1IBL K;  5IWA K;  4LF9 K;  4LFA K;  4DR3 K;  1XNR K;  4LF5 K;  4GKK K;  5LMN K;  4GKJ K;  4V19 S;  4B3S K;  2UU9 K;  4DV3 K;  4X65 K;  4X62 K;  5LMU K;  4DUY K;  2VQF K;  3J80 O;  4DR5 K;  2E5L K;  2F4V K;  5IT9 O;  1I94 K;  3J7Y P;  1IBM K;  4DR6 K;  5FLX O;  3T1H K;  1HNX K;  4K0K K;  4JI1 K;  4B3T K;  4DV6 K;  3JAM O;  3T1Y K;  4CW7 B;  4DR4 K;  4JI3 K;  3J7A P;  4JI0 K;  1IBK K;  1J5E K;  1HNW K;  1HNZ K;  1XMQ K;  1XMO K;  4JI2 K;  2UUB K;  4JI8 K;  2UUA K;  1N36 K;  2UXC K;  5A2Q O;  4JYA K;  4CVN E;  1HR0 K;  4LFC K;  4AQY K;  4DV0 K;  4JV5 K;  1N34 K;  4JI7 K;  4JI4 K;  4DV4 K;  4LFB K;  4B3R K;  4B3M K;  4DR2 K;  2VQE K;  4DV1 K;  4DV2 K;  4YHH K;  1N32 K;  4NXM K;  2ZM6 K;  4DV7 K;  4JI5 K;  4DR1 K;  4LF4 K;  2UUC K;  4JI6 K;  4DUZ K;  4LF7 K;  1FJG K;  4LF8 K;  4DR7 K;  5BR8 K;  4DV5 K;  4LF6 K;  4OX9 K;  2HHH K;  3OTO K;  4X64 K;  4YY3 K;  4X66 K;  5AJ3 K;  1N33 K;  4NXN K; 
#chains in the Genus database with same CATH topology
 3RMC A;  5BRF A;  1C1B A;  1T8E A;  1E3M A;  1TKD A;  2O8F B;  2HF4 A;  4H0Y B;  1LWF A;  2Q97 A;  3VER A;  5F1X A;  5SZT A;  4EAH D;  2A1S A;  3VQ4 A;  5EX5 A;  2KW4 A;  2O8F A;  2DPN A;  4JS5 A;  3PO4 A;  5BN8 A;  5AZJ B;  3CFO A;  2Q3S A;  1SKW A;  3TAM A;  3LZI A;  3CJ9 A;  3HPG A;  4H5R A;  3SBG A;  3AO4 A;  3R9P A;  4DF8 A;  3D2E B;  3VQ6 A;  3P83 D;  1S1T A;  3NGI A;  3HP9 A;  3GOI A;  2FSN A;  3CJA A;  4CJL A;  2QWR A;  2QA4 N;  4FXD A;  1SZ2 A;  2ZQB A;  1NGC A;  2CGL A;  3K57 A;  2HNY A;  4EZ9 A;  3JAM O;  3H3O B;  1SL1 A;  2JGU A;  3OY9 A;  1KAZ A;  2FF3 B;  4B9U A;  2HST A;  1BO5 O;  1QS4 A;  3MWT A;  4DSK A;  1RTH A;  4BE0 A;  3MEG A;  4H5T A;  3WXL A;  3TAP A;  1GLF O;  2UXC K;  2QKB A;  1QSY A;  4FJK A;  1YAG A;  3QLH A;  3SMS A;  4JI7 K;  1HPZ A;  4BDP A;  4BRP A;  3VEN A;  3O6W A;  1OH8 A;  4BRG A;  5BPL A;  1QQO A;  3VA0 A;  3CCQ N;  5FRN A;  3HPO A;  3HO1 A;  4DV7 K;  4FWQ A;  1L3T A;  4CJR A;  3CYM A;  3E1Y A;  2GBZ A;  4LF7 K;  3VF4 A;  4KB1 A;  2KZZ A;  3AVJ A;  4FPA A;  4DV5 K;  4FLX A;  4E7I A;  4EFH A;  2P9N A;  4A2A A;  1NK7 A;  4B9V A;  3TSU A;  4LY7 A;  4FJ8 A;  1RDD A;  1OKJ A;  3OYE A;  3VQE A;  3FZF A;  4ELT A;  4PUO A;  2XHB A;  3SMP A;  1XNQ K;  3SPZ A;  2UXD K;  4EHT A;  2VG7 A;  2P5G A;  4DWI A;  1QHT A;  1RNH A;  2P9L B;  1JL1 A;  2YHB A;  3R6M A;  4YDU A;  4YFU A;  3PUF A;  4N76 A;  3OYH A;  1E4F T;  2DY4 A;  5EU7 A;  1IH7 A;  2Z1H A;  3AAR A;  4CJV A;  3CCR N;  1U48 A;  2P9L A;  1ATR A;  4JLH A;  5HBM A;  1CLQ A;  4K25 A;  1YJN N;  1VQ8 N;  3FZL A;  5KRS A;  3D2F A;  3U4L A;  1ZC6 A;  4CHY A;  3DXM B;  3O1W A;  3H46 O;  3RR7 A;  4I2Q A;  3QEX A;  3K5M A;  1BIS A;  2F8S A;  4YOR A;  2P9K B;  1BDG A;  1X9W A;  1MU2 A;  2FF6 A;  1VSM A;  4BR0 A;  3AVF A;  3V9X A;  1R0A A;  3CJB A;  3CM5 A;  1SV5 A;  2NRT A;  3QET A;  1WUA A;  4BC4 A;  1IBK K;  4JKF A;  2XO7 A;  2FXU A;  4G9Z A;  4AIL C;  3H08 A;  3P4I A;  2QXL A;  4ID1 A;  1D4X A;  3PO5 A;  1FKO A;  3AVM A;  4GMJ B;  3VEX A;  3MCA B;  1HLU A;  4CZL A;  5A2Q O;  3J7Z O;  4U67 L;  3VQ5 A;  1G99 A;  3L2U A;  4FOI A;  4PQU A;  1T3V A;  1HQU A;  3ZX2 A;  1ZYQ A;  3DWL A;  4FWP A;  5LJV A;  2ASM A;  3J8A A;  3NCI A;  2HND A;  2NRW A;  4JI6 K;  3MAQ A;  5AZI B;  1DLO A;  4KHU A;  4BR2 A;  1P8Z A;  3ZET B;  4B1W B;  1EKE A;  4E0D A;  1P90 A;  4PY5 A;  4M42 A;  4OX9 K;  4HUE A;  1KCF A;  3FZH A;  3B6P A;  5M1Q A;  4YOW A;  4B9M A;  1LAW A;  3ZET A;  1K8K B;  2ZGZ A;  3U9Z A;  3JYT A;  2DFF A;  1IBL K;  3KK3 A;  4BVP A;  4PL8 A;  4N47 A;  3ZSQ A;  1XNR K;  1CZ9 A;  3O80 A;  1IV0 A;  3DRR A;  4M3X A;  4V19 S;  2H3G X;  3MN7 A;  1XC9 A;  2UU9 K;  3KKR A;  4CJW A;  2A1R A;  1NJZ A;  4H5V A;  1HMV A;  3A5N C;  4YNQ A;  2XY5 A;  3KVG A;  3DLB A;  3M3Z A;  2PFU A;  2Z1J A;  4KBO A;  1YIJ N;  1EXQ A;  5GAH P;  3V9S A;  2QWN A;  2V7Z A;  4JK7 A;  4Z0U A;  4K41 A;  4J2D A;  1MA9 B;  1U6Z A;  4JI1 K;  2V7Y A;  2GEM A;  3PIP L;  1TK5 A;  4FJ7 A;  4QOZ B;  3SK3 A;  3O9R A;  1QVG M;  1TGO A;  2GWJ A;  3ZSO A;  3OHR A;  3KWG A;  1NOY A;  3HSC A;  1TKZ A;  4UQG A;  4OJR A;  1TYQ A;  4BGB A;  4JI2 K;  2HNZ A;  3QDK A;  2E1Y A;  3ZSW A;  5GAD P;  3SUQ A;  1RT5 A;  2P9I A;  4B8C A;  4IJA A;  4LFC K;  4YOY A;  1GLD G;  1VSL A;  3I56 N;  3U3Y A;  4BGA A;  4BDZ A;  2F8T A;  3VQC A;  4XH5 A;  3CHW A;  5KPT A;  1W0H A;  2JWK A;  4E3S A;  3S41 A;  4CEO A;  4DV2 K;  5EY4 A;  5AQM A;  2P9S A;  1QQN A;  3ATV A;  3PIO L;  4BRO A;  3O9U A;  2IVP A;  1YTA A;  1DTT A;  2I7N A;  4H4O A;  2QWP A;  4LF8 K;  1WBD A;  4PL7 A;  3OYC A;  4LSN A;  4DQR A;  3QEI A;  4O8K A;  3V81 A;  2X6N A;  4FLU A;  1RCH A;  2Q36 A;  2NZT A;  3IAY A;  4FVU A;  3K5O A;  5J2Q A;  5CR4 A;  4B8A B;  3B8A X;  3NGZ A;  3LDL A;  4LD0 A;  3R3L A;  3F73 A;  1BCO A;  2B4J A;  2G8U A;  4LF9 K;  2YJE A;  3T19 A;  4B08 A;  2W42 A;  4KH5 A;  3M8Q A;  3TTD A;  4DFP A;  2IOC A;  5J2P A;  3ZCM A;  4BQZ A;  3QEV A;  5JS1 A;  4X65 K;  1VQ9 N;  2F96 A;  2RPI A;  1JLC A;  1D9F A;  4N5S A;  4FJL A;  5FPM A;  2VQF K;  3EKU A;  3K5L A;  1VQM N;  2WON A;  4K8X A;  3NHG A;  1L3V A;  3TAB A;  1ESV A;  1YUW A;  3G10 A;  3WEE B;  3JXU A;  3QFU A;  1RFQ A;  3S9H A;  4C1N K;  1JJ2 M;  3DOK A;  3O3H A;  4IOA L;  3ATU A;  1EWQ A;  3OYJ A;  4JKH A;  1NKB A;  4AHS A;  4WFA L;  4AHR A;  1EWR A;  3EY1 A;  4IJN A;  1TL1 A;  3IKM A;  4CHP A;  1T7P A;  2YNH A;  3DXK A;  1UOC A;  3QEP A;  4IKF A;  3O4N A;  1IKY A;  2YNI A;  1U49 A;  1W9H A;  3W0L A;  1ITG A;  4A62 A;  1BA1 A;  1WLJ A;  5KGW A;  3C94 A;  3C95 A;  4DV4 K;  3RMB A;  4CED A;  3SAF A;  1IG8 A;  4DR2 K;  3AO3 A;  1RBR A;  4BRD A;  1N32 K;  1T6C A;  3I55 N;  4MFB A;  3HPH A;  4MLH A;  1CXQ A;  3CI5 A;  1GOC A;  4B1Y B;  1JLB A;  4OLB A;  3MEC A;  4DUZ K;  2WUS A;  3CC2 N;  1MWM A;  3G6E N;  1BI4 A;  3AVA A;  1S72 N;  5FPE A;  2YHX A;  1NGH A;  4DFM A;  5C42 A;  3LDS A;  4NXN K;  4CFC A;  4E7J A;  2HHX A;  4BQL A;  1U2V A;  2G8V A;  2UXB K;  1L3U A;  4I6M B;  4KHY A;  2OAN A;  3BEX A;  5MLC Q;  4IFY A;  2QEX N;  3KD5 E;  4IWV A;  1ZXO A;  4CHN A;  4W5T A;  3IS9 A;  3K5N A;  3GDQ A;  4CE9 A;  4B3S K;  1Q18 A;  3NF6 A;  2O8D B;  4FJN A;  3RRG A;  4O0J A;  3TAQ A;  1OH5 A;  2PY5 A;  3V1O A;  4OGE A;  2D0B A;  5C12 A;  3SCX A;  4OLA A;  4JRP A;  4H5W A;  1NJY A;  4CIE A;  4DR6 K;  4TSX A;  3VF2 A;  4C8K A;  2X6S A;  3IRX A;  1ATN A;  3HVT A;  1BGX T;  2ITG A;  2IC3 A;  1SKS A;  3A0I X;  2FSK A;  3MN6 A;  2HOE A;  4FW1 A;  5E26 A;  3AV9 A;  4C8L A;  1RT1 A;  1W97 L;  3QER A;  1BU6 O;  3WNE A;  1J5E K;  4AM6 A;  4FZX C;  1EP4 A;  4J2B A;  2E8A A;  2RN2 A;  3VQ9 A;  2A6A A;  2HBJ A;  1J53 A;  1YJ9 N;  4BRL A;  1BA0 A;  1I39 A;  2HHT A;  3AVL A;  3DJC A;  3V6D A;  4FYD A;  1EO1 A;  4JYA K;  4FJM A;  4CIF A;  5LY3 A;  3AAP A;  2YV0 X;  3HZ6 A;  4DU3 A;  4B9N A;  4IOX A;  1B9F A;  3EL2 A;  3TSP A;  5JIC A;  5BPN A;  2VGM A;  2O8E B;  2HBK A;  3MMV A;  2ASP A;  4CZG A;  2O8C A;  3AVK A;  2XY7 A;  2PBD A;  4JI5 K;  3FR0 A;  4IXC A;  2Q0U A;  4BWJ A;  4H0T B;  1RT4 A;  3KIO A;  4PA1 A;  2PYL A;  3LP0 A;  1UA0 A;  1M90 O;  2O8E A;  5BR8 K;  2E2N A;  3SI6 A;  4K43 A;  3CFP A;  3L4Q A;  3CIP A;  4HUG A;  3RWU A;  1U45 A;  3PV8 A;  3MN5 A;  3O3G A;  1ZBS A;  4LC9 B;  2HVI A;  1JXB A;  2X78 A;  4J2A A;  4ICL A;  1GLE G;  1HQE A;  3CCV N;  3L3U A;  3P5J A;  5AQF A;  4KHW A;  3KLG A;  2FBV A;  3QIN A;  1KRP A;  3CQX A;  1NJI O;  3KK1 A;  1C0M A;  1NMD A;  3BZC A;  4Z4G A;  3MX5 A;  3UKU B;  4QS7 A;  4ID5 A;  4RG8 A;  1NGE A;  4JD2 B;  3UB5 A;  1KAX A;  4CIG A;  4E19 A;  1HYS A;  4M63 C;  1OVY A;  4FCY A;  3UKU A;  4JD2 A;  2E5L K;  3KK7 A;  2Q2R A;  1GOB A;  3I33 A;  3P1G A;  1NK5 A;  3VQ8 A;  1OH7 A;  3T1H K;  1VRU A;  3JS6 A;  4EZ6 A;  4M7Y A;  3SQ2 A;  1F21 A;  3LWL A;  3ZSV A;  1SUQ A;  4KV8 A;  2ZD1 A;  3UIQ A;  3IUC A;  4EP5 A;  1LOT B;  5DK5 A;  3SAG A;  1XI1 A;  1A5X A;  1QQM A;  5I42 A;  3QIO A;  2QXF A;  3NF9 A;  3EZW A;  2WOM A;  2UYT A;  3L0Q A;  3QO9 A;  3OYG A;  1YXQ A;  4UY8 O;  4DQ8 A;  4DSF A;  3FGU A;  3N4P A;  1O1W A;  1IG9 A;  4H0V B;  3C6H A;  1VSI A;  1Z6R A;  4GVM A;  4DG1 A;  4I9Q A;  4GNI A;  4FWO A;  3WQU A;  2KHO A;  3D45 A;  3NE6 A;  3UE5 A;  3LP3 A;  3MCP A;  1ASU A;  2ZM6 K;  3PX6 A;  1IKX A;  3FE1 A;  1J6Z A;  2W41 A;  1NJW A;  1LWC A;  1KVC A;  3CCM N;  1VQO N;  2Z1I A;  3E9P A;  1ATS A;  1S1U A;  3L3V A;  3A5O C;  3EYZ A;  1RTJ A;  4BC5 A;  5LJW A;  4DTS A;  1Y64 A;  3CJC A;  4FVM A;  2VGN A;  4JKG A;  3M8S A;  2IIR A;  4Z4C A;  3H45 C;  1BIU A;  1VSE A;  4B9T A;  2P9N B;  2CH5 A;  2V52 B;  5AQR A;  5M1K A;  1JLF A;  4IZ9 A;  3AVC A;  2FLO A;  5GIN A;  4HTU A;  5BR9 A;  4E7K A;  4BAC A;  3OS2 A;  4RW4 A;  4BR5 A;  1MWK A;  1ZBI A;  4Y0W A;  5BRH A;  4DTR A;  3C6U A;  1VSD A;  3J80 O;  4FJ9 A;  1VQL N;  2OTJ N;  3J7Y P;  1VQ6 N;  4OO1 J;  2XY6 A;  2OZS A;  2PAV A;  1IJJ A;  4JKE A;  4M3U A;  4W5O A;  2KFZ A;  4YOT A;  4FK0 A;  4CEB A;  5AQT A;  5AQI A;  3CCE N;  3D2F B;  2VYP A;  4DQS A;  4B1X B;  3MED A;  3SUN A;  2B5J A;  3I0S A;  3TTC A;  3KLI A;  2HHW A;  3G4S N;  1VK0 A;  4CEZ A;  4CJE A;  2ZJP L;  1U47 A;  4CF8 A;  1JCE A;  2YX6 A;  3OYF A;  5AQN A;  4XH1 A;  4Z4H A;  4BRK A;  2GEL A;  3HBT A;  3C7N A;  4OKK A;  1Q7Y O;  1KC8 O;  3DRP A;  1QSL A;  3G0Z A;  3CCL N;  4LSL A;  2P9U A;  1HR0 K;  2JWL A;  1V4S A;  3HT3 A;  1TK8 A;  2KZM A;  3VOV A;  3CPW M;  5J1E A;  4E1M A;  1Q81 O;  1ASV A;  4FSV A;  1JLE A;  3HST B;  3OYA A;  3OYN A;  3V9Z A;  1JCG A;  4KTQ A;  3OYI A;  3PLA A;  5I3U A;  1BQM A;  4C8M A;  3WXM B;  3O9S A;  1C1A A;  3OW2 M;  1VSF A;  4ISG A;  5AQP A;  4FJI A;  3WXI A;  4M41 A;  1C1C A;  1BG3 A;  3AA3 A;  5M1O A;  1KXP A;  3BUZ B;  3JSM A;  1S9E A;  5JLH A;  3P39 A;  4WFN L;  3DLE A;  4F3O A;  1T03 A;  4LFA K;  2D5R A;  3W3D A;  2BTF A;  2OA8 A;  3VQ7 A;  2E2Q A;  2BUP A;  3AO1 A;  3ULE B;  4GKK K;  4M3Z A;  3P31 A;  2QTD A;  5AQZ A;  4Z94 A;  1VQP N;  1YHQ N;  1E4G T;  3QNN A;  4JK8 A;  3CXC M;  2E2P A;  2OPP A;  1A5W A;  4CFD A;  1FXX A;  1MDU B;  3VMF B;  3ULE A;  3CCS N;  3CME N;  5AQK A;  1RT6 A;  3HRG A;  4M45 A;  3E9O A;  4FWS A;  5AQG A;  3VQA A;  4ZHR A;  5KRT A;  2GV9 A;  3DLR A;  5AQV A;  1RTI A;  4B9L A;  2B6A A;  1QTM A;  4KRE A;  1RT3 A;  4FK2 A;  4RW8 A;  2HHQ A;  3ENO A;  1YVU A;  5SWM A;  4H0X B;  4CD1 A;  3PX0 A;  3VEZ A;  4KFB A;  1VQ5 N;  4CW7 B;  3LPT A;  4N41 A;  4DSL A;  4XH4 A;  2I7P A;  3CER A;  2CGJ A;  2E20 A;  4JNE A;  3S3O A;  1X9M A;  4W5R A;  1CZB A;  1WB9 A;  4BR4 A;  1C0F A;  4CJS A;  5AFU H;  4OPK A;  1XHX A;  3ZEU A;  1HPM A;  4PKG A;  3VQP A;  3OYM A;  1KLN A;  3SUP A;  4LH5 A;  1TYQ B;  2BAN A;  3BY5 A;  1Q86 O;  1C0U A;  5BPM A;  4LH4 A;  3E66 A;  1K9M O;  3WT0 A;  4DTP A;  1LCU A;  2P9I B;  3IFR A;  1NK9 A;  4DSE A;  1U04 A;  1VRT A;  4DQP A;  4HCB A;  3M8R A;  1CZA N;  3L6Q A;  5CHI A;  1YI2 N;  3CPE A;  3T69 A;  4KO0 A;  5GAG P;  2P9S B;  1NLV A;  4QS8 A;  2G8H A;  3VET A;  2O8B B;  2EHG A;  2OPS A;  1EX4 A;  3PSI A;  4CF2 A;  3LDP A;  4JKB A;  2D0O A;  3CC4 N;  3CQY A;  5M1N A;  4KKO A;  1RGI A;  1Z25 A;  2O8B A;  2QM1 A;  2O4I A;  4OKJ A;  2BGG A;  4FWR A;  4FK4 A;  4DR3 K;  1XC3 A;  1A5V A;  1H1V A;  2YNF A;  3UKR A;  1I3A A;  2AP1 A;  3L2Q A;  1ZBL A;  5BN9 A;  1L3S A;  4CF0 A;  4DV3 K;  3LAK A;  4CEQ A;  1BHL A;  2QW9 A;  4AHT A;  1KAY A;  1VHX A;  3WUH A;  4MQ3 A;  3QIP A;  4A2B A;  4BRI A;  4CER A;  5GIP A;  3ZSX A;  5HRP A;  2OZM A;  1S6Q A;  4JRQ A;  5C0Y A;  4BR7 A;  3ID6 A;  1S6P A;  3K58 A;  4BDY A;  2G8K A;  1VSK A;  1N6Q A;  2HBL A;  3AGR A;  2G8I A;  3DLK A;  1L5U A;  2ZGY A;  4GY2 B;  3TAG A;  2V51 B;  3NAE A;  2P9P B;  4IO8 A;  3OS1 A;  3NH2 A;  1NJX A;  1X9J A;  4CZE A;  1XQS C;  1YVN A;  5F0X A;  4KHN A;  2E1Z A;  3PSF A;  3M5R A;  2P9P A;  4CGG A;  2R7Y A;  3C6A A;  3LZJ A;  3O4Q A;  3FFK B;  4F2R A;  5EOY A;  3EKS A;  5JVH L;  1RDW X;  5KGX A;  2GX9 A;  1NU0 A;  1RDU A;  5C10 A;  5D3G A;  4DTX A;  5HLF A;  3HTV A;  2QWO A;  4ELV A;  5ADX A;  3DXK B;  4LFB K;  4B3R K;  3DYA A;  3THW A;  2DFH A;  4IO9 L;  4DV1 K;  4CGH A;  4NXM K;  2GUI A;  2E6L A;  4DKW A;  4FLY A;  1WN7 A;  1XHZ A;  1NOZ A;  4NCB A;  1QE1 A;  2A3Z A;  2IGI A;  3ITH A;  3OS0 A;  2KKZ A;  3NVM A;  5AQQ A;  1QZ6 A;  3ZSZ A;  4JKA A;  4LF6 K;  4CZF A;  5HRS A;  3OBY A;  4CEA A;  5C2D A;  4FZY A;  1N8R O;  4EP4 A;  3LP2 A;  4KI6 A;  3OJU A;  2RHK A;  3EE8 A;  3HP6 A;  2OCE A;  1BI4 B;  1O13 A;  5FDL A;  3BP8 A;  4YDU C;  1NGG A;  4IDK A;  4RW9 A;  4WQ4 A;  4DHY A;  3PX4 A;  4GKJ K;  2Q31 A;  1U2V B;  1B92 A;  4ISF A;  1WSF A;  2HMP A;  4KPY A;  4M3T A;  3QB0 A;  4MDA A;  1TL3 A;  1NK8 A;  2FBX A;  5LMU K;  1HKG A;  4DR5 K;  4IBN A;  4Y1C A;  1I94 K;  3CCU N;  1YIT N;  4BRN A;  3VEV A;  3CF5 L;  5FLX O;  3SV3 A;  3CC7 N;  4O5B A;  5C24 A;  2E88 A;  3IMX A;  4KTZ A;  4FO0 A;  2YHA A;  4CGF A;  3VGM A;  1GLB G;  4DTO A;  1SQK A;  3PY8 A;  3T1Y K;  4FW2 A;  2ZJQ L;  2QWM A;  3N4Q A;  1C6V A;  1HUX A;  4OVL A;  4CFA A;  3B6O A;  1EQY A;  5EVZ A;  3VQB A;  1KLM A;  3E01 A;  1S5J A;  3SZ2 A;  4F4K A;  4CBU A;  4J2E A;  3MXM A;  3QFP A;  1RT2 A;  4CF1 A;  5HRN A;  4IG0 A;  1NMN A;  4CJT A;  4CI6 A;  3NDK A;  1KSP A;  4WFB L;  3FZM A;  3P38 A;  4NCG A;  1IO2 A;  3A2F A;  3QEW A;  3LDQ A;  2YHY A;  4BE1 A;  1N34 K;  4YOV A;  1S22 A;  3U9D A;  4L3Q A;  3G71 N;  3L2V A;  5HP1 A;  2VQE K;  3V1R A;  3ZYY X;  4YHH K;  1YTU A;  1QQC A;  3LL3 A;  3THX A;  5CY4 A;  1JLG A;  4BY9 C;  1NBW A;  4CJK A;  3VQD A;  1Q9Y A;  1KVA A;  5ELZ A;  5AQY A;  4FWL A;  1B9D A;  1TV6 A;  1NK4 A;  1NM1 A;  4HVJ A;  3VPZ A;  5M1P A;  4B1V A;  1RDB A;  3VEY A;  1D9D A;  4X64 K;  2O8C B;  1ZBF A;  1K73 O;  2IVN A;  3AVI A;  4L8R B;  3RR8 A;  5TKY A;  2HHV A;  1OH6 A;  5AQH A;  1X9S A;  4ZTJ A;  4B3O A;  2QWQ A;  3VTH A;  4Z4I A;  4ISE A;  3E9L A;  3RSE A;  3FFI A;  1YF5 L;  3HJF A;  4CJU A;  2HW3 A;  3RMA A;  3GG4 A;  1LV5 A;  4ZTF A;  4NYN A;  1NGI A;  3U6F A;  4CEC A;  3IG1 A;  4RW6 A;  3CD6 N;  1KTQ A;  1JLQ A;  4H8K A;  2HVH A;  1LW2 A;  1S9G A;  2OTL N;  1SKR A;  3AVH A;  5K14 A;  4DUY K;  4M3Y A;  1HX1 A;  3SNN A;  5AFU A;  2F4V K;  5IT9 O;  2X74 A;  1UWB A;  1WAF A;  3O9T A;  4A5B A;  2KQ2 A;  3KD1 E;  3VA3 A;  4O55 A;  4FLV A;  3OYD A;  1EET A;  4K0K K;  1NG9 A;  1GLA G;  4C1N I;  5JMV A;  2IS3 A;  1D8Y A;  1WSJ A;  2IVO A;  5AQW A;  3ZSY A;  4CBX A;  3J7A P;  4DS5 A;  2A40 A;  4JI0 K;  3OVN A;  4RCH A;  1VAZ A;  3MXI A;  5KPR A;  2VWB A;  4KHS A;  4H4M A;  2ZF5 O;  1BUP A;  3H1Q A;  1RBS A;  2UUA K;  1V4T A;  4CVN E;  4CK2 A;  4O4G A;  3EO3 A;  2WFB A;  4NLC A;  1NGF A;  3NMU A;  2DFE A;  4C23 A;  4CGD A;  4FWM A;  3THY A;  1RDC A;  2VG6 A;  2CGK A;  3HI0 A;  1BL3 A;  1X3M A;  4DSI A;  5GIO A;  3LPU A;  3THV A;  3S3N A;  1HKC A;  4DTN A;  4CZK A;  4FM0 A;  4CZI A;  4DTM A;  4KTW A;  4E89 A;  1Z26 A;  4IDH A;  4FLZ A;  4FZZ A;  1BCM A;  1RBU A;  4BG9 A;  2VG5 A;  3R8E A;  1TUY A;  3TAF A;  1NKE A;  5AR0 A;  3LM2 A;  1VQK N;  3F2K A;  3QBW A;  4C8N A;  3TPQ A;  4HUF A;  3ASM A;  4BRQ A;  4KHP K;  3J81 O;  1BWF O;  3AY9 A;  4FLT A;  5AZJ A;  1YJW N;  3C0B A;  4AHC A;  4G1Q A;  3D2E A;  3O3F A;  2BE2 A;  4B9Q A;  3NH1 A;  3DI6 A;  4JKG B;  1VSH A;  4HHT A;  3SBT A;  1S1X A;  1REV A;  3KTQ A;  3HOS A;  3O08 A;  4O5F A;  3MK6 A;  3D6R A;  5DMR A;  1DEJ A;  3HYF A;  4X62 K;  4HCC A;  4Y1D A;  1J54 A;  1TVR A;  5ADX H;  5AQJ A;  4B9S A;  4AM7 A;  3K9K A;  4B1U B;  4I2P A;  1HJO A;  1W7A A;  1SAZ A;  3VES A;  1Q8I A;  2LSN A;  4MLE A;  4WE1 A;  1NGB A;  2GWK A;  3LM9 A;  4FPB A;  4DLG A;  1VQ7 N;  4B3T K;  2NRH A;  4WF9 L;  4HWI A;  2O4G A;  2QI2 A;  1JCF A;  2P5O A;  4CZH A;  3RVC A;  3AO5 A;  2XY8 A;  4BWM A;  2F9W A;  4IOC L;  4F8R A;  4FLW A;  4W5N A;  2AA4 A;  2F7T A;  3HM9 A;  3AA5 X;  1XMQ K;  4A57 A;  1XMO K;  4BRF A;  1SL2 A;  4O0I A;  3TAN A;  4WCE L;  4KH4 A;  3VN5 A;  1N36 K;  1T6D A;  1NWK A;  4R79 A;  1DKG D;  1RBT A;  4AQY K;  1WOQ A;  2YCH A;  2HHS A;  3I8B A;  3LAN A;  3C7N B;  4JKC A;  4K42 A;  1BQN A;  4CBW A;  2NRR A;  3C65 A;  4N56 A;  1C0T A;  1D5A A;  1WSG A;  3K2P A;  5J2M A;  1KD1 O;  1NGD A;  5EXW A;  2FBY A;  3U8X A;  4ILH A;  4GW6 A;  2P9U B;  2G8F A;  3ZT0 A;  2XRI A;  5KTQ A;  4LF4 K;  3WXK A;  2UUC K;  1FW6 A;  4WQ4 C;  3GL1 A;  4CK3 A;  1QSS A;  3O9Q A;  3ID8 A;  4HTL A;  1TKX A;  1WBB A;  1FJG K;  2EX3 A;  2QKK A;  3KKS A;  1ZBU A;  4DR7 K;  4DQQ A;  3A5M C;  2E2O A;  4RWT A;  4X66 K;  1ILY A;  2QK9 A;  4PKH A;  2YI1 A;  3F5T A;  4DTU A;  3NH0 A;  3ZX3 A;  2VCP A;  3AA4 A;  3L8B A;  3CM6 A;  2HHU A;  3AO2 A;  2ITM A;  2J4R A;  4O44 A;  3SQ1 A;  1HNI A;  4BRH A;  4ILG B;  3C6T A;  4LF5 K;  3DXM A;  4A59 A;  2E4L A;  3HVR A;  1Y97 A;  4CHO A;  4KI4 A;  3OYK A;  1HKB A;  5HOO A;  4MO4 A;  2HMI A;  4DFK A;  1WNS A;  4CJ3 A;  4CJF A;  3MDQ A;  2P9K A;  4GV9 A;  2D0P A;  2W6K A;  5AQL A;  4BE2 A;  3HOT A;  4F3T A;  2D0C A;  1SS6 A;  3HXM A;  2YJF A;  4CJQ A;  3MN9 A;  1VSJ A;  3EN9 A;  5FPN A;  3TU5 A;  1NKC A;  4ELU A;  1WSH A;  3KWI A;  3O8M A;  3Q7C A;  5I9E B;  3H6E A;  2G8W A;  2KFN A;  1HNV A;  3R1X A;  1HYV A;  5KI6 A;  1FK9 A;  4DV6 K;  3FLC O;  5HRR A;  5BRE A;  4BRE A;  3KLH A;  2YHW A;  2IAJ A;  3OYB A;  1T44 A;  3BF3 A;  4U7B A;  1T05 A;  1NK6 A;  4BVO A;  1WAJ A;  4OKE A;  4FJH A;  1KFS A;  4BRA A;  3VGK A;  4XIU A;  3RRH A;  4DMN A;  4GV6 A;  3L2W A;  2NLX A;  2ETJ A;  3TR8 A;  4FM2 A;  4OGC A;  4JV5 K;  4IFE A;  5AZI A;  3OBW A;  3ZSR A;  4B3M K;  1GLL O;  5AQS A;  1OVQ A;  5AQO A;  3ZT2 A;  3V9U A;  4Z4F A;  1KVB A;  3Q7B A;  3OJS A;  4H5N A;  3ZEU B;  3I8D A;  1HYZ A;  2NRV A;  3MEE A;  3DM2 A;  1BOT O;  5HL7 L;  1NGJ A;  1K8K A;  2ZWH A;  5DM7 L;  2Q0R A;  5CZ2 A;  1VQ4 N;  1JL2 A;  3QIC A;  2YKN A;  4B1Z A;  4CF9 A;  3FZK A;  3GBT A;  4JHD B;  1N33 K;  4WQ5 A;  4CEF A;  1WSI A;  4KRF A;  3EZ5 A;  5LL6 Z;  3HM8 A;  4GV3 A;  4OPH A;  4JKD A;  3TAR A;  2D0A A;  3A5L C;  2NRZ A;  4JHD A;  4AF1 A;  4ILJ A;  3ZX0 A;  1QZ5 A;  1TAU A;  2GTD A;  4KAZ A;  4NCA A;  1HJR A;  3L4I A;  3TAE A;  1GOA A;  2FC0 A;  2Q1N A;  3NVK A;  1BIZ A;  3RMD A;  1FKP A;  3LAM A;  3DLL L;  2HF3 A;  3LDO A;  4QS9 A;  2FSJ A;  2P51 A;  4KH6 A;  5CYM A;  4FWK A;  3SV4 A;  3M8P A;  4CGJ A;  4PWD A;  3UKR B;  1IBM K;  2OPQ A;  1X3N A;  1W2B M;  4AHV A;  3ULD A;  4K8Z A;  5E84 A;  4M3W A;  3QES A;  3ENB A;  4CHQ A;  4GVE A;  3H1V X;  3BF1 A;  1TAQ A;  3MX2 A;  3AVB A;  1JLA A;  1GLJ O;  2OYQ A;  2E6M A;  3F9M A;  3AGK A;  2ZE2 A;  3DRS A;  1UAX A;  3D0P A;  4E7H A;  1NGA A;  3SYZ A;  5M1F A;  2ATQ A;  3NF8 A;  3HL8 A;  4FJ5 A;  1DGK N;  4YOX A;  3M6G A;  4H03 B;  5CE3 A;  3WNF A;  4Q5V A;  4QAG A;  3SUO A;  4DB3 A;  3K0S A;  4DF4 A;  3NGY A;  3RTV A;  2NUB A;  3EE9 A;  4JI8 K;  2AJQ A;  4CJ7 A;  3CJ1 A;  1X1P A;  3S3M A;  4CEE A;  2NRX A;  4PHT X;  2RF2 A;  1CXU A;  3CMA N;  1UA1 A;  3BZK A;  4CGI A;  4IEI A;  4FM1 A;  3CG7 A;  4W5Q A;  1GLC G;  2A5X A;  1JXE A;  4KHQ A;  2Y1J A;  4H0P A;  3BGR A;  2BH1 A;  3AA2 A;  2KTQ A;  4FWN A;  4JK9 A;  4JN4 A;  3KK2 A;  1QHA A;  4QCL A;  4IG3 A;  3M1F A;  2W40 A;  5TKW A;  2NNW A;  1NK0 A;  3ISN C;  4CJ5 A;  4RTF D;  5JVG L;  3O5B A;  3HK2 A;  3SJH A;  3TTF A;  4F9O A;  2Y1I A;  3VEO A;  3ZT1 A;  3KZB A;  3THW B;  3ZT3 A;  1VQN N;  4BC3 A;  3SQ4 A;  4J8F A;  3OTO K;  2RKI A;  3KJV A;  2KLA A;  1ASW A;  1Z05 A;  1M1K O;  1XWL A;  2VWJ A;  3AAQ A;  3DLG A;  4Q0B A;  1NNE A;  5DM6 L;  4F2S A;  5IWA K;  4DTJ A;  1RIL A;  4YOU A;  1DT9 A;  4RW7 A;  3VEW A;  5LMN K;  5BRD A;  3H3N O;  3T7Z A;  1Q9X A;  3WNH A;  4R5P A;  1ZBH A;  3MXJ A;  3WEE A;  4WYB A;  3SJJ A;  1RDA A;  4CZJ A;  4CJ4 A;  4CK1 A;  3MWP A;  2ASO A;  2D1K A;  3CET A;  3OA9 A;  3V1Q A;  2A42 A;  3CCJ N;  3NBP A;  4BC2 A;  3QNO A;  4NLB A;  4Z4E A;  4I9L A;  1S1W A;  1HNX K;  4A5A A;  3K59 A;  4FJJ A;  4DR4 K;  2CH6 A;  3NFA A;  5T7B A;  3TI0 A;  1Q82 O;  3T3F A;  2RE2 A;  3WNG A;  5H1S Q;  3CFR A;  1JKH A;  2I5J A;  2FBT A;  2WC9 A;  4CCH A;  1K8A O;  1KFD A;  3DOL A;  1HNZ K;  3VGL A;  4DSJ A;  1U4B A;  1J9A A;  4OPJ A;  2QWL A;  4C8O A;  1QVF M;  2ZJR L;  3O4W A;  4FOE A;  1LW0 A;  4M3R A;  3I0R A;  4KB0 A;  1RBV A;  3IDH A;  4DV0 K;  4JI4 K;  2Z1G A;  3WXJ A;  2A41 A;  4EIA A;  4JAX A;  3V9W A;  1SL0 A;  3A8Y A;  4NYF A;  1RTD A;  3KHY A;  4XEI A;  4DR1 K;  2D4W A;  4M7X A;  4E1N A;  4OPA A;  3SLC A;  5CYQ A;  1K6Y A;  1IKW A;  2P1J A;  4CES A;  5AQX A;  2OPR A;  1J5O A;  3DAW A;  3DLH A;  4CFB A;  4I6M A;  4FJG A;  3ZT4 A;  3THX B;  4JEP A;  3LAL A;  4YY3 K;  5AJ3 K;  1HRH A;  3V4I A;  3K9J A;  3O1B A;  3D7E O;  4BG8 A;  1LWE A;  3LDN A;  2O8D A;  3QBX A;  1DTQ A;  4PKI A;  3G25 A;  5FRM A;  3BDP A;  5GAE P;  5E41 A;  3CJ7 A;  1R59 O;  1N5Y A;  3WQT A;  2JLE A;  5C15 A;  1LAV A;  3TWH A;  2YNG A;  1C0G A;  3CQ8 A;  3U3G A;  3L2R A;  3RSE B;  2WBN A;  5FPD A;  3ENH A;  2YKM A;  1KQS M;  3EEQ A;  4IFV A;  4DU4 A;  5C25 A;  5B8H A;  5KPZ A;  3QML A;  4EHU A;  4BRM A;  3TSQ A;  5HRO A;  5CZ1 A;  1IKV A;  4E7L A;  5JS2 A;  5KQD A;  4A61 A;  4DFJ A;  3SQ0 A;  2BDP A;  4JI3 K;  4H0O A;  5AQU A;  3AVN A;  4CZM A;  3OYL A;  4BR9 A;  1HNW K;  4BRC A;  4AH9 A;  2EWS A;  2UUB K;  4IEE A;  3ZLJ A;  4NB4 A;  3F9K A;  4DQI A;  4FL9 A;  4DS4 A;  3SPY A;  5C2F A;  4CHZ A;  1TUU A;  3LP1 A;  3GE1 A;  2PZS A;  3T1A A;  2HBM A;  3VQQ A;  4CJP A;  1RT7 A;  4WQ5 C;  1G15 A;  4JS4 A;  2WTU A;  5JLF A;  3SAH A;  2PYJ A;  2F9T A;  2VWK A;  4DLE A;  1S3X A;  2W6L A;  4I7F A;  1XUP O;  1YT3 A;  3NF7 A;  5FRO A;  4NO7 A;  3VF6 A;  5KQ8 A;  2DTU A;  5J2N A;  1TKT A;  2GUP A;  3ALY A;  4MDB A;  1WSE A;  2IDO A;  4CD3 A;  4O8U A;  2HB5 A;  4DCH A;  3AVG A;  1TK0 A;  5F2R A;  4AHU A;  3THY B;  3VTI A;  4DU1 A;  1S1V A;  2HHH K;  4E1J A;  3KLE A;  4FJX A;  4MO5 A;  3LWM A;  3KLF A;  3DMJ A; 
#chains in the Genus database with same CATH homology
 5LL6 Z;  2UXB K;  1XNQ K;  4KHP K;  2UXD K;  3J81 O;  1IBL K;  5IWA K;  4LF9 K;  4LFA K;  4DR3 K;  1XNR K;  4LF5 K;  4GKK K;  5LMN K;  4GKJ K;  4V19 S;  4B3S K;  2UU9 K;  4DV3 K;  4X65 K;  4X62 K;  5LMU K;  4DUY K;  2VQF K;  3J80 O;  4DR5 K;  2E5L K;  2F4V K;  5IT9 O;  1I94 K;  3J7Y P;  1IBM K;  4DR6 K;  5FLX O;  3T1H K;  1HNX K;  4K0K K;  4JI1 K;  4B3T K;  4DV6 K;  3JAM O;  3T1Y K;  4CW7 B;  4DR4 K;  4JI3 K;  3J7A P;  4JI0 K;  1IBK K;  1J5E K;  1HNW K;  1HNZ K;  1XMQ K;  1XMO K;  4JI2 K;  2UUB K;  4JI8 K;  2UUA K;  1N36 K;  2UXC K;  5A2Q O;  4JYA K;  4CVN E;  1HR0 K;  4LFC K;  4AQY K;  4DV0 K;  4JV5 K;  1N34 K;  4JI7 K;  4JI4 K;  4DV4 K;  4LFB K;  4B3R K;  4B3M K;  4DR2 K;  2VQE K;  4DV1 K;  4DV2 K;  4YHH K;  1N32 K;  4NXM K;  2ZM6 K;  4DV7 K;  4JI5 K;  4DR1 K;  4LF4 K;  2UUC K;  4JI6 K;  4DUZ K;  4LF7 K;  1FJG K;  4LF8 K;  4DR7 K;  5BR8 K;  4DV5 K;  4LF6 K;  4OX9 K;  2HHH K;  3OTO K;  4X64 K;  4YY3 K;  4X66 K;  5AJ3 K;  1N33 K;  4NXN K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...