5C24A

Crystal structure of hiv-1 reverse transcriptase in complex with 7-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8-dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
537
structure length
537
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPAKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
total genus 151
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c24A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c24A05
4KFBA 2W9CB 3CFRA 3TABA 3KHGA 3OYFA 1IKYB 4DTOA 2B6AB 2QV6A 3D28A 4DSFA 4CF8A 1TL3A 3T19A 5HRPA 4F3OA 5HRNA 4NCGA 2KFZA 3LWMA 2UVWA 4B9VA 3CFPA 3QNNA 4H8KA 3OYLA 3IAYA 4N76A 2D3UA 3MXMA 4TYAA 1NJZA 3V1OA 2ZE2A 5KG0A 4IFVB 4RW7B 3HP9A 1JXBA 3SYZA 4K8ZA 2RKIB 3AVGA 3OLAA 3DLKB 1HYSB 1W9HA 4TY8A 3MR2A 4AHCA 1KVAA 4ED1A 1VSEA 3NF8A 1BGXT 4OPKA 2HMIB 2DFHA 5KG3A 4CJ5A 4RW4A 4RNMA 3RB4A 5FRMA 3NKYA 4Q45A 3KLFA 1NOYA 4MIAA 4N47A 1R0AB 3KLGA 2AX1A 5KFMA 4EBDA 4O44B 4EBCA 2VG5B 2G8IA 1GOBA 4IH6A 2OPSB 3QINA 2IC3B 2I5JB 3LDSA 5EUHA 3MR5A 2E9RX 1JXLA 1VSJA 1JLAB 3HKWA 3NCIA 5DQIA 3WNHA 1XI1A 4E3SA 5KFFA 4J2DA 3U3GA 3SUPA 1CXUA 1JLFA 2O4GA 4FCYA 4FS1A 1S1XA 2FLPA 4J9MA 2R8IA 4KTQA 4KI4A 1DTQA 3O4QA 4MIBA 4CECA 1TK0A 1JKHA 1S97A 1B9DA 5DG7A 4JLHA 3SFGA 4Q8FA 2WONB 4TN2A 3GILA 1NK9A 1NHVA 3QEIA 4CJSA 4IH5A 4QWEA 2FBTA 2C28A 5F8IA 1Z25A 4ELTA 5F8LA 3H40A 1RBUA 1LWFA 2D3ZA 1S6PA 1IKVA 1N4LA 2C2DA 4F4WA 3SZ2A 4ECQA 4O5BA 1J5OB 1RT6B 2R8KA 4FBUA 3LZIA 3TARA 3OJSA 4M3XA 4M3RA 4R0EA 3DLGB 4FLWA 4UQGA 1NK6A 4E0DA 1QE1B 2HNYA 2FVPA 1TVRB 3NGYA 4Z0UA 4ID5B 4RW6B 4CF2A 2IM0A 3RB6A 5J2QA 2HNDB 4DL4A 3AVFA 4BACA 2ZKUA 1RBVA 1S1UB 4FLVA 4ZVHA 4DTJA 1S1WA 2D0AA 3MECA 4CEDA 4IFYB 5SZTA 4FJ9A 3ZT1A 4Y34A 5FDLA 4Y3CA 4CEZA 4JS5A 4EO6A 4ED7A 4QAGA 2DFFA 4FW1A 1HMVA 3SQ4A 1D9DA 4ZP8A 4NLWA 1RYSA 1CZBA 4HYKA 4DQQA 4XO0A 1RBRA 1FKPB 4B9MA 1T03A 3CDWA 1Z4UA 2IMWP 3CJ0A 3KLEA 2WB4A 4Q8EA 4RG8A 4DL3A 3KLHB 2W9AA 2YNFA 3NHGA 4ECUA 3DLHA 1HQEA 4RNNA 4MKBA 4BE0A 2HHWA 1D0EA 5I42B 4IKFA 4FM2A 3MEDB 2V4RA 1KCFA 4YFUA 4ZTFA 4AHVA 4OLBA 4CERA 1L3UA 2G8HA 4KTZA 2XY5A 3PO5A 1LV5A 2AQ4A 3UQSA 1LWCB 2B4JA 1NOZA 4KB0A 4CIFA 3BSOA 4JV1A 2G8UA 3VQ6A 3QETA 4ECXA 3KHLA 3KK1A 3PZPA 3CJ4A 1KHVA 2A1SA 4M41A 3GV8B 5C42B 3DLBA 2JEJA 5C5JA 4O3PA 2IAJA 3ZSRA 2XCAA 2GIRA 1RAJA 3P1GA 3PR5B 3S3NA 4KKOB 3C6TB 1BQMB 1SUQA 3V4IA 1A5XA 3V9ZA 1S9GA 1HNVB 1JIHA 3S9HA 4J9SA 3EZUA 5JS1A 2F8EX 2IOCA 5KTQA 3KKSA 4WYWA 3DRRB 5J1EA 4Z4FA 3VQ8A 4MFBA 4DLGA 2F8TA 3ZSZA 4ZHRA 3NBPA 4HVJA 2IM3A 3UPFA 1JLCB 2FBVA 2YNHB 2XRIA 3ISND 1MMLA 2FVRA 4Y2CA 1RTIB 1U45A 4CFCA 3V81A 4F4KA 3G6XA 3MTKA 4J2BA 2FJXA 5CYQB 5HLFB 3IGVA 4F4ZA 4CGDA 3CJ2A 4B3OB 4FZZA 3NE6A 3H98A 1T7PA 1I3AA 2NUBA 1TKTA 1BQNB 2HHXA 3E51A 2R2TA 3NGZA 3H5SA 2VG6B 4CHQA 1KSPA 2VG7B 3SV3A 4CGJA 3SJJA 4DG1B 3DOKA 4KRFA 3CJ5A 3SQ1A 1KFDA 3QYYA 2PZSA 2V9WA 1FKOA 3FQLA 2WK4A 4CGHA 3EPIA 4K50A 3H2LA 3ZSOA 4I2PA 4N5SA 1RT1B 3DI6B 3FFIA 4YMEA 1EP4A 4NLGA 3N6NA 3SUQA 4KHMA 4XIUA 3HSTB 4EO8A 5KRSA 4NLPA 1RNHA 1TL1A 3AO4A 5HP1A 3RBEA 5CYMA 3VQBA 5KFIA 5EWFA 4M3TA 4O3QA 2YKNB 4LD0A 4IDKB 4KHSA 1KLMA 1CSJA 3V9SA 4DTXA 1T05A 3OHBA 3OYCA 2WCXA 4BE1A 2OYQA 4DEZA 1HYZA 3M8PA 1S9EB 4TYBA 3C6UB 1RDCA 2FVSA 4H4MA 2Z1IA 4FJ7A 5F8NA 1XWLA 4WYLA 4IG3B 2J6UA 2E6MA 2JEFA 3LPUA 4B08A 2W9CA 3OYHA 3HPOA 5L1JA 4DMNA 4Y2AA 4ED3A 3I5CA 4NLYA 4IQXA 4IKAA 1XHZA 1IKYA 4DQRA 2B6AA 4DS4A 4OPJA 3LANA 3KK3A 3CQ8A 4BWJA 3V1RA 1RDAA 4M94A 1N5YB 4N41A 3SCXA 1LW2B 1ASUA 3KTQA 1L3SA 3BGRB 3LALA 4RW7A 1C1BB 2RKIA 1WNSA 1HRHA 2YHAA 2GIQA 3DLKA 4NLSA 1S0OA 5HBMA 3AVAA 1S4FA 5KFTA 3NGIA 3AV9A 4LQ3A 1BCOA 1RTHB 2HMIA 3E01B 1JLBB 3Q8PB 4F4XA 2OZSA 3I0RA 3LP2B 1T3NA 3EY1A 4FS2A 3JSMB 2QK9A 1R0AA 2FC0A 3TR8A 3HJFA 3P5JA 4O44A 5HROB 3K5LA 1QUVA 1X9WA 2VG5A 4LSNA 4DSKA 5F9LA 3MR3A 5KFOA 1L3VA 2ILZA 1C1CA 3RR8A 1RT7A 4EEYA 3M9OB 3F9KA 3L2WA 2IC3A 2I5JA 4J9OA 4DQIA 3RRGA 5DMRA 1JLAA 4OVLA 3K5MA 3BSCA 2IA6A 1LAVA 3KHHA 4Z4GA 4JRQA 3MAQA 5KFQA 2HVIA 3SPZA 3PHEA 4OKJA 4DFKA 3PX4A 4IH7A 3OVNA 3AVMA 3DMJB 4M3ZA 2HWHA 1XC9A 4ZVEA 4KB1A 3G6VA 4KHUA 4KHRA 1DTTB 3QLHB 3JYTB 2IDOA 4DU4A 5KG4A 2HAIA 3GIIA 2WONA 2ASLA 1C0TA 5KFNA 1RTJB 2FJVA 4W5NA 4ED0A 4F8RA 3TWHA 4IRCA 3OYAA 3RTVA 4W5RA 1Y97A 3AA3A 1U4BA 1RT2B 5EU7A 2AGPA 4CK3A 4ZVGA 3OL6A 3B6PA 4CJKA 3CIZA 3ZSWA 1J5OA 1RT6A 1K6YA 3I5BA 5KFWA 1D1UA 3CDUA 4DSJA 2RF2A 2R8HA 1ASWA 2BE2B 4DTPA 4J2AA 5KFCA 3DLGA 5KFGA 3AVBA 1WAFA 5F8MA 1QE1A 1RDDA 4EYHB 1TVRA 1S1VB 4K4WA 3LPTA 3LAMA 4ED6A 3NFAA 5KFBA 2ALZA 2HNDA 4QWDA 3MF5A 3OHAA 4O55A 3O3FA 1K1SA 4BWMA 4M3UA 2XHBA 2R2SA 1JXEA 4NYNA 3DDKA 2D0BA 5T7BA 4IFYA 3TQ1A 1TV6B 3G10A 2PYLA 3V1QA 2W7OA 3QGIA 3V6KA 4IOBA 4NYFA 5J2MB 3OS1A 4DFJA 4CEAA 3RRHA 4NRUA 5KFLA 4ECSA 2D7SA 4QW9A 4K4TA 3OL9A 3EPGA 3OYNA 1TKDA 2IS3A 1FKPA 1GX6A 3KHRA 4F50A 2BQ3A 3QO9B 2OH2A 3KLHA 1BI4A 4KO0B 2KFNA 5K14B 3DYAB 3OLBA 1S1TB 5I42A 3MEDA 1KRPA 2XO7A 4EYIB 3PW2A 2OPQB 5CY4A 4FLXA 1TK5A 3KD5E 1LWCA 2CKWA 4ED2A 4J9LA 4PWDB 1SH2A 3QZ8A 2XGQA 1NK7A 5C42A 5KFHA 2HWIA 2GV9A 4E7LA 3CDEA 4MQ3A 3RR7A 4OKKA 4XPEA 3LP0A 1WSIA 3K57A 4I7FB 3OYBA 3KJVB 1YTAA 1U47A 4KKOA 3Q8RB 1W0HA 1QSSA 1RT5B 1S0NA 5SWMA 1KLNA 1HNVA 4CF0A 4YR2A 2Y1JA 3PJXA 1L5UA 1BISA 4EZ9A 1NHUA 3H59A 5JXSA 4TXSA 5DK5A 1JLQA 3GQCA 1ZBLA 3D0PA 3DRRA 3DRPB 4MK7A 4E7KA 3BSAA 3H5YA 3RAQA 4ELVA 5KT2A 4ECRA 4F2SA 4KE5A 3LP1B 3C95A 2DPIA 3KIOA 1JLCA 4CJVA 2YNHA 3M8SA 4NLTA 1RT3B 1IKXB 2BANB 2W42A 3OYDA 2IM2A 4KREA 2YHBA 1JLGB 5CYQA 5HLFA 3S3OA 3B6OA 4Z4HA 4JV0A 4B3OA 3U3YA 4LSLB 1X1PA 1TAQA 4ECTA 1NJYA 1W25A 4DSLA 1J9AA 2VG7A 1LWEB 4DG1A 4AH9A 2W9BB 3V9UA 3SNNA 3SQ2A 4ZPAA 1HQUB 4FJMA 3ZT3A 3QIDA 1HNIB 2ZQBA 3KD1E 1RYRA 2ZD1B 2AWZA 3HVWA 1RT1A 4QWBA 3DI6A 3N6LA 3PR4A 4CFBA 4URQU 4TY9A 2C22A 4EBEA 3N6MA 3DRSB 5KFXA 1VSFA 1EETB 2DY4A 1TAUA 3UR0A 4I9QA 1NKCA 4HHTA 3SUNA 2YKNA 4IDKA 2JEIA 2YKMA 2E9TA 1U04A 2AU0A 3HXMA 4PQUB 1WN7A 4FJIA 2O4IA 3CVKA 2YV0X 5JS2A 3I0SB 4O4GA 1S9EA 4CCHA 2B5JB 4BDZA 3C6UA 4DSEA 1HYVA 3QIPB 4DS5A 3IRXA 2DPJA 3QZ7A 2WRMA 4R8UA 2HHVA 3MEEB 3EZ5A 4E89A 1SKSA 3RBDA 4RW9B 4ZMMA 5I3UB 3P83D 2KZZA 2KZMA 2KTQA 5F8GA 5EWEA 1LW0A 4CHZA 2XY7A 4ZPBA 3MXIA 3SFUA 2X6SA 2Q3SA 4NLDA 5KFDA 3WNFA 4J9PA 4NLOA 4HUEA 3OYEA 4QWAA 3ITHB 1LW2A 4CF1A 3PW7A 1I6JA 4NCGB 2BR0A 1TGOA 3BGRA 3AO1A 3VQCA 1ZBUA 1YT3A 3HVRA 1C1BA 4OGCA 4M95A 3KMSA 3AVJA 4RW8B 2B43A 3QNOA 2W8LA 3GIKA 2OPRA 4J9RA 2CJQA 4CJ3A 1D8YA 2JGUA 3HM9A 2IJFA 1RTHA 4DU1A 1SL0A 3LZJA 3E01A 1JLBA 3TAPA 4FJLA 5J2PB 3TI0A 4CHNA 3LP2A 1UWBB 1GOAA 2BRLA 3UIQA 4O3NA 2JLEA 3MEGB 3JSMA 3D5MA 4K8XA 3RB0A 3AVNA 5HROA 1RILA 3MFIA 4DTNA 1VRTA 4G3IA 3F73A 2FVQA 1G15A 3PVXA 3HK2A 2BQUA 1N6QA 4K4VA 1VRUB 5DG8A 1RA6A 2D41A 1BCMA 4FJXA 1FK9B 3PX0A 4M45A 4JS4A 3QEPA 4NLQA 4J9NA 2Z1HA 1NJWA 4HKQA 3V6DA 3TVKA 3KKRA 3VQ9A 3OYKA 4GMJB 4B9NA 3DMJA 3KLIB 5KFUA 1CXQA 1S0MA 4PUOA 1JX4A 1DTTA 3OSNA 3QLHA 3JYTA 2X74A 5KT7A 3NH2A 3H5XA 3CJ3A 1ZTWA 3IN5A 1DTQB 1RTJA 2F8SA 2R7YA 4CJTA 3QERA 2O5DA 2D0CA 5KFSA 1RT2A 4CJRA 1NKBA 1LAWA 3ICLA 1UAXA 4FLUA 3PW4A 3L2UA 1TKXB 2HW3A 3OS0A 4R5PA 2GBZA 3T5JA 1S6PB 4ZTJA 1C6VA 2BE2A 2UUWA 2AGOA 3VA3A 5KG7A 4CGIA 3PO4A 1S1VA 3VQ7A 2IM1A 4FK2A 1XR6A 3RMBA 4MK8A 4PA1A 1XHXA 2WTFA 2P1JA 3ZSXA 4FXDA 3VQEA 2R8GA 3DOLA 3QIOA 5KGXA 1BIZA 5KFVA 1WSGA 4H4OB 5J2QB 3H4DA 5HRSA 4IG0A 4CFDA 1N56A 1S6QB 1TV6A 1RCHA 2X6NA 2I1RA 2KW4A 1IKWB 3AVLA 4WZQA 2YNIB 5J2MA 4HUGA 1REVB 4E19A 3CYMA 1IH7A 4DL7A 1S9FA 1FXXA 3BDPA 3IG1A 4KHNA 1SH3A 3RMDA 2BGGA 2G8FA 4NCAA 3HL8A 1HMVB 4Z4IA 2VA3A 3L3UA 1A5WA 4B9UA 3BREA 2Z1GA 2IBKA 1RA7A 4IR1A 3AA4A 4DFMA 3V9XA 5KT6A 4CHOA 3HP6A 4HCBA 4YR0A 3KLEB 4KO0A 2AX0A 3NDKA 1NNDA 2FBXA 1VSHA 4FVMA 2HHUA 4KV8B 5K14A 3DYAA 2FJWA 4IFVA 3H4BA 3HVAA 4WXOA 1S1TA 2C2EA 5KFPA 4CJQA 4KBIA 1HYSA 4DTMA 4BDPA 2OPQA 4K4UA 1HQEB 3K5NA 4CK2A 2Y1IA 4PY5A 4Q0BB 5FROA 3K59A 4G1QB 2V0NA 4FM0A 1WSEA 4TSXA 3RMAA 4AHUA 4PWDA 3AA2A 3TAGA 4RNHA 1QQCA 1NKEA 4AHRA 4HCCA 3OS2A 4KI6A 4O4RA 4DQSA 1QSYA 3KK1B 1L3TA 4I7FA 5KG2A 3KJVA 4CJUA 3T5HA 2ASDA 3GYNA 3KNAA 2C2RA 1RT5A 2OPSA 3L2QA 1WSHA 3FSIA 4CEFA 1U49A 5C24B 2OPPB 4CEEA 1CZ9A 3NH1A 4LQ9A 2G8WA 3DRPA 1JLEB 4FLTA 2XI3A 4ICLB 4URGA 5KFKA 3TANA 3ZSYA 5J1EB 2ILYA 4NCBA 4KHWA 4QPXA 3QESA 4FM1A 4LY7A 3VN5A 4CHPA 4X2BA 1UA0A 1RT3A 1S10A 2BRKA 3M9NB 3QEWA 1JL2A 1IKXA 3NMAA 3NBPB 4ZHRB 4ZP6A 3AA5X 4C8MA 5L1LA 3LAKA 4DSIA 1YVFA 4WFXA 1JLGA 3GIJA 3SUOA 4O3OA 4LSLA 2G8VA 1ZBFA 2HNZB 1JL1A 2XY6A 2HVHA 4DLEA 2E9ZA 2E6LA 1VSDA 2DFEA 4RUAA 2W9BA 3BQ2A 5KI6A 4RNOA 3V9WA 4AHSA 1HQUA 4AHTA 1HNIA 4CGFA 5J2NB 4YQWA 3VQQA 2XC9A 2AJQA 2ZD1A 2E4LA 4ID5A 4RW6A 2G8KA 5DLFA 4EP4A 1FKOB 1XR5A 3L2RA 3PUFA 4FK0A 3DRSA 1BIUA 1WSJA 1EETA 1ZTTA 1F21A 3PJWA 1S1UA 1WSFA 5KGWA 3AVKA 1SL1A 3FDSA 2GC8A 4E7JA 3M8QB 5KG6A 4J9QA 1D5AA 4IR9A 4KHYA 2ASJA 4O0IA 4O3SA 1WAJA 4Q44A 1QHTA 4E7HA 2DTUA 3ZSQA 3I0SA 1KLMB 4CF9A 1SKRA 2B5JA 1RDRA 5F8JA 1SV5B 3ULDA 3QIPA 2ETJA 1HPZB 3QEVA 5DQHA 4M42A 4ECZA 5D3GB 4CJ4A 4H4MB 5DQGA 3K58A 2FVCA 4RW9A 2F96A 3NGDA 4EP5A 3L8BA 3SI6A 4CEQA 1RTDB 2ATQA 4NLXA 1IG9A 4FBTA 1J54A 1VSMA 1B92A 1RT4B 1KVCA 3NAIA 1O1WA 4FZYA 3ITHA 4HTUA 1QAJA 3QGGA 4MKAA 2W7PA 3GV5B 4CFAA 3KK3B 2WHOA 4M3YA 3NF9A 2J6TA 3TAMB 1S5JA 1C0UB 2YNGB 2FLLA 3MXJA 3T5LA 3U6FA 4RW8A 5DGBA 3H5UA 2WOMB 4DWIA 2J6SA 3LWLA 1MU2B 5HRRA 5HBMB 4NZ0A 5C25B 3HPGA 4ZPDA 5J2PA 4OJRA 4ZP7A 3PX6A 3C6TA 1BQMA 4DF8A 1UWBA 4W5TA 3MEGA 2Z1JA 4RZRA 4B8AB 3VA0A 4CESA 3OJUA 3I0RB 4XPCA 4HUFA 3LP3A 3ZSVA 3K5OA 4K4SA 4QWCA 4B8CA 2P51A 1VRUA 4TLRA 4FJ8A 1EKEA 1DLOB 4LSNB 3HVTB 4KAIA 2BDPA 1FK9A 3VQPA 1C1CB 1RT7B 5KG1A 4I2QB 1XR7A 4YP3A 2IJNA 4E1MA 1RTIA 2FBYA 3UDLA 3CM5A 4FJGA 3KLIA 4RNFA 4ZP9A 3L2VA 4DQPA 4DF4A 2OA8A 4N56A 2RPIA 2VWKA 4J2EA 3IS9B 4C8NA 3BQ1A 3D45A 3G86A 1WNEA 1BQNA 2HHQA 1BHLA 1B9FA 3WNEA 1C0TB 2VG6A 3VQSA 3FQKA 1TQLA 2VWJA 1Q9YA 5DG9A 1TKXA 1N48A 1NK5A 4E7IA 3G6YA 3I5AA 1EXQA 3TAEA 3DLEB 3AVHA 4YR3A 4FJ5A 4WE1B 3DM2B 2RF2B 3OYMA 3NL0A 2IGIA 4CE9A 4C8OA 1I39A 4ZPCA 3SV4A 2EC0A 2V4QA 1S48A 3CG7A 4H4OA 4M3WA 1KFSA 1TKZB 1RBSA 1HARA 4FYDA 1S6QA 5KFJA 1SL2A 1Q9XA 1IM4A 3HYFA 1IKWA 2HHTA 4Q5VA 2YNIA 2EX3A 1REVA 5KFEA 3SQ0A 3K2PA 2QKKA 3KK2B 4TQRA 3BJYA 4IBNA 4OGEA 4CJEA 4IG3A 3PW5A 4B9LA 4O3RA 2XWYA 4CJPA 2P5GA 3O3HA 4BDYA 3Q8SB 3OSPA 4KFBB 1SH0A 2BQRA 3ZT4A 1X9SA 3IGNA 2R2RA 1N5YA 3V6JA 4FLZA 1S49A 1TL3B 3BR9A 1NK0A 4U7CA 4KV8A 1BI4B 4B9TA 4KSEB 3T1AA 2A1RA 1VK0A 4BE2A 4W5QA 1ZBHA 1J53A 1NJXA 2ZE2B 1Q8IA 4DU3A 4KB7A 4Q0BA 5EWGA 3ISNC 4G1QA 4TQSA 4I9LA 4TY8B 2QKBA 4NLRA 3Q8QB 3T3FA 5FRNA 4W5OA 1UA1A 3O4NA 2UVUA 4Y1CA 4RW4B 3NF6A 1QSLA 2X78A 3KLFB 3S3MA 3LP0B 3NAEA 2D5RA 3ASMA 1NK8A 3KLGB 2UVVA 5C24A 1ZETA 3TAQA 2OPPA 4F4YA 2XY8A 2HB5A 5F9NA 4WZMA 4URSA 4Y1DA 1JLEA 4RUCA 3L3VA 5DLGA 3ZT2A 4ICLA 1JLQB 4CHYA 5DGAA 4QW8A 1KVBA 1ASVA 4KPYA 5KFAA 3ZCMA 3NF7A 1JLFB 4ECWA 4DL6A 1C1AA 3HO1A 3BSNA 1S1XB 2R2UA 5L9XA 4CIEA 3MFHA 1VSIA 3TAFA 1JKHB 3AO5A 5KT4A 4ED8A 4WXWA 3VQ5A 2RDIA 4CJLA 3RWUA 2HNZA 5KFZA 3RAXA 4JV2A 2FLNA 3M9MB 1ZBIA 4DFPA 4AILC 2RN2A 4CGGA 1UOCA 3NH0A 3OYGA 1LWFB 3CO9A 1IKVB 4KHQA 4FW2A 4F3TA 3OL7A 4EZ6A 5KRTA 5L1IA 4CEBA 5J2NA 5KG5A 4QOZB 4WFZA 2GUIA 1VSLA 3RB3A 3NAHA 3BQ0A 1A5VA 3OL8A 4FJHA 2HNYB 2P5OA 5F8HA 1C2PA 4ZVFA 4CJFA 3M8QA 3O3GA 3V6HA 4NRTA 3OYJA 1S1WB 3MECB 5FDLB 4Q43A 2YKMB 4FZXC 2PYJA 4GC7A 4DTSA 4O0JA 5KFRA 1EX4A 1KTQA 3I8DA 4OL8A 4O4GB 1SV5A 5T14A 1CLQA 1ITGA 1HPZA 3AO3A 5D3GA 4K4ZA 3SI8A 3QO9A 3DLRA 1HJRA 3IRXB 4J9KA 1T03B 4R8UB 3A2FA 3ALYA 2W8KA 2VA2A 1GX5A 1RTDA 3AVIA 1T8EA 3PV8A 5EDWA 4ELUA 4CK1A 4GC6A 4LH4A 1LW0B 1RT4A 1Z26A 2YNFB 3RMCA 2JEGA 3HHKA 3T5KA 3AO2A 2UUTA 1QS4A 4B9SA 5L1KA 3TAMA 1T94A 4U6PA 1C0UA 2YNGA 4ECVA 4ECYA 3MR6A 3FRZA 3WNGA 4WFYA 4RU9A 4NYZA 2WOMA 4GVMA 2OZMA 1MU2A 4NLVA 1YVUA 5C25A 2OPRB 3OY9A 4K4YA 4Z4EA 4H54A 2IAJB 4E1NA 4IRKA 1U09A 1SKWA 3CM6A 4F2RA 1K1QA 2XGPA 1SUQB 3V4IB 1D9FA 5JUMA 2PY5A 3HPHA 1S9GB 3G0ZA 4OKEA 4DL2A 2EHGA 4KTWA 4YNQA 1DLOA 3HVTA 4IRDA 3LP1A 2UVRA 1VRTB 1WLJA 3QGHA 2RDJA 4I2QA 1N6QB 4MFBB 2XI2A 4OLAA 1TK8A 3M8RA 1RBTA 2BANA 5KFYA 1OS5A 2ITGA 4MH8A 4DTRA 3VQAA 2QXFA 3GV7B 3V6DB 3H08A 4C8LA 3GIMA 1KHWA 2R8JA 3V81B 3IS9A 4MK9A 4PUOB 4K4XA 1RDBA 4FJJA 4CIGA 4ID1A 4JUZA 4Z4CA 1YTUA 1LWEA 1TKTB 2AGQA 2JC0A 4DTUA 3OYIA 1IO2A 5CZ2A 1VSKA 2LSNA 3HT3A 3DOKB 3DLEA 1GOCA 2QE5A 5KT3A 4R5PB 4I2PB 4WE1A 3DM2A 1U48A 3KLVA 5CZ1A 3FFIB 1EP4B 4L8RB 1QAIA 5KT5A 4JRPA 1TL1B 4FLYA 5HP1B 5CYMB 2JC1A 3SPYA 4FK4A 4PQUA 1ZYQA 3QEXA 4KAZA 5E41A 3VQDA 1TKZA 2ATLA 3DOLB 4LH5A 3CFOA 3KOAA 1T05B 1NK4A 3ZT0A 2HHSA 4IG0B 3VQ4A 3PY8A 1QTMA 3M8PB 1TP7A 4C8KA 3KK2A 1BL3A 2KQ2A 4QCLA 4CJWA 3MEEA 4GW6A 3AVCA 1X9MA 4FJNA 4FJKA 4NLUA 4CEOA 3EYZA 5I3UA 3KMQA 4DL5A 1C0MA 3IG1B 3THVA 3PW0A 2XCPA 3C94A 3CWJA
chains in the Genus database with same CATH superfamily
3HZ6A 3VMFB 3CFRA 5BR8K 3KHGA 1X4EA 4K7QA 2NLXA 3D28A 2P9SB 4CF8A 4F3OA 2R9LA 5H1SV 2N4CA 3I4HX 2MYFA 4B9VA 5MLCQ 3ENBA 4O23A 4H8KA 2IFXA 5J1PA 3OYLA 1LK5A 2D3UA 2QTDA 4TYAA 1NJZA 3MXMA 2ZE2A 3T1YK 4IFVB 4DR3J 1JXBA 1RDWX 1ZPWX 5D78A 2RKIB 3DLKB 1HBOA 3VQTA 3U4LA 3ZLJA 4AHCA 1M5OC 5IWAF 4N8OA 4RNMA 4DV4K 3RB4A 2A41A 2GGPB 3B4MA 1W2BR 3AGKA 3KYLA 4N47A 3PSIA 2E2OA 5ETKA 2DNZA 2YY3A 4O44B 4NXNK 1SJFA 3AA9A 1HI1A 1OVYA 4JK9A 2I5JB 1OYDA 2VFTA 1GQEA 3HKWA 2QSFA 1NGHA 2EG1A 4FWMA 1XI1A 5KFFA 4J2DA 3QQCD 1Y64A 3TEGA 1MWYA 4WCEL 5AQHA 1JLFA 2O4GA 2VGNA 2BACA 2RMLA 4FN5A 2R8IA 3M32A 2ERRA 3P6YC 2B8QA 3ENVA 4CECA 1TK0A 4LT6A 1S97A 1B9DA 3SFGA 1NGIA 3GR1A 5HVHA 3QEIA 2YWWA 2V2KA 2I9SA 1FRHA 3V2UC 2P5VA 1RBUA 1IKVA 2C2DA 1R7IA 4MAKA 1N5VA 1UEKA 4FBUA 1PYSB 3KKFA 3OJSA 1NGAA 4M3XA 3W9IA 1HLUA 2Q66A 4UQGA 1NMDA 5GADI 4AXIA 3DHXA 2HNYA 2FVPA 4RW6B 3LDQA 3I32A 5DDQC 3RB6A 2CZ9A 2HNDB 1U02A 2HGMA 5EX3A 4KY3A 4V19S 3WBZA 2ZKUA 4GVLA 3IWNC 1S1UB 4USJC 3ZT1A 4M5MA 4Y34A 5FDLA 2HLTA 2PO4A 2RUSA 2HHHF 1VK8A 4CEZA 4IYQA 3FCWA 3JSYA 3TZZA 1P1LA 3UR3C 2CAJA 3SQ4A 2MXYA 1XMQF 2A0FB 4IEEA 3CMQA 3OTCA 1DJ0A 4DQQA 4XO0A 2F4FA 2NLWA 3H7HB 1FKPB 1T03A 2QZ8A 3CDWA 1T9WA 2J7WA 3KLEA 2WB4A 4I6MB 2VIHA 4OZ3A 1MROA 4NEYA 3C19A 3KLHB 3G9CA 2V8DA 4DV1F 2DR7A 4NYPA 1CZAN 3NHGA 3W8PA 4CZHA 2XMAA 3DLHA 4DR2F 3A5MC 3VGLA 4DBQA 1RWMB 2LQBA 3I9ZA 2G8HA 4LR8A 4BR9A 1CJKB 4ZCLA 1YBTA 4JI3K 2JFDA 1S5ZA 2M70A 2NSBA 1MW7A 3KHLA 3H8YA 2GA7A 3GIRA 3RSEA 1M5SA 3DLBA 3VF2A 1JCGA 1GMUA 2KB2A 2XCAA 3U1LA 1UVKA 3PR5B 2YQ1A 3J81Y 1EKRA 4RTFD 4OX7A 1SUQA 3V4IA 3D9BA 1A5XA 2HS3A 1JIHA 3S9HA 2MJNA 2KRBA 2JWKA 5KTQA 1RWVB 4LF6K 1EO1A 4X64J 3VQ8A 4MFBA 4X4PA 2F8TA 4A8WA 5IOLA 4ZHRA 2IM3A 2R7TA 4ZDNA 2YNHB 5B08A 3ISND 5E26A 3I4PA 2HBYB 1RKJA 4CFCA 3ZZPA 2WW4A 4M5IA 2PN6A 3L95X 3CJ2A 4B3OB 1NGDA 4CRJA 2CG4A 3D1OA 3IRWP 5HOOA 2DNLA 2VG6B 3SV3A 4CGJA 1DT9A 4DG1B 4NX9A 2V9KA 1D4XA 3HCXA 1U24A 4NXMK 3DRXA 2RRAA 1KFDA 1UJ6A 2V9WA 3FQLA 2WK4A 3K9KA 4CGHA 1D8ZA 5EVZA 2CPIA 4I2PA 2BOAA 4NZ7A 4NLGA 2DTJA 2UUAJ 4KHMA 3HSTB 2F9TA 3CC2N 2HBLA 3AO4A 2G1DA 5EWFA 4M3TA 1UW9A 2YKNB 3R9PA 4EGLA 3L3CA 2NR0A 2DNYA 1R6YA 3V9SA 5LMUK 4DTXA 3JS9A 3OHBA 1Q53A 3GP9A 4EWTA 4DEZA 3MPYA 5BJRA 1PBUA 2O01C 5AE2A 2MQLA 4CQ1A 1X3MA 4FJ7A 3HM8A 1I51B 1HBMA 4ES3A 5GAHP 1SVDA 4IG3B 2J6UA 2ADCA 2QC3A 3LPUA 2OEMA 4WCEQ 3O8MA 3OYHA 5L1JA 2MKYA 1XHZA 1IKYA 4DQRA 1OH6A 3LANA 2GCFA 3CQ8A 4UOCA 3CCLS 1HKAA 4BWJA 4M94A 3HFVA 4N41A 4NMXA 1X0PA 1L3SA 2MQNA 3BGRB 4RW7A 4IFEA 1C1BB 2G2YA 1WNSA 3CD0A 1IWAA 2GIQA 2J76E 2VFSA 5IT9U 4NLSA 3CT9A 1ZXOA 3THXA 3AV9A 4LF7J 1LEOA 4P2FA 1RTHB 3E01B 1JLBB 3ZZRA 5C0YA 4CO4A 1BU6O 3GR0A 2OZSA 3EL2A 3K9JA 1R0AA 2FC0A 3J7ZO 1TR0A 3LW5C 4CBXA 3HJFA 2B0GA 4IO9Q 2VG5A 3PDNA 3DLLL 4GO5X 4KGZB 1RT7A 5FD1A 3M9OB 4MKYA 3L2WA 4W98A 1R0BG 3IAM9 3HZEA 1YITS 1R31A 4TLQA 3BGOP 2LECA 2XEXA 3MAQA 1N34K 2EKYA 2HVIA 1A0OB 4YB6A 2P9CA 4EIAA 4ZVEA 2DPNA 3H0PA 2QX0A 2O8CB 4KHRA 4LBPA 4DU4A 2ROPA 5KG4A 1WDDA 4BRFA 3GIIA 4PR6A 2WONA 1RTJB 4W5NA 3A8EA 3AA3A 1RT2B 1EWRA 2ROGA 2W6LA 3OL6A 3WC2A 3DU5A 2P9PB 1J5OA 1K6YA 3I5BA 1D1UA 4FNIA 2BE2B 4DTPA 4LSZB 3DLGA 2UUCF 3AVBA 4AXJA 1QE1A 1TVRA 1S1VB 3J7ZT 3S8SA 4ED6A 1S72S 3UE2A 3QRPA 4DHYA 2CQCA 4QWDA 4O55A 3HHLC 1K1SA 2QFJA 4NYNA 3QJJA 3VEXA 2D0BA 5T7BA 3LDOA 5G0RA 3MPVA 4IFYA 4NPOA 4X62J 3G10A 3V1QA 2W7OA 3QGIA 3V6KA 3G4SN 2BUNA 3OS1A 2VD3A 1RHRB 1Q78A 2HVZA 3TWZA 3UNYA 3CJAA 3VTIA 9RUBA 4K4TA 1Q8KA 3ZETA 2IS3A 2JWLA 4JI7J 5M1NA 3KHRA 4F50A 2MMYA 3GJRB 2OH2A 3ZZ0A 2OANA 2AV5A 3JSBA 4JNEA 3FBBA 4PXDA 3MMAB 3HT0A 3O6QA 2R4FA 3DYAB 2MHEA 3R3LA 2EVZA 1X5TA 2RIJA 3QMQA 4PKDB 3CCJN 2KO1A 3ILOA 1UPMB 2X1AA 2QA2A 1WF0A 3UNGC 4ATNA 3UDCA 2Z56B 1SH2A 4PXCA 2KL8A 1NK7A 2HWIA 4DX8H 2UXBJ 2O8BA 3RR7A 3JAMU 4OKKA 3NNAA 2WBMA 2MKHA 5D4PA 2D4WA 1YRXA 5I4MA 3L7UA 4A8FA 4KYZA 5GMDA 1KLNA 2QWLA 2YWKA 3GJQB 2FTRA 1L5UA 1BISA 4QYZK 3AH6A 1VQ7N 1HNZK 5F1XA 3HMJG 3S6EA 3NVMA 3DRRA 3FMWA 3DRPB 1FDDA 4DR7J 3BSAA 3KNGA 4ELVA 4ECRA 3LP1B 4PEOA 4FF3A 2LXFA 5HL7L 2W6KA 3KIOA 1WUAA 2HRTA 3W66A 3R5BA 3M8SA 4C1NK 5AQUA 1Q8LA 3NLCA 2Z2YB 2DCLA 4RUBA 2P9IA 2DB1A 2HQIA 2IM2A 2GHPA 4KREA 2V67A 4QIEA 2EPIA 4CLFA 5KPTA 1U2RA 2Y8YA 4QU7A 2HBJA 4MDBA 5B09A 4USKA 1W25A 1S0VA 3O9SA 4Y28C 4DI6A 2WSFC 4DV6J 2F9JA 2GQCA 3AB4B 2GQ2A 2SXLA 3HULA 4YOTA 2YTCA 1H2VZ 1LCUA 1HNIB 2F63A 2OFGX 1OIAA 2PBDA 2QA1A 4B17A 2ZD1B 4QWBA 3DI6A 2MZJA 1VQLS 3AAQA 4EBEA 3N6MA 3DRSB 1K8KB 1VSFA 4B3MJ 4I9QA 1F60B 2M3DA 3SUNA 1HNXK 1FJGF 1FFGB 3FE1A 2RJZA 4HR2A 2JEIA 2PE8A 4CLYA 1WN7A 2O4IA 2YV0X 1L3KA 4OO1J 1S9EA 3DLLQ 3G4SS 4JV5J 2Y3YA 4FF1A 3GTYX 2ZGZA 4MMOA 4DSEA 4X64K 1U1RA 1YRUA 3DDNA 1HYVA 3GG0A 3IRXA 4Q2LA 5JLHA 1A9NB 1XERA 4CI6A 5IT4A 1IR2A 4K59A 3IBFB 2KTQA 5F8GA 1LW0A 2ALYB 4V19X 3RW7A 2GEMA 2OD4A 4NO7A 3Q0AA 3EZWA 3WNFA 1NXIA 4HHHA 3KG4A 4U95A 4QWAA 1LW2A 2DNGA 3C66A 1YWXA 1XN9A 1I6JA 3HRGA 5CA5A 1SIZA 3CCJS 1YT3A 2KXNB 4OGCA 3VF4A 5K8OA 4RW8B 3TW0A 3G96A 1T3OA 1RADB 2OPRA 4J9RA 4CJ3A 1EQMA 4JI8F 4MO4A 1D8YA 1M5PC 1VBKA 2JGUA 4BG8A 1NDCA 4DU1A 3TAPA 4FJLA 3M1VA 3KDOA 3A3NB 2DHAA 3LP2A 2C42A 2BRLA 3UIQA 4OHVA 3MEGB 3D5MA 5AQVA 2UUAK 3F9MA 1HR0K 2RHSB 4C23A 4UQTA 4GV9A 1MDUB 3F73A 2PDAA 2KDOA 2BQUA 1N6QA 5IV3A 5DG8A 2D41A 3BZQA 4ZN1A 5F0XA 4JKDA 3RU0A 3PX0A 2XZDB 4YOEA 4CT9A 1TMJA 4BQLA 2WSEC 3TVKA 1VIXA 4KH4A 3NS6A 4HT5A 2MZRA 3BGLA 1S0MA 4G1PA 2FD2A 3G8TA 1DTTA 2MGZA 3JYTA 1K8AO 1LQ9A 2X74A 5KT7A 3PTWA 1UMJA 2DO4A 4IUFA 2YH0A 1KEKA 3IN5A 2V68A 2MZ1A 5D4LA 2IRUA 3CCQN 2XQCA 2D0CA 5KFSA 2NYHA 4CJRA 1NKBA 3ICLA 3M8YA 4FLUA 4DV5K 1TKXB 5H9FK 2BH1A 1UVMA 3W2VB 4RWTA 2V7ZA 3OUYB 2VYPA 4H5RA 3RBZA 2V50A 2AGOA 1X5OA 3BGFA 1NJIO 2HQCA 2D0OA 2YPZA 2J7KA 4CGIA 4PXEA 2N4DA 3RMBA 4PA1A 1HJOA 3D1QA 2P1JA 4FXDA 3VQEA 5KFVA 3R5AA 3H4DA 3IMQJ 3VESA 4IG0A 1H0HB 1S6QB 2ZH2A 1BWVA 2QYGA 4C0HA 4JI2K 1REVB 2NUHA 1YIJS 3FKBA 1FXXA 2NRZA 4EUVA 3BDPA 3WHIA 1P6TA 2UYTA 2B9EA 2GAHC 4NCAA 3QWUA 1ATSA 1K8AT 2XMUA 3IM8A 1A5WA 4DZ6A 5CD4H 2I2YA 1ZH5A 2UZAA 1K44A 1GLCG 4IR1A 4DFMA 2DGWA 2V8VA 1NSAA 5KT6A 5GADU 4LF9F 5M1FA 5HK4A 1NLVA 2CPYA 4YR0A 3KLEB 2AX0A 2NRXA 1VSHA 3NGSA 1BA0A 4WXOA 1S1TA 1C0GA 4L72B 1HYSA 4CK2A 4DR6K 4Q0BB 3K89A 3K59A 5FROA 2V0NA 4FM0A 4TSXA 1NJIT 2J4RA 1F0XA 3AA2A 3GFXA 4AHRA 2XYGB 4HCCA 4KI6A 2DXDA 3CJCA 1HBUA 1YJRA 1L3TA 3KJVA 3AXMA 3WIVA 3KNAA 1RT5A 2IVPA 2OPSA 1WSHA 1EHWA 1LFWA 2B7BB 2UUBF 4LQ9A 5A2QU 2YKAA 4I64A 3VHQA 1CVJA 4URGA 1N8RO 5KFKA 3QATA 2LEAA 2HK2A 1RU1A 2ILYA 3QESA 1U2VA 1N54B 4FM1A 2I7NA 1U1LA 4JI1K 1UA0A 1RT3A 1S10A 2EW9A 2ASOA 3M9NB 3QEWA 1IKXA 4ZHRB 2MZTA 1F2GA 4WFXA 1JLGA 5CH7B 1W7AA 4F3MA 4LSLA 2HPUA 1ZBFA 2JZ5A 2VV5A 4DR5F 3CXCR 2HVHA 2J8SA 3CB4A 2QMWA 2BEFA 3HI9A 2I7PA 3THYB 2E9ZA 1QD1A 3OR2A 2QMXA 5AQNA 4CLUA 2W9BA 3PIOL 3KUEA 3O5TB 3V9WA 4WIQA 4CGFA 5J2NB 2XC9A 1BC6A 2AJQA 2CXEA 4ID5A 4RL1A 4FK0A 3P4IA 3CC4N 1BIUA 4L3QA 4UOHA 5E3AA 5ETOA 1WSFA 2GJ2A 5KGWA 3FDSA 1WC1A 2GC8A 1D5AA 1QHTA 2DTUA 1N8RT 7FD1A 2VQFK 3AD7C 3I0SA 4JOUA 2KM8C 3JTOA 1UL3A 5AJ3F 1ZM3A 4NMLA 3AD8C 1HL6A 2GWJA 3FEYB 3ULDA 4LF8F 3R2CJ 3L9ZA 3UE5A 4PZVA 2ETJA 5TKWA 4ZCIA 2HVDA 3O1LA 3HFZB 4YOXA 3ENAA 4RW9A 4Z2XA 3R97A 3L8BA 4OX8A 2HYIB 3MCPA 1VJWA 4CEQA 1J54A 2W2NP 1FXDA 2LLZA 1KVCA 2M5YA 1I3OB 1T11A 3ITHA 3J7YP 4MKAA 3PNIA 4ERDA 4M3YA 3HHLD 2J6TA 2YX1A 3AD9C 3O8WA 3EGNA 1UJ4A 4NLCA 4DV6K 3M1FA 4USTA 2APOA 1HHSA 3FVYA 1YHQS 1MU2B 3F44A 2MLYA 1NSQA 2NYIA 2GO8A 4NZ0A 1AZSA 3TUJC 3HPGA 5J2PA 3THXB 2F4VF 4RWWA 1BQMA 3FR0A 3ZEUB 1VLYA 1Q18A 2W1BA 4V19J 1FX4A 3W9JA 4CESA 4ALZA 5LY3A 4OX6A 4YHHF 4B3MK 1HWJA 2MKJA 3MN7A 2P51A 3ID8A 5EY4A 4W92B 3M6GA 4FJ8A 1DLOB 2Q3PA 1RT7B 4Y6IA 1XMQJ 1FVQA 1XR7A 3M2VA 4E1MA 4DR1K 1RTIA 2G0JA 1XK8A 2JFKA 3CM5A 4ZP9A 4DQPA 3L2VA 3SCKE 4F67A 2OA8A 2CDRB 3VR1A 2NQPA 2A40A 1I94F 2VWKA 2ZWHA 4DB3A 4J2EA 3IS9B 4DV1J 4L3NA 4IZ9A 1IBKK 8ATCB 3BQ1A 3KZBA 1WNEA 4C97A 2BKNA 2HHQA 2A10A 2VKRA 1F6TA 1B9FA 4ZVRB 3JSRA 5AQOA 3WNEA 3VOVA 1AROP 4ILMA 1AW0A 1IBMJ 2VPXB 2AKWB 3UD5A 1PG5B 1SKUB 2QTWA 4CDIA 3WIUA 3AVHA 1YJ9N 4BRPA 3C16A 1UTAA 5B8HA 2CVEA 3C2PA 3ZX2A 2XULA 2P9NA 3CC4S 2B4PA 2CPEA 2QL5B 4OJ3A 2BZ2A 4K43A 5KPRA 3SV4A 2D3O1 3CG7A 4H4OA 3QICA 3R1XA 1HUXA 3TEHB 3NVKA 1IM4A 1IKWA 3C65A 5G0RB 3BN7A 4CTAA 2YHWA 1Y7PA 2U2FA 5KFEA 3SQ0A 2QKKA 3BJYA 4TQRA 1VK3A 4OGEA 5M1KA 5IM0A 1DKGD 1GTEA 1PC4A 2P5GA 2CNNB 4BDYA 3OSPA 4KFBB 1WTBA 2BQRA 3MUTP 3ZT4A 3CNQP 3PEHA 3R6MA 2RS2A 2R2RA 1CBKA 1O51A 1S49A 1TL3B 4KV8A 3TVZA 3VAJA 2XLJA 2Z57B 2HG4A 4KSEB 3T1AA 2PA3A 4W5QA 3W3DA 2WVDA 3ZZZA 3CCUN 4G1QA 1VBYA 4FPAA 4RO0A 4TY8B 3L4BC 4CLWA 3FZHA 3MM7B 1Y11A 2W25A 3KUGA 1NH7A 3Q8QB 3PIOQ 1SC6A 4Y1CA 2UVUA 4BC7A 1N32F 3O80A 2RRNA 2O8BB 2M2BA 3H90A 3I56N 4AQYK 3RGIA 1VLOA 2OPPA 5GVQA 2XY8A 1FRIA 3W63A 4A8OA 5DLGA 3HHEA 4CHYA 5DGAA 4C6AA 3MOZA 4LR7A 1NU4A 4KPYA 5KFAA 3BPDA 2KU7A 5D77A 3BSNA 1S1XB 4CLKA 2UU9F 1Q81O 1SQGA 3MFHA 1VSIA 1RHQB 4P9SA 4DUYK 2VOPA 4DUTA 3ISZA 5FIIA 4H5VA 3EICA 3TAFA 5AQMA 3AO5A 5D0HA 4U7UD 4WXWA 4FOEA 3LUYA 1YSJA 1MMDA 1NM2A 2HNZA 3WQTA 1EZZB 4BGBA 1X5PA 1T44A 2K06A 4GV3A 3OYGA 1LWFB 1Y3KA 4FW2A 1XNQK 3ZTPA 3VAMA 4HI2A 5L1IA 4YOVA 5KG5A 1RBOB 3QFPA 4LFBK 2VASA 2GUIA 3BEGB 3NAHA 1VAZA 3WXJA 1A5VA 1HW8A 4FJHA 3D0GE 2Z2LA 1E6VA 2E2PA 1NGFA 1VQYA 4NI2A 2ZH7A 3M8QA 1QTNB 3CPWR 3VPZA 4NRTA 3MECB 3UI3A 1YJWS 1WF2A 8RUCA 1VQ9S 2G2OA 4Q43A 2HSEB 3D7EO 4FZXC 4FWSA 3A13A 5KFRA 4ILJA 1CLQA 5LJVA 1Q81T 2LFVA 1YJ7A 2IMOA 4ES2A 3GFHA 3AA8A 3ULEB 5D3GA 4K4ZA 3D6MB 3QO9A 4ID8A 3IRXB 1EIYB 1T9UA 2W8KA 3CCMN 1M5VC 4CK1A 4Z94A 2VBYA 1CJUA 1LW0B 1RT4A 1RTZA 3R27A 3AODA 3RMCA 4DN9A 4AL6A 1N33F 2YPYA 3TAMA 5AZIA 4X4TA 5CE3A 3E9LA 2V51B 2UUCJ 3ADAC 2HAFA 3MCMA 2ZH3A 2A6AA 4UY85 2OPRB 5IWAK 2IAJB 2CQIA 4MT1A 5BRHA 4E1NA 1U09A 2B9WA 4F2RA 2XB2D 1LWXA 4A59A 5JUMA 2HBQB 2PY5A 1UCNA 1S9GB 1EQYA 2P9UA 4OKEA 4BROA 3LDLA 3W5ZA 2EHGA 2HURA 3QRRA 1XJWB 3QGHA 1U1QA 1N6QB 2IDEA 4OLAA 3DCAA 4ISGA 5AQLA 2BANA 2IPOB 1M5HA 3VF0B 4MH8A 3BEXA 2EBEA 3GIMA 4IO8A 2R8JA 4MTPA 4A61A 2RNEA 2Y0BB 5BR9A 4CIGA 2DIVA 5H9EJ 4KH1B 4Z4CA 2J0SD 2I8EA 4P72A 1YTUA 1LWEA 1TKTB 3RBXA 2JC0A 4DTUA 4CLLA 4BRCA 5CZ2A 2DHXA 1G3OA 3HT3A 3OFGA 3DOKB 1ZA2B 2B9XA 1FJ7A 1GOCA 2QE5A 4OYMA 1LKZA 2IYGA 4YDDB 2OO4A 1YI2N 4L6V3 4DV2F 4WE1A 1NGBA 1DQ8A 2IVYA 3VV2B 1EP4B 5DZ7A 3TOQA 3NOGA 3HBTA 4FLYA 5HP1B 4FK4A 3CMAS 2E7VA 3H20A 1ZYQA 3QEXA 4KAZA 1CC7A 3VQDA 2E5LF 2E1PA 2ATLA 1Y3JA 3KOAA 1T05B 4D3HA 1FDAA 2HHHK 2HHSA 1MWMA 4IG0B 1BL3A 4M63A 1K9MO 4CJWA 1X7VA 4BRQA 3MEEA 4CEOA 3N9UC 2X1FA 5I3UA 4DL5A 3THVA 4BR5A 3C94A 5E5NA 2H3EB 1URNA 3CWJA 3FEZA 1SXLA 3TABA 2MY8A 3NWRA 2B6AB 3HSGA 2QV6A 3VGKA 2NRTA 5HRNA 1GXUA 3Q2TC 4OYIA 1RXOB 3N01A 4I68A 2FSNA 4ZA1A 3LWMA 2ADBA 1TUYA 3DXKB 4DR2K 2CIMA 3NG8A 3CFPA 4OI2A 3EM1A 4BS2A 3IAYA 4N76A 5KG0A 5AQGA 3VEVA 4OLPA 3OLAA 2V94A 1HYSB 1W9HA 3TA1A 3MR2A 4KIAA 1IR1A 2CADA 1ZZFA 4OPKA 1RK8A 2HMIB 5BRDA 4CJ5A 3TU5A 3MMBA 3TJAA 3I6PA 2XSJA 2ASMA 2HZAA 2O8DB 1FJGJ 4NA3A 5IC6B 3KLGA 3BYRA 1NDLA 1RACB 4EBCA 1HHQA 2OPSB 3L0QA 1K9MT 4YY3K 4CLTA 3EX7B 2FC8A 1X4DA 5DQIA 4CZGA 4E3SA 3GJTB 2QG9B 4KGVB 3U3GA 2DCUB 1CULA 1CXUA 3LDPA 4CZKA 4FS1A 2FLPA 4J9MA 4KTQA 4KI4A 2ZVSA 5HSPA 1K0VA 4OPHA 1BXNA 5DG7A 4DDFA 1AYEA 3IBCB 4TN2A 3PSFA 3NGTA 2OMOA 5L46A 1SQFA 2BE9B 4LRAA 3O4WA 3P31A 2C28A 2XS7A 4ELTA 2D3ZA 4F4WA 3UN2A 1C4CA 1IJFB 3TJ8A 4JK8A 4JI8J 2AEMA 2CPZA 1U2CA 3I33A 3OR2B 3FNNA 4R0EA 4DR3F 4UT4A 3CCVS 5D4OA 2C2ZB 3CCES 4OZ1A 4ID5B 2WVEA 2GS8A 4CF2A 3BBBA 4ZVUB 5J2QA 4M1KA 3AVFA 3RVCA 5L9NA 2DEIA 2ZUAA 3NNCA 4JYAK 1RBVA 4ZVHA 1SAZA 2Q1NA 5B7WA 3SMZA 2RB7A 3QT6A 2ZH6A 5TKYA 3R5DA 4FVUA 4JS5A 4EO6A 3WUHA 3A5NC 4QAGA 2HQGA 2P9GA 4FW1A 2OFHX 2Q2RA 3HLUA 2UV8A 1X60A 1U1OA 4LF5J 4NLWA 1VYAA 2JNJA 4HH0A 2MSSA 5A8KA 3CUNA 3S1TA 2BA9A 4DL3A 2EXUA 2YVSA 2W9AA 1KNZA 2BTFA 4BR4A 3AHPA 3SBTA 1HQEA 4RNNA 4MKBA 1WEXA 2IVMA 2PIIA 4FYXB 1SB6A 2FGOA 4FM2A 3MEDB 4FSVA 5KQ8A 3THWB 2QEXN 4AHVA 4CERA 4CJ7A 1L3UA 2RSQA 4ISFA 1H7XA 2AQ4A 3UQSA 1LWCB 4CIFA 3BSOA 5ETMA 3KK1A 1F9EB 3PZPA 3CJ4A 2B56A 5C5JA 4OYPA 4L74A 3EXCX 2OTLS 4FPBA 2AJ0A 3SDEB 2P6SA 4KKOB 2M9KA 1GLDG 1BQMB 2FF3B 3AXKA 3K8VA 1UVJA 3V9ZA 2BJ1A 2NNWA 1YLXA 3K0JA 4B3TF 2MQPA 1WI6A 2B3TB 3Q8YA 4DLGA 4X84A 2LCWA 2RAQA 3NBPA 1JLCB 2PEBA 3QPIA 2XRIA 1VC0A 1C4AA 1RTIB 3GCWP 4A48A 1U45A 4BRLA 2QA4S 3V81A 4F4KA 3G6XA 4LF9J 1NNEA 5KOWA 5CYQB 4CGDA 4X4QA 5HAOA 3ELHA 3H98A 1NAQA 4C4WA 5C7PA 2R2TA 3NGZA 1KSPA 2VG7B 3FJ2A 3CJ5A 2FJAB 4C9DA 3QYYA 2CGLA 1N5TA 3UFCX 1J5EF 3EPIA 4K50A 5ETLA 3U1NA 5CHIA 3NXZA 1RT1B 4GKKF 3FFIA 4F04B 4YMEA 3N6NA 3C16B 1OMSA 4EO8A 5KRSA 4NLPA 4LF4J 1TL1A 4HACA 5JVHL 4JBCA 3RBEA 5CYMA 4A62A 5F3ZA 1BUXA 4OYAA 4JKGA 4KHSA 4DJBA 5ETPA 4OIXA 4UW2A 2WCXA 4R0JA 1VQ5S 2OJ3A 2ZJPL 1HYZA 3POTA 3S7RA 4WQ5A 4DR4F 4ANCA 3CI5A 2GAGC 3I55N 2YWFA 2UXCF 2W01A 3C6UB 4CTAB 1RDCA 2FVSA 2BM0A 3MMCA 2XNRA 4OZJA 2PFUA 3PRBA 4WYLA 2NXJA 4OYBA 5IM0B 4XK8C 3BBCA 4B08A 3SEOA 3HPOA 3SAGA 4RKUC 2GO9A 4NLYA 2W2PP 2P9EA 5ADZA 4PG7A 3O9TA 3AOAA 1Z2ZA 4Y2KA 3V1RA 3IA0A 2E8AA 2CQDA 2V34A 3KTQA 3LALA 3DXBA 4ZS6A 4NWBA 1D09B 2RKIA 3D68A 3ET6A 3DLKA 5K9FA 3Q7CA 1DFDA 1OY8A 5KFTA 3NGIA 2HQFA 1XNRK 3V4MA 3HOTA 2D9OA 1R0CB 2G0IA 1ELOA 4IXCA 4F4XA 1T3NA 1FO1A 4DPUA 4OV1A 3U7JA 3JSMB 1UW4A 3EDQB 1V4TA 4CO0A 4M7XA 4O44A 5HROB 3K5LA 1QUVA 2PA8D 2ZF5O 3VALA 2I38A 3F9KA 5K8PA 2KG0A 2I5JA 5F3TA 4X4VA 3BPSP 1R8AA 2HRUA 4Z4GA 7FDRA 4JRQA 5KFQA 2V6AA 3SPZA 2V4JB 1GLAG 3OVNA 4BRNA 3AVMA 4IOCL 4M3ZA 4DV0F 1AA1B 4KB1A 3G6VA 4IJNA 2ITMA 2BJ3A 4FWOA 3BM7A 5HN0A 1C0TA 1RWWB 4GVBB 1N0VC 2FJVA 4ED0A 5B0BA 4IRCA 2Z0GA 5HMWA 3RTVA 1NMEB 2VF3A 3PHTA 2O8EB 4ZVGA 2F1FA 3B6PA 1WOOA 5GMKa 3R6LB 4OX9K 4WFAQ 3CDUA 4DSJA 1VQSA 2RF2A 2PFDA 4U7UK 2R8HA 1XMOF 4J2AA 1P1TA 1R27B 1RB0A 3K5PA 4K2JA 2RE2A 1WAFA 5DM6Q 4E98A 4EYHB 2Y1RI 4K4WA 3LAMA 2FDNA 3MM5B 4YHHJ 2F5GA 4J37A 2HNDA 2KN4A 3MF5A 4M3UA 2R2SA 4HLBA 1E6VB 4WBFA 3FZBA 4U8VA 5LT5A 4NI2B 4CYUB 2E1ZA 5T7LB 2PYLA 4N8NA 1BDGA 2DHHA 4IOBA 4QS8A 5EN1A 1ZPVA 2CQBA 5LJ5Y 4CEAA 3WXIA 3RRHA 3I55S 4U9RA 3HSDA 1HX1A 2D7SA 5J1NA 1N36F 3CJ9A 1I94J 4KT0C 2FHJA 1TYQA 1FKPA 1GX6A 5GAGP 3OVBA 3MD1A 4YB1P 2C2KB 3MWTA 2VGMA 4NE9C 2GZOA 3QO9B 1CS4B 4I6MA 2F8MA 4Y2MA 3KLHA 1HD0A 1SS6A 1BI4A 3VGUA 1U6BA 1ZM9A 1BOTO 5AQRA 2OD6A 1CJUB 5JMNA 2XMTA 1KRPA 2LXIA 3PW2A 2DRAA 3NCRA 2OPQB 3QFUA 1CJKA 2ZFHA 4LFAF 2VQEF 5ITHA 3R7NB 5AZIB 1RE1B 4DCPB 3TTCA 3CDAA 1RLDA 5KFHA 5DJBA 4JKHA 1U25A 2C3MA 3VEOA 5IT0A 3K57A 3Q8RB 1QSSA 1W0HA 3LOUA 3FK4A 5LMNK 5SWMA 4CZIA 2JLGA 2DY1A 4GKJF 4YR2A 4QIVA 3PJXA 2Y1JA 5JVHQ 2FF6A 3TTDA 2CZ4A 5DK5A 3GQCA 2F65A 5T41A 3TR5A 4F2SA 1FF2A 2DNHA 2CYYA 1WKKA 2YNHA 3F41A 3ILJA 2C3YA 2QGFB 2BANB 5E7OB 4EHTA 4Y0FA 4PKHA 4Z4HA 4B3OA 4IWVA 3TX8A 1X1PA 1SI9A 2EG2A 4ECTA 4B3SF 3LM2A 2K3KA 2VL1A 2O8FB 1FI4A 1LWEB 4DG1A 2RRBA 3HTVA 5IFMA 1HQUB 1I1GA 1TELA 5C2DA 3QIDA 2YJFA 1W2IA 1RYRA 3DWLA 3UKUB 2GELA 1N32J 3HVWA 3LGHA 1CLFA 3N6LA 2UXDJ 4CFBA 4TY9A 3O5BA 1EETB 3GYGA 2DY4A 4CNZA 3VF6A 2YKNA 3P38A 3IR5B 5E33A 2UXBF 2JOQA 1VIOA 4P2SA 1U04A 3HXMA 3WX8A 4P73A 4CBUA 3ENHA 3MURP 4CO2A 4DOZA 5JS2A 4AD6A 2R7OA 4CCHA 4JI4K 1VI7A 1W2BM 2EKNA 3KWMA 1JQGA 2HHPA 2B5JB 4BDZA 4H0YB 5A2QO 3Q22A 2NSCA 1GH8A 3QIPB 2UU9J 2N7CA 3Q8VA 4L75A 3C8YA 4R8UA 2HHVA 3MEEB 5BR8F 2D0PA 2E1RA 1WOSA 3EZ5A 1SKSA 5I3UB 1ZM4A 5HJXA 5EWEA 5CABA 5LSLA 4IOCQ 2VONA 3SFUA 2Q3SA 4NLDA 5KFDA 2AZ3A 3DLJA 4NLOA 2FYXA 2VB6A 1RI7A 4OYWA 1TGOA 3BGRA 2PMWA 3VQCA 3RJMB 1QM9A 2QYCA 1O13A 1ZBUA 4KH0B 1YZ7A 1C1BA 4M95A 3KMSA 1IJEB 2B43A 2HVEA 2W8LA 3GIKA 4ZCKA 1WC3A 3B82A 4C8YA 4UTGA 2XWXA 2CWXA 4GV6A 5HO4A 2IJFA 1RTHA 3LZJA 3E01A 1JLBA 4JK7A 1W7WA 5AQWA 4WF9L 3EE9A 1M1KO 1RBLA 3W3SA 2HFOA 3G71S 4NXNF 2Y9HA 4FOIA 1M90O 1ROFA 4NA1A 4YOWA 1SCJB 1S59A 1RILA 2GVDA 4DTNA 1VRTA 1KVIA 3SBGA 1R43A 4G3IA 2FVQA 3PVXA 3HK2A 2W4PA 4DKWA 1VRUB 1RA6A 4USUA 2UUBK 4FJXA 1N52B 5FPEA 1FK9B 2M8DB 4JS4A 2PGCA 1H7WA 1OVQA 3QEPA 2HFNA 4NLQA 4J9NA 1ATNA 4HKQA 3KKRA 2GIFA 3KLIB 3GBTA 2C3PA 5KFUA 1CULB 1JX4A 1RCOB 3CJRA 2QWMA 2J5AA 4B1VA 3RYLA 3H5XA 2F8SA 1RTJA 2GHVC 5M1OA 5HVGA 5AE1A 1N33J 3L7OA 3QERA 2RQKA 5ETTA 4DR5K 4CO3A 1RT2A 2F3JA 4C3LA 4WK3A 2ZBCA 3FGVA 1BE4A 3AARA 4JKFA 2DGXA 1KQSM 2P9PA 3PYFA 2GFFA 4R5PA 2QL9B 1T6CA 3KK7A 4A8QA 1SC3B 2BE2A 2MLZA 1E6YA 1M1KT 2UUWA 4BBYA 2H5JB 3VA3A 4ER8A 5C2FA 4ZOSA 3Q2SC 5KG7A 4JEPA 3PO4A 1S1VA 1M90T 3TUPA 4U96A 2AA4A 1H6KX 5IC4B 2IM1A 4FK2A 1XR6A 3VZIA 1XHXA 3ZSXA 1YJTA 3M6XA 3F0NA 4WKYA 3QIOA 5KGXA 4RU2A 3SJHA 5JMVA 5J2QB 2FC9A 3CD6S 1RCHA 4LVOP 3BO2A 2X6NA 2KW4A 4FWRA 2ZH9A 4WZQA 4KBOA 4HUGA 4E19A 3CYMA 1S9FA 5AJ3K 4DL0C 1SH3A 1B3TA 2G8FA 4LF8K 2VA3A 4QQBA 5C10A 3CCRN 3BREA 1M1HA 4NL5A 4A2BA 4OJHA 2ABYA 4BC3A 1HI8A 5HQLA 3W60A 5A8WA 3V9XA 3H46O 4CHOA 3O9RA 1YTYA 4U67L 3MMAA 2HHUA 2FBXA 2V8HA 2X7IA 4X4OA 1VQ8N 3DYAA 2D69A 3H4BA 3QMLA 2C2EA 3M7VA 5GAEP 4I56A 4KBIA 4JI3F 2GMHA 4BDPA 1HQEB 2HFUA 2EI5A 4PY5A 2Y1IA 3OTBA 4HDHA 3VGVA 2ZDOA 4DV2J 3MM6B 3RMAA 3EE3A 4A4JA 5L8RC 4JI5J 1NKEA 3WEEB 1OH5A 4DQSA 1QSYA 1SIWB 3KK1B 3VEYA 4GNIA 2F4VK 3NEKA 2JRSA 2GVZB 2KI2A 3J80U 4IO1A 4DQ8A 3CCSS 3T6JA 2XMWA 4CJUA 1E3MA 2E5LJ 3O6WA 4KGMA 3QSIA 4LF6F 4CEFA 5K8NA 4PG8A 2G8WA 2HEKA 4UY8O 3DRPA 1JLEB 4NEZA 4FLTA 2ZBIA 4ICLB 1KOOA 3TVYA 3ZSYA 3CJKB 3MGJA 4LY7A 4X2BA 2E5GA 1FRKA 3NBPB 3MAHA 3NMAA 5CXTA 1ATRA 3AA5X 3LAKA 2CG8A 2RUGA 1YVFA 2BM1A 2XS5A 4ZN3A 3W7BA 2L41A 4WPAA 1APSA 2XY6A 2O67A 5ELZA 2XM3A 3AOBA 2XYHB 4PKIA 1KVKA 2ZHAA 3BQ2A 5KI6A 2H3GX 2X3GA 2DNRA 4AHTA 1HNIA 2ACYA 3VQQA 2ZD1A 3EE8A 2AP1A 3MCOA 2QWQA 2CPHA 3GG1A 4O0NA 4BC4A 3DRSA 5AXMA 1K8KA 1D3WA 1YJUA 4WF9Q 5LMUF 1SL1A 1HKCA 1WSRA 4RR5A 4E7JA 4CT8A 5KG6A 4UY8T 4KHYA 2RU3A 2IRYA 4O0IA 4O3SA 1WAJA 4Q44A 4E7HA 3CDBA 4BVOA 1VQ4S 1IV0A 1NWKA 2CJAA 3T9ZA 1SKRA 2L9DA 2DNNA 5F8JA 2PSZA 3ZX3A 2PC6A 3NP5A 3B6BA 2DGQA 1HPZB 2E2NA 2R3VA 5DQHA 1UZDA 4ECZA 1RAFB 3T1HK 4CJ4A 3K58A 1KP6A 4LFCK 1IG8A 1TL7B 2F96A 3NGDA 4EP5A 3U9DA 4UOFA 1X4CA 1VSMA 1B92A 3X3UA 3IFRA 4UZCA 4CFAA 2WHOA 3NF9A 1FNMA 2W4CA 4KRWA 4K5RA 4USHA 2KH9A 5AQSA 2YNGB 2FLLA 3T5LA 5RUBA 4DCOB 4RW8A 3U6FA 1JMTA 2E5JA 4CH7A 5BYQA 3ET6B 4DWIA 1JJ4A 5AR0A 4LUBA 3BH6B 3B54A 3QJPA 1WF1A 2DO0A 2OHDA 4DF8A 1SQEA 4W5TA 5BREA 3UD3P 3MEGA 2CPDA 3SSRA 4B8AB 2P9LB 4K42A 3OJUA 2EBGA 4XPCA 1EX8A 4HUFA 3LP3A 3RZAA 3ZSVA 2Q0RA 4QWCA 4B8CA 1CJVB 5B0FA 2CVIA 3KDNA 3R6GB 2ZHBA 1T6DA 4TLRA 1NBEB 5KPZA 5EGYA 1N34F 3VQPA 1HWIA 5KG1A 2C2OB 4ZLPA 2IJNA 1Q79A 4YS2A 2RQ4A 3UDLA 2IA0A 4LMZA 5H1SQ 4CLZA 2NRVA 4ED4A 3BDEA 2XMMA 4BC9A 4P7TA 3CEDA 5CHCB 3NY0A 3C3LA 1JCFA 2OGUA 3OFEA 1X3NA 1FRJA 1W26A 1V3SA 3QJLA 1ZBTA 4PWWA 2IVFB 2M88A 2XLKA 4LR9A 4YB5A 1C0TB 5FLXY 2VWJA 4J9VA 4YN3B 2ROEA 1Q9YA 4U67Q 1BQXA 1TKXA 3MM8B 1N48A 4JI6K 2PEHA 1NK5A 3G6YA 1JJ2M 1CQMA 4CP5A 1EXQA 3TAEA 3PKYA 5LOQA 3DLEB 3OW2R 3W2VA 3OUYA 3B78A 4FJ5A 4PRFA 5AQPA 4CLPA 3NRBA 1V6HA 3HI0A 1VQKS 2QXLA 2RF2B 1RWXB 1QZ5A 1M5KC 1Y4ZB 4ZIWA 4A46A 3JQKA 4C8OA 3QAEA 3VAHA 2LYVA 2EC0A 3AY9A 4IO9L 1V3RA 4X66F 1KFSA 4B3TJ 5GIPA 1HARA 1S6QA 3G6EN 3TP2A 4XH5A 4G65A 3DDIA 3MX5A 4Q5VA 2AYBA 2EX3A 5DRKA 4DU7A 1REVA 2MKSA 1FTRA 2ZM6K 5FJ4A 1V9OA 2Z2ZA 5F0UA 1NSKL 2Z2MA 3PW5A 1Y5IB 1ILYA 2YI1A 1FT8A 2XWYA 3Q7BA 3FZ2A 1FTCA 2X3DA 3O3HA 4DCJB 2OTJN 5HJYA 1Y00A 4XH4A 1TYQB 1KQSR 1VS3A 1F9FA 4JP8A 1G2EA 1PIEA 1N5YA 3V6JA 4FLZA 2G13A 2NZ4A 4U7CA 4K41A 4X65K 2F9DA 3CCTA 3FEXB 4B9TA 1BI4B 1VK0A 4W4MA 4OLOA 3TNVA 4BE2A 1N33K 1J53A 3DN9A 4Q0BA 1Q7LB 2VC1A 3D1HA 3OR1B 1J5EJ 1E4GT 2DNOA 1QHAA 2QKBA 4GKKJ 1W97L 1IBMF 3H42A 4ED5A 4W5OA 3MZIA 3QT5A 2JVRA 4RW4B 2W41A 3HHNB 3EXYA 3PKMA 3KLFB 3AQOA 4P52A 2LA4A 3MCNA 2V2QA 3PIPQ 1TZ0A 2K2PA 2D5RA 1NK8A 1HNZF 4BC2A 1TMMA 4BRGA 2DH8A 3P39A 4CZMA 2EWSA 2QLXA 3VENA 2CJYB 1BG3A 2Q79A 4K0KJ 4DR4J 4URSA 4Y1DA 4EHUA 3L3VA 3ENWA 1YQHA 2UXCJ 2CWKA 1QUPA 4O8KA 3D6RA 1SJQA 4WJBA 4QIWD 1FRLA 3LQVA 4DL6A 3OPKA 1NB7A 1Z2LA 3H1VX 3R3TA 4IOAL 4JI0F 5KOXA 1UFWA 3ZTQA 2PMZD 5JICA 2XLIA 3C14A 1JKHB 1YAGA 5KT4A 4OYXA 3G25A 2RDIA 3ZZOA 2OLWA 4WK1A 4WP3A 2XYPB 3RAXA 4WP8A 2FLNA 5AQJA 3M9MB 1ZBIA 4F25A 1T9YA 4DFPA 4PL8A 3BP8A 5JVGL 1UOCA 3THYA 2WTUA 4FL9A 1TUGB 3NH0A 2CQ1A 4F0MA 4TU7A 4KHQA 1RZMA 4F3TA 1RSCA 5KRTA 5GINA 1I5OB 2CQ0A 4Y65A 4CEBA 2JH3A 5J2NA 4QOZB 2Z8QA 3MD3A 2EWHA 1LXJA 4WFZA 1HKGA 4DV2K 2MDAA 4ZVQB 3GMGA 3MX2A 3SAFA 1HNXF 4M7YA 4RUHA 5F8HA 1C2PA 3DJCA 3PACA 1V5VA 1OKJA 2F8HA 4YDXA 1OY9A 4ILGB 4AFFA 2DK2A 3UKRB 3EJMA 1S1WB 4J7CA 2VWBA 3ZTOA 1B7YB 2A2CA 4Y2IA 4A2AA 3KJQB 3U02A 3LGNA 4DTSA 4O0JA 1EX4A 2G2ZA 1X4HA 3I8DA 5EHHA 4DV0J 1ITGA 1K0TA 1QLNA 3AO3A 3UVJB 3OXGA 1S12A 1PILA 4PKGA 4R8UB 3ALYA 4KR0B 2VA2A 2R42A 3MPUB 3AVIA 1FWLA 1T8EA 3PV8A 2CQGA 2VOOA 5EDWA 1Z26A 4DCHA 2YNFB 1AFIA 1XUPO 1BA1A 4Y00A 3HHKA 1VMBA 4PAAA 3AO2A 2UUTA 5GAHI 1WG1A 3ATVA 4G1IA 1Q5YA 1T94A 4U6PA 2WB1D 1WG4A 4K5SA 4WFNL 3MR6A 1XMOJ 2ACMA 4NYZA 2IDLA 1Q8BA 1MU2A 2VH7A 3RRKA 4NB4A 2ZH4A 1FX2A 1ZAVA 2HGNA 2BXJA 4K4YA 3OTOJ 1HR0F 5D6GA 3ZEUA 2GV1A 3ZO7A 2MZSA 4FO0A 3IKMA 2UV8G 4IRKA 1VQPN 3CM6A 1K1QA 2XBPA 3AJ1A 4ENOA 1D9FA 5LL6d 1RAAB 3MOJB 3HHLB 4DX5A 4U7BA 4DL2A 1GFWB 4JKAA 5FPDA 2XMKA 3DAWA 2BE7D 4OI6A 2GVDB 1DLOA 1SC4B 4IRDA 2UVRA 1VRTB 1WLJA 3IR6B 3PRVA 2DHSA 2XI2A 3AY0A 4FVCA 1N36J 3TPQA 1TK8A 3R5JB 1RP5A 3M8RA 1RBTA 3MMVA 2RQCA 3QT8A 3H08A 4C8LA 3IS9A 1RHUB 3WQPA 1YF5L 2B51A 2JJ4D 3CE8A 4ID1A 1CG2A 1HNWJ 5LXRA 3LA0A 4DV5F 1WC4A 1OSCA 4ILRA 4M8LA 4BY9C 3D2FB 2DGUA 2LQ9A 4FP9A 3H25A 1VQNN 2G0CA 4LFAJ 2VQEJ 2LKZA 1M1GA 1WWHA 2E88A 1IVZA 2JWNA 3AT1B 4R5PB 2RE1A 4OHWA 3MR7A 4DXLA 3M8ZA 4DR3K 3QFHA 1U48A 1OH8A 3KLVA 1E6YB 5CZ1A 5KT5A 1T02A 1XQSC 4XTTA 1FWKA 4GKJJ 2EFQA 2ZGYA 2GJIA 3SPYA 2UP1A 4PQUA 5E41A 3D2WA 1DZ5A 3CC2S 4LBIA 2Q0UA 3PLAA 4JI2F 5AQYA 4KPCA 1URRA 4KQZA 3BO3A 2KKZA 4MLEA 5AQQA 3M8PB 1TP7A 3EKUA 2Q31A 4QCLA 3M05A 3UDEA 4EFAC 1UEVA 1QQMA 3N5BA 1C0MA 3PW0A 2XS2A 2HBRB 3GOIA 1KTVA 5B0CA 5HMYA 4KFBA 2VBWA 2W9CB 4EMDA 5CZVA 2EK6A 1HW9A 3CETA 4EK2A 3CD5A 4BHQA 1JJ2R 4IOAQ 3OYFA 4DTOA 1NUEA 4DSFA 1TL3A 4B3SJ 4NCGA 5A8WB 1NDKA 4OHZA 2L48A 3QNNA 2NRRA 2LXUA 4RLEA 2VZ9A 3ONQA 5AXLA 4K8ZA 5BN9A 4CIOA 3M3ZA 2V2ZA 5JVGQ 3W9HA 4TY8A 1G1XA 1UP1A 3MM7A 1VSEA 4ED1A 3QBXA 3NF8A 1BGXT 2HBKA 2BOPA 4AT1B 2N7YA 3CXCM 2MQQA 2XHWA 5FRMA 3NKYA 1MLAA 3IO1A 4OQJA 3OXFA 1VQON 2WAQD 3VWSA 4KH6A 4EBDA 4OYOA 1J2VA 6FD1A 3OTEA 4FWPA 4IH6A 3EKSA 2P9KB 3QINA 2LQJA 2IC3B 3UWTA 3LDSA 5EUHA 4M5DB 2E9RX 1JXLA 1VSJA 1JLAB 2W40A 3NCIA 4JI1F 4J8FA 2HZCA 2AP6A 3SUPA 5BR8J 1B99A 4PYAA 2PMHA 4FCYA 1S1XA 4F36A 3BV8A 3SQGB 2AJ1A 3O4QA 4MIBA 1NPKA 3U9ZA 4Q8FA 2D3OR 1IBCB 3T1YJ 1NK9A 3GFZA 3ZZUA 3ZTSA 4IH5A 4CJSA 4QWEA 5F8IA 1Z25A 2Z30B 2MQ8A 3H40A 1LWFA 2IRXA 3MMJA 3KJFB 3SZ2A 3QBCA 4ZIVA 4ECQA 1RT6B 1BLUA 2QRRA 1IWGA 4H5NA 4OI0A 3FRYA 4WFNQ 1J5EK 1NEEA 4C7QA 1NK6A 4E0DA 3DHWC 4NXNJ 4Z37A 3NGYA 2IM0A 1FE4A 1FRMA 1YJNN 1V4SA 2HLUA 1FHTA 5L39A 3H45C 1S3XA 4BACA 4OI3A 4QR2A 1XIQA 4DHVA 2VQFF 4FLVA 3VAFA 3ETOA 2D0AA 3MECA 3C15B 4FJ9A 5SZTA 4Y3CA 2QLJB 2XMJA 4H0VB 2M52A 3O08A 4EFHA 3PG9A 3OBYA 4DR4K 1FJEB 2YWHA 1ZA1B 3TSQA 4H5TA 3ULEA 4ZP8A 3CTRA 1RYSA 1CZBA 4B9MA 4ZLNA 2IMWP 3CJ0A 4Q8EA 1WC5A 5IV4A 3SK3A 2ZH1A 4ECUA 5IXUA 4DU8A 3O3LA 5EX0A 1JNZB 4QS9A 4LRCA 1PC5A 2HHWA 1KAYA 1D0EA 5I42B 4IKFA 2V4RA 4ZTFA 4QIGA 4TVAB 1HBNA 3HD2A 2XY5A 3PO5A 4F9OA 2B4JA 1NOZA 4JV1A 2G8UA 2YWGA 8AT1B 1KHVA 1XEZA 3GV8B 5C42B 2JEJA 4I6WA 2IAJA 2H9ZA 4ZKAA 1RAJA 4DX7A 3P1GA 1X4BA 3S3NA 1RAHB 4ITSA 2Y0SD 1U2FA 1AUSL 3SXLA 1S9GA 1HNVB 3NGRA 3EZUA 5JS1A 2F8EX 3KKSA 1Y0HA 2DGTA 4M63C 4DR1F 4H4KA 1VQ7S 4Z4FA 3UB5A 3ZYYX 3MI7X 4DV3F 2E29A 4OHYA 2DVIA 3P3DA 1WHXA 3FBCA 3P45B 4YB7A 2DD8S 1MMLA 4Y2CA 1IBKF 4MDAA 2O3DA 4L76A 4UUXA 4F0HA 3W64A 4LF5F 3F2KA 5HLFB 3IC1A 3IGVA 2E1YA 3NE6A 3BYPA 1R8HA 4DMZA 2VPZB 1TKTA 4JI3J 4NLBA 4OZ5A 2HHXA 4I4BA 3EEQA 3H5SA 4CHQA 3SJJA 3DOKA 1O8BA 3SQ1A 1O6XA 1T9VA 4LVNP 2ZZTA 4N5SA 3HZGA 2CQ2A 1FA0A 1XMBA 1EP4A 1VHIA 5A0YB 5GMEA 3SUQA 3CCWA 3TX0A 2OSRA 5HP1A 4TKTA 5KFIA 4LF7K 4JD2A 1PJ7A 4LF6J 3WXLA 3QNWB 3VAGA 4IDKB 5AQKA 1KLMA 1RWPB 4YDUA 3C0BA 1T05A 2BV3A 1TUWA 4BE1A 1SJ1A 2J0QD 4RX6A 1B64A 3UW1A 2NXEA 5A6WA 5E2QA 3OA9A 2Z1IA 2MEWA 5F8NA 1XWLA 1KN6A 3P5TL 3UO0A 4C11B 3M6WA 2QN6B 2ZUGA 3PRDA 2KYZA 4Y2AA 4ED3A 3I5CA 2MY7A 3TZXA 2B6AA 2B9YA 2YH1A 5EXWA 2PI5A 1MG7A 3LTOA 2BMBA 2CA9A 4M5NA 4NXMJ 1N5YB 3DXKA 3K17A 2EFPA 4NYOA 3R5CA 2ZJQL 1ASUA 4OZ0A 1RKIA 3CF5Q 4P71A 2ZKTA 3IMXA 1HRHA 2YHAA 4CD3A 3MDFA 1S0OA 3AVAA 1B4SA 4LFAK 2VQEK 1S4FA 4ILHA 3PJ9A 2POKA 4IOXA 4LQ3A 1J27A 3E1YA 2HMIA 2QSWA 1YJVA 1WEZA 4A8YA 1Y5LB 1QJHA 3I0RA 2KLAA 5LMUJ 2O8DA 1OSDA 4DUZF 2P2CB 3EY1A 2QK9A 2LDIA 3EGZA 4PHTX 4GKJK 3E66A 4A8SA 3WT0A 3W5XA 5F9LA 1LOUA 3M2RB 4LF4F 3RR8A 4EEYA 3EVOA 4DQIA 2MTLA 2CDQA 5DMRA 2JDJA 4BCAA 3BSCA 2IA6A 4OI4A 3KHHA 2BJ8A 4FXWA 3G82B 4X62K 3PHEA 4OKJA 4DFKA 2U1AA 2YX7A 4IH7A 3DMJB 3CPWM 3JXUA 4KHUA 2MQMA 3QBWA 2HBZB 3QLHB 4J90A 1VC5A 3QDKA 2ZBPA 4F8RA 3TWHA 3OYAA 3C14B 4JI7K 2FUG9 4QS7A 1RHKB 1U4BA 5EU7A 1F3FA 3M4XA 4CK3A 1VCTA 3CCQS 2ZDPA 4XH1A 1X9JA 3GYXB 4CJKA 3ZC4A 3UCUP 1UPPA 1H73A 1HIYA 1QVFR 3C7NB 4WU3A 4A8KA 4FKYA 5KFCA 5KFGA 5MLCV 5F8MA 1FDNA 3JXOA 1RDDA 1GLEG 1JXVA 2ALZA 3C6AA 3ILLA 3O3FA 2Y8WA 5AQXA 1GMWA 2XHBA 2UXBK 3G87A 1KAZA 1Q7YO 2OELA 3N4QA 2X51A 1N34J 1TV6B 5BRFA 5J2MB 3CJQA 1U1MA 1DBDA 3S41A 4NRUA 3OV7A 3QT7A 3EPGA 3OYNA 4DR7K 1TKDA 5D0GA 3P49B 3DGPB 2E1CA 2WW8A 2BQ3A 2PFFB 4HTIA 4LC9B 3NCQA 5HMXA 5G4DA 4KO0B 1DAXA 5K14B 3FCVA 3MEDA 3THWA 5D8HB 2XO7A 4EYIB 3PCOB 5M1PA 4FLXA 1LWCA 4ED2A 4J9LA 2E1AA 4MLHA 2VDIA 4PWDB 4AE5A 4I6YA 2GMJA 1PO6A 1VOMA 2GV9A 2CPFA 3L09A 1HWUA 5HMZA 4E7LA 2BBEA 3J7YI 2Z58B 4XPEA 2DH7A 4I7FB 3NGKA 2EFNA 3SDEA 1YTAA 1VJQA 4KKOA 1KXPA 1Q7YT 4X66J 3ZZYA 1S0NA 2QL7B 3OFFA 3GE9A 1TUVA 4CF0A 3H3NO 4CZEA 1NHUA 1FNXH 3H59A 5JXSA 2BJ7A 1Q5VA 1JLQA 1ZBLA 1WHWA 4F02A 2M0GB 5BYRA 3GZ7A 5B0EA 4WQ5C 4MK7A 2KXFA 3UCZP 3RAQA 5KT2A 4JKEA 2GHWA 5AZJA 2GW8A 1RABB 3GDQA 5GAHU 1VHFA 5A8RB 2DPIA 3C95A 1UWAA 3TSPA 3M30B 1JLCA 4OJGA 4CO1A 3ZNUA 4JV5K 2W42A 3OYDA 2H4WB 2YHBA 5CYQA 4UZBA 4KJIA 1S79A 3A3PB 3S3OA 1QDUB 2RQMA 2FY8A 3U3YA 3H1QA 4WWSA 3AFGA 3SMPA 1TAQA 1NJYA 3A8JA 5GADP 3K7RA 1J9AA 2VG7A 4AUKA 1HI0P 4DN0A 2NZCA 3V9UA 3SNNA 3SQ2A 1FFSB 2K8GA 3PFEA 2ZJQQ 3FZLA 5L38A 2YXLA 4FJMA 3IR7B 2AWZA 4H03B 1RT1A 2LMIA 3PR4A 2C22A 4QYZJ 5KFXA 1RDUA 2Q1LA 1HNZJ 3O1WA 4P75A 2HRYA 1Z05A 3AOCA 3I87A 4RBUA 2NZTA 3D2EB 3J80O 2BABA 1E4FT 4YORA 2VUGA 5FLXU 2YKMA 2E9TA 2AU0A 4PQUB 4FJIA 4A57A 2ZNYA 1T0TV 2AF6A 1RBAA 2ZJRQ 2JVOA 1SJ3P 2A1BA 2DR9A 3C6UA 3NOCA 1RHMB 1MN9A 1JJHA 2VFRA 4JI0J 3MEKA 2GWKA 3W5YA 3MN9A 4E89A 4QBUA 1JNRB 4LRDA 2KZMA 2FGCA 2XY7A 3CCLN 2OEKA 3MXIA 1NZ8A 2X6SA 4ZVTB 4HUEA 2BX6A 3CQXA 1K73O 5DZ6A 4CF1A 2QW9A 4NCGB 2BR0A 3VTHA 1YGYA 3HVRA 1SJ4P 3TRGA 4I1TA 3TSUA 3CSKA 1DEJA 1RLCL 2CJQA 4WQ4A 4V1Ak 1H74A 3D3BJ 3I82A 1HNXJ 4ZPVR 3TI0A 2V63A 3A3OB 4CHNA 5BPMA 1UWBB 3I9V9 5LSOA 4O3NA 3JSMA 1YBAA 3HKZD 3A5LC 3RB0A 2FHMA 4YY3F 2UXDF 5HROA 1KDNA 3SLCA 3MFIA 3LL3A 1RAGB 2P8IA 1U8SA 5E3QA 2V52B 1YITN 2BKOA 1S6UA 1BCMA 3IAS9 2R7SA 3I96A 2DXFA 4A47A 3SCJE 3T7ZA 2J9CA 1FD8A 2E5HA 1NJWA 3VQ9A 2V4JA 2CGJA 4B9NA 4H0OA 3JTPA 2ZZMA 4HT7A 3GL1A 4B1XB 3CULA 1K73T 4GVBA 3US5A 4CJTA 2KYXA 1F3VA 3J81U 1PJ6A 2O5DA 4C2MA 2HFSA 1S99A 1H98A 3VEZA 1WJ9A 3LPYA 2O8EA 4ZITA 1LAWA 2DIUA 3L2UA 2AJFE 2HW3A 3OS0A 2GBZA 3EDRB 5K5MA 1S6OA 1MA9B 2IJRA 4M5JA 5CCLA 1HR0J 3VZHA 1YJ9S 1S72N 5JJBA 1S4EA 1WACA 4JYAF 3MM5A 4MK8A 4OPAA 2WTFA 2ZEJA 4PL7A 4UOGA 1BIZA 4WTYA 2JL9A 2MJUA 2HBMA 1FEEA 4CYUA 1N56A 2J9DE 3BKUA 5T7LA 3ZNJ1 3AVLA 2YNIB 4OJ1A 1WEYA 1YBUA 5BN8A 3IG1A 4NOHA 3M6VA