4CF0A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf0A00
3M8SA 3HL8A 3LWLA 4DSEA 1BL3A 1DTTA 3QIPA 4Y1CA 2HHTA 3H08A 1S1TA 3KLHA 1YVUA 3T3FA 1NJZA 1VSIA 5HBMA 1NJYA 1REVA 4Z4GA 2F8TA 1NK8A 2Q3SA 1S1UA 1HQEA 3LAKA 4FM0A 4HCCA 4DTOA 5FROA 1KLNA 2YV0X 3RMCA 2HHUA 3HJFA 1HYZA 4FJIA 3NGIA 3MXIA 4BE2A 3SUPA 3THVA 2EHGA 3O4NA 4M3XA 4HUEA 1RILA 4M3UA 2HVIA 4J2DA 5J2PA 1WSJA 2XY8A 3SV4A 2HHQA 4EZ6A 1KVAA 2X74A 2XO7A 1VSJA 3QNNA 1Q9XA 3AO3A 1WSFA 1RT6A 4E7JA 1IKWA 4DTRA 3QESA 1LAWA 4FJ7A 4CGIA 1WSIA 1KFDA 1B9FA 3DLEA 1D9DA 4B8AB 4Z4CA 3S3NA 3K5NA 4KHSA 4DQSA 2G8UA 3ZCMA 3QEWA 3AVGA 4BWJA 1LWCA 4DTJA 2P1JA 1LW2A 3IG1A 2B4JA 2GUIA 3DM2A 4O44A 4CERA 3L2WA 1SKWA 4FYDA 1C1CA 4FK2A 1ZBIA 2DTUA 1A5XA 4FM1A 3JYTA 3OYHA 3AVLA 3I8DA 2Z1JA 4IBNA 4CF8A 2HW3A 2HHWA 3OS1A 1U47A 3SYZA 4OKJA 5HRNA 4FLYA 3QERA 3DOLA 1FXXA 4NYNA 3ZSVA 3OYLA 1RT4A 5J2QA 3V9ZA 3NH0A 3AA3A 4OVLA 4OGCA 4AHCA 1NK4A 1QQCA 4KO0A 1BIUA 3DLGA 3NGZA 3TWHA 4DF4A 2Y1IA 1Q9YA 4FLUA 3G10A 3QEIA 3ALYA 1XWLA 1VSFA 1WN7A 4W5NA 3PUFA 5J1EA 2HNZA 4NCBA 3NCIA 5KRTA 4FZXC 5KRSA 4DS4A 1TL3A 3DRPA 2AJQA 1RT2A 2IC3A 3DOKA 4E7KA 2RN2A 1YT3A 3TANA 5J2NA 2PYLA 3AVMA 4CFBA 4E1MA 1UOCA 1Z26A 2YKNA 4H4MA 3O4QA 1N5YA 2YHAA 4DS5A 1A5VA 4QCLA 3ZSYA 2XY5A 4KFBA 3TR8A 3TI0A 4CHQA 3NFAA 1UWBA 3ZSWA 1T8EA 4GMJB 4CF9A 3ZT1A 3HPOA 4FLVA 4K8ZA 2KFNA 4CHPA 4FW2A 3L2UA 4DQRA 4CJUA 1ASWA 3LZJA 4PQUA 1JLGA 2VG5A 4B08A 3TAPA 1TK5A 2P5GA 3ZSRA 2KW4A 3MEGA 5CYQA 4DSJA 4CGGA 4RW9A 3V81A 1ZYQA 2DFHA 4JLHA 3SUOA 4CIEA 4DTPA 1ASUA 5KI6A 1I39A 4RW7A 4OLBA 1WAFA 1W9HA 3VQ6A 4W5TA 1SV5A 5I3UA 1C1BA 1DLOA 2XRIA 1RT5A 4YNQA 4AHSA 4CHZA 1HPZA 1IKXA 4OGEA 3HP9A 5JS2A 4CJ5A 4E19A 5C25A 1F21A 1BI4A 2BANA 2D0AA 2Z1GA 1RTJA 2D5RA 4CE9A 3SQ4A 1ITGA 3LP3A 2YNFA 1X9WA 4FJGA 2GV9A 4IFVA 2IOCA 4BWMA 4ELUA 3T19A 1VSMA 4HHTA 2Y1JA 4F4KA 4CEFA 3M8PA 4CECA 1JL1A 2WOMA 5CZ2A 4DWIA 4O55A 3VQPA 3RMBA 4DFKA 2BE2A 4EP4A 1KVBA 4GW6A 3RMAA 5JS1A 5FDLA 4DTSA 4FZZA 3ZT4A 3MXMA 5CY4A 1HMVA 1RDAA 3VQ4A 1RBRA 2WONA 4M42A 1WLJA 3ZT3A 1JLAA 1IH7A 4CESA 3KJVA 1Z25A 4F3TA 1VSEA 4CJPA 5C42A 4W5OA 3T1AA 3ZSQA 1QTMA 1TV6A 2HHVA 3K59A 2JGUA 4BACA 4BDZA 4E3SA 1U49A 1NKBA 3OYEA 3TAEA 1BISA 4FJXA 4M3YA 2HHSA 2RPIA 4N47A 4QAGA 4JRQA 4DSLA 4GVMA 1NK7A 4AILC 3OS2A 3LP1A 1U48A 4AHRA 3AVFA 1J9AA 3OYJA 3L2QA 1LWEA 2D0BA 3TABA 3AVNA 5CZ1A 1T7PA 4KHWA 1RDBA 1KRPA 3LPUA 4CJVA 2KZZA 4HVJA 3LANA 1J53A 1KVCA 2I5JA 2QKKA 3LALA 3V1QA 3MEEA 4RW6A 1C0UA 1X1PA 4CEQA 4ZTJA 4UQGA 2QK9A 3SQ2A 2HB5A 3PV8A 3DLRA 3HP6A 3NHGA 3TARA 1U04A 2KZMA 3OYAA 1IO2A 2OYQA 1QHTA 3QO9A 3HO1A 4OKEA 1ZBFA 4LH4A 3KLIA 5D3GA 1L3VA 3QEVA 3S3MA 1NK9A 4FJNA 4DTNA 2FBTA 3AO2A 3ZSOA 4DLEA 3WNEA 1SKSA 4LSLA 1IG9A 2G8VA 2FBYA 2VG6A 3P5JA 3O3GA 3RWUA 4M3WA 4FLWA 1LAVA 3LP0A 4CHNA 1S9GA 4FK4A 2FC0A 3EZ5A 1RT1A 4I9QA 4PWDA 1J5OA 4N5SA 2KTQA 2E6LA 3HSTB 1LV5A 4W5RA 3SV3A 4G1QA 1O1WA 5EU7A 4Z4HA 4J2AA 4O5BA 1HQUA 2FBXA 4CJ3A 4CJQA 4KAZA 3OY9A 4KI6A 1VSHA 4FJMA 3A2FA 1HRHA 1VK0A 4CJ4A 4CK1A 4CJFA 3AVHA 3DRSA 4CK3A 4DU1A 1KSPA 4KREA 4KKOA 2YNGA 1NK5A 1EX4A 4OKKA 3P1GA 4CJKA 3HM9A 1XHZA 2BGGA 4IKFA 1BHLA 3AVAA 1Q8IA 4CJEA 5KTQA 2YHBA 3IS9A 4CHOA 3VQEA 3KKRA 4FJ8A 4KV8A 3OS0A 3RR7A 2ZD1A 3U6FA 2Z1IA 4IG0A 4DFPA 4CEDA 2VG7A 4CJLA 1JKHA 3K2PA 2HNYA 4L8RB 3AV9A 3AVBA 1CXUA 1D5AA 3AVJA 1RCHA 2XHBA 1ZBLA 3DLHA 3ITHA 4M3TA 1HNVA 1L3SA 1TVRA 5I42A 4J2EA 3V6DA 1TK8A 1TKXA 1FKPA 4M3ZA 1RBUA 2IGIA 2OPRA 3VN5A 3KLGA 4CIGA 2G8FA 3C94A 4KTZA 4B3OA 3HVTA 4M3RA 4CCHA 2IAJA 3DRRA 1RTIA 5K14A 4ZTFA 4H4OA 4CJSA 4R5PA 1U4BA 1D8YA 4CJRA 1WAJA 4LD0A 4KHNA 4NCGA 3C6TA 2YKMA 1UA0A 3OYNA 3LP2A 3NF8A 2G8KA 4B9LA 3RMDA 4ELTA 4DQQA 4CGFA 3VQ9A 3AVKA 3V1OA 3QNOA 3MXJA 1L5UA 4KHQA 2F8SA 1GOBA 4B8CA 2VWKA 4LH5A 3PX0A 3VQBA 1T05A 4CHYA 1VSLA 4CJWA 3AA4A 4AH9A 4FJKA 1GOAA 2FBVA 3O3HA 4XIUA 4E7HA 2HNDA 4DU3A 4CGDA 3U3GA 1RTHA 4OJRA 3BDPA 1EETA 3ZSXA 3K5OA 1S6PA 4I7FA 3L2VA 2EX3A 1X9SA 1LW0A 4E1NA 1QE1A 2HHXA 3NH1A 2GBZA 3G0ZA 1JLQA 3AA5X 3KK3A 2NUBA 5SWMA 4Q5VA 3ULDA 5SZTA 1VRTA 4JS5A 3LAMA 3HPHA 4DQPA 1MU2A 2VWJA 1JXBA 2R7YA 3AO4A 3VA3A 4PY5A 1NK6A 2YNHA 1TL1A 1B92A 3VQ5A 2B6AA 1CZBA 3OYIA 3KK2A 3KD5E 1SL0A 5DK5A 3HYFA 3OYFA 3VA0A 4J2BA 2W42A 3AVCA 3V4IA 1QSSA 4DSIA 4OLAA 4BDYA 3TAFA 3IAYA 4Z4FA 4OPJA 2ZE2A 3V9WA 4EZ9A 3P83D 4Z4IA 2A1RA 1JXEA 3S3OA 4KB1A 4B9SA 3VQ7A 5KGWA 4O0JA 2G8IA 1RT3A 4DF8A 3NF6A 2Z1HA 4I9LA 2RF2A 4AHVA 1YTAA 3CYMA 4FCYA 3V9SA 4E0DA 4F2RA 3SI6A 4F3OA 3PO4A 1LWFA 4Y1DA 4CF2A 1NOYA 3ASMA 3ZT2A 4W5QA 3SUNA 4CEEA 3EY1A 3NE6A 4DSFA 4DMNA 3DLKA 3OYGA 4ID5A 3CFRA 2O4GA 3L8BA 3OYKA 2OA8A 3U3YA 1BQMA 1NOZA 1NJWA 1VSDA 1C0MA 1CLQA 4CEAA 4FJLA 3VQDA 2IDOA 1R0AA 4KB0A 1EXQA 4CIFA 2XY7A 1J54A 4FZYA 1XI1A 4ELVA 4B9VA 1K6YA 3I0RA 3AVIA 1UAXA 2ATQA 2PZSA 3K58A 2E4LA 3RRHA 1B9DA 3AO5A 3K5MA 3SCXA 3OJUA 4JS4A 3HPGA 3KK1A 1QSLA 4QOZB 1WSHA 3B6PA 3B6OA 3AO1A 3NBPA 3LPTA 3EYZA 5CYMA 4E7LA 3TAGA 3PO5A 1BI4B 4N41A 1X9MA 4CFCA 4FK0A 1S5JA 3FFIA 3WNGA 5FRNA 1JLEA 1CZ9A 2ZQBA 3WNHA 3F9KA 4FJHA 4FJ9A 1IKVA 4E89A 3QEXA 2ITGA 3C6UA 4WE1A 1N6QA 1RBVA 1RT7A 1HYVA 1S1XA 2F96A 2KQ2A 1VRUA 1ZBUA 1UA1A 4M45A 3DLBA 1XHXA 4MQ3A 5T7BA 1HYSA 5HRRA 4HTUA 3OJSA 2O4IA 1S1VA 1C1AA 3QETA 4DTXA 1W0HA 2E6MA 3SUQA 3OYDA 4FJ5A 2DFFA 4KHUA 2JLEA 3VQCA 1RBSA 1CXQA 1RDDA 4LY7A 5J2MA 4DU4A 3OVNA 3PX4A 1G15A 4LSNA 1FK9A 1C6VA 4C8OA 2DFEA 5HROA 4H8KA 4N56A 4FLZA 3OYMA 3ZSZA 1HNIA 1RNHA 2D0CA 1WSEA 2OPPA 2RKIA 1S6QA 4KTWA 4DQIA 3SQ1A 4ZHRA 4B9NA 4F8RA 4B9TA 4KHYA 2P51A 3CFPA 3V9UA 2LSNA 3NF7A 4AHTA 3D0PA 4EP5A 3JSMA 1SUQA 3O3FA 3L2RA 1EP4A 3CQ8A 4BE1A 4KTQA 1TAUA 3SNNA 4BDPA 4FVMA 4CFAA 3CG7A 4JRPA 1ZBHA 2KFZA 4CEBA 5HRPA 3RTVA 5HP1A 1IKYA 4CEOA 2G8WA 3K57A 5C24A 4F2SA 4O0IA 1NK0A 1SKRA 2XY6A 4B9MA 4IDKA 1FKOA 1TKZA 3CM6A 1A5WA 1L3UA 4CGJA 3WNFA 3NH2A 1TKTA 2DY4A 1JLBA 5HRSA 1KCFA 4FJJA 3QIOA 4CK2A 5FRMA 4CF0A 4DTUA 2BDPA 1Y97A 2YNIA 3IRXA 1TKDA 4E7IA 3V1RA 3MAQA 4DG1A 2PYJA 4HUFA 1WNSA 1C0TA 4YFUA 3SJJA 3KTQA 4DFJA 1SL2A 3NF9A 3M8RA 3CM5A 3LWMA 1NKCA 1D9FA 3SQ0A 4O4GA 3V9XA 2PY5A 3DMJA 3ISNC 1RDCA 2IS3A 3QINA 2A1SA 2X6SA 1L3TA 3ZT0A 3K5LA 3SPYA 4KI4A 4Z4EA 2HMIA 1S1WA 1KTQA 4BE0A 3L3VA 4IFYA 4FXDA 3KIOA 3VQ8A 5KGXA 5HLFA 3CFOA 1S9EA 1TAQA 1T03A 4N76A 4FLXA 1KFSA 1BQNA 1ASVA 3L3UA 4IG3A 4OPKA 3VQQA 3F73A 2X6NA 3I0SA 1HJRA 4I2PA 1RBTA 4FLTA 3RR8A 2QKBA 2ETJA 3QEPA 3DI6A 3DYAA 1KLMA 2B5JA 3E01A 4FW1A 3NDKA 4DLGA 3KD1E 4KPYA 4NCAA 4RW8A 4PUOA 4PA1A 4Z0UA 3OYCA 3LDSA 3NGYA 4K8XA 1WSGA 3MECA 1QS4A 4CEZA 4NYFA 2OPSA 4C8MA 3HT3A 3LZIA 1JL2A 4CJTA 4C8KA 3OYBA 4C8NA 1JLFA 4KRFA 1SL1A 1BGXT 3KKSA 4M41A 2X78A 1EKEA 3KLFA 2OZMA 2OZSA 3M8QA 3UIQA 3VQAA 3HVRA 1I3AA 1XC9A 4MFBA 4DFMA 4DSKA 3AA2A 3SPZA 1NKEA 3QLHA 4TSXA 3RRGA 1BIZA 2QXFA 1RTDA 4B9UA 1U45A 1TK0A 4C8LA 1JLCA 4AHUA 2G8HA 3PY8A 4DTMA 4CGHA 3MEDA 3HK2A 1BCMA 4ICLA 4HUGA 4RG8A 3SZ2A 1DTQA 3BGRA 1GOCA 2OPQA 3C95A 5E41A 1VSKA 3TAQA 2P5OA 3TAMA 4ID1A 4CFDA 3D45A 1QSYA 3HXMA 4RW4A 4HCBA 5DMRA 4Q0BA 3KLEA 4FM2A 1NJXA 3NAEA 1TGOA 4I2QA 3PX6A 2HVHA 1BCOA 4CF1A 3S9HA 1YTUA
chains in the Genus database with same CATH superfamily
4H5RA 4JEPA 2HHTA 5AQNA 3T3FA 1NJYA 1CZAN 4BRPA 3VF2A 1REVA 2F9TA 1VQ7N 2UU9K 1S1UA 4A2BA 2D1KA 2ITMA 1KLNA 3RMCA 4DV7K 3FZHA 3HJFA 2V7YA 4JI8K 4MO5A 4BE2A 3SUPA 3C7NA 2EHGA 3DXMB 4J2DA 3AO3A 1EWQA 1WSFA 1RT6A 4E7JA 1LAWA 4BRCA 1EO1A 4DV1K 4IOAL 3ENBA 4CGIA 1VQLN 1B9FA 3S3NA 2CGKA 1BG3A 1NGCA 3F2KA 4FSVA 1LW2A 4O44A 2W41A 2GUIA 3DM2A 4KH6A 4AQYK 1U6ZA 2DTUA 3GE1A 2HBLA 3JYTA 4NB4A 2Z1JA 1TUYA 3TSQA 3J81O 4OKJA 4NYNA 4DHYA 1YHQN 4BR9A 3LDQA 4AHCA 3D2FA 4KO0A 3NGZA 3O4WA 4FLUA 2E1ZA 5J1EA 1GLBG 2HNZA 5KRTA 1HX1A 4DS4A 3DRPA 3SJHA 3DOKA 3C65A 4E7KA 3AVMA 4H4MA 1DKGD 3O4QA 1N5YA 4QCLA 1K8AO 4KFBA 3TR8A 4GMJB 4K8ZA 4IZ9A 3ZT1A 3CCLN 5BRHA 4CHPA 3SAFA 2AP1A 2QWPA 2VG5A 4B08A 1ATRA 4B1XB 5AQQA 4DSJA 4H5WA 5KI6A 3EEQA 5C2FA 4W5TA 1VHXA 1RFQA 1RT5A 4YNQA 3LDPA 4CJ5A 5JS2A 4E19A 1BI4A 2BANA 1HKGA 2D0AA 1RTJA 2NRVA 1YITN 4ELUA 4HHTA 3TSUA 3AAQA 3L0QA 3CETA 2P9NA 5CZ2A 4O55A 3RMAA 5JS1A 5E26A 3ZT4A 3MXMA 4M42A 3CCJN 3ZT3A 1IH7A 3ENHA 3M1FA 3R6MA 4CESA 3BY5A 4WFBL 2GUPA 5GINA 1VSEA 2QEXN 5C42A 4W5OA 3U9DA 1QTMA 1FJGK 3AARA 2HHSA 1MDUB 4N47A 4JRQA 3FFKB 3OS2A 4A61A 1T7PA 3LPUA 4CJVA 4CI6A 1J53A 1N8RO 4LFCK 1VQ4N 4JHDA 2IIRA 4BC3A 4RW6A 3O6WA 1X1PA 3PV8A 4A59A 3HP6A 3IMXA 4NLCA 3DXKB 4FO0A 2E20A 4BC5A 4MLEA 3AY9A 4JN4A 5GAHP 1SKSA 4LSLA 2FBYA 5AQFA 2RE2A 5C15A 3O3GA 4FK4A 1S9GA 1OH5A 2I7PA 5TKYA 4N5SA 5FLXO 4W5RA 2KHOA 1O1WA 5BR8K 5KQDA 4O5BA 1LCUA 1T44A 4KAZA 3D2EA 3TPQA 1HRHA 3AVHA 3DRSA 5A2QO 4KKOA 2A42A 4A5AA 4GV6A 1EX4A 4CJKA 2AA4A 3AVAA 3PSIA 5KTQA 1N34K 3IS9A 3UE5A 3P31A 4FWQA 4IJNA 4JI0K 3VF6A 3WXMB 3SAGA 3U6FA 4IG0A 4DFPA 4CJLA 1NNEA 2NRZA 1MWKA 3KHYA 3AV9A 3AVBA 2FSJA 5JVGL 1TVRA 5I42A 5LL6Z 3V6DA 1TKXA 2IVPA 2P9IA 3VN5A 2HF3A 4KTZA 4CCHA 3HSCA 1U4BA 4CJSA 1WAJA 3BEXA 2G8KA 3OYNA 3P4IA 4FXDA 1HNZK 2E2PA 2Q31A 3V1OA 4PL7A 3VQBA 3DWLA 4CJWA 3AA4A 4AH9A 4FJKA 4E7HA 2HNDA 3E9LA 3R8EA 4CGDA 4OJRA 5E84A 5LY3A 4DR7K 4I7FA 3CJBA 3L2VA 3OHRA 1X9SA 3CPWM 2HHXA 4HWIA 4B1WB 3ID6A 1KC8O 3AA5X 2QWNA 1OH8A 2I7NA 4H0PA 1VRTA 3CCSN 2VWJA 2ASPA 2YNHA 1B92A 4CZHA 1P8ZA 3VA0A 3V4IA 3TAFA 2ZJRL 4JI1K 4BRIA 4IOXA 5BREA 4DUYK 4I9LA 2CH5A 3V9SA 4F2RA 4Y1DA 3SUNA 4CEEA 3NE6A 2QWOA 4DSFA 3DLKA 4ID5A 3U3YA 2FSKA 1VSDA 5AQTA 4FJLA 3LDNA 5JMVA 3K0SA 4CIFA 5ADXA 3QICA 1XI1A 3I0RA 3ZEUA 1B9DA 2QWMA 4FOIA 4JS4A 4QOZB 5GADP 3B6PA 4PUOA 1NM1A 2NRRA 4HTLA 1Y64A 4NXNK 4N41A 3FZFA 5FRNA 2ZQBA 5BPLA 3WNHA 4H0TB 1S1XA 2F96A 2KQ2A 3W0LA 1UA1A 3BP8A 1HYSA 5AZIA 3OJSA 2O4IA 2YI1A 1C1AA 2E6MA 4KHUA 1DT9A 3VQCA 1YI2N 2Q0RA 5J2MA 2P9KA 5AQRA 3T7ZA 2E2QA 3CF5L 4H8KA 2E2NA 1RNHA 4O5FA 1S6QA 4F8RA 3SQ1A 4ZHRA 3VOVA 5FPDA 2O8DB 1QVFM 2BH1A 3NF7A 4AHTA 1XUPO 4CZKA 3JSMA 3O3FA 4BE1A 4JRPA 2KFZA 4CEBA 1IKYA 3VEXA 2G8WA 2XY6A 4PKHA 4FVUA 2O8BA 2HF4A 1L3UA 3NH2A 5HRSA 3HZ6A 4H03B 4CK2A 3THWB 1BA0A 2BDPA 3V1RA 4J8FA 4A2AA 4YFUA 3SJJA 2V7ZA 4BR4A 1SL2A 1YJ9N 3NMUA 3CERA 3SQ0A 3CIPA 2Q97A 3ISNC 1RDCA 1L3TA 2X6SA 4O8UA 3VTIA 3K5LA 4Z4EA 3ULEA 4DV3K 1KTQA 3UKRA 4BE0A 5HLFA 2O8FA 1S9EA 4N76A 2HBJA 4FLXA 3I0SA 2QKBA 1RBTA 2BUPA 2ETJA 2B5JA 3ID8A 4IXCA 3KD1E 4RW8A 4PA1A 3LDSA 1IG8A 4CVNE 3RSEA 1I94K 1QS4A 4CEZA 4LF8K 1RDUA 3VGLA 1JL2A 1OKJA 2P9LA 1JLFA 1SL1A 1BGXT 4M41A 3R9PA 2OZSA 3M8QA 1Q86O 4JD2B 3KZBA 4DSKA 3WXKA 4LF4K 2FLOA 1V4TA 3CJ9A 3WXLA 1TK0A 1Q81O 4DTMA 3JAMO 4LF5K 3HK2A 1BCMA 4ICLA 2E2OA 4HUGA 5EVZA 2CH6A 4EHTA 3C95A 2P5OA 4DV4K 3TAQA 4ID1A 1P90A 3PIOL 4HCBA 5GAGP 4FM2A 2QM1A 2HVHA 4LC9B 3J7AP 1DTTA 1JCEA 4NO7A 4M7YA 3RVCA 3KLHA 3ZX3A 3A5OC 2Q3SA 4FM0A 1XQSC 2GX9A 4DTOA 5GIPA 1Z05A 3T1HK 1ZBSA 4BRDA 4M3XA 3SV4A 2HHQA 4JKGB 2O8CA 3ZETA 4KHPK 4BR0A 4XH1A 1WSIA 1D9DA 4B8AB 4LF9K 2HMPA 4DQSA 3AVGA 4BWJA 4DTJA 4CERA 1SKWA 1C1CA 2A3ZA 1YJNN 1A5XA 4FM1A 3OYHA 2RHKA 3I8DA 1E4GT 4CF8A 3OS1A 1FXXA 1YF5L 3V9ZA 3DLLL 3CI5A 3AA3A 4OVLA 3CCMN 1NK4A 1QQCA 1BIUA 3DLGA 3S41A 3QEIA 3ALYA 1VSFA 3PUFA 3NCIA 4FZXC 5KRSA 4BRHA 4DUZK 3EKSA 1YT3A 3TANA 4CFBA 1NGIA 1Z26A 2YKNA 2O8EB 4DS5A 1A5VA 3ZSYA 3TI0A 1BO5O 3ZSWA 3SAHA 3H1QA 3I55N 4IDHA 3MEGA 5CYQA 1E3MA 4CGGA 1ZYQA 5LJVA 1ASUA 4OLBA 4E1JA 5I3UA 2XRIA 2JWKA 1RDWX 4FWNA 1QQNA 1HPZA 1IKXA 4OGEA 4JKCA 4X66K 4FJGA 2GV9A 1KQSM 4CECA 4DWIA 3VQPA 3GDQA 2YJEA 1KVBA 4EP4A 1WBDA 5FDLA 3G25A 4FZZA 1NLVA 2BTFA 3G4SN 4JNEA 1RDAA 3VQ4A 2WONA 1WLJA 4JYAK 3KJVA 1Z25A 3TU5A 5CE3A 4YOUA 1TV6A 2D0PA 2HHVA 4E3SA 3A8YA 1GLDG 1BUPA 3TAEA 1VQ8N 2RPIA 2P9PA 4GVMA 1NK7A 3G71N 4AHRA 1NJIO 3WEEB 3AVNA 5CZ1A 1KRPA 4HVJA 2I5JA 1VQPN 3EKUA 3LALA 1T6CA 3V1QA 4DR5K 4ZTJA 5BN8A 4UQGA 4DB3A 3DLRA 1K9MO 1BCOA 3VGMA 1U04A 2KZMA 1IO2A 2OYQA 1Q82O 3QO9A 4V19S 1HNXK 5D3GA 4BRLA 5AQLA 3QEVA 1L3VA 2WTUA 4DTNA 4DLEA 1IG9A 2G8VA 3J8AA 3SMSA 3RWUA 4JI5K 1LAVA 3EZ5A 4PWDA 3NVKA 2E6LA 2QI2A 1LV5A 2OTLN 4G1QA 1R59O 3DAWA 1NGFA 2NRXA 4H5VA 3CJCA 2QWQA 2WBNA 5TKWA 4FJMA 1VK0A 4CJ4A 4CJFA 3VGKA 1KSPA 4CK3A 3HM9A 1XMOK 3L4QA 1BHLA 1DGKN 2YHBA 3VQEA 3KKRA 4JKHA 4OO1J 4DV5K 4FPBA 2UUCK 5JLHA 2Z1IA 4BREA 1IJJA 1OH6A 1JKHA 4H5NA 3K2PA 4L8RB 3EE8A 1ZBLA 3ITHA 3R3LA 3SMPA 1E4FT 4X65K 1U2VA 2OPRA 3KLGA 4CIGA 2G8FA 4WQ4C 5EY4A 4NLBA 4M3RA 4EFHA 3C7NB 3DRRA 3WXIA 1D8YA 3CQXA 4KHNA 1WOQA 3C6TA 4YHHK 2YKMA 3LP2A 4ELTA 4DQQA 3VQ9A 3MXJA 4A62A 1L5UA 3PX0A 1VSLA 3O3HA 4JKDA 3MDQA 1RTHA 3BDPA 1EETA 1S6PA 1LW0A 3NH1A 1WBBA 5LJWA 2GBZA 4MDAA 4CJ7A 4IWVA 5SWMA 4Q5VA 3ULDA 2VGNA 4DQPA 3VETA 4DV2K 1JXBA 3VA3A 5AFUA 1NK6A 4PY5A 1TL1A 1OH7A 3D2FB 2P9UA 3KK2A 3KD5E 3O1BA 3CHWA 1SL0A 4XH5A 4J2BA 3AVCA 1QVGM 4BDYA 4Z4FA 2ZE2A 3V9WA 4EZ9A 3P83D 2JWLA 4Z4IA 2A1RA 2G8IA 1YTAA 4FCYA 4L3QA 5DM7L 3PO4A 5B8HA 2E5LK 3EY1A 4DMNA 4GKJK 3CFRA 3I8BA 3OYKA 3I56N 1BQMA 4CEAA 4XH4A 4KB0A 1EXQA 2WUSA 2XY7A 1GLEG 4B9VA 2V51B 3E1YA 2ATQA 5C10A 4WQ4A 2E4LA 5C2DA 3O9QA 3HPGA 3KK1A 4PKIA 3HTVA 3MK6A 3LPTA 5CYMA 4E7LA 1BI4B 1X9MA 1S5JA 3M6GA 3FFIA 4LFAK 3F9KA 4FJHA 3P38A 4FJ9A 4E89A 3EZWA 3C6UA 3SLCA 2P9NB 1HYVA 3OBWA 3MCPA 3G6EN 1VRUA 1ZBUA 4M45A 4MQ3A 5T7BA 1X3MA 5HRRA 2NZTA 3OYDA 2PBDA 3GOIA 1ZC6A 1QHAA 1FK9A 1C6VA 4LSNA 4GNIA 4C8OA 4N56A 1VAZA 2RKIA 1WSEA 2FF3B 4B9NA 3FZMA 2Q36A 2P51A 5AQJA 1IBMK 1SUQA 4KTQA 4BRGA 5EXWA 4C1NI 1ZBHA 4CZLA 3RTVA 3C6HA 3K57A 4JHDB 1NK0A 1FKOA 4GV3A 3WNFA 2GELA 4K42A 4CF0A 4DTUA 2YNIA 3IRXA 1TKDA 3MAQA 3BZCA 2YHXA 3W3DA 4DG1A 4HUFA 3NF9A 3LWMA 4YDUC 1NKCA 3L4IA 2PY5A 4XEIA 1NGAA 3ZT0A 4KI4A 1WUAA 4DQ8A 3L3VA 3D2EB 4DR6K 3CFOA 1KFSA 3E9PA 1W7AA 1ASVA 3L3UA 4IG3A 3EN9A 3QDKA 1YXQA 2X6NA 4I2PA 3H3OB 4FLTA 3RR8A 4CD1A 3QEPA 3Q7BA 4DLGA 5GIOA 4KPYA 4Z0UA 4OPAA 4YORA 3MN9A 3IFRA 3LZIA 4B1YB 4CJTA 3KKSA 2X78A 3KLFA 4DKWA 1IBLK 3UIQA 4WFNL 3VQAA 3HVRA 3AA2A 2CGJA 1NKEA 1G99A 2P9IB 1M90O 4C8LA 3PY8A 4CGHA 4H5TA 5HOOA 1DTQA 3A5MC 3BGRA 3EE9A 5E41A 3TAMA 1QSYA 1H1VA 4Q0BA 3CJ1A 2UXCK 3NAEA 1HKBA 3FZLA 3LWLA 4DSEA 1BL3A 3QIPA 4Y1CA 4YDUA 1S1TA 3FGUA 1YVUA 2ZWHA 4MDBA 1KAXA 3LAKA 5F1XA 4HCCA 2UYTA 3THXA 2YV0X 2HHUA 3LM9A 4FJIA 3MXIA 3THVA 3A5LC 3C6AA 1WSJA 1VQKN 4B3MK 3LL3A 4EZ6A 1KVAA 1YUWA 2XO7A 3QNNA 4JV5K 2P9SA 1IKWA 4DTRA 3QESA 4FJ7A 2ASMA 4H0OA 5AZJA 3DLEA 4FWMA 1IV0A 1EWRA 4CZEA 4Z4CA 4FWLA 3K5NA 4JI3K 3ZCMA 3QEWA 2Q0UA 2P1JA 2GEMA 3IG1A 2B4JA 4FYDA 1ZBIA 4YOVA 3AVLA 2ZGZA 4IBNA 1HPMA 1U47A 3SYZA 4FLYA 3ZEUB 4ILJA 3OYLA 5J2QA 4BQZA 3NH0A 4OGCA 3VMFB 3TWHA 1Q9YA 4BROA 3G10A 4LFBK 1XWLA 4O8KA 1WN7A 4AF1A 4NCBA 1O13A 1TL3A 2RN2A 2PYLA 5J2NA 2V52B 5AZIB 2XY5A 4BVOA 3NFAA 3N4PA 3VENA 3HPOA 4CF9A 3ATVA 1OVQA 2KFNA 2VGMA 3CCRN 4CJUA 3CC2N 1ASWA 3LZJA 5GAEP 3TAPA 1TK5A 3ZSRA 2KW4A 5KPRA 2A40A 3HRGA 3JS6A 2DFHA 3SUOA 4CIEA 2P9KB 1J6ZA 3SK3A 1I39A 4B1VA 1WAFA 1W9HA 1KAYA 1SV5A 4YOTA 4AHSA 4CHZA 4BGBA 4JS5A 1F21A 4K0KK 4CE9A 2D5RA 3SQ4A 2NRHA 2YNFA 1X9WA 1NWKA 3T19A 1VSMA 4F4KA 4B1UB 3M8PA 4ISEA 1NGGA 3FR0A 4DFKA 4BC2A 4BG8A 2O8BB 4ILGB 4Y0WA 1S72N 1RBRA 1JLAA 5ELZA 5EX5A 2ZJQL 4EIAA 4M63C 4CBWA 1VQ6N 4F3TA 3ZSQA 3K9KA 2JGUA 4BACA 4BDZA 1U49A 3UKUA 1NKBA 3OYEA 2NLXA 1BISA 4QAGA 1LOTB 3SBTA 1GLJO 3QFPA 3ULEB 3AVFA 3UKRB 1J9AA 3OYJA 3TABA 2O8FB 3VEOA 2KZZA 2ZM6K 1KVCA 2QKKA 4ISFA 1ATSA 1D4XA 4CEQA 1TYQA 4DV0K 2QK9A 1HLUA 3TARA 3NHGA 3OYAA 3RSEB 3CJAA 3HO1A 4OKEA 3THYA 1ZBFA 4LH4A 3KLIA 4CZMA 2Q1NA 3AO2A 1K8KA 2P9LB 3WNEA 1SAZA 2VG6A 4FWPA 4M3WA 3LP0A 3Q7CA 1GLCG 2HSTA 2FC0A 1RT1A 2VQEK 5AR0A 3K9JA 5AQMA 1HQUA 2FBXA 4H0XB 4CJ3A 4CJQA 3VF4A 2OANA 4U7BA 4CK1A 4KREA 2QTDA 4I6MA 2YNGA 1NK5A 5M1OA 1XHZA 3P1GA 2BGGA 4IKFA 1Q8IA 3OS0A 3HOTA 3IUCA 2ZD1A 2FF6A 4BRKA 5C12A 4CEDA 2OTJN 2HNYA 3CXCM 3DLHA 4IJAA 4K41A 1CXUA 2VWBA 2XHBA 4M3TA 3OTOK 1HNVA 1L3SA 1TK8A 4RWTA 3C0BA 3C94A 3FZKA 3HVTA 2IAJA 4H4OA 4B3RK 4CJRA 3O9TA 4LD0A 2VCPA 2O8CB 2YJFA 1UA0A 4B9LA 3ZETB 3J80O 4CGFA 3QNOA 3AVKA 4KHQA 4B8CA 4FOEA 2VWKA 4LH5A 4GVEA 4CHYA 5JVHL 4BRQA 1VQON 4XIUA 2QWRA 3U3GA 3ZYYX 5AQOA 3ZSXA 5C0YA 4BVPA 4K43A 2EX3A 4E1NA 1QE1A 5LMUK 3WUHA 5AJ3K 5KQ8A 1JLQA 5SZTA 3LAMA 4CBUA 4BRAA 3VQ5A 2KKZA 4DR3K 1CZBA 3MWTA 3HYFA 4OX9K 2W42A 3E66A 4DSIA 4OLAA 3O08A 4JK7A 4LF6K 4FWRA 4OPJA 3DXMA 4QS7A 5AQZA 1BWFO 3S3OA 2A6AA 4JK8A 4DV6K 4B9SA 4WYBA 3VQ7A 4KB1A 3EO3A 5M1PA 5DM6L 1RT3A 4DF8A 3NF6A 2RF2A 1LWFA 4CF2A 1NOYA 3ASMA 2Q2RA 3O80A 2O4GA 1VQ5N 1VQMN 5JLFA 1NJWA 5M1FA 1C0MA 3U4LA 1CLQA 4BR2A 5F0XA 3M5RA 3OW2M 3LDLA 4C23A 1J54A 4FZYA 4DR4K 1UAXA 3PSFA 3K58A 1KXPA 4QS9A 3K5MA 3SCXA 3OJUA 4PHTX 2WFBA 3AO1A 3B6OA 3TAGA 3VERA 4CFCA 1VQNN 5EOYA 3ZX2A 3WNGA 1JLEA 1CZ9A 2HHHK 1IKVA 4G9ZA 2A41A 2ITGA 4K25A 1N6QA 4A5BA 3DLBA 1XHXA 3MN5A 3CCUN 3H46O 4HTUA 5BPNA 1YVNA 2QA4N 4DR2K 4H0VB 3SUQA 4IOCL 1NMNA 3WT0A 2JLEA 1HR0K 1BA1A 1RBSA 1CXQA 4LY7A 4GKKK 3CQYA 4DU4A 1G15A 4CZFA 5AQIA 1GLFO 2W6KA 3VESA 3ZSZA 1HNIA 2P9PB 3F5TA 2VYPA 4KTWA 4KHYA 1WB9A 2EWSA 4BRMA 4B9TA 3CFPA 3V9UA 2LSNA 4EP5A 1EP4A 4IEIA 1TAUA 3SNNA 3QFUA 4CFAA 3CG7A 5HRPA 5HP1A 4FWOA 5C24A 4F2SA 4O0IA 2W6LA 1SKRA 4B3SK 4JKBA 4CGJA 2DY4A 3GL1A 1JLBA 1KCFA 3QIOA 3ATUA 1W2BM 1S3XA 1T6DA 3O1WA 1WNSA 3KTQA 1TUUA 3BF1A 3QB0A 3UB5A 3M8RA 5JICA 1D9FA 3F9MA 4O4GA 3V9XA 2QW9A 1V4SA 2IS3A 3QINA 2A1SA 3HBTA 1BU6O 3SPYA 4B3TK 4JI7K 1ESVA 3VEZA 2VQFK 5AQGA 3KIOA 4GY2B 3VQ8A 1TAQA 1XMQK 4YY3K 3WQUA 1BQNA 3O9UA 4OPKA 5AQHA 5IT9O 3F73A 1HJRA 4JK9A 3DI6A 1ILYA 3DYAA 4FW1A 3NDKA 4MLHA 3LDOA 2F7TA 2CGLA 3H3NO 3NGYA 4JI4K 1WSGA 3DXKA 4NYFA 3VEYA 3O5BA 1BOTO 3HT3A 4WCEL 2H3GX 4KRFA 2HBKA 3J7YP 2OZMA 4FPAA 4CBXA 4MFBA 4DFMA 3SPZA 1U2VB 1NU0A 5AQUA 3RRGA 2QXFA 1RTDA 1U45A 1JLCA 3ENOA 4BG9A 1HJOA 3MEDA 3U9ZA 3WQTA 4RG8A 3SZ2A 4X64K 2OPQA 2E88A 3D45A 5LMNK 3FE1A 3QMLA 3HXMA 4RW4A 3NVMA 5DMRA 4H0YB 3KLEA 4AM7A 1JCFA 4I2QA 3PX6A 3S9HA 3M8SA 1IBKK 3KK7A 4BY9C 5KPTA 3HL8A 4BR5A 2ZF5O 3H08A 1YIJN 1NJZA 2WC9A 1VSIA 5HBMA 2F8TA 4Z4GA 2IVOA 1GLAG 1NK8A 1HQEA 5FROA 1JCGA 2P9UB 1HYZA 3NGIA 5AQXA 3O4NA 4CZIA 1RILA 4HUEA 4M3UA 2HVIA 2OCEA 5J2PA 2XY8A 1NGEA 2X74A 1VSJA 1Q9XA 2UUBK 3N4QA 1KFDA 4BR7A 3CMAN 5AQSA 4KHSA 3B8AX 2G8UA 3T69A 2J4RA 1LWCA 1C0FA 3L2WA 4AM6A 4FK2A 1NGDA 2HOEA 3MCAB 3BUZB 2HHWA 2HW3A 4R79A 3QERA 5AQPA 5HRNA 1GLLO 3DOLA 3ZSVA 1RT4A 4KBOA 4B9QA 2E8AA 1BDGA 2NRWA 5BRDA 3LM2A 4IEEA 4A57A 4IFEA 4DF4A 2Y1IA 4IO8A 4W5NA 1SS6A 2GWJA 1C0GA 4YOXA 1RT2A 1MA9B 2IC3A 4JKEA 2AJQA 4E1MA 1UOCA 3KVGA 4KH4A 3T1YK 1W97L 2YHAA 4CHQA 1KAZA 1UWBA 3PLAA 1T8EA 4FLVA 5AQVA 4FW2A 3L2UA 4DQRA 2F9WA 5KPZA 5HL7L 4PQUA 1JLGA 3CPEA 1VQ9N 2P5GA 1S22A 4RW9A 3V81A 4JLHA 4DTPA 4RW7A 3VQ6A 1C1BA 1DLOA 3HI0A 2FXUA 1RGIA 3ZX0A 5C25A 3HP9A 2Z1GA 3LP3A 4IFVA 2IOCA 3JXUA 4BWMA 2Y1JA 2YHYA 4CEFA 1JL1A 2WOMA 4WF9L 3RMBA 3SBGA 3I33A 2BE2A 4GW6A 3E9OA 4DTSA 2DPNA 4GV9A 5CY4A 1HMVA 4RCHA 3DJCA 1T3VA 4CJPA 1SQKA 4WQ5C 3T1AA 3K59A 4ILHA 4FJXA 4M3YA 2UXBK 1XNRK 4DSLA 4AILC 3LP1A 1U48A 5AFUH 2O8DA 3L2QA 1LWEA 2D0BA 1HNWK 4KHWA 1Q7YO 1RDBA 3MN6A 2D0OA 3LANA 3O9RA 4ISGA 3MEEA 1C0UA 5AQYA 1JJ2M 3SQ2A 4BQLA 2HB5A 1X9JA 4KH5A 3O9SA 4JAXA 1QHTA 5BN9A 3THWA 5FPNA 2E1YA 3S3MA 1NK9A 4FJNA 1NGJA 2FBTA 3ZSOA 4YOWA 2QXLA 2YX6A 3VTHA 3TTDA 3P5JA 3CJ7A 4FLWA 4FL9A 4CHNA 4I9QA 4PL8A 1J5OA 3ZLJA 2KTQA 2W40A 3HSTB 3SV3A 2QWLA 4Z94A 5EU7A 5I9EB 4Z4HA 4J2AA 3TSPA 5M1NA 2YCHA 3OY9A 3TTCA 4KI6A 1VSHA 3A2FA 1NG9A 4M7XA 4DU1A 2GWKA 3MN7A 3HM8A 3M3ZA 4OKKA 3L6QA 2PAVA 4JKFA 4DR1K 3MX2A 4CJEA 4CHOA 4FJ8A 4KV8A 3RR7A 3D6RA 4WQ5A 3H45C 2VG7A 3KWIA 1FW6A 3AVJA 3D7EO 1D5AA 1RCHA 4WFAL 1N32K 3MX5A 4U67L 4J2EA 3FLCO 4JD2A 2A5XA 1FKPA 3THXB 4CZJA 4M3ZA 1NGHA 1RBUA 2IGIA 2YHWA 4B3OA 1RTIA 4YOYA 3P39A 5K14A 4ZTFA 4R5PA 2PFUA 5F2RA 4NCGA 1NMDA 3O8MA 3CC4N 2P9SB 3NF8A 3RMDA 3J7ZO 2F8SA 2NNWA 5AZJB 1GOBA 1T05A 4CW7B 1GOAA 2FBVA 4DU3A 3IDHA 1K73O 1NBWA 4BC4A 3K5OA 3CCQN 3G0ZA 3KK3A 1NGBA 2NUBA 2HBMA 3HPHA 1XC3A 3OA9A 1MU2A 4JI6K 2R7YA 2IVNA 3AO4A 3BZKA 4DCHA 2B6AA 2NRTA 3OYIA 1YAGA 5DK5A 3OYFA 1QSSA 3H1VX 4OPHA 3IAYA 1JXEA 4JKGA 4JKAA 5KGWA 3GG4A 4O0JA 5BRFA 2Z1HA 4E0DA 4AHVA 1KD1O 3CYMA 4F3OA 2ASOA 3SI6A 4PKGA 3ZT2A 5CHIA 4W5QA 3QBXA 3VEVA 4QS8A 3OYGA 3L8BA 2OA8A 1NOZA 5AQWA 3VQDA 2IDOA 4B1ZA 1R0AA 5AQKA 4ELVA 3CD6N 1K6YA 3AVIA 1MWMA 2PZSA 3A0IX 1X3NA 3CMEN 3RRHA 3AO5A 1QSLA 2D4WA 3TTFA 1WSHA 3EYZA 3H6EA 3NBPA 3PO5A 2F4VK 3PIPL 4FK0A 2UXDK 1N36K 2ZJPL 3QEXA 4WE1A 1RBVA 1RT7A 5ADXH 2GTDA 3MMVA 4LF7K 2O8EA 3CCVN 3U8XA 4CZGA 1S1VA 4C1NK 3VPZA 3QETA 4DTXA 1QZ6A 1W0HA 2KLAA 4BRNA 4FJ5A 2DFFA 1RDDA 2FSNA 3VEWA 3OVNA 3PX4A 3R1XA 2DFEA 5HROA 3UKUB 4FLZA 1M1KO 3OYMA 3GBTA 2D0CA 2OPPA 3OBYA 1YJWN 4DQIA 4BRFA 3D0PA 3L2RA 3CQ8A 4BDPA 4FVMA 2UUAK 4JI2K 4CEOA 4BGAA 4B9MA 1TYQB 4IDKA 1TKZA 3CM6A 1A5WA 4MO4A 1TKTA 3THYB 4FJJA 1Q18A 1N33K 4FWSA 1QQMA 3HOSA 5FRMA 1Y97A 4E7IA 2PYJA 1K8KB 3BF3A 4IO9L 1C0TA 3A5NC 1DEJA 1QQOA 1XNQK 5FPMA 1ATNA 4DFJA 3EL2A 3CM5A 1EQYA 3DMJA 1OVYA 3AAPA 4NXMK 2HMIA 1S1WA 4IFYA 5BR9A 1T03A 5KGXA 3WEEA 5FPEA 4CD3A 3WXJA 5IWAK 1J5EK 4I6MB 3VQQA 3AGKA 5BPMA 4FWKA 4EHUA 3E01A 1KLMA 4NCAA 1Z6RA 5MLCQ 3CCEN 3OYCA 1HUXA 4K8XA 1ZXOA 5CR4A 3MECA 1SZ2A 2OPSA 4C8MA 4F9OA 4C8KA 3OYBA 4UY8O 4C8NA 1EKEA 3IKMA 3KWGA 1I3AA 3QBWA 4RTFD 1XC9A 4EAHD 3QLHA 4TSXA 5M1QA 1BIZA 5M1KA 4X62K 4B9UA 4AHUA 2G8HA 3CC7N 3AGRA 1HKCA 1GOCA 1VSKA 4CFDA 3MWPA 1QZ5A 2ZGYA 5H1SQ 1NJXA 1TGOA 1ITGA 4CF1A 1YTUA
chains in the Genus database with same CATH topology
3M8SA 3HL8A 3LWLA 4DSEA 1BL3A 1DTTA 3QIPA 4Y1CA 2HHTA 3H08A 1S1TA 3KLHA 1YVUA 3T3FA 1NJZA 1VSIA 5HBMA 1NJYA 1REVA 4Z4GA 2F8TA 1NK8A 2Q3SA 1S1UA 1HQEA 3LAKA 4FM0A 4HCCA 4DTOA 5FROA 1KLNA 2YV0X 3RMCA 2HHUA 3HJFA 1HYZA 4FJIA 3NGIA 3MXIA 4BE2A 3SUPA 3THVA 2EHGA 3O4NA 4M3XA 4HUEA 1RILA 4M3UA 2HVIA 4J2DA 5J2PA 1WSJA 2XY8A 3SV4A 2HHQA 4EZ6A 1KVAA 2X74A 2XO7A 1VSJA 3QNNA 1Q9XA 3AO3A 1WSFA 1RT6A 4E7JA 1IKWA 4DTRA 3QESA 1LAWA 4FJ7A 4CGIA 1WSIA 1KFDA 1B9FA 3DLEA 1D9DA 4B8AB 4Z4CA 3S3NA 3K5NA 4KHSA 4DQSA 2G8UA 3ZCMA 3QEWA 3AVGA 4BWJA 1LWCA 4DTJA 2P1JA 1LW2A 3IG1A 2B4JA 2GUIA 3DM2A 4O44A 4CERA 3L2WA 1SKWA 4FYDA 1C1CA 4FK2A 1ZBIA 2DTUA 1A5XA 4FM1A 3JYTA 3OYHA 3AVLA 3I8DA 2Z1JA 4IBNA 4CF8A 2HW3A 2HHWA 3OS1A 1U47A 3SYZA 4OKJA 5HRNA 4FLYA 3QERA 3DOLA 1FXXA 4NYNA 3ZSVA 3OYLA 1RT4A 5J2QA 3V9ZA 3NH0A 3AA3A 4OVLA 4OGCA 4AHCA 1NK4A 1QQCA 4KO0A 1BIUA 3DLGA 3NGZA 3TWHA 4DF4A 2Y1IA 1Q9YA 4FLUA 3G10A 3QEIA 3ALYA 1XWLA 1VSFA 1WN7A 4W5NA 3PUFA 5J1EA 2HNZA 4NCBA 3NCIA 5KRTA 4FZXC 5KRSA 4DS4A 1TL3A 3DRPA 2AJQA 1RT2A 2IC3A 3DOKA 4E7KA 2RN2A 1YT3A 3TANA 5J2NA 2PYLA 3AVMA 4CFBA 4E1MA 1UOCA 1Z26A 2YKNA 4H4MA 3O4QA 1N5YA 2YHAA 4DS5A 1A5VA 4QCLA 3ZSYA 2XY5A 4KFBA 3TR8A 3TI0A 4CHQA 3NFAA 1UWBA 3ZSWA 1T8EA 4GMJB 4CF9A 3ZT1A 3HPOA 4FLVA 4K8ZA 2KFNA 4CHPA 4FW2A 3L2UA 4DQRA 4CJUA 1ASWA 3LZJA 4PQUA 1JLGA 2VG5A 4B08A 3TAPA 1TK5A 2P5GA 3ZSRA 2KW4A 3MEGA 5CYQA 4DSJA 4CGGA 4RW9A 3V81A 1ZYQA 2DFHA 4JLHA 3SUOA 4CIEA 4DTPA 1ASUA 5KI6A 1I39A 4RW7A 4OLBA 1WAFA 1W9HA 3VQ6A 4W5TA 1SV5A 5I3UA 1C1BA 1DLOA 2XRIA 1RT5A 4YNQA 4AHSA 4CHZA 1HPZA 1IKXA 4OGEA 3HP9A 5JS2A 4CJ5A 4E19A 5C25A 1F21A 1BI4A 2BANA 2D0AA 2Z1GA 1RTJA 2D5RA 4CE9A 3SQ4A 1ITGA 3LP3A 2YNFA 1X9WA 4FJGA 2GV9A 4IFVA 2IOCA 4BWMA 4ELUA 3T19A 1VSMA 4HHTA 2Y1JA 4F4KA 4CEFA 3M8PA 4CECA 1JL1A 2WOMA 5CZ2A 4DWIA 4O55A 3VQPA 3RMBA 4DFKA 2BE2A 4EP4A 1KVBA 4GW6A 3RMAA 5JS1A 5FDLA 4DTSA 4FZZA 3ZT4A 3MXMA 5CY4A 1HMVA 1RDAA 3VQ4A 1RBRA 2WONA 4M42A 1WLJA 3ZT3A 1JLAA 1IH7A 4CESA 3KJVA 1Z25A 4F3TA 1VSEA 4CJPA 5C42A 4W5OA 3T1AA 3ZSQA 1QTMA 1TV6A 2HHVA 3K59A 2JGUA 4BACA 4BDZA 4E3SA 1U49A 1NKBA 3OYEA 3TAEA 1BISA 4FJXA 4M3YA 2HHSA 2RPIA 4N47A 4QAGA 4JRQA 4DSLA 4GVMA 1NK7A 4AILC 3OS2A 3LP1A 1U48A 4AHRA 3AVFA 1J9AA 3OYJA 3L2QA 1LWEA 2D0BA 3TABA 3AVNA 5CZ1A 1T7PA 4KHWA 1RDBA 1KRPA 3LPUA 4CJVA 2KZZA 4HVJA 3LANA 1J53A 1KVCA 2I5JA 2QKKA 3LALA 3V1QA 3MEEA 4RW6A 1C0UA 1X1PA 4CEQA 4ZTJA 4UQGA 2QK9A 3SQ2A 2HB5A 3PV8A 3DLRA 3HP6A 3NHGA 3TARA 1U04A 2KZMA 3OYAA 1IO2A 2OYQA 1QHTA 3QO9A 3HO1A 4OKEA 1ZBFA 4LH4A 3KLIA 5D3GA 1L3VA 3QEVA 3S3MA 1NK9A 4FJNA 4DTNA 2FBTA 3AO2A 3ZSOA 4DLEA 3WNEA 1SKSA 4LSLA 1IG9A 2G8VA 2FBYA 2VG6A 3P5JA 3O3GA 3RWUA 4M3WA 4FLWA 1LAVA 3LP0A 4CHNA 1S9GA 4FK4A 2FC0A 3EZ5A 1RT1A 4I9QA 4PWDA 1J5OA 4N5SA 2KTQA 2E6LA 3HSTB 1LV5A 4W5RA 3SV3A 4G1QA 1O1WA 5EU7A 4Z4HA 4J2AA 4O5BA 1HQUA 2FBXA 4CJ3A 4CJQA 4KAZA 3OY9A 4KI6A 1VSHA 4FJMA 3A2FA 1HRHA 1VK0A 4CJ4A 4CK1A 4CJFA 3AVHA 3DRSA 4CK3A 4DU1A 1KSPA 4KREA 4KKOA 2YNGA 1NK5A 1EX4A 4OKKA 3P1GA 4CJKA 3HM9A 1XHZA 2BGGA 4IKFA 1BHLA 3AVAA 1Q8IA 4CJEA 5KTQA 2YHBA 3IS9A 4CHOA 3VQEA 3KKRA 4FJ8A 4KV8A 3OS0A 3RR7A 2ZD1A 3U6FA 2Z1IA 4IG0A 4DFPA 4CEDA 2VG7A 4CJLA 1JKHA 3K2PA 2HNYA 4L8RB 3AV9A 3AVBA 1CXUA 1D5AA 3AVJA 1RCHA 2XHBA 1ZBLA 3DLHA 3ITHA 4M3TA 1HNVA 1L3SA 1TVRA 5I42A 4J2EA 3V6DA 1TK8A 1TKXA 1FKPA 4M3ZA 1RBUA 2IGIA 2OPRA 3VN5A 3KLGA 4CIGA 2G8FA 3C94A 4KTZA 4B3OA 3HVTA 4M3RA 4CCHA 2IAJA 3DRRA 1RTIA 5K14A 4ZTFA 4H4OA 4CJSA 4R5PA 1U4BA 1D8YA 4CJRA 1WAJA 4LD0A 4KHNA 4NCGA 3C6TA 2YKMA 1UA0A 3OYNA 3LP2A 3NF8A 2G8KA 4B9LA 3RMDA 4ELTA 4DQQA 4CGFA 3VQ9A 3AVKA 3V1OA 3QNOA 3MXJA 1L5UA 4KHQA 2F8SA 1GOBA 4B8CA 2VWKA 4LH5A 3PX0A 3VQBA 1T05A 4CHYA 1VSLA 4CJWA 3AA4A 4AH9A 4FJKA 1GOAA 2FBVA 3O3HA 4XIUA 4E7HA 2HNDA 4DU3A 4CGDA 3U3GA 1RTHA 4OJRA 3BDPA 1EETA 3ZSXA 3K5OA 1S6PA 4I7FA 3L2VA 2EX3A 1X9SA 1LW0A 4E1NA 1QE1A 2HHXA 3NH1A 2GBZA 3G0ZA 1JLQA 3AA5X 3KK3A 2NUBA 5SWMA 4Q5VA 3ULDA 5SZTA 1VRTA 4JS5A 3LAMA 3HPHA 4DQPA 1MU2A 2VWJA 1JXBA 2R7YA 3AO4A 3VA3A 4PY5A 1NK6A 2YNHA 1TL1A 1B92A 3VQ5A 2B6AA 1CZBA 3OYIA 3KK2A 3KD5E 1SL0A 5DK5A 3HYFA 3OYFA 3VA0A 4J2BA 2W42A 3AVCA 3V4IA 1QSSA 4DSIA 4OLAA 4BDYA 3TAFA 3IAYA 4Z4FA 4OPJA 2ZE2A 3V9WA 4EZ9A 3P83D 4Z4IA 2A1RA 1JXEA 3S3OA 4KB1A 4B9SA 3VQ7A 5KGWA 4O0JA 2G8IA 1RT3A 4DF8A 3NF6A 2Z1HA 4I9LA 2RF2A 4AHVA 1YTAA 3CYMA 4FCYA 3V9SA 4E0DA 4F2RA 3SI6A 4F3OA 3PO4A 1LWFA 4Y1DA 4CF2A 1NOYA 3ASMA 3ZT2A 4W5QA 3SUNA 4CEEA 3EY1A 3NE6A 4DSFA 4DMNA 3DLKA 3OYGA 4ID5A 3CFRA 2O4GA 3L8BA 3OYKA 2OA8A 3U3YA 1BQMA 1NOZA 1NJWA 1VSDA 1C0MA 1CLQA 4CEAA 4FJLA 3VQDA 2IDOA 1R0AA 4KB0A 1EXQA 4CIFA 2XY7A 1J54A 4FZYA 1XI1A 4ELVA 4B9VA 1K6YA 3I0RA 3AVIA 1UAXA 2ATQA 2PZSA 3K58A 2E4LA 3RRHA 1B9DA 3AO5A 3K5MA 3SCXA 3OJUA 4JS4A 3HPGA 3KK1A 1QSLA 4QOZB 1WSHA 3B6PA 3B6OA 3AO1A 3NBPA 3LPTA 3EYZA 5CYMA 4E7LA 3TAGA 3PO5A 1BI4B 4N41A 1X9MA 4CFCA 4FK0A 1S5JA 3FFIA 3WNGA 5FRNA 1JLEA 1CZ9A 2ZQBA 3WNHA 3F9KA 4FJHA 4FJ9A 1IKVA 4E89A 3QEXA 2ITGA 3C6UA 4WE1A 1N6QA 1RBVA 1RT7A 1HYVA 1S1XA 2F96A 2KQ2A 1VRUA 1ZBUA 1UA1A 4M45A 3DLBA 1XHXA 4MQ3A 5T7BA 1HYSA 5HRRA 4HTUA 3OJSA 2O4IA 1S1VA 1C1AA 3QETA 4DTXA 1W0HA 2E6MA 3SUQA 3OYDA 4FJ5A 2DFFA 4KHUA 2JLEA 3VQCA 1RBSA 1CXQA 1RDDA 4LY7A 5J2MA 4DU4A 3OVNA 3PX4A 1G15A 4LSNA 1FK9A 1C6VA 4C8OA 2DFEA 5HROA 4H8KA 4N56A 4FLZA 3OYMA 3ZSZA 1HNIA 1RNHA 2D0CA 1WSEA 2OPPA 2RKIA 1S6QA 4KTWA 4DQIA 3SQ1A 4ZHRA 4B9NA 4F8RA 4B9TA 4KHYA 2P51A 3CFPA 3V9UA 2LSNA 3NF7A 4AHTA 3D0PA 4EP5A 3JSMA 1SUQA 3O3FA 3L2RA 1EP4A 3CQ8A 4BE1A 4KTQA 1TAUA 3SNNA 4BDPA 4FVMA 4CFAA 3CG7A 4JRPA 1ZBHA 2KFZA 4CEBA 5HRPA 3RTVA 5HP1A 1IKYA 4CEOA 2G8WA 3K57A 5C24A 4F2SA 4O0IA 1NK0A 1SKRA 2XY6A 4B9MA 4IDKA 1FKOA 1TKZA 3CM6A 1A5WA 1L3UA 4CGJA 3WNFA 3NH2A 1TKTA 2DY4A 1JLBA 5HRSA 1KCFA 4FJJA 3QIOA 4CK2A 5FRMA 4CF0A 4DTUA 2BDPA 1Y97A 2YNIA 3IRXA 1TKDA 4E7IA 3V1RA 3MAQA 4DG1A 2PYJA 4HUFA 1WNSA 1C0TA 4YFUA 3SJJA 3KTQA 4DFJA 1SL2A 3NF9A 3M8RA 3CM5A 3LWMA 1NKCA 1D9FA 3SQ0A 4O4GA 3V9XA 2PY5A 3DMJA 3ISNC 1RDCA 2IS3A 3QINA 2A1SA 2X6SA 1L3TA 3ZT0A 3K5LA 3SPYA 4KI4A 4Z4EA 2HMIA 1S1WA 1KTQA 4BE0A 3L3VA 4IFYA 4FXDA 3KIOA 3VQ8A 5KGXA 5HLFA 3CFOA 1S9EA 1TAQA 1T03A 4N76A 4FLXA 1KFSA 1BQNA 1ASVA 3L3UA 4IG3A 4OPKA 3VQQA 3F73A 2X6NA 3I0SA 1HJRA 4I2PA 1RBTA 4FLTA 3RR8A 2QKBA 2ETJA 3QEPA 3DI6A 3DYAA 1KLMA 2B5JA 3E01A 4FW1A 3NDKA 4DLGA 3KD1E 4KPYA 4NCAA 4RW8A 4PUOA 4PA1A 4Z0UA 3OYCA 3LDSA 3NGYA 4K8XA 1WSGA 3MECA 1QS4A 4CEZA 4NYFA 2OPSA 4C8MA 3HT3A 3LZIA 1JL2A 4CJTA 4C8KA 3OYBA 4C8NA 1JLFA 4KRFA 1SL1A 1BGXT 3KKSA 4M41A 2X78A 1EKEA 3KLFA 2OZMA 2OZSA 3M8QA 3UIQA 3VQAA 3HVRA 1I3AA 1XC9A 4MFBA 4DFMA 4DSKA 3AA2A 3SPZA 1NKEA 3QLHA 4TSXA 3RRGA 1BIZA 2QXFA 1RTDA 4B9UA 1U45A 1TK0A 4C8LA 1JLCA 4AHUA 2G8HA 3PY8A 4DTMA 4CGHA 3MEDA 3HK2A 1BCMA 4ICLA 4HUGA 4RG8A 3SZ2A 1DTQA 3BGRA 1GOCA 2OPQA 3C95A 5E41A 1VSKA 3TAQA 2P5OA 3TAMA 4ID1A 4CFDA 3D45A 1QSYA 3HXMA 4RW4A 4HCBA 5DMRA 4Q0BA 3KLEA 4FM2A 1NJXA 3NAEA 1TGOA 4I2QA 3PX6A 2HVHA 1BCOA 4CF1A 3S9HA 1YTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8S A;  3HL8 A;  3LWL A;  4DSE A;  1BL3 A;  1DTT A;  3QIP A;  4Y1C A;  2HHT A;  3H08 A;  1S1T A;  3KLH A;  1YVU A;  3T3F A;  1NJZ A;  1VSI A;  5HBM A;  1NJY A;  1REV A;  4Z4G A;  2F8T A;  1NK8 A;  2Q3S A;  1S1U A;  1HQE A;  3LAK A;  4FM0 A;  4HCC A;  4DTO A;  5FRO A;  1KLN A;  2YV0 X;  3RMC A;  2HHU A;  3HJF A;  1HYZ A;  4FJI A;  3NGI A;  3MXI A;  4BE2 A;  3SUP A;  3THV A;  2EHG A;  3O4N A;  4M3X A;  4HUE A;  1RIL A;  4M3U A;  2HVI A;  4J2D A;  5J2P A;  1WSJ A;  2XY8 A;  3SV4 A;  2HHQ A;  4EZ6 A;  1KVA A;  2X74 A;  2XO7 A;  1VSJ A;  3QNN A;  1Q9X A;  3AO3 A;  1WSF A;  1RT6 A;  4E7J A;  1IKW A;  4DTR A;  3QES A;  1LAW A;  4FJ7 A;  4CGI A;  1WSI A;  1KFD A;  1B9F A;  3DLE A;  1D9D A;  4B8A B;  4Z4C A;  3S3N A;  3K5N A;  4KHS A;  4DQS A;  2G8U A;  3ZCM A;  3QEW A;  3AVG A;  4BWJ A;  1LWC A;  4DTJ A;  2P1J A;  1LW2 A;  3IG1 A;  2B4J A;  2GUI A;  3DM2 A;  4O44 A;  4CER A;  3L2W A;  1SKW A;  4FYD A;  1C1C A;  4FK2 A;  1ZBI A;  2DTU A;  1A5X A;  4FM1 A;  3JYT A;  3OYH A;  3AVL A;  3I8D A;  2Z1J A;  4IBN A;  4CF8 A;  2HW3 A;  2HHW A;  3OS1 A;  1U47 A;  3SYZ A;  4OKJ A;  5HRN A;  4FLY A;  3QER A;  3DOL A;  1FXX A;  4NYN A;  3ZSV A;  3OYL A;  1RT4 A;  5J2Q A;  3V9Z A;  3NH0 A;  3AA3 A;  4OVL A;  4OGC A;  4AHC A;  1NK4 A;  1QQC A;  4KO0 A;  1BIU A;  3DLG A;  3NGZ A;  3TWH A;  4DF4 A;  2Y1I A;  1Q9Y A;  4FLU A;  3G10 A;  3QEI A;  3ALY A;  1XWL A;  1VSF A;  1WN7 A;  4W5N A;  3PUF A;  5J1E A;  2HNZ A;  4NCB A;  3NCI A;  5KRT A;  4FZX C;  5KRS A;  4DS4 A;  1TL3 A;  3DRP A;  2AJQ A;  1RT2 A;  2IC3 A;  3DOK A;  4E7K A;  2RN2 A;  1YT3 A;  3TAN A;  5J2N A;  2PYL A;  3AVM A;  4CFB A;  4E1M A;  1UOC A;  1Z26 A;  2YKN A;  4H4M A;  3O4Q A;  1N5Y A;  2YHA A;  4DS5 A;  1A5V A;  4QCL A;  3ZSY A;  2XY5 A;  4KFB A;  3TR8 A;  3TI0 A;  4CHQ A;  3NFA A;  1UWB A;  3ZSW A;  1T8E A;  4GMJ B;  4CF9 A;  3ZT1 A;  3HPO A;  4FLV A;  4K8Z A;  2KFN A;  4CHP A;  4FW2 A;  3L2U A;  4DQR A;  4CJU A;  1ASW A;  3LZJ A;  4PQU A;  1JLG A;  2VG5 A;  4B08 A;  3TAP A;  1TK5 A;  2P5G A;  3ZSR A;  2KW4 A;  3MEG A;  5CYQ A;  4DSJ A;  4CGG A;  4RW9 A;  3V81 A;  1ZYQ A;  2DFH A;  4JLH A;  3SUO A;  4CIE A;  4DTP A;  1ASU A;  5KI6 A;  1I39 A;  4RW7 A;  4OLB A;  1WAF A;  1W9H A;  3VQ6 A;  4W5T A;  1SV5 A;  5I3U A;  1C1B A;  1DLO A;  2XRI A;  1RT5 A;  4YNQ A;  4AHS A;  4CHZ A;  1HPZ A;  1IKX A;  4OGE A;  3HP9 A;  5JS2 A;  4CJ5 A;  4E19 A;  5C25 A;  1F21 A;  1BI4 A;  2BAN A;  2D0A A;  2Z1G A;  1RTJ A;  2D5R A;  4CE9 A;  3SQ4 A;  1ITG A;  3LP3 A;  2YNF A;  1X9W A;  4FJG A;  2GV9 A;  4IFV A;  2IOC A;  4BWM A;  4ELU A;  3T19 A;  1VSM A;  4HHT A;  2Y1J A;  4F4K A;  4CEF A;  3M8P A;  4CEC A;  1JL1 A;  2WOM A;  5CZ2 A;  4DWI A;  4O55 A;  3VQP A;  3RMB A;  4DFK A;  2BE2 A;  4EP4 A;  1KVB A;  4GW6 A;  3RMA A;  5JS1 A;  5FDL A;  4DTS A;  4FZZ A;  3ZT4 A;  3MXM A;  5CY4 A;  1HMV A;  1RDA A;  3VQ4 A;  1RBR A;  2WON A;  4M42 A;  1WLJ A;  3ZT3 A;  1JLA A;  1IH7 A;  4CES A;  3KJV A;  1Z25 A;  4F3T A;  1VSE A;  4CJP A;  5C42 A;  4W5O A;  3T1A A;  3ZSQ A;  1QTM A;  1TV6 A;  2HHV A;  3K59 A;  2JGU A;  4BAC A;  4BDZ A;  4E3S A;  1U49 A;  1NKB A;  3OYE A;  3TAE A;  1BIS A;  4FJX A;  4M3Y A;  2HHS A;  2RPI A;  4N47 A;  4QAG A;  4JRQ A;  4DSL A;  4GVM A;  1NK7 A;  4AIL C;  3OS2 A;  3LP1 A;  1U48 A;  4AHR A;  3AVF A;  1J9A A;  3OYJ A;  3L2Q A;  1LWE A;  2D0B A;  3TAB A;  3AVN A;  5CZ1 A;  1T7P A;  4KHW A;  1RDB A;  1KRP A;  3LPU A;  4CJV A;  2KZZ A;  4HVJ A;  3LAN A;  1J53 A;  1KVC A;  2I5J A;  2QKK A;  3LAL A;  3V1Q A;  3MEE A;  4RW6 A;  1C0U A;  1X1P A;  4CEQ A;  4ZTJ A;  4UQG A;  2QK9 A;  3SQ2 A;  2HB5 A;  3PV8 A;  3DLR A;  3HP6 A;  3NHG A;  3TAR A;  1U04 A;  2KZM A;  3OYA A;  1IO2 A;  2OYQ A;  1QHT A;  3QO9 A;  3HO1 A;  4OKE A;  1ZBF A;  4LH4 A;  3KLI A;  5D3G A;  1L3V A;  3QEV A;  3S3M A;  1NK9 A;  4FJN A;  4DTN A;  2FBT A;  3AO2 A;  3ZSO A;  4DLE A;  3WNE A;  1SKS A;  4LSL A;  1IG9 A;  2G8V A;  2FBY A;  2VG6 A;  3P5J A;  3O3G A;  3RWU A;  4M3W A;  4FLW A;  1LAV A;  3LP0 A;  4CHN A;  1S9G A;  4FK4 A;  2FC0 A;  3EZ5 A;  1RT1 A;  4I9Q A;  4PWD A;  1J5O A;  4N5S A;  2KTQ A;  2E6L A;  3HST B;  1LV5 A;  4W5R A;  3SV3 A;  4G1Q A;  1O1W A;  5EU7 A;  4Z4H A;  4J2A A;  4O5B A;  1HQU A;  2FBX A;  4CJ3 A;  4CJQ A;  4KAZ A;  3OY9 A;  4KI6 A;  1VSH A;  4FJM A;  3A2F A;  1HRH A;  1VK0 A;  4CJ4 A;  4CK1 A;  4CJF A;  3AVH A;  3DRS A;  4CK3 A;  4DU1 A;  1KSP A;  4KRE A;  4KKO A;  2YNG A;  1NK5 A;  1EX4 A;  4OKK A;  3P1G A;  4CJK A;  3HM9 A;  1XHZ A;  2BGG A;  4IKF A;  1BHL A;  3AVA A;  1Q8I A;  4CJE A;  5KTQ A;  2YHB A;  3IS9 A;  4CHO A;  3VQE A;  3KKR A;  4FJ8 A;  4KV8 A;  3OS0 A;  3RR7 A;  2ZD1 A;  3U6F A;  2Z1I A;  4IG0 A;  4DFP A;  4CED A;  2VG7 A;  4CJL A;  1JKH A;  3K2P A;  2HNY A;  4L8R B;  3AV9 A;  3AVB A;  1CXU A;  1D5A A;  3AVJ A;  1RCH A;  2XHB A;  1ZBL A;  3DLH A;  3ITH A;  4M3T A;  1HNV A;  1L3S A;  1TVR A;  5I42 A;  4J2E A;  3V6D A;  1TK8 A;  1TKX A;  1FKP A;  4M3Z A;  1RBU A;  2IGI A;  2OPR A;  3VN5 A;  3KLG A;  4CIG A;  2G8F A;  3C94 A;  4KTZ A;  4B3O A;  3HVT A;  4M3R A;  4CCH A;  2IAJ A;  3DRR A;  1RTI A;  5K14 A;  4ZTF A;  4H4O A;  4CJS A;  4R5P A;  1U4B A;  1D8Y A;  4CJR A;  1WAJ A;  4LD0 A;  4KHN A;  4NCG A;  3C6T A;  2YKM A;  1UA0 A;  3OYN A;  3LP2 A;  3NF8 A;  2G8K A;  4B9L A;  3RMD A;  4ELT A;  4DQQ A;  4CGF A;  3VQ9 A;  3AVK A;  3V1O A;  3QNO A;  3MXJ A;  1L5U A;  4KHQ A;  2F8S A;  1GOB A;  4B8C A;  2VWK A;  4LH5 A;  3PX0 A;  3VQB A;  1T05 A;  4CHY A;  1VSL A;  4CJW A;  3AA4 A;  4AH9 A;  4FJK A;  1GOA A;  2FBV A;  3O3H A;  4XIU A;  4E7H A;  2HND A;  4DU3 A;  4CGD A;  3U3G A;  1RTH A;  4OJR A;  3BDP A;  1EET A;  3ZSX A;  3K5O A;  1S6P A;  4I7F A;  3L2V A;  2EX3 A;  1X9S A;  1LW0 A;  4E1N A;  1QE1 A;  2HHX A;  3NH1 A;  2GBZ A;  3G0Z A;  1JLQ A;  3AA5 X;  3KK3 A;  2NUB A;  5SWM A;  4Q5V A;  3ULD A;  5SZT A;  1VRT A;  4JS5 A;  3LAM A;  3HPH A;  4DQP A;  1MU2 A;  2VWJ A;  1JXB A;  2R7Y A;  3AO4 A;  3VA3 A;  4PY5 A;  1NK6 A;  2YNH A;  1TL1 A;  1B92 A;  3VQ5 A;  2B6A A;  1CZB A;  3OYI A;  3KK2 A;  3KD5 E;  1SL0 A;  5DK5 A;  3HYF A;  3OYF A;  3VA0 A;  4J2B A;  2W42 A;  3AVC A;  3V4I A;  1QSS A;  4DSI A;  4OLA A;  4BDY A;  3TAF A;  3IAY A;  4Z4F A;  4OPJ A;  2ZE2 A;  3V9W A;  4EZ9 A;  3P83 D;  4Z4I A;  2A1R A;  1JXE A;  3S3O A;  4KB1 A;  4B9S A;  3VQ7 A;  5KGW A;  4O0J A;  2G8I A;  1RT3 A;  4DF8 A;  3NF6 A;  2Z1H A;  4I9L A;  2RF2 A;  4AHV A;  1YTA A;  3CYM A;  4FCY A;  3V9S A;  4E0D A;  4F2R A;  3SI6 A;  4F3O A;  3PO4 A;  1LWF A;  4Y1D A;  4CF2 A;  1NOY A;  3ASM A;  3ZT2 A;  4W5Q A;  3SUN A;  4CEE A;  3EY1 A;  3NE6 A;  4DSF A;  4DMN A;  3DLK A;  3OYG A;  4ID5 A;  3CFR A;  2O4G A;  3L8B A;  3OYK A;  2OA8 A;  3U3Y A;  1BQM A;  1NOZ A;  1NJW A;  1VSD A;  1C0M A;  1CLQ A;  4CEA A;  4FJL A;  3VQD A;  2IDO A;  1R0A A;  4KB0 A;  1EXQ A;  4CIF A;  2XY7 A;  1J54 A;  4FZY A;  1XI1 A;  4ELV A;  4B9V A;  1K6Y A;  3I0R A;  3AVI A;  1UAX A;  2ATQ A;  2PZS A;  3K58 A;  2E4L A;  3RRH A;  1B9D A;  3AO5 A;  3K5M A;  3SCX A;  3OJU A;  4JS4 A;  3HPG A;  3KK1 A;  1QSL A;  4QOZ B;  1WSH A;  3B6P A;  3B6O A;  3AO1 A;  3NBP A;  3LPT A;  3EYZ A;  5CYM A;  4E7L A;  3TAG A;  3PO5 A;  1BI4 B;  4N41 A;  1X9M A;  4CFC A;  4FK0 A;  1S5J A;  3FFI A;  3WNG A;  5FRN A;  1JLE A;  1CZ9 A;  2ZQB A;  3WNH A;  3F9K A;  4FJH A;  4FJ9 A;  1IKV A;  4E89 A;  3QEX A;  2ITG A;  3C6U A;  4WE1 A;  1N6Q A;  1RBV A;  1RT7 A;  1HYV A;  1S1X A;  2F96 A;  2KQ2 A;  1VRU A;  1ZBU A;  1UA1 A;  4M45 A;  3DLB A;  1XHX A;  4MQ3 A;  5T7B A;  1HYS A;  5HRR A;  4HTU A;  3OJS A;  2O4I A;  1S1V A;  1C1A A;  3QET A;  4DTX A;  1W0H A;  2E6M A;  3SUQ A;  3OYD A;  4FJ5 A;  2DFF A;  4KHU A;  2JLE A;  3VQC A;  1RBS A;  1CXQ A;  1RDD A;  4LY7 A;  5J2M A;  4DU4 A;  3OVN A;  3PX4 A;  1G15 A;  4LSN A;  1FK9 A;  1C6V A;  4C8O A;  2DFE A;  5HRO A;  4H8K A;  4N56 A;  4FLZ A;  3OYM A;  3ZSZ A;  1HNI A;  1RNH A;  2D0C A;  1WSE A;  2OPP A;  2RKI A;  1S6Q A;  4KTW A;  4DQI A;  3SQ1 A;  4ZHR A;  4B9N A;  4F8R A;  4B9T A;  4KHY A;  2P51 A;  3CFP A;  3V9U A;  2LSN A;  3NF7 A;  4AHT A;  3D0P A;  4EP5 A;  3JSM A;  1SUQ A;  3O3F A;  3L2R A;  1EP4 A;  3CQ8 A;  4BE1 A;  4KTQ A;  1TAU A;  3SNN A;  4BDP A;  4FVM A;  4CFA A;  3CG7 A;  4JRP A;  1ZBH A;  2KFZ A;  4CEB A;  5HRP A;  3RTV A;  5HP1 A;  1IKY A;  4CEO A;  2G8W A;  3K57 A;  5C24 A;  4F2S A;  4O0I A;  1NK0 A;  1SKR A;  2XY6 A;  4B9M A;  4IDK A;  1FKO A;  1TKZ A;  3CM6 A;  1A5W A;  1L3U A;  4CGJ A;  3WNF A;  3NH2 A;  1TKT A;  2DY4 A;  1JLB A;  5HRS A;  1KCF A;  4FJJ A;  3QIO A;  4CK2 A;  5FRM A;  4CF0 A;  4DTU A;  2BDP A;  1Y97 A;  2YNI A;  3IRX A;  1TKD A;  4E7I A;  3V1R A;  3MAQ A;  4DG1 A;  2PYJ A;  4HUF A;  1WNS A;  1C0T A;  4YFU A;  3SJJ A;  3KTQ A;  4DFJ A;  1SL2 A;  3NF9 A;  3M8R A;  3CM5 A;  3LWM A;  1NKC A;  1D9F A;  3SQ0 A;  4O4G A;  3V9X A;  2PY5 A;  3DMJ A;  3ISN C;  1RDC A;  2IS3 A;  3QIN A;  2A1S A;  2X6S A;  1L3T A;  3ZT0 A;  3K5L A;  3SPY A;  4KI4 A;  4Z4E A;  2HMI A;  1S1W A;  1KTQ A;  4BE0 A;  3L3V A;  4IFY A;  4FXD A;  3KIO A;  3VQ8 A;  5KGX A;  5HLF A;  3CFO A;  1S9E A;  1TAQ A;  1T03 A;  4N76 A;  4FLX A;  1KFS A;  1BQN A;  1ASV A;  3L3U A;  4IG3 A;  4OPK A;  3VQQ A;  3F73 A;  2X6N A;  3I0S A;  1HJR A;  4I2P A;  1RBT A;  4FLT A;  3RR8 A;  2QKB A;  2ETJ A;  3QEP A;  3DI6 A;  3DYA A;  1KLM A;  2B5J A;  3E01 A;  4FW1 A;  3NDK A;  4DLG A;  3KD1 E;  4KPY A;  4NCA A;  4RW8 A;  4PUO A;  4PA1 A;  4Z0U A;  3OYC A;  3LDS A;  3NGY A;  4K8X A;  1WSG A;  3MEC A;  1QS4 A;  4CEZ A;  4NYF A;  2OPS A;  4C8M A;  3HT3 A;  3LZI A;  1JL2 A;  4CJT A;  4C8K A;  3OYB A;  4C8N A;  1JLF A;  4KRF A;  1SL1 A;  1BGX T;  3KKS A;  4M41 A;  2X78 A;  1EKE A;  3KLF A;  2OZM A;  2OZS A;  3M8Q A;  3UIQ A;  3VQA A;  3HVR A;  1I3A A;  1XC9 A;  4MFB A;  4DFM A;  4DSK A;  3AA2 A;  3SPZ A;  1NKE A;  3QLH A;  4TSX A;  3RRG A;  1BIZ A;  2QXF A;  1RTD A;  4B9U A;  1U45 A;  1TK0 A;  4C8L A;  1JLC A;  4AHU A;  2G8H A;  3PY8 A;  4DTM A;  4CGH A;  3MED A;  3HK2 A;  1BCM A;  4ICL A;  4HUG A;  4RG8 A;  3SZ2 A;  1DTQ A;  3BGR A;  1GOC A;  2OPQ A;  3C95 A;  5E41 A;  1VSK A;  3TAQ A;  2P5O A;  3TAM A;  4ID1 A;  4CFD A;  3D45 A;  1QSY A;  3HXM A;  4RW4 A;  4HCB A;  5DMR A;  4Q0B A;  3KLE A;  4FM2 A;  1NJX A;  3NAE A;  1TGO A;  4I2Q A;  3PX6 A;  2HVH A;  1BCO A;  4CF1 A;  3S9H A;  1YTU A; 
#chains in the Genus database with same CATH topology
 4H5R A;  4JEP A;  2HHT A;  5AQN A;  3T3F A;  1NJY A;  1CZA N;  4BRP A;  3VF2 A;  1REV A;  2F9T A;  1VQ7 N;  2UU9 K;  1S1U A;  4A2B A;  2D1K A;  2ITM A;  1KLN A;  3RMC A;  4DV7 K;  3FZH A;  3HJF A;  2V7Y A;  4JI8 K;  4MO5 A;  4BE2 A;  3SUP A;  3C7N A;  2EHG A;  3DXM B;  4J2D A;  3AO3 A;  1EWQ A;  1WSF A;  1RT6 A;  4E7J A;  1LAW A;  4BRC A;  1EO1 A;  4DV1 K;  4IOA L;  3ENB A;  4CGI A;  1VQL N;  1B9F A;  3S3N A;  2CGK A;  1BG3 A;  1NGC A;  3F2K A;  4FSV A;  1LW2 A;  4O44 A;  2W41 A;  2GUI A;  3DM2 A;  4KH6 A;  4AQY K;  1U6Z A;  2DTU A;  3GE1 A;  2HBL A;  3JYT A;  4NB4 A;  2Z1J A;  1TUY A;  3TSQ A;  3J81 O;  4OKJ A;  4NYN A;  4DHY A;  1YHQ N;  4BR9 A;  3LDQ A;  4AHC A;  3D2F A;  4KO0 A;  3NGZ A;  3O4W A;  4FLU A;  2E1Z A;  5J1E A;  1GLB G;  2HNZ A;  5KRT A;  1HX1 A;  4DS4 A;  3DRP A;  3SJH A;  3DOK A;  3C65 A;  4E7K A;  3AVM A;  4H4M A;  1DKG D;  3O4Q A;  1N5Y A;  4QCL A;  1K8A O;  4KFB A;  3TR8 A;  4GMJ B;  4K8Z A;  4IZ9 A;  3ZT1 A;  3CCL N;  5BRH A;  4CHP A;  3SAF A;  2AP1 A;  2QWP A;  2VG5 A;  4B08 A;  1ATR A;  4B1X B;  5AQQ A;  4DSJ A;  4H5W A;  5KI6 A;  3EEQ A;  5C2F A;  4W5T A;  1VHX A;  1RFQ A;  1RT5 A;  4YNQ A;  3LDP A;  4CJ5 A;  5JS2 A;  4E19 A;  1BI4 A;  2BAN A;  1HKG A;  2D0A A;  1RTJ A;  2NRV A;  1YIT N;  4ELU A;  4HHT A;  3TSU A;  3AAQ A;  3L0Q A;  3CET A;  2P9N A;  5CZ2 A;  4O55 A;  3RMA A;  5JS1 A;  5E26 A;  3ZT4 A;  3MXM A;  4M42 A;  3CCJ N;  3ZT3 A;  1IH7 A;  3ENH A;  3M1F A;  3R6M A;  4CES A;  3BY5 A;  4WFB L;  2GUP A;  5GIN A;  1VSE A;  2QEX N;  5C42 A;  4W5O A;  3U9D A;  1QTM A;  1FJG K;  3AAR A;  2HHS A;  1MDU B;  4N47 A;  4JRQ A;  3FFK B;  3OS2 A;  4A61 A;  1T7P A;  3LPU A;  4CJV A;  4CI6 A;  1J53 A;  1N8R O;  4LFC K;  1VQ4 N;  4JHD A;  2IIR A;  4BC3 A;  4RW6 A;  3O6W A;  1X1P A;  3PV8 A;  4A59 A;  3HP6 A;  3IMX A;  4NLC A;  3DXK B;  4FO0 A;  2E20 A;  4BC5 A;  4MLE A;  3AY9 A;  4JN4 A;  5GAH P;  1SKS A;  4LSL A;  2FBY A;  5AQF A;  2RE2 A;  5C15 A;  3O3G A;  4FK4 A;  1S9G A;  1OH5 A;  2I7P A;  5TKY A;  4N5S A;  5FLX O;  4W5R A;  2KHO A;  1O1W A;  5BR8 K;  5KQD A;  4O5B A;  1LCU A;  1T44 A;  4KAZ A;  3D2E A;  3TPQ A;  1HRH A;  3AVH A;  3DRS A;  5A2Q O;  4KKO A;  2A42 A;  4A5A A;  4GV6 A;  1EX4 A;  4CJK A;  2AA4 A;  3AVA A;  3PSI A;  5KTQ A;  1N34 K;  3IS9 A;  3UE5 A;  3P31 A;  4FWQ A;  4IJN A;  4JI0 K;  3VF6 A;  3WXM B;  3SAG A;  3U6F A;  4IG0 A;  4DFP A;  4CJL A;  1NNE A;  2NRZ A;  1MWK A;  3KHY A;  3AV9 A;  3AVB A;  2FSJ A;  5JVG L;  1TVR A;  5I42 A;  5LL6 Z;  3V6D A;  1TKX A;  2IVP A;  2P9I A;  3VN5 A;  2HF3 A;  4KTZ A;  4CCH A;  3HSC A;  1U4B A;  4CJS A;  1WAJ A;  3BEX A;  2G8K A;  3OYN A;  3P4I A;  4FXD A;  1HNZ K;  2E2P A;  2Q31 A;  3V1O A;  4PL7 A;  3VQB A;  3DWL A;  4CJW A;  3AA4 A;  4AH9 A;  4FJK A;  4E7H A;  2HND A;  3E9L A;  3R8E A;  4CGD A;  4OJR A;  5E84 A;  5LY3 A;  4DR7 K;  4I7F A;  3CJB A;  3L2V A;  3OHR A;  1X9S A;  3CPW M;  2HHX A;  4HWI A;  4B1W B;  3ID6 A;  1KC8 O;  3AA5 X;  2QWN A;  1OH8 A;  2I7N A;  4H0P A;  1VRT A;  3CCS N;  2VWJ A;  2ASP A;  2YNH A;  1B92 A;  4CZH A;  1P8Z A;  3VA0 A;  3V4I A;  3TAF A;  2ZJR L;  4JI1 K;  4BRI A;  4IOX A;  5BRE A;  4DUY K;  4I9L A;  2CH5 A;  3V9S A;  4F2R A;  4Y1D A;  3SUN A;  4CEE A;  3NE6 A;  2QWO A;  4DSF A;  3DLK A;  4ID5 A;  3U3Y A;  2FSK A;  1VSD A;  5AQT A;  4FJL A;  3LDN A;  5JMV A;  3K0S A;  4CIF A;  5ADX A;  3QIC A;  1XI1 A;  3I0R A;  3ZEU A;  1B9D A;  2QWM A;  4FOI A;  4JS4 A;  4QOZ B;  5GAD P;  3B6P A;  4PUO A;  1NM1 A;  2NRR A;  4HTL A;  1Y64 A;  4NXN K;  4N41 A;  3FZF A;  5FRN A;  2ZQB A;  5BPL A;  3WNH A;  4H0T B;  1S1X A;  2F96 A;  2KQ2 A;  3W0L A;  1UA1 A;  3BP8 A;  1HYS A;  5AZI A;  3OJS A;  2O4I A;  2YI1 A;  1C1A A;  2E6M A;  4KHU A;  1DT9 A;  3VQC A;  1YI2 N;  2Q0R A;  5J2M A;  2P9K A;  5AQR A;  3T7Z A;  2E2Q A;  3CF5 L;  4H8K A;  2E2N A;  1RNH A;  4O5F A;  1S6Q A;  4F8R A;  3SQ1 A;  4ZHR A;  3VOV A;  5FPD A;  2O8D B;  1QVF M;  2BH1 A;  3NF7 A;  4AHT A;  1XUP O;  4CZK A;  3JSM A;  3O3F A;  4BE1 A;  4JRP A;  2KFZ A;  4CEB A;  1IKY A;  3VEX A;  2G8W A;  2XY6 A;  4PKH A;  4FVU A;  2O8B A;  2HF4 A;  1L3U A;  3NH2 A;  5HRS A;  3HZ6 A;  4H03 B;  4CK2 A;  3THW B;  1BA0 A;  2BDP A;  3V1R A;  4J8F A;  4A2A A;  4YFU A;  3SJJ A;  2V7Z A;  4BR4 A;  1SL2 A;  1YJ9 N;  3NMU A;  3CER A;  3SQ0 A;  3CIP A;  2Q97 A;  3ISN C;  1RDC A;  1L3T A;  2X6S A;  4O8U A;  3VTI A;  3K5L A;  4Z4E A;  3ULE A;  4DV3 K;  1KTQ A;  3UKR A;  4BE0 A;  5HLF A;  2O8F A;  1S9E A;  4N76 A;  2HBJ A;  4FLX A;  3I0S A;  2QKB A;  1RBT A;  2BUP A;  2ETJ A;  2B5J A;  3ID8 A;  4IXC A;  3KD1 E;  4RW8 A;  4PA1 A;  3LDS A;  1IG8 A;  4CVN E;  3RSE A;  1I94 K;  1QS4 A;  4CEZ A;  4LF8 K;  1RDU A;  3VGL A;  1JL2 A;  1OKJ A;  2P9L A;  1JLF A;  1SL1 A;  1BGX T;  4M41 A;  3R9P A;  2OZS A;  3M8Q A;  1Q86 O;  4JD2 B;  3KZB A;  4DSK A;  3WXK A;  4LF4 K;  2FLO A;  1V4T A;  3CJ9 A;  3WXL A;  1TK0 A;  1Q81 O;  4DTM A;  3JAM O;  4LF5 K;  3HK2 A;  1BCM A;  4ICL A;  2E2O A;  4HUG A;  5EVZ A;  2CH6 A;  4EHT A;  3C95 A;  2P5O A;  4DV4 K;  3TAQ A;  4ID1 A;  1P90 A;  3PIO L;  4HCB A;  5GAG P;  4FM2 A;  2QM1 A;  2HVH A;  4LC9 B;  3J7A P;  1DTT A;  1JCE A;  4NO7 A;  4M7Y A;  3RVC A;  3KLH A;  3ZX3 A;  3A5O C;  2Q3S A;  4FM0 A;  1XQS C;  2GX9 A;  4DTO A;  5GIP A;  1Z05 A;  3T1H K;  1ZBS A;  4BRD A;  4M3X A;  3SV4 A;  2HHQ A;  4JKG B;  2O8C A;  3ZET A;  4KHP K;  4BR0 A;  4XH1 A;  1WSI A;  1D9D A;  4B8A B;  4LF9 K;  2HMP A;  4DQS A;  3AVG A;  4BWJ A;  4DTJ A;  4CER A;  1SKW A;  1C1C A;  2A3Z A;  1YJN N;  1A5X A;  4FM1 A;  3OYH A;  2RHK A;  3I8D A;  1E4G T;  4CF8 A;  3OS1 A;  1FXX A;  1YF5 L;  3V9Z A;  3DLL L;  3CI5 A;  3AA3 A;  4OVL A;  3CCM N;  1NK4 A;  1QQC A;  1BIU A;  3DLG A;  3S41 A;  3QEI A;  3ALY A;  1VSF A;  3PUF A;  3NCI A;  4FZX C;  5KRS A;  4BRH A;  4DUZ K;  3EKS A;  1YT3 A;  3TAN A;  4CFB A;  1NGI A;  1Z26 A;  2YKN A;  2O8E B;  4DS5 A;  1A5V A;  3ZSY A;  3TI0 A;  1BO5 O;  3ZSW A;  3SAH A;  3H1Q A;  3I55 N;  4IDH A;  3MEG A;  5CYQ A;  1E3M A;  4CGG A;  1ZYQ A;  5LJV A;  1ASU A;  4OLB A;  4E1J A;  5I3U A;  2XRI A;  2JWK A;  1RDW X;  4FWN A;  1QQN A;  1HPZ A;  1IKX A;  4OGE A;  4JKC A;  4X66 K;  4FJG A;  2GV9 A;  1KQS M;  4CEC A;  4DWI A;  3VQP A;  3GDQ A;  2YJE A;  1KVB A;  4EP4 A;  1WBD A;  5FDL A;  3G25 A;  4FZZ A;  1NLV A;  2BTF A;  3G4S N;  4JNE A;  1RDA A;  3VQ4 A;  2WON A;  1WLJ A;  4JYA K;  3KJV A;  1Z25 A;  3TU5 A;  5CE3 A;  4YOU A;  1TV6 A;  2D0P A;  2HHV A;  4E3S A;  3A8Y A;  1GLD G;  1BUP A;  3TAE A;  1VQ8 N;  2RPI A;  2P9P A;  4GVM A;  1NK7 A;  3G71 N;  4AHR A;  1NJI O;  3WEE B;  3AVN A;  5CZ1 A;  1KRP A;  4HVJ A;  2I5J A;  1VQP N;  3EKU A;  3LAL A;  1T6C A;  3V1Q A;  4DR5 K;  4ZTJ A;  5BN8 A;  4UQG A;  4DB3 A;  3DLR A;  1K9M O;  1BCO A;  3VGM A;  1U04 A;  2KZM A;  1IO2 A;  2OYQ A;  1Q82 O;  3QO9 A;  4V19 S;  1HNX K;  5D3G A;  4BRL A;  5AQL A;  3QEV A;  1L3V A;  2WTU A;  4DTN A;  4DLE A;  1IG9 A;  2G8V A;  3J8A A;  3SMS A;  3RWU A;  4JI5 K;  1LAV A;  3EZ5 A;  4PWD A;  3NVK A;  2E6L A;  2QI2 A;  1LV5 A;  2OTL N;  4G1Q A;  1R59 O;  3DAW A;  1NGF A;  2NRX A;  4H5V A;  3CJC A;  2QWQ A;  2WBN A;  5TKW A;  4FJM A;  1VK0 A;  4CJ4 A;  4CJF A;  3VGK A;  1KSP A;  4CK3 A;  3HM9 A;  1XMO K;  3L4Q A;  1BHL A;  1DGK N;  2YHB A;  3VQE A;  3KKR A;  4JKH A;  4OO1 J;  4DV5 K;  4FPB A;  2UUC K;  5JLH A;  2Z1I A;  4BRE A;  1IJJ A;  1OH6 A;  1JKH A;  4H5N A;  3K2P A;  4L8R B;  3EE8 A;  1ZBL A;  3ITH A;  3R3L A;  3SMP A;  1E4F T;  4X65 K;  1U2V A;  2OPR A;  3KLG A;  4CIG A;  2G8F A;  4WQ4 C;  5EY4 A;  4NLB A;  4M3R A;  4EFH A;  3C7N B;  3DRR A;  3WXI A;  1D8Y A;  3CQX A;  4KHN A;  1WOQ A;  3C6T A;  4YHH K;  2YKM A;  3LP2 A;  4ELT A;  4DQQ A;  3VQ9 A;  3MXJ A;  4A62 A;  1L5U A;  3PX0 A;  1VSL A;  3O3H A;  4JKD A;  3MDQ A;  1RTH A;  3BDP A;  1EET A;  1S6P A;  1LW0 A;  3NH1 A;  1WBB A;  5LJW A;  2GBZ A;  4MDA A;  4CJ7 A;  4IWV A;  5SWM A;  4Q5V A;  3ULD A;  2VGN A;  4DQP A;  3VET A;  4DV2 K;  1JXB A;  3VA3 A;  5AFU A;  1NK6 A;  4PY5 A;  1TL1 A;  1OH7 A;  3D2F B;  2P9U A;  3KK2 A;  3KD5 E;  3O1B A;  3CHW A;  1SL0 A;  4XH5 A;  4J2B A;  3AVC A;  1QVG M;  4BDY A;  4Z4F A;  2ZE2 A;  3V9W A;  4EZ9 A;  3P83 D;  2JWL A;  4Z4I A;  2A1R A;  2G8I A;  1YTA A;  4FCY A;  4L3Q A;  5DM7 L;  3PO4 A;  5B8H A;  2E5L K;  3EY1 A;  4DMN A;  4GKJ K;  3CFR A;  3I8B A;  3OYK A;  3I56 N;  1BQM A;  4CEA A;  4XH4 A;  4KB0 A;  1EXQ A;  2WUS A;  2XY7 A;  1GLE G;  4B9V A;  2V51 B;  3E1Y A;  2ATQ A;  5C10 A;  4WQ4 A;  2E4L A;  5C2D A;  3O9Q A;  3HPG A;  3KK1 A;  4PKI A;  3HTV A;  3MK6 A;  3LPT A;  5CYM A;  4E7L A;  1BI4 B;  1X9M A;  1S5J A;  3M6G A;  3FFI A;  4LFA K;  3F9K A;  4FJH A;  3P38 A;  4FJ9 A;  4E89 A;  3EZW A;  3C6U A;  3SLC A;  2P9N B;  1HYV A;  3OBW A;  3MCP A;  3G6E N;  1VRU A;  1ZBU A;  4M45 A;  4MQ3 A;  5T7B A;  1X3M A;  5HRR A;  2NZT A;  3OYD A;  2PBD A;  3GOI A;  1ZC6 A;  1QHA A;  1FK9 A;  1C6V A;  4LSN A;  4GNI A;  4C8O A;  4N56 A;  1VAZ A;  2RKI A;  1WSE A;  2FF3 B;  4B9N A;  3FZM A;  2Q36 A;  2P51 A;  5AQJ A;  1IBM K;  1SUQ A;  4KTQ A;  4BRG A;  5EXW A;  4C1N I;  1ZBH A;  4CZL A;  3RTV A;  3C6H A;  3K57 A;  4JHD B;  1NK0 A;  1FKO A;  4GV3 A;  3WNF A;  2GEL A;  4K42 A;  4CF0 A;  4DTU A;  2YNI A;  3IRX A;  1TKD A;  3MAQ A;  3BZC A;  2YHX A;  3W3D A;  4DG1 A;  4HUF A;  3NF9 A;  3LWM A;  4YDU C;  1NKC A;  3L4I A;  2PY5 A;  4XEI A;  1NGA A;  3ZT0 A;  4KI4 A;  1WUA A;  4DQ8 A;  3L3V A;  3D2E B;  4DR6 K;  3CFO A;  1KFS A;  3E9P A;  1W7A A;  1ASV A;  3L3U A;  4IG3 A;  3EN9 A;  3QDK A;  1YXQ A;  2X6N A;  4I2P A;  3H3O B;  4FLT A;  3RR8 A;  4CD1 A;  3QEP A;  3Q7B A;  4DLG A;  5GIO A;  4KPY A;  4Z0U A;  4OPA A;  4YOR A;  3MN9 A;  3IFR A;  3LZI A;  4B1Y B;  4CJT A;  3KKS A;  2X78 A;  3KLF A;  4DKW A;  1IBL K;  3UIQ A;  4WFN L;  3VQA A;  3HVR A;  3AA2 A;  2CGJ A;  1NKE A;  1G99 A;  2P9I B;  1M90 O;  4C8L A;  3PY8 A;  4CGH A;  4H5T A;  5HOO A;  1DTQ A;  3A5M C;  3BGR A;  3EE9 A;  5E41 A;  3TAM A;  1QSY A;  1H1V A;  4Q0B A;  3CJ1 A;  2UXC K;  3NAE A;  1HKB A;  3FZL A;  3LWL A;  4DSE A;  1BL3 A;  3QIP A;  4Y1C A;  4YDU A;  1S1T A;  3FGU A;  1YVU A;  2ZWH A;  4MDB A;  1KAX A;  3LAK A;  5F1X A;  4HCC A;  2UYT A;  3THX A;  2YV0 X;  2HHU A;  3LM9 A;  4FJI A;  3MXI A;  3THV A;  3A5L C;  3C6A A;  1WSJ A;  1VQK N;  4B3M K;  3LL3 A;  4EZ6 A;  1KVA A;  1YUW A;  2XO7 A;  3QNN A;  4JV5 K;  2P9S A;  1IKW A;  4DTR A;  3QES A;  4FJ7 A;  2ASM A;  4H0O A;  5AZJ A;  3DLE A;  4FWM A;  1IV0 A;  1EWR A;  4CZE A;  4Z4C A;  4FWL A;  3K5N A;  4JI3 K;  3ZCM A;  3QEW A;  2Q0U A;  2P1J A;  2GEM A;  3IG1 A;  2B4J A;  4FYD A;  1ZBI A;  4YOV A;  3AVL A;  2ZGZ A;  4IBN A;  1HPM A;  1U47 A;  3SYZ A;  4FLY A;  3ZEU B;  4ILJ A;  3OYL A;  5J2Q A;  4BQZ A;  3NH0 A;  4OGC A;  3VMF B;  3TWH A;  1Q9Y A;  4BRO A;  3G10 A;  4LFB K;  1XWL A;  4O8K A;  1WN7 A;  4AF1 A;  4NCB A;  1O13 A;  1TL3 A;  2RN2 A;  2PYL A;  5J2N A;  2V52 B;  5AZI B;  2XY5 A;  4BVO A;  3NFA A;  3N4P A;  3VEN A;  3HPO A;  4CF9 A;  3ATV A;  1OVQ A;  2KFN A;  2VGM A;  3CCR N;  4CJU A;  3CC2 N;  1ASW A;  3LZJ A;  5GAE P;  3TAP A;  1TK5 A;  3ZSR A;  2KW4 A;  5KPR A;  2A40 A;  3HRG A;  3JS6 A;  2DFH A;  3SUO A;  4CIE A;  2P9K B;  1J6Z A;  3SK3 A;  1I39 A;  4B1V A;  1WAF A;  1W9H A;  1KAY A;  1SV5 A;  4YOT A;  4AHS A;  4CHZ A;  4BGB A;  4JS5 A;  1F21 A;  4K0K K;  4CE9 A;  2D5R A;  3SQ4 A;  2NRH A;  2YNF A;  1X9W A;  1NWK A;  3T19 A;  1VSM A;  4F4K A;  4B1U B;  3M8P A;  4ISE A;  1NGG A;  3FR0 A;  4DFK A;  4BC2 A;  4BG8 A;  2O8B B;  4ILG B;  4Y0W A;  1S72 N;  1RBR A;  1JLA A;  5ELZ A;  5EX5 A;  2ZJQ L;  4EIA A;  4M63 C;  4CBW A;  1VQ6 N;  4F3T A;  3ZSQ A;  3K9K A;  2JGU A;  4BAC A;  4BDZ A;  1U49 A;  3UKU A;  1NKB A;  3OYE A;  2NLX A;  1BIS A;  4QAG A;  1LOT B;  3SBT A;  1GLJ O;  3QFP A;  3ULE B;  3AVF A;  3UKR B;  1J9A A;  3OYJ A;  3TAB A;  2O8F B;  3VEO A;  2KZZ A;  2ZM6 K;  1KVC A;  2QKK A;  4ISF A;  1ATS A;  1D4X A;  4CEQ A;  1TYQ A;  4DV0 K;  2QK9 A;  1HLU A;  3TAR A;  3NHG A;  3OYA A;  3RSE B;  3CJA A;  3HO1 A;  4OKE A;  3THY A;  1ZBF A;  4LH4 A;  3KLI A;  4CZM A;  2Q1N A;  3AO2 A;  1K8K A;  2P9L B;  3WNE A;  1SAZ A;  2VG6 A;  4FWP A;  4M3W A;  3LP0 A;  3Q7C A;  1GLC G;  2HST A;  2FC0 A;  1RT1 A;  2VQE K;  5AR0 A;  3K9J A;  5AQM A;  1HQU A;  2FBX A;  4H0X B;  4CJ3 A;  4CJQ A;  3VF4 A;  2OAN A;  4U7B A;  4CK1 A;  4KRE A;  2QTD A;  4I6M A;  2YNG A;  1NK5 A;  5M1O A;  1XHZ A;  3P1G A;  2BGG A;  4IKF A;  1Q8I A;  3OS0 A;  3HOT A;  3IUC A;  2ZD1 A;  2FF6 A;  4BRK A;  5C12 A;  4CED A;  2OTJ N;  2HNY A;  3CXC M;  3DLH A;  4IJA A;  4K41 A;  1CXU A;  2VWB A;  2XHB A;  4M3T A;  3OTO K;  1HNV A;  1L3S A;  1TK8 A;  4RWT A;  3C0B A;  3C94 A;  3FZK A;  3HVT A;  2IAJ A;  4H4O A;  4B3R K;  4CJR A;  3O9T A;  4LD0 A;  2VCP A;  2O8C B;  2YJF A;  1UA0 A;  4B9L A;  3ZET B;  3J80 O;  4CGF A;  3QNO A;  3AVK A;  4KHQ A;  4B8C A;  4FOE A;  2VWK A;  4LH5 A;  4GVE A;  4CHY A;  5JVH L;  4BRQ A;  1VQO N;  4XIU A;  2QWR A;  3U3G A;  3ZYY X;  5AQO A;  3ZSX A;  5C0Y A;  4BVP A;  4K43 A;  2EX3 A;  4E1N A;  1QE1 A;  5LMU K;  3WUH A;  5AJ3 K;  5KQ8 A;  1JLQ A;  5SZT A;  3LAM A;  4CBU A;  4BRA A;  3VQ5 A;  2KKZ A;  4DR3 K;  1CZB A;  3MWT A;  3HYF A;  4OX9 K;  2W42 A;  3E66 A;  4DSI A;  4OLA A;  3O08 A;  4JK7 A;  4LF6 K;  4FWR A;  4OPJ A;  3DXM A;  4QS7 A;  5AQZ A;  1BWF O;  3S3O A;  2A6A A;  4JK8 A;  4DV6 K;  4B9S A;  4WYB A;  3VQ7 A;  4KB1 A;  3EO3 A;  5M1P A;  5DM6 L;  1RT3 A;  4DF8 A;  3NF6 A;  2RF2 A;  1LWF A;  4CF2 A;  1NOY A;  3ASM A;  2Q2R A;  3O80 A;  2O4G A;  1VQ5 N;  1VQM N;  5JLF A;  1NJW A;  5M1F A;  1C0M A;  3U4L A;  1CLQ A;  4BR2 A;  5F0X A;  3M5R A;  3OW2 M;  3LDL A;  4C23 A;  1J54 A;  4FZY A;  4DR4 K;  1UAX A;  3PSF A;  3K58 A;  1KXP A;  4QS9 A;  3K5M A;  3SCX A;  3OJU A;  4PHT X;  2WFB A;  3AO1 A;  3B6O A;  3TAG A;  3VER A;  4CFC A;  1VQN N;  5EOY A;  3ZX2 A;  3WNG A;  1JLE A;  1CZ9 A;  2HHH K;  1IKV A;  4G9Z A;  2A41 A;  2ITG A;  4K25 A;  1N6Q A;  4A5B A;  3DLB A;  1XHX A;  3MN5 A;  3CCU N;  3H46 O;  4HTU A;  5BPN A;  1YVN A;  2QA4 N;  4DR2 K;  4H0V B;  3SUQ A;  4IOC L;  1NMN A;  3WT0 A;  2JLE A;  1HR0 K;  1BA1 A;  1RBS A;  1CXQ A;  4LY7 A;  4GKK K;  3CQY A;  4DU4 A;  1G15 A;  4CZF A;  5AQI A;  1GLF O;  2W6K A;  3VES A;  3ZSZ A;  1HNI A;  2P9P B;  3F5T A;  2VYP A;  4KTW A;  4KHY A;  1WB9 A;  2EWS A;  4BRM A;  4B9T A;  3CFP A;  3V9U A;  2LSN A;  4EP5 A;  1EP4 A;  4IEI A;  1TAU A;  3SNN A;  3QFU A;  4CFA A;  3CG7 A;  5HRP A;  5HP1 A;  4FWO A;  5C24 A;  4F2S A;  4O0I A;  2W6L A;  1SKR A;  4B3S K;  4JKB A;  4CGJ A;  2DY4 A;  3GL1 A;  1JLB A;  1KCF A;  3QIO A;  3ATU A;  1W2B M;  1S3X A;  1T6D A;  3O1W A;  1WNS A;  3KTQ A;  1TUU A;  3BF1 A;  3QB0 A;  3UB5 A;  3M8R A;  5JIC A;  1D9F A;  3F9M A;  4O4G A;  3V9X A;  2QW9 A;  1V4S A;  2IS3 A;  3QIN A;  2A1S A;  3HBT A;  1BU6 O;  3SPY A;  4B3T K;  4JI7 K;  1ESV A;  3VEZ A;  2VQF K;  5AQG A;  3KIO A;  4GY2 B;  3VQ8 A;  1TAQ A;  1XMQ K;  4YY3 K;  3WQU A;  1BQN A;  3O9U A;  4OPK A;  5AQH A;  5IT9 O;  3F73 A;  1HJR A;  4JK9 A;  3DI6 A;  1ILY A;  3DYA A;  4FW1 A;  3NDK A;  4MLH A;  3LDO A;  2F7T A;  2CGL A;  3H3N O;  3NGY A;  4JI4 K;  1WSG A;  3DXK A;  4NYF A;  3VEY A;  3O5B A;  1BOT O;  3HT3 A;  4WCE L;  2H3G X;  4KRF A;  2HBK A;  3J7Y P;  2OZM A;  4FPA A;  4CBX A;  4MFB A;  4DFM A;  3SPZ A;  1U2V B;  1NU0 A;  5AQU A;  3RRG A;  2QXF A;  1RTD A;  1U45 A;  1JLC A;  3ENO A;  4BG9 A;  1HJO A;  3MED A;  3U9Z A;  3WQT A;  4RG8 A;  3SZ2 A;  4X64 K;  2OPQ A;  2E88 A;  3D45 A;  5LMN K;  3FE1 A;  3QML A;  3HXM A;  4RW4 A;  3NVM A;  5DMR A;  4H0Y B;  3KLE A;  4AM7 A;  1JCF A;  4I2Q A;  3PX6 A;  3S9H A;  3M8S A;  1IBK K;  3KK7 A;  4BY9 C;  5KPT A;  3HL8 A;  4BR5 A;  2ZF5 O;  3H08 A;  1YIJ N;  1NJZ A;  2WC9 A;  1VSI A;  5HBM A;  2F8T A;  4Z4G A;  2IVO A;  1GLA G;  1NK8 A;  1HQE A;  5FRO A;  1JCG A;  2P9U B;  1HYZ A;  3NGI A;  5AQX A;  3O4N A;  4CZI A;  1RIL A;  4HUE A;  4M3U A;  2HVI A;  2OCE A;  5J2P A;  2XY8 A;  1NGE A;  2X74 A;  1VSJ A;  1Q9X A;  2UUB K;  3N4Q A;  1KFD A;  4BR7 A;  3CMA N;  5AQS A;  4KHS A;  3B8A X;  2G8U A;  3T69 A;  2J4R A;  1LWC A;  1C0F A;  3L2W A;  4AM6 A;  4FK2 A;  1NGD A;  2HOE A;  3MCA B;  3BUZ B;  2HHW A;  2HW3 A;  4R79 A;  3QER A;  5AQP A;  5HRN A;  1GLL O;  3DOL A;  3ZSV A;  1RT4 A;  4KBO A;  4B9Q A;  2E8A A;  1BDG A;  2NRW A;  5BRD A;  3LM2 A;  4IEE A;  4A57 A;  4IFE A;  4DF4 A;  2Y1I A;  4IO8 A;  4W5N A;  1SS6 A;  2GWJ A;  1C0G A;  4YOX A;  1RT2 A;  1MA9 B;  2IC3 A;  4JKE A;  2AJQ A;  4E1M A;  1UOC A;  3KVG A;  4KH4 A;  3T1Y K;  1W97 L;  2YHA A;  4CHQ A;  1KAZ A;  1UWB A;  3PLA A;  1T8E A;  4FLV A;  5AQV A;  4FW2 A;  3L2U A;  4DQR A;  2F9W A;  5KPZ A;  5HL7 L;  4PQU A;  1JLG A;  3CPE A;  1VQ9 N;  2P5G A;  1S22 A;  4RW9 A;  3V81 A;  4JLH A;  4DTP A;  4RW7 A;  3VQ6 A;  1C1B A;  1DLO A;  3HI0 A;  2FXU A;  1RGI A;  3ZX0 A;  5C25 A;  3HP9 A;  2Z1G A;  3LP3 A;  4IFV A;  2IOC A;  3JXU A;  4BWM A;  2Y1J A;  2YHY A;  4CEF A;  1JL1 A;  2WOM A;  4WF9 L;  3RMB A;  3SBG A;  3I33 A;  2BE2 A;  4GW6 A;  3E9O A;  4DTS A;  2DPN A;  4GV9 A;  5CY4 A;  1HMV A;  4RCH A;  3DJC A;  1T3V A;  4CJP A;  1SQK A;  4WQ5 C;  3T1A A;  3K59 A;  4ILH A;  4FJX A;  4M3Y A;  2UXB K;  1XNR K;  4DSL A;  4AIL C;  3LP1 A;  1U48 A;  5AFU H;  2O8D A;  3L2Q A;  1LWE A;  2D0B A;  1HNW K;  4KHW A;  1Q7Y O;  1RDB A;  3MN6 A;  2D0O A;  3LAN A;  3O9R A;  4ISG A;  3MEE A;  1C0U A;  5AQY A;  1JJ2 M;  3SQ2 A;  4BQL A;  2HB5 A;  1X9J A;  4KH5 A;  3O9S A;  4JAX A;  1QHT A;  5BN9 A;  3THW A;  5FPN A;  2E1Y A;  3S3M A;  1NK9 A;  4FJN A;  1NGJ A;  2FBT A;  3ZSO A;  4YOW A;  2QXL A;  2YX6 A;  3VTH A;  3TTD A;  3P5J A;  3CJ7 A;  4FLW A;  4FL9 A;  4CHN A;  4I9Q A;  4PL8 A;  1J5O A;  3ZLJ A;  2KTQ A;  2W40 A;  3HST B;  3SV3 A;  2QWL A;  4Z94 A;  5EU7 A;  5I9E B;  4Z4H A;  4J2A A;  3TSP A;  5M1N A;  2YCH A;  3OY9 A;  3TTC A;  4KI6 A;  1VSH A;  3A2F A;  1NG9 A;  4M7X A;  4DU1 A;  2GWK A;  3MN7 A;  3HM8 A;  3M3Z A;  4OKK A;  3L6Q A;  2PAV A;  4JKF A;  4DR1 K;  3MX2 A;  4CJE A;  4CHO A;  4FJ8 A;  4KV8 A;  3RR7 A;  3D6R A;  4WQ5 A;  3H45 C;  2VG7 A;  3KWI A;  1FW6 A;  3AVJ A;  3D7E O;  1D5A A;  1RCH A;  4WFA L;  1N32 K;  3MX5 A;  4U67 L;  4J2E A;  3FLC O;  4JD2 A;  2A5X A;  1FKP A;  3THX B;  4CZJ A;  4M3Z A;  1NGH A;  1RBU A;  2IGI A;  2YHW A;  4B3O A;  1RTI A;  4YOY A;  3P39 A;  5K14 A;  4ZTF A;  4R5P A;  2PFU A;  5F2R A;  4NCG A;  1NMD A;  3O8M A;  3CC4 N;  2P9S B;  3NF8 A;  3RMD A;  3J7Z O;  2F8S A;  2NNW A;  5AZJ B;  1GOB A;  1T05 A;  4CW7 B;  1GOA A;  2FBV A;  4DU3 A;  3IDH A;  1K73 O;  1NBW A;  4BC4 A;  3K5O A;  3CCQ N;  3G0Z A;  3KK3 A;  1NGB A;  2NUB A;  2HBM A;  3HPH A;  1XC3 A;  3OA9 A;  1MU2 A;  4JI6 K;  2R7Y A;  2IVN A;  3AO4 A;  3BZK A;  4DCH A;  2B6A A;  2NRT A;  3OYI A;  1YAG A;  5DK5 A;  3OYF A;  1QSS A;  3H1V X;  4OPH A;  3IAY A;  1JXE A;  4JKG A;  4JKA A;  5KGW A;  3GG4 A;  4O0J A;  5BRF A;  2Z1H A;  4E0D A;  4AHV A;  1KD1 O;  3CYM A;  4F3O A;  2ASO A;  3SI6 A;  4PKG A;  3ZT2 A;  5CHI A;  4W5Q A;  3QBX A;  3VEV A;  4QS8 A;  3OYG A;  3L8B A;  2OA8 A;  1NOZ A;  5AQW A;  3VQD A;  2IDO A;  4B1Z A;  1R0A A;  5AQK A;  4ELV A;  3CD6 N;  1K6Y A;  3AVI A;  1MWM A;  2PZS A;  3A0I X;  1X3N A;  3CME N;  3RRH A;  3AO5 A;  1QSL A;  2D4W A;  3TTF A;  1WSH A;  3EYZ A;  3H6E A;  3NBP A;  3PO5 A;  2F4V K;  3PIP L;  4FK0 A;  2UXD K;  1N36 K;  2ZJP L;  3QEX A;  4WE1 A;  1RBV A;  1RT7 A;  5ADX H;  2GTD A;  3MMV A;  4LF7 K;  2O8E A;  3CCV N;  3U8X A;  4CZG A;  1S1V A;  4C1N K;  3VPZ A;  3QET A;  4DTX A;  1QZ6 A;  1W0H A;  2KLA A;  4BRN A;  4FJ5 A;  2DFF A;  1RDD A;  2FSN A;  3VEW A;  3OVN A;  3PX4 A;  3R1X A;  2DFE A;  5HRO A;  3UKU B;  4FLZ A;  1M1K O;  3OYM A;  3GBT A;  2D0C A;  2OPP A;  3OBY A;  1YJW N;  4DQI A;  4BRF A;  3D0P A;  3L2R A;  3CQ8 A;  4BDP A;  4FVM A;  2UUA K;  4JI2 K;  4CEO A;  4BGA A;  4B9M A;  1TYQ B;  4IDK A;  1TKZ A;  3CM6 A;  1A5W A;  4MO4 A;  1TKT A;  3THY B;  4FJJ A;  1Q18 A;  1N33 K;  4FWS A;  1QQM A;  3HOS A;  5FRM A;  1Y97 A;  4E7I A;  2PYJ A;  1K8K B;  3BF3 A;  4IO9 L;  1C0T A;  3A5N C;  1DEJ A;  1QQO A;  1XNQ K;  5FPM A;  1ATN A;  4DFJ A;  3EL2 A;  3CM5 A;  1EQY A;  3DMJ A;  1OVY A;  3AAP A;  4NXM K;  2HMI A;  1S1W A;  4IFY A;  5BR9 A;  1T03 A;  5KGX A;  3WEE A;  5FPE A;  4CD3 A;  3WXJ A;  5IWA K;  1J5E K;  4I6M B;  3VQQ A;  3AGK A;  5BPM A;  4FWK A;  4EHU A;  3E01 A;  1KLM A;  4NCA A;  1Z6R A;  5MLC Q;  3CCE N;  3OYC A;  1HUX A;  4K8X A;  1ZXO A;  5CR4 A;  3MEC A;  1SZ2 A;  2OPS A;  4C8M A;  4F9O A;  4C8K A;  3OYB A;  4UY8 O;  4C8N A;  1EKE A;  3IKM A;  3KWG A;  1I3A A;  3QBW A;  4RTF D;  1XC9 A;  4EAH D;  3QLH A;  4TSX A;  5M1Q A;  1BIZ A;  5M1K A;  4X62 K;  4B9U A;  4AHU A;  2G8H A;  3CC7 N;  3AGR A;  1HKC A;  1GOC A;  1VSK A;  4CFD A;  3MWP A;  1QZ5 A;  2ZGY A;  5H1S Q;  1NJX A;  1TGO A;  1ITG A;  4CF1 A;  1YTU A; 
#chains in the Genus database with same CATH homology
 3M8S A;  3HL8 A;  3LWL A;  4DSE A;  1BL3 A;  1DTT A;  3QIP A;  4Y1C A;  2HHT A;  3H08 A;  1S1T A;  3KLH A;  1YVU A;  3T3F A;  1NJZ A;  1VSI A;  5HBM A;  1NJY A;  1REV A;  4Z4G A;  2F8T A;  1NK8 A;  2Q3S A;  1S1U A;  1HQE A;  3LAK A;  4FM0 A;  4HCC A;  4DTO A;  5FRO A;  1KLN A;  2YV0 X;  3RMC A;  2HHU A;  3HJF A;  1HYZ A;  4FJI A;  3NGI A;  3MXI A;  4BE2 A;  3SUP A;  3THV A;  2EHG A;  3O4N A;  4M3X A;  4HUE A;  1RIL A;  4M3U A;  2HVI A;  4J2D A;  5J2P A;  1WSJ A;  2XY8 A;  3SV4 A;  2HHQ A;  4EZ6 A;  1KVA A;  2X74 A;  2XO7 A;  1VSJ A;  3QNN A;  1Q9X A;  3AO3 A;  1WSF A;  1RT6 A;  4E7J A;  1IKW A;  4DTR A;  3QES A;  1LAW A;  4FJ7 A;  4CGI A;  1WSI A;  1KFD A;  1B9F A;  3DLE A;  1D9D A;  4B8A B;  4Z4C A;  3S3N A;  3K5N A;  4KHS A;  4DQS A;  2G8U A;  3ZCM A;  3QEW A;  3AVG A;  4BWJ A;  1LWC A;  4DTJ A;  2P1J A;  1LW2 A;  3IG1 A;  2B4J A;  2GUI A;  3DM2 A;  4O44 A;  4CER A;  3L2W A;  1SKW A;  4FYD A;  1C1C A;  4FK2 A;  1ZBI A;  2DTU A;  1A5X A;  4FM1 A;  3JYT A;  3OYH A;  3AVL A;  3I8D A;  2Z1J A;  4IBN A;  4CF8 A;  2HW3 A;  2HHW A;  3OS1 A;  1U47 A;  3SYZ A;  4OKJ A;  5HRN A;  4FLY A;  3QER A;  3DOL A;  1FXX A;  4NYN A;  3ZSV A;  3OYL A;  1RT4 A;  5J2Q A;  3V9Z A;  3NH0 A;  3AA3 A;  4OVL A;  4OGC A;  4AHC A;  1NK4 A;  1QQC A;  4KO0 A;  1BIU A;  3DLG A;  3NGZ A;  3TWH A;  4DF4 A;  2Y1I A;  1Q9Y A;  4FLU A;  3G10 A;  3QEI A;  3ALY A;  1XWL A;  1VSF A;  1WN7 A;  4W5N A;  3PUF A;  5J1E A;  2HNZ A;  4NCB A;  3NCI A;  5KRT A;  4FZX C;  5KRS A;  4DS4 A;  1TL3 A;  3DRP A;  2AJQ A;  1RT2 A;  2IC3 A;  3DOK A;  4E7K A;  2RN2 A;  1YT3 A;  3TAN A;  5J2N A;  2PYL A;  3AVM A;  4CFB A;  4E1M A;  1UOC A;  1Z26 A;  2YKN A;  4H4M A;  3O4Q A;  1N5Y A;  2YHA A;  4DS5 A;  1A5V A;  4QCL A;  3ZSY A;  2XY5 A;  4KFB A;  3TR8 A;  3TI0 A;  4CHQ A;  3NFA A;  1UWB A;  3ZSW A;  1T8E A;  4GMJ B;  4CF9 A;  3ZT1 A;  3HPO A;  4FLV A;  4K8Z A;  2KFN A;  4CHP A;  4FW2 A;  3L2U A;  4DQR A;  4CJU A;  1ASW A;  3LZJ A;  4PQU A;  1JLG A;  2VG5 A;  4B08 A;  3TAP A;  1TK5 A;  2P5G A;  3ZSR A;  2KW4 A;  3MEG A;  5CYQ A;  4DSJ A;  4CGG A;  4RW9 A;  3V81 A;  1ZYQ A;  2DFH A;  4JLH A;  3SUO A;  4CIE A;  4DTP A;  1ASU A;  5KI6 A;  1I39 A;  4RW7 A;  4OLB A;  1WAF A;  1W9H A;  3VQ6 A;  4W5T A;  1SV5 A;  5I3U A;  1C1B A;  1DLO A;  2XRI A;  1RT5 A;  4YNQ A;  4AHS A;  4CHZ A;  1HPZ A;  1IKX A;  4OGE A;  3HP9 A;  5JS2 A;  4CJ5 A;  4E19 A;  5C25 A;  1F21 A;  1BI4 A;  2BAN A;  2D0A A;  2Z1G A;  1RTJ A;  2D5R A;  4CE9 A;  3SQ4 A;  1ITG A;  3LP3 A;  2YNF A;  1X9W A;  4FJG A;  2GV9 A;  4IFV A;  2IOC A;  4BWM A;  4ELU A;  3T19 A;  1VSM A;  4HHT A;  2Y1J A;  4F4K A;  4CEF A;  3M8P A;  4CEC A;  1JL1 A;  2WOM A;  5CZ2 A;  4DWI A;  4O55 A;  3VQP A;  3RMB A;  4DFK A;  2BE2 A;  4EP4 A;  1KVB A;  4GW6 A;  3RMA A;  5JS1 A;  5FDL A;  4DTS A;  4FZZ A;  3ZT4 A;  3MXM A;  5CY4 A;  1HMV A;  1RDA A;  3VQ4 A;  1RBR A;  2WON A;  4M42 A;  1WLJ A;  3ZT3 A;  1JLA A;  1IH7 A;  4CES A;  3KJV A;  1Z25 A;  4F3T A;  1VSE A;  4CJP A;  5C42 A;  4W5O A;  3T1A A;  3ZSQ A;  1QTM A;  1TV6 A;  2HHV A;  3K59 A;  2JGU A;  4BAC A;  4BDZ A;  4E3S A;  1U49 A;  1NKB A;  3OYE A;  3TAE A;  1BIS A;  4FJX A;  4M3Y A;  2HHS A;  2RPI A;  4N47 A;  4QAG A;  4JRQ A;  4DSL A;  4GVM A;  1NK7 A;  4AIL C;  3OS2 A;  3LP1 A;  1U48 A;  4AHR A;  3AVF A;  1J9A A;  3OYJ A;  3L2Q A;  1LWE A;  2D0B A;  3TAB A;  3AVN A;  5CZ1 A;  1T7P A;  4KHW A;  1RDB A;  1KRP A;  3LPU A;  4CJV A;  2KZZ A;  4HVJ A;  3LAN A;  1J53 A;  1KVC A;  2I5J A;  2QKK A;  3LAL A;  3V1Q A;  3MEE A;  4RW6 A;  1C0U A;  1X1P A;  4CEQ A;  4ZTJ A;  4UQG A;  2QK9 A;  3SQ2 A;  2HB5 A;  3PV8 A;  3DLR A;  3HP6 A;  3NHG A;  3TAR A;  1U04 A;  2KZM A;  3OYA A;  1IO2 A;  2OYQ A;  1QHT A;  3QO9 A;  3HO1 A;  4OKE A;  1ZBF A;  4LH4 A;  3KLI A;  5D3G A;  1L3V A;  3QEV A;  3S3M A;  1NK9 A;  4FJN A;  4DTN A;  2FBT A;  3AO2 A;  3ZSO A;  4DLE A;  3WNE A;  1SKS A;  4LSL A;  1IG9 A;  2G8V A;  2FBY A;  2VG6 A;  3P5J A;  3O3G A;  3RWU A;  4M3W A;  4FLW A;  1LAV A;  3LP0 A;  4CHN A;  1S9G A;  4FK4 A;  2FC0 A;  3EZ5 A;  1RT1 A;  4I9Q A;  4PWD A;  1J5O A;  4N5S A;  2KTQ A;  2E6L A;  3HST B;  1LV5 A;  4W5R A;  3SV3 A;  4G1Q A;  1O1W A;  5EU7 A;  4Z4H A;  4J2A A;  4O5B A;  1HQU A;  2FBX A;  4CJ3 A;  4CJQ A;  4KAZ A;  3OY9 A;  4KI6 A;  1VSH A;  4FJM A;  3A2F A;  1HRH A;  1VK0 A;  4CJ4 A;  4CK1 A;  4CJF A;  3AVH A;  3DRS A;  4CK3 A;  4DU1 A;  1KSP A;  4KRE A;  4KKO A;  2YNG A;  1NK5 A;  1EX4 A;  4OKK A;  3P1G A;  4CJK A;  3HM9 A;  1XHZ A;  2BGG A;  4IKF A;  1BHL A;  3AVA A;  1Q8I A;  4CJE A;  5KTQ A;  2YHB A;  3IS9 A;  4CHO A;  3VQE A;  3KKR A;  4FJ8 A;  4KV8 A;  3OS0 A;  3RR7 A;  2ZD1 A;  3U6F A;  2Z1I A;  4IG0 A;  4DFP A;  4CED A;  2VG7 A;  4CJL A;  1JKH A;  3K2P A;  2HNY A;  4L8R B;  3AV9 A;  3AVB A;  1CXU A;  1D5A A;  3AVJ A;  1RCH A;  2XHB A;  1ZBL A;  3DLH A;  3ITH A;  4M3T A;  1HNV A;  1L3S A;  1TVR A;  5I42 A;  4J2E A;  3V6D A;  1TK8 A;  1TKX A;  1FKP A;  4M3Z A;  1RBU A;  2IGI A;  2OPR A;  3VN5 A;  3KLG A;  4CIG A;  2G8F A;  3C94 A;  4KTZ A;  4B3O A;  3HVT A;  4M3R A;  4CCH A;  2IAJ A;  3DRR A;  1RTI A;  5K14 A;  4ZTF A;  4H4O A;  4CJS A;  4R5P A;  1U4B A;  1D8Y A;  4CJR A;  1WAJ A;  4LD0 A;  4KHN A;  4NCG A;  3C6T A;  2YKM A;  1UA0 A;  3OYN A;  3LP2 A;  3NF8 A;  2G8K A;  4B9L A;  3RMD A;  4ELT A;  4DQQ A;  4CGF A;  3VQ9 A;  3AVK A;  3V1O A;  3QNO A;  3MXJ A;  1L5U A;  4KHQ A;  2F8S A;  1GOB A;  4B8C A;  2VWK A;  4LH5 A;  3PX0 A;  3VQB A;  1T05 A;  4CHY A;  1VSL A;  4CJW A;  3AA4 A;  4AH9 A;  4FJK A;  1GOA A;  2FBV A;  3O3H A;  4XIU A;  4E7H A;  2HND A;  4DU3 A;  4CGD A;  3U3G A;  1RTH A;  4OJR A;  3BDP A;  1EET A;  3ZSX A;  3K5O A;  1S6P A;  4I7F A;  3L2V A;  2EX3 A;  1X9S A;  1LW0 A;  4E1N A;  1QE1 A;  2HHX A;  3NH1 A;  2GBZ A;  3G0Z A;  1JLQ A;  3AA5 X;  3KK3 A;  2NUB A;  5SWM A;  4Q5V A;  3ULD A;  5SZT A;  1VRT A;  4JS5 A;  3LAM A;  3HPH A;  4DQP A;  1MU2 A;  2VWJ A;  1JXB A;  2R7Y A;  3AO4 A;  3VA3 A;  4PY5 A;  1NK6 A;  2YNH A;  1TL1 A;  1B92 A;  3VQ5 A;  2B6A A;  1CZB A;  3OYI A;  3KK2 A;  3KD5 E;  1SL0 A;  5DK5 A;  3HYF A;  3OYF A;  3VA0 A;  4J2B A;  2W42 A;  3AVC A;  3V4I A;  1QSS A;  4DSI A;  4OLA A;  4BDY A;  3TAF A;  3IAY A;  4Z4F A;  4OPJ A;  2ZE2 A;  3V9W A;  4EZ9 A;  3P83 D;  4Z4I A;  2A1R A;  1JXE A;  3S3O A;  4KB1 A;  4B9S A;  3VQ7 A;  5KGW A;  4O0J A;  2G8I A;  1RT3 A;  4DF8 A;  3NF6 A;  2Z1H A;  4I9L A;  2RF2 A;  4AHV A;  1YTA A;  3CYM A;  4FCY A;  3V9S A;  4E0D A;  4F2R A;  3SI6 A;  4F3O A;  3PO4 A;  1LWF A;  4Y1D A;  4CF2 A;  1NOY A;  3ASM A;  3ZT2 A;  4W5Q A;  3SUN A;  4CEE A;  3EY1 A;  3NE6 A;  4DSF A;  4DMN A;  3DLK A;  3OYG A;  4ID5 A;  3CFR A;  2O4G A;  3L8B A;  3OYK A;  2OA8 A;  3U3Y A;  1BQM A;  1NOZ A;  1NJW A;  1VSD A;  1C0M A;  1CLQ A;  4CEA A;  4FJL A;  3VQD A;  2IDO A;  1R0A A;  4KB0 A;  1EXQ A;  4CIF A;  2XY7 A;  1J54 A;  4FZY A;  1XI1 A;  4ELV A;  4B9V A;  1K6Y A;  3I0R A;  3AVI A;  1UAX A;  2ATQ A;  2PZS A;  3K58 A;  2E4L A;  3RRH A;  1B9D A;  3AO5 A;  3K5M A;  3SCX A;  3OJU A;  4JS4 A;  3HPG A;  3KK1 A;  1QSL A;  4QOZ B;  1WSH A;  3B6P A;  3B6O A;  3AO1 A;  3NBP A;  3LPT A;  3EYZ A;  5CYM A;  4E7L A;  3TAG A;  3PO5 A;  1BI4 B;  4N41 A;  1X9M A;  4CFC A;  4FK0 A;  1S5J A;  3FFI A;  3WNG A;  5FRN A;  1JLE A;  1CZ9 A;  2ZQB A;  3WNH A;  3F9K A;  4FJH A;  4FJ9 A;  1IKV A;  4E89 A;  3QEX A;  2ITG A;  3C6U A;  4WE1 A;  1N6Q A;  1RBV A;  1RT7 A;  1HYV A;  1S1X A;  2F96 A;  2KQ2 A;  1VRU A;  1ZBU A;  1UA1 A;  4M45 A;  3DLB A;  1XHX A;  4MQ3 A;  5T7B A;  1HYS A;  5HRR A;  4HTU A;  3OJS A;  2O4I A;  1S1V A;  1C1A A;  3QET A;  4DTX A;  1W0H A;  2E6M A;  3SUQ A;  3OYD A;  4FJ5 A;  2DFF A;  4KHU A;  2JLE A;  3VQC A;  1RBS A;  1CXQ A;  1RDD A;  4LY7 A;  5J2M A;  4DU4 A;  3OVN A;  3PX4 A;  1G15 A;  4LSN A;  1FK9 A;  1C6V A;  4C8O A;  2DFE A;  5HRO A;  4H8K A;  4N56 A;  4FLZ A;  3OYM A;  3ZSZ A;  1HNI A;  1RNH A;  2D0C A;  1WSE A;  2OPP A;  2RKI A;  1S6Q A;  4KTW A;  4DQI A;  3SQ1 A;  4ZHR A;  4B9N A;  4F8R A;  4B9T A;  4KHY A;  2P51 A;  3CFP A;  3V9U A;  2LSN A;  3NF7 A;  4AHT A;  3D0P A;  4EP5 A;  3JSM A;  1SUQ A;  3O3F A;  3L2R A;  1EP4 A;  3CQ8 A;  4BE1 A;  4KTQ A;  1TAU A;  3SNN A;  4BDP A;  4FVM A;  4CFA A;  3CG7 A;  4JRP A;  1ZBH A;  2KFZ A;  4CEB A;  5HRP A;  3RTV A;  5HP1 A;  1IKY A;  4CEO A;  2G8W A;  3K57 A;  5C24 A;  4F2S A;  4O0I A;  1NK0 A;  1SKR A;  2XY6 A;  4B9M A;  4IDK A;  1FKO A;  1TKZ A;  3CM6 A;  1A5W A;  1L3U A;  4CGJ A;  3WNF A;  3NH2 A;  1TKT A;  2DY4 A;  1JLB A;  5HRS A;  1KCF A;  4FJJ A;  3QIO A;  4CK2 A;  5FRM A;  4CF0 A;  4DTU A;  2BDP A;  1Y97 A;  2YNI A;  3IRX A;  1TKD A;  4E7I A;  3V1R A;  3MAQ A;  4DG1 A;  2PYJ A;  4HUF A;  1WNS A;  1C0T A;  4YFU A;  3SJJ A;  3KTQ A;  4DFJ A;  1SL2 A;  3NF9 A;  3M8R A;  3CM5 A;  3LWM A;  1NKC A;  1D9F A;  3SQ0 A;  4O4G A;  3V9X A;  2PY5 A;  3DMJ A;  3ISN C;  1RDC A;  2IS3 A;  3QIN A;  2A1S A;  2X6S A;  1L3T A;  3ZT0 A;  3K5L A;  3SPY A;  4KI4 A;  4Z4E A;  2HMI A;  1S1W A;  1KTQ A;  4BE0 A;  3L3V A;  4IFY A;  4FXD A;  3KIO A;  3VQ8 A;  5KGX A;  5HLF A;  3CFO A;  1S9E A;  1TAQ A;  1T03 A;  4N76 A;  4FLX A;  1KFS A;  1BQN A;  1ASV A;  3L3U A;  4IG3 A;  4OPK A;  3VQQ A;  3F73 A;  2X6N A;  3I0S A;  1HJR A;  4I2P A;  1RBT A;  4FLT A;  3RR8 A;  2QKB A;  2ETJ A;  3QEP A;  3DI6 A;  3DYA A;  1KLM A;  2B5J A;  3E01 A;  4FW1 A;  3NDK A;  4DLG A;  3KD1 E;  4KPY A;  4NCA A;  4RW8 A;  4PUO A;  4PA1 A;  4Z0U A;  3OYC A;  3LDS A;  3NGY A;  4K8X A;  1WSG A;  3MEC A;  1QS4 A;  4CEZ A;  4NYF A;  2OPS A;  4C8M A;  3HT3 A;  3LZI A;  1JL2 A;  4CJT A;  4C8K A;  3OYB A;  4C8N A;  1JLF A;  4KRF A;  1SL1 A;  1BGX T;  3KKS A;  4M41 A;  2X78 A;  1EKE A;  3KLF A;  2OZM A;  2OZS A;  3M8Q A;  3UIQ A;  3VQA A;  3HVR A;  1I3A A;  1XC9 A;  4MFB A;  4DFM A;  4DSK A;  3AA2 A;  3SPZ A;  1NKE A;  3QLH A;  4TSX A;  3RRG A;  1BIZ A;  2QXF A;  1RTD A;  4B9U A;  1U45 A;  1TK0 A;  4C8L A;  1JLC A;  4AHU A;  2G8H A;  3PY8 A;  4DTM A;  4CGH A;  3MED A;  3HK2 A;  1BCM A;  4ICL A;  4HUG A;  4RG8 A;  3SZ2 A;  1DTQ A;  3BGR A;  1GOC A;  2OPQ A;  3C95 A;  5E41 A;  1VSK A;  3TAQ A;  2P5O A;  3TAM A;  4ID1 A;  4CFD A;  3D45 A;  1QSY A;  3HXM A;  4RW4 A;  4HCB A;  5DMR A;  4Q0B A;  3KLE A;  4FM2 A;  1NJX A;  3NAE A;  1TGO A;  4I2Q A;  3PX6 A;  2HVH A;  1BCO A;  4CF1 A;  3S9H A;  1YTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...