3V9SA

Crystal structure of rnase t in complex with a product ssdna (aac) with one mg in the active site
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 63
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9sA00
4AHTA 3IG1A 1A5XA 1S1VA 2KTQA 3HVTA 5SZTA 4OKKA 1TK0A 3V1QA 1BQMA 3CM5A 4CGHA 1JLGA 2E6MA 4M3RA 3OYAA 3V9ZA 3AA3A 4Q0BA 3S9HA 1I3AA 1B9FA 4MFBA 4DS5A 3AVJA 3ZSWA 1W0HA 2YKNA 3RR7A 3PY8A 4BACA 4CF8A 1VSLA 3ZT3A 1VSFA 4CFBA 2OZSA 4B3OA 3ZT4A 1UOCA 1HYVA 1RBUA 2QKBA 1VSIA 2YNHA 4CJ4A 3U6FA 3EY1A 3NH1A 3HVRA 5DMRA 4DSKA 2KQ2A 3C6UA 3THVA 2D5RA 1U47A 4KHNA 4NYNA 2X6NA 4E19A 4KHQA 4YNQA 3OYMA 4BDZA 2BE2A 4DQRA 1KLNA 4AHVA 4CGFA 4KHSA 4FM1A 1IG9A 4F3TA 3NH2A 3H08A 1Q8IA 3VQ9A 3OYFA 1IKVA 1RILA 5CYMA 1VSEA 1S5JA 1WSFA 1Y97A 3DLRA 3QERA 5C25A 1HYSA 2F8TA 3QEVA 1JKHA 2NUBA 3CYMA 4FLVA 1NK8A 4CESA 4B9NA 4ID5A 1O1WA 4DFMA 4CIEA 4N41A 4Z0UA 4XIUA 1IKWA 1NK0A 4B9LA 3A2FA 3V9UA 2QK9A 4CECA 3I0SA 1RBVA 4CJSA 1VSMA 1TV6A 3L3VA 3HPOA 3C95A 1BGXT 3EYZA 4HHTA 5J2MA 1Q9XA 3VA0A 1RBSA 3CG7A 3OYGA 4CF9A 3LZIA 3SZ2A 2P51A 5HP1A 3U3YA 1RTHA 2IC3A 4AHRA 5HBMA 4E1MA 3SUOA 4M41A 3VQEA 1F21A 1RBRA 1BIUA 2HB5A 1X9SA 1ZBUA 4PQUA 3NF9A 2W42A 3DRSA 3HT3A 2WOMA 2A1SA 3HPGA 1BIZA 4KTWA 2DFHA 2EHGA 4RW9A 3K58A 4DFJA 3TAPA 1NK5A 2PYJA 3DLBA 3TAEA 3MEGA 4CCHA 5KRSA 2HNYA 1L3SA 3U3GA 3AVIA 2FBXA 3V1OA 4M42A 1TKTA 1B9DA 3LP0A 4W5OA 4DQIA 3VQPA 1VK0A 4CJPA 3OYCA 2HNZA 1XC9A 4CJEA 3K5NA 4HVJA 4FK2A 3SQ2A 2IAJA 4CJUA 3AVKA 1EXQA 1JXBA 1IKYA 4UQGA 3PV8A 3HP9A 1X9WA 4J2EA 1KVCA 4NYFA 3OYNA 4LSNA 1RT2A 4AH9A 4CJWA 4DF4A 2Y1JA 4ELUA 1S1UA 1S9GA 3S3OA 4B8AB 1QE1A 3AO1A 5KI6A 3KJVA 2OA8A 4FLUA 1L3TA 4EZ9A 4FZYA 4F8RA 1HMVA 4M3YA 3NFAA 2OPPA 2RN2A 4CEFA 4ZTJA 3OYKA 3JSMA 4CGIA 5KGXA 1QSLA 4FJ9A 1QHTA 4Z4FA 4LY7A 1JLAA 3LZJA 3QIPA 2PZSA 5FRNA 5EU7A 5HROA 3HO1A 3CM6A 2GUIA 2QKKA 3S3NA 3CFRA 4H8KA 3V6DA 1UAXA 3SYZA 3D45A 2D0CA 4FLYA 3BGRA 4KKOA 1R0AA 2KZMA 3B6PA 4CEOA 1DTTA 5HRRA 5I42A 2XHBA 5SWMA 1JLFA 3PX0A 3ZT0A 1S1XA 5I3UA 4ELTA 3LANA 4I2QA 1BL3A 3VQ5A 3T1AA 3NCIA 5HLFA 4CJRA 2XY6A 3AVBA 4DSJA 3AO3A 4CJTA 4FLTA 3VA3A 1D5AA 3MXMA 1N6QA 4N5SA 2PY5A 3TR8A 3AVCA 5HRNA 4I7FA 1RT3A 4KHUA 4OGCA 1L5UA 1X9MA 3SUNA 4FLWA 4CJKA 3OYHA 4OKJA 1ZBFA 3K5MA 3HYFA 3WNFA 1VRTA 4DFPA 1NOYA 5KRTA 2G8KA 4HCBA 2YHBA 4AHCA 4IFYA 1S1WA 3K5OA 4C8NA 4CJLA 1HNIA 3M8PA 3DRPA 3ZT2A 5CY4A 3NGZA 3S3MA 1B92A 1BISA 4KTZA 3VQ6A 4KB0A 3TABA 4QOZB 4F2SA 3MECA 1RCHA 1J5OA 3PX4A 2HHXA 1ITGA 3WNEA 1BCMA 3QETA 1CXQA 1EP4A 4RW4A 3NE6A 4C8LA 1QS4A 2VG7A 1LW0A 4CHZA 2HW3A 3AVFA 3OYEA 3HP6A 2EX3A 2IOCA 4DU1A 3NGYA 3K59A 3OYIA 4DMNA 1GOBA 1KTQA 4F2RA 4FW1A 4CHOA 1RTJA 2GV9A 3OJUA 4DTRA 1LV5A 2E6LA 3UIQA 4KPYA 1J54A 4M3UA 2VWKA 4OPKA 4CEZA 4QAGA 4FJKA 3VQQA 4C8KA 4BE2A 1WSIA 2OZMA 1HPZA 2RKIA 1FK9A 3MXIA 5J2QA 1G15A 1RT1A 2B5JA 1JLEA 1WSGA 4H4MA 3NHGA 3SPZA 4CJFA 1CXUA 1SV5A 3HL8A 4DTSA 4EZ6A 4B9TA 5CZ2A 1TK8A 2HHSA 2VG6A 3MEDA 3LP1A 1SKSA 2A1RA 4O55A 3CQ8A 3KLIA 3OY9A 4HTUA 4BWJA 1C0MA 4IG3A 3O4NA 4DTMA 1C0TA 3SUPA 4B9MA 2E4LA 4CF0A 4PY5A 1WSHA 3RTVA 4BDYA 3P83D 4EP4A 4RW6A 2HVHA 1T05A 3WNGA 4IBNA 1GOCA 2KW4A 4FJIA 4KB1A 1Q9YA 1Z25A 4RW7A 1DTQA 2XY8A 4M45A 4FJGA 4CHYA 4G1QA 1YVUA 3B6OA 3LP3A 3VQ8A 1ASWA 1Z26A 1ASVA 5J1EA 3JYTA 4Z4EA 4OLAA 1XHXA 4KHYA 3DYAA 1TVRA 3RMBA 3LP2A 3T3FA 4FXDA 3G0ZA 4B9SA 4NCGA 3PUFA 5C24A 3VN5A 2XY5A 3MEEA 3OYJA 1KFSA 2BDPA 1XI1A 3RMDA 3NF8A 1ZBHA 3DI6A 2HVIA 2HHVA 1BQNA 2D0AA 2I5JA 4DTPA 4FVMA 4DG1A 3HPHA 5J2NA 3LPUA 2Z1HA 1SL1A 1SKRA 2HHUA 3M8SA 2OYQA 3DM2A 3TANA 1BI4A 3V9WA 4W5NA 2ZQBA 4FJJA 3QINA 2G8UA 3M8RA 2WONA 1LW2A 4CFDA 3BDPA 4KI4A 5D3GA 1CZ9A 1W9HA 3DOLA 2ITGA 1LAVA 4I9LA 4BWMA 3DRRA 3LAMA 4L8RB 3O3HA 3AA2A 1NJXA 1LAWA 1LWCA 4DTNA 1TL3A 3TARA 1BCOA 4K8ZA 4ICLA 3SV3A 3K57A 3RMAA 1SKWA 3KLEA 1KSPA 2VG5A 2X74A 3F9KA 3OS0A 3C6TA 1YT3A 1U49A 4B9VA 4KI6A 4PUOA 1KVAA 1C1AA 1FKOA 4HUFA 3OS2A 2FBYA 2FBTA 3DLKA 3FFIA 3V1RA 3OJSA 3TWHA 2PYLA 3QIOA 4OVLA 3OYDA 3QNOA 4MQ3A 4CHNA 3VQCA 3TI0A 4DSIA 3O3FA 4YFUA 4H4OA 3SNNA 3V81A 3AVHA 2G8HA 3AV9A 1U4BA 4DU3A 1K6YA 3AVAA 4E7KA 1C1CA 4DTOA 2O4IA 1EKEA 4RW8A 3TAGA 1IKXA 1RT6A 2IGIA 1EETA 4CGDA 4IG0A 4Z4CA 2DFEA 2D0BA 1QSYA 4FZXC 3KLHA 3DLGA 3NF7A 4DTUA 1IH7A 3K2PA 3TAFA 4FM2A 4FZZA 3DMJA 2IS3A 2YKMA 1KRPA 4LSLA 2Y1IA 1KCFA 3AVMA 4F4KA 3RRHA 3SCXA 3KK1A 3MAQA 3P1GA 2HHWA 3OYBA 3KKSA 3ASMA 1KLMA 4KFBA 4LD0A 4J2AA 1N5YA 2ETJA 3LDSA 3SQ0A 4HUGA 3NF6A 4B8CA 1RNHA 4OKEA 2HNDA 4OGEA 4DLEA 2JGUA 4E3SA 1TK5A 1CLQA 2F8SA 3NH0A 1RTDA 2AJQA 3E01A 1J9AA 1VRUA 4CEBA 1YTUA 3LALA 2O4GA 3TAMA 3I8DA 1NKCA 3OS1A 2YV0X 4PA1A 1JL1A 4FJHA 3PO4A 1HQEA 4FCYA 4BE0A 4GMJB 3KLFA 3SJJA 4FW2A 4O0IA 1VSJA 1WAJA 1U48A 3V9XA 3VQ4A 3OYLA 3NBPA 4ZHRA 5KTQA 2X78A 2DFFA 2YHAA 3ZSXA 1EX4A 3QEXA 3SPYA 1D9FA 2G8FA 3RR8A 3AVNA 4KO0A 4O4GA 5CYQA 4CGGA 3O3GA 2RPIA 4FK4A 4OPJA 4ID1A 1HQUA 1RDAA 4ZTFA 3KK3A 4FJMA 4O44A 2FBVA 2OPQA 1D9DA 3IAYA 1U45A 3V4IA 4JS4A 1BHLA 4Y1CA 4M3XA 1HYZA 3ZSVA 1MU2A 4FJ8A 1NK6A 4FJ5A 3L2VA 4O0JA 4AILC 1A5VA 1C1BA 3RWUA 1S6QA 3EZ5A 2FC0A 3ITHA 1WSJA 3VQAA 4Q5VA 1JL2A 4J2BA 4DWIA 3ISNC 4AHUA 3RRGA 2KFNA 1QSSA 3SUQA 2P5GA 4JLHA 1KVBA 3VQDA 3DLEA 3HSTB 2BGGA 4I9QA 5E41A 2G8VA 3SQ1A 1NK9A 3P5JA 1LWEA 4KRFA 4DTJA 4CIFA 2B4JA 1ZYQA 3L2QA 4DQSA 4IFVA 5KGWA 3VQ7A 3DLHA 4E0DA 4F3OA 4FK0A 3L3UA 1L3UA 5FDLA 3TAQA 2HMIA 4CGJA 4HUEA 4DS4A 1RBTA 3CFPA 1WAFA 2B6AA 2ZD1A 1J53A 4KREA 3SV4A 1NKEA 4DF8A 3QEIA 1L3VA 1A5WA 4DLGA 4DTXA 4ELVA 4KV8A 3QLHA 5C42A 2YNFA 1T8EA 3L8BA 4CHQA 1NK4A 3T19A 4I2PA 4B08A 2HHQA 2XO7A 5J2PA 1VSKA 1WSEA 3NAEA 1NJWA 3O4QA 2HHTA 3AVGA 1JLQA 5K14A 4LH4A 1NK7A 1TGOA 3OVNA 4WE1A 4DSLA 3AA4A 4CIGA 1TKXA 3DOKA 1TKZA 3ALYA 3AO4A 2LSNA 4CF1A 3F73A 4FLXA 4E7IA 1T03A 3AA5X 1SL2A 4NCBA 2OPSA 4TSXA 5FROA 4KAZA 1D8YA 4M3TA 4Z4HA 1WN7A 1NJZA 4E1NA 4CK1A 1KFDA 4W5TA 1RT4A 4RG8A 5DK5A 3ULDA 1C6VA 4CEEA 1RDDA 3KIOA 4CF2A 1XWLA 1HRHA 1RTIA 4CHPA 4JRPA 1T7PA 4K8XA 2G8WA 3IS9A 3KKRA 1NJYA 2KFZA 4J2DA 4CK2A 4HCCA 4NCAA 3AVLA 3KLGA 2YNGA 4DFKA 4PWDA 3QESA 4CJ3A 4CK3A 1GOAA 1LWFA 4BE1A 3KTQA 1I39A 5CZ1A 4N47A 1X1PA 2G8IA 2IDOA 1S6PA 2Q3SA 1UA0A 4CJQA 1DLOA 4KHWA 4LH5A 4M3WA 2VWJA 1REVA 4GVMA 4CJVA 2Z1GA 4DSEA 4BDPA 3NDKA 3KD5E 3QNNA 3KD1E 3M8QA 3G10A 4FJLA 2X6SA 1WLJA 2JLEA 3ZSZA 4QCLA 3ZT1A 3KK2A 4E7HA 3L2RA 4CEQA 3AO5A 1SUQA 3CFOA 4OJRA 4B9UA 4DQPA 3QO9A 3ZCMA 4OLBA 1WNSA 4FM0A 1IO2A 5JS1A 4DQQA 1BI4B 4N56A 3L2UA 2OPRA 1TKDA 3V9SA 4N76A 4Z4IA 3C94A 1JLBA 3MXJA 5JS2A 4EP5A 4E7LA 4W5RA 3LPTA 4FLZA 2P1JA 1XHZA 2QXFA 3L2WA 3LWLA 4CE9A 3LAKA 1QTMA 4FYDA 1CZBA 1HNVA 1FXXA 1RDBA 1U04A 2XRIA 3D0PA 3RMCA 3PO5A 1RT7A 5HRPA 4FJNA 1RDCA 2ZE2A 4CFCA 4DSFA 4Z4GA 3LWMA 2KZZA 1TAUA 1NKBA 2DTUA 3VQBA 1QQCA 1TAQA 1UA1A 3HM9A 4CERA 4IKFA 3QEPA 3QEWA 2DY4A 3ZSOA 3NGIA 4JRQA 1S9EA 1VSHA 1NOZA 4Y1DA 4R5PA 4DU4A 1ASUA 2BANA 2XY7A 4CEAA 1C0UA 3HK2A 3HJFA 1ZBIA 4W5QA 3SQ4A 1JLCA 2ATQA 2YNIA 4JS5A 2Z1IA 4C8MA 1TL1A 3ZSRA 1UWBA 2P5OA 4CEDA 4GW6A 4E89A 4E7JA 1RT5A 3I0RA 4FJXA 5HRSA 1VSDA 1SL0A 1S1TA 1JXEA 2GBZA 3PX6A 2F96A 5FRMA 3ZSYA 1FKPA 1HJRA 3WNHA 4CFAA 4FJ7A 3AO2A 3IRXA 5T7BA 2RF2A 4C8OA 4IDKA 4O5BA 3SI6A 3HXMA 4CJ5A 3K5LA 2R7YA 1ZBLA 4M3ZA 3ZSQA 4AHSA 2Z1JA 4KTQA 1YTAA
chains in the Genus database with same CATH superfamily
3IG1A 1A5XA 2KTQA 3LDOA 3VF6A 1BUPA 1JLGA 4M3RA 4FWSA 1B9FA 4AM6A 3AVJA 3ZSWA 3PY8A 2YCHA 4B3OA 3ZT4A 4XH5A 2RHKA 3EY1A 4F9OA 1E3MA 3THVA 1U47A 4BQLA 4KHNA 4E19A 3CCLN 5IT9O 2BE2A 5JLHA 5KPZA 3NH2A 3H08A 4BR5A 3E66A 3VQ9A 3U3YA 3FFKB 1VSEA 3W0LA 2E88A 1YHQN 2F8TA 3QEVA 3CYMA 4CIEA 1NK0A 1IKWA 4DV4K 1VQ4N 3V9UA 2QTDA 2QK9A 4CECA 4CJSA 1VSMA 4AQYK 1BGXT 4HHTA 1HLUA 3CG7A 4ILHA 4A5AA 3LZIA 1RTHA 4FPAA 5HBMA 4E1MA 3SUOA 4M41A 5GAHP 1F21A 4H0PA 1ZBUA 3FZMA 5KPTA 3HPGA 3O1WA 3TAPA 3K58A 4DFJA 4JV5K 3TAEA 4G9ZA 2E5LK 1L3SA 3U3GA 4MO5A 3C6HA 4W5OA 4LF9K 4B3RK 1XC9A 3L0QA 1J6ZA 1EXQA 4BQZA 3HP9A 4A57A 4X64K 4NYFA 3OYNA 2NRWA 4DF4A 4AH9A 2WUSA 5HOOA 1S1UA 1S9GA 2P9PA 4B8AB 3UKUA 3AO1A 1L3TA 4FVUA 1E4GT 4CEFA 4FJ9A 2P9NA 2PZSA 2QKKA 2CH6A 3V6DA 1UAXA 2ASOA 3D45A 3KWGA 2YHYA 4JYAK 1R0AA 1NJIO 2KZMA 4GKKK 1JLFA 4NXMK 3KHYA 1RDUA 3VQ5A 4KHPK 3NCIA 2XY6A 3ZEUB 1P8ZA 2D4WA 3AO3A 4DR5K 4FLTA 3VA3A 4DKWA 3AVCA 5LL6Z 1K8KB 1XNQK 1YF5L 4YORA 1ZBFA 3HYFA 3WNFA 3T1YK 4DR6K 4AHCA 1HNXK 4CJLA 3QBXA 3M8PA 3NGZA 3S3MA 1NMDA 4FWRA 2HF4A 1VQ6N 2O8CB 1QHAA 4DCHA 2NRTA 2HHXA 3WNEA 3QETA 1CXQA 1EP4A 4BR2A 1QS4A 4WF9L 4HWIA 4CHZA 3O4WA 3AVFA 3DXKA 1DGKN 1NGJA 1LOTB 5EOYA 3OYIA 3WQTA 1GOBA 4CHOA 3HM8A 4DTRA 4GV3A 4FJKA 1WSIA 3MXIA 5J2QA 1RT1A 2B5JA 3SPZA 2E2OA 4CJFA 4IOAL 1SV5A 5AQIA 1TK8A 4R79A 3LP1A 3MMVA 3WXKA 4O55A 3OY9A 4BWJA 3O4NA 3CCUN 3THXB 5AQYA 3WNGA 4IBNA 1GOCA 3SBTA 3CJCA 2UUCK 3LP3A 1ASVA 4Z4EA 4PKGA 3A5LC 4C1NK 4FXDA 4B9SA 4JKAA 5AR0A 2I7PA 3MEEA 3ZLJA 1XI1A 4X62K 3DI6A 3D7EO 4MDAA 1BQNA 2HHVA 3LPUA 3DXMA 4DV6K 3V9WA 3JAMO 4W5NA 2ZQBA 4YY3K 4FJJA 4LF4K 1SZ2A 3BDPA 3DJCA 3DRRA 4WQ5A 1LWCA 2ZJQL 1TL3A 1BCOA 3PSFA 3H1QA 1OH6A 2X74A 3OS0A 3THWA 1YT3A 2FBYA 4LFCK 4A2AA 5I9EB 3PIOL 4B9QA 4QS8A 2YHXA 3VQCA 1NMNA 3SNNA 2G8HA 3AV9A 1U4BA 4DU3A 1XNRK 4GKJK 1QQOA 4BRPA 4B3MK 3ID8A 2ZM6K 3LDLA 3TAGA 1IKXA 2IGIA 4Z4CA 3DLLL 2GTDA 1VQLN 3NF7A 4DTUA 4RTFD 3K2PA 4FZZA 5DM7L 2P9IA 2YKMA 1KRPA 2O8DA 4LSLA 2Y1IA 3RRHA 2F9TA 4IDHA 3OYBA 3CPWM 1IBKK 4J2AA 3EO3A 4HUGA 4C1NI 4OKEA 4OGEA 4YOTA 1CLQA 2GELA 3P38A 3NH0A 4JI4K 3E01A 2ASMA 1O13A 5BPLA 3I8DA 3DWLA 2KKZA 3TPQA 4FJHA 4GMJB 3KLFA 3SJJA 3O8MA 1WAJA 3NBPA 5KTQA 1ATNA 1D9FA 1WB9A 4KO0A 4FK4A 3O3GA 1GLLO 4BRCA 2P9KA 4BG9A 1D9DA 1ZXOA 2OPQA 3IAYA 1KXPA 3V4IA 1BHLA 2NRVA 1HYZA 3FZFA 3AY9A 4IXCA 1NK6A 4FJ5A 1VQON 4O0JA 2Q0RA 1S6QA 3KZBA 3VQAA 4Q5VA 4MO4A 1E4FT 3BF1A 2KFNA 3RRGA 3VQDA 4FL9A 2BGGA 3SJHA 4JI8K 5E41A 3P5JA 4CIFA 1P90A 4JD2B 1ZYQA 1HNWK 4IFVA 3VQ7A 4E0DA 4F3OA 1NGDA 1L3UA 4HUEA 1WAFA 2ZD1A 4KREA 4YHHK 4KBOA 3QEIA 1SAZA 5B8HA 2P9LB 4DTXA 1G99A 3BY5A 5LJWA 2YNFA 3L8BA 4CHQA 3OTOK 4I2PA 2HHQA 5J2PA 4JI0K 1JLQA 1QZ5A 5K14A 2FSKA 3OVNA 3AA4A 4M3YA 4CF1A 1SL2A 3UB5A 2OPSA 4PL8A 2VQEK 5GAGP 4M3TA 4E1NA 4CZIA 4CEEA 4IOCL 3VF4A 2FF3B 1T7PA 2G8WA 1NJYA 2KFZA 4NCAA 3KLGA 2O8FA 5JVGL 1Q81O 3ENHA 1I39A 3S41A 2G8IA 4WFAL 2FF6A 4CJQA 4JKCA 4CJVA 3KD1E 3O9TA 4FJLA 1N32K 3ZSZA 2Q1NA 3M1FA 1SUQA 4DQPA 4OLBA 4FM0A 3FLCO 1HX1A 3D2EA 2Q97A 4N76A 1ATRA 3C94A 3MXJA 3CMAN 2UUBK 3LPTA 4XEIA 2QXFA 4GV9A 4JI5K 1KAYA 3VEOA 3VENA 4CE9A 3LAKA 4Y0WA 5C2FA 4DSFA 3CJ9A 1TAUA 2QXLA 1UA1A 3AGKA 5AQFA 1IJJA 3QEWA 2DY4A 3TSQA 1S9EA 4DU4A 1NOZA 4Y1DA 4CEAA 4H5RA 3F2KA 3NVMA 4JS5A 4DV0K 3ZSRA 2VGMA 4CEDA 4BR4A 3I0RA 3WT0A 2IVPA 2F96A 4EAHD 3ZSYA 3WNHA 3IRXA 3C7NA 3CCEN 3Q7BA 5BN9A 1ZBLA 2QWNA 2Q0UA 4CZMA 1VQMN 1YTAA 3SV3A 1S1VA 3HVTA 5SZTA 2E8AA 3V1QA 3AGRA 4DUZK 4CGHA 1WBDA 1I3AA 3CF5L 4FWPA 4DS5A 2YKNA 1K9MO 4BACA 2HOEA 3KWIA 1VSFA 1JCFA 1RGIA 5DMRA 2KQ2A 3C6UA 4I6MA 2ASPA 4BDZA 2QA4N 4CGFA 3A0IX 1W97L 3ULEB 3DLRA 1HYSA 5C25A 1JKHA 2O8EB 5FLXO 3HRGA 4B9NA 4DV7K 4DFMA 4B9LA 4JHDB 4E7LA 3MWPA 1RBVA 1L5UA 1TV6A 3C95A 2JWLA 2HB5A 2HHHK 4CJ7A 5AFUA 3HT3A 2CGJA 2HBKA 4FWLA 3N4QA 4YDUA 3CI5A 4CD1A 4KTWA 3A5NC 3D2FA 3JXUA 3QICA 2HBLA 4CCHA 5KRSA 3ZYYX 4BGBA 2FBXA 2W40A 4M42A 1TKTA 3K9KA 3LP0A 3OYCA 4CJPA 1IBMK 3K5NA 2V7YA 3AVKA 2IVNA 4BC2A 1JXBA 1IKYA 4UQGA 3PV8A 1X9WA 1T44A 3QB0A 4CJWA 4ELUA 4H0VB 1QE1A 5KI6A 4F8RA 1HMVA 3NFAA 2RN2A 5H1SQ 1QSLA 4CGIA 4Z4FA 5FRNA 1JLAA 3LZJA 3QIPA 5CE3A 3THYB 2YI1A 4H8KA 1MWMA 4FLYA 3BGRA 4KKOA 2O8EA 3HI0A 3J80O 4ELTA 3OA9A 3CCRN 5JLFA 4L3QA 2UU9K 5HLFA 3JS6A 4DSJA 1GLCG 3WEEB 3MXMA 4N5SA 3VF2A 2VWBA 1HR0K 3ATVA 1H1VA 2ZGZA 1X9MA 4FLWA 2A6AA 5KRTA 2G8KA 1S72N 4PKHA 1HNIA 3ZT2A 1CZAN 5CY4A 3D6RA 5DM6L 1BISA 4KTZA 4KB0A 3TABA 3MECA 4U7BA 3CD6N 3MX5A 1ITGA 3HBTA 4C8LA 3NE6A 4CZGA 2WBNA 4FWOA 5BRDA 1LW0A 5AQKA 3OYEA 3HP6A 3VEVA 2IOCA 2PBDA 4DU1A 3K59A 1EO1A 3OW2M 4M3UA 2QM1A 2UXBK 4AM7A 4C8KA 4A62A 1U2VA 2OZMA 5BPMA 2RKIA 4H5TA 3O1BA 4JEPA 4EZ6A 2GX9A 1ATSA 5LMUK 4A61A 5CZ2A 4B9TA 1SQKA 2OCEA 1SKSA 1NM1A 1C0MA 1KAXA 4DTMA 2E4LA 4CF0A 1WSHA 3RTVA 3P83D 1IV0A 3G4SN 3QFUA 4FO0A 2KW4A 1BU6O 4RW7A 3VOVA 2XY8A 4M45A 3B6OA 2UUAK 3SLCA 3VQ8A 1ASWA 3Q7CA 3RSEB 3ATUA 4BC3A 3PUFA 1NNEA 3MDQA 3VEXA 2HVIA 3WXLA 4BRFA 2I5JA 4DTPA 3HPHA 1SL1A 1Q18A 2OYQA 5TKWA 1SS6A 4BRIA 4C23A 2WONA 3M8RA 1LW2A 1YVNA 5D3GA 1CZ9A 1LAVA 4IFEA 3LAMA 4M7XA 3AA2A 3TARA 4WQ4A 3K57A 3RMAA 4YOWA 5AQRA 3MX2A 5AQUA 4E1JA 1XQSC 4BROA 4B9VA 4KTQA 3GE1A 3OS2A 3OJSA 2OANA 3MWTA 4MQ3A 2ZJPL 3OBWA 3O3FA 4CI6A 4ISFA 4E7KA 1NGCA 4DTOA 3SBGA 2O4IA 2F9WA 1NLVA 4LF8K 4JKHA 5F2RA 1EETA 4B1VA 4FZXC 2D0BA 3KLHA 1K8AO 3VPZA 4FM2A 2IS3A 3VTIA 1Y64A 4FSVA 3SCXA 3KK1A 3P4IA 4DR1K 2P9SB 1KLMA 4KFBA 1N5YA 1K73O 3L4QA 2HNDA 4E3SA 1TK5A 4IWVA 5F0XA 5E84A 3TAMA 1MDUB 2F7TA 2YV0X 4CZKA 4FCYA 1HNZK 4FW2A 3VQ4A 4ZHRA 2DFFA 5EXWA 1EX4A 1VHXA 4DV5K 4CGGA 5C2DA 4OPJA 4ID1A 3KK3A 4FJMA 5AQHA 2FBVA 4JS4A 4M3XA 3THYA 3VESA 1OKJA 2HBMA 4DR4K 4LFAK 5AQGA 3TTDA 2E20A 4AILC 3RWUA 2FC0A 4J2BA 1WSJA 3MN6A 4J8FA 3O5BA 5AFUH 3ISNC 3O9QA 1YITN 4AHUA 1QSSA 4JLHA 3DLEA 3HSTB 4I9QA 4H0XB 4KRFA 1TYQA 1OH8A 4DQSA 5KGWA 2P9LA 3LM2A 2QWRA 4CGJA 4DS4A 2B6AA 2WC9A 1N34K 4DF8A 2GUPA 4O8UA 4BRQA 4KV8A 4A2BA 4EIAA 5C42A 1EWQA 1T8EA 3CJ7A 1MWKA 4B08A 3BZKA 4RCHA 1NBWA 1WSEA 3O4QA 3H3OB 4QS7A 2BTFA 3CC2N 4CIGA 4E7IA 3DOKA 3EE9A 4NCBA 5AQMA 5FROA 4KAZA 4Z4HA 1NJZA 4PL7A 4CK1A 1KFDA 4W5TA 3ULDA 2NZTA 1TUYA 1RDDA 4DHYA 4CF2A 1XWLA 4CHPA 4OX9K 4K25A 2YNGA 4GV6A 3H1VX 3QESA 4CJ3A 4CK3A 3U4LA 5CZ1A 4N47A 1UA0A 1DLOA 3ID6A 4KHWA 1KQSM 4JK7A 2Z1GA 3NDKA 5AQJA 3QNNA 3VEZA 2JLEA 4V19S 1YUWA 3CC7N 3L2RA 3AO5A 3R1XA 4OJRA 4B9UA 3QO9A 1WNSA 1IO2A 5JS1A 4JI2K 1BI4B 3SAGA 4N56A 2PFUA 3V9SA 4K42A 1JLBA 4H5NA 5C15A 2NLXA 3MK6A 1XHZA 4JKBA 3L2WA 5FPEA 2KHOA 3DAWA 1CZBA 1HNVA 1FXXA 1U04A 3D0PA 3RMCA 2ZE2A 4Z4GA 2EWSA 1C0GA 3AARA 5FPMA 3OBYA 2DTUA 3VQBA 2P9UB 3QEPA 5JICA 4IO8A 3NGIA 1VSHA 2Q2RA 2J4RA 1Q7YO 1ZBIA 1FW6A 3C65A 1UWBA 2YHWA 4JD2A 3WXJA 3WUHA 1TYQB 3FE1A 3VGKA 2ZJRL 5M1PA 3PX6A 2GBZA 1FKPA 2QWPA 4CFAA 1EWRA 1Q86O 4C8OA 4O5BA 4AF1A 3H6EA 3E1YA 4K41A 3ZSQA 1VQNN 4ILGB 4KHQA 2WFBA 4LC9B 4BC5A 4OKKA 5C10A 1BQMA 3CM5A 5TKYA 3TTFA 4Q0BA 3AA3A 3I55N 4MFBA 2E2NA 2E1YA 4BGAA 1W0HA 1DEJA 3RR7A 4CF8A 3ZT3A 4JAXA 5LMNK 1YJWN 3U9ZA 3GBTA 1RBUA 3LL3A 3O08A 4BVPA 1HKGA 3U6FA 3HVRA 5AZJB 4YNQA 1KLNA 4AHVA 4FM1A 1IG9A 1Q8IA 4YOUA 3OYFA 1RILA 1IBLK 1Z6RA 1TUUA 3TSPA 2NUBA 2HBJA 4FLVA 3H3NO 1NK8A 2VQFK 1O1WA 1J5EK 2NRHA 4Z0UA 4PY5A 3A2FA 3FZKA 3L3VA 5AJ3K 4CBXA 3HPOA 5J2MA 4A5BA 1Q9XA 3VA0A 3OYGA 4CF9A 3SZ2A 5HP1A 4AHRA 1X9SA 3CCQN 1RBRA 1BIUA 3IKMA 3CQXA 3NF9A 2W42A 4NXNK 2A1SA 1BIZA 1V4TA 3FZLA 2PYJA 3DLBA 1NK5A 3BP8A 3MEGA 3AVIA 3V1OA 4DQIA 3EZWA 3VQPA 2BH1A 5CR4A 4YDUC 4CJEA 1XMOK 3SQ2A 1QVFM 4CJUA 4CZEA 3O9UA 1KVCA 2P9IB 5LY3A 4EZ9A 5C0YA 5AZJA 4FZYA 1GLDG 1BA1A 3ZX3A 4ZTJA 5AQTA 5HL7L 5AQZA 1GLEG 5EU7A 5HROA 3HO1A 2GUIA 4JK8A 3A5MC 3CFRA 4DB3A 1YJ9N 5KPRA 4CEOA 1DTTA 5HRRA 1JJ2M 3O6WA 3ZETB 3PSIA 4H03B 5I3UA 3ENBA 2Q36A 4BC4A 3L6QA 4DR7K 4EHTA 5ADXA 4CJTA 2NRRA 3IMXA 3TR8A 4I7FA 1RT3A 4LF7K 4KHUA 3ZX0A 3ZEUA 4FWNA 3SUNA 3K5MA 5BR8K 4HCBA 2YHBA 4MDBA 4NLCA 1ZBSA 4C8NA 4BR0A 5MLCQ 5EY4A 3J7YP 4YOVA 1B92A 3VQ6A 4CZJA 4IJNA 1J5OA 1VQPN 4RW4A 2IIRA 3TSUA 3IUCA 2VG7A 2HW3A 3FR0A 4JI1K 1YAGA 2ZF5O 3NGYA 1NU0A 1KTQA 3WQUA 2WTUA 4FW1A 3CHWA 4K43A 1RTJA 2GV9A 3OJUA 3UIQA 2E6LA 4DR3K 1J54A 1GLBG 2VWKA 4DV1K 4QAGA 3VQQA 1NGGA 4BE2A 1V4SA 1W2BM 1HPZA 5AQPA 4BVOA 2BUPA 1JLEA 3NHGA 3OHRA 1NGFA 4OPAA 3MEDA 4DQ8A 2ZGYA 4LF6K 3CQ8A 3KLIA 4HTUA 3G25A 4IG3A 2IVOA 4NO7A 4JKFA 3U9DA 3SUPA 5GINA 1X3MA 2FLOA 1N33K 4BDYA 5BREA 4EP4A 1T05A 2YX6A 3VMFB 4FJIA 3IDHA 3WXMB 3C6AA 1S22A 4JN4A 4FJGA 4GY2B 1YVUA 3LM9A 3JYTA 1Z26A 1OVQA 2QWOA 1XHXA 4KHYA 3DYAA 4JI6K 5GAEP 4IZ9A 4NB4A 3EE8A 3T3FA 3G0ZA 4PHTX 2XY5A 2P9SA 3TTCA 3HOSA 2NRXA 2OTLN 2BDPA 1OH7A 3RMDA 3NF8A 2D0AA 1IG8A 4FVMA 1QVGM 2ITMA 1SKRA 3DXKB 2HHUA 4M63C 1HJOA 3TANA 1BI4A 1YIJN 4B1YB 3WEEA 2QI2A 4JHDA 4CFDA 3DOLA 4BWMA 4B1WB 1XUPO 2AP1A 1NJXA 1LAWA 4DTNA 4K8ZA 1KD1O 3WXIA 1SKWA 3KLEA 4BRLA 2VG5A 4JNEA 1VQ5N 3F9KA 3CJAA 1U49A 4KI6A 4PUOA 4HUFA 3QIOA 3THWB 4IEEA 3TI0A 4YFUA 3AVHA 3FGUA 3AVAA 1C1CA 1EKEA 1RT6A 4CGDA 4IG0A 3HSCA 4DV2K 3LDNA 3VEWA 1DKGD 3CQYA 3TAFA 3G6EN 1NG9A 5FPDA 3HOTA 1KCFA 3AVMA 2D1KA 4F4KA 3HTVA 3P1GA 2VGNA 4O8KA 3ASMA 3AAQA 4CZFA 1T6CA 2ETJA 2A41A 3NF6A 4H5VA 4DLEA 4O5FA 4IJAA 1NGBA 2F8SA 4DV3K 2A42A 5C12A 3GDQA 1YTUA 4IEIA 1NKCA 3AAPA 3OS1A 4CZHA 5ELZA 3PO4A 1HQEA 4BE0A 5BR9A 4IOXA 2DPNA 4O0IA 1U48A 1X3NA 3V9XA 5BPNA 3OYLA 2X78A 2YHAA 3SPYA 4X66K 5CYQA 4YOXA 4BRHA 2RPIA 3ULEA 1HQUA 1C0FA 4ZTFA 3LDQA 1U45A 4Y1CA 1MU2A 3K9JA 3BZCA 4XH1A 3L2VA 1GLFO 3EZ5A 1JL2A 3ZX2A 3SUQA 4BR7A 2AA4A 4B3SK 5LJVA 3CCMN 1LWEA 3GG4A 3CCJN 3MN9A 1EQYA 3QDKA 3L3UA 2HMIA 4FK0A 3TAQA 1RBTA 1J53A 1BOTO 1L3VA 1YXQA 1A5WA 4DLGA 4ELVA 1VQ8N 3QLHA 1U2VB 3UKRB 3T19A 1BO5O 3A8YA 3VGMA 3CERA 2XO7A 1BDGA 1NJWA 3NAEA 3AVGA 4LH4A 1NK7A 1TGOA 2GEMA 3ALYA 3AO4A 3F73A 3J7ZO 3E9LA 4FPBA 1RT4A 4RG8A 5DK5A 4DUYK 1C6VA 3RVCA 1HRHA 4JRPA 3IS9A 4CK2A 4HCCA 4H0YB 3VERA 4BRDA 5BN8A 3FZHA 4DFKA 1X1PA 2IDOA 1S6PA 2Q3SA 4RWTA 4M3WA 2VWJA 1U6ZA 1XMQK 4DSEA 4BDPA 3LDPA 3KD5E 5AQLA 3M8QA 1VQKN 3ZT1A 3KK2A 4E7HA 4CEQA 3O9SA 1QQMA 5M1KA 2NNWA 3H46O 3L2UA 2OPRA 3EKSA 4Z4IA 3QFPA 4EP5A 4W5RA 3CC4N 2D0OA 1QTMA 4LFBK 4X65K 3PO5A 1BWFO 2YJEA 1RT7A 1RDCA 2P9UA 4CFCA 2PAVA 2RE2A 3RSEA 1QQCA 1TAQA 3IFRA 4CERA 4IKFA 3ENOA 5CHIA 2A3ZA 2W41A 2XY7A 3THXA 4LF5K 1ASUA 2BANA 4BRMA 1C0UA 5AQWA 1ZC6A 2ATQA 4C8MA 5AZIB 5E26A 4GW6A 1RT5A 5HRSA 2UXCK 3P31A 1SL0A 3C7NB 1JXEA 3M5RA 2FXUA 2P9PB 4H0OA 4FJ7A 5T7BA 4BRKA 2RF2A 5AQSA 4HTLA 4IDKA 1NGEA 1JCGA 3HXMA 2R7YA 2QWLA 3K5LA 4M3ZA 4AHSA 2Z1JA 3F9MA 1MA9B 4AHTA 4CW7B 1TK0A 2E6MA 3OYAA 3V9ZA 3S9HA 3EL2A 3BF3A 4WFNL 5GIOA 1VSLA 4CFBA 2OZSA 1UOCA 1HYVA 3J7AP 2QKBA 1VSIA 2YNHA 4CJ4A 3R3LA 3NH1A 4DSKA 2D5RA 1VAZA 4NYNA 2X6NA 3VETA 3OYMA 2V7ZA 4DQRA 3R8EA 3R6MA 4KHSA 4F3TA 4IO9L 2CGKA 5JVHL 1IKVA 5CYMA 1Y97A 1S5JA 1WSFA 2CGLA 3QERA 1YI2N 3CMEN 3EKUA 4KH6A 3VGLA 2QEXN 4JKGA 1I94K 2FSJA 4CESA 2QW9A 4ID5A 4N41A 4WQ5C 1N8RO 4XIUA 1KAZA 4CBUA 3I0SA 3EYZA 4OO1J 3D2EB 1RBSA 2YJFA 2P51A 3H45C 2IC3A 5AQVA 1WUAA 1Q82O 3VQEA 4PQUA 3CJBA 3W3DA 3DRSA 3CCSN 2WOMA 3T1HK 2VYPA 2W6KA 2DFHA 2EHGA 4RW9A 4Z94A 2HNYA 1ESVA 2GWKA 1B9DA 3SK3A 1VK0A 4U67L 2HNZA 3CXCM 4HVJA 4FK2A 1QQNA 2IAJA 4DR2K 4NLBA 4J2EA 4LSNA 1RT2A 2Y1JA 1DT9A 2HSTA 4MLHA 3S3OA 4CBWA 2O8BA 3KJVA 2OA8A 4JK9A 4FLUA 1T6DA 4CZLA 5AQQA 4I6MB 2OPPA 4CD3A 3OYKA 3JSMA 2Q31A 4FWKA 5KGXA 1QHTA 2E1ZA 4LY7A 4CVNE 5AQXA 3UKUB 3CM6A 3S3NA 1KC8O 1QZ6A 3T69A 3SYZA 2D0CA 1T3VA 4JKGB 3B6PA 3G71N 4JKEA 5I42A 2XHBA 5SWMA 3PX0A 3ZT0A 3NMUA 1S1XA 3LANA 4I2QA 5EX5A 1BL3A 3PIPL 3T1AA 4CJRA 3AVBA 4ISGA 2W6LA 3DXMB 1N6QA 1D5AA 2PY5A 2V52B 3E9PA 5HRNA 4OGCA 3T7ZA 4CJKA 3OYHA 4OKJA 2A40A 4DFPA 1VRTA 1M1KO 1NOYA 1NGIA 5IWAK 5GADP 4IFYA 1S1WA 3SMPA 3K5OA 3D2FB 3P39A 3DRPA 3UE5A 1VQ9N 5F1XA 3M3ZA 5M1FA 2F4VK 4F2SA 4QOZB 1XC3A 1RCHA 3PX4A 4UY8O 1BCMA 4WQ4C 2E2PA 1M90O 1LCUA 2O8CA 2EX3A 2O8BB 3KVGA 1HUXA 4DMNA 1W7AA 4F2RA 2H3GX 1LV5A 4KPYA 4OPKA 2UYTA 3KK7A 4CEZA 3BEXA 2O8FB 3F5TA 1ILYA 1FK9A 1G15A 4OLAA 4H4MA 1WSGA 4M7YA 1CXUA 4DTSA 3HL8A 1OVYA 3BUZB 2HHSA 3SAHA 2VG6A 4FWMA 1VQ7N 4H5WA 4ILJA 2A1RA 1C0TA 4B9MA 3QMLA 4B1ZA 3C0BA 1GLAG 4RW6A 2HVHA 1NWKA 4KB1A 2VCPA 5FPNA 1Q9YA 3K0SA 1Z25A 4KH4A 1DTQA 4CHYA 4G1QA 5JMVA 4K0KK 5KQDA 5J1EA 1TVRA 3RMBA 3LP2A 2P9KB 4NCGA 5C24A 3VN5A 3OYJA 1KFSA 3EN9A 1ZBHA 4DG1A 5J2NA 2Z1HA 5KQ8A 3M8SA 3MN7A 3DM2A 3J81O 3VTHA 3MCAB 3QINA 2G8UA 3MCPA 5AQOA 4KI4A 1W9HA 4I9LA 2ITGA 4L8RB 3O3HA 4ICLA 2JWKA 1KSPA 3EEQA 3C6TA 4FOEA 1KVAA 1C1AA 1FKOA 3V1RA 2FBTA 3DLKA 3FFIA 3TWHA 2PYLA 4OVLA 3OYDA 3QNOA 4CHNA 4DSIA 1D4XA 4H4OA 3V81A 4WFBL 1K6YA 1BG3A 3J8AA 5EVZA 4RW8A 4FOIA 5ADXH 2DFEA 3I8BA 4B1UB 1QSYA 3DLGA 4YOYA 4KH5A 1IH7A 1JCEA 2KLAA 3DMJA 3M6GA 4H0TB 4BY9C 2D0PA 3MAQA 2HHWA 4JKDA 3KKSA 4LD0A 4XH4A 3LDSA 3SQ0A 4B8CA 3A5OC 4JI3K 1RNHA 2OTJN 3CCVN 2JGUA 1N36K 2HMPA 3CJ1A 2AJQA 1RTDA 1J9AA 1VRUA 3GL1A 4BR9A 3HZ6A 4CEBA 3LALA 2O4GA 2GWJA 5AQNA 1YJNN 4PA1A 1JL1A 3E9OA 5M1NA 1VSJA 5GIPA 3SMSA 3ZSXA 3QEXA 1GLJO 2G8FA 3RR8A 1HPMA 1K8KA 3AVNA 4O4GA 3VEYA 3PLAA 1RDAA 4O44A 4QS9A 3ZSVA 4FJ8A 1A5VA 1C1BA 3ITHA 4DWIA 3ZETA 2P5GA 1KVBA 2G8VA 3SQ1A 1NK9A 2V51B 4EHUA 1RFQA 4GNIA 4DTJA 2B4JA 3MN5A 3GOIA 2O8DB 3L2QA 3DLHA 3QBWA 2P9NB 5FDLA 2ZWHA 3CFPA 3O9RA 3SV4A 1NKEA 1X9JA 4WCEL 4BREA 2QWQA 4PKIA 1NK4A 5M1QA 2QWMA 1VSKA 2HHTA 3CETA 5A2QO 4WE1A 4DSLA 1TKXA 1TKZA 4FLXA 1WBBA 2LSNA 1T03A 3AA5X 4TSXA 4ISEA 1NGAA 3TU5A 2CH5A 1D8YA 1WN7A 5AZIA 3B8AX 4GVEA 1HKBA 3KIOA 1RTIA 5BRHA 4K8XA 3I33A 3KKRA 3L4IA 4FWQA 4J2DA 3AVLA 5M1OA 4PWDA 4BRGA 3R9PA 1GOAA 1LWFA 4BE1A 3KTQA 1BA0A 4LH5A 1REVA 2HF3A 4GVMA 3G10A 1WLJA 2X6SA 4QCLA 3N4PA 2NRZA 4B3TK 1WOQA 4BRAA 3CFOA 3ZCMA 4DQQA 1TKDA 1OH5A 4MLEA 5JS2A 4FLZA 2P1JA 3LWLA 4FYDA 1RDBA 2XRIA 5HRPA 4FJNA 4BG8A 3LWMA 2KZZA 1NKBA 1S3XA 1Z05A 5BRFA 3NVKA 1RDWX 3HM9A 3ZSOA 3O80A 4A59A 4OPHA 4JRQA 3CPEA 2FSNA 3SAFA 4B1XB 4R5PA 3HK2A 3HJFA 4W5QA 1NGHA 1JLCA 2YNIA 3SQ4A 3U8XA 2Z1IA 4BRNA 2UXDK 1TL1A 2P5OA 3I56N 4JI7K 4E89A 4E7JA 2I7NA 4FJXA 1HKCA 1VSDA 4EFHA 1S1TA 5FRMA 2A5XA 1HJRA 3AO2A 3CIPA 1R59O 3UKRA 3SI6A 4CJ5A 4WYBA 1FJGK 2E2QA
chains in the Genus database with same CATH topology
4AHTA 3IG1A 1A5XA 1S1VA 2KTQA 3HVTA 5SZTA 4OKKA 1TK0A 3V1QA 1BQMA 3CM5A 4CGHA 1JLGA 2E6MA 4M3RA 3OYAA 3V9ZA 3AA3A 4Q0BA 3S9HA 1I3AA 1B9FA 4MFBA 4DS5A 3AVJA 3ZSWA 1W0HA 2YKNA 3RR7A 3PY8A 4BACA 4CF8A 1VSLA 3ZT3A 1VSFA 4CFBA 2OZSA 4B3OA 3ZT4A 1UOCA 1HYVA 1RBUA 2QKBA 1VSIA 2YNHA 4CJ4A 3U6FA 3EY1A 3NH1A 3HVRA 5DMRA 4DSKA 2KQ2A 3C6UA 3THVA 2D5RA 1U47A 4KHNA 4NYNA 2X6NA 4E19A 4KHQA 4YNQA 3OYMA 4BDZA 2BE2A 4DQRA 1KLNA 4AHVA 4CGFA 4KHSA 4FM1A 1IG9A 4F3TA 3NH2A 3H08A 1Q8IA 3VQ9A 3OYFA 1IKVA 1RILA 5CYMA 1VSEA 1S5JA 1WSFA 1Y97A 3DLRA 3QERA 5C25A 1HYSA 2F8TA 3QEVA 1JKHA 2NUBA 3CYMA 4FLVA 1NK8A 4CESA 4B9NA 4ID5A 1O1WA 4DFMA 4CIEA 4N41A 4Z0UA 4XIUA 1IKWA 1NK0A 4B9LA 3A2FA 3V9UA 2QK9A 4CECA 3I0SA 1RBVA 4CJSA 1VSMA 1TV6A 3L3VA 3HPOA 3C95A 1BGXT 3EYZA 4HHTA 5J2MA 1Q9XA 3VA0A 1RBSA 3CG7A 3OYGA 4CF9A 3LZIA 3SZ2A 2P51A 5HP1A 3U3YA 1RTHA 2IC3A 4AHRA 5HBMA 4E1MA 3SUOA 4M41A 3VQEA 1F21A 1RBRA 1BIUA 2HB5A 1X9SA 1ZBUA 4PQUA 3NF9A 2W42A 3DRSA 3HT3A 2WOMA 2A1SA 3HPGA 1BIZA 4KTWA 2DFHA 2EHGA 4RW9A 3K58A 4DFJA 3TAPA 1NK5A 2PYJA 3DLBA 3TAEA 3MEGA 4CCHA 5KRSA 2HNYA 1L3SA 3U3GA 3AVIA 2FBXA 3V1OA 4M42A 1TKTA 1B9DA 3LP0A 4W5OA 4DQIA 3VQPA 1VK0A 4CJPA 3OYCA 2HNZA 1XC9A 4CJEA 3K5NA 4HVJA 4FK2A 3SQ2A 2IAJA 4CJUA 3AVKA 1EXQA 1JXBA 1IKYA 4UQGA 3PV8A 3HP9A 1X9WA 4J2EA 1KVCA 4NYFA 3OYNA 4LSNA 1RT2A 4AH9A 4CJWA 4DF4A 2Y1JA 4ELUA 1S1UA 1S9GA 3S3OA 4B8AB 1QE1A 3AO1A 5KI6A 3KJVA 2OA8A 4FLUA 1L3TA 4EZ9A 4FZYA 4F8RA 1HMVA 4M3YA 3NFAA 2OPPA 2RN2A 4CEFA 4ZTJA 3OYKA 3JSMA 4CGIA 5KGXA 1QSLA 4FJ9A 1QHTA 4Z4FA 4LY7A 1JLAA 3LZJA 3QIPA 2PZSA 5FRNA 5EU7A 5HROA 3HO1A 3CM6A 2GUIA 2QKKA 3S3NA 3CFRA 4H8KA 3V6DA 1UAXA 3SYZA 3D45A 2D0CA 4FLYA 3BGRA 4KKOA 1R0AA 2KZMA 3B6PA 4CEOA 1DTTA 5HRRA 5I42A 2XHBA 5SWMA 1JLFA 3PX0A 3ZT0A 1S1XA 5I3UA 4ELTA 3LANA 4I2QA 1BL3A 3VQ5A 3T1AA 3NCIA 5HLFA 4CJRA 2XY6A 3AVBA 4DSJA 3AO3A 4CJTA 4FLTA 3VA3A 1D5AA 3MXMA 1N6QA 4N5SA 2PY5A 3TR8A 3AVCA 5HRNA 4I7FA 1RT3A 4KHUA 4OGCA 1L5UA 1X9MA 3SUNA 4FLWA 4CJKA 3OYHA 4OKJA 1ZBFA 3K5MA 3HYFA 3WNFA 1VRTA 4DFPA 1NOYA 5KRTA 2G8KA 4HCBA 2YHBA 4AHCA 4IFYA 1S1WA 3K5OA 4C8NA 4CJLA 1HNIA 3M8PA 3DRPA 3ZT2A 5CY4A 3NGZA 3S3MA 1B92A 1BISA 4KTZA 3VQ6A 4KB0A 3TABA 4QOZB 4F2SA 3MECA 1RCHA 1J5OA 3PX4A 2HHXA 1ITGA 3WNEA 1BCMA 3QETA 1CXQA 1EP4A 4RW4A 3NE6A 4C8LA 1QS4A 2VG7A 1LW0A 4CHZA 2HW3A 3AVFA 3OYEA 3HP6A 2EX3A 2IOCA 4DU1A 3NGYA 3K59A 3OYIA 4DMNA 1GOBA 1KTQA 4F2RA 4FW1A 4CHOA 1RTJA 2GV9A 3OJUA 4DTRA 1LV5A 2E6LA 3UIQA 4KPYA 1J54A 4M3UA 2VWKA 4OPKA 4CEZA 4QAGA 4FJKA 3VQQA 4C8KA 4BE2A 1WSIA 2OZMA 1HPZA 2RKIA 1FK9A 3MXIA 5J2QA 1G15A 1RT1A 2B5JA 1JLEA 1WSGA 4H4MA 3NHGA 3SPZA 4CJFA 1CXUA 1SV5A 3HL8A 4DTSA 4EZ6A 4B9TA 5CZ2A 1TK8A 2HHSA 2VG6A 3MEDA 3LP1A 1SKSA 2A1RA 4O55A 3CQ8A 3KLIA 3OY9A 4HTUA 4BWJA 1C0MA 4IG3A 3O4NA 4DTMA 1C0TA 3SUPA 4B9MA 2E4LA 4CF0A 4PY5A 1WSHA 3RTVA 4BDYA 3P83D 4EP4A 4RW6A 2HVHA 1T05A 3WNGA 4IBNA 1GOCA 2KW4A 4FJIA 4KB1A 1Q9YA 1Z25A 4RW7A 1DTQA 2XY8A 4M45A 4FJGA 4CHYA 4G1QA 1YVUA 3B6OA 3LP3A 3VQ8A 1ASWA 1Z26A 1ASVA 5J1EA 3JYTA 4Z4EA 4OLAA 1XHXA 4KHYA 3DYAA 1TVRA 3RMBA 3LP2A 3T3FA 4FXDA 3G0ZA 4B9SA 4NCGA 3PUFA 5C24A 3VN5A 2XY5A 3MEEA 3OYJA 1KFSA 2BDPA 1XI1A 3RMDA 3NF8A 1ZBHA 3DI6A 2HVIA 2HHVA 1BQNA 2D0AA 2I5JA 4DTPA 4FVMA 4DG1A 3HPHA 5J2NA 3LPUA 2Z1HA 1SL1A 1SKRA 2HHUA 3M8SA 2OYQA 3DM2A 3TANA 1BI4A 3V9WA 4W5NA 2ZQBA 4FJJA 3QINA 2G8UA 3M8RA 2WONA 1LW2A 4CFDA 3BDPA 4KI4A 5D3GA 1CZ9A 1W9HA 3DOLA 2ITGA 1LAVA 4I9LA 4BWMA 3DRRA 3LAMA 4L8RB 3O3HA 3AA2A 1NJXA 1LAWA 1LWCA 4DTNA 1TL3A 3TARA 1BCOA 4K8ZA 4ICLA 3SV3A 3K57A 3RMAA 1SKWA 3KLEA 1KSPA 2VG5A 2X74A 3F9KA 3OS0A 3C6TA 1YT3A 1U49A 4B9VA 4KI6A 4PUOA 1KVAA 1C1AA 1FKOA 4HUFA 3OS2A 2FBYA 2FBTA 3DLKA 3FFIA 3V1RA 3OJSA 3TWHA 2PYLA 3QIOA 4OVLA 3OYDA 3QNOA 4MQ3A 4CHNA 3VQCA 3TI0A 4DSIA 3O3FA 4YFUA 4H4OA 3SNNA 3V81A 3AVHA 2G8HA 3AV9A 1U4BA 4DU3A 1K6YA 3AVAA 4E7KA 1C1CA 4DTOA 2O4IA 1EKEA 4RW8A 3TAGA 1IKXA 1RT6A 2IGIA 1EETA 4CGDA 4IG0A 4Z4CA 2DFEA 2D0BA 1QSYA 4FZXC 3KLHA 3DLGA 3NF7A 4DTUA 1IH7A 3K2PA 3TAFA 4FM2A 4FZZA 3DMJA 2IS3A 2YKMA 1KRPA 4LSLA 2Y1IA 1KCFA 3AVMA 4F4KA 3RRHA 3SCXA 3KK1A 3MAQA 3P1GA 2HHWA 3OYBA 3KKSA 3ASMA 1KLMA 4KFBA 4LD0A 4J2AA 1N5YA 2ETJA 3LDSA 3SQ0A 4HUGA 3NF6A 4B8CA 1RNHA 4OKEA 2HNDA 4OGEA 4DLEA 2JGUA 4E3SA 1TK5A 1CLQA 2F8SA 3NH0A 1RTDA 2AJQA 3E01A 1J9AA 1VRUA 4CEBA 1YTUA 3LALA 2O4GA 3TAMA 3I8DA 1NKCA 3OS1A 2YV0X 4PA1A 1JL1A 4FJHA 3PO4A 1HQEA 4FCYA 4BE0A 4GMJB 3KLFA 3SJJA 4FW2A 4O0IA 1VSJA 1WAJA 1U48A 3V9XA 3VQ4A 3OYLA 3NBPA 4ZHRA 5KTQA 2X78A 2DFFA 2YHAA 3ZSXA 1EX4A 3QEXA 3SPYA 1D9FA 2G8FA 3RR8A 3AVNA 4KO0A 4O4GA 5CYQA 4CGGA 3O3GA 2RPIA 4FK4A 4OPJA 4ID1A 1HQUA 1RDAA 4ZTFA 3KK3A 4FJMA 4O44A 2FBVA 2OPQA 1D9DA 3IAYA 1U45A 3V4IA 4JS4A 1BHLA 4Y1CA 4M3XA 1HYZA 3ZSVA 1MU2A 4FJ8A 1NK6A 4FJ5A 3L2VA 4O0JA 4AILC 1A5VA 1C1BA 3RWUA 1S6QA 3EZ5A 2FC0A 3ITHA 1WSJA 3VQAA 4Q5VA 1JL2A 4J2BA 4DWIA 3ISNC 4AHUA 3RRGA 2KFNA 1QSSA 3SUQA 2P5GA 4JLHA 1KVBA 3VQDA 3DLEA 3HSTB 2BGGA 4I9QA 5E41A 2G8VA 3SQ1A 1NK9A 3P5JA 1LWEA 4KRFA 4DTJA 4CIFA 2B4JA 1ZYQA 3L2QA 4DQSA 4IFVA 5KGWA 3VQ7A 3DLHA 4E0DA 4F3OA 4FK0A 3L3UA 1L3UA 5FDLA 3TAQA 2HMIA 4CGJA 4HUEA 4DS4A 1RBTA 3CFPA 1WAFA 2B6AA 2ZD1A 1J53A 4KREA 3SV4A 1NKEA 4DF8A 3QEIA 1L3VA 1A5WA 4DLGA 4DTXA 4ELVA 4KV8A 3QLHA 5C42A 2YNFA 1T8EA 3L8BA 4CHQA 1NK4A 3T19A 4I2PA 4B08A 2HHQA 2XO7A 5J2PA 1VSKA 1WSEA 3NAEA 1NJWA 3O4QA 2HHTA 3AVGA 1JLQA 5K14A 4LH4A 1NK7A 1TGOA 3OVNA 4WE1A 4DSLA 3AA4A 4CIGA 1TKXA 3DOKA 1TKZA 3ALYA 3AO4A 2LSNA 4CF1A 3F73A 4FLXA 4E7IA 1T03A 3AA5X 1SL2A 4NCBA 2OPSA 4TSXA 5FROA 4KAZA 1D8YA 4M3TA 4Z4HA 1WN7A 1NJZA 4E1NA 4CK1A 1KFDA 4W5TA 1RT4A 4RG8A 5DK5A 3ULDA 1C6VA 4CEEA 1RDDA 3KIOA 4CF2A 1XWLA 1HRHA 1RTIA 4CHPA 4JRPA 1T7PA 4K8XA 2G8WA 3IS9A 3KKRA 1NJYA 2KFZA 4J2DA 4CK2A 4HCCA 4NCAA 3AVLA 3KLGA 2YNGA 4DFKA 4PWDA 3QESA 4CJ3A 4CK3A 1GOAA 1LWFA 4BE1A 3KTQA 1I39A 5CZ1A 4N47A 1X1PA 2G8IA 2IDOA 1S6PA 2Q3SA 1UA0A 4CJQA 1DLOA 4KHWA 4LH5A 4M3WA 2VWJA 1REVA 4GVMA 4CJVA 2Z1GA 4DSEA 4BDPA 3NDKA 3KD5E 3QNNA 3KD1E 3M8QA 3G10A 4FJLA 2X6SA 1WLJA 2JLEA 3ZSZA 4QCLA 3ZT1A 3KK2A 4E7HA 3L2RA 4CEQA 3AO5A 1SUQA 3CFOA 4OJRA 4B9UA 4DQPA 3QO9A 3ZCMA 4OLBA 1WNSA 4FM0A 1IO2A 5JS1A 4DQQA 1BI4B 4N56A 3L2UA 2OPRA 1TKDA 3V9SA 4N76A 4Z4IA 3C94A 1JLBA 3MXJA 5JS2A 4EP5A 4E7LA 4W5RA 3LPTA 4FLZA 2P1JA 1XHZA 2QXFA 3L2WA 3LWLA 4CE9A 3LAKA 1QTMA 4FYDA 1CZBA 1HNVA 1FXXA 1RDBA 1U04A 2XRIA 3D0PA 3RMCA 3PO5A 1RT7A 5HRPA 4FJNA 1RDCA 2ZE2A 4CFCA 4DSFA 4Z4GA 3LWMA 2KZZA 1TAUA 1NKBA 2DTUA 3VQBA 1QQCA 1TAQA 1UA1A 3HM9A 4CERA 4IKFA 3QEPA 3QEWA 2DY4A 3ZSOA 3NGIA 4JRQA 1S9EA 1VSHA 1NOZA 4Y1DA 4R5PA 4DU4A 1ASUA 2BANA 2XY7A 4CEAA 1C0UA 3HK2A 3HJFA 1ZBIA 4W5QA 3SQ4A 1JLCA 2ATQA 2YNIA 4JS5A 2Z1IA 4C8MA 1TL1A 3ZSRA 1UWBA 2P5OA 4CEDA 4GW6A 4E89A 4E7JA 1RT5A 3I0RA 4FJXA 5HRSA 1VSDA 1SL0A 1S1TA 1JXEA 2GBZA 3PX6A 2F96A 5FRMA 3ZSYA 1FKPA 1HJRA 3WNHA 4CFAA 4FJ7A 3AO2A 3IRXA 5T7BA 2RF2A 4C8OA 4IDKA 4O5BA 3SI6A 3HXMA 4CJ5A 3K5LA 2R7YA 1ZBLA 4M3ZA 3ZSQA 4AHSA 2Z1JA 4KTQA 1YTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AHT A;  3IG1 A;  1A5X A;  1S1V A;  2KTQ A;  3HVT A;  5SZT A;  4OKK A;  1TK0 A;  3V1Q A;  1BQM A;  3CM5 A;  4CGH A;  1JLG A;  2E6M A;  4M3R A;  3OYA A;  3V9Z A;  3AA3 A;  4Q0B A;  3S9H A;  1I3A A;  1B9F A;  4MFB A;  4DS5 A;  3AVJ A;  3ZSW A;  1W0H A;  2YKN A;  3RR7 A;  3PY8 A;  4BAC A;  4CF8 A;  1VSL A;  3ZT3 A;  1VSF A;  4CFB A;  2OZS A;  4B3O A;  3ZT4 A;  1UOC A;  1HYV A;  1RBU A;  2QKB A;  1VSI A;  2YNH A;  4CJ4 A;  3U6F A;  3EY1 A;  3NH1 A;  3HVR A;  5DMR A;  4DSK A;  2KQ2 A;  3C6U A;  3THV A;  2D5R A;  1U47 A;  4KHN A;  4NYN A;  2X6N A;  4E19 A;  4KHQ A;  4YNQ A;  3OYM A;  4BDZ A;  2BE2 A;  4DQR A;  1KLN A;  4AHV A;  4CGF A;  4KHS A;  4FM1 A;  1IG9 A;  4F3T A;  3NH2 A;  3H08 A;  1Q8I A;  3VQ9 A;  3OYF A;  1IKV A;  1RIL A;  5CYM A;  1VSE A;  1S5J A;  1WSF A;  1Y97 A;  3DLR A;  3QER A;  5C25 A;  1HYS A;  2F8T A;  3QEV A;  1JKH A;  2NUB A;  3CYM A;  4FLV A;  1NK8 A;  4CES A;  4B9N A;  4ID5 A;  1O1W A;  4DFM A;  4CIE A;  4N41 A;  4Z0U A;  4XIU A;  1IKW A;  1NK0 A;  4B9L A;  3A2F A;  3V9U A;  2QK9 A;  4CEC A;  3I0S A;  1RBV A;  4CJS A;  1VSM A;  1TV6 A;  3L3V A;  3HPO A;  3C95 A;  1BGX T;  3EYZ A;  4HHT A;  5J2M A;  1Q9X A;  3VA0 A;  1RBS A;  3CG7 A;  3OYG A;  4CF9 A;  3LZI A;  3SZ2 A;  2P51 A;  5HP1 A;  3U3Y A;  1RTH A;  2IC3 A;  4AHR A;  5HBM A;  4E1M A;  3SUO A;  4M41 A;  3VQE A;  1F21 A;  1RBR A;  1BIU A;  2HB5 A;  1X9S A;  1ZBU A;  4PQU A;  3NF9 A;  2W42 A;  3DRS A;  3HT3 A;  2WOM A;  2A1S A;  3HPG A;  1BIZ A;  4KTW A;  2DFH A;  2EHG A;  4RW9 A;  3K58 A;  4DFJ A;  3TAP A;  1NK5 A;  2PYJ A;  3DLB A;  3TAE A;  3MEG A;  4CCH A;  5KRS A;  2HNY A;  1L3S A;  3U3G A;  3AVI A;  2FBX A;  3V1O A;  4M42 A;  1TKT A;  1B9D A;  3LP0 A;  4W5O A;  4DQI A;  3VQP A;  1VK0 A;  4CJP A;  3OYC A;  2HNZ A;  1XC9 A;  4CJE A;  3K5N A;  4HVJ A;  4FK2 A;  3SQ2 A;  2IAJ A;  4CJU A;  3AVK A;  1EXQ A;  1JXB A;  1IKY A;  4UQG A;  3PV8 A;  3HP9 A;  1X9W A;  4J2E A;  1KVC A;  4NYF A;  3OYN A;  4LSN A;  1RT2 A;  4AH9 A;  4CJW A;  4DF4 A;  2Y1J A;  4ELU A;  1S1U A;  1S9G A;  3S3O A;  4B8A B;  1QE1 A;  3AO1 A;  5KI6 A;  3KJV A;  2OA8 A;  4FLU A;  1L3T A;  4EZ9 A;  4FZY A;  4F8R A;  1HMV A;  4M3Y A;  3NFA A;  2OPP A;  2RN2 A;  4CEF A;  4ZTJ A;  3OYK A;  3JSM A;  4CGI A;  5KGX A;  1QSL A;  4FJ9 A;  1QHT A;  4Z4F A;  4LY7 A;  1JLA A;  3LZJ A;  3QIP A;  2PZS A;  5FRN A;  5EU7 A;  5HRO A;  3HO1 A;  3CM6 A;  2GUI A;  2QKK A;  3S3N A;  3CFR A;  4H8K A;  3V6D A;  1UAX A;  3SYZ A;  3D45 A;  2D0C A;  4FLY A;  3BGR A;  4KKO A;  1R0A A;  2KZM A;  3B6P A;  4CEO A;  1DTT A;  5HRR A;  5I42 A;  2XHB A;  5SWM A;  1JLF A;  3PX0 A;  3ZT0 A;  1S1X A;  5I3U A;  4ELT A;  3LAN A;  4I2Q A;  1BL3 A;  3VQ5 A;  3T1A A;  3NCI A;  5HLF A;  4CJR A;  2XY6 A;  3AVB A;  4DSJ A;  3AO3 A;  4CJT A;  4FLT A;  3VA3 A;  1D5A A;  3MXM A;  1N6Q A;  4N5S A;  2PY5 A;  3TR8 A;  3AVC A;  5HRN A;  4I7F A;  1RT3 A;  4KHU A;  4OGC A;  1L5U A;  1X9M A;  3SUN A;  4FLW A;  4CJK A;  3OYH A;  4OKJ A;  1ZBF A;  3K5M A;  3HYF A;  3WNF A;  1VRT A;  4DFP A;  1NOY A;  5KRT A;  2G8K A;  4HCB A;  2YHB A;  4AHC A;  4IFY A;  1S1W A;  3K5O A;  4C8N A;  4CJL A;  1HNI A;  3M8P A;  3DRP A;  3ZT2 A;  5CY4 A;  3NGZ A;  3S3M A;  1B92 A;  1BIS A;  4KTZ A;  3VQ6 A;  4KB0 A;  3TAB A;  4QOZ B;  4F2S A;  3MEC A;  1RCH A;  1J5O A;  3PX4 A;  2HHX A;  1ITG A;  3WNE A;  1BCM A;  3QET A;  1CXQ A;  1EP4 A;  4RW4 A;  3NE6 A;  4C8L A;  1QS4 A;  2VG7 A;  1LW0 A;  4CHZ A;  2HW3 A;  3AVF A;  3OYE A;  3HP6 A;  2EX3 A;  2IOC A;  4DU1 A;  3NGY A;  3K59 A;  3OYI A;  4DMN A;  1GOB A;  1KTQ A;  4F2R A;  4FW1 A;  4CHO A;  1RTJ A;  2GV9 A;  3OJU A;  4DTR A;  1LV5 A;  2E6L A;  3UIQ A;  4KPY A;  1J54 A;  4M3U A;  2VWK A;  4OPK A;  4CEZ A;  4QAG A;  4FJK A;  3VQQ A;  4C8K A;  4BE2 A;  1WSI A;  2OZM A;  1HPZ A;  2RKI A;  1FK9 A;  3MXI A;  5J2Q A;  1G15 A;  1RT1 A;  2B5J A;  1JLE A;  1WSG A;  4H4M A;  3NHG A;  3SPZ A;  4CJF A;  1CXU A;  1SV5 A;  3HL8 A;  4DTS A;  4EZ6 A;  4B9T A;  5CZ2 A;  1TK8 A;  2HHS A;  2VG6 A;  3MED A;  3LP1 A;  1SKS A;  2A1R A;  4O55 A;  3CQ8 A;  3KLI A;  3OY9 A;  4HTU A;  4BWJ A;  1C0M A;  4IG3 A;  3O4N A;  4DTM A;  1C0T A;  3SUP A;  4B9M A;  2E4L A;  4CF0 A;  4PY5 A;  1WSH A;  3RTV A;  4BDY A;  3P83 D;  4EP4 A;  4RW6 A;  2HVH A;  1T05 A;  3WNG A;  4IBN A;  1GOC A;  2KW4 A;  4FJI A;  4KB1 A;  1Q9Y A;  1Z25 A;  4RW7 A;  1DTQ A;  2XY8 A;  4M45 A;  4FJG A;  4CHY A;  4G1Q A;  1YVU A;  3B6O A;  3LP3 A;  3VQ8 A;  1ASW A;  1Z26 A;  1ASV A;  5J1E A;  3JYT A;  4Z4E A;  4OLA A;  1XHX A;  4KHY A;  3DYA A;  1TVR A;  3RMB A;  3LP2 A;  3T3F A;  4FXD A;  3G0Z A;  4B9S A;  4NCG A;  3PUF A;  5C24 A;  3VN5 A;  2XY5 A;  3MEE A;  3OYJ A;  1KFS A;  2BDP A;  1XI1 A;  3RMD A;  3NF8 A;  1ZBH A;  3DI6 A;  2HVI A;  2HHV A;  1BQN A;  2D0A A;  2I5J A;  4DTP A;  4FVM A;  4DG1 A;  3HPH A;  5J2N A;  3LPU A;  2Z1H A;  1SL1 A;  1SKR A;  2HHU A;  3M8S A;  2OYQ A;  3DM2 A;  3TAN A;  1BI4 A;  3V9W A;  4W5N A;  2ZQB A;  4FJJ A;  3QIN A;  2G8U A;  3M8R A;  2WON A;  1LW2 A;  4CFD A;  3BDP A;  4KI4 A;  5D3G A;  1CZ9 A;  1W9H A;  3DOL A;  2ITG A;  1LAV A;  4I9L A;  4BWM A;  3DRR A;  3LAM A;  4L8R B;  3O3H A;  3AA2 A;  1NJX A;  1LAW A;  1LWC A;  4DTN A;  1TL3 A;  3TAR A;  1BCO A;  4K8Z A;  4ICL A;  3SV3 A;  3K57 A;  3RMA A;  1SKW A;  3KLE A;  1KSP A;  2VG5 A;  2X74 A;  3F9K A;  3OS0 A;  3C6T A;  1YT3 A;  1U49 A;  4B9V A;  4KI6 A;  4PUO A;  1KVA A;  1C1A A;  1FKO A;  4HUF A;  3OS2 A;  2FBY A;  2FBT A;  3DLK A;  3FFI A;  3V1R A;  3OJS A;  3TWH A;  2PYL A;  3QIO A;  4OVL A;  3OYD A;  3QNO A;  4MQ3 A;  4CHN A;  3VQC A;  3TI0 A;  4DSI A;  3O3F A;  4YFU A;  4H4O A;  3SNN A;  3V81 A;  3AVH A;  2G8H A;  3AV9 A;  1U4B A;  4DU3 A;  1K6Y A;  3AVA A;  4E7K A;  1C1C A;  4DTO A;  2O4I A;  1EKE A;  4RW8 A;  3TAG A;  1IKX A;  1RT6 A;  2IGI A;  1EET A;  4CGD A;  4IG0 A;  4Z4C A;  2DFE A;  2D0B A;  1QSY A;  4FZX C;  3KLH A;  3DLG A;  3NF7 A;  4DTU A;  1IH7 A;  3K2P A;  3TAF A;  4FM2 A;  4FZZ A;  3DMJ A;  2IS3 A;  2YKM A;  1KRP A;  4LSL A;  2Y1I A;  1KCF A;  3AVM A;  4F4K A;  3RRH A;  3SCX A;  3KK1 A;  3MAQ A;  3P1G A;  2HHW A;  3OYB A;  3KKS A;  3ASM A;  1KLM A;  4KFB A;  4LD0 A;  4J2A A;  1N5Y A;  2ETJ A;  3LDS A;  3SQ0 A;  4HUG A;  3NF6 A;  4B8C A;  1RNH A;  4OKE A;  2HND A;  4OGE A;  4DLE A;  2JGU A;  4E3S A;  1TK5 A;  1CLQ A;  2F8S A;  3NH0 A;  1RTD A;  2AJQ A;  3E01 A;  1J9A A;  1VRU A;  4CEB A;  1YTU A;  3LAL A;  2O4G A;  3TAM A;  3I8D A;  1NKC A;  3OS1 A;  2YV0 X;  4PA1 A;  1JL1 A;  4FJH A;  3PO4 A;  1HQE A;  4FCY A;  4BE0 A;  4GMJ B;  3KLF A;  3SJJ A;  4FW2 A;  4O0I A;  1VSJ A;  1WAJ A;  1U48 A;  3V9X A;  3VQ4 A;  3OYL A;  3NBP A;  4ZHR A;  5KTQ A;  2X78 A;  2DFF A;  2YHA A;  3ZSX A;  1EX4 A;  3QEX A;  3SPY A;  1D9F A;  2G8F A;  3RR8 A;  3AVN A;  4KO0 A;  4O4G A;  5CYQ A;  4CGG A;  3O3G A;  2RPI A;  4FK4 A;  4OPJ A;  4ID1 A;  1HQU A;  1RDA A;  4ZTF A;  3KK3 A;  4FJM A;  4O44 A;  2FBV A;  2OPQ A;  1D9D A;  3IAY A;  1U45 A;  3V4I A;  4JS4 A;  1BHL A;  4Y1C A;  4M3X A;  1HYZ A;  3ZSV A;  1MU2 A;  4FJ8 A;  1NK6 A;  4FJ5 A;  3L2V A;  4O0J A;  4AIL C;  1A5V A;  1C1B A;  3RWU A;  1S6Q A;  3EZ5 A;  2FC0 A;  3ITH A;  1WSJ A;  3VQA A;  4Q5V A;  1JL2 A;  4J2B A;  4DWI A;  3ISN C;  4AHU A;  3RRG A;  2KFN A;  1QSS A;  3SUQ A;  2P5G A;  4JLH A;  1KVB A;  3VQD A;  3DLE A;  3HST B;  2BGG A;  4I9Q A;  5E41 A;  2G8V A;  3SQ1 A;  1NK9 A;  3P5J A;  1LWE A;  4KRF A;  4DTJ A;  4CIF A;  2B4J A;  1ZYQ A;  3L2Q A;  4DQS A;  4IFV A;  5KGW A;  3VQ7 A;  3DLH A;  4E0D A;  4F3O A;  4FK0 A;  3L3U A;  1L3U A;  5FDL A;  3TAQ A;  2HMI A;  4CGJ A;  4HUE A;  4DS4 A;  1RBT A;  3CFP A;  1WAF A;  2B6A A;  2ZD1 A;  1J53 A;  4KRE A;  3SV4 A;  1NKE A;  4DF8 A;  3QEI A;  1L3V A;  1A5W A;  4DLG A;  4DTX A;  4ELV A;  4KV8 A;  3QLH A;  5C42 A;  2YNF A;  1T8E A;  3L8B A;  4CHQ A;  1NK4 A;  3T19 A;  4I2P A;  4B08 A;  2HHQ A;  2XO7 A;  5J2P A;  1VSK A;  1WSE A;  3NAE A;  1NJW A;  3O4Q A;  2HHT A;  3AVG A;  1JLQ A;  5K14 A;  4LH4 A;  1NK7 A;  1TGO A;  3OVN A;  4WE1 A;  4DSL A;  3AA4 A;  4CIG A;  1TKX A;  3DOK A;  1TKZ A;  3ALY A;  3AO4 A;  2LSN A;  4CF1 A;  3F73 A;  4FLX A;  4E7I A;  1T03 A;  3AA5 X;  1SL2 A;  4NCB A;  2OPS A;  4TSX A;  5FRO A;  4KAZ A;  1D8Y A;  4M3T A;  4Z4H A;  1WN7 A;  1NJZ A;  4E1N A;  4CK1 A;  1KFD A;  4W5T A;  1RT4 A;  4RG8 A;  5DK5 A;  3ULD A;  1C6V A;  4CEE A;  1RDD A;  3KIO A;  4CF2 A;  1XWL A;  1HRH A;  1RTI A;  4CHP A;  4JRP A;  1T7P A;  4K8X A;  2G8W A;  3IS9 A;  3KKR A;  1NJY A;  2KFZ A;  4J2D A;  4CK2 A;  4HCC A;  4NCA A;  3AVL A;  3KLG A;  2YNG A;  4DFK A;  4PWD A;  3QES A;  4CJ3 A;  4CK3 A;  1GOA A;  1LWF A;  4BE1 A;  3KTQ A;  1I39 A;  5CZ1 A;  4N47 A;  1X1P A;  2G8I A;  2IDO A;  1S6P A;  2Q3S A;  1UA0 A;  4CJQ A;  1DLO A;  4KHW A;  4LH5 A;  4M3W A;  2VWJ A;  1REV A;  4GVM A;  4CJV A;  2Z1G A;  4DSE A;  4BDP A;  3NDK A;  3KD5 E;  3QNN A;  3KD1 E;  3M8Q A;  3G10 A;  4FJL A;  2X6S A;  1WLJ A;  2JLE A;  3ZSZ A;  4QCL A;  3ZT1 A;  3KK2 A;  4E7H A;  3L2R A;  4CEQ A;  3AO5 A;  1SUQ A;  3CFO A;  4OJR A;  4B9U A;  4DQP A;  3QO9 A;  3ZCM A;  4OLB A;  1WNS A;  4FM0 A;  1IO2 A;  5JS1 A;  4DQQ A;  1BI4 B;  4N56 A;  3L2U A;  2OPR A;  1TKD A;  3V9S A;  4N76 A;  4Z4I A;  3C94 A;  1JLB A;  3MXJ A;  5JS2 A;  4EP5 A;  4E7L A;  4W5R A;  3LPT A;  4FLZ A;  2P1J A;  1XHZ A;  2QXF A;  3L2W A;  3LWL A;  4CE9 A;  3LAK A;  1QTM A;  4FYD A;  1CZB A;  1HNV A;  1FXX A;  1RDB A;  1U04 A;  2XRI A;  3D0P A;  3RMC A;  3PO5 A;  1RT7 A;  5HRP A;  4FJN A;  1RDC A;  2ZE2 A;  4CFC A;  4DSF A;  4Z4G A;  3LWM A;  2KZZ A;  1TAU A;  1NKB A;  2DTU A;  3VQB A;  1QQC A;  1TAQ A;  1UA1 A;  3HM9 A;  4CER A;  4IKF A;  3QEP A;  3QEW A;  2DY4 A;  3ZSO A;  3NGI A;  4JRQ A;  1S9E A;  1VSH A;  1NOZ A;  4Y1D A;  4R5P A;  4DU4 A;  1ASU A;  2BAN A;  2XY7 A;  4CEA A;  1C0U A;  3HK2 A;  3HJF A;  1ZBI A;  4W5Q A;  3SQ4 A;  1JLC A;  2ATQ A;  2YNI A;  4JS5 A;  2Z1I A;  4C8M A;  1TL1 A;  3ZSR A;  1UWB A;  2P5O A;  4CED A;  4GW6 A;  4E89 A;  4E7J A;  1RT5 A;  3I0R A;  4FJX A;  5HRS A;  1VSD A;  1SL0 A;  1S1T A;  1JXE A;  2GBZ A;  3PX6 A;  2F96 A;  5FRM A;  3ZSY A;  1FKP A;  1HJR A;  3WNH A;  4CFA A;  4FJ7 A;  3AO2 A;  3IRX A;  5T7B A;  2RF2 A;  4C8O A;  4IDK A;  4O5B A;  3SI6 A;  3HXM A;  4CJ5 A;  3K5L A;  2R7Y A;  1ZBL A;  4M3Z A;  3ZSQ A;  4AHS A;  2Z1J A;  4KTQ A;  1YTA A; 
#chains in the Genus database with same CATH topology
 3IG1 A;  1A5X A;  2KTQ A;  3LDO A;  3VF6 A;  1BUP A;  1JLG A;  4M3R A;  4FWS A;  1B9F A;  4AM6 A;  3AVJ A;  3ZSW A;  3PY8 A;  2YCH A;  4B3O A;  3ZT4 A;  4XH5 A;  2RHK A;  3EY1 A;  4F9O A;  1E3M A;  3THV A;  1U47 A;  4BQL A;  4KHN A;  4E19 A;  3CCL N;  5IT9 O;  2BE2 A;  5JLH A;  5KPZ A;  3NH2 A;  3H08 A;  4BR5 A;  3E66 A;  3VQ9 A;  3U3Y A;  3FFK B;  1VSE A;  3W0L A;  2E88 A;  1YHQ N;  2F8T A;  3QEV A;  3CYM A;  4CIE A;  1NK0 A;  1IKW A;  4DV4 K;  1VQ4 N;  3V9U A;  2QTD A;  2QK9 A;  4CEC A;  4CJS A;  1VSM A;  4AQY K;  1BGX T;  4HHT A;  1HLU A;  3CG7 A;  4ILH A;  4A5A A;  3LZI A;  1RTH A;  4FPA A;  5HBM A;  4E1M A;  3SUO A;  4M41 A;  5GAH P;  1F21 A;  4H0P A;  1ZBU A;  3FZM A;  5KPT A;  3HPG A;  3O1W A;  3TAP A;  3K58 A;  4DFJ A;  4JV5 K;  3TAE A;  4G9Z A;  2E5L K;  1L3S A;  3U3G A;  4MO5 A;  3C6H A;  4W5O A;  4LF9 K;  4B3R K;  1XC9 A;  3L0Q A;  1J6Z A;  1EXQ A;  4BQZ A;  3HP9 A;  4A57 A;  4X64 K;  4NYF A;  3OYN A;  2NRW A;  4DF4 A;  4AH9 A;  2WUS A;  5HOO A;  1S1U A;  1S9G A;  2P9P A;  4B8A B;  3UKU A;  3AO1 A;  1L3T A;  4FVU A;  1E4G T;  4CEF A;  4FJ9 A;  2P9N A;  2PZS A;  2QKK A;  2CH6 A;  3V6D A;  1UAX A;  2ASO A;  3D45 A;  3KWG A;  2YHY A;  4JYA K;  1R0A A;  1NJI O;  2KZM A;  4GKK K;  1JLF A;  4NXM K;  3KHY A;  1RDU A;  3VQ5 A;  4KHP K;  3NCI A;  2XY6 A;  3ZEU B;  1P8Z A;  2D4W A;  3AO3 A;  4DR5 K;  4FLT A;  3VA3 A;  4DKW A;  3AVC A;  5LL6 Z;  1K8K B;  1XNQ K;  1YF5 L;  4YOR A;  1ZBF A;  3HYF A;  3WNF A;  3T1Y K;  4DR6 K;  4AHC A;  1HNX K;  4CJL A;  3QBX A;  3M8P A;  3NGZ A;  3S3M A;  1NMD A;  4FWR A;  2HF4 A;  1VQ6 N;  2O8C B;  1QHA A;  4DCH A;  2NRT A;  2HHX A;  3WNE A;  3QET A;  1CXQ A;  1EP4 A;  4BR2 A;  1QS4 A;  4WF9 L;  4HWI A;  4CHZ A;  3O4W A;  3AVF A;  3DXK A;  1DGK N;  1NGJ A;  1LOT B;  5EOY A;  3OYI A;  3WQT A;  1GOB A;  4CHO A;  3HM8 A;  4DTR A;  4GV3 A;  4FJK A;  1WSI A;  3MXI A;  5J2Q A;  1RT1 A;  2B5J A;  3SPZ A;  2E2O A;  4CJF A;  4IOA L;  1SV5 A;  5AQI A;  1TK8 A;  4R79 A;  3LP1 A;  3MMV A;  3WXK A;  4O55 A;  3OY9 A;  4BWJ A;  3O4N A;  3CCU N;  3THX B;  5AQY A;  3WNG A;  4IBN A;  1GOC A;  3SBT A;  3CJC A;  2UUC K;  3LP3 A;  1ASV A;  4Z4E A;  4PKG A;  3A5L C;  4C1N K;  4FXD A;  4B9S A;  4JKA A;  5AR0 A;  2I7P A;  3MEE A;  3ZLJ A;  1XI1 A;  4X62 K;  3DI6 A;  3D7E O;  4MDA A;  1BQN A;  2HHV A;  3LPU A;  3DXM A;  4DV6 K;  3V9W A;  3JAM O;  4W5N A;  2ZQB A;  4YY3 K;  4FJJ A;  4LF4 K;  1SZ2 A;  3BDP A;  3DJC A;  3DRR A;  4WQ5 A;  1LWC A;  2ZJQ L;  1TL3 A;  1BCO A;  3PSF A;  3H1Q A;  1OH6 A;  2X74 A;  3OS0 A;  3THW A;  1YT3 A;  2FBY A;  4LFC K;  4A2A A;  5I9E B;  3PIO L;  4B9Q A;  4QS8 A;  2YHX A;  3VQC A;  1NMN A;  3SNN A;  2G8H A;  3AV9 A;  1U4B A;  4DU3 A;  1XNR K;  4GKJ K;  1QQO A;  4BRP A;  4B3M K;  3ID8 A;  2ZM6 K;  3LDL A;  3TAG A;  1IKX A;  2IGI A;  4Z4C A;  3DLL L;  2GTD A;  1VQL N;  3NF7 A;  4DTU A;  4RTF D;  3K2P A;  4FZZ A;  5DM7 L;  2P9I A;  2YKM A;  1KRP A;  2O8D A;  4LSL A;  2Y1I A;  3RRH A;  2F9T A;  4IDH A;  3OYB A;  3CPW M;  1IBK K;  4J2A A;  3EO3 A;  4HUG A;  4C1N I;  4OKE A;  4OGE A;  4YOT A;  1CLQ A;  2GEL A;  3P38 A;  3NH0 A;  4JI4 K;  3E01 A;  2ASM A;  1O13 A;  5BPL A;  3I8D A;  3DWL A;  2KKZ A;  3TPQ A;  4FJH A;  4GMJ B;  3KLF A;  3SJJ A;  3O8M A;  1WAJ A;  3NBP A;  5KTQ A;  1ATN A;  1D9F A;  1WB9 A;  4KO0 A;  4FK4 A;  3O3G A;  1GLL O;  4BRC A;  2P9K A;  4BG9 A;  1D9D A;  1ZXO A;  2OPQ A;  3IAY A;  1KXP A;  3V4I A;  1BHL A;  2NRV A;  1HYZ A;  3FZF A;  3AY9 A;  4IXC A;  1NK6 A;  4FJ5 A;  1VQO N;  4O0J A;  2Q0R A;  1S6Q A;  3KZB A;  3VQA A;  4Q5V A;  4MO4 A;  1E4F T;  3BF1 A;  2KFN A;  3RRG A;  3VQD A;  4FL9 A;  2BGG A;  3SJH A;  4JI8 K;  5E41 A;  3P5J A;  4CIF A;  1P90 A;  4JD2 B;  1ZYQ A;  1HNW K;  4IFV A;  3VQ7 A;  4E0D A;  4F3O A;  1NGD A;  1L3U A;  4HUE A;  1WAF A;  2ZD1 A;  4KRE A;  4YHH K;  4KBO A;  3QEI A;  1SAZ A;  5B8H A;  2P9L B;  4DTX A;  1G99 A;  3BY5 A;  5LJW A;  2YNF A;  3L8B A;  4CHQ A;  3OTO K;  4I2P A;  2HHQ A;  5J2P A;  4JI0 K;  1JLQ A;  1QZ5 A;  5K14 A;  2FSK A;  3OVN A;  3AA4 A;  4M3Y A;  4CF1 A;  1SL2 A;  3UB5 A;  2OPS A;  4PL8 A;  2VQE K;  5GAG P;  4M3T A;  4E1N A;  4CZI A;  4CEE A;  4IOC L;  3VF4 A;  2FF3 B;  1T7P A;  2G8W A;  1NJY A;  2KFZ A;  4NCA A;  3KLG A;  2O8F A;  5JVG L;  1Q81 O;  3ENH A;  1I39 A;  3S41 A;  2G8I A;  4WFA L;  2FF6 A;  4CJQ A;  4JKC A;  4CJV A;  3KD1 E;  3O9T A;  4FJL A;  1N32 K;  3ZSZ A;  2Q1N A;  3M1F A;  1SUQ A;  4DQP A;  4OLB A;  4FM0 A;  3FLC O;  1HX1 A;  3D2E A;  2Q97 A;  4N76 A;  1ATR A;  3C94 A;  3MXJ A;  3CMA N;  2UUB K;  3LPT A;  4XEI A;  2QXF A;  4GV9 A;  4JI5 K;  1KAY A;  3VEO A;  3VEN A;  4CE9 A;  3LAK A;  4Y0W A;  5C2F A;  4DSF A;  3CJ9 A;  1TAU A;  2QXL A;  1UA1 A;  3AGK A;  5AQF A;  1IJJ A;  3QEW A;  2DY4 A;  3TSQ A;  1S9E A;  4DU4 A;  1NOZ A;  4Y1D A;  4CEA A;  4H5R A;  3F2K A;  3NVM A;  4JS5 A;  4DV0 K;  3ZSR A;  2VGM A;  4CED A;  4BR4 A;  3I0R A;  3WT0 A;  2IVP A;  2F96 A;  4EAH D;  3ZSY A;  3WNH A;  3IRX A;  3C7N A;  3CCE N;  3Q7B A;  5BN9 A;  1ZBL A;  2QWN A;  2Q0U A;  4CZM A;  1VQM N;  1YTA A;  3SV3 A;  1S1V A;  3HVT A;  5SZT A;  2E8A A;  3V1Q A;  3AGR A;  4DUZ K;  4CGH A;  1WBD A;  1I3A A;  3CF5 L;  4FWP A;  4DS5 A;  2YKN A;  1K9M O;  4BAC A;  2HOE A;  3KWI A;  1VSF A;  1JCF A;  1RGI A;  5DMR A;  2KQ2 A;  3C6U A;  4I6M A;  2ASP A;  4BDZ A;  2QA4 N;  4CGF A;  3A0I X;  1W97 L;  3ULE B;  3DLR A;  1HYS A;  5C25 A;  1JKH A;  2O8E B;  5FLX O;  3HRG A;  4B9N A;  4DV7 K;  4DFM A;  4B9L A;  4JHD B;  4E7L A;  3MWP A;  1RBV A;  1L5U A;  1TV6 A;  3C95 A;  2JWL A;  2HB5 A;  2HHH K;  4CJ7 A;  5AFU A;  3HT3 A;  2CGJ A;  2HBK A;  4FWL A;  3N4Q A;  4YDU A;  3CI5 A;  4CD1 A;  4KTW A;  3A5N C;  3D2F A;  3JXU A;  3QIC A;  2HBL A;  4CCH A;  5KRS A;  3ZYY X;  4BGB A;  2FBX A;  2W40 A;  4M42 A;  1TKT A;  3K9K A;  3LP0 A;  3OYC A;  4CJP A;  1IBM K;  3K5N A;  2V7Y A;  3AVK A;  2IVN A;  4BC2 A;  1JXB A;  1IKY A;  4UQG A;  3PV8 A;  1X9W A;  1T44 A;  3QB0 A;  4CJW A;  4ELU A;  4H0V B;  1QE1 A;  5KI6 A;  4F8R A;  1HMV A;  3NFA A;  2RN2 A;  5H1S Q;  1QSL A;  4CGI A;  4Z4F A;  5FRN A;  1JLA A;  3LZJ A;  3QIP A;  5CE3 A;  3THY B;  2YI1 A;  4H8K A;  1MWM A;  4FLY A;  3BGR A;  4KKO A;  2O8E A;  3HI0 A;  3J80 O;  4ELT A;  3OA9 A;  3CCR N;  5JLF A;  4L3Q A;  2UU9 K;  5HLF A;  3JS6 A;  4DSJ A;  1GLC G;  3WEE B;  3MXM A;  4N5S A;  3VF2 A;  2VWB A;  1HR0 K;  3ATV A;  1H1V A;  2ZGZ A;  1X9M A;  4FLW A;  2A6A A;  5KRT A;  2G8K A;  1S72 N;  4PKH A;  1HNI A;  3ZT2 A;  1CZA N;  5CY4 A;  3D6R A;  5DM6 L;  1BIS A;  4KTZ A;  4KB0 A;  3TAB A;  3MEC A;  4U7B A;  3CD6 N;  3MX5 A;  1ITG A;  3HBT A;  4C8L A;  3NE6 A;  4CZG A;  2WBN A;  4FWO A;  5BRD A;  1LW0 A;  5AQK A;  3OYE A;  3HP6 A;  3VEV A;  2IOC A;  2PBD A;  4DU1 A;  3K59 A;  1EO1 A;  3OW2 M;  4M3U A;  2QM1 A;  2UXB K;  4AM7 A;  4C8K A;  4A62 A;  1U2V A;  2OZM A;  5BPM A;  2RKI A;  4H5T A;  3O1B A;  4JEP A;  4EZ6 A;  2GX9 A;  1ATS A;  5LMU K;  4A61 A;  5CZ2 A;  4B9T A;  1SQK A;  2OCE A;  1SKS A;  1NM1 A;  1C0M A;  1KAX A;  4DTM A;  2E4L A;  4CF0 A;  1WSH A;  3RTV A;  3P83 D;  1IV0 A;  3G4S N;  3QFU A;  4FO0 A;  2KW4 A;  1BU6 O;  4RW7 A;  3VOV A;  2XY8 A;  4M45 A;  3B6O A;  2UUA K;  3SLC A;  3VQ8 A;  1ASW A;  3Q7C A;  3RSE B;  3ATU A;  4BC3 A;  3PUF A;  1NNE A;  3MDQ A;  3VEX A;  2HVI A;  3WXL A;  4BRF A;  2I5J A;  4DTP A;  3HPH A;  1SL1 A;  1Q18 A;  2OYQ A;  5TKW A;  1SS6 A;  4BRI A;  4C23 A;  2WON A;  3M8R A;  1LW2 A;  1YVN A;  5D3G A;  1CZ9 A;  1LAV A;  4IFE A;  3LAM A;  4M7X A;  3AA2 A;  3TAR A;  4WQ4 A;  3K57 A;  3RMA A;  4YOW A;  5AQR A;  3MX2 A;  5AQU A;  4E1J A;  1XQS C;  4BRO A;  4B9V A;  4KTQ A;  3GE1 A;  3OS2 A;  3OJS A;  2OAN A;  3MWT A;  4MQ3 A;  2ZJP L;  3OBW A;  3O3F A;  4CI6 A;  4ISF A;  4E7K A;  1NGC A;  4DTO A;  3SBG A;  2O4I A;  2F9W A;  1NLV A;  4LF8 K;  4JKH A;  5F2R A;  1EET A;  4B1V A;  4FZX C;  2D0B A;  3KLH A;  1K8A O;  3VPZ A;  4FM2 A;  2IS3 A;  3VTI A;  1Y64 A;  4FSV A;  3SCX A;  3KK1 A;  3P4I A;  4DR1 K;  2P9S B;  1KLM A;  4KFB A;  1N5Y A;  1K73 O;  3L4Q A;  2HND A;  4E3S A;  1TK5 A;  4IWV A;  5F0X A;  5E84 A;  3TAM A;  1MDU B;  2F7T A;  2YV0 X;  4CZK A;  4FCY A;  1HNZ K;  4FW2 A;  3VQ4 A;  4ZHR A;  2DFF A;  5EXW A;  1EX4 A;  1VHX A;  4DV5 K;  4CGG A;  5C2D A;  4OPJ A;  4ID1 A;  3KK3 A;  4FJM A;  5AQH A;  2FBV A;  4JS4 A;  4M3X A;  3THY A;  3VES A;  1OKJ A;  2HBM A;  4DR4 K;  4LFA K;  5AQG A;  3TTD A;  2E20 A;  4AIL C;  3RWU A;  2FC0 A;  4J2B A;  1WSJ A;  3MN6 A;  4J8F A;  3O5B A;  5AFU H;  3ISN C;  3O9Q A;  1YIT N;  4AHU A;  1QSS A;  4JLH A;  3DLE A;  3HST B;  4I9Q A;  4H0X B;  4KRF A;  1TYQ A;  1OH8 A;  4DQS A;  5KGW A;  2P9L A;  3LM2 A;  2QWR A;  4CGJ A;  4DS4 A;  2B6A A;  2WC9 A;  1N34 K;  4DF8 A;  2GUP A;  4O8U A;  4BRQ A;  4KV8 A;  4A2B A;  4EIA A;  5C42 A;  1EWQ A;  1T8E A;  3CJ7 A;  1MWK A;  4B08 A;  3BZK A;  4RCH A;  1NBW A;  1WSE A;  3O4Q A;  3H3O B;  4QS7 A;  2BTF A;  3CC2 N;  4CIG A;  4E7I A;  3DOK A;  3EE9 A;  4NCB A;  5AQM A;  5FRO A;  4KAZ A;  4Z4H A;  1NJZ A;  4PL7 A;  4CK1 A;  1KFD A;  4W5T A;  3ULD A;  2NZT A;  1TUY A;  1RDD A;  4DHY A;  4CF2 A;  1XWL A;  4CHP A;  4OX9 K;  4K25 A;  2YNG A;  4GV6 A;  3H1V X;  3QES A;  4CJ3 A;  4CK3 A;  3U4L A;  5CZ1 A;  4N47 A;  1UA0 A;  1DLO A;  3ID6 A;  4KHW A;  1KQS M;  4JK7 A;  2Z1G A;  3NDK A;  5AQJ A;  3QNN A;  3VEZ A;  2JLE A;  4V19 S;  1YUW A;  3CC7 N;  3L2R A;  3AO5 A;  3R1X A;  4OJR A;  4B9U A;  3QO9 A;  1WNS A;  1IO2 A;  5JS1 A;  4JI2 K;  1BI4 B;  3SAG A;  4N56 A;  2PFU A;  3V9S A;  4K42 A;  1JLB A;  4H5N A;  5C15 A;  2NLX A;  3MK6 A;  1XHZ A;  4JKB A;  3L2W A;  5FPE A;  2KHO A;  3DAW A;  1CZB A;  1HNV A;  1FXX A;  1U04 A;  3D0P A;  3RMC A;  2ZE2 A;  4Z4G A;  2EWS A;  1C0G A;  3AAR A;  5FPM A;  3OBY A;  2DTU A;  3VQB A;  2P9U B;  3QEP A;  5JIC A;  4IO8 A;  3NGI A;  1VSH A;  2Q2R A;  2J4R A;  1Q7Y O;  1ZBI A;  1FW6 A;  3C65 A;  1UWB A;  2YHW A;  4JD2 A;  3WXJ A;  3WUH A;  1TYQ B;  3FE1 A;  3VGK A;  2ZJR L;  5M1P A;  3PX6 A;  2GBZ A;  1FKP A;  2QWP A;  4CFA A;  1EWR A;  1Q86 O;  4C8O A;  4O5B A;  4AF1 A;  3H6E A;  3E1Y A;  4K41 A;  3ZSQ A;  1VQN N;  4ILG B;  4KHQ A;  2WFB A;  4LC9 B;  4BC5 A;  4OKK A;  5C10 A;  1BQM A;  3CM5 A;  5TKY A;  3TTF A;  4Q0B A;  3AA3 A;  3I55 N;  4MFB A;  2E2N A;  2E1Y A;  4BGA A;  1W0H A;  1DEJ A;  3RR7 A;  4CF8 A;  3ZT3 A;  4JAX A;  5LMN K;  1YJW N;  3U9Z A;  3GBT A;  1RBU A;  3LL3 A;  3O08 A;  4BVP A;  1HKG A;  3U6F A;  3HVR A;  5AZJ B;  4YNQ A;  1KLN A;  4AHV A;  4FM1 A;  1IG9 A;  1Q8I A;  4YOU A;  3OYF A;  1RIL A;  1IBL K;  1Z6R A;  1TUU A;  3TSP A;  2NUB A;  2HBJ A;  4FLV A;  3H3N O;  1NK8 A;  2VQF K;  1O1W A;  1J5E K;  2NRH A;  4Z0U A;  4PY5 A;  3A2F A;  3FZK A;  3L3V A;  5AJ3 K;  4CBX A;  3HPO A;  5J2M A;  4A5B A;  1Q9X A;  3VA0 A;  3OYG A;  4CF9 A;  3SZ2 A;  5HP1 A;  4AHR A;  1X9S A;  3CCQ N;  1RBR A;  1BIU A;  3IKM A;  3CQX A;  3NF9 A;  2W42 A;  4NXN K;  2A1S A;  1BIZ A;  1V4T A;  3FZL A;  2PYJ A;  3DLB A;  1NK5 A;  3BP8 A;  3MEG A;  3AVI A;  3V1O A;  4DQI A;  3EZW A;  3VQP A;  2BH1 A;  5CR4 A;  4YDU C;  4CJE A;  1XMO K;  3SQ2 A;  1QVF M;  4CJU A;  4CZE A;  3O9U A;  1KVC A;  2P9I B;  5LY3 A;  4EZ9 A;  5C0Y A;  5AZJ A;  4FZY A;  1GLD G;  1BA1 A;  3ZX3 A;  4ZTJ A;  5AQT A;  5HL7 L;  5AQZ A;  1GLE G;  5EU7 A;  5HRO A;  3HO1 A;  2GUI A;  4JK8 A;  3A5M C;  3CFR A;  4DB3 A;  1YJ9 N;  5KPR A;  4CEO A;  1DTT A;  5HRR A;  1JJ2 M;  3O6W A;  3ZET B;  3PSI A;  4H03 B;  5I3U A;  3ENB A;  2Q36 A;  4BC4 A;  3L6Q A;  4DR7 K;  4EHT A;  5ADX A;  4CJT A;  2NRR A;  3IMX A;  3TR8 A;  4I7F A;  1RT3 A;  4LF7 K;  4KHU A;  3ZX0 A;  3ZEU A;  4FWN A;  3SUN A;  3K5M A;  5BR8 K;  4HCB A;  2YHB A;  4MDB A;  4NLC A;  1ZBS A;  4C8N A;  4BR0 A;  5MLC Q;  5EY4 A;  3J7Y P;  4YOV A;  1B92 A;  3VQ6 A;  4CZJ A;  4IJN A;  1J5O A;  1VQP N;  4RW4 A;  2IIR A;  3TSU A;  3IUC A;  2VG7 A;  2HW3 A;  3FR0 A;  4JI1 K;  1YAG A;  2ZF5 O;  3NGY A;  1NU0 A;  1KTQ A;  3WQU A;  2WTU A;  4FW1 A;  3CHW A;  4K43 A;  1RTJ A;  2GV9 A;  3OJU A;  3UIQ A;  2E6L A;  4DR3 K;  1J54 A;  1GLB G;  2VWK A;  4DV1 K;  4QAG A;  3VQQ A;  1NGG A;  4BE2 A;  1V4S A;  1W2B M;  1HPZ A;  5AQP A;  4BVO A;  2BUP A;  1JLE A;  3NHG A;  3OHR A;  1NGF A;  4OPA A;  3MED A;  4DQ8 A;  2ZGY A;  4LF6 K;  3CQ8 A;  3KLI A;  4HTU A;  3G25 A;  4IG3 A;  2IVO A;  4NO7 A;  4JKF A;  3U9D A;  3SUP A;  5GIN A;  1X3M A;  2FLO A;  1N33 K;  4BDY A;  5BRE A;  4EP4 A;  1T05 A;  2YX6 A;  3VMF B;  4FJI A;  3IDH A;  3WXM B;  3C6A A;  1S22 A;  4JN4 A;  4FJG A;  4GY2 B;  1YVU A;  3LM9 A;  3JYT A;  1Z26 A;  1OVQ A;  2QWO A;  1XHX A;  4KHY A;  3DYA A;  4JI6 K;  5GAE P;  4IZ9 A;  4NB4 A;  3EE8 A;  3T3F A;  3G0Z A;  4PHT X;  2XY5 A;  2P9S A;  3TTC A;  3HOS A;  2NRX A;  2OTL N;  2BDP A;  1OH7 A;  3RMD A;  3NF8 A;  2D0A A;  1IG8 A;  4FVM A;  1QVG M;  2ITM A;  1SKR A;  3DXK B;  2HHU A;  4M63 C;  1HJO A;  3TAN A;  1BI4 A;  1YIJ N;  4B1Y B;  3WEE A;  2QI2 A;  4JHD A;  4CFD A;  3DOL A;  4BWM A;  4B1W B;  1XUP O;  2AP1 A;  1NJX A;  1LAW A;  4DTN A;  4K8Z A;  1KD1 O;  3WXI A;  1SKW A;  3KLE A;  4BRL A;  2VG5 A;  4JNE A;  1VQ5 N;  3F9K A;  3CJA A;  1U49 A;  4KI6 A;  4PUO A;  4HUF A;  3QIO A;  3THW B;  4IEE A;  3TI0 A;  4YFU A;  3AVH A;  3FGU A;  3AVA A;  1C1C A;  1EKE A;  1RT6 A;  4CGD A;  4IG0 A;  3HSC A;  4DV2 K;  3LDN A;  3VEW A;  1DKG D;  3CQY A;  3TAF A;  3G6E N;  1NG9 A;  5FPD A;  3HOT A;  1KCF A;  3AVM A;  2D1K A;  4F4K A;  3HTV A;  3P1G A;  2VGN A;  4O8K A;  3ASM A;  3AAQ A;  4CZF A;  1T6C A;  2ETJ A;  2A41 A;  3NF6 A;  4H5V A;  4DLE A;  4O5F A;  4IJA A;  1NGB A;  2F8S A;  4DV3 K;  2A42 A;  5C12 A;  3GDQ A;  1YTU A;  4IEI A;  1NKC A;  3AAP A;  3OS1 A;  4CZH A;  5ELZ A;  3PO4 A;  1HQE A;  4BE0 A;  5BR9 A;  4IOX A;  2DPN A;  4O0I A;  1U48 A;  1X3N A;  3V9X A;  5BPN A;  3OYL A;  2X78 A;  2YHA A;  3SPY A;  4X66 K;  5CYQ A;  4YOX A;  4BRH A;  2RPI A;  3ULE A;  1HQU A;  1C0F A;  4ZTF A;  3LDQ A;  1U45 A;  4Y1C A;  1MU2 A;  3K9J A;  3BZC A;  4XH1 A;  3L2V A;  1GLF O;  3EZ5 A;  1JL2 A;  3ZX2 A;  3SUQ A;  4BR7 A;  2AA4 A;  4B3S K;  5LJV A;  3CCM N;  1LWE A;  3GG4 A;  3CCJ N;  3MN9 A;  1EQY A;  3QDK A;  3L3U A;  2HMI A;  4FK0 A;  3TAQ A;  1RBT A;  1J53 A;  1BOT O;  1L3V A;  1YXQ A;  1A5W A;  4DLG A;  4ELV A;  1VQ8 N;  3QLH A;  1U2V B;  3UKR B;  3T19 A;  1BO5 O;  3A8Y A;  3VGM A;  3CER A;  2XO7 A;  1BDG A;  1NJW A;  3NAE A;  3AVG A;  4LH4 A;  1NK7 A;  1TGO A;  2GEM A;  3ALY A;  3AO4 A;  3F73 A;  3J7Z O;  3E9L A;  4FPB A;  1RT4 A;  4RG8 A;  5DK5 A;  4DUY K;  1C6V A;  3RVC A;  1HRH A;  4JRP A;  3IS9 A;  4CK2 A;  4HCC A;  4H0Y B;  3VER A;  4BRD A;  5BN8 A;  3FZH A;  4DFK A;  1X1P A;  2IDO A;  1S6P A;  2Q3S A;  4RWT A;  4M3W A;  2VWJ A;  1U6Z A;  1XMQ K;  4DSE A;  4BDP A;  3LDP A;  3KD5 E;  5AQL A;  3M8Q A;  1VQK N;  3ZT1 A;  3KK2 A;  4E7H A;  4CEQ A;  3O9S A;  1QQM A;  5M1K A;  2NNW A;  3H46 O;  3L2U A;  2OPR A;  3EKS A;  4Z4I A;  3QFP A;  4EP5 A;  4W5R A;  3CC4 N;  2D0O A;  1QTM A;  4LFB K;  4X65 K;  3PO5 A;  1BWF O;  2YJE A;  1RT7 A;  1RDC A;  2P9U A;  4CFC A;  2PAV A;  2RE2 A;  3RSE A;  1QQC A;  1TAQ A;  3IFR A;  4CER A;  4IKF A;  3ENO A;  5CHI A;  2A3Z A;  2W41 A;  2XY7 A;  3THX A;  4LF5 K;  1ASU A;  2BAN A;  4BRM A;  1C0U A;  5AQW A;  1ZC6 A;  2ATQ A;  4C8M A;  5AZI B;  5E26 A;  4GW6 A;  1RT5 A;  5HRS A;  2UXC K;  3P31 A;  1SL0 A;  3C7N B;  1JXE A;  3M5R A;  2FXU A;  2P9P B;  4H0O A;  4FJ7 A;  5T7B A;  4BRK A;  2RF2 A;  5AQS A;  4HTL A;  4IDK A;  1NGE A;  1JCG A;  3HXM A;  2R7Y A;  2QWL A;  3K5L A;  4M3Z A;  4AHS A;  2Z1J A;  3F9M A;  1MA9 B;  4AHT A;  4CW7 B;  1TK0 A;  2E6M A;  3OYA A;  3V9Z A;  3S9H A;  3EL2 A;  3BF3 A;  4WFN L;  5GIO A;  1VSL A;  4CFB A;  2OZS A;  1UOC A;  1HYV A;  3J7A P;  2QKB A;  1VSI A;  2YNH A;  4CJ4 A;  3R3L A;  3NH1 A;  4DSK A;  2D5R A;  1VAZ A;  4NYN A;  2X6N A;  3VET A;  3OYM A;  2V7Z A;  4DQR A;  3R8E A;  3R6M A;  4KHS A;  4F3T A;  4IO9 L;  2CGK A;  5JVH L;  1IKV A;  5CYM A;  1Y97 A;  1S5J A;  1WSF A;  2CGL A;  3QER A;  1YI2 N;  3CME N;  3EKU A;  4KH6 A;  3VGL A;  2QEX N;  4JKG A;  1I94 K;  2FSJ A;  4CES A;  2QW9 A;  4ID5 A;  4N41 A;  4WQ5 C;  1N8R O;  4XIU A;  1KAZ A;  4CBU A;  3I0S A;  3EYZ A;  4OO1 J;  3D2E B;  1RBS A;  2YJF A;  2P51 A;  3H45 C;  2IC3 A;  5AQV A;  1WUA A;  1Q82 O;  3VQE A;  4PQU A;  3CJB A;  3W3D A;  3DRS A;  3CCS N;  2WOM A;  3T1H K;  2VYP A;  2W6K A;  2DFH A;  2EHG A;  4RW9 A;  4Z94 A;  2HNY A;  1ESV A;  2GWK A;  1B9D A;  3SK3 A;  1VK0 A;  4U67 L;  2HNZ A;  3CXC M;  4HVJ A;  4FK2 A;  1QQN A;  2IAJ A;  4DR2 K;  4NLB A;  4J2E A;  4LSN A;  1RT2 A;  2Y1J A;  1DT9 A;  2HST A;  4MLH A;  3S3O A;  4CBW A;  2O8B A;  3KJV A;  2OA8 A;  4JK9 A;  4FLU A;  1T6D A;  4CZL A;  5AQQ A;  4I6M B;  2OPP A;  4CD3 A;  3OYK A;  3JSM A;  2Q31 A;  4FWK A;  5KGX A;  1QHT A;  2E1Z A;  4LY7 A;  4CVN E;  5AQX A;  3UKU B;  3CM6 A;  3S3N A;  1KC8 O;  1QZ6 A;  3T69 A;  3SYZ A;  2D0C A;  1T3V A;  4JKG B;  3B6P A;  3G71 N;  4JKE A;  5I42 A;  2XHB A;  5SWM A;  3PX0 A;  3ZT0 A;  3NMU A;  1S1X A;  3LAN A;  4I2Q A;  5EX5 A;  1BL3 A;  3PIP L;  3T1A A;  4CJR A;  3AVB A;  4ISG A;  2W6L A;  3DXM B;  1N6Q A;  1D5A A;  2PY5 A;  2V52 B;  3E9P A;  5HRN A;  4OGC A;  3T7Z A;  4CJK A;  3OYH A;  4OKJ A;  2A40 A;  4DFP A;  1VRT A;  1M1K O;  1NOY A;  1NGI A;  5IWA K;  5GAD P;  4IFY A;  1S1W A;  3SMP A;  3K5O A;  3D2F B;  3P39 A;  3DRP A;  3UE5 A;  1VQ9 N;  5F1X A;  3M3Z A;  5M1F A;  2F4V K;  4F2S A;  4QOZ B;  1XC3 A;  1RCH A;  3PX4 A;  4UY8 O;  1BCM A;  4WQ4 C;  2E2P A;  1M90 O;  1LCU A;  2O8C A;  2EX3 A;  2O8B B;  3KVG A;  1HUX A;  4DMN A;  1W7A A;  4F2R A;  2H3G X;  1LV5 A;  4KPY A;  4OPK A;  2UYT A;  3KK7 A;  4CEZ A;  3BEX A;  2O8F B;  3F5T A;  1ILY A;  1FK9 A;  1G15 A;  4OLA A;  4H4M A;  1WSG A;  4M7Y A;  1CXU A;  4DTS A;  3HL8 A;  1OVY A;  3BUZ B;  2HHS A;  3SAH A;  2VG6 A;  4FWM A;  1VQ7 N;  4H5W A;  4ILJ A;  2A1R A;  1C0T A;  4B9M A;  3QML A;  4B1Z A;  3C0B A;  1GLA G;  4RW6 A;  2HVH A;  1NWK A;  4KB1 A;  2VCP A;  5FPN A;  1Q9Y A;  3K0S A;  1Z25 A;  4KH4 A;  1DTQ A;  4CHY A;  4G1Q A;  5JMV A;  4K0K K;  5KQD A;  5J1E A;  1TVR A;  3RMB A;  3LP2 A;  2P9K B;  4NCG A;  5C24 A;  3VN5 A;  3OYJ A;  1KFS A;  3EN9 A;  1ZBH A;  4DG1 A;  5J2N A;  2Z1H A;  5KQ8 A;  3M8S A;  3MN7 A;  3DM2 A;  3J81 O;  3VTH A;  3MCA B;  3QIN A;  2G8U A;  3MCP A;  5AQO A;  4KI4 A;  1W9H A;  4I9L A;  2ITG A;  4L8R B;  3O3H A;  4ICL A;  2JWK A;  1KSP A;  3EEQ A;  3C6T A;  4FOE A;  1KVA A;  1C1A A;  1FKO A;  3V1R A;  2FBT A;  3DLK A;  3FFI A;  3TWH A;  2PYL A;  4OVL A;  3OYD A;  3QNO A;  4CHN A;  4DSI A;  1D4X A;  4H4O A;  3V81 A;  4WFB L;  1K6Y A;  1BG3 A;  3J8A A;  5EVZ A;  4RW8 A;  4FOI A;  5ADX H;  2DFE A;  3I8B A;  4B1U B;  1QSY A;  3DLG A;  4YOY A;  4KH5 A;  1IH7 A;  1JCE A;  2KLA A;  3DMJ A;  3M6G A;  4H0T B;  4BY9 C;  2D0P A;  3MAQ A;  2HHW A;  4JKD A;  3KKS A;  4LD0 A;  4XH4 A;  3LDS A;  3SQ0 A;  4B8C A;  3A5O C;  4JI3 K;  1RNH A;  2OTJ N;  3CCV N;  2JGU A;  1N36 K;  2HMP A;  3CJ1 A;  2AJQ A;  1RTD A;  1J9A A;  1VRU A;  3GL1 A;  4BR9 A;  3HZ6 A;  4CEB A;  3LAL A;  2O4G A;  2GWJ A;  5AQN A;  1YJN N;  4PA1 A;  1JL1 A;  3E9O A;  5M1N A;  1VSJ A;  5GIP A;  3SMS A;  3ZSX A;  3QEX A;  1GLJ O;  2G8F A;  3RR8 A;  1HPM A;  1K8K A;  3AVN A;  4O4G A;  3VEY A;  3PLA A;  1RDA A;  4O44 A;  4QS9 A;  3ZSV A;  4FJ8 A;  1A5V A;  1C1B A;  3ITH A;  4DWI A;  3ZET A;  2P5G A;  1KVB A;  2G8V A;  3SQ1 A;  1NK9 A;  2V51 B;  4EHU A;  1RFQ A;  4GNI A;  4DTJ A;  2B4J A;  3MN5 A;  3GOI A;  2O8D B;  3L2Q A;  3DLH A;  3QBW A;  2P9N B;  5FDL A;  2ZWH A;  3CFP A;  3O9R A;  3SV4 A;  1NKE A;  1X9J A;  4WCE L;  4BRE A;  2QWQ A;  4PKI A;  1NK4 A;  5M1Q A;  2QWM A;  1VSK A;  2HHT A;  3CET A;  5A2Q O;  4WE1 A;  4DSL A;  1TKX A;  1TKZ A;  4FLX A;  1WBB A;  2LSN A;  1T03 A;  3AA5 X;  4TSX A;  4ISE A;  1NGA A;  3TU5 A;  2CH5 A;  1D8Y A;  1WN7 A;  5AZI A;  3B8A X;  4GVE A;  1HKB A;  3KIO A;  1RTI A;  5BRH A;  4K8X A;  3I33 A;  3KKR A;  3L4I A;  4FWQ A;  4J2D A;  3AVL A;  5M1O A;  4PWD A;  4BRG A;  3R9P A;  1GOA A;  1LWF A;  4BE1 A;  3KTQ A;  1BA0 A;  4LH5 A;  1REV A;  2HF3 A;  4GVM A;  3G10 A;  1WLJ A;  2X6S A;  4QCL A;  3N4P A;  2NRZ A;  4B3T K;  1WOQ A;  4BRA A;  3CFO A;  3ZCM A;  4DQQ A;  1TKD A;  1OH5 A;  4MLE A;  5JS2 A;  4FLZ A;  2P1J A;  3LWL A;  4FYD A;  1RDB A;  2XRI A;  5HRP A;  4FJN A;  4BG8 A;  3LWM A;  2KZZ A;  1NKB A;  1S3X A;  1Z05 A;  5BRF A;  3NVK A;  1RDW X;  3HM9 A;  3ZSO A;  3O80 A;  4A59 A;  4OPH A;  4JRQ A;  3CPE A;  2FSN A;  3SAF A;  4B1X B;  4R5P A;  3HK2 A;  3HJF A;  4W5Q A;  1NGH A;  1JLC A;  2YNI A;  3SQ4 A;  3U8X A;  2Z1I A;  4BRN A;  2UXD K;  1TL1 A;  2P5O A;  3I56 N;  4JI7 K;  4E89 A;  4E7J A;  2I7N A;  4FJX A;  1HKC A;  1VSD A;  4EFH A;  1S1T A;  5FRM A;  2A5X A;  1HJR A;  3AO2 A;  3CIP A;  1R59 O;  3UKR A;  3SI6 A;  4CJ5 A;  4WYB A;  1FJG K;  2E2Q A; 
#chains in the Genus database with same CATH homology
 4AHT A;  3IG1 A;  1A5X A;  1S1V A;  2KTQ A;  3HVT A;  5SZT A;  4OKK A;  1TK0 A;  3V1Q A;  1BQM A;  3CM5 A;  4CGH A;  1JLG A;  2E6M A;  4M3R A;  3OYA A;  3V9Z A;  3AA3 A;  4Q0B A;  3S9H A;  1I3A A;  1B9F A;  4MFB A;  4DS5 A;  3AVJ A;  3ZSW A;  1W0H A;  2YKN A;  3RR7 A;  3PY8 A;  4BAC A;  4CF8 A;  1VSL A;  3ZT3 A;  1VSF A;  4CFB A;  2OZS A;  4B3O A;  3ZT4 A;  1UOC A;  1HYV A;  1RBU A;  2QKB A;  1VSI A;  2YNH A;  4CJ4 A;  3U6F A;  3EY1 A;  3NH1 A;  3HVR A;  5DMR A;  4DSK A;  2KQ2 A;  3C6U A;  3THV A;  2D5R A;  1U47 A;  4KHN A;  4NYN A;  2X6N A;  4E19 A;  4KHQ A;  4YNQ A;  3OYM A;  4BDZ A;  2BE2 A;  4DQR A;  1KLN A;  4AHV A;  4CGF A;  4KHS A;  4FM1 A;  1IG9 A;  4F3T A;  3NH2 A;  3H08 A;  1Q8I A;  3VQ9 A;  3OYF A;  1IKV A;  1RIL A;  5CYM A;  1VSE A;  1S5J A;  1WSF A;  1Y97 A;  3DLR A;  3QER A;  5C25 A;  1HYS A;  2F8T A;  3QEV A;  1JKH A;  2NUB A;  3CYM A;  4FLV A;  1NK8 A;  4CES A;  4B9N A;  4ID5 A;  1O1W A;  4DFM A;  4CIE A;  4N41 A;  4Z0U A;  4XIU A;  1IKW A;  1NK0 A;  4B9L A;  3A2F A;  3V9U A;  2QK9 A;  4CEC A;  3I0S A;  1RBV A;  4CJS A;  1VSM A;  1TV6 A;  3L3V A;  3HPO A;  3C95 A;  1BGX T;  3EYZ A;  4HHT A;  5J2M A;  1Q9X A;  3VA0 A;  1RBS A;  3CG7 A;  3OYG A;  4CF9 A;  3LZI A;  3SZ2 A;  2P51 A;  5HP1 A;  3U3Y A;  1RTH A;  2IC3 A;  4AHR A;  5HBM A;  4E1M A;  3SUO A;  4M41 A;  3VQE A;  1F21 A;  1RBR A;  1BIU A;  2HB5 A;  1X9S A;  1ZBU A;  4PQU A;  3NF9 A;  2W42 A;  3DRS A;  3HT3 A;  2WOM A;  2A1S A;  3HPG A;  1BIZ A;  4KTW A;  2DFH A;  2EHG A;  4RW9 A;  3K58 A;  4DFJ A;  3TAP A;  1NK5 A;  2PYJ A;  3DLB A;  3TAE A;  3MEG A;  4CCH A;  5KRS A;  2HNY A;  1L3S A;  3U3G A;  3AVI A;  2FBX A;  3V1O A;  4M42 A;  1TKT A;  1B9D A;  3LP0 A;  4W5O A;  4DQI A;  3VQP A;  1VK0 A;  4CJP A;  3OYC A;  2HNZ A;  1XC9 A;  4CJE A;  3K5N A;  4HVJ A;  4FK2 A;  3SQ2 A;  2IAJ A;  4CJU A;  3AVK A;  1EXQ A;  1JXB A;  1IKY A;  4UQG A;  3PV8 A;  3HP9 A;  1X9W A;  4J2E A;  1KVC A;  4NYF A;  3OYN A;  4LSN A;  1RT2 A;  4AH9 A;  4CJW A;  4DF4 A;  2Y1J A;  4ELU A;  1S1U A;  1S9G A;  3S3O A;  4B8A B;  1QE1 A;  3AO1 A;  5KI6 A;  3KJV A;  2OA8 A;  4FLU A;  1L3T A;  4EZ9 A;  4FZY A;  4F8R A;  1HMV A;  4M3Y A;  3NFA A;  2OPP A;  2RN2 A;  4CEF A;  4ZTJ A;  3OYK A;  3JSM A;  4CGI A;  5KGX A;  1QSL A;  4FJ9 A;  1QHT A;  4Z4F A;  4LY7 A;  1JLA A;  3LZJ A;  3QIP A;  2PZS A;  5FRN A;  5EU7 A;  5HRO A;  3HO1 A;  3CM6 A;  2GUI A;  2QKK A;  3S3N A;  3CFR A;  4H8K A;  3V6D A;  1UAX A;  3SYZ A;  3D45 A;  2D0C A;  4FLY A;  3BGR A;  4KKO A;  1R0A A;  2KZM A;  3B6P A;  4CEO A;  1DTT A;  5HRR A;  5I42 A;  2XHB A;  5SWM A;  1JLF A;  3PX0 A;  3ZT0 A;  1S1X A;  5I3U A;  4ELT A;  3LAN A;  4I2Q A;  1BL3 A;  3VQ5 A;  3T1A A;  3NCI A;  5HLF A;  4CJR A;  2XY6 A;  3AVB A;  4DSJ A;  3AO3 A;  4CJT A;  4FLT A;  3VA3 A;  1D5A A;  3MXM A;  1N6Q A;  4N5S A;  2PY5 A;  3TR8 A;  3AVC A;  5HRN A;  4I7F A;  1RT3 A;  4KHU A;  4OGC A;  1L5U A;  1X9M A;  3SUN A;  4FLW A;  4CJK A;  3OYH A;  4OKJ A;  1ZBF A;  3K5M A;  3HYF A;  3WNF A;  1VRT A;  4DFP A;  1NOY A;  5KRT A;  2G8K A;  4HCB A;  2YHB A;  4AHC A;  4IFY A;  1S1W A;  3K5O A;  4C8N A;  4CJL A;  1HNI A;  3M8P A;  3DRP A;  3ZT2 A;  5CY4 A;  3NGZ A;  3S3M A;  1B92 A;  1BIS A;  4KTZ A;  3VQ6 A;  4KB0 A;  3TAB A;  4QOZ B;  4F2S A;  3MEC A;  1RCH A;  1J5O A;  3PX4 A;  2HHX A;  1ITG A;  3WNE A;  1BCM A;  3QET A;  1CXQ A;  1EP4 A;  4RW4 A;  3NE6 A;  4C8L A;  1QS4 A;  2VG7 A;  1LW0 A;  4CHZ A;  2HW3 A;  3AVF A;  3OYE A;  3HP6 A;  2EX3 A;  2IOC A;  4DU1 A;  3NGY A;  3K59 A;  3OYI A;  4DMN A;  1GOB A;  1KTQ A;  4F2R A;  4FW1 A;  4CHO A;  1RTJ A;  2GV9 A;  3OJU A;  4DTR A;  1LV5 A;  2E6L A;  3UIQ A;  4KPY A;  1J54 A;  4M3U A;  2VWK A;  4OPK A;  4CEZ A;  4QAG A;  4FJK A;  3VQQ A;  4C8K A;  4BE2 A;  1WSI A;  2OZM A;  1HPZ A;  2RKI A;  1FK9 A;  3MXI A;  5J2Q A;  1G15 A;  1RT1 A;  2B5J A;  1JLE A;  1WSG A;  4H4M A;  3NHG A;  3SPZ A;  4CJF A;  1CXU A;  1SV5 A;  3HL8 A;  4DTS A;  4EZ6 A;  4B9T A;  5CZ2 A;  1TK8 A;  2HHS A;  2VG6 A;  3MED A;  3LP1 A;  1SKS A;  2A1R A;  4O55 A;  3CQ8 A;  3KLI A;  3OY9 A;  4HTU A;  4BWJ A;  1C0M A;  4IG3 A;  3O4N A;  4DTM A;  1C0T A;  3SUP A;  4B9M A;  2E4L A;  4CF0 A;  4PY5 A;  1WSH A;  3RTV A;  4BDY A;  3P83 D;  4EP4 A;  4RW6 A;  2HVH A;  1T05 A;  3WNG A;  4IBN A;  1GOC A;  2KW4 A;  4FJI A;  4KB1 A;  1Q9Y A;  1Z25 A;  4RW7 A;  1DTQ A;  2XY8 A;  4M45 A;  4FJG A;  4CHY A;  4G1Q A;  1YVU A;  3B6O A;  3LP3 A;  3VQ8 A;  1ASW A;  1Z26 A;  1ASV A;  5J1E A;  3JYT A;  4Z4E A;  4OLA A;  1XHX A;  4KHY A;  3DYA A;  1TVR A;  3RMB A;  3LP2 A;  3T3F A;  4FXD A;  3G0Z A;  4B9S A;  4NCG A;  3PUF A;  5C24 A;  3VN5 A;  2XY5 A;  3MEE A;  3OYJ A;  1KFS A;  2BDP A;  1XI1 A;  3RMD A;  3NF8 A;  1ZBH A;  3DI6 A;  2HVI A;  2HHV A;  1BQN A;  2D0A A;  2I5J A;  4DTP A;  4FVM A;  4DG1 A;  3HPH A;  5J2N A;  3LPU A;  2Z1H A;  1SL1 A;  1SKR A;  2HHU A;  3M8S A;  2OYQ A;  3DM2 A;  3TAN A;  1BI4 A;  3V9W A;  4W5N A;  2ZQB A;  4FJJ A;  3QIN A;  2G8U A;  3M8R A;  2WON A;  1LW2 A;  4CFD A;  3BDP A;  4KI4 A;  5D3G A;  1CZ9 A;  1W9H A;  3DOL A;  2ITG A;  1LAV A;  4I9L A;  4BWM A;  3DRR A;  3LAM A;  4L8R B;  3O3H A;  3AA2 A;  1NJX A;  1LAW A;  1LWC A;  4DTN A;  1TL3 A;  3TAR A;  1BCO A;  4K8Z A;  4ICL A;  3SV3 A;  3K57 A;  3RMA A;  1SKW A;  3KLE A;  1KSP A;  2VG5 A;  2X74 A;  3F9K A;  3OS0 A;  3C6T A;  1YT3 A;  1U49 A;  4B9V A;  4KI6 A;  4PUO A;  1KVA A;  1C1A A;  1FKO A;  4HUF A;  3OS2 A;  2FBY A;  2FBT A;  3DLK A;  3FFI A;  3V1R A;  3OJS A;  3TWH A;  2PYL A;  3QIO A;  4OVL A;  3OYD A;  3QNO A;  4MQ3 A;  4CHN A;  3VQC A;  3TI0 A;  4DSI A;  3O3F A;  4YFU A;  4H4O A;  3SNN A;  3V81 A;  3AVH A;  2G8H A;  3AV9 A;  1U4B A;  4DU3 A;  1K6Y A;  3AVA A;  4E7K A;  1C1C A;  4DTO A;  2O4I A;  1EKE A;  4RW8 A;  3TAG A;  1IKX A;  1RT6 A;  2IGI A;  1EET A;  4CGD A;  4IG0 A;  4Z4C A;  2DFE A;  2D0B A;  1QSY A;  4FZX C;  3KLH A;  3DLG A;  3NF7 A;  4DTU A;  1IH7 A;  3K2P A;  3TAF A;  4FM2 A;  4FZZ A;  3DMJ A;  2IS3 A;  2YKM A;  1KRP A;  4LSL A;  2Y1I A;  1KCF A;  3AVM A;  4F4K A;  3RRH A;  3SCX A;  3KK1 A;  3MAQ A;  3P1G A;  2HHW A;  3OYB A;  3KKS A;  3ASM A;  1KLM A;  4KFB A;  4LD0 A;  4J2A A;  1N5Y A;  2ETJ A;  3LDS A;  3SQ0 A;  4HUG A;  3NF6 A;  4B8C A;  1RNH A;  4OKE A;  2HND A;  4OGE A;  4DLE A;  2JGU A;  4E3S A;  1TK5 A;  1CLQ A;  2F8S A;  3NH0 A;  1RTD A;  2AJQ A;  3E01 A;  1J9A A;  1VRU A;  4CEB A;  1YTU A;  3LAL A;  2O4G A;  3TAM A;  3I8D A;  1NKC A;  3OS1 A;  2YV0 X;  4PA1 A;  1JL1 A;  4FJH A;  3PO4 A;  1HQE A;  4FCY A;  4BE0 A;  4GMJ B;  3KLF A;  3SJJ A;  4FW2 A;  4O0I A;  1VSJ A;  1WAJ A;  1U48 A;  3V9X A;  3VQ4 A;  3OYL A;  3NBP A;  4ZHR A;  5KTQ A;  2X78 A;  2DFF A;  2YHA A;  3ZSX A;  1EX4 A;  3QEX A;  3SPY A;  1D9F A;  2G8F A;  3RR8 A;  3AVN A;  4KO0 A;  4O4G A;  5CYQ A;  4CGG A;  3O3G A;  2RPI A;  4FK4 A;  4OPJ A;  4ID1 A;  1HQU A;  1RDA A;  4ZTF A;  3KK3 A;  4FJM A;  4O44 A;  2FBV A;  2OPQ A;  1D9D A;  3IAY A;  1U45 A;  3V4I A;  4JS4 A;  1BHL A;  4Y1C A;  4M3X A;  1HYZ A;  3ZSV A;  1MU2 A;  4FJ8 A;  1NK6 A;  4FJ5 A;  3L2V A;  4O0J A;  4AIL C;  1A5V A;  1C1B A;  3RWU A;  1S6Q A;  3EZ5 A;  2FC0 A;  3ITH A;  1WSJ A;  3VQA A;  4Q5V A;  1JL2 A;  4J2B A;  4DWI A;  3ISN C;  4AHU A;  3RRG A;  2KFN A;  1QSS A;  3SUQ A;  2P5G A;  4JLH A;  1KVB A;  3VQD A;  3DLE A;  3HST B;  2BGG A;  4I9Q A;  5E41 A;  2G8V A;  3SQ1 A;  1NK9 A;  3P5J A;  1LWE A;  4KRF A;  4DTJ A;  4CIF A;  2B4J A;  1ZYQ A;  3L2Q A;  4DQS A;  4IFV A;  5KGW A;  3VQ7 A;  3DLH A;  4E0D A;  4F3O A;  4FK0 A;  3L3U A;  1L3U A;  5FDL A;  3TAQ A;  2HMI A;  4CGJ A;  4HUE A;  4DS4 A;  1RBT A;  3CFP A;  1WAF A;  2B6A A;  2ZD1 A;  1J53 A;  4KRE A;  3SV4 A;  1NKE A;  4DF8 A;  3QEI A;  1L3V A;  1A5W A;  4DLG A;  4DTX A;  4ELV A;  4KV8 A;  3QLH A;  5C42 A;  2YNF A;  1T8E A;  3L8B A;  4CHQ A;  1NK4 A;  3T19 A;  4I2P A;  4B08 A;  2HHQ A;  2XO7 A;  5J2P A;  1VSK A;  1WSE A;  3NAE A;  1NJW A;  3O4Q A;  2HHT A;  3AVG A;  1JLQ A;  5K14 A;  4LH4 A;  1NK7 A;  1TGO A;  3OVN A;  4WE1 A;  4DSL A;  3AA4 A;  4CIG A;  1TKX A;  3DOK A;  1TKZ A;  3ALY A;  3AO4 A;  2LSN A;  4CF1 A;  3F73 A;  4FLX A;  4E7I A;  1T03 A;  3AA5 X;  1SL2 A;  4NCB A;  2OPS A;  4TSX A;  5FRO A;  4KAZ A;  1D8Y A;  4M3T A;  4Z4H A;  1WN7 A;  1NJZ A;  4E1N A;  4CK1 A;  1KFD A;  4W5T A;  1RT4 A;  4RG8 A;  5DK5 A;  3ULD A;  1C6V A;  4CEE A;  1RDD A;  3KIO A;  4CF2 A;  1XWL A;  1HRH A;  1RTI A;  4CHP A;  4JRP A;  1T7P A;  4K8X A;  2G8W A;  3IS9 A;  3KKR A;  1NJY A;  2KFZ A;  4J2D A;  4CK2 A;  4HCC A;  4NCA A;  3AVL A;  3KLG A;  2YNG A;  4DFK A;  4PWD A;  3QES A;  4CJ3 A;  4CK3 A;  1GOA A;  1LWF A;  4BE1 A;  3KTQ A;  1I39 A;  5CZ1 A;  4N47 A;  1X1P A;  2G8I A;  2IDO A;  1S6P A;  2Q3S A;  1UA0 A;  4CJQ A;  1DLO A;  4KHW A;  4LH5 A;  4M3W A;  2VWJ A;  1REV A;  4GVM A;  4CJV A;  2Z1G A;  4DSE A;  4BDP A;  3NDK A;  3KD5 E;  3QNN A;  3KD1 E;  3M8Q A;  3G10 A;  4FJL A;  2X6S A;  1WLJ A;  2JLE A;  3ZSZ A;  4QCL A;  3ZT1 A;  3KK2 A;  4E7H A;  3L2R A;  4CEQ A;  3AO5 A;  1SUQ A;  3CFO A;  4OJR A;  4B9U A;  4DQP A;  3QO9 A;  3ZCM A;  4OLB A;  1WNS A;  4FM0 A;  1IO2 A;  5JS1 A;  4DQQ A;  1BI4 B;  4N56 A;  3L2U A;  2OPR A;  1TKD A;  3V9S A;  4N76 A;  4Z4I A;  3C94 A;  1JLB A;  3MXJ A;  5JS2 A;  4EP5 A;  4E7L A;  4W5R A;  3LPT A;  4FLZ A;  2P1J A;  1XHZ A;  2QXF A;  3L2W A;  3LWL A;  4CE9 A;  3LAK A;  1QTM A;  4FYD A;  1CZB A;  1HNV A;  1FXX A;  1RDB A;  1U04 A;  2XRI A;  3D0P A;  3RMC A;  3PO5 A;  1RT7 A;  5HRP A;  4FJN A;  1RDC A;  2ZE2 A;  4CFC A;  4DSF A;  4Z4G A;  3LWM A;  2KZZ A;  1TAU A;  1NKB A;  2DTU A;  3VQB A;  1QQC A;  1TAQ A;  1UA1 A;  3HM9 A;  4CER A;  4IKF A;  3QEP A;  3QEW A;  2DY4 A;  3ZSO A;  3NGI A;  4JRQ A;  1S9E A;  1VSH A;  1NOZ A;  4Y1D A;  4R5P A;  4DU4 A;  1ASU A;  2BAN A;  2XY7 A;  4CEA A;  1C0U A;  3HK2 A;  3HJF A;  1ZBI A;  4W5Q A;  3SQ4 A;  1JLC A;  2ATQ A;  2YNI A;  4JS5 A;  2Z1I A;  4C8M A;  1TL1 A;  3ZSR A;  1UWB A;  2P5O A;  4CED A;  4GW6 A;  4E89 A;  4E7J A;  1RT5 A;  3I0R A;  4FJX A;  5HRS A;  1VSD A;  1SL0 A;  1S1T A;  1JXE A;  2GBZ A;  3PX6 A;  2F96 A;  5FRM A;  3ZSY A;  1FKP A;  1HJR A;  3WNH A;  4CFA A;  4FJ7 A;  3AO2 A;  3IRX A;  5T7B A;  2RF2 A;  4C8O A;  4IDK A;  4O5B A;  3SI6 A;  3HXM A;  4CJ5 A;  3K5L A;  2R7Y A;  1ZBL A;  4M3Z A;  3ZSQ A;  4AHS A;  2Z1J A;  4KTQ A;  1YTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...