4CF0A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf0A00
4FLZA 1TKZA 4IDKA 4AHUA 2AJQA 3AVKA 3HPHA 1S1TA 1Q9YA 3NH1A 4IKFA 3ZT4A 3V9ZA 1X9SA 4JLHA 4DSIA 3I0SA 1RBUA 4CFCA 4FLXA 4DSJA 2E4LA 3WNGA 1IKVA 2IAJA 4EP4A 3IRXA 2ETJA 4DLEA 4QCLA 4N41A 1LW0A 2KW4A 1S6QA 3KLFA 2G8UA 4CGDA 3K5MA 4E1NA 3OYLA 5CZ1A 4DTJA 2ITGA 3V6DA 2PYJA 4E89A 4CJUA 2XY7A 4KHQA 4FLWA 3MXIA 4OJRA 4K8ZA 3PV8A 4NCBA 1IKYA 2BE2A 1LWFA 1JLFA 3AV9A 2VWKA 3KLIA 4ICLA 4W5TA 1TKDA 1WLJA 4BE2A 1C0MA 3SPYA 1ZBFA 3V1QA 4CF0A 4HUGA 4RW7A 1S9EA 1HPZA 2RN2A 4KFBA 1CXQA 3VQDA 2XRIA 3SV4A 4DS5A 3QEXA 1XI1A 1TK0A 3SUNA 4FYDA 1MU2A 3PX4A 4E7KA 4CIEA 4DU4A 3BDPA 4NCGA 2IDOA 3QNNA 1SL0A 1CXUA 2YKMA 2A1RA 1RT4A 3L2RA 5DMRA 1VSJA 2HHVA 3L2QA 1ZBIA 2OZMA 4BDPA 4B8CA 4HVJA 2YNGA 5J2PA 3AVIA 4N47A 1L3SA 3KK3A 5HRSA 3O4NA 3NHGA 3TR8A 3TARA 1RNHA 2P1JA 1VSEA 1VSKA 4ELVA 1RDBA 5CYMA 3MAQA 4CGJA 1IKWA 4ID5A 2FBYA 4DFPA 3JYTA 1VSHA 4OKEA 5KI6A 3OYIA 3AA2A 3C6TA 4RG8A 1JLQA 1RDCA 1WN7A 4YFUA 4DFMA 4AILC 2Z1IA 3OYKA 4BACA 1HMVA 3LZJA 4DF4A 5T7BA 3NH0A 3OYMA 4KHWA 3AA3A 3VA3A 3EYZA 3QLHA 4CFBA 4KB1A 2HHUA 3V9SA 4OLBA 3LPTA 4N56A 1K6YA 1Y97A 3CYMA 1NJWA 1TL1A 2G8WA 4OKKA 3LP0A 3VQ5A 1UA0A 4F4KA 4CK3A 4KV8A 2KQ2A 3SPZA 2ZQBA 3ZT2A 4IFYA 3RRGA 4DTPA 4HUEA 1RT3A 1BQNA 2XY6A 4EZ9A 4OVLA 4CEDA 1JL2A 1CLQA 4RW6A 4JS5A 4H8KA 3OVNA 3SUOA 1C1CA 1RT2A 4FJHA 1LAVA 1VSMA 3QIPA 1C6VA 1GOBA 1W9HA 4R5PA 4W5QA 3OYCA 3CFOA 3HP6A 3TAMA 1KRPA 3L3UA 2OZSA 4M3UA 4FJ5A 1RT1A 2X74A 4F8RA 1B92A 4PUOA 1ZYQA 4W5NA 3HL8A 2IS3A 4KTWA 3SUPA 1NK5A 2W42A 3KK1A 2Y1IA 4CFAA 3NDKA 1VK0A 3F9KA 4DWIA 3H08A 3HP9A 4CGGA 5CY4A 4BE0A 5J1EA 2QK9A 1TVRA 4B9TA 2Q3SA 1NJXA 5I3UA 4O5BA 1EP4A 1NK6A 1RILA 2EX3A 3G10A 3QO9A 3MECA 3L2VA 3AVNA 1QE1A 4FCYA 5CYQA 2YNIA 2VG6A 4FJNA 1VSIA 4Z4CA 3OJUA 1RT6A 4CIFA 4J2DA 1RBRA 3ISNC 2X6NA 2VG7A 1T03A 1BISA 3AVCA 2HHQA 3C6UA 3NH2A 2IGIA 3EY1A 3CG7A 1A5VA 4KAZA 3HJFA 1JXBA 4CEFA 3KKSA 3VQEA 4CECA 5FRMA 1KLMA 1EKEA 4OPKA 3DLHA 4Z4EA 4N76A 3KD5E 4CF9A 1HNIA 3SV3A 3MXMA 4B8AB 4QOZB 3NF7A 3DLGA 3O3FA 3SI6A 1RDDA 3HT3A 1VRTA 2EHGA 1RT5A 3P5JA 2HNDA 4AHRA 4CGIA 4PQUA 2O4IA 4M3WA 1RBVA 2D0BA 3U3YA 3VQ8A 3ZT3A 3K58A 2HB5A 5FRNA 3TAFA 3I0RA 3QNOA 4DTXA 4CK1A 3AA4A 3DI6A 3O3GA 1QHTA 2P5GA 1S6PA 4E0DA 4FJLA 1T8EA 1U47A 1T05A 4WE1A 3S9HA 3M8QA 4OGCA 1HQEA 3PX6A 1KFDA 4F3OA 1L3UA 3SQ0A 4CFDA 2BDPA 3HPGA 3OYFA 1JL1A 1LAWA 4BDZA 1VSLA 2OYQA 3ZT1A 4CHPA 1U04A 4LSLA 4AH9A 3AO5A 1L3VA 1WAFA 2VG5A 3L2WA 1ASWA 1WSGA 3QINA 3OYEA 1F21A 4FLTA 1S9GA 1BI4A 4DSEA 2B4JA 4FZZA 5C24A 4RW9A 3SQ2A 3NF9A 2D0CA 4HHTA 2X78A 3TWHA 4DTSA 4CEZA 1JLAA 3VQCA 3K57A 4CJ4A 3OYGA 1X1PA 2IC3A 1EETA 3IS9A 4DTRA 1U48A 2KFNA 4M3TA 1TK8A 1QQCA 5HBMA 3QERA 5D3GA 3HVRA 3NGIA 3ZSQA 1J53A 1JKHA 1R0AA 3CFPA 1C1AA 2ATQA 4DU1A 3DRPA 1SKWA 4CJPA 1XWLA 1D5AA 2Z1JA 3AVMA 1TGOA 5KGXA 1ZBLA 1X9MA 3IG1A 4KO0A 3LWMA 3SUQA 1NKCA 2OA8A 1HYZA 1QSYA 4MFBA 3B6OA 4FK2A 2RF2A 4NYNA 4UQGA 1QSSA 5C42A 4DSLA 4KB0A 4J2AA 2ZD1A 4CEAA 1W0HA 4FM0A 3QESA 3KLHA 4Y1CA 1NJZA 3RR7A 3PO4A 4FJXA 2F8TA 2HVHA 1DTQA 4I2PA 4DU3A 1LV5A 4F3TA 4Z4FA 3LAMA 3QEWA 3T1AA 3MEEA 3G0ZA 4IBNA 3AVLA 3VQQA 3TI0A 1HRHA 1QSLA 4KREA 3C95A 5E41A 1Q9XA 2PY5A 3KLGA 1LWCA 5K14A 4LH4A 2KZMA 4DQRA 2B6AA 4DG1A 4CJKA 1HJRA 4CGFA 1HYVA 1U45A 2YNFA 3ZT0A 2WONA 3NF8A 3ZSVA 4C8KA 4F2SA 4C8OA 1ITGA 3LP2A 1L3TA 3LALA 1EX4A 1RDAA 5SZTA 4FZXC 1KLNA 1YTAA 4M45A 3QETA 4ELUA 1TAUA 4BDYA 3LDSA 4CHOA 1BIUA 3U6FA 3OY9A 1KFSA 3ZSWA 4ZHRA 1IKXA 1S1UA 3ZSZA 3V9UA 4KKOA 3CM5A 3VQ6A 3WNFA 4DLGA 3C94A 4CEEA 2F8SA 3KTQA 1ASUA 3NGZA 1NK0A 3KIOA 3HXMA 1U4BA 3DOKA 1UAXA 3RTVA 1NK4A 3RR8A 2FBXA 2BANA 3AVAA 3LANA 1ZBUA 1S1WA 4CJFA 3K5LA 2Y1JA 2G8IA 4Q0BA 3TANA 2JGUA 2YHAA 4E19A 1WAJA 3QEPA 3HSTB 5JS2A 1QTMA 4F2RA 3VQAA 1IO2A 2YV0X 4OPJA 2HHSA 2DTUA 1FK9A 4C8LA 1YT3A 3M8SA 3AA5X 2O4GA 4K8XA 3ALYA 3DLRA 3VN5A 4I9QA 5C25A 1VSDA 3L3VA 3LPUA 3HVTA 2XHBA 3S3NA 3LWLA 3JSMA 1XHZA 3OYDA 4QAGA 2FBVA 4CJEA 3NE6A 1REVA 2A1SA 1KVBA 3LP1A 4HTUA 1FXXA 4FLUA 2RKIA 2KZZA 3DOLA 3A2FA 3AVGA 3VQBA 3HPOA 4DF8A 1VRUA 2GUIA 3U3GA 3UIQA 2HNZA 2DFEA 4GVMA 3QIOA 3MXJA 1TV6A 4FJGA 3ZSRA 4FW2A 4AHVA 2OPPA 4KTZA 3VQ4A 3B6PA 1N5YA 4JRQA 3V81A 3AVBA 3OS1A 2QXFA 4CF1A 3VQPA 4BE1A 3T3FA 1L5UA 1JXEA 4Z4HA 4FJMA 5HP1A 4DTOA 4CJTA 4H4MA 3RRHA 1D9DA 3D45A 1RTDA 3EZ5A 1IH7A 1UWBA 4E7LA 4CHZA 5KTQA 1T7PA 4B08A 2HHXA 1S1VA 2HHTA 2QKBA 1B9FA 4CF2A 4E7JA 4FK0A 4Q5VA 3ZSXA 3F73A 4FLVA 3OS0A 2PZSA 4CJLA 4OLAA 4KI6A 4LD0A 4CJ3A 5J2MA 3TAGA 3ITHA 5HLFA 1XHXA 4E3SA 3DLEA 1WSJA 1NK8A 1YVUA 2I5JA 4E7IA 4M3XA 4B9UA 5DK5A 2HVIA 2G8HA 4NCAA 3ULDA 1FKPA 4MQ3A 4KHNA 3CQ8A 4FJKA 3DRRA 2ZE2A 4TSXA 3ZCMA 1U49A 2GBZA 2VWJA 2GV9A 4CJWA 4FM1A 1D8YA 4M3ZA 1BHLA 1JLCA 1LW2A 1C0UA 3KLEA 1BQMA 3T19A 4DTUA 3PX0A 4FZYA 5FDLA 4BWMA 2JLEA 2KTQA 2LSNA 3P83D 3LZIA 1BCOA 3DRSA 4W5OA 3RMBA 4LY7A 3E01A 1VSFA 3HM9A 2DFFA 2XY5A 2HNYA 4FJ7A 4CJSA 4KHSA 2FBTA 4E7HA 1SKRA 1RT7A 1RBTA 4FJJA 4B9NA 3AVJA 1GOAA 4M41A 3P1GA 1S1XA 3O3HA 3V1OA 3RMDA 2E6LA 4KHYA 1TKTA 5FROA 1SUQA 3SJJA 4YNQA 1J9AA 1WSIA 3OYAA 3TAEA 1SKSA 1D9FA 2YHBA 2PYLA 4KTQA 4J2EA 4CHYA 4Z4IA 1JLGA 2D0AA 1WSEA 3D0PA 3NF6A 1FKOA 4G1QA 1NJYA 1YTUA 2YKNA 4RW8A 3SNNA 1HQUA 4GMJB 1UOCA 4EP5A 4JS4A 4PA1A 4Z0UA 3TAQA 4KHUA 2B5JA 2OPQA 1WSHA 1A5XA 3AO4A 1LWEA 3WNHA 3RMAA 2WOMA 4N5SA 4J2BA 3QEVA 1CZ9A 4M42A 3M8RA 1N6QA 3V1RA 4DQPA 3PUFA 1G15A 3K2PA 3K5OA 4OKJA 3KJVA 4CHQA 4O44A 1ZBHA 1KTQA 4B9VA 4W5RA 2DY4A 2BGGA 1C1BA 4FVMA 4AHCA 4CJQA 4I2QA 3I8DA 4PWDA 2IOCA 4ZTFA 3PO5A 3CM6A 1S5JA 4GW6A 4OGEA 4H4OA 4CE9A 1NOYA 3M8PA 5JS1A 2D5RA 4BWJA 3V4IA 4FJ8A 3OYNA 1DTTA 4CK2A 1A5WA 3PY8A 1Z25A 4LH5A 2XO7A 4DSFA 4ZTJA 1BL3A 2OPRA 1NOZA 3AVFA 4AHTA 4DS4A 1TL3A 3L2UA 3S3MA 4B9MA 2HW3A 4I7FA 4DMNA 1RCHA 4EZ6A 2G8FA 4FK4A 4KI4A 3TABA 1BGXT 4IG3A 4CIGA 1KCFA 2Z1HA 2XY8A 2R7YA 4DQSA 1RTIA 1O1WA 1JLBA 5EU7A 3HO1A 4CF8A 4Z4GA 4CEBA 4E1MA 4JRPA 3SYZA 3NBPA 1TK5A 4HCCA 3K5NA 3KD1E 3NFAA 4DSKA 2F96A 3NCIA 3NAEA 1KVCA 3BGRA 4DFJA 4ELTA 4IFVA 2NUBA 4RW4A 4Y1DA 4C8NA 1KSPA 3FFIA 4M3RA 3AO1A 4B9LA 3OJSA 1B9DA 1BCMA 1BIZA 3WNEA 5HROA 1RTHA 4CCHA 4HUFA 4I9LA 3IAYA 2P51A 4FJIA 4FM2A 3HYFA 3KKRA 4IG0A 3K59A 4O4GA 4DQQA 5KRTA 4DFKA 4HCBA 3LAKA 4O0JA 3TAPA 1EXQA 1I39A 4CEQA 5HRPA 1SL1A 1NKEA 5HRNA 4B9SA 4DTMA 2FC0A 3ZSOA 4O55A 5HRRA 4O0IA 4XIUA 3LP3A 3SCXA 4CEOA 1SL2A 4CGHA 3HK2A 3MEDA 4ID1A 1NK7A 1QS4A 1NKBA 1J5OA 1RTJA 3OS2A 3VQ7A 4CESA 1DLOA 1UA1A 2QKKA 3MEGA 4PY5A 3DMJA 1GOCA 3DLKA 3NGYA 4CJVA 1IG9A 4CJ5A 5SWMA 3AO3A 4CHNA 4LSNA 3AVHA 4C8MA 3DYAA 3KK2A 1X9WA 5J2NA 3AO2A 3ASMA 3SQ4A 1C0TA 4FXDA 2OPSA 3CFRA 2G8KA 5CZ2A 3ZSYA 1XC9A 3OYBA 4CERA 3V9WA 2DFHA 2G8VA 1BI4B 2Z1GA 3VQ9A 4DQIA 1JLEA 2HMIA 1J54A 3SZ2A 1Q8IA 1NK9A 3VA0A 5KGWA 1KVAA 1WNSA 3V9XA 4FJ9A 2KFZA 1I3AA 1WSFA 1ASVA 5KRSA 4AHSA 1TKXA 3RWUA 4KPYA 4B3OA 4FW1A 5I42A 3DM2A 3OYHA 2E6MA 4FLYA 3THVA 4L8RB 1TAQA 3O4QA 2RPIA 1HNVA 3DLBA 3SQ1A 4M3YA 1CZBA 3S3OA 1RBSA 2YNHA 4CJRA 3OYJA 3QEIA 1Z26A 3L8BA 4KRFA 2HHWA 5J2QA 1HYSA 1SV5A 3RMCA 4DTNA 2X6SA 2P5OA 4NYFA
chains in the Genus database with same CATH superfamily
3AVKA 1S1TA 1VQMN 1X9SA 3I0SA 1U6ZA 2IAJA 4FO0A 3IRXA 2ETJA 3SMSA 2UUBK 2QXLA 3KLFA 2XY7A 4BR2A 3GOIA 1N8RO 3MXIA 2VQEK 3PV8A 1IKYA 3ULEA 3AV9A 4ICLA 2P9PB 4W5TA 1TKDA 4CF0A 4HUGA 1HPZA 4DS5A 3PIOL 3QEXA 4WQ5C 1NBWA 2YKMA 2GX9A 4HVJA 4BRGA 3KK3A 5HRSA 1L3SA 3O4NA 5DM6L 3NHGA 2YI1A 2A3ZA 1RDBA 3MAQA 4K0KK 4DFPA 2FBYA 1J5EK 3JYTA 4OKEA 1KXPA 3P38A 5AQGA 3C6TA 4YFUA 1RDCA 1WN7A 3G71N 3OYKA 1HMVA 3I55N 4C1NK 1DT9A 2IIRA 4CZMA 3VA3A 3EYZA 4CFBA 2HHUA 3VGLA 1NGHA 1TL1A 3VQ5A 3NMUA 2IVOA 1BWFO 4CK3A 2KQ2A 3RRGA 1BQNA 1JL2A 1VQ8N 1RT2A 2JWLA 1RFQA 3LDLA 4IJAA 2X74A 4PUOA 3HL8A 2IS3A 3ZETB 4KTWA 1NK5A 3WQUA 3NDKA 4JI6K 3PSIA 3BF3A 4WQ5A 5CYQA 3T7ZA 3KZBA 4Z4CA 4CIFA 1GLAG 4J2DA 1T03A 2X6NA 1W2BM 3TTCA 3NH2A 1KLMA 5AR0A 4Z4EA 1HNIA 3NF7A 1RDDA 1VRTA 2EHGA 1RT5A 3O9SA 3P5JA 4YDUC 4NB4A 4H0PA 3MN9A 2D0BA 3VQ8A 1SAZA 3K58A 5BPMA 3ZX3A 3K9JA 4CK1A 3DI6A 4FWRA 1QHTA 2Q31A 2CGKA 4BGBA 1HQEA 3HPGA 5FPMA 1VSLA 5ADXH 4CHPA 1U04A 3AO5A 3FR0A 4Z94A 4DR5K 1WAFA 5AQUA 4FLTA 4MLEA 1BI4A 4BY9C 2B4JA 3CF5L 3TWHA 3L4IA 2KHOA 1NGJA 1EETA 1K8KB 2W41A 2Q0UA 2I7PA 5AQNA 1TK8A 5FLXO 1GLEG 2ZWHA 2D4WA 4DU1A 3IUCA 1SKWA 3O1BA 1ZBLA 2AP1A 2OA8A 1RDUA 1HYZA 1NWKA 4MFBA 1NGEA 3R9PA 4U7BA 3VENA 4NYNA 4UQGA 5CR4A 4IZ9A 4CEAA 1W0HA 3QESA 4Y1CA 2F8TA 4FJXA 1DTQA 4F3TA 4Z4FA 3LAMA 1NGCA 3T1AA 3VQQA 3UB5A 3H3OB 3C95A 2P9UB 3KLGA 2E2QA 3SMPA 4JKEA 4DG1A 2GEMA 1HYVA 5BN9A 2YNFA 2WONA 4C8KA 3SAHA 3VEWA 4F2SA 3LP2A 1L3TA 1EX4A 1RDAA 5SZTA 4FZXC 3PSFA 3QETA 2QWMA 4CHOA 3U6FA 1XMOK 4NLCA 4ZHRA 1Q81O 4KKOA 3CM5A 3VQ6A 3WNFA 3KTQA 3K0SA 1ASUA 1EQYA 4GNIA 1UAXA 3RTVA 1NK4A 4H03B 2BANA 1IV0A 3AVAA 4H5NA 5M1PA 2G8IA 1C0GA 4GV3A 3TANA 4Q0BA 4YOYA 2BH1A 4E19A 5GINA 4M63C 3HSTB 4OPJA 2HHSA 3AA5X 3PIPL 3BF1A 4A57A 3ALYA 5C25A 4KH4A 3LWLA 2NRXA 4CJEA 1YAGA 4HTUA 1R59O 1RDWX 4FLUA 2KZZA 3BEXA 3AVGA 3MDQA 4DV0K 3UIQA 3U3GA 1U2VB 3ZSRA 4FW2A 4JRQA 3V81A 2QXFA 4CF1A 3THWB 4DUYK 1L5UA 4XH4A 3CJBA 5HP1A 3RVCA 4CJTA 1D9DA 3ZYYX 1RTDA 4CHZA 5KTQA 1T7PA 3VTIA 2RHKA 1MWKA 1QQMA 3I8BA 2HHTA 3CHWA 4E7JA 4FK0A 3ZSXA 4BC4A 2PZSA 1GLDG 4H0VB 2P9PA 1NJIO 5GAGP 4WQ4A 1OKJA 1WSJA 1P8ZA 4B9UA 3KK7A 4JI4K 4NCAA 3ULDA 4DR4K 1FKPA 3SBTA 3CQ8A 2H3GX 4FJKA 4B3RK 3DRRA 3ZCMA 4CJWA 1D8YA 3KLEA 3HRGA 2KTQA 3P83D 3RMBA 1NM1A 3OBWA 4E7HA 3UKRA 4B9NA 2QWQA 3CI5A 1VQKN 3KVGA 1S1XA 3VF4A 3V1OA 4LF7K 1VQ6N 4YOWA 1WSIA 4KTQA 1SKSA 2YHBA 4JKHA 3K9KA 1JLGA 2D0AA 1NJYA 4RW8A 5M1OA 3VF6A 4GMJB 1UOCA 4M7XA 4EP5A 4JS4A 5M1NA 4PA1A 2OPQA 1WSHA 3WNHA 3RMAA 3A8YA 4H5VA 3QEVA 4E1JA 2HMPA 3H1VX 3R6MA 3V1RA 3PUFA 4CHQA 4JHDB 2QWPA 3I8DA 3CERA 2IOCA 3CM6A 1S5JA 1TUYA 5GADP 3M8PA 4CJ7A 4BWJA 3V4IA 4FJ8A 3VOVA 1DTTA 2OCEA 4C1NI 1A5WA 1Z25A 2UYTA 4DSFA 1YHQN 2OPRA 3ATUA 5FPEA 1TL3A 2CGLA 2HW3A 4I7FA 2Z1HA 3TTDA 5AQQA 1JLBA 3LDQA 4HTLA 4I6MB 3CCVN 3C65A 4X64K 4CZLA 1HNXK 2F96A 4X66K 4B1ZA 4ELTA 4RW4A 4K25A 3FFIA 2ZF5O 1B9DA 1BCMA 5AQSA 4CVNE 4DV1K 3ZLJA 4CCHA 3TSUA 4IG0A 4DFKA 4HCBA 4C23A 5F1XA 4O0JA 2P9KA 2O8BA 1SL1A 3ENOA 5HRNA 1SL2A 4CEOA 3HK2A 3MEDA 1V4SA 2ZM6K 1NKBA 3D2EB 5AFUH 3O6WA 3OS2A 1N32K 4M7YA 3DLKA 3NGYA 4CJVA 4CJ5A 3R8EA 4CHNA 5BN8A 1QVGM 4C8MA 5C2FA 4EHTA 1M90O 4FSVA 2G8KA 5CZ2A 3G4SN 1XC9A 3V9WA 1BI4B 3VQ9A 1JLEA 1J54A 3SZ2A 1I3AA 5KRSA 4AHSA 3DM2A 4WFAL 3W0LA 3TSPA 3VF2A 3THVA 4BR5A 4L8RB 3SQ1A 2QEXN 3S3OA 4V19S 4CJRA 1Z26A 3SAFA 2HHWA 4JHDA 3RMCA 2A6AA 4DTNA 3CETA 2O8CA 4DKWA 2F9TA 5AQPA 3HPHA 1Q9YA 3NH1A 4LFBK 1TYQA 1RBUA 2CH6A 4BGAA 4DSJA 3FZKA 1SZ2A 2A42A 1IKVA 1NGAA 1NNEA 4DLEA 2KW4A 2G8UA 1S6QA 4E1NA 4FVUA 3OYLA 2ITGA 2W40A 4KHQA 5LJVA 3FZLA 2P9SB 1MDUB 4ISGA 2BE2A 3U4LA 4DQ8A 1DGKN 4CBWA 3IMXA 3IKMA 3KLIA 5M1FA 2HBLA 4BE2A 1T6DA 1ZBFA 4XEIA 5GIPA 3J8AA 3TTFA 2XRIA 1XI1A 2P9NA 2O8EA 1MU2A 3PX4A 1VQLN 4CIEA 4DU4A 3O9UA 3QNNA 2A1RA 3L2RA 4I6MA 1VSJA 1ZBIA 2OZMA 4B8CA 2YNGA 3TR8A 3UKUA 1VSEA 4CGJA 1IKWA 4ID5A 3J7YP 3EEQA 5KI6A 3OYIA 4G9ZA 1WUAA 4AILC 4H0OA 4ISEA 4IEIA 4ILHA 3P4IA 3VEZA 4BACA 2OTJN 4DF4A 5T7BA 2FSJA 3BZKA 4KHWA 3AA3A 4RCHA 5AQTA 4CI6A 4N56A 2VYPA 1Y97A 3CYMA 1NJWA 2VGNA 2G8WA 4OKKA 2QWNA 3LP0A 1UA0A 4MO5A 3VEOA 4F4KA 5TKYA 1RT3A 2XY6A 4H8KA 3OVNA 1C1CA 3KWGA 2NRZA 1VSMA 1VQ4N 3CFOA 3G6EN 3EZWA 3H46O 3MN6A 2OZSA 3LM9A 4BG9A 4FJ5A 1RT1A 2BTFA 4W5NA 1B92A 5AQYA 2Y1IA 1VK0A 1EWQA 3F9KA 3H08A 3HP9A 4CGGA 4JK7A 4BE0A 5BR9A 1NJXA 5I3UA 4O5BA 2D1KA 1NK6A 3CD6N 3QO9A 1QE1A 1YJ9N 2VG6A 1VSIA 2YJEA 5C15A 1RBRA 4GY2B 5GAEP 1BISA 2BUPA 2F7TA 3C6UA 3EY1A 2IGIA 4CZIA 3CG7A 5A2QO 3HJFA 3HBTA 4BVPA 3VQEA 4CECA 2HF4A 1Z05A 4OPKA 4JI1K 3ZETA 4N76A 3WT0A 1P90A 5I9EB 4QOZB 4FWLA 2HNDA 4AHRA 1X9JA 3W3DA 2HB5A 5FRNA 3I0RA 4YORA 4GV9A 1T3VA 2P5GA 2AA4A 3DXMB 4WE1A 2J4RA 3AARA 4FWMA 3S9HA 4OGCA 1KFDA 2I7NA 4F3OA 1KAYA 3SQ0A 4BVOA 4O5FA 3UE5A 4EFHA 4AH9A 1L3VA 2VG5A 1QQOA 5IWAK 3L2WA 3OYEA 3FFKB 3U8XA 3SQ2A 4RW9A 3CJ7A 2X78A 3HOTA 4FPBA 1BA0A 4KHPK 2NNWA 3K57A 3IS9A 4DTRA 2IVNA 3U9DA 5D3GA 2HBJA 4FWQA 3CQXA 3CFPA 1D5AA 4FWNA 5KGXA 1HLUA 1ZC6A 3ID8A 1QSYA 2ASPA 1QSSA 5C42A 4DSLA 3CPWM 4FM0A 2NRTA 1BO5O 4I2PA 3HZ6A 4DV7K 3AVLA 3EKSA 1QSLA 1ZBSA 4KREA 4LH4A 2KZMA 4CJKA 4H0TB 3ZT0A 3NF8A 3ZSVA 3M3ZA 4GV6A 1E4FT 3D2FA 3LALA 4PKGA 3MMVA 4JI0K 5LJWA 4KBOA 1YTAA 3THWA 1KLNA 2NRHA 1HR0K 3ULEB 2ZJRL 3LDSA 3TU5A 3THYA 3FZMA 4B3MK 1KD1O 3JS6A 4BROA 1S1UA 1GLLO 2HHQA 3MCPA 4DLGA 4PL7A 3C94A 3C6AA 3NGZA 5AQFA 3ZEUB 3KIOA 1X3NA 3DOKA 3RR8A 1IJJA 2Q0RA 3LANA 4DHYA 4NLBA 2YHAA 3O4WA 1QTMA 3VQAA 3WXMB 2YV0X 2DTUA 1Q86O 3M8SA 2O4GA 2P9NB 4I9QA 3LPUA 3HVTA 4GVEA 3S3NA 3JSMA 4A5BA 4LC9B 4LF5K 4QAGA 2FBVA 3NE6A 3MWPA 3DOLA 3A2FA 4FWPA 3VQBA 3JAMO 4EHUA 2HNZA 3O5BA 4KTZA 1FW6A 1N5YA 4IFEA 3AVBA 4BE1A 4JD2B 4Z4HA 4FJMA 2D0OA 3CXCM 4ILGB 4CBXA 4E7LA 1UWBA 4HWIA 5M1QA 4H5WA 4B08A 1T44A 4BRLA 3CC2N 2HHXA 1HJOA 2Q1NA 4JKDA 2QKBA 4FLVA 3OS0A 4KI6A 3N4PA 4PL8A 2QI2A 3KWIA 1NK8A 1NGBA 4MQ3A 3WQTA 1U49A 2VWJA 4BR4A 3PX0A 1BQMA 2JLEA 2LSNA 3DRSA 4W5OA 1LCUA 4B1WB 1VSFA 3HM9A 2DFFA 2XY5A 2HNYA 4LF6K 4KHSA 3B8AX 3AVJA 4CZKA 4JKFA 5JVHL 2E6LA 5FROA 1QZ6A 2YX6A 4YY3K 3SJJA 1D9FA 3DXMA 3L6QA 3D0PA 1FKOA 4G1QA 3WXIA 3LM2A 1HQUA 4X62K 3AO4A 1NGIA 1CZ9A 4JEPA 3M8RA 3CC4N 3K5OA 2QWLA 4O44A 3WXLA 3A5NC 4W5RA 2BGGA 4CJQA 3OHRA 4ZTFA 1ATNA 4EAHD 4GW6A 1YF5L 4OGEA 4H4OA 1NOYA 5JS1A 5E84A 4KH6A 4CK2A 3QICA 4LH5A 4DS4A 1KAZA 4DMNA 4EZ6A 4FK4A 4KI4A 1BGXT 4IG3A 5EY4A 4CIGA 3DXKA 1KCFA 1QVFM 3QFPA 3WXJA 2R7YA 1RTIA 3QB0A 3HO1A 4JD2A 4CF8A 3VGKA 4JRPA 1XQSC 3D6RA 4HCCA 3K5NA 3KD1E 2YHYA 4FOIA 3NCIA 1KVCA 3BGRA 1GLFO 1KSPA 3AO1A 2V7ZA 4FOEA 2NZTA 4DV6K 2F9WA 3IAYA 3HYFA 5ELZA 5KRTA 5M1KA 5JLFA 3THYB 1EXQA 5AQMA 5HRPA 4B9SA 4O55A 4CGHA 1DLOA 2QKKA 3E66A 3MEGA 4LSNA 3KK2A 1X9WA 4MDAA 5J2NA 3ASMA 3ID6A 4FXDA 2OPSA 3ZSYA 3OYBA 4CERA 3I56N 2VCPA 3IFRA 3R3LA 1RGIA 3BZCA 1QHAA 3VPZA 5KGWA 1KVAA 2KFZA 2O8BB 3RWUA 4KPYA 4B3OA 4FW1A 3TSQA 5I42A 4MDBA 3OYHA 4FLYA 3O4QA 5F2RA 1HNVA 3FE1A 5AQWA 2NRWA 4BR7A 3QEIA 4DV4K 3S41A 5J2QA 2P9UA 2GELA 2X6SA 1HPMA 4NYFA 4IDKA 4AHUA 2AJQA 4BRCA 2W6LA 3ZT4A 3MK6A 3IDHA 4JLHA 4BC5A 4DSIA 4CFCA 3AGRA 5TKWA 2GUPA 4N41A 1LW0A 5CHIA 4CGDA 3K5MA 3EE8A 3AY9A 3V6DA 3UKUB 5KPZA 1E4GT 4E89A 4CJUA 1VQPN 4OJRA 3CCRN 4K8ZA 1NMNA 1LWFA 1JLFA 1OH8A 4YHHK 4DR7K 2VWKA 1WLJA 3O9TA 4CZFA 3OA9A 3VEVA 3SPYA 4RW7A 1S9EA 2RN2A 1CXQA 3SV4A 1ZXOA 1NGDA 4BREA 4IOCL 1SL0A 1Q7YO 1RT4A 5DMRA 1GLCG 3L2QA 2HHVA 5J2PA 4IO9L 2VGMA 2OTLN 3ATVA 4FWKA 3NVKA 3RSEB 1RNHA 3TARA 4ELVA 2A41A 3NVMA 3DJCA 3AA2A 3GDQA 1DEJA 1JLQA 3CCQN 2Z1IA 1BG3A 4YOTA 3LZJA 3NH0A 2E1YA 5LL6Z 3OYMA 4H0XB 1NG9A 3QLHA 1TUUA 4JKGB 4KB1A 3V9SA 4OLBA 1K6YA 3L4QA 4KV8A 2P9IB 2ZQBA 4IFYA 4EZ9A 4J8FA 4CEDA 4JS5A 1D4XA 3CJ9A 4FJHA 1VQNN 1LAVA 1C6VA 1GOBA 1KRPA 3L3UA 4M3UA 3SK3A 3SUPA 4B1YB 1XUPO 4LF4K 3QFUA 3QMLA 4DWIA 4PKIA 1NLVA 5CY4A 1K8AO 5J1EA 4YOUA 4B9TA 2Q3SA 3M1FA 5JMVA 2EX3A 3MECA 1N33K 4FCYA 2HHHK 5C0YA 2VG7A 1OH5A 5BPLA 1JXBA 1OVYA 5AZJB 5FRMA 4A59A 3CMEN 2FXUA 3DLHA 4CF9A 1IBMK 3MXMA 4B8AB 2NRVA 3DLGA 3HT3A 4BRIA 4RWTA 5AZIB 3F2KA 3TAFA 1S6PA 4FJLA 1T8EA 1EWRA 1NGFA 3M8QA 2GWKA 1LOTB 3LDNA 2FF6A 4JAXA 4IOXA 2ITMA 3OYFA 1JL1A 1LAWA 4BDZA 3G25A 2OYQA 4LSLA 1ASWA 3T1YK 5C24A 3NF9A 2D0CA 4HHTA 4DTSA 2O8DB 4CEZA 2E2NA 2NRRA 5FPDA 4CJ4A 1X1PA 2IC3A 2KFNA 4BR9A 2WC9A 3RSEA 3O9QA 4JI7K 1QQCA 3BP8A 3HVRA 3ZSQA 4O8KA 2WTUA 1R0AA 1JKHA 1WOQA 2ATQA 1HKBA 3DRPA 4CJPA 1XWLA 2Z1JA 3AVMA 5LMNK 1TGOA 1X9MA 1VQ5N 3LWMA 3B6OA 4WF9L 4FK2A 2RF2A 1EO1A 4MLHA 4KB0A 3HM8A 2RE2A 2ZD1A 3KLHA 1NJZA 3PO4A 4JKGA 2GWJA 3LDPA 4H5RA 1LV5A 1XNRK 3QEWA 3TI0A 3G0ZA 3LL3A 3CJAA 5HOOA 2PY5A 5E41A 1Q9XA 3GBTA 2B6AA 3M6GA 4B9QA 1KAXA 4C8OA 1ITGA 4DV3K 4M45A 4AQYK 1TAUA 4BDYA 3R1XA 1BU6O 3VEYA 2P9KB 3A0IX 3JXUA 3OY9A 1KFSA 1IKXA 3E1YA 2YJFA 1ZBUA 1S1WA 4CJFA 3K5LA 2UXBK 3SLCA 1WAJA 3AGKA 4F2RA 1IO2A 2WFBA 3MWTA 4C8LA 1YT3A 1ATRA 3DLRA 3CCSN 2KKZA 1VSDA 3L3VA 1KQSM 3OYDA 4BRFA 2CGJA 3DLLL 1REVA 2A1SA 1VQ9N 3LP1A 1FXXA 3HTVA 4GKKK 2P9IA 2RKIA 3HPOA 1VRUA 2DFEA 4GVMA 3QIOA 1HX1A 3MXJA 1TV6A 4FJGA 2E88A 1ESVA 1YI2N 3OS1A 2YHWA 2WBNA 3A5OC 3T3FA 1JXEA 4DTOA 4F9OA 4H4MA 5LY3A 3D45A 4MO4A 4WQ4C 3EZ5A 1IH7A 1K8KA 1MA9B 2ASMA 2O8EB 3D2EA 1YIJN 4CF2A 4Q5VA 4LD0A 4CJ3A 5J2MA 3TAGA 5HLFA 1XHXA 1SS6A 3DLEA 3U9ZA 5BREA 1K9MO 2I5JA 4H0YB 3H1QA 4M3XA 5DK5A 1S72N 4CZGA 2ZE2A 5EOYA 2GV9A 3N4QA 4FM1A 4M3ZA 1JLCA 1BHLA 1LW2A 4DTUA 4FZYA 3T19A 2UXDK 5FDLA 4BWMA 4CZJA 3E01A 3E9PA 2P9LA 4CJSA 3CJ1A 4FJJA 4JI2K 3FZFA 1GOAA 1W97L 3P1GA 2VQFK 4JI5K 3O3HA 3VERA 4KHYA 1TKTA 5BPNA 1SUQA 4YNQA 1J9AA 5KPTA 4J2EA 1WSEA 1YTUA 3NF6A 2YKNA 3ENHA 4CW7B 4KHUA 4Z0UA 4DV2K 1TYQB 2WOMA 5BRHA 4J2BA 4M42A 3E9LA 5CE3A 1HNWK 4A2BA 5AQZA 3CCUN 1YJWN 2O8DA 3KJVA 1KTQA 4B9VA 3P39A 4IO8A 1C1BA 3WXKA 4IDHA 4CE9A 4BRPA 3DAWA 3F5TA 3OYNA 5AQJA 2DPNA 3D7EO 2XO7A 4ILJA 4AHTA 1NOZA 3S3MA 1WB9A 1RCHA 3PLAA 3TABA 2XY8A 4XH5A 4BG8A 1XC3A 4DQSA 4LFAK 4YOVA 4H5TA 5EU7A 3A5MC 4E1MA 4Z4GA 1TK5A 3O1WA 4DSKA 3NAEA 4DFJA 3J80O 4FWOA 2NUBA 4Y1DA 4C8NA 4BRQA 4B9LA 3OJSA 1BIZA 1U2VA 3WNEA 1RTHA 2UUAK 4HUFA 4I9LA 2P51A 4FJIA 2ZGYA 3KKRA 2V52B 4JK8A 3K59A 2EWSA 3C7NA 3CPEA 3VEXA 3M5RA 4GKJK 4CEQA 5GAHP 4A61A 2FC0A 3ZX2A 3SCXA 4O0IA 3LP3A 1NK7A 4ID1A 1WBBA 3SBGA 1QS4A 1RTJA 3VQ7A 3DMJA 1GOCA 4DUZK 3DYAA 3SQ4A 1C0TA 1IG8A 3CFRA 3ZEUA 3KHYA 4K41A 2HF3A 1NK9A 1S3XA 3H45C 3V9XA 1WSFA 1ASVA 1BUPA 5IT9O 4OPAA 2E1ZA 4X65K 4LFCK 4M3YA 2YNHA 3OYJA 3SAGA 3E9OA 4IXCA 3L8BA 4K43A 1HYSA 3AAQA 1YJNN 3OYCA 1VAZA 5JLHA 4FLZA 3J7ZO 1TKZA 2P9SA 3GL1A 4IKFA 3V9ZA 1JJ2M 3THXA 3VETA 4FLXA 2E4LA 3P31A 3WNGA 4EP4A 3MN5A 4QCLA 1JCGA 4QS7A 4DTJA 5CZ1A 2PYJA 2HBMA 4WFBL 4FLWA 4NXMK 4AF1A 1Q18A 3CCJN 1ATSA 4NCBA 3T69A 3VESA 3EN9A 1G99A 2CH5A 3HSCA 4WCEL 4OPHA 2JWKA 1Y64A 4BRNA 1C0MA 4DR1K 3V1QA 4JI3K 4KFBA 3VQDA 2P9LB 4FYDA 1TK0A 3SUNA 2QW9A 4E7KA 3BDPA 4NCGA 4K42A 4YDUA 5KPRA 2IDOA 3OTOK 1CXUA 4BDPA 5AQXA 1YUWA 3AVIA 4N47A 3VGMA 3GE1A 5LMUK 3HI0A 2P1JA 1GLJO 1VSKA 4JK9A 3CCEN 5CYMA 2FF3B 1VSHA 3CMAN 4RG8A 5EX5A 4DFMA 2A40A 1W7AA 1O13A 2FSNA 1VHXA 5EXWA 3UKRB 4DR6K 4JYAK 2PBDA 4BC2A 1YXQA 4AM6A 1N34K 5AZJA 3LPTA 5C12A 3EL2A 2QA4N 3SPZA 4Y0WA 2HBKA 3ZT2A 4DTPA 4HUEA 4OVLA 1CLQA 2UUCK 4RW6A 3SUOA 3QIPA 4R5PA 1W9HA 5ADXA 4W5QA 3HP6A 3TAMA 2A5XA 3CQYA 3I33A 4F8RA 4U67L 1ZYQA 4JN4A 4DR3K 2O8FA 4FWSA 2W42A 3EE9A 3KK1A 3ZX0A 4CFAA 5DM7L 1K73O 3C6HA 2QK9A 1TVRA 1IBLK 3WUHA 4CBUA 1EP4A 1RILA 3G10A 3L2VA 3AVNA 3L0QA 4BRKA 2YNIA 4FJNA 5BRDA 3OJUA 1RT6A 1MWMA 3A5LC 3ISNC 3AVCA 4BQLA 1A5VA 4KAZA 3J7AP 2O8CB 4CEFA 5FPNA 3KKSA 3CCLN 3GG4A 3OW2M 1EKEA 3KD5E 4JKCA 3SV3A 3O3FA 3SI6A 1QZ5A 2O4IA 4CGIA 4PQUA 5AJ3K 4M3WA 1RBVA 3U3YA 3ZT3A 3QNOA 2QWRA 4DTXA 4JI8K 3AA4A 3O3GA 3HOSA 3FLCO 4E0DA 1U47A 1T6CA 1T05A 3C7NB 4JKAA 1S22A 4BC3A 3PX6A 2UU9K 1L3UA 2V51B 2ZGZA 3OBYA 4CFDA 3WEEB 2BDPA 5JICA 3ZT1A 3DXKB 3QINA 1WSGA 3VTHA 4A5AA 1F21A 1KC8O 1S9GA 4DSEA 4FZZA 2V7YA 1JLAA 1VQ7N 3VQCA 3MCAB 3OYGA 2VWBA 4IJNA 1U48A 3WEEA 4M3TA 1QQNA 5HBMA 3QERA 3NGIA 1J53A 1C1AA 1NKCA 3IG1A 4KO0A 4BRHA 3SUQA 1HNZK 4J2AA 1BOTO 4BRDA 2HVHA 3RR7A 4R79A 4DU3A 3MEEA 4IBNA 4LF9K 3BY5A 1HRHA 4WYBA 5C2DA 1E3MA 1LWCA 5K14A 3AAPA 4DQRA 1HJRA 4CGFA 1OVQA 4CD1A 1U45A 1JCEA 2OANA 1Z6RA 1OH6A 4B1XB 4ELUA 3ENBA 3THXB 1ILYA 2IVPA 2HOEA 1BIUA 3ZSWA 3V9UA 1SKRA 4DF8A 3ZSZA 2GTDA 2E8AA 2F8SA 4NO7A 4CEEA 2F4VK 1NK0A 1U4BA 3HXMA 2Q36A 2FBXA 3CJCA 4A2AA 2Y1JA 2NLXA 3DWLA 2JGUA 3QEPA 1SQKA 5JS2A 2YCHA 4CZHA 1IBKK 1FK9A 3EO3A 4K8XA 4B3TK 3VN5A 5B8HA 4BRMA 2XHBA 4AM7A 1XHZA 4FL9A 3MX2A 5BR8K 4L3QA 2W6KA 1KVBA 1V4TA 4IEEA 4BRAA 3O08A 2GUIA 4AHVA 2OPPA 3VQ4A 2FSKA 3B6PA 5AQVA 4ISFA 4JKBA 3VQPA 4DR2K 3BUZB 1H1VA 5C10A 2O8FB 3RRHA 1HKGA 2QTDA 1YITN 5AQRA 1XMQK 1S1VA 1JCFA 1B9FA 4OX9K 5GIOA 3F73A 1BA1A 4OLAA 4CJLA 4B1VA 3ITHA 3CCMN 4E3SA 1YVUA 4E7IA 4RTFD 4IWVA 3EKUA 5KQDA 5HL7L 3SJHA 2E5LK 2HVIA 2G8HA 5AQHA 4QS8A 4KHNA 3J81O 2E2PA 4TSXA 4BQZA 2GBZA 1NMDA 1C0UA 1BDGA 2WUSA 3H6EA 4PKHA 3LZIA 1BCOA 3O80A 4UY8O 4LY7A 4FJ7A 2FBTA 4PHTX 1RT7A 1RBTA 1I94K 4M41A 3O9RA 3MN7A 2HSTA 3RMDA 1OH7A 2QWOA 3VMFB 3TPQA 3O8MA 5KQ8A 1J6ZA 4KH5A 3OYAA 3TAEA 2PYLA 5AQKA 4Z4IA 1FJGK 4CHYA 2YHXA 3SNNA 3QDKA 4B1UB 2KLAA 3TAQA 2B5JA 5AZIA 1A5XA 1LWEA 2Q97A 4N5SA 2ZJQL 4DCHA 3D2FB 1N6QA 4DQPA 1G15A 3K2PA 4OKJA 3CIPA 2ZJPL 1NU0A 3C0BA 1ZBHA 4CZEA 2DY4A 3F9MA 4FVMA 4AHCA 4PWDA 4I2QA 1N36K 3PO5A 4JNEA 5F0XA 2QM1A 2D5RA 5EVZA 5AQIA 2E20A 5AQOA 3PY8A 4ZTJA 1BL3A 1C0FA 3AVFA 4B9MA 3L2UA 3QBWA 2PAVA 2G8FA 3H3NO 4LF8K 1YVNA 2D0PA 1O1WA 4CEBA 3SYZA 3NBPA 4CD3A 3QBXA 5E26A 1X3MA 3CC7N 3NFAA 2E2OA 1WBDA 4IFVA 4NXNK 3Q7BA 4M3RA 4DB3A 1XNQK 4A62A 5HROA 3Q7CA 1M1KO 4FM2A 4O8UA 4O4GA 4DQQA 3LAKA 4B3SK 5AQLA 3TAPA 1I39A 2PFUA 4IOAL 1NKEA 4BR0A 4DTMA 1DKGD 3ZSOA 5HRRA 2Q2RA 4XIUA 1J5OA 5AFUA 4CESA 4WFNL 5JVGL 1UA1A 4PY5A 1IG9A 5MLCQ 5SWMA 3AO3A 1CZAN 3AVHA 5H1SQ 3AO2A 1Q82O 2ASOA 4OO1J 2UXCK 2G8VA 2DFHA 2Z1GA 4DQIA 2HMIA 1VQON 1GLBG 1Q8IA 3T1HK 3VA0A 3LDOA 4FPAA 1WNSA 4FJ9A 1TKXA 1NGGA 2E6MA 4JV5K 4XH1A 4YOXA 1TAQA 3FGUA 3MX5A 2RPIA 3DLBA 1CZBA 1HUXA 1HKCA 1RBSA 5BRFA 4QS9A 4KRFA 2FLOA 3FZHA 1SV5A 2P5OA 4EIAA 4DV5K
chains in the Genus database with same CATH topology
4FLZA 1TKZA 4IDKA 4AHUA 2AJQA 3AVKA 3HPHA 1S1TA 1Q9YA 3NH1A 4IKFA 3ZT4A 3V9ZA 1X9SA 4JLHA 4DSIA 3I0SA 1RBUA 4CFCA 4FLXA 4DSJA 2E4LA 3WNGA 1IKVA 2IAJA 4EP4A 3IRXA 2ETJA 4DLEA 4QCLA 4N41A 1LW0A 2KW4A 1S6QA 3KLFA 2G8UA 4CGDA 3K5MA 4E1NA 3OYLA 5CZ1A 4DTJA 2ITGA 3V6DA 2PYJA 4E89A 4CJUA 2XY7A 4KHQA 4FLWA 3MXIA 4OJRA 4K8ZA 3PV8A 4NCBA 1IKYA 2BE2A 1LWFA 1JLFA 3AV9A 2VWKA 3KLIA 4ICLA 4W5TA 1TKDA 1WLJA 4BE2A 1C0MA 3SPYA 1ZBFA 3V1QA 4CF0A 4HUGA 4RW7A 1S9EA 1HPZA 2RN2A 4KFBA 1CXQA 3VQDA 2XRIA 3SV4A 4DS5A 3QEXA 1XI1A 1TK0A 3SUNA 4FYDA 1MU2A 3PX4A 4E7KA 4CIEA 4DU4A 3BDPA 4NCGA 2IDOA 3QNNA 1SL0A 1CXUA 2YKMA 2A1RA 1RT4A 3L2RA 5DMRA 1VSJA 2HHVA 3L2QA 1ZBIA 2OZMA 4BDPA 4B8CA 4HVJA 2YNGA 5J2PA 3AVIA 4N47A 1L3SA 3KK3A 5HRSA 3O4NA 3NHGA 3TR8A 3TARA 1RNHA 2P1JA 1VSEA 1VSKA 4ELVA 1RDBA 5CYMA 3MAQA 4CGJA 1IKWA 4ID5A 2FBYA 4DFPA 3JYTA 1VSHA 4OKEA 5KI6A 3OYIA 3AA2A 3C6TA 4RG8A 1JLQA 1RDCA 1WN7A 4YFUA 4DFMA 4AILC 2Z1IA 3OYKA 4BACA 1HMVA 3LZJA 4DF4A 5T7BA 3NH0A 3OYMA 4KHWA 3AA3A 3VA3A 3EYZA 3QLHA 4CFBA 4KB1A 2HHUA 3V9SA 4OLBA 3LPTA 4N56A 1K6YA 1Y97A 3CYMA 1NJWA 1TL1A 2G8WA 4OKKA 3LP0A 3VQ5A 1UA0A 4F4KA 4CK3A 4KV8A 2KQ2A 3SPZA 2ZQBA 3ZT2A 4IFYA 3RRGA 4DTPA 4HUEA 1RT3A 1BQNA 2XY6A 4EZ9A 4OVLA 4CEDA 1JL2A 1CLQA 4RW6A 4JS5A 4H8KA 3OVNA 3SUOA 1C1CA 1RT2A 4FJHA 1LAVA 1VSMA 3QIPA 1C6VA 1GOBA 1W9HA 4R5PA 4W5QA 3OYCA 3CFOA 3HP6A 3TAMA 1KRPA 3L3UA 2OZSA 4M3UA 4FJ5A 1RT1A 2X74A 4F8RA 1B92A 4PUOA 1ZYQA 4W5NA 3HL8A 2IS3A 4KTWA 3SUPA 1NK5A 2W42A 3KK1A 2Y1IA 4CFAA 3NDKA 1VK0A 3F9KA 4DWIA 3H08A 3HP9A 4CGGA 5CY4A 4BE0A 5J1EA 2QK9A 1TVRA 4B9TA 2Q3SA 1NJXA 5I3UA 4O5BA 1EP4A 1NK6A 1RILA 2EX3A 3G10A 3QO9A 3MECA 3L2VA 3AVNA 1QE1A 4FCYA 5CYQA 2YNIA 2VG6A 4FJNA 1VSIA 4Z4CA 3OJUA 1RT6A 4CIFA 4J2DA 1RBRA 3ISNC 2X6NA 2VG7A 1T03A 1BISA 3AVCA 2HHQA 3C6UA 3NH2A 2IGIA 3EY1A 3CG7A 1A5VA 4KAZA 3HJFA 1JXBA 4CEFA 3KKSA 3VQEA 4CECA 5FRMA 1KLMA 1EKEA 4OPKA 3DLHA 4Z4EA 4N76A 3KD5E 4CF9A 1HNIA 3SV3A 3MXMA 4B8AB 4QOZB 3NF7A 3DLGA 3O3FA 3SI6A 1RDDA 3HT3A 1VRTA 2EHGA 1RT5A 3P5JA 2HNDA 4AHRA 4CGIA 4PQUA 2O4IA 4M3WA 1RBVA 2D0BA 3U3YA 3VQ8A 3ZT3A 3K58A 2HB5A 5FRNA 3TAFA 3I0RA 3QNOA 4DTXA 4CK1A 3AA4A 3DI6A 3O3GA 1QHTA 2P5GA 1S6PA 4E0DA 4FJLA 1T8EA 1U47A 1T05A 4WE1A 3S9HA 3M8QA 4OGCA 1HQEA 3PX6A 1KFDA 4F3OA 1L3UA 3SQ0A 4CFDA 2BDPA 3HPGA 3OYFA 1JL1A 1LAWA 4BDZA 1VSLA 2OYQA 3ZT1A 4CHPA 1U04A 4LSLA 4AH9A 3AO5A 1L3VA 1WAFA 2VG5A 3L2WA 1ASWA 1WSGA 3QINA 3OYEA 1F21A 4FLTA 1S9GA 1BI4A 4DSEA 2B4JA 4FZZA 5C24A 4RW9A 3SQ2A 3NF9A 2D0CA 4HHTA 2X78A 3TWHA 4DTSA 4CEZA 1JLAA 3VQCA 3K57A 4CJ4A 3OYGA 1X1PA 2IC3A 1EETA 3IS9A 4DTRA 1U48A 2KFNA 4M3TA 1TK8A 1QQCA 5HBMA 3QERA 5D3GA 3HVRA 3NGIA 3ZSQA 1J53A 1JKHA 1R0AA 3CFPA 1C1AA 2ATQA 4DU1A 3DRPA 1SKWA 4CJPA 1XWLA 1D5AA 2Z1JA 3AVMA 1TGOA 5KGXA 1ZBLA 1X9MA 3IG1A 4KO0A 3LWMA 3SUQA 1NKCA 2OA8A 1HYZA 1QSYA 4MFBA 3B6OA 4FK2A 2RF2A 4NYNA 4UQGA 1QSSA 5C42A 4DSLA 4KB0A 4J2AA 2ZD1A 4CEAA 1W0HA 4FM0A 3QESA 3KLHA 4Y1CA 1NJZA 3RR7A 3PO4A 4FJXA 2F8TA 2HVHA 1DTQA 4I2PA 4DU3A 1LV5A 4F3TA 4Z4FA 3LAMA 3QEWA 3T1AA 3MEEA 3G0ZA 4IBNA 3AVLA 3VQQA 3TI0A 1HRHA 1QSLA 4KREA 3C95A 5E41A 1Q9XA 2PY5A 3KLGA 1LWCA 5K14A 4LH4A 2KZMA 4DQRA 2B6AA 4DG1A 4CJKA 1HJRA 4CGFA 1HYVA 1U45A 2YNFA 3ZT0A 2WONA 3NF8A 3ZSVA 4C8KA 4F2SA 4C8OA 1ITGA 3LP2A 1L3TA 3LALA 1EX4A 1RDAA 5SZTA 4FZXC 1KLNA 1YTAA 4M45A 3QETA 4ELUA 1TAUA 4BDYA 3LDSA 4CHOA 1BIUA 3U6FA 3OY9A 1KFSA 3ZSWA 4ZHRA 1IKXA 1S1UA 3ZSZA 3V9UA 4KKOA 3CM5A 3VQ6A 3WNFA 4DLGA 3C94A 4CEEA 2F8SA 3KTQA 1ASUA 3NGZA 1NK0A 3KIOA 3HXMA 1U4BA 3DOKA 1UAXA 3RTVA 1NK4A 3RR8A 2FBXA 2BANA 3AVAA 3LANA 1ZBUA 1S1WA 4CJFA 3K5LA 2Y1JA 2G8IA 4Q0BA 3TANA 2JGUA 2YHAA 4E19A 1WAJA 3QEPA 3HSTB 5JS2A 1QTMA 4F2RA 3VQAA 1IO2A 2YV0X 4OPJA 2HHSA 2DTUA 1FK9A 4C8LA 1YT3A 3M8SA 3AA5X 2O4GA 4K8XA 3ALYA 3DLRA 3VN5A 4I9QA 5C25A 1VSDA 3L3VA 3LPUA 3HVTA 2XHBA 3S3NA 3LWLA 3JSMA 1XHZA 3OYDA 4QAGA 2FBVA 4CJEA 3NE6A 1REVA 2A1SA 1KVBA 3LP1A 4HTUA 1FXXA 4FLUA 2RKIA 2KZZA 3DOLA 3A2FA 3AVGA 3VQBA 3HPOA 4DF8A 1VRUA 2GUIA 3U3GA 3UIQA 2HNZA 2DFEA 4GVMA 3QIOA 3MXJA 1TV6A 4FJGA 3ZSRA 4FW2A 4AHVA 2OPPA 4KTZA 3VQ4A 3B6PA 1N5YA 4JRQA 3V81A 3AVBA 3OS1A 2QXFA 4CF1A 3VQPA 4BE1A 3T3FA 1L5UA 1JXEA 4Z4HA 4FJMA 5HP1A 4DTOA 4CJTA 4H4MA 3RRHA 1D9DA 3D45A 1RTDA 3EZ5A 1IH7A 1UWBA 4E7LA 4CHZA 5KTQA 1T7PA 4B08A 2HHXA 1S1VA 2HHTA 2QKBA 1B9FA 4CF2A 4E7JA 4FK0A 4Q5VA 3ZSXA 3F73A 4FLVA 3OS0A 2PZSA 4CJLA 4OLAA 4KI6A 4LD0A 4CJ3A 5J2MA 3TAGA 3ITHA 5HLFA 1XHXA 4E3SA 3DLEA 1WSJA 1NK8A 1YVUA 2I5JA 4E7IA 4M3XA 4B9UA 5DK5A 2HVIA 2G8HA 4NCAA 3ULDA 1FKPA 4MQ3A 4KHNA 3CQ8A 4FJKA 3DRRA 2ZE2A 4TSXA 3ZCMA 1U49A 2GBZA 2VWJA 2GV9A 4CJWA 4FM1A 1D8YA 4M3ZA 1BHLA 1JLCA 1LW2A 1C0UA 3KLEA 1BQMA 3T19A 4DTUA 3PX0A 4FZYA 5FDLA 4BWMA 2JLEA 2KTQA 2LSNA 3P83D 3LZIA 1BCOA 3DRSA 4W5OA 3RMBA 4LY7A 3E01A 1VSFA 3HM9A 2DFFA 2XY5A 2HNYA 4FJ7A 4CJSA 4KHSA 2FBTA 4E7HA 1SKRA 1RT7A 1RBTA 4FJJA 4B9NA 3AVJA 1GOAA 4M41A 3P1GA 1S1XA 3O3HA 3V1OA 3RMDA 2E6LA 4KHYA 1TKTA 5FROA 1SUQA 3SJJA 4YNQA 1J9AA 1WSIA 3OYAA 3TAEA 1SKSA 1D9FA 2YHBA 2PYLA 4KTQA 4J2EA 4CHYA 4Z4IA 1JLGA 2D0AA 1WSEA 3D0PA 3NF6A 1FKOA 4G1QA 1NJYA 1YTUA 2YKNA 4RW8A 3SNNA 1HQUA 4GMJB 1UOCA 4EP5A 4JS4A 4PA1A 4Z0UA 3TAQA 4KHUA 2B5JA 2OPQA 1WSHA 1A5XA 3AO4A 1LWEA 3WNHA 3RMAA 2WOMA 4N5SA 4J2BA 3QEVA 1CZ9A 4M42A 3M8RA 1N6QA 3V1RA 4DQPA 3PUFA 1G15A 3K2PA 3K5OA 4OKJA 3KJVA 4CHQA 4O44A 1ZBHA 1KTQA 4B9VA 4W5RA 2DY4A 2BGGA 1C1BA 4FVMA 4AHCA 4CJQA 4I2QA 3I8DA 4PWDA 2IOCA 4ZTFA 3PO5A 3CM6A 1S5JA 4GW6A 4OGEA 4H4OA 4CE9A 1NOYA 3M8PA 5JS1A 2D5RA 4BWJA 3V4IA 4FJ8A 3OYNA 1DTTA 4CK2A 1A5WA 3PY8A 1Z25A 4LH5A 2XO7A 4DSFA 4ZTJA 1BL3A 2OPRA 1NOZA 3AVFA 4AHTA 4DS4A 1TL3A 3L2UA 3S3MA 4B9MA 2HW3A 4I7FA 4DMNA 1RCHA 4EZ6A 2G8FA 4FK4A 4KI4A 3TABA 1BGXT 4IG3A 4CIGA 1KCFA 2Z1HA 2XY8A 2R7YA 4DQSA 1RTIA 1O1WA 1JLBA 5EU7A 3HO1A 4CF8A 4Z4GA 4CEBA 4E1MA 4JRPA 3SYZA 3NBPA 1TK5A 4HCCA 3K5NA 3KD1E 3NFAA 4DSKA 2F96A 3NCIA 3NAEA 1KVCA 3BGRA 4DFJA 4ELTA 4IFVA 2NUBA 4RW4A 4Y1DA 4C8NA 1KSPA 3FFIA 4M3RA 3AO1A 4B9LA 3OJSA 1B9DA 1BCMA 1BIZA 3WNEA 5HROA 1RTHA 4CCHA 4HUFA 4I9LA 3IAYA 2P51A 4FJIA 4FM2A 3HYFA 3KKRA 4IG0A 3K59A 4O4GA 4DQQA 5KRTA 4DFKA 4HCBA 3LAKA 4O0JA 3TAPA 1EXQA 1I39A 4CEQA 5HRPA 1SL1A 1NKEA 5HRNA 4B9SA 4DTMA 2FC0A 3ZSOA 4O55A 5HRRA 4O0IA 4XIUA 3LP3A 3SCXA 4CEOA 1SL2A 4CGHA 3HK2A 3MEDA 4ID1A 1NK7A 1QS4A 1NKBA 1J5OA 1RTJA 3OS2A 3VQ7A 4CESA 1DLOA 1UA1A 2QKKA 3MEGA 4PY5A 3DMJA 1GOCA 3DLKA 3NGYA 4CJVA 1IG9A 4CJ5A 5SWMA 3AO3A 4CHNA 4LSNA 3AVHA 4C8MA 3DYAA 3KK2A 1X9WA 5J2NA 3AO2A 3ASMA 3SQ4A 1C0TA 4FXDA 2OPSA 3CFRA 2G8KA 5CZ2A 3ZSYA 1XC9A 3OYBA 4CERA 3V9WA 2DFHA 2G8VA 1BI4B 2Z1GA 3VQ9A 4DQIA 1JLEA 2HMIA 1J54A 3SZ2A 1Q8IA 1NK9A 3VA0A 5KGWA 1KVAA 1WNSA 3V9XA 4FJ9A 2KFZA 1I3AA 1WSFA 1ASVA 5KRSA 4AHSA 1TKXA 3RWUA 4KPYA 4B3OA 4FW1A 5I42A 3DM2A 3OYHA 2E6MA 4FLYA 3THVA 4L8RB 1TAQA 3O4QA 2RPIA 1HNVA 3DLBA 3SQ1A 4M3YA 1CZBA 3S3OA 1RBSA 2YNHA 4CJRA 3OYJA 3QEIA 1Z26A 3L8BA 4KRFA 2HHWA 5J2QA 1HYSA 1SV5A 3RMCA 4DTNA 2X6SA 2P5OA 4NYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLZ A;  1TKZ A;  4IDK A;  4AHU A;  2AJQ A;  3AVK A;  3HPH A;  1S1T A;  1Q9Y A;  3NH1 A;  4IKF A;  3ZT4 A;  3V9Z A;  1X9S A;  4JLH A;  4DSI A;  3I0S A;  1RBU A;  4CFC A;  4FLX A;  4DSJ A;  2E4L A;  3WNG A;  1IKV A;  2IAJ A;  4EP4 A;  3IRX A;  2ETJ A;  4DLE A;  4QCL A;  4N41 A;  1LW0 A;  2KW4 A;  1S6Q A;  3KLF A;  2G8U A;  4CGD A;  3K5M A;  4E1N A;  3OYL A;  5CZ1 A;  4DTJ A;  2ITG A;  3V6D A;  2PYJ A;  4E89 A;  4CJU A;  2XY7 A;  4KHQ A;  4FLW A;  3MXI A;  4OJR A;  4K8Z A;  3PV8 A;  4NCB A;  1IKY A;  2BE2 A;  1LWF A;  1JLF A;  3AV9 A;  2VWK A;  3KLI A;  4ICL A;  4W5T A;  1TKD A;  1WLJ A;  4BE2 A;  1C0M A;  3SPY A;  1ZBF A;  3V1Q A;  4CF0 A;  4HUG A;  4RW7 A;  1S9E A;  1HPZ A;  2RN2 A;  4KFB A;  1CXQ A;  3VQD A;  2XRI A;  3SV4 A;  4DS5 A;  3QEX A;  1XI1 A;  1TK0 A;  3SUN A;  4FYD A;  1MU2 A;  3PX4 A;  4E7K A;  4CIE A;  4DU4 A;  3BDP A;  4NCG A;  2IDO A;  3QNN A;  1SL0 A;  1CXU A;  2YKM A;  2A1R A;  1RT4 A;  3L2R A;  5DMR A;  1VSJ A;  2HHV A;  3L2Q A;  1ZBI A;  2OZM A;  4BDP A;  4B8C A;  4HVJ A;  2YNG A;  5J2P A;  3AVI A;  4N47 A;  1L3S A;  3KK3 A;  5HRS A;  3O4N A;  3NHG A;  3TR8 A;  3TAR A;  1RNH A;  2P1J A;  1VSE A;  1VSK A;  4ELV A;  1RDB A;  5CYM A;  3MAQ A;  4CGJ A;  1IKW A;  4ID5 A;  2FBY A;  4DFP A;  3JYT A;  1VSH A;  4OKE A;  5KI6 A;  3OYI A;  3AA2 A;  3C6T A;  4RG8 A;  1JLQ A;  1RDC A;  1WN7 A;  4YFU A;  4DFM A;  4AIL C;  2Z1I A;  3OYK A;  4BAC A;  1HMV A;  3LZJ A;  4DF4 A;  5T7B A;  3NH0 A;  3OYM A;  4KHW A;  3AA3 A;  3VA3 A;  3EYZ A;  3QLH A;  4CFB A;  4KB1 A;  2HHU A;  3V9S A;  4OLB A;  3LPT A;  4N56 A;  1K6Y A;  1Y97 A;  3CYM A;  1NJW A;  1TL1 A;  2G8W A;  4OKK A;  3LP0 A;  3VQ5 A;  1UA0 A;  4F4K A;  4CK3 A;  4KV8 A;  2KQ2 A;  3SPZ A;  2ZQB A;  3ZT2 A;  4IFY A;  3RRG A;  4DTP A;  4HUE A;  1RT3 A;  1BQN A;  2XY6 A;  4EZ9 A;  4OVL A;  4CED A;  1JL2 A;  1CLQ A;  4RW6 A;  4JS5 A;  4H8K A;  3OVN A;  3SUO A;  1C1C A;  1RT2 A;  4FJH A;  1LAV A;  1VSM A;  3QIP A;  1C6V A;  1GOB A;  1W9H A;  4R5P A;  4W5Q A;  3OYC A;  3CFO A;  3HP6 A;  3TAM A;  1KRP A;  3L3U A;  2OZS A;  4M3U A;  4FJ5 A;  1RT1 A;  2X74 A;  4F8R A;  1B92 A;  4PUO A;  1ZYQ A;  4W5N A;  3HL8 A;  2IS3 A;  4KTW A;  3SUP A;  1NK5 A;  2W42 A;  3KK1 A;  2Y1I A;  4CFA A;  3NDK A;  1VK0 A;  3F9K A;  4DWI A;  3H08 A;  3HP9 A;  4CGG A;  5CY4 A;  4BE0 A;  5J1E A;  2QK9 A;  1TVR A;  4B9T A;  2Q3S A;  1NJX A;  5I3U A;  4O5B A;  1EP4 A;  1NK6 A;  1RIL A;  2EX3 A;  3G10 A;  3QO9 A;  3MEC A;  3L2V A;  3AVN A;  1QE1 A;  4FCY A;  5CYQ A;  2YNI A;  2VG6 A;  4FJN A;  1VSI A;  4Z4C A;  3OJU A;  1RT6 A;  4CIF A;  4J2D A;  1RBR A;  3ISN C;  2X6N A;  2VG7 A;  1T03 A;  1BIS A;  3AVC A;  2HHQ A;  3C6U A;  3NH2 A;  2IGI A;  3EY1 A;  3CG7 A;  1A5V A;  4KAZ A;  3HJF A;  1JXB A;  4CEF A;  3KKS A;  3VQE A;  4CEC A;  5FRM A;  1KLM A;  1EKE A;  4OPK A;  3DLH A;  4Z4E A;  4N76 A;  3KD5 E;  4CF9 A;  1HNI A;  3SV3 A;  3MXM A;  4B8A B;  4QOZ B;  3NF7 A;  3DLG A;  3O3F A;  3SI6 A;  1RDD A;  3HT3 A;  1VRT A;  2EHG A;  1RT5 A;  3P5J A;  2HND A;  4AHR A;  4CGI A;  4PQU A;  2O4I A;  4M3W A;  1RBV A;  2D0B A;  3U3Y A;  3VQ8 A;  3ZT3 A;  3K58 A;  2HB5 A;  5FRN A;  3TAF A;  3I0R A;  3QNO A;  4DTX A;  4CK1 A;  3AA4 A;  3DI6 A;  3O3G A;  1QHT A;  2P5G A;  1S6P A;  4E0D A;  4FJL A;  1T8E A;  1U47 A;  1T05 A;  4WE1 A;  3S9H A;  3M8Q A;  4OGC A;  1HQE A;  3PX6 A;  1KFD A;  4F3O A;  1L3U A;  3SQ0 A;  4CFD A;  2BDP A;  3HPG A;  3OYF A;  1JL1 A;  1LAW A;  4BDZ A;  1VSL A;  2OYQ A;  3ZT1 A;  4CHP A;  1U04 A;  4LSL A;  4AH9 A;  3AO5 A;  1L3V A;  1WAF A;  2VG5 A;  3L2W A;  1ASW A;  1WSG A;  3QIN A;  3OYE A;  1F21 A;  4FLT A;  1S9G A;  1BI4 A;  4DSE A;  2B4J A;  4FZZ A;  5C24 A;  4RW9 A;  3SQ2 A;  3NF9 A;  2D0C A;  4HHT A;  2X78 A;  3TWH A;  4DTS A;  4CEZ A;  1JLA A;  3VQC A;  3K57 A;  4CJ4 A;  3OYG A;  1X1P A;  2IC3 A;  1EET A;  3IS9 A;  4DTR A;  1U48 A;  2KFN A;  4M3T A;  1TK8 A;  1QQC A;  5HBM A;  3QER A;  5D3G A;  3HVR A;  3NGI A;  3ZSQ A;  1J53 A;  1JKH A;  1R0A A;  3CFP A;  1C1A A;  2ATQ A;  4DU1 A;  3DRP A;  1SKW A;  4CJP A;  1XWL A;  1D5A A;  2Z1J A;  3AVM A;  1TGO A;  5KGX A;  1ZBL A;  1X9M A;  3IG1 A;  4KO0 A;  3LWM A;  3SUQ A;  1NKC A;  2OA8 A;  1HYZ A;  1QSY A;  4MFB A;  3B6O A;  4FK2 A;  2RF2 A;  4NYN A;  4UQG A;  1QSS A;  5C42 A;  4DSL A;  4KB0 A;  4J2A A;  2ZD1 A;  4CEA A;  1W0H A;  4FM0 A;  3QES A;  3KLH A;  4Y1C A;  1NJZ A;  3RR7 A;  3PO4 A;  4FJX A;  2F8T A;  2HVH A;  1DTQ A;  4I2P A;  4DU3 A;  1LV5 A;  4F3T A;  4Z4F A;  3LAM A;  3QEW A;  3T1A A;  3MEE A;  3G0Z A;  4IBN A;  3AVL A;  3VQQ A;  3TI0 A;  1HRH A;  1QSL A;  4KRE A;  3C95 A;  5E41 A;  1Q9X A;  2PY5 A;  3KLG A;  1LWC A;  5K14 A;  4LH4 A;  2KZM A;  4DQR A;  2B6A A;  4DG1 A;  4CJK A;  1HJR A;  4CGF A;  1HYV A;  1U45 A;  2YNF A;  3ZT0 A;  2WON A;  3NF8 A;  3ZSV A;  4C8K A;  4F2S A;  4C8O A;  1ITG A;  3LP2 A;  1L3T A;  3LAL A;  1EX4 A;  1RDA A;  5SZT A;  4FZX C;  1KLN A;  1YTA A;  4M45 A;  3QET A;  4ELU A;  1TAU A;  4BDY A;  3LDS A;  4CHO A;  1BIU A;  3U6F A;  3OY9 A;  1KFS A;  3ZSW A;  4ZHR A;  1IKX A;  1S1U A;  3ZSZ A;  3V9U A;  4KKO A;  3CM5 A;  3VQ6 A;  3WNF A;  4DLG A;  3C94 A;  4CEE A;  2F8S A;  3KTQ A;  1ASU A;  3NGZ A;  1NK0 A;  3KIO A;  3HXM A;  1U4B A;  3DOK A;  1UAX A;  3RTV A;  1NK4 A;  3RR8 A;  2FBX A;  2BAN A;  3AVA A;  3LAN A;  1ZBU A;  1S1W A;  4CJF A;  3K5L A;  2Y1J A;  2G8I A;  4Q0B A;  3TAN A;  2JGU A;  2YHA A;  4E19 A;  1WAJ A;  3QEP A;  3HST B;  5JS2 A;  1QTM A;  4F2R A;  3VQA A;  1IO2 A;  2YV0 X;  4OPJ A;  2HHS A;  2DTU A;  1FK9 A;  4C8L A;  1YT3 A;  3M8S A;  3AA5 X;  2O4G A;  4K8X A;  3ALY A;  3DLR A;  3VN5 A;  4I9Q A;  5C25 A;  1VSD A;  3L3V A;  3LPU A;  3HVT A;  2XHB A;  3S3N A;  3LWL A;  3JSM A;  1XHZ A;  3OYD A;  4QAG A;  2FBV A;  4CJE A;  3NE6 A;  1REV A;  2A1S A;  1KVB A;  3LP1 A;  4HTU A;  1FXX A;  4FLU A;  2RKI A;  2KZZ A;  3DOL A;  3A2F A;  3AVG A;  3VQB A;  3HPO A;  4DF8 A;  1VRU A;  2GUI A;  3U3G A;  3UIQ A;  2HNZ A;  2DFE A;  4GVM A;  3QIO A;  3MXJ A;  1TV6 A;  4FJG A;  3ZSR A;  4FW2 A;  4AHV A;  2OPP A;  4KTZ A;  3VQ4 A;  3B6P A;  1N5Y A;  4JRQ A;  3V81 A;  3AVB A;  3OS1 A;  2QXF A;  4CF1 A;  3VQP A;  4BE1 A;  3T3F A;  1L5U A;  1JXE A;  4Z4H A;  4FJM A;  5HP1 A;  4DTO A;  4CJT A;  4H4M A;  3RRH A;  1D9D A;  3D45 A;  1RTD A;  3EZ5 A;  1IH7 A;  1UWB A;  4E7L A;  4CHZ A;  5KTQ A;  1T7P A;  4B08 A;  2HHX A;  1S1V A;  2HHT A;  2QKB A;  1B9F A;  4CF2 A;  4E7J A;  4FK0 A;  4Q5V A;  3ZSX A;  3F73 A;  4FLV A;  3OS0 A;  2PZS A;  4CJL A;  4OLA A;  4KI6 A;  4LD0 A;  4CJ3 A;  5J2M A;  3TAG A;  3ITH A;  5HLF A;  1XHX A;  4E3S A;  3DLE A;  1WSJ A;  1NK8 A;  1YVU A;  2I5J A;  4E7I A;  4M3X A;  4B9U A;  5DK5 A;  2HVI A;  2G8H A;  4NCA A;  3ULD A;  1FKP A;  4MQ3 A;  4KHN A;  3CQ8 A;  4FJK A;  3DRR A;  2ZE2 A;  4TSX A;  3ZCM A;  1U49 A;  2GBZ A;  2VWJ A;  2GV9 A;  4CJW A;  4FM1 A;  1D8Y A;  4M3Z A;  1BHL A;  1JLC A;  1LW2 A;  1C0U A;  3KLE A;  1BQM A;  3T19 A;  4DTU A;  3PX0 A;  4FZY A;  5FDL A;  4BWM A;  2JLE A;  2KTQ A;  2LSN A;  3P83 D;  3LZI A;  1BCO A;  3DRS A;  4W5O A;  3RMB A;  4LY7 A;  3E01 A;  1VSF A;  3HM9 A;  2DFF A;  2XY5 A;  2HNY A;  4FJ7 A;  4CJS A;  4KHS A;  2FBT A;  4E7H A;  1SKR A;  1RT7 A;  1RBT A;  4FJJ A;  4B9N A;  3AVJ A;  1GOA A;  4M41 A;  3P1G A;  1S1X A;  3O3H A;  3V1O A;  3RMD A;  2E6L A;  4KHY A;  1TKT A;  5FRO A;  1SUQ A;  3SJJ A;  4YNQ A;  1J9A A;  1WSI A;  3OYA A;  3TAE A;  1SKS A;  1D9F A;  2YHB A;  2PYL A;  4KTQ A;  4J2E A;  4CHY A;  4Z4I A;  1JLG A;  2D0A A;  1WSE A;  3D0P A;  3NF6 A;  1FKO A;  4G1Q A;  1NJY A;  1YTU A;  2YKN A;  4RW8 A;  3SNN A;  1HQU A;  4GMJ B;  1UOC A;  4EP5 A;  4JS4 A;  4PA1 A;  4Z0U A;  3TAQ A;  4KHU A;  2B5J A;  2OPQ A;  1WSH A;  1A5X A;  3AO4 A;  1LWE A;  3WNH A;  3RMA A;  2WOM A;  4N5S A;  4J2B A;  3QEV A;  1CZ9 A;  4M42 A;  3M8R A;  1N6Q A;  3V1R A;  4DQP A;  3PUF A;  1G15 A;  3K2P A;  3K5O A;  4OKJ A;  3KJV A;  4CHQ A;  4O44 A;  1ZBH A;  1KTQ A;  4B9V A;  4W5R A;  2DY4 A;  2BGG A;  1C1B A;  4FVM A;  4AHC A;  4CJQ A;  4I2Q A;  3I8D A;  4PWD A;  2IOC A;  4ZTF A;  3PO5 A;  3CM6 A;  1S5J A;  4GW6 A;  4OGE A;  4H4O A;  4CE9 A;  1NOY A;  3M8P A;  5JS1 A;  2D5R A;  4BWJ A;  3V4I A;  4FJ8 A;  3OYN A;  1DTT A;  4CK2 A;  1A5W A;  3PY8 A;  1Z25 A;  4LH5 A;  2XO7 A;  4DSF A;  4ZTJ A;  1BL3 A;  2OPR A;  1NOZ A;  3AVF A;  4AHT A;  4DS4 A;  1TL3 A;  3L2U A;  3S3M A;  4B9M A;  2HW3 A;  4I7F A;  4DMN A;  1RCH A;  4EZ6 A;  2G8F A;  4FK4 A;  4KI4 A;  3TAB A;  1BGX T;  4IG3 A;  4CIG A;  1KCF A;  2Z1H A;  2XY8 A;  2R7Y A;  4DQS A;  1RTI A;  1O1W A;  1JLB A;  5EU7 A;  3HO1 A;  4CF8 A;  4Z4G A;  4CEB A;  4E1M A;  4JRP A;  3SYZ A;  3NBP A;  1TK5 A;  4HCC A;  3K5N A;  3KD1 E;  3NFA A;  4DSK A;  2F96 A;  3NCI A;  3NAE A;  1KVC A;  3BGR A;  4DFJ A;  4ELT A;  4IFV A;  2NUB A;  4RW4 A;  4Y1D A;  4C8N A;  1KSP A;  3FFI A;  4M3R A;  3AO1 A;  4B9L A;  3OJS A;  1B9D A;  1BCM A;  1BIZ A;  3WNE A;  5HRO A;  1RTH A;  4CCH A;  4HUF A;  4I9L A;  3IAY A;  2P51 A;  4FJI A;  4FM2 A;  3HYF A;  3KKR A;  4IG0 A;  3K59 A;  4O4G A;  4DQQ A;  5KRT A;  4DFK A;  4HCB A;  3LAK A;  4O0J A;  3TAP A;  1EXQ A;  1I39 A;  4CEQ A;  5HRP A;  1SL1 A;  1NKE A;  5HRN A;  4B9S A;  4DTM A;  2FC0 A;  3ZSO A;  4O55 A;  5HRR A;  4O0I A;  4XIU A;  3LP3 A;  3SCX A;  4CEO A;  1SL2 A;  4CGH A;  3HK2 A;  3MED A;  4ID1 A;  1NK7 A;  1QS4 A;  1NKB A;  1J5O A;  1RTJ A;  3OS2 A;  3VQ7 A;  4CES A;  1DLO A;  1UA1 A;  2QKK A;  3MEG A;  4PY5 A;  3DMJ A;  1GOC A;  3DLK A;  3NGY A;  4CJV A;  1IG9 A;  4CJ5 A;  5SWM A;  3AO3 A;  4CHN A;  4LSN A;  3AVH A;  4C8M A;  3DYA A;  3KK2 A;  1X9W A;  5J2N A;  3AO2 A;  3ASM A;  3SQ4 A;  1C0T A;  4FXD A;  2OPS A;  3CFR A;  2G8K A;  5CZ2 A;  3ZSY A;  1XC9 A;  3OYB A;  4CER A;  3V9W A;  2DFH A;  2G8V A;  1BI4 B;  2Z1G A;  3VQ9 A;  4DQI A;  1JLE A;  2HMI A;  1J54 A;  3SZ2 A;  1Q8I A;  1NK9 A;  3VA0 A;  5KGW A;  1KVA A;  1WNS A;  3V9X A;  4FJ9 A;  2KFZ A;  1I3A A;  1WSF A;  1ASV A;  5KRS A;  4AHS A;  1TKX A;  3RWU A;  4KPY A;  4B3O A;  4FW1 A;  5I42 A;  3DM2 A;  3OYH A;  2E6M A;  4FLY A;  3THV A;  4L8R B;  1TAQ A;  3O4Q A;  2RPI A;  1HNV A;  3DLB A;  3SQ1 A;  4M3Y A;  1CZB A;  3S3O A;  1RBS A;  2YNH A;  4CJR A;  3OYJ A;  3QEI A;  1Z26 A;  3L8B A;  4KRF A;  2HHW A;  5J2Q A;  1HYS A;  1SV5 A;  3RMC A;  4DTN A;  2X6S A;  2P5O A;  4NYF A; 
#chains in the Genus database with same CATH topology
 3AVK A;  1S1T A;  1VQM N;  1X9S A;  3I0S A;  1U6Z A;  2IAJ A;  4FO0 A;  3IRX A;  2ETJ A;  3SMS A;  2UUB K;  2QXL A;  3KLF A;  2XY7 A;  4BR2 A;  3GOI A;  1N8R O;  3MXI A;  2VQE K;  3PV8 A;  1IKY A;  3ULE A;  3AV9 A;  4ICL A;  2P9P B;  4W5T A;  1TKD A;  4CF0 A;  4HUG A;  1HPZ A;  4DS5 A;  3PIO L;  3QEX A;  4WQ5 C;  1NBW A;  2YKM A;  2GX9 A;  4HVJ A;  4BRG A;  3KK3 A;  5HRS A;  1L3S A;  3O4N A;  5DM6 L;  3NHG A;  2YI1 A;  2A3Z A;  1RDB A;  3MAQ A;  4K0K K;  4DFP A;  2FBY A;  1J5E K;  3JYT A;  4OKE A;  1KXP A;  3P38 A;  5AQG A;  3C6T A;  4YFU A;  1RDC A;  1WN7 A;  3G71 N;  3OYK A;  1HMV A;  3I55 N;  4C1N K;  1DT9 A;  2IIR A;  4CZM A;  3VA3 A;  3EYZ A;  4CFB A;  2HHU A;  3VGL A;  1NGH A;  1TL1 A;  3VQ5 A;  3NMU A;  2IVO A;  1BWF O;  4CK3 A;  2KQ2 A;  3RRG A;  1BQN A;  1JL2 A;  1VQ8 N;  1RT2 A;  2JWL A;  1RFQ A;  3LDL A;  4IJA A;  2X74 A;  4PUO A;  3HL8 A;  2IS3 A;  3ZET B;  4KTW A;  1NK5 A;  3WQU A;  3NDK A;  4JI6 K;  3PSI A;  3BF3 A;  4WQ5 A;  5CYQ A;  3T7Z A;  3KZB A;  4Z4C A;  4CIF A;  1GLA G;  4J2D A;  1T03 A;  2X6N A;  1W2B M;  3TTC A;  3NH2 A;  1KLM A;  5AR0 A;  4Z4E A;  1HNI A;  3NF7 A;  1RDD A;  1VRT A;  2EHG A;  1RT5 A;  3O9S A;  3P5J A;  4YDU C;  4NB4 A;  4H0P A;  3MN9 A;  2D0B A;  3VQ8 A;  1SAZ A;  3K58 A;  5BPM A;  3ZX3 A;  3K9J A;  4CK1 A;  3DI6 A;  4FWR A;  1QHT A;  2Q31 A;  2CGK A;  4BGB A;  1HQE A;  3HPG A;  5FPM A;  1VSL A;  5ADX H;  4CHP A;  1U04 A;  3AO5 A;  3FR0 A;  4Z94 A;  4DR5 K;  1WAF A;  5AQU A;  4FLT A;  4MLE A;  1BI4 A;  4BY9 C;  2B4J A;  3CF5 L;  3TWH A;  3L4I A;  2KHO A;  1NGJ A;  1EET A;  1K8K B;  2W41 A;  2Q0U A;  2I7P A;  5AQN A;  1TK8 A;  5FLX O;  1GLE G;  2ZWH A;  2D4W A;  4DU1 A;  3IUC A;  1SKW A;  3O1B A;  1ZBL A;  2AP1 A;  2OA8 A;  1RDU A;  1HYZ A;  1NWK A;  4MFB A;  1NGE A;  3R9P A;  4U7B A;  3VEN A;  4NYN A;  4UQG A;  5CR4 A;  4IZ9 A;  4CEA A;  1W0H A;  3QES A;  4Y1C A;  2F8T A;  4FJX A;  1DTQ A;  4F3T A;  4Z4F A;  3LAM A;  1NGC A;  3T1A A;  3VQQ A;  3UB5 A;  3H3O B;  3C95 A;  2P9U B;  3KLG A;  2E2Q A;  3SMP A;  4JKE A;  4DG1 A;  2GEM A;  1HYV A;  5BN9 A;  2YNF A;  2WON A;  4C8K A;  3SAH A;  3VEW A;  4F2S A;  3LP2 A;  1L3T A;  1EX4 A;  1RDA A;  5SZT A;  4FZX C;  3PSF A;  3QET A;  2QWM A;  4CHO A;  3U6F A;  1XMO K;  4NLC A;  4ZHR A;  1Q81 O;  4KKO A;  3CM5 A;  3VQ6 A;  3WNF A;  3KTQ A;  3K0S A;  1ASU A;  1EQY A;  4GNI A;  1UAX A;  3RTV A;  1NK4 A;  4H03 B;  2BAN A;  1IV0 A;  3AVA A;  4H5N A;  5M1P A;  2G8I A;  1C0G A;  4GV3 A;  3TAN A;  4Q0B A;  4YOY A;  2BH1 A;  4E19 A;  5GIN A;  4M63 C;  3HST B;  4OPJ A;  2HHS A;  3AA5 X;  3PIP L;  3BF1 A;  4A57 A;  3ALY A;  5C25 A;  4KH4 A;  3LWL A;  2NRX A;  4CJE A;  1YAG A;  4HTU A;  1R59 O;  1RDW X;  4FLU A;  2KZZ A;  3BEX A;  3AVG A;  3MDQ A;  4DV0 K;  3UIQ A;  3U3G A;  1U2V B;  3ZSR A;  4FW2 A;  4JRQ A;  3V81 A;  2QXF A;  4CF1 A;  3THW B;  4DUY K;  1L5U A;  4XH4 A;  3CJB A;  5HP1 A;  3RVC A;  4CJT A;  1D9D A;  3ZYY X;  1RTD A;  4CHZ A;  5KTQ A;  1T7P A;  3VTI A;  2RHK A;  1MWK A;  1QQM A;  3I8B A;  2HHT A;  3CHW A;  4E7J A;  4FK0 A;  3ZSX A;  4BC4 A;  2PZS A;  1GLD G;  4H0V B;  2P9P A;  1NJI O;  5GAG P;  4WQ4 A;  1OKJ A;  1WSJ A;  1P8Z A;  4B9U A;  3KK7 A;  4JI4 K;  4NCA A;  3ULD A;  4DR4 K;  1FKP A;  3SBT A;  3CQ8 A;  2H3G X;  4FJK A;  4B3R K;  3DRR A;  3ZCM A;  4CJW A;  1D8Y A;  3KLE A;  3HRG A;  2KTQ A;  3P83 D;  3RMB A;  1NM1 A;  3OBW A;  4E7H A;  3UKR A;  4B9N A;  2QWQ A;  3CI5 A;  1VQK N;  3KVG A;  1S1X A;  3VF4 A;  3V1O A;  4LF7 K;  1VQ6 N;  4YOW A;  1WSI A;  4KTQ A;  1SKS A;  2YHB A;  4JKH A;  3K9K A;  1JLG A;  2D0A A;  1NJY A;  4RW8 A;  5M1O A;  3VF6 A;  4GMJ B;  1UOC A;  4M7X A;  4EP5 A;  4JS4 A;  5M1N A;  4PA1 A;  2OPQ A;  1WSH A;  3WNH A;  3RMA A;  3A8Y A;  4H5V A;  3QEV A;  4E1J A;  2HMP A;  3H1V X;  3R6M A;  3V1R A;  3PUF A;  4CHQ A;  4JHD B;  2QWP A;  3I8D A;  3CER A;  2IOC A;  3CM6 A;  1S5J A;  1TUY A;  5GAD P;  3M8P A;  4CJ7 A;  4BWJ A;  3V4I A;  4FJ8 A;  3VOV A;  1DTT A;  2OCE A;  4C1N I;  1A5W A;  1Z25 A;  2UYT A;  4DSF A;  1YHQ N;  2OPR A;  3ATU A;  5FPE A;  1TL3 A;  2CGL A;  2HW3 A;  4I7F A;  2Z1H A;  3TTD A;  5AQQ A;  1JLB A;  3LDQ A;  4HTL A;  4I6M B;  3CCV N;  3C65 A;  4X64 K;  4CZL A;  1HNX K;  2F96 A;  4X66 K;  4B1Z A;  4ELT A;  4RW4 A;  4K25 A;  3FFI A;  2ZF5 O;  1B9D A;  1BCM A;  5AQS A;  4CVN E;  4DV1 K;  3ZLJ A;  4CCH A;  3TSU A;  4IG0 A;  4DFK A;  4HCB A;  4C23 A;  5F1X A;  4O0J A;  2P9K A;  2O8B A;  1SL1 A;  3ENO A;  5HRN A;  1SL2 A;  4CEO A;  3HK2 A;  3MED A;  1V4S A;  2ZM6 K;  1NKB A;  3D2E B;  5AFU H;  3O6W A;  3OS2 A;  1N32 K;  4M7Y A;  3DLK A;  3NGY A;  4CJV A;  4CJ5 A;  3R8E A;  4CHN A;  5BN8 A;  1QVG M;  4C8M A;  5C2F A;  4EHT A;  1M90 O;  4FSV A;  2G8K A;  5CZ2 A;  3G4S N;  1XC9 A;  3V9W A;  1BI4 B;  3VQ9 A;  1JLE A;  1J54 A;  3SZ2 A;  1I3A A;  5KRS A;  4AHS A;  3DM2 A;  4WFA L;  3W0L A;  3TSP A;  3VF2 A;  3THV A;  4BR5 A;  4L8R B;  3SQ1 A;  2QEX N;  3S3O A;  4V19 S;  4CJR A;  1Z26 A;  3SAF A;  2HHW A;  4JHD A;  3RMC A;  2A6A A;  4DTN A;  3CET A;  2O8C A;  4DKW A;  2F9T A;  5AQP A;  3HPH A;  1Q9Y A;  3NH1 A;  4LFB K;  1TYQ A;  1RBU A;  2CH6 A;  4BGA A;  4DSJ A;  3FZK A;  1SZ2 A;  2A42 A;  1IKV A;  1NGA A;  1NNE A;  4DLE A;  2KW4 A;  2G8U A;  1S6Q A;  4E1N A;  4FVU A;  3OYL A;  2ITG A;  2W40 A;  4KHQ A;  5LJV A;  3FZL A;  2P9S B;  1MDU B;  4ISG A;  2BE2 A;  3U4L A;  4DQ8 A;  1DGK N;  4CBW A;  3IMX A;  3IKM A;  3KLI A;  5M1F A;  2HBL A;  4BE2 A;  1T6D A;  1ZBF A;  4XEI A;  5GIP A;  3J8A A;  3TTF A;  2XRI A;  1XI1 A;  2P9N A;  2O8E A;  1MU2 A;  3PX4 A;  1VQL N;  4CIE A;  4DU4 A;  3O9U A;  3QNN A;  2A1R A;  3L2R A;  4I6M A;  1VSJ A;  1ZBI A;  2OZM A;  4B8C A;  2YNG A;  3TR8 A;  3UKU A;  1VSE A;  4CGJ A;  1IKW A;  4ID5 A;  3J7Y P;  3EEQ A;  5KI6 A;  3OYI A;  4G9Z A;  1WUA A;  4AIL C;  4H0O A;  4ISE A;  4IEI A;  4ILH A;  3P4I A;  3VEZ A;  4BAC A;  2OTJ N;  4DF4 A;  5T7B A;  2FSJ A;  3BZK A;  4KHW A;  3AA3 A;  4RCH A;  5AQT A;  4CI6 A;  4N56 A;  2VYP A;  1Y97 A;  3CYM A;  1NJW A;  2VGN A;  2G8W A;  4OKK A;  2QWN A;  3LP0 A;  1UA0 A;  4MO5 A;  3VEO A;  4F4K A;  5TKY A;  1RT3 A;  2XY6 A;  4H8K A;  3OVN A;  1C1C A;  3KWG A;  2NRZ A;  1VSM A;  1VQ4 N;  3CFO A;  3G6E N;  3EZW A;  3H46 O;  3MN6 A;  2OZS A;  3LM9 A;  4BG9 A;  4FJ5 A;  1RT1 A;  2BTF A;  4W5N A;  1B92 A;  5AQY A;  2Y1I A;  1VK0 A;  1EWQ A;  3F9K A;  3H08 A;  3HP9 A;  4CGG A;  4JK7 A;  4BE0 A;  5BR9 A;  1NJX A;  5I3U A;  4O5B A;  2D1K A;  1NK6 A;  3CD6 N;  3QO9 A;  1QE1 A;  1YJ9 N;  2VG6 A;  1VSI A;  2YJE A;  5C15 A;  1RBR A;  4GY2 B;  5GAE P;  1BIS A;  2BUP A;  2F7T A;  3C6U A;  3EY1 A;  2IGI A;  4CZI A;  3CG7 A;  5A2Q O;  3HJF A;  3HBT A;  4BVP A;  3VQE A;  4CEC A;  2HF4 A;  1Z05 A;  4OPK A;  4JI1 K;  3ZET A;  4N76 A;  3WT0 A;  1P90 A;  5I9E B;  4QOZ B;  4FWL A;  2HND A;  4AHR A;  1X9J A;  3W3D A;  2HB5 A;  5FRN A;  3I0R A;  4YOR A;  4GV9 A;  1T3V A;  2P5G A;  2AA4 A;  3DXM B;  4WE1 A;  2J4R A;  3AAR A;  4FWM A;  3S9H A;  4OGC A;  1KFD A;  2I7N A;  4F3O A;  1KAY A;  3SQ0 A;  4BVO A;  4O5F A;  3UE5 A;  4EFH A;  4AH9 A;  1L3V A;  2VG5 A;  1QQO A;  5IWA K;  3L2W A;  3OYE A;  3FFK B;  3U8X A;  3SQ2 A;  4RW9 A;  3CJ7 A;  2X78 A;  3HOT A;  4FPB A;  1BA0 A;  4KHP K;  2NNW A;  3K57 A;  3IS9 A;  4DTR A;  2IVN A;  3U9D A;  5D3G A;  2HBJ A;  4FWQ A;  3CQX A;  3CFP A;  1D5A A;  4FWN A;  5KGX A;  1HLU A;  1ZC6 A;  3ID8 A;  1QSY A;  2ASP A;  1QSS A;  5C42 A;  4DSL A;  3CPW M;  4FM0 A;  2NRT A;  1BO5 O;  4I2P A;  3HZ6 A;  4DV7 K;  3AVL A;  3EKS A;  1QSL A;  1ZBS A;  4KRE A;  4LH4 A;  2KZM A;  4CJK A;  4H0T B;  3ZT0 A;  3NF8 A;  3ZSV A;  3M3Z A;  4GV6 A;  1E4F T;  3D2F A;  3LAL A;  4PKG A;  3MMV A;  4JI0 K;  5LJW A;  4KBO A;  1YTA A;  3THW A;  1KLN A;  2NRH A;  1HR0 K;  3ULE B;  2ZJR L;  3LDS A;  3TU5 A;  3THY A;  3FZM A;  4B3M K;  1KD1 O;  3JS6 A;  4BRO A;  1S1U A;  1GLL O;  2HHQ A;  3MCP A;  4DLG A;  4PL7 A;  3C94 A;  3C6A A;  3NGZ A;  5AQF A;  3ZEU B;  3KIO A;  1X3N A;  3DOK A;  3RR8 A;  1IJJ A;  2Q0R A;  3LAN A;  4DHY A;  4NLB A;  2YHA A;  3O4W A;  1QTM A;  3VQA A;  3WXM B;  2YV0 X;  2DTU A;  1Q86 O;  3M8S A;  2O4G A;  2P9N B;  4I9Q A;  3LPU A;  3HVT A;  4GVE A;  3S3N A;  3JSM A;  4A5B A;  4LC9 B;  4LF5 K;  4QAG A;  2FBV A;  3NE6 A;  3MWP A;  3DOL A;  3A2F A;  4FWP A;  3VQB A;  3JAM O;  4EHU A;  2HNZ A;  3O5B A;  4KTZ A;  1FW6 A;  1N5Y A;  4IFE A;  3AVB A;  4BE1 A;  4JD2 B;  4Z4H A;  4FJM A;  2D0O A;  3CXC M;  4ILG B;  4CBX A;  4E7L A;  1UWB A;  4HWI A;  5M1Q A;  4H5W A;  4B08 A;  1T44 A;  4BRL A;  3CC2 N;  2HHX A;  1HJO A;  2Q1N A;  4JKD A;  2QKB A;  4FLV A;  3OS0 A;  4KI6 A;  3N4P A;  4PL8 A;  2QI2 A;  3KWI A;  1NK8 A;  1NGB A;  4MQ3 A;  3WQT A;  1U49 A;  2VWJ A;  4BR4 A;  3PX0 A;  1BQM A;  2JLE A;  2LSN A;  3DRS A;  4W5O A;  1LCU A;  4B1W B;  1VSF A;  3HM9 A;  2DFF A;  2XY5 A;  2HNY A;  4LF6 K;  4KHS A;  3B8A X;  3AVJ A;  4CZK A;  4JKF A;  5JVH L;  2E6L A;  5FRO A;  1QZ6 A;  2YX6 A;  4YY3 K;  3SJJ A;  1D9F A;  3DXM A;  3L6Q A;  3D0P A;  1FKO A;  4G1Q A;  3WXI A;  3LM2 A;  1HQU A;  4X62 K;  3AO4 A;  1NGI A;  1CZ9 A;  4JEP A;  3M8R A;  3CC4 N;  3K5O A;  2QWL A;  4O44 A;  3WXL A;  3A5N C;  4W5R A;  2BGG A;  4CJQ A;  3OHR A;  4ZTF A;  1ATN A;  4EAH D;  4GW6 A;  1YF5 L;  4OGE A;  4H4O A;  1NOY A;  5JS1 A;  5E84 A;  4KH6 A;  4CK2 A;  3QIC A;  4LH5 A;  4DS4 A;  1KAZ A;  4DMN A;  4EZ6 A;  4FK4 A;  4KI4 A;  1BGX T;  4IG3 A;  5EY4 A;  4CIG A;  3DXK A;  1KCF A;  1QVF M;  3QFP A;  3WXJ A;  2R7Y A;  1RTI A;  3QB0 A;  3HO1 A;  4JD2 A;  4CF8 A;  3VGK A;  4JRP A;  1XQS C;  3D6R A;  4HCC A;  3K5N A;  3KD1 E;  2YHY A;  4FOI A;  3NCI A;  1KVC A;  3BGR A;  1GLF O;  1KSP A;  3AO1 A;  2V7Z A;  4FOE A;  2NZT A;  4DV6 K;  2F9W A;  3IAY A;  3HYF A;  5ELZ A;  5KRT A;  5M1K A;  5JLF A;  3THY B;  1EXQ A;  5AQM A;  5HRP A;  4B9S A;  4O55 A;  4CGH A;  1DLO A;  2QKK A;  3E66 A;  3MEG A;  4LSN A;  3KK2 A;  1X9W A;  4MDA A;  5J2N A;  3ASM A;  3ID6 A;  4FXD A;  2OPS A;  3ZSY A;  3OYB A;  4CER A;  3I56 N;  2VCP A;  3IFR A;  3R3L A;  1RGI A;  3BZC A;  1QHA A;  3VPZ A;  5KGW A;  1KVA A;  2KFZ A;  2O8B B;  3RWU A;  4KPY A;  4B3O A;  4FW1 A;  3TSQ A;  5I42 A;  4MDB A;  3OYH A;  4FLY A;  3O4Q A;  5F2R A;  1HNV A;  3FE1 A;  5AQW A;  2NRW A;  4BR7 A;  3QEI A;  4DV4 K;  3S41 A;  5J2Q A;  2P9U A;  2GEL A;  2X6S A;  1HPM A;  4NYF A;  4IDK A;  4AHU A;  2AJQ A;  4BRC A;  2W6L A;  3ZT4 A;  3MK6 A;  3IDH A;  4JLH A;  4BC5 A;  4DSI A;  4CFC A;  3AGR A;  5TKW A;  2GUP A;  4N41 A;  1LW0 A;  5CHI A;  4CGD A;  3K5M A;  3EE8 A;  3AY9 A;  3V6D A;  3UKU B;  5KPZ A;  1E4G T;  4E89 A;  4CJU A;  1VQP N;  4OJR A;  3CCR N;  4K8Z A;  1NMN A;  1LWF A;  1JLF A;  1OH8 A;  4YHH K;  4DR7 K;  2VWK A;  1WLJ A;  3O9T A;  4CZF A;  3OA9 A;  3VEV A;  3SPY A;  4RW7 A;  1S9E A;  2RN2 A;  1CXQ A;  3SV4 A;  1ZXO A;  1NGD A;  4BRE A;  4IOC L;  1SL0 A;  1Q7Y O;  1RT4 A;  5DMR A;  1GLC G;  3L2Q A;  2HHV A;  5J2P A;  4IO9 L;  2VGM A;  2OTL N;  3ATV A;  4FWK A;  3NVK A;  3RSE B;  1RNH A;  3TAR A;  4ELV A;  2A41 A;  3NVM A;  3DJC A;  3AA2 A;  3GDQ A;  1DEJ A;  1JLQ A;  3CCQ N;  2Z1I A;  1BG3 A;  4YOT A;  3LZJ A;  3NH0 A;  2E1Y A;  5LL6 Z;  3OYM A;  4H0X B;  1NG9 A;  3QLH A;  1TUU A;  4JKG B;  4KB1 A;  3V9S A;  4OLB A;  1K6Y A;  3L4Q A;  4KV8 A;  2P9I B;  2ZQB A;  4IFY A;  4EZ9 A;  4J8F A;  4CED A;  4JS5 A;  1D4X A;  3CJ9 A;  4FJH A;  1VQN N;  1LAV A;  1C6V A;  1GOB A;  1KRP A;  3L3U A;  4M3U A;  3SK3 A;  3SUP A;  4B1Y B;  1XUP O;  4LF4 K;  3QFU A;  3QML A;  4DWI A;  4PKI A;  1NLV A;  5CY4 A;  1K8A O;  5J1E A;  4YOU A;  4B9T A;  2Q3S A;  3M1F A;  5JMV A;  2EX3 A;  3MEC A;  1N33 K;  4FCY A;  2HHH K;  5C0Y A;  2VG7 A;  1OH5 A;  5BPL A;  1JXB A;  1OVY A;  5AZJ B;  5FRM A;  4A59 A;  3CME N;  2FXU A;  3DLH A;  4CF9 A;  1IBM K;  3MXM A;  4B8A B;  2NRV A;  3DLG A;  3HT3 A;  4BRI A;  4RWT A;  5AZI B;  3F2K A;  3TAF A;  1S6P A;  4FJL A;  1T8E A;  1EWR A;  1NGF A;  3M8Q A;  2GWK A;  1LOT B;  3LDN A;  2FF6 A;  4JAX A;  4IOX A;  2ITM A;  3OYF A;  1JL1 A;  1LAW A;  4BDZ A;  3G25 A;  2OYQ A;  4LSL A;  1ASW A;  3T1Y K;  5C24 A;  3NF9 A;  2D0C A;  4HHT A;  4DTS A;  2O8D B;  4CEZ A;  2E2N A;  2NRR A;  5FPD A;  4CJ4 A;  1X1P A;  2IC3 A;  2KFN A;  4BR9 A;  2WC9 A;  3RSE A;  3O9Q A;  4JI7 K;  1QQC A;  3BP8 A;  3HVR A;  3ZSQ A;  4O8K A;  2WTU A;  1R0A A;  1JKH A;  1WOQ A;  2ATQ A;  1HKB A;  3DRP A;  4CJP A;  1XWL A;  2Z1J A;  3AVM A;  5LMN K;  1TGO A;  1X9M A;  1VQ5 N;  3LWM A;  3B6O A;  4WF9 L;  4FK2 A;  2RF2 A;  1EO1 A;  4MLH A;  4KB0 A;  3HM8 A;  2RE2 A;  2ZD1 A;  3KLH A;  1NJZ A;  3PO4 A;  4JKG A;  2GWJ A;  3LDP A;  4H5R A;  1LV5 A;  1XNR K;  3QEW A;  3TI0 A;  3G0Z A;  3LL3 A;  3CJA A;  5HOO A;  2PY5 A;  5E41 A;  1Q9X A;  3GBT A;  2B6A A;  3M6G A;  4B9Q A;  1KAX A;  4C8O A;  1ITG A;  4DV3 K;  4M45 A;  4AQY K;  1TAU A;  4BDY A;  3R1X A;  1BU6 O;  3VEY A;  2P9K B;  3A0I X;  3JXU A;  3OY9 A;  1KFS A;  1IKX A;  3E1Y A;  2YJF A;  1ZBU A;  1S1W A;  4CJF A;  3K5L A;  2UXB K;  3SLC A;  1WAJ A;  3AGK A;  4F2R A;  1IO2 A;  2WFB A;  3MWT A;  4C8L A;  1YT3 A;  1ATR A;  3DLR A;  3CCS N;  2KKZ A;  1VSD A;  3L3V A;  1KQS M;  3OYD A;  4BRF A;  2CGJ A;  3DLL L;  1REV A;  2A1S A;  1VQ9 N;  3LP1 A;  1FXX A;  3HTV A;  4GKK K;  2P9I A;  2RKI A;  3HPO A;  1VRU A;  2DFE A;  4GVM A;  3QIO A;  1HX1 A;  3MXJ A;  1TV6 A;  4FJG A;  2E88 A;  1ESV A;  1YI2 N;  3OS1 A;  2YHW A;  2WBN A;  3A5O C;  3T3F A;  1JXE A;  4DTO A;  4F9O A;  4H4M A;  5LY3 A;  3D45 A;  4MO4 A;  4WQ4 C;  3EZ5 A;  1IH7 A;  1K8K A;  1MA9 B;  2ASM A;  2O8E B;  3D2E A;  1YIJ N;  4CF2 A;  4Q5V A;  4LD0 A;  4CJ3 A;  5J2M A;  3TAG A;  5HLF A;  1XHX A;  1SS6 A;  3DLE A;  3U9Z A;  5BRE A;  1K9M O;  2I5J A;  4H0Y B;  3H1Q A;  4M3X A;  5DK5 A;  1S72 N;  4CZG A;  2ZE2 A;  5EOY A;  2GV9 A;  3N4Q A;  4FM1 A;  4M3Z A;  1JLC A;  1BHL A;  1LW2 A;  4DTU A;  4FZY A;  3T19 A;  2UXD K;  5FDL A;  4BWM A;  4CZJ A;  3E01 A;  3E9P A;  2P9L A;  4CJS A;  3CJ1 A;  4FJJ A;  4JI2 K;  3FZF A;  1GOA A;  1W97 L;  3P1G A;  2VQF K;  4JI5 K;  3O3H A;  3VER A;  4KHY A;  1TKT A;  5BPN A;  1SUQ A;  4YNQ A;  1J9A A;  5KPT A;  4J2E A;  1WSE A;  1YTU A;  3NF6 A;  2YKN A;  3ENH A;  4CW7 B;  4KHU A;  4Z0U A;  4DV2 K;  1TYQ B;  2WOM A;  5BRH A;  4J2B A;  4M42 A;  3E9L A;  5CE3 A;  1HNW K;  4A2B A;  5AQZ A;  3CCU N;  1YJW N;  2O8D A;  3KJV A;  1KTQ A;  4B9V A;  3P39 A;  4IO8 A;  1C1B A;  3WXK A;  4IDH A;  4CE9 A;  4BRP A;  3DAW A;  3F5T A;  3OYN A;  5AQJ A;  2DPN A;  3D7E O;  2XO7 A;  4ILJ A;  4AHT A;  1NOZ A;  3S3M A;  1WB9 A;  1RCH A;  3PLA A;  3TAB A;  2XY8 A;  4XH5 A;  4BG8 A;  1XC3 A;  4DQS A;  4LFA K;  4YOV A;  4H5T A;  5EU7 A;  3A5M C;  4E1M A;  4Z4G A;  1TK5 A;  3O1W A;  4DSK A;  3NAE A;  4DFJ A;  3J80 O;  4FWO A;  2NUB A;  4Y1D A;  4C8N A;  4BRQ A;  4B9L A;  3OJS A;  1BIZ A;  1U2V A;  3WNE A;  1RTH A;  2UUA K;  4HUF A;  4I9L A;  2P51 A;  4FJI A;  2ZGY A;  3KKR A;  2V52 B;  4JK8 A;  3K59 A;  2EWS A;  3C7N A;  3CPE A;  3VEX A;  3M5R A;  4GKJ K;  4CEQ A;  5GAH P;  4A61 A;  2FC0 A;  3ZX2 A;  3SCX A;  4O0I A;  3LP3 A;  1NK7 A;  4ID1 A;  1WBB A;  3SBG A;  1QS4 A;  1RTJ A;  3VQ7 A;  3DMJ A;  1GOC A;  4DUZ K;  3DYA A;  3SQ4 A;  1C0T A;  1IG8 A;  3CFR A;  3ZEU A;  3KHY A;  4K41 A;  2HF3 A;  1NK9 A;  1S3X A;  3H45 C;  3V9X A;  1WSF A;  1ASV A;  1BUP A;  5IT9 O;  4OPA A;  2E1Z A;  4X65 K;  4LFC K;  4M3Y A;  2YNH A;  3OYJ A;  3SAG A;  3E9O A;  4IXC A;  3L8B A;  4K43 A;  1HYS A;  3AAQ A;  1YJN N;  3OYC A;  1VAZ A;  5JLH A;  4FLZ A;  3J7Z O;  1TKZ A;  2P9S A;  3GL1 A;  4IKF A;  3V9Z A;  1JJ2 M;  3THX A;  3VET A;  4FLX A;  2E4L A;  3P31 A;  3WNG A;  4EP4 A;  3MN5 A;  4QCL A;  1JCG A;  4QS7 A;  4DTJ A;  5CZ1 A;  2PYJ A;  2HBM A;  4WFB L;  4FLW A;  4NXM K;  4AF1 A;  1Q18 A;  3CCJ N;  1ATS A;  4NCB A;  3T69 A;  3VES A;  3EN9 A;  1G99 A;  2CH5 A;  3HSC A;  4WCE L;  4OPH A;  2JWK A;  1Y64 A;  4BRN A;  1C0M A;  4DR1 K;  3V1Q A;  4JI3 K;  4KFB A;  3VQD A;  2P9L B;  4FYD A;  1TK0 A;  3SUN A;  2QW9 A;  4E7K A;  3BDP A;  4NCG A;  4K42 A;  4YDU A;  5KPR A;  2IDO A;  3OTO K;  1CXU A;  4BDP A;  5AQX A;  1YUW A;  3AVI A;  4N47 A;  3VGM A;  3GE1 A;  5LMU K;  3HI0 A;  2P1J A;  1GLJ O;  1VSK A;  4JK9 A;  3CCE N;  5CYM A;  2FF3 B;  1VSH A;  3CMA N;  4RG8 A;  5EX5 A;  4DFM A;  2A40 A;  1W7A A;  1O13 A;  2FSN A;  1VHX A;  5EXW A;  3UKR B;  4DR6 K;  4JYA K;  2PBD A;  4BC2 A;  1YXQ A;  4AM6 A;  1N34 K;  5AZJ A;  3LPT A;  5C12 A;  3EL2 A;  2QA4 N;  3SPZ A;  4Y0W A;  2HBK A;  3ZT2 A;  4DTP A;  4HUE A;  4OVL A;  1CLQ A;  2UUC K;  4RW6 A;  3SUO A;  3QIP A;  4R5P A;  1W9H A;  5ADX A;  4W5Q A;  3HP6 A;  3TAM A;  2A5X A;  3CQY A;  3I33 A;  4F8R A;  4U67 L;  1ZYQ A;  4JN4 A;  4DR3 K;  2O8F A;  4FWS A;  2W42 A;  3EE9 A;  3KK1 A;  3ZX0 A;  4CFA A;  5DM7 L;  1K73 O;  3C6H A;  2QK9 A;  1TVR A;  1IBL K;  3WUH A;  4CBU A;  1EP4 A;  1RIL A;  3G10 A;  3L2V A;  3AVN A;  3L0Q A;  4BRK A;  2YNI A;  4FJN A;  5BRD A;  3OJU A;  1RT6 A;  1MWM A;  3A5L C;  3ISN C;  3AVC A;  4BQL A;  1A5V A;  4KAZ A;  3J7A P;  2O8C B;  4CEF A;  5FPN A;  3KKS A;  3CCL N;  3GG4 A;  3OW2 M;  1EKE A;  3KD5 E;  4JKC A;  3SV3 A;  3O3F A;  3SI6 A;  1QZ5 A;  2O4I A;  4CGI A;  4PQU A;  5AJ3 K;  4M3W A;  1RBV A;  3U3Y A;  3ZT3 A;  3QNO A;  2QWR A;  4DTX A;  4JI8 K;  3AA4 A;  3O3G A;  3HOS A;  3FLC O;  4E0D A;  1U47 A;  1T6C A;  1T05 A;  3C7N B;  4JKA A;  1S22 A;  4BC3 A;  3PX6 A;  2UU9 K;  1L3U A;  2V51 B;  2ZGZ A;  3OBY A;  4CFD A;  3WEE B;  2BDP A;  5JIC A;  3ZT1 A;  3DXK B;  3QIN A;  1WSG A;  3VTH A;  4A5A A;  1F21 A;  1KC8 O;  1S9G A;  4DSE A;  4FZZ A;  2V7Y A;  1JLA A;  1VQ7 N;  3VQC A;  3MCA B;  3OYG A;  2VWB A;  4IJN A;  1U48 A;  3WEE A;  4M3T A;  1QQN A;  5HBM A;  3QER A;  3NGI A;  1J53 A;  1C1A A;  1NKC A;  3IG1 A;  4KO0 A;  4BRH A;  3SUQ A;  1HNZ K;  4J2A A;  1BOT O;  4BRD A;  2HVH A;  3RR7 A;  4R79 A;  4DU3 A;  3MEE A;  4IBN A;  4LF9 K;  3BY5 A;  1HRH A;  4WYB A;  5C2D A;  1E3M A;  1LWC A;  5K14 A;  3AAP A;  4DQR A;  1HJR A;  4CGF A;  1OVQ A;  4CD1 A;  1U45 A;  1JCE A;  2OAN A;  1Z6R A;  1OH6 A;  4B1X B;  4ELU A;  3ENB A;  3THX B;  1ILY A;  2IVP A;  2HOE A;  1BIU A;  3ZSW A;  3V9U A;  1SKR A;  4DF8 A;  3ZSZ A;  2GTD A;  2E8A A;  2F8S A;  4NO7 A;  4CEE A;  2F4V K;  1NK0 A;  1U4B A;  3HXM A;  2Q36 A;  2FBX A;  3CJC A;  4A2A A;  2Y1J A;  2NLX A;  3DWL A;  2JGU A;  3QEP A;  1SQK A;  5JS2 A;  2YCH A;  4CZH A;  1IBK K;  1FK9 A;  3EO3 A;  4K8X A;  4B3T K;  3VN5 A;  5B8H A;  4BRM A;  2XHB A;  4AM7 A;  1XHZ A;  4FL9 A;  3MX2 A;  5BR8 K;  4L3Q A;  2W6K A;  1KVB A;  1V4T A;  4IEE A;  4BRA A;  3O08 A;  2GUI A;  4AHV A;  2OPP A;  3VQ4 A;  2FSK A;  3B6P A;  5AQV A;  4ISF A;  4JKB A;  3VQP A;  4DR2 K;  3BUZ B;  1H1V A;  5C10 A;  2O8F B;  3RRH A;  1HKG A;  2QTD A;  1YIT N;  5AQR A;  1XMQ K;  1S1V A;  1JCF A;  1B9F A;  4OX9 K;  5GIO A;  3F73 A;  1BA1 A;  4OLA A;  4CJL A;  4B1V A;  3ITH A;  3CCM N;  4E3S A;  1YVU A;  4E7I A;  4RTF D;  4IWV A;  3EKU A;  5KQD A;  5HL7 L;  3SJH A;  2E5L K;  2HVI A;  2G8H A;  5AQH A;  4QS8 A;  4KHN A;  3J81 O;  2E2P A;  4TSX A;  4BQZ A;  2GBZ A;  1NMD A;  1C0U A;  1BDG A;  2WUS A;  3H6E A;  4PKH A;  3LZI A;  1BCO A;  3O80 A;  4UY8 O;  4LY7 A;  4FJ7 A;  2FBT A;  4PHT X;  1RT7 A;  1RBT A;  1I94 K;  4M41 A;  3O9R A;  3MN7 A;  2HST A;  3RMD A;  1OH7 A;  2QWO A;  3VMF B;  3TPQ A;  3O8M A;  5KQ8 A;  1J6Z A;  4KH5 A;  3OYA A;  3TAE A;  2PYL A;  5AQK A;  4Z4I A;  1FJG K;  4CHY A;  2YHX A;  3SNN A;  3QDK A;  4B1U B;  2KLA A;  3TAQ A;  2B5J A;  5AZI A;  1A5X A;  1LWE A;  2Q97 A;  4N5S A;  2ZJQ L;  4DCH A;  3D2F B;  1N6Q A;  4DQP A;  1G15 A;  3K2P A;  4OKJ A;  3CIP A;  2ZJP L;  1NU0 A;  3C0B A;  1ZBH A;  4CZE A;  2DY4 A;  3F9M A;  4FVM A;  4AHC A;  4PWD A;  4I2Q A;  1N36 K;  3PO5 A;  4JNE A;  5F0X A;  2QM1 A;  2D5R A;  5EVZ A;  5AQI A;  2E20 A;  5AQO A;  3PY8 A;  4ZTJ A;  1BL3 A;  1C0F A;  3AVF A;  4B9M A;  3L2U A;  3QBW A;  2PAV A;  2G8F A;  3H3N O;  4LF8 K;  1YVN A;  2D0P A;  1O1W A;  4CEB A;  3SYZ A;  3NBP A;  4CD3 A;  3QBX A;  5E26 A;  1X3M A;  3CC7 N;  3NFA A;  2E2O A;  1WBD A;  4IFV A;  4NXN K;  3Q7B A;  4M3R A;  4DB3 A;  1XNQ K;  4A62 A;  5HRO A;  3Q7C A;  1M1K O;  4FM2 A;  4O8U A;  4O4G A;  4DQQ A;  3LAK A;  4B3S K;  5AQL A;  3TAP A;  1I39 A;  2PFU A;  4IOA L;  1NKE A;  4BR0 A;  4DTM A;  1DKG D;  3ZSO A;  5HRR A;  2Q2R A;  4XIU A;  1J5O A;  5AFU A;  4CES A;  4WFN L;  5JVG L;  1UA1 A;  4PY5 A;  1IG9 A;  5MLC Q;  5SWM A;  3AO3 A;  1CZA N;  3AVH A;  5H1S Q;  3AO2 A;  1Q82 O;  2ASO A;  4OO1 J;  2UXC K;  2G8V A;  2DFH A;  2Z1G A;  4DQI A;  2HMI A;  1VQO N;  1GLB G;  1Q8I A;  3T1H K;  3VA0 A;  3LDO A;  4FPA A;  1WNS A;  4FJ9 A;  1TKX A;  1NGG A;  2E6M A;  4JV5 K;  4XH1 A;  4YOX A;  1TAQ A;  3FGU A;  3MX5 A;  2RPI A;  3DLB A;  1CZB A;  1HUX A;  1HKC A;  1RBS A;  5BRF A;  4QS9 A;  4KRF A;  2FLO A;  3FZH A;  1SV5 A;  2P5O A;  4EIA A;  4DV5 K; 
#chains in the Genus database with same CATH homology
 4FLZ A;  1TKZ A;  4IDK A;  4AHU A;  2AJQ A;  3AVK A;  3HPH A;  1S1T A;  1Q9Y A;  3NH1 A;  4IKF A;  3ZT4 A;  3V9Z A;  1X9S A;  4JLH A;  4DSI A;  3I0S A;  1RBU A;  4CFC A;  4FLX A;  4DSJ A;  2E4L A;  3WNG A;  1IKV A;  2IAJ A;  4EP4 A;  3IRX A;  2ETJ A;  4DLE A;  4QCL A;  4N41 A;  1LW0 A;  2KW4 A;  1S6Q A;  3KLF A;  2G8U A;  4CGD A;  3K5M A;  4E1N A;  3OYL A;  5CZ1 A;  4DTJ A;  2ITG A;  3V6D A;  2PYJ A;  4E89 A;  4CJU A;  2XY7 A;  4KHQ A;  4FLW A;  3MXI A;  4OJR A;  4K8Z A;  3PV8 A;  4NCB A;  1IKY A;  2BE2 A;  1LWF A;  1JLF A;  3AV9 A;  2VWK A;  3KLI A;  4ICL A;  4W5T A;  1TKD A;  1WLJ A;  4BE2 A;  1C0M A;  3SPY A;  1ZBF A;  3V1Q A;  4CF0 A;  4HUG A;  4RW7 A;  1S9E A;  1HPZ A;  2RN2 A;  4KFB A;  1CXQ A;  3VQD A;  2XRI A;  3SV4 A;  4DS5 A;  3QEX A;  1XI1 A;  1TK0 A;  3SUN A;  4FYD A;  1MU2 A;  3PX4 A;  4E7K A;  4CIE A;  4DU4 A;  3BDP A;  4NCG A;  2IDO A;  3QNN A;  1SL0 A;  1CXU A;  2YKM A;  2A1R A;  1RT4 A;  3L2R A;  5DMR A;  1VSJ A;  2HHV A;  3L2Q A;  1ZBI A;  2OZM A;  4BDP A;  4B8C A;  4HVJ A;  2YNG A;  5J2P A;  3AVI A;  4N47 A;  1L3S A;  3KK3 A;  5HRS A;  3O4N A;  3NHG A;  3TR8 A;  3TAR A;  1RNH A;  2P1J A;  1VSE A;  1VSK A;  4ELV A;  1RDB A;  5CYM A;  3MAQ A;  4CGJ A;  1IKW A;  4ID5 A;  2FBY A;  4DFP A;  3JYT A;  1VSH A;  4OKE A;  5KI6 A;  3OYI A;  3AA2 A;  3C6T A;  4RG8 A;  1JLQ A;  1RDC A;  1WN7 A;  4YFU A;  4DFM A;  4AIL C;  2Z1I A;  3OYK A;  4BAC A;  1HMV A;  3LZJ A;  4DF4 A;  5T7B A;  3NH0 A;  3OYM A;  4KHW A;  3AA3 A;  3VA3 A;  3EYZ A;  3QLH A;  4CFB A;  4KB1 A;  2HHU A;  3V9S A;  4OLB A;  3LPT A;  4N56 A;  1K6Y A;  1Y97 A;  3CYM A;  1NJW A;  1TL1 A;  2G8W A;  4OKK A;  3LP0 A;  3VQ5 A;  1UA0 A;  4F4K A;  4CK3 A;  4KV8 A;  2KQ2 A;  3SPZ A;  2ZQB A;  3ZT2 A;  4IFY A;  3RRG A;  4DTP A;  4HUE A;  1RT3 A;  1BQN A;  2XY6 A;  4EZ9 A;  4OVL A;  4CED A;  1JL2 A;  1CLQ A;  4RW6 A;  4JS5 A;  4H8K A;  3OVN A;  3SUO A;  1C1C A;  1RT2 A;  4FJH A;  1LAV A;  1VSM A;  3QIP A;  1C6V A;  1GOB A;  1W9H A;  4R5P A;  4W5Q A;  3OYC A;  3CFO A;  3HP6 A;  3TAM A;  1KRP A;  3L3U A;  2OZS A;  4M3U A;  4FJ5 A;  1RT1 A;  2X74 A;  4F8R A;  1B92 A;  4PUO A;  1ZYQ A;  4W5N A;  3HL8 A;  2IS3 A;  4KTW A;  3SUP A;  1NK5 A;  2W42 A;  3KK1 A;  2Y1I A;  4CFA A;  3NDK A;  1VK0 A;  3F9K A;  4DWI A;  3H08 A;  3HP9 A;  4CGG A;  5CY4 A;  4BE0 A;  5J1E A;  2QK9 A;  1TVR A;  4B9T A;  2Q3S A;  1NJX A;  5I3U A;  4O5B A;  1EP4 A;  1NK6 A;  1RIL A;  2EX3 A;  3G10 A;  3QO9 A;  3MEC A;  3L2V A;  3AVN A;  1QE1 A;  4FCY A;  5CYQ A;  2YNI A;  2VG6 A;  4FJN A;  1VSI A;  4Z4C A;  3OJU A;  1RT6 A;  4CIF A;  4J2D A;  1RBR A;  3ISN C;  2X6N A;  2VG7 A;  1T03 A;  1BIS A;  3AVC A;  2HHQ A;  3C6U A;  3NH2 A;  2IGI A;  3EY1 A;  3CG7 A;  1A5V A;  4KAZ A;  3HJF A;  1JXB A;  4CEF A;  3KKS A;  3VQE A;  4CEC A;  5FRM A;  1KLM A;  1EKE A;  4OPK A;  3DLH A;  4Z4E A;  4N76 A;  3KD5 E;  4CF9 A;  1HNI A;  3SV3 A;  3MXM A;  4B8A B;  4QOZ B;  3NF7 A;  3DLG A;  3O3F A;  3SI6 A;  1RDD A;  3HT3 A;  1VRT A;  2EHG A;  1RT5 A;  3P5J A;  2HND A;  4AHR A;  4CGI A;  4PQU A;  2O4I A;  4M3W A;  1RBV A;  2D0B A;  3U3Y A;  3VQ8 A;  3ZT3 A;  3K58 A;  2HB5 A;  5FRN A;  3TAF A;  3I0R A;  3QNO A;  4DTX A;  4CK1 A;  3AA4 A;  3DI6 A;  3O3G A;  1QHT A;  2P5G A;  1S6P A;  4E0D A;  4FJL A;  1T8E A;  1U47 A;  1T05 A;  4WE1 A;  3S9H A;  3M8Q A;  4OGC A;  1HQE A;  3PX6 A;  1KFD A;  4F3O A;  1L3U A;  3SQ0 A;  4CFD A;  2BDP A;  3HPG A;  3OYF A;  1JL1 A;  1LAW A;  4BDZ A;  1VSL A;  2OYQ A;  3ZT1 A;  4CHP A;  1U04 A;  4LSL A;  4AH9 A;  3AO5 A;  1L3V A;  1WAF A;  2VG5 A;  3L2W A;  1ASW A;  1WSG A;  3QIN A;  3OYE A;  1F21 A;  4FLT A;  1S9G A;  1BI4 A;  4DSE A;  2B4J A;  4FZZ A;  5C24 A;  4RW9 A;  3SQ2 A;  3NF9 A;  2D0C A;  4HHT A;  2X78 A;  3TWH A;  4DTS A;  4CEZ A;  1JLA A;  3VQC A;  3K57 A;  4CJ4 A;  3OYG A;  1X1P A;  2IC3 A;  1EET A;  3IS9 A;  4DTR A;  1U48 A;  2KFN A;  4M3T A;  1TK8 A;  1QQC A;  5HBM A;  3QER A;  5D3G A;  3HVR A;  3NGI A;  3ZSQ A;  1J53 A;  1JKH A;  1R0A A;  3CFP A;  1C1A A;  2ATQ A;  4DU1 A;  3DRP A;  1SKW A;  4CJP A;  1XWL A;  1D5A A;  2Z1J A;  3AVM A;  1TGO A;  5KGX A;  1ZBL A;  1X9M A;  3IG1 A;  4KO0 A;  3LWM A;  3SUQ A;  1NKC A;  2OA8 A;  1HYZ A;  1QSY A;  4MFB A;  3B6O A;  4FK2 A;  2RF2 A;  4NYN A;  4UQG A;  1QSS A;  5C42 A;  4DSL A;  4KB0 A;  4J2A A;  2ZD1 A;  4CEA A;  1W0H A;  4FM0 A;  3QES A;  3KLH A;  4Y1C A;  1NJZ A;  3RR7 A;  3PO4 A;  4FJX A;  2F8T A;  2HVH A;  1DTQ A;  4I2P A;  4DU3 A;  1LV5 A;  4F3T A;  4Z4F A;  3LAM A;  3QEW A;  3T1A A;  3MEE A;  3G0Z A;  4IBN A;  3AVL A;  3VQQ A;  3TI0 A;  1HRH A;  1QSL A;  4KRE A;  3C95 A;  5E41 A;  1Q9X A;  2PY5 A;  3KLG A;  1LWC A;  5K14 A;  4LH4 A;  2KZM A;  4DQR A;  2B6A A;  4DG1 A;  4CJK A;  1HJR A;  4CGF A;  1HYV A;  1U45 A;  2YNF A;  3ZT0 A;  2WON A;  3NF8 A;  3ZSV A;  4C8K A;  4F2S A;  4C8O A;  1ITG A;  3LP2 A;  1L3T A;  3LAL A;  1EX4 A;  1RDA A;  5SZT A;  4FZX C;  1KLN A;  1YTA A;  4M45 A;  3QET A;  4ELU A;  1TAU A;  4BDY A;  3LDS A;  4CHO A;  1BIU A;  3U6F A;  3OY9 A;  1KFS A;  3ZSW A;  4ZHR A;  1IKX A;  1S1U A;  3ZSZ A;  3V9U A;  4KKO A;  3CM5 A;  3VQ6 A;  3WNF A;  4DLG A;  3C94 A;  4CEE A;  2F8S A;  3KTQ A;  1ASU A;  3NGZ A;  1NK0 A;  3KIO A;  3HXM A;  1U4B A;  3DOK A;  1UAX A;  3RTV A;  1NK4 A;  3RR8 A;  2FBX A;  2BAN A;  3AVA A;  3LAN A;  1ZBU A;  1S1W A;  4CJF A;  3K5L A;  2Y1J A;  2G8I A;  4Q0B A;  3TAN A;  2JGU A;  2YHA A;  4E19 A;  1WAJ A;  3QEP A;  3HST B;  5JS2 A;  1QTM A;  4F2R A;  3VQA A;  1IO2 A;  2YV0 X;  4OPJ A;  2HHS A;  2DTU A;  1FK9 A;  4C8L A;  1YT3 A;  3M8S A;  3AA5 X;  2O4G A;  4K8X A;  3ALY A;  3DLR A;  3VN5 A;  4I9Q A;  5C25 A;  1VSD A;  3L3V A;  3LPU A;  3HVT A;  2XHB A;  3S3N A;  3LWL A;  3JSM A;  1XHZ A;  3OYD A;  4QAG A;  2FBV A;  4CJE A;  3NE6 A;  1REV A;  2A1S A;  1KVB A;  3LP1 A;  4HTU A;  1FXX A;  4FLU A;  2RKI A;  2KZZ A;  3DOL A;  3A2F A;  3AVG A;  3VQB A;  3HPO A;  4DF8 A;  1VRU A;  2GUI A;  3U3G A;  3UIQ A;  2HNZ A;  2DFE A;  4GVM A;  3QIO A;  3MXJ A;  1TV6 A;  4FJG A;  3ZSR A;  4FW2 A;  4AHV A;  2OPP A;  4KTZ A;  3VQ4 A;  3B6P A;  1N5Y A;  4JRQ A;  3V81 A;  3AVB A;  3OS1 A;  2QXF A;  4CF1 A;  3VQP A;  4BE1 A;  3T3F A;  1L5U A;  1JXE A;  4Z4H A;  4FJM A;  5HP1 A;  4DTO A;  4CJT A;  4H4M A;  3RRH A;  1D9D A;  3D45 A;  1RTD A;  3EZ5 A;  1IH7 A;  1UWB A;  4E7L A;  4CHZ A;  5KTQ A;  1T7P A;  4B08 A;  2HHX A;  1S1V A;  2HHT A;  2QKB A;  1B9F A;  4CF2 A;  4E7J A;  4FK0 A;  4Q5V A;  3ZSX A;  3F73 A;  4FLV A;  3OS0 A;  2PZS A;  4CJL A;  4OLA A;  4KI6 A;  4LD0 A;  4CJ3 A;  5J2M A;  3TAG A;  3ITH A;  5HLF A;  1XHX A;  4E3S A;  3DLE A;  1WSJ A;  1NK8 A;  1YVU A;  2I5J A;  4E7I A;  4M3X A;  4B9U A;  5DK5 A;  2HVI A;  2G8H A;  4NCA A;  3ULD A;  1FKP A;  4MQ3 A;  4KHN A;  3CQ8 A;  4FJK A;  3DRR A;  2ZE2 A;  4TSX A;  3ZCM A;  1U49 A;  2GBZ A;  2VWJ A;  2GV9 A;  4CJW A;  4FM1 A;  1D8Y A;  4M3Z A;  1BHL A;  1JLC A;  1LW2 A;  1C0U A;  3KLE A;  1BQM A;  3T19 A;  4DTU A;  3PX0 A;  4FZY A;  5FDL A;  4BWM A;  2JLE A;  2KTQ A;  2LSN A;  3P83 D;  3LZI A;  1BCO A;  3DRS A;  4W5O A;  3RMB A;  4LY7 A;  3E01 A;  1VSF A;  3HM9 A;  2DFF A;  2XY5 A;  2HNY A;  4FJ7 A;  4CJS A;  4KHS A;  2FBT A;  4E7H A;  1SKR A;  1RT7 A;  1RBT A;  4FJJ A;  4B9N A;  3AVJ A;  1GOA A;  4M41 A;  3P1G A;  1S1X A;  3O3H A;  3V1O A;  3RMD A;  2E6L A;  4KHY A;  1TKT A;  5FRO A;  1SUQ A;  3SJJ A;  4YNQ A;  1J9A A;  1WSI A;  3OYA A;  3TAE A;  1SKS A;  1D9F A;  2YHB A;  2PYL A;  4KTQ A;  4J2E A;  4CHY A;  4Z4I A;  1JLG A;  2D0A A;  1WSE A;  3D0P A;  3NF6 A;  1FKO A;  4G1Q A;  1NJY A;  1YTU A;  2YKN A;  4RW8 A;  3SNN A;  1HQU A;  4GMJ B;  1UOC A;  4EP5 A;  4JS4 A;  4PA1 A;  4Z0U A;  3TAQ A;  4KHU A;  2B5J A;  2OPQ A;  1WSH A;  1A5X A;  3AO4 A;  1LWE A;  3WNH A;  3RMA A;  2WOM A;  4N5S A;  4J2B A;  3QEV A;  1CZ9 A;  4M42 A;  3M8R A;  1N6Q A;  3V1R A;  4DQP A;  3PUF A;  1G15 A;  3K2P A;  3K5O A;  4OKJ A;  3KJV A;  4CHQ A;  4O44 A;  1ZBH A;  1KTQ A;  4B9V A;  4W5R A;  2DY4 A;  2BGG A;  1C1B A;  4FVM A;  4AHC A;  4CJQ A;  4I2Q A;  3I8D A;  4PWD A;  2IOC A;  4ZTF A;  3PO5 A;  3CM6 A;  1S5J A;  4GW6 A;  4OGE A;  4H4O A;  4CE9 A;  1NOY A;  3M8P A;  5JS1 A;  2D5R A;  4BWJ A;  3V4I A;  4FJ8 A;  3OYN A;  1DTT A;  4CK2 A;  1A5W A;  3PY8 A;  1Z25 A;  4LH5 A;  2XO7 A;  4DSF A;  4ZTJ A;  1BL3 A;  2OPR A;  1NOZ A;  3AVF A;  4AHT A;  4DS4 A;  1TL3 A;  3L2U A;  3S3M A;  4B9M A;  2HW3 A;  4I7F A;  4DMN A;  1RCH A;  4EZ6 A;  2G8F A;  4FK4 A;  4KI4 A;  3TAB A;  1BGX T;  4IG3 A;  4CIG A;  1KCF A;  2Z1H A;  2XY8 A;  2R7Y A;  4DQS A;  1RTI A;  1O1W A;  1JLB A;  5EU7 A;  3HO1 A;  4CF8 A;  4Z4G A;  4CEB A;  4E1M A;  4JRP A;  3SYZ A;  3NBP A;  1TK5 A;  4HCC A;  3K5N A;  3KD1 E;  3NFA A;  4DSK A;  2F96 A;  3NCI A;  3NAE A;  1KVC A;  3BGR A;  4DFJ A;  4ELT A;  4IFV A;  2NUB A;  4RW4 A;  4Y1D A;  4C8N A;  1KSP A;  3FFI A;  4M3R A;  3AO1 A;  4B9L A;  3OJS A;  1B9D A;  1BCM A;  1BIZ A;  3WNE A;  5HRO A;  1RTH A;  4CCH A;  4HUF A;  4I9L A;  3IAY A;  2P51 A;  4FJI A;  4FM2 A;  3HYF A;  3KKR A;  4IG0 A;  3K59 A;  4O4G A;  4DQQ A;  5KRT A;  4DFK A;  4HCB A;  3LAK A;  4O0J A;  3TAP A;  1EXQ A;  1I39 A;  4CEQ A;  5HRP A;  1SL1 A;  1NKE A;  5HRN A;  4B9S A;  4DTM A;  2FC0 A;  3ZSO A;  4O55 A;  5HRR A;  4O0I A;  4XIU A;  3LP3 A;  3SCX A;  4CEO A;  1SL2 A;  4CGH A;  3HK2 A;  3MED A;  4ID1 A;  1NK7 A;  1QS4 A;  1NKB A;  1J5O A;  1RTJ A;  3OS2 A;  3VQ7 A;  4CES A;  1DLO A;  1UA1 A;  2QKK A;  3MEG A;  4PY5 A;  3DMJ A;  1GOC A;  3DLK A;  3NGY A;  4CJV A;  1IG9 A;  4CJ5 A;  5SWM A;  3AO3 A;  4CHN A;  4LSN A;  3AVH A;  4C8M A;  3DYA A;  3KK2 A;  1X9W A;  5J2N A;  3AO2 A;  3ASM A;  3SQ4 A;  1C0T A;  4FXD A;  2OPS A;  3CFR A;  2G8K A;  5CZ2 A;  3ZSY A;  1XC9 A;  3OYB A;  4CER A;  3V9W A;  2DFH A;  2G8V A;  1BI4 B;  2Z1G A;  3VQ9 A;  4DQI A;  1JLE A;  2HMI A;  1J54 A;  3SZ2 A;  1Q8I A;  1NK9 A;  3VA0 A;  5KGW A;  1KVA A;  1WNS A;  3V9X A;  4FJ9 A;  2KFZ A;  1I3A A;  1WSF A;  1ASV A;  5KRS A;  4AHS A;  1TKX A;  3RWU A;  4KPY A;  4B3O A;  4FW1 A;  5I42 A;  3DM2 A;  3OYH A;  2E6M A;  4FLY A;  3THV A;  4L8R B;  1TAQ A;  3O4Q A;  2RPI A;  1HNV A;  3DLB A;  3SQ1 A;  4M3Y A;  1CZB A;  3S3O A;  1RBS A;  2YNH A;  4CJR A;  3OYJ A;  3QEI A;  1Z26 A;  3L8B A;  4KRF A;  2HHW A;  5J2Q A;  1HYS A;  1SV5 A;  3RMC A;  4DTN A;  2X6S A;  2P5O A;  4NYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...