4DV2K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv2K00
3J7AP 4YHHK 1HNWK 4DUZK 4X62K 3J7YP 4DR6K 3J81O 4LF7K 4LFBK 4B3RK 4JI1K 1I94K 4K0KK 4X65K 2UUCK 4KHPK 5IT9O 2VQFK 4JI4K 4LF9K 4LF6K 2ZM6K 2UXBK 3T1HK 4LF8K 2UUBK 5LL6Z 5LMUK 4JI7K 4JI8K 1HNZK 4B3TK 4LFCK 1N36K 4DV3K 1HR0K 5BR8K 4LF4K 4CVNE 4DR5K 1J5EK 2F4VK 3T1YK 1N33K 4DV0K 4JYAK 4NXMK 4AQYK 5FLXO 4YY3K 2UXDK 1HNXK 1XMOK 4DV4K 4CW7B 1IBLK 2E5LK 4LF5K 2UUAK 3JAMO 2UU9K 5A2QO 4DV6K 4DR2K 4DR3K 4DV5K 4GKJK 3J80O 4JI6K 1XNQK 4GKKK 4V19S 4OX9K 4JI5K 5LMNK 4JI3K 1XNRK 5IWAK 1N34K 1IBKK 4DR1K 4DV7K 4B3MK 4LFAK 4X66K 4DUYK 4DR4K 4DV1K 4NXNK 4B3SK 2UXCK 1FJGK 1XMQK 4DV2K 5AJ3K 2HHHK 4DR7K 1N32K 3OTOK 2VQEK 4X64K 4JV5K 1IBMK 4JI2K 4JI0K
chains in the Genus database with same CATH superfamily
3PO5A 1GOBA 2YHWA 4E3SA 3DLEA 3H1VX 4CEDA 4LSLA 4DR6K 3KZBA 3QBWA 3K57A 3GL1A 1BUPA 3OYLA 4BR7A 2Q0RA 5AQIA 2FSNA 1JLEA 4WE1A 4C1NI 4FPBA 1OKJA 3ZT3A 3TTCA 4CFBA 2XO7A 3OBYA 3ZSOA 4AHCA 3FE1A 3NBPA 2E1YA 4IO9L 4IOAL 3WT0A 3T1HK 2Z1IA 1HKCA 2WC9A 3AO3A 2HVHA 4A2AA 2OPSA 4B9UA 5AZJA 2BANA 4B9LA 4AHUA 3VQ4A 2HNZA 3SMPA 1J5EK 4FSVA 2GELA 4I9QA 1TVRA 4DFKA 5I3UA 2E8AA 4ZTJA 4JYAK 2LSNA 4FWOA 2QA4N 3GOIA 5AQTA 1HJOA 2HW3A 2F96A 3IFRA 1QSYA 3P1GA 3PX4A 1MU2A 1RGIA 3EZ5A 3M3ZA 1WSHA 4IEIA 1OVQA 2HBMA 2P9UA 2UUAK 4AHSA 2PYLA 4N5SA 4EP4A 1NKEA 1RTJA 2KZMA 5BPNA 1RBTA 4CF2A 1HJRA 4JS4A 3P39A 4M3WA 3CPWM 3QDKA 4W5RA 2YNGA 3MAQA 3TSQA 3HP6A 5AQVA 4K25A 2P9IB 1REVA 3VTIA 4R79A 3ATVA 4A5BA 4A5AA 3SUOA 1CXQA 1BA0A 3CCEN 1N6QA 4B3MK 4LFAK 5CY4A 1JL1A 1KRPA 3ISNC 2KZZA 2OTJN 4B3SK 4OPKA 2FC0A 5AJ3K 4KTQA 3MDQA 1ZYQA 3E66A 4I2QA 3SK3A 4B9SA 1TL3A 3ZSRA 1LWEA 5CE3A 2WUSA 2P9LA 3HPOA 4JI2K 1VQNN 4OO1J 3D45A 1HNWK 4FJGA 3EKSA 4CZFA 4YOWA 5J2NA 1WB9A 3HPGA 3S3MA 2O8FA 1J9AA 2P9NA 2DFEA 5C15A 4JKFA 4B9MA 2OYQA 1DEJA 4E19A 2KFNA 1YI2N 2Q0UA 1NM1A 1JLQA 2A3ZA 3M8RA 4PL7A 4H0TB 3AVIA 3FFKB 4L8RB 4KH5A 2HNDA 3RSEA 5CZ2A 3QETA 1U45A 3OYEA 3K2PA 3O9UA 3LDSA 3V81A 5CR4A 1S22A 2ETJA 3ZT1A 4FWNA 3C7NB 2E88A 3CERA 3D2EB 3HM9A 4KPYA 1BG3A 4FOEA 3WNGA 2O8BB 1KFSA 1RT1A 3ATUA 1VRTA 4DTNA 4ISGA 2KW4A 1BDGA 1X9WA 4H8KA 4EAHD 4M45A 3H3NO 3ULEB 1RDAA 5FPDA 3S41A 3LDNA 2ZWHA 1JCGA 1ESVA 1IBLK 3PSFA 5AQKA 3HTVA 3SQ4A 3MX5A 1ATSA 4W5QA 3TTFA 4MDBA 3VERA 3MCPA 3V1RA 3U9DA 1T05A 4WQ4A 4GMJB 1BHLA 4BQLA 3WEEB 1IKVA 1WSGA 4JKGB 3LZIA 3WNFA 1S1VA 3RVCA 2E6LA 1JLGA 3AA4A 1N8RO 5HRRA 4Z4FA 2YHBA 2VG6A 5MLCQ 1XNQK 3MEDA 3H45C 1VSMA 2GX9A 3D2FA 3CC4N 1GLFO 4V19S 4FLWA 3BF1A 2CH5A 3LWLA 1XNRK 5CYQA 1A5WA 4FYDA 3THVA 1EETA 5BPMA 3RMBA 1T03A 2EWSA 3K58A 3O1WA 1S1UA 1RDUA 2AP1A 3DMJA 4LD0A 4FK2A 4NYFA 1W97L 1MA9B 2YX6A 1TKDA 1BU6O 1QZ6A 3RMAA 3P5JA 2HHHK 2GTDA 1JL2A 4CGHA 1VQPN 3QEPA 3OHRA 4MLHA 4JV5K 1C0MA 4H5VA 4ELTA 4CJUA 1BISA 3OYMA 1RTIA 2D1KA 4O8UA 4FJ9A 3SI6A 3CPEA 3VQCA 1T6CA 4FM0A 3M6GA 3NMUA 4OPAA 1HNIA 1RBSA 3F73A 3OBWA 4QS9A 3PUFA 1QSLA 5HROA 5HRSA 3CCRN 4LF6K 4A57A 1VQON 4IZ9A 2ZM6K 4XH5A 1BCMA 3E9OA 1C0UA 2CGKA 4CE9A 4FWRA 2FSJA 3A5NC 4CJPA 5JS2A 3THWB 1QHTA 1N36K 3MECA 1LCUA 4CHPA 3VQAA 4C8OA 4H0XB 4H5WA 3VQ8A 2FBXA 3OYBA 1YJWN 3G10A 4JD2B 3DI6A 3KKSA 4GY2B 3LP2A 4BRPA 3V9SA 5J2QA 4CJQA 3L8BA 3U3YA 3C6TA 4NCAA 2O8EB 2V52B 5T7BA 3VEXA 4GV9A 4FPAA 3WXLA 3QEVA 3C0BA 1HX1A 4GV6A 4U7BA 3ID8A 2ZJRL 3D0PA 1RCHA 3KWIA 1IO2A 3CI5A 2KLAA 4WYBA 4DV6K 3CC7N 1IJJA 4FWSA 2PBDA 1ZBIA 2HVIA 4KB1A 4ILJA 3IS9A 1GLCG 3NVMA 2YJFA 4JI6K 2JLEA 3TAFA 4YDUA 5LMNK 1CZAN 3KLFA 1NK0A 4C8MA 3KWGA 4CJ7A 2HHXA 1RT5A 2O8CA 2D0CA 1RTDA 4X66K 3U9ZA 4PHTX 4NXNK 3MXJA 2UXCK 1RT2A 1VHXA 3LAKA 3O1BA 4B1ZA 3PIOL 1HRHA 4A61A 2P1JA 5CZ1A 4CGGA 4Y1DA 3WXIA 1SKWA 1B9FA 2ZJPL 3OYHA 3QEIA 2F9WA 3F9MA 4C8KA 3VN5A 3A5OC 1TAQA 3HJFA 4M3UA 3CMAN 3ZEUB 4O4GA 4M3TA 3KLIA 1NBWA 1SUQA 2ATQA 4CZJA 3FR0A 4YORA 4J2DA 4E7IA 1X3MA 4CJ5A 2QXFA 1ZC6A 2P5OA 3SV4A 2UXBK 4BC5A 4RW8A 1C6VA 3AVKA 4JI7K 4JI8K 2HBJA 3ZSQA 3DLHA 4C1NK 3ZX2A 1UWBA 4AM7A 3QLHA 3AVHA 4F2SA 1RDBA 3SMSA 4FWMA 3AV9A 5AQZA 2D5RA 2F7TA 1KSPA 4BG8A 2D0OA 5LJVA 3PV8A 4CJ3A 4ID5A 3PSIA 2V7YA 4I6MB 2HB5A 4OPHA 1CZ9A 2E5LK 1LAWA 1CXUA 4FOIA 2NRZA 5BN9A 4FK0A 1S6PA 5AQOA 3VQQA 5FRNA 4HHTA 1NGFA 3TU5A 2YNHA 2P9IA 1L3TA 3CCUN 4FVUA 1FKPA 3VGLA 4BR9A 3MEEA 2W6LA 3ENOA 1ZBFA 3NVKA 2RKIA 3O6WA 3KJVA 3UB5A 1H1VA 1J5OA 1Z26A 3K59A 3I33A 2BTFA 2JWLA 2OCEA 2VWBA 4DTMA 3TARA 2KTQA 2B6AA 1F21A 4BVOA 5LJWA 4X64K 3THYA 3VGMA 1ASVA 4DUZK 2IIRA 2G8IA 1NOZA 4FWLA 2OA8A 1KVBA 2OTLN 4CHYA 1XC3A 4IBNA 2ASPA 3A2FA 4MFBA 4JK7A 3VEVA 3SCXA 1SL1A 1WAJA 1FKOA 4O0IA 3NCIA 4GVMA 2DFFA 4CIFA 3THXB 2F8TA 4CZMA 1TK0A 2FLOA 3QBXA 4LF9K 5B8HA 1L3SA 1NGGA 5ELZA 2ZE2A 1VSHA 4NO7A 3L2RA 5LL6Z 4KHWA 4OKJA 1NGIA 3O3FA 4R5PA 4E0DA 1Z6RA 1XQSC 4H5NA 3LM9A 1ILYA 3C7NA 2G8HA 3D2EA 4BRIA 4FO0A 2O8BA 4DV3K 1YVNA 3OA9A 4DR5K 1DKGD 4JN4A 5BN8A 4Y0WA 2QKBA 3U8XA 5AQRA 3ULEA 3IAYA 4PA1A 1EX4A 4FWQA 4Z4HA 3RWUA 4GVEA 4DSLA 3WXJA 1ZBUA 3CJ7A 2UXDK 1Q8IA 4BQZA 4CW7B 3OS2A 5AQUA 4CJVA 4E7LA 4DTPA 1SL0A 1Q86O 2NRTA 4DTRA 1QZ5A 4O5FA 4H0YB 4KAZA 5EY4A 5TKYA 1D9DA 2QEXN 1GOAA 3J80O 3DAWA 4H5TA 1YVUA 1UA1A 1TK8A 4CGJA 4CJKA 4OLAA 1J53A 4E7KA 5KGWA 4KHNA 5AFUA 4N41A 5KQDA 5AQMA 3TWHA 3S3NA 4EHUA 4DV1K 1NK7A 2YV0X 1XMQK 4DV2K 2PY5A 2KQ2A 3D7EO 1EXQA 3VEZA 2Z1GA 2W42A 4PWDA 3G71N 3O3GA 4A62A 1RBVA 1EO1A 4ELUA 1YUWA 1QS4A 4MO5A 1K6YA 2HHWA 1JLBA 1RTHA 3TANA 1OH6A 4DFJA 1EKEA 3CJCA 4B1UB 3DLRA 2HMPA 2QWNA 4JNEA 4CF8A 4J2BA 4RG8A 4KHPK 4DFMA 1ATRA 3IMXA 1C1BA 1XUPO 3TSPA 4CF0A 4CF1A 1W9HA 1D4XA 3CJBA 1E4GT 4B3OA 4DS4A 1NGAA 2W6KA 5HP1A 3OYFA 2IAJA 3TAGA 3O8MA 1SAZA 4M3YA 1RDWX 4CJWA 2WOMA 4TSXA 3THWA 4JS5A 2IDOA 5KRTA 2ASMA 4Z4EA 3IKMA 5K14A 1NGDA 4KHYA 3AARA 4FVMA 4JD2A 4HUGA 1HMVA 4AILC 3OYGA 4N56A 3E01A 4H4MA 4CVNE 4IO8A 1FXXA 2ZGZA 3FZMA 1RT7A 3AVCA 3VF4A 3BP8A 4BE2A 3R9PA 1QVGM 4DQQA 3HL8A 1YJ9N 1EQYA 3VESA 5LY3A 1CLQA 4FLYA 3A5MC 3LL3A 5JVGL 4CJSA 4FLUA 3EL2A 1VK0A 3GE1A 4KRFA 4DTOA 3A8YA 4CESA 1YJNN 4UY8O 4XH4A 5EOYA 3LPTA 2Q97A 4W5TA 3ZCMA 4CEEA 4FK4A 4LSNA 2WFBA 4HTLA 3O3HA 1BL3A 4CD3A 1HPZA 1OH8A 1SL2A 4FJ5A 1QQMA 3ZSVA 5D3GA 3T3FA 3QIOA 4CZKA 3IDHA 2EX3A 4DFPA 4M41A 3S9HA 1S72N 1NK6A 2AA4A 4YFUA 3Q7CA 4WQ4C 3LPUA 4LC9B 2QWMA 3VA3A 3HM8A 4BWMA 3V9ZA 4BRAA 4GNIA 3CG7A 2HF3A 4PKHA 1N32K 2G8VA 3G6EN 2QM1A 2HBLA 3VQEA 2RF2A 4DSFA 2NRXA 4B1WB 4M7XA 3L6QA 3SJJA 3WQUA 5FPEA 3L3UA 1Q9XA 1ASWA 2GWJA 1LW2A 4QOZB 3AAQA 2ZQBA 3SJHA 4NYNA 4CZIA 2YJEA 3AO4A 4WQ5C 1D8YA 2DTUA 3EYZA 3VQ9A 3ZT2A 3TAMA 3KHYA 3HO1A 1NGEA 3CXCM 3WNHA 2X6NA 4M63C 5SWMA 1U6ZA 4OGCA 3U4LA 3NH2A 2XY6A 3K5MA 1BI4A 2QKKA 4NCBA 2NRWA 3D6RA 4FJXA 1SZ2A 1U2VB 3CJAA 3Q7BA 1YXQA 2Q36A 1UOCA 4DF4A 1NG9A 4DU1A 4M3XA 1S1TA 2E6MA 3BGRA 2HBKA 2Q31A 3QB0A 2GV9A 3L3VA 2BDPA 4Z4IA 4RTFD 4BRNA 5M1NA 3LP3A 4OKEA 4RW6A 4JKEA 3ZSYA 4WCEL 3E9LA 5AFUH 3VQBA 4Z4CA 3KK1A 2QI2A 4DTXA 3QNOA 4DQSA 3ZX3A 4BRDA 2HHTA 4FWKA 1Q18A 2IVPA 4OJRA 5FPMA 1O13A 2Y1IA 4KTWA 3MMVA 4BG9A 4OX9K 1XI1A 3O80A 5F1XA 1JLCA 1XHZA 4I2PA 3TABA 1QTMA 1BQMA 3KIOA 4OVLA 3WUHA 3P31A 2P9PA 5GIOA 1B9DA 2HHSA 4RWTA 1W2BM 5JICA 5EXWA 3SV3A 2XY7A 2UYTA 3NGYA 4O8KA 3ZSZA 4RCHA 2FF6A 1RFQA 3EO3A 2O4GA 3HI0A 4A59A 2A41A 3CCMN 3DJCA 2IVOA 2HHQA 4YHHK 4BDYA 3L2UA 3H08A 4BR5A 4LFBK 4PQUA 4KO0A 1RT6A 3ZT4A 4FLZA 3V9XA 1I94K 2B5JA 2UUCK 4RW4A 2DFHA 3PX0A 1IV0A 4CIGA 5AR0A 4CZEA 2VWJA 1X1PA 2Y1JA 3L2QA 3FZKA 3SUNA 4BRQA 4PKIA 1Q82O 3I0SA 1M90O 4Q0BA 1L3VA 5AQGA 4AHRA 1BGXT 3OVNA 5M1KA 1WSJA 3ZETB 2NZTA 5M1QA 1WSIA 3MWTA 3ZX0A 3MXIA 4KTZA 1T7PA 4DTUA 4CCHA 4YOXA 4PUOA 4RW9A 3VA0A 4E89A 4CK1A 4JRPA 3TPQA 3HXMA 4FZYA 2QWLA 3GG4A 1X9MA 2R7YA 3AA2A 4H5RA 3CCVN 1HQEA 3NH1A 2J4RA 4JKDA 2RN2A 3VQ6A 1GLBG 2Q1NA 3CFRA 3QICA 5C2FA 4CJFA 1JLAA 1KFDA 3DXMB 4BGBA 1K8KA 4BROA 3F5TA 4JHDB 4Y1CA 3P4IA 3JSMA 3A0IX 1SKSA 1D9FA 2YKNA 4B08A 4B9TA 1OH5A 2JWKA 4PKGA 5J1EA 4XEIA 4WFBL 5KGXA 1VRUA 4FZZA 3VF2A 4CEZA 1NWKA 4IKFA 3AGRA 5JLFA 5AZIB 1GLLO 4LY7A 4KH4A 5IWAK 3AVJA 3F9KA 2P9SA 1V4TA 1HPMA 4BRGA 3HVTA 3BUZB 3OW2M 1ZBHA 1DTTA 4BREA 1SS6A 1C0TA 2H3GX 4DG1A 4BACA 2F8SA 3HBTA 3SBTA 3FZFA 4CIEA 4YOTA 4ZTFA 1K9MO 1GLAG 5DK5A 2GUIA 4OPJA 4B3RK 4YOUA 4H0VB 1X3NA 3CCSN 5AZJB 3RRHA 1S5JA 1WN7A 4FJ8A 2BGGA 2D0BA 4ICLA 5C24A 4JI4K 3V9UA 2FBTA 3MWPA 4FZXC 2E2PA 4FJLA 2YNFA 4G1QA 4N76A 4E1MA 2A6AA 3V9WA 1VQ7N 1NK9A 3VPZA 3P83D 4HVJA 4CHZA 1LWFA 4FL9A 1VQLN 4AM6A 2P9UB 1C0FA 2HOEA 4LF4K 4CJLA 3NF8A 2F4VK 1KCFA 4QS7A 3H6EA 3R3LA 2OPQA 5M1FA 4KREA 2BUPA 4WFAL 1TUUA 5KPRA 2PFUA 4YY3K 2G8UA 2FBVA 2E1ZA 4GV3A 1NGJA 3VEWA 3CC2N 1VQ6N 3AGKA 2QTDA 2G8FA 4IJNA 4OKKA 4CEOA 3CM5A 4CEQA 4JKHA 1C1CA 4M7YA 3ZLJA 1DGKN 3FLCO 1BIZA 2RE2A 3SUPA 3AVGA 5M1OA 3I0RA 3F2KA 3NH0A 4FXDA 1S3XA 5AQSA 1S9EA 3AA5X 4F4KA 2DY4A 1NJXA 3VQDA 1KVAA 1S9GA 2I7NA 5AQYA 4DTJA 4L3QA 1UAXA 2QWQA 4DMNA 3JXUA 5F0XA 1P90A 1I3AA 5BPLA 1YHQN 3LDOA 3KK2A 3MXMA 5I42A 4FJ7A 1BQNA 4UQGA 2YKMA 1FJGK 5AQWA 4DSJA 3AVNA 3CCQN 3M8PA 4BGAA 4DR7K 3QERA 4HWIA 2VQEK 4MO4A 1NK5A 3O4WA 3UKUB 2E20A 2IGIA 4IOCL 4BVPA 2Z1HA 1VSKA 1VQ9N 4CHOA 3W0LA 3J7YP 5DM6L 2XRIA 3BDPA 3SBGA 5AQPA 3RSEB 2PZSA 3EZWA 2P5GA 4LF7K 2I5JA 1RBRA 3HYFA 1KTQA 4EFHA 4K0KK 4IFYA 2X74A 1KXPA 3SPZA 2VYPA 3VETA 2G8KA 1WBDA 2VG5A 3LP1A 4B9VA 4XH1A 3OYCA 2OPRA 1XHXA 3DXKB 3DLBA 1IKYA 4DSEA 1KAYA 2UUBK 2GUPA 3N4PA 4CFDA 1V4SA 4H4OA 4CFCA 3SPYA 1B92A 3IRXA 1VSEA 3QEWA 3VENA 4CK3A 3VF6A 3VQ7A 4BRCA 3K9KA 2WBNA 4JKBA 4FCYA 1U04A 4CGDA 3OY9A 1NGBA 5C12A 4DKWA 1TKXA 3M8QA 4AQYK 3VTHA 1JXBA 3BZCA 4IG0A 1TAUA 3D2FB 3CJ1A 3GBTA 5JLHA 3K5LA 4QCLA 4K8ZA 2IC3A 3JYTA 3HSCA 2UU9K 3MEGA 5HOOA 3QO9A 2QWRA 4DR2K 2ASOA 3VOVA 3MN9A 4BR4A 4CZHA 3G4SN 2IVNA 4DV5K 2NRVA 3B8AX 4PL8A 3J8AA 1VQKN 3EY1A 1K73O 1T3VA 3RMDA 3UIQA 5GIPA 2RPIA 3L2VA 1VSFA 2A1SA 2NRRA 5AQLA 5E84A 3NF9A 3HVRA 3KKRA 4GW6A 3WEEA 3CQXA 4JKGA 3VQPA 3SLCA 2GWKA 1MWMA 3AO1A 2NLXA 3G25A 3CMEN 1NNEA 1YAGA 3L0QA 2I7PA 3DYAA 3OTOK 4U67L 3ZSXA 2A5XA 5KPZA 3MX2A 3J7AP 3T7ZA 4ISFA 3P38A 5GINA 3IG1A 4DF8A 4N47A 1BCOA 2QK9A 1VQ8N 1Y97A 2FXUA 3TAPA 4QS8A 3M5RA 3CJ9A 5AQFA 1S6QA 4RW7A 2VQFK 1T44A 4EHTA 1VAZA 4DSKA 4HTUA 4J2AA 1EP4A 1HYVA 3ZETA 2YHYA 4F9OA 2JGUA 1KAZA 3QMLA 1HYZA 3CCJN 1FW6A 4IEEA 4KHUA 3AA3A 4ILGB 3FZLA 4BE1A 1GLEG 1ZBSA 4CF9A 1G15A 3T1YK 2W40A 1E3MA 4CERA 4FJIA 3TR8A 3MN5A 3CFOA 3HPHA 4DLGA 3C94A 4NB4A 1DLOA 5FDLA 4E1NA 5E26A 2QXLA 4FJJA 4YOVA 2A1RA 2PAVA 4CJEA 3S3OA 1ATNA 1NK8A 1NMDA 3EEQA 3NHGA 3WQTA 3LWMA 1NJYA 2B4JA 2O8CB 3QIPA 2IOCA 2WONA 3V4IA 1VSIA 1BWFO 1QQOA 2O8EA 5I9EB 1GLJO 4JLHA 4NCGA 3O9RA 1E4FT 5ADXA 4FW1A 3R1XA 2HSTA 5FROA 1KC8O 4FM2A 1QE1A 1IG9A 1XC9A 4DR4K 3I8DA 4K41A 4FLTA 5HLFA 1U4BA 3H3OB 1EWRA 4MLEA 4BWJA 1IH7A 4JKAA 4C8NA 3I55N 3LM2A 1YT3A 3SQ2A 4J2EA 1RBUA 1UA0A 4DWIA 2Q2RA 4IDHA 5C42A 1KAXA 1A5XA 1KVCA 2Q3SA 3K5OA 2VCPA 4JEPA 3SUQA 4JI0K 2PYJA 2O8DB 4G9ZA 2QWPA 3CCLN 1NKCA 5AQNA 3KLHA 4IDKA 4O5BA 1KQSM 1VSDA 5KPTA 3E9PA 1Z05A 2QW9A 3GDQA 3AVBA 4X65K 4DU4A 3ID6A 4ELVA 1XWLA 2KKZA 3C6AA 1WBBA 3OYKA 3ULDA 2OPPA 3LALA 1U49A 3A5LC 3O5BA 3FZHA 3WXKA 4LF8K 3LP0A 3EE9A 5KI6A 4H0PA 3ZSWA 2ZD1A 1HNZK 5E41A 4JAXA 3ZEUA 3SNNA 3T19A 4ILHA 4ISEA 4KHQA 3O9TA 3HOSA 1RDCA 5KQ8A 1LV5A 1ASUA 1NK4A 2YCHA 4DS5A 3U3GA 5FLXO 3PY8A 2NRHA 4C8LA 3NF6A 5HBMA 1ZXOA 4JKCA 4K42A 3HT3A 4DLEA 3CETA 4F8RA 1EWQA 2E4LA 1M1KO 3KD1E 1VSJA 4CEBA 3CQ8A 4YOYA 4WFNL 3LDQA 2YNIA 1O1WA 4I6MA 4HUFA 2FSKA 3G0ZA 3W3DA 4JI5K 1JCEA 1IBKK 4Z94A 3SQ0A 5AQXA 1TYQB 3SYZA 3THYB 4BDZA 1KD1O 3LAMA 3AVFA 4AF1A 2OZMA 4DUYK 4HCCA 4Z4GA 2E2QA 3O08A 1Q9YA 3LZJA 3TI0A 4IFEA 1VQMN 3DOKA 1W0HA 2CGLA 1LOTB 3UKUA 3T69A 4M3RA 2BE2A 3I8BA 2HHVA 1R59O 5H1SQ 4CZLA 1NGCA 2FF3B 4OLBA 3L4IA 4A2BA 2FBYA 4BC4A 1Y64A 2ITGA 2KFZA 3K5NA 3KLGA 3DXKA 4H03B 3HZ6A 2HMIA 2NUBA 3DOLA 1RILA 3MN6A 1NU0A 1P8ZA 3UKRB 4CEFA 4CGFA 5BREA 1WSEA 4E1JA 3VEYA 4YDUC 1TGOA 1YIJN 4AHVA 3KK7A 1VSLA 2V7ZA 5BR8K 1N5YA 2YI1A 3OS1A 1NOYA 3MCAB 3THXA 4DV0K 1X9SA 3HOTA 2P9KB 4FLVA 3ZT0A 3KVGA 1BO5O 3O4QA 4BRKA 4DHYA 5ADXH 3CFPA 1HNXK 4M42A 3BY5A 4MDAA 2VGMA 1TUYA 5J2MA 3VGKA 1FK9A 4LF5K 1MDUB 4BRHA 3JAMO 3QFUA 1NJIO 4WQ5A 4F3OA 3NF7A 4NLBA 3EN9A 1IKWA 5EX5A 3E1YA 3V1OA 4Z0UA 4FLXA 1RNHA 1BA1A 3CD6N 4CECA 3PLAA 2CGJA 4FJMA 1X9JA 3R8EA 4JRQA 1SQKA 4B8CA 3H1QA 3TAQA 1CZBA 3HP9A 1WOQA 2F9TA 4FJKA 2AJQA 3CF5L 5C0YA 4LH4A 1QHAA 3ALYA 2XY8A 5AQJA 2DPNA 5EVZA 3HRGA 1MWKA 1QQCA 3PX6A 1NJZA 4K43A 1TK5A 5GADP 3NFAA 3NE6A 1K8AO 1JJ2M 1J54A 4O44A 4ZHRA 4HCBA 4NLCA 2V51B 3AY9A 4EZ6A 3OJUA 2VGNA 4KFBA 3KK3A 1D5AA 5F2RA 1KLNA 1JKHA 4DQPA 5EU7A 1WSFA 3L2WA 1HLUA 1S1XA 1HUXA 2W41A 5IT9O 4BR2A 1BIUA 4BC3A 1YTAA 3MK6A 4KBOA 4O0JA 4DTSA 4KI4A 3EE8A 2ITMA 4IG3A 2E2NA 3NGIA 3C6UA 1Q7YO 2HF4A 1JLFA 3VEOA 3M1FA 3CM6A 3C6HA 2X6SA 5JS1A 3AO5A 4KKOA 2D4WA 3QESA 3QNNA 3J7ZO 3CYMA 4IJAA 3UE5A 2O4IA 4DQ8A 4JK9A 1S1WA 5DM7L 3HSTB 1N33K 5C10A 1HQUA 1U47A 1WLJA 3MN7A 1VQ5N 3DLGA 4NXMK 3ENHA 4HUEA 3ZYYX 1XMOK 1GLDG 4E7JA 1GOCA 2A40A 1SKRA 4FWPA 1DTQA 4BRFA 1L3UA 1YITN 2YHAA 1U48A 4J8FA 3LDPA 3DM2A 3DLLL 4DR3K 4OGEA 3K9JA 4GKJK 3L4QA 3DRSA 4EZ9A 1C1AA 4GKKK 3T1AA 3NGZA 4FW2A 1NJWA 4DV7K 3CHWA 4FM1A 5TKWA 2OANA 3AVAA 1TL1A 3KLEA 2NNWA 3DRPA 1YF5L 3OYDA 4CD1A 2OZSA 2HHUA 3C95A 3V1QA 3B6PA 5C2DA 4B9NA 4B1YB 3AVMA 4C23A 2O8DA 3OS0A 1IBMK 3CQYA 4W5NA 2P9LB 2WTUA 5BRHA 4X62K 3J81O 1HNVA 2IS3A 1SV5A 4JI1K 1BI4B 2VWKA 3U6FA 1DT9A 3TAEA 5JVHL 3EKUA 1TV6A 4ID1A 3N4QA 3CIPA 4DQIA 4M3ZA 3FFIA 1A5VA 5M1PA 1W7AA 2P9NB 3AVLA 3HK2A 2O8FB 3QFPA 1Z25A 1WAFA 4B9QA 4IOXA 5JMVA 3OYAA 1QSSA 4IXCA 1QQNA 4DCHA 5DMRA 3K0SA 2ZJQL 3ASMA 4H0OA 3O9SA 3SQ1A 1NLVA 1IG8A 2X78A 2EHGA 5LMUK 1IKXA 1RT4A 3RRGA 1KLMA 4CJ4A 1TKTA 4CEAA 4AH9A 5BR9A 3NAEA 4B3TK 4LFCK 4O55A 3VQ5A 1HR0K 3OJSA 1JXEA 3O4NA 1RT3A 3AO2A 1WUAA 4E7HA 5HRNA 3KD5E 4CZGA 3TTDA 2E2OA 1NKBA 1G99A 3BEXA 1WNSA 1VQ4N 5GAGP 1U2VA 3H46O 3DLKA 4JK8A 5AQHA 3WXMB 1TKZA 1L5UA 3NDKA 4EP5A 4CGIA 2GBZA 5KTQA 2P9PB 4BRMA 4F3TA 5BRDA 4FJHA 3DRRA 4LH5A 2VG7A 4CI6A 4B1VA 3AAPA 2GEMA 2BH1A 4BY9C 1TYQA 1ITGA 4PY5A 2ZF5O 1T8EA 3DWLA 1N34K 4DR1K 5GAEP 5KRSA 4QAGA 4CK2A 5BRFA 1NGHA 3SAHA 3BZKA 4CJTA 4F2RA 2XHBA 3OYNA 4I7FA 4BRLA 4DB3A 3QINA 4KH6A 1C0GA 3RMCA 3SAFA 4IFVA 4CFAA 3RR8A 4Q5VA 1HKBA 1I39A 2D0PA 4B8AB 4EIAA 4BE0A 2RHKA 3BF3A 4WF9L 4I9LA 2Z1JA 5J2PA 4KI6A 1QVFM 4BR0A 3QEXA 2CH6A 3UKRA 3M8SA 5CHIA 3SAGA 5GAHP 4KV8A 1OH7A 4FJNA 4W5OA 1ZBLA 4IWVA 3OYIA 2KHOA 1J6ZA 3OYJA 3C65A 1K8KB 1LAVA 1NMNA 2P9KA 3I56N 4BC2A 1YTUA 4DQRA 2D0AA 5SZTA 4CBXA 4DU3A 1JCFA 2QWOA 4XIUA 3B6OA 2P51A 5C25A 4DV4K 1LW0A 5HL7L 3RTVA 3LDLA 1R0AA 3FGUA 2P9SB 2A42A 5A2QO 3TSUA 1OVYA 3O9QA 4CBUA 1Q81O 4CHNA 4CHQA 2G8WA 5FRMA 5AQQA 3IUCA 2YHXA 2ZGYA 4BDPA 4K8XA 4AHTA 1BOTO 5FPNA 3DXMA 4JI3K 4B1XB 5CYMA 3RR7A 3SZ2A 4JHDA 3PIPL 1HKGA 1HYSA 3VMFB 3ITHA 3ENBA 4CBWA 2XY5A 3KTQA 2HNYA 4MQ3A 1T6DA 3PO4A 1LWCA 3JS6A 3LANA 4KB0A 3R6MA 3WNEA 4DSIA 4CJRA 5HRPA 5AZIA 4YNQA 3V6DA 1RDDA 4KHSA
chains in the Genus database with same CATH topology
3J7AP 4YHHK 1HNWK 4DUZK 4X62K 3J7YP 4DR6K 3J81O 4LF7K 4LFBK 4B3RK 4JI1K 1I94K 4K0KK 4X65K 2UUCK 4KHPK 5IT9O 2VQFK 4JI4K 4LF9K 4LF6K 2ZM6K 2UXBK 3T1HK 4LF8K 2UUBK 5LL6Z 5LMUK 4JI7K 4JI8K 1HNZK 4B3TK 4LFCK 1N36K 4DV3K 1HR0K 5BR8K 4LF4K 4CVNE 4DR5K 1J5EK 2F4VK 3T1YK 1N33K 4DV0K 4JYAK 4NXMK 4AQYK 5FLXO 4YY3K 2UXDK 1HNXK 1XMOK 4DV4K 4CW7B 1IBLK 2E5LK 4LF5K 2UUAK 3JAMO 2UU9K 5A2QO 4DV6K 4DR2K 4DR3K 4DV5K 4GKJK 3J80O 4JI6K 1XNQK 4GKKK 4V19S 4OX9K 4JI5K 5LMNK 4JI3K 1XNRK 5IWAK 1N34K 1IBKK 4DR1K 4DV7K 4B3MK 4LFAK 4X66K 4DUYK 4DR4K 4DV1K 4NXNK 4B3SK 2UXCK 1FJGK 1XMQK 4DV2K 5AJ3K 2HHHK 4DR7K 1N32K 3OTOK 2VQEK 4X64K 4JV5K 1IBMK 4JI2K 4JI0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A P;  4YHH K;  1HNW K;  4DUZ K;  4X62 K;  3J7Y P;  4DR6 K;  3J81 O;  4LF7 K;  4LFB K;  4B3R K;  4JI1 K;  1I94 K;  4K0K K;  4X65 K;  2UUC K;  4KHP K;  5IT9 O;  2VQF K;  4JI4 K;  4LF9 K;  4LF6 K;  2ZM6 K;  2UXB K;  3T1H K;  4LF8 K;  2UUB K;  5LL6 Z;  5LMU K;  4JI7 K;  4JI8 K;  1HNZ K;  4B3T K;  4LFC K;  1N36 K;  4DV3 K;  1HR0 K;  5BR8 K;  4LF4 K;  4CVN E;  4DR5 K;  1J5E K;  2F4V K;  3T1Y K;  1N33 K;  4DV0 K;  4JYA K;  4NXM K;  4AQY K;  5FLX O;  4YY3 K;  2UXD K;  1HNX K;  1XMO K;  4DV4 K;  4CW7 B;  1IBL K;  2E5L K;  4LF5 K;  2UUA K;  3JAM O;  2UU9 K;  5A2Q O;  4DV6 K;  4DR2 K;  4DR3 K;  4DV5 K;  4GKJ K;  3J80 O;  4JI6 K;  1XNQ K;  4GKK K;  4V19 S;  4OX9 K;  4JI5 K;  5LMN K;  4JI3 K;  1XNR K;  5IWA K;  1N34 K;  1IBK K;  4DR1 K;  4DV7 K;  4B3M K;  4LFA K;  4X66 K;  4DUY K;  4DR4 K;  4DV1 K;  4NXN K;  4B3S K;  2UXC K;  1FJG K;  1XMQ K;  4DV2 K;  5AJ3 K;  2HHH K;  4DR7 K;  1N32 K;  3OTO K;  2VQE K;  4X64 K;  4JV5 K;  1IBM K;  4JI2 K;  4JI0 K; 
#chains in the Genus database with same CATH topology
 3PO5 A;  1GOB A;  2YHW A;  4E3S A;  3DLE A;  3H1V X;  4CED A;  4LSL A;  4DR6 K;  3KZB A;  3QBW A;  3K57 A;  3GL1 A;  1BUP A;  3OYL A;  4BR7 A;  2Q0R A;  5AQI A;  2FSN A;  1JLE A;  4WE1 A;  4C1N I;  4FPB A;  1OKJ A;  3ZT3 A;  3TTC A;  4CFB A;  2XO7 A;  3OBY A;  3ZSO A;  4AHC A;  3FE1 A;  3NBP A;  2E1Y A;  4IO9 L;  4IOA L;  3WT0 A;  3T1H K;  2Z1I A;  1HKC A;  2WC9 A;  3AO3 A;  2HVH A;  4A2A A;  2OPS A;  4B9U A;  5AZJ A;  2BAN A;  4B9L A;  4AHU A;  3VQ4 A;  2HNZ A;  3SMP A;  1J5E K;  4FSV A;  2GEL A;  4I9Q A;  1TVR A;  4DFK A;  5I3U A;  2E8A A;  4ZTJ A;  4JYA K;  2LSN A;  4FWO A;  2QA4 N;  3GOI A;  5AQT A;  1HJO A;  2HW3 A;  2F96 A;  3IFR A;  1QSY A;  3P1G A;  3PX4 A;  1MU2 A;  1RGI A;  3EZ5 A;  3M3Z A;  1WSH A;  4IEI A;  1OVQ A;  2HBM A;  2P9U A;  2UUA K;  4AHS A;  2PYL A;  4N5S A;  4EP4 A;  1NKE A;  1RTJ A;  2KZM A;  5BPN A;  1RBT A;  4CF2 A;  1HJR A;  4JS4 A;  3P39 A;  4M3W A;  3CPW M;  3QDK A;  4W5R A;  2YNG A;  3MAQ A;  3TSQ A;  3HP6 A;  5AQV A;  4K25 A;  2P9I B;  1REV A;  3VTI A;  4R79 A;  3ATV A;  4A5B A;  4A5A A;  3SUO A;  1CXQ A;  1BA0 A;  3CCE N;  1N6Q A;  4B3M K;  4LFA K;  5CY4 A;  1JL1 A;  1KRP A;  3ISN C;  2KZZ A;  2OTJ N;  4B3S K;  4OPK A;  2FC0 A;  5AJ3 K;  4KTQ A;  3MDQ A;  1ZYQ A;  3E66 A;  4I2Q A;  3SK3 A;  4B9S A;  1TL3 A;  3ZSR A;  1LWE A;  5CE3 A;  2WUS A;  2P9L A;  3HPO A;  4JI2 K;  1VQN N;  4OO1 J;  3D45 A;  1HNW K;  4FJG A;  3EKS A;  4CZF A;  4YOW A;  5J2N A;  1WB9 A;  3HPG A;  3S3M A;  2O8F A;  1J9A A;  2P9N A;  2DFE A;  5C15 A;  4JKF A;  4B9M A;  2OYQ A;  1DEJ A;  4E19 A;  2KFN A;  1YI2 N;  2Q0U A;  1NM1 A;  1JLQ A;  2A3Z A;  3M8R A;  4PL7 A;  4H0T B;  3AVI A;  3FFK B;  4L8R B;  4KH5 A;  2HND A;  3RSE A;  5CZ2 A;  3QET A;  1U45 A;  3OYE A;  3K2P A;  3O9U A;  3LDS A;  3V81 A;  5CR4 A;  1S22 A;  2ETJ A;  3ZT1 A;  4FWN A;  3C7N B;  2E88 A;  3CER A;  3D2E B;  3HM9 A;  4KPY A;  1BG3 A;  4FOE A;  3WNG A;  2O8B B;  1KFS A;  1RT1 A;  3ATU A;  1VRT A;  4DTN A;  4ISG A;  2KW4 A;  1BDG A;  1X9W A;  4H8K A;  4EAH D;  4M45 A;  3H3N O;  3ULE B;  1RDA A;  5FPD A;  3S41 A;  3LDN A;  2ZWH A;  1JCG A;  1ESV A;  1IBL K;  3PSF A;  5AQK A;  3HTV A;  3SQ4 A;  3MX5 A;  1ATS A;  4W5Q A;  3TTF A;  4MDB A;  3VER A;  3MCP A;  3V1R A;  3U9D A;  1T05 A;  4WQ4 A;  4GMJ B;  1BHL A;  4BQL A;  3WEE B;  1IKV A;  1WSG A;  4JKG B;  3LZI A;  3WNF A;  1S1V A;  3RVC A;  2E6L A;  1JLG A;  3AA4 A;  1N8R O;  5HRR A;  4Z4F A;  2YHB A;  2VG6 A;  5MLC Q;  1XNQ K;  3MED A;  3H45 C;  1VSM A;  2GX9 A;  3D2F A;  3CC4 N;  1GLF O;  4V19 S;  4FLW A;  3BF1 A;  2CH5 A;  3LWL A;  1XNR K;  5CYQ A;  1A5W A;  4FYD A;  3THV A;  1EET A;  5BPM A;  3RMB A;  1T03 A;  2EWS A;  3K58 A;  3O1W A;  1S1U A;  1RDU A;  2AP1 A;  3DMJ A;  4LD0 A;  4FK2 A;  4NYF A;  1W97 L;  1MA9 B;  2YX6 A;  1TKD A;  1BU6 O;  1QZ6 A;  3RMA A;  3P5J A;  2HHH K;  2GTD A;  1JL2 A;  4CGH A;  1VQP N;  3QEP A;  3OHR A;  4MLH A;  4JV5 K;  1C0M A;  4H5V A;  4ELT A;  4CJU A;  1BIS A;  3OYM A;  1RTI A;  2D1K A;  4O8U A;  4FJ9 A;  3SI6 A;  3CPE A;  3VQC A;  1T6C A;  4FM0 A;  3M6G A;  3NMU A;  4OPA A;  1HNI A;  1RBS A;  3F73 A;  3OBW A;  4QS9 A;  3PUF A;  1QSL A;  5HRO A;  5HRS A;  3CCR N;  4LF6 K;  4A57 A;  1VQO N;  4IZ9 A;  2ZM6 K;  4XH5 A;  1BCM A;  3E9O A;  1C0U A;  2CGK A;  4CE9 A;  4FWR A;  2FSJ A;  3A5N C;  4CJP A;  5JS2 A;  3THW B;  1QHT A;  1N36 K;  3MEC A;  1LCU A;  4CHP A;  3VQA A;  4C8O A;  4H0X B;  4H5W A;  3VQ8 A;  2FBX A;  3OYB A;  1YJW N;  3G10 A;  4JD2 B;  3DI6 A;  3KKS A;  4GY2 B;  3LP2 A;  4BRP A;  3V9S A;  5J2Q A;  4CJQ A;  3L8B A;  3U3Y A;  3C6T A;  4NCA A;  2O8E B;  2V52 B;  5T7B A;  3VEX A;  4GV9 A;  4FPA A;  3WXL A;  3QEV A;  3C0B A;  1HX1 A;  4GV6 A;  4U7B A;  3ID8 A;  2ZJR L;  3D0P A;  1RCH A;  3KWI A;  1IO2 A;  3CI5 A;  2KLA A;  4WYB A;  4DV6 K;  3CC7 N;  1IJJ A;  4FWS A;  2PBD A;  1ZBI A;  2HVI A;  4KB1 A;  4ILJ A;  3IS9 A;  1GLC G;  3NVM A;  2YJF A;  4JI6 K;  2JLE A;  3TAF A;  4YDU A;  5LMN K;  1CZA N;  3KLF A;  1NK0 A;  4C8M A;  3KWG A;  4CJ7 A;  2HHX A;  1RT5 A;  2O8C A;  2D0C A;  1RTD A;  4X66 K;  3U9Z A;  4PHT X;  4NXN K;  3MXJ A;  2UXC K;  1RT2 A;  1VHX A;  3LAK A;  3O1B A;  4B1Z A;  3PIO L;  1HRH A;  4A61 A;  2P1J A;  5CZ1 A;  4CGG A;  4Y1D A;  3WXI A;  1SKW A;  1B9F A;  2ZJP L;  3OYH A;  3QEI A;  2F9W A;  3F9M A;  4C8K A;  3VN5 A;  3A5O C;  1TAQ A;  3HJF A;  4M3U A;  3CMA N;  3ZEU B;  4O4G A;  4M3T A;  3KLI A;  1NBW A;  1SUQ A;  2ATQ A;  4CZJ A;  3FR0 A;  4YOR A;  4J2D A;  4E7I A;  1X3M A;  4CJ5 A;  2QXF A;  1ZC6 A;  2P5O A;  3SV4 A;  2UXB K;  4BC5 A;  4RW8 A;  1C6V A;  3AVK A;  4JI7 K;  4JI8 K;  2HBJ A;  3ZSQ A;  3DLH A;  4C1N K;  3ZX2 A;  1UWB A;  4AM7 A;  3QLH A;  3AVH A;  4F2S A;  1RDB A;  3SMS A;  4FWM A;  3AV9 A;  5AQZ A;  2D5R A;  2F7T A;  1KSP A;  4BG8 A;  2D0O A;  5LJV A;  3PV8 A;  4CJ3 A;  4ID5 A;  3PSI A;  2V7Y A;  4I6M B;  2HB5 A;  4OPH A;  1CZ9 A;  2E5L K;  1LAW A;  1CXU A;  4FOI A;  2NRZ A;  5BN9 A;  4FK0 A;  1S6P A;  5AQO A;  3VQQ A;  5FRN A;  4HHT A;  1NGF A;  3TU5 A;  2YNH A;  2P9I A;  1L3T A;  3CCU N;  4FVU A;  1FKP A;  3VGL A;  4BR9 A;  3MEE A;  2W6L A;  3ENO A;  1ZBF A;  3NVK A;  2RKI A;  3O6W A;  3KJV A;  3UB5 A;  1H1V A;  1J5O A;  1Z26 A;  3K59 A;  3I33 A;  2BTF A;  2JWL A;  2OCE A;  2VWB A;  4DTM A;  3TAR A;  2KTQ A;  2B6A A;  1F21 A;  4BVO A;  5LJW A;  4X64 K;  3THY A;  3VGM A;  1ASV A;  4DUZ K;  2IIR A;  2G8I A;  1NOZ A;  4FWL A;  2OA8 A;  1KVB A;  2OTL N;  4CHY A;  1XC3 A;  4IBN A;  2ASP A;  3A2F A;  4MFB A;  4JK7 A;  3VEV A;  3SCX A;  1SL1 A;  1WAJ A;  1FKO A;  4O0I A;  3NCI A;  4GVM A;  2DFF A;  4CIF A;  3THX B;  2F8T A;  4CZM A;  1TK0 A;  2FLO A;  3QBX A;  4LF9 K;  5B8H A;  1L3S A;  1NGG A;  5ELZ A;  2ZE2 A;  1VSH A;  4NO7 A;  3L2R A;  5LL6 Z;  4KHW A;  4OKJ A;  1NGI A;  3O3F A;  4R5P A;  4E0D A;  1Z6R A;  1XQS C;  4H5N A;  3LM9 A;  1ILY A;  3C7N A;  2G8H A;  3D2E A;  4BRI A;  4FO0 A;  2O8B A;  4DV3 K;  1YVN A;  3OA9 A;  4DR5 K;  1DKG D;  4JN4 A;  5BN8 A;  4Y0W A;  2QKB A;  3U8X A;  5AQR A;  3ULE A;  3IAY A;  4PA1 A;  1EX4 A;  4FWQ A;  4Z4H A;  3RWU A;  4GVE A;  4DSL A;  3WXJ A;  1ZBU A;  3CJ7 A;  2UXD K;  1Q8I A;  4BQZ A;  4CW7 B;  3OS2 A;  5AQU A;  4CJV A;  4E7L A;  4DTP A;  1SL0 A;  1Q86 O;  2NRT A;  4DTR A;  1QZ5 A;  4O5F A;  4H0Y B;  4KAZ A;  5EY4 A;  5TKY A;  1D9D A;  2QEX N;  1GOA A;  3J80 O;  3DAW A;  4H5T A;  1YVU A;  1UA1 A;  1TK8 A;  4CGJ A;  4CJK A;  4OLA A;  1J53 A;  4E7K A;  5KGW A;  4KHN A;  5AFU A;  4N41 A;  5KQD A;  5AQM A;  3TWH A;  3S3N A;  4EHU A;  4DV1 K;  1NK7 A;  2YV0 X;  1XMQ K;  4DV2 K;  2PY5 A;  2KQ2 A;  3D7E O;  1EXQ A;  3VEZ A;  2Z1G A;  2W42 A;  4PWD A;  3G71 N;  3O3G A;  4A62 A;  1RBV A;  1EO1 A;  4ELU A;  1YUW A;  1QS4 A;  4MO5 A;  1K6Y A;  2HHW A;  1JLB A;  1RTH A;  3TAN A;  1OH6 A;  4DFJ A;  1EKE A;  3CJC A;  4B1U B;  3DLR A;  2HMP A;  2QWN A;  4JNE A;  4CF8 A;  4J2B A;  4RG8 A;  4KHP K;  4DFM A;  1ATR A;  3IMX A;  1C1B A;  1XUP O;  3TSP A;  4CF0 A;  4CF1 A;  1W9H A;  1D4X A;  3CJB A;  1E4G T;  4B3O A;  4DS4 A;  1NGA A;  2W6K A;  5HP1 A;  3OYF A;  2IAJ A;  3TAG A;  3O8M A;  1SAZ A;  4M3Y A;  1RDW X;  4CJW A;  2WOM A;  4TSX A;  3THW A;  4JS5 A;  2IDO A;  5KRT A;  2ASM A;  4Z4E A;  3IKM A;  5K14 A;  1NGD A;  4KHY A;  3AAR A;  4FVM A;  4JD2 A;  4HUG A;  1HMV A;  4AIL C;  3OYG A;  4N56 A;  3E01 A;  4H4M A;  4CVN E;  4IO8 A;  1FXX A;  2ZGZ A;  3FZM A;  1RT7 A;  3AVC A;  3VF4 A;  3BP8 A;  4BE2 A;  3R9P A;  1QVG M;  4DQQ A;  3HL8 A;  1YJ9 N;  1EQY A;  3VES A;  5LY3 A;  1CLQ A;  4FLY A;  3A5M C;  3LL3 A;  5JVG L;  4CJS A;  4FLU A;  3EL2 A;  1VK0 A;  3GE1 A;  4KRF A;  4DTO A;  3A8Y A;  4CES A;  1YJN N;  4UY8 O;  4XH4 A;  5EOY A;  3LPT A;  2Q97 A;  4W5T A;  3ZCM A;  4CEE A;  4FK4 A;  4LSN A;  2WFB A;  4HTL A;  3O3H A;  1BL3 A;  4CD3 A;  1HPZ A;  1OH8 A;  1SL2 A;  4FJ5 A;  1QQM A;  3ZSV A;  5D3G A;  3T3F A;  3QIO A;  4CZK A;  3IDH A;  2EX3 A;  4DFP A;  4M41 A;  3S9H A;  1S72 N;  1NK6 A;  2AA4 A;  4YFU A;  3Q7C A;  4WQ4 C;  3LPU A;  4LC9 B;  2QWM A;  3VA3 A;  3HM8 A;  4BWM A;  3V9Z A;  4BRA A;  4GNI A;  3CG7 A;  2HF3 A;  4PKH A;  1N32 K;  2G8V A;  3G6E N;  2QM1 A;  2HBL A;  3VQE A;  2RF2 A;  4DSF A;  2NRX A;  4B1W B;  4M7X A;  3L6Q A;  3SJJ A;  3WQU A;  5FPE A;  3L3U A;  1Q9X A;  1ASW A;  2GWJ A;  1LW2 A;  4QOZ B;  3AAQ A;  2ZQB A;  3SJH A;  4NYN A;  4CZI A;  2YJE A;  3AO4 A;  4WQ5 C;  1D8Y A;  2DTU A;  3EYZ A;  3VQ9 A;  3ZT2 A;  3TAM A;  3KHY A;  3HO1 A;  1NGE A;  3CXC M;  3WNH A;  2X6N A;  4M63 C;  5SWM A;  1U6Z A;  4OGC A;  3U4L A;  3NH2 A;  2XY6 A;  3K5M A;  1BI4 A;  2QKK A;  4NCB A;  2NRW A;  3D6R A;  4FJX A;  1SZ2 A;  1U2V B;  3CJA A;  3Q7B A;  1YXQ A;  2Q36 A;  1UOC A;  4DF4 A;  1NG9 A;  4DU1 A;  4M3X A;  1S1T A;  2E6M A;  3BGR A;  2HBK A;  2Q31 A;  3QB0 A;  2GV9 A;  3L3V A;  2BDP A;  4Z4I A;  4RTF D;  4BRN A;  5M1N A;  3LP3 A;  4OKE A;  4RW6 A;  4JKE A;  3ZSY A;  4WCE L;  3E9L A;  5AFU H;  3VQB A;  4Z4C A;  3KK1 A;  2QI2 A;  4DTX A;  3QNO A;  4DQS A;  3ZX3 A;  4BRD A;  2HHT A;  4FWK A;  1Q18 A;  2IVP A;  4OJR A;  5FPM A;  1O13 A;  2Y1I A;  4KTW A;  3MMV A;  4BG9 A;  4OX9 K;  1XI1 A;  3O80 A;  5F1X A;  1JLC A;  1XHZ A;  4I2P A;  3TAB A;  1QTM A;  1BQM A;  3KIO A;  4OVL A;  3WUH A;  3P31 A;  2P9P A;  5GIO A;  1B9D A;  2HHS A;  4RWT A;  1W2B M;  5JIC A;  5EXW A;  3SV3 A;  2XY7 A;  2UYT A;  3NGY A;  4O8K A;  3ZSZ A;  4RCH A;  2FF6 A;  1RFQ A;  3EO3 A;  2O4G A;  3HI0 A;  4A59 A;  2A41 A;  3CCM N;  3DJC A;  2IVO A;  2HHQ A;  4YHH K;  4BDY A;  3L2U A;  3H08 A;  4BR5 A;  4LFB K;  4PQU A;  4KO0 A;  1RT6 A;  3ZT4 A;  4FLZ A;  3V9X A;  1I94 K;  2B5J A;  2UUC K;  4RW4 A;  2DFH A;  3PX0 A;  1IV0 A;  4CIG A;  5AR0 A;  4CZE A;  2VWJ A;  1X1P A;  2Y1J A;  3L2Q A;  3FZK A;  3SUN A;  4BRQ A;  4PKI A;  1Q82 O;  3I0S A;  1M90 O;  4Q0B A;  1L3V A;  5AQG A;  4AHR A;  1BGX T;  3OVN A;  5M1K A;  1WSJ A;  3ZET B;  2NZT A;  5M1Q A;  1WSI A;  3MWT A;  3ZX0 A;  3MXI A;  4KTZ A;  1T7P A;  4DTU A;  4CCH A;  4YOX A;  4PUO A;  4RW9 A;  3VA0 A;  4E89 A;  4CK1 A;  4JRP A;  3TPQ A;  3HXM A;  4FZY A;  2QWL A;  3GG4 A;  1X9M A;  2R7Y A;  3AA2 A;  4H5R A;  3CCV N;  1HQE A;  3NH1 A;  2J4R A;  4JKD A;  2RN2 A;  3VQ6 A;  1GLB G;  2Q1N A;  3CFR A;  3QIC A;  5C2F A;  4CJF A;  1JLA A;  1KFD A;  3DXM B;  4BGB A;  1K8K A;  4BRO A;  3F5T A;  4JHD B;  4Y1C A;  3P4I A;  3JSM A;  3A0I X;  1SKS A;  1D9F A;  2YKN A;  4B08 A;  4B9T A;  1OH5 A;  2JWK A;  4PKG A;  5J1E A;  4XEI A;  4WFB L;  5KGX A;  1VRU A;  4FZZ A;  3VF2 A;  4CEZ A;  1NWK A;  4IKF A;  3AGR A;  5JLF A;  5AZI B;  1GLL O;  4LY7 A;  4KH4 A;  5IWA K;  3AVJ A;  3F9K A;  2P9S A;  1V4T A;  1HPM A;  4BRG A;  3HVT A;  3BUZ B;  3OW2 M;  1ZBH A;  1DTT A;  4BRE A;  1SS6 A;  1C0T A;  2H3G X;  4DG1 A;  4BAC A;  2F8S A;  3HBT A;  3SBT A;  3FZF A;  4CIE A;  4YOT A;  4ZTF A;  1K9M O;  1GLA G;  5DK5 A;  2GUI A;  4OPJ A;  4B3R K;  4YOU A;  4H0V B;  1X3N A;  3CCS N;  5AZJ B;  3RRH A;  1S5J A;  1WN7 A;  4FJ8 A;  2BGG A;  2D0B A;  4ICL A;  5C24 A;  4JI4 K;  3V9U A;  2FBT A;  3MWP A;  4FZX C;  2E2P A;  4FJL A;  2YNF A;  4G1Q A;  4N76 A;  4E1M A;  2A6A A;  3V9W A;  1VQ7 N;  1NK9 A;  3VPZ A;  3P83 D;  4HVJ A;  4CHZ A;  1LWF A;  4FL9 A;  1VQL N;  4AM6 A;  2P9U B;  1C0F A;  2HOE A;  4LF4 K;  4CJL A;  3NF8 A;  2F4V K;  1KCF A;  4QS7 A;  3H6E A;  3R3L A;  2OPQ A;  5M1F A;  4KRE A;  2BUP A;  4WFA L;  1TUU A;  5KPR A;  2PFU A;  4YY3 K;  2G8U A;  2FBV A;  2E1Z A;  4GV3 A;  1NGJ A;  3VEW A;  3CC2 N;  1VQ6 N;  3AGK A;  2QTD A;  2G8F A;  4IJN A;  4OKK A;  4CEO A;  3CM5 A;  4CEQ A;  4JKH A;  1C1C A;  4M7Y A;  3ZLJ A;  1DGK N;  3FLC O;  1BIZ A;  2RE2 A;  3SUP A;  3AVG A;  5M1O A;  3I0R A;  3F2K A;  3NH0 A;  4FXD A;  1S3X A;  5AQS A;  1S9E A;  3AA5 X;  4F4K A;  2DY4 A;  1NJX A;  3VQD A;  1KVA A;  1S9G A;  2I7N A;  5AQY A;  4DTJ A;  4L3Q A;  1UAX A;  2QWQ A;  4DMN A;  3JXU A;  5F0X A;  1P90 A;  1I3A A;  5BPL A;  1YHQ N;  3LDO A;  3KK2 A;  3MXM A;  5I42 A;  4FJ7 A;  1BQN A;  4UQG A;  2YKM A;  1FJG K;  5AQW A;  4DSJ A;  3AVN A;  3CCQ N;  3M8P A;  4BGA A;  4DR7 K;  3QER A;  4HWI A;  2VQE K;  4MO4 A;  1NK5 A;  3O4W A;  3UKU B;  2E20 A;  2IGI A;  4IOC L;  4BVP A;  2Z1H A;  1VSK A;  1VQ9 N;  4CHO A;  3W0L A;  3J7Y P;  5DM6 L;  2XRI A;  3BDP A;  3SBG A;  5AQP A;  3RSE B;  2PZS A;  3EZW A;  2P5G A;  4LF7 K;  2I5J A;  1RBR A;  3HYF A;  1KTQ A;  4EFH A;  4K0K K;  4IFY A;  2X74 A;  1KXP A;  3SPZ A;  2VYP A;  3VET A;  2G8K A;  1WBD A;  2VG5 A;  3LP1 A;  4B9V A;  4XH1 A;  3OYC A;  2OPR A;  1XHX A;  3DXK B;  3DLB A;  1IKY A;  4DSE A;  1KAY A;  2UUB K;  2GUP A;  3N4P A;  4CFD A;  1V4S A;  4H4O A;  4CFC A;  3SPY A;  1B92 A;  3IRX A;  1VSE A;  3QEW A;  3VEN A;  4CK3 A;  3VF6 A;  3VQ7 A;  4BRC A;  3K9K A;  2WBN A;  4JKB A;  4FCY A;  1U04 A;  4CGD A;  3OY9 A;  1NGB A;  5C12 A;  4DKW A;  1TKX A;  3M8Q A;  4AQY K;  3VTH A;  1JXB A;  3BZC A;  4IG0 A;  1TAU A;  3D2F B;  3CJ1 A;  3GBT A;  5JLH A;  3K5L A;  4QCL A;  4K8Z A;  2IC3 A;  3JYT A;  3HSC A;  2UU9 K;  3MEG A;  5HOO A;  3QO9 A;  2QWR A;  4DR2 K;  2ASO A;  3VOV A;  3MN9 A;  4BR4 A;  4CZH A;  3G4S N;  2IVN A;  4DV5 K;  2NRV A;  3B8A X;  4PL8 A;  3J8A A;  1VQK N;  3EY1 A;  1K73 O;  1T3V A;  3RMD A;  3UIQ A;  5GIP A;  2RPI A;  3L2V A;  1VSF A;  2A1S A;  2NRR A;  5AQL A;  5E84 A;  3NF9 A;  3HVR A;  3KKR A;  4GW6 A;  3WEE A;  3CQX A;  4JKG A;  3VQP A;  3SLC A;  2GWK A;  1MWM A;  3AO1 A;  2NLX A;  3G25 A;  3CME N;  1NNE A;  1YAG A;  3L0Q A;  2I7P A;  3DYA A;  3OTO K;  4U67 L;  3ZSX A;  2A5X A;  5KPZ A;  3MX2 A;  3J7A P;  3T7Z A;  4ISF A;  3P38 A;  5GIN A;  3IG1 A;  4DF8 A;  4N47 A;  1BCO A;  2QK9 A;  1VQ8 N;  1Y97 A;  2FXU A;  3TAP A;  4QS8 A;  3M5R A;  3CJ9 A;  5AQF A;  1S6Q A;  4RW7 A;  2VQF K;  1T44 A;  4EHT A;  1VAZ A;  4DSK A;  4HTU A;  4J2A A;  1EP4 A;  1HYV A;  3ZET A;  2YHY A;  4F9O A;  2JGU A;  1KAZ A;  3QML A;  1HYZ A;  3CCJ N;  1FW6 A;  4IEE A;  4KHU A;  3AA3 A;  4ILG B;  3FZL A;  4BE1 A;  1GLE G;  1ZBS A;  4CF9 A;  1G15 A;  3T1Y K;  2W40 A;  1E3M A;  4CER A;  4FJI A;  3TR8 A;  3MN5 A;  3CFO A;  3HPH A;  4DLG A;  3C94 A;  4NB4 A;  1DLO A;  5FDL A;  4E1N A;  5E26 A;  2QXL A;  4FJJ A;  4YOV A;  2A1R A;  2PAV A;  4CJE A;  3S3O A;  1ATN A;  1NK8 A;  1NMD A;  3EEQ A;  3NHG A;  3WQT A;  3LWM A;  1NJY A;  2B4J A;  2O8C B;  3QIP A;  2IOC A;  2WON A;  3V4I A;  1VSI A;  1BWF O;  1QQO A;  2O8E A;  5I9E B;  1GLJ O;  4JLH A;  4NCG A;  3O9R A;  1E4F T;  5ADX A;  4FW1 A;  3R1X A;  2HST A;  5FRO A;  1KC8 O;  4FM2 A;  1QE1 A;  1IG9 A;  1XC9 A;  4DR4 K;  3I8D A;  4K41 A;  4FLT A;  5HLF A;  1U4B A;  3H3O B;  1EWR A;  4MLE A;  4BWJ A;  1IH7 A;  4JKA A;  4C8N A;  3I55 N;  3LM2 A;  1YT3 A;  3SQ2 A;  4J2E A;  1RBU A;  1UA0 A;  4DWI A;  2Q2R A;  4IDH A;  5C42 A;  1KAX A;  1A5X A;  1KVC A;  2Q3S A;  3K5O A;  2VCP A;  4JEP A;  3SUQ A;  4JI0 K;  2PYJ A;  2O8D B;  4G9Z A;  2QWP A;  3CCL N;  1NKC A;  5AQN A;  3KLH A;  4IDK A;  4O5B A;  1KQS M;  1VSD A;  5KPT A;  3E9P A;  1Z05 A;  2QW9 A;  3GDQ A;  3AVB A;  4X65 K;  4DU4 A;  3ID6 A;  4ELV A;  1XWL A;  2KKZ A;  3C6A A;  1WBB A;  3OYK A;  3ULD A;  2OPP A;  3LAL A;  1U49 A;  3A5L C;  3O5B A;  3FZH A;  3WXK A;  4LF8 K;  3LP0 A;  3EE9 A;  5KI6 A;  4H0P A;  3ZSW A;  2ZD1 A;  1HNZ K;  5E41 A;  4JAX A;  3ZEU A;  3SNN A;  3T19 A;  4ILH A;  4ISE A;  4KHQ A;  3O9T A;  3HOS A;  1RDC A;  5KQ8 A;  1LV5 A;  1ASU A;  1NK4 A;  2YCH A;  4DS5 A;  3U3G A;  5FLX O;  3PY8 A;  2NRH A;  4C8L A;  3NF6 A;  5HBM A;  1ZXO A;  4JKC A;  4K42 A;  3HT3 A;  4DLE A;  3CET A;  4F8R A;  1EWQ A;  2E4L A;  1M1K O;  3KD1 E;  1VSJ A;  4CEB A;  3CQ8 A;  4YOY A;  4WFN L;  3LDQ A;  2YNI A;  1O1W A;  4I6M A;  4HUF A;  2FSK A;  3G0Z A;  3W3D A;  4JI5 K;  1JCE A;  1IBK K;  4Z94 A;  3SQ0 A;  5AQX A;  1TYQ B;  3SYZ A;  3THY B;  4BDZ A;  1KD1 O;  3LAM A;  3AVF A;  4AF1 A;  2OZM A;  4DUY K;  4HCC A;  4Z4G A;  2E2Q A;  3O08 A;  1Q9Y A;  3LZJ A;  3TI0 A;  4IFE A;  1VQM N;  3DOK A;  1W0H A;  2CGL A;  1LOT B;  3UKU A;  3T69 A;  4M3R A;  2BE2 A;  3I8B A;  2HHV A;  1R59 O;  5H1S Q;  4CZL A;  1NGC A;  2FF3 B;  4OLB A;  3L4I A;  4A2B A;  2FBY A;  4BC4 A;  1Y64 A;  2ITG A;  2KFZ A;  3K5N A;  3KLG A;  3DXK A;  4H03 B;  3HZ6 A;  2HMI A;  2NUB A;  3DOL A;  1RIL A;  3MN6 A;  1NU0 A;  1P8Z A;  3UKR B;  4CEF A;  4CGF A;  5BRE A;  1WSE A;  4E1J A;  3VEY A;  4YDU C;  1TGO A;  1YIJ N;  4AHV A;  3KK7 A;  1VSL A;  2V7Z A;  5BR8 K;  1N5Y A;  2YI1 A;  3OS1 A;  1NOY A;  3MCA B;  3THX A;  4DV0 K;  1X9S A;  3HOT A;  2P9K B;  4FLV A;  3ZT0 A;  3KVG A;  1BO5 O;  3O4Q A;  4BRK A;  4DHY A;  5ADX H;  3CFP A;  1HNX K;  4M42 A;  3BY5 A;  4MDA A;  2VGM A;  1TUY A;  5J2M A;  3VGK A;  1FK9 A;  4LF5 K;  1MDU B;  4BRH A;  3JAM O;  3QFU A;  1NJI O;  4WQ5 A;  4F3O A;  3NF7 A;  4NLB A;  3EN9 A;  1IKW A;  5EX5 A;  3E1Y A;  3V1O A;  4Z0U A;  4FLX A;  1RNH A;  1BA1 A;  3CD6 N;  4CEC A;  3PLA A;  2CGJ A;  4FJM A;  1X9J A;  3R8E A;  4JRQ A;  1SQK A;  4B8C A;  3H1Q A;  3TAQ A;  1CZB A;  3HP9 A;  1WOQ A;  2F9T A;  4FJK A;  2AJQ A;  3CF5 L;  5C0Y A;  4LH4 A;  1QHA A;  3ALY A;  2XY8 A;  5AQJ A;  2DPN A;  5EVZ A;  3HRG A;  1MWK A;  1QQC A;  3PX6 A;  1NJZ A;  4K43 A;  1TK5 A;  5GAD P;  3NFA A;  3NE6 A;  1K8A O;  1JJ2 M;  1J54 A;  4O44 A;  4ZHR A;  4HCB A;  4NLC A;  2V51 B;  3AY9 A;  4EZ6 A;  3OJU A;  2VGN A;  4KFB A;  3KK3 A;  1D5A A;  5F2R A;  1KLN A;  1JKH A;  4DQP A;  5EU7 A;  1WSF A;  3L2W A;  1HLU A;  1S1X A;  1HUX A;  2W41 A;  5IT9 O;  4BR2 A;  1BIU A;  4BC3 A;  1YTA A;  3MK6 A;  4KBO A;  4O0J A;  4DTS A;  4KI4 A;  3EE8 A;  2ITM A;  4IG3 A;  2E2N A;  3NGI A;  3C6U A;  1Q7Y O;  2HF4 A;  1JLF A;  3VEO A;  3M1F A;  3CM6 A;  3C6H A;  2X6S A;  5JS1 A;  3AO5 A;  4KKO A;  2D4W A;  3QES A;  3QNN A;  3J7Z O;  3CYM A;  4IJA A;  3UE5 A;  2O4I A;  4DQ8 A;  4JK9 A;  1S1W A;  5DM7 L;  3HST B;  1N33 K;  5C10 A;  1HQU A;  1U47 A;  1WLJ A;  3MN7 A;  1VQ5 N;  3DLG A;  4NXM K;  3ENH A;  4HUE A;  3ZYY X;  1XMO K;  1GLD G;  4E7J A;  1GOC A;  2A40 A;  1SKR A;  4FWP A;  1DTQ A;  4BRF A;  1L3U A;  1YIT N;  2YHA A;  1U48 A;  4J8F A;  3LDP A;  3DM2 A;  3DLL L;  4DR3 K;  4OGE A;  3K9J A;  4GKJ K;  3L4Q A;  3DRS A;  4EZ9 A;  1C1A A;  4GKK K;  3T1A A;  3NGZ A;  4FW2 A;  1NJW A;  4DV7 K;  3CHW A;  4FM1 A;  5TKW A;  2OAN A;  3AVA A;  1TL1 A;  3KLE A;  2NNW A;  3DRP A;  1YF5 L;  3OYD A;  4CD1 A;  2OZS A;  2HHU A;  3C95 A;  3V1Q A;  3B6P A;  5C2D A;  4B9N A;  4B1Y B;  3AVM A;  4C23 A;  2O8D A;  3OS0 A;  1IBM K;  3CQY A;  4W5N A;  2P9L B;  2WTU A;  5BRH A;  4X62 K;  3J81 O;  1HNV A;  2IS3 A;  1SV5 A;  4JI1 K;  1BI4 B;  2VWK A;  3U6F A;  1DT9 A;  3TAE A;  5JVH L;  3EKU A;  1TV6 A;  4ID1 A;  3N4Q A;  3CIP A;  4DQI A;  4M3Z A;  3FFI A;  1A5V A;  5M1P A;  1W7A A;  2P9N B;  3AVL A;  3HK2 A;  2O8F B;  3QFP A;  1Z25 A;  1WAF A;  4B9Q A;  4IOX A;  5JMV A;  3OYA A;  1QSS A;  4IXC A;  1QQN A;  4DCH A;  5DMR A;  3K0S A;  2ZJQ L;  3ASM A;  4H0O A;  3O9S A;  3SQ1 A;  1NLV A;  1IG8 A;  2X78 A;  2EHG A;  5LMU K;  1IKX A;  1RT4 A;  3RRG A;  1KLM A;  4CJ4 A;  1TKT A;  4CEA A;  4AH9 A;  5BR9 A;  3NAE A;  4B3T K;  4LFC K;  4O55 A;  3VQ5 A;  1HR0 K;  3OJS A;  1JXE A;  3O4N A;  1RT3 A;  3AO2 A;  1WUA A;  4E7H A;  5HRN A;  3KD5 E;  4CZG A;  3TTD A;  2E2O A;  1NKB A;  1G99 A;  3BEX A;  1WNS A;  1VQ4 N;  5GAG P;  1U2V A;  3H46 O;  3DLK A;  4JK8 A;  5AQH A;  3WXM B;  1TKZ A;  1L5U A;  3NDK A;  4EP5 A;  4CGI A;  2GBZ A;  5KTQ A;  2P9P B;  4BRM A;  4F3T A;  5BRD A;  4FJH A;  3DRR A;  4LH5 A;  2VG7 A;  4CI6 A;  4B1V A;  3AAP A;  2GEM A;  2BH1 A;  4BY9 C;  1TYQ A;  1ITG A;  4PY5 A;  2ZF5 O;  1T8E A;  3DWL A;  1N34 K;  4DR1 K;  5GAE P;  5KRS A;  4QAG A;  4CK2 A;  5BRF A;  1NGH A;  3SAH A;  3BZK A;  4CJT A;  4F2R A;  2XHB A;  3OYN A;  4I7F A;  4BRL A;  4DB3 A;  3QIN A;  4KH6 A;  1C0G A;  3RMC A;  3SAF A;  4IFV A;  4CFA A;  3RR8 A;  4Q5V A;  1HKB A;  1I39 A;  2D0P A;  4B8A B;  4EIA A;  4BE0 A;  2RHK A;  3BF3 A;  4WF9 L;  4I9L A;  2Z1J A;  5J2P A;  4KI6 A;  1QVF M;  4BR0 A;  3QEX A;  2CH6 A;  3UKR A;  3M8S A;  5CHI A;  3SAG A;  5GAH P;  4KV8 A;  1OH7 A;  4FJN A;  4W5O A;  1ZBL A;  4IWV A;  3OYI A;  2KHO A;  1J6Z A;  3OYJ A;  3C65 A;  1K8K B;  1LAV A;  1NMN A;  2P9K A;  3I56 N;  4BC2 A;  1YTU A;  4DQR A;  2D0A A;  5SZT A;  4CBX A;  4DU3 A;  1JCF A;  2QWO A;  4XIU A;  3B6O A;  2P51 A;  5C25 A;  4DV4 K;  1LW0 A;  5HL7 L;  3RTV A;  3LDL A;  1R0A A;  3FGU A;  2P9S B;  2A42 A;  5A2Q O;  3TSU A;  1OVY A;  3O9Q A;  4CBU A;  1Q81 O;  4CHN A;  4CHQ A;  2G8W A;  5FRM A;  5AQQ A;  3IUC A;  2YHX A;  2ZGY A;  4BDP A;  4K8X A;  4AHT A;  1BOT O;  5FPN A;  3DXM A;  4JI3 K;  4B1X B;  5CYM A;  3RR7 A;  3SZ2 A;  4JHD A;  3PIP L;  1HKG A;  1HYS A;  3VMF B;  3ITH A;  3ENB A;  4CBW A;  2XY5 A;  3KTQ A;  2HNY A;  4MQ3 A;  1T6D A;  3PO4 A;  1LWC A;  3JS6 A;  3LAN A;  4KB0 A;  3R6M A;  3WNE A;  4DSI A;  4CJR A;  5HRP A;  5AZI A;  4YNQ A;  3V6D A;  1RDD A;  4KHS A; 
#chains in the Genus database with same CATH homology
 3J7A P;  4YHH K;  1HNW K;  4DUZ K;  4X62 K;  3J7Y P;  4DR6 K;  3J81 O;  4LF7 K;  4LFB K;  4B3R K;  4JI1 K;  1I94 K;  4K0K K;  4X65 K;  2UUC K;  4KHP K;  5IT9 O;  2VQF K;  4JI4 K;  4LF9 K;  4LF6 K;  2ZM6 K;  2UXB K;  3T1H K;  4LF8 K;  2UUB K;  5LL6 Z;  5LMU K;  4JI7 K;  4JI8 K;  1HNZ K;  4B3T K;  4LFC K;  1N36 K;  4DV3 K;  1HR0 K;  5BR8 K;  4LF4 K;  4CVN E;  4DR5 K;  1J5E K;  2F4V K;  3T1Y K;  1N33 K;  4DV0 K;  4JYA K;  4NXM K;  4AQY K;  5FLX O;  4YY3 K;  2UXD K;  1HNX K;  1XMO K;  4DV4 K;  4CW7 B;  1IBL K;  2E5L K;  4LF5 K;  2UUA K;  3JAM O;  2UU9 K;  5A2Q O;  4DV6 K;  4DR2 K;  4DR3 K;  4DV5 K;  4GKJ K;  3J80 O;  4JI6 K;  1XNQ K;  4GKK K;  4V19 S;  4OX9 K;  4JI5 K;  5LMN K;  4JI3 K;  1XNR K;  5IWA K;  1N34 K;  1IBK K;  4DR1 K;  4DV7 K;  4B3M K;  4LFA K;  4X66 K;  4DUY K;  4DR4 K;  4DV1 K;  4NXN K;  4B3S K;  2UXC K;  1FJG K;  1XMQ K;  4DV2 K;  5AJ3 K;  2HHH K;  4DR7 K;  1N32 K;  3OTO K;  2VQE K;  4X64 K;  4JV5 K;  1IBM K;  4JI2 K;  4JI0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...