1VSJA

Asv integrase core domain with cd(ii) cofactors
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects on enzymatic activity.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endonuclease
total genus 50
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vsjA00
1LV5A 4FZZA 1NK0A 1D8YA 2DFHA 5JS1A 3TWHA 1IKYA 3SNNA 4B9MA 3FFIA 1RBSA 3TR8A 3SPYA 4CGJA 4DQRA 4DS5A 1KSPA 3K59A 3SUQA 4F3OA 5FROA 2OPPA 3QESA 2NUBA 5CYQA 3AA2A 3DLBA 1KVBA 1S9GA 1SL2A 4E89A 5EU7A 3C95A 3HXMA 1C6VA 1D9DA 4ZHRA 3ZT2A 4FLUA 2OPSA 3HPHA 5KGXA 4CGFA 2JLEA 2YNHA 1U48A 3VQ5A 3PX6A 5D3GA 2KFZA 3DLRA 4CE9A 3VQQA 1Q8IA 1KLMA 2HB5A 3QINA 3JYTA 4IG0A 3SV4A 4DU4A 2G8VA 3AVFA 1HYZA 4GVMA 1JLAA 3LP3A 4I2QA 3ZCMA 3AV9A 3SUNA 2P5GA 2HNZA 4UQGA 3V9SA 1NJWA 4FLWA 3JSMA 3V81A 4HVJA 2XY7A 4RW6A 3L2VA 4HUFA 2ZD1A 4DTPA 4AHRA 4H8KA 5HBMA 5SWMA 4N47A 3OYDA 4DTRA 3O3HA 4DQIA 4LSLA 3RTVA 3ZSOA 4AILC 3HP9A 4CK1A 1L3UA 1RDAA 1JLCA 1JLQA 4IFVA 3CQ8A 4FLXA 3QIOA 4LD0A 1X9MA 4DQSA 4F4KA 4ID1A 5CY4A 5JS2A 2BANA 3TAEA 3S3OA 4Z0UA 1CXQA 1WAJA 4FJ8A 3LWMA 4FW1A 4DF4A 1FKOA 2OPQA 3LANA 1S1VA 1EXQA 3O4NA 4Z4CA 3NCIA 3V9UA 2OZSA 4C8LA 1HMVA 3HSTB 4IBNA 4BACA 3OS0A 1XC9A 1RTDA 5FDLA 4FJ7A 1ZBFA 2YHAA 4BDZA 4M3RA 1WSJA 4W5OA 3SPZA 1L3VA 3AO1A 2XY8A 4KI4A 4E7HA 3HK2A 1HYSA 4FM2A 2HW3A 4DFKA 1RBTA 1RNHA 4L8RB 4M3TA 4DU3A 1BI4B 5HRRA 1L5UA 1XHXA 2Z1JA 3CG7A 3VQ8A 1BGXT 5HRSA 2QKKA 4IFYA 4CFAA 4HTUA 4KHSA 1L3TA 4CHYA 3ZT4A 3NDKA 4YNQA 3BGRA 3QIPA 4FM0A 4FLYA 3HVRA 4F8RA 1YT3A 4CJEA 5HROA 4DU1A 4CF8A 4E7IA 3TAFA 4DTNA 2X78A 4CFDA 1IKWA 3LAMA 2G8FA 4KI6A 4CF0A 3K5OA 4QAGA 3KIOA 2EHGA 4DSJA 1RDDA 1C1AA 4OKKA 2AJQA 3V9WA 3EZ5A 4HCBA 2E6MA 2IGIA 3C6TA 2DY4A 3QEVA 4CJKA 4M42A 4B9TA 1TL1A 3OYEA 3RR8A 4KKOA 1IKXA 4FJKA 2G8WA 4FZXC 3KKRA 1QS4A 1RTIA 3QO9A 2EX3A 3OYFA 1Q9XA 3AVGA 1S1UA 3DRSA 4O0IA 1TKTA 1RDBA 3CM6A 3MEEA 4KAZA 3LZIA 4FLVA 3QETA 3DLEA 4KFBA 4CFCA 1TGOA 1S9EA 4RW7A 3OS2A 4CHQA 3TANA 1KFDA 2XY6A 1NOYA 4PWDA 4J2DA 4C8OA 3SJJA 5J2MA 2G8HA 3CFOA 4FK0A 3VQAA 4DTJA 4KB0A 1HYVA 1RT6A 4B08A 3I0SA 1EKEA 3OYMA 1IH7A 3ZSRA 3ZSYA 4KV8A 1TKZA 3V1QA 3G0ZA 2GV9A 3KK3A 4M3WA 3P5JA 1LAVA 3K2PA 4DLEA 4DTXA 4NCGA 1TK8A 4J2EA 3LWLA 4M3XA 1D5AA 1QHTA 5HP1A 4FM1A 1A5XA 4AHUA 4TSXA 2HNYA 4E0DA 4PY5A 1KVCA 2HHUA 5SZTA 2E4LA 2HNDA 1NJXA 5E41A 5DMRA 4OJRA 4ZTFA 3MEDA 1RTJA 3ALYA 1RBUA 4CIGA 5C24A 3C94A 1FXXA 1QQCA 4CECA 1N5YA 4DSIA 1ASWA 1XI1A 2RKIA 4H4OA 1VK0A 3I8DA 3T1AA 3DM2A 4CJUA 4AHTA 4KHNA 3TI0A 4FJHA 4ID5A 4CJQA 3IG1A 4FK4A 2RPIA 3NF7A 4DSKA 4BDYA 1SKSA 4KTQA 4FLTA 3ZSQA 2XY5A 3VQ4A 4CEOA 2A1SA 3SQ4A 3CM5A 3AVLA 4ZTJA 1ASUA 1ZBUA 4BE1A 1NK8A 3B6OA 1YVUA 4C8NA 3NGZA 1SL1A 2X74A 4W5NA 4CJSA 3T19A 4CGGA 1U45A 2PZSA 4ELUA 3D0PA 1JLEA 5KRSA 4DSEA 3AO5A 1RT1A 4DTUA 4B9LA 3WNFA 3HYFA 3A2FA 1WSEA 1EP4A 3PUFA 1U4BA 1JXEA 3SI6A 4IDKA 3RMCA 3SCXA 3MXIA 4FK2A 1NJZA 2D0AA 3D45A 4C8MA 1J9AA 4BWJA 5J2NA 2YNIA 2FBXA 3KLHA 3OYCA 4DQQA 4Q0BA 1K6YA 4CK2A 4ELVA 4KHQA 1KLNA 3BDPA 4O0JA 1EX4A 3K58A 2F8SA 4E19A 2DTUA 3HVTA 3V6DA 4GW6A 4CFBA 1KFSA 4B9UA 2BGGA 1FK9A 2GBZA 3OYBA 4JS4A 4JS5A 2X6SA 1QTMA 3NH0A 4FYDA 3LP1A 1BI4A 4FJGA 3MEGA 3IAYA 1WSIA 3IRXA 1BHLA 4BDPA 4DWIA 4OLAA 4K8XA 3DI6A 1VSFA 3SUOA 1VRUA 1RDCA 4RG8A 3VQEA 3RWUA 2KZZA 1Z26A 3NHGA 3LDSA 4RW4A 3LALA 1ZBLA 4Z4FA 2KZMA 2KQ2A 3HP6A 2YNFA 4DMNA 3KD5E 3DMJA 3L8BA 4IG3A 4CGDA 2A1RA 4ICLA 3S3MA 4IKFA 2YKNA 3OYHA 4EZ6A 4KB1A 4FJNA 1I3AA 1CZ9A 1WN7A 3ITHA 1VRTA 3AVIA 2LSNA 4O5BA 3KLIA 4AH9A 4F3TA 3SQ0A 1TAQA 4CHNA 3K5LA 1VSHA 3ULDA 4CHZA 1J5OA 3NAEA 4K8ZA 2IC3A 4OKJA 4DTMA 3VQDA 1RBVA 2DFFA 1S1WA 3DYAA 4FW2A 5CZ2A 2WOMA 4M3UA 1G15A 2D0CA 4CEEA 3O4QA 3TAMA 4I9LA 3KLGA 3LAKA 3PV8A 1SKRA 1QE1A 1TK5A 4FJLA 4PQUA 5DK5A 4F2SA 1C1CA 1FKPA 1WNSA 4KO0A 4CJWA 4BE0A 1RT4A 1L3SA 3IS9A 4HCCA 3DRRA 1XWLA 1CXUA 4Y1DA 3OYIA 4DTSA 3QNNA 1SKWA 4NCAA 4R5PA 1SV5A 4DS4A 3V4IA 2OYQA 3L3UA 1WAFA 1BIZA 1NK6A 3AVJA 4KRFA 4JRPA 1NKEA 1C1BA 4LH4A 3LPTA 4OKEA 4ELTA 1DTQA 3OYLA 2KFNA 2D5RA 4KHWA 1C0MA 5CYMA 2VWJA 4I2PA 4Y1CA 4I7FA 1U49A 3RRGA 1T05A 3OJUA 3LPUA 4FJMA 2YHBA 2KW4A 4CJRA 1A5WA 1B92A 3DOKA 1GOBA 3CFPA 4Z4EA 1LW2A 1HNVA 3OJSA 3WNEA 3VA0A 4HUGA 3M8SA 2VG5A 4FLZA 3AA5X 4C8KA 3SUPA 2XO7A 4MQ3A 1Q9YA 1DTTA 3AA3A 3V1RA 3SV3A 3V9XA 4FZYA 4I9QA 3ASMA 3HL8A 3ZT0A 3OYNA 1YTAA 4CJ5A 1QSSA 4Z4GA 4E1NA 3HPGA 5C25A 4CCHA 2FC0A 1RCHA 4HUEA 3HO1A 3U3GA 3L2RA 1WSHA 1UOCA 4B9VA 2R7YA 4CEAA 2BE2A 4CF2A 1HPZA 5C42A 5CZ1A 4CERA 1VSMA 2RF2A 4DQPA 4CGHA 1TVRA 2RN2A 3TAQA 3OYJA 2ZE2A 3AO3A 4E7KA 4LSNA 3SQ1A 3EYZA 5J2QA 1UA0A 3ZSWA 3KKSA 2KTQA 4O4GA 4EZ9A 1VSLA 3ZT3A 3OVNA 1UWBA 4E7JA 1NK7A 1X9SA 3ZSZA 1TKDA 1C0UA 5FRMA 2HHSA 2Y1IA 1J54A 2I5JA 4CF1A 4DLGA 4DFJA 4B3OA 3TAGA 4W5TA 3NFAA 1U47A 3AA4A 4FJXA 4CESA 3V9ZA 2G8UA 2VWKA 3HJFA 3RR7A 1W9HA 2QXFA 1VSIA 4LH5A 4CGIA 1NOZA 3PO4A 2OZMA 1IKVA 1MU2A 4KTWA 3QEXA 3ZSXA 2HHWA 2W42A 2FBYA 1YTUA 1ITGA 2ATQA 4OLBA 3TARA 1CLQA 1KRPA 3OYKA 4RW9A 4WE1A 3P83D 3RMDA 2F96A 3AVMA 3T3FA 1TKXA 1KTQA 3RMAA 3VQ6A 3PO5A 2QKBA 1KCFA 4CEQA 1RT7A 2OPRA 1RT5A 3P1GA 3DLGA 4AHCA 1NJYA 1UA1A 5HRPA 3ZT1A 5KI6A 3DLKA 3OY9A 3LP0A 4CIFA 3OYGA 4DFMA 3THVA 3CFRA 1XHZA 3UIQA 1WSGA 3I0RA 1WSFA 4CEBA 2XRIA 3O3GA 3KK2A 2B6AA 4M3ZA 2HHVA 2HHQA 3K5MA 3PX4A 2WONA 1EETA 3MXJA 3NF9A 3SZ2A 1S6PA 3U6FA 3RMBA 1N6QA 4MFBA 4DFPA 3WNHA 1C0TA 1TL3A 2Z1GA 4CF9A 3L3VA 1CZBA 4E1MA 2PYJA 4OVLA 3K57A 1QSYA 2JGUA 4KREA 4O44A 3VQ7A 1UAXA 4DG1A 3NH2A 3M8PA 3OYAA 3AO4A 4FJIA 5HRNA 3L2UA 3LZJA 1LWCA 1JLFA 3HPOA 1VSDA 5J1EA 5KTQA 4CIEA 3AVHA 3CYMA 5FRNA 2HHTA 4B8CA 1BL3A 1JL2A 3U3YA 4CK3A 3K5NA 2PY5A 1LWEA 2ETJA 1R0AA 1JLBA 3F9KA 3VQ9A 1ZYQA 2OA8A 2G8KA 1LWFA 4AHVA 3QEWA 4CJ4A 1NKCA 1O1WA 1S5JA 1WLJA 4JLHA 3QEIA 4NYFA 4KHUA 3MXMA 3PY8A 3KK1A 4CJ3A 3AVBA 5I3UA 2E6LA 1JL1A 1REVA 1VSJA 2IAJA 4W5QA 3M8RA 3EY1A 3DOLA 4GMJB 4CEZA 1X9WA 2PYLA 4PUOA 2X6NA 3S3NA 4CJVA 2IOCA 4F2RA 3G10A 3QLHA 3ISNC 1Z25A 2YKMA 3VN5A 1BCOA 2BDPA 3MECA 4AHSA 1BCMA 3SYZA 3ZSVA 3O3FA 4Z4IA 2B4JA 2O4GA 3LP2A 3KJVA 4FCYA 2O4IA 4RW8A 1ZBIA 4M41A 3VQCA 2P51A 3E01A 3NH1A 3F73A 3V1OA 1NKBA 4JRQA 3NBPA 2ZQBA 3KLEA 5HLFA 1BQMA 2YV0X 4NYNA 3L2QA 4DSLA 4B8AB 1RBRA 1JLGA 1Y97A 3PX0A 3DLHA 3NGIA 1GOAA 3HT3A 1NK9A 3TABA 5K14A 2XHBA 3NF8A 3AVAA 1HNIA 4KTZA 1S6QA 4J2BA 4N56A 1TV6A 3OS1A 3NF6A 1VSKA 4HHTA 3SQ2A 4EP4A 1I39A 4FJJA 5KGWA 3QERA 1IO2A 4BWMA 2B5JA 3C6UA 1VSEA 1JXBA 3AVNA 1RILA 1QSLA 4QOZB 4LY7A 4Z4HA 4N76A 3M8QA 4O55A 2IDOA 2QK9A 1BIUA 1A5VA 4KPYA 1IG9A 4DTOA 1T03A 4CJPA 1HJRA 3WNGA 2IS3A 4XIUA 1F21A 1BQNA 1SL0A 4DF8A 3NGYA 4H4MA 1RT3A 1U04A 4DSFA 2YNGA 4G1QA 3NE6A 1JKHA 2P1JA 3QNOA 4J2AA 4M3YA 1X1PA 2Z1HA 2F8TA 4NCBA 1B9FA 2G8IA 4FXDA 4QCLA 1ZBHA 1S1TA 2DFEA 5T7BA 1B9DA 2VG7A 3TAPA 4M45A 1J53A 2Y1JA 2P5OA 4FJ5A 4OPKA 1T8EA 4CEFA 1BISA 4CJLA 3VQPA 3DRPA 4CHPA 1GOCA 4EP5A 4PA1A 5I42A 4E7LA 4Q5VA 3KTQA 2HVIA 4W5RA 2FBTA 2VG6A 3AVKA 4CHOA 4B9SA 4FJ9A 3QEPA 1T7PA 4FVMA 3HM9A 4N41A 1SUQA 1W0HA 1DLOA 3KD1E 1TAUA 2Q3SA 5J2PA 1KVAA 3MAQA 2FBVA 2Z1IA 4KHYA 2GUIA 1D9FA 1RTHA 1RT2A 4E3SA 5KRTA 1LAWA 2ITGA 1NK4A 3AO2A 4B9NA 2D0BA 1LW0A 1HQUA 3KLFA 4N5SA 2HVHA 2HHXA 3RRHA 4OPJA 3H08A 4CEDA 4BE2A 3S9HA 3VQBA 1HRHA 1TK0A 1ASVA 4CJTA 2HMIA 3L2WA 1NK5A 1S1XA 3AVCA 1HQEA 4OGEA 3B6PA 4YFUA 4CJFA 4OGCA 3VA3A
chains in the Genus database with same CATH superfamily
1LV5A 1IKYA 1XMOK 5JVGL 3G6EN 3SPYA 4KH6A 3U8XA 2OPPA 4I6MB 3SAHA 3QESA 3DLBA 1KVBA 1S9GA 2VYPA 1SL2A 2HHHK 5EU7A 1W97L 3A5MC 4ZHRA 2YNHA 1NGFA 1RFQA 4R79A 5EX5A 4CE9A 3VQQA 2HB5A 2G8VA 3QINA 4IG0A 3SV4A 3AVFA 4WF9L 5M1KA 1HYZA 4I2QA 3TSUA 4CI6A 3AGRA 1NK6A 3C6HA 4RW6A 5CE3A 3L2VA 2ZD1A 5SWMA 4N47A 2UU9K 3O9UA 1M90O 3QDKA 4EAHD 3ID8A 5F2RA 4AILC 3HP9A 1TUYA 1JLQA 4FLXA 4LD0A 5JS2A 3MCPA 4DQ8A 2BANA 4CZMA 4PHTX 3EKUA 2V52B 4CZEA 4FOEA 4FW1A 2OZSA 1S1VA 4Z4CA 4BRQA 3NCIA 2A3ZA 3IUCA 1HMVA 4IBNA 3JS6A 4DV7K 2AA4A 4FJ7A 1ZBFA 1WSJA 4JD2B 3SPZA 3AO1A 4E7HA 2HW3A 4FM2A 2F9WA 4DFKA 1RBTA 4L8RB 4DU3A 1BI4B 5HRRA 1Z05A 3C6AA 4HTUA 5BR9A 4CHYA 4FWLA 1VQ4N 4F8RA 1YT3A 3VMFB 4E7IA 4DU1A 4CFDA 3LAMA 2P9NA 4KI6A 3V9WA 2P9SA 3WXLA 3C6TA 1T6CA 3D2FB 4B9TA 3J7ZO 3CJ7A 4H03B 3O1BA 4KKOA 4FJKA 2F7TA 4FOIA 3C7NA 3AVGA 4DB3A 2OTLN 1IV0A 3CM6A 1TGOA 1S9EA 4JEPA 1KFDA 1NOYA 2QWRA 3VPZA 3N4PA 4C8OA 5J2MA 2P9KA 2YHYA 4FK0A 1DGKN 3VEWA 3F9MA 1HKGA 1IH7A 4AF1A 4M3WA 1LAVA 4DLEA 1TK8A 1QHTA 5HP1A 1TYQB 1GLLO 5EOYA 3QFPA 4F9OA 4JI0K 4PY5A 4JKFA 1KVCA 2NRTA 5SZTA 2E4LA 4C1NI 4ZTFA 2OCEA 1WBBA 3ALYA 5BN8A 3VEYA 4C23A 4CECA 4CJUA 2CGJA 4KHNA 3TI0A 4FJHA 4FK4A 5AQUA 3NF7A 4BDYA 4KTQA 4FLTA 4CZGA 5FPEA 3SBGA 3NGZA 1N8RO 4CGGA 1U45A 3JAMO 1E3MA 4DR1K 1SZ2A 3PUFA 2E5LK 3TSPA 3THWB 4C8MA 3SLCA 4WFNL 1K6YA 4ELVA 1OH8A 1E4GT 4E1JA 3E9OA 4X62K 3V6DA 4GV3A 3D2EB 1KFSA 3GOIA 1FW6A 1BI4A 1WUAA 3IRXA 4BDPA 4OLAA 3THYB 1VSFA 3SUOA 1VRUA 1RDCA 3RWUA 3VQEA 3EE9A 2KZMA 4RW4A 4LF5K 3WXKA 5C2FA 3KD5E 3L8BA 1C0GA 3HTVA 2YKNA 4KB1A 1I3AA 4F3TA 3D2FA 4CHZA 1K8AO 4OKJA 2CH6A 4DHYA 1S1WA 1Q82O 5BR8K 1NGGA 3KLGA 4I9LA 3LAKA 3PV8A 1QE1A 4MO4A 4B1VA 3LDOA 4F2SA 2UUCK 5JMVA 3HI0A 4BE0A 5KPRA 4FZZA 1XWLA 4MDAA 4BC3A 1WAFA 2OTJN 3J7AP 3OYLA 2D5RA 1C0MA 3M6GA 4XEIA 1U49A 3RRGA 3OJUA 1XC3A 3LPUA 1B92A 4JKGB 3OJSA 5CR4A 2A6AA 3M8SA 4NXMK 3PSIA 3WQTA 3SUPA 1DTTA 4BRGA 3ASMA 5AQMA 3ZT0A 3OYNA 5B8HA 4Z4GA 2J4RA 4E1NA 3CERA 4DKWA 1V4TA 4CCHA 4HUEA 1K8KB 4CEAA 3CI5A 2RF2A 2E2NA 1O13A 1R59O 4CGHA 2QEXN 4JN4A 2QM1A 1NGCA 5J2QA 3ZSWA 3KKSA 1W7AA 2KTQA 1VSLA 1X9SA 3ZSZA 2HHSA 2I5JA 4W5TA 1U47A 4OPHA 4FJXA 2G8UA 2VWKA 3HJFA 4FWKA 2QXFA 4ILGB 2IIRA 4CGIA 1NOZA 1IKVA 2UXBK 1YTUA 3D2EA 3R1XA 1ITGA 3TU5A 1NGHA 2O8EA 5AQRA 4YOXA 3KZBA 1KTQA 3BF3A 2ZJPL 4FWRA 4GNIA 3P1GA 3DLGA 2RHKA 4CBUA 2F4VK 1Q7YO 5KI6A 1SQKA 3OY9A 3ATUA 4FWPA 4O8KA 3THVA 1XHZA 1T44A 1WSFA 3O3GA 2HHVA 4IEEA 2HHQA 2QA4N 1EETA 3U6FA 1S6PA 2HBKA 3NMUA 3WNHA 2QTDA 3LM9A 2Z1GA 2GX9A 4CF9A 1CZBA 2PYJA 3K57A 1V4SA 4XH4A 1QSYA 4KREA 2E1ZA 1UAXA 4DG1A 4DV4K 4A59A 3AO4A 1E4FT 3TTDA 4LF8K 1X9JA 1LWCA 4CBXA 3HPOA 1GLDG 1VSDA 3FR0A 4B9QA 4BRKA 4CIEA 3CYMA 5FRNA 4B8CA 1YJNN 1JL2A 3T1HK 3H46O 4BRFA 4CK3A 2PY5A 2E1YA 1NGIA 1ZYQA 2HF4A 3TTCA 1LWFA 1NGEA 2BH1A 1S5JA 3QEIA 2ITMA 5AR0A 2CGLA 3MXMA 3KK1A 5IT9O 4H0TB 2E6LA 1JL1A 2NRWA 4W5QA 3NVKA 2PYLA 4GMJB 4CEZA 3MN7A 2IOCA 3ISNC 4Z94A 3R9PA 2BTFA 4JKGA 3OBYA 4QS7A 2O4GA 4M41A 3ULEB 2P51A 3VQCA 2ZQBA 3KLEA 5HLFA 1BQMA 3C0BA 3L2QA 4DSLA 5C10A 3HT3A 1DT9A 1NK9A 3TABA 3NF6A 4IOAL 1I39A 1IO2A 2B5JA 1X3MA 1JXBA 1MWKA 1T03A 1C0FA 1OH6A 5M1FA 1SL0A 2VGMA 4DF8A 4BVOA 5KPTA 4DSFA 4G1QA 3KWIA 3QNOA 3ATVA 3HM8A 2F8TA 1BU6O 2Q31A 3SJHA 3CJAA 1JCFA 2DFEA 3O1WA 3G25A 2VG7A 2ZGYA 1J53A 2P5OA 1FJGK 4CEFA 5ELZA 4A57A 3DRPA 2HVIA 4JI8K 2E2OA 4CHOA 4FJ9A 3QEPA 3HM9A 1DLOA 3IKMA 4BR9A 5J2PA 1KQSM 4IWVA 4K41A 3PLAA 4E3SA 5KRTA 2O8DB 5ADXH 1HNWK 2D0BA 2NRXA 2HHXA 2HVHA 5ADXA 3ZETB 3H08A 3RSEB 3VQBA 1ASVA 4JI2K 3L2WA 4ISFA 3AVCA 2P9IB 1OVQA 3ZX3A 4OGCA 1NK0A 3R8EA 1D8YA 5JS1A 3VTIA 2AP1A 1N34K 3FFIA 1RBSA 1OVYA 3THXA 5FPDA 2NUBA 5CYQA 5LMUK 3HXMA 3ZT2A 2JLEA 1QVGM 1U48A 4IFEA 2KFZA 1KLMA 1W2BM 1IJJA 4PL8A 1JLAA 3ULEA 3ZCMA 3SK3A 3AV9A 2P5GA 2HNZA 4UQGA 3V9SA 1NJWA 3JSMA 3V81A 2NNWA 4HVJA 3EZWA 2XY7A 4HUFA 4AHRA 4H8KA 5HBMA 4DTRA 3MN5A 5CHIA 5AQVA 3LDPA 4LSLA 2ZGZA 3SAFA 2Q0UA 4WCEL 4ILHA 1JLCA 4IFVA 3U9DA 4F4KA 4JKDA 5AQLA 1WB9A 1EQYA 3EO3A 1G99A 4FJ8A 3PIOL 4DF4A 5EY4A 1FKOA 1EXQA 3O4NA 4CZKA 5GIOA 3J8AA 3QMLA 4GKJK 5FDLA 2YHAA 3O9SA 4M3RA 1S22A 1TUUA 1RNHA 4M3TA 1VQNN 1BG3A 1XHXA 1BGXT 5HRSA 2QKKA 4CFAA 4KHSA 1L3TA 2ZJQL 3BGRA 3FZHA 3HVRA 5HROA 3TAFA 1XNQK 1KXPA 2X78A 4DTNA 1IKWA 3K5OA 2EHGA 1RDDA 1C1AA 3EZ5A 2E6MA 2O8CB 3UKRB 4M42A 3OYEA 4B3TK 3VOVA 3RR8A 1N32K 1IKXA 3KKRA 1QS4A 4AQYK 3I55N 5GAHP 1Q9XA 3GBTA 2O8DA 3D6RA 5GAGP 3DRSA 4O0IA 1TKTA 2FSNA 3B8AX 4BR0A 4FLVA 3QETA 4GV9A 4KFBA 4CFCA 3N4QA 3BEXA 2QW9A 4PWDA 1ILYA 2P9SB 1HYVA 5BPLA 3I0SA 1ATNA 4YOYA 3OYMA 2HF3A 1NMNA 4FWMA 3ZSYA 3VF2A 1EWQA 1TKZA 1YAGA 4CW7B 3C7NB 4ISEA 4TSXA 2UUBK 4YOWA 3QBXA 1M1KO 5BRHA 3FZMA 2HNDA 5DMRA 4OJRA 3SMPA 3MEDA 5AQSA 3C94A 4BGBA 1FXXA 1QQCA 1ASWA 1XI1A 1ZXOA 2ASOA 1HNXK 2HSTA 4IXCA 1NLVA 1T6DA 2RPIA 3DWLA 4DSKA 1SKSA 2DPNA 4K42A 2HBLA 1NGDA 3H1VX 3MX2A 2A1SA 3CM5A 1VQ6N 3L4QA 3A0IX 4ZTJA 1ASUA 1VQ9N 3K9JA 4C8NA 3QICA 4JKHA 2E2QA 4CJSA 4U7BA 4ELUA 3CCVN 1EO1A 4B9LA 3WNFA 3SI6A 4IDKA 3MXIA 3SCXA 1VQ8N 3D45A 1J9AA 3CCRN 3KLHA 4DQQA 1KLNA 3KHYA 1YXQA 3BDPA 3K58A 2KHOA 1VQON 4JS5A 4FYDA 1LOTB 1WSIA 4DWIA 1BHLA 4K8XA 3DI6A 4RG8A 1YJWN 3LDSA 4Z4FA 3LALA 3KVGA 2KQ2A 4DMNA 2YX6A 2A1RA 4ICLA 4IKFA 4DV6K 1VRTA 2O8CA 3LM2A 2UXCK 4ISGA 3UKRA 2IC3A 1U6ZA 2DFFA 3DYAA 5CZ2A 5GIPA 5C0YA 2JWLA 4CEEA 3AY9A 4M7YA 4PQUA 1HPMA 3CETA 4KO0A 4CJWA 4X64K 1X3NA 4HCCA 4Y1DA 4DTSA 1YIJN 4NCAA 4DS4A 3V4IA 2QWQA 4OKEA 2GELA 2HMPA 5HOOA 2IVPA 2VWJA 4FJMA 4K0KK 2YHBA 2KW4A 1A5WA 2O8FB 3DOKA 4Z4EA 3TPQA 1HNVA 4JI7K 4C8KA 2XO7A 1Q9YA 4H5VA 3V1RA 3Q7BA 3HL8A 1N33K 3HPGA 5C25A 3HBTA 1WSHA 2O8BB 1BOTO 2BE2A 4YDUC 1HPZA 4DQPA 2ZJRL 4YDUA 2RN2A 3P38A 4LSNA 2YHXA 3OVNA 4E7JA 4GV6A 4IJNA 3QBWA 4DLGA 3L0QA 1RDUA 3TAGA 3NFAA 3AA4A 4DUZK 1W9HA 3BF1A 2D4WA 4LH5A 2RE2A 2HHWA 2FBYA 4RCHA 3KWGA 1QQNA 4OLBA 1GLEG 1KRPA 3OYKA 4RW9A 4WE1A 3RMDA 3A5NC 2D0PA 3AVMA 3RMAA 2P9UB 1NGJA 5HRPA 1K73O 4BRIA 3U4LA 3OYGA 3SMSA 3CFRA 4H0YB 1WSGA 2PFUA 4X66K 4M3ZA 2XRIA 2B6AA 2W6LA 3K5MA 3PX4A 1GLBG 3CCLN 2Q36A 4MFBA 4E1MA 4OVLA 2O8EB 5DM6L 3VQ7A 2VQFK 4FO0A 4HWIA 3ZX2A 3MWTA 5J1EA 3I8BA 4BG9A 3VERA 3OTOK 1R0AA 4WFAL 3F9KA 4FWNA 4DCHA 3ZEUA 4CJ4A 4IOCL 1NKCA 1O1WA 4K25A 4J8FA 4KHUA 4CJ3A 3P39A 1REVA 1VSJA 4O5FA 1QZ6A 4PUOA 3CHWA 2O8FA 3BP8A 2WTUA 2BDPA 4AHSA 3BZCA 3O3FA 2B4JA 1ZBIA 3F73A 3WXJA 3NH1A 2FLOA 2YV0X 1GOAA 5K14A 1HNIA 2O8BA 4KTZA 3UB5A 4N56A 2P9LB 1VSKA 5KGWA 1HKBA 1GLFO 3PIPL 4BWMA 1VSEA 1QSLA 2YJEA 2JWKA 4QOZB 4LY7A 3EEQA 4DR7K 2IDOA 1A5VA 1IG9A 4MO5A 3KK7A 3D7EO 4DTOA 4CJPA 4BRAA 2IS3A 4XIUA 5GINA 2YNGA 3NE6A 4IJAA 2P1JA 1XUPO 3EKSA 4L3QA 4UY8O 2G8IA 5LJVA 1S1TA 3T7ZA 5E26A 2P9UA 5BREA 3W0LA 5I42A 4E7LA 3DXKA 2VG6A 4YOVA 3CMAN 2BUPA 5AZIB 5TKYA 4FVMA 4N41A 1SUQA 1W0HA 2FSKA 1EWRA 4LF4K 1RTHA 2VGNA 4WYBA 3J7YP 2ITGA 4JK8A 4B9NA 1LW0A 1HQUA 1Y64A 4OPJA 4CEDA 1TK0A 2HMIA 1HRHA 2FXUA 4CJTA 1BA1A 1NK5A 3MMVA 1S1XA 1HQEA 3LDNA 2GWKA 4JK9A 4JKEA 2DFHA 5AQGA 3DLLL 4DUYK 3SNNA 4NB4A 4LFBK 4BVPA 4DS5A 2YI1A 3VENA 3FZLA 3VGMA 3AA2A 4BQZA 4LFAK 4E89A 3AAQA 3RVCA 1C6VA 1K9MO 2OPSA 5KGXA 4QS8A 4CGFA 2QWMA 4NLBA 5D3GA 1Q8IA 4DU4A 1IBLK 4GVMA 4JI5K 3SUNA 3F5TA 4FLWA 4DTPA 2ZF5O 3EE8A 3THXB 3O3HA 1Q86O 4DQIA 3RTVA 3VETA 2P9LA 2A5XA 1L3UA 1RDAA 1VQ5N 4H5TA 4HTLA 3TAEA 1QQOA 3S3OA 1CXQA 1HLUA 3V9UA 4C8LA 5AQFA 3OS0A 1XC9A 1RTDA 3DJCA 1L3VA 4BDZA 4BRMA 1QQMA 3LL3A 4BR7A 3FLCO 3VEVA 3CCSN 4LF7K 2Z1JA 5AQTA 2Q1NA 4IFYA 3L4IA 3ZT4A 3NDKA 4YNQA 3QIPA 4FM0A 4FLYA 4CJEA 1NK4A 4XH1A 1NM1A 3T69A 5BPMA 4DSJA 1NMDA 3KIOA 4OKKA 4WFBL 2IGIA 5AZIA 5JLFA 1HUXA 2DY4A 4RTFD 3WXMB 4CJKA 2WC9A 2ZWHA 5TKWA 4CZJA 4FZXC 1RTIA 2EX3A 1D4XA 3ZYYX 1RDBA 3MEEA 3H6EA 3CCUN 3TANA 4RW7A 3OS2A 4A61A 2ASMA 4QS9A 2XY6A 3BZKA 4J2DA 5JVHL 3SJJA 3CFOA 4KH4A 3VF6A 4DTJA 3E9LA 4AM6A 4RWTA 4H0VB 4JNEA 1EKEA 3ZSRA 4KV8A 3J80O 3QB0A 3G0ZA 3V1QA 3ENHA 2GV9A 3KK3A 2VQEK 4X65K 3K2PA 4DTXA 4J2EA 2GUPA 3LWLA 3GG4A 2QWPA 1A5XA 1BO5O 4A2AA 4AM7A 2E88A 5C12A 2CGKA 3IFRA 1RTJA 1NG9A 5C24A 4OO1J 1N5YA 4DSIA 2RKIA 4H4OA 4MLHA 3H1QA 3T1AA 4AHTA 4ID5A 2ZM6K 4Y0WA 4CBWA 3CPEA 2W41A 3BY5A 4H5RA 3AVLA 1ZBUA 4BE1A 1NK8A 3B6OA 4JYAK 3T19A 5BPNA 2QWOA 5E84A 3HYFA 1WSEA 1EP4A 5J2NA 2A41A 4BWJA 4Q0BA 4CK2A 4KHQA 4O0JA 1VQKN 1EX4A 5AFUA 3CCJN 2DTUA 2A40A 4GW6A 4FPAA 4B9UA 3CJ1A 1FK9A 4JI1K 3OYBA 4JS4A 1Q81O 3CC7N 2P9PB 3HOTA 2X6SA 1JCEA 4DV5K 3IAYA 3K0SA 3HSCA 4IOXA 2V7YA 4DR6K 4DV0K 2KZZA 1Z26A 3H3OB 4FL9A 5F0XA 1ESVA 1ATSA 3DMJA 4IG3A 4CGDA 1GLJO 2W6KA 3OYHA 4IO8A 1NWKA 3ITHA 4O5BA 3AVIA 2Q2RA 4H5NA 3KLIA 4ILJA 1U2VA 1VSHA 3ULDA 1J5OA 2E8AA 1BWFO 2GWJA 3VQDA 1RBVA 1KC8O 1OH7A 3F2KA 3E66A 4LF9K 4M3UA 3LDLA 1G15A 2D0CA 1ATRA 4YHHK 1QVFM 4H5WA 3NVMA 1SKRA 4BRCA 4BC2A 3GL1A 4U67L 3OBWA 1P90A 1NGAA 3DRRA 3R6MA 3TTFA 1SV5A 4YOTA 1BIZA 3AVJA 1VQMN 2GEMA 4JRPA 4FWOA 1C1BA 4ELTA 5CYMA 4I2PA 4KBOA 4Y1CA 4I7FA 5GAEP 2NRHA 5C15A 4CJRA 4JHDA 1GOBA 1LW2A 1IG8A 3WNEA 4DR2K 4HUGA 3I33A 1GLCG 3MK6A 2V51B 4A5AA 4FZYA 4I9QA 3EN9A 1YTAA 4CJ5A 1QSSA 2FC0A 5HL7L 3L2RA 1YITN 4B9VA 1VQPN 4FPBA 1RGIA 2R7YA 4NO7A 3OA9A 4CF2A 5CZ1A 4CERA 1VSMA 1GLAG 1TVRA 1YVNA 1VHXA 2ZE2A 3OYJA 3ENBA 3EYZA 1UA0A 4EZ9A 3ZT3A 1NK7A 1UWBA 1TKDA 2Y1IA 3AGKA 5AQOA 3CJCA 5AQWA 4EHUA 4BG8A 3CC2N 4JI4K 3V9ZA 5AQKA 1SAZA 1VSIA 2OZMA 1MU2A 3FZFA 4BROA 2CH5A 3ZSXA 2W42A 3FGUA 4JI6K 2P9PA 5AQHA 1CLQA 1I94K 3P83D 1TKXA 2QKBA 3UKUA 1KCFA 4CEQA 5LMNK 2OPRA 1RT5A 1QHAA 1UA1A 3ZT1A 2I7PA 3DLKA 4CIFA 5EXWA 4CEBA 1MWMA 3KK2A 4KHPK 3G71N 3NF9A 3SZ2A 5AZJA 1N6QA 1C0TA 5M1QA 3SAGA 2WBNA 1XNRK 2JGUA 4O44A 3OYAA 4FJIA 3CJ9A 5HRNA 4EHTA 3LZJA 3Q7CA 4PKGA 1JLFA 4A5BA 1KD1O 1BUPA 2HHTA 3P4IA 3U3YA 5AQIA 2HBJA 3UE5A 4IZ9A 1LWEA 2ETJA 1JLBA 2G8KA 1N36K 4AHVA 4JLHA 4BR5A 4NYFA 2Q0RA 5I3UA 3O9QA 4B1ZA 2IAJA 5M1NA 3M8RA 4LF6K 1YI2N 4BRNA 3S3NA 3G10A 3ZX0A 1Z25A 1BCMA 3ZSVA 2OANA 4Z4IA 1LCUA 3KJVA 1YUWA 1VAZA 3V1OA 1NKBA 3NBPA 1NGBA 4B3MK 1Y97A 3ZEUB 3DLHA 3CF5L 3NF8A 4BREA 4J2BA 3DXMB 4H0XB 2WFBA 3OS1A 3SQ2A 3VTHA 4EP4A 4FJJA 3QERA 4GKKK 4K43A 3C6UA 3AVNA 1BIUA 3WEEB 1HJRA 3WNGA 5MLCQ 4DV2K 1F21A 4H4MA 1RT3A 1U04A 2QI2A 3VGLA 3WQUA 4PL7A 4J2AA 4M3YA 4BC5A 4OPAA 1X1PA 4BRLA 3O08A 4NCBA 4JV5K 1B9FA 4FXDA 4QCLA 3VESA 5T7BA 4IEIA 2KKZA 4OX9K 4FJ5A 1T3VA 1NBWA 5FPNA 4EP5A 3FE1A 4CHPA 4PA1A 4BQLA 5H1SQ 4Q5VA 3O80A 3KTQA 4FWQA 3VEZA 3AVKA 1JCGA 2UXDK 2A42A 2I7NA 3WUHA 1T7PA 5KPZA 3KD1E 5FPMA 4NXNK 1TAUA 4CZIA 4C1NK 4MLEA 1KVAA 3MAQA 2FBVA 4I6MA 4KHYA 1LAWA 3K9KA 3KLFA 4N5SA 3CJBA 2H3GX 5I9EB 1S72N 4B3SK 3DXKB 3B6PA 4YFUA 4CJFA 2IVNA 3HOSA 3TWHA 3L6QA 3ZLJA 4B9MA 3P31A 2YHWA 3TR8A 4CGJA 4DQRA 1KSPA 4WQ4C 3K59A 3SUQA 4F3OA 5FROA 4WQ4A 4EFHA 1YJ9N 3C95A 4JI3K 3AAPA 1D9DA 2FF6A 4FLUA 3HPHA 5GADP 1ZC6A 2WUSA 5JLHA 4GVEA 4DR3K 3VQ5A 3PX6A 3DLRA 3JYTA 5AQJA 1SS6A 4KH5A 3LP3A 4JD2A 3OYDA 5EVZA 5FLXO 1WOQA 4JKCA 4CZLA 3ZSOA 3DXMA 5IWAK 4CK1A 1MA9B 2VCPA 1JJ2M 3CQ8A 3QIOA 1X9MA 2UUAK 4DQSA 2NLXA 4ID1A 5CY4A 1HR0K 3QFUA 3I56N 4Z0UA 1WAJA 3LWMA 3O9TA 2OPQA 3LANA 3WEEA 3IMXA 3HSTB 3WXIA 4BACA 3IDHA 3CQXA 4KI4A 4W5OA 2XY8A 3HK2A 1HYSA 1S3XA 4CZFA 1L5UA 2HOEA 3CG7A 3VQ8A 4B1WB 4A2BA 4CF8A 2G8FA 5F1XA 4CF0A 4QAGA 1YHQN 2D0OA 2AJQA 3CIPA 4HCBA 3H45C 4BR4A 3QEVA 3T1YK 3CCQN 2V7ZA 1TL1A 2PAVA 1ZBSA 2G8WA 3QO9A 3OYFA 1KAZA 1TYQA 1S1UA 4KAZA 3LZIA 3DLEA 2QWLA 4CHQA 2G8HA 3VQAA 4KB0A 3VEOA 1RT6A 4B08A 4DV1K 2E2PA 5AQXA 3BUZB 1NU0A 3CPWM 3P5JA 4NCGA 5AQYA 4M3XA 1D5AA 5AJ3K 4FM1A 4BGAA 4AHUA 2HNYA 4EIAA 3ENOA 4E0DA 4YOUA 2HHUA 1NJXA 5E41A 1J6ZA 1RBUA 4CIGA 2Q97A 3THWA 3SBTA 1VQ7N 1VK0A 4DR5K 3I8DA 3DM2A 4LFCK 4CJQA 3IG1A 3ZSQA 2XY5A 3VQ4A 4CEOA 4JKBA 3SQ4A 3O5BA 4DR4K 1SL1A 1YVUA 1IBKK 2X74A 2PBDA 4W5NA 2PZSA 3A5LC 3D0PA 3MN6A 1JLEA 5KRSA 4DSEA 3AO5A 1RT1A 3THYA 4BRPA 4DTUA 3A2FA 4LC9B 1U4BA 2NZTA 1JXEA 4FK2A 3RMCA 1NJZA 2D0AA 2YNIA 2FBXA 2GTDA 3OYCA 3GE1A 5AQNA 2F8SA 4E19A 3HVTA 3O9RA 4CFBA 3O4WA 2BGGA 1H1VA 2GBZA 3J81O 2W40A 1QTMA 3NH0A 2UYTA 3LP1A 1HX1A 4FJGA 3MEGA 3CD6N 4FVUA 5M1OA 5KQ8A 4H0PA 3CCEN 3NHGA 3A8YA 1ZBLA 4O8UA 4B1UB 3M5RA 3HP6A 4YORA 3O8MA 2YNFA 4M7XA 2F9TA 2QXLA 3S3MA 4EZ6A 3GDQA 5LL6Z 1OKJA 3EL2A 1CZ9A 1WN7A 4FJNA 2LSNA 4AH9A 3SQ0A 1TAQA 4BC4A 4CHNA 3K5LA 3VF4A 3E1YA 3NAEA 4K8ZA 1XQSC 4DTMA 3MN9A 4FW2A 2WOMA 2QWNA 1MDUB 3O4QA 3TAMA 1TK5A 3OW2M 4FJLA 5DK5A 1C1CA 1FKPA 1DKGD 1WNSA 1RT4A 1L3SA 3IS9A 2D1KA 3OYIA 1CXUA 1SKWA 3QNNA 4YY3K 4R5PA 2FF3B 3L3UA 5LY3A 4DV3K 5DM7L 4KRFA 1NKEA 1U2VB 4LH4A 1K8KA 3LPTA 1DTQA 2KFNA 4KHWA 1RDWX 1T05A 2NRVA 3CFPA 4A62A 3CC4N 4IDHA 3VA0A 1XMQK 4FLZA 2VG5A 1Z6RA 3AA5X 4MQ3A 1BDGA 3AA3A 3SV3A 3V9XA 1J5EK 1RCHA 3HO1A 3O6WA 3U3GA 1UOCA 1P8ZA 3WT0A 5C42A 3G4SN 3TAQA 3AO3A 4E7KA 3SQ1A 2YCHA 4JHDB 4O4GA 5LJWA 2FSJA 5FRMA 4FSVA 1C0UA 1J54A 4B3OA 4CF1A 4DFJA 3LDQA 4CESA 3CQYA 2ASPA 3RR7A 3PO4A 4H0OA 3QEXA 4KTWA 2IVOA 4MDBA 2ATQA 3TARA 3H3NO 2F96A 4FWSA 3T3FA 3PO5A 3VQ6A 1NJYA 2VWBA 1RT7A 4AHCA 3AARA 4BRDA 3LP0A 3CMEN 4DFMA 3UIQA 3M1FA 3W3DA 3I0RA 2E20A 1Q18A 5AFUH 2WONA 3MXJA 3MWPA 4IO9L 3RMBA 2HBMA 1KAXA 4DFPA 1TL3A 3L3VA 4JK7A 3MDQA 3E9PA 2NRRA 3NH2A 5KQDA 3M8PA 3ID6A 3L2UA 3S41A 3UKUB 5AQPA 1KAYA 5KTQA 3AVHA 3PSFA 1BL3A 4V19S 3TSQA 4B3RK 3K5NA 2EWSA 3VQ9A 2OA8A 1HJOA 4NLCA 3QEWA 5AZJB 1WLJA 4CD3A 3PY8A 3AVBA 4JAXA 1QZ5A 4CZHA 5C2DA 3MX5A 3EY1A 3DOLA 1X9WA 2X6NA 4CJVA 4F2RA 3C65A 3FZKA 3QLHA 2YKMA 3VN5A 1BCOA 2YJFA 3MECA 4PKHA 3SYZA 1CZAN 4FCYA 3LP2A 2O4IA 4RW8A 4BY9C 5AQZA 3E01A 4JRQA 4G9ZA 4NYNA 4B8AB 1RBRA 1JLGA 3PX0A 3NGIA 3FFKB 1DEJA 2NRZA 2XHBA 3AVAA 1S6QA 3JXUA 1TV6A 3R3LA 3HRGA 4HHTA 3U9ZA 1IBMK 3DAWA 1OH5A 1RILA 4Z4HA 4N76A 3M8QA 4O55A 2QK9A 5A2QO 3VEXA 3OHRA 4BRHA 4KPYA 1WBDA 1VQLN 4GY2B 1BQNA 3NGYA 3MCAB 3HZ6A 4CVNE 1JKHA 3A5OC 4XH5A 4WQ5C 2Z1HA 4JKAA 4WQ5A 1ZBHA 1HKCA 4BR2A 4B1XB 1NJIO 1B9DA 5BN9A 3TAPA 4M45A 2Y1JA 3ZETA 1YF5L 3RSEA 4OPKA 1T8EA 1BISA 4CJLA 3VQPA 2OYQA 1GOCA 2P9IA 4CD1A 1BA0A 2P9NB 4W5RA 2FBTA 5M1PA 4PKIA 3VGKA 5AQQA 4B9SA 5JICA 4CJ7A 1HNZK 2Q3SA 5BRDA 2Z1IA 2GUIA 4B1YB 1D9FA 1RT2A 3M3ZA 1NNEA 3AO2A 3CCMN 4M63C 3RRHA 4BE2A 3S9HA 3CXCM 5BRFA 2KLAA 4OGEA 2P9KB 3VA3A
chains in the Genus database with same CATH topology
1LV5A 4FZZA 1NK0A 1D8YA 2DFHA 5JS1A 3TWHA 1IKYA 3SNNA 4B9MA 3FFIA 1RBSA 3TR8A 3SPYA 4CGJA 4DQRA 4DS5A 1KSPA 3K59A 3SUQA 4F3OA 5FROA 2OPPA 3QESA 2NUBA 5CYQA 3AA2A 3DLBA 1KVBA 1S9GA 1SL2A 4E89A 5EU7A 3C95A 3HXMA 1C6VA 1D9DA 4ZHRA 3ZT2A 4FLUA 2OPSA 3HPHA 5KGXA 4CGFA 2JLEA 2YNHA 1U48A 3VQ5A 3PX6A 5D3GA 2KFZA 3DLRA 4CE9A 3VQQA 1Q8IA 1KLMA 2HB5A 3QINA 3JYTA 4IG0A 3SV4A 4DU4A 2G8VA 3AVFA 1HYZA 4GVMA 1JLAA 3LP3A 4I2QA 3ZCMA 3AV9A 3SUNA 2P5GA 2HNZA 4UQGA 3V9SA 1NJWA 4FLWA 3JSMA 3V81A 4HVJA 2XY7A 4RW6A 3L2VA 4HUFA 2ZD1A 4DTPA 4AHRA 4H8KA 5HBMA 5SWMA 4N47A 3OYDA 4DTRA 3O3HA 4DQIA 4LSLA 3RTVA 3ZSOA 4AILC 3HP9A 4CK1A 1L3UA 1RDAA 1JLCA 1JLQA 4IFVA 3CQ8A 4FLXA 3QIOA 4LD0A 1X9MA 4DQSA 4F4KA 4ID1A 5CY4A 5JS2A 2BANA 3TAEA 3S3OA 4Z0UA 1CXQA 1WAJA 4FJ8A 3LWMA 4FW1A 4DF4A 1FKOA 2OPQA 3LANA 1S1VA 1EXQA 3O4NA 4Z4CA 3NCIA 3V9UA 2OZSA 4C8LA 1HMVA 3HSTB 4IBNA 4BACA 3OS0A 1XC9A 1RTDA 5FDLA 4FJ7A 1ZBFA 2YHAA 4BDZA 4M3RA 1WSJA 4W5OA 3SPZA 1L3VA 3AO1A 2XY8A 4KI4A 4E7HA 3HK2A 1HYSA 4FM2A 2HW3A 4DFKA 1RBTA 1RNHA 4L8RB 4M3TA 4DU3A 1BI4B 5HRRA 1L5UA 1XHXA 2Z1JA 3CG7A 3VQ8A 1BGXT 5HRSA 2QKKA 4IFYA 4CFAA 4HTUA 4KHSA 1L3TA 4CHYA 3ZT4A 3NDKA 4YNQA 3BGRA 3QIPA 4FM0A 4FLYA 3HVRA 4F8RA 1YT3A 4CJEA 5HROA 4DU1A 4CF8A 4E7IA 3TAFA 4DTNA 2X78A 4CFDA 1IKWA 3LAMA 2G8FA 4KI6A 4CF0A 3K5OA 4QAGA 3KIOA 2EHGA 4DSJA 1RDDA 1C1AA 4OKKA 2AJQA 3V9WA 3EZ5A 4HCBA 2E6MA 2IGIA 3C6TA 2DY4A 3QEVA 4CJKA 4M42A 4B9TA 1TL1A 3OYEA 3RR8A 4KKOA 1IKXA 4FJKA 2G8WA 4FZXC 3KKRA 1QS4A 1RTIA 3QO9A 2EX3A 3OYFA 1Q9XA 3AVGA 1S1UA 3DRSA 4O0IA 1TKTA 1RDBA 3CM6A 3MEEA 4KAZA 3LZIA 4FLVA 3QETA 3DLEA 4KFBA 4CFCA 1TGOA 1S9EA 4RW7A 3OS2A 4CHQA 3TANA 1KFDA 2XY6A 1NOYA 4PWDA 4J2DA 4C8OA 3SJJA 5J2MA 2G8HA 3CFOA 4FK0A 3VQAA 4DTJA 4KB0A 1HYVA 1RT6A 4B08A 3I0SA 1EKEA 3OYMA 1IH7A 3ZSRA 3ZSYA 4KV8A 1TKZA 3V1QA 3G0ZA 2GV9A 3KK3A 4M3WA 3P5JA 1LAVA 3K2PA 4DLEA 4DTXA 4NCGA 1TK8A 4J2EA 3LWLA 4M3XA 1D5AA 1QHTA 5HP1A 4FM1A 1A5XA 4AHUA 4TSXA 2HNYA 4E0DA 4PY5A 1KVCA 2HHUA 5SZTA 2E4LA 2HNDA 1NJXA 5E41A 5DMRA 4OJRA 4ZTFA 3MEDA 1RTJA 3ALYA 1RBUA 4CIGA 5C24A 3C94A 1FXXA 1QQCA 4CECA 1N5YA 4DSIA 1ASWA 1XI1A 2RKIA 4H4OA 1VK0A 3I8DA 3T1AA 3DM2A 4CJUA 4AHTA 4KHNA 3TI0A 4FJHA 4ID5A 4CJQA 3IG1A 4FK4A 2RPIA 3NF7A 4DSKA 4BDYA 1SKSA 4KTQA 4FLTA 3ZSQA 2XY5A 3VQ4A 4CEOA 2A1SA 3SQ4A 3CM5A 3AVLA 4ZTJA 1ASUA 1ZBUA 4BE1A 1NK8A 3B6OA 1YVUA 4C8NA 3NGZA 1SL1A 2X74A 4W5NA 4CJSA 3T19A 4CGGA 1U45A 2PZSA 4ELUA 3D0PA 1JLEA 5KRSA 4DSEA 3AO5A 1RT1A 4DTUA 4B9LA 3WNFA 3HYFA 3A2FA 1WSEA 1EP4A 3PUFA 1U4BA 1JXEA 3SI6A 4IDKA 3RMCA 3SCXA 3MXIA 4FK2A 1NJZA 2D0AA 3D45A 4C8MA 1J9AA 4BWJA 5J2NA 2YNIA 2FBXA 3KLHA 3OYCA 4DQQA 4Q0BA 1K6YA 4CK2A 4ELVA 4KHQA 1KLNA 3BDPA 4O0JA 1EX4A 3K58A 2F8SA 4E19A 2DTUA 3HVTA 3V6DA 4GW6A 4CFBA 1KFSA 4B9UA 2BGGA 1FK9A 2GBZA 3OYBA 4JS4A 4JS5A 2X6SA 1QTMA 3NH0A 4FYDA 3LP1A 1BI4A 4FJGA 3MEGA 3IAYA 1WSIA 3IRXA 1BHLA 4BDPA 4DWIA 4OLAA 4K8XA 3DI6A 1VSFA 3SUOA 1VRUA 1RDCA 4RG8A 3VQEA 3RWUA 2KZZA 1Z26A 3NHGA 3LDSA 4RW4A 3LALA 1ZBLA 4Z4FA 2KZMA 2KQ2A 3HP6A 2YNFA 4DMNA 3KD5E 3DMJA 3L8BA 4IG3A 4CGDA 2A1RA 4ICLA 3S3MA 4IKFA 2YKNA 3OYHA 4EZ6A 4KB1A 4FJNA 1I3AA 1CZ9A 1WN7A 3ITHA 1VRTA 3AVIA 2LSNA 4O5BA 3KLIA 4AH9A 4F3TA 3SQ0A 1TAQA 4CHNA 3K5LA 1VSHA 3ULDA 4CHZA 1J5OA 3NAEA 4K8ZA 2IC3A 4OKJA 4DTMA 3VQDA 1RBVA 2DFFA 1S1WA 3DYAA 4FW2A 5CZ2A 2WOMA 4M3UA 1G15A 2D0CA 4CEEA 3O4QA 3TAMA 4I9LA 3KLGA 3LAKA 3PV8A 1SKRA 1QE1A 1TK5A 4FJLA 4PQUA 5DK5A 4F2SA 1C1CA 1FKPA 1WNSA 4KO0A 4CJWA 4BE0A 1RT4A 1L3SA 3IS9A 4HCCA 3DRRA 1XWLA 1CXUA 4Y1DA 3OYIA 4DTSA 3QNNA 1SKWA 4NCAA 4R5PA 1SV5A 4DS4A 3V4IA 2OYQA 3L3UA 1WAFA 1BIZA 1NK6A 3AVJA 4KRFA 4JRPA 1NKEA 1C1BA 4LH4A 3LPTA 4OKEA 4ELTA 1DTQA 3OYLA 2KFNA 2D5RA 4KHWA 1C0MA 5CYMA 2VWJA 4I2PA 4Y1CA 4I7FA 1U49A 3RRGA 1T05A 3OJUA 3LPUA 4FJMA 2YHBA 2KW4A 4CJRA 1A5WA 1B92A 3DOKA 1GOBA 3CFPA 4Z4EA 1LW2A 1HNVA 3OJSA 3WNEA 3VA0A 4HUGA 3M8SA 2VG5A 4FLZA 3AA5X 4C8KA 3SUPA 2XO7A 4MQ3A 1Q9YA 1DTTA 3AA3A 3V1RA 3SV3A 3V9XA 4FZYA 4I9QA 3ASMA 3HL8A 3ZT0A 3OYNA 1YTAA 4CJ5A 1QSSA 4Z4GA 4E1NA 3HPGA 5C25A 4CCHA 2FC0A 1RCHA 4HUEA 3HO1A 3U3GA 3L2RA 1WSHA 1UOCA 4B9VA 2R7YA 4CEAA 2BE2A 4CF2A 1HPZA 5C42A 5CZ1A 4CERA 1VSMA 2RF2A 4DQPA 4CGHA 1TVRA 2RN2A 3TAQA 3OYJA 2ZE2A 3AO3A 4E7KA 4LSNA 3SQ1A 3EYZA 5J2QA 1UA0A 3ZSWA 3KKSA 2KTQA 4O4GA 4EZ9A 1VSLA 3ZT3A 3OVNA 1UWBA 4E7JA 1NK7A 1X9SA 3ZSZA 1TKDA 1C0UA 5FRMA 2HHSA 2Y1IA 1J54A 2I5JA 4CF1A 4DLGA 4DFJA 4B3OA 3TAGA 4W5TA 3NFAA 1U47A 3AA4A 4FJXA 4CESA 3V9ZA 2G8UA 2VWKA 3HJFA 3RR7A 1W9HA 2QXFA 1VSIA 4LH5A 4CGIA 1NOZA 3PO4A 2OZMA 1IKVA 1MU2A 4KTWA 3QEXA 3ZSXA 2HHWA 2W42A 2FBYA 1YTUA 1ITGA 2ATQA 4OLBA 3TARA 1CLQA 1KRPA 3OYKA 4RW9A 4WE1A 3P83D 3RMDA 2F96A 3AVMA 3T3FA 1TKXA 1KTQA 3RMAA 3VQ6A 3PO5A 2QKBA 1KCFA 4CEQA 1RT7A 2OPRA 1RT5A 3P1GA 3DLGA 4AHCA 1NJYA 1UA1A 5HRPA 3ZT1A 5KI6A 3DLKA 3OY9A 3LP0A 4CIFA 3OYGA 4DFMA 3THVA 3CFRA 1XHZA 3UIQA 1WSGA 3I0RA 1WSFA 4CEBA 2XRIA 3O3GA 3KK2A 2B6AA 4M3ZA 2HHVA 2HHQA 3K5MA 3PX4A 2WONA 1EETA 3MXJA 3NF9A 3SZ2A 1S6PA 3U6FA 3RMBA 1N6QA 4MFBA 4DFPA 3WNHA 1C0TA 1TL3A 2Z1GA 4CF9A 3L3VA 1CZBA 4E1MA 2PYJA 4OVLA 3K57A 1QSYA 2JGUA 4KREA 4O44A 3VQ7A 1UAXA 4DG1A 3NH2A 3M8PA 3OYAA 3AO4A 4FJIA 5HRNA 3L2UA 3LZJA 1LWCA 1JLFA 3HPOA 1VSDA 5J1EA 5KTQA 4CIEA 3AVHA 3CYMA 5FRNA 2HHTA 4B8CA 1BL3A 1JL2A 3U3YA 4CK3A 3K5NA 2PY5A 1LWEA 2ETJA 1R0AA 1JLBA 3F9KA 3VQ9A 1ZYQA 2OA8A 2G8KA 1LWFA 4AHVA 3QEWA 4CJ4A 1NKCA 1O1WA 1S5JA 1WLJA 4JLHA 3QEIA 4NYFA 4KHUA 3MXMA 3PY8A 3KK1A 4CJ3A 3AVBA 5I3UA 2E6LA 1JL1A 1REVA 1VSJA 2IAJA 4W5QA 3M8RA 3EY1A 3DOLA 4GMJB 4CEZA 1X9WA 2PYLA 4PUOA 2X6NA 3S3NA 4CJVA 2IOCA 4F2RA 3G10A 3QLHA 3ISNC 1Z25A 2YKMA 3VN5A 1BCOA 2BDPA 3MECA 4AHSA 1BCMA 3SYZA 3ZSVA 3O3FA 4Z4IA 2B4JA 2O4GA 3LP2A 3KJVA 4FCYA 2O4IA 4RW8A 1ZBIA 4M41A 3VQCA 2P51A 3E01A 3NH1A 3F73A 3V1OA 1NKBA 4JRQA 3NBPA 2ZQBA 3KLEA 5HLFA 1BQMA 2YV0X 4NYNA 3L2QA 4DSLA 4B8AB 1RBRA 1JLGA 1Y97A 3PX0A 3DLHA 3NGIA 1GOAA 3HT3A 1NK9A 3TABA 5K14A 2XHBA 3NF8A 3AVAA 1HNIA 4KTZA 1S6QA 4J2BA 4N56A 1TV6A 3OS1A 3NF6A 1VSKA 4HHTA 3SQ2A 4EP4A 1I39A 4FJJA 5KGWA 3QERA 1IO2A 4BWMA 2B5JA 3C6UA 1VSEA 1JXBA 3AVNA 1RILA 1QSLA 4QOZB 4LY7A 4Z4HA 4N76A 3M8QA 4O55A 2IDOA 2QK9A 1BIUA 1A5VA 4KPYA 1IG9A 4DTOA 1T03A 4CJPA 1HJRA 3WNGA 2IS3A 4XIUA 1F21A 1BQNA 1SL0A 4DF8A 3NGYA 4H4MA 1RT3A 1U04A 4DSFA 2YNGA 4G1QA 3NE6A 1JKHA 2P1JA 3QNOA 4J2AA 4M3YA 1X1PA 2Z1HA 2F8TA 4NCBA 1B9FA 2G8IA 4FXDA 4QCLA 1ZBHA 1S1TA 2DFEA 5T7BA 1B9DA 2VG7A 3TAPA 4M45A 1J53A 2Y1JA 2P5OA 4FJ5A 4OPKA 1T8EA 4CEFA 1BISA 4CJLA 3VQPA 3DRPA 4CHPA 1GOCA 4EP5A 4PA1A 5I42A 4E7LA 4Q5VA 3KTQA 2HVIA 4W5RA 2FBTA 2VG6A 3AVKA 4CHOA 4B9SA 4FJ9A 3QEPA 1T7PA 4FVMA 3HM9A 4N41A 1SUQA 1W0HA 1DLOA 3KD1E 1TAUA 2Q3SA 5J2PA 1KVAA 3MAQA 2FBVA 2Z1IA 4KHYA 2GUIA 1D9FA 1RTHA 1RT2A 4E3SA 5KRTA 1LAWA 2ITGA 1NK4A 3AO2A 4B9NA 2D0BA 1LW0A 1HQUA 3KLFA 4N5SA 2HVHA 2HHXA 3RRHA 4OPJA 3H08A 4CEDA 4BE2A 3S9HA 3VQBA 1HRHA 1TK0A 1ASVA 4CJTA 2HMIA 3L2WA 1NK5A 1S1XA 3AVCA 1HQEA 4OGEA 3B6PA 4YFUA 4CJFA 4OGCA 3VA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LV5 A;  4FZZ A;  1NK0 A;  1D8Y A;  2DFH A;  5JS1 A;  3TWH A;  1IKY A;  3SNN A;  4B9M A;  3FFI A;  1RBS A;  3TR8 A;  3SPY A;  4CGJ A;  4DQR A;  4DS5 A;  1KSP A;  3K59 A;  3SUQ A;  4F3O A;  5FRO A;  2OPP A;  3QES A;  2NUB A;  5CYQ A;  3AA2 A;  3DLB A;  1KVB A;  1S9G A;  1SL2 A;  4E89 A;  5EU7 A;  3C95 A;  3HXM A;  1C6V A;  1D9D A;  4ZHR A;  3ZT2 A;  4FLU A;  2OPS A;  3HPH A;  5KGX A;  4CGF A;  2JLE A;  2YNH A;  1U48 A;  3VQ5 A;  3PX6 A;  5D3G A;  2KFZ A;  3DLR A;  4CE9 A;  3VQQ A;  1Q8I A;  1KLM A;  2HB5 A;  3QIN A;  3JYT A;  4IG0 A;  3SV4 A;  4DU4 A;  2G8V A;  3AVF A;  1HYZ A;  4GVM A;  1JLA A;  3LP3 A;  4I2Q A;  3ZCM A;  3AV9 A;  3SUN A;  2P5G A;  2HNZ A;  4UQG A;  3V9S A;  1NJW A;  4FLW A;  3JSM A;  3V81 A;  4HVJ A;  2XY7 A;  4RW6 A;  3L2V A;  4HUF A;  2ZD1 A;  4DTP A;  4AHR A;  4H8K A;  5HBM A;  5SWM A;  4N47 A;  3OYD A;  4DTR A;  3O3H A;  4DQI A;  4LSL A;  3RTV A;  3ZSO A;  4AIL C;  3HP9 A;  4CK1 A;  1L3U A;  1RDA A;  1JLC A;  1JLQ A;  4IFV A;  3CQ8 A;  4FLX A;  3QIO A;  4LD0 A;  1X9M A;  4DQS A;  4F4K A;  4ID1 A;  5CY4 A;  5JS2 A;  2BAN A;  3TAE A;  3S3O A;  4Z0U A;  1CXQ A;  1WAJ A;  4FJ8 A;  3LWM A;  4FW1 A;  4DF4 A;  1FKO A;  2OPQ A;  3LAN A;  1S1V A;  1EXQ A;  3O4N A;  4Z4C A;  3NCI A;  3V9U A;  2OZS A;  4C8L A;  1HMV A;  3HST B;  4IBN A;  4BAC A;  3OS0 A;  1XC9 A;  1RTD A;  5FDL A;  4FJ7 A;  1ZBF A;  2YHA A;  4BDZ A;  4M3R A;  1WSJ A;  4W5O A;  3SPZ A;  1L3V A;  3AO1 A;  2XY8 A;  4KI4 A;  4E7H A;  3HK2 A;  1HYS A;  4FM2 A;  2HW3 A;  4DFK A;  1RBT A;  1RNH A;  4L8R B;  4M3T A;  4DU3 A;  1BI4 B;  5HRR A;  1L5U A;  1XHX A;  2Z1J A;  3CG7 A;  3VQ8 A;  1BGX T;  5HRS A;  2QKK A;  4IFY A;  4CFA A;  4HTU A;  4KHS A;  1L3T A;  4CHY A;  3ZT4 A;  3NDK A;  4YNQ A;  3BGR A;  3QIP A;  4FM0 A;  4FLY A;  3HVR A;  4F8R A;  1YT3 A;  4CJE A;  5HRO A;  4DU1 A;  4CF8 A;  4E7I A;  3TAF A;  4DTN A;  2X78 A;  4CFD A;  1IKW A;  3LAM A;  2G8F A;  4KI6 A;  4CF0 A;  3K5O A;  4QAG A;  3KIO A;  2EHG A;  4DSJ A;  1RDD A;  1C1A A;  4OKK A;  2AJQ A;  3V9W A;  3EZ5 A;  4HCB A;  2E6M A;  2IGI A;  3C6T A;  2DY4 A;  3QEV A;  4CJK A;  4M42 A;  4B9T A;  1TL1 A;  3OYE A;  3RR8 A;  4KKO A;  1IKX A;  4FJK A;  2G8W A;  4FZX C;  3KKR A;  1QS4 A;  1RTI A;  3QO9 A;  2EX3 A;  3OYF A;  1Q9X A;  3AVG A;  1S1U A;  3DRS A;  4O0I A;  1TKT A;  1RDB A;  3CM6 A;  3MEE A;  4KAZ A;  3LZI A;  4FLV A;  3QET A;  3DLE A;  4KFB A;  4CFC A;  1TGO A;  1S9E A;  4RW7 A;  3OS2 A;  4CHQ A;  3TAN A;  1KFD A;  2XY6 A;  1NOY A;  4PWD A;  4J2D A;  4C8O A;  3SJJ A;  5J2M A;  2G8H A;  3CFO A;  4FK0 A;  3VQA A;  4DTJ A;  4KB0 A;  1HYV A;  1RT6 A;  4B08 A;  3I0S A;  1EKE A;  3OYM A;  1IH7 A;  3ZSR A;  3ZSY A;  4KV8 A;  1TKZ A;  3V1Q A;  3G0Z A;  2GV9 A;  3KK3 A;  4M3W A;  3P5J A;  1LAV A;  3K2P A;  4DLE A;  4DTX A;  4NCG A;  1TK8 A;  4J2E A;  3LWL A;  4M3X A;  1D5A A;  1QHT A;  5HP1 A;  4FM1 A;  1A5X A;  4AHU A;  4TSX A;  2HNY A;  4E0D A;  4PY5 A;  1KVC A;  2HHU A;  5SZT A;  2E4L A;  2HND A;  1NJX A;  5E41 A;  5DMR A;  4OJR A;  4ZTF A;  3MED A;  1RTJ A;  3ALY A;  1RBU A;  4CIG A;  5C24 A;  3C94 A;  1FXX A;  1QQC A;  4CEC A;  1N5Y A;  4DSI A;  1ASW A;  1XI1 A;  2RKI A;  4H4O A;  1VK0 A;  3I8D A;  3T1A A;  3DM2 A;  4CJU A;  4AHT A;  4KHN A;  3TI0 A;  4FJH A;  4ID5 A;  4CJQ A;  3IG1 A;  4FK4 A;  2RPI A;  3NF7 A;  4DSK A;  4BDY A;  1SKS A;  4KTQ A;  4FLT A;  3ZSQ A;  2XY5 A;  3VQ4 A;  4CEO A;  2A1S A;  3SQ4 A;  3CM5 A;  3AVL A;  4ZTJ A;  1ASU A;  1ZBU A;  4BE1 A;  1NK8 A;  3B6O A;  1YVU A;  4C8N A;  3NGZ A;  1SL1 A;  2X74 A;  4W5N A;  4CJS A;  3T19 A;  4CGG A;  1U45 A;  2PZS A;  4ELU A;  3D0P A;  1JLE A;  5KRS A;  4DSE A;  3AO5 A;  1RT1 A;  4DTU A;  4B9L A;  3WNF A;  3HYF A;  3A2F A;  1WSE A;  1EP4 A;  3PUF A;  1U4B A;  1JXE A;  3SI6 A;  4IDK A;  3RMC A;  3SCX A;  3MXI A;  4FK2 A;  1NJZ A;  2D0A A;  3D45 A;  4C8M A;  1J9A A;  4BWJ A;  5J2N A;  2YNI A;  2FBX A;  3KLH A;  3OYC A;  4DQQ A;  4Q0B A;  1K6Y A;  4CK2 A;  4ELV A;  4KHQ A;  1KLN A;  3BDP A;  4O0J A;  1EX4 A;  3K58 A;  2F8S A;  4E19 A;  2DTU A;  3HVT A;  3V6D A;  4GW6 A;  4CFB A;  1KFS A;  4B9U A;  2BGG A;  1FK9 A;  2GBZ A;  3OYB A;  4JS4 A;  4JS5 A;  2X6S A;  1QTM A;  3NH0 A;  4FYD A;  3LP1 A;  1BI4 A;  4FJG A;  3MEG A;  3IAY A;  1WSI A;  3IRX A;  1BHL A;  4BDP A;  4DWI A;  4OLA A;  4K8X A;  3DI6 A;  1VSF A;  3SUO A;  1VRU A;  1RDC A;  4RG8 A;  3VQE A;  3RWU A;  2KZZ A;  1Z26 A;  3NHG A;  3LDS A;  4RW4 A;  3LAL A;  1ZBL A;  4Z4F A;  2KZM A;  2KQ2 A;  3HP6 A;  2YNF A;  4DMN A;  3KD5 E;  3DMJ A;  3L8B A;  4IG3 A;  4CGD A;  2A1R A;  4ICL A;  3S3M A;  4IKF A;  2YKN A;  3OYH A;  4EZ6 A;  4KB1 A;  4FJN A;  1I3A A;  1CZ9 A;  1WN7 A;  3ITH A;  1VRT A;  3AVI A;  2LSN A;  4O5B A;  3KLI A;  4AH9 A;  4F3T A;  3SQ0 A;  1TAQ A;  4CHN A;  3K5L A;  1VSH A;  3ULD A;  4CHZ A;  1J5O A;  3NAE A;  4K8Z A;  2IC3 A;  4OKJ A;  4DTM A;  3VQD A;  1RBV A;  2DFF A;  1S1W A;  3DYA A;  4FW2 A;  5CZ2 A;  2WOM A;  4M3U A;  1G15 A;  2D0C A;  4CEE A;  3O4Q A;  3TAM A;  4I9L A;  3KLG A;  3LAK A;  3PV8 A;  1SKR A;  1QE1 A;  1TK5 A;  4FJL A;  4PQU A;  5DK5 A;  4F2S A;  1C1C A;  1FKP A;  1WNS A;  4KO0 A;  4CJW A;  4BE0 A;  1RT4 A;  1L3S A;  3IS9 A;  4HCC A;  3DRR A;  1XWL A;  1CXU A;  4Y1D A;  3OYI A;  4DTS A;  3QNN A;  1SKW A;  4NCA A;  4R5P A;  1SV5 A;  4DS4 A;  3V4I A;  2OYQ A;  3L3U A;  1WAF A;  1BIZ A;  1NK6 A;  3AVJ A;  4KRF A;  4JRP A;  1NKE A;  1C1B A;  4LH4 A;  3LPT A;  4OKE A;  4ELT A;  1DTQ A;  3OYL A;  2KFN A;  2D5R A;  4KHW A;  1C0M A;  5CYM A;  2VWJ A;  4I2P A;  4Y1C A;  4I7F A;  1U49 A;  3RRG A;  1T05 A;  3OJU A;  3LPU A;  4FJM A;  2YHB A;  2KW4 A;  4CJR A;  1A5W A;  1B92 A;  3DOK A;  1GOB A;  3CFP A;  4Z4E A;  1LW2 A;  1HNV A;  3OJS A;  3WNE A;  3VA0 A;  4HUG A;  3M8S A;  2VG5 A;  4FLZ A;  3AA5 X;  4C8K A;  3SUP A;  2XO7 A;  4MQ3 A;  1Q9Y A;  1DTT A;  3AA3 A;  3V1R A;  3SV3 A;  3V9X A;  4FZY A;  4I9Q A;  3ASM A;  3HL8 A;  3ZT0 A;  3OYN A;  1YTA A;  4CJ5 A;  1QSS A;  4Z4G A;  4E1N A;  3HPG A;  5C25 A;  4CCH A;  2FC0 A;  1RCH A;  4HUE A;  3HO1 A;  3U3G A;  3L2R A;  1WSH A;  1UOC A;  4B9V A;  2R7Y A;  4CEA A;  2BE2 A;  4CF2 A;  1HPZ A;  5C42 A;  5CZ1 A;  4CER A;  1VSM A;  2RF2 A;  4DQP A;  4CGH A;  1TVR A;  2RN2 A;  3TAQ A;  3OYJ A;  2ZE2 A;  3AO3 A;  4E7K A;  4LSN A;  3SQ1 A;  3EYZ A;  5J2Q A;  1UA0 A;  3ZSW A;  3KKS A;  2KTQ A;  4O4G A;  4EZ9 A;  1VSL A;  3ZT3 A;  3OVN A;  1UWB A;  4E7J A;  1NK7 A;  1X9S A;  3ZSZ A;  1TKD A;  1C0U A;  5FRM A;  2HHS A;  2Y1I A;  1J54 A;  2I5J A;  4CF1 A;  4DLG A;  4DFJ A;  4B3O A;  3TAG A;  4W5T A;  3NFA A;  1U47 A;  3AA4 A;  4FJX A;  4CES A;  3V9Z A;  2G8U A;  2VWK A;  3HJF A;  3RR7 A;  1W9H A;  2QXF A;  1VSI A;  4LH5 A;  4CGI A;  1NOZ A;  3PO4 A;  2OZM A;  1IKV A;  1MU2 A;  4KTW A;  3QEX A;  3ZSX A;  2HHW A;  2W42 A;  2FBY A;  1YTU A;  1ITG A;  2ATQ A;  4OLB A;  3TAR A;  1CLQ A;  1KRP A;  3OYK A;  4RW9 A;  4WE1 A;  3P83 D;  3RMD A;  2F96 A;  3AVM A;  3T3F A;  1TKX A;  1KTQ A;  3RMA A;  3VQ6 A;  3PO5 A;  2QKB A;  1KCF A;  4CEQ A;  1RT7 A;  2OPR A;  1RT5 A;  3P1G A;  3DLG A;  4AHC A;  1NJY A;  1UA1 A;  5HRP A;  3ZT1 A;  5KI6 A;  3DLK A;  3OY9 A;  3LP0 A;  4CIF A;  3OYG A;  4DFM A;  3THV A;  3CFR A;  1XHZ A;  3UIQ A;  1WSG A;  3I0R A;  1WSF A;  4CEB A;  2XRI A;  3O3G A;  3KK2 A;  2B6A A;  4M3Z A;  2HHV A;  2HHQ A;  3K5M A;  3PX4 A;  2WON A;  1EET A;  3MXJ A;  3NF9 A;  3SZ2 A;  1S6P A;  3U6F A;  3RMB A;  1N6Q A;  4MFB A;  4DFP A;  3WNH A;  1C0T A;  1TL3 A;  2Z1G A;  4CF9 A;  3L3V A;  1CZB A;  4E1M A;  2PYJ A;  4OVL A;  3K57 A;  1QSY A;  2JGU A;  4KRE A;  4O44 A;  3VQ7 A;  1UAX A;  4DG1 A;  3NH2 A;  3M8P A;  3OYA A;  3AO4 A;  4FJI A;  5HRN A;  3L2U A;  3LZJ A;  1LWC A;  1JLF A;  3HPO A;  1VSD A;  5J1E A;  5KTQ A;  4CIE A;  3AVH A;  3CYM A;  5FRN A;  2HHT A;  4B8C A;  1BL3 A;  1JL2 A;  3U3Y A;  4CK3 A;  3K5N A;  2PY5 A;  1LWE A;  2ETJ A;  1R0A A;  1JLB A;  3F9K A;  3VQ9 A;  1ZYQ A;  2OA8 A;  2G8K A;  1LWF A;  4AHV A;  3QEW A;  4CJ4 A;  1NKC A;  1O1W A;  1S5J A;  1WLJ A;  4JLH A;  3QEI A;  4NYF A;  4KHU A;  3MXM A;  3PY8 A;  3KK1 A;  4CJ3 A;  3AVB A;  5I3U A;  2E6L A;  1JL1 A;  1REV A;  1VSJ A;  2IAJ A;  4W5Q A;  3M8R A;  3EY1 A;  3DOL A;  4GMJ B;  4CEZ A;  1X9W A;  2PYL A;  4PUO A;  2X6N A;  3S3N A;  4CJV A;  2IOC A;  4F2R A;  3G10 A;  3QLH A;  3ISN C;  1Z25 A;  2YKM A;  3VN5 A;  1BCO A;  2BDP A;  3MEC A;  4AHS A;  1BCM A;  3SYZ A;  3ZSV A;  3O3F A;  4Z4I A;  2B4J A;  2O4G A;  3LP2 A;  3KJV A;  4FCY A;  2O4I A;  4RW8 A;  1ZBI A;  4M41 A;  3VQC A;  2P51 A;  3E01 A;  3NH1 A;  3F73 A;  3V1O A;  1NKB A;  4JRQ A;  3NBP A;  2ZQB A;  3KLE A;  5HLF A;  1BQM A;  2YV0 X;  4NYN A;  3L2Q A;  4DSL A;  4B8A B;  1RBR A;  1JLG A;  1Y97 A;  3PX0 A;  3DLH A;  3NGI A;  1GOA A;  3HT3 A;  1NK9 A;  3TAB A;  5K14 A;  2XHB A;  3NF8 A;  3AVA A;  1HNI A;  4KTZ A;  1S6Q A;  4J2B A;  4N56 A;  1TV6 A;  3OS1 A;  3NF6 A;  1VSK A;  4HHT A;  3SQ2 A;  4EP4 A;  1I39 A;  4FJJ A;  5KGW A;  3QER A;  1IO2 A;  4BWM A;  2B5J A;  3C6U A;  1VSE A;  1JXB A;  3AVN A;  1RIL A;  1QSL A;  4QOZ B;  4LY7 A;  4Z4H A;  4N76 A;  3M8Q A;  4O55 A;  2IDO A;  2QK9 A;  1BIU A;  1A5V A;  4KPY A;  1IG9 A;  4DTO A;  1T03 A;  4CJP A;  1HJR A;  3WNG A;  2IS3 A;  4XIU A;  1F21 A;  1BQN A;  1SL0 A;  4DF8 A;  3NGY A;  4H4M A;  1RT3 A;  1U04 A;  4DSF A;  2YNG A;  4G1Q A;  3NE6 A;  1JKH A;  2P1J A;  3QNO A;  4J2A A;  4M3Y A;  1X1P A;  2Z1H A;  2F8T A;  4NCB A;  1B9F A;  2G8I A;  4FXD A;  4QCL A;  1ZBH A;  1S1T A;  2DFE A;  5T7B A;  1B9D A;  2VG7 A;  3TAP A;  4M45 A;  1J53 A;  2Y1J A;  2P5O A;  4FJ5 A;  4OPK A;  1T8E A;  4CEF A;  1BIS A;  4CJL A;  3VQP A;  3DRP A;  4CHP A;  1GOC A;  4EP5 A;  4PA1 A;  5I42 A;  4E7L A;  4Q5V A;  3KTQ A;  2HVI A;  4W5R A;  2FBT A;  2VG6 A;  3AVK A;  4CHO A;  4B9S A;  4FJ9 A;  3QEP A;  1T7P A;  4FVM A;  3HM9 A;  4N41 A;  1SUQ A;  1W0H A;  1DLO A;  3KD1 E;  1TAU A;  2Q3S A;  5J2P A;  1KVA A;  3MAQ A;  2FBV A;  2Z1I A;  4KHY A;  2GUI A;  1D9F A;  1RTH A;  1RT2 A;  4E3S A;  5KRT A;  1LAW A;  2ITG A;  1NK4 A;  3AO2 A;  4B9N A;  2D0B A;  1LW0 A;  1HQU A;  3KLF A;  4N5S A;  2HVH A;  2HHX A;  3RRH A;  4OPJ A;  3H08 A;  4CED A;  4BE2 A;  3S9H A;  3VQB A;  1HRH A;  1TK0 A;  1ASV A;  4CJT A;  2HMI A;  3L2W A;  1NK5 A;  1S1X A;  3AVC A;  1HQE A;  4OGE A;  3B6P A;  4YFU A;  4CJF A;  4OGC A;  3VA3 A; 
#chains in the Genus database with same CATH topology
 1LV5 A;  1IKY A;  1XMO K;  5JVG L;  3G6E N;  3SPY A;  4KH6 A;  3U8X A;  2OPP A;  4I6M B;  3SAH A;  3QES A;  3DLB A;  1KVB A;  1S9G A;  2VYP A;  1SL2 A;  2HHH K;  5EU7 A;  1W97 L;  3A5M C;  4ZHR A;  2YNH A;  1NGF A;  1RFQ A;  4R79 A;  5EX5 A;  4CE9 A;  3VQQ A;  2HB5 A;  2G8V A;  3QIN A;  4IG0 A;  3SV4 A;  3AVF A;  4WF9 L;  5M1K A;  1HYZ A;  4I2Q A;  3TSU A;  4CI6 A;  3AGR A;  1NK6 A;  3C6H A;  4RW6 A;  5CE3 A;  3L2V A;  2ZD1 A;  5SWM A;  4N47 A;  2UU9 K;  3O9U A;  1M90 O;  3QDK A;  4EAH D;  3ID8 A;  5F2R A;  4AIL C;  3HP9 A;  1TUY A;  1JLQ A;  4FLX A;  4LD0 A;  5JS2 A;  3MCP A;  4DQ8 A;  2BAN A;  4CZM A;  4PHT X;  3EKU A;  2V52 B;  4CZE A;  4FOE A;  4FW1 A;  2OZS A;  1S1V A;  4Z4C A;  4BRQ A;  3NCI A;  2A3Z A;  3IUC A;  1HMV A;  4IBN A;  3JS6 A;  4DV7 K;  2AA4 A;  4FJ7 A;  1ZBF A;  1WSJ A;  4JD2 B;  3SPZ A;  3AO1 A;  4E7H A;  2HW3 A;  4FM2 A;  2F9W A;  4DFK A;  1RBT A;  4L8R B;  4DU3 A;  1BI4 B;  5HRR A;  1Z05 A;  3C6A A;  4HTU A;  5BR9 A;  4CHY A;  4FWL A;  1VQ4 N;  4F8R A;  1YT3 A;  3VMF B;  4E7I A;  4DU1 A;  4CFD A;  3LAM A;  2P9N A;  4KI6 A;  3V9W A;  2P9S A;  3WXL A;  3C6T A;  1T6C A;  3D2F B;  4B9T A;  3J7Z O;  3CJ7 A;  4H03 B;  3O1B A;  4KKO A;  4FJK A;  2F7T A;  4FOI A;  3C7N A;  3AVG A;  4DB3 A;  2OTL N;  1IV0 A;  3CM6 A;  1TGO A;  1S9E A;  4JEP A;  1KFD A;  1NOY A;  2QWR A;  3VPZ A;  3N4P A;  4C8O A;  5J2M A;  2P9K A;  2YHY A;  4FK0 A;  1DGK N;  3VEW A;  3F9M A;  1HKG A;  1IH7 A;  4AF1 A;  4M3W A;  1LAV A;  4DLE A;  1TK8 A;  1QHT A;  5HP1 A;  1TYQ B;  1GLL O;  5EOY A;  3QFP A;  4F9O A;  4JI0 K;  4PY5 A;  4JKF A;  1KVC A;  2NRT A;  5SZT A;  2E4L A;  4C1N I;  4ZTF A;  2OCE A;  1WBB A;  3ALY A;  5BN8 A;  3VEY A;  4C23 A;  4CEC A;  4CJU A;  2CGJ A;  4KHN A;  3TI0 A;  4FJH A;  4FK4 A;  5AQU A;  3NF7 A;  4BDY A;  4KTQ A;  4FLT A;  4CZG A;  5FPE A;  3SBG A;  3NGZ A;  1N8R O;  4CGG A;  1U45 A;  3JAM O;  1E3M A;  4DR1 K;  1SZ2 A;  3PUF A;  2E5L K;  3TSP A;  3THW B;  4C8M A;  3SLC A;  4WFN L;  1K6Y A;  4ELV A;  1OH8 A;  1E4G T;  4E1J A;  3E9O A;  4X62 K;  3V6D A;  4GV3 A;  3D2E B;  1KFS A;  3GOI A;  1FW6 A;  1BI4 A;  1WUA A;  3IRX A;  4BDP A;  4OLA A;  3THY B;  1VSF A;  3SUO A;  1VRU A;  1RDC A;  3RWU A;  3VQE A;  3EE9 A;  2KZM A;  4RW4 A;  4LF5 K;  3WXK A;  5C2F A;  3KD5 E;  3L8B A;  1C0G A;  3HTV A;  2YKN A;  4KB1 A;  1I3A A;  4F3T A;  3D2F A;  4CHZ A;  1K8A O;  4OKJ A;  2CH6 A;  4DHY A;  1S1W A;  1Q82 O;  5BR8 K;  1NGG A;  3KLG A;  4I9L A;  3LAK A;  3PV8 A;  1QE1 A;  4MO4 A;  4B1V A;  3LDO A;  4F2S A;  2UUC K;  5JMV A;  3HI0 A;  4BE0 A;  5KPR A;  4FZZ A;  1XWL A;  4MDA A;  4BC3 A;  1WAF A;  2OTJ N;  3J7A P;  3OYL A;  2D5R A;  1C0M A;  3M6G A;  4XEI A;  1U49 A;  3RRG A;  3OJU A;  1XC3 A;  3LPU A;  1B92 A;  4JKG B;  3OJS A;  5CR4 A;  2A6A A;  3M8S A;  4NXM K;  3PSI A;  3WQT A;  3SUP A;  1DTT A;  4BRG A;  3ASM A;  5AQM A;  3ZT0 A;  3OYN A;  5B8H A;  4Z4G A;  2J4R A;  4E1N A;  3CER A;  4DKW A;  1V4T A;  4CCH A;  4HUE A;  1K8K B;  4CEA A;  3CI5 A;  2RF2 A;  2E2N A;  1O13 A;  1R59 O;  4CGH A;  2QEX N;  4JN4 A;  2QM1 A;  1NGC A;  5J2Q A;  3ZSW A;  3KKS A;  1W7A A;  2KTQ A;  1VSL A;  1X9S A;  3ZSZ A;  2HHS A;  2I5J A;  4W5T A;  1U47 A;  4OPH A;  4FJX A;  2G8U A;  2VWK A;  3HJF A;  4FWK A;  2QXF A;  4ILG B;  2IIR A;  4CGI A;  1NOZ A;  1IKV A;  2UXB K;  1YTU A;  3D2E A;  3R1X A;  1ITG A;  3TU5 A;  1NGH A;  2O8E A;  5AQR A;  4YOX A;  3KZB A;  1KTQ A;  3BF3 A;  2ZJP L;  4FWR A;  4GNI A;  3P1G A;  3DLG A;  2RHK A;  4CBU A;  2F4V K;  1Q7Y O;  5KI6 A;  1SQK A;  3OY9 A;  3ATU A;  4FWP A;  4O8K A;  3THV A;  1XHZ A;  1T44 A;  1WSF A;  3O3G A;  2HHV A;  4IEE A;  2HHQ A;  2QA4 N;  1EET A;  3U6F A;  1S6P A;  2HBK A;  3NMU A;  3WNH A;  2QTD A;  3LM9 A;  2Z1G A;  2GX9 A;  4CF9 A;  1CZB A;  2PYJ A;  3K57 A;  1V4S A;  4XH4 A;  1QSY A;  4KRE A;  2E1Z A;  1UAX A;  4DG1 A;  4DV4 K;  4A59 A;  3AO4 A;  1E4F T;  3TTD A;  4LF8 K;  1X9J A;  1LWC A;  4CBX A;  3HPO A;  1GLD G;  1VSD A;  3FR0 A;  4B9Q A;  4BRK A;  4CIE A;  3CYM A;  5FRN A;  4B8C A;  1YJN N;  1JL2 A;  3T1H K;  3H46 O;  4BRF A;  4CK3 A;  2PY5 A;  2E1Y A;  1NGI A;  1ZYQ A;  2HF4 A;  3TTC A;  1LWF A;  1NGE A;  2BH1 A;  1S5J A;  3QEI A;  2ITM A;  5AR0 A;  2CGL A;  3MXM A;  3KK1 A;  5IT9 O;  4H0T B;  2E6L A;  1JL1 A;  2NRW A;  4W5Q A;  3NVK A;  2PYL A;  4GMJ B;  4CEZ A;  3MN7 A;  2IOC A;  3ISN C;  4Z94 A;  3R9P A;  2BTF A;  4JKG A;  3OBY A;  4QS7 A;  2O4G A;  4M41 A;  3ULE B;  2P51 A;  3VQC A;  2ZQB A;  3KLE A;  5HLF A;  1BQM A;  3C0B A;  3L2Q A;  4DSL A;  5C10 A;  3HT3 A;  1DT9 A;  1NK9 A;  3TAB A;  3NF6 A;  4IOA L;  1I39 A;  1IO2 A;  2B5J A;  1X3M A;  1JXB A;  1MWK A;  1T03 A;  1C0F A;  1OH6 A;  5M1F A;  1SL0 A;  2VGM A;  4DF8 A;  4BVO A;  5KPT A;  4DSF A;  4G1Q A;  3KWI A;  3QNO A;  3ATV A;  3HM8 A;  2F8T A;  1BU6 O;  2Q31 A;  3SJH A;  3CJA A;  1JCF A;  2DFE A;  3O1W A;  3G25 A;  2VG7 A;  2ZGY A;  1J53 A;  2P5O A;  1FJG K;  4CEF A;  5ELZ A;  4A57 A;  3DRP A;  2HVI A;  4JI8 K;  2E2O A;  4CHO A;  4FJ9 A;  3QEP A;  3HM9 A;  1DLO A;  3IKM A;  4BR9 A;  5J2P A;  1KQS M;  4IWV A;  4K41 A;  3PLA A;  4E3S A;  5KRT A;  2O8D B;  5ADX H;  1HNW K;  2D0B A;  2NRX A;  2HHX A;  2HVH A;  5ADX A;  3ZET B;  3H08 A;  3RSE B;  3VQB A;  1ASV A;  4JI2 K;  3L2W A;  4ISF A;  3AVC A;  2P9I B;  1OVQ A;  3ZX3 A;  4OGC A;  1NK0 A;  3R8E A;  1D8Y A;  5JS1 A;  3VTI A;  2AP1 A;  1N34 K;  3FFI A;  1RBS A;  1OVY A;  3THX A;  5FPD A;  2NUB A;  5CYQ A;  5LMU K;  3HXM A;  3ZT2 A;  2JLE A;  1QVG M;  1U48 A;  4IFE A;  2KFZ A;  1KLM A;  1W2B M;  1IJJ A;  4PL8 A;  1JLA A;  3ULE A;  3ZCM A;  3SK3 A;  3AV9 A;  2P5G A;  2HNZ A;  4UQG A;  3V9S A;  1NJW A;  3JSM A;  3V81 A;  2NNW A;  4HVJ A;  3EZW A;  2XY7 A;  4HUF A;  4AHR A;  4H8K A;  5HBM A;  4DTR A;  3MN5 A;  5CHI A;  5AQV A;  3LDP A;  4LSL A;  2ZGZ A;  3SAF A;  2Q0U A;  4WCE L;  4ILH A;  1JLC A;  4IFV A;  3U9D A;  4F4K A;  4JKD A;  5AQL A;  1WB9 A;  1EQY A;  3EO3 A;  1G99 A;  4FJ8 A;  3PIO L;  4DF4 A;  5EY4 A;  1FKO A;  1EXQ A;  3O4N A;  4CZK A;  5GIO A;  3J8A A;  3QML A;  4GKJ K;  5FDL A;  2YHA A;  3O9S A;  4M3R A;  1S22 A;  1TUU A;  1RNH A;  4M3T A;  1VQN N;  1BG3 A;  1XHX A;  1BGX T;  5HRS A;  2QKK A;  4CFA A;  4KHS A;  1L3T A;  2ZJQ L;  3BGR A;  3FZH A;  3HVR A;  5HRO A;  3TAF A;  1XNQ K;  1KXP A;  2X78 A;  4DTN A;  1IKW A;  3K5O A;  2EHG A;  1RDD A;  1C1A A;  3EZ5 A;  2E6M A;  2O8C B;  3UKR B;  4M42 A;  3OYE A;  4B3T K;  3VOV A;  3RR8 A;  1N32 K;  1IKX A;  3KKR A;  1QS4 A;  4AQY K;  3I55 N;  5GAH P;  1Q9X A;  3GBT A;  2O8D A;  3D6R A;  5GAG P;  3DRS A;  4O0I A;  1TKT A;  2FSN A;  3B8A X;  4BR0 A;  4FLV A;  3QET A;  4GV9 A;  4KFB A;  4CFC A;  3N4Q A;  3BEX A;  2QW9 A;  4PWD A;  1ILY A;  2P9S B;  1HYV A;  5BPL A;  3I0S A;  1ATN A;  4YOY A;  3OYM A;  2HF3 A;  1NMN A;  4FWM A;  3ZSY A;  3VF2 A;  1EWQ A;  1TKZ A;  1YAG A;  4CW7 B;  3C7N B;  4ISE A;  4TSX A;  2UUB K;  4YOW A;  3QBX A;  1M1K O;  5BRH A;  3FZM A;  2HND A;  5DMR A;  4OJR A;  3SMP A;  3MED A;  5AQS A;  3C94 A;  4BGB A;  1FXX A;  1QQC A;  1ASW A;  1XI1 A;  1ZXO A;  2ASO A;  1HNX K;  2HST A;  4IXC A;  1NLV A;  1T6D A;  2RPI A;  3DWL A;  4DSK A;  1SKS A;  2DPN A;  4K42 A;  2HBL A;  1NGD A;  3H1V X;  3MX2 A;  2A1S A;  3CM5 A;  1VQ6 N;  3L4Q A;  3A0I X;  4ZTJ A;  1ASU A;  1VQ9 N;  3K9J A;  4C8N A;  3QIC A;  4JKH A;  2E2Q A;  4CJS A;  4U7B A;  4ELU A;  3CCV N;  1EO1 A;  4B9L A;  3WNF A;  3SI6 A;  4IDK A;  3MXI A;  3SCX A;  1VQ8 N;  3D45 A;  1J9A A;  3CCR N;  3KLH A;  4DQQ A;  1KLN A;  3KHY A;  1YXQ A;  3BDP A;  3K58 A;  2KHO A;  1VQO N;  4JS5 A;  4FYD A;  1LOT B;  1WSI A;  4DWI A;  1BHL A;  4K8X A;  3DI6 A;  4RG8 A;  1YJW N;  3LDS A;  4Z4F A;  3LAL A;  3KVG A;  2KQ2 A;  4DMN A;  2YX6 A;  2A1R A;  4ICL A;  4IKF A;  4DV6 K;  1VRT A;  2O8C A;  3LM2 A;  2UXC K;  4ISG A;  3UKR A;  2IC3 A;  1U6Z A;  2DFF A;  3DYA A;  5CZ2 A;  5GIP A;  5C0Y A;  2JWL A;  4CEE A;  3AY9 A;  4M7Y A;  4PQU A;  1HPM A;  3CET A;  4KO0 A;  4CJW A;  4X64 K;  1X3N A;  4HCC A;  4Y1D A;  4DTS A;  1YIJ N;  4NCA A;  4DS4 A;  3V4I A;  2QWQ A;  4OKE A;  2GEL A;  2HMP A;  5HOO A;  2IVP A;  2VWJ A;  4FJM A;  4K0K K;  2YHB A;  2KW4 A;  1A5W A;  2O8F B;  3DOK A;  4Z4E A;  3TPQ A;  1HNV A;  4JI7 K;  4C8K A;  2XO7 A;  1Q9Y A;  4H5V A;  3V1R A;  3Q7B A;  3HL8 A;  1N33 K;  3HPG A;  5C25 A;  3HBT A;  1WSH A;  2O8B B;  1BOT O;  2BE2 A;  4YDU C;  1HPZ A;  4DQP A;  2ZJR L;  4YDU A;  2RN2 A;  3P38 A;  4LSN A;  2YHX A;  3OVN A;  4E7J A;  4GV6 A;  4IJN A;  3QBW A;  4DLG A;  3L0Q A;  1RDU A;  3TAG A;  3NFA A;  3AA4 A;  4DUZ K;  1W9H A;  3BF1 A;  2D4W A;  4LH5 A;  2RE2 A;  2HHW A;  2FBY A;  4RCH A;  3KWG A;  1QQN A;  4OLB A;  1GLE G;  1KRP A;  3OYK A;  4RW9 A;  4WE1 A;  3RMD A;  3A5N C;  2D0P A;  3AVM A;  3RMA A;  2P9U B;  1NGJ A;  5HRP A;  1K73 O;  4BRI A;  3U4L A;  3OYG A;  3SMS A;  3CFR A;  4H0Y B;  1WSG A;  2PFU A;  4X66 K;  4M3Z A;  2XRI A;  2B6A A;  2W6L A;  3K5M A;  3PX4 A;  1GLB G;  3CCL N;  2Q36 A;  4MFB A;  4E1M A;  4OVL A;  2O8E B;  5DM6 L;  3VQ7 A;  2VQF K;  4FO0 A;  4HWI A;  3ZX2 A;  3MWT A;  5J1E A;  3I8B A;  4BG9 A;  3VER A;  3OTO K;  1R0A A;  4WFA L;  3F9K A;  4FWN A;  4DCH A;  3ZEU A;  4CJ4 A;  4IOC L;  1NKC A;  1O1W A;  4K25 A;  4J8F A;  4KHU A;  4CJ3 A;  3P39 A;  1REV A;  1VSJ A;  4O5F A;  1QZ6 A;  4PUO A;  3CHW A;  2O8F A;  3BP8 A;  2WTU A;  2BDP A;  4AHS A;  3BZC A;  3O3F A;  2B4J A;  1ZBI A;  3F73 A;  3WXJ A;  3NH1 A;  2FLO A;  2YV0 X;  1GOA A;  5K14 A;  1HNI A;  2O8B A;  4KTZ A;  3UB5 A;  4N56 A;  2P9L B;  1VSK A;  5KGW A;  1HKB A;  1GLF O;  3PIP L;  4BWM A;  1VSE A;  1QSL A;  2YJE A;  2JWK A;  4QOZ B;  4LY7 A;  3EEQ A;  4DR7 K;  2IDO A;  1A5V A;  1IG9 A;  4MO5 A;  3KK7 A;  3D7E O;  4DTO A;  4CJP A;  4BRA A;  2IS3 A;  4XIU A;  5GIN A;  2YNG A;  3NE6 A;  4IJA A;  2P1J A;  1XUP O;  3EKS A;  4L3Q A;  4UY8 O;  2G8I A;  5LJV A;  1S1T A;  3T7Z A;  5E26 A;  2P9U A;  5BRE A;  3W0L A;  5I42 A;  4E7L A;  3DXK A;  2VG6 A;  4YOV A;  3CMA N;  2BUP A;  5AZI B;  5TKY A;  4FVM A;  4N41 A;  1SUQ A;  1W0H A;  2FSK A;  1EWR A;  4LF4 K;  1RTH A;  2VGN A;  4WYB A;  3J7Y P;  2ITG A;  4JK8 A;  4B9N A;  1LW0 A;  1HQU A;  1Y64 A;  4OPJ A;  4CED A;  1TK0 A;  2HMI A;  1HRH A;  2FXU A;  4CJT A;  1BA1 A;  1NK5 A;  3MMV A;  1S1X A;  1HQE A;  3LDN A;  2GWK A;  4JK9 A;  4JKE A;  2DFH A;  5AQG A;  3DLL L;  4DUY K;  3SNN A;  4NB4 A;  4LFB K;  4BVP A;  4DS5 A;  2YI1 A;  3VEN A;  3FZL A;  3VGM A;  3AA2 A;  4BQZ A;  4LFA K;  4E89 A;  3AAQ A;  3RVC A;  1C6V A;  1K9M O;  2OPS A;  5KGX A;  4QS8 A;  4CGF A;  2QWM A;  4NLB A;  5D3G A;  1Q8I A;  4DU4 A;  1IBL K;  4GVM A;  4JI5 K;  3SUN A;  3F5T A;  4FLW A;  4DTP A;  2ZF5 O;  3EE8 A;  3THX B;  3O3H A;  1Q86 O;  4DQI A;  3RTV A;  3VET A;  2P9L A;  2A5X A;  1L3U A;  1RDA A;  1VQ5 N;  4H5T A;  4HTL A;  3TAE A;  1QQO A;  3S3O A;  1CXQ A;  1HLU A;  3V9U A;  4C8L A;  5AQF A;  3OS0 A;  1XC9 A;  1RTD A;  3DJC A;  1L3V A;  4BDZ A;  4BRM A;  1QQM A;  3LL3 A;  4BR7 A;  3FLC O;  3VEV A;  3CCS N;  4LF7 K;  2Z1J A;  5AQT A;  2Q1N A;  4IFY A;  3L4I A;  3ZT4 A;  3NDK A;  4YNQ A;  3QIP A;  4FM0 A;  4FLY A;  4CJE A;  1NK4 A;  4XH1 A;  1NM1 A;  3T69 A;  5BPM A;  4DSJ A;  1NMD A;  3KIO A;  4OKK A;  4WFB L;  2IGI A;  5AZI A;  5JLF A;  1HUX A;  2DY4 A;  4RTF D;  3WXM B;  4CJK A;  2WC9 A;  2ZWH A;  5TKW A;  4CZJ A;  4FZX C;  1RTI A;  2EX3 A;  1D4X A;  3ZYY X;  1RDB A;  3MEE A;  3H6E A;  3CCU N;  3TAN A;  4RW7 A;  3OS2 A;  4A61 A;  2ASM A;  4QS9 A;  2XY6 A;  3BZK A;  4J2D A;  5JVH L;  3SJJ A;  3CFO A;  4KH4 A;  3VF6 A;  4DTJ A;  3E9L A;  4AM6 A;  4RWT A;  4H0V B;  4JNE A;  1EKE A;  3ZSR A;  4KV8 A;  3J80 O;  3QB0 A;  3G0Z A;  3V1Q A;  3ENH A;  2GV9 A;  3KK3 A;  2VQE K;  4X65 K;  3K2P A;  4DTX A;  4J2E A;  2GUP A;  3LWL A;  3GG4 A;  2QWP A;  1A5X A;  1BO5 O;  4A2A A;  4AM7 A;  2E88 A;  5C12 A;  2CGK A;  3IFR A;  1RTJ A;  1NG9 A;  5C24 A;  4OO1 J;  1N5Y A;  4DSI A;  2RKI A;  4H4O A;  4MLH A;  3H1Q A;  3T1A A;  4AHT A;  4ID5 A;  2ZM6 K;  4Y0W A;  4CBW A;  3CPE A;  2W41 A;  3BY5 A;  4H5R A;  3AVL A;  1ZBU A;  4BE1 A;  1NK8 A;  3B6O A;  4JYA K;  3T19 A;  5BPN A;  2QWO A;  5E84 A;  3HYF A;  1WSE A;  1EP4 A;  5J2N A;  2A41 A;  4BWJ A;  4Q0B A;  4CK2 A;  4KHQ A;  4O0J A;  1VQK N;  1EX4 A;  5AFU A;  3CCJ N;  2DTU A;  2A40 A;  4GW6 A;  4FPA A;  4B9U A;  3CJ1 A;  1FK9 A;  4JI1 K;  3OYB A;  4JS4 A;  1Q81 O;  3CC7 N;  2P9P B;  3HOT A;  2X6S A;  1JCE A;  4DV5 K;  3IAY A;  3K0S A;  3HSC A;  4IOX A;  2V7Y A;  4DR6 K;  4DV0 K;  2KZZ A;  1Z26 A;  3H3O B;  4FL9 A;  5F0X A;  1ESV A;  1ATS A;  3DMJ A;  4IG3 A;  4CGD A;  1GLJ O;  2W6K A;  3OYH A;  4IO8 A;  1NWK A;  3ITH A;  4O5B A;  3AVI A;  2Q2R A;  4H5N A;  3KLI A;  4ILJ A;  1U2V A;  1VSH A;  3ULD A;  1J5O A;  2E8A A;  1BWF O;  2GWJ A;  3VQD A;  1RBV A;  1KC8 O;  1OH7 A;  3F2K A;  3E66 A;  4LF9 K;  4M3U A;  3LDL A;  1G15 A;  2D0C A;  1ATR A;  4YHH K;  1QVF M;  4H5W A;  3NVM A;  1SKR A;  4BRC A;  4BC2 A;  3GL1 A;  4U67 L;  3OBW A;  1P90 A;  1NGA A;  3DRR A;  3R6M A;  3TTF A;  1SV5 A;  4YOT A;  1BIZ A;  3AVJ A;  1VQM N;  2GEM A;  4JRP A;  4FWO A;  1C1B A;  4ELT A;  5CYM A;  4I2P A;  4KBO A;  4Y1C A;  4I7F A;  5GAE P;  2NRH A;  5C15 A;  4CJR A;  4JHD A;  1GOB A;  1LW2 A;  1IG8 A;  3WNE A;  4DR2 K;  4HUG A;  3I33 A;  1GLC G;  3MK6 A;  2V51 B;  4A5A A;  4FZY A;  4I9Q A;  3EN9 A;  1YTA A;  4CJ5 A;  1QSS A;  2FC0 A;  5HL7 L;  3L2R A;  1YIT N;  4B9V A;  1VQP N;  4FPB A;  1RGI A;  2R7Y A;  4NO7 A;  3OA9 A;  4CF2 A;  5CZ1 A;  4CER A;  1VSM A;  1GLA G;  1TVR A;  1YVN A;  1VHX A;  2ZE2 A;  3OYJ A;  3ENB A;  3EYZ A;  1UA0 A;  4EZ9 A;  3ZT3 A;  1NK7 A;  1UWB A;  1TKD A;  2Y1I A;  3AGK A;  5AQO A;  3CJC A;  5AQW A;  4EHU A;  4BG8 A;  3CC2 N;  4JI4 K;  3V9Z A;  5AQK A;  1SAZ A;  1VSI A;  2OZM A;  1MU2 A;  3FZF A;  4BRO A;  2CH5 A;  3ZSX A;  2W42 A;  3FGU A;  4JI6 K;  2P9P A;  5AQH A;  1CLQ A;  1I94 K;  3P83 D;  1TKX A;  2QKB A;  3UKU A;  1KCF A;  4CEQ A;  5LMN K;  2OPR A;  1RT5 A;  1QHA A;  1UA1 A;  3ZT1 A;  2I7P A;  3DLK A;  4CIF A;  5EXW A;  4CEB A;  1MWM A;  3KK2 A;  4KHP K;  3G71 N;  3NF9 A;  3SZ2 A;  5AZJ A;  1N6Q A;  1C0T A;  5M1Q A;  3SAG A;  2WBN A;  1XNR K;  2JGU A;  4O44 A;  3OYA A;  4FJI A;  3CJ9 A;  5HRN A;  4EHT A;  3LZJ A;  3Q7C A;  4PKG A;  1JLF A;  4A5B A;  1KD1 O;  1BUP A;  2HHT A;  3P4I A;  3U3Y A;  5AQI A;  2HBJ A;  3UE5 A;  4IZ9 A;  1LWE A;  2ETJ A;  1JLB A;  2G8K A;  1N36 K;  4AHV A;  4JLH A;  4BR5 A;  4NYF A;  2Q0R A;  5I3U A;  3O9Q A;  4B1Z A;  2IAJ A;  5M1N A;  3M8R A;  4LF6 K;  1YI2 N;  4BRN A;  3S3N A;  3G10 A;  3ZX0 A;  1Z25 A;  1BCM A;  3ZSV A;  2OAN A;  4Z4I A;  1LCU A;  3KJV A;  1YUW A;  1VAZ A;  3V1O A;  1NKB A;  3NBP A;  1NGB A;  4B3M K;  1Y97 A;  3ZEU B;  3DLH A;  3CF5 L;  3NF8 A;  4BRE A;  4J2B A;  3DXM B;  4H0X B;  2WFB A;  3OS1 A;  3SQ2 A;  3VTH A;  4EP4 A;  4FJJ A;  3QER A;  4GKK K;  4K43 A;  3C6U A;  3AVN A;  1BIU A;  3WEE B;  1HJR A;  3WNG A;  5MLC Q;  4DV2 K;  1F21 A;  4H4M A;  1RT3 A;  1U04 A;  2QI2 A;  3VGL A;  3WQU A;  4PL7 A;  4J2A A;  4M3Y A;  4BC5 A;  4OPA A;  1X1P A;  4BRL A;  3O08 A;  4NCB A;  4JV5 K;  1B9F A;  4FXD A;  4QCL A;  3VES A;  5T7B A;  4IEI A;  2KKZ A;  4OX9 K;  4FJ5 A;  1T3V A;  1NBW A;  5FPN A;  4EP5 A;  3FE1 A;  4CHP A;  4PA1 A;  4BQL A;  5H1S Q;  4Q5V A;  3O80 A;  3KTQ A;  4FWQ A;  3VEZ A;  3AVK A;  1JCG A;  2UXD K;  2A42 A;  2I7N A;  3WUH A;  1T7P A;  5KPZ A;  3KD1 E;  5FPM A;  4NXN K;  1TAU A;  4CZI A;  4C1N K;  4MLE A;  1KVA A;  3MAQ A;  2FBV A;  4I6M A;  4KHY A;  1LAW A;  3K9K A;  3KLF A;  4N5S A;  3CJB A;  2H3G X;  5I9E B;  1S72 N;  4B3S K;  3DXK B;  3B6P A;  4YFU A;  4CJF A;  2IVN A;  3HOS A;  3TWH A;  3L6Q A;  3ZLJ A;  4B9M A;  3P31 A;  2YHW A;  3TR8 A;  4CGJ A;  4DQR A;  1KSP A;  4WQ4 C;  3K59 A;  3SUQ A;  4F3O A;  5FRO A;  4WQ4 A;  4EFH A;  1YJ9 N;  3C95 A;  4JI3 K;  3AAP A;  1D9D A;  2FF6 A;  4FLU A;  3HPH A;  5GAD P;  1ZC6 A;  2WUS A;  5JLH A;  4GVE A;  4DR3 K;  3VQ5 A;  3PX6 A;  3DLR A;  3JYT A;  5AQJ A;  1SS6 A;  4KH5 A;  3LP3 A;  4JD2 A;  3OYD A;  5EVZ A;  5FLX O;  1WOQ A;  4JKC A;  4CZL A;  3ZSO A;  3DXM A;  5IWA K;  4CK1 A;  1MA9 B;  2VCP A;  1JJ2 M;  3CQ8 A;  3QIO A;  1X9M A;  2UUA K;  4DQS A;  2NLX A;  4ID1 A;  5CY4 A;  1HR0 K;  3QFU A;  3I56 N;  4Z0U A;  1WAJ A;  3LWM A;  3O9T A;  2OPQ A;  3LAN A;  3WEE A;  3IMX A;  3HST B;  3WXI A;  4BAC A;  3IDH A;  3CQX A;  4KI4 A;  4W5O A;  2XY8 A;  3HK2 A;  1HYS A;  1S3X A;  4CZF A;  1L5U A;  2HOE A;  3CG7 A;  3VQ8 A;  4B1W B;  4A2B A;  4CF8 A;  2G8F A;  5F1X A;  4CF0 A;  4QAG A;  1YHQ N;  2D0O A;  2AJQ A;  3CIP A;  4HCB A;  3H45 C;  4BR4 A;  3QEV A;  3T1Y K;  3CCQ N;  2V7Z A;  1TL1 A;  2PAV A;  1ZBS A;  2G8W A;  3QO9 A;  3OYF A;  1KAZ A;  1TYQ A;  1S1U A;  4KAZ A;  3LZI A;  3DLE A;  2QWL A;  4CHQ A;  2G8H A;  3VQA A;  4KB0 A;  3VEO A;  1RT6 A;  4B08 A;  4DV1 K;  2E2P A;  5AQX A;  3BUZ B;  1NU0 A;  3CPW M;  3P5J A;  4NCG A;  5AQY A;  4M3X A;  1D5A A;  5AJ3 K;  4FM1 A;  4BGA A;  4AHU A;  2HNY A;  4EIA A;  3ENO A;  4E0D A;  4YOU A;  2HHU A;  1NJX A;  5E41 A;  1J6Z A;  1RBU A;  4CIG A;  2Q97 A;  3THW A;  3SBT A;  1VQ7 N;  1VK0 A;  4DR5 K;  3I8D A;  3DM2 A;  4LFC K;  4CJQ A;  3IG1 A;  3ZSQ A;  2XY5 A;  3VQ4 A;  4CEO A;  4JKB A;  3SQ4 A;  3O5B A;  4DR4 K;  1SL1 A;  1YVU A;  1IBK K;  2X74 A;  2PBD A;  4W5N A;  2PZS A;  3A5L C;  3D0P A;  3MN6 A;  1JLE A;  5KRS A;  4DSE A;  3AO5 A;  1RT1 A;  3THY A;  4BRP A;  4DTU A;  3A2F A;  4LC9 B;  1U4B A;  2NZT A;  1JXE A;  4FK2 A;  3RMC A;  1NJZ A;  2D0A A;  2YNI A;  2FBX A;  2GTD A;  3OYC A;  3GE1 A;  5AQN A;  2F8S A;  4E19 A;  3HVT A;  3O9R A;  4CFB A;  3O4W A;  2BGG A;  1H1V A;  2GBZ A;  3J81 O;  2W40 A;  1QTM A;  3NH0 A;  2UYT A;  3LP1 A;  1HX1 A;  4FJG A;  3MEG A;  3CD6 N;  4FVU A;  5M1O A;  5KQ8 A;  4H0P A;  3CCE N;  3NHG A;  3A8Y A;  1ZBL A;  4O8U A;  4B1U B;  3M5R A;  3HP6 A;  4YOR A;  3O8M A;  2YNF A;  4M7X A;  2F9T A;  2QXL A;  3S3M A;  4EZ6 A;  3GDQ A;  5LL6 Z;  1OKJ A;  3EL2 A;  1CZ9 A;  1WN7 A;  4FJN A;  2LSN A;  4AH9 A;  3SQ0 A;  1TAQ A;  4BC4 A;  4CHN A;  3K5L A;  3VF4 A;  3E1Y A;  3NAE A;  4K8Z A;  1XQS C;  4DTM A;  3MN9 A;  4FW2 A;  2WOM A;  2QWN A;  1MDU B;  3O4Q A;  3TAM A;  1TK5 A;  3OW2 M;  4FJL A;  5DK5 A;  1C1C A;  1FKP A;  1DKG D;  1WNS A;  1RT4 A;  1L3S A;  3IS9 A;  2D1K A;  3OYI A;  1CXU A;  1SKW A;  3QNN A;  4YY3 K;  4R5P A;  2FF3 B;  3L3U A;  5LY3 A;  4DV3 K;  5DM7 L;  4KRF A;  1NKE A;  1U2V B;  4LH4 A;  1K8K A;  3LPT A;  1DTQ A;  2KFN A;  4KHW A;  1RDW X;  1T05 A;  2NRV A;  3CFP A;  4A62 A;  3CC4 N;  4IDH A;  3VA0 A;  1XMQ K;  4FLZ A;  2VG5 A;  1Z6R A;  3AA5 X;  4MQ3 A;  1BDG A;  3AA3 A;  3SV3 A;  3V9X A;  1J5E K;  1RCH A;  3HO1 A;  3O6W A;  3U3G A;  1UOC A;  1P8Z A;  3WT0 A;  5C42 A;  3G4S N;  3TAQ A;  3AO3 A;  4E7K A;  3SQ1 A;  2YCH A;  4JHD B;  4O4G A;  5LJW A;  2FSJ A;  5FRM A;  4FSV A;  1C0U A;  1J54 A;  4B3O A;  4CF1 A;  4DFJ A;  3LDQ A;  4CES A;  3CQY A;  2ASP A;  3RR7 A;  3PO4 A;  4H0O A;  3QEX A;  4KTW A;  2IVO A;  4MDB A;  2ATQ A;  3TAR A;  3H3N O;  2F96 A;  4FWS A;  3T3F A;  3PO5 A;  3VQ6 A;  1NJY A;  2VWB A;  1RT7 A;  4AHC A;  3AAR A;  4BRD A;  3LP0 A;  3CME N;  4DFM A;  3UIQ A;  3M1F A;  3W3D A;  3I0R A;  2E20 A;  1Q18 A;  5AFU H;  2WON A;  3MXJ A;  3MWP A;  4IO9 L;  3RMB A;  2HBM A;  1KAX A;  4DFP A;  1TL3 A;  3L3V A;  4JK7 A;  3MDQ A;  3E9P A;  2NRR A;  3NH2 A;  5KQD A;  3M8P A;  3ID6 A;  3L2U A;  3S41 A;  3UKU B;  5AQP A;  1KAY A;  5KTQ A;  3AVH A;  3PSF A;  1BL3 A;  4V19 S;  3TSQ A;  4B3R K;  3K5N A;  2EWS A;  3VQ9 A;  2OA8 A;  1HJO A;  4NLC A;  3QEW A;  5AZJ B;  1WLJ A;  4CD3 A;  3PY8 A;  3AVB A;  4JAX A;  1QZ5 A;  4CZH A;  5C2D A;  3MX5 A;  3EY1 A;  3DOL A;  1X9W A;  2X6N A;  4CJV A;  4F2R A;  3C65 A;  3FZK A;  3QLH A;  2YKM A;  3VN5 A;  1BCO A;  2YJF A;  3MEC A;  4PKH A;  3SYZ A;  1CZA N;  4FCY A;  3LP2 A;  2O4I A;  4RW8 A;  4BY9 C;  5AQZ A;  3E01 A;  4JRQ A;  4G9Z A;  4NYN A;  4B8A B;  1RBR A;  1JLG A;  3PX0 A;  3NGI A;  3FFK B;  1DEJ A;  2NRZ A;  2XHB A;  3AVA A;  1S6Q A;  3JXU A;  1TV6 A;  3R3L A;  3HRG A;  4HHT A;  3U9Z A;  1IBM K;  3DAW A;  1OH5 A;  1RIL A;  4Z4H A;  4N76 A;  3M8Q A;  4O55 A;  2QK9 A;  5A2Q O;  3VEX A;  3OHR A;  4BRH A;  4KPY A;  1WBD A;  1VQL N;  4GY2 B;  1BQN A;  3NGY A;  3MCA B;  3HZ6 A;  4CVN E;  1JKH A;  3A5O C;  4XH5 A;  4WQ5 C;  2Z1H A;  4JKA A;  4WQ5 A;  1ZBH A;  1HKC A;  4BR2 A;  4B1X B;  1NJI O;  1B9D A;  5BN9 A;  3TAP A;  4M45 A;  2Y1J A;  3ZET A;  1YF5 L;  3RSE A;  4OPK A;  1T8E A;  1BIS A;  4CJL A;  3VQP A;  2OYQ A;  1GOC A;  2P9I A;  4CD1 A;  1BA0 A;  2P9N B;  4W5R A;  2FBT A;  5M1P A;  4PKI A;  3VGK A;  5AQQ A;  4B9S A;  5JIC A;  4CJ7 A;  1HNZ K;  2Q3S A;  5BRD A;  2Z1I A;  2GUI A;  4B1Y B;  1D9F A;  1RT2 A;  3M3Z A;  1NNE A;  3AO2 A;  3CCM N;  4M63 C;  3RRH A;  4BE2 A;  3S9H A;  3CXC M;  5BRF A;  2KLA A;  4OGE A;  2P9K B;  3VA3 A; 
#chains in the Genus database with same CATH homology
 1LV5 A;  4FZZ A;  1NK0 A;  1D8Y A;  2DFH A;  5JS1 A;  3TWH A;  1IKY A;  3SNN A;  4B9M A;  3FFI A;  1RBS A;  3TR8 A;  3SPY A;  4CGJ A;  4DQR A;  4DS5 A;  1KSP A;  3K59 A;  3SUQ A;  4F3O A;  5FRO A;  2OPP A;  3QES A;  2NUB A;  5CYQ A;  3AA2 A;  3DLB A;  1KVB A;  1S9G A;  1SL2 A;  4E89 A;  5EU7 A;  3C95 A;  3HXM A;  1C6V A;  1D9D A;  4ZHR A;  3ZT2 A;  4FLU A;  2OPS A;  3HPH A;  5KGX A;  4CGF A;  2JLE A;  2YNH A;  1U48 A;  3VQ5 A;  3PX6 A;  5D3G A;  2KFZ A;  3DLR A;  4CE9 A;  3VQQ A;  1Q8I A;  1KLM A;  2HB5 A;  3QIN A;  3JYT A;  4IG0 A;  3SV4 A;  4DU4 A;  2G8V A;  3AVF A;  1HYZ A;  4GVM A;  1JLA A;  3LP3 A;  4I2Q A;  3ZCM A;  3AV9 A;  3SUN A;  2P5G A;  2HNZ A;  4UQG A;  3V9S A;  1NJW A;  4FLW A;  3JSM A;  3V81 A;  4HVJ A;  2XY7 A;  4RW6 A;  3L2V A;  4HUF A;  2ZD1 A;  4DTP A;  4AHR A;  4H8K A;  5HBM A;  5SWM A;  4N47 A;  3OYD A;  4DTR A;  3O3H A;  4DQI A;  4LSL A;  3RTV A;  3ZSO A;  4AIL C;  3HP9 A;  4CK1 A;  1L3U A;  1RDA A;  1JLC A;  1JLQ A;  4IFV A;  3CQ8 A;  4FLX A;  3QIO A;  4LD0 A;  1X9M A;  4DQS A;  4F4K A;  4ID1 A;  5CY4 A;  5JS2 A;  2BAN A;  3TAE A;  3S3O A;  4Z0U A;  1CXQ A;  1WAJ A;  4FJ8 A;  3LWM A;  4FW1 A;  4DF4 A;  1FKO A;  2OPQ A;  3LAN A;  1S1V A;  1EXQ A;  3O4N A;  4Z4C A;  3NCI A;  3V9U A;  2OZS A;  4C8L A;  1HMV A;  3HST B;  4IBN A;  4BAC A;  3OS0 A;  1XC9 A;  1RTD A;  5FDL A;  4FJ7 A;  1ZBF A;  2YHA A;  4BDZ A;  4M3R A;  1WSJ A;  4W5O A;  3SPZ A;  1L3V A;  3AO1 A;  2XY8 A;  4KI4 A;  4E7H A;  3HK2 A;  1HYS A;  4FM2 A;  2HW3 A;  4DFK A;  1RBT A;  1RNH A;  4L8R B;  4M3T A;  4DU3 A;  1BI4 B;  5HRR A;  1L5U A;  1XHX A;  2Z1J A;  3CG7 A;  3VQ8 A;  1BGX T;  5HRS A;  2QKK A;  4IFY A;  4CFA A;  4HTU A;  4KHS A;  1L3T A;  4CHY A;  3ZT4 A;  3NDK A;  4YNQ A;  3BGR A;  3QIP A;  4FM0 A;  4FLY A;  3HVR A;  4F8R A;  1YT3 A;  4CJE A;  5HRO A;  4DU1 A;  4CF8 A;  4E7I A;  3TAF A;  4DTN A;  2X78 A;  4CFD A;  1IKW A;  3LAM A;  2G8F A;  4KI6 A;  4CF0 A;  3K5O A;  4QAG A;  3KIO A;  2EHG A;  4DSJ A;  1RDD A;  1C1A A;  4OKK A;  2AJQ A;  3V9W A;  3EZ5 A;  4HCB A;  2E6M A;  2IGI A;  3C6T A;  2DY4 A;  3QEV A;  4CJK A;  4M42 A;  4B9T A;  1TL1 A;  3OYE A;  3RR8 A;  4KKO A;  1IKX A;  4FJK A;  2G8W A;  4FZX C;  3KKR A;  1QS4 A;  1RTI A;  3QO9 A;  2EX3 A;  3OYF A;  1Q9X A;  3AVG A;  1S1U A;  3DRS A;  4O0I A;  1TKT A;  1RDB A;  3CM6 A;  3MEE A;  4KAZ A;  3LZI A;  4FLV A;  3QET A;  3DLE A;  4KFB A;  4CFC A;  1TGO A;  1S9E A;  4RW7 A;  3OS2 A;  4CHQ A;  3TAN A;  1KFD A;  2XY6 A;  1NOY A;  4PWD A;  4J2D A;  4C8O A;  3SJJ A;  5J2M A;  2G8H A;  3CFO A;  4FK0 A;  3VQA A;  4DTJ A;  4KB0 A;  1HYV A;  1RT6 A;  4B08 A;  3I0S A;  1EKE A;  3OYM A;  1IH7 A;  3ZSR A;  3ZSY A;  4KV8 A;  1TKZ A;  3V1Q A;  3G0Z A;  2GV9 A;  3KK3 A;  4M3W A;  3P5J A;  1LAV A;  3K2P A;  4DLE A;  4DTX A;  4NCG A;  1TK8 A;  4J2E A;  3LWL A;  4M3X A;  1D5A A;  1QHT A;  5HP1 A;  4FM1 A;  1A5X A;  4AHU A;  4TSX A;  2HNY A;  4E0D A;  4PY5 A;  1KVC A;  2HHU A;  5SZT A;  2E4L A;  2HND A;  1NJX A;  5E41 A;  5DMR A;  4OJR A;  4ZTF A;  3MED A;  1RTJ A;  3ALY A;  1RBU A;  4CIG A;  5C24 A;  3C94 A;  1FXX A;  1QQC A;  4CEC A;  1N5Y A;  4DSI A;  1ASW A;  1XI1 A;  2RKI A;  4H4O A;  1VK0 A;  3I8D A;  3T1A A;  3DM2 A;  4CJU A;  4AHT A;  4KHN A;  3TI0 A;  4FJH A;  4ID5 A;  4CJQ A;  3IG1 A;  4FK4 A;  2RPI A;  3NF7 A;  4DSK A;  4BDY A;  1SKS A;  4KTQ A;  4FLT A;  3ZSQ A;  2XY5 A;  3VQ4 A;  4CEO A;  2A1S A;  3SQ4 A;  3CM5 A;  3AVL A;  4ZTJ A;  1ASU A;  1ZBU A;  4BE1 A;  1NK8 A;  3B6O A;  1YVU A;  4C8N A;  3NGZ A;  1SL1 A;  2X74 A;  4W5N A;  4CJS A;  3T19 A;  4CGG A;  1U45 A;  2PZS A;  4ELU A;  3D0P A;  1JLE A;  5KRS A;  4DSE A;  3AO5 A;  1RT1 A;  4DTU A;  4B9L A;  3WNF A;  3HYF A;  3A2F A;  1WSE A;  1EP4 A;  3PUF A;  1U4B A;  1JXE A;  3SI6 A;  4IDK A;  3RMC A;  3SCX A;  3MXI A;  4FK2 A;  1NJZ A;  2D0A A;  3D45 A;  4C8M A;  1J9A A;  4BWJ A;  5J2N A;  2YNI A;  2FBX A;  3KLH A;  3OYC A;  4DQQ A;  4Q0B A;  1K6Y A;  4CK2 A;  4ELV A;  4KHQ A;  1KLN A;  3BDP A;  4O0J A;  1EX4 A;  3K58 A;  2F8S A;  4E19 A;  2DTU A;  3HVT A;  3V6D A;  4GW6 A;  4CFB A;  1KFS A;  4B9U A;  2BGG A;  1FK9 A;  2GBZ A;  3OYB A;  4JS4 A;  4JS5 A;  2X6S A;  1QTM A;  3NH0 A;  4FYD A;  3LP1 A;  1BI4 A;  4FJG A;  3MEG A;  3IAY A;  1WSI A;  3IRX A;  1BHL A;  4BDP A;  4DWI A;  4OLA A;  4K8X A;  3DI6 A;  1VSF A;  3SUO A;  1VRU A;  1RDC A;  4RG8 A;  3VQE A;  3RWU A;  2KZZ A;  1Z26 A;  3NHG A;  3LDS A;  4RW4 A;  3LAL A;  1ZBL A;  4Z4F A;  2KZM A;  2KQ2 A;  3HP6 A;  2YNF A;  4DMN A;  3KD5 E;  3DMJ A;  3L8B A;  4IG3 A;  4CGD A;  2A1R A;  4ICL A;  3S3M A;  4IKF A;  2YKN A;  3OYH A;  4EZ6 A;  4KB1 A;  4FJN A;  1I3A A;  1CZ9 A;  1WN7 A;  3ITH A;  1VRT A;  3AVI A;  2LSN A;  4O5B A;  3KLI A;  4AH9 A;  4F3T A;  3SQ0 A;  1TAQ A;  4CHN A;  3K5L A;  1VSH A;  3ULD A;  4CHZ A;  1J5O A;  3NAE A;  4K8Z A;  2IC3 A;  4OKJ A;  4DTM A;  3VQD A;  1RBV A;  2DFF A;  1S1W A;  3DYA A;  4FW2 A;  5CZ2 A;  2WOM A;  4M3U A;  1G15 A;  2D0C A;  4CEE A;  3O4Q A;  3TAM A;  4I9L A;  3KLG A;  3LAK A;  3PV8 A;  1SKR A;  1QE1 A;  1TK5 A;  4FJL A;  4PQU A;  5DK5 A;  4F2S A;  1C1C A;  1FKP A;  1WNS A;  4KO0 A;  4CJW A;  4BE0 A;  1RT4 A;  1L3S A;  3IS9 A;  4HCC A;  3DRR A;  1XWL A;  1CXU A;  4Y1D A;  3OYI A;  4DTS A;  3QNN A;  1SKW A;  4NCA A;  4R5P A;  1SV5 A;  4DS4 A;  3V4I A;  2OYQ A;  3L3U A;  1WAF A;  1BIZ A;  1NK6 A;  3AVJ A;  4KRF A;  4JRP A;  1NKE A;  1C1B A;  4LH4 A;  3LPT A;  4OKE A;  4ELT A;  1DTQ A;  3OYL A;  2KFN A;  2D5R A;  4KHW A;  1C0M A;  5CYM A;  2VWJ A;  4I2P A;  4Y1C A;  4I7F A;  1U49 A;  3RRG A;  1T05 A;  3OJU A;  3LPU A;  4FJM A;  2YHB A;  2KW4 A;  4CJR A;  1A5W A;  1B92 A;  3DOK A;  1GOB A;  3CFP A;  4Z4E A;  1LW2 A;  1HNV A;  3OJS A;  3WNE A;  3VA0 A;  4HUG A;  3M8S A;  2VG5 A;  4FLZ A;  3AA5 X;  4C8K A;  3SUP A;  2XO7 A;  4MQ3 A;  1Q9Y A;  1DTT A;  3AA3 A;  3V1R A;  3SV3 A;  3V9X A;  4FZY A;  4I9Q A;  3ASM A;  3HL8 A;  3ZT0 A;  3OYN A;  1YTA A;  4CJ5 A;  1QSS A;  4Z4G A;  4E1N A;  3HPG A;  5C25 A;  4CCH A;  2FC0 A;  1RCH A;  4HUE A;  3HO1 A;  3U3G A;  3L2R A;  1WSH A;  1UOC A;  4B9V A;  2R7Y A;  4CEA A;  2BE2 A;  4CF2 A;  1HPZ A;  5C42 A;  5CZ1 A;  4CER A;  1VSM A;  2RF2 A;  4DQP A;  4CGH A;  1TVR A;  2RN2 A;  3TAQ A;  3OYJ A;  2ZE2 A;  3AO3 A;  4E7K A;  4LSN A;  3SQ1 A;  3EYZ A;  5J2Q A;  1UA0 A;  3ZSW A;  3KKS A;  2KTQ A;  4O4G A;  4EZ9 A;  1VSL A;  3ZT3 A;  3OVN A;  1UWB A;  4E7J A;  1NK7 A;  1X9S A;  3ZSZ A;  1TKD A;  1C0U A;  5FRM A;  2HHS A;  2Y1I A;  1J54 A;  2I5J A;  4CF1 A;  4DLG A;  4DFJ A;  4B3O A;  3TAG A;  4W5T A;  3NFA A;  1U47 A;  3AA4 A;  4FJX A;  4CES A;  3V9Z A;  2G8U A;  2VWK A;  3HJF A;  3RR7 A;  1W9H A;  2QXF A;  1VSI A;  4LH5 A;  4CGI A;  1NOZ A;  3PO4 A;  2OZM A;  1IKV A;  1MU2 A;  4KTW A;  3QEX A;  3ZSX A;  2HHW A;  2W42 A;  2FBY A;  1YTU A;  1ITG A;  2ATQ A;  4OLB A;  3TAR A;  1CLQ A;  1KRP A;  3OYK A;  4RW9 A;  4WE1 A;  3P83 D;  3RMD A;  2F96 A;  3AVM A;  3T3F A;  1TKX A;  1KTQ A;  3RMA A;  3VQ6 A;  3PO5 A;  2QKB A;  1KCF A;  4CEQ A;  1RT7 A;  2OPR A;  1RT5 A;  3P1G A;  3DLG A;  4AHC A;  1NJY A;  1UA1 A;  5HRP A;  3ZT1 A;  5KI6 A;  3DLK A;  3OY9 A;  3LP0 A;  4CIF A;  3OYG A;  4DFM A;  3THV A;  3CFR A;  1XHZ A;  3UIQ A;  1WSG A;  3I0R A;  1WSF A;  4CEB A;  2XRI A;  3O3G A;  3KK2 A;  2B6A A;  4M3Z A;  2HHV A;  2HHQ A;  3K5M A;  3PX4 A;  2WON A;  1EET A;  3MXJ A;  3NF9 A;  3SZ2 A;  1S6P A;  3U6F A;  3RMB A;  1N6Q A;  4MFB A;  4DFP A;  3WNH A;  1C0T A;  1TL3 A;  2Z1G A;  4CF9 A;  3L3V A;  1CZB A;  4E1M A;  2PYJ A;  4OVL A;  3K57 A;  1QSY A;  2JGU A;  4KRE A;  4O44 A;  3VQ7 A;  1UAX A;  4DG1 A;  3NH2 A;  3M8P A;  3OYA A;  3AO4 A;  4FJI A;  5HRN A;  3L2U A;  3LZJ A;  1LWC A;  1JLF A;  3HPO A;  1VSD A;  5J1E A;  5KTQ A;  4CIE A;  3AVH A;  3CYM A;  5FRN A;  2HHT A;  4B8C A;  1BL3 A;  1JL2 A;  3U3Y A;  4CK3 A;  3K5N A;  2PY5 A;  1LWE A;  2ETJ A;  1R0A A;  1JLB A;  3F9K A;  3VQ9 A;  1ZYQ A;  2OA8 A;  2G8K A;  1LWF A;  4AHV A;  3QEW A;  4CJ4 A;  1NKC A;  1O1W A;  1S5J A;  1WLJ A;  4JLH A;  3QEI A;  4NYF A;  4KHU A;  3MXM A;  3PY8 A;  3KK1 A;  4CJ3 A;  3AVB A;  5I3U A;  2E6L A;  1JL1 A;  1REV A;  1VSJ A;  2IAJ A;  4W5Q A;  3M8R A;  3EY1 A;  3DOL A;  4GMJ B;  4CEZ A;  1X9W A;  2PYL A;  4PUO A;  2X6N A;  3S3N A;  4CJV A;  2IOC A;  4F2R A;  3G10 A;  3QLH A;  3ISN C;  1Z25 A;  2YKM A;  3VN5 A;  1BCO A;  2BDP A;  3MEC A;  4AHS A;  1BCM A;  3SYZ A;  3ZSV A;  3O3F A;  4Z4I A;  2B4J A;  2O4G A;  3LP2 A;  3KJV A;  4FCY A;  2O4I A;  4RW8 A;  1ZBI A;  4M41 A;  3VQC A;  2P51 A;  3E01 A;  3NH1 A;  3F73 A;  3V1O A;  1NKB A;  4JRQ A;  3NBP A;  2ZQB A;  3KLE A;  5HLF A;  1BQM A;  2YV0 X;  4NYN A;  3L2Q A;  4DSL A;  4B8A B;  1RBR A;  1JLG A;  1Y97 A;  3PX0 A;  3DLH A;  3NGI A;  1GOA A;  3HT3 A;  1NK9 A;  3TAB A;  5K14 A;  2XHB A;  3NF8 A;  3AVA A;  1HNI A;  4KTZ A;  1S6Q A;  4J2B A;  4N56 A;  1TV6 A;  3OS1 A;  3NF6 A;  1VSK A;  4HHT A;  3SQ2 A;  4EP4 A;  1I39 A;  4FJJ A;  5KGW A;  3QER A;  1IO2 A;  4BWM A;  2B5J A;  3C6U A;  1VSE A;  1JXB A;  3AVN A;  1RIL A;  1QSL A;  4QOZ B;  4LY7 A;  4Z4H A;  4N76 A;  3M8Q A;  4O55 A;  2IDO A;  2QK9 A;  1BIU A;  1A5V A;  4KPY A;  1IG9 A;  4DTO A;  1T03 A;  4CJP A;  1HJR A;  3WNG A;  2IS3 A;  4XIU A;  1F21 A;  1BQN A;  1SL0 A;  4DF8 A;  3NGY A;  4H4M A;  1RT3 A;  1U04 A;  4DSF A;  2YNG A;  4G1Q A;  3NE6 A;  1JKH A;  2P1J A;  3QNO A;  4J2A A;  4M3Y A;  1X1P A;  2Z1H A;  2F8T A;  4NCB A;  1B9F A;  2G8I A;  4FXD A;  4QCL A;  1ZBH A;  1S1T A;  2DFE A;  5T7B A;  1B9D A;  2VG7 A;  3TAP A;  4M45 A;  1J53 A;  2Y1J A;  2P5O A;  4FJ5 A;  4OPK A;  1T8E A;  4CEF A;  1BIS A;  4CJL A;  3VQP A;  3DRP A;  4CHP A;  1GOC A;  4EP5 A;  4PA1 A;  5I42 A;  4E7L A;  4Q5V A;  3KTQ A;  2HVI A;  4W5R A;  2FBT A;  2VG6 A;  3AVK A;  4CHO A;  4B9S A;  4FJ9 A;  3QEP A;  1T7P A;  4FVM A;  3HM9 A;  4N41 A;  1SUQ A;  1W0H A;  1DLO A;  3KD1 E;  1TAU A;  2Q3S A;  5J2P A;  1KVA A;  3MAQ A;  2FBV A;  2Z1I A;  4KHY A;  2GUI A;  1D9F A;  1RTH A;  1RT2 A;  4E3S A;  5KRT A;  1LAW A;  2ITG A;  1NK4 A;  3AO2 A;  4B9N A;  2D0B A;  1LW0 A;  1HQU A;  3KLF A;  4N5S A;  2HVH A;  2HHX A;  3RRH A;  4OPJ A;  3H08 A;  4CED A;  4BE2 A;  3S9H A;  3VQB A;  1HRH A;  1TK0 A;  1ASV A;  4CJT A;  2HMI A;  3L2W A;  1NK5 A;  1S1X A;  3AVC A;  1HQE A;  4OGE A;  3B6P A;  4YFU A;  4CJF A;  4OGC A;  3VA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...