3V9SA

Crystal structure of rnase t in complex with a product ssdna (aac) with one mg in the active site
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
total genus 63
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9sA00
1VSFA 1IO2A 3TWHA 1RT6A 3SV4A 4KB0A 3VQCA 1IKWA 3QEXA 1VSHA 3RR8A 3B6OA 1FKPA 3NAEA 4FJIA 1QSSA 4RW4A 4FXDA 4R5PA 4AHSA 4PA1A 2WOMA 3V1QA 2RN2A 4IFYA 5CYMA 4DF4A 4JS4A 3OYFA 3MEEA 3DLBA 5JS2A 4DTPA 3L2UA 4EP5A 3EYZA 4BDYA 4QAGA 3PV8A 2IGIA 3CYMA 2P1JA 5HBMA 2IDOA 1XI1A 4DSKA 3VN5A 3VQ4A 3HVRA 4CJTA 2G8VA 1J9AA 3S9HA 3KD1E 2XY6A 3IRXA 1WAJA 3C6UA 3I8DA 3QERA 3L3VA 3ZSOA 1CLQA 3WNFA 1VRUA 1EX4A 4HCBA 1JLEA 3SYZA 3QEPA 3C95A 1B9DA 4DSIA 1LW2A 3AO2A 4PWDA 3QEWA 3AVKA 1TAUA 2EHGA 4DLEA 2HHTA 4DQQA 1VSJA 5J2PA 3ZT1A 4DMNA 4M3RA 3HK2A 4Z4IA 4AHVA 2HVHA 4OLAA 1RBTA 3SUQA 1JLCA 4PQUA 1JLAA 1NJXA 4H4OA 4AHUA 2Y1JA 5JS1A 2LSNA 4FLYA 3NF9A 3UIQA 2IS3A 3ITHA 1VSEA 2HNYA 4AHTA 4CIEA 4FZZA 3CFOA 3RMDA 3ZSRA 4CJUA 3PO5A 1HYSA 3AVJA 1WNSA 1NK0A 4J2BA 3IG1A 3ZSZA 4H8KA 2O4GA 1LV5A 1S5JA 4FYDA 4FLWA 1XHZA 3RMBA 3K2PA 1K6YA 3QO9A 4H4MA 1Y97A 3LWLA 1S1VA 5C42A 3BDPA 1NK7A 1IH7A 4DSJA 3K5OA 3HSTB 4OJRA 1U49A 3V1OA 4CEZA 3OYBA 1LWEA 5J2QA 1EKEA 3SPZA 2O4IA 1W9HA 4F3OA 1JL2A 4IFVA 4CJLA 1RCHA 1FKOA 2VWKA 2YNIA 4TSXA 4DG1A 3V9ZA 3DYAA 3FFIA 5SWMA 4E1MA 4FJJA 4FJXA 5KRSA 1N6QA 4B9VA 2X6SA 2VG6A 3QIOA 4W5RA 4G1QA 4CEOA 3P1GA 4HCCA 4QOZB 4OGCA 4YFUA 1C1CA 1L3TA 3RTVA 4KTQA 1QHTA 1UAXA 3CM6A 1W0HA 1NJYA 2OPSA 2Z1JA 1WSEA 4OGEA 2G8KA 1WSIA 2E6MA 2GUIA 1KCFA 1LAWA 2E6LA 2YNHA 3TABA 1A5WA 3AVMA 4W5OA 4DQIA 1GOCA 4LD0A 2B6AA 1U04A 3PUFA 5KGXA 3O3FA 1JLBA 3AO5A 4FVMA 1LAVA 3HXMA 4HUFA 3MXIA 2OYQA 3PX4A 4DFMA 4B9MA 1JLQA 4CEQA 2FBYA 4EZ9A 4ID1A 4CEEA 3HP6A 1HPZA 4RW7A 4LH4A 4CIFA 3VQ9A 3KK2A 3DRRA 2XO7A 3LAKA 3OS2A 4DTNA 2PY5A 3HVTA 1RILA 4KI4A 3CM5A 1WSFA 2D0CA 3U3GA 4CGFA 4CJFA 1ZBFA 1TKDA 2Z1HA 1IG9A 2HHSA 1RT1A 3C6TA 1TAQA 1J54A 4DS5A 3QETA 1RDCA 1N5YA 3HPHA 3JSMA 1BIZA 4W5TA 3OYEA 2BANA 4JS5A 4B9LA 1SL0A 2HHWA 3K59A 1QE1A 4M42A 4OLBA 3ISNC 2VWJA 3OY9A 3AVFA 3MAQA 2DFHA 2X6NA 2BDPA 4N5SA 5HP1A 3NHGA 3LWMA 1ZBUA 3QLHA 1ZYQA 1B92A 3VQDA 4DTRA 4FJGA 4CFCA 3TANA 3NFAA 2FC0A 1SKRA 4KB1A 2FBTA 3DLHA 3H08A 4CGGA 3KIOA 4KI6A 3RRGA 3K57A 2W42A 4FLUA 4KHWA 3AA5X 4AHRA 4K8ZA 2QK9A 4E19A 4KO0A 4NCAA 4B3OA 1SKWA 1NKCA 3SQ2A 3LP1A 3TAMA 2OPRA 4CF8A 2G8IA 3AVCA 4DTOA 4N56A 4OVLA 3OYLA 3V6DA 4C8KA 3HJFA 3MEGA 3K5LA 4Y1DA 3V9XA 1TL1A 3SUNA 4KHSA 1LW0A 4M3UA 3QNOA 4DSFA 3RMAA 3HL8A 3WNGA 1BI4A 2Z1IA 1BL3A 1WSHA 3OYGA 2KFNA 1BCOA 2B5JA 4CJVA 1RNHA 5D3GA 3VQEA 4AHCA 1EP4A 1MU2A 4YNQA 5CY4A 4BACA 3SJJA 3EY1A 2YNGA 2HHXA 1HMVA 5CZ2A 4CF9A 2OZMA 2HNZA 4E1NA 3MEDA 5K14A 3A2FA 4GW6A 1A5XA 3VQBA 1SL2A 3MXJA 3L2VA 3T3FA 2G8WA 1J53A 1WLJA 4M3YA 1O1WA 3ZT2A 3NBPA 1UWBA 2P5OA 4IKFA 4M3XA 1SKSA 1NK5A 2DTUA 4BDPA 4CJ4A 3C94A 2BGGA 2PYLA 1DLOA 1G15A 3TAQA 1NJWA 3OJSA 1RTDA 4KKOA 3TI0A 3F9KA 4CJ3A 1BI4B 5KTQA 3AO1A 4E7JA 4B9TA 4DWIA 2Z1GA 4K8XA 4O44A 1SV5A 1B9FA 4J2EA 1X1PA 1NKBA 1JLGA 1S6QA 4AILC 3S3NA 1UOCA 2OPPA 2JLEA 4CHOA 2A1SA 3L2RA 1ITGA 1RT3A 4ID5A 2XHBA 4I9QA 1EETA 1NKEA 1Q9XA 3L2WA 1RBRA 2OPQA 4JRQA 1KFDA 1F21A 2HHQA 1NOYA 1DTQA 4E89A 2HB5A 3NE6A 4CK3A 3HYFA 4DTSA 1FXXA 2WONA 4N41A 5HRSA 2YKNA 1CXQA 3T1AA 4IDKA 3LP2A 1C6VA 3ZSYA 4HUEA 4DLGA 1ASUA 3LP0A 3VQPA 4KRFA 4JLHA 4C8MA 5I42A 1YT3A 1LWFA 4FLZA 1ZBHA 2KQ2A 4HTUA 4F2SA 3NF6A 2D0BA 5C24A 2D5RA 3DLRA 4CJQA 3F73A 3OYJA 4CFAA 4JRPA 4DQSA 2YHBA 2ATQA 3SQ4A 3OS1A 3QESA 4E7KA 4FW1A 4CEBA 4KHYA 2KZZA 2RPIA 4RG8A 3SQ1A 2QXFA 4FJ5A 1EXQA 1Q8IA 3I0RA 4FLTA 1X9WA 2KW4A 1BHLA 1NK8A 2F8SA 4E3SA 1LWCA 5KGWA 3AA3A 2QKBA 1RDAA 4O55A 1YTAA 4M3ZA 4GMJB 4M3WA 3G10A 3HPOA 4E7IA 1C0TA 2I5JA 2VG5A 3TARA 4F8RA 3VQ7A 1HNIA 4NCGA 3V9SA 4CE9A 4Q5VA 3G0ZA 1U48A 3QEVA 1QTMA 3KLIA 1T7PA 3DRSA 3P5JA 2Q3SA 4CEFA 3NDKA 4BE1A 2A1RA 3BGRA 4Z4CA 4AH9A 1KVAA 1KSPA 2IAJA 4MQ3A 2HHUA 4CK2A 1RBSA 1BGXT 4FJ8A 1S1UA 1NK6A 4J2AA 4E0DA 1HQUA 3OS0A 4O5BA 2IC3A 4B9NA 4CF0A 3DOKA 4CGIA 2RKIA 4I2QA 1KVBA 5DMRA 1UA1A 4FJMA 4OKJA 1IKYA 4CESA 3PX0A 4FW2A 3OYDA 1BIUA 3S3OA 3TR8A 3PY8A 2BE2A 4B9SA 3SQ0A 3S3MA 1ZBIA 1RDBA 3DMJA 3ZSXA 4DTMA 1VSIA 3D45A 3CFRA 1REVA 4HHTA 4FM2A 1HYZA 4C8NA 1TK5A 3JYTA 2ZQBA 3VA0A 4OPKA 3WNHA 4FZYA 1D8YA 4FM1A 3AA2A 3SI6A 1D9DA 3VQQA 2NUBA 4CHNA 4DQRA 1HJRA 4CJEA 4DF8A 4ZTJA 2G8HA 3TAFA 4CF1A 3PO4A 1VK0A 4M45A 4KFBA 1TK0A 3O3GA 4KHQA 2IOCA 4Z0UA 1TKXA 4Z4HA 2R7YA 3RMCA 4CERA 1T8EA 5HROA 5HRNA 3OYCA 1QSLA 3K5NA 4IG0A 3LDSA 2HNDA 1JXBA 3V4IA 3CFPA 4IG3A 3SZ2A 4CJ5A 3L3UA 3LZJA 4ICLA 4FLXA 2G8FA 4IBNA 3DRPA 4FM0A 3O4NA 4PUOA 3MXMA 4CJRA 4I2PA 3M8SA 3B6PA 2AJQA 4RW6A 5FDLA 3SUPA 3LZIA 3KD5E 3AVGA 4EP4A 5J2NA 4FZXC 5FROA 4FK0A 3OVNA 3WNEA 1DTTA 1GOAA 3NGIA 3SPYA 3VQ6A 4O4GA 3QINA 5KRTA 4DTXA 4LSNA 3ZT0A 3AVIA 4CHYA 4FLVA 1RTHA 1IKXA 4DFJA 4NCBA 1RDDA 2X78A 3LALA 3ZSVA 1U4BA 4N47A 4DSLA 3ZCMA 3KK1A 3U6FA 3HPGA 1T05A 4CK1A 1KVCA 3HP9A 1WAFA 4MFBA 3MECA 3SNNA 3M8QA 2G8UA 4FJNA 4DU1A 1S9EA 4KPYA 1BCMA 4PY5A 1D5AA 4W5NA 3AV9A 4FJHA 4DSEA 1JKHA 1L5UA 3HO1A 1A5VA 4DU3A 4CECA 5E41A 3ULDA 1HQEA 4KAZA 3TAGA 4LSLA 2YV0X 2ETJA 3NF8A 3VQ8A 4CCHA 2YNFA 3M8PA 2XY7A 5I3UA 3NGYA 5HRRA 1ASVA 1S9GA 4CFDA 1RT4A 3U3YA 3SCXA 4FCYA 3THVA 4ZTFA 1L3UA 4L8RB 4KHUA 1SL1A 3LP3A 4F2RA 3K5MA 4BE0A 2YHAA 4W5QA 3V9WA 1NJZA 1RBUA 2ZE2A 4FJLA 4Z4GA 4CGHA 1CXUA 3I0SA 3T19A 1IKVA 4CIGA 2PYJA 5C25A 1RT2A 1XHXA 3IAYA 3LPTA 3SUOA 3RWUA 5T7BA 3AA4A 5HRPA 3KJVA 3ZT3A 1C0MA 3CQ8A 3EZ5A 2P51A 4Y1CA 3LANA 4BDZA 4Z4FA 4Q0BA 4M41A 4E7HA 1C0UA 1RT7A 1KTQA 3OYHA 1RBVA 4ZHRA 2D0AA 2GBZA 5HLFA 3HT3A 1R0AA 4QCLA 2P5GA 2QKKA 4BWJA 3KLEA 5DK5A 3TAEA 1I39A 1UA0A 4RW8A 2B4JA 4FJKA 4CGJA 3OYNA 3V9UA 1TKZA 1HNVA 1TV6A 2VG7A 1S6PA 3VQAA 3KLGA 3KLFA 4NYNA 5SZTA 4DQPA 3IS9A 3QIPA 3SV3A 1XC9A 4CJWA 1D9FA 3AVAA 4FK2A 1HYVA 3QNNA 3TAPA 4CHZA 3AVNA 4FJ9A 1KLNA 2HMIA 4E7LA 5J2MA 3NGZA 3RRHA 4NYFA 2Y1IA 3RR7A 1XWLA 1HRHA 3PX6A 1X9MA 4RW9A 1U45A 4O0JA 4CEDA 3AO3A 3AVLA 5FRMA 4F4KA 2DFEA 1BISA 1C1AA 1RTJA 1VSKA 2XY5A 3ZSWA 3DOLA 1VSDA 2EX3A 3O4QA 1CZBA 3KLHA 3VA3A 4DFPA 3QEIA 4FJ7A 2E4LA 4J2DA 4HVJA 3ASMA 1QS4A 3CG7A 5CYQA 1YVUA 4CJSA 3DLEA 1J5OA 4F3TA 1VRTA 1T03A 1TGOA 3KKRA 4ELTA 4ELVA 1NK9A 3NCIA 1WSJA 2YKMA 1JXEA 5CZ1A 4CJPA 2DFFA 4DFKA 1BQMA 2XY8A 1BQNA 4I9LA 3OYAA 2HW3A 4OKEA 4KV8A 3V1RA 4B08A 1C1BA 2FBVA 4CGDA 4C8OA 4DS4A 3L2QA 1WN7A 4CJKA 2HHVA 3NH0A 2ZD1A 3OYIA 4B8CA 5KI6A 5FRNA 1L3SA 4KREA 4HUGA 4N76A 2F96A 2ITGA 1L3VA 4OPJA 1TKTA 1GOBA 4BE2A 1QQCA 3DM2A 2X74A 1WSGA 1X9SA 2F8TA 2KZMA 1RT5A 4CFBA 1SUQA 1KFSA 3KTQA 1RTIA 4OKKA 5J1EA 3NH2A 4DTJA 4KHNA 4GVMA 4KTZA 4FK4A 2OZSA 4KTWA 1YTUA 3AO4A 2HVIA 3ALYA 1TL3A 4CHPA 4EZ6A 1U47A 2PZSA 1KLMA 2JGUA 3DI6A 3K58A 1I3AA 3LAMA 4ELUA 1NK4A 1TK8A 1S1TA 1KRPA 1QSYA 4Z4EA 3VQ5A 2RF2A 3E01A 4BWMA 3M8RA 4XIUA 4CHQA 4O0IA 3OYMA 4B9UA 3ZT4A 1ASWA 4UQGA 4CEAA 1VSMA 1Z26A 3O3HA 3KK3A 3DLGA 2OA8A 3NH1A 3NF7A 4I7FA 2DY4A 3OJUA 1JL1A 1JLFA 2FBXA 3AVBA 3D0PA 3OYKA 2XRIA 4WE1A 3KKSA 3V81A 5EU7A 3DLKA 4LH5A 1S1XA 4DU4A 1Z25A 3LPUA 2KTQA 3P83D 1FK9A 2GV9A 1TVRA 3ZSQA 1S1WA 4B8AB 3HM9A 4DTUA 4C8LA 1CZ9A 4LY7A 4CF2A 1NOZA 3L8BA 4M3TA 1VSLA 1Q9YA 1ZBLA 2KFZA 3AVHA
chains in the Genus database with same CATH superfamily
1VSFA 3SV4A 4KB0A 2BH1A 3QEXA 3SAFA 3MX5A 4BGBA 1QSSA 4FJIA 4FXDA 3MEEA 2E5LK 5JS2A 3VEWA 4IO9L 4BDYA 3HZ6A 4ILJA 4J8FA 1XI1A 2P1JA 4DSKA 2IDOA 3VN5A 4U7BA 2NRWA 2XY6A 3QERA 3M5RA 1O13A 1XMOK 2Q31A 3THYA 1MDUB 3EN9A 4C1NK 4DSIA 1LW2A 4PWDA 1TAUA 3QEWA 4DLEA 3EKUA 1VSJA 5J2PA 3HK2A 5BRFA 3SUQA 1JLAA 3NF9A 3SJHA 3ITHA 1K73O 4AHTA 4FZZA 3MN5A 4CJUA 3PO5A 3IKMA 3W0LA 4WQ4C 5AQPA 4FLWA 1XHZA 1NLVA 1K8KB 3BZKA 3HBTA 1NM1A 5AQSA 4FSVA 5J2QA 1IBLK 1JL2A 4C1NI 5BPMA 2O8CA 4CEOA 4IOXA 3CD6N 4PKIA 4JI0K 1YUWA 1QHTA 2CGJA 2Z1JA 3CMAN 1HNXK 2E6MA 1M90O 4LD0A 2B6AA 1HKCA 3PUFA 4HUFA 2OYQA 4LF5K 4B9MA 3QBXA 4ID1A 3HP6A 1HPZA 3KK2A 4LH4A 2PY5A 3DRRA 4DTNA 3JAMO 3HVTA 1QVFM 3CM5A 2D0CA 4FOEA 4CJFA 1RT1A 5FPEA 1TAQA 3QETA 3JSMA 1RGIA 5H1SQ 1SL0A 2Q36A 3K59A 4Y0WA 4OLBA 3TTCA 4WYBA 4X65K 1ATSA 1X9JA 4GV9A 4JI4K 4ILGB 3QLHA 1B92A 3VQDA 4FJGA 4CFCA 5LJVA 3H08A 3RRGA 4DQ8A 4GVEA 4AHRA 4K8ZA 2QK9A 4E19A 4KO0A 1SKWA 3MN9A 3A5OC 3WEEA 3AVCA 1IV0A 4N56A 3HJFA 4AF1A 3PIPL 3TSQA 4DR5K 2O8FA 1TL1A 5LJWA 1LW0A 3HL8A 4BR4A 3WNGA 4B1XB 4JKCA 4YNQA 4LC9B 2HNZA 4FWMA 3VQBA 4OPHA 4M3YA 1O1WA 3OW2M 4YDUC 3NBPA 3ZETB 4IKFA 1CZAN 3T69A 5C0YA 1G15A 4H0OA 3HRGA 3PIOL 3OJSA 4A59A 3O1BA 1VQ6N 2J4RA 4B9TA 4O44A 1SV5A 1DKGD 1S6QA 1UOCA 2JLEA 4BC2A 2A1SA 2XHBA 4I9QA 1EETA 1WBBA 1W97L 1Y64A 3MN6A 4M7XA 5JVHL 3U9ZA 4DTSA 2GX9A 1VQ8N 1S3XA 1IBMK 1C0FA 4HUEA 3LP0A 4JK7A 4KRFA 3F2KA 4FLZA 4F2SA 5C24A 3DLRA 4H0YB 4DQSA 2YHBA 1OH7A 4FW1A 3CCQN 3ZEUB 1FW6A 3JXUA 2ITMA 4JKDA 1BHLA 4CBWA 1NK8A 1JCEA 3AA3A 2QKBA 5AZIB 4M3ZA 4M3WA 2I5JA 2GEMA 3CJ7A 4BQLA 3CPWM 4CE9A 3QEVA 1T7PA 1YXQA 4BE1A 3NDKA 2Q3SA 2QWMA 5KQ8A 4AH9A 4MQ3A 1BGXT 3OS0A 2IC3A 1KVBA 2VQFK 1UA1A 4FJMA 3C7NA 2V7ZA 3QB0A 1S22A 3TR8A 4B9SA 4DR7K 4JD2B 3ZSXA 3IMXA 3CFRA 3CIPA 3WXJA 4FZYA 5GAEP 4BRGA 4DF8A 3PO4A 2Q97A 3O3GA 2IOCA 1J6ZA 4Z0UA 4Z4HA 4NXNK 4CERA 5HROA 5HRNA 3ZX2A 4YOWA 3K5NA 3V4IA 4IG3A 4ISGA 4A5BA 2G8FA 3CCMN 4DR4K 3O4NA 3MXMA 3H3NO 4K42A 4RW6A 4BR9A 4EP4A 3OVNA 2E2NA 3WNEA 3NGIA 2O8DA 2X78A 3WT0A 3ZSVA 1NGAA 3QBWA 4N47A 4KBOA 4CK1A 1WAFA 4MFBA 2VWBA 1YJ9N 4PKGA 2G8UA 4FJNA 2Q0UA 4W5NA 2ZJRL 4CD1A 4X64K 3HO1A 1A5VA 1QQNA 4DU3A 4CECA 1HQEA 3TAGA 3DAWA 3VQ8A 3M8PA 2XY7A 4FOIA 1RT4A 3CC2N 4F2RA 3V9WA 1E4FT 4CGHA 1IKVA 3IAYA 3LPTA 3QMLA 5HRPA 3CQ8A 1QQMA 1YIJN 4BDZA 4Z4FA 4GV6A 4WF9L 2GBZA 4QCLA 2QKKA 3KLEA 4IJAA 4RW8A 1TYQA 4WQ5A 1HNVA 1S6PA 3R1XA 3KLGA 4NYNA 3IS9A 3QIPA 2FSJA 5LY3A 3SV3A 1XC9A 3L0QA 4WCEL 5LMNK 4B1ZA 2P9PB 3Q7BA 3AVNA 3CQXA 1Q82O 1NGFA 3NGZA 3RR7A 1XWLA 3DWLA 1U45A 5ADXH 4CEDA 3ZX0A 5FRMA 4BC5A 3CCJN 3SLCA 3HTVA 3ZSWA 3DOLA 3O4QA 2V52B 3ATUA 3UKRA 3THXA 3QEIA 3U9DA 4FWLA 3ASMA 1QS4A 2QXLA 1J5OA 3FR0A 4F3TA 3MN7A 4BRFA 4BR0A 3T1YK 3KKRA 4ELTA 2P9NB 2YKMA 4CJPA 2DFFA 3H6EA 4UY8O 4CZHA 4C8OA 3L2QA 4CJKA 2HHVA 3OYIA 3VTIA 4U67L 4B1YB 1T6DA 5FRNA 1N34K 2F96A 1L3VA 2O8BA 2F8TA 4CFBA 1SUQA 3KTQA 5J1EA 5HOOA 4FK4A 4PHTX 1YTUA 2HVIA 3ALYA 4GY2B 1TL3A 4EZ6A 3DI6A 2AA4A 2W40A 4IOAL 2CH5A 1TK8A 3CJ9A 1H1VA 2D4WA 3G25A 3OYMA 5BN8A 1E4GT 3U8XA 1TUYA 3NH1A 2DY4A 1JLFA 2FBXA 4WE1A 4BRMA 1OH5A 3KKSA 4DR3K 2QW9A 4BY9C 4DU4A 2KTQA 4NB4A 4RTFD 2GV9A 4FPAA 4LY7A 3KHYA 1JCGA 1G99A 2KFZA 3PLAA 4B1WB 1IO2A 4FL9A 3O8MA 3VQCA 2EWSA 1IKWA 5BRDA 1VSHA 1QHAA 3IFRA 4FPBA 3LDQA 4PA1A 2WOMA 3V1QA 1X3MA 3O9TA 4IFYA 5CYMA 5FPDA 5AQVA 3OYFA 3DLBA 5C12A 4RWTA 3L2UA 4QAGA 4CBUA 2UXBK 3VQ4A 1MWMA 3IRXA 3I8DA 3F5TA 1VRUA 4CW7B 1JLEA 2UUBK 3C95A 1BDGA 4DQQA 1ZXOA 3ZT1A 2UXDK 1K8KA 4Z4IA 3O9SA 3GE1A 1JLCA 4PQUA 4AHUA 2E1YA 1D4XA 2LSNA 3UIQA 1E3MA 3HOSA 1VSEA 3CFOA 3ZSRA 4CZFA 1WNSA 3IG1A 4H8KA 1S5JA 4JI7K 2NRVA 3K2PA 1K6YA 3VF4A 5DM7L 2ZF5O 5C42A 1NNEA 1IH7A 3KD1E 3V1OA 4CEZA 1N8RO 1LWEA 3SPZA 4BG9A 4B3SK 4CJLA 2YNIA 4DG1A 3DYAA 5SWMA 3UKUB 1N6QA 2VG6A 3QIOA 4BC3A 1S72N 4OGCA 3W3DA 1RDWX 3RSEB 2ASOA 3CCLN 2OPSA 3CCSN 1WSIA 4A2AA 2GUIA 1KCFA 3G6EN 1A5WA 4XH4A 1ZC6A 3KZBA 4JK9A 4DQIA 3CQYA 3HXMA 1JLBA 2D1KA 4DFMA 4KHPK 2Q2RA 4EZ9A 5B8HA 3GBTA 4CEEA 4KPYA 2A5XA 2F9WA 2IVNA 3VQ9A 4R79A 3LAKA 3OS2A 1LCUA 1RILA 2HHSA 4LF8K 4BR7A 3C6TA 4FVUA 1N5YA 1N33K 3HPHA 1BIZA 3OYEA 2BANA 4JS5A 4B9LA 2HHWA 4M42A 2QTDA 3ISNC 3AVFA 3MAQA 2DFHA 2BTFA 5HP1A 4K43A 5EX5A 1M1KO 3TANA 3DLHA 3KIOA 4KI6A 3ENHA 3E9LA 4KHWA 3SK3A 4JN4A 3P4IA 3WQTA 1SQKA 1NKCA 3SQ2A 1VQLN 4WQ4A 3TAMA 2G8IA 2OPRA 3MCPA 1OVYA 5AFUH 4DTOA 4C8KA 3MEGA 3P31A 5BREA 4M3UA 5JICA 1R59O 3FFKB 2Z1IA 2B5JA 4CJVA 4AHCA 1EP4A 1MU2A 3PSIA 3SJJA 1EO1A 2YNGA 4JEPA 4E1NA 3A2FA 1SL2A 1NJIO 3L2VA 5TKWA 4HWIA 2P5OA 2DTUA 1IG8A 3CPEA 2BGGA 1DLOA 3TAQA 4KKOA 3TI0A 2W6LA 4H5RA 2A41A 3SBGA 1ESVA 4E7JA 4K8XA 1X1PA 1NKBA 4CHOA 2NRHA 3L2RA 1ITGA 4ID5A 4YOVA 3ZEUA 3NE6A 4CK3A 5HRSA 4CZLA 3A5NC 3B8AX 2A42A 4GKJK 5I42A 3CI5A 5M1OA 3CJCA 4AQYK 4HTUA 2UU9K 5M1PA 3NF6A 4CJQA 4JRPA 2ATQA 3OS1A 1NMNA 3LM2A 2HBMA 2KZZA 2RPIA 5AQGA 2QXFA 1ATNA 1EWQA 1Q8IA 3KK7A 4JV5K 4FLTA 1GLCG 4BGAA 4PL7A 4E3SA 2NRRA 3CC7N 4YOUA 3HPOA 2VG5A 4JKGB 4C23A 1HNIA 4DV6K 3CC4N 4JD2A 4Q5VA 2GUPA 1QTMA 2QWQA 3DRSA 2A1RA 4CJ7A 3BGRA 4Z4CA 2HMPA 4YDUA 1BWFO 1RBSA 4XEIA 4M7YA 1NK6A 1HQUA 3FZMA 3AAPA 5AQJA 4CGIA 4I2QA 4OKJA 3I33A 3PX0A 2QWNA 3S3OA 3PY8A 2BE2A 3VTHA 3SQ0A 1ZBIA 1RFQA 3DMJA 4DTMA 1VSIA 3D45A 4BR2A 4HHTA 4FM2A 1HYZA 4C8NA 5IWAK 3JYTA 2ZQBA 3J7AP 1D8YA 4DCHA 4FM1A 3ZLJA 4CHNA 3D2EB 4DQRA 1HJRA 4CJEA 5M1KA 2G8HA 4CF1A 4AM6A 2NRTA 4M45A 4KFBA 4H0XB 2ZJQL 4KHQA 1TKXA 4JI3K 1XQSC 4IXCA 3OYCA 1QSLA 4IEIA 4IG0A 1BA0A 1VQ7N 3CFPA 2YHWA 5AQHA 4MDBA 4FLXA 3LZJA 4IDHA 3DRPA 3AY9A 3B6PA 2AJQA 3SUPA 3MDQA 4FZXC 2YHYA 2P9LB 3EE9A 5FROA 1DTTA 2ZGYA 3MX2A 3SPYA 4FWSA 4O4GA 3VQ6A 3QINA 4DTXA 1WB9A 4CHYA 3TSUA 3ID8A 4DV0K 1IKXA 4NCBA 4BREA 1RDDA 4DHYA 3ZCMA 1BO5O 3PSFA 3HP9A 4JKAA 2V7YA 3M8QA 3FZFA 4DU1A 1BCMA 1T3VA 3VGMA 3WXMB 4FJHA 4H0VB 5E41A 5E84A 4BRIA 3NMUA 4CVNE 4WFBL 2OCEA 4IJNA 1ASVA 4YOXA 1S9GA 3U3YA 5M1NA 3SCXA 4FCYA 1BOTO 4ZTFA 1GLLO 1L3UA 4L8RB 4LF9K 5JMVA 4BE0A 2YHAA 2ZE2A 3I0SA 3M1FA 1VQ5N 1RT2A 1XHXA 1GLFO 2P9PA 5AQNA 5AQXA 1J5EK 3SUOA 4F9OA 1C0MA 2F9TA 3J81O 2P51A 3QFPA 4Q0BA 4WFNL 4BVOA 4ZHRA 5AQZA 5HLFA 1R0AA 1I39A 2WFBA 3I55N 4CGJA 2ZGZA 1TV6A 5C10A 5GAGP 4CJWA 1BG3A 1HX1A 4FK2A 3TAPA 4FJ9A 3R8EA 2HMIA 4E7LA 4BROA 3RRHA 3T7ZA 4NYFA 2P9NA 2QM1A 1HRHA 3PX6A 5AQIA 3CERA 4F4KA 4BRAA 4CZIA 1CZBA 3CCUN 2UXCK 2E4LA 5KPTA 2P9IB 4JI8K 5LL6Z 1YVUA 2YJFA 1T03A 2D0PA 5HL7L 3J7YP 2KHOA 4BRCA 3MWTA 4FWPA 1BQNA 2E1ZA 2NZTA 4KV8A 5KPRA 1VQKN 4DS4A 1WN7A 3NH0A 4B8CA 2E2QA 4HUGA 4N76A 4GKKK 1U2VB 3OHRA 1X9SA 2X74A 2KZMA 4A57A 2W6KA 2JGUA 1I3AA 3LAMA 3QFUA 2QEXN 1NK4A 4I6MB 4ELUA 2NRXA 4Z4EA 3VQ5A 4XIUA 4O0IA 3ZT4A 1ASWA 1VHXA 4B9QA 1VSMA 1T44A 4I7FA 2VGNA 4DV5K 2P9SB 2XRIA 2PFUA 4LH5A 3A5MC 1X3NA 4B8AB 1IJJA 4DTUA 4IOCL 1NOZA 3L8BA 1HUXA 4B3RK 4M63C 3AVHA 1NGBA 3O9UA 3TWHA 2IVPA 4CZKA 1RT6A 4HTLA 3B6OA 2FF3B 3VGKA 3TTFA 1FKPA 4R5PA 2RN2A 5AQWA 4DF4A 4JS4A 4DTPA 4MLEA 2IGIA 4K41A 4CJTA 2YX6A 1J9AA 3S9HA 1CLQA 1OKJA 1NGHA 3FGUA 1YI2N 4JKFA 3QEPA 1B9DA 3AO2A 5FPNA 3AVKA 2EHGA 1EQYA 2YHXA 4CBXA 4DMNA 4M3RA 3VMFB 2HVHA 3C6HA 4PL8A 2FF6A 5AFUA 3MCAB 3I56N 4FLYA 2IS3A 2HNYA 4CI6A 2CGLA 3AVJA 1NK0A 3UKUA 4J2BA 4B1VA 3ZSZA 3WXLA 4FYDA 2HF4A 3MWPA 4MO4A 3RSEA 3VOVA 1V4TA 3QO9A 4H4MA 1Y97A 3LWLA 3H1QA 1S1VA 4DSJA 3K5OA 3HSTB 4OJRA 2O4IA 3OYBA 1BA1A 1EKEA 2E2OA 3L4IA 2F4VK 1W9HA 4F3OA 4OPAA 4JAXA 2HBKA 1QVGM 1FKOA 3V9ZA 3FFIA 4E1MA 4FJXA 5KRSA 4B9VA 2X6SA 4W5RA 3P1GA 4HCCA 4YFUA 4FWOA 1EWRA 1L3TA 4KTQA 1UAXA 1W0HA 2G8KA 4OGEA 1WSEA 4XH5A 5CR4A 4LF6K 2YNHA 4OX9K 4LFCK 3TABA 3AVMA 1GOCA 5KGXA 3O3FA 1U04A 3RMBA 4FVMA 3AO5A 1QZ6A 4JI2K 1GLJO 3MXIA 3PX4A 2V51B 1JLQA 4CEQA 4CZJA 1NJXA 1NG9A 4RW7A 3O6WA 4EAHD 4KI4A 3WXKA 1WSFA 4CGFA 1TKDA 1ZBFA 4JHDB 1IG9A 5IT9O 4EIAA 1QE1A 3BP8A 3OY9A 2IIRA 4JI6K 3VEOA 2Q1NA 2X6NA 4N5SA 3K9JA 4OO1J 1ZYQA 4DTRA 1SKRA 3NFAA 2FC0A 4KB1A 1BUPA 3D2FB 2W42A 1MA9B 2O8EB 5BPLA 3LP1A 5AQYA 2NRZA 4OVLA 3OYLA 2GELA 3K5LA 3CMEN 3SUNA 4KHSA 3QNOA 4DSFA 4PKHA 3RMAA 1FJGK 3R9PA 4G9ZA 4O8KA 1BCOA 3LDNA 1RNHA 3VENA 5D3GA 3ATVA 5CY4A 2HHXA 3EY1A 1ZBSA 5CZ2A 2OZMA 3CETA 4DV1K 3MEDA 2P9UB 1JJ2M 4NLCA 3G4SN 1Q86O 1J53A 1WLJA 3L6QA 3EL2A 1YITN 1SKSA 1NK5A 4CJ4A 3C94A 1VQMN 3J80O 1RTDA 3ULEB 4CJ3A 5JLFA 3H46O 4DUYK 1BI4B 5E26A 4IFEA 4DWIA 1B9FA 4J2EA 2O8DB 2NNWA 1JLGA 2P9KB 5EVZA 1RT3A 1NKEA 5BRHA 3FZKA 2OPQA 4WFAL 4JRQA 1Q7YO 2OTJN 3H45C 3LDOA 1F21A 2HB5A 3K9KA 3LL3A 5I9EB 2WONA 3L4QA 2A6AA 4RCHA 4KH6A 3T1AA 3ENBA 4IDKA 1C6VA 4DLGA 1HLUA 5FPMA 3VQPA 4BR5A 1LWFA 1ZBHA 1IBKK 4BC4A 4JKGA 5M1FA 2D5RA 3OYJA 3SQ4A 4MDAA 1GLAG 4KHYA 5AQOA 2VCPA 3SQ1A 3BUZB 4FJ5A 4DKWA 1SAZA 1YJWN 1X9WA 5BN9A 3BY5A 4FWKA 2W41A 3AGKA 4MLHA 1RDAA 4O55A 4EHTA 4O8UA 3G10A 3TARA 4NO7A 4NCGA 2F7TA 3O4WA 1U48A 4H0TB 4KH4A 3P5JA 4DV2K 4MO5A 1NMDA 3GOIA 3HM8A 5AQMA 1KSPA 3D2EA 3FE1A 1OVQA 4CK2A 2UYTA 4FJ8A 4J2AA 4O5BA 4B9NA 4CF0A 2FXUA 1RDUA 2QI2A 2RKIA 5AQKA 3LDLA 4CESA 4CD3A 5MLCQ 4GV3A 4LFAK 3OYDA 1BIUA 1RDBA 1Z05A 2ASMA 5EOYA 5F2RA 5BR9A 1TK5A 4H0PA 3VA0A 4OPKA 2P9LA 3SI6A 3VQQA 1V4SA 4LF4K 3VEVA 3A8YA 3TAFA 1VK0A 1TK0A 1T8EA 1P8ZA 3FZLA 4EFHA 4BRDA 2HNDA 1YVNA 3CXCM 4CJ5A 3L3UA 3ZETA 4IBNA 4BVPA 4PUOA 5M1QA 4CJRA 3KD5E 5J2NA 1HKBA 4FK0A 5AZJB 2A40A 2HBJA 1GOAA 4IWVA 5KRTA 4LSNA 3VERA 4FLVA 4DFJA 1N36K 2HSTA 3AGRA 3OA9A 4DSLA 3KK1A 3U6FA 3HPGA 5AQUA 3SNNA 1S9EA 3E9PA 4PY5A 3J8AA 1KQSM 3AARA 1L5UA 1YF5L 1VQON 5KPZA 4JNEA 3ULDA 4KAZA 2ETJA 4CCHA 2DPNA 2YNFA 3NGYA 5HRRA 3H3OB 4QS8A 3THVA 1SL1A 3LP3A 3O9RA 4W5QA 2BUPA 4FJLA 4Z4GA 1CXUA 3QDKA 3T19A 2PYJA 3RWUA 3A5LC 3AA4A 3D6RA 3H1VX 5AQLA 3KJVA 1WBDA 2QWRA 3EZ5A 4Y1CA 3S41A 4M41A 2I7PA 1KTQA 4YOYA 1RBVA 4BRLA 5AZIA 4A2BA 2CGKA 2GWJA 3SAHA 3TAEA 1UA0A 3O80A 4FWRA 1BU6O 2P9IA 3HSCA 1DGKN 1HYVA 3QNNA 4CZEA 4DUZK 1KLNA 5J2MA 2Y1IA 1NGIA 5C15A 4RW9A 3NVKA 2OTLN 1NBWA 2FLOA 2DFEA 1VSKA 2XY5A 1VSDA 2JWKA 2EX3A 5EXWA 4EHUA 4DFPA 3EEQA 2JWLA 3CG7A 4CJSA 3DLEA 1U2VA 1VRTA 1TGOA 3NCIA 2E8AA 1WSJA 1JXEA 1BQMA 2IVOA 2HW3A 4JK8A 5CE3A 4OKEA 3V1RA 2FSNA 4IZ9A 1C1BA 2FBVA 1ATRA 4I6MA 4NLBA 3DXMB 2ZD1A 1HPMA 2PAVA 2QWOA 3THWB 1L3SA 2ITGA 1QQCA 2P9SA 1KFSA 1RTIA 4OKKA 4DTJA 4KHNA 3A0IX 4GVMA 5ADXA 1U47A 2PZSA 1KLMA 3K58A 1S1TA 3CJAA 2RF2A 3E01A 4BWMA 3UE5A 3M8RA 4CHQA 4O5FA 1W7AA 5AQQA 4UQGA 3KK3A 3BZCA 3KVGA 4CEAA 1SS6A 4JKHA 3KWIA 3O3HA 3CCEN 4B3MK 3BF1A 3NF7A 4BRPA 3OJUA 3AVBA 3D0PA 4FO0A 5EU7A 4BQZA 3DLKA 1S1XA 1Z25A 3LPUA 3LDPA 4CF2A 3CCVN 4M3TA 4X66K 1Q9YA 4B9UA 4YHHK 2ZM6K 1XC3A 5JVGL 3K0SA 2HOEA 3ID6A 3RR8A 3C6AA 1HKGA 3NAEA 1XUPO 4RW4A 4AHSA 3DXKB 5BPNA 5F1XA 3EYZA 3ZYYX 4EP5A 4DR6K 3PV8A 3CYMA 5HBMA 4CZGA 5FLXO 3HVRA 2G8VA 1VQ9N 1WAJA 3T1HK 3C6UA 3L3VA 3ZSOA 3WNFA 1GLBG 1EX4A 5EY4A 4HCBA 3SYZA 5C2DA 4DR1K 4BRHA 3P38A 4H5VA 2RHKA 3CCRN 2HHTA 4BRQA 3D7EO 4AHVA 5TKYA 4OLAA 1RBTA 3NVMA 3WXIA 2NLXA 1HNWK 4H4OA 2Y1JA 5JS1A 1HJOA 4CIEA 3RMDA 3THYB 1WOQA 5BR8K 3VF6A 2YJEA 3VPZA 2O4GA 1LV5A 5GIOA 3QICA 3HI0A 4H5NA 3BDPA 1NK7A 1N32K 2ASPA 1K9MO 1U49A 4IEEA 2OANA 3DJCA 2AP1A 4IFVA 1RCHA 1NWKA 2VWKA 4A61A 4JI1K 4GNIA 1U6ZA 4TSXA 1I94K 3OBYA 4FJJA 4G1QA 4QOZB 5A2QO 1C1CA 4JHDA 1Q81O 3RTVA 3CM6A 1NJYA 2YI1A 1LAWA 2E6LA 4ISFA 3VEYA 4W5OA 3O1WA 3O5BA 1OH6A 1LAVA 2FBYA 4A5AA 2O8CB 1MWKA 4CIFA 2XO7A 1T6CA 4YOTA 3U3GA 3J7ZO 3DLLL 2Z1HA 1VQNN 2Q0RA 2VGMA 1J54A 3D2FA 4DS5A 3WUHA 1RDCA 4W5TA 2O8EA 1KXPA 1KAZA 4E1JA 3Q7CA 4BRNA 2VWJA 1W2BM 3ZX3A 2VYPA 2QWPA 3AAQA 4QS9A 2BDPA 3NHGA 3LWMA 1ZBUA 3VEXA 2GTDA 4IO8A 2FBTA 5GAHP 4CGGA 1SZ2A 3K57A 3OBWA 4FLUA 4H5TA 3AA5X 4JI5K 4NCAA 2P9UA 4B3OA 2HHHK 4DR2K 3FZHA 3OTOK 4CF8A 2KKZA 1NGEA 1KD1O 3V6DA 1VAZA 4Y1DA 3E1YA 3V9XA 3ULEA 3SMSA 3VF2A 4K25A 1DT9A 1BI4A 1WUAA 3OYGA 1BL3A 1WSHA 2KFNA 1K8AO 1QQOA 3VQEA 4BACA 3P39A 1HMVA 4CF9A 2P9KA 1XMQK 1HNZK 1DEJA 2E20A 5K14A 4GW6A 1A5XA 2CH6A 2G8WA 2A3ZA 3MXJA 3T3FA 3ZT2A 3WEEB 1UWBA 4M3XA 4BDPA 2O8FB 2PYLA 2PBDA 1NJWA 2KLAA 3F9KA 3HOTA 4LFBK 5KTQA 3AO1A 2Z1GA 1KC8O 3CJ1A 4AILC 3S3NA 3M6GA 2OPPA 4YORA 4X62K 1Q9XA 3L2WA 1RBRA 1P90A 1GLDG 3E66A 1KFDA 2HHQA 2E2PA 1HR0K 1NOYA 3VETA 1DTQA 4E89A 3MMVA 3GL1A 3HYFA 1FXXA 1NGDA 4N41A 2YKNA 1CXQA 3LP2A 3ZSYA 1ASUA 4JLHA 4C8MA 4B3TK 1YT3A 1VQPN 2KQ2A 1Q18A 2D0BA 3FLCO 3EZWA 3F73A 4CFAA 5GINA 1XNQK 3QESA 4E7KA 4CEBA 4RG8A 1EXQA 4BG8A 3CJBA 4CZMA 3I0RA 2KW4A 2F8SA 3IUCA 1ILYA 1LWCA 5KGWA 3EE8A 1YTAA 4GMJB 4E7IA 1C0TA 4F8RA 5KQDA 3E9OA 3U4LA 3VQ7A 3F9MA 3V9SA 3G0ZA 3GDQA 2WBNA 3KWGA 3KLIA 3O9QA 4CEFA 5GIPA 2H3GX 4DV3K 3CHWA 1KVAA 2IAJA 3O08A 2HHUA 4L3QA 4DV4K 3N4QA 1S1UA 4E0DA 1LOTB 1Z6RA 3TPQA 3DOKA 5DMRA 4BRKA 1IKYA 4FW2A 3TSPA 2HBLA 4JYAK 1KAYA 3S3MA 5AQTA 1REVA 3WQUA 3M3ZA 2VQEK 2UUCK 1GLEG 3WNHA 2QWLA 1D9DA 3AA2A 5AZJA 2NUBA 2RE2A 4NXMK 4ZTJA 3SAGA 4WQ5C 2R7YA 3RMCA 4XH1A 3C7NB 3LDSA 1JXBA 2GWKA 3SZ2A 2WTUA 5LMUK 4ICLA 4FM0A 3I8BA 2WC9A 4I2PA 3M8SA 5FDLA 3LZIA 3AVGA 1NU0A 4KH5A 1KAXA 4K0KK 3ZT0A 3AVIA 1XNRK 1RTHA 4B1UB 3LALA 3TTDA 1U4BA 1T05A 1KVCA 2QA4N 5AR0A 3MECA 1NGJA 2FSKA 3LM9A 1D5AA 3AV9A 3TU5A 4DSEA 1JKHA 5F0XA 3SMPA 3EKSA 4LSLA 2YV0X 3NF8A 4FWNA 5GADP 2I7NA 5I3UA 3JS6A 4CFDA 4KHUA 1C0GA 3K5MA 1NJZA 1RBUA 4ILHA 1QZ5A 4CIGA 5C25A 4LF7K 5T7BA 2ZWHA 3ZT3A 3LANA 4QS7A 4E7HA 1C0UA 1RT7A 3OYHA 3R6MA 2D0AA 1HYSA 3HT3A 2P5GA 4BWJA 3N4PA 5DK5A 3VGLA 2B4JA 4FJKA 3V9UA 3OYNA 1TKZA 2VG7A 3VQAA 3KLFA 5C2FA 5SZTA 4DQPA 4H5WA 1D9FA 3AVAA 1NGCA 4CHZA 1NGGA 3R3LA 4AM7A 1X9MA 1YHQN 4DB3A 4O0JA 4H03B 3AO3A 3AVLA 1BISA 1C1AA 1RTJA 5AQFA 1TUUA 3BF3A 5CHIA 1TYQB 3KLHA 3VA3A 3DXMA 4FJ7A 3THWA 3C65A 4J2DA 4HVJA 5CYQA 3IDHA 2HF3A 4ELVA 1NK9A 1YAGA 3EO3A 4DV7K 5AQRA 5CZ1A 3BEXA 4DFKA 4A62A 2XY8A 3ENOA 4I9LA 3OYAA 4B08A 5AJ3K 4FWQA 4CGDA 3THXB 3UKRB 1VQ4N 2D0OA 5KI6A 4JKEA 3UB5A 4KREA 5ELZA 4OPJA 1TKTA 1GOBA 4BE2A 3DM2A 1WSGA 3MK6A 1RT5A 2UUAK 3VESA 1OH8A 3CF5L 3NH2A 2E88A 4KTZA 2ZJPL 4YY3K 2OZSA 4KTWA 3AO4A 4V19S 4CHPA 5JLHA 3G71N 3GG4A 5DM6L 1KRPA 1QSYA 4ISEA 1JCFA 2OA8A 1Z26A 3DLGA 2O8BB 1JL1A 3DXKA 3OYKA 1YJNN 3V81A 3VEZA 2YCHA 4JKBA 3C0BA 1FK9A 3P83D 1TVRA 3ZSQA 1S1WA 3HM9A 4C8LA 1CZ9A 3RVCA 1VSLA 4Z94A 1ZBLA 2WUSA 3SBTA
chains in the Genus database with same CATH topology
1VSFA 1IO2A 3TWHA 1RT6A 3SV4A 4KB0A 3VQCA 1IKWA 3QEXA 1VSHA 3RR8A 3B6OA 1FKPA 3NAEA 4FJIA 1QSSA 4RW4A 4FXDA 4R5PA 4AHSA 4PA1A 2WOMA 3V1QA 2RN2A 4IFYA 5CYMA 4DF4A 4JS4A 3OYFA 3MEEA 3DLBA 5JS2A 4DTPA 3L2UA 4EP5A 3EYZA 4BDYA 4QAGA 3PV8A 2IGIA 3CYMA 2P1JA 5HBMA 2IDOA 1XI1A 4DSKA 3VN5A 3VQ4A 3HVRA 4CJTA 2G8VA 1J9AA 3S9HA 3KD1E 2XY6A 3IRXA 1WAJA 3C6UA 3I8DA 3QERA 3L3VA 3ZSOA 1CLQA 3WNFA 1VRUA 1EX4A 4HCBA 1JLEA 3SYZA 3QEPA 3C95A 1B9DA 4DSIA 1LW2A 3AO2A 4PWDA 3QEWA 3AVKA 1TAUA 2EHGA 4DLEA 2HHTA 4DQQA 1VSJA 5J2PA 3ZT1A 4DMNA 4M3RA 3HK2A 4Z4IA 4AHVA 2HVHA 4OLAA 1RBTA 3SUQA 1JLCA 4PQUA 1JLAA 1NJXA 4H4OA 4AHUA 2Y1JA 5JS1A 2LSNA 4FLYA 3NF9A 3UIQA 2IS3A 3ITHA 1VSEA 2HNYA 4AHTA 4CIEA 4FZZA 3CFOA 3RMDA 3ZSRA 4CJUA 3PO5A 1HYSA 3AVJA 1WNSA 1NK0A 4J2BA 3IG1A 3ZSZA 4H8KA 2O4GA 1LV5A 1S5JA 4FYDA 4FLWA 1XHZA 3RMBA 3K2PA 1K6YA 3QO9A 4H4MA 1Y97A 3LWLA 1S1VA 5C42A 3BDPA 1NK7A 1IH7A 4DSJA 3K5OA 3HSTB 4OJRA 1U49A 3V1OA 4CEZA 3OYBA 1LWEA 5J2QA 1EKEA 3SPZA 2O4IA 1W9HA 4F3OA 1JL2A 4IFVA 4CJLA 1RCHA 1FKOA 2VWKA 2YNIA 4TSXA 4DG1A 3V9ZA 3DYAA 3FFIA 5SWMA 4E1MA 4FJJA 4FJXA 5KRSA 1N6QA 4B9VA 2X6SA 2VG6A 3QIOA 4W5RA 4G1QA 4CEOA 3P1GA 4HCCA 4QOZB 4OGCA 4YFUA 1C1CA 1L3TA 3RTVA 4KTQA 1QHTA 1UAXA 3CM6A 1W0HA 1NJYA 2OPSA 2Z1JA 1WSEA 4OGEA 2G8KA 1WSIA 2E6MA 2GUIA 1KCFA 1LAWA 2E6LA 2YNHA 3TABA 1A5WA 3AVMA 4W5OA 4DQIA 1GOCA 4LD0A 2B6AA 1U04A 3PUFA 5KGXA 3O3FA 1JLBA 3AO5A 4FVMA 1LAVA 3HXMA 4HUFA 3MXIA 2OYQA 3PX4A 4DFMA 4B9MA 1JLQA 4CEQA 2FBYA 4EZ9A 4ID1A 4CEEA 3HP6A 1HPZA 4RW7A 4LH4A 4CIFA 3VQ9A 3KK2A 3DRRA 2XO7A 3LAKA 3OS2A 4DTNA 2PY5A 3HVTA 1RILA 4KI4A 3CM5A 1WSFA 2D0CA 3U3GA 4CGFA 4CJFA 1ZBFA 1TKDA 2Z1HA 1IG9A 2HHSA 1RT1A 3C6TA 1TAQA 1J54A 4DS5A 3QETA 1RDCA 1N5YA 3HPHA 3JSMA 1BIZA 4W5TA 3OYEA 2BANA 4JS5A 4B9LA 1SL0A 2HHWA 3K59A 1QE1A 4M42A 4OLBA 3ISNC 2VWJA 3OY9A 3AVFA 3MAQA 2DFHA 2X6NA 2BDPA 4N5SA 5HP1A 3NHGA 3LWMA 1ZBUA 3QLHA 1ZYQA 1B92A 3VQDA 4DTRA 4FJGA 4CFCA 3TANA 3NFAA 2FC0A 1SKRA 4KB1A 2FBTA 3DLHA 3H08A 4CGGA 3KIOA 4KI6A 3RRGA 3K57A 2W42A 4FLUA 4KHWA 3AA5X 4AHRA 4K8ZA 2QK9A 4E19A 4KO0A 4NCAA 4B3OA 1SKWA 1NKCA 3SQ2A 3LP1A 3TAMA 2OPRA 4CF8A 2G8IA 3AVCA 4DTOA 4N56A 4OVLA 3OYLA 3V6DA 4C8KA 3HJFA 3MEGA 3K5LA 4Y1DA 3V9XA 1TL1A 3SUNA 4KHSA 1LW0A 4M3UA 3QNOA 4DSFA 3RMAA 3HL8A 3WNGA 1BI4A 2Z1IA 1BL3A 1WSHA 3OYGA 2KFNA 1BCOA 2B5JA 4CJVA 1RNHA 5D3GA 3VQEA 4AHCA 1EP4A 1MU2A 4YNQA 5CY4A 4BACA 3SJJA 3EY1A 2YNGA 2HHXA 1HMVA 5CZ2A 4CF9A 2OZMA 2HNZA 4E1NA 3MEDA 5K14A 3A2FA 4GW6A 1A5XA 3VQBA 1SL2A 3MXJA 3L2VA 3T3FA 2G8WA 1J53A 1WLJA 4M3YA 1O1WA 3ZT2A 3NBPA 1UWBA 2P5OA 4IKFA 4M3XA 1SKSA 1NK5A 2DTUA 4BDPA 4CJ4A 3C94A 2BGGA 2PYLA 1DLOA 1G15A 3TAQA 1NJWA 3OJSA 1RTDA 4KKOA 3TI0A 3F9KA 4CJ3A 1BI4B 5KTQA 3AO1A 4E7JA 4B9TA 4DWIA 2Z1GA 4K8XA 4O44A 1SV5A 1B9FA 4J2EA 1X1PA 1NKBA 1JLGA 1S6QA 4AILC 3S3NA 1UOCA 2OPPA 2JLEA 4CHOA 2A1SA 3L2RA 1ITGA 1RT3A 4ID5A 2XHBA 4I9QA 1EETA 1NKEA 1Q9XA 3L2WA 1RBRA 2OPQA 4JRQA 1KFDA 1F21A 2HHQA 1NOYA 1DTQA 4E89A 2HB5A 3NE6A 4CK3A 3HYFA 4DTSA 1FXXA 2WONA 4N41A 5HRSA 2YKNA 1CXQA 3T1AA 4IDKA 3LP2A 1C6VA 3ZSYA 4HUEA 4DLGA 1ASUA 3LP0A 3VQPA 4KRFA 4JLHA 4C8MA 5I42A 1YT3A 1LWFA 4FLZA 1ZBHA 2KQ2A 4HTUA 4F2SA 3NF6A 2D0BA 5C24A 2D5RA 3DLRA 4CJQA 3F73A 3OYJA 4CFAA 4JRPA 4DQSA 2YHBA 2ATQA 3SQ4A 3OS1A 3QESA 4E7KA 4FW1A 4CEBA 4KHYA 2KZZA 2RPIA 4RG8A 3SQ1A 2QXFA 4FJ5A 1EXQA 1Q8IA 3I0RA 4FLTA 1X9WA 2KW4A 1BHLA 1NK8A 2F8SA 4E3SA 1LWCA 5KGWA 3AA3A 2QKBA 1RDAA 4O55A 1YTAA 4M3ZA 4GMJB 4M3WA 3G10A 3HPOA 4E7IA 1C0TA 2I5JA 2VG5A 3TARA 4F8RA 3VQ7A 1HNIA 4NCGA 3V9SA 4CE9A 4Q5VA 3G0ZA 1U48A 3QEVA 1QTMA 3KLIA 1T7PA 3DRSA 3P5JA 2Q3SA 4CEFA 3NDKA 4BE1A 2A1RA 3BGRA 4Z4CA 4AH9A 1KVAA 1KSPA 2IAJA 4MQ3A 2HHUA 4CK2A 1RBSA 1BGXT 4FJ8A 1S1UA 1NK6A 4J2AA 4E0DA 1HQUA 3OS0A 4O5BA 2IC3A 4B9NA 4CF0A 3DOKA 4CGIA 2RKIA 4I2QA 1KVBA 5DMRA 1UA1A 4FJMA 4OKJA 1IKYA 4CESA 3PX0A 4FW2A 3OYDA 1BIUA 3S3OA 3TR8A 3PY8A 2BE2A 4B9SA 3SQ0A 3S3MA 1ZBIA 1RDBA 3DMJA 3ZSXA 4DTMA 1VSIA 3D45A 3CFRA 1REVA 4HHTA 4FM2A 1HYZA 4C8NA 1TK5A 3JYTA 2ZQBA 3VA0A 4OPKA 3WNHA 4FZYA 1D8YA 4FM1A 3AA2A 3SI6A 1D9DA 3VQQA 2NUBA 4CHNA 4DQRA 1HJRA 4CJEA 4DF8A 4ZTJA 2G8HA 3TAFA 4CF1A 3PO4A 1VK0A 4M45A 4KFBA 1TK0A 3O3GA 4KHQA 2IOCA 4Z0UA 1TKXA 4Z4HA 2R7YA 3RMCA 4CERA 1T8EA 5HROA 5HRNA 3OYCA 1QSLA 3K5NA 4IG0A 3LDSA 2HNDA 1JXBA 3V4IA 3CFPA 4IG3A 3SZ2A 4CJ5A 3L3UA 3LZJA 4ICLA 4FLXA 2G8FA 4IBNA 3DRPA 4FM0A 3O4NA 4PUOA 3MXMA 4CJRA 4I2PA 3M8SA 3B6PA 2AJQA 4RW6A 5FDLA 3SUPA 3LZIA 3KD5E 3AVGA 4EP4A 5J2NA 4FZXC 5FROA 4FK0A 3OVNA 3WNEA 1DTTA 1GOAA 3NGIA 3SPYA 3VQ6A 4O4GA 3QINA 5KRTA 4DTXA 4LSNA 3ZT0A 3AVIA 4CHYA 4FLVA 1RTHA 1IKXA 4DFJA 4NCBA 1RDDA 2X78A 3LALA 3ZSVA 1U4BA 4N47A 4DSLA 3ZCMA 3KK1A 3U6FA 3HPGA 1T05A 4CK1A 1KVCA 3HP9A 1WAFA 4MFBA 3MECA 3SNNA 3M8QA 2G8UA 4FJNA 4DU1A 1S9EA 4KPYA 1BCMA 4PY5A 1D5AA 4W5NA 3AV9A 4FJHA 4DSEA 1JKHA 1L5UA 3HO1A 1A5VA 4DU3A 4CECA 5E41A 3ULDA 1HQEA 4KAZA 3TAGA 4LSLA 2YV0X 2ETJA 3NF8A 3VQ8A 4CCHA 2YNFA 3M8PA 2XY7A 5I3UA 3NGYA 5HRRA 1ASVA 1S9GA 4CFDA 1RT4A 3U3YA 3SCXA 4FCYA 3THVA 4ZTFA 1L3UA 4L8RB 4KHUA 1SL1A 3LP3A 4F2RA 3K5MA 4BE0A 2YHAA 4W5QA 3V9WA 1NJZA 1RBUA 2ZE2A 4FJLA 4Z4GA 4CGHA 1CXUA 3I0SA 3T19A 1IKVA 4CIGA 2PYJA 5C25A 1RT2A 1XHXA 3IAYA 3LPTA 3SUOA 3RWUA 5T7BA 3AA4A 5HRPA 3KJVA 3ZT3A 1C0MA 3CQ8A 3EZ5A 2P51A 4Y1CA 3LANA 4BDZA 4Z4FA 4Q0BA 4M41A 4E7HA 1C0UA 1RT7A 1KTQA 3OYHA 1RBVA 4ZHRA 2D0AA 2GBZA 5HLFA 3HT3A 1R0AA 4QCLA 2P5GA 2QKKA 4BWJA 3KLEA 5DK5A 3TAEA 1I39A 1UA0A 4RW8A 2B4JA 4FJKA 4CGJA 3OYNA 3V9UA 1TKZA 1HNVA 1TV6A 2VG7A 1S6PA 3VQAA 3KLGA 3KLFA 4NYNA 5SZTA 4DQPA 3IS9A 3QIPA 3SV3A 1XC9A 4CJWA 1D9FA 3AVAA 4FK2A 1HYVA 3QNNA 3TAPA 4CHZA 3AVNA 4FJ9A 1KLNA 2HMIA 4E7LA 5J2MA 3NGZA 3RRHA 4NYFA 2Y1IA 3RR7A 1XWLA 1HRHA 3PX6A 1X9MA 4RW9A 1U45A 4O0JA 4CEDA 3AO3A 3AVLA 5FRMA 4F4KA 2DFEA 1BISA 1C1AA 1RTJA 1VSKA 2XY5A 3ZSWA 3DOLA 1VSDA 2EX3A 3O4QA 1CZBA 3KLHA 3VA3A 4DFPA 3QEIA 4FJ7A 2E4LA 4J2DA 4HVJA 3ASMA 1QS4A 3CG7A 5CYQA 1YVUA 4CJSA 3DLEA 1J5OA 4F3TA 1VRTA 1T03A 1TGOA 3KKRA 4ELTA 4ELVA 1NK9A 3NCIA 1WSJA 2YKMA 1JXEA 5CZ1A 4CJPA 2DFFA 4DFKA 1BQMA 2XY8A 1BQNA 4I9LA 3OYAA 2HW3A 4OKEA 4KV8A 3V1RA 4B08A 1C1BA 2FBVA 4CGDA 4C8OA 4DS4A 3L2QA 1WN7A 4CJKA 2HHVA 3NH0A 2ZD1A 3OYIA 4B8CA 5KI6A 5FRNA 1L3SA 4KREA 4HUGA 4N76A 2F96A 2ITGA 1L3VA 4OPJA 1TKTA 1GOBA 4BE2A 1QQCA 3DM2A 2X74A 1WSGA 1X9SA 2F8TA 2KZMA 1RT5A 4CFBA 1SUQA 1KFSA 3KTQA 1RTIA 4OKKA 5J1EA 3NH2A 4DTJA 4KHNA 4GVMA 4KTZA 4FK4A 2OZSA 4KTWA 1YTUA 3AO4A 2HVIA 3ALYA 1TL3A 4CHPA 4EZ6A 1U47A 2PZSA 1KLMA 2JGUA 3DI6A 3K58A 1I3AA 3LAMA 4ELUA 1NK4A 1TK8A 1S1TA 1KRPA 1QSYA 4Z4EA 3VQ5A 2RF2A 3E01A 4BWMA 3M8RA 4XIUA 4CHQA 4O0IA 3OYMA 4B9UA 3ZT4A 1ASWA 4UQGA 4CEAA 1VSMA 1Z26A 3O3HA 3KK3A 3DLGA 2OA8A 3NH1A 3NF7A 4I7FA 2DY4A 3OJUA 1JL1A 1JLFA 2FBXA 3AVBA 3D0PA 3OYKA 2XRIA 4WE1A 3KKSA 3V81A 5EU7A 3DLKA 4LH5A 1S1XA 4DU4A 1Z25A 3LPUA 2KTQA 3P83D 1FK9A 2GV9A 1TVRA 3ZSQA 1S1WA 4B8AB 3HM9A 4DTUA 4C8LA 1CZ9A 4LY7A 4CF2A 1NOZA 3L8BA 4M3TA 1VSLA 1Q9YA 1ZBLA 2KFZA 3AVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSF A;  1IO2 A;  3TWH A;  1RT6 A;  3SV4 A;  4KB0 A;  3VQC A;  1IKW A;  3QEX A;  1VSH A;  3RR8 A;  3B6O A;  1FKP A;  3NAE A;  4FJI A;  1QSS A;  4RW4 A;  4FXD A;  4R5P A;  4AHS A;  4PA1 A;  2WOM A;  3V1Q A;  2RN2 A;  4IFY A;  5CYM A;  4DF4 A;  4JS4 A;  3OYF A;  3MEE A;  3DLB A;  5JS2 A;  4DTP A;  3L2U A;  4EP5 A;  3EYZ A;  4BDY A;  4QAG A;  3PV8 A;  2IGI A;  3CYM A;  2P1J A;  5HBM A;  2IDO A;  1XI1 A;  4DSK A;  3VN5 A;  3VQ4 A;  3HVR A;  4CJT A;  2G8V A;  1J9A A;  3S9H A;  3KD1 E;  2XY6 A;  3IRX A;  1WAJ A;  3C6U A;  3I8D A;  3QER A;  3L3V A;  3ZSO A;  1CLQ A;  3WNF A;  1VRU A;  1EX4 A;  4HCB A;  1JLE A;  3SYZ A;  3QEP A;  3C95 A;  1B9D A;  4DSI A;  1LW2 A;  3AO2 A;  4PWD A;  3QEW A;  3AVK A;  1TAU A;  2EHG A;  4DLE A;  2HHT A;  4DQQ A;  1VSJ A;  5J2P A;  3ZT1 A;  4DMN A;  4M3R A;  3HK2 A;  4Z4I A;  4AHV A;  2HVH A;  4OLA A;  1RBT A;  3SUQ A;  1JLC A;  4PQU A;  1JLA A;  1NJX A;  4H4O A;  4AHU A;  2Y1J A;  5JS1 A;  2LSN A;  4FLY A;  3NF9 A;  3UIQ A;  2IS3 A;  3ITH A;  1VSE A;  2HNY A;  4AHT A;  4CIE A;  4FZZ A;  3CFO A;  3RMD A;  3ZSR A;  4CJU A;  3PO5 A;  1HYS A;  3AVJ A;  1WNS A;  1NK0 A;  4J2B A;  3IG1 A;  3ZSZ A;  4H8K A;  2O4G A;  1LV5 A;  1S5J A;  4FYD A;  4FLW A;  1XHZ A;  3RMB A;  3K2P A;  1K6Y A;  3QO9 A;  4H4M A;  1Y97 A;  3LWL A;  1S1V A;  5C42 A;  3BDP A;  1NK7 A;  1IH7 A;  4DSJ A;  3K5O A;  3HST B;  4OJR A;  1U49 A;  3V1O A;  4CEZ A;  3OYB A;  1LWE A;  5J2Q A;  1EKE A;  3SPZ A;  2O4I A;  1W9H A;  4F3O A;  1JL2 A;  4IFV A;  4CJL A;  1RCH A;  1FKO A;  2VWK A;  2YNI A;  4TSX A;  4DG1 A;  3V9Z A;  3DYA A;  3FFI A;  5SWM A;  4E1M A;  4FJJ A;  4FJX A;  5KRS A;  1N6Q A;  4B9V A;  2X6S A;  2VG6 A;  3QIO A;  4W5R A;  4G1Q A;  4CEO A;  3P1G A;  4HCC A;  4QOZ B;  4OGC A;  4YFU A;  1C1C A;  1L3T A;  3RTV A;  4KTQ A;  1QHT A;  1UAX A;  3CM6 A;  1W0H A;  1NJY A;  2OPS A;  2Z1J A;  1WSE A;  4OGE A;  2G8K A;  1WSI A;  2E6M A;  2GUI A;  1KCF A;  1LAW A;  2E6L A;  2YNH A;  3TAB A;  1A5W A;  3AVM A;  4W5O A;  4DQI A;  1GOC A;  4LD0 A;  2B6A A;  1U04 A;  3PUF A;  5KGX A;  3O3F A;  1JLB A;  3AO5 A;  4FVM A;  1LAV A;  3HXM A;  4HUF A;  3MXI A;  2OYQ A;  3PX4 A;  4DFM A;  4B9M A;  1JLQ A;  4CEQ A;  2FBY A;  4EZ9 A;  4ID1 A;  4CEE A;  3HP6 A;  1HPZ A;  4RW7 A;  4LH4 A;  4CIF A;  3VQ9 A;  3KK2 A;  3DRR A;  2XO7 A;  3LAK A;  3OS2 A;  4DTN A;  2PY5 A;  3HVT A;  1RIL A;  4KI4 A;  3CM5 A;  1WSF A;  2D0C A;  3U3G A;  4CGF A;  4CJF A;  1ZBF A;  1TKD A;  2Z1H A;  1IG9 A;  2HHS A;  1RT1 A;  3C6T A;  1TAQ A;  1J54 A;  4DS5 A;  3QET A;  1RDC A;  1N5Y A;  3HPH A;  3JSM A;  1BIZ A;  4W5T A;  3OYE A;  2BAN A;  4JS5 A;  4B9L A;  1SL0 A;  2HHW A;  3K59 A;  1QE1 A;  4M42 A;  4OLB A;  3ISN C;  2VWJ A;  3OY9 A;  3AVF A;  3MAQ A;  2DFH A;  2X6N A;  2BDP A;  4N5S A;  5HP1 A;  3NHG A;  3LWM A;  1ZBU A;  3QLH A;  1ZYQ A;  1B92 A;  3VQD A;  4DTR A;  4FJG A;  4CFC A;  3TAN A;  3NFA A;  2FC0 A;  1SKR A;  4KB1 A;  2FBT A;  3DLH A;  3H08 A;  4CGG A;  3KIO A;  4KI6 A;  3RRG A;  3K57 A;  2W42 A;  4FLU A;  4KHW A;  3AA5 X;  4AHR A;  4K8Z A;  2QK9 A;  4E19 A;  4KO0 A;  4NCA A;  4B3O A;  1SKW A;  1NKC A;  3SQ2 A;  3LP1 A;  3TAM A;  2OPR A;  4CF8 A;  2G8I A;  3AVC A;  4DTO A;  4N56 A;  4OVL A;  3OYL A;  3V6D A;  4C8K A;  3HJF A;  3MEG A;  3K5L A;  4Y1D A;  3V9X A;  1TL1 A;  3SUN A;  4KHS A;  1LW0 A;  4M3U A;  3QNO A;  4DSF A;  3RMA A;  3HL8 A;  3WNG A;  1BI4 A;  2Z1I A;  1BL3 A;  1WSH A;  3OYG A;  2KFN A;  1BCO A;  2B5J A;  4CJV A;  1RNH A;  5D3G A;  3VQE A;  4AHC A;  1EP4 A;  1MU2 A;  4YNQ A;  5CY4 A;  4BAC A;  3SJJ A;  3EY1 A;  2YNG A;  2HHX A;  1HMV A;  5CZ2 A;  4CF9 A;  2OZM A;  2HNZ A;  4E1N A;  3MED A;  5K14 A;  3A2F A;  4GW6 A;  1A5X A;  3VQB A;  1SL2 A;  3MXJ A;  3L2V A;  3T3F A;  2G8W A;  1J53 A;  1WLJ A;  4M3Y A;  1O1W A;  3ZT2 A;  3NBP A;  1UWB A;  2P5O A;  4IKF A;  4M3X A;  1SKS A;  1NK5 A;  2DTU A;  4BDP A;  4CJ4 A;  3C94 A;  2BGG A;  2PYL A;  1DLO A;  1G15 A;  3TAQ A;  1NJW A;  3OJS A;  1RTD A;  4KKO A;  3TI0 A;  3F9K A;  4CJ3 A;  1BI4 B;  5KTQ A;  3AO1 A;  4E7J A;  4B9T A;  4DWI A;  2Z1G A;  4K8X A;  4O44 A;  1SV5 A;  1B9F A;  4J2E A;  1X1P A;  1NKB A;  1JLG A;  1S6Q A;  4AIL C;  3S3N A;  1UOC A;  2OPP A;  2JLE A;  4CHO A;  2A1S A;  3L2R A;  1ITG A;  1RT3 A;  4ID5 A;  2XHB A;  4I9Q A;  1EET A;  1NKE A;  1Q9X A;  3L2W A;  1RBR A;  2OPQ A;  4JRQ A;  1KFD A;  1F21 A;  2HHQ A;  1NOY A;  1DTQ A;  4E89 A;  2HB5 A;  3NE6 A;  4CK3 A;  3HYF A;  4DTS A;  1FXX A;  2WON A;  4N41 A;  5HRS A;  2YKN A;  1CXQ A;  3T1A A;  4IDK A;  3LP2 A;  1C6V A;  3ZSY A;  4HUE A;  4DLG A;  1ASU A;  3LP0 A;  3VQP A;  4KRF A;  4JLH A;  4C8M A;  5I42 A;  1YT3 A;  1LWF A;  4FLZ A;  1ZBH A;  2KQ2 A;  4HTU A;  4F2S A;  3NF6 A;  2D0B A;  5C24 A;  2D5R A;  3DLR A;  4CJQ A;  3F73 A;  3OYJ A;  4CFA A;  4JRP A;  4DQS A;  2YHB A;  2ATQ A;  3SQ4 A;  3OS1 A;  3QES A;  4E7K A;  4FW1 A;  4CEB A;  4KHY A;  2KZZ A;  2RPI A;  4RG8 A;  3SQ1 A;  2QXF A;  4FJ5 A;  1EXQ A;  1Q8I A;  3I0R A;  4FLT A;  1X9W A;  2KW4 A;  1BHL A;  1NK8 A;  2F8S A;  4E3S A;  1LWC A;  5KGW A;  3AA3 A;  2QKB A;  1RDA A;  4O55 A;  1YTA A;  4M3Z A;  4GMJ B;  4M3W A;  3G10 A;  3HPO A;  4E7I A;  1C0T A;  2I5J A;  2VG5 A;  3TAR A;  4F8R A;  3VQ7 A;  1HNI A;  4NCG A;  3V9S A;  4CE9 A;  4Q5V A;  3G0Z A;  1U48 A;  3QEV A;  1QTM A;  3KLI A;  1T7P A;  3DRS A;  3P5J A;  2Q3S A;  4CEF A;  3NDK A;  4BE1 A;  2A1R A;  3BGR A;  4Z4C A;  4AH9 A;  1KVA A;  1KSP A;  2IAJ A;  4MQ3 A;  2HHU A;  4CK2 A;  1RBS A;  1BGX T;  4FJ8 A;  1S1U A;  1NK6 A;  4J2A A;  4E0D A;  1HQU A;  3OS0 A;  4O5B A;  2IC3 A;  4B9N A;  4CF0 A;  3DOK A;  4CGI A;  2RKI A;  4I2Q A;  1KVB A;  5DMR A;  1UA1 A;  4FJM A;  4OKJ A;  1IKY A;  4CES A;  3PX0 A;  4FW2 A;  3OYD A;  1BIU A;  3S3O A;  3TR8 A;  3PY8 A;  2BE2 A;  4B9S A;  3SQ0 A;  3S3M A;  1ZBI A;  1RDB A;  3DMJ A;  3ZSX A;  4DTM A;  1VSI A;  3D45 A;  3CFR A;  1REV A;  4HHT A;  4FM2 A;  1HYZ A;  4C8N A;  1TK5 A;  3JYT A;  2ZQB A;  3VA0 A;  4OPK A;  3WNH A;  4FZY A;  1D8Y A;  4FM1 A;  3AA2 A;  3SI6 A;  1D9D A;  3VQQ A;  2NUB A;  4CHN A;  4DQR A;  1HJR A;  4CJE A;  4DF8 A;  4ZTJ A;  2G8H A;  3TAF A;  4CF1 A;  3PO4 A;  1VK0 A;  4M45 A;  4KFB A;  1TK0 A;  3O3G A;  4KHQ A;  2IOC A;  4Z0U A;  1TKX A;  4Z4H A;  2R7Y A;  3RMC A;  4CER A;  1T8E A;  5HRO A;  5HRN A;  3OYC A;  1QSL A;  3K5N A;  4IG0 A;  3LDS A;  2HND A;  1JXB A;  3V4I A;  3CFP A;  4IG3 A;  3SZ2 A;  4CJ5 A;  3L3U A;  3LZJ A;  4ICL A;  4FLX A;  2G8F A;  4IBN A;  3DRP A;  4FM0 A;  3O4N A;  4PUO A;  3MXM A;  4CJR A;  4I2P A;  3M8S A;  3B6P A;  2AJQ A;  4RW6 A;  5FDL A;  3SUP A;  3LZI A;  3KD5 E;  3AVG A;  4EP4 A;  5J2N A;  4FZX C;  5FRO A;  4FK0 A;  3OVN A;  3WNE A;  1DTT A;  1GOA A;  3NGI A;  3SPY A;  3VQ6 A;  4O4G A;  3QIN A;  5KRT A;  4DTX A;  4LSN A;  3ZT0 A;  3AVI A;  4CHY A;  4FLV A;  1RTH A;  1IKX A;  4DFJ A;  4NCB A;  1RDD A;  2X78 A;  3LAL A;  3ZSV A;  1U4B A;  4N47 A;  4DSL A;  3ZCM A;  3KK1 A;  3U6F A;  3HPG A;  1T05 A;  4CK1 A;  1KVC A;  3HP9 A;  1WAF A;  4MFB A;  3MEC A;  3SNN A;  3M8Q A;  2G8U A;  4FJN A;  4DU1 A;  1S9E A;  4KPY A;  1BCM A;  4PY5 A;  1D5A A;  4W5N A;  3AV9 A;  4FJH A;  4DSE A;  1JKH A;  1L5U A;  3HO1 A;  1A5V A;  4DU3 A;  4CEC A;  5E41 A;  3ULD A;  1HQE A;  4KAZ A;  3TAG A;  4LSL A;  2YV0 X;  2ETJ A;  3NF8 A;  3VQ8 A;  4CCH A;  2YNF A;  3M8P A;  2XY7 A;  5I3U A;  3NGY A;  5HRR A;  1ASV A;  1S9G A;  4CFD A;  1RT4 A;  3U3Y A;  3SCX A;  4FCY A;  3THV A;  4ZTF A;  1L3U A;  4L8R B;  4KHU A;  1SL1 A;  3LP3 A;  4F2R A;  3K5M A;  4BE0 A;  2YHA A;  4W5Q A;  3V9W A;  1NJZ A;  1RBU A;  2ZE2 A;  4FJL A;  4Z4G A;  4CGH A;  1CXU A;  3I0S A;  3T19 A;  1IKV A;  4CIG A;  2PYJ A;  5C25 A;  1RT2 A;  1XHX A;  3IAY A;  3LPT A;  3SUO A;  3RWU A;  5T7B A;  3AA4 A;  5HRP A;  3KJV A;  3ZT3 A;  1C0M A;  3CQ8 A;  3EZ5 A;  2P51 A;  4Y1C A;  3LAN A;  4BDZ A;  4Z4F A;  4Q0B A;  4M41 A;  4E7H A;  1C0U A;  1RT7 A;  1KTQ A;  3OYH A;  1RBV A;  4ZHR A;  2D0A A;  2GBZ A;  5HLF A;  3HT3 A;  1R0A A;  4QCL A;  2P5G A;  2QKK A;  4BWJ A;  3KLE A;  5DK5 A;  3TAE A;  1I39 A;  1UA0 A;  4RW8 A;  2B4J A;  4FJK A;  4CGJ A;  3OYN A;  3V9U A;  1TKZ A;  1HNV A;  1TV6 A;  2VG7 A;  1S6P A;  3VQA A;  3KLG A;  3KLF A;  4NYN A;  5SZT A;  4DQP A;  3IS9 A;  3QIP A;  3SV3 A;  1XC9 A;  4CJW A;  1D9F A;  3AVA A;  4FK2 A;  1HYV A;  3QNN A;  3TAP A;  4CHZ A;  3AVN A;  4FJ9 A;  1KLN A;  2HMI A;  4E7L A;  5J2M A;  3NGZ A;  3RRH A;  4NYF A;  2Y1I A;  3RR7 A;  1XWL A;  1HRH A;  3PX6 A;  1X9M A;  4RW9 A;  1U45 A;  4O0J A;  4CED A;  3AO3 A;  3AVL A;  5FRM A;  4F4K A;  2DFE A;  1BIS A;  1C1A A;  1RTJ A;  1VSK A;  2XY5 A;  3ZSW A;  3DOL A;  1VSD A;  2EX3 A;  3O4Q A;  1CZB A;  3KLH A;  3VA3 A;  4DFP A;  3QEI A;  4FJ7 A;  2E4L A;  4J2D A;  4HVJ A;  3ASM A;  1QS4 A;  3CG7 A;  5CYQ A;  1YVU A;  4CJS A;  3DLE A;  1J5O A;  4F3T A;  1VRT A;  1T03 A;  1TGO A;  3KKR A;  4ELT A;  4ELV A;  1NK9 A;  3NCI A;  1WSJ A;  2YKM A;  1JXE A;  5CZ1 A;  4CJP A;  2DFF A;  4DFK A;  1BQM A;  2XY8 A;  1BQN A;  4I9L A;  3OYA A;  2HW3 A;  4OKE A;  4KV8 A;  3V1R A;  4B08 A;  1C1B A;  2FBV A;  4CGD A;  4C8O A;  4DS4 A;  3L2Q A;  1WN7 A;  4CJK A;  2HHV A;  3NH0 A;  2ZD1 A;  3OYI A;  4B8C A;  5KI6 A;  5FRN A;  1L3S A;  4KRE A;  4HUG A;  4N76 A;  2F96 A;  2ITG A;  1L3V A;  4OPJ A;  1TKT A;  1GOB A;  4BE2 A;  1QQC A;  3DM2 A;  2X74 A;  1WSG A;  1X9S A;  2F8T A;  2KZM A;  1RT5 A;  4CFB A;  1SUQ A;  1KFS A;  3KTQ A;  1RTI A;  4OKK A;  5J1E A;  3NH2 A;  4DTJ A;  4KHN A;  4GVM A;  4KTZ A;  4FK4 A;  2OZS A;  4KTW A;  1YTU A;  3AO4 A;  2HVI A;  3ALY A;  1TL3 A;  4CHP A;  4EZ6 A;  1U47 A;  2PZS A;  1KLM A;  2JGU A;  3DI6 A;  3K58 A;  1I3A A;  3LAM A;  4ELU A;  1NK4 A;  1TK8 A;  1S1T A;  1KRP A;  1QSY A;  4Z4E A;  3VQ5 A;  2RF2 A;  3E01 A;  4BWM A;  3M8R A;  4XIU A;  4CHQ A;  4O0I A;  3OYM A;  4B9U A;  3ZT4 A;  1ASW A;  4UQG A;  4CEA A;  1VSM A;  1Z26 A;  3O3H A;  3KK3 A;  3DLG A;  2OA8 A;  3NH1 A;  3NF7 A;  4I7F A;  2DY4 A;  3OJU A;  1JL1 A;  1JLF A;  2FBX A;  3AVB A;  3D0P A;  3OYK A;  2XRI A;  4WE1 A;  3KKS A;  3V81 A;  5EU7 A;  3DLK A;  4LH5 A;  1S1X A;  4DU4 A;  1Z25 A;  3LPU A;  2KTQ A;  3P83 D;  1FK9 A;  2GV9 A;  1TVR A;  3ZSQ A;  1S1W A;  4B8A B;  3HM9 A;  4DTU A;  4C8L A;  1CZ9 A;  4LY7 A;  4CF2 A;  1NOZ A;  3L8B A;  4M3T A;  1VSL A;  1Q9Y A;  1ZBL A;  2KFZ A;  3AVH A; 
#chains in the Genus database with same CATH topology
 1VSF A;  3SV4 A;  4KB0 A;  2BH1 A;  3QEX A;  3SAF A;  3MX5 A;  4BGB A;  1QSS A;  4FJI A;  4FXD A;  3MEE A;  2E5L K;  5JS2 A;  3VEW A;  4IO9 L;  4BDY A;  3HZ6 A;  4ILJ A;  4J8F A;  1XI1 A;  2P1J A;  4DSK A;  2IDO A;  3VN5 A;  4U7B A;  2NRW A;  2XY6 A;  3QER A;  3M5R A;  1O13 A;  1XMO K;  2Q31 A;  3THY A;  1MDU B;  3EN9 A;  4C1N K;  4DSI A;  1LW2 A;  4PWD A;  1TAU A;  3QEW A;  4DLE A;  3EKU A;  1VSJ A;  5J2P A;  3HK2 A;  5BRF A;  3SUQ A;  1JLA A;  3NF9 A;  3SJH A;  3ITH A;  1K73 O;  4AHT A;  4FZZ A;  3MN5 A;  4CJU A;  3PO5 A;  3IKM A;  3W0L A;  4WQ4 C;  5AQP A;  4FLW A;  1XHZ A;  1NLV A;  1K8K B;  3BZK A;  3HBT A;  1NM1 A;  5AQS A;  4FSV A;  5J2Q A;  1IBL K;  1JL2 A;  4C1N I;  5BPM A;  2O8C A;  4CEO A;  4IOX A;  3CD6 N;  4PKI A;  4JI0 K;  1YUW A;  1QHT A;  2CGJ A;  2Z1J A;  3CMA N;  1HNX K;  2E6M A;  1M90 O;  4LD0 A;  2B6A A;  1HKC A;  3PUF A;  4HUF A;  2OYQ A;  4LF5 K;  4B9M A;  3QBX A;  4ID1 A;  3HP6 A;  1HPZ A;  3KK2 A;  4LH4 A;  2PY5 A;  3DRR A;  4DTN A;  3JAM O;  3HVT A;  1QVF M;  3CM5 A;  2D0C A;  4FOE A;  4CJF A;  1RT1 A;  5FPE A;  1TAQ A;  3QET A;  3JSM A;  1RGI A;  5H1S Q;  1SL0 A;  2Q36 A;  3K59 A;  4Y0W A;  4OLB A;  3TTC A;  4WYB A;  4X65 K;  1ATS A;  1X9J A;  4GV9 A;  4JI4 K;  4ILG B;  3QLH A;  1B92 A;  3VQD A;  4FJG A;  4CFC A;  5LJV A;  3H08 A;  3RRG A;  4DQ8 A;  4GVE A;  4AHR A;  4K8Z A;  2QK9 A;  4E19 A;  4KO0 A;  1SKW A;  3MN9 A;  3A5O C;  3WEE A;  3AVC A;  1IV0 A;  4N56 A;  3HJF A;  4AF1 A;  3PIP L;  3TSQ A;  4DR5 K;  2O8F A;  1TL1 A;  5LJW A;  1LW0 A;  3HL8 A;  4BR4 A;  3WNG A;  4B1X B;  4JKC A;  4YNQ A;  4LC9 B;  2HNZ A;  4FWM A;  3VQB A;  4OPH A;  4M3Y A;  1O1W A;  3OW2 M;  4YDU C;  3NBP A;  3ZET B;  4IKF A;  1CZA N;  3T69 A;  5C0Y A;  1G15 A;  4H0O A;  3HRG A;  3PIO L;  3OJS A;  4A59 A;  3O1B A;  1VQ6 N;  2J4R A;  4B9T A;  4O44 A;  1SV5 A;  1DKG D;  1S6Q A;  1UOC A;  2JLE A;  4BC2 A;  2A1S A;  2XHB A;  4I9Q A;  1EET A;  1WBB A;  1W97 L;  1Y64 A;  3MN6 A;  4M7X A;  5JVH L;  3U9Z A;  4DTS A;  2GX9 A;  1VQ8 N;  1S3X A;  1IBM K;  1C0F A;  4HUE A;  3LP0 A;  4JK7 A;  4KRF A;  3F2K A;  4FLZ A;  4F2S A;  5C24 A;  3DLR A;  4H0Y B;  4DQS A;  2YHB A;  1OH7 A;  4FW1 A;  3CCQ N;  3ZEU B;  1FW6 A;  3JXU A;  2ITM A;  4JKD A;  1BHL A;  4CBW A;  1NK8 A;  1JCE A;  3AA3 A;  2QKB A;  5AZI B;  4M3Z A;  4M3W A;  2I5J A;  2GEM A;  3CJ7 A;  4BQL A;  3CPW M;  4CE9 A;  3QEV A;  1T7P A;  1YXQ A;  4BE1 A;  3NDK A;  2Q3S A;  2QWM A;  5KQ8 A;  4AH9 A;  4MQ3 A;  1BGX T;  3OS0 A;  2IC3 A;  1KVB A;  2VQF K;  1UA1 A;  4FJM A;  3C7N A;  2V7Z A;  3QB0 A;  1S22 A;  3TR8 A;  4B9S A;  4DR7 K;  4JD2 B;  3ZSX A;  3IMX A;  3CFR A;  3CIP A;  3WXJ A;  4FZY A;  5GAE P;  4BRG A;  4DF8 A;  3PO4 A;  2Q97 A;  3O3G A;  2IOC A;  1J6Z A;  4Z0U A;  4Z4H A;  4NXN K;  4CER A;  5HRO A;  5HRN A;  3ZX2 A;  4YOW A;  3K5N A;  3V4I A;  4IG3 A;  4ISG A;  4A5B A;  2G8F A;  3CCM N;  4DR4 K;  3O4N A;  3MXM A;  3H3N O;  4K42 A;  4RW6 A;  4BR9 A;  4EP4 A;  3OVN A;  2E2N A;  3WNE A;  3NGI A;  2O8D A;  2X78 A;  3WT0 A;  3ZSV A;  1NGA A;  3QBW A;  4N47 A;  4KBO A;  4CK1 A;  1WAF A;  4MFB A;  2VWB A;  1YJ9 N;  4PKG A;  2G8U A;  4FJN A;  2Q0U A;  4W5N A;  2ZJR L;  4CD1 A;  4X64 K;  3HO1 A;  1A5V A;  1QQN A;  4DU3 A;  4CEC A;  1HQE A;  3TAG A;  3DAW A;  3VQ8 A;  3M8P A;  2XY7 A;  4FOI A;  1RT4 A;  3CC2 N;  4F2R A;  3V9W A;  1E4F T;  4CGH A;  1IKV A;  3IAY A;  3LPT A;  3QML A;  5HRP A;  3CQ8 A;  1QQM A;  1YIJ N;  4BDZ A;  4Z4F A;  4GV6 A;  4WF9 L;  2GBZ A;  4QCL A;  2QKK A;  3KLE A;  4IJA A;  4RW8 A;  1TYQ A;  4WQ5 A;  1HNV A;  1S6P A;  3R1X A;  3KLG A;  4NYN A;  3IS9 A;  3QIP A;  2FSJ A;  5LY3 A;  3SV3 A;  1XC9 A;  3L0Q A;  4WCE L;  5LMN K;  4B1Z A;  2P9P B;  3Q7B A;  3AVN A;  3CQX A;  1Q82 O;  1NGF A;  3NGZ A;  3RR7 A;  1XWL A;  3DWL A;  1U45 A;  5ADX H;  4CED A;  3ZX0 A;  5FRM A;  4BC5 A;  3CCJ N;  3SLC A;  3HTV A;  3ZSW A;  3DOL A;  3O4Q A;  2V52 B;  3ATU A;  3UKR A;  3THX A;  3QEI A;  3U9D A;  4FWL A;  3ASM A;  1QS4 A;  2QXL A;  1J5O A;  3FR0 A;  4F3T A;  3MN7 A;  4BRF A;  4BR0 A;  3T1Y K;  3KKR A;  4ELT A;  2P9N B;  2YKM A;  4CJP A;  2DFF A;  3H6E A;  4UY8 O;  4CZH A;  4C8O A;  3L2Q A;  4CJK A;  2HHV A;  3OYI A;  3VTI A;  4U67 L;  4B1Y B;  1T6D A;  5FRN A;  1N34 K;  2F96 A;  1L3V A;  2O8B A;  2F8T A;  4CFB A;  1SUQ A;  3KTQ A;  5J1E A;  5HOO A;  4FK4 A;  4PHT X;  1YTU A;  2HVI A;  3ALY A;  4GY2 B;  1TL3 A;  4EZ6 A;  3DI6 A;  2AA4 A;  2W40 A;  4IOA L;  2CH5 A;  1TK8 A;  3CJ9 A;  1H1V A;  2D4W A;  3G25 A;  3OYM A;  5BN8 A;  1E4G T;  3U8X A;  1TUY A;  3NH1 A;  2DY4 A;  1JLF A;  2FBX A;  4WE1 A;  4BRM A;  1OH5 A;  3KKS A;  4DR3 K;  2QW9 A;  4BY9 C;  4DU4 A;  2KTQ A;  4NB4 A;  4RTF D;  2GV9 A;  4FPA A;  4LY7 A;  3KHY A;  1JCG A;  1G99 A;  2KFZ A;  3PLA A;  4B1W B;  1IO2 A;  4FL9 A;  3O8M A;  3VQC A;  2EWS A;  1IKW A;  5BRD A;  1VSH A;  1QHA A;  3IFR A;  4FPB A;  3LDQ A;  4PA1 A;  2WOM A;  3V1Q A;  1X3M A;  3O9T A;  4IFY A;  5CYM A;  5FPD A;  5AQV A;  3OYF A;  3DLB A;  5C12 A;  4RWT A;  3L2U A;  4QAG A;  4CBU A;  2UXB K;  3VQ4 A;  1MWM A;  3IRX A;  3I8D A;  3F5T A;  1VRU A;  4CW7 B;  1JLE A;  2UUB K;  3C95 A;  1BDG A;  4DQQ A;  1ZXO A;  3ZT1 A;  2UXD K;  1K8K A;  4Z4I A;  3O9S A;  3GE1 A;  1JLC A;  4PQU A;  4AHU A;  2E1Y A;  1D4X A;  2LSN A;  3UIQ A;  1E3M A;  3HOS A;  1VSE A;  3CFO A;  3ZSR A;  4CZF A;  1WNS A;  3IG1 A;  4H8K A;  1S5J A;  4JI7 K;  2NRV A;  3K2P A;  1K6Y A;  3VF4 A;  5DM7 L;  2ZF5 O;  5C42 A;  1NNE A;  1IH7 A;  3KD1 E;  3V1O A;  4CEZ A;  1N8R O;  1LWE A;  3SPZ A;  4BG9 A;  4B3S K;  4CJL A;  2YNI A;  4DG1 A;  3DYA A;  5SWM A;  3UKU B;  1N6Q A;  2VG6 A;  3QIO A;  4BC3 A;  1S72 N;  4OGC A;  3W3D A;  1RDW X;  3RSE B;  2ASO A;  3CCL N;  2OPS A;  3CCS N;  1WSI A;  4A2A A;  2GUI A;  1KCF A;  3G6E N;  1A5W A;  4XH4 A;  1ZC6 A;  3KZB A;  4JK9 A;  4DQI A;  3CQY A;  3HXM A;  1JLB A;  2D1K A;  4DFM A;  4KHP K;  2Q2R A;  4EZ9 A;  5B8H A;  3GBT A;  4CEE A;  4KPY A;  2A5X A;  2F9W A;  2IVN A;  3VQ9 A;  4R79 A;  3LAK A;  3OS2 A;  1LCU A;  1RIL A;  2HHS A;  4LF8 K;  4BR7 A;  3C6T A;  4FVU A;  1N5Y A;  1N33 K;  3HPH A;  1BIZ A;  3OYE A;  2BAN A;  4JS5 A;  4B9L A;  2HHW A;  4M42 A;  2QTD A;  3ISN C;  3AVF A;  3MAQ A;  2DFH A;  2BTF A;  5HP1 A;  4K43 A;  5EX5 A;  1M1K O;  3TAN A;  3DLH A;  3KIO A;  4KI6 A;  3ENH A;  3E9L A;  4KHW A;  3SK3 A;  4JN4 A;  3P4I A;  3WQT A;  1SQK A;  1NKC A;  3SQ2 A;  1VQL N;  4WQ4 A;  3TAM A;  2G8I A;  2OPR A;  3MCP A;  1OVY A;  5AFU H;  4DTO A;  4C8K A;  3MEG A;  3P31 A;  5BRE A;  4M3U A;  5JIC A;  1R59 O;  3FFK B;  2Z1I A;  2B5J A;  4CJV A;  4AHC A;  1EP4 A;  1MU2 A;  3PSI A;  3SJJ A;  1EO1 A;  2YNG A;  4JEP A;  4E1N A;  3A2F A;  1SL2 A;  1NJI O;  3L2V A;  5TKW A;  4HWI A;  2P5O A;  2DTU A;  1IG8 A;  3CPE A;  2BGG A;  1DLO A;  3TAQ A;  4KKO A;  3TI0 A;  2W6L A;  4H5R A;  2A41 A;  3SBG A;  1ESV A;  4E7J A;  4K8X A;  1X1P A;  1NKB A;  4CHO A;  2NRH A;  3L2R A;  1ITG A;  4ID5 A;  4YOV A;  3ZEU A;  3NE6 A;  4CK3 A;  5HRS A;  4CZL A;  3A5N C;  3B8A X;  2A42 A;  4GKJ K;  5I42 A;  3CI5 A;  5M1O A;  3CJC A;  4AQY K;  4HTU A;  2UU9 K;  5M1P A;  3NF6 A;  4CJQ A;  4JRP A;  2ATQ A;  3OS1 A;  1NMN A;  3LM2 A;  2HBM A;  2KZZ A;  2RPI A;  5AQG A;  2QXF A;  1ATN A;  1EWQ A;  1Q8I A;  3KK7 A;  4JV5 K;  4FLT A;  1GLC G;  4BGA A;  4PL7 A;  4E3S A;  2NRR A;  3CC7 N;  4YOU A;  3HPO A;  2VG5 A;  4JKG B;  4C23 A;  1HNI A;  4DV6 K;  3CC4 N;  4JD2 A;  4Q5V A;  2GUP A;  1QTM A;  2QWQ A;  3DRS A;  2A1R A;  4CJ7 A;  3BGR A;  4Z4C A;  2HMP A;  4YDU A;  1BWF O;  1RBS A;  4XEI A;  4M7Y A;  1NK6 A;  1HQU A;  3FZM A;  3AAP A;  5AQJ A;  4CGI A;  4I2Q A;  4OKJ A;  3I33 A;  3PX0 A;  2QWN A;  3S3O A;  3PY8 A;  2BE2 A;  3VTH A;  3SQ0 A;  1ZBI A;  1RFQ A;  3DMJ A;  4DTM A;  1VSI A;  3D45 A;  4BR2 A;  4HHT A;  4FM2 A;  1HYZ A;  4C8N A;  5IWA K;  3JYT A;  2ZQB A;  3J7A P;  1D8Y A;  4DCH A;  4FM1 A;  3ZLJ A;  4CHN A;  3D2E B;  4DQR A;  1HJR A;  4CJE A;  5M1K A;  2G8H A;  4CF1 A;  4AM6 A;  2NRT A;  4M45 A;  4KFB A;  4H0X B;  2ZJQ L;  4KHQ A;  1TKX A;  4JI3 K;  1XQS C;  4IXC A;  3OYC A;  1QSL A;  4IEI A;  4IG0 A;  1BA0 A;  1VQ7 N;  3CFP A;  2YHW A;  5AQH A;  4MDB A;  4FLX A;  3LZJ A;  4IDH A;  3DRP A;  3AY9 A;  3B6P A;  2AJQ A;  3SUP A;  3MDQ A;  4FZX C;  2YHY A;  2P9L B;  3EE9 A;  5FRO A;  1DTT A;  2ZGY A;  3MX2 A;  3SPY A;  4FWS A;  4O4G A;  3VQ6 A;  3QIN A;  4DTX A;  1WB9 A;  4CHY A;  3TSU A;  3ID8 A;  4DV0 K;  1IKX A;  4NCB A;  4BRE A;  1RDD A;  4DHY A;  3ZCM A;  1BO5 O;  3PSF A;  3HP9 A;  4JKA A;  2V7Y A;  3M8Q A;  3FZF A;  4DU1 A;  1BCM A;  1T3V A;  3VGM A;  3WXM B;  4FJH A;  4H0V B;  5E41 A;  5E84 A;  4BRI A;  3NMU A;  4CVN E;  4WFB L;  2OCE A;  4IJN A;  1ASV A;  4YOX A;  1S9G A;  3U3Y A;  5M1N A;  3SCX A;  4FCY A;  1BOT O;  4ZTF A;  1GLL O;  1L3U A;  4L8R B;  4LF9 K;  5JMV A;  4BE0 A;  2YHA A;  2ZE2 A;  3I0S A;  3M1F A;  1VQ5 N;  1RT2 A;  1XHX A;  1GLF O;  2P9P A;  5AQN A;  5AQX A;  1J5E K;  3SUO A;  4F9O A;  1C0M A;  2F9T A;  3J81 O;  2P51 A;  3QFP A;  4Q0B A;  4WFN L;  4BVO A;  4ZHR A;  5AQZ A;  5HLF A;  1R0A A;  1I39 A;  2WFB A;  3I55 N;  4CGJ A;  2ZGZ A;  1TV6 A;  5C10 A;  5GAG P;  4CJW A;  1BG3 A;  1HX1 A;  4FK2 A;  3TAP A;  4FJ9 A;  3R8E A;  2HMI A;  4E7L A;  4BRO A;  3RRH A;  3T7Z A;  4NYF A;  2P9N A;  2QM1 A;  1HRH A;  3PX6 A;  5AQI A;  3CER A;  4F4K A;  4BRA A;  4CZI A;  1CZB A;  3CCU N;  2UXC K;  2E4L A;  5KPT A;  2P9I B;  4JI8 K;  5LL6 Z;  1YVU A;  2YJF A;  1T03 A;  2D0P A;  5HL7 L;  3J7Y P;  2KHO A;  4BRC A;  3MWT A;  4FWP A;  1BQN A;  2E1Z A;  2NZT A;  4KV8 A;  5KPR A;  1VQK N;  4DS4 A;  1WN7 A;  3NH0 A;  4B8C A;  2E2Q A;  4HUG A;  4N76 A;  4GKK K;  1U2V B;  3OHR A;  1X9S A;  2X74 A;  2KZM A;  4A57 A;  2W6K A;  2JGU A;  1I3A A;  3LAM A;  3QFU A;  2QEX N;  1NK4 A;  4I6M B;  4ELU A;  2NRX A;  4Z4E A;  3VQ5 A;  4XIU A;  4O0I A;  3ZT4 A;  1ASW A;  1VHX A;  4B9Q A;  1VSM A;  1T44 A;  4I7F A;  2VGN A;  4DV5 K;  2P9S B;  2XRI A;  2PFU A;  4LH5 A;  3A5M C;  1X3N A;  4B8A B;  1IJJ A;  4DTU A;  4IOC L;  1NOZ A;  3L8B A;  1HUX A;  4B3R K;  4M63 C;  3AVH A;  1NGB A;  3O9U A;  3TWH A;  2IVP A;  4CZK A;  1RT6 A;  4HTL A;  3B6O A;  2FF3 B;  3VGK A;  3TTF A;  1FKP A;  4R5P A;  2RN2 A;  5AQW A;  4DF4 A;  4JS4 A;  4DTP A;  4MLE A;  2IGI A;  4K41 A;  4CJT A;  2YX6 A;  1J9A A;  3S9H A;  1CLQ A;  1OKJ A;  1NGH A;  3FGU A;  1YI2 N;  4JKF A;  3QEP A;  1B9D A;  3AO2 A;  5FPN A;  3AVK A;  2EHG A;  1EQY A;  2YHX A;  4CBX A;  4DMN A;  4M3R A;  3VMF B;  2HVH A;  3C6H A;  4PL8 A;  2FF6 A;  5AFU A;  3MCA B;  3I56 N;  4FLY A;  2IS3 A;  2HNY A;  4CI6 A;  2CGL A;  3AVJ A;  1NK0 A;  3UKU A;  4J2B A;  4B1V A;  3ZSZ A;  3WXL A;  4FYD A;  2HF4 A;  3MWP A;  4MO4 A;  3RSE A;  3VOV A;  1V4T A;  3QO9 A;  4H4M A;  1Y97 A;  3LWL A;  3H1Q A;  1S1V A;  4DSJ A;  3K5O A;  3HST B;  4OJR A;  2O4I A;  3OYB A;  1BA1 A;  1EKE A;  2E2O A;  3L4I A;  2F4V K;  1W9H A;  4F3O A;  4OPA A;  4JAX A;  2HBK A;  1QVG M;  1FKO A;  3V9Z A;  3FFI A;  4E1M A;  4FJX A;  5KRS A;  4B9V A;  2X6S A;  4W5R A;  3P1G A;  4HCC A;  4YFU A;  4FWO A;  1EWR A;  1L3T A;  4KTQ A;  1UAX A;  1W0H A;  2G8K A;  4OGE A;  1WSE A;  4XH5 A;  5CR4 A;  4LF6 K;  2YNH A;  4OX9 K;  4LFC K;  3TAB A;  3AVM A;  1GOC A;  5KGX A;  3O3F A;  1U04 A;  3RMB A;  4FVM A;  3AO5 A;  1QZ6 A;  4JI2 K;  1GLJ O;  3MXI A;  3PX4 A;  2V51 B;  1JLQ A;  4CEQ A;  4CZJ A;  1NJX A;  1NG9 A;  4RW7 A;  3O6W A;  4EAH D;  4KI4 A;  3WXK A;  1WSF A;  4CGF A;  1TKD A;  1ZBF A;  4JHD B;  1IG9 A;  5IT9 O;  4EIA A;  1QE1 A;  3BP8 A;  3OY9 A;  2IIR A;  4JI6 K;  3VEO A;  2Q1N A;  2X6N A;  4N5S A;  3K9J A;  4OO1 J;  1ZYQ A;  4DTR A;  1SKR A;  3NFA A;  2FC0 A;  4KB1 A;  1BUP A;  3D2F B;  2W42 A;  1MA9 B;  2O8E B;  5BPL A;  3LP1 A;  5AQY A;  2NRZ A;  4OVL A;  3OYL A;  2GEL A;  3K5L A;  3CME N;  3SUN A;  4KHS A;  3QNO A;  4DSF A;  4PKH A;  3RMA A;  1FJG K;  3R9P A;  4G9Z A;  4O8K A;  1BCO A;  3LDN A;  1RNH A;  3VEN A;  5D3G A;  3ATV A;  5CY4 A;  2HHX A;  3EY1 A;  1ZBS A;  5CZ2 A;  2OZM A;  3CET A;  4DV1 K;  3MED A;  2P9U B;  1JJ2 M;  4NLC A;  3G4S N;  1Q86 O;  1J53 A;  1WLJ A;  3L6Q A;  3EL2 A;  1YIT N;  1SKS A;  1NK5 A;  4CJ4 A;  3C94 A;  1VQM N;  3J80 O;  1RTD A;  3ULE B;  4CJ3 A;  5JLF A;  3H46 O;  4DUY K;  1BI4 B;  5E26 A;  4IFE A;  4DWI A;  1B9F A;  4J2E A;  2O8D B;  2NNW A;  1JLG A;  2P9K B;  5EVZ A;  1RT3 A;  1NKE A;  5BRH A;  3FZK A;  2OPQ A;  4WFA L;  4JRQ A;  1Q7Y O;  2OTJ N;  3H45 C;  3LDO A;  1F21 A;  2HB5 A;  3K9K A;  3LL3 A;  5I9E B;  2WON A;  3L4Q A;  2A6A A;  4RCH A;  4KH6 A;  3T1A A;  3ENB A;  4IDK A;  1C6V A;  4DLG A;  1HLU A;  5FPM A;  3VQP A;  4BR5 A;  1LWF A;  1ZBH A;  1IBK K;  4BC4 A;  4JKG A;  5M1F A;  2D5R A;  3OYJ A;  3SQ4 A;  4MDA A;  1GLA G;  4KHY A;  5AQO A;  2VCP A;  3SQ1 A;  3BUZ B;  4FJ5 A;  4DKW A;  1SAZ A;  1YJW N;  1X9W A;  5BN9 A;  3BY5 A;  4FWK A;  2W41 A;  3AGK A;  4MLH A;  1RDA A;  4O55 A;  4EHT A;  4O8U A;  3G10 A;  3TAR A;  4NO7 A;  4NCG A;  2F7T A;  3O4W A;  1U48 A;  4H0T B;  4KH4 A;  3P5J A;  4DV2 K;  4MO5 A;  1NMD A;  3GOI A;  3HM8 A;  5AQM A;  1KSP A;  3D2E A;  3FE1 A;  1OVQ A;  4CK2 A;  2UYT A;  4FJ8 A;  4J2A A;  4O5B A;  4B9N A;  4CF0 A;  2FXU A;  1RDU A;  2QI2 A;  2RKI A;  5AQK A;  3LDL A;  4CES A;  4CD3 A;  5MLC Q;  4GV3 A;  4LFA K;  3OYD A;  1BIU A;  1RDB A;  1Z05 A;  2ASM A;  5EOY A;  5F2R A;  5BR9 A;  1TK5 A;  4H0P A;  3VA0 A;  4OPK A;  2P9L A;  3SI6 A;  3VQQ A;  1V4S A;  4LF4 K;  3VEV A;  3A8Y A;  3TAF A;  1VK0 A;  1TK0 A;  1T8E A;  1P8Z A;  3FZL A;  4EFH A;  4BRD A;  2HND A;  1YVN A;  3CXC M;  4CJ5 A;  3L3U A;  3ZET A;  4IBN A;  4BVP A;  4PUO A;  5M1Q A;  4CJR A;  3KD5 E;  5J2N A;  1HKB A;  4FK0 A;  5AZJ B;  2A40 A;  2HBJ A;  1GOA A;  4IWV A;  5KRT A;  4LSN A;  3VER A;  4FLV A;  4DFJ A;  1N36 K;  2HST A;  3AGR A;  3OA9 A;  4DSL A;  3KK1 A;  3U6F A;  3HPG A;  5AQU A;  3SNN A;  1S9E A;  3E9P A;  4PY5 A;  3J8A A;  1KQS M;  3AAR A;  1L5U A;  1YF5 L;  1VQO N;  5KPZ A;  4JNE A;  3ULD A;  4KAZ A;  2ETJ A;  4CCH A;  2DPN A;  2YNF A;  3NGY A;  5HRR A;  3H3O B;  4QS8 A;  3THV A;  1SL1 A;  3LP3 A;  3O9R A;  4W5Q A;  2BUP A;  4FJL A;  4Z4G A;  1CXU A;  3QDK A;  3T19 A;  2PYJ A;  3RWU A;  3A5L C;  3AA4 A;  3D6R A;  3H1V X;  5AQL A;  3KJV A;  1WBD A;  2QWR A;  3EZ5 A;  4Y1C A;  3S41 A;  4M41 A;  2I7P A;  1KTQ A;  4YOY A;  1RBV A;  4BRL A;  5AZI A;  4A2B A;  2CGK A;  2GWJ A;  3SAH A;  3TAE A;  1UA0 A;  3O80 A;  4FWR A;  1BU6 O;  2P9I A;  3HSC A;  1DGK N;  1HYV A;  3QNN A;  4CZE A;  4DUZ K;  1KLN A;  5J2M A;  2Y1I A;  1NGI A;  5C15 A;  4RW9 A;  3NVK A;  2OTL N;  1NBW A;  2FLO A;  2DFE A;  1VSK A;  2XY5 A;  1VSD A;  2JWK A;  2EX3 A;  5EXW A;  4EHU A;  4DFP A;  3EEQ A;  2JWL A;  3CG7 A;  4CJS A;  3DLE A;  1U2V A;  1VRT A;  1TGO A;  3NCI A;  2E8A A;  1WSJ A;  1JXE A;  1BQM A;  2IVO A;  2HW3 A;  4JK8 A;  5CE3 A;  4OKE A;  3V1R A;  2FSN A;  4IZ9 A;  1C1B A;  2FBV A;  1ATR A;  4I6M A;  4NLB A;  3DXM B;  2ZD1 A;  1HPM A;  2PAV A;  2QWO A;  3THW B;  1L3S A;  2ITG A;  1QQC A;  2P9S A;  1KFS A;  1RTI A;  4OKK A;  4DTJ A;  4KHN A;  3A0I X;  4GVM A;  5ADX A;  1U47 A;  2PZS A;  1KLM A;  3K58 A;  1S1T A;  3CJA A;  2RF2 A;  3E01 A;  4BWM A;  3UE5 A;  3M8R A;  4CHQ A;  4O5F A;  1W7A A;  5AQQ A;  4UQG A;  3KK3 A;  3BZC A;  3KVG A;  4CEA A;  1SS6 A;  4JKH A;  3KWI A;  3O3H A;  3CCE N;  4B3M K;  3BF1 A;  3NF7 A;  4BRP A;  3OJU A;  3AVB A;  3D0P A;  4FO0 A;  5EU7 A;  4BQZ A;  3DLK A;  1S1X A;  1Z25 A;  3LPU A;  3LDP A;  4CF2 A;  3CCV N;  4M3T A;  4X66 K;  1Q9Y A;  4B9U A;  4YHH K;  2ZM6 K;  1XC3 A;  5JVG L;  3K0S A;  2HOE A;  3ID6 A;  3RR8 A;  3C6A A;  1HKG A;  3NAE A;  1XUP O;  4RW4 A;  4AHS A;  3DXK B;  5BPN A;  5F1X A;  3EYZ A;  3ZYY X;  4EP5 A;  4DR6 K;  3PV8 A;  3CYM A;  5HBM A;  4CZG A;  5FLX O;  3HVR A;  2G8V A;  1VQ9 N;  1WAJ A;  3T1H K;  3C6U A;  3L3V A;  3ZSO A;  3WNF A;  1GLB G;  1EX4 A;  5EY4 A;  4HCB A;  3SYZ A;  5C2D A;  4DR1 K;  4BRH A;  3P38 A;  4H5V A;  2RHK A;  3CCR N;  2HHT A;  4BRQ A;  3D7E O;  4AHV A;  5TKY A;  4OLA A;  1RBT A;  3NVM A;  3WXI A;  2NLX A;  1HNW K;  4H4O A;  2Y1J A;  5JS1 A;  1HJO A;  4CIE A;  3RMD A;  3THY B;  1WOQ A;  5BR8 K;  3VF6 A;  2YJE A;  3VPZ A;  2O4G A;  1LV5 A;  5GIO A;  3QIC A;  3HI0 A;  4H5N A;  3BDP A;  1NK7 A;  1N32 K;  2ASP A;  1K9M O;  1U49 A;  4IEE A;  2OAN A;  3DJC A;  2AP1 A;  4IFV A;  1RCH A;  1NWK A;  2VWK A;  4A61 A;  4JI1 K;  4GNI A;  1U6Z A;  4TSX A;  1I94 K;  3OBY A;  4FJJ A;  4G1Q A;  4QOZ B;  5A2Q O;  1C1C A;  4JHD A;  1Q81 O;  3RTV A;  3CM6 A;  1NJY A;  2YI1 A;  1LAW A;  2E6L A;  4ISF A;  3VEY A;  4W5O A;  3O1W A;  3O5B A;  1OH6 A;  1LAV A;  2FBY A;  4A5A A;  2O8C B;  1MWK A;  4CIF A;  2XO7 A;  1T6C A;  4YOT A;  3U3G A;  3J7Z O;  3DLL L;  2Z1H A;  1VQN N;  2Q0R A;  2VGM A;  1J54 A;  3D2F A;  4DS5 A;  3WUH A;  1RDC A;  4W5T A;  2O8E A;  1KXP A;  1KAZ A;  4E1J A;  3Q7C A;  4BRN A;  2VWJ A;  1W2B M;  3ZX3 A;  2VYP A;  2QWP A;  3AAQ A;  4QS9 A;  2BDP A;  3NHG A;  3LWM A;  1ZBU A;  3VEX A;  2GTD A;  4IO8 A;  2FBT A;  5GAH P;  4CGG A;  1SZ2 A;  3K57 A;  3OBW A;  4FLU A;  4H5T A;  3AA5 X;  4JI5 K;  4NCA A;  2P9U A;  4B3O A;  2HHH K;  4DR2 K;  3FZH A;  3OTO K;  4CF8 A;  2KKZ A;  1NGE A;  1KD1 O;  3V6D A;  1VAZ A;  4Y1D A;  3E1Y A;  3V9X A;  3ULE A;  3SMS A;  3VF2 A;  4K25 A;  1DT9 A;  1BI4 A;  1WUA A;  3OYG A;  1BL3 A;  1WSH A;  2KFN A;  1K8A O;  1QQO A;  3VQE A;  4BAC A;  3P39 A;  1HMV A;  4CF9 A;  2P9K A;  1XMQ K;  1HNZ K;  1DEJ A;  2E20 A;  5K14 A;  4GW6 A;  1A5X A;  2CH6 A;  2G8W A;  2A3Z A;  3MXJ A;  3T3F A;  3ZT2 A;  3WEE B;  1UWB A;  4M3X A;  4BDP A;  2O8F B;  2PYL A;  2PBD A;  1NJW A;  2KLA A;  3F9K A;  3HOT A;  4LFB K;  5KTQ A;  3AO1 A;  2Z1G A;  1KC8 O;  3CJ1 A;  4AIL C;  3S3N A;  3M6G A;  2OPP A;  4YOR A;  4X62 K;  1Q9X A;  3L2W A;  1RBR A;  1P90 A;  1GLD G;  3E66 A;  1KFD A;  2HHQ A;  2E2P A;  1HR0 K;  1NOY A;  3VET A;  1DTQ A;  4E89 A;  3MMV A;  3GL1 A;  3HYF A;  1FXX A;  1NGD A;  4N41 A;  2YKN A;  1CXQ A;  3LP2 A;  3ZSY A;  1ASU A;  4JLH A;  4C8M A;  4B3T K;  1YT3 A;  1VQP N;  2KQ2 A;  1Q18 A;  2D0B A;  3FLC O;  3EZW A;  3F73 A;  4CFA A;  5GIN A;  1XNQ K;  3QES A;  4E7K A;  4CEB A;  4RG8 A;  1EXQ A;  4BG8 A;  3CJB A;  4CZM A;  3I0R A;  2KW4 A;  2F8S A;  3IUC A;  1ILY A;  1LWC A;  5KGW A;  3EE8 A;  1YTA A;  4GMJ B;  4E7I A;  1C0T A;  4F8R A;  5KQD A;  3E9O A;  3U4L A;  3VQ7 A;  3F9M A;  3V9S A;  3G0Z A;  3GDQ A;  2WBN A;  3KWG A;  3KLI A;  3O9Q A;  4CEF A;  5GIP A;  2H3G X;  4DV3 K;  3CHW A;  1KVA A;  2IAJ A;  3O08 A;  2HHU A;  4L3Q A;  4DV4 K;  3N4Q A;  1S1U A;  4E0D A;  1LOT B;  1Z6R A;  3TPQ A;  3DOK A;  5DMR A;  4BRK A;  1IKY A;  4FW2 A;  3TSP A;  2HBL A;  4JYA K;  1KAY A;  3S3M A;  5AQT A;  1REV A;  3WQU A;  3M3Z A;  2VQE K;  2UUC K;  1GLE G;  3WNH A;  2QWL A;  1D9D A;  3AA2 A;  5AZJ A;  2NUB A;  2RE2 A;  4NXM K;  4ZTJ A;  3SAG A;  4WQ5 C;  2R7Y A;  3RMC A;  4XH1 A;  3C7N B;  3LDS A;  1JXB A;  2GWK A;  3SZ2 A;  2WTU A;  5LMU K;  4ICL A;  4FM0 A;  3I8B A;  2WC9 A;  4I2P A;  3M8S A;  5FDL A;  3LZI A;  3AVG A;  1NU0 A;  4KH5 A;  1KAX A;  4K0K K;  3ZT0 A;  3AVI A;  1XNR K;  1RTH A;  4B1U B;  3LAL A;  3TTD A;  1U4B A;  1T05 A;  1KVC A;  2QA4 N;  5AR0 A;  3MEC A;  1NGJ A;  2FSK A;  3LM9 A;  1D5A A;  3AV9 A;  3TU5 A;  4DSE A;  1JKH A;  5F0X A;  3SMP A;  3EKS A;  4LSL A;  2YV0 X;  3NF8 A;  4FWN A;  5GAD P;  2I7N A;  5I3U A;  3JS6 A;  4CFD A;  4KHU A;  1C0G A;  3K5M A;  1NJZ A;  1RBU A;  4ILH A;  1QZ5 A;  4CIG A;  5C25 A;  4LF7 K;  5T7B A;  2ZWH A;  3ZT3 A;  3LAN A;  4QS7 A;  4E7H A;  1C0U A;  1RT7 A;  3OYH A;  3R6M A;  2D0A A;  1HYS A;  3HT3 A;  2P5G A;  4BWJ A;  3N4P A;  5DK5 A;  3VGL A;  2B4J A;  4FJK A;  3V9U A;  3OYN A;  1TKZ A;  2VG7 A;  3VQA A;  3KLF A;  5C2F A;  5SZT A;  4DQP A;  4H5W A;  1D9F A;  3AVA A;  1NGC A;  4CHZ A;  1NGG A;  3R3L A;  4AM7 A;  1X9M A;  1YHQ N;  4DB3 A;  4O0J A;  4H03 B;  3AO3 A;  3AVL A;  1BIS A;  1C1A A;  1RTJ A;  5AQF A;  1TUU A;  3BF3 A;  5CHI A;  1TYQ B;  3KLH A;  3VA3 A;  3DXM A;  4FJ7 A;  3THW A;  3C65 A;  4J2D A;  4HVJ A;  5CYQ A;  3IDH A;  2HF3 A;  4ELV A;  1NK9 A;  1YAG A;  3EO3 A;  4DV7 K;  5AQR A;  5CZ1 A;  3BEX A;  4DFK A;  4A62 A;  2XY8 A;  3ENO A;  4I9L A;  3OYA A;  4B08 A;  5AJ3 K;  4FWQ A;  4CGD A;  3THX B;  3UKR B;  1VQ4 N;  2D0O A;  5KI6 A;  4JKE A;  3UB5 A;  4KRE A;  5ELZ A;  4OPJ A;  1TKT A;  1GOB A;  4BE2 A;  3DM2 A;  1WSG A;  3MK6 A;  1RT5 A;  2UUA K;  3VES A;  1OH8 A;  3CF5 L;  3NH2 A;  2E88 A;  4KTZ A;  2ZJP L;  4YY3 K;  2OZS A;  4KTW A;  3AO4 A;  4V19 S;  4CHP A;  5JLH A;  3G71 N;  3GG4 A;  5DM6 L;  1KRP A;  1QSY A;  4ISE A;  1JCF A;  2OA8 A;  1Z26 A;  3DLG A;  2O8B B;  1JL1 A;  3DXK A;  3OYK A;  1YJN N;  3V81 A;  3VEZ A;  2YCH A;  4JKB A;  3C0B A;  1FK9 A;  3P83 D;  1TVR A;  3ZSQ A;  1S1W A;  3HM9 A;  4C8L A;  1CZ9 A;  3RVC A;  1VSL A;  4Z94 A;  1ZBL A;  2WUS A;  3SBT A; 
#chains in the Genus database with same CATH homology
 1VSF A;  1IO2 A;  3TWH A;  1RT6 A;  3SV4 A;  4KB0 A;  3VQC A;  1IKW A;  3QEX A;  1VSH A;  3RR8 A;  3B6O A;  1FKP A;  3NAE A;  4FJI A;  1QSS A;  4RW4 A;  4FXD A;  4R5P A;  4AHS A;  4PA1 A;  2WOM A;  3V1Q A;  2RN2 A;  4IFY A;  5CYM A;  4DF4 A;  4JS4 A;  3OYF A;  3MEE A;  3DLB A;  5JS2 A;  4DTP A;  3L2U A;  4EP5 A;  3EYZ A;  4BDY A;  4QAG A;  3PV8 A;  2IGI A;  3CYM A;  2P1J A;  5HBM A;  2IDO A;  1XI1 A;  4DSK A;  3VN5 A;  3VQ4 A;  3HVR A;  4CJT A;  2G8V A;  1J9A A;  3S9H A;  3KD1 E;  2XY6 A;  3IRX A;  1WAJ A;  3C6U A;  3I8D A;  3QER A;  3L3V A;  3ZSO A;  1CLQ A;  3WNF A;  1VRU A;  1EX4 A;  4HCB A;  1JLE A;  3SYZ A;  3QEP A;  3C95 A;  1B9D A;  4DSI A;  1LW2 A;  3AO2 A;  4PWD A;  3QEW A;  3AVK A;  1TAU A;  2EHG A;  4DLE A;  2HHT A;  4DQQ A;  1VSJ A;  5J2P A;  3ZT1 A;  4DMN A;  4M3R A;  3HK2 A;  4Z4I A;  4AHV A;  2HVH A;  4OLA A;  1RBT A;  3SUQ A;  1JLC A;  4PQU A;  1JLA A;  1NJX A;  4H4O A;  4AHU A;  2Y1J A;  5JS1 A;  2LSN A;  4FLY A;  3NF9 A;  3UIQ A;  2IS3 A;  3ITH A;  1VSE A;  2HNY A;  4AHT A;  4CIE A;  4FZZ A;  3CFO A;  3RMD A;  3ZSR A;  4CJU A;  3PO5 A;  1HYS A;  3AVJ A;  1WNS A;  1NK0 A;  4J2B A;  3IG1 A;  3ZSZ A;  4H8K A;  2O4G A;  1LV5 A;  1S5J A;  4FYD A;  4FLW A;  1XHZ A;  3RMB A;  3K2P A;  1K6Y A;  3QO9 A;  4H4M A;  1Y97 A;  3LWL A;  1S1V A;  5C42 A;  3BDP A;  1NK7 A;  1IH7 A;  4DSJ A;  3K5O A;  3HST B;  4OJR A;  1U49 A;  3V1O A;  4CEZ A;  3OYB A;  1LWE A;  5J2Q A;  1EKE A;  3SPZ A;  2O4I A;  1W9H A;  4F3O A;  1JL2 A;  4IFV A;  4CJL A;  1RCH A;  1FKO A;  2VWK A;  2YNI A;  4TSX A;  4DG1 A;  3V9Z A;  3DYA A;  3FFI A;  5SWM A;  4E1M A;  4FJJ A;  4FJX A;  5KRS A;  1N6Q A;  4B9V A;  2X6S A;  2VG6 A;  3QIO A;  4W5R A;  4G1Q A;  4CEO A;  3P1G A;  4HCC A;  4QOZ B;  4OGC A;  4YFU A;  1C1C A;  1L3T A;  3RTV A;  4KTQ A;  1QHT A;  1UAX A;  3CM6 A;  1W0H A;  1NJY A;  2OPS A;  2Z1J A;  1WSE A;  4OGE A;  2G8K A;  1WSI A;  2E6M A;  2GUI A;  1KCF A;  1LAW A;  2E6L A;  2YNH A;  3TAB A;  1A5W A;  3AVM A;  4W5O A;  4DQI A;  1GOC A;  4LD0 A;  2B6A A;  1U04 A;  3PUF A;  5KGX A;  3O3F A;  1JLB A;  3AO5 A;  4FVM A;  1LAV A;  3HXM A;  4HUF A;  3MXI A;  2OYQ A;  3PX4 A;  4DFM A;  4B9M A;  1JLQ A;  4CEQ A;  2FBY A;  4EZ9 A;  4ID1 A;  4CEE A;  3HP6 A;  1HPZ A;  4RW7 A;  4LH4 A;  4CIF A;  3VQ9 A;  3KK2 A;  3DRR A;  2XO7 A;  3LAK A;  3OS2 A;  4DTN A;  2PY5 A;  3HVT A;  1RIL A;  4KI4 A;  3CM5 A;  1WSF A;  2D0C A;  3U3G A;  4CGF A;  4CJF A;  1ZBF A;  1TKD A;  2Z1H A;  1IG9 A;  2HHS A;  1RT1 A;  3C6T A;  1TAQ A;  1J54 A;  4DS5 A;  3QET A;  1RDC A;  1N5Y A;  3HPH A;  3JSM A;  1BIZ A;  4W5T A;  3OYE A;  2BAN A;  4JS5 A;  4B9L A;  1SL0 A;  2HHW A;  3K59 A;  1QE1 A;  4M42 A;  4OLB A;  3ISN C;  2VWJ A;  3OY9 A;  3AVF A;  3MAQ A;  2DFH A;  2X6N A;  2BDP A;  4N5S A;  5HP1 A;  3NHG A;  3LWM A;  1ZBU A;  3QLH A;  1ZYQ A;  1B92 A;  3VQD A;  4DTR A;  4FJG A;  4CFC A;  3TAN A;  3NFA A;  2FC0 A;  1SKR A;  4KB1 A;  2FBT A;  3DLH A;  3H08 A;  4CGG A;  3KIO A;  4KI6 A;  3RRG A;  3K57 A;  2W42 A;  4FLU A;  4KHW A;  3AA5 X;  4AHR A;  4K8Z A;  2QK9 A;  4E19 A;  4KO0 A;  4NCA A;  4B3O A;  1SKW A;  1NKC A;  3SQ2 A;  3LP1 A;  3TAM A;  2OPR A;  4CF8 A;  2G8I A;  3AVC A;  4DTO A;  4N56 A;  4OVL A;  3OYL A;  3V6D A;  4C8K A;  3HJF A;  3MEG A;  3K5L A;  4Y1D A;  3V9X A;  1TL1 A;  3SUN A;  4KHS A;  1LW0 A;  4M3U A;  3QNO A;  4DSF A;  3RMA A;  3HL8 A;  3WNG A;  1BI4 A;  2Z1I A;  1BL3 A;  1WSH A;  3OYG A;  2KFN A;  1BCO A;  2B5J A;  4CJV A;  1RNH A;  5D3G A;  3VQE A;  4AHC A;  1EP4 A;  1MU2 A;  4YNQ A;  5CY4 A;  4BAC A;  3SJJ A;  3EY1 A;  2YNG A;  2HHX A;  1HMV A;  5CZ2 A;  4CF9 A;  2OZM A;  2HNZ A;  4E1N A;  3MED A;  5K14 A;  3A2F A;  4GW6 A;  1A5X A;  3VQB A;  1SL2 A;  3MXJ A;  3L2V A;  3T3F A;  2G8W A;  1J53 A;  1WLJ A;  4M3Y A;  1O1W A;  3ZT2 A;  3NBP A;  1UWB A;  2P5O A;  4IKF A;  4M3X A;  1SKS A;  1NK5 A;  2DTU A;  4BDP A;  4CJ4 A;  3C94 A;  2BGG A;  2PYL A;  1DLO A;  1G15 A;  3TAQ A;  1NJW A;  3OJS A;  1RTD A;  4KKO A;  3TI0 A;  3F9K A;  4CJ3 A;  1BI4 B;  5KTQ A;  3AO1 A;  4E7J A;  4B9T A;  4DWI A;  2Z1G A;  4K8X A;  4O44 A;  1SV5 A;  1B9F A;  4J2E A;  1X1P A;  1NKB A;  1JLG A;  1S6Q A;  4AIL C;  3S3N A;  1UOC A;  2OPP A;  2JLE A;  4CHO A;  2A1S A;  3L2R A;  1ITG A;  1RT3 A;  4ID5 A;  2XHB A;  4I9Q A;  1EET A;  1NKE A;  1Q9X A;  3L2W A;  1RBR A;  2OPQ A;  4JRQ A;  1KFD A;  1F21 A;  2HHQ A;  1NOY A;  1DTQ A;  4E89 A;  2HB5 A;  3NE6 A;  4CK3 A;  3HYF A;  4DTS A;  1FXX A;  2WON A;  4N41 A;  5HRS A;  2YKN A;  1CXQ A;  3T1A A;  4IDK A;  3LP2 A;  1C6V A;  3ZSY A;  4HUE A;  4DLG A;  1ASU A;  3LP0 A;  3VQP A;  4KRF A;  4JLH A;  4C8M A;  5I42 A;  1YT3 A;  1LWF A;  4FLZ A;  1ZBH A;  2KQ2 A;  4HTU A;  4F2S A;  3NF6 A;  2D0B A;  5C24 A;  2D5R A;  3DLR A;  4CJQ A;  3F73 A;  3OYJ A;  4CFA A;  4JRP A;  4DQS A;  2YHB A;  2ATQ A;  3SQ4 A;  3OS1 A;  3QES A;  4E7K A;  4FW1 A;  4CEB A;  4KHY A;  2KZZ A;  2RPI A;  4RG8 A;  3SQ1 A;  2QXF A;  4FJ5 A;  1EXQ A;  1Q8I A;  3I0R A;  4FLT A;  1X9W A;  2KW4 A;  1BHL A;  1NK8 A;  2F8S A;  4E3S A;  1LWC A;  5KGW A;  3AA3 A;  2QKB A;  1RDA A;  4O55 A;  1YTA A;  4M3Z A;  4GMJ B;  4M3W A;  3G10 A;  3HPO A;  4E7I A;  1C0T A;  2I5J A;  2VG5 A;  3TAR A;  4F8R A;  3VQ7 A;  1HNI A;  4NCG A;  3V9S A;  4CE9 A;  4Q5V A;  3G0Z A;  1U48 A;  3QEV A;  1QTM A;  3KLI A;  1T7P A;  3DRS A;  3P5J A;  2Q3S A;  4CEF A;  3NDK A;  4BE1 A;  2A1R A;  3BGR A;  4Z4C A;  4AH9 A;  1KVA A;  1KSP A;  2IAJ A;  4MQ3 A;  2HHU A;  4CK2 A;  1RBS A;  1BGX T;  4FJ8 A;  1S1U A;  1NK6 A;  4J2A A;  4E0D A;  1HQU A;  3OS0 A;  4O5B A;  2IC3 A;  4B9N A;  4CF0 A;  3DOK A;  4CGI A;  2RKI A;  4I2Q A;  1KVB A;  5DMR A;  1UA1 A;  4FJM A;  4OKJ A;  1IKY A;  4CES A;  3PX0 A;  4FW2 A;  3OYD A;  1BIU A;  3S3O A;  3TR8 A;  3PY8 A;  2BE2 A;  4B9S A;  3SQ0 A;  3S3M A;  1ZBI A;  1RDB A;  3DMJ A;  3ZSX A;  4DTM A;  1VSI A;  3D45 A;  3CFR A;  1REV A;  4HHT A;  4FM2 A;  1HYZ A;  4C8N A;  1TK5 A;  3JYT A;  2ZQB A;  3VA0 A;  4OPK A;  3WNH A;  4FZY A;  1D8Y A;  4FM1 A;  3AA2 A;  3SI6 A;  1D9D A;  3VQQ A;  2NUB A;  4CHN A;  4DQR A;  1HJR A;  4CJE A;  4DF8 A;  4ZTJ A;  2G8H A;  3TAF A;  4CF1 A;  3PO4 A;  1VK0 A;  4M45 A;  4KFB A;  1TK0 A;  3O3G A;  4KHQ A;  2IOC A;  4Z0U A;  1TKX A;  4Z4H A;  2R7Y A;  3RMC A;  4CER A;  1T8E A;  5HRO A;  5HRN A;  3OYC A;  1QSL A;  3K5N A;  4IG0 A;  3LDS A;  2HND A;  1JXB A;  3V4I A;  3CFP A;  4IG3 A;  3SZ2 A;  4CJ5 A;  3L3U A;  3LZJ A;  4ICL A;  4FLX A;  2G8F A;  4IBN A;  3DRP A;  4FM0 A;  3O4N A;  4PUO A;  3MXM A;  4CJR A;  4I2P A;  3M8S A;  3B6P A;  2AJQ A;  4RW6 A;  5FDL A;  3SUP A;  3LZI A;  3KD5 E;  3AVG A;  4EP4 A;  5J2N A;  4FZX C;  5FRO A;  4FK0 A;  3OVN A;  3WNE A;  1DTT A;  1GOA A;  3NGI A;  3SPY A;  3VQ6 A;  4O4G A;  3QIN A;  5KRT A;  4DTX A;  4LSN A;  3ZT0 A;  3AVI A;  4CHY A;  4FLV A;  1RTH A;  1IKX A;  4DFJ A;  4NCB A;  1RDD A;  2X78 A;  3LAL A;  3ZSV A;  1U4B A;  4N47 A;  4DSL A;  3ZCM A;  3KK1 A;  3U6F A;  3HPG A;  1T05 A;  4CK1 A;  1KVC A;  3HP9 A;  1WAF A;  4MFB A;  3MEC A;  3SNN A;  3M8Q A;  2G8U A;  4FJN A;  4DU1 A;  1S9E A;  4KPY A;  1BCM A;  4PY5 A;  1D5A A;  4W5N A;  3AV9 A;  4FJH A;  4DSE A;  1JKH A;  1L5U A;  3HO1 A;  1A5V A;  4DU3 A;  4CEC A;  5E41 A;  3ULD A;  1HQE A;  4KAZ A;  3TAG A;  4LSL A;  2YV0 X;  2ETJ A;  3NF8 A;  3VQ8 A;  4CCH A;  2YNF A;  3M8P A;  2XY7 A;  5I3U A;  3NGY A;  5HRR A;  1ASV A;  1S9G A;  4CFD A;  1RT4 A;  3U3Y A;  3SCX A;  4FCY A;  3THV A;  4ZTF A;  1L3U A;  4L8R B;  4KHU A;  1SL1 A;  3LP3 A;  4F2R A;  3K5M A;  4BE0 A;  2YHA A;  4W5Q A;  3V9W A;  1NJZ A;  1RBU A;  2ZE2 A;  4FJL A;  4Z4G A;  4CGH A;  1CXU A;  3I0S A;  3T19 A;  1IKV A;  4CIG A;  2PYJ A;  5C25 A;  1RT2 A;  1XHX A;  3IAY A;  3LPT A;  3SUO A;  3RWU A;  5T7B A;  3AA4 A;  5HRP A;  3KJV A;  3ZT3 A;  1C0M A;  3CQ8 A;  3EZ5 A;  2P51 A;  4Y1C A;  3LAN A;  4BDZ A;  4Z4F A;  4Q0B A;  4M41 A;  4E7H A;  1C0U A;  1RT7 A;  1KTQ A;  3OYH A;  1RBV A;  4ZHR A;  2D0A A;  2GBZ A;  5HLF A;  3HT3 A;  1R0A A;  4QCL A;  2P5G A;  2QKK A;  4BWJ A;  3KLE A;  5DK5 A;  3TAE A;  1I39 A;  1UA0 A;  4RW8 A;  2B4J A;  4FJK A;  4CGJ A;  3OYN A;  3V9U A;  1TKZ A;  1HNV A;  1TV6 A;  2VG7 A;  1S6P A;  3VQA A;  3KLG A;  3KLF A;  4NYN A;  5SZT A;  4DQP A;  3IS9 A;  3QIP A;  3SV3 A;  1XC9 A;  4CJW A;  1D9F A;  3AVA A;  4FK2 A;  1HYV A;  3QNN A;  3TAP A;  4CHZ A;  3AVN A;  4FJ9 A;  1KLN A;  2HMI A;  4E7L A;  5J2M A;  3NGZ A;  3RRH A;  4NYF A;  2Y1I A;  3RR7 A;  1XWL A;  1HRH A;  3PX6 A;  1X9M A;  4RW9 A;  1U45 A;  4O0J A;  4CED A;  3AO3 A;  3AVL A;  5FRM A;  4F4K A;  2DFE A;  1BIS A;  1C1A A;  1RTJ A;  1VSK A;  2XY5 A;  3ZSW A;  3DOL A;  1VSD A;  2EX3 A;  3O4Q A;  1CZB A;  3KLH A;  3VA3 A;  4DFP A;  3QEI A;  4FJ7 A;  2E4L A;  4J2D A;  4HVJ A;  3ASM A;  1QS4 A;  3CG7 A;  5CYQ A;  1YVU A;  4CJS A;  3DLE A;  1J5O A;  4F3T A;  1VRT A;  1T03 A;  1TGO A;  3KKR A;  4ELT A;  4ELV A;  1NK9 A;  3NCI A;  1WSJ A;  2YKM A;  1JXE A;  5CZ1 A;  4CJP A;  2DFF A;  4DFK A;  1BQM A;  2XY8 A;  1BQN A;  4I9L A;  3OYA A;  2HW3 A;  4OKE A;  4KV8 A;  3V1R A;  4B08 A;  1C1B A;  2FBV A;  4CGD A;  4C8O A;  4DS4 A;  3L2Q A;  1WN7 A;  4CJK A;  2HHV A;  3NH0 A;  2ZD1 A;  3OYI A;  4B8C A;  5KI6 A;  5FRN A;  1L3S A;  4KRE A;  4HUG A;  4N76 A;  2F96 A;  2ITG A;  1L3V A;  4OPJ A;  1TKT A;  1GOB A;  4BE2 A;  1QQC A;  3DM2 A;  2X74 A;  1WSG A;  1X9S A;  2F8T A;  2KZM A;  1RT5 A;  4CFB A;  1SUQ A;  1KFS A;  3KTQ A;  1RTI A;  4OKK A;  5J1E A;  3NH2 A;  4DTJ A;  4KHN A;  4GVM A;  4KTZ A;  4FK4 A;  2OZS A;  4KTW A;  1YTU A;  3AO4 A;  2HVI A;  3ALY A;  1TL3 A;  4CHP A;  4EZ6 A;  1U47 A;  2PZS A;  1KLM A;  2JGU A;  3DI6 A;  3K58 A;  1I3A A;  3LAM A;  4ELU A;  1NK4 A;  1TK8 A;  1S1T A;  1KRP A;  1QSY A;  4Z4E A;  3VQ5 A;  2RF2 A;  3E01 A;  4BWM A;  3M8R A;  4XIU A;  4CHQ A;  4O0I A;  3OYM A;  4B9U A;  3ZT4 A;  1ASW A;  4UQG A;  4CEA A;  1VSM A;  1Z26 A;  3O3H A;  3KK3 A;  3DLG A;  2OA8 A;  3NH1 A;  3NF7 A;  4I7F A;  2DY4 A;  3OJU A;  1JL1 A;  1JLF A;  2FBX A;  3AVB A;  3D0P A;  3OYK A;  2XRI A;  4WE1 A;  3KKS A;  3V81 A;  5EU7 A;  3DLK A;  4LH5 A;  1S1X A;  4DU4 A;  1Z25 A;  3LPU A;  2KTQ A;  3P83 D;  1FK9 A;  2GV9 A;  1TVR A;  3ZSQ A;  1S1W A;  4B8A B;  3HM9 A;  4DTU A;  4C8L A;  1CZ9 A;  4LY7 A;  4CF2 A;  1NOZ A;  3L8B A;  4M3T A;  1VSL A;  1Q9Y A;  1ZBL A;  2KFZ A;  3AVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...