1VSJA

Asv integrase core domain with cd(ii) cofactors
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords INTEGRASE
publication title Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects on enzymatic activity.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 50
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsjA00
1JKHA 2KW4A 4Q5VA 1JLAA 1QSLA 1KLMA 4CCHA 1NOZA 3DLRA 2A1RA 5J1EA 3ALYA 1D9DA 3M8SA 3QESA 2GUIA 4LSNA 1L3VA 1ZBLA 1FKPA 4CHNA 4HTUA 4CGGA 1D9FA 4B9LA 4DSEA 2OPPA 4C8MA 4DLEA 4ELVA 1J54A 4K8ZA 2ATQA 3NF8A 3L2UA 1SKSA 4W5TA 1D8YA 3IG1A 4AHVA 3ZT1A 5HRRA 3VQEA 3AVNA 4AHSA 3HK2A 1RT1A 3PX0A 5DK5A 5CYQA 3LANA 1U4BA 3VQ4A 4FZXC 4O44A 3G0ZA 3F73A 2LSNA 1U48A 1W9HA 2A1SA 1HQEA 4O0IA 2OZMA 3S3MA 1FKOA 4Z4CA 1L3SA 4FYDA 3L2QA 1SV5A 3TABA 1W0HA 5EU7A 1NK9A 4CGDA 4OLAA 3AVIA 3C6TA 1VK0A 5KRTA 3DRSA 4FJ5A 2E6MA 4KFBA 1Z26A 3NH2A 3TWHA 1TKTA 4B9MA 4DTJA 3RRGA 3ZT2A 4N41A 3WNFA 3CM5A 3KK1A 1XHXA 4H8KA 3ZCMA 4KI4A 3SQ4A 4DSIA 4AHRA 1SL0A 1S1WA 3BDPA 4FLXA 3QNOA 4GVMA 2PYJA 3KTQA 3C6UA 1T7PA 4DSFA 3THVA 2VWJA 4ELTA 2P5OA 4CEAA 3KLFA 3CG7A 2E4LA 2P51A 3AVHA 3ZSXA 5KI6A 4CJFA 4CF2A 2Y1JA 3HPOA 3SV4A 2KFZA 4M3ZA 4CEZA 4CEDA 3RMBA 1RT4A 3AVAA 4I7FA 4MFBA 3SPYA 4IG3A 4HVJA 4CJPA 1S1UA 3ULDA 4EP4A 3HYFA 3OVNA 3KKRA 4CIFA 4RW9A 1BIUA 3QEVA 3OYKA 3PUFA 5I3UA 5CY4A 2HMIA 4FXDA 2O4IA 2HVIA 3B6OA 4DTMA 3MAQA 2HHUA 3L3UA 1ZBFA 3I0RA 4AHTA 4EP5A 2GBZA 1RT5A 2B5JA 1QQCA 2FBXA 1NJXA 3OYBA 3SUNA 4CESA 4ID5A 3QEIA 1U04A 3NDKA 4DFPA 3VQ7A 4FK2A 4CE9A 3C95A 1KFSA 4KHNA 1HPZA 3IRXA 4AH9A 4CEEA 4CGHA 1UOCA 4CF9A 5T7BA 5J2NA 4DSLA 1XHZA 3KD1E 4PUOA 4FZZA 1CZ9A 1VSMA 3KIOA 1Y97A 3E01A 2DTUA 3VQ5A 2VWKA 3O3FA 3AA2A 1Q9XA 1QSSA 1JLEA 4RW7A 4F4KA 1LAWA 1WSIA 3OYIA 2WONA 3ZT4A 4OJRA 3V9UA 4CFAA 2Z1IA 3L2VA 3MXJA 5J2PA 3AO2A 1T8EA 4M3XA 2W42A 1A5VA 3OY9A 2KZMA 2X78A 3K59A 4I2QA 4DTOA 1FK9A 2G8HA 5JS2A 3CQ8A 4HUGA 3V9WA 1RTDA 3DMJA 4YNQA 4FJLA 1S1XA 3TAFA 5HROA 5C42A 2Z1GA 3CFRA 2HHVA 4UQGA 2XY6A 2YNIA 3LDSA 3LAMA 3NH1A 4CF1A 4JRPA 3PO5A 4N76A 1TKZA 2D0AA 2YNHA 1TV6A 3OJSA 3VQ8A 3L8BA 3SYZA 3HVRA 4DTSA 1IG9A 4JS5A 1TAQA 1T05A 1IKYA 3H08A 5KTQA 5FRNA 4FZYA 3QEXA 2B6AA 1HJRA 2B4JA 1NJYA 1JL1A 2P5GA 3FFIA 1B9FA 3HXMA 2YKMA 3F9KA 4DS4A 1JL2A 1WAJA 3LP2A 4H4OA 1LAVA 4CHOA 1X9WA 3OYNA 3IAYA 4DU3A 5HRPA 4IBNA 5C24A 3VQDA 4CJ5A 4CK1A 2E6LA 3G10A 4DTPA 4NCBA 2GV9A 3SZ2A 4FJ9A 1VSIA 4QAGA 4M45A 3OYJA 3OYMA 4DTUA 4DSKA 1A5WA 5CZ1A 1MU2A 3VA0A 1RTJA 3S9HA 4FK4A 4KAZA 1VSKA 4F2SA 3TR8A 4CEQA 4J2DA 1HNVA 2RF2A 4CFBA 4CHQA 4KHUA 1J53A 4KTWA 4CERA 1WSGA 3RWUA 2BANA 1RDDA 5FROA 4FJGA 3NBPA 1DLOA 3NF6A 2Q3SA 3WNGA 4CGFA 3RMDA 1RBSA 1BI4B 3K5MA 5E41A 1JLGA 2P1JA 1TL1A 4FVMA 1QTMA 1ZBHA 1L5UA 3M8PA 4M3YA 4PQUA 1NKCA 4E19A 4LD0A 2G8WA 3L2RA 5HLFA 4FLTA 4CK2A 3CFPA 4Z4EA 3OYCA 3QIPA 4DQQA 4CEBA 3AVKA 3V9ZA 1Q9YA 4CJ3A 5CZ2A 3SQ0A 3ASMA 3HVTA 4OPKA 3JSMA 1BL3A 4XIUA 3OYHA 1JLBA 1RT3A 4DQIA 3AA4A 3UIQA 1C0UA 3SUQA 2HB5A 4I9LA 3V1RA 1C1AA 3NGYA 3L2WA 1BGXT 4DTXA 1NK6A 3D45A 1HRHA 3NH0A 4DWIA 4C8LA 2KTQA 2IOCA 1N6QA 5CYMA 1EP4A 1HQUA 4CECA 4DFMA 5J2QA 2IAJA 3MEDA 3TANA 3RMCA 1VSLA 4FW2A 1J9AA 3AA5X 4K8XA 3LWMA 1VSHA 4FJKA 4F3OA 4Z4HA 1B9DA 3AO3A 1WN7A 1NJWA 4OLBA 4CEFA 1BIZA 1RBRA 1VRTA 3OS0A 1NKEA 1HYSA 4Z4GA 3LPUA 3PX6A 1LW0A 1TKDA 3QEWA 1RDCA 1S5JA 4H4MA 4FJJA 1LW2A 3SI6A 4DTRA 4KHQA 2HHWA 3ZSVA 3LWLA 1SKRA 4E0DA 4M3TA 3QO9A 4CHZA 4GW6A 5HRSA 3VA3A 4HCBA 2HVHA 3QERA 2DY4A 4CFCA 4CJEA 4CHPA 4E89A 4BE1A 4JRQA 3VQCA 1T03A 4DFJA 3HJFA 3ZT3A 4FM0A 2G8UA 4N56A 1NK0A 1XWLA 4MQ3A 4AILC 1RTHA 2XY7A 5KGXA 5FRMA 1C1BA 1NKBA 3AVCA 3O4NA 1N5YA 3RR8A 3NAEA 4KHYA 1LWFA 4W5NA 3SUOA 2F8TA 1RBUA 1X1PA 2DFEA 1L3UA 2AJQA 4DTNA 4F2RA 2OYQA 1C1CA 3U3YA 3I0SA 3RMAA 1RDBA 5HP1A 4KHWA 3HO1A 1VSEA 1IO2A 4KO0A 4CGJA 2FBYA 1ASWA 5HRNA 1QS4A 3DLBA 2YHAA 4KTQA 4IG0A 1NJZA 4B8AB 3LZIA 4CF8A 3V9SA 2KFNA 1RBVA 1REVA 3B6PA 4O4GA 3RR7A 2IGIA 2YKNA 2XRIA 3QLHA 3SPZA 1S6PA 2NUBA 3OYGA 4AHCA 3KD5E 2XY8A 1WSEA 3A2FA 4KB1A 3TARA 1S9GA 3AO4A 3CYMA 1HMVA 2KQ2A 4CK3A 1X9SA 3V1QA 4FLYA 3K2PA 1ZYQA 3RTVA 2PY5A 3AVFA 2WOMA 3DI6A 1KRPA 4Q0BA 4PA1A 3K58A 2DFFA 4N47A 1BQMA 4FJHA 3RRHA 2DFHA 4AHUA 3PV8A 3KK3A 3S3NA 3HT3A 3KK2A 3QNNA 4FCYA 4O5BA 3PX4A 4B9VA 2ZQBA 3OYEA 4KHSA 3AO5A 2IC3A 2Y1IA 3BGRA 1C6VA 2OZSA 2HHXA 1L3TA 3DM2A 2HHSA 3LP1A 4IKFA 4CF0A 1KVAA 4FK0A 1RNHA 1LWCA 4BE2A 3SJJA 3V81A 1JXEA 2HHTA 3P5JA 1BISA 3NE6A 3MXMA 1XC9A 3HPGA 1ZBUA 1VSFA 2VG7A 4OPJA 2XY5A 4KPYA 3ZSWA 4CJKA 3IS9A 4HUEA 1LV5A 3CFOA 3K5NA 5C25A 1DTTA 1SUQA 4KTZA 2FC0A 3ZSOA 1S6QA 1NK7A 1KCFA 4BACA 1RILA 2IDOA 4B8CA 3OYAA 4E7JA 4QOZB 2XO7A 4B3OA 2QKKA 4LH5A 1WAFA 1IKWA 1HNIA 3DOLA 4ICLA 1QSYA 4DSJA 4Z4IA 4CIGA 3KLGA 3I8DA 1NK8A 2F8SA 3KLHA 3T19A 3ITHA 4NYFA 2HW3A 1TL3A 1TGOA 3NCIA 4Z4FA 2YNFA 3VQ6A 2XHBA 4E1MA 3AVJA 3JYTA 2G8KA 4CJRA 3P83D 4DLGA 2JGUA 1K6YA 2F96A 2JLEA 2EX3A 3VQAA 3ZT0A 4YFUA 3NGIA 1TK8A 3DLHA 3L3VA 1SL1A 4B9SA 3NF7A 4I2PA 2KZZA 4ZHRA 1IH7A 3NFAA 3KJVA 2D0BA 3ZSRA 2YHBA 2RPIA 1R0AA 3DOKA 1RTIA 4FLVA 4CJQA 3HPHA 2G8IA 4CJTA 2X74A 3V4IA 3KKSA 2BGGA 2YNGA 3HSTB 4LH4A 4TSXA 4M42A 2QK9A 3SQ1A 4E7KA 1CXQA 3SNNA 1DTQA 1HYVA 3NGZA 3EZ5A 3PY8A 4EZ9A 1UA0A 4C8KA 3K57A 3LALA 1S9EA 1KVBA 3AA3A 4KRFA 3LPTA 1C0TA 3P1GA 4DF4A 2G8FA 3QIOA 3K5OA 1JLFA 4CJWA 4PWDA 1QHTA 4RG8A 3LZJA 4KREA 4BDZA 4OGEA 3O3GA 5FDLA 4QCLA 1U45A 1GOBA 4E1NA 1IKXA 3DRPA 3OYFA 3SV3A 3HL8A 2RKIA 2YV0X 4CJ4A 4B9TA 1YVUA 4CJLA 3DRRA 5SWMA 2OA8A 2ZD1A 4B9UA 4M3RA 3OYLA 1KVCA 3HP6A 4ELUA 4PY5A 4RW4A 2X6SA 1Z25A 4O0JA 4FLWA 2HHQA 2OPQA 2PZSA 4J2AA 5K14A 4FJ7A 4KB0A 3VN5A 3MECA 3KLIA 4BDPA 4RW8A 1JXBA 1ITGA 4CHYA 3TAGA 4RW6A 3TAEA 4M3UA 1I39A 4FJ8A 4KI6A 4DU4A 3PO4A 3WNHA 4DF8A 5I42A 3V9XA 4ZTJA 4CGIA 3OYDA 3CM6A 3TAQA 3DLKA 4J2BA 3VQPA 4ZTFA 2OPSA 5D3GA 1TK5A 3NF9A 3MEGA 3HM9A 4DS5A 4IFVA 1C0MA 2HNZA 3ZSZA 1RDAA 4FM2A 5J2MA 1KTQA 2EHGA 1BCMA 4DMNA 1JLQA 2QKBA 4FJNA 4DU1A 1NK5A 1ZBIA 4LY7A 1UWBA 1JLCA 1CLQA 1LWEA 3DLGA 4DG1A 4JLHA 3O4QA 1UA1A 3V1OA 3VQ9A 1WNSA 2QXFA 4L8RB 3LP0A 2FBTA 3D0PA 1J5OA 4C8OA 1TK0A 3AVBA 4B08A 4JS4A 1WSFA 3T3FA 4CFDA 4O55A 4DQSA 4IDKA 1KFDA 4FJMA 4ID1A 4BWMA 1XI1A 1YTUA 4OKJA 4GMJB 1IKVA 3LP3A 3MEEA 4Y1CA 3MXIA 1RT6A 4FLUA 1U49A 5JS1A 2OPRA 3NHGA 1SL2A 1CXUA 1EXQA 3HP9A 2ETJA 1GOAA 3TI0A 3T1AA 3AO1A 3VQBA 2R7YA 4FJXA 2VG5A 3ZSQA 4W5OA 1X9MA 3ISNC 4E3SA 1KSPA 3U6FA 1VSJA 5HBMA 2I5JA 4KKOA 1VSDA 1KLNA 1U47A 1B92A 3TAMA 4R5PA 3M8RA 3DLEA 2Z1JA 4FLZA 3TAPA 2Z1HA 2X6NA 3AVGA 4F8RA 3VQQA 2FBVA 1TKXA 2D5RA 3OS1A 1F21A 1D5AA 1BCOA 2RN2A 3S3OA 4E7HA 1WLJA 1CZBA 3SUPA 4FJIA 4NCAA 4BWJA 4IFYA 3QEPA 2ITGA 2VG6A 1FXXA 4E7LA 4C8NA 1WSHA 4NCGA 4DQPA 1NK4A 4FW1A 4CJUA 1BQNA 3LAKA 1BI4A 5DMRA 2IS3A 3OS2A 4HUFA 4B9NA 1QE1A 3QINA 1EETA 4KV8A 3K5LA 3KLEA 2O4GA 1EKEA 5KGWA 4DQRA 4G1QA 1BHLA 1WSJA 4CJSA 4E7IA 4NYNA 4M3WA 4EZ6A 2BDPA 3AVMA 1S1TA 1TVRA 3U3GA 3WNEA 1GOCA 3C94A 1UAXA 4OKEA 1SKWA 1RT7A 1YT3A 4OGCA 4N5SA 1O1WA 1A5XA 4HHTA 4BE0A 1VRUA 3EY1A 3EYZA 4WE1A 2HNYA 1Q8IA 2HNDA 2G8VA 3OJUA 5SZTA 1NOYA 3SCXA 3M8QA 4W5RA 4M41A 3DYAA 1G15A 4J2EA 1TAUA 3AV9A 2D0CA 2BE2A 4F3TA 4Z0UA 4OKKA 4FM1A 1RBTA 1HYZA 3QETA 4I9QA 4HCCA 4LSLA 4BDYA 4DFKA 1S1VA 3ZSYA 1EX4A 3V6DA 1RCHA 4CEOA 1ASVA 1I3AA 1ASUA 4CJVA 4CIEA 3AVLA 5KRSA 3O3HA 4W5QA 2ZE2A 3SQ2A 2PYLA 4OVLA 1RT2A 1YTAA 4Y1DA
chains in the Genus database with same CATH superfamily
4B3RK 4FWSA 1JKHA 2V7ZA 1KLMA 1NOZA 5MLCQ 2A1RA 2GUIA 4LSNA 3ZX3A 1NLVA 4HTUA 5C15A 4U67L 4DSEA 4J2EA 3EKSA 4YY3K 3VQEA 3LANA 4H0PA 1U4BA 3SAHA 2Q0UA 3F73A 2LSNA 4JK8A 3OW2M 5TKWA 1S3XA 4Z4CA 2KHOA 4FYDA 3L2QA 3TABA 1W0HA 4CGDA 4EHUA 1VQ5N 5KRTA 2UXDK 1VQKN 4B9MA 5FPEA 3WNFA 3CM5A 3KK1A 2CH6A 2GUPA 4JKHA 4KI4A 3O9SA 4DSIA 4DV0K 1OVQA 1S1WA 3C6UA 2VWJA 4ELTA 4FWQA 4CJFA 2Y1JA 1HYSA 4ISFA 2KFZA 1BOTO 3DXMA 4M3ZA 4CEZA 4H5NA 1RT4A 4I6MB 3SPYA 4FWKA 4PKGA 5BRHA 2NRVA 5EVZA 3HYFA 4CIFA 5C0YA 5GAGP 4FXDA 1BIUA 3QEVA 2HVIA 5CY4A 2FLOA 2H3GX 4JKFA 3HSCA 3MAQA 4NLCA 4AHTA 3UB5A 4CI6A 5CE3A 2B5JA 3SUNA 4DR5K 2O8BA 3QEIA 3VETA 3VQ7A 3F5TA 4KHNA 1R59O 4CEEA 4CGHA 5T7BA 1XHZA 1CZ9A 1NGCA 5FPMA 1Y97A 3E01A 3O3FA 1EQYA 3ZT4A 3V9UA 4CFAA 3DXKA 3AO2A 3OY9A 4OPHA 4I2QA 5BN8A 4DTOA 3CCSN 3CQ8A 3V9WA 2CGJA 4UQGA 4WQ4A 4A62A 3NH1A 4FOIA 3VQ8A 1C0GA 4IEEA 4IWVA 1EWRA 1SZ2A 3H08A 1NGDA 1VQON 1BU6O 2B4JA 2DPNA 1JL1A 1NJYA 2P5GA 1B9FA 2WBNA 5AQWA 1KQSM 4A5AA 3LP2A 1LAVA 1IJJA 1XNQK 3FZMA 2F9TA 4IBNA 5C24A 1MDUB 4CJ5A 2EWSA 2NRWA 3CF5L 2GV9A 4PWDA 4QAGA 5H1SQ 3OYJA 2VQFK 1MU2A 2E2OA 4QS9A 1WSGA 2BANA 4FJGA 3NBPA 3NF6A 4DR3K 1RFQA 4ILGB 4JI4K 1OH8A 4M3YA 3M8PA 1E4GT 1XMOK 4PQUA 4LD0A 3L2RA 2ITMA 3CFPA 1TUUA 1MA9B 4WF9L 3UKRB 5CZ2A 3ASMA 4OPKA 3JSMA 2VQEK 1BL3A 1JLBA 1RT3A 4F9OA 2Q36A 3D45A 3NH0A 4C8LA 1WUAA 5LMUK 1N6QA 5CR4A 5J2QA 4IZ9A 1Z05A 4FW2A 3RMCA 3AA5X 1VSHA 4YHHK 3R8EA 2BTFA 4FJKA 1N36K 3AO3A 4CEFA 1BIZA 1RBRA 4RTFD 2YHYA 4JI7K 1NMNA 3M5RA 1S5JA 1LW2A 4DTRA 3LWLA 5M1OA 4E0DA 4GW6A 5HRSA 3VA3A 3VEWA 2E2QA 5AQYA 2NRHA 3UKUB 4FWMA 3C7NB 3L0QA 4CFCA 4CJEA 4YDUC 4IJNA 2YI1A 3VQCA 1T03A 5AQXA 3L6QA 2A41A 4FM0A 3ZEUA 1XWLA 4NXMK 2FF3B 1X3NA 5KGXA 2XY7A 3O4NA 1T44A 3NAEA 1LWFA 4W5NA 3SUOA 2AJQA 3PIPL 4DTNA 3VEYA 4CGJA 4KH6A 3O9TA 4IG0A 1TYQA 3MWTA 2KFNA 1RBVA 3B6PA 3SPZA 1U2VB 4BC3A 3VGKA 2HHWA 1IV0A 2KQ2A 3V1QA 5GAEP 1OVYA 4CZKA 4Q0BA 3K58A 1RDUA 4JI6K 1VAZA 3S3NA 4IOXA 3HBTA 4CD3A 4YOYA 2P9KA 3PX4A 4B9VA 2ZQBA 3AO5A 2Y1IA 2OZSA 2WFBA 4BRHA 4YOTA 3DM2A 3DLLL 4JD2A 1LWCA 1X3MA 3CI5A 4MO5A 1JXEA 3V81A 4DR6K 3QBWA 3NE6A 2HF4A 3LDPA 1VQLN 1ZBUA 3MMVA 4OPJA 1LV5A 3CFOA 3K5NA 4H0TB 1DTTA 4KTZA 1HKBA 2FC0A 4BRGA 4E1JA 1S6QA 3U9DA 2IDOA 3OYAA 2CGKA 2XO7A 1WAFA 3CJAA 4EHTA 4AM6A 4ICLA 4PHTX 5C12A 4Z4IA 4CIGA 3H45C 3KLGA 3PSFA 2F8SA 3ITHA 4FWPA 1TL3A 1TGOA 3NCIA 4H5WA 4Z4FA 4E1MA 3AVJA 1HKGA 4CJRA 4DLGA 5EY4A 3HTVA 3NF7A 4ZHRA 3VERA 5BR9A 1IH7A 3N4QA 3FZKA 2D0BA 3ZSRA 4FLVA 4CJQA 3HPHA 2G8IA 4CJTA 4PL7A 3CETA 3KKSA 4GVEA 3HSTB 3SNNA 1CXQA 4EZ9A 4B1ZA 1UA0A 3K57A 3BF1A 1GLAG 3AA3A 2Q2RA 3LPTA 3OBYA 4X66K 2G8FA 3VTIA 3O1WA 1QQMA 3C65A 1JJ2M 2D4WA 4I6MA 4RG8A 3LZJA 5M1QA 4BDZA 4OGEA 5FDLA 1IKXA 3SV3A 4M7YA 3EO3A 4CJ4A 4B9TA 4CJLA 3DRRA 4LF8K 3HP6A 2A5XA 3ZLJA 4O0JA 4CBXA 3I55N 2PZSA 3SLCA 3KLIA 5CHIA 3MN5A 4CHYA 3TSPA 3TAGA 4M3UA 3KZBA 4DU4A 3PO4A 2VCPA 3WNHA 2O8FB 4ZTJA 3OYDA 3CM6A 2QWPA 3VQPA 5AQUA 3U8XA 2P9UB 3NF9A 1CZAN 2IVOA 3HM9A 3TSQA 2RE2A 2W6KA 2ZJPL 2EHGA 3CQYA 5ELZA 1NMDA 1N34K 1ZBIA 5GADP 1JLCA 1LWEA 4DG1A 4CVNE 1FW6A 3KHYA 3CJ7A 3O4QA 1UA1A 3CMEN 4LF7K 2QXFA 3LP0A 3D0PA 1J5OA 4B08A 1YF5L 2VYPA 3HOTA 4JS4A 1ESVA 1J6ZA 4BWMA 3AARA 1XI1A 1YTUA 5LMNK 1IKVA 5JS1A 2E20A 1CXUA 2CH5A 3HP9A 4FJXA 3ZSQA 1X9MA 4E3SA 1KSPA 3U6FA 2I5JA 4QS7A 4KKOA 1VSDA 1BWFO 3TAMA 3M8RA 2X6NA 4H0VB 4F8RA 1KAYA 2FBVA 2D5RA 1BCOA 4FJIA 3F2KA 1WLJA 3O80A 4NCAA 3QEPA 1VQ4N 4O8UA 4NCGA 1BQNA 1YJNN 3LAKA 3IKMA 4HUFA 4BR5A 4LF5K 1GLCG 3KLEA 4JN4A 2O4GA 1Q81O 1EKEA 5KGWA 4G1QA 1E3MA 4NYNA 4CZHA 2PBDA 3UKRA 2BDPA 1TVRA 3FGUA 3CCLN 1SKWA 4GKJK 4JKDA 1O1WA 1A5XA 4HHTA 5AZIB 4WE1A 2HNDA 5SZTA 3SCXA 2ASMA 5BRFA 1TAUA 3AGRA 4CBWA 2BE2A 4H0YB 1HYZA 4DV2K 4BDYA 1S1VA 5IWAK 3W3DA 1ASVA 4CJVA 2PYLA 1YTAA 3WQUA 2KW4A 1JCEA 3LL3A 4H5VA 3UKUA 3C7NA 5J1EA 3QESA 1L3VA 2V51B 3M1FA 1FKPA 1HNZK 4B9LA 1Q82O 2OPPA 4C8MA 4DLEA 2ATQA 4KHPK 3W0LA 4BRFA 4W5TA 1D8YA 1S22A 5HRRA 1RT1A 2FSKA 4PKIA 1XNRK 1U48A 2A1SA 1FKOA 5KQ8A 5EU7A 1NK9A 4ILJA 5AQFA 2E6MA 1Z26A 1TKTA 4A57A 4H8KA 5BR8K 5M1PA 3CCVN 3O1BA 5AFUH 3BDPA 4FLXA 3QNOA 4GVMA 4LF9K 4DR4K 4CEAA 3CG7A 3KWIA 5KI6A 4DV4K 1NG9A 4B3MK 3ZETB 4IG3A 1Q18A 2E5LK 1KD1O 2O4IA 3OYKA 3CXCM 5I3UA 3B6OA 2HHUA 4H03B 1ZBFA 3J7YP 2GBZA 1RT5A 3CJ9A 1NJXA 2NNWA 4A5BA 5AQSA 1U04A 3NDKA 4CE9A 1HNWK 4B9QA 3MCAB 4C1NI 5BPMA 4AH9A 4FL9A 5J2NA 3KD1E 4FZZA 5M1KA 3GBTA 1QSSA 3G71N 1LAWA 3GE1A 2V7YA 4BR2A 4FPBA 1EO1A 4BC5A 1T8EA 5AQHA 2KZMA 3K59A 4BG9A 2G8HA 3QFPA 2P9IA 3TAFA 2F7TA 4JYAK 2XY6A 2YNIA 3HI0A 3LAMA 4CF1A 2YNHA 3OJSA 3E1YA 4DTSA 1NGJA 3CCMN 5KTQA 4FZYA 4A61A 4QS8A 3LDLA 1HJRA 3FFIA 1VQ8N 4DV6K 4DS4A 4H4OA 1X9WA 3IAYA 3CPEA 2QTDA 3H1QA 4CK1A 5GAHP 3CQXA 4NCBA 4FJ9A 4H0OA 4M45A 1A5WA 3S9HA 1RTJA 1VSKA 4F2SA 4OX9K 2RF2A 2YX6A 3E66A 1KXPA 4CERA 2NRTA 3WNGA 4CGFA 2Q3SA 2QM1A 3H1VX 3K5MA 1BI4B 4DV7K 1IBLK 1L5UA 1NKCA 4E19A 5HLFA 4FLTA 2O8FA 4DQQA 3QDKA 3AVKA 3JXUA 4DV1K 1BA0A 2P9UA 1HJOA 3WXIA 3Q7BA 3O4WA 4EFHA 2KLAA 3O6WA 4XIUA 3OYHA 3UIQA 3AA4A 1MWKA 3L2WA 1C1AA 3A5NC 2KTQA 2IOCA 5GINA 3ENHA 2UUCK 1J9AA 2ZJRL 3MN7A 3ENOA 4WFBL 1WN7A 1NJWA 1T6CA 2RHKA 3OS0A 4Z4GA 4DB3A 4YOXA 4KHQA 3VF2A 4JKCA 3ULEB 4HCBA 3QERA 3T1YK 4CHPA 4E89A 1I94K 2AP1A 4JRQA 4CZFA 1NU0A 5B8HA 2G8UA 3P39A 1NK0A 3RSEB 1OH7A 1KAXA 3AVCA 3RR8A 4B1VA 1KAZA 2F8TA 4BROA 1RBUA 2OYQA 1C1CA 3AAQA 3RMAA 1RDBA 4B1UB 1IO2A 4KO0A 4JKAA 1QS4A 2A42A 2E1YA 3H6EA 3TSUA 3LZIA 3J80O 1V4SA 4O4GA 2IGIA 3AGKA 3QLHA 5LL6Z 1YIJN 1S6PA 3RR7A 2XY8A 1WSEA 3AO4A 1HMVA 3AVFA 2FSNA 2WOMA 3DI6A 2I7PA 4N47A 4FJHA 3KK2A 5AZIA 4O5BA 4EAHD 5BRDA 1EWQA 2IC3A 3BGRA 2P9LB 2ZGZA 4ISEA 1NBWA 4BE2A 3P38A 4BC4A 3MXMA 3HPGA 1QHAA 1OH6A 3ZSWA 3E9LA 4H0XB 3ZSOA 5I9EB 1RILA 4KBOA 4B8CA 4E7JA 1NGBA 4H5RA 3I8DA 1NGIA 1NK8A 3QFUA 1ZXOA 3C6AA 3O9UA 2HW3A 3SMSA 3CCUN 2WC9A 5AQIA 3I56N 2EX3A 3VQAA 3ZT0A 3NGIA 3L3VA 4I2PA 5E26A 2KZZA 4KH5A 2PFUA 3KJVA 1C0FA 2YHBA 3DOKA 4JHDB 1XMQK 1K73O 2BGGA 1X9JA 4E7KA 1DTQA 1HYVA 3T7ZA 3NGZA 3EZ5A 3PY8A 1GLBG 2QWRA 3LALA 4KRFA 4DKWA 3P1GA 4B3SK 3QIOA 1JLFA 4CJWA 4CJ7A 1QHTA 1QQOA 2HOEA 3ZETA 1NGFA 2VGMA 3SJHA 4QCLA 1BG3A 1GOBA 4FPAA 3C6HA 3DRPA 3HL8A 2RKIA 1YVUA 2OA8A 4BR4A 4B9UA 4MDAA 4PY5A 5FPNA 5AQKA 4YORA 4J2AA 4KB0A 4RW8A 4RW6A 3SK3A 4KI6A 4FJ8A 2GX9A 3THYA 3V9XA 4G9ZA 3DLKA 4ZTFA 3MK6A 2OPSA 4BRPA 3MEGA 4IFVA 3N4PA 3ZSZA 4FM2A 4M3XA 1KTQA 1BCMA 1JLQA 1RDWX 2QWLA 2QXLA 1NK5A 4LY7A 4YOVA 4IO9L 4GY2B 1HPMA 4L8RB 1WSFA 4DQSA 2A3ZA 1KFDA 2PAVA 4Y1CA 1K8KB 1SL2A 5JVHL 1EXQA 5A2QO 2ETJA 1GOAA 3AO1A 2R7YA 4BVPA 3A5LC 4BY9C 3EEQA 4OPAA 5HBMA 1ATRA 4C23A 3FZHA 4BRCA 1U47A 5AQOA 3AVGA 3D2EB 1TKXA 4B1YB 2JWLA 4JI5K 4E7HA 1CZBA 3SUPA 3H46O 4IFYA 2ITGA 2VG6A 3VENA 2FXUA 4CJUA 1BI4A 2ASOA 2QWQA 2IS3A 3B8AX 4NXNK 1OKJA 4PKHA 1QE1A 1EETA 4FWNA 2QWNA 2VGNA 3D2FB 3LM2A 2VWBA 2BUPA 2D0PA 3BUZB 1SAZA 1S1TA 3U3GA 3CCEN 2HBJA 3C94A 4OGCA 4N5SA 3R1XA 4BE0A 3BF3A 4CW7B 2P9IB 4BRDA 1ZBSA 4LF6K 3J8AA 1G15A 2D0CA 4F3TA 5JVGL 5GIPA 4BRNA 4LSLA 3V6DA 1I3AA 1ASUA 3O3HA 5KRSA 3QICA 4W5QA 2ZE2A 4Y1DA 3ULEA 4Q5VA 1JLAA 1QSLA 4CCHA 5AQZA 3ALYA 5ADXH 1ZBLA 4CHNA 4ELVA 4CGGA 1D9FA 2GTDA 4K8ZA 3L2UA 4BC2A 1DGKN 5JLHA 5EOYA 3IG1A 3RSEA 4AHVA 4MO4A 3ZT1A 4AHSA 2UXCK 5DK5A 5CYQA 3VQ4A 4O44A 4XEIA 1HQEA 3QB0A 1L3SA 2D1KA 3VF6A 3AVIA 3PLAA 1ILYA 3C6TA 3DRSA 4JK9A 1Q7YO 3TWHA 4DTJA 3RRGA 4N41A 3TTCA 1XHXA 3ZCMA 1N32K 4AHRA 1SL0A 3VESA 4DV5K 1H1VA 2PYJA 1T7PA 3THVA 3CIPA 2P5OA 3KLFA 4CF2A 1BO5O 2E4LA 2P51A 3ZSXA 3HPOA 3SV4A 4I7FA 4MFBA 4HVJA 4CJPA 2P9LA 3ULDA 3BZKA 2HMIA 1QVGM 4DTMA 3RVCA 3M6GA 4EP5A 3OYBA 4CESA 3CC7N 4ID5A 2P9PA 1QQNA 4DFPA 3C95A 3EE9A 1ATNA 1HPZA 3IRXA 3HK2A 1UOCA 4DSLA 4PUOA 1VSMA 5AJ3K 3KIOA 3VQ5A 3AA2A 4RW7A 1WSIA 2WONA 3J81O 4OJRA 3K9KA 3L2VA 3MXJA 4CBUA 1A5VA 4GKKK 3THXB 4WQ4C 5M1NA 1FK9A 5C10A 4HUGA 1RTDA 4JI3K 4YNQA 5HROA 5C42A 2Z1GA 3LDOA 3U9ZA 5AQGA 4DHYA 1FJGK 4N76A 1TKZA 2BH1A 3MWPA 1TV6A 4JI2K 3TU5A 5F1XA 3SYZA 3HVRA 4JHDA 5HOOA 4JS5A 4BRQA 1T05A 5BN9A 5E84A 4IJAA 4DCHA 3CCQN 2E2PA 3HXMA 1JL2A 4CHOA 3OYNA 4DU3A 3LM9A 4JI8K 5HRPA 3VQDA 2E6LA 3G10A 3G25A 4DTPA 2E88A 3ATVA 4DR2K 3SZ2A 1VSIA 4DTUA 2NZTA 3EKUA 3VA0A 3TR8A 1YJWN 4EIAA 1W7AA 1HNVA 4J2DA 4KHUA 1J53A 1KC8O 5FROA 1RDDA 3IUCA 3RMDA 5E41A 4JV5K 1QTMA 1ZBHA 3FZFA 2G8WA 3OYCA 3WQTA 5AQLA 1YI2N 1Q9YA 4CJ3A 1HUXA 3SQ0A 1NWKA 4CZMA 1GLEG 3GDQA 4DQIA 3IDHA 3TTFA 1C0UA 3SUQA 2HB5A 4I9LA 3V1RA 3NGYA 3WUHA 1VQMN 3P4IA 5CYMA 1EP4A 4CECA 1YJ9N 3TANA 1VSLA 4RCHA 3FR0A 1B9DA 3O8MA 4Z4HA 2HBMA 4OLBA 1VRTA 1T3VA 1K8KA 3PX6A 1LW0A 1TKDA 4H4MA 3CJ1A 2FSJA 3ZSVA 5AQMA 1SKRA 2HVHA 3CJCA 3G4SN 3CCJN 1VQPN 1TUYA 3SAGA 3ZT3A 1VQ6N 3D2EA 2F4VK 1RTHA 1C1BA 4KHYA 2DFEA 1L3UA 3U3YA 3I0SA 4KHWA 1N33K 5HRNA 3DLBA 2FBYA 4FWRA 1SS6A 4B8AB 4CF8A 3V9SA 2A40A 3D2FA 4AF1A 5C2FA 2YKNA 2XRIA 3THYB 2NUBA 1VQNN 4AHCA 3KD5E 3A2FA 1GLLO 4KB1A 3CYMA 4KTQA 1X9SA 2ZF5O 1ZYQA 3K2PA 2Q0RA 3VEZA 1P8ZA 1KRPA 4PA1A 2O8CB 1BQMA 2DFHA 4BR7A 3PV8A 3KK3A 3ATUA 5AQJA 3WXLA 3CC4N 3QNNA 4FCYA 3JAMO 4FOEA 3H3NO 3KWGA 1C6VA 2HHXA 3VMFB 1L3TA 4WQ5A 2HHSA 4IKFA 2HMPA 4CF0A 5KPZA 1KVAA 4FK0A 1RNHA 3SJJA 2OCEA 3OTOK 2OTLN 3P5JA 3IFRA 1BISA 1XC9A 4BRKA 1VSFA 3IS9A 5C25A 3D7EO 1W2BM 1YITN 4V19S 1NK7A 4IOAL 4BRAA 1K8AO 2QKKA 1IKWA 1GLJO 1HNIA 1NGEA 3DOLA 4Z94A 4DSJA 1XUPO 3OBWA 3T19A 4X62K 1ATSA 3F9MA 1IG8A 2YJFA 2G8KA 3P83D 1HR0K 2JGUA 1LCUA 2F96A 3WXJA 1VQ9N 2JLEA 4YFUA 4B9SA 4HWIA 4WCEL 2P9NB 4B1WB 5AQPA 3A5OC 2RPIA 4CZGA 1RTIA 4KH4A 4MLHA 3V4IA 4LH4A 4TSXA 2QK9A 4CZJA 4C8KA 3J7AP 1S9EA 1C0TA 4DF4A 3HRGA 4GV3A 3K5OA 1BDGA 3CMAN 4BG8A 3VEOA 3M3ZA 1BUPA 3OYFA 4BQLA 5HL7L 2YV0X 1SQKA 3CERA 2ZD1A 3OYLA 1KVCA 3VEVA 2NRRA 3O08A 4RW4A 2X6SA 4X64K 1Z25A 3GOIA 2OPQA 4FJ7A 3VN5A 4BDPA 1NM1A 1ITGA 3D6RA 4HTLA 5GIOA 4DF8A 4CGIA 3FZLA 3TAQA 2QWOA 4FSVA 2NRZA 1WBDA 2ZWHA 4RWTA 2UXBK 4DS5A 2HNZA 3THXA 1RDAA 2QKBA 4FJNA 4DU1A 4IFEA 1JCGA 2YHWA 2UU9K 1WNSA 3ZYYX 4C8OA 3AVBA 5C2DA 4O55A 4FJMA 4XH1A 3LP3A 3MEEA 3MXIA 3VF4A 3VGLA 4FLUA 1U49A 2OPRA 2GWJA 1P90A 3T1AA 4JK7A 3NVMA 1HKCA 2VG5A 4W5OA 3ID6A 5JMVA 4H5TA 3JS6A 4O5FA 5BPLA 1KLNA 1XQSC 2ZM6K 4JI1K 1B92A 3TAPA 3DLEA 2Z1JA 3VOVA 3VQQA 3U4LA 5IT9O 5EXWA 3OS1A 1F21A 3S3OA 2RN2A 5AQNA 2V52B 2YCHA 3THWB 1W97L 4DR1K 4BWJA 1FXXA 4JNEA 2W40A 2E8AA 4DQPA 4FW1A 2P9PB 1YHQN 5JICA 5DMRA 1YVNA 4KV8A 3K5LA 1YXQA 2CGLA 3VEXA 5LY3A 1M90O 2ZGYA 3QMLA 3AVMA 2I7NA 3WNEA 3O9RA 1YT3A 3BY5A 3CC2N 3IMXA 2F9WA 3A0IX 1WBBA 1VRUA 4DR7K 1Q8IA 3OJUA 1NOYA 4JKEA 4M41A 4JKGB 3AY9A 2E2NA 3AV9A 4LF4K 1QVFM 2O8EB 4U7BA 4Z0UA 4FM1A 1RBTA 3WEEB 4XH5A 3QETA 4JI0K 3ZSYA 1EX4A 4CEOA 3O5BA 1M1KO 4K0KK 4CIEA 3AVLA 5FPDA 1RT2A 4LFBK 2AA4A 2A6AA 2ZJQL 3DLRA 2JWKA 3M8SA 4KAZA 4K42A 3WT0A 4NB4A 1J54A 2YJEA 3NF8A 4AM7A 4K25A 1SKSA 2GELA 4BVOA 4FVUA 3AVNA 2P9SB 4NO7A 3PX0A 4FZXC 3G0ZA 3I33A 1W9HA 3P31A 4O0IA 2OZMA 3S3MA 1SV5A 2O8DB 5AFUA 2J4RA 4OLAA 1VK0A 4FJ5A 5KPTA 4KFBA 3NH2A 3ZT2A 2ASPA 3FFKB 4FWOA 3SQ4A 1V4TA 2O8CA 2UUAK 3KTQA 5F2RA 2QI2A 4DSFA 4LC9B 3SBGA 4CEDA 3RMBA 3AVAA 3T69A 3O9QA 1S1UA 3E9OA 4EP4A 3OVNA 1YAGA 3KKRA 4RW9A 3PUFA 3CCRN 5LJWA 3DWLA 3L3UA 3I0RA 1Z6RA 4A59A 1QQCA 2FBXA 3H3OB 3R9PA 3MDQA 4FK2A 1KFSA 3BP8A 4FWLA 4CF9A 5AR0A 1GLDG 1S72N 3FLCO 2DTUA 2VWKA 1Q9XA 3PSIA 1JLEA 4F4KA 4BQZA 3OYIA 3QBXA 2Z1IA 5J2PA 2E1ZA 2W42A 2X78A 4JAXA 1QZ5A 2WUSA 4DV3K 5JS2A 4BREA 3DMJA 2Q31A 1S1XA 4WQ5C 4DQ8A 4FJLA 3CFRA 2HHVA 2P9NA 1YUWA 2IVNA 3LDSA 4JRPA 3PO5A 2D0AA 3L8BA 3KK7A 1IG9A 3HOSA 1XC3A 1TAQA 5BPNA 1IKYA 2OANA 5FRNA 4C1NK 4FO0A 2B6AA 3QEXA 4DUYK 1J5EK 4L3QA 3SAFA 2YKMA 3F9KA 3OA9A 1WAJA 3ENBA 4DSKA 3LDQA 3OYMA 5CZ1A 1N8RO 4FK4A 3GG4A 4CEQA 4BRMA 4CFBA 4CHQA 3LDNA 3G6EN 4KTWA 3RWUA 3UE5A 1DLOA 2WTUA 1RBSA 5AQRA 3BZCA 1JLGA 4GNIA 2P1JA 1TL1A 4FVMA 3CPWM 4BGAA 2OTJN 4Z4EA 4CK2A 3QIPA 3VGMA 4CEBA 1GLFO 3V9ZA 1Q86O 2HBLA 3HVTA 3R3LA 3K0SA 3TTDA 2HSTA 3DAWA 2W41A 4DTXA 1BGXT 1NK6A 1HRHA 4DWIA 1BA1A 1VHXA 4WFAL 1HQUA 4DFMA 5AZJB 2IAJA 3MEDA 4MDBA 4K8XA 4WYBA 3LWMA 3HM8A 4F3OA 3HZ6A 1NKEA 3LPUA 2GWKA 3QEWA 1RDCA 5DM7L 4FJJA 3SI6A 5DM6L 3MX2A 4M3TA 3QO9A 4CHZA 3CD6N 2DY4A 4BE1A 1DEJA 4DFJA 3HJFA 5F0XA 3ZX0A 4N56A 4GV9A 3EL2A 4MQ3A 4AILC 5FRMA 3THWA 1NKBA 4MLEA 1N5YA 4IEIA 4Y0WA 1X1PA 2Q1NA 4F2RA 3MN9A 5HP1A 5AQVA 3HO1A 1VSEA 1WB9A 1ASWA 2UYTA 2YHAA 1NJZA 1REVA 3BEXA 3KVGA 3J7ZO 3OYGA 1LOTB 3TARA 1S9GA 1D9DA 1NGGA 4CK3A 2PY5A 4FLYA 4YOUA 3RTVA 2IVPA 3PIOL 2DFFA 4M63C 2NLXA 3T1HK 4B1XB 4LFCK 3RRHA 3WXKA 4AHUA 1JCFA 3HT3A 2HF3A 3DXMB 1T6DA 3OYEA 4KHSA 4JKGA 5FLXO 2O8EA 3LP1A 3WEEA 3MX5A 4CD1A 4CZEA 1HX1A 1OH5A 4XH4A 2HHTA 2O8BB 1Y64A 2VG7A 2XY5A 4KPYA 4CZLA 4CJKA 4HUEA 4BR0A 1SUQA 1KCFA 4BACA 4QOZB 2GEMA 3NMUA 4B3OA 4LH5A 2QW9A 1QSYA 3KLHA 4NYFA 2P9SA 3DXKB 1HLUA 4CZIA 2YNFA 3VQ6A 2XHBA 3JYTA 4BGBA 4M7XA 4B3TK 1K6YA 2O8DA 1TK8A 2QWMA 3DLHA 1SL1A 1NNEA 3SBTA 3ID8A 2FF6A 1DT9A 4A2AA 3NFAA 1R0AA 3FE1A 4JKBA 2X74A 2YNGA 4M42A 3A8YA 3SQ1A 1HNXK 1IBMK 1O13A 4NLBA 1RGIA 1KVBA 4IDHA 3AAPA 3Q7CA 4KREA 3O3GA 4K43A 1U45A 3SMPA 2HHHK 4OO1J 4BRIA 4E1NA 4O8KA 5SWMA 1NGHA 2HBKA 3S41A 4M3RA 3VTHA 4ELUA 5LJVA 4FLWA 4K41A 4GV6A 2HHQA 5K14A 3MECA 1MWMA 1JXBA 3TAEA 1NJIO 1I39A 4R79A 3I8BA 1U2VA 3K9JA 4JEPA 5I42A 4AQYK 4J2BA 4ILHA 4YDUA 3EE8A 5D3GA 5BREA 1TK5A 1C0MA 4YOWA 5J2MA 4DMNA 3CJBA 1UWBA 3WXMB 1CLQA 2Q97A 3DLGA 1VQ7N 4JLHA 3V1OA 3VQ9A 2FBTA 1TK0A 3MN6A 3T3FA 4UY8O 3ZX2A 4CFDA 5KPRA 4ISGA 4IDKA 3VPZA 4ID1A 4OKJA 4GMJB 1RT6A 3NHGA 1WOQA 3TI0A 5EX5A 3VQBA 5AQQA 4BR9A 3ISNC 1K9MO 2YHXA 1VSJA 1D4XA 1QZ6A 3NVKA 4R5PA 4FLZA 2Z1HA 2NRXA 4IO8A 1U6ZA 3ZEUB 1D5AA 5M1FA 3E9PA 2QEXN 2UUBK 3L4IA 4E7LA 3OHRA 4C8NA 1WSHA 5KQDA 1NK4A 3OS2A 1ZC6A 1NGAA 1E4FT 3L4QA 4J8FA 3C0BA 4B9NA 3GL1A 3QINA 1TYQB 2D0OA 4A2BA 4DQRA 1BHLA 1WSJA 4CJSA 4E7IA 2KKZA 3TPQA 4PL8A 4X65K 4EZ6A 4M3WA 4DUZK 1GOCA 1UAXA 4OKEA 3A5MC 1RT7A 4LFAK 3MCPA 4IXCA 3EY1A 2HNYA 2IIRA 3EN9A 3EYZA 2P9KB 2G8VA 1G99A 4IOCL 3M8QA 5AZJA 4W5RA 1IBKK 3DYAA 5ADXA 5JLFA 5TKYA 2W6LA 4OKKA 3CHWA 3EZWA 4JD2B 4I9QA 4HCCA 4DFKA 1DKGD 3R6MA 1RCHA 5AQTA 4WFNL 4BRLA 2QA4N 3SQ2A 3AVHA 3DJCA 4OVLA
chains in the Genus database with same CATH topology
1JKHA 2KW4A 4Q5VA 1JLAA 1QSLA 1KLMA 4CCHA 1NOZA 3DLRA 2A1RA 5J1EA 3ALYA 1D9DA 3M8SA 3QESA 2GUIA 4LSNA 1L3VA 1ZBLA 1FKPA 4CHNA 4HTUA 4CGGA 1D9FA 4B9LA 4DSEA 2OPPA 4C8MA 4DLEA 4ELVA 1J54A 4K8ZA 2ATQA 3NF8A 3L2UA 1SKSA 4W5TA 1D8YA 3IG1A 4AHVA 3ZT1A 5HRRA 3VQEA 3AVNA 4AHSA 3HK2A 1RT1A 3PX0A 5DK5A 5CYQA 3LANA 1U4BA 3VQ4A 4FZXC 4O44A 3G0ZA 3F73A 2LSNA 1U48A 1W9HA 2A1SA 1HQEA 4O0IA 2OZMA 3S3MA 1FKOA 4Z4CA 1L3SA 4FYDA 3L2QA 1SV5A 3TABA 1W0HA 5EU7A 1NK9A 4CGDA 4OLAA 3AVIA 3C6TA 1VK0A 5KRTA 3DRSA 4FJ5A 2E6MA 4KFBA 1Z26A 3NH2A 3TWHA 1TKTA 4B9MA 4DTJA 3RRGA 3ZT2A 4N41A 3WNFA 3CM5A 3KK1A 1XHXA 4H8KA 3ZCMA 4KI4A 3SQ4A 4DSIA 4AHRA 1SL0A 1S1WA 3BDPA 4FLXA 3QNOA 4GVMA 2PYJA 3KTQA 3C6UA 1T7PA 4DSFA 3THVA 2VWJA 4ELTA 2P5OA 4CEAA 3KLFA 3CG7A 2E4LA 2P51A 3AVHA 3ZSXA 5KI6A 4CJFA 4CF2A 2Y1JA 3HPOA 3SV4A 2KFZA 4M3ZA 4CEZA 4CEDA 3RMBA 1RT4A 3AVAA 4I7FA 4MFBA 3SPYA 4IG3A 4HVJA 4CJPA 1S1UA 3ULDA 4EP4A 3HYFA 3OVNA 3KKRA 4CIFA 4RW9A 1BIUA 3QEVA 3OYKA 3PUFA 5I3UA 5CY4A 2HMIA 4FXDA 2O4IA 2HVIA 3B6OA 4DTMA 3MAQA 2HHUA 3L3UA 1ZBFA 3I0RA 4AHTA 4EP5A 2GBZA 1RT5A 2B5JA 1QQCA 2FBXA 1NJXA 3OYBA 3SUNA 4CESA 4ID5A 3QEIA 1U04A 3NDKA 4DFPA 3VQ7A 4FK2A 4CE9A 3C95A 1KFSA 4KHNA 1HPZA 3IRXA 4AH9A 4CEEA 4CGHA 1UOCA 4CF9A 5T7BA 5J2NA 4DSLA 1XHZA 3KD1E 4PUOA 4FZZA 1CZ9A 1VSMA 3KIOA 1Y97A 3E01A 2DTUA 3VQ5A 2VWKA 3O3FA 3AA2A 1Q9XA 1QSSA 1JLEA 4RW7A 4F4KA 1LAWA 1WSIA 3OYIA 2WONA 3ZT4A 4OJRA 3V9UA 4CFAA 2Z1IA 3L2VA 3MXJA 5J2PA 3AO2A 1T8EA 4M3XA 2W42A 1A5VA 3OY9A 2KZMA 2X78A 3K59A 4I2QA 4DTOA 1FK9A 2G8HA 5JS2A 3CQ8A 4HUGA 3V9WA 1RTDA 3DMJA 4YNQA 4FJLA 1S1XA 3TAFA 5HROA 5C42A 2Z1GA 3CFRA 2HHVA 4UQGA 2XY6A 2YNIA 3LDSA 3LAMA 3NH1A 4CF1A 4JRPA 3PO5A 4N76A 1TKZA 2D0AA 2YNHA 1TV6A 3OJSA 3VQ8A 3L8BA 3SYZA 3HVRA 4DTSA 1IG9A 4JS5A 1TAQA 1T05A 1IKYA 3H08A 5KTQA 5FRNA 4FZYA 3QEXA 2B6AA 1HJRA 2B4JA 1NJYA 1JL1A 2P5GA 3FFIA 1B9FA 3HXMA 2YKMA 3F9KA 4DS4A 1JL2A 1WAJA 3LP2A 4H4OA 1LAVA 4CHOA 1X9WA 3OYNA 3IAYA 4DU3A 5HRPA 4IBNA 5C24A 3VQDA 4CJ5A 4CK1A 2E6LA 3G10A 4DTPA 4NCBA 2GV9A 3SZ2A 4FJ9A 1VSIA 4QAGA 4M45A 3OYJA 3OYMA 4DTUA 4DSKA 1A5WA 5CZ1A 1MU2A 3VA0A 1RTJA 3S9HA 4FK4A 4KAZA 1VSKA 4F2SA 3TR8A 4CEQA 4J2DA 1HNVA 2RF2A 4CFBA 4CHQA 4KHUA 1J53A 4KTWA 4CERA 1WSGA 3RWUA 2BANA 1RDDA 5FROA 4FJGA 3NBPA 1DLOA 3NF6A 2Q3SA 3WNGA 4CGFA 3RMDA 1RBSA 1BI4B 3K5MA 5E41A 1JLGA 2P1JA 1TL1A 4FVMA 1QTMA 1ZBHA 1L5UA 3M8PA 4M3YA 4PQUA 1NKCA 4E19A 4LD0A 2G8WA 3L2RA 5HLFA 4FLTA 4CK2A 3CFPA 4Z4EA 3OYCA 3QIPA 4DQQA 4CEBA 3AVKA 3V9ZA 1Q9YA 4CJ3A 5CZ2A 3SQ0A 3ASMA 3HVTA 4OPKA 3JSMA 1BL3A 4XIUA 3OYHA 1JLBA 1RT3A 4DQIA 3AA4A 3UIQA 1C0UA 3SUQA 2HB5A 4I9LA 3V1RA 1C1AA 3NGYA 3L2WA 1BGXT 4DTXA 1NK6A 3D45A 1HRHA 3NH0A 4DWIA 4C8LA 2KTQA 2IOCA 1N6QA 5CYMA 1EP4A 1HQUA 4CECA 4DFMA 5J2QA 2IAJA 3MEDA 3TANA 3RMCA 1VSLA 4FW2A 1J9AA 3AA5X 4K8XA 3LWMA 1VSHA 4FJKA 4F3OA 4Z4HA 1B9DA 3AO3A 1WN7A 1NJWA 4OLBA 4CEFA 1BIZA 1RBRA 1VRTA 3OS0A 1NKEA 1HYSA 4Z4GA 3LPUA 3PX6A 1LW0A 1TKDA 3QEWA 1RDCA 1S5JA 4H4MA 4FJJA 1LW2A 3SI6A 4DTRA 4KHQA 2HHWA 3ZSVA 3LWLA 1SKRA 4E0DA 4M3TA 3QO9A 4CHZA 4GW6A 5HRSA 3VA3A 4HCBA 2HVHA 3QERA 2DY4A 4CFCA 4CJEA 4CHPA 4E89A 4BE1A 4JRQA 3VQCA 1T03A 4DFJA 3HJFA 3ZT3A 4FM0A 2G8UA 4N56A 1NK0A 1XWLA 4MQ3A 4AILC 1RTHA 2XY7A 5KGXA 5FRMA 1C1BA 1NKBA 3AVCA 3O4NA 1N5YA 3RR8A 3NAEA 4KHYA 1LWFA 4W5NA 3SUOA 2F8TA 1RBUA 1X1PA 2DFEA 1L3UA 2AJQA 4DTNA 4F2RA 2OYQA 1C1CA 3U3YA 3I0SA 3RMAA 1RDBA 5HP1A 4KHWA 3HO1A 1VSEA 1IO2A 4KO0A 4CGJA 2FBYA 1ASWA 5HRNA 1QS4A 3DLBA 2YHAA 4KTQA 4IG0A 1NJZA 4B8AB 3LZIA 4CF8A 3V9SA 2KFNA 1RBVA 1REVA 3B6PA 4O4GA 3RR7A 2IGIA 2YKNA 2XRIA 3QLHA 3SPZA 1S6PA 2NUBA 3OYGA 4AHCA 3KD5E 2XY8A 1WSEA 3A2FA 4KB1A 3TARA 1S9GA 3AO4A 3CYMA 1HMVA 2KQ2A 4CK3A 1X9SA 3V1QA 4FLYA 3K2PA 1ZYQA 3RTVA 2PY5A 3AVFA 2WOMA 3DI6A 1KRPA 4Q0BA 4PA1A 3K58A 2DFFA 4N47A 1BQMA 4FJHA 3RRHA 2DFHA 4AHUA 3PV8A 3KK3A 3S3NA 3HT3A 3KK2A 3QNNA 4FCYA 4O5BA 3PX4A 4B9VA 2ZQBA 3OYEA 4KHSA 3AO5A 2IC3A 2Y1IA 3BGRA 1C6VA 2OZSA 2HHXA 1L3TA 3DM2A 2HHSA 3LP1A 4IKFA 4CF0A 1KVAA 4FK0A 1RNHA 1LWCA 4BE2A 3SJJA 3V81A 1JXEA 2HHTA 3P5JA 1BISA 3NE6A 3MXMA 1XC9A 3HPGA 1ZBUA 1VSFA 2VG7A 4OPJA 2XY5A 4KPYA 3ZSWA 4CJKA 3IS9A 4HUEA 1LV5A 3CFOA 3K5NA 5C25A 1DTTA 1SUQA 4KTZA 2FC0A 3ZSOA 1S6QA 1NK7A 1KCFA 4BACA 1RILA 2IDOA 4B8CA 3OYAA 4E7JA 4QOZB 2XO7A 4B3OA 2QKKA 4LH5A 1WAFA 1IKWA 1HNIA 3DOLA 4ICLA 1QSYA 4DSJA 4Z4IA 4CIGA 3KLGA 3I8DA 1NK8A 2F8SA 3KLHA 3T19A 3ITHA 4NYFA 2HW3A 1TL3A 1TGOA 3NCIA 4Z4FA 2YNFA 3VQ6A 2XHBA 4E1MA 3AVJA 3JYTA 2G8KA 4CJRA 3P83D 4DLGA 2JGUA 1K6YA 2F96A 2JLEA 2EX3A 3VQAA 3ZT0A 4YFUA 3NGIA 1TK8A 3DLHA 3L3VA 1SL1A 4B9SA 3NF7A 4I2PA 2KZZA 4ZHRA 1IH7A 3NFAA 3KJVA 2D0BA 3ZSRA 2YHBA 2RPIA 1R0AA 3DOKA 1RTIA 4FLVA 4CJQA 3HPHA 2G8IA 4CJTA 2X74A 3V4IA 3KKSA 2BGGA 2YNGA 3HSTB 4LH4A 4TSXA 4M42A 2QK9A 3SQ1A 4E7KA 1CXQA 3SNNA 1DTQA 1HYVA 3NGZA 3EZ5A 3PY8A 4EZ9A 1UA0A 4C8KA 3K57A 3LALA 1S9EA 1KVBA 3AA3A 4KRFA 3LPTA 1C0TA 3P1GA 4DF4A 2G8FA 3QIOA 3K5OA 1JLFA 4CJWA 4PWDA 1QHTA 4RG8A 3LZJA 4KREA 4BDZA 4OGEA 3O3GA 5FDLA 4QCLA 1U45A 1GOBA 4E1NA 1IKXA 3DRPA 3OYFA 3SV3A 3HL8A 2RKIA 2YV0X 4CJ4A 4B9TA 1YVUA 4CJLA 3DRRA 5SWMA 2OA8A 2ZD1A 4B9UA 4M3RA 3OYLA 1KVCA 3HP6A 4ELUA 4PY5A 4RW4A 2X6SA 1Z25A 4O0JA 4FLWA 2HHQA 2OPQA 2PZSA 4J2AA 5K14A 4FJ7A 4KB0A 3VN5A 3MECA 3KLIA 4BDPA 4RW8A 1JXBA 1ITGA 4CHYA 3TAGA 4RW6A 3TAEA 4M3UA 1I39A 4FJ8A 4KI6A 4DU4A 3PO4A 3WNHA 4DF8A 5I42A 3V9XA 4ZTJA 4CGIA 3OYDA 3CM6A 3TAQA 3DLKA 4J2BA 3VQPA 4ZTFA 2OPSA 5D3GA 1TK5A 3NF9A 3MEGA 3HM9A 4DS5A 4IFVA 1C0MA 2HNZA 3ZSZA 1RDAA 4FM2A 5J2MA 1KTQA 2EHGA 1BCMA 4DMNA 1JLQA 2QKBA 4FJNA 4DU1A 1NK5A 1ZBIA 4LY7A 1UWBA 1JLCA 1CLQA 1LWEA 3DLGA 4DG1A 4JLHA 3O4QA 1UA1A 3V1OA 3VQ9A 1WNSA 2QXFA 4L8RB 3LP0A 2FBTA 3D0PA 1J5OA 4C8OA 1TK0A 3AVBA 4B08A 4JS4A 1WSFA 3T3FA 4CFDA 4O55A 4DQSA 4IDKA 1KFDA 4FJMA 4ID1A 4BWMA 1XI1A 1YTUA 4OKJA 4GMJB 1IKVA 3LP3A 3MEEA 4Y1CA 3MXIA 1RT6A 4FLUA 1U49A 5JS1A 2OPRA 3NHGA 1SL2A 1CXUA 1EXQA 3HP9A 2ETJA 1GOAA 3TI0A 3T1AA 3AO1A 3VQBA 2R7YA 4FJXA 2VG5A 3ZSQA 4W5OA 1X9MA 3ISNC 4E3SA 1KSPA 3U6FA 1VSJA 5HBMA 2I5JA 4KKOA 1VSDA 1KLNA 1U47A 1B92A 3TAMA 4R5PA 3M8RA 3DLEA 2Z1JA 4FLZA 3TAPA 2Z1HA 2X6NA 3AVGA 4F8RA 3VQQA 2FBVA 1TKXA 2D5RA 3OS1A 1F21A 1D5AA 1BCOA 2RN2A 3S3OA 4E7HA 1WLJA 1CZBA 3SUPA 4FJIA 4NCAA 4BWJA 4IFYA 3QEPA 2ITGA 2VG6A 1FXXA 4E7LA 4C8NA 1WSHA 4NCGA 4DQPA 1NK4A 4FW1A 4CJUA 1BQNA 3LAKA 1BI4A 5DMRA 2IS3A 3OS2A 4HUFA 4B9NA 1QE1A 3QINA 1EETA 4KV8A 3K5LA 3KLEA 2O4GA 1EKEA 5KGWA 4DQRA 4G1QA 1BHLA 1WSJA 4CJSA 4E7IA 4NYNA 4M3WA 4EZ6A 2BDPA 3AVMA 1S1TA 1TVRA 3U3GA 3WNEA 1GOCA 3C94A 1UAXA 4OKEA 1SKWA 1RT7A 1YT3A 4OGCA 4N5SA 1O1WA 1A5XA 4HHTA 4BE0A 1VRUA 3EY1A 3EYZA 4WE1A 2HNYA 1Q8IA 2HNDA 2G8VA 3OJUA 5SZTA 1NOYA 3SCXA 3M8QA 4W5RA 4M41A 3DYAA 1G15A 4J2EA 1TAUA 3AV9A 2D0CA 2BE2A 4F3TA 4Z0UA 4OKKA 4FM1A 1RBTA 1HYZA 3QETA 4I9QA 4HCCA 4LSLA 4BDYA 4DFKA 1S1VA 3ZSYA 1EX4A 3V6DA 1RCHA 4CEOA 1ASVA 1I3AA 1ASUA 4CJVA 4CIEA 3AVLA 5KRSA 3O3HA 4W5QA 2ZE2A 3SQ2A 2PYLA 4OVLA 1RT2A 1YTAA 4Y1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKH A;  2KW4 A;  4Q5V A;  1JLA A;  1QSL A;  1KLM A;  4CCH A;  1NOZ A;  3DLR A;  2A1R A;  5J1E A;  3ALY A;  1D9D A;  3M8S A;  3QES A;  2GUI A;  4LSN A;  1L3V A;  1ZBL A;  1FKP A;  4CHN A;  4HTU A;  4CGG A;  1D9F A;  4B9L A;  4DSE A;  2OPP A;  4C8M A;  4DLE A;  4ELV A;  1J54 A;  4K8Z A;  2ATQ A;  3NF8 A;  3L2U A;  1SKS A;  4W5T A;  1D8Y A;  3IG1 A;  4AHV A;  3ZT1 A;  5HRR A;  3VQE A;  3AVN A;  4AHS A;  3HK2 A;  1RT1 A;  3PX0 A;  5DK5 A;  5CYQ A;  3LAN A;  1U4B A;  3VQ4 A;  4FZX C;  4O44 A;  3G0Z A;  3F73 A;  2LSN A;  1U48 A;  1W9H A;  2A1S A;  1HQE A;  4O0I A;  2OZM A;  3S3M A;  1FKO A;  4Z4C A;  1L3S A;  4FYD A;  3L2Q A;  1SV5 A;  3TAB A;  1W0H A;  5EU7 A;  1NK9 A;  4CGD A;  4OLA A;  3AVI A;  3C6T A;  1VK0 A;  5KRT A;  3DRS A;  4FJ5 A;  2E6M A;  4KFB A;  1Z26 A;  3NH2 A;  3TWH A;  1TKT A;  4B9M A;  4DTJ A;  3RRG A;  3ZT2 A;  4N41 A;  3WNF A;  3CM5 A;  3KK1 A;  1XHX A;  4H8K A;  3ZCM A;  4KI4 A;  3SQ4 A;  4DSI A;  4AHR A;  1SL0 A;  1S1W A;  3BDP A;  4FLX A;  3QNO A;  4GVM A;  2PYJ A;  3KTQ A;  3C6U A;  1T7P A;  4DSF A;  3THV A;  2VWJ A;  4ELT A;  2P5O A;  4CEA A;  3KLF A;  3CG7 A;  2E4L A;  2P51 A;  3AVH A;  3ZSX A;  5KI6 A;  4CJF A;  4CF2 A;  2Y1J A;  3HPO A;  3SV4 A;  2KFZ A;  4M3Z A;  4CEZ A;  4CED A;  3RMB A;  1RT4 A;  3AVA A;  4I7F A;  4MFB A;  3SPY A;  4IG3 A;  4HVJ A;  4CJP A;  1S1U A;  3ULD A;  4EP4 A;  3HYF A;  3OVN A;  3KKR A;  4CIF A;  4RW9 A;  1BIU A;  3QEV A;  3OYK A;  3PUF A;  5I3U A;  5CY4 A;  2HMI A;  4FXD A;  2O4I A;  2HVI A;  3B6O A;  4DTM A;  3MAQ A;  2HHU A;  3L3U A;  1ZBF A;  3I0R A;  4AHT A;  4EP5 A;  2GBZ A;  1RT5 A;  2B5J A;  1QQC A;  2FBX A;  1NJX A;  3OYB A;  3SUN A;  4CES A;  4ID5 A;  3QEI A;  1U04 A;  3NDK A;  4DFP A;  3VQ7 A;  4FK2 A;  4CE9 A;  3C95 A;  1KFS A;  4KHN A;  1HPZ A;  3IRX A;  4AH9 A;  4CEE A;  4CGH A;  1UOC A;  4CF9 A;  5T7B A;  5J2N A;  4DSL A;  1XHZ A;  3KD1 E;  4PUO A;  4FZZ A;  1CZ9 A;  1VSM A;  3KIO A;  1Y97 A;  3E01 A;  2DTU A;  3VQ5 A;  2VWK A;  3O3F A;  3AA2 A;  1Q9X A;  1QSS A;  1JLE A;  4RW7 A;  4F4K A;  1LAW A;  1WSI A;  3OYI A;  2WON A;  3ZT4 A;  4OJR A;  3V9U A;  4CFA A;  2Z1I A;  3L2V A;  3MXJ A;  5J2P A;  3AO2 A;  1T8E A;  4M3X A;  2W42 A;  1A5V A;  3OY9 A;  2KZM A;  2X78 A;  3K59 A;  4I2Q A;  4DTO A;  1FK9 A;  2G8H A;  5JS2 A;  3CQ8 A;  4HUG A;  3V9W A;  1RTD A;  3DMJ A;  4YNQ A;  4FJL A;  1S1X A;  3TAF A;  5HRO A;  5C42 A;  2Z1G A;  3CFR A;  2HHV A;  4UQG A;  2XY6 A;  2YNI A;  3LDS A;  3LAM A;  3NH1 A;  4CF1 A;  4JRP A;  3PO5 A;  4N76 A;  1TKZ A;  2D0A A;  2YNH A;  1TV6 A;  3OJS A;  3VQ8 A;  3L8B A;  3SYZ A;  3HVR A;  4DTS A;  1IG9 A;  4JS5 A;  1TAQ A;  1T05 A;  1IKY A;  3H08 A;  5KTQ A;  5FRN A;  4FZY A;  3QEX A;  2B6A A;  1HJR A;  2B4J A;  1NJY A;  1JL1 A;  2P5G A;  3FFI A;  1B9F A;  3HXM A;  2YKM A;  3F9K A;  4DS4 A;  1JL2 A;  1WAJ A;  3LP2 A;  4H4O A;  1LAV A;  4CHO A;  1X9W A;  3OYN A;  3IAY A;  4DU3 A;  5HRP A;  4IBN A;  5C24 A;  3VQD A;  4CJ5 A;  4CK1 A;  2E6L A;  3G10 A;  4DTP A;  4NCB A;  2GV9 A;  3SZ2 A;  4FJ9 A;  1VSI A;  4QAG A;  4M45 A;  3OYJ A;  3OYM A;  4DTU A;  4DSK A;  1A5W A;  5CZ1 A;  1MU2 A;  3VA0 A;  1RTJ A;  3S9H A;  4FK4 A;  4KAZ A;  1VSK A;  4F2S A;  3TR8 A;  4CEQ A;  4J2D A;  1HNV A;  2RF2 A;  4CFB A;  4CHQ A;  4KHU A;  1J53 A;  4KTW A;  4CER A;  1WSG A;  3RWU A;  2BAN A;  1RDD A;  5FRO A;  4FJG A;  3NBP A;  1DLO A;  3NF6 A;  2Q3S A;  3WNG A;  4CGF A;  3RMD A;  1RBS A;  1BI4 B;  3K5M A;  5E41 A;  1JLG A;  2P1J A;  1TL1 A;  4FVM A;  1QTM A;  1ZBH A;  1L5U A;  3M8P A;  4M3Y A;  4PQU A;  1NKC A;  4E19 A;  4LD0 A;  2G8W A;  3L2R A;  5HLF A;  4FLT A;  4CK2 A;  3CFP A;  4Z4E A;  3OYC A;  3QIP A;  4DQQ A;  4CEB A;  3AVK A;  3V9Z A;  1Q9Y A;  4CJ3 A;  5CZ2 A;  3SQ0 A;  3ASM A;  3HVT A;  4OPK A;  3JSM A;  1BL3 A;  4XIU A;  3OYH A;  1JLB A;  1RT3 A;  4DQI A;  3AA4 A;  3UIQ A;  1C0U A;  3SUQ A;  2HB5 A;  4I9L A;  3V1R A;  1C1A A;  3NGY A;  3L2W A;  1BGX T;  4DTX A;  1NK6 A;  3D45 A;  1HRH A;  3NH0 A;  4DWI A;  4C8L A;  2KTQ A;  2IOC A;  1N6Q A;  5CYM A;  1EP4 A;  1HQU A;  4CEC A;  4DFM A;  5J2Q A;  2IAJ A;  3MED A;  3TAN A;  3RMC A;  1VSL A;  4FW2 A;  1J9A A;  3AA5 X;  4K8X A;  3LWM A;  1VSH A;  4FJK A;  4F3O A;  4Z4H A;  1B9D A;  3AO3 A;  1WN7 A;  1NJW A;  4OLB A;  4CEF A;  1BIZ A;  1RBR A;  1VRT A;  3OS0 A;  1NKE A;  1HYS A;  4Z4G A;  3LPU A;  3PX6 A;  1LW0 A;  1TKD A;  3QEW A;  1RDC A;  1S5J A;  4H4M A;  4FJJ A;  1LW2 A;  3SI6 A;  4DTR A;  4KHQ A;  2HHW A;  3ZSV A;  3LWL A;  1SKR A;  4E0D A;  4M3T A;  3QO9 A;  4CHZ A;  4GW6 A;  5HRS A;  3VA3 A;  4HCB A;  2HVH A;  3QER A;  2DY4 A;  4CFC A;  4CJE A;  4CHP A;  4E89 A;  4BE1 A;  4JRQ A;  3VQC A;  1T03 A;  4DFJ A;  3HJF A;  3ZT3 A;  4FM0 A;  2G8U A;  4N56 A;  1NK0 A;  1XWL A;  4MQ3 A;  4AIL C;  1RTH A;  2XY7 A;  5KGX A;  5FRM A;  1C1B A;  1NKB A;  3AVC A;  3O4N A;  1N5Y A;  3RR8 A;  3NAE A;  4KHY A;  1LWF A;  4W5N A;  3SUO A;  2F8T A;  1RBU A;  1X1P A;  2DFE A;  1L3U A;  2AJQ A;  4DTN A;  4F2R A;  2OYQ A;  1C1C A;  3U3Y A;  3I0S A;  3RMA A;  1RDB A;  5HP1 A;  4KHW A;  3HO1 A;  1VSE A;  1IO2 A;  4KO0 A;  4CGJ A;  2FBY A;  1ASW A;  5HRN A;  1QS4 A;  3DLB A;  2YHA A;  4KTQ A;  4IG0 A;  1NJZ A;  4B8A B;  3LZI A;  4CF8 A;  3V9S A;  2KFN A;  1RBV A;  1REV A;  3B6P A;  4O4G A;  3RR7 A;  2IGI A;  2YKN A;  2XRI A;  3QLH A;  3SPZ A;  1S6P A;  2NUB A;  3OYG A;  4AHC A;  3KD5 E;  2XY8 A;  1WSE A;  3A2F A;  4KB1 A;  3TAR A;  1S9G A;  3AO4 A;  3CYM A;  1HMV A;  2KQ2 A;  4CK3 A;  1X9S A;  3V1Q A;  4FLY A;  3K2P A;  1ZYQ A;  3RTV A;  2PY5 A;  3AVF A;  2WOM A;  3DI6 A;  1KRP A;  4Q0B A;  4PA1 A;  3K58 A;  2DFF A;  4N47 A;  1BQM A;  4FJH A;  3RRH A;  2DFH A;  4AHU A;  3PV8 A;  3KK3 A;  3S3N A;  3HT3 A;  3KK2 A;  3QNN A;  4FCY A;  4O5B A;  3PX4 A;  4B9V A;  2ZQB A;  3OYE A;  4KHS A;  3AO5 A;  2IC3 A;  2Y1I A;  3BGR A;  1C6V A;  2OZS A;  2HHX A;  1L3T A;  3DM2 A;  2HHS A;  3LP1 A;  4IKF A;  4CF0 A;  1KVA A;  4FK0 A;  1RNH A;  1LWC A;  4BE2 A;  3SJJ A;  3V81 A;  1JXE A;  2HHT A;  3P5J A;  1BIS A;  3NE6 A;  3MXM A;  1XC9 A;  3HPG A;  1ZBU A;  1VSF A;  2VG7 A;  4OPJ A;  2XY5 A;  4KPY A;  3ZSW A;  4CJK A;  3IS9 A;  4HUE A;  1LV5 A;  3CFO A;  3K5N A;  5C25 A;  1DTT A;  1SUQ A;  4KTZ A;  2FC0 A;  3ZSO A;  1S6Q A;  1NK7 A;  1KCF A;  4BAC A;  1RIL A;  2IDO A;  4B8C A;  3OYA A;  4E7J A;  4QOZ B;  2XO7 A;  4B3O A;  2QKK A;  4LH5 A;  1WAF A;  1IKW A;  1HNI A;  3DOL A;  4ICL A;  1QSY A;  4DSJ A;  4Z4I A;  4CIG A;  3KLG A;  3I8D A;  1NK8 A;  2F8S A;  3KLH A;  3T19 A;  3ITH A;  4NYF A;  2HW3 A;  1TL3 A;  1TGO A;  3NCI A;  4Z4F A;  2YNF A;  3VQ6 A;  2XHB A;  4E1M A;  3AVJ A;  3JYT A;  2G8K A;  4CJR A;  3P83 D;  4DLG A;  2JGU A;  1K6Y A;  2F96 A;  2JLE A;  2EX3 A;  3VQA A;  3ZT0 A;  4YFU A;  3NGI A;  1TK8 A;  3DLH A;  3L3V A;  1SL1 A;  4B9S A;  3NF7 A;  4I2P A;  2KZZ A;  4ZHR A;  1IH7 A;  3NFA A;  3KJV A;  2D0B A;  3ZSR A;  2YHB A;  2RPI A;  1R0A A;  3DOK A;  1RTI A;  4FLV A;  4CJQ A;  3HPH A;  2G8I A;  4CJT A;  2X74 A;  3V4I A;  3KKS A;  2BGG A;  2YNG A;  3HST B;  4LH4 A;  4TSX A;  4M42 A;  2QK9 A;  3SQ1 A;  4E7K A;  1CXQ A;  3SNN A;  1DTQ A;  1HYV A;  3NGZ A;  3EZ5 A;  3PY8 A;  4EZ9 A;  1UA0 A;  4C8K A;  3K57 A;  3LAL A;  1S9E A;  1KVB A;  3AA3 A;  4KRF A;  3LPT A;  1C0T A;  3P1G A;  4DF4 A;  2G8F A;  3QIO A;  3K5O A;  1JLF A;  4CJW A;  4PWD A;  1QHT A;  4RG8 A;  3LZJ A;  4KRE A;  4BDZ A;  4OGE A;  3O3G A;  5FDL A;  4QCL A;  1U45 A;  1GOB A;  4E1N A;  1IKX A;  3DRP A;  3OYF A;  3SV3 A;  3HL8 A;  2RKI A;  2YV0 X;  4CJ4 A;  4B9T A;  1YVU A;  4CJL A;  3DRR A;  5SWM A;  2OA8 A;  2ZD1 A;  4B9U A;  4M3R A;  3OYL A;  1KVC A;  3HP6 A;  4ELU A;  4PY5 A;  4RW4 A;  2X6S A;  1Z25 A;  4O0J A;  4FLW A;  2HHQ A;  2OPQ A;  2PZS A;  4J2A A;  5K14 A;  4FJ7 A;  4KB0 A;  3VN5 A;  3MEC A;  3KLI A;  4BDP A;  4RW8 A;  1JXB A;  1ITG A;  4CHY A;  3TAG A;  4RW6 A;  3TAE A;  4M3U A;  1I39 A;  4FJ8 A;  4KI6 A;  4DU4 A;  3PO4 A;  3WNH A;  4DF8 A;  5I42 A;  3V9X A;  4ZTJ A;  4CGI A;  3OYD A;  3CM6 A;  3TAQ A;  3DLK A;  4J2B A;  3VQP A;  4ZTF A;  2OPS A;  5D3G A;  1TK5 A;  3NF9 A;  3MEG A;  3HM9 A;  4DS5 A;  4IFV A;  1C0M A;  2HNZ A;  3ZSZ A;  1RDA A;  4FM2 A;  5J2M A;  1KTQ A;  2EHG A;  1BCM A;  4DMN A;  1JLQ A;  2QKB A;  4FJN A;  4DU1 A;  1NK5 A;  1ZBI A;  4LY7 A;  1UWB A;  1JLC A;  1CLQ A;  1LWE A;  3DLG A;  4DG1 A;  4JLH A;  3O4Q A;  1UA1 A;  3V1O A;  3VQ9 A;  1WNS A;  2QXF A;  4L8R B;  3LP0 A;  2FBT A;  3D0P A;  1J5O A;  4C8O A;  1TK0 A;  3AVB A;  4B08 A;  4JS4 A;  1WSF A;  3T3F A;  4CFD A;  4O55 A;  4DQS A;  4IDK A;  1KFD A;  4FJM A;  4ID1 A;  4BWM A;  1XI1 A;  1YTU A;  4OKJ A;  4GMJ B;  1IKV A;  3LP3 A;  3MEE A;  4Y1C A;  3MXI A;  1RT6 A;  4FLU A;  1U49 A;  5JS1 A;  2OPR A;  3NHG A;  1SL2 A;  1CXU A;  1EXQ A;  3HP9 A;  2ETJ A;  1GOA A;  3TI0 A;  3T1A A;  3AO1 A;  3VQB A;  2R7Y A;  4FJX A;  2VG5 A;  3ZSQ A;  4W5O A;  1X9M A;  3ISN C;  4E3S A;  1KSP A;  3U6F A;  1VSJ A;  5HBM A;  2I5J A;  4KKO A;  1VSD A;  1KLN A;  1U47 A;  1B92 A;  3TAM A;  4R5P A;  3M8R A;  3DLE A;  2Z1J A;  4FLZ A;  3TAP A;  2Z1H A;  2X6N A;  3AVG A;  4F8R A;  3VQQ A;  2FBV A;  1TKX A;  2D5R A;  3OS1 A;  1F21 A;  1D5A A;  1BCO A;  2RN2 A;  3S3O A;  4E7H A;  1WLJ A;  1CZB A;  3SUP A;  4FJI A;  4NCA A;  4BWJ A;  4IFY A;  3QEP A;  2ITG A;  2VG6 A;  1FXX A;  4E7L A;  4C8N A;  1WSH A;  4NCG A;  4DQP A;  1NK4 A;  4FW1 A;  4CJU A;  1BQN A;  3LAK A;  1BI4 A;  5DMR A;  2IS3 A;  3OS2 A;  4HUF A;  4B9N A;  1QE1 A;  3QIN A;  1EET A;  4KV8 A;  3K5L A;  3KLE A;  2O4G A;  1EKE A;  5KGW A;  4DQR A;  4G1Q A;  1BHL A;  1WSJ A;  4CJS A;  4E7I A;  4NYN A;  4M3W A;  4EZ6 A;  2BDP A;  3AVM A;  1S1T A;  1TVR A;  3U3G A;  3WNE A;  1GOC A;  3C94 A;  1UAX A;  4OKE A;  1SKW A;  1RT7 A;  1YT3 A;  4OGC A;  4N5S A;  1O1W A;  1A5X A;  4HHT A;  4BE0 A;  1VRU A;  3EY1 A;  3EYZ A;  4WE1 A;  2HNY A;  1Q8I A;  2HND A;  2G8V A;  3OJU A;  5SZT A;  1NOY A;  3SCX A;  3M8Q A;  4W5R A;  4M41 A;  3DYA A;  1G15 A;  4J2E A;  1TAU A;  3AV9 A;  2D0C A;  2BE2 A;  4F3T A;  4Z0U A;  4OKK A;  4FM1 A;  1RBT A;  1HYZ A;  3QET A;  4I9Q A;  4HCC A;  4LSL A;  4BDY A;  4DFK A;  1S1V A;  3ZSY A;  1EX4 A;  3V6D A;  1RCH A;  4CEO A;  1ASV A;  1I3A A;  1ASU A;  4CJV A;  4CIE A;  3AVL A;  5KRS A;  3O3H A;  4W5Q A;  2ZE2 A;  3SQ2 A;  2PYL A;  4OVL A;  1RT2 A;  1YTA A;  4Y1D A; 
#chains in the Genus database with same CATH topology
 4B3R K;  4FWS A;  1JKH A;  2V7Z A;  1KLM A;  1NOZ A;  5MLC Q;  2A1R A;  2GUI A;  4LSN A;  3ZX3 A;  1NLV A;  4HTU A;  5C15 A;  4U67 L;  4DSE A;  4J2E A;  3EKS A;  4YY3 K;  3VQE A;  3LAN A;  4H0P A;  1U4B A;  3SAH A;  2Q0U A;  3F73 A;  2LSN A;  4JK8 A;  3OW2 M;  5TKW A;  1S3X A;  4Z4C A;  2KHO A;  4FYD A;  3L2Q A;  3TAB A;  1W0H A;  4CGD A;  4EHU A;  1VQ5 N;  5KRT A;  2UXD K;  1VQK N;  4B9M A;  5FPE A;  3WNF A;  3CM5 A;  3KK1 A;  2CH6 A;  2GUP A;  4JKH A;  4KI4 A;  3O9S A;  4DSI A;  4DV0 K;  1OVQ A;  1S1W A;  3C6U A;  2VWJ A;  4ELT A;  4FWQ A;  4CJF A;  2Y1J A;  1HYS A;  4ISF A;  2KFZ A;  1BOT O;  3DXM A;  4M3Z A;  4CEZ A;  4H5N A;  1RT4 A;  4I6M B;  3SPY A;  4FWK A;  4PKG A;  5BRH A;  2NRV A;  5EVZ A;  3HYF A;  4CIF A;  5C0Y A;  5GAG P;  4FXD A;  1BIU A;  3QEV A;  2HVI A;  5CY4 A;  2FLO A;  2H3G X;  4JKF A;  3HSC A;  3MAQ A;  4NLC A;  4AHT A;  3UB5 A;  4CI6 A;  5CE3 A;  2B5J A;  3SUN A;  4DR5 K;  2O8B A;  3QEI A;  3VET A;  3VQ7 A;  3F5T A;  4KHN A;  1R59 O;  4CEE A;  4CGH A;  5T7B A;  1XHZ A;  1CZ9 A;  1NGC A;  5FPM A;  1Y97 A;  3E01 A;  3O3F A;  1EQY A;  3ZT4 A;  3V9U A;  4CFA A;  3DXK A;  3AO2 A;  3OY9 A;  4OPH A;  4I2Q A;  5BN8 A;  4DTO A;  3CCS N;  3CQ8 A;  3V9W A;  2CGJ A;  4UQG A;  4WQ4 A;  4A62 A;  3NH1 A;  4FOI A;  3VQ8 A;  1C0G A;  4IEE A;  4IWV A;  1EWR A;  1SZ2 A;  3H08 A;  1NGD A;  1VQO N;  1BU6 O;  2B4J A;  2DPN A;  1JL1 A;  1NJY A;  2P5G A;  1B9F A;  2WBN A;  5AQW A;  1KQS M;  4A5A A;  3LP2 A;  1LAV A;  1IJJ A;  1XNQ K;  3FZM A;  2F9T A;  4IBN A;  5C24 A;  1MDU B;  4CJ5 A;  2EWS A;  2NRW A;  3CF5 L;  2GV9 A;  4PWD A;  4QAG A;  5H1S Q;  3OYJ A;  2VQF K;  1MU2 A;  2E2O A;  4QS9 A;  1WSG A;  2BAN A;  4FJG A;  3NBP A;  3NF6 A;  4DR3 K;  1RFQ A;  4ILG B;  4JI4 K;  1OH8 A;  4M3Y A;  3M8P A;  1E4G T;  1XMO K;  4PQU A;  4LD0 A;  3L2R A;  2ITM A;  3CFP A;  1TUU A;  1MA9 B;  4WF9 L;  3UKR B;  5CZ2 A;  3ASM A;  4OPK A;  3JSM A;  2VQE K;  1BL3 A;  1JLB A;  1RT3 A;  4F9O A;  2Q36 A;  3D45 A;  3NH0 A;  4C8L A;  1WUA A;  5LMU K;  1N6Q A;  5CR4 A;  5J2Q A;  4IZ9 A;  1Z05 A;  4FW2 A;  3RMC A;  3AA5 X;  1VSH A;  4YHH K;  3R8E A;  2BTF A;  4FJK A;  1N36 K;  3AO3 A;  4CEF A;  1BIZ A;  1RBR A;  4RTF D;  2YHY A;  4JI7 K;  1NMN A;  3M5R A;  1S5J A;  1LW2 A;  4DTR A;  3LWL A;  5M1O A;  4E0D A;  4GW6 A;  5HRS A;  3VA3 A;  3VEW A;  2E2Q A;  5AQY A;  2NRH A;  3UKU B;  4FWM A;  3C7N B;  3L0Q A;  4CFC A;  4CJE A;  4YDU C;  4IJN A;  2YI1 A;  3VQC A;  1T03 A;  5AQX A;  3L6Q A;  2A41 A;  4FM0 A;  3ZEU A;  1XWL A;  4NXM K;  2FF3 B;  1X3N A;  5KGX A;  2XY7 A;  3O4N A;  1T44 A;  3NAE A;  1LWF A;  4W5N A;  3SUO A;  2AJQ A;  3PIP L;  4DTN A;  3VEY A;  4CGJ A;  4KH6 A;  3O9T A;  4IG0 A;  1TYQ A;  3MWT A;  2KFN A;  1RBV A;  3B6P A;  3SPZ A;  1U2V B;  4BC3 A;  3VGK A;  2HHW A;  1IV0 A;  2KQ2 A;  3V1Q A;  5GAE P;  1OVY A;  4CZK A;  4Q0B A;  3K58 A;  1RDU A;  4JI6 K;  1VAZ A;  3S3N A;  4IOX A;  3HBT A;  4CD3 A;  4YOY A;  2P9K A;  3PX4 A;  4B9V A;  2ZQB A;  3AO5 A;  2Y1I A;  2OZS A;  2WFB A;  4BRH A;  4YOT A;  3DM2 A;  3DLL L;  4JD2 A;  1LWC A;  1X3M A;  3CI5 A;  4MO5 A;  1JXE A;  3V81 A;  4DR6 K;  3QBW A;  3NE6 A;  2HF4 A;  3LDP A;  1VQL N;  1ZBU A;  3MMV A;  4OPJ A;  1LV5 A;  3CFO A;  3K5N A;  4H0T B;  1DTT A;  4KTZ A;  1HKB A;  2FC0 A;  4BRG A;  4E1J A;  1S6Q A;  3U9D A;  2IDO A;  3OYA A;  2CGK A;  2XO7 A;  1WAF A;  3CJA A;  4EHT A;  4AM6 A;  4ICL A;  4PHT X;  5C12 A;  4Z4I A;  4CIG A;  3H45 C;  3KLG A;  3PSF A;  2F8S A;  3ITH A;  4FWP A;  1TL3 A;  1TGO A;  3NCI A;  4H5W A;  4Z4F A;  4E1M A;  3AVJ A;  1HKG A;  4CJR A;  4DLG A;  5EY4 A;  3HTV A;  3NF7 A;  4ZHR A;  3VER A;  5BR9 A;  1IH7 A;  3N4Q A;  3FZK A;  2D0B A;  3ZSR A;  4FLV A;  4CJQ A;  3HPH A;  2G8I A;  4CJT A;  4PL7 A;  3CET A;  3KKS A;  4GVE A;  3HST B;  3SNN A;  1CXQ A;  4EZ9 A;  4B1Z A;  1UA0 A;  3K57 A;  3BF1 A;  1GLA G;  3AA3 A;  2Q2R A;  3LPT A;  3OBY A;  4X66 K;  2G8F A;  3VTI A;  3O1W A;  1QQM A;  3C65 A;  1JJ2 M;  2D4W A;  4I6M A;  4RG8 A;  3LZJ A;  5M1Q A;  4BDZ A;  4OGE A;  5FDL A;  1IKX A;  3SV3 A;  4M7Y A;  3EO3 A;  4CJ4 A;  4B9T A;  4CJL A;  3DRR A;  4LF8 K;  3HP6 A;  2A5X A;  3ZLJ A;  4O0J A;  4CBX A;  3I55 N;  2PZS A;  3SLC A;  3KLI A;  5CHI A;  3MN5 A;  4CHY A;  3TSP A;  3TAG A;  4M3U A;  3KZB A;  4DU4 A;  3PO4 A;  2VCP A;  3WNH A;  2O8F B;  4ZTJ A;  3OYD A;  3CM6 A;  2QWP A;  3VQP A;  5AQU A;  3U8X A;  2P9U B;  3NF9 A;  1CZA N;  2IVO A;  3HM9 A;  3TSQ A;  2RE2 A;  2W6K A;  2ZJP L;  2EHG A;  3CQY A;  5ELZ A;  1NMD A;  1N34 K;  1ZBI A;  5GAD P;  1JLC A;  1LWE A;  4DG1 A;  4CVN E;  1FW6 A;  3KHY A;  3CJ7 A;  3O4Q A;  1UA1 A;  3CME N;  4LF7 K;  2QXF A;  3LP0 A;  3D0P A;  1J5O A;  4B08 A;  1YF5 L;  2VYP A;  3HOT A;  4JS4 A;  1ESV A;  1J6Z A;  4BWM A;  3AAR A;  1XI1 A;  1YTU A;  5LMN K;  1IKV A;  5JS1 A;  2E20 A;  1CXU A;  2CH5 A;  3HP9 A;  4FJX A;  3ZSQ A;  1X9M A;  4E3S A;  1KSP A;  3U6F A;  2I5J A;  4QS7 A;  4KKO A;  1VSD A;  1BWF O;  3TAM A;  3M8R A;  2X6N A;  4H0V B;  4F8R A;  1KAY A;  2FBV A;  2D5R A;  1BCO A;  4FJI A;  3F2K A;  1WLJ A;  3O80 A;  4NCA A;  3QEP A;  1VQ4 N;  4O8U A;  4NCG A;  1BQN A;  1YJN N;  3LAK A;  3IKM A;  4HUF A;  4BR5 A;  4LF5 K;  1GLC G;  3KLE A;  4JN4 A;  2O4G A;  1Q81 O;  1EKE A;  5KGW A;  4G1Q A;  1E3M A;  4NYN A;  4CZH A;  2PBD A;  3UKR A;  2BDP A;  1TVR A;  3FGU A;  3CCL N;  1SKW A;  4GKJ K;  4JKD A;  1O1W A;  1A5X A;  4HHT A;  5AZI B;  4WE1 A;  2HND A;  5SZT A;  3SCX A;  2ASM A;  5BRF A;  1TAU A;  3AGR A;  4CBW A;  2BE2 A;  4H0Y B;  1HYZ A;  4DV2 K;  4BDY A;  1S1V A;  5IWA K;  3W3D A;  1ASV A;  4CJV A;  2PYL A;  1YTA A;  3WQU A;  2KW4 A;  1JCE A;  3LL3 A;  4H5V A;  3UKU A;  3C7N A;  5J1E A;  3QES A;  1L3V A;  2V51 B;  3M1F A;  1FKP A;  1HNZ K;  4B9L A;  1Q82 O;  2OPP A;  4C8M A;  4DLE A;  2ATQ A;  4KHP K;  3W0L A;  4BRF A;  4W5T A;  1D8Y A;  1S22 A;  5HRR A;  1RT1 A;  2FSK A;  4PKI A;  1XNR K;  1U48 A;  2A1S A;  1FKO A;  5KQ8 A;  5EU7 A;  1NK9 A;  4ILJ A;  5AQF A;  2E6M A;  1Z26 A;  1TKT A;  4A57 A;  4H8K A;  5BR8 K;  5M1P A;  3CCV N;  3O1B A;  5AFU H;  3BDP A;  4FLX A;  3QNO A;  4GVM A;  4LF9 K;  4DR4 K;  4CEA A;  3CG7 A;  3KWI A;  5KI6 A;  4DV4 K;  1NG9 A;  4B3M K;  3ZET B;  4IG3 A;  1Q18 A;  2E5L K;  1KD1 O;  2O4I A;  3OYK A;  3CXC M;  5I3U A;  3B6O A;  2HHU A;  4H03 B;  1ZBF A;  3J7Y P;  2GBZ A;  1RT5 A;  3CJ9 A;  1NJX A;  2NNW A;  4A5B A;  5AQS A;  1U04 A;  3NDK A;  4CE9 A;  1HNW K;  4B9Q A;  3MCA B;  4C1N I;  5BPM A;  4AH9 A;  4FL9 A;  5J2N A;  3KD1 E;  4FZZ A;  5M1K A;  3GBT A;  1QSS A;  3G71 N;  1LAW A;  3GE1 A;  2V7Y A;  4BR2 A;  4FPB A;  1EO1 A;  4BC5 A;  1T8E A;  5AQH A;  2KZM A;  3K59 A;  4BG9 A;  2G8H A;  3QFP A;  2P9I A;  3TAF A;  2F7T A;  4JYA K;  2XY6 A;  2YNI A;  3HI0 A;  3LAM A;  4CF1 A;  2YNH A;  3OJS A;  3E1Y A;  4DTS A;  1NGJ A;  3CCM N;  5KTQ A;  4FZY A;  4A61 A;  4QS8 A;  3LDL A;  1HJR A;  3FFI A;  1VQ8 N;  4DV6 K;  4DS4 A;  4H4O A;  1X9W A;  3IAY A;  3CPE A;  2QTD A;  3H1Q A;  4CK1 A;  5GAH P;  3CQX A;  4NCB A;  4FJ9 A;  4H0O A;  4M45 A;  1A5W A;  3S9H A;  1RTJ A;  1VSK A;  4F2S A;  4OX9 K;  2RF2 A;  2YX6 A;  3E66 A;  1KXP A;  4CER A;  2NRT A;  3WNG A;  4CGF A;  2Q3S A;  2QM1 A;  3H1V X;  3K5M A;  1BI4 B;  4DV7 K;  1IBL K;  1L5U A;  1NKC A;  4E19 A;  5HLF A;  4FLT A;  2O8F A;  4DQQ A;  3QDK A;  3AVK A;  3JXU A;  4DV1 K;  1BA0 A;  2P9U A;  1HJO A;  3WXI A;  3Q7B A;  3O4W A;  4EFH A;  2KLA A;  3O6W A;  4XIU A;  3OYH A;  3UIQ A;  3AA4 A;  1MWK A;  3L2W A;  1C1A A;  3A5N C;  2KTQ A;  2IOC A;  5GIN A;  3ENH A;  2UUC K;  1J9A A;  2ZJR L;  3MN7 A;  3ENO A;  4WFB L;  1WN7 A;  1NJW A;  1T6C A;  2RHK A;  3OS0 A;  4Z4G A;  4DB3 A;  4YOX A;  4KHQ A;  3VF2 A;  4JKC A;  3ULE B;  4HCB A;  3QER A;  3T1Y K;  4CHP A;  4E89 A;  1I94 K;  2AP1 A;  4JRQ A;  4CZF A;  1NU0 A;  5B8H A;  2G8U A;  3P39 A;  1NK0 A;  3RSE B;  1OH7 A;  1KAX A;  3AVC A;  3RR8 A;  4B1V A;  1KAZ A;  2F8T A;  4BRO A;  1RBU A;  2OYQ A;  1C1C A;  3AAQ A;  3RMA A;  1RDB A;  4B1U B;  1IO2 A;  4KO0 A;  4JKA A;  1QS4 A;  2A42 A;  2E1Y A;  3H6E A;  3TSU A;  3LZI A;  3J80 O;  1V4S A;  4O4G A;  2IGI A;  3AGK A;  3QLH A;  5LL6 Z;  1YIJ N;  1S6P A;  3RR7 A;  2XY8 A;  1WSE A;  3AO4 A;  1HMV A;  3AVF A;  2FSN A;  2WOM A;  3DI6 A;  2I7P A;  4N47 A;  4FJH A;  3KK2 A;  5AZI A;  4O5B A;  4EAH D;  5BRD A;  1EWQ A;  2IC3 A;  3BGR A;  2P9L B;  2ZGZ A;  4ISE A;  1NBW A;  4BE2 A;  3P38 A;  4BC4 A;  3MXM A;  3HPG A;  1QHA A;  1OH6 A;  3ZSW A;  3E9L A;  4H0X B;  3ZSO A;  5I9E B;  1RIL A;  4KBO A;  4B8C A;  4E7J A;  1NGB A;  4H5R A;  3I8D A;  1NGI A;  1NK8 A;  3QFU A;  1ZXO A;  3C6A A;  3O9U A;  2HW3 A;  3SMS A;  3CCU N;  2WC9 A;  5AQI A;  3I56 N;  2EX3 A;  3VQA A;  3ZT0 A;  3NGI A;  3L3V A;  4I2P A;  5E26 A;  2KZZ A;  4KH5 A;  2PFU A;  3KJV A;  1C0F A;  2YHB A;  3DOK A;  4JHD B;  1XMQ K;  1K73 O;  2BGG A;  1X9J A;  4E7K A;  1DTQ A;  1HYV A;  3T7Z A;  3NGZ A;  3EZ5 A;  3PY8 A;  1GLB G;  2QWR A;  3LAL A;  4KRF A;  4DKW A;  3P1G A;  4B3S K;  3QIO A;  1JLF A;  4CJW A;  4CJ7 A;  1QHT A;  1QQO A;  2HOE A;  3ZET A;  1NGF A;  2VGM A;  3SJH A;  4QCL A;  1BG3 A;  1GOB A;  4FPA A;  3C6H A;  3DRP A;  3HL8 A;  2RKI A;  1YVU A;  2OA8 A;  4BR4 A;  4B9U A;  4MDA A;  4PY5 A;  5FPN A;  5AQK A;  4YOR A;  4J2A A;  4KB0 A;  4RW8 A;  4RW6 A;  3SK3 A;  4KI6 A;  4FJ8 A;  2GX9 A;  3THY A;  3V9X A;  4G9Z A;  3DLK A;  4ZTF A;  3MK6 A;  2OPS A;  4BRP A;  3MEG A;  4IFV A;  3N4P A;  3ZSZ A;  4FM2 A;  4M3X A;  1KTQ A;  1BCM A;  1JLQ A;  1RDW X;  2QWL A;  2QXL A;  1NK5 A;  4LY7 A;  4YOV A;  4IO9 L;  4GY2 B;  1HPM A;  4L8R B;  1WSF A;  4DQS A;  2A3Z A;  1KFD A;  2PAV A;  4Y1C A;  1K8K B;  1SL2 A;  5JVH L;  1EXQ A;  5A2Q O;  2ETJ A;  1GOA A;  3AO1 A;  2R7Y A;  4BVP A;  3A5L C;  4BY9 C;  3EEQ A;  4OPA A;  5HBM A;  1ATR A;  4C23 A;  3FZH A;  4BRC A;  1U47 A;  5AQO A;  3AVG A;  3D2E B;  1TKX A;  4B1Y B;  2JWL A;  4JI5 K;  4E7H A;  1CZB A;  3SUP A;  3H46 O;  4IFY A;  2ITG A;  2VG6 A;  3VEN A;  2FXU A;  4CJU A;  1BI4 A;  2ASO A;  2QWQ A;  2IS3 A;  3B8A X;  4NXN K;  1OKJ A;  4PKH A;  1QE1 A;  1EET A;  4FWN A;  2QWN A;  2VGN A;  3D2F B;  3LM2 A;  2VWB A;  2BUP A;  2D0P A;  3BUZ B;  1SAZ A;  1S1T A;  3U3G A;  3CCE N;  2HBJ A;  3C94 A;  4OGC A;  4N5S A;  3R1X A;  4BE0 A;  3BF3 A;  4CW7 B;  2P9I B;  4BRD A;  1ZBS A;  4LF6 K;  3J8A A;  1G15 A;  2D0C A;  4F3T A;  5JVG L;  5GIP A;  4BRN A;  4LSL A;  3V6D A;  1I3A A;  1ASU A;  3O3H A;  5KRS A;  3QIC A;  4W5Q A;  2ZE2 A;  4Y1D A;  3ULE A;  4Q5V A;  1JLA A;  1QSL A;  4CCH A;  5AQZ A;  3ALY A;  5ADX H;  1ZBL A;  4CHN A;  4ELV A;  4CGG A;  1D9F A;  2GTD A;  4K8Z A;  3L2U A;  4BC2 A;  1DGK N;  5JLH A;  5EOY A;  3IG1 A;  3RSE A;  4AHV A;  4MO4 A;  3ZT1 A;  4AHS A;  2UXC K;  5DK5 A;  5CYQ A;  3VQ4 A;  4O44 A;  4XEI A;  1HQE A;  3QB0 A;  1L3S A;  2D1K A;  3VF6 A;  3AVI A;  3PLA A;  1ILY A;  3C6T A;  3DRS A;  4JK9 A;  1Q7Y O;  3TWH A;  4DTJ A;  3RRG A;  4N41 A;  3TTC A;  1XHX A;  3ZCM A;  1N32 K;  4AHR A;  1SL0 A;  3VES A;  4DV5 K;  1H1V A;  2PYJ A;  1T7P A;  3THV A;  3CIP A;  2P5O A;  3KLF A;  4CF2 A;  1BO5 O;  2E4L A;  2P51 A;  3ZSX A;  3HPO A;  3SV4 A;  4I7F A;  4MFB A;  4HVJ A;  4CJP A;  2P9L A;  3ULD A;  3BZK A;  2HMI A;  1QVG M;  4DTM A;  3RVC A;  3M6G A;  4EP5 A;  3OYB A;  4CES A;  3CC7 N;  4ID5 A;  2P9P A;  1QQN A;  4DFP A;  3C95 A;  3EE9 A;  1ATN A;  1HPZ A;  3IRX A;  3HK2 A;  1UOC A;  4DSL A;  4PUO A;  1VSM A;  5AJ3 K;  3KIO A;  3VQ5 A;  3AA2 A;  4RW7 A;  1WSI A;  2WON A;  3J81 O;  4OJR A;  3K9K A;  3L2V A;  3MXJ A;  4CBU A;  1A5V A;  4GKK K;  3THX B;  4WQ4 C;  5M1N A;  1FK9 A;  5C10 A;  4HUG A;  1RTD A;  4JI3 K;  4YNQ A;  5HRO A;  5C42 A;  2Z1G A;  3LDO A;  3U9Z A;  5AQG A;  4DHY A;  1FJG K;  4N76 A;  1TKZ A;  2BH1 A;  3MWP A;  1TV6 A;  4JI2 K;  3TU5 A;  5F1X A;  3SYZ A;  3HVR A;  4JHD A;  5HOO A;  4JS5 A;  4BRQ A;  1T05 A;  5BN9 A;  5E84 A;  4IJA A;  4DCH A;  3CCQ N;  2E2P A;  3HXM A;  1JL2 A;  4CHO A;  3OYN A;  4DU3 A;  3LM9 A;  4JI8 K;  5HRP A;  3VQD A;  2E6L A;  3G10 A;  3G25 A;  4DTP A;  2E88 A;  3ATV A;  4DR2 K;  3SZ2 A;  1VSI A;  4DTU A;  2NZT A;  3EKU A;  3VA0 A;  3TR8 A;  1YJW N;  4EIA A;  1W7A A;  1HNV A;  4J2D A;  4KHU A;  1J53 A;  1KC8 O;  5FRO A;  1RDD A;  3IUC A;  3RMD A;  5E41 A;  4JV5 K;  1QTM A;  1ZBH A;  3FZF A;  2G8W A;  3OYC A;  3WQT A;  5AQL A;  1YI2 N;  1Q9Y A;  4CJ3 A;  1HUX A;  3SQ0 A;  1NWK A;  4CZM A;  1GLE G;  3GDQ A;  4DQI A;  3IDH A;  3TTF A;  1C0U A;  3SUQ A;  2HB5 A;  4I9L A;  3V1R A;  3NGY A;  3WUH A;  1VQM N;  3P4I A;  5CYM A;  1EP4 A;  4CEC A;  1YJ9 N;  3TAN A;  1VSL A;  4RCH A;  3FR0 A;  1B9D A;  3O8M A;  4Z4H A;  2HBM A;  4OLB A;  1VRT A;  1T3V A;  1K8K A;  3PX6 A;  1LW0 A;  1TKD A;  4H4M A;  3CJ1 A;  2FSJ A;  3ZSV A;  5AQM A;  1SKR A;  2HVH A;  3CJC A;  3G4S N;  3CCJ N;  1VQP N;  1TUY A;  3SAG A;  3ZT3 A;  1VQ6 N;  3D2E A;  2F4V K;  1RTH A;  1C1B A;  4KHY A;  2DFE A;  1L3U A;  3U3Y A;  3I0S A;  4KHW A;  1N33 K;  5HRN A;  3DLB A;  2FBY A;  4FWR A;  1SS6 A;  4B8A B;  4CF8 A;  3V9S A;  2A40 A;  3D2F A;  4AF1 A;  5C2F A;  2YKN A;  2XRI A;  3THY B;  2NUB A;  1VQN N;  4AHC A;  3KD5 E;  3A2F A;  1GLL O;  4KB1 A;  3CYM A;  4KTQ A;  1X9S A;  2ZF5 O;  1ZYQ A;  3K2P A;  2Q0R A;  3VEZ A;  1P8Z A;  1KRP A;  4PA1 A;  2O8C B;  1BQM A;  2DFH A;  4BR7 A;  3PV8 A;  3KK3 A;  3ATU A;  5AQJ A;  3WXL A;  3CC4 N;  3QNN A;  4FCY A;  3JAM O;  4FOE A;  3H3N O;  3KWG A;  1C6V A;  2HHX A;  3VMF B;  1L3T A;  4WQ5 A;  2HHS A;  4IKF A;  2HMP A;  4CF0 A;  5KPZ A;  1KVA A;  4FK0 A;  1RNH A;  3SJJ A;  2OCE A;  3OTO K;  2OTL N;  3P5J A;  3IFR A;  1BIS A;  1XC9 A;  4BRK A;  1VSF A;  3IS9 A;  5C25 A;  3D7E O;  1W2B M;  1YIT N;  4V19 S;  1NK7 A;  4IOA L;  4BRA A;  1K8A O;  2QKK A;  1IKW A;  1GLJ O;  1HNI A;  1NGE A;  3DOL A;  4Z94 A;  4DSJ A;  1XUP O;  3OBW A;  3T19 A;  4X62 K;  1ATS A;  3F9M A;  1IG8 A;  2YJF A;  2G8K A;  3P83 D;  1HR0 K;  2JGU A;  1LCU A;  2F96 A;  3WXJ A;  1VQ9 N;  2JLE A;  4YFU A;  4B9S A;  4HWI A;  4WCE L;  2P9N B;  4B1W B;  5AQP A;  3A5O C;  2RPI A;  4CZG A;  1RTI A;  4KH4 A;  4MLH A;  3V4I A;  4LH4 A;  4TSX A;  2QK9 A;  4CZJ A;  4C8K A;  3J7A P;  1S9E A;  1C0T A;  4DF4 A;  3HRG A;  4GV3 A;  3K5O A;  1BDG A;  3CMA N;  4BG8 A;  3VEO A;  3M3Z A;  1BUP A;  3OYF A;  4BQL A;  5HL7 L;  2YV0 X;  1SQK A;  3CER A;  2ZD1 A;  3OYL A;  1KVC A;  3VEV A;  2NRR A;  3O08 A;  4RW4 A;  2X6S A;  4X64 K;  1Z25 A;  3GOI A;  2OPQ A;  4FJ7 A;  3VN5 A;  4BDP A;  1NM1 A;  1ITG A;  3D6R A;  4HTL A;  5GIO A;  4DF8 A;  4CGI A;  3FZL A;  3TAQ A;  2QWO A;  4FSV A;  2NRZ A;  1WBD A;  2ZWH A;  4RWT A;  2UXB K;  4DS5 A;  2HNZ A;  3THX A;  1RDA A;  2QKB A;  4FJN A;  4DU1 A;  4IFE A;  1JCG A;  2YHW A;  2UU9 K;  1WNS A;  3ZYY X;  4C8O A;  3AVB A;  5C2D A;  4O55 A;  4FJM A;  4XH1 A;  3LP3 A;  3MEE A;  3MXI A;  3VF4 A;  3VGL A;  4FLU A;  1U49 A;  2OPR A;  2GWJ A;  1P90 A;  3T1A A;  4JK7 A;  3NVM A;  1HKC A;  2VG5 A;  4W5O A;  3ID6 A;  5JMV A;  4H5T A;  3JS6 A;  4O5F A;  5BPL A;  1KLN A;  1XQS C;  2ZM6 K;  4JI1 K;  1B92 A;  3TAP A;  3DLE A;  2Z1J A;  3VOV A;  3VQQ A;  3U4L A;  5IT9 O;  5EXW A;  3OS1 A;  1F21 A;  3S3O A;  2RN2 A;  5AQN A;  2V52 B;  2YCH A;  3THW B;  1W97 L;  4DR1 K;  4BWJ A;  1FXX A;  4JNE A;  2W40 A;  2E8A A;  4DQP A;  4FW1 A;  2P9P B;  1YHQ N;  5JIC A;  5DMR A;  1YVN A;  4KV8 A;  3K5L A;  1YXQ A;  2CGL A;  3VEX A;  5LY3 A;  1M90 O;  2ZGY A;  3QML A;  3AVM A;  2I7N A;  3WNE A;  3O9R A;  1YT3 A;  3BY5 A;  3CC2 N;  3IMX A;  2F9W A;  3A0I X;  1WBB A;  1VRU A;  4DR7 K;  1Q8I A;  3OJU A;  1NOY A;  4JKE A;  4M41 A;  4JKG B;  3AY9 A;  2E2N A;  3AV9 A;  4LF4 K;  1QVF M;  2O8E B;  4U7B A;  4Z0U A;  4FM1 A;  1RBT A;  3WEE B;  4XH5 A;  3QET A;  4JI0 K;  3ZSY A;  1EX4 A;  4CEO A;  3O5B A;  1M1K O;  4K0K K;  4CIE A;  3AVL A;  5FPD A;  1RT2 A;  4LFB K;  2AA4 A;  2A6A A;  2ZJQ L;  3DLR A;  2JWK A;  3M8S A;  4KAZ A;  4K42 A;  3WT0 A;  4NB4 A;  1J54 A;  2YJE A;  3NF8 A;  4AM7 A;  4K25 A;  1SKS A;  2GEL A;  4BVO A;  4FVU A;  3AVN A;  2P9S B;  4NO7 A;  3PX0 A;  4FZX C;  3G0Z A;  3I33 A;  1W9H A;  3P31 A;  4O0I A;  2OZM A;  3S3M A;  1SV5 A;  2O8D B;  5AFU A;  2J4R A;  4OLA A;  1VK0 A;  4FJ5 A;  5KPT A;  4KFB A;  3NH2 A;  3ZT2 A;  2ASP A;  3FFK B;  4FWO A;  3SQ4 A;  1V4T A;  2O8C A;  2UUA K;  3KTQ A;  5F2R A;  2QI2 A;  4DSF A;  4LC9 B;  3SBG A;  4CED A;  3RMB A;  3AVA A;  3T69 A;  3O9Q A;  1S1U A;  3E9O A;  4EP4 A;  3OVN A;  1YAG A;  3KKR A;  4RW9 A;  3PUF A;  3CCR N;  5LJW A;  3DWL A;  3L3U A;  3I0R A;  1Z6R A;  4A59 A;  1QQC A;  2FBX A;  3H3O B;  3R9P A;  3MDQ A;  4FK2 A;  1KFS A;  3BP8 A;  4FWL A;  4CF9 A;  5AR0 A;  1GLD G;  1S72 N;  3FLC O;  2DTU A;  2VWK A;  1Q9X A;  3PSI A;  1JLE A;  4F4K A;  4BQZ A;  3OYI A;  3QBX A;  2Z1I A;  5J2P A;  2E1Z A;  2W42 A;  2X78 A;  4JAX A;  1QZ5 A;  2WUS A;  4DV3 K;  5JS2 A;  4BRE A;  3DMJ A;  2Q31 A;  1S1X A;  4WQ5 C;  4DQ8 A;  4FJL A;  3CFR A;  2HHV A;  2P9N A;  1YUW A;  2IVN A;  3LDS A;  4JRP A;  3PO5 A;  2D0A A;  3L8B A;  3KK7 A;  1IG9 A;  3HOS A;  1XC3 A;  1TAQ A;  5BPN A;  1IKY A;  2OAN A;  5FRN A;  4C1N K;  4FO0 A;  2B6A A;  3QEX A;  4DUY K;  1J5E K;  4L3Q A;  3SAF A;  2YKM A;  3F9K A;  3OA9 A;  1WAJ A;  3ENB A;  4DSK A;  3LDQ A;  3OYM A;  5CZ1 A;  1N8R O;  4FK4 A;  3GG4 A;  4CEQ A;  4BRM A;  4CFB A;  4CHQ A;  3LDN A;  3G6E N;  4KTW A;  3RWU A;  3UE5 A;  1DLO A;  2WTU A;  1RBS A;  5AQR A;  3BZC A;  1JLG A;  4GNI A;  2P1J A;  1TL1 A;  4FVM A;  3CPW M;  4BGA A;  2OTJ N;  4Z4E A;  4CK2 A;  3QIP A;  3VGM A;  4CEB A;  1GLF O;  3V9Z A;  1Q86 O;  2HBL A;  3HVT A;  3R3L A;  3K0S A;  3TTD A;  2HST A;  3DAW A;  2W41 A;  4DTX A;  1BGX T;  1NK6 A;  1HRH A;  4DWI A;  1BA1 A;  1VHX A;  4WFA L;  1HQU A;  4DFM A;  5AZJ B;  2IAJ A;  3MED A;  4MDB A;  4K8X A;  4WYB A;  3LWM A;  3HM8 A;  4F3O A;  3HZ6 A;  1NKE A;  3LPU A;  2GWK A;  3QEW A;  1RDC A;  5DM7 L;  4FJJ A;  3SI6 A;  5DM6 L;  3MX2 A;  4M3T A;  3QO9 A;  4CHZ A;  3CD6 N;  2DY4 A;  4BE1 A;  1DEJ A;  4DFJ A;  3HJF A;  5F0X A;  3ZX0 A;  4N56 A;  4GV9 A;  3EL2 A;  4MQ3 A;  4AIL C;  5FRM A;  3THW A;  1NKB A;  4MLE A;  1N5Y A;  4IEI A;  4Y0W A;  1X1P A;  2Q1N A;  4F2R A;  3MN9 A;  5HP1 A;  5AQV A;  3HO1 A;  1VSE A;  1WB9 A;  1ASW A;  2UYT A;  2YHA A;  1NJZ A;  1REV A;  3BEX A;  3KVG A;  3J7Z O;  3OYG A;  1LOT B;  3TAR A;  1S9G A;  1D9D A;  1NGG A;  4CK3 A;  2PY5 A;  4FLY A;  4YOU A;  3RTV A;  2IVP A;  3PIO L;  2DFF A;  4M63 C;  2NLX A;  3T1H K;  4B1X B;  4LFC K;  3RRH A;  3WXK A;  4AHU A;  1JCF A;  3HT3 A;  2HF3 A;  3DXM B;  1T6D A;  3OYE A;  4KHS A;  4JKG A;  5FLX O;  2O8E A;  3LP1 A;  3WEE A;  3MX5 A;  4CD1 A;  4CZE A;  1HX1 A;  1OH5 A;  4XH4 A;  2HHT A;  2O8B B;  1Y64 A;  2VG7 A;  2XY5 A;  4KPY A;  4CZL A;  4CJK A;  4HUE A;  4BR0 A;  1SUQ A;  1KCF A;  4BAC A;  4QOZ B;  2GEM A;  3NMU A;  4B3O A;  4LH5 A;  2QW9 A;  1QSY A;  3KLH A;  4NYF A;  2P9S A;  3DXK B;  1HLU A;  4CZI A;  2YNF A;  3VQ6 A;  2XHB A;  3JYT A;  4BGB A;  4M7X A;  4B3T K;  1K6Y A;  2O8D A;  1TK8 A;  2QWM A;  3DLH A;  1SL1 A;  1NNE A;  3SBT A;  3ID8 A;  2FF6 A;  1DT9 A;  4A2A A;  3NFA A;  1R0A A;  3FE1 A;  4JKB A;  2X74 A;  2YNG A;  4M42 A;  3A8Y A;  3SQ1 A;  1HNX K;  1IBM K;  1O13 A;  4NLB A;  1RGI A;  1KVB A;  4IDH A;  3AAP A;  3Q7C A;  4KRE A;  3O3G A;  4K43 A;  1U45 A;  3SMP A;  2HHH K;  4OO1 J;  4BRI A;  4E1N A;  4O8K A;  5SWM A;  1NGH A;  2HBK A;  3S41 A;  4M3R A;  3VTH A;  4ELU A;  5LJV A;  4FLW A;  4K41 A;  4GV6 A;  2HHQ A;  5K14 A;  3MEC A;  1MWM A;  1JXB A;  3TAE A;  1NJI O;  1I39 A;  4R79 A;  3I8B A;  1U2V A;  3K9J A;  4JEP A;  5I42 A;  4AQY K;  4J2B A;  4ILH A;  4YDU A;  3EE8 A;  5D3G A;  5BRE A;  1TK5 A;  1C0M A;  4YOW A;  5J2M A;  4DMN A;  3CJB A;  1UWB A;  3WXM B;  1CLQ A;  2Q97 A;  3DLG A;  1VQ7 N;  4JLH A;  3V1O A;  3VQ9 A;  2FBT A;  1TK0 A;  3MN6 A;  3T3F A;  4UY8 O;  3ZX2 A;  4CFD A;  5KPR A;  4ISG A;  4IDK A;  3VPZ A;  4ID1 A;  4OKJ A;  4GMJ B;  1RT6 A;  3NHG A;  1WOQ A;  3TI0 A;  5EX5 A;  3VQB A;  5AQQ A;  4BR9 A;  3ISN C;  1K9M O;  2YHX A;  1VSJ A;  1D4X A;  1QZ6 A;  3NVK A;  4R5P A;  4FLZ A;  2Z1H A;  2NRX A;  4IO8 A;  1U6Z A;  3ZEU B;  1D5A A;  5M1F A;  3E9P A;  2QEX N;  2UUB K;  3L4I A;  4E7L A;  3OHR A;  4C8N A;  1WSH A;  5KQD A;  1NK4 A;  3OS2 A;  1ZC6 A;  1NGA A;  1E4F T;  3L4Q A;  4J8F A;  3C0B A;  4B9N A;  3GL1 A;  3QIN A;  1TYQ B;  2D0O A;  4A2B A;  4DQR A;  1BHL A;  1WSJ A;  4CJS A;  4E7I A;  2KKZ A;  3TPQ A;  4PL8 A;  4X65 K;  4EZ6 A;  4M3W A;  4DUZ K;  1GOC A;  1UAX A;  4OKE A;  3A5M C;  1RT7 A;  4LFA K;  3MCP A;  4IXC A;  3EY1 A;  2HNY A;  2IIR A;  3EN9 A;  3EYZ A;  2P9K B;  2G8V A;  1G99 A;  4IOC L;  3M8Q A;  5AZJ A;  4W5R A;  1IBK K;  3DYA A;  5ADX A;  5JLF A;  5TKY A;  2W6L A;  4OKK A;  3CHW A;  3EZW A;  4JD2 B;  4I9Q A;  4HCC A;  4DFK A;  1DKG D;  3R6M A;  1RCH A;  5AQT A;  4WFN L;  4BRL A;  2QA4 N;  3SQ2 A;  3AVH A;  3DJC A;  4OVL A; 
#chains in the Genus database with same CATH homology
 1JKH A;  2KW4 A;  4Q5V A;  1JLA A;  1QSL A;  1KLM A;  4CCH A;  1NOZ A;  3DLR A;  2A1R A;  5J1E A;  3ALY A;  1D9D A;  3M8S A;  3QES A;  2GUI A;  4LSN A;  1L3V A;  1ZBL A;  1FKP A;  4CHN A;  4HTU A;  4CGG A;  1D9F A;  4B9L A;  4DSE A;  2OPP A;  4C8M A;  4DLE A;  4ELV A;  1J54 A;  4K8Z A;  2ATQ A;  3NF8 A;  3L2U A;  1SKS A;  4W5T A;  1D8Y A;  3IG1 A;  4AHV A;  3ZT1 A;  5HRR A;  3VQE A;  3AVN A;  4AHS A;  3HK2 A;  1RT1 A;  3PX0 A;  5DK5 A;  5CYQ A;  3LAN A;  1U4B A;  3VQ4 A;  4FZX C;  4O44 A;  3G0Z A;  3F73 A;  2LSN A;  1U48 A;  1W9H A;  2A1S A;  1HQE A;  4O0I A;  2OZM A;  3S3M A;  1FKO A;  4Z4C A;  1L3S A;  4FYD A;  3L2Q A;  1SV5 A;  3TAB A;  1W0H A;  5EU7 A;  1NK9 A;  4CGD A;  4OLA A;  3AVI A;  3C6T A;  1VK0 A;  5KRT A;  3DRS A;  4FJ5 A;  2E6M A;  4KFB A;  1Z26 A;  3NH2 A;  3TWH A;  1TKT A;  4B9M A;  4DTJ A;  3RRG A;  3ZT2 A;  4N41 A;  3WNF A;  3CM5 A;  3KK1 A;  1XHX A;  4H8K A;  3ZCM A;  4KI4 A;  3SQ4 A;  4DSI A;  4AHR A;  1SL0 A;  1S1W A;  3BDP A;  4FLX A;  3QNO A;  4GVM A;  2PYJ A;  3KTQ A;  3C6U A;  1T7P A;  4DSF A;  3THV A;  2VWJ A;  4ELT A;  2P5O A;  4CEA A;  3KLF A;  3CG7 A;  2E4L A;  2P51 A;  3AVH A;  3ZSX A;  5KI6 A;  4CJF A;  4CF2 A;  2Y1J A;  3HPO A;  3SV4 A;  2KFZ A;  4M3Z A;  4CEZ A;  4CED A;  3RMB A;  1RT4 A;  3AVA A;  4I7F A;  4MFB A;  3SPY A;  4IG3 A;  4HVJ A;  4CJP A;  1S1U A;  3ULD A;  4EP4 A;  3HYF A;  3OVN A;  3KKR A;  4CIF A;  4RW9 A;  1BIU A;  3QEV A;  3OYK A;  3PUF A;  5I3U A;  5CY4 A;  2HMI A;  4FXD A;  2O4I A;  2HVI A;  3B6O A;  4DTM A;  3MAQ A;  2HHU A;  3L3U A;  1ZBF A;  3I0R A;  4AHT A;  4EP5 A;  2GBZ A;  1RT5 A;  2B5J A;  1QQC A;  2FBX A;  1NJX A;  3OYB A;  3SUN A;  4CES A;  4ID5 A;  3QEI A;  1U04 A;  3NDK A;  4DFP A;  3VQ7 A;  4FK2 A;  4CE9 A;  3C95 A;  1KFS A;  4KHN A;  1HPZ A;  3IRX A;  4AH9 A;  4CEE A;  4CGH A;  1UOC A;  4CF9 A;  5T7B A;  5J2N A;  4DSL A;  1XHZ A;  3KD1 E;  4PUO A;  4FZZ A;  1CZ9 A;  1VSM A;  3KIO A;  1Y97 A;  3E01 A;  2DTU A;  3VQ5 A;  2VWK A;  3O3F A;  3AA2 A;  1Q9X A;  1QSS A;  1JLE A;  4RW7 A;  4F4K A;  1LAW A;  1WSI A;  3OYI A;  2WON A;  3ZT4 A;  4OJR A;  3V9U A;  4CFA A;  2Z1I A;  3L2V A;  3MXJ A;  5J2P A;  3AO2 A;  1T8E A;  4M3X A;  2W42 A;  1A5V A;  3OY9 A;  2KZM A;  2X78 A;  3K59 A;  4I2Q A;  4DTO A;  1FK9 A;  2G8H A;  5JS2 A;  3CQ8 A;  4HUG A;  3V9W A;  1RTD A;  3DMJ A;  4YNQ A;  4FJL A;  1S1X A;  3TAF A;  5HRO A;  5C42 A;  2Z1G A;  3CFR A;  2HHV A;  4UQG A;  2XY6 A;  2YNI A;  3LDS A;  3LAM A;  3NH1 A;  4CF1 A;  4JRP A;  3PO5 A;  4N76 A;  1TKZ A;  2D0A A;  2YNH A;  1TV6 A;  3OJS A;  3VQ8 A;  3L8B A;  3SYZ A;  3HVR A;  4DTS A;  1IG9 A;  4JS5 A;  1TAQ A;  1T05 A;  1IKY A;  3H08 A;  5KTQ A;  5FRN A;  4FZY A;  3QEX A;  2B6A A;  1HJR A;  2B4J A;  1NJY A;  1JL1 A;  2P5G A;  3FFI A;  1B9F A;  3HXM A;  2YKM A;  3F9K A;  4DS4 A;  1JL2 A;  1WAJ A;  3LP2 A;  4H4O A;  1LAV A;  4CHO A;  1X9W A;  3OYN A;  3IAY A;  4DU3 A;  5HRP A;  4IBN A;  5C24 A;  3VQD A;  4CJ5 A;  4CK1 A;  2E6L A;  3G10 A;  4DTP A;  4NCB A;  2GV9 A;  3SZ2 A;  4FJ9 A;  1VSI A;  4QAG A;  4M45 A;  3OYJ A;  3OYM A;  4DTU A;  4DSK A;  1A5W A;  5CZ1 A;  1MU2 A;  3VA0 A;  1RTJ A;  3S9H A;  4FK4 A;  4KAZ A;  1VSK A;  4F2S A;  3TR8 A;  4CEQ A;  4J2D A;  1HNV A;  2RF2 A;  4CFB A;  4CHQ A;  4KHU A;  1J53 A;  4KTW A;  4CER A;  1WSG A;  3RWU A;  2BAN A;  1RDD A;  5FRO A;  4FJG A;  3NBP A;  1DLO A;  3NF6 A;  2Q3S A;  3WNG A;  4CGF A;  3RMD A;  1RBS A;  1BI4 B;  3K5M A;  5E41 A;  1JLG A;  2P1J A;  1TL1 A;  4FVM A;  1QTM A;  1ZBH A;  1L5U A;  3M8P A;  4M3Y A;  4PQU A;  1NKC A;  4E19 A;  4LD0 A;  2G8W A;  3L2R A;  5HLF A;  4FLT A;  4CK2 A;  3CFP A;  4Z4E A;  3OYC A;  3QIP A;  4DQQ A;  4CEB A;  3AVK A;  3V9Z A;  1Q9Y A;  4CJ3 A;  5CZ2 A;  3SQ0 A;  3ASM A;  3HVT A;  4OPK A;  3JSM A;  1BL3 A;  4XIU A;  3OYH A;  1JLB A;  1RT3 A;  4DQI A;  3AA4 A;  3UIQ A;  1C0U A;  3SUQ A;  2HB5 A;  4I9L A;  3V1R A;  1C1A A;  3NGY A;  3L2W A;  1BGX T;  4DTX A;  1NK6 A;  3D45 A;  1HRH A;  3NH0 A;  4DWI A;  4C8L A;  2KTQ A;  2IOC A;  1N6Q A;  5CYM A;  1EP4 A;  1HQU A;  4CEC A;  4DFM A;  5J2Q A;  2IAJ A;  3MED A;  3TAN A;  3RMC A;  1VSL A;  4FW2 A;  1J9A A;  3AA5 X;  4K8X A;  3LWM A;  1VSH A;  4FJK A;  4F3O A;  4Z4H A;  1B9D A;  3AO3 A;  1WN7 A;  1NJW A;  4OLB A;  4CEF A;  1BIZ A;  1RBR A;  1VRT A;  3OS0 A;  1NKE A;  1HYS A;  4Z4G A;  3LPU A;  3PX6 A;  1LW0 A;  1TKD A;  3QEW A;  1RDC A;  1S5J A;  4H4M A;  4FJJ A;  1LW2 A;  3SI6 A;  4DTR A;  4KHQ A;  2HHW A;  3ZSV A;  3LWL A;  1SKR A;  4E0D A;  4M3T A;  3QO9 A;  4CHZ A;  4GW6 A;  5HRS A;  3VA3 A;  4HCB A;  2HVH A;  3QER A;  2DY4 A;  4CFC A;  4CJE A;  4CHP A;  4E89 A;  4BE1 A;  4JRQ A;  3VQC A;  1T03 A;  4DFJ A;  3HJF A;  3ZT3 A;  4FM0 A;  2G8U A;  4N56 A;  1NK0 A;  1XWL A;  4MQ3 A;  4AIL C;  1RTH A;  2XY7 A;  5KGX A;  5FRM A;  1C1B A;  1NKB A;  3AVC A;  3O4N A;  1N5Y A;  3RR8 A;  3NAE A;  4KHY A;  1LWF A;  4W5N A;  3SUO A;  2F8T A;  1RBU A;  1X1P A;  2DFE A;  1L3U A;  2AJQ A;  4DTN A;  4F2R A;  2OYQ A;  1C1C A;  3U3Y A;  3I0S A;  3RMA A;  1RDB A;  5HP1 A;  4KHW A;  3HO1 A;  1VSE A;  1IO2 A;  4KO0 A;  4CGJ A;  2FBY A;  1ASW A;  5HRN A;  1QS4 A;  3DLB A;  2YHA A;  4KTQ A;  4IG0 A;  1NJZ A;  4B8A B;  3LZI A;  4CF8 A;  3V9S A;  2KFN A;  1RBV A;  1REV A;  3B6P A;  4O4G A;  3RR7 A;  2IGI A;  2YKN A;  2XRI A;  3QLH A;  3SPZ A;  1S6P A;  2NUB A;  3OYG A;  4AHC A;  3KD5 E;  2XY8 A;  1WSE A;  3A2F A;  4KB1 A;  3TAR A;  1S9G A;  3AO4 A;  3CYM A;  1HMV A;  2KQ2 A;  4CK3 A;  1X9S A;  3V1Q A;  4FLY A;  3K2P A;  1ZYQ A;  3RTV A;  2PY5 A;  3AVF A;  2WOM A;  3DI6 A;  1KRP A;  4Q0B A;  4PA1 A;  3K58 A;  2DFF A;  4N47 A;  1BQM A;  4FJH A;  3RRH A;  2DFH A;  4AHU A;  3PV8 A;  3KK3 A;  3S3N A;  3HT3 A;  3KK2 A;  3QNN A;  4FCY A;  4O5B A;  3PX4 A;  4B9V A;  2ZQB A;  3OYE A;  4KHS A;  3AO5 A;  2IC3 A;  2Y1I A;  3BGR A;  1C6V A;  2OZS A;  2HHX A;  1L3T A;  3DM2 A;  2HHS A;  3LP1 A;  4IKF A;  4CF0 A;  1KVA A;  4FK0 A;  1RNH A;  1LWC A;  4BE2 A;  3SJJ A;  3V81 A;  1JXE A;  2HHT A;  3P5J A;  1BIS A;  3NE6 A;  3MXM A;  1XC9 A;  3HPG A;  1ZBU A;  1VSF A;  2VG7 A;  4OPJ A;  2XY5 A;  4KPY A;  3ZSW A;  4CJK A;  3IS9 A;  4HUE A;  1LV5 A;  3CFO A;  3K5N A;  5C25 A;  1DTT A;  1SUQ A;  4KTZ A;  2FC0 A;  3ZSO A;  1S6Q A;  1NK7 A;  1KCF A;  4BAC A;  1RIL A;  2IDO A;  4B8C A;  3OYA A;  4E7J A;  4QOZ B;  2XO7 A;  4B3O A;  2QKK A;  4LH5 A;  1WAF A;  1IKW A;  1HNI A;  3DOL A;  4ICL A;  1QSY A;  4DSJ A;  4Z4I A;  4CIG A;  3KLG A;  3I8D A;  1NK8 A;  2F8S A;  3KLH A;  3T19 A;  3ITH A;  4NYF A;  2HW3 A;  1TL3 A;  1TGO A;  3NCI A;  4Z4F A;  2YNF A;  3VQ6 A;  2XHB A;  4E1M A;  3AVJ A;  3JYT A;  2G8K A;  4CJR A;  3P83 D;  4DLG A;  2JGU A;  1K6Y A;  2F96 A;  2JLE A;  2EX3 A;  3VQA A;  3ZT0 A;  4YFU A;  3NGI A;  1TK8 A;  3DLH A;  3L3V A;  1SL1 A;  4B9S A;  3NF7 A;  4I2P A;  2KZZ A;  4ZHR A;  1IH7 A;  3NFA A;  3KJV A;  2D0B A;  3ZSR A;  2YHB A;  2RPI A;  1R0A A;  3DOK A;  1RTI A;  4FLV A;  4CJQ A;  3HPH A;  2G8I A;  4CJT A;  2X74 A;  3V4I A;  3KKS A;  2BGG A;  2YNG A;  3HST B;  4LH4 A;  4TSX A;  4M42 A;  2QK9 A;  3SQ1 A;  4E7K A;  1CXQ A;  3SNN A;  1DTQ A;  1HYV A;  3NGZ A;  3EZ5 A;  3PY8 A;  4EZ9 A;  1UA0 A;  4C8K A;  3K57 A;  3LAL A;  1S9E A;  1KVB A;  3AA3 A;  4KRF A;  3LPT A;  1C0T A;  3P1G A;  4DF4 A;  2G8F A;  3QIO A;  3K5O A;  1JLF A;  4CJW A;  4PWD A;  1QHT A;  4RG8 A;  3LZJ A;  4KRE A;  4BDZ A;  4OGE A;  3O3G A;  5FDL A;  4QCL A;  1U45 A;  1GOB A;  4E1N A;  1IKX A;  3DRP A;  3OYF A;  3SV3 A;  3HL8 A;  2RKI A;  2YV0 X;  4CJ4 A;  4B9T A;  1YVU A;  4CJL A;  3DRR A;  5SWM A;  2OA8 A;  2ZD1 A;  4B9U A;  4M3R A;  3OYL A;  1KVC A;  3HP6 A;  4ELU A;  4PY5 A;  4RW4 A;  2X6S A;  1Z25 A;  4O0J A;  4FLW A;  2HHQ A;  2OPQ A;  2PZS A;  4J2A A;  5K14 A;  4FJ7 A;  4KB0 A;  3VN5 A;  3MEC A;  3KLI A;  4BDP A;  4RW8 A;  1JXB A;  1ITG A;  4CHY A;  3TAG A;  4RW6 A;  3TAE A;  4M3U A;  1I39 A;  4FJ8 A;  4KI6 A;  4DU4 A;  3PO4 A;  3WNH A;  4DF8 A;  5I42 A;  3V9X A;  4ZTJ A;  4CGI A;  3OYD A;  3CM6 A;  3TAQ A;  3DLK A;  4J2B A;  3VQP A;  4ZTF A;  2OPS A;  5D3G A;  1TK5 A;  3NF9 A;  3MEG A;  3HM9 A;  4DS5 A;  4IFV A;  1C0M A;  2HNZ A;  3ZSZ A;  1RDA A;  4FM2 A;  5J2M A;  1KTQ A;  2EHG A;  1BCM A;  4DMN A;  1JLQ A;  2QKB A;  4FJN A;  4DU1 A;  1NK5 A;  1ZBI A;  4LY7 A;  1UWB A;  1JLC A;  1CLQ A;  1LWE A;  3DLG A;  4DG1 A;  4JLH A;  3O4Q A;  1UA1 A;  3V1O A;  3VQ9 A;  1WNS A;  2QXF A;  4L8R B;  3LP0 A;  2FBT A;  3D0P A;  1J5O A;  4C8O A;  1TK0 A;  3AVB A;  4B08 A;  4JS4 A;  1WSF A;  3T3F A;  4CFD A;  4O55 A;  4DQS A;  4IDK A;  1KFD A;  4FJM A;  4ID1 A;  4BWM A;  1XI1 A;  1YTU A;  4OKJ A;  4GMJ B;  1IKV A;  3LP3 A;  3MEE A;  4Y1C A;  3MXI A;  1RT6 A;  4FLU A;  1U49 A;  5JS1 A;  2OPR A;  3NHG A;  1SL2 A;  1CXU A;  1EXQ A;  3HP9 A;  2ETJ A;  1GOA A;  3TI0 A;  3T1A A;  3AO1 A;  3VQB A;  2R7Y A;  4FJX A;  2VG5 A;  3ZSQ A;  4W5O A;  1X9M A;  3ISN C;  4E3S A;  1KSP A;  3U6F A;  1VSJ A;  5HBM A;  2I5J A;  4KKO A;  1VSD A;  1KLN A;  1U47 A;  1B92 A;  3TAM A;  4R5P A;  3M8R A;  3DLE A;  2Z1J A;  4FLZ A;  3TAP A;  2Z1H A;  2X6N A;  3AVG A;  4F8R A;  3VQQ A;  2FBV A;  1TKX A;  2D5R A;  3OS1 A;  1F21 A;  1D5A A;  1BCO A;  2RN2 A;  3S3O A;  4E7H A;  1WLJ A;  1CZB A;  3SUP A;  4FJI A;  4NCA A;  4BWJ A;  4IFY A;  3QEP A;  2ITG A;  2VG6 A;  1FXX A;  4E7L A;  4C8N A;  1WSH A;  4NCG A;  4DQP A;  1NK4 A;  4FW1 A;  4CJU A;  1BQN A;  3LAK A;  1BI4 A;  5DMR A;  2IS3 A;  3OS2 A;  4HUF A;  4B9N A;  1QE1 A;  3QIN A;  1EET A;  4KV8 A;  3K5L A;  3KLE A;  2O4G A;  1EKE A;  5KGW A;  4DQR A;  4G1Q A;  1BHL A;  1WSJ A;  4CJS A;  4E7I A;  4NYN A;  4M3W A;  4EZ6 A;  2BDP A;  3AVM A;  1S1T A;  1TVR A;  3U3G A;  3WNE A;  1GOC A;  3C94 A;  1UAX A;  4OKE A;  1SKW A;  1RT7 A;  1YT3 A;  4OGC A;  4N5S A;  1O1W A;  1A5X A;  4HHT A;  4BE0 A;  1VRU A;  3EY1 A;  3EYZ A;  4WE1 A;  2HNY A;  1Q8I A;  2HND A;  2G8V A;  3OJU A;  5SZT A;  1NOY A;  3SCX A;  3M8Q A;  4W5R A;  4M41 A;  3DYA A;  1G15 A;  4J2E A;  1TAU A;  3AV9 A;  2D0C A;  2BE2 A;  4F3T A;  4Z0U A;  4OKK A;  4FM1 A;  1RBT A;  1HYZ A;  3QET A;  4I9Q A;  4HCC A;  4LSL A;  4BDY A;  4DFK A;  1S1V A;  3ZSY A;  1EX4 A;  3V6D A;  1RCH A;  4CEO A;  1ASV A;  1I3A A;  1ASU A;  4CJV A;  4CIE A;  3AVL A;  5KRS A;  3O3H A;  4W5Q A;  2ZE2 A;  3SQ2 A;  2PYL A;  4OVL A;  1RT2 A;  1YTA A;  4Y1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...