4DV2K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv2K00
2VQEK 4X62K 4LFAK 2UXBK 4GKKK 4X65K 4DR3K 2ZM6K 4B3RK 4DV6K 4DR1K 1N32K 3OTOK 4LFBK 4KHPK 4B3MK 4DV0K 4CVNE 1J5EK 2UUAK 4DUZK 2VQFK 4DR2K 3J7YP 4DR6K 4DV2K 4JI6K 1IBKK 4K0KK 4YY3K 4NXMK 3J81O 4JV5K 4DV7K 4YHHK 3JAMO 5FLXO 4LF7K 1HNWK 1XNRK 1I94K 3T1YK 5LL6Z 1XNQK 4JI2K 5AJ3K 2E5LK 1FJGK 1XMOK 1XMQK 4B3TK 4AQYK 5IWAK 2F4VK 4JI5K 4NXNK 3T1HK 2HHHK 4DV4K 4CW7B 4JI0K 4JYAK 4LF9K 1N36K 1N33K 1HNXK 1IBMK 4DV5K 1IBLK 2UXCK 4B3SK 1HNZK 4JI3K 4OX9K 4JI4K 1HR0K 4DV1K 4LF8K 5BR8K 4X66K 4JI1K 5A2QO 2UUCK 2UXDK 4JI7K 4DV3K 4V19S 5LMNK 4DR7K 4DUYK 4JI8K 4LF5K 4X64K 1N34K 4LFCK 3J7AP 5LMUK 3J80O 2UUBK 2UU9K 4GKJK 5IT9O 4DR5K 4LF4K 4LF6K 4DR4K
chains in the Genus database with same CATH superfamily
1X1PA 5GAGP 4BACA 3NE6A 1VSMA 2HBLA 2P9UB 4QS9A 1XUPO 3DLKA 4B3RK 3VENA 4ZTFA 2HMIA 2QA4N 4DV6K 4M7XA 4CHOA 4Z4IA 4FPBA 2QWQA 1UA1A 2CH6A 1JLGA 1CLQA 1NGDA 4CHNA 1FKPA 1WN7A 2YHYA 4FJXA 2VQFK 2D0CA 3SCXA 4JD2B 4ELVA 3L0QA 4W5OA 4J2AA 4ID5A 1NBWA 1Q82O 4NXMK 3U4LA 2E1YA 3AY9A 1GLFO 5KI6A 4GV3A 5AQLA 3OS0A 4YHHK 3MCPA 1LWCA 4NCAA 1T6DA 1HKGA 1TAUA 2VWJA 3SMPA 3Q7BA 4Z0UA 3ATUA 5C10A 3FZMA 3HI0A 4YORA 3RRHA 3HVRA 4CZHA 3K59A 2O8FB 2VWBA 3KJVA 5IWAK 3NF8A 5AQNA 5KTQA 1W9HA 4M3RA 3CJ1A 4FLTA 4DKWA 3HSTB 3VA3A 2P9KA 1BGXT 5JVHL 4B08A 3AA2A 4WCEL 1NK7A 1VHXA 4DFMA 1NNEA 5C25A 3HVTA 2Q2RA 3QO9A 2Z1GA 1KAXA 2UXCK 4B3SK 1QVFM 3HPGA 3CJ9A 3LAKA 2YHAA 3B8AX 4I6MB 1D9DA 2ASMA 3THVA 3QB0A 2YV0X 4FL9A 3C6HA 4CECA 3TTFA 4FLZA 2D4WA 2O8DB 3CCSN 4DF8A 4BDPA 2EX3A 4CJ4A 3G6EN 3EO3A 1S9GA 2UU9K 4YOXA 4OO1J 5IT9O 4DFPA 1EKEA 3TWHA 5HP1A 3SUOA 2UYTA 3HYFA 3QBXA 4A5AA 3SUQA 3I0SA 4B8CA 1BI4A 3BZCA 3DRRA 4B9NA 4CJWA 1HMVA 1VSFA 2G8HA 3LWLA 5H1SQ 3TAEA 3BGRA 2OA8A 2JGUA 1ATSA 2YKMA 1NJXA 4I9QA 4KH6A 4CIEA 4N56A 4G9ZA 1N32K 3THYB 3AVCA 4DG1A 1KFDA 2QWNA 5AQHA 4JS5A 4BR4A 2KZMA 3SI6A 3H6EA 2XO7A 1B9FA 5AQYA 4CHPA 5DMRA 5CYMA 3IKMA 2D5RA 3CJBA 1OH5A 2V51B 1ZBHA 3LANA 5J1EA 3VQPA 2BANA 3C0BA 1ZYQA 3HXMA 1KQSM 4DTSA 2O8BB 3O3FA 2Z1IA 1YI2N 4DQRA 2A1RA 5AQWA 1HNIA 4M3YA 3T1YK 4LC9B 4N5SA 3WXJA 2G8FA 4B1XB 4IBNA 1NMDA 4DQ8A 3V81A 3RSEA 1XMOK 3CG7A 4YOYA 2E1ZA 3AA3A 3CQ8A 3T1HK 3HZ6A 4CW7B 1NOZA 1CXQA 4CF1A 1E3MA 1WSIA 4CF9A 1DTTA 3OYAA 3AO1A 3M8SA 4CFDA 4JKGA 1Q9YA 2BE2A 4IG3A 1YXQA 3P1GA 1QQMA 4CHQA 4KTWA 4FM1A 2LSNA 3K58A 4BR9A 4KKOA 5C2FA 2QXFA 4CJEA 3WXKA 4JAXA 5BREA 1W97L 1U48A 3NDKA 3CPEA 4C8OA 4LFCK 3DRPA 2IVPA 3UKUA 2ZJPL 1K6YA 3HSCA 4CJUA 2P9KB 3W0LA 1L5UA 3E1YA 4F8RA 3CIPA 1JLBA 3ID8A 3KLEA 5C15A 1UA0A 2PYJA 4KHWA 1EXQA 1VQON 3GE1A 4RTFD 5BRDA 5I3UA 1S1UA 1C6VA 3LZIA 1P8ZA 4KB1A 2GTDA 5AFUA 4DSLA 4B3MK 2PZSA 3OYHA 2XY5A 1S1VA 3F2KA 4M45A 4OVLA 4JS4A 5J2PA 4CD3A 3QBWA 2PBDA 4CGFA 4E7HA 4W5QA 1T7PA 4DV2K 4K0KK 3P5JA 3QEXA 3I56N 4FWKA 3DJCA 2BUPA 4BGAA 3NGIA 1WUAA 3WQTA 3J81O 2FBXA 5C24A 1BI4B 2CGJA 3PX4A 5TKYA 3DXMB 5KGWA 3CCRN 3AO2A 3CFRA 3ZSZA 5MLCQ 1T3VA 1NJIO 2P9SA 5C42A 4IEEA 3BY5A 1TKTA 3QINA 4FVMA 1JXEA 3E9OA 5KRSA 1JXBA 4CFAA 4MQ3A 3FZKA 2CGKA 4QS7A 2NNWA 4MO4A 2P9NA 2HW3A 1S5JA 1W0HA 1YITN 2O8EB 4BRFA 4OLBA 4M3UA 4BC5A 1NKEA 1JLFA 4N41A 2B4JA 4H4MA 3LP1A 1ASWA 4NB4A 3ZEUA 2NUBA 3P39A 3VQ9A 1BUPA 4K8ZA 3O9RA 1SKRA 1TKZA 3AGRA 1YJ9N 1A5XA 1GOCA 2HB5A 3EKSA 4FJKA 1LCUA 2OZSA 3RSEB 3TI0A 2QWMA 1BCOA 3ZT3A 4PY5A 1RT7A 2A42A 4BRPA 5JLFA 3V1QA 1JL1A 3LWMA 4CHZA 3P31A 3NVMA 1SL0A 1NKCA 4EHUA 3VQEA 1BOTO 4E7LA 1BHLA 4N47A 1YAGA 4IG0A 3CMEN 4KAZA 4OPHA 3CYMA 3SMSA 3MMVA 5CYQA 4FW1A 5T7BA 3ALYA 4DU1A 4DV0K 1S22A 3QNNA 1J5EK 4KREA 3TAGA 4B9QA 3CJ7A 3U3YA 3EE9A 4WQ4A 4CJFA 3UKUB 4DR2K 4A62A 4Z94A 4DTUA 1BQNA 3T19A 3FZHA 3KK7A 1Q7YO 3O1WA 1TKXA 1JJ2M 1XI1A 3SAHA 3FR0A 2OTLN 4JKFA 4LSLA 5AQKA 1HNWK 4LF7K 2PYLA 4EP4A 4BRQA 4JI2K 4CJPA 4F3OA 5EVZA 3DXKB 4MLEA 4RWTA 3NH2A 4CEQA 1EWQA 4JRQA 4FYDA 1VQ8N 2V7ZA 4IZ9A 3DLLL 2Q36A 2OPSA 5D3GA 4J2DA 3ZX3A 3G10A 3DMJA 3AARA 3K2PA 3OHRA 2HHTA 1EX4A 1SKSA 4A2BA 3DM2A 4LY7A 3TTDA 5BRHA 4YFUA 1QS4A 3AVLA 3BUZB 1C0GA 1KVCA 1Q81O 3L4IA 3VQAA 4IWVA 2VWKA 3JSMA 4Y1CA 4HVJA 2AJQA 5EXWA 4DQQA 2A5XA 2P9SB 4CJLA 3H3NO 3D2EA 5FRMA 1GLBG 2HNYA 2WUSA 3RMBA 4CJTA 4FWLA 4OKEA 4KPYA 3MWTA 3DOKA 3M8QA 2P9UA 3OS2A 4BRNA 3MEEA 3KIOA 1C0FA 4Q5VA 4H8KA 3CC2N 1I39A 2P9NB 3GG4A 4X62K 2UXBK 4WQ4C 3B6PA 3THXB 1K8AO 4FJNA 3T3FA 2XY6A 2EHGA 4FK0A 4FLUA 1EWRA 4NCGA 3BF1A 4DMNA 3AVGA 3VQCA 4HUGA 3NBPA 4JD2A 1VSHA 1GOBA 1CZAN 5HBMA 2JLEA 2GWJA 1XHZA 4FWRA 5M1KA 3QLHA 4CJQA 4DR6K 5M1QA 3ENBA 5JICA 3G71N 1WB9A 3M1FA 2HF4A 3E01A 4KTQA 5BPNA 2OZMA 1D5AA 3VQ4A 1GLLO 3RMAA 3V1OA 3MECA 4F9OA 1NJWA 3EZWA 3K0SA 2GBZA 3D2FB 1TK8A 3V1RA 2DPNA 3N4PA 1T05A 3WXIA 3CF5L 4C8KA 4MLHA 4RW8A 3OYEA 1H1VA 1O1WA 5GAEP 1BA0A 2F4VK 4PKGA 4DS4A 4F2RA 4CGJA 4OPAA 4CZGA 3UIQA 4K25A 4QAGA 5AR0A 4BC4A 4LF9K 3I8BA 3C94A 3KLFA 3EYZA 4XH1A 5KRTA 4CF8A 2E6MA 4KBOA 4M3TA 2VGNA 4DSIA 4DTRA 3OYMA 1FKOA 3NHGA 2QK9A 3SV4A 2RHKA 1BIUA 2GUIA 1OH6A 1RT2A 4KTZA 2O8DA 1BA1A 4A5BA 3VTIA 4BC2A 2HMPA 3ISNC 5DM7L 4IDKA 3H45C 4UY8O 1OVYA 4CZMA 4LF5K 3J7AP 4IJNA 3ZCMA 3CCQN 1X9WA 3SV3A 4LF6K 4FPAA 3IUCA 1T44A 4ILJA 1M1KO 1C0UA 3ZT4A 4WQ5A 3J8AA 1L3SA 1J54A 1RBRA 3OJSA 3THYA 4HCBA 4Z4FA 1X9JA 2HBKA 4DSKA 3AVNA 1S6QA 1WSGA 1B92A 2GELA 3LL3A 3VQDA 4AILC 4BR7A 3D7EO 3EZ5A 3R8EA 3L2UA 2HHQA 1T6CA 4WFBL 2A6AA 3M8RA 3D2EB 1ZBSA 1VRUA 4GY2B 2DTUA 1Z25A 2PFUA 3FE1A 3L4QA 5AQXA 1U6ZA 4C8LA 3CCEN 1GLJO 2E6LA 3OBYA 5FPMA 3IFRA 4BVOA 5AQOA 3DWLA 4CD1A 4C8NA 3F73A 3HO1A 4CK3A 4NO7A 3TU5A 4GV9A 3OYCA 4HUEA 3SJJA 4FW2A 2ASOA 2YNFA 2E5LK 4F2SA 1FJGK 3O9TA 2QWRA 3QFPA 1SL2A 4ID1A 3K57A 4B9SA 4EAHD 1BCMA 4N76A 1HKBA 1QQCA 3D45A 1IV0A 2W42A 3CCUN 1XC3A 4G1QA 5M1PA 5FPDA 5JLHA 4Z4CA 5K14A 5AQQA 3MX2A 3RRGA 3CMAN 4XH5A 4DHYA 4IO9L 4J2EA 4WQ5C 3V9ZA 4DTXA 4JKHA 4IO8A 3UKRA 4EFHA 3E9PA 1MU2A 2YHBA 1OH7A 3EY1A 2HSTA 1E4GT 3D6RA 3CC7N 3L2QA 1N34K 2XY8A 5LMUK 2QWLA 1FXXA 1JLAA 5BN9A 2IS3A 3VEWA 2YCHA 1C0TA 1U4BA 2ZF5O 4FCYA 1HLUA 3FFIA 5E84A 1BL3A 3C65A 4CGDA 3N4QA 5I42A 4IFVA 1TK0A 3C95A 2NLXA 4LFAK 3CCLN 5AZIA 3F9KA 3QNOA 4I7FA 3SQ4A 1HPMA 2F7TA 1GLDG 1RDUA 4XEIA 1K9MO 1VQLN 4B1YB 1RDCA 2ZQBA 2CGLA 4IXCA 2FSNA 2HBMA 4CJ3A 3CD6N 4CEAA 4J8FA 4OKJA 1KSPA 3ZX0A 1Q9XA 5EU7A 3ATVA 4FJ5A 2WONA 2E8AA 3O9UA 3EN9A 4I2PA 4B1ZA 4LD0A 3DXMA 3LDOA 4KO0A 2VG7A 4A61A 2AA4A 4H0PA 2HNZA 4DV7K 4BE0A 3O4WA 4PHTX 5CZ2A 3VPZA 1LAVA 2X6NA 3A0IX 1RBSA 2ZE2A 4R79A 1XNQK 4IFEA 3KVGA 5AJ3K 1QHAA 3VGMA 5GIPA 1X3MA 4B8AB 2QWOA 3KKSA 3RVCA 3GOIA 1J5OA 4A57A 1X9SA 1GLCG 3G25A 4K8XA 5TKWA 3H1VX 4W5RA 2O8EA 4C1NI 3OJUA 4FJIA 3SAGA 4FJHA 4F3TA 5E26A 1KFSA 1IBLK 1HKCA 1ZBUA 1YVNA 2VG5A 4OX9K 3A2FA 3LDNA 5HL7L 2P9LA 2X78A 4O8KA 4BG9A 4WF9L 3PIPL 4FVUA 2P5GA 5HOOA 4FK4A 4JI1K 2KZZA 1LAWA 3RR7A 3WXMB 3C6AA 2R7YA 3VQBA 4JHDA 4FOEA 1Q18A 2F9TA 4M41A 1JL2A 4H5RA 5AFUH 4YNQA 1RDDA 4M3XA 1G15A 5KGXA 1BIZA 2VGMA 3A5NC 4DCHA 4O44A 3TTCA 2VQEK 1ILYA 1RBUA 3M6GA 2W41A 1EQYA 4X65K 5C0YA 3WUHA 1DT9A 1JCGA 4DR3K 1BO5O 1QQNA 5AQRA 4MDAA 4DSEA 3IS9A 3SLCA 1U49A 2XRIA 3RTVA 4IOXA 1VQMN 4CHYA 3A5LC 1RTIA 3UKRB 1NG9A 3TSQA 3HP6A 4DLGA 4ELTA 2KFZA 2ITGA 5HROA 4B9UA 1KRPA 4CVNE 3G4SN 2DFEA 4BDZA 3LALA 4DUZK 4Z4EA 2A1SA 3MCAB 4BRKA 1ESVA 4CE9A 1HNVA 3DXKA 3MK6A 2Y1IA 1L3TA 5AZIB 3AA5X 3TSPA 1NGCA 4KFBA 3AVIA 1VQNN 4E0DA 1QVGM 1YVUA 4AHCA 3VERA 2HVIA 1REVA 4DB3A 1EO1A 3AVKA 4JI5K 1S3XA 5ADXA 3ZSRA 1XQSC 3AV9A 1C0MA 4H4OA 1G99A 4PKIA 1N5YA 3ZLJA 2D0BA 2IDOA 4M42A 3EE8A 4AH9A 4DU3A 3CI5A 3QDKA 4H5TA 1NU0A 5AQJA 3O08A 4CZIA 4CGIA 1IJJA 5EX5A 3SUNA 3PLAA 1ASVA 2YJEA 4JI4K 4W5TA 5FROA 3VF2A 4DFJA 1QSSA 3OYJA 1U2VA 2IIRA 3KTQA 4B9MA 1NJZA 3HRGA 3HM9A 3MN6A 2GWKA 2W6LA 4JI7K 1K73O 1RCHA 3R9PA 2JWLA 2ITMA 4X64K 4E7IA 2IVOA 1YF5L 1OKJA 5CZ1A 1VQ9N 4W5NA 4AM7A 1NGHA 3RWUA 3THXA 3CHWA 3IRXA 4LF4K 1J9AA 1K8KB 4DFKA 4DQPA 1OVQA 4IOAL 1Y64A 3H3OB 2IC3A 4KI4A 4B1WB 4KHYA 4QOZB 4JRPA 4FJ9A 3V9WA 3NF9A 3OVNA 2P9LB 3HPOA 1SUQA 1VSIA 2D1KA 1D9FA 2ASPA 4E1MA 4CESA 4M7YA 3QIOA 1RT1A 2G8KA 3M8PA 3G0ZA 4KHNA 2OTJN 4FOIA 3OYLA 1HX1A 2BH1A 3B6OA 3ENOA 4JHDB 4CI6A 2ZJQL 1LWEA 3VEOA 1SQKA 1WNSA 4M3ZA 1L3UA 5E41A 1KC8O 3D2FA 5GADP 1SKWA 4BRDA 1NM1A 3DRSA 3ZX2A 4ILHA 4FZYA 4YDUA 3A5MC 3SYZA 1KTQA 1XNRK 4J2BA 3T7ZA 3LDLA 3GBTA 3QEIA 3Q7CA 1QHTA 1Q8IA 3VETA 3P38A 5KQ8A 3V6DA 4FWMA 3MXIA 3VF4A 3I8DA 3RMCA 4IJAA 2RN2A 1VRTA 2G8WA 4OPKA 2E2PA 1J53A 2IGIA 3DYAA 3F9MA 4YOUA 1WAFA 5AQUA 4E3SA 2FXUA 1RTJA 5AQZA 1I3AA 1NK9A 3LM2A 3CC4N 1JCFA 3ZSOA 4E1NA 1Z6RA 3VQ8A 5A2QO 2UXDK 1BDGA 3PIOL 5LMNK 4WE1A 3BDPA 4BDYA 4JNEA 4O5BA 3VQ6A 4OGEA 5BPMA 4HTLA 4BRCA 3O1BA 1CZ9A 2YNHA 3WNFA 1HQUA 2KKZA 3CFOA 4FJLA 1C1BA 1KAZA 3MN9A 4PWDA 4OGCA 3HL8A 3VTHA 1IH7A 3QEPA 1VQPN 4B9VA 3LPTA 3VGKA 4AHRA 3FFKB 4CBUA 3TAQA 1TAQA 3HOTA 5SZTA 4BVPA 1X9MA 3C6UA 1YJWN 5HRNA 4YDUC 3L2RA 1U2VB 3OTOK 3MAQA 5B8HA 3VEYA 3DI6A 2IAJA 5F0XA 3SQ1A 1SZ2A 1YIJN 1P90A 3KD1E 3AA4A 1LWFA 4FLXA 1MWMA 3O5BA 3TR8A 2D0OA 4B1VA 3NH1A 2Y1JA 1RFQA 3SK3A 4CBWA 2Q1NA 5KPZA 3OYNA 4E89A 3QERA 3L3UA 4AHSA 1JKHA 3U8XA 1W7AA 4FWPA 4FWSA 3UB5A 3DOLA 1CXUA 3LP2A 2FSJA 1TL1A 3CQXA 4CZEA 3EKUA 1XMQK 4FWOA 3ZSVA 3LDSA 4CJ7A 4DTJA 2RE2A 4H5NA 1NGIA 4CJRA 2O4GA 4CEZA 3V9XA 1SL1A 3CETA 3R1XA 1TGOA 3JS6A 4AHTA 4XH4A 3WEEA 2ZD1A 5I9EB 4H5VA 2PAVA 2WFBA 1SAZA 3FGUA 3P4IA 4I2QA 4HCCA 2D0AA 3GDQA 4JKAA 4CZLA 5GIOA 3CXCM 3F5TA 5F1XA 4AHVA 3DLBA 4AM6A 3E66A 1V4SA 3GL1A 3M3ZA 3NFAA 4LH4A 1QSYA 3AVFA 4EHTA 5DK5A 1XC9A 4X66K 3VMFB 1V4TA 1NK6A 4Z4HA 3OYDA 1NOYA 2H3GX 1KAYA 4CF0A 4CFBA 3OS1A 3WNHA 2P5OA 2UUBK 2Q31A 4CJVA 3O4QA 1EETA 1RBVA 4R5PA 3ULEA 4CEFA 3ZT0A 5M1NA 3KK2A 5AQFA 3PSFA 4RW4A 3DAWA 4CJSA 2ZGYA 4CEOA 3ZT1A 2ZM6K 3U9DA 1IO2A 4O8UA 3CM6A 4I9LA 3MXJA 4KH5A 2P9IA 2NRTA 2BDPA 1NGFA 4LFBK 1RDWX 2HVHA 4OKKA 2P9PB 2YJFA 4BQLA 1WOQA 3ZSXA 4CEDA 1IKXA 1HRHA 3DLRA 1D8YA 3O6WA 3EL2A 4DSFA 1VQ4N 3NF7A 1WSFA 3WXLA 4CF2A 4DQIA 1RT3A 3J7YP 3TSUA 3SQ2A 2GX9A 1IBKK 2V7YA 4FLVA 4CGGA 1DKGD 2B5JA 4JKCA 1FK9A 2E2QA 2KFNA 2QXLA 1TK5A 4BE2A 2HOEA 5FLXO 3SPZA 1JLEA 4DS5A 4A59A 4H03B 5BPLA 3VGLA 4FSVA 4JLHA 1ZC6A 1ITGA 1HYVA 3L2WA 4IKFA 1S1XA 4ZTJA 3K9JA 4AQYK 2ZGZA 3WQUA 3LM9A 2HHHK 4DV4K 4FZXC 4KRFA 4KHQA 1JCEA 4GMJB 2W6KA 5CE3A 4PA1A 2OPRA 1N36K 2Q0RA 4FJ8A 3ID6A 2NZTA 1U45A 3O9QA 3KKRA 1HNZK 1O13A 1RDBA 4KHUA 4CBXA 2WOMA 4B1UB 2KHOA 4DV1K 2XY7A 4ELUA 4CERA 3NGYA 1QTMA 1VSLA 2QM1A 2I7NA 4DLEA 4EZ9A 1YTAA 1YUWA 2WTUA 3CJAA 5HRPA 4LH5A 3J80O 2ZJRL 2QW9A 3C7NB 4UQGA 1WBDA 5BRFA 1KXPA 4DR5K 4H0YB 4NLCA 2HHSA 4DWIA 2D0PA 4Q0BA 4JKDA 1OH8A 3VN5A 4IEIA 3WEEB 1Y97A 3KK3A 1LW0A 4GKKK 3BF3A 1J6ZA 2YNIA 3HP9A 3ZETB 3TAFA 2Z1JA 4BROA 1LV5A 3QIPA 3OYFA 3VOVA 4BQZA 4DR1K 4NLBA 4NYFA 3QETA 3NMUA 4CJKA 5LJWA 3SPYA 2KLAA 1HJOA 5JMVA 1YHQN 2HF3A 1TVRA 2Q0UA 3NAEA 3D0PA 4YOTA 3IG1A 3L6QA 4BE1A 2VG6A 2KW4A 3SBGA 3ULEB 4E19A 2AP1A 3O3GA 1MWKA 1DGKN 2XHBA 2QI2A 1QSLA 4JEPA 5AQGA 2G8IA 3O80A 1S1TA 1C1CA 2Q3SA 1HQEA 4KH4A 4BRMA 5AQIA 3MDQA 2RKIA 2FBVA 2W40A 3AVJA 3A5OC 3MEDA 3OW2M 5F2RA 1KLNA 4FK2A 2P9IB 1C1AA 1DEJA 2WBNA 1VQ6N 1YTUA 4CZFA 3TPQA 3V4IA 3OYIA 3VF6A 4BRGA 3E9LA 1VQKN 1U47A 2QWPA 2E88A 4JI0K 3C6TA 3QEVA 3M5RA 1N33K 3QICA 1VSJA 1GLEG 2BGGA 3PO5A 3U3GA 2NRWA 3L2VA 3WT0A 5HRSA 4JI3K 1RBTA 3K5OA 2E4LA 3EEQA 3AVBA 3QMLA 3TARA 1HR0K 3O9SA 4LF8K 3K9KA 3LPUA 2FF3B 4YOVA 1YJNN 4PQUA 2OYQA 4WYBA 5J2NA 4PUOA 3ZSYA 1K8KA 4B3OA 2F9WA 4FLYA 2G8VA 2HHXA 4NCBA 1LOTB 2NRHA 2OPPA 1A5WA 1T03A 1S72N 3VEXA 3MN5A 4K42A 4ISEA 3SQ0A 1Q86O 1VSEA 1WLJA 2OCEA 4H5WA 3TABA 1IKWA 5FPNA 1YT3A 2E2OA 5EOYA 3SJHA 3HT3A 3S41A 4FLWA 2B6AA 3QEWA 5AQSA 3SUPA 4O55A 3L8BA 1F21A 2VCPA 3KLHA 4GVMA 1QE1A 4U7BA 1WBBA 1U04A 2PY5A 2VYPA 3O3HA 3OA9A 4H0VB 4BWJA 1VK0A 2FC0A 4MDBA 3P83D 3THWA 3I0RA 4TSXA 2RPIA 4IOCL 3PSIA 3S3NA 5HLFA 3WNGA 5JVGL 1BU6O 1CZBA 3A8YA 1S9EA 1E4FT 4CEEA 4C1NK 5AQVA 2Q97A 4RW9A 5ADXH 3V9SA 4JV5K 1MA9B 2E20A 2HBJA 3S3MA 4O4GA 4ILGB 5AQMA 1TUYA 1KVBA 2FBTA 2YX6A 1I94K 4OPJA 4O0JA 3AVMA 3MN7A 5CHIA 2FSKA 4EIAA 4RCHA 3HPHA 2GUPA 3HTVA 4BY9C 2F8TA 2X74A 3PX6A 2ATQA 4E1JA 3HOSA 4BGBA 3KHYA 1BISA 2RF2A 1TKDA 1EP4A 2FLOA 4BG8A 1HNXK 4O0IA 3LZJA 4DV5K 2YNGA 4HHTA 3T1AA 3DLEA 2YHXA 3HBTA 3ENHA 1Z05A 3PO4A 3J7ZO 3H1QA 4YOWA 1NK4A 3CCJN 3T69A 4FM2A 1ZBFA 3LAMA 4JKBA 5AZJA 4A2AA 4GVEA 2A3ZA 4CIFA 4CCHA 5BR8K 3KLIA 4GW6A 3ZSWA 4F4KA 2JWKA 4V19S 4DUYK 3SBTA 3PUFA 1HYZA 5ELZA 4ICLA 1WSEA 3NCIA 5J2MA 2IOCA 3O8MA 4LSNA 4FJGA 4CK2A 2HHUA 1IKVA 3K5LA 1QZ5A 3VQ5A 5LY3A 4OLAA 3OYGA 4OJRA 4U67L 4RW7A 2QKKA 3VEZA 4PKHA 4B9LA 1ZBIA 4JN4A 1S6PA 4M63C 4H0OA 4KHPK 4HTUA 4C8MA 3VA0A 4GV6A 4Y0WA 1N6QA 4JKEA 4FJMA 2F8SA 2UUAK 1IKYA 2E2NA 3K5NA 4CK1A 3CM5A 3CERA 4JK7A 3AO4A 5FDLA 3DLHA 4KHSA 2O8CA 2A40A 1HPZA 5M1FA 3CFPA 1ZBLA 4L3QA 4CFCA 2ZWHA 4H0XB 3JAMO 4DU4A 4BWMA 4HUFA 3NVKA 1SS6A 3LP0A 2HNDA 2OPQA 5KPRA 1TV6A 2P51A 3NH0A 4AF1A 3H08A 1RT6A 4WFNL 1IG9A 3AO3A 4H0TB 4FWQA 1N8RO 1X3NA 1NGJA 1VSKA 1FW6A 4FZZA 3FZLA 2P1JA 5FPEA 3CJCA 2X6SA 4NXNK 4BRLA 1JLCA 4BR0A 2F96A 3THWB 1RTHA 3H46O 1NK0A 4DTNA 5LJVA 4DTPA 4FJ7A 5BN8A 3SNNA 1RNHA 1RT4A 3O4NA 3R6MA 5C12A 2BTFA 3ASMA 2HHWA 4K41A 3VESA 3TAPA 3BEXA 1NLVA 3I55N 4JKGB 2ETJA 1W2BM 1BQMA 3VQQA 2NRXA 1DLOA 1QZ6A 3KK1A 1TL3A 1LW2A 1ATNA 1UOCA 4ISFA 3ITHA 4EZ6A 5JS2A 4C23A 1IG8A 2QEXN 4GKJK 1NMNA 3ZT2A 4DR4K 1NK8A 5AQTA 5HRRA 4O5FA 1HJRA 5JS1A 2FF6A 4PL7A 5CY4A 2P9PA 4KV8A 4WFAL 2EWSA 3JXUA 1DTQA 4QCLA 3RR8A 5AZJB 4DQSA 1RDAA 1Z26A 2I5JA 4CZJA 1KCFA 3IDHA 5BR9A 4IFYA 4M3WA 1RGIA 3KWGA 1KD1O 4QS8A 1RTDA 3UE5A 4DTMA 2NRZA 3LDPA 3SZ2A 3I33A 5AQPA 4YY3K 2YHWA 1L3VA 1VAZA 1ZXOA 4DSJA 1MDUB 5KPTA 1NKBA 3PY8A 4PL8A 5C2DA 5LL6Z 3AGKA 2FBYA 1TUUA 1A5VA 3OYBA 3BP8A 1R59O 2DFFA 3K5MA 4B3TK 2Z1HA 2QTDA 4BR2A 3S3OA 1TYQA 4CGHA 3QFUA 4NYNA 2A41A 4L8RB 3FZFA 3FLCO 4BRHA 2YI1A 1NGBA 4BRIA 1XHXA 4KB0A 3KLGA 1IBMK 3OY9A 4BREA 1NJYA 2O8CB 1ASUA 3AVAA 4FO0A 4XIUA 1GOAA 1SV5A 4HWIA 3TANA 5SWMA 3W3DA 3KWIA 4Y1DA 3SAFA 2UUCK 3C7NA 2NRRA 1HUXA 4DV3K 3ZEUB 1M90O 4JI8K 2GV9A 4FM0A 2KQ2A 3IMXA 3KD5E 2GEMA 1WSJA 1KVAA 3ZYYX 1KLMA 4ISGA 3ZETA 3MWPA 3KZBA 2G8UA 2DY4A 3NF6A 1VSDA 3HK2A 3L3VA 3HM8A 4FWNA 3AAPA 4JK8A 2OANA 3CPWM 5DM6L 4IDHA 1JLQA 2CH5A 1WAJA 1NGAA 5M1OA 3MEGA 2IVNA 2O8FA 3RMDA 2NRVA 3LP3A 3AO5A 5EY4A 1RT5A 3R3LA 1ATRA 5J2QA 2HHVA 3DLGA 5KQDA 1VQ5N 1D4XA 2YKNA 3VQ7A 2O4IA 4E7JA 4JI6K 4AHUA 3JYTA 3MXMA 5CR4A 2QKBA 1NK5A 3NGZA 4EP5A 4KI6A 3CCVN 3VEVA 3WNEA 4CJ5A 4BR5A 4GNIA 4BC3A 3OYKA 3PX0A 4I6MA 1GLAG 4CZKA 1HYSA 3ZSQA 1T8EA 4E7KA 4FJJA 4ZHRA 2J4RA 3BZKA 4BRAA 1XWLA 4MFBA 2WC9A 1NWKA 1RILA 3V9UA 2I7PA 4JYAK 3ULDA 4RW6A 3U6FA 1R0AA 3PV8A 3TAMA 4CEBA 2KTQA 3OBWA 1NGEA 3U9ZA 1QQOA 4DTOA 1B9DA 1UAXA 4RG8A 4Z4GA 4B9TA 5GINA 4DF4A 3AAQA 3HJFA 1S1WA 4JK9A 3QESA 4FXDA 3LDQA 2V52B 3CQYA 4DR7K 3AVHA 1UWBA 4MO5A 3CCMN 1WSHA 3IAYA 1TYQB 4K43A 5GAHP 5FRNA 3MX5A 3S9HA 1VQ7N 4CIGA 2DFHA 1NGGA 1BG3A 1BWFO 2O8BA
chains in the Genus database with same CATH topology
2VQEK 4X62K 4LFAK 2UXBK 4GKKK 4X65K 4DR3K 2ZM6K 4B3RK 4DV6K 4DR1K 1N32K 3OTOK 4LFBK 4KHPK 4B3MK 4DV0K 4CVNE 1J5EK 2UUAK 4DUZK 2VQFK 4DR2K 3J7YP 4DR6K 4DV2K 4JI6K 1IBKK 4K0KK 4YY3K 4NXMK 3J81O 4JV5K 4DV7K 4YHHK 3JAMO 5FLXO 4LF7K 1HNWK 1XNRK 1I94K 3T1YK 5LL6Z 1XNQK 4JI2K 5AJ3K 2E5LK 1FJGK 1XMOK 1XMQK 4B3TK 4AQYK 5IWAK 2F4VK 4JI5K 4NXNK 3T1HK 2HHHK 4DV4K 4CW7B 4JI0K 4JYAK 4LF9K 1N36K 1N33K 1HNXK 1IBMK 4DV5K 1IBLK 2UXCK 4B3SK 1HNZK 4JI3K 4OX9K 4JI4K 1HR0K 4DV1K 4LF8K 5BR8K 4X66K 4JI1K 5A2QO 2UUCK 2UXDK 4JI7K 4DV3K 4V19S 5LMNK 4DR7K 4DUYK 4JI8K 4LF5K 4X64K 1N34K 4LFCK 3J7AP 5LMUK 3J80O 2UUBK 2UU9K 4GKJK 5IT9O 4DR5K 4LF4K 4LF6K 4DR4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE K;  4X62 K;  4LFA K;  2UXB K;  4GKK K;  4X65 K;  4DR3 K;  2ZM6 K;  4B3R K;  4DV6 K;  4DR1 K;  1N32 K;  3OTO K;  4LFB K;  4KHP K;  4B3M K;  4DV0 K;  4CVN E;  1J5E K;  2UUA K;  4DUZ K;  2VQF K;  4DR2 K;  3J7Y P;  4DR6 K;  4DV2 K;  4JI6 K;  1IBK K;  4K0K K;  4YY3 K;  4NXM K;  3J81 O;  4JV5 K;  4DV7 K;  4YHH K;  3JAM O;  5FLX O;  4LF7 K;  1HNW K;  1XNR K;  1I94 K;  3T1Y K;  5LL6 Z;  1XNQ K;  4JI2 K;  5AJ3 K;  2E5L K;  1FJG K;  1XMO K;  1XMQ K;  4B3T K;  4AQY K;  5IWA K;  2F4V K;  4JI5 K;  4NXN K;  3T1H K;  2HHH K;  4DV4 K;  4CW7 B;  4JI0 K;  4JYA K;  4LF9 K;  1N36 K;  1N33 K;  1HNX K;  1IBM K;  4DV5 K;  1IBL K;  2UXC K;  4B3S K;  1HNZ K;  4JI3 K;  4OX9 K;  4JI4 K;  1HR0 K;  4DV1 K;  4LF8 K;  5BR8 K;  4X66 K;  4JI1 K;  5A2Q O;  2UUC K;  2UXD K;  4JI7 K;  4DV3 K;  4V19 S;  5LMN K;  4DR7 K;  4DUY K;  4JI8 K;  4LF5 K;  4X64 K;  1N34 K;  4LFC K;  3J7A P;  5LMU K;  3J80 O;  2UUB K;  2UU9 K;  4GKJ K;  5IT9 O;  4DR5 K;  4LF4 K;  4LF6 K;  4DR4 K; 
#chains in the Genus database with same CATH topology
 1X1P A;  5GAG P;  4BAC A;  3NE6 A;  1VSM A;  2HBL A;  2P9U B;  4QS9 A;  1XUP O;  3DLK A;  4B3R K;  3VEN A;  4ZTF A;  2HMI A;  2QA4 N;  4DV6 K;  4M7X A;  4CHO A;  4Z4I A;  4FPB A;  2QWQ A;  1UA1 A;  2CH6 A;  1JLG A;  1CLQ A;  1NGD A;  4CHN A;  1FKP A;  1WN7 A;  2YHY A;  4FJX A;  2VQF K;  2D0C A;  3SCX A;  4JD2 B;  4ELV A;  3L0Q A;  4W5O A;  4J2A A;  4ID5 A;  1NBW A;  1Q82 O;  4NXM K;  3U4L A;  2E1Y A;  3AY9 A;  1GLF O;  5KI6 A;  4GV3 A;  5AQL A;  3OS0 A;  4YHH K;  3MCP A;  1LWC A;  4NCA A;  1T6D A;  1HKG A;  1TAU A;  2VWJ A;  3SMP A;  3Q7B A;  4Z0U A;  3ATU A;  5C10 A;  3FZM A;  3HI0 A;  4YOR A;  3RRH A;  3HVR A;  4CZH A;  3K59 A;  2O8F B;  2VWB A;  3KJV A;  5IWA K;  3NF8 A;  5AQN A;  5KTQ A;  1W9H A;  4M3R A;  3CJ1 A;  4FLT A;  4DKW A;  3HST B;  3VA3 A;  2P9K A;  1BGX T;  5JVH L;  4B08 A;  3AA2 A;  4WCE L;  1NK7 A;  1VHX A;  4DFM A;  1NNE A;  5C25 A;  3HVT A;  2Q2R A;  3QO9 A;  2Z1G A;  1KAX A;  2UXC K;  4B3S K;  1QVF M;  3HPG A;  3CJ9 A;  3LAK A;  2YHA A;  3B8A X;  4I6M B;  1D9D A;  2ASM A;  3THV A;  3QB0 A;  2YV0 X;  4FL9 A;  3C6H A;  4CEC A;  3TTF A;  4FLZ A;  2D4W A;  2O8D B;  3CCS N;  4DF8 A;  4BDP A;  2EX3 A;  4CJ4 A;  3G6E N;  3EO3 A;  1S9G A;  2UU9 K;  4YOX A;  4OO1 J;  5IT9 O;  4DFP A;  1EKE A;  3TWH A;  5HP1 A;  3SUO A;  2UYT A;  3HYF A;  3QBX A;  4A5A A;  3SUQ A;  3I0S A;  4B8C A;  1BI4 A;  3BZC A;  3DRR A;  4B9N A;  4CJW A;  1HMV A;  1VSF A;  2G8H A;  3LWL A;  5H1S Q;  3TAE A;  3BGR A;  2OA8 A;  2JGU A;  1ATS A;  2YKM A;  1NJX A;  4I9Q A;  4KH6 A;  4CIE A;  4N56 A;  4G9Z A;  1N32 K;  3THY B;  3AVC A;  4DG1 A;  1KFD A;  2QWN A;  5AQH A;  4JS5 A;  4BR4 A;  2KZM A;  3SI6 A;  3H6E A;  2XO7 A;  1B9F A;  5AQY A;  4CHP A;  5DMR A;  5CYM A;  3IKM A;  2D5R A;  3CJB A;  1OH5 A;  2V51 B;  1ZBH A;  3LAN A;  5J1E A;  3VQP A;  2BAN A;  3C0B A;  1ZYQ A;  3HXM A;  1KQS M;  4DTS A;  2O8B B;  3O3F A;  2Z1I A;  1YI2 N;  4DQR A;  2A1R A;  5AQW A;  1HNI A;  4M3Y A;  3T1Y K;  4LC9 B;  4N5S A;  3WXJ A;  2G8F A;  4B1X B;  4IBN A;  1NMD A;  4DQ8 A;  3V81 A;  3RSE A;  1XMO K;  3CG7 A;  4YOY A;  2E1Z A;  3AA3 A;  3CQ8 A;  3T1H K;  3HZ6 A;  4CW7 B;  1NOZ A;  1CXQ A;  4CF1 A;  1E3M A;  1WSI A;  4CF9 A;  1DTT A;  3OYA A;  3AO1 A;  3M8S A;  4CFD A;  4JKG A;  1Q9Y A;  2BE2 A;  4IG3 A;  1YXQ A;  3P1G A;  1QQM A;  4CHQ A;  4KTW A;  4FM1 A;  2LSN A;  3K58 A;  4BR9 A;  4KKO A;  5C2F A;  2QXF A;  4CJE A;  3WXK A;  4JAX A;  5BRE A;  1W97 L;  1U48 A;  3NDK A;  3CPE A;  4C8O A;  4LFC K;  3DRP A;  2IVP A;  3UKU A;  2ZJP L;  1K6Y A;  3HSC A;  4CJU A;  2P9K B;  3W0L A;  1L5U A;  3E1Y A;  4F8R A;  3CIP A;  1JLB A;  3ID8 A;  3KLE A;  5C15 A;  1UA0 A;  2PYJ A;  4KHW A;  1EXQ A;  1VQO N;  3GE1 A;  4RTF D;  5BRD A;  5I3U A;  1S1U A;  1C6V A;  3LZI A;  1P8Z A;  4KB1 A;  2GTD A;  5AFU A;  4DSL A;  4B3M K;  2PZS A;  3OYH A;  2XY5 A;  1S1V A;  3F2K A;  4M45 A;  4OVL A;  4JS4 A;  5J2P A;  4CD3 A;  3QBW A;  2PBD A;  4CGF A;  4E7H A;  4W5Q A;  1T7P A;  4DV2 K;  4K0K K;  3P5J A;  3QEX A;  3I56 N;  4FWK A;  3DJC A;  2BUP A;  4BGA A;  3NGI A;  1WUA A;  3WQT A;  3J81 O;  2FBX A;  5C24 A;  1BI4 B;  2CGJ A;  3PX4 A;  5TKY A;  3DXM B;  5KGW A;  3CCR N;  3AO2 A;  3CFR A;  3ZSZ A;  5MLC Q;  1T3V A;  1NJI O;  2P9S A;  5C42 A;  4IEE A;  3BY5 A;  1TKT A;  3QIN A;  4FVM A;  1JXE A;  3E9O A;  5KRS A;  1JXB A;  4CFA A;  4MQ3 A;  3FZK A;  2CGK A;  4QS7 A;  2NNW A;  4MO4 A;  2P9N A;  2HW3 A;  1S5J A;  1W0H A;  1YIT N;  2O8E B;  4BRF A;  4OLB A;  4M3U A;  4BC5 A;  1NKE A;  1JLF A;  4N41 A;  2B4J A;  4H4M A;  3LP1 A;  1ASW A;  4NB4 A;  3ZEU A;  2NUB A;  3P39 A;  3VQ9 A;  1BUP A;  4K8Z A;  3O9R A;  1SKR A;  1TKZ A;  3AGR A;  1YJ9 N;  1A5X A;  1GOC A;  2HB5 A;  3EKS A;  4FJK A;  1LCU A;  2OZS A;  3RSE B;  3TI0 A;  2QWM A;  1BCO A;  3ZT3 A;  4PY5 A;  1RT7 A;  2A42 A;  4BRP A;  5JLF A;  3V1Q A;  1JL1 A;  3LWM A;  4CHZ A;  3P31 A;  3NVM A;  1SL0 A;  1NKC A;  4EHU A;  3VQE A;  1BOT O;  4E7L A;  1BHL A;  4N47 A;  1YAG A;  4IG0 A;  3CME N;  4KAZ A;  4OPH A;  3CYM A;  3SMS A;  3MMV A;  5CYQ A;  4FW1 A;  5T7B A;  3ALY A;  4DU1 A;  4DV0 K;  1S22 A;  3QNN A;  1J5E K;  4KRE A;  3TAG A;  4B9Q A;  3CJ7 A;  3U3Y A;  3EE9 A;  4WQ4 A;  4CJF A;  3UKU B;  4DR2 K;  4A62 A;  4Z94 A;  4DTU A;  1BQN A;  3T19 A;  3FZH A;  3KK7 A;  1Q7Y O;  3O1W A;  1TKX A;  1JJ2 M;  1XI1 A;  3SAH A;  3FR0 A;  2OTL N;  4JKF A;  4LSL A;  5AQK A;  1HNW K;  4LF7 K;  2PYL A;  4EP4 A;  4BRQ A;  4JI2 K;  4CJP A;  4F3O A;  5EVZ A;  3DXK B;  4MLE A;  4RWT A;  3NH2 A;  4CEQ A;  1EWQ A;  4JRQ A;  4FYD A;  1VQ8 N;  2V7Z A;  4IZ9 A;  3DLL L;  2Q36 A;  2OPS A;  5D3G A;  4J2D A;  3ZX3 A;  3G10 A;  3DMJ A;  3AAR A;  3K2P A;  3OHR A;  2HHT A;  1EX4 A;  1SKS A;  4A2B A;  3DM2 A;  4LY7 A;  3TTD A;  5BRH A;  4YFU A;  1QS4 A;  3AVL A;  3BUZ B;  1C0G A;  1KVC A;  1Q81 O;  3L4I A;  3VQA A;  4IWV A;  2VWK A;  3JSM A;  4Y1C A;  4HVJ A;  2AJQ A;  5EXW A;  4DQQ A;  2A5X A;  2P9S B;  4CJL A;  3H3N O;  3D2E A;  5FRM A;  1GLB G;  2HNY A;  2WUS A;  3RMB A;  4CJT A;  4FWL A;  4OKE A;  4KPY A;  3MWT A;  3DOK A;  3M8Q A;  2P9U A;  3OS2 A;  4BRN A;  3MEE A;  3KIO A;  1C0F A;  4Q5V A;  4H8K A;  3CC2 N;  1I39 A;  2P9N B;  3GG4 A;  4X62 K;  2UXB K;  4WQ4 C;  3B6P A;  3THX B;  1K8A O;  4FJN A;  3T3F A;  2XY6 A;  2EHG A;  4FK0 A;  4FLU A;  1EWR A;  4NCG A;  3BF1 A;  4DMN A;  3AVG A;  3VQC A;  4HUG A;  3NBP A;  4JD2 A;  1VSH A;  1GOB A;  1CZA N;  5HBM A;  2JLE A;  2GWJ A;  1XHZ A;  4FWR A;  5M1K A;  3QLH A;  4CJQ A;  4DR6 K;  5M1Q A;  3ENB A;  5JIC A;  3G71 N;  1WB9 A;  3M1F A;  2HF4 A;  3E01 A;  4KTQ A;  5BPN A;  2OZM A;  1D5A A;  3VQ4 A;  1GLL O;  3RMA A;  3V1O A;  3MEC A;  4F9O A;  1NJW A;  3EZW A;  3K0S A;  2GBZ A;  3D2F B;  1TK8 A;  3V1R A;  2DPN A;  3N4P A;  1T05 A;  3WXI A;  3CF5 L;  4C8K A;  4MLH A;  4RW8 A;  3OYE A;  1H1V A;  1O1W A;  5GAE P;  1BA0 A;  2F4V K;  4PKG A;  4DS4 A;  4F2R A;  4CGJ A;  4OPA A;  4CZG A;  3UIQ A;  4K25 A;  4QAG A;  5AR0 A;  4BC4 A;  4LF9 K;  3I8B A;  3C94 A;  3KLF A;  3EYZ A;  4XH1 A;  5KRT A;  4CF8 A;  2E6M A;  4KBO A;  4M3T A;  2VGN A;  4DSI A;  4DTR A;  3OYM A;  1FKO A;  3NHG A;  2QK9 A;  3SV4 A;  2RHK A;  1BIU A;  2GUI A;  1OH6 A;  1RT2 A;  4KTZ A;  2O8D A;  1BA1 A;  4A5B A;  3VTI A;  4BC2 A;  2HMP A;  3ISN C;  5DM7 L;  4IDK A;  3H45 C;  4UY8 O;  1OVY A;  4CZM A;  4LF5 K;  3J7A P;  4IJN A;  3ZCM A;  3CCQ N;  1X9W A;  3SV3 A;  4LF6 K;  4FPA A;  3IUC A;  1T44 A;  4ILJ A;  1M1K O;  1C0U A;  3ZT4 A;  4WQ5 A;  3J8A A;  1L3S A;  1J54 A;  1RBR A;  3OJS A;  3THY A;  4HCB A;  4Z4F A;  1X9J A;  2HBK A;  4DSK A;  3AVN A;  1S6Q A;  1WSG A;  1B92 A;  2GEL A;  3LL3 A;  3VQD A;  4AIL C;  4BR7 A;  3D7E O;  3EZ5 A;  3R8E A;  3L2U A;  2HHQ A;  1T6C A;  4WFB L;  2A6A A;  3M8R A;  3D2E B;  1ZBS A;  1VRU A;  4GY2 B;  2DTU A;  1Z25 A;  2PFU A;  3FE1 A;  3L4Q A;  5AQX A;  1U6Z A;  4C8L A;  3CCE N;  1GLJ O;  2E6L A;  3OBY A;  5FPM A;  3IFR A;  4BVO A;  5AQO A;  3DWL A;  4CD1 A;  4C8N A;  3F73 A;  3HO1 A;  4CK3 A;  4NO7 A;  3TU5 A;  4GV9 A;  3OYC A;  4HUE A;  3SJJ A;  4FW2 A;  2ASO A;  2YNF A;  2E5L K;  4F2S A;  1FJG K;  3O9T A;  2QWR A;  3QFP A;  1SL2 A;  4ID1 A;  3K57 A;  4B9S A;  4EAH D;  1BCM A;  4N76 A;  1HKB A;  1QQC A;  3D45 A;  1IV0 A;  2W42 A;  3CCU N;  1XC3 A;  4G1Q A;  5M1P A;  5FPD A;  5JLH A;  4Z4C A;  5K14 A;  5AQQ A;  3MX2 A;  3RRG A;  3CMA N;  4XH5 A;  4DHY A;  4IO9 L;  4J2E A;  4WQ5 C;  3V9Z A;  4DTX A;  4JKH A;  4IO8 A;  3UKR A;  4EFH A;  3E9P A;  1MU2 A;  2YHB A;  1OH7 A;  3EY1 A;  2HST A;  1E4G T;  3D6R A;  3CC7 N;  3L2Q A;  1N34 K;  2XY8 A;  5LMU K;  2QWL A;  1FXX A;  1JLA A;  5BN9 A;  2IS3 A;  3VEW A;  2YCH A;  1C0T A;  1U4B A;  2ZF5 O;  4FCY A;  1HLU A;  3FFI A;  5E84 A;  1BL3 A;  3C65 A;  4CGD A;  3N4Q A;  5I42 A;  4IFV A;  1TK0 A;  3C95 A;  2NLX A;  4LFA K;  3CCL N;  5AZI A;  3F9K A;  3QNO A;  4I7F A;  3SQ4 A;  1HPM A;  2F7T A;  1GLD G;  1RDU A;  4XEI A;  1K9M O;  1VQL N;  4B1Y B;  1RDC A;  2ZQB A;  2CGL A;  4IXC A;  2FSN A;  2HBM A;  4CJ3 A;  3CD6 N;  4CEA A;  4J8F A;  4OKJ A;  1KSP A;  3ZX0 A;  1Q9X A;  5EU7 A;  3ATV A;  4FJ5 A;  2WON A;  2E8A A;  3O9U A;  3EN9 A;  4I2P A;  4B1Z A;  4LD0 A;  3DXM A;  3LDO A;  4KO0 A;  2VG7 A;  4A61 A;  2AA4 A;  4H0P A;  2HNZ A;  4DV7 K;  4BE0 A;  3O4W A;  4PHT X;  5CZ2 A;  3VPZ A;  1LAV A;  2X6N A;  3A0I X;  1RBS A;  2ZE2 A;  4R79 A;  1XNQ K;  4IFE A;  3KVG A;  5AJ3 K;  1QHA A;  3VGM A;  5GIP A;  1X3M A;  4B8A B;  2QWO A;  3KKS A;  3RVC A;  3GOI A;  1J5O A;  4A57 A;  1X9S A;  1GLC G;  3G25 A;  4K8X A;  5TKW A;  3H1V X;  4W5R A;  2O8E A;  4C1N I;  3OJU A;  4FJI A;  3SAG A;  4FJH A;  4F3T A;  5E26 A;  1KFS A;  1IBL K;  1HKC A;  1ZBU A;  1YVN A;  2VG5 A;  4OX9 K;  3A2F A;  3LDN A;  5HL7 L;  2P9L A;  2X78 A;  4O8K A;  4BG9 A;  4WF9 L;  3PIP L;  4FVU A;  2P5G A;  5HOO A;  4FK4 A;  4JI1 K;  2KZZ A;  1LAW A;  3RR7 A;  3WXM B;  3C6A A;  2R7Y A;  3VQB A;  4JHD A;  4FOE A;  1Q18 A;  2F9T A;  4M41 A;  1JL2 A;  4H5R A;  5AFU H;  4YNQ A;  1RDD A;  4M3X A;  1G15 A;  5KGX A;  1BIZ A;  2VGM A;  3A5N C;  4DCH A;  4O44 A;  3TTC A;  2VQE K;  1ILY A;  1RBU A;  3M6G A;  2W41 A;  1EQY A;  4X65 K;  5C0Y A;  3WUH A;  1DT9 A;  1JCG A;  4DR3 K;  1BO5 O;  1QQN A;  5AQR A;  4MDA A;  4DSE A;  3IS9 A;  3SLC A;  1U49 A;  2XRI A;  3RTV A;  4IOX A;  1VQM N;  4CHY A;  3A5L C;  1RTI A;  3UKR B;  1NG9 A;  3TSQ A;  3HP6 A;  4DLG A;  4ELT A;  2KFZ A;  2ITG A;  5HRO A;  4B9U A;  1KRP A;  4CVN E;  3G4S N;  2DFE A;  4BDZ A;  3LAL A;  4DUZ K;  4Z4E A;  2A1S A;  3MCA B;  4BRK A;  1ESV A;  4CE9 A;  1HNV A;  3DXK A;  3MK6 A;  2Y1I A;  1L3T A;  5AZI B;  3AA5 X;  3TSP A;  1NGC A;  4KFB A;  3AVI A;  1VQN N;  4E0D A;  1QVG M;  1YVU A;  4AHC A;  3VER A;  2HVI A;  1REV A;  4DB3 A;  1EO1 A;  3AVK A;  4JI5 K;  1S3X A;  5ADX A;  3ZSR A;  1XQS C;  3AV9 A;  1C0M A;  4H4O A;  1G99 A;  4PKI A;  1N5Y A;  3ZLJ A;  2D0B A;  2IDO A;  4M42 A;  3EE8 A;  4AH9 A;  4DU3 A;  3CI5 A;  3QDK A;  4H5T A;  1NU0 A;  5AQJ A;  3O08 A;  4CZI A;  4CGI A;  1IJJ A;  5EX5 A;  3SUN A;  3PLA A;  1ASV A;  2YJE A;  4JI4 K;  4W5T A;  5FRO A;  3VF2 A;  4DFJ A;  1QSS A;  3OYJ A;  1U2V A;  2IIR A;  3KTQ A;  4B9M A;  1NJZ A;  3HRG A;  3HM9 A;  3MN6 A;  2GWK A;  2W6L A;  4JI7 K;  1K73 O;  1RCH A;  3R9P A;  2JWL A;  2ITM A;  4X64 K;  4E7I A;  2IVO A;  1YF5 L;  1OKJ A;  5CZ1 A;  1VQ9 N;  4W5N A;  4AM7 A;  1NGH A;  3RWU A;  3THX A;  3CHW A;  3IRX A;  4LF4 K;  1J9A A;  1K8K B;  4DFK A;  4DQP A;  1OVQ A;  4IOA L;  1Y64 A;  3H3O B;  2IC3 A;  4KI4 A;  4B1W B;  4KHY A;  4QOZ B;  4JRP A;  4FJ9 A;  3V9W A;  3NF9 A;  3OVN A;  2P9L B;  3HPO A;  1SUQ A;  1VSI A;  2D1K A;  1D9F A;  2ASP A;  4E1M A;  4CES A;  4M7Y A;  3QIO A;  1RT1 A;  2G8K A;  3M8P A;  3G0Z A;  4KHN A;  2OTJ N;  4FOI A;  3OYL A;  1HX1 A;  2BH1 A;  3B6O A;  3ENO A;  4JHD B;  4CI6 A;  2ZJQ L;  1LWE A;  3VEO A;  1SQK A;  1WNS A;  4M3Z A;  1L3U A;  5E41 A;  1KC8 O;  3D2F A;  5GAD P;  1SKW A;  4BRD A;  1NM1 A;  3DRS A;  3ZX2 A;  4ILH A;  4FZY A;  4YDU A;  3A5M C;  3SYZ A;  1KTQ A;  1XNR K;  4J2B A;  3T7Z A;  3LDL A;  3GBT A;  3QEI A;  3Q7C A;  1QHT A;  1Q8I A;  3VET A;  3P38 A;  5KQ8 A;  3V6D A;  4FWM A;  3MXI A;  3VF4 A;  3I8D A;  3RMC A;  4IJA A;  2RN2 A;  1VRT A;  2G8W A;  4OPK A;  2E2P A;  1J53 A;  2IGI A;  3DYA A;  3F9M A;  4YOU A;  1WAF A;  5AQU A;  4E3S A;  2FXU A;  1RTJ A;  5AQZ A;  1I3A A;  1NK9 A;  3LM2 A;  3CC4 N;  1JCF A;  3ZSO A;  4E1N A;  1Z6R A;  3VQ8 A;  5A2Q O;  2UXD K;  1BDG A;  3PIO L;  5LMN K;  4WE1 A;  3BDP A;  4BDY A;  4JNE A;  4O5B A;  3VQ6 A;  4OGE A;  5BPM A;  4HTL A;  4BRC A;  3O1B A;  1CZ9 A;  2YNH A;  3WNF A;  1HQU A;  2KKZ A;  3CFO A;  4FJL A;  1C1B A;  1KAZ A;  3MN9 A;  4PWD A;  4OGC A;  3HL8 A;  3VTH A;  1IH7 A;  3QEP A;  1VQP N;  4B9V A;  3LPT A;  3VGK A;  4AHR A;  3FFK B;  4CBU A;  3TAQ A;  1TAQ A;  3HOT A;  5SZT A;  4BVP A;  1X9M A;  3C6U A;  1YJW N;  5HRN A;  4YDU C;  3L2R A;  1U2V B;  3OTO K;  3MAQ A;  5B8H A;  3VEY A;  3DI6 A;  2IAJ A;  5F0X A;  3SQ1 A;  1SZ2 A;  1YIJ N;  1P90 A;  3KD1 E;  3AA4 A;  1LWF A;  4FLX A;  1MWM A;  3O5B A;  3TR8 A;  2D0O A;  4B1V A;  3NH1 A;  2Y1J A;  1RFQ A;  3SK3 A;  4CBW A;  2Q1N A;  5KPZ A;  3OYN A;  4E89 A;  3QER A;  3L3U A;  4AHS A;  1JKH A;  3U8X A;  1W7A A;  4FWP A;  4FWS A;  3UB5 A;  3DOL A;  1CXU A;  3LP2 A;  2FSJ A;  1TL1 A;  3CQX A;  4CZE A;  3EKU A;  1XMQ K;  4FWO A;  3ZSV A;  3LDS A;  4CJ7 A;  4DTJ A;  2RE2 A;  4H5N A;  1NGI A;  4CJR A;  2O4G A;  4CEZ A;  3V9X A;  1SL1 A;  3CET A;  3R1X A;  1TGO A;  3JS6 A;  4AHT A;  4XH4 A;  3WEE A;  2ZD1 A;  5I9E B;  4H5V A;  2PAV A;  2WFB A;  1SAZ A;  3FGU A;  3P4I A;  4I2Q A;  4HCC A;  2D0A A;  3GDQ A;  4JKA A;  4CZL A;  5GIO A;  3CXC M;  3F5T A;  5F1X A;  4AHV A;  3DLB A;  4AM6 A;  3E66 A;  1V4S A;  3GL1 A;  3M3Z A;  3NFA A;  4LH4 A;  1QSY A;  3AVF A;  4EHT A;  5DK5 A;  1XC9 A;  4X66 K;  3VMF B;  1V4T A;  1NK6 A;  4Z4H A;  3OYD A;  1NOY A;  2H3G X;  1KAY A;  4CF0 A;  4CFB A;  3OS1 A;  3WNH A;  2P5O A;  2UUB K;  2Q31 A;  4CJV A;  3O4Q A;  1EET A;  1RBV A;  4R5P A;  3ULE A;  4CEF A;  3ZT0 A;  5M1N A;  3KK2 A;  5AQF A;  3PSF A;  4RW4 A;  3DAW A;  4CJS A;  2ZGY A;  4CEO A;  3ZT1 A;  2ZM6 K;  3U9D A;  1IO2 A;  4O8U A;  3CM6 A;  4I9L A;  3MXJ A;  4KH5 A;  2P9I A;  2NRT A;  2BDP A;  1NGF A;  4LFB K;  1RDW X;  2HVH A;  4OKK A;  2P9P B;  2YJF A;  4BQL A;  1WOQ A;  3ZSX A;  4CED A;  1IKX A;  1HRH A;  3DLR A;  1D8Y A;  3O6W A;  3EL2 A;  4DSF A;  1VQ4 N;  3NF7 A;  1WSF A;  3WXL A;  4CF2 A;  4DQI A;  1RT3 A;  3J7Y P;  3TSU A;  3SQ2 A;  2GX9 A;  1IBK K;  2V7Y A;  4FLV A;  4CGG A;  1DKG D;  2B5J A;  4JKC A;  1FK9 A;  2E2Q A;  2KFN A;  2QXL A;  1TK5 A;  4BE2 A;  2HOE A;  5FLX O;  3SPZ A;  1JLE A;  4DS5 A;  4A59 A;  4H03 B;  5BPL A;  3VGL A;  4FSV A;  4JLH A;  1ZC6 A;  1ITG A;  1HYV A;  3L2W A;  4IKF A;  1S1X A;  4ZTJ A;  3K9J A;  4AQY K;  2ZGZ A;  3WQU A;  3LM9 A;  2HHH K;  4DV4 K;  4FZX C;  4KRF A;  4KHQ A;  1JCE A;  4GMJ B;  2W6K A;  5CE3 A;  4PA1 A;  2OPR A;  1N36 K;  2Q0R A;  4FJ8 A;  3ID6 A;  2NZT A;  1U45 A;  3O9Q A;  3KKR A;  1HNZ K;  1O13 A;  1RDB A;  4KHU A;  4CBX A;  2WOM A;  4B1U B;  2KHO A;  4DV1 K;  2XY7 A;  4ELU A;  4CER A;  3NGY A;  1QTM A;  1VSL A;  2QM1 A;  2I7N A;  4DLE A;  4EZ9 A;  1YTA A;  1YUW A;  2WTU A;  3CJA A;  5HRP A;  4LH5 A;  3J80 O;  2ZJR L;  2QW9 A;  3C7N B;  4UQG A;  1WBD A;  5BRF A;  1KXP A;  4DR5 K;  4H0Y B;  4NLC A;  2HHS A;  4DWI A;  2D0P A;  4Q0B A;  4JKD A;  1OH8 A;  3VN5 A;  4IEI A;  3WEE B;  1Y97 A;  3KK3 A;  1LW0 A;  4GKK K;  3BF3 A;  1J6Z A;  2YNI A;  3HP9 A;  3ZET B;  3TAF A;  2Z1J A;  4BRO A;  1LV5 A;  3QIP A;  3OYF A;  3VOV A;  4BQZ A;  4DR1 K;  4NLB A;  4NYF A;  3QET A;  3NMU A;  4CJK A;  5LJW A;  3SPY A;  2KLA A;  1HJO A;  5JMV A;  1YHQ N;  2HF3 A;  1TVR A;  2Q0U A;  3NAE A;  3D0P A;  4YOT A;  3IG1 A;  3L6Q A;  4BE1 A;  2VG6 A;  2KW4 A;  3SBG A;  3ULE B;  4E19 A;  2AP1 A;  3O3G A;  1MWK A;  1DGK N;  2XHB A;  2QI2 A;  1QSL A;  4JEP A;  5AQG A;  2G8I A;  3O80 A;  1S1T A;  1C1C A;  2Q3S A;  1HQE A;  4KH4 A;  4BRM A;  5AQI A;  3MDQ A;  2RKI A;  2FBV A;  2W40 A;  3AVJ A;  3A5O C;  3MED A;  3OW2 M;  5F2R A;  1KLN A;  4FK2 A;  2P9I B;  1C1A A;  1DEJ A;  2WBN A;  1VQ6 N;  1YTU A;  4CZF A;  3TPQ A;  3V4I A;  3OYI A;  3VF6 A;  4BRG A;  3E9L A;  1VQK N;  1U47 A;  2QWP A;  2E88 A;  4JI0 K;  3C6T A;  3QEV A;  3M5R A;  1N33 K;  3QIC A;  1VSJ A;  1GLE G;  2BGG A;  3PO5 A;  3U3G A;  2NRW A;  3L2V A;  3WT0 A;  5HRS A;  4JI3 K;  1RBT A;  3K5O A;  2E4L A;  3EEQ A;  3AVB A;  3QML A;  3TAR A;  1HR0 K;  3O9S A;  4LF8 K;  3K9K A;  3LPU A;  2FF3 B;  4YOV A;  1YJN N;  4PQU A;  2OYQ A;  4WYB A;  5J2N A;  4PUO A;  3ZSY A;  1K8K A;  4B3O A;  2F9W A;  4FLY A;  2G8V A;  2HHX A;  4NCB A;  1LOT B;  2NRH A;  2OPP A;  1A5W A;  1T03 A;  1S72 N;  3VEX A;  3MN5 A;  4K42 A;  4ISE A;  3SQ0 A;  1Q86 O;  1VSE A;  1WLJ A;  2OCE A;  4H5W A;  3TAB A;  1IKW A;  5FPN A;  1YT3 A;  2E2O A;  5EOY A;  3SJH A;  3HT3 A;  3S41 A;  4FLW A;  2B6A A;  3QEW A;  5AQS A;  3SUP A;  4O55 A;  3L8B A;  1F21 A;  2VCP A;  3KLH A;  4GVM A;  1QE1 A;  4U7B A;  1WBB A;  1U04 A;  2PY5 A;  2VYP A;  3O3H A;  3OA9 A;  4H0V B;  4BWJ A;  1VK0 A;  2FC0 A;  4MDB A;  3P83 D;  3THW A;  3I0R A;  4TSX A;  2RPI A;  4IOC L;  3PSI A;  3S3N A;  5HLF A;  3WNG A;  5JVG L;  1BU6 O;  1CZB A;  3A8Y A;  1S9E A;  1E4F T;  4CEE A;  4C1N K;  5AQV A;  2Q97 A;  4RW9 A;  5ADX H;  3V9S A;  4JV5 K;  1MA9 B;  2E20 A;  2HBJ A;  3S3M A;  4O4G A;  4ILG B;  5AQM A;  1TUY A;  1KVB A;  2FBT A;  2YX6 A;  1I94 K;  4OPJ A;  4O0J A;  3AVM A;  3MN7 A;  5CHI A;  2FSK A;  4EIA A;  4RCH A;  3HPH A;  2GUP A;  3HTV A;  4BY9 C;  2F8T A;  2X74 A;  3PX6 A;  2ATQ A;  4E1J A;  3HOS A;  4BGB A;  3KHY A;  1BIS A;  2RF2 A;  1TKD A;  1EP4 A;  2FLO A;  4BG8 A;  1HNX K;  4O0I A;  3LZJ A;  4DV5 K;  2YNG A;  4HHT A;  3T1A A;  3DLE A;  2YHX A;  3HBT A;  3ENH A;  1Z05 A;  3PO4 A;  3J7Z O;  3H1Q A;  4YOW A;  1NK4 A;  3CCJ N;  3T69 A;  4FM2 A;  1ZBF A;  3LAM A;  4JKB A;  5AZJ A;  4A2A A;  4GVE A;  2A3Z A;  4CIF A;  4CCH A;  5BR8 K;  3KLI A;  4GW6 A;  3ZSW A;  4F4K A;  2JWK A;  4V19 S;  4DUY K;  3SBT A;  3PUF A;  1HYZ A;  5ELZ A;  4ICL A;  1WSE A;  3NCI A;  5J2M A;  2IOC A;  3O8M A;  4LSN A;  4FJG A;  4CK2 A;  2HHU A;  1IKV A;  3K5L A;  1QZ5 A;  3VQ5 A;  5LY3 A;  4OLA A;  3OYG A;  4OJR A;  4U67 L;  4RW7 A;  2QKK A;  3VEZ A;  4PKH A;  4B9L A;  1ZBI A;  4JN4 A;  1S6P A;  4M63 C;  4H0O A;  4KHP K;  4HTU A;  4C8M A;  3VA0 A;  4GV6 A;  4Y0W A;  1N6Q A;  4JKE A;  4FJM A;  2F8S A;  2UUA K;  1IKY A;  2E2N A;  3K5N A;  4CK1 A;  3CM5 A;  3CER A;  4JK7 A;  3AO4 A;  5FDL A;  3DLH A;  4KHS A;  2O8C A;  2A40 A;  1HPZ A;  5M1F A;  3CFP A;  1ZBL A;  4L3Q A;  4CFC A;  2ZWH A;  4H0X B;  3JAM O;  4DU4 A;  4BWM A;  4HUF A;  3NVK A;  1SS6 A;  3LP0 A;  2HND A;  2OPQ A;  5KPR A;  1TV6 A;  2P51 A;  3NH0 A;  4AF1 A;  3H08 A;  1RT6 A;  4WFN L;  1IG9 A;  3AO3 A;  4H0T B;  4FWQ A;  1N8R O;  1X3N A;  1NGJ A;  1VSK A;  1FW6 A;  4FZZ A;  3FZL A;  2P1J A;  5FPE A;  3CJC A;  2X6S A;  4NXN K;  4BRL A;  1JLC A;  4BR0 A;  2F96 A;  3THW B;  1RTH A;  3H46 O;  1NK0 A;  4DTN A;  5LJV A;  4DTP A;  4FJ7 A;  5BN8 A;  3SNN A;  1RNH A;  1RT4 A;  3O4N A;  3R6M A;  5C12 A;  2BTF A;  3ASM A;  2HHW A;  4K41 A;  3VES A;  3TAP A;  3BEX A;  1NLV A;  3I55 N;  4JKG B;  2ETJ A;  1W2B M;  1BQM A;  3VQQ A;  2NRX A;  1DLO A;  1QZ6 A;  3KK1 A;  1TL3 A;  1LW2 A;  1ATN A;  1UOC A;  4ISF A;  3ITH A;  4EZ6 A;  5JS2 A;  4C23 A;  1IG8 A;  2QEX N;  4GKJ K;  1NMN A;  3ZT2 A;  4DR4 K;  1NK8 A;  5AQT A;  5HRR A;  4O5F A;  1HJR A;  5JS1 A;  2FF6 A;  4PL7 A;  5CY4 A;  2P9P A;  4KV8 A;  4WFA L;  2EWS A;  3JXU A;  1DTQ A;  4QCL A;  3RR8 A;  5AZJ B;  4DQS A;  1RDA A;  1Z26 A;  2I5J A;  4CZJ A;  1KCF A;  3IDH A;  5BR9 A;  4IFY A;  4M3W A;  1RGI A;  3KWG A;  1KD1 O;  4QS8 A;  1RTD A;  3UE5 A;  4DTM A;  2NRZ A;  3LDP A;  3SZ2 A;  3I33 A;  5AQP A;  4YY3 K;  2YHW A;  1L3V A;  1VAZ A;  1ZXO A;  4DSJ A;  1MDU B;  5KPT A;  1NKB A;  3PY8 A;  4PL8 A;  5C2D A;  5LL6 Z;  3AGK A;  2FBY A;  1TUU A;  1A5V A;  3OYB A;  3BP8 A;  1R59 O;  2DFF A;  3K5M A;  4B3T K;  2Z1H A;  2QTD A;  4BR2 A;  3S3O A;  1TYQ A;  4CGH A;  3QFU A;  4NYN A;  2A41 A;  4L8R B;  3FZF A;  3FLC O;  4BRH A;  2YI1 A;  1NGB A;  4BRI A;  1XHX A;  4KB0 A;  3KLG A;  1IBM K;  3OY9 A;  4BRE A;  1NJY A;  2O8C B;  1ASU A;  3AVA A;  4FO0 A;  4XIU A;  1GOA A;  1SV5 A;  4HWI A;  3TAN A;  5SWM A;  3W3D A;  3KWI A;  4Y1D A;  3SAF A;  2UUC K;  3C7N A;  2NRR A;  1HUX A;  4DV3 K;  3ZEU B;  1M90 O;  4JI8 K;  2GV9 A;  4FM0 A;  2KQ2 A;  3IMX A;  3KD5 E;  2GEM A;  1WSJ A;  1KVA A;  3ZYY X;  1KLM A;  4ISG A;  3ZET A;  3MWP A;  3KZB A;  2G8U A;  2DY4 A;  3NF6 A;  1VSD A;  3HK2 A;  3L3V A;  3HM8 A;  4FWN A;  3AAP A;  4JK8 A;  2OAN A;  3CPW M;  5DM6 L;  4IDH A;  1JLQ A;  2CH5 A;  1WAJ A;  1NGA A;  5M1O A;  3MEG A;  2IVN A;  2O8F A;  3RMD A;  2NRV A;  3LP3 A;  3AO5 A;  5EY4 A;  1RT5 A;  3R3L A;  1ATR A;  5J2Q A;  2HHV A;  3DLG A;  5KQD A;  1VQ5 N;  1D4X A;  2YKN A;  3VQ7 A;  2O4I A;  4E7J A;  4JI6 K;  4AHU A;  3JYT A;  3MXM A;  5CR4 A;  2QKB A;  1NK5 A;  3NGZ A;  4EP5 A;  4KI6 A;  3CCV N;  3VEV A;  3WNE A;  4CJ5 A;  4BR5 A;  4GNI A;  4BC3 A;  3OYK A;  3PX0 A;  4I6M A;  1GLA G;  4CZK A;  1HYS A;  3ZSQ A;  1T8E A;  4E7K A;  4FJJ A;  4ZHR A;  2J4R A;  3BZK A;  4BRA A;  1XWL A;  4MFB A;  2WC9 A;  1NWK A;  1RIL A;  3V9U A;  2I7P A;  4JYA K;  3ULD A;  4RW6 A;  3U6F A;  1R0A A;  3PV8 A;  3TAM A;  4CEB A;  2KTQ A;  3OBW A;  1NGE A;  3U9Z A;  1QQO A;  4DTO A;  1B9D A;  1UAX A;  4RG8 A;  4Z4G A;  4B9T A;  5GIN A;  4DF4 A;  3AAQ A;  3HJF A;  1S1W A;  4JK9 A;  3QES A;  4FXD A;  3LDQ A;  2V52 B;  3CQY A;  4DR7 K;  3AVH A;  1UWB A;  4MO5 A;  3CCM N;  1WSH A;  3IAY A;  1TYQ B;  4K43 A;  5GAH P;  5FRN A;  3MX5 A;  3S9H A;  1VQ7 N;  4CIG A;  2DFH A;  1NGG A;  1BG3 A;  1BWF O;  2O8B A; 
#chains in the Genus database with same CATH homology
 2VQE K;  4X62 K;  4LFA K;  2UXB K;  4GKK K;  4X65 K;  4DR3 K;  2ZM6 K;  4B3R K;  4DV6 K;  4DR1 K;  1N32 K;  3OTO K;  4LFB K;  4KHP K;  4B3M K;  4DV0 K;  4CVN E;  1J5E K;  2UUA K;  4DUZ K;  2VQF K;  4DR2 K;  3J7Y P;  4DR6 K;  4DV2 K;  4JI6 K;  1IBK K;  4K0K K;  4YY3 K;  4NXM K;  3J81 O;  4JV5 K;  4DV7 K;  4YHH K;  3JAM O;  5FLX O;  4LF7 K;  1HNW K;  1XNR K;  1I94 K;  3T1Y K;  5LL6 Z;  1XNQ K;  4JI2 K;  5AJ3 K;  2E5L K;  1FJG K;  1XMO K;  1XMQ K;  4B3T K;  4AQY K;  5IWA K;  2F4V K;  4JI5 K;  4NXN K;  3T1H K;  2HHH K;  4DV4 K;  4CW7 B;  4JI0 K;  4JYA K;  4LF9 K;  1N36 K;  1N33 K;  1HNX K;  1IBM K;  4DV5 K;  1IBL K;  2UXC K;  4B3S K;  1HNZ K;  4JI3 K;  4OX9 K;  4JI4 K;  1HR0 K;  4DV1 K;  4LF8 K;  5BR8 K;  4X66 K;  4JI1 K;  5A2Q O;  2UUC K;  2UXD K;  4JI7 K;  4DV3 K;  4V19 S;  5LMN K;  4DR7 K;  4DUY K;  4JI8 K;  4LF5 K;  4X64 K;  1N34 K;  4LFC K;  3J7A P;  5LMU K;  3J80 O;  2UUB K;  2UU9 K;  4GKJ K;  5IT9 O;  4DR5 K;  4LF4 K;  4LF6 K;  4DR4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...