1BI4B

Catalytic domain of hiv-1 integrase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
153
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFLIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna integration
molecule keywords INTEGRASE
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 45
structure length 143
sequence length 153
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bi4B00
1WSIA 1J9AA 3KK3A 4M3RA 2OPRA 1L3VA 4JS4A 1IKXA 1C1CA 4EZ9A 3VA0A 3VQPA 3U3YA 1TL1A 3DLGA 5JS1A 1T7PA 1BI4A 1IH7A 1ZBFA 4E7LA 1C6VA 1TKDA 2O4GA 3L3UA 1L5UA 3VQ6A 1HYSA 4AH9A 2G8UA 5I3UA 3M8SA 3RR8A 1RT3A 4ELUA 4E1MA 4DSIA 4Z4EA 3AVGA 2ZQBA 4C8NA 3HT3A 1C1BA 3LP1A 4JRQA 4F2SA 1U49A 4HUEA 2I5JA 4CJ5A 4FJGA 3DMJA 3A2FA 3OS1A 4M3XA 4DF4A 1KVAA 4QAGA 4J2DA 4JS5A 3AVNA 1BIUA 4ELVA 4CHOA 1CLQA 3DLHA 4OKJA 3V9WA 2AJQA 4IFVA 3ZSRA 4RW7A 1HMVA 3EZ5A 1TK5A 4DU1A 4HTUA 3G10A 3AVMA 3AA3A 1ITGA 1KLMA 2FBTA 2Z1JA 3O3GA 3PUFA 4CGIA 4BACA 2PZSA 4CECA 5C42A 3SI6A 2YHBA 1REVA 3QIPA 1BHLA 1EKEA 2RF2A 5K14A 3OYHA 3QNNA 1QSSA 1BI4B 1S6QA 2IAJA 5J1EA 4N56A 1TAUA 3NF7A 4FLXA 1HNVA 4EP4A 1BCMA 1LW2A 5CYQA 1Q9XA 1TGOA 1RTIA 3TR8A 1DTTA 2HHQA 4E1NA 3KIOA 2YNFA 3SNNA 4NCGA 4CEQA 4DWIA 1XHXA 3AV9A 3MEEA 1YT3A 4DMNA 4PA1A 4FM0A 4DS5A 3ZT0A 4AHVA 4KTQA 3HSTB 3K59A 2HHUA 2IC3A 2Z1IA 4FJ5A 4KI6A 3VQ9A 4DSEA 1RT4A 4I2QA 1XI1A 4O44A 4Z4FA 1IO2A 3VQ4A 4FW2A 4CF0A 4FJJA 1FK9A 1RDDA 2PY5A 3H08A 1RT6A 1S1XA 2RPIA 3DYAA 3KD1E 4CFAA 4DLEA 3DOLA 2G8KA 1SL0A 3DM2A 1QQCA 5JS2A 3AVFA 1NOZA 3OYDA 3IG1A 3SUPA 4CIGA 4FK4A 1WLJA 1WSFA 4BDZA 1ZBHA 3WNEA 4N76A 4Z4IA 1A5XA 2B6AA 1CXQA 3OYJA 3CM5A 5KRSA 4OJRA 2X6NA 3QETA 4KRFA 3AVJA 3SV3A 3HXMA 1VRUA 3ZCMA 3AO4A 3EY1A 1U45A 1HNIA 3VQBA 4B8CA 4M3ZA 4E7JA 3AO1A 4R5PA 3FFIA 3HYFA 3IRXA 4KHUA 4FCYA 3RMBA 3CG7A 4DLGA 1N5YA 2DFHA 1C0TA 4DTPA 2KFNA 2OA8A 2VG6A 4LSNA 4M41A 3MXIA 3WNHA 3OYIA 3LDSA 2WOMA 3U6FA 4B9UA 1IKYA 4FJIA 3RR7A 1RT5A 3DRSA 4FLWA 3OYNA 3DLKA 4W5RA 4KFBA 3KK1A 3L2RA 2GBZA 3K5NA 3S3OA 2HW3A 3S9HA 3P1GA 3HJFA 4E7KA 3B6PA 4OKEA 2D5RA 1TK0A 3HPHA 2OPQA 3LZIA 1YTUA 3K57A 1JLQA 2D0BA 1J53A 3D45A 3V9XA 4DFMA 3VQ8A 4ELTA 3OS2A 2Y1IA 3AA5X 1S5JA 1RT2A 2HNZA 4HUFA 3QIOA 3M8RA 3C6UA 4B9LA 2XY7A 3QEXA 4QOZB 4KREA 3CYMA 5HLFA 4DTRA 4DSLA 2B4JA 2G8VA 3LWLA 5HRPA 2XRIA 3NCIA 4BE2A 4FM1A 3HL8A 4H8KA 4L8RB 1J54A 4CFDA 3OYAA 3O3FA 4HCBA 4K8XA 4DSJA 3TAMA 3AVIA 1VK0A 4Y1DA 4Q0BA 3I8DA 2DTUA 4IDKA 1GOAA 4RG8A 3PX6A 3SUQA 3MXMA 1C0UA 1LWCA 3V9ZA 1XC9A 4DTNA 1X9SA 3JYTA 2NUBA 1TKTA 4JLHA 4FXDA 4Z4HA 3KKRA 4IKFA 1NK7A 1HQEA 1UOCA 3K2PA 4DTOA 3L8BA 1NJZA 3AO5A 3PY8A 3LZJA 3SPYA 1GOBA 4RW9A 1VRTA 1U04A 3TAPA 1EXQA 3THVA 4DTUA 1KCFA 4KHNA 1CZ9A 4KHWA 4HUGA 5KGWA 3NGYA 4I9LA 4CHZA 2VWJA 2E6LA 1TKZA 4E7HA 3TABA 4CJKA 3ZSVA 2IOCA 3LAKA 2DY4A 1SUQA 1EETA 4ICLA 1RT7A 4CJLA 3I0RA 1VSLA 3RMDA 3TAGA 4C8OA 1JXEA 3KLFA 3AO3A 4F4KA 4KB1A 4M3TA 1RTJA 4OLAA 1QSLA 3OYFA 1HYZA 4IG3A 1BL3A 2IGIA 4CF2A 4DTMA 5SWMA 1NK5A 1S6PA 3F9KA 1RBTA 1ZBUA 4E19A 3K58A 3PO4A 4CE9A 1RT1A 2HHWA 1A5VA 5T7BA 3ALYA 3ULDA 3SJJA 1DTQA 3K5OA 4LY7A 3RRHA 4KHSA 2W42A 4M42A 3SUOA 3B6OA 3MECA 3V9SA 4N5SA 4CIEA 2IDOA 1WNSA 4FLYA 3OYKA 2B5JA 2LSNA 2YNGA 3C95A 3L3VA 4ID1A 3ZT1A 1MU2A 3MEDA 3K5LA 4M3WA 4NYFA 1RCHA 3HVTA 1EX4A 1RNHA 2Q3SA 2P51A 4J2BA 5HRSA 4TSXA 2FBYA 2A1SA 3V1QA 4CJWA 1VSEA 1WN7A 4AILC 1QE1A 3PX4A 2KFZA 3NBPA 4ZTJA 1ASVA 2E6MA 3NHGA 2X6SA 2OPPA 1N6QA 2YNIA 3SQ2A 4LH4A 5HBMA 3KLGA 4E3SA 2F96A 1RBUA 3P5JA 4FVMA 3SZ2A 4DQQA 1RBSA 4KI4A 3PO5A 4AHRA 4YNQA 5HP1A 1KTQA 5DMRA 4DF8A 3HM9A 4F3TA 4CGHA 1X9MA 3CFOA 3TI0A 1UAXA 1JL2A 3AA2A 3AA4A 2QXFA 3QEIA 1LWFA 3RWUA 3WNFA 4OPJA 2OZMA 3OVNA 3SQ0A 2PYLA 3OS0A 4I9QA 2YV0X 3TAFA 4BDPA 3OYGA 3VQDA 3QERA 1KSPA 3AVHA 4DSFA 1W0HA 2GV9A 2VG5A 3AVKA 4DU4A 3SQ1A 4FZYA 1ZBIA 1GOCA 3VN5A 1JLEA 4CHYA 4M45A 4FJKA 4IBNA 2JGUA 3LALA 1ASUA 1U47A 1RBVA 4CJPA 5J2NA 5CYMA 1ZBLA 1WSGA 1KLNA 2OYQA 4E7IA 4CF8A 1RDBA 2YKMA 3LP0A 4KTWA 4BWMA 4CHQA 3F73A 4KHQA 2D0CA 4NCBA 2HHTA 3VQ7A 1WSJA 4CEOA 3OYEA 1NK8A 1JLGA 1TAQA 2HVIA 3DRRA 4CEAA 4CEZA 5E41A 3RRGA 3G0ZA 1T03A 2F8TA 3SPZA 3KK2A 3TWHA 1WAFA 4AHUA 3QINA 4KPYA 2VWKA 1WSHA 1IG9A 2YKNA 4O4GA 4DTJA 4BWJA 4KB0A 4I2PA 3DRPA 1R0AA 1LV5A 2G8HA 4LH5A 3VQCA 3DI6A 1ZYQA 4Z4GA 4KO0A 2XHBA 2XY5A 1G15A 4DQPA 4RW4A 4AHSA 1CZBA 2GUIA 5HRRA 4B9MA 4E0DA 4CEDA 3NH2A 3C94A 3O3HA 2XY6A 1JLAA 3OJSA 2PYJA 3HK2A 4B08A 3ZSWA 1RTHA 1D5AA 3QNOA 2E4LA 4BDYA 1K6YA 4ZTFA 3IAYA 3P83D 1S1VA 1LW0A 4ID5A 5KRTA 3OYBA 1CXUA 4CEEA 3ZT4A 3M8PA 1B9FA 2O4IA 4H4MA 4CEBA 1RILA 3NE6A 3RMCA 3DLEA 4LD0A 4CJRA 4B9SA 3V1RA 1NJYA 2BDPA 4M3YA 1LAWA 1SL1A 5CZ2A 3V9UA 2X78A 3QEPA 1S1UA 4FLTA 3OYCA 1UWBA 5DK5A 1JLBA 1KFDA 2WONA 3VA3A 2DFEA 3K5MA 4OGEA 4FJLA 4FM2A 4B3OA 1JXBA 3QO9A 2Z1HA 4Z0UA 1BGXT 4CGDA 1UA1A 1L3SA 1J5OA 3QEWA 2HB5A 4HHTA 1VSDA 4DQSA 2XY8A 4CJFA 1KRPA 5HROA 4HCCA 1Y97A 2F8SA 3LWMA 3MXJA 4FJXA 5HRNA 4PQUA 2HHXA 5FRNA 4MQ3A 3U3GA 4CGGA 1FKOA 4FLZA 2Y1JA 1LAVA 2HMIA 2OZSA 2G8WA 3NAEA 3TAQA 1VSJA 3V6DA 1NK0A 1QS4A 3CQ8A 3KLHA 3SUNA 2FBXA 4OGCA 4G1QA 3I0SA 5CZ1A 3ZSOA 1XHZA 2HVHA 3DLBA 3LPUA 4CCHA 3LPTA 3PX0A 2ZE2A 4QCLA 3D0PA 3HVRA 3O4NA 5KTQA 3VQEA 3CFPA 3PV8A 4FK2A 4Y1CA 1QSYA 3KLIA 1FKPA 3NGZA 3S3MA 1RDCA 3HP9A 4EP5A 2YNHA 3L2QA 3T3FA 4DTXA 1IKWA 1IKVA 1T05A 4CJSA 1U48A 4Z4CA 4KKOA 4FLVA 4N47A 1BQNA 4CESA 2KZZA 2HNYA 1Z25A 3L2WA 3RTVA 4CJVA 1JLFA 1Z26A 1SKSA 3ZSYA 4M3UA 3NH0A 4FW1A 1TKXA 3TANA 4KHYA 1NKCA 2XO7A 1T8EA 1Q9YA 4O0JA 2KQ2A 1B9DA 4CJUA 3NDKA 2IS3A 2G8FA 3VQAA 4FK0A 3OY9A 1TK8A 2QK9A 4RW8A 4CFBA 2ETJA 1NJXA 4FJMA 3ZT2A 4AHTA 4BE0A 3HPOA 1KVBA 1NK6A 1C1AA 3V81A 1B92A 1A5WA 3SQ4A 4B9TA 4CJEA 4PUOA 1HRHA 1Q8IA 1HPZA 4CGFA 1BIZA 4E89A 1LWEA 1X1PA 3AVBA 4CJ3A 2BANA 4UQGA 3RMAA 4F2RA 4GMJB 3ZT3A 3TAEA 3ASMA 3L2UA 4O5BA 2P1JA 3BGRA 1ASWA 2HHVA 2FC0A 1L3UA 1WSEA 3HP6A 1U4BA 1S9GA 4J2AA 1JLCA 2VG7A 3CM6A 4Q5VA 4FJ8A 3SCXA 4KV8A 3OYMA 4DS4A 2A1RA 3DOKA 3MEGA 3BDPA 1VSKA 2QKBA 5D3GA 1SV5A 5SZTA 3SV4A 1L3TA 2HNDA 4DG1A 1D8YA 2HHSA 3M8QA 1FXXA 5KGXA 1TVRA 3AO2A 4XIUA 4AHCA 4YFUA 3L2VA 1KFSA 4OKKA 3NF6A 3KKSA 4CK1A 3QEVA 1HYVA 4OPKA 4F8RA 4GVMA 1D9FA 4FZZA 4CF9A 3V1OA 2Z1GA 2P5OA 5C25A 1VSFA 4FJNA 3S3NA 5FDLA 4I7FA 4J2EA 1NKEA 3DLRA 3NGIA 1QTMA 3V4IA 2OPSA 3KD5E 2FBVA 2ITGA 4CJ4A 4DFPA 4RW6A 4KAZA 4W5OA 3T1AA 4DQIA 1S9EA 1JKHA 1VSMA 4FJHA 3KLEA 1WAJA 4CJQA 4FZXC 1S1WA 4NCAA 2RKIA 4C8KA 3UIQA 2KZMA 4W5NA 2KW4A 2ZD1A 3AVLA 3LP3A 3O4QA 4CEFA 4FLUA 1W9HA 4WE1A 1F21A 2EX3A 4IFYA 4PWDA 4CGJA 4CK2A 4ZHRA 4B8AB 4CJTA 4C8LA 3TARA 3VQ5A 2G8IA 2BGGA 4DFKA 1RTDA 4OVLA 3KJVA 1JL1A 2ATQA 3HO1A 4CERA 4DU3A 3LP2A 3E01A 2RN2A 3LAMA 4FYDA 4CFCA 4O0IA 1I39A 3AVAA 1RDAA 1NOYA 4H4OA 1VSHA 5J2MA 1HQUA 1TL3A 3OJUA 1X9WA 3LANA 1O1WA 3NF8A 1NK4A 3NF9A 1SKWA 1SKRA 1VSIA 4EZ6A 4B9VA 1UA0A 1QHTA 4JRPA 2KTQA 4K8ZA 1TV6A 2YHAA 2BE2A 4KTZA 1HJRA 3SYZA 2EHGA 4CHNA 4N41A 3OYLA 3ITHA 4F3OA 1BISA 1SL2A 1KVCA 3EYZA 1NK9A 3IS9A 4B9NA 2P5GA 5J2PA 4IG0A 3NH1A 4FJ7A 3QLHA 5KI6A 5I42A 4W5TA 4CHPA 3JSMA 1NJWA 1RBRA 2QKKA 3QESA 3ZSXA 4W5QA 2D0AA 5C24A 4GW6A 4CIFA 4FJ9A 4CK3A 1C0MA 1YTAA 1I3AA 4LSLA 1BCOA 1XWLA 3HPGA 3CFRA 1BQMA 4CF1A 4MFBA 4DFJA 1EP4A 1DLOA 4BE1A 4O55A 4DTSA 5CY4A 1NKBA 5J2QA 5EU7A 4PY5A 4DSKA 3T19A 4OLBA 1YVUA 1S1TA 2JLEA 3NFAA 3AVCA 5FRMA 1D9DA 2DFFA 2R7YA 4HVJA 3C6TA 3WNGA 4NYNA 3VQQA 2X74A 4DQRA 3ZSQA 3ZSZA 3MAQA 3ISNC 5FROA 4C8MA 3KTQA
chains in the Genus database with same CATH superfamily
4JS4A 2GUPA 1IKXA 1C1CA 2CH5A 3VA0A 4EZ9A 4H0PA 4BC3A 1N36K 1BI4A 3GG4A 4BR0A 1NGIA 4E1JA 2O4GA 1TKDA 2NRRA 2GX9A 5ADXH 5EOYA 3HT3A 2D0OA 3LP1A 2I5JA 3PIOL 2YI1A 5AZIB 1QZ5A 4BRPA 4M3XA 1KVAA 1OH5A 3ID8A 1T44A 2E2OA 4RW7A 4H0YB 3T69A 1ITGA 3O3GA 4WFNL 4BACA 4CECA 3SI6A 1REVA 3EN9A 3FE1A 2RF2A 3O9QA 5K14A 3QNNA 1BI4B 5J1EA 4EP4A 1BCMA 1LW2A 3S41A 4A61A 2UUBK 2QTDA 1DTTA 1VQKN 4E1NA 1KXPA 5AQUA 2YNFA 3LDQA 3Q7CA 4NCGA 4DWIA 1EQYA 3AV9A 3MEEA 4B1ZA 4EHTA 4KTQA 3ZT0A 4AHVA 3HSTB 2IC3A 4KI6A 4DSEA 1RT4A 1IO2A 3VQ4A 4MDBA 4JKBA 1RDDA 5KQ8A 3M6GA 2QM1A 5BRHA 3OYDA 4PL8A 5AQFA 4N76A 4OJRA 4WCEL 3SV3A 1U45A 4B8CA 3PSFA 3AO1A 5KPTA 3IRXA 4KHUA 4DLGA 2OA8A 4LSNA 3OYIA 2P9PA 3U6FA 4LF7K 1IKYA 4MO4A 1GLLO 4KFBA 4BRHA 1R59O 3S3OA 3WQUA 3P1GA 3S9HA 2VQFK 1IJJA 3AARA 4LFBK 2OPQA 2Q31A 3VTHA 3LZIA 3LDPA 2D0BA 1J53A 3D45A 3V9XA 2CGJA 1VQ6N 2DPNA 3A5NC 2Y1IA 3WUHA 4EFHA 2HNZA 2BTFA 3UKRA 3C6UA 2XY7A 4FWRA 3HM8A 5HLFA 2NRVA 2E2QA 3T1YK 4GV9A 3BF1A 2Q36A 2WTUA 3MMVA 5F1XA 3OYAA 2P9PB 3O3FA 4JI4K 3TAMA 4J8FA 4Y1DA 3ENBA 3PX6A 1GOAA 1XC9A 3T1HK 3A0IX 4JK9A 4LF6K 3EO3A 4FXDA 3KKRA 1HQEA 1UOCA 3K2PA 1NJZA 4ILHA 1Y64A 3SPYA 1U04A 4AF1A 3CCJN 1YJNN 5KGWA 3R9PA 2W6LA 3O9TA 3U9DA 2DY4A 2IOCA 1EETA 4ICLA 1RT7A 3G25A 1ATNA 1VSLA 1FJGK 4MO5A 2CGKA 4M3TA 3AO3A 4OLAA 3OYFA 3M1FA 3J80O 3EZWA 3L4QA 1RT1A 3J7ZO 1A5VA 3FR0A 4JK8A 3ALYA 1P90A 1DTQA 4EHUA 4KHSA 1S72N 2W42A 4CZMA 5KPZA 4CIEA 1WNSA 2B5JA 4FPBA 3H45C 4M3WA 4NYFA 1EX4A 1RNHA 3SLCA 1VSEA 4CZHA 4YDUC 5HL7L 3ENHA 3CD6N 1EO1A 5GAGP 2KFZA 3NHGA 2OPPA 5HBMA 4KI4A 3P5JA 2VQEK 4BGBA 5DMRA 1X9MA 3TI0A 3ZLJA 4FWOA 1E4FT 3QEIA 1LWFA 2QWPA 1BA1A 3E1YA 4BDPA 4FWNA 1KSPA 4DSFA 4BRNA 2O8DA 2GV9A 2VG5A 3AVKA 4FZYA 3VN5A 4FJKA 3ZX2A 4DV0K 1ASUA 1U47A 4CJPA 5J2NA 1WSGA 4BROA 4JI0K 4M7XA 4BWMA 3F73A 4NCBA 3VQ7A 3R6MA 1TAQA 2WBNA 3CCEN 3CJ9A 1WSHA 1IG9A 1NWKA 2YKNA 3OBYA 5F2RA 4BWJA 3DRPA 1R0AA 2G8HA 1ZBSA 4KO0A 5BR9A 4RW4A 5HRRA 2GUIA 4B9MA 3CJ1A 2ITMA 2PYJA 3ZSWA 1RTHA 4K43A 2O8DB 3QNOA 4ZTFA 4ID5A 4H0XB 2Q97A 5KRTA 1B9FA 4LD0A 3L0QA 4CJRA 4LF8K 3V1RA 2BDPA 3I33A 1LAWA 4JKGA 3C65A 4XEIA 1UWBA 5DK5A 1JLBA 1KFDA 4FM2A 4BRKA 2FF3B 3QO9A 3D2EA 1UA1A 1J5OA 1OVYA 3TSUA 3QEWA 1XMQK 4DV3K 5IT9O 4HHTA 1VSDA 2F8SA 4FJXA 5HRNA 4DV2K 4BRGA 4CGGA 4FLZA 2Y1JA 1LAVA 2NZTA 1HJOA 2ASPA 4BRAA 3P39A 1NK0A 1QS4A 2GWKA 2FBXA 3QBWA 4G1QA 4OX9K 1XC3A 2WUSA 4JKGB 3ZSOA 3FGUA 4CCHA 3LPTA 1WOQA 5KTQA 3CFPA 4K25A 5BRFA 3PV8A 4BRLA 4FOIA 3D2EB 5JLFA 2UUAK 4Y1CA 5AQIA 3NGZA 1EWQA 1RDCA 4IXCA 4FWQA 3HP9A 3T3FA 1IKWA 4BR9A 1BQNA 4CESA 4CJVA 1JLFA 4AM6A 4M3UA 2IVNA 4PKGA 1TKXA 4KHYA 1NKCA 3VGKA 1VAZA 1K73O 2NRWA 2IS3A 2G8FA 3OY9A 2QK9A 1NJXA 1KVBA 3V81A 5E84A 4CJEA 4CGFA 3AVBA 4FWKA 1QQOA 4UQGA 4JI7K 3MX5A 3JAMO 3L2UA 2W40A 2P1JA 3J7AP 1ASWA 1Z05A 2O8CA 3CCMN 4BRDA 4Q5VA 2VG7A 3CQYA 4FJ8A 3EEQA 3SCXA 1VQPN 3BDPA 1N8RO 1VSKA 2HBKA 2NRHA 3OTOK 1M1KO 1L3TA 4DG1A 3B8AX 2GTDA 4B9QA 3M8QA 4ISFA 5KGXA 4XIUA 5LMNK 4AHCA 4YFUA 1KFSA 3QEVA 4GVMA 4FZZA 3V1OA 1OH6A 3CCLN 3S3NA 4I7FA 4BG9A 2UXBK 3KD5E 2FBVA 2ITGA 4DFPA 4RW6A 3DWLA 2AA4A 1MWKA 3KLEA 3NVMA 2NLXA 4FZXC 4BG8A 4NCAA 2RKIA 4C8KA 4BREA 2ZD1A 2O8CB 3O4QA 5FLXO 5AQLA 1F21A 1DKGD 4KBOA 5AQOA 3HO1A 3LP2A 4BY9C 4B3SK 2VYPA 1NOYA 4H4OA 1VSHA 1NLVA 3L6QA 1SKWA 3PSIA 4B9VA 4BC4A 4JRPA 1TV6A 4KTZA 4DB3A 5AQMA 4BQLA 3O6WA 5AQVA 3SYZA 3U4LA 3OYLA 1KVCA 5MLCQ 4FJ7A 4ISGA 3QLHA 5KI6A 3H3NO 3JSMA 2QKKA 3ATUA 3ZSXA 2D0AA 2E2PA 4FJ9A 3PX0A 1C0MA 4LSLA 5LMUK 1BQMA 4CF1A 5E26A 3E9PA 1DLOA 4BE1A 3KWGA 4O55A 5CY4A 1YVUA 1D9DA 2DFFA 3U9ZA 3IDHA 3ZSQA 1VHXA 1J9AA 3KK3A 4M3RA 2OPRA 1L3VA 4NB4A 1HKBA 3AGRA 4LF5K 4PKIA 3DLGA 5AQKA 1T7PA 4IZ9A 3FZLA 4IJNA 3RR8A 4B1WB 1RT3A 4DSIA 1C1BA 4JRQA 4B1XB 4F2SA 2HF4A 2D1KA 1VQNN 4DHYA 3H1QA 3SAHA 3AVNA 1BIUA 4ELVA 4CHOA 1CLQA 3BF3A 4IFVA 3ZSRA 1HMVA 2QWNA 3O4WA 4DU1A 3G10A 3AA3A 4CGIA 3DLLL 2NNWA 3SMSA 3H6EA 1BHLA 3O9UA 3OYHA 1QSSA 5GAEP 4FSVA 1RGIA 3M3ZA 1Q82O 2F9WA 3TU5A 4FLXA 1HNVA 3O1WA 3D2FA 1RTIA 3TR8A 4ISEA 4CEQA 1XHXA 4FM0A 4PA1A 2HHUA 1JCEA 3K59A 4JI5K 2Z1IA 4FJ5A 1CZAN 2FSKA 3VQ9A 4I2QA 4Z4FA 3MN9A 2PY5A 3DYAA 1LCUA 3BUZB 4DLEA 3DM2A 3AVFA 3IG1A 1WLJA 4BDZA 1ZBHA 3WNEA 4Z4IA 1A5XA 3O5BA 1CXQA 3OYJA 3CM5A 2P9NA 3QETA 4KRFA 1HNIA 3D2FB 1GLEG 4FCYA 3A5MC 1N5YA 1C0TA 3MXIA 2WOMA 3L4IA 4X66K 4B9UA 1RT5A 3DRSA 3EKSA 3VEWA 2GBZA 4E7KA 1TK0A 1KC8O 3HPHA 4A2BA 3K57A 4JKCA 2YJEA 3C6AA 4ELTA 3AA5X 4H03B 3M8RA 2P9NB 3FLCO 2YHWA 3CYMA 3I55N 4DTRA 2B4JA 4JKAA 3LWLA 5JVHL 3IMXA 4FWLA 4BR5A 4H8KA 1J54A 1YVNA 4CFDA 4HCBA 2O8EA 3GDQA 1TUUA 3MWTA 4LC9B 2OANA 3SUQA 2A42A 1NMNA 2NUBA 4Z4HA 2BH1A 2WFBA 1NK7A 3L8BA 3AO5A 3N4QA 4RW9A 3TAPA 1EXQA 3E9LA 1KCFA 4KHNA 5JICA 3VOVA 4BR7A 3NGYA 2VWJA 2E6LA 1WBBA 1O13A 3TABA 3IKMA 4CJKA 3ZSVA 4BVOA 3I0RA 2O8FA 2O8EB 3AGKA 3I8BA 3TAGA 4KB1A 4F4KA 5ADXA 2IGIA 4DTMA 1NK5A 1S6PA 4E19A 1ZBUA 2HHWA 1V4TA 3ULDA 4NXMK 3VESA 3K5OA 3RRHA 3CXCM 4G9ZA 4EAHD 3OYKA 3ZT1A 2LSNA 2RE2A 4ID1A 4DV7K 3K5LA 3AAPA 4BRMA 4J2BA 5DM7L 3ZX0A 2H3GX 5HRSA 5BN8A 4CJWA 3V1QA 4AILC 4YHHK 5AZJA 4WYBA 2O8FB 4ZTJA 2E6MA 1N6QA 2YNIA 4B3RK 2HBJA 3LL3A 4E3SA 1RBUA 4FVMA 4EIAA 4YOUA 3HM9A 3F5TA 4CGHA 4F3TA 1UAXA 1JL2A 3AA2A 2E5LK 2QXFA 3MWPA 2OZMA 4JI2K 3UB5A 3OVNA 3SQ0A 2PYLA 4I9QA 3OYGA 3QBXA 1W0HA 1JLEA 4M45A 2JGUA 3D6RA 4YOXA 3CIPA 2OYQA 4E7IA 4GV3A 4KTWA 4CHQA 2D0CA 5AZJB 1WSJA 4BR4A 1NK8A 1C0GA 3G0ZA 2F8TA 3SPZA 1WAFA 2W6KA 3M5RA 3J7YP 4Z4GA 1G15A 1JCFA 4E0DA 1CZBA 4JI8K 4DR1K 4O8UA 3OJSA 1VQ4N 1KAZA 3HK2A 1D5AA 2E4LA 2YX6A 3CC2N 1E3MA 3OYBA 1CXUA 3QB0A 3M8PA 3C7NA 4CEBA 4AQYK 3RMCA 1W7AA 3DLEA 1X9JA 2GELA 5CZ2A 3VMFB 1GLBG 2YCHA 4FLTA 2VCPA 1SS6A 3VA3A 3K5MA 4FJLA 3OA9A 3KK7A 2A6AA 1JXBA 2Z1HA 2HB5A 1BA0A 4HCCA 2XY8A 4CJFA 5GIPA 2HHXA 4BC2A 4X62K 2HMIA 4DQ8A 4WQ5A 2G8WA 3UKRB 3TAQA 1WB9A 2OCEA 3C7NB 3G6EN 4OGCA 4JKEA 3VF2A 2ZE2A 4QCLA 4H5VA 2VGNA 5AQXA 4DKWA 4FK2A 5C0YA 4KHPK 5BPMA 3KLIA 2VGMA 4EP5A 1X3MA 2Q0RA 4BQZA 5FPMA 4GNIA 1HLUA 4B3TK 1SKSA 1N34K 3THYA 1N33K 3NH0A 4FW1A 4A59A 2XO7A 4A5AA 3VF6A 3CJAA 4CI6A 4LF4K 1B9DA 3FFKB 3SAFA 3W3DA 2ETJA 4FJMA 3ZT2A 1ILYA 1NK6A 1C1AA 1B92A 1RDUA 4B9TA 4B1UB 1Q8IA 2DTUA 1BIZA 5BPLA 3LDOA 3ZT3A 3TAEA 3ASMA 2HHVA 3BGRA 1IBMK 3HP6A 1U4BA 3CM6A 3OYMA 2QA4N 2QKBA 5GAHP 5DM6L 3THYB 2UU9K 1YITN 1FXXA 1TVRA 3AO2A 4JI1K 1Q81O 4ILGB 4OKKA 2D0PA 1HYVA 4A62A 2CGLA 4CF9A 1BO5O 3EE9A 1U6ZA 2EWSA 2Z1GA 1VSFA 4FJNA 4YOTA 1NKEA 1OVQA 2OPSA 5BR8K 2P9LA 5AQWA 4KAZA 4W5OA 1S9EA 4C23A 4FJHA 2KZMA 1HNXK 1V4SA 4LFAK 1W9HA 2EX3A 4IFYA 3R3LA 4CGJA 4ZHRA 2A5XA 4ILJA 2OTJN 4CD1A 3TARA 3HBTA 5IWAK 3KJVA 4CERA 4DU3A 3E01A 2RN2A 3LAMA 4CFCA 4RCHA 2QXLA 3ZETA 1TL3A 1C0FA 1X9WA 1O1WA 3NF8A 3NF9A 1VSIA 4EZ6A 4YOWA 4K8ZA 4PHTX 2P9LB 1HJRA 1IV0A 4N41A 3ITHA 1BISA 1NK9A 3IS9A 5JMVA 4IG0A 3HOSA 4DV5K 1NJWA 5I42A 4W5TA 1RBRA 3QESA 4W5QA 5C24A 4CIFA 3T7ZA 4CK3A 3CCQN 3CFRA 1I3AA 1BCOA 1XWLA 3TTDA 1I94K 4DFJA 4HWIA 2F4VK 1KD1O 5J2QA 4PY5A 4L3QA 4GKJK 1GLJO 3ZETB 1T3VA 5FRMA 4B1YB 2KHOA 3C6TA 3WNGA 1W97L 3VTIA 4WQ4A 4I6MA 4MLHA 4Z94A 2P9SA 4BC5A 5AQSA 3WXKA 1NG9A 3WXJA 1T6CA 3VQPA 1IH7A 1ZBFA 3VEOA 2NRXA 3VQ6A 4AH9A 2G8UA 5I3UA 1HYSA 2A41A 4ELUA 4E1MA 5AQQA 4JI6K 1U49A 4FJGA 1Q7YO 5C15A 3A2FA 4DF4A 3R1XA 1SZ2A 3V9WA 2AJQA 1VQLN 3OHRA 3EZ5A 1NGJA 3JXUA 4I6MB 1K9MO 4HTUA 2P9SB 2FBTA 3PUFA 3WQTA 2PZSA 2HBLA 3QIPA 3VEYA 4B1VA 2QWQA 3ID6A 2IAJA 4N56A 1TAUA 4LFCK 5H1SQ 1QZ6A 5GINA 3J8AA 4WQ5C 4MLEA 5CYQA 2HHQA 5BN9A 2HMPA 2ASMA 3KIOA 3SNNA 3WXIA 3THXA 4DS5A 4GV6A 4DMNA 3DJCA 1BWFO 3VPZA 5TKWA 1XI1A 2W41A 1NM1A 4FW2A 4CF0A 1FK9A 3KD1E 3O1BA 3H08A 1RT6A 1S1XA 2RPIA 4MDAA 3DOLA 5F0XA 1QQCA 5JS2A 1NOZA 3ZYYX 3SUPA 4CIGA 4FK4A 2ZJQL 1WSFA 4IOCL 1DGKN 1MA9B 3HOTA 2HSTA 5KRSA 2X6NA 4IOXA 1J6ZA 3HXMA 1VRUA 3AO4A 4CZLA 3VQBA 4JD2A 4R5PA 5M1PA 3RMBA 5AQGA 3CG7A 1D4XA 2KFNA 1ZXOA 2VG6A 1IBLK 3THXB 3QDKA 4FJIA 2V7YA 4FLWA 5AJ3K 3KK1A 5FPEA 2HW3A 5AQNA 2D5RA 1MDUB 3P38A 5GIOA 1YTUA 4FO0A 1JLQA 5A2QO 4DR5K 1G99A 2QWMA 1JJ2M 1S5JA 1RT2A 4PL7A 4K41A 4HUFA 4B9LA 4GY2B 4QOZB 3QEXA 4KREA 4C1NI 3PIPL 4IO8A 4DSLA 4JD2B 4H5RA 2G8VA 4QS9A 2XRIA 5AQTA 5HRPA 4X65K 4BE2A 1VQMN 4FM1A 4CJ7A 4HTLA 4K8XA 4XH5A 1VK0A 2QWOA 4IDKA 3MXMA 1C0UA 1LWCA 2E20A 4CZEA 4DTNA 3MN7A 2GEMA 1TKTA 4JLHA 4IEIA 4IWVA 3LDNA 4IKFA 4BR2A 4RWTA 4DTOA 4XH4A 3PY8A 3LM9A 3IFRA 1GOBA 4FWPA 3SBTA 1NJIO 3FZHA 1CZ9A 3JS6A 4KHWA 4CBWA 4NO7A 3RVCA 4E7HA 4CHZA 1TKZA 3MDQA 1SUQA 3CQXA 1NGBA 4CJLA 4DCHA 3TTFA 3RMDA 3CCSN 1NU0A 1JXEA 2HHHK 1QSLA 4CZIA 3G4SN 2QEXN 1HYZA 1NGGA 3KVGA 1BL3A 3F9KA 1RBTA 3PO4A 3I56N 3OBWA 3AY9A 1XNRK 5T7BA 3QFUA 2JWLA 4LY7A 4FOEA 4M42A 3B6OA 3MECA 3BZCA 1K8AO 2ASOA 3MN6A 4FLYA 2Q0UA 1MU2A 1BDGA 1RCHA 3HVTA 2Q3SA 4OPAA 1YF5L 4TSXA 3VEZA 1ATRA 1WN7A 1NNEA 3PX4A 3NBPA 1ASVA 2X6SA 3BY5A 5CR4A 3SQ2A 4LH4A 3KLGA 3GL1A 2P9IA 4WQ4C 1RBSA 3PO5A 4AHRA 4YNQA 4DR7K 1BUPA 1J5EK 1XNQK 3AA4A 3MCAB 3RWUA 3WNFA 4OPJA 3OS0A 2YV0X 3TAFA 3A5OC 1GOCA 4BVPA 5CE3A 4IBNA 3LALA 3TSQA 4FVUA 3ZX3A 1ZBLA 3FZFA 4CF8A 2YKMA 3LP0A 4KHQA 4NXNK 3U8XA 2HHTA 3OYEA 5AFUH 3BEXA 1JLGA 1GLDG 1YXQA 5AQRA 4CEZA 2HVIA 4H0OA 1T03A 5CHIA 3KK2A 3TWHA 2P9IB 2YHXA 4DTJA 4KB0A 2P9UA 3VQCA 1IG8A 2XY5A 4AHSA 4CEDA 3NH2A 2XY6A 1XMOK 5AQYA 1K6YA 3IAYA 1LW0A 2UUCK 2D4WA 5M1QA 3ZT4A 1WBDA 3BP8A 2O4IA 4H4MA 3NE6A 1RILA 1XQSC 5LJWA 4M3YA 1SL1A 3V9UA 2X78A 3QEPA 3VEXA 1VQ7N 4WFAL 4JN4A 3F2KA 2UXCK 3LDLA 4BRFA 4IFEA 4JKDA 1L3SA 3O08A 4YORA 2IVPA 5HROA 1YHQN 1OH7A 2FSJA 4GVEA 3IUCA 3G71N 3VETA 4A2AA 4FWSA 5M1FA 3UE5A 3V6DA 5C12A 4CZGA 1DEJA 3ULEA 3I0SA 4DR6K 3DLBA 2FF6A 3TPQA 1NBWA 3HVRA 1YUWA 3O4NA 3VQEA 4QS7A 1YIJN 2QWRA 1HPMA 3S3MA 1IBKK 4U67L 2YNHA 2WC9A 1IKVA 1T05A 1LV5A 1U48A 4Z4CA 4FLVA 4IOAL 4N47A 2KZZA 1X3NA 1Z26A 3ZSYA 3CC7N 5M1KA 3LM2A 5AQPA 1Q9YA 4BRQA 4CBUA 3ULEB 3CC4N 3VQAA 1NGFA 4RW8A 3WEEA 4AHTA 4BE0A 1A5WA 1TYQA 3SQ4A 1HRHA 1QQMA 4E89A 1LWEA 4CJ3A 2NRZA 3CCRN 3NVKA 5JVGL 2HF3A 3HTVA 1WSEA 1JLCA 2IVOA 4H5TA 2KLAA 2A40A 2I7PA 4DS4A 2A1RA 3MEGA 3CJCA 5D3GA 1SV5A 5SZTA 2OTLN 1ESVA 2ZJRL 2HNDA 2E2NA 4A57A 3SV4A 1D8YA 2HHSA 1HUXA 3L2VA 1NGAA 4AM7A 3NF6A 3KKSA 4OPKA 4F8RA 4JK7A 1D9FA 4DV4K 2P5OA 5C25A 2HOEA 3H1VX 4J2EA 3DLRA 3WEEB 3NGIA 1QTMA 3V4IA 3HSCA 1P8ZA 4CJ4A 4H5WA 1TYQB 3T1AA 1VSMA 3UIQA 2KW4A 4FLUA 4CEFA 2V7ZA 4PWDA 4Y0WA 4CK2A 4C8LA 3CPWM 3VQ5A 3THWA 4DFKA 1JL1A 4FYDA 5C10A 4O0IA 3AVAA 4JHDA 5J2MA 2ZJPL 3LANA 4M7YA 1QHTA 2KTQA 2YHAA 2PFUA 4WF9L 2AP1A 5FPDA 4F3OA 1SL2A 4B9NA 3EYZA 5AR0A 3NH1A 1XUPO 2HBMA 4CHPA 3A5LC 4KH6A 4GW6A 3THWB 1OH8A 3CHWA 3GBTA 3T19A 3UKUA 1S1TA 4JHDB 3AVCA 1ATSA 2YHYA 2QI2A 3O9RA 1RFQA 4DQRA 3ZSZA 3O8MA 4CZJA 3ISNC 3MAQA 3SZ2A 3KTQA 1WSIA 4DR4K 1H1VA 5AQZA 4DV1K 5EVZA 4LF9K 4DV6K 3U3YA 1TL1A 5JS1A 3A8YA 4E7LA 1C6VA 4JI3K 3KWIA 1TUYA 3L3UA 3P31A 1L5UA 3M8SA 1LOTB 3AAQA 2ZQBA 3AVGA 1BU6O 2F9TA 4C8NA 1HKCA 5C2DA 4HUEA 4CJ5A 5LJVA 3CMAN 3DMJA 3OS1A 4OPHA 2CH6A 3VERA 4CZKA 1VQ9N 4QAGA 3UKUB 4J2DA 4FPAA 4JS5A 3KHYA 5KQDA 3DLHA 4OKJA 3CETA 4RTFD 1TK5A 3ZEUA 3AVMA 1KLMA 2Z1JA 3HI0A 2E1ZA 4U7BA 5C42A 2YHBA 4JKFA 4M63C 1EKEA 4DUZK 1KAYA 1S6QA 3NF7A 1Q9XA 1TGOA 1MWMA 4K42A 1YT3A 1S22A 4DR3K 3O9SA 4O44A 1YJWN 4FJJA 3ZEUB 3Q7BA 1QQNA 4CFAA 2G8KA 1VQ5N 1SL0A 1HNZK 2O8BA 1HX1A 5C2FA 1U2VA 3E66A 3F9MA 2B6AA 4CBXA 4QS8A 2E8AA 2FLOA 3AVJA 2JWKA 3ZCMA 3EY1A 4M3ZA 4E7JA 3FFIA 3HYFA 4CD3A 4H0TB 4JYAK 2DFHA 4DTPA 2GWJA 4DR2K 5AQJA 4M41A 3WNHA 3LDSA 3RR7A 3OYNA 3DLKA 4W5RA 3L2RA 1GLCG 3K5NA 1DT9A 3D7EO 4FWMA 3HJFA 3B6PA 4OKEA 2E1YA 4YOVA 1YI2N 2O8BB 4DFMA 3VQ8A 3OS2A 1U2VB 1KAXA 5JLHA 3DXMA 3QMLA 3QIOA 3C6HA 4H5NA 1E4GT 2QWLA 3KZBA 2P9KA 3NCIA 2VWBA 1JCGA 3HL8A 4L8RB 3DAWA 1NGHA 4DSJA 3AVIA 4Q0BA 1WUAA 3I8DA 4RG8A 2UYTA 1Q18A 3V9ZA 1X9SA 4JEPA 5B8HA 3JYTA 2QW9A 5BPNA 3VF4A 3NMUA 4YY3K 2PAVA 4R79A 3LZJA 2V52B 1VRTA 3DXMB 4H0VB 5EXWA 3THVA 4F9OA 4DTUA 4HUGA 3HRGA 4I9LA 4O8KA 2FSNA 2P9KB 3GOIA 3LAKA 3R8EA 2ZF5O 2I7NA 2Q2RA 1YJ9N 4OO1J 4C8OA 3KLFA 1RTJA 2ZM6K 4IG3A 3GE1A 4CF2A 5SWMA 3K58A 3CI5A 4CE9A 3SJJA 4CW7B 3ATVA 1SAZA 3SUOA 3V9SA 4N5SA 2IDOA 3L3VA 2YNGA 3C95A 1FW6A 3MEDA 1YAGA 2P51A 2ZGZA 2FBYA 2A1SA 2PBDA 1QE1A 4IDHA 4CVNE 4NLCA 2F96A 4DQQA 5HP1A 1KTQA 4DF8A 4V19S 3H46O 3CFOA 3QFPA 3HZ6A 1NGCA 5EY4A 3VQDA 3QERA 4IJAA 1T6DA 3AVHA 4WFBL 4DU4A 3OW2M 3SQ1A 3N4PA 1ZBIA 4CHYA 1RBVA 5CYMA 1KLNA 1RDBA 2FXUA 4CZFA 3CERA 4CEOA 3DRRA 4CEAA 5E41A 3RRGA 5AQHA 5KPRA 4A5BA 4AHUA 3QINA 3K9KA 4KPYA 2VWKA 4O4GA 1VQ8N 4I2PA 3E9OA 4LH5A 3DI6A 1ZYQA 1KQSM 2XHBA 1Q86O 5EX5A 4DQPA 3C94A 3O3HA 1JLAA 4B08A 1BOTO 4BDYA 3P83D 1S1VA 1BG3A 5I9EB 4CEEA 3SMPA 5BREA 3DXKA 3CMEN 1NMDA 2IIRA 4B9SA 1NJYA 5GADP 1S1UA 3OYCA 1K8KA 2WONA 2DFEA 3CJBA 4K0KK 4OGEA 3FZMA 4B3OA 5HOOA 4BRCA 1QVFM 4Z0UA 1BGXT 4CGDA 1HR0K 4DQSA 1KRPA 3P4IA 1Y97A 3LWMA 3VGMA 1OKJA 3MXJA 4PQUA 5FRNA 4IEEA 4MQ3A 3U3GA 2NRTA 2ZWHA 1FKOA 2OZSA 5LL6Z 4JNEA 4KH5A 3SAGA 3NAEA 1VSJA 3CQ8A 1EWRA 3KLHA 3DXKB 3SUNA 3C0BA 3WXMB 1NGDA 4UY8O 5CZ1A 2V51B 1XHZA 2HVHA 1QVGM 1K8KB 3LPUA 3D0PA 1Z6RA 4FL9A 2RHKA 5LY3A 1QSYA 1FKPA 5BRDA 1VQON 3L2QA 4DTXA 4CJSA 4KKOA 3VENA 2HNYA 1Z25A 1ZC6A 3L2WA 3RTVA 3VEVA 4X64K 3EKUA 3TANA 1T8EA 1QHAA 4O0JA 3TSPA 4GKKK 2KQ2A 4CJUA 3NDKA 3K0SA 1RDWX 4FK0A 1N32K 1HKGA 1TK8A 4CFBA 1SQKA 3HPOA 4JAXA 4PUOA 4OLBA 1HPZA 1X1PA 2J4RA 2BANA 2Q1NA 3EL2A 3RMAA 4F2RA 2ZGYA 3PLAA 4GMJB 4O5BA 3VGLA 2FC0A 3RSEA 1L3UA 4J2AA 1S9GA 4KV8A 3DOKA 3J81O 1S3XA 5M1OA 3CPEA 4C1NK 3O80A 4CK1A 4JKHA 5TKYA 3SK3A 4KH4A 5FDLA 2UXDK 3MN5A 4DQIA 4NLBA 1JKHA 1NGEA 5FPNA 1W2BM 4YOYA 1WAJA 4CJQA 1S1WA 4W5NA 3AVLA 3LP3A 3RSEB 5AFUA 4WE1A 4B8AB 3W0LA 4CJTA 2A3ZA 3QICA 2G8IA 2BGGA 4XH1A 1GLAG 4OVLA 1RTDA 2ATQA 3EE8A 4JV5K 1I39A 1RDAA 1HNWK 1HQUA 3OJUA 3SJHA 3MK6A 1SKRA 4PKHA 1UA0A 5M1NA 4DUYK 3CCVN 2BE2A 3CCUN 3WT0A 3SBGA 3BZKA 2EHGA 4CHNA 3ENOA 2BUPA 4IO9L 2KKZA 3WXLA 2P5GA 4O5FA 2P9UB 5J2PA 1M90O 2E88A 3K9JA 2YJFA 2F7TA 3H3OB 1YTAA 1NK4A 4Z4EA 3HPGA 4MFBA 5AZIA 1EP4A 4DTSA 1NKBA 5ELZA 4B3MK 5EU7A 3CF5L 4YDUA 4DSKA 3NFAA 3MX2A 2JLEA 3CJ7A 4BRIA 2R7YA 4HVJA 1GLFO 4NYNA 3FZKA 2X74A 3VQQA 3MCPA 3TTCA 4BGAA 5FROA 4C8MA
chains in the Genus database with same CATH topology
1WSIA 1J9AA 3KK3A 4M3RA 2OPRA 1L3VA 4JS4A 1IKXA 1C1CA 4EZ9A 3VA0A 3VQPA 3U3YA 1TL1A 3DLGA 5JS1A 1T7PA 1BI4A 1IH7A 1ZBFA 4E7LA 1C6VA 1TKDA 2O4GA 3L3UA 1L5UA 3VQ6A 1HYSA 4AH9A 2G8UA 5I3UA 3M8SA 3RR8A 1RT3A 4ELUA 4E1MA 4DSIA 4Z4EA 3AVGA 2ZQBA 4C8NA 3HT3A 1C1BA 3LP1A 4JRQA 4F2SA 1U49A 4HUEA 2I5JA 4CJ5A 4FJGA 3DMJA 3A2FA 3OS1A 4M3XA 4DF4A 1KVAA 4QAGA 4J2DA 4JS5A 3AVNA 1BIUA 4ELVA 4CHOA 1CLQA 3DLHA 4OKJA 3V9WA 2AJQA 4IFVA 3ZSRA 4RW7A 1HMVA 3EZ5A 1TK5A 4DU1A 4HTUA 3G10A 3AVMA 3AA3A 1ITGA 1KLMA 2FBTA 2Z1JA 3O3GA 3PUFA 4CGIA 4BACA 2PZSA 4CECA 5C42A 3SI6A 2YHBA 1REVA 3QIPA 1BHLA 1EKEA 2RF2A 5K14A 3OYHA 3QNNA 1QSSA 1BI4B 1S6QA 2IAJA 5J1EA 4N56A 1TAUA 3NF7A 4FLXA 1HNVA 4EP4A 1BCMA 1LW2A 5CYQA 1Q9XA 1TGOA 1RTIA 3TR8A 1DTTA 2HHQA 4E1NA 3KIOA 2YNFA 3SNNA 4NCGA 4CEQA 4DWIA 1XHXA 3AV9A 3MEEA 1YT3A 4DMNA 4PA1A 4FM0A 4DS5A 3ZT0A 4AHVA 4KTQA 3HSTB 3K59A 2HHUA 2IC3A 2Z1IA 4FJ5A 4KI6A 3VQ9A 4DSEA 1RT4A 4I2QA 1XI1A 4O44A 4Z4FA 1IO2A 3VQ4A 4FW2A 4CF0A 4FJJA 1FK9A 1RDDA 2PY5A 3H08A 1RT6A 1S1XA 2RPIA 3DYAA 3KD1E 4CFAA 4DLEA 3DOLA 2G8KA 1SL0A 3DM2A 1QQCA 5JS2A 3AVFA 1NOZA 3OYDA 3IG1A 3SUPA 4CIGA 4FK4A 1WLJA 1WSFA 4BDZA 1ZBHA 3WNEA 4N76A 4Z4IA 1A5XA 2B6AA 1CXQA 3OYJA 3CM5A 5KRSA 4OJRA 2X6NA 3QETA 4KRFA 3AVJA 3SV3A 3HXMA 1VRUA 3ZCMA 3AO4A 3EY1A 1U45A 1HNIA 3VQBA 4B8CA 4M3ZA 4E7JA 3AO1A 4R5PA 3FFIA 3HYFA 3IRXA 4KHUA 4FCYA 3RMBA 3CG7A 4DLGA 1N5YA 2DFHA 1C0TA 4DTPA 2KFNA 2OA8A 2VG6A 4LSNA 4M41A 3MXIA 3WNHA 3OYIA 3LDSA 2WOMA 3U6FA 4B9UA 1IKYA 4FJIA 3RR7A 1RT5A 3DRSA 4FLWA 3OYNA 3DLKA 4W5RA 4KFBA 3KK1A 3L2RA 2GBZA 3K5NA 3S3OA 2HW3A 3S9HA 3P1GA 3HJFA 4E7KA 3B6PA 4OKEA 2D5RA 1TK0A 3HPHA 2OPQA 3LZIA 1YTUA 3K57A 1JLQA 2D0BA 1J53A 3D45A 3V9XA 4DFMA 3VQ8A 4ELTA 3OS2A 2Y1IA 3AA5X 1S5JA 1RT2A 2HNZA 4HUFA 3QIOA 3M8RA 3C6UA 4B9LA 2XY7A 3QEXA 4QOZB 4KREA 3CYMA 5HLFA 4DTRA 4DSLA 2B4JA 2G8VA 3LWLA 5HRPA 2XRIA 3NCIA 4BE2A 4FM1A 3HL8A 4H8KA 4L8RB 1J54A 4CFDA 3OYAA 3O3FA 4HCBA 4K8XA 4DSJA 3TAMA 3AVIA 1VK0A 4Y1DA 4Q0BA 3I8DA 2DTUA 4IDKA 1GOAA 4RG8A 3PX6A 3SUQA 3MXMA 1C0UA 1LWCA 3V9ZA 1XC9A 4DTNA 1X9SA 3JYTA 2NUBA 1TKTA 4JLHA 4FXDA 4Z4HA 3KKRA 4IKFA 1NK7A 1HQEA 1UOCA 3K2PA 4DTOA 3L8BA 1NJZA 3AO5A 3PY8A 3LZJA 3SPYA 1GOBA 4RW9A 1VRTA 1U04A 3TAPA 1EXQA 3THVA 4DTUA 1KCFA 4KHNA 1CZ9A 4KHWA 4HUGA 5KGWA 3NGYA 4I9LA 4CHZA 2VWJA 2E6LA 1TKZA 4E7HA 3TABA 4CJKA 3ZSVA 2IOCA 3LAKA 2DY4A 1SUQA 1EETA 4ICLA 1RT7A 4CJLA 3I0RA 1VSLA 3RMDA 3TAGA 4C8OA 1JXEA 3KLFA 3AO3A 4F4KA 4KB1A 4M3TA 1RTJA 4OLAA 1QSLA 3OYFA 1HYZA 4IG3A 1BL3A 2IGIA 4CF2A 4DTMA 5SWMA 1NK5A 1S6PA 3F9KA 1RBTA 1ZBUA 4E19A 3K58A 3PO4A 4CE9A 1RT1A 2HHWA 1A5VA 5T7BA 3ALYA 3ULDA 3SJJA 1DTQA 3K5OA 4LY7A 3RRHA 4KHSA 2W42A 4M42A 3SUOA 3B6OA 3MECA 3V9SA 4N5SA 4CIEA 2IDOA 1WNSA 4FLYA 3OYKA 2B5JA 2LSNA 2YNGA 3C95A 3L3VA 4ID1A 3ZT1A 1MU2A 3MEDA 3K5LA 4M3WA 4NYFA 1RCHA 3HVTA 1EX4A 1RNHA 2Q3SA 2P51A 4J2BA 5HRSA 4TSXA 2FBYA 2A1SA 3V1QA 4CJWA 1VSEA 1WN7A 4AILC 1QE1A 3PX4A 2KFZA 3NBPA 4ZTJA 1ASVA 2E6MA 3NHGA 2X6SA 2OPPA 1N6QA 2YNIA 3SQ2A 4LH4A 5HBMA 3KLGA 4E3SA 2F96A 1RBUA 3P5JA 4FVMA 3SZ2A 4DQQA 1RBSA 4KI4A 3PO5A 4AHRA 4YNQA 5HP1A 1KTQA 5DMRA 4DF8A 3HM9A 4F3TA 4CGHA 1X9MA 3CFOA 3TI0A 1UAXA 1JL2A 3AA2A 3AA4A 2QXFA 3QEIA 1LWFA 3RWUA 3WNFA 4OPJA 2OZMA 3OVNA 3SQ0A 2PYLA 3OS0A 4I9QA 2YV0X 3TAFA 4BDPA 3OYGA 3VQDA 3QERA 1KSPA 3AVHA 4DSFA 1W0HA 2GV9A 2VG5A 3AVKA 4DU4A 3SQ1A 4FZYA 1ZBIA 1GOCA 3VN5A 1JLEA 4CHYA 4M45A 4FJKA 4IBNA 2JGUA 3LALA 1ASUA 1U47A 1RBVA 4CJPA 5J2NA 5CYMA 1ZBLA 1WSGA 1KLNA 2OYQA 4E7IA 4CF8A 1RDBA 2YKMA 3LP0A 4KTWA 4BWMA 4CHQA 3F73A 4KHQA 2D0CA 4NCBA 2HHTA 3VQ7A 1WSJA 4CEOA 3OYEA 1NK8A 1JLGA 1TAQA 2HVIA 3DRRA 4CEAA 4CEZA 5E41A 3RRGA 3G0ZA 1T03A 2F8TA 3SPZA 3KK2A 3TWHA 1WAFA 4AHUA 3QINA 4KPYA 2VWKA 1WSHA 1IG9A 2YKNA 4O4GA 4DTJA 4BWJA 4KB0A 4I2PA 3DRPA 1R0AA 1LV5A 2G8HA 4LH5A 3VQCA 3DI6A 1ZYQA 4Z4GA 4KO0A 2XHBA 2XY5A 1G15A 4DQPA 4RW4A 4AHSA 1CZBA 2GUIA 5HRRA 4B9MA 4E0DA 4CEDA 3NH2A 3C94A 3O3HA 2XY6A 1JLAA 3OJSA 2PYJA 3HK2A 4B08A 3ZSWA 1RTHA 1D5AA 3QNOA 2E4LA 4BDYA 1K6YA 4ZTFA 3IAYA 3P83D 1S1VA 1LW0A 4ID5A 5KRTA 3OYBA 1CXUA 4CEEA 3ZT4A 3M8PA 1B9FA 2O4IA 4H4MA 4CEBA 1RILA 3NE6A 3RMCA 3DLEA 4LD0A 4CJRA 4B9SA 3V1RA 1NJYA 2BDPA 4M3YA 1LAWA 1SL1A 5CZ2A 3V9UA 2X78A 3QEPA 1S1UA 4FLTA 3OYCA 1UWBA 5DK5A 1JLBA 1KFDA 2WONA 3VA3A 2DFEA 3K5MA 4OGEA 4FJLA 4FM2A 4B3OA 1JXBA 3QO9A 2Z1HA 4Z0UA 1BGXT 4CGDA 1UA1A 1L3SA 1J5OA 3QEWA 2HB5A 4HHTA 1VSDA 4DQSA 2XY8A 4CJFA 1KRPA 5HROA 4HCCA 1Y97A 2F8SA 3LWMA 3MXJA 4FJXA 5HRNA 4PQUA 2HHXA 5FRNA 4MQ3A 3U3GA 4CGGA 1FKOA 4FLZA 2Y1JA 1LAVA 2HMIA 2OZSA 2G8WA 3NAEA 3TAQA 1VSJA 3V6DA 1NK0A 1QS4A 3CQ8A 3KLHA 3SUNA 2FBXA 4OGCA 4G1QA 3I0SA 5CZ1A 3ZSOA 1XHZA 2HVHA 3DLBA 3LPUA 4CCHA 3LPTA 3PX0A 2ZE2A 4QCLA 3D0PA 3HVRA 3O4NA 5KTQA 3VQEA 3CFPA 3PV8A 4FK2A 4Y1CA 1QSYA 3KLIA 1FKPA 3NGZA 3S3MA 1RDCA 3HP9A 4EP5A 2YNHA 3L2QA 3T3FA 4DTXA 1IKWA 1IKVA 1T05A 4CJSA 1U48A 4Z4CA 4KKOA 4FLVA 4N47A 1BQNA 4CESA 2KZZA 2HNYA 1Z25A 3L2WA 3RTVA 4CJVA 1JLFA 1Z26A 1SKSA 3ZSYA 4M3UA 3NH0A 4FW1A 1TKXA 3TANA 4KHYA 1NKCA 2XO7A 1T8EA 1Q9YA 4O0JA 2KQ2A 1B9DA 4CJUA 3NDKA 2IS3A 2G8FA 3VQAA 4FK0A 3OY9A 1TK8A 2QK9A 4RW8A 4CFBA 2ETJA 1NJXA 4FJMA 3ZT2A 4AHTA 4BE0A 3HPOA 1KVBA 1NK6A 1C1AA 3V81A 1B92A 1A5WA 3SQ4A 4B9TA 4CJEA 4PUOA 1HRHA 1Q8IA 1HPZA 4CGFA 1BIZA 4E89A 1LWEA 1X1PA 3AVBA 4CJ3A 2BANA 4UQGA 3RMAA 4F2RA 4GMJB 3ZT3A 3TAEA 3ASMA 3L2UA 4O5BA 2P1JA 3BGRA 1ASWA 2HHVA 2FC0A 1L3UA 1WSEA 3HP6A 1U4BA 1S9GA 4J2AA 1JLCA 2VG7A 3CM6A 4Q5VA 4FJ8A 3SCXA 4KV8A 3OYMA 4DS4A 2A1RA 3DOKA 3MEGA 3BDPA 1VSKA 2QKBA 5D3GA 1SV5A 5SZTA 3SV4A 1L3TA 2HNDA 4DG1A 1D8YA 2HHSA 3M8QA 1FXXA 5KGXA 1TVRA 3AO2A 4XIUA 4AHCA 4YFUA 3L2VA 1KFSA 4OKKA 3NF6A 3KKSA 4CK1A 3QEVA 1HYVA 4OPKA 4F8RA 4GVMA 1D9FA 4FZZA 4CF9A 3V1OA 2Z1GA 2P5OA 5C25A 1VSFA 4FJNA 3S3NA 5FDLA 4I7FA 4J2EA 1NKEA 3DLRA 3NGIA 1QTMA 3V4IA 2OPSA 3KD5E 2FBVA 2ITGA 4CJ4A 4DFPA 4RW6A 4KAZA 4W5OA 3T1AA 4DQIA 1S9EA 1JKHA 1VSMA 4FJHA 3KLEA 1WAJA 4CJQA 4FZXC 1S1WA 4NCAA 2RKIA 4C8KA 3UIQA 2KZMA 4W5NA 2KW4A 2ZD1A 3AVLA 3LP3A 3O4QA 4CEFA 4FLUA 1W9HA 4WE1A 1F21A 2EX3A 4IFYA 4PWDA 4CGJA 4CK2A 4ZHRA 4B8AB 4CJTA 4C8LA 3TARA 3VQ5A 2G8IA 2BGGA 4DFKA 1RTDA 4OVLA 3KJVA 1JL1A 2ATQA 3HO1A 4CERA 4DU3A 3LP2A 3E01A 2RN2A 3LAMA 4FYDA 4CFCA 4O0IA 1I39A 3AVAA 1RDAA 1NOYA 4H4OA 1VSHA 5J2MA 1HQUA 1TL3A 3OJUA 1X9WA 3LANA 1O1WA 3NF8A 1NK4A 3NF9A 1SKWA 1SKRA 1VSIA 4EZ6A 4B9VA 1UA0A 1QHTA 4JRPA 2KTQA 4K8ZA 1TV6A 2YHAA 2BE2A 4KTZA 1HJRA 3SYZA 2EHGA 4CHNA 4N41A 3OYLA 3ITHA 4F3OA 1BISA 1SL2A 1KVCA 3EYZA 1NK9A 3IS9A 4B9NA 2P5GA 5J2PA 4IG0A 3NH1A 4FJ7A 3QLHA 5KI6A 5I42A 4W5TA 4CHPA 3JSMA 1NJWA 1RBRA 2QKKA 3QESA 3ZSXA 4W5QA 2D0AA 5C24A 4GW6A 4CIFA 4FJ9A 4CK3A 1C0MA 1YTAA 1I3AA 4LSLA 1BCOA 1XWLA 3HPGA 3CFRA 1BQMA 4CF1A 4MFBA 4DFJA 1EP4A 1DLOA 4BE1A 4O55A 4DTSA 5CY4A 1NKBA 5J2QA 5EU7A 4PY5A 4DSKA 3T19A 4OLBA 1YVUA 1S1TA 2JLEA 3NFAA 3AVCA 5FRMA 1D9DA 2DFFA 2R7YA 4HVJA 3C6TA 3WNGA 4NYNA 3VQQA 2X74A 4DQRA 3ZSQA 3ZSZA 3MAQA 3ISNC 5FROA 4C8MA 3KTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSI A;  1J9A A;  3KK3 A;  4M3R A;  2OPR A;  1L3V A;  4JS4 A;  1IKX A;  1C1C A;  4EZ9 A;  3VA0 A;  3VQP A;  3U3Y A;  1TL1 A;  3DLG A;  5JS1 A;  1T7P A;  1BI4 A;  1IH7 A;  1ZBF A;  4E7L A;  1C6V A;  1TKD A;  2O4G A;  3L3U A;  1L5U A;  3VQ6 A;  1HYS A;  4AH9 A;  2G8U A;  5I3U A;  3M8S A;  3RR8 A;  1RT3 A;  4ELU A;  4E1M A;  4DSI A;  4Z4E A;  3AVG A;  2ZQB A;  4C8N A;  3HT3 A;  1C1B A;  3LP1 A;  4JRQ A;  4F2S A;  1U49 A;  4HUE A;  2I5J A;  4CJ5 A;  4FJG A;  3DMJ A;  3A2F A;  3OS1 A;  4M3X A;  4DF4 A;  1KVA A;  4QAG A;  4J2D A;  4JS5 A;  3AVN A;  1BIU A;  4ELV A;  4CHO A;  1CLQ A;  3DLH A;  4OKJ A;  3V9W A;  2AJQ A;  4IFV A;  3ZSR A;  4RW7 A;  1HMV A;  3EZ5 A;  1TK5 A;  4DU1 A;  4HTU A;  3G10 A;  3AVM A;  3AA3 A;  1ITG A;  1KLM A;  2FBT A;  2Z1J A;  3O3G A;  3PUF A;  4CGI A;  4BAC A;  2PZS A;  4CEC A;  5C42 A;  3SI6 A;  2YHB A;  1REV A;  3QIP A;  1BHL A;  1EKE A;  2RF2 A;  5K14 A;  3OYH A;  3QNN A;  1QSS A;  1BI4 B;  1S6Q A;  2IAJ A;  5J1E A;  4N56 A;  1TAU A;  3NF7 A;  4FLX A;  1HNV A;  4EP4 A;  1BCM A;  1LW2 A;  5CYQ A;  1Q9X A;  1TGO A;  1RTI A;  3TR8 A;  1DTT A;  2HHQ A;  4E1N A;  3KIO A;  2YNF A;  3SNN A;  4NCG A;  4CEQ A;  4DWI A;  1XHX A;  3AV9 A;  3MEE A;  1YT3 A;  4DMN A;  4PA1 A;  4FM0 A;  4DS5 A;  3ZT0 A;  4AHV A;  4KTQ A;  3HST B;  3K59 A;  2HHU A;  2IC3 A;  2Z1I A;  4FJ5 A;  4KI6 A;  3VQ9 A;  4DSE A;  1RT4 A;  4I2Q A;  1XI1 A;  4O44 A;  4Z4F A;  1IO2 A;  3VQ4 A;  4FW2 A;  4CF0 A;  4FJJ A;  1FK9 A;  1RDD A;  2PY5 A;  3H08 A;  1RT6 A;  1S1X A;  2RPI A;  3DYA A;  3KD1 E;  4CFA A;  4DLE A;  3DOL A;  2G8K A;  1SL0 A;  3DM2 A;  1QQC A;  5JS2 A;  3AVF A;  1NOZ A;  3OYD A;  3IG1 A;  3SUP A;  4CIG A;  4FK4 A;  1WLJ A;  1WSF A;  4BDZ A;  1ZBH A;  3WNE A;  4N76 A;  4Z4I A;  1A5X A;  2B6A A;  1CXQ A;  3OYJ A;  3CM5 A;  5KRS A;  4OJR A;  2X6N A;  3QET A;  4KRF A;  3AVJ A;  3SV3 A;  3HXM A;  1VRU A;  3ZCM A;  3AO4 A;  3EY1 A;  1U45 A;  1HNI A;  3VQB A;  4B8C A;  4M3Z A;  4E7J A;  3AO1 A;  4R5P A;  3FFI A;  3HYF A;  3IRX A;  4KHU A;  4FCY A;  3RMB A;  3CG7 A;  4DLG A;  1N5Y A;  2DFH A;  1C0T A;  4DTP A;  2KFN A;  2OA8 A;  2VG6 A;  4LSN A;  4M41 A;  3MXI A;  3WNH A;  3OYI A;  3LDS A;  2WOM A;  3U6F A;  4B9U A;  1IKY A;  4FJI A;  3RR7 A;  1RT5 A;  3DRS A;  4FLW A;  3OYN A;  3DLK A;  4W5R A;  4KFB A;  3KK1 A;  3L2R A;  2GBZ A;  3K5N A;  3S3O A;  2HW3 A;  3S9H A;  3P1G A;  3HJF A;  4E7K A;  3B6P A;  4OKE A;  2D5R A;  1TK0 A;  3HPH A;  2OPQ A;  3LZI A;  1YTU A;  3K57 A;  1JLQ A;  2D0B A;  1J53 A;  3D45 A;  3V9X A;  4DFM A;  3VQ8 A;  4ELT A;  3OS2 A;  2Y1I A;  3AA5 X;  1S5J A;  1RT2 A;  2HNZ A;  4HUF A;  3QIO A;  3M8R A;  3C6U A;  4B9L A;  2XY7 A;  3QEX A;  4QOZ B;  4KRE A;  3CYM A;  5HLF A;  4DTR A;  4DSL A;  2B4J A;  2G8V A;  3LWL A;  5HRP A;  2XRI A;  3NCI A;  4BE2 A;  4FM1 A;  3HL8 A;  4H8K A;  4L8R B;  1J54 A;  4CFD A;  3OYA A;  3O3F A;  4HCB A;  4K8X A;  4DSJ A;  3TAM A;  3AVI A;  1VK0 A;  4Y1D A;  4Q0B A;  3I8D A;  2DTU A;  4IDK A;  1GOA A;  4RG8 A;  3PX6 A;  3SUQ A;  3MXM A;  1C0U A;  1LWC A;  3V9Z A;  1XC9 A;  4DTN A;  1X9S A;  3JYT A;  2NUB A;  1TKT A;  4JLH A;  4FXD A;  4Z4H A;  3KKR A;  4IKF A;  1NK7 A;  1HQE A;  1UOC A;  3K2P A;  4DTO A;  3L8B A;  1NJZ A;  3AO5 A;  3PY8 A;  3LZJ A;  3SPY A;  1GOB A;  4RW9 A;  1VRT A;  1U04 A;  3TAP A;  1EXQ A;  3THV A;  4DTU A;  1KCF A;  4KHN A;  1CZ9 A;  4KHW A;  4HUG A;  5KGW A;  3NGY A;  4I9L A;  4CHZ A;  2VWJ A;  2E6L A;  1TKZ A;  4E7H A;  3TAB A;  4CJK A;  3ZSV A;  2IOC A;  3LAK A;  2DY4 A;  1SUQ A;  1EET A;  4ICL A;  1RT7 A;  4CJL A;  3I0R A;  1VSL A;  3RMD A;  3TAG A;  4C8O A;  1JXE A;  3KLF A;  3AO3 A;  4F4K A;  4KB1 A;  4M3T A;  1RTJ A;  4OLA A;  1QSL A;  3OYF A;  1HYZ A;  4IG3 A;  1BL3 A;  2IGI A;  4CF2 A;  4DTM A;  5SWM A;  1NK5 A;  1S6P A;  3F9K A;  1RBT A;  1ZBU A;  4E19 A;  3K58 A;  3PO4 A;  4CE9 A;  1RT1 A;  2HHW A;  1A5V A;  5T7B A;  3ALY A;  3ULD A;  3SJJ A;  1DTQ A;  3K5O A;  4LY7 A;  3RRH A;  4KHS A;  2W42 A;  4M42 A;  3SUO A;  3B6O A;  3MEC A;  3V9S A;  4N5S A;  4CIE A;  2IDO A;  1WNS A;  4FLY A;  3OYK A;  2B5J A;  2LSN A;  2YNG A;  3C95 A;  3L3V A;  4ID1 A;  3ZT1 A;  1MU2 A;  3MED A;  3K5L A;  4M3W A;  4NYF A;  1RCH A;  3HVT A;  1EX4 A;  1RNH A;  2Q3S A;  2P51 A;  4J2B A;  5HRS A;  4TSX A;  2FBY A;  2A1S A;  3V1Q A;  4CJW A;  1VSE A;  1WN7 A;  4AIL C;  1QE1 A;  3PX4 A;  2KFZ A;  3NBP A;  4ZTJ A;  1ASV A;  2E6M A;  3NHG A;  2X6S A;  2OPP A;  1N6Q A;  2YNI A;  3SQ2 A;  4LH4 A;  5HBM A;  3KLG A;  4E3S A;  2F96 A;  1RBU A;  3P5J A;  4FVM A;  3SZ2 A;  4DQQ A;  1RBS A;  4KI4 A;  3PO5 A;  4AHR A;  4YNQ A;  5HP1 A;  1KTQ A;  5DMR A;  4DF8 A;  3HM9 A;  4F3T A;  4CGH A;  1X9M A;  3CFO A;  3TI0 A;  1UAX A;  1JL2 A;  3AA2 A;  3AA4 A;  2QXF A;  3QEI A;  1LWF A;  3RWU A;  3WNF A;  4OPJ A;  2OZM A;  3OVN A;  3SQ0 A;  2PYL A;  3OS0 A;  4I9Q A;  2YV0 X;  3TAF A;  4BDP A;  3OYG A;  3VQD A;  3QER A;  1KSP A;  3AVH A;  4DSF A;  1W0H A;  2GV9 A;  2VG5 A;  3AVK A;  4DU4 A;  3SQ1 A;  4FZY A;  1ZBI A;  1GOC A;  3VN5 A;  1JLE A;  4CHY A;  4M45 A;  4FJK A;  4IBN A;  2JGU A;  3LAL A;  1ASU A;  1U47 A;  1RBV A;  4CJP A;  5J2N A;  5CYM A;  1ZBL A;  1WSG A;  1KLN A;  2OYQ A;  4E7I A;  4CF8 A;  1RDB A;  2YKM A;  3LP0 A;  4KTW A;  4BWM A;  4CHQ A;  3F73 A;  4KHQ A;  2D0C A;  4NCB A;  2HHT A;  3VQ7 A;  1WSJ A;  4CEO A;  3OYE A;  1NK8 A;  1JLG A;  1TAQ A;  2HVI A;  3DRR A;  4CEA A;  4CEZ A;  5E41 A;  3RRG A;  3G0Z A;  1T03 A;  2F8T A;  3SPZ A;  3KK2 A;  3TWH A;  1WAF A;  4AHU A;  3QIN A;  4KPY A;  2VWK A;  1WSH A;  1IG9 A;  2YKN A;  4O4G A;  4DTJ A;  4BWJ A;  4KB0 A;  4I2P A;  3DRP A;  1R0A A;  1LV5 A;  2G8H A;  4LH5 A;  3VQC A;  3DI6 A;  1ZYQ A;  4Z4G A;  4KO0 A;  2XHB A;  2XY5 A;  1G15 A;  4DQP A;  4RW4 A;  4AHS A;  1CZB A;  2GUI A;  5HRR A;  4B9M A;  4E0D A;  4CED A;  3NH2 A;  3C94 A;  3O3H A;  2XY6 A;  1JLA A;  3OJS A;  2PYJ A;  3HK2 A;  4B08 A;  3ZSW A;  1RTH A;  1D5A A;  3QNO A;  2E4L A;  4BDY A;  1K6Y A;  4ZTF A;  3IAY A;  3P83 D;  1S1V A;  1LW0 A;  4ID5 A;  5KRT A;  3OYB A;  1CXU A;  4CEE A;  3ZT4 A;  3M8P A;  1B9F A;  2O4I A;  4H4M A;  4CEB A;  1RIL A;  3NE6 A;  3RMC A;  3DLE A;  4LD0 A;  4CJR A;  4B9S A;  3V1R A;  1NJY A;  2BDP A;  4M3Y A;  1LAW A;  1SL1 A;  5CZ2 A;  3V9U A;  2X78 A;  3QEP A;  1S1U A;  4FLT A;  3OYC A;  1UWB A;  5DK5 A;  1JLB A;  1KFD A;  2WON A;  3VA3 A;  2DFE A;  3K5M A;  4OGE A;  4FJL A;  4FM2 A;  4B3O A;  1JXB A;  3QO9 A;  2Z1H A;  4Z0U A;  1BGX T;  4CGD A;  1UA1 A;  1L3S A;  1J5O A;  3QEW A;  2HB5 A;  4HHT A;  1VSD A;  4DQS A;  2XY8 A;  4CJF A;  1KRP A;  5HRO A;  4HCC A;  1Y97 A;  2F8S A;  3LWM A;  3MXJ A;  4FJX A;  5HRN A;  4PQU A;  2HHX A;  5FRN A;  4MQ3 A;  3U3G A;  4CGG A;  1FKO A;  4FLZ A;  2Y1J A;  1LAV A;  2HMI A;  2OZS A;  2G8W A;  3NAE A;  3TAQ A;  1VSJ A;  3V6D A;  1NK0 A;  1QS4 A;  3CQ8 A;  3KLH A;  3SUN A;  2FBX A;  4OGC A;  4G1Q A;  3I0S A;  5CZ1 A;  3ZSO A;  1XHZ A;  2HVH A;  3DLB A;  3LPU A;  4CCH A;  3LPT A;  3PX0 A;  2ZE2 A;  4QCL A;  3D0P A;  3HVR A;  3O4N A;  5KTQ A;  3VQE A;  3CFP A;  3PV8 A;  4FK2 A;  4Y1C A;  1QSY A;  3KLI A;  1FKP A;  3NGZ A;  3S3M A;  1RDC A;  3HP9 A;  4EP5 A;  2YNH A;  3L2Q A;  3T3F A;  4DTX A;  1IKW A;  1IKV A;  1T05 A;  4CJS A;  1U48 A;  4Z4C A;  4KKO A;  4FLV A;  4N47 A;  1BQN A;  4CES A;  2KZZ A;  2HNY A;  1Z25 A;  3L2W A;  3RTV A;  4CJV A;  1JLF A;  1Z26 A;  1SKS A;  3ZSY A;  4M3U A;  3NH0 A;  4FW1 A;  1TKX A;  3TAN A;  4KHY A;  1NKC A;  2XO7 A;  1T8E A;  1Q9Y A;  4O0J A;  2KQ2 A;  1B9D A;  4CJU A;  3NDK A;  2IS3 A;  2G8F A;  3VQA A;  4FK0 A;  3OY9 A;  1TK8 A;  2QK9 A;  4RW8 A;  4CFB A;  2ETJ A;  1NJX A;  4FJM A;  3ZT2 A;  4AHT A;  4BE0 A;  3HPO A;  1KVB A;  1NK6 A;  1C1A A;  3V81 A;  1B92 A;  1A5W A;  3SQ4 A;  4B9T A;  4CJE A;  4PUO A;  1HRH A;  1Q8I A;  1HPZ A;  4CGF A;  1BIZ A;  4E89 A;  1LWE A;  1X1P A;  3AVB A;  4CJ3 A;  2BAN A;  4UQG A;  3RMA A;  4F2R A;  4GMJ B;  3ZT3 A;  3TAE A;  3ASM A;  3L2U A;  4O5B A;  2P1J A;  3BGR A;  1ASW A;  2HHV A;  2FC0 A;  1L3U A;  1WSE A;  3HP6 A;  1U4B A;  1S9G A;  4J2A A;  1JLC A;  2VG7 A;  3CM6 A;  4Q5V A;  4FJ8 A;  3SCX A;  4KV8 A;  3OYM A;  4DS4 A;  2A1R A;  3DOK A;  3MEG A;  3BDP A;  1VSK A;  2QKB A;  5D3G A;  1SV5 A;  5SZT A;  3SV4 A;  1L3T A;  2HND A;  4DG1 A;  1D8Y A;  2HHS A;  3M8Q A;  1FXX A;  5KGX A;  1TVR A;  3AO2 A;  4XIU A;  4AHC A;  4YFU A;  3L2V A;  1KFS A;  4OKK A;  3NF6 A;  3KKS A;  4CK1 A;  3QEV A;  1HYV A;  4OPK A;  4F8R A;  4GVM A;  1D9F A;  4FZZ A;  4CF9 A;  3V1O A;  2Z1G A;  2P5O A;  5C25 A;  1VSF A;  4FJN A;  3S3N A;  5FDL A;  4I7F A;  4J2E A;  1NKE A;  3DLR A;  3NGI A;  1QTM A;  3V4I A;  2OPS A;  3KD5 E;  2FBV A;  2ITG A;  4CJ4 A;  4DFP A;  4RW6 A;  4KAZ A;  4W5O A;  3T1A A;  4DQI A;  1S9E A;  1JKH A;  1VSM A;  4FJH A;  3KLE A;  1WAJ A;  4CJQ A;  4FZX C;  1S1W A;  4NCA A;  2RKI A;  4C8K A;  3UIQ A;  2KZM A;  4W5N A;  2KW4 A;  2ZD1 A;  3AVL A;  3LP3 A;  3O4Q A;  4CEF A;  4FLU A;  1W9H A;  4WE1 A;  1F21 A;  2EX3 A;  4IFY A;  4PWD A;  4CGJ A;  4CK2 A;  4ZHR A;  4B8A B;  4CJT A;  4C8L A;  3TAR A;  3VQ5 A;  2G8I A;  2BGG A;  4DFK A;  1RTD A;  4OVL A;  3KJV A;  1JL1 A;  2ATQ A;  3HO1 A;  4CER A;  4DU3 A;  3LP2 A;  3E01 A;  2RN2 A;  3LAM A;  4FYD A;  4CFC A;  4O0I A;  1I39 A;  3AVA A;  1RDA A;  1NOY A;  4H4O A;  1VSH A;  5J2M A;  1HQU A;  1TL3 A;  3OJU A;  1X9W A;  3LAN A;  1O1W A;  3NF8 A;  1NK4 A;  3NF9 A;  1SKW A;  1SKR A;  1VSI A;  4EZ6 A;  4B9V A;  1UA0 A;  1QHT A;  4JRP A;  2KTQ A;  4K8Z A;  1TV6 A;  2YHA A;  2BE2 A;  4KTZ A;  1HJR A;  3SYZ A;  2EHG A;  4CHN A;  4N41 A;  3OYL A;  3ITH A;  4F3O A;  1BIS A;  1SL2 A;  1KVC A;  3EYZ A;  1NK9 A;  3IS9 A;  4B9N A;  2P5G A;  5J2P A;  4IG0 A;  3NH1 A;  4FJ7 A;  3QLH A;  5KI6 A;  5I42 A;  4W5T A;  4CHP A;  3JSM A;  1NJW A;  1RBR A;  2QKK A;  3QES A;  3ZSX A;  4W5Q A;  2D0A A;  5C24 A;  4GW6 A;  4CIF A;  4FJ9 A;  4CK3 A;  1C0M A;  1YTA A;  1I3A A;  4LSL A;  1BCO A;  1XWL A;  3HPG A;  3CFR A;  1BQM A;  4CF1 A;  4MFB A;  4DFJ A;  1EP4 A;  1DLO A;  4BE1 A;  4O55 A;  4DTS A;  5CY4 A;  1NKB A;  5J2Q A;  5EU7 A;  4PY5 A;  4DSK A;  3T19 A;  4OLB A;  1YVU A;  1S1T A;  2JLE A;  3NFA A;  3AVC A;  5FRM A;  1D9D A;  2DFF A;  2R7Y A;  4HVJ A;  3C6T A;  3WNG A;  4NYN A;  3VQQ A;  2X74 A;  4DQR A;  3ZSQ A;  3ZSZ A;  3MAQ A;  3ISN C;  5FRO A;  4C8M A;  3KTQ A; 
#chains in the Genus database with same CATH topology
 4JS4 A;  2GUP A;  1IKX A;  1C1C A;  2CH5 A;  3VA0 A;  4EZ9 A;  4H0P A;  4BC3 A;  1N36 K;  1BI4 A;  3GG4 A;  4BR0 A;  1NGI A;  4E1J A;  2O4G A;  1TKD A;  2NRR A;  2GX9 A;  5ADX H;  5EOY A;  3HT3 A;  2D0O A;  3LP1 A;  2I5J A;  3PIO L;  2YI1 A;  5AZI B;  1QZ5 A;  4BRP A;  4M3X A;  1KVA A;  1OH5 A;  3ID8 A;  1T44 A;  2E2O A;  4RW7 A;  4H0Y B;  3T69 A;  1ITG A;  3O3G A;  4WFN L;  4BAC A;  4CEC A;  3SI6 A;  1REV A;  3EN9 A;  3FE1 A;  2RF2 A;  3O9Q A;  5K14 A;  3QNN A;  1BI4 B;  5J1E A;  4EP4 A;  1BCM A;  1LW2 A;  3S41 A;  4A61 A;  2UUB K;  2QTD A;  1DTT A;  1VQK N;  4E1N A;  1KXP A;  5AQU A;  2YNF A;  3LDQ A;  3Q7C A;  4NCG A;  4DWI A;  1EQY A;  3AV9 A;  3MEE A;  4B1Z A;  4EHT A;  4KTQ A;  3ZT0 A;  4AHV A;  3HST B;  2IC3 A;  4KI6 A;  4DSE A;  1RT4 A;  1IO2 A;  3VQ4 A;  4MDB A;  4JKB A;  1RDD A;  5KQ8 A;  3M6G A;  2QM1 A;  5BRH A;  3OYD A;  4PL8 A;  5AQF A;  4N76 A;  4OJR A;  4WCE L;  3SV3 A;  1U45 A;  4B8C A;  3PSF A;  3AO1 A;  5KPT A;  3IRX A;  4KHU A;  4DLG A;  2OA8 A;  4LSN A;  3OYI A;  2P9P A;  3U6F A;  4LF7 K;  1IKY A;  4MO4 A;  1GLL O;  4KFB A;  4BRH A;  1R59 O;  3S3O A;  3WQU A;  3P1G A;  3S9H A;  2VQF K;  1IJJ A;  3AAR A;  4LFB K;  2OPQ A;  2Q31 A;  3VTH A;  3LZI A;  3LDP A;  2D0B A;  1J53 A;  3D45 A;  3V9X A;  2CGJ A;  1VQ6 N;  2DPN A;  3A5N C;  2Y1I A;  3WUH A;  4EFH A;  2HNZ A;  2BTF A;  3UKR A;  3C6U A;  2XY7 A;  4FWR A;  3HM8 A;  5HLF A;  2NRV A;  2E2Q A;  3T1Y K;  4GV9 A;  3BF1 A;  2Q36 A;  2WTU A;  3MMV A;  5F1X A;  3OYA A;  2P9P B;  3O3F A;  4JI4 K;  3TAM A;  4J8F A;  4Y1D A;  3ENB A;  3PX6 A;  1GOA A;  1XC9 A;  3T1H K;  3A0I X;  4JK9 A;  4LF6 K;  3EO3 A;  4FXD A;  3KKR A;  1HQE A;  1UOC A;  3K2P A;  1NJZ A;  4ILH A;  1Y64 A;  3SPY A;  1U04 A;  4AF1 A;  3CCJ N;  1YJN N;  5KGW A;  3R9P A;  2W6L A;  3O9T A;  3U9D A;  2DY4 A;  2IOC A;  1EET A;  4ICL A;  1RT7 A;  3G25 A;  1ATN A;  1VSL A;  1FJG K;  4MO5 A;  2CGK A;  4M3T A;  3AO3 A;  4OLA A;  3OYF A;  3M1F A;  3J80 O;  3EZW A;  3L4Q A;  1RT1 A;  3J7Z O;  1A5V A;  3FR0 A;  4JK8 A;  3ALY A;  1P90 A;  1DTQ A;  4EHU A;  4KHS A;  1S72 N;  2W42 A;  4CZM A;  5KPZ A;  4CIE A;  1WNS A;  2B5J A;  4FPB A;  3H45 C;  4M3W A;  4NYF A;  1EX4 A;  1RNH A;  3SLC A;  1VSE A;  4CZH A;  4YDU C;  5HL7 L;  3ENH A;  3CD6 N;  1EO1 A;  5GAG P;  2KFZ A;  3NHG A;  2OPP A;  5HBM A;  4KI4 A;  3P5J A;  2VQE K;  4BGB A;  5DMR A;  1X9M A;  3TI0 A;  3ZLJ A;  4FWO A;  1E4F T;  3QEI A;  1LWF A;  2QWP A;  1BA1 A;  3E1Y A;  4BDP A;  4FWN A;  1KSP A;  4DSF A;  4BRN A;  2O8D A;  2GV9 A;  2VG5 A;  3AVK A;  4FZY A;  3VN5 A;  4FJK A;  3ZX2 A;  4DV0 K;  1ASU A;  1U47 A;  4CJP A;  5J2N A;  1WSG A;  4BRO A;  4JI0 K;  4M7X A;  4BWM A;  3F73 A;  4NCB A;  3VQ7 A;  3R6M A;  1TAQ A;  2WBN A;  3CCE N;  3CJ9 A;  1WSH A;  1IG9 A;  1NWK A;  2YKN A;  3OBY A;  5F2R A;  4BWJ A;  3DRP A;  1R0A A;  2G8H A;  1ZBS A;  4KO0 A;  5BR9 A;  4RW4 A;  5HRR A;  2GUI A;  4B9M A;  3CJ1 A;  2ITM A;  2PYJ A;  3ZSW A;  1RTH A;  4K43 A;  2O8D B;  3QNO A;  4ZTF A;  4ID5 A;  4H0X B;  2Q97 A;  5KRT A;  1B9F A;  4LD0 A;  3L0Q A;  4CJR A;  4LF8 K;  3V1R A;  2BDP A;  3I33 A;  1LAW A;  4JKG A;  3C65 A;  4XEI A;  1UWB A;  5DK5 A;  1JLB A;  1KFD A;  4FM2 A;  4BRK A;  2FF3 B;  3QO9 A;  3D2E A;  1UA1 A;  1J5O A;  1OVY A;  3TSU A;  3QEW A;  1XMQ K;  4DV3 K;  5IT9 O;  4HHT A;  1VSD A;  2F8S A;  4FJX A;  5HRN A;  4DV2 K;  4BRG A;  4CGG A;  4FLZ A;  2Y1J A;  1LAV A;  2NZT A;  1HJO A;  2ASP A;  4BRA A;  3P39 A;  1NK0 A;  1QS4 A;  2GWK A;  2FBX A;  3QBW A;  4G1Q A;  4OX9 K;  1XC3 A;  2WUS A;  4JKG B;  3ZSO A;  3FGU A;  4CCH A;  3LPT A;  1WOQ A;  5KTQ A;  3CFP A;  4K25 A;  5BRF A;  3PV8 A;  4BRL A;  4FOI A;  3D2E B;  5JLF A;  2UUA K;  4Y1C A;  5AQI A;  3NGZ A;  1EWQ A;  1RDC A;  4IXC A;  4FWQ A;  3HP9 A;  3T3F A;  1IKW A;  4BR9 A;  1BQN A;  4CES A;  4CJV A;  1JLF A;  4AM6 A;  4M3U A;  2IVN A;  4PKG A;  1TKX A;  4KHY A;  1NKC A;  3VGK A;  1VAZ A;  1K73 O;  2NRW A;  2IS3 A;  2G8F A;  3OY9 A;  2QK9 A;  1NJX A;  1KVB A;  3V81 A;  5E84 A;  4CJE A;  4CGF A;  3AVB A;  4FWK A;  1QQO A;  4UQG A;  4JI7 K;  3MX5 A;  3JAM O;  3L2U A;  2W40 A;  2P1J A;  3J7A P;  1ASW A;  1Z05 A;  2O8C A;  3CCM N;  4BRD A;  4Q5V A;  2VG7 A;  3CQY A;  4FJ8 A;  3EEQ A;  3SCX A;  1VQP N;  3BDP A;  1N8R O;  1VSK A;  2HBK A;  2NRH A;  3OTO K;  1M1K O;  1L3T A;  4DG1 A;  3B8A X;  2GTD A;  4B9Q A;  3M8Q A;  4ISF A;  5KGX A;  4XIU A;  5LMN K;  4AHC A;  4YFU A;  1KFS A;  3QEV A;  4GVM A;  4FZZ A;  3V1O A;  1OH6 A;  3CCL N;  3S3N A;  4I7F A;  4BG9 A;  2UXB K;  3KD5 E;  2FBV A;  2ITG A;  4DFP A;  4RW6 A;  3DWL A;  2AA4 A;  1MWK A;  3KLE A;  3NVM A;  2NLX A;  4FZX C;  4BG8 A;  4NCA A;  2RKI A;  4C8K A;  4BRE A;  2ZD1 A;  2O8C B;  3O4Q A;  5FLX O;  5AQL A;  1F21 A;  1DKG D;  4KBO A;  5AQO A;  3HO1 A;  3LP2 A;  4BY9 C;  4B3S K;  2VYP A;  1NOY A;  4H4O A;  1VSH A;  1NLV A;  3L6Q A;  1SKW A;  3PSI A;  4B9V A;  4BC4 A;  4JRP A;  1TV6 A;  4KTZ A;  4DB3 A;  5AQM A;  4BQL A;  3O6W A;  5AQV A;  3SYZ A;  3U4L A;  3OYL A;  1KVC A;  5MLC Q;  4FJ7 A;  4ISG A;  3QLH A;  5KI6 A;  3H3N O;  3JSM A;  2QKK A;  3ATU A;  3ZSX A;  2D0A A;  2E2P A;  4FJ9 A;  3PX0 A;  1C0M A;  4LSL A;  5LMU K;  1BQM A;  4CF1 A;  5E26 A;  3E9P A;  1DLO A;  4BE1 A;  3KWG A;  4O55 A;  5CY4 A;  1YVU A;  1D9D A;  2DFF A;  3U9Z A;  3IDH A;  3ZSQ A;  1VHX A;  1J9A A;  3KK3 A;  4M3R A;  2OPR A;  1L3V A;  4NB4 A;  1HKB A;  3AGR A;  4LF5 K;  4PKI A;  3DLG A;  5AQK A;  1T7P A;  4IZ9 A;  3FZL A;  4IJN A;  3RR8 A;  4B1W B;  1RT3 A;  4DSI A;  1C1B A;  4JRQ A;  4B1X B;  4F2S A;  2HF4 A;  2D1K A;  1VQN N;  4DHY A;  3H1Q A;  3SAH A;  3AVN A;  1BIU A;  4ELV A;  4CHO A;  1CLQ A;  3BF3 A;  4IFV A;  3ZSR A;  1HMV A;  2QWN A;  3O4W A;  4DU1 A;  3G10 A;  3AA3 A;  4CGI A;  3DLL L;  2NNW A;  3SMS A;  3H6E A;  1BHL A;  3O9U A;  3OYH A;  1QSS A;  5GAE P;  4FSV A;  1RGI A;  3M3Z A;  1Q82 O;  2F9W A;  3TU5 A;  4FLX A;  1HNV A;  3O1W A;  3D2F A;  1RTI A;  3TR8 A;  4ISE A;  4CEQ A;  1XHX A;  4FM0 A;  4PA1 A;  2HHU A;  1JCE A;  3K59 A;  4JI5 K;  2Z1I A;  4FJ5 A;  1CZA N;  2FSK A;  3VQ9 A;  4I2Q A;  4Z4F A;  3MN9 A;  2PY5 A;  3DYA A;  1LCU A;  3BUZ B;  4DLE A;  3DM2 A;  3AVF A;  3IG1 A;  1WLJ A;  4BDZ A;  1ZBH A;  3WNE A;  4Z4I A;  1A5X A;  3O5B A;  1CXQ A;  3OYJ A;  3CM5 A;  2P9N A;  3QET A;  4KRF A;  1HNI A;  3D2F B;  1GLE G;  4FCY A;  3A5M C;  1N5Y A;  1C0T A;  3MXI A;  2WOM A;  3L4I A;  4X66 K;  4B9U A;  1RT5 A;  3DRS A;  3EKS A;  3VEW A;  2GBZ A;  4E7K A;  1TK0 A;  1KC8 O;  3HPH A;  4A2B A;  3K57 A;  4JKC A;  2YJE A;  3C6A A;  4ELT A;  3AA5 X;  4H03 B;  3M8R A;  2P9N B;  3FLC O;  2YHW A;  3CYM A;  3I55 N;  4DTR A;  2B4J A;  4JKA A;  3LWL A;  5JVH L;  3IMX A;  4FWL A;  4BR5 A;  4H8K A;  1J54 A;  1YVN A;  4CFD A;  4HCB A;  2O8E A;  3GDQ A;  1TUU A;  3MWT A;  4LC9 B;  2OAN A;  3SUQ A;  2A42 A;  1NMN A;  2NUB A;  4Z4H A;  2BH1 A;  2WFB A;  1NK7 A;  3L8B A;  3AO5 A;  3N4Q A;  4RW9 A;  3TAP A;  1EXQ A;  3E9L A;  1KCF A;  4KHN A;  5JIC A;  3VOV A;  4BR7 A;  3NGY A;  2VWJ A;  2E6L A;  1WBB A;  1O13 A;  3TAB A;  3IKM A;  4CJK A;  3ZSV A;  4BVO A;  3I0R A;  2O8F A;  2O8E B;  3AGK A;  3I8B A;  3TAG A;  4KB1 A;  4F4K A;  5ADX A;  2IGI A;  4DTM A;  1NK5 A;  1S6P A;  4E19 A;  1ZBU A;  2HHW A;  1V4T A;  3ULD A;  4NXM K;  3VES A;  3K5O A;  3RRH A;  3CXC M;  4G9Z A;  4EAH D;  3OYK A;  3ZT1 A;  2LSN A;  2RE2 A;  4ID1 A;  4DV7 K;  3K5L A;  3AAP A;  4BRM A;  4J2B A;  5DM7 L;  3ZX0 A;  2H3G X;  5HRS A;  5BN8 A;  4CJW A;  3V1Q A;  4AIL C;  4YHH K;  5AZJ A;  4WYB A;  2O8F B;  4ZTJ A;  2E6M A;  1N6Q A;  2YNI A;  4B3R K;  2HBJ A;  3LL3 A;  4E3S A;  1RBU A;  4FVM A;  4EIA A;  4YOU A;  3HM9 A;  3F5T A;  4CGH A;  4F3T A;  1UAX A;  1JL2 A;  3AA2 A;  2E5L K;  2QXF A;  3MWP A;  2OZM A;  4JI2 K;  3UB5 A;  3OVN A;  3SQ0 A;  2PYL A;  4I9Q A;  3OYG A;  3QBX A;  1W0H A;  1JLE A;  4M45 A;  2JGU A;  3D6R A;  4YOX A;  3CIP A;  2OYQ A;  4E7I A;  4GV3 A;  4KTW A;  4CHQ A;  2D0C A;  5AZJ B;  1WSJ A;  4BR4 A;  1NK8 A;  1C0G A;  3G0Z A;  2F8T A;  3SPZ A;  1WAF A;  2W6K A;  3M5R A;  3J7Y P;  4Z4G A;  1G15 A;  1JCF A;  4E0D A;  1CZB A;  4JI8 K;  4DR1 K;  4O8U A;  3OJS A;  1VQ4 N;  1KAZ A;  3HK2 A;  1D5A A;  2E4L A;  2YX6 A;  3CC2 N;  1E3M A;  3OYB A;  1CXU A;  3QB0 A;  3M8P A;  3C7N A;  4CEB A;  4AQY K;  3RMC A;  1W7A A;  3DLE A;  1X9J A;  2GEL A;  5CZ2 A;  3VMF B;  1GLB G;  2YCH A;  4FLT A;  2VCP A;  1SS6 A;  3VA3 A;  3K5M A;  4FJL A;  3OA9 A;  3KK7 A;  2A6A A;  1JXB A;  2Z1H A;  2HB5 A;  1BA0 A;  4HCC A;  2XY8 A;  4CJF A;  5GIP A;  2HHX A;  4BC2 A;  4X62 K;  2HMI A;  4DQ8 A;  4WQ5 A;  2G8W A;  3UKR B;  3TAQ A;  1WB9 A;  2OCE A;  3C7N B;  3G6E N;  4OGC A;  4JKE A;  3VF2 A;  2ZE2 A;  4QCL A;  4H5V A;  2VGN A;  5AQX A;  4DKW A;  4FK2 A;  5C0Y A;  4KHP K;  5BPM A;  3KLI A;  2VGM A;  4EP5 A;  1X3M A;  2Q0R A;  4BQZ A;  5FPM A;  4GNI A;  1HLU A;  4B3T K;  1SKS A;  1N34 K;  3THY A;  1N33 K;  3NH0 A;  4FW1 A;  4A59 A;  2XO7 A;  4A5A A;  3VF6 A;  3CJA A;  4CI6 A;  4LF4 K;  1B9D A;  3FFK B;  3SAF A;  3W3D A;  2ETJ A;  4FJM A;  3ZT2 A;  1ILY A;  1NK6 A;  1C1A A;  1B92 A;  1RDU A;  4B9T A;  4B1U B;  1Q8I A;  2DTU A;  1BIZ A;  5BPL A;  3LDO A;  3ZT3 A;  3TAE A;  3ASM A;  2HHV A;  3BGR A;  1IBM K;  3HP6 A;  1U4B A;  3CM6 A;  3OYM A;  2QA4 N;  2QKB A;  5GAH P;  5DM6 L;  3THY B;  2UU9 K;  1YIT N;  1FXX A;  1TVR A;  3AO2 A;  4JI1 K;  1Q81 O;  4ILG B;  4OKK A;  2D0P A;  1HYV A;  4A62 A;  2CGL A;  4CF9 A;  1BO5 O;  3EE9 A;  1U6Z A;  2EWS A;  2Z1G A;  1VSF A;  4FJN A;  4YOT A;  1NKE A;  1OVQ A;  2OPS A;  5BR8 K;  2P9L A;  5AQW A;  4KAZ A;  4W5O A;  1S9E A;  4C23 A;  4FJH A;  2KZM A;  1HNX K;  1V4S A;  4LFA K;  1W9H A;  2EX3 A;  4IFY A;  3R3L A;  4CGJ A;  4ZHR A;  2A5X A;  4ILJ A;  2OTJ N;  4CD1 A;  3TAR A;  3HBT A;  5IWA K;  3KJV A;  4CER A;  4DU3 A;  3E01 A;  2RN2 A;  3LAM A;  4CFC A;  4RCH A;  2QXL A;  3ZET A;  1TL3 A;  1C0F A;  1X9W A;  1O1W A;  3NF8 A;  3NF9 A;  1VSI A;  4EZ6 A;  4YOW A;  4K8Z A;  4PHT X;  2P9L B;  1HJR A;  1IV0 A;  4N41 A;  3ITH A;  1BIS A;  1NK9 A;  3IS9 A;  5JMV A;  4IG0 A;  3HOS A;  4DV5 K;  1NJW A;  5I42 A;  4W5T A;  1RBR A;  3QES A;  4W5Q A;  5C24 A;  4CIF A;  3T7Z A;  4CK3 A;  3CCQ N;  3CFR A;  1I3A A;  1BCO A;  1XWL A;  3TTD A;  1I94 K;  4DFJ A;  4HWI A;  2F4V K;  1KD1 O;  5J2Q A;  4PY5 A;  4L3Q A;  4GKJ K;  1GLJ O;  3ZET B;  1T3V A;  5FRM A;  4B1Y B;  2KHO A;  3C6T A;  3WNG A;  1W97 L;  3VTI A;  4WQ4 A;  4I6M A;  4MLH A;  4Z94 A;  2P9S A;  4BC5 A;  5AQS A;  3WXK A;  1NG9 A;  3WXJ A;  1T6C A;  3VQP A;  1IH7 A;  1ZBF A;  3VEO A;  2NRX A;  3VQ6 A;  4AH9 A;  2G8U A;  5I3U A;  1HYS A;  2A41 A;  4ELU A;  4E1M A;  5AQQ A;  4JI6 K;  1U49 A;  4FJG A;  1Q7Y O;  5C15 A;  3A2F A;  4DF4 A;  3R1X A;  1SZ2 A;  3V9W A;  2AJQ A;  1VQL N;  3OHR A;  3EZ5 A;  1NGJ A;  3JXU A;  4I6M B;  1K9M O;  4HTU A;  2P9S B;  2FBT A;  3PUF A;  3WQT A;  2PZS A;  2HBL A;  3QIP A;  3VEY A;  4B1V A;  2QWQ A;  3ID6 A;  2IAJ A;  4N56 A;  1TAU A;  4LFC K;  5H1S Q;  1QZ6 A;  5GIN A;  3J8A A;  4WQ5 C;  4MLE A;  5CYQ A;  2HHQ A;  5BN9 A;  2HMP A;  2ASM A;  3KIO A;  3SNN A;  3WXI A;  3THX A;  4DS5 A;  4GV6 A;  4DMN A;  3DJC A;  1BWF O;  3VPZ A;  5TKW A;  1XI1 A;  2W41 A;  1NM1 A;  4FW2 A;  4CF0 A;  1FK9 A;  3KD1 E;  3O1B A;  3H08 A;  1RT6 A;  1S1X A;  2RPI A;  4MDA A;  3DOL A;  5F0X A;  1QQC A;  5JS2 A;  1NOZ A;  3ZYY X;  3SUP A;  4CIG A;  4FK4 A;  2ZJQ L;  1WSF A;  4IOC L;  1DGK N;  1MA9 B;  3HOT A;  2HST A;  5KRS A;  2X6N A;  4IOX A;  1J6Z A;  3HXM A;  1VRU A;  3AO4 A;  4CZL A;  3VQB A;  4JD2 A;  4R5P A;  5M1P A;  3RMB A;  5AQG A;  3CG7 A;  1D4X A;  2KFN A;  1ZXO A;  2VG6 A;  1IBL K;  3THX B;  3QDK A;  4FJI A;  2V7Y A;  4FLW A;  5AJ3 K;  3KK1 A;  5FPE A;  2HW3 A;  5AQN A;  2D5R A;  1MDU B;  3P38 A;  5GIO A;  1YTU A;  4FO0 A;  1JLQ A;  5A2Q O;  4DR5 K;  1G99 A;  2QWM A;  1JJ2 M;  1S5J A;  1RT2 A;  4PL7 A;  4K41 A;  4HUF A;  4B9L A;  4GY2 B;  4QOZ B;  3QEX A;  4KRE A;  4C1N I;  3PIP L;  4IO8 A;  4DSL A;  4JD2 B;  4H5R A;  2G8V A;  4QS9 A;  2XRI A;  5AQT A;  5HRP A;  4X65 K;  4BE2 A;  1VQM N;  4FM1 A;  4CJ7 A;  4HTL A;  4K8X A;  4XH5 A;  1VK0 A;  2QWO A;  4IDK A;  3MXM A;  1C0U A;  1LWC A;  2E20 A;  4CZE A;  4DTN A;  3MN7 A;  2GEM A;  1TKT A;  4JLH A;  4IEI A;  4IWV A;  3LDN A;  4IKF A;  4BR2 A;  4RWT A;  4DTO A;  4XH4 A;  3PY8 A;  3LM9 A;  3IFR A;  1GOB A;  4FWP A;  3SBT A;  1NJI O;  3FZH A;  1CZ9 A;  3JS6 A;  4KHW A;  4CBW A;  4NO7 A;  3RVC A;  4E7H A;  4CHZ A;  1TKZ A;  3MDQ A;  1SUQ A;  3CQX A;  1NGB A;  4CJL A;  4DCH A;  3TTF A;  3RMD A;  3CCS N;  1NU0 A;  1JXE A;  2HHH K;  1QSL A;  4CZI A;  3G4S N;  2QEX N;  1HYZ A;  1NGG A;  3KVG A;  1BL3 A;  3F9K A;  1RBT A;  3PO4 A;  3I56 N;  3OBW A;  3AY9 A;  1XNR K;  5T7B A;  3QFU A;  2JWL A;  4LY7 A;  4FOE A;  4M42 A;  3B6O A;  3MEC A;  3BZC A;  1K8A O;  2ASO A;  3MN6 A;  4FLY A;  2Q0U A;  1MU2 A;  1BDG A;  1RCH A;  3HVT A;  2Q3S A;  4OPA A;  1YF5 L;  4TSX A;  3VEZ A;  1ATR A;  1WN7 A;  1NNE A;  3PX4 A;  3NBP A;  1ASV A;  2X6S A;  3BY5 A;  5CR4 A;  3SQ2 A;  4LH4 A;  3KLG A;  3GL1 A;  2P9I A;  4WQ4 C;  1RBS A;  3PO5 A;  4AHR A;  4YNQ A;  4DR7 K;  1BUP A;  1J5E K;  1XNQ K;  3AA4 A;  3MCA B;  3RWU A;  3WNF A;  4OPJ A;  3OS0 A;  2YV0 X;  3TAF A;  3A5O C;  1GOC A;  4BVP A;  5CE3 A;  4IBN A;  3LAL A;  3TSQ A;  4FVU A;  3ZX3 A;  1ZBL A;  3FZF A;  4CF8 A;  2YKM A;  3LP0 A;  4KHQ A;  4NXN K;  3U8X A;  2HHT A;  3OYE A;  5AFU H;  3BEX A;  1JLG A;  1GLD G;  1YXQ A;  5AQR A;  4CEZ A;  2HVI A;  4H0O A;  1T03 A;  5CHI A;  3KK2 A;  3TWH A;  2P9I B;  2YHX A;  4DTJ A;  4KB0 A;  2P9U A;  3VQC A;  1IG8 A;  2XY5 A;  4AHS A;  4CED A;  3NH2 A;  2XY6 A;  1XMO K;  5AQY A;  1K6Y A;  3IAY A;  1LW0 A;  2UUC K;  2D4W A;  5M1Q A;  3ZT4 A;  1WBD A;  3BP8 A;  2O4I A;  4H4M A;  3NE6 A;  1RIL A;  1XQS C;  5LJW A;  4M3Y A;  1SL1 A;  3V9U A;  2X78 A;  3QEP A;  3VEX A;  1VQ7 N;  4WFA L;  4JN4 A;  3F2K A;  2UXC K;  3LDL A;  4BRF A;  4IFE A;  4JKD A;  1L3S A;  3O08 A;  4YOR A;  2IVP A;  5HRO A;  1YHQ N;  1OH7 A;  2FSJ A;  4GVE A;  3IUC A;  3G71 N;  3VET A;  4A2A A;  4FWS A;  5M1F A;  3UE5 A;  3V6D A;  5C12 A;  4CZG A;  1DEJ A;  3ULE A;  3I0S A;  4DR6 K;  3DLB A;  2FF6 A;  3TPQ A;  1NBW A;  3HVR A;  1YUW A;  3O4N A;  3VQE A;  4QS7 A;  1YIJ N;  2QWR A;  1HPM A;  3S3M A;  1IBK K;  4U67 L;  2YNH A;  2WC9 A;  1IKV A;  1T05 A;  1LV5 A;  1U48 A;  4Z4C A;  4FLV A;  4IOA L;  4N47 A;  2KZZ A;  1X3N A;  1Z26 A;  3ZSY A;  3CC7 N;  5M1K A;  3LM2 A;  5AQP A;  1Q9Y A;  4BRQ A;  4CBU A;  3ULE B;  3CC4 N;  3VQA A;  1NGF A;  4RW8 A;  3WEE A;  4AHT A;  4BE0 A;  1A5W A;  1TYQ A;  3SQ4 A;  1HRH A;  1QQM A;  4E89 A;  1LWE A;  4CJ3 A;  2NRZ A;  3CCR N;  3NVK A;  5JVG L;  2HF3 A;  3HTV A;  1WSE A;  1JLC A;  2IVO A;  4H5T A;  2KLA A;  2A40 A;  2I7P A;  4DS4 A;  2A1R A;  3MEG A;  3CJC A;  5D3G A;  1SV5 A;  5SZT A;  2OTL N;  1ESV A;  2ZJR L;  2HND A;  2E2N A;  4A57 A;  3SV4 A;  1D8Y A;  2HHS A;  1HUX A;  3L2V A;  1NGA A;  4AM7 A;  3NF6 A;  3KKS A;  4OPK A;  4F8R A;  4JK7 A;  1D9F A;  4DV4 K;  2P5O A;  5C25 A;  2HOE A;  3H1V X;  4J2E A;  3DLR A;  3WEE B;  3NGI A;  1QTM A;  3V4I A;  3HSC A;  1P8Z A;  4CJ4 A;  4H5W A;  1TYQ B;  3T1A A;  1VSM A;  3UIQ A;  2KW4 A;  4FLU A;  4CEF A;  2V7Z A;  4PWD A;  4Y0W A;  4CK2 A;  4C8L A;  3CPW M;  3VQ5 A;  3THW A;  4DFK A;  1JL1 A;  4FYD A;  5C10 A;  4O0I A;  3AVA A;  4JHD A;  5J2M A;  2ZJP L;  3LAN A;  4M7Y A;  1QHT A;  2KTQ A;  2YHA A;  2PFU A;  4WF9 L;  2AP1 A;  5FPD A;  4F3O A;  1SL2 A;  4B9N A;  3EYZ A;  5AR0 A;  3NH1 A;  1XUP O;  2HBM A;  4CHP A;  3A5L C;  4KH6 A;  4GW6 A;  3THW B;  1OH8 A;  3CHW A;  3GBT A;  3T19 A;  3UKU A;  1S1T A;  4JHD B;  3AVC A;  1ATS A;  2YHY A;  2QI2 A;  3O9R A;  1RFQ A;  4DQR A;  3ZSZ A;  3O8M A;  4CZJ A;  3ISN C;  3MAQ A;  3SZ2 A;  3KTQ A;  1WSI A;  4DR4 K;  1H1V A;  5AQZ A;  4DV1 K;  5EVZ A;  4LF9 K;  4DV6 K;  3U3Y A;  1TL1 A;  5JS1 A;  3A8Y A;  4E7L A;  1C6V A;  4JI3 K;  3KWI A;  1TUY A;  3L3U A;  3P31 A;  1L5U A;  3M8S A;  1LOT B;  3AAQ A;  2ZQB A;  3AVG A;  1BU6 O;  2F9T A;  4C8N A;  1HKC A;  5C2D A;  4HUE A;  4CJ5 A;  5LJV A;  3CMA N;  3DMJ A;  3OS1 A;  4OPH A;  2CH6 A;  3VER A;  4CZK A;  1VQ9 N;  4QAG A;  3UKU B;  4J2D A;  4FPA A;  4JS5 A;  3KHY A;  5KQD A;  3DLH A;  4OKJ A;  3CET A;  4RTF D;  1TK5 A;  3ZEU A;  3AVM A;  1KLM A;  2Z1J A;  3HI0 A;  2E1Z A;  4U7B A;  5C42 A;  2YHB A;  4JKF A;  4M63 C;  1EKE A;  4DUZ K;  1KAY A;  1S6Q A;  3NF7 A;  1Q9X A;  1TGO A;  1MWM A;  4K42 A;  1YT3 A;  1S22 A;  4DR3 K;  3O9S A;  4O44 A;  1YJW N;  4FJJ A;  3ZEU B;  3Q7B A;  1QQN A;  4CFA A;  2G8K A;  1VQ5 N;  1SL0 A;  1HNZ K;  2O8B A;  1HX1 A;  5C2F A;  1U2V A;  3E66 A;  3F9M A;  2B6A A;  4CBX A;  4QS8 A;  2E8A A;  2FLO A;  3AVJ A;  2JWK A;  3ZCM A;  3EY1 A;  4M3Z A;  4E7J A;  3FFI A;  3HYF A;  4CD3 A;  4H0T B;  4JYA K;  2DFH A;  4DTP A;  2GWJ A;  4DR2 K;  5AQJ A;  4M41 A;  3WNH A;  3LDS A;  3RR7 A;  3OYN A;  3DLK A;  4W5R A;  3L2R A;  1GLC G;  3K5N A;  1DT9 A;  3D7E O;  4FWM A;  3HJF A;  3B6P A;  4OKE A;  2E1Y A;  4YOV A;  1YI2 N;  2O8B B;  4DFM A;  3VQ8 A;  3OS2 A;  1U2V B;  1KAX A;  5JLH A;  3DXM A;  3QML A;  3QIO A;  3C6H A;  4H5N A;  1E4G T;  2QWL A;  3KZB A;  2P9K A;  3NCI A;  2VWB A;  1JCG A;  3HL8 A;  4L8R B;  3DAW A;  1NGH A;  4DSJ A;  3AVI A;  4Q0B A;  1WUA A;  3I8D A;  4RG8 A;  2UYT A;  1Q18 A;  3V9Z A;  1X9S A;  4JEP A;  5B8H A;  3JYT A;  2QW9 A;  5BPN A;  3VF4 A;  3NMU A;  4YY3 K;  2PAV A;  4R79 A;  3LZJ A;  2V52 B;  1VRT A;  3DXM B;  4H0V B;  5EXW A;  3THV A;  4F9O A;  4DTU A;  4HUG A;  3HRG A;  4I9L A;  4O8K A;  2FSN A;  2P9K B;  3GOI A;  3LAK A;  3R8E A;  2ZF5 O;  2I7N A;  2Q2R A;  1YJ9 N;  4OO1 J;  4C8O A;  3KLF A;  1RTJ A;  2ZM6 K;  4IG3 A;  3GE1 A;  4CF2 A;  5SWM A;  3K58 A;  3CI5 A;  4CE9 A;  3SJJ A;  4CW7 B;  3ATV A;  1SAZ A;  3SUO A;  3V9S A;  4N5S A;  2IDO A;  3L3V A;  2YNG A;  3C95 A;  1FW6 A;  3MED A;  1YAG A;  2P51 A;  2ZGZ A;  2FBY A;  2A1S A;  2PBD A;  1QE1 A;  4IDH A;  4CVN E;  4NLC A;  2F96 A;  4DQQ A;  5HP1 A;  1KTQ A;  4DF8 A;  4V19 S;  3H46 O;  3CFO A;  3QFP A;  3HZ6 A;  1NGC A;  5EY4 A;  3VQD A;  3QER A;  4IJA A;  1T6D A;  3AVH A;  4WFB L;  4DU4 A;  3OW2 M;  3SQ1 A;  3N4P A;  1ZBI A;  4CHY A;  1RBV A;  5CYM A;  1KLN A;  1RDB A;  2FXU A;  4CZF A;  3CER A;  4CEO A;  3DRR A;  4CEA A;  5E41 A;  3RRG A;  5AQH A;  5KPR A;  4A5B A;  4AHU A;  3QIN A;  3K9K A;  4KPY A;  2VWK A;  4O4G A;  1VQ8 N;  4I2P A;  3E9O A;  4LH5 A;  3DI6 A;  1ZYQ A;  1KQS M;  2XHB A;  1Q86 O;  5EX5 A;  4DQP A;  3C94 A;  3O3H A;  1JLA A;  4B08 A;  1BOT O;  4BDY A;  3P83 D;  1S1V A;  1BG3 A;  5I9E B;  4CEE A;  3SMP A;  5BRE A;  3DXK A;  3CME N;  1NMD A;  2IIR A;  4B9S A;  1NJY A;  5GAD P;  1S1U A;  3OYC A;  1K8K A;  2WON A;  2DFE A;  3CJB A;  4K0K K;  4OGE A;  3FZM A;  4B3O A;  5HOO A;  4BRC A;  1QVF M;  4Z0U A;  1BGX T;  4CGD A;  1HR0 K;  4DQS A;  1KRP A;  3P4I A;  1Y97 A;  3LWM A;  3VGM A;  1OKJ A;  3MXJ A;  4PQU A;  5FRN A;  4IEE A;  4MQ3 A;  3U3G A;  2NRT A;  2ZWH A;  1FKO A;  2OZS A;  5LL6 Z;  4JNE A;  4KH5 A;  3SAG A;  3NAE A;  1VSJ A;  3CQ8 A;  1EWR A;  3KLH A;  3DXK B;  3SUN A;  3C0B A;  3WXM B;  1NGD A;  4UY8 O;  5CZ1 A;  2V51 B;  1XHZ A;  2HVH A;  1QVG M;  1K8K B;  3LPU A;  3D0P A;  1Z6R A;  4FL9 A;  2RHK A;  5LY3 A;  1QSY A;  1FKP A;  5BRD A;  1VQO N;  3L2Q A;  4DTX A;  4CJS A;  4KKO A;  3VEN A;  2HNY A;  1Z25 A;  1ZC6 A;  3L2W A;  3RTV A;  3VEV A;  4X64 K;  3EKU A;  3TAN A;  1T8E A;  1QHA A;  4O0J A;  3TSP A;  4GKK K;  2KQ2 A;  4CJU A;  3NDK A;  3K0S A;  1RDW X;  4FK0 A;  1N32 K;  1HKG A;  1TK8 A;  4CFB A;  1SQK A;  3HPO A;  4JAX A;  4PUO A;  4OLB A;  1HPZ A;  1X1P A;  2J4R A;  2BAN A;  2Q1N A;  3EL2 A;  3RMA A;  4F2R A;  2ZGY A;  3PLA A;  4GMJ B;  4O5B A;  3VGL A;  2FC0 A;  3RSE A;  1L3U A;  4J2A A;  1S9G A;  4KV8 A;  3DOK A;  3J81 O;  1S3X A;  5M1O A;  3CPE A;  4C1N K;  3O80 A;  4CK1 A;  4JKH A;  5TKY A;  3SK3 A;  4KH4 A;  5FDL A;  2UXD K;  3MN5 A;  4DQI A;  4NLB A;  1JKH A;  1NGE A;  5FPN A;  1W2B M;  4YOY A;  1WAJ A;  4CJQ A;  1S1W A;  4W5N A;  3AVL A;  3LP3 A;  3RSE B;  5AFU A;  4WE1 A;  4B8A B;  3W0L A;  4CJT A;  2A3Z A;  3QIC A;  2G8I A;  2BGG A;  4XH1 A;  1GLA G;  4OVL A;  1RTD A;  2ATQ A;  3EE8 A;  4JV5 K;  1I39 A;  1RDA A;  1HNW K;  1HQU A;  3OJU A;  3SJH A;  3MK6 A;  1SKR A;  4PKH A;  1UA0 A;  5M1N A;  4DUY K;  3CCV N;  2BE2 A;  3CCU N;  3WT0 A;  3SBG A;  3BZK A;  2EHG A;  4CHN A;  3ENO A;  2BUP A;  4IO9 L;  2KKZ A;  3WXL A;  2P5G A;  4O5F A;  2P9U B;  5J2P A;  1M90 O;  2E88 A;  3K9J A;  2YJF A;  2F7T A;  3H3O B;  1YTA A;  1NK4 A;  4Z4E A;  3HPG A;  4MFB A;  5AZI A;  1EP4 A;  4DTS A;  1NKB A;  5ELZ A;  4B3M K;  5EU7 A;  3CF5 L;  4YDU A;  4DSK A;  3NFA A;  3MX2 A;  2JLE A;  3CJ7 A;  4BRI A;  2R7Y A;  4HVJ A;  1GLF O;  4NYN A;  3FZK A;  2X74 A;  3VQQ A;  3MCP A;  3TTC A;  4BGA A;  5FRO A;  4C8M A; 
#chains in the Genus database with same CATH homology
 1WSI A;  1J9A A;  3KK3 A;  4M3R A;  2OPR A;  1L3V A;  4JS4 A;  1IKX A;  1C1C A;  4EZ9 A;  3VA0 A;  3VQP A;  3U3Y A;  1TL1 A;  3DLG A;  5JS1 A;  1T7P A;  1BI4 A;  1IH7 A;  1ZBF A;  4E7L A;  1C6V A;  1TKD A;  2O4G A;  3L3U A;  1L5U A;  3VQ6 A;  1HYS A;  4AH9 A;  2G8U A;  5I3U A;  3M8S A;  3RR8 A;  1RT3 A;  4ELU A;  4E1M A;  4DSI A;  4Z4E A;  3AVG A;  2ZQB A;  4C8N A;  3HT3 A;  1C1B A;  3LP1 A;  4JRQ A;  4F2S A;  1U49 A;  4HUE A;  2I5J A;  4CJ5 A;  4FJG A;  3DMJ A;  3A2F A;  3OS1 A;  4M3X A;  4DF4 A;  1KVA A;  4QAG A;  4J2D A;  4JS5 A;  3AVN A;  1BIU A;  4ELV A;  4CHO A;  1CLQ A;  3DLH A;  4OKJ A;  3V9W A;  2AJQ A;  4IFV A;  3ZSR A;  4RW7 A;  1HMV A;  3EZ5 A;  1TK5 A;  4DU1 A;  4HTU A;  3G10 A;  3AVM A;  3AA3 A;  1ITG A;  1KLM A;  2FBT A;  2Z1J A;  3O3G A;  3PUF A;  4CGI A;  4BAC A;  2PZS A;  4CEC A;  5C42 A;  3SI6 A;  2YHB A;  1REV A;  3QIP A;  1BHL A;  1EKE A;  2RF2 A;  5K14 A;  3OYH A;  3QNN A;  1QSS A;  1BI4 B;  1S6Q A;  2IAJ A;  5J1E A;  4N56 A;  1TAU A;  3NF7 A;  4FLX A;  1HNV A;  4EP4 A;  1BCM A;  1LW2 A;  5CYQ A;  1Q9X A;  1TGO A;  1RTI A;  3TR8 A;  1DTT A;  2HHQ A;  4E1N A;  3KIO A;  2YNF A;  3SNN A;  4NCG A;  4CEQ A;  4DWI A;  1XHX A;  3AV9 A;  3MEE A;  1YT3 A;  4DMN A;  4PA1 A;  4FM0 A;  4DS5 A;  3ZT0 A;  4AHV A;  4KTQ A;  3HST B;  3K59 A;  2HHU A;  2IC3 A;  2Z1I A;  4FJ5 A;  4KI6 A;  3VQ9 A;  4DSE A;  1RT4 A;  4I2Q A;  1XI1 A;  4O44 A;  4Z4F A;  1IO2 A;  3VQ4 A;  4FW2 A;  4CF0 A;  4FJJ A;  1FK9 A;  1RDD A;  2PY5 A;  3H08 A;  1RT6 A;  1S1X A;  2RPI A;  3DYA A;  3KD1 E;  4CFA A;  4DLE A;  3DOL A;  2G8K A;  1SL0 A;  3DM2 A;  1QQC A;  5JS2 A;  3AVF A;  1NOZ A;  3OYD A;  3IG1 A;  3SUP A;  4CIG A;  4FK4 A;  1WLJ A;  1WSF A;  4BDZ A;  1ZBH A;  3WNE A;  4N76 A;  4Z4I A;  1A5X A;  2B6A A;  1CXQ A;  3OYJ A;  3CM5 A;  5KRS A;  4OJR A;  2X6N A;  3QET A;  4KRF A;  3AVJ A;  3SV3 A;  3HXM A;  1VRU A;  3ZCM A;  3AO4 A;  3EY1 A;  1U45 A;  1HNI A;  3VQB A;  4B8C A;  4M3Z A;  4E7J A;  3AO1 A;  4R5P A;  3FFI A;  3HYF A;  3IRX A;  4KHU A;  4FCY A;  3RMB A;  3CG7 A;  4DLG A;  1N5Y A;  2DFH A;  1C0T A;  4DTP A;  2KFN A;  2OA8 A;  2VG6 A;  4LSN A;  4M41 A;  3MXI A;  3WNH A;  3OYI A;  3LDS A;  2WOM A;  3U6F A;  4B9U A;  1IKY A;  4FJI A;  3RR7 A;  1RT5 A;  3DRS A;  4FLW A;  3OYN A;  3DLK A;  4W5R A;  4KFB A;  3KK1 A;  3L2R A;  2GBZ A;  3K5N A;  3S3O A;  2HW3 A;  3S9H A;  3P1G A;  3HJF A;  4E7K A;  3B6P A;  4OKE A;  2D5R A;  1TK0 A;  3HPH A;  2OPQ A;  3LZI A;  1YTU A;  3K57 A;  1JLQ A;  2D0B A;  1J53 A;  3D45 A;  3V9X A;  4DFM A;  3VQ8 A;  4ELT A;  3OS2 A;  2Y1I A;  3AA5 X;  1S5J A;  1RT2 A;  2HNZ A;  4HUF A;  3QIO A;  3M8R A;  3C6U A;  4B9L A;  2XY7 A;  3QEX A;  4QOZ B;  4KRE A;  3CYM A;  5HLF A;  4DTR A;  4DSL A;  2B4J A;  2G8V A;  3LWL A;  5HRP A;  2XRI A;  3NCI A;  4BE2 A;  4FM1 A;  3HL8 A;  4H8K A;  4L8R B;  1J54 A;  4CFD A;  3OYA A;  3O3F A;  4HCB A;  4K8X A;  4DSJ A;  3TAM A;  3AVI A;  1VK0 A;  4Y1D A;  4Q0B A;  3I8D A;  2DTU A;  4IDK A;  1GOA A;  4RG8 A;  3PX6 A;  3SUQ A;  3MXM A;  1C0U A;  1LWC A;  3V9Z A;  1XC9 A;  4DTN A;  1X9S A;  3JYT A;  2NUB A;  1TKT A;  4JLH A;  4FXD A;  4Z4H A;  3KKR A;  4IKF A;  1NK7 A;  1HQE A;  1UOC A;  3K2P A;  4DTO A;  3L8B A;  1NJZ A;  3AO5 A;  3PY8 A;  3LZJ A;  3SPY A;  1GOB A;  4RW9 A;  1VRT A;  1U04 A;  3TAP A;  1EXQ A;  3THV A;  4DTU A;  1KCF A;  4KHN A;  1CZ9 A;  4KHW A;  4HUG A;  5KGW A;  3NGY A;  4I9L A;  4CHZ A;  2VWJ A;  2E6L A;  1TKZ A;  4E7H A;  3TAB A;  4CJK A;  3ZSV A;  2IOC A;  3LAK A;  2DY4 A;  1SUQ A;  1EET A;  4ICL A;  1RT7 A;  4CJL A;  3I0R A;  1VSL A;  3RMD A;  3TAG A;  4C8O A;  1JXE A;  3KLF A;  3AO3 A;  4F4K A;  4KB1 A;  4M3T A;  1RTJ A;  4OLA A;  1QSL A;  3OYF A;  1HYZ A;  4IG3 A;  1BL3 A;  2IGI A;  4CF2 A;  4DTM A;  5SWM A;  1NK5 A;  1S6P A;  3F9K A;  1RBT A;  1ZBU A;  4E19 A;  3K58 A;  3PO4 A;  4CE9 A;  1RT1 A;  2HHW A;  1A5V A;  5T7B A;  3ALY A;  3ULD A;  3SJJ A;  1DTQ A;  3K5O A;  4LY7 A;  3RRH A;  4KHS A;  2W42 A;  4M42 A;  3SUO A;  3B6O A;  3MEC A;  3V9S A;  4N5S A;  4CIE A;  2IDO A;  1WNS A;  4FLY A;  3OYK A;  2B5J A;  2LSN A;  2YNG A;  3C95 A;  3L3V A;  4ID1 A;  3ZT1 A;  1MU2 A;  3MED A;  3K5L A;  4M3W A;  4NYF A;  1RCH A;  3HVT A;  1EX4 A;  1RNH A;  2Q3S A;  2P51 A;  4J2B A;  5HRS A;  4TSX A;  2FBY A;  2A1S A;  3V1Q A;  4CJW A;  1VSE A;  1WN7 A;  4AIL C;  1QE1 A;  3PX4 A;  2KFZ A;  3NBP A;  4ZTJ A;  1ASV A;  2E6M A;  3NHG A;  2X6S A;  2OPP A;  1N6Q A;  2YNI A;  3SQ2 A;  4LH4 A;  5HBM A;  3KLG A;  4E3S A;  2F96 A;  1RBU A;  3P5J A;  4FVM A;  3SZ2 A;  4DQQ A;  1RBS A;  4KI4 A;  3PO5 A;  4AHR A;  4YNQ A;  5HP1 A;  1KTQ A;  5DMR A;  4DF8 A;  3HM9 A;  4F3T A;  4CGH A;  1X9M A;  3CFO A;  3TI0 A;  1UAX A;  1JL2 A;  3AA2 A;  3AA4 A;  2QXF A;  3QEI A;  1LWF A;  3RWU A;  3WNF A;  4OPJ A;  2OZM A;  3OVN A;  3SQ0 A;  2PYL A;  3OS0 A;  4I9Q A;  2YV0 X;  3TAF A;  4BDP A;  3OYG A;  3VQD A;  3QER A;  1KSP A;  3AVH A;  4DSF A;  1W0H A;  2GV9 A;  2VG5 A;  3AVK A;  4DU4 A;  3SQ1 A;  4FZY A;  1ZBI A;  1GOC A;  3VN5 A;  1JLE A;  4CHY A;  4M45 A;  4FJK A;  4IBN A;  2JGU A;  3LAL A;  1ASU A;  1U47 A;  1RBV A;  4CJP A;  5J2N A;  5CYM A;  1ZBL A;  1WSG A;  1KLN A;  2OYQ A;  4E7I A;  4CF8 A;  1RDB A;  2YKM A;  3LP0 A;  4KTW A;  4BWM A;  4CHQ A;  3F73 A;  4KHQ A;  2D0C A;  4NCB A;  2HHT A;  3VQ7 A;  1WSJ A;  4CEO A;  3OYE A;  1NK8 A;  1JLG A;  1TAQ A;  2HVI A;  3DRR A;  4CEA A;  4CEZ A;  5E41 A;  3RRG A;  3G0Z A;  1T03 A;  2F8T A;  3SPZ A;  3KK2 A;  3TWH A;  1WAF A;  4AHU A;  3QIN A;  4KPY A;  2VWK A;  1WSH A;  1IG9 A;  2YKN A;  4O4G A;  4DTJ A;  4BWJ A;  4KB0 A;  4I2P A;  3DRP A;  1R0A A;  1LV5 A;  2G8H A;  4LH5 A;  3VQC A;  3DI6 A;  1ZYQ A;  4Z4G A;  4KO0 A;  2XHB A;  2XY5 A;  1G15 A;  4DQP A;  4RW4 A;  4AHS A;  1CZB A;  2GUI A;  5HRR A;  4B9M A;  4E0D A;  4CED A;  3NH2 A;  3C94 A;  3O3H A;  2XY6 A;  1JLA A;  3OJS A;  2PYJ A;  3HK2 A;  4B08 A;  3ZSW A;  1RTH A;  1D5A A;  3QNO A;  2E4L A;  4BDY A;  1K6Y A;  4ZTF A;  3IAY A;  3P83 D;  1S1V A;  1LW0 A;  4ID5 A;  5KRT A;  3OYB A;  1CXU A;  4CEE A;  3ZT4 A;  3M8P A;  1B9F A;  2O4I A;  4H4M A;  4CEB A;  1RIL A;  3NE6 A;  3RMC A;  3DLE A;  4LD0 A;  4CJR A;  4B9S A;  3V1R A;  1NJY A;  2BDP A;  4M3Y A;  1LAW A;  1SL1 A;  5CZ2 A;  3V9U A;  2X78 A;  3QEP A;  1S1U A;  4FLT A;  3OYC A;  1UWB A;  5DK5 A;  1JLB A;  1KFD A;  2WON A;  3VA3 A;  2DFE A;  3K5M A;  4OGE A;  4FJL A;  4FM2 A;  4B3O A;  1JXB A;  3QO9 A;  2Z1H A;  4Z0U A;  1BGX T;  4CGD A;  1UA1 A;  1L3S A;  1J5O A;  3QEW A;  2HB5 A;  4HHT A;  1VSD A;  4DQS A;  2XY8 A;  4CJF A;  1KRP A;  5HRO A;  4HCC A;  1Y97 A;  2F8S A;  3LWM A;  3MXJ A;  4FJX A;  5HRN A;  4PQU A;  2HHX A;  5FRN A;  4MQ3 A;  3U3G A;  4CGG A;  1FKO A;  4FLZ A;  2Y1J A;  1LAV A;  2HMI A;  2OZS A;  2G8W A;  3NAE A;  3TAQ A;  1VSJ A;  3V6D A;  1NK0 A;  1QS4 A;  3CQ8 A;  3KLH A;  3SUN A;  2FBX A;  4OGC A;  4G1Q A;  3I0S A;  5CZ1 A;  3ZSO A;  1XHZ A;  2HVH A;  3DLB A;  3LPU A;  4CCH A;  3LPT A;  3PX0 A;  2ZE2 A;  4QCL A;  3D0P A;  3HVR A;  3O4N A;  5KTQ A;  3VQE A;  3CFP A;  3PV8 A;  4FK2 A;  4Y1C A;  1QSY A;  3KLI A;  1FKP A;  3NGZ A;  3S3M A;  1RDC A;  3HP9 A;  4EP5 A;  2YNH A;  3L2Q A;  3T3F A;  4DTX A;  1IKW A;  1IKV A;  1T05 A;  4CJS A;  1U48 A;  4Z4C A;  4KKO A;  4FLV A;  4N47 A;  1BQN A;  4CES A;  2KZZ A;  2HNY A;  1Z25 A;  3L2W A;  3RTV A;  4CJV A;  1JLF A;  1Z26 A;  1SKS A;  3ZSY A;  4M3U A;  3NH0 A;  4FW1 A;  1TKX A;  3TAN A;  4KHY A;  1NKC A;  2XO7 A;  1T8E A;  1Q9Y A;  4O0J A;  2KQ2 A;  1B9D A;  4CJU A;  3NDK A;  2IS3 A;  2G8F A;  3VQA A;  4FK0 A;  3OY9 A;  1TK8 A;  2QK9 A;  4RW8 A;  4CFB A;  2ETJ A;  1NJX A;  4FJM A;  3ZT2 A;  4AHT A;  4BE0 A;  3HPO A;  1KVB A;  1NK6 A;  1C1A A;  3V81 A;  1B92 A;  1A5W A;  3SQ4 A;  4B9T A;  4CJE A;  4PUO A;  1HRH A;  1Q8I A;  1HPZ A;  4CGF A;  1BIZ A;  4E89 A;  1LWE A;  1X1P A;  3AVB A;  4CJ3 A;  2BAN A;  4UQG A;  3RMA A;  4F2R A;  4GMJ B;  3ZT3 A;  3TAE A;  3ASM A;  3L2U A;  4O5B A;  2P1J A;  3BGR A;  1ASW A;  2HHV A;  2FC0 A;  1L3U A;  1WSE A;  3HP6 A;  1U4B A;  1S9G A;  4J2A A;  1JLC A;  2VG7 A;  3CM6 A;  4Q5V A;  4FJ8 A;  3SCX A;  4KV8 A;  3OYM A;  4DS4 A;  2A1R A;  3DOK A;  3MEG A;  3BDP A;  1VSK A;  2QKB A;  5D3G A;  1SV5 A;  5SZT A;  3SV4 A;  1L3T A;  2HND A;  4DG1 A;  1D8Y A;  2HHS A;  3M8Q A;  1FXX A;  5KGX A;  1TVR A;  3AO2 A;  4XIU A;  4AHC A;  4YFU A;  3L2V A;  1KFS A;  4OKK A;  3NF6 A;  3KKS A;  4CK1 A;  3QEV A;  1HYV A;  4OPK A;  4F8R A;  4GVM A;  1D9F A;  4FZZ A;  4CF9 A;  3V1O A;  2Z1G A;  2P5O A;  5C25 A;  1VSF A;  4FJN A;  3S3N A;  5FDL A;  4I7F A;  4J2E A;  1NKE A;  3DLR A;  3NGI A;  1QTM A;  3V4I A;  2OPS A;  3KD5 E;  2FBV A;  2ITG A;  4CJ4 A;  4DFP A;  4RW6 A;  4KAZ A;  4W5O A;  3T1A A;  4DQI A;  1S9E A;  1JKH A;  1VSM A;  4FJH A;  3KLE A;  1WAJ A;  4CJQ A;  4FZX C;  1S1W A;  4NCA A;  2RKI A;  4C8K A;  3UIQ A;  2KZM A;  4W5N A;  2KW4 A;  2ZD1 A;  3AVL A;  3LP3 A;  3O4Q A;  4CEF A;  4FLU A;  1W9H A;  4WE1 A;  1F21 A;  2EX3 A;  4IFY A;  4PWD A;  4CGJ A;  4CK2 A;  4ZHR A;  4B8A B;  4CJT A;  4C8L A;  3TAR A;  3VQ5 A;  2G8I A;  2BGG A;  4DFK A;  1RTD A;  4OVL A;  3KJV A;  1JL1 A;  2ATQ A;  3HO1 A;  4CER A;  4DU3 A;  3LP2 A;  3E01 A;  2RN2 A;  3LAM A;  4FYD A;  4CFC A;  4O0I A;  1I39 A;  3AVA A;  1RDA A;  1NOY A;  4H4O A;  1VSH A;  5J2M A;  1HQU A;  1TL3 A;  3OJU A;  1X9W A;  3LAN A;  1O1W A;  3NF8 A;  1NK4 A;  3NF9 A;  1SKW A;  1SKR A;  1VSI A;  4EZ6 A;  4B9V A;  1UA0 A;  1QHT A;  4JRP A;  2KTQ A;  4K8Z A;  1TV6 A;  2YHA A;  2BE2 A;  4KTZ A;  1HJR A;  3SYZ A;  2EHG A;  4CHN A;  4N41 A;  3OYL A;  3ITH A;  4F3O A;  1BIS A;  1SL2 A;  1KVC A;  3EYZ A;  1NK9 A;  3IS9 A;  4B9N A;  2P5G A;  5J2P A;  4IG0 A;  3NH1 A;  4FJ7 A;  3QLH A;  5KI6 A;  5I42 A;  4W5T A;  4CHP A;  3JSM A;  1NJW A;  1RBR A;  2QKK A;  3QES A;  3ZSX A;  4W5Q A;  2D0A A;  5C24 A;  4GW6 A;  4CIF A;  4FJ9 A;  4CK3 A;  1C0M A;  1YTA A;  1I3A A;  4LSL A;  1BCO A;  1XWL A;  3HPG A;  3CFR A;  1BQM A;  4CF1 A;  4MFB A;  4DFJ A;  1EP4 A;  1DLO A;  4BE1 A;  4O55 A;  4DTS A;  5CY4 A;  1NKB A;  5J2Q A;  5EU7 A;  4PY5 A;  4DSK A;  3T19 A;  4OLB A;  1YVU A;  1S1T A;  2JLE A;  3NFA A;  3AVC A;  5FRM A;  1D9D A;  2DFF A;  2R7Y A;  4HVJ A;  3C6T A;  3WNG A;  4NYN A;  3VQQ A;  2X74 A;  4DQR A;  3ZSQ A;  3ZSZ A;  3MAQ A;  3ISN C;  5FRO A;  4C8M A;  3KTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...