5C24A

Crystal structure of hiv-1 reverse transcriptase in complex with 7-((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8-dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
537
structure length
537
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPAKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE, P66 SUBUNIT
publication title Discovery and crystallography of bicyclic arylaminoazines as potent inhibitors of HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase, hydrolase/inhibitor
total genus 151
structure length 537
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5c24A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5c24A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5c24A05
3L2RA 2OZMA 3DM2A 4WXOA 4H54A 3KK3B 4FJ7A 4I2QB 4CGGA 4LD0A 4WYLA 3SCXA 2VA3A 3DRPA 3HVTB 3H5YA 2WTFA 1S1VB 2C28A 2Z1HA 2GIQA 4JS4A 3I0RB 4DQQA 2OPRA 4NLSA 5D3GA 3HVRA 1S1WA 3NL0A 3OYEA 3QIPA 2X6NA 3E01A 3KLHB 1TVRA 4TN2A 3ICLA 5HBMA 4Q8FA 4E7HA 1KHVA 1NKCA 2IA6A 4ECZA 3OYJA 3M8SA 1KHWA 4DL3A 3ZSXA 2AU0A 3D0PA 4O4GB 3DRRB 4DG1B 1TV6A 4LH5A 3KLEA 1WLJA 2ZQBA 4ZPDA 3V1OA 5FROA 2BGGA 4IRKA 3V6JA 4FLUA 4BE1A 1NHVA 3C6TA 3IGVA 1C0TB 3T5HA 3KD5E 4IH6A 4RW8A 5KFGA 4CF0A 2R8JA 3QO9A 1KFSA 1HPZA 1XHXA 4EP5A 4IRCA 1HYSB 4LQ3A 3VA0A 1SH2A 1TKTB 1GOBA 1SUQA 4NCBA 1WSEA 3TAQA 2KZZA 4NLQA 4W5QA 4ECRA 1BIUA 4CF9A 3CVKA 3D28A 1S1XA 1DLOB 3U3YA 4FW1A 3NF8A 2FJVA 4GC6A 3K5OA 3ZSOA 1YVUA 1WAFA 1IKVB 3NMAA 3TVKA 1KCFA 1VSIA 4R8UB 1S6PB 3G10A 4CHNA 4H4OB 3BQ2A 4FJGA 5SZTA 4CHYA 4DTRA 5KFAA 2RF2B 4DLEA 4ELVA 4CEDA 2IOCA 3Q8PB 4RNFA 3QEPA 4K4WA 3GYNA 4Q44A 1IKXB 3GIIA 3HXMA 5J2MB 3V9ZA 3FFIA 1FK9B 3SFUA 3DLGA 1X9MA 4ZVEA 2QKBA 3HHKA 3RBDA 3SV4A 4FLZA 1VRTA 2VG5B 4DLGA 3MEGB 2B5JB 5KFEA 3L2VA 3OL8A 3VQ7A 3H08A 3Q8RB 2HB5A 3VA3A 3PW7A 4XPCA 3PW2A 3C6UA 2EC0A 4PWDB 4QW8A 5JUMA 4MFBB 3NH2A 1TP7A 1T05B 4IFYA 3TAFA 1NJZA 4F4ZA 2D41A 4K4ZA 4K50A 3UDLA 3OY9A 3M8QA 2R7YA 1RT1B 4BE0A 4FLYA 3BREA 1HQUA 3THVA 4Y2CA 2BANB 2FJWA 4NCGB 4DSIA 3V9XA 2YKNB 2JGUA 1MU2B 5KT3A 3H98A 3PX0A 4KHWA 4I2PB 3WNEA 5J2QA 4AH9A 3BJYA 4C8NA 2ASDA 4Z4EA 4JV1A 1LWCB 4CJEA 5KG6A 3WNHA 3SI6A 1T7PA 1CLQA 4DF8A 4RW6B 2VG6B 2W9CA 4C8MA 4CK1A 3QGHA 3MTKA 1JLEA 3JYTA 3AVMA 3PUFA 3SZ2A 3DMJA 3SQ2A 1SKRA 1A5XA 3SQ4A 4ZPBA 4I9LA 3SUQA 4KKOA 1FKPB 4IDKA 1RT5B 3NAEA 5KT7A 1I39A 4L8RB 2HHTA 3HYFA 3RRGA 3KLGA 2D0BA 1JLAB 3KKRA 2PY5A 3KHLA 3DOKB 1U09A 4F2SA 5J2NB 3HM9A 4EYIB 1RTIA 3SUPA 4QWEA 5HROA 2I5JA 1G15A 1Z26A 4AILC 3TABA 4O0JA 1CXUA 1YTUA 2KW4A 3HPGA 1LW2B 1HNVA 4NYZA 2YNFA 1D8YA 1LWFA 4M3RA 1C0MA 4ZTFA 5K14A 4CERA 2E9ZA 5I3UA 1WNSA 3ZT2A 3LZJA 3AO3A 1QSSA 4DWIA 3ALYA 3FQKA 4O4RA 3CIZA 3PO5A 3LALA 1WSHA 3OYLA 3HT3A 3M8PB 4TQSA 1HMVB 1EP4B 4AHVA 4CJKA 3KMQA 1RBRA 5HLFB 1S9GB 4FLVA 4KB7A 1NK5A 3FRZA 2QKKA 3CFPA 2RPIA 4MKBA 3RBEA 4KHUA 1B9FA 3NKYA 2QK9A 1UAXA 3SJJA 4Y3CA 2DY4A 2B4JA 4OVLA 3PX4A 4TY9A 3SNNA 4NLWA 3Q8QB 1S6QB 3V9SA 4TXSA 4F4XA 1C1CA 4BWJA 4ZPCA 3VQEA 5F8LA 4KAZA 3HO1A 4CHQA 4Z4FA 4CEZA 1IM4A 1BI4B 1QSYA 5F8NA 5KFLA 3QNNA 4RW7B 4ID5A 4Z4HA 4DTNA 1BL3A 1BCOA 4FS2A 3KK2B 2WRMA 3P5JA 2QV6A 2OH2A 2KTQA 2CKWA 1CZBA 3VQ9A 2HW3A 3DLBA 2WONA 1C1BB 1NOZA 3MR2A 5JS1A 4FBUA 3G0ZA 1TK5A 4W5TA 2ILYA 4IG0B 3OYBA 3MXMA 2HHXA 2G8IA 3NF9A 4YNQA 4B9MA 2W7PA 4CGDA 4G3IA 2V4QA 4I9QA 2W9BB 2FC0A 1JXEA 5FRMA 2XY6A 2FBYA 3ZSYA 4FK2A 5FRNA 1OS5A 5CYMA 1FKOB 3RR8A 4DFKA 1U48A 4PUOA 2RDIA 3OYMA 3SYZA 1NK0A 1JX4A 3AVIA 5J1EB 4Y34A 1K1QA 1A5WA 1DTTB 3OLAA 4DFJA 3DI6B 2FBTA 3KK3A 2Z1IA 4I2QA 1ZBHA 1XWLA 3HVTA 3OL7A 3KHRA 4DMNA 2R8KA 3RTVA 1A5VA 1S1VA 4K4UA 3TI0A 3I0RA 4GMJB 4EBCA 4DQSA 4NLVA 1QQCA 3QGGA 1S0MA 3NE6A 2J6TA 2B6AB 3B6OA 1TAUA 1JL1A 1U4BA 3MF5A 1X1PA 4NLDA 3KLHA 2HNZB 2OPSB 5T7BA 4RW9A 1RTHB 3LAMA 4O3QA 2UVUA 3EZ5A 1REVA 3QLHB 5KFVA 4KSEB 4OKJA 4DQRA 4AHSA 4KTWA 1VRUA 4ZP7A 5KFPA 3GQCA 4O4GA 2AGOA 3DRRA 1ZTWA 1C6VA 5F9NA 1C0TA 4FM1A 4KBIA 4K4XA 3QEWA 1VSKA 5DG9A 5KG3A 3S3OA 1IKWA 2VG7B 2X6SA 1QE1A 2PYLA 1NK4A 2LSNA 2Z1JA 2HHUA 3NCIA 4CJ4A 1HYSA 1LV5A 2D5RA 3ITHB 3RB0A 5CZ2A 1JLFB 1TL1A 3MR5A 3NGIA 3SUOA 4F50A 2ALZA 2XGPA 4J9KA 5SWMA 2FLPA 2UUTA 4CJWA 1L3VA 1DLOA 5KFHA 4B9LA 4C8LA 3L2WA 4FJMA 1IKVA 1SL1A 4R8UA 1IKYB 1S6PA 4K4YA 1UA0A 1QSLA 4H4OA 2ETJA 4CJUA 4YMEA 4MIAA 2RF2A 3OYIA 4DL4A 3L8BA 2WHOA 5F9LA 4IBNA 3BQ0A 3BGRB 1S1TB 1VSEA 4EP4A 3V1QA 4LSNB 1TL3B 1S4FA 3MECB 2ASLA 3OL9A 1L3UA 3IAYA 5J2MA 1VSJA 1HRHA 3AO1A 1ASWA 3HSTB 2R2RA 3O3GA 3OS2A 3AVHA 1U49A 3H40A 1JLCB 4MK9A 2W8KA 3NHGA 2VG5A 4IKFA 2B5JA 4ZPAA 3KLIB 4KREA 3JSMB 5KTQA 1XHZA 4Z4IA 4QWDA 4URSA 4PWDA 4M3XA 2FVRA 3UIQA 4O0IA 4DQIA 1UA1A 4NLOA 4MFBA 3IS9B 1T05A 4HHTA 2YKMA 3V81B 5EWEA 4E7LA 4KB1A 1SH3A 3CO9A 4O3PA 3OSPA 2ILZA 2BANA 3DRSB 4NCGA 1MU2A 2B43A 3NGDA 2HNYB 5C5JA 4K8ZA 4YR3A 4I2PA 4CFDA 4J9LA 1JXBA 4ICLB 4J9QA 4WZQA 4XO0A 3CJ3A 1LWCA 4OLBA 3LP2B 3CJ2A 4KO0B 3MXIA 4RW6A 3HKWA 1RDRA 4G1QA 2VG6A 1KLNA 4N5SA 4X2BA 1C2PA 4KHQA 4NLPA 4DFMA 2YNGB 4CFCA 2GC8A 3NH0A 5JXSA 1BISA 4DSLA 3T1AA 5C42B 4CGIA 1FKPA 1RT5A 4KTQA 3QEVA 3IRXB 3OYCA 3HK2A 2F8TA 4BWMA 4JRQA 4DU3A 3HJFA 1JLAA 4NLTA 3DOKA 4RG8A 2FBVA 5DK5A 5C24B 2FJXA 4KFBB 4F8RA 5J2NA 2YV0X 1RT3B 4IG3A 4HUGA 4CJFA 2DFEA 1HQEB 3QETA 3AA5X 4CE9A 3HP6A 4B8AB 3TAEA 3NDKA 4DL2A 3AVAA 1WAJA 3CM5A 1JLGB 2NUBA 2V0NA 1N4LA 1N56A 5T14A 2IM1A 4CJTA 4PA1A 3QINA 3BDPA 4KI6A 3OVNA 4LH4A 3RAXA 3O4QA 1J54A 4EBEA 5DLGA 3M8PA 3AA2A 1HMVA 3IG1B 5EWGA 1EP4A 3NAIA 1D5AA 5HLFA 1S9GA 4JUZA 4E89A 4R5PB 2EX3A 5J2PB 4LSLB 2AX0A 3T3FA 1S48A 2XY8A 4MK7A 3RMCA 1NK7A 3PW0A 1DTQB 1EETB 4NRTA 4CJQA 3RB6A 3HPOA 1NKBA 4OL8A 1GOCA 2UVRA 3OLBA 3AVGA 1CSJA 1LAVA 1KRPA 4MH8A 4M3WA 3MFHA 2XHBA 1BI4A 2P5GA 3ZT1A 4WFXA 4DSJA 4EO8A 1ZTTA 3KK2A 2JC0A 4CF1A 2HNDA 5KFOA 2BE2B 1BGXT 1J9AA 3LPTA 3V6DB 1C1BA 5DLFA 2E6MA 4IOBA 3LZIA 1Q9XA 3OYHA 4BDZA 4IG0A 1ZYQA 4J9OA 4CHOA 3KHHA 3OYKA 2IBKA 2YNIB 4B8CA 3KK1B 4O3NA 1VSDA 4IFVA 4W5NA 5DQHA 3T5LA 3U3GA 1S9FA 3PV8A 5KFDA 4KTZA 3WNFA 1FKOA 4KAIA 1N48A 2C2EA 2HVHA 4TY8B 3LWMA 1W9HA 5KG7A 1RT7B 5I42B 4K8XA 4XPEA 3QEXA 3VQQA 4K4TA 3RB3A 4QPXA 3DI6A 2ATLA 4FK0A 4FYDA 4CJ3A 4NLGA 1RYSA 4KB0A 3LP1B 2W9AA 1RDDA 3KLFB 4KHMA 2IGIA 5KFCA 4BE2A 4YR0A 3DLRA 3CM6A 3RMDA 4E1NA 4LQ9A 1RT6B 2B6AA 5KFIA 1XC9A 1N5YB 2XCAA 4Q5VA 4J2EA 3UQSA 2HNZA 2OPSA 5KFRA 1NOYA 2OPPB 3LAKA 2IJNA 4ED3A 2E4LA 2QE5A 4FJJA 4OPKA 3QLHA 4CGHA 3V4IB 4DTUA 4ELTA 4RZRA 3P1GA 4H8KA 4PQUA 4RUCA 3N6LA 4JRPA 4TYAA 4WE1B 4M41A 3IN5A 3E51A 1RA6A 3TANA 4MQ3A 3NF6A 4CJLA 4ECTA 5DQGA 3EY1A 3VQSA 1RT2B 5KRSA 2VG7A 3OYAA 4XIUA 3LP0B 5KGWA 1QAIA 3HPHA 4CESA 3NBPB 4ED6A 3ITHA 3Q8SB 4CEFA 4IKAA 4RW4B 1JLFA 4F4KA 3EZUA 3AVJA 3LWLA 4DL5A 2HWIA 5HRSA 1ZBLA 1JLBB 4CF2A 1IO2A 5L9XA 2AWZA 3BSOA 1N6QB 1B9DA 1ASVA 3B6PA 2EHGA 2BQRA 3GV8B 3KLVA 1U04A 1WSGA 3DYAB 4KHRA 4FLWA 4JV0A 1TKZB 5KFFA 4OLAA 5HP1B 1KVCA 3BGRA 4J2BA 5DGAA 4FJ8A 1S1TA 4NLRA 4EZ9A 4LSNA 1TL3A 1YTAA 3MECA 4E7JA 3QESA 2W8LA 4DTMA 2HAIA 1NJYA 2FVCA 3V1RA 3FQLA 3ZSRA 4N56A 4FK4A 3OHBA 2JEJA 1F21A 1TAQA 4DTSA 2O4GA 4CFBA 1BQMB 1NJWA 1JLCA 2PZSA 4EZ6A 2XY5A 1WSFA 1NNDA 3MEDB 1WSIA 3KD1E 4IQXA 3GIMA 3KLIA 3JSMA 1VK0A 2W42A 4FJ5A 2HMIB 3VQBA 3QNOA 1SV5B 4DFPA 4J2AA 3K5LA 4NLUA 3AO4A 4DL7A 1LWEB 4URQU 3IS9A 4M3TA 4MK8A 4ECVA 2FBXA 4F4WA 3V81A 3M9NB 4CIEA 4OKKA 3PO4A 4I7FA 3HP9A 2G8VA 3S3NA 3OHAA 3DRSA 1QAJA 3AVNA 4ECXA 2GV9A 1RILA 2HNYA 3AV9A 1SKWA 1RDBA 4ICLA 4K4SA 3VQ8A 1VSLA 4BACA 2FVQA 4C8KA 2JEFA 2HHQA 3LP2A 4M45A 4KO0A 2KZMA 1NKEA 4FCYA 1NK6A 1KLMB 3SPYA 1ZBUA 5HRPA 2IAJB 2YNGA 2GBZA 5CZ1A 2D0CA 3MFIA 1QTMA 3H2LA 4ZP9A 1B92A 2X78A 5L1LA 2WOMB 2UVVA 3AVBA 3AO2A 1HNIB 1RNHA 3IRXA 1J53A 3BSCA 3CJ0A 2G8FA 5C24A 5L1JA 3I5AA 4ECYA 4KFBA 4ECQA 4TSXA 3VQ4A 3CJ5A 5EWFA 2D3ZA 1RT3A 2CJQA 2ZE2B 1HQEA 3MEEB 4KV8B 1HARA 3U6FA 2BRLA 2F8EX 1JLGA 2XO7A 2DPJA 2E9TA 4DTXA 4DG1A 1UOCA 3IG1A 3BSNA 5FDLB 4FVMA 2OYQA 3NAHA 4TQRA 2Z1GA 4ZVHA 3PX6A 3MR6A 4R5PA 4FZXC 4LSLA 1KVBA 1IH7A 3TAPA 4N76A 1Y97A 2ZKUA 1EXQA 3QGIA 1KSPA 1EETA 5CYQB 2XI3A 4M95A 4NLYA 2X74A 3KNAA 2JLEA 1TKTA 1RT4B 2DFHA 3SV3A 3NH1A 3WNGA 4B9UA 4ED2A 5KFYA 2IC3B 4B9NA 4NYNA 3GV5B 4DS4A 1SKSA 3TAGA 4J2DA 4KI4A 2FLNA 1RBUA 3RB4A 1S9EB 2XC9A 4IDKB 4N47A 3CQ8A 2BE2A 3F9KA 4EYHB 2OZSA 3EPIA 1S10A 4O55A 4Y2AA 3OSNA 3KLGB 1TGOA 4F3OA 3C95A 1L5UA 1CXQA 5E41A 1WN7A 4CFAA 2G8UA 2YNIA 1IKXA 5EUHA 4FJ9A 3CFRA 5KG2A 4IH7A 1J5OB 3KK1A 4FM0A 1QUVA 3NGYA 2IM3A 2RKIB 4QOZB 2R8GA 1FK9A 3T19A 2P5OA 5K14B 3DLHA 4ED1A 1L3TA 2HWHA 4TY8A 4WYWA 3MEGA 4O3SA 1RT7A 5I42A 4ED8A 4EEYA 4F2RA 4ECUA 1I3AA 1VSFA 3OS0A 2D0AA 5HRNA 3ZSQA 3LP1A 2BQ3A 1JLQB 2AX1A 4CK3A 1RT6A 3GV7B 3UR0A 4FJIA 4TYBA 3DLEB 1N5YA 3PZPA 1RT1A 5KFJA 4H4MB 4F4YA 3G6YA 1D0EA 1LW0B 3RWUA 4ED7A 3M9MB 3ZT0A 2YKNA 2DTUA 4OJRA 3N6MA 2R2UA 3V4IA 3PHEA 5F8MA 3TWHA 3TAMB 1K1SA 3ZT4A 3AA4A 3LPUA 5L1KA 2YHAA 1RDAA 4B9VA 1XR7A 2XI2A 3CWJA 1RT2A 3D45A 3K57A 3LP0A 1TKXB 5EDWA 4Y1DA 2BDPA 5DMRA 3LDSA 3ZSZA 3NBPA 4ZP6A 4M3ZA 4GC7A 4QW9A 3GILA 4RNMA 2E9RX 4RW4A 1SH0A 4CIFA 3H4BA 2C2DA 3T5JA 4CK2A 3I0SB 3KKSA 3ASMA 2DPIA 5KFZA 1I6JA 5DG7A 4CHZA 1W0HA 1N6QA 3F73A 3AO5A 1T8EA 3QEIA 1T03B 4JS5A 2VWJA 3DYAA 4FJLA 1LW2A 1T3NA 2XGQA 1BHLA 2HHWA 1TKZA 3IGNA 4CF8A 2HVIA 5HP1A 3OJUA 3OS1A 1WSJA 1HJRA 5KT6A 2BRKA 3SQ0A 5C25B 2IM2A 2E6LA 4ZVFA 4E3SA 4HKQA 4AHUA 1LAWA 4RW9B 2JC1A 1GOAA 2QXFA 3HL8A 1Q9YA 4B3OB 5KFSA 4J9PA 1REVB 4CJSA 5JS2A 1BQMA 1VRUB 4YFUA 3UPFA 4HVJA 5KFKA 4M3UA 4IH5A 5KFWA 3T5KA 3MEDA 4DTPA 4FZZA 3H5SA 2DFFA 3TQ1A 1S6QA 4AHCA 1D9FA 1WNEA 1RA7A 1L3SA 1RBVA 2HMIA 1SV5A 1IKWB 4Q0BB 1R0AB 5KG0A 1QE1B 3PJXA 1BQNB 1TQLA 1SL2A 1LWEA 2V4RA 2HHVA 4RW7A 4U6PA 4RU9A 2ATQA 4ZHRB 5KFMA 1C0UB 2R2SA 1TL1B 4Z4CA 4FJNA 3PW5A 4J9MA 3O3FA 2YNHB 4CEAA 4ZTJA 3DOLB 2UVWA 5KRTA 4E1MA 1SL0A 5KG4A 4WFYA 1RTJB 4URGA 2W9BA 3O3HA 1KLMA 1ZBFA 1Q8IA 2GIRA 4CEOA 1ZBIA 3D5MA 3SQ1A 4FJHA 2IAJA 3ISND 1BIZA 4AHRA 5J1EA 5DGBA 1DTTA 4ID1A 2WOMA 5KT5A 1HNIA 2C2RA 5KT4A 1JKHB 2PYJA 3K58A 1NHUA 4FJKA 4ED0A 1D1UA 4KE5A 1ITGA 2ZE2A 3K59A 1X9WA 3MEEA 4KV8A 4ZVGA 2RDJA 3PVXA 4KHNA 2IM0A 5DQIA 4DL6A 4HCBA 3G86A 3MAQA 4J9SA 3QERA 1RTHA 5KFBA 1QHTA 3CG7A 3BR9A 3OJSA 3I8DA 1RCHA 3KJVB 3DLKB 4OPJA 2GUIA 3A2FA 5KG1A 4Z4GA 4NRUA 3AVCA 2P1JA 2YKMB 1UWBB 1S1UB 5FDLA 1RTDB 3AVKA 4J9RA 3LANA 1GX6A 4FW2A 3NFAA 4DSEA 3OYFA 2BR0A 4YQWA 3HVWA 4O44B 2V9WA 2D7SA 4Z0UA 1RYRA 4U7CA 5F8GA 5CYQA 4DTJA 4WXWA 3EPGA 1Z25A 3FDSA 2OPQB 3ULDA 1RT4A 4G1QB 1X9SA 3AVFA 3FSIA 5KT2A 1EX4A 4CEQA 2IC3A 2ZD1B 2FLLA 5KGXA 3K5NA 3VN5A 4N41A 4M94A 2VWKA 1S9EA 1IKYA 1CZ9A 3KMSA 3L3VA 3DM2B 3N6NA 3KHGA 3KIOA 4B9SA 1W25A 2I1RA 3QIOA 4BDYA 3PY8A 4KHYA 4IRDA 3HVAA 3DRPB 2C22A 3AVLA 2D3UA 4CJPA 4ELUA 2A1SA 2OPRB 3ZCMA 5D3GB 4IG3B 2WCXA 1U45A 3DDKA 1JXLA 1TKDA 1S1WB 3RAQA 1RBTA 3QIPB 1J5OA 5KFNA 3SPZA 1RDCA 3S9HA 3E01B 1TVRB 2RKIA 5HBMB 3SI8A 4FLXA 2OA8A 4OGCA 3VQ5A 2J6UA 3CFOA 5CY4A 4GW6A 4MKAA 5HRRA 4B08A 4WZMA 2FVSA 3PW4A 4C8OA 2KFZA 3K5MA 4DU1A 1TV6B 3KLEB 3ZT3A 4M3YA 1EKEA 4QWCA 2IDOA 3NGZA 4DU4A 3C6TB 1JIHA 4CGFA 2WB4A 1YT3A 4RW8B 1JLQA 4DQPA 4Q8EA 3QIDA 4GVMA 1XI1A 3RR7A 3QO9B 1HPZB 4KHSA 4NCAA 3QYYA 2G8HA 4ECSA 3DLEA 4IR1A 2F96A 3G6VA 4H4MA 2VA2A 3KTQA 1SUQB 1LW0A 4DEZA 2O5DA 3H5UA 1VSMA 2P51A 3S3MA 3OYNA 1TK0A 2W7OA 1S1XB 2RN2A 3TAMA 4TLRA 4FM2A 2YHBA 4OGEA 3ZSWA 1ZETA 3CJ4A 4OKEA 4ECWA 3EYZA 4LY7A 2HNDB 2R8HA 4CJRA 3OYDA 4R0EA 3ISNC 1NK9A 1BCMA 4NZ0A 1KFDA 4RUAA 4UQGA 5EU7A 4HUFA 4J9NA 4RNHA 3CDEA 4HCCA 1TKXA 4JLHA 1TK8A 2Y1JA 3RMAA 3QZ8A 4AHTA 3VQDA 1YVFA 5C42A 4CHPA 2FVPA 4DF4A 3MR3A 2G8KA 4HUEA 2IJFA 4W5RA 3VQ6A 4IFVB 4RNOA 4DS5A 4Q43A 1S49A 3FFIB 1VSHA 3DLGB 2O4IA 3I0SA 4KRFA 4MIBA 2A1RA 2XWYA 3OL6A 3CDWA 4E7IA 2XY7A 1VRTB 3SUNA 1S97A 1FXXA 1T03A 5F8IA 3PR5B 3G6XA 3P83D 2HHSA 4Q45A 4FLTA 3QZ7A 4O3RA 4M42A 3C6UB 4WFZA 4O5BA 4CEEA 2AGPA 4E7KA 2IS3A 5F8JA 1HYVA 3TARA 4E0DA 1D9DA 4IFYB 5C25A 1GX5A 3M8QB 3M8RA 1HQUB 4Y1CA 4E19A 4B3OA 4QWBA 5J2PA 4JV2A 1NJXA 3L2UA 2XCPA 3RMBA 2AJQA 5J2QB 4PQUB 3BSAA 2Q3SA 4QCLA 1DTQA 2AGQA 4FBTA 1T94A 2R2TA 1U47A 4W5OA 2W9CB 4O3OA 1JLEB 3JYTB 4Q0BA 3DMJB 1R0AA 5KI6A 2JEGA 3LP3A 3CDUA 1BQNA 4HTUA 2UUWA 4FZYA 3H5XA 3NF7A 3C94A 3O4NA 3PJWA 4ZHRA 4KKOB 1C0UA 4CECA 5KFQA 4EBDA 3V6DA 4F3TA 4ZMMA 2YNHA 1QS4A 3VQAA 3DOLA 4K4VA 4QAGA 4DSFA 1ASUA 3ZSVA 1RTIB 1IG9A 3CYMA 1RTJA 5HROB 2I5JB 2WK4A 4CJ5A 1Z4UA 1NK8A 4RNNA 1HNVB 2YNFB 5F8HA 1LWFB 2XRIA 2Y1IA 1KTQA 4NYFA 4HYKA 5I3UB 3BQ1A 2ASJA 4DSKA 3GIKA 4CJVA 1O1WA 1JKHA 1K6YA 4YR2A 3OYGA 3VQPA 4FJXA 2ITGA 4IR9A 3L3UA 3KLFA 3V6HA 1S0NA 4QWAA 3RRHA 3I5CA 2JEIA 1C1CB 3L2QA 3SFGA 2OPPA 3AA3A 1XR5A 5KG5A 2F8SA 3KOAA 1S5JA 1XR6A 4CGJA 5KFTA 2G8WA 3KJVA 3DLKA 3M9OB 3I5BA 3V9WA 3H4DA 4B9TA 4ID5B 4WE1A 3VQCA 4CIGA 4DTOA 1UWBA 1S1UA 1RTDA 4EO6A 4I7FB 1KVAA 2IMWP 3TR8A 4NLXA 2WONB 1C1AA 3V9UA 2BQUA 4YP3A 1JL2A 3MXJA 5KFUA 4CCHA 1MMLA 1RAJA 3GIJA 5KFXA 4ZP8A 4O44A 4FS1A 4BDPA 3V6KA 2KQ2A 3H59A 5DG8A 4PY5A 1RBSA 2OPQA 1S0OA 3PR4A 2AQ4A 1HYZA 4KPYA 4FXDA 5L1IA 2J6SA 5CYMB 4CEBA 2R8IA 2ZD1A 2KFNA 3K2PA 1JLBA 4PUOB
chains in the Genus database with same CATH superfamily
2CZ9A 3MOJB 2W2PP 4R79A 3DM2A 3OV7A 5JICA 2I9SA 5CQGA 4Z37A 4AM7A 3POTA 2Z1HA 3BYRA 2EFVA 4JS4A 4DQQA 5ETQA 5D8HB 1GLEG 2VDHA 1S1WA 3NL0A 1W2IA 4I0WA 3OYEA 2X6NA 3C7NB 3E01A 2H51B 3J7ZO 2HHHF 3AFGA 3OYJA 4DPYA 3M8SA 1KHWA 1FD8A 4CZKA 2AU0A 1X7VA 3DRRB 3KLEA 1Q79A 4H0TB 5FROA 3V6JA 2FHJD 2XZWA 1VQNN 3ZXWA 1C0TB 3KD5E 1Q8LA 4IH6A 2F8HA 1H2UX 2A6OA 1IBLK 2R7OA 4CF0A 4LF6J 4P10A 4EP5A 4BC4A 2YHWA 3VA0A 3EN9A 1ITPA 1U2RA 3L09A 3VGSA 2YVSA 2Y1RI 1BIUA 3D28A 3CD6N 1PYTA 3C2PA 3EZWA 1DLOB 3OBIA 2FJVA 4KGVB 2VQFJ 3K5OA 4ILGB 2RU3A 4OX9F 2CPIA 3HTVA 1W97L 5B0AA 4CHNA 2A2CA 5JVGQ 1HKGA 4BR5A 4FJGA 1YJTA 3A5MC 4DLEA 3QDKA 1NM2A 4PYDA 2CQ3A 4P72A 4DPUA 3QEPA 4K4WA 3R5BA 4ZLPA 3VTHA 1IKXB 3GIIA 2HGLA 3HXMA 2BM0A 1CULA 4W92B 2JOQA 5JJBA 5DDPC 2QKBA 4ZVEA 3HHKA 2WVFA 1P90A 2G0CA 4FLZA 4DLGA 4PXCA 3L2VA 3R1HA 3OL8A 2EG1A 1WF2A 4XPCA 3C15B 3GFZA 2VH7A 3Q86A 4DUZF 3CJBA 3WX8A 4JI2F 3ZZOA 3SCLE 3ZNUA 2E7XA 4J37A 1T11A 1QTNB 3T1YF 2J8AA 2O8BB 3I32A 1TP7A 2LQ8A 1T05B 1NJZA 4ILMA 3TAFA 2B9XA 4JI7J 4K4ZA 4K50A 2DH7A 1NJIO 2LQ5A 5AQGA 3THXB 4RTFD 4ALZA 3THVA 3TZXA 1K8AT 2BEFA 3K9JA 2FJWA 4NCGB 5A8WA 1VR6A 2HFOA 3CETA 2YKNB 2JGUA 1TTHB 3QBWA 4I2PB 2ZOFA 3BJYA 1MROB 4B3TJ 1XNRK 2YCHA 1SXLA 4CJEA 2E5JA 4QZVB 5KG6A 3VVUA 3DXMA 4CBUA 1RQ0A 4C8MA 3E9PA 1JLEA 2H4WB 5TKYA 4XH4A 3UKRB 2XG8A 3AAWB 4P74A 4WQ4C 2CQIA 4KKOA 1FKPB 2KI2A 3NAEA 1HNXK 1M5OC 4PWUA 4K0KF 3CJQA 3QICA 3KHLA 1WOQA 5J2NB 2DIUA 3IP0A 1MWYA 3K2YA 2P9UA 2KXNB 3D6FB 3HSZA 4QWEA 1UVJA 1G15A 1FEHA 4N77A 3RW6A 4DR3J 1CXUA 6FD1A 4PXDA 4M3RA 1O8BA 1UPPA 2DNOA 2YX7A 3UCGA 2GMHA 2DR5A 2N82B 2GV1A 3ZT2A 4DWIA 4FYXB 3GJRB 4NWBA 3PO5A 2ZM6J 3M8PB 1EP4B 4NA2A 4CLKA 1WC1A 2PFUA 1RBRA 1SJRA 3C14A 3CFPA 2RPIA 4MKBA 3RBEA 1B9FA 2CNOB 3SJJA 5CYJA 3ZZPA 3SNNA 1ZM9A 3R5AA 1YRXA 1VQ8N 2CQCA 4C8YA 5BPNA 5K8NA 1BA1A 3CCRN 4WK1A 4MDAA 4Z4FA 3I9V9 2Q97A 1SZ2A 4A48A 1KN6A 5HMXA 5LL6Z 4DTNA 2CZVC 2WRMA 2JJ4D 1HQ2A 3P5JA 2OH2A 2CKWA 2HW3A 1DZ5A 3DLBA 3R5GA 5CABA 4USJC 4OZ1A 4FBUA 3G0ZA 4W5TA 2ILYA 3OYBA 3NY0A 4B3RK 3MXMA 4ZLNA 3VQTA 1JNZB 3PLAA 2C2MB 2V4QA 3KK7A 2W9BB 3FZKA 3HOTA 2OEMA 4OX8A 1RBAA 4I68A 1WWHA 1QAYA 4ZKAA 4CNZA 3GJTB 3MMJA 5D15A 3OYMA 1JX4A 3AVIA 5J1EB 1X31C 3OLAA 1ATNA 2B0GA 3KK3A 3LPYA 1RDWX 2WBNA 1LOUA 1WUUA 4I2QA 3BKFA 3CI5A 1N5VA 3KHRA 4DMNA 4MMOA 1JQGA 2WVCA 4Z7YA 4DV2K 2UXBK 1QQCA 3QGGA 4S0MA 1S0MA 2GZOA 3PIOQ 2AD9A 2YPZA 3W60A 1BC6A 2FSNA 4O3QA 3RSEB 4PCQA 5KFVA 4KSEB 3P8BB 4FNIA 5EGYA 2GVDA 3TZYA 2NZ4A 4P2FA 4O4GA 1RAHB 3A3OB 3ZZRA 4D3HA 1J5EK 3S3OA 4DR4K 2VG7B 2KFYA 3W3SA 1VQ7S 1N34F 2LSNA 2L9DA 2HHUA 2M3DA 4E8UA 2E7VA 1S6UA 5HQMA 3NGIA 1TL1A 4YS2A 1G7CB 2VFTA 3MR5A 3SUOA 1R43A 2GFFA 4RJVA 2XLJA 3CCJS 4C4WA 4P2XA 5SWMA 3D4JA 3PSIA 1RHKB 3GDQA 2AF6A 4K2XA 5KQDA 3J81U 3O08A 1SL1A 4DR2J 1RJJA 5L38A 1S6PA 3ELHA 5IT9Y 5HOOA 1UA0A 4JI3K 3NCQA 2WSFC 1VYAA 4A8YA 2RF2A 2HSTA 3GTYX 5AQRA 3L8BA 3LM2A 2XO6A 4HDHA 2PMHA 5J2MA 4DX7A 4KH6A 4A8MP 1M0SA 4JNEA 1ASWA 1TMMA 3A8YA 1EQMA 2UUAF 1HKBA 3O3GA 1BHNA 4ILLA 3R5CA 2B5JA 4A8OA 2J8SA 2DNLA 3U9ZA 3DRXA 4BRLA 3AA8A 4NZ7A 4WPAA 2B7BB 3BGLA 2KVIA 4PWDA 3CXCM 2FVRA 2Z56B 1HL6A 3FBFA 5L46A 2LEBA 4DQIA 1UA1A 1Z2ZA 2EFPA 3CT9A 4HHTA 3Q7BA 5EWEA 2UUBK 2KT2A 4KB1A 2K2PA 3CO9A 4HTIA 3U1NA 3TU5A 2E5HA 2BANA 1SVDA 2B43A 3NGDA 3N01A 4YR3A 3UWTA 4CZHA 4A2AA 1LWCA 3LP2B 4WTOB 1RDRA 1WKJA 4G1QA 2FZKB 4TU9A 1FJ7A 1XQSC 3SSQA 3IFEA 2CGKA 1RGVA 5E33A 2E5LK 3M5RA 1TELA 4CFCA 5JXSA 2DNMA 1BISA 5IFMA 3MEKA 3N79A 1DGKN 2COLA 1ATSA 2YKOA 1WEXA 5DK5A 2EG2A 5HANA 3L4IA 1P1LA 3VENA 4IG3A 4HUGA 1ZBTA 1Q81O 2WSCC 1OMSA 2P9KB 4CE9A 3TAEA 1O5JA 4L72B 1GLLO 3NDKA 3ENWA 4ZVRB 1IV0A 3CF5Q 3LQVA 1WG5A 1N33K 5T14A 2FTRA 4ZVTB 4NZ6A 2BE9B 4YY3F 4KI6A 3IMQJ 4DDFA 2XM3A 3D68A 2QX0A 3UDEA 4LJMA 5EWGA 3H42A 1S99A 3NGRA 1HNZK 2MKIA 5HLFA 3BP8A 4E89A 4F67A 1S0VA 2HPUA 2DVIA 3T3FA 2PD1A 4CH1A 2HMPA 5GINA 4IOAL 3LGHA 2R3VA 1NK7A 3HPOA 1DTQB 2DH8A 4CTAA 4A5BA 4CJQA 1NKBA 1JK9B 4RCHA 5B0EA 2MYFA 2YHYA 3W61A 2Z0GA 4M3WA 5K20B 4KRWA 1BI4A 4WK3A 4CZEA 1U1MA 3ZT1A 4WFXA 4DSJA 2LECA 1ZTTA 4DMZA 5AQJA 3KK2A 5AXNA 2HNDA 5KFOA 1Y00A 2V50A 2EKNA 4DV3J 5B0DA 4GV6A 3LPTA 5HATA 3LZIA 1Q9XA 1AFJA 2ITMA 2DH9A 1XEZA 2K8GA 1MWMA 4J9OA 4CHOA 4F25A 3SSRA 2V63A 1WOSA 3KK1B 2UU9F 4PPZA 4O3NA 1H74A 3G87A 5BYRA 3O6QA 2NXJA 5DQHA 1NU4A 1S9FA 3MAAB 2Q3PA 4JHDA 4G1PA 1ZA1B 5KFDA 2W2NP 5B0CA 1FKOA 5E7OB 1N48A 2C2EA 1V3RA 1LQ9A 1T3OA 1NNEA 4DX6A 1DJ0A 4M5JA 5LXRA 4K4TA 3MM9A 5AQQA 3RB3A 3DI6A 2ATLA 2QZ8A 3FCWA 1RDDA 2IGIA 4CLWA 5KFCA 1HHTP 3CM6A 1NGGA 1UVKA 1HBUB 2FHOB 4LIRA 5KFIA 2IVNA 3MM7A 1V6HA 2OPSA 4CYUA 4K5SA 2D1KA 3IM8A 2E4LA 1RK8A 3MK6A 2JZ5A 2QE5A 4ATNA 4FJJA 4V19S 2OEKA 5T7LA 3BEGB 3ZTQA 3P1GA 4H8KA 4K43A 4PQUA 4DV6J 1RHUB 1T44A 5FJ4A 2HZCA 4TYAA 1WI6A 1I94K 3IN5A 4YOUA 1BU6O 5AFUA 3PRBA 1CJTA 2G9OA 1HBOB 4H0YB 1VBXA 2MSTA 1G2EA 4N8NA 4XIUA 3C66A 2VFUA 3HPHA 2F3JA 3M1VA 2HVEA 4RW4B 5D4NA 4QIWD 2E29A 2KVQE 3LWLA 2AIRB 2V69A 1GLDG 1S57A 2XULA 2AWZA 2Q43A 4CJ7A 1N6QB 2JHEA 4ES1A 4ANCA 3B6PA 1KOHA 2EHGA 3GPAA 1P8GA 1ZM4A 4LF4F 3GV8B 4JI6J 2RQ4A 2V9KA 1MA9B 4C2MA 5FIIA 2VHGA 5EX5A 5HVFA 4OLAA 3BGRA 1RAAB 4J2BA 1SB6A 3V5RA 5L39A 1B3TA 4LF5J 1S1TA 3CMAN 2QXLA 4LSNA 1TL3A 2J7WA 2MGZA 1YKWA 2J9EA 1VQLN 1X0FA 2PT0A 4E7JA 2XNRA 1ELOA 2ZZMA 2E1CA 2F1FA 1F21A 3K7RA 4FXWA 4CFBA 2DNPA 1JLCA 2XY5A 1WSFA 1NNDA 5M2RA 1D4XA 3QNWB 3KLIA 3W9JA 3EUNA 2YH1A 2W42A 4ZCIA 4NXNK 4DFPA 3VCDA 2VPXB 4J2AA 4FF2A 3OTCA 3AO4A 4DL7A 3IS9A 2M0GB 2KLAA 4ECVA 4F4WA 3V81A 4OKKA 3UNYA 4ES3A 5U47A 1O6XA 4OYWA 4JKFA 2VQEK 1SKWA 2MLXA 4BACA 3IM9A 3HFKA 1RCOB 1RAEB 1IBKJ 2ZH5A 2KT3A 1MMDA 1SC1B 1KLMB 4CH0S 2K1RB 4XDDA 2IRUA 3S6EA 2YNGA 4GKKJ 4GO5X 1QTMA 1JXVA 4ZP9A 2X78A 3AO2A 4UW2A 4FVCA 3IRXA 4L3NA 5IC4B 4DV7K 1AW0A 3GJSB 2G8FA 4ECYA 4CLFA 3I5AA 4KFBA 4XEIA 4LF2A 1ZA2B 3VQ4A 3SXLA 3FCVA 1RT3A 3OFFA 2YY3A 1HQEA 3MEEB 5LMUK 3C8YA 1BA0A 2XSJB 4ZPWR 5HJXA 4LFAF 3CMES 1RHJB 4ZLLA 2Q6BA 4DG1A 4X4NA 2ZITA 3BGOP 1XMQJ 3NAHA 1KS2A 3MR6A 1KONA 3HFZB 4AQYK 1Q95G 4K41A 1HHSA 4M5MA 2F65A 3OUYB 2H54B 3QGIA 1KSPA 2XI3A 3QJPA 4FO0A 4X65J 4OHZA 2AP6A 3SV3A 3NH1A 3WNGA 1Q82O 2B4UA 4ED2A 3K8WA 3WZ0A 5KFYA 2LYVA 4I56A 3IR7B 1GTHA 1JCGA 2ASYA 2MZ1A 2ZWOA 3F9KA 1HNWJ 3SJHA 1A9NB 2VV5A 2O1PA 2VJVA 3D1HA 1PIEA 2OFHX 2PBDA 1B0PA 1N5QA 3CC2S 1L5UA 4PZVA 1RAOA 1CXQA 3FBEA 4WFAQ 1TL5A 2JLGA 3AHPA 4G65A 2DGUA 1J5OB 2G2OA 3TNVA 2DR7A 2VYPA 2BJ1A 4FM0A 2J7KA 1R59O 3CQYA 2RKIB 2KM8C 5AQYA 2N4CA 3T19A 9ATCB 2DB1A 3M05A 2E2OA 5K14B 5DDOC 4WYWA 1FFWB 1RT7A 2PE8A 2VZ9A 2ASOA 3UNGC 2CNLB 1WJ9A 4HL9A 4ZOSA 3M7VA 3FLCO 1YK9A 3OS0A 2D0AA 3ZSQA 2P9LB 3LP1A 2AX1A 3LDOA 4LF7K 5LT5A 4M5DB 1RT6A 1DQ8A 5IZHA 2QFJA 3DLEB 1N5YA 1G6BA 3G6YA 3EJMA 3JSYA 4CM0A 2DTUA 2HQGA 3V4IA 5DJBA 3TAMB 3DGPB 3PCOB 4OJHA 2X1FA 4CZFA 1YRTA 3FEXB 3RVCA 3A8IA 3F56A 3LP0A 1LOTB 4Y1DA 3UN2A 1CG2A 2LQJA 3ZSZA 3JAMU 5MLCV 2DGXA 4QW9A 4RNMA 1VBZA 2E9RX 1HBNA 1SS6A 1SH0A 4LREA 3PKYA 1VQMS 3DC2A 2PA3A 1JJHA 4U7UK 2DK2A 3T5JA 5DM6Q 2ZH9A 4M5HA 2DPIA 3IRWP 1I6JA 5A6WA 3CD7A 1WKKA 4WJBA 3CW2C 3F73A 1XMOK 3AO5A 3P45B 5AE1A 1HWJA 1NU0A 4F9OA 3MCSA 2V94A 3MTJA 1T3NA 4RLEA 3JXOA 5HMYA 2J4RA 2HHWA 3FZFA 4CF8A 4LF8F 2HVIA 4NO7A 1Q7YT 5C2GA 1HIYA 3UDVA 3THYA 2DYAA 3E1YA 1BY9A 2K7JA 4OI4A 3R9LA 1R8AA 4E3SA 4OZJA 2VF3A 5MLCQ 1MWZA 1V3SA 4B3OB 1XK8A 2XHWA 4E1JA 1VRUB 4M3UA 4IH5A 5KFWA 3R2DJ 3R8YA 4ED4A 3QSYB 3NRBA 3L3CA 1R0AB 1QE1B 4PG6A 2Z57B 1K0VA 3PJXA 1EX8A 2QA2A 3DHWC 4RW7A 4RU9A 5KFMA 1C0UB 2B3TB 1KVKA 3O3FA 1IBMF 3AAPA 2ZH6A 1VQKN 2HFZA 2YNHB 2ZUGA 2R7QA 4CEAA 2XS5A 4ZTJA 1VC6A 3RJMB 1HD0A 3C6AA 2MQLA 3W5YA 3WEEA 4E1MA 1FJEB 4FWNA 3IBCB 3NNHA 3W9HA 2QG9B 2HS4A 5AQOA 1ZBFA 1Q8IA 2HK2A 3QB0A 1HHQA 2QWNA 4FJHA 2IAJA 1SBRA 4HACA 3M32A 2GQQA 3U4LA 3OR1A 1DTTA 1HNIA 4IXCA 1ACMB 3E3XA 3OXFA 5ADXH 3FZHA 1ZPVA 1K0TA 2D3OR 2R7WA 5LMNJ 3GWCA 3BF1A 1HWLA 4KV8A 1PILA 3PVXA 4M5IA 1UPMB 5IC6B 4HCBA 4A61A 1GXUA 2ERRA 2VBWA 1QHTA 1FX4A 4PKDB 1OH5A 3BR9A 4U96A 5F0UA 1BO5O 1RCHA 4OPJA 4OX9K 2GUIA 1UCNA 3MPDA 1IVZA 1S1UB 4JB8B 5FDLA 1PO6A 1XUPO 1GX6A 3ZLJA 4PAAA 3MWPA 1QM9A 2RT3A 3HVWA 6FDRA 1BLUA 4Z0UA 3CJSA 1KBRA 5F8GA 1WEYA 4OLOA 3EPGA 1Z25A 2MPUA 4A8FA 3AVFA 2HURA 3O44A 2HQCA 4CZIA 2WAQD 1EX4A 2IC3A 1S77D 3K5NA 4DUZK 1M5SA 3ULEA 4WQ4A 1UTAA 4OMFG 3DM2B 1VQ7N 4BDYA 4KHYA 3TTDA 2W6LA 3HVAA 3POTB 5F3ZA 3ZCMA 5FLXY 2WCXA 1X5PA 1JXLA 3CCJN 1S1WB 3RAQA 1ZH5A 3D6TB 5KFNA 3E01B 1RKIA 1OSCA 2LMIA 4DR7K 4MKAA 3VGVA 3JQKA 2VJUA 3AQOA 2C3UA 3PW4A 5IT9U 2FHJA 2RAQA 1UAWA 3KLEB 3K8VA 4OI2A 4M3YA 3CMQA 1EKEA 1MN9A 4LR7A 4QWCA 1C0FA 1YT3A 1KP6A 2Q1NA 4CI0B 4F4AA 3IR6B 1XI1A 4NE9C 4LUBA 3PRVA 2LQ9A 4KHSA 3QYYA 1TL7A 1TUGB 4ECSA 1YDLA 5BR8K 4IR1A 2D1CA 4RPFA 2XQCA 3TSPA 4GVBB 3O4WA 2YHBA 3BPDA 1ZETA 3PYEA 4ECWA 3EYZA 2KRRA 3QRRA 4CJRA 3OYDA 1NSPA 1SCJB 1NK9A 2I2YA 3EZOA 3ID8A 4PKGA 2Z2LA 2VC1A 2BJ7A 1U6FA 1MN7A 1TKXA 3ATVA 1C4CA 3VQDA 4CHPA 1Y4ZB 2R42A 2HBKA 2QMWA 4W5RA 2OSQA 1CULB 3PFOA 1VSHA 2C2KB 3VAHA 3U9DA 2J0SD 3KWGA 1T9XA 2IVPA 1DQ9A 1XNRJ 5KAKA 2H5JB 4FLTA 1RWXB 1FDBA 2OTLN 2GWKA 3TARA 3QRPA 4NPOA 4QQBA 4A5AA 3IBFB 4C1NI 4X64F 5C25A 1JNRB 3PIPL 1GK8A 4Y1CA 5A8WB 4DV0F 4JV2A 3L2UA 4LBPA 4B3SF 3DXSX 3HMJG 4CQ1A 4QCLA 4UTGA 1S79A 2BE7D 3HI0A 2VQFF 3DXMB 2R2TA 2XMKA 3EXCX 4B17A 2ZBIA 4YDUA 1QD1A 3GLJA 1FFGB 3JS6A 5E2QA 5H9FJ 4O3OA 4YORA 1JLEB 1OPIA 4Q0BA 2ACMA 4FWOA 4YDDB 1BQNA 2UUWA 3OR2A 1GQEA 2YI1A 3C94A 3CCLN 5GAEI 4KKOB 1YJVA 1T6CA 5KFQA 2OO4A 4ITSA 1QS4A 4CT8A 2E88A 2FSJA 3DOLA 3NGUA 3NNCA 4OI1A 3LDQA 3BO2A 1SIZA 2P9UB 2CA9A 3QWPA 1RTJA 4F3MA 4CJ5A 1VDHA 1NK8A 4RNNA 1P1TA 1ZM2A 1NDPA 3CB4A 2Y1IA 1KTQA 4A8XA 2ASJA 4G9ZA 2C3OA 2VIHA 4CJVA 2RNEA 4JI7F 1FO1A 1X5TA 1JKHA 2DD8S 1N32K 2DCUB 1N34K 4NI2A 4LF9F 4BRPA 3U27A 2ITGA 3L3UA 3V6HA 3BV8A 4QWAA 3AQPA 4B3RJ 2N4DA 4B3TF 4USWA 1KAZA 2N7CA 5E5NA 2VBZA 3AD8C 1VCTA 2FPHX 3L2QA 3SFGA 3AA3A 3D1OA 3KG1A 4P73A 1S5JA 4CGJA 2R9LA 3WIVA 3M9OB 3KJVA 3I5BA 1S7HA 3V9WA 3W1YC 2FHKA 4X62J 4DJBA 4RUHA 4B9TA 4IDHA 2LDYA 1DKGD 3TUZC 8ATCB 4FSVA 1KVAA 3TR8A 2C2OB 2DNQA 1M1GA 1XNQF 2VDIA 3W5ZA 4DL0C 3GIJA 3SCIE 5KFXA 3OT9A 5ETNA 2KQ2A 1XC3A 2HVZA 5A0YA 5DG8A 4DV2J 2P2CB 4J90A 5L9NA 4PY5A 1IR2A 4OYXA 1RWWB 5M1QA 3PR4A 2AQ4A 1TUVA 2UUAK 4PG5A 2J6SA 4CEBA 2KFNA 2VICA 4X4TA 2HGMA 3CCMN 4YOWA 3VGMA 4DV4F 3FMBA 2GW8A 3WX4A 2OZMA 3KK3B 1PJ7A 2CQ0A 4I2QB 4P75A 4CGGA 4FJ7A 2CWKA 1J5EJ 4C0HA 4DR4J 2WTFA 4B1YB 2C28A 1VQ6S 3NWGA 4C3KA 5GAGP 3G8SA 4UY8O 2F8MA 4BC5A 4BGAA 4QOTA 4UOGA 1KHVA 1NKCA 5EOYA 3R6GB 4ECZA 4CVNE 1NSAA 4DL3A 1KC8T 2GVDB 2J9DA 3Q0AA 3AOCA 3A5OC 1Q0NA 4O4GB 2ZJRL 2BJEA 2A5XA 1RAIB 3V1OA 2BGGA 4PEOA 4IRKA 1M90O 4ZA1A 3TVZA 3AB2B 1EIYB 2DY1A 3DRYA 3FMWA 1RWKB 4JI3J 3C6TA 1K47A 5AQSA 2HRTA 4RW8A 3Q24A 4EFHA 1RWOB 1M1KO 1HPMA 2QL9B 4JAXA 1NGAA 1SQEA 1GOBA 1NLKL 2DHSA 1NZAA 1WSEA 4NLQA 4CF9A 2ZJQQ 2GEMA 3U3YA 2GCFA 3VEOA 3ENBA 2V34A 2BKNA 2OTJN 1Z1ZA 4IO8A 1S6PB 3BQ2A 1VQOS 3NOCA 1EWRA 4CHYA 4WIQA 2RF2B 1Q8KA 5A8RA 3H90A 3MM8A 4RNFA 3GYNA 4RO0A 4Q44A 3I4HX 1VJWA 4BRMA 3LTOA 3J80Y 5J2MB 5IS2A 3T69A 1IJJA 4C1NK 3I56S 4I4BA 2HQFA 1EARA 2B5JB 5KFEA 2A6MA 3I55S 3VQ7A 3H08A 5AR0A 3VA3A 3PW7A 4QR0A 3J7Z5 3G8TA 4PWDB 1PBUA 4H03B 3UD3P 3DXKA 3DLLL 4JKEA 4NX9A 2E5LJ 4MKYA 4IFYA 3UFCX 4F4ZA 2D41A 4UOHA 4H4KC 3M8QA 3OY9A 1RT1B 4FLYA 3D67A 4Y2CA 2BANB 2UXDF 2NRTA 4AE5A 3V9XA 5KT3A 4I6AA 4JI1K 3H98A 3L7PA 1FJGJ 4KHWA 3WNEA 4C8NA 2NPIA 2UU9K 4Z4EA 3CQXA 4JV1A 4JI8K 1LWCB 2QSWA 1SQFA 1U8WA 3WNHA 1T7PA 1GXLA 1CLQA 2PIIA 1VQ4S 2D69A 5BRHA 1HR0F 3S41A 4YB5A 2LCWA 2ZOGA 3PUFA 3B6BA 3DMJA 3SQ2A 4I9LA 3A4TA 3D6MB 3R9PA 2CWXA 3QMQA 2W4DA 1U0HA 2IVOA 2VU5A 1GLCG 2HHTA 4L8RB 5DM7L 5EVZA 2AYEA 2D0BA 4TNOA 2VBYA 3H3OB 4F2SA 4PR6A 4OLPA 3FJ2A 4CZCA 1OIAA 1YRUA 3HM9A 1UVIA 1RTIA 4L6V3 3TPQA 2I5JA 4AILC 1XBWA 3TABA 4DPXA 3QMLA 2XMUA 3HPGA 2FLOA 4DI6A 1RDUA 1AFIA 1HNVA 4NYZA 2RS8A 1LWFA 1C0MA 3TA1A 3D2FA 4CERA 1YJRA 2CAJA 2KXFA 1FRKA 3FQKA 4O4RA 2B56A 1HI1A 5M2UA 3TTCA 4AHVA 2QMXA 2XYGB 5K8OA 3KMQA 4O0NA 5HLFB 1FESA 3CC2N 4V19J 5ETTA 4KB7A 4BCAA 3B4MA 1OYEA 3NKYA 2QK9A 1RABB 3QT5A 1JJ4A 1UAXA 4ILJA 4YOXA 3PX4A 4OVLA 4DR2K 2DIVA 2JSXA 2FC9A 2W01A 3OVAA 4ZCKA 3UO0A 4CTAB 1HX1A 3L0QA 4TXSA 1RCXB 2J5AA 4B1VA 3JTPA 1Y64A 5F8LA 3HO1A 1T02A 5EHHA 1UW4A 2E1YA 1Q5YA 1VJQA 1IM4A 1QSYA 1BI4B 3TEGA 3VF0B 2V2QA 2DISA 1YZ6A 4Z4HA 2ZKTA 2W2MP 3KK2B 2KTQA 1CZBA 3OXGA 1DY3A 2BUPA 5ETKA 1NOZA 3MR2A 5JS1A 2P9EA 2DITA 3VAJA 1NDCA 4B9MA 4YNQA 3GSDA 4K8RA 3WQTA 1FTRA 2FC0A 4B1WB 1JXEA 1OVQA 5FRMA 2XY6A 4BQZA 2E2NA 5FRNA 3JSRA 5KPTA 5D78A 4JHDB 2B8PA 1FKOB 3RR8A 5FPDA 4DFKA 2OLWA 1U48A 3CC7S 2Z58B 4Y34A 1K1QA 1A5WA 2HS0A 5AQTA 1I94J 4Y65A 3MM9B 1GXTA 1LK7A 4DFJA 3QT8A 3DI6B 5CHIA 3A1YG 1RUSA 2DNZA 1FHTA 1R8HA 1RAFB 1XWLA 3HOSA 3OL7A 5M1KA 2J0QD 4K7QA 2FZGB 4NLVA 1VQMN 3KNGA 4GKJK 2BKPA 3MM7B 3W66A 5B09A 3KLHA 1JCFA 2OPSB 2C2NA 3ILIA 1RTHB 3LAMA 4ZVOB 5RUBA 4LBIA 3EZ5A 1QQOA 5T7LB 4NLCA 4HR2A 4AT1B 3MUTP 2O8EA 4LR8A 4IUFA 3O9UA 3HCXA 3NOGA 1CJTB 2JWLA 4K42A 1C6VA 1OVYA 4DV3F 1VSKA 1IKWA 3OQ2A 3QT6A 1TMJA 1DEJA 1LV5A 1E4GT 3TQEA 2D5RA 3M1VB 5LSLA 5CZ2A 1NEEA 2ALZA 2XGPA 4J9KA 3ZX3A 2CJAA 3KUHA 2FLPA 2UXCF 2DXDA 4LBHA 2V7ZA 4OX7A 4BGBA 3TRGA 4RWXA 5KFHA 4B9LA 1YBAA 3SBTA 3L2WA 4FJMA 1IKVA 4I6MA 4R8UA 1IKYB 3HSDA 4H4OA 2A2DA 4F0HA 4P9SA 4YMEA 1SJQA 4IOAQ 4W4MA 2IHR1 3R3LA 1CJKA 3WQUA 1DRZA 3BGRB 2ASMA 1Y3JA 3A3NB 4OYOA 1S1TB 3TYTA 1KAYA 3V1QA 4LSNB 1TL3B 1S4FA 4OHWA 2MGZB 3OL9A 5D0EA 3AO1A 3CCVS 3O1LA 3ENQA 4USKA 3CCEN 4JYAK 1A6LA 1NGCA 3AVHA 2CG8A 1JLCB 5A2QY 4MK9A 5D6GA 4IKFA 3I6PA 4ZPAA 2QGFB 1TUYA 1HKCA 2YKPA 3AODA 3KLIB 4E2FB 4KREA 1BD6A 2HBZB 4RBTA 1XHZA 1LK5A 4IOCQ 2WW8A 2VKRA 4URSA 2XLIA 1MG7A 3UIQA 4FXVA 1H1VA 1FW6A 1NPRA 4CLYA 1WELA 4MFBA 1NBWA 3IS9B 2O8DA 3HKZD 4ZPTR 2YKMA 3V81B 2EFNA 3EGVA 3VTIA 3KUGA 3J7ZT 1R89A 4RX6A 1T9VA 2EBEA 3CIPA 4DV7J 3W2WB 4CFDA 5AJ3F 4DR6F 1RWNB 4XO0A 2A40A 1X3MA 2L9NA 3IKMA 4I64A 1FDNA 3MR7A 3CJ2A 3DGVA 3FCHA 5GVQA 1YUWA 5TKWA 5C12A 4RW6A 1N5TA 4N5SA 2CQPA 4CO2A 1C2PA 4KHQA 3TUPA 2IIRA 2V51B 4LF1A 4U95A 1YIJS 4ZIVA 4DFMA 2YNGB 4FF4A 2GC8A 4OYAA 3WUHA 3M8WA 9RUBA 2OSRA 3T1AA 2ZJPL 5C42B 1RT5A 3HLUA 1NBEB 4OV6A 2GIFA 3IRXB 2F8TA 4FPBA 1VQPS 1NH7A 1JLAA 3MWBA 4NLTA 5IV4A 3DOKA 1Y11A 4DV6K 1F9EB 4KFBB 1NO8A 4NXMF 2CH6A 4HLBA 2W41A 4EIAA 2YV0X 1RT3B 2CH5A 1RHRB 1X8DA 3QETA 1HQEB 3AVAA 1WAJA 3W64A 2NUBA 2U1AA 5AXKA 2WW4A 2IM1A 2NRZA 4V19X 3BZQA 3BDPA 3MXHP 2M5YA 3NGTA 3RAXA 1J54A 1I1GA 4EBEA 1HMVA 1YJNS 1RBLA 4MAKA 1S9GA 1FI4A 4W98A 2HFNA 5J2PB 5FLXU 2APOA 2MKHA 4C98A 1UWAA 1NSKL 1W2BR 4IO9Q 4P6QA 3RMCA 3MMVA 1GOCA 2J9CA 2DNKA 2UUCJ 4JI6K 4JI5J 4P2SA 3OLBA 5HL7Q 3G6ES 1IBKF 4U67Q 4IYQA 3AVGA 3JQJA 2ZH8A 4MH8A 2ZH7A 4DV5J 2DO4A 3E2EA 1YGYA 4LF5K 4BREA 4DR5J 5IWAF 1PC5A 4EO8A 1NJIT 2JC0A 1FEEA 1NHKL 4CF1A 3IAS9 3CJKA 1BGXT 1J9AA 4C8ZA 5G0RB 5DLFA 4IOBA 4WTYA 4JK9A 4IG0A 2ZHBA 2CG4A 3CDBA 3KHHA 2MHEA 4DQ8A 1WHWA 1VSDA 4IFEA 3QQCD 1P8ZA 3JTNA 4KQZA 1VK8A 4W5NA 1FRXA 3CCUN 3RBXA 4KTZA 4KAIA 1W9HA 5KG7A 3B8HA 1RT7B 4BRNA 1UJ5A 3R6MA 4XPEA 2MQMA 1NZ8A 1QHAA 4OYMA 4QPXA 3UCUP 5LM7E 1AA1B 1ZC6A 4FK0A 3M6VA 4NLGA 3LP1B 1RTZA 3KLFB 4YR0A 3DLRA 4X4UA 4E1NA 1RT6B 2VFRA 4CD3A 2B6AA 1IBMK 1N5YB 2XCAA 4J2EA 4KHPF 5KFRA 2OPPB 3LAKA 2IMOA 3SCKE 5AFUH 5AQNA 2H4YB 3BM7A 3QLHA 5B7WA 4CGHA 3V4IB 4GKKK 5BREA 4USMA 4Q2LA 4WE1B 1K8KA 4M41A 3CPWR 4ZIWA 3NF6A 4CJLA 2B8QA 1E6YA 2FC8A 3E8OA 4ECTA 1Y9OA 3VQSA 3MMCB 5KRSA 3OYAA 1T95A 3CD5A 3LP0B 1ZAWA 4TVAB 4DUTA 3KXDA 4OV1A 2RQCA 1U8SA 5LJVA 4JD2A 1NGEA 3CJ1A 1JLFA 4I69A 3FKBA 4F4KA 4TU7A 4BQLA 2V68A 2RSQA 5D4LA 3P49B 3ZTSA 2B7CB 4DPWA 5GADP 1JLBB 2ZEJA 2NXEA 2E66A 1G1XA 3IMXA 1XMQK 2MY8A 1Z05A 2HGNA 2MZJA 4OI6A 1WSGA 2DNYA 3NVMA 1TFWA 4KHRA 3FRYA 2ABYA 1YSJA 2ZVSA 3HSJA 2QMUB 1X4FA 3S7RA 4U7BA 2JWKA 2V8GA 3MECA 2RUSA 4A47A 2W8LA 3R97A 2CQBA 3ZTPA 1WTFA 1X4EA 3ZSRA 4FK4A 3FE1A 3OHBA 1FRMA 2SXLA 2ADCA 4B1XB 1NJWA 4O5FA 5JVGL 2AT1B 5EXWA 2ZBCA 4FNHA 1HNWK 4JV5F 3THWA 1VK0A 2ZGYA 1BUPA 1IBCB 2HHHJ 2JVOA 2ZH2A 1X4DA 1JJCB 3GL1A 3TZZA 2R4FA 4A62A 2HIYA 3M1FA 4MTPA 4URQU 4MK8A 2KL8A 1VI7A 3B82A 2BJ3A 4P71A 5DDRC 1SQKA 1X0PA 2BUNA 5C7PA 3H3NO 2H5EA 3HP9A 3O5BA 1QAJA 2RRAA 1RILA 1DFDA 3AV9A 4H5NA 4AL7A 4ICLA 4C8KA 3WEEB 2Y9HA 3OTOK 4C11A 3VZIA 2RE1A 4OYPA 4M45A 4KO0A 4ILRA 4LVNP 1YJWN 1NKEA 3NEKA 1NK6A 3BN4A 3EM1A 4FOIA 2GVZA 3MM5A 1V4SA 2M9KA 3WXJA 3G71N 2ZVIA 1YHQS 2IAJB 4HACB 3EO3A 4OX9J 2YKQA 3M32B 3HI9A 3BF3A 3VF2A 3NXZA 3OR1B 3DU6A 2A42A 1HNIB 2J9DE 1J53A 4PL7A 3CULA 1FWPA 1R8PA 4B3MF 4PABA 4TSXA 3CJ5A 5EWFA 1QZ5A 2CJQA 3FZBA 3MI7X 4KV8B 1HARA 3BR8A 3AY9A 5KPZA 3O80A 2K3KA 3BBCA 4J9VA 4IO1A 2F63A 4BRQA 2AJ4A 3BSNA 4DUZJ 5FDLB 2HOEA 1UFLA 4TQRA 3PX6A 4JI2J 1NUEA 4R5PA 3CEDA 4LSLA 3JS9A 1KVBA 4U8VA 4XTTA 2QWOA 1EETA 3ETMA 3KNAA 4MDBA 3WBZA 3DOMA 1P9YA 1X9JA 3US5A 3OTEA 1Y5LB 2IC3B 1WEZA 4NYNA 5LJ5Y 4DS4A 2M52A 5ETSA 3FR0A 3T41A 3TAGA 1R31A 2A10A 3ULEB 4IDKB 4N47A 1VBKA 3CQ8A 2BE2A 3GP9A 3EPIA 1S10A 3O9RA 5IQ6A 3KLGB 1TGOA 3SMZA 4NOHA 4FWQA 2QI2A 3GE1A 2XSFA 4CFAA 3C3LA 2VUGA 2Q36A 1URNA 1IKXA 5LMNF 2I7PA 1JMTA 4IH7A 3AOBA 1GLAG 1FKAF 5EN1A 3TOQA 2IM3A 4B3SK 4QOZB 3F41A 4KBOA 3FSYA 2BTFA 4OYZA 2KDOA 1IN0A 2BACA 1UJ6A 4ED1A 1L3TA 2WZ1A 5BJRA 2JNJA 4ED8A 1F60B 4XH5A 3HF5A 5IQQA 4EEYA 4F2RA 5M1FA 5HRNA 4TU8A 2BQ3A 3BKTA 2DNNA 3IWNC 4WFBL 3J80U 4FJIA 1Q81T 1FD2A 3PZPA 4F4YA 3P39A 3RWUA 4GVLA 4M7YA 4ED7A 2YKNA 3N6MA 3QATA 1YAGA 2NRRA 3CUNA 3TWHA 2PI5A 1YZ7A 5CCLA 1K1SA 1Y3KA 3ZT4A 3SMSA 3R2CJ 1XR7A 1GMUA 1RT2A 5AQKA 3WXMB 1K44A 3D45A 3MPVA 2HFSA 3MM6A 1TKXB 1BG3A 5GAGU 2FF6A 3UKRA 3LDSA 4UZBA 4ZP6A 1IBLF 1WF1A 1DT9A 3CJAA 4GC7A 3GILA 4UUWA 3D66A 2PSZA 2CVEA 1QLNA 2VC0A 3EWGA 2ZNYA 1YTYA 2DGWA 3ZZYA 2EFOA 4DKWA 4JS5A 2VWJA 1VC0A 2XGQA 4DCHA 3EGZA 1W2BM 5HP1A 5KOWA 3OS1A 4KC5A 2OHDA 3RUBL 4EK2A 2MZSA 4FYVB 5C25B 4CLPA 2BJDA 1E4FT 1U7LA 3GONA 3QFWA 1XNQK 1LAWA 4RW9B 2ALYB 1D8ZA 1Q9YA 2VGNA 5KFSA 4J9PA 3BUZB 1REVB 4I6WA 1S4EA 1OO0B 3B78A 2IVYA 1NSQA 1BQMA 2ZNZA 3HFVA 4YFUA 4HVJA 2QLXA 4DTPA 3NLCA 3H5SA 5GMEA 2DPNA 2DFFA 2FDNA 2I38A 3AH6A 2C2ZB 3K5PA 1RA7A 4CO5A 1L3SA 1YITS 3AJDA 1QQNA 2IYIA 2HMIA 4DUYF 4QYZK 1SV5A 4Q0BB 1NLVA 1BQNB 1SL2A 1S22A 1FNMA 4L74A 4JKDA 2R2SA 2W2OP 4ISEA 2NNWA 4M1KA 2QL5B 3PW5A 4J9MA 3AXMA 4NYOA 3TEHB 1N32J 5D0HA 1N34J 2LEAA 5GAHP 5HAOA 3DOLB 3M6UA 2Z30B 5KRTA 2WVDA 3CGIA 2CGLA 1SL0A 4CLUA 3JXUA 1RTJB 4TLQA 2ZC4A 4P7VA 4DU8A 3H7HB 3N4QA 4URGA 2W9BA 2AV5A 1FDAA 1RHQB 4USIA 1XERA 2DBBA 1ZBIA 3D5MA 5LXYA 3VESA 2QWQA 5ETLA 3VR1A 3RAMA 5J1EA 4C9DA 5DGBA 4LMZA 2WOMA 1TU0B 3VEXA 1JKHB 1DURA 5FPEA 1JCEA 2AHOB 3EDQB 1HNXF 4NI2B 3AAQA 4ED0A 1D1UA 5T41A 2ZHOA 2ZE2A 3GFYA 1X9WA 3CPWM 1WBDA 1U6ZA 2EFQA 2DGOA 3G86A 3MAQA 4WQ5C 3SDEA 3WT0A 3CE8A 3CO0P 3CJCA 4DB3A 2UUAJ 3CG7A 3CC7N 1HLWA 3KJVB 3PM9A 3A2FA 5KG1A 2QLWA 1HFEL 2P1JA 2QRRA 3IBWA 3JAMY 3LANA 4MYTA 1YF5L 4H4KA 3NFAA 2HVDA 4DSEA 1MW7A 5AQIA 3TP2A 2H5IB 2O3DA 3D7SB 3PKMA 3CF5L 1HI0P 5A0YB 1RYRA 3ZYYX 1G3OA 4U7CA 3A12A 5CYQA 4BVOA 5JLFA 3ULDA 1X9SA 3DKDA 1TL4A 4QBUA 3FSIA 2MQ8A 5KOXA 2QLBB 3I96A 5CHCB 2VWKA 1S9EA 5AZJA 4IWVA 3MDFA 4OI0A 3L3VA 3N6NA 1VQNS 2Q66A 4B9SA 3QIOA 4BHQA 1U1KA 2D3UA 4ELUA 2A1SA 4BRCA 2DHGA 3MCMA 2I8EA 3O8MA 3SCJE 1U45A 1WG4A 3SAFA 4M5KA 3S9HA 5H9FK 1C4AA 4USVA 2YWKA 2OA8A 4B08A 2POKA 2VBXA 1AUSL 4DX8H 3QWUA 3CD6S 5AQUA 3NGZA 1K73T 3SBMA 3OFHA 3C6TB 2WB4A 3R6LB 4RW8B 1JLQA 4YY3J 3VPZA 3RR7A 3KWMA 2AEJA 2DGVA 3T9ZA 2F4VK 2PI4A 4NCAA 3GR1A 2G8HA 3DJCA 3RGIA 5LSRA 1NPKA 4DV2F 2F96A 2UXBF 4KH5A 3J7A1 1LW0A 1X4CA 5A2QU 2FY8A 2P51A 2W7OA 3CC4S 3SEOA 1UEUA 2QYCA 2CJYB 4LRBA 4FM2A 4OGEA 3GCWP 3ZSWA 2O01C 2F40A 4H0PA 2CPFA 3Q83A 3U02A 5F2RA 4O8UA 4NZ0A 5A8RB 5EU7A 3BB5A 4FPAA 2GJIA 4HCCA 4OPHA 4JLHA 2Y1JA 1J5EF 1NGBA 3RMAA 3QZ8A 4DR4F 4AHTA 3ULHA 1RAGB 4OJGA 2CQDA 3NS7B 4DF4A 2QFIA 3MR3A 4HUEA 5I3QA 3VQ6A 4IFVB 4Q43A 3I0SA 2V4JA 4J91A 4KRFA 4MIBA 4ZCMA 4HWIA 4JI1J 2YTCA 1IR0A 5K8PA 4X62K 3CDWA 2PMZD 3SUNA 2W4CA 1OH6A 4MT1A 2UU9J 1WC0A 4HH1A 4JI8J 1U1NA 1FXXA 1T03A 2P9KA 3HHEA 2YPYA 3G6XA 4Q45A 3QZ7A 4J5OA 2L41A 4JI3F 4IOXA 4CEEA 3O9TA 3OPKA 3DXKB 2Y0BB 1BDGA 5AQMA 5F8JA 2IS3A 4FWPA 2NSBA 4E0DA 5DO2A 4ZJLA 1D9DA 4ZJOA 4UT4A 4IFYB 3SQOP 1GX5A 3M8QB 2LFVA 3R3TA 2GO8A 2FIUA 1HWIA 1YI2N 3BF4A 3KKFA 2FJDB 5D4OA 2Q3SA 2Q31A 1DTQA 4GV3A 4YDUC 2AGQA 1BWEA 5B0BA 3DCAA 2VPYB 1ZS6A 2OIHA 1FE0A 3MMAA 3DMJB 3LGMA 1NRKA 4YB1P 4FZYA 3NF7A 3PJWA 1U0HB 4ZHRA 3J81O 3D2EB 1YVNA 2GJFA 1Q18A 1XJWB 3D6RA 4EBDA 2UZAA 2UUBF 4ZMMA 2VASA 3P5TL 1YJ9S 3VQAA 1ASUA 3ZSVA 1RTIB 1IG9A 3CYMA 2I5JB 4BC2A 1VQ8S 1HNVB 2CQ2A 1LWFB 3VAIA 3GG4A 2XRIA 3OHRA 3D2FB 3CDAA 4HYKA 3CCRS 3BQ1A 1T0TV 5AXLA 3UN3A 2BH1A 2E5LF 2CPXA 1EKSA 2DGTA 2NZCA 2MXYA 4A46A 3NMUA 4C6AA 3RU0A 2HBQB 1K6YA 4YR2A 3OYGA 2VD3A 5ADZA 1UKUA 2QWMA 2N3OA 2F4FA 1YJ7A 3CCZA 7AT1B 4WU2A 4DV1K 4X66F 4DR1F 1XMBA 3CTRA 3L7OA 3HZEA 3KOAA 3EEQA 5E84A 4AUKA 5KFTA 2BKOA 2CPZA 1UZHA 3A5NC 1N33F 6AT1B 3GG1A 4AYBD 4CIGA 4DTOA 1RTDA 4EO6A 4I7FB 1LEOA 2V5HG 2YKAA 1O13A 3EX7B 1C1AA 2DXEA 3C16A 1UETA 3R1XA 4YP3A 1HNZF 1JL2A 2EK6A 3MXJA 5KFUA 4CCHA 1MMLA 1RAJA 4ZP8A 4FS1A 4BDPA 2GWJA 1C0GA 3MD1A 1T3VA 1NB2A 3C0BA 1Q86O 4WWSA 1QUPA 4GKJJ 2OPQA 4KPYA 2CPYA 4CRJA 1R0CB 1S7IA 2G13A 2Q1LA 5L1IA 4HHHA 4BR9A 3A13A 3K2PA 4V1Ak 1F5BA 2JX2A 3MX5A 4XAKA 1KQKA 4EI2A 3L2RA 3BGFA 4WXOA 4H54A 1FJGK 1DARA 1F2GA 4LD0A 4WYLA 2VA3A 3DRPA 4KJIA 1B64A 4ANDA 2GIQA 2OPRA 4NLSA 5D3GA 1CJVB 1KDNA 4C3MA 3KLHB 1CZAN 5E3PA 4E7HA 4DR6K 3P4UB 2IA6A 3H20A 2GGPA 3ZSXA 3WC2A 5DM7Q 2KHCA 1BUXA 3PFEA 3W65A 2RHKA 1TV6A 4LH5A 2ZQBA 4ZPDA 4BE1A 1R8BA 4AL5A 3CJRA 1CJUB 1Q7LB 2Q6CA 4WFAL 3IGVA 1TYQA 3T5HA 3VV2B 2WBMA 1FWLA 4JBCA 4HI1A 4C0BA 4OFZA 4QS8A 1R6VA 1XHXA 4IRCA 4A8SA 1SC3B 4U7UD 1Q5VA 1N8RO 1TKTB 2J0WA 4NCBA 3V2UC 5HN0A 4NXMK 2RVJA 4W5QA 4ECRA 3T6JA 4A57A 1S1XA 2QJ3A 4JYAJ 3FFKB 4FW1A 5ITHA 1YVUA 1OWXA 3ZZTA 1WAFA 1IKVB 1KCFA 4I6MB 4R8UB 4H4OB 5SZTA 3LO3A 4HHJA 5KFAA 4CEDA 2IOCA 3Q8PB 3AOAA 3TJ9A 1CJKB 3SAGA 4I6YA 2U2FA 3TUJC 1CBKA 1CQMA 4CZJA 3L4BC 3V9ZA 3FFIA 2KM8B 1FK9B 3DLGA 1X9MA 1H7XA 2HRYA 4Z7CA 1VQ5N 4QIGA 3LPEA 3ZZZA 3FZ2A 5HMWA 4UY85 3MEGB 2VOPA 3Q8RB 4JI0K 3PW2A 3H2UB 3C6UA 5HMZA 2QYGA 3GCXP 4CO0A 4YHHF 2NRXA 5BPLA 4MFBB 4GV9A 2CJXB 2O8DB 3UDLA 4EUVA 3EVWA 1HQUA 4OZNA 2LKZA 5HQ8A 5CAAA 1F6TA 5GADU 2XBPA 2Q2RA 1HWUA 5J2QA 4AH9A 2AJ0A 1CC8A 2PN6A 2ASDA 4RL1A 2IBOA 4KH0B 2ZUAA 3W2VA 1BWVA 2CFXA 4RW6B 3FNNA 2W9CA 1NGJA 3QGHA 3JYTA 3G2XA 2MZQA 3SZ2A 1E3MA 3GFHA 2HWTA 4BG8A 4NXNF 3CPEA 2GQCA 3SQ4A 4ZPBA 2X3DA 1FA0A 3SUQA 4DCOB 1RT5B 1I39A 1KNZA 3BH7B 3HYFA 3RRGA 2QEXS 1NG9A 1N0UA 4ISGA 1JLAB 1AYEA 3KKRA 3DOKB 2VPWB 1U09A 3N28A 2L08A 2CUYA 3CJTA 4EYIB 2VQEF 2Z2ZA 2NYIA 2ROGA 3O2IA 5BXIA 2I7NA 5F0XA 2QO3A 1S72N 1YTUA 1LW2B 2G2ZA 5CE3A 5K14A 2E9ZA 5I3UA 2O8CA 3Q7CA 2KO1A 3LZJA 2XLKA 1N36K 1QSSA 1WKLA 3ALYA 4ZK7M 2GMLA 5HK4A 4DCJB 3HT3A 1WSHA 3OYLA 3HHLD 1REGX 2CJKA 4TQSA 1HMVB 4CJKA 1S9GB 4FLVA 3BS9A 3HT0A 2B9EA 4LF8J 3AXKA 3FRZA 4H5TA 2QKKA 2XMAA 2F7VA 4GVEA 4DV7F 2E1MC 1D9AA 1OY6A 2MDAA 4M5DA 4Y3CA 3CJ8A 4TY9A 3GE9A 3Q8QB 1S6QB 3V9SA 2RMLA 4DCPB 5E0OA 4LC9B 4D3GA 1O0PA 3CCSN 3VHQA 3BYPA 5LMUF 4CHQA 4LFCF 1VQ9N 3OBWA 2J7UA 2DNGA 3R7NB 4NEYA 3AT1B 5DZ6A 1BL3A 4FS2A 2A3ZA 3HHNB 2QV6A 1GLBG 3VQ9A 3DDNA 2GELA 2QM1A 1TK5A 4LFBK 4IG0B 1UEVA 2HHXA 2G8IA 4AQYF 4JI4K 2W7PA 4ES2A 4G3IA 3H1QA 1IBMJ 3H46O 3DAWA 3W3DA 1EQ0A 1UVMA 4JP8A 2RDIA 2XZTB 3SYZA 3P3DA 2OMOA 1B70B 2FBTA 4F0MA 1Y5NB 4BR0A 1ZBHA 1VMBA 3HVTA 4OPAA 2R8KA 1A5VA 1S1VA 4K4UA 4Y2IA 3TI0A 3I0RA 4GMJB 3NE6A 2B6AB 1JL1A 1U4BA 4H0VB 3MF5A 4NLDA 2KYXA 1SJ3P 5C10A 2UVUA 3O9SA 4R0JA 4DPOA 3QLHB 4OKJA 2EFGA 5J1NA 4KTWA 1VRUA 2E1RA 5KFPA 3GQCA 1ZZFA 1Z2LA 1SJ4P 1ZTWA 1K8KB 4HH0A 1RSCA 5JMNA 1NWKA 3GZ7A 3ENAA 1E6YB 3HBTA 4YN3B 5F9NA 2P9CA 5KG3A 3X1LB 4RBVA 3FK4A 2MQQA 3BZKA 3IFRA 1QE1A 4FF3A 1VS3A 2PYLA 2WUSA 1NK4A 4OIXA 2Z1JA 2QL7B 5CZVA 3VAMA 4CJ4A 1HYSA 2BM1A 3NS6A 4LF7F 5E3AA 1U24A 3RB0A 2E2PA 1JLFB 3B8AX 3CMAS 1R27B 1I3OB 2UUTA 1VQLS 2OEJA 4CJWA 3I82A 4TKTA 4C8LA 2XMJA 3VF6A 1JWWA 4ZDNA 3NGSA 1YITN 1FRIA 3P96A 4WF9Q 4CJUA 2V8VA 3I4PA 4ED5A 2A3JA 4DL4A 4OHYA 5F9LA 3HHLC 4IBNA 3BQ0A 4QU7A 1MDUB 3DXBA 2V52B 5B0FA 4EP4A 1VLYA 2UUCK 4JI5K 4FWRA 3D3BJ 3MECB 4OZ3A 1L3UA 5BR9A 1VSJA 4RBUA 4DV5K 3FZMA 4HT7A 2MKJA 3CERA 1QVFR 2VGMA 3HSTB 1ZPWX 1RI7A 3OS2A 4DR5K 1WG1A 3H40A 2W8KA 1G4CA 2VG5A 3IO1A 4CNYA 1HBMA 3AD7C 3RG6A 3D0IE 2LXIA 3OTOJ 2WVBA 2CPJA 4WP3A 3KUEA 3L4QA 5H9EJ 3W8GA 3ETOA 5KTQA 1XMOF 3TJ8A 3NCRA 2IJRA 4O0IA 1TUWA 4NLOA 4YDXA 1MMNA 1KKHA 3WC0A 2DEIA 5M1OA 1EWQA 4QYRA 3ZEUB 3BGUA 3QBCA 1MU2A 4GO7X 4K8ZA 2CPHA 3F44A 5LSOA 5A76A 4ICLB 4J9QA 4F36A 1XN9A 3JAMO 4C11B 1YG0A 4DN0A 3KG0A 4Y2KA 4KO0B 1SJFA 4J8FA 3MXIA 1VOMA 1KLNA 2VG6A 2GVZB 3MM5B 3QAEA 1M1KT 3G82A 1X4BA 4BG9A 1R0BG 1RZMA 4DSLA 4M63C 1Z6RA 1HW8A 1U2CA 4KH4A 3VZHA 4KTQA 4ZVQB 5DZ7A 3HK2A 4JRQA 4RWWA 4DU3A 3HJFA 2FBVA 2H3EB 2FJXA 2PC6A 4Z2XA 3AY0A 1E6VA 4BLGA 2P9GA 2DFEA 3VEVA 4CJFA 3HP6A 4B8AB 4ZVSB 2KU7A 2V0NA 4C48A 1N4LA 4G6VB 1N56A 2V8HA 2PO4A 3BBFA 2MB0B 3QJJA 2Z4PA 4PA1A 3OVNA 4JKCA 5DLGA 2KXHA 1EAYC 2EK1A 3NAIA 2E20A 3G8QA 4FKXA 4R5PB 2EX3A 1BQXA 3T1HK 5GAHU 4LSLB 4YOTA 1Y10A 4PKHA 4NLBA 2F9JA 1KD1O 2GX8A 2I0XA 4X64J 8AT1B 2D9PA 1KQSR 4MK7A 2C1EB 1EETB 2NLWA 5AQXA 3VGKA 1RGIA 1X60A 4DV0J 2IRXA 3DOMB 1LAVA 1QJHA 4B3SJ 5ETMA 2YH0A 3MFHA 1UVNA 2XHBA 5CR4A 4GVBA 2D74B 4UOCA 1CQNA 3WXIA 3NP5A 3J81j 2BE2B 1B0TA 4IJAA 1X3NA 3V6DB 1C1BA 2FJAB 3OYHA 4BDZA 1RADB 2IBKA 4B8CA 2CNKB 3FSXA 2HHHK 2DY9A 3SSSA 2Y1LB 3CC4N 3PV8A 4BROA 4U9RA 3WNFA 3PG9A 1FRLA 2HVHA 3LWMA 4DPTA 1SKUB 3D0HE 3QEXA 3VQQA 4DUYK 2NS1B 4CO3A 2EI5A 4FYDA 2MQPA 4ZVPB 2JFKA 3M30A 1RYSA 3MN9A 4KB0A 2W9AA 1WSRA 1L3KA 4BE2A 1NGHA 3RMDA 4LQ9A 1XC9A 2CIMA 4Q5VA 2HNZA 2B4VA 4LF9J 4WQ5A 4OPKA 3P31A 4ELTA 2RB7A 4EU0A 2IDLA 4DR7F 2V2KA 4JRPA 3E51A 5AXMA 5DETA 3TANA 4MQ3A 3J7AP 2BXJA 2BVZA 4FL9A 2GQ2A 1WBBA 5JLHA 1WC5A 1RT2B 4B02A 3GG0A 3HSCA 4CO4A 3MM6B 3J7YI 2NUUG 3R8EA 3H6EA 4K5RA 3ITHA 3Q8SB 4IKAA 3PJ9A 3UR3C 2WVEA 1VGYA 3EZUA 4F7VA 3AVJA 5BR8F 2P5VA 1XNQJ 2GMJA 4DL5A 3WXLA 4KPCA 2OCEA 2MZRA 1VK3A 2CQ1A 5HRSA 4CF2A 2HQ3A 2W40A 1IO2A 5L9XA 3DDIA 3BSOA 4J7CA 1B9DA 3KZBA 1ASVA 3JB9k 5CD4A 4JI2K 2DKOB 3H1VX 3T7ZA 2MZTA 3KLVA 4FWMA 3Q23A 1U04A 2HHPA 4I67A 2GS8A 5THWA 5C2FA 3T1YK 4A8WA 1FJCA 4JV0A 2WC9A 4FLWA 5JMVA 2XNQA 4QYZJ 5KFFA 1SI9A 1LFPA 5HP1B 3M2RA 5IT9O 2UYTA 4DV4J 4YB7A 4FJ8A 2ZJQL 1YTAA 3HRGA 1DHMA 1WHVA 1WOPA 1YJ9N 2FVCA 3V1RA 3FQLA 4HTJA 4N56A 1VQKS 2IYGA 3LF0A 1BQMB 2EXUA 2PZSA 4EZ6A 1NMEB 4LVOP 2LEPA 4IQXA 3GIMA 5K8MA 3JSMA 2CQGA 4CI6A 2HMIB 2QWPA 2A6AA 2ZWHA 3VQBA 3IR5B 2P6TA 1SV5B 3QNOA 2D0OA 5IM0A 4K0KK 3VGLA 4CIEA 4FN5A 3PO4A 1ZBSA 3VMFB 3IUCA 2CZ4A 4WKYA 3OHAA 3DRSA 3PTWA 1WDDA 1FVSA 4ECXA 2GV9A 2HNYA 3W63A 3J7AN 5BYSA 2BV3A 3ZC4A 1RDBA 2LXFA 1VSLA 1H98A 2JDJA 1OPZA 2A1BA 2HBRB 1PJ5A 1ATRA 4FCYA 4XH1A 5E3QA 4WFBQ 3CNQP 4PXEA 3BN7A 1TFYA 4BR7A 4PXBA 5HRPA 4JKGA 2XEXA 1GMWD 3KVGA 2YWFA 2DR8A 5CZ1A 5C15A 2D0CA 1Q53A 3OW2R 1K9MO 3MFIA 4F0KA 3WDOA 3EMTA 3CCQS 2WOMB 3FBCA 2UVVA 3AVBA 3ZFVA 2BJ9A 1FXDA 2DEJA 4Z94A 4EAHD 5C24A 5L1JA 1RU2A 2W7AA 3KDNA 2ZE2B 3D7EO 5ELZA 2BRLA 5H1SV 4CP5A 3ZETA 1JLGA 1URRA 3SDEB 1SC6A 2V2ZA 3MAHA 2XO7A 5B0GA 4DTXA 4LF6F 3IG1A 2DGSA 4PG7A 3TWZA 3TX0A 2YWGA 4WIIA 5BN8A 1SJ1A 4KGMA 5D4PA 4ZVHA 4FZXC 4KT0C 2HRUA 4KH1B 1N32F 3TAPA 4N76A 1EXQA 5L8RC 5CYQB 4M95A 5AQFA 2X74A 1B7FA 4RKUC 2NXUA 2JLEA 2UXDJ 1FDDA 2DFHA 4B9UA 3MGJA 3ZTOA 1AB8A 2BOPA 4B9NA 5FD1A 4DBQA 1N0VC 5H1SQ 5BYQA 2FZCB 1SKSA 4J2DA 4KI4A 3R5DA 4X4OA 1S9EB 5AZJB 2NRHA 2P9SA 2HBMA 1HR0J