5C24A

Crystal structure of hiv-1 reverse transcriptase in complex with 7-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8-dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
537
structure length
537
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPAKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
total genus 151
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c24A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c24A05
1TKZA 2FVQA 1KCFA 2CKWA 3O3FA 5KFNA 4RW6B 1HNIB 1EKEA 3TANA 3B6PA 3KMSA 5E41A 3CJ0A 3TQ1A 2XY8A 3DLHA 4B9NA 4HVJA 4IFVA 1S9EB 4X2BA 4NRUA 1IKXA 2FVPA 3KHRA 4CJLA 4PUOB 2QV6A 2B5JA 4QWBA 5EUHA 3LZJA 2ITGA 1MMLA 1J5OB 1JLCA 5CZ1A 3WNGA 4KAZA 1RCHA 2IS3A 5KFKA 4NYZA 4Y1CA 3SNNA 1N6QB 5FDLA 5HLFA 3HKWA 2WTFA 3PW5A 1S97A 3PR4A 3LALA 2O5DA 3KD5E 4JRQA 2F96A 2ASJA 4DSKA 1S1WA 3KJVB 1EX4A 3NF8A 3AA3A 2J6UA 3NHGA 3MXIA 2ASLA 4ZPCA 1NK8A 4M3TA 2KFZA 1HNVA 2XHBA 4TLRA 3LWLA 4CHNA 4IG0A 3DOKA 1TAUA 1NJYA 4Y1DA 3CDEA 4RNNA 1UWBA 4FJ9A 1X9MA 3HXMA 1ZYQA 2BANB 2YNFB 2HNZB 1RT5B 1QUVA 5HP1A 5EU7A 4CGGA 2D3UA 4PQUB 4CHYA 4RZRA 1KHWA 1FXXA 4FJLA 1RT6B 3QEIA 1KVCA 3PW0A 1TKXA 4NLWA 3AVLA 1YTAA 3GV7B 2HNDA 2KQ2A 1S1TA 3EZUA 2QXFA 5K14A 1C2PA 2RDIA 1NHVA 4O4RA 3THVA 3K58A 4KTWA 5DMRA 2UVRA 1WSEA 4CGFA 3ASMA 2HMIA 5FROA 3AVCA 2FVSA 2FLPA 2D0AA 4LY7A 3WNEA 3C6UB 2QKKA 3PY8A 4ID1A 2C2RA 1JLFB 1SH0A 5KFEA 4KO0B 5EWFA 1C6VA 4Y2CA 3DLEB 1BHLA 2DTUA 2ATLA 3S9HA 1D9DA 4I7FA 5CYMB 3V6DA 3KJVA 3EYZA 1C1BA 4MFBA 4RW8B 4YR3A 4CF1A 2GC8A 1JLQA 1RTIA 2HHUA 1DTTB 5J2NB 1HYSB 3QEPA 2ZD1A 4Q8FA 1I6JA 3BQ2A 2AJQA 4IDKA 2V9WA 4FJNA 4FJGA 4FZYA 2J6SA 3AO2A 1RTDA 3GILA 3AVIA 2XY7A 2RDJA 4O3PA 4KHMA 1YVFA 1RBUA 4HHTA 5D3GB 4NLOA 4NLTA 3HVTA 4HKQA 1ASWA 4GVMA 3VQSA 2EX3A 3MEEB 1VSHA 1Q9XA 2XO7A 3FQKA 1RT6A 4J2BA 3TAEA 3KLHA 2YNGB 1CSJA 3LP0B 3WNFA 4ICLB 4JLHA 3P83D 4E1NA 3AVFA 5KFYA 5HROB 5D3GA 2OZMA 1RT1A 3QYYA 3MR2A 4KI6A 3NAHA 4FLYA 2AWZA 2E6LA 4FJ5A 4KTZA 1EETB 2WCXA 4ECYA 4KFBB 2B4JA 1N5YB 1T7PA 3KTQA 3QO9B 3M9NB 4B9LA 1TVRB 1VSEA 4KO0A 2FVCA 2R8HA 1CLQA 5SWMA 3QLHB 5CYMA 3PX0A 3KLGB 2FBXA 1NOYA 1X9WA 1EP4B 2F8TA 3RR7A 4NCBA 4FW1A 4DLEA 4IRKA 2OA8A 1JLGA 3G6XA 4M41A 3BDPA 4ZTJA 2XGQA 4AH9A 4TYBA 1YT3A 3ZT2A 1RTJA 1S1XA 2ZE2B 3M8PA 1LAVA 3AO5A 3L3VA 4WXOA 3FSIA 4WFXA 4B9VA 3HJFA 3LZIA 1ZETA 4FJXA 2YNHB 1JXLA 4B9UA 3CFPA 1J9AA 3OYMA 3S3OA 4N47A 5J2PA 3NFAA 5KFQA 4O0IA 4OKEA 1U09A 2R8IA 2V0NA 1U4BA 4Q45A 4FCYA 2ZQBA 4DTUA 2AX0A 1CXQA 5JS2A 2JEJA 4IRDA 4DQRA 1C0TA 2C2EA 3C94A 5HLFB 1QQCA 1BGXT 3CFOA 1U47A 4QWDA 3LDSA 1C1BB 1S6QB 3SV4A 3T5LA 3OS1A 2DPIA 1NK4A 2OPQB 3NGZA 1Z25A 1RT4B 3KK3B 4IDKB 2YKNB 5C42B 3DLRA 4O3NA 4AHVA 3OYHA 2RF2A 4M3YA 4FS2A 4NLGA 2EC0A 3BSCA 4BWMA 4BDZA 3H98A 1RTHA 4MIAA 4ECQA 1T3NA 3PX4A 3LWMA 1RBRA 3H4BA 4M3XA 2FC0A 1BQMA 3AO3A 1RT4A 1JL1A 4DTOA 3DM2B 2OPRA 3H5XA 1KFDA 1LW0A 1QE1A 3CDUA 3F9KA 1C0MA 3GYNA 4FLVA 4FLUA 1F21A 2FLNA 1K1SA 3PUFA 3KLFB 3C95A 5KT6A 4N56A 4FS1A 4RNHA 2JGUA 3CVKA 4JRPA 5KFAA 4J2DA 3IG1A 3M8QA 1QS4A 4EZ6A 2BRLA 4JV2A 3L8BA 3A2FA 4KHRA 2XCPA 1W25A 3OL7A 1T03A 4ZVEA 1IG9A 4FXDA 4LSLA 3CQ8A 1XHXA 3T3FA 3HT3A 1SKSA 1JLFA 4W5NA 3KHGA 2IAJB 1MU2A 4OLBA 1NK7A 3MFHA 4JS5A 1QSSA 4YNQA 4MK9A 3IRXB 1DTQA 4ECRA 4I7FB 3AO4A 4K8XA 4O44A 4CJRA 2BQRA 3AO1A 3OHBA 1HYZA 4Z4GA 3M8RA 1SV5B 3H5SA 3VQBA 2W9AA 3SQ1A 4WFYA 1HYSA 4CJ5A 1IO2A 4J9PA 4IBNA 4K8ZA 3IS9B 1S9FA 1WLJA 3SFGA 4ED8A 1RTDB 4ED2A 5KRTA 3T5JA 4LSNB 4CK1A 3V4IB 3T5HA 4URGA 1A5WA 2IMWP 2P5OA 4DWIA 3MF5A 1XR6A 4Z4FA 1D9FA 3O3GA 1D1UA 1NKEA 1N48A 1JLEA 3IS9A 3KIOA 5C5JA 4YQWA 1RBSA 2X6SA 5KT3A 3V6HA 4DTSA 3GIJA 1BI4B 2IC3A 4DEZA 1LWEA 4ICLA 4CJ3A 3OYIA 4O3RA 4RW7B 1N5YA 2OPQA 2DFHA 3T19A 4BWJA 3KLEA 4F4KA 2XGPA 2Y1IA 2OZSA 4KTQA 4B8CA 3G10A 3P1GA 2VG5B 5KG4A 4QPXA 2W9CA 3ZT1A 2FVRA 4OPKA 2GV9A 4NZ0A 3UIQA 5KT2A 1KVBA 4H54A 1S1UA 3C6UA 1SKRA 1ZBIA 3OL9A 2FJWA 4DSIA 1KTQA 3MEDB 3S3NA 4IQXA 3MEGA 3SCXA 3NH0A 1IKYA 2IM3A 1RTJB 3LP1A 1NK5A 3OLBA 5KFFA 2R8GA 4F4YA 2W9BB 3SI6A 3VQ6A 1UWBB 3PX6A 1X1PA 2FJVA 3VQEA 4FM2A 3JYTB 1VRTA 1HQUB 1C1AA 1WAJA 4XO0A 3RBDA 2HHXA 4G1QA 4KREA 4IR9A 2IOCA 4HUFA 1VSMA 3RWUA 3V9XA 4FK0A 4EBDA 4DSFA 4KHUA 4I2PA 3HPOA 4FK4A 2WONA 4LQ3A 4CE9A 3DLBA 3P5JA 4NLRA 3RMAA 3I0SB 4B3OA 4J9QA 4KB7A 3OSNA 5FRMA 3BREA 5KGWA 4LD0A 5KG2A 4F3OA 1S9GB 3MR5A 1KSPA 5HROA 2C28A 3TR8A 4DQPA 3DLGB 1HMVA 2OPPA 4U6PA 4J2AA 2E9TA 3OS2A 2QKBA 3N6MA 4Y2AA 4YFUA 2BE2B 3DYAA 3ZT4A 5KFWA 3VQCA 2IM2A 4IG0B 4Z4EA 5F8GA 4KV8A 4QWAA 1DTTA 5C42A 3BR9A 4ID5B 3AA4A 3RAXA 2PYJA 4J9MA 1HRHA 4C8MA 2XY5A 3I8DA 3H59A 3V1QA 1QAIA 1JLGB 1JLAB 2E9RX 3OJUA 2KFNA 2HHTA 5HRRA 2NUBA 2B6AB 3C6TA 4NLUA 3NL0A 1BCOA 1UAXA 3OSPA 2PYLA 3KD1E 3GV8B 3V1OA 2D3ZA 5HRSA 3H40A 3V1RA 4OGCA 5HBMA 1JLBB 3QIOA 3I0RA 2YHBA 4CECA 2D5RA 4EYIB 3VN5A 4K4XA 2G8FA 2F8SA 4CF0A 3M8QB 2GIRA 5DK5A 3CM5A 1ZBLA 3HPHA 1KLNA 3LPTA 1HPZA 5F8LA 3KK2A 3TI0A 4NYFA 4I2QB 4PWDB 3BSNA 2XI3A 1YVUA 5J2NA 2YKMA 4YR2A 4DL7A 2XWYA 2VG6B 1BQNB 1C0UA 3OYDA 4L8RB 1MU2B 3QINA 3QESA 4FVMA 3U3GA 4DTRA 1VRUA 4R5PB 3E01B 3QZ7A 1SH2A 5CYQA 3AVBA 4MIBA 1JXBA 4DL6A 4RNOA 4IR1A 5J2MB 4J9KA 3I5AA 4B08A 3ZT3A 4FZZA 1C0UB 3ZSQA 4CF9A 2HHVA 3DOLA 2WHOA 1L3TA 4DTJA 4DSJA 2HWIA 1SV5A 1VSJA 3ZSXA 4DF4A 4R8UB 4LH5A 2HW3A 4ECSA 3NBPA 2X78A 1S6PA 5EDWA 4CJ4A 4CEQA 4UQGA 1RBTA 2LSNA 4URQU 3OS0A 3L2WA 2Z1IA 3I0SA 1UA0A 2R8JA 2F8EX 4FLXA 4Y3CA 3TAFA 4K4WA 3ITHA 3DOLB 2QE5A 4NLVA 2HNDB 4QW9A 5KFUA 1S1TB 4MQ3A 5KFBA 1QHTA 4M3UA 4DL2A 3T1AA 3VQDA 1TK5A 4CGIA 4J9RA 3BJYA 3RMBA 4DL5A 3QO9A 1RA7A 4KKOB 3SV3A 3SQ4A 3CJ4A 2BDPA 3OL6A 4CFDA 4CESA 4BE0A 5KT4A 3KMQA 1FKOA 5KFTA 5DQGA 1TGOA 3KOAA 3ZSVA 3LAMA 3K2PA 4OVLA 4DMNA 4GC7A 2YKNA 4RU9A 3AVKA 1TKTA 3AVJA 3PVXA 1WSIA 3OYAA 3HK2A 4N41A 1RDCA 3RRGA 1S1UB 2GUIA 1YTUA 1TL1B 3MECB 2UVVA 3L3UA 1TV6A 1EXQA 3M8PB 2IM1A 2B6AA 4PA1A 1TK8A 1BQMB 1KRPA 5KG3A 3OVNA 3NMAA 3M8SA 3DI6A 5KTQA 4XIUA 4CJKA 3IGNA 4AHCA 4Z0UA 5KFSA 3ZSYA 2BQUA 5KG6A 1S6PB 4HTUA 4KHYA 2O4IA 1Q9YA 3VA0A 3ZT0A 5K14B 1DLOA 1IKWB 2RPIA 3PO5A 4HCBA 4Z4HA 4IOBA 4GMJB 5L1JA 1RILA 1R0AA 1W9HA 4PY5A 4FYDA 4JV0A 4DSEA 1NKBA 4OLAA 4N76A 4H4OA 4AHSA 5DQHA 2E9ZA 1EETA 1BIUA 2B5JB 2FBVA 1TL3A 4CEDA 3MAQA 1HARA 2QK9A 3DLKB 4TN2A 1QAJA 3QGGA 2AGOA 3ISNC 1ZBFA 3HYFA 4QCLA 5J2MA 4FJHA 3QETA 1U49A 3DRSB 4BDYA 2I5JA 4Q0BA 1SL2A 2YHAA 3L2UA 5J1EA 5F9NA 5JS1A 3BGRB 3SYZA 4FK2A 3DRRB 1JX4A 1RNHA 2G8KA 4FM1A 4AHTA 4YR0A 4CHQA 1CZ9A 4MKAA 1XR7A 1T05A 5HRPA 1U04A 1SH3A 4EP5A 4CCHA 3KLIB 4JV1A 4HUGA 4M3WA 5HBMB 2Y1JA 1RTHB 5J2QA 2GBZA 2D41A 4EP4A 1C1CA 1CZBA 4J9OA 1G15A 3PJWA 1D5AA 1REVB 1BI4A 4EEYA 1JLBA 4HCCA 3TAMA 1VK0A 3NH1A 4CGJA 1NNDA 3LAKA 1QSYA 3DRPA 4K4TA 4C8OA 2YKMB 3QGIA 4RW4A 5KI6A 4B9TA 4ZP8A 2HMIB 5KG1A 1HPZB 5KG7A 3B6OA 2W9CB 4ZMMA 4YP3A 1TL1A 1S5JA 4B8AB 1BQNA 1ZTWA 4CF8A 3HHKA 1B92A 1XWLA 4CJUA 4KHWA 3ICLA 5F8HA 1RT3A 2R8KA 3M9MB 3IN5A 4NYNA 1D0EA 3SUQA 1RT5A 2AGQA 4ZPBA 4CJTA 4ZVGA 4AHRA 3DDKA 3AV9A 3NGDA 3SZ2A 3QERA 1T94A 4E3SA 1RAJA 4I9QA 4F2RA 3HVTB 1HNVB 4IH7A 4ED0A 3EZ5A 2ZKUA 4U7CA 4R0EA 4OKKA 3I5BA 1HNIA 3CJ3A 3RAQA 1RDBA 3HL8A 1JLEB 2Q3SA 4O3QA 3NF9A 4KB1A 1LWCB 1L3UA 5F8MA 1IH7A 1REVA 3LP0A 1LW2B 4KFBA 3FFIB 5JXSA 3MXJA 2BGGA 2GIQA 4TQRA 1XC9A 2VG5A 5KFPA 3VQAA 2VWJA 2HB5A 1KVAA 1IKYB 3EY1A 3KKRA 4G3IA 2AX1A 4NLYA 2W8LA 4RW7A 1WNSA 3DRRA 2BR0A 3KLVA 1BL3A 4ECVA 4ED1A 4DF8A 1TKXB 4WYLA 3TAQA 4F2SA 4I9LA 3DI6B 3KLIA 3KHHA 1S9EA 5CZ2A 1VSKA 1A5XA 1RTIB 2JLEA 2YNGA 3MEDA 5EWEA 4ELUA 4PUOA 1GX5A 3K5MA 4CEZA 4GC6A 3FQLA 1FK9B 1RT7A 3G6YA 4AHUA 3QEWA 4Z4CA 5J2PB 2HHQA 1VSDA 3KK1A 3TAMB 3OYLA 1WSHA 3RTVA 3CM6A 2R7YA 5I42A 4CJFA 3OLAA 4RW9A 4NLDA 2YNHA 2W42A 3V6KA 3HP9A 3SUPA 2BQ3A 2IAJA 3OHAA 3V81A 4DFJA 3CYMA 3I5CA 5L9XA 4FLWA 3QIPB 3PJXA 4FLTA 2HWHA 4DTPA 4OJRA 3RRHA 5FDLB 4FJJA 4DL3A 5KGXA 5I3UA 1RDDA 1A5VA 3H2LA 4URSA 4ECUA 5DLGA 4KHQA 1TL3B 2BE2A 3DYAB 1JKHA 3Q8RB 4KE5A 3OYGA 5KFLA 2G8UA 1ZBUA 1NJWA 1TAQA 5DGAA 4ECXA 1S9GA 1JLQB 4LH4A 1FKOB 3ISND 4CEFA 3SUOA 4K50A 1HMVB 4RUAA 2YNIB 3T5KA 2I1RA 1EP4A 3BSAA 5C25B 3VQ8A 3BSOA 5F8NA 2V4RA 3GV5B 3TAGA 3OYNA 2VA3A 4TSXA 4CEOA 3RB0A 4FW2A 3OYCA 5L1KA 5F8JA 2OPRB 2IJNA 3QEXA 3OYEA 4W5OA 4O55A 5T14A 2P5GA 4NRTA 1B9FA 5F9LA 3KK1B 5C25A 4CFBA 3GIIA 2RN2A 2AQ4A 1S1VB 4F50A 3BQ1A 4WXWA 2R2RA 2OH2A 3HSTB 4IKFA 3DRPB 1RT1B 3KK2B 2PY5A 1JXEA 3VQPA 4CK3A 3QIPA 1NJZA 2JEFA 4K4YA 3D28A 1SKWA 4MFBB 2IJFA 3PW4A 2VA2A 5KFRA 4CJEA 5I3UB 5DLFA 1S1VA 1K1QA 1LV5A 1RYSA 2RF2B 4DL4A 2HHSA 4W5TA 4FJ8A 3OYFA 4KI4A 4RW8A 1WNEA 3K59A 2VWKA 3D0PA 2UVWA 4Y34A 2HVIA 3KLGA 3QIDA 3AVHA 4EBEA 2ILZA 3NBPB 2HHWA 2KW4A 2CJQA 4E7HA 1X9SA 1TKZB 1UOCA 4Q44A 1BIZA 3VQ7A 1FK9A 2WRMA 4HYKA 3SPZA 4K4ZA 5J1EB 4RNMA 2J6TA 1I39A 5KFOA 3TAPA 4EYHB 2W7OA 3IG1B 4CEEA 2UVUA 4OL8A 1ASVA 4QWEA 4E0DA 1I3AA 3ITHB 3PW2A 4JUZA 3QZ8A 2HNYA 5SZTA 5L1LA 4FJIA 4ECTA 4HUEA 3LPUA 4ECWA 2DFEA 1XI1A 4ZPDA 4ECZA 1JLCB 3SI8A 1RT2A 4ELVA 3PW7A 1TQLA 4O0JA 4IG3A 4DG1A 1LWCA 3DLGA 3TABA 1Z4UA 2D0CA 1SUQA 4CEBA 4F4ZA 3EPGA 3JSMB 4BE2A 2ATQA 2BRKA 1DTQB 4O5BA 4DQQA 4YMEA 4NCGA 3RB3A 3HVWA 4CGHA 4KV8B 3DM2A 2JEIA 3Q8PB 4O44B 3TARA 4DG1B 1IKVA 4F4XA 4RW4B 3E01A 4IH6A 1UA1A 3NF6A 1NK0A 1NK6A 4F8RA 2WB4A 3NGYA 3OYJA 1L5UA 3SQ2A 4RUCA 4FZXC 4WE1B 3PV8A 1IKWA 3GIMA 4DTXA 1JL2A 4KHSA 4LSNA 2A1SA 2V4QA 5KFGA 3K57A 2JC1A 1J5OA 4CGDA 3G6VA 4K4UA 4G1QB 1U48A 3VQ9A 1NKCA 4TY8B 4CFAA 2DY4A 1N6QA 4OGEA 1VRTB 2X74A 3O3HA 4IRCA 4QOZB 5KG0A 2UUTA 1NOZA 4ZP6A 3KLHB 4WZQA 5J2QB 5KFXA 1RDAA 4CEAA 4DFMA 4Q8EA 3L2QA 2RKIB 3SPYA 4DS5A 5C24A 2O4GA 3V9ZA 4TY8A 1WSJA 3QEVA 1VSFA 4DLGA 5T7BA 1SUQB 3NCIA 1GOCA 3V81B 5KFZA 1S6QA 3MTKA 4Q0BB 3VA3A 4CIFA 1LWEB 5CYQB 1T8EA 5HP1B 1S49A 1NK9A 2KZMA 1FKPA 4J2EA 3ALYA 1Q8IA 1Z26A 1WAFA 4C8NA 3IRXA 3M9OB 4O4GB 4TQSA 1QE1B 2XY6A 4MK8A 2ILYA 4M3RA 3BGRA 4ZTFA 1BCMA 3BQ0A 3V9WA 4M95A 5JUMA 4CHPA 4CIGA 1RBVA 3CO9A 3Q8QB 4QWCA 4IFYA 2IM0A 4DTNA 4K4VA 4E1MA 1XHZA 3HP6A 3IAYA 5CY4A 2WOMA 3MXMA 2IA6A 3KLFA 3RMCA 4I2PB 3ZSOA 1B9DA 4ED3A 4QAGA 1L3VA 2HNZA 2OPSB 4H4MB 4KPYA 2ASDA 3UQSA 4W5QA 3FDSA 1HQUA 4QW8A 4M45A 3CJ2A 1S10A 3HVAA 2C2DA 3VQ5A 4J9SA 4AILC 3FFIA 3K5OA 1TP7A 3K5NA 3QNNA 4RW9B 1ZTTA 4TYAA 1KLMA 2R2SA 2IGIA 5KT5A 4CF2A 4M42A 2DPJA 2OYQA 4GW6A 4H8KA 1XR5A 3AA2A 2P1JA 1C1CB 3LP3A 2X6NA 1RA6A 4R5PA 3N6NA 4KSEB 4E7JA 4ID5A 3OL8A 3NAEA 3H08A 4IH5A 5KFCA 3QGHA 2YV0X 3CDWA 2Z1JA 1L3SA 4NLXA 3IGVA 4Z4IA 2BANA 1S0MA 4K4SA 1GX6A 3V9SA 4ELTA 5KFVA 1OS5A 3S3MA 3KHLA 1S0OA 3C6TB 4PQUA 2WONB 2VG7B 2W8KA 4Q43A 2ZD1B 4TY9A 1S4FA 1CXUA 4BACA 3HPGA 3MR3A 3AVMA 3K5LA 4B9MA 3AA5X 5C24B 2P51A 4FLZA 3NGIA 5DQIA 3LP2B 1O1WA 4CFCA 3SFUA 4EO8A 1JLAA 3CFRA 4C8LA 2OPPB 5KRSA 2IC3B 3EPIA 5KFIA 4ZHRA 2XRIA 3O4QA 1HQEA 3NH2A 4XPEA 3DLKA 3RB6A 5KT7A 3DMJB 4DQIA 2FBYA 4WFZA 2B43A 5KFMA 2UUWA 4CJSA 1KLMB 1KHVA 4IG3B 4NCGB 3NKYA 4WYWA 1WSFA 4DFPA 2I5JB 4DS4A 2JEGA 4CJVA 1RYRA 1JKHB 3LP1B 2ETJA 1TKTB 4EZ9A 1TVRA 2A1RA 3KNAA 4I2QA 3O4NA 4E7IA 1WSGA 1IKVB 3GIKA 4NCAA 2Z1HA 3LANA 3G0ZA 4TXSA 3AVNA 2WOMB 2W9BA 4RG8A 3UDLA 3L2RA 3WNHA 1S1XB 2ZE2A 4LQ9A 4NLPA 3UR0A 3I0RB 1LAWA 4CJQA 4DSLA 2VG7A 4ZVFA 3CWJA 3MFIA 5I42B 1N56A 5KFHA 3OYBA 2XC9A 1TV6B 2R2TA 2XCAA 4RW6A 3GQCA 4ED6A 4KAIA 3CG7A 1IKXB 1RT7B 4E7KA 4B9SA 4JS4A 3NE6A 4DU3A 4KBIA 1S0NA 4FJMA 2G8VA 2D0BA 3V4IA 4ZP9A 4PWDA 5DG9A 3RB4A 3U6FA 4MKBA 5F8IA 1GOBA 4CERA 1T03B 4F4WA 5EWGA 4BDPA 2AU0A 4FBUA 1HQEB 2FJXA 3NAIA 1R0AB 4ZPAA 4M94A 5DGBA 1C0TB 3D5MA 2RKIA 2IBKA 1WN7A 4J9LA 2G8IA 1IM4A 2PZSA 1HYVA 5DG7A 1ASUA 4CIEA 1LW0B 4FBTA 4OKJA 3V9UA 2VG6A 2FBTA 3KK3A 3PO4A 1S48A 4DU4A 5DG8A 5KFJA 1TKDA 4C8KA 1RDRA 3ZSZA 5KG5A 4CK2A 1NJXA 3OY9A 4Q5VA 1W0HA 4IFYB 3DRSA 3DOKB 4DTMA 4ED7A 4BE1A 3L2VA 2ALZA 2FLLA 3HO1A 4EBCA 1JIHA 2YNFA 2KZZA 3G86A 4N5SA 3VQ4A 3VQQA 3D45A 1QSLA 4R8UA 1KFSA 1VSLA 3PR5B 4KKOA 4FJ7A 1SL0A 1BISA 3AVGA 1T05B 4FM0A 3NF7A 4EO6A 1LWFB 3H5UA 3DMJA 3SUNA 2HAIA 4NLSA 5FRNA 4IFVB 2OPSA 4H4MA 1D8YA 2DFFA 4DQSA 1GOAA 5KFDA 2G8WA 1DLOB 1RT2B 4M3ZA 4OPJA 4DU1A 1VRUB 4ZVHA 3HM9A 5L1IA 4E19A 2HVHA 1SL1A 1VSIA 3AVAA 3CIZA 1LWFA 4MH8A 3UPFA 3JSMA 3SQ0A 3RR8A 4KRFA 4XPCA 3ULDA 3RMDA 4CJWA 4MK7A 1Y97A 2Z1GA 4H4OB 3TVKA 1N4LA 3MEGB 4O3OA 3HVRA 3Q8SB 3RBEA 1RT3B 1K6YA 3F73A 4F3TA 3PHEA 3ZSRA 2JC0A 1J53A 3E51A 1FKPB 3FRZA 1TK0A 4WE1A 4J9NA 3MEEA 1NHUA 4O4GA 2EHGA 4KB0A 2WK4A 2G8HA 4E7LA 3MR6A 3N6LA 5HRNA 4W5RA 3LP2A 1HJRA 3QNOA 1QTMA 4ZHRB 1J54A 3OJSA 3PZPA 4B3OB 4IKAA 3U3YA 4LSLB 3TWHA 4E89A 4CHZA 3V6JA 2XI2A 4FJKA 2E4LA 2D7SA 3OYKA 2W7PA 4CHOA 2R2UA 2IDOA 3H5YA 3KLEB 3CJ5A 4O3SA 3SJJA 3ZCMA 1LW2A 4ZP7A 2HNYB 2AGPA 1S1WB 3ZSWA 1U45A 3H4DA 3NDKA 3MECA 3JYTA 3QLHA 4RNFA 4NLQA 4CJPA 3DLEA 3V6DB 3KKSA 2KTQA 2E6MA 1ZBHA 2YNIA 2C22A 4DFKA 4WZMA 4KHNA 1ITGA
chains in the Genus database with same CATH superfamily
4TLQA 4EWTA 4LT6A 1KCFA 2CKWA 4JI5J 3SK3A 3O3FA 2F63A 5AZJB 3O6WA 2IY5B 3BKFA 3MD1A 3KMSA 3CJ0A 2XY8A 3DLHA 2OTLN 4HVJA 2HGNA 2ZOMA 3TX0A 5AQRA 4X66J 3ZTRA 3DNCA 4PUOB 3AD7C 1KDNA 3LW5C 2ITGA 3TA0A 5F0UA 2CPDA 4KPCA 1T9YA 1J5OB 1JLCA 2DEJA 2HBYB 5DZ7A 2FJEB 3AOBA 4Y1CA 1N6QB 1N8RO 3VAKA 3PW5A 3GJSB 4K0KF 1NGFA 4DSKA 1S1WA 2ZC4A 3NHGA 2J6UA 2ASLA 2LP4A 4ZPCA 3F5TA 4M3TA 4MKYA 2EFOA 2LXFA 2FSNA 1QD1A 3DOKA 1TAUA 3HF5A 4QYRA 3CDEA 5TKYA 5KQ8A 5F0XA 3HXMA 1ZYQA 4K2JA 5HP1A 4IO1A 1SC3B 4CGGA 2V4JB 3J80Y 2DNPA 2XG8A 1UTAA 3BKTA 2DNNA 1RT6B 3PW0A 4U8YA 1TKXA 5CA5A 3BB5A 3QBCA 1S1TA 3EZUA 4JI1F 1C2PA 3K7RA 2C3OA 1U1KA 3THVA 5BPMA 4C1NI 2CQ0A 2BH1A 2UVRA 2B8QA 4CGFA 1NHKL 1H38A 3AVCA 2NYHA 2D0AA 1YJUA 2V2KA 3PY8A 2OFGX 1ELOA 5I4MA 2DXDA 1SH0A 2QYCA 3VVUA 1UVMA 4Y2CA 3DLEB 1D9DA 3AA8A 4C8YA 2YPYA 2UUCF 5LMUJ 2V50A 1C1BA 2JDJA 2RS8A 1N0VC 5G0RA 4CF1A 1LEOA 1JLQA 2HHUA 4PXBA 5J2NB 3QEPA 4EHTA 1I6JA 2RS2A 2VPYB 4AYBD 1G99A 4FJGA 2LXUA 1R89A 4OJGA 2VFUA 3NMRA 2RDJA 1ZH5A 4O3PA 4GVLA 3T9NA 4DR3K 5DZ6A 3I55S 4ID8A 3OXLA 2MKSA 5A6WA 5HL7Q 4GVMA 1Y7PA 1VSHA 4FSVA 5C12A 4A2BA 2XO7A 2UUCK 5A8KA 3GSIA 4JLHA 3P83D 4E1NA 1N32F 4P2XA 1CJKB 4FWQA 3VCDA 2C42A 1IR1A 2W40A 3EZOA 3M30B 3QYYA 4KI6A 3HHLA 2WCXA 3BS9A 1RU1A 4K8RA 1UL3A 3ZNUA 1VSEA 1T02A 2PAVA 2O8EA 1K9MO 4LF8K 4PWWA 1HBMA 2N4CA 3W7BA 3R5JB 5CYMA 5HK4A 3MK6A 3PX0A 2UXBK 3BPDA 3M5RA 3I31A 3RR7A 4NCBA 1RWUA 3VALA 1QTNB 4DLEA 3KNGA 1JLGA 2HVZA 3AOAA 1S72N 1QAXA 4AL5A 1RTJA 1S1XA 1APSA 3HSGA 3E8OA 3AO5A 3L3VA 2YXLA 2UUAF 3T1YF 1XNQJ 1MN7A 4FYYB 4B9VA 5B8HA 3OV7A 5B0FA 2YKOA 2K1RA 2L48A 2VFRA 3HFKA 5CXTA 4B9UA 1PYTA 1J9AA 1CEZA 3QRQA 2BA9A 2XMVA 2KKZA 2R8IA 1U4BA 4DV5J 4FCYA 3G6EN 4H03B 4DV7K 5EOYA 5L38A 4DTUA 2CJXB 2AX0A 2JEJA 2PEBA 4FWRA 3M2UB 3C94A 4X4QA 5A2QY 1BGXT 3CFOA 3LDSA 4GKKF 4Y6IA 4H5VA 2C3YA 3ZZUA 4P72A 1XNRF 1XMOK 2OPQB 4B3TJ 3BR8A 4IOXA 4IDKB 4M63C 5C42B 3RSEB 2YHXA 3UB5A 3O9QA 4M3YA 3P5BP 4WTYA 1VLOA 4BDZA 3H98A 4MIAA 3L7UA 5HJXA 3J80U 3C6HA 1RBRA 6FD1A 4LFBJ 4DOZA 4P75A 3KWGA 4DTOA 1AYEA 3TJAA 4I67A 3VR1A 3GYNA 3I33A 3OXGA 3TRGA 3E1YA 4DQ8A 2AJFE 4BRAA 2DNLA 1L3KA 2FGOA 4FS1A 3CVKA 2I38A 1RWOB 1QS4A 4EZ6A 1FRKA 1HNZK 1Q7YT 2Y0SD 2GJIA 1NO8A 2RMLA 3L8BA 1B99A 1W25A 3OL7A 2FF6A 1IG9A 1N8RT 4H5NA 4GY2B 2DXEA 5AZIA 4W5NA 2IAJB 1EQYA 4ZVQB 4DV7J 5BXIA 1OH8A 4DV5K 3PCOB 4OLBA 2DNHA 1JCGA 5LOQA 2XS5A 1GLAG 3NOCA 4PKHA 4I69A 5AFUH 5AQXA 4PKGA 1DTQA 3MD3A 2P9KB 3HSCA 3MAAA 4IO9L 2OEMA 3Q22A 3AO4A 4K8XA 2WZ1A 3US5A 3VQBA 3SQ1A 2J9EA 2AZ3A 4E98A 5L9NA 4K8ZA 4IBNA 1S3XA 5HMYA 4U7BA 4F0MA 3IS9B 1S9FA 3NOGA 4NWBA 1GTEA 5DDOC 4DV5F 3P8BB 2Z0GA 4FZVA 3V4IB 4URGA 2P5OA 4DWIA 3M1VA 4ZPVR 2UXBJ 2Z58B 2DNRA 1YDLA 2RHKA 1K0TA 3UO0A 2A42A 1N48A 1JLEA 2R9LA 2R7XA 1AROP 4KH4A 2C3MA 5KT3A 3V6HA 3QMQA 1T9UA 2NUUG 5BYSA 4CJ3A 2EI5A 3T19A 4BWJA 2Y1IA 3BZQA 4KTQA 3N9UC 4B8CA 1KC8T 1HBMB 1N34F 1GLBG 3A13A 4ZN3A 4QPXA 2X1GA 1XQSC 1HWUA 4OYXA 4NZ0A 2XEXA 1W2BM 1OWXA 2ZM6K 4H54A 4WFAL 1NGJA 3VQTA 3UCGA 2RUGA 4Y2MA 3SCXA 5ADXH 1RTJB 1NK5A 2NXUA 1XMOF 2YH1A 2ZF5O 1X1PA 3OW2M 2B9XA 3HKZD 1GEHA 1C1AA 2WSCC 1WAJA 1HJOA 3TNVA 4AXJA 3CCUN 3RBDA 2WFBA 2RRAA 2PSZA 4HUFA 2CFXA 1VSMA 2K7JA 4X4OA 2VPXB 5K8OA 4FK4A 1TL7B 3O80A 4ANCA 5THWA 3DLBA 3RMAA 4B3OA 4KB7A 2XZWA 2UXCK 5FRMA 4ES1A 4F3OA 1S9GB 3G71N 2C28A 4YOEA 1FERA 4CO0A 1IWAA 4EK2A 3DLGB 3GR0A 4U6PA 4DPXA 2ZEJA 1MSWD 3N6MA 4IEIA 1Y4ZB 2CG4A 1VK8A 2IYGA 3FBBA 3ENWA 3VAGA 3W5XA 2PFDA 5C42A 4LF8F 2DNKA 2EC2A 1RP5A 4K0KK 1B3TA 2HHTA 2SXLA 2JJ4D 4G1IA 3D2EA 2DIUA 3M8YA 4ISGA 3C6TA 3I56N 1UAXA 3OSPA 4X65K 2PYLA 3M2VA 2MQNA 2J7UA 3H40A 4YB5A 5HBMA 1WUAA 2A41A 2DHGA 4L6V3 4B1ZA 4M1KA 4CF0A 2GIRA 5DK5A 3CM5A 3MX5A 1F2GA 5EX3A 3LPTA 4Q2LA 5IV3A 4NYFA 5EY4A 5K20B 1TL4A 2FHJA 4YR2A 4DL7A 4V1Ak 1BQNB 3I4HX 4L8RB 5DS7A 3JTNA 4FVMA 5BJRA 1NJIO 2FQQB 3S1TA 2XMAA 1SH2A 3TUZC 5FPDA 5D0HA 4RJVA 5J2MB 2DBBA 3I5AA 4X62J 2W4DA 1MWKA 3ZT3A 1NEEA 3U27A 1C0UB 2WVCA 2BKPA 4JNEA 4UOGA 4WK1A 4FYVB 2B8PA 4RR5A 3DOLA 2M5YA 1DGKN 3BGFA 2YJEA 1VSJA 4DF4A 3ZSXA 3FZLA 2J8AA 1VI7A 3BH6B 2PMZD 2X78A 1QVFM 3OT9A 1RWPB 5EDWA 3JSBA 2Q97A 4CJ4A 4PXDA 4URQU 1FWLA 2N4DA 2QLWA 2F8EX 1A9NB 4K4WA 2QE5A 1VAZA 4NLVA 1UVLA 2CJ9A 1YF5L 2B3TB 2ZBQA 1Q53A 2CJYB 1TK5A 2ZHBA 2DJWA 1VIOA 1N0UA 2ZJQL 2EG1A 4KKOB 3SV3A 4ZN1A 4BG8A 2BDPA 2GGPB 3OTEA 4A62A 4BE0A 4NB4A 4B3TF 5L46A 1K44A 1P27B 3HULA 4DMNA 1FD2A 5K9FA 1TKTA 5IC4B 1FJEB 1RDCA 1RJJA 4A8SA 1YTUA 4DV6F 1B64A 3MECB 3L3UA 4RU2A 4LF9K 2IM1A 2B6AA 1TK8A 4ZS6A 1BQMB 1KWMA 3MN6A 3M8SA 1U1NA 4A8QA 3IGNA 4Z0UA 3U1MA 4HTUA 3VA0A 5K14B 1IKWB 2VQEK 3PKYA 2RJZA 2ZVSA 3U9DA 1RDWX 4OJHA 1R0AA 1S99A 2B7BB 3BPSP 2E1YA 2MZSA 4F3MA 5T7LA 1DQ8A 3WXIA 4N76A 4H4OA 3IA0A 2QO3A 4AHSA 5DQHA 3B78A 2CQ4A 1EETA 1XMQJ 2BJEA 1GT8A 5CZVA 3MAQA 2ZJQQ 2CG8A 2ZH3A 3CC7S 1Q8BA 2HS3A 2AGOA 3ISNC 2ZDPA 2XS7A 3CSKA 4CH7A 1TUUA 4B1YB 4FJHA 5GAEU 1S7IA 1U49A 3DRSB 5A2QO 4NXMK 3BYRA 4C97A 4ZVTB 3L2UA 1BE4A 3TZZA 2KO1A 3EWGA 5JS1A 2K8GA 4ZVPB 2KRBA 3I9V9 4K59A 2F4VK 4DV1K 4OFZA 1RNHA 1HPMA 2WBRA 2G1DA 2EEYA 2HWTA 4WWSA 1H7XA 1PCAA 1U04A 4EP5A 2KDOA 5D8HB 5HBMB 1JJ2M 3IMXA 3EO3A 2D41A 4UY85 1LXNA 5IFMA 1EQ0A 1WSVA 4J9OA 1G15A 4JYAJ 3N4PA 4MDBA 2OKQA 5BN8A 1CS4A 2UXDF 1KAZA 1RAFB 2CQ1A 3QMLA 1REGX 2XYGB 1FI4A 1R8CA 2GAHC 3B6OA 1NLKL 5AXMA 4B8AB 1BQXA 1BQNA 4A8OA 1ZTWA 5A0YB 2C3UA 5HAOA 1N5SA 2HHHJ 1CJUB 1D0EA 1VQKS 1RT5A 2N82B 2MLZA 1MN9A 5DETA 4AHRA 1V3ZA 3NS5A 4X66F 2KG0A 1HBNB 3EGZA 2R7SA 4H0PA 3NGDA 3QERA 1J5EF 4E3SA 1F1BB 4I9QA 4IH7A 3CF5Q 4ED0A 3AY9A 4QR0A 3CJ3A 3K5PA 3W62A 2XNQA 5JVHQ 4O3QA 2DGUA 4HHJA 1REVA 2IRUA 4ZCKA 2AJ4A 2POKA 1LW2B 3V4MA 2Q6CA 5JXSA 2ABYA 4CBWA 4G9ZA 2GGPA 4TQRA 3T6BA 1JCFA 3OTDA 1IBLJ 4O23A 2QFJA 4NXNF 2VG5A 3BEGB 1FXRA 5ITHA 3A4TA 3EGNA 3W9JA 2I9SA 1U2FA 3IBFB 3H25A 2E5IA 2EWSA 4NLYA 2MLXA 2W8LA 4RW7A 1WNSA 5LMUK 4Q7AA 3DRRA 4M5NA 1N36K 3HZEA 1BL3A 5GINA 4A5AA 6FDRA 4CLLA 1TKXB 3O2IA 1U24A 2YWKA 1Z6RA 4I9LA 3IUCA 4WIIA 3ZO7A 1D4XA 1ZA1B 1NM2A 1RTIB 2FC8A 4CZLA 3MEDA 2QW9A 3C16A 2Z4PA 3MCOA 2DNZA 1FFGB 3U7JA 1M90O 5M1QA 4UTGA 3OYLA 1WSHA 4CJFA 4USWA 1LOUA 2HRTA 2W42A 3V6KA 3MM6B 3J7YU 3EMTA 1DQAA 3TEGA 3WC2A 3CYMA 3I5CA 3G25A 4DDFA 5L9XA 2CPJA 1RE1B 3LDNA 1QZ6A 2HWHA 1YJ7A 5J1NA 5T7LB 2WBNA 2R3VA 4GO7X 1Q16B 1RDDA 2GQQA 3DYAB 1SPBP 4FF4A 1W26A 4KE5A 5KFLA 2IA0A 4JK8A 5AE3A 1GNKA 2W4PA 3THYB 5FJ4A 2J0WA 3R6LB 3H42A 4ECXA 4JKFA 3G8QA 4X62F 4M5IA 3CD5A 3SUOA 4K50A 2I1RA 3BSAA 3DU5A 2CZ9A 3OR2A 1WHYA 3SAHA 3CJKA 2GMJA 3OTOJ 3D1QA 1KN6A 1R59O 2VA3A 4QPTA 5L1KA 2UV8A 4L3KA 1SAZA 3PACA 4DPTA 3OYEA 1VQPN 2HGLA 4DR1J 3ISZA 4O55A 2M8DB 5F9LA 3KK1B 1VQYA 2IMOA 5AQTA 1RCOB 1S1VB 2H4YB 3BQ1A 4LFAJ 4FPBA 1QUPA 1UJ5A 3J7Z5 3R97A 4JI2J 1RT1B 1B0VA 3D28A 4F67A 1HL6A 2IJFA 2VL1A 4OYAA 3MMCB 5I3UB 3TEHB 3VAHA 5DLFA 1IJEB 3HD1A 3DXSX 4F04B 1E6VA 1WC5A 3OYFA 2UVWA 1QQOA 3DHWC 2BW2A 2NXCA 3QIDA 4EBEA 3BEXA 5AQNA 1EIYB 4DB3A 4PQAA 2BM1A 5K5MA 1PJ7A 4Q44A 3O8MA 2RVJA 4CH1A 2CPHA 1N34K 4QS9A 1ZM3A 3O1LA 1NB2A 2E7XA 4OZNA 4PG4A 2DRBA 2GHWA 4G1PA 2L9DA 2ZHAA 2J6TA 3WEEA 2CQGA 4OL8A 4E0DA 1KOOA 1OY6A 3ITHB 3PW2A 3QZ8A 1Q7YO 1R31A 4IJNA 4MMOA 3N0VA 4ECWA 1XI1A 4ECZA 2HSTA 3GSDA 3T41A 3SI8A 3WX8A 3UN3A 5F0WA 1HNWF 4OHZA 1JK9B 4CYUA 1RKJA 3TABA 4OO1J 1K9MT 1SUQA 2VBYA 1F9HA 4TKTA 4HACB 3J81U 4NCGA 4HHHA 4CGHA 2KHOA 3TARA 2L08A 1YJNN 3NGSA 4JHDB 3QRPA 4F8RA 1WKLA 2Q2RA 4EI2A 2BJ7A 2FXUA 2P9IA 4KH1B 1WF1A 1R0BG 3KHYA 2KI2A 3DXKA 3GIMA 1U2VB 3UN5A 4ANEA 2V4QA 4F4AA 1U02A 3K57A 4ZIWA 1JNRB 4J37A 4K4UA 5LMNJ 4C1NK 4UY8T 4LRDA 4OGEA 5AJ3J 5KG0A 2EWHA 4JD2B 5KFXA 1RDAA 4UOCA 3L2QA 5BN9A 3SPYA 1YITN 3V9ZA 1WSJA 3CJAA 2H48B 4DLGA 1VSFA 5T7BA 1RB0A 3VAMA 3UCZP 1S6QA 5LXRA 3MTKA 4YB6A 5JVGL 2CDQA 3HTVA 3E9LA 1LWEB 2ZZMA 1T8EA 2CJBA 1S49A 2CA9A 3C15B 4J2EA 3ZXWA 2BJDA 3NWGA 4C8NA 2HPUA 4CT8A 2XY6A 4MK8A 2ILYA 4KH6A 4M3RA 3BGRA 4AE5A 2NPIA 3V9WA 3MUTP 4CIGA 4JI2K 4I6MB 4DTNA 5K8MA 4HT7A 3SIPB 4E1MA 2RE2A 1XHZA 2J0SD 4GV9A 1U6BA 2J9DA 3MXMA 4OI2A 3ZSOA 3THWA 3C19A 4J9VA 3I6PA 3FUYA 1WKKA 2UUBK 4K42A 2RAQA 5DO2A 4BRHA 4HR2A 3VQ5A 4LF5F 2H4WB 2MJUA 2HQIA 3QNNA 4DV1F 4RW9B 4OJ3A 2QWRA 1DT9A 5FIIA 4CF2A 4M42A 1KNZA 5SUHA 2ZH1A 3AA2A 1C1CB 1RA6A 3F41A 3N6NA 2RQMA 3NAEA 1UKUA 3THPA 1ITPA 2Q43A 1RGVA 4S0MA 4Y65A 7AT1B 2Z1JA 2VB6A 2VJVA 4KBOA 4X4SA 4Z4IA 1S0MA 4BR0A 1OS5A 3S3MA 2OI2A 1NNEA 2UXDK 2DGOA 1S0OA 1TL7A 4Q43A 3IWXA 4UY8O 3V2UC 2JFKA 4BACA 1RBOB 4X4TA 2D9OA 3K5LA 4B9MA 2HBKA 5CHCB 4CP5A 5DQIA 3LP2B 2LQ9A 2P6TA 5LMNK 5KRSA 4RO0A 4NZ7A 2VWBA 5KFIA 2DH8A 3PTWA 4OPAA 1YBAA 2APOA 1NRKA 1VQPS 4HWIA 2OUGA 4DQIA 2B43A 2K2PA 4CJSA 8RUCA 4NCGB 1WDDA 3NKYA 3D2FA 2AJ0A 4DS4A 5DM7Q 1XMOJ 3LP1B 1S57A 1N5TA 1TKTB 1JJ4A 4B3SF 4EZ9A 1RFQA 3ZZYA 5GMKa 3R5BA 1NSAA 2CYYA 2F65A 4NMXA 4NCAA 5AQGA 3A8JA 4B1XB 3MPWA 3AVNA 4BR7A 3D9BA 1S1XB 1LAWA 4LQ9A 4NLPA 4DSLA 5B0AA 4ETXA 1YJWS 4ZVFA 3CWJA 1ZS6A 5KFHA 2XCAA 3GQCA 3ZZPA 1IKXB 1PG5B 2K1RB 2DRAA 1HR0K 1VQ5S 1S0NA 1NH7A 2YWFA 2M8HA 2D0BA 3MWTA 5DG9A 2DR9A 3O9TA 3VGLA 3U6FA 4MKBA 5F8IA 2VYPA 2JRSA 4CERA 2R7UA 1H6KX 4FBUA 4LF4K 4LFAF 2H5IB 2FJXA 2VPWB 4JI2F 4F7VA 4ZJOA 1R0AB 4CZJA 5DDQC 4C0BA 4DUZF 4YUDA 1WN7A 4KH0B 1UVJA 4NL5A 2JVOA 1EX8A 2FHKA 5E7OB 3W64A 4OKJA 1A6LA 1X5PA 3V9UA 2J9CA 1S48A 3KZBA 5KFJA 1NBEB 1RDRA 2IDLA 2CDRB 4MT1A 1NJXA 4Q5VA 2XMTA 2ALYB 2VOOA 1W0HA 3DRSA 4OIXA 1U26A 3CC2N 2DB1A 3FNNA 3L2VA 1WD6A 5AQUA 2ALZA 2QMWA 4EBCA 1FEHA 4GVBB 3CD0A 2HQFA 4N5SA 3CJ8A 2UUCJ 3D45A 4R8UA 1KFSA 3CCSN 4JI3K 2MQMA 3BYPA 3PR5B 3G96A 4KKOA 2E1ZA 5B0GA 5EGYA 5CR4A 4EO6A 1LWFB 2JLGA 3FKBA 4NLSA 1OYEA 4RBVA 2VFTA 5KFDA 3W63A 1DLOB 5GAHU 2RD5C 1SBRA 4OPJA 4BS2A 4DU1A 1VRUB 4ZVHA 3QNWB 2QYGA 1BHNA 4LREA 2GMHA 3GCWP 4KRFA 4XPCA 3ULDA 2XO6A 4CJWA 3AAPA 2CPZA 2YHYA 1IM6A 3HVRA 3Q8SB 5IOLA 2GS8A 1X5OA 3MOJB 2MKCA 3PHEA 4KT0C 1J53A 5BR9A 1Q81T 5LSOA 4C9DA 3E51A 2W7AA 5FPEA 2F5GA 3I4PA 4BR2A 2EHGA 2ZBCA 1BA0A 4KB0A 2DNYA 2WK4A 4PR6A 4BRFA 2G8HA 4E7LA 4U96A 1KQSR 5HRNA 1WC4A 1Y5IB 2NZ4A 2VKZG 3LP2A 1KVIA 2DH9A 1EWQA 3BBCA 1YIJN 1I51B 2RQ4A 4OZ2A 3T6JA 2V6AA 4IKAA 1RKIA 3U3YA 4LSLB 2A6OA 4E89A 5HATA 4OQJA 2YWWA 4FJKA 3DGPA 2E4LA 3D54A 2IDOA 4A48A 1NZ8A 3H5YA 3DRYA 4YOYA 3CJ5A 1FRLA 3SJJA 3ZCMA 5DJBA 1LW2A 5ETLA 2RNEA 2HNYB 3CNQP 3ID8A 1N36J 3ZSWA 1QVGR 1Q82T 1GMUA 3JYTA 4RNFA 3EJMA 4NLQA 4CJPA 4WFNL 1NLVA 3KKSA 2CPEA 2UUBJ 4KHNA 1ITGA 1ZBSA 4USIA 1WACA 1ATRA 3QJJA 1VYAA 4A46A 2CQ3A 3ET6B 1VDHA 2DR6A 2PC6A 3BY5A 4K25A 1OH5A 3LOUA 2K7KA 3CJCA 1EKEA 3BUZB 3TANA 3B6PA 5H1SV 2HVEA 4CO3A 4B9NA 4JI3J 5CHIA 4RTFD 4OI3A 2DTJA 4M5DA 5ADXA 2F9DA 1IKXA 1A7GE 2FVPA 2CRLA 3H90A 3KHRA 4CJLA 2QV6A 2B5JA 4EMDA 4XDCA 2Q1NA 2K06A 2VF3A 2QT7A 4HDGA 1FFSB 4ZITA 1RCHA 1QJHA 2IS3A 5D4PA 3VEOA 2P9SB 2WTFA 1S97A 3CCWA 2O5DA 4F3QA 4JRQA 2BACA 2HHHK 3KJVB 5IT9U 1EX4A 4OPHA 1YQHA 3MXIA 3U1NA 1NK8A 1NBWA 2KFZA 2XHBA 3NGUA 4TLRA 4CHNA 1GLDG 4ITSA 3JAMO 1NJYA 3BP8A 2BANB 3MM8B 4X4NA 4DV7F 1BLUA 1QUVA 1UP1A 3PXGa 4PQUB 3JAMY 7FD1A 4NA1A 1KHWA 1FXXA 4IO8A 3QEIA 4JI8J 1KVCA 1QY7A 4NLWA 5ETNA 5CQGA 3AVLA 3PYDA 2XBPA 3GV7B 2HNDA 2KQ2A 2QXFA 2MZRA 1OPIA 4K0KJ 4KTWA 2YH0A 4OYOA 1WTBA 4OJ1A 5FROA 2AHOB 4YOVA 3WNEA 1FRXA 4OZ0A 4ID1A 3SAFA 2C2RA 4FNHA 5KFEA 4KO0B 5EWFA 3P39A 1BHLA 1K8KA 3ULEB 3CJSA 4IXCA 4FYXB 4YR3A 1RTIA 4U67L 1GAOA 4YY3F 1HYSB 1Q95G 2ZD1A 4NMLA 4NXNK 5L8RC 2AJQA 2V51B 2V9WA 1WG5A 4ZJQA 1WTFA 4R25A 1P6TA 3C3LA 1LFWA 4KHPK 3AVIA 1GXTA 1YVFA 4JI0F 4NLOA 2D9PA 1HBUA 3HVTA 4HKQA 1RISA 3MI7X 3NGRA 3VQSA 4J2BA 4UT4A 3KLHA 1KD1T 3NNCA 1CSJA 2JH3A 3WNFA 4EU0A 4ILJA 3AVFA 3VGSA 2H3GX 4H0YB 2CPXA 3PKMA 3OHRA 3NAHA 2KVIA 2EKYA 4FJ5A 1NGHA 4KTZA 5AQZA 2B4JA 4DR4K 3M9NB 3UNGC 4CO1A 3PEHA 2FVCA 2P9CA 1YI2S 1CLQA 3SSQA 5HQLA 4X64F 4LRAA 3KLGB 1S0VA 2FBXA 2EPIA 1X9WA 2PI4A 4P2MA 2OA8A 2HK2A 1X0FA 3T1YJ 1XNQF 2RU9A 3FEZA 2P9IB 4ZTJA 2XGQA 3EKSA 3T69A 2EFGA 3W8PA 4IOAQ 4NYPA 1ZAVA 5RUBA 3MM9B 3W2VB 3ZT2A 1FDNA 1MMDA 4DR1F 4FVCA 2HOEA 1UFKA 5ETQA 3O9UA 3D1OA 4QU7A 3CD6S 3GYXB 1NGAA 4FJXA 4RL1A 5BPNA 4C8ZA 4LC9B 2BX6A 3BZKA 1TMJA 3GG0A 3ZZZA 5ADZA 4AM6A 2MDAA 2WBMA 3S3OA 3EE9A 4OKEA 2D69A 2KLAA 2VFSA 4A8YA 4BGBA 2C2EA 3QICA 4LIRA 3NNHA 4QWDA 3NS7B 2DNQA 1C1BB 1S6QB 3SV4A 5G0RB 2DPIA 1UFWA 4QR2A 3ZX0A 4L72B 1HHTP 3ZLJA 2RSQA 3AJ2A 1RT4B 4LFBF 2YKNB 5ETSA 2IHR1 5MLCV 3J7ZT 3OYHA 2RF2A 1EJ7L 4CJ7A 5D15A 4DCHA 3BSCA 2K3IA 2DKOB 1RTHA 4ECQA 1T3NA 4DR7J 3LWMA 3MM5A 1FTRA 1SJQA 1GXLA 4M3XA 1VQ9S 3J8AA 2HQ3A 3H45C 2DY9A 2E1RA 1JL1A 2X1BA 2OPRA 3F2KA 4WKRA 1LW0A 3CDUA 3C46A 4AXIA 3IMQJ 2A40A 3PUFA 3C95A 3QFPA 5KT6A 3MX2A 4JOUA 3A0IX 4N56A 4RNHA 5KFAA 4JI7J 2ZJRQ 4J7CA 3J81O 3IFRA 3IG1A 2NXEA 1M1HA 1Y0HA 1PJ5A 2YCHA 1JJHA 2BRLA 4CD3A 4LF7K 3D4JA 3F56A 1K73T 4D3GA 3A2FA 4ZVEA 2ZH8A 3CXCR 4CZCA 1IV0A 4HVZA 3ZNJ1 5BR8F 2OTLS 2CUYA 3MR7A 1U6ZA 3J81Y 2BABA 4P9SA 3OPKA 3HHNB 4B17A 2QI2A 2AT1B 3HT0A 4NXNJ 4JS5A 3MDQA 1T11A 4ZVOB 4ILGB 4B9QA 1LKZA 3CQXA 4O44A 2D3OR 2J9DE 1VQ8S 2BYCA 2CWKA 1HYZA 3M8RA 3MDFA 1SQKA 1HYSA 4CJ5A 3TWZA 1IO2A 1NDPA 4WF9L 5A0YA 2ZDOA 1WLJA 3HRGA 1SIWB 1WF0A 1OIAA 4ED2A 5A2QU 4LSNB 1YJTA 1FJGJ 2HGMA 2J76E 2E20A 3BH7B 2ASOA 1OY8A 2WW4A 4CZEA 1WC1A 2PMHA 3WHIA 4JI8K 3IP0A 1HBNA 1D9FA 2KJWA 2CPYA 1U1LA 3IS9A 4A2AA 1RBSA 1BI4B 1LWEA 4P2FA 1N88A 1TYQB 4LJMA 3DDNA 2OPQA 1VQ4N 2XGPA 1WBBA 1H73A 2OZSA 1S12A 4QYZJ 1T3OA 2Z2MA 3AY0A 4KJIA 2VG5B 2W9CA 3KUEA 1G2EA 2FVRA 4WK3A 4OPKA 2GV9A 3QWUA 4OLPA 1R8AA 4XH4A 3RBXA 1U6FA 2FJAB 1FRHA 3OL9A 2FIUA 2EFNA 1KTQA 3S3NA 3QFHA 2M9KA 4CZHA 1HHSA 4IQXA 1HI8A 2DVIA 3NH0A 3ETMA 2IM3A 3LP1A 3OLBA 2R8GA 3B4DA 4Y0WA 4F4YA 2LLZA 5AJ3F 3CMAS 4GV3A 3VQ6A 1UWBB 3PX6A 1E4GT 2FJVA 1VRTA 1X0PA 3HMJG 1YKWA 4G1QA 4KREA 4IR9A 2IOCA 2QWLA 4EIAA 2DR7A 2C1EB 1X4BA 4JI4F 4FK0A 1K73O 3NVKA 4UW2A 2VFVA 4ENOA 2WONA 1T6CA 1G6BA 3IR5B 3P5JA 4M5HA 4NLRA 3I0SB 5E84A 4DR5F 3AQOA 4JAXA 4J9QA 3AAQA 5KG2A 3MR5A 5HROA 2VOPA 3TR8A 2VKRA 4DPUA 1HMVA 2OPPA 1FX4A 4J2AA 2GFFA 4ED4A 2E9TA 2N7YA 3OS2A 5DDPC 4Y2AA 3DYAA 2QLFB 3W65A 2IVPA 1OKJA 5KFWA 3R5CA 3VQCA 1XMQK 2IM2A 4KGKA 1Q8KA 4IG0B 4Z4EA 1FJGF 2VDHA 3PJ9A 1DTTA 4ID5B 3RAXA 4J9MA 1HRHA 1ULRA 2Z2ZA 2MMYA 2XY5A 3D6TB 2D1CA 2KB2A 2XMWA 3CC2S 1B7FA 5JVGQ 3V1QA 4LMZA 4FKXA 2E2OA 4CH0S 3OR2B 3C0BA 3PNIA 4KGVB 1HNZJ 1UAWA 2KU7A 4WIQA 3NCQA 4AL6A 2NSBA 3KD1E 3GV8B 3V1OA 2MY7A 2Z57B 3V1RA 3MGJA 3MAHA 1JLBB 3DLJA 2V8PA 3CE8A 4MYUA 5H9EJ 2OHDA 1VOMA 2XQCA 2V5HG 5LL6Z 4DZ6A 4K4XA 2F8SA 1ZBLA 1KLNA 3HPHA 2PFUA 1HPZA 1F9EB 3TI0A 4PWDB 1YVUA 2DHAA 3D6MB 4A61A 1VC5A 1GFWB 3ENAA 3MZIA 1IBMK 3QINA 1VRUA 2DH7A 3KKFA 3L09A 4F0KA 1HD1A 2E88A 5CYQA 1P8GA 2V2ZA 4MIBA 4JI1J 3ZETB 1CC8A 3FCHA 3CCZA 5IC6B 4DL6A 1JXBA 4RNOA 3T7ZA 3KXDA 4B08A 1NGGA 3G82B 3U1LA 4BQZA 3PIOL 2ZUGA 3ZSQA 5KAKA 2Q66A 4F0HA 3WZ0A 2HWIA 3R5GA 3H3NO 2HW3A 3RG6A 1S6PA 3CIMA 3Q0AA 3L2WA 2Z1IA 1CJTA 4C48A 4Y3CA 3TAFA 3OFHA 3ITHA 3DOLB 1TYQA 2QSWA 5KFUA 2AEJA 4MQ3A 5KFBA 1JJ2R 2J0XA 2GWJA 2HQDA 3VQDA 1FNMA 3BJYA 5FPMA 2A2CA 1HNWJ 4ES2A 4YY3K 4RWWA 3QO9A 4FOEA 1QHAA 3T9ZA 2NZCA 4LF6F 3OL6A 2DHHA 5ETPA 2YX7A 4CESA 3TVYA 1X9JA 1VJWA 5KFTA 2XMMA 4Z7CA 4GC7A 4QYZK 3AGKA 3N28A 3JAMU 3PVXA 2MJNA 1NPKA 1XJWB 1V3RA 3HK2A 1FFWB 1TL1B 4FL9A 1NZAA 2QEXS 2UVVA 1UMJA 1TV6A 1EXQA 1E3MA 3M8PB 4PA1A 3VF4A 1IBCB 5KG3A 3M2VB 2MZQA 3K17A 2QA4N 4FF1A 5KFSA 2H5JB 1QVFR 1Q9YA 4FYWB 2ZGZA 3ZT0A 1DLOA 1FJGK 2O8DA 1PKUA 2HFVA 4BREA 1FDBA 3PO5A 4HCBA 4X4PA 1XMQF 4GMJB 1RILA 2B9EA 1W9HA 3IR7B 4DMZA 2M0GB 4OLAA 2C3PA 3OVAA 4DJBA 5AQKA 2B5JB 1TL3A 2A2DA 4C6AA 2QK9A 1UEVA 4U7UK 3DLKB 3QGGA 3CJRA 4LF6K 3HYFA 3LH2S 2AP1A 1C0FA 5J2MA 3O9SA 3QETA 3OW2R 3FBFA 4K2XA 1I3OB 2GO8A 2I5JA 2ACYA 3EZWA 2BM0A 1RWNB 2Z8QA 4LR8A 2V69A 2YHAA 4H0VB 2AYGA 3J7A1 2W4CA 2HRYA 1I94J 3BGRB 3SYZA 3PHTA 4FK2A 1VS3A 3OFGA 2OMOA 2U2FA 3W0LA 4FM1A 3SDEB 2IVFB 4WBFA 3UN2A 4YR0A 4WYBA 1WDTA 2AYBA 1T05A 4ZKAA 4JYAF 2I2YA 1AFJA 3NGKA 4CCHA 3KLIB 4LFCJ 4HUGA 2HFUA 1YX2A 3I82A 5J2QA 2GBZA 3AB4B 4H5TA 1FKAF 5CABA 3K2YA 2AIRB 3PJWA 1D5AA 4CLUA 4M5LA 1JLBA 5BPLA 3TAMA 2FZKB 1VK0A 4WFBL 2ZNYA 1NNDA 4K4TA 2WVBA 4USHA 2P6SA 3QGIA 4LRBA 4JHDA 2MQQA 5KPZA 1S59A 3S41A 1H72C 5KG1A 3UW1A 1K8KB 1HPZB 1VBZA 3QBXA 2HLTA 3AJ1A 3NXZA 2E66A 3HHKA 2BOPA 3MXHP 1XWLA 4MO5A 4CJUA 4KHWA 3ICLA 3VOVA 3ULEA 2R8KA 3OVSA 2GAGC 4XH1A 4NYNA 2QL5B 3W2WB 1Y5LB 2DHXA 4ZVGA 3DDKA 6AT1B 2OLWA 3GTYX 1BWFO 3HVTB 2M88A 2P9NB 3EZ5A 4YHHK 1CJTB 4OKKA 3I5BA 1HNIA 1RDBA 5GAGP 1RGIA 2HZVA 2F7VA 2H1YA 3B4MA 3NF9A 2ADCA 4BC7A 2A18A 1GTHA 5F8MA 4DX8H 3MCSA 2GMLA 2RHSB 3FFIB 3MXJA 3LQVA 2ITMA 1K8AO 3TYTA 1XC9A 4G65A 2DXFA 2DNMA 5KFPA 4E8UA 2HB5A 1IKYB 4AD6A 3KKRA 2CH6A 2ZJPL 4O8UA 1VQ9N 2JX2A 2P9PB 2CAJA 3ZZTA 3KLVA 4CZIA 5C0YA 2G2ZA 1PAUB 4ED1A 4WYLA 4F2SA 2Q6BA 2LDYA 3THWB 2F3JA 3NRBA 3KHHA 1S9EA 2MSTA 3AXKA 1A5XA 1T9TA 1K0VA 5J1PA 1G1XA 4ELUA 4GV6A 1GX5A 4DV2K 4ZK7M 3G6YA 4NASA 3TUIC 3B6BA 1X4AA 1WG4A 3M30A 4AL7A 4RW9A 4NLDA 2IAJA 3OHAA 4PZVA 4DFJA 2HBQB 3BBBA 2O8EB 3QIPB 2MKHA 2FDNA 5B0BA 3ENHA 4OJRA 4DTPA 1RACB 5FDLB 4CLPA 3MCPA 5KGXA 4QIVA 4URSA 1WC6A 4ECUA 5DLGA 1TL3B 1JKHA 5LJ3Y 2EG2A 4DV0J 1AUDA 3OYGA 4OHWA 2G2OA 4USKA 4JI0J 2G8UA 1ZBUA 4PEOA 1EO1A 1S9GA 4LH4A 2YJFA 2UXCJ 3ISND 4V19X 1VQMS 4JI8F 5JLHA 1V5VA 5CD4A 1NDLA 2KKHA 2YNIB 4OYIA 2KVQE 1Y10A 5C25B 2VQEF 5EXWA 1FWKA 3BSOA 3OUYB 3SQGA 5E3AA 3GV5B 4TSXA 1H0HB 4LF1A 2W24A 2ADBA 2FUG9 5AXLA 3BN4A 2OPRB 3QEXA 2FGCA 2GQCA 1XNQK 4W5OA 5T14A 1KD1O 3A8EA 4PYAA 1SJ4P 1XNRJ 3SEOA 3HSTB 2HQGA 2GO9A 3M8WA 4PPDA 2PY5A 1JXEA 2F4FA 1AXQA 5GMEA 2UYTA 1T9VA 1FWPA 1SKWA 1VQNS 1IBKF 1HBOB 3PW4A 1FE0A 2X1FA 3RBZA 5LL6d 5HSPA 1S1VA 2HBRB 1LV5A 2V68A 4JBCA 3T1HF 4RW8A 4A47A 4Y34A 3SCJE 3CDBA 1KQGB 1TFWA 2KW4A 2XSJA 3RU0A 1UOCA 4RX6A 1H2UX 1UEUA 4YEAA 1E6VB 3VQ7A 1HWIA 3NGTA 5CCLA 4UZCA 3VGTA 4K4ZA 5J1EB 4RNMA 4PABA 5A76A 4YDDB 4EYHB 2G4BA 4OHYA 3WXJA 3L3CA 3T1HK 4LF2A 4BRDA 4FO0A 4UUXA 2QC3A 2UV8G 4JKGA 4FJIA 1SIZA 4I56A 1TUVA 2G13A 5HQ8A 1Q8LA 2DFEA 1U8WA 5HO4A 1JLCB 3HHLD 2HFZA 1R8BA 4JV5F 1RT2A 4OZJA 1TQLA 4DG1A 2QXLA 3DLGA 1BWVA 2E2PA 1R0CB 3I9ZA 2QSFA 4F4ZA 3JSMB 4BE2A 1DTQB 4RCHA 4O5BA 1R27B 4YMEA 4I4BA 3RB3A 4GRSA 3HVWA 1OQ6A 2QA1A 2V9KA 2E44A 2DIVA 5D4NA 5M1KA 1VQ6N 2Y8WA 3E01A 3NF6A 4A8XA 1OPZA 2DR8A 2JL9A 2WB4A 2ZH7A 3SQ2A 2UUBF 4P2SA 4OI1A 4RUCA 4WE1B 3Q2TC 3QPIA 1MROB 5D4OA 3M6GA 2A1SA 2BBEA 4HT5A 1HR0F 1AT1B 4X65F 4DPYA 3THXA 1RHJB 3PSIA 2E8AA 5KPTA 1RHUB 4G1QB 4TY8B 2X7IA 3C8YA 4DR6J 2RHQB 1VRTB 4QOZB 2UUTA 4WZQA 5C15A 4CEAA 2HS0A 4DS5A 5C24A 2O4GA 3KVGA 2DCLA 3DLLL 4C0OC 5H9FJ 4M5DB 3ZC4A 3W60A 1GOCA 4HH1A 1ESVA 4Q0BB 2Z30B 2CQHA 4DR6K 2K3KA 3FEXB 1VQLN 1NJIT 4H5WA 4DR4F 2NRRA 2VU5A 4DUYF 1Z26A 1WAFA 3IRXA 1FO1A 4TQSA 1QE1B 2ZFHA 3WIVA 5HJYA 4WCEL 2EK1A 3KDNA 4K7QA 1P9QC 2IIHA 4FF2A 2E2NA 4CHPA 3Q8QB 3W5ZA 4IFYA 2IM0A 1HD0A 3CD7A 3HP6A 2CJAA 3HOSA 2OTJS 3KYLA 2DGVA 3OBIA 2WOMA 1UZDA 2IA6A 4FWPA 3G2XA 3ENQA 1RADB 4DPWA 5AXNA 4ED3A 4KRWA 4QAGA 1H74A 1EARA 4H4MB 1U0SA 1DAXA 3CCRS 1VQ8N 3FDSA 3NVMA 4QW8A 1TMMA 4M45A 4TU8A 2P5VA 1T9WA 2DGXA 4J9SA 4JI5F 3K5OA 3Q89A 3E9PA 1QZ5A 4BGAA 4B1VA 1ZTTA 2R2SA 2IYIA 5M2UA 5GADP 4GW6A 1M5OC 4NEZA 1RTZA 2P1JA 2KM8C 1LOTB 2JVRA 4LF8J 5GAGI 4LF5K 4KSEB 1FVQA 3J7YP 3H08A 2GX9A 1U0HB 1L3SA 3SJHA 4DR2J 4CI0B 3F0NA 3TZYA 3IGVA 4YOTA 1AB8A 1WB9A 4K4SA 2RQKA 4DKWA 3KHLA 3DC2A 3LGNA 4LRFA 3C6TB 2ACMA 2WONB 2VG7B 2W8KA 2ZD1B 3CCLS 3HPGA 3MR3A 1A0OB 1GQEA 1VBKA 1OJ4A 4OI4A 3AA5X 2BKNA 4L3QA 3VTIA 4FLZA 2NRVA 4C7QA 4CFCA 3UNYA 4EO8A 1X5TA 3CFRA 2OPPB 5IWAF 3NG8A 5DM6Q 2DITA 2IC3B 4ZHRA 3O4QA 1HQEA 2NRXA 3NH2A 1VQOS 2ATCB 3DMJB 2FBYA 2AZ1A 4WFZA 3CERA 1KLMB 3UDEA 1TELA 1KHVA 4C3KA 2YWGA 1RAIB 2KHCA 4DFPA 3HSZA 4DV6J 1EB0A 1XK8A 4B3MJ 4DV0F 2JEGA 2FC9A 4CM0A 3GL1A 5A8WB 3TP2A 4O8KA 5IT0A 3UKRB 5HMXA 5KPRA 4I2QA 1FXLA 5AXKA 1EKRA 1DQ9A 3GIKA 3UDVA 3G0ZA 4TXSA 1PILA 3THXB 3GG1A 3WNHA 2OSQA 1VR6A 1MROA 2BE9B 1N56A 1SKUB 4EHUA 4JI0K 3DHXA 1J5EK 1TV6B 2XC9A 4KAIA 1FRIA 1NWKA 3AAWB 4E7KA 2AEFA 3A5NC 3NE6A 4KBIA 4CNZA 4FJMA 1ZM2A 4ZP9A 4PWDA 1P1TA 3K89A 4DUZJ 5D4LA 1G3OA 1F0XA 3EKUA 2DD8S 4USMA 4H4KA 1FVSA 3TSPA 3GR1A 4BDPA 2AU0A 4Z7YA 2QEXN 3P49B 4ZPAA 2CZVC 3D5MA 2IBKA 2V8DA 4DR2F 2G8IA 4AFFA 4JN4A 4BC5A 4FVUA 2UZAA 3TZXA 2R7VA 2FBTA 2VG6A 2OELA 3TUPA 5FLXO 3PO4A 4F26A 1YGYA 3DXBA 1HHQA 3CEDA 4XAKA 5KG5A 3CCRN 2YWEA 1ZPVA 4IFYB 4DTMA 4BE1A 2R4FA 5FLXY 2FLLA 1JJCB 1YUWA 2YX6A 1CULA 1XIQA 2V8GA 1SJRA 3HCXA 3VQQA 2MQPA 3DRXA 1QSLA 3UD5A 2CGJA 2DEIA 3POTB 2QMXA 3BO4A 1VSLA 2UUAK 2XLJA 1OSCA 3R7BB 1ZA2B 2QRRA 4FJ7A 1BISA 3TSQA 1R8PA 3AVGA 1T05B 2GHVC 4IOAL 5FRNA 4P52A 4JI5K 4TU7A 3Q24A 4IFVB 1FXDA 4H4MA 2GQ2A 4CLYA 1M90T 4DQSA 1GOAA 1YJ9N 2XZDB 2FY8A 2G8WA 4X4UA 2IRXA 4M3ZA 3FLCO 3QJPA 3BN7A 5L1IA 1S76D 4ERDA 2Z2YB 4A59A 3CIZA 1LWFA 3FVYA 2V94A 3RR8A 3RMDA 1F3FA 4DCOB 3RSEA 4MK7A 1Y97A 2XZTB 3AB2B 4C23A 4LBHA 3TVKA 3CETA 4O3OA 1K6YA 2BUNA 2ASYA 3F73A 2VDIA 1OVQA 4JKAA 4QZVB 4F3TA 1KR4A 2M70A 3B8HA 3ZSRA 2JC0A 2WB1D 3SSSA 1FD8A 3QFWA 1FKPB 3BZCA 3TW0A 4JI1K 4X4VA 3TSUA 2IFXA 4J9NA 1M1KO 3MEEA 2RT3A 4O4GA 5AJ3K 2Y1RI 2QWNA 1N33F 3UCUP 4CLFA 1JXVA 1SCJB 4PXCA 4Y2IA 4FP9A 4DR6F 4FPAA 4JI4J 1OSDA 2Y3YA 2DGQA 1IBMF 2A1BA 3WXLA 4ZHRB 3PZPA 4B3OB 3FSXA 4RBTA 4CDIA 3CCJS 2XI2A 2D7SA 2W7PA 3CXCM 1YXQA 5D0RA 2E1PA 3R3LA 1H98A 2N3LA 5M1OA 4UOFA 3R1XA 2VBXA 4IUFA 3JTPA 1S1WB 2DYAA 3H4DA 1FDDA 4HI1A 3R2CJ 3QLHA 3ENVA 2GEMA 4DUYJ 1J5EJ 3V6DB 3I8BA 2E6MA 3OD2A 2C22A 4DFKA 2PN6A 2EC0A 4LFCF 3R8YA 2ROGA 1TKZA 2HK3A 5KFNA 3TO8A 2LU1A 4EUVA 1MNEA 5E41A 3TQ1A 4M5MA 1S9EB 1WBDA 4B3MK 2IDEA 4B3RF 3UKUB 1XTZA 5EUHA 2PE8A 1TU0B 3PSFA 1MMLA 1WKJA 5CZ1A 4UUWA 3LF0A 3U8XA 2H9ZA 4CLTA 3TTCA 4NYZA 5FDLA 5HLFA 3HKWA 3LALA 2F96A 2ASJA 3M8ZA 4LF7F 1ZPWX 3NF8A 1FESA 3EX7B 3AA3A 4OYZA 2ZM6J 2P9NA 4NX9A 2QTDA 4IG0A 2LDIA 3K9JA 2C2OB 4Y1DA 3H1QA 4RNNA 2VD3A 4FJ9A 1F2HA 4QU6A 3TJ8A 4RLEA 4Y0FA 3A5MC 3M32B 3WQPA 3D67A 4RZRA 1HFEL 4PRFA 1YITS 2R7RA 4FJLA 5C2CA 1U2RA 1NMDA 1YTAA 3MM6A 3DGPB 2KT2A 2RDIA 2XNRA 2JSXA 1NHVA 4LVOP 3K58A 4NPOA 2YX1A 5DMRA 3VGMA 3ASMA 2HMIA 3U02A 1R8HA 2BW7A 3Q86A 4LY7A 1V5IB 5F3ZA 4OX8A 3R6MA 2QKKA 2NRWA 3VENA 3CCJN 4DL0C 5JMVA 4IEEA 2I6WA 5CYMB 4CBUA 2QTWA 3EYZA 4RW8B 3H8YA 3FE1A 2UUAJ 2VGNA 1O0PA 3VAFA 2W2NP 2KJVA 3EEQA 3BQ2A 2GTDA 4ILRA 3EVMA 4FJNA 1Q78A 3TA2A 1YIJS 1RTDA 3GILA 3CTRA 2XY7A 4KHMA 3QT6A 3J7AP 5D3GB 1GMWA 2HLUA 4NLTA 2A6AA 2AYMA 1ASWA 2F40A 3MEEB 5AQJA 3GP9A 1Q9XA 1RT6A 3CGIA 3CMAN 2YNGB 2CNLB 3KG0A 5C2DA 2OEKA 1WEZA 2ZBPA 2ZH5A 1UCNA 2IJRA 5KFYA 1Q5YA 5HROB 3MOZA 1RT1A 3EVWA 3MR2A 4IWVA 4LF7J 1E6YB 1EETB 5AR0A 5H9FK 4GO5X 2ZITA 1SZ2A 1T7PA 4JI7K 4KGZB 3QO9B 1V9OA 3MMJA 1P9YA 2C2MB 4MLEA 3QLHB 4OHVA 4HLBA 4IRKA 3M6VA 3G6XA 3OFEA 3O8WA 4JI6J 4KYZA 3Q7CA 3V5RA 1YT3A 3JXUA 2ZE2B 3M8PA 1MLAA 3O5BA 2VICA 4WXOA 1J6ZA 2PGCA 3FSIA 1QAYA 1EKSA 1NG9A 1H1VA 1HWJA 2FYXA 2YNHB 3VF6A 2HZCA 4OMFG 1FJ7A 3CFPA 2GWKA 3OYMA 4N47A 5J2PA 1VRQC 5KFQA 4O0IA 2CWXA 4Q45A 2ZQBA 2W01A 3TA1A 2NLXA 4AQYK 4OZLA 1CXQA 3VZHA 2ZNZA 1T44A 1M5VC 4IRDA 1C0TA 2HS4A 5HLFB 1QQCA 5HN0A 5EX5A 1N32J 3O1WA 4RWXA 4HACA 1PJ6A 3NGZA 1Z25A 3FZFA 2OGUA 3KK3B 3ULHA 1HWLA 2ROEA 3W5YA 4AHVA 3ONQA 3BV8A 3BO3A 2HHPA 4NLGA 1Z05A 4BWMA 4U7UD 3EGWB 3PX4A 3CT9A 1Z2LA 3CI5A 3H4BA 1BQMA 4ATNA 3AO3A 1RT4A 5D0EA 3HZGA 3DM2B 4CTAA 3H5XA 1KFDA 4PL8A 4LVNP 1QE1A 1C0MA 2MKYA 5HVGA 3CIPA 2VQFF 1YK9A 1PIEA 1PO6A 2FLNA 1K1SA 4BC3A 1M5PC 2JGUA 4JRPA 4LF5J 2VONA 2WW8A 4FWLA 5BRDA 3CC4N 1FF2A 3LDLA 4DV1J 2F4VJ 1UFLA 3P5TL 4PG7A 4NO7A 4KHRA 3VGVA 1T03A 1MWYA 4KR0B 4FXDA 4USJC 3T3FA 3CQ8A 4WU3A 3HT3A 4MJKA 5DM7L 3KHGA 2A6MA 1DKGD 1XNRK 1UVNA 3NLCA 3MFHA 4YNQA 4MK9A 3N4QA 2PBDA 3L95X 2NLWA 4DX6A 2CGLA 1JCEA 1HR0J 4USUA 3Q8YA 2FHOB 2CQPA 2BQRA 3AO1A 3THTA 4Z4GA 2F8MA 1SV5B 3RGIA 3VV2B 2W9AA 5ELZA 2V7YA 3EXYA 3NWRA 1Q86O 1BWEA 1RWKB 3SFGA 1RTDB 2VGMA 3WUHA 3T5JA 5IT9Y 4WTOB 3PRDA 2IMWP 3LTOA 4M5KA 4A8WA 1OVYA 2HBZB 5KOXA 4Z4FA 1S6UA 2N3OA 1D1UA 4BRKA 3O44A 4CO4A 4EFHA 5HOOA 5C5JA 3CD6N 3AHPA 2Y8YA 4DTSA 3GIJA 2AD9A 2IC3A 3NS6A 3M1FA 3D3BJ 2DFHA 2HAFA 4OV1A 1G7CB 1S72S 2WVDA 4MYTA 2M4MA 1E6YA 1HQ2A 1OY9A 1NGBA 2PMWA 1HX1A 1NUEA 3G10A 3P1GA 3EE8A 5KT2A 2JHEA 4YN3B 1KVBA 3VETA 3C6UA 3VPZA 3MM5B 1SKRA 1ZBIA 2FJWA 3PIOQ 4DSIA 3HBTA 2HFNA 3SDEA 3MEGA 1YJVA 4FDFA 4ZDNA 4F25A 1IKYA 4JKHA 1F9FA 2MLYA 5KFFA 3ZX2A 5IM0A 4U67Q 3SI6A 4N8OA 4FM2A 1IBLF 3JYTB 4DV3F 4M8LA 2OFHX 4XO0A 4M63A 3K8VA 1SJ1A 4P73A 4DCJB 3VGKA 3KG1A 2HHXA 5U47A 3RWUA 4EBDA 4DN9A 1BMQB 4DSFA 2KRRA 4I2PA 3ZX3A 4LQ3A 2R7OA 4CE9A 3HI0A 1U8SA 3DU6A 5E26A 3E2EA 3HX9A 2JWKA 2J4RA 3BREA 1XUPO 1PYSB 3GOIA 1LXJA 2WSFC 1SXLA 1KSPA 1YRTA 3GB0A 4NLCA 3R2DJ 5F1XA 1P1LA 4FXWA 2QKBA 2GJ2A 4YFUA 2CIMA 2HEKA 5I3PA 1OO0B 3EVOA 3ZT4A 4GKKK 5AQOA 3TUJC 4CW7B 3E66A 2X3DA 3IM9A 4ZCLA 5F8GA 4KV8A 2IVNA 1J27A 1O5JA 3TJ9A 1B7YB 3RZAA 3BKUA 3W8GA 2X51A 4C8MA 4JEPA 2AJ2A 4ALZA 3L4BC 2E9RX 2E2QA 2KFNA 3BF4A 4A8FA 3OUYA 4M5GA 1YG0A 1QLNA 3VWSA 5GIPA 4WF9Q 2ZH2A 5HVHA 3NL0A 1VJQA 1BCOA 4GNIA 3I32A 2D3ZA 3UD3P 1KXPA 4BRLA 3A8YA 2PD1A 5CAAA 3QIOA 1PGZA 3I0RA 2C2NA 2YHBA 4CECA 2D5RA 4EYIB 3CC4S 2G8FA 1RWMB 3MCMA 4B3MF 1U1RA 1VHFA 3MMBB 2XSFA 4I2QB 3O3LA 2XI3A 2CH5A 4X84A 2XWYA 3VZIA 2NSCA 4LBPA 3QESA 2HQCA 3U3GA 4R5PB 3QZ7A 4LFCK 3AVBA 3QRRA 4IR1A 4J9KA 2G0CA 3UE5A 4KHPJ 4FZZA 3ZYYX 4MO4A 4O0NA 2PI5A 3GU0A 2RILA 2HHVA 4DTJA 4DSJA 1SV5A 2CQIA 4R8UB 4LH5A 2UU9J 3A8IA 2CNNB 4UQGA 2LSNA 3G82A 2I7PA 4I6AA 3I0SA 1UA0A 4AF1A 1VQ7N 4OV6A 5B0EA 4FWSA 3EXCX 4QW9A 2P9LA 1S1TB 4K5RA 2CADA 1Y3KA 3AJDA 2X1AA 4J9RA 2HG4A 3RMBA 2IVYA 4R0JA 2FHJD 4I68A 1CG2A 3SBMA 3R7NB 5KT4A 4JI4K 2O8FA 3DDIA 1KKHA 3C15A 4C11B 3ZSVA 3K2PA 2V67A 3IDHA 5LJ5Y 3WXMB 3AVJA 1FW6A 4F36A 4N41A 3RRGA 2QMUB 5IM0B 3IBWA 2AV5A 1RI7A 2XTJP 3DOMA 5IQQA 3NMAA 3DI6A 4IJAA 5KTQA 4XIUA 4OYPA 5LY3A 1R6YA 4AHCA 1WEXA 2BQUA 4KHYA 2O4IA 2B9WA 3VEXA 4OZ3A 2V63A 5KQDA 5A8KB 5L1JA 3L9ZA 3MM9A 3W2VA 4PY5A 3QT8A 1Q79A 2MY8A 4JV0A 3ID6A 3CO0P 3ILOA 1RQ0A 4Z37A 1BIUA 3ENOA 1ATNA 4CEDA 1HLUA 1VQON 1HARA 3AQPA 1WOOA 1QAJA 1O51A 3R1HA 4ZA1A 3HHEA 1Q82O 4OX9K 1RWXB 4RUHA 3CCMN 4RWTA 3HOTA 5GAHP 3GG4A 2RRBA 4U9RA 3W1YC 1MWZA 2RRNA 3P96A 4BDYA 4FNIA 1RDUA 4Q0BA 1SL2A 5I9EB 3BM7A 2I0XA 5J1EA 1UPPA 3OTOK 5F9NA 1N32K 1GLJO 1JX4A 5GAGU 2BEFA 2G8KA 4I6WA 2EBEA 4AHTA 1CZ9A 4MKAA 2ZHOA 4C2MA 2FD2A 4DV3J 2OO4A 4DCPB 4EGLA 4QIWD 1RUSA 1YLXA 3BDEA 3H2VE 4M7YA 3AXMA 4JV1A 3J81j 2Y1JA 1RTHB 4QS8A 1KP6A 4EP4A 4DZDA 3NCPA 4W92B 2HF3A 4LSZB 3ZFVA 4WP8A 3CCLN 1REVB 2V8HA 3CCUS 2E7VA 1F6TA 4HCCA 1HW8A 4CGJA 2NRTA 1QSYA 3DRPA 1YI2N 1RXOB 5KI6A 5GAEP 4B9TA 3PM9A 1TR0A 2HMIB 3J7YI 2GCFA 2OCEA 5LMNF 4ZMMA 4YP3A 1TL1A 2A10A 3M4XA 5LSRA 2XM3A 1JNZB 1YBTA 1RAOA 2H5EA 1DFDA 5ETVA 1AUSL 1DHMA 2B51A 1SC6A 5F8HA 1RT3A 3M9MB 3CCSS 1RZMA 3IN5A 3IKMA 3FMWA 2AGQA 2OIHA 4ZPBA 3FJ2A 5GADU 4CJTA 3AV9A 3TTFA 3SZ2A 2Q36A 1T94A 1NCLA 1B4SA 1HNVB 3D0IE 5C10A 5D6GA 3MCNA 4R0EA 1HKAA 1ZOTA 4CD1A 5BREA 4DV6K 2AJ1A 2ZH9A 3HL8A 5B0CA 2GVDA 5JLFA 1WI8A 4O5FA 4YDUA 3NNAA 4KB1A 3KWMA 1LWCB 4KGMA 3DLLQ 5IT4A 1IH7A 1P8ZA 3TOQA 2B4PA 2LYVA 4LR7A 2BGGA 5GAEI 2F9JA 3Q8UA 1YJ9S 2CXEA 3QAEA 1HI0P 3VQAA 4DU7A 4J5OA 5GAHI 3EY1A 5FD1A 3SBGA 1X4DA 4FWMA 4ILHA 4WP3A 3AH6A 2WUSA 4QBUA 5IXUA 3CPWR 4MIWA 2AMCB 4B02A 2BR0A 5TKWA 4I0WA 3J80O 1D3WA 3A5OC 5C2FA 3EDQB 4ECVA 1OMSA 3TAQA 1Q81O 2FPHX 2MTLA 3ETOA 3DI6B 3KLIA 1VFJA 3EUNA 4DR2K 3EGVA 3CCQS 2ZWHA 2Q3PA 2QLJB 3W66A 4K41A 4CEZA 3WDOA 4GC6A 3NP5A 3FQLA 1FK9B 1FHTA 3SLCA 3QEWA 4G6VB 1RABB 1T9XA 5J2PB 4HL9A 2DGWA 1VSDA 3KK1A 3TAMB 3RTVA 3CM6A 1NB7A 2YNHA 2RH3A 3J7AN 1TUGB 3V81A 1WC3A 3VVTA 3AFGA 2D3O1 1HA1A 4FLWA 4C0HA 4FLTA 1Q5VA 4BRPA 1YJNS 2DISA 1Y11A 5I3UA 1A5VA