1VSEA

Asv integrase core domain with mg(ii) cofactor and hepes ligand, low mg concentration form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic domain of avian sarcoma virus integrase: conformation of the active-site residues in the presence of divalent cations.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endoribonuclease
molecule keywords INTEGRASE
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vseA00
4KI6A 2HHXA 1U47A 4W5QA 1LV5A 4C8MA 3VQDA 4Q0BA 3L2VA 3L2RA 4KPYA 4N5SA 3B6PA 3DOKA 1NKCA 2R7YA 2F8SA 4RW7A 5HBMA 2IGIA 4FZXC 1SKRA 2X6NA 3ASMA 1NJWA 2G8KA 3SV4A 3QO9A 3TARA 3G10A 3DYAA 5E41A 4E7IA 4DSKA 1MU2A 1EKEA 4O4GA 5CYQA 5FROA 4CGIA 1A5VA 3OJSA 5HROA 1EP4A 1KVBA 1HRHA 4O55A 4EP4A 3LANA 5DK5A 4DG1A 4QAGA 1KLNA 4PUOA 4CEFA 1L3TA 3NDKA 4B9MA 3DI6A 4DTNA 1ZBLA 3MXMA 1F21A 3DLGA 3O4QA 4AHTA 4CFBA 3L2UA 3TAGA 4O0IA 3S3NA 3RWUA 1WLJA 4DF8A 4KREA 1UWBA 4E1MA 1VSMA 1KFDA 4LSLA 3VQ8A 4FCYA 3ISNC 1U4BA 4EZ6A 4FXDA 3RTVA 3S3MA 3OYNA 2XY7A 3KKRA 3PX6A 1TL1A 4CJ4A 5KGXA 3P1GA 2G8IA 4I9LA 2VG5A 3ZT4A 3BGRA 3OJUA 4FJ8A 2IC3A 1CZ9A 4GW6A 4Z4IA 1FKPA 1BQNA 1Q8IA 1LAWA 4CEQA 1NK9A 1NJXA 1BL3A 3ZT0A 4E0DA 1WAFA 4DU4A 2BE2A 3NFAA 2Z1HA 2OPPA 1RT3A 4Z0UA 1NJZA 3KTQA 3HP9A 1LW0A 2DFFA 1RDAA 3AA5X 3G0ZA 2JGUA 3MEEA 5CZ2A 4CHOA 3V9XA 4EZ9A 4K8XA 3OYCA 4HTUA 4H4MA 4BE1A 3HJFA 1J9AA 4CCHA 2WONA 4KHQA 4E7HA 3K5LA 3VA0A 1S1WA 2OPRA 4IG3A 3AO4A 3ZSRA 2KZMA 3LPTA 5J2NA 2IDOA 3NF8A 4CIFA 2G8FA 1JLAA 4LSNA 3U6FA 1DTTA 4CJLA 2IS3A 3DRSA 3VQ4A 3VQQA 4B8CA 3KIOA 1D9DA 4CECA 2QKBA 1VSEA 2A1RA 1VSLA 4JRQA 3L8BA 4CF9A 4RG8A 3CQ8A 4E7KA 1RT1A 1TVRA 3ZT2A 3NH0A 4F2SA 3VQEA 2RF2A 3AV9A 3SUQA 4W5RA 4ELUA 4B9SA 3AVMA 4I2PA 3SJJA 1HQEA 4BDYA 3L3UA 4WE1A 4CJKA 1K6YA 3NF9A 4DS4A 3BDPA 1BHLA 1C0MA 2HNYA 4DS5A 4C8OA 3AVNA 3V4IA 5J2QA 4KB1A 5FRMA 1BCMA 1S9EA 4CJFA 1SKSA 4J2DA 1S6QA 4NYFA 3OY9A 3TWHA 3U3YA 2KTQA 4R5PA 4FM0A 2YKNA 2YHAA 4CGDA 1T8EA 1Z25A 5I3UA 2HW3A 3L2WA 3V81A 1TK5A 1TKTA 4OVLA 3VQ7A 3M8SA 1VSKA 2O4GA 4UQGA 4W5OA 1U45A 3MXJA 1B9FA 4OJRA 4B8AB 4KTQA 4CEBA 3C6UA 3VQ6A 3NE6A 3KLIA 1D5AA 2EHGA 4CK2A 4BACA 1JL2A 2DFEA 3LP0A 1BI4A 3VQBA 4CK3A 2XO7A 3PO5A 4M3XA 5FRNA 1C1BA 4KKOA 3K59A 1KRPA 4CEZA 4XIUA 2OZMA 3DOLA 4FVMA 4CJVA 4M3RA 1TAQA 2ITGA 4DFJA 4KHSA 1VK0A 4JS4A 4F8RA 3RMDA 4Z4HA 3HYFA 3ZSYA 3M8RA 2O4IA 4DFMA 3UIQA 1CLQA 2OPSA 3NAEA 1YTUA 5KRTA 1HNIA 4DTSA 4KHYA 3AVLA 3NF7A 3SPZA 2QKKA 4DFPA 4CF8A 1C6VA 1VSDA 4OLAA 4W5NA 5SZTA 1XI1A 4HHTA 3RMBA 3U3GA 4M3UA 2PZSA 3SPYA 1T7PA 3ZT1A 1U04A 4AHUA 3V9WA 4CIGA 3V6DA 5KGWA 3HT3A 3OYHA 1NKEA 1NOZA 3SQ2A 1RTIA 4CFDA 3PX0A 2E6LA 4LY7A 5J2MA 1RDCA 3RMAA 4ID1A 1GOAA 2YNFA 1TV6A 3VQPA 5J2PA 3QETA 3QEVA 4NCAA 4KAZA 4GVMA 4KB0A 1ZBHA 3NHGA 3K5OA 1O1WA 1JLBA 3AO1A 2DTUA 3AVIA 1ZBUA 5FDLA 1X1PA 2PY5A 1JLCA 1TKZA 4J2BA 4FLYA 4N41A 4BWJA 2F8TA 3S9HA 4OGCA 3PX4A 1EETA 1IH7A 1JXEA 4LH5A 4YNQA 4B08A 3LDSA 3OVNA 4KHUA 3L2QA 4FJ7A 2VG6A 1HNVA 1KVAA 3DRPA 1WN7A 5SWMA 4CEOA 4CHNA 4OKKA 4FM2A 3I8DA 3SUPA 4IBNA 3AVHA 4O44A 4KV8A 4CJWA 1IO2A 1ITGA 3NF6A 2AJQA 5CY4A 4KTWA 3LALA 4FYDA 1LW2A 3IG1A 1NKBA 3T3FA 2X78A 4AHVA 4E7JA 3MECA 3KK3A 3O3FA 4FLZA 2P51A 4H4OA 4KO0A 4DSFA 1NK0A 2G8VA 3NGIA 3OYBA 3M8PA 3VN5A 4B9TA 1ASUA 3HK2A 1WSGA 4AHSA 4PY5A 5T7BA 3OYEA 1A5WA 2I5JA 2KQ2A 3AA3A 4CEEA 3PY8A 4F3OA 1Y97A 4FJIA 3I0RA 3SUOA 2KZZA 4OLBA 1J5OA 4CGGA 1G15A 3QESA 1Q9XA 1RTHA 1REVA 5C42A 4CJRA 1RBUA 3NCIA 3AO3A 3LP1A 3OYLA 3SQ4A 4CEDA 2D5RA 2XY8A 1HYSA 3DM2A 4C8NA 1S9GA 4DU1A 2OPQA 1D9FA 2D0BA 3ITHA 1W9HA 1S1XA 3M8QA 4CGHA 4CIEA 5HRPA 1TK8A 3AVAA 3KD1E 1TAUA 1VSHA 4K8ZA 3SUNA 2P5OA 4PA1A 1RDDA 1YVUA 3V1RA 3LWLA 3O3HA 4BE0A 1R0AA 3T1AA 3VQCA 1HPZA 1HYVA 3IS9A 4DTMA 3QINA 1U49A 2G8WA 4Y1CA 2F96A 1VRTA 2BGGA 4BWMA 1UOCA 3LAMA 1NK7A 4J2AA 3C6TA 4CGJA 1U48A 1WSHA 3OS0A 4FJLA 1KVCA 3LZJA 2GBZA 3HL8A 3QNOA 4ELVA 4BDPA 1TKDA 4E7LA 3K57A 1FK9A 4IDKA 2YKMA 4F2RA 4F4KA 3ZSXA 3ZSOA 3PO4A 4CJPA 3F73A 2E6MA 3V1QA 4CJSA 5JS2A 2HHUA 4QOZB 4FW1A 1TL3A 2D0CA 1KTQA 2QK9A 4B9LA 2W42A 4B9VA 1UAXA 2Y1IA 3OYFA 3HPHA 2PYJA 4CJ3A 2OZSA 3LZIA 4GMJB 3B6OA 3OYJA 3OYGA 3AO5A 4FJKA 3SYZA 1B9DA 4Z4CA 4CF1A 3K2PA 4DTUA 3O4NA 1JLFA 1T03A 1S6PA 2JLEA 4HUFA 1BIZA 3O3GA 3MEGA 1RBRA 3OYDA 1IG9A 3DLHA 2ZD1A 1JLQA 3MAQA 3KLFA 1C0UA 3DRRA 1C1CA 2YNGA 2ATQA 2KW4A 5J1EA 3KJVA 4FJGA 4Z4EA 2ZQBA 4CFCA 4DTOA 1RT7A 2XHBA 4DF4A 1FXXA 4YFUA 2EX3A 1TGOA 3MEDA 3EY1A 2KFZA 3HM9A 4NCBA 1L5UA 4CJQA 4E1NA 1NOYA 4HCBA 3I0SA 3L3VA 1YT3A 4KTZA 2A1SA 1BI4B 3V1OA 5DMRA 2QXFA 4DTXA 1BIUA 3ZSZA 3PUFA 4B9UA 4BDZA 3K58A 4FK4A 3TAPA 2YNHA 3RMCA 1NK5A 3AVFA 3HXMA 2DY4A 4N47A 3HPGA 4CHZA 1DLOA 1IKVA 4CGFA 1WSFA 3QEPA 1QSYA 1S1TA 4B9NA 3T19A 3V9SA 2Z1JA 3SQ0A 1QS4A 2FBYA 3CG7A 2B4JA 4OPJA 4L8RB 4FZZA 3AA4A 3OYAA 4NYNA 5KRSA 3QERA 2RN2A 4CE9A 4CK1A 5HRSA 2XY6A 1SV5A 1ZYQA 1NJYA 1JXBA 1RTJA 1L3VA 1BISA 1I39A 3NH1A 1D8YA 2G8HA 2HHVA 3IAYA 4DQPA 4FK2A 1RBTA 3CM6A 1B92A 4BE2A 2FBVA 1SL0A 2XY5A 1GOBA 1RDBA 2PYLA 2X6SA 3P83D 5KI6A 3AVJA 3LAKA 1FKOA 2HHWA 1J53A 4ZTJA 2BANA 2WOMA 3IRXA 1C1AA 1ZBFA 2YNIA 5KTQA 4DQQA 3VA3A 4JS5A 3KD5E 1IKXA 4LH4A 3HP6A 4JRPA 1KSPA 4FLVA 3KLGA 1NK4A 1RNHA 2OYQA 5K14A 3K5MA 3QIOA 4DQSA 4IKFA 3HO1A 1WSIA 1IKWA 1KFSA 3AVKA 3F9KA 4ELTA 3QNNA 2HB5A 3CFPA 5CZ1A 2Y1JA 4QCLA 4OKEA 1JKHA 4AHCA 3D0PA 4E3SA 1J54A 1JLGA 3THVA 4Q5VA 1QHTA 4HUEA 3H08A 3TAMA 4FLUA 3PV8A 4I9QA 3HSTB 4FK0A 1GOCA 4AH9A 4DSEA 4N56A 1XC9A 4M3TA 3V9ZA 1Z26A 1WAJA 3RR8A 3DMJA 3HVTA 4FLTA 2YV0X 3NGYA 2X74A 4M41A 3AVBA 2GV9A 3WNGA 3TANA 1S5JA 4DSIA 2FBXA 2HNZA 4DLEA 4HCCA 3CM5A 5D3GA 4AHRA 1S1UA 3NH2A 4B3OA 1RT4A 4KRFA 2OA8A 1VSJA 5C25A 3KKSA 4KI4A 4CJUA 1RT2A 4DWIA 3C95A 2Z1GA 3OS1A 1RT5A 2HMIA 1DTQA 4CJEA 3LWMA 3S3OA 2Z1IA 1X9SA 5EU7A 4I2QA 4MQ3A 1HMVA 3QIPA 4RW9A 4IG0A 2D0AA 1LWEA 1RCHA 1BCOA 1WSEA 2FBTA 4NCGA 4CHPA 1I3AA 3SZ2A 4IFVA 3KK2A 4DSLA 2B6AA 2BDPA 2HHSA 3NBPA 3JSMA 3RR7A 1JLEA 4ICLA 4M45A 4CF0A 4ZTFA 3HPOA 1RT6A 2HVIA 4FLXA 3AVCA 3AVGA 3SCXA 4DQIA 4FZYA 4CJTA 4AILC 4FJNA 2DFHA 3HVRA 4FM1A 5HRNA 4J2EA 4RW4A 4OGEA 4ZHRA 3OS2A 2G8UA 4PQUA 4OKJA 3OYKA 4O0JA 4HUGA 3DLBA 1CXUA 2NUBA 3EYZA 1EX4A 3QLHA 4FJXA 1RBVA 1L3SA 3DLEA 1ASVA 4JLHA 3E01A 3D45A 5HRRA 4RW8A 5HP1A 1RBSA 3QEIA 2FC0A 3TR8A 1A5XA 1ZBIA 4CHYA 3OYMA 1X9MA 1C0TA 1XWLA 4FJ9A 1N5YA 2HHTA 4N76A 3WNFA 3ZSQA 4CHQA 3TAFA 1NK6A 4CJ5A 4Z4GA 4FJHA 1TK0A 3AA2A 1BGXT 1RILA 2GUIA 3ZSVA 3FFIA 2HNDA 1LWFA 1WNSA 4DFKA 3SQ1A 1UA0A 5C24A 4I7FA 4FLWA 3RRHA 3SI6A 1SL1A 4FJ5A 1QSSA 1NK8A 5CYMA 4CESA 4M3WA 3EZ5A 2XRIA 5HLFA 3ZSWA 1QE1A 3A2FA 2ETJA 1IKYA 1VRUA 3ZT3A 4RW6A 1QSLA 2ZE2A 1QTMA 3WNHA 1X9WA 3CFOA 4FJJA 2IOCA 4Y1DA 4CF2A 1LWCA 1RTDA 3ZCMA 3LPUA 4G1QA 3TABA 1UA1A 3WNEA 4O5BA 3OYIA 1KLMA 4DLGA 3P5JA 4DSJA 4FJMA 4Z4FA 4CEAA 2HHQA 2RKIA 3AO2A 4W5TA 3RRGA 3LP2A 1HYZA 1W0HA 2RPIA 3C94A 1XHZA 2P1JA 2VWJA 1SUQA 2LSNA 2B5JA 3VQAA 3SV3A 1T05A 4CERA 1S1VA 2HVHA 1Q9YA 4FW2A 1VSFA 5JS1A 4DTPA 1JL1A 1VSIA 1CZBA 1YTAA 3VQ5A 3VQ9A 3ALYA 4E19A 4H8KA 3SNNA 3JYTA 4LD0A 4M3YA 4KFBA 4DTJA 3TAEA 1ASWA 3DLRA 1XHXA 2E4LA 4M3ZA 3LP3A 4PWDA 3QEWA 2VG7A 4M42A 3KLEA 4KHWA 4ID5A 4DU3A 3K5NA 1HJRA 5I42A 4E89A 3NGZA 3KK1A 3V9UA 1BQMA 1SL2A 4F3TA 4TSXA 4C8KA 1L3UA 4DMNA 4C8LA 1LAVA 4MFBA 4DQRA 3TAQA 3MXIA 3CFRA 1N6QA 2YHBA 1WSJA 1SKWA 4IFYA 1EXQA 4CFAA 3ULDA 2IAJA 3QEXA 2VWKA 4HVJA 3KLHA 3DLKA 3TI0A 2Q3SA 2P5GA 1KCFA 4DTRA 3CYMA 1CXQA 1QQCA 4EP5A 1HQUA 4KHNA 4OPKA 1TKXA 2KFNA
chains in the Genus database with same CATH superfamily
4W5QA 5AQRA 4LF8K 3VQDA 4Q0BA 2P9UB 4BG9A 3B6PA 5LMNK 5HBMA 3OHRA 4FZXC 3G10A 3DYAA 4EIAA 3THYB 5BN9A 3RVCA 3AAQA 1EKEA 4O4GA 1YUWA 5HROA 3SJHA 4O55A 2P9SA 4DG1A 3DI6A 2D1KA 4H0TB 4HTLA 1X9JA 1F21A 3O4QA 3O8MA 4AHTA 3S3NA 4O0IA 4A2BA 3RWUA 4NLBA 4DF8A 3CCJN 1VSMA 3VQ8A 4FCYA 1U4BA 3ISNC 2A6AA 2XY7A 4LF4K 4I9LA 2VG5A 3BGRA 2P9PA 2P9SB 1NK9A 1JJ2M 3LDNA 4CZLA 5KPRA 2HHHK 2BE2A 2Z1HA 3HP9A 2ZM6K 3AA5X 5JVHL 4C1NI 3WQTA 4WQ4A 3FZMA 3HJFA 4CCHA 2FF6A 2WONA 4KHQA 3K5LA 3H45C 2KZMA 3LPTA 4CIFA 2G8FA 3ATVA 4IFEA 4BRIA 3O08A 4L3QA 2OTJN 4CECA 1T44A 2Q2RA 2A1RA 3TTDA 1VSLA 2FSJA 3H1VX 3CQ8A 4RG8A 5M1PA 3CJ1A 4PKIA 3ZT2A 3VQEA 1E4GT 4ELUA 4I2PA 1HQEA 3IKMA 4CJKA 3CJ7A 2UXBK 4RTFD 3BDPA 5AZIB 2HNYA 3AVNA 5HOOA 3V4IA 4KHPK 1X3NA 2P9UA 4JK8A 2Q36A 3OY9A 4CGDA 4DUYK 2VGNA 3A5OC 3ID6A 1WBBA 3FGUA 4IDHA 3SK3A 4W5OA 2PAVA 5GADP 3NE6A 3KLIA 3UKUA 3LP0A 5FRNA 4M3XA 4KKOA 1Q82O 3TTCA 4DFJA 1NWKA 1VK0A 1K8AO 3EKSA 3RMDA 4Z4HA 3HYFA 1KAZA 1VQLN 4DFMA 3UIQA 1CLQA 3FZLA 2OPSA 3D2EB 3NAEA 4DTSA 2QKKA 3CERA 1VSDA 1WB9A 1Z05A 4HHTA 1BA0A 4CIGA 5KGWA 1HX1A 1NOZA 3Q7CA 3SQ2A 1RTIA 4CFDA 4K0KK 5J2MA 1TV6A 4NCAA 3O9QA 3D2EA 1O1WA 1JLBA 2E2PA 1QHAA 3AVIA 4CZFA 3VEWA 3H3OB 1JLCA 4WQ4C 1HUXA 1HR0K 1YXQA 1NLVA 4J2BA 4BWJA 2QA4N 4YHHK 5KQDA 3L2QA 2VG6A 5ELZA 2QM1A 4CEOA 5GAHP 4KV8A 4CJWA 4DV1K 5C12A 1U6ZA 1IO2A 1GLLO 3M6GA 4WF9L 4JI5K 3MCPA 4FYDA 3C7NB 4AHVA 5CE3A 3L0QA 3O3FA 3VN5A 3HK2A 5T7BA 2I5JA 4F3OA 3PY8A 3MN5A 3PSFA 2KZZA 5GAEP 1J5OA 3GE1A 4CGGA 3QESA 1Q9XA 3SBGA 2I7NA 1REVA 1M90O 4FWOA 4BRGA 4CJRA 3D6RA 2D5RA 1R59O 3G6EN 3DM2A 4BRQA 3FE1A 4DU1A 3C7NA 2OPQA 3M8QA 2HBLA 4CIEA 3KD1E 4LF9K 4K8ZA 1SS6A 1VQMN 1I94K 1YVUA 3K9KA 3O3HA 1SAZA 1HPZA 4JI4K 2G8WA 1MDUB 1VRTA 2QXLA 3LAMA 3TPQA 4FJLA 4A5AA 4PL8A 2FXUA 3LZJA 4FOIA 2F4VK 4H0OA 4BVPA 4CBUA 3DLLL 3ZSOA 4CJPA 4FWMA 4CBWA 2P9IA 1YIJN 5JS2A 2HHUA 1TL3A 1KTQA 2NRZA 3VPZA 4B9LA 1UAXA 3T7ZA 3OYFA 3HPHA 3J81O 3OYJA 2V7YA 3LZIA 2E1ZA 3AO5A 4FJKA 3U8XA 1JLFA 2O8EB 2W6LA 4CD1A 5M1OA 1BOTO 3KWIA 2CGKA 4H0PA 1NGGA 3KLFA 4GVEA 3DRRA 5CHIA 4BGAA 3SAFA 1NGJA 4CFCA 4DTOA 1FXXA 3MEDA 4CD3A 4NCBA 3VEXA 5EX5A 1WUAA 5GINA 5GIOA 2NNWA 2QXFA 2QWMA 4DTXA 1BIUA 2O8EA 3CPWM 3LDLA 4FK4A 2YNHA 3QMLA 4B3MK 3AVFA 1IKVA 2D0OA 4B9NA 4EHUA 1QS4A 3UE5A 4CZGA 4FZZA 4L8RB 4BGBA 3AA4A 3OYAA 5KRSA 1ZYQA 4A62A 1JXBA 2HHVA 2ZJPL 4DQPA 2E88A 4BE2A 3VGKA 1NU0A 1RDBA 3P83D 3MWPA 4ILHA 1GLEG 2QI2A 1J53A 1ZBFA 2YNIA 1IKXA 2ZGZA 4LH4A 1VQKN 4FLVA 3C6AA 5TKWA 3LDPA 2QWQA 5K14A 2WC9A 3QIOA 3R9PA 3HO1A 3BZKA 4GKKK 1IKWA 3F9KA 1QZ5A 5CZ1A 4QCLA 1JKHA 4AHCA 4DUZK 4QS8A 4MLHA 3MCAB 3TAMA 1T6DA 3VOVA 1GOCA 1NG9A 3V9ZA 1Z26A 3VENA 2FBXA 5AQPA 5C0YA 3MX2A 1RT4A 4GNIA 5C25A 2W41A 3SAHA 3QFUA 1RT2A 4DWIA 2D0PA 3C95A 4BRFA 3OS1A 3ZETA 3KWGA 3EN9A 4V19S 3ZX3A 4M7YA 2Z1IA 3QIPA 3M8SA 3MWTA 2D0AA 4NCGA 1RCHA 4FK0A 1I3AA 4IFVA 3JSMA 4ICLA 5EVZA 1VQ6N 2HVIA 3FFKB 4FLXA 1Z6RA 4FJNA 2DFHA 4PL7A 4OGEA 3O5BA 4U67L 4OKJA 1D4XA 2ASMA 3QLHA 4YDUC 2IVNA 2I7PA 4RW8A 5GAGP 4CHYA 4FJ9A 1XWLA 3G25A 4DV6K 4I7FA 3RRHA 3E9OA 1NK8A 4B9QA 3EZ5A 5HLFA 1QE1A 3A2FA 1NGEA 3ZX0A 2ASPA 2ZE2A 5AFUA 3FZFA 5AQTA 4CF2A 3ZCMA 1RDWX 3TABA 3OYIA 4FJMA 4Z4FA 4CEAA 4W5TA 3PLAA 3LDQA 1HYZA 1W0HA 2RPIA 2O8BA 2VWJA 2B5JA 3EE8A 4CERA 3H3NO 1Q9YA 2ZJQL 3WXJA 4H8KA 3SNNA 1JCFA 3U4LA 3HOSA 3TAEA 3UB5A 4M3ZA 1XHXA 3QEWA 2QWPA 4DB3A 4U7BA 4H0YB 4K42A 1YVNA 3KK1A 1N8RO 4C8KA 4C8LA 3CFRA 5LJWA 1WSJA 3ULDA 4QS7A 1QQCA 2OTLN 5FPEA 2UUBK 1BWFO 2HHXA 3L2VA 3L2RA 4OPHA 2R7YA 2HF4A 4YY3K 2F8SA 2IGIA 1SKRA 2X6NA 4IWVA 3SV4A 4IEEA 1Y64A 3H1QA 1YJNN 4CGIA 1EP4A 4BREA 1IG8A 4BC4A 3P31A 4QAGA 4C23A 1L3TA 3NDKA 1OVYA 4DTNA 1NMNA 3MXMA 3DLGA 4FWNA 4KREA 1UWBA 4LSLA 5KGXA 3QDKA 4B1UB 2G8IA 3NMUA 3ZT4A 1FKPA 4J8FA 4JHDB 5I9EB 1BQNA 1LAWA 2CGLA 4BRDA 5AQFA 1BL3A 3ZT0A 1GLCG 3CJAA 2OPPA 2QW9A 3MEEA 5M1QA 3S41A 4K8XA 3UKRB 3OYCA 4HTUA 4H4MA 4BE1A 3THYA 1QVFM 2RE2A 4YOWA 1XC3A 1JLAA 4X65K 4BR7A 1BO5O 3VQ4A 4KH5A 1D9DA 4AM6A 1VSEA 3CXCM 4JRQA 4BC5A 4PKGA 1U2VA 4CF9A 4E7KA 1RT1A 1TVRA 4W5RA 4B9SA 3AVMA 3TU5A 3L3UA 1K6YA 1MWMA 3NF9A 3J7AP 5AQKA 1BHLA 1C0MA 3M3ZA 4DS5A 2ITMA 5J2QA 4KB1A 5FRMA 1BCMA 1SKSA 1EWQA 1S6QA 3U3YA 2KTQA 4R5PA 2YHAA 1Z25A 3J80O 5I3UA 4EHTA 1TK5A 3PIOL 4OVLA 3VQ7A 4BRNA 1C0GA 2WTUA 1B9FA 4OJRA 4CEBA 5FPNA 3KVGA 2EHGA 4CK3A 1XNQK 3K59A 5LY3A 2OZMA 3DOLA 4FVMA 5IT9O 4M3RA 2V51B 3BUZB 4KHSA 3F2KA 3ZSYA 4JI1K 3M8RA 5JVGL 2O8CA 1QQMA 1E3MA 1HNIA 3SPZA 3NF7A 1M1KO 4JHDA 4A5BA 1VQ8N 3ZT1A 3I55N 2FF3B 1O13A 3L6QA 2UUAK 3PX0A 2P9IB 3E9PA 4ID1A 2YNFA 2Q0UA 2Q0RA 3QEVA 3U9DA 4DR2K 1RGIA 1SZ2A 1T3VA 3AO1A 3AGRA 2DTUA 5F0XA 1ZBUA 2VGMA 1X1PA 1TKZA 4N41A 2F8TA 4OGCA 1OKJA 3FLCO 1EETA 3WT0A 4YNQA 1U2VB 3OVNA 3I56N 1JCGA 1HNVA 3DRPA 4CHNA 4OKKA 4KH4A 4JI6K 1XMQK 3AVHA 1ITGA 2QWNA 1W7AA 3DWLA 1NKBA 4E7JA 3VTIA 3VETA 1NK0A 2P51A 4H4OA 2G8VA 1WSGA 1ATSA 4AHSA 2AP1A 1A5WA 4FJIA 4CZMA 3SUOA 3SMPA 4OLBA 3VESA 5MLCQ 4JKHA 3NCIA 3AO3A 3LP1A 3SQ4A 1QVGM 2GELA 3BEXA 3O9SA 3L4IA 1S1XA 1J5EK 4CGHA 3AVAA 3E1YA 3SUNA 4OO1J 2DPNA 3IUCA 4PA1A 1RDDA 3F5TA 3VQCA 4DTMA 3IS9A 2AA4A 3QINA 4Y1CA 4XH1A 1NK7A 1UOCA 4J2AA 1DEJA 4O8KA 1KVCA 4MDBA 3QNOA 4ELVA 4BDPA 1TKDA 4IDKA 4NXMK 2YKMA 5AJ3K 1VQ4N 3EZWA 3ZSXA 3V1QA 4CJSA 5JMVA 4FW1A 2D0CA 2QK9A 2W42A 4CW7B 2WFBA 2NLXA 2O8FA 4CJ3A 4IJAA 4Z4CA 3GDQA 4CF1A 3CCRN 4DTUA 3VERA 2JLEA 1NM1A 1BIZA 1IBMK 5EOYA 4YOXA 3G4SN 4BG8A 4YDUA 2NRRA 2ZD1A 5AQJA 1C0UA 5M1NA 2YNGA 4LF6K 2KW4A 4Z4EA 2RHKA 2ZQBA 2NZTA 2XHBA 2UUCK 3VF4A 4YFUA 3EY1A 4JKDA 2KFZA 4DV2K 4LC9B 5AQYA 1W2BM 4E1NA 4A57A 3QBXA 2A40A 3V1OA 3MN7A 5AQIA 3ZSZA 4B9UA 3TAPA 1NK5A 2NRVA 4IO9L 2O8DA 1QQNA 3M1FA 4GKJK 2DY4A 3HPGA 4CHZA 1JCEA 4BC3A 4CGFA 1WSFA 4WCEL 3SQ0A 2FBYA 3CG7A 3IDHA 2YJFA 2P9KA 4NYNA 3W0LA 2PBDA 4FWKA 5HRSA 1L3VA 5ADXH 4WFNL 3IAYA 3CM6A 4IOXA 2FBVA 1N33K 4O5FA 1GOBA 2X6SA 4CVNE 3LAKA 2UYTA 1N34K 1VQ5N 2BANA 2WOMA 4X64K 3HP6A 5BRDA 4BVOA 1K8KA 5LJVA 4DQSA 3TSPA 2VQEK 4FPAA 1KFSA 4B1XB 4DCHA 4BR5A 1VQ7N 4OKEA 3D0PA 4E3SA 4YOTA 3THVA 3H08A 3MMVA 4I9QA 5C2FA 4AH9A 3ZETB 1XC9A 4H5NA 3HTVA 3NGYA 3DJCA 3AVBA 2GV9A 4DSIA 3J7ZO 3CM5A 4AHRA 4B3OA 4KRFA 3O80A 1VSJA 4CJUA 1TYQB 4JKBA 1RT5A 3OTOK 4CJEA 3CHWA 1VQPN 3CCSN 1HMVA 1ILYA 4CHPA 4IG0A 1WSEA 2FBTA 4DSLA 1CZAN 2HHSA 2B6AA 2BDPA 3RR7A 4CF0A 3HZ6A 1S22A 2HBKA 4KBOA 3DXMB 3CF5L 4FM1A 5HRNA 4J2EA 3OYKA 3EYZA 2E20A 1RBVA 1L3SA 3DLEA 1ASVA 5HRRA 3C6HA 3CC7N 3OA9A 1RBSA 2NRXA 3OYMA 1C0TA 3MK6A 3ZSQA 1NK6A 5AQNA 4CJ5A 5E26A 1TK0A 3ZSVA 1RILA 1NJZA 3FFIA 2HNDA 4DFKA 5C24A 1HNXK 3DXMA 4JN4A 3WXIA 4ISGA 3EKUA 2UXDK 4CESA 5BRHA 3ZSWA 3PSIA 4GV9A 2YHYA 1QTMA 1LWCA 4QS9A 3JXUA 1S72N 1RTDA 2CH6A 4DLGA 3P5JA 3EEQA 5FPDA 1S1VA 1KAYA 1VSFA 4FW2A 1VSIA 4E19A 4LD0A 4M3YA 4KFBA 4PWDA 2E4LA 4I6MA 3P39A 3KLEA 2GUPA 3K5NA 4XH4A 3NGZA 1SL2A 3V9UA 1BQMA 4WQ5A 1LAVA 4YOUA 3TAQA 1N6QA 2YHBA 1SKWA 4IFYA 3WEEB 4CFAA 3QEXA 4BRPA 2VWKA 5AQLA 3KLHA 1NMDA 3TI0A 2NRWA 2P5GA 1KCFA 3VGLA 4EP5A 1TKXA 5F2RA 4JI8K 2KFNA 4DV5K 1NJWA 5E41A 4CJ7A 1ATNA 1MU2A 5CYQA 5FROA 4A59A 5BN8A 1KVBA 1HRHA 5EXWA 4WYBA 5DK5A 3CC2N 4PUOA 4CEFA 2Q97A 4B9MA 2FLOA 4B1YB 1VQ9N 1Q86O 2F7TA 1WLJA 1BU6O 1KFDA 4DQ8A 4FXDA 5KPZA 3RTVA 3OYNA 3PX6A 1TL1A 3UKRA 4CJ4A 3P1GA 2UU9K 4K43A 4BROA 2UXCK 3OJUA 4FJ8A 2ASOA 3VF2A 1QQOA 1Q8IA 4DR5K 1WAFA 4WFAL 4DU4A 3NFAA 1RT3A 3W3DA 4DV4K 1RDAA 3CJCA 3G0ZA 2JGUA 3V9XA 4BC2A 2QEXN 1J9AA 4E7HA 3VA0A 2E2NA 2NRHA 3O9TA 2IDOA 4LSNA 4ILGB 1DTTA 3U6FA 4DR1K 2IS3A 2F9WA 3DRSA 4B8CA 3KIOA 1KQSM 2QKBA 3NH0A 3CCUN 3SJJA 1NGIA 3K9JA 5H1SQ 3D2FB 5JLHA 5M1FA 2P9LA 4WFBL 5AQQA 3VGMA 3TWHA 4FM0A 2YKNA 1T8EA 3L2WA 1MWKA 3V81A 1TKTA 1VSKA 2O4GA 4UQGA 1U45A 3MXJA 3THWB 4B8AB 4KH6A 2W6KA 3VQ6A 4IXCA 1D5AA 5GIPA 2Q1NA 1BI4A 3PO5A 2D4WA 5AQZA 4CEZA 3SAGA 3BF1A 1YHQN 3M5RA 3HBTA 4JS4A 4F8RA 5AQHA 2O4IA 1YF5L 1E4FT 1YTUA 2QWRA 5KRTA 5TKYA 4KHYA 4OLAA 1XI1A 3VEVA 4M3UA 3SPYA 1T7PA 4AHUA 1HJOA 1TUUA 3OYHA 4IOAL 2E6LA 1RDCA 3N4PA 1GOAA 3VQPA 2IVPA 4KB0A 3NHGA 1TYQA 1EWRA 1ZC6A 3AGKA 1OH8A 5LL6Z 5FDLA 2PY5A 4EFHA 1KAXA 2W40A 4LFAK 4FLYA 3KZBA 4H5RA 3S9HA 1NJIO 1K9MO 1JXEA 5BPNA 4XEIA 4MO5A 3T1HK 1WN7A 5SWMA 4FM2A 2O8CB 3I8DA 4BQZA 4IBNA 4PKHA 3SUPA 3WQUA 3D2FA 3NF6A 2E2OA 1IV0A 4KTWA 2GTDA 2X78A 3KK3A 4DSFA 3HOTA 1RFQA 3NGIA 1ASUA 4MO4A 3JS6A 3CIPA 4BY9C 3CQXA 1Y97A 3I0RA 3WUHA 1IJJA 3O6WA 2VCPA 4DHYA 5AZJB 1G15A 4JD2B 5C42A 4JKCA 3OYLA 2XY8A 1HYSA 2HF3A 4C8NA 1D9FA 2D0BA 3ITHA 4YOVA 1TK8A 4BQLA 1TAUA 1VSHA 3O1WA 4CZJA 1R0AA 3LWLA 2ZJRL 4YOYA 1GLDG 3T1AA 4K41A 5JLFA 4CGJA 3ZEUB 3OS0A 3FZHA 3H6EA 1BDGA 3CCQN 4E7LA 1OH5A 2ZF5O 3U9ZA 4WQ5C 4F2RA 4F4KA 3PO4A 1K8KB 2E6MA 1HNWK 1T6CA 4QOZB 5C2DA 3WXMB 4B9VA 4JKAA 2Y1IA 1HKCA 2A41A 2OZSA 4GMJB 3B6OA 3OYGA 3NVKA 3SYZA 1NGCA 3O4NA 1S6PA 3WEEA 4HUFA 2E8AA 1RBRA 3OYDA 1IG9A 3Q7BA 3DLHA 4LF7K 2WUSA 3T69A 4FJGA 2ATQA 3KK7A 1RT7A 1J6ZA 2ZGYA 2JWLA 1TGOA 4CZEA 4JYAK 1NBWA 4HCBA 1YJ9N 3I0SA 3L3VA 3SLCA 4NB4A 4A2AA 1BI4B 3FZKA 2YCHA 2FSKA 2E5LK 2WBNA 4BDZA 4CBXA 5AZJA 4H0XB 3RMCA 3CCEN 3HXMA 3C0BA 4AF1A 4ISFA 3GG4A 4BR0A 4YORA 2O8FB 4FWQA 3T19A 2Z1JA 4FO0A 4OPJA 3THXB 3QERA 4CE9A 1SV5A 1NJYA 2G8HA 1RTJA 1BISA 1I39A 4H0VB 3NH1A 3I8BA 4FK2A 1RBTA 1NGAA 4JI7K 1B92A 1SL0A 3NVMA 2HOEA 5KPTA 2XY5A 3O9UA 5KI6A 3ZEUA 3OW2M 1YAGA 3AVJA 1FKOA 1XUPO 1C1AA 4DQQA 3QBWA 1KSPA 4JRPA 3THXA 1NK4A 3BY5A 2CGJA 1WSIA 4BRAA 3AAPA 3AVKA 4ELTA 3CCLN 2HB5A 2VWBA 3LM2A 3VEYA 1J54A 4X62K 5AQSA 4HUEA 1QHTA 2BTFA 4FLUA 3PV8A 3HSCA 3HSTB 4N56A 2OCEA 5ADXA 4FLTA 3TANA 2X74A 1S5JA 2HNZA 4DLEA 4HCCA 4I6MB 5D3GA 4OX9K 1OVQA 4KI4A 2Z1GA 3ENHA 1DTQA 3R1XA 3LWMA 3S3OA 3THWA 1NGHA 4RW9A 4W5NA 1LWEA 1BCOA 2IIRA 3SZ2A 5C15A 3KK2A 3DXKB 4FVUA 3NBPA 1JLEA 5BREA 3HPOA 1HNZK 3SCXA 3AVGA 1SQKA 4CJTA 4AILC 3HVRA 3OS2A 4ZHRA 4PQUA 3DLBA 4O0JA 2A3ZA 3SMSA 4FJXA 3D45A 5HP1A 4CZIA 1ZBIA 1X9MA 1N5YA 4N76A 3WNFA 2YI1A 5JICA 4Z4GA 1C0FA 3AA2A 3P4IA 1U47A 1GLBG 4DV7K 1UA0A 5KQ8A 4FLWA 3SI6A 2A5XA 1VQNN 4CI6A 2ETJA 1FW6A 4RW6A 1ESVA 4FJJA 3T1YK 4Y1DA 1QZ6A 1UA1A 1KXPA 4O5BA 3WNEA 1KLMA 4AM7A 4AQYK 4DSJA 2HHQA 3AO2A 3RRGA 4B3TK 1XHZA 2P1JA 1WOQA 3KHYA 1W97L 2LSNA 4HWIA 4K25A 3VQAA 5JS1A 2HVHA 4BR4A 1N32K 1JL1A 5AQUA 1CZBA 2A42A 4O8UA 3OBWA 5CR4A 5DM7L 3TSUA 4DTJA 3DLRA 3LP3A 2VG7A 4M42A 4M63C 4B1ZA 4KHWA 4ID5A 4DU3A 3BF3A 1HJRA 5I42A 5AQOA 3ULEA 4E89A 4RWTA 4F3TA 5AR0A 3CETA 3CMAN 4DMNA 4DQRA 5BPLA 3GL1A 3SBTA 1EXQA 4UY8O 3CJ9A 3LDOA 1CXQA 2P9LB 3CYMA 4JKFA 4KHNA 4OPKA 1HLUA 5E84A 5M1KA 4KI6A 4JKGB 1LV5A 4C8MA 4KPYA 2YHWA 4N5SA 3DOKA 1NKCA 4DKWA 4RW7A 3O1BA 4C1NK 3ASMA 3RSEB 3QO9A 3QFPA 3TARA 4E7IA 2EWSA 4DSKA 4E1JA 1A5VA 2E1YA 4JNEA 3OJSA 4EP4A 1OH7A 3LANA 1KLNA 3B8AX 1ZBLA 3L2UA 4CFBA 3TAGA 4DR3K 4PHTX 4E1MA 4FWPA 4BR9A 4FPBA 4EAHD 4EZ6A 3S3MA 3CCVN 2BH1A 3VEZA 3KKRA 4FOEA 4B3SK 3O9RA 2IC3A 1CZ9A 4GW6A 4Z4IA 2BUPA 1DT9A 4CEQA 1NJXA 3AY9A 4E0DA 1IBLK 3CC4N 3KTQA 4Z0UA 5CZ2A 1LW0A 2DFFA 4H03B 3CCMN 4EZ9A 3EL2A 4IEIA 4CHOA 3L4QA 2KHOA 4MLEA 5C10A 3QICA 1S1WA 2OPRA 4H5WA 4IG3A 3AO4A 3ZSRA 3TTFA 5J2NA 4BRCA 3NF8A 4CJLA 2CH5A 3VQQA 4LF5K 3L8BA 4F2SA 2RF2A 3AV9A 3SUQA 4CZHA 4BDYA 3R6MA 4WE1A 3A5MC 4DS4A 3LL3A 3R3LA 1S3XA 4X66K 4C8OA 3IMXA 4G9ZA 4JKGA 1S9EA 4CJFA 4J2DA 4NYFA 1MA9B 3ENBA 2HW3A 5AQGA 3JAMO 4XH5A 4JD2A 4JI2K 3MX5A 4KTQA 3C6UA 1NNEA 2G8KA 4BACA 4CK2A 2J4RA 4BRLA 1JL2A 2DFEA 3BZCA 3MN9A 3VQBA 2XO7A 3BP8A 1C1BA 1KRPA 4XIUA 4CJVA 1TAQA 2ITGA 4NXNK 4MDAA 1Q18A 1V4SA 3CD6N 3UKUB 3AVLA 2P9PB 4DFPA 4CF8A 1C6VA 5SZTA 3RMBA 1G99A 4BRKA 4F9OA 3U3GA 2PZSA 1U04A 3V9WA 3V6DA 3HT3A 2GX9A 1NKEA 5B8HA 1N36K 4LY7A 3RMAA 2VYPA 3QETA 5J2PA 1XQSC 4GVMA 1ZBHA 4A61A 3K5OA 1GLAG 2HMPA 4BRMA 4BRHA 1H1VA 3CPEA 1P8ZA 2P9KB 5IWAK 3ID8A 3PX4A 1IH7A 3LDSA 4LH5A 4KHUA 4B08A 1LOTB 3A5NC 3ATUA 4FJ7A 3VEOA 1KVAA 1ATRA 3RSEA 4R79A 4O44A 5LMUK 4DV0K 2AJQA 5CY4A 3LALA 1KD1O 3MDQA 1LW2A 3IG1A 3T3FA 3MECA 4JEPA 4FLZA 4KO0A 1Q7YO 4JK7A 3OYBA 3M8PA 4B9TA 3P38A 1DGKN 4PY5A 3OYEA 2KQ2A 4FJHA 3AA3A 4CEEA 2ZWHA 5DM6L 1GLFO 3ZYYX 1RTHA 1RBUA 3E66A 4CEDA 2KLAA 1K73O 4ILJA 1S9GA 5BRFA 4DR6K 1W9HA 2YJEA 3K0SA 5HRPA 3DAWA 2PFUA 1DKGD 2P5OA 5A2QO 4BE0A 3V1RA 4M7XA 1HYVA 1U49A 2BGGA 2F96A 4IZ9A 4BWMA 3C6TA 1WBDA 1U48A 1WSHA 4LFCK 4IOCL 2GBZA 3HL8A 1YI2N 3K57A 1FK9A 1X3MA 4FWSA 3F73A 3CQYA 4IJNA 2V52B 1KC8O 3ZLJA 2PYJA 3HI0A 3R8EA 3MN6A 1B9DA 3CMEN 3K2PA 1T03A 3AARA 2KKZA 3O3GA 2JWKA 3C65A 3MEGA 1ZBSA 1TUYA 4B1WB 1JLQA 3MAQA 3QB0A 1OH6A 1C1CA 5J1EA 3KJVA 3WXLA 2P9NA 4DF4A 3HRGA 2EX3A 2E2QA 2OANA 3HM9A 1L5UA 4CJQA 5F1XA 3EO3A 1NOYA 3PIPL 3N4QA 1YT3A 4KTZA 2A1SA 5EY4A 5DMRA 4CZKA 3GBTA 3PUFA 4Z94A 3K58A 1EQYA 4N47A 1DLOA 3QEPA 4FL9A 1QSYA 1S1TA 3V9SA 5FLXO 4JI3K 4JV5K 2B4JA 3HM8A 2RN2A 4CK1A 2XY6A 3CI5A 3VF6A 4NO7A 1D8YA 1BUPA 3F9MA 1NGBA 2QWOA 4LFBK 1XNRK 2PYLA 4GV3A 1RDUA 2HHWA 3VMFB 1NGFA 4ZTJA 1VAZA 3IRXA 5KTQA 3KD5E 3VA3A 4JS5A 2QTDA 3WXKA 5BR9A 3KLGA 1RNHA 2QWLA 4ISEA 2OYQA 5AQWA 3K5MA 3J7YP 4IKFA 3H46O 3QNNA 3CFPA 2Y1JA 4FSVA 1JLGA 4Q5VA 3TSQA 5AQMA 4DSEA 4M3TA 1WAJA 3RR8A 3A5LC 1Q81O 3DMJA 3HVTA 2GEMA 5FPMA 2YV0X 4M41A 3WNGA 3A8YA 4GY2B 4DR7K 1LCUA 2GWJA 1S1UA 3NH2A 2P9NB 3I33A 3DXKA 1V4TA 2OA8A 5AQXA 4Y0WA 3KKSA 1NGDA 2HBMA 5HL7L 3E9LA 4JI0K 4DV3K 2HMIA 1GLJO 1HPMA 1X9SA 5EU7A 4I2QA 4MQ3A 3J8AA 4KAZA 2IVOA 2H3GX 3OBYA 4M45A 4ZTFA 3A0IX 3D7EO 1RT6A 1BA1A 2YHXA 3AVCA 4FZYA 2F9TA 4DQIA 4DR4K 5AQVA 4H5VA 4RW4A 4JKEA 2G8UA 1EO1A 4HUGA 4JAXA 1CXUA 2NUBA 1EX4A 5AZIA 4JLHA 3E01A 3QEIA 2FC0A 3TR8A 1A5XA 1BG3A 4H5TA 2HHTA 4CHQA 3TAFA 2GWKA 3VTHA 1HKGA 2VQFK 1BGXT 2GUIA 3SQ1A 1T05A 1LWFA 1WNSA 3CJBA 1XMOK 1SL1A 2Q31A 4JK9A 4FJ5A 1YJWN 1QSSA 3O4WA 4BR2A 1FJGK 5CYMA 5AFUH 4M3WA 4B1VA 2XRIA 1VHXA 1QSLA 1IKYA 1VRUA 3ZT3A 3IFRA 3WNHA 1X9WA 3CFOA 2IOCA 2YX6A 2HBJA 2O8DB 3LPUA 4G1QA 5BPMA 1P90A 3EE9A 2RKIA 1HKBA 3LP2A 3C94A 3ULEB 3ENOA 1SUQA 4OPAA 3SV3A 5BR8K 4DTPA 1YTAA 3VQ5A 4FWLA 3ALYA 3VQ9A 3G71N 4GV6A 3JYTA 4B3RK 1YITN 3ZX2A 1ASWA 4FWRA 2O8BB 4NLCA 4IO8A 4TSXA 1L3UA 4MFBA 2V7ZA 3MXIA 1VQON 3GOIA 2FSNA 2IAJA 2NRTA 4HVJA 2HSTA 4RCHA 3DLKA 2Q3SA 4DTRA 3FR0A 1HQUA 1ZXOA 3LM9A 1IBKK
chains in the Genus database with same CATH topology
4KI6A 2HHXA 1U47A 4W5QA 1LV5A 4C8MA 3VQDA 4Q0BA 3L2VA 3L2RA 4KPYA 4N5SA 3B6PA 3DOKA 1NKCA 2R7YA 2F8SA 4RW7A 5HBMA 2IGIA 4FZXC 1SKRA 2X6NA 3ASMA 1NJWA 2G8KA 3SV4A 3QO9A 3TARA 3G10A 3DYAA 5E41A 4E7IA 4DSKA 1MU2A 1EKEA 4O4GA 5CYQA 5FROA 4CGIA 1A5VA 3OJSA 5HROA 1EP4A 1KVBA 1HRHA 4O55A 4EP4A 3LANA 5DK5A 4DG1A 4QAGA 1KLNA 4PUOA 4CEFA 1L3TA 3NDKA 4B9MA 3DI6A 4DTNA 1ZBLA 3MXMA 1F21A 3DLGA 3O4QA 4AHTA 4CFBA 3L2UA 3TAGA 4O0IA 3S3NA 3RWUA 1WLJA 4DF8A 4KREA 1UWBA 4E1MA 1VSMA 1KFDA 4LSLA 3VQ8A 4FCYA 3ISNC 1U4BA 4EZ6A 4FXDA 3RTVA 3S3MA 3OYNA 2XY7A 3KKRA 3PX6A 1TL1A 4CJ4A 5KGXA 3P1GA 2G8IA 4I9LA 2VG5A 3ZT4A 3BGRA 3OJUA 4FJ8A 2IC3A 1CZ9A 4GW6A 4Z4IA 1FKPA 1BQNA 1Q8IA 1LAWA 4CEQA 1NK9A 1NJXA 1BL3A 3ZT0A 4E0DA 1WAFA 4DU4A 2BE2A 3NFAA 2Z1HA 2OPPA 1RT3A 4Z0UA 1NJZA 3KTQA 3HP9A 1LW0A 2DFFA 1RDAA 3AA5X 3G0ZA 2JGUA 3MEEA 5CZ2A 4CHOA 3V9XA 4EZ9A 4K8XA 3OYCA 4HTUA 4H4MA 4BE1A 3HJFA 1J9AA 4CCHA 2WONA 4KHQA 4E7HA 3K5LA 3VA0A 1S1WA 2OPRA 4IG3A 3AO4A 3ZSRA 2KZMA 3LPTA 5J2NA 2IDOA 3NF8A 4CIFA 2G8FA 1JLAA 4LSNA 3U6FA 1DTTA 4CJLA 2IS3A 3DRSA 3VQ4A 3VQQA 4B8CA 3KIOA 1D9DA 4CECA 2QKBA 1VSEA 2A1RA 1VSLA 4JRQA 3L8BA 4CF9A 4RG8A 3CQ8A 4E7KA 1RT1A 1TVRA 3ZT2A 3NH0A 4F2SA 3VQEA 2RF2A 3AV9A 3SUQA 4W5RA 4ELUA 4B9SA 3AVMA 4I2PA 3SJJA 1HQEA 4BDYA 3L3UA 4WE1A 4CJKA 1K6YA 3NF9A 4DS4A 3BDPA 1BHLA 1C0MA 2HNYA 4DS5A 4C8OA 3AVNA 3V4IA 5J2QA 4KB1A 5FRMA 1BCMA 1S9EA 4CJFA 1SKSA 4J2DA 1S6QA 4NYFA 3OY9A 3TWHA 3U3YA 2KTQA 4R5PA 4FM0A 2YKNA 2YHAA 4CGDA 1T8EA 1Z25A 5I3UA 2HW3A 3L2WA 3V81A 1TK5A 1TKTA 4OVLA 3VQ7A 3M8SA 1VSKA 2O4GA 4UQGA 4W5OA 1U45A 3MXJA 1B9FA 4OJRA 4B8AB 4KTQA 4CEBA 3C6UA 3VQ6A 3NE6A 3KLIA 1D5AA 2EHGA 4CK2A 4BACA 1JL2A 2DFEA 3LP0A 1BI4A 3VQBA 4CK3A 2XO7A 3PO5A 4M3XA 5FRNA 1C1BA 4KKOA 3K59A 1KRPA 4CEZA 4XIUA 2OZMA 3DOLA 4FVMA 4CJVA 4M3RA 1TAQA 2ITGA 4DFJA 4KHSA 1VK0A 4JS4A 4F8RA 3RMDA 4Z4HA 3HYFA 3ZSYA 3M8RA 2O4IA 4DFMA 3UIQA 1CLQA 2OPSA 3NAEA 1YTUA 5KRTA 1HNIA 4DTSA 4KHYA 3AVLA 3NF7A 3SPZA 2QKKA 4DFPA 4CF8A 1C6VA 1VSDA 4OLAA 4W5NA 5SZTA 1XI1A 4HHTA 3RMBA 3U3GA 4M3UA 2PZSA 3SPYA 1T7PA 3ZT1A 1U04A 4AHUA 3V9WA 4CIGA 3V6DA 5KGWA 3HT3A 3OYHA 1NKEA 1NOZA 3SQ2A 1RTIA 4CFDA 3PX0A 2E6LA 4LY7A 5J2MA 1RDCA 3RMAA 4ID1A 1GOAA 2YNFA 1TV6A 3VQPA 5J2PA 3QETA 3QEVA 4NCAA 4KAZA 4GVMA 4KB0A 1ZBHA 3NHGA 3K5OA 1O1WA 1JLBA 3AO1A 2DTUA 3AVIA 1ZBUA 5FDLA 1X1PA 2PY5A 1JLCA 1TKZA 4J2BA 4FLYA 4N41A 4BWJA 2F8TA 3S9HA 4OGCA 3PX4A 1EETA 1IH7A 1JXEA 4LH5A 4YNQA 4B08A 3LDSA 3OVNA 4KHUA 3L2QA 4FJ7A 2VG6A 1HNVA 1KVAA 3DRPA 1WN7A 5SWMA 4CEOA 4CHNA 4OKKA 4FM2A 3I8DA 3SUPA 4IBNA 3AVHA 4O44A 4KV8A 4CJWA 1IO2A 1ITGA 3NF6A 2AJQA 5CY4A 4KTWA 3LALA 4FYDA 1LW2A 3IG1A 1NKBA 3T3FA 2X78A 4AHVA 4E7JA 3MECA 3KK3A 3O3FA 4FLZA 2P51A 4H4OA 4KO0A 4DSFA 1NK0A 2G8VA 3NGIA 3OYBA 3M8PA 3VN5A 4B9TA 1ASUA 3HK2A 1WSGA 4AHSA 4PY5A 5T7BA 3OYEA 1A5WA 2I5JA 2KQ2A 3AA3A 4CEEA 3PY8A 4F3OA 1Y97A 4FJIA 3I0RA 3SUOA 2KZZA 4OLBA 1J5OA 4CGGA 1G15A 3QESA 1Q9XA 1RTHA 1REVA 5C42A 4CJRA 1RBUA 3NCIA 3AO3A 3LP1A 3OYLA 3SQ4A 4CEDA 2D5RA 2XY8A 1HYSA 3DM2A 4C8NA 1S9GA 4DU1A 2OPQA 1D9FA 2D0BA 3ITHA 1W9HA 1S1XA 3M8QA 4CGHA 4CIEA 5HRPA 1TK8A 3AVAA 3KD1E 1TAUA 1VSHA 4K8ZA 3SUNA 2P5OA 4PA1A 1RDDA 1YVUA 3V1RA 3LWLA 3O3HA 4BE0A 1R0AA 3T1AA 3VQCA 1HPZA 1HYVA 3IS9A 4DTMA 3QINA 1U49A 2G8WA 4Y1CA 2F96A 1VRTA 2BGGA 4BWMA 1UOCA 3LAMA 1NK7A 4J2AA 3C6TA 4CGJA 1U48A 1WSHA 3OS0A 4FJLA 1KVCA 3LZJA 2GBZA 3HL8A 3QNOA 4ELVA 4BDPA 1TKDA 4E7LA 3K57A 1FK9A 4IDKA 2YKMA 4F2RA 4F4KA 3ZSXA 3ZSOA 3PO4A 4CJPA 3F73A 2E6MA 3V1QA 4CJSA 5JS2A 2HHUA 4QOZB 4FW1A 1TL3A 2D0CA 1KTQA 2QK9A 4B9LA 2W42A 4B9VA 1UAXA 2Y1IA 3OYFA 3HPHA 2PYJA 4CJ3A 2OZSA 3LZIA 4GMJB 3B6OA 3OYJA 3OYGA 3AO5A 4FJKA 3SYZA 1B9DA 4Z4CA 4CF1A 3K2PA 4DTUA 3O4NA 1JLFA 1T03A 1S6PA 2JLEA 4HUFA 1BIZA 3O3GA 3MEGA 1RBRA 3OYDA 1IG9A 3DLHA 2ZD1A 1JLQA 3MAQA 3KLFA 1C0UA 3DRRA 1C1CA 2YNGA 2ATQA 2KW4A 5J1EA 3KJVA 4FJGA 4Z4EA 2ZQBA 4CFCA 4DTOA 1RT7A 2XHBA 4DF4A 1FXXA 4YFUA 2EX3A 1TGOA 3MEDA 3EY1A 2KFZA 3HM9A 4NCBA 1L5UA 4CJQA 4E1NA 1NOYA 4HCBA 3I0SA 3L3VA 1YT3A 4KTZA 2A1SA 1BI4B 3V1OA 5DMRA 2QXFA 4DTXA 1BIUA 3ZSZA 3PUFA 4B9UA 4BDZA 3K58A 4FK4A 3TAPA 2YNHA 3RMCA 1NK5A 3AVFA 3HXMA 2DY4A 4N47A 3HPGA 4CHZA 1DLOA 1IKVA 4CGFA 1WSFA 3QEPA 1QSYA 1S1TA 4B9NA 3T19A 3V9SA 2Z1JA 3SQ0A 1QS4A 2FBYA 3CG7A 2B4JA 4OPJA 4L8RB 4FZZA 3AA4A 3OYAA 4NYNA 5KRSA 3QERA 2RN2A 4CE9A 4CK1A 5HRSA 2XY6A 1SV5A 1ZYQA 1NJYA 1JXBA 1RTJA 1L3VA 1BISA 1I39A 3NH1A 1D8YA 2G8HA 2HHVA 3IAYA 4DQPA 4FK2A 1RBTA 3CM6A 1B92A 4BE2A 2FBVA 1SL0A 2XY5A 1GOBA 1RDBA 2PYLA 2X6SA 3P83D 5KI6A 3AVJA 3LAKA 1FKOA 2HHWA 1J53A 4ZTJA 2BANA 2WOMA 3IRXA 1C1AA 1ZBFA 2YNIA 5KTQA 4DQQA 3VA3A 4JS5A 3KD5E 1IKXA 4LH4A 3HP6A 4JRPA 1KSPA 4FLVA 3KLGA 1NK4A 1RNHA 2OYQA 5K14A 3K5MA 3QIOA 4DQSA 4IKFA 3HO1A 1WSIA 1IKWA 1KFSA 3AVKA 3F9KA 4ELTA 3QNNA 2HB5A 3CFPA 5CZ1A 2Y1JA 4QCLA 4OKEA 1JKHA 4AHCA 3D0PA 4E3SA 1J54A 1JLGA 3THVA 4Q5VA 1QHTA 4HUEA 3H08A 3TAMA 4FLUA 3PV8A 4I9QA 3HSTB 4FK0A 1GOCA 4AH9A 4DSEA 4N56A 1XC9A 4M3TA 3V9ZA 1Z26A 1WAJA 3RR8A 3DMJA 3HVTA 4FLTA 2YV0X 3NGYA 2X74A 4M41A 3AVBA 2GV9A 3WNGA 3TANA 1S5JA 4DSIA 2FBXA 2HNZA 4DLEA 4HCCA 3CM5A 5D3GA 4AHRA 1S1UA 3NH2A 4B3OA 1RT4A 4KRFA 2OA8A 1VSJA 5C25A 3KKSA 4KI4A 4CJUA 1RT2A 4DWIA 3C95A 2Z1GA 3OS1A 1RT5A 2HMIA 1DTQA 4CJEA 3LWMA 3S3OA 2Z1IA 1X9SA 5EU7A 4I2QA 4MQ3A 1HMVA 3QIPA 4RW9A 4IG0A 2D0AA 1LWEA 1RCHA 1BCOA 1WSEA 2FBTA 4NCGA 4CHPA 1I3AA 3SZ2A 4IFVA 3KK2A 4DSLA 2B6AA 2BDPA 2HHSA 3NBPA 3JSMA 3RR7A 1JLEA 4ICLA 4M45A 4CF0A 4ZTFA 3HPOA 1RT6A 2HVIA 4FLXA 3AVCA 3AVGA 3SCXA 4DQIA 4FZYA 4CJTA 4AILC 4FJNA 2DFHA 3HVRA 4FM1A 5HRNA 4J2EA 4RW4A 4OGEA 4ZHRA 3OS2A 2G8UA 4PQUA 4OKJA 3OYKA 4O0JA 4HUGA 3DLBA 1CXUA 2NUBA 3EYZA 1EX4A 3QLHA 4FJXA 1RBVA 1L3SA 3DLEA 1ASVA 4JLHA 3E01A 3D45A 5HRRA 4RW8A 5HP1A 1RBSA 3QEIA 2FC0A 3TR8A 1A5XA 1ZBIA 4CHYA 3OYMA 1X9MA 1C0TA 1XWLA 4FJ9A 1N5YA 2HHTA 4N76A 3WNFA 3ZSQA 4CHQA 3TAFA 1NK6A 4CJ5A 4Z4GA 4FJHA 1TK0A 3AA2A 1BGXT 1RILA 2GUIA 3ZSVA 3FFIA 2HNDA 1LWFA 1WNSA 4DFKA 3SQ1A 1UA0A 5C24A 4I7FA 4FLWA 3RRHA 3SI6A 1SL1A 4FJ5A 1QSSA 1NK8A 5CYMA 4CESA 4M3WA 3EZ5A 2XRIA 5HLFA 3ZSWA 1QE1A 3A2FA 2ETJA 1IKYA 1VRUA 3ZT3A 4RW6A 1QSLA 2ZE2A 1QTMA 3WNHA 1X9WA 3CFOA 4FJJA 2IOCA 4Y1DA 4CF2A 1LWCA 1RTDA 3ZCMA 3LPUA 4G1QA 3TABA 1UA1A 3WNEA 4O5BA 3OYIA 1KLMA 4DLGA 3P5JA 4DSJA 4FJMA 4Z4FA 4CEAA 2HHQA 2RKIA 3AO2A 4W5TA 3RRGA 3LP2A 1HYZA 1W0HA 2RPIA 3C94A 1XHZA 2P1JA 2VWJA 1SUQA 2LSNA 2B5JA 3VQAA 3SV3A 1T05A 4CERA 1S1VA 2HVHA 1Q9YA 4FW2A 1VSFA 5JS1A 4DTPA 1JL1A 1VSIA 1CZBA 1YTAA 3VQ5A 3VQ9A 3ALYA 4E19A 4H8KA 3SNNA 3JYTA 4LD0A 4M3YA 4KFBA 4DTJA 3TAEA 1ASWA 3DLRA 1XHXA 2E4LA 4M3ZA 3LP3A 4PWDA 3QEWA 2VG7A 4M42A 3KLEA 4KHWA 4ID5A 4DU3A 3K5NA 1HJRA 5I42A 4E89A 3NGZA 3KK1A 3V9UA 1BQMA 1SL2A 4F3TA 4TSXA 4C8KA 1L3UA 4DMNA 4C8LA 1LAVA 4MFBA 4DQRA 3TAQA 3MXIA 3CFRA 1N6QA 2YHBA 1WSJA 1SKWA 4IFYA 1EXQA 4CFAA 3ULDA 2IAJA 3QEXA 2VWKA 4HVJA 3KLHA 3DLKA 3TI0A 2Q3SA 2P5GA 1KCFA 4DTRA 3CYMA 1CXQA 1QQCA 4EP5A 1HQUA 4KHNA 4OPKA 1TKXA 2KFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KI6 A;  2HHX A;  1U47 A;  4W5Q A;  1LV5 A;  4C8M A;  3VQD A;  4Q0B A;  3L2V A;  3L2R A;  4KPY A;  4N5S A;  3B6P A;  3DOK A;  1NKC A;  2R7Y A;  2F8S A;  4RW7 A;  5HBM A;  2IGI A;  4FZX C;  1SKR A;  2X6N A;  3ASM A;  1NJW A;  2G8K A;  3SV4 A;  3QO9 A;  3TAR A;  3G10 A;  3DYA A;  5E41 A;  4E7I A;  4DSK A;  1MU2 A;  1EKE A;  4O4G A;  5CYQ A;  5FRO A;  4CGI A;  1A5V A;  3OJS A;  5HRO A;  1EP4 A;  1KVB A;  1HRH A;  4O55 A;  4EP4 A;  3LAN A;  5DK5 A;  4DG1 A;  4QAG A;  1KLN A;  4PUO A;  4CEF A;  1L3T A;  3NDK A;  4B9M A;  3DI6 A;  4DTN A;  1ZBL A;  3MXM A;  1F21 A;  3DLG A;  3O4Q A;  4AHT A;  4CFB A;  3L2U A;  3TAG A;  4O0I A;  3S3N A;  3RWU A;  1WLJ A;  4DF8 A;  4KRE A;  1UWB A;  4E1M A;  1VSM A;  1KFD A;  4LSL A;  3VQ8 A;  4FCY A;  3ISN C;  1U4B A;  4EZ6 A;  4FXD A;  3RTV A;  3S3M A;  3OYN A;  2XY7 A;  3KKR A;  3PX6 A;  1TL1 A;  4CJ4 A;  5KGX A;  3P1G A;  2G8I A;  4I9L A;  2VG5 A;  3ZT4 A;  3BGR A;  3OJU A;  4FJ8 A;  2IC3 A;  1CZ9 A;  4GW6 A;  4Z4I A;  1FKP A;  1BQN A;  1Q8I A;  1LAW A;  4CEQ A;  1NK9 A;  1NJX A;  1BL3 A;  3ZT0 A;  4E0D A;  1WAF A;  4DU4 A;  2BE2 A;  3NFA A;  2Z1H A;  2OPP A;  1RT3 A;  4Z0U A;  1NJZ A;  3KTQ A;  3HP9 A;  1LW0 A;  2DFF A;  1RDA A;  3AA5 X;  3G0Z A;  2JGU A;  3MEE A;  5CZ2 A;  4CHO A;  3V9X A;  4EZ9 A;  4K8X A;  3OYC A;  4HTU A;  4H4M A;  4BE1 A;  3HJF A;  1J9A A;  4CCH A;  2WON A;  4KHQ A;  4E7H A;  3K5L A;  3VA0 A;  1S1W A;  2OPR A;  4IG3 A;  3AO4 A;  3ZSR A;  2KZM A;  3LPT A;  5J2N A;  2IDO A;  3NF8 A;  4CIF A;  2G8F A;  1JLA A;  4LSN A;  3U6F A;  1DTT A;  4CJL A;  2IS3 A;  3DRS A;  3VQ4 A;  3VQQ A;  4B8C A;  3KIO A;  1D9D A;  4CEC A;  2QKB A;  1VSE A;  2A1R A;  1VSL A;  4JRQ A;  3L8B A;  4CF9 A;  4RG8 A;  3CQ8 A;  4E7K A;  1RT1 A;  1TVR A;  3ZT2 A;  3NH0 A;  4F2S A;  3VQE A;  2RF2 A;  3AV9 A;  3SUQ A;  4W5R A;  4ELU A;  4B9S A;  3AVM A;  4I2P A;  3SJJ A;  1HQE A;  4BDY A;  3L3U A;  4WE1 A;  4CJK A;  1K6Y A;  3NF9 A;  4DS4 A;  3BDP A;  1BHL A;  1C0M A;  2HNY A;  4DS5 A;  4C8O A;  3AVN A;  3V4I A;  5J2Q A;  4KB1 A;  5FRM A;  1BCM A;  1S9E A;  4CJF A;  1SKS A;  4J2D A;  1S6Q A;  4NYF A;  3OY9 A;  3TWH A;  3U3Y A;  2KTQ A;  4R5P A;  4FM0 A;  2YKN A;  2YHA A;  4CGD A;  1T8E A;  1Z25 A;  5I3U A;  2HW3 A;  3L2W A;  3V81 A;  1TK5 A;  1TKT A;  4OVL A;  3VQ7 A;  3M8S A;  1VSK A;  2O4G A;  4UQG A;  4W5O A;  1U45 A;  3MXJ A;  1B9F A;  4OJR A;  4B8A B;  4KTQ A;  4CEB A;  3C6U A;  3VQ6 A;  3NE6 A;  3KLI A;  1D5A A;  2EHG A;  4CK2 A;  4BAC A;  1JL2 A;  2DFE A;  3LP0 A;  1BI4 A;  3VQB A;  4CK3 A;  2XO7 A;  3PO5 A;  4M3X A;  5FRN A;  1C1B A;  4KKO A;  3K59 A;  1KRP A;  4CEZ A;  4XIU A;  2OZM A;  3DOL A;  4FVM A;  4CJV A;  4M3R A;  1TAQ A;  2ITG A;  4DFJ A;  4KHS A;  1VK0 A;  4JS4 A;  4F8R A;  3RMD A;  4Z4H A;  3HYF A;  3ZSY A;  3M8R A;  2O4I A;  4DFM A;  3UIQ A;  1CLQ A;  2OPS A;  3NAE A;  1YTU A;  5KRT A;  1HNI A;  4DTS A;  4KHY A;  3AVL A;  3NF7 A;  3SPZ A;  2QKK A;  4DFP A;  4CF8 A;  1C6V A;  1VSD A;  4OLA A;  4W5N A;  5SZT A;  1XI1 A;  4HHT A;  3RMB A;  3U3G A;  4M3U A;  2PZS A;  3SPY A;  1T7P A;  3ZT1 A;  1U04 A;  4AHU A;  3V9W A;  4CIG A;  3V6D A;  5KGW A;  3HT3 A;  3OYH A;  1NKE A;  1NOZ A;  3SQ2 A;  1RTI A;  4CFD A;  3PX0 A;  2E6L A;  4LY7 A;  5J2M A;  1RDC A;  3RMA A;  4ID1 A;  1GOA A;  2YNF A;  1TV6 A;  3VQP A;  5J2P A;  3QET A;  3QEV A;  4NCA A;  4KAZ A;  4GVM A;  4KB0 A;  1ZBH A;  3NHG A;  3K5O A;  1O1W A;  1JLB A;  3AO1 A;  2DTU A;  3AVI A;  1ZBU A;  5FDL A;  1X1P A;  2PY5 A;  1JLC A;  1TKZ A;  4J2B A;  4FLY A;  4N41 A;  4BWJ A;  2F8T A;  3S9H A;  4OGC A;  3PX4 A;  1EET A;  1IH7 A;  1JXE A;  4LH5 A;  4YNQ A;  4B08 A;  3LDS A;  3OVN A;  4KHU A;  3L2Q A;  4FJ7 A;  2VG6 A;  1HNV A;  1KVA A;  3DRP A;  1WN7 A;  5SWM A;  4CEO A;  4CHN A;  4OKK A;  4FM2 A;  3I8D A;  3SUP A;  4IBN A;  3AVH A;  4O44 A;  4KV8 A;  4CJW A;  1IO2 A;  1ITG A;  3NF6 A;  2AJQ A;  5CY4 A;  4KTW A;  3LAL A;  4FYD A;  1LW2 A;  3IG1 A;  1NKB A;  3T3F A;  2X78 A;  4AHV A;  4E7J A;  3MEC A;  3KK3 A;  3O3F A;  4FLZ A;  2P51 A;  4H4O A;  4KO0 A;  4DSF A;  1NK0 A;  2G8V A;  3NGI A;  3OYB A;  3M8P A;  3VN5 A;  4B9T A;  1ASU A;  3HK2 A;  1WSG A;  4AHS A;  4PY5 A;  5T7B A;  3OYE A;  1A5W A;  2I5J A;  2KQ2 A;  3AA3 A;  4CEE A;  3PY8 A;  4F3O A;  1Y97 A;  4FJI A;  3I0R A;  3SUO A;  2KZZ A;  4OLB A;  1J5O A;  4CGG A;  1G15 A;  3QES A;  1Q9X A;  1RTH A;  1REV A;  5C42 A;  4CJR A;  1RBU A;  3NCI A;  3AO3 A;  3LP1 A;  3OYL A;  3SQ4 A;  4CED A;  2D5R A;  2XY8 A;  1HYS A;  3DM2 A;  4C8N A;  1S9G A;  4DU1 A;  2OPQ A;  1D9F A;  2D0B A;  3ITH A;  1W9H A;  1S1X A;  3M8Q A;  4CGH A;  4CIE A;  5HRP A;  1TK8 A;  3AVA A;  3KD1 E;  1TAU A;  1VSH A;  4K8Z A;  3SUN A;  2P5O A;  4PA1 A;  1RDD A;  1YVU A;  3V1R A;  3LWL A;  3O3H A;  4BE0 A;  1R0A A;  3T1A A;  3VQC A;  1HPZ A;  1HYV A;  3IS9 A;  4DTM A;  3QIN A;  1U49 A;  2G8W A;  4Y1C A;  2F96 A;  1VRT A;  2BGG A;  4BWM A;  1UOC A;  3LAM A;  1NK7 A;  4J2A A;  3C6T A;  4CGJ A;  1U48 A;  1WSH A;  3OS0 A;  4FJL A;  1KVC A;  3LZJ A;  2GBZ A;  3HL8 A;  3QNO A;  4ELV A;  4BDP A;  1TKD A;  4E7L A;  3K57 A;  1FK9 A;  4IDK A;  2YKM A;  4F2R A;  4F4K A;  3ZSX A;  3ZSO A;  3PO4 A;  4CJP A;  3F73 A;  2E6M A;  3V1Q A;  4CJS A;  5JS2 A;  2HHU A;  4QOZ B;  4FW1 A;  1TL3 A;  2D0C A;  1KTQ A;  2QK9 A;  4B9L A;  2W42 A;  4B9V A;  1UAX A;  2Y1I A;  3OYF A;  3HPH A;  2PYJ A;  4CJ3 A;  2OZS A;  3LZI A;  4GMJ B;  3B6O A;  3OYJ A;  3OYG A;  3AO5 A;  4FJK A;  3SYZ A;  1B9D A;  4Z4C A;  4CF1 A;  3K2P A;  4DTU A;  3O4N A;  1JLF A;  1T03 A;  1S6P A;  2JLE A;  4HUF A;  1BIZ A;  3O3G A;  3MEG A;  1RBR A;  3OYD A;  1IG9 A;  3DLH A;  2ZD1 A;  1JLQ A;  3MAQ A;  3KLF A;  1C0U A;  3DRR A;  1C1C A;  2YNG A;  2ATQ A;  2KW4 A;  5J1E A;  3KJV A;  4FJG A;  4Z4E A;  2ZQB A;  4CFC A;  4DTO A;  1RT7 A;  2XHB A;  4DF4 A;  1FXX A;  4YFU A;  2EX3 A;  1TGO A;  3MED A;  3EY1 A;  2KFZ A;  3HM9 A;  4NCB A;  1L5U A;  4CJQ A;  4E1N A;  1NOY A;  4HCB A;  3I0S A;  3L3V A;  1YT3 A;  4KTZ A;  2A1S A;  1BI4 B;  3V1O A;  5DMR A;  2QXF A;  4DTX A;  1BIU A;  3ZSZ A;  3PUF A;  4B9U A;  4BDZ A;  3K58 A;  4FK4 A;  3TAP A;  2YNH A;  3RMC A;  1NK5 A;  3AVF A;  3HXM A;  2DY4 A;  4N47 A;  3HPG A;  4CHZ A;  1DLO A;  1IKV A;  4CGF A;  1WSF A;  3QEP A;  1QSY A;  1S1T A;  4B9N A;  3T19 A;  3V9S A;  2Z1J A;  3SQ0 A;  1QS4 A;  2FBY A;  3CG7 A;  2B4J A;  4OPJ A;  4L8R B;  4FZZ A;  3AA4 A;  3OYA A;  4NYN A;  5KRS A;  3QER A;  2RN2 A;  4CE9 A;  4CK1 A;  5HRS A;  2XY6 A;  1SV5 A;  1ZYQ A;  1NJY A;  1JXB A;  1RTJ A;  1L3V A;  1BIS A;  1I39 A;  3NH1 A;  1D8Y A;  2G8H A;  2HHV A;  3IAY A;  4DQP A;  4FK2 A;  1RBT A;  3CM6 A;  1B92 A;  4BE2 A;  2FBV A;  1SL0 A;  2XY5 A;  1GOB A;  1RDB A;  2PYL A;  2X6S A;  3P83 D;  5KI6 A;  3AVJ A;  3LAK A;  1FKO A;  2HHW A;  1J53 A;  4ZTJ A;  2BAN A;  2WOM A;  3IRX A;  1C1A A;  1ZBF A;  2YNI A;  5KTQ A;  4DQQ A;  3VA3 A;  4JS5 A;  3KD5 E;  1IKX A;  4LH4 A;  3HP6 A;  4JRP A;  1KSP A;  4FLV A;  3KLG A;  1NK4 A;  1RNH A;  2OYQ A;  5K14 A;  3K5M A;  3QIO A;  4DQS A;  4IKF A;  3HO1 A;  1WSI A;  1IKW A;  1KFS A;  3AVK A;  3F9K A;  4ELT A;  3QNN A;  2HB5 A;  3CFP A;  5CZ1 A;  2Y1J A;  4QCL A;  4OKE A;  1JKH A;  4AHC A;  3D0P A;  4E3S A;  1J54 A;  1JLG A;  3THV A;  4Q5V A;  1QHT A;  4HUE A;  3H08 A;  3TAM A;  4FLU A;  3PV8 A;  4I9Q A;  3HST B;  4FK0 A;  1GOC A;  4AH9 A;  4DSE A;  4N56 A;  1XC9 A;  4M3T A;  3V9Z A;  1Z26 A;  1WAJ A;  3RR8 A;  3DMJ A;  3HVT A;  4FLT A;  2YV0 X;  3NGY A;  2X74 A;  4M41 A;  3AVB A;  2GV9 A;  3WNG A;  3TAN A;  1S5J A;  4DSI A;  2FBX A;  2HNZ A;  4DLE A;  4HCC A;  3CM5 A;  5D3G A;  4AHR A;  1S1U A;  3NH2 A;  4B3O A;  1RT4 A;  4KRF A;  2OA8 A;  1VSJ A;  5C25 A;  3KKS A;  4KI4 A;  4CJU A;  1RT2 A;  4DWI A;  3C95 A;  2Z1G A;  3OS1 A;  1RT5 A;  2HMI A;  1DTQ A;  4CJE A;  3LWM A;  3S3O A;  2Z1I A;  1X9S A;  5EU7 A;  4I2Q A;  4MQ3 A;  1HMV A;  3QIP A;  4RW9 A;  4IG0 A;  2D0A A;  1LWE A;  1RCH A;  1BCO A;  1WSE A;  2FBT A;  4NCG A;  4CHP A;  1I3A A;  3SZ2 A;  4IFV A;  3KK2 A;  4DSL A;  2B6A A;  2BDP A;  2HHS A;  3NBP A;  3JSM A;  3RR7 A;  1JLE A;  4ICL A;  4M45 A;  4CF0 A;  4ZTF A;  3HPO A;  1RT6 A;  2HVI A;  4FLX A;  3AVC A;  3AVG A;  3SCX A;  4DQI A;  4FZY A;  4CJT A;  4AIL C;  4FJN A;  2DFH A;  3HVR A;  4FM1 A;  5HRN A;  4J2E A;  4RW4 A;  4OGE A;  4ZHR A;  3OS2 A;  2G8U A;  4PQU A;  4OKJ A;  3OYK A;  4O0J A;  4HUG A;  3DLB A;  1CXU A;  2NUB A;  3EYZ A;  1EX4 A;  3QLH A;  4FJX A;  1RBV A;  1L3S A;  3DLE A;  1ASV A;  4JLH A;  3E01 A;  3D45 A;  5HRR A;  4RW8 A;  5HP1 A;  1RBS A;  3QEI A;  2FC0 A;  3TR8 A;  1A5X A;  1ZBI A;  4CHY A;  3OYM A;  1X9M A;  1C0T A;  1XWL A;  4FJ9 A;  1N5Y A;  2HHT A;  4N76 A;  3WNF A;  3ZSQ A;  4CHQ A;  3TAF A;  1NK6 A;  4CJ5 A;  4Z4G A;  4FJH A;  1TK0 A;  3AA2 A;  1BGX T;  1RIL A;  2GUI A;  3ZSV A;  3FFI A;  2HND A;  1LWF A;  1WNS A;  4DFK A;  3SQ1 A;  1UA0 A;  5C24 A;  4I7F A;  4FLW A;  3RRH A;  3SI6 A;  1SL1 A;  4FJ5 A;  1QSS A;  1NK8 A;  5CYM A;  4CES A;  4M3W A;  3EZ5 A;  2XRI A;  5HLF A;  3ZSW A;  1QE1 A;  3A2F A;  2ETJ A;  1IKY A;  1VRU A;  3ZT3 A;  4RW6 A;  1QSL A;  2ZE2 A;  1QTM A;  3WNH A;  1X9W A;  3CFO A;  4FJJ A;  2IOC A;  4Y1D A;  4CF2 A;  1LWC A;  1RTD A;  3ZCM A;  3LPU A;  4G1Q A;  3TAB A;  1UA1 A;  3WNE A;  4O5B A;  3OYI A;  1KLM A;  4DLG A;  3P5J A;  4DSJ A;  4FJM A;  4Z4F A;  4CEA A;  2HHQ A;  2RKI A;  3AO2 A;  4W5T A;  3RRG A;  3LP2 A;  1HYZ A;  1W0H A;  2RPI A;  3C94 A;  1XHZ A;  2P1J A;  2VWJ A;  1SUQ A;  2LSN A;  2B5J A;  3VQA A;  3SV3 A;  1T05 A;  4CER A;  1S1V A;  2HVH A;  1Q9Y A;  4FW2 A;  1VSF A;  5JS1 A;  4DTP A;  1JL1 A;  1VSI A;  1CZB A;  1YTA A;  3VQ5 A;  3VQ9 A;  3ALY A;  4E19 A;  4H8K A;  3SNN A;  3JYT A;  4LD0 A;  4M3Y A;  4KFB A;  4DTJ A;  3TAE A;  1ASW A;  3DLR A;  1XHX A;  2E4L A;  4M3Z A;  3LP3 A;  4PWD A;  3QEW A;  2VG7 A;  4M42 A;  3KLE A;  4KHW A;  4ID5 A;  4DU3 A;  3K5N A;  1HJR A;  5I42 A;  4E89 A;  3NGZ A;  3KK1 A;  3V9U A;  1BQM A;  1SL2 A;  4F3T A;  4TSX A;  4C8K A;  1L3U A;  4DMN A;  4C8L A;  1LAV A;  4MFB A;  4DQR A;  3TAQ A;  3MXI A;  3CFR A;  1N6Q A;  2YHB A;  1WSJ A;  1SKW A;  4IFY A;  1EXQ A;  4CFA A;  3ULD A;  2IAJ A;  3QEX A;  2VWK A;  4HVJ A;  3KLH A;  3DLK A;  3TI0 A;  2Q3S A;  2P5G A;  1KCF A;  4DTR A;  3CYM A;  1CXQ A;  1QQC A;  4EP5 A;  1HQU A;  4KHN A;  4OPK A;  1TKX A;  2KFN A; 
#chains in the Genus database with same CATH topology
 4W5Q A;  5AQR A;  4LF8 K;  3VQD A;  4Q0B A;  2P9U B;  4BG9 A;  3B6P A;  5LMN K;  5HBM A;  3OHR A;  4FZX C;  3G10 A;  3DYA A;  4EIA A;  3THY B;  5BN9 A;  3RVC A;  3AAQ A;  1EKE A;  4O4G A;  1YUW A;  5HRO A;  3SJH A;  4O55 A;  2P9S A;  4DG1 A;  3DI6 A;  2D1K A;  4H0T B;  4HTL A;  1X9J A;  1F21 A;  3O4Q A;  3O8M A;  4AHT A;  3S3N A;  4O0I A;  4A2B A;  3RWU A;  4NLB A;  4DF8 A;  3CCJ N;  1VSM A;  3VQ8 A;  4FCY A;  1U4B A;  3ISN C;  2A6A A;  2XY7 A;  4LF4 K;  4I9L A;  2VG5 A;  3BGR A;  2P9P A;  2P9S B;  1NK9 A;  1JJ2 M;  3LDN A;  4CZL A;  5KPR A;  2HHH K;  2BE2 A;  2Z1H A;  3HP9 A;  2ZM6 K;  3AA5 X;  5JVH L;  4C1N I;  3WQT A;  4WQ4 A;  3FZM A;  3HJF A;  4CCH A;  2FF6 A;  2WON A;  4KHQ A;  3K5L A;  3H45 C;  2KZM A;  3LPT A;  4CIF A;  2G8F A;  3ATV A;  4IFE A;  4BRI A;  3O08 A;  4L3Q A;  2OTJ N;  4CEC A;  1T44 A;  2Q2R A;  2A1R A;  3TTD A;  1VSL A;  2FSJ A;  3H1V X;  3CQ8 A;  4RG8 A;  5M1P A;  3CJ1 A;  4PKI A;  3ZT2 A;  3VQE A;  1E4G T;  4ELU A;  4I2P A;  1HQE A;  3IKM A;  4CJK A;  3CJ7 A;  2UXB K;  4RTF D;  3BDP A;  5AZI B;  2HNY A;  3AVN A;  5HOO A;  3V4I A;  4KHP K;  1X3N A;  2P9U A;  4JK8 A;  2Q36 A;  3OY9 A;  4CGD A;  4DUY K;  2VGN A;  3A5O C;  3ID6 A;  1WBB A;  3FGU A;  4IDH A;  3SK3 A;  4W5O A;  2PAV A;  5GAD P;  3NE6 A;  3KLI A;  3UKU A;  3LP0 A;  5FRN A;  4M3X A;  4KKO A;  1Q82 O;  3TTC A;  4DFJ A;  1NWK A;  1VK0 A;  1K8A O;  3EKS A;  3RMD A;  4Z4H A;  3HYF A;  1KAZ A;  1VQL N;  4DFM A;  3UIQ A;  1CLQ A;  3FZL A;  2OPS A;  3D2E B;  3NAE A;  4DTS A;  2QKK A;  3CER A;  1VSD A;  1WB9 A;  1Z05 A;  4HHT A;  1BA0 A;  4CIG A;  5KGW A;  1HX1 A;  1NOZ A;  3Q7C A;  3SQ2 A;  1RTI A;  4CFD A;  4K0K K;  5J2M A;  1TV6 A;  4NCA A;  3O9Q A;  3D2E A;  1O1W A;  1JLB A;  2E2P A;  1QHA A;  3AVI A;  4CZF A;  3VEW A;  3H3O B;  1JLC A;  4WQ4 C;  1HUX A;  1HR0 K;  1YXQ A;  1NLV A;  4J2B A;  4BWJ A;  2QA4 N;  4YHH K;  5KQD A;  3L2Q A;  2VG6 A;  5ELZ A;  2QM1 A;  4CEO A;  5GAH P;  4KV8 A;  4CJW A;  4DV1 K;  5C12 A;  1U6Z A;  1IO2 A;  1GLL O;  3M6G A;  4WF9 L;  4JI5 K;  3MCP A;  4FYD A;  3C7N B;  4AHV A;  5CE3 A;  3L0Q A;  3O3F A;  3VN5 A;  3HK2 A;  5T7B A;  2I5J A;  4F3O A;  3PY8 A;  3MN5 A;  3PSF A;  2KZZ A;  5GAE P;  1J5O A;  3GE1 A;  4CGG A;  3QES A;  1Q9X A;  3SBG A;  2I7N A;  1REV A;  1M90 O;  4FWO A;  4BRG A;  4CJR A;  3D6R A;  2D5R A;  1R59 O;  3G6E N;  3DM2 A;  4BRQ A;  3FE1 A;  4DU1 A;  3C7N A;  2OPQ A;  3M8Q A;  2HBL A;  4CIE A;  3KD1 E;  4LF9 K;  4K8Z A;  1SS6 A;  1VQM N;  1I94 K;  1YVU A;  3K9K A;  3O3H A;  1SAZ A;  1HPZ A;  4JI4 K;  2G8W A;  1MDU B;  1VRT A;  2QXL A;  3LAM A;  3TPQ A;  4FJL A;  4A5A A;  4PL8 A;  2FXU A;  3LZJ A;  4FOI A;  2F4V K;  4H0O A;  4BVP A;  4CBU A;  3DLL L;  3ZSO A;  4CJP A;  4FWM A;  4CBW A;  2P9I A;  1YIJ N;  5JS2 A;  2HHU A;  1TL3 A;  1KTQ A;  2NRZ A;  3VPZ A;  4B9L A;  1UAX A;  3T7Z A;  3OYF A;  3HPH A;  3J81 O;  3OYJ A;  2V7Y A;  3LZI A;  2E1Z A;  3AO5 A;  4FJK A;  3U8X A;  1JLF A;  2O8E B;  2W6L A;  4CD1 A;  5M1O A;  1BOT O;  3KWI A;  2CGK A;  4H0P A;  1NGG A;  3KLF A;  4GVE A;  3DRR A;  5CHI A;  4BGA A;  3SAF A;  1NGJ A;  4CFC A;  4DTO A;  1FXX A;  3MED A;  4CD3 A;  4NCB A;  3VEX A;  5EX5 A;  1WUA A;  5GIN A;  5GIO A;  2NNW A;  2QXF A;  2QWM A;  4DTX A;  1BIU A;  2O8E A;  3CPW M;  3LDL A;  4FK4 A;  2YNH A;  3QML A;  4B3M K;  3AVF A;  1IKV A;  2D0O A;  4B9N A;  4EHU A;  1QS4 A;  3UE5 A;  4CZG A;  4FZZ A;  4L8R B;  4BGB A;  3AA4 A;  3OYA A;  5KRS A;  1ZYQ A;  4A62 A;  1JXB A;  2HHV A;  2ZJP L;  4DQP A;  2E88 A;  4BE2 A;  3VGK A;  1NU0 A;  1RDB A;  3P83 D;  3MWP A;  4ILH A;  1GLE G;  2QI2 A;  1J53 A;  1ZBF A;  2YNI A;  1IKX A;  2ZGZ A;  4LH4 A;  1VQK N;  4FLV A;  3C6A A;  5TKW A;  3LDP A;  2QWQ A;  5K14 A;  2WC9 A;  3QIO A;  3R9P A;  3HO1 A;  3BZK A;  4GKK K;  1IKW A;  3F9K A;  1QZ5 A;  5CZ1 A;  4QCL A;  1JKH A;  4AHC A;  4DUZ K;  4QS8 A;  4MLH A;  3MCA B;  3TAM A;  1T6D A;  3VOV A;  1GOC A;  1NG9 A;  3V9Z A;  1Z26 A;  3VEN A;  2FBX A;  5AQP A;  5C0Y A;  3MX2 A;  1RT4 A;  4GNI A;  5C25 A;  2W41 A;  3SAH A;  3QFU A;  1RT2 A;  4DWI A;  2D0P A;  3C95 A;  4BRF A;  3OS1 A;  3ZET A;  3KWG A;  3EN9 A;  4V19 S;  3ZX3 A;  4M7Y A;  2Z1I A;  3QIP A;  3M8S A;  3MWT A;  2D0A A;  4NCG A;  1RCH A;  4FK0 A;  1I3A A;  4IFV A;  3JSM A;  4ICL A;  5EVZ A;  1VQ6 N;  2HVI A;  3FFK B;  4FLX A;  1Z6R A;  4FJN A;  2DFH A;  4PL7 A;  4OGE A;  3O5B A;  4U67 L;  4OKJ A;  1D4X A;  2ASM A;  3QLH A;  4YDU C;  2IVN A;  2I7P A;  4RW8 A;  5GAG P;  4CHY A;  4FJ9 A;  1XWL A;  3G25 A;  4DV6 K;  4I7F A;  3RRH A;  3E9O A;  1NK8 A;  4B9Q A;  3EZ5 A;  5HLF A;  1QE1 A;  3A2F A;  1NGE A;  3ZX0 A;  2ASP A;  2ZE2 A;  5AFU A;  3FZF A;  5AQT A;  4CF2 A;  3ZCM A;  1RDW X;  3TAB A;  3OYI A;  4FJM A;  4Z4F A;  4CEA A;  4W5T A;  3PLA A;  3LDQ A;  1HYZ A;  1W0H A;  2RPI A;  2O8B A;  2VWJ A;  2B5J A;  3EE8 A;  4CER A;  3H3N O;  1Q9Y A;  2ZJQ L;  3WXJ A;  4H8K A;  3SNN A;  1JCF A;  3U4L A;  3HOS A;  3TAE A;  3UB5 A;  4M3Z A;  1XHX A;  3QEW A;  2QWP A;  4DB3 A;  4U7B A;  4H0Y B;  4K42 A;  1YVN A;  3KK1 A;  1N8R O;  4C8K A;  4C8L A;  3CFR A;  5LJW A;  1WSJ A;  3ULD A;  4QS7 A;  1QQC A;  2OTL N;  5FPE A;  2UUB K;  1BWF O;  2HHX A;  3L2V A;  3L2R A;  4OPH A;  2R7Y A;  2HF4 A;  4YY3 K;  2F8S A;  2IGI A;  1SKR A;  2X6N A;  4IWV A;  3SV4 A;  4IEE A;  1Y64 A;  3H1Q A;  1YJN N;  4CGI A;  1EP4 A;  4BRE A;  1IG8 A;  4BC4 A;  3P31 A;  4QAG A;  4C23 A;  1L3T A;  3NDK A;  1OVY A;  4DTN A;  1NMN A;  3MXM A;  3DLG A;  4FWN A;  4KRE A;  1UWB A;  4LSL A;  5KGX A;  3QDK A;  4B1U B;  2G8I A;  3NMU A;  3ZT4 A;  1FKP A;  4J8F A;  4JHD B;  5I9E B;  1BQN A;  1LAW A;  2CGL A;  4BRD A;  5AQF A;  1BL3 A;  3ZT0 A;  1GLC G;  3CJA A;  2OPP A;  2QW9 A;  3MEE A;  5M1Q A;  3S41 A;  4K8X A;  3UKR B;  3OYC A;  4HTU A;  4H4M A;  4BE1 A;  3THY A;  1QVF M;  2RE2 A;  4YOW A;  1XC3 A;  1JLA A;  4X65 K;  4BR7 A;  1BO5 O;  3VQ4 A;  4KH5 A;  1D9D A;  4AM6 A;  1VSE A;  3CXC M;  4JRQ A;  4BC5 A;  4PKG A;  1U2V A;  4CF9 A;  4E7K A;  1RT1 A;  1TVR A;  4W5R A;  4B9S A;  3AVM A;  3TU5 A;  3L3U A;  1K6Y A;  1MWM A;  3NF9 A;  3J7A P;  5AQK A;  1BHL A;  1C0M A;  3M3Z A;  4DS5 A;  2ITM A;  5J2Q A;  4KB1 A;  5FRM A;  1BCM A;  1SKS A;  1EWQ A;  1S6Q A;  3U3Y A;  2KTQ A;  4R5P A;  2YHA A;  1Z25 A;  3J80 O;  5I3U A;  4EHT A;  1TK5 A;  3PIO L;  4OVL A;  3VQ7 A;  4BRN A;  1C0G A;  2WTU A;  1B9F A;  4OJR A;  4CEB A;  5FPN A;  3KVG A;  2EHG A;  4CK3 A;  1XNQ K;  3K59 A;  5LY3 A;  2OZM A;  3DOL A;  4FVM A;  5IT9 O;  4M3R A;  2V51 B;  3BUZ B;  4KHS A;  3F2K A;  3ZSY A;  4JI1 K;  3M8R A;  5JVG L;  2O8C A;  1QQM A;  1E3M A;  1HNI A;  3SPZ A;  3NF7 A;  1M1K O;  4JHD A;  4A5B A;  1VQ8 N;  3ZT1 A;  3I55 N;  2FF3 B;  1O13 A;  3L6Q A;  2UUA K;  3PX0 A;  2P9I B;  3E9P A;  4ID1 A;  2YNF A;  2Q0U A;  2Q0R A;  3QEV A;  3U9D A;  4DR2 K;  1RGI A;  1SZ2 A;  1T3V A;  3AO1 A;  3AGR A;  2DTU A;  5F0X A;  1ZBU A;  2VGM A;  1X1P A;  1TKZ A;  4N41 A;  2F8T A;  4OGC A;  1OKJ A;  3FLC O;  1EET A;  3WT0 A;  4YNQ A;  1U2V B;  3OVN A;  3I56 N;  1JCG A;  1HNV A;  3DRP A;  4CHN A;  4OKK A;  4KH4 A;  4JI6 K;  1XMQ K;  3AVH A;  1ITG A;  2QWN A;  1W7A A;  3DWL A;  1NKB A;  4E7J A;  3VTI A;  3VET A;  1NK0 A;  2P51 A;  4H4O A;  2G8V A;  1WSG A;  1ATS A;  4AHS A;  2AP1 A;  1A5W A;  4FJI A;  4CZM A;  3SUO A;  3SMP A;  4OLB A;  3VES A;  5MLC Q;  4JKH A;  3NCI A;  3AO3 A;  3LP1 A;  3SQ4 A;  1QVG M;  2GEL A;  3BEX A;  3O9S A;  3L4I A;  1S1X A;  1J5E K;  4CGH A;  3AVA A;  3E1Y A;  3SUN A;  4OO1 J;  2DPN A;  3IUC A;  4PA1 A;  1RDD A;  3F5T A;  3VQC A;  4DTM A;  3IS9 A;  2AA4 A;  3QIN A;  4Y1C A;  4XH1 A;  1NK7 A;  1UOC A;  4J2A A;  1DEJ A;  4O8K A;  1KVC A;  4MDB A;  3QNO A;  4ELV A;  4BDP A;  1TKD A;  4IDK A;  4NXM K;  2YKM A;  5AJ3 K;  1VQ4 N;  3EZW A;  3ZSX A;  3V1Q A;  4CJS A;  5JMV A;  4FW1 A;  2D0C A;  2QK9 A;  2W42 A;  4CW7 B;  2WFB A;  2NLX A;  2O8F A;  4CJ3 A;  4IJA A;  4Z4C A;  3GDQ A;  4CF1 A;  3CCR N;  4DTU A;  3VER A;  2JLE A;  1NM1 A;  1BIZ A;  1IBM K;  5EOY A;  4YOX A;  3G4S N;  4BG8 A;  4YDU A;  2NRR A;  2ZD1 A;  5AQJ A;  1C0U A;  5M1N A;  2YNG A;  4LF6 K;  2KW4 A;  4Z4E A;  2RHK A;  2ZQB A;  2NZT A;  2XHB A;  2UUC K;  3VF4 A;  4YFU A;  3EY1 A;  4JKD A;  2KFZ A;  4DV2 K;  4LC9 B;  5AQY A;  1W2B M;  4E1N A;  4A57 A;  3QBX A;  2A40 A;  3V1O A;  3MN7 A;  5AQI A;  3ZSZ A;  4B9U A;  3TAP A;  1NK5 A;  2NRV A;  4IO9 L;  2O8D A;  1QQN A;  3M1F A;  4GKJ K;  2DY4 A;  3HPG A;  4CHZ A;  1JCE A;  4BC3 A;  4CGF A;  1WSF A;  4WCE L;  3SQ0 A;  2FBY A;  3CG7 A;  3IDH A;  2YJF A;  2P9K A;  4NYN A;  3W0L A;  2PBD A;  4FWK A;  5HRS A;  1L3V A;  5ADX H;  4WFN L;  3IAY A;  3CM6 A;  4IOX A;  2FBV A;  1N33 K;  4O5F A;  1GOB A;  2X6S A;  4CVN E;  3LAK A;  2UYT A;  1N34 K;  1VQ5 N;  2BAN A;  2WOM A;  4X64 K;  3HP6 A;  5BRD A;  4BVO A;  1K8K A;  5LJV A;  4DQS A;  3TSP A;  2VQE K;  4FPA A;  1KFS A;  4B1X B;  4DCH A;  4BR5 A;  1VQ7 N;  4OKE A;  3D0P A;  4E3S A;  4YOT A;  3THV A;  3H08 A;  3MMV A;  4I9Q A;  5C2F A;  4AH9 A;  3ZET B;  1XC9 A;  4H5N A;  3HTV A;  3NGY A;  3DJC A;  3AVB A;  2GV9 A;  4DSI A;  3J7Z O;  3CM5 A;  4AHR A;  4B3O A;  4KRF A;  3O80 A;  1VSJ A;  4CJU A;  1TYQ B;  4JKB A;  1RT5 A;  3OTO K;  4CJE A;  3CHW A;  1VQP N;  3CCS N;  1HMV A;  1ILY A;  4CHP A;  4IG0 A;  1WSE A;  2FBT A;  4DSL A;  1CZA N;  2HHS A;  2B6A A;  2BDP A;  3RR7 A;  4CF0 A;  3HZ6 A;  1S22 A;  2HBK A;  4KBO A;  3DXM B;  3CF5 L;  4FM1 A;  5HRN A;  4J2E A;  3OYK A;  3EYZ A;  2E20 A;  1RBV A;  1L3S A;  3DLE A;  1ASV A;  5HRR A;  3C6H A;  3CC7 N;  3OA9 A;  1RBS A;  2NRX A;  3OYM A;  1C0T A;  3MK6 A;  3ZSQ A;  1NK6 A;  5AQN A;  4CJ5 A;  5E26 A;  1TK0 A;  3ZSV A;  1RIL A;  1NJZ A;  3FFI A;  2HND A;  4DFK A;  5C24 A;  1HNX K;  3DXM A;  4JN4 A;  3WXI A;  4ISG A;  3EKU A;  2UXD K;  4CES A;  5BRH A;  3ZSW A;  3PSI A;  4GV9 A;  2YHY A;  1QTM A;  1LWC A;  4QS9 A;  3JXU A;  1S72 N;  1RTD A;  2CH6 A;  4DLG A;  3P5J A;  3EEQ A;  5FPD A;  1S1V A;  1KAY A;  1VSF A;  4FW2 A;  1VSI A;  4E19 A;  4LD0 A;  4M3Y A;  4KFB A;  4PWD A;  2E4L A;  4I6M A;  3P39 A;  3KLE A;  2GUP A;  3K5N A;  4XH4 A;  3NGZ A;  1SL2 A;  3V9U A;  1BQM A;  4WQ5 A;  1LAV A;  4YOU A;  3TAQ A;  1N6Q A;  2YHB A;  1SKW A;  4IFY A;  3WEE B;  4CFA A;  3QEX A;  4BRP A;  2VWK A;  5AQL A;  3KLH A;  1NMD A;  3TI0 A;  2NRW A;  2P5G A;  1KCF A;  3VGL A;  4EP5 A;  1TKX A;  5F2R A;  4JI8 K;  2KFN A;  4DV5 K;  1NJW A;  5E41 A;  4CJ7 A;  1ATN A;  1MU2 A;  5CYQ A;  5FRO A;  4A59 A;  5BN8 A;  1KVB A;  1HRH A;  5EXW A;  4WYB A;  5DK5 A;  3CC2 N;  4PUO A;  4CEF A;  2Q97 A;  4B9M A;  2FLO A;  4B1Y B;  1VQ9 N;  1Q86 O;  2F7T A;  1WLJ A;  1BU6 O;  1KFD A;  4DQ8 A;  4FXD A;  5KPZ A;  3RTV A;  3OYN A;  3PX6 A;  1TL1 A;  3UKR A;  4CJ4 A;  3P1G A;  2UU9 K;  4K43 A;  4BRO A;  2UXC K;  3OJU A;  4FJ8 A;  2ASO A;  3VF2 A;  1QQO A;  1Q8I A;  4DR5 K;  1WAF A;  4WFA L;  4DU4 A;  3NFA A;  1RT3 A;  3W3D A;  4DV4 K;  1RDA A;  3CJC A;  3G0Z A;  2JGU A;  3V9X A;  4BC2 A;  2QEX N;  1J9A A;  4E7H A;  3VA0 A;  2E2N A;  2NRH A;  3O9T A;  2IDO A;  4LSN A;  4ILG B;  1DTT A;  3U6F A;  4DR1 K;  2IS3 A;  2F9W A;  3DRS A;  4B8C A;  3KIO A;  1KQS M;  2QKB A;  3NH0 A;  3CCU N;  3SJJ A;  1NGI A;  3K9J A;  5H1S Q;  3D2F B;  5JLH A;  5M1F A;  2P9L A;  4WFB L;  5AQQ A;  3VGM A;  3TWH A;  4FM0 A;  2YKN A;  1T8E A;  3L2W A;  1MWK A;  3V81 A;  1TKT A;  1VSK A;  2O4G A;  4UQG A;  1U45 A;  3MXJ A;  3THW B;  4B8A B;  4KH6 A;  2W6K A;  3VQ6 A;  4IXC A;  1D5A A;  5GIP A;  2Q1N A;  1BI4 A;  3PO5 A;  2D4W A;  5AQZ A;  4CEZ A;  3SAG A;  3BF1 A;  1YHQ N;  3M5R A;  3HBT A;  4JS4 A;  4F8R A;  5AQH A;  2O4I A;  1YF5 L;  1E4F T;  1YTU A;  2QWR A;  5KRT A;  5TKY A;  4KHY A;  4OLA A;  1XI1 A;  3VEV A;  4M3U A;  3SPY A;  1T7P A;  4AHU A;  1HJO A;  1TUU A;  3OYH A;  4IOA L;  2E6L A;  1RDC A;  3N4P A;  1GOA A;  3VQP A;  2IVP A;  4KB0 A;  3NHG A;  1TYQ A;  1EWR A;  1ZC6 A;  3AGK A;  1OH8 A;  5LL6 Z;  5FDL A;  2PY5 A;  4EFH A;  1KAX A;  2W40 A;  4LFA K;  4FLY A;  3KZB A;  4H5R A;  3S9H A;  1NJI O;  1K9M O;  1JXE A;  5BPN A;  4XEI A;  4MO5 A;  3T1H K;  1WN7 A;  5SWM A;  4FM2 A;  2O8C B;  3I8D A;  4BQZ A;  4IBN A;  4PKH A;  3SUP A;  3WQU A;  3D2F A;  3NF6 A;  2E2O A;  1IV0 A;  4KTW A;  2GTD A;  2X78 A;  3KK3 A;  4DSF A;  3HOT A;  1RFQ A;  3NGI A;  1ASU A;  4MO4 A;  3JS6 A;  3CIP A;  4BY9 C;  3CQX A;  1Y97 A;  3I0R A;  3WUH A;  1IJJ A;  3O6W A;  2VCP A;  4DHY A;  5AZJ B;  1G15 A;  4JD2 B;  5C42 A;  4JKC A;  3OYL A;  2XY8 A;  1HYS A;  2HF3 A;  4C8N A;  1D9F A;  2D0B A;  3ITH A;  4YOV A;  1TK8 A;  4BQL A;  1TAU A;  1VSH A;  3O1W A;  4CZJ A;  1R0A A;  3LWL A;  2ZJR L;  4YOY A;  1GLD G;  3T1A A;  4K41 A;  5JLF A;  4CGJ A;  3ZEU B;  3OS0 A;  3FZH A;  3H6E A;  1BDG A;  3CCQ N;  4E7L A;  1OH5 A;  2ZF5 O;  3U9Z A;  4WQ5 C;  4F2R A;  4F4K A;  3PO4 A;  1K8K B;  2E6M A;  1HNW K;  1T6C A;  4QOZ B;  5C2D A;  3WXM B;  4B9V A;  4JKA A;  2Y1I A;  1HKC A;  2A41 A;  2OZS A;  4GMJ B;  3B6O A;  3OYG A;  3NVK A;  3SYZ A;  1NGC A;  3O4N A;  1S6P A;  3WEE A;  4HUF A;  2E8A A;  1RBR A;  3OYD A;  1IG9 A;  3Q7B A;  3DLH A;  4LF7 K;  2WUS A;  3T69 A;  4FJG A;  2ATQ A;  3KK7 A;  1RT7 A;  1J6Z A;  2ZGY A;  2JWL A;  1TGO A;  4CZE A;  4JYA K;  1NBW A;  4HCB A;  1YJ9 N;  3I0S A;  3L3V A;  3SLC A;  4NB4 A;  4A2A A;  1BI4 B;  3FZK A;  2YCH A;  2FSK A;  2E5L K;  2WBN A;  4BDZ A;  4CBX A;  5AZJ A;  4H0X B;  3RMC A;  3CCE N;  3HXM A;  3C0B A;  4AF1 A;  4ISF A;  3GG4 A;  4BR0 A;  4YOR A;  2O8F B;  4FWQ A;  3T19 A;  2Z1J A;  4FO0 A;  4OPJ A;  3THX B;  3QER A;  4CE9 A;  1SV5 A;  1NJY A;  2G8H A;  1RTJ A;  1BIS A;  1I39 A;  4H0V B;  3NH1 A;  3I8B A;  4FK2 A;  1RBT A;  1NGA A;  4JI7 K;  1B92 A;  1SL0 A;  3NVM A;  2HOE A;  5KPT A;  2XY5 A;  3O9U A;  5KI6 A;  3ZEU A;  3OW2 M;  1YAG A;  3AVJ A;  1FKO A;  1XUP O;  1C1A A;  4DQQ A;  3QBW A;  1KSP A;  4JRP A;  3THX A;  1NK4 A;  3BY5 A;  2CGJ A;  1WSI A;  4BRA A;  3AAP A;  3AVK A;  4ELT A;  3CCL N;  2HB5 A;  2VWB A;  3LM2 A;  3VEY A;  1J54 A;  4X62 K;  5AQS A;  4HUE A;  1QHT A;  2BTF A;  4FLU A;  3PV8 A;  3HSC A;  3HST B;  4N56 A;  2OCE A;  5ADX A;  4FLT A;  3TAN A;  2X74 A;  1S5J A;  2HNZ A;  4DLE A;  4HCC A;  4I6M B;  5D3G A;  4OX9 K;  1OVQ A;  4KI4 A;  2Z1G A;  3ENH A;  1DTQ A;  3R1X A;  3LWM A;  3S3O A;  3THW A;  1NGH A;  4RW9 A;  4W5N A;  1LWE A;  1BCO A;  2IIR A;  3SZ2 A;  5C15 A;  3KK2 A;  3DXK B;  4FVU A;  3NBP A;  1JLE A;  5BRE A;  3HPO A;  1HNZ K;  3SCX A;  3AVG A;  1SQK A;  4CJT A;  4AIL C;  3HVR A;  3OS2 A;  4ZHR A;  4PQU A;  3DLB A;  4O0J A;  2A3Z A;  3SMS A;  4FJX A;  3D45 A;  5HP1 A;  4CZI A;  1ZBI A;  1X9M A;  1N5Y A;  4N76 A;  3WNF A;  2YI1 A;  5JIC A;  4Z4G A;  1C0F A;  3AA2 A;  3P4I A;  1U47 A;  1GLB G;  4DV7 K;  1UA0 A;  5KQ8 A;  4FLW A;  3SI6 A;  2A5X A;  1VQN N;  4CI6 A;  2ETJ A;  1FW6 A;  4RW6 A;  1ESV A;  4FJJ A;  3T1Y K;  4Y1D A;  1QZ6 A;  1UA1 A;  1KXP A;  4O5B A;  3WNE A;  1KLM A;  4AM7 A;  4AQY K;  4DSJ A;  2HHQ A;  3AO2 A;  3RRG A;  4B3T K;  1XHZ A;  2P1J A;  1WOQ A;  3KHY A;  1W97 L;  2LSN A;  4HWI A;  4K25 A;  3VQA A;  5JS1 A;  2HVH A;  4BR4 A;  1N32 K;  1JL1 A;  5AQU A;  1CZB A;  2A42 A;  4O8U A;  3OBW A;  5CR4 A;  5DM7 L;  3TSU A;  4DTJ A;  3DLR A;  3LP3 A;  2VG7 A;  4M42 A;  4M63 C;  4B1Z A;  4KHW A;  4ID5 A;  4DU3 A;  3BF3 A;  1HJR A;  5I42 A;  5AQO A;  3ULE A;  4E89 A;  4RWT A;  4F3T A;  5AR0 A;  3CET A;  3CMA N;  4DMN A;  4DQR A;  5BPL A;  3GL1 A;  3SBT A;  1EXQ A;  4UY8 O;  3CJ9 A;  3LDO A;  1CXQ A;  2P9L B;  3CYM A;  4JKF A;  4KHN A;  4OPK A;  1HLU A;  5E84 A;  5M1K A;  4KI6 A;  4JKG B;  1LV5 A;  4C8M A;  4KPY A;  2YHW A;  4N5S A;  3DOK A;  1NKC A;  4DKW A;  4RW7 A;  3O1B A;  4C1N K;  3ASM A;  3RSE B;  3QO9 A;  3QFP A;  3TAR A;  4E7I A;  2EWS A;  4DSK A;  4E1J A;  1A5V A;  2E1Y A;  4JNE A;  3OJS A;  4EP4 A;  1OH7 A;  3LAN A;  1KLN A;  3B8A X;  1ZBL A;  3L2U A;  4CFB A;  3TAG A;  4DR3 K;  4PHT X;  4E1M A;  4FWP A;  4BR9 A;  4FPB A;  4EAH D;  4EZ6 A;  3S3M A;  3CCV N;  2BH1 A;  3VEZ A;  3KKR A;  4FOE A;  4B3S K;  3O9R A;  2IC3 A;  1CZ9 A;  4GW6 A;  4Z4I A;  2BUP A;  1DT9 A;  4CEQ A;  1NJX A;  3AY9 A;  4E0D A;  1IBL K;  3CC4 N;  3KTQ A;  4Z0U A;  5CZ2 A;  1LW0 A;  2DFF A;  4H03 B;  3CCM N;  4EZ9 A;  3EL2 A;  4IEI A;  4CHO A;  3L4Q A;  2KHO A;  4MLE A;  5C10 A;  3QIC A;  1S1W A;  2OPR A;  4H5W A;  4IG3 A;  3AO4 A;  3ZSR A;  3TTF A;  5J2N A;  4BRC A;  3NF8 A;  4CJL A;  2CH5 A;  3VQQ A;  4LF5 K;  3L8B A;  4F2S A;  2RF2 A;  3AV9 A;  3SUQ A;  4CZH A;  4BDY A;  3R6M A;  4WE1 A;  3A5M C;  4DS4 A;  3LL3 A;  3R3L A;  1S3X A;  4X66 K;  4C8O A;  3IMX A;  4G9Z A;  4JKG A;  1S9E A;  4CJF A;  4J2D A;  4NYF A;  1MA9 B;  3ENB A;  2HW3 A;  5AQG A;  3JAM O;  4XH5 A;  4JD2 A;  4JI2 K;  3MX5 A;  4KTQ A;  3C6U A;  1NNE A;  2G8K A;  4BAC A;  4CK2 A;  2J4R A;  4BRL A;  1JL2 A;  2DFE A;  3BZC A;  3MN9 A;  3VQB A;  2XO7 A;  3BP8 A;  1C1B A;  1KRP A;  4XIU A;  4CJV A;  1TAQ A;  2ITG A;  4NXN K;  4MDA A;  1Q18 A;  1V4S A;  3CD6 N;  3UKU B;  3AVL A;  2P9P B;  4DFP A;  4CF8 A;  1C6V A;  5SZT A;  3RMB A;  1G99 A;  4BRK A;  4F9O A;  3U3G A;  2PZS A;  1U04 A;  3V9W A;  3V6D A;  3HT3 A;  2GX9 A;  1NKE A;  5B8H A;  1N36 K;  4LY7 A;  3RMA A;  2VYP A;  3QET A;  5J2P A;  1XQS C;  4GVM A;  1ZBH A;  4A61 A;  3K5O A;  1GLA G;  2HMP A;  4BRM A;  4BRH A;  1H1V A;  3CPE A;  1P8Z A;  2P9K B;  5IWA K;  3ID8 A;  3PX4 A;  1IH7 A;  3LDS A;  4LH5 A;  4KHU A;  4B08 A;  1LOT B;  3A5N C;  3ATU A;  4FJ7 A;  3VEO A;  1KVA A;  1ATR A;  3RSE A;  4R79 A;  4O44 A;  5LMU K;  4DV0 K;  2AJQ A;  5CY4 A;  3LAL A;  1KD1 O;  3MDQ A;  1LW2 A;  3IG1 A;  3T3F A;  3MEC A;  4JEP A;  4FLZ A;  4KO0 A;  1Q7Y O;  4JK7 A;  3OYB A;  3M8P A;  4B9T A;  3P38 A;  1DGK N;  4PY5 A;  3OYE A;  2KQ2 A;  4FJH A;  3AA3 A;  4CEE A;  2ZWH A;  5DM6 L;  1GLF O;  3ZYY X;  1RTH A;  1RBU A;  3E66 A;  4CED A;  2KLA A;  1K73 O;  4ILJ A;  1S9G A;  5BRF A;  4DR6 K;  1W9H A;  2YJE A;  3K0S A;  5HRP A;  3DAW A;  2PFU A;  1DKG D;  2P5O A;  5A2Q O;  4BE0 A;  3V1R A;  4M7X A;  1HYV A;  1U49 A;  2BGG A;  2F96 A;  4IZ9 A;  4BWM A;  3C6T A;  1WBD A;  1U48 A;  1WSH A;  4LFC K;  4IOC L;  2GBZ A;  3HL8 A;  1YI2 N;  3K57 A;  1FK9 A;  1X3M A;  4FWS A;  3F73 A;  3CQY A;  4IJN A;  2V52 B;  1KC8 O;  3ZLJ A;  2PYJ A;  3HI0 A;  3R8E A;  3MN6 A;  1B9D A;  3CME N;  3K2P A;  1T03 A;  3AAR A;  2KKZ A;  3O3G A;  2JWK A;  3C65 A;  3MEG A;  1ZBS A;  1TUY A;  4B1W B;  1JLQ A;  3MAQ A;  3QB0 A;  1OH6 A;  1C1C A;  5J1E A;  3KJV A;  3WXL A;  2P9N A;  4DF4 A;  3HRG A;  2EX3 A;  2E2Q A;  2OAN A;  3HM9 A;  1L5U A;  4CJQ A;  5F1X A;  3EO3 A;  1NOY A;  3PIP L;  3N4Q A;  1YT3 A;  4KTZ A;  2A1S A;  5EY4 A;  5DMR A;  4CZK A;  3GBT A;  3PUF A;  4Z94 A;  3K58 A;  1EQY A;  4N47 A;  1DLO A;  3QEP A;  4FL9 A;  1QSY A;  1S1T A;  3V9S A;  5FLX O;  4JI3 K;  4JV5 K;  2B4J A;  3HM8 A;  2RN2 A;  4CK1 A;  2XY6 A;  3CI5 A;  3VF6 A;  4NO7 A;  1D8Y A;  1BUP A;  3F9M A;  1NGB A;  2QWO A;  4LFB K;  1XNR K;  2PYL A;  4GV3 A;  1RDU A;  2HHW A;  3VMF B;  1NGF A;  4ZTJ A;  1VAZ A;  3IRX A;  5KTQ A;  3KD5 E;  3VA3 A;  4JS5 A;  2QTD A;  3WXK A;  5BR9 A;  3KLG A;  1RNH A;  2QWL A;  4ISE A;  2OYQ A;  5AQW A;  3K5M A;  3J7Y P;  4IKF A;  3H46 O;  3QNN A;  3CFP A;  2Y1J A;  4FSV A;  1JLG A;  4Q5V A;  3TSQ A;  5AQM A;  4DSE A;  4M3T A;  1WAJ A;  3RR8 A;  3A5L C;  1Q81 O;  3DMJ A;  3HVT A;  2GEM A;  5FPM A;  2YV0 X;  4M41 A;  3WNG A;  3A8Y A;  4GY2 B;  4DR7 K;  1LCU A;  2GWJ A;  1S1U A;  3NH2 A;  2P9N B;  3I33 A;  3DXK A;  1V4T A;  2OA8 A;  5AQX A;  4Y0W A;  3KKS A;  1NGD A;  2HBM A;  5HL7 L;  3E9L A;  4JI0 K;  4DV3 K;  2HMI A;  1GLJ O;  1HPM A;  1X9S A;  5EU7 A;  4I2Q A;  4MQ3 A;  3J8A A;  4KAZ A;  2IVO A;  2H3G X;  3OBY A;  4M45 A;  4ZTF A;  3A0I X;  3D7E O;  1RT6 A;  1BA1 A;  2YHX A;  3AVC A;  4FZY A;  2F9T A;  4DQI A;  4DR4 K;  5AQV A;  4H5V A;  4RW4 A;  4JKE A;  2G8U A;  1EO1 A;  4HUG A;  4JAX A;  1CXU A;  2NUB A;  1EX4 A;  5AZI A;  4JLH A;  3E01 A;  3QEI A;  2FC0 A;  3TR8 A;  1A5X A;  1BG3 A;  4H5T A;  2HHT A;  4CHQ A;  3TAF A;  2GWK A;  3VTH A;  1HKG A;  2VQF K;  1BGX T;  2GUI A;  3SQ1 A;  1T05 A;  1LWF A;  1WNS A;  3CJB A;  1XMO K;  1SL1 A;  2Q31 A;  4JK9 A;  4FJ5 A;  1YJW N;  1QSS A;  3O4W A;  4BR2 A;  1FJG K;  5CYM A;  5AFU H;  4M3W A;  4B1V A;  2XRI A;  1VHX A;  1QSL A;  1IKY A;  1VRU A;  3ZT3 A;  3IFR A;  3WNH A;  1X9W A;  3CFO A;  2IOC A;  2YX6 A;  2HBJ A;  2O8D B;  3LPU A;  4G1Q A;  5BPM A;  1P90 A;  3EE9 A;  2RKI A;  1HKB A;  3LP2 A;  3C94 A;  3ULE B;  3ENO A;  1SUQ A;  4OPA A;  3SV3 A;  5BR8 K;  4DTP A;  1YTA A;  3VQ5 A;  4FWL A;  3ALY A;  3VQ9 A;  3G71 N;  4GV6 A;  3JYT A;  4B3R K;  1YIT N;  3ZX2 A;  1ASW A;  4FWR A;  2O8B B;  4NLC A;  4IO8 A;  4TSX A;  1L3U A;  4MFB A;  2V7Z A;  3MXI A;  1VQO N;  3GOI A;  2FSN A;  2IAJ A;  2NRT A;  4HVJ A;  2HST A;  4RCH A;  3DLK A;  2Q3S A;  4DTR A;  3FR0 A;  1HQU A;  1ZXO A;  3LM9 A;  1IBK K; 
#chains in the Genus database with same CATH homology
 4KI6 A;  2HHX A;  1U47 A;  4W5Q A;  1LV5 A;  4C8M A;  3VQD A;  4Q0B A;  3L2V A;  3L2R A;  4KPY A;  4N5S A;  3B6P A;  3DOK A;  1NKC A;  2R7Y A;  2F8S A;  4RW7 A;  5HBM A;  2IGI A;  4FZX C;  1SKR A;  2X6N A;  3ASM A;  1NJW A;  2G8K A;  3SV4 A;  3QO9 A;  3TAR A;  3G10 A;  3DYA A;  5E41 A;  4E7I A;  4DSK A;  1MU2 A;  1EKE A;  4O4G A;  5CYQ A;  5FRO A;  4CGI A;  1A5V A;  3OJS A;  5HRO A;  1EP4 A;  1KVB A;  1HRH A;  4O55 A;  4EP4 A;  3LAN A;  5DK5 A;  4DG1 A;  4QAG A;  1KLN A;  4PUO A;  4CEF A;  1L3T A;  3NDK A;  4B9M A;  3DI6 A;  4DTN A;  1ZBL A;  3MXM A;  1F21 A;  3DLG A;  3O4Q A;  4AHT A;  4CFB A;  3L2U A;  3TAG A;  4O0I A;  3S3N A;  3RWU A;  1WLJ A;  4DF8 A;  4KRE A;  1UWB A;  4E1M A;  1VSM A;  1KFD A;  4LSL A;  3VQ8 A;  4FCY A;  3ISN C;  1U4B A;  4EZ6 A;  4FXD A;  3RTV A;  3S3M A;  3OYN A;  2XY7 A;  3KKR A;  3PX6 A;  1TL1 A;  4CJ4 A;  5KGX A;  3P1G A;  2G8I A;  4I9L A;  2VG5 A;  3ZT4 A;  3BGR A;  3OJU A;  4FJ8 A;  2IC3 A;  1CZ9 A;  4GW6 A;  4Z4I A;  1FKP A;  1BQN A;  1Q8I A;  1LAW A;  4CEQ A;  1NK9 A;  1NJX A;  1BL3 A;  3ZT0 A;  4E0D A;  1WAF A;  4DU4 A;  2BE2 A;  3NFA A;  2Z1H A;  2OPP A;  1RT3 A;  4Z0U A;  1NJZ A;  3KTQ A;  3HP9 A;  1LW0 A;  2DFF A;  1RDA A;  3AA5 X;  3G0Z A;  2JGU A;  3MEE A;  5CZ2 A;  4CHO A;  3V9X A;  4EZ9 A;  4K8X A;  3OYC A;  4HTU A;  4H4M A;  4BE1 A;  3HJF A;  1J9A A;  4CCH A;  2WON A;  4KHQ A;  4E7H A;  3K5L A;  3VA0 A;  1S1W A;  2OPR A;  4IG3 A;  3AO4 A;  3ZSR A;  2KZM A;  3LPT A;  5J2N A;  2IDO A;  3NF8 A;  4CIF A;  2G8F A;  1JLA A;  4LSN A;  3U6F A;  1DTT A;  4CJL A;  2IS3 A;  3DRS A;  3VQ4 A;  3VQQ A;  4B8C A;  3KIO A;  1D9D A;  4CEC A;  2QKB A;  1VSE A;  2A1R A;  1VSL A;  4JRQ A;  3L8B A;  4CF9 A;  4RG8 A;  3CQ8 A;  4E7K A;  1RT1 A;  1TVR A;  3ZT2 A;  3NH0 A;  4F2S A;  3VQE A;  2RF2 A;  3AV9 A;  3SUQ A;  4W5R A;  4ELU A;  4B9S A;  3AVM A;  4I2P A;  3SJJ A;  1HQE A;  4BDY A;  3L3U A;  4WE1 A;  4CJK A;  1K6Y A;  3NF9 A;  4DS4 A;  3BDP A;  1BHL A;  1C0M A;  2HNY A;  4DS5 A;  4C8O A;  3AVN A;  3V4I A;  5J2Q A;  4KB1 A;  5FRM A;  1BCM A;  1S9E A;  4CJF A;  1SKS A;  4J2D A;  1S6Q A;  4NYF A;  3OY9 A;  3TWH A;  3U3Y A;  2KTQ A;  4R5P A;  4FM0 A;  2YKN A;  2YHA A;  4CGD A;  1T8E A;  1Z25 A;  5I3U A;  2HW3 A;  3L2W A;  3V81 A;  1TK5 A;  1TKT A;  4OVL A;  3VQ7 A;  3M8S A;  1VSK A;  2O4G A;  4UQG A;  4W5O A;  1U45 A;  3MXJ A;  1B9F A;  4OJR A;  4B8A B;  4KTQ A;  4CEB A;  3C6U A;  3VQ6 A;  3NE6 A;  3KLI A;  1D5A A;  2EHG A;  4CK2 A;  4BAC A;  1JL2 A;  2DFE A;  3LP0 A;  1BI4 A;  3VQB A;  4CK3 A;  2XO7 A;  3PO5 A;  4M3X A;  5FRN A;  1C1B A;  4KKO A;  3K59 A;  1KRP A;  4CEZ A;  4XIU A;  2OZM A;  3DOL A;  4FVM A;  4CJV A;  4M3R A;  1TAQ A;  2ITG A;  4DFJ A;  4KHS A;  1VK0 A;  4JS4 A;  4F8R A;  3RMD A;  4Z4H A;  3HYF A;  3ZSY A;  3M8R A;  2O4I A;  4DFM A;  3UIQ A;  1CLQ A;  2OPS A;  3NAE A;  1YTU A;  5KRT A;  1HNI A;  4DTS A;  4KHY A;  3AVL A;  3NF7 A;  3SPZ A;  2QKK A;  4DFP A;  4CF8 A;  1C6V A;  1VSD A;  4OLA A;  4W5N A;  5SZT A;  1XI1 A;  4HHT A;  3RMB A;  3U3G A;  4M3U A;  2PZS A;  3SPY A;  1T7P A;  3ZT1 A;  1U04 A;  4AHU A;  3V9W A;  4CIG A;  3V6D A;  5KGW A;  3HT3 A;  3OYH A;  1NKE A;  1NOZ A;  3SQ2 A;  1RTI A;  4CFD A;  3PX0 A;  2E6L A;  4LY7 A;  5J2M A;  1RDC A;  3RMA A;  4ID1 A;  1GOA A;  2YNF A;  1TV6 A;  3VQP A;  5J2P A;  3QET A;  3QEV A;  4NCA A;  4KAZ A;  4GVM A;  4KB0 A;  1ZBH A;  3NHG A;  3K5O A;  1O1W A;  1JLB A;  3AO1 A;  2DTU A;  3AVI A;  1ZBU A;  5FDL A;  1X1P A;  2PY5 A;  1JLC A;  1TKZ A;  4J2B A;  4FLY A;  4N41 A;  4BWJ A;  2F8T A;  3S9H A;  4OGC A;  3PX4 A;  1EET A;  1IH7 A;  1JXE A;  4LH5 A;  4YNQ A;  4B08 A;  3LDS A;  3OVN A;  4KHU A;  3L2Q A;  4FJ7 A;  2VG6 A;  1HNV A;  1KVA A;  3DRP A;  1WN7 A;  5SWM A;  4CEO A;  4CHN A;  4OKK A;  4FM2 A;  3I8D A;  3SUP A;  4IBN A;  3AVH A;  4O44 A;  4KV8 A;  4CJW A;  1IO2 A;  1ITG A;  3NF6 A;  2AJQ A;  5CY4 A;  4KTW A;  3LAL A;  4FYD A;  1LW2 A;  3IG1 A;  1NKB A;  3T3F A;  2X78 A;  4AHV A;  4E7J A;  3MEC A;  3KK3 A;  3O3F A;  4FLZ A;  2P51 A;  4H4O A;  4KO0 A;  4DSF A;  1NK0 A;  2G8V A;  3NGI A;  3OYB A;  3M8P A;  3VN5 A;  4B9T A;  1ASU A;  3HK2 A;  1WSG A;  4AHS A;  4PY5 A;  5T7B A;  3OYE A;  1A5W A;  2I5J A;  2KQ2 A;  3AA3 A;  4CEE A;  3PY8 A;  4F3O A;  1Y97 A;  4FJI A;  3I0R A;  3SUO A;  2KZZ A;  4OLB A;  1J5O A;  4CGG A;  1G15 A;  3QES A;  1Q9X A;  1RTH A;  1REV A;  5C42 A;  4CJR A;  1RBU A;  3NCI A;  3AO3 A;  3LP1 A;  3OYL A;  3SQ4 A;  4CED A;  2D5R A;  2XY8 A;  1HYS A;  3DM2 A;  4C8N A;  1S9G A;  4DU1 A;  2OPQ A;  1D9F A;  2D0B A;  3ITH A;  1W9H A;  1S1X A;  3M8Q A;  4CGH A;  4CIE A;  5HRP A;  1TK8 A;  3AVA A;  3KD1 E;  1TAU A;  1VSH A;  4K8Z A;  3SUN A;  2P5O A;  4PA1 A;  1RDD A;  1YVU A;  3V1R A;  3LWL A;  3O3H A;  4BE0 A;  1R0A A;  3T1A A;  3VQC A;  1HPZ A;  1HYV A;  3IS9 A;  4DTM A;  3QIN A;  1U49 A;  2G8W A;  4Y1C A;  2F96 A;  1VRT A;  2BGG A;  4BWM A;  1UOC A;  3LAM A;  1NK7 A;  4J2A A;  3C6T A;  4CGJ A;  1U48 A;  1WSH A;  3OS0 A;  4FJL A;  1KVC A;  3LZJ A;  2GBZ A;  3HL8 A;  3QNO A;  4ELV A;  4BDP A;  1TKD A;  4E7L A;  3K57 A;  1FK9 A;  4IDK A;  2YKM A;  4F2R A;  4F4K A;  3ZSX A;  3ZSO A;  3PO4 A;  4CJP A;  3F73 A;  2E6M A;  3V1Q A;  4CJS A;  5JS2 A;  2HHU A;  4QOZ B;  4FW1 A;  1TL3 A;  2D0C A;  1KTQ A;  2QK9 A;  4B9L A;  2W42 A;  4B9V A;  1UAX A;  2Y1I A;  3OYF A;  3HPH A;  2PYJ A;  4CJ3 A;  2OZS A;  3LZI A;  4GMJ B;  3B6O A;  3OYJ A;  3OYG A;  3AO5 A;  4FJK A;  3SYZ A;  1B9D A;  4Z4C A;  4CF1 A;  3K2P A;  4DTU A;  3O4N A;  1JLF A;  1T03 A;  1S6P A;  2JLE A;  4HUF A;  1BIZ A;  3O3G A;  3MEG A;  1RBR A;  3OYD A;  1IG9 A;  3DLH A;  2ZD1 A;  1JLQ A;  3MAQ A;  3KLF A;  1C0U A;  3DRR A;  1C1C A;  2YNG A;  2ATQ A;  2KW4 A;  5J1E A;  3KJV A;  4FJG A;  4Z4E A;  2ZQB A;  4CFC A;  4DTO A;  1RT7 A;  2XHB A;  4DF4 A;  1FXX A;  4YFU A;  2EX3 A;  1TGO A;  3MED A;  3EY1 A;  2KFZ A;  3HM9 A;  4NCB A;  1L5U A;  4CJQ A;  4E1N A;  1NOY A;  4HCB A;  3I0S A;  3L3V A;  1YT3 A;  4KTZ A;  2A1S A;  1BI4 B;  3V1O A;  5DMR A;  2QXF A;  4DTX A;  1BIU A;  3ZSZ A;  3PUF A;  4B9U A;  4BDZ A;  3K58 A;  4FK4 A;  3TAP A;  2YNH A;  3RMC A;  1NK5 A;  3AVF A;  3HXM A;  2DY4 A;  4N47 A;  3HPG A;  4CHZ A;  1DLO A;  1IKV A;  4CGF A;  1WSF A;  3QEP A;  1QSY A;  1S1T A;  4B9N A;  3T19 A;  3V9S A;  2Z1J A;  3SQ0 A;  1QS4 A;  2FBY A;  3CG7 A;  2B4J A;  4OPJ A;  4L8R B;  4FZZ A;  3AA4 A;  3OYA A;  4NYN A;  5KRS A;  3QER A;  2RN2 A;  4CE9 A;  4CK1 A;  5HRS A;  2XY6 A;  1SV5 A;  1ZYQ A;  1NJY A;  1JXB A;  1RTJ A;  1L3V A;  1BIS A;  1I39 A;  3NH1 A;  1D8Y A;  2G8H A;  2HHV A;  3IAY A;  4DQP A;  4FK2 A;  1RBT A;  3CM6 A;  1B92 A;  4BE2 A;  2FBV A;  1SL0 A;  2XY5 A;  1GOB A;  1RDB A;  2PYL A;  2X6S A;  3P83 D;  5KI6 A;  3AVJ A;  3LAK A;  1FKO A;  2HHW A;  1J53 A;  4ZTJ A;  2BAN A;  2WOM A;  3IRX A;  1C1A A;  1ZBF A;  2YNI A;  5KTQ A;  4DQQ A;  3VA3 A;  4JS5 A;  3KD5 E;  1IKX A;  4LH4 A;  3HP6 A;  4JRP A;  1KSP A;  4FLV A;  3KLG A;  1NK4 A;  1RNH A;  2OYQ A;  5K14 A;  3K5M A;  3QIO A;  4DQS A;  4IKF A;  3HO1 A;  1WSI A;  1IKW A;  1KFS A;  3AVK A;  3F9K A;  4ELT A;  3QNN A;  2HB5 A;  3CFP A;  5CZ1 A;  2Y1J A;  4QCL A;  4OKE A;  1JKH A;  4AHC A;  3D0P A;  4E3S A;  1J54 A;  1JLG A;  3THV A;  4Q5V A;  1QHT A;  4HUE A;  3H08 A;  3TAM A;  4FLU A;  3PV8 A;  4I9Q A;  3HST B;  4FK0 A;  1GOC A;  4AH9 A;  4DSE A;  4N56 A;  1XC9 A;  4M3T A;  3V9Z A;  1Z26 A;  1WAJ A;  3RR8 A;  3DMJ A;  3HVT A;  4FLT A;  2YV0 X;  3NGY A;  2X74 A;  4M41 A;  3AVB A;  2GV9 A;  3WNG A;  3TAN A;  1S5J A;  4DSI A;  2FBX A;  2HNZ A;  4DLE A;  4HCC A;  3CM5 A;  5D3G A;  4AHR A;  1S1U A;  3NH2 A;  4B3O A;  1RT4 A;  4KRF A;  2OA8 A;  1VSJ A;  5C25 A;  3KKS A;  4KI4 A;  4CJU A;  1RT2 A;  4DWI A;  3C95 A;  2Z1G A;  3OS1 A;  1RT5 A;  2HMI A;  1DTQ A;  4CJE A;  3LWM A;  3S3O A;  2Z1I A;  1X9S A;  5EU7 A;  4I2Q A;  4MQ3 A;  1HMV A;  3QIP A;  4RW9 A;  4IG0 A;  2D0A A;  1LWE A;  1RCH A;  1BCO A;  1WSE A;  2FBT A;  4NCG A;  4CHP A;  1I3A A;  3SZ2 A;  4IFV A;  3KK2 A;  4DSL A;  2B6A A;  2BDP A;  2HHS A;  3NBP A;  3JSM A;  3RR7 A;  1JLE A;  4ICL A;  4M45 A;  4CF0 A;  4ZTF A;  3HPO A;  1RT6 A;  2HVI A;  4FLX A;  3AVC A;  3AVG A;  3SCX A;  4DQI A;  4FZY A;  4CJT A;  4AIL C;  4FJN A;  2DFH A;  3HVR A;  4FM1 A;  5HRN A;  4J2E A;  4RW4 A;  4OGE A;  4ZHR A;  3OS2 A;  2G8U A;  4PQU A;  4OKJ A;  3OYK A;  4O0J A;  4HUG A;  3DLB A;  1CXU A;  2NUB A;  3EYZ A;  1EX4 A;  3QLH A;  4FJX A;  1RBV A;  1L3S A;  3DLE A;  1ASV A;  4JLH A;  3E01 A;  3D45 A;  5HRR A;  4RW8 A;  5HP1 A;  1RBS A;  3QEI A;  2FC0 A;  3TR8 A;  1A5X A;  1ZBI A;  4CHY A;  3OYM A;  1X9M A;  1C0T A;  1XWL A;  4FJ9 A;  1N5Y A;  2HHT A;  4N76 A;  3WNF A;  3ZSQ A;  4CHQ A;  3TAF A;  1NK6 A;  4CJ5 A;  4Z4G A;  4FJH A;  1TK0 A;  3AA2 A;  1BGX T;  1RIL A;  2GUI A;  3ZSV A;  3FFI A;  2HND A;  1LWF A;  1WNS A;  4DFK A;  3SQ1 A;  1UA0 A;  5C24 A;  4I7F A;  4FLW A;  3RRH A;  3SI6 A;  1SL1 A;  4FJ5 A;  1QSS A;  1NK8 A;  5CYM A;  4CES A;  4M3W A;  3EZ5 A;  2XRI A;  5HLF A;  3ZSW A;  1QE1 A;  3A2F A;  2ETJ A;  1IKY A;  1VRU A;  3ZT3 A;  4RW6 A;  1QSL A;  2ZE2 A;  1QTM A;  3WNH A;  1X9W A;  3CFO A;  4FJJ A;  2IOC A;  4Y1D A;  4CF2 A;  1LWC A;  1RTD A;  3ZCM A;  3LPU A;  4G1Q A;  3TAB A;  1UA1 A;  3WNE A;  4O5B A;  3OYI A;  1KLM A;  4DLG A;  3P5J A;  4DSJ A;  4FJM A;  4Z4F A;  4CEA A;  2HHQ A;  2RKI A;  3AO2 A;  4W5T A;  3RRG A;  3LP2 A;  1HYZ A;  1W0H A;  2RPI A;  3C94 A;  1XHZ A;  2P1J A;  2VWJ A;  1SUQ A;  2LSN A;  2B5J A;  3VQA A;  3SV3 A;  1T05 A;  4CER A;  1S1V A;  2HVH A;  1Q9Y A;  4FW2 A;  1VSF A;  5JS1 A;  4DTP A;  1JL1 A;  1VSI A;  1CZB A;  1YTA A;  3VQ5 A;  3VQ9 A;  3ALY A;  4E19 A;  4H8K A;  3SNN A;  3JYT A;  4LD0 A;  4M3Y A;  4KFB A;  4DTJ A;  3TAE A;  1ASW A;  3DLR A;  1XHX A;  2E4L A;  4M3Z A;  3LP3 A;  4PWD A;  3QEW A;  2VG7 A;  4M42 A;  3KLE A;  4KHW A;  4ID5 A;  4DU3 A;  3K5N A;  1HJR A;  5I42 A;  4E89 A;  3NGZ A;  3KK1 A;  3V9U A;  1BQM A;  1SL2 A;  4F3T A;  4TSX A;  4C8K A;  1L3U A;  4DMN A;  4C8L A;  1LAV A;  4MFB A;  4DQR A;  3TAQ A;  3MXI A;  3CFR A;  1N6Q A;  2YHB A;  1WSJ A;  1SKW A;  4IFY A;  1EXQ A;  4CFA A;  3ULD A;  2IAJ A;  3QEX A;  2VWK A;  4HVJ A;  3KLH A;  3DLK A;  3TI0 A;  2Q3S A;  2P5G A;  1KCF A;  4DTR A;  3CYM A;  1CXQ A;  1QQC A;  4EP5 A;  1HQU A;  4KHN A;  4OPK A;  1TKX A;  2KFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...