3V9SA

Crystal structure of rnase t in complex with a product ssdna (aac) with one mg in the active site
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 63
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9sA00
3NF6A 2BDPA 1LAWA 4UQGA 2QXFA 4CGGA 3TAQA 1BI4A 3M8QA 5FROA 3DMJA 4OLAA 2B4JA 1JLQA 4B08A 3WNGA 1RDBA 2O4IA 4R5PA 3CFPA 4CEBA 3VQ6A 4CJ4A 3TI0A 3KLFA 3NFAA 4B9SA 1WLJA 2IC3A 2GUIA 2B6AA 3HM9A 1RT7A 1BGXT 4FLZA 2HVHA 2VWKA 1WAFA 2KW4A 3SUPA 3KD1E 4DS5A 3NGYA 1XC9A 4FJHA 1Q9XA 2VG7A 3JSMA 1BL3A 1VK0A 2GBZA 3HT3A 4OVLA 4JS4A 2KZZA 3CFOA 3OY9A 2W42A 3V1OA 1J5OA 3L8BA 4FZZA 4KHSA 1S6PA 4TSXA 3HP9A 2OZMA 5HROA 2LSNA 3K5NA 1LW0A 1X9SA 5EU7A 4BWJA 4KPYA 4CJKA 4CJUA 1NK5A 4FLUA 2WONA 3RWUA 3LPUA 3ZSZA 2VWJA 4H8KA 2A1SA 3JYTA 3ZSVA 3RMBA 4B9MA 3KLIA 4M3WA 3HO1A 4PY5A 3OS1A 2JLEA 4AH9A 5HRPA 4DTRA 2IGIA 1IKWA 4DFKA 4N47A 5J2QA 1RBVA 3H08A 4CHYA 3SNNA 2A1RA 1RBUA 1SL2A 3F73A 2VG6A 3QNOA 1VRUA 1SL1A 1HPZA 2ITGA 3AO2A 4DFJA 3RR8A 4HCCA 4CERA 5CZ1A 3TAFA 3KKSA 1KCFA 3ZSRA 4ID1A 3AVGA 4I7FA 2YNHA 1EETA 1U49A 4E7JA 1C0UA 4DTOA 4FM2A 1Q8IA 1W0HA 1JLGA 4ZHRA 4DU1A 3NDKA 4LSLA 3D45A 2ZD1A 1VRTA 2D5RA 4K8ZA 2BE2A 2NUBA 5C25A 1BIZA 2G8HA 3LAKA 4CJPA 1GOBA 4GW6A 4E89A 3RRHA 2DFEA 4FM0A 3UIQA 4AHVA 2B5JA 2IOCA 3LP0A 4DTPA 3VQAA 3HPOA 3V81A 4M3XA 4BDYA 4CFAA 1RDAA 2P5OA 2YHAA 3VQBA 3CFRA 1CXUA 3AVBA 4RW4A 4F4KA 1T05A 1L3UA 3AVMA 3O3HA 5J2NA 4CGHA 2EHGA 2YNGA 3TARA 4Z4FA 3HXMA 3DOLA 4OGEA 2BGGA 1JLEA 3AO1A 3ZSWA 1NJZA 2ETJA 1A5WA 1XI1A 3RR7A 4KHQA 3DYAA 4H4MA 4KTZA 1I39A 4B9TA 4CJTA 2OYQA 3AO4A 4C8NA 3LANA 4ELTA 1XHZA 1ASVA 3TAMA 5J1EA 2AJQA 3NH1A 3EYZA 4CF0A 3AA3A 4CFCA 4EZ9A 4KHNA 1BQNA 3K5OA 3HVRA 4I9LA 1B92A 3WNEA 3ZT1A 4FLWA 4C8KA 4KTQA 3AA2A 3B6OA 4AHTA 5HRNA 3SUOA 1F21A 1QS4A 1TKTA 4FJJA 3EZ5A 3NGIA 3I0RA 5D3GA 2ZE2A 2G8UA 1ZBHA 4Z4HA 1KVCA 3PO4A 3LP1A 4AHSA 2R7YA 4H4OA 3DLEA 3RRGA 1HRHA 3NF9A 3AVHA 1LW2A 3SQ4A 3L2RA 1JL2A 3RMDA 1KFSA 1RDDA 4DFMA 2DTUA 3SI6A 1IKYA 3VQ4A 3HPHA 5KI6A 2FBTA 4CF9A 1HNVA 3U3GA 1YTAA 3KIOA 4RG8A 1Y97A 2KQ2A 4O0JA 4CEDA 3LZJA 4F2SA 1ASWA 1J53A 3AA5X 3DRPA 4M3UA 3QEXA 3NHGA 5HBMA 4CK1A 3SPZA 1NK4A 4J2EA 4NCAA 1X9MA 5DMRA 1C1CA 3MEDA 3NGZA 4CEQA 2RKIA 4DG1A 4JRPA 4E1MA 2PYJA 4B9LA 3DM2A 4BE0A 4L8RB 2RF2A 1RT2A 2F96A 1U45A 4FJIA 4FZYA 4CJVA 5I3UA 4FLTA 3I8DA 1UOCA 1WSGA 3DLRA 3IS9A 3QEPA 3KLHA 1TKDA 2XO7A 3DLGA 4FLXA 4Q0BA 4W5RA 2OPPA 1RILA 3VQPA 3O3FA 4CGIA 1NK0A 4C8MA 1U04A 4CJFA 2G8KA 4CHZA 4DWIA 4CIEA 3NAEA 4BE2A 1S5JA 2IDOA 4CE9A 4FJLA 1CZBA 3HL8A 2Z1IA 4BWMA 4LY7A 4EP4A 1J54A 5J2PA 1SKSA 1TKXA 3PX0A 3AVKA 3OYIA 5FRMA 3OYMA 1U4BA 1BQMA 4RW8A 3HK2A 4NCBA 4OKJA 2FBVA 3SJJA 1GOAA 4CIFA 5SWMA 1RT4A 1RTDA 4E3SA 3S3NA 3I0SA 4KKOA 4F3TA 1TAQA 2HHVA 1X1PA 1NOYA 3CM5A 1YVUA 3QETA 1UA0A 4FJKA 3RMAA 3HJFA 3WNFA 3VQEA 4CJQA 1VSEA 4PA1A 4BACA 4Z4EA 2IAJA 3QINA 1C0MA 3P5JA 4CJWA 4B8AB 3QEIA 4E1NA 1RBSA 1QHTA 2YNFA 3AVLA 3ZSOA 3OS2A 4FM1A 1L3VA 3DLHA 5CY4A 1RDCA 2Y1JA 5CZ2A 4W5QA 1D8YA 1RT3A 4DTSA 3CQ8A 2G8WA 4DS4A 2D0BA 3V9SA 2OZSA 2YKNA 3ZSXA 4ZTFA 2FBXA 1C1AA 4CJSA 4OGCA 4DSJA 1SKWA 1FKOA 1RT1A 3VQ9A 4KHYA 1EKEA 4W5OA 1JLCA 3DRSA 4JLHA 4O55A 4KB0A 1Z26A 4I9QA 3K5MA 1CLQA 1ZBFA 3G0ZA 2IS3A 4CGDA 2PYLA 1LWCA 3LZIA 4M45A 3KLGA 3KJVA 4DSIA 1C1BA 3ITHA 2KFZA 4M42A 3DLBA 4FZXC 4KI6A 2Z1JA 5CYMA 2HHUA 1BIUA 3QNNA 1TK5A 4IDKA 4J2AA 3ALYA 3O4QA 4RW9A 5K14A 4CJ5A 4CK3A 4IFYA 3SCXA 1W9HA 2X6SA 3TAEA 1NK6A 1N6QA 1C0TA 1IH7A 4J2DA 1LAVA 4Z4CA 4GVMA 3MXJA 3PV8A 3E01A 1R0AA 4ICLA 1WSFA 4CESA 1S1UA 1TGOA 4ELUA 4E7IA 4DQPA 1ZBIA 1JXEA 2HHQA 1D9DA 1HYSA 3S3OA 4DLEA 4I2QA 4CEEA 1JLBA 4MQ3A 4O5BA 5KTQA 1TK8A 3LALA 3C6TA 4W5NA 3A2FA 3HYFA 2Z1GA 4Z4GA 4DFPA 3IAYA 4CFBA 1JLAA 3VQ7A 2RPIA 4JS5A 3SQ2A 1NKBA 4KHUA 3ZCMA 1NOZA 1EX4A 1VSFA 3P83D 1NJWA 4F8RA 2DY4A 4CJRA 2EX3A 3L2VA 3QIPA 3L3VA 4IG0A 4OJRA 4N56A 4KI4A 3V9XA 1HNIA 1NJYA 1TV6A 3U6FA 3LAMA 4AHRA 4FJ7A 1RCHA 3OYHA 3OYFA 1LWEA 3NH2A 1Q9YA 4OPKA 5CYQA 1RNHA 4DQRA 4DTXA 4CF2A 2QKKA 3K58A 5T7BA 1CXQA 4FJ5A 1ASUA 4FJ8A 5FRNA 1D9FA 5JS1A 3V6DA 1RT5A 2WOMA 5DK5A 3DOKA 3IRXA 3P1GA 3OYBA 4IKFA 3SUNA 4IG3A 2DFFA 2E6LA 3HPGA 4XIUA 3SPYA 1SKRA 1LWFA 2P1JA 4CF8A 3VA0A 3TR8A 3S9HA 5HRRA 3KD5E 1L5UA 1S9EA 3M8PA 2G8FA 1DLOA 4PQUA 4DTNA 4QCLA 2OPSA 4FW1A 4O4GA 5J2MA 4N41A 1L3TA 1KVAA 1B9FA 2YKMA 4CK2A 5KRTA 5KRSA 1RTIA 2HHTA 2OPRA 3SV4A 3OYAA 5KGXA 2Q3SA 2P51A 4Y1CA 3AVIA 4AHUA 5C42A 3T19A 1EXQA 4CFDA 4IBNA 1EP4A 4FJGA 1ITGA 3LPTA 1KLMA 4KFBA 4NCGA 4M41A 3T1AA 4LSNA 4ELVA 2ZQBA 4PUOA 1O1WA 3TWHA 3SYZA 1WSHA 2HNYA 3O3GA 2OA8A 3ZSQA 1DTTA 1LV5A 2PY5A 1BCOA 4CGFA 5E41A 3L2QA 4KREA 5JS2A 4NYFA 4HTUA 5HP1A 1NK7A 3QLHA 4JRQA 3BGRA 1S1XA 4DQQA 1XWLA 4FK4A 1WSIA 2VG5A 1S1VA 4LD0A 4E0DA 4LH5A 1HQUA 1RBTA 1XHXA 3CM6A 3LP2A 3EY1A 3C94A 4DSEA 3NCIA 3MXIA 1TKZA 3OYLA 1RTJA 4F3OA 3TAGA 4K8XA 1NKEA 3B6PA 4FLYA 3ZT3A 3L2UA 4CGJA 4FJNA 4J2BA 4CHPA 4FK2A 5I42A 3MEEA 1Z25A 3ZSYA 2RN2A 2F8TA 3VN5A 3AVCA 3NF7A 4CEFA 1UA1A 4QAGA 3F9KA 3ULDA 3NF8A 3SQ0A 4M3ZA 4DU3A 2HNZA 4EP5A 3KLEA 3AO5A 4E7LA 3QEVA 3ISNC 3OYDA 1BCMA 1K6YA 1BHLA 4ZTJA 1IKXA 4I2PA 4HHTA 1WAJA 4KB1A 4FJ9A 4GMJB 3DI6A 4O44A 3PX6A 4HUFA 4DTJA 4Z0UA 3THVA 4B3OA 1BISA 3LWMA 1ZBLA 1T03A 4YNQA 5KGWA 4DSLA 1KTQA 1QQCA 1RT6A 3K2PA 3MECA 1D5AA 3VQ5A 4CEAA 3OYJA 3D0PA 4CF1A 1DTQA 1I3AA 3AVNA 1FXXA 1U47A 4FK0A 2QKBA 3M8RA 3MXMA 4DQIA 3FFIA 1KRPA 3NE6A 3PY8A 2KTQA 4KRFA 1HYZA 3C95A 3G10A 4BE1A 4F2RA 1C6VA 3RMCA 3ASMA 4DSKA 5FDLA 1IKVA 1T8EA 1HQEA 4KV8A 2X78A 4CIGA 3HVTA 4FW2A 2G8VA 2FBYA 1VSJA 3V9UA 3BDPA 3PO5A 4C8LA 3MAQA 4DTUA 3OJUA 4M3TA 4YFUA 4PWDA 2ATQA 3QIOA 3KTQA 4NYNA 1QTMA 4KO0A 3OYCA 3L2WA 1REVA 1WNSA 2YNIA 3VA3A 1T7PA 1VSLA 3K59A 2D0AA 3V1RA 3OVNA 4E19A 1JLFA 1ZBUA 3K5LA 3KK1A 4M3RA 4B9VA 1S1TA 4OPJA 2KFNA 4DU4A 4BDPA 4MFBA 3KK2A 2XY5A 2XY7A 3NBPA 1UAXA 3L3UA 1QSYA 2HHXA 3QERA 1TL3A 3OYGA 3WNHA 3OS0A 3SV3A 4CHQA 1TK0A 3AV9A 4C8OA 3VQCA 4BDZA 1A5XA 2P5GA 3QO9A 3SUQA 3QESA 4HCBA 2YHBA 4CEZA 2E6MA 4FCYA 4FYDA 1TVRA 4CJ3A 1A5VA 1JL1A 1S9GA 4N76A 2E4LA 2HNDA 4CECA 1NK8A 4Z4IA 4Q5VA 3DLKA 4B9UA 1S1WA 4CJLA 3VQ8A 5C24A 1NKCA 3PUFA 5HRSA 2HB5A 2HHSA 4ID5A 2YV0X 1BI4B 3VQDA 4AHCA 1U48A 1CZ9A 4CHOA 3HSTB 4LH4A 4RW6A 3SZ2A 1SV5A 1IG9A 2HHWA 1B9DA 2FC0A 3IG1A 4N5SA 4G1QA 2HMIA 1TL1A 3RTVA 3U3YA 3MEGA 2Z1HA 1NK9A 3PX4A 3CYMA 3TANA 1QSLA 2I5JA 3LDSA 3QEWA 1QE1A 1KSPA 4E7KA 2F8SA 1HYVA 3KKRA 2D0CA 1FK9A 1JKHA 3TABA 5SZTA 2OPQA 4M3YA 2DFHA 1FKPA 4KTWA 3LP3A 3M8SA 4DMNA 4DSFA 4W5TA 4OKEA 2XY8A 3V9WA 2PZSA 1L3SA 4FJMA 2KZMA 3AVJA 4KAZA 3K57A 2QK9A 2HW3A 3OYEA 1WSJA 1VSIA 3CG7A 1S6QA 1KVBA 4CJEA 1JXBA 3NH0A 3HP6A 4CEOA 1TAUA 2XY6A 4B9NA 1SL0A 4CHNA 4QOZB 3OYKA 1UWBA 1KLNA 3AO3A 3KK3A 4B8CA 2Y1IA 1SUQA 1VSHA 1HJRA 3OJSA 2GV9A 3V1QA 2O4GA 1KFDA 3C6UA 3ZT0A 3VQQA 2XHBA 3AVAA 4FVMA 3T3FA 5HLFA 1ZYQA 1X9WA 1N5YA 1RBRA 4FJXA 3V9ZA 1YT3A 3LWLA 1G15A 4FXDA 1WSEA 4RW7A 2JGUA 3AA4A 3TAPA 1IO2A 2XRIA 3ZT4A 3ZT2A 4E7HA 4O0IA 4DTMA 3S3MA 2X74A 3O4NA 4EZ6A 4HVJA 4DQSA 4DF8A 3AVFA 1YTUA 4KHWA 4IFVA 1RTHA 4FLVA 4OKKA 3SQ1A 4AILC 4DLGA 1HMVA 1MU2A 1NJXA 1VSMA 1WN7A 2X6NA 3OYNA 4CCHA 2HVIA 2G8IA 1VSKA 1GOCA 4HUGA 2BANA 4DF4A 1VSDA 3DRRA 1QSSA 1J9AA 4Y1DA 3V4IA 4HUEA 4WE1A 4OLBA
chains in the Genus database with same CATH superfamily
3NF6A 3CMEN 2QXFA 3TAQA 3O80A 1JLQA 4B08A 3CFPA 2GEMA 3GDQA 1EWQA 3NFAA 3F5TA 4B9SA 3T7ZA 3TSUA 4A2AA 2GUIA 1EO1A 1RT7A 2FSKA 3JXUA 1WAFA 5FPDA 4DS5A 1XC9A 4G9ZA 1Q9XA 4IJAA 3HM8A 1J5OA 3OY9A 1NGFA 3V1OA 4DUYK 4BY9C 1YAGA 3EE8A 3SMPA 5AZJB 4K0KK 1X9SA 4CJKA 2CGLA 4FLUA 1WBBA 3ZYYX 3J7AP 2WONA 4H8KA 2VYPA 3JYTA 4B9MA 4DUZK 4PY5A 3OS1A 4AH9A 1OH6A 1D4XA 2IGIA 4JI1K 1RBUA 2QWOA 2ITGA 5GAEP 1M1KO 4DV4K 2W41A 3ATVA 4FWNA 3H6EA 3AVGA 2YNHA 4NXNK 3SAGA 1JLGA 2ZD1A 4JHDA 5GADP 3C0BA 4DV1K 1TYQB 2B5JA 4WQ5A 3VQAA 4BDYA 4CFAA 2YHAA 3VQBA 3CFRA 4EHUA 4F4KA 1XC3A 2NNWA 3AVMA 5J2NA 2YNGA 4Z4FA 2Q2RA 3DOLA 3BEXA 3AO1A 2ETJA 5AQYA 1XI1A 3DYAA 4FSVA 4H4MA 5KQ8A 4JI0K 4FWLA 5C15A 3LANA 4O8UA 3N4PA 1ASVA 1NBWA 3I8BA 4HWIA 3S41A 3VPZA 3CF5L 1W97L 3WNEA 2W6KA 4FLWA 3B6OA 3SUOA 1TKTA 2UXBK 2WC9A 3EZ5A 4JKBA 3NGIA 4JKGA 2ZE2A 2G8UA 1ZBHA 1KVCA 3PO4A 5AQHA 1HRHA 1MWKA 3H3OB 4ISEA 5KI6A 2FBTA 1HNVA 3RSEA 1YTAA 4RG8A 4ISFA 1Y97A 2KQ2A 2QWPA 4UY8O 4BRCA 3AA5X 1SZ2A 3QMLA 3QEXA 3SPZA 4CK1A 3KHYA 1C1CA 1W2BM 2WUSA 5EY4A 4B9LA 1U45A 3ZX2A 3DLRA 4E1JA 3QEPA 4DV3K 2P9IB 3DLGA 4W5RA 3L0QA 1VQNN 3C6HA 4O8KA 1JCEA 3H46O 4CHZA 4CE9A 3PIOL 4JI2K 2Q0RA 3HL8A 2Z1IA 4NLCA 2QTDA 3TSQA 4EP4A 5J2PA 3ID8A 1SKSA 3O9QA 4WYBA 3AVKA 3OYIA 5FRMA 5AQSA 1U4BA 5MLCQ 1GOAA 4RTFD 1RT4A 4E3SA 4KKOA 2HHVA 4FJKA 1YVUA 3RMAA 4QS8A 1KAXA 4DR3K 1C0MA 3A5MC 1RBSA 3P31A 3AAPA 1RDCA 1K8KA 5CZ2A 1D8YA 2D0BA 4B3SK 1NNEA 2GWJA 2FBXA 4CJSA 3CQXA 4W5OA 4I9QA 3C6AA 3K5MA 3H1VX 2OTJN 2IS3A 2IVOA 1LWCA 4M45A 3KLGA 1XNQK 3J7ZO 4J2AA 3O4QA 4RW9A 5K14A 3TAEA 1C0TA 5AQXA 4GVMA 3AGRA 3WXJA 1R0AA 3PV8A 4ICLA 1WSFA 1S1UA 3ZX3A 4DQPA 2AP1A 3S3OA 1S22A 4O5BA 3BZCA 3HYFA 4BR7A 4CFBA 4EFHA 3VQ7A 1NKBA 3SQ2A 1NGEA 1T6DA 3ZETB 4H03B 2P9UA 3QIPA 5HOOA 5IT9O 1VQMN 4OJRA 4WFBL 3V9XA 1TV6A 3U6FA 4FJ7A 1Q9YA 1KAZA 4DTXA 4CF2A 1CXQA 4A5BA 5DK5A 1X3NA 3IRXA 2VGMA 4IKFA 4MDBA 1QZ5A 2E6LA 3O4WA 3MK6A 2QXLA 5HRRA 1L5UA 4DR6K 4DV6K 2F9WA 1KVAA 5E84A 5AQNA 4BC2A 3SK3A 1TUUA 3ENHA 5KGXA 5LY3A 4AHUA 4KFBA 1WSHA 3O3GA 5AQOA 1DTTA 3VTIA 1BCOA 3L2QA 3CHWA 3HI0A 4KREA 1O13A 1NK7A 4BR5A 4EHTA 3QLHA 3BGRA 1S1XA 3C7NA 2E2QA 2V7YA 4LH5A 3MXIA 3QFUA 4FWPA 3NCIA 5KQDA 3OTOK 1NKEA 3B6PA 4YOUA 5AQRA 3ZT3A 1HUXA 4FOEA 4J2BA 3KWIA 1BDGA 5I42A 4FK2A 3M6GA 2F8TA 4EIAA 1OVYA 2P9PB 3VN5A 4B3TK 3H45C 1UA1A 3TTDA 3NF8A 1LOTB 4ILHA 4BR0A 4IEIA 2NRVA 4EP5A 3AO5A 3QEVA 3ISNC 3ULEA 1K6YA 1NGAA 5BPMA 2VWBA 3LDQA 3O9UA 5AR0A 4JI8K 2D1KA 4DTJA 3WUHA 2PFUA 4Z0UA 5LJWA 1ZBLA 1KTQA 1RT6A 4X62K 3K2PA 4IOCL 1D5AA 3D0PA 1Q7YO 4FK0A 3T1HK 1FXXA 1HX1A 3FFIA 3HZ6A 2BUPA 4BE1A 3CJCA 1GLFO 4DSKA 4BR4A 3VGMA 3WXMB 1IKVA 4CIGA 3L4QA 3HVTA 4FW2A 2FBYA 1VSJA 4C8LA 4DTUA 4JKGB 4PWDA 2PBDA 2QWNA 2YHYA 3KZBA 4KO0A 3VA3A 1WNSA 3K59A 2P9SA 3OVNA 5AQMA 4E19A 4OO1J 4PKIA 3C65A 3VGKA 2BTFA 1S1TA 4DU4A 4BDPA 3VETA 1UAXA 3L3UA 1QSYA 2HHXA 3D7EO 3CC7N 1KXPA 3CC2N 3J81O 1QQMA 3QESA 2YHBA 1A5VA 1S9GA 1YUWA 2E4LA 2HNDA 4CECA 1P90A 4B9UA 2QEXN 1BI4B 1N34K 2P9KB 2P9NA 4LH4A 4BRHA 3SZ2A 1KD1O 3GL1A 2HMIA 2IVNA 3U3YA 2I5JA 3LDSA 4B1WB 1QE1A 2E2OA 1IBMK 2HBJA 5SZTA 2UXCK 4KTWA 4W5TA 2XY8A 4FJMA 3CETA 2HW3A 3OYEA 4JKEA 3BP8A 1VSIA 1KVBA 1GLEG 1JXBA 2XY6A 1SL0A 4IWVA 3AO3A 2GWKA 1SUQA 3DXKB 1DGKN 2GV9A 2O4GA 3MN7A 4YDUA 1K8KB 3P4IA 4K43A 1HLUA 3SAHA 3QDKA 1WB9A 4BG9A 1RBRA 4JKAA 2A40A 4LF4K 3V9ZA 1G15A 4BRMA 2JGUA 3AA4A 1YTUA 3CD6N 4OKKA 3SQ1A 4DLGA 1NJXA 1VSMA 3OYNA 1VSKA 5GIPA 4HUGA 4DF4A 4Y1DA 1J5EK 4OLBA 5GIOA 4CGGA 1CZAN 1ESVA 3M8QA 5ADXH 1SAZA 2Q36A 2B4JA 3QB0A 4A61A 5JVHL 4CEBA 3VQ6A 2QM1A 3KLFA 5JLFA 2B6AA 3HM9A 1BGXT 4FLZA 3IKMA 5LMNK 3CCEN 4FJHA 2VG7A 4OVLA 4I6MA 3K9JA 4FZZA 3H3NO 2O8CA 1S6PA 5EXWA 5HROA 4FWOA 1LW0A 3MMVA 4X65K 4LF8K 4H5WA 3TTCA 3RWUA 3O6WA 3ZSZA 2VWJA 4KH4A 3KLIA 4FWMA 4DTRA 3I55N 4DV0K 5J2QA 3SNNA 1RBVA 3H08A 5M1OA 4CHYA 4R79A 1NGHA 3ID6A 1SL1A 3PIPL 3MN5A 4JV5K 4HCCA 3O9RA 1NGCA 3TAFA 4I7FA 1U49A 2NRWA 4E7JA 1C0UA 4FM2A 5AZIA 1W0HA 1W7AA 4LSLA 4K8ZA 3FFKB 3UKRA 2BE2A 2NUBA 4A2BA 2E2PA 1BIZA 4IJNA 4CJPA 3RRHA 2FLOA 4JD2A 4AM7A 3HPOA 4DTPA 3V81A 1RDAA 2P5OA 1CXUA 3AVBA 1U2VB 4CZFA 4CGHA 2EHGA 3TARA 1Q81O 1K9MO 1G99A 3IUCA 1NJZA 5GAGP 3RR7A 5AJ3K 4KTZA 1I39A 3VENA 4AF1A 3SAFA 1R59O 3TAMA 5J1EA 1VQ7N 3EYZA 3VEWA 4BVPA 4I9LA 1B92A 3MN9A 4AHTA 5D3GA 3QBXA 3LP1A 2R7YA 2P9LA 3DLEA 1LW2A 3SQ4A 2QWMA 1NG9A 1KFSA 1RDDA 4DFMA 2V52B 3ZLJA 3O9SA 5FPEA 3BUZB 3EO3A 4XH5A 4B9QA 1XMQK 3KIOA 4M63C 4O0JA 1ASWA 1J53A 1RGIA 3NHGA 1NK4A 1X9MA 5DMRA 3MEDA 4CEQA 1HJOA 1Q82O 4DG1A 4E1MA 2PYJA 4BE0A 2RF2A 2F96A 4FJIA 1HKBA 4H5NA 5BPNA 3ZEUA 4B1VA 4FWQA 3KLHA 3VQPA 3O3FA 5M1KA 4CJFA 4CIEA 1N36K 3PX0A 1KQSM 3HK2A 2O8DA 3HRGA 5F0XA 1LCUA 3SJJA 1IBKK 1RTDA 3VEVA 1UA0A 1P8ZA 5ADXA 3WNFA 4JI5K 3VQEA 1IG8A 4PA1A 4BACA 3F9MA 4CJWA 4B8AB 1QHTA 3AVLA 2UYTA 4RWTA 5CY4A 5DM6L 4W5QA 1RT3A 3AY9A 4DTSA 4DS4A 3V9SA 1VQ6N 2YKNA 4ZTFA 1E3MA 2E1YA 1C1AA 3CMAN 1V4SA 4K25A 1EWRA 4KB0A 1JLCA 2HBMA 1KC8O 4LFCK 1YVNA 2O8FB 4WQ4C 3LZIA 3KJVA 1C1BA 2KFZA 4M42A 3DLBA 5CYMA 1BIUA 3QNNA 1NU0A 2ZM6K 1NK6A 1GLDG 5GAHP 4PL7A 2E8AA 4BRPA 4CESA 1BA1A 3VEZA 1ZBIA 1HKGA 2VQEK 2HHQA 4DLEA 3A5OC 5EVZA 4Z4GA 2Q1NA 5FLXO 3P38A 4DCHA 2HBLA 3G6EN 1NJWA 3P83D 4A5AA 4F8RA 4CJRA 2EX3A 3L2VA 4N56A 4KI4A 1NJYA 1RCHA 3NH2A 4IXCA 1T44A 1RNHA 4FJ8A 1ASUA 5FRNA 1RT5A 3DOKA 3CJ9A 3CPEA 3P1GA 1YHQN 2QWQA 3SUNA 3K0SA 2GX9A 3HPGA 4IEEA 3KD5E 1S9EA 4NO7A 4CJ7A 3EKSA 3M5RA 4WCEL 4C1NK 4FW1A 2O8BA 3AAQA 1RTIA 1DEJA 2FF6A 4JYAK 3AVIA 4DHYA 1EP4A 5KPRA 4FJGA 3LPTA 4FL9A 4ELVA 2ZQBA 4KH5A 3FR0A 2HNYA 3ZSQA 2PY5A 4HTLA 4CGFA 3VOVA 4CD1A 3WQUA 5HP1A 4JRQA 1XWLA 2E5LK 1WSIA 1KAYA 1NMNA 4DSEA 3LP2A 3ENOA 3OYLA 3J7YP 3L2UA 4CGJA 3R8EA 4BRKA 4ISGA 1Z25A 2YHWA 3FE1A 2RN2A 4IOAL 3NF7A 3QICA 3LDOA 3F9KA 4AQYK 1M90O 2O8EA 5CHIA 3KLEA 3CCRN 3VGLA 4LC9B 4O44A 3THVA 1HR0K 1DT9A 5B8HA 3LWMA 4DSLA 5KGWA 3WXIA 3LL3A 3MECA 3FZHA 1U47A 2KLAA 4MLHA 3MXMA 4NB4A 1KRPA 4JKDA 3PY8A 3JAMO 1C0FA 5GINA 3NVKA 3MDQA 1C6VA 3UKUA 1YJNN 3ASMA 3DJCA 4DB3A 1HQEA 4OPAA 4MDAA 3PO5A 4K41A 3OJUA 4YFUA 3QIOA 3CCLN 3KTQA 3OYCA 1T7PA 2ZJQL 2CGKA 1GLBG 1ZBUA 3K5LA 4B9VA 3PSIA 4OPJA 4H5RA 3NBPA 2ZJPL 4B1YB 3QERA 1TL3A 3SV3A 1TK0A 3AV9A 4U7BA 4C8OA 1A5XA 3OA9A 3SUQA 4HCBA 4FYDA 3D6RA 4CJ3A 4CVNE 1SS6A 4Z4IA 4Q5VA 3QBWA 3DLKA 3ZEUB 1JJ2M 4Y0WA 1NKCA 5HRSA 3HSTB 1IG9A 2HHWA 4A62A 1B9DA 3IG1A 4YOXA 3RTVA 1RFQA 3MEGA 4WQ4A 3TANA 1JKHA 2DFHA 4DMNA 5AQLA 3R6MA 1L3SA 2F9TA 4LFAK 1FJGK 3VF2A 3LDPA 1TAUA 1Y64A 4CEOA 4B9NA 1QHAA 3OYKA 4BVOA 1KLNA 4DKWA 2KKZA 3SBTA 3E9OA 1VQKN 1KFDA 3TPQA 1VQ4N 3C6UA 3CIPA 3G71N 2XHBA 3AGKA 3PLAA 3CCVN 5HLFA 1ZYQA 1X9WA 1YITN 1N8RO 4FJXA 2AA4A 3L4IA 1WSEA 3CCSN 3ZT2A 4DTMA 4O0IA 5FPMA 3O4NA 3WT0A 5C2FA 1RTHA 3A0IX 3D2FA 2HVIA 4CCHA 2X6NA 1N33K 2F7TA 2NRHA 4JHDB 2BANA 2XY7A 1LAWA 3LM9A 4UQGA 5LMUK 5FROA 4OLAA 4YHHK 3R9PA 2O4IA 4R5PA 4CJ4A 3THXA 3DAWA 3O1WA 4DV7K 3SUPA 4FWKA 3KD1E 3NGYA 3JSMA 4JKFA 1BL3A 4MO5A 2GBZA 3N4QA 4JS4A 3CFOA 2W42A 4KHSA 4TSXA 5JMVA 1Z05A 3MN6A 4CJUA 4LF7K 1NK5A 1BOTO 5C0YA 4GV6A 3B8AX 3LPUA 4IO8A 4M3WA 5C10A 3ZSVA 3HO1A 4PKGA 3EEQA 4LF5K 1BUPA 4CZLA 1IKWA 2A1RA 4N47A 1HNWK 3F73A 2VG6A 5AQKA 3CCQN 3QNOA 3AO2A 3RSEB 3RR8A 4CERA 4ILGB 5CZ1A 3VERA 1KCFA 1EETA 3RVCA 4A59A 3MCPA 2YI1A 2ZJRL 4DTOA 2QW9A 1Q8IA 4ZHRA 4DU1A 3NDKA 2W6LA 3E9PA 1VRTA 2D5RA 1BO5O 2Q0UA 3I56N 2G8HA 2DFEA 4FM0A 3UIQA 4DR1K 4DR4K 4AHVA 2IOCA 3KWGA 2NRRA 5KPZA 2HMPA 4BQZA 5AFUH 4IOXA 3BZKA 5DM7L 3ZSWA 4KHQA 1A5WA 3E9LA 4C8NA 4ELTA 2ZWHA 1XHZA 2GTDA 4CFCA 4EZ9A 4OPHA 3K5OA 1JCGA 3MWTA 4NXMK 2A41A 3K9KA 4C8KA 5M1QA 3AA2A 5HRNA 1F21A 1QS4A 3FLCO 3I0RA 4PHTX 2E88A 2FSNA 5BR8K 4YOWA 3RRGA 3AVHA 4QS9A 2HOEA 3RMDA 4BR2A 1IKYA 2YJEA 3VF6A 4JKHA 3U3GA 3T1YK 1FW6A 3O9TA 3LZJA 2CH5A 4B1XB 3DRPA 4FPBA 4ILJA 4J2EA 4NCAA 1C0GA 1YXQA 1NGBA 2NRTA 4JK7A 3DM2A 1ATSA 2EWSA 2GUPA 3EZWA 4DR5K 2NZTA 4FLTA 3I8DA 3QFPA 5I3UA 1TYQA 1TKDA 2XO7A 4Q0BA 4IZ9A 1YI2N 4CBWA 4CGIA 1NK0A 3NVMA 4JI6K 5AQIA 1YJ9N 2IDOA 4FJLA 4DR7K 2ASMA 5EX5A 3CCJN 3CJAA 3OYMA 2P9UB 4RW8A 5SWMA 1X3MA 4F9OA 3S3NA 4LF9K 1NOYA 3QETA 3HJFA 4BRFA 4CJQA 1VSEA 4Z4EA 2IAJA 3P5JA 4E1NA 2YNFA 3OS2A 3DLHA 4JI7K 2NRZA 3CQ8A 2G8WA 3HTVA 5AQFA 3ZSXA 5LJVA 2ZGZA 1SKWA 1FKOA 1RT1A 3LDLA 3VQ9A 1EKEA 4O55A 1CLQA 2E2NA 2NRXA 1ZBFA 3G0ZA 4B3MK 3VEXA 3P39A 2UUBK 4DSIA 1GLLO 2E1ZA 4V19S 5EOYA 4KI6A 2HHUA 1QQNA 4CJ5A 4KH6A 5AQWA 4IFYA 3SCXA 1N6QA 2ZF5O 1IH7A 3T69A 3UE5A 1YJWN 4BRAA 2P9IA 4FVUA 3U8XA 4YY3K 3C7NB 3Q7BA 4LF6K 1MDUB 4YOVA 3R1XA 4CD3A 1XUPO 5AQPA 4MQ3A 4CEEA 5I9EB 5KTQA 4W5NA 3LALA 3C6TA 3E1YA 3A2FA 2Z1GA 3D2FB 3IAYA 3CJ1A 2RPIA 4KHUA 1NMDA 2HF3A 1NOZA 5BRHA 2A42A 2UU9K 2OTLN 5F1XA 1HPMA 3LAMA 5C2DA 3ULEB 4BRNA 4OPKA 3G4SN 4FWRA 4KHPK 4H0XB 3MCAB 2HBKA 3D2EA 5JS1A 3V6DA 2WOMA 3EE9A 3JS6A 4CZHA 3OYBA 3ENBA 2DFFA 1SKRA 4BREA 1LWFA 2P1JA 3TR8A 1DKGD 3M8PA 2G8FA 1DLOA 1HNXK 4QCLA 1BU6O 4O4GA 3HOSA 4N41A 4GV3A 1L3TA 1B9FA 4YOTA 4CK2A 2HHTA 2ASPA 3BY5A 4RCHA 2Q3SA 3OYAA 1V4TA 3T19A 3I33A 4NCGA 5AQTA 4M41A 3T1AA 3TWHA 3SYZA 3O5BA 2OA8A 1LV5A 1YIJN 2P9SB 4XEIA 5JS2A 4HTUA 4DQQA 2VG5A 5M1NA 4E0DA 1HQUA 3CM6A 1XHXA 3EY1A 3C94A 3CJBA 4F3OA 1RTJA 3TAGA 1X9JA 4BGAA 1VQON 4CHPA 2IVPA 4JK9A 5AQZA 3H1QA 1GLJO 3ZSYA 4U67L 4CZIA 3AVCA 1OKJA 4QAGA 2RE2A 5BPLA 5ELZA 2P9NB 4GNIA 1IKXA 1S72N 4HHTA 1WAJA 3DI6A 4JK8A 2D0PA 1NM1A 4HUFA 4H5TA 4MO4A 4B3OA 4CBXA 3SBGA 3OYJA 4CF1A 1I3AA 3AVNA 2QWLA 1XNRK 5M1PA 1RDWX 3M8RA 4DQIA 2KTQA 3FZMA 2OANA 1HYZA 2YCHA 3G10A 3SLCA 4BRDA 1OVQA 1WOQA 3RMCA 4H0VB 5FDLA 3LM2A 4KV8A 2X78A 2G8VA 3BDPA 4M3TA 2DPNA 4X64K 5BR9A 1REVA 1OH7A 2YNIA 5C12A 1VSLA 5CR4A 5E26A 4BC4A 1JLFA 3KK1A 4M3RA 2XY5A 3OYGA 3WNHA 3Q7CA 2V7ZA 5BN9A 4CHQA 3VQCA 2P5GA 1ZC6A 4H0TB 1WBDA 2P9PA 4CEZA 2E6MA 1JL1A 2UXDK 4N76A 1NK8A 4B3RK 1E4GT 4CJLA 3GBTA 3IFRA 1VHXA 3PUFA 2HHSA 4ID5A 3VQDA 1S3XA 3VTHA 4CHOA 3GG4A 1HNZK 2FC0A 4G1QA 1Z6RA 1NK9A 2Z1HA 1QSLA 3QEWA 1KSPA 4E7KA 2F8SA 3KKRA 4BGBA 3TSPA 3UB5A 1FK9A 2OPQA 4M3YA 1FKPA 4DSFA 3LP3A 2ITMA 4PKHA 1QQOA 2PZSA 2VCPA 3ZX0A 3AVJA 4KAZA 2QK9A 4I6MB 4YOYA 1WSJA 1S6QA 3F2KA 4CJEA 1NJIO 2O8CB 3EN9A 3HP6A 4FWSA 4CHNA 1UWBA 1I94K 3DXMA 3KK3A 2Y1IA 4M7YA 1VSHA 1HJRA 3V1QA 1BA0A 3W0LA 4JEPA 1IBLK 3U9ZA 3VQQA 4FVMA 3T3FA 2WTUA 4BC5A 1NGDA 4RW7A 1HKCA 4BRGA 1IO2A 2XRIA 4E7HA 2X74A 4H0YB 4DF8A 3U9DA 4KHWA 4IFVA 4B1UB 4FLVA 4AILC 5AZIB 1WN7A 5M1FA 1WUAA 2G8IA 3UKRB 2QA4N 1VSDA 3DRRA 4WFNL 1QSSA 1J9AA 3V4IA 4WE1A 4FO0A 3VF4A 3ZT4A 1QVFM 2BDPA 4JD2B 1BI4A 2P9KA 3DMJA 5BREA 3WNGA 4WF9L 4MLEA 1RDBA 3A5LC 1QZ6A 3VESA 4BG8A 3TI0A 1WLJA 3TU5A 2IC3A 3J8AA 4M7XA 2HVHA 2VWKA 2KW4A 2D4WA 3CCMN 1NWKA 2I7NA 4CZEA 4DV5K 1ZBSA 1VK0A 2QWRA 3HT3A 2KZZA 3IMXA 2A5XA 2JWLA 3L8BA 2OZMA 3HP9A 1VQPN 2LSNA 4CI6A 3K5NA 3D2EB 5EU7A 4BWJA 4KPYA 3DXKA 2P9LB 3RMBA 2A1SA 2H3GX 4JI4K 4BROA 3SMSA 2JLEA 5HRPA 1ILYA 4AM6A 4DFKA 4BRIA 3CPWM 1SL2A 2HF4A 1VRUA 1HPZA 4DFJA 3OHRA 4A57A 3KKSA 3G25A 3ZSRA 4ID1A 4JI3K 4BQLA 1U6ZA 1K73O 3D45A 4XH4A 5C25A 4B1ZA 3LAKA 1GOBA 4GW6A 4XH1A 4E89A 2ASOA 3LP0A 1GLAG 2HSTA 4H0PA 3WXLA 4GKJK 3CQYA 2RHKA 4RW4A 1T05A 1L3UA 3O3HA 3HXMA 3R3LA 4OGEA 2BGGA 4YDUC 1JLEA 3FZKA 1ATRA 5BRFA 1H1VA 4B9TA 2OYQA 4CJTA 3AO4A 5KPTA 1BWFO 2AJQA 2O8DB 4BRLA 3NH1A 4CF0A 3AA3A 3OW2M 4KHNA 1BQNA 3HVRA 3ZT1A 2PAVA 3AARA 4KTQA 1VQ5N 4FJJA 1Q18A 3OBWA 4Z4HA 4H4OA 3NF9A 5A2QO 1JL2A 3HSCA 3L2RA 3HOTA 2CGJA 4DR2K 2DTUA 3SI6A 3VQ4A 3HPHA 4CF9A 5BN8A 4CEDA 4F2SA 2E20A 4IDHA 2OCEA 4M3UA 3CCUN 5HBMA 5CE3A 3THWA 3NGZA 2RKIA 4JRPA 3LDNA 4L8RB 1RT2A 1JCFA 4NLBA 2QI2A 4CJVA 4FZYA 1UOCA 1VAZA 1WSGA 5IWAK 1T3VA 3IS9A 5AQVA 4FLXA 2OPPA 1RILA 1J6ZA 4C8MA 1U2VA 1U04A 2G8KA 3CXCM 4DWIA 3NAEA 4BE2A 1S5JA 1VQ9N 1CZBA 4BWMA 4LY7A 1J54A 2FF3B 1TKXA 2BH1A 1Q86O 1BQMA 1QVGM 4NCBA 4OKJA 2FBVA 2FSJA 4CIFA 3KVGA 4CBUA 5TKWA 3I0SA 4F3TA 1TAQA 1X1PA 4O5FA 3CM5A 1MWMA 5JVGL 1NLVA 4DV2K 4FOIA 3QINA 4Z94A 3QEIA 3GOIA 4FM1A 3ZSOA 3CJ7A 2NLXA 1L3VA 1VQ8N 3U4LA 2Y1JA 3E66A 5JLHA 3THYA 4C23A 2OZSA 4OGCA 4DSJA 4DQ8A 1N32K 1YF5L 2O8BB 4KHYA 2F4VK 4LFBK 3DRSA 4JLHA 4CW7B 5AQJA 1Z26A 4GKKK 3VEOA 4CGDA 2PYLA 2W40A 3DXMB 3ITHA 3WEEA 4FZXC 2Z1JA 1TK5A 4IDKA 4J8FA 3ALYA 4CK3A 3PSFA 1W9HA 2X6SA 4J2DA 1LAVA 4PL8A 4CZKA 4Z4CA 3MXJA 3E01A 5F2RA 4H0OA 1TGOA 4ELUA 4E7IA 2HHHK 1JXEA 3A5NC 4C1NI 1D9DA 1HYSA 4EAHD 4I2QA 1JLBA 1TK8A 3MX5A 5BRDA 4DFPA 1JLAA 2CH6A 4JS5A 3ZCMA 1EX4A 4YORA 1VSFA 2DY4A 3A8YA 2V51B 3L3VA 4IG0A 3O08A 2GELA 2O8EB 1HNIA 1ZXOA 4AHRA 2FXUA 4JN4A 3OYFA 1LWEA 3OYHA 1OH5A 5CYQA 2QKKA 2J4RA 5AZJA 4DQRA 4FJ5A 3K58A 5T7BA 1BG3A 1D9FA 4QS7A 3TTFA 4GV9A 5HL7L 1T6CA 3VMFB 3OBYA 3O1BA 4IG3A 3SPYA 4XIUA 3VA0A 4CF8A 3S9HA 4CZJA 3VEYA 4OX9K 4PQUA 4DTNA 2OPSA 5J2MA 2YKMA 3UKUB 5KRTA 5KRSA 2OPRA 4CZMA 3SV4A 2O8FA 3FZFA 2P51A 4JAXA 4Y1CA 5C42A 3BF1A 2Q31A 5AQUA 1EXQA 4CFDA 4IBNA 4BRQA 1ITGA 1KLMA 1MA9B 4M3XA 2D0OA 4LSNA 4PUOA 1O1WA 3MX2A 5E41A 4NYFA 4H5VA 4FK4A 1S1VA 4LD0A 1RBTA 1TKZA 4K8XA 2A6AA 4JKCA 4FLYA 5TKYA 2JWKA 4FJNA 4L3QA 3MEEA 4CEFA 3FZLA 1E4FT 3MWPA 3ULDA 3SQ0A 1XMOK 4M3ZA 4DU3A 1GLCG 2IIRA 3KK7A 2A3ZA 1TUYA 2HNZA 4E7LA 2KHOA 4GVEA 3HBTA 3OYDA 1BCMA 1BHLA 2YJFA 4ZTJA 1OH8A 4I2PA 4KB1A 4FJ9A 4GMJB 5JICA 4CZGA 3PX6A 1BISA 1T03A 4YNQA 1QQCA 4CEAA 3VQ5A 1DTQA 2QKBA 3CC4N 4KBOA 3M3ZA 3ATUA 3NE6A 4KRFA 4WQ5C 3C95A 3DLLL 4F2RA 5AQQA 3FGUA 3J80O 3O8MA 1T8EA 3V9UA 2I7PA 3MAQA 3EL2A 2ATQA 2VQFK 4NYNA 3L6QA 1QTMA 2YHXA 3L2WA 5AQGA 2D0AA 3V1RA 5H1SQ 1K8AO 3M1FA 1SQKA 3IDHA 2WBNA 3SJHA 2KFNA 1IV0A 4MFBA 3KK2A 3W3DA 4X66K 3BF3A 3OS0A 4BDZA 3QO9A 2UUCK 2Q97A 3THWB 4FCYA 1IJJA 1TVRA 4BR9A 3GE1A 2YX6A 1S1WA 4JNEA 4GY2B 3VQ8A 5C24A 2HB5A 2YV0X 5LL6Z 4AHCA 1U48A 1CZ9A 4RW6A 1SV5A 4FPAA 4N5SA 1TL1A 3PX4A 3CYMA 5AFUA 3THXB 1XQSC 1HYVA 2D0CA 3TABA 3EKUA 1NGIA 3M8SA 4IFEA 3V9WA 4OKEA 2KZMA 3K57A 3CG7A 3NH0A 2ZGYA 4QOZB 1EQYA 1VQLN 4B8CA 2WFBA 3OJSA 3NMUA 3CI5A 1ATNA 3ZT0A 3AVAA 1NGGA 1N5YA 3THYB 3DWLA 4IO9L 1YT3A 3LWLA 4K42A 4FXDA 3TAPA 1NGJA 2VGNA 3WXKA 3S3MA 1RDUA 4EZ6A 4HVJA 4DQSA 3AVFA 3WQTA 3WEEB 2UUAK 1HMVA 1MU2A 5FPNA 3CERA 1GOCA 3ZETA 4BC3A 4WFAL 4HUEA 4AHSA
chains in the Genus database with same CATH topology
3NF6A 2BDPA 1LAWA 4UQGA 2QXFA 4CGGA 3TAQA 1BI4A 3M8QA 5FROA 3DMJA 4OLAA 2B4JA 1JLQA 4B08A 3WNGA 1RDBA 2O4IA 4R5PA 3CFPA 4CEBA 3VQ6A 4CJ4A 3TI0A 3KLFA 3NFAA 4B9SA 1WLJA 2IC3A 2GUIA 2B6AA 3HM9A 1RT7A 1BGXT 4FLZA 2HVHA 2VWKA 1WAFA 2KW4A 3SUPA 3KD1E 4DS5A 3NGYA 1XC9A 4FJHA 1Q9XA 2VG7A 3JSMA 1BL3A 1VK0A 2GBZA 3HT3A 4OVLA 4JS4A 2KZZA 3CFOA 3OY9A 2W42A 3V1OA 1J5OA 3L8BA 4FZZA 4KHSA 1S6PA 4TSXA 3HP9A 2OZMA 5HROA 2LSNA 3K5NA 1LW0A 1X9SA 5EU7A 4BWJA 4KPYA 4CJKA 4CJUA 1NK5A 4FLUA 2WONA 3RWUA 3LPUA 3ZSZA 2VWJA 4H8KA 2A1SA 3JYTA 3ZSVA 3RMBA 4B9MA 3KLIA 4M3WA 3HO1A 4PY5A 3OS1A 2JLEA 4AH9A 5HRPA 4DTRA 2IGIA 1IKWA 4DFKA 4N47A 5J2QA 1RBVA 3H08A 4CHYA 3SNNA 2A1RA 1RBUA 1SL2A 3F73A 2VG6A 3QNOA 1VRUA 1SL1A 1HPZA 2ITGA 3AO2A 4DFJA 3RR8A 4HCCA 4CERA 5CZ1A 3TAFA 3KKSA 1KCFA 3ZSRA 4ID1A 3AVGA 4I7FA 2YNHA 1EETA 1U49A 4E7JA 1C0UA 4DTOA 4FM2A 1Q8IA 1W0HA 1JLGA 4ZHRA 4DU1A 3NDKA 4LSLA 3D45A 2ZD1A 1VRTA 2D5RA 4K8ZA 2BE2A 2NUBA 5C25A 1BIZA 2G8HA 3LAKA 4CJPA 1GOBA 4GW6A 4E89A 3RRHA 2DFEA 4FM0A 3UIQA 4AHVA 2B5JA 2IOCA 3LP0A 4DTPA 3VQAA 3HPOA 3V81A 4M3XA 4BDYA 4CFAA 1RDAA 2P5OA 2YHAA 3VQBA 3CFRA 1CXUA 3AVBA 4RW4A 4F4KA 1T05A 1L3UA 3AVMA 3O3HA 5J2NA 4CGHA 2EHGA 2YNGA 3TARA 4Z4FA 3HXMA 3DOLA 4OGEA 2BGGA 1JLEA 3AO1A 3ZSWA 1NJZA 2ETJA 1A5WA 1XI1A 3RR7A 4KHQA 3DYAA 4H4MA 4KTZA 1I39A 4B9TA 4CJTA 2OYQA 3AO4A 4C8NA 3LANA 4ELTA 1XHZA 1ASVA 3TAMA 5J1EA 2AJQA 3NH1A 3EYZA 4CF0A 3AA3A 4CFCA 4EZ9A 4KHNA 1BQNA 3K5OA 3HVRA 4I9LA 1B92A 3WNEA 3ZT1A 4FLWA 4C8KA 4KTQA 3AA2A 3B6OA 4AHTA 5HRNA 3SUOA 1F21A 1QS4A 1TKTA 4FJJA 3EZ5A 3NGIA 3I0RA 5D3GA 2ZE2A 2G8UA 1ZBHA 4Z4HA 1KVCA 3PO4A 3LP1A 4AHSA 2R7YA 4H4OA 3DLEA 3RRGA 1HRHA 3NF9A 3AVHA 1LW2A 3SQ4A 3L2RA 1JL2A 3RMDA 1KFSA 1RDDA 4DFMA 2DTUA 3SI6A 1IKYA 3VQ4A 3HPHA 5KI6A 2FBTA 4CF9A 1HNVA 3U3GA 1YTAA 3KIOA 4RG8A 1Y97A 2KQ2A 4O0JA 4CEDA 3LZJA 4F2SA 1ASWA 1J53A 3AA5X 3DRPA 4M3UA 3QEXA 3NHGA 5HBMA 4CK1A 3SPZA 1NK4A 4J2EA 4NCAA 1X9MA 5DMRA 1C1CA 3MEDA 3NGZA 4CEQA 2RKIA 4DG1A 4JRPA 4E1MA 2PYJA 4B9LA 3DM2A 4BE0A 4L8RB 2RF2A 1RT2A 2F96A 1U45A 4FJIA 4FZYA 4CJVA 5I3UA 4FLTA 3I8DA 1UOCA 1WSGA 3DLRA 3IS9A 3QEPA 3KLHA 1TKDA 2XO7A 3DLGA 4FLXA 4Q0BA 4W5RA 2OPPA 1RILA 3VQPA 3O3FA 4CGIA 1NK0A 4C8MA 1U04A 4CJFA 2G8KA 4CHZA 4DWIA 4CIEA 3NAEA 4BE2A 1S5JA 2IDOA 4CE9A 4FJLA 1CZBA 3HL8A 2Z1IA 4BWMA 4LY7A 4EP4A 1J54A 5J2PA 1SKSA 1TKXA 3PX0A 3AVKA 3OYIA 5FRMA 3OYMA 1U4BA 1BQMA 4RW8A 3HK2A 4NCBA 4OKJA 2FBVA 3SJJA 1GOAA 4CIFA 5SWMA 1RT4A 1RTDA 4E3SA 3S3NA 3I0SA 4KKOA 4F3TA 1TAQA 2HHVA 1X1PA 1NOYA 3CM5A 1YVUA 3QETA 1UA0A 4FJKA 3RMAA 3HJFA 3WNFA 3VQEA 4CJQA 1VSEA 4PA1A 4BACA 4Z4EA 2IAJA 3QINA 1C0MA 3P5JA 4CJWA 4B8AB 3QEIA 4E1NA 1RBSA 1QHTA 2YNFA 3AVLA 3ZSOA 3OS2A 4FM1A 1L3VA 3DLHA 5CY4A 1RDCA 2Y1JA 5CZ2A 4W5QA 1D8YA 1RT3A 4DTSA 3CQ8A 2G8WA 4DS4A 2D0BA 3V9SA 2OZSA 2YKNA 3ZSXA 4ZTFA 2FBXA 1C1AA 4CJSA 4OGCA 4DSJA 1SKWA 1FKOA 1RT1A 3VQ9A 4KHYA 1EKEA 4W5OA 1JLCA 3DRSA 4JLHA 4O55A 4KB0A 1Z26A 4I9QA 3K5MA 1CLQA 1ZBFA 3G0ZA 2IS3A 4CGDA 2PYLA 1LWCA 3LZIA 4M45A 3KLGA 3KJVA 4DSIA 1C1BA 3ITHA 2KFZA 4M42A 3DLBA 4FZXC 4KI6A 2Z1JA 5CYMA 2HHUA 1BIUA 3QNNA 1TK5A 4IDKA 4J2AA 3ALYA 3O4QA 4RW9A 5K14A 4CJ5A 4CK3A 4IFYA 3SCXA 1W9HA 2X6SA 3TAEA 1NK6A 1N6QA 1C0TA 1IH7A 4J2DA 1LAVA 4Z4CA 4GVMA 3MXJA 3PV8A 3E01A 1R0AA 4ICLA 1WSFA 4CESA 1S1UA 1TGOA 4ELUA 4E7IA 4DQPA 1ZBIA 1JXEA 2HHQA 1D9DA 1HYSA 3S3OA 4DLEA 4I2QA 4CEEA 1JLBA 4MQ3A 4O5BA 5KTQA 1TK8A 3LALA 3C6TA 4W5NA 3A2FA 3HYFA 2Z1GA 4Z4GA 4DFPA 3IAYA 4CFBA 1JLAA 3VQ7A 2RPIA 4JS5A 3SQ2A 1NKBA 4KHUA 3ZCMA 1NOZA 1EX4A 1VSFA 3P83D 1NJWA 4F8RA 2DY4A 4CJRA 2EX3A 3L2VA 3QIPA 3L3VA 4IG0A 4OJRA 4N56A 4KI4A 3V9XA 1HNIA 1NJYA 1TV6A 3U6FA 3LAMA 4AHRA 4FJ7A 1RCHA 3OYHA 3OYFA 1LWEA 3NH2A 1Q9YA 4OPKA 5CYQA 1RNHA 4DQRA 4DTXA 4CF2A 2QKKA 3K58A 5T7BA 1CXQA 4FJ5A 1ASUA 4FJ8A 5FRNA 1D9FA 5JS1A 3V6DA 1RT5A 2WOMA 5DK5A 3DOKA 3IRXA 3P1GA 3OYBA 4IKFA 3SUNA 4IG3A 2DFFA 2E6LA 3HPGA 4XIUA 3SPYA 1SKRA 1LWFA 2P1JA 4CF8A 3VA0A 3TR8A 3S9HA 5HRRA 3KD5E 1L5UA 1S9EA 3M8PA 2G8FA 1DLOA 4PQUA 4DTNA 4QCLA 2OPSA 4FW1A 4O4GA 5J2MA 4N41A 1L3TA 1KVAA 1B9FA 2YKMA 4CK2A 5KRTA 5KRSA 1RTIA 2HHTA 2OPRA 3SV4A 3OYAA 5KGXA 2Q3SA 2P51A 4Y1CA 3AVIA 4AHUA 5C42A 3T19A 1EXQA 4CFDA 4IBNA 1EP4A 4FJGA 1ITGA 3LPTA 1KLMA 4KFBA 4NCGA 4M41A 3T1AA 4LSNA 4ELVA 2ZQBA 4PUOA 1O1WA 3TWHA 3SYZA 1WSHA 2HNYA 3O3GA 2OA8A 3ZSQA 1DTTA 1LV5A 2PY5A 1BCOA 4CGFA 5E41A 3L2QA 4KREA 5JS2A 4NYFA 4HTUA 5HP1A 1NK7A 3QLHA 4JRQA 3BGRA 1S1XA 4DQQA 1XWLA 4FK4A 1WSIA 2VG5A 1S1VA 4LD0A 4E0DA 4LH5A 1HQUA 1RBTA 1XHXA 3CM6A 3LP2A 3EY1A 3C94A 4DSEA 3NCIA 3MXIA 1TKZA 3OYLA 1RTJA 4F3OA 3TAGA 4K8XA 1NKEA 3B6PA 4FLYA 3ZT3A 3L2UA 4CGJA 4FJNA 4J2BA 4CHPA 4FK2A 5I42A 3MEEA 1Z25A 3ZSYA 2RN2A 2F8TA 3VN5A 3AVCA 3NF7A 4CEFA 1UA1A 4QAGA 3F9KA 3ULDA 3NF8A 3SQ0A 4M3ZA 4DU3A 2HNZA 4EP5A 3KLEA 3AO5A 4E7LA 3QEVA 3ISNC 3OYDA 1BCMA 1K6YA 1BHLA 4ZTJA 1IKXA 4I2PA 4HHTA 1WAJA 4KB1A 4FJ9A 4GMJB 3DI6A 4O44A 3PX6A 4HUFA 4DTJA 4Z0UA 3THVA 4B3OA 1BISA 3LWMA 1ZBLA 1T03A 4YNQA 5KGWA 4DSLA 1KTQA 1QQCA 1RT6A 3K2PA 3MECA 1D5AA 3VQ5A 4CEAA 3OYJA 3D0PA 4CF1A 1DTQA 1I3AA 3AVNA 1FXXA 1U47A 4FK0A 2QKBA 3M8RA 3MXMA 4DQIA 3FFIA 1KRPA 3NE6A 3PY8A 2KTQA 4KRFA 1HYZA 3C95A 3G10A 4BE1A 4F2RA 1C6VA 3RMCA 3ASMA 4DSKA 5FDLA 1IKVA 1T8EA 1HQEA 4KV8A 2X78A 4CIGA 3HVTA 4FW2A 2G8VA 2FBYA 1VSJA 3V9UA 3BDPA 3PO5A 4C8LA 3MAQA 4DTUA 3OJUA 4M3TA 4YFUA 4PWDA 2ATQA 3QIOA 3KTQA 4NYNA 1QTMA 4KO0A 3OYCA 3L2WA 1REVA 1WNSA 2YNIA 3VA3A 1T7PA 1VSLA 3K59A 2D0AA 3V1RA 3OVNA 4E19A 1JLFA 1ZBUA 3K5LA 3KK1A 4M3RA 4B9VA 1S1TA 4OPJA 2KFNA 4DU4A 4BDPA 4MFBA 3KK2A 2XY5A 2XY7A 3NBPA 1UAXA 3L3UA 1QSYA 2HHXA 3QERA 1TL3A 3OYGA 3WNHA 3OS0A 3SV3A 4CHQA 1TK0A 3AV9A 4C8OA 3VQCA 4BDZA 1A5XA 2P5GA 3QO9A 3SUQA 3QESA 4HCBA 2YHBA 4CEZA 2E6MA 4FCYA 4FYDA 1TVRA 4CJ3A 1A5VA 1JL1A 1S9GA 4N76A 2E4LA 2HNDA 4CECA 1NK8A 4Z4IA 4Q5VA 3DLKA 4B9UA 1S1WA 4CJLA 3VQ8A 5C24A 1NKCA 3PUFA 5HRSA 2HB5A 2HHSA 4ID5A 2YV0X 1BI4B 3VQDA 4AHCA 1U48A 1CZ9A 4CHOA 3HSTB 4LH4A 4RW6A 3SZ2A 1SV5A 1IG9A 2HHWA 1B9DA 2FC0A 3IG1A 4N5SA 4G1QA 2HMIA 1TL1A 3RTVA 3U3YA 3MEGA 2Z1HA 1NK9A 3PX4A 3CYMA 3TANA 1QSLA 2I5JA 3LDSA 3QEWA 1QE1A 1KSPA 4E7KA 2F8SA 1HYVA 3KKRA 2D0CA 1FK9A 1JKHA 3TABA 5SZTA 2OPQA 4M3YA 2DFHA 1FKPA 4KTWA 3LP3A 3M8SA 4DMNA 4DSFA 4W5TA 4OKEA 2XY8A 3V9WA 2PZSA 1L3SA 4FJMA 2KZMA 3AVJA 4KAZA 3K57A 2QK9A 2HW3A 3OYEA 1WSJA 1VSIA 3CG7A 1S6QA 1KVBA 4CJEA 1JXBA 3NH0A 3HP6A 4CEOA 1TAUA 2XY6A 4B9NA 1SL0A 4CHNA 4QOZB 3OYKA 1UWBA 1KLNA 3AO3A 3KK3A 4B8CA 2Y1IA 1SUQA 1VSHA 1HJRA 3OJSA 2GV9A 3V1QA 2O4GA 1KFDA 3C6UA 3ZT0A 3VQQA 2XHBA 3AVAA 4FVMA 3T3FA 5HLFA 1ZYQA 1X9WA 1N5YA 1RBRA 4FJXA 3V9ZA 1YT3A 3LWLA 1G15A 4FXDA 1WSEA 4RW7A 2JGUA 3AA4A 3TAPA 1IO2A 2XRIA 3ZT4A 3ZT2A 4E7HA 4O0IA 4DTMA 3S3MA 2X74A 3O4NA 4EZ6A 4HVJA 4DQSA 4DF8A 3AVFA 1YTUA 4KHWA 4IFVA 1RTHA 4FLVA 4OKKA 3SQ1A 4AILC 4DLGA 1HMVA 1MU2A 1NJXA 1VSMA 1WN7A 2X6NA 3OYNA 4CCHA 2HVIA 2G8IA 1VSKA 1GOCA 4HUGA 2BANA 4DF4A 1VSDA 3DRRA 1QSSA 1J9AA 4Y1DA 3V4IA 4HUEA 4WE1A 4OLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF6 A;  2BDP A;  1LAW A;  4UQG A;  2QXF A;  4CGG A;  3TAQ A;  1BI4 A;  3M8Q A;  5FRO A;  3DMJ A;  4OLA A;  2B4J A;  1JLQ A;  4B08 A;  3WNG A;  1RDB A;  2O4I A;  4R5P A;  3CFP A;  4CEB A;  3VQ6 A;  4CJ4 A;  3TI0 A;  3KLF A;  3NFA A;  4B9S A;  1WLJ A;  2IC3 A;  2GUI A;  2B6A A;  3HM9 A;  1RT7 A;  1BGX T;  4FLZ A;  2HVH A;  2VWK A;  1WAF A;  2KW4 A;  3SUP A;  3KD1 E;  4DS5 A;  3NGY A;  1XC9 A;  4FJH A;  1Q9X A;  2VG7 A;  3JSM A;  1BL3 A;  1VK0 A;  2GBZ A;  3HT3 A;  4OVL A;  4JS4 A;  2KZZ A;  3CFO A;  3OY9 A;  2W42 A;  3V1O A;  1J5O A;  3L8B A;  4FZZ A;  4KHS A;  1S6P A;  4TSX A;  3HP9 A;  2OZM A;  5HRO A;  2LSN A;  3K5N A;  1LW0 A;  1X9S A;  5EU7 A;  4BWJ A;  4KPY A;  4CJK A;  4CJU A;  1NK5 A;  4FLU A;  2WON A;  3RWU A;  3LPU A;  3ZSZ A;  2VWJ A;  4H8K A;  2A1S A;  3JYT A;  3ZSV A;  3RMB A;  4B9M A;  3KLI A;  4M3W A;  3HO1 A;  4PY5 A;  3OS1 A;  2JLE A;  4AH9 A;  5HRP A;  4DTR A;  2IGI A;  1IKW A;  4DFK A;  4N47 A;  5J2Q A;  1RBV A;  3H08 A;  4CHY A;  3SNN A;  2A1R A;  1RBU A;  1SL2 A;  3F73 A;  2VG6 A;  3QNO A;  1VRU A;  1SL1 A;  1HPZ A;  2ITG A;  3AO2 A;  4DFJ A;  3RR8 A;  4HCC A;  4CER A;  5CZ1 A;  3TAF A;  3KKS A;  1KCF A;  3ZSR A;  4ID1 A;  3AVG A;  4I7F A;  2YNH A;  1EET A;  1U49 A;  4E7J A;  1C0U A;  4DTO A;  4FM2 A;  1Q8I A;  1W0H A;  1JLG A;  4ZHR A;  4DU1 A;  3NDK A;  4LSL A;  3D45 A;  2ZD1 A;  1VRT A;  2D5R A;  4K8Z A;  2BE2 A;  2NUB A;  5C25 A;  1BIZ A;  2G8H A;  3LAK A;  4CJP A;  1GOB A;  4GW6 A;  4E89 A;  3RRH A;  2DFE A;  4FM0 A;  3UIQ A;  4AHV A;  2B5J A;  2IOC A;  3LP0 A;  4DTP A;  3VQA A;  3HPO A;  3V81 A;  4M3X A;  4BDY A;  4CFA A;  1RDA A;  2P5O A;  2YHA A;  3VQB A;  3CFR A;  1CXU A;  3AVB A;  4RW4 A;  4F4K A;  1T05 A;  1L3U A;  3AVM A;  3O3H A;  5J2N A;  4CGH A;  2EHG A;  2YNG A;  3TAR A;  4Z4F A;  3HXM A;  3DOL A;  4OGE A;  2BGG A;  1JLE A;  3AO1 A;  3ZSW A;  1NJZ A;  2ETJ A;  1A5W A;  1XI1 A;  3RR7 A;  4KHQ A;  3DYA A;  4H4M A;  4KTZ A;  1I39 A;  4B9T A;  4CJT A;  2OYQ A;  3AO4 A;  4C8N A;  3LAN A;  4ELT A;  1XHZ A;  1ASV A;  3TAM A;  5J1E A;  2AJQ A;  3NH1 A;  3EYZ A;  4CF0 A;  3AA3 A;  4CFC A;  4EZ9 A;  4KHN A;  1BQN A;  3K5O A;  3HVR A;  4I9L A;  1B92 A;  3WNE A;  3ZT1 A;  4FLW A;  4C8K A;  4KTQ A;  3AA2 A;  3B6O A;  4AHT A;  5HRN A;  3SUO A;  1F21 A;  1QS4 A;  1TKT A;  4FJJ A;  3EZ5 A;  3NGI A;  3I0R A;  5D3G A;  2ZE2 A;  2G8U A;  1ZBH A;  4Z4H A;  1KVC A;  3PO4 A;  3LP1 A;  4AHS A;  2R7Y A;  4H4O A;  3DLE A;  3RRG A;  1HRH A;  3NF9 A;  3AVH A;  1LW2 A;  3SQ4 A;  3L2R A;  1JL2 A;  3RMD A;  1KFS A;  1RDD A;  4DFM A;  2DTU A;  3SI6 A;  1IKY A;  3VQ4 A;  3HPH A;  5KI6 A;  2FBT A;  4CF9 A;  1HNV A;  3U3G A;  1YTA A;  3KIO A;  4RG8 A;  1Y97 A;  2KQ2 A;  4O0J A;  4CED A;  3LZJ A;  4F2S A;  1ASW A;  1J53 A;  3AA5 X;  3DRP A;  4M3U A;  3QEX A;  3NHG A;  5HBM A;  4CK1 A;  3SPZ A;  1NK4 A;  4J2E A;  4NCA A;  1X9M A;  5DMR A;  1C1C A;  3MED A;  3NGZ A;  4CEQ A;  2RKI A;  4DG1 A;  4JRP A;  4E1M A;  2PYJ A;  4B9L A;  3DM2 A;  4BE0 A;  4L8R B;  2RF2 A;  1RT2 A;  2F96 A;  1U45 A;  4FJI A;  4FZY A;  4CJV A;  5I3U A;  4FLT A;  3I8D A;  1UOC A;  1WSG A;  3DLR A;  3IS9 A;  3QEP A;  3KLH A;  1TKD A;  2XO7 A;  3DLG A;  4FLX A;  4Q0B A;  4W5R A;  2OPP A;  1RIL A;  3VQP A;  3O3F A;  4CGI A;  1NK0 A;  4C8M A;  1U04 A;  4CJF A;  2G8K A;  4CHZ A;  4DWI A;  4CIE A;  3NAE A;  4BE2 A;  1S5J A;  2IDO A;  4CE9 A;  4FJL A;  1CZB A;  3HL8 A;  2Z1I A;  4BWM A;  4LY7 A;  4EP4 A;  1J54 A;  5J2P A;  1SKS A;  1TKX A;  3PX0 A;  3AVK A;  3OYI A;  5FRM A;  3OYM A;  1U4B A;  1BQM A;  4RW8 A;  3HK2 A;  4NCB A;  4OKJ A;  2FBV A;  3SJJ A;  1GOA A;  4CIF A;  5SWM A;  1RT4 A;  1RTD A;  4E3S A;  3S3N A;  3I0S A;  4KKO A;  4F3T A;  1TAQ A;  2HHV A;  1X1P A;  1NOY A;  3CM5 A;  1YVU A;  3QET A;  1UA0 A;  4FJK A;  3RMA A;  3HJF A;  3WNF A;  3VQE A;  4CJQ A;  1VSE A;  4PA1 A;  4BAC A;  4Z4E A;  2IAJ A;  3QIN A;  1C0M A;  3P5J A;  4CJW A;  4B8A B;  3QEI A;  4E1N A;  1RBS A;  1QHT A;  2YNF A;  3AVL A;  3ZSO A;  3OS2 A;  4FM1 A;  1L3V A;  3DLH A;  5CY4 A;  1RDC A;  2Y1J A;  5CZ2 A;  4W5Q A;  1D8Y A;  1RT3 A;  4DTS A;  3CQ8 A;  2G8W A;  4DS4 A;  2D0B A;  3V9S A;  2OZS A;  2YKN A;  3ZSX A;  4ZTF A;  2FBX A;  1C1A A;  4CJS A;  4OGC A;  4DSJ A;  1SKW A;  1FKO A;  1RT1 A;  3VQ9 A;  4KHY A;  1EKE A;  4W5O A;  1JLC A;  3DRS A;  4JLH A;  4O55 A;  4KB0 A;  1Z26 A;  4I9Q A;  3K5M A;  1CLQ A;  1ZBF A;  3G0Z A;  2IS3 A;  4CGD A;  2PYL A;  1LWC A;  3LZI A;  4M45 A;  3KLG A;  3KJV A;  4DSI A;  1C1B A;  3ITH A;  2KFZ A;  4M42 A;  3DLB A;  4FZX C;  4KI6 A;  2Z1J A;  5CYM A;  2HHU A;  1BIU A;  3QNN A;  1TK5 A;  4IDK A;  4J2A A;  3ALY A;  3O4Q A;  4RW9 A;  5K14 A;  4CJ5 A;  4CK3 A;  4IFY A;  3SCX A;  1W9H A;  2X6S A;  3TAE A;  1NK6 A;  1N6Q A;  1C0T A;  1IH7 A;  4J2D A;  1LAV A;  4Z4C A;  4GVM A;  3MXJ A;  3PV8 A;  3E01 A;  1R0A A;  4ICL A;  1WSF A;  4CES A;  1S1U A;  1TGO A;  4ELU A;  4E7I A;  4DQP A;  1ZBI A;  1JXE A;  2HHQ A;  1D9D A;  1HYS A;  3S3O A;  4DLE A;  4I2Q A;  4CEE A;  1JLB A;  4MQ3 A;  4O5B A;  5KTQ A;  1TK8 A;  3LAL A;  3C6T A;  4W5N A;  3A2F A;  3HYF A;  2Z1G A;  4Z4G A;  4DFP A;  3IAY A;  4CFB A;  1JLA A;  3VQ7 A;  2RPI A;  4JS5 A;  3SQ2 A;  1NKB A;  4KHU A;  3ZCM A;  1NOZ A;  1EX4 A;  1VSF A;  3P83 D;  1NJW A;  4F8R A;  2DY4 A;  4CJR A;  2EX3 A;  3L2V A;  3QIP A;  3L3V A;  4IG0 A;  4OJR A;  4N56 A;  4KI4 A;  3V9X A;  1HNI A;  1NJY A;  1TV6 A;  3U6F A;  3LAM A;  4AHR A;  4FJ7 A;  1RCH A;  3OYH A;  3OYF A;  1LWE A;  3NH2 A;  1Q9Y A;  4OPK A;  5CYQ A;  1RNH A;  4DQR A;  4DTX A;  4CF2 A;  2QKK A;  3K58 A;  5T7B A;  1CXQ A;  4FJ5 A;  1ASU A;  4FJ8 A;  5FRN A;  1D9F A;  5JS1 A;  3V6D A;  1RT5 A;  2WOM A;  5DK5 A;  3DOK A;  3IRX A;  3P1G A;  3OYB A;  4IKF A;  3SUN A;  4IG3 A;  2DFF A;  2E6L A;  3HPG A;  4XIU A;  3SPY A;  1SKR A;  1LWF A;  2P1J A;  4CF8 A;  3VA0 A;  3TR8 A;  3S9H A;  5HRR A;  3KD5 E;  1L5U A;  1S9E A;  3M8P A;  2G8F A;  1DLO A;  4PQU A;  4DTN A;  4QCL A;  2OPS A;  4FW1 A;  4O4G A;  5J2M A;  4N41 A;  1L3T A;  1KVA A;  1B9F A;  2YKM A;  4CK2 A;  5KRT A;  5KRS A;  1RTI A;  2HHT A;  2OPR A;  3SV4 A;  3OYA A;  5KGX A;  2Q3S A;  2P51 A;  4Y1C A;  3AVI A;  4AHU A;  5C42 A;  3T19 A;  1EXQ A;  4CFD A;  4IBN A;  1EP4 A;  4FJG A;  1ITG A;  3LPT A;  1KLM A;  4KFB A;  4NCG A;  4M41 A;  3T1A A;  4LSN A;  4ELV A;  2ZQB A;  4PUO A;  1O1W A;  3TWH A;  3SYZ A;  1WSH A;  2HNY A;  3O3G A;  2OA8 A;  3ZSQ A;  1DTT A;  1LV5 A;  2PY5 A;  1BCO A;  4CGF A;  5E41 A;  3L2Q A;  4KRE A;  5JS2 A;  4NYF A;  4HTU A;  5HP1 A;  1NK7 A;  3QLH A;  4JRQ A;  3BGR A;  1S1X A;  4DQQ A;  1XWL A;  4FK4 A;  1WSI A;  2VG5 A;  1S1V A;  4LD0 A;  4E0D A;  4LH5 A;  1HQU A;  1RBT A;  1XHX A;  3CM6 A;  3LP2 A;  3EY1 A;  3C94 A;  4DSE A;  3NCI A;  3MXI A;  1TKZ A;  3OYL A;  1RTJ A;  4F3O A;  3TAG A;  4K8X A;  1NKE A;  3B6P A;  4FLY A;  3ZT3 A;  3L2U A;  4CGJ A;  4FJN A;  4J2B A;  4CHP A;  4FK2 A;  5I42 A;  3MEE A;  1Z25 A;  3ZSY A;  2RN2 A;  2F8T A;  3VN5 A;  3AVC A;  3NF7 A;  4CEF A;  1UA1 A;  4QAG A;  3F9K A;  3ULD A;  3NF8 A;  3SQ0 A;  4M3Z A;  4DU3 A;  2HNZ A;  4EP5 A;  3KLE A;  3AO5 A;  4E7L A;  3QEV A;  3ISN C;  3OYD A;  1BCM A;  1K6Y A;  1BHL A;  4ZTJ A;  1IKX A;  4I2P A;  4HHT A;  1WAJ A;  4KB1 A;  4FJ9 A;  4GMJ B;  3DI6 A;  4O44 A;  3PX6 A;  4HUF A;  4DTJ A;  4Z0U A;  3THV A;  4B3O A;  1BIS A;  3LWM A;  1ZBL A;  1T03 A;  4YNQ A;  5KGW A;  4DSL A;  1KTQ A;  1QQC A;  1RT6 A;  3K2P A;  3MEC A;  1D5A A;  3VQ5 A;  4CEA A;  3OYJ A;  3D0P A;  4CF1 A;  1DTQ A;  1I3A A;  3AVN A;  1FXX A;  1U47 A;  4FK0 A;  2QKB A;  3M8R A;  3MXM A;  4DQI A;  3FFI A;  1KRP A;  3NE6 A;  3PY8 A;  2KTQ A;  4KRF A;  1HYZ A;  3C95 A;  3G10 A;  4BE1 A;  4F2R A;  1C6V A;  3RMC A;  3ASM A;  4DSK A;  5FDL A;  1IKV A;  1T8E A;  1HQE A;  4KV8 A;  2X78 A;  4CIG A;  3HVT A;  4FW2 A;  2G8V A;  2FBY A;  1VSJ A;  3V9U A;  3BDP A;  3PO5 A;  4C8L A;  3MAQ A;  4DTU A;  3OJU A;  4M3T A;  4YFU A;  4PWD A;  2ATQ A;  3QIO A;  3KTQ A;  4NYN A;  1QTM A;  4KO0 A;  3OYC A;  3L2W A;  1REV A;  1WNS A;  2YNI A;  3VA3 A;  1T7P A;  1VSL A;  3K59 A;  2D0A A;  3V1R A;  3OVN A;  4E19 A;  1JLF A;  1ZBU A;  3K5L A;  3KK1 A;  4M3R A;  4B9V A;  1S1T A;  4OPJ A;  2KFN A;  4DU4 A;  4BDP A;  4MFB A;  3KK2 A;  2XY5 A;  2XY7 A;  3NBP A;  1UAX A;  3L3U A;  1QSY A;  2HHX A;  3QER A;  1TL3 A;  3OYG A;  3WNH A;  3OS0 A;  3SV3 A;  4CHQ A;  1TK0 A;  3AV9 A;  4C8O A;  3VQC A;  4BDZ A;  1A5X A;  2P5G A;  3QO9 A;  3SUQ A;  3QES A;  4HCB A;  2YHB A;  4CEZ A;  2E6M A;  4FCY A;  4FYD A;  1TVR A;  4CJ3 A;  1A5V A;  1JL1 A;  1S9G A;  4N76 A;  2E4L A;  2HND A;  4CEC A;  1NK8 A;  4Z4I A;  4Q5V A;  3DLK A;  4B9U A;  1S1W A;  4CJL A;  3VQ8 A;  5C24 A;  1NKC A;  3PUF A;  5HRS A;  2HB5 A;  2HHS A;  4ID5 A;  2YV0 X;  1BI4 B;  3VQD A;  4AHC A;  1U48 A;  1CZ9 A;  4CHO A;  3HST B;  4LH4 A;  4RW6 A;  3SZ2 A;  1SV5 A;  1IG9 A;  2HHW A;  1B9D A;  2FC0 A;  3IG1 A;  4N5S A;  4G1Q A;  2HMI A;  1TL1 A;  3RTV A;  3U3Y A;  3MEG A;  2Z1H A;  1NK9 A;  3PX4 A;  3CYM A;  3TAN A;  1QSL A;  2I5J A;  3LDS A;  3QEW A;  1QE1 A;  1KSP A;  4E7K A;  2F8S A;  1HYV A;  3KKR A;  2D0C A;  1FK9 A;  1JKH A;  3TAB A;  5SZT A;  2OPQ A;  4M3Y A;  2DFH A;  1FKP A;  4KTW A;  3LP3 A;  3M8S A;  4DMN A;  4DSF A;  4W5T A;  4OKE A;  2XY8 A;  3V9W A;  2PZS A;  1L3S A;  4FJM A;  2KZM A;  3AVJ A;  4KAZ A;  3K57 A;  2QK9 A;  2HW3 A;  3OYE A;  1WSJ A;  1VSI A;  3CG7 A;  1S6Q A;  1KVB A;  4CJE A;  1JXB A;  3NH0 A;  3HP6 A;  4CEO A;  1TAU A;  2XY6 A;  4B9N A;  1SL0 A;  4CHN A;  4QOZ B;  3OYK A;  1UWB A;  1KLN A;  3AO3 A;  3KK3 A;  4B8C A;  2Y1I A;  1SUQ A;  1VSH A;  1HJR A;  3OJS A;  2GV9 A;  3V1Q A;  2O4G A;  1KFD A;  3C6U A;  3ZT0 A;  3VQQ A;  2XHB A;  3AVA A;  4FVM A;  3T3F A;  5HLF A;  1ZYQ A;  1X9W A;  1N5Y A;  1RBR A;  4FJX A;  3V9Z A;  1YT3 A;  3LWL A;  1G15 A;  4FXD A;  1WSE A;  4RW7 A;  2JGU A;  3AA4 A;  3TAP A;  1IO2 A;  2XRI A;  3ZT4 A;  3ZT2 A;  4E7H A;  4O0I A;  4DTM A;  3S3M A;  2X74 A;  3O4N A;  4EZ6 A;  4HVJ A;  4DQS A;  4DF8 A;  3AVF A;  1YTU A;  4KHW A;  4IFV A;  1RTH A;  4FLV A;  4OKK A;  3SQ1 A;  4AIL C;  4DLG A;  1HMV A;  1MU2 A;  1NJX A;  1VSM A;  1WN7 A;  2X6N A;  3OYN A;  4CCH A;  2HVI A;  2G8I A;  1VSK A;  1GOC A;  4HUG A;  2BAN A;  4DF4 A;  1VSD A;  3DRR A;  1QSS A;  1J9A A;  4Y1D A;  3V4I A;  4HUE A;  4WE1 A;  4OLB A; 
#chains in the Genus database with same CATH topology
 3NF6 A;  3CME N;  2QXF A;  3TAQ A;  3O80 A;  1JLQ A;  4B08 A;  3CFP A;  2GEM A;  3GDQ A;  1EWQ A;  3NFA A;  3F5T A;  4B9S A;  3T7Z A;  3TSU A;  4A2A A;  2GUI A;  1EO1 A;  1RT7 A;  2FSK A;  3JXU A;  1WAF A;  5FPD A;  4DS5 A;  1XC9 A;  4G9Z A;  1Q9X A;  4IJA A;  3HM8 A;  1J5O A;  3OY9 A;  1NGF A;  3V1O A;  4DUY K;  4BY9 C;  1YAG A;  3EE8 A;  3SMP A;  5AZJ B;  4K0K K;  1X9S A;  4CJK A;  2CGL A;  4FLU A;  1WBB A;  3ZYY X;  3J7A P;  2WON A;  4H8K A;  2VYP A;  3JYT A;  4B9M A;  4DUZ K;  4PY5 A;  3OS1 A;  4AH9 A;  1OH6 A;  1D4X A;  2IGI A;  4JI1 K;  1RBU A;  2QWO A;  2ITG A;  5GAE P;  1M1K O;  4DV4 K;  2W41 A;  3ATV A;  4FWN A;  3H6E A;  3AVG A;  2YNH A;  4NXN K;  3SAG A;  1JLG A;  2ZD1 A;  4JHD A;  5GAD P;  3C0B A;  4DV1 K;  1TYQ B;  2B5J A;  4WQ5 A;  3VQA A;  4BDY A;  4CFA A;  2YHA A;  3VQB A;  3CFR A;  4EHU A;  4F4K A;  1XC3 A;  2NNW A;  3AVM A;  5J2N A;  2YNG A;  4Z4F A;  2Q2R A;  3DOL A;  3BEX A;  3AO1 A;  2ETJ A;  5AQY A;  1XI1 A;  3DYA A;  4FSV A;  4H4M A;  5KQ8 A;  4JI0 K;  4FWL A;  5C15 A;  3LAN A;  4O8U A;  3N4P A;  1ASV A;  1NBW A;  3I8B A;  4HWI A;  3S41 A;  3VPZ A;  3CF5 L;  1W97 L;  3WNE A;  2W6K A;  4FLW A;  3B6O A;  3SUO A;  1TKT A;  2UXB K;  2WC9 A;  3EZ5 A;  4JKB A;  3NGI A;  4JKG A;  2ZE2 A;  2G8U A;  1ZBH A;  1KVC A;  3PO4 A;  5AQH A;  1HRH A;  1MWK A;  3H3O B;  4ISE A;  5KI6 A;  2FBT A;  1HNV A;  3RSE A;  1YTA A;  4RG8 A;  4ISF A;  1Y97 A;  2KQ2 A;  2QWP A;  4UY8 O;  4BRC A;  3AA5 X;  1SZ2 A;  3QML A;  3QEX A;  3SPZ A;  4CK1 A;  3KHY A;  1C1C A;  1W2B M;  2WUS A;  5EY4 A;  4B9L A;  1U45 A;  3ZX2 A;  3DLR A;  4E1J A;  3QEP A;  4DV3 K;  2P9I B;  3DLG A;  4W5R A;  3L0Q A;  1VQN N;  3C6H A;  4O8K A;  1JCE A;  3H46 O;  4CHZ A;  4CE9 A;  3PIO L;  4JI2 K;  2Q0R A;  3HL8 A;  2Z1I A;  4NLC A;  2QTD A;  3TSQ A;  4EP4 A;  5J2P A;  3ID8 A;  1SKS A;  3O9Q A;  4WYB A;  3AVK A;  3OYI A;  5FRM A;  5AQS A;  1U4B A;  5MLC Q;  1GOA A;  4RTF D;  1RT4 A;  4E3S A;  4KKO A;  2HHV A;  4FJK A;  1YVU A;  3RMA A;  4QS8 A;  1KAX A;  4DR3 K;  1C0M A;  3A5M C;  1RBS A;  3P31 A;  3AAP A;  1RDC A;  1K8K A;  5CZ2 A;  1D8Y A;  2D0B A;  4B3S K;  1NNE A;  2GWJ A;  2FBX A;  4CJS A;  3CQX A;  4W5O A;  4I9Q A;  3C6A A;  3K5M A;  3H1V X;  2OTJ N;  2IS3 A;  2IVO A;  1LWC A;  4M45 A;  3KLG A;  1XNQ K;  3J7Z O;  4J2A A;  3O4Q A;  4RW9 A;  5K14 A;  3TAE A;  1C0T A;  5AQX A;  4GVM A;  3AGR A;  3WXJ A;  1R0A A;  3PV8 A;  4ICL A;  1WSF A;  1S1U A;  3ZX3 A;  4DQP A;  2AP1 A;  3S3O A;  1S22 A;  4O5B A;  3BZC A;  3HYF A;  4BR7 A;  4CFB A;  4EFH A;  3VQ7 A;  1NKB A;  3SQ2 A;  1NGE A;  1T6D A;  3ZET B;  4H03 B;  2P9U A;  3QIP A;  5HOO A;  5IT9 O;  1VQM N;  4OJR A;  4WFB L;  3V9X A;  1TV6 A;  3U6F A;  4FJ7 A;  1Q9Y A;  1KAZ A;  4DTX A;  4CF2 A;  1CXQ A;  4A5B A;  5DK5 A;  1X3N A;  3IRX A;  2VGM A;  4IKF A;  4MDB A;  1QZ5 A;  2E6L A;  3O4W A;  3MK6 A;  2QXL A;  5HRR A;  1L5U A;  4DR6 K;  4DV6 K;  2F9W A;  1KVA A;  5E84 A;  5AQN A;  4BC2 A;  3SK3 A;  1TUU A;  3ENH A;  5KGX A;  5LY3 A;  4AHU A;  4KFB A;  1WSH A;  3O3G A;  5AQO A;  1DTT A;  3VTI A;  1BCO A;  3L2Q A;  3CHW A;  3HI0 A;  4KRE A;  1O13 A;  1NK7 A;  4BR5 A;  4EHT A;  3QLH A;  3BGR A;  1S1X A;  3C7N A;  2E2Q A;  2V7Y A;  4LH5 A;  3MXI A;  3QFU A;  4FWP A;  3NCI A;  5KQD A;  3OTO K;  1NKE A;  3B6P A;  4YOU A;  5AQR A;  3ZT3 A;  1HUX A;  4FOE A;  4J2B A;  3KWI A;  1BDG A;  5I42 A;  4FK2 A;  3M6G A;  2F8T A;  4EIA A;  1OVY A;  2P9P B;  3VN5 A;  4B3T K;  3H45 C;  1UA1 A;  3TTD A;  3NF8 A;  1LOT B;  4ILH A;  4BR0 A;  4IEI A;  2NRV A;  4EP5 A;  3AO5 A;  3QEV A;  3ISN C;  3ULE A;  1K6Y A;  1NGA A;  5BPM A;  2VWB A;  3LDQ A;  3O9U A;  5AR0 A;  4JI8 K;  2D1K A;  4DTJ A;  3WUH A;  2PFU A;  4Z0U A;  5LJW A;  1ZBL A;  1KTQ A;  1RT6 A;  4X62 K;  3K2P A;  4IOC L;  1D5A A;  3D0P A;  1Q7Y O;  4FK0 A;  3T1H K;  1FXX A;  1HX1 A;  3FFI A;  3HZ6 A;  2BUP A;  4BE1 A;  3CJC A;  1GLF O;  4DSK A;  4BR4 A;  3VGM A;  3WXM B;  1IKV A;  4CIG A;  3L4Q A;  3HVT A;  4FW2 A;  2FBY A;  1VSJ A;  4C8L A;  4DTU A;  4JKG B;  4PWD A;  2PBD A;  2QWN A;  2YHY A;  3KZB A;  4KO0 A;  3VA3 A;  1WNS A;  3K59 A;  2P9S A;  3OVN A;  5AQM A;  4E19 A;  4OO1 J;  4PKI A;  3C65 A;  3VGK A;  2BTF A;  1S1T A;  4DU4 A;  4BDP A;  3VET A;  1UAX A;  3L3U A;  1QSY A;  2HHX A;  3D7E O;  3CC7 N;  1KXP A;  3CC2 N;  3J81 O;  1QQM A;  3QES A;  2YHB A;  1A5V A;  1S9G A;  1YUW A;  2E4L A;  2HND A;  4CEC A;  1P90 A;  4B9U A;  2QEX N;  1BI4 B;  1N34 K;  2P9K B;  2P9N A;  4LH4 A;  4BRH A;  3SZ2 A;  1KD1 O;  3GL1 A;  2HMI A;  2IVN A;  3U3Y A;  2I5J A;  3LDS A;  4B1W B;  1QE1 A;  2E2O A;  1IBM K;  2HBJ A;  5SZT A;  2UXC K;  4KTW A;  4W5T A;  2XY8 A;  4FJM A;  3CET A;  2HW3 A;  3OYE A;  4JKE A;  3BP8 A;  1VSI A;  1KVB A;  1GLE G;  1JXB A;  2XY6 A;  1SL0 A;  4IWV A;  3AO3 A;  2GWK A;  1SUQ A;  3DXK B;  1DGK N;  2GV9 A;  2O4G A;  3MN7 A;  4YDU A;  1K8K B;  3P4I A;  4K43 A;  1HLU A;  3SAH A;  3QDK A;  1WB9 A;  4BG9 A;  1RBR A;  4JKA A;  2A40 A;  4LF4 K;  3V9Z A;  1G15 A;  4BRM A;  2JGU A;  3AA4 A;  1YTU A;  3CD6 N;  4OKK A;  3SQ1 A;  4DLG A;  1NJX A;  1VSM A;  3OYN A;  1VSK A;  5GIP A;  4HUG A;  4DF4 A;  4Y1D A;  1J5E K;  4OLB A;  5GIO A;  4CGG A;  1CZA N;  1ESV A;  3M8Q A;  5ADX H;  1SAZ A;  2Q36 A;  2B4J A;  3QB0 A;  4A61 A;  5JVH L;  4CEB A;  3VQ6 A;  2QM1 A;  3KLF A;  5JLF A;  2B6A A;  3HM9 A;  1BGX T;  4FLZ A;  3IKM A;  5LMN K;  3CCE N;  4FJH A;  2VG7 A;  4OVL A;  4I6M A;  3K9J A;  4FZZ A;  3H3N O;  2O8C A;  1S6P A;  5EXW A;  5HRO A;  4FWO A;  1LW0 A;  3MMV A;  4X65 K;  4LF8 K;  4H5W A;  3TTC A;  3RWU A;  3O6W A;  3ZSZ A;  2VWJ A;  4KH4 A;  3KLI A;  4FWM A;  4DTR A;  3I55 N;  4DV0 K;  5J2Q A;  3SNN A;  1RBV A;  3H08 A;  5M1O A;  4CHY A;  4R79 A;  1NGH A;  3ID6 A;  1SL1 A;  3PIP L;  3MN5 A;  4JV5 K;  4HCC A;  3O9R A;  1NGC A;  3TAF A;  4I7F A;  1U49 A;  2NRW A;  4E7J A;  1C0U A;  4FM2 A;  5AZI A;  1W0H A;  1W7A A;  4LSL A;  4K8Z A;  3FFK B;  3UKR A;  2BE2 A;  2NUB A;  4A2B A;  2E2P A;  1BIZ A;  4IJN A;  4CJP A;  3RRH A;  2FLO A;  4JD2 A;  4AM7 A;  3HPO A;  4DTP A;  3V81 A;  1RDA A;  2P5O A;  1CXU A;  3AVB A;  1U2V B;  4CZF A;  4CGH A;  2EHG A;  3TAR A;  1Q81 O;  1K9M O;  1G99 A;  3IUC A;  1NJZ A;  5GAG P;  3RR7 A;  5AJ3 K;  4KTZ A;  1I39 A;  3VEN A;  4AF1 A;  3SAF A;  1R59 O;  3TAM A;  5J1E A;  1VQ7 N;  3EYZ A;  3VEW A;  4BVP A;  4I9L A;  1B92 A;  3MN9 A;  4AHT A;  5D3G A;  3QBX A;  3LP1 A;  2R7Y A;  2P9L A;  3DLE A;  1LW2 A;  3SQ4 A;  2QWM A;  1NG9 A;  1KFS A;  1RDD A;  4DFM A;  2V52 B;  3ZLJ A;  3O9S A;  5FPE A;  3BUZ B;  3EO3 A;  4XH5 A;  4B9Q A;  1XMQ K;  3KIO A;  4M63 C;  4O0J A;  1ASW A;  1J53 A;  1RGI A;  3NHG A;  1NK4 A;  1X9M A;  5DMR A;  3MED A;  4CEQ A;  1HJO A;  1Q82 O;  4DG1 A;  4E1M A;  2PYJ A;  4BE0 A;  2RF2 A;  2F96 A;  4FJI A;  1HKB A;  4H5N A;  5BPN A;  3ZEU A;  4B1V A;  4FWQ A;  3KLH A;  3VQP A;  3O3F A;  5M1K A;  4CJF A;  4CIE A;  1N36 K;  3PX0 A;  1KQS M;  3HK2 A;  2O8D A;  3HRG A;  5F0X A;  1LCU A;  3SJJ A;  1IBK K;  1RTD A;  3VEV A;  1UA0 A;  1P8Z A;  5ADX A;  3WNF A;  4JI5 K;  3VQE A;  1IG8 A;  4PA1 A;  4BAC A;  3F9M A;  4CJW A;  4B8A B;  1QHT A;  3AVL A;  2UYT A;  4RWT A;  5CY4 A;  5DM6 L;  4W5Q A;  1RT3 A;  3AY9 A;  4DTS A;  4DS4 A;  3V9S A;  1VQ6 N;  2YKN A;  4ZTF A;  1E3M A;  2E1Y A;  1C1A A;  3CMA N;  1V4S A;  4K25 A;  1EWR A;  4KB0 A;  1JLC A;  2HBM A;  1KC8 O;  4LFC K;  1YVN A;  2O8F B;  4WQ4 C;  3LZI A;  3KJV A;  1C1B A;  2KFZ A;  4M42 A;  3DLB A;  5CYM A;  1BIU A;  3QNN A;  1NU0 A;  2ZM6 K;  1NK6 A;  1GLD G;  5GAH P;  4PL7 A;  2E8A A;  4BRP A;  4CES A;  1BA1 A;  3VEZ A;  1ZBI A;  1HKG A;  2VQE K;  2HHQ A;  4DLE A;  3A5O C;  5EVZ A;  4Z4G A;  2Q1N A;  5FLX O;  3P38 A;  4DCH A;  2HBL A;  3G6E N;  1NJW A;  3P83 D;  4A5A A;  4F8R A;  4CJR A;  2EX3 A;  3L2V A;  4N56 A;  4KI4 A;  1NJY A;  1RCH A;  3NH2 A;  4IXC A;  1T44 A;  1RNH A;  4FJ8 A;  1ASU A;  5FRN A;  1RT5 A;  3DOK A;  3CJ9 A;  3CPE A;  3P1G A;  1YHQ N;  2QWQ A;  3SUN A;  3K0S A;  2GX9 A;  3HPG A;  4IEE A;  3KD5 E;  1S9E A;  4NO7 A;  4CJ7 A;  3EKS A;  3M5R A;  4WCE L;  4C1N K;  4FW1 A;  2O8B A;  3AAQ A;  1RTI A;  1DEJ A;  2FF6 A;  4JYA K;  3AVI A;  4DHY A;  1EP4 A;  5KPR A;  4FJG A;  3LPT A;  4FL9 A;  4ELV A;  2ZQB A;  4KH5 A;  3FR0 A;  2HNY A;  3ZSQ A;  2PY5 A;  4HTL A;  4CGF A;  3VOV A;  4CD1 A;  3WQU A;  5HP1 A;  4JRQ A;  1XWL A;  2E5L K;  1WSI A;  1KAY A;  1NMN A;  4DSE A;  3LP2 A;  3ENO A;  3OYL A;  3J7Y P;  3L2U A;  4CGJ A;  3R8E A;  4BRK A;  4ISG A;  1Z25 A;  2YHW A;  3FE1 A;  2RN2 A;  4IOA L;  3NF7 A;  3QIC A;  3LDO A;  3F9K A;  4AQY K;  1M90 O;  2O8E A;  5CHI A;  3KLE A;  3CCR N;  3VGL A;  4LC9 B;  4O44 A;  3THV A;  1HR0 K;  1DT9 A;  5B8H A;  3LWM A;  4DSL A;  5KGW A;  3WXI A;  3LL3 A;  3MEC A;  3FZH A;  1U47 A;  2KLA A;  4MLH A;  3MXM A;  4NB4 A;  1KRP A;  4JKD A;  3PY8 A;  3JAM O;  1C0F A;  5GIN A;  3NVK A;  3MDQ A;  1C6V A;  3UKU A;  1YJN N;  3ASM A;  3DJC A;  4DB3 A;  1HQE A;  4OPA A;  4MDA A;  3PO5 A;  4K41 A;  3OJU A;  4YFU A;  3QIO A;  3CCL N;  3KTQ A;  3OYC A;  1T7P A;  2ZJQ L;  2CGK A;  1GLB G;  1ZBU A;  3K5L A;  4B9V A;  3PSI A;  4OPJ A;  4H5R A;  3NBP A;  2ZJP L;  4B1Y B;  3QER A;  1TL3 A;  3SV3 A;  1TK0 A;  3AV9 A;  4U7B A;  4C8O A;  1A5X A;  3OA9 A;  3SUQ A;  4HCB A;  4FYD A;  3D6R A;  4CJ3 A;  4CVN E;  1SS6 A;  4Z4I A;  4Q5V A;  3QBW A;  3DLK A;  3ZEU B;  1JJ2 M;  4Y0W A;  1NKC A;  5HRS A;  3HST B;  1IG9 A;  2HHW A;  4A62 A;  1B9D A;  3IG1 A;  4YOX A;  3RTV A;  1RFQ A;  3MEG A;  4WQ4 A;  3TAN A;  1JKH A;  2DFH A;  4DMN A;  5AQL A;  3R6M A;  1L3S A;  2F9T A;  4LFA K;  1FJG K;  3VF2 A;  3LDP A;  1TAU A;  1Y64 A;  4CEO A;  4B9N A;  1QHA A;  3OYK A;  4BVO A;  1KLN A;  4DKW A;  2KKZ A;  3SBT A;  3E9O A;  1VQK N;  1KFD A;  3TPQ A;  1VQ4 N;  3C6U A;  3CIP A;  3G71 N;  2XHB A;  3AGK A;  3PLA A;  3CCV N;  5HLF A;  1ZYQ A;  1X9W A;  1YIT N;  1N8R O;  4FJX A;  2AA4 A;  3L4I A;  1WSE A;  3CCS N;  3ZT2 A;  4DTM A;  4O0I A;  5FPM A;  3O4N A;  3WT0 A;  5C2F A;  1RTH A;  3A0I X;  3D2F A;  2HVI A;  4CCH A;  2X6N A;  1N33 K;  2F7T A;  2NRH A;  4JHD B;  2BAN A;  2XY7 A;  1LAW A;  3LM9 A;  4UQG A;  5LMU K;  5FRO A;  4OLA A;  4YHH K;  3R9P A;  2O4I A;  4R5P A;  4CJ4 A;  3THX A;  3DAW A;  3O1W A;  4DV7 K;  3SUP A;  4FWK A;  3KD1 E;  3NGY A;  3JSM A;  4JKF A;  1BL3 A;  4MO5 A;  2GBZ A;  3N4Q A;  4JS4 A;  3CFO A;  2W42 A;  4KHS A;  4TSX A;  5JMV A;  1Z05 A;  3MN6 A;  4CJU A;  4LF7 K;  1NK5 A;  1BOT O;  5C0Y A;  4GV6 A;  3B8A X;  3LPU A;  4IO8 A;  4M3W A;  5C10 A;  3ZSV A;  3HO1 A;  4PKG A;  3EEQ A;  4LF5 K;  1BUP A;  4CZL A;  1IKW A;  2A1R A;  4N47 A;  1HNW K;  3F73 A;  2VG6 A;  5AQK A;  3CCQ N;  3QNO A;  3AO2 A;  3RSE B;  3RR8 A;  4CER A;  4ILG B;  5CZ1 A;  3VER A;  1KCF A;  1EET A;  3RVC A;  4A59 A;  3MCP A;  2YI1 A;  2ZJR L;  4DTO A;  2QW9 A;  1Q8I A;  4ZHR A;  4DU1 A;  3NDK A;  2W6L A;  3E9P A;  1VRT A;  2D5R A;  1BO5 O;  2Q0U A;  3I56 N;  2G8H A;  2DFE A;  4FM0 A;  3UIQ A;  4DR1 K;  4DR4 K;  4AHV A;  2IOC A;  3KWG A;  2NRR A;  5KPZ A;  2HMP A;  4BQZ A;  5AFU H;  4IOX A;  3BZK A;  5DM7 L;  3ZSW A;  4KHQ A;  1A5W A;  3E9L A;  4C8N A;  4ELT A;  2ZWH A;  1XHZ A;  2GTD A;  4CFC A;  4EZ9 A;  4OPH A;  3K5O A;  1JCG A;  3MWT A;  4NXM K;  2A41 A;  3K9K A;  4C8K A;  5M1Q A;  3AA2 A;  5HRN A;  1F21 A;  1QS4 A;  3FLC O;  3I0R A;  4PHT X;  2E88 A;  2FSN A;  5BR8 K;  4YOW A;  3RRG A;  3AVH A;  4QS9 A;  2HOE A;  3RMD A;  4BR2 A;  1IKY A;  2YJE A;  3VF6 A;  4JKH A;  3U3G A;  3T1Y K;  1FW6 A;  3O9T A;  3LZJ A;  2CH5 A;  4B1X B;  3DRP A;  4FPB A;  4ILJ A;  4J2E A;  4NCA A;  1C0G A;  1YXQ A;  1NGB A;  2NRT A;  4JK7 A;  3DM2 A;  1ATS A;  2EWS A;  2GUP A;  3EZW A;  4DR5 K;  2NZT A;  4FLT A;  3I8D A;  3QFP A;  5I3U A;  1TYQ A;  1TKD A;  2XO7 A;  4Q0B A;  4IZ9 A;  1YI2 N;  4CBW A;  4CGI A;  1NK0 A;  3NVM A;  4JI6 K;  5AQI A;  1YJ9 N;  2IDO A;  4FJL A;  4DR7 K;  2ASM A;  5EX5 A;  3CCJ N;  3CJA A;  3OYM A;  2P9U B;  4RW8 A;  5SWM A;  1X3M A;  4F9O A;  3S3N A;  4LF9 K;  1NOY A;  3QET A;  3HJF A;  4BRF A;  4CJQ A;  1VSE A;  4Z4E A;  2IAJ A;  3P5J A;  4E1N A;  2YNF A;  3OS2 A;  3DLH A;  4JI7 K;  2NRZ A;  3CQ8 A;  2G8W A;  3HTV A;  5AQF A;  3ZSX A;  5LJV A;  2ZGZ A;  1SKW A;  1FKO A;  1RT1 A;  3LDL A;  3VQ9 A;  1EKE A;  4O55 A;  1CLQ A;  2E2N A;  2NRX A;  1ZBF A;  3G0Z A;  4B3M K;  3VEX A;  3P39 A;  2UUB K;  4DSI A;  1GLL O;  2E1Z A;  4V19 S;  5EOY A;  4KI6 A;  2HHU A;  1QQN A;  4CJ5 A;  4KH6 A;  5AQW A;  4IFY A;  3SCX A;  1N6Q A;  2ZF5 O;  1IH7 A;  3T69 A;  3UE5 A;  1YJW N;  4BRA A;  2P9I A;  4FVU A;  3U8X A;  4YY3 K;  3C7N B;  3Q7B A;  4LF6 K;  1MDU B;  4YOV A;  3R1X A;  4CD3 A;  1XUP O;  5AQP A;  4MQ3 A;  4CEE A;  5I9E B;  5KTQ A;  4W5N A;  3LAL A;  3C6T A;  3E1Y A;  3A2F A;  2Z1G A;  3D2F B;  3IAY A;  3CJ1 A;  2RPI A;  4KHU A;  1NMD A;  2HF3 A;  1NOZ A;  5BRH A;  2A42 A;  2UU9 K;  2OTL N;  5F1X A;  1HPM A;  3LAM A;  5C2D A;  3ULE B;  4BRN A;  4OPK A;  3G4S N;  4FWR A;  4KHP K;  4H0X B;  3MCA B;  2HBK A;  3D2E A;  5JS1 A;  3V6D A;  2WOM A;  3EE9 A;  3JS6 A;  4CZH A;  3OYB A;  3ENB A;  2DFF A;  1SKR A;  4BRE A;  1LWF A;  2P1J A;  3TR8 A;  1DKG D;  3M8P A;  2G8F A;  1DLO A;  1HNX K;  4QCL A;  1BU6 O;  4O4G A;  3HOS A;  4N41 A;  4GV3 A;  1L3T A;  1B9F A;  4YOT A;  4CK2 A;  2HHT A;  2ASP A;  3BY5 A;  4RCH A;  2Q3S A;  3OYA A;  1V4T A;  3T19 A;  3I33 A;  4NCG A;  5AQT A;  4M41 A;  3T1A A;  3TWH A;  3SYZ A;  3O5B A;  2OA8 A;  1LV5 A;  1YIJ N;  2P9S B;  4XEI A;  5JS2 A;  4HTU A;  4DQQ A;  2VG5 A;  5M1N A;  4E0D A;  1HQU A;  3CM6 A;  1XHX A;  3EY1 A;  3C94 A;  3CJB A;  4F3O A;  1RTJ A;  3TAG A;  1X9J A;  4BGA A;  1VQO N;  4CHP A;  2IVP A;  4JK9 A;  5AQZ A;  3H1Q A;  1GLJ O;  3ZSY A;  4U67 L;  4CZI A;  3AVC A;  1OKJ A;  4QAG A;  2RE2 A;  5BPL A;  5ELZ A;  2P9N B;  4GNI A;  1IKX A;  1S72 N;  4HHT A;  1WAJ A;  3DI6 A;  4JK8 A;  2D0P A;  1NM1 A;  4HUF A;  4H5T A;  4MO4 A;  4B3O A;  4CBX A;  3SBG A;  3OYJ A;  4CF1 A;  1I3A A;  3AVN A;  2QWL A;  1XNR K;  5M1P A;  1RDW X;  3M8R A;  4DQI A;  2KTQ A;  3FZM A;  2OAN A;  1HYZ A;  2YCH A;  3G10 A;  3SLC A;  4BRD A;  1OVQ A;  1WOQ A;  3RMC A;  4H0V B;  5FDL A;  3LM2 A;  4KV8 A;  2X78 A;  2G8V A;  3BDP A;  4M3T A;  2DPN A;  4X64 K;  5BR9 A;  1REV A;  1OH7 A;  2YNI A;  5C12 A;  1VSL A;  5CR4 A;  5E26 A;  4BC4 A;  1JLF A;  3KK1 A;  4M3R A;  2XY5 A;  3OYG A;  3WNH A;  3Q7C A;  2V7Z A;  5BN9 A;  4CHQ A;  3VQC A;  2P5G A;  1ZC6 A;  4H0T B;  1WBD A;  2P9P A;  4CEZ A;  2E6M A;  1JL1 A;  2UXD K;  4N76 A;  1NK8 A;  4B3R K;  1E4G T;  4CJL A;  3GBT A;  3IFR A;  1VHX A;  3PUF A;  2HHS A;  4ID5 A;  3VQD A;  1S3X A;  3VTH A;  4CHO A;  3GG4 A;  1HNZ K;  2FC0 A;  4G1Q A;  1Z6R A;  1NK9 A;  2Z1H A;  1QSL A;  3QEW A;  1KSP A;  4E7K A;  2F8S A;  3KKR A;  4BGB A;  3TSP A;  3UB5 A;  1FK9 A;  2OPQ A;  4M3Y A;  1FKP A;  4DSF A;  3LP3 A;  2ITM A;  4PKH A;  1QQO A;  2PZS A;  2VCP A;  3ZX0 A;  3AVJ A;  4KAZ A;  2QK9 A;  4I6M B;  4YOY A;  1WSJ A;  1S6Q A;  3F2K A;  4CJE A;  1NJI O;  2O8C B;  3EN9 A;  3HP6 A;  4FWS A;  4CHN A;  1UWB A;  1I94 K;  3DXM A;  3KK3 A;  2Y1I A;  4M7Y A;  1VSH A;  1HJR A;  3V1Q A;  1BA0 A;  3W0L A;  4JEP A;  1IBL K;  3U9Z A;  3VQQ A;  4FVM A;  3T3F A;  2WTU A;  4BC5 A;  1NGD A;  4RW7 A;  1HKC A;  4BRG A;  1IO2 A;  2XRI A;  4E7H A;  2X74 A;  4H0Y B;  4DF8 A;  3U9D A;  4KHW A;  4IFV A;  4B1U B;  4FLV A;  4AIL C;  5AZI B;  1WN7 A;  5M1F A;  1WUA A;  2G8I A;  3UKR B;  2QA4 N;  1VSD A;  3DRR A;  4WFN L;  1QSS A;  1J9A A;  3V4I A;  4WE1 A;  4FO0 A;  3VF4 A;  3ZT4 A;  1QVF M;  2BDP A;  4JD2 B;  1BI4 A;  2P9K A;  3DMJ A;  5BRE A;  3WNG A;  4WF9 L;  4MLE A;  1RDB A;  3A5L C;  1QZ6 A;  3VES A;  4BG8 A;  3TI0 A;  1WLJ A;  3TU5 A;  2IC3 A;  3J8A A;  4M7X A;  2HVH A;  2VWK A;  2KW4 A;  2D4W A;  3CCM N;  1NWK A;  2I7N A;  4CZE A;  4DV5 K;  1ZBS A;  1VK0 A;  2QWR A;  3HT3 A;  2KZZ A;  3IMX A;  2A5X A;  2JWL A;  3L8B A;  2OZM A;  3HP9 A;  1VQP N;  2LSN A;  4CI6 A;  3K5N A;  3D2E B;  5EU7 A;  4BWJ A;  4KPY A;  3DXK A;  2P9L B;  3RMB A;  2A1S A;  2H3G X;  4JI4 K;  4BRO A;  3SMS A;  2JLE A;  5HRP A;  1ILY A;  4AM6 A;  4DFK A;  4BRI A;  3CPW M;  1SL2 A;  2HF4 A;  1VRU A;  1HPZ A;  4DFJ A;  3OHR A;  4A57 A;  3KKS A;  3G25 A;  3ZSR A;  4ID1 A;  4JI3 K;  4BQL A;  1U6Z A;  1K73 O;  3D45 A;  4XH4 A;  5C25 A;  4B1Z A;  3LAK A;  1GOB A;  4GW6 A;  4XH1 A;  4E89 A;  2ASO A;  3LP0 A;  1GLA G;  2HST A;  4H0P A;  3WXL A;  4GKJ K;  3CQY A;  2RHK A;  4RW4 A;  1T05 A;  1L3U A;  3O3H A;  3HXM A;  3R3L A;  4OGE A;  2BGG A;  4YDU C;  1JLE A;  3FZK A;  1ATR A;  5BRF A;  1H1V A;  4B9T A;  2OYQ A;  4CJT A;  3AO4 A;  5KPT A;  1BWF O;  2AJQ A;  2O8D B;  4BRL A;  3NH1 A;  4CF0 A;  3AA3 A;  3OW2 M;  4KHN A;  1BQN A;  3HVR A;  3ZT1 A;  2PAV A;  3AAR A;  4KTQ A;  1VQ5 N;  4FJJ A;  1Q18 A;  3OBW A;  4Z4H A;  4H4O A;  3NF9 A;  5A2Q O;  1JL2 A;  3HSC A;  3L2R A;  3HOT A;  2CGJ A;  4DR2 K;  2DTU A;  3SI6 A;  3VQ4 A;  3HPH A;  4CF9 A;  5BN8 A;  4CED A;  4F2S A;  2E20 A;  4IDH A;  2OCE A;  4M3U A;  3CCU N;  5HBM A;  5CE3 A;  3THW A;  3NGZ A;  2RKI A;  4JRP A;  3LDN A;  4L8R B;  1RT2 A;  1JCF A;  4NLB A;  2QI2 A;  4CJV A;  4FZY A;  1UOC A;  1VAZ A;  1WSG A;  5IWA K;  1T3V A;  3IS9 A;  5AQV A;  4FLX A;  2OPP A;  1RIL A;  1J6Z A;  4C8M A;  1U2V A;  1U04 A;  2G8K A;  3CXC M;  4DWI A;  3NAE A;  4BE2 A;  1S5J A;  1VQ9 N;  1CZB A;  4BWM A;  4LY7 A;  1J54 A;  2FF3 B;  1TKX A;  2BH1 A;  1Q86 O;  1BQM A;  1QVG M;  4NCB A;  4OKJ A;  2FBV A;  2FSJ A;  4CIF A;  3KVG A;  4CBU A;  5TKW A;  3I0S A;  4F3T A;  1TAQ A;  1X1P A;  4O5F A;  3CM5 A;  1MWM A;  5JVG L;  1NLV A;  4DV2 K;  4FOI A;  3QIN A;  4Z94 A;  3QEI A;  3GOI A;  4FM1 A;  3ZSO A;  3CJ7 A;  2NLX A;  1L3V A;  1VQ8 N;  3U4L A;  2Y1J A;  3E66 A;  5JLH A;  3THY A;  4C23 A;  2OZS A;  4OGC A;  4DSJ A;  4DQ8 A;  1N32 K;  1YF5 L;  2O8B B;  4KHY A;  2F4V K;  4LFB K;  3DRS A;  4JLH A;  4CW7 B;  5AQJ A;  1Z26 A;  4GKK K;  3VEO A;  4CGD A;  2PYL A;  2W40 A;  3DXM B;  3ITH A;  3WEE A;  4FZX C;  2Z1J A;  1TK5 A;  4IDK A;  4J8F A;  3ALY A;  4CK3 A;  3PSF A;  1W9H A;  2X6S A;  4J2D A;  1LAV A;  4PL8 A;  4CZK A;  4Z4C A;  3MXJ A;  3E01 A;  5F2R A;  4H0O A;  1TGO A;  4ELU A;  4E7I A;  2HHH K;  1JXE A;  3A5N C;  4C1N I;  1D9D A;  1HYS A;  4EAH D;  4I2Q A;  1JLB A;  1TK8 A;  3MX5 A;  5BRD A;  4DFP A;  1JLA A;  2CH6 A;  4JS5 A;  3ZCM A;  1EX4 A;  4YOR A;  1VSF A;  2DY4 A;  3A8Y A;  2V51 B;  3L3V A;  4IG0 A;  3O08 A;  2GEL A;  2O8E B;  1HNI A;  1ZXO A;  4AHR A;  2FXU A;  4JN4 A;  3OYF A;  1LWE A;  3OYH A;  1OH5 A;  5CYQ A;  2QKK A;  2J4R A;  5AZJ A;  4DQR A;  4FJ5 A;  3K58 A;  5T7B A;  1BG3 A;  1D9F A;  4QS7 A;  3TTF A;  4GV9 A;  5HL7 L;  1T6C A;  3VMF B;  3OBY A;  3O1B A;  4IG3 A;  3SPY A;  4XIU A;  3VA0 A;  4CF8 A;  3S9H A;  4CZJ A;  3VEY A;  4OX9 K;  4PQU A;  4DTN A;  2OPS A;  5J2M A;  2YKM A;  3UKU B;  5KRT A;  5KRS A;  2OPR A;  4CZM A;  3SV4 A;  2O8F A;  3FZF A;  2P51 A;  4JAX A;  4Y1C A;  5C42 A;  3BF1 A;  2Q31 A;  5AQU A;  1EXQ A;  4CFD A;  4IBN A;  4BRQ A;  1ITG A;  1KLM A;  1MA9 B;  4M3X A;  2D0O A;  4LSN A;  4PUO A;  1O1W A;  3MX2 A;  5E41 A;  4NYF A;  4H5V A;  4FK4 A;  1S1V A;  4LD0 A;  1RBT A;  1TKZ A;  4K8X A;  2A6A A;  4JKC A;  4FLY A;  5TKY A;  2JWK A;  4FJN A;  4L3Q A;  3MEE A;  4CEF A;  3FZL A;  1E4F T;  3MWP A;  3ULD A;  3SQ0 A;  1XMO K;  4M3Z A;  4DU3 A;  1GLC G;  2IIR A;  3KK7 A;  2A3Z A;  1TUY A;  2HNZ A;  4E7L A;  2KHO A;  4GVE A;  3HBT A;  3OYD A;  1BCM A;  1BHL A;  2YJF A;  4ZTJ A;  1OH8 A;  4I2P A;  4KB1 A;  4FJ9 A;  4GMJ B;  5JIC A;  4CZG A;  3PX6 A;  1BIS A;  1T03 A;  4YNQ A;  1QQC A;  4CEA A;  3VQ5 A;  1DTQ A;  2QKB A;  3CC4 N;  4KBO A;  3M3Z A;  3ATU A;  3NE6 A;  4KRF A;  4WQ5 C;  3C95 A;  3DLL L;  4F2R A;  5AQQ A;  3FGU A;  3J80 O;  3O8M A;  1T8E A;  3V9U A;  2I7P A;  3MAQ A;  3EL2 A;  2ATQ A;  2VQF K;  4NYN A;  3L6Q A;  1QTM A;  2YHX A;  3L2W A;  5AQG A;  2D0A A;  3V1R A;  5H1S Q;  1K8A O;  3M1F A;  1SQK A;  3IDH A;  2WBN A;  3SJH A;  2KFN A;  1IV0 A;  4MFB A;  3KK2 A;  3W3D A;  4X66 K;  3BF3 A;  3OS0 A;  4BDZ A;  3QO9 A;  2UUC K;  2Q97 A;  3THW B;  4FCY A;  1IJJ A;  1TVR A;  4BR9 A;  3GE1 A;  2YX6 A;  1S1W A;  4JNE A;  4GY2 B;  3VQ8 A;  5C24 A;  2HB5 A;  2YV0 X;  5LL6 Z;  4AHC A;  1U48 A;  1CZ9 A;  4RW6 A;  1SV5 A;  4FPA A;  4N5S A;  1TL1 A;  3PX4 A;  3CYM A;  5AFU A;  3THX B;  1XQS C;  1HYV A;  2D0C A;  3TAB A;  3EKU A;  1NGI A;  3M8S A;  4IFE A;  3V9W A;  4OKE A;  2KZM A;  3K57 A;  3CG7 A;  3NH0 A;  2ZGY A;  4QOZ B;  1EQY A;  1VQL N;  4B8C A;  2WFB A;  3OJS A;  3NMU A;  3CI5 A;  1ATN A;  3ZT0 A;  3AVA A;  1NGG A;  1N5Y A;  3THY B;  3DWL A;  4IO9 L;  1YT3 A;  3LWL A;  4K42 A;  4FXD A;  3TAP A;  1NGJ A;  2VGN A;  3WXK A;  3S3M A;  1RDU A;  4EZ6 A;  4HVJ A;  4DQS A;  3AVF A;  3WQT A;  3WEE B;  2UUA K;  1HMV A;  1MU2 A;  5FPN A;  3CER A;  1GOC A;  3ZET A;  4BC3 A;  4WFA L;  4HUE A;  4AHS A; 
#chains in the Genus database with same CATH homology
 3NF6 A;  2BDP A;  1LAW A;  4UQG A;  2QXF A;  4CGG A;  3TAQ A;  1BI4 A;  3M8Q A;  5FRO A;  3DMJ A;  4OLA A;  2B4J A;  1JLQ A;  4B08 A;  3WNG A;  1RDB A;  2O4I A;  4R5P A;  3CFP A;  4CEB A;  3VQ6 A;  4CJ4 A;  3TI0 A;  3KLF A;  3NFA A;  4B9S A;  1WLJ A;  2IC3 A;  2GUI A;  2B6A A;  3HM9 A;  1RT7 A;  1BGX T;  4FLZ A;  2HVH A;  2VWK A;  1WAF A;  2KW4 A;  3SUP A;  3KD1 E;  4DS5 A;  3NGY A;  1XC9 A;  4FJH A;  1Q9X A;  2VG7 A;  3JSM A;  1BL3 A;  1VK0 A;  2GBZ A;  3HT3 A;  4OVL A;  4JS4 A;  2KZZ A;  3CFO A;  3OY9 A;  2W42 A;  3V1O A;  1J5O A;  3L8B A;  4FZZ A;  4KHS A;  1S6P A;  4TSX A;  3HP9 A;  2OZM A;  5HRO A;  2LSN A;  3K5N A;  1LW0 A;  1X9S A;  5EU7 A;  4BWJ A;  4KPY A;  4CJK A;  4CJU A;  1NK5 A;  4FLU A;  2WON A;  3RWU A;  3LPU A;  3ZSZ A;  2VWJ A;  4H8K A;  2A1S A;  3JYT A;  3ZSV A;  3RMB A;  4B9M A;  3KLI A;  4M3W A;  3HO1 A;  4PY5 A;  3OS1 A;  2JLE A;  4AH9 A;  5HRP A;  4DTR A;  2IGI A;  1IKW A;  4DFK A;  4N47 A;  5J2Q A;  1RBV A;  3H08 A;  4CHY A;  3SNN A;  2A1R A;  1RBU A;  1SL2 A;  3F73 A;  2VG6 A;  3QNO A;  1VRU A;  1SL1 A;  1HPZ A;  2ITG A;  3AO2 A;  4DFJ A;  3RR8 A;  4HCC A;  4CER A;  5CZ1 A;  3TAF A;  3KKS A;  1KCF A;  3ZSR A;  4ID1 A;  3AVG A;  4I7F A;  2YNH A;  1EET A;  1U49 A;  4E7J A;  1C0U A;  4DTO A;  4FM2 A;  1Q8I A;  1W0H A;  1JLG A;  4ZHR A;  4DU1 A;  3NDK A;  4LSL A;  3D45 A;  2ZD1 A;  1VRT A;  2D5R A;  4K8Z A;  2BE2 A;  2NUB A;  5C25 A;  1BIZ A;  2G8H A;  3LAK A;  4CJP A;  1GOB A;  4GW6 A;  4E89 A;  3RRH A;  2DFE A;  4FM0 A;  3UIQ A;  4AHV A;  2B5J A;  2IOC A;  3LP0 A;  4DTP A;  3VQA A;  3HPO A;  3V81 A;  4M3X A;  4BDY A;  4CFA A;  1RDA A;  2P5O A;  2YHA A;  3VQB A;  3CFR A;  1CXU A;  3AVB A;  4RW4 A;  4F4K A;  1T05 A;  1L3U A;  3AVM A;  3O3H A;  5J2N A;  4CGH A;  2EHG A;  2YNG A;  3TAR A;  4Z4F A;  3HXM A;  3DOL A;  4OGE A;  2BGG A;  1JLE A;  3AO1 A;  3ZSW A;  1NJZ A;  2ETJ A;  1A5W A;  1XI1 A;  3RR7 A;  4KHQ A;  3DYA A;  4H4M A;  4KTZ A;  1I39 A;  4B9T A;  4CJT A;  2OYQ A;  3AO4 A;  4C8N A;  3LAN A;  4ELT A;  1XHZ A;  1ASV A;  3TAM A;  5J1E A;  2AJQ A;  3NH1 A;  3EYZ A;  4CF0 A;  3AA3 A;  4CFC A;  4EZ9 A;  4KHN A;  1BQN A;  3K5O A;  3HVR A;  4I9L A;  1B92 A;  3WNE A;  3ZT1 A;  4FLW A;  4C8K A;  4KTQ A;  3AA2 A;  3B6O A;  4AHT A;  5HRN A;  3SUO A;  1F21 A;  1QS4 A;  1TKT A;  4FJJ A;  3EZ5 A;  3NGI A;  3I0R A;  5D3G A;  2ZE2 A;  2G8U A;  1ZBH A;  4Z4H A;  1KVC A;  3PO4 A;  3LP1 A;  4AHS A;  2R7Y A;  4H4O A;  3DLE A;  3RRG A;  1HRH A;  3NF9 A;  3AVH A;  1LW2 A;  3SQ4 A;  3L2R A;  1JL2 A;  3RMD A;  1KFS A;  1RDD A;  4DFM A;  2DTU A;  3SI6 A;  1IKY A;  3VQ4 A;  3HPH A;  5KI6 A;  2FBT A;  4CF9 A;  1HNV A;  3U3G A;  1YTA A;  3KIO A;  4RG8 A;  1Y97 A;  2KQ2 A;  4O0J A;  4CED A;  3LZJ A;  4F2S A;  1ASW A;  1J53 A;  3AA5 X;  3DRP A;  4M3U A;  3QEX A;  3NHG A;  5HBM A;  4CK1 A;  3SPZ A;  1NK4 A;  4J2E A;  4NCA A;  1X9M A;  5DMR A;  1C1C A;  3MED A;  3NGZ A;  4CEQ A;  2RKI A;  4DG1 A;  4JRP A;  4E1M A;  2PYJ A;  4B9L A;  3DM2 A;  4BE0 A;  4L8R B;  2RF2 A;  1RT2 A;  2F96 A;  1U45 A;  4FJI A;  4FZY A;  4CJV A;  5I3U A;  4FLT A;  3I8D A;  1UOC A;  1WSG A;  3DLR A;  3IS9 A;  3QEP A;  3KLH A;  1TKD A;  2XO7 A;  3DLG A;  4FLX A;  4Q0B A;  4W5R A;  2OPP A;  1RIL A;  3VQP A;  3O3F A;  4CGI A;  1NK0 A;  4C8M A;  1U04 A;  4CJF A;  2G8K A;  4CHZ A;  4DWI A;  4CIE A;  3NAE A;  4BE2 A;  1S5J A;  2IDO A;  4CE9 A;  4FJL A;  1CZB A;  3HL8 A;  2Z1I A;  4BWM A;  4LY7 A;  4EP4 A;  1J54 A;  5J2P A;  1SKS A;  1TKX A;  3PX0 A;  3AVK A;  3OYI A;  5FRM A;  3OYM A;  1U4B A;  1BQM A;  4RW8 A;  3HK2 A;  4NCB A;  4OKJ A;  2FBV A;  3SJJ A;  1GOA A;  4CIF A;  5SWM A;  1RT4 A;  1RTD A;  4E3S A;  3S3N A;  3I0S A;  4KKO A;  4F3T A;  1TAQ A;  2HHV A;  1X1P A;  1NOY A;  3CM5 A;  1YVU A;  3QET A;  1UA0 A;  4FJK A;  3RMA A;  3HJF A;  3WNF A;  3VQE A;  4CJQ A;  1VSE A;  4PA1 A;  4BAC A;  4Z4E A;  2IAJ A;  3QIN A;  1C0M A;  3P5J A;  4CJW A;  4B8A B;  3QEI A;  4E1N A;  1RBS A;  1QHT A;  2YNF A;  3AVL A;  3ZSO A;  3OS2 A;  4FM1 A;  1L3V A;  3DLH A;  5CY4 A;  1RDC A;  2Y1J A;  5CZ2 A;  4W5Q A;  1D8Y A;  1RT3 A;  4DTS A;  3CQ8 A;  2G8W A;  4DS4 A;  2D0B A;  3V9S A;  2OZS A;  2YKN A;  3ZSX A;  4ZTF A;  2FBX A;  1C1A A;  4CJS A;  4OGC A;  4DSJ A;  1SKW A;  1FKO A;  1RT1 A;  3VQ9 A;  4KHY A;  1EKE A;  4W5O A;  1JLC A;  3DRS A;  4JLH A;  4O55 A;  4KB0 A;  1Z26 A;  4I9Q A;  3K5M A;  1CLQ A;  1ZBF A;  3G0Z A;  2IS3 A;  4CGD A;  2PYL A;  1LWC A;  3LZI A;  4M45 A;  3KLG A;  3KJV A;  4DSI A;  1C1B A;  3ITH A;  2KFZ A;  4M42 A;  3DLB A;  4FZX C;  4KI6 A;  2Z1J A;  5CYM A;  2HHU A;  1BIU A;  3QNN A;  1TK5 A;  4IDK A;  4J2A A;  3ALY A;  3O4Q A;  4RW9 A;  5K14 A;  4CJ5 A;  4CK3 A;  4IFY A;  3SCX A;  1W9H A;  2X6S A;  3TAE A;  1NK6 A;  1N6Q A;  1C0T A;  1IH7 A;  4J2D A;  1LAV A;  4Z4C A;  4GVM A;  3MXJ A;  3PV8 A;  3E01 A;  1R0A A;  4ICL A;  1WSF A;  4CES A;  1S1U A;  1TGO A;  4ELU A;  4E7I A;  4DQP A;  1ZBI A;  1JXE A;  2HHQ A;  1D9D A;  1HYS A;  3S3O A;  4DLE A;  4I2Q A;  4CEE A;  1JLB A;  4MQ3 A;  4O5B A;  5KTQ A;  1TK8 A;  3LAL A;  3C6T A;  4W5N A;  3A2F A;  3HYF A;  2Z1G A;  4Z4G A;  4DFP A;  3IAY A;  4CFB A;  1JLA A;  3VQ7 A;  2RPI A;  4JS5 A;  3SQ2 A;  1NKB A;  4KHU A;  3ZCM A;  1NOZ A;  1EX4 A;  1VSF A;  3P83 D;  1NJW A;  4F8R A;  2DY4 A;  4CJR A;  2EX3 A;  3L2V A;  3QIP A;  3L3V A;  4IG0 A;  4OJR A;  4N56 A;  4KI4 A;  3V9X A;  1HNI A;  1NJY A;  1TV6 A;  3U6F A;  3LAM A;  4AHR A;  4FJ7 A;  1RCH A;  3OYH A;  3OYF A;  1LWE A;  3NH2 A;  1Q9Y A;  4OPK A;  5CYQ A;  1RNH A;  4DQR A;  4DTX A;  4CF2 A;  2QKK A;  3K58 A;  5T7B A;  1CXQ A;  4FJ5 A;  1ASU A;  4FJ8 A;  5FRN A;  1D9F A;  5JS1 A;  3V6D A;  1RT5 A;  2WOM A;  5DK5 A;  3DOK A;  3IRX A;  3P1G A;  3OYB A;  4IKF A;  3SUN A;  4IG3 A;  2DFF A;  2E6L A;  3HPG A;  4XIU A;  3SPY A;  1SKR A;  1LWF A;  2P1J A;  4CF8 A;  3VA0 A;  3TR8 A;  3S9H A;  5HRR A;  3KD5 E;  1L5U A;  1S9E A;  3M8P A;  2G8F A;  1DLO A;  4PQU A;  4DTN A;  4QCL A;  2OPS A;  4FW1 A;  4O4G A;  5J2M A;  4N41 A;  1L3T A;  1KVA A;  1B9F A;  2YKM A;  4CK2 A;  5KRT A;  5KRS A;  1RTI A;  2HHT A;  2OPR A;  3SV4 A;  3OYA A;  5KGX A;  2Q3S A;  2P51 A;  4Y1C A;  3AVI A;  4AHU A;  5C42 A;  3T19 A;  1EXQ A;  4CFD A;  4IBN A;  1EP4 A;  4FJG A;  1ITG A;  3LPT A;  1KLM A;  4KFB A;  4NCG A;  4M41 A;  3T1A A;  4LSN A;  4ELV A;  2ZQB A;  4PUO A;  1O1W A;  3TWH A;  3SYZ A;  1WSH A;  2HNY A;  3O3G A;  2OA8 A;  3ZSQ A;  1DTT A;  1LV5 A;  2PY5 A;  1BCO A;  4CGF A;  5E41 A;  3L2Q A;  4KRE A;  5JS2 A;  4NYF A;  4HTU A;  5HP1 A;  1NK7 A;  3QLH A;  4JRQ A;  3BGR A;  1S1X A;  4DQQ A;  1XWL A;  4FK4 A;  1WSI A;  2VG5 A;  1S1V A;  4LD0 A;  4E0D A;  4LH5 A;  1HQU A;  1RBT A;  1XHX A;  3CM6 A;  3LP2 A;  3EY1 A;  3C94 A;  4DSE A;  3NCI A;  3MXI A;  1TKZ A;  3OYL A;  1RTJ A;  4F3O A;  3TAG A;  4K8X A;  1NKE A;  3B6P A;  4FLY A;  3ZT3 A;  3L2U A;  4CGJ A;  4FJN A;  4J2B A;  4CHP A;  4FK2 A;  5I42 A;  3MEE A;  1Z25 A;  3ZSY A;  2RN2 A;  2F8T A;  3VN5 A;  3AVC A;  3NF7 A;  4CEF A;  1UA1 A;  4QAG A;  3F9K A;  3ULD A;  3NF8 A;  3SQ0 A;  4M3Z A;  4DU3 A;  2HNZ A;  4EP5 A;  3KLE A;  3AO5 A;  4E7L A;  3QEV A;  3ISN C;  3OYD A;  1BCM A;  1K6Y A;  1BHL A;  4ZTJ A;  1IKX A;  4I2P A;  4HHT A;  1WAJ A;  4KB1 A;  4FJ9 A;  4GMJ B;  3DI6 A;  4O44 A;  3PX6 A;  4HUF A;  4DTJ A;  4Z0U A;  3THV A;  4B3O A;  1BIS A;  3LWM A;  1ZBL A;  1T03 A;  4YNQ A;  5KGW A;  4DSL A;  1KTQ A;  1QQC A;  1RT6 A;  3K2P A;  3MEC A;  1D5A A;  3VQ5 A;  4CEA A;  3OYJ A;  3D0P A;  4CF1 A;  1DTQ A;  1I3A A;  3AVN A;  1FXX A;  1U47 A;  4FK0 A;  2QKB A;  3M8R A;  3MXM A;  4DQI A;  3FFI A;  1KRP A;  3NE6 A;  3PY8 A;  2KTQ A;  4KRF A;  1HYZ A;  3C95 A;  3G10 A;  4BE1 A;  4F2R A;  1C6V A;  3RMC A;  3ASM A;  4DSK A;  5FDL A;  1IKV A;  1T8E A;  1HQE A;  4KV8 A;  2X78 A;  4CIG A;  3HVT A;  4FW2 A;  2G8V A;  2FBY A;  1VSJ A;  3V9U A;  3BDP A;  3PO5 A;  4C8L A;  3MAQ A;  4DTU A;  3OJU A;  4M3T A;  4YFU A;  4PWD A;  2ATQ A;  3QIO A;  3KTQ A;  4NYN A;  1QTM A;  4KO0 A;  3OYC A;  3L2W A;  1REV A;  1WNS A;  2YNI A;  3VA3 A;  1T7P A;  1VSL A;  3K59 A;  2D0A A;  3V1R A;  3OVN A;  4E19 A;  1JLF A;  1ZBU A;  3K5L A;  3KK1 A;  4M3R A;  4B9V A;  1S1T A;  4OPJ A;  2KFN A;  4DU4 A;  4BDP A;  4MFB A;  3KK2 A;  2XY5 A;  2XY7 A;  3NBP A;  1UAX A;  3L3U A;  1QSY A;  2HHX A;  3QER A;  1TL3 A;  3OYG A;  3WNH A;  3OS0 A;  3SV3 A;  4CHQ A;  1TK0 A;  3AV9 A;  4C8O A;  3VQC A;  4BDZ A;  1A5X A;  2P5G A;  3QO9 A;  3SUQ A;  3QES A;  4HCB A;  2YHB A;  4CEZ A;  2E6M A;  4FCY A;  4FYD A;  1TVR A;  4CJ3 A;  1A5V A;  1JL1 A;  1S9G A;  4N76 A;  2E4L A;  2HND A;  4CEC A;  1NK8 A;  4Z4I A;  4Q5V A;  3DLK A;  4B9U A;  1S1W A;  4CJL A;  3VQ8 A;  5C24 A;  1NKC A;  3PUF A;  5HRS A;  2HB5 A;  2HHS A;  4ID5 A;  2YV0 X;  1BI4 B;  3VQD A;  4AHC A;  1U48 A;  1CZ9 A;  4CHO A;  3HST B;  4LH4 A;  4RW6 A;  3SZ2 A;  1SV5 A;  1IG9 A;  2HHW A;  1B9D A;  2FC0 A;  3IG1 A;  4N5S A;  4G1Q A;  2HMI A;  1TL1 A;  3RTV A;  3U3Y A;  3MEG A;  2Z1H A;  1NK9 A;  3PX4 A;  3CYM A;  3TAN A;  1QSL A;  2I5J A;  3LDS A;  3QEW A;  1QE1 A;  1KSP A;  4E7K A;  2F8S A;  1HYV A;  3KKR A;  2D0C A;  1FK9 A;  1JKH A;  3TAB A;  5SZT A;  2OPQ A;  4M3Y A;  2DFH A;  1FKP A;  4KTW A;  3LP3 A;  3M8S A;  4DMN A;  4DSF A;  4W5T A;  4OKE A;  2XY8 A;  3V9W A;  2PZS A;  1L3S A;  4FJM A;  2KZM A;  3AVJ A;  4KAZ A;  3K57 A;  2QK9 A;  2HW3 A;  3OYE A;  1WSJ A;  1VSI A;  3CG7 A;  1S6Q A;  1KVB A;  4CJE A;  1JXB A;  3NH0 A;  3HP6 A;  4CEO A;  1TAU A;  2XY6 A;  4B9N A;  1SL0 A;  4CHN A;  4QOZ B;  3OYK A;  1UWB A;  1KLN A;  3AO3 A;  3KK3 A;  4B8C A;  2Y1I A;  1SUQ A;  1VSH A;  1HJR A;  3OJS A;  2GV9 A;  3V1Q A;  2O4G A;  1KFD A;  3C6U A;  3ZT0 A;  3VQQ A;  2XHB A;  3AVA A;  4FVM A;  3T3F A;  5HLF A;  1ZYQ A;  1X9W A;  1N5Y A;  1RBR A;  4FJX A;  3V9Z A;  1YT3 A;  3LWL A;  1G15 A;  4FXD A;  1WSE A;  4RW7 A;  2JGU A;  3AA4 A;  3TAP A;  1IO2 A;  2XRI A;  3ZT4 A;  3ZT2 A;  4E7H A;  4O0I A;  4DTM A;  3S3M A;  2X74 A;  3O4N A;  4EZ6 A;  4HVJ A;  4DQS A;  4DF8 A;  3AVF A;  1YTU A;  4KHW A;  4IFV A;  1RTH A;  4FLV A;  4OKK A;  3SQ1 A;  4AIL C;  4DLG A;  1HMV A;  1MU2 A;  1NJX A;  1VSM A;  1WN7 A;  2X6N A;  3OYN A;  4CCH A;  2HVI A;  2G8I A;  1VSK A;  1GOC A;  4HUG A;  2BAN A;  4DF4 A;  1VSD A;  3DRR A;  1QSS A;  1J9A A;  4Y1D A;  3V4I A;  4HUE A;  4WE1 A;  4OLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...