1VSEA

Asv integrase core domain with mg(ii) cofactor and hepes ligand, low mg concentration form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords INTEGRASE
publication title The catalytic domain of avian sarcoma virus integrase: conformation of the active-site residues in the presence of divalent cations.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vseA00
4KHSA 3NBPA 3HL8A 1BI4B 1IKWA 3KLGA 4Z4EA 3DRPA 2G8IA 1IKYA 1RTIA 3KJVA 4Z4HA 3RR7A 4LSLA 4CEFA 1IO2A 1KVAA 4CF8A 1UOCA 2HVHA 4DLGA 1TKZA 4CFCA 3T3FA 1ZBFA 3AO3A 4W5TA 3VA0A 4Q0BA 4CJWA 1N6QA 2F8TA 3LZIA 4CGJA 3QINA 2X6SA 3O3GA 4Z4IA 5KRTA 4KHQA 2F96A 1NK8A 4CGIA 3V9UA 4F2RA 4KHYA 2PYJA 3ULDA 3P83D 3VA3A 5FRNA 4F4KA 1X9SA 5SZTA 3DI6A 1JLGA 1S1XA 3DMJA 4PA1A 4E7KA 3K5OA 2IOCA 3HSTB 4JLHA 3OS1A 4DFMA 1D9FA 1NJYA 2EHGA 3CYMA 5CY4A 3AV9A 4EP5A 4UQGA 2O4IA 3THVA 3LANA 4OPJA 1TK0A 4ELUA 3V9ZA 3PX4A 1KVCA 4KV8A 4CGGA 2Y1IA 3I8DA 4M3WA 1RILA 3K5LA 2VG5A 4RW7A 4HCCA 4KTZA 3HP9A 2HVIA 3DRRA 3QESA 1VSKA 3SNNA 1BQNA 4N47A 1WN7A 4JRPA 4F3OA 3HT3A 3DLRA 4FK2A 3I0RA 3OYLA 1W9HA 1RT7A 4FJ8A 1REVA 4N56A 4E3SA 3SV3A 2IS3A 3G10A 3LAMA 1ASVA 3LP1A 1C0TA 4B9VA 4CGHA 2E6MA 4DQQA 3S3NA 4FLUA 1C1AA 1I39A 1BL3A 3CFPA 1NJWA 1BQMA 4DTPA 1DTTA 1T05A 4GVMA 1LWCA 5CYMA 4CJ5A 3OS2A 1JXBA 3MEEA 1VSJA 4CFAA 4IFYA 4Z4CA 2XO7A 4Y1DA 4DLEA 1LWEA 4OLBA 3O4QA 3U6FA 1VSDA 4B9SA 4CJSA 3G0ZA 2R7YA 4DQIA 4FJJA 4KRFA 5C24A 1TKTA 3LP0A 3RR8A 1SKSA 2HMIA 3ZT4A 4CGDA 2BE2A 3DM2A 3MEDA 3DOLA 4H4OA 4O4GA 3V1QA 3LWLA 3KTQA 4E7JA 1FXXA 2HHVA 2G8WA 1VSIA 4FLWA 3U3YA 2DFHA 2KQ2A 1NK4A 4NCAA 4CHNA 1A5XA 3NE6A 1HQUA 1KCFA 2AJQA 4AHSA 2DTUA 4OLAA 3L2UA 4LSNA 1NOZA 4CEBA 4PQUA 3DLGA 3OYHA 1KTQA 2RPIA 4GMJB 3ZT1A 1RNHA 4AH9A 2HNYA 2BDPA 4FJGA 2HHUA 4DSEA 4CHOA 4QOZB 1HYVA 2B5JA 4B9LA 1HNIA 2DFFA 3H08A 1TK8A 5HLFA 1BIUA 1UA0A 3KLFA 4JS4A 3SCXA 3V9XA 4BDYA 2P51A 4DS5A 5J2NA 1L5UA 3TWHA 4FW2A 4CF0A 4E0DA 3SUNA 3TR8A 1WNSA 1QTMA 4E1NA 4FK4A 3NF8A 4OGCA 4DTJA 1LWFA 1J54A 1Z26A 4OVLA 3SQ0A 3NF9A 3HVRA 4FCYA 2YNHA 1NK7A 2FBYA 4O44A 4DF4A 3KD1E 4YNQA 1DLOA 4GW6A 1TV6A 4CHYA 3AVCA 1RTDA 3HPHA 1JKHA 3WNEA 2OYQA 4C8LA 1TGOA 3RTVA 1T7PA 3HJFA 1UWBA 3MEGA 3MXJA 4HTUA 3VQAA 4B9MA 1RT4A 1NKEA 4M3ZA 3ZSXA 1O1WA 4N5SA 3D0PA 2KFZA 3AO2A 5C42A 2GUIA 2PZSA 3LPTA 1WAFA 3MXMA 3KKRA 4DSFA 4AHCA 4RW8A 1JL1A 3AVFA 3HM9A 1QHTA 3SUPA 4EZ6A 4B08A 4CEAA 2IGIA 1XI1A 1Q9XA 1B9DA 1TKXA 2HNZA 1JLFA 1CZBA 4CK2A 1K6YA 5FROA 1KLNA 1IH7A 1SL1A 2FBVA 4DSLA 1S1WA 4AHVA 5KI6A 4EZ9A 1RTHA 4RW6A 4CERA 5EU7A 3AA2A 4CJRA 4CE9A 2VWJA 3CG7A 1ZBUA 3M8SA 4CIGA 3L3VA 3ZT2A 4M3UA 1RT1A 4F3TA 4CEQA 4KB0A 4W5RA 2XY8A 1GOCA 4FZZA 1NKBA 2Z1JA 1NJZA 1T03A 4QAGA 4O0JA 4Q5VA 4DTSA 1B92A 1JLBA 1JLAA 1U49A 1TL1A 4TSXA 3ZSWA 3NGIA 3SQ4A 4J2BA 4B3OA 3QEIA 4HUFA 2Q3SA 3HPGA 3DLKA 4CJFA 3LWMA 2RKIA 1BCOA 1VSEA 1RBRA 1X9MA 1WSIA 2QXFA 1YVUA 4DFPA 2GV9A 4NCGA 4K8XA 1VSFA 4ID5A 3T19A 4AILC 1YTUA 3V9WA 1ZBLA 4KI6A 2XHBA 4J2EA 2JLEA 3NGZA 1QSLA 4M3YA 1SL2A 2I5JA 3QIOA 3OVNA 3ISNC 3OY9A 3AVAA 4ZHRA 4CJKA 5K14A 1LV5A 3DYAA 3QEPA 3SYZA 1A5WA 2ITGA 4CCHA 3AO1A 5J1EA 3OJUA 2HB5A 2XRIA 4BE1A 4CF1A 3V1RA 4EP4A 4DQSA 3C95A 1HPZA 4PUOA 4N41A 3NF6A 3BGRA 1LAVA 2OPPA 2HNDA 4I9LA 5SWMA 4FJNA 3KIOA 1W0HA 3NCIA 4CESA 2XY5A 1Q9YA 4ELTA 3V9SA 3VQ6A 5J2PA 3AVIA 2P5GA 1NK0A 1CZ9A 1I3AA 3OYFA 3PV8A 3SI6A 1VSLA 4FJXA 1ZBHA 4FJIA 3HXMA 3HK2A 3VQEA 2VG6A 3HPOA 4J2AA 2OZMA 2ATQA 2HW3A 4CIEA 1TVRA 2X6NA 4E89A 3C94A 3D45A 4FJ7A 5FDLA 3B6OA 3VN5A 1HYSA 2VWKA 4IBNA 5C25A 5HRRA 3QEXA 1WSGA 1RT5A 3SUOA 1JLCA 3OYAA 3VQ8A 3KLIA 3RRHA 1KFSA 4DQRA 1WSHA 3V1OA 3OS0A 2QK9A 1BIZA 1FK9A 3KK2A 3K5NA 2FBXA 3IG1A 3OYGA 3V81A 3QETA 4DTXA 3QERA 4FJ9A 1GOAA 3NFAA 1L3TA 4Z4FA 4I7FA 3CM5A 3S3OA 1BHLA 2HHSA 2X78A 4ICLA 4M42A 3TAGA 4DTRA 4FZYA 1S5JA 2W42A 2WOMA 1L3UA 4CIFA 1RBTA 3LAKA 4DSIA 1R0AA 1D5AA 4B8CA 5E41A 1Z25A 3OYNA 1WLJA 1RBVA 3ZSYA 1X1PA 4IG3A 2HHXA 3O4NA 3LP2A 4FJ5A 4KHUA 1XHZA 1D9DA 1RDDA 3DLBA 3VQ9A 4B9UA 5DK5A 4KHWA 5I42A 1MU2A 1WSJA 2D0AA 3QLHA 4CFDA 5HRNA 2G8HA 3DRSA 1S9EA 3HO1A 4OKJA 3WNFA 1RT6A 1L3SA 2WONA 3KKSA 1NOYA 2KW4A 1EXQA 4BE0A 1ASWA 4C8OA 3VQPA 3TAPA 3JYTA 2HHQA 1KLMA 1S1UA 5CZ2A 4Z0UA 4CK3A 5HBMA 2Z1IA 3CM6A 4CFBA 3S9HA 4KPYA 3VQ5A 3ZCMA 4J2DA 4FM2A 1D8YA 4H8KA 1ITGA 4KTQA 1QQCA 1WSFA 4KKOA 4CJ4A 3NHGA 3ZT3A 2YNGA 2D0BA 3AVBA 1S6PA 4DQPA 3TAFA 2BANA 3AA3A 4RG8A 4RW9A 3SJJA 5FRMA 4W5QA 3OYJA 4FJHA 3LZJA 3TANA 3OYKA 4DSKA 4AHUA 1N5YA 3ZSOA 3NDKA 3SQ1A 1NK9A 1JLQA 3L2VA 3AVJA 3QEWA 1Q8IA 3ZSRA 4CEOA 1TK5A 4M3TA 1VSMA 3BDPA 4NYNA 2OPSA 4M45A 4HUEA 4FZXC 1NKCA 2LSNA 4KI4A 4FJMA 1VSHA 1HQEA 2XY7A 1SKWA 4K8ZA 1YT3A 4F2SA 1ASUA 1VRUA 3V4IA 3TAQA 4E7IA 4QCLA 1FKOA 1YTAA 1GOBA 1G15A 4I2PA 4FLTA 4CEDA 3RMBA 3PO4A 3AVMA 4B8AB 4DG1A 3MXIA 4HCBA 4N76A 4OKKA 5JS2A 3TABA 4KHNA 1C6VA 3DLEA 2O4GA 2RF2A 4FJKA 1NK5A 4DF8A 1QSYA 1U4BA 2P5OA 1C0MA 3O3HA 3OYEA 2G8VA 1SKRA 3TI0A 3RMAA 4DTUA 4HUGA 1RBUA 1TAUA 3VQCA 2KFNA 3PY8A 4HHTA 3E01A 4DU3A 4CEEA 4W5NA 1HJRA 3AVHA 4Y1CA 3PX6A 4O55A 3RWUA 2RN2A 3AVLA 4OKEA 4CK1A 4FLVA 1RDBA 3QNNA 4KAZA 4DU4A 4BACA 1RBSA 5I3UA 3LP3A 3WNGA 3OYIA 3ASMA 3WNHA 4FYDA 4M3RA 3L8BA 4B9TA 4LH5A 4BE2A 3VQDA 1QS4A 2ZE2A 4KO0A 3PUFA 1RT2A 4O0IA 3OYCA 1RCHA 3AA4A 1IKVA 2YKMA 5KGWA 2VG7A 1LW2A 4IFVA 3HP6A 1NK6A 4ZTJA 2YHBA 4R5PA 1KRPA 4HVJA 3TAMA 2G8FA 4DSJA 2XY6A 1JXEA 3P5JA 2FBTA 4CJQA 4CJPA 4CF9A 1VRTA 3KK3A 3QIPA 4I2QA 3VQQA 1C1BA 5HRSA 3OJSA 1S1TA 4FJLA 3ZT0A 4PY5A 3ALYA 2IC3A 3LALA 3NH1A 1FKPA 1WAJA 4IG0A 2YKNA 3PX0A 3U3GA 5CYQA 3M8RA 3EZ5A 2QKBA 4FLZA 2OZSA 4DTMA 5T7BA 4KTWA 1BCMA 4CJTA 4H4MA 3PO5A 1CLQA 1B9FA 3B6PA 1EETA 3A2FA 2KZZA 4LY7A 2E6LA 3MECA 4CHPA 2Z1GA 4DFJA 2YV0X 2OPQA 2ETJA 2GBZA 1TAQA 1VK0A 4IKFA 1ZBIA 5HRPA 1EKEA 2QKKA 4YFUA 4BDZA 4F8RA 4LD0A 3VQ4A 3JSMA 3NH2A 4ZTFA 3F73A 2G8KA 3IS9A 3CQ8A 2ZD1A 1HRHA 1CXQA 4CJUA 3AO4A 3TAEA 1IKXA 5J2QA 2JGUA 4PWDA 1S9GA 4E7LA 5J2MA 4FXDA 3L3UA 4BDPA 1Y97A 2DFEA 3OYMA 1KSPA 1RDAA 3AVGA 4CJVA 3ITHA 2PYLA 4I9QA 3HYFA 4AHTA 4FVMA 1EP4A 4NYFA 1ZYQA 2A1RA 3NH0A 1UAXA 4KREA 1NJXA 1T8EA 4LH4A 2P1JA 3LPUA 4RW4A 2NUBA 4O5BA 4NCBA 1A5VA 3V6DA 3QO9A 4OJRA 2B4JA 3KK1A 1JL2A 2E4LA 3O3FA 4FLYA 1S6QA 3OYBA 1TL3A 5JS1A 2OPRA 1LAWA 1U04A 4BWJA 3EY1A 5HP1A 3RRGA 3KD5E 3VQBA 4CECA 2HHTA 4E1MA 1XHXA 4W5OA 2YNIA 1EX4A 2B6AA 4Z4GA 4DMNA 2DY4A 3L2QA 4KFBA 1XC9A 5KGXA 3QEVA 1U48A 3DOKA 4IDKA 3SPYA 3S3MA 1QSSA 2Z1HA 3L2WA 2A1SA 4AHRA 4E19A 3IAYA 2YHAA 4JRQA 1SUQA 1X9WA 1C0UA 4XIUA 3K57A 3QNOA 1J53A 4MFBA 3MAQA 4MQ3A 1XWLA 3EYZA 1U45A 4C8MA 2X74A 1LW0A 3RMDA 2EX3A 4JS5A 3TARA 1QE1A 1J5OA 3ZSZA 2IAJA 3K5MA 2IDOA 2ZQBA 3AO5A 4DFKA 3T1AA 3P1GA 4OPKA 3L2RA 4DS4A 4B9NA 3DLHA 1U47A 3UIQA 4M3XA 2KTQA 4FLXA 4ELVA 3AA5X 4FM0A 3SQ2A 3C6UA 2D0CA 3K2PA 4WE1A 4CF2A 4M41A 1KFDA 3IRXA 3NF7A 4OGEA 3K59A 3ZSVA 3LDSA 1TKDA 3VQ7A 1BI4A 3ZSQA 2BGGA 1L3VA 1S1VA 5DMRA 2D5RA 5D3GA 4KB1A 1RDCA 4DU1A 4C8KA 1C1CA 3F9KA 1F21A 1BGXT 5CZ1A 4FM1A 4FK0A 3C6TA 3NAEA 4DTOA 3SPZA 3M8PA 3KLHA 1SL0A 3SUQA 1HNVA 4ID1A 4L8RB 5HROA 1HYZA 5KTQA 1J9AA 1BISA 4BWMA 4G1QA 3SV4A 4DTNA 1DTQA 2PY5A 2KZMA 1SV5A 3OYDA 3SZ2A 3RMCA 2F8SA 4CGFA 4FW1A 3AVNA 4E7HA 3HVTA 3CFOA 3CFRA 5KRSA 2Y1JA 1RT3A 3FFIA 2HHWA 1RTJA 4C8NA 2OA8A 4CHZA 4CEZA 1IG9A 1JLEA 2FC0A 3AVKA 4CJLA 2YNFA 3NGYA 4CJEA 1HMVA 3K58A 1WSEA 1CXUA 1KVBA 4CHQA 3I0SA 2G8UA 3KLEA 4CJ3A 1UA1A 4DWIA 3M8QA
chains in the Genus database with same CATH superfamily
3HL8A 3KLGA 1C0FA 2JWKA 2G8IA 4Z4HA 4AM6A 2HVHA 3T3FA 3F5TA 3AO3A 1WB9A 4CJWA 1N6QA 3VENA 3BZKA 4CGJA 3QINA 2X6SA 3O3GA 4Z4IA 4KHQA 1VQ9N 3DLLL 2F96A 4YOXA 4CGIA 3V9UA 1NK8A 5AQVA 3EE9A 4F2RA 5FRNA 1QZ5A 4PA1A 3DMJA 1X3MA 1D9FA 4DFMA 3C6HA 1OKJA 4DR5K 2EHGA 4OPJA 1TK0A 4WF9L 4ELUA 4ILJA 4O8UA 3L4IA 4CGGA 2P9LA 3ID6A 3K5LA 4HCCA 2HVIA 4N47A 4FWSA 2F4VK 4FK2A 1G99A 5AQHA 4XEIA 1RDUA 3LAMA 3LP1A 3VEOA 2QEXN 3CFPA 1DTTA 4JI2K 3ID8A 1NJIO 3O08A 3U6FA 4BR0A 4B9SA 2R7YA 4KRFA 4PKIA 5C24A 1SKSA 3ZT4A 4CGDA 3IUCA 3DM2A 4H4OA 4JK8A 5M1OA 1VSIA 2AP1A 3U3YA 4NCAA 1HQUA 1O13A 3ZX0A 2AJQA 2DTUA 4WFNL 1NOZA 3O4WA 5AQMA 1H1VA 2HMPA 3WUHA 3ZT1A 1RNHA 3K9KA 4IJAA 4AH9A 2HNYA 1LOTB 1HYVA 4B9LA 1TK8A 3MN5A 3SCXA 3V9XA 4KH5A 5B8HA 1M1KO 2WTUA 3J7YP 4CBXA 1IBKK 4FK4A 4OGCA 4DTJA 1BOTO 3PSIA 4O44A 2YHYA 4YHHK 3AVCA 2VQEK 4AQYK 4C8LA 1RT4A 5FPMA 2ASPA 4B1UB 1NKEA 3IDHA 3AO2A 1ATSA 2GUIA 3LPTA 4DV5K 3JAMO 1JL1A 3HM9A 3SUPA 4CEAA 1XI1A 1Q9XA 1B9DA 4BR9A 3TTDA 1K6YA 3EN9A 3D2FA 5FROA 1SL1A 4FWNA 4PL8A 1RTHA 4RW6A 3KHYA 1FJGK 3AY9A 1ZBUA 3M8SA 4CIGA 4CZKA 3L3VA 3ZETA 5HOOA 2XY8A 3P31A 1NJZA 5AZJB 1B92A 3FZKA 4CD1A 4TSXA 5GAEP 3HPGA 1VSEA 4A5BA 1YVUA 4DR7K 4ID5A 4EFHA 1YTUA 2Q0RA 1ZBLA 4KI6A 1WOQA 4FWPA 2HBLA 4J2EA 3O9QA 3QIOA 3OVNA 3PLAA 4ZHRA 3R8EA 2P9NA 2UXBK 2JWLA 1A5WA 4CCHA 1YAGA 5J1EA 3OJUA 2HB5A 4BE1A 3V1RA 2W6LA 4PUOA 5JICA 1HPZA 2ZF5O 3SLCA 1IBMK 4FJNA 3NCIA 4WQ5A 4FJXA 3D6RA 1T3VA 1TUUA 3DJCA 2OZMA 2E20A 1ZC6A 5FDLA 5BPNA 4GY2B 2VWKA 5C25A 3SAFA 4PKHA 1RT5A 3VQ8A 3KLIA 1KFSA 4DQRA 2QXLA 3GOIA 1K8KA 4BC3A 1J5EK 1P90A 3D2EA 3NMUA 3TAGA 4FZYA 4JI5K 3RSEB 2WOMA 2P9KB 4CIFA 5AQIA 3CCSN 1R0AA 1D5AA 4B8CA 5AQTA 5E41A 1WLJA 1X1PA 3O4NA 4FSVA 4Z4EA 3TU5A 5DK5A 2G8HA 2WUSA 1E4FT 1RT6A 4CBUA 1NOYA 3LDNA 1YXQA 3TAPA 3JYTA 3UE5A 1S1UA 4Z0UA 3S9HA 4CFBA 2D4WA 3ZCMA 4DHYA 2IIRA 3CCRN 1WSFA 3KWIA 4V19S 1VQLN 3CQYA 3OYJA 3OYKA 4AHUA 1N5YA 1NK9A 1U2VB 1MDUB 3AVJA 3BDPA 4KI4A 1MWKA 4K8ZA 3V4IA 4QCLA 3CHWA 5C2FA 1G15A 4FLTA 2O8FA 3AVMA 4B8AB 3AGRA 4KHNA 1T6DA 1NK5A 2P5OA 2G8VA 1HJOA 4K42A 3VQCA 2KFNA 4HHTA 3AVHA 4F9OA 4OKEA 4JI1K 4FLVA 3QNNA 4KAZA 1GLBG 3LP3A 3WNGA 4JK7A 3ASMA 4IO9L 4BE2A 4O0IA 3PUFA 1RT2A 3OYCA 5KGWA 2VG7A 3CMEN 1LW2A 1GLJO 1NK6A 4BRNA 1KRPA 3A8YA 3TAMA 4QS9A 2FSJA 3A5NC 2G8FA 1QQMA 3P5JA 2FBTA 4BRIA 3QIPA 3VQQA 1C1BA 3G71N 2VQFK 2UXDK 4DUZK 3THXB 3FGUA 2Q2RA 2NRHA 1BCMA 1CLQA 4IXCA 4BR7A 1IJJA 4DR2K 4DFJA 2YV0X 4WQ4C 5KPZA 2OPQA 1TAQA 2GBZA 2AA4A 3VPZA 2QKKA 2W41A 4ZTFA 1MWMA 4OX9K 1HRHA 3E66A 3F2KA 3LL3A 1S9GA 5J2MA 2DFEA 1KSPA 4FL9A 4I6MA 4NYFA 3G6EN 3NH0A 1UAXA 3MWPA 3A0IX 1EO1A 1A5VA 3QO9A 1GLFO 2E4LA 1S6QA 1VQPN 3RRGA 3B8AX 3F9MA 3I8BA 3VQBA 4CECA 2HHTA 4A2AA 4E1MA 3WXIA 3T1HK 5KGXA 1HNZK 3SPYA 4AHRA 2E1ZA 4JRQA 1C0UA 3QNOA 3K57A 3MAQA 5C2DA 3AAQA 4XH1A 1S72N 3O6WA 4A62A 3VF2A 5C12A 2OTJN 1J5OA 4OPKA 3L2RA 1WBDA 2EWSA 3J8AA 3U9DA 5BN9A 4DR1K 2KTQA 4FWRA 4FLXA 2Q36A 4JNEA 3AA5X 3LDSA 3NF7A 4OGEA 3K59A 5AZJA 2NZTA 2BGGA 4KH6A 3T69A 3C0BA 5D3GA 4DB3A 1BUPA 5CZ1A 3CJAA 4FM1A 4DTOA 3ULEB 3SUQA 5HROA 4B3MK 3E9LA 4DTNA 4G1QA 5DM6L 3RMCA 2F8SA 4DV0K 4FW1A 3AVNA 3HVTA 3CFRA 5AQZA 4H0OA 5KRSA 2HHWA 2OA8A 3NGYA 3DAWA 1WSEA 1UA1A 1IKYA 4CBWA 4E1JA 3R9PA 4LSLA 4CEFA 2O8CB 4DLGA 4CFCA 1ZBFA 1YHQN 3I56N 1VQMN 3R1XA 3MN7A 4KHYA 3U8XA 3VA3A 3P83D 2FF6A 1WUAA 1RFQA 3DI6A 3K5OA 2IOCA 3VMFB 2P9UB 2E1YA 3CYMA 4EP5A 4UQGA 2O4IA 1J6ZA 3V9ZA 3CMAN 1KVCA 2Y1IA 3I8DA 5AQJA 4H5NA 1KAYA 5JMVA 1P8ZA 4KTZA 1WN7A 4JKBA 4F3OA 1X9JA 4JK9A 4N56A 4E3SA 3SV3A 4JKGA 1ASVA 2GWKA 4RTFD 4B9VA 2E6MA 1NGAA 1ATRA 1YITN 1W97L 4U67L 4DTPA 3MEEA 4CFAA 4IFYA 4DLEA 4Y1DA 3O4QA 4CJSA 3G0ZA 1T6CA 2O8BB 3CPWM 2BE2A 3CIPA 4E7JA 2HHVA 3T1YK 2G8WA 2F9TA 4FLWA 2DFHA 2PBDA 2UU9K 3I33A 4CEBA 5EXWA 2RPIA 3JXUA 3R3LA 2HHUA 4FJGA 2ITMA 4YY3K 2A41A 4CHOA 1HNIA 3H08A 1HKCA 2P51A 1QVGM 4FW2A 4E0DA 3SUNA 4E1NA 1J54A 1TYQB 1Z26A 4OVLA 1VQ7N 4CW7B 3KD1E 4BRPA 4YNQA 4CHYA 5F0XA 1JCFA 1RTDA 2FLOA 4GKJK 1K9MO 1JKHA 2OYQA 5AZIB 1UWBA 3MEGA 3MXJA 2KKZA 4HTUA 4B9MA 3HI0A 3EZWA 4BR5A 4M3ZA 2D1KA 3D0PA 2PZSA 1NGEA 1WAFA 3KKRA 1HNXK 3CCMN 3THWA 2HNZA 1JLFA 4H0TB 1S1WA 4H5WA 5JLHA 5KI6A 3L6QA 4MLEA 3TTCA 4CERA 4EZ9A 5EU7A 2O8EA 4H0PA 4M3UA 4JKCA 4F3TA 4W5RA 4FOEA 3G25A 4A61A 2Z1JA 1T03A 4O0JA 1NGJA 4DTSA 1JLAA 3J7AP 1TL1A 3ZSWA 5AQXA 3QEIA 1KD1O 4CJFA 4HTLA 3LWMA 2RKIA 1BCOA 4IOAL 1RBRA 2QXFA 3M3ZA 1V4SA 4NCGA 3DXKB 4K8XA 3T19A 1VQON 1YUWA 2NLXA 2JLEA 1QSLA 3C7NA 2I5JA 4MDAA 3OY9A 3ISNC 2E8AA 3NVMA 3QEPA 3AO1A 4EP4A 1LAVA 2I7NA 4I9LA 5SWMA 1XNRK 3KIOA 4ELTA 4CESA 2XY5A 1TUYA 1NK0A 3OYFA 3IFRA 3SI6A 5BREA 1QQNA 4ISFA 4UY8O 3HK2A 1VQ4N 3CJBA 5AQNA 4CIEA 4C23A 2X6NA 4E89A 1XMQK 3CC2N 3THYA 3B6OA 3VN5A 1HYSA 2Q31A 3H45C 1WSGA 3OYAA 1WSHA 1BIZA 2CGJA 1M90O 2FBXA 2NRVA 4DTXA 1GOAA 1L3TA 5AQYA 1E4GT 4I7FA 1GLDG 4MO4A 2X78A 4BRLA 3KZBA 4M42A 3EL2A 5KPTA 1RBTA 3LM9A 3VF4A 4DSIA 4O8KA 1Z25A 3PIOL 1RBVA 4FO0A 1JJ2M 4FJ5A 5GADP 1XHZA 4NLBA 4LF9K 1RDDA 1MU2A 3QLHA 4CFDA 3HO1A 2P9PA 1L3SA 3KKSA 4BE0A 1FW6A 5EOYA 4C8OA 4JKEA 1KLMA 3BF1A 3VQ5A 5C0YA 4LFBK 1D8YA 4JAXA 3NHGA 3ZT3A 4DQPA 1C0GA 4H0YB 4W5QA 2YHWA 4DSKA 2GUPA 3ZSOA 4B3TK 5AQFA 3SQ1A 5KQDA 3CQXA 4FZXC 1NKCA 1OVQA 1XUPO 3MK6A 1SKWA 3GDQA 3GL1A 3ZEUB 1CZAN 4GV9A 4Y0WA 1YTAA 4BG9A 1GOBA 3RMBA 4HCBA 4N76A 2A3ZA 2E5LK 4OKKA 3TABA 4FJKA 1QSYA 2QW9A 1U4BA 1C0MA 3O3HA 4BRCA 2NRXA 2ASMA 1BA0A 4HUGA 1RBUA 4B9QA 4NLCA 1HJRA 3E9OA 4Y1CA 4MLHA 3AVLA 3HM8A 5I3UA 3OYIA 2ZGZA 3VTIA 2QWNA 4WCEL 3I55N 2HF3A 4LH5A 1BWFO 1QS4A 1NNEA 4JKDA 3BZCA 4ZTJA 3CF5L 4R5PA 5JVGL 3UKRB 4DSJA 4YOUA 2YHXA 4I2QA 3OJSA 3LALA 3NH1A 4BG8A 1WAJA 4IG0A 3WXKA 5GIPA 2FXUA 5CYQA 2QKBA 2OZSA 4GNIA 4JHDA 5T7BA 1BO5O 4KTWA 1B9FA 1EETA 3SMSA 4IOXA 2KZZA 5IWAK 2E88A 2Z1GA 2UXCK 4BC4A 4BDZA 3VQ4A 3JSMA 3CQ8A 5DM7L 4CJUA 3AO4A 3CJ7A 3BUZB 4E7LA 4X65K 3L3UA 3QBXA 3OYMA 4CJVA 2PYLA 4FVMA 1U6ZA 2CH5A 1NU0A 1T8EA 1E3MA 2QA4N 4CZIA 2BTFA 3VTHA 2B4JA 3KK1A 5AQOA 1MA9B 4XH5A 1JL2A 3CJ1A 3O1WA 4MDBA 3O3FA 5JS1A 1TL3A 5BR9A 4NO7A 3KD5E 5JLFA 2QM1A 1N33K 4W5OA 2B6AA 4Z4GA 4DMNA 2DY4A 4JI3K 5LJVA 3G4SN 4JI8K 4RCHA 4M63C 4IDKA 4DR3K 3DXMA 1BG3A 3VOVA 1U45A 1NBWA 4DV1K 4C8MA 3WEEB 3O5BA 3RMDA 1GLLO 2IAJA 2QWRA 4DR6K 4LC9B 3P1GA 4B9NA 1U47A 4X62K 2WFBA 3FE1A 4FM0A 3K2PA 2D0CA 1KFDA 3ZSVA 4ISEA 1S1VA 1RDCA 4NXMK 1F21A 1BGXT 4JI0K 3C6TA 3PIPL 3M8PA 3SPZA 2P9SB 1W7AA 3P38A 3DXKA 1HYZA 2UUCK 1DTQA 2QWLA 1QVFM 2HSTA 4E7HA 2D0PA 3CFOA 1ZXOA 1RT3A 3FFIA 4IEIA 3H1VX 1JLEA 3VESA 4CHQA 1KVBA 3UKUB 3I0SA 4H0XB 3KLEA 4DWIA 3M8QA 1GLCG 1BI4B 1IKWA 4BGAA 3KJVA 3RR7A 1IO2A 4CF8A 1YJWN 3WXLA 4W5TA 4Q0BA 4JD2B 1HX1A 3CC4N 3BY5A 4OPHA 3VEXA 5KRTA 4CZFA 2HOEA 4K43A 2PYJA 1Q82O 4DV2K 5AR0A 4F4KA 4BRMA 5SZTA 1X9SA 4FWMA 1JLGA 1S1XA 3FR0A 4E7KA 1VQ5N 3HSTB 4JLHA 3QB0A 2GELA 3AV9A 3PSFA 4IDHA 5ADXA 4ISGA 4FWQA 3LDOA 3PX4A 4KV8A 4M7YA 2HBMA 2O8DB 2VG5A 3HBTA 4RW7A 4BRHA 3O1BA 3HP9A 3QESA 1VSKA 1BQNA 3DLRA 4BY9C 5A2QO 4JYAK 1REVA 2IS3A 3G10A 1C0TA 4CGHA 1YVNA 1I39A 1BL3A 1NJWA 4GVMA 1LWCA 3EO3A 5CYMA 4CJ5A 3M5RA 1JXBA 4EIAA 4Z4CA 2WBNA 3OS2A 2XO7A 4OLBA 1LWEA 3MMVA 4DQIA 3LP0A 3RR8A 1NGIA 3MEDA 4O4GA 3V1QA 3KTQA 4BRFA 1FXXA 1NMDA 3CJCA 3CPEA 4NB4A 4G9ZA 2KQ2A 1NK4A 2FSKA 4CHNA 2P9LB 4KBOA 3MX5A 5EY4A 1KCFA 2OCEA 3IKMA 1HKBA 4OLAA 4MO5A 4LSNA 3L2UA 4BVPA 3A5MC 3DLGA 1VQ8N 2ZM6K 1OH6A 4DSEA 4QOZB 1Y64A 5BPLA 1XNQK 3KLFA 1KQSM 1L5UA 3TWHA 4CF0A 1SQKA 1GLEG 1WNSA 3C65A 1OVYA 3NF8A 3SQ0A 3KWGA 1NK7A 2V7YA 2FBYA 3A5LC 3HRGA 4GW6A 3CCQN 3K0SA 5BPMA 2NRTA 3RTVA 3HJFA 3MCAB 4U7BA 1O1WA 4N5SA 4QS8A 4O5FA 3LM2A 3MXMA 3VETA 4BC5A 1JCGA 4LFAK 4RW8A 3MN6A 1QHTA 2IGIA 2NRZA 4A59A 1YJ9N 2RHKA 4K41A 1IH7A 2FBVA 4L3QA 4BC2A 4KHPK 4AHVA 1YI2N 3AA2A 4YOVA 3CG7A 3ZT2A 1YJNN 4FWKA 1RT1A 4CEQA 4KB0A 1Z05A 4CZMA 3QFUA 4QAGA 3EEQA 4CJ7A 1JLBA 4CZEA 2YX6A 3BF3A 4GKKK 3NGIA 4K0KK 3SQ4A 5BN8A 4LF4K 3DLKA 2GX9A 4XH4A 1X9MA 2NRWA 3TSQA 3OTOK 4DFPA 2GV9A 4IOCL 1VQKN 1HKGA 3O9TA 3NGZA 4M3YA 5FPNA 3D2FB 1SL2A 4CJKA 5K14A 3ZYYX 1LV5A 4DV4K 4BREA 3RSEA 2P9KA 3ZETB 3CI5A 4CF1A 5BR8K 4DQSA 3C95A 5GIOA 4CZLA 1NGBA 2HNDA 4H03B 1Q9YA 5J2PA 2WC9A 1CZ9A 1I3AA 3PV8A 1VSLA 5E26A 1ZBHA 4DV3K 4FJIA 3H46O 3HXMA 2VG6A 4J2AA 2HW3A 3C94A 3D45A 4FJ7A 1SZ2A 4B3SK 2Q1NA 4WQ5C 3SUOA 3H3OB 2GEMA 3U9ZA 3OS0A 1Q86O 3KK2A 3IG1A 3QETA 3QERA 4FJ9A 4CZHA 4Z4FA 3CCJN 3S3OA 2P9NB 2HHSA 1NGFA 4ICLA 4DTRA 2W42A 5M1QA 1ZBSA 1Q81O 1U2VA 4IWVA 4BGBA 5LMNK 4IG3A 4OO1J 4GV3A 3FZLA 4B9UA 3VQ9A 5I42A 1WSJA 2D0AA 1S9EA 4OKJA 3WNFA 3VGMA 2WONA 2KLAA 1V4TA 1EXQA 1ASWA 3VGLA 2Z1IA 3CM6A 3MX2A 4YOTA 4R79A 2OANA 3QICA 5C10A 4KTQA 1QQCA 1NGHA 1K8KB 4CJ4A 2D0BA 3AVBA 3D2EB 3SJJA 4RG8A 5FRMA 3LZJA 3NDKA 1RDWX 1TK5A 4CEOA 2OPSA 4M45A 2GWJA 1D4XA 2LSNA 4FJMA 1XMOK 1HQEA 2XY7A 4F2SA 1ASUA 3TAQA 4E7IA 4I2PA 3MXIA 5AJ3K 1C6VA 2QWPA 3THXA 3TI0A 3RMAA 3PY8A 4W5NA 1KAZA 3E01A 4CEEA 4DU3A 3J81O 3RWUA 3PX6A 2F9WA 4O55A 2RN2A 4CK1A 3FZMA 1RDBA 4IEEA 4BACA 4DU4A 1RBSA 4C1NK 3WNHA 1BA1A 3L8BA 3VQDA 2ZE2A 2VCPA 1RCHA 1IKVA 2CGKA 2YKMA 4JKFA 4IFVA 4B1YB 2VWBA 4HVJA 3E9PA 5ADXH 2XY6A 1JXEA 4CJPA 4CF9A 4BRGA 3KK3A 2UUBK 3D7EO 3QFPA 2O8FB 4CZGA 4EHTA 4K25A 5HRSA 4FJLA 4PY5A 2FF3B 2IC3A 3E1YA 1KXPA 2YKNA 4CZJA 3PX0A 1EWRA 3N4PA 3U3GA 4WQ4A 3M8RA 4JI7K 5MLCQ 4FLZA 2HF4A 2E2QA 3PO5A 3CJ9A 4B1WB 4BROA 3B6PA 3O9UA 2E6LA 3MECA 4DQ8A 5C15A 4CHPA 3ZX3A 4LF8K 1ZBIA 2ETJA 4IKFA 3TPQA 3T7ZA 3WXJA 1EKEA 4F8RA 3NH2A 2G8KA 3WQUA 3OHRA 2W40A 3TAEA 5J2QA 4PWDA 4AM7A 4B3RK 4FXDA 2QTDA 3P4IA 4YOYA 4I9QA 3HYFA 2BUPA 3O9RA 1EP4A 5FLXO 1NGDA 3GG4A 1ZYQA 2A1RA 3C6AA 4X66K 2P1JA 3LPUA 4RW4A 2NUBA 4O5BA 3RVCA 4NCBA 4OJRA 1RGIA 1DKGD 1I94K 4IJNA 2NRRA 1LAWA 4BWJA 4DKWA 4PHTX 3CCVN 4BR2A 2D0OA 5AQLA 1XHXA 2YNIA 3OA9A 5F2RA 3L2QA 4KFBA 1XC9A 3QEVA 4B1XB 3ULEA 3EE8A 3S3MA 3L2WA 3HZ6A 2A1SA 1X9WA 4LF6K 1SUQA 1KAXA 1J53A 4MQ3A 1XWLA 2HBKA 3H3NO 2ZGYA 4I6MB 2X74A 4BRAA 1VAZA 1LW0A 3SBGA 3TSUA 4WFBL 4WFAL 3SBTA 3TARA 5ELZA 2IDOA 1NMNA 3AO5A 4DFKA 1VQNN 3T1AA 3ENOA 4DS4A 4AF1A 3HOTA 4ELVA 4M7XA 3C6UA 4CF2A 1TKDA 3IRXA 3VQ7A 3ZSQA 2ZJPL 3TTFA 3JS6A 3BEXA 4DU1A 3M6GA 1C1CA 4C8KA 3F9KA 4FK0A 2O8CA 3AGKA 3NAEA 5F1XA 5FPEA 5AQKA 3KLHA 3CETA 1SL0A 1HNVA 1QHAA 3N4QA 2VGNA 3QBWA 1NLVA 1SAZA 2ZWHA 5KTQA 4QS7A 1HNWK 4BWMA 5M1KA 2IVOA 2QWQA 2KZMA 3OYDA 3SZ2A 4DCHA 4CGFA 3FFKB 1K73O 2P9UA 5BRHA 4C8NA 1IG9A 1DEJA 2PAVA 1CXUA 2G8UA 4H5RA 4C1NI 2E2NA 5AQGA 4KHSA 3NBPA 2DPNA 2IVPA 3DRPA 1RTIA 1JCEA 3L4QA 1KVAA 1UOCA 2F7TA 1TKZA 3VA0A 3VEWA 2F8TA 5LJWA 3LZIA 4FPBA 3ULDA 3J7ZO 4JKAA 4BR4A 2O8BA 3OS1A 2ASOA 1NJYA 3OBYA 3M1FA 5CY4A 3THVA 3LANA 4DV7K 4WYBA 3AARA 3AAPA 4M3WA 1RILA 2I7PA 2P9IB 4IFEA 3DRRA 3SNNA 3QDKA 4JRPA 3HT3A 3I0RA 3OYLA 2KHOA 1W9HA 1RT7A 4FJ8A 3UB5A 4ILHA 3CCEN 4DQQA 3S3NA 4FLUA 1C1AA 3DWLA 4YOWA 1BQMA 1T05A 1S22A 2ZJQL 1VSJA 1TYQA 1VSDA 4FJJA 1BDGA 2YCHA 3H1QA 1TKTA 3ATUA 2HMIA 1EQYA 3LWLA 1SS6A 3DOLA 5AZIA 3EKSA 4A2BA 4FWOA 3KVGA 1A5XA 3NE6A 2OTLN 4AHSA 4PQUA 3OYHA 1KTQA 4GMJB 4YDUC 3HOSA 2HBJA 1R59O 4YORA 4CD3A 4JKGB 2BDPA 2B5JA 2DFFA 4X64K 1BIUA 2BH1A 5BRFA 5HLFA 4JS4A 1UA0A 4LF7K 2Q97A 4BDYA 4DS5A 5J2NA 4GV6A 3TR8A 1QTMA 1LWFA 3NF9A 3HVRA 4FCYA 2YNHA 4DF4A 1DLOA 3HTVA 1N36K 1TV6A 3HPHA 3WNEA 1TGOA 1T7PA 1BU6O 5AFUH 3VQAA 3ZSXA 3O80A 5C42A 2QWOA 4BRKA 1NGCA 3WQTA 5LY3A 4DSFA 4H5VA 4AHCA 3AVFA 4EZ6A 4CVNE 1HPMA 4B08A 5TKYA 1TKXA 1CZBA 4CK2A 2CH6A 1KLNA 1NM1A 4DSLA 4CI6A 2GTDA 2FSNA 4CE9A 4CJRA 2VWJA 4HWIA 2V7ZA 4FZZA 1GOCA 2VYPA 4ILGB 1N8RO 1NKBA 4Q5VA 2A6AA 3K9JA 3GBTA 1VQ6N 1U49A 3BP8A 3VEZA 4J2BA 4B3OA 4HUFA 2Q3SA 4IO8A 3VGKA 3R6MA 1WSIA 5CHIA 3LDQA 3W0LA 1VSFA 4AILC 5BRDA 3THWB 3V9WA 2XHBA 2QI2A 3MDQA 5GAHP 3AVAA 3FZHA 3VEYA 3DYAA 2O8EB 1NWKA 2YJFA 3SYZA 3QMLA 2ITGA 1HUXA 5AQRA 2XRIA 3CCLN 3L0QA 3LDPA 5M1FA 1Q18A 1KC8O 4FWLA 4N41A 3NF6A 4H5TA 3BGRA 2OPPA 1W0HA 2KFZA 3V9SA 3VQ6A 2P5GA 3AVIA 5M1NA 1N32K 3VQEA 3HPOA 4LF5K 2ATQA 3SK3A 1TVRA 2UYTA 4JI4K 1NG9A 4JEPA 4IBNA 3QEXA 5HRRA 3OBWA 1JLCA 3RRHA 4JKHA 3V1OA 2QK9A 3C7NB 1FK9A 5AQPA 3K5NA 4EAHD 1XC3A 3OYGA 3V81A 3NFAA 3CM5A 1BHLA 3VF6A 1S5JA 2A5XA 1L3UA 3LAKA 3CCUN 3OYNA 2J4RA 3ZSYA 2QWMA 2HHXA 4KHUA 3LP2A 2VGMA 1D9DA 1Z6RA 2CGLA 3DLBA 4KHWA 5HRNA 3TSPA 1DT9A 4A5AA 4DR4K 3DRSA 3CC7N 1HLUA 3O8MA 3WXMB 3ZEUA 4BQZA 2KW4A 3CERA 1YF5L 2A40A 3VQPA 3SMPA 3THYB 2HHQA 5CZ2A 4CK3A 5FPDA 5HBMA 3GE1A 4BVOA 4KPYA 2IVNA 4J2DA 1DGKN 4FM2A 2V52B 4H8KA 5GAGP 1ITGA 4KKOA 5EX5A 2YNGA 3MWTA 1S6PA 4RWTA 5AQQA 3TAFA 2BANA 3AA3A 4RW9A 4FJHA 3TANA 4PL7A 4FPAA 3ENHA 1JLQA 3L2VA 3QEWA 4M3TA 1Q8IA 3ZSRA 5IT9O 2HHHK 1VSMA 2Q0UA 3O9SA 4NYNA 4HUEA 3EKUA 4H0VB 1VSHA 3UKRA 1YT3A 2P9PB 5EVZA 1VRUA 1FKOA 1IV0A 4CEDA 3PO4A 4IZ9A 4DG1A 4DV6K 5JS2A 3DLEA 1IG8A 2O4GA 2RF2A 3A5OC 4DF8A 3OYEA 1SKRA 5I9EB 4DTUA 1TAUA 4JN4A 4B1ZA 4BRDA 3SJHA 4JV5K 3HSCA 4KH4A 4FYDA 4M3RA 4B9TA 5AQUA 4KO0A 3AA4A 3HP6A 2YHBA 3P39A 4BRQA 4CJQA 1VRTA 2P9IA 1S1TA 3ZT0A 3ALYA 1FKPA 3ZX2A 3W3DA 3EZ5A 4B1VA 3SAHA 4DTMA 2E2OA 1OH5A 4CJTA 4H4MA 3S41A 2A42A 3A2FA 4LY7A 2ZJRL 4BQLA 1IBLK 1VK0A 1EWQA 5HRPA 5LL6Z 3U4LA 4YFUA 4LD0A 4JI6K 1X3NA 4J8FA 3F73A 5KPRA 3IS9A 3LDLA 1YIJN 2ZD1A 1CXQA 5M1PA 3NVKA 1IKXA 3ATVA 2JGUA 1VHXA 3H6EA 1LCUA 1Y97A 4BDPA 3J80O 1RDAA 3AVGA 3ITHA 4AHTA 2YJEA 1N34K 3WEEA 5JVHL 1NGGA 1K8AO 4KREA 1NJXA 4JHDB 4LH4A 5CE3A 1OH7A 1GLAG 3V6DA 3OW2M 3SAGA 4LFCK 4FLYA 1WBBA 3OYBA 5HL7L 2PFUA 2OPRA 1U04A 3EY1A 5HP1A 4OPAA 4GVEA 3ZLJA 5GINA 1EX4A 1Q7YO 1W2BM 4YDUA 1U48A 3DOKA 3Q7BA 3FZFA 2P9SA 1QSSA 1QQOA 2Z1HA 4E19A 3IAYA 2YHAA 4NXNK 4XIUA 4MFBA 3EYZA 4PKGA 2H3GX 4FVUA 3ENBA 3KK7A 2RE2A 2EX3A 1XQSC 5AQWA 4JS5A 1QE1A 4DUYK 3ZSZA 3Q7CA 4Z94A 3MCPA 2ZQBA 3K5MA 1T44A 3DLHA 5E84A 3VERA 3WT0A 3UIQA 4M3XA 3FLCO 4FOIA 3SQ2A 4WE1A 3UKUA 3VEVA 4M41A 2W6KA 1OH8A 1BI4A 3MN9A 1L3VA 5DMRA 5LMUK 2D5RA 1ATNA 1ILYA 4KB1A 2NNWA 5AQSA 5CR4A 1QZ6A 1S3XA 4A57A 5TKWA 3DXMB 4JD2A 4L8RB 4ID1A 5AFUA 3CD6N 1J9AA 1BISA 3SV4A 2PY5A 2UUAK 1SV5A 2V51B 3CXCM 5H1SQ 5KQ8A 1ESVA 2Y1JA 2YI1A 1RTJA 4CHZA 2E2PA 4CEZA 2FC0A 3AVKA 4CJLA 2YNFA 4CJEA 3K58A 1HMVA 1HR0K 2O8DA 4EHUA 3IMXA 4CJ3A
chains in the Genus database with same CATH topology
4KHSA 3NBPA 3HL8A 1BI4B 1IKWA 3KLGA 4Z4EA 3DRPA 2G8IA 1IKYA 1RTIA 3KJVA 4Z4HA 3RR7A 4LSLA 4CEFA 1IO2A 1KVAA 4CF8A 1UOCA 2HVHA 4DLGA 1TKZA 4CFCA 3T3FA 1ZBFA 3AO3A 4W5TA 3VA0A 4Q0BA 4CJWA 1N6QA 2F8TA 3LZIA 4CGJA 3QINA 2X6SA 3O3GA 4Z4IA 5KRTA 4KHQA 2F96A 1NK8A 4CGIA 3V9UA 4F2RA 4KHYA 2PYJA 3ULDA 3P83D 3VA3A 5FRNA 4F4KA 1X9SA 5SZTA 3DI6A 1JLGA 1S1XA 3DMJA 4PA1A 4E7KA 3K5OA 2IOCA 3HSTB 4JLHA 3OS1A 4DFMA 1D9FA 1NJYA 2EHGA 3CYMA 5CY4A 3AV9A 4EP5A 4UQGA 2O4IA 3THVA 3LANA 4OPJA 1TK0A 4ELUA 3V9ZA 3PX4A 1KVCA 4KV8A 4CGGA 2Y1IA 3I8DA 4M3WA 1RILA 3K5LA 2VG5A 4RW7A 4HCCA 4KTZA 3HP9A 2HVIA 3DRRA 3QESA 1VSKA 3SNNA 1BQNA 4N47A 1WN7A 4JRPA 4F3OA 3HT3A 3DLRA 4FK2A 3I0RA 3OYLA 1W9HA 1RT7A 4FJ8A 1REVA 4N56A 4E3SA 3SV3A 2IS3A 3G10A 3LAMA 1ASVA 3LP1A 1C0TA 4B9VA 4CGHA 2E6MA 4DQQA 3S3NA 4FLUA 1C1AA 1I39A 1BL3A 3CFPA 1NJWA 1BQMA 4DTPA 1DTTA 1T05A 4GVMA 1LWCA 5CYMA 4CJ5A 3OS2A 1JXBA 3MEEA 1VSJA 4CFAA 4IFYA 4Z4CA 2XO7A 4Y1DA 4DLEA 1LWEA 4OLBA 3O4QA 3U6FA 1VSDA 4B9SA 4CJSA 3G0ZA 2R7YA 4DQIA 4FJJA 4KRFA 5C24A 1TKTA 3LP0A 3RR8A 1SKSA 2HMIA 3ZT4A 4CGDA 2BE2A 3DM2A 3MEDA 3DOLA 4H4OA 4O4GA 3V1QA 3LWLA 3KTQA 4E7JA 1FXXA 2HHVA 2G8WA 1VSIA 4FLWA 3U3YA 2DFHA 2KQ2A 1NK4A 4NCAA 4CHNA 1A5XA 3NE6A 1HQUA 1KCFA 2AJQA 4AHSA 2DTUA 4OLAA 3L2UA 4LSNA 1NOZA 4CEBA 4PQUA 3DLGA 3OYHA 1KTQA 2RPIA 4GMJB 3ZT1A 1RNHA 4AH9A 2HNYA 2BDPA 4FJGA 2HHUA 4DSEA 4CHOA 4QOZB 1HYVA 2B5JA 4B9LA 1HNIA 2DFFA 3H08A 1TK8A 5HLFA 1BIUA 1UA0A 3KLFA 4JS4A 3SCXA 3V9XA 4BDYA 2P51A 4DS5A 5J2NA 1L5UA 3TWHA 4FW2A 4CF0A 4E0DA 3SUNA 3TR8A 1WNSA 1QTMA 4E1NA 4FK4A 3NF8A 4OGCA 4DTJA 1LWFA 1J54A 1Z26A 4OVLA 3SQ0A 3NF9A 3HVRA 4FCYA 2YNHA 1NK7A 2FBYA 4O44A 4DF4A 3KD1E 4YNQA 1DLOA 4GW6A 1TV6A 4CHYA 3AVCA 1RTDA 3HPHA 1JKHA 3WNEA 2OYQA 4C8LA 1TGOA 3RTVA 1T7PA 3HJFA 1UWBA 3MEGA 3MXJA 4HTUA 3VQAA 4B9MA 1RT4A 1NKEA 4M3ZA 3ZSXA 1O1WA 4N5SA 3D0PA 2KFZA 3AO2A 5C42A 2GUIA 2PZSA 3LPTA 1WAFA 3MXMA 3KKRA 4DSFA 4AHCA 4RW8A 1JL1A 3AVFA 3HM9A 1QHTA 3SUPA 4EZ6A 4B08A 4CEAA 2IGIA 1XI1A 1Q9XA 1B9DA 1TKXA 2HNZA 1JLFA 1CZBA 4CK2A 1K6YA 5FROA 1KLNA 1IH7A 1SL1A 2FBVA 4DSLA 1S1WA 4AHVA 5KI6A 4EZ9A 1RTHA 4RW6A 4CERA 5EU7A 3AA2A 4CJRA 4CE9A 2VWJA 3CG7A 1ZBUA 3M8SA 4CIGA 3L3VA 3ZT2A 4M3UA 1RT1A 4F3TA 4CEQA 4KB0A 4W5RA 2XY8A 1GOCA 4FZZA 1NKBA 2Z1JA 1NJZA 1T03A 4QAGA 4O0JA 4Q5VA 4DTSA 1B92A 1JLBA 1JLAA 1U49A 1TL1A 4TSXA 3ZSWA 3NGIA 3SQ4A 4J2BA 4B3OA 3QEIA 4HUFA 2Q3SA 3HPGA 3DLKA 4CJFA 3LWMA 2RKIA 1BCOA 1VSEA 1RBRA 1X9MA 1WSIA 2QXFA 1YVUA 4DFPA 2GV9A 4NCGA 4K8XA 1VSFA 4ID5A 3T19A 4AILC 1YTUA 3V9WA 1ZBLA 4KI6A 2XHBA 4J2EA 2JLEA 3NGZA 1QSLA 4M3YA 1SL2A 2I5JA 3QIOA 3OVNA 3ISNC 3OY9A 3AVAA 4ZHRA 4CJKA 5K14A 1LV5A 3DYAA 3QEPA 3SYZA 1A5WA 2ITGA 4CCHA 3AO1A 5J1EA 3OJUA 2HB5A 2XRIA 4BE1A 4CF1A 3V1RA 4EP4A 4DQSA 3C95A 1HPZA 4PUOA 4N41A 3NF6A 3BGRA 1LAVA 2OPPA 2HNDA 4I9LA 5SWMA 4FJNA 3KIOA 1W0HA 3NCIA 4CESA 2XY5A 1Q9YA 4ELTA 3V9SA 3VQ6A 5J2PA 3AVIA 2P5GA 1NK0A 1CZ9A 1I3AA 3OYFA 3PV8A 3SI6A 1VSLA 4FJXA 1ZBHA 4FJIA 3HXMA 3HK2A 3VQEA 2VG6A 3HPOA 4J2AA 2OZMA 2ATQA 2HW3A 4CIEA 1TVRA 2X6NA 4E89A 3C94A 3D45A 4FJ7A 5FDLA 3B6OA 3VN5A 1HYSA 2VWKA 4IBNA 5C25A 5HRRA 3QEXA 1WSGA 1RT5A 3SUOA 1JLCA 3OYAA 3VQ8A 3KLIA 3RRHA 1KFSA 4DQRA 1WSHA 3V1OA 3OS0A 2QK9A 1BIZA 1FK9A 3KK2A 3K5NA 2FBXA 3IG1A 3OYGA 3V81A 3QETA 4DTXA 3QERA 4FJ9A 1GOAA 3NFAA 1L3TA 4Z4FA 4I7FA 3CM5A 3S3OA 1BHLA 2HHSA 2X78A 4ICLA 4M42A 3TAGA 4DTRA 4FZYA 1S5JA 2W42A 2WOMA 1L3UA 4CIFA 1RBTA 3LAKA 4DSIA 1R0AA 1D5AA 4B8CA 5E41A 1Z25A 3OYNA 1WLJA 1RBVA 3ZSYA 1X1PA 4IG3A 2HHXA 3O4NA 3LP2A 4FJ5A 4KHUA 1XHZA 1D9DA 1RDDA 3DLBA 3VQ9A 4B9UA 5DK5A 4KHWA 5I42A 1MU2A 1WSJA 2D0AA 3QLHA 4CFDA 5HRNA 2G8HA 3DRSA 1S9EA 3HO1A 4OKJA 3WNFA 1RT6A 1L3SA 2WONA 3KKSA 1NOYA 2KW4A 1EXQA 4BE0A 1ASWA 4C8OA 3VQPA 3TAPA 3JYTA 2HHQA 1KLMA 1S1UA 5CZ2A 4Z0UA 4CK3A 5HBMA 2Z1IA 3CM6A 4CFBA 3S9HA 4KPYA 3VQ5A 3ZCMA 4J2DA 4FM2A 1D8YA 4H8KA 1ITGA 4KTQA 1QQCA 1WSFA 4KKOA 4CJ4A 3NHGA 3ZT3A 2YNGA 2D0BA 3AVBA 1S6PA 4DQPA 3TAFA 2BANA 3AA3A 4RG8A 4RW9A 3SJJA 5FRMA 4W5QA 3OYJA 4FJHA 3LZJA 3TANA 3OYKA 4DSKA 4AHUA 1N5YA 3ZSOA 3NDKA 3SQ1A 1NK9A 1JLQA 3L2VA 3AVJA 3QEWA 1Q8IA 3ZSRA 4CEOA 1TK5A 4M3TA 1VSMA 3BDPA 4NYNA 2OPSA 4M45A 4HUEA 4FZXC 1NKCA 2LSNA 4KI4A 4FJMA 1VSHA 1HQEA 2XY7A 1SKWA 4K8ZA 1YT3A 4F2SA 1ASUA 1VRUA 3V4IA 3TAQA 4E7IA 4QCLA 1FKOA 1YTAA 1GOBA 1G15A 4I2PA 4FLTA 4CEDA 3RMBA 3PO4A 3AVMA 4B8AB 4DG1A 3MXIA 4HCBA 4N76A 4OKKA 5JS2A 3TABA 4KHNA 1C6VA 3DLEA 2O4GA 2RF2A 4FJKA 1NK5A 4DF8A 1QSYA 1U4BA 2P5OA 1C0MA 3O3HA 3OYEA 2G8VA 1SKRA 3TI0A 3RMAA 4DTUA 4HUGA 1RBUA 1TAUA 3VQCA 2KFNA 3PY8A 4HHTA 3E01A 4DU3A 4CEEA 4W5NA 1HJRA 3AVHA 4Y1CA 3PX6A 4O55A 3RWUA 2RN2A 3AVLA 4OKEA 4CK1A 4FLVA 1RDBA 3QNNA 4KAZA 4DU4A 4BACA 1RBSA 5I3UA 3LP3A 3WNGA 3OYIA 3ASMA 3WNHA 4FYDA 4M3RA 3L8BA 4B9TA 4LH5A 4BE2A 3VQDA 1QS4A 2ZE2A 4KO0A 3PUFA 1RT2A 4O0IA 3OYCA 1RCHA 3AA4A 1IKVA 2YKMA 5KGWA 2VG7A 1LW2A 4IFVA 3HP6A 1NK6A 4ZTJA 2YHBA 4R5PA 1KRPA 4HVJA 3TAMA 2G8FA 4DSJA 2XY6A 1JXEA 3P5JA 2FBTA 4CJQA 4CJPA 4CF9A 1VRTA 3KK3A 3QIPA 4I2QA 3VQQA 1C1BA 5HRSA 3OJSA 1S1TA 4FJLA 3ZT0A 4PY5A 3ALYA 2IC3A 3LALA 3NH1A 1FKPA 1WAJA 4IG0A 2YKNA 3PX0A 3U3GA 5CYQA 3M8RA 3EZ5A 2QKBA 4FLZA 2OZSA 4DTMA 5T7BA 4KTWA 1BCMA 4CJTA 4H4MA 3PO5A 1CLQA 1B9FA 3B6PA 1EETA 3A2FA 2KZZA 4LY7A 2E6LA 3MECA 4CHPA 2Z1GA 4DFJA 2YV0X 2OPQA 2ETJA 2GBZA 1TAQA 1VK0A 4IKFA 1ZBIA 5HRPA 1EKEA 2QKKA 4YFUA 4BDZA 4F8RA 4LD0A 3VQ4A 3JSMA 3NH2A 4ZTFA 3F73A 2G8KA 3IS9A 3CQ8A 2ZD1A 1HRHA 1CXQA 4CJUA 3AO4A 3TAEA 1IKXA 5J2QA 2JGUA 4PWDA 1S9GA 4E7LA 5J2MA 4FXDA 3L3UA 4BDPA 1Y97A 2DFEA 3OYMA 1KSPA 1RDAA 3AVGA 4CJVA 3ITHA 2PYLA 4I9QA 3HYFA 4AHTA 4FVMA 1EP4A 4NYFA 1ZYQA 2A1RA 3NH0A 1UAXA 4KREA 1NJXA 1T8EA 4LH4A 2P1JA 3LPUA 4RW4A 2NUBA 4O5BA 4NCBA 1A5VA 3V6DA 3QO9A 4OJRA 2B4JA 3KK1A 1JL2A 2E4LA 3O3FA 4FLYA 1S6QA 3OYBA 1TL3A 5JS1A 2OPRA 1LAWA 1U04A 4BWJA 3EY1A 5HP1A 3RRGA 3KD5E 3VQBA 4CECA 2HHTA 4E1MA 1XHXA 4W5OA 2YNIA 1EX4A 2B6AA 4Z4GA 4DMNA 2DY4A 3L2QA 4KFBA 1XC9A 5KGXA 3QEVA 1U48A 3DOKA 4IDKA 3SPYA 3S3MA 1QSSA 2Z1HA 3L2WA 2A1SA 4AHRA 4E19A 3IAYA 2YHAA 4JRQA 1SUQA 1X9WA 1C0UA 4XIUA 3K57A 3QNOA 1J53A 4MFBA 3MAQA 4MQ3A 1XWLA 3EYZA 1U45A 4C8MA 2X74A 1LW0A 3RMDA 2EX3A 4JS5A 3TARA 1QE1A 1J5OA 3ZSZA 2IAJA 3K5MA 2IDOA 2ZQBA 3AO5A 4DFKA 3T1AA 3P1GA 4OPKA 3L2RA 4DS4A 4B9NA 3DLHA 1U47A 3UIQA 4M3XA 2KTQA 4FLXA 4ELVA 3AA5X 4FM0A 3SQ2A 3C6UA 2D0CA 3K2PA 4WE1A 4CF2A 4M41A 1KFDA 3IRXA 3NF7A 4OGEA 3K59A 3ZSVA 3LDSA 1TKDA 3VQ7A 1BI4A 3ZSQA 2BGGA 1L3VA 1S1VA 5DMRA 2D5RA 5D3GA 4KB1A 1RDCA 4DU1A 4C8KA 1C1CA 3F9KA 1F21A 1BGXT 5CZ1A 4FM1A 4FK0A 3C6TA 3NAEA 4DTOA 3SPZA 3M8PA 3KLHA 1SL0A 3SUQA 1HNVA 4ID1A 4L8RB 5HROA 1HYZA 5KTQA 1J9AA 1BISA 4BWMA 4G1QA 3SV4A 4DTNA 1DTQA 2PY5A 2KZMA 1SV5A 3OYDA 3SZ2A 3RMCA 2F8SA 4CGFA 4FW1A 3AVNA 4E7HA 3HVTA 3CFOA 3CFRA 5KRSA 2Y1JA 1RT3A 3FFIA 2HHWA 1RTJA 4C8NA 2OA8A 4CHZA 4CEZA 1IG9A 1JLEA 2FC0A 3AVKA 4CJLA 2YNFA 3NGYA 4CJEA 1HMVA 3K58A 1WSEA 1CXUA 1KVBA 4CHQA 3I0SA 2G8UA 3KLEA 4CJ3A 1UA1A 4DWIA 3M8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHS A;  3NBP A;  3HL8 A;  1BI4 B;  1IKW A;  3KLG A;  4Z4E A;  3DRP A;  2G8I A;  1IKY A;  1RTI A;  3KJV A;  4Z4H A;  3RR7 A;  4LSL A;  4CEF A;  1IO2 A;  1KVA A;  4CF8 A;  1UOC A;  2HVH A;  4DLG A;  1TKZ A;  4CFC A;  3T3F A;  1ZBF A;  3AO3 A;  4W5T A;  3VA0 A;  4Q0B A;  4CJW A;  1N6Q A;  2F8T A;  3LZI A;  4CGJ A;  3QIN A;  2X6S A;  3O3G A;  4Z4I A;  5KRT A;  4KHQ A;  2F96 A;  1NK8 A;  4CGI A;  3V9U A;  4F2R A;  4KHY A;  2PYJ A;  3ULD A;  3P83 D;  3VA3 A;  5FRN A;  4F4K A;  1X9S A;  5SZT A;  3DI6 A;  1JLG A;  1S1X A;  3DMJ A;  4PA1 A;  4E7K A;  3K5O A;  2IOC A;  3HST B;  4JLH A;  3OS1 A;  4DFM A;  1D9F A;  1NJY A;  2EHG A;  3CYM A;  5CY4 A;  3AV9 A;  4EP5 A;  4UQG A;  2O4I A;  3THV A;  3LAN A;  4OPJ A;  1TK0 A;  4ELU A;  3V9Z A;  3PX4 A;  1KVC A;  4KV8 A;  4CGG A;  2Y1I A;  3I8D A;  4M3W A;  1RIL A;  3K5L A;  2VG5 A;  4RW7 A;  4HCC A;  4KTZ A;  3HP9 A;  2HVI A;  3DRR A;  3QES A;  1VSK A;  3SNN A;  1BQN A;  4N47 A;  1WN7 A;  4JRP A;  4F3O A;  3HT3 A;  3DLR A;  4FK2 A;  3I0R A;  3OYL A;  1W9H A;  1RT7 A;  4FJ8 A;  1REV A;  4N56 A;  4E3S A;  3SV3 A;  2IS3 A;  3G10 A;  3LAM A;  1ASV A;  3LP1 A;  1C0T A;  4B9V A;  4CGH A;  2E6M A;  4DQQ A;  3S3N A;  4FLU A;  1C1A A;  1I39 A;  1BL3 A;  3CFP A;  1NJW A;  1BQM A;  4DTP A;  1DTT A;  1T05 A;  4GVM A;  1LWC A;  5CYM A;  4CJ5 A;  3OS2 A;  1JXB A;  3MEE A;  1VSJ A;  4CFA A;  4IFY A;  4Z4C A;  2XO7 A;  4Y1D A;  4DLE A;  1LWE A;  4OLB A;  3O4Q A;  3U6F A;  1VSD A;  4B9S A;  4CJS A;  3G0Z A;  2R7Y A;  4DQI A;  4FJJ A;  4KRF A;  5C24 A;  1TKT A;  3LP0 A;  3RR8 A;  1SKS A;  2HMI A;  3ZT4 A;  4CGD A;  2BE2 A;  3DM2 A;  3MED A;  3DOL A;  4H4O A;  4O4G A;  3V1Q A;  3LWL A;  3KTQ A;  4E7J A;  1FXX A;  2HHV A;  2G8W A;  1VSI A;  4FLW A;  3U3Y A;  2DFH A;  2KQ2 A;  1NK4 A;  4NCA A;  4CHN A;  1A5X A;  3NE6 A;  1HQU A;  1KCF A;  2AJQ A;  4AHS A;  2DTU A;  4OLA A;  3L2U A;  4LSN A;  1NOZ A;  4CEB A;  4PQU A;  3DLG A;  3OYH A;  1KTQ A;  2RPI A;  4GMJ B;  3ZT1 A;  1RNH A;  4AH9 A;  2HNY A;  2BDP A;  4FJG A;  2HHU A;  4DSE A;  4CHO A;  4QOZ B;  1HYV A;  2B5J A;  4B9L A;  1HNI A;  2DFF A;  3H08 A;  1TK8 A;  5HLF A;  1BIU A;  1UA0 A;  3KLF A;  4JS4 A;  3SCX A;  3V9X A;  4BDY A;  2P51 A;  4DS5 A;  5J2N A;  1L5U A;  3TWH A;  4FW2 A;  4CF0 A;  4E0D A;  3SUN A;  3TR8 A;  1WNS A;  1QTM A;  4E1N A;  4FK4 A;  3NF8 A;  4OGC A;  4DTJ A;  1LWF A;  1J54 A;  1Z26 A;  4OVL A;  3SQ0 A;  3NF9 A;  3HVR A;  4FCY A;  2YNH A;  1NK7 A;  2FBY A;  4O44 A;  4DF4 A;  3KD1 E;  4YNQ A;  1DLO A;  4GW6 A;  1TV6 A;  4CHY A;  3AVC A;  1RTD A;  3HPH A;  1JKH A;  3WNE A;  2OYQ A;  4C8L A;  1TGO A;  3RTV A;  1T7P A;  3HJF A;  1UWB A;  3MEG A;  3MXJ A;  4HTU A;  3VQA A;  4B9M A;  1RT4 A;  1NKE A;  4M3Z A;  3ZSX A;  1O1W A;  4N5S A;  3D0P A;  2KFZ A;  3AO2 A;  5C42 A;  2GUI A;  2PZS A;  3LPT A;  1WAF A;  3MXM A;  3KKR A;  4DSF A;  4AHC A;  4RW8 A;  1JL1 A;  3AVF A;  3HM9 A;  1QHT A;  3SUP A;  4EZ6 A;  4B08 A;  4CEA A;  2IGI A;  1XI1 A;  1Q9X A;  1B9D A;  1TKX A;  2HNZ A;  1JLF A;  1CZB A;  4CK2 A;  1K6Y A;  5FRO A;  1KLN A;  1IH7 A;  1SL1 A;  2FBV A;  4DSL A;  1S1W A;  4AHV A;  5KI6 A;  4EZ9 A;  1RTH A;  4RW6 A;  4CER A;  5EU7 A;  3AA2 A;  4CJR A;  4CE9 A;  2VWJ A;  3CG7 A;  1ZBU A;  3M8S A;  4CIG A;  3L3V A;  3ZT2 A;  4M3U A;  1RT1 A;  4F3T A;  4CEQ A;  4KB0 A;  4W5R A;  2XY8 A;  1GOC A;  4FZZ A;  1NKB A;  2Z1J A;  1NJZ A;  1T03 A;  4QAG A;  4O0J A;  4Q5V A;  4DTS A;  1B92 A;  1JLB A;  1JLA A;  1U49 A;  1TL1 A;  4TSX A;  3ZSW A;  3NGI A;  3SQ4 A;  4J2B A;  4B3O A;  3QEI A;  4HUF A;  2Q3S A;  3HPG A;  3DLK A;  4CJF A;  3LWM A;  2RKI A;  1BCO A;  1VSE A;  1RBR A;  1X9M A;  1WSI A;  2QXF A;  1YVU A;  4DFP A;  2GV9 A;  4NCG A;  4K8X A;  1VSF A;  4ID5 A;  3T19 A;  4AIL C;  1YTU A;  3V9W A;  1ZBL A;  4KI6 A;  2XHB A;  4J2E A;  2JLE A;  3NGZ A;  1QSL A;  4M3Y A;  1SL2 A;  2I5J A;  3QIO A;  3OVN A;  3ISN C;  3OY9 A;  3AVA A;  4ZHR A;  4CJK A;  5K14 A;  1LV5 A;  3DYA A;  3QEP A;  3SYZ A;  1A5W A;  2ITG A;  4CCH A;  3AO1 A;  5J1E A;  3OJU A;  2HB5 A;  2XRI A;  4BE1 A;  4CF1 A;  3V1R A;  4EP4 A;  4DQS A;  3C95 A;  1HPZ A;  4PUO A;  4N41 A;  3NF6 A;  3BGR A;  1LAV A;  2OPP A;  2HND A;  4I9L A;  5SWM A;  4FJN A;  3KIO A;  1W0H A;  3NCI A;  4CES A;  2XY5 A;  1Q9Y A;  4ELT A;  3V9S A;  3VQ6 A;  5J2P A;  3AVI A;  2P5G A;  1NK0 A;  1CZ9 A;  1I3A A;  3OYF A;  3PV8 A;  3SI6 A;  1VSL A;  4FJX A;  1ZBH A;  4FJI A;  3HXM A;  3HK2 A;  3VQE A;  2VG6 A;  3HPO A;  4J2A A;  2OZM A;  2ATQ A;  2HW3 A;  4CIE A;  1TVR A;  2X6N A;  4E89 A;  3C94 A;  3D45 A;  4FJ7 A;  5FDL A;  3B6O A;  3VN5 A;  1HYS A;  2VWK A;  4IBN A;  5C25 A;  5HRR A;  3QEX A;  1WSG A;  1RT5 A;  3SUO A;  1JLC A;  3OYA A;  3VQ8 A;  3KLI A;  3RRH A;  1KFS A;  4DQR A;  1WSH A;  3V1O A;  3OS0 A;  2QK9 A;  1BIZ A;  1FK9 A;  3KK2 A;  3K5N A;  2FBX A;  3IG1 A;  3OYG A;  3V81 A;  3QET A;  4DTX A;  3QER A;  4FJ9 A;  1GOA A;  3NFA A;  1L3T A;  4Z4F A;  4I7F A;  3CM5 A;  3S3O A;  1BHL A;  2HHS A;  2X78 A;  4ICL A;  4M42 A;  3TAG A;  4DTR A;  4FZY A;  1S5J A;  2W42 A;  2WOM A;  1L3U A;  4CIF A;  1RBT A;  3LAK A;  4DSI A;  1R0A A;  1D5A A;  4B8C A;  5E41 A;  1Z25 A;  3OYN A;  1WLJ A;  1RBV A;  3ZSY A;  1X1P A;  4IG3 A;  2HHX A;  3O4N A;  3LP2 A;  4FJ5 A;  4KHU A;  1XHZ A;  1D9D A;  1RDD A;  3DLB A;  3VQ9 A;  4B9U A;  5DK5 A;  4KHW A;  5I42 A;  1MU2 A;  1WSJ A;  2D0A A;  3QLH A;  4CFD A;  5HRN A;  2G8H A;  3DRS A;  1S9E A;  3HO1 A;  4OKJ A;  3WNF A;  1RT6 A;  1L3S A;  2WON A;  3KKS A;  1NOY A;  2KW4 A;  1EXQ A;  4BE0 A;  1ASW A;  4C8O A;  3VQP A;  3TAP A;  3JYT A;  2HHQ A;  1KLM A;  1S1U A;  5CZ2 A;  4Z0U A;  4CK3 A;  5HBM A;  2Z1I A;  3CM6 A;  4CFB A;  3S9H A;  4KPY A;  3VQ5 A;  3ZCM A;  4J2D A;  4FM2 A;  1D8Y A;  4H8K A;  1ITG A;  4KTQ A;  1QQC A;  1WSF A;  4KKO A;  4CJ4 A;  3NHG A;  3ZT3 A;  2YNG A;  2D0B A;  3AVB A;  1S6P A;  4DQP A;  3TAF A;  2BAN A;  3AA3 A;  4RG8 A;  4RW9 A;  3SJJ A;  5FRM A;  4W5Q A;  3OYJ A;  4FJH A;  3LZJ A;  3TAN A;  3OYK A;  4DSK A;  4AHU A;  1N5Y A;  3ZSO A;  3NDK A;  3SQ1 A;  1NK9 A;  1JLQ A;  3L2V A;  3AVJ A;  3QEW A;  1Q8I A;  3ZSR A;  4CEO A;  1TK5 A;  4M3T A;  1VSM A;  3BDP A;  4NYN A;  2OPS A;  4M45 A;  4HUE A;  4FZX C;  1NKC A;  2LSN A;  4KI4 A;  4FJM A;  1VSH A;  1HQE A;  2XY7 A;  1SKW A;  4K8Z A;  1YT3 A;  4F2S A;  1ASU A;  1VRU A;  3V4I A;  3TAQ A;  4E7I A;  4QCL A;  1FKO A;  1YTA A;  1GOB A;  1G15 A;  4I2P A;  4FLT A;  4CED A;  3RMB A;  3PO4 A;  3AVM A;  4B8A B;  4DG1 A;  3MXI A;  4HCB A;  4N76 A;  4OKK A;  5JS2 A;  3TAB A;  4KHN A;  1C6V A;  3DLE A;  2O4G A;  2RF2 A;  4FJK A;  1NK5 A;  4DF8 A;  1QSY A;  1U4B A;  2P5O A;  1C0M A;  3O3H A;  3OYE A;  2G8V A;  1SKR A;  3TI0 A;  3RMA A;  4DTU A;  4HUG A;  1RBU A;  1TAU A;  3VQC A;  2KFN A;  3PY8 A;  4HHT A;  3E01 A;  4DU3 A;  4CEE A;  4W5N A;  1HJR A;  3AVH A;  4Y1C A;  3PX6 A;  4O55 A;  3RWU A;  2RN2 A;  3AVL A;  4OKE A;  4CK1 A;  4FLV A;  1RDB A;  3QNN A;  4KAZ A;  4DU4 A;  4BAC A;  1RBS A;  5I3U A;  3LP3 A;  3WNG A;  3OYI A;  3ASM A;  3WNH A;  4FYD A;  4M3R A;  3L8B A;  4B9T A;  4LH5 A;  4BE2 A;  3VQD A;  1QS4 A;  2ZE2 A;  4KO0 A;  3PUF A;  1RT2 A;  4O0I A;  3OYC A;  1RCH A;  3AA4 A;  1IKV A;  2YKM A;  5KGW A;  2VG7 A;  1LW2 A;  4IFV A;  3HP6 A;  1NK6 A;  4ZTJ A;  2YHB A;  4R5P A;  1KRP A;  4HVJ A;  3TAM A;  2G8F A;  4DSJ A;  2XY6 A;  1JXE A;  3P5J A;  2FBT A;  4CJQ A;  4CJP A;  4CF9 A;  1VRT A;  3KK3 A;  3QIP A;  4I2Q A;  3VQQ A;  1C1B A;  5HRS A;  3OJS A;  1S1T A;  4FJL A;  3ZT0 A;  4PY5 A;  3ALY A;  2IC3 A;  3LAL A;  3NH1 A;  1FKP A;  1WAJ A;  4IG0 A;  2YKN A;  3PX0 A;  3U3G A;  5CYQ A;  3M8R A;  3EZ5 A;  2QKB A;  4FLZ A;  2OZS A;  4DTM A;  5T7B A;  4KTW A;  1BCM A;  4CJT A;  4H4M A;  3PO5 A;  1CLQ A;  1B9F A;  3B6P A;  1EET A;  3A2F A;  2KZZ A;  4LY7 A;  2E6L A;  3MEC A;  4CHP A;  2Z1G A;  4DFJ A;  2YV0 X;  2OPQ A;  2ETJ A;  2GBZ A;  1TAQ A;  1VK0 A;  4IKF A;  1ZBI A;  5HRP A;  1EKE A;  2QKK A;  4YFU A;  4BDZ A;  4F8R A;  4LD0 A;  3VQ4 A;  3JSM A;  3NH2 A;  4ZTF A;  3F73 A;  2G8K A;  3IS9 A;  3CQ8 A;  2ZD1 A;  1HRH A;  1CXQ A;  4CJU A;  3AO4 A;  3TAE A;  1IKX A;  5J2Q A;  2JGU A;  4PWD A;  1S9G A;  4E7L A;  5J2M A;  4FXD A;  3L3U A;  4BDP A;  1Y97 A;  2DFE A;  3OYM A;  1KSP A;  1RDA A;  3AVG A;  4CJV A;  3ITH A;  2PYL A;  4I9Q A;  3HYF A;  4AHT A;  4FVM A;  1EP4 A;  4NYF A;  1ZYQ A;  2A1R A;  3NH0 A;  1UAX A;  4KRE A;  1NJX A;  1T8E A;  4LH4 A;  2P1J A;  3LPU A;  4RW4 A;  2NUB A;  4O5B A;  4NCB A;  1A5V A;  3V6D A;  3QO9 A;  4OJR A;  2B4J A;  3KK1 A;  1JL2 A;  2E4L A;  3O3F A;  4FLY A;  1S6Q A;  3OYB A;  1TL3 A;  5JS1 A;  2OPR A;  1LAW A;  1U04 A;  4BWJ A;  3EY1 A;  5HP1 A;  3RRG A;  3KD5 E;  3VQB A;  4CEC A;  2HHT A;  4E1M A;  1XHX A;  4W5O A;  2YNI A;  1EX4 A;  2B6A A;  4Z4G A;  4DMN A;  2DY4 A;  3L2Q A;  4KFB A;  1XC9 A;  5KGX A;  3QEV A;  1U48 A;  3DOK A;  4IDK A;  3SPY A;  3S3M A;  1QSS A;  2Z1H A;  3L2W A;  2A1S A;  4AHR A;  4E19 A;  3IAY A;  2YHA A;  4JRQ A;  1SUQ A;  1X9W A;  1C0U A;  4XIU A;  3K57 A;  3QNO A;  1J53 A;  4MFB A;  3MAQ A;  4MQ3 A;  1XWL A;  3EYZ A;  1U45 A;  4C8M A;  2X74 A;  1LW0 A;  3RMD A;  2EX3 A;  4JS5 A;  3TAR A;  1QE1 A;  1J5O A;  3ZSZ A;  2IAJ A;  3K5M A;  2IDO A;  2ZQB A;  3AO5 A;  4DFK A;  3T1A A;  3P1G A;  4OPK A;  3L2R A;  4DS4 A;  4B9N A;  3DLH A;  1U47 A;  3UIQ A;  4M3X A;  2KTQ A;  4FLX A;  4ELV A;  3AA5 X;  4FM0 A;  3SQ2 A;  3C6U A;  2D0C A;  3K2P A;  4WE1 A;  4CF2 A;  4M41 A;  1KFD A;  3IRX A;  3NF7 A;  4OGE A;  3K59 A;  3ZSV A;  3LDS A;  1TKD A;  3VQ7 A;  1BI4 A;  3ZSQ A;  2BGG A;  1L3V A;  1S1V A;  5DMR A;  2D5R A;  5D3G A;  4KB1 A;  1RDC A;  4DU1 A;  4C8K A;  1C1C A;  3F9K A;  1F21 A;  1BGX T;  5CZ1 A;  4FM1 A;  4FK0 A;  3C6T A;  3NAE A;  4DTO A;  3SPZ A;  3M8P A;  3KLH A;  1SL0 A;  3SUQ A;  1HNV A;  4ID1 A;  4L8R B;  5HRO A;  1HYZ A;  5KTQ A;  1J9A A;  1BIS A;  4BWM A;  4G1Q A;  3SV4 A;  4DTN A;  1DTQ A;  2PY5 A;  2KZM A;  1SV5 A;  3OYD A;  3SZ2 A;  3RMC A;  2F8S A;  4CGF A;  4FW1 A;  3AVN A;  4E7H A;  3HVT A;  3CFO A;  3CFR A;  5KRS A;  2Y1J A;  1RT3 A;  3FFI A;  2HHW A;  1RTJ A;  4C8N A;  2OA8 A;  4CHZ A;  4CEZ A;  1IG9 A;  1JLE A;  2FC0 A;  3AVK A;  4CJL A;  2YNF A;  3NGY A;  4CJE A;  1HMV A;  3K58 A;  1WSE A;  1CXU A;  1KVB A;  4CHQ A;  3I0S A;  2G8U A;  3KLE A;  4CJ3 A;  1UA1 A;  4DWI A;  3M8Q A; 
#chains in the Genus database with same CATH topology
 3HL8 A;  3KLG A;  1C0F A;  2JWK A;  2G8I A;  4Z4H A;  4AM6 A;  2HVH A;  3T3F A;  3F5T A;  3AO3 A;  1WB9 A;  4CJW A;  1N6Q A;  3VEN A;  3BZK A;  4CGJ A;  3QIN A;  2X6S A;  3O3G A;  4Z4I A;  4KHQ A;  1VQ9 N;  3DLL L;  2F96 A;  4YOX A;  4CGI A;  3V9U A;  1NK8 A;  5AQV A;  3EE9 A;  4F2R A;  5FRN A;  1QZ5 A;  4PA1 A;  3DMJ A;  1X3M A;  1D9F A;  4DFM A;  3C6H A;  1OKJ A;  4DR5 K;  2EHG A;  4OPJ A;  1TK0 A;  4WF9 L;  4ELU A;  4ILJ A;  4O8U A;  3L4I A;  4CGG A;  2P9L A;  3ID6 A;  3K5L A;  4HCC A;  2HVI A;  4N47 A;  4FWS A;  2F4V K;  4FK2 A;  1G99 A;  5AQH A;  4XEI A;  1RDU A;  3LAM A;  3LP1 A;  3VEO A;  2QEX N;  3CFP A;  1DTT A;  4JI2 K;  3ID8 A;  1NJI O;  3O08 A;  3U6F A;  4BR0 A;  4B9S A;  2R7Y A;  4KRF A;  4PKI A;  5C24 A;  1SKS A;  3ZT4 A;  4CGD A;  3IUC A;  3DM2 A;  4H4O A;  4JK8 A;  5M1O A;  1VSI A;  2AP1 A;  3U3Y A;  4NCA A;  1HQU A;  1O13 A;  3ZX0 A;  2AJQ A;  2DTU A;  4WFN L;  1NOZ A;  3O4W A;  5AQM A;  1H1V A;  2HMP A;  3WUH A;  3ZT1 A;  1RNH A;  3K9K A;  4IJA A;  4AH9 A;  2HNY A;  1LOT B;  1HYV A;  4B9L A;  1TK8 A;  3MN5 A;  3SCX A;  3V9X A;  4KH5 A;  5B8H A;  1M1K O;  2WTU A;  3J7Y P;  4CBX A;  1IBK K;  4FK4 A;  4OGC A;  4DTJ A;  1BOT O;  3PSI A;  4O44 A;  2YHY A;  4YHH K;  3AVC A;  2VQE K;  4AQY K;  4C8L A;  1RT4 A;  5FPM A;  2ASP A;  4B1U B;  1NKE A;  3IDH A;  3AO2 A;  1ATS A;  2GUI A;  3LPT A;  4DV5 K;  3JAM O;  1JL1 A;  3HM9 A;  3SUP A;  4CEA A;  1XI1 A;  1Q9X A;  1B9D A;  4BR9 A;  3TTD A;  1K6Y A;  3EN9 A;  3D2F A;  5FRO A;  1SL1 A;  4FWN A;  4PL8 A;  1RTH A;  4RW6 A;  3KHY A;  1FJG K;  3AY9 A;  1ZBU A;  3M8S A;  4CIG A;  4CZK A;  3L3V A;  3ZET A;  5HOO A;  2XY8 A;  3P31 A;  1NJZ A;  5AZJ B;  1B92 A;  3FZK A;  4CD1 A;  4TSX A;  5GAE P;  3HPG A;  1VSE A;  4A5B A;  1YVU A;  4DR7 K;  4ID5 A;  4EFH A;  1YTU A;  2Q0R A;  1ZBL A;  4KI6 A;  1WOQ A;  4FWP A;  2HBL A;  4J2E A;  3O9Q A;  3QIO A;  3OVN A;  3PLA A;  4ZHR A;  3R8E A;  2P9N A;  2UXB K;  2JWL A;  1A5W A;  4CCH A;  1YAG A;  5J1E A;  3OJU A;  2HB5 A;  4BE1 A;  3V1R A;  2W6L A;  4PUO A;  5JIC A;  1HPZ A;  2ZF5 O;  3SLC A;  1IBM K;  4FJN A;  3NCI A;  4WQ5 A;  4FJX A;  3D6R A;  1T3V A;  1TUU A;  3DJC A;  2OZM A;  2E20 A;  1ZC6 A;  5FDL A;  5BPN A;  4GY2 B;  2VWK A;  5C25 A;  3SAF A;  4PKH A;  1RT5 A;  3VQ8 A;  3KLI A;  1KFS A;  4DQR A;  2QXL A;  3GOI A;  1K8K A;  4BC3 A;  1J5E K;  1P90 A;  3D2E A;  3NMU A;  3TAG A;  4FZY A;  4JI5 K;  3RSE B;  2WOM A;  2P9K B;  4CIF A;  5AQI A;  3CCS N;  1R0A A;  1D5A A;  4B8C A;  5AQT A;  5E41 A;  1WLJ A;  1X1P A;  3O4N A;  4FSV A;  4Z4E A;  3TU5 A;  5DK5 A;  2G8H A;  2WUS A;  1E4F T;  1RT6 A;  4CBU A;  1NOY A;  3LDN A;  1YXQ A;  3TAP A;  3JYT A;  3UE5 A;  1S1U A;  4Z0U A;  3S9H A;  4CFB A;  2D4W A;  3ZCM A;  4DHY A;  2IIR A;  3CCR N;  1WSF A;  3KWI A;  4V19 S;  1VQL N;  3CQY A;  3OYJ A;  3OYK A;  4AHU A;  1N5Y A;  1NK9 A;  1U2V B;  1MDU B;  3AVJ A;  3BDP A;  4KI4 A;  1MWK A;  4K8Z A;  3V4I A;  4QCL A;  3CHW A;  5C2F A;  1G15 A;  4FLT A;  2O8F A;  3AVM A;  4B8A B;  3AGR A;  4KHN A;  1T6D A;  1NK5 A;  2P5O A;  2G8V A;  1HJO A;  4K42 A;  3VQC A;  2KFN A;  4HHT A;  3AVH A;  4F9O A;  4OKE A;  4JI1 K;  4FLV A;  3QNN A;  4KAZ A;  1GLB G;  3LP3 A;  3WNG A;  4JK7 A;  3ASM A;  4IO9 L;  4BE2 A;  4O0I A;  3PUF A;  1RT2 A;  3OYC A;  5KGW A;  2VG7 A;  3CME N;  1LW2 A;  1GLJ O;  1NK6 A;  4BRN A;  1KRP A;  3A8Y A;  3TAM A;  4QS9 A;  2FSJ A;  3A5N C;  2G8F A;  1QQM A;  3P5J A;  2FBT A;  4BRI A;  3QIP A;  3VQQ A;  1C1B A;  3G71 N;  2VQF K;  2UXD K;  4DUZ K;  3THX B;  3FGU A;  2Q2R A;  2NRH A;  1BCM A;  1CLQ A;  4IXC A;  4BR7 A;  1IJJ A;  4DR2 K;  4DFJ A;  2YV0 X;  4WQ4 C;  5KPZ A;  2OPQ A;  1TAQ A;  2GBZ A;  2AA4 A;  3VPZ A;  2QKK A;  2W41 A;  4ZTF A;  1MWM A;  4OX9 K;  1HRH A;  3E66 A;  3F2K A;  3LL3 A;  1S9G A;  5J2M A;  2DFE A;  1KSP A;  4FL9 A;  4I6M A;  4NYF A;  3G6E N;  3NH0 A;  1UAX A;  3MWP A;  3A0I X;  1EO1 A;  1A5V A;  3QO9 A;  1GLF O;  2E4L A;  1S6Q A;  1VQP N;  3RRG A;  3B8A X;  3F9M A;  3I8B A;  3VQB A;  4CEC A;  2HHT A;  4A2A A;  4E1M A;  3WXI A;  3T1H K;  5KGX A;  1HNZ K;  3SPY A;  4AHR A;  2E1Z A;  4JRQ A;  1C0U A;  3QNO A;  3K57 A;  3MAQ A;  5C2D A;  3AAQ A;  4XH1 A;  1S72 N;  3O6W A;  4A62 A;  3VF2 A;  5C12 A;  2OTJ N;  1J5O A;  4OPK A;  3L2R A;  1WBD A;  2EWS A;  3J8A A;  3U9D A;  5BN9 A;  4DR1 K;  2KTQ A;  4FWR A;  4FLX A;  2Q36 A;  4JNE A;  3AA5 X;  3LDS A;  3NF7 A;  4OGE A;  3K59 A;  5AZJ A;  2NZT A;  2BGG A;  4KH6 A;  3T69 A;  3C0B A;  5D3G A;  4DB3 A;  1BUP A;  5CZ1 A;  3CJA A;  4FM1 A;  4DTO A;  3ULE B;  3SUQ A;  5HRO A;  4B3M K;  3E9L A;  4DTN A;  4G1Q A;  5DM6 L;  3RMC A;  2F8S A;  4DV0 K;  4FW1 A;  3AVN A;  3HVT A;  3CFR A;  5AQZ A;  4H0O A;  5KRS A;  2HHW A;  2OA8 A;  3NGY A;  3DAW A;  1WSE A;  1UA1 A;  1IKY A;  4CBW A;  4E1J A;  3R9P A;  4LSL A;  4CEF A;  2O8C B;  4DLG A;  4CFC A;  1ZBF A;  1YHQ N;  3I56 N;  1VQM N;  3R1X A;  3MN7 A;  4KHY A;  3U8X A;  3VA3 A;  3P83 D;  2FF6 A;  1WUA A;  1RFQ A;  3DI6 A;  3K5O A;  2IOC A;  3VMF B;  2P9U B;  2E1Y A;  3CYM A;  4EP5 A;  4UQG A;  2O4I A;  1J6Z A;  3V9Z A;  3CMA N;  1KVC A;  2Y1I A;  3I8D A;  5AQJ A;  4H5N A;  1KAY A;  5JMV A;  1P8Z A;  4KTZ A;  1WN7 A;  4JKB A;  4F3O A;  1X9J A;  4JK9 A;  4N56 A;  4E3S A;  3SV3 A;  4JKG A;  1ASV A;  2GWK A;  4RTF D;  4B9V A;  2E6M A;  1NGA A;  1ATR A;  1YIT N;  1W97 L;  4U67 L;  4DTP A;  3MEE A;  4CFA A;  4IFY A;  4DLE A;  4Y1D A;  3O4Q A;  4CJS A;  3G0Z A;  1T6C A;  2O8B B;  3CPW M;  2BE2 A;  3CIP A;  4E7J A;  2HHV A;  3T1Y K;  2G8W A;  2F9T A;  4FLW A;  2DFH A;  2PBD A;  2UU9 K;  3I33 A;  4CEB A;  5EXW A;  2RPI A;  3JXU A;  3R3L A;  2HHU A;  4FJG A;  2ITM A;  4YY3 K;  2A41 A;  4CHO A;  1HNI A;  3H08 A;  1HKC A;  2P51 A;  1QVG M;  4FW2 A;  4E0D A;  3SUN A;  4E1N A;  1J54 A;  1TYQ B;  1Z26 A;  4OVL A;  1VQ7 N;  4CW7 B;  3KD1 E;  4BRP A;  4YNQ A;  4CHY A;  5F0X A;  1JCF A;  1RTD A;  2FLO A;  4GKJ K;  1K9M O;  1JKH A;  2OYQ A;  5AZI B;  1UWB A;  3MEG A;  3MXJ A;  2KKZ A;  4HTU A;  4B9M A;  3HI0 A;  3EZW A;  4BR5 A;  4M3Z A;  2D1K A;  3D0P A;  2PZS A;  1NGE A;  1WAF A;  3KKR A;  1HNX K;  3CCM N;  3THW A;  2HNZ A;  1JLF A;  4H0T B;  1S1W A;  4H5W A;  5JLH A;  5KI6 A;  3L6Q A;  4MLE A;  3TTC A;  4CER A;  4EZ9 A;  5EU7 A;  2O8E A;  4H0P A;  4M3U A;  4JKC A;  4F3T A;  4W5R A;  4FOE A;  3G25 A;  4A61 A;  2Z1J A;  1T03 A;  4O0J A;  1NGJ A;  4DTS A;  1JLA A;  3J7A P;  1TL1 A;  3ZSW A;  5AQX A;  3QEI A;  1KD1 O;  4CJF A;  4HTL A;  3LWM A;  2RKI A;  1BCO A;  4IOA L;  1RBR A;  2QXF A;  3M3Z A;  1V4S A;  4NCG A;  3DXK B;  4K8X A;  3T19 A;  1VQO N;  1YUW A;  2NLX A;  2JLE A;  1QSL A;  3C7N A;  2I5J A;  4MDA A;  3OY9 A;  3ISN C;  2E8A A;  3NVM A;  3QEP A;  3AO1 A;  4EP4 A;  1LAV A;  2I7N A;  4I9L A;  5SWM A;  1XNR K;  3KIO A;  4ELT A;  4CES A;  2XY5 A;  1TUY A;  1NK0 A;  3OYF A;  3IFR A;  3SI6 A;  5BRE A;  1QQN A;  4ISF A;  4UY8 O;  3HK2 A;  1VQ4 N;  3CJB A;  5AQN A;  4CIE A;  4C23 A;  2X6N A;  4E89 A;  1XMQ K;  3CC2 N;  3THY A;  3B6O A;  3VN5 A;  1HYS A;  2Q31 A;  3H45 C;  1WSG A;  3OYA A;  1WSH A;  1BIZ A;  2CGJ A;  1M90 O;  2FBX A;  2NRV A;  4DTX A;  1GOA A;  1L3T A;  5AQY A;  1E4G T;  4I7F A;  1GLD G;  4MO4 A;  2X78 A;  4BRL A;  3KZB A;  4M42 A;  3EL2 A;  5KPT A;  1RBT A;  3LM9 A;  3VF4 A;  4DSI A;  4O8K A;  1Z25 A;  3PIO L;  1RBV A;  4FO0 A;  1JJ2 M;  4FJ5 A;  5GAD P;  1XHZ A;  4NLB A;  4LF9 K;  1RDD A;  1MU2 A;  3QLH A;  4CFD A;  3HO1 A;  2P9P A;  1L3S A;  3KKS A;  4BE0 A;  1FW6 A;  5EOY A;  4C8O A;  4JKE A;  1KLM A;  3BF1 A;  3VQ5 A;  5C0Y A;  4LFB K;  1D8Y A;  4JAX A;  3NHG A;  3ZT3 A;  4DQP A;  1C0G A;  4H0Y B;  4W5Q A;  2YHW A;  4DSK A;  2GUP A;  3ZSO A;  4B3T K;  5AQF A;  3SQ1 A;  5KQD A;  3CQX A;  4FZX C;  1NKC A;  1OVQ A;  1XUP O;  3MK6 A;  1SKW A;  3GDQ A;  3GL1 A;  3ZEU B;  1CZA N;  4GV9 A;  4Y0W A;  1YTA A;  4BG9 A;  1GOB A;  3RMB A;  4HCB A;  4N76 A;  2A3Z A;  2E5L K;  4OKK A;  3TAB A;  4FJK A;  1QSY A;  2QW9 A;  1U4B A;  1C0M A;  3O3H A;  4BRC A;  2NRX A;  2ASM A;  1BA0 A;  4HUG A;  1RBU A;  4B9Q A;  4NLC A;  1HJR A;  3E9O A;  4Y1C A;  4MLH A;  3AVL A;  3HM8 A;  5I3U A;  3OYI A;  2ZGZ A;  3VTI A;  2QWN A;  4WCE L;  3I55 N;  2HF3 A;  4LH5 A;  1BWF O;  1QS4 A;  1NNE A;  4JKD A;  3BZC A;  4ZTJ A;  3CF5 L;  4R5P A;  5JVG L;  3UKR B;  4DSJ A;  4YOU A;  2YHX A;  4I2Q A;  3OJS A;  3LAL A;  3NH1 A;  4BG8 A;  1WAJ A;  4IG0 A;  3WXK A;  5GIP A;  2FXU A;  5CYQ A;  2QKB A;  2OZS A;  4GNI A;  4JHD A;  5T7B A;  1BO5 O;  4KTW A;  1B9F A;  1EET A;  3SMS A;  4IOX A;  2KZZ A;  5IWA K;  2E88 A;  2Z1G A;  2UXC K;  4BC4 A;  4BDZ A;  3VQ4 A;  3JSM A;  3CQ8 A;  5DM7 L;  4CJU A;  3AO4 A;  3CJ7 A;  3BUZ B;  4E7L A;  4X65 K;  3L3U A;  3QBX A;  3OYM A;  4CJV A;  2PYL A;  4FVM A;  1U6Z A;  2CH5 A;  1NU0 A;  1T8E A;  1E3M A;  2QA4 N;  4CZI A;  2BTF A;  3VTH A;  2B4J A;  3KK1 A;  5AQO A;  1MA9 B;  4XH5 A;  1JL2 A;  3CJ1 A;  3O1W A;  4MDB A;  3O3F A;  5JS1 A;  1TL3 A;  5BR9 A;  4NO7 A;  3KD5 E;  5JLF A;  2QM1 A;  1N33 K;  4W5O A;  2B6A A;  4Z4G A;  4DMN A;  2DY4 A;  4JI3 K;  5LJV A;  3G4S N;  4JI8 K;  4RCH A;  4M63 C;  4IDK A;  4DR3 K;  3DXM A;  1BG3 A;  3VOV A;  1U45 A;  1NBW A;  4DV1 K;  4C8M A;  3WEE B;  3O5B A;  3RMD A;  1GLL O;  2IAJ A;  2QWR A;  4DR6 K;  4LC9 B;  3P1G A;  4B9N A;  1U47 A;  4X62 K;  2WFB A;  3FE1 A;  4FM0 A;  3K2P A;  2D0C A;  1KFD A;  3ZSV A;  4ISE A;  1S1V A;  1RDC A;  4NXM K;  1F21 A;  1BGX T;  4JI0 K;  3C6T A;  3PIP L;  3M8P A;  3SPZ A;  2P9S B;  1W7A A;  3P38 A;  3DXK A;  1HYZ A;  2UUC K;  1DTQ A;  2QWL A;  1QVF M;  2HST A;  4E7H A;  2D0P A;  3CFO A;  1ZXO A;  1RT3 A;  3FFI A;  4IEI A;  3H1V X;  1JLE A;  3VES A;  4CHQ A;  1KVB A;  3UKU B;  3I0S A;  4H0X B;  3KLE A;  4DWI A;  3M8Q A;  1GLC G;  1BI4 B;  1IKW A;  4BGA A;  3KJV A;  3RR7 A;  1IO2 A;  4CF8 A;  1YJW N;  3WXL A;  4W5T A;  4Q0B A;  4JD2 B;  1HX1 A;  3CC4 N;  3BY5 A;  4OPH A;  3VEX A;  5KRT A;  4CZF A;  2HOE A;  4K43 A;  2PYJ A;  1Q82 O;  4DV2 K;  5AR0 A;  4F4K A;  4BRM A;  5SZT A;  1X9S A;  4FWM A;  1JLG A;  1S1X A;  3FR0 A;  4E7K A;  1VQ5 N;  3HST B;  4JLH A;  3QB0 A;  2GEL A;  3AV9 A;  3PSF A;  4IDH A;  5ADX A;  4ISG A;  4FWQ A;  3LDO A;  3PX4 A;  4KV8 A;  4M7Y A;  2HBM A;  2O8D B;  2VG5 A;  3HBT A;  4RW7 A;  4BRH A;  3O1B A;  3HP9 A;  3QES A;  1VSK A;  1BQN A;  3DLR A;  4BY9 C;  5A2Q O;  4JYA K;  1REV A;  2IS3 A;  3G10 A;  1C0T A;  4CGH A;  1YVN A;  1I39 A;  1BL3 A;  1NJW A;  4GVM A;  1LWC A;  3EO3 A;  5CYM A;  4CJ5 A;  3M5R A;  1JXB A;  4EIA A;  4Z4C A;  2WBN A;  3OS2 A;  2XO7 A;  4OLB A;  1LWE A;  3MMV A;  4DQI A;  3LP0 A;  3RR8 A;  1NGI A;  3MED A;  4O4G A;  3V1Q A;  3KTQ A;  4BRF A;  1FXX A;  1NMD A;  3CJC A;  3CPE A;  4NB4 A;  4G9Z A;  2KQ2 A;  1NK4 A;  2FSK A;  4CHN A;  2P9L B;  4KBO A;  3MX5 A;  5EY4 A;  1KCF A;  2OCE A;  3IKM A;  1HKB A;  4OLA A;  4MO5 A;  4LSN A;  3L2U A;  4BVP A;  3A5M C;  3DLG A;  1VQ8 N;  2ZM6 K;  1OH6 A;  4DSE A;  4QOZ B;  1Y64 A;  5BPL A;  1XNQ K;  3KLF A;  1KQS M;  1L5U A;  3TWH A;  4CF0 A;  1SQK A;  1GLE G;  1WNS A;  3C65 A;  1OVY A;  3NF8 A;  3SQ0 A;  3KWG A;  1NK7 A;  2V7Y A;  2FBY A;  3A5L C;  3HRG A;  4GW6 A;  3CCQ N;  3K0S A;  5BPM A;  2NRT A;  3RTV A;  3HJF A;  3MCA B;  4U7B A;  1O1W A;  4N5S A;  4QS8 A;  4O5F A;  3LM2 A;  3MXM A;  3VET A;  4BC5 A;  1JCG A;  4LFA K;  4RW8 A;  3MN6 A;  1QHT A;  2IGI A;  2NRZ A;  4A59 A;  1YJ9 N;  2RHK A;  4K41 A;  1IH7 A;  2FBV A;  4L3Q A;  4BC2 A;  4KHP K;  4AHV A;  1YI2 N;  3AA2 A;  4YOV A;  3CG7 A;  3ZT2 A;  1YJN N;  4FWK A;  1RT1 A;  4CEQ A;  4KB0 A;  1Z05 A;  4CZM A;  3QFU A;  4QAG A;  3EEQ A;  4CJ7 A;  1JLB A;  4CZE A;  2YX6 A;  3BF3 A;  4GKK K;  3NGI A;  4K0K K;  3SQ4 A;  5BN8 A;  4LF4 K;  3DLK A;  2GX9 A;  4XH4 A;  1X9M A;  2NRW A;  3TSQ A;  3OTO K;  4DFP A;  2GV9 A;  4IOC L;  1VQK N;  1HKG A;  3O9T A;  3NGZ A;  4M3Y A;  5FPN A;  3D2F B;  1SL2 A;  4CJK A;  5K14 A;  3ZYY X;  1LV5 A;  4DV4 K;  4BRE A;  3RSE A;  2P9K A;  3ZET B;  3CI5 A;  4CF1 A;  5BR8 K;  4DQS A;  3C95 A;  5GIO A;  4CZL A;  1NGB A;  2HND A;  4H03 B;  1Q9Y A;  5J2P A;  2WC9 A;  1CZ9 A;  1I3A A;  3PV8 A;  1VSL A;  5E26 A;  1ZBH A;  4DV3 K;  4FJI A;  3H46 O;  3HXM A;  2VG6 A;  4J2A A;  2HW3 A;  3C94 A;  3D45 A;  4FJ7 A;  1SZ2 A;  4B3S K;  2Q1N A;  4WQ5 C;  3SUO A;  3H3O B;  2GEM A;  3U9Z A;  3OS0 A;  1Q86 O;  3KK2 A;  3IG1 A;  3QET A;  3QER A;  4FJ9 A;  4CZH A;  4Z4F A;  3CCJ N;  3S3O A;  2P9N B;  2HHS A;  1NGF A;  4ICL A;  4DTR A;  2W42 A;  5M1Q A;  1ZBS A;  1Q81 O;  1U2V A;  4IWV A;  4BGB A;  5LMN K;  4IG3 A;  4OO1 J;  4GV3 A;  3FZL A;  4B9U A;  3VQ9 A;  5I42 A;  1WSJ A;  2D0A A;  1S9E A;  4OKJ A;  3WNF A;  3VGM A;  2WON A;  2KLA A;  1V4T A;  1EXQ A;  1ASW A;  3VGL A;  2Z1I A;  3CM6 A;  3MX2 A;  4YOT A;  4R79 A;  2OAN A;  3QIC A;  5C10 A;  4KTQ A;  1QQC A;  1NGH A;  1K8K B;  4CJ4 A;  2D0B A;  3AVB A;  3D2E B;  3SJJ A;  4RG8 A;  5FRM A;  3LZJ A;  3NDK A;  1RDW X;  1TK5 A;  4CEO A;  2OPS A;  4M45 A;  2GWJ A;  1D4X A;  2LSN A;  4FJM A;  1XMO K;  1HQE A;  2XY7 A;  4F2S A;  1ASU A;  3TAQ A;  4E7I A;  4I2P A;  3MXI A;  5AJ3 K;  1C6V A;  2QWP A;  3THX A;  3TI0 A;  3RMA A;  3PY8 A;  4W5N A;  1KAZ A;  3E01 A;  4CEE A;  4DU3 A;  3J81 O;  3RWU A;  3PX6 A;  2F9W A;  4O55 A;  2RN2 A;  4CK1 A;  3FZM A;  1RDB A;  4IEE A;  4BAC A;  4DU4 A;  1RBS A;  4C1N K;  3WNH A;  1BA1 A;  3L8B A;  3VQD A;  2ZE2 A;  2VCP A;  1RCH A;  1IKV A;  2CGK A;  2YKM A;  4JKF A;  4IFV A;  4B1Y B;  2VWB A;  4HVJ A;  3E9P A;  5ADX H;  2XY6 A;  1JXE A;  4CJP A;  4CF9 A;  4BRG A;  3KK3 A;  2UUB K;  3D7E O;  3QFP A;  2O8F B;  4CZG A;  4EHT A;  4K25 A;  5HRS A;  4FJL A;  4PY5 A;  2FF3 B;  2IC3 A;  3E1Y A;  1KXP A;  2YKN A;  4CZJ A;  3PX0 A;  1EWR A;  3N4P A;  3U3G A;  4WQ4 A;  3M8R A;  4JI7 K;  5MLC Q;  4FLZ A;  2HF4 A;  2E2Q A;  3PO5 A;  3CJ9 A;  4B1W B;  4BRO A;  3B6P A;  3O9U A;  2E6L A;  3MEC A;  4DQ8 A;  5C15 A;  4CHP A;  3ZX3 A;  4LF8 K;  1ZBI A;  2ETJ A;  4IKF A;  3TPQ A;  3T7Z A;  3WXJ A;  1EKE A;  4F8R A;  3NH2 A;  2G8K A;  3WQU A;  3OHR A;  2W40 A;  3TAE A;  5J2Q A;  4PWD A;  4AM7 A;  4B3R K;  4FXD A;  2QTD A;  3P4I A;  4YOY A;  4I9Q A;  3HYF A;  2BUP A;  3O9R A;  1EP4 A;  5FLX O;  1NGD A;  3GG4 A;  1ZYQ A;  2A1R A;  3C6A A;  4X66 K;  2P1J A;  3LPU A;  4RW4 A;  2NUB A;  4O5B A;  3RVC A;  4NCB A;  4OJR A;  1RGI A;  1DKG D;  1I94 K;  4IJN A;  2NRR A;  1LAW A;  4BWJ A;  4DKW A;  4PHT X;  3CCV N;  4BR2 A;  2D0O A;  5AQL A;  1XHX A;  2YNI A;  3OA9 A;  5F2R A;  3L2Q A;  4KFB A;  1XC9 A;  3QEV A;  4B1X B;  3ULE A;  3EE8 A;  3S3M A;  3L2W A;  3HZ6 A;  2A1S A;  1X9W A;  4LF6 K;  1SUQ A;  1KAX A;  1J53 A;  4MQ3 A;  1XWL A;  2HBK A;  3H3N O;  2ZGY A;  4I6M B;  2X74 A;  4BRA A;  1VAZ A;  1LW0 A;  3SBG A;  3TSU A;  4WFB L;  4WFA L;  3SBT A;  3TAR A;  5ELZ A;  2IDO A;  1NMN A;  3AO5 A;  4DFK A;  1VQN N;  3T1A A;  3ENO A;  4DS4 A;  4AF1 A;  3HOT A;  4ELV A;  4M7X A;  3C6U A;  4CF2 A;  1TKD A;  3IRX A;  3VQ7 A;  3ZSQ A;  2ZJP L;  3TTF A;  3JS6 A;  3BEX A;  4DU1 A;  3M6G A;  1C1C A;  4C8K A;  3F9K A;  4FK0 A;  2O8C A;  3AGK A;  3NAE A;  5F1X A;  5FPE A;  5AQK A;  3KLH A;  3CET A;  1SL0 A;  1HNV A;  1QHA A;  3N4Q A;  2VGN A;  3QBW A;  1NLV A;  1SAZ A;  2ZWH A;  5KTQ A;  4QS7 A;  1HNW K;  4BWM A;  5M1K A;  2IVO A;  2QWQ A;  2KZM A;  3OYD A;  3SZ2 A;  4DCH A;  4CGF A;  3FFK B;  1K73 O;  2P9U A;  5BRH A;  4C8N A;  1IG9 A;  1DEJ A;  2PAV A;  1CXU A;  2G8U A;  4H5R A;  4C1N I;  2E2N A;  5AQG A;  4KHS A;  3NBP A;  2DPN A;  2IVP A;  3DRP A;  1RTI A;  1JCE A;  3L4Q A;  1KVA A;  1UOC A;  2F7T A;  1TKZ A;  3VA0 A;  3VEW A;  2F8T A;  5LJW A;  3LZI A;  4FPB A;  3ULD A;  3J7Z O;  4JKA A;  4BR4 A;  2O8B A;  3OS1 A;  2ASO A;  1NJY A;  3OBY A;  3M1F A;  5CY4 A;  3THV A;  3LAN A;  4DV7 K;  4WYB A;  3AAR A;  3AAP A;  4M3W A;  1RIL A;  2I7P A;  2P9I B;  4IFE A;  3DRR A;  3SNN A;  3QDK A;  4JRP A;  3HT3 A;  3I0R A;  3OYL A;  2KHO A;  1W9H A;  1RT7 A;  4FJ8 A;  3UB5 A;  4ILH A;  3CCE N;  4DQQ A;  3S3N A;  4FLU A;  1C1A A;  3DWL A;  4YOW A;  1BQM A;  1T05 A;  1S22 A;  2ZJQ L;  1VSJ A;  1TYQ A;  1VSD A;  4FJJ A;  1BDG A;  2YCH A;  3H1Q A;  1TKT A;  3ATU A;  2HMI A;  1EQY A;  3LWL A;  1SS6 A;  3DOL A;  5AZI A;  3EKS A;  4A2B A;  4FWO A;  3KVG A;  1A5X A;  3NE6 A;  2OTL N;  4AHS A;  4PQU A;  3OYH A;  1KTQ A;  4GMJ B;  4YDU C;  3HOS A;  2HBJ A;  1R59 O;  4YOR A;  4CD3 A;  4JKG B;  2BDP A;  2B5J A;  2DFF A;  4X64 K;  1BIU A;  2BH1 A;  5BRF A;  5HLF A;  4JS4 A;  1UA0 A;  4LF7 K;  2Q97 A;  4BDY A;  4DS5 A;  5J2N A;  4GV6 A;  3TR8 A;  1QTM A;  1LWF A;  3NF9 A;  3HVR A;  4FCY A;  2YNH A;  4DF4 A;  1DLO A;  3HTV A;  1N36 K;  1TV6 A;  3HPH A;  3WNE A;  1TGO A;  1T7P A;  1BU6 O;  5AFU H;  3VQA A;  3ZSX A;  3O80 A;  5C42 A;  2QWO A;  4BRK A;  1NGC A;  3WQT A;  5LY3 A;  4DSF A;  4H5V A;  4AHC A;  3AVF A;  4EZ6 A;  4CVN E;  1HPM A;  4B08 A;  5TKY A;  1TKX A;  1CZB A;  4CK2 A;  2CH6 A;  1KLN A;  1NM1 A;  4DSL A;  4CI6 A;  2GTD A;  2FSN A;  4CE9 A;  4CJR A;  2VWJ A;  4HWI A;  2V7Z A;  4FZZ A;  1GOC A;  2VYP A;  4ILG B;  1N8R O;  1NKB A;  4Q5V A;  2A6A A;  3K9J A;  3GBT A;  1VQ6 N;  1U49 A;  3BP8 A;  3VEZ A;  4J2B A;  4B3O A;  4HUF A;  2Q3S A;  4IO8 A;  3VGK A;  3R6M A;  1WSI A;  5CHI A;  3LDQ A;  3W0L A;  1VSF A;  4AIL C;  5BRD A;  3THW B;  3V9W A;  2XHB A;  2QI2 A;  3MDQ A;  5GAH P;  3AVA A;  3FZH A;  3VEY A;  3DYA A;  2O8E B;  1NWK A;  2YJF A;  3SYZ A;  3QML A;  2ITG A;  1HUX A;  5AQR A;  2XRI A;  3CCL N;  3L0Q A;  3LDP A;  5M1F A;  1Q18 A;  1KC8 O;  4FWL A;  4N41 A;  3NF6 A;  4H5T A;  3BGR A;  2OPP A;  1W0H A;  2KFZ A;  3V9S A;  3VQ6 A;  2P5G A;  3AVI A;  5M1N A;  1N32 K;  3VQE A;  3HPO A;  4LF5 K;  2ATQ A;  3SK3 A;  1TVR A;  2UYT A;  4JI4 K;  1NG9 A;  4JEP A;  4IBN A;  3QEX A;  5HRR A;  3OBW A;  1JLC A;  3RRH A;  4JKH A;  3V1O A;  2QK9 A;  3C7N B;  1FK9 A;  5AQP A;  3K5N A;  4EAH D;  1XC3 A;  3OYG A;  3V81 A;  3NFA A;  3CM5 A;  1BHL A;  3VF6 A;  1S5J A;  2A5X A;  1L3U A;  3LAK A;  3CCU N;  3OYN A;  2J4R A;  3ZSY A;  2QWM A;  2HHX A;  4KHU A;  3LP2 A;  2VGM A;  1D9D A;  1Z6R A;  2CGL A;  3DLB A;  4KHW A;  5HRN A;  3TSP A;  1DT9 A;  4A5A A;  4DR4 K;  3DRS A;  3CC7 N;  1HLU A;  3O8M A;  3WXM B;  3ZEU A;  4BQZ A;  2KW4 A;  3CER A;  1YF5 L;  2A40 A;  3VQP A;  3SMP A;  3THY B;  2HHQ A;  5CZ2 A;  4CK3 A;  5FPD A;  5HBM A;  3GE1 A;  4BVO A;  4KPY A;  2IVN A;  4J2D A;  1DGK N;  4FM2 A;  2V52 B;  4H8K A;  5GAG P;  1ITG A;  4KKO A;  5EX5 A;  2YNG A;  3MWT A;  1S6P A;  4RWT A;  5AQQ A;  3TAF A;  2BAN A;  3AA3 A;  4RW9 A;  4FJH A;  3TAN A;  4PL7 A;  4FPA A;  3ENH A;  1JLQ A;  3L2V A;  3QEW A;  4M3T A;  1Q8I A;  3ZSR A;  5IT9 O;  2HHH K;  1VSM A;  2Q0U A;  3O9S A;  4NYN A;  4HUE A;  3EKU A;  4H0V B;  1VSH A;  3UKR A;  1YT3 A;  2P9P B;  5EVZ A;  1VRU A;  1FKO A;  1IV0 A;  4CED A;  3PO4 A;  4IZ9 A;  4DG1 A;  4DV6 K;  5JS2 A;  3DLE A;  1IG8 A;  2O4G A;  2RF2 A;  3A5O C;  4DF8 A;  3OYE A;  1SKR A;  5I9E B;  4DTU A;  1TAU A;  4JN4 A;  4B1Z A;  4BRD A;  3SJH A;  4JV5 K;  3HSC A;  4KH4 A;  4FYD A;  4M3R A;  4B9T A;  5AQU A;  4KO0 A;  3AA4 A;  3HP6 A;  2YHB A;  3P39 A;  4BRQ A;  4CJQ A;  1VRT A;  2P9I A;  1S1T A;  3ZT0 A;  3ALY A;  1FKP A;  3ZX2 A;  3W3D A;  3EZ5 A;  4B1V A;  3SAH A;  4DTM A;  2E2O A;  1OH5 A;  4CJT A;  4H4M A;  3S41 A;  2A42 A;  3A2F A;  4LY7 A;  2ZJR L;  4BQL A;  1IBL K;  1VK0 A;  1EWQ A;  5HRP A;  5LL6 Z;  3U4L A;  4YFU A;  4LD0 A;  4JI6 K;  1X3N A;  4J8F A;  3F73 A;  5KPR A;  3IS9 A;  3LDL A;  1YIJ N;  2ZD1 A;  1CXQ A;  5M1P A;  3NVK A;  1IKX A;  3ATV A;  2JGU A;  1VHX A;  3H6E A;  1LCU A;  1Y97 A;  4BDP A;  3J80 O;  1RDA A;  3AVG A;  3ITH A;  4AHT A;  2YJE A;  1N34 K;  3WEE A;  5JVH L;  1NGG A;  1K8A O;  4KRE A;  1NJX A;  4JHD B;  4LH4 A;  5CE3 A;  1OH7 A;  1GLA G;  3V6D A;  3OW2 M;  3SAG A;  4LFC K;  4FLY A;  1WBB A;  3OYB A;  5HL7 L;  2PFU A;  2OPR A;  1U04 A;  3EY1 A;  5HP1 A;  4OPA A;  4GVE A;  3ZLJ A;  5GIN A;  1EX4 A;  1Q7Y O;  1W2B M;  4YDU A;  1U48 A;  3DOK A;  3Q7B A;  3FZF A;  2P9S A;  1QSS A;  1QQO A;  2Z1H A;  4E19 A;  3IAY A;  2YHA A;  4NXN K;  4XIU A;  4MFB A;  3EYZ A;  4PKG A;  2H3G X;  4FVU A;  3ENB A;  3KK7 A;  2RE2 A;  2EX3 A;  1XQS C;  5AQW A;  4JS5 A;  1QE1 A;  4DUY K;  3ZSZ A;  3Q7C A;  4Z94 A;  3MCP A;  2ZQB A;  3K5M A;  1T44 A;  3DLH A;  5E84 A;  3VER A;  3WT0 A;  3UIQ A;  4M3X A;  3FLC O;  4FOI A;  3SQ2 A;  4WE1 A;  3UKU A;  3VEV A;  4M41 A;  2W6K A;  1OH8 A;  1BI4 A;  3MN9 A;  1L3V A;  5DMR A;  5LMU K;  2D5R A;  1ATN A;  1ILY A;  4KB1 A;  2NNW A;  5AQS A;  5CR4 A;  1QZ6 A;  1S3X A;  4A57 A;  5TKW A;  3DXM B;  4JD2 A;  4L8R B;  4ID1 A;  5AFU A;  3CD6 N;  1J9A A;  1BIS A;  3SV4 A;  2PY5 A;  2UUA K;  1SV5 A;  2V51 B;  3CXC M;  5H1S Q;  5KQ8 A;  1ESV A;  2Y1J A;  2YI1 A;  1RTJ A;  4CHZ A;  2E2P A;  4CEZ A;  2FC0 A;  3AVK A;  4CJL A;  2YNF A;  4CJE A;  3K58 A;  1HMV A;  1HR0 K;  2O8D A;  4EHU A;  3IMX A;  4CJ3 A; 
#chains in the Genus database with same CATH homology
 4KHS A;  3NBP A;  3HL8 A;  1BI4 B;  1IKW A;  3KLG A;  4Z4E A;  3DRP A;  2G8I A;  1IKY A;  1RTI A;  3KJV A;  4Z4H A;  3RR7 A;  4LSL A;  4CEF A;  1IO2 A;  1KVA A;  4CF8 A;  1UOC A;  2HVH A;  4DLG A;  1TKZ A;  4CFC A;  3T3F A;  1ZBF A;  3AO3 A;  4W5T A;  3VA0 A;  4Q0B A;  4CJW A;  1N6Q A;  2F8T A;  3LZI A;  4CGJ A;  3QIN A;  2X6S A;  3O3G A;  4Z4I A;  5KRT A;  4KHQ A;  2F96 A;  1NK8 A;  4CGI A;  3V9U A;  4F2R A;  4KHY A;  2PYJ A;  3ULD A;  3P83 D;  3VA3 A;  5FRN A;  4F4K A;  1X9S A;  5SZT A;  3DI6 A;  1JLG A;  1S1X A;  3DMJ A;  4PA1 A;  4E7K A;  3K5O A;  2IOC A;  3HST B;  4JLH A;  3OS1 A;  4DFM A;  1D9F A;  1NJY A;  2EHG A;  3CYM A;  5CY4 A;  3AV9 A;  4EP5 A;  4UQG A;  2O4I A;  3THV A;  3LAN A;  4OPJ A;  1TK0 A;  4ELU A;  3V9Z A;  3PX4 A;  1KVC A;  4KV8 A;  4CGG A;  2Y1I A;  3I8D A;  4M3W A;  1RIL A;  3K5L A;  2VG5 A;  4RW7 A;  4HCC A;  4KTZ A;  3HP9 A;  2HVI A;  3DRR A;  3QES A;  1VSK A;  3SNN A;  1BQN A;  4N47 A;  1WN7 A;  4JRP A;  4F3O A;  3HT3 A;  3DLR A;  4FK2 A;  3I0R A;  3OYL A;  1W9H A;  1RT7 A;  4FJ8 A;  1REV A;  4N56 A;  4E3S A;  3SV3 A;  2IS3 A;  3G10 A;  3LAM A;  1ASV A;  3LP1 A;  1C0T A;  4B9V A;  4CGH A;  2E6M A;  4DQQ A;  3S3N A;  4FLU A;  1C1A A;  1I39 A;  1BL3 A;  3CFP A;  1NJW A;  1BQM A;  4DTP A;  1DTT A;  1T05 A;  4GVM A;  1LWC A;  5CYM A;  4CJ5 A;  3OS2 A;  1JXB A;  3MEE A;  1VSJ A;  4CFA A;  4IFY A;  4Z4C A;  2XO7 A;  4Y1D A;  4DLE A;  1LWE A;  4OLB A;  3O4Q A;  3U6F A;  1VSD A;  4B9S A;  4CJS A;  3G0Z A;  2R7Y A;  4DQI A;  4FJJ A;  4KRF A;  5C24 A;  1TKT A;  3LP0 A;  3RR8 A;  1SKS A;  2HMI A;  3ZT4 A;  4CGD A;  2BE2 A;  3DM2 A;  3MED A;  3DOL A;  4H4O A;  4O4G A;  3V1Q A;  3LWL A;  3KTQ A;  4E7J A;  1FXX A;  2HHV A;  2G8W A;  1VSI A;  4FLW A;  3U3Y A;  2DFH A;  2KQ2 A;  1NK4 A;  4NCA A;  4CHN A;  1A5X A;  3NE6 A;  1HQU A;  1KCF A;  2AJQ A;  4AHS A;  2DTU A;  4OLA A;  3L2U A;  4LSN A;  1NOZ A;  4CEB A;  4PQU A;  3DLG A;  3OYH A;  1KTQ A;  2RPI A;  4GMJ B;  3ZT1 A;  1RNH A;  4AH9 A;  2HNY A;  2BDP A;  4FJG A;  2HHU A;  4DSE A;  4CHO A;  4QOZ B;  1HYV A;  2B5J A;  4B9L A;  1HNI A;  2DFF A;  3H08 A;  1TK8 A;  5HLF A;  1BIU A;  1UA0 A;  3KLF A;  4JS4 A;  3SCX A;  3V9X A;  4BDY A;  2P51 A;  4DS5 A;  5J2N A;  1L5U A;  3TWH A;  4FW2 A;  4CF0 A;  4E0D A;  3SUN A;  3TR8 A;  1WNS A;  1QTM A;  4E1N A;  4FK4 A;  3NF8 A;  4OGC A;  4DTJ A;  1LWF A;  1J54 A;  1Z26 A;  4OVL A;  3SQ0 A;  3NF9 A;  3HVR A;  4FCY A;  2YNH A;  1NK7 A;  2FBY A;  4O44 A;  4DF4 A;  3KD1 E;  4YNQ A;  1DLO A;  4GW6 A;  1TV6 A;  4CHY A;  3AVC A;  1RTD A;  3HPH A;  1JKH A;  3WNE A;  2OYQ A;  4C8L A;  1TGO A;  3RTV A;  1T7P A;  3HJF A;  1UWB A;  3MEG A;  3MXJ A;  4HTU A;  3VQA A;  4B9M A;  1RT4 A;  1NKE A;  4M3Z A;  3ZSX A;  1O1W A;  4N5S A;  3D0P A;  2KFZ A;  3AO2 A;  5C42 A;  2GUI A;  2PZS A;  3LPT A;  1WAF A;  3MXM A;  3KKR A;  4DSF A;  4AHC A;  4RW8 A;  1JL1 A;  3AVF A;  3HM9 A;  1QHT A;  3SUP A;  4EZ6 A;  4B08 A;  4CEA A;  2IGI A;  1XI1 A;  1Q9X A;  1B9D A;  1TKX A;  2HNZ A;  1JLF A;  1CZB A;  4CK2 A;  1K6Y A;  5FRO A;  1KLN A;  1IH7 A;  1SL1 A;  2FBV A;  4DSL A;  1S1W A;  4AHV A;  5KI6 A;  4EZ9 A;  1RTH A;  4RW6 A;  4CER A;  5EU7 A;  3AA2 A;  4CJR A;  4CE9 A;  2VWJ A;  3CG7 A;  1ZBU A;  3M8S A;  4CIG A;  3L3V A;  3ZT2 A;  4M3U A;  1RT1 A;  4F3T A;  4CEQ A;  4KB0 A;  4W5R A;  2XY8 A;  1GOC A;  4FZZ A;  1NKB A;  2Z1J A;  1NJZ A;  1T03 A;  4QAG A;  4O0J A;  4Q5V A;  4DTS A;  1B92 A;  1JLB A;  1JLA A;  1U49 A;  1TL1 A;  4TSX A;  3ZSW A;  3NGI A;  3SQ4 A;  4J2B A;  4B3O A;  3QEI A;  4HUF A;  2Q3S A;  3HPG A;  3DLK A;  4CJF A;  3LWM A;  2RKI A;  1BCO A;  1VSE A;  1RBR A;  1X9M A;  1WSI A;  2QXF A;  1YVU A;  4DFP A;  2GV9 A;  4NCG A;  4K8X A;  1VSF A;  4ID5 A;  3T19 A;  4AIL C;  1YTU A;  3V9W A;  1ZBL A;  4KI6 A;  2XHB A;  4J2E A;  2JLE A;  3NGZ A;  1QSL A;  4M3Y A;  1SL2 A;  2I5J A;  3QIO A;  3OVN A;  3ISN C;  3OY9 A;  3AVA A;  4ZHR A;  4CJK A;  5K14 A;  1LV5 A;  3DYA A;  3QEP A;  3SYZ A;  1A5W A;  2ITG A;  4CCH A;  3AO1 A;  5J1E A;  3OJU A;  2HB5 A;  2XRI A;  4BE1 A;  4CF1 A;  3V1R A;  4EP4 A;  4DQS A;  3C95 A;  1HPZ A;  4PUO A;  4N41 A;  3NF6 A;  3BGR A;  1LAV A;  2OPP A;  2HND A;  4I9L A;  5SWM A;  4FJN A;  3KIO A;  1W0H A;  3NCI A;  4CES A;  2XY5 A;  1Q9Y A;  4ELT A;  3V9S A;  3VQ6 A;  5J2P A;  3AVI A;  2P5G A;  1NK0 A;  1CZ9 A;  1I3A A;  3OYF A;  3PV8 A;  3SI6 A;  1VSL A;  4FJX A;  1ZBH A;  4FJI A;  3HXM A;  3HK2 A;  3VQE A;  2VG6 A;  3HPO A;  4J2A A;  2OZM A;  2ATQ A;  2HW3 A;  4CIE A;  1TVR A;  2X6N A;  4E89 A;  3C94 A;  3D45 A;  4FJ7 A;  5FDL A;  3B6O A;  3VN5 A;  1HYS A;  2VWK A;  4IBN A;  5C25 A;  5HRR A;  3QEX A;  1WSG A;  1RT5 A;  3SUO A;  1JLC A;  3OYA A;  3VQ8 A;  3KLI A;  3RRH A;  1KFS A;  4DQR A;  1WSH A;  3V1O A;  3OS0 A;  2QK9 A;  1BIZ A;  1FK9 A;  3KK2 A;  3K5N A;  2FBX A;  3IG1 A;  3OYG A;  3V81 A;  3QET A;  4DTX A;  3QER A;  4FJ9 A;  1GOA A;  3NFA A;  1L3T A;  4Z4F A;  4I7F A;  3CM5 A;  3S3O A;  1BHL A;  2HHS A;  2X78 A;  4ICL A;  4M42 A;  3TAG A;  4DTR A;  4FZY A;  1S5J A;  2W42 A;  2WOM A;  1L3U A;  4CIF A;  1RBT A;  3LAK A;  4DSI A;  1R0A A;  1D5A A;  4B8C A;  5E41 A;  1Z25 A;  3OYN A;  1WLJ A;  1RBV A;  3ZSY A;  1X1P A;  4IG3 A;  2HHX A;  3O4N A;  3LP2 A;  4FJ5 A;  4KHU A;  1XHZ A;  1D9D A;  1RDD A;  3DLB A;  3VQ9 A;  4B9U A;  5DK5 A;  4KHW A;  5I42 A;  1MU2 A;  1WSJ A;  2D0A A;  3QLH A;  4CFD A;  5HRN A;  2G8H A;  3DRS A;  1S9E A;  3HO1 A;  4OKJ A;  3WNF A;  1RT6 A;  1L3S A;  2WON A;  3KKS A;  1NOY A;  2KW4 A;  1EXQ A;  4BE0 A;  1ASW A;  4C8O A;  3VQP A;  3TAP A;  3JYT A;  2HHQ A;  1KLM A;  1S1U A;  5CZ2 A;  4Z0U A;  4CK3 A;  5HBM A;  2Z1I A;  3CM6 A;  4CFB A;  3S9H A;  4KPY A;  3VQ5 A;  3ZCM A;  4J2D A;  4FM2 A;  1D8Y A;  4H8K A;  1ITG A;  4KTQ A;  1QQC A;  1WSF A;  4KKO A;  4CJ4 A;  3NHG A;  3ZT3 A;  2YNG A;  2D0B A;  3AVB A;  1S6P A;  4DQP A;  3TAF A;  2BAN A;  3AA3 A;  4RG8 A;  4RW9 A;  3SJJ A;  5FRM A;  4W5Q A;  3OYJ A;  4FJH A;  3LZJ A;  3TAN A;  3OYK A;  4DSK A;  4AHU A;  1N5Y A;  3ZSO A;  3NDK A;  3SQ1 A;  1NK9 A;  1JLQ A;  3L2V A;  3AVJ A;  3QEW A;  1Q8I A;  3ZSR A;  4CEO A;  1TK5 A;  4M3T A;  1VSM A;  3BDP A;  4NYN A;  2OPS A;  4M45 A;  4HUE A;  4FZX C;  1NKC A;  2LSN A;  4KI4 A;  4FJM A;  1VSH A;  1HQE A;  2XY7 A;  1SKW A;  4K8Z A;  1YT3 A;  4F2S A;  1ASU A;  1VRU A;  3V4I A;  3TAQ A;  4E7I A;  4QCL A;  1FKO A;  1YTA A;  1GOB A;  1G15 A;  4I2P A;  4FLT A;  4CED A;  3RMB A;  3PO4 A;  3AVM A;  4B8A B;  4DG1 A;  3MXI A;  4HCB A;  4N76 A;  4OKK A;  5JS2 A;  3TAB A;  4KHN A;  1C6V A;  3DLE A;  2O4G A;  2RF2 A;  4FJK A;  1NK5 A;  4DF8 A;  1QSY A;  1U4B A;  2P5O A;  1C0M A;  3O3H A;  3OYE A;  2G8V A;  1SKR A;  3TI0 A;  3RMA A;  4DTU A;  4HUG A;  1RBU A;  1TAU A;  3VQC A;  2KFN A;  3PY8 A;  4HHT A;  3E01 A;  4DU3 A;  4CEE A;  4W5N A;  1HJR A;  3AVH A;  4Y1C A;  3PX6 A;  4O55 A;  3RWU A;  2RN2 A;  3AVL A;  4OKE A;  4CK1 A;  4FLV A;  1RDB A;  3QNN A;  4KAZ A;  4DU4 A;  4BAC A;  1RBS A;  5I3U A;  3LP3 A;  3WNG A;  3OYI A;  3ASM A;  3WNH A;  4FYD A;  4M3R A;  3L8B A;  4B9T A;  4LH5 A;  4BE2 A;  3VQD A;  1QS4 A;  2ZE2 A;  4KO0 A;  3PUF A;  1RT2 A;  4O0I A;  3OYC A;  1RCH A;  3AA4 A;  1IKV A;  2YKM A;  5KGW A;  2VG7 A;  1LW2 A;  4IFV A;  3HP6 A;  1NK6 A;  4ZTJ A;  2YHB A;  4R5P A;  1KRP A;  4HVJ A;  3TAM A;  2G8F A;  4DSJ A;  2XY6 A;  1JXE A;  3P5J A;  2FBT A;  4CJQ A;  4CJP A;  4CF9 A;  1VRT A;  3KK3 A;  3QIP A;  4I2Q A;  3VQQ A;  1C1B A;  5HRS A;  3OJS A;  1S1T A;  4FJL A;  3ZT0 A;  4PY5 A;  3ALY A;  2IC3 A;  3LAL A;  3NH1 A;  1FKP A;  1WAJ A;  4IG0 A;  2YKN A;  3PX0 A;  3U3G A;  5CYQ A;  3M8R A;  3EZ5 A;  2QKB A;  4FLZ A;  2OZS A;  4DTM A;  5T7B A;  4KTW A;  1BCM A;  4CJT A;  4H4M A;  3PO5 A;  1CLQ A;  1B9F A;  3B6P A;  1EET A;  3A2F A;  2KZZ A;  4LY7 A;  2E6L A;  3MEC A;  4CHP A;  2Z1G A;  4DFJ A;  2YV0 X;  2OPQ A;  2ETJ A;  2GBZ A;  1TAQ A;  1VK0 A;  4IKF A;  1ZBI A;  5HRP A;  1EKE A;  2QKK A;  4YFU A;  4BDZ A;  4F8R A;  4LD0 A;  3VQ4 A;  3JSM A;  3NH2 A;  4ZTF A;  3F73 A;  2G8K A;  3IS9 A;  3CQ8 A;  2ZD1 A;  1HRH A;  1CXQ A;  4CJU A;  3AO4 A;  3TAE A;  1IKX A;  5J2Q A;  2JGU A;  4PWD A;  1S9G A;  4E7L A;  5J2M A;  4FXD A;  3L3U A;  4BDP A;  1Y97 A;  2DFE A;  3OYM A;  1KSP A;  1RDA A;  3AVG A;  4CJV A;  3ITH A;  2PYL A;  4I9Q A;  3HYF A;  4AHT A;  4FVM A;  1EP4 A;  4NYF A;  1ZYQ A;  2A1R A;  3NH0 A;  1UAX A;  4KRE A;  1NJX A;  1T8E A;  4LH4 A;  2P1J A;  3LPU A;  4RW4 A;  2NUB A;  4O5B A;  4NCB A;  1A5V A;  3V6D A;  3QO9 A;  4OJR A;  2B4J A;  3KK1 A;  1JL2 A;  2E4L A;  3O3F A;  4FLY A;  1S6Q A;  3OYB A;  1TL3 A;  5JS1 A;  2OPR A;  1LAW A;  1U04 A;  4BWJ A;  3EY1 A;  5HP1 A;  3RRG A;  3KD5 E;  3VQB A;  4CEC A;  2HHT A;  4E1M A;  1XHX A;  4W5O A;  2YNI A;  1EX4 A;  2B6A A;  4Z4G A;  4DMN A;  2DY4 A;  3L2Q A;  4KFB A;  1XC9 A;  5KGX A;  3QEV A;  1U48 A;  3DOK A;  4IDK A;  3SPY A;  3S3M A;  1QSS A;  2Z1H A;  3L2W A;  2A1S A;  4AHR A;  4E19 A;  3IAY A;  2YHA A;  4JRQ A;  1SUQ A;  1X9W A;  1C0U A;  4XIU A;  3K57 A;  3QNO A;  1J53 A;  4MFB A;  3MAQ A;  4MQ3 A;  1XWL A;  3EYZ A;  1U45 A;  4C8M A;  2X74 A;  1LW0 A;  3RMD A;  2EX3 A;  4JS5 A;  3TAR A;  1QE1 A;  1J5O A;  3ZSZ A;  2IAJ A;  3K5M A;  2IDO A;  2ZQB A;  3AO5 A;  4DFK A;  3T1A A;  3P1G A;  4OPK A;  3L2R A;  4DS4 A;  4B9N A;  3DLH A;  1U47 A;  3UIQ A;  4M3X A;  2KTQ A;  4FLX A;  4ELV A;  3AA5 X;  4FM0 A;  3SQ2 A;  3C6U A;  2D0C A;  3K2P A;  4WE1 A;  4CF2 A;  4M41 A;  1KFD A;  3IRX A;  3NF7 A;  4OGE A;  3K59 A;  3ZSV A;  3LDS A;  1TKD A;  3VQ7 A;  1BI4 A;  3ZSQ A;  2BGG A;  1L3V A;  1S1V A;  5DMR A;  2D5R A;  5D3G A;  4KB1 A;  1RDC A;  4DU1 A;  4C8K A;  1C1C A;  3F9K A;  1F21 A;  1BGX T;  5CZ1 A;  4FM1 A;  4FK0 A;  3C6T A;  3NAE A;  4DTO A;  3SPZ A;  3M8P A;  3KLH A;  1SL0 A;  3SUQ A;  1HNV A;  4ID1 A;  4L8R B;  5HRO A;  1HYZ A;  5KTQ A;  1J9A A;  1BIS A;  4BWM A;  4G1Q A;  3SV4 A;  4DTN A;  1DTQ A;  2PY5 A;  2KZM A;  1SV5 A;  3OYD A;  3SZ2 A;  3RMC A;  2F8S A;  4CGF A;  4FW1 A;  3AVN A;  4E7H A;  3HVT A;  3CFO A;  3CFR A;  5KRS A;  2Y1J A;  1RT3 A;  3FFI A;  2HHW A;  1RTJ A;  4C8N A;  2OA8 A;  4CHZ A;  4CEZ A;  1IG9 A;  1JLE A;  2FC0 A;  3AVK A;  4CJL A;  2YNF A;  3NGY A;  4CJE A;  1HMV A;  3K58 A;  1WSE A;  1CXU A;  1KVB A;  4CHQ A;  3I0S A;  2G8U A;  3KLE A;  4CJ3 A;  1UA1 A;  4DWI A;  3M8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...