5C24A

Crystal structure of hiv-1 reverse transcriptase in complex with 7-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8-dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
537
structure length
537
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPAKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 151
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c24A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c24A05
4O3PA 4Z4FA 3RTVA 4CK3A 1IKWA 5C42A 3DRSA 4Y2CA 4H4MB 3DLEB 5F8NA 3GIKA 2QK9A 4NLQA 3JSMB 2V4RA 5FRMA 3CDWA 3EZUA 1BL3A 2Y1IA 5JXSA 2OA8A 4MQ3A 3AVIA 2JC0A 3ULDA 1FXXA 1HQUA 5CYMA 1T94A 2FC0A 3AVKA 5KFKA 5JS2A 4FZYA 4O55A 1QAJA 4TYAA 4ECSA 3H08A 1EP4B 4DTOA 1S1WB 4RW7A 3GV5B 4J9OA 1S5JA 2VG5B 4CGDA 4ECVA 2BANA 1OS5A 3NH2A 4IBNA 4RG8A 3KK2A 2IM1A 2CKWA 4J9MA 5J1EB 3CDUA 3WNGA 3DYAB 1S9EA 2Z1GA 1KHVA 3H40A 2YHAA 1S1TB 3KIOA 1JXBA 5I3UA 5C24A 3KLHB 4LSLB 4FLUA 5J2NA 2BE2B 4RZRA 2BQ3A 3NF9A 4NRTA 1JLBB 5HLFB 1QS4A 1GOCA 4ZPCA 3NCIA 1RDBA 4FJMA 4FYDA 4RNOA 3AO3A 2F96A 3PVXA 2C2DA 1ASWA 2G8IA 4HCBA 1S1VB 2R2UA 1Y97A 3KLGA 3IG1B 1VSHA 4E89A 4O3QA 4RNHA 4Q0BA 5EWFA 3CIZA 3IGNA 1T3NA 4FW1A 1IH7A 4O5BA 1BQNA 1EX4A 3V4IA 1RTJA 1VSDA 4J2EA 4CIGA 3OYEA 2XY6A 3BREA 2FBTA 3H59A 2E9RX 2IBKA 1BIUA 2RKIB 4R8UA 3KKSA 4CJQA 5T14A 1RT3B 1Z26A 3UR0A 1HYSB 4CF8A 4O3SA 4ZHRB 4DTNA 4GVMA 2FJXA 2D0AA 4FVMA 2XI3A 2WK4A 4EBDA 4FW2A 1Z25A 4IKFA 4OKEA 3ZSOA 4DU3A 3PW7A 1RT4B 5KFYA 2OYQA 3VN5A 1ITGA 3RRHA 3OL7A 3H5UA 2V0NA 2ASLA 4ECRA 1TAUA 1RTHA 3NL0A 2VG6A 1U47A 3AVLA 1SL2A 1JKHA 3D45A 2HB5A 2BQUA 1BCOA 3V1OA 3QETA 2X78A 4KKOA 4KTZA 1A5WA 2AJQA 3NBPA 4PA1A 5KFBA 1NHVA 3RB4A 2IC3A 4FJ9A 1C0MA 3DRRA 4K4UA 1RT5A 4CK2A 1S0OA 5J2PA 3LP1A 4MH8A 5J2MB 3HPHA 1HYVA 4J9NA 4CJLA 4CFBA 3KD1E 3UIQA 4FM2A 3H98A 2E6LA 2NUBA 4O44B 2YNGA 3UDLA 4N56A 3SV4A 3HHKA 5FDLB 4IDKA 4FJXA 4UQGA 1JLFA 2HNZB 4J9RA 3BSCA 3OJSA 1WSEA 4I2PB 4FLZA 1T03A 1RYSA 5DQHA 4E7KA 4W5NA 2D7SA 3MECB 1LV5A 1S6QB 3H5XA 3BDPA 3L2VA 1B92A 2QV6A 5KT2A 3QNOA 1JLEA 3OS1A 4OKKA 3JYTA 1IG9A 4N5SA 5KFMA 3L2UA 4CJFA 4LQ3A 3O3HA 2XCAA 1JLGA 1U09A 4QWCA 3SI6A 2IS3A 2GIQA 5KG6A 1UA1A 4FJKA 1TP7A 3I5AA 4RW9A 4PUOB 4I7FB 5T7BA 3VA0A 3DLRA 4ZP8A 1U04A 4NLOA 3SFUA 4KPYA 1KLMB 4O3NA 4RNNA 1LWFA 1XC9A 1HPZB 2FJVA 4PQUA 3DRPA 1TK0A 4JV1A 1RNHA 2HHWA 4KI6A 3LP0B 4IFYB 5KFUA 1CSJA 3DOLB 3LWMA 2HNDA 1UWBB 3KLIA 3E51A 2FVRA 2ASDA 1R0AA 2WONB 2IJFA 4QCLA 5KFIA 2J6UA 4U7CA 4JV0A 2E9ZA 3HK2A 1NNDA 1J53A 4B3OA 2R2SA 3NF7A 4ZTJA 5DQGA 1MU2A 4RUCA 4ED3A 4WZQA 3DMJA 1RA6A 2C22A 4DU4A 2XCPA 2I1RA 2XRIA 4PWDA 3ASMA 1NJZA 4CGGA 2JEJA 1ZYQA 4CJVA 1SL1A 4CHZA 3SUQA 3QIOA 3NDKA 4Z0UA 5KFWA 5KFAA 4TQSA 4KB1A 1TKZB 4DG1A 4IG0B 2XC9A 1UAXA 4AH9A 5HRNA 2IM2A 4O4RA 1TKDA 5CY4A 3AVMA 1BIZA 3HPGA 1HNIB 3TR8A 4DFMA 3PW4A 3BJYA 1BI4B 2D3UA 1O1WA 1IKXA 4FJ8A 3ZSYA 3QGHA 3M8QB 4JV2A 4CEBA 1QSLA 1GOBA 3IAYA 2KFZA 2AGPA 1C1CB 2XGQA 2IMWP 4JUZA 3EYZA 3KHLA 3RB0A 4J2BA 3QNNA 3TAQA 2ATLA 3VQSA 3L8BA 2LSNA 3PW2A 2ILYA 4IOBA 2HNYA 5KFXA 4CF1A 4E7LA 2WOMB 3S9HA 1BHLA 4NLTA 4NLVA 3OLAA 3GIIA 4FJNA 2DFEA 4TQRA 3SNNA 4EEYA 4O4GB 3MEDB 3V6KA 4LY7A 1BGXT 4W5RA 1BISA 3O4NA 1I39A 2FVQA 4IRCA 4QOZB 4DSLA 1RT6B 4RW4B 3AVAA 3C94A 4Y3CA 2FLNA 1VSKA 2IM0A 3E01A 3EY1A 3B6PA 4KV8B 3H2LA 3SQ0A 1DTTA 4CFAA 1DLOA 4KRFA 1S9GA 3G0ZA 4HTUA 3Q8QB 1N5YB 3PO5A 4LSNA 5DG7A 3CVKA 5EUHA 4W5OA 4EYIB 4F4ZA 4NYZA 5L1KA 3KD5E 4DWIA 2DFFA 1SV5B 3KJVA 4OKJA 4NZ0A 4O3RA 1X9WA 4NLSA 1ZBFA 4FJJA 2D41A 2QKBA 4K8XA 1RTIB 3C95A 1ZBHA 4F2SA 2RPIA 1B9FA 4IR1A 2OPQA 1TKXA 1S0NA 4CFDA 1LWCB 3V81B 4YP3A 4OGCA 1XI1A 5K14A 4DU1A 3DI6B 1EXQA 1EETB 4WE1B 2OPRA 3KOAA 3OVNA 4H4OB 1N6QA 1VRUA 5KT4A 1WN7A 3CO9A 4I2QA 5D3GB 2ALZA 3H4DA 1LAVA 1LAWA 1VK0A 1WSGA 4Q44A 5KFOA 3P83D 4TY8A 3ITHB 3RRGA 2YKNA 4NCBA 2O5DA 4DL3A 4F4WA 3UPFA 1CZ9A 5SZTA 4YNQA 3I5CA 2Z1HA 3ISNC 4ED8A 4QWAA 1KRPA 3DLKA 3KK1A 2W9BA 3RR7A 2HWIA 4Y1CA 3IS9A 4DLEA 2G8VA 1S10A 5KFQA 1C1BB 5KTQA 2G8UA 4CJWA 2B5JB 3VQ8A 3FFIB 5HBMA 4IFVB 3NMAA 3QO9B 2PYLA 4ZVEA 3M8SA 4KB0A 4N41A 2ZD1A 2EX3A 5HP1A 2FVSA 2IM3A 2P51A 3C6TB 4CEDA 4WFYA 5EDWA 3C6UA 4HUEA 3CFRA 1RDDA 2OZSA 3MEGB 1KVBA 4NCGA 1NJYA 4AILC 3OYFA 1RT2A 3CYMA 1S4FA 3M9OB 3V9UA 1C0TA 3CWJA 3QYYA 4I9LA 1SH2A 5C25B 4ZPDA 3L2RA 3TAFA 1LWEA 3I0RB 4K4ZA 3FRZA 1XR5A 4K4YA 1HJRA 2G8FA 5KFCA 4CFCA 1FKPA 1LW0A 1L3TA 4CECA 2BRLA 1W0HA 1HMVB 4CGFA 4I9QA 1QE1A 2R8IA 5F8IA 3OYHA 3MFHA 4Y34A 4MK7A 4AHUA 1IKWB 5C42B 3BQ0A 4BWMA 2OPPA 3DRSB 4M3UA 4YQWA 2O4IA 2R2RA 2FJWA 1J9AA 1NOZA 2G8WA 3VQCA 4ZVGA 4EO8A 3VQPA 4FS2A 4CF9A 1BCMA 5KRTA 1HQUB 1TL3A 5CYMB 2AGQA 2GC8A 2XGPA 5F8GA 5L1JA 1ZTWA 1BQMA 3AVFA 4KO0A 1TV6A 4NYNA 3FDSA 3RMCA 1WNSA 4RW7B 4ED7A 5KG2A 1D9DA 1IKYA 2D3ZA 4IQXA 4CJEA 4ZP7A 3OYKA 2WRMA 3QZ7A 1WAJA 4KTWA 2P5OA 1ZETA 4YR0A 2BANB 2Z1IA 5HRSA 1ZBUA 4M3ZA 1NJXA 3JSMA 3OYJA 3WNFA 2C2EA 4CK1A 3OJUA 4XPCA 2AGOA 3KK2B 4OPJA 4FJ7A 3HM9A 1T05A 4FK4A 1S9EB 4HKQA 1L3SA 4E0DA 4ED1A 4CGJA 5I3UB 4CIFA 5C24B 3QIPA 5F9NA 2HMIA 2QXFA 5KFZA 5CZ2A 5J2NB 4ZPAA 4OVLA 3VA3A 1EP4A 3DOKA 3GILA 4DL5A 3OYBA 4DQSA 2C2RA 5JS1A 3AA4A 5KRSA 3FQKA 3TAMA 3VQ9A 4JS5A 4KHQA 4CGIA 1QQCA 1CXUA 3HL8A 3L3VA 3GIMA 3QGGA 2ZE2A 3KLGB 3TI0A 2V9WA 3I0SA 5CYQA 4CHNA 1IKVA 3T5KA 2YKMA 3K59A 4Q0BB 1BQNB 3V4IB 1RTJB 1WSIA 3CDEA 4FLYA 4TYBA 4EBCA 4FJIA 1N4LA 2UUTA 4YR2A 4M3YA 4RW8A 4IH6A 2A1RA 4QPXA 4R8UB 4XPEA 5KFGA 2ZQBA 3K5OA 4G3IA 1C6VA 1RBTA 1VRTA 2DPIA 4DLGA 4CEFA 2DFHA 2JC1A 4ELUA 1D1UA 2IDOA 4E1NA 4XIUA 1QSYA 2F8TA 4DTSA 3K5NA 4IR9A 2IGIA 4ZMMA 1SKSA 3PO4A 2YNHB 1KLNA 1RTHB 3MR6A 1Q9YA 2VG6B 4EP4A 1UA0A 4B9LA 4WFZA 5FROA 3MR5A 1JKHB 4NLRA 2IA6A 1RBRA 2YNIA 3HVTA 1RT1A 2ILZA 4GC6A 4KKOB 4CJPA 1U48A 3NBPB 2ITGA 3V6DA 3AV9A 4DFPA 1IO2A 4C8LA 3PHEA 2XO7A 3UQSA 2IC3B 4LQ9A 4KAZA 3DRRB 4KHRA 3HYFA 1RT5B 1TL1A 4KHYA 3RMAA 4WXOA 5J2PB 5HROA 3LP1B 3HJFA 2HHXA 3TAEA 2UVWA 2OPSA 1KFDA 1KVCA 5FRNA 1J5OA 4DFJA 2YNGB 4CEOA 2CJQA 1HNVA 3KHHA 4IDKB 1Q9XA 1JLFB 4ELVA 2R8JA 2HAIA 4DQRA 4BE1A 1T03B 1KSPA 4FM0A 4KE5A 3IRXB 4TSXA 5KT6A 1SH3A 4O3OA 3NGDA 3KNAA 4W5TA 3OYIA 2J6TA 2VWJA 3KLFA 1SH0A 1D9FA 1QUVA 1QAIA 3JYTB 4O0IA 3SCXA 4FBUA 4ZP9A 3SV3A 2VA2A 3AVGA 1JLGB 2P1JA 1JL2A 4CEAA 4FZXC 2FBXA 3V9WA 4B08A 3HVRA 1U4BA 1I3AA 4RW9B 4F8RA 3SFGA 1TVRA 3DLGA 4X2BA 3CFOA 4J9SA 2FBYA 3CFPA 3QINA 4E7JA 1LWFB 3AO2A 2AU0A 4PQUB 3DRPB 3P5JA 4K4VA 4WYWA 2J6SA 1D8YA 4QWDA 1HRHA 2HNDB 1WNEA 3ZT2A 4KSEB 3SZ2A 3PY8A 3KLIB 2IOCA 4BACA 1ZBLA 4ED0A 1R0AB 4KHSA 3OYCA 4MFBA 1JLAA 4DF4A 4DL7A 4B3OB 1VSJA 1S0MA 3I5BA 4BE0A 3MEEA 4Z4CA 4JRPA 3KLVA 4I7FA 3HXMA 4E7IA 3AA3A 3OL6A 1FK9A 1MU2B 3HO1A 4DL2A 3DMJB 4NLYA 4KBIA 3LP2A 4PWDB 3HVWA 3GIJA 3MFIA 4IFYA 2GUIA 1JXEA 4M41A 5KFTA 4FLTA 2HWHA 3KK3A 4ICLA 1EKEA 3QEWA 2VG7A 1NKCA 1S6PA 4B9MA 4LH4A 4YFUA 4DG1B 2YV0X 4G1QA 3S3OA 4CJKA 3VQ5A 1TKTA 2IAJA 2AX1A 3U6FA 1IKXB 3CM5A 4NLWA 1C1AA 5L1LA 1NOYA 4K4TA 4URSA 4B8CA 2X6SA 4C8MA 2HVHA 3D28A 3TVKA 4ZVHA 4HUFA 3PW5A 3V6HA 2PYJA 1NK8A 3CJ5A 1TK5A 3NKYA 5DGBA 4K50A 2RF2A 4Z4GA 1CXQA 4FJ5A 1RBVA 4XO0A 4TY9A 5KG1A 2HNYB 1SKWA 2B4JA 3LP3A 3BGRB 3N6LA 3LAKA 3GYNA 1TAQA 4OLAA 4YR3A 1RTDA 1F21A 3V9SA 5DQIA 2Z1JA 1JX4A 4N76A 4K4XA 4ZP6A 3K5MA 3TARA 1SKRA 3G10A 1YT3A 4CEEA 3CJ0A 3N6NA 1S1UA 3ISND 3LZIA 3RR8A 3E01B 3V9XA 2HHSA 1DTTB 1DLOB 3T5JA 1S9GB 3DDKA 3VQDA 3SJJA 3MR3A 3PJXA 4RNFA 4FS1A 2E6MA 4OLBA 3RBDA 5F8LA 2RDJA 5C5JA 4DTXA 4LSNB 4CGHA 1NK6A 1FKOA 4B9SA 4J9LA 1VSMA 1C0UA 4HCCA 2W8LA 1S1XA 3TABA 4KFBA 4FK0A 1QHTA 3KJVB 4OPKA 1KFSA 1JL1A 4FXDA 2D5RA 3NAHA 4MKAA 3SUPA 3T1AA 2XY7A 1WAFA 4URGA 3IGVA 2VA3A 2EC0A 1KCFA 1LW2A 1SUQA 2OPQB 1JLCA 4E3SA 1TKXB 3OL9A 1ZBIA 3K5LA 1QSSA 3QLHA 5K14B 4DSFA 2UUWA 4DS5A 3QIDA 3HKWA 3NH0A 3NAIA 2OPRB 1REVB 1N6QB 1VRUB 4R5PA 1X9MA 3AVBA 1RYRA 4I2QB 3MTKA 3M8PA 1KVAA 2FLPA 2YHBA 4DL6A 5I42A 2ETJA 1XHZA 2VWKA 4TY8B 4F3OA 3KMSA 1TGOA 1Z4UA 4AHCA 3QEVA 4FBTA 3BSNA 2YKNB 4Y2AA 1W9HA 4LH5A 3L2WA 4ECWA 4CHPA 3LDSA 4DTUA 3MF5A 3QEIA 1GX6A 3RAQA 1EETA 3DLKB 4NLGA 4RU9A 3KK1B 2W9BB 2KZZA 4EZ9A 3IS9B 3Q8SB 3OS0A 4NLDA 5KGWA 5L1IA 1NK4A 2B43A 1JLQA 4J2DA 4IG3A 4MIBA 4ECXA 3SYZA 2I5JA 2B6AA 5HBMB 1CLQA 1Q8IA 2ZKUA 5HRPA 4CJTA 2ZD1B 4BDZA 3KLEA 4AHSA 4AHVA 4JS4A 5HP1B 3F73A 3OYDA 1MMLA 3Q8PB 3ZSRA 3TWHA 1NK0A 4YMEA 3C6UB 5KFEA 4FCYA 4MIAA 4DSEA 4IH7A 3LANA 2R8HA 4M3RA 4NCGB 4FLVA 3MXMA 1RT2B 4M3TA 2KQ2A 3U3GA 1ASVA 4CF0A 5KG4A 4LD0A 1S97A 1C0TB 4DEZA 2HHUA 3SQ1A 4PY5A 4Z4EA 3OYGA 3OY9A 1LWEB 3ZSQA 1VSLA 3DM2A 5CZ1A 1FKPB 1LW0B 3B6OA 4EO6A 4WXWA 4DQPA 4FLXA 4Q8EA 1RCHA 2G8HA 1QE1B 2YNFA 1RT7A 3AO1A 4F4XA 4RW6A 1NKBA 1K1QA 4ECUA 3AO5A 3ZSWA 2XHBA 2OPPB 1DTQA 2IJNA 4URQU 4F2RA 2D0CA 3VQAA 3G86A 3VQEA 4OL8A 3BQ1A 3KMQA 4DF8A 1HQEA 3CM6A 4QWBA 3ALYA 4K8ZA 3AO4A 1TL3B 4DQIA 1HYZA 4ZPBA 3CJ3A 1BQMB 3OHBA 4KO0B 1TV6B 3TANA 4DS4A 4GC7A 1A5VA 4EP5A 3PR5B 3VQ6A 2KFNA 2XWYA 4ID5A 3ZCMA 2UVVA 5KFNA 1IKYB 5J2QA 3BR9A 3ZT1A 3IN5A 3QESA 1JIHA 2W9CA 4ZTFA 2FVCA 4KB7A 4CJ3A 3OL8A 3PJWA 4MKBA 4H4MA 3LAMA 1T05B 4EZ6A 4KTQA 3DLEA 1NJWA 1U49A 2DTUA 5F8MA 1GOAA 4K4WA 1NHUA 1WSFA 4KAIA 3PUFA 2XY5A 4CHQA 4ECYA 3QIPB 2HMIB 2HHTA 3T19A 4ID1A 4Q8FA 4FM1A 4CERA 1N56A 3DOKB 4CEZA 1RBUA 3TAMB 3MR2A 5DLFA 4CCHA 4J9QA 3OYNA 3QEPA 1S1WA 4QW8A 3PZPA 2ZE2B 1XWLA 3I0SB 5CYQB 2VG5A 1IKVB 5KG0A 2YKMB 3RB6A 3VQ4A 4M94A 3MXIA 3EPGA 5E41A 1VSFA 4RW8B 5J1EA 4MK9A 3DYAA 4EBEA 1L3UA 4RUAA 1VRTB 1S1TA 4DSKA 1S9FA 3AVHA 4B8AB 4TLRA 1NK9A 3KLHA 4DTMA 4LSLA 4QWEA 1U45A 2BE2A 1JLBA 5HLFA 4EYHB 3M9MB 4ELTA 4IRKA 3S3MA 2HW3A 2JEFA 5HRRA 2W7PA 2O4GA 1S1VA 3M8RA 3IG1A 3ZSXA 3H5YA 3L3UA 2YNIB 3HVTB 1RT1B 3T5LA 2P5GA 5DLGA 3V6DB 4K4SA 3O4QA 3D0PA 5KFDA 2RKIA 1RT3A 5EWEA 5JUMA 1TL1B 2PY5A 1HYSA 3S3NA 4ZHRA 4M3XA 5F8JA 5HROB 4TN2A 4ZVFA 3OYLA 4Q43A 2BRKA 4Q45A 1RT4A 2OPSB 3GV8B 3KKRA 4CJSA 4HVJA 2YNHA 1J5OB 2AQ4A 4DSJA 4DQQA 1HNVB 4NLXA 4O0JA 1K6YA 2W8KA 3ZT3A 4KI4A 3KHGA 4WYLA 1L3VA 2GBZA 4CEQA 3RBEA 2Y1JA 4Z4HA 3KLFB 3HP6A 3SQ4A 2R8KA 5KFSA 3RMDA 3NGZA 3G6XA 4JRQA 4MK8A 4TXSA 4CIEA 1JLEB 5J2MA 2EHGA 5F9LA 4DSIA 1ZTTA 1X1PA 2WTFA 3SUOA 4O44A 3D5MA 3HPOA 4J9KA 2X74A 1L5UA 5FDLA 1RBSA 1X9SA 2DPJA 2HNZA 3IRXA 4BWJA 1TVRB 3DLGB 3WNEA 3LPTA 4I2PA 5DGAA 2F8SA 3ICLA 2BQRA 2ASJA 4KREA 1I6JA 3MECA 1S6QA 3NH1A 2WCXA 4IH5A 2FVPA 1D5AA 2R8GA 2R7YA 1VSIA 4W5QA 5L9XA 3PX0A 4GW6A 4MFBB 1JLAB 4BE2A 4B9TA 3SI8A 4M45A 3ZT0A 3MEEB 1N48A 3M9NB 3NGYA 5EWGA 5KFJA 5KT7A 5KFHA 3ZT4A 4U6PA 1KTQA 3WNHA 4DL4A 1FK9B 3SQ2A 1NK5A 4PUOA 3AVJA 1RDRA 3LP2B 5KG7A 1G15A 4DTPA 4ED6A 1YVUA 2FBVA 4CHYA 3G6VA 4B9VA 1D0EA 3KK3B 1KLMA 4ICLB 3VQQA 4F4KA 3THVA 1HPZA 3V1QA 2BGGA 1VSEA 3ZSZA 3FSIA 1YTAA 2VG7B 1S6PB 3LP0A 3TAGA 1ASUA 3DOLA 4G1QB 3SPYA 3HSTB 1UWBA 3KHRA 4HYKA 2G8KA 1IM4A 2HHVA 2F8EX 2WONA 3SPZA 2XI2A 5KFPA 1TKTB 2IAJB 5KG5A 4QAGA 3CJ2A 4IRDA 2D0BA 4KHMA 4OJRA 3KTQA 4B9NA 3T5HA 3RB3A 4N47A 3NF8A 2KW4A 4FJGA 4F3TA 3OYAA 4B9UA 3K57A 3N6MA 3NF6A 5KFLA 3H4BA 2RF2B 1XR6A 3EZ5A 3QZ8A 3HP9A 3V6JA 4HHTA 3TAPA 1WSHA 1TKZA 1JXLA 3I8DA 2W42A 4IG0A 3K2PA 1RDCA 1RTDB 3EPIA 4CF2A 4RNMA 4DTRA 2PZSA 4FLWA 5KGXA 3L2QA 3HVAA 5KI6A 1HNIA 5DG9A 3LPUA 2UVRA 3NAEA 2DY4A 1BI4A 1HARA 1CZBA 2C28A 1J54A 4CE9A 1S1UB 3M8QA 4M42A 3NFAA 2KTQA 3V1RA 3VQ7A 1C1CA 5KT5A 1RILA 3CJ4A 1WSJA 3PW0A 1XR7A 4F4YA 3QGIA 2XY8A 4L8RB 3TQ1A 5DMRA 3BGRA 3OHAA 3OSPA 3GV7B 4KHUA 4CESA 4NLUA 1FKOB 3NE6A 4NLPA 2WOMA 4F50A 3MAQA 1C0UB 1S1XB 3PR4A 4R0EA 4ED2A 4KFBB 3AA5X 4WZMA 2GV9A 2BDPA 4O4GA 3BSOA 3PX4A 3MEDA 2JGUA 3U3YA 4FK2A 1S49A 4FJLA 2QKKA 1RT6A 5KFRA 1LW2B 1SUQB 4RW4A 1JLCB 1TQLA 4BDPA 3Q8RB 2GIRA 4CJUA 1SL0A 3O3FA 1RA7A 3QLHB 4KV8A 3FQLA 3NGIA 4H8KA 2FLLA 2W7OA 2HHQA 4Q5VA 2X6NA 4J9PA 1N5YA 3PV8A 1TK8A 3K58A 4R5PB 3AVNA 2WB4A 3HT3A 4Z4IA 4QW9A 3M8PB 3LZJA 4CJ4A 4DMNA 1T7PA 5I42B 1SV5A 4OGEA 3SUNA 2QE5A 1K1SA 3H5SA 1RTIA 4ECTA 3A2FA 1NKEA 3CQ8A 5KG3A 2HVIA 1RDAA 1WLJA 4Y1DA 1GX5A 3GQCA 4KHWA 4HUGA 4M95A 2E4LA 4KHNA 4C8NA 1LWCA 1QTMA 4NYFA 3V81A 4GMJB 1NK7A 1YTUA 4CJRA 1REVA 3OSNA 5KFFA 3DI6A 4NCAA 3MXJA 4WE1A 2A1SA 2JLEA 4JLHA 1A5XA 3ZSVA 1JLQB 2ATQA 4IG3B 3V9ZA 4H4OA 2I5JB 2KZMA 2B6AB 3QERA 5D3GA 3LWLA 3RMBA 4E1MA 1YVFA 3KLEB 2AWZA 3AVCA 4FJHA 2RN2A 4J2AA 3G6YA 3ITHA 1S48A 5DK5A 3DLBA 3RWUA 3CG7A 2BR0A 2V4QA 4BDYA 1XHXA 3T3FA 5SWMA 3OYMA 4CHOA 4WFXA 3BSAA 4DFKA 1KHWA 5DG8A 2E9TA 3DM2B 4H54A 1C1BA 1T8EA 4FZZA 4DTJA 4ECZA 1C2PA 2B5JA 3NHGA 3LALA 3FFIA 4E19A 4IFVA 2YNFB 3QO9A 1RT7B 4RW6B 3F9KA 3AA2A 3P1GA 2AX0A 3C6TA 2JEIA 5KFVA 1DTQB 4C8KA 3QEXA 4E7HA 3OLBA 5EU7A 1W25A 3MEGA 2WHOA 3OS2A 4CJ5A 2JEGA 1B9DA 2Q3SA 2R2TA 1HQEB 4IKAA 3O3GA 4AHTA 3VQBA 3BQ2A 2W9AA 4AHRA 4NRUA 5C25A 1RAJA 2RDIA 3I0RA 2OH2A 4ID5B 2UVUA 5F8HA 3RAXA 4C8OA 4M3WA 1UOCA 5KT3A 2OZMA 5J2QB 3PX6A 1HMVA 2W9CB 4ECQA 3DLHA
chains in the Genus database with same CATH superfamily
4J9UE 4Z4FA 2GVZB 5K8NA 4Y2CA 4XH4A 3CHWA 3JSMB 4CLYA 1WTBA 1RABB 2OA8A 4B3TK 3CC2S 5CXTA 3DNCA 5CYMA 1T94A 1KEKA 2OEJA 3AVKA 2IVOA 4FZYA 5CAAA 3R7BB 4W4MA 4N8OA 2NLWA 1A7GE 2HS4A 3N01A 1X4BA 3DDNA 3CNQP 3P96A 5FD1A 4RTFD 1OS5A 4M5HA 3CDUA 1KHVA 3H40A 2YHAA 2WFBA 4UT4A 4X66J 5C24A 3SAFA 4JB8B 5J2NA 1RBOB 3KNGA 2MQPA 3Q0AA 3NF9A 1JLBB 2VV5A 4ZPCA 2WAQD 3M6GA 4FJMA 4RNOA 2QA2A 1D09B 4HCBA 1UL3A 3H46O 1VSHA 3VEYA 4CNZA 3BS9A 3MM5A 5DM7L 4CO3A 5A6PA 2NRHA 1EX4A 1RTJA 3A3NB 4CIGA 1FD2A 4M1KA 3SCKE 2FBTA 1BIUA 4A8KA 3WX4A 1NEEA 1R0CB 1Z26A 3UR0A 4O3SA 4GVMA 1ESVA 2YX6A 1TR0A 4DDFA 1NLVA 1F3VA 2XI3A 5CHIA 3L6QA 4OPHA 2HBRB 4DR7F 3CJBA 4AFFA 3CD0A 1ITGA 3WBZA 1GLLO 4CYUA 1F9HA 1LFPA 4WCEL 2B4PA 5BRFA 3P8BB 1V4TA 7FD1A 2CJBA 2CNOB 3D45A 2HB5A 1BCOA 4KKOA 4CDIA 1A5WA 2AJQA 3NBPA 1JNZB 5KFBA 1NHVA 4O8KA 4K4UA 4CK2A 2XHWA 1NZAA 3QFPA 4BR9A 3CMES 2AW0A 4MH8A 5J2MB 4CFBA 3KD1E 5M1PA 1U02A 2P2CB 2HG4A 2JLGA 3EDQB 1R59O 3CCMN 1NWKA 2NUBA 2YNGA 2XYHB 2V52B 4X4UA 4MDAA 3CCSN 4PRFA 4O23A 4P2MA 3I87A 2DITA 1ZM2A 1N5TA 2HNZB 4UQGA 2YQ1A 2Q3PA 1IJEB 1PAEX 3OJSA 4UOGA 4IOXA 1T03A 3DCAA 2RU3A 3CPEA 2D7SA 1MWMA 4DR3F 4LF4F 5EY4A 1S6QB 4EFHA 1Q0NA 5DZ7A 2M88A 5J1PA 1S99A 1EQ0A 3QNOA 2YWGA 3CCLN 2R7RA 4J37A 1X4HA 4BQLA 4PR6A 1S12A 2B56A 1KAZA 4FWLA 1VQ4N 3U1NA 3OBWA 4LF7J 4BGAA 3O44A 1VOMA 5DM7Q 3WX8A 3FRYA 4FJKA 2HS0A 3I5AA 3RJMB 1HNZJ 4PUOB 5E3CA 5IXUA 4I7FB 1CJVA 4CLWA 2X51A 1U04A 3U9ZA 1KLMB 3CDAA 5A8RA 4O3NA 3CPWR 3MEKA 1FKAF 2UXBF 4JV1A 2HHWA 4IFYB 3AGRA 1RCXB 1TUVA 3LWMA 2HNDA 4PG4A 3KLIA 3E51A 4M5IA 2LEBA 2FPHX 2M4MA 4DV4J 1SC1B 2IJFA 2J6UA 2ZOMA 2FHOB 4RUBA 4UW2A 2QYCA 4DHYA 1Y9OA 1Y7PA 4WCEQ 1F0XA 3HSGA 1HA1A 5CABA 3P6YC 2A3JA 5ETMA 1VQNN 1GMWA 4BBYA 3DMJA 3MD1A 3MCOA 1FXDA 3NCPA 1FEHA 4GVBB 3ASMA 2FHJD 2JEJA 1ZYQA 3PKYA 1XJWB 3DGPA 4TQSA 5KOXA 1VQ8N 4KRWA 2L3MA 1IUJA 4LF8J 1Q18A 4PQAA 2PFDA 3GYXB 3T1HF 5KPRA 5DJBA 5A76A 2IM2A 1TKDA 3O9TA 2C3OA 1J2VA 1HNIB 2CDRB 4TNOA 1O1WA 1IKXA 5LXYA 5L9NA 3M8QB 4CEBA 1X9JA 2GO8A 2CGLA 1C1CB 5IQ6A 2G0IA 1FW6A 2HFUA 4JUZA 1Q8BA 3R97A 3LDNA 2ZJRL 1U1QA 2ATLA 3VQSA 1ZOTA 4FNHA 2LSNA 4YOUA 1WKJA 3POTA 4CF1A 3MM9B 1BHLA 4NLTA 3GIIA 2QIFA 2WTUA 3MEDB 4JYAJ 2E7XA 4G1PA 1F3FA 4OI6A 2R7WA 2Q0UA 3UN2A 1TFYA 5LMUK 2HRUA 3GCXP 2N7YA 1GK8A 4LVNP 3TP2A 4QOZB 4MT1A 3C94A 1QM9A 3LQVA 5H9EJ 3EY1A 2Y8WA 4B3RK 4KV8B 3H2LA 1DTTA 4X4SA 1BG3A 3ATUA 4LSNA 2XQCA 1BC6A 3VGKA 2W25A 3NG8A 2CYYA 2D1KA 5ETTA 2VDIA 1WSRA 1SV5B 3NGTA 4NZ0A 2MLXA 1HQ2A 2NRTA 1GXLA 4QPTA 4CLSA 4A8MP 2D41A 4NZ7A 2FGOA 1NH7A 2M7SA 2QFIA 3GZ7A 1B9FA 4FWRA 1PC4A 2LQ5A 3BR8A 3T6BA 3V81B 4C8ZA 1OJ4A 1XI1A 2LU1A 3BPSP 3HSCA 1N5QA 4JI4J 4DV7K 1T11A 4H4OB 4KYZA 1VRUA 3UE5A 2PMWA 4ZPWR 4CP5A 2QEXS 4M7XA 4GKJF 4CTAA 4BRAA 3MMCA 4PG8A 1R8PA 1XNQF 1VK0A 4DV6K 4Q44A 1X3NA 3GFHA 3NCRA 3AA9A 3GMGA 2ROEA 3K8VA 2VFVA 1FESA 1U2RA 2YKNA 2ZJRQ 4F4WA 4LT6A 1CZ9A 3MWTA 1FVQA 4YNQA 3DRXA 1OYDA 3ISNC 1KC8O 3UKRA 1QTNB 1G1XA 3TA0A 4V19X 3RR7A 4WIIA 4TU9A 2XBPA 3OTDA 4NWBA 3UN5A 5KTQA 4GKKF 4YOWA 3FFIB 5HBMA 3QO9B 4B02A 1YJWS 2UU9F 3CC7S 4KB0A 2ZD1A 2EX3A 1GTEA 2P51A 4CZLA 4M5KA 1W2IA 4BRKA 4WFYA 5EDWA 3C6UA 1RDDA 1M0SA 1VQ5S 3MEGB 3OYFA 2P6TA 4A47A 2MEWA 3UVJB 4QS8A 3CWJA 2DKOB 3AAWB 5C25B 4M63A 4ZPDA 5D4LA 3CJKA 1EQYA 3TAFA 3I0RB 3P3DA 2A2CA 4K4YA 1LW0A 3DFEA 1L3TA 3ZTPA 1PSDA 1YQHA 1YJVA 3C14B 3OUYA 1W0HA 4A61A 2R8IA 5F8IA 1VQON 3EVWA 4L3NA 4M5MA 2JJ4D 4AHUA 5C42B 3DRSB 4ZN3A 4YQWA 3BKTA 1Q82O 4W90B 2G8WA 2A41A 4FF2A 1OSDA 2C3MA 2PMZD 4KGKA 4ZVGA 2R9LA 4FS2A 4LIRA 1FT8A 3WUHA 2RD5C 3CPWM 5KRTA 2MZ1A 4FWQA 1ZTWA 1J27A 3R9LA 2WC9A 3RMCA 2JVOA 5KPZA 4RW7B 3L7PA 5KQDA 1MLAA 1IKYA 3AAPA 1EX8A 4LF4J 3NGUA 4KTWA 2BANB 4DCJB 2Z1IA 4M3ZA 3JSMA 4XPCA 4HR2A 2AGOA 1T05A 4MKYA 2I2YA 3KKFA 2E1RA 4FK4A 5HVGA 4B3MJ 1GMUA 5K8PA 4E0DA 5BJRA 4CGJA 3OW2R 4CIFA 2BMBA 5F9NA 2HMIA 2Z0GA 2QXFA 2V9KA 4ZPAA 1C0GA 3VA3A 1IQZA 2VF3A 3FE1A 1KR4A 3OTEA 4JI5J 3FQKA 3TAMA 4KHQA 4CO0A 5IOLA 1LQ9A 1BD6A 1P1LA 1JCFA 1YLXA 3C6AA 2ZHBA 1IKVA 5AE1A 4B3TF 3OTOK 1V5VA 1BQNB 1ZS6A 4NA2A 4YR2A 4M3YA 2ZQBA 4G3IA 1RBTA 3UN3A 2DFHA 3WXKA 2OD6A 4ITSA 4HTIA 5T41A 3CCZA 2DR8A 3O9SA 2CJXB 2DT9A 1KQFB 1RLDA 4DTSA 5ITHA 3TYTA 2YPZA 2KI2A 5FPNA 4CBXA 4M63C 2IGIA 4LBHA 4CH7A 2KFYA 3MUVP 1SKSA 2E2QA 2HAFA 2UUAF 5LMNJ 1U6ZA 4IEEA 2LP4A 1Q9YA 2VG6B 1XQIA 2BJ7A 1HKBA 2IA6A 1RBRA 2CQPA 2ILZA 4L3QA 2I7PA 3O9RA 2OELA 3C66A 5AQNA 1RISA 4QR1A 1CJKA 3PHEA 2XO7A 4I6WA 4LRAA 1RT5B 4CI6A 4G6VB 3RMAA 1RHUB 5ETRA 1QLNA 4QYZJ 3HJFA 2HHXA 2FF3B 5IWAJ 3TAEA 2UVWA 4JK8A 2OPSA 1KFDA 4DFJA 2CJAA 4BRDA 1YHQN 1FCAA 3N5FA 4USWA 2CJQA 1IBLF 1XNRK 1JLFB 2LCWA 3J7AN 2NXNA 1SH3A 4OYMA 3NGDA 2J8SA 2Z8QA 4CZKA 4ZIVA 4W5TA 4KQZA 2VWJA 4GV6A 2EFPA 2NS1B 1QUVA 1D9FA 1QAIA 3D3BJ 3MM7A 2IA0A 1M90O 2QGFB 4YHHF 4C1NK 2P1JA 4CEAA 5TKYA 4FZXC 2FBXA 2K3IA 1U4BA 5BPLA 4RW9B 3OR1A 3R3LA 3DXKA 2OAUA 2IJRA 4JI8F 2F9WA 3NS5A 3UB5A 3FBFA 1HKCA 2FBYA 3CFPA 2HRYA 3CF5L 1LWFB 3P5JA 4IEIA 2J6SA 2H3EB 3EMTA 3FUYA 1YIJS 4RWTA 3SZ2A 3ZT2A 5K20B 3VV2B 2IOCA 4BACA 1X0PA 1ZBLA 3UDVA 2O8FB 1X4DA 2ZUAA 4QU6A 4Z4CA 3CJCA 3W0LA 4JRPA 3KLVA 4I7FA 3I96A 5BR8K 1VQMN 2EWSA 5LJVA 4NLYA 4KBIA 1CEZA 2HIYA 3HVWA 3MFIA 4IFYA 3OD2A 1K8AO 1QVGR 4JI1F 2IDLA 4FLTA 1RKIA 4ICLA 2MY8A 2N3OA 1XK8A 1EKEA 2R7VA 3QEWA 1S6PA 3MN7A 2BKOA 4DG1B 4G1QA 4Z7CA 3NY0A 4FOEA 5BPMA 4JI7J 2ZJQL 2DNGA 1I3OB 1TKTA 3HHDA 1OPZA 2KXHA 3SSSA 5L1LA 3D7SB 1FWPA 4BC2A 3F41A 2DISA 2X6SA 3THYA 2PYJA 4P6QA 3NKYA 1OIAA 5DGBA 3R2DJ 2RF2A 1RHJB 3HX9A 3UNGC 1RBVA 1XMOK 2K1RB 3HSZA 3EEQA 5KG1A 5A8WB 2RHSB 2P9LA 3HHLD 4BS2A 2HHPA 1UFWA 4YR3A 3JTNA 3V9SA 1VBYA 5DQIA 4N76A 1SKRA 3OBYA 2UUBF 1R3NA 2J7UA 2XHCA 2UZAA 5B09A 3A8IA 4JKDA 3LZIA 1WACA 3ULEA 4PWWA 2BJ3A 3UW1A 1DLOB 3T5JA 4N8NA 1S9GB 2V68A 3DDKA 3VQDA 3MR3A 2RDJA 4DTXA 3KFWX 5CR4A 2AYBA 2JWNA 1S72N 2HEKA 2VGMA 3TABA 4HH0A 3QFWA 1QD1A 2P9EA 5M2PA 4O0NA 2N7CA 4C4WA 3DJCA 4JP8A 1X60A 1M5HA 1GLJO 3IGVA 1LW2A 1E6YB 2OPQB 4B3SJ 4OYAA 1TKXB 1OQ3A 4HI2A 1X3MA 4ERDA 1J5EJ 4LRCA 5LOQA 1LFWA 1VBKA 4RWXA 4DS5A 3QIDA 3O2IA 3NH0A 1EJ7L 3GSIA 4DV2K 2DR6A 5E3QA 4R5PA 2ZJQQ 4A59A 4I2QB 3M8PA 4JI6K 2GEMA 5I42A 2VICA 2VWKA 2C2NA 4B3RF 2P9IA 4AHCA 1NSKL 5HANA 2VASA 4Y2AA 2DVIA 1F1BB 1W9HA 3Q7CA 4ECWA 4DTUA 1KNZA 2O3DA 4NLGA 3BUZB 3SDEA 2W9BB 1R6YA 1NDKA 4CO2A 2A10A 1XBWA 4M5NA 4OLOA 4NASA 1K8KB 4MIBA 3T69A 3MX2A 3ZTOA 3GJSB 3SYZA 1Y10A 3PHTA 4NI2A 3J8AA 1VCTA 4P7VA 3KLEA 4AHSA 2Q6CA 2HVEA 5HP1B 4J9VA 1NDLA 3Q8PB 2OJ3A 4UUXA 4K0KK 3R1LA 2YQ0A 4FCYA 3VGLA 4NCGB 1NU4A 3B4MA 4YB7A 1IBKJ 5KG4A 2ZDOA 2GQQA 1S97A 4LD0A 1C0TB 3VTIA 2V2ZA 3HCXA 4Z4EA 3SCLE 3CC2N 4J8FA 1PJ6A 4EI2A 3DM2A 5CZ1A 1ATRA 3B6OA 4EO6A 3A4TA 2Z2ZA 4Q8EA 1RCHA 1RDWX 3MCSA 1RT7A 3AO1A 2CNKB 1NKBA 1HX1A 3E3XA 1KAXA 2BABA 2OPPB 5D4PA 3M2UB 3GCWP 2OTLN 1LNQA 5AQLA 3GE1A 1NNEA 4U7BA 2Q0RA 3KMQA 1JWWA 4NL5A 2U1AA 4QWBA 2DCUB 2EG1A 3O1BA 1YRXA 4ZPBA 3CJ3A 4WF9Q 3R9PA 3HF5A 1PJ5A 1P1TA 3U1MA 5MLCQ 1OY8A 3GL1A 4ETXA 2UVVA 3THPA 3HFKA 3OXGA 2W6KA 2W9CA 2KB2A 4CJ3A 4BRCA 3ZZYA 1FD8A 4NXNF 3OT9A 3LAMA 4G9ZA 2RQCA 4EZ6A 5BREA 1NJWA 2HHHK 4C3KA 4CH1A 3K9JA 2LDYA 2VC1A 1GOAA 4K4WA 4AQYK 4KAIA 1PILA 2MGZB 4CHQA 1QVGM 2HHTA 4FM1A 4DV0K 1N56A 3DOKB 2AA4A 4CEZA 3NVKA 4GVLA 3ENVA 4X4TA 2CJKA 1UTAA 2QYGA 3MR2A 5FPDA 3D2FA 3QEPA 1S1WA 1WDDA 1LCUA 4QW8A 4IUFA 3O6QA 4BRHA 3RB6A 3VQ4A 3EPGA 5E41A 3IUCA 2YX4A 1M5KC 3L4BC 5GMDA 2APOA 2DH8A 2PSZA 3CDBA 4B8AB 4MMOA 3KLHA 4CLLA 4LSLA 3E9LA 2WBNA 1IN0A 2MKJA 5I3PA 1U45A 3P39A 1YZ7A 3CT9A 3DC2A 2OMOA 2PN6A 4CW7B 3T1YF 3A3OB 4CLTA 2OFGX 3W9JA 2FIUA 3M8RA 4BRMA 3J80O 2EBEA 2HZVA 1YTYA 4PYDA 4HT7A 2C42A 4IYQA 2Y8YA 5GMEA 1DGKN 4WU2A 4RJVA 3N0VA 2RKIA 2R7SA 1HYSA 4QS9A 4M3XA 3VF0B 3RUBL 3OTOF 2B4OA 4Q45A 3CCUS 1J5OB 4DR5K 2AQ4A 1W7WA 2RT3A 5D4NA 3DKDA 4DQQA 2CJYB 3FZMA 4O0JA 2CGJA 1YI2S 3ZETB 4KI4A 1L3VA 1VIOA 4ZCKA 4CEQA 3SMZA 3ADAC 1CZAN 2XMTA 2DNPA 5ETLA 1HHQA 3KLFB 3AXKA 4DPOA 3RW6A 5H9FK 2DGWA 2P9KB 4BRNA 5KFSA 1AT1B 2KT5A 3RMDA 4MK8A 4CIEA 2OUGA 1NGHA 3NLCA 1FJCA 2XLJA 4DV3F 2WTFA 1P9YA 1KOHA 1N8RO 2GJFA 4O44A 2F5GA 2KVIA 3G96A 3TU5A 4DI6A 3MAAB 2X74A 2RUSA 2V50A 1RBSA 3PYGA 1X9SA 2DPJA 2EK6A 3JSYA 1CS4A 4H0PA 3D6HB 4NEZA 1PCAA 3N4PA 4KH0B 1FE0A 3ICLA 5DM6L 4KREA 3LL3A 4BG9A 2HFNA 1FTCA 3MECA 4L75A 4ZVSB 4AD6A 3CCRS 3NH1A 3M8ZA 4FVCA 2Q43A 5LM7E 1XNRF 2R8GA 3QBWA 1VSIA 3PX0A 2AJ4A 4DPXA 5GAGI 2Y3YA 1H6KX 4JI2K 1YITN 2YBVA 2VIHA 1HNXK 1NZ8A 3M9NB 5D78A 4QZVB 4A46A 2EKYA 3SEOA 4DV5K 2M9KA 3SQ2A 4DUZK 2K7JA 2ZGYA 5LMUJ 3AVJA 2VB6A 1G15A 5AXKA 1YVUA 4CHYA 1SB6A 4B9VA 3VQQA 3AFGA 3CI5A 2HQIA 3LP0A 2LYVA 2XMKA 2ZH4A 2RS2A 2XTJP 3DOLA 1FNMA 3MN5A 2LMIA 1S4EA 4HYKA 2DRDA 1CJTA 2WONA 2V63A 3ENOA 3VEXA 4QAGA 3GTYX 3QFHA 1BOTO 4B9NA 3T5HA 2XYPB 3NF8A 2KW4A 4FJGA 3ZC4A 1T9VA 1V3RA 3NF6A 3BH6B 5EVZA 2ZWPA 5KFLA 3MM8A 3AH6A 2DIVA 5AXLA 2DCLA 1XR6A 3QZ8A 3HP9A 1PAUB 2VC0A 3KG4A 4YY3F 2N3LA 3JSBA 3TW0A 1TKZA 2XYGB 1QZ6A 1JXLA 4YB1P 5F1XA 2XSJA 4IDHA 2MHNA 1LWXA 1F2GA 4A8YA 4B1ZA 4FLWA 4DV7J 3HVAA 2FSNA 5KI6A 5CZXA 2DY4A 1QVFM 4DV6J 1J54A 1S1UB 3O6WA 4E2FB 5DM6Q 3TOQA 3V1RA 3G4SN 1KBRA 1NHKL 4JEPA 2CQHA 3CJ4A 3NWRA 3FGUA 4A5AA 2QLFB 2ZVIA 3HI0A 1NB7A 2NZ4A 3TQ1A 3OHAA 1SIZA 3GG0A 2AV5A 2OP5A 4UZBA 4CESA 2LEAA 1VQ6S 3MAQA 5M1NA 1S1XB 3PR4A 2CPFA 3AOCA 4WZMA 1H7WA 2RHQB 4USTA 4JD2A 2DY9A 1SJQA 3E9PA 2W1BA 2J0SD 1E6VA 2IPOB 4CT9A 3I4PA 8RUCA 3O3LA 1S49A 3CJTA 1XMOF 5ELZA 2O8CB 1RWOB 1WF1A 1EKRA 5HAOA 2P9NB 3RVCA 2QKKA 1RT6A 2VGNA 2GV1A 5H1SQ 2O8EA 1TQLA 1SL0A 4CJUA 3X1LB 1RA7A 1HBOA 3NGIA 2HF3A 2GQ2A 4J9PA 1N5YA 1TL5A 3VQTA 1H3DA 3P38A 2ZOFA 1SCJB 2HWTA 1D9AA 4IZ9A 1X4FA 1GLBG 3Q89A 4DMNA 5AE2A 4RWWA 4DU7A 3CC7N 4X64F 4WYBA 3FSXA 2GJ2A 3VGVA 2ASMA 1RTIA 2B9EA 1NKEA 3QT8A 5KG3A 1WLJA 4KHWA 4HUGA 3P49B 2E4LA 5AJ3K 4C0BA 2ZM6F 3MM6A 1R89A 2FUG9 3QB0A 1PG5B 4DR2F 4KH4A 2Z2LA 1X4GA 1NK7A 2N4CA 4GMJB 4H5RA 4YS2A 1OH5A 3C65A 1WKKA 4JLHA 2CQ1A 1JK9B 2MMYA 2KG1A 4H0YB 2HURA 4X65F 5IT4A 1GT8A 3EX7B 3FC9A 2RS8A 1U1RA 5EGYA 2E1CA 4AL7A 1MG7A 3LWLA 3VGUA 3RMBA 4OIXA 2I9SA 4P75A 5EOYA 3AVCA 2DY1A 4XTTA 3CGIA 3CE8A 1GXUA 4DMZA 4MYUA 5F0WA 3ITHA 5DK5A 1FFGB 2B51A 3CCWA 4ENOA 3CG7A 2V4QA 3M2RB 4PKGA 1XHXA 1IR1A 5SWMA 2ASYA 2BH1A 2GHVC 5HN0A 4LSZB 4XDDA 4M5JA 2D0OA 3V2UC 3DLJA 3J7Z5 1C1BA 1T8EA 1WDTA 3E2EA 1BQXA 2KXFA 1N36F 3NHGA 1HW8A 2FTRA 3F9KA 4CRJA 5KFVA 5DDQC 2UV8A 4OYOA 1K44A 1WC3A 3CC4S 3KUGA 5EU7A 3A13A 2WHOA 3OS2A 3I6PA 2JEGA 1QJHA 1DARA 4C0HA 1HQEB 4IKAA 3VQBA 4RU2A 2V8VA 3ZLJA 4NRUA 1NG9A 3AODA 2RDIA 4X62F 2GMJA 3DLLL 5KT3A 4OZJA 3HZ6A 2NXEA 4M5LA 4OZLA 2DXEA 2I7NA 3C16B 1IKWA 3FBCA 2VHGA 3OQ2A 4CVNE 3EE9A 3DLEB 3GIKA 2WW8A 4NLQA 3J7ZO 1RBLA 2V4RA 1KP6A 3C15A 1RWWB 1HKGA 3CDWA 3EZUA 1K47A 1BL3A 4JI3K 3T41A 2G4BA 4DV1J 3AVIA 3VF6A 3QRQA 2JC0A 1FXXA 2DR7A 1B64A 1S6OA 5LT5A 1HBNA 3ETOA 1N34J 4O55A 1QAJA 1KTVA 3OVBA 2JSXA 4DTOA 2PA3A 3GV5B 2PGCA 1S5JA 2VDHA 1U6FA 2DR5A 1QZ5A 4LJMA 2VG5B 1B3TA 3O9QA 4KIAA 3R1XA 3NH2A 4IBNA 2NSCA 2P5VA 2H65B 2CKWA 2IM1A 3WNGA 3DYAB 3PEJA 4DKWA 1S9EA 2Z1GA 1S1TB 1HBUB 1JXBA 8ATCB 5I3QA 3HT0A 3IXQA 4NRTA 1QS4A 4LFBK 1WF0A 5F3ZA 4LFAK 1RDBA 4FYDA 4GVEA 3JSRA 4BY9C 1TL7B 2F96A 2G8IA 1S1VB 3MURP 2HGLA 4AQYF 1XN9A 4O3QA 1RXOB 2FQQB 5EWFA 3CIZA 1T3NA 3V4IA 2A2DA 2XY6A 2E9RX 1PJ7A 4R8UA 3KKSA 4CJQA 5T14A 2L08A 5HVHA 2D0AA 1FRLA 3DLLQ 4FW2A 1Z25A 3EXYA 3QJLA 3W3DA 3P4UB 3RRKA 1RT4B 3G9CA 5KFYA 2VBYA 2EKNA 1HBMA 2XNQA 3VN5A 2B9YA 4LRFA 1FA0A 4KT0C 3W8PA 4OYIA 2V0NA 2ASLA 1TAUA 2AEMA 1RTHA 1CQMA 3M32A 2YX7A 3WXJA 1SL2A 2P9UB 4WFNL 1WD6A 4A2AA 5BR8J 2BQUA 1GXTA 2X78A 4LF9K 3F44A 5AR0A 4FYXB 4LMZA 2IC3A 4FJ9A 2CUYA 4E98A 1YIJN 2YPYA 4BGBA 5T7LB 5J2PA 3LP1A 2V6AA 3A8KA 1KOOA 3CULA 2DHGA 5GADI 3M6UA 3UIQA 3D1HA 3H98A 5ETOA 4PAAA 1TYQA 3CCEN 4EK2A 3UDLA 5JVHQ 3ZETA 5BRHA 5FDLB 4IDKA 4DR1J 3JXUA 2VOPA 1FDBA 2CQGA 5DQHA 2E66A 2W01A 4DR5F 5AQTA 1D8ZA 4CLPA 4BRLA 2QV6A 5KT2A 3VEOA 3MMAB 2B7BB 1IG9A 1RAEB 1U24A 3L3CA 2KT3A 1XMOJ 3TO8A 5KFMA 2ZZMA 3QRPA 4LQ3A 3TSPA 1U0SA 2GIQA 1M5VC 4FXWA 1H74A 4BC5A 4EMDA 4ZJLA 1TP7A 5T7BA 1RWMB 4NLOA 3QGPA 1HPZB 1RNHA 2K2PA 2WBMA 3IR7B 3CCMS 2P9PB 2DYAA 3CCSS 2ASDA 2CPIA 1R0AA 4U7CA 2E9ZA 1Q8LA 1IQTA 3J7YI 2IVFB 3DN9A 4ZTJA 2ZH5A 1P8ZA 4WFNQ 3KXDA 1BHNA 2B9WA 4RUCA 1Q95G 1SJ1A 2G2ZA 2C22A 1NGEA 1NGAA 4A8OA 1C4AA 4PWDA 4RX6A 1NJZA 4JI2F 3WIVA 4CHZA 3SUQA 1KDNA 4Z0UA 3GJRB 5KFWA 1WHXA 2ZHAA 2XC9A 1UAXA 3PLAA 4DV2J 1ACMB 4ZDNA 3HPGA 4DFMA 4OFZA 3PW4A 2QXLA 2D3UA 5KAKA 4JI6J 4JV2A 1QSLA 3IAYA 2IMWP 1JCGA 2L9DA 4UF4A 3RB0A 3TVZA 1H0HB 3L8BA 4HACB 4Y0FA 1R43A 2WOMB 2ZNYA 5FJ4A 3FBEA 5ETVA 4FJNA 3OLAA 3K0JA 3SNNA 4A8XA 3CJAA 1VQNS 4LY7A 3V6KA 4Z37A 5KOWA 4MJKA 2OIHA 1T3OA 4W5RA 4WWSA 3O4NA 4IWVA 3J7YU 2EG2A 4C48A 4IRCA 4DSLA 1A9NB 3UFCX 4RW4B 3AVAA 2X3GA 2HQCA 1VQ8S 4K0KJ 4Y3CA 1UVJA 1VSKA 4DV4K 1Y3JA 3ET6B 2QM1A 4HTUA 2MSTA 4Z2XA 3Q8QB 4YDXA 3PO5A 2IVPA 2J4RA 4X4RA 3LUYA 4BR7A 4K2JA 3H2VE 4W5OA 1FJGF 4F4ZA 4NYZA 5A2QO 3AB4B 1VQLS 3QQCD 1JJ2R 2DFFA 3D67A 3A5MC 5M1KA 1ZBHA 3EZWA 4JBCA 1KVJA 3KJNB 3ONQA 4IR1A 1FRJA 3I8BA 4LF8K 2Y1LB 4CFDA 4JKBA 5IFMA 3UNYA 1LXNA 1XERA 4OGCA 5K14A 4DU1A 3DI6B 1EXQA 1EETB 4WE1B 4P2SA 4NB4A 3KOAA 1WN7A 4M5DB 3AJ2A 3LO3A 1WSGA 2U2FA 5D4OA 5IM0B 2ZGZA 4TY8A 4DHVA 2YKPA 1VHXA 2ASPA 3OXLA 3CXCM 2O5DA 3D6FB 1NPRA 4DL3A 3UPFA 3D2WA 4OHXA 5AQRA 1VQKN 4QWAA 1IBMF 2HHHJ 1OVQA 2F9JA 1R8AA 2XG8A 3KK1A 3N4WA 3IS9A 4DLEA 2G8VA 3CJ7A 4Y00A 1U1LA 4A5BA 1NLKL 1TUWA 2FDNA 5IC4B 1UFKA 4J91A 4DV0J 2ROGA 3KG0A 2B5JB 2PYLA 3M8SA 2AEJA 2FVSA 3G8SA 3C6TB 2F4VJ 4ZS6A 4CEDA 1ZPVA 4HUEA 5J1NA 2F65A 1U2CA 1UJ5A 3NGRA 3J7A1 1Y5IB 1NJYA 3R27A 4V19S 3O1LA 4I9LA 1WG4A 2QL5B 1LWEA 4K4ZA 4YOXA 4ZCIA 3U4LA 2ZH1A 2G8FA 4CFCA 1WSVA 5E26A 1UJ4A 1AA1B 4L74A 2MPUA 1HMVB 4CGFA 1QE1A 4DU8A 3OYHA 4Y34A 4OZ3A 3W1YC 2R2RA 5C7PA 2FJWA 3TRGA 2CPDA 2DRBA 4HI1A 1CPZA 3PCOB 4LF6K 2M70A 1BCMA 1TTHB 3C6HA 3BZCA 5CYMB 3AHPA 5F8GA 5L1JA 1HWLA 3AVFA 4JI0K 1TV6A 3FDSA 4ILLA 2HGNA 3MPVA 1XMQK 2FC9A 3A5NC 1HWJA 5KG2A 1VI7A 2D3ZA 1VMBA 1O13A 2OTJN 4CJEA 4ZP7A 3OYKA 1V5IB 1WAJA 4WQ5A 4LF5F 1ZETA 5HRSA 1ZBUA 3WNFA 2C2EA 3FEZA 3KJQB 2JH3A 4OPJA 2A6OA 4FJ7A 4QR2A 3ZZRA 4NO7A 1MROA 4ZCMA 1IJJA 5C24B 3QIPA 4P73A 5J2NB 4OVLA 5H9FJ 1Y5LB 2NCKL 3OYBA 5JS1A 5KRSA 4KGVB 1VQOS 1U2FA 1QQCA 1CXUA 3VF2A 3QGGA 2ZE2A 1S79A 5AQQA 2CFXA 5CYQA 4JI3F 1JQGA 3MM5B 5B0DA 1YI2N 1RTJB 2W2PP 3CDEA 3NXZA 1WSIA 4FLYA 4TYBA 4A57A 1N4LA 4RW8A 2MQNA 4IH6A 5GAHU 3WXLA 3N4QA 4XPEA 2CPJA 3QSIA 4G1IA 3RU0A 2DPIA 5A8KA 4DLGA 4ILRA 2XSFA 3W63A 1D1UA 2WSEC 4CI0B 1QAYA 4DJBA 1VK8A 4XIUA 1QSYA 4IQMA 2HPUA 1VDHA 1GLEG 4CYUB 3UD5A 3PO4A 1BWFO 2YHWA 1KLNA 4MAKA 3DAWA 1HNXJ 4I6YA 1UA0A 4WFZA 3HTVA 4EHTA 2YNIA 5IT0A 4DV5J 3EM1A 2MJNA 4DUZJ 2UUCF 4KKOB 4CLFA 4CJPA 5LJ3Y 3NBPB 3V6DA 3MDQA 1W26A 1IO2A 3UQSA 1NSPA 4LQ9A 1R27B 2NUUG 1HHTP 4CZHA 4KAZA 1TL1A 4KHYA 3GWCA 3CCRN 3B8AX 4WXOA 4AL5A 1NGFA 2BTFA 5FRNA 2VBWA 2JWLA 1HIYA 2YNGB 2NRZA 4CEOA 2DHAA 1HNVA 5HOOA 4YOYA 2PFFB 1JJ2M 4ELVA 2R8JA 3TTFA 1B0TA 3MHYA 1PGZA 3B54A 4BE1A 1T03B 3THXA 4FM0A 4LFCK 4KE5A 4XAKA 2AP1A 3JTOA 4WKRA 1NDCA 2OCEA 1HLWA 4UOFA 3OYIA 1CC8A 2IHR1 2QMUB 5CCLA 2DNHA 4H0TB 2JL9A 5HATA 4FBUA 4ZP9A 1CC7A 1QHAA 1RTZA 3VVTA 4FDFA 5KQ8A 4PG5A 2FXUA 4F4AA 4B08A 3BN4A 3W9IA 4PPDA 3SFGA 1URNA 4BHQA 1TVRA 1CJVB 2NRRA 2FZKB 5HVFA 5A8RB 2CZ9A 3JQMA 4F9OA 4P72A 1O6XA 1UPPA 5B0CA 1D8YA 4CBWA 4JKHA 2HNDB 4KSEB 3KLIB 3FFKB 1ZZFA 3LTOA 4Q2LA 4BR5A 1YHQS 3C8YA 1H98A 1BDGA 1CQNA 3ETMA 4B17A 4C1NI 1S0MA 2EVZA 5C12A 4U8YA 3HXMA 4OQJA 3OL6A 4JKAA 1FK9A 3PIPL 3HO1A 4DL2A 3DMJB 2FJEB 3PNIA 3W60A 1DAXA 2GUIA 5KFTA 1X4EA 4QYZK 2AJ0A 2HWHA 3KK3A 5IWAK 2VG7A 1VC6A 3DGPB 2AHOB 3R8EA 4LH4A 1S7HA 3WT0A 3FR0A 1L3KA 2QJ3A 1GMVA 1VQ6N 3EL2A 4LF1A 1SAZA 4RUHA 2IAJA 3M7VA 3K89A 3U6FA 2IVYA 4QIVA 1IKXB 3CM5A 2Y9HA 5MAOA 4DUTA 4B8CA 1NGBA 1S5ZA 3D28A 2HVHA 5HQMA 3H8YA 4Z4GA 2HBQB 3FBBA 3SBTA 5GIPA 5AJ3J 1N0UA 3POTB 2A6MA 4BCAA 3OTBA 4H03B 3LP3A 1SC3B 2DNMA 5GAEI 2RRBA 2DH9A 1TAQA 4OJHA 4OV1A 4GNIA 4OLAA 1RTDA 3JAMO 3FLCO 3DXMA 3K2YA 5GAHP 2Z1JA 4CT8A 1MN9A 1YT3A 3N6NA 2OEMA 1FFWB 2HK3A 2KHDA 1T3VA 5AFUH 3A1YG 3MDFA 3OXFA 1DTTB 4OHYA 1PIEA 4JKEA 3NNCA 4ED5A 4WQ4A 4RNFA 4FS1A 2E6MA 4HDHA 3D9BA 5BN8A 2VWBA 4LSNB 2FLOA 3SSRA 3C0BA 2OI2A 1SBRA 3LOUA 4HCCA 3V4MA 1YAGA 2JNJA 2LKZA 1NUEA 4KFBA 3QICA 1KFSA 4OPKA 3G87A 4OI4A 2D3O1 1U8SA 4MKAA 3PIPQ 4QYRA 4LF7F 1H7XA 2ZH7A 2E5LK 2VA3A 1SUQA 4U7UD 4E3SA 2BX6A 3I56N 1EO1A 1HNZF 3K5LA 2COLA 1FRKA 1SQKA 4DSFA 2UUWA 3M5RA 1FVSA 3G6EN 2XS5A 1M1KT 3NAIA 1VRUB 5CE3A 1RYRA 2CQ0A 4QIGA 3IBFB 4CTAB 3MMCB 1R7IA 5IQQA 2WBRA 4MO5A 2FLPA 3ZZTA 1X31C 2ETJA 4DV4F 1XHZA 3VERA 1TGOA 1Z4UA 3BSNA 2QWQA 2YKNB 4LH5A 1HUXA 1E4GT 3LDSA 3R7NB 2BYCA 3EVMA 1GX6A 3BF3A 2E44A 2YWEA 3EXCX 1EETA 3UKRB 2BKPA 5CCMA 2OSQA 2XWXA 2HVDA 4EZ9A 2GHWA 2YKOA 4NLDA 4IO8A 5KGWA 5L1IA 3W62A 1IG8A 2I5JA 1Q81T 3QPIA 1I51B 4A4JA 5HBMB 4LF8F 1Q8IA 2IVMA 2YJEA 5HRPA 4CJTA 2YJFA 2ZD1B 4AHVA 4JS4A 1UKUA 1MMLA 2QWLA 7AT1B 3ZSRA 1KC8T 3TWHA 3C6UB 2O66A 1HR0K 1PYOB 5AQFA 2VJVA 4IH7A 4FLVA 3W5XA 2DRAA 4CLUA 3Q8VA 3U3GA 3NOGA 4FVUA 2CWKA 2VQEJ 4DQ8A 2HHUA 3SQ1A 3IAS9 1OQ6A 2FD2A 3OY9A 2L9WA 3CJKB 2B8QA 5GINA 3IM8A 3BO2A 2DNLA 3O9UA 3ZTSA 1LW0B 2GVDA 4H0VB 3KUHA 3OUYB 3ID8A 4LFBJ 2YNFA 4LFAJ 2Q36A 2V51B 4OPAA 3M6XA 4F4XA 4OX9K 4RW6A 2H9ZA 4OHVA 4ECUA 3AO5A 2ZH8A 1J5EK 9RUBA 4JYAF 1DTQA 4W92B 2IJNA 2UV8G 5JMVA 4OL8A 4ID8A 1K0VA 3JS6A 4ANDA 3ALYA 3R5GA 1B7FA 4K8ZA 1UVMA 1Z1ZA 3AO4A 2GQCA 4DQIA 3JS9A 2OLWA 2IBOA 4KH5A 4DS4A 1BO5O 1YF5L 3H6EA 1UCNA 2VQFJ 3F56A 1NBWA 2HLTA 3S8SA 3IP0A 1IKYB 1Q82T 3BR9A 4JV5K 3IN5A 3QESA 1DRZA 4ZTFA 2DEJA 2HOEA 4F3QA 4YDDB 1SZ2A 4FPRA 4H4MA 4M7YA 1T05B 5HQLA 3OFGA 2MZTA 4HTJA 3VR1A 4G65A 1WSFA 3PUFA 4LF9J 4ETZA 3RAMA 2HMIB 1S7IA 4GY2B 3OR2A 4DX8H 3T19A 3X3UA 4ID1A 4Q8FA 1YRUA 1RBUA 2R7UA 3TAMB 3PXGa 2L9NA 2JFKA 4JKGA 4JI4F 2J0QD 3PZPA 1AUSL 2OTLS 2BM0A 2H54B 1XWLA 4YN3B 1IKVB 3ENAA 2KH9A 2ZBIA 1IBKK 3M1VA 2RDDA 2GNKA 1B99A 3P45B 2HBMA 3O1WA 2KJVA 5J1EA 2E8AA 2EFGA 4MK9A 1MA9B 4EBEA 1L3UA 4RUAA 2EFNA 2XS2A 3BEXA 1S9FA 1F5CA 3U8XA 4TLRA 3KWIA 4RO0A 3H1QA 4ANCA 4I6AA 4QWEA 1HNWK 1DZ5A 2BE2A 5HLFA 3R5AA 4EYHB 1NJIO 2HW3A 2O4GA 3F9MA 4CZJA 1IWAA 3IG1A 3T9ZA 3ZSXA 2V67A 3H5YA 1KN6A 3TTCA 1H2VZ 3UD3P 3EZOA 3MMBA 3M8YA 4OHWA 1NU0A 3O4QA 2M2BA 1CJKB 4PABA 5KFDA 1RT3A 5D0EA 5EWEA 2XMVA 4ZHRA 2VBXA 2M5YA 1K0TA 1N5SA 2BRKA 2OPSB 4HVJA 2X1BA 4DSJA 2B4VA 4A2BA 3PRVA 4DPWA 1K6YA 2BOAA 3ENWA 3KHGA 2AEFA 3Q24A 4DUYK 2F3JA 1VFJA 4YORA 3RBEA 1Z2ZA 2Y1JA 3HP6A 4ALZA 1YUWA 4DX7A 4ZN1A 3TJ8A 2LXUA 3MM7B 4BLGA 3MUTP 1JLEB 1YKWA 2ZFHA 2GGPA 2YKAA 3VAJA 5F9LA 4DSIA 3LDOA 1ZA2B 5D0HA 1RACB 3SUOA 5M1FA 3HPOA 3UO0A 4J9KA 3Q8UA 4CO4A 2QWPA 3OR1B 1I94K 3UDEA 3PKMA 2ZBPA 3DXKB 4ZPTR 4BWJA 3WNEA 4I2PA 2CQ2A 4A8WA 5DGAA 3WC0A 2F8SA 2QX0A 1BA1A 3D66A 1XQSC 5FLXU 1VC0A 5C10A 2JX2A 2QO3A 1I6JA 1M90T 5K8OA 4ZLLA 3EE8A 2WCXA 5D8HB 1QQNA 2FC8A 1D5AA 2R7YA 4OI3A 4B3MF 2V4JA 5L9XA 4GW6A 4F0KA 2XNRA 3ZT0A 1PBAA 2RQKA 3VAGA 1EARA 1N48A 3NGYA 4LFCF 1KD1O 5KFJA 5KT7A 2UXDJ 4JI5F 4U6PA 1GFWB 4LIWA 2C2MB 2QN6B 2Q6BA 1RAAB 5LY3A 2FY8A 2QC3A 2PBDA 4FWKA 2FHJA 2PEHA 1NMNA 4GO7X 4ICLB 3THVA 1VSEA 3ZSZA 4WP3A 5DRKA 2MQMA 1YDLA 1S6PB 4XH5A 3THWA 1CJUA 1ASUA 4G1QB 3HSTB 1UWBA 3Q22A 1RHKB 4OZNA 2ZHOA 4IXCA 2F8EX 1P6TA 5HMWA 2XULA 5KFPA 1TKTB 2V8HA 4UY85 1K8AT 3S7RA 4F3TA 3GFZA 1F9EB 1VRQC 5CH7B 3AT1B 3K5PA 3THYB 3Q83A 3K57A 5TKWA 3H4BA 4EU0A 1RADB 4C3LA 5LMNF 3L7OA 1SQGA 1KONA 3IFRA 3Q8YA 2RF2B 2E29A 4KR0B 3K9KA 1WSHA 1YITS 3L9ZA 2YXLA 2VL1A 3I8DA 2P9LB 3BEGB 4FF1A 4IG0A 3EE3A 1RDCA 2MZJA 4CF2A 4RNMA 3LPUA 1VQLN 2O8BA 4FOIA 1BI4A 5AQMA 5IWAF 3ZNUA 3G2XA 1CZBA 4CE9A 1FHTA 2WUSA 4KH1B 4M42A 1E3MA 3NFAA 3ULEB 3SBMA 1AW0A 3H2UB 2F9DA 1ZAWA 3C46A 1UEKA 1RAFB 1WSJA 4HHHA 3TR5A 3TJ9A 2DGOA 4BC4A 4UY8O 4NLPA 4BG8A 4GRSA 1YJ9N 3D6RA 5AQJA 2QLBB 4ED2A 3AA5X 2BDPA 4O4GA 3PX4A 1DBDA 4R79A 3J7AP 2E1MC 4P2XA 3VTHA 4QIFA 1PO6A 3AQPA 4A8FA 3SQGA 5KFRA 1LW2B 2DD8S 2AJ1A 3HM8A 4OV6A 1U1KA 1W2BR 2Y1RI 2AJFE 3TWZA 3BKFA 3O3FA 2YHXA 4H8KA 3QBCA 2M8DB 3PV8A 4BVOA 4R5PB 2Q2RA 4NX9A 2AP6A 2VFSA 2CAJA 3UWTA 4QW9A 3M8PB 2V7ZA 3LZJA 3KWMA 5I42B 2DNQA 3G4SS 4CBUA 1VQPN 2P9IB 3THTA 4XEIA 4YOTA 4OYZA 4DR6K 1BUXA 3LPYA 2HVIA 1RDAA 2I0XA 3D54A 2PEBA 4KHNA 1B0PA 3S1TA 1NGDA 1LWCA 3VCDA 3SDEB 3OSNA 2RVJA 4CLKA 2A1SA 2JLEA 4LF6J 1CULA 2MQQA 3ZSVA 1Q7YT 3M6VA 4I68A 2I6WA 4NI2B 4OLPA 2J9DA 3IR5B 5D3GA 4BC7A 4JI0J 1G6BA 3KLEB 2AWZA 2WVCA 3BN7A 4FJHA 4LF2A 1XMQJ 1IXKA 1NH8A 2RN2A 4JI7F 3HRGA 3DLBA 3GJQB 1VAZA 1R8CA 1VBXA 4AYBD 1BU6O 2RRAA 4DFKA 1KHWA 2EBGA 2KRBA 1NRKA 3M05A 5DG8A 3DM2B 3EICA 2HQGA 3SJHA 4FZZA 4DTJA 1C2PA 3MPUB 2XMUA 3LALA 4E19A 4IFVA 1YG0A 1VYAA 1RT7B 1FWLA 2E5IA 3AA2A 2JEIA 1VQ7N 2DPNA 4E7HA 3OLBA 1U0HA 4CZIA 3A8YA 5JJBA 2R2TA 1B7YB 3HMJG 4AHTA 4H4KC 3LF0A 1TL4A 2MQOA 2J76E 3N9UC 3ZX0A 1QY7A 1RAJA 3QJPA 5EX3A 2OH2A 3NMRA 2J0XA 2UVUA 5C2FA 2LQJA 1UOCA 2OZMA 2L48A 3WZ0A 1OPIA 2W9CB 4I6MA 1RGVA 4O3PA 2D74B 5IT9U 3RTVA 1DQ9A 4OYWA 4JHDA 5F8NA 2MB0B 2ZOGA 2KJWA 1DT9A 3JB9k 2Y1IA 3HHNB 2G2OA 4MQ3A 3PTWA 4L3KA 3ZZUA 2H4WB 4C97A 3ULDA 4B3SF 1HQUA 2Q31A 5KFKA 2FSKA 1J5EF 3D2FB 1S1WB 4J9OA 3KYLA 2X1FA 1LOTB 2D9PA 4CGDA 1M5SA 4ECVA 4OJ3A 3ZX3A 2YWWA 3KK2A 4J9MA 2I38A 1DFDA 3QNWB 3KIOA 4DR7K 4LFCJ 1G7CB 5K8MA 5I3UA 3VEVA 3CCQS 2RHKA 3KLHB 4LSLB 3VOVA 4RZRA 3ZZZA 2ZKTA 3W2VA 3NCIA 2VPXB 3AO3A 2E7WA 5MLCV 1ASWA 2R2UA 4U9RA 3KLGA 2OFHX 3DXBA 3MCNA 4E89A 3AOBA 2QSWA 4Q0BA 3ILOA 3IGNA 1RZMA 2ZC4A 1VSDA 3BREA 3H59A 3W64A 2IBKA 2RKIB 2BM1A 1ZBSA 2HSEB 2GCFA 4CF8A 1HYSB 1IR2A 2FJXA 2WK4A 1IBKF 1Q5VA 4EBDA 3CMAS 3PW7A 2BUPA 2OYQA 1DKGD 2HFSA 3AD9C 5AQUA 3OL7A 1VLOA 3H5UA 5FPEA 2GZOA 4ECRA 3NL0A 4KJIA 1U47A 4K5SA 3AVLA 1ZBTA 4UOCA 4F7VA 4DV1K 1NSQA 4KGMA 4ZK7M 1JKHA 2ZWHA 2C3UA 2DK2A 3MOZA 3QETA 4DCHA 1U2VA 1LKZA 3BF4A 1DQAA 1S77D 1REGX 3RZAA 3VAFA 2W41A 2YWKA 1N34K 3RG6A 3RB4A 1ULRA 1K73O 1C0MA 1WOQA 3DRRA 4OYPA 1W2BM 3KG1A 1S0OA 2RUGA 1HW9A 4H5WA 1WHVA 4HVZA 2BEFA 2A1BA 3HPHA 4WTYA 3M4XA 3ZTQA 4OZ5A 2XO6A 2NPIA 4FM2A 4O44B 2AJ2A 3A3PB 5B0AA 4MTPA 3MCAB 2UXBK 1J6ZA 4ZVOB 3SV4A 1NO8A 3HHKA 4ES2A 4FJXA 4HT5A 1CS4B 3ZX2A 4J9RA 3VEZA 2EFOA 3UI3A 5AQGA 1RYSA 5ADXH 1YJRA 1QUPA 4E7KA 1S0VA 5BXIA 4W5NA 3MECB 3BDPA 3R5BA 3L2VA 1B92A 1N8RT 1JLEA 5JLFA 3OS1A 2CNLB 3JYTA 4N5SA 1ZZNA 3L2UA 3O3HA 5THWA 1JLGA 2OD4A 3GP9A 2IS3A 5KG6A 1D4XA 1HL6A 4PKIA 1I1GA 2CQDA 1LK7A 2CADA 4J90A 2GTDA 5I9EB 2CPHA 4RR5A 2XLKA 5IT9Y 3SFUA 4KPYA 2MKCA 1XC9A 2FJVA 4PQUA 4C11A 3DRPA 5HL7L 1YSJA 3LP0B 4IOCL 2K8GA 3HDSA 1KKHA 3DOLB 3D3CJ 4HEA9 3CCES 2FVRA 5ADZA 1Z05A 1CJTB 2WONB 1JCEA 3FZLA 1LK5A 4DOZA 3G8QA 4J5OA 4L76A 1AFJA 1NNDA 1GLFO 2HMPA 4B3OA 1Y11A 4ISGA 4FYVB 2Y0SD 3PYDA 3I31A 4P74A 5DQGA 4U8VA 4PL8A 2H51B 1WC1A 1MU2A 1KAYA 3O5BA 4ED3A 1RA6A 2QWRA 1ZM4A 3MM8B 1GTHA 2XCPA 2XRIA 1N5VA 3DXSX 4CGGA 2E5LJ 4CJVA 2ALYB 1SL1A 5LJWA 3ID6A 3Q2TC 2CQBA 4OYBA 3QIOA 3QBXA 3NDKA 5KFAA 3R6GB 1TKZB 2XSJB 3HHLA 3NOCA 4B1YB 2PFUA 4AH9A 3GE9A 2WSCC 3CQYA 4DR1K 1TU0B 1VHFA 1O8BA 5CY4A 1VBZA 3TR8A 1FDNA 2YHYA 1G3OA 5HO4A 2PD1A 3BJYA 2SXLA 4EIAA 5I4MA 4FJ8A 3QGHA 2KFZA 2XGQA 2KDOA 3D0HE 4CNYA 3PYEA 1AZSA 3EYZA 3OFFA 4J2BA 1MWKA 3IFEA 5AQZA 3CJ9A 2OSRA 3VMFB 3O8WA 3PW2A 4IOBA 2HNYA 3VALA 1EZZB 4E7LA 1JNRB 1NCLA 2A5XA 5AT1B 4DR4J 4NLVA 3E8OA 4JD2B 1E6VB 1R6VA 1KS2A 3CF5Q 1FNXH 1BISA 4OYXA 1I39A 1RT6B 4Z7YA 2YH0A 2O8EB 2HQ3A 3IMXA 3K0SA 1HR0J 5HL7Q 4IOCQ 2FLNA 3E01A 3B6PA 1N33J 3GFYA 1HBOB 3I82A 4KRFA 4BREA 3G0ZA 4USMA 4CO5A 4FWNA 1N5YB 2MKIA 3QAUA 2IRYA 5DG7A 3C3LA 4PEOA 5EUHA 4QQBA 2KHOA 4EYIB 5LL6Z 1NAQA 3R5CA 5AZIA 3SBGA 3KWGA 3KJVA 2HQDA 2V8PA 2J7KA 1VC5A 1X9WA 3UCGA 3TVYA 4NLSA 3HJVA 4ILGB 3LH2S 4K8XA 1RTIB 2PI4A 5JICA 3GB0A 3B82A 4F2SA 4OX9J 2RPIA 2GMHA 2N82B 4H0XB 1WB9A 4GKKK 3MM6B 1S0NA 3AAQA 3IC1A 2OHDA 5LMUF 4YP3A 4NMXA 5BYQA 2UU9K 1IWGA 5ADXA 3I9ZA 4K7QA 2OPRA 3OVNA 1UVIA 1N6QA 2QG9B 1H72C 5KT4A 3ILJA 3R6LB 3IR6B 2ALZA 3H4DA 1LAWA 3BGUA 3HHLC 5KFOA 3P83D 3Q2SC 3ITHB 2VPYB 4JV5J 3RRGA 4C0OC 1K9MO 2MKKA 2KG0A 5SZTA 2Z1HA 2PA8D 1BY9A 3LDQA 5H1SV 3QFUA 4ED8A 2HGMA 3RBZA 2DHHA 3DLKA 4TU7A 4C2MA 4ZKAA 3PFEA 4DX5A 3EJMA 3TNVA 4NMLA 5KFQA 1OY9A 1C1BB 2FB0A 2XZWA 3VQ8A 3NMAA 4ZVEA 4N41A 3R1HA 1A0OB 2IM3A 4LRBA 4DV7F 4BRIA 2J0WA 4MLEA 2CJ9A 1ZXOA 3CFRA 3D2EA 2DBBA 1KVBA 4LC9B 4AILC 4DV6F 4BR2A 1RT2A 3CYMA 3TX8A 3M9OB 3QYYA 3TTDA 3FRZA 4AT1B 2IFXA 1XR5A 1FKPA 2C3PA 1HNWJ 2XM3A 2H4YB 4Y2IA 3HSDA 3TUPA 2XMMA 2G9OA 1TUYA 2XMAA 3QMLA 1VQKS 1IKWB 3IWLA 1T0TV 3BQ0A 4M3UA 2O4IA 1GH8A 2PMHA 1OO0B 3C15B 4AM7A 3QDKA 3D7EO 4X84A 3AY9A 3VQPA 2DGVA 3AJDA 2PC6A 2KT2A 3KZBA 1TL3A 2AGQA 2XGPA 2VPWB 1X4AA 3VWSA 1BQMA 1QVFR 4KHPK 1HBNB 4KO0A 4NYNA 5E33A 2FY1A 5B8HA 2V7YA 2DGSA 4ED7A 1D9DA 3AB2B 4IQXA 4PYAA 3J7ZT 2WRMA 3MWBA 3QZ7A 1FF2A 3OHRA 2W2MP 2AYGA 1Q86O 3OJUA 3HM9A 3M2VA 5DDPC 2MHEA 1ZAXA 1DQ8A 4CO1A 1S9EB 3LW5C 4O5FA 4HKQA 3VAHA 4DUYJ 2QA1A 1X0FA 2AYMA 1TZ0A 2UUAK 5CZ2A 5KFZA 3NRBA 2LLZA 5F0XA 3M1FA 4FO0A 3GILA 2C2RA 3R7SB 2F4VK 3VQ9A 3PM9A 4CGIA 3HL8A 3L3VA 5F41A 3GIMA 4BRPA 2FHKA 1RWUA 2V9WA 3I0SA 2YKQA 4ZJOA 4CHNA 3T5KA 2W24A 2YKMA 1U1NA 2IIHA 1KQGB 2HBJA 1WBDA 1WBBA 3ZZPA 3V4IB 1I94J 3GU0A 2MLYA 4EBCA 1OKJA 4FJIA 2A1RA 3H0PA 4QPXA 4R8UB 1T9XA 5KFGA 3K5OA 2BW7A 1C6VA 4ISEA 5RUBA 1VRTA 4CH0S 1VISA 3RSEA 4CEFA 3VZHA 3H45C 2JC1A 1IBLK 3CJQA 2Y0BB 4ELUA 2E2OA 3MI7X 2OTJS 4E1NA 9ATCB 2DEIA 2MKSA 2EFQA 2ZEJA 1ZC6A 2CWXA 1HBMB 3K5NA 4IR9A 5G0RA 2Q66A 4ZMMA 1YJ7A 2E1ZA 2YNHB 4DN0A 2B0GA 3BGLA 1RTHB 3I9V9 3M32B 4B9LA 2GW8A 3MR5A 4L73A 3HVTA 1RT1A 3BF1A 1RWNB 3OA9A 4YHHK 3AV9A 2CIMA 2P9GA 1T6CA 4C8LA 3HI9A 3BZKA 2IC3B 1V6HA 1GQEA 3MCMA 4WFAL 4KHRA 3HYFA 2W2QP 4FYYB 1WELA 4L72B 4JK9A 2ZBQA 2GMLA 2CGKA 5J2PB 5HROA 3LP1B 1GNKA 4ZVUB 4JI8K 1KVCA 1N32J 3MPYA 1RGIA 5SUHA 2J9EA 1TYQB 1V4SA 5AQHA 5CQGA 4IDKB 2LA6A 1Y64A 1FDDA 3G82A 2NUHA 2UXCJ 4DQRA 5KT6A 1HD0A 4IFEA 1TMMA 3H42A 4O3OA 4D3HA 2H5IB 3KNAA 5CHCB 1Q7LB 3VGSA 2J6TA 4QR0A 3MAHA 1MMDA 1V3SA 3SV3A 4DV1F 2F63A 1MDUB 2KO1A 2OO4A 5E0OA 1OSCA 4JI1K 4Q2MA 1WF2A 4HHJA 1F5AA 3V9WA 4WIQA 1N34F 2LU2A 3UKUA 3G71N 2ZNZA 2W2OP 2M52A 3DLGA 4X2BA 3CFOA 4WPAA 4E7JA 2EPIA 3AO2A 2AU0A 4ATNA 4WYWA 3KHYA 2H5JB 1VJWA 1WNEA 4ZIWA 2RQMA 1R0AB 1JB0C 3OYCA 4MFBA 1JLAA 1ZA1B 3P5BP 1KQKA 4YDUA 1VSJA 3I5BA 5BRDA 3MEEA 2NQPA 3LM9A 4E7IA 2NRVA 3AA3A 3VGMA 2LFVA 2PIIA 3BY5A 3LP2A 3M30A 2ZH6A 2YWFA 4PWDB 1UPMB 3GIJA 3QMQA 3A0IX 1JXEA 4M41A 3OV7A 4WTOB 4WFAQ 4ILHA 2KHCA 4BRQA 4B9MA 4DX6A 4YFUA 2UUBK 3MMJA 3Q86A 4K5RA 3PJ9A 4EAHD 2IIRA 5D0RA 2BJ1A 3ATVA 3VQ5A 2ABYA 1T9WA 4I1TA 4OMFG 5AZJA 4NLWA 1C1AA 1NOYA 3TSQA 1RWKB 4C8MA 3TVKA 1BWVA 1GMWD 4HUFA 1YXQA 1NK8A 3CJ5A 1TK5A 4K43A 3W2WA 3UD4P 4DR6J 5F3TA 3FSYA 1CXQA 4FJ5A 3EGNA 3WXMB 2GX8A 5BR8F 2QRRA 4TY9A 3T7ZA 4C98A 2WVFA 2HF4A 3WEEB 1SKWA 1GEHA 3S41A 3BGRB 3N6LA 3LAKA 5GAGU 1F21A 1YGYA 4ZP6A 3K5MA 3TARA 4DN9A 2VFTA 2QTWA 4CEEA 2GS8A 3ISND 4NPOA 2ROPA 2O67A 2F9TA 4DR1F 3V9XA 3HOTA 3ISZA 2HHSA 2PO4A 3SJJA 3PJXA 4NYPA 4OLBA 5C5JA 2GIFA 3O5TB 1NK6A 1FKOA 4FN5A 4J9LA 4TVAB 1ZM3A 1C0UA 1MWZA 3AD8C 4FK0A 4UUWA 1HI0P 1JL1A 4FXDA 3NAHA 1Q16B 3S01A 1M1KO 3SUPA 3T1AA 4YDUC 2XY7A 1WAFA 4URGA 4FXVA 3O4WA 1JLCA 1Q1KA 3CCJS 4YOEA 1SS6A 1ZBIA 4KPCA 2O8DA 3FZ2A 3QLHA 5K14B 1XUPO 2C3YA 1PC5A 3HKWA 1REVB 1DURA 1X9MA 4PG6A 3SCIE 3LDLA 3MTKA 3TUIC 4PXDA 2IRXA 5AQKA 1OH7A 2YHBA 4DL6A 1MW7A 2N4DA 3S6EA 4TY8B 3BPDA 4R0JA 3KMSA 4USVA 3QEVA 4FBTA 2CPZA 4RBUA 3L2WA 2E1YA 4DCPB 4CHPA 3CEDA 1Q81O 4PCQA 4HLBA 3MF5A 1WJ9A 3RAQA 2BV3A 3C7NA 4PXEA 3ZEUA 3D4JA 2RB7A 3VENA 2AZ1A 2VUGA 3KK1B 5EN1A 2FSJA 3VETA 3DOMA 2KZZA 3IS9B