4DV2K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv2K00
4DV0K 4DUZK 1IBLK 4B3TK 4DV7K 4DV5K 4DR4K 1J5EK 3JAMO 5LMNK 4DR6K 4LF6K 4DV1K 4LFBK 4B3RK 4CW7B 3J81O 4JI5K 1N36K 4X64K 4NXMK 4JI7K 2UU9K 4GKKK 3J7YP 1FJGK 5BR8K 5LL6Z 4YY3K 4CVNE 3J80O 4DR1K 5IWAK 1XMOK 1HNWK 3T1YK 4JI6K 4OX9K 5LMUK 2E5LK 4X66K 1IBMK 5FLXO 4LF5K 3T1HK 4JI2K 4DR2K 4JI1K 1XNRK 4DUYK 4GKJK 1IBKK 4DR7K 2UUAK 1HNXK 4DR3K 4LFCK 4JI0K 4DV3K 2HHHK 4KHPK 4B3SK 4AQYK 2UUBK 4DV4K 4K0KK 1XNQK 2F4VK 4X62K 1N33K 4DV2K 4JI3K 1N34K 2UXBK 1I94K 5AJ3K 2VQEK 2VQFK 4JYAK 5IT9O 4LF4K 4LFAK 4LF8K 4LF9K 2UUCK 4YHHK 4JI8K 4LF7K 1N32K 4JI4K 4DR5K 4B3MK 1HNZK 2UXCK 1HR0K 5A2QO 3OTOK 4V19S 2UXDK 4DV6K 1XMQK 4NXNK 4JV5K 4X65K 2ZM6K 3J7AP
chains in the Genus database with same CATH superfamily
4B8CA 5I42A 4DSLA 1NGCA 1QZ5A 3R1XA 1HQUA 3T7ZA 1YJ9N 5BPLA 4AHUA 5CHIA 3IKMA 4FK4A 1X3MA 3C6HA 3DLKA 3J81O 5KRTA 1U6ZA 3C94A 4N47A 2A40A 3SZ2A 3P83D 3VQDA 1DKGD 1RBUA 4YOYA 4CVNE 3K9KA 1NJZA 3J8AA 4FL9A 4ICLA 1D4XA 2P9LB 5EY4A 3VERA 1NK5A 1QVFM 3AVNA 3HL8A 3OS1A 1T03A 3LANA 4LY7A 4FLUA 3H1VX 1D5AA 1KLNA 3I56N 2GTDA 1QVGM 2W41A 1S1UA 3AO4A 3FZHA 3WXLA 5DMRA 1S6PA 1SAZA 3HZ6A 1QHAA 4MO5A 3ZT3A 4CZMA 4PL7A 1Q9XA 5FDLA 4BRKA 2ITGA 4RW9A 3QDKA 1BU6O 3CPWM 4WYBA 1JJ2M 4ILJA 4JI0K 3VF2A 4E7HA 1QE1A 3QESA 3GL1A 3MXJA 5M1FA 4WFBL 3EY1A 4CEBA 4FJKA 5C0YA 1U49A 3WNFA 4CJ7A 3NBPA 4Z4GA 4DV2K 1FXXA 3SUOA 1X9JA 3A8YA 4UY8O 4WF9L 3MN5A 5EVZA 4QOZB 1RDAA 4PWDA 4Z4CA 2XY6A 3U9DA 3C7NB 2FBVA 3NE6A 2OANA 1N32K 2E1YA 1GLLO 3AVFA 2ZJPL 4CZFA 4JNEA 4DV6K 1NGHA 1YVUA 3VETA 2HMPA 1R59O 5M1KA 4FK0A 5MLCQ 2HHSA 4FZYA 3IMXA 3OYAA 3TAFA 2HVHA 4H8KA 3AAQA 3F2KA 1RCHA 4B9TA 3L3UA 1BI4B 1SKRA 4DFKA 1RBVA 2WONA 4NYNA 4HUEA 4Q0BA 1JL2A 4BE1A 1RT4A 2E1ZA 4FWOA 4B1XB 4X64K 4L8RB 2FF6A 1EQYA 3CCEN 4J2EA 2O8FA 2X74A 1C0UA 2BANA 3A0IX 4IG3A 3NGZA 3GDQA 4UQGA 3O3FA 1T44A 2Q0RA 4JI6K 1NJWA 5LMUK 3ZETB 2YJFA 2A5XA 2O8BA 1W97L 3T19A 4C8KA 1IG9A 4QS8A 4CJTA 1EETA 2KHOA 4BREA 2FSNA 5FLXO 3NF7A 3CHWA 2V7YA 3FLCO 2P9KB 3I55N 3PIOL 4E1JA 4JAXA 4M63C 3SJJA 4MDBA 3QLHA 4EHTA 3CETA 4FLZA 3T3FA 1SV5A 2F9TA 3CXCM 1HKCA 3ZEUB 3QINA 3QNOA 1WNSA 3CJBA 3V1OA 4BRMA 2P51A 3V9WA 3HVTA 1RT1A 1NGEA 4J2BA 1KVBA 3OA9A 4DTUA 2F4VK 4FJLA 3CM5A 3OYCA 3A5MC 1N34K 2QKBA 3DLGA 1VK0A 1HNIA 3G25A 4CJQA 2ZJQL 4CEAA 3RSEB 4EZ6A 5E84A 4IKFA 4WFAL 3TARA 2A6AA 2OYQA 2FSKA 1RDUA 3HPHA 3TSPA 1HNZK 3LDOA 2O8CB 3NF6A 4GVMA 2Q2RA 2YHBA 5BRFA 3VEZA 4CE9A 2VCPA 1HKGA 1JCEA 3LDLA 3SAHA 4HUGA 1FK9A 5KQ8A 4CZJA 2YX6A 3OJSA 4MLEA 1T8EA 4H5NA 3SJHA 4FO0A 4DSKA 4ID5A 1C1AA 4BRPA 4Q5VA 3V9UA 1KRPA 4ZTFA 1WN7A 4AHCA 1C0FA 2NUBA 3P31A 4FM1A 3MMVA 3BDPA 4XH4A 1IO2A 1LWFA 3VEYA 4JI7K 1NMNA 2QWMA 4CJFA 3LDSA 3DRPA 1N5YA 3OYKA 2Y1IA 4IOXA 1ITGA 1Q8IA 4CF8A 3WQUA 1LCUA 2D0OA 4F2RA 2DPNA 4BR4A 4M3XA 5KGXA 4DFJA 4JHDB 2E5LK 3AVAA 4F9OA 3CIPA 3O9SA 4IFVA 4DTOA 1U45A 2KFNA 4KH6A 4BVPA 3UKUA 2HBJA 3NFAA 1RDCA 5BREA 4CFBA 4M3ZA 4OPKA 5J2NA 5H1SQ 4H4MA 4I9QA 3THWA 4BWMA 4M42A 3RVCA 4CGGA 1S9GA 4OO1J 3QNNA 4DU4A 4J8FA 3L3VA 3MCAB 5AQIA 3FZLA 4CBUA 1C0GA 3M8RA 4M41A 3THYA 3CERA 2E88A 1BWFO 1N33K 4E0DA 2W6LA 1WBBA 3UB5A 3LAMA 4H0TB 5KQDA 1QSLA 4JKEA 2E2OA 2WTUA 2NZTA 4JI8K 3AGRA 1ASWA 1RTIA 1HKBA 2E2NA 2VYPA 1V4TA 2UXCK 1BIUA 2QXLA 1IH7A 3HSCA 3MX2A 1XMQK 4AF1A 1J53A 5EXWA 4X65K 3U3YA 3AVGA 3VTIA 3PSIA 3ZEUA 1NK0A 4PUOA 1IBLK 1TUYA 2VG5A 4FWKA 1OH8A 3BP8A 4CD3A 3SMPA 4LF6K 2V51B 2IVPA 1A5WA 1Y97A 4JKFA 4W5OA 1WSGA 4GNIA 4JS5A 3J80O 3OYGA 3EZ5A 1XMOK 4AHSA 3WQTA 1QSSA 4H0XB 4PHTX 4CF0A 4IO8A 1L3TA 2AP1A 4HVJA 4K8ZA 5CY4A 1YI2N 4JK8A 4JS4A 4FLTA 2OPRA 4ZTJA 5C2DA 3SNNA 4PA1A 3KWGA 3T1HK 3VENA 4CEQA 5J2QA 3P5JA 4BRAA 1C1CA 3DMJA 4A61A 3O4WA 4GVEA 3O3HA 1Q86O 1RILA 4YOXA 3C95A 1VAZA 1YIJN 3ENBA 1S6QA 5M1PA 2NRZA 4F8RA 3DYAA 3BZKA 5HRRA 3KLHA 3SQ4A 1CZ9A 3U9ZA 3SQ0A 2I7PA 1VSJA 3RWUA 3AVCA 4DTXA 4BGBA 3BEXA 4RW7A 4E1NA 1NLVA 5CR4A 4BRNA 3E1YA 3VMFB 2Z1GA 1IKVA 4CEFA 3QFUA 5T7BA 4LF9K 5KPRA 3CCLN 3GBTA 1SS6A 4E7IA 4DG1A 4AM7A 5I3UA 1I3AA 4JEPA 2WBNA 3NMUA 4B3MK 4CJUA 3PY8A 3AVIA 4H5WA 5CE3A 4KRFA 1QZ6A 3O8MA 5AQNA 2A3ZA 1RTDA 1YJWN 1WLJA 4EP4A 1VQPN 1Z26A 1CXUA 3H46O 4MO4A 4Y1CA 4FWSA 4ISFA 4DV5K 2Z1JA 3M6GA 4B9VA 3CCSN 3LDPA 1RBTA 3CJAA 3THYB 1KCFA 1GLJO 2Q0UA 1ZBHA 4WFNL 3TTFA 1N6QA 2P9SB 4KHSA 4CI6A 3N4QA 4FSVA 2YV0X 4AHVA 3PX0A 1TK5A 1HX1A 1DEJA 2D0PA 4R79A 3KJVA 4JK9A 5HRSA 3S3OA 3ZSQA 4CJ3A 4OVLA 4KHYA 3LL3A 5BN8A 2HHWA 4RCHA 1LWCA 4Y0WA 4DR2K 2P5GA 3QEXA 2ZWHA 2CGKA 1ASUA 4YOWA 3NVMA 5E41A 1BCMA 4EIAA 2P9UA 3VEWA 3M8PA 3SAFA 3ASMA 1NKEA 2HSTA 4JKBA 2GEMA 1OKJA 3GG4A 3QEIA 3SMSA 1WSEA 4CJEA 4B3SK 4BY9C 4ILHA 3LP1A 4YDUA 1K9MO 2HHQA 2F8SA 3DLEA 3D2FB 2OZMA 2O8EB 5AQLA 1BDGA 1QSYA 1I94K 1BOTO 2WOMA 4FWQA 2VQFK 2ASPA 3R6MA 3SQ2A 4LFAK 4IG0A 2E2QA 4HCBA 1GLAG 4IJNA 2UYTA 2HBKA 3VQ8A 1QS4A 4C1NI 4MDAA 1U48A 4DCHA 2A1SA 5BRHA 3RMBA 4CJRA 2QK9A 3DWLA 2YHXA 4B9QA 3NF8A 1SL0A 1RFQA 3DRRA 1NU0A 1TGOA 2DFEA 4OGEA 4BDPA 3E9PA 5HBMA 5C25A 3OYEA 1VSKA 4GY2B 1ZBUA 3C6UA 4FJ5A 1Y64A 4CBWA 4CFDA 1CLQA 3QEVA 3TTCA 4CZKA 3CQYA 3EE8A 4CF2A 3D0PA 3KK3A 2Q1NA 3ENHA 3U4LA 4DKWA 4DFMA 3CC7N 3FFIA 4B3RK 5SZTA 1TL1A 3CJ9A 4DSFA 1ASVA 1F21A 3BY5A 3MEDA 4M3UA 4GKKK 4AHRA 1FJGK 5LL6Z 1S22A 2KKZA 3QEWA 1VQLN 1NGFA 2HVIA 3O1BA 3MXMA 4CCHA 1VQON 3RR7A 3E9LA 5F2RA 2D5RA 1YTAA 3A5OC 1K8AO 4C23A 3PX4A 3AGKA 3PUFA 3BUZB 4CEDA 3AVLA 2FBXA 2FF3B 2W40A 3VQBA 1NKCA 4LH4A 2CGLA 3WXJA 1Z6RA 2E20A 5K14A 2VWJA 1J6ZA 4K43A 3S9HA 4CJVA 4BDZA 4KHNA 2CGJA 1QQNA 4CK3A 1ZXOA 3B6OA 1D9DA 1KAZA 3VQ5A 2UUAK 4OPHA 3DM2A 2Y1JA 3HVRA 4RG8A 3H08A 4CF1A 4C8OA 1GOBA 3I33A 3EKSA 3G4SN 1WUAA 3THVA 3FGUA 3O80A 5C2FA 4FWNA 3ZT1A 1FKOA 1GLDG 4CZGA 3MAQA 2E4LA 1JCGA 4N56A 3A5LC 3QMLA 4ILGB 4BRFA 3VPZA 3C6TA 1SQKA 4CGFA 4DS4A 5IT9O 5C15A 4F3TA 2V52B 1GLFO 3NH1A 3JXUA 4IWVA 3LZJA 4KTQA 3QIOA 3TAPA 4WCEL 2RF2A 4DTSA 3M3ZA 4BRLA 1HR0K 4KH4A 3THWB 1RBSA 4E1MA 3TR8A 4Z4EA 4NB4A 1OVYA 4KBOA 4CEZA 4MQ3A 4DTMA 2NRVA 5TKWA 4DUZK 3PV8A 4O8UA 4YDUC 3CJ7A 4E7KA 4BRQA 1ZBFA 4DFPA 3DI6A 1J5EK 4DHYA 1JLBA 4KREA 4CJSA 2E2PA 4KTZA 1QQCA 1UA0A 1WOQA 4WQ4A 3CC2N 1ZBIA 3TAGA 4K8XA 5IWAK 3OYLA 1K73O 4C8MA 1A5VA 1HLUA 4FW2A 1HJRA 3G10A 3E66A 5FPMA 3U8XA 4DSEA 2XY7A 2FXUA 4A2BA 2G8IA 3M5RA 4BC2A 2OTJN 1O13A 4PQUA 4KHWA 3ZT2A 3DOKA 2QA4N 1NK9A 5HRNA 2DTUA 1P8ZA 3GE1A 2CH5A 2PBDA 3CQXA 3WNEA 2VGMA 3KVGA 2A1RA 2NRTA 3ZX0A 4FZZA 1JLCA 3TANA 4Z4FA 3ZSYA 3NAEA 1L3UA 4CJLA 1OH6A 2B4JA 2QW9A 5EOYA 2P9NA 2RHKA 3ZT0A 5GAGP 1MA9B 3J7ZO 3SV3A 3V9ZA 2HNYA 2QEXN 4BRCA 1XNQK 4O5FA 1XQSC 3WEEB 1E4GT 2YI1A 3CJCA 3AA3A 4EAHD 3KK1A 4FOIA 4O8KA 2VQEK 4CECA 2QI2A 1NGAA 1VQ4N 1EXQA 4LF4K 1JLAA 2HF4A 4CGIA 3E01A 4JKGB 5KRSA 3CD6N 4W5NA 5ADXA 5M1NA 1LAVA 1YT3A 1S72N 5HROA 3AA2A 5FROA 1UWBA 4Y1DA 4H5TA 4Z4IA 2JWLA 3HOSA 4BRDA 3VQAA 3T69A 3G0ZA 4DQQA 5HLFA 3LPUA 2OA8A 5AR0A 2I5JA 3O9RA 2W42A 4FXDA 4KPYA 4LFBK 3ISNC 4XH5A 3ZETA 4FZXC 3WNHA 4DQ8A 1H1VA 4KB1A 4EP5A 3VA3A 2UU9K 4E7JA 3LPTA 5BR8K 4WQ5C 4HWIA 4DSIA 1TAUA 1SL1A 2D0AA 4BC5A 1YHQN 1BA0A 3UKRA 1BQMA 1ZBLA 4H03B 4CIFA 2OTLN 1GLEG 4HUFA 4NLCA 4BVOA 3SUQA 3AVKA 4E7LA 3V9XA 2WUSA 3VGLA 4LF5K 1TKXA 5M1OA 3OVNA 1VQ7N 1ZYQA 4M3TA 2IIRA 4IFEA 4FJXA 2GBZA 2GV9A 4DTNA 3M1FA 3L6QA 3LWLA 2AJQA 5GIPA 4PY5A 2NRHA 5AFUH 4CJ4A 3AA5X 3R3LA 3KZBA 3T1AA 4CZHA 3GOIA 5AQWA 1BG3A 2CH6A 4DF8A 3LP2A 1YAGA 5B8HA 4DSJA 4WQ4C 2P9IB 2P9PB 2HHUA 4FJ8A 4PL8A 3CYMA 3NF9A 3ID6A 3D7EO 3D45A 3AO1A 3AA4A 5AZIA 1MWKA 4BQLA 3SV4A 4DTPA 4LF8K 1VSFA 3W3DA 3SPYA 1NG9A 1IJJA 5ADXH 3IDHA 1W2BM 2A42A 1I39A 3RTVA 1XI1A 1TK0A 2P1JA 1CZAN 3L2QA 1NK7A 1K6YA 1D9FA 3WUHA 3P38A 3VQ6A 4FCYA 1Q82O 1HYVA 1JLEA 2UXDK 2KZMA 1YTUA 2HNDA 4BGAA 4LC9B 4CF9A 1HYSA 4YNQA 4R5PA 3TWHA 4IXCA 4K25A 3LP3A 1X1PA 1P90A 3FZKA 1S3XA 1E4FT 1ATNA 4A5BA 5C10A 3NH0A 3IAYA 3ENOA 4LSLA 1T3VA 4MLHA 2X6SA 4QAGA 3WXIA 4RTFD 3UKUB 4A57A 2GWKA 1JLGA 2X6NA 3AV9A 3DLLL 1IG8A 3ZSWA 3CI5A 3QFPA 4EZ9A 1VSDA 2QWLA 1U2VB 4DTJA 3F9KA 3TI0A 1BHLA 3MN7A 3RMAA 2GWJA 1ATRA 4I7FA 5BR9A 4X66K 3EN9A 4QS7A 3O4QA 3SUNA 3SQ1A 2RPIA 4DQPA 3WXMB 2IDOA 2FSJA 1NGDA 3MX5A 4YORA 5AFUA 5AZJA 3ZLJA 3MN6A 4IDHA 4GKJK 1Q18A 3HPOA 1CZBA 1WAJA 4BQZA 2ZD1A 1R0AA 2OCEA 3VQCA 4NLBA 5JS2A 3KD1E 1VRTA 2GELA 2P9IA 2O4IA 3HYFA 3L2RA 4CK1A 4K0KK 5JVGL 3M8QA 3OBWA 1FW6A 3ULDA 4NCGA 4XH1A 1YITN 4PKHA 3ZX2A 4I2PA 1EWQA 4A62A 2FC0A 2FBTA 3PO4A 4CK2A 4BR7A 2D4WA 2Q3SA 1NK4A 4BE2A 1HNVA 3RMDA 3RSEA 3CF5L 4M3RA 3WXKA 2G8FA 3QICA 1QQMA 3CCVN 3BF1A 4ELTA 3K2PA 4K41A 2ITMA 4KKOA 2ZM6K 3RMCA 4FJ7A 1TKTA 1MU2A 4H0PA 3VA0A 1XC3A 1BCOA 4NCBA 1O1WA 2YCHA 4G9ZA 3ITHA 1EX4A 5LMNK 1REVA 1CXQA 2VWKA 2GUPA 5BRDA 4CW7B 4JI5K 3RRGA 2D0BA 3ZSVA 2YHYA 3DJCA 3OS0A 4KH5A 4YY3K 1W9HA 4B9UA 3HM9A 1LAWA 3LP0A 3L2WA 5CZ1A 3O08A 4DS5A 3G6EN 3D2EA 5KPZA 2HNZA 3HSTB 1RDBA 1VQMN 1XHXA 2HHVA 2IGIA 1GLCG 3CCUN 1OH7A 2QM1A 2O8FB 5JMVA 4W5RA 5AQGA 4CHNA 1XNRK 4FVUA 4IJAA 3BGRA 1KSPA 1HYZA 2VG6A 3OBYA 3UE5A 4JKHA 3CQ8A 2GX9A 2P9SA 3H45C 3RR8A 4OKKA 4XIUA 2NRRA 4CD1A 3AO2A 4KB0A 3R8EA 2UUBK 4IEEA 3CCMN 1LW2A 1S1TA 3C6AA 4O5BA 3WT0A 3LZIA 3TSUA 1M1KO 4B8AB 4RWTA 4FK2A 4OLBA 1VSHA 2JLEA 4FJMA 1GOAA 1NGJA 4B1WB 4BG8A 3C7NA 5HP1A 4KTWA 1K8KA 2HW3A 3CFPA 2YKNA 1JCFA 3VF4A 1BQNA 5AQKA 2O8DA 3O9TA 5A2QO 3Q7BA 5AQHA 5BPMA 3NH2A 3HBTA 2HF3A 4BR9A 2QWNA 4JV5K 2QWOA 1YJNN 1QTMA 2ASOA 2OPQA 3THXB 4AH9A 3P4IA 1YUWA 4H5RA 3P39A 2HOEA 4K42A 2YNGA 4CHQA 3OY9A 4HTLA 4IFYA 1JXEA 4ID1A 3VEVA 4CHPA 1VQ8N 4YOTA 3F73A 3DXKB 5HL7L 4BACA 1KTQA 1N8RO 5CYQA 3PX6A 2Z1IA 3OYDA 2Q36A 2E6MA 3MN9A 3O6WA 1V4SA 1TAQA 1KD1O 1QHTA 3C0BA 2PAVA 3KKRA 3OYHA 3QBWA 2NLXA 1S5JA 3QBXA 2HBLA 1IBMK 2ZQBA 4OKJA 3I0SA 1J54A 4IOCL 4MFBA 2E6LA 4CJKA 4FLWA 3D2FA 2O8EA 3LDQA 2W6KA 3K59A 5AQYA 1NMDA 4ISGA 1C0TA 2A41A 1SKSA 1HQEA 2P9LA 4I6MB 2B5JA 3SCXA 3HTVA 2F96A 4CJPA 3AO3A 3OYIA 3EZWA 3FFKB 2B6AA 2NRWA 4LFCK 3I8BA 3MEGA 5AQZA 3PIPL 3TAEA 3EE9A 3H3NO 1Z25A 1TUUA 2JWKA 4QS9A 3KWIA 2GUIA 1BGXT 4AQYK 4CGJA 3O5BA 1MDUB 1JKHA 4FWLA 3KLIA 2G8WA 3O4NA 4ELVA 5DM7L 4FLYA 2BUPA 4FJJA 5DK5A 5GADP 1WBDA 2ZJRL 3K5NA 5C24A 5AZJB 4DMNA 4A5AA 1KVAA 3OHRA 4I6MA 2UXBK 1OH5A 1ESVA 3H3OB 4CEOA 5AQMA 3DLHA 3MWPA 1TV6A 1RT3A 3ZT4A 1VQ9N 4M3WA 1BO5O 1Q7YO 5FPEA 2O8DB 3V81A 1IV0A 3ID8A 4DU3A 4PKGA 4V19S 2PYJA 1YXQA 3CCRN 3G71N 4DLEA 3QB0A 3R9PA 3SLCA 1VQNN 1NGGA 4I2QA 3VQ9A 2E8AA 3ZCMA 3K58A 5JLFA 3TU5A 4ELUA 3OJUA 3CJ1A 3VGMA 3F5TA 4OKEA 4GMJB 4WQ5A 1B92A 2RE2A 4M3YA 4BRHA 3EYZA 4PKIA 5GIOA 4NYFA 5AQQA 3LM9A 3MDQA 4JN4A 3KKSA 4QCLA 4C8LA 4JRQA 4CZIA 3CFOA 1BA1A 1VRUA 1T7PA 1EP4A 1KFDA 5AQOA 3PLAA 3SI6A 1IKYA 1W0HA 3PSFA 4H0OA 4JHDA 1NJYA 3VOVA 5AQPA 2V7ZA 1JLQA 1JLFA 4BR5A 5LY3A 3CC4N 3ATVA 3TAMA 3ATUA 5ELZA 4F4KA 2IVNA 3H6EA 4JKGA 4JI2K 3AARA 3HP9A 3AO5A 4B08A 4E89A 4H0YB 3L2VA 5JICA 4FM0A 2BGGA 4F2SA 4DUYK 3SUPA 4JKDA 1KAXA 2F9WA 5GAEP 4B9SA 1HNXK 1HPMA 4YOVA 3AY9A 4B1UB 1C1BA 5KGWA 2P9UB 2QTDA 2KFZA 4CFAA 2P9KA 3K5OA 3KLFA 4CZLA 4IZ9A 4FYDA 2F7TA 3DXMB 1EKEA 3L4QA 3VGKA 1HUXA 1Q9YA 2KLAA 4IDKA 3HPGA 1SKWA 3NGIA 3D6RA 3IG1A 1VSEA 5AQSA 3NVKA 4BG9A 2D1KA 4GV6A 1KC8O 4O44A 1NOYA 3H1QA 1NK8A 4JI4K 2X78A 3OYNA 3W0LA 4N76A 3BZCA 3DXMA 4IBNA 5LJWA 3MXIA 4OPAA 3HK2A 3P1GA 1VSLA 4CJ5A 4BWJA 1YF5L 4ZHRA 5CYMA 2XRIA 1VHXA 2G8HA 4DU1A 2G8VA 2VGNA 4BRIA 4FLXA 1DTTA 3I0RA 4DR4K 5AQXA 3JAMO 3VF6A 3LM2A 2VG7A 4CGDA 3QEPA 2QKKA 4CHOA 4G1QA 3TPQA 3JSMA 1KAYA 1WB9A 3KTQA 4BR2A 1KXPA 5C42A 2JGUA 1BIZA 1JXBA 3L4IA 5FRNA 5FRMA 1E3MA 3NGYA 4DQSA 4N41A 1VSIA 4FPAA 4JKAA 2XO7A 3HRGA 2IAJA 3KHYA 2LSNA 3ZSZA 3KIOA 2BTFA 3MEEA 3KLEA 4DWIA 3A2FA 1VQ5N 4GV3A 2IC3A 2XY8A 4J2DA 2I7NA 4B1YB 4IOAL 4CIGA 1J9AA 3ZX3A 3PO5A 5AQVA 1RGIA 3AVJA 2P9NB 1RTHA 3EL2A 4CBXA 1K8KB 3V1RA 4E3SA 4FJGA 4FWPA 1IKXA 2EX3A 3JS6A 1BI4A 1DGKN 4DR3K 1W7AA 4C1NK 3VTHA 3LAKA 1HPZA 5AQJA 4A59A 1X9WA 4KV8A 3TSQA 1NBWA 1D8YA 4CZEA 4AHTA 1DTQA 4KI4A 4EHUA 3UKRB 4TSXA 3OYJA 3S3MA 2ZF5O 3ZSOA 1VQKN 1BUPA 1NOZA 4YOUA 2EHGA 5D3GA 2P9PA 3QO9A 1X3NA 3FZFA 2YNHA 4YHHK 4WE1A 1G99A 2QWQA 1TVRA 4RW6A 2OPSA 1TKDA 3SBTA 2AA4A 1OVQA 3OTOK 1S1WA 3MCPA 2BE2A 4BROA 3MK6A 2XHBA 2RKIA 4H0VB 4M7XA 4L3QA 3SBGA 3CM6A 3VEOA 4LSNA 1XWLA 2EWSA 4DB3A 1HJOA 3TAQA 4Z94A 4H5VA 4M7YA 3IRXA 4BR0A 4KAZA 5KI6A 5F0XA 3HP6A 3MWTA 4DV1K 1L3VA 1XUPO 3AAPA 1KLMA 3FZMA 1B9DA 2HB5A 3V1QA 4KI6A 4O0IA 1NM1A 1RT5A 4NXMK 4U7BA 3K0SA 4HCCA 4FVMA 3B8AX 1UAXA 2VWBA 1S9EA 1GLBG 4IO9L 1HNWK 3HOTA 1T6DA 4KO0A 4OX9K 2WC9A 3HI0A 1DLOA 4YFUA 5EU7A 2HMIA 4CJWA 5HRPA 5I9EB 4RW8A 3KK2A 3U6FA 2O8CA 1LWEA 4OJRA 1DT9A 1T6CA 2KW4A 5AQTA 1UA1A 1NJXA 2YKMA 4FPBA 2FBYA 5E26A 4CERA 3ZSXA 2HHTA 1ZBSA 3O3GA 3UIQA 3SAGA 2PY5A 3HJFA 2YNFA 4OLAA 1IKWA 3O9QA 2NNWA 1U4BA 2DY4A 2YNIA 1L5UA 3AVHA 1WAFA 5GINA 3HXMA 1J5OA 3VESA 1ILYA 4OPJA 5J2PA 4B9LA 2YHWA 4FJ9A 3CPEA 4FW1A 3A5NC 3HM8A 1NGBA 1HRHA 2QWRA 1MWMA 2KTQA 3S3NA 1NK6A 4DQIA 3EKUA 4EFHA 4JYAK 4AILC 2FLOA 2Z1HA 3IUCA 2R7YA 3CMAN 3LDNA 4CHZA 2UUCK 4DQRA 5BPNA 3Q7CA 3OS2A 3ZYYX 2IS3A 3SPZA 3U3GA 4NXNK 1NGIA 2ZGYA 1XC9A 3L0QA 3TTDA 4U67L 5FPDA 1U2VA 4CHYA 1RT2A 2F8TA 4B3TK 4B9MA 4DV7K 1EO1A 3VN5A 4FLVA 4B1VA 5J1EA 4DR6K 3OYFA 1T05A 3C65A 1ZC6A 3MECA 1N36K 4CESA 4BDYA 5JS1A 1RT7A 2Q97A 2IVOA 2RN2A 1TYQB 3K9JA 4JK7A 2D0CA 2G8KA 2NRXA 4J2AA 3M8SA 3CG7A 2ZE2A 5CZ2A 3NHGA 3L2UA 4DTRA 3DAWA 4BE0A 1B9FA 3QERA 3BF3A 1FKPA 1SZ2A 4A2AA 3D2EB 3N4PA 3CCJN 3FE1A 4JI1K 5LJVA 3WEEA 4JLHA 3FR0A 3DRSA 3OYBA 2WFBA 2DFFA 1GOCA 1KFSA 4DR7K 3QIPA 1L3SA 3VEXA 4ISEA 4DV3K 2P5OA 4HHTA 4B9NA 3DOLA 2HBMA 1HMVA 1NWKA 4N5SA 2O8BB 4CFCA 4KHUA 4CGHA 1WSFA 5JVHL 3K57A 1S1XA 4JD2A 1C0MA 4LD0A 4GW6A 3DXKA 4KFBA 5C12A 1ATSA 4DF4A 1NKBA 2ASMA 2O4GA 4LF7K 4DLGA 3DLRA 4JRPA 3VQPA 3KLGA 2ZGZA 1LOTB 4BC3A 2DFHA 1LW0A 5GAHP 1X9SA 3RRHA 3DLBA 4DR5K 2ATQA 3S41A 2BDPA 1S1VA 4BRGA 3V9SA 2OZSA 1BISA 5F1XA 1WSIA 1RT6A 3QETA 2XY5A 2Q31A 2PYLA 4XEIA 4Z4HA 3TABA 3L8BA 5BN9A 5M1QA 1WSJA 4DV0K 5KPTA 4NCAA 3SK3A 4IEIA 3NCIA 1SL2A 2G8UA 4W5TA 1X9MA 4O0JA 3SYZA 5AQRA 1RTJA 3LWMA 4B3OA 3THXA 4H4OA 1UOCA 4M45A 3HO1A 3IFRA 4NO7A 1WSHA 4FJNA 4GV9A 3J7YP 5FPNA 3ULEB 3OYMA 3JYTA 2PZSA 2PFUA 4W5QA 4C8NA 5HOOA 1NJIO 4FM2A 4DR1K 1KQSM 3T1YK 3AVBA 2QWPA 3B6PA 5KTQA 2ETJA 2YJEA 3CFRA 2QXFA 4AM6A 1M90O 1KVCA 1QQOA 3V4IA 2H3GX 3NDKA 3VQEA 3K5MA 1XHZA 5J2MA 5TKYA 2OPPA 4FWRA 1C6VA 2IOCA 1EWRA 3ULEA 1RDWX 3EO3A 1TK8A 3O9UA 4LH5A 3V6DA 4FWMA 1IBKK 1SUQA 3LALA 1VSMA 5JLHA 3VQ4A 4CEEA 4E19A 1LV5A 4BC4A 2BH1A 5AQFA 3HT3A 5AQUA 3K5LA 5DM6L 2HHHK 4FOEA 3VQ7A 4KHPK 1TL3A 3IS9A 4O55A 4DV4K 3CCQN 1YVNA 4HTUA 4RW4A 4Z0UA 1U47A 1U04A 3ALYA 1G15A 3O1WA 1TKZA 1Z05A 4X62K 4JKCA 4JD2B 4F3OA 1A5XA 4I9LA 1TYQA 5SWMA 4JI3K 5AJ3K 3VQQA 4FJHA 1NNEA 4FJIA 3KK7A 1RBRA 2J4RA 4B1ZA 4O4GA 5EX5A 3F9MA 1Q81O 3ZSRA 1BL3A 3KD5E 3EEQA 2KQ2A 2YHAA 3I8DA 2HHXA 4OGCA 4CIEA 4KHQA 1VQ6N 1JL1A 3AVMA 1RNHA 1RDDA 3WNGA 2KZZA 3OW2M 5AZIB 3E9OA 3CMEN 3J7AP
chains in the Genus database with same CATH topology
4DV0K 4DUZK 1IBLK 4B3TK 4DV7K 4DV5K 4DR4K 1J5EK 3JAMO 5LMNK 4DR6K 4LF6K 4DV1K 4LFBK 4B3RK 4CW7B 3J81O 4JI5K 1N36K 4X64K 4NXMK 4JI7K 2UU9K 4GKKK 3J7YP 1FJGK 5BR8K 5LL6Z 4YY3K 4CVNE 3J80O 4DR1K 5IWAK 1XMOK 1HNWK 3T1YK 4JI6K 4OX9K 5LMUK 2E5LK 4X66K 1IBMK 5FLXO 4LF5K 3T1HK 4JI2K 4DR2K 4JI1K 1XNRK 4DUYK 4GKJK 1IBKK 4DR7K 2UUAK 1HNXK 4DR3K 4LFCK 4JI0K 4DV3K 2HHHK 4KHPK 4B3SK 4AQYK 2UUBK 4DV4K 4K0KK 1XNQK 2F4VK 4X62K 1N33K 4DV2K 4JI3K 1N34K 2UXBK 1I94K 5AJ3K 2VQEK 2VQFK 4JYAK 5IT9O 4LF4K 4LFAK 4LF8K 4LF9K 2UUCK 4YHHK 4JI8K 4LF7K 1N32K 4JI4K 4DR5K 4B3MK 1HNZK 2UXCK 1HR0K 5A2QO 3OTOK 4V19S 2UXDK 4DV6K 1XMQK 4NXNK 4JV5K 4X65K 2ZM6K 3J7AP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 K;  4DUZ K;  1IBL K;  4B3T K;  4DV7 K;  4DV5 K;  4DR4 K;  1J5E K;  3JAM O;  5LMN K;  4DR6 K;  4LF6 K;  4DV1 K;  4LFB K;  4B3R K;  4CW7 B;  3J81 O;  4JI5 K;  1N36 K;  4X64 K;  4NXM K;  4JI7 K;  2UU9 K;  4GKK K;  3J7Y P;  1FJG K;  5BR8 K;  5LL6 Z;  4YY3 K;  4CVN E;  3J80 O;  4DR1 K;  5IWA K;  1XMO K;  1HNW K;  3T1Y K;  4JI6 K;  4OX9 K;  5LMU K;  2E5L K;  4X66 K;  1IBM K;  5FLX O;  4LF5 K;  3T1H K;  4JI2 K;  4DR2 K;  4JI1 K;  1XNR K;  4DUY K;  4GKJ K;  1IBK K;  4DR7 K;  2UUA K;  1HNX K;  4DR3 K;  4LFC K;  4JI0 K;  4DV3 K;  2HHH K;  4KHP K;  4B3S K;  4AQY K;  2UUB K;  4DV4 K;  4K0K K;  1XNQ K;  2F4V K;  4X62 K;  1N33 K;  4DV2 K;  4JI3 K;  1N34 K;  2UXB K;  1I94 K;  5AJ3 K;  2VQE K;  2VQF K;  4JYA K;  5IT9 O;  4LF4 K;  4LFA K;  4LF8 K;  4LF9 K;  2UUC K;  4YHH K;  4JI8 K;  4LF7 K;  1N32 K;  4JI4 K;  4DR5 K;  4B3M K;  1HNZ K;  2UXC K;  1HR0 K;  5A2Q O;  3OTO K;  4V19 S;  2UXD K;  4DV6 K;  1XMQ K;  4NXN K;  4JV5 K;  4X65 K;  2ZM6 K;  3J7A P; 
#chains in the Genus database with same CATH topology
 4B8C A;  5I42 A;  4DSL A;  1NGC A;  1QZ5 A;  3R1X A;  1HQU A;  3T7Z A;  1YJ9 N;  5BPL A;  4AHU A;  5CHI A;  3IKM A;  4FK4 A;  1X3M A;  3C6H A;  3DLK A;  3J81 O;  5KRT A;  1U6Z A;  3C94 A;  4N47 A;  2A40 A;  3SZ2 A;  3P83 D;  3VQD A;  1DKG D;  1RBU A;  4YOY A;  4CVN E;  3K9K A;  1NJZ A;  3J8A A;  4FL9 A;  4ICL A;  1D4X A;  2P9L B;  5EY4 A;  3VER A;  1NK5 A;  1QVF M;  3AVN A;  3HL8 A;  3OS1 A;  1T03 A;  3LAN A;  4LY7 A;  4FLU A;  3H1V X;  1D5A A;  1KLN A;  3I56 N;  2GTD A;  1QVG M;  2W41 A;  1S1U A;  3AO4 A;  3FZH A;  3WXL A;  5DMR A;  1S6P A;  1SAZ A;  3HZ6 A;  1QHA A;  4MO5 A;  3ZT3 A;  4CZM A;  4PL7 A;  1Q9X A;  5FDL A;  4BRK A;  2ITG A;  4RW9 A;  3QDK A;  1BU6 O;  3CPW M;  4WYB A;  1JJ2 M;  4ILJ A;  4JI0 K;  3VF2 A;  4E7H A;  1QE1 A;  3QES A;  3GL1 A;  3MXJ A;  5M1F A;  4WFB L;  3EY1 A;  4CEB A;  4FJK A;  5C0Y A;  1U49 A;  3WNF A;  4CJ7 A;  3NBP A;  4Z4G A;  4DV2 K;  1FXX A;  3SUO A;  1X9J A;  3A8Y A;  4UY8 O;  4WF9 L;  3MN5 A;  5EVZ A;  4QOZ B;  1RDA A;  4PWD A;  4Z4C A;  2XY6 A;  3U9D A;  3C7N B;  2FBV A;  3NE6 A;  2OAN A;  1N32 K;  2E1Y A;  1GLL O;  3AVF A;  2ZJP L;  4CZF A;  4JNE A;  4DV6 K;  1NGH A;  1YVU A;  3VET A;  2HMP A;  1R59 O;  5M1K A;  4FK0 A;  5MLC Q;  2HHS A;  4FZY A;  3IMX A;  3OYA A;  3TAF A;  2HVH A;  4H8K A;  3AAQ A;  3F2K A;  1RCH A;  4B9T A;  3L3U A;  1BI4 B;  1SKR A;  4DFK A;  1RBV A;  2WON A;  4NYN A;  4HUE A;  4Q0B A;  1JL2 A;  4BE1 A;  1RT4 A;  2E1Z A;  4FWO A;  4B1X B;  4X64 K;  4L8R B;  2FF6 A;  1EQY A;  3CCE N;  4J2E A;  2O8F A;  2X74 A;  1C0U A;  2BAN A;  3A0I X;  4IG3 A;  3NGZ A;  3GDQ A;  4UQG A;  3O3F A;  1T44 A;  2Q0R A;  4JI6 K;  1NJW A;  5LMU K;  3ZET B;  2YJF A;  2A5X A;  2O8B A;  1W97 L;  3T19 A;  4C8K A;  1IG9 A;  4QS8 A;  4CJT A;  1EET A;  2KHO A;  4BRE A;  2FSN A;  5FLX O;  3NF7 A;  3CHW A;  2V7Y A;  3FLC O;  2P9K B;  3I55 N;  3PIO L;  4E1J A;  4JAX A;  4M63 C;  3SJJ A;  4MDB A;  3QLH A;  4EHT A;  3CET A;  4FLZ A;  3T3F A;  1SV5 A;  2F9T A;  3CXC M;  1HKC A;  3ZEU B;  3QIN A;  3QNO A;  1WNS A;  3CJB A;  3V1O A;  4BRM A;  2P51 A;  3V9W A;  3HVT A;  1RT1 A;  1NGE A;  4J2B A;  1KVB A;  3OA9 A;  4DTU A;  2F4V K;  4FJL A;  3CM5 A;  3OYC A;  3A5M C;  1N34 K;  2QKB A;  3DLG A;  1VK0 A;  1HNI A;  3G25 A;  4CJQ A;  2ZJQ L;  4CEA A;  3RSE B;  4EZ6 A;  5E84 A;  4IKF A;  4WFA L;  3TAR A;  2A6A A;  2OYQ A;  2FSK A;  1RDU A;  3HPH A;  3TSP A;  1HNZ K;  3LDO A;  2O8C B;  3NF6 A;  4GVM A;  2Q2R A;  2YHB A;  5BRF A;  3VEZ A;  4CE9 A;  2VCP A;  1HKG A;  1JCE A;  3LDL A;  3SAH A;  4HUG A;  1FK9 A;  5KQ8 A;  4CZJ A;  2YX6 A;  3OJS A;  4MLE A;  1T8E A;  4H5N A;  3SJH A;  4FO0 A;  4DSK A;  4ID5 A;  1C1A A;  4BRP A;  4Q5V A;  3V9U A;  1KRP A;  4ZTF A;  1WN7 A;  4AHC A;  1C0F A;  2NUB A;  3P31 A;  4FM1 A;  3MMV A;  3BDP A;  4XH4 A;  1IO2 A;  1LWF A;  3VEY A;  4JI7 K;  1NMN A;  2QWM A;  4CJF A;  3LDS A;  3DRP A;  1N5Y A;  3OYK A;  2Y1I A;  4IOX A;  1ITG A;  1Q8I A;  4CF8 A;  3WQU A;  1LCU A;  2D0O A;  4F2R A;  2DPN A;  4BR4 A;  4M3X A;  5KGX A;  4DFJ A;  4JHD B;  2E5L K;  3AVA A;  4F9O A;  3CIP A;  3O9S A;  4IFV A;  4DTO A;  1U45 A;  2KFN A;  4KH6 A;  4BVP A;  3UKU A;  2HBJ A;  3NFA A;  1RDC A;  5BRE A;  4CFB A;  4M3Z A;  4OPK A;  5J2N A;  5H1S Q;  4H4M A;  4I9Q A;  3THW A;  4BWM A;  4M42 A;  3RVC A;  4CGG A;  1S9G A;  4OO1 J;  3QNN A;  4DU4 A;  4J8F A;  3L3V A;  3MCA B;  5AQI A;  3FZL A;  4CBU A;  1C0G A;  3M8R A;  4M41 A;  3THY A;  3CER A;  2E88 A;  1BWF O;  1N33 K;  4E0D A;  2W6L A;  1WBB A;  3UB5 A;  3LAM A;  4H0T B;  5KQD A;  1QSL A;  4JKE A;  2E2O A;  2WTU A;  2NZT A;  4JI8 K;  3AGR A;  1ASW A;  1RTI A;  1HKB A;  2E2N A;  2VYP A;  1V4T A;  2UXC K;  1BIU A;  2QXL A;  1IH7 A;  3HSC A;  3MX2 A;  1XMQ K;  4AF1 A;  1J53 A;  5EXW A;  4X65 K;  3U3Y A;  3AVG A;  3VTI A;  3PSI A;  3ZEU A;  1NK0 A;  4PUO A;  1IBL K;  1TUY A;  2VG5 A;  4FWK A;  1OH8 A;  3BP8 A;  4CD3 A;  3SMP A;  4LF6 K;  2V51 B;  2IVP A;  1A5W A;  1Y97 A;  4JKF A;  4W5O A;  1WSG A;  4GNI A;  4JS5 A;  3J80 O;  3OYG A;  3EZ5 A;  1XMO K;  4AHS A;  3WQT A;  1QSS A;  4H0X B;  4PHT X;  4CF0 A;  4IO8 A;  1L3T A;  2AP1 A;  4HVJ A;  4K8Z A;  5CY4 A;  1YI2 N;  4JK8 A;  4JS4 A;  4FLT A;  2OPR A;  4ZTJ A;  5C2D A;  3SNN A;  4PA1 A;  3KWG A;  3T1H K;  3VEN A;  4CEQ A;  5J2Q A;  3P5J A;  4BRA A;  1C1C A;  3DMJ A;  4A61 A;  3O4W A;  4GVE A;  3O3H A;  1Q86 O;  1RIL A;  4YOX A;  3C95 A;  1VAZ A;  1YIJ N;  3ENB A;  1S6Q A;  5M1P A;  2NRZ A;  4F8R A;  3DYA A;  3BZK A;  5HRR A;  3KLH A;  3SQ4 A;  1CZ9 A;  3U9Z A;  3SQ0 A;  2I7P A;  1VSJ A;  3RWU A;  3AVC A;  4DTX A;  4BGB A;  3BEX A;  4RW7 A;  4E1N A;  1NLV A;  5CR4 A;  4BRN A;  3E1Y A;  3VMF B;  2Z1G A;  1IKV A;  4CEF A;  3QFU A;  5T7B A;  4LF9 K;  5KPR A;  3CCL N;  3GBT A;  1SS6 A;  4E7I A;  4DG1 A;  4AM7 A;  5I3U A;  1I3A A;  4JEP A;  2WBN A;  3NMU A;  4B3M K;  4CJU A;  3PY8 A;  3AVI A;  4H5W A;  5CE3 A;  4KRF A;  1QZ6 A;  3O8M A;  5AQN A;  2A3Z A;  1RTD A;  1YJW N;  1WLJ A;  4EP4 A;  1VQP N;  1Z26 A;  1CXU A;  3H46 O;  4MO4 A;  4Y1C A;  4FWS A;  4ISF A;  4DV5 K;  2Z1J A;  3M6G A;  4B9V A;  3CCS N;  3LDP A;  1RBT A;  3CJA A;  3THY B;  1KCF A;  1GLJ O;  2Q0U A;  1ZBH A;  4WFN L;  3TTF A;  1N6Q A;  2P9S B;  4KHS A;  4CI6 A;  3N4Q A;  4FSV A;  2YV0 X;  4AHV A;  3PX0 A;  1TK5 A;  1HX1 A;  1DEJ A;  2D0P A;  4R79 A;  3KJV A;  4JK9 A;  5HRS A;  3S3O A;  3ZSQ A;  4CJ3 A;  4OVL A;  4KHY A;  3LL3 A;  5BN8 A;  2HHW A;  4RCH A;  1LWC A;  4Y0W A;  4DR2 K;  2P5G A;  3QEX A;  2ZWH A;  2CGK A;  1ASU A;  4YOW A;  3NVM A;  5E41 A;  1BCM A;  4EIA A;  2P9U A;  3VEW A;  3M8P A;  3SAF A;  3ASM A;  1NKE A;  2HST A;  4JKB A;  2GEM A;  1OKJ A;  3GG4 A;  3QEI A;  3SMS A;  1WSE A;  4CJE A;  4B3S K;  4BY9 C;  4ILH A;  3LP1 A;  4YDU A;  1K9M O;  2HHQ A;  2F8S A;  3DLE A;  3D2F B;  2OZM A;  2O8E B;  5AQL A;  1BDG A;  1QSY A;  1I94 K;  1BOT O;  2WOM A;  4FWQ A;  2VQF K;  2ASP A;  3R6M A;  3SQ2 A;  4LFA K;  4IG0 A;  2E2Q A;  4HCB A;  1GLA G;  4IJN A;  2UYT A;  2HBK A;  3VQ8 A;  1QS4 A;  4C1N I;  4MDA A;  1U48 A;  4DCH A;  2A1S A;  5BRH A;  3RMB A;  4CJR A;  2QK9 A;  3DWL A;  2YHX A;  4B9Q A;  3NF8 A;  1SL0 A;  1RFQ A;  3DRR A;  1NU0 A;  1TGO A;  2DFE A;  4OGE A;  4BDP A;  3E9P A;  5HBM A;  5C25 A;  3OYE A;  1VSK A;  4GY2 B;  1ZBU A;  3C6U A;  4FJ5 A;  1Y64 A;  4CBW A;  4CFD A;  1CLQ A;  3QEV A;  3TTC A;  4CZK A;  3CQY A;  3EE8 A;  4CF2 A;  3D0P A;  3KK3 A;  2Q1N A;  3ENH A;  3U4L A;  4DKW A;  4DFM A;  3CC7 N;  3FFI A;  4B3R K;  5SZT A;  1TL1 A;  3CJ9 A;  4DSF A;  1ASV A;  1F21 A;  3BY5 A;  3MED A;  4M3U A;  4GKK K;  4AHR A;  1FJG K;  5LL6 Z;  1S22 A;  2KKZ A;  3QEW A;  1VQL N;  1NGF A;  2HVI A;  3O1B A;  3MXM A;  4CCH A;  1VQO N;  3RR7 A;  3E9L A;  5F2R A;  2D5R A;  1YTA A;  3A5O C;  1K8A O;  4C23 A;  3PX4 A;  3AGK A;  3PUF A;  3BUZ B;  4CED A;  3AVL A;  2FBX A;  2FF3 B;  2W40 A;  3VQB A;  1NKC A;  4LH4 A;  2CGL A;  3WXJ A;  1Z6R A;  2E20 A;  5K14 A;  2VWJ A;  1J6Z A;  4K43 A;  3S9H A;  4CJV A;  4BDZ A;  4KHN A;  2CGJ A;  1QQN A;  4CK3 A;  1ZXO A;  3B6O A;  1D9D A;  1KAZ A;  3VQ5 A;  2UUA K;  4OPH A;  3DM2 A;  2Y1J A;  3HVR A;  4RG8 A;  3H08 A;  4CF1 A;  4C8O A;  1GOB A;  3I33 A;  3EKS A;  3G4S N;  1WUA A;  3THV A;  3FGU A;  3O80 A;  5C2F A;  4FWN A;  3ZT1 A;  1FKO A;  1GLD G;  4CZG A;  3MAQ A;  2E4L A;  1JCG A;  4N56 A;  3A5L C;  3QML A;  4ILG B;  4BRF A;  3VPZ A;  3C6T A;  1SQK A;  4CGF A;  4DS4 A;  5IT9 O;  5C15 A;  4F3T A;  2V52 B;  1GLF O;  3NH1 A;  3JXU A;  4IWV A;  3LZJ A;  4KTQ A;  3QIO A;  3TAP A;  4WCE L;  2RF2 A;  4DTS A;  3M3Z A;  4BRL A;  1HR0 K;  4KH4 A;  3THW B;  1RBS A;  4E1M A;  3TR8 A;  4Z4E A;  4NB4 A;  1OVY A;  4KBO A;  4CEZ A;  4MQ3 A;  4DTM A;  2NRV A;  5TKW A;  4DUZ K;  3PV8 A;  4O8U A;  4YDU C;  3CJ7 A;  4E7K A;  4BRQ A;  1ZBF A;  4DFP A;  3DI6 A;  1J5E K;  4DHY A;  1JLB A;  4KRE A;  4CJS A;  2E2P A;  4KTZ A;  1QQC A;  1UA0 A;  1WOQ A;  4WQ4 A;  3CC2 N;  1ZBI A;  3TAG A;  4K8X A;  5IWA K;  3OYL A;  1K73 O;  4C8M A;  1A5V A;  1HLU A;  4FW2 A;  1HJR A;  3G10 A;  3E66 A;  5FPM A;  3U8X A;  4DSE A;  2XY7 A;  2FXU A;  4A2B A;  2G8I A;  3M5R A;  4BC2 A;  2OTJ N;  1O13 A;  4PQU A;  4KHW A;  3ZT2 A;  3DOK A;  2QA4 N;  1NK9 A;  5HRN A;  2DTU A;  1P8Z A;  3GE1 A;  2CH5 A;  2PBD A;  3CQX A;  3WNE A;  2VGM A;  3KVG A;  2A1R A;  2NRT A;  3ZX0 A;  4FZZ A;  1JLC A;  3TAN A;  4Z4F A;  3ZSY A;  3NAE A;  1L3U A;  4CJL A;  1OH6 A;  2B4J A;  2QW9 A;  5EOY A;  2P9N A;  2RHK A;  3ZT0 A;  5GAG P;  1MA9 B;  3J7Z O;  3SV3 A;  3V9Z A;  2HNY A;  2QEX N;  4BRC A;  1XNQ K;  4O5F A;  1XQS C;  3WEE B;  1E4G T;  2YI1 A;  3CJC A;  3AA3 A;  4EAH D;  3KK1 A;  4FOI A;  4O8K A;  2VQE K;  4CEC A;  2QI2 A;  1NGA A;  1VQ4 N;  1EXQ A;  4LF4 K;  1JLA A;  2HF4 A;  4CGI A;  3E01 A;  4JKG B;  5KRS A;  3CD6 N;  4W5N A;  5ADX A;  5M1N A;  1LAV A;  1YT3 A;  1S72 N;  5HRO A;  3AA2 A;  5FRO A;  1UWB A;  4Y1D A;  4H5T A;  4Z4I A;  2JWL A;  3HOS A;  4BRD A;  3VQA A;  3T69 A;  3G0Z A;  4DQQ A;  5HLF A;  3LPU A;  2OA8 A;  5AR0 A;  2I5J A;  3O9R A;  2W42 A;  4FXD A;  4KPY A;  4LFB K;  3ISN C;  4XH5 A;  3ZET A;  4FZX C;  3WNH A;  4DQ8 A;  1H1V A;  4KB1 A;  4EP5 A;  3VA3 A;  2UU9 K;  4E7J A;  3LPT A;  5BR8 K;  4WQ5 C;  4HWI A;  4DSI A;  1TAU A;  1SL1 A;  2D0A A;  4BC5 A;  1YHQ N;  1BA0 A;  3UKR A;  1BQM A;  1ZBL A;  4H03 B;  4CIF A;  2OTL N;  1GLE G;  4HUF A;  4NLC A;  4BVO A;  3SUQ A;  3AVK A;  4E7L A;  3V9X A;  2WUS A;  3VGL A;  4LF5 K;  1TKX A;  5M1O A;  3OVN A;  1VQ7 N;  1ZYQ A;  4M3T A;  2IIR A;  4IFE A;  4FJX A;  2GBZ A;  2GV9 A;  4DTN A;  3M1F A;  3L6Q A;  3LWL A;  2AJQ A;  5GIP A;  4PY5 A;  2NRH A;  5AFU H;  4CJ4 A;  3AA5 X;  3R3L A;  3KZB A;  3T1A A;  4CZH A;  3GOI A;  5AQW A;  1BG3 A;  2CH6 A;  4DF8 A;  3LP2 A;  1YAG A;  5B8H A;  4DSJ A;  4WQ4 C;  2P9I B;  2P9P B;  2HHU A;  4FJ8 A;  4PL8 A;  3CYM A;  3NF9 A;  3ID6 A;  3D7E O;  3D45 A;  3AO1 A;  3AA4 A;  5AZI A;  1MWK A;  4BQL A;  3SV4 A;  4DTP A;  4LF8 K;  1VSF A;  3W3D A;  3SPY A;  1NG9 A;  1IJJ A;  5ADX H;  3IDH A;  1W2B M;  2A42 A;  1I39 A;  3RTV A;  1XI1 A;  1TK0 A;  2P1J A;  1CZA N;  3L2Q A;  1NK7 A;  1K6Y A;  1D9F A;  3WUH A;  3P38 A;  3VQ6 A;  4FCY A;  1Q82 O;  1HYV A;  1JLE A;  2UXD K;  2KZM A;  1YTU A;  2HND A;  4BGA A;  4LC9 B;  4CF9 A;  1HYS A;  4YNQ A;  4R5P A;  3TWH A;  4IXC A;  4K25 A;  3LP3 A;  1X1P A;  1P90 A;  3FZK A;  1S3X A;  1E4F T;  1ATN A;  4A5B A;  5C10 A;  3NH0 A;  3IAY A;  3ENO A;  4LSL A;  1T3V A;  4MLH A;  2X6S A;  4QAG A;  3WXI A;  4RTF D;  3UKU B;  4A57 A;  2GWK A;  1JLG A;  2X6N A;  3AV9 A;  3DLL L;  1IG8 A;  3ZSW A;  3CI5 A;  3QFP A;  4EZ9 A;  1VSD A;  2QWL A;  1U2V B;  4DTJ A;  3F9K A;  3TI0 A;  1BHL A;  3MN7 A;  3RMA A;  2GWJ A;  1ATR A;  4I7F A;  5BR9 A;  4X66 K;  3EN9 A;  4QS7 A;  3O4Q A;  3SUN A;  3SQ1 A;  2RPI A;  4DQP A;  3WXM B;  2IDO A;  2FSJ A;  1NGD A;  3MX5 A;  4YOR A;  5AFU A;  5AZJ A;  3ZLJ A;  3MN6 A;  4IDH A;  4GKJ K;  1Q18 A;  3HPO A;  1CZB A;  1WAJ A;  4BQZ A;  2ZD1 A;  1R0A A;  2OCE A;  3VQC A;  4NLB A;  5JS2 A;  3KD1 E;  1VRT A;  2GEL A;  2P9I A;  2O4I A;  3HYF A;  3L2R A;  4CK1 A;  4K0K K;  5JVG L;  3M8Q A;  3OBW A;  1FW6 A;  3ULD A;  4NCG A;  4XH1 A;  1YIT N;  4PKH A;  3ZX2 A;  4I2P A;  1EWQ A;  4A62 A;  2FC0 A;  2FBT A;  3PO4 A;  4CK2 A;  4BR7 A;  2D4W A;  2Q3S A;  1NK4 A;  4BE2 A;  1HNV A;  3RMD A;  3RSE A;  3CF5 L;  4M3R A;  3WXK A;  2G8F A;  3QIC A;  1QQM A;  3CCV N;  3BF1 A;  4ELT A;  3K2P A;  4K41 A;  2ITM A;  4KKO A;  2ZM6 K;  3RMC A;  4FJ7 A;  1TKT A;  1MU2 A;  4H0P A;  3VA0 A;  1XC3 A;  1BCO A;  4NCB A;  1O1W A;  2YCH A;  4G9Z A;  3ITH A;  1EX4 A;  5LMN K;  1REV A;  1CXQ A;  2VWK A;  2GUP A;  5BRD A;  4CW7 B;  4JI5 K;  3RRG A;  2D0B A;  3ZSV A;  2YHY A;  3DJC A;  3OS0 A;  4KH5 A;  4YY3 K;  1W9H A;  4B9U A;  3HM9 A;  1LAW A;  3LP0 A;  3L2W A;  5CZ1 A;  3O08 A;  4DS5 A;  3G6E N;  3D2E A;  5KPZ A;  2HNZ A;  3HST B;  1RDB A;  1VQM N;  1XHX A;  2HHV A;  2IGI A;  1GLC G;  3CCU N;  1OH7 A;  2QM1 A;  2O8F B;  5JMV A;  4W5R A;  5AQG A;  4CHN A;  1XNR K;  4FVU A;  4IJA A;  3BGR A;  1KSP A;  1HYZ A;  2VG6 A;  3OBY A;  3UE5 A;  4JKH A;  3CQ8 A;  2GX9 A;  2P9S A;  3H45 C;  3RR8 A;  4OKK A;  4XIU A;  2NRR A;  4CD1 A;  3AO2 A;  4KB0 A;  3R8E A;  2UUB K;  4IEE A;  3CCM N;  1LW2 A;  1S1T A;  3C6A A;  4O5B A;  3WT0 A;  3LZI A;  3TSU A;  1M1K O;  4B8A B;  4RWT A;  4FK2 A;  4OLB A;  1VSH A;  2JLE A;  4FJM A;  1GOA A;  1NGJ A;  4B1W B;  4BG8 A;  3C7N A;  5HP1 A;  4KTW A;  1K8K A;  2HW3 A;  3CFP A;  2YKN A;  1JCF A;  3VF4 A;  1BQN A;  5AQK A;  2O8D A;  3O9T A;  5A2Q O;  3Q7B A;  5AQH A;  5BPM A;  3NH2 A;  3HBT A;  2HF3 A;  4BR9 A;  2QWN A;  4JV5 K;  2QWO A;  1YJN N;  1QTM A;  2ASO A;  2OPQ A;  3THX B;  4AH9 A;  3P4I A;  1YUW A;  4H5R A;  3P39 A;  2HOE A;  4K42 A;  2YNG A;  4CHQ A;  3OY9 A;  4HTL A;  4IFY A;  1JXE A;  4ID1 A;  3VEV A;  4CHP A;  1VQ8 N;  4YOT A;  3F73 A;  3DXK B;  5HL7 L;  4BAC A;  1KTQ A;  1N8R O;  5CYQ A;  3PX6 A;  2Z1I A;  3OYD A;  2Q36 A;  2E6M A;  3MN9 A;  3O6W A;  1V4S A;  1TAQ A;  1KD1 O;  1QHT A;  3C0B A;  2PAV A;  3KKR A;  3OYH A;  3QBW A;  2NLX A;  1S5J A;  3QBX A;  2HBL A;  1IBM K;  2ZQB A;  4OKJ A;  3I0S A;  1J54 A;  4IOC L;  4MFB A;  2E6L A;  4CJK A;  4FLW A;  3D2F A;  2O8E A;  3LDQ A;  2W6K A;  3K59 A;  5AQY A;  1NMD A;  4ISG A;  1C0T A;  2A41 A;  1SKS A;  1HQE A;  2P9L A;  4I6M B;  2B5J A;  3SCX A;  3HTV A;  2F96 A;  4CJP A;  3AO3 A;  3OYI A;  3EZW A;  3FFK B;  2B6A A;  2NRW A;  4LFC K;  3I8B A;  3MEG A;  5AQZ A;  3PIP L;  3TAE A;  3EE9 A;  3H3N O;  1Z25 A;  1TUU A;  2JWK A;  4QS9 A;  3KWI A;  2GUI A;  1BGX T;  4AQY K;  4CGJ A;  3O5B A;  1MDU B;  1JKH A;  4FWL A;  3KLI A;  2G8W A;  3O4N A;  4ELV A;  5DM7 L;  4FLY A;  2BUP A;  4FJJ A;  5DK5 A;  5GAD P;  1WBD A;  2ZJR L;  3K5N A;  5C24 A;  5AZJ B;  4DMN A;  4A5A A;  1KVA A;  3OHR A;  4I6M A;  2UXB K;  1OH5 A;  1ESV A;  3H3O B;  4CEO A;  5AQM A;  3DLH A;  3MWP A;  1TV6 A;  1RT3 A;  3ZT4 A;  1VQ9 N;  4M3W A;  1BO5 O;  1Q7Y O;  5FPE A;  2O8D B;  3V81 A;  1IV0 A;  3ID8 A;  4DU3 A;  4PKG A;  4V19 S;  2PYJ A;  1YXQ A;  3CCR N;  3G71 N;  4DLE A;  3QB0 A;  3R9P A;  3SLC A;  1VQN N;  1NGG A;  4I2Q A;  3VQ9 A;  2E8A A;  3ZCM A;  3K58 A;  5JLF A;  3TU5 A;  4ELU A;  3OJU A;  3CJ1 A;  3VGM A;  3F5T A;  4OKE A;  4GMJ B;  4WQ5 A;  1B92 A;  2RE2 A;  4M3Y A;  4BRH A;  3EYZ A;  4PKI A;  5GIO A;  4NYF A;  5AQQ A;  3LM9 A;  3MDQ A;  4JN4 A;  3KKS A;  4QCL A;  4C8L A;  4JRQ A;  4CZI A;  3CFO A;  1BA1 A;  1VRU A;  1T7P A;  1EP4 A;  1KFD A;  5AQO A;  3PLA A;  3SI6 A;  1IKY A;  1W0H A;  3PSF A;  4H0O A;  4JHD A;  1NJY A;  3VOV A;  5AQP A;  2V7Z A;  1JLQ A;  1JLF A;  4BR5 A;  5LY3 A;  3CC4 N;  3ATV A;  3TAM A;  3ATU A;  5ELZ A;  4F4K A;  2IVN A;  3H6E A;  4JKG A;  4JI2 K;  3AAR A;  3HP9 A;  3AO5 A;  4B08 A;  4E89 A;  4H0Y B;  3L2V A;  5JIC A;  4FM0 A;  2BGG A;  4F2S A;  4DUY K;  3SUP A;  4JKD A;  1KAX A;  2F9W A;  5GAE P;  4B9S A;  1HNX K;  1HPM A;  4YOV A;  3AY9 A;  4B1U B;  1C1B A;  5KGW A;  2P9U B;  2QTD A;  2KFZ A;  4CFA A;  2P9K A;  3K5O A;  3KLF A;  4CZL A;  4IZ9 A;  4FYD A;  2F7T A;  3DXM B;  1EKE A;  3L4Q A;  3VGK A;  1HUX A;  1Q9Y A;  2KLA A;  4IDK A;  3HPG A;  1SKW A;  3NGI A;  3D6R A;  3IG1 A;  1VSE A;  5AQS A;  3NVK A;  4BG9 A;  2D1K A;  4GV6 A;  1KC8 O;  4O44 A;  1NOY A;  3H1Q A;  1NK8 A;  4JI4 K;  2X78 A;  3OYN A;  3W0L A;  4N76 A;  3BZC A;  3DXM A;  4IBN A;  5LJW A;  3MXI A;  4OPA A;  3HK2 A;  3P1G A;  1VSL A;  4CJ5 A;  4BWJ A;  1YF5 L;  4ZHR A;  5CYM A;  2XRI A;  1VHX A;  2G8H A;  4DU1 A;  2G8V A;  2VGN A;  4BRI A;  4FLX A;  1DTT A;  3I0R A;  4DR4 K;  5AQX A;  3JAM O;  3VF6 A;  3LM2 A;  2VG7 A;  4CGD A;  3QEP A;  2QKK A;  4CHO A;  4G1Q A;  3TPQ A;  3JSM A;  1KAY A;  1WB9 A;  3KTQ A;  4BR2 A;  1KXP A;  5C42 A;  2JGU A;  1BIZ A;  1JXB A;  3L4I A;  5FRN A;  5FRM A;  1E3M A;  3NGY A;  4DQS A;  4N41 A;  1VSI A;  4FPA A;  4JKA A;  2XO7 A;  3HRG A;  2IAJ A;  3KHY A;  2LSN A;  3ZSZ A;  3KIO A;  2BTF A;  3MEE A;  3KLE A;  4DWI A;  3A2F A;  1VQ5 N;  4GV3 A;  2IC3 A;  2XY8 A;  4J2D A;  2I7N A;  4B1Y B;  4IOA L;  4CIG A;  1J9A A;  3ZX3 A;  3PO5 A;  5AQV A;  1RGI A;  3AVJ A;  2P9N B;  1RTH A;  3EL2 A;  4CBX A;  1K8K B;  3V1R A;  4E3S A;  4FJG A;  4FWP A;  1IKX A;  2EX3 A;  3JS6 A;  1BI4 A;  1DGK N;  4DR3 K;  1W7A A;  4C1N K;  3VTH A;  3LAK A;  1HPZ A;  5AQJ A;  4A59 A;  1X9W A;  4KV8 A;  3TSQ A;  1NBW A;  1D8Y A;  4CZE A;  4AHT A;  1DTQ A;  4KI4 A;  4EHU A;  3UKR B;  4TSX A;  3OYJ A;  3S3M A;  2ZF5 O;  3ZSO A;  1VQK N;  1BUP A;  1NOZ A;  4YOU A;  2EHG A;  5D3G A;  2P9P A;  3QO9 A;  1X3N A;  3FZF A;  2YNH A;  4YHH K;  4WE1 A;  1G99 A;  2QWQ A;  1TVR A;  4RW6 A;  2OPS A;  1TKD A;  3SBT A;  2AA4 A;  1OVQ A;  3OTO K;  1S1W A;  3MCP A;  2BE2 A;  4BRO A;  3MK6 A;  2XHB A;  2RKI A;  4H0V B;  4M7X A;  4L3Q A;  3SBG A;  3CM6 A;  3VEO A;  4LSN A;  1XWL A;  2EWS A;  4DB3 A;  1HJO A;  3TAQ A;  4Z94 A;  4H5V A;  4M7Y A;  3IRX A;  4BR0 A;  4KAZ A;  5KI6 A;  5F0X A;  3HP6 A;  3MWT A;  4DV1 K;  1L3V A;  1XUP O;  3AAP A;  1KLM A;  3FZM A;  1B9D A;  2HB5 A;  3V1Q A;  4KI6 A;  4O0I A;  1NM1 A;  1RT5 A;  4NXM K;  4U7B A;  3K0S A;  4HCC A;  4FVM A;  3B8A X;  1UAX A;  2VWB A;  1S9E A;  1GLB G;  4IO9 L;  1HNW K;  3HOT A;  1T6D A;  4KO0 A;  4OX9 K;  2WC9 A;  3HI0 A;  1DLO A;  4YFU A;  5EU7 A;  2HMI A;  4CJW A;  5HRP A;  5I9E B;  4RW8 A;  3KK2 A;  3U6F A;  2O8C A;  1LWE A;  4OJR A;  1DT9 A;  1T6C A;  2KW4 A;  5AQT A;  1UA1 A;  1NJX A;  2YKM A;  4FPB A;  2FBY A;  5E26 A;  4CER A;  3ZSX A;  2HHT A;  1ZBS A;  3O3G A;  3UIQ A;  3SAG A;  2PY5 A;  3HJF A;  2YNF A;  4OLA A;  1IKW A;  3O9Q A;  2NNW A;  1U4B A;  2DY4 A;  2YNI A;  1L5U A;  3AVH A;  1WAF A;  5GIN A;  3HXM A;  1J5O A;  3VES A;  1ILY A;  4OPJ A;  5J2P A;  4B9L A;  2YHW A;  4FJ9 A;  3CPE A;  4FW1 A;  3A5N C;  3HM8 A;  1NGB A;  1HRH A;  2QWR A;  1MWM A;  2KTQ A;  3S3N A;  1NK6 A;  4DQI A;  3EKU A;  4EFH A;  4JYA K;  4AIL C;  2FLO A;  2Z1H A;  3IUC A;  2R7Y A;  3CMA N;  3LDN A;  4CHZ A;  2UUC K;  4DQR A;  5BPN A;  3Q7C A;  3OS2 A;  3ZYY X;  2IS3 A;  3SPZ A;  3U3G A;  4NXN K;  1NGI A;  2ZGY A;  1XC9 A;  3L0Q A;  3TTD A;  4U67 L;  5FPD A;  1U2V A;  4CHY A;  1RT2 A;  2F8T A;  4B3T K;  4B9M A;  4DV7 K;  1EO1 A;  3VN5 A;  4FLV A;  4B1V A;  5J1E A;  4DR6 K;  3OYF A;  1T05 A;  3C65 A;  1ZC6 A;  3MEC A;  1N36 K;  4CES A;  4BDY A;  5JS1 A;  1RT7 A;  2Q97 A;  2IVO A;  2RN2 A;  1TYQ B;  3K9J A;  4JK7 A;  2D0C A;  2G8K A;  2NRX A;  4J2A A;  3M8S A;  3CG7 A;  2ZE2 A;  5CZ2 A;  3NHG A;  3L2U A;  4DTR A;  3DAW A;  4BE0 A;  1B9F A;  3QER A;  3BF3 A;  1FKP A;  1SZ2 A;  4A2A A;  3D2E B;  3N4P A;  3CCJ N;  3FE1 A;  4JI1 K;  5LJV A;  3WEE A;  4JLH A;  3FR0 A;  3DRS A;  3OYB A;  2WFB A;  2DFF A;  1GOC A;  1KFS A;  4DR7 K;  3QIP A;  1L3S A;  3VEX A;  4ISE A;  4DV3 K;  2P5O A;  4HHT A;  4B9N A;  3DOL A;  2HBM A;  1HMV A;  1NWK A;  4N5S A;  2O8B B;  4CFC A;  4KHU A;  4CGH A;  1WSF A;  5JVH L;  3K57 A;  1S1X A;  4JD2 A;  1C0M A;  4LD0 A;  4GW6 A;  3DXK A;  4KFB A;  5C12 A;  1ATS A;  4DF4 A;  1NKB A;  2ASM A;  2O4G A;  4LF7 K;  4DLG A;  3DLR A;  4JRP A;  3VQP A;  3KLG A;  2ZGZ A;  1LOT B;  4BC3 A;  2DFH A;  1LW0 A;  5GAH P;  1X9S A;  3RRH A;  3DLB A;  4DR5 K;  2ATQ A;  3S41 A;  2BDP A;  1S1V A;  4BRG A;  3V9S A;  2OZS A;  1BIS A;  5F1X A;  1WSI A;  1RT6 A;  3QET A;  2XY5 A;  2Q31 A;  2PYL A;  4XEI A;  4Z4H A;  3TAB A;  3L8B A;  5BN9 A;  5M1Q A;  1WSJ A;  4DV0 K;  5KPT A;  4NCA A;  3SK3 A;  4IEI A;  3NCI A;  1SL2 A;  2G8U A;  4W5T A;  1X9M A;  4O0J A;  3SYZ A;  5AQR A;  1RTJ A;  3LWM A;  4B3O A;  3THX A;  4H4O A;  1UOC A;  4M45 A;  3HO1 A;  3IFR A;  4NO7 A;  1WSH A;  4FJN A;  4GV9 A;  3J7Y P;  5FPN A;  3ULE B;  3OYM A;  3JYT A;  2PZS A;  2PFU A;  4W5Q A;  4C8N A;  5HOO A;  1NJI O;  4FM2 A;  4DR1 K;  1KQS M;  3T1Y K;  3AVB A;  2QWP A;  3B6P A;  5KTQ A;  2ETJ A;  2YJE A;  3CFR A;  2QXF A;  4AM6 A;  1M90 O;  1KVC A;  1QQO A;  3V4I A;  2H3G X;  3NDK A;  3VQE A;  3K5M A;  1XHZ A;  5J2M A;  5TKY A;  2OPP A;  4FWR A;  1C6V A;  2IOC A;  1EWR A;  3ULE A;  1RDW X;  3EO3 A;  1TK8 A;  3O9U A;  4LH5 A;  3V6D A;  4FWM A;  1IBK K;  1SUQ A;  3LAL A;  1VSM A;  5JLH A;  3VQ4 A;  4CEE A;  4E19 A;  1LV5 A;  4BC4 A;  2BH1 A;  5AQF A;  3HT3 A;  5AQU A;  3K5L A;  5DM6 L;  2HHH K;  4FOE A;  3VQ7 A;  4KHP K;  1TL3 A;  3IS9 A;  4O55 A;  4DV4 K;  3CCQ N;  1YVN A;  4HTU A;  4RW4 A;  4Z0U A;  1U47 A;  1U04 A;  3ALY A;  1G15 A;  3O1W A;  1TKZ A;  1Z05 A;  4X62 K;  4JKC A;  4JD2 B;  4F3O A;  1A5X A;  4I9L A;  1TYQ A;  5SWM A;  4JI3 K;  5AJ3 K;  3VQQ A;  4FJH A;  1NNE A;  4FJI A;  3KK7 A;  1RBR A;  2J4R A;  4B1Z A;  4O4G A;  5EX5 A;  3F9M A;  1Q81 O;  3ZSR A;  1BL3 A;  3KD5 E;  3EEQ A;  2KQ2 A;  2YHA A;  3I8D A;  2HHX A;  4OGC A;  4CIE A;  4KHQ A;  1VQ6 N;  1JL1 A;  3AVM A;  1RNH A;  1RDD A;  3WNG A;  2KZZ A;  3OW2 M;  5AZI B;  3E9O A;  3CME N;  3J7A P; 
#chains in the Genus database with same CATH homology
 4DV0 K;  4DUZ K;  1IBL K;  4B3T K;  4DV7 K;  4DV5 K;  4DR4 K;  1J5E K;  3JAM O;  5LMN K;  4DR6 K;  4LF6 K;  4DV1 K;  4LFB K;  4B3R K;  4CW7 B;  3J81 O;  4JI5 K;  1N36 K;  4X64 K;  4NXM K;  4JI7 K;  2UU9 K;  4GKK K;  3J7Y P;  1FJG K;  5BR8 K;  5LL6 Z;  4YY3 K;  4CVN E;  3J80 O;  4DR1 K;  5IWA K;  1XMO K;  1HNW K;  3T1Y K;  4JI6 K;  4OX9 K;  5LMU K;  2E5L K;  4X66 K;  1IBM K;  5FLX O;  4LF5 K;  3T1H K;  4JI2 K;  4DR2 K;  4JI1 K;  1XNR K;  4DUY K;  4GKJ K;  1IBK K;  4DR7 K;  2UUA K;  1HNX K;  4DR3 K;  4LFC K;  4JI0 K;  4DV3 K;  2HHH K;  4KHP K;  4B3S K;  4AQY K;  2UUB K;  4DV4 K;  4K0K K;  1XNQ K;  2F4V K;  4X62 K;  1N33 K;  4DV2 K;  4JI3 K;  1N34 K;  2UXB K;  1I94 K;  5AJ3 K;  2VQE K;  2VQF K;  4JYA K;  5IT9 O;  4LF4 K;  4LFA K;  4LF8 K;  4LF9 K;  2UUC K;  4YHH K;  4JI8 K;  4LF7 K;  1N32 K;  4JI4 K;  4DR5 K;  4B3M K;  1HNZ K;  2UXC K;  1HR0 K;  5A2Q O;  3OTO K;  4V19 S;  2UXD K;  4DV6 K;  1XMQ K;  4NXN K;  4JV5 K;  4X65 K;  2ZM6 K;  3J7A P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...