1VSEA

Asv integrase core domain with mg(ii) cofactor and hepes ligand, low mg concentration form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title The catalytic domain of avian sarcoma virus integrase: conformation of the active-site residues in the presence of divalent cations.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endoribonuclease
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vseA00
2X78A 1RT2A 4DG1A 4CEZA 3M8PA 1JKHA 3TAMA 2GBZA 3I0SA 3SV3A 4DSFA 2ZQBA 2B4JA 2OZSA 5KTQA 1RBUA 3VQBA 4JRPA 3V9WA 2HVHA 3VA3A 4B9VA 2QKBA 1S1VA 1N6QA 4M3XA 2D5RA 3H08A 3PUFA 3HJFA 1J53A 1NOZA 4CHQA 3SJJA 3I0RA 1X9WA 1JLFA 3DOLA 3NCIA 4YFUA 3SV4A 3CQ8A 3OYHA 4OGEA 4F4KA 4DSEA 4HUEA 4NYFA 3T3FA 5J2PA 4N41A 1S9GA 4CGIA 2G8WA 5KRTA 4J2DA 3O4NA 4CFBA 3S3MA 4K8ZA 1U45A 3AO1A 3K59A 5C25A 4B9SA 1VSJA 4HUGA 4CEOA 3S3OA 4M3YA 3ZSZA 2OPQA 2HHXA 2Z1HA 3NBPA 3EZ5A 3VQDA 1T03A 4EZ9A 1CZ9A 1TL3A 4KTQA 3SUPA 3DM2A 4FJ7A 4FXDA 3DLHA 3MXMA 3SYZA 3JYTA 1RT6A 1JL1A 1Q9YA 4FVMA 3OJUA 3OYBA 4M3RA 4FM1A 3SI6A 1XC9A 3VQPA 4B9NA 2HNYA 3LALA 3NFAA 4IDKA 5KI6A 3NDKA 1L3UA 1CLQA 3KIOA 3U3YA 3AVHA 4HVJA 5HLFA 2XY6A 2AJQA 1NK4A 1L3SA 1HQUA 3CFOA 3OJSA 3K57A 3LP0A 5C24A 1Z25A 1BGXT 3LPTA 3D45A 4GVMA 4CHOA 3RMDA 1KFSA 1BI4B 1DLOA 1JLAA 3HP9A 3NH2A 4DTUA 1ZBLA 1U48A 4FW2A 5KRSA 3HXMA 3HM9A 3IAYA 4KO0A 3OYLA 1ASUA 1NJYA 4DSIA 4W5NA 3NGZA 4F8RA 1U49A 1JLGA 3TWHA 1RBTA 4CHNA 3LDSA 3D0PA 1NK5A 5HBMA 1B9DA 4FM2A 2W42A 1TKTA 4DU4A 3TANA 2ITGA 4Z4EA 3VQAA 1BISA 3DRSA 4AHRA 5FRMA 2OPPA 1YTUA 3KLGA 3QO9A 1CZBA 4CEFA 1TVRA 2WONA 2YV0X 3CM5A 1W0HA 3IG1A 4ELUA 3AVLA 1HYSA 3LP1A 4AHCA 4DTRA 5DK5A 1UAXA 4CJ3A 2DY4A 2VWKA 1O1WA 3HT3A 4JRQA 4CGGA 3B6OA 1RT4A 3AVMA 3DLEA 3HPHA 3NE6A 4KFBA 4RG8A 5CYMA 4RW4A 4ZTFA 4AHTA 1SUQA 2O4GA 3PO5A 1QSYA 3C94A 3SQ4A 3P5JA 4C8NA 1UA0A 4BDYA 1NKCA 1RBRA 2P51A 3KJVA 2Y1IA 4PQUA 1Z26A 4H8KA 4DFJA 2P1JA 4DQQA 4FLXA 3K5OA 4QOZB 3NH1A 1JLEA 3AVCA 1KRPA 4M3UA 4ZTJA 2YNFA 3ZCMA 4W5RA 4FK4A 4FM0A 4CJPA 2HHSA 3HYFA 3SUOA 3RMBA 2RN2A 1NK6A 3DI6A 1RTJA 3LPUA 4BE0A 4LD0A 2QKKA 4KREA 4FLTA 3K2PA 4NCGA 4B9UA 3QEVA 4KB0A 4PWDA 1DTQA 3OS1A 4I2PA 2RF2A 1TKZA 1T7PA 1S6PA 3DLKA 3ZSRA 3V9UA 4H4MA 3ZT0A 4CEEA 4R5PA 2XO7A 4DQSA 4F2RA 2GUIA 3AVIA 4M3TA 3BDPA 3CFRA 1C0UA 1X1PA 3ZSVA 4E89A 2DTUA 1QSLA 1WSEA 4PA1A 1S1XA 3HPOA 1FKOA 4FLYA 2E6LA 4CJUA 3DOKA 4B8CA 4CHPA 2BDPA 3SQ1A 3SPZA 5HRSA 4Z4GA 4Q0BA 1N5YA 2FBXA 3S3NA 2KZZA 1WSJA 2ETJA 4OKEA 3HVRA 3V81A 3PX0A 4OLAA 4OKKA 2HB5A 4BWJA 1UWBA 1IKWA 1GOBA 1VSEA 1Q9XA 3OYFA 5HRRA 4NCBA 1WSFA 4AHSA 4KHNA 3RR7A 1D8YA 5J2MA 1B9FA 1NK7A 1K6YA 1C1AA 1RDDA 4IFVA 4O55A 2HHTA 2HHWA 1HYZA 4CHZA 3U6FA 3HL8A 1HMVA 3KK3A 2HW3A 3L2QA 4FJHA 4CF9A 4M41A 3VQ9A 1CXUA 4DLEA 1ZBIA 4CIFA 3T1AA 3EYZA 1RT7A 4DMNA 3QEIA 4E7JA 1NKEA 1BCMA 4FW1A 1J5OA 2E4LA 2KFNA 3K5LA 1HNIA 4KTZA 4E7KA 2XRIA 2IGIA 3V1RA 2VG7A 4J2BA 3LZJA 4CERA 3VN5A 3TAFA 1F21A 1I39A 1R0AA 4W5TA 3CFPA 3TI0A 4O0JA 3ZT4A 3LAKA 3OYMA 4B9TA 3SQ0A 4HCCA 4KPYA 1TAQA 3TR8A 3OY9A 2JGUA 5JS2A 3C6UA 1D9DA 4TSXA 4FJ9A 2RKIA 3B6PA 3OS2A 4DTPA 4ID5A 2FC0A 1NK8A 4FZXC 4FK2A 2HHQA 3AVJA 5HROA 2DFHA 4DTMA 4KRFA 3E01A 5T7BA 4JS5A 2G8UA 4CIGA 4C8LA 1ZBHA 4CK3A 4OJRA 5KGXA 4CESA 3G0ZA 4NYNA 4LSNA 3EY1A 4CJVA 4DU1A 5I3UA 4M3WA 1ZBUA 3F73A 3RWUA 3QERA 1XHZA 1NJXA 4OKJA 1SV5A 1KTQA 1Q8IA 1LW0A 2KW4A 4CJQA 4J2EA 2OYQA 4MQ3A 1S1TA 3AVGA 2VWJA 3FFIA 5SWMA 1RTDA 3ZT3A 2DFEA 1VSKA 3AA2A 3SQ2A 2BGGA 1TK5A 3V9ZA 3RMCA 1IG9A 1REVA 3V6DA 3VQ7A 4HUFA 3SNNA 4DQRA 1NK9A 1ITGA 3OVNA 3PX4A 4DQIA 2HHVA 1EETA 4IBNA 2F8SA 3ITHA 3MEGA 3L3VA 4CGHA 4BE2A 2IC3A 3V9SA 2G8KA 3V1OA 2BE2A 3RRHA 4ELTA 4KHUA 4OVLA 1WSHA 1WNSA 1YVUA 3CM6A 4DF4A 4FLZA 1C6VA 1U47A 4EP5A 3PO4A 4BDPA 1TK8A 5SZTA 3QESA 4DF8A 1NOYA 2G8VA 3KKSA 4KI4A 2P5OA 4DSJA 2OPRA 4KB1A 3M8RA 4CF0A 1BIZA 1HPZA 4CGDA 1TAUA 1LWEA 4FJXA 4J2AA 2GV9A 2X6SA 2OPSA 3PX6A 1BHLA 1JLCA 4RW9A 3U3GA 4CJTA 4E1NA 3DRPA 1ASVA 4M3ZA 4PUOA 4G1QA 2F96A 3HVTA 4B08A 1VSIA 4F2SA 3AVBA 4I7FA 1UOCA 3OYIA 1IKVA 4CHYA 4ELVA 3HP6A 1EP4A 4HHTA 4E0DA 2QK9A 5E41A 3AO4A 3AVAA 1RBVA 3QIOA 1B92A 3MXIA 4FJIA 1GOCA 4UQGA 4W5OA 1LAVA 1VK0A 3O3FA 3CG7A 1I3AA 4ID1A 4E7HA 2A1RA 3MEDA 1JLBA 4E1MA 2E6MA 3SZ2A 1ASWA 1VSFA 1A5VA 1HNVA 4FLUA 3THVA 1RDAA 1EXQA 1JXBA 1RDBA 4CE9A 4EP4A 1BCOA 1G15A 4CJLA 1LW2A 5HRPA 3O3GA 3SUNA 1T05A 4FJGA 4O0IA 2PYLA 4KHSA 1L3TA 3AO2A 5FROA 4B9MA 3MEEA 5HP1A 1CXQA 4CJWA 1NJWA 1WLJA 3K5MA 2G8FA 3HSTB 3L2VA 1LAWA 4AHVA 3QNNA 4FJNA 1VSMA 3KK2A 4BWMA 3QIPA 3L2UA 3RRGA 4I9QA 1FKPA 2ZD1A 4DQPA 1S1UA 3L8BA 1FXXA 4DS5A 4CCHA 4M42A 3AVFA 2NUBA 3V4IA 3NF9A 1W9HA 4N56A 3QNOA 3SUQA 4PY5A 1D5AA 3OYCA 1BL3A 4I2QA 4CJEA 3TABA 4Z0UA 3MECA 1BI4A 4ICLA 4OLBA 3MAQA 3DLGA 5HRNA 4E7IA 1RNHA 3AVNA 4BE1A 3VQ4A 2RPIA 1BQMA 3WNHA 3KD1E 2HMIA 5FDLA 2I5JA 3PV8A 1TGOA 4N47A 3NF8A 3G10A 1GOAA 1VRTA 1QE1A 3T19A 5J2QA 2WOMA 3CYMA 2PZSA 4O5BA 4CEQA 2R7YA 3WNFA 4DS4A 1NKBA 4BACA 3NF7A 2PY5A 2B5JA 3L3UA 3NGYA 3L2RA 2IDOA 4E19A 3AA5X 1T8EA 4Z4FA 4KKOA 3C95A 3HK2A 2HHUA 1KCFA 5C42A 4ZHRA 5EU7A 4CJRA 3SCXA 1SKSA 1ZBFA 3DMJA 1JL2A 4LH5A 3LP2A 4C8OA 2XY5A 4LSLA 2XHBA 1EKEA 3OYGA 3AO5A 1KVAA 4OGCA 1QHTA 3NAEA 1IO2A 1C0MA 1HJRA 1TK0A 2IS3A 2YKNA 4QAGA 3OS0A 3JSMA 3S9HA 2P5GA 1DTTA 2LSNA 2D0CA 3M8SA 4DFPA 4H4OA 2IAJA 4Q5VA 1UA1A 4FJKA 4KHWA 3RMAA 4XIUA 2KQ2A 1U4BA 1TL1A 4WE1A 3OYKA 2X6NA 1TV6A 4HTUA 2O4IA 1IKYA 4RW7A 3LWLA 2ZE2A 3ZT2A 4B8AB 3C6TA 4CEBA 4CFAA 3KKRA 4FLVA 3P1GA 1LV5A 3LP3A 3QETA 3TAEA 1KLNA 4JS4A 4CF1A 3TARA 5CY4A 1QSSA 5CZ1A 1D9FA 1SKRA 4Y1DA 3NGIA 4DWIA 4KHQA 1C1BA 4OPJA 4CK1A 5J1EA 4FYDA 1TKXA 2FBVA 2X74A 1KLMA 3AV9A 1WN7A 1HQEA 4DTSA 4NCAA 2F8TA 4FZYA 1A5WA 3QINA 1LWCA 3K5NA 4N76A 4C8MA 1L5UA 3A2FA 1C1CA 2D0BA 3IRXA 1TKDA 3M8QA 3OYJA 4DFKA 1X9MA 2YHBA 1RDCA 3RTVA 5I42A 4KV8A 3NF6A 4CEDA 1J54A 5J2NA 3LAMA 4CJSA 1YT3A 1HYVA 3OYDA 4GMJB 3TAPA 4CJKA 4MFBA 3ZT1A 4DFMA 1RT3A 3AO3A 5CZ2A 4KAZA 3V1QA 3DRRA 3P83D 2G8HA 4AHUA 4E3SA 2FBTA 2Y1JA 4L8RB 1RBSA 3VA0A 4YNQA 5JS1A 2A1SA 4IG3A 3ALYA 4OPKA 3VQQA 3VQ6A 2KTQA 3AA4A 1J9AA 3NHGA 3AA3A 3BGRA 1KVBA 2QXFA 4FJ8A 4CJFA 2Z1IA 3OYAA 4FJJA 3VQCA 4DU3A 4Z4IA 2KZMA 2YNGA 4RW8A 3LZIA 3ZSQA 1KFDA 1QTMA 4JLHA 1BIUA 3PY8A 4RW6A 3O4QA 4IKFA 4DSLA 1IH7A 4LH4A 4AH9A 4CGFA 3NH0A 4Z4HA 4GW6A 4IG0A 1XWLA 5CYQA 4CGJA 3KTQA 4FCYA 4DTNA 3LANA 1RTIA 1ZYQA 1QQCA 4FK0A 4Y1CA 4B9LA 4CFDA 2XY7A 3ZSWA 3ASMA 1WAFA 1RILA 3KLIA 2EHGA 4LY7A 1S1WA 4DLGA 3TAGA 1WAJA 4CJ4A 1RT1A 1SL2A 1Y97A 1C0TA 1MU2A 4CK2A 4KI6A 2VG5A 2YNIA 3QLHA 1VSHA 3DLRA 4N5SA 3K58A 2OA8A 4O44A 3ZSOA 3LWMA 4FZZA 3QEPA 3KLFA 3QEXA 4AILC 2Q3SA 2YKMA 1XI1A 2KFZA 3F9KA 4B3OA 1U04A 1VRUA 4DSKA 2HNDA 4CFCA 3RR8A 5FRNA 4BDZA 1JXEA 3ZSXA 4CJ5A 3DLBA 3KK1A 1X9SA 2OZMA 3WNEA 4F3OA 3OYNA 3I8DA 3AVKA 3MXJA 4O4GA 1S9EA 2EX3A 3VQ5A 4FJ5A 4KHYA 1XHXA 3KLHA 1S6QA 4CF2A 4Z4CA 1SKWA 1VSDA 1WSGA 2BANA 3ZSYA 1EX4A 4CEAA 1BQNA 3QEWA 4HCBA 2HNZA 1SL0A 4FJMA 3SPYA 1YTAA 4FJLA 2HVIA 1QS4A 4C8KA 3DYAA 2PYJA 2G8IA 3VQEA 4CECA 2ATQA 4E7LA 3V9XA 4M45A 1A5XA 5DMRA 1HRHA 1IKXA 1S5JA 4DTOA 4F3TA 2Z1JA 4QCLA 2FBYA 4I9LA 4FLWA 2JLEA 2D0AA 3IS9A 4DTJA 1WSIA 5K14A 1L3VA 3WNGA 4IFYA 4DTXA 3UIQA 1RT5A 1VSLA 3O3HA 4KTWA 4EZ6A 2XY8A 3OYEA 2IOCA 3ISNC 1KVCA 3KLEA 2VG6A 2YHAA 3ULDA 3HO1A 1NJZA 2DFFA 1NK0A 1FK9A 2B6AA 3VQ8A 1RCHA 3KD5E 4CF8A 1JLQA 1KSPA 1SL1A 4K8XA 2Z1GA 3L2WA 2YNHA 4W5QA 5D3GA 1RTHA 3TAQA 5KGWA 4CIEA 3HPGA 1LWFA
chains in the Genus database with same CATH superfamily
1T6DA 2B4JA 2O8DB 3DJCA 1RBUA 4JI0K 3CCLN 4B9VA 1N6QA 4M3XA 3HJFA 1J53A 1X9WA 3DOLA 1E4FT 4KH6A 4J2DA 4CGIA 4EIAA 4XH4A 2UUCK 3S3MA 4K8ZA 4B9SA 4FWLA 4HUGA 4CEOA 2NLXA 2OPQA 3M3ZA 4NXMK 3TTFA 4DUZK 3VQDA 2F7TA 4PL7A 4CJ7A 3D2FA 4CW7B 3SUPA 3DM2A 4DUYK 1Z05A 1JL1A 3OJUA 3SI6A 4M3RA 1XC9A 2HNYA 3LALA 2IVPA 3NFAA 1L3UA 3KIOA 2O8FB 1YVNA 2E2NA 3FZMA 4MO5A 3WXKA 1BGXT 3D45A 5LY3A 3GE1A 1KFSA 3HP9A 1S72N 1HR0K 4KHPK 1N32K 4DSIA 1ZC6A 2QWOA 1NK5A 4DU4A 1TKTA 3R1XA 3TANA 1M90O 3VEVA 3LDPA 4BRLA 5FRMA 2OPPA 3A5LC 3KLGA 1VQNN 5FPDA 2P9SB 3IG1A 1HYSA 3ZEUA 3CF5L 4GV6A 5DK5A 2F9WA 2VWKA 3AVMA 4AF1A 4KFBA 4GV3A 4RW4A 4ZTFA 2P9LA 3SQ4A 3P5JA 1SQKA 3MX5A 1NKCA 2P51A 1Z26A 4DFJA 1O13A 2P1JA 3TTDA 3H1VX 2ITMA 4FLXA 1VQ4N 1KRPA 3G71N 3ZCMA 5C10A 4FM0A 4CJPA 2HHSA 2QXLA 3RMBA 3DI6A 2A5XA 3WQTA 4BE0A 4LD0A 4NCGA 3M5RA 4JKAA 4ILHA 4PWDA 2Q0UA 3O1BA 1TKZA 4DV2K 3DLKA 3ZSRA 1KAZA 3V9UA 4R5PA 3AVIA 3HOTA 1C0UA 3ZSVA 4E89A 2DTUA 1OVQA 3GBTA 3ULEA 2O8FA 1FKOA 3AARA 3SPZA 4Z4GA 4JK9A 4Q0BA 2FBXA 3S3NA 2UUBK 1HX1A 4OKEA 4OLAA 2HB5A 3CMAN 5AQJA 1WSFA 4KHNA 3I33A 4NLCA 5GAHP 5CHIA 1HYZA 2HHWA 1HMVA 3ENHA 3KK3A 2HW3A 4DR7K 4M41A 3VQ9A 1CXUA 2ZWHA 2F9TA 4DLEA 3T1AA 4GKJK 1RT7A 4FW1A 2KFNA 4KTZA 2YHWA 4CD3A 4CBXA 3VN5A 1F21A 1R0AA 3TI0A 4B9TA 3LAKA 4HCCA 1TAQA 3TR8A 5JS2A 3A8YA 1WB9A 5JICA 5M1PA 1HNXK 4OJRA 2OANA 4NYNA 4M3WA 4CJVA 1ZBUA 3F73A 3RWUA 4FWSA 4QS9A 2KW4A 4CZLA 4J2EA 3AVGA 2VWJA 3NVMA 2DFEA 3EEQA 1ILYA 3RMCA 1REVA 1JCGA 4DQRA 3VMFB 3PX4A 1EETA 2IVNA 4FWRA 2FF6A 4YDUC 4BE2A 3V9SA 1K9MO 4MDAA 3V1OA 3RRHA 4ELTA 4KHUA 1C6VA 5M1OA 4KB1A 2OPRA 3HZ6A 2VCPA 3WT0A 4AQYK 4J2AA 2GV9A 2OPSA 1BHLA 1JLCA 4K42A 5GINA 4RW9A 4CJTA 3QICA 5JMVA 4IJNA 1ASVA 3VEYA 2GUPA 5AQPA 2VWBA 4ELVA 2QK9A 5E41A 1RBVA 1B92A 3RSEB 3U9ZA 1T44A 1LAVA 3O3FA 3CG7A 4E7HA 2A1RA 5E26A 4E1MA 4FWNA 3O3GA 1QHAA 3LM9A 2O8BA 4KH5A 4NLBA 3HSTB 3G6EN 1LAWA 3QIPA 3ZX3A 1FXXA 4J8FA 3O1WA 3SUQA 1D5AA 1BL3A 2V52B 4CJEA 4YHHK 4Z0UA 3TABA 2V7YA 3A5MC 4E7IA 3AVNA 3VQ4A 2RPIA 3KD1E 2OCEA 2P9IA 3NVKA 3NF8A 1NGAA 4JI2K 3G10A 4FOEA 1VRTA 3T19A 2ASPA 4CEQA 3WNFA 3J80O 4BACA 4LF6K 1BG3A 4Z4FA 2UXCK 3THXB 4KKOA 3C95A 4MDBA 4BG9A 4JI7K 1NGCA 3KVGA 5GIOA 4OPAA 4CJRA 3SCXA 3J7AP 4NB4A 4X64K 4LFCK 5AQVA 4IDHA 1EKEA 4OGCA 1QHTA 1IO2A 1VQ9N 3JSMA 4QAGA 3S9HA 1DTTA 5BN9A 4FWPA 4Q5VA 3AAQA 1UA1A 3PSIA 3RMAA 4XIUA 2KQ2A 1U4BA 1TL1A 2X6NA 1TV6A 4JKGA 4HTUA 3TU5A 2ZE2A 4BC5A 3KKRA 3EN9A 4I6MA 5AQLA 2F8SA 4CF1A 3TARA 3JXUA 5CZ1A 3NGIA 4FYDA 3N4QA 2X74A 2FBVA 3I8BA 1KLMA 5FPNA 1HQEA 3THWB 1YXQA 1NM1A 3QINA 1LWCA 3ZETA 4A5BA 3THYB 1C1CA 4DFKA 3IMXA 2HBKA 2H3GX 5E84A 3ID8A 5J2NA 3KHYA 2NRZA 1YT3A 3WXJA 2A3ZA 3OYDA 1VQPN 3TAPA 4CJKA 4MFBA 4DFMA 4ILJA 3AO3A 3DRRA 3WEEA 4O5FA 2QW9A 3BP8A 4BRGA 2P9PA 2A1SA 4IG3A 3VQ6A 3AA4A 3CJCA 1J9AA 3NHGA 2QWNA 3AA3A 2E2QA 3MX2A 4CJFA 4FJ8A 3OYAA 4DU3A 2UXBK 2KZMA 4JLHA 5AQUA 4RW6A 1KD1O 1FJGK 4CGFA 5AQIA 1YJ9N 4CGJA 3HBTA 1RTIA 2BTFA 4Y1CA 3HOSA 4CFDA 5B8HA 1QZ5A 1RILA 5BPMA 3TAGA 4C1NK 4DR6K 4LFBK 1RT1A 1SL2A 1C0TA 5BRDA 4KI6A 2VG5A 3DLRA 4N5SA 2I7PA 4CZGA 4FZZA 4RWTA 2Q3SA 2CH6A 3FZKA 3CJBA 2CGKA 2D0OA 1GLFO 4BDZA 5KPRA 2IVOA 5JVGL 1N34K 2OZMA 4O4GA 1TYQA 1S6QA 2HMPA 3QEWA 1Q86O 1XNRK 3DYAA 1GLEG 2PYJA 3CD6N 3VQEA 3V9XA 4F3TA 2AJQA 3HM8A 2FSJA 2JLEA 2HBMA 5K14A 4B1WB 3F9MA 1RT5A 1VSLA 4KTWA 2P9UB 4CZHA 3OBYA 2VG6A 5AZJB 3ID6A 3VQ8A 1RCHA 3KD5E 4CF8A 1YAGA 3P4IA 1SL1A 2Z1GA 3L2WA 4W5QA 4DV0K 3HPGA 1LWFA 4DB3A 4DG1A 1JKHA 3TAMA 1HJOA 2ZQBA 4DHYA 2OZSA 3BZKA 1K73O 3V9WA 2HVHA 4FPAA 5GIPA 1DEJA 1G99A 3H08A 3DXMA 3UB5A 4YFUA 3SV4A 3CQ8A 3OYHA 4OGEA 2GWJA 4DSEA 4HUEA 5J2PA 4CZMA 4N41A 3BF3A 4WF9L 4CFBA 1U45A 3FZLA 3O5BA 3AO1A 4LFAK 5IT9O 1ATSA 1YUWA 2Z1HA 4A59A 3EZ5A 4EZ9A 1CZ9A 4KTQA 4FJ7A 5IWAK 3SYZA 4H0YB 3EE9A 1Q9YA 4IEIA 4FM1A 3VQPA 1CLQA 3NDKA 5KI6A 3AVHA 1L3SA 4BR5A 3OJSA 1NKEA 3LP0A 4CHOA 4XH1A 2E8AA 1W2BM 3RMDA 1BI4B 1DLOA 3NH2A 4M7YA 1U48A 3CXCM 5AQGA 3UKUB 3HXMA 2P9UA 3IAYA 1NJYA 2VQFK 3TWHA 1RBTA 3VEWA 5HBMA 2WTUA 2W42A 4X66K 3VQAA 5EX5A 5AZIB 4ILGB 2HF3A 4BRAA 5M1NA 1D4XA 1YF5L 3LP1A 1IG8A 2V51B 3HT3A 4JRQA 3MN5A 3B6OA 2WUSA 3NE6A 1IBKK 4RG8A 4BRNA 3C94A 1UA0A 4OO1J 4CVNE 4H0VB 4QOZB 1JLEA 2HHHK 4W5RA 2BH1A 2P9KA 3HYFA 4HWIA 1NMNA 3LPUA 3BZCA 4KREA 4FLTA 3TSQA 1S6PA 2VGNA 4H0TB 2NRVA 1I94K 1X1PA 4C1NI 4PA1A 4WQ4C 3HPOA 2E6LA 4CJUA 1XUPO 5HRSA 2KZZA 3V81A 3M1FA 4BWJA 1M1KO 5AQXA 3ZYYX 5HL7L 1Q9XA 3RR7A 1E4GT 5J2MA 1K6YA 4CZIA 1RDDA 3SMSA 4JN4A 1JJ2M 1QQMA 3BY5A 1XMOK 5C0YA 3L2QA 1YJWN 4DMNA 3QEIA 4E7JA 2E4LA 4E7KA 2XRIA 3V1RA 4CD1A 4FOIA 1HNZK 1KAYA 3E1YA 3CFPA 1Q82O 3SAHA 3GL1A 4FSVA 3OY9A 1S22A 3C0BA 4TSXA 4YOVA 2RKIA 3B6PA 4DTPA 2HHQA 4FZXC 3VF4A 1OH5A 5HROA 2DFHA 3FGUA 4CZKA 2ZGZA 4DTMA 4JS5A 5T7BA 4JI5K 4PKIA 2ASMA 4AM6A 5KGXA 3AGRA 1C0GA 3E66A 3I55N 3EY1A 3VETA 4JI6K 3ATUA 1NJXA 1SV5A 4WQ5C 1Q8IA 5AR0A 5I9EB 3VERA 4CBUA 3FFIA 5SWMA 2P9NB 3ZT3A 3C7NB 4FWMA 3SQ2A 2RE2A 1IG9A 3V6DA 4HUFA 1OH8A 3O9QA 1SZ2A 3CIPA 4CGHA 5MLCQ 5CR4A 2IC3A 1Z6RA 1K8AO 1WSHA 1WNSA 4DF4A 3CM6A 1U47A 3PO4A 4JHDA 4BDPA 3A5NC 5SZTA 2G8VA 4ISGA 3KKSA 3WUHA 1K8KA 1RFQA 3TSUA 3H45C 4DSJA 4LF9K 3AGKA 5DM6L 3EL2A 4BRMA 5FLXO 3H6EA 2X6SA 4H5WA 3PX6A 1TUYA 2E88A 3TPQA 4G1QA 2O8DA 3MWPA 2F96A 4F2SA 3NMUA 3IUCA 4LF4K 1Q18A 1EP4A 4A5AA 3AO4A 2O8EB 1U2VB 1NGIA 3MEDA 3OHRA 3K9JA 3VOVA 1VSFA 3QFPA 4EP4A 3SUNA 2JWLA 2D1KA 1R59O 5ADXA 5HP1A 4Y0WA 1NJWA 2G8FA 3KK2A 3RRGA 4BRDA 2W6LA 1FKPA 2P9NA 2VYPA 1NGJA 4DS5A 3IDHA 3AVFA 1NGGA 3NF9A 1W9HA 3QNOA 1WOQA 5GADP 3O08A 3MECA 2PBDA 5AQWA 4BE1A 2Q1NA 3WNHA 1BQMA 4DR4K 3E9OA 1NGBA 3PV8A 2YJFA 3CJAA 4V19S 2VGMA 3CYMA 5AQSA 3HI0A 4O5BA 4JKDA 2P9SA 3CETA 2PY5A 3L2RA 3AA5X 1XNQK 3HK2A 5BRHA 1KCFA 2QWPA 5C15A 5F1XA 3PIPL 1SKSA 3DMJA 4LH5A 4FVUA 4C8OA 3AO5A 3NAEA 2IS3A 1GLBG 3OS0A 2ZGYA 4JK8A 2P5GA 3IKMA 4H5TA 5FPEA 1GLDG 4FJKA 2GTDA 4WE1A 1YI2N 4RW7A 3OA9A 4FLVA 3R8EA 4JV5K 2AA4A 4Y1DA 4DWIA 4KHQA 3CQYA 5J1EA 1TKXA 3AV9A 2QEXN 4DTSA 4NCAA 4FPBA 1BO5O 1V4SA 1EWRA 1L5UA 1E3MA 3IRXA 3M8QA 1X9MA 3SMPA 1NLVA 3RTVA 3O9SA 3E9PA 2QM1A 3NF6A 4B1UB 5KQ8A 3KK7A 3CHWA 3IFRA 4BRPA 4BR0A 5CZ2A 3CCQN 4AHUA 4E3SA 3VF6A 1HPMA 5KPZA 1NGDA 1LCUA 2O8CB 4BGAA 3BGRA 2QXFA 1VQLN 3VQCA 2YNGA 4RW8A 3LZIA 3LDNA 2J4RA 4U67L 1IH7A 4LH4A 4AH9A 5EXWA 1IBMK 4Z4HA 3HTVA 2HOEA 4IOXA 4IG0A 1HNWK 3KWGA 3KTQA 3LANA 1QQCA 2E1YA 1N8RO 4B9LA 3MN7A 3KLIA 4H0XB 3J7ZO 4LY7A 4CI6A 4JKCA 4DLGA 3VTIA 4CJ4A 1Y97A 3KWIA 3J7YP 2YNIA 4FWOA 1S3XA 3LWMA 1EQYA 5C12A 3QEXA 1U04A 5JLHA 4DSKA 2HNDA 4DQ8A 4H5NA 4CJ5A 3DLBA 4XEIA 2QI2A 3W3DA 4Z94A 3VQ5A 3KLHA 1SKWA 2FF3B 4JAXA 2HNZA 4FJMA 1JCEA 5JLFA 4C8KA 4RTFD 1IKXA 4QCLA 2Z1JA 4I9LA 4FLWA 2EWSA 3IS9A 4DTJA 2OTJN 5M1KA 3WNGA 4DTXA 4A62A 2QTDA 4DR2K 3QB0A 4YDUA 3KLEA 2YHAA 3HO1A 4BRCA 1NJZA 1NK0A 4CZEA 2FSNA 4NXNK 2YI1A 3RSEA 1KSPA 3ZX2A 5D3GA 2YNHA 5KGWA 4CIEA 4CEZA 4DSFA 3QFUA 3VQBA 1VQ6N 3D2EB 2QKBA 2D5RA 1NOZA 3SJJA 3T7ZA 3QDKA 1JLFA 4F4KA 3T3FA 4NYFA 1S9GA 5M1FA 3O4NA 3C6AA 5C25A 3S3OA 1GLAG 4B3SK 4YOUA 3NBPA 1T03A 2D4WA 1TL3A 3DLHA 3L6QA 3JYTA 4JK7A 5H1SQ 1HKGA 2KLAA 3OYBA 5FPMA 1P90A 4B9NA 2NRRA 4IDKA 4B1YB 3U3YA 5HLFA 1H1VA 3CFOA 3K57A 1Z25A 1RDWX 3THXA 1ZBLA 4DTUA 4X65K 2RHKA 2JWKA 2E5LK 3UKRB 4A61A 4FW2A 1ASUA 4W5NA 5C2FA 1U49A 1JLGA 4CHNA 3LDSA 3D0PA 4FM2A 4B3RK 4DR1K 2ITGA 3DRSA 1YTUA 3QO9A 4CEFA 5TKWA 2ZJPL 1TVRA 2WONA 2YV0X 3CM5A 1W0HA 4ELUA 2A41A 2NNWA 1QZ6A 4AHCA 5A2QO 2NRWA 1O1WA 2I7NA 3R9PA 3HPHA 3VEOA 3VPZA 3N4PA 4AHTA 2O4GA 3PO5A 1QSYA 4A57A 4C8NA 4PQUA 1WUAA 5LMUK 4DQQA 2PAVA 3THWA 3DXKB 3K5OA 3THYA 3NH1A 3AVCA 3CPEA 3C6HA 1IBLK 3SUOA 4BR7A 4JI3K 4LC9B 3K2PA 4BVPA 2CGLA 4B9UA 3QEVA 4KB0A 4DKWA 3OS1A 1FW6A 2RF2A 1T7PA 4B1VA 3CCUN 2W6KA 4H4MA 4CEEA 2GUIA 1WSEA 3CCEN 1VAZA 3DOKA 4B8CA 3SQ1A 3ZLJA 1N5YA 1MWKA 5KPTA 1WSJA 4OKKA 4BRIA 1UWBA 3UKRA 1IKWA 1GOBA 5AQFA 1VSEA 5HRRA 4NCBA 4JEPA 4B1XB 1D8YA 2KKZA 1B9FA 2ASOA 4OX9K 3CJ7A 1C1AA 4IFVA 4A2BA 3J8AA 2HHTA 3U6FA 3HL8A 1J5EK 5BR9A 4CF9A 5LMNK 1ZBIA 4BR4A 4WCEL 1BCMA 2A6AA 4AM7A 5ADXH 3FFKB 1NGEA 3CPWM 1HNIA 3L0QA 2IGIA 2VG7A 3TAFA 2GEMA 2GWKA 1I39A 4K25A 4O0JA 4G9ZA 3SQ0A 2HSTA 1X3MA 3C6UA 1Q81O 4FJ9A 5HOOA 4FK2A 4ID5A 1NK8A 4KH4A 5JVHL 4ISFA 4KRFA 3E01A 2G8UA 4IOAL 1ZBHA 4CIGA 2E2PA 4FWKA 4CK3A 3WXLA 3VF2A 4LSNA 5TKYA 4YY3K 5EOYA 4IOCL 4OKJA 1KTQA 1X9JA 4MO4A 3S41A 4CJQA 4MQ3A 1S1TA 4H0PA 4EFHA 1VSKA 3AA2A 2CH5A 3O9UA 3V9ZA 1NK9A 1ITGA 1NNEA 1DKGD 4IBNA 3ITHA 4H03B 4CBWA 1P8ZA 2G8KA 2YHYA 4IO8A 2BE2A 3PLAA 4FLZA 4EP5A 1TK8A 3QESA 1BUPA 4DF8A 1NOYA 4KI4A 5AZJA 4U7BA 1BIZA 1HPZA 4CGDA 1TAUA 1LWEA 4FJXA 4E1JA 4DR5K 1QQNA 1MA9B 3U9DA 4PHTX 4E1NA 4KBOA 2E1ZA 4H5VA 5AQZA 1HKCA 3HVTA 4B08A 1YITN 4I7FA 3TSPA 4HHTA 4HTLA 3AVAA 3QIOA 4FL9A 4FJIA 1W97L 1I3AA 4BG8A 1JLBA 3LL3A 2E6MA 3UE5A 3SZ2A 1A5VA 2E20A 3THVA 1RDAA 1EXQA 4CE9A 1RDBA 1BCOA 4FJGA 1T05A 4KHSA 4B9MA 1CXQA 4CJWA 2QWMA 1WLJA 3L2VA 3QNNA 3CMEN 4X62K 2HBJA 1VSMA 4FJNA 2ZD1A 4DQPA 4BC4A 3CCMN 3L8BA 4M42A 4CCHA 3GG4A 1T3VA 2NUBA 3V4IA 4PY5A 1ZXOA 4GKKK 3OYCA 1KQSM 1XC3A 4I2QA 3A5OC 3MWTA 1BI4A 4IJAA 3MAQA 3D2FB 3DLGA 5HRNA 1RNHA 5AQHA 3UKUA 2HMIA 5FDLA 3F5TA 2I5JA 4N47A 2WFBA 1IV0A 1GOAA 3O80A 3VEXA 4WFAL 4B3TK 3CCSN 2WOMA 5AZIA 2R7YA 4BQLA 3B8AX 1T8EA 2IDOA 4E19A 3W0LA 4WFBL 3OTOK 5EU7A 4BROA 1QQOA 1ZBFA 1JL2A 2GELA 2UXDK 3LP2A 1BA1A 2XHBA 3OYGA 3SAFA 2WBNA 1C0MA 5GAGP 5KQDA 2YKNA 4M7XA 5AFUA 4DFPA 4H4OA 1WBBA 2QWRA 4KHWA 2WC9A 3ZEUB 4LF5K 5AQTA 3OYKA 3CCRN 4BR9A 1IKYA 3ZT2A 1LV5A 4CFAA 3JAMO 3P1GA 3LP3A 2UU9K 2P9LB 5CY4A 5AQKA 1SKRA 2YX6A 4CK1A 5AJ3K 3R6MA 4BGBA 3JS6A 3CCJN 1WN7A 4FZYA 5GAEP 3K5NA 4N76A 4R79A 3A2FA 3OYJA 2YHBA 1NGFA 2IIRA 1RDCA 5I42A 2KHOA 1J54A 3LAMA 4CJSA 3E9LA 1HYVA 4GMJB 1V4TA 3ZT1A 1RT3A 3V1QA 3SLCA 2UUAK 4BRKA 2G8HA 4JI4K 3ULEB 1RBSA 3VA0A 4YNQA 5JS1A 3EZWA 3GOIA 3VQQA 4IFEA 4WQ4A 2FXUA 1KVBA 2Z1IA 4Z4IA 2FLOA 4ISEA 3ZSQA 1KFDA 1QTMA 1BIUA 4H5RA 1BU6O 1DT9A 4DSLA 2Q31A 4EHUA 4GW6A 1XWLA 5CYQA 3FZFA 3MN9A 2XY7A 3ASMA 2D0PA 2EHGA 4PL8A 1VQMN 1WAJA 3ENBA 1HKBA 4GVEA 1GLJO 1QVGM 3QLHA 3K58A 4O44A 3FE1A 1J6ZA 3KLFA 2YCHA 4AILC 3C7NA 1XI1A 3MDQA 3F9KA 4B3OA 5BREA 1VRUA 3KZBA 4CFCA 3RR8A 5FRNA 4BY9C 1JXEA 5AQMA 3KK1A 3ENOA 3MCAB 3I8DA 3AVKA 3MXJA 4B9QA 3CJ9A 4GV9A 4FJ5A 1OVYA 4CF2A 4Z4CA 1WSGA 2BANA 1EX4A 1BDGA 4HCBA 2ZF5O 1SL0A 3SPYA 1YTAA 4FJLA 2HVIA 1QS4A 4CECA 2NRXA 2ATQA 4WQ5A 4DTOA 4M45A 1A5XA 2ZM6K 2FBYA 2Q2RA 2BUPA 4BRFA 4YOXA 2D0AA 4C23A 1X3NA 1ZBSA 4L3QA 3UIQA 3O3HA 2HBLA 3TTCA 2XY8A 3U4LA 3CC4N 4GNIA 2NRTA 2IOCA 3ISNC 1BWFO 3ULDA 2DFFA 3Q7CA 1FK9A 1KXPA 2B6AA 4PKHA 2O8EA 1U2VA 4CZJA 4K8XA 4YOYA 3LM2A 2X78A 1RT2A 1BA0A 3M8PA 3LDOA 2GBZA 3I0SA 3SV3A 1NBWA 4DV3K 5KTQA 4JRPA 1VQ5N 4FO0A 3VA3A 1S1VA 2F4VK 3PUFA 4CHQA 3I0RA 5CE3A 3NCIA 3T1HK 1YIJN 4JKHA 2G8WA 5KRTA 3ATVA 4K41A 5AQQA 3K59A 2W40A 1VSJA 4M3YA 3ZSZA 2HHXA 4BRQA 3F2KA 4PKGA 3CERA 2O8BB 3A0IX 4QS7A 3MMVA 3MN6A 3QBWA 4BC3A 4FXDA 3MXMA 5M1QA 5C2DA 3WXMB 2NRHA 1RT6A 4FVMA 5DM7L 4O8KA 4JKEA 2QA4N 4HVJA 2XY6A 1NK4A 1HQUA 3OBWA 3G25A 5C24A 3LPTA 4GVMA 4BC2A 3BF1A 2Q0RA 3O4WA 1JLAA 2QWQA 5KRSA 3HM9A 4NO7A 4KO0A 2P9IB 3OYLA 3NGZA 4F8RA 3EKUA 1B9DA 5ELZA 1ATRA 4YORA 4Z4EA 1BISA 3VGKA 1Y64A 1NMDA 4AHRA 1CZBA 3O9RA 4YOTA 3AVLA 4DTRA 1UAXA 4CJ3A 2DY4A 4CGGA 3DLEA 1RT4A 4DV6K 4A2AA 5CYMA 1SUQA 4BDYA 1RBRA 3KJVA 2Y1IA 1NG9A 1T6CA 4H8KA 3EE8A 4MLHA 4M3UA 3T1YK 4ZTJA 2YNFA 4JI1K 4MLEA 4FK4A 4JKGB 1NK6A 2RN2A 1RTJA 2HF4A 4I6MB 2QKKA 3SJHA 4B3MK 1DTQA 4I2PA 3VENA 3ZT0A 2XO7A 4F2RA 3ZETB 5BR8K 4DQSA 4M3TA 3BDPA 3CFRA 1QSLA 3MCPA 4FLYA 1S1XA 3T69A 5LJWA 3ZX0A 3O9TA 3J81O 4CHPA 2BDPA 1GLCG 4GY2B 2O8CA 2YJEA 2ETJA 3HVRA 3PX0A 1SS6A 1MDUB 4JI8K 1XQSC 3OYFA 1LOTB 4AHSA 4LF8K 4IO9L 1NK7A 4IEEA 4BRHA 4BQZA 1U6ZA 4O55A 3LDLA 4CHZA 3WEEB 2P9PB 4FJHA 1RGIA 1YJNN 4CIFA 2YHXA 4YOWA 3EYZA 1J5OA 3K5LA 4DCHA 2DPNA 3BEXA 4J2BA 3LZJA 3D7EO 4CERA 1VHXA 4W5TA 3M6GA 3ZT4A 3OYMA 3SBGA 4KPYA 2JGUA 1D9DA 3CC7N 3OS2A 3DLLL 2FC0A 1KAXA 3AVJA 3EKSA 1VQON 4C8LA 4EHTA 4BREA 4CESA 3G0ZA 1OH7A 5I3UA 4DU1A 2A42A 3QERA 1XHZA 3O6WA 2QWLA 1LW0A 2ZJQL 2OYQA 1RTDA 2BGGA 3L4QA 1VQ7N 1TK5A 3H1QA 3SNNA 4DQIA 3VQ7A 2HHVA 3OVNA 4LF7K 3Q7BA 1ESVA 1IJJA 1HUXA 4QS8A 3MEGA 5BN8A 3EO3A 3L3VA 4JNEA 1VQ8N 1TYQB 1NWKA 3K0SA 2AP1A 4H0OA 4OVLA 4FJJA 1YVUA 3R3LA 5AFUH 3U8XA 4JD2B 2P5OA 1SAZA 3M8RA 4CF0A 3FR0A 1QVFM 3CJ1A 3MK6A 3SAGA 3PSFA 2GX9A 3HSCA 4UY8O 4WYBA 2UYTA 3U3GA 3DRPA 4M3ZA 4PUOA 1HLUA 1VSIA 3AVBA 1UOCA 3OYIA 1NGHA 1IKVA 3D2EA 4CHYA 3HP6A 3P38A 4E0DA 2FSKA 3MXIA 1GOCA 4UQGA 4W5OA 1VK0A 3FLCO 4ID1A 2PFUA 5LL6Z 4O8UA 1EO1A 4IWVA 3SBTA 4FWQA 1ASWA 1HNVA 4FLUA 1BOTO 1JXBA 5HRPA 1G15A 3CI5A 4BR2A 1LW2A 4CJLA 5F0XA 4O0IA 2PYLA 3HRGA 2CGJA 1L3TA 3AO2A 5FROA 3I56N 3MEEA 4DV4K 3DXMB 3K5MA 4AHVA 1VQKN 4BWMA 3L2UA 4DV7K 4I9QA 1S1UA 3FZHA 4N56A 1DGKN 1MWMA 3AAPA 4ICLA 4OLBA 4WFNL 1KC8O 3O8MA 1TGOA 4JD2A 2A40A 1QE1A 3VGLA 5J2QA 2PZSA 3QBXA 4DS4A 1C0FA 4JYAK 1NKBA 3NF7A 2B5JA 3L3UA 3NGYA 1CZAN 3DWLA 2HHUA 5C42A 4ZHRA 3VEZA 2XY5A 4LSLA 4DV1K 1KVAA 1TK0A 1HJRA 2LSNA 1W7AA 2D0CA 3M8SA 2IAJA 3D6RA 4JKBA 3DXKA 1ATNA 4RCHA 2O4IA 2VQEK 3LWLA 4K0KK 3P31A 4B8AB 4CEBA 3C6TA 3CCVN 3TAEA 3QETA 1KLNA 3PIOL 4JS4A 1QSSA 1D9FA 1C1BA 3VGMA 4OPJA 1OKJA 2F8TA 1Q7YO 1A5WA 4C8MA 2Q97A 2NZTA 2D0BA 5AQNA 1TKDA 4EAHD 2P9KB 4KV8A 1N36K 4CEDA 3WXIA 2V7ZA 5BPNA 3AY9A 3H3OB 1RDUA 4BVOA 1XMQK 4KAZA 3VESA 3P83D 2Y1JA 2FBTA 4L8RB 3CC2N 1WBDA 3SK3A 4OPKA 3ALYA 1JCFA 4M63C 2KTQA 1NU0A 5EY4A 1N33K 5F2RA 3BUZB 3GDQA 3OW2M 3K9KA 3PY8A 3WQUA 3O4QA 4IKFA 3VTHA 3NH0A 3H46O 2ZJRL 4F9OA 4XH5A 4FCYA 4DTNA 2W41A 1ZYQA 4FK0A 4K43A 5EVZA 3ZSWA 1WAFA 3DAWA 5AQYA 1S1WA 3RVCA 1MU2A 4CK2A 5AQRA 1YHQN 1VSHA 2OA8A 3ZSOA 3QEPA 2KFZA 2YKMA 1EWQA 3ZSXA 3G4SN 3H3NO 1X9SA 3WNEA 4F3OA 4IXCA 3OYNA 1S9EA 2EX3A 4KHYA 1XHXA 4JKFA 1VSDA 3ZSYA 3LDQA 4CEAA 1NJIO 2OTLN 1BQNA 4IZ9A 4B1ZA 2E2OA 2G8IA 4DR3K 4E7LA 5DMRA 1HRHA 1TUUA 1S5JA 3QMLA 5LJVA 5BPLA 1OH6A 1WSIA 1L3VA 5AQOA 4IFYA 4OPHA 4DV5K 3CQXA 4EZ6A 3OYEA 4JHDB 3P39A 3L4IA 4CZFA 1KVCA 5BRFA 1GLLO 1K8KB 2Q36A 1JLQA 1RTHA 3TAQA 3C65A
chains in the Genus database with same CATH topology
2X78A 1RT2A 4DG1A 4CEZA 3M8PA 1JKHA 3TAMA 2GBZA 3I0SA 3SV3A 4DSFA 2ZQBA 2B4JA 2OZSA 5KTQA 1RBUA 3VQBA 4JRPA 3V9WA 2HVHA 3VA3A 4B9VA 2QKBA 1S1VA 1N6QA 4M3XA 2D5RA 3H08A 3PUFA 3HJFA 1J53A 1NOZA 4CHQA 3SJJA 3I0RA 1X9WA 1JLFA 3DOLA 3NCIA 4YFUA 3SV4A 3CQ8A 3OYHA 4OGEA 4F4KA 4DSEA 4HUEA 4NYFA 3T3FA 5J2PA 4N41A 1S9GA 4CGIA 2G8WA 5KRTA 4J2DA 3O4NA 4CFBA 3S3MA 4K8ZA 1U45A 3AO1A 3K59A 5C25A 4B9SA 1VSJA 4HUGA 4CEOA 3S3OA 4M3YA 3ZSZA 2OPQA 2HHXA 2Z1HA 3NBPA 3EZ5A 3VQDA 1T03A 4EZ9A 1CZ9A 1TL3A 4KTQA 3SUPA 3DM2A 4FJ7A 4FXDA 3DLHA 3MXMA 3SYZA 3JYTA 1RT6A 1JL1A 1Q9YA 4FVMA 3OJUA 3OYBA 4M3RA 4FM1A 3SI6A 1XC9A 3VQPA 4B9NA 2HNYA 3LALA 3NFAA 4IDKA 5KI6A 3NDKA 1L3UA 1CLQA 3KIOA 3U3YA 3AVHA 4HVJA 5HLFA 2XY6A 2AJQA 1NK4A 1L3SA 1HQUA 3CFOA 3OJSA 3K57A 3LP0A 5C24A 1Z25A 1BGXT 3LPTA 3D45A 4GVMA 4CHOA 3RMDA 1KFSA 1BI4B 1DLOA 1JLAA 3HP9A 3NH2A 4DTUA 1ZBLA 1U48A 4FW2A 5KRSA 3HXMA 3HM9A 3IAYA 4KO0A 3OYLA 1ASUA 1NJYA 4DSIA 4W5NA 3NGZA 4F8RA 1U49A 1JLGA 3TWHA 1RBTA 4CHNA 3LDSA 3D0PA 1NK5A 5HBMA 1B9DA 4FM2A 2W42A 1TKTA 4DU4A 3TANA 2ITGA 4Z4EA 3VQAA 1BISA 3DRSA 4AHRA 5FRMA 2OPPA 1YTUA 3KLGA 3QO9A 1CZBA 4CEFA 1TVRA 2WONA 2YV0X 3CM5A 1W0HA 3IG1A 4ELUA 3AVLA 1HYSA 3LP1A 4AHCA 4DTRA 5DK5A 1UAXA 4CJ3A 2DY4A 2VWKA 1O1WA 3HT3A 4JRQA 4CGGA 3B6OA 1RT4A 3AVMA 3DLEA 3HPHA 3NE6A 4KFBA 4RG8A 5CYMA 4RW4A 4ZTFA 4AHTA 1SUQA 2O4GA 3PO5A 1QSYA 3C94A 3SQ4A 3P5JA 4C8NA 1UA0A 4BDYA 1NKCA 1RBRA 2P51A 3KJVA 2Y1IA 4PQUA 1Z26A 4H8KA 4DFJA 2P1JA 4DQQA 4FLXA 3K5OA 4QOZB 3NH1A 1JLEA 3AVCA 1KRPA 4M3UA 4ZTJA 2YNFA 3ZCMA 4W5RA 4FK4A 4FM0A 4CJPA 2HHSA 3HYFA 3SUOA 3RMBA 2RN2A 1NK6A 3DI6A 1RTJA 3LPUA 4BE0A 4LD0A 2QKKA 4KREA 4FLTA 3K2PA 4NCGA 4B9UA 3QEVA 4KB0A 4PWDA 1DTQA 3OS1A 4I2PA 2RF2A 1TKZA 1T7PA 1S6PA 3DLKA 3ZSRA 3V9UA 4H4MA 3ZT0A 4CEEA 4R5PA 2XO7A 4DQSA 4F2RA 2GUIA 3AVIA 4M3TA 3BDPA 3CFRA 1C0UA 1X1PA 3ZSVA 4E89A 2DTUA 1QSLA 1WSEA 4PA1A 1S1XA 3HPOA 1FKOA 4FLYA 2E6LA 4CJUA 3DOKA 4B8CA 4CHPA 2BDPA 3SQ1A 3SPZA 5HRSA 4Z4GA 4Q0BA 1N5YA 2FBXA 3S3NA 2KZZA 1WSJA 2ETJA 4OKEA 3HVRA 3V81A 3PX0A 4OLAA 4OKKA 2HB5A 4BWJA 1UWBA 1IKWA 1GOBA 1VSEA 1Q9XA 3OYFA 5HRRA 4NCBA 1WSFA 4AHSA 4KHNA 3RR7A 1D8YA 5J2MA 1B9FA 1NK7A 1K6YA 1C1AA 1RDDA 4IFVA 4O55A 2HHTA 2HHWA 1HYZA 4CHZA 3U6FA 3HL8A 1HMVA 3KK3A 2HW3A 3L2QA 4FJHA 4CF9A 4M41A 3VQ9A 1CXUA 4DLEA 1ZBIA 4CIFA 3T1AA 3EYZA 1RT7A 4DMNA 3QEIA 4E7JA 1NKEA 1BCMA 4FW1A 1J5OA 2E4LA 2KFNA 3K5LA 1HNIA 4KTZA 4E7KA 2XRIA 2IGIA 3V1RA 2VG7A 4J2BA 3LZJA 4CERA 3VN5A 3TAFA 1F21A 1I39A 1R0AA 4W5TA 3CFPA 3TI0A 4O0JA 3ZT4A 3LAKA 3OYMA 4B9TA 3SQ0A 4HCCA 4KPYA 1TAQA 3TR8A 3OY9A 2JGUA 5JS2A 3C6UA 1D9DA 4TSXA 4FJ9A 2RKIA 3B6PA 3OS2A 4DTPA 4ID5A 2FC0A 1NK8A 4FZXC 4FK2A 2HHQA 3AVJA 5HROA 2DFHA 4DTMA 4KRFA 3E01A 5T7BA 4JS5A 2G8UA 4CIGA 4C8LA 1ZBHA 4CK3A 4OJRA 5KGXA 4CESA 3G0ZA 4NYNA 4LSNA 3EY1A 4CJVA 4DU1A 5I3UA 4M3WA 1ZBUA 3F73A 3RWUA 3QERA 1XHZA 1NJXA 4OKJA 1SV5A 1KTQA 1Q8IA 1LW0A 2KW4A 4CJQA 4J2EA 2OYQA 4MQ3A 1S1TA 3AVGA 2VWJA 3FFIA 5SWMA 1RTDA 3ZT3A 2DFEA 1VSKA 3AA2A 3SQ2A 2BGGA 1TK5A 3V9ZA 3RMCA 1IG9A 1REVA 3V6DA 3VQ7A 4HUFA 3SNNA 4DQRA 1NK9A 1ITGA 3OVNA 3PX4A 4DQIA 2HHVA 1EETA 4IBNA 2F8SA 3ITHA 3MEGA 3L3VA 4CGHA 4BE2A 2IC3A 3V9SA 2G8KA 3V1OA 2BE2A 3RRHA 4ELTA 4KHUA 4OVLA 1WSHA 1WNSA 1YVUA 3CM6A 4DF4A 4FLZA 1C6VA 1U47A 4EP5A 3PO4A 4BDPA 1TK8A 5SZTA 3QESA 4DF8A 1NOYA 2G8VA 3KKSA 4KI4A 2P5OA 4DSJA 2OPRA 4KB1A 3M8RA 4CF0A 1BIZA 1HPZA 4CGDA 1TAUA 1LWEA 4FJXA 4J2AA 2GV9A 2X6SA 2OPSA 3PX6A 1BHLA 1JLCA 4RW9A 3U3GA 4CJTA 4E1NA 3DRPA 1ASVA 4M3ZA 4PUOA 4G1QA 2F96A 3HVTA 4B08A 1VSIA 4F2SA 3AVBA 4I7FA 1UOCA 3OYIA 1IKVA 4CHYA 4ELVA 3HP6A 1EP4A 4HHTA 4E0DA 2QK9A 5E41A 3AO4A 3AVAA 1RBVA 3QIOA 1B92A 3MXIA 4FJIA 1GOCA 4UQGA 4W5OA 1LAVA 1VK0A 3O3FA 3CG7A 1I3AA 4ID1A 4E7HA 2A1RA 3MEDA 1JLBA 4E1MA 2E6MA 3SZ2A 1ASWA 1VSFA 1A5VA 1HNVA 4FLUA 3THVA 1RDAA 1EXQA 1JXBA 1RDBA 4CE9A 4EP4A 1BCOA 1G15A 4CJLA 1LW2A 5HRPA 3O3GA 3SUNA 1T05A 4FJGA 4O0IA 2PYLA 4KHSA 1L3TA 3AO2A 5FROA 4B9MA 3MEEA 5HP1A 1CXQA 4CJWA 1NJWA 1WLJA 3K5MA 2G8FA 3HSTB 3L2VA 1LAWA 4AHVA 3QNNA 4FJNA 1VSMA 3KK2A 4BWMA 3QIPA 3L2UA 3RRGA 4I9QA 1FKPA 2ZD1A 4DQPA 1S1UA 3L8BA 1FXXA 4DS5A 4CCHA 4M42A 3AVFA 2NUBA 3V4IA 3NF9A 1W9HA 4N56A 3QNOA 3SUQA 4PY5A 1D5AA 3OYCA 1BL3A 4I2QA 4CJEA 3TABA 4Z0UA 3MECA 1BI4A 4ICLA 4OLBA 3MAQA 3DLGA 5HRNA 4E7IA 1RNHA 3AVNA 4BE1A 3VQ4A 2RPIA 1BQMA 3WNHA 3KD1E 2HMIA 5FDLA 2I5JA 3PV8A 1TGOA 4N47A 3NF8A 3G10A 1GOAA 1VRTA 1QE1A 3T19A 5J2QA 2WOMA 3CYMA 2PZSA 4O5BA 4CEQA 2R7YA 3WNFA 4DS4A 1NKBA 4BACA 3NF7A 2PY5A 2B5JA 3L3UA 3NGYA 3L2RA 2IDOA 4E19A 3AA5X 1T8EA 4Z4FA 4KKOA 3C95A 3HK2A 2HHUA 1KCFA 5C42A 4ZHRA 5EU7A 4CJRA 3SCXA 1SKSA 1ZBFA 3DMJA 1JL2A 4LH5A 3LP2A 4C8OA 2XY5A 4LSLA 2XHBA 1EKEA 3OYGA 3AO5A 1KVAA 4OGCA 1QHTA 3NAEA 1IO2A 1C0MA 1HJRA 1TK0A 2IS3A 2YKNA 4QAGA 3OS0A 3JSMA 3S9HA 2P5GA 1DTTA 2LSNA 2D0CA 3M8SA 4DFPA 4H4OA 2IAJA 4Q5VA 1UA1A 4FJKA 4KHWA 3RMAA 4XIUA 2KQ2A 1U4BA 1TL1A 4WE1A 3OYKA 2X6NA 1TV6A 4HTUA 2O4IA 1IKYA 4RW7A 3LWLA 2ZE2A 3ZT2A 4B8AB 3C6TA 4CEBA 4CFAA 3KKRA 4FLVA 3P1GA 1LV5A 3LP3A 3QETA 3TAEA 1KLNA 4JS4A 4CF1A 3TARA 5CY4A 1QSSA 5CZ1A 1D9FA 1SKRA 4Y1DA 3NGIA 4DWIA 4KHQA 1C1BA 4OPJA 4CK1A 5J1EA 4FYDA 1TKXA 2FBVA 2X74A 1KLMA 3AV9A 1WN7A 1HQEA 4DTSA 4NCAA 2F8TA 4FZYA 1A5WA 3QINA 1LWCA 3K5NA 4N76A 4C8MA 1L5UA 3A2FA 1C1CA 2D0BA 3IRXA 1TKDA 3M8QA 3OYJA 4DFKA 1X9MA 2YHBA 1RDCA 3RTVA 5I42A 4KV8A 3NF6A 4CEDA 1J54A 5J2NA 3LAMA 4CJSA 1YT3A 1HYVA 3OYDA 4GMJB 3TAPA 4CJKA 4MFBA 3ZT1A 4DFMA 1RT3A 3AO3A 5CZ2A 4KAZA 3V1QA 3DRRA 3P83D 2G8HA 4AHUA 4E3SA 2FBTA 2Y1JA 4L8RB 1RBSA 3VA0A 4YNQA 5JS1A 2A1SA 4IG3A 3ALYA 4OPKA 3VQQA 3VQ6A 2KTQA 3AA4A 1J9AA 3NHGA 3AA3A 3BGRA 1KVBA 2QXFA 4FJ8A 4CJFA 2Z1IA 3OYAA 4FJJA 3VQCA 4DU3A 4Z4IA 2KZMA 2YNGA 4RW8A 3LZIA 3ZSQA 1KFDA 1QTMA 4JLHA 1BIUA 3PY8A 4RW6A 3O4QA 4IKFA 4DSLA 1IH7A 4LH4A 4AH9A 4CGFA 3NH0A 4Z4HA 4GW6A 4IG0A 1XWLA 5CYQA 4CGJA 3KTQA 4FCYA 4DTNA 3LANA 1RTIA 1ZYQA 1QQCA 4FK0A 4Y1CA 4B9LA 4CFDA 2XY7A 3ZSWA 3ASMA 1WAFA 1RILA 3KLIA 2EHGA 4LY7A 1S1WA 4DLGA 3TAGA 1WAJA 4CJ4A 1RT1A 1SL2A 1Y97A 1C0TA 1MU2A 4CK2A 4KI6A 2VG5A 2YNIA 3QLHA 1VSHA 3DLRA 4N5SA 3K58A 2OA8A 4O44A 3ZSOA 3LWMA 4FZZA 3QEPA 3KLFA 3QEXA 4AILC 2Q3SA 2YKMA 1XI1A 2KFZA 3F9KA 4B3OA 1U04A 1VRUA 4DSKA 2HNDA 4CFCA 3RR8A 5FRNA 4BDZA 1JXEA 3ZSXA 4CJ5A 3DLBA 3KK1A 1X9SA 2OZMA 3WNEA 4F3OA 3OYNA 3I8DA 3AVKA 3MXJA 4O4GA 1S9EA 2EX3A 3VQ5A 4FJ5A 4KHYA 1XHXA 3KLHA 1S6QA 4CF2A 4Z4CA 1SKWA 1VSDA 1WSGA 2BANA 3ZSYA 1EX4A 4CEAA 1BQNA 3QEWA 4HCBA 2HNZA 1SL0A 4FJMA 3SPYA 1YTAA 4FJLA 2HVIA 1QS4A 4C8KA 3DYAA 2PYJA 2G8IA 3VQEA 4CECA 2ATQA 4E7LA 3V9XA 4M45A 1A5XA 5DMRA 1HRHA 1IKXA 1S5JA 4DTOA 4F3TA 2Z1JA 4QCLA 2FBYA 4I9LA 4FLWA 2JLEA 2D0AA 3IS9A 4DTJA 1WSIA 5K14A 1L3VA 3WNGA 4IFYA 4DTXA 3UIQA 1RT5A 1VSLA 3O3HA 4KTWA 4EZ6A 2XY8A 3OYEA 2IOCA 3ISNC 1KVCA 3KLEA 2VG6A 2YHAA 3ULDA 3HO1A 1NJZA 2DFFA 1NK0A 1FK9A 2B6AA 3VQ8A 1RCHA 3KD5E 4CF8A 1JLQA 1KSPA 1SL1A 4K8XA 2Z1GA 3L2WA 2YNHA 4W5QA 5D3GA 1RTHA 3TAQA 5KGWA 4CIEA 3HPGA 1LWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X78 A;  1RT2 A;  4DG1 A;  4CEZ A;  3M8P A;  1JKH A;  3TAM A;  2GBZ A;  3I0S A;  3SV3 A;  4DSF A;  2ZQB A;  2B4J A;  2OZS A;  5KTQ A;  1RBU A;  3VQB A;  4JRP A;  3V9W A;  2HVH A;  3VA3 A;  4B9V A;  2QKB A;  1S1V A;  1N6Q A;  4M3X A;  2D5R A;  3H08 A;  3PUF A;  3HJF A;  1J53 A;  1NOZ A;  4CHQ A;  3SJJ A;  3I0R A;  1X9W A;  1JLF A;  3DOL A;  3NCI A;  4YFU A;  3SV4 A;  3CQ8 A;  3OYH A;  4OGE A;  4F4K A;  4DSE A;  4HUE A;  4NYF A;  3T3F A;  5J2P A;  4N41 A;  1S9G A;  4CGI A;  2G8W A;  5KRT A;  4J2D A;  3O4N A;  4CFB A;  3S3M A;  4K8Z A;  1U45 A;  3AO1 A;  3K59 A;  5C25 A;  4B9S A;  1VSJ A;  4HUG A;  4CEO A;  3S3O A;  4M3Y A;  3ZSZ A;  2OPQ A;  2HHX A;  2Z1H A;  3NBP A;  3EZ5 A;  3VQD A;  1T03 A;  4EZ9 A;  1CZ9 A;  1TL3 A;  4KTQ A;  3SUP A;  3DM2 A;  4FJ7 A;  4FXD A;  3DLH A;  3MXM A;  3SYZ A;  3JYT A;  1RT6 A;  1JL1 A;  1Q9Y A;  4FVM A;  3OJU A;  3OYB A;  4M3R A;  4FM1 A;  3SI6 A;  1XC9 A;  3VQP A;  4B9N A;  2HNY A;  3LAL A;  3NFA A;  4IDK A;  5KI6 A;  3NDK A;  1L3U A;  1CLQ A;  3KIO A;  3U3Y A;  3AVH A;  4HVJ A;  5HLF A;  2XY6 A;  2AJQ A;  1NK4 A;  1L3S A;  1HQU A;  3CFO A;  3OJS A;  3K57 A;  3LP0 A;  5C24 A;  1Z25 A;  1BGX T;  3LPT A;  3D45 A;  4GVM A;  4CHO A;  3RMD A;  1KFS A;  1BI4 B;  1DLO A;  1JLA A;  3HP9 A;  3NH2 A;  4DTU A;  1ZBL A;  1U48 A;  4FW2 A;  5KRS A;  3HXM A;  3HM9 A;  3IAY A;  4KO0 A;  3OYL A;  1ASU A;  1NJY A;  4DSI A;  4W5N A;  3NGZ A;  4F8R A;  1U49 A;  1JLG A;  3TWH A;  1RBT A;  4CHN A;  3LDS A;  3D0P A;  1NK5 A;  5HBM A;  1B9D A;  4FM2 A;  2W42 A;  1TKT A;  4DU4 A;  3TAN A;  2ITG A;  4Z4E A;  3VQA A;  1BIS A;  3DRS A;  4AHR A;  5FRM A;  2OPP A;  1YTU A;  3KLG A;  3QO9 A;  1CZB A;  4CEF A;  1TVR A;  2WON A;  2YV0 X;  3CM5 A;  1W0H A;  3IG1 A;  4ELU A;  3AVL A;  1HYS A;  3LP1 A;  4AHC A;  4DTR A;  5DK5 A;  1UAX A;  4CJ3 A;  2DY4 A;  2VWK A;  1O1W A;  3HT3 A;  4JRQ A;  4CGG A;  3B6O A;  1RT4 A;  3AVM A;  3DLE A;  3HPH A;  3NE6 A;  4KFB A;  4RG8 A;  5CYM A;  4RW4 A;  4ZTF A;  4AHT A;  1SUQ A;  2O4G A;  3PO5 A;  1QSY A;  3C94 A;  3SQ4 A;  3P5J A;  4C8N A;  1UA0 A;  4BDY A;  1NKC A;  1RBR A;  2P51 A;  3KJV A;  2Y1I A;  4PQU A;  1Z26 A;  4H8K A;  4DFJ A;  2P1J A;  4DQQ A;  4FLX A;  3K5O A;  4QOZ B;  3NH1 A;  1JLE A;  3AVC A;  1KRP A;  4M3U A;  4ZTJ A;  2YNF A;  3ZCM A;  4W5R A;  4FK4 A;  4FM0 A;  4CJP A;  2HHS A;  3HYF A;  3SUO A;  3RMB A;  2RN2 A;  1NK6 A;  3DI6 A;  1RTJ A;  3LPU A;  4BE0 A;  4LD0 A;  2QKK A;  4KRE A;  4FLT A;  3K2P A;  4NCG A;  4B9U A;  3QEV A;  4KB0 A;  4PWD A;  1DTQ A;  3OS1 A;  4I2P A;  2RF2 A;  1TKZ A;  1T7P A;  1S6P A;  3DLK A;  3ZSR A;  3V9U A;  4H4M A;  3ZT0 A;  4CEE A;  4R5P A;  2XO7 A;  4DQS A;  4F2R A;  2GUI A;  3AVI A;  4M3T A;  3BDP A;  3CFR A;  1C0U A;  1X1P A;  3ZSV A;  4E89 A;  2DTU A;  1QSL A;  1WSE A;  4PA1 A;  1S1X A;  3HPO A;  1FKO A;  4FLY A;  2E6L A;  4CJU A;  3DOK A;  4B8C A;  4CHP A;  2BDP A;  3SQ1 A;  3SPZ A;  5HRS A;  4Z4G A;  4Q0B A;  1N5Y A;  2FBX A;  3S3N A;  2KZZ A;  1WSJ A;  2ETJ A;  4OKE A;  3HVR A;  3V81 A;  3PX0 A;  4OLA A;  4OKK A;  2HB5 A;  4BWJ A;  1UWB A;  1IKW A;  1GOB A;  1VSE A;  1Q9X A;  3OYF A;  5HRR A;  4NCB A;  1WSF A;  4AHS A;  4KHN A;  3RR7 A;  1D8Y A;  5J2M A;  1B9F A;  1NK7 A;  1K6Y A;  1C1A A;  1RDD A;  4IFV A;  4O55 A;  2HHT A;  2HHW A;  1HYZ A;  4CHZ A;  3U6F A;  3HL8 A;  1HMV A;  3KK3 A;  2HW3 A;  3L2Q A;  4FJH A;  4CF9 A;  4M41 A;  3VQ9 A;  1CXU A;  4DLE A;  1ZBI A;  4CIF A;  3T1A A;  3EYZ A;  1RT7 A;  4DMN A;  3QEI A;  4E7J A;  1NKE A;  1BCM A;  4FW1 A;  1J5O A;  2E4L A;  2KFN A;  3K5L A;  1HNI A;  4KTZ A;  4E7K A;  2XRI A;  2IGI A;  3V1R A;  2VG7 A;  4J2B A;  3LZJ A;  4CER A;  3VN5 A;  3TAF A;  1F21 A;  1I39 A;  1R0A A;  4W5T A;  3CFP A;  3TI0 A;  4O0J A;  3ZT4 A;  3LAK A;  3OYM A;  4B9T A;  3SQ0 A;  4HCC A;  4KPY A;  1TAQ A;  3TR8 A;  3OY9 A;  2JGU A;  5JS2 A;  3C6U A;  1D9D A;  4TSX A;  4FJ9 A;  2RKI A;  3B6P A;  3OS2 A;  4DTP A;  4ID5 A;  2FC0 A;  1NK8 A;  4FZX C;  4FK2 A;  2HHQ A;  3AVJ A;  5HRO A;  2DFH A;  4DTM A;  4KRF A;  3E01 A;  5T7B A;  4JS5 A;  2G8U A;  4CIG A;  4C8L A;  1ZBH A;  4CK3 A;  4OJR A;  5KGX A;  4CES A;  3G0Z A;  4NYN A;  4LSN A;  3EY1 A;  4CJV A;  4DU1 A;  5I3U A;  4M3W A;  1ZBU A;  3F73 A;  3RWU A;  3QER A;  1XHZ A;  1NJX A;  4OKJ A;  1SV5 A;  1KTQ A;  1Q8I A;  1LW0 A;  2KW4 A;  4CJQ A;  4J2E A;  2OYQ A;  4MQ3 A;  1S1T A;  3AVG A;  2VWJ A;  3FFI A;  5SWM A;  1RTD A;  3ZT3 A;  2DFE A;  1VSK A;  3AA2 A;  3SQ2 A;  2BGG A;  1TK5 A;  3V9Z A;  3RMC A;  1IG9 A;  1REV A;  3V6D A;  3VQ7 A;  4HUF A;  3SNN A;  4DQR A;  1NK9 A;  1ITG A;  3OVN A;  3PX4 A;  4DQI A;  2HHV A;  1EET A;  4IBN A;  2F8S A;  3ITH A;  3MEG A;  3L3V A;  4CGH A;  4BE2 A;  2IC3 A;  3V9S A;  2G8K A;  3V1O A;  2BE2 A;  3RRH A;  4ELT A;  4KHU A;  4OVL A;  1WSH A;  1WNS A;  1YVU A;  3CM6 A;  4DF4 A;  4FLZ A;  1C6V A;  1U47 A;  4EP5 A;  3PO4 A;  4BDP A;  1TK8 A;  5SZT A;  3QES A;  4DF8 A;  1NOY A;  2G8V A;  3KKS A;  4KI4 A;  2P5O A;  4DSJ A;  2OPR A;  4KB1 A;  3M8R A;  4CF0 A;  1BIZ A;  1HPZ A;  4CGD A;  1TAU A;  1LWE A;  4FJX A;  4J2A A;  2GV9 A;  2X6S A;  2OPS A;  3PX6 A;  1BHL A;  1JLC A;  4RW9 A;  3U3G A;  4CJT A;  4E1N A;  3DRP A;  1ASV A;  4M3Z A;  4PUO A;  4G1Q A;  2F96 A;  3HVT A;  4B08 A;  1VSI A;  4F2S A;  3AVB A;  4I7F A;  1UOC A;  3OYI A;  1IKV A;  4CHY A;  4ELV A;  3HP6 A;  1EP4 A;  4HHT A;  4E0D A;  2QK9 A;  5E41 A;  3AO4 A;  3AVA A;  1RBV A;  3QIO A;  1B92 A;  3MXI A;  4FJI A;  1GOC A;  4UQG A;  4W5O A;  1LAV A;  1VK0 A;  3O3F A;  3CG7 A;  1I3A A;  4ID1 A;  4E7H A;  2A1R A;  3MED A;  1JLB A;  4E1M A;  2E6M A;  3SZ2 A;  1ASW A;  1VSF A;  1A5V A;  1HNV A;  4FLU A;  3THV A;  1RDA A;  1EXQ A;  1JXB A;  1RDB A;  4CE9 A;  4EP4 A;  1BCO A;  1G15 A;  4CJL A;  1LW2 A;  5HRP A;  3O3G A;  3SUN A;  1T05 A;  4FJG A;  4O0I A;  2PYL A;  4KHS A;  1L3T A;  3AO2 A;  5FRO A;  4B9M A;  3MEE A;  5HP1 A;  1CXQ A;  4CJW A;  1NJW A;  1WLJ A;  3K5M A;  2G8F A;  3HST B;  3L2V A;  1LAW A;  4AHV A;  3QNN A;  4FJN A;  1VSM A;  3KK2 A;  4BWM A;  3QIP A;  3L2U A;  3RRG A;  4I9Q A;  1FKP A;  2ZD1 A;  4DQP A;  1S1U A;  3L8B A;  1FXX A;  4DS5 A;  4CCH A;  4M42 A;  3AVF A;  2NUB A;  3V4I A;  3NF9 A;  1W9H A;  4N56 A;  3QNO A;  3SUQ A;  4PY5 A;  1D5A A;  3OYC A;  1BL3 A;  4I2Q A;  4CJE A;  3TAB A;  4Z0U A;  3MEC A;  1BI4 A;  4ICL A;  4OLB A;  3MAQ A;  3DLG A;  5HRN A;  4E7I A;  1RNH A;  3AVN A;  4BE1 A;  3VQ4 A;  2RPI A;  1BQM A;  3WNH A;  3KD1 E;  2HMI A;  5FDL A;  2I5J A;  3PV8 A;  1TGO A;  4N47 A;  3NF8 A;  3G10 A;  1GOA A;  1VRT A;  1QE1 A;  3T19 A;  5J2Q A;  2WOM A;  3CYM A;  2PZS A;  4O5B A;  4CEQ A;  2R7Y A;  3WNF A;  4DS4 A;  1NKB A;  4BAC A;  3NF7 A;  2PY5 A;  2B5J A;  3L3U A;  3NGY A;  3L2R A;  2IDO A;  4E19 A;  3AA5 X;  1T8E A;  4Z4F A;  4KKO A;  3C95 A;  3HK2 A;  2HHU A;  1KCF A;  5C42 A;  4ZHR A;  5EU7 A;  4CJR A;  3SCX A;  1SKS A;  1ZBF A;  3DMJ A;  1JL2 A;  4LH5 A;  3LP2 A;  4C8O A;  2XY5 A;  4LSL A;  2XHB A;  1EKE A;  3OYG A;  3AO5 A;  1KVA A;  4OGC A;  1QHT A;  3NAE A;  1IO2 A;  1C0M A;  1HJR A;  1TK0 A;  2IS3 A;  2YKN A;  4QAG A;  3OS0 A;  3JSM A;  3S9H A;  2P5G A;  1DTT A;  2LSN A;  2D0C A;  3M8S A;  4DFP A;  4H4O A;  2IAJ A;  4Q5V A;  1UA1 A;  4FJK A;  4KHW A;  3RMA A;  4XIU A;  2KQ2 A;  1U4B A;  1TL1 A;  4WE1 A;  3OYK A;  2X6N A;  1TV6 A;  4HTU A;  2O4I A;  1IKY A;  4RW7 A;  3LWL A;  2ZE2 A;  3ZT2 A;  4B8A B;  3C6T A;  4CEB A;  4CFA A;  3KKR A;  4FLV A;  3P1G A;  1LV5 A;  3LP3 A;  3QET A;  3TAE A;  1KLN A;  4JS4 A;  4CF1 A;  3TAR A;  5CY4 A;  1QSS A;  5CZ1 A;  1D9F A;  1SKR A;  4Y1D A;  3NGI A;  4DWI A;  4KHQ A;  1C1B A;  4OPJ A;  4CK1 A;  5J1E A;  4FYD A;  1TKX A;  2FBV A;  2X74 A;  1KLM A;  3AV9 A;  1WN7 A;  1HQE A;  4DTS A;  4NCA A;  2F8T A;  4FZY A;  1A5W A;  3QIN A;  1LWC A;  3K5N A;  4N76 A;  4C8M A;  1L5U A;  3A2F A;  1C1C A;  2D0B A;  3IRX A;  1TKD A;  3M8Q A;  3OYJ A;  4DFK A;  1X9M A;  2YHB A;  1RDC A;  3RTV A;  5I42 A;  4KV8 A;  3NF6 A;  4CED A;  1J54 A;  5J2N A;  3LAM A;  4CJS A;  1YT3 A;  1HYV A;  3OYD A;  4GMJ B;  3TAP A;  4CJK A;  4MFB A;  3ZT1 A;  4DFM A;  1RT3 A;  3AO3 A;  5CZ2 A;  4KAZ A;  3V1Q A;  3DRR A;  3P83 D;  2G8H A;  4AHU A;  4E3S A;  2FBT A;  2Y1J A;  4L8R B;  1RBS A;  3VA0 A;  4YNQ A;  5JS1 A;  2A1S A;  4IG3 A;  3ALY A;  4OPK A;  3VQQ A;  3VQ6 A;  2KTQ A;  3AA4 A;  1J9A A;  3NHG A;  3AA3 A;  3BGR A;  1KVB A;  2QXF A;  4FJ8 A;  4CJF A;  2Z1I A;  3OYA A;  4FJJ A;  3VQC A;  4DU3 A;  4Z4I A;  2KZM A;  2YNG A;  4RW8 A;  3LZI A;  3ZSQ A;  1KFD A;  1QTM A;  4JLH A;  1BIU A;  3PY8 A;  4RW6 A;  3O4Q A;  4IKF A;  4DSL A;  1IH7 A;  4LH4 A;  4AH9 A;  4CGF A;  3NH0 A;  4Z4H A;  4GW6 A;  4IG0 A;  1XWL A;  5CYQ A;  4CGJ A;  3KTQ A;  4FCY A;  4DTN A;  3LAN A;  1RTI A;  1ZYQ A;  1QQC A;  4FK0 A;  4Y1C A;  4B9L A;  4CFD A;  2XY7 A;  3ZSW A;  3ASM A;  1WAF A;  1RIL A;  3KLI A;  2EHG A;  4LY7 A;  1S1W A;  4DLG A;  3TAG A;  1WAJ A;  4CJ4 A;  1RT1 A;  1SL2 A;  1Y97 A;  1C0T A;  1MU2 A;  4CK2 A;  4KI6 A;  2VG5 A;  2YNI A;  3QLH A;  1VSH A;  3DLR A;  4N5S A;  3K58 A;  2OA8 A;  4O44 A;  3ZSO A;  3LWM A;  4FZZ A;  3QEP A;  3KLF A;  3QEX A;  4AIL C;  2Q3S A;  2YKM A;  1XI1 A;  2KFZ A;  3F9K A;  4B3O A;  1U04 A;  1VRU A;  4DSK A;  2HND A;  4CFC A;  3RR8 A;  5FRN A;  4BDZ A;  1JXE A;  3ZSX A;  4CJ5 A;  3DLB A;  3KK1 A;  1X9S A;  2OZM A;  3WNE A;  4F3O A;  3OYN A;  3I8D A;  3AVK A;  3MXJ A;  4O4G A;  1S9E A;  2EX3 A;  3VQ5 A;  4FJ5 A;  4KHY A;  1XHX A;  3KLH A;  1S6Q A;  4CF2 A;  4Z4C A;  1SKW A;  1VSD A;  1WSG A;  2BAN A;  3ZSY A;  1EX4 A;  4CEA A;  1BQN A;  3QEW A;  4HCB A;  2HNZ A;  1SL0 A;  4FJM A;  3SPY A;  1YTA A;  4FJL A;  2HVI A;  1QS4 A;  4C8K A;  3DYA A;  2PYJ A;  2G8I A;  3VQE A;  4CEC A;  2ATQ A;  4E7L A;  3V9X A;  4M45 A;  1A5X A;  5DMR A;  1HRH A;  1IKX A;  1S5J A;  4DTO A;  4F3T A;  2Z1J A;  4QCL A;  2FBY A;  4I9L A;  4FLW A;  2JLE A;  2D0A A;  3IS9 A;  4DTJ A;  1WSI A;  5K14 A;  1L3V A;  3WNG A;  4IFY A;  4DTX A;  3UIQ A;  1RT5 A;  1VSL A;  3O3H A;  4KTW A;  4EZ6 A;  2XY8 A;  3OYE A;  2IOC A;  3ISN C;  1KVC A;  3KLE A;  2VG6 A;  2YHA A;  3ULD A;  3HO1 A;  1NJZ A;  2DFF A;  1NK0 A;  1FK9 A;  2B6A A;  3VQ8 A;  1RCH A;  3KD5 E;  4CF8 A;  1JLQ A;  1KSP A;  1SL1 A;  4K8X A;  2Z1G A;  3L2W A;  2YNH A;  4W5Q A;  5D3G A;  1RTH A;  3TAQ A;  5KGW A;  4CIE A;  3HPG A;  1LWF A; 
#chains in the Genus database with same CATH topology
 1T6D A;  2B4J A;  2O8D B;  3DJC A;  1RBU A;  4JI0 K;  3CCL N;  4B9V A;  1N6Q A;  4M3X A;  3HJF A;  1J53 A;  1X9W A;  3DOL A;  1E4F T;  4KH6 A;  4J2D A;  4CGI A;  4EIA A;  4XH4 A;  2UUC K;  3S3M A;  4K8Z A;  4B9S A;  4FWL A;  4HUG A;  4CEO A;  2NLX A;  2OPQ A;  3M3Z A;  4NXM K;  3TTF A;  4DUZ K;  3VQD A;  2F7T A;  4PL7 A;  4CJ7 A;  3D2F A;  4CW7 B;  3SUP A;  3DM2 A;  4DUY K;  1Z05 A;  1JL1 A;  3OJU A;  3SI6 A;  4M3R A;  1XC9 A;  2HNY A;  3LAL A;  2IVP A;  3NFA A;  1L3U A;  3KIO A;  2O8F B;  1YVN A;  2E2N A;  3FZM A;  4MO5 A;  3WXK A;  1BGX T;  3D45 A;  5LY3 A;  3GE1 A;  1KFS A;  3HP9 A;  1S72 N;  1HR0 K;  4KHP K;  1N32 K;  4DSI A;  1ZC6 A;  2QWO A;  1NK5 A;  4DU4 A;  1TKT A;  3R1X A;  3TAN A;  1M90 O;  3VEV A;  3LDP A;  4BRL A;  5FRM A;  2OPP A;  3A5L C;  3KLG A;  1VQN N;  5FPD A;  2P9S B;  3IG1 A;  1HYS A;  3ZEU A;  3CF5 L;  4GV6 A;  5DK5 A;  2F9W A;  2VWK A;  3AVM A;  4AF1 A;  4KFB A;  4GV3 A;  4RW4 A;  4ZTF A;  2P9L A;  3SQ4 A;  3P5J A;  1SQK A;  3MX5 A;  1NKC A;  2P51 A;  1Z26 A;  4DFJ A;  1O13 A;  2P1J A;  3TTD A;  3H1V X;  2ITM A;  4FLX A;  1VQ4 N;  1KRP A;  3G71 N;  3ZCM A;  5C10 A;  4FM0 A;  4CJP A;  2HHS A;  2QXL A;  3RMB A;  3DI6 A;  2A5X A;  3WQT A;  4BE0 A;  4LD0 A;  4NCG A;  3M5R A;  4JKA A;  4ILH A;  4PWD A;  2Q0U A;  3O1B A;  1TKZ A;  4DV2 K;  3DLK A;  3ZSR A;  1KAZ A;  3V9U A;  4R5P A;  3AVI A;  3HOT A;  1C0U A;  3ZSV A;  4E89 A;  2DTU A;  1OVQ A;  3GBT A;  3ULE A;  2O8F A;  1FKO A;  3AAR A;  3SPZ A;  4Z4G A;  4JK9 A;  4Q0B A;  2FBX A;  3S3N A;  2UUB K;  1HX1 A;  4OKE A;  4OLA A;  2HB5 A;  3CMA N;  5AQJ A;  1WSF A;  4KHN A;  3I33 A;  4NLC A;  5GAH P;  5CHI A;  1HYZ A;  2HHW A;  1HMV A;  3ENH A;  3KK3 A;  2HW3 A;  4DR7 K;  4M41 A;  3VQ9 A;  1CXU A;  2ZWH A;  2F9T A;  4DLE A;  3T1A A;  4GKJ K;  1RT7 A;  4FW1 A;  2KFN A;  4KTZ A;  2YHW A;  4CD3 A;  4CBX A;  3VN5 A;  1F21 A;  1R0A A;  3TI0 A;  4B9T A;  3LAK A;  4HCC A;  1TAQ A;  3TR8 A;  5JS2 A;  3A8Y A;  1WB9 A;  5JIC A;  5M1P A;  1HNX K;  4OJR A;  2OAN A;  4NYN A;  4M3W A;  4CJV A;  1ZBU A;  3F73 A;  3RWU A;  4FWS A;  4QS9 A;  2KW4 A;  4CZL A;  4J2E A;  3AVG A;  2VWJ A;  3NVM A;  2DFE A;  3EEQ A;  1ILY A;  3RMC A;  1REV A;  1JCG A;  4DQR A;  3VMF B;  3PX4 A;  1EET A;  2IVN A;  4FWR A;  2FF6 A;  4YDU C;  4BE2 A;  3V9S A;  1K9M O;  4MDA A;  3V1O A;  3RRH A;  4ELT A;  4KHU A;  1C6V A;  5M1O A;  4KB1 A;  2OPR A;  3HZ6 A;  2VCP A;  3WT0 A;  4AQY K;  4J2A A;  2GV9 A;  2OPS A;  1BHL A;  1JLC A;  4K42 A;  5GIN A;  4RW9 A;  4CJT A;  3QIC A;  5JMV A;  4IJN A;  1ASV A;  3VEY A;  2GUP A;  5AQP A;  2VWB A;  4ELV A;  2QK9 A;  5E41 A;  1RBV A;  1B92 A;  3RSE B;  3U9Z A;  1T44 A;  1LAV A;  3O3F A;  3CG7 A;  4E7H A;  2A1R A;  5E26 A;  4E1M A;  4FWN A;  3O3G A;  1QHA A;  3LM9 A;  2O8B A;  4KH5 A;  4NLB A;  3HST B;  3G6E N;  1LAW A;  3QIP A;  3ZX3 A;  1FXX A;  4J8F A;  3O1W A;  3SUQ A;  1D5A A;  1BL3 A;  2V52 B;  4CJE A;  4YHH K;  4Z0U A;  3TAB A;  2V7Y A;  3A5M C;  4E7I A;  3AVN A;  3VQ4 A;  2RPI A;  3KD1 E;  2OCE A;  2P9I A;  3NVK A;  3NF8 A;  1NGA A;  4JI2 K;  3G10 A;  4FOE A;  1VRT A;  3T19 A;  2ASP A;  4CEQ A;  3WNF A;  3J80 O;  4BAC A;  4LF6 K;  1BG3 A;  4Z4F A;  2UXC K;  3THX B;  4KKO A;  3C95 A;  4MDB A;  4BG9 A;  4JI7 K;  1NGC A;  3KVG A;  5GIO A;  4OPA A;  4CJR A;  3SCX A;  3J7A P;  4NB4 A;  4X64 K;  4LFC K;  5AQV A;  4IDH A;  1EKE A;  4OGC A;  1QHT A;  1IO2 A;  1VQ9 N;  3JSM A;  4QAG A;  3S9H A;  1DTT A;  5BN9 A;  4FWP A;  4Q5V A;  3AAQ A;  1UA1 A;  3PSI A;  3RMA A;  4XIU A;  2KQ2 A;  1U4B A;  1TL1 A;  2X6N A;  1TV6 A;  4JKG A;  4HTU A;  3TU5 A;  2ZE2 A;  4BC5 A;  3KKR A;  3EN9 A;  4I6M A;  5AQL A;  2F8S A;  4CF1 A;  3TAR A;  3JXU A;  5CZ1 A;  3NGI A;  4FYD A;  3N4Q A;  2X74 A;  2FBV A;  3I8B A;  1KLM A;  5FPN A;  1HQE A;  3THW B;  1YXQ A;  1NM1 A;  3QIN A;  1LWC A;  3ZET A;  4A5B A;  3THY B;  1C1C A;  4DFK A;  3IMX A;  2HBK A;  2H3G X;  5E84 A;  3ID8 A;  5J2N A;  3KHY A;  2NRZ A;  1YT3 A;  3WXJ A;  2A3Z A;  3OYD A;  1VQP N;  3TAP A;  4CJK A;  4MFB A;  4DFM A;  4ILJ A;  3AO3 A;  3DRR A;  3WEE A;  4O5F A;  2QW9 A;  3BP8 A;  4BRG A;  2P9P A;  2A1S A;  4IG3 A;  3VQ6 A;  3AA4 A;  3CJC A;  1J9A A;  3NHG A;  2QWN A;  3AA3 A;  2E2Q A;  3MX2 A;  4CJF A;  4FJ8 A;  3OYA A;  4DU3 A;  2UXB K;  2KZM A;  4JLH A;  5AQU A;  4RW6 A;  1KD1 O;  1FJG K;  4CGF A;  5AQI A;  1YJ9 N;  4CGJ A;  3HBT A;  1RTI A;  2BTF A;  4Y1C A;  3HOS A;  4CFD A;  5B8H A;  1QZ5 A;  1RIL A;  5BPM A;  3TAG A;  4C1N K;  4DR6 K;  4LFB K;  1RT1 A;  1SL2 A;  1C0T A;  5BRD A;  4KI6 A;  2VG5 A;  3DLR A;  4N5S A;  2I7P A;  4CZG A;  4FZZ A;  4RWT A;  2Q3S A;  2CH6 A;  3FZK A;  3CJB A;  2CGK A;  2D0O A;  1GLF O;  4BDZ A;  5KPR A;  2IVO A;  5JVG L;  1N34 K;  2OZM A;  4O4G A;  1TYQ A;  1S6Q A;  2HMP A;  3QEW A;  1Q86 O;  1XNR K;  3DYA A;  1GLE G;  2PYJ A;  3CD6 N;  3VQE A;  3V9X A;  4F3T A;  2AJQ A;  3HM8 A;  2FSJ A;  2JLE A;  2HBM A;  5K14 A;  4B1W B;  3F9M A;  1RT5 A;  1VSL A;  4KTW A;  2P9U B;  4CZH A;  3OBY A;  2VG6 A;  5AZJ B;  3ID6 A;  3VQ8 A;  1RCH A;  3KD5 E;  4CF8 A;  1YAG A;  3P4I A;  1SL1 A;  2Z1G A;  3L2W A;  4W5Q A;  4DV0 K;  3HPG A;  1LWF A;  4DB3 A;  4DG1 A;  1JKH A;  3TAM A;  1HJO A;  2ZQB A;  4DHY A;  2OZS A;  3BZK A;  1K73 O;  3V9W A;  2HVH A;  4FPA A;  5GIP A;  1DEJ A;  1G99 A;  3H08 A;  3DXM A;  3UB5 A;  4YFU A;  3SV4 A;  3CQ8 A;  3OYH A;  4OGE A;  2GWJ A;  4DSE A;  4HUE A;  5J2P A;  4CZM A;  4N41 A;  3BF3 A;  4WF9 L;  4CFB A;  1U45 A;  3FZL A;  3O5B A;  3AO1 A;  4LFA K;  5IT9 O;  1ATS A;  1YUW A;  2Z1H A;  4A59 A;  3EZ5 A;  4EZ9 A;  1CZ9 A;  4KTQ A;  4FJ7 A;  5IWA K;  3SYZ A;  4H0Y B;  3EE9 A;  1Q9Y A;  4IEI A;  4FM1 A;  3VQP A;  1CLQ A;  3NDK A;  5KI6 A;  3AVH A;  1L3S A;  4BR5 A;  3OJS A;  1NKE A;  3LP0 A;  4CHO A;  4XH1 A;  2E8A A;  1W2B M;  3RMD A;  1BI4 B;  1DLO A;  3NH2 A;  4M7Y A;  1U48 A;  3CXC M;  5AQG A;  3UKU B;  3HXM A;  2P9U A;  3IAY A;  1NJY A;  2VQF K;  3TWH A;  1RBT A;  3VEW A;  5HBM A;  2WTU A;  2W42 A;  4X66 K;  3VQA A;  5EX5 A;  5AZI B;  4ILG B;  2HF3 A;  4BRA A;  5M1N A;  1D4X A;  1YF5 L;  3LP1 A;  1IG8 A;  2V51 B;  3HT3 A;  4JRQ A;  3MN5 A;  3B6O A;  2WUS A;  3NE6 A;  1IBK K;  4RG8 A;  4BRN A;  3C94 A;  1UA0 A;  4OO1 J;  4CVN E;  4H0V B;  4QOZ B;  1JLE A;  2HHH K;  4W5R A;  2BH1 A;  2P9K A;  3HYF A;  4HWI A;  1NMN A;  3LPU A;  3BZC A;  4KRE A;  4FLT A;  3TSQ A;  1S6P A;  2VGN A;  4H0T B;  2NRV A;  1I94 K;  1X1P A;  4C1N I;  4PA1 A;  4WQ4 C;  3HPO A;  2E6L A;  4CJU A;  1XUP O;  5HRS A;  2KZZ A;  3V81 A;  3M1F A;  4BWJ A;  1M1K O;  5AQX A;  3ZYY X;  5HL7 L;  1Q9X A;  3RR7 A;  1E4G T;  5J2M A;  1K6Y A;  4CZI A;  1RDD A;  3SMS A;  4JN4 A;  1JJ2 M;  1QQM A;  3BY5 A;  1XMO K;  5C0Y A;  3L2Q A;  1YJW N;  4DMN A;  3QEI A;  4E7J A;  2E4L A;  4E7K A;  2XRI A;  3V1R A;  4CD1 A;  4FOI A;  1HNZ K;  1KAY A;  3E1Y A;  3CFP A;  1Q82 O;  3SAH A;  3GL1 A;  4FSV A;  3OY9 A;  1S22 A;  3C0B A;  4TSX A;  4YOV A;  2RKI A;  3B6P A;  4DTP A;  2HHQ A;  4FZX C;  3VF4 A;  1OH5 A;  5HRO A;  2DFH A;  3FGU A;  4CZK A;  2ZGZ A;  4DTM A;  4JS5 A;  5T7B A;  4JI5 K;  4PKI A;  2ASM A;  4AM6 A;  5KGX A;  3AGR A;  1C0G A;  3E66 A;  3I55 N;  3EY1 A;  3VET A;  4JI6 K;  3ATU A;  1NJX A;  1SV5 A;  4WQ5 C;  1Q8I A;  5AR0 A;  5I9E B;  3VER A;  4CBU A;  3FFI A;  5SWM A;  2P9N B;  3ZT3 A;  3C7N B;  4FWM A;  3SQ2 A;  2RE2 A;  1IG9 A;  3V6D A;  4HUF A;  1OH8 A;  3O9Q A;  1SZ2 A;  3CIP A;  4CGH A;  5MLC Q;  5CR4 A;  2IC3 A;  1Z6R A;  1K8A O;  1WSH A;  1WNS A;  4DF4 A;  3CM6 A;  1U47 A;  3PO4 A;  4JHD A;  4BDP A;  3A5N C;  5SZT A;  2G8V A;  4ISG A;  3KKS A;  3WUH A;  1K8K A;  1RFQ A;  3TSU A;  3H45 C;  4DSJ A;  4LF9 K;  3AGK A;  5DM6 L;  3EL2 A;  4BRM A;  5FLX O;  3H6E A;  2X6S A;  4H5W A;  3PX6 A;  1TUY A;  2E88 A;  3TPQ A;  4G1Q A;  2O8D A;  3MWP A;  2F96 A;  4F2S A;  3NMU A;  3IUC A;  4LF4 K;  1Q18 A;  1EP4 A;  4A5A A;  3AO4 A;  2O8E B;  1U2V B;  1NGI A;  3MED A;  3OHR A;  3K9J A;  3VOV A;  1VSF A;  3QFP A;  4EP4 A;  3SUN A;  2JWL A;  2D1K A;  1R59 O;  5ADX A;  5HP1 A;  4Y0W A;  1NJW A;  2G8F A;  3KK2 A;  3RRG A;  4BRD A;  2W6L A;  1FKP A;  2P9N A;  2VYP A;  1NGJ A;  4DS5 A;  3IDH A;  3AVF A;  1NGG A;  3NF9 A;  1W9H A;  3QNO A;  1WOQ A;  5GAD P;  3O08 A;  3MEC A;  2PBD A;  5AQW A;  4BE1 A;  2Q1N A;  3WNH A;  1BQM A;  4DR4 K;  3E9O A;  1NGB A;  3PV8 A;  2YJF A;  3CJA A;  4V19 S;  2VGM A;  3CYM A;  5AQS A;  3HI0 A;  4O5B A;  4JKD A;  2P9S A;  3CET A;  2PY5 A;  3L2R A;  3AA5 X;  1XNQ K;  3HK2 A;  5BRH A;  1KCF A;  2QWP A;  5C15 A;  5F1X A;  3PIP L;  1SKS A;  3DMJ A;  4LH5 A;  4FVU A;  4C8O A;  3AO5 A;  3NAE A;  2IS3 A;  1GLB G;  3OS0 A;  2ZGY A;  4JK8 A;  2P5G A;  3IKM A;  4H5T A;  5FPE A;  1GLD G;  4FJK A;  2GTD A;  4WE1 A;  1YI2 N;  4RW7 A;  3OA9 A;  4FLV A;  3R8E A;  4JV5 K;  2AA4 A;  4Y1D A;  4DWI A;  4KHQ A;  3CQY A;  5J1E A;  1TKX A;  3AV9 A;  2QEX N;  4DTS A;  4NCA A;  4FPB A;  1BO5 O;  1V4S A;  1EWR A;  1L5U A;  1E3M A;  3IRX A;  3M8Q A;  1X9M A;  3SMP A;  1NLV A;  3RTV A;  3O9S A;  3E9P A;  2QM1 A;  3NF6 A;  4B1U B;  5KQ8 A;  3KK7 A;  3CHW A;  3IFR A;  4BRP A;  4BR0 A;  5CZ2 A;  3CCQ N;  4AHU A;  4E3S A;  3VF6 A;  1HPM A;  5KPZ A;  1NGD A;  1LCU A;  2O8C B;  4BGA A;  3BGR A;  2QXF A;  1VQL N;  3VQC A;  2YNG A;  4RW8 A;  3LZI A;  3LDN A;  2J4R A;  4U67 L;  1IH7 A;  4LH4 A;  4AH9 A;  5EXW A;  1IBM K;  4Z4H A;  3HTV A;  2HOE A;  4IOX A;  4IG0 A;  1HNW K;  3KWG A;  3KTQ A;  3LAN A;  1QQC A;  2E1Y A;  1N8R O;  4B9L A;  3MN7 A;  3KLI A;  4H0X B;  3J7Z O;  4LY7 A;  4CI6 A;  4JKC A;  4DLG A;  3VTI A;  4CJ4 A;  1Y97 A;  3KWI A;  3J7Y P;  2YNI A;  4FWO A;  1S3X A;  3LWM A;  1EQY A;  5C12 A;  3QEX A;  1U04 A;  5JLH A;  4DSK A;  2HND A;  4DQ8 A;  4H5N A;  4CJ5 A;  3DLB A;  4XEI A;  2QI2 A;  3W3D A;  4Z94 A;  3VQ5 A;  3KLH A;  1SKW A;  2FF3 B;  4JAX A;  2HNZ A;  4FJM A;  1JCE A;  5JLF A;  4C8K A;  4RTF D;  1IKX A;  4QCL A;  2Z1J A;  4I9L A;  4FLW A;  2EWS A;  3IS9 A;  4DTJ A;  2OTJ N;  5M1K A;  3WNG A;  4DTX A;  4A62 A;  2QTD A;  4DR2 K;  3QB0 A;  4YDU A;  3KLE A;  2YHA A;  3HO1 A;  4BRC A;  1NJZ A;  1NK0 A;  4CZE A;  2FSN A;  4NXN K;  2YI1 A;  3RSE A;  1KSP A;  3ZX2 A;  5D3G A;  2YNH A;  5KGW A;  4CIE A;  4CEZ A;  4DSF A;  3QFU A;  3VQB A;  1VQ6 N;  3D2E B;  2QKB A;  2D5R A;  1NOZ A;  3SJJ A;  3T7Z A;  3QDK A;  1JLF A;  4F4K A;  3T3F A;  4NYF A;  1S9G A;  5M1F A;  3O4N A;  3C6A A;  5C25 A;  3S3O A;  1GLA G;  4B3S K;  4YOU A;  3NBP A;  1T03 A;  2D4W A;  1TL3 A;  3DLH A;  3L6Q A;  3JYT A;  4JK7 A;  5H1S Q;  1HKG A;  2KLA A;  3OYB A;  5FPM A;  1P90 A;  4B9N A;  2NRR A;  4IDK A;  4B1Y B;  3U3Y A;  5HLF A;  1H1V A;  3CFO A;  3K57 A;  1Z25 A;  1RDW X;  3THX A;  1ZBL A;  4DTU A;  4X65 K;  2RHK A;  2JWK A;  2E5L K;  3UKR B;  4A61 A;  4FW2 A;  1ASU A;  4W5N A;  5C2F A;  1U49 A;  1JLG A;  4CHN A;  3LDS A;  3D0P A;  4FM2 A;  4B3R K;  4DR1 K;  2ITG A;  3DRS A;  1YTU A;  3QO9 A;  4CEF A;  5TKW A;  2ZJP L;  1TVR A;  2WON A;  2YV0 X;  3CM5 A;  1W0H A;  4ELU A;  2A41 A;  2NNW A;  1QZ6 A;  4AHC A;  5A2Q O;  2NRW A;  1O1W A;  2I7N A;  3R9P A;  3HPH A;  3VEO A;  3VPZ A;  3N4P A;  4AHT A;  2O4G A;  3PO5 A;  1QSY A;  4A57 A;  4C8N A;  4PQU A;  1WUA A;  5LMU K;  4DQQ A;  2PAV A;  3THW A;  3DXK B;  3K5O A;  3THY A;  3NH1 A;  3AVC A;  3CPE A;  3C6H A;  1IBL K;  3SUO A;  4BR7 A;  4JI3 K;  4LC9 B;  3K2P A;  4BVP A;  2CGL A;  4B9U A;  3QEV A;  4KB0 A;  4DKW A;  3OS1 A;  1FW6 A;  2RF2 A;  1T7P A;  4B1V A;  3CCU N;  2W6K A;  4H4M A;  4CEE A;  2GUI A;  1WSE A;  3CCE N;  1VAZ A;  3DOK A;  4B8C A;  3SQ1 A;  3ZLJ A;  1N5Y A;  1MWK A;  5KPT A;  1WSJ A;  4OKK A;  4BRI A;  1UWB A;  3UKR A;  1IKW A;  1GOB A;  5AQF A;  1VSE A;  5HRR A;  4NCB A;  4JEP A;  4B1X B;  1D8Y A;  2KKZ A;  1B9F A;  2ASO A;  4OX9 K;  3CJ7 A;  1C1A A;  4IFV A;  4A2B A;  3J8A A;  2HHT A;  3U6F A;  3HL8 A;  1J5E K;  5BR9 A;  4CF9 A;  5LMN K;  1ZBI A;  4BR4 A;  4WCE L;  1BCM A;  2A6A A;  4AM7 A;  5ADX H;  3FFK B;  1NGE A;  3CPW M;  1HNI A;  3L0Q A;  2IGI A;  2VG7 A;  3TAF A;  2GEM A;  2GWK A;  1I39 A;  4K25 A;  4O0J A;  4G9Z A;  3SQ0 A;  2HST A;  1X3M A;  3C6U A;  1Q81 O;  4FJ9 A;  5HOO A;  4FK2 A;  4ID5 A;  1NK8 A;  4KH4 A;  5JVH L;  4ISF A;  4KRF A;  3E01 A;  2G8U A;  4IOA L;  1ZBH A;  4CIG A;  2E2P A;  4FWK A;  4CK3 A;  3WXL A;  3VF2 A;  4LSN A;  5TKY A;  4YY3 K;  5EOY A;  4IOC L;  4OKJ A;  1KTQ A;  1X9J A;  4MO4 A;  3S41 A;  4CJQ A;  4MQ3 A;  1S1T A;  4H0P A;  4EFH A;  1VSK A;  3AA2 A;  2CH5 A;  3O9U A;  3V9Z A;  1NK9 A;  1ITG A;  1NNE A;  1DKG D;  4IBN A;  3ITH A;  4H03 B;  4CBW A;  1P8Z A;  2G8K A;  2YHY A;  4IO8 A;  2BE2 A;  3PLA A;  4FLZ A;  4EP5 A;  1TK8 A;  3QES A;  1BUP A;  4DF8 A;  1NOY A;  4KI4 A;  5AZJ A;  4U7B A;  1BIZ A;  1HPZ A;  4CGD A;  1TAU A;  1LWE A;  4FJX A;  4E1J A;  4DR5 K;  1QQN A;  1MA9 B;  3U9D A;  4PHT X;  4E1N A;  4KBO A;  2E1Z A;  4H5V A;  5AQZ A;  1HKC A;  3HVT A;  4B08 A;  1YIT N;  4I7F A;  3TSP A;  4HHT A;  4HTL A;  3AVA A;  3QIO A;  4FL9 A;  4FJI A;  1W97 L;  1I3A A;  4BG8 A;  1JLB A;  3LL3 A;  2E6M A;  3UE5 A;  3SZ2 A;  1A5V A;  2E20 A;  3THV A;  1RDA A;  1EXQ A;  4CE9 A;  1RDB A;  1BCO A;  4FJG A;  1T05 A;  4KHS A;  4B9M A;  1CXQ A;  4CJW A;  2QWM A;  1WLJ A;  3L2V A;  3QNN A;  3CME N;  4X62 K;  2HBJ A;  1VSM A;  4FJN A;  2ZD1 A;  4DQP A;  4BC4 A;  3CCM N;  3L8B A;  4M42 A;  4CCH A;  3GG4 A;  1T3V A;  2NUB A;  3V4I A;  4PY5 A;  1ZXO A;  4GKK K;  3OYC A;  1KQS M;  1XC3 A;  4I2Q A;  3A5O C;  3MWT A;  1BI4 A;  4IJA A;  3MAQ A;  3D2F B;  3DLG A;  5HRN A;  1RNH A;  5AQH A;  3UKU A;  2HMI A;  5FDL A;  3F5T A;  2I5J A;  4N47 A;  2WFB A;  1IV0 A;  1GOA A;  3O80 A;  3VEX A;  4WFA L;  4B3T K;  3CCS N;  2WOM A;  5AZI A;  2R7Y A;  4BQL A;  3B8A X;  1T8E A;  2IDO A;  4E19 A;  3W0L A;  4WFB L;  3OTO K;  5EU7 A;  4BRO A;  1QQO A;  1ZBF A;  1JL2 A;  2GEL A;  2UXD K;  3LP2 A;  1BA1 A;  2XHB A;  3OYG A;  3SAF A;  2WBN A;  1C0M A;  5GAG P;  5KQD A;  2YKN A;  4M7X A;  5AFU A;  4DFP A;  4H4O A;  1WBB A;  2QWR A;  4KHW A;  2WC9 A;  3ZEU B;  4LF5 K;  5AQT A;  3OYK A;  3CCR N;  4BR9 A;  1IKY A;  3ZT2 A;  1LV5 A;  4CFA A;  3JAM O;  3P1G A;  3LP3 A;  2UU9 K;  2P9L B;  5CY4 A;  5AQK A;  1SKR A;  2YX6 A;  4CK1 A;  5AJ3 K;  3R6M A;  4BGB A;  3JS6 A;  3CCJ N;  1WN7 A;  4FZY A;  5GAE P;  3K5N A;  4N76 A;  4R79 A;  3A2F A;  3OYJ A;  2YHB A;  1NGF A;  2IIR A;  1RDC A;  5I42 A;  2KHO A;  1J54 A;  3LAM A;  4CJS A;  3E9L A;  1HYV A;  4GMJ B;  1V4T A;  3ZT1 A;  1RT3 A;  3V1Q A;  3SLC A;  2UUA K;  4BRK A;  2G8H A;  4JI4 K;  3ULE B;  1RBS A;  3VA0 A;  4YNQ A;  5JS1 A;  3EZW A;  3GOI A;  3VQQ A;  4IFE A;  4WQ4 A;  2FXU A;  1KVB A;  2Z1I A;  4Z4I A;  2FLO A;  4ISE A;  3ZSQ A;  1KFD A;  1QTM A;  1BIU A;  4H5R A;  1BU6 O;  1DT9 A;  4DSL A;  2Q31 A;  4EHU A;  4GW6 A;  1XWL A;  5CYQ A;  3FZF A;  3MN9 A;  2XY7 A;  3ASM A;  2D0P A;  2EHG A;  4PL8 A;  1VQM N;  1WAJ A;  3ENB A;  1HKB A;  4GVE A;  1GLJ O;  1QVG M;  3QLH A;  3K58 A;  4O44 A;  3FE1 A;  1J6Z A;  3KLF A;  2YCH A;  4AIL C;  3C7N A;  1XI1 A;  3MDQ A;  3F9K A;  4B3O A;  5BRE A;  1VRU A;  3KZB A;  4CFC A;  3RR8 A;  5FRN A;  4BY9 C;  1JXE A;  5AQM A;  3KK1 A;  3ENO A;  3MCA B;  3I8D A;  3AVK A;  3MXJ A;  4B9Q A;  3CJ9 A;  4GV9 A;  4FJ5 A;  1OVY A;  4CF2 A;  4Z4C A;  1WSG A;  2BAN A;  1EX4 A;  1BDG A;  4HCB A;  2ZF5 O;  1SL0 A;  3SPY A;  1YTA A;  4FJL A;  2HVI A;  1QS4 A;  4CEC A;  2NRX A;  2ATQ A;  4WQ5 A;  4DTO A;  4M45 A;  1A5X A;  2ZM6 K;  2FBY A;  2Q2R A;  2BUP A;  4BRF A;  4YOX A;  2D0A A;  4C23 A;  1X3N A;  1ZBS A;  4L3Q A;  3UIQ A;  3O3H A;  2HBL A;  3TTC A;  2XY8 A;  3U4L A;  3CC4 N;  4GNI A;  2NRT A;  2IOC A;  3ISN C;  1BWF O;  3ULD A;  2DFF A;  3Q7C A;  1FK9 A;  1KXP A;  2B6A A;  4PKH A;  2O8E A;  1U2V A;  4CZJ A;  4K8X A;  4YOY A;  3LM2 A;  2X78 A;  1RT2 A;  1BA0 A;  3M8P A;  3LDO A;  2GBZ A;  3I0S A;  3SV3 A;  1NBW A;  4DV3 K;  5KTQ A;  4JRP A;  1VQ5 N;  4FO0 A;  3VA3 A;  1S1V A;  2F4V K;  3PUF A;  4CHQ A;  3I0R A;  5CE3 A;  3NCI A;  3T1H K;  1YIJ N;  4JKH A;  2G8W A;  5KRT A;  3ATV A;  4K41 A;  5AQQ A;  3K59 A;  2W40 A;  1VSJ A;  4M3Y A;  3ZSZ A;  2HHX A;  4BRQ A;  3F2K A;  4PKG A;  3CER A;  2O8B B;  3A0I X;  4QS7 A;  3MMV A;  3MN6 A;  3QBW A;  4BC3 A;  4FXD A;  3MXM A;  5M1Q A;  5C2D A;  3WXM B;  2NRH A;  1RT6 A;  4FVM A;  5DM7 L;  4O8K A;  4JKE A;  2QA4 N;  4HVJ A;  2XY6 A;  1NK4 A;  1HQU A;  3OBW A;  3G25 A;  5C24 A;  3LPT A;  4GVM A;  4BC2 A;  3BF1 A;  2Q0R A;  3O4W A;  1JLA A;  2QWQ A;  5KRS A;  3HM9 A;  4NO7 A;  4KO0 A;  2P9I B;  3OYL A;  3NGZ A;  4F8R A;  3EKU A;  1B9D A;  5ELZ A;  1ATR A;  4YOR A;  4Z4E A;  1BIS A;  3VGK A;  1Y64 A;  1NMD A;  4AHR A;  1CZB A;  3O9R A;  4YOT A;  3AVL A;  4DTR A;  1UAX A;  4CJ3 A;  2DY4 A;  4CGG A;  3DLE A;  1RT4 A;  4DV6 K;  4A2A A;  5CYM A;  1SUQ A;  4BDY A;  1RBR A;  3KJV A;  2Y1I A;  1NG9 A;  1T6C A;  4H8K A;  3EE8 A;  4MLH A;  4M3U A;  3T1Y K;  4ZTJ A;  2YNF A;  4JI1 K;  4MLE A;  4FK4 A;  4JKG B;  1NK6 A;  2RN2 A;  1RTJ A;  2HF4 A;  4I6M B;  2QKK A;  3SJH A;  4B3M K;  1DTQ A;  4I2P A;  3VEN A;  3ZT0 A;  2XO7 A;  4F2R A;  3ZET B;  5BR8 K;  4DQS A;  4M3T A;  3BDP A;  3CFR A;  1QSL A;  3MCP A;  4FLY A;  1S1X A;  3T69 A;  5LJW A;  3ZX0 A;  3O9T A;  3J81 O;  4CHP A;  2BDP A;  1GLC G;  4GY2 B;  2O8C A;  2YJE A;  2ETJ A;  3HVR A;  3PX0 A;  1SS6 A;  1MDU B;  4JI8 K;  1XQS C;  3OYF A;  1LOT B;  4AHS A;  4LF8 K;  4IO9 L;  1NK7 A;  4IEE A;  4BRH A;  4BQZ A;  1U6Z A;  4O55 A;  3LDL A;  4CHZ A;  3WEE B;  2P9P B;  4FJH A;  1RGI A;  1YJN N;  4CIF A;  2YHX A;  4YOW A;  3EYZ A;  1J5O A;  3K5L A;  4DCH A;  2DPN A;  3BEX A;  4J2B A;  3LZJ A;  3D7E O;  4CER A;  1VHX A;  4W5T A;  3M6G A;  3ZT4 A;  3OYM A;  3SBG A;  4KPY A;  2JGU A;  1D9D A;  3CC7 N;  3OS2 A;  3DLL L;  2FC0 A;  1KAX A;  3AVJ A;  3EKS A;  1VQO N;  4C8L A;  4EHT A;  4BRE A;  4CES A;  3G0Z A;  1OH7 A;  5I3U A;  4DU1 A;  2A42 A;  3QER A;  1XHZ A;  3O6W A;  2QWL A;  1LW0 A;  2ZJQ L;  2OYQ A;  1RTD A;  2BGG A;  3L4Q A;  1VQ7 N;  1TK5 A;  3H1Q A;  3SNN A;  4DQI A;  3VQ7 A;  2HHV A;  3OVN A;  4LF7 K;  3Q7B A;  1ESV A;  1IJJ A;  1HUX A;  4QS8 A;  3MEG A;  5BN8 A;  3EO3 A;  3L3V A;  4JNE A;  1VQ8 N;  1TYQ B;  1NWK A;  3K0S A;  2AP1 A;  4H0O A;  4OVL A;  4FJJ A;  1YVU A;  3R3L A;  5AFU H;  3U8X A;  4JD2 B;  2P5O A;  1SAZ A;  3M8R A;  4CF0 A;  3FR0 A;  1QVF M;  3CJ1 A;  3MK6 A;  3SAG A;  3PSF A;  2GX9 A;  3HSC A;  4UY8 O;  4WYB A;  2UYT A;  3U3G A;  3DRP A;  4M3Z A;  4PUO A;  1HLU A;  1VSI A;  3AVB A;  1UOC A;  3OYI A;  1NGH A;  1IKV A;  3D2E A;  4CHY A;  3HP6 A;  3P38 A;  4E0D A;  2FSK A;  3MXI A;  1GOC A;  4UQG A;  4W5O A;  1VK0 A;  3FLC O;  4ID1 A;  2PFU A;  5LL6 Z;  4O8U A;  1EO1 A;  4IWV A;  3SBT A;  4FWQ A;  1ASW A;  1HNV A;  4FLU A;  1BOT O;  1JXB A;  5HRP A;  1G15 A;  3CI5 A;  4BR2 A;  1LW2 A;  4CJL A;  5F0X A;  4O0I A;  2PYL A;  3HRG A;  2CGJ A;  1L3T A;  3AO2 A;  5FRO A;  3I56 N;  3MEE A;  4DV4 K;  3DXM B;  3K5M A;  4AHV A;  1VQK N;  4BWM A;  3L2U A;  4DV7 K;  4I9Q A;  1S1U A;  3FZH A;  4N56 A;  1DGK N;  1MWM A;  3AAP A;  4ICL A;  4OLB A;  4WFN L;  1KC8 O;  3O8M A;  1TGO A;  4JD2 A;  2A40 A;  1QE1 A;  3VGL A;  5J2Q A;  2PZS A;  3QBX A;  4DS4 A;  1C0F A;  4JYA K;  1NKB A;  3NF7 A;  2B5J A;  3L3U A;  3NGY A;  1CZA N;  3DWL A;  2HHU A;  5C42 A;  4ZHR A;  3VEZ A;  2XY5 A;  4LSL A;  4DV1 K;  1KVA A;  1TK0 A;  1HJR A;  2LSN A;  1W7A A;  2D0C A;  3M8S A;  2IAJ A;  3D6R A;  4JKB A;  3DXK A;  1ATN A;  4RCH A;  2O4I A;  2VQE K;  3LWL A;  4K0K K;  3P31 A;  4B8A B;  4CEB A;  3C6T A;  3CCV N;  3TAE A;  3QET A;  1KLN A;  3PIO L;  4JS4 A;  1QSS A;  1D9F A;  1C1B A;  3VGM A;  4OPJ A;  1OKJ A;  2F8T A;  1Q7Y O;  1A5W A;  4C8M A;  2Q97 A;  2NZT A;  2D0B A;  5AQN A;  1TKD A;  4EAH D;  2P9K B;  4KV8 A;  1N36 K;  4CED A;  3WXI A;  2V7Z A;  5BPN A;  3AY9 A;  3H3O B;  1RDU A;  4BVO A;  1XMQ K;  4KAZ A;  3VES A;  3P83 D;  2Y1J A;  2FBT A;  4L8R B;  3CC2 N;  1WBD A;  3SK3 A;  4OPK A;  3ALY A;  1JCF A;  4M63 C;  2KTQ A;  1NU0 A;  5EY4 A;  1N33 K;  5F2R A;  3BUZ B;  3GDQ A;  3OW2 M;  3K9K A;  3PY8 A;  3WQU A;  3O4Q A;  4IKF A;  3VTH A;  3NH0 A;  3H46 O;  2ZJR L;  4F9O A;  4XH5 A;  4FCY A;  4DTN A;  2W41 A;  1ZYQ A;  4FK0 A;  4K43 A;  5EVZ A;  3ZSW A;  1WAF A;  3DAW A;  5AQY A;  1S1W A;  3RVC A;  1MU2 A;  4CK2 A;  5AQR A;  1YHQ N;  1VSH A;  2OA8 A;  3ZSO A;  3QEP A;  2KFZ A;  2YKM A;  1EWQ A;  3ZSX A;  3G4S N;  3H3N O;  1X9S A;  3WNE A;  4F3O A;  4IXC A;  3OYN A;  1S9E A;  2EX3 A;  4KHY A;  1XHX A;  4JKF A;  1VSD A;  3ZSY A;  3LDQ A;  4CEA A;  1NJI O;  2OTL N;  1BQN A;  4IZ9 A;  4B1Z A;  2E2O A;  2G8I A;  4DR3 K;  4E7L A;  5DMR A;  1HRH A;  1TUU A;  1S5J A;  3QML A;  5LJV A;  5BPL A;  1OH6 A;  1WSI A;  1L3V A;  5AQO A;  4IFY A;  4OPH A;  4DV5 K;  3CQX A;  4EZ6 A;  3OYE A;  4JHD B;  3P39 A;  3L4I A;  4CZF A;  1KVC A;  5BRF A;  1GLL O;  1K8K B;  2Q36 A;  1JLQ A;  1RTH A;  3TAQ A;  3C65 A; 
#chains in the Genus database with same CATH homology
 2X78 A;  1RT2 A;  4DG1 A;  4CEZ A;  3M8P A;  1JKH A;  3TAM A;  2GBZ A;  3I0S A;  3SV3 A;  4DSF A;  2ZQB A;  2B4J A;  2OZS A;  5KTQ A;  1RBU A;  3VQB A;  4JRP A;  3V9W A;  2HVH A;  3VA3 A;  4B9V A;  2QKB A;  1S1V A;  1N6Q A;  4M3X A;  2D5R A;  3H08 A;  3PUF A;  3HJF A;  1J53 A;  1NOZ A;  4CHQ A;  3SJJ A;  3I0R A;  1X9W A;  1JLF A;  3DOL A;  3NCI A;  4YFU A;  3SV4 A;  3CQ8 A;  3OYH A;  4OGE A;  4F4K A;  4DSE A;  4HUE A;  4NYF A;  3T3F A;  5J2P A;  4N41 A;  1S9G A;  4CGI A;  2G8W A;  5KRT A;  4J2D A;  3O4N A;  4CFB A;  3S3M A;  4K8Z A;  1U45 A;  3AO1 A;  3K59 A;  5C25 A;  4B9S A;  1VSJ A;  4HUG A;  4CEO A;  3S3O A;  4M3Y A;  3ZSZ A;  2OPQ A;  2HHX A;  2Z1H A;  3NBP A;  3EZ5 A;  3VQD A;  1T03 A;  4EZ9 A;  1CZ9 A;  1TL3 A;  4KTQ A;  3SUP A;  3DM2 A;  4FJ7 A;  4FXD A;  3DLH A;  3MXM A;  3SYZ A;  3JYT A;  1RT6 A;  1JL1 A;  1Q9Y A;  4FVM A;  3OJU A;  3OYB A;  4M3R A;  4FM1 A;  3SI6 A;  1XC9 A;  3VQP A;  4B9N A;  2HNY A;  3LAL A;  3NFA A;  4IDK A;  5KI6 A;  3NDK A;  1L3U A;  1CLQ A;  3KIO A;  3U3Y A;  3AVH A;  4HVJ A;  5HLF A;  2XY6 A;  2AJQ A;  1NK4 A;  1L3S A;  1HQU A;  3CFO A;  3OJS A;  3K57 A;  3LP0 A;  5C24 A;  1Z25 A;  1BGX T;  3LPT A;  3D45 A;  4GVM A;  4CHO A;  3RMD A;  1KFS A;  1BI4 B;  1DLO A;  1JLA A;  3HP9 A;  3NH2 A;  4DTU A;  1ZBL A;  1U48 A;  4FW2 A;  5KRS A;  3HXM A;  3HM9 A;  3IAY A;  4KO0 A;  3OYL A;  1ASU A;  1NJY A;  4DSI A;  4W5N A;  3NGZ A;  4F8R A;  1U49 A;  1JLG A;  3TWH A;  1RBT A;  4CHN A;  3LDS A;  3D0P A;  1NK5 A;  5HBM A;  1B9D A;  4FM2 A;  2W42 A;  1TKT A;  4DU4 A;  3TAN A;  2ITG A;  4Z4E A;  3VQA A;  1BIS A;  3DRS A;  4AHR A;  5FRM A;  2OPP A;  1YTU A;  3KLG A;  3QO9 A;  1CZB A;  4CEF A;  1TVR A;  2WON A;  2YV0 X;  3CM5 A;  1W0H A;  3IG1 A;  4ELU A;  3AVL A;  1HYS A;  3LP1 A;  4AHC A;  4DTR A;  5DK5 A;  1UAX A;  4CJ3 A;  2DY4 A;  2VWK A;  1O1W A;  3HT3 A;  4JRQ A;  4CGG A;  3B6O A;  1RT4 A;  3AVM A;  3DLE A;  3HPH A;  3NE6 A;  4KFB A;  4RG8 A;  5CYM A;  4RW4 A;  4ZTF A;  4AHT A;  1SUQ A;  2O4G A;  3PO5 A;  1QSY A;  3C94 A;  3SQ4 A;  3P5J A;  4C8N A;  1UA0 A;  4BDY A;  1NKC A;  1RBR A;  2P51 A;  3KJV A;  2Y1I A;  4PQU A;  1Z26 A;  4H8K A;  4DFJ A;  2P1J A;  4DQQ A;  4FLX A;  3K5O A;  4QOZ B;  3NH1 A;  1JLE A;  3AVC A;  1KRP A;  4M3U A;  4ZTJ A;  2YNF A;  3ZCM A;  4W5R A;  4FK4 A;  4FM0 A;  4CJP A;  2HHS A;  3HYF A;  3SUO A;  3RMB A;  2RN2 A;  1NK6 A;  3DI6 A;  1RTJ A;  3LPU A;  4BE0 A;  4LD0 A;  2QKK A;  4KRE A;  4FLT A;  3K2P A;  4NCG A;  4B9U A;  3QEV A;  4KB0 A;  4PWD A;  1DTQ A;  3OS1 A;  4I2P A;  2RF2 A;  1TKZ A;  1T7P A;  1S6P A;  3DLK A;  3ZSR A;  3V9U A;  4H4M A;  3ZT0 A;  4CEE A;  4R5P A;  2XO7 A;  4DQS A;  4F2R A;  2GUI A;  3AVI A;  4M3T A;  3BDP A;  3CFR A;  1C0U A;  1X1P A;  3ZSV A;  4E89 A;  2DTU A;  1QSL A;  1WSE A;  4PA1 A;  1S1X A;  3HPO A;  1FKO A;  4FLY A;  2E6L A;  4CJU A;  3DOK A;  4B8C A;  4CHP A;  2BDP A;  3SQ1 A;  3SPZ A;  5HRS A;  4Z4G A;  4Q0B A;  1N5Y A;  2FBX A;  3S3N A;  2KZZ A;  1WSJ A;  2ETJ A;  4OKE A;  3HVR A;  3V81 A;  3PX0 A;  4OLA A;  4OKK A;  2HB5 A;  4BWJ A;  1UWB A;  1IKW A;  1GOB A;  1VSE A;  1Q9X A;  3OYF A;  5HRR A;  4NCB A;  1WSF A;  4AHS A;  4KHN A;  3RR7 A;  1D8Y A;  5J2M A;  1B9F A;  1NK7 A;  1K6Y A;  1C1A A;  1RDD A;  4IFV A;  4O55 A;  2HHT A;  2HHW A;  1HYZ A;  4CHZ A;  3U6F A;  3HL8 A;  1HMV A;  3KK3 A;  2HW3 A;  3L2Q A;  4FJH A;  4CF9 A;  4M41 A;  3VQ9 A;  1CXU A;  4DLE A;  1ZBI A;  4CIF A;  3T1A A;  3EYZ A;  1RT7 A;  4DMN A;  3QEI A;  4E7J A;  1NKE A;  1BCM A;  4FW1 A;  1J5O A;  2E4L A;  2KFN A;  3K5L A;  1HNI A;  4KTZ A;  4E7K A;  2XRI A;  2IGI A;  3V1R A;  2VG7 A;  4J2B A;  3LZJ A;  4CER A;  3VN5 A;  3TAF A;  1F21 A;  1I39 A;  1R0A A;  4W5T A;  3CFP A;  3TI0 A;  4O0J A;  3ZT4 A;  3LAK A;  3OYM A;  4B9T A;  3SQ0 A;  4HCC A;  4KPY A;  1TAQ A;  3TR8 A;  3OY9 A;  2JGU A;  5JS2 A;  3C6U A;  1D9D A;  4TSX A;  4FJ9 A;  2RKI A;  3B6P A;  3OS2 A;  4DTP A;  4ID5 A;  2FC0 A;  1NK8 A;  4FZX C;  4FK2 A;  2HHQ A;  3AVJ A;  5HRO A;  2DFH A;  4DTM A;  4KRF A;  3E01 A;  5T7B A;  4JS5 A;  2G8U A;  4CIG A;  4C8L A;  1ZBH A;  4CK3 A;  4OJR A;  5KGX A;  4CES A;  3G0Z A;  4NYN A;  4LSN A;  3EY1 A;  4CJV A;  4DU1 A;  5I3U A;  4M3W A;  1ZBU A;  3F73 A;  3RWU A;  3QER A;  1XHZ A;  1NJX A;  4OKJ A;  1SV5 A;  1KTQ A;  1Q8I A;  1LW0 A;  2KW4 A;  4CJQ A;  4J2E A;  2OYQ A;  4MQ3 A;  1S1T A;  3AVG A;  2VWJ A;  3FFI A;  5SWM A;  1RTD A;  3ZT3 A;  2DFE A;  1VSK A;  3AA2 A;  3SQ2 A;  2BGG A;  1TK5 A;  3V9Z A;  3RMC A;  1IG9 A;  1REV A;  3V6D A;  3VQ7 A;  4HUF A;  3SNN A;  4DQR A;  1NK9 A;  1ITG A;  3OVN A;  3PX4 A;  4DQI A;  2HHV A;  1EET A;  4IBN A;  2F8S A;  3ITH A;  3MEG A;  3L3V A;  4CGH A;  4BE2 A;  2IC3 A;  3V9S A;  2G8K A;  3V1O A;  2BE2 A;  3RRH A;  4ELT A;  4KHU A;  4OVL A;  1WSH A;  1WNS A;  1YVU A;  3CM6 A;  4DF4 A;  4FLZ A;  1C6V A;  1U47 A;  4EP5 A;  3PO4 A;  4BDP A;  1TK8 A;  5SZT A;  3QES A;  4DF8 A;  1NOY A;  2G8V A;  3KKS A;  4KI4 A;  2P5O A;  4DSJ A;  2OPR A;  4KB1 A;  3M8R A;  4CF0 A;  1BIZ A;  1HPZ A;  4CGD A;  1TAU A;  1LWE A;  4FJX A;  4J2A A;  2GV9 A;  2X6S A;  2OPS A;  3PX6 A;  1BHL A;  1JLC A;  4RW9 A;  3U3G A;  4CJT A;  4E1N A;  3DRP A;  1ASV A;  4M3Z A;  4PUO A;  4G1Q A;  2F96 A;  3HVT A;  4B08 A;  1VSI A;  4F2S A;  3AVB A;  4I7F A;  1UOC A;  3OYI A;  1IKV A;  4CHY A;  4ELV A;  3HP6 A;  1EP4 A;  4HHT A;  4E0D A;  2QK9 A;  5E41 A;  3AO4 A;  3AVA A;  1RBV A;  3QIO A;  1B92 A;  3MXI A;  4FJI A;  1GOC A;  4UQG A;  4W5O A;  1LAV A;  1VK0 A;  3O3F A;  3CG7 A;  1I3A A;  4ID1 A;  4E7H A;  2A1R A;  3MED A;  1JLB A;  4E1M A;  2E6M A;  3SZ2 A;  1ASW A;  1VSF A;  1A5V A;  1HNV A;  4FLU A;  3THV A;  1RDA A;  1EXQ A;  1JXB A;  1RDB A;  4CE9 A;  4EP4 A;  1BCO A;  1G15 A;  4CJL A;  1LW2 A;  5HRP A;  3O3G A;  3SUN A;  1T05 A;  4FJG A;  4O0I A;  2PYL A;  4KHS A;  1L3T A;  3AO2 A;  5FRO A;  4B9M A;  3MEE A;  5HP1 A;  1CXQ A;  4CJW A;  1NJW A;  1WLJ A;  3K5M A;  2G8F A;  3HST B;  3L2V A;  1LAW A;  4AHV A;  3QNN A;  4FJN A;  1VSM A;  3KK2 A;  4BWM A;  3QIP A;  3L2U A;  3RRG A;  4I9Q A;  1FKP A;  2ZD1 A;  4DQP A;  1S1U A;  3L8B A;  1FXX A;  4DS5 A;  4CCH A;  4M42 A;  3AVF A;  2NUB A;  3V4I A;  3NF9 A;  1W9H A;  4N56 A;  3QNO A;  3SUQ A;  4PY5 A;  1D5A A;  3OYC A;  1BL3 A;  4I2Q A;  4CJE A;  3TAB A;  4Z0U A;  3MEC A;  1BI4 A;  4ICL A;  4OLB A;  3MAQ A;  3DLG A;  5HRN A;  4E7I A;  1RNH A;  3AVN A;  4BE1 A;  3VQ4 A;  2RPI A;  1BQM A;  3WNH A;  3KD1 E;  2HMI A;  5FDL A;  2I5J A;  3PV8 A;  1TGO A;  4N47 A;  3NF8 A;  3G10 A;  1GOA A;  1VRT A;  1QE1 A;  3T19 A;  5J2Q A;  2WOM A;  3CYM A;  2PZS A;  4O5B A;  4CEQ A;  2R7Y A;  3WNF A;  4DS4 A;  1NKB A;  4BAC A;  3NF7 A;  2PY5 A;  2B5J A;  3L3U A;  3NGY A;  3L2R A;  2IDO A;  4E19 A;  3AA5 X;  1T8E A;  4Z4F A;  4KKO A;  3C95 A;  3HK2 A;  2HHU A;  1KCF A;  5C42 A;  4ZHR A;  5EU7 A;  4CJR A;  3SCX A;  1SKS A;  1ZBF A;  3DMJ A;  1JL2 A;  4LH5 A;  3LP2 A;  4C8O A;  2XY5 A;  4LSL A;  2XHB A;  1EKE A;  3OYG A;  3AO5 A;  1KVA A;  4OGC A;  1QHT A;  3NAE A;  1IO2 A;  1C0M A;  1HJR A;  1TK0 A;  2IS3 A;  2YKN A;  4QAG A;  3OS0 A;  3JSM A;  3S9H A;  2P5G A;  1DTT A;  2LSN A;  2D0C A;  3M8S A;  4DFP A;  4H4O A;  2IAJ A;  4Q5V A;  1UA1 A;  4FJK A;  4KHW A;  3RMA A;  4XIU A;  2KQ2 A;  1U4B A;  1TL1 A;  4WE1 A;  3OYK A;  2X6N A;  1TV6 A;  4HTU A;  2O4I A;  1IKY A;  4RW7 A;  3LWL A;  2ZE2 A;  3ZT2 A;  4B8A B;  3C6T A;  4CEB A;  4CFA A;  3KKR A;  4FLV A;  3P1G A;  1LV5 A;  3LP3 A;  3QET A;  3TAE A;  1KLN A;  4JS4 A;  4CF1 A;  3TAR A;  5CY4 A;  1QSS A;  5CZ1 A;  1D9F A;  1SKR A;  4Y1D A;  3NGI A;  4DWI A;  4KHQ A;  1C1B A;  4OPJ A;  4CK1 A;  5J1E A;  4FYD A;  1TKX A;  2FBV A;  2X74 A;  1KLM A;  3AV9 A;  1WN7 A;  1HQE A;  4DTS A;  4NCA A;  2F8T A;  4FZY A;  1A5W A;  3QIN A;  1LWC A;  3K5N A;  4N76 A;  4C8M A;  1L5U A;  3A2F A;  1C1C A;  2D0B A;  3IRX A;  1TKD A;  3M8Q A;  3OYJ A;  4DFK A;  1X9M A;  2YHB A;  1RDC A;  3RTV A;  5I42 A;  4KV8 A;  3NF6 A;  4CED A;  1J54 A;  5J2N A;  3LAM A;  4CJS A;  1YT3 A;  1HYV A;  3OYD A;  4GMJ B;  3TAP A;  4CJK A;  4MFB A;  3ZT1 A;  4DFM A;  1RT3 A;  3AO3 A;  5CZ2 A;  4KAZ A;  3V1Q A;  3DRR A;  3P83 D;  2G8H A;  4AHU A;  4E3S A;  2FBT A;  2Y1J A;  4L8R B;  1RBS A;  3VA0 A;  4YNQ A;  5JS1 A;  2A1S A;  4IG3 A;  3ALY A;  4OPK A;  3VQQ A;  3VQ6 A;  2KTQ A;  3AA4 A;  1J9A A;  3NHG A;  3AA3 A;  3BGR A;  1KVB A;  2QXF A;  4FJ8 A;  4CJF A;  2Z1I A;  3OYA A;  4FJJ A;  3VQC A;  4DU3 A;  4Z4I A;  2KZM A;  2YNG A;  4RW8 A;  3LZI A;  3ZSQ A;  1KFD A;  1QTM A;  4JLH A;  1BIU A;  3PY8 A;  4RW6 A;  3O4Q A;  4IKF A;  4DSL A;  1IH7 A;  4LH4 A;  4AH9 A;  4CGF A;  3NH0 A;  4Z4H A;  4GW6 A;  4IG0 A;  1XWL A;  5CYQ A;  4CGJ A;  3KTQ A;  4FCY A;  4DTN A;  3LAN A;  1RTI A;  1ZYQ A;  1QQC A;  4FK0 A;  4Y1C A;  4B9L A;  4CFD A;  2XY7 A;  3ZSW A;  3ASM A;  1WAF A;  1RIL A;  3KLI A;  2EHG A;  4LY7 A;  1S1W A;  4DLG A;  3TAG A;  1WAJ A;  4CJ4 A;  1RT1 A;  1SL2 A;  1Y97 A;  1C0T A;  1MU2 A;  4CK2 A;  4KI6 A;  2VG5 A;  2YNI A;  3QLH A;  1VSH A;  3DLR A;  4N5S A;  3K58 A;  2OA8 A;  4O44 A;  3ZSO A;  3LWM A;  4FZZ A;  3QEP A;  3KLF A;  3QEX A;  4AIL C;  2Q3S A;  2YKM A;  1XI1 A;  2KFZ A;  3F9K A;  4B3O A;  1U04 A;  1VRU A;  4DSK A;  2HND A;  4CFC A;  3RR8 A;  5FRN A;  4BDZ A;  1JXE A;  3ZSX A;  4CJ5 A;  3DLB A;  3KK1 A;  1X9S A;  2OZM A;  3WNE A;  4F3O A;  3OYN A;  3I8D A;  3AVK A;  3MXJ A;  4O4G A;  1S9E A;  2EX3 A;  3VQ5 A;  4FJ5 A;  4KHY A;  1XHX A;  3KLH A;  1S6Q A;  4CF2 A;  4Z4C A;  1SKW A;  1VSD A;  1WSG A;  2BAN A;  3ZSY A;  1EX4 A;  4CEA A;  1BQN A;  3QEW A;  4HCB A;  2HNZ A;  1SL0 A;  4FJM A;  3SPY A;  1YTA A;  4FJL A;  2HVI A;  1QS4 A;  4C8K A;  3DYA A;  2PYJ A;  2G8I A;  3VQE A;  4CEC A;  2ATQ A;  4E7L A;  3V9X A;  4M45 A;  1A5X A;  5DMR A;  1HRH A;  1IKX A;  1S5J A;  4DTO A;  4F3T A;  2Z1J A;  4QCL A;  2FBY A;  4I9L A;  4FLW A;  2JLE A;  2D0A A;  3IS9 A;  4DTJ A;  1WSI A;  5K14 A;  1L3V A;  3WNG A;  4IFY A;  4DTX A;  3UIQ A;  1RT5 A;  1VSL A;  3O3H A;  4KTW A;  4EZ6 A;  2XY8 A;  3OYE A;  2IOC A;  3ISN C;  1KVC A;  3KLE A;  2VG6 A;  2YHA A;  3ULD A;  3HO1 A;  1NJZ A;  2DFF A;  1NK0 A;  1FK9 A;  2B6A A;  3VQ8 A;  1RCH A;  3KD5 E;  4CF8 A;  1JLQ A;  1KSP A;  1SL1 A;  4K8X A;  2Z1G A;  3L2W A;  2YNH A;  4W5Q A;  5D3G A;  1RTH A;  3TAQ A;  5KGW A;  4CIE A;  3HPG A;  1LWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...