1BI4B

Catalytic domain of hiv-1 integrase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFLIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
molecule keywords INTEGRASE
total genus 45
structure length 143
sequence length 153
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bi4B00
4CEDA 4PA1A 1TKDA 2FBXA 4JLHA 3KLHA 1ZYQA 2KFNA 3RRGA 4B9VA 3VQ7A 1T7PA 1LW0A 3OYNA 1VSJA 2IAJA 3NF6A 4KRFA 3AVLA 3T19A 3UIQA 2F96A 3ZCMA 2Z1GA 3S3MA 1N5YA 1TVRA 1YVUA 4HVJA 4DU4A 3V81A 1SL2A 2OZMA 4B9NA 5FDLA 1LAVA 4M3TA 1ASWA 1KVCA 2VG5A 3ZSWA 1IKVA 3S9HA 1MU2A 3LP2A 3NGIA 1CLQA 4UQGA 3NH1A 1EETA 4N47A 2F8SA 3ZSXA 1JLFA 2YV0X 2QK9A 1UOCA 4RW9A 2ZQBA 4DQQA 3NGZA 2DFFA 2Q3SA 3QETA 4DSIA 4DQPA 2G8IA 4KHYA 2DTUA 4CFDA 3DLKA 4ELVA 3K57A 5HRSA 4DQSA 5CY4A 2P1JA 4KFBA 4CJPA 2RN2A 3RRHA 3O4NA 3TAFA 4AHVA 4YNQA 4CF8A 3HPOA 2O4GA 3L2VA 1IKWA 1JLAA 3B6PA 3VQ4A 4R5PA 4HCCA 2G8UA 4DS4A 5FRNA 2XY7A 2IOCA 3VQEA 5D3GA 4Z4EA 5J2MA 4N5SA 3L2WA 4N41A 4AH9A 4JS4A 1QSLA 1QQCA 2X78A 2OZSA 1C1AA 1RT3A 4RW6A 3K59A 1Q9YA 4CJVA 3DLBA 2I5JA 4Q5VA 1NK4A 4CEOA 3LANA 3OS2A 1KTQA 1FXXA 3I0SA 4H4MA 5KTQA 2FBVA 3HT3A 1SKWA 3E01A 1RTJA 1WAFA 4IDKA 4B08A 3KLEA 4KB1A 3NFAA 3K5MA 3AO5A 1NK7A 1RT7A 1Q8IA 3AVIA 3HVTA 2E6LA 1VSMA 3G0ZA 1JKHA 1RBTA 1YT3A 3KK2A 4DF8A 4C8OA 3RMDA 1O1WA 5C24A 4J2DA 3G10A 4F3TA 4FJJA 4H4OA 2B6AA 2GBZA 3V1QA 3OYKA 3DYAA 3OYLA 3EY1A 3THVA 4F8RA 4M3RA 3MEEA 4BWMA 4FZYA 4ZTJA 3F73A 1GOAA 5SZTA 4F3OA 4BE1A 1VSLA 3KLGA 1D8YA 1D9DA 1WSEA 3SV4A 2DFEA 4J2BA 3PUFA 3SQ0A 1B9DA 3RMAA 4JRPA 3LZIA 3U3GA 2HMIA 4CGHA 3FFIA 1EX4A 2ZD1A 5JS2A 4OLAA 2OPQA 4CJSA 3U6FA 1DTTA 3DLHA 1S1WA 1SKRA 4HUGA 1T05A 1IO2A 1NK8A 3TAQA 3AVJA 4FVMA 1C0MA 3DOLA 4Z0UA 2YNFA 4M45A 3SQ1A 2HNDA 4IBNA 1ZBFA 2HNZA 4CJRA 3EZ5A 2D0BA 4DSLA 1RT2A 3B6OA 1XHZA 2XRIA 3RTVA 1Y97A 1LWEA 4IKFA 2YNGA 4MFBA 2RF2A 1U49A 1QS4A 1NKCA 3ZT0A 4FJNA 4LSNA 1JL2A 3V4IA 1CZ9A 3OY9A 3LP1A 3CQ8A 4Y1DA 4I2QA 4NYNA 3OYMA 4DS5A 4ZTFA 2LSNA 5KGXA 2ATQA 3NF7A 2HNYA 4CEFA 2D0AA 2VWJA 1N6QA 4DU1A 4OPJA 2YKMA 2EHGA 2QXFA 5CZ1A 4CIGA 1EKEA 1RCHA 3QEIA 3SPZA 3PX4A 3U3YA 4FYDA 4DQRA 2RKIA 3OYEA 3QESA 2NUBA 4FJMA 4M3UA 4FXDA 3VQ8A 4KPYA 3HJFA 1D5AA 1WSIA 3NBPA 4FJ8A 4PWDA 4Q0BA 3L2UA 3SCXA 3ZT3A 1VK0A 3TWHA 2BGGA 1K6YA 1GOBA 3OYAA 4KREA 1KLMA 4G1QA 4NYFA 4CERA 4M3WA 4CJ5A 3WNFA 4CECA 1WSGA 3ZSRA 4CEAA 4CJ4A 1TK0A 4CF1A 4EZ6A 1VSIA 5FRMA 1RTHA 3ISNC 5HRNA 3SJJA 4OGEA 4BE2A 2YKNA 1U48A 4AHSA 1WSJA 2OA8A 3OYFA 5DK5A 2YNIA 1L5UA 5T7BA 2B4JA 4HUEA 3C6TA 4O0IA 3DRRA 5KGWA 5EU7A 2O4IA 3HPGA 1JLCA 2KW4A 4CEBA 4FLVA 4E7JA 2JLEA 3O3HA 4PY5A 1S6QA 3RMCA 1ZBHA 5CZ2A 1I39A 2P51A 4EP5A 3AVFA 1ZBUA 1ASUA 4CJUA 4CHOA 1TV6A 3IRXA 3ITHA 4HUFA 3MAQA 3HVRA 1X9MA 1A5XA 1BIUA 1KRPA 3DMJA 3NCIA 1F21A 3VA0A 1RTDA 4O5BA 3LWMA 3KKSA 4CGGA 3L2QA 4BDYA 4ELTA 2QKKA 3ZSOA 1TL1A 3S3NA 3QEPA 4K8ZA 3AVKA 4L8RB 1VRTA 2WONA 2P5GA 4M3YA 4DMNA 1WN7A 4DFMA 4M3ZA 3HP9A 1C0TA 4LSLA 4NCGA 1KVAA 1S6PA 3MXJA 3AVGA 1U45A 3CG7A 2WOMA 4N76A 3V9UA 2QKBA 4FLWA 3OJUA 2B5JA 3VQ6A 2HHXA 1XC9A 1FK9A 1YTUA 3TAEA 2YHBA 4DTNA 3SUQA 3TAMA 3ULDA 3V9XA 1G15A 3V1OA 5K14A 2DFHA 3WNHA 3OS1A 2A1SA 2HHSA 4B9MA 1LWFA 3DLRA 3K2PA 2G8KA 4DSKA 3NH2A 4FJXA 5I3UA 1RBUA 1BQMA 3KJVA 3OS0A 2ZE2A 1RDDA 4QOZB 3K5OA 3RR8A 4ID1A 3KD5E 1QSYA 5C42A 3CYMA 1L3VA 2G8HA 3SQ4A 5I42A 3PO4A 1W9HA 1RT1A 4DFKA 1QSSA 3PX0A 3RR7A 4MQ3A 3ZSYA 3VQQA 4I7FA 2Z1IA 3OYIA 1VRUA 1J5OA 2R7YA 3QO9A 3TABA 3K5LA 2DY4A 4CHPA 3HPHA 1C1CA 4H8KA 3HP6A 4DFJA 4OKKA 4FCYA 4PUOA 3OYCA 3SUPA 3MXMA 1NK5A 1IKXA 4KHUA 1SL0A 4DTRA 2JGUA 1NK9A 4CK3A 3TR8A 4F2SA 3OYGA 4O44A 3ASMA 3TARA 3HK2A 1QE1A 3NH0A 4DF4A 1Z25A 1CZBA 1S1XA 4IFYA 1RT4A 4Y1CA 4AHTA 1A5WA 3HM9A 1HMVA 3AVAA 3M8SA 1C6VA 4OKJA 4DFPA 2BDPA 3M8QA 4CJLA 1HYVA 1VSHA 4CGIA 4AHUA 3AA4A 1S9EA 2A1RA 3AVNA 3SPYA 2EX3A 1FKPA 4CEEA 5CYQA 4DG1A 3QIOA 4DTMA 1JXEA 3NHGA 4DTJA 2G8WA 4YFUA 3C6UA 1XWLA 3MEGA 5HRRA 1X9SA 4KI6A 2X74A 4DU3A 2KTQA 1GOCA 4F2RA 4M3XA 4HHTA 4O4GA 3HYFA 4CIEA 4IG0A 1W0HA 3PX6A 1UA0A 4FJIA 1HYSA 5SWMA 3OYBA 3L3VA 1S1TA 3KLFA 4DSEA 1S9GA 4LH4A 4Z4IA 4FLYA 4W5OA 4E89A 4CHYA 2XO7A 4FLZA 1DLOA 4FZXC 4CFCA 4FJKA 1TKXA 1IKYA 1LAWA 4I9LA 4OPKA 4C8LA 4FK2A 1I3AA 1VSFA 3V9SA 4FLXA 1KCFA 3D0PA 2BE2A 1NK0A 1TK5A 2KZMA 4FW2A 5C25A 1EXQA 4FJ5A 5J2QA 3O4QA 4CCHA 4E19A 4C8KA 3NF8A 2IDOA 3ZSQA 4CJQA 2IGIA 3SYZA 2OPSA 3O3FA 1X9WA 1JXBA 3M8PA 1L3TA 3QEWA 4IFVA 3OYDA 1S1VA 1NKBA 2D5RA 4DTPA 2X6NA 3TAGA 3ZSVA 3WNGA 5J1EA 4CJFA 4DQIA 3L8BA 4FJ9A 1UA1A 3CFRA 1BCOA 1UAXA 2E4LA 3KTQA 2HHWA 5J2PA 1HRHA 1ITGA 4QAGA 4KB0A 4DLEA 4FLUA 2HHTA 3VA3A 1RDAA 3LAMA 4M41A 3VQCA 4FK0A 1TAQA 3OYJA 1ZBIA 3T1AA 4W5RA 3CM5A 2FBTA 2YNHA 4DWIA 3RMBA 2VG6A 3EYZA 4B3OA 4OJRA 4J2AA 1JL1A 4CF2A 1TKZA 3CFOA 3H08A 2Z1HA 2RPIA 1RT6A 3NGYA 1T8EA 3I8DA 4BWJA 3BDPA 5JS1A 2KZZA 3VQAA 1KLNA 3QEVA 3QEXA 1JLQA 4CK1A 2HVHA 3AVHA 4BDZA 4CJTA 3AO4A 1RTIA 4F4KA 3LPUA 3PV8A 3NE6A 3AA2A 2W42A 4OLBA 3C95A 1JLGA 4CJWA 3KKRA 4O0JA 2XY6A 4CIFA 4GW6A 2Y1JA 4Z4FA 4QCLA 5HBMA 4CE9A 3DRPA 1BI4B 4FM0A 3QLHA 1Z26A 1VSKA 1C0UA 1VSEA 2IC3A 4KTZA 1XI1A 3AA5X 2E6MA 4CHZA 1HPZA 4CFAA 3SNNA 1JLEA 3AO2A 3AVBA 3KLIA 3QINA 3SUNA 4KV8A 1ASVA 4CGDA 4FM2A 3M8RA 4DTXA 3TI0A 1KFSA 4C8MA 2HW3A 4CEQA 2OPRA 4NCAA 1WLJA 3DLGA 3VQ9A 2PYLA 4ELUA 4PQUA 4E3SA 1HQUA 3V6DA 1IH7A 1J54A 2VG7A 4Z4GA 3JYTA 1WNSA 4B9TA 4W5QA 2PYJA 3SV3A 4FZZA 4CGJA 4Z4CA 4FJHA 4O55A 3QERA 4DSJA 4I2PA 4KTQA 4E7IA 1SUQA 4CF0A 4KHNA 3HL8A 1J53A 3VQDA 1SL1A 2OYQA 1SV5A 5DMRA 3AVCA 1QHTA 4ICLA 3IAYA 4ZHRA 4OGCA 3V9WA 4KHSA 4KHQA 1KSPA 2BANA 1ZBLA 4KHWA 1BL3A 3HSTB 2AJQA 3NDKA 4AILC 1NJYA 2X6SA 1WSFA 1RNHA 4CJEA 1L3UA 2KFZA 4E0DA 1RBRA 3D45A 1T03A 3WNEA 1NOYA 1HNVA 1S1UA 4RG8A 3ZT1A 4FK4A 4W5NA 4DLGA 2HVIA 1U4BA 4ID5A 2OPPA 4EP4A 3SZ2A 1BHLA 4W5TA 2YHAA 1NJWA 4N56A 5HLFA 2XY5A 3K5NA 4DTOA 3F9KA 4JS5A 3TANA 3SUOA 4GVMA 4EZ9A 3CM6A 4CGFA 1LW2A 1LV5A 1NKEA 1WAJA 3L3UA 2HB5A 4E7HA 5HROA 1TKTA 4B8AB 2Z1JA 4TSXA 4BACA 1L3SA 2IS3A 5E41A 3CFPA 3MECA 2G8VA 2FBYA 3ZSZA 2Y1IA 3JSMA 2F8TA 1BI4A 4LD0A 1TAUA 4DTSA 2ITGA 4DSFA 3LALA 1HYZA 3OVNA 1U47A 3IS9A 3AO3A 2PY5A 4FJGA 1D9FA 4FW1A 3LZJA 4FJ7A 4CF9A 1QTMA 3PY8A 2KQ2A 5CYMA 3LP3A 4OKEA 1NOZA 1RT5A 2GUIA 4HTUA 4KO0A 4CHQA 5J2NA 2PZSA 4K8XA 1C1BA 3HO1A 5KRTA 4B9UA 4FJLA 4CJKA 1BGXT 1BCMA 1RBVA 4DTUA 1TGOA 2GV9A 3L2RA 2HHQA 1HNIA 3AO1A 3DM2A 1R0AA 3AV9A 2G8FA 3T3FA 4NCBA 4FLTA 2ETJA 3LAKA 1DTQA 3A2FA 1KFDA 1RILA 1KVBA 4GMJB 3QIPA 2XHBA 4M42A 1A5VA 1B92A 4BE0A 4CK2A 4XIUA 1VSDA 1FKOA 3IG1A 3V1RA 4RW7A 3S3OA 2P5OA 3MEDA 3SI6A 4B9LA 3VQ5A 4KTWA 1BQNA 3VQBA 4WE1A 3LWLA 4B9SA 1JLBA 4E1MA 3VQPA 4E1NA 1J9AA 3MXIA 4CFBA 1CXUA 3KK1A 1SKSA 1NJXA 3BGRA 3LP0A 4Z4HA 1RDCA 3LPTA 1HJRA 3C94A 3O3GA 1WSHA 1CXQA 1XHXA 5KRSA 3NF9A 3OYHA 1TL3A 3OJSA 4KAZA 1BISA 4J2EA 4RW4A 3ZT2A 4C8NA 2XY8A 4E7LA 3DOKA 4E7KA 1S5JA 3AA3A 1TK8A 1NK6A 4LH5A 3V9ZA 3ALYA 1X1PA 3AVMA 3DI6A 4RW8A 1B9FA 4LY7A 4CESA 3HXMA 1NJZA 3KD1E 1RBSA 3P83D 3K58A 3NAEA 4JRQA 1Q9XA 4HCBA 3SQ2A 1REVA 4CEZA 4I9QA 2D0CA 4AHRA 3QNOA 4AHCA 4KKOA 3DRSA 3LDSA 5HP1A 2HHUA 3KIOA 3P5JA 5HRPA 5FROA 4CHNA 3KK3A 3QNNA 3DLEA 5KI6A 4CJ3A 4FM1A 1YTAA 3P1GA 1UWBA 3TAPA 4KI4A 4BDPA 2VWKA 3ZT4A 1LWCA 3PO5A 1BIZA 4OVLA 1RDBA 1EP4A 2HHVA 1U04A 4B8CA 3VN5A 4IG3A 1IG9A 3RWUA 3I0RA 1HQEA 2FC0A
chains in the Genus database with same CATH superfamily
3QBXA 1NMNA 3RRGA 2P9LA 2IAJA 3AVLA 3UIQA 2QWOA 4I6MA 4IOCL 4DCHA 4H0XB 1YVUA 3D7EO 4MLEA 4YDUA 1E4GT 1HUXA 1KVCA 4UQGA 3PSIA 4JI7K 2YV0X 2QK9A 4CZIA 2FSNA 3NGZA 2Q3SA 2G8IA 2DTUA 4ELVA 2YCHA 2P1JA 5TKWA 2NRVA 4CF8A 3HPOA 1NMDA 3ZX0A 1NGHA 4BRGA 3KWGA 5D3GA 2E2PA 4BRLA 4NXMK 1QQCA 1C1AA 4CJVA 3DLBA 2I5JA 1R59O 4CD1A 3LL3A 5AFUH 5KTQA 4C23A 3KLEA 3BF3A 3AO5A 3W3DA 3EZWA 1HKCA 4DF8A 1YT3A 1O1WA 1DT9A 2B6AA 5KPTA 4JI5K 4KH4A 4M3RA 3L0QA 3VEXA 5SZTA 4F3OA 1MWMA 1FW6A 1GLDG 3PUFA 1QQMA 1B9DA 3IDHA 3U3GA 2HMIA 4CGHA 4JK7A 3FFIA 2ZD1A 5JS2A 2OPQA 4I6MB 2F9WA 4HUGA 2OANA 3TAQA 3AVJA 2CH5A 2A40A 4Z0UA 2YNFA 3VF4A 3KWIA 1ZBFA 2HNZA 4DSLA 2D0BA 4GY2B 1RT2A 2ASOA 3FZHA 1NKCA 1XNQK 5BPNA 3MMVA 4H5WA 2QI2A 3WQUA 3O9TA 4Y1DA 4I2QA 4NYNA 2LSNA 3E1YA 4KHPK 3NF7A 1GLEG 5CZ1A 2QXFA 3VPZA 4DR5K 3SAHA 4FYDA 3SPZA 3PX4A 1I94K 2NUBA 4FXDA 4H0OA 2HF3A 4KPYA 4WFNL 3HJFA 1WSIA 4PKGA 1NGFA 3ZT3A 2P9PB 3OYAA 4KREA 1KLMA 4CERA 4B3SK 1T6DA 4CECA 1TK0A 3T7ZA 3P38A 3SJJA 2Q97A 1U48A 3MX5A 1QHAA 4FL9A 1L5UA 5T7BA 4O0IA 2IIRA 5EU7A 1JLCA 2HF4A 2QWNA 4E7JA 4RTFD 3RMCA 1ZBHA 3CD6N 1NNEA 1I39A 4FWMA 4WFAL 3AVFA 2GELA 2JWLA 1ZBUA 5DM6L 3H1QA 3NVMA 4JI3K 4HUFA 2QM1A 1BIUA 3NCIA 2F4VK 4O5BA 3KKSA 2QKKA 1TUUA 3QEPA 4GKJK 4LSLA 4LF8K 1KAYA 3MXJA 3CHWA 2D0PA 3AVGA 4B9QA 2QKBA 3RSEB 3SMSA 3CC2N 1VQMN 3SUQA 4A2BA 1OH6A 1G15A 5I9EB 2HHSA 5AQPA 3DLRA 2OCEA 4EHUA 4QOZB 3K5OA 2A42A 3KD5E 1EQYA 5I42A 3SMPA 1QSSA 3RR7A 4MQ3A 3VQQA 4JK9A 3OYIA 5C15A 2O8EA 3P31A 4WYBA 4B1ZA 4DFJA 3MN5A 2NRZA 3WXLA 3MXMA 2I7PA 3TARA 3HK2A 1KAZA 1Z25A 1S1XA 4AHTA 1A5WA 1MWKA 1VQLN 2CGJA 4DFPA 5EX5A 3M8QA 4IEEA 1VSHA 4CJLA 1W97L 4DFMA 4CEEA 5CYQA 2G8WA 2IVNA 1JXEA 4DR7K 4XH4A 5KQ8A 4X65K 1XWLA 2FSJA 4LF7K 4HHTA 4YOVA 3RSEA 3PX6A 1HYSA 5SWMA 4LF6K 3KLFA 4FLYA 2WBNA 3VETA 1S3XA 1RDUA 2XO7A 1DLOA 4FZXC 4CFCA 1TKXA 2VYPA 4I9LA 1KQSM 3GDQA 3D2FA 4FLXA 5ADXH 2BE2A 1NK0A 2O8DA 5C25A 5F1XA 3WXMB 3ZLJA 3ULEA 2QWMA 4CCHA 3NF8A 1VQ8N 4DR1K 2IGIA 4AQYK 1JXBA 3HI0A 3DAWA 3AGRA 1L3TA 1S1VA 1NKBA 2X6NA 5EOYA 1UA1A 1BCOA 1VHXA 1UAXA 1X3NA 3J7ZO 3E9PA 1XMOK 3O4WA 1HNZK 1YI2N 1RDAA 4M41A 1OH5A 4CD3A 2QTDA 2ASMA 3A5LC 4O8UA 5AQKA 3RMBA 2VG6A 5FLXO 2ZJQL 3QMLA 3CFOA 2Z1HA 1NGJA 3BDPA 3QEVA 4FWSA 4BDZA 4CJTA 3AO4A 1RTIA 2KHOA 2V52B 3K9KA 3ENBA 4IDHA 3AA2A 2W42A 4CJWA 2VWBA 3KKRA 4O0JA 4CIFA 4ILGB 4CE9A 3THYA 1YITN 4Z94A 1VSEA 3AA5X 1ESVA 4LF9K 3FLCO 1HPZA 4CFAA 3SUNA 2CGKA 4FM2A 4DTXA 5MLCQ 1HKBA 3TI0A 2E5LK 2HW3A 4MDBA 4NCAA 2OPRA 1YAGA 4ELUA 4E3SA 3O9QA 1J54A 3M5RA 4Z4GA 5M1KA 4B9TA 3THWA 4FPAA 4LFCK 3CJCA 3QERA 4E7IA 1SUQA 4IFEA 4CF0A 1J53A 4JYAK 5DMRA 4ICLA 1QHTA 3O1BA 4CZJA 4B3TK 1SS6A 4KHSA 4KHWA 1ZBLA 3JXUA 4AILC 2X6SA 5AQTA 4B1YB 3J7YP 1HX1A 4E0DA 3D45A 4W5NA 4B1UB 2HVIA 4ID5A 5AQWA 4MO5A 3K5NA 4DTOA 3F9KA 4BVOA 2QWPA 1LW2A 1WAJA 3CCQN 3L3UA 4WFBL 2Z1JA 5LJWA 4BACA 4JV5K 3LDQA 5AQHA 4BRAA 5E41A 1XC3A 2G8VA 3UB5A 2Y1IA 3JSMA 2F8TA 3QBWA 4JKDA 1EWQA 1OKJA 4LD0A 3ATVA 3WXJA 2UXCK 4DTSA 2ITGA 4CBXA 3LALA 1HYZA 3OVNA 4FW1A 3LZJA 5CYMA 4HTUA 2PZSA 1RT5A 1VAZA 4EHTA 4DB3A 3Q7CA 2GV9A 2QW9A 3AV9A 3BF1A 2YI1A 1ATSA 3LAKA 4M42A 5JICA 3IG1A 4B9LA 4KTWA 4B9SA 1IV0A 3KK1A 3BGRA 3LPTA 3O3GA 1XHXA 1CXQA 5KRSA 2NRWA 1BISA 3I55N 3TU5A 2V51B 4E7KA 1S5JA 1NK6A 4LH5A 3V9ZA 3ALYA 3AVMA 4BGBA 3WXIA 4LY7A 3P83D 1Q9XA 1N36K 5LMUK 2D0CA 4AHRA 1YJ9N 2QWQA 4FWLA 3CCMN 3DRSA 3KIOA 5C10A 1YHQN 4WCEL 4B3RK 1X9JA 3DLEA 4FSVA 5KI6A 3P1GA 1BDGA 4KI4A 4BDPA 3ZT4A 1BIZA 3UKUA 1NGBA 1U04A 5BRFA 3F2KA 4PL8A 4GV3A 2FC0A 4CEDA 1BU6O 4JLHA 4IEIA 4XH5A 2KFNA 4H03B 3VQ7A 1T7PA 4B9VA 2ZWHA 3OYNA 1IBKK 4KRFA 1XQSC 3ZCMA 2Z1GA 3S3MA 1TVRA 4ISGA 4DU4A 1M90O 1SL2A 1JCFA 4YHHK 1LAVA 4JN4A 1ASWA 4XH1A 3ZSWA 3S9HA 1XMQK 1MU2A 3LP2A 3MWTA 1EETA 4N47A 3ZSXA 1JLFA 3H3NO 2ZQBA 4DQPA 1BA0A 4CFDA 3K57A 4DQSA 5AQYA 5C2DA 3VGLA 4CJPA 4DR6K 3O4NA 3TAFA 4AHVA 3D2EA 3B6PA 1BOTO 3DXKA 5FPNA 3VQ4A 3QDKA 4R5PA 2G8UA 3VF6A 3VQEA 2E2NA 2ITMA 3C6HA 5J2MA 4AH9A 4JS4A 2PFUA 1NJIO 1QSLA 4RW6A 1RT3A 4NLCA 4Q5VA 4CEOA 3LANA 3CCRN 1KTQA 2E88A 5F2RA 1FXXA 3I0SA 3IUCA 3VGMA 2EWSA 1RTJA 4WQ5C 4IDKA 4B08A 1KC8O 4KB1A 4IJAA 3HOSA 1NK7A 1RT7A 3AVIA 2O8CA 3UKUB 3HSCA 4H0PA 2D1KA 3G0ZA 1RBTA 3FZKA 2FF6A 1VQON 4J2DA 3G10A 3OYLA 3V1QA 2P9UA 3MEEA 4FZYA 4ZTJA 3THYB 1BG3A 1VSLA 3IMXA 1D9DA 1WSEA 4J2BA 2HSTA 3RMAA 1EO1A 4A2AA 4DV4K 2IVOA 4OLAA 5B8HA 3CCLN 4H5TA 3DLHA 2GX9A 3P39A 1T05A 4BRIA 4BRQA 5JLHA 2HNDA 3EZ5A 2P9KB 1JCEA 3B6OA 3RTVA 4IOAL 2HHHK 2AA4A 4MFBA 1QS4A 3ZT0A 3WXKA 4DS5A 2E2QA 3TSUA 2Q31A 5JVGL 4LF5K 1EKEA 3SJHA 4CBUA 4M3UA 1ZBSA 4OPHA 3MCAB 4Q0BA 3L2UA 1VK0A 1K6YA 3AARA 1X3MA 3CCVN 3ZSRA 4CF1A 4NB4A 3H3OB 5HRNA 4OGEA 4BE2A 1RGIA 4AHSA 2YNIA 2B4JA 4HUEA 3G4SN 3O6WA 1Q82O 3CCJN 2JLEA 3O3HA 4PY5A 4DV7K 4H5RA 4IXCA 1ASUA 4CHOA 2P9PA 3QFUA 3MAQA 1BWFO 5AQRA 3AAPA 3PLAA 3VA0A 3L2QA 4BDYA 2Q2RA 1TL1A 3D6RA 3AVKA 4M3YA 4DMNA 4M3ZA 3EN9A 4DR2K 1C0TA 3U9DA 1S6PA 2WOMA 3OJUA 1XC9A 3TAMA 3VESA 3ULDA 3TTDA 3FR0A 3V1OA 3V9XA 3A5NC 4CVNE 4FO0A 2A1SA 4FJXA 4JI1K 1N34K 1BQMA 1E4FT 3DLLL 1D4XA 2ZE2A 4X66K 1RDDA 4ISFA 3RR8A 2FXUA 5C42A 3CYMA 3PX0A 3ZSYA 1J5OA 1NWKA 3QO9A 3TABA 4CHPA 4YOTA 3HPHA 1C1CA 4H8KA 3HP6A 4FCYA 3OYCA 1IKXA 4KHUA 4DTRA 4CK3A 3OYGA 3I33A 1H1VA 1QE1A 3CPEA 3NH0A 4IFYA 4Y1CA 4BR7A 3AVAA 3M8SA 4OO1J 1C6VA 3NMUA 5AQOA 5HL7L 3AA4A 1S9EA 4DUYK 2A1RA 2HBJA 3AVNA 3SPYA 2EX3A 4M7YA 4DG1A 3QIOA 4DTMA 2NNWA 3MX2A 5GINA 3NHGA 4DTJA 3C6UA 5HRRA 5GADP 4DU3A 1Q7YO 3HYFA 1W0HA 5KPRA 3C6AA 4FJIA 1G99A 5A2QO 1S9GA 4W5OA 2GEMA 2P9NA 3CCEN 4FK2A 2O8EB 1KCFA 4NLBA 1TK5A 4FW2A 4DKWA 1EXQA 3HM8A 4NO7A 3D2EB 3ZSQA 3N4QA 3QEWA 2D5RA 4DTPA 3TAGA 3BY5A 3ZSVA 3WNGA 1YJNN 5LY3A 2HHWA 2GWKA 1ITGA 5GIPA 3CPWM 3DWLA 5AZJA 4Y0WA 2AP1A 3OYJA 3SLCA 4CZMA 4AM7A 3T1AA 2FBTA 4FWQA 4DWIA 4OJRA 3IKMA 1HNXK 3H08A 3BZCA 1T8EA 2RPIA 3NGYA 4CZEA 1Q18A 1LOTB 5JS1A 4EAHD 3VQAA 4JEPA 2NLXA 2P9UB 2HVHA 3AVHA 5AQGA 4F4KA 4JK8A 2QWLA 4OLBA 5BN9A 3C95A 4JKBA 4GW6A 1BI4B 4FM0A 3EO3A 1ATRA 4BRKA 1VSKA 1C0UA 2UU9K 2IC3A 1XI1A 2W6KA 2E6MA 3ID6A 3SNNA 1JLEA 1HLUA 3AVBA 3KLIA 3QINA 1VQ9N 4X64K 1ASVA 3M8RA 1KFSA 3ENHA 2P9NB 3VQ9A 4PQUA 3SBGA 3V6DA 2VG7A 3P4IA 3JYTA 1WNSA 2PYJA 3EL2A 4CGJA 4FJHA 4O55A 4I2PA 3J81O 4JI6K 5AQJA 2OYQA 5BN8A 3V9WA 1OH8A 2AJQA 3OTOK 5AZJB 1YXQA 1RNHA 4CJEA 1L3UA 1OH7A 3Q7BA 1IG8A 3KZBA 1T03A 1XUPO 5AZIA 3WNEA 3ZT1A 5GAGP 4DLGA 1N32K 1U4BA 4EP4A 1BHLA 1NJWA 4N56A 4CZGA 5HLFA 1K8KB 3O9UA 4JS5A 2E1ZA 4EZ9A 3CM6A 2HBMA 2HB5A 4O8KA 4TSXA 4BRFA 3CFPA 2UYTA 1BI4A 4DSFA 3A5OC 5LJVA 3AO3A 4FJGA 1D9FA 2ZM6K 3H1VX 1QTMA 3C7NA 4O5FA 3CETA 1NOZA 2GUIA 4CHQA 5J2NA 4K8XA 1C1BA 4BR0A 2ZF5O 5KRTA 4CJKA 1RBVA 3PIPL 1MA9B 1HNIA 2FSKA 3DM2A 3T3FA 4NCBA 4FLTA 2ETJA 4IOXA 1RILA 1KVBA 4DV6K 2XHBA 1A5VA 1K9MO 1ILYA 3VEOA 3G25A 3PIOL 1FKOA 2BH1A 4BY9C 1KD1O 5CHIA 3S3OA 3SI6A 3VQ5A 4E1MA 4H0YB 4YOWA 1SKSA 3LP0A 1WBDA 4Z4HA 1RDCA 1TYQB 2V7YA 5H1SQ 1WSHA 3TTFA 4A61A 3OYHA 4B1VA 4J2EA 3TSPA 3EKSA 3GOIA 5GAHP 3AA3A 1SAZA 2A41A 1B9FA 1NJZA 4CESA 1RBSA 2GUPA 5FPEA 4JRQA 3QNOA 4RWTA 4AHCA 3MDQA 3O08A 5HP1A 2HHUA 4CHNA 4FM1A 1UWBA 3TAPA 2VWKA 3N4PA 4OVLA 4BQZA 3FZLA 2E1YA 2P9KA 2DFFA 5BRHA 1ZYQA 5C2FA 3NF6A 2F96A 2VCPA 1NM1A 1N5YA 2OZMA 3CI5A 3EE8A 5FDLA 2YHWA 4JKGA 2VG5A 4DR3K 1IKVA 1CLQA 2P9IA 3NH1A 3WEEB 2F8SA 4BR2A 2KLAA 3MN7A 4DQQA 4LF4K 2UXDK 3L4QA 4JI4K 4JD2A 5CY4A 4KFBA 5E26A 1RDWX 2RN2A 2YHXA 3RRHA 4MDAA 4YNQA 2O4GA 1IKWA 1GLJO 3ZYYX 2QA4N 2XY7A 3BUZB 5BR8K 1SQKA 5AR0A 1EWRA 2X78A 1Q9YA 3K59A 4A5BA 2YJFA 2VGMA 2VQFK 2Q0RA 4IZ9A 4H4MA 2FBVA 3HT3A 1SKWA 3E01A 3VOVA 1WAFA 3I8BA 3K5MA 1OVYA 1Q8IA 3HVTA 1Q86O 2WUSA 1JKHA 3KK2A 1VQ5N 3FZMA 4C8OA 4CW7B 4F3TA 4FJJA 4H4OA 3OYKA 3THVA 3DYAA 2QEXN 4WQ4A 4BWMA 2ZGYA 1W7AA 4BE1A 1Z05A 3KLGA 5FPDA 5AQFA 4ILJA 4X62K 3SV4A 2PAVA 3U4LA 4JRPA 3LZIA 3VERA 4FWKA 1EX4A 4CJSA 4PKIA 3U6FA 3CERA 1SKRA 3WEEA 1IO2A 1NK8A 4FVMA 1S72N 1C0MA 2BTFA 4M45A 4PL7A 3SQ1A 4IBNA 4CJRA 4BC5A 2XRIA 2YNGA 4FJNA 4QS7A 1SZ2A 4WF9L 4FVUA 4V19S 3OY9A 3CQ8A 3OYMA 5KGXA 2ATQA 2HNYA 4B1XB 4OPJA 4JNEA 2YKMA 3QEIA 1RCHA 4DQRA 2WC9A 3GG4A 3OYEA 4PWDA 4FJ8A 3ENOA 3TWHA 3ZX2A 3THXB 1GOBA 4G1QA 1J5EK 4GKKK 5F0XA 4M3WA 4YDUC 3I56N 4CEAA 4CJ4A 1VSIA 5FRMA 1RTHA 3O8MA 3OYFA 3C6TA 3DRRA 2O4IA 3GBTA 2KW4A 4CEBA 3M1FA 4FLVA 1VQKN 3T1HK 5CZ2A 2P51A 5BPMA 4FOIA 5ADXA 1TV6A 3BEXA 3HVRA 3G6EN 3DMJA 2FF3B 1KRPA 1RTDA 4CGGA 3CMAN 3M3ZA 4K8ZA 1CZAN 2P5GA 1WN7A 1QQOA 4E1JA 1KVAA 3VGKA 1U45A 3CG7A 4H5NA 2W41A 4N76A 3V9UA 2HHXA 3VQ6A 2DPNA 1YTUA 3ZETB 3TAEA 4DTNA 2ASPA 1NBWA 2CH6A 2RE2A 1XNRK 4L3QA 5K14A 2OTJN 5M1FA 3OS1A 4DSKA 1LWFA 3NH2A 5I3UA 3FE1A 1RBUA 3KJVA 4BR9A 3OS0A 1TUYA 4DV2K 4ID1A 3DJCA 3LDOA 1GLFO 4DFKA 1RT1A 1YIJN 4NXNK 5AQXA 3CJ7A 2Z1IA 1VRUA 4KH6A 5AQIA 4PUOA 1NK5A 4YOXA 2JGUA 4DF4A 3CJ1A 3HM9A 1RT4A 5JMVA 1RFQA 4OKJA 2O8CB 2BDPA 1HYVA 4CGIA 4AHUA 3LDNA 1FKPA 4FJ5A 5M1NA 4YFUA 4B3MK 3CF5L 1X9SA 4KI6A 5AZIB 3U8XA 2X74A 2KTQA 1GOCA 4M3XA 2CGLA 4IG0A 1UA0A 4JKHA 3OYBA 5BREA 1JCGA 1S1TA 4LH4A 1Z6RA 4BRDA 3VEVA 4BRMA 1IBLK 1NGAA 3VMFB 4FLZA 3D2FB 1DEJA 4C8LA 4EFHA 1YVNA 4JD2B 2OTLN 4DHYA 5J2QA 3O4QA 2UUBK 4E19A 4CJQA 2OPSA 3ZX3A 3M8PA 4IFVA 3OYDA 1HJOA 4GVEA 5J1EA 4CJFA 4BRHA 3L8BA 3CFRA 3J80O 3KTQA 5J2PA 1HRHA 4DLEA 4KH5A 3AGKA 1KXPA 1HNWK 1TAQA 3HTVA 1NGDA 3EE9A 4C1NK 1ZBIA 4W5RA 3CM5A 1U2VA 1QVGM 3C7NB 4B3OA 3C65A 4CF2A 5DM7L 3F5TA 1V4TA 1KLNA 5E84A 4OX9K 2A5XA 5LL6Z 4BR5A 4DV1K 3A5MC 2XY6A 4FPBA 5HBMA 3DRPA 2Q1NA 4JHDB 3QLHA 1Z26A 1NU0A 5EVZA 4KTZA 4HWIA 3AO2A 4CGDA 2UXBK 5AQQA 3G71N 3THWB 2QXLA 1HQUA 4BQLA 3SBTA 4FZZA 4QS9A 4Z4CA 4DSJA 4CJ7A 4FWNA 2O8BB 3HL8A 1ATNA 1SV5A 1GLAG 3AY9A 4ZHRA 4OGCA 4KHQA 4BRNA 1KSPA 2BANA 3WT0A 3NDKA 1NLVA 5AQVA 1WSFA 4WQ5A 4F9OA 1NOYA 1S1UA 4LC9B 4FK4A 3KK7A 3ATUA 4W5TA 4AM6A 4BRPA 2Q36A 3SZ2A 2XY5A 1DKGD 3A8YA 3TANA 3KHYA 4JKGB 1LV5A 3ID8A 4JI8K 4E7HA 3GE1A 1TKTA 4B8AB 5HROA 1L3SA 1LCUA 2IS3A 1QZ5A 1GLLO 1WOQA 3MN9A 4JHDA 4A59A 3O5BA 5AFUA 1GLBG 3IS9A 4CZFA 3O9RA 2NZTA 3LP3A 4OKEA 3CCSN 3OBWA 4KO0A 3R9PA 4IO9L 3H45C 4M7XA 4FJLA 1BGXT 3L2RA 2HHQA 3OA9A 2O8FA 2ZJRL 2G8FA 4G9ZA 3GL1A 1DTQA 4GMJB 4UY8O 1B92A 4K42A 2J4RA 1VSDA 2HMPA 3ZETA 3K0SA 1WB9A 1K8KA 3MCPA 1BQNA 3VQBA 4WE1A 3LWLA 4IWVA 3PSFA 3L6QA 4JKEA 3UE5A 3NF9A 4BRCA 1TL3A 4JI2K 5AQUA 2XY8A 4MLHA 1TK8A 2F7TA 3R3LA 3TTCA 4JAXA 1NGEA 1X1PA 3DI6A 2D0OA 4RW8A 1NGCA 5KQDA 3KD1E 4GNIA 3K58A 1WBBA 4HCBA 3SQ2A 1REVA 2P9LB 1NGIA 3C0BA 3VENA 4DV3K 4KKOA 4AF1A 1J6ZA 5FROA 3KK3A 3QNNA 3EEQA 5FPMA 1KAXA 1LWCA 3PO5A 4JKCA 3VN5A 3RWUA 3L4IA 3I0RA 1HQEA 4PA1A 4FWRA 1NG9A 1TKDA 2FBXA 3KLHA 2O8FB 1FJGK 1LW0A 4ISEA 1VSJA 4DV5K 3T19A 3V81A 4HVJA 3CJBA 4B9NA 4EIAA 4M3TA 2VGNA 1IJJA 3NGIA 3S41A 2BUPA 1BA1A 1OVQA 1UOCA 4RW9A 5M1QA 4DSIA 3QETA 3CC4N 4KHYA 3DLKA 4FWPA 5TKYA 4A5AA 5HRSA 3CJ9A 3OBYA 3ZEUB 4DV0K 3VTIA 3L2VA 3FGUA 1JLAA 4HCCA 4DS4A 5FRNA 2IOCA 4Z4EA 2W6LA 3DXKB 4N5SA 3L2WA 1T3VA 2JWKA 3CCUN 4N41A 5EY4A 2OZSA 2P9SB 3O1WA 3VEZA 1NK4A 4BVPA 5JVHL 3OS2A 4H0VB 3U9ZA 5AQZA 1DGKN 3IFRA 4CZHA 3NFAA 4BG8A 4QS8A 2E6LA 1VSMA 3BP8A 3RMDA 5C24A 1M1KO 2HBKA 2GBZA 3EY1A 4F8RA 4R79A 3F73A 1GOAA 1D8YA 2DFEA 3SQ0A 3E66A 3VTHA 5EXWA 3EKUA 4A57A 4HTLA 3DXMA 3LM9A 2A3ZA 5AJ3K 1S22A 1DTTA 4DQ8A 1S1WA 3HZ6A 3J7AP 1VQ6N 3QICA 3DOLA 2UUCK 2YX6A 2NRTA 1XHZA 4ILHA 1Y97A 1LWEA 5LMNK 4IKFA 3J8AA 2RF2A 4JKAA 1U49A 4LSNA 1JL2A 3V4IA 1CZ9A 3NVKA 1V4SA 3LP1A 3MK6A 3VF2A 2ZJPL 4ZTFA 3E9LA 2GTDA 4DR4K 5BRDA 1N8RO 4CEFA 2D0AA 2VWJA 1N6QA 4DU1A 2EHGA 4CIGA 4M63C 3U3YA 1T44A 2RKIA 4FJMA 3QESA 3LM2A 3VQ8A 3CJAA 1D5AA 1ZC6A 3NBPA 3AAQA 3SCXA 4BGAA 2BGGA 4FWOA 5M1PA 1C0FA 3JS6A 4NYFA 4CJ5A 3WNFA 4WQ4C 1WSGA 3B8AX 4EZ6A 3ISNC 2YKNA 1WSJA 2ZGZA 2OA8A 5DK5A 4BC2A 3W0LA 3QFPA 5KGWA 4LFAK 3HPGA 1S6QA 3UKRB 4EP5A 4CJUA 2E20A 3ITHA 3IRXA 5GAEP 5BPLA 1X9MA 1A5XA 3WUHA 5JLFA 1F21A 3LWMA 4ELTA 2WFBA 3K9JA 3ZSOA 2D4WA 1O13A 3S3NA 4L8RB 1VRTA 2WONA 4OPAA 3HP9A 4NCGA 2Q0UA 4IJNA 4FLWA 1WUAA 2B5JA 1FK9A 2YHBA 1NGGA 3VEWA 3WNHA 1QZ6A 2DFHA 4B9MA 2G8KA 3K2PA 4K0KK 3OHRA 2HOEA 1QSYA 1L3VA 4K41A 2G8HA 3SQ4A 3PO4A 3SAGA 1W9HA 1HR0K 4I7FA 2GWJA 2R7YA 2DY4A 3K5LA 3E9OA 4IO8A 5HOOA 1U6ZA 4OKKA 3SUPA 5KPZA 3ULEB 1SL0A 1NK9A 1T6CA 3TR8A 4F2SA 4O44A 3ASMA 4U67L 3T1YK 3PY8A 1CZBA 4A62A 2E8AA 1HMVA 3UKRA 4RCHA 4GV9A 5M1OA 4MO4A 3TPQA 3HOTA 3BZKA 2O8DB 4BROA 3H6EA 3MEGA 3F9MA 5AQSA 4F2RA 4BR4A 2O8BA 4O4GA 4CIEA 4JI0K 1ZXOA 1Q81O 4YORA 3L3VA 4DSEA 3SK3A 4Z4IA 3CC7N 4E89A 4CHYA 4YOYA 1P8ZA 3FZFA 4FJKA 3HBTA 1IKYA 1LAWA 3CQXA 4OPKA 1I3AA 1VSFA 5AQLA 5IT9O 3V9SA 2E2OA 4CZKA 3D0PA 3CXCM 2KZMA 3OW2M 4C8KA 2W40A 4K25A 2IDOA 3SYZA 1MDUB 3O3FA 1X9WA 4BG9A 3MN6A 1YF5L 1HKGA 4DQIA 2PBDA 4FJ9A 4PHTX 2E4LA 4QAGA 1VQ4N 4KB0A 4FLUA 2HHTA 3VA3A 3LAMA 3VQCA 4FK0A 5ELZA 2YNHA 3O9SA 3TSQA 3EYZA 3H46O 5BR9A 1E3MA 1VQNN 4J2AA 1JL1A 2I7NA 1TKZA 4K43A 1RT6A 3O80A 3I8DA 4BWJA 4BREA 3VEYA 2KZZA 2VQEK 4DUZK 3QEXA 1JLQA 4CK1A 3LDLA 2UUAK 3THXA 3LPUA 3R6MA 3PV8A 3NE6A 1JLGA 2Y1JA 4Z4FA 4QCLA 4CI6A 4U7BA 1K73O 3QB0A 2KKZA 4CHZA 1N33K 4KV8A 4CBWA 4C8MA 2H3GX 4CEQA 1WLJA 3DLGA 2PYLA 5CE3A 1IH7A 2NRHA 4H0TB 1YJWN 3HRGA 4W5QA 3SV3A 1U2VB 5AQMA 4KTQA 4KHNA 4H5VA 3VQDA 1SL1A 3AVCA 2HBLA 3IAYA 4FOEA 1Y64A 5AQNA 5CR4A 1BL3A 3HSTB 1NJYA 4GV6A 2YHYA 2P9IB 5C0YA 2KFZA 4C1NI 1RBRA 1HNVA 4RG8A 4PKHA 2OPPA 2YHAA 3JAMO 2YJEA 2A6AA 3R8EA 3SUOA 4GVMA 4CGFA 5C12A 3RVCA 1NKEA 4BC3A 3LDPA 3MECA 2FBYA 3ZSZA 2RHKA 3KVGA 1K8AO 2NRXA 1TAUA 1C0GA 2IVPA 1BO5O 1U47A 3ZEUA 2PY5A 4FJ7A 4CF9A 2KQ2A 2NRRA 5IWAK 3M6GA 4J8FA 4JKFA 3HO1A 4B9UA 3A0IX 1BCMA 4DTUA 1TGOA 3AO1A 3CIPA 1R0AA 1KFDA 3A2FA 1IBMK 3QIPA 4BE0A 4CK2A 4XIUA 3T69A 1VQPN 1GLCG 3V1RA 4RW7A 4KBOA 2P9SA 3MEDA 2P5OA 4YOUA 1JLBA 2WTUA 3VQPA 4E1NA 1J9AA 3MXIA 4CFBA 1CXUA 3R1XA 1VQ7N 1NJXA 4LFBK 1HJRA 3C94A 5GIOA 4CZLA 4BC4A 4YY3K 3OJSA 4KAZA 3FFKB 1TYQA 4RW4A 3ZT2A 4C8NA 4XEIA 4E7LA 3CQYA 4B1WB 3DOKA 3MWPA 1W2BM 3HXMA 2QWRA 2V7ZA 1HPMA 1BUPA 3NAEA 4CEZA 4I9QA 2FLOA 3WQTA 1YUWA 3LDSA 1QVFM 3P5JA 5HRPA 3CMEN 3DXMB 4CJ3A 1YTAA 1JJ2M 1P90A 3SAFA 1RDBA 1EP4A 2HHVA 1QQNA 4B8CA 4IG3A 1IG9A 2F9TA
chains in the Genus database with same CATH topology
4CEDA 4PA1A 1TKDA 2FBXA 4JLHA 3KLHA 1ZYQA 2KFNA 3RRGA 4B9VA 3VQ7A 1T7PA 1LW0A 3OYNA 1VSJA 2IAJA 3NF6A 4KRFA 3AVLA 3T19A 3UIQA 2F96A 3ZCMA 2Z1GA 3S3MA 1N5YA 1TVRA 1YVUA 4HVJA 4DU4A 3V81A 1SL2A 2OZMA 4B9NA 5FDLA 1LAVA 4M3TA 1ASWA 1KVCA 2VG5A 3ZSWA 1IKVA 3S9HA 1MU2A 3LP2A 3NGIA 1CLQA 4UQGA 3NH1A 1EETA 4N47A 2F8SA 3ZSXA 1JLFA 2YV0X 2QK9A 1UOCA 4RW9A 2ZQBA 4DQQA 3NGZA 2DFFA 2Q3SA 3QETA 4DSIA 4DQPA 2G8IA 4KHYA 2DTUA 4CFDA 3DLKA 4ELVA 3K57A 5HRSA 4DQSA 5CY4A 2P1JA 4KFBA 4CJPA 2RN2A 3RRHA 3O4NA 3TAFA 4AHVA 4YNQA 4CF8A 3HPOA 2O4GA 3L2VA 1IKWA 1JLAA 3B6PA 3VQ4A 4R5PA 4HCCA 2G8UA 4DS4A 5FRNA 2XY7A 2IOCA 3VQEA 5D3GA 4Z4EA 5J2MA 4N5SA 3L2WA 4N41A 4AH9A 4JS4A 1QSLA 1QQCA 2X78A 2OZSA 1C1AA 1RT3A 4RW6A 3K59A 1Q9YA 4CJVA 3DLBA 2I5JA 4Q5VA 1NK4A 4CEOA 3LANA 3OS2A 1KTQA 1FXXA 3I0SA 4H4MA 5KTQA 2FBVA 3HT3A 1SKWA 3E01A 1RTJA 1WAFA 4IDKA 4B08A 3KLEA 4KB1A 3NFAA 3K5MA 3AO5A 1NK7A 1RT7A 1Q8IA 3AVIA 3HVTA 2E6LA 1VSMA 3G0ZA 1JKHA 1RBTA 1YT3A 3KK2A 4DF8A 4C8OA 3RMDA 1O1WA 5C24A 4J2DA 3G10A 4F3TA 4FJJA 4H4OA 2B6AA 2GBZA 3V1QA 3OYKA 3DYAA 3OYLA 3EY1A 3THVA 4F8RA 4M3RA 3MEEA 4BWMA 4FZYA 4ZTJA 3F73A 1GOAA 5SZTA 4F3OA 4BE1A 1VSLA 3KLGA 1D8YA 1D9DA 1WSEA 3SV4A 2DFEA 4J2BA 3PUFA 3SQ0A 1B9DA 3RMAA 4JRPA 3LZIA 3U3GA 2HMIA 4CGHA 3FFIA 1EX4A 2ZD1A 5JS2A 4OLAA 2OPQA 4CJSA 3U6FA 1DTTA 3DLHA 1S1WA 1SKRA 4HUGA 1T05A 1IO2A 1NK8A 3TAQA 3AVJA 4FVMA 1C0MA 3DOLA 4Z0UA 2YNFA 4M45A 3SQ1A 2HNDA 4IBNA 1ZBFA 2HNZA 4CJRA 3EZ5A 2D0BA 4DSLA 1RT2A 3B6OA 1XHZA 2XRIA 3RTVA 1Y97A 1LWEA 4IKFA 2YNGA 4MFBA 2RF2A 1U49A 1QS4A 1NKCA 3ZT0A 4FJNA 4LSNA 1JL2A 3V4IA 1CZ9A 3OY9A 3LP1A 3CQ8A 4Y1DA 4I2QA 4NYNA 3OYMA 4DS5A 4ZTFA 2LSNA 5KGXA 2ATQA 3NF7A 2HNYA 4CEFA 2D0AA 2VWJA 1N6QA 4DU1A 4OPJA 2YKMA 2EHGA 2QXFA 5CZ1A 4CIGA 1EKEA 1RCHA 3QEIA 3SPZA 3PX4A 3U3YA 4FYDA 4DQRA 2RKIA 3OYEA 3QESA 2NUBA 4FJMA 4M3UA 4FXDA 3VQ8A 4KPYA 3HJFA 1D5AA 1WSIA 3NBPA 4FJ8A 4PWDA 4Q0BA 3L2UA 3SCXA 3ZT3A 1VK0A 3TWHA 2BGGA 1K6YA 1GOBA 3OYAA 4KREA 1KLMA 4G1QA 4NYFA 4CERA 4M3WA 4CJ5A 3WNFA 4CECA 1WSGA 3ZSRA 4CEAA 4CJ4A 1TK0A 4CF1A 4EZ6A 1VSIA 5FRMA 1RTHA 3ISNC 5HRNA 3SJJA 4OGEA 4BE2A 2YKNA 1U48A 4AHSA 1WSJA 2OA8A 3OYFA 5DK5A 2YNIA 1L5UA 5T7BA 2B4JA 4HUEA 3C6TA 4O0IA 3DRRA 5KGWA 5EU7A 2O4IA 3HPGA 1JLCA 2KW4A 4CEBA 4FLVA 4E7JA 2JLEA 3O3HA 4PY5A 1S6QA 3RMCA 1ZBHA 5CZ2A 1I39A 2P51A 4EP5A 3AVFA 1ZBUA 1ASUA 4CJUA 4CHOA 1TV6A 3IRXA 3ITHA 4HUFA 3MAQA 3HVRA 1X9MA 1A5XA 1BIUA 1KRPA 3DMJA 3NCIA 1F21A 3VA0A 1RTDA 4O5BA 3LWMA 3KKSA 4CGGA 3L2QA 4BDYA 4ELTA 2QKKA 3ZSOA 1TL1A 3S3NA 3QEPA 4K8ZA 3AVKA 4L8RB 1VRTA 2WONA 2P5GA 4M3YA 4DMNA 1WN7A 4DFMA 4M3ZA 3HP9A 1C0TA 4LSLA 4NCGA 1KVAA 1S6PA 3MXJA 3AVGA 1U45A 3CG7A 2WOMA 4N76A 3V9UA 2QKBA 4FLWA 3OJUA 2B5JA 3VQ6A 2HHXA 1XC9A 1FK9A 1YTUA 3TAEA 2YHBA 4DTNA 3SUQA 3TAMA 3ULDA 3V9XA 1G15A 3V1OA 5K14A 2DFHA 3WNHA 3OS1A 2A1SA 2HHSA 4B9MA 1LWFA 3DLRA 3K2PA 2G8KA 4DSKA 3NH2A 4FJXA 5I3UA 1RBUA 1BQMA 3KJVA 3OS0A 2ZE2A 1RDDA 4QOZB 3K5OA 3RR8A 4ID1A 3KD5E 1QSYA 5C42A 3CYMA 1L3VA 2G8HA 3SQ4A 5I42A 3PO4A 1W9HA 1RT1A 4DFKA 1QSSA 3PX0A 3RR7A 4MQ3A 3ZSYA 3VQQA 4I7FA 2Z1IA 3OYIA 1VRUA 1J5OA 2R7YA 3QO9A 3TABA 3K5LA 2DY4A 4CHPA 3HPHA 1C1CA 4H8KA 3HP6A 4DFJA 4OKKA 4FCYA 4PUOA 3OYCA 3SUPA 3MXMA 1NK5A 1IKXA 4KHUA 1SL0A 4DTRA 2JGUA 1NK9A 4CK3A 3TR8A 4F2SA 3OYGA 4O44A 3ASMA 3TARA 3HK2A 1QE1A 3NH0A 4DF4A 1Z25A 1CZBA 1S1XA 4IFYA 1RT4A 4Y1CA 4AHTA 1A5WA 3HM9A 1HMVA 3AVAA 3M8SA 1C6VA 4OKJA 4DFPA 2BDPA 3M8QA 4CJLA 1HYVA 1VSHA 4CGIA 4AHUA 3AA4A 1S9EA 2A1RA 3AVNA 3SPYA 2EX3A 1FKPA 4CEEA 5CYQA 4DG1A 3QIOA 4DTMA 1JXEA 3NHGA 4DTJA 2G8WA 4YFUA 3C6UA 1XWLA 3MEGA 5HRRA 1X9SA 4KI6A 2X74A 4DU3A 2KTQA 1GOCA 4F2RA 4M3XA 4HHTA 4O4GA 3HYFA 4CIEA 4IG0A 1W0HA 3PX6A 1UA0A 4FJIA 1HYSA 5SWMA 3OYBA 3L3VA 1S1TA 3KLFA 4DSEA 1S9GA 4LH4A 4Z4IA 4FLYA 4W5OA 4E89A 4CHYA 2XO7A 4FLZA 1DLOA 4FZXC 4CFCA 4FJKA 1TKXA 1IKYA 1LAWA 4I9LA 4OPKA 4C8LA 4FK2A 1I3AA 1VSFA 3V9SA 4FLXA 1KCFA 3D0PA 2BE2A 1NK0A 1TK5A 2KZMA 4FW2A 5C25A 1EXQA 4FJ5A 5J2QA 3O4QA 4CCHA 4E19A 4C8KA 3NF8A 2IDOA 3ZSQA 4CJQA 2IGIA 3SYZA 2OPSA 3O3FA 1X9WA 1JXBA 3M8PA 1L3TA 3QEWA 4IFVA 3OYDA 1S1VA 1NKBA 2D5RA 4DTPA 2X6NA 3TAGA 3ZSVA 3WNGA 5J1EA 4CJFA 4DQIA 3L8BA 4FJ9A 1UA1A 3CFRA 1BCOA 1UAXA 2E4LA 3KTQA 2HHWA 5J2PA 1HRHA 1ITGA 4QAGA 4KB0A 4DLEA 4FLUA 2HHTA 3VA3A 1RDAA 3LAMA 4M41A 3VQCA 4FK0A 1TAQA 3OYJA 1ZBIA 3T1AA 4W5RA 3CM5A 2FBTA 2YNHA 4DWIA 3RMBA 2VG6A 3EYZA 4B3OA 4OJRA 4J2AA 1JL1A 4CF2A 1TKZA 3CFOA 3H08A 2Z1HA 2RPIA 1RT6A 3NGYA 1T8EA 3I8DA 4BWJA 3BDPA 5JS1A 2KZZA 3VQAA 1KLNA 3QEVA 3QEXA 1JLQA 4CK1A 2HVHA 3AVHA 4BDZA 4CJTA 3AO4A 1RTIA 4F4KA 3LPUA 3PV8A 3NE6A 3AA2A 2W42A 4OLBA 3C95A 1JLGA 4CJWA 3KKRA 4O0JA 2XY6A 4CIFA 4GW6A 2Y1JA 4Z4FA 4QCLA 5HBMA 4CE9A 3DRPA 1BI4B 4FM0A 3QLHA 1Z26A 1VSKA 1C0UA 1VSEA 2IC3A 4KTZA 1XI1A 3AA5X 2E6MA 4CHZA 1HPZA 4CFAA 3SNNA 1JLEA 3AO2A 3AVBA 3KLIA 3QINA 3SUNA 4KV8A 1ASVA 4CGDA 4FM2A 3M8RA 4DTXA 3TI0A 1KFSA 4C8MA 2HW3A 4CEQA 2OPRA 4NCAA 1WLJA 3DLGA 3VQ9A 2PYLA 4ELUA 4PQUA 4E3SA 1HQUA 3V6DA 1IH7A 1J54A 2VG7A 4Z4GA 3JYTA 1WNSA 4B9TA 4W5QA 2PYJA 3SV3A 4FZZA 4CGJA 4Z4CA 4FJHA 4O55A 3QERA 4DSJA 4I2PA 4KTQA 4E7IA 1SUQA 4CF0A 4KHNA 3HL8A 1J53A 3VQDA 1SL1A 2OYQA 1SV5A 5DMRA 3AVCA 1QHTA 4ICLA 3IAYA 4ZHRA 4OGCA 3V9WA 4KHSA 4KHQA 1KSPA 2BANA 1ZBLA 4KHWA 1BL3A 3HSTB 2AJQA 3NDKA 4AILC 1NJYA 2X6SA 1WSFA 1RNHA 4CJEA 1L3UA 2KFZA 4E0DA 1RBRA 3D45A 1T03A 3WNEA 1NOYA 1HNVA 1S1UA 4RG8A 3ZT1A 4FK4A 4W5NA 4DLGA 2HVIA 1U4BA 4ID5A 2OPPA 4EP4A 3SZ2A 1BHLA 4W5TA 2YHAA 1NJWA 4N56A 5HLFA 2XY5A 3K5NA 4DTOA 3F9KA 4JS5A 3TANA 3SUOA 4GVMA 4EZ9A 3CM6A 4CGFA 1LW2A 1LV5A 1NKEA 1WAJA 3L3UA 2HB5A 4E7HA 5HROA 1TKTA 4B8AB 2Z1JA 4TSXA 4BACA 1L3SA 2IS3A 5E41A 3CFPA 3MECA 2G8VA 2FBYA 3ZSZA 2Y1IA 3JSMA 2F8TA 1BI4A 4LD0A 1TAUA 4DTSA 2ITGA 4DSFA 3LALA 1HYZA 3OVNA 1U47A 3IS9A 3AO3A 2PY5A 4FJGA 1D9FA 4FW1A 3LZJA 4FJ7A 4CF9A 1QTMA 3PY8A 2KQ2A 5CYMA 3LP3A 4OKEA 1NOZA 1RT5A 2GUIA 4HTUA 4KO0A 4CHQA 5J2NA 2PZSA 4K8XA 1C1BA 3HO1A 5KRTA 4B9UA 4FJLA 4CJKA 1BGXT 1BCMA 1RBVA 4DTUA 1TGOA 2GV9A 3L2RA 2HHQA 1HNIA 3AO1A 3DM2A 1R0AA 3AV9A 2G8FA 3T3FA 4NCBA 4FLTA 2ETJA 3LAKA 1DTQA 3A2FA 1KFDA 1RILA 1KVBA 4GMJB 3QIPA 2XHBA 4M42A 1A5VA 1B92A 4BE0A 4CK2A 4XIUA 1VSDA 1FKOA 3IG1A 3V1RA 4RW7A 3S3OA 2P5OA 3MEDA 3SI6A 4B9LA 3VQ5A 4KTWA 1BQNA 3VQBA 4WE1A 3LWLA 4B9SA 1JLBA 4E1MA 3VQPA 4E1NA 1J9AA 3MXIA 4CFBA 1CXUA 3KK1A 1SKSA 1NJXA 3BGRA 3LP0A 4Z4HA 1RDCA 3LPTA 1HJRA 3C94A 3O3GA 1WSHA 1CXQA 1XHXA 5KRSA 3NF9A 3OYHA 1TL3A 3OJSA 4KAZA 1BISA 4J2EA 4RW4A 3ZT2A 4C8NA 2XY8A 4E7LA 3DOKA 4E7KA 1S5JA 3AA3A 1TK8A 1NK6A 4LH5A 3V9ZA 3ALYA 1X1PA 3AVMA 3DI6A 4RW8A 1B9FA 4LY7A 4CESA 3HXMA 1NJZA 3KD1E 1RBSA 3P83D 3K58A 3NAEA 4JRQA 1Q9XA 4HCBA 3SQ2A 1REVA 4CEZA 4I9QA 2D0CA 4AHRA 3QNOA 4AHCA 4KKOA 3DRSA 3LDSA 5HP1A 2HHUA 3KIOA 3P5JA 5HRPA 5FROA 4CHNA 3KK3A 3QNNA 3DLEA 5KI6A 4CJ3A 4FM1A 1YTAA 3P1GA 1UWBA 3TAPA 4KI4A 4BDPA 2VWKA 3ZT4A 1LWCA 3PO5A 1BIZA 4OVLA 1RDBA 1EP4A 2HHVA 1U04A 4B8CA 3VN5A 4IG3A 1IG9A 3RWUA 3I0RA 1HQEA 2FC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CED A;  4PA1 A;  1TKD A;  2FBX A;  4JLH A;  3KLH A;  1ZYQ A;  2KFN A;  3RRG A;  4B9V A;  3VQ7 A;  1T7P A;  1LW0 A;  3OYN A;  1VSJ A;  2IAJ A;  3NF6 A;  4KRF A;  3AVL A;  3T19 A;  3UIQ A;  2F96 A;  3ZCM A;  2Z1G A;  3S3M A;  1N5Y A;  1TVR A;  1YVU A;  4HVJ A;  4DU4 A;  3V81 A;  1SL2 A;  2OZM A;  4B9N A;  5FDL A;  1LAV A;  4M3T A;  1ASW A;  1KVC A;  2VG5 A;  3ZSW A;  1IKV A;  3S9H A;  1MU2 A;  3LP2 A;  3NGI A;  1CLQ A;  4UQG A;  3NH1 A;  1EET A;  4N47 A;  2F8S A;  3ZSX A;  1JLF A;  2YV0 X;  2QK9 A;  1UOC A;  4RW9 A;  2ZQB A;  4DQQ A;  3NGZ A;  2DFF A;  2Q3S A;  3QET A;  4DSI A;  4DQP A;  2G8I A;  4KHY A;  2DTU A;  4CFD A;  3DLK A;  4ELV A;  3K57 A;  5HRS A;  4DQS A;  5CY4 A;  2P1J A;  4KFB A;  4CJP A;  2RN2 A;  3RRH A;  3O4N A;  3TAF A;  4AHV A;  4YNQ A;  4CF8 A;  3HPO A;  2O4G A;  3L2V A;  1IKW A;  1JLA A;  3B6P A;  3VQ4 A;  4R5P A;  4HCC A;  2G8U A;  4DS4 A;  5FRN A;  2XY7 A;  2IOC A;  3VQE A;  5D3G A;  4Z4E A;  5J2M A;  4N5S A;  3L2W A;  4N41 A;  4AH9 A;  4JS4 A;  1QSL A;  1QQC A;  2X78 A;  2OZS A;  1C1A A;  1RT3 A;  4RW6 A;  3K59 A;  1Q9Y A;  4CJV A;  3DLB A;  2I5J A;  4Q5V A;  1NK4 A;  4CEO A;  3LAN A;  3OS2 A;  1KTQ A;  1FXX A;  3I0S A;  4H4M A;  5KTQ A;  2FBV A;  3HT3 A;  1SKW A;  3E01 A;  1RTJ A;  1WAF A;  4IDK A;  4B08 A;  3KLE A;  4KB1 A;  3NFA A;  3K5M A;  3AO5 A;  1NK7 A;  1RT7 A;  1Q8I A;  3AVI A;  3HVT A;  2E6L A;  1VSM A;  3G0Z A;  1JKH A;  1RBT A;  1YT3 A;  3KK2 A;  4DF8 A;  4C8O A;  3RMD A;  1O1W A;  5C24 A;  4J2D A;  3G10 A;  4F3T A;  4FJJ A;  4H4O A;  2B6A A;  2GBZ A;  3V1Q A;  3OYK A;  3DYA A;  3OYL A;  3EY1 A;  3THV A;  4F8R A;  4M3R A;  3MEE A;  4BWM A;  4FZY A;  4ZTJ A;  3F73 A;  1GOA A;  5SZT A;  4F3O A;  4BE1 A;  1VSL A;  3KLG A;  1D8Y A;  1D9D A;  1WSE A;  3SV4 A;  2DFE A;  4J2B A;  3PUF A;  3SQ0 A;  1B9D A;  3RMA A;  4JRP A;  3LZI A;  3U3G A;  2HMI A;  4CGH A;  3FFI A;  1EX4 A;  2ZD1 A;  5JS2 A;  4OLA A;  2OPQ A;  4CJS A;  3U6F A;  1DTT A;  3DLH A;  1S1W A;  1SKR A;  4HUG A;  1T05 A;  1IO2 A;  1NK8 A;  3TAQ A;  3AVJ A;  4FVM A;  1C0M A;  3DOL A;  4Z0U A;  2YNF A;  4M45 A;  3SQ1 A;  2HND A;  4IBN A;  1ZBF A;  2HNZ A;  4CJR A;  3EZ5 A;  2D0B A;  4DSL A;  1RT2 A;  3B6O A;  1XHZ A;  2XRI A;  3RTV A;  1Y97 A;  1LWE A;  4IKF A;  2YNG A;  4MFB A;  2RF2 A;  1U49 A;  1QS4 A;  1NKC A;  3ZT0 A;  4FJN A;  4LSN A;  1JL2 A;  3V4I A;  1CZ9 A;  3OY9 A;  3LP1 A;  3CQ8 A;  4Y1D A;  4I2Q A;  4NYN A;  3OYM A;  4DS5 A;  4ZTF A;  2LSN A;  5KGX A;  2ATQ A;  3NF7 A;  2HNY A;  4CEF A;  2D0A A;  2VWJ A;  1N6Q A;  4DU1 A;  4OPJ A;  2YKM A;  2EHG A;  2QXF A;  5CZ1 A;  4CIG A;  1EKE A;  1RCH A;  3QEI A;  3SPZ A;  3PX4 A;  3U3Y A;  4FYD A;  4DQR A;  2RKI A;  3OYE A;  3QES A;  2NUB A;  4FJM A;  4M3U A;  4FXD A;  3VQ8 A;  4KPY A;  3HJF A;  1D5A A;  1WSI A;  3NBP A;  4FJ8 A;  4PWD A;  4Q0B A;  3L2U A;  3SCX A;  3ZT3 A;  1VK0 A;  3TWH A;  2BGG A;  1K6Y A;  1GOB A;  3OYA A;  4KRE A;  1KLM A;  4G1Q A;  4NYF A;  4CER A;  4M3W A;  4CJ5 A;  3WNF A;  4CEC A;  1WSG A;  3ZSR A;  4CEA A;  4CJ4 A;  1TK0 A;  4CF1 A;  4EZ6 A;  1VSI A;  5FRM A;  1RTH A;  3ISN C;  5HRN A;  3SJJ A;  4OGE A;  4BE2 A;  2YKN A;  1U48 A;  4AHS A;  1WSJ A;  2OA8 A;  3OYF A;  5DK5 A;  2YNI A;  1L5U A;  5T7B A;  2B4J A;  4HUE A;  3C6T A;  4O0I A;  3DRR A;  5KGW A;  5EU7 A;  2O4I A;  3HPG A;  1JLC A;  2KW4 A;  4CEB A;  4FLV A;  4E7J A;  2JLE A;  3O3H A;  4PY5 A;  1S6Q A;  3RMC A;  1ZBH A;  5CZ2 A;  1I39 A;  2P51 A;  4EP5 A;  3AVF A;  1ZBU A;  1ASU A;  4CJU A;  4CHO A;  1TV6 A;  3IRX A;  3ITH A;  4HUF A;  3MAQ A;  3HVR A;  1X9M A;  1A5X A;  1BIU A;  1KRP A;  3DMJ A;  3NCI A;  1F21 A;  3VA0 A;  1RTD A;  4O5B A;  3LWM A;  3KKS A;  4CGG A;  3L2Q A;  4BDY A;  4ELT A;  2QKK A;  3ZSO A;  1TL1 A;  3S3N A;  3QEP A;  4K8Z A;  3AVK A;  4L8R B;  1VRT A;  2WON A;  2P5G A;  4M3Y A;  4DMN A;  1WN7 A;  4DFM A;  4M3Z A;  3HP9 A;  1C0T A;  4LSL A;  4NCG A;  1KVA A;  1S6P A;  3MXJ A;  3AVG A;  1U45 A;  3CG7 A;  2WOM A;  4N76 A;  3V9U A;  2QKB A;  4FLW A;  3OJU A;  2B5J A;  3VQ6 A;  2HHX A;  1XC9 A;  1FK9 A;  1YTU A;  3TAE A;  2YHB A;  4DTN A;  3SUQ A;  3TAM A;  3ULD A;  3V9X A;  1G15 A;  3V1O A;  5K14 A;  2DFH A;  3WNH A;  3OS1 A;  2A1S A;  2HHS A;  4B9M A;  1LWF A;  3DLR A;  3K2P A;  2G8K A;  4DSK A;  3NH2 A;  4FJX A;  5I3U A;  1RBU A;  1BQM A;  3KJV A;  3OS0 A;  2ZE2 A;  1RDD A;  4QOZ B;  3K5O A;  3RR8 A;  4ID1 A;  3KD5 E;  1QSY A;  5C42 A;  3CYM A;  1L3V A;  2G8H A;  3SQ4 A;  5I42 A;  3PO4 A;  1W9H A;  1RT1 A;  4DFK A;  1QSS A;  3PX0 A;  3RR7 A;  4MQ3 A;  3ZSY A;  3VQQ A;  4I7F A;  2Z1I A;  3OYI A;  1VRU A;  1J5O A;  2R7Y A;  3QO9 A;  3TAB A;  3K5L A;  2DY4 A;  4CHP A;  3HPH A;  1C1C A;  4H8K A;  3HP6 A;  4DFJ A;  4OKK A;  4FCY A;  4PUO A;  3OYC A;  3SUP A;  3MXM A;  1NK5 A;  1IKX A;  4KHU A;  1SL0 A;  4DTR A;  2JGU A;  1NK9 A;  4CK3 A;  3TR8 A;  4F2S A;  3OYG A;  4O44 A;  3ASM A;  3TAR A;  3HK2 A;  1QE1 A;  3NH0 A;  4DF4 A;  1Z25 A;  1CZB A;  1S1X A;  4IFY A;  1RT4 A;  4Y1C A;  4AHT A;  1A5W A;  3HM9 A;  1HMV A;  3AVA A;  3M8S A;  1C6V A;  4OKJ A;  4DFP A;  2BDP A;  3M8Q A;  4CJL A;  1HYV A;  1VSH A;  4CGI A;  4AHU A;  3AA4 A;  1S9E A;  2A1R A;  3AVN A;  3SPY A;  2EX3 A;  1FKP A;  4CEE A;  5CYQ A;  4DG1 A;  3QIO A;  4DTM A;  1JXE A;  3NHG A;  4DTJ A;  2G8W A;  4YFU A;  3C6U A;  1XWL A;  3MEG A;  5HRR A;  1X9S A;  4KI6 A;  2X74 A;  4DU3 A;  2KTQ A;  1GOC A;  4F2R A;  4M3X A;  4HHT A;  4O4G A;  3HYF A;  4CIE A;  4IG0 A;  1W0H A;  3PX6 A;  1UA0 A;  4FJI A;  1HYS A;  5SWM A;  3OYB A;  3L3V A;  1S1T A;  3KLF A;  4DSE A;  1S9G A;  4LH4 A;  4Z4I A;  4FLY A;  4W5O A;  4E89 A;  4CHY A;  2XO7 A;  4FLZ A;  1DLO A;  4FZX C;  4CFC A;  4FJK A;  1TKX A;  1IKY A;  1LAW A;  4I9L A;  4OPK A;  4C8L A;  4FK2 A;  1I3A A;  1VSF A;  3V9S A;  4FLX A;  1KCF A;  3D0P A;  2BE2 A;  1NK0 A;  1TK5 A;  2KZM A;  4FW2 A;  5C25 A;  1EXQ A;  4FJ5 A;  5J2Q A;  3O4Q A;  4CCH A;  4E19 A;  4C8K A;  3NF8 A;  2IDO A;  3ZSQ A;  4CJQ A;  2IGI A;  3SYZ A;  2OPS A;  3O3F A;  1X9W A;  1JXB A;  3M8P A;  1L3T A;  3QEW A;  4IFV A;  3OYD A;  1S1V A;  1NKB A;  2D5R A;  4DTP A;  2X6N A;  3TAG A;  3ZSV A;  3WNG A;  5J1E A;  4CJF A;  4DQI A;  3L8B A;  4FJ9 A;  1UA1 A;  3CFR A;  1BCO A;  1UAX A;  2E4L A;  3KTQ A;  2HHW A;  5J2P A;  1HRH A;  1ITG A;  4QAG A;  4KB0 A;  4DLE A;  4FLU A;  2HHT A;  3VA3 A;  1RDA A;  3LAM A;  4M41 A;  3VQC A;  4FK0 A;  1TAQ A;  3OYJ A;  1ZBI A;  3T1A A;  4W5R A;  3CM5 A;  2FBT A;  2YNH A;  4DWI A;  3RMB A;  2VG6 A;  3EYZ A;  4B3O A;  4OJR A;  4J2A A;  1JL1 A;  4CF2 A;  1TKZ A;  3CFO A;  3H08 A;  2Z1H A;  2RPI A;  1RT6 A;  3NGY A;  1T8E A;  3I8D A;  4BWJ A;  3BDP A;  5JS1 A;  2KZZ A;  3VQA A;  1KLN A;  3QEV A;  3QEX A;  1JLQ A;  4CK1 A;  2HVH A;  3AVH A;  4BDZ A;  4CJT A;  3AO4 A;  1RTI A;  4F4K A;  3LPU A;  3PV8 A;  3NE6 A;  3AA2 A;  2W42 A;  4OLB A;  3C95 A;  1JLG A;  4CJW A;  3KKR A;  4O0J A;  2XY6 A;  4CIF A;  4GW6 A;  2Y1J A;  4Z4F A;  4QCL A;  5HBM A;  4CE9 A;  3DRP A;  1BI4 B;  4FM0 A;  3QLH A;  1Z26 A;  1VSK A;  1C0U A;  1VSE A;  2IC3 A;  4KTZ A;  1XI1 A;  3AA5 X;  2E6M A;  4CHZ A;  1HPZ A;  4CFA A;  3SNN A;  1JLE A;  3AO2 A;  3AVB A;  3KLI A;  3QIN A;  3SUN A;  4KV8 A;  1ASV A;  4CGD A;  4FM2 A;  3M8R A;  4DTX A;  3TI0 A;  1KFS A;  4C8M A;  2HW3 A;  4CEQ A;  2OPR A;  4NCA A;  1WLJ A;  3DLG A;  3VQ9 A;  2PYL A;  4ELU A;  4PQU A;  4E3S A;  1HQU A;  3V6D A;  1IH7 A;  1J54 A;  2VG7 A;  4Z4G A;  3JYT A;  1WNS A;  4B9T A;  4W5Q A;  2PYJ A;  3SV3 A;  4FZZ A;  4CGJ A;  4Z4C A;  4FJH A;  4O55 A;  3QER A;  4DSJ A;  4I2P A;  4KTQ A;  4E7I A;  1SUQ A;  4CF0 A;  4KHN A;  3HL8 A;  1J53 A;  3VQD A;  1SL1 A;  2OYQ A;  1SV5 A;  5DMR A;  3AVC A;  1QHT A;  4ICL A;  3IAY A;  4ZHR A;  4OGC A;  3V9W A;  4KHS A;  4KHQ A;  1KSP A;  2BAN A;  1ZBL A;  4KHW A;  1BL3 A;  3HST B;  2AJQ A;  3NDK A;  4AIL C;  1NJY A;  2X6S A;  1WSF A;  1RNH A;  4CJE A;  1L3U A;  2KFZ A;  4E0D A;  1RBR A;  3D45 A;  1T03 A;  3WNE A;  1NOY A;  1HNV A;  1S1U A;  4RG8 A;  3ZT1 A;  4FK4 A;  4W5N A;  4DLG A;  2HVI A;  1U4B A;  4ID5 A;  2OPP A;  4EP4 A;  3SZ2 A;  1BHL A;  4W5T A;  2YHA A;  1NJW A;  4N56 A;  5HLF A;  2XY5 A;  3K5N A;  4DTO A;  3F9K A;  4JS5 A;  3TAN A;  3SUO A;  4GVM A;  4EZ9 A;  3CM6 A;  4CGF A;  1LW2 A;  1LV5 A;  1NKE A;  1WAJ A;  3L3U A;  2HB5 A;  4E7H A;  5HRO A;  1TKT A;  4B8A B;  2Z1J A;  4TSX A;  4BAC A;  1L3S A;  2IS3 A;  5E41 A;  3CFP A;  3MEC A;  2G8V A;  2FBY A;  3ZSZ A;  2Y1I A;  3JSM A;  2F8T A;  1BI4 A;  4LD0 A;  1TAU A;  4DTS A;  2ITG A;  4DSF A;  3LAL A;  1HYZ A;  3OVN A;  1U47 A;  3IS9 A;  3AO3 A;  2PY5 A;  4FJG A;  1D9F A;  4FW1 A;  3LZJ A;  4FJ7 A;  4CF9 A;  1QTM A;  3PY8 A;  2KQ2 A;  5CYM A;  3LP3 A;  4OKE A;  1NOZ A;  1RT5 A;  2GUI A;  4HTU A;  4KO0 A;  4CHQ A;  5J2N A;  2PZS A;  4K8X A;  1C1B A;  3HO1 A;  5KRT A;  4B9U A;  4FJL A;  4CJK A;  1BGX T;  1BCM A;  1RBV A;  4DTU A;  1TGO A;  2GV9 A;  3L2R A;  2HHQ A;  1HNI A;  3AO1 A;  3DM2 A;  1R0A A;  3AV9 A;  2G8F A;  3T3F A;  4NCB A;  4FLT A;  2ETJ A;  3LAK A;  1DTQ A;  3A2F A;  1KFD A;  1RIL A;  1KVB A;  4GMJ B;  3QIP A;  2XHB A;  4M42 A;  1A5V A;  1B92 A;  4BE0 A;  4CK2 A;  4XIU A;  1VSD A;  1FKO A;  3IG1 A;  3V1R A;  4RW7 A;  3S3O A;  2P5O A;  3MED A;  3SI6 A;  4B9L A;  3VQ5 A;  4KTW A;  1BQN A;  3VQB A;  4WE1 A;  3LWL A;  4B9S A;  1JLB A;  4E1M A;  3VQP A;  4E1N A;  1J9A A;  3MXI A;  4CFB A;  1CXU A;  3KK1 A;  1SKS A;  1NJX A;  3BGR A;  3LP0 A;  4Z4H A;  1RDC A;  3LPT A;  1HJR A;  3C94 A;  3O3G A;  1WSH A;  1CXQ A;  1XHX A;  5KRS A;  3NF9 A;  3OYH A;  1TL3 A;  3OJS A;  4KAZ A;  1BIS A;  4J2E A;  4RW4 A;  3ZT2 A;  4C8N A;  2XY8 A;  4E7L A;  3DOK A;  4E7K A;  1S5J A;  3AA3 A;  1TK8 A;  1NK6 A;  4LH5 A;  3V9Z A;  3ALY A;  1X1P A;  3AVM A;  3DI6 A;  4RW8 A;  1B9F A;  4LY7 A;  4CES A;  3HXM A;  1NJZ A;  3KD1 E;  1RBS A;  3P83 D;  3K58 A;  3NAE A;  4JRQ A;  1Q9X A;  4HCB A;  3SQ2 A;  1REV A;  4CEZ A;  4I9Q A;  2D0C A;  4AHR A;  3QNO A;  4AHC A;  4KKO A;  3DRS A;  3LDS A;  5HP1 A;  2HHU A;  3KIO A;  3P5J A;  5HRP A;  5FRO A;  4CHN A;  3KK3 A;  3QNN A;  3DLE A;  5KI6 A;  4CJ3 A;  4FM1 A;  1YTA A;  3P1G A;  1UWB A;  3TAP A;  4KI4 A;  4BDP A;  2VWK A;  3ZT4 A;  1LWC A;  3PO5 A;  1BIZ A;  4OVL A;  1RDB A;  1EP4 A;  2HHV A;  1U04 A;  4B8C A;  3VN5 A;  4IG3 A;  1IG9 A;  3RWU A;  3I0R A;  1HQE A;  2FC0 A; 
#chains in the Genus database with same CATH topology
 3QBX A;  1NMN A;  3RRG A;  2P9L A;  2IAJ A;  3AVL A;  3UIQ A;  2QWO A;  4I6M A;  4IOC L;  4DCH A;  4H0X B;  1YVU A;  3D7E O;  4MLE A;  4YDU A;  1E4G T;  1HUX A;  1KVC A;  4UQG A;  3PSI A;  4JI7 K;  2YV0 X;  2QK9 A;  4CZI A;  2FSN A;  3NGZ A;  2Q3S A;  2G8I A;  2DTU A;  4ELV A;  2YCH A;  2P1J A;  5TKW A;  2NRV A;  4CF8 A;  3HPO A;  1NMD A;  3ZX0 A;  1NGH A;  4BRG A;  3KWG A;  5D3G A;  2E2P A;  4BRL A;  4NXM K;  1QQC A;  1C1A A;  4CJV A;  3DLB A;  2I5J A;  1R59 O;  4CD1 A;  3LL3 A;  5AFU H;  5KTQ A;  4C23 A;  3KLE A;  3BF3 A;  3AO5 A;  3W3D A;  3EZW A;  1HKC A;  4DF8 A;  1YT3 A;  1O1W A;  1DT9 A;  2B6A A;  5KPT A;  4JI5 K;  4KH4 A;  4M3R A;  3L0Q A;  3VEX A;  5SZT A;  4F3O A;  1MWM A;  1FW6 A;  1GLD G;  3PUF A;  1QQM A;  1B9D A;  3IDH A;  3U3G A;  2HMI A;  4CGH A;  4JK7 A;  3FFI A;  2ZD1 A;  5JS2 A;  2OPQ A;  4I6M B;  2F9W A;  4HUG A;  2OAN A;  3TAQ A;  3AVJ A;  2CH5 A;  2A40 A;  4Z0U A;  2YNF A;  3VF4 A;  3KWI A;  1ZBF A;  2HNZ A;  4DSL A;  2D0B A;  4GY2 B;  1RT2 A;  2ASO A;  3FZH A;  1NKC A;  1XNQ K;  5BPN A;  3MMV A;  4H5W A;  2QI2 A;  3WQU A;  3O9T A;  4Y1D A;  4I2Q A;  4NYN A;  2LSN A;  3E1Y A;  4KHP K;  3NF7 A;  1GLE G;  5CZ1 A;  2QXF A;  3VPZ A;  4DR5 K;  3SAH A;  4FYD A;  3SPZ A;  3PX4 A;  1I94 K;  2NUB A;  4FXD A;  4H0O A;  2HF3 A;  4KPY A;  4WFN L;  3HJF A;  1WSI A;  4PKG A;  1NGF A;  3ZT3 A;  2P9P B;  3OYA A;  4KRE A;  1KLM A;  4CER A;  4B3S K;  1T6D A;  4CEC A;  1TK0 A;  3T7Z A;  3P38 A;  3SJJ A;  2Q97 A;  1U48 A;  3MX5 A;  1QHA A;  4FL9 A;  1L5U A;  5T7B A;  4O0I A;  2IIR A;  5EU7 A;  1JLC A;  2HF4 A;  2QWN A;  4E7J A;  4RTF D;  3RMC A;  1ZBH A;  3CD6 N;  1NNE A;  1I39 A;  4FWM A;  4WFA L;  3AVF A;  2GEL A;  2JWL A;  1ZBU A;  5DM6 L;  3H1Q A;  3NVM A;  4JI3 K;  4HUF A;  2QM1 A;  1BIU A;  3NCI A;  2F4V K;  4O5B A;  3KKS A;  2QKK A;  1TUU A;  3QEP A;  4GKJ K;  4LSL A;  4LF8 K;  1KAY A;  3MXJ A;  3CHW A;  2D0P A;  3AVG A;  4B9Q A;  2QKB A;  3RSE B;  3SMS A;  3CC2 N;  1VQM N;  3SUQ A;  4A2B A;  1OH6 A;  1G15 A;  5I9E B;  2HHS A;  5AQP A;  3DLR A;  2OCE A;  4EHU A;  4QOZ B;  3K5O A;  2A42 A;  3KD5 E;  1EQY A;  5I42 A;  3SMP A;  1QSS A;  3RR7 A;  4MQ3 A;  3VQQ A;  4JK9 A;  3OYI A;  5C15 A;  2O8E A;  3P31 A;  4WYB A;  4B1Z A;  4DFJ A;  3MN5 A;  2NRZ A;  3WXL A;  3MXM A;  2I7P A;  3TAR A;  3HK2 A;  1KAZ A;  1Z25 A;  1S1X A;  4AHT A;  1A5W A;  1MWK A;  1VQL N;  2CGJ A;  4DFP A;  5EX5 A;  3M8Q A;  4IEE A;  1VSH A;  4CJL A;  1W97 L;  4DFM A;  4CEE A;  5CYQ A;  2G8W A;  2IVN A;  1JXE A;  4DR7 K;  4XH4 A;  5KQ8 A;  4X65 K;  1XWL A;  2FSJ A;  4LF7 K;  4HHT A;  4YOV A;  3RSE A;  3PX6 A;  1HYS A;  5SWM A;  4LF6 K;  3KLF A;  4FLY A;  2WBN A;  3VET A;  1S3X A;  1RDU A;  2XO7 A;  1DLO A;  4FZX C;  4CFC A;  1TKX A;  2VYP A;  4I9L A;  1KQS M;  3GDQ A;  3D2F A;  4FLX A;  5ADX H;  2BE2 A;  1NK0 A;  2O8D A;  5C25 A;  5F1X A;  3WXM B;  3ZLJ A;  3ULE A;  2QWM A;  4CCH A;  3NF8 A;  1VQ8 N;  4DR1 K;  2IGI A;  4AQY K;  1JXB A;  3HI0 A;  3DAW A;  3AGR A;  1L3T A;  1S1V A;  1NKB A;  2X6N A;  5EOY A;  1UA1 A;  1BCO A;  1VHX A;  1UAX A;  1X3N A;  3J7Z O;  3E9P A;  1XMO K;  3O4W A;  1HNZ K;  1YI2 N;  1RDA A;  4M41 A;  1OH5 A;  4CD3 A;  2QTD A;  2ASM A;  3A5L C;  4O8U A;  5AQK A;  3RMB A;  2VG6 A;  5FLX O;  2ZJQ L;  3QML A;  3CFO A;  2Z1H A;  1NGJ A;  3BDP A;  3QEV A;  4FWS A;  4BDZ A;  4CJT A;  3AO4 A;  1RTI A;  2KHO A;  2V52 B;  3K9K A;  3ENB A;  4IDH A;  3AA2 A;  2W42 A;  4CJW A;  2VWB A;  3KKR A;  4O0J A;  4CIF A;  4ILG B;  4CE9 A;  3THY A;  1YIT N;  4Z94 A;  1VSE A;  3AA5 X;  1ESV A;  4LF9 K;  3FLC O;  1HPZ A;  4CFA A;  3SUN A;  2CGK A;  4FM2 A;  4DTX A;  5MLC Q;  1HKB A;  3TI0 A;  2E5L K;  2HW3 A;  4MDB A;  4NCA A;  2OPR A;  1YAG A;  4ELU A;  4E3S A;  3O9Q A;  1J54 A;  3M5R A;  4Z4G A;  5M1K A;  4B9T A;  3THW A;  4FPA A;  4LFC K;  3CJC A;  3QER A;  4E7I A;  1SUQ A;  4IFE A;  4CF0 A;  1J53 A;  4JYA K;  5DMR A;  4ICL A;  1QHT A;  3O1B A;  4CZJ A;  4B3T K;  1SS6 A;  4KHS A;  4KHW A;  1ZBL A;  3JXU A;  4AIL C;  2X6S A;  5AQT A;  4B1Y B;  3J7Y P;  1HX1 A;  4E0D A;  3D45 A;  4W5N A;  4B1U B;  2HVI A;  4ID5 A;  5AQW A;  4MO5 A;  3K5N A;  4DTO A;  3F9K A;  4BVO A;  2QWP A;  1LW2 A;  1WAJ A;  3CCQ N;  3L3U A;  4WFB L;  2Z1J A;  5LJW A;  4BAC A;  4JV5 K;  3LDQ A;  5AQH A;  4BRA A;  5E41 A;  1XC3 A;  2G8V A;  3UB5 A;  2Y1I A;  3JSM A;  2F8T A;  3QBW A;  4JKD A;  1EWQ A;  1OKJ A;  4LD0 A;  3ATV A;  3WXJ A;  2UXC K;  4DTS A;  2ITG A;  4CBX A;  3LAL A;  1HYZ A;  3OVN A;  4FW1 A;  3LZJ A;  5CYM A;  4HTU A;  2PZS A;  1RT5 A;  1VAZ A;  4EHT A;  4DB3 A;  3Q7C A;  2GV9 A;  2QW9 A;  3AV9 A;  3BF1 A;  2YI1 A;  1ATS A;  3LAK A;  4M42 A;  5JIC A;  3IG1 A;  4B9L A;  4KTW A;  4B9S A;  1IV0 A;  3KK1 A;  3BGR A;  3LPT A;  3O3G A;  1XHX A;  1CXQ A;  5KRS A;  2NRW A;  1BIS A;  3I55 N;  3TU5 A;  2V51 B;  4E7K A;  1S5J A;  1NK6 A;  4LH5 A;  3V9Z A;  3ALY A;  3AVM A;  4BGB A;  3WXI A;  4LY7 A;  3P83 D;  1Q9X A;  1N36 K;  5LMU K;  2D0C A;  4AHR A;  1YJ9 N;  2QWQ A;  4FWL A;  3CCM N;  3DRS A;  3KIO A;  5C10 A;  1YHQ N;  4WCE L;  4B3R K;  1X9J A;  3DLE A;  4FSV A;  5KI6 A;  3P1G A;  1BDG A;  4KI4 A;  4BDP A;  3ZT4 A;  1BIZ A;  3UKU A;  1NGB A;  1U04 A;  5BRF A;  3F2K A;  4PL8 A;  4GV3 A;  2FC0 A;  4CED A;  1BU6 O;  4JLH A;  4IEI A;  4XH5 A;  2KFN A;  4H03 B;  3VQ7 A;  1T7P A;  4B9V A;  2ZWH A;  3OYN A;  1IBK K;  4KRF A;  1XQS C;  3ZCM A;  2Z1G A;  3S3M A;  1TVR A;  4ISG A;  4DU4 A;  1M90 O;  1SL2 A;  1JCF A;  4YHH K;  1LAV A;  4JN4 A;  1ASW A;  4XH1 A;  3ZSW A;  3S9H A;  1XMQ K;  1MU2 A;  3LP2 A;  3MWT A;  1EET A;  4N47 A;  3ZSX A;  1JLF A;  3H3N O;  2ZQB A;  4DQP A;  1BA0 A;  4CFD A;  3K57 A;  4DQS A;  5AQY A;  5C2D A;  3VGL A;  4CJP A;  4DR6 K;  3O4N A;  3TAF A;  4AHV A;  3D2E A;  3B6P A;  1BOT O;  3DXK A;  5FPN A;  3VQ4 A;  3QDK A;  4R5P A;  2G8U A;  3VF6 A;  3VQE A;  2E2N A;  2ITM A;  3C6H A;  5J2M A;  4AH9 A;  4JS4 A;  2PFU A;  1NJI O;  1QSL A;  4RW6 A;  1RT3 A;  4NLC A;  4Q5V A;  4CEO A;  3LAN A;  3CCR N;  1KTQ A;  2E88 A;  5F2R A;  1FXX A;  3I0S A;  3IUC A;  3VGM A;  2EWS A;  1RTJ A;  4WQ5 C;  4IDK A;  4B08 A;  1KC8 O;  4KB1 A;  4IJA A;  3HOS A;  1NK7 A;  1RT7 A;  3AVI A;  2O8C A;  3UKU B;  3HSC A;  4H0P A;  2D1K A;  3G0Z A;  1RBT A;  3FZK A;  2FF6 A;  1VQO N;  4J2D A;  3G10 A;  3OYL A;  3V1Q A;  2P9U A;  3MEE A;  4FZY A;  4ZTJ A;  3THY B;  1BG3 A;  1VSL A;  3IMX A;  1D9D A;  1WSE A;  4J2B A;  2HST A;  3RMA A;  1EO1 A;  4A2A A;  4DV4 K;  2IVO A;  4OLA A;  5B8H A;  3CCL N;  4H5T A;  3DLH A;  2GX9 A;  3P39 A;  1T05 A;  4BRI A;  4BRQ A;  5JLH A;  2HND A;  3EZ5 A;  2P9K B;  1JCE A;  3B6O A;  3RTV A;  4IOA L;  2HHH K;  2AA4 A;  4MFB A;  1QS4 A;  3ZT0 A;  3WXK A;  4DS5 A;  2E2Q A;  3TSU A;  2Q31 A;  5JVG L;  4LF5 K;  1EKE A;  3SJH A;  4CBU A;  4M3U A;  1ZBS A;  4OPH A;  3MCA B;  4Q0B A;  3L2U A;  1VK0 A;  1K6Y A;  3AAR A;  1X3M A;  3CCV N;  3ZSR A;  4CF1 A;  4NB4 A;  3H3O B;  5HRN A;  4OGE A;  4BE2 A;  1RGI A;  4AHS A;  2YNI A;  2B4J A;  4HUE A;  3G4S N;  3O6W A;  1Q82 O;  3CCJ N;  2JLE A;  3O3H A;  4PY5 A;  4DV7 K;  4H5R A;  4IXC A;  1ASU A;  4CHO A;  2P9P A;  3QFU A;  3MAQ A;  1BWF O;  5AQR A;  3AAP A;  3PLA A;  3VA0 A;  3L2Q A;  4BDY A;  2Q2R A;  1TL1 A;  3D6R A;  3AVK A;  4M3Y A;  4DMN A;  4M3Z A;  3EN9 A;  4DR2 K;  1C0T A;  3U9D A;  1S6P A;  2WOM A;  3OJU A;  1XC9 A;  3TAM A;  3VES A;  3ULD A;  3TTD A;  3FR0 A;  3V1O A;  3V9X A;  3A5N C;  4CVN E;  4FO0 A;  2A1S A;  4FJX A;  4JI1 K;  1N34 K;  1BQM A;  1E4F T;  3DLL L;  1D4X A;  2ZE2 A;  4X66 K;  1RDD A;  4ISF A;  3RR8 A;  2FXU A;  5C42 A;  3CYM A;  3PX0 A;  3ZSY A;  1J5O A;  1NWK A;  3QO9 A;  3TAB A;  4CHP A;  4YOT A;  3HPH A;  1C1C A;  4H8K A;  3HP6 A;  4FCY A;  3OYC A;  1IKX A;  4KHU A;  4DTR A;  4CK3 A;  3OYG A;  3I33 A;  1H1V A;  1QE1 A;  3CPE A;  3NH0 A;  4IFY A;  4Y1C A;  4BR7 A;  3AVA A;  3M8S A;  4OO1 J;  1C6V A;  3NMU A;  5AQO A;  5HL7 L;  3AA4 A;  1S9E A;  4DUY K;  2A1R A;  2HBJ A;  3AVN A;  3SPY A;  2EX3 A;  4M7Y A;  4DG1 A;  3QIO A;  4DTM A;  2NNW A;  3MX2 A;  5GIN A;  3NHG A;  4DTJ A;  3C6U A;  5HRR A;  5GAD P;  4DU3 A;  1Q7Y O;  3HYF A;  1W0H A;  5KPR A;  3C6A A;  4FJI A;  1G99 A;  5A2Q O;  1S9G A;  4W5O A;  2GEM A;  2P9N A;  3CCE N;  4FK2 A;  2O8E B;  1KCF A;  4NLB A;  1TK5 A;  4FW2 A;  4DKW A;  1EXQ A;  3HM8 A;  4NO7 A;  3D2E B;  3ZSQ A;  3N4Q A;  3QEW A;  2D5R A;  4DTP A;  3TAG A;  3BY5 A;  3ZSV A;  3WNG A;  1YJN N;  5LY3 A;  2HHW A;  2GWK A;  1ITG A;  5GIP A;  3CPW M;  3DWL A;  5AZJ A;  4Y0W A;  2AP1 A;  3OYJ A;  3SLC A;  4CZM A;  4AM7 A;  3T1A A;  2FBT A;  4FWQ A;  4DWI A;  4OJR A;  3IKM A;  1HNX K;  3H08 A;  3BZC A;  1T8E A;  2RPI A;  3NGY A;  4CZE A;  1Q18 A;  1LOT B;  5JS1 A;  4EAH D;  3VQA A;  4JEP A;  2NLX A;  2P9U B;  2HVH A;  3AVH A;  5AQG A;  4F4K A;  4JK8 A;  2QWL A;  4OLB A;  5BN9 A;  3C95 A;  4JKB A;  4GW6 A;  1BI4 B;  4FM0 A;  3EO3 A;  1ATR A;  4BRK A;  1VSK A;  1C0U A;  2UU9 K;  2IC3 A;  1XI1 A;  2W6K A;  2E6M A;  3ID6 A;  3SNN A;  1JLE A;  1HLU A;  3AVB A;  3KLI A;  3QIN A;  1VQ9 N;  4X64 K;  1ASV A;  3M8R A;  1KFS A;  3ENH A;  2P9N B;  3VQ9 A;  4PQU A;  3SBG A;  3V6D A;  2VG7 A;  3P4I A;  3JYT A;  1WNS A;  2PYJ A;  3EL2 A;  4CGJ A;  4FJH A;  4O55 A;  4I2P A;  3J81 O;  4JI6 K;  5AQJ A;  2OYQ A;  5BN8 A;  3V9W A;  1OH8 A;  2AJQ A;  3OTO K;  5AZJ B;  1YXQ A;  1RNH A;  4CJE A;  1L3U A;  1OH7 A;  3Q7B A;  1IG8 A;  3KZB A;  1T03 A;  1XUP O;  5AZI A;  3WNE A;  3ZT1 A;  5GAG P;  4DLG A;  1N32 K;  1U4B A;  4EP4 A;  1BHL A;  1NJW A;  4N56 A;  4CZG A;  5HLF A;  1K8K B;  3O9U A;  4JS5 A;  2E1Z A;  4EZ9 A;  3CM6 A;  2HBM A;  2HB5 A;  4O8K A;  4TSX A;  4BRF A;  3CFP A;  2UYT A;  1BI4 A;  4DSF A;  3A5O C;  5LJV A;  3AO3 A;  4FJG A;  1D9F A;  2ZM6 K;  3H1V X;  1QTM A;  3C7N A;  4O5F A;  3CET A;  1NOZ A;  2GUI A;  4CHQ A;  5J2N A;  4K8X A;  1C1B A;  4BR0 A;  2ZF5 O;  5KRT A;  4CJK A;  1RBV A;  3PIP L;  1MA9 B;  1HNI A;  2FSK A;  3DM2 A;  3T3F A;  4NCB A;  4FLT A;  2ETJ A;  4IOX A;  1RIL A;  1KVB A;  4DV6 K;  2XHB A;  1A5V A;  1K9M O;  1ILY A;  3VEO A;  3G25 A;  3PIO L;  1FKO A;  2BH1 A;  4BY9 C;  1KD1 O;  5CHI A;  3S3O A;  3SI6 A;  3VQ5 A;  4E1M A;  4H0Y B;  4YOW A;  1SKS A;  3LP0 A;  1WBD A;  4Z4H A;  1RDC A;  1TYQ B;  2V7Y A;  5H1S Q;  1WSH A;  3TTF A;  4A61 A;  3OYH A;  4B1V A;  4J2E A;  3TSP A;  3EKS A;  3GOI A;  5GAH P;  3AA3 A;  1SAZ A;  2A41 A;  1B9F A;  1NJZ A;  4CES A;  1RBS A;  2GUP A;  5FPE A;  4JRQ A;  3QNO A;  4RWT A;  4AHC A;  3MDQ A;  3O08 A;  5HP1 A;  2HHU A;  4CHN A;  4FM1 A;  1UWB A;  3TAP A;  2VWK A;  3N4P A;  4OVL A;  4BQZ A;  3FZL A;  2E1Y A;  2P9K A;  2DFF A;  5BRH A;  1ZYQ A;  5C2F A;  3NF6 A;  2F96 A;  2VCP A;  1NM1 A;  1N5Y A;  2OZM A;  3CI5 A;  3EE8 A;  5FDL A;  2YHW A;  4JKG A;  2VG5 A;  4DR3 K;  1IKV A;  1CLQ A;  2P9I A;  3NH1 A;  3WEE B;  2F8S A;  4BR2 A;  2KLA A;  3MN7 A;  4DQQ A;  4LF4 K;  2UXD K;  3L4Q A;  4JI4 K;  4JD2 A;  5CY4 A;  4KFB A;  5E26 A;  1RDW X;  2RN2 A;  2YHX A;  3RRH A;  4MDA A;  4YNQ A;  2O4G A;  1IKW A;  1GLJ O;  3ZYY X;  2QA4 N;  2XY7 A;  3BUZ B;  5BR8 K;  1SQK A;  5AR0 A;  1EWR A;  2X78 A;  1Q9Y A;  3K59 A;  4A5B A;  2YJF A;  2VGM A;  2VQF K;  2Q0R A;  4IZ9 A;  4H4M A;  2FBV A;  3HT3 A;  1SKW A;  3E01 A;  3VOV A;  1WAF A;  3I8B A;  3K5M A;  1OVY A;  1Q8I A;  3HVT A;  1Q86 O;  2WUS A;  1JKH A;  3KK2 A;  1VQ5 N;  3FZM A;  4C8O A;  4CW7 B;  4F3T A;  4FJJ A;  4H4O A;  3OYK A;  3THV A;  3DYA A;  2QEX N;  4WQ4 A;  4BWM A;  2ZGY A;  1W7A A;  4BE1 A;  1Z05 A;  3KLG A;  5FPD A;  5AQF A;  4ILJ A;  4X62 K;  3SV4 A;  2PAV A;  3U4L A;  4JRP A;  3LZI A;  3VER A;  4FWK A;  1EX4 A;  4CJS A;  4PKI A;  3U6F A;  3CER A;  1SKR A;  3WEE A;  1IO2 A;  1NK8 A;  4FVM A;  1S72 N;  1C0M A;  2BTF A;  4M45 A;  4PL7 A;  3SQ1 A;  4IBN A;  4CJR A;  4BC5 A;  2XRI A;  2YNG A;  4FJN A;  4QS7 A;  1SZ2 A;  4WF9 L;  4FVU A;  4V19 S;  3OY9 A;  3CQ8 A;  3OYM A;  5KGX A;  2ATQ A;  2HNY A;  4B1X B;  4OPJ A;  4JNE A;  2YKM A;  3QEI A;  1RCH A;  4DQR A;  2WC9 A;  3GG4 A;  3OYE A;  4PWD A;  4FJ8 A;  3ENO A;  3TWH A;  3ZX2 A;  3THX B;  1GOB A;  4G1Q A;  1J5E K;  4GKK K;  5F0X A;  4M3W A;  4YDU C;  3I56 N;  4CEA A;  4CJ4 A;  1VSI A;  5FRM A;  1RTH A;  3O8M A;  3OYF A;  3C6T A;  3DRR A;  2O4I A;  3GBT A;  2KW4 A;  4CEB A;  3M1F A;  4FLV A;  1VQK N;  3T1H K;  5CZ2 A;  2P51 A;  5BPM A;  4FOI A;  5ADX A;  1TV6 A;  3BEX A;  3HVR A;  3G6E N;  3DMJ A;  2FF3 B;  1KRP A;  1RTD A;  4CGG A;  3CMA N;  3M3Z A;  4K8Z A;  1CZA N;  2P5G A;  1WN7 A;  1QQO A;  4E1J A;  1KVA A;  3VGK A;  1U45 A;  3CG7 A;  4H5N A;  2W41 A;  4N76 A;  3V9U A;  2HHX A;  3VQ6 A;  2DPN A;  1YTU A;  3ZET B;  3TAE A;  4DTN A;  2ASP A;  1NBW A;  2CH6 A;  2RE2 A;  1XNR K;  4L3Q A;  5K14 A;  2OTJ N;  5M1F A;  3OS1 A;  4DSK A;  1LWF A;  3NH2 A;  5I3U A;  3FE1 A;  1RBU A;  3KJV A;  4BR9 A;  3OS0 A;  1TUY A;  4DV2 K;  4ID1 A;  3DJC A;  3LDO A;  1GLF O;  4DFK A;  1RT1 A;  1YIJ N;  4NXN K;  5AQX A;  3CJ7 A;  2Z1I A;  1VRU A;  4KH6 A;  5AQI A;  4PUO A;  1NK5 A;  4YOX A;  2JGU A;  4DF4 A;  3CJ1 A;  3HM9 A;  1RT4 A;  5JMV A;  1RFQ A;  4OKJ A;  2O8C B;  2BDP A;  1HYV A;  4CGI A;  4AHU A;  3LDN A;  1FKP A;  4FJ5 A;  5M1N A;  4YFU A;  4B3M K;  3CF5 L;  1X9S A;  4KI6 A;  5AZI B;  3U8X A;  2X74 A;  2KTQ A;  1GOC A;  4M3X A;  2CGL A;  4IG0 A;  1UA0 A;  4JKH A;  3OYB A;  5BRE A;  1JCG A;  1S1T A;  4LH4 A;  1Z6R A;  4BRD A;  3VEV A;  4BRM A;  1IBL K;  1NGA A;  3VMF B;  4FLZ A;  3D2F B;  1DEJ A;  4C8L A;  4EFH A;  1YVN A;  4JD2 B;  2OTL N;  4DHY A;  5J2Q A;  3O4Q A;  2UUB K;  4E19 A;  4CJQ A;  2OPS A;  3ZX3 A;  3M8P A;  4IFV A;  3OYD A;  1HJO A;  4GVE A;  5J1E A;  4CJF A;  4BRH A;  3L8B A;  3CFR A;  3J80 O;  3KTQ A;  5J2P A;  1HRH A;  4DLE A;  4KH5 A;  3AGK A;  1KXP A;  1HNW K;  1TAQ A;  3HTV A;  1NGD A;  3EE9 A;  4C1N K;  1ZBI A;  4W5R A;  3CM5 A;  1U2V A;  1QVG M;  3C7N B;  4B3O A;  3C65 A;  4CF2 A;  5DM7 L;  3F5T A;  1V4T A;  1KLN A;  5E84 A;  4OX9 K;  2A5X A;  5LL6 Z;  4BR5 A;  4DV1 K;  3A5M C;  2XY6 A;  4FPB A;  5HBM A;  3DRP A;  2Q1N A;  4JHD B;  3QLH A;  1Z26 A;  1NU0 A;  5EVZ A;  4KTZ A;  4HWI A;  3AO2 A;  4CGD A;  2UXB K;  5AQQ A;  3G71 N;  3THW B;  2QXL A;  1HQU A;  4BQL A;  3SBT A;  4FZZ A;  4QS9 A;  4Z4C A;  4DSJ A;  4CJ7 A;  4FWN A;  2O8B B;  3HL8 A;  1ATN A;  1SV5 A;  1GLA G;  3AY9 A;  4ZHR A;  4OGC A;  4KHQ A;  4BRN A;  1KSP A;  2BAN A;  3WT0 A;  3NDK A;  1NLV A;  5AQV A;  1WSF A;  4WQ5 A;  4F9O A;  1NOY A;  1S1U A;  4LC9 B;  4FK4 A;  3KK7 A;  3ATU A;  4W5T A;  4AM6 A;  4BRP A;  2Q36 A;  3SZ2 A;  2XY5 A;  1DKG D;  3A8Y A;  3TAN A;  3KHY A;  4JKG B;  1LV5 A;  3ID8 A;  4JI8 K;  4E7H A;  3GE1 A;  1TKT A;  4B8A B;  5HRO A;  1L3S A;  1LCU A;  2IS3 A;  1QZ5 A;  1GLL O;  1WOQ A;  3MN9 A;  4JHD A;  4A59 A;  3O5B A;  5AFU A;  1GLB G;  3IS9 A;  4CZF A;  3O9R A;  2NZT A;  3LP3 A;  4OKE A;  3CCS N;  3OBW A;  4KO0 A;  3R9P A;  4IO9 L;  3H45 C;  4M7X A;  4FJL A;  1BGX T;  3L2R A;  2HHQ A;  3OA9 A;  2O8F A;  2ZJR L;  2G8F A;  4G9Z A;  3GL1 A;  1DTQ A;  4GMJ B;  4UY8 O;  1B92 A;  4K42 A;  2J4R A;  1VSD A;  2HMP A;  3ZET A;  3K0S A;  1WB9 A;  1K8K A;  3MCP A;  1BQN A;  3VQB A;  4WE1 A;  3LWL A;  4IWV A;  3PSF A;  3L6Q A;  4JKE A;  3UE5 A;  3NF9 A;  4BRC A;  1TL3 A;  4JI2 K;  5AQU A;  2XY8 A;  4MLH A;  1TK8 A;  2F7T A;  3R3L A;  3TTC A;  4JAX A;  1NGE A;  1X1P A;  3DI6 A;  2D0O A;  4RW8 A;  1NGC A;  5KQD A;  3KD1 E;  4GNI A;  3K58 A;  1WBB A;  4HCB A;  3SQ2 A;  1REV A;  2P9L B;  1NGI A;  3C0B A;  3VEN A;  4DV3 K;  4KKO A;  4AF1 A;  1J6Z A;  5FRO A;  3KK3 A;  3QNN A;  3EEQ A;  5FPM A;  1KAX A;  1LWC A;  3PO5 A;  4JKC A;  3VN5 A;  3RWU A;  3L4I A;  3I0R A;  1HQE A;  4PA1 A;  4FWR A;  1NG9 A;  1TKD A;  2FBX A;  3KLH A;  2O8F B;  1FJG K;  1LW0 A;  4ISE A;  1VSJ A;  4DV5 K;  3T19 A;  3V81 A;  4HVJ A;  3CJB A;  4B9N A;  4EIA A;  4M3T A;  2VGN A;  1IJJ A;  3NGI A;  3S41 A;  2BUP A;  1BA1 A;  1OVQ A;  1UOC A;  4RW9 A;  5M1Q A;  4DSI A;  3QET A;  3CC4 N;  4KHY A;  3DLK A;  4FWP A;  5TKY A;  4A5A A;  5HRS A;  3CJ9 A;  3OBY A;  3ZEU B;  4DV0 K;  3VTI A;  3L2V A;  3FGU A;  1JLA A;  4HCC A;  4DS4 A;  5FRN A;  2IOC A;  4Z4E A;  2W6L A;  3DXK B;  4N5S A;  3L2W A;  1T3V A;  2JWK A;  3CCU N;  4N41 A;  5EY4 A;  2OZS A;  2P9S B;  3O1W A;  3VEZ A;  1NK4 A;  4BVP A;  5JVH L;  3OS2 A;  4H0V B;  3U9Z A;  5AQZ A;  1DGK N;  3IFR A;  4CZH A;  3NFA A;  4BG8 A;  4QS8 A;  2E6L A;  1VSM A;  3BP8 A;  3RMD A;  5C24 A;  1M1K O;  2HBK A;  2GBZ A;  3EY1 A;  4F8R A;  4R79 A;  3F73 A;  1GOA A;  1D8Y A;  2DFE A;  3SQ0 A;  3E66 A;  3VTH A;  5EXW A;  3EKU A;  4A57 A;  4HTL A;  3DXM A;  3LM9 A;  2A3Z A;  5AJ3 K;  1S22 A;  1DTT A;  4DQ8 A;  1S1W A;  3HZ6 A;  3J7A P;  1VQ6 N;  3QIC A;  3DOL A;  2UUC K;  2YX6 A;  2NRT A;  1XHZ A;  4ILH A;  1Y97 A;  1LWE A;  5LMN K;  4IKF A;  3J8A A;  2RF2 A;  4JKA A;  1U49 A;  4LSN A;  1JL2 A;  3V4I A;  1CZ9 A;  3NVK A;  1V4S A;  3LP1 A;  3MK6 A;  3VF2 A;  2ZJP L;  4ZTF A;  3E9L A;  2GTD A;  4DR4 K;  5BRD A;  1N8R O;  4CEF A;  2D0A A;  2VWJ A;  1N6Q A;  4DU1 A;  2EHG A;  4CIG A;  4M63 C;  3U3Y A;  1T44 A;  2RKI A;  4FJM A;  3QES A;  3LM2 A;  3VQ8 A;  3CJA A;  1D5A A;  1ZC6 A;  3NBP A;  3AAQ A;  3SCX A;  4BGA A;  2BGG A;  4FWO A;  5M1P A;  1C0F A;  3JS6 A;  4NYF A;  4CJ5 A;  3WNF A;  4WQ4 C;  1WSG A;  3B8A X;  4EZ6 A;  3ISN C;  2YKN A;  1WSJ A;  2ZGZ A;  2OA8 A;  5DK5 A;  4BC2 A;  3W0L A;  3QFP A;  5KGW A;  4LFA K;  3HPG A;  1S6Q A;  3UKR B;  4EP5 A;  4CJU A;  2E20 A;  3ITH A;  3IRX A;  5GAE P;  5BPL A;  1X9M A;  1A5X A;  3WUH A;  5JLF A;  1F21 A;  3LWM A;  4ELT A;  2WFB A;  3K9J A;  3ZSO A;  2D4W A;  1O13 A;  3S3N A;  4L8R B;  1VRT A;  2WON A;  4OPA A;  3HP9 A;  4NCG A;  2Q0U A;  4IJN A;  4FLW A;  1WUA A;  2B5J A;  1FK9 A;  2YHB A;  1NGG A;  3VEW A;  3WNH A;  1QZ6 A;  2DFH A;  4B9M A;  2G8K A;  3K2P A;  4K0K K;  3OHR A;  2HOE A;  1QSY A;  1L3V A;  4K41 A;  2G8H A;  3SQ4 A;  3PO4 A;  3SAG A;  1W9H A;  1HR0 K;  4I7F A;  2GWJ A;  2R7Y A;  2DY4 A;  3K5L A;  3E9O A;  4IO8 A;  5HOO A;  1U6Z A;  4OKK A;  3SUP A;  5KPZ A;  3ULE B;  1SL0 A;  1NK9 A;  1T6C A;  3TR8 A;  4F2S A;  4O44 A;  3ASM A;  4U67 L;  3T1Y K;  3PY8 A;  1CZB A;  4A62 A;  2E8A A;  1HMV A;  3UKR A;  4RCH A;  4GV9 A;  5M1O A;  4MO4 A;  3TPQ A;  3HOT A;  3BZK A;  2O8D B;  4BRO A;  3H6E A;  3MEG A;  3F9M A;  5AQS A;  4F2R A;  4BR4 A;  2O8B A;  4O4G A;  4CIE A;  4JI0 K;  1ZXO A;  1Q81 O;  4YOR A;  3L3V A;  4DSE A;  3SK3 A;  4Z4I A;  3CC7 N;  4E89 A;  4CHY A;  4YOY A;  1P8Z A;  3FZF A;  4FJK A;  3HBT A;  1IKY A;  1LAW A;  3CQX A;  4OPK A;  1I3A A;  1VSF A;  5AQL A;  5IT9 O;  3V9S A;  2E2O A;  4CZK A;  3D0P A;  3CXC M;  2KZM A;  3OW2 M;  4C8K A;  2W40 A;  4K25 A;  2IDO A;  3SYZ A;  1MDU B;  3O3F A;  1X9W A;  4BG9 A;  3MN6 A;  1YF5 L;  1HKG A;  4DQI A;  2PBD A;  4FJ9 A;  4PHT X;  2E4L A;  4QAG A;  1VQ4 N;  4KB0 A;  4FLU A;  2HHT A;  3VA3 A;  3LAM A;  3VQC A;  4FK0 A;  5ELZ A;  2YNH A;  3O9S A;  3TSQ A;  3EYZ A;  3H46 O;  5BR9 A;  1E3M A;  1VQN N;  4J2A A;  1JL1 A;  2I7N A;  1TKZ A;  4K43 A;  1RT6 A;  3O80 A;  3I8D A;  4BWJ A;  4BRE A;  3VEY A;  2KZZ A;  2VQE K;  4DUZ K;  3QEX A;  1JLQ A;  4CK1 A;  3LDL A;  2UUA K;  3THX A;  3LPU A;  3R6M A;  3PV8 A;  3NE6 A;  1JLG A;  2Y1J A;  4Z4F A;  4QCL A;  4CI6 A;  4U7B A;  1K73 O;  3QB0 A;  2KKZ A;  4CHZ A;  1N33 K;  4KV8 A;  4CBW A;  4C8M A;  2H3G X;  4CEQ A;  1WLJ A;  3DLG A;  2PYL A;  5CE3 A;  1IH7 A;  2NRH A;  4H0T B;  1YJW N;  3HRG A;  4W5Q A;  3SV3 A;  1U2V B;  5AQM A;  4KTQ A;  4KHN A;  4H5V A;  3VQD A;  1SL1 A;  3AVC A;  2HBL A;  3IAY A;  4FOE A;  1Y64 A;  5AQN A;  5CR4 A;  1BL3 A;  3HST B;  1NJY A;  4GV6 A;  2YHY A;  2P9I B;  5C0Y A;  2KFZ A;  4C1N I;  1RBR A;  1HNV A;  4RG8 A;  4PKH A;  2OPP A;  2YHA A;  3JAM O;  2YJE A;  2A6A A;  3R8E A;  3SUO A;  4GVM A;  4CGF A;  5C12 A;  3RVC A;  1NKE A;  4BC3 A;  3LDP A;  3MEC A;  2FBY A;  3ZSZ A;  2RHK A;  3KVG A;  1K8A O;  2NRX A;  1TAU A;  1C0G A;  2IVP A;  1BO5 O;  1U47 A;  3ZEU A;  2PY5 A;  4FJ7 A;  4CF9 A;  2KQ2 A;  2NRR A;  5IWA K;  3M6G A;  4J8F A;  4JKF A;  3HO1 A;  4B9U A;  3A0I X;  1BCM A;  4DTU A;  1TGO A;  3AO1 A;  3CIP A;  1R0A A;  1KFD A;  3A2F A;  1IBM K;  3QIP A;  4BE0 A;  4CK2 A;  4XIU A;  3T69 A;  1VQP N;  1GLC G;  3V1R A;  4RW7 A;  4KBO A;  2P9S A;  3MED A;  2P5O A;  4YOU A;  1JLB A;  2WTU A;  3VQP A;  4E1N A;  1J9A A;  3MXI A;  4CFB A;  1CXU A;  3R1X A;  1VQ7 N;  1NJX A;  4LFB K;  1HJR A;  3C94 A;  5GIO A;  4CZL A;  4BC4 A;  4YY3 K;  3OJS A;  4KAZ A;  3FFK B;  1TYQ A;  4RW4 A;  3ZT2 A;  4C8N A;  4XEI A;  4E7L A;  3CQY A;  4B1W B;  3DOK A;  3MWP A;  1W2B M;  3HXM A;  2QWR A;  2V7Z A;  1HPM A;  1BUP A;  3NAE A;  4CEZ A;  4I9Q A;  2FLO A;  3WQT A;  1YUW A;  3LDS A;  1QVF M;  3P5J A;  5HRP A;  3CME N;  3DXM B;  4CJ3 A;  1YTA A;  1JJ2 M;  1P90 A;  3SAF A;  1RDB A;  1EP4 A;  2HHV A;  1QQN A;  4B8C A;  4IG3 A;  1IG9 A;  2F9T A; 
#chains in the Genus database with same CATH homology
 4CED A;  4PA1 A;  1TKD A;  2FBX A;  4JLH A;  3KLH A;  1ZYQ A;  2KFN A;  3RRG A;  4B9V A;  3VQ7 A;  1T7P A;  1LW0 A;  3OYN A;  1VSJ A;  2IAJ A;  3NF6 A;  4KRF A;  3AVL A;  3T19 A;  3UIQ A;  2F96 A;  3ZCM A;  2Z1G A;  3S3M A;  1N5Y A;  1TVR A;  1YVU A;  4HVJ A;  4DU4 A;  3V81 A;  1SL2 A;  2OZM A;  4B9N A;  5FDL A;  1LAV A;  4M3T A;  1ASW A;  1KVC A;  2VG5 A;  3ZSW A;  1IKV A;  3S9H A;  1MU2 A;  3LP2 A;  3NGI A;  1CLQ A;  4UQG A;  3NH1 A;  1EET A;  4N47 A;  2F8S A;  3ZSX A;  1JLF A;  2YV0 X;  2QK9 A;  1UOC A;  4RW9 A;  2ZQB A;  4DQQ A;  3NGZ A;  2DFF A;  2Q3S A;  3QET A;  4DSI A;  4DQP A;  2G8I A;  4KHY A;  2DTU A;  4CFD A;  3DLK A;  4ELV A;  3K57 A;  5HRS A;  4DQS A;  5CY4 A;  2P1J A;  4KFB A;  4CJP A;  2RN2 A;  3RRH A;  3O4N A;  3TAF A;  4AHV A;  4YNQ A;  4CF8 A;  3HPO A;  2O4G A;  3L2V A;  1IKW A;  1JLA A;  3B6P A;  3VQ4 A;  4R5P A;  4HCC A;  2G8U A;  4DS4 A;  5FRN A;  2XY7 A;  2IOC A;  3VQE A;  5D3G A;  4Z4E A;  5J2M A;  4N5S A;  3L2W A;  4N41 A;  4AH9 A;  4JS4 A;  1QSL A;  1QQC A;  2X78 A;  2OZS A;  1C1A A;  1RT3 A;  4RW6 A;  3K59 A;  1Q9Y A;  4CJV A;  3DLB A;  2I5J A;  4Q5V A;  1NK4 A;  4CEO A;  3LAN A;  3OS2 A;  1KTQ A;  1FXX A;  3I0S A;  4H4M A;  5KTQ A;  2FBV A;  3HT3 A;  1SKW A;  3E01 A;  1RTJ A;  1WAF A;  4IDK A;  4B08 A;  3KLE A;  4KB1 A;  3NFA A;  3K5M A;  3AO5 A;  1NK7 A;  1RT7 A;  1Q8I A;  3AVI A;  3HVT A;  2E6L A;  1VSM A;  3G0Z A;  1JKH A;  1RBT A;  1YT3 A;  3KK2 A;  4DF8 A;  4C8O A;  3RMD A;  1O1W A;  5C24 A;  4J2D A;  3G10 A;  4F3T A;  4FJJ A;  4H4O A;  2B6A A;  2GBZ A;  3V1Q A;  3OYK A;  3DYA A;  3OYL A;  3EY1 A;  3THV A;  4F8R A;  4M3R A;  3MEE A;  4BWM A;  4FZY A;  4ZTJ A;  3F73 A;  1GOA A;  5SZT A;  4F3O A;  4BE1 A;  1VSL A;  3KLG A;  1D8Y A;  1D9D A;  1WSE A;  3SV4 A;  2DFE A;  4J2B A;  3PUF A;  3SQ0 A;  1B9D A;  3RMA A;  4JRP A;  3LZI A;  3U3G A;  2HMI A;  4CGH A;  3FFI A;  1EX4 A;  2ZD1 A;  5JS2 A;  4OLA A;  2OPQ A;  4CJS A;  3U6F A;  1DTT A;  3DLH A;  1S1W A;  1SKR A;  4HUG A;  1T05 A;  1IO2 A;  1NK8 A;  3TAQ A;  3AVJ A;  4FVM A;  1C0M A;  3DOL A;  4Z0U A;  2YNF A;  4M45 A;  3SQ1 A;  2HND A;  4IBN A;  1ZBF A;  2HNZ A;  4CJR A;  3EZ5 A;  2D0B A;  4DSL A;  1RT2 A;  3B6O A;  1XHZ A;  2XRI A;  3RTV A;  1Y97 A;  1LWE A;  4IKF A;  2YNG A;  4MFB A;  2RF2 A;  1U49 A;  1QS4 A;  1NKC A;  3ZT0 A;  4FJN A;  4LSN A;  1JL2 A;  3V4I A;  1CZ9 A;  3OY9 A;  3LP1 A;  3CQ8 A;  4Y1D A;  4I2Q A;  4NYN A;  3OYM A;  4DS5 A;  4ZTF A;  2LSN A;  5KGX A;  2ATQ A;  3NF7 A;  2HNY A;  4CEF A;  2D0A A;  2VWJ A;  1N6Q A;  4DU1 A;  4OPJ A;  2YKM A;  2EHG A;  2QXF A;  5CZ1 A;  4CIG A;  1EKE A;  1RCH A;  3QEI A;  3SPZ A;  3PX4 A;  3U3Y A;  4FYD A;  4DQR A;  2RKI A;  3OYE A;  3QES A;  2NUB A;  4FJM A;  4M3U A;  4FXD A;  3VQ8 A;  4KPY A;  3HJF A;  1D5A A;  1WSI A;  3NBP A;  4FJ8 A;  4PWD A;  4Q0B A;  3L2U A;  3SCX A;  3ZT3 A;  1VK0 A;  3TWH A;  2BGG A;  1K6Y A;  1GOB A;  3OYA A;  4KRE A;  1KLM A;  4G1Q A;  4NYF A;  4CER A;  4M3W A;  4CJ5 A;  3WNF A;  4CEC A;  1WSG A;  3ZSR A;  4CEA A;  4CJ4 A;  1TK0 A;  4CF1 A;  4EZ6 A;  1VSI A;  5FRM A;  1RTH A;  3ISN C;  5HRN A;  3SJJ A;  4OGE A;  4BE2 A;  2YKN A;  1U48 A;  4AHS A;  1WSJ A;  2OA8 A;  3OYF A;  5DK5 A;  2YNI A;  1L5U A;  5T7B A;  2B4J A;  4HUE A;  3C6T A;  4O0I A;  3DRR A;  5KGW A;  5EU7 A;  2O4I A;  3HPG A;  1JLC A;  2KW4 A;  4CEB A;  4FLV A;  4E7J A;  2JLE A;  3O3H A;  4PY5 A;  1S6Q A;  3RMC A;  1ZBH A;  5CZ2 A;  1I39 A;  2P51 A;  4EP5 A;  3AVF A;  1ZBU A;  1ASU A;  4CJU A;  4CHO A;  1TV6 A;  3IRX A;  3ITH A;  4HUF A;  3MAQ A;  3HVR A;  1X9M A;  1A5X A;  1BIU A;  1KRP A;  3DMJ A;  3NCI A;  1F21 A;  3VA0 A;  1RTD A;  4O5B A;  3LWM A;  3KKS A;  4CGG A;  3L2Q A;  4BDY A;  4ELT A;  2QKK A;  3ZSO A;  1TL1 A;  3S3N A;  3QEP A;  4K8Z A;  3AVK A;  4L8R B;  1VRT A;  2WON A;  2P5G A;  4M3Y A;  4DMN A;  1WN7 A;  4DFM A;  4M3Z A;  3HP9 A;  1C0T A;  4LSL A;  4NCG A;  1KVA A;  1S6P A;  3MXJ A;  3AVG A;  1U45 A;  3CG7 A;  2WOM A;  4N76 A;  3V9U A;  2QKB A;  4FLW A;  3OJU A;  2B5J A;  3VQ6 A;  2HHX A;  1XC9 A;  1FK9 A;  1YTU A;  3TAE A;  2YHB A;  4DTN A;  3SUQ A;  3TAM A;  3ULD A;  3V9X A;  1G15 A;  3V1O A;  5K14 A;  2DFH A;  3WNH A;  3OS1 A;  2A1S A;  2HHS A;  4B9M A;  1LWF A;  3DLR A;  3K2P A;  2G8K A;  4DSK A;  3NH2 A;  4FJX A;  5I3U A;  1RBU A;  1BQM A;  3KJV A;  3OS0 A;  2ZE2 A;  1RDD A;  4QOZ B;  3K5O A;  3RR8 A;  4ID1 A;  3KD5 E;  1QSY A;  5C42 A;  3CYM A;  1L3V A;  2G8H A;  3SQ4 A;  5I42 A;  3PO4 A;  1W9H A;  1RT1 A;  4DFK A;  1QSS A;  3PX0 A;  3RR7 A;  4MQ3 A;  3ZSY A;  3VQQ A;  4I7F A;  2Z1I A;  3OYI A;  1VRU A;  1J5O A;  2R7Y A;  3QO9 A;  3TAB A;  3K5L A;  2DY4 A;  4CHP A;  3HPH A;  1C1C A;  4H8K A;  3HP6 A;  4DFJ A;  4OKK A;  4FCY A;  4PUO A;  3OYC A;  3SUP A;  3MXM A;  1NK5 A;  1IKX A;  4KHU A;  1SL0 A;  4DTR A;  2JGU A;  1NK9 A;  4CK3 A;  3TR8 A;  4F2S A;  3OYG A;  4O44 A;  3ASM A;  3TAR A;  3HK2 A;  1QE1 A;  3NH0 A;  4DF4 A;  1Z25 A;  1CZB A;  1S1X A;  4IFY A;  1RT4 A;  4Y1C A;  4AHT A;  1A5W A;  3HM9 A;  1HMV A;  3AVA A;  3M8S A;  1C6V A;  4OKJ A;  4DFP A;  2BDP A;  3M8Q A;  4CJL A;  1HYV A;  1VSH A;  4CGI A;  4AHU A;  3AA4 A;  1S9E A;  2A1R A;  3AVN A;  3SPY A;  2EX3 A;  1FKP A;  4CEE A;  5CYQ A;  4DG1 A;  3QIO A;  4DTM A;  1JXE A;  3NHG A;  4DTJ A;  2G8W A;  4YFU A;  3C6U A;  1XWL A;  3MEG A;  5HRR A;  1X9S A;  4KI6 A;  2X74 A;  4DU3 A;  2KTQ A;  1GOC A;  4F2R A;  4M3X A;  4HHT A;  4O4G A;  3HYF A;  4CIE A;  4IG0 A;  1W0H A;  3PX6 A;  1UA0 A;  4FJI A;  1HYS A;  5SWM A;  3OYB A;  3L3V A;  1S1T A;  3KLF A;  4DSE A;  1S9G A;  4LH4 A;  4Z4I A;  4FLY A;  4W5O A;  4E89 A;  4CHY A;  2XO7 A;  4FLZ A;  1DLO A;  4FZX C;  4CFC A;  4FJK A;  1TKX A;  1IKY A;  1LAW A;  4I9L A;  4OPK A;  4C8L A;  4FK2 A;  1I3A A;  1VSF A;  3V9S A;  4FLX A;  1KCF A;  3D0P A;  2BE2 A;  1NK0 A;  1TK5 A;  2KZM A;  4FW2 A;  5C25 A;  1EXQ A;  4FJ5 A;  5J2Q A;  3O4Q A;  4CCH A;  4E19 A;  4C8K A;  3NF8 A;  2IDO A;  3ZSQ A;  4CJQ A;  2IGI A;  3SYZ A;  2OPS A;  3O3F A;  1X9W A;  1JXB A;  3M8P A;  1L3T A;  3QEW A;  4IFV A;  3OYD A;  1S1V A;  1NKB A;  2D5R A;  4DTP A;  2X6N A;  3TAG A;  3ZSV A;  3WNG A;  5J1E A;  4CJF A;  4DQI A;  3L8B A;  4FJ9 A;  1UA1 A;  3CFR A;  1BCO A;  1UAX A;  2E4L A;  3KTQ A;  2HHW A;  5J2P A;  1HRH A;  1ITG A;  4QAG A;  4KB0 A;  4DLE A;  4FLU A;  2HHT A;  3VA3 A;  1RDA A;  3LAM A;  4M41 A;  3VQC A;  4FK0 A;  1TAQ A;  3OYJ A;  1ZBI A;  3T1A A;  4W5R A;  3CM5 A;  2FBT A;  2YNH A;  4DWI A;  3RMB A;  2VG6 A;  3EYZ A;  4B3O A;  4OJR A;  4J2A A;  1JL1 A;  4CF2 A;  1TKZ A;  3CFO A;  3H08 A;  2Z1H A;  2RPI A;  1RT6 A;  3NGY A;  1T8E A;  3I8D A;  4BWJ A;  3BDP A;  5JS1 A;  2KZZ A;  3VQA A;  1KLN A;  3QEV A;  3QEX A;  1JLQ A;  4CK1 A;  2HVH A;  3AVH A;  4BDZ A;  4CJT A;  3AO4 A;  1RTI A;  4F4K A;  3LPU A;  3PV8 A;  3NE6 A;  3AA2 A;  2W42 A;  4OLB A;  3C95 A;  1JLG A;  4CJW A;  3KKR A;  4O0J A;  2XY6 A;  4CIF A;  4GW6 A;  2Y1J A;  4Z4F A;  4QCL A;  5HBM A;  4CE9 A;  3DRP A;  1BI4 B;  4FM0 A;  3QLH A;  1Z26 A;  1VSK A;  1C0U A;  1VSE A;  2IC3 A;  4KTZ A;  1XI1 A;  3AA5 X;  2E6M A;  4CHZ A;  1HPZ A;  4CFA A;  3SNN A;  1JLE A;  3AO2 A;  3AVB A;  3KLI A;  3QIN A;  3SUN A;  4KV8 A;  1ASV A;  4CGD A;  4FM2 A;  3M8R A;  4DTX A;  3TI0 A;  1KFS A;  4C8M A;  2HW3 A;  4CEQ A;  2OPR A;  4NCA A;  1WLJ A;  3DLG A;  3VQ9 A;  2PYL A;  4ELU A;  4PQU A;  4E3S A;  1HQU A;  3V6D A;  1IH7 A;  1J54 A;  2VG7 A;  4Z4G A;  3JYT A;  1WNS A;  4B9T A;  4W5Q A;  2PYJ A;  3SV3 A;  4FZZ A;  4CGJ A;  4Z4C A;  4FJH A;  4O55 A;  3QER A;  4DSJ A;  4I2P A;  4KTQ A;  4E7I A;  1SUQ A;  4CF0 A;  4KHN A;  3HL8 A;  1J53 A;  3VQD A;  1SL1 A;  2OYQ A;  1SV5 A;  5DMR A;  3AVC A;  1QHT A;  4ICL A;  3IAY A;  4ZHR A;  4OGC A;  3V9W A;  4KHS A;  4KHQ A;  1KSP A;  2BAN A;  1ZBL A;  4KHW A;  1BL3 A;  3HST B;  2AJQ A;  3NDK A;  4AIL C;  1NJY A;  2X6S A;  1WSF A;  1RNH A;  4CJE A;  1L3U A;  2KFZ A;  4E0D A;  1RBR A;  3D45 A;  1T03 A;  3WNE A;  1NOY A;  1HNV A;  1S1U A;  4RG8 A;  3ZT1 A;  4FK4 A;  4W5N A;  4DLG A;  2HVI A;  1U4B A;  4ID5 A;  2OPP A;  4EP4 A;  3SZ2 A;  1BHL A;  4W5T A;  2YHA A;  1NJW A;  4N56 A;  5HLF A;  2XY5 A;  3K5N A;  4DTO A;  3F9K A;  4JS5 A;  3TAN A;  3SUO A;  4GVM A;  4EZ9 A;  3CM6 A;  4CGF A;  1LW2 A;  1LV5 A;  1NKE A;  1WAJ A;  3L3U A;  2HB5 A;  4E7H A;  5HRO A;  1TKT A;  4B8A B;  2Z1J A;  4TSX A;  4BAC A;  1L3S A;  2IS3 A;  5E41 A;  3CFP A;  3MEC A;  2G8V A;  2FBY A;  3ZSZ A;  2Y1I A;  3JSM A;  2F8T A;  1BI4 A;  4LD0 A;  1TAU A;  4DTS A;  2ITG A;  4DSF A;  3LAL A;  1HYZ A;  3OVN A;  1U47 A;  3IS9 A;  3AO3 A;  2PY5 A;  4FJG A;  1D9F A;  4FW1 A;  3LZJ A;  4FJ7 A;  4CF9 A;  1QTM A;  3PY8 A;  2KQ2 A;  5CYM A;  3LP3 A;  4OKE A;  1NOZ A;  1RT5 A;  2GUI A;  4HTU A;  4KO0 A;  4CHQ A;  5J2N A;  2PZS A;  4K8X A;  1C1B A;  3HO1 A;  5KRT A;  4B9U A;  4FJL A;  4CJK A;  1BGX T;  1BCM A;  1RBV A;  4DTU A;  1TGO A;  2GV9 A;  3L2R A;  2HHQ A;  1HNI A;  3AO1 A;  3DM2 A;  1R0A A;  3AV9 A;  2G8F A;  3T3F A;  4NCB A;  4FLT A;  2ETJ A;  3LAK A;  1DTQ A;  3A2F A;  1KFD A;  1RIL A;  1KVB A;  4GMJ B;  3QIP A;  2XHB A;  4M42 A;  1A5V A;  1B92 A;  4BE0 A;  4CK2 A;  4XIU A;  1VSD A;  1FKO A;  3IG1 A;  3V1R A;  4RW7 A;  3S3O A;  2P5O A;  3MED A;  3SI6 A;  4B9L A;  3VQ5 A;  4KTW A;  1BQN A;  3VQB A;  4WE1 A;  3LWL A;  4B9S A;  1JLB A;  4E1M A;  3VQP A;  4E1N A;  1J9A A;  3MXI A;  4CFB A;  1CXU A;  3KK1 A;  1SKS A;  1NJX A;  3BGR A;  3LP0 A;  4Z4H A;  1RDC A;  3LPT A;  1HJR A;  3C94 A;  3O3G A;  1WSH A;  1CXQ A;  1XHX A;  5KRS A;  3NF9 A;  3OYH A;  1TL3 A;  3OJS A;  4KAZ A;  1BIS A;  4J2E A;  4RW4 A;  3ZT2 A;  4C8N A;  2XY8 A;  4E7L A;  3DOK A;  4E7K A;  1S5J A;  3AA3 A;  1TK8 A;  1NK6 A;  4LH5 A;  3V9Z A;  3ALY A;  1X1P A;  3AVM A;  3DI6 A;  4RW8 A;  1B9F A;  4LY7 A;  4CES A;  3HXM A;  1NJZ A;  3KD1 E;  1RBS A;  3P83 D;  3K58 A;  3NAE A;  4JRQ A;  1Q9X A;  4HCB A;  3SQ2 A;  1REV A;  4CEZ A;  4I9Q A;  2D0C A;  4AHR A;  3QNO A;  4AHC A;  4KKO A;  3DRS A;  3LDS A;  5HP1 A;  2HHU A;  3KIO A;  3P5J A;  5HRP A;  5FRO A;  4CHN A;  3KK3 A;  3QNN A;  3DLE A;  5KI6 A;  4CJ3 A;  4FM1 A;  1YTA A;  3P1G A;  1UWB A;  3TAP A;  4KI4 A;  4BDP A;  2VWK A;  3ZT4 A;  1LWC A;  3PO5 A;  1BIZ A;  4OVL A;  1RDB A;  1EP4 A;  2HHV A;  1U04 A;  4B8C A;  3VN5 A;  4IG3 A;  1IG9 A;  3RWU A;  3I0R A;  1HQE A;  2FC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...