4CF0A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf0A00
1DTQA 3VQ9A 1IKVA 4KV8A 1GOCA 5J2QA 2BANA 1B9DA 1EKEA 3ITHA 4RW8A 1ASWA 3LP1A 2IC3A 3OYAA 1HNVA 3QEIA 2ETJA 3KJVA 3IAYA 4KB1A 4FZZA 4RW4A 3OYFA 4ICLA 4UQGA 3JYTA 3T3FA 2KZZA 4F8RA 3ZT1A 4CF0A 3PX0A 4O44A 3TABA 4J2DA 4PY5A 3ZT4A 1TAUA 2YKNA 4CF2A 3SUOA 4KHWA 3OYHA 3VQ5A 3AA2A 4CHPA 4E7IA 2RF2A 4PUOA 3M8SA 4E3SA 4XIUA 2Z1GA 4DQPA 4DSJA 2IAJA 3ZT3A 4M3UA 3K59A 2IGIA 2EHGA 1YTUA 1S1UA 3KK3A 3TWHA 1ZBHA 1DTTA 2ZQBA 4B9LA 2FC0A 2DFEA 1F21A 1RTHA 3AO2A 3KLHA 3PX4A 3OVNA 4JS4A 4DTJA 3DMJA 2VWJA 2O4IA 1RBVA 4B8AB 4CFAA 4OKEA 3VQCA 3V9UA 2GUIA 1L5UA 3V1RA 3DI6A 1VSEA 4M3ZA 5DK5A 4CJ3A 4B9NA 4CEQA 1S9GA 4F4KA 3O4NA 3K58A 4Q5VA 1ZYQA 1A5WA 2VG7A 2RKIA 4G1QA 1IKWA 4FJ5A 2DTUA 4M3WA 4E0DA 5EU7A 1TGOA 1S1XA 1TK8A 1NK7A 1KLNA 1FKPA 4KO0A 4Z4HA 4CFBA 3VQ4A 4OKJA 1C1BA 1WAFA 3T1AA 1A5VA 4EP5A 4GVMA 4DS4A 4Z0UA 2QKBA 4BDZA 3MXMA 3ZSVA 4LH4A 3V9SA 4FLYA 3V81A 2D0CA 4N5SA 1ZBIA 4AHTA 3NGYA 1R0AA 2IOCA 3HPGA 3TANA 1QE1A 4I9LA 4DWIA 3AVCA 4ID5A 5KGXA 1IKYA 3OYDA 2IDOA 3K57A 1L3VA 3L2WA 1A5XA 1WSFA 1LAWA 5HRPA 1TL1A 4N41A 3RMDA 4Z4GA 4CECA 4FW2A 3VQ7A 4NYFA 2D5RA 4CJ4A 3SJJA 2DFFA 4CK1A 1CXUA 1QHTA 1RDCA 2HHWA 2HHXA 3PUFA 2E4LA 1JXBA 1VSIA 3K2PA 1QS4A 5CY4A 3LDSA 1BQMA 1X9WA 2PZSA 3O4QA 1WN7A 1NOZA 3K5LA 1U45A 1B92A 2FBYA 5HRNA 3E01A 4OGEA 3NH2A 4CEBA 3ZSQA 3HPOA 4B8CA 2ITGA 4DTOA 2BDPA 4FLVA 3CFRA 3WNFA 4CGHA 3HP6A 4M42A 4CGFA 3DOKA 1C6VA 4R5PA 4FM0A 4ZTJA 3LP0A 2XY5A 1SKWA 3NCIA 4KHYA 3QO9A 1X9MA 3I0RA 3VQPA 3KLEA 3OYCA 4BWJA 3MXIA 1HJRA 1JL1A 2JGUA 1IO2A 1VSFA 2OPSA 3NF7A 4FXDA 4N47A 2HHVA 1TK0A 3VQ8A 4Z4EA 3RMAA 1Y97A 1RCHA 3NF9A 4CK3A 1TKDA 3HO1A 1U4BA 4B3OA 1S6PA 3ZT0A 3AVHA 4OPJA 4DU4A 3OYJA 3BDPA 4AHUA 5C42A 3CQ8A 4DSLA 4CFDA 2WOMA 3H08A 3HVTA 3P1GA 4F3TA 1FKOA 3CFOA 4KKOA 4FJGA 3L2QA 3LPUA 1WNSA 3AVBA 1JLAA 1TL3A 3O3HA 2KFNA 3QERA 4I2QA 2DY4A 3DLGA 1TKZA 4E7JA 2A1RA 3PO5A 1T7PA 3NH1A 5KI6A 4PQUA 3M8RA 4DFJA 4CEEA 5KTQA 3SUNA 3KK1A 5J2PA 3JSMA 4B9MA 4GMJB 3VQAA 3VA3A 4FLTA 4NCBA 3MAQA 1J53A 4HTUA 1VSDA 2Y1JA 3VQDA 1TV6A 4LSLA 1NK6A 4KAZA 5CZ1A 4KFBA 3B6PA 1LAVA 1T05A 1VSHA 5HP1A 2KZMA 3QIOA 2HNDA 3SQ4A 4CJPA 4CEDA 1RT7A 3DOLA 4CJSA 3HM9A 4KHNA 3OJUA 1C0MA 1RDDA 3C6UA 4IFYA 1VSJA 5K14A 4HCBA 2RN2A 4DTSA 4L8RB 3PY8A 4CF8A 2B4JA 5C25A 3L2VA 3AO5A 5KGWA 1BI4A 4YNQA 4DMNA 2YNIA 2XHBA 1HQEA 2B6AA 2O4GA 1BI4B 4CESA 4JS5A 4E19A 1NK0A 1N6QA 4CHOA 1IG9A 3HYFA 4DFPA 5C24A 4PWDA 1XHXA 2RPIA 4FLXA 4FK4A 4KTQA 3ZCMA 3C6TA 4LD0A 4DTNA 5FRNA 1TAQA 1W0HA 2YHAA 4WE1A 3LP3A 4CHYA 3TARA 1T03A 1NKEA 2PYJA 4FK0A 1EP4A 1S1TA 3C95A 3M8QA 3U3YA 1N5YA 4FZYA 3QNNA 4C8KA 3SCXA 1QQCA 3RTVA 1J5OA 5D3GA 1JLGA 4FLUA 3AA5X 4W5NA 4BWMA 3F9KA 4KTWA 4W5OA 2WONA 1LWEA 1RILA 4DTRA 3RRHA 4DFMA 2P5GA 2EX3A 3NH0A 2F8TA 2YV0X 4QAGA 3AVAA 4HUEA 5KRTA 5T7BA 1UWBA 4DS5A 1NK4A 3LAKA 1RT4A 4DF4A 4DSKA 1I3AA 3KKRA 1EXQA 3QETA 1T8EA 2HHUA 1SKSA 2HNYA 2HVHA 3AA4A 4RW6A 4CK2A 4CEOA 1X9SA 1RBTA 3S3NA 1RNHA 4O5BA 1G15A 3MEGA 4GW6A 1XWLA 5J2MA 1ASVA 2E6MA 3C94A 3PV8A 4IKFA 4KHUA 4KHSA 4FJJA 2KQ2A 4RW9A 1CZ9A 4FLWA 2KTQA 1C0TA 3IRXA 1SL0A 5FRMA 3QLHA 3NGZA 1SL1A 3ISNC 3DLKA 3O3GA 2ATQA 3VN5A 2HMIA 5HRRA 3CFPA 1SV5A 2QK9A 4OJRA 5J1EA 1FK9A 3V9ZA 4HUFA 1QTMA 4H4OA 4JRQA 4B9TA 2Z1IA 2VG5A 3MEDA 2XY7A 1CZBA 3I8DA 1QSLA 1FXXA 3HK2A 3AVJA 3NBPA 4KTZA 4DFKA 3OYGA 1NOYA 4DTMA 3ALYA 1BCMA 3U3GA 4DU3A 4M45A 3SNNA 3L8BA 3TAGA 4CIFA 4HCCA 4H4MA 4FJLA 1BGXT 4I7FA 3AV9A 1U04A 1EX4A 4FJKA 1NJZA 4BE1A 4CJTA 5CYMA 1KCFA 5SWMA 4CJFA 3HVRA 2YKMA 3LZJA 4FJ9A 3DM2A 4CHNA 1BQNA 3G10A 5FROA 3ULDA 1HRHA 3SYZA 5DMRA 1NJXA 4ELVA 2KFZA 4J2EA 4AILC 5HBMA 3OS2A 4FM2A 3RR7A 2P1JA 4OLAA 3AVLA 5JS1A 4EZ9A 4J2AA 3KD1E 3V1OA 3NDKA 4DG1A 2E6LA 1YTAA 4LH5A 3LWLA 4FJ8A 5SZTA 2YNFA 3ZT2A 4FM1A 4IFVA 1Z26A 3MXJA 1D9FA 2A1SA 3V6DA 1RT6A 4IG0A 1C0UA 1RBSA 1RBUA 2X6NA 2YNHA 3F73A 3VA0A 2D0BA 2QXFA 3DRSA 3HP9A 5I42A 1TK5A 4FJNA 3IG1A 3ZSXA 3AVKA 4C8NA 3EY1A 3AVGA 3L2RA 4B08A 1UA0A 1HYZA 1RDAA 1RTJA 1WLJA 5JS2A 3AO3A 3QEVA 4Y1CA 3I0SA 1BIZA 2G8VA 4NCAA 3HJFA 4MQ3A 3VQEA 4C8OA 2G8WA 1GOAA 3LALA 3OYKA 4N76A 4K8XA 1RDBA 3DYAA 1DLOA 3AA3A 4CIEA 4KREA 2AJQA 3G0ZA 3TR8A 1VK0A 3MECA 4I2PA 3TAPA 1NK5A 4EP4A 3QNOA 1YVUA 1UAXA 5HLFA 3P83D 2I5JA 4FCYA 3NHGA 1JXEA 5CYQA 3SV3A 3L3UA 1JLCA 4DLEA 3SUPA 1U47A 4BACA 1U49A 4FJHA 3LP2A 4KI4A 1HNIA 3V1QA 1RT2A 1YT3A 4IG3A 2OZMA 2F96A 3LWMA 1CLQA 1REVA 2OPRA 4F3OA 3THVA 3NF6A 4KRFA 4E1NA 2JLEA 3V4IA 1BISA 2NUBA 3P5JA 3AVNA 3LPTA 4FW1A 4F2RA 4CE9A 4O55A 1TVRA 3HL8A 4DTXA 4N56A 2IS3A 3B6OA 4Q0BA 2XY6A 4CJKA 1VSMA 3NGIA 1XI1A 1KRPA 3M8PA 1KVAA 2YHBA 3HSTB 2Z1HA 2G8UA 4B9UA 2HHQA 4M3TA 1NJWA 1KSPA 1ZBFA 4E7HA 3S3OA 5KRSA 1D8YA 3AVIA 3NE6A 2G8HA 2P51A 1Z25A 4ELTA 2G8KA 4TSXA 4W5RA 2OYQA 3OS1A 4HHTA 1NKBA 2HHSA 3VQ6A 4RW7A 4Z4IA 3OYIA 2HNZA 4CF9A 2B5JA 4C8LA 4NCGA 3QEWA 2Y1IA 1LWFA 3HXMA 4I9QA 4CJ5A 1KFSA 3RMCA 3QINA 4DQRA 3WNHA 2OPPA 4OLBA 4YFUA 4DQIA 3CM5A 1HYVA 4NYNA 3CYMA 3S9HA 3WNGA 2HVIA 3QEXA 3ZSOA 1Q9YA 4CEAA 1JLQA 4E1MA 2R7YA 3FFIA 3ZSZA 4CJUA 1VRTA 4DTUA 1BCOA 1XC9A 4CJWA 1S9EA 4JRPA 3O3FA 1SKRA 1GOBA 1RTIA 4CGIA 2GBZA 1LV5A 2PYLA 3DLEA 4E7LA 4CEFA 1NJYA 1RT3A 4IBNA 3K5OA 4LY7A 4E7KA 3AVMA 4J2BA 4AHCA 1KFDA 4QOZB 3A2FA 3MEEA 4CF1A 1KTQA 4FJIA 4JLHA 4CHZA 1BIUA 1Q9XA 2BGGA 2F8SA 1K6YA 4DSFA 2ZD1A 3OYNA 5J2NA 3TAFA 3HPHA 1W9HA 1SL2A 1JL2A 4BE0A 3TAQA 4H8KA 3KLFA 1WSJA 2VWKA 4IDKA 3QIPA 1X1PA 2HHTA 1ITGA 1S1WA 4AHSA 2XO7A 4W5QA 4CJQA 3L2UA 1S5JA 4Y1DA 3SZ2A 1RTDA 3IS9A 3CM6A 3LAMA 4BDYA 1L3SA 1VRUA 4FK2A 3K5NA 4OGCA 4FJMA 1LWCA 4Z4FA 2Z1JA 4CIGA 3EZ5A 3L3VA 1JLFA 4ID1A 4CJVA 2ZE2A 1UA1A 2OZSA 3HT3A 2X74A 3OYLA 1NKCA 3OYEA 4ZTFA 2HB5A 3DRPA 1LW0A 4O4GA 1J9AA 3OJSA 1B9FA 2DFHA 2KW4A 1IKXA 3SPYA 3KLGA 3TI0A 4C8MA 4M3YA 4OKKA 4FYDA 1HMVA 3U6FA 1S1VA 3PO4A 1C1AA 4CEZA 3OYBA 3SUQA 4B9SA 4FVMA 3OYMA 4O0IA 2XY8A 3KD5E 3ZSRA 1S6QA 3CG7A 4LSNA 3NAEA 1C1CA 1WSEA 3OS0A 3RWUA 3BGRA 3UIQA 2BE2A 4KI6A 4OVLA 2YNGA 4AHRA 1JLEA 3TAEA 4DSIA 1HYSA 4KPYA 3SQ2A 1NK9A 3VQQA 2LSNA 4CGJA 1QSYA 1O1WA 1Q8IA 3TAMA 1HQUA 5CZ2A 4CJRA 1BL3A 3ZSYA 3RRGA 2VG6A 4FZXC 3QESA 4CJLA 1D5AA 1KVBA 1KVCA 2FBTA 3ZSWA 4M3XA 1MU2A 5HROA 4KHQA 1I39A 4FJ7A 4FJXA 1BHLA 3KIOA 3AO4A 3K5MA 4CGGA 1WSIA 4KB0A 1D9DA 1L3TA 4B9VA 1RT5A 2G8FA 2HW3A 3SI6A 3AVFA 4Z4CA 1TKXA 3KLIA 3S3MA 5HRSA 2OA8A 4BE2A 1U48A 3KK2A 4EZ6A 1TKTA 1ASUA 3NFAA 3AO1A 3V9WA 2PY5A 1ZBUA 1VSLA 5E41A 1NK8A 1JLBA 3LANA 2X6SA 1VSKA 4CFCA 3DRRA 1EETA 1L3UA 2P5OA 1CXQA 1WSGA 2XRIA 3ASMA 4MFBA 1LW2A 1KLMA 4W5TA 3EYZA 1RT1A 1WAJA 3SQ0A 3PX6A 5I3UA 2X78A 4O0JA 4FLZA 4DU1A 4DF8A 3RR8A 4K8ZA 4HVJA 1JKHA 2QKKA 4CHQA 3OY9A 4QCLA 3RMBA 3VQBA 2GV9A 3D45A 4M41A 2W42A 3V9XA 1XHZA 4DQQA 3DLBA 1WSHA 3SV4A 4ZHRA 3LZIA 3KKSA 3T19A 3SPZA 2OPQA 2D0AA 1QSSA 1RBRA 4RG8A 4ELUA 4M3RA 4BDPA 4CJEA 4CCHA 1SUQA 4CERA 3KTQA 3DLRA 4E89A 2Q3SA 4DLGA 4CGDA 3NF8A 2FBXA 1HPZA 4DSEA 4DTPA 4PA1A 4HUGA 3QEPA 1UOCA 1ZBLA 4F2SA 1J54A 4AH9A 3SQ1A 2FBVA 3WNEA 4AHVA 3D0PA 4OPKA 5FDLA 3DLHA 2G8IA 4DQSA 1IH7A
chains in the Genus database with same CATH superfamily
2CGJA 1IKVA 3O9RA 3ITHA 4RW8A 3QEIA 3IAYA 5KPZA 4UQGA 3JYTA 5JLFA 4CF0A 3PX0A 3TABA 4LFAK 1TAUA 2YKNA 4BRQA 4KHWA 4H5RA 4H0OA 5AZJB 4CHPA 4E7IA 3K9KA 2EWSA 4PUOA 3M8SA 2YHYA 5BRHA 4DKWA 3DWLA 2FC0A 3AO2A 3KLHA 1WUAA 2HF3A 3WQUA 3FGUA 3OVNA 4JS4A 4DTJA 2VWJA 2O4IA 5AQQA 4B8AB 2GUIA 4A5AA 3V1RA 3DI6A 2Q36A 5AFUA 4NO7A 4CEQA 4H5NA 4JI8K 2VG7A 5BPMA 4E0DA 1TGOA 5BRDA 1TK8A 3WUHA 4Z4HA 4CFBA 3VQ4A 2ZWHA 4JI5K 3IUCA 1WAFA 3T1AA 4GVMA 5FLXO 3HSCA 4LH4A 2D0CA 1VQ7N 1NGBA 3FE1A 2IOCA 3AVCA 3UKRA 5KGXA 3OYDA 1GLDG 1L3VA 3D2FA 3D2FB 4Z4GA 3VQ7A 3WXLA 4NYFA 3SJJA 4CJ4A 1CXUA 3P4IA 4AQYK 4PKGA 2E4LA 1J5EK 3KWGA 3LDSA 3EO3A 1WN7A 1NOZA 1B92A 2FBYA 3J8AA 3ZSQA 4B8CA 2ITGA 3CFRA 3A0IX 4M42A 4CGFA 4R5PA 3LP0A 5JVHL 2XY5A 1SKWA 2F7TA 5C15A 3G4SN 1HJRA 1IO2A 1VSFA 1YXQA 1VQLN 4FXDA 3CQXA 2IVOA 3NF9A 4BG9A 4YOWA 2WOMA 4JD2A 3HVTA 4F3TA 4IFEA 1TKZA 5A2QO 5C0YA 4E7JA 4KH4A 3NH1A 2P9KB 3KWIA 5AQVA 2E88A 4NCBA 3VQAA 4FLTA 1J53A 3ENBA 1VSDA 3ENHA 2QWOA 4JKCA 4K25A 1LAVA 3PIPL 1T05A 1VSHA 3ATUA 1NJIO 2W40A 4Y0WA 1BG3A 3E9LA 3F5TA 4IFYA 5K14A 4JI4K 4CZLA 1VQON 2RN2A 3PY8A 5C25A 2NRXA 4FWRA 1BI4A 3MN7A 2B6AA 3H3NO 1BI4B 1NGHA 4CESA 4JS5A 3THYB 1N6QA 1IG9A 3W3DA 3HYFA 1GLJO 3CJ7A 3M1FA 5FRNA 4XEIA 4CHYA 5FPMA 1T03A 2PAVA 1EP4A 3M8QA 4B3MK 3O08A 1RGIA 2P9SA 3QFPA 4OX9K 1QQOA 1U2VA 3RRHA 1RILA 2GX9A 2CGKA 2EX3A 1NK4A 1CZAN 1UWBA 3LAKA 1RT4A 4DF4A 2O8FB 4DSKA 5KQ8A 3BEXA 2HNYA 4Z94A 4YOVA 4MLEA 4RW6A 4CK2A 4CEOA 1YJ9N 1X9SA 4NXNK 3S3NA 3MEGA 4GY2B 5J2MA 2E6MA 3PV8A 1W97L 3CETA 2KTQA 3VGLA 3IRXA 3NGZA 4DV7K 3ISNC 3VF4A 5CE3A 1QHAA 3EKUA 5HRRA 4DR5K 2QK9A 5GAGP 1QTMA 4HUFA 3RSEB 2Z1IA 2VG5A 3MEDA 2XY7A 3HK2A 4X65K 3MWPA 2FF3B 1BGXT 1U04A 1EX4A 3IDHA 1KCFA 3U8XA 5SWMA 3PLAA 3HVRA 5AQKA 1VQKN 3G10A 5FROA 4H5VA 1HRHA 1NJXA 4J2EA 4OLAA 1IBKK 2P1JA 3AVLA 3NDKA 1YTAA 4LH5A 1ZBSA 5SZTA 4FM1A 1VQ8N 3MXJA 1NGGA 1RT6A 2E8AA 4IG0A 5ADXH 3VA0A 5I42A 2D0BA 3DRSA 3O4WA 3IG1A 4DV3K 3H3OB 1UA0A 1RDAA 5JS2A 3CMAN 3HJFA 2HHHK 3CCUN 4N76A 2Q0RA 3AA3A 4CIEA 2Q31A 2AJQA 2VGNA 3TAPA 3PSFA 5M1NA 3P83D 3VGKA 4FCYA 2VQFK 3VESA 5CYQA 2QTDA 1JLCA 4DLEA 1NBWA 1KAYA 3V1QA 3HI0A 2OPRA 3HBTA 4K41A 3THVA 4KRFA 2OTLN 3CJCA 2JLEA 4F2RA 1BISA 1HPMA 3LPTA 1KAXA 1HLUA 4CE9A 2FSKA 2IS3A 2XY6A 1IBLK 3CCRN 4B9UA 3C7NA 4M3TA 4JKGA 1NJWA 3HZ6A 2A41A 1D8YA 3AVIA 2G8HA 3BF1A 5AQJA 4ELTA 2OYQA 3OS1A 4HHTA 1NKBA 3VQ6A 3L0QA 2HNZA 3CQYA 3ID6A 4NCGA 2Y1IA 1LWFA 2QWQA 3QINA 1OH6A 4DQRA 3LDQA 4YY3K 2E1YA 2HBMA 3ZSOA 4CEAA 1Q9YA 4E1MA 1J6ZA 1LCUA 4CD3A 2R7YA 4BGBA 3PSIA 1VRTA 1BCOA 3C6HA 1RTIA 2PYLA 1NJYA 3K5OA 4E7KA 4AHCA 4QOZB 1Q9XA 2QWLA 2BGGA 3TAFA 1SL2A 3H1QA 1WSJA 4BRAA 3CC7N 4YOTA 4W5QA 1S5JA 3IS9A 4CI6A 2QW9A 4GVEA 4CZIA 1XNQK 1LWCA 3VENA 2Z1JA 4IO8A 4CIGA 1JLFA 4BR5A 2X74A 3OYEA 1LW0A 4J8FA 3GG4A 3VOVA 3KLGA 4M3YA 3VEWA 4FYDA 3SAFA 4FVMA 3NAEA 5IT9O 3QBXA 1C1CA 3QBWA 1MDUB 2BE2A 4DSIA 3SQ2A 1NK9A 2E2NA 1HQUA 2NLXA 3ZSYA 3H45C 5BREA 3QESA 1VQMN 1KVCA 2FBTA 1IBMK 4M3XA 1BHLA 3KIOA 3AO4A 2RE2A 1L3TA 4B9VA 4Z4CA 3SBTA 3M3ZA 4EZ6A 1NNEA 2YX6A 1ZBUA 3LANA 2VWBA 2UUAK 4WF9L 3KVGA 2E2PA 3AY9A 4MFBA 4IOAL 3TTDA 3EYZA 4RCHA 1JKHA 4A57A 1W7AA 3D2EA 1NMNA 2ZJPL 3RMBA 3D45A 4IJNA 2W42A 3V9XA 1XHZA 2FLOA 4DQQA 3SV4A 2VQEK 3DLBA 3LZIA 3T19A 1BOTO 5GINA 1E3MA 4BDPA 1WB9A 4CJEA 4CCHA 1SUQA 2ASMA 2O8CA 3DLRA 4E89A 2Q3SA 2O8BB 5DM7L 2QM1A 1HPZA 1NGIA 3MN9A 3SMPA 4HUGA 1UOCA 4F2SA 1J54A 3EZWA 4AH9A 3SQ1A 2FBVA 4AHVA 4FWOA 4KV8A 2YJFA 1GOCA 2D4WA 2BANA 1B9DA 3OYAA 2IC3A 3KJVA 2A42A 5AQZA 2UXBK 4RW4A 3T3FA 4ICLA 4O44A 4PY5A 4YOYA 1OH7A 3AA2A 3H1VX 1NGAA 2Z1GA 4DQPA 2IAJA 3ZT3A 2EHGA 4M63C 4LF8K 4H0VB 1N32K 2Q2RA 3N4PA 2PFUA 4B1XB 2H3GX 1L5UA 1VSEA 4M3ZA 2E2OA 3EE8A 4IO9L 1S9GA 3I8BA 1NGJA 3K58A 4JI1K 1ZYQA 1A5WA 4B1YB 1K73O 4FJ5A 1NK7A 4K42A 5BN9A 1WBDA 4DV6K 4KO0A 2P9NB 2E5LK 4H0XB 3BF3A 1A5VA 1V4SA 4BDZA 3MXMA 3ZSVA 3V9SA 3P39A 3NMUA 1R0AA 3TANA 4UY8O 2QXLA 4ID5A 1IV0A 4A59A 3FR0A 4DB3A 1KXPA 2ZM6K 2IDOA 3K57A 2WBNA 1A5XA 4FWNA 3WXJA 1LAWA 5HRPA 3JS6A 2CH5A 4B1ZA 1RDCA 1QHTA 5F1XA 1QQNA 3PUFA 3VEVA 5CY4A 2PZSA 1BQMA 3O4QA 3E01A 4OGEA 4CEBA 4FL9A 3WNFA 4CGHA 1O13A 4B9QA 2UYTA 1C6VA 3O1WA 3MCAB 3NCIA 3QO9A 3KLEA 4BWJA 1JL1A 4PKIA 3A5LC 4Z4EA 3RMAA 1Y97A 4U67L 1TKDA 4CK3A 4B3OA 4DU4A 5AZIB 3BDPA 5C42A 4CFDA 1S22A 5E84A 3H08A 2NRRA 3P1GA 1FKOA 3CFOA 3L2QA 3LPUA 1JLAA 2KFNA 2DY4A 4I2QA 3BZKA 1NU0A 3MWTA 5GIPA 2UUBK 3M8RA 4BVPA 4DFJA 2QI2A 4CEEA 2P9LA 3KK1A 3K0SA 3JSMA 4BC2A 1YF5L 4BROA 3VA3A 4C1NI 3MAQA 1E4GT 1MA9B 1TV6A 2NRZA 5CZ1A 3B8AX 4MDAA 3SBGA 2KZMA 2HNDA 4B1UB 3P38A 3R3LA 4CEDA 1RT7A 1VQ4N 4CJSA 5BR8K 1RDDA 4BQLA 3FLCO 4DTSA 4L8RB 4JI2K 4CF8A 2YNIA 1NK0A 4CHOA 1HNXK 2UXDK 4PWDA 1XHXA 4BY9C 4DTNA 3LP3A 1NKEA 2PYJA 3U3YA 1YJNN 4FZYA 3QNNA 1YVNA 3RTVA 1BU6O 1JLGA 4FLUA 4BWMA 3F9KA 4W5OA 3A8YA 3NH0A 4DS5A 1OH5A 1EQYA 3LM2A 5JICA 3E1YA 3I56N 1RNHA 4GW6A 4IKFA 4KHSA 4FLWA 1C0TA 3MX5A 3QLHA 3C65A 4DHYA 2GELA 4IEIA 3HOTA 2BTFA 1SV5A 2E2QA 4H4OA 3UKRB 1FXXA 3AVJA 3NBPA 3U9ZA 4DTMA 3BUZB 3LL3A 3SNNA 3L8BA 4HCCA 4H4MA 2IVPA 1NJZA 2OANA 4CJFA 4FWQA 2YKMA 4ILJA 3DM2A 4CHNA 1BQNA 2A6AA 3ULDA 4AILC 3RR7A 1HKCA 2WC9A 4JKDA 4JKHA 1YAGA 4B1VA 1X3MA 4DG1A 2E6LA 2HSTA 2FSJA 4FWKA 4FJ8A 3CERA 1Z26A 3ENOA 1D9FA 3J7ZO 1RBSA 2X6NA 3HP9A 4FJNA 4GV3A 3T69A 3ATVA 3LM9A 3VTIA 3AVKA 4C8NA 3AVGA 4JD2B 4B08A 1HYZA 1RTJA 4JK7A 3AO3A 4Y1CA 1OKJA 3P31A 2QA4N 2G8VA 4NCAA 3LDNA 3UKUA 3VQEA 2E20A 3TTCA 4FPAA 4YDUC 1SZ2A 3LALA 1YUWA 1RDBA 3DYAA 4DV4K 4K8XA 3G0ZA 3O5BA 2ASOA 4I2PA 3J80O 4EP4A 3N4QA 2F9WA 3QNOA 1NK5A 1UAXA 4NXMK 2I5JA 4DR7K 3MDQA 4JEPA 3L3UA 2NRTA 4JI0K 3SUPA 1JCEA 4BACA 1SAZA 4FJHA 1HNIA 4YHHK 4IG3A 5AQRA 2F4VK 3LWMA 2P9IA 2QEXN 5LMUK 2VCPA 3V4IA 3GDQA 3CJAA 3OBWA 4DTXA 3NGIA 1XI1A 1KVAA 3QB0A 2G8UA 4LF7K 3ZX0A 2YHXA 2Q97A 3S3OA 5KRSA 1NGCA 1Z25A 1RDUA 4NLCA 4Z4IA 3OYIA 3CCLN 4CF9A 1P8ZA 3ZEUA 4E1JA 3HXMA 4I9QA 4IXCA 4OPHA 4CJ5A 3O9SA 2P9SB 3RVCA 3WNHA 4OLBA 4BC5A 1BA0A 3WNGA 1KQSM 4JI3K 1U2VB 3M5RA 4CJUA 4DTUA 1SQKA 2CGLA 1GOBA 4O8UA 4CGIA 1FW6A 2A40A 4E7LA 1ZC6A 2GWJA 3AVMA 5ELZA 1KFDA 3A2FA 3MEEA 4CF1A 4FJIA 3SMSA 3AGKA 2F8SA 1K6YA 4JV5K 5J2NA 1JL2A 4H8KA 3KLFA 2VWKA 4IDKA 4CVNE 1GLCG 4AHSA 1S1WA 3ZX2A 3FZHA 3AGRA 4FSVA 4CJQA 3SZ2A 4Y1DA 3CM6A 1TUYA 4BDYA 4FK2A 1GLLO 5AQTA 1MWMA 4OGCA 4DCHA 2OZSA 3L3VA 5M1PA 4CJVA 4RWTA 1SS6A 4BREA 3OYLA 1XMOK 2DFHA 2KW4A 2P9UA 3SPYA 3TI0A 2P9UB 1HMVA 1S1VA 3PO4A 1C1AA 3OYBA 3THWA 3G71N 4O0IA 1HUXA 3ZSRA 4ILGB 2E1ZA 3OS0A 3BGRA 4WYBA 4KI6A 3O1BA 3CMEN 4AHRA 1HYSA 5LMNK 4A2BA 4YDUA 1QSYA 4OPAA 1O1WA 1Q8IA 2A3ZA 1BL3A 4R79A 3J7YP 2FF6A 4LC9B 4CJLA 1D5AA 4MO5A 5BPLA 3ZSWA 1OH8A 2W6LA 1MU2A 5HROA 3HTVA 4KHQA 2O8DA 3O9TA 4QS8A 4KB0A 2HW3A 1RT5A 2G8FA 3SI6A 2O8EA 1VQPN 5C2FA 3KLIA 3S3MA 2P9PA 3ZYYX 5HRSA 4BE2A 2P9PB 3KK2A 1ASUA 3AO1A 4EFHA 1JLBA 2X6SA 2WTUA 2VGMA 5AR0A 2P5OA 5BPNA 4HWIA 1LW2A 1KLMA 3OBYA 5AQUA 3PX6A 3VETA 4DU1A 3RR8A 4H03B 4BC4A 1TYQA 3ID8A 5KPRA 4ZHRA 3KKSA 3DAWA 3SPZA 2OPQA 4RG8A 4ELUA 3MN6A 1Z6RA 5AJ3K 3QEWA 3HOSA 4CGDA 4BRKA 2D0PA 4C23A 4PA1A 4CBWA 4CJ7A 5KQDA 3C7NB 3DLHA 2A5XA 4JKGB 2G8IA 2A1SA 1IH7A 1DTQA 3VQ9A 3VEXA 5J2QA 1EO1A 5AQLA 1EKEA 3E9OA 3NVMA 1ASWA 3LP1A 2ETJA 4KB1A 4FZZA 3OYFA 2KZZA 3K9JA 4F8RA 3D6RA 3R8EA 3O9UA 3TSQA 5FPEA 1N33K 3DLLL 4BQZA 1NGEA 3AAQA 1XMQK 4XIUA 3CCEN 4DSJA 1YTUA 5FPNA 1S1UA 3TWHA 1DTTA 2ZQBA 3MX2A 1HR0K 4B9LA 2KLAA 1F21A 5AQNA 1RTHA 4IJAA 3PX4A 3ULEA 2IVNA 3GBTA 4GV6A 3DMJA 3ULEB 1S3XA 2DPNA 1RDWX 3V9UA 2NRWA 4HTLA 5LJWA 3FFKB 1IJJA 5C10A 4F4KA 3CCJN 1X3NA 1YI2N 4G1QA 4M7YA 4M3WA 5FPDA 1S1XA 3J7AP 3CC4N 1FKPA 2VYPA 4EP5A 5TKWA 2QKBA 4Z0UA 4FLYA 2YJEA 3H6EA 5EX5A 4K0KK 3NVKA 3HPGA 2GWKA 1Z05A 3ZLJA 5LY3A 1HX1A 3I33A 4GV9A 3S41A 4N41A 4FW2A 4CBXA 1XC3A 2DFFA 2HBJA 2HHXA 3THXA 1JXBA 1VSIA 3K2PA 1QVFM 1X9WA 4JHDA 4JHDB 5HRNA 3NH2A 1ESVA 3DXMA 3HPOA 4DQ8A 4DTOA 3DXMB 3ZX3A 4BRPA 4AM6A 3HP6A 3DOKA 4ZTJA 3OA9A 5F0XA 3QMLA 4KHYA 1X9MA 4BRHA 3OYCA 3MXIA 2JGUA 3NF7A 2OPSA 4N47A 1T6DA 1GLAG 1RCHA 1TUUA 3HO1A 4BR2A 2NRHA 1QVGM 3OYJA 1YIJN 4AHUA 3CQ8A 4A61A 1HNZK 4DSLA 4DR1K 4FJGA 3AVBA 3D2EB 5AFUH 3O3HA 5JMVA 1VHXA 3QERA 1EWRA 3EKSA 2A1RA 5KI6A 4PQUA 4LF6K 5KTQA 4FPBA 3SUNA 1T6CA 4V19S 2O8CB 4GMJB 2YHWA 5M1KA 1C0FA 4HTUA 4JN4A 4LSLA 3OTOK 4KAZA 4KFBA 1DEJA 3QIOA 4IWVA 4CJPA 1DT9A 3DOLA 3HM9A 4H5TA 1XUPO 4PHTX 3C6UA 1VSJA 3E66A 1NWKA 1BA1A 2YI1A 2B4JA 5CR4A 3TTFA 3L2VA 2GEMA 3AO5A 1LOTB 1HQEA 4E19A 3MK6A 1NG9A 4DFPA 4FLXA 4FK4A 1QZ5A 4WFBL 3ZCMA 3C6TA 4LD0A 1TAQA 2YHAA 4WE1A 2ITMA 3TARA 4FK0A 1S1TA 4L3QA 4BRMA 4C8KA 3SCXA 1QQCA 5ADXA 5D3GA 4A62A 4W5NA 3LDLA 2WONA 4DFMA 2P5GA 2F8TA 4HUEA 4QAGA 4BG8A 5T7BA 4DR6K 4DR2K 3R1XA 1I3AA 3KKRA 1EXQA 3QETA 1T8EA 1DGKN 1SKSA 2HVHA 5M1OA 1G99A 4FWLA 1WOQA 1XWLA 1ASVA 3PIOL 2BUPA 4H0PA 2KQ2A 4FJJA 1CZ9A 1U6ZA 5EXWA 1SL0A 3D7EO 1SL1A 4FWSA 2V7ZA 3DLKA 4IEEA 3O3GA 2ATQA 3VN5A 3ZETA 3CFPA 4EIAA 4OJRA 3O80A 3V9ZA 4JRQA 4DR3K 1CZBA 3I8DA 3OYGA 1NOYA 4XH5A 5M1FA 1ATRA 4FO0A 4FOIA 4I7FA 4CJTA 5CYMA 1NGFA 3I55N 2QWRA 4C1NK 4OO1J 4FJ9A 3HRGA 3SYZA 4NLBA 5DM6L 4FM2A 4GKKK 5JS1A 2JWKA 1NLVA 3V1OA 2W41A 3KK7A 2D0OA 2F9TA 1C0UA 1RBUA 4JNEA 3WXKA 3A5NC 3L4IA 3WQTA 4DUYK 3ZSXA 3EY1A 3L2RA 1WLJA 3QEVA 1BIZA 3TU5A 3CPWM 4C8OA 4JI6K 2G8WA 1GOAA 3OYKA 3MMVA 3TR8A 3MECA 2P9LB 5HLFA 4DV1K 3NHGA 2D1KA 1JXEA 3OHRA 2ZJRL 1U49A 3CJBA 3LP2A 1Q82O 2OZMA 1REVA 4E1NA 4B3SK 4FW1A 3SJHA 4O55A 4N56A 3B6OA 4Q0BA 4CJKA 1VSMA 4GNIA 1KRPA 3TPQA 3M8PA 2HHQA 2YHBA 2Z1HA 1KSPA 1ZBFA 3CCSN 2ZGYA 3NE6A 2P51A 2G8KA 4TSXA 4W5RA 2HHSA 4RW7A 5AQYA 2B5JA 5B8HA 3SLCA 1VQ9N 4BRCA 4YFUA 3CM5A 4BRIA 5AZJA 3CYMA 1M1KO 3S9HA 1JLQA 3FFIA 3ZSZA 1ILYA 1XC9A 4CJWA 3C6AA 4NB4A 3O3FA 3VEYA 1LV5A 2GBZA 3DLEA 4LF5K 1RT3A 4IBNA 4LY7A 5M1QA 1KTQA 2BH1A 1HKBA 3WXIA 4DSFA 2HF4A 3OYNA 3VPZA 2ASPA 3TAQA 5HL7L 2CH6A 2XO7A 4BRLA 2HMPA 4XH4A 1H1VA 2ZJQL 1VQNN 5AQSA 4X64K 4YOUA 3LAMA 1VRUA 4CZFA 5KPTA 4WFNL 4ID1A 2ZE2A 3SAHA 3FZKA 3CJ9A 1NKCA 4ZTFA 2QWNA 1KC8O 3DRPA 4DV2K 3CF5L 4O4GA 1J9AA 3OJSA 3DXKA 3U4LA 3GE1A 4FVUA 3DXKB 4B9SA 3Q7CA 3JAMO 1T3VA 2XY8A 3R9PA 1S6QA 3CG7A 4LSNA 3W0LA 3RWUA 3UIQA 3EEQA 1VAZA 2YNGA 3TAEA 3FZMA 1K8AO 4KPYA 4B3TK 5GAEP 2LSNA 1JCFA 4CGJA 5CZ2A 2VG6A 3CI5A 3O8MA 5GADP 4WQ5C 1KVBA 2I7PA 1MWKA 4M7XA 1T44A 1I39A 2V51B 4JKEA 5JLHA 4FJ7A 3K5MA 1D9DA 3AVFA 3GOIA 3QICA 3UKUB 2OA8A 1RFQA 2HBLA 1U48A 2PY5A 3MN5A 1GLBG 3FZFA 4YORA 3EN9A 5E41A 5GIOA 1NK8A 1VSKA 3DRRA 4BR4A 1EETA 3WEEA 1L3UA 4ILHA 3WEEB 1WSGA 3ASMA 3VERA 4W5TA 4BRNA 1RT1A 1WAJA 3SQ0A 5I3UA 4O0JA 4FLZA 4K8ZA 4HVJA 4BRDA 2QKKA 4JK9A 3OY9A 2RHKA 4M41A 2P9IB 1WSHA 5I9EB 2P9KA 2D0AA 1RBRA 4DV0K 1P90A 2NZTA 2FBXA 4DSEA 1BUPA 3QEPA 4BC3A 3D0PA 4OPKA 5FDLA 4DQSA 3CJ1A 1KAZA 1VQ5N 3LDOA 4GKJK 1HNVA 1XQSC 1I94K 3ZEUB 3ZT1A 1GLEG 4J2DA 1HJOA 3ZT4A 2NNWA 3KHYA 1N36K 3THYA 4CF2A 3Q7BA 3SUOA 3OYHA 3O6WA 3VQ5A 5TKYA 2RF2A 4B1WB 1ATSA 4E3SA 4M3UA 2AP1A 3K59A 2IGIA 3KK3A 1ZBHA 2HOEA 5JVGL 2DFEA 3L4QA 4BVOA 1KD1O 1Q18A 5C2DA 1Q81O 1RBVA 4XH1A 4CFAA 4OKEA 3VQCA 4JI7K 3LDPA 3CXCM 2O8FA 4IOXA 1EWQA 3CC2N 5DK5A 4CJ3A 5GAHP 4B9NA 3O4NA 4Q5VA 1GLFO 1X9JA 1WBBA 2RKIA 1IKWA 2QWPA 4O8KA 2DTUA 5EU7A 1KLNA 5EOYA 3VF2A 3AARA 1E4FT 4OKJA 1C1BA 3O9QA 4DS4A 4WQ5A 3V81A 1NGDA 4N5SA 1ZBIA 4AHTA 3NGYA 1QE1A 2JWLA 4I9LA 3THWB 4DWIA 5AQGA 3RSEA 1IKYA 3VF6A 1OVYA 3L2WA 1WSFA 2OCEA 1TL1A 3RMDA 3HM8A 4CECA 1VQ6N 2D5RA 4CK1A 2HHWA 4MDBA 1QS4A 2KKZA 3K5LA 1U45A 2KHOA 1YHQN 3UB5A 2BDPA 4FLVA 2O8DB 3CHWA 4FM0A 4G9ZA 4QS9A 3F2KA 2O8EB 4FOEA 3I0RA 3VQPA 2HHVA 3IKMA 4CZMA 1TK0A 3VQ8A 5H1SQ 1FJGK 1M90O 1U4BA 1S6PA 3ZT0A 3AVHA 4OPJA 1NMDA 3VMFB 4KKOA 3TSPA 1WNSA 1TL3A 4KH6A 1TYQB 3DLGA 4PKHA 1BO5O 4PL7A 3PO5A 3BZCA 5J2PA 4B9MA 1Q86O 3UE5A 4U7BA 2Y1JA 3VQDA 3CD6N 1NK6A 1QZ6A 3B6PA 3C0BA 5LL6Z 4CZJA 5HP1A 3SQ4A 4WQ4C 4KHNA 1YJWN 3OJUA 1C0MA 4HCBA 3WT0A 4KHPK 3U9DA 5BN8A 5KGWA 2XHBA 4YNQA 4DMNA 2O4GA 4IOCL 2Q0UA 3IFRA 5C24A 2RPIA 4KTQA 4BR7A 1W0HA 4H5WA 2GUPA 3C95A 1N5YA 1DKGD 1J5OA 4JKAA 3AA5X 5BRFA 2QWMA 4KTWA 4DUZK 4DTRA 1LWEA 1HNWK 4KBOA 2V52B 2YV0X 1W2BM 3AVAA 1T7PA 5KRTA 4CW7B 2HHUA 3CCQN 4IDHA 4JYAK 4BR0A 3AA4A 5CHIA 1RBTA 1OVQA 4EHUA 4O5BA 1G15A 4BGAA 4KHUA 3C94A 4BRFA 4RW9A 5FRMA 4JK8A 5BR9A 3F9MA 3CCMN 2J4RA 5MLCQ 2HMIA 4YOXA 5J1EA 1FK9A 4B9TA 3IMXA 1QSLA 3VEOA 4DFKA 4KTZA 3ALYA 1BCMA 3U3GA 4DU3A 4K43A 4M45A 3TAGA 4CIFA 4FJLA 4X62K 4X66K 3AV9A 4FJKA 3THXB 4BE1A 1NM1A 4CD1A 1D4XA 3LZJA 1ATNA 5DMRA 4ELVA 2KFZA 5HBMA 3OS2A 1BDGA 4EZ9A 2I7NA 3KD1E 4J2AA 4QS7A 3LWLA 2NRVA 2YNFA 3ZT2A 1N34K 4IFVA 3V6DA 3L6QA 4CZGA 2YNHA 3F73A 3SK3A 1TK5A 2QXFA 4IZ9A 1QQMA 4PL8A 4CZEA 1YITN 2AA4A 2W6KA 3I0SA 4WQ4A 4MQ3A 5AQOA 4H0YB 3BP8A 4KREA 1DLOA 4WFAL 1VK0A 5AQXA 3G25A 4AF1A 1YVUA 3EE9A 3OW2M 3SV3A 5F2RA 1U47A 4KI4A 3QFUA 3R6MA 1RT2A 1YT3A 5LJVA 2UU9K 2F96A 1CLQA 3EL2A 3VGMA 4F3OA 5C12A 3NF6A 2HBKA 5AQIA 1V4TA 2NUBA 3AVNA 3P5JA 1TVRA 4CBUA 3HL8A 4AM7A 2FXUA 2O8BA 4F9OA 2PBDA 3HSTB 4H0TB 4E7HA 4A5BA 3SAGA 4LFCK 2YCHA 3J81O 2ZF5O 3T7ZA 4C8LA 1KFSA 4DV5K 3RMCA 2OPPA 4FWPA 3MCPA 5EY4A 4DQIA 4NYNA 1HYVA 2HVIA 3QEXA 5AQFA 1S9EA 4JRPA 1SKRA 4CZKA 4CEFA 3T1HK 4J2BA 4I6MA 1JCGA 4I6MB 5HOOA 4JLHA 4CHZA 1BIUA 4MO4A 4MLHA 2ZD1A 3HPHA 1K8KA 1W9HA 3H46O 4BRGA 4BE0A 1K8KB 4LF9K 4BR9A 3AAPA 4O5FA 3QIPA 1X1PA 2WUSA 2HHTA 2WFBA 1ITGA 2IIRA 3L2UA 3ZETB 1RTDA 4KH5A 2V7YA 1L3SA 3JXUA 4B3RK 3K5NA 4FJMA 4Z4FA 3EZ5A 3FZLA 4ISGA 2FSNA 1UA1A 3TSUA 3HT3A 1ZXOA 5AQMA 2P9NA 2HB5A 5E26A 2UXCK 3E9PA 1B9FA 1S72N 1IKXA 4C8MA 4OKKA 3U6FA 4CEZA 3KZBA 1R59O 3SUQA 3OYMA 3KD5E 1WSEA 4CZHA 3QDKA 3WXMB 2ZGZA 4OVLA 1JLEA 3VQQA 1Q7YO 3TAMA 5IWAK 3CPEA 4CJRA 3RRGA 4DR4K 3T1YK 4FZXC 4LFBK 1Y64A 1XNRK 4FJXA 4CGGA 1WSIA 4WCEL 4ISFA 3A5OC 3CCVN 4ISEA 1TKXA 5AQHA 4EHTA 1TKTA 3NFAA 3V9WA 1VSLA 3VTHA 4A2AA 4CFCA 1CXQA 5AQPA 2XRIA 5AZIA 2X78A 4DF8A 3A5MC 4RTFD 1K9MO 1HKGA 2UUCK 4CHQA 4QCLA 3VQBA 3VEZA 2GV9A 3GL1A 5AQWA 2OTJN 1BWFO 3DJCA 4JAXA 1N8RO 2Q1NA 1QSSA 5EVZA 4M3RA 4FWMA 1C0GA 4JKFA 4CERA 4JKBA 3KTQA 2GTDA 3CIPA 4DLGA 4LF4K 3NF8A 1IG8A 3BY5A 4DTPA 4EAHD 1ZBLA 3M6GA 3WNEA 3G6EN 1JJ2M
chains in the Genus database with same CATH topology
1DTQA 3VQ9A 1IKVA 4KV8A 1GOCA 5J2QA 2BANA 1B9DA 1EKEA 3ITHA 4RW8A 1ASWA 3LP1A 2IC3A 3OYAA 1HNVA 3QEIA 2ETJA 3KJVA 3IAYA 4KB1A 4FZZA 4RW4A 3OYFA 4ICLA 4UQGA 3JYTA 3T3FA 2KZZA 4F8RA 3ZT1A 4CF0A 3PX0A 4O44A 3TABA 4J2DA 4PY5A 3ZT4A 1TAUA 2YKNA 4CF2A 3SUOA 4KHWA 3OYHA 3VQ5A 3AA2A 4CHPA 4E7IA 2RF2A 4PUOA 3M8SA 4E3SA 4XIUA 2Z1GA 4DQPA 4DSJA 2IAJA 3ZT3A 4M3UA 3K59A 2IGIA 2EHGA 1YTUA 1S1UA 3KK3A 3TWHA 1ZBHA 1DTTA 2ZQBA 4B9LA 2FC0A 2DFEA 1F21A 1RTHA 3AO2A 3KLHA 3PX4A 3OVNA 4JS4A 4DTJA 3DMJA 2VWJA 2O4IA 1RBVA 4B8AB 4CFAA 4OKEA 3VQCA 3V9UA 2GUIA 1L5UA 3V1RA 3DI6A 1VSEA 4M3ZA 5DK5A 4CJ3A 4B9NA 4CEQA 1S9GA 4F4KA 3O4NA 3K58A 4Q5VA 1ZYQA 1A5WA 2VG7A 2RKIA 4G1QA 1IKWA 4FJ5A 2DTUA 4M3WA 4E0DA 5EU7A 1TGOA 1S1XA 1TK8A 1NK7A 1KLNA 1FKPA 4KO0A 4Z4HA 4CFBA 3VQ4A 4OKJA 1C1BA 1WAFA 3T1AA 1A5VA 4EP5A 4GVMA 4DS4A 4Z0UA 2QKBA 4BDZA 3MXMA 3ZSVA 4LH4A 3V9SA 4FLYA 3V81A 2D0CA 4N5SA 1ZBIA 4AHTA 3NGYA 1R0AA 2IOCA 3HPGA 3TANA 1QE1A 4I9LA 4DWIA 3AVCA 4ID5A 5KGXA 1IKYA 3OYDA 2IDOA 3K57A 1L3VA 3L2WA 1A5XA 1WSFA 1LAWA 5HRPA 1TL1A 4N41A 3RMDA 4Z4GA 4CECA 4FW2A 3VQ7A 4NYFA 2D5RA 4CJ4A 3SJJA 2DFFA 4CK1A 1CXUA 1QHTA 1RDCA 2HHWA 2HHXA 3PUFA 2E4LA 1JXBA 1VSIA 3K2PA 1QS4A 5CY4A 3LDSA 1BQMA 1X9WA 2PZSA 3O4QA 1WN7A 1NOZA 3K5LA 1U45A 1B92A 2FBYA 5HRNA 3E01A 4OGEA 3NH2A 4CEBA 3ZSQA 3HPOA 4B8CA 2ITGA 4DTOA 2BDPA 4FLVA 3CFRA 3WNFA 4CGHA 3HP6A 4M42A 4CGFA 3DOKA 1C6VA 4R5PA 4FM0A 4ZTJA 3LP0A 2XY5A 1SKWA 3NCIA 4KHYA 3QO9A 1X9MA 3I0RA 3VQPA 3KLEA 3OYCA 4BWJA 3MXIA 1HJRA 1JL1A 2JGUA 1IO2A 1VSFA 2OPSA 3NF7A 4FXDA 4N47A 2HHVA 1TK0A 3VQ8A 4Z4EA 3RMAA 1Y97A 1RCHA 3NF9A 4CK3A 1TKDA 3HO1A 1U4BA 4B3OA 1S6PA 3ZT0A 3AVHA 4OPJA 4DU4A 3OYJA 3BDPA 4AHUA 5C42A 3CQ8A 4DSLA 4CFDA 2WOMA 3H08A 3HVTA 3P1GA 4F3TA 1FKOA 3CFOA 4KKOA 4FJGA 3L2QA 3LPUA 1WNSA 3AVBA 1JLAA 1TL3A 3O3HA 2KFNA 3QERA 4I2QA 2DY4A 3DLGA 1TKZA 4E7JA 2A1RA 3PO5A 1T7PA 3NH1A 5KI6A 4PQUA 3M8RA 4DFJA 4CEEA 5KTQA 3SUNA 3KK1A 5J2PA 3JSMA 4B9MA 4GMJB 3VQAA 3VA3A 4FLTA 4NCBA 3MAQA 1J53A 4HTUA 1VSDA 2Y1JA 3VQDA 1TV6A 4LSLA 1NK6A 4KAZA 5CZ1A 4KFBA 3B6PA 1LAVA 1T05A 1VSHA 5HP1A 2KZMA 3QIOA 2HNDA 3SQ4A 4CJPA 4CEDA 1RT7A 3DOLA 4CJSA 3HM9A 4KHNA 3OJUA 1C0MA 1RDDA 3C6UA 4IFYA 1VSJA 5K14A 4HCBA 2RN2A 4DTSA 4L8RB 3PY8A 4CF8A 2B4JA 5C25A 3L2VA 3AO5A 5KGWA 1BI4A 4YNQA 4DMNA 2YNIA 2XHBA 1HQEA 2B6AA 2O4GA 1BI4B 4CESA 4JS5A 4E19A 1NK0A 1N6QA 4CHOA 1IG9A 3HYFA 4DFPA 5C24A 4PWDA 1XHXA 2RPIA 4FLXA 4FK4A 4KTQA 3ZCMA 3C6TA 4LD0A 4DTNA 5FRNA 1TAQA 1W0HA 2YHAA 4WE1A 3LP3A 4CHYA 3TARA 1T03A 1NKEA 2PYJA 4FK0A 1EP4A 1S1TA 3C95A 3M8QA 3U3YA 1N5YA 4FZYA 3QNNA 4C8KA 3SCXA 1QQCA 3RTVA 1J5OA 5D3GA 1JLGA 4FLUA 3AA5X 4W5NA 4BWMA 3F9KA 4KTWA 4W5OA 2WONA 1LWEA 1RILA 4DTRA 3RRHA 4DFMA 2P5GA 2EX3A 3NH0A 2F8TA 2YV0X 4QAGA 3AVAA 4HUEA 5KRTA 5T7BA 1UWBA 4DS5A 1NK4A 3LAKA 1RT4A 4DF4A 4DSKA 1I3AA 3KKRA 1EXQA 3QETA 1T8EA 2HHUA 1SKSA 2HNYA 2HVHA 3AA4A 4RW6A 4CK2A 4CEOA 1X9SA 1RBTA 3S3NA 1RNHA 4O5BA 1G15A 3MEGA 4GW6A 1XWLA 5J2MA 1ASVA 2E6MA 3C94A 3PV8A 4IKFA 4KHUA 4KHSA 4FJJA 2KQ2A 4RW9A 1CZ9A 4FLWA 2KTQA 1C0TA 3IRXA 1SL0A 5FRMA 3QLHA 3NGZA 1SL1A 3ISNC 3DLKA 3O3GA 2ATQA 3VN5A 2HMIA 5HRRA 3CFPA 1SV5A 2QK9A 4OJRA 5J1EA 1FK9A 3V9ZA 4HUFA 1QTMA 4H4OA 4JRQA 4B9TA 2Z1IA 2VG5A 3MEDA 2XY7A 1CZBA 3I8DA 1QSLA 1FXXA 3HK2A 3AVJA 3NBPA 4KTZA 4DFKA 3OYGA 1NOYA 4DTMA 3ALYA 1BCMA 3U3GA 4DU3A 4M45A 3SNNA 3L8BA 3TAGA 4CIFA 4HCCA 4H4MA 4FJLA 1BGXT 4I7FA 3AV9A 1U04A 1EX4A 4FJKA 1NJZA 4BE1A 4CJTA 5CYMA 1KCFA 5SWMA 4CJFA 3HVRA 2YKMA 3LZJA 4FJ9A 3DM2A 4CHNA 1BQNA 3G10A 5FROA 3ULDA 1HRHA 3SYZA 5DMRA 1NJXA 4ELVA 2KFZA 4J2EA 4AILC 5HBMA 3OS2A 4FM2A 3RR7A 2P1JA 4OLAA 3AVLA 5JS1A 4EZ9A 4J2AA 3KD1E 3V1OA 3NDKA 4DG1A 2E6LA 1YTAA 4LH5A 3LWLA 4FJ8A 5SZTA 2YNFA 3ZT2A 4FM1A 4IFVA 1Z26A 3MXJA 1D9FA 2A1SA 3V6DA 1RT6A 4IG0A 1C0UA 1RBSA 1RBUA 2X6NA 2YNHA 3F73A 3VA0A 2D0BA 2QXFA 3DRSA 3HP9A 5I42A 1TK5A 4FJNA 3IG1A 3ZSXA 3AVKA 4C8NA 3EY1A 3AVGA 3L2RA 4B08A 1UA0A 1HYZA 1RDAA 1RTJA 1WLJA 5JS2A 3AO3A 3QEVA 4Y1CA 3I0SA 1BIZA 2G8VA 4NCAA 3HJFA 4MQ3A 3VQEA 4C8OA 2G8WA 1GOAA 3LALA 3OYKA 4N76A 4K8XA 1RDBA 3DYAA 1DLOA 3AA3A 4CIEA 4KREA 2AJQA 3G0ZA 3TR8A 1VK0A 3MECA 4I2PA 3TAPA 1NK5A 4EP4A 3QNOA 1YVUA 1UAXA 5HLFA 3P83D 2I5JA 4FCYA 3NHGA 1JXEA 5CYQA 3SV3A 3L3UA 1JLCA 4DLEA 3SUPA 1U47A 4BACA 1U49A 4FJHA 3LP2A 4KI4A 1HNIA 3V1QA 1RT2A 1YT3A 4IG3A 2OZMA 2F96A 3LWMA 1CLQA 1REVA 2OPRA 4F3OA 3THVA 3NF6A 4KRFA 4E1NA 2JLEA 3V4IA 1BISA 2NUBA 3P5JA 3AVNA 3LPTA 4FW1A 4F2RA 4CE9A 4O55A 1TVRA 3HL8A 4DTXA 4N56A 2IS3A 3B6OA 4Q0BA 2XY6A 4CJKA 1VSMA 3NGIA 1XI1A 1KRPA 3M8PA 1KVAA 2YHBA 3HSTB 2Z1HA 2G8UA 4B9UA 2HHQA 4M3TA 1NJWA 1KSPA 1ZBFA 4E7HA 3S3OA 5KRSA 1D8YA 3AVIA 3NE6A 2G8HA 2P51A 1Z25A 4ELTA 2G8KA 4TSXA 4W5RA 2OYQA 3OS1A 4HHTA 1NKBA 2HHSA 3VQ6A 4RW7A 4Z4IA 3OYIA 2HNZA 4CF9A 2B5JA 4C8LA 4NCGA 3QEWA 2Y1IA 1LWFA 3HXMA 4I9QA 4CJ5A 1KFSA 3RMCA 3QINA 4DQRA 3WNHA 2OPPA 4OLBA 4YFUA 4DQIA 3CM5A 1HYVA 4NYNA 3CYMA 3S9HA 3WNGA 2HVIA 3QEXA 3ZSOA 1Q9YA 4CEAA 1JLQA 4E1MA 2R7YA 3FFIA 3ZSZA 4CJUA 1VRTA 4DTUA 1BCOA 1XC9A 4CJWA 1S9EA 4JRPA 3O3FA 1SKRA 1GOBA 1RTIA 4CGIA 2GBZA 1LV5A 2PYLA 3DLEA 4E7LA 4CEFA 1NJYA 1RT3A 4IBNA 3K5OA 4LY7A 4E7KA 3AVMA 4J2BA 4AHCA 1KFDA 4QOZB 3A2FA 3MEEA 4CF1A 1KTQA 4FJIA 4JLHA 4CHZA 1BIUA 1Q9XA 2BGGA 2F8SA 1K6YA 4DSFA 2ZD1A 3OYNA 5J2NA 3TAFA 3HPHA 1W9HA 1SL2A 1JL2A 4BE0A 3TAQA 4H8KA 3KLFA 1WSJA 2VWKA 4IDKA 3QIPA 1X1PA 2HHTA 1ITGA 1S1WA 4AHSA 2XO7A 4W5QA 4CJQA 3L2UA 1S5JA 4Y1DA 3SZ2A 1RTDA 3IS9A 3CM6A 3LAMA 4BDYA 1L3SA 1VRUA 4FK2A 3K5NA 4OGCA 4FJMA 1LWCA 4Z4FA 2Z1JA 4CIGA 3EZ5A 3L3VA 1JLFA 4ID1A 4CJVA 2ZE2A 1UA1A 2OZSA 3HT3A 2X74A 3OYLA 1NKCA 3OYEA 4ZTFA 2HB5A 3DRPA 1LW0A 4O4GA 1J9AA 3OJSA 1B9FA 2DFHA 2KW4A 1IKXA 3SPYA 3KLGA 3TI0A 4C8MA 4M3YA 4OKKA 4FYDA 1HMVA 3U6FA 1S1VA 3PO4A 1C1AA 4CEZA 3OYBA 3SUQA 4B9SA 4FVMA 3OYMA 4O0IA 2XY8A 3KD5E 3ZSRA 1S6QA 3CG7A 4LSNA 3NAEA 1C1CA 1WSEA 3OS0A 3RWUA 3BGRA 3UIQA 2BE2A 4KI6A 4OVLA 2YNGA 4AHRA 1JLEA 3TAEA 4DSIA 1HYSA 4KPYA 3SQ2A 1NK9A 3VQQA 2LSNA 4CGJA 1QSYA 1O1WA 1Q8IA 3TAMA 1HQUA 5CZ2A 4CJRA 1BL3A 3ZSYA 3RRGA 2VG6A 4FZXC 3QESA 4CJLA 1D5AA 1KVBA 1KVCA 2FBTA 3ZSWA 4M3XA 1MU2A 5HROA 4KHQA 1I39A 4FJ7A 4FJXA 1BHLA 3KIOA 3AO4A 3K5MA 4CGGA 1WSIA 4KB0A 1D9DA 1L3TA 4B9VA 1RT5A 2G8FA 2HW3A 3SI6A 3AVFA 4Z4CA 1TKXA 3KLIA 3S3MA 5HRSA 2OA8A 4BE2A 1U48A 3KK2A 4EZ6A 1TKTA 1ASUA 3NFAA 3AO1A 3V9WA 2PY5A 1ZBUA 1VSLA 5E41A 1NK8A 1JLBA 3LANA 2X6SA 1VSKA 4CFCA 3DRRA 1EETA 1L3UA 2P5OA 1CXQA 1WSGA 2XRIA 3ASMA 4MFBA 1LW2A 1KLMA 4W5TA 3EYZA 1RT1A 1WAJA 3SQ0A 3PX6A 5I3UA 2X78A 4O0JA 4FLZA 4DU1A 4DF8A 3RR8A 4K8ZA 4HVJA 1JKHA 2QKKA 4CHQA 3OY9A 4QCLA 3RMBA 3VQBA 2GV9A 3D45A 4M41A 2W42A 3V9XA 1XHZA 4DQQA 3DLBA 1WSHA 3SV4A 4ZHRA 3LZIA 3KKSA 3T19A 3SPZA 2OPQA 2D0AA 1QSSA 1RBRA 4RG8A 4ELUA 4M3RA 4BDPA 4CJEA 4CCHA 1SUQA 4CERA 3KTQA 3DLRA 4E89A 2Q3SA 4DLGA 4CGDA 3NF8A 2FBXA 1HPZA 4DSEA 4DTPA 4PA1A 4HUGA 3QEPA 1UOCA 1ZBLA 4F2SA 1J54A 4AH9A 3SQ1A 2FBVA 3WNEA 4AHVA 3D0PA 4OPKA 5FDLA 3DLHA 2G8IA 4DQSA 1IH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTQ A;  3VQ9 A;  1IKV A;  4KV8 A;  1GOC A;  5J2Q A;  2BAN A;  1B9D A;  1EKE A;  3ITH A;  4RW8 A;  1ASW A;  3LP1 A;  2IC3 A;  3OYA A;  1HNV A;  3QEI A;  2ETJ A;  3KJV A;  3IAY A;  4KB1 A;  4FZZ A;  4RW4 A;  3OYF A;  4ICL A;  4UQG A;  3JYT A;  3T3F A;  2KZZ A;  4F8R A;  3ZT1 A;  4CF0 A;  3PX0 A;  4O44 A;  3TAB A;  4J2D A;  4PY5 A;  3ZT4 A;  1TAU A;  2YKN A;  4CF2 A;  3SUO A;  4KHW A;  3OYH A;  3VQ5 A;  3AA2 A;  4CHP A;  4E7I A;  2RF2 A;  4PUO A;  3M8S A;  4E3S A;  4XIU A;  2Z1G A;  4DQP A;  4DSJ A;  2IAJ A;  3ZT3 A;  4M3U A;  3K59 A;  2IGI A;  2EHG A;  1YTU A;  1S1U A;  3KK3 A;  3TWH A;  1ZBH A;  1DTT A;  2ZQB A;  4B9L A;  2FC0 A;  2DFE A;  1F21 A;  1RTH A;  3AO2 A;  3KLH A;  3PX4 A;  3OVN A;  4JS4 A;  4DTJ A;  3DMJ A;  2VWJ A;  2O4I A;  1RBV A;  4B8A B;  4CFA A;  4OKE A;  3VQC A;  3V9U A;  2GUI A;  1L5U A;  3V1R A;  3DI6 A;  1VSE A;  4M3Z A;  5DK5 A;  4CJ3 A;  4B9N A;  4CEQ A;  1S9G A;  4F4K A;  3O4N A;  3K58 A;  4Q5V A;  1ZYQ A;  1A5W A;  2VG7 A;  2RKI A;  4G1Q A;  1IKW A;  4FJ5 A;  2DTU A;  4M3W A;  4E0D A;  5EU7 A;  1TGO A;  1S1X A;  1TK8 A;  1NK7 A;  1KLN A;  1FKP A;  4KO0 A;  4Z4H A;  4CFB A;  3VQ4 A;  4OKJ A;  1C1B A;  1WAF A;  3T1A A;  1A5V A;  4EP5 A;  4GVM A;  4DS4 A;  4Z0U A;  2QKB A;  4BDZ A;  3MXM A;  3ZSV A;  4LH4 A;  3V9S A;  4FLY A;  3V81 A;  2D0C A;  4N5S A;  1ZBI A;  4AHT A;  3NGY A;  1R0A A;  2IOC A;  3HPG A;  3TAN A;  1QE1 A;  4I9L A;  4DWI A;  3AVC A;  4ID5 A;  5KGX A;  1IKY A;  3OYD A;  2IDO A;  3K57 A;  1L3V A;  3L2W A;  1A5X A;  1WSF A;  1LAW A;  5HRP A;  1TL1 A;  4N41 A;  3RMD A;  4Z4G A;  4CEC A;  4FW2 A;  3VQ7 A;  4NYF A;  2D5R A;  4CJ4 A;  3SJJ A;  2DFF A;  4CK1 A;  1CXU A;  1QHT A;  1RDC A;  2HHW A;  2HHX A;  3PUF A;  2E4L A;  1JXB A;  1VSI A;  3K2P A;  1QS4 A;  5CY4 A;  3LDS A;  1BQM A;  1X9W A;  2PZS A;  3O4Q A;  1WN7 A;  1NOZ A;  3K5L A;  1U45 A;  1B92 A;  2FBY A;  5HRN A;  3E01 A;  4OGE A;  3NH2 A;  4CEB A;  3ZSQ A;  3HPO A;  4B8C A;  2ITG A;  4DTO A;  2BDP A;  4FLV A;  3CFR A;  3WNF A;  4CGH A;  3HP6 A;  4M42 A;  4CGF A;  3DOK A;  1C6V A;  4R5P A;  4FM0 A;  4ZTJ A;  3LP0 A;  2XY5 A;  1SKW A;  3NCI A;  4KHY A;  3QO9 A;  1X9M A;  3I0R A;  3VQP A;  3KLE A;  3OYC A;  4BWJ A;  3MXI A;  1HJR A;  1JL1 A;  2JGU A;  1IO2 A;  1VSF A;  2OPS A;  3NF7 A;  4FXD A;  4N47 A;  2HHV A;  1TK0 A;  3VQ8 A;  4Z4E A;  3RMA A;  1Y97 A;  1RCH A;  3NF9 A;  4CK3 A;  1TKD A;  3HO1 A;  1U4B A;  4B3O A;  1S6P A;  3ZT0 A;  3AVH A;  4OPJ A;  4DU4 A;  3OYJ A;  3BDP A;  4AHU A;  5C42 A;  3CQ8 A;  4DSL A;  4CFD A;  2WOM A;  3H08 A;  3HVT A;  3P1G A;  4F3T A;  1FKO A;  3CFO A;  4KKO A;  4FJG A;  3L2Q A;  3LPU A;  1WNS A;  3AVB A;  1JLA A;  1TL3 A;  3O3H A;  2KFN A;  3QER A;  4I2Q A;  2DY4 A;  3DLG A;  1TKZ A;  4E7J A;  2A1R A;  3PO5 A;  1T7P A;  3NH1 A;  5KI6 A;  4PQU A;  3M8R A;  4DFJ A;  4CEE A;  5KTQ A;  3SUN A;  3KK1 A;  5J2P A;  3JSM A;  4B9M A;  4GMJ B;  3VQA A;  3VA3 A;  4FLT A;  4NCB A;  3MAQ A;  1J53 A;  4HTU A;  1VSD A;  2Y1J A;  3VQD A;  1TV6 A;  4LSL A;  1NK6 A;  4KAZ A;  5CZ1 A;  4KFB A;  3B6P A;  1LAV A;  1T05 A;  1VSH A;  5HP1 A;  2KZM A;  3QIO A;  2HND A;  3SQ4 A;  4CJP A;  4CED A;  1RT7 A;  3DOL A;  4CJS A;  3HM9 A;  4KHN A;  3OJU A;  1C0M A;  1RDD A;  3C6U A;  4IFY A;  1VSJ A;  5K14 A;  4HCB A;  2RN2 A;  4DTS A;  4L8R B;  3PY8 A;  4CF8 A;  2B4J A;  5C25 A;  3L2V A;  3AO5 A;  5KGW A;  1BI4 A;  4YNQ A;  4DMN A;  2YNI A;  2XHB A;  1HQE A;  2B6A A;  2O4G A;  1BI4 B;  4CES A;  4JS5 A;  4E19 A;  1NK0 A;  1N6Q A;  4CHO A;  1IG9 A;  3HYF A;  4DFP A;  5C24 A;  4PWD A;  1XHX A;  2RPI A;  4FLX A;  4FK4 A;  4KTQ A;  3ZCM A;  3C6T A;  4LD0 A;  4DTN A;  5FRN A;  1TAQ A;  1W0H A;  2YHA A;  4WE1 A;  3LP3 A;  4CHY A;  3TAR A;  1T03 A;  1NKE A;  2PYJ A;  4FK0 A;  1EP4 A;  1S1T A;  3C95 A;  3M8Q A;  3U3Y A;  1N5Y A;  4FZY A;  3QNN A;  4C8K A;  3SCX A;  1QQC A;  3RTV A;  1J5O A;  5D3G A;  1JLG A;  4FLU A;  3AA5 X;  4W5N A;  4BWM A;  3F9K A;  4KTW A;  4W5O A;  2WON A;  1LWE A;  1RIL A;  4DTR A;  3RRH A;  4DFM A;  2P5G A;  2EX3 A;  3NH0 A;  2F8T A;  2YV0 X;  4QAG A;  3AVA A;  4HUE A;  5KRT A;  5T7B A;  1UWB A;  4DS5 A;  1NK4 A;  3LAK A;  1RT4 A;  4DF4 A;  4DSK A;  1I3A A;  3KKR A;  1EXQ A;  3QET A;  1T8E A;  2HHU A;  1SKS A;  2HNY A;  2HVH A;  3AA4 A;  4RW6 A;  4CK2 A;  4CEO A;  1X9S A;  1RBT A;  3S3N A;  1RNH A;  4O5B A;  1G15 A;  3MEG A;  4GW6 A;  1XWL A;  5J2M A;  1ASV A;  2E6M A;  3C94 A;  3PV8 A;  4IKF A;  4KHU A;  4KHS A;  4FJJ A;  2KQ2 A;  4RW9 A;  1CZ9 A;  4FLW A;  2KTQ A;  1C0T A;  3IRX A;  1SL0 A;  5FRM A;  3QLH A;  3NGZ A;  1SL1 A;  3ISN C;  3DLK A;  3O3G A;  2ATQ A;  3VN5 A;  2HMI A;  5HRR A;  3CFP A;  1SV5 A;  2QK9 A;  4OJR A;  5J1E A;  1FK9 A;  3V9Z A;  4HUF A;  1QTM A;  4H4O A;  4JRQ A;  4B9T A;  2Z1I A;  2VG5 A;  3MED A;  2XY7 A;  1CZB A;  3I8D A;  1QSL A;  1FXX A;  3HK2 A;  3AVJ A;  3NBP A;  4KTZ A;  4DFK A;  3OYG A;  1NOY A;  4DTM A;  3ALY A;  1BCM A;  3U3G A;  4DU3 A;  4M45 A;  3SNN A;  3L8B A;  3TAG A;  4CIF A;  4HCC A;  4H4M A;  4FJL A;  1BGX T;  4I7F A;  3AV9 A;  1U04 A;  1EX4 A;  4FJK A;  1NJZ A;  4BE1 A;  4CJT A;  5CYM A;  1KCF A;  5SWM A;  4CJF A;  3HVR A;  2YKM A;  3LZJ A;  4FJ9 A;  3DM2 A;  4CHN A;  1BQN A;  3G10 A;  5FRO A;  3ULD A;  1HRH A;  3SYZ A;  5DMR A;  1NJX A;  4ELV A;  2KFZ A;  4J2E A;  4AIL C;  5HBM A;  3OS2 A;  4FM2 A;  3RR7 A;  2P1J A;  4OLA A;  3AVL A;  5JS1 A;  4EZ9 A;  4J2A A;  3KD1 E;  3V1O A;  3NDK A;  4DG1 A;  2E6L A;  1YTA A;  4LH5 A;  3LWL A;  4FJ8 A;  5SZT A;  2YNF A;  3ZT2 A;  4FM1 A;  4IFV A;  1Z26 A;  3MXJ A;  1D9F A;  2A1S A;  3V6D A;  1RT6 A;  4IG0 A;  1C0U A;  1RBS A;  1RBU A;  2X6N A;  2YNH A;  3F73 A;  3VA0 A;  2D0B A;  2QXF A;  3DRS A;  3HP9 A;  5I42 A;  1TK5 A;  4FJN A;  3IG1 A;  3ZSX A;  3AVK A;  4C8N A;  3EY1 A;  3AVG A;  3L2R A;  4B08 A;  1UA0 A;  1HYZ A;  1RDA A;  1RTJ A;  1WLJ A;  5JS2 A;  3AO3 A;  3QEV A;  4Y1C A;  3I0S A;  1BIZ A;  2G8V A;  4NCA A;  3HJF A;  4MQ3 A;  3VQE A;  4C8O A;  2G8W A;  1GOA A;  3LAL A;  3OYK A;  4N76 A;  4K8X A;  1RDB A;  3DYA A;  1DLO A;  3AA3 A;  4CIE A;  4KRE A;  2AJQ A;  3G0Z A;  3TR8 A;  1VK0 A;  3MEC A;  4I2P A;  3TAP A;  1NK5 A;  4EP4 A;  3QNO A;  1YVU A;  1UAX A;  5HLF A;  3P83 D;  2I5J A;  4FCY A;  3NHG A;  1JXE A;  5CYQ A;  3SV3 A;  3L3U A;  1JLC A;  4DLE A;  3SUP A;  1U47 A;  4BAC A;  1U49 A;  4FJH A;  3LP2 A;  4KI4 A;  1HNI A;  3V1Q A;  1RT2 A;  1YT3 A;  4IG3 A;  2OZM A;  2F96 A;  3LWM A;  1CLQ A;  1REV A;  2OPR A;  4F3O A;  3THV A;  3NF6 A;  4KRF A;  4E1N A;  2JLE A;  3V4I A;  1BIS A;  2NUB A;  3P5J A;  3AVN A;  3LPT A;  4FW1 A;  4F2R A;  4CE9 A;  4O55 A;  1TVR A;  3HL8 A;  4DTX A;  4N56 A;  2IS3 A;  3B6O A;  4Q0B A;  2XY6 A;  4CJK A;  1VSM A;  3NGI A;  1XI1 A;  1KRP A;  3M8P A;  1KVA A;  2YHB A;  3HST B;  2Z1H A;  2G8U A;  4B9U A;  2HHQ A;  4M3T A;  1NJW A;  1KSP A;  1ZBF A;  4E7H A;  3S3O A;  5KRS A;  1D8Y A;  3AVI A;  3NE6 A;  2G8H A;  2P51 A;  1Z25 A;  4ELT A;  2G8K A;  4TSX A;  4W5R A;  2OYQ A;  3OS1 A;  4HHT A;  1NKB A;  2HHS A;  3VQ6 A;  4RW7 A;  4Z4I A;  3OYI A;  2HNZ A;  4CF9 A;  2B5J A;  4C8L A;  4NCG A;  3QEW A;  2Y1I A;  1LWF A;  3HXM A;  4I9Q A;  4CJ5 A;  1KFS A;  3RMC A;  3QIN A;  4DQR A;  3WNH A;  2OPP A;  4OLB A;  4YFU A;  4DQI A;  3CM5 A;  1HYV A;  4NYN A;  3CYM A;  3S9H A;  3WNG A;  2HVI A;  3QEX A;  3ZSO A;  1Q9Y A;  4CEA A;  1JLQ A;  4E1M A;  2R7Y A;  3FFI A;  3ZSZ A;  4CJU A;  1VRT A;  4DTU A;  1BCO A;  1XC9 A;  4CJW A;  1S9E A;  4JRP A;  3O3F A;  1SKR A;  1GOB A;  1RTI A;  4CGI A;  2GBZ A;  1LV5 A;  2PYL A;  3DLE A;  4E7L A;  4CEF A;  1NJY A;  1RT3 A;  4IBN A;  3K5O A;  4LY7 A;  4E7K A;  3AVM A;  4J2B A;  4AHC A;  1KFD A;  4QOZ B;  3A2F A;  3MEE A;  4CF1 A;  1KTQ A;  4FJI A;  4JLH A;  4CHZ A;  1BIU A;  1Q9X A;  2BGG A;  2F8S A;  1K6Y A;  4DSF A;  2ZD1 A;  3OYN A;  5J2N A;  3TAF A;  3HPH A;  1W9H A;  1SL2 A;  1JL2 A;  4BE0 A;  3TAQ A;  4H8K A;  3KLF A;  1WSJ A;  2VWK A;  4IDK A;  3QIP A;  1X1P A;  2HHT A;  1ITG A;  1S1W A;  4AHS A;  2XO7 A;  4W5Q A;  4CJQ A;  3L2U A;  1S5J A;  4Y1D A;  3SZ2 A;  1RTD A;  3IS9 A;  3CM6 A;  3LAM A;  4BDY A;  1L3S A;  1VRU A;  4FK2 A;  3K5N A;  4OGC A;  4FJM A;  1LWC A;  4Z4F A;  2Z1J A;  4CIG A;  3EZ5 A;  3L3V A;  1JLF A;  4ID1 A;  4CJV A;  2ZE2 A;  1UA1 A;  2OZS A;  3HT3 A;  2X74 A;  3OYL A;  1NKC A;  3OYE A;  4ZTF A;  2HB5 A;  3DRP A;  1LW0 A;  4O4G A;  1J9A A;  3OJS A;  1B9F A;  2DFH A;  2KW4 A;  1IKX A;  3SPY A;  3KLG A;  3TI0 A;  4C8M A;  4M3Y A;  4OKK A;  4FYD A;  1HMV A;  3U6F A;  1S1V A;  3PO4 A;  1C1A A;  4CEZ A;  3OYB A;  3SUQ A;  4B9S A;  4FVM A;  3OYM A;  4O0I A;  2XY8 A;  3KD5 E;  3ZSR A;  1S6Q A;  3CG7 A;  4LSN A;  3NAE A;  1C1C A;  1WSE A;  3OS0 A;  3RWU A;  3BGR A;  3UIQ A;  2BE2 A;  4KI6 A;  4OVL A;  2YNG A;  4AHR A;  1JLE A;  3TAE A;  4DSI A;  1HYS A;  4KPY A;  3SQ2 A;  1NK9 A;  3VQQ A;  2LSN A;  4CGJ A;  1QSY A;  1O1W A;  1Q8I A;  3TAM A;  1HQU A;  5CZ2 A;  4CJR A;  1BL3 A;  3ZSY A;  3RRG A;  2VG6 A;  4FZX C;  3QES A;  4CJL A;  1D5A A;  1KVB A;  1KVC A;  2FBT A;  3ZSW A;  4M3X A;  1MU2 A;  5HRO A;  4KHQ A;  1I39 A;  4FJ7 A;  4FJX A;  1BHL A;  3KIO A;  3AO4 A;  3K5M A;  4CGG A;  1WSI A;  4KB0 A;  1D9D A;  1L3T A;  4B9V A;  1RT5 A;  2G8F A;  2HW3 A;  3SI6 A;  3AVF A;  4Z4C A;  1TKX A;  3KLI A;  3S3M A;  5HRS A;  2OA8 A;  4BE2 A;  1U48 A;  3KK2 A;  4EZ6 A;  1TKT A;  1ASU A;  3NFA A;  3AO1 A;  3V9W A;  2PY5 A;  1ZBU A;  1VSL A;  5E41 A;  1NK8 A;  1JLB A;  3LAN A;  2X6S A;  1VSK A;  4CFC A;  3DRR A;  1EET A;  1L3U A;  2P5O A;  1CXQ A;  1WSG A;  2XRI A;  3ASM A;  4MFB A;  1LW2 A;  1KLM A;  4W5T A;  3EYZ A;  1RT1 A;  1WAJ A;  3SQ0 A;  3PX6 A;  5I3U A;  2X78 A;  4O0J A;  4FLZ A;  4DU1 A;  4DF8 A;  3RR8 A;  4K8Z A;  4HVJ A;  1JKH A;  2QKK A;  4CHQ A;  3OY9 A;  4QCL A;  3RMB A;  3VQB A;  2GV9 A;  3D45 A;  4M41 A;  2W42 A;  3V9X A;  1XHZ A;  4DQQ A;  3DLB A;  1WSH A;  3SV4 A;  4ZHR A;  3LZI A;  3KKS A;  3T19 A;  3SPZ A;  2OPQ A;  2D0A A;  1QSS A;  1RBR A;  4RG8 A;  4ELU A;  4M3R A;  4BDP A;  4CJE A;  4CCH A;  1SUQ A;  4CER A;  3KTQ A;  3DLR A;  4E89 A;  2Q3S A;  4DLG A;  4CGD A;  3NF8 A;  2FBX A;  1HPZ A;  4DSE A;  4DTP A;  4PA1 A;  4HUG A;  3QEP A;  1UOC A;  1ZBL A;  4F2S A;  1J54 A;  4AH9 A;  3SQ1 A;  2FBV A;  3WNE A;  4AHV A;  3D0P A;  4OPK A;  5FDL A;  3DLH A;  2G8I A;  4DQS A;  1IH7 A; 
#chains in the Genus database with same CATH topology
 2CGJ A;  1IKV A;  3O9R A;  3ITH A;  4RW8 A;  3QEI A;  3IAY A;  5KPZ A;  4UQG A;  3JYT A;  5JLF A;  4CF0 A;  3PX0 A;  3TAB A;  4LFA K;  1TAU A;  2YKN A;  4BRQ A;  4KHW A;  4H5R A;  4H0O A;  5AZJ B;  4CHP A;  4E7I A;  3K9K A;  2EWS A;  4PUO A;  3M8S A;  2YHY A;  5BRH A;  4DKW A;  3DWL A;  2FC0 A;  3AO2 A;  3KLH A;  1WUA A;  2HF3 A;  3WQU A;  3FGU A;  3OVN A;  4JS4 A;  4DTJ A;  2VWJ A;  2O4I A;  5AQQ A;  4B8A B;  2GUI A;  4A5A A;  3V1R A;  3DI6 A;  2Q36 A;  5AFU A;  4NO7 A;  4CEQ A;  4H5N A;  4JI8 K;  2VG7 A;  5BPM A;  4E0D A;  1TGO A;  5BRD A;  1TK8 A;  3WUH A;  4Z4H A;  4CFB A;  3VQ4 A;  2ZWH A;  4JI5 K;  3IUC A;  1WAF A;  3T1A A;  4GVM A;  5FLX O;  3HSC A;  4LH4 A;  2D0C A;  1VQ7 N;  1NGB A;  3FE1 A;  2IOC A;  3AVC A;  3UKR A;  5KGX A;  3OYD A;  1GLD G;  1L3V A;  3D2F A;  3D2F B;  4Z4G A;  3VQ7 A;  3WXL A;  4NYF A;  3SJJ A;  4CJ4 A;  1CXU A;  3P4I A;  4AQY K;  4PKG A;  2E4L A;  1J5E K;  3KWG A;  3LDS A;  3EO3 A;  1WN7 A;  1NOZ A;  1B92 A;  2FBY A;  3J8A A;  3ZSQ A;  4B8C A;  2ITG A;  3CFR A;  3A0I X;  4M42 A;  4CGF A;  4R5P A;  3LP0 A;  5JVH L;  2XY5 A;  1SKW A;  2F7T A;  5C15 A;  3G4S N;  1HJR A;  1IO2 A;  1VSF A;  1YXQ A;  1VQL N;  4FXD A;  3CQX A;  2IVO A;  3NF9 A;  4BG9 A;  4YOW A;  2WOM A;  4JD2 A;  3HVT A;  4F3T A;  4IFE A;  1TKZ A;  5A2Q O;  5C0Y A;  4E7J A;  4KH4 A;  3NH1 A;  2P9K B;  3KWI A;  5AQV A;  2E88 A;  4NCB A;  3VQA A;  4FLT A;  1J53 A;  3ENB A;  1VSD A;  3ENH A;  2QWO A;  4JKC A;  4K25 A;  1LAV A;  3PIP L;  1T05 A;  1VSH A;  3ATU A;  1NJI O;  2W40 A;  4Y0W A;  1BG3 A;  3E9L A;  3F5T A;  4IFY A;  5K14 A;  4JI4 K;  4CZL A;  1VQO N;  2RN2 A;  3PY8 A;  5C25 A;  2NRX A;  4FWR A;  1BI4 A;  3MN7 A;  2B6A A;  3H3N O;  1BI4 B;  1NGH A;  4CES A;  4JS5 A;  3THY B;  1N6Q A;  1IG9 A;  3W3D A;  3HYF A;  1GLJ O;  3CJ7 A;  3M1F A;  5FRN A;  4XEI A;  4CHY A;  5FPM A;  1T03 A;  2PAV A;  1EP4 A;  3M8Q A;  4B3M K;  3O08 A;  1RGI A;  2P9S A;  3QFP A;  4OX9 K;  1QQO A;  1U2V A;  3RRH A;  1RIL A;  2GX9 A;  2CGK A;  2EX3 A;  1NK4 A;  1CZA N;  1UWB A;  3LAK A;  1RT4 A;  4DF4 A;  2O8F B;  4DSK A;  5KQ8 A;  3BEX A;  2HNY A;  4Z94 A;  4YOV A;  4MLE A;  4RW6 A;  4CK2 A;  4CEO A;  1YJ9 N;  1X9S A;  4NXN K;  3S3N A;  3MEG A;  4GY2 B;  5J2M A;  2E6M A;  3PV8 A;  1W97 L;  3CET A;  2KTQ A;  3VGL A;  3IRX A;  3NGZ A;  4DV7 K;  3ISN C;  3VF4 A;  5CE3 A;  1QHA A;  3EKU A;  5HRR A;  4DR5 K;  2QK9 A;  5GAG P;  1QTM A;  4HUF A;  3RSE B;  2Z1I A;  2VG5 A;  3MED A;  2XY7 A;  3HK2 A;  4X65 K;  3MWP A;  2FF3 B;  1BGX T;  1U04 A;  1EX4 A;  3IDH A;  1KCF A;  3U8X A;  5SWM A;  3PLA A;  3HVR A;  5AQK A;  1VQK N;  3G10 A;  5FRO A;  4H5V A;  1HRH A;  1NJX A;  4J2E A;  4OLA A;  1IBK K;  2P1J A;  3AVL A;  3NDK A;  1YTA A;  4LH5 A;  1ZBS A;  5SZT A;  4FM1 A;  1VQ8 N;  3MXJ A;  1NGG A;  1RT6 A;  2E8A A;  4IG0 A;  5ADX H;  3VA0 A;  5I42 A;  2D0B A;  3DRS A;  3O4W A;  3IG1 A;  4DV3 K;  3H3O B;  1UA0 A;  1RDA A;  5JS2 A;  3CMA N;  3HJF A;  2HHH K;  3CCU N;  4N76 A;  2Q0R A;  3AA3 A;  4CIE A;  2Q31 A;  2AJQ A;  2VGN A;  3TAP A;  3PSF A;  5M1N A;  3P83 D;  3VGK A;  4FCY A;  2VQF K;  3VES A;  5CYQ A;  2QTD A;  1JLC A;  4DLE A;  1NBW A;  1KAY A;  3V1Q A;  3HI0 A;  2OPR A;  3HBT A;  4K41 A;  3THV A;  4KRF A;  2OTL N;  3CJC A;  2JLE A;  4F2R A;  1BIS A;  1HPM A;  3LPT A;  1KAX A;  1HLU A;  4CE9 A;  2FSK A;  2IS3 A;  2XY6 A;  1IBL K;  3CCR N;  4B9U A;  3C7N A;  4M3T A;  4JKG A;  1NJW A;  3HZ6 A;  2A41 A;  1D8Y A;  3AVI A;  2G8H A;  3BF1 A;  5AQJ A;  4ELT A;  2OYQ A;  3OS1 A;  4HHT A;  1NKB A;  3VQ6 A;  3L0Q A;  2HNZ A;  3CQY A;  3ID6 A;  4NCG A;  2Y1I A;  1LWF A;  2QWQ A;  3QIN A;  1OH6 A;  4DQR A;  3LDQ A;  4YY3 K;  2E1Y A;  2HBM A;  3ZSO A;  4CEA A;  1Q9Y A;  4E1M A;  1J6Z A;  1LCU A;  4CD3 A;  2R7Y A;  4BGB A;  3PSI A;  1VRT A;  1BCO A;  3C6H A;  1RTI A;  2PYL A;  1NJY A;  3K5O A;  4E7K A;  4AHC A;  4QOZ B;  1Q9X A;  2QWL A;  2BGG A;  3TAF A;  1SL2 A;  3H1Q A;  1WSJ A;  4BRA A;  3CC7 N;  4YOT A;  4W5Q A;  1S5J A;  3IS9 A;  4CI6 A;  2QW9 A;  4GVE A;  4CZI A;  1XNQ K;  1LWC A;  3VEN A;  2Z1J A;  4IO8 A;  4CIG A;  1JLF A;  4BR5 A;  2X74 A;  3OYE A;  1LW0 A;  4J8F A;  3GG4 A;  3VOV A;  3KLG A;  4M3Y A;  3VEW A;  4FYD A;  3SAF A;  4FVM A;  3NAE A;  5IT9 O;  3QBX A;  1C1C A;  3QBW A;  1MDU B;  2BE2 A;  4DSI A;  3SQ2 A;  1NK9 A;  2E2N A;  1HQU A;  2NLX A;  3ZSY A;  3H45 C;  5BRE A;  3QES A;  1VQM N;  1KVC A;  2FBT A;  1IBM K;  4M3X A;  1BHL A;  3KIO A;  3AO4 A;  2RE2 A;  1L3T A;  4B9V A;  4Z4C A;  3SBT A;  3M3Z A;  4EZ6 A;  1NNE A;  2YX6 A;  1ZBU A;  3LAN A;  2VWB A;  2UUA K;  4WF9 L;  3KVG A;  2E2P A;  3AY9 A;  4MFB A;  4IOA L;  3TTD A;  3EYZ A;  4RCH A;  1JKH A;  4A57 A;  1W7A A;  3D2E A;  1NMN A;  2ZJP L;  3RMB A;  3D45 A;  4IJN A;  2W42 A;  3V9X A;  1XHZ A;  2FLO A;  4DQQ A;  3SV4 A;  2VQE K;  3DLB A;  3LZI A;  3T19 A;  1BOT O;  5GIN A;  1E3M A;  4BDP A;  1WB9 A;  4CJE A;  4CCH A;  1SUQ A;  2ASM A;  2O8C A;  3DLR A;  4E89 A;  2Q3S A;  2O8B B;  5DM7 L;  2QM1 A;  1HPZ A;  1NGI A;  3MN9 A;  3SMP A;  4HUG A;  1UOC A;  4F2S A;  1J54 A;  3EZW A;  4AH9 A;  3SQ1 A;  2FBV A;  4AHV A;  4FWO A;  4KV8 A;  2YJF A;  1GOC A;  2D4W A;  2BAN A;  1B9D A;  3OYA A;  2IC3 A;  3KJV A;  2A42 A;  5AQZ A;  2UXB K;  4RW4 A;  3T3F A;  4ICL A;  4O44 A;  4PY5 A;  4YOY A;  1OH7 A;  3AA2 A;  3H1V X;  1NGA A;  2Z1G A;  4DQP A;  2IAJ A;  3ZT3 A;  2EHG A;  4M63 C;  4LF8 K;  4H0V B;  1N32 K;  2Q2R A;  3N4P A;  2PFU A;  4B1X B;  2H3G X;  1L5U A;  1VSE A;  4M3Z A;  2E2O A;  3EE8 A;  4IO9 L;  1S9G A;  3I8B A;  1NGJ A;  3K58 A;  4JI1 K;  1ZYQ A;  1A5W A;  4B1Y B;  1K73 O;  4FJ5 A;  1NK7 A;  4K42 A;  5BN9 A;  1WBD A;  4DV6 K;  4KO0 A;  2P9N B;  2E5L K;  4H0X B;  3BF3 A;  1A5V A;  1V4S A;  4BDZ A;  3MXM A;  3ZSV A;  3V9S A;  3P39 A;  3NMU A;  1R0A A;  3TAN A;  4UY8 O;  2QXL A;  4ID5 A;  1IV0 A;  4A59 A;  3FR0 A;  4DB3 A;  1KXP A;  2ZM6 K;  2IDO A;  3K57 A;  2WBN A;  1A5X A;  4FWN A;  3WXJ A;  1LAW A;  5HRP A;  3JS6 A;  2CH5 A;  4B1Z A;  1RDC A;  1QHT A;  5F1X A;  1QQN A;  3PUF A;  3VEV A;  5CY4 A;  2PZS A;  1BQM A;  3O4Q A;  3E01 A;  4OGE A;  4CEB A;  4FL9 A;  3WNF A;  4CGH A;  1O13 A;  4B9Q A;  2UYT A;  1C6V A;  3O1W A;  3MCA B;  3NCI A;  3QO9 A;  3KLE A;  4BWJ A;  1JL1 A;  4PKI A;  3A5L C;  4Z4E A;  3RMA A;  1Y97 A;  4U67 L;  1TKD A;  4CK3 A;  4B3O A;  4DU4 A;  5AZI B;  3BDP A;  5C42 A;  4CFD A;  1S22 A;  5E84 A;  3H08 A;  2NRR A;  3P1G A;  1FKO A;  3CFO A;  3L2Q A;  3LPU A;  1JLA A;  2KFN A;  2DY4 A;  4I2Q A;  3BZK A;  1NU0 A;  3MWT A;  5GIP A;  2UUB K;  3M8R A;  4BVP A;  4DFJ A;  2QI2 A;  4CEE A;  2P9L A;  3KK1 A;  3K0S A;  3JSM A;  4BC2 A;  1YF5 L;  4BRO A;  3VA3 A;  4C1N I;  3MAQ A;  1E4G T;  1MA9 B;  1TV6 A;  2NRZ A;  5CZ1 A;  3B8A X;  4MDA A;  3SBG A;  2KZM A;  2HND A;  4B1U B;  3P38 A;  3R3L A;  4CED A;  1RT7 A;  1VQ4 N;  4CJS A;  5BR8 K;  1RDD A;  4BQL A;  3FLC O;  4DTS A;  4L8R B;  4JI2 K;  4CF8 A;  2YNI A;  1NK0 A;  4CHO A;  1HNX K;  2UXD K;  4PWD A;  1XHX A;  4BY9 C;  4DTN A;  3LP3 A;  1NKE A;  2PYJ A;  3U3Y A;  1YJN N;  4FZY A;  3QNN A;  1YVN A;  3RTV A;  1BU6 O;  1JLG A;  4FLU A;  4BWM A;  3F9K A;  4W5O A;  3A8Y A;  3NH0 A;  4DS5 A;  1OH5 A;  1EQY A;  3LM2 A;  5JIC A;  3E1Y A;  3I56 N;  1RNH A;  4GW6 A;  4IKF A;  4KHS A;  4FLW A;  1C0T A;  3MX5 A;  3QLH A;  3C65 A;  4DHY A;  2GEL A;  4IEI A;  3HOT A;  2BTF A;  1SV5 A;  2E2Q A;  4H4O A;  3UKR B;  1FXX A;  3AVJ A;  3NBP A;  3U9Z A;  4DTM A;  3BUZ B;  3LL3 A;  3SNN A;  3L8B A;  4HCC A;  4H4M A;  2IVP A;  1NJZ A;  2OAN A;  4CJF A;  4FWQ A;  2YKM A;  4ILJ A;  3DM2 A;  4CHN A;  1BQN A;  2A6A A;  3ULD A;  4AIL C;  3RR7 A;  1HKC A;  2WC9 A;  4JKD A;  4JKH A;  1YAG A;  4B1V A;  1X3M A;  4DG1 A;  2E6L A;  2HST A;  2FSJ A;  4FWK A;  4FJ8 A;  3CER A;  1Z26 A;  3ENO A;  1D9F A;  3J7Z O;  1RBS A;  2X6N A;  3HP9 A;  4FJN A;  4GV3 A;  3T69 A;  3ATV A;  3LM9 A;  3VTI A;  3AVK A;  4C8N A;  3AVG A;  4JD2 B;  4B08 A;  1HYZ A;  1RTJ A;  4JK7 A;  3AO3 A;  4Y1C A;  1OKJ A;  3P31 A;  2QA4 N;  2G8V A;  4NCA A;  3LDN A;  3UKU A;  3VQE A;  2E20 A;  3TTC A;  4FPA A;  4YDU C;  1SZ2 A;  3LAL A;  1YUW A;  1RDB A;  3DYA A;  4DV4 K;  4K8X A;  3G0Z A;  3O5B A;  2ASO A;  4I2P A;  3J80 O;  4EP4 A;  3N4Q A;  2F9W A;  3QNO A;  1NK5 A;  1UAX A;  4NXM K;  2I5J A;  4DR7 K;  3MDQ A;  4JEP A;  3L3U A;  2NRT A;  4JI0 K;  3SUP A;  1JCE A;  4BAC A;  1SAZ A;  4FJH A;  1HNI A;  4YHH K;  4IG3 A;  5AQR A;  2F4V K;  3LWM A;  2P9I A;  2QEX N;  5LMU K;  2VCP A;  3V4I A;  3GDQ A;  3CJA A;  3OBW A;  4DTX A;  3NGI A;  1XI1 A;  1KVA A;  3QB0 A;  2G8U A;  4LF7 K;  3ZX0 A;  2YHX A;  2Q97 A;  3S3O A;  5KRS A;  1NGC A;  1Z25 A;  1RDU A;  4NLC A;  4Z4I A;  3OYI A;  3CCL N;  4CF9 A;  1P8Z A;  3ZEU A;  4E1J A;  3HXM A;  4I9Q A;  4IXC A;  4OPH A;  4CJ5 A;  3O9S A;  2P9S B;  3RVC A;  3WNH A;  4OLB A;  4BC5 A;  1BA0 A;  3WNG A;  1KQS M;  4JI3 K;  1U2V B;  3M5R A;  4CJU A;  4DTU A;  1SQK A;  2CGL A;  1GOB A;  4O8U A;  4CGI A;  1FW6 A;  2A40 A;  4E7L A;  1ZC6 A;  2GWJ A;  3AVM A;  5ELZ A;  1KFD A;  3A2F A;  3MEE A;  4CF1 A;  4FJI A;  3SMS A;  3AGK A;  2F8S A;  1K6Y A;  4JV5 K;  5J2N A;  1JL2 A;  4H8K A;  3KLF A;  2VWK A;  4IDK A;  4CVN E;  1GLC G;  4AHS A;  1S1W A;  3ZX2 A;  3FZH A;  3AGR A;  4FSV A;  4CJQ A;  3SZ2 A;  4Y1D A;  3CM6 A;  1TUY A;  4BDY A;  4FK2 A;  1GLL O;  5AQT A;  1MWM A;  4OGC A;  4DCH A;  2OZS A;  3L3V A;  5M1P A;  4CJV A;  4RWT A;  1SS6 A;  4BRE A;  3OYL A;  1XMO K;  2DFH A;  2KW4 A;  2P9U A;  3SPY A;  3TI0 A;  2P9U B;  1HMV A;  1S1V A;  3PO4 A;  1C1A A;  3OYB A;  3THW A;  3G71 N;  4O0I A;  1HUX A;  3ZSR A;  4ILG B;  2E1Z A;  3OS0 A;  3BGR A;  4WYB A;  4KI6 A;  3O1B A;  3CME N;  4AHR A;  1HYS A;  5LMN K;  4A2B A;  4YDU A;  1QSY A;  4OPA A;  1O1W A;  1Q8I A;  2A3Z A;  1BL3 A;  4R79 A;  3J7Y P;  2FF6 A;  4LC9 B;  4CJL A;  1D5A A;  4MO5 A;  5BPL A;  3ZSW A;  1OH8 A;  2W6L A;  1MU2 A;  5HRO A;  3HTV A;  4KHQ A;  2O8D A;  3O9T A;  4QS8 A;  4KB0 A;  2HW3 A;  1RT5 A;  2G8F A;  3SI6 A;  2O8E A;  1VQP N;  5C2F A;  3KLI A;  3S3M A;  2P9P A;  3ZYY X;  5HRS A;  4BE2 A;  2P9P B;  3KK2 A;  1ASU A;  3AO1 A;  4EFH A;  1JLB A;  2X6S A;  2WTU A;  2VGM A;  5AR0 A;  2P5O A;  5BPN A;  4HWI A;  1LW2 A;  1KLM A;  3OBY A;  5AQU A;  3PX6 A;  3VET A;  4DU1 A;  3RR8 A;  4H03 B;  4BC4 A;  1TYQ A;  3ID8 A;  5KPR A;  4ZHR A;  3KKS A;  3DAW A;  3SPZ A;  2OPQ A;  4RG8 A;  4ELU A;  3MN6 A;  1Z6R A;  5AJ3 K;  3QEW A;  3HOS A;  4CGD A;  4BRK A;  2D0P A;  4C23 A;  4PA1 A;  4CBW A;  4CJ7 A;  5KQD A;  3C7N B;  3DLH A;  2A5X A;  4JKG B;  2G8I A;  2A1S A;  1IH7 A;  1DTQ A;  3VQ9 A;  3VEX A;  5J2Q A;  1EO1 A;  5AQL A;  1EKE A;  3E9O A;  3NVM A;  1ASW A;  3LP1 A;  2ETJ A;  4KB1 A;  4FZZ A;  3OYF A;  2KZZ A;  3K9J A;  4F8R A;  3D6R A;  3R8E A;  3O9U A;  3TSQ A;  5FPE A;  1N33 K;  3DLL L;  4BQZ A;  1NGE A;  3AAQ A;  1XMQ K;  4XIU A;  3CCE N;  4DSJ A;  1YTU A;  5FPN A;  1S1U A;  3TWH A;  1DTT A;  2ZQB A;  3MX2 A;  1HR0 K;  4B9L A;  2KLA A;  1F21 A;  5AQN A;  1RTH A;  4IJA A;  3PX4 A;  3ULE A;  2IVN A;  3GBT A;  4GV6 A;  3DMJ A;  3ULE B;  1S3X A;  2DPN A;  1RDW X;  3V9U A;  2NRW A;  4HTL A;  5LJW A;  3FFK B;  1IJJ A;  5C10 A;  4F4K A;  3CCJ N;  1X3N A;  1YI2 N;  4G1Q A;  4M7Y A;  4M3W A;  5FPD A;  1S1X A;  3J7A P;  3CC4 N;  1FKP A;  2VYP A;  4EP5 A;  5TKW A;  2QKB A;  4Z0U A;  4FLY A;  2YJE A;  3H6E A;  5EX5 A;  4K0K K;  3NVK A;  3HPG A;  2GWK A;  1Z05 A;  3ZLJ A;  5LY3 A;  1HX1 A;  3I33 A;  4GV9 A;  3S41 A;  4N41 A;  4FW2 A;  4CBX A;  1XC3 A;  2DFF A;  2HBJ A;  2HHX A;  3THX A;  1JXB A;  1VSI A;  3K2P A;  1QVF M;  1X9W A;  4JHD A;  4JHD B;  5HRN A;  3NH2 A;  1ESV A;  3DXM A;  3HPO A;  4DQ8 A;  4DTO A;  3DXM B;  3ZX3 A;  4BRP A;  4AM6 A;  3HP6 A;  3DOK A;  4ZTJ A;  3OA9 A;  5F0X A;  3QML A;  4KHY A;  1X9M A;  4BRH A;  3OYC A;  3MXI A;  2JGU A;  3NF7 A;  2OPS A;  4N47 A;  1T6D A;  1GLA G;  1RCH A;  1TUU A;  3HO1 A;  4BR2 A;  2NRH A;  1QVG M;  3OYJ A;  1YIJ N;  4AHU A;  3CQ8 A;  4A61 A;  1HNZ K;  4DSL A;  4DR1 K;  4FJG A;  3AVB A;  3D2E B;  5AFU H;  3O3H A;  5JMV A;  1VHX A;  3QER A;  1EWR A;  3EKS A;  2A1R A;  5KI6 A;  4PQU A;  4LF6 K;  5KTQ A;  4FPB A;  3SUN A;  1T6C A;  4V19 S;  2O8C B;  4GMJ B;  2YHW A;  5M1K A;  1C0F A;  4HTU A;  4JN4 A;  4LSL A;  3OTO K;  4KAZ A;  4KFB A;  1DEJ A;  3QIO A;  4IWV A;  4CJP A;  1DT9 A;  3DOL A;  3HM9 A;  4H5T A;  1XUP O;  4PHT X;  3C6U A;  1VSJ A;  3E66 A;  1NWK A;  1BA1 A;  2YI1 A;  2B4J A;  5CR4 A;  3TTF A;  3L2V A;  2GEM A;  3AO5 A;  1LOT B;  1HQE A;  4E19 A;  3MK6 A;  1NG9 A;  4DFP A;  4FLX A;  4FK4 A;  1QZ5 A;  4WFB L;  3ZCM A;  3C6T A;  4LD0 A;  1TAQ A;  2YHA A;  4WE1 A;  2ITM A;  3TAR A;  4FK0 A;  1S1T A;  4L3Q A;  4BRM A;  4C8K A;  3SCX A;  1QQC A;  5ADX A;  5D3G A;  4A62 A;  4W5N A;  3LDL A;  2WON A;  4DFM A;  2P5G A;  2F8T A;  4HUE A;  4QAG A;  4BG8 A;  5T7B A;  4DR6 K;  4DR2 K;  3R1X A;  1I3A A;  3KKR A;  1EXQ A;  3QET A;  1T8E A;  1DGK N;  1SKS A;  2HVH A;  5M1O A;  1G99 A;  4FWL A;  1WOQ A;  1XWL A;  1ASV A;  3PIO L;  2BUP A;  4H0P A;  2KQ2 A;  4FJJ A;  1CZ9 A;  1U6Z A;  5EXW A;  1SL0 A;  3D7E O;  1SL1 A;  4FWS A;  2V7Z A;  3DLK A;  4IEE A;  3O3G A;  2ATQ A;  3VN5 A;  3ZET A;  3CFP A;  4EIA A;  4OJR A;  3O80 A;  3V9Z A;  4JRQ A;  4DR3 K;  1CZB A;  3I8D A;  3OYG A;  1NOY A;  4XH5 A;  5M1F A;  1ATR A;  4FO0 A;  4FOI A;  4I7F A;  4CJT A;  5CYM A;  1NGF A;  3I55 N;  2QWR A;  4C1N K;  4OO1 J;  4FJ9 A;  3HRG A;  3SYZ A;  4NLB A;  5DM6 L;  4FM2 A;  4GKK K;  5JS1 A;  2JWK A;  1NLV A;  3V1O A;  2W41 A;  3KK7 A;  2D0O A;  2F9T A;  1C0U A;  1RBU A;  4JNE A;  3WXK A;  3A5N C;  3L4I A;  3WQT A;  4DUY K;  3ZSX A;  3EY1 A;  3L2R A;  1WLJ A;  3QEV A;  1BIZ A;  3TU5 A;  3CPW M;  4C8O A;  4JI6 K;  2G8W A;  1GOA A;  3OYK A;  3MMV A;  3TR8 A;  3MEC A;  2P9L B;  5HLF A;  4DV1 K;  3NHG A;  2D1K A;  1JXE A;  3OHR A;  2ZJR L;  1U49 A;  3CJB A;  3LP2 A;  1Q82 O;  2OZM A;  1REV A;  4E1N A;  4B3S K;  4FW1 A;  3SJH A;  4O55 A;  4N56 A;  3B6O A;  4Q0B A;  4CJK A;  1VSM A;  4GNI A;  1KRP A;  3TPQ A;  3M8P A;  2HHQ A;  2YHB A;  2Z1H A;  1KSP A;  1ZBF A;  3CCS N;  2ZGY A;  3NE6 A;  2P51 A;  2G8K A;  4TSX A;  4W5R A;  2HHS A;  4RW7 A;  5AQY A;  2B5J A;  5B8H A;  3SLC A;  1VQ9 N;  4BRC A;  4YFU A;  3CM5 A;  4BRI A;  5AZJ A;  3CYM A;  1M1K O;  3S9H A;  1JLQ A;  3FFI A;  3ZSZ A;  1ILY A;  1XC9 A;  4CJW A;  3C6A A;  4NB4 A;  3O3F A;  3VEY A;  1LV5 A;  2GBZ A;  3DLE A;  4LF5 K;  1RT3 A;  4IBN A;  4LY7 A;  5M1Q A;  1KTQ A;  2BH1 A;  1HKB A;  3WXI A;  4DSF A;  2HF4 A;  3OYN A;  3VPZ A;  2ASP A;  3TAQ A;  5HL7 L;  2CH6 A;  2XO7 A;  4BRL A;  2HMP A;  4XH4 A;  1H1V A;  2ZJQ L;  1VQN N;  5AQS A;  4X64 K;  4YOU A;  3LAM A;  1VRU A;  4CZF A;  5KPT A;  4WFN L;  4ID1 A;  2ZE2 A;  3SAH A;  3FZK A;  3CJ9 A;  1NKC A;  4ZTF A;  2QWN A;  1KC8 O;  3DRP A;  4DV2 K;  3CF5 L;  4O4G A;  1J9A A;  3OJS A;  3DXK A;  3U4L A;  3GE1 A;  4FVU A;  3DXK B;  4B9S A;  3Q7C A;  3JAM O;  1T3V A;  2XY8 A;  3R9P A;  1S6Q A;  3CG7 A;  4LSN A;  3W0L A;  3RWU A;  3UIQ A;  3EEQ A;  1VAZ A;  2YNG A;  3TAE A;  3FZM A;  1K8A O;  4KPY A;  4B3T K;  5GAE P;  2LSN A;  1JCF A;  4CGJ A;  5CZ2 A;  2VG6 A;  3CI5 A;  3O8M A;  5GAD P;  4WQ5 C;  1KVB A;  2I7P A;  1MWK A;  4M7X A;  1T44 A;  1I39 A;  2V51 B;  4JKE A;  5JLH A;  4FJ7 A;  3K5M A;  1D9D A;  3AVF A;  3GOI A;  3QIC A;  3UKU B;  2OA8 A;  1RFQ A;  2HBL A;  1U48 A;  2PY5 A;  3MN5 A;  1GLB G;  3FZF A;  4YOR A;  3EN9 A;  5E41 A;  5GIO A;  1NK8 A;  1VSK A;  3DRR A;  4BR4 A;  1EET A;  3WEE A;  1L3U A;  4ILH A;  3WEE B;  1WSG A;  3ASM A;  3VER A;  4W5T A;  4BRN A;  1RT1 A;  1WAJ A;  3SQ0 A;  5I3U A;  4O0J A;  4FLZ A;  4K8Z A;  4HVJ A;  4BRD A;  2QKK A;  4JK9 A;  3OY9 A;  2RHK A;  4M41 A;  2P9I B;  1WSH A;  5I9E B;  2P9K A;  2D0A A;  1RBR A;  4DV0 K;  1P90 A;  2NZT A;  2FBX A;  4DSE A;  1BUP A;  3QEP A;  4BC3 A;  3D0P A;  4OPK A;  5FDL A;  4DQS A;  3CJ1 A;  1KAZ A;  1VQ5 N;  3LDO A;  4GKJ K;  1HNV A;  1XQS C;  1I94 K;  3ZEU B;  3ZT1 A;  1GLE G;  4J2D A;  1HJO A;  3ZT4 A;  2NNW A;  3KHY A;  1N36 K;  3THY A;  4CF2 A;  3Q7B A;  3SUO A;  3OYH A;  3O6W A;  3VQ5 A;  5TKY A;  2RF2 A;  4B1W B;  1ATS A;  4E3S A;  4M3U A;  2AP1 A;  3K59 A;  2IGI A;  3KK3 A;  1ZBH A;  2HOE A;  5JVG L;  2DFE A;  3L4Q A;  4BVO A;  1KD1 O;  1Q18 A;  5C2D A;  1Q81 O;  1RBV A;  4XH1 A;  4CFA A;  4OKE A;  3VQC A;  4JI7 K;  3LDP A;  3CXC M;  2O8F A;  4IOX A;  1EWQ A;  3CC2 N;  5DK5 A;  4CJ3 A;  5GAH P;  4B9N A;  3O4N A;  4Q5V A;  1GLF O;  1X9J A;  1WBB A;  2RKI A;  1IKW A;  2QWP A;  4O8K A;  2DTU A;  5EU7 A;  1KLN A;  5EOY A;  3VF2 A;  3AAR A;  1E4F T;  4OKJ A;  1C1B A;  3O9Q A;  4DS4 A;  4WQ5 A;  3V81 A;  1NGD A;  4N5S A;  1ZBI A;  4AHT A;  3NGY A;  1QE1 A;  2JWL A;  4I9L A;  3THW B;  4DWI A;  5AQG A;  3RSE A;  1IKY A;  3VF6 A;  1OVY A;  3L2W A;  1WSF A;  2OCE A;  1TL1 A;  3RMD A;  3HM8 A;  4CEC A;  1VQ6 N;  2D5R A;  4CK1 A;  2HHW A;  4MDB A;  1QS4 A;  2KKZ A;  3K5L A;  1U45 A;  2KHO A;  1YHQ N;  3UB5 A;  2BDP A;  4FLV A;  2O8D B;  3CHW A;  4FM0 A;  4G9Z A;  4QS9 A;  3F2K A;  2O8E B;  4FOE A;  3I0R A;  3VQP A;  2HHV A;  3IKM A;  4CZM A;  1TK0 A;  3VQ8 A;  5H1S Q;  1FJG K;  1M90 O;  1U4B A;  1S6P A;  3ZT0 A;  3AVH A;  4OPJ A;  1NMD A;  3VMF B;  4KKO A;  3TSP A;  1WNS A;  1TL3 A;  4KH6 A;  1TYQ B;  3DLG A;  4PKH A;  1BO5 O;  4PL7 A;  3PO5 A;  3BZC A;  5J2P A;  4B9M A;  1Q86 O;  3UE5 A;  4U7B A;  2Y1J A;  3VQD A;  3CD6 N;  1NK6 A;  1QZ6 A;  3B6P A;  3C0B A;  5LL6 Z;  4CZJ A;  5HP1 A;  3SQ4 A;  4WQ4 C;  4KHN A;  1YJW N;  3OJU A;  1C0M A;  4HCB A;  3WT0 A;  4KHP K;  3U9D A;  5BN8 A;  5KGW A;  2XHB A;  4YNQ A;  4DMN A;  2O4G A;  4IOC L;  2Q0U A;  3IFR A;  5C24 A;  2RPI A;  4KTQ A;  4BR7 A;  1W0H A;  4H5W A;  2GUP A;  3C95 A;  1N5Y A;  1DKG D;  1J5O A;  4JKA A;  3AA5 X;  5BRF A;  2QWM A;  4KTW A;  4DUZ K;  4DTR A;  1LWE A;  1HNW K;  4KBO A;  2V52 B;  2YV0 X;  1W2B M;  3AVA A;  1T7P A;  5KRT A;  4CW7 B;  2HHU A;  3CCQ N;  4IDH A;  4JYA K;  4BR0 A;  3AA4 A;  5CHI A;  1RBT A;  1OVQ A;  4EHU A;  4O5B A;  1G15 A;  4BGA A;  4KHU A;  3C94 A;  4BRF A;  4RW9 A;  5FRM A;  4JK8 A;  5BR9 A;  3F9M A;  3CCM N;  2J4R A;  5MLC Q;  2HMI A;  4YOX A;  5J1E A;  1FK9 A;  4B9T A;  3IMX A;  1QSL A;  3VEO A;  4DFK A;  4KTZ A;  3ALY A;  1BCM A;  3U3G A;  4DU3 A;  4K43 A;  4M45 A;  3TAG A;  4CIF A;  4FJL A;  4X62 K;  4X66 K;  3AV9 A;  4FJK A;  3THX B;  4BE1 A;  1NM1 A;  4CD1 A;  1D4X A;  3LZJ A;  1ATN A;  5DMR A;  4ELV A;  2KFZ A;  5HBM A;  3OS2 A;  1BDG A;  4EZ9 A;  2I7N A;  3KD1 E;  4J2A A;  4QS7 A;  3LWL A;  2NRV A;  2YNF A;  3ZT2 A;  1N34 K;  4IFV A;  3V6D A;  3L6Q A;  4CZG A;  2YNH A;  3F73 A;  3SK3 A;  1TK5 A;  2QXF A;  4IZ9 A;  1QQM A;  4PL8 A;  4CZE A;  1YIT N;  2AA4 A;  2W6K A;  3I0S A;  4WQ4 A;  4MQ3 A;  5AQO A;  4H0Y B;  3BP8 A;  4KRE A;  1DLO A;  4WFA L;  1VK0 A;  5AQX A;  3G25 A;  4AF1 A;  1YVU A;  3EE9 A;  3OW2 M;  3SV3 A;  5F2R A;  1U47 A;  4KI4 A;  3QFU A;  3R6M A;  1RT2 A;  1YT3 A;  5LJV A;  2UU9 K;  2F96 A;  1CLQ A;  3EL2 A;  3VGM A;  4F3O A;  5C12 A;  3NF6 A;  2HBK A;  5AQI A;  1V4T A;  2NUB A;  3AVN A;  3P5J A;  1TVR A;  4CBU A;  3HL8 A;  4AM7 A;  2FXU A;  2O8B A;  4F9O A;  2PBD A;  3HST B;  4H0T B;  4E7H A;  4A5B A;  3SAG A;  4LFC K;  2YCH A;  3J81 O;  2ZF5 O;  3T7Z A;  4C8L A;  1KFS A;  4DV5 K;  3RMC A;  2OPP A;  4FWP A;  3MCP A;  5EY4 A;  4DQI A;  4NYN A;  1HYV A;  2HVI A;  3QEX A;  5AQF A;  1S9E A;  4JRP A;  1SKR A;  4CZK A;  4CEF A;  3T1H K;  4J2B A;  4I6M A;  1JCG A;  4I6M B;  5HOO A;  4JLH A;  4CHZ A;  1BIU A;  4MO4 A;  4MLH A;  2ZD1 A;  3HPH A;  1K8K A;  1W9H A;  3H46 O;  4BRG A;  4BE0 A;  1K8K B;  4LF9 K;  4BR9 A;  3AAP A;  4O5F A;  3QIP A;  1X1P A;  2WUS A;  2HHT A;  2WFB A;  1ITG A;  2IIR A;  3L2U A;  3ZET B;  1RTD A;  4KH5 A;  2V7Y A;  1L3S A;  3JXU A;  4B3R K;  3K5N A;  4FJM A;  4Z4F A;  3EZ5 A;  3FZL A;  4ISG A;  2FSN A;  1UA1 A;  3TSU A;  3HT3 A;  1ZXO A;  5AQM A;  2P9N A;  2HB5 A;  5E26 A;  2UXC K;  3E9P A;  1B9F A;  1S72 N;  1IKX A;  4C8M A;  4OKK A;  3U6F A;  4CEZ A;  3KZB A;  1R59 O;  3SUQ A;  3OYM A;  3KD5 E;  1WSE A;  4CZH A;  3QDK A;  3WXM B;  2ZGZ A;  4OVL A;  1JLE A;  3VQQ A;  1Q7Y O;  3TAM A;  5IWA K;  3CPE A;  4CJR A;  3RRG A;  4DR4 K;  3T1Y K;  4FZX C;  4LFB K;  1Y64 A;  1XNR K;  4FJX A;  4CGG A;  1WSI A;  4WCE L;  4ISF A;  3A5O C;  3CCV N;  4ISE A;  1TKX A;  5AQH A;  4EHT A;  1TKT A;  3NFA A;  3V9W A;  1VSL A;  3VTH A;  4A2A A;  4CFC A;  1CXQ A;  5AQP A;  2XRI A;  5AZI A;  2X78 A;  4DF8 A;  3A5M C;  4RTF D;  1K9M O;  1HKG A;  2UUC K;  4CHQ A;  4QCL A;  3VQB A;  3VEZ A;  2GV9 A;  3GL1 A;  5AQW A;  2OTJ N;  1BWF O;  3DJC A;  4JAX A;  1N8R O;  2Q1N A;  1QSS A;  5EVZ A;  4M3R A;  4FWM A;  1C0G A;  4JKF A;  4CER A;  4JKB A;  3KTQ A;  2GTD A;  3CIP A;  4DLG A;  4LF4 K;  3NF8 A;  1IG8 A;  3BY5 A;  4DTP A;  4EAH D;  1ZBL A;  3M6G A;  3WNE A;  3G6E N;  1JJ2 M; 
#chains in the Genus database with same CATH homology
 1DTQ A;  3VQ9 A;  1IKV A;  4KV8 A;  1GOC A;  5J2Q A;  2BAN A;  1B9D A;  1EKE A;  3ITH A;  4RW8 A;  1ASW A;  3LP1 A;  2IC3 A;  3OYA A;  1HNV A;  3QEI A;  2ETJ A;  3KJV A;  3IAY A;  4KB1 A;  4FZZ A;  4RW4 A;  3OYF A;  4ICL A;  4UQG A;  3JYT A;  3T3F A;  2KZZ A;  4F8R A;  3ZT1 A;  4CF0 A;  3PX0 A;  4O44 A;  3TAB A;  4J2D A;  4PY5 A;  3ZT4 A;  1TAU A;  2YKN A;  4CF2 A;  3SUO A;  4KHW A;  3OYH A;  3VQ5 A;  3AA2 A;  4CHP A;  4E7I A;  2RF2 A;  4PUO A;  3M8S A;  4E3S A;  4XIU A;  2Z1G A;  4DQP A;  4DSJ A;  2IAJ A;  3ZT3 A;  4M3U A;  3K59 A;  2IGI A;  2EHG A;  1YTU A;  1S1U A;  3KK3 A;  3TWH A;  1ZBH A;  1DTT A;  2ZQB A;  4B9L A;  2FC0 A;  2DFE A;  1F21 A;  1RTH A;  3AO2 A;  3KLH A;  3PX4 A;  3OVN A;  4JS4 A;  4DTJ A;  3DMJ A;  2VWJ A;  2O4I A;  1RBV A;  4B8A B;  4CFA A;  4OKE A;  3VQC A;  3V9U A;  2GUI A;  1L5U A;  3V1R A;  3DI6 A;  1VSE A;  4M3Z A;  5DK5 A;  4CJ3 A;  4B9N A;  4CEQ A;  1S9G A;  4F4K A;  3O4N A;  3K58 A;  4Q5V A;  1ZYQ A;  1A5W A;  2VG7 A;  2RKI A;  4G1Q A;  1IKW A;  4FJ5 A;  2DTU A;  4M3W A;  4E0D A;  5EU7 A;  1TGO A;  1S1X A;  1TK8 A;  1NK7 A;  1KLN A;  1FKP A;  4KO0 A;  4Z4H A;  4CFB A;  3VQ4 A;  4OKJ A;  1C1B A;  1WAF A;  3T1A A;  1A5V A;  4EP5 A;  4GVM A;  4DS4 A;  4Z0U A;  2QKB A;  4BDZ A;  3MXM A;  3ZSV A;  4LH4 A;  3V9S A;  4FLY A;  3V81 A;  2D0C A;  4N5S A;  1ZBI A;  4AHT A;  3NGY A;  1R0A A;  2IOC A;  3HPG A;  3TAN A;  1QE1 A;  4I9L A;  4DWI A;  3AVC A;  4ID5 A;  5KGX A;  1IKY A;  3OYD A;  2IDO A;  3K57 A;  1L3V A;  3L2W A;  1A5X A;  1WSF A;  1LAW A;  5HRP A;  1TL1 A;  4N41 A;  3RMD A;  4Z4G A;  4CEC A;  4FW2 A;  3VQ7 A;  4NYF A;  2D5R A;  4CJ4 A;  3SJJ A;  2DFF A;  4CK1 A;  1CXU A;  1QHT A;  1RDC A;  2HHW A;  2HHX A;  3PUF A;  2E4L A;  1JXB A;  1VSI A;  3K2P A;  1QS4 A;  5CY4 A;  3LDS A;  1BQM A;  1X9W A;  2PZS A;  3O4Q A;  1WN7 A;  1NOZ A;  3K5L A;  1U45 A;  1B92 A;  2FBY A;  5HRN A;  3E01 A;  4OGE A;  3NH2 A;  4CEB A;  3ZSQ A;  3HPO A;  4B8C A;  2ITG A;  4DTO A;  2BDP A;  4FLV A;  3CFR A;  3WNF A;  4CGH A;  3HP6 A;  4M42 A;  4CGF A;  3DOK A;  1C6V A;  4R5P A;  4FM0 A;  4ZTJ A;  3LP0 A;  2XY5 A;  1SKW A;  3NCI A;  4KHY A;  3QO9 A;  1X9M A;  3I0R A;  3VQP A;  3KLE A;  3OYC A;  4BWJ A;  3MXI A;  1HJR A;  1JL1 A;  2JGU A;  1IO2 A;  1VSF A;  2OPS A;  3NF7 A;  4FXD A;  4N47 A;  2HHV A;  1TK0 A;  3VQ8 A;  4Z4E A;  3RMA A;  1Y97 A;  1RCH A;  3NF9 A;  4CK3 A;  1TKD A;  3HO1 A;  1U4B A;  4B3O A;  1S6P A;  3ZT0 A;  3AVH A;  4OPJ A;  4DU4 A;  3OYJ A;  3BDP A;  4AHU A;  5C42 A;  3CQ8 A;  4DSL A;  4CFD A;  2WOM A;  3H08 A;  3HVT A;  3P1G A;  4F3T A;  1FKO A;  3CFO A;  4KKO A;  4FJG A;  3L2Q A;  3LPU A;  1WNS A;  3AVB A;  1JLA A;  1TL3 A;  3O3H A;  2KFN A;  3QER A;  4I2Q A;  2DY4 A;  3DLG A;  1TKZ A;  4E7J A;  2A1R A;  3PO5 A;  1T7P A;  3NH1 A;  5KI6 A;  4PQU A;  3M8R A;  4DFJ A;  4CEE A;  5KTQ A;  3SUN A;  3KK1 A;  5J2P A;  3JSM A;  4B9M A;  4GMJ B;  3VQA A;  3VA3 A;  4FLT A;  4NCB A;  3MAQ A;  1J53 A;  4HTU A;  1VSD A;  2Y1J A;  3VQD A;  1TV6 A;  4LSL A;  1NK6 A;  4KAZ A;  5CZ1 A;  4KFB A;  3B6P A;  1LAV A;  1T05 A;  1VSH A;  5HP1 A;  2KZM A;  3QIO A;  2HND A;  3SQ4 A;  4CJP A;  4CED A;  1RT7 A;  3DOL A;  4CJS A;  3HM9 A;  4KHN A;  3OJU A;  1C0M A;  1RDD A;  3C6U A;  4IFY A;  1VSJ A;  5K14 A;  4HCB A;  2RN2 A;  4DTS A;  4L8R B;  3PY8 A;  4CF8 A;  2B4J A;  5C25 A;  3L2V A;  3AO5 A;  5KGW A;  1BI4 A;  4YNQ A;  4DMN A;  2YNI A;  2XHB A;  1HQE A;  2B6A A;  2O4G A;  1BI4 B;  4CES A;  4JS5 A;  4E19 A;  1NK0 A;  1N6Q A;  4CHO A;  1IG9 A;  3HYF A;  4DFP A;  5C24 A;  4PWD A;  1XHX A;  2RPI A;  4FLX A;  4FK4 A;  4KTQ A;  3ZCM A;  3C6T A;  4LD0 A;  4DTN A;  5FRN A;  1TAQ A;  1W0H A;  2YHA A;  4WE1 A;  3LP3 A;  4CHY A;  3TAR A;  1T03 A;  1NKE A;  2PYJ A;  4FK0 A;  1EP4 A;  1S1T A;  3C95 A;  3M8Q A;  3U3Y A;  1N5Y A;  4FZY A;  3QNN A;  4C8K A;  3SCX A;  1QQC A;  3RTV A;  1J5O A;  5D3G A;  1JLG A;  4FLU A;  3AA5 X;  4W5N A;  4BWM A;  3F9K A;  4KTW A;  4W5O A;  2WON A;  1LWE A;  1RIL A;  4DTR A;  3RRH A;  4DFM A;  2P5G A;  2EX3 A;  3NH0 A;  2F8T A;  2YV0 X;  4QAG A;  3AVA A;  4HUE A;  5KRT A;  5T7B A;  1UWB A;  4DS5 A;  1NK4 A;  3LAK A;  1RT4 A;  4DF4 A;  4DSK A;  1I3A A;  3KKR A;  1EXQ A;  3QET A;  1T8E A;  2HHU A;  1SKS A;  2HNY A;  2HVH A;  3AA4 A;  4RW6 A;  4CK2 A;  4CEO A;  1X9S A;  1RBT A;  3S3N A;  1RNH A;  4O5B A;  1G15 A;  3MEG A;  4GW6 A;  1XWL A;  5J2M A;  1ASV A;  2E6M A;  3C94 A;  3PV8 A;  4IKF A;  4KHU A;  4KHS A;  4FJJ A;  2KQ2 A;  4RW9 A;  1CZ9 A;  4FLW A;  2KTQ A;  1C0T A;  3IRX A;  1SL0 A;  5FRM A;  3QLH A;  3NGZ A;  1SL1 A;  3ISN C;  3DLK A;  3O3G A;  2ATQ A;  3VN5 A;  2HMI A;  5HRR A;  3CFP A;  1SV5 A;  2QK9 A;  4OJR A;  5J1E A;  1FK9 A;  3V9Z A;  4HUF A;  1QTM A;  4H4O A;  4JRQ A;  4B9T A;  2Z1I A;  2VG5 A;  3MED A;  2XY7 A;  1CZB A;  3I8D A;  1QSL A;  1FXX A;  3HK2 A;  3AVJ A;  3NBP A;  4KTZ A;  4DFK A;  3OYG A;  1NOY A;  4DTM A;  3ALY A;  1BCM A;  3U3G A;  4DU3 A;  4M45 A;  3SNN A;  3L8B A;  3TAG A;  4CIF A;  4HCC A;  4H4M A;  4FJL A;  1BGX T;  4I7F A;  3AV9 A;  1U04 A;  1EX4 A;  4FJK A;  1NJZ A;  4BE1 A;  4CJT A;  5CYM A;  1KCF A;  5SWM A;  4CJF A;  3HVR A;  2YKM A;  3LZJ A;  4FJ9 A;  3DM2 A;  4CHN A;  1BQN A;  3G10 A;  5FRO A;  3ULD A;  1HRH A;  3SYZ A;  5DMR A;  1NJX A;  4ELV A;  2KFZ A;  4J2E A;  4AIL C;  5HBM A;  3OS2 A;  4FM2 A;  3RR7 A;  2P1J A;  4OLA A;  3AVL A;  5JS1 A;  4EZ9 A;  4J2A A;  3KD1 E;  3V1O A;  3NDK A;  4DG1 A;  2E6L A;  1YTA A;  4LH5 A;  3LWL A;  4FJ8 A;  5SZT A;  2YNF A;  3ZT2 A;  4FM1 A;  4IFV A;  1Z26 A;  3MXJ A;  1D9F A;  2A1S A;  3V6D A;  1RT6 A;  4IG0 A;  1C0U A;  1RBS A;  1RBU A;  2X6N A;  2YNH A;  3F73 A;  3VA0 A;  2D0B A;  2QXF A;  3DRS A;  3HP9 A;  5I42 A;  1TK5 A;  4FJN A;  3IG1 A;  3ZSX A;  3AVK A;  4C8N A;  3EY1 A;  3AVG A;  3L2R A;  4B08 A;  1UA0 A;  1HYZ A;  1RDA A;  1RTJ A;  1WLJ A;  5JS2 A;  3AO3 A;  3QEV A;  4Y1C A;  3I0S A;  1BIZ A;  2G8V A;  4NCA A;  3HJF A;  4MQ3 A;  3VQE A;  4C8O A;  2G8W A;  1GOA A;  3LAL A;  3OYK A;  4N76 A;  4K8X A;  1RDB A;  3DYA A;  1DLO A;  3AA3 A;  4CIE A;  4KRE A;  2AJQ A;  3G0Z A;  3TR8 A;  1VK0 A;  3MEC A;  4I2P A;  3TAP A;  1NK5 A;  4EP4 A;  3QNO A;  1YVU A;  1UAX A;  5HLF A;  3P83 D;  2I5J A;  4FCY A;  3NHG A;  1JXE A;  5CYQ A;  3SV3 A;  3L3U A;  1JLC A;  4DLE A;  3SUP A;  1U47 A;  4BAC A;  1U49 A;  4FJH A;  3LP2 A;  4KI4 A;  1HNI A;  3V1Q A;  1RT2 A;  1YT3 A;  4IG3 A;  2OZM A;  2F96 A;  3LWM A;  1CLQ A;  1REV A;  2OPR A;  4F3O A;  3THV A;  3NF6 A;  4KRF A;  4E1N A;  2JLE A;  3V4I A;  1BIS A;  2NUB A;  3P5J A;  3AVN A;  3LPT A;  4FW1 A;  4F2R A;  4CE9 A;  4O55 A;  1TVR A;  3HL8 A;  4DTX A;  4N56 A;  2IS3 A;  3B6O A;  4Q0B A;  2XY6 A;  4CJK A;  1VSM A;  3NGI A;  1XI1 A;  1KRP A;  3M8P A;  1KVA A;  2YHB A;  3HST B;  2Z1H A;  2G8U A;  4B9U A;  2HHQ A;  4M3T A;  1NJW A;  1KSP A;  1ZBF A;  4E7H A;  3S3O A;  5KRS A;  1D8Y A;  3AVI A;  3NE6 A;  2G8H A;  2P51 A;  1Z25 A;  4ELT A;  2G8K A;  4TSX A;  4W5R A;  2OYQ A;  3OS1 A;  4HHT A;  1NKB A;  2HHS A;  3VQ6 A;  4RW7 A;  4Z4I A;  3OYI A;  2HNZ A;  4CF9 A;  2B5J A;  4C8L A;  4NCG A;  3QEW A;  2Y1I A;  1LWF A;  3HXM A;  4I9Q A;  4CJ5 A;  1KFS A;  3RMC A;  3QIN A;  4DQR A;  3WNH A;  2OPP A;  4OLB A;  4YFU A;  4DQI A;  3CM5 A;  1HYV A;  4NYN A;  3CYM A;  3S9H A;  3WNG A;  2HVI A;  3QEX A;  3ZSO A;  1Q9Y A;  4CEA A;  1JLQ A;  4E1M A;  2R7Y A;  3FFI A;  3ZSZ A;  4CJU A;  1VRT A;  4DTU A;  1BCO A;  1XC9 A;  4CJW A;  1S9E A;  4JRP A;  3O3F A;  1SKR A;  1GOB A;  1RTI A;  4CGI A;  2GBZ A;  1LV5 A;  2PYL A;  3DLE A;  4E7L A;  4CEF A;  1NJY A;  1RT3 A;  4IBN A;  3K5O A;  4LY7 A;  4E7K A;  3AVM A;  4J2B A;  4AHC A;  1KFD A;  4QOZ B;  3A2F A;  3MEE A;  4CF1 A;  1KTQ A;  4FJI A;  4JLH A;  4CHZ A;  1BIU A;  1Q9X A;  2BGG A;  2F8S A;  1K6Y A;  4DSF A;  2ZD1 A;  3OYN A;  5J2N A;  3TAF A;  3HPH A;  1W9H A;  1SL2 A;  1JL2 A;  4BE0 A;  3TAQ A;  4H8K A;  3KLF A;  1WSJ A;  2VWK A;  4IDK A;  3QIP A;  1X1P A;  2HHT A;  1ITG A;  1S1W A;  4AHS A;  2XO7 A;  4W5Q A;  4CJQ A;  3L2U A;  1S5J A;  4Y1D A;  3SZ2 A;  1RTD A;  3IS9 A;  3CM6 A;  3LAM A;  4BDY A;  1L3S A;  1VRU A;  4FK2 A;  3K5N A;  4OGC A;  4FJM A;  1LWC A;  4Z4F A;  2Z1J A;  4CIG A;  3EZ5 A;  3L3V A;  1JLF A;  4ID1 A;  4CJV A;  2ZE2 A;  1UA1 A;  2OZS A;  3HT3 A;  2X74 A;  3OYL A;  1NKC A;  3OYE A;  4ZTF A;  2HB5 A;  3DRP A;  1LW0 A;  4O4G A;  1J9A A;  3OJS A;  1B9F A;  2DFH A;  2KW4 A;  1IKX A;  3SPY A;  3KLG A;  3TI0 A;  4C8M A;  4M3Y A;  4OKK A;  4FYD A;  1HMV A;  3U6F A;  1S1V A;  3PO4 A;  1C1A A;  4CEZ A;  3OYB A;  3SUQ A;  4B9S A;  4FVM A;  3OYM A;  4O0I A;  2XY8 A;  3KD5 E;  3ZSR A;  1S6Q A;  3CG7 A;  4LSN A;  3NAE A;  1C1C A;  1WSE A;  3OS0 A;  3RWU A;  3BGR A;  3UIQ A;  2BE2 A;  4KI6 A;  4OVL A;  2YNG A;  4AHR A;  1JLE A;  3TAE A;  4DSI A;  1HYS A;  4KPY A;  3SQ2 A;  1NK9 A;  3VQQ A;  2LSN A;  4CGJ A;  1QSY A;  1O1W A;  1Q8I A;  3TAM A;  1HQU A;  5CZ2 A;  4CJR A;  1BL3 A;  3ZSY A;  3RRG A;  2VG6 A;  4FZX C;  3QES A;  4CJL A;  1D5A A;  1KVB A;  1KVC A;  2FBT A;  3ZSW A;  4M3X A;  1MU2 A;  5HRO A;  4KHQ A;  1I39 A;  4FJ7 A;  4FJX A;  1BHL A;  3KIO A;  3AO4 A;  3K5M A;  4CGG A;  1WSI A;  4KB0 A;  1D9D A;  1L3T A;  4B9V A;  1RT5 A;  2G8F A;  2HW3 A;  3SI6 A;  3AVF A;  4Z4C A;  1TKX A;  3KLI A;  3S3M A;  5HRS A;  2OA8 A;  4BE2 A;  1U48 A;  3KK2 A;  4EZ6 A;  1TKT A;  1ASU A;  3NFA A;  3AO1 A;  3V9W A;  2PY5 A;  1ZBU A;  1VSL A;  5E41 A;  1NK8 A;  1JLB A;  3LAN A;  2X6S A;  1VSK A;  4CFC A;  3DRR A;  1EET A;  1L3U A;  2P5O A;  1CXQ A;  1WSG A;  2XRI A;  3ASM A;  4MFB A;  1LW2 A;  1KLM A;  4W5T A;  3EYZ A;  1RT1 A;  1WAJ A;  3SQ0 A;  3PX6 A;  5I3U A;  2X78 A;  4O0J A;  4FLZ A;  4DU1 A;  4DF8 A;  3RR8 A;  4K8Z A;  4HVJ A;  1JKH A;  2QKK A;  4CHQ A;  3OY9 A;  4QCL A;  3RMB A;  3VQB A;  2GV9 A;  3D45 A;  4M41 A;  2W42 A;  3V9X A;  1XHZ A;  4DQQ A;  3DLB A;  1WSH A;  3SV4 A;  4ZHR A;  3LZI A;  3KKS A;  3T19 A;  3SPZ A;  2OPQ A;  2D0A A;  1QSS A;  1RBR A;  4RG8 A;  4ELU A;  4M3R A;  4BDP A;  4CJE A;  4CCH A;  1SUQ A;  4CER A;  3KTQ A;  3DLR A;  4E89 A;  2Q3S A;  4DLG A;  4CGD A;  3NF8 A;  2FBX A;  1HPZ A;  4DSE A;  4DTP A;  4PA1 A;  4HUG A;  3QEP A;  1UOC A;  1ZBL A;  4F2S A;  1J54 A;  4AH9 A;  3SQ1 A;  2FBV A;  3WNE A;  4AHV A;  3D0P A;  4OPK A;  5FDL A;  3DLH A;  2G8I A;  4DQS A;  1IH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...