3V9SA

Crystal structure of rnase t in complex with a product ssdna (aac) with one mg in the active site
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 63
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9sA00
1ZBUA 3TAEA 4ICLA 5SZTA 3ZSRA 3EYZA 4B9TA 1UWBA 3DOLA 3QEVA 1DTTA 3OS1A 1ASWA 2Z1HA 3L3VA 4CIFA 2FBYA 5J2QA 4QCLA 2HVIA 3PV8A 1WN7A 2IAJA 2A1SA 1RDCA 3NF7A 3QLHA 4XIUA 3HP6A 3HT3A 1C0UA 3SV4A 4W5QA 4CESA 2XY7A 1QHTA 1KVCA 5HBMA 4CJVA 1XWLA 4BWMA 3PO5A 4DS5A 4IBNA 3VQQA 1BL3A 4FK2A 3ZSZA 1NJYA 4QOZB 3CYMA 3LAKA 3S3MA 1N5YA 2LSNA 3T1AA 3QEXA 2YHBA 4J2AA 2DFHA 1CZ9A 3LALA 2RF2A 3OYBA 3V81A 1JL1A 1HNIA 4IG3A 3NGZA 4DQQA 1XHZA 4EZ9A 1ZBFA 3DRPA 4M3ZA 3LPUA 1ASVA 4IG0A 1S5JA 4DSIA 4YNQA 4HCCA 1DLOA 1TAUA 1RT7A 1TVRA 3RTVA 3IG1A 3ITHA 3O4QA 3EY1A 2G8HA 2DFEA 4N56A 1S1UA 3K5OA 1VSLA 2GV9A 3MXIA 4AILC 2BANA 4FVMA 1QSYA 3O3GA 3DLBA 3NE6A 4CJEA 4EP5A 4CF1A 4M45A 4Z4CA 4HTUA 3HJFA 4NYFA 3AVGA 1HQUA 2RKIA 3C95A 1VSHA 3D0PA 3O4NA 4I2PA 1VSKA 2VWKA 4RG8A 4FLTA 1CXUA 2Z1GA 3TAFA 4NCAA 2ATQA 4M3TA 1BISA 5E41A 3MAQA 2EX3A 2XRIA 4FJ7A 1Q9XA 1X9MA 4NCBA 1S9GA 3AVLA 2GUIA 1FKPA 3VA0A 2X6NA 4DQIA 3NGIA 1SKWA 1HYZA 3OYLA 1LWEA 1TL3A 4R5PA 3ZT0A 3HK2A 1D5AA 1G15A 4HUFA 4KKOA 4KHSA 4B3OA 4DG1A 4AHSA 3OYJA 1ITGA 5J2NA 1EKEA 3H08A 3LZIA 1LAWA 4E1MA 4DTSA 2IC3A 5C42A 3QINA 4BDZA 3SUQA 3SPZA 1SKRA 4KHWA 3LP1A 1JLCA 1B9FA 4RW8A 1L3SA 1S1TA 3VQ5A 3DLGA 1RT1A 3M8SA 4F2SA 3QO9A 4FLXA 5J2PA 3KJVA 3RMCA 1B9DA 4CHNA 4E1NA 4F3OA 4BDYA 4DSEA 4B9VA 1KLNA 2F8SA 4KI6A 1EETA 4AHCA 1A5VA 4ZTJA 1BCOA 3ZSWA 3HVRA 3RRHA 4E7KA 1WSEA 4G1QA 2AJQA 3IRXA 2HNZA 4FCYA 4KHUA 3SYZA 3AA5X 2DY4A 4CK1A 3AA3A 1SL1A 2G8KA 3VQ9A 3E01A 4N5SA 1C1CA 3LWMA 3AVAA 3KLIA 3MEEA 4FLYA 2KZZA 1NK9A 2W42A 4Z4HA 3MECA 3AVKA 3TAQA 1LV5A 2KFNA 2D0BA 3O3FA 2QXFA 3JYTA 3OYFA 5CYQA 4KPYA 4FJGA 4OGCA 1WSGA 1RT2A 3VQPA 1LW0A 1HPZA 2HHXA 5KGWA 3RMBA 3V9UA 4DQRA 4CHQA 4JLHA 3K58A 4FXDA 1RDDA 4B9LA 2YHAA 3LDSA 1I3AA 1KFDA 3LZJA 2HHWA 4OKKA 4E7HA 4DS4A 3CM5A 3SNNA 4Z0UA 4DSLA 3V9SA 2DTUA 3TWHA 3AO5A 5KRSA 5I3UA 2HVHA 2G8FA 1ZYQA 2OA8A 3OVNA 4CJQA 4NCGA 3NAEA 4W5RA 2YNGA 2FBTA 1QSSA 1L5UA 4Z4EA 3SQ2A 2BE2A 4I7FA 3TAPA 2VWJA 1QE1A 4DU3A 1GOBA 2Q3SA 2I5JA 3SUNA 2YKMA 4OJRA 4NYNA 5HRPA 4O4GA 4DFKA 4BWJA 3SI6A 3HPHA 5DK5A 3L2QA 4ELVA 2XO7A 4FJ8A 1R0AA 2OYQA 4FJLA 3ZT4A 1RTHA 3OYDA 4FJHA 4CGFA 2GBZA 3FFIA 3LPTA 4W5OA 1NOYA 3KTQA 1RDBA 4EZ6A 3VQBA 3CFOA 1NJWA 4HCBA 3KLHA 3QETA 1QSLA 4CEAA 4CEQA 2OPPA 1VSMA 2KQ2A 4CERA 4L8RB 1CZBA 1EXQA 1KSPA 4KHNA 2IOCA 1RNHA 4WE1A 1RT3A 2D5RA 1T7PA 4C8NA 1WSFA 1WAJA 2FC0A 3AVMA 2PZSA 3L8BA 3OY9A 4M3UA 3NF8A 3QEWA 1W9HA 5FDLA 4FM1A 3AA2A 4E19A 2Y1JA 4CHYA 5KI6A 1IKXA 4H4MA 4MQ3A 4TSXA 4CEDA 1TK0A 4I9LA 2ITGA 4JRQA 4BDPA 1JKHA 4DSFA 1BGXT 1RBRA 3I0SA 3L2WA 1RILA 3F73A 3TABA 3VN5A 4Z4GA 4UQGA 3QIOA 2OZSA 4PUOA 2OPSA 4CEOA 1S6PA 4IFYA 4CEEA 3U6FA 2QKKA 1NK8A 1QS4A 1RBSA 3CQ8A 1KRPA 4O44A 2PY5A 2FBVA 4GVMA 4IDKA 4KAZA 3ZT3A 3S3OA 4KFBA 5I42A 3SV3A 2XHBA 3TAGA 3L2RA 5KTQA 4QAGA 1J53A 4E7JA 4N41A 2D0CA 3AO3A 1T03A 3SQ0A 2P5OA 1F21A 4DF8A 2Z1JA 3ISNC 3OS0A 3A2FA 4CHOA 4E0DA 4ZTFA 1NK7A 4F4KA 4Z4IA 5CYMA 4O0JA 3PO4A 3OJSA 4C8OA 2X6SA 4PA1A 2YNIA 4FLUA 2KZMA 1MU2A 3LP0A 3KIOA 1YTAA 4ELTA 4I9QA 1J9AA 5JS1A 2RPIA 1REVA 3P83D 4GW6A 4RW9A 4CJRA 3AVHA 3LP2A 3I8DA 3SZ2A 4PQUA 3IS9A 3WNFA 4B9SA 1NOZA 3VQ8A 1WLJA 1RT5A 4AHVA 3HXMA 4JS4A 4M3RA 2XY6A 3SJJA 5HRRA 4FW2A 3AVJA 3KKRA 1LAVA 4E89A 3KK2A 1HYVA 5HP1A 3RR8A 3AO2A 2P51A 4DLEA 4FM2A 4HUGA 3HL8A 2XY8A 1C6VA 4DU1A 3PX0A 3UIQA 4ZHRA 1HJRA 3V1OA 3AV9A 1JXEA 1WSJA 2B4JA 4B8CA 4O5BA 3U3GA 3AO1A 1IKYA 2B5JA 1TL1A 3NH1A 1A5XA 2PYJA 3DLHA 1YT3A 4KB0A 3V9ZA 3L3UA 4OKEA 5DMRA 3C94A 1DTQA 4CJLA 3OYGA 1L3VA 1GOAA 4FZYA 1C1AA 2E6LA 4CEBA 3IAYA 4KTQA 3K5NA 2ZD1A 5CZ2A 3MXMA 1TGOA 1X9WA 1KFSA 4J2EA 1RT6A 3PUFA 3VQEA 4B8AB 4CJKA 2R7YA 3DLEA 3V4IA 3S3NA 3V9XA 3CG7A 1UOCA 1C1BA 3OYIA 3NBPA 1SL2A 4C8LA 1SL0A 5K14A 2WONA 2VG6A 3WNHA 4N47A 3C6TA 2B6AA 1T8EA 2JGUA 4CEZA 1NKBA 4O0IA 3PY8A 4B9UA 2P1JA 2FBXA 4FM0A 1NK5A 2YNFA 1ZBLA 3QEIA 2PYLA 5JS2A 4F2RA 1BCMA 2G8UA 4KREA 5HRSA 1KLMA 4DF4A 2ETJA 1UA0A 5J2MA 5SWMA 3MEGA 1S6QA 1VSDA 3G0ZA 4ELUA 3OYCA 2KTQA 1I39A 1A5WA 1X1PA 2DFFA 3NCIA 2IDOA 3TARA 4H4OA 5HRNA 2VG7A 4CIEA 1TKDA 4KV8A 3QIPA 1LWCA 4OVLA 5FRMA 1BIZA 3CM6A 4CGDA 5FRNA 4JS5A 4LD0A 1FK9A 1RBUA 4I2QA 3ZSQA 1VSEA 4CF8A 1T05A 1K6YA 3P5JA 4FK4A 3B6OA 4FJIA 1JLAA 1VSIA 3AVFA 3SPYA 3TI0A 1XC9A 4DQSA 3VQ6A 3K5MA 4DTOA 1Q8IA 3F9KA 4FJKA 3HPOA 4LH5A 5FROA 3DLRA 3TAMA 3QNNA 2EHGA 3RR7A 4FLVA 1RTIA 1JLFA 1HNVA 4LH4A 2JLEA 4IFVA 4KHQA 1S1XA 2D0AA 4DFMA 1Y97A 5T7BA 4FLZA 3DMJA 1BIUA 3HYFA 4W5TA 1L3UA 3HPGA 3AVCA 4CHPA 4DQPA 2HHTA 2QKBA 3VQCA 1O1WA 3PX6A 2O4GA 4CK2A 4FZXC 3ZSYA 2IS3A 1J54A 3D45A 3M8QA 3HSTB 3OYAA 1NJXA 1TK8A 4CJ5A 1NKEA 2OZMA 1VK0A 2YNHA 4DFJA 4KHYA 4Q0BA 4C8KA 4DSKA 1BHLA 3T19A 1JLEA 3VQ4A 1WAFA 1RTDA 1CXQA 4FZZA 1NJZA 1L3TA 4FYDA 1RT4A 2BGGA 3KK3A 1BI4A 1HRHA 1W0HA 2E6MA 2HNDA 4KO0A 3ZSVA 1TKXA 4CFBA 1NK6A 3OYNA 3B6PA 4GMJB 5EU7A 3JSMA 1WSHA 3DYAA 4BACA 3AO4A 5HROA 3DLKA 2HHUA 4DTUA 4KB1A 4FK0A 1VRUA 4OKJA 4DTPA 4M41A 4DWIA 4F8RA 1RBTA 3KKSA 3U3YA 2G8WA 3VQDA 3SQ4A 1ZBIA 1KCFA 4CIGA 3QEPA 1JLQA 4AHTA 3DRSA 4LSLA 4BE2A 4CE9A 1RDAA 3VQAA 2NUBA 2X78A 3NGYA 2QK9A 1SV5A 2HW3A 3WNGA 4DFPA 1YTUA 4DMNA 4E7IA 1GOCA 4B08A 3VQ7A 1KVAA 1TKTA 4RW7A 3ZSOA 4CJ3A 3PX4A 2IGIA 4OGEA 4E7LA 4DTJA 3SUOA 4Y1CA 4CJSA 4CGIA 1S9EA 4FJNA 2O4IA 3ZT2A 3HO1A 2HHSA 4C8MA 4HHTA 1U04A 3SQ1A 4W5NA 1JXBA 1UAXA 2ZE2A 1HQEA 4M3YA 4K8ZA 3M8PA 4ID5A 1HMVA 1U48A 4OPKA 4FW1A 3S9HA 1J5OA 4KI4A 3OS2A 1JLBA 1RBVA 3OYEA 2OPQA 3KLFA 2HMIA 4F3TA 3NDKA 1IO2A 1TAQA 3QNOA 4FJ9A 4AH9A 3DRRA 4FLWA 3M8RA 1VSFA 2VG5A 4CCHA 3HM9A 4BE1A 4HVJA 1C0TA 3NHGA 2F8TA 1XHXA 1TV6A 4M42A 1WSIA 3NH2A 4M3XA 4LY7A 3K2PA 5C25A 4JRPA 1QTMA 3EZ5A 2YKNA 3HVTA 1ZBHA 3TANA 3RRGA 3NFAA 4CGHA 4CF2A 2G8IA 4AHRA 3V1RA 3SUPA 4CFCA 4CJWA 4IKFA 4DTNA 4E3SA 1CLQA 3RMDA 3RMAA 3AA4A 4DLGA 1UA1A 1LW2A 4MFBA 1D9DA 2YV0X 3KLEA 5D3GA 1U45A 1TKZA 1JL2A 3ALYA 4CJFA 2KFZA 4H8KA 1Z25A 3AVBA 3DI6A 1ASUA 3ZSXA 3ULDA 3CFRA 1IKVA 3DOKA 4HUEA 3O3HA 4ID1A 3V1QA 4CFDA 4DTXA 1NK0A 4CECA 4DTMA 3LWLA 1LWFA 3V6DA 4Y1DA 1U49A 3KD5E 1N6QA 4OLAA 4CGJA 1YVUA 3I0RA 3RWUA 3OYKA 5KRTA 4J2BA 4RW4A 3LANA 3P1GA 3NF9A 1JLGA 2XY5A 1EX4A 1NK4A 3MEDA 3OYMA 4O55A 4PY5A 4KTWA 4FJJA 1Z26A 5KGXA 4DSJA 3KD1E 4OPJA 2HHVA 1IKWA 4RW6A 3VA3A 2A1RA 4J2DA 1KVBA 4DTRA 4PWDA 3ASMA 1HYSA 1FXXA 4Q5VA 4CGGA 3KLGA 1WNSA 3QERA 1NKCA 4OLBA 4FJMA 4KTZA 5J1EA 4DU4A 2Y1IA 1BQMA 2RN2A 3BDPA 1QQCA 1U4BA 1IH7A 1KTQA 4CEFA 3AVIA 1D9FA 4CF0A 3MXJA 2X74A 3ZCMA 5C24A 1FKOA 4CHZA 3K57A 2ZQBA 2BDPA 4FJXA 4M3WA 2Z1IA 4LSNA 4AHUA 1D8YA 2HNYA 4CJ4A 3WNEA 4BE0A 1RTJA 3THVA 1IG9A 1B92A 4K8XA 3AVNA 2OPRA 3LP3A 1C0MA 4B9MA 3ZT1A 2E4LA 5HLFA 1XI1A 1TK5A 3T3FA 1VRTA 1S1WA 1U47A 3K5LA 1BQNA 1RCHA 3K59A 4N76A 3HP9A 2HB5A 2WOMA 4CFAA 5CZ1A 3OYHA 3L2UA 1X9SA 3OJUA 4EP4A 3BGRA 3SCXA 4CJTA 1Q9YA 3NH0A 3V9WA 2F96A 3G10A 3QESA 4Z4FA 3CFPA 4CF9A 2G8VA 1VSJA 4FJ5A 1S1VA 2P5GA 3L2VA 2HHQA 4CJUA 1BI4B 2KW4A 4CK3A 3C6UA 3DM2A 3KK1A 1EP4A 3LAMA 3NF6A 3TR8A 4CJPA 4YFUA 1SKSA 4KRFA 5CY4A 1SUQA 4B9NA
chains in the Genus database with same CATH superfamily
2AA4A 1DTTA 3OS1A 1QQNA 3DWLA 2Z1HA 4CIFA 1E4FT 4JI6K 4GNIA 1RDCA 5M1FA 4XIUA 1BA1A 4CJ7A 4JKGB 3P4IA 4FK2A 3ZSZA 2W40A 3CYMA 3S3MA 3L0QA 3QEXA 3VOVA 1CZ9A 3V81A 1HNIA 4IG3A 4EZ9A 4A2BA 2GUPA 4IG0A 4ISFA 1ZXOA 1YITN 4YNQA 3MN7A 3EY1A 2DFEA 2GV9A 3MXIA 1IJJA 4AILC 2O8EA 3NE6A 4HTUA 4BRMA 4FL9A 3HJFA 2V52B 2HBKA 1N8RO 4BR5A 3MK6A 1RFQA 2VWKA 4KBOA 3TSUA 3TAFA 4NCAA 1BISA 3MAQA 4FJ7A 2EX3A 4BC5A 3CF5L 4WYBA 1HNWK 4BROA 1X9MA 2NRZA 3AVLA 1FKPA 2ASMA 3NGIA 1LWEA 4DUYK 3WEEB 3O4WA 1KD1O 1BWFO 1D5AA 4HUFA 4KKOA 4KHSA 4DG1A 4LF4K 2P9KB 3PLAA 1EKEA 3LZIA 1S72N 4E1MA 3VENA 3EZWA 2UXCK 3CETA 2Q31A 2CH5A 2D1KA 1SKRA 3LP1A 1L3SA 3SLCA 5KQDA 4F2SA 1RT1A 4BR9A 1HNXK 5J2PA 3KJVA 3RMCA 4CHNA 4E1NA 4DSEA 1KLNA 1EETA 4AHCA 1BCOA 3BY5A 3A5NC 3D6RA 2AJQA 3IRXA 4FCYA 2F9TA 4CVNE 3AA3A 1BU6O 3BZKA 3FLCO 3VQ9A 4LF9K 4AF1A 3AVAA 1NK9A 4JKFA 5C12A 3AVKA 1LV5A 4DV3K 2KFNA 2QXFA 3IFRA 3L4QA 3AGKA 1WSGA 1LW0A 1HPZA 4CD3A 2HHHK 3QDKA 3I56N 3K58A 1OH6A 3O8MA 4C1NI 4NXNK 1KC8O 4FOIA 4OKKA 1NWKA 3AO5A 5I3UA 1VHXA 5AQQA 2G8FA 4Z4EA 2YNGA 1FW6A 5AQPA 1GOBA 4R79A 4JHDA 4NYNA 3SI6A 4DFKA 4BWJA 5DK5A 3L2QA 3HBTA 3DXKB 2QWMA 4BR0A 3FZHA 1RTHA 4CGFA 4WF9L 1GLCG 3FFIA 3KTQA 1N32K 1RDBA 4JI2K 4NB4A 4CEQA 2OPPA 4L8RB 3CCJN 3VEXA 4CD1A 5EY4A 3CIPA 3O9RA 1RT3A 4A5BA 2P9LB 1JCFA 2PZSA 3L8BA 4M3UA 3NF8A 1W9HA 2ZGZA 5FDLA 4FM1A 2Y1JA 3VTHA 2UUCK 4MQ3A 1TK0A 4I9LA 2ITGA 3MCPA 4DSFA 3THWA 3TABA 2E88A 3PSIA 4PUOA 4RTFD 3AGRA 4CEEA 3U6FA 2QKKA 3D2EB 1RBSA 3CQ8A 2PY5A 4O44A 2FBVA 5TKWA 3VF2A 3EE9A 1VQLN 2XHBA 1CZAN 1QZ6A 4CBWA 2D0CA 5JVHL 3OS0A 4Z4IA 4CHOA 4X64K 4JKDA 4O0JA 1ZBSA 3U9ZA 5AQMA 3I8BA 1XNQK 4PQUA 1NOZA 1WLJA 1LOTB 3KKRA 4E89A 5JVGL 3BUZB 4HUGA 3HL8A 4DU1A 3O08A 3BF1A 3NVMA 4B8CA 3U3GA 3AO1A 3NH1A 2PYJA 1M90O 3HOTA 3V9ZA 5DMRA 3C94A 3O9SA 4FZYA 2E6LA 4KTQA 4BRPA 4YOUA 2YJFA 3K5NA 4CZGA 1TGOA 1KFSA 1RT6A 3PUFA 3VQEA 4JKGA 4B8AB 1VQ9N 3TSQA 3LM2A 2P9IB 3NBPA 1NLVA 3ZX3A 3DJCA 2WONA 3DXMB 3EN9A 4FWRA 2B6AA 1WBBA 4GKJK 4KHPK 1V4TA 2P9UB 1S22A 4DV4K 4B1WB 4F2RA 1Q18A 1NBWA 3MWPA 2G8UA 4DF4A 1UA0A 3MEGA 3HTVA 2CGLA 5AFUH 1HX1A 1I39A 2D4WA 3EO3A 5C2FA 2VG7A 1TKDA 4KV8A 3P39A 5FRMA 1KAYA 3E9PA 5FRNA 1VSEA 4FK4A 4MLEA 4GV9A 2RHKA 3B6OA 2NNWA 3AVFA 1XC9A 3TI0A 3WXJA 4FJKA 3F9KA 2UXDK 5JICA 1VQ7N 4LH5A 3DLRA 3QNNA 2EHGA 3I55N 1YF5L 2VGNA 4FLVA 3UKUB 3WEEA 4KHQA 3THYB 2JLEA 1SQKA 2D0AA 4WQ5C 4GVEA 1I94K 4FLZA 2HHTA 2P9KA 3VQCA 1NGHA 1J54A 3OYAA 1TK8A 3CJ1A 1VK0A 2YNHA 4FWLA 4K25A 1RTDA 1CXQA 2VWBA 4BGBA 2BGGA 3ZSVA 1NK6A 5C15A 3JSMA 4JEPA 1M1KO 5HROA 4DTUA 4KB1A 2NRRA 1VRUA 5C0YA 4M41A 3H6EA 1RBTA 2WTUA 2G8WA 3W0LA 1JLQA 2ASPA 2P9SB 1RDAA 3E9OA 2NUBA 3NGYA 3WXLA 4CJ3A 5GIPA 4YOYA 3UKRA 3WXIA 3SUOA 1S9EA 4WQ5A 3ZT2A 3SQ1A 4JK7A 1JXBA 2ZE2A 4BRGA 4K8ZA 4GV6A 3W3DA 4JHDB 1J5OA 3R8EA 3D2FA 1FJGK 3HI0A 2A41A 2HBJA 2BTFA 3OBWA 2O8DB 4BRFA 2ZJQL 4K41A 3NDKA 4FJ9A 4AH9A 4MO5A 1SS6A 2VG5A 1VAZA 4HVJA 1C0TA 3J7ZO 4M42A 2QW9A 3K2PA 3VEYA 2A6AA 2YKNA 2YHXA 4B3RK 3NFAA 2NZTA 1QQMA 4CF2A 4UY8O 4IKFA 3RMDA 3MX2A 4BG8A 4MFBA 1IG8A 2I7NA 2YHWA 3MWTA 4DR5K 4H8KA 1Z25A 3AVBA 3CC4N 4HUEA 1NK0A 4DTXA 3V6DA 4Y1DA 4FVUA 1YVUA 3I0RA 4RW4A 1HLUA 1EX4A 4H03B 1N33K 5AQXA 4OPJA 1HYSA 4DTRA 2KKZA 4A61A 1NKCA 1EQYA 4KTZA 2Y1IA 3FR0A 1NJIO 4LF7K 4A5AA 5M1PA 4CF0A 4O5FA 1OH7A 2QM1A 4M3WA 2Z1IA 4AHUA 3MCAB 1IG9A 1B92A 3AVNA 3LP3A 1C0MA 4B9MA 3ZLJA 2UXBK 3T3FA 2P9IA 3GG4A 4X65K 3K59A 3HP9A 2ASOA 3MMVA 5CZ1A 3QFUA 4ILHA 4CJTA 3G10A 2E20A 1NGBA 1BUPA 4DR4K 3CFPA 2G8VA 1VSJA 2HHQA 4CJUA 1MWKA 3IUCA 1EP4A 4M63C 2O8BB 4CJPA 1VQMN 1SKSA 5CY4A 1ZBUA 1UWBA 4DV5K 4KH5A 3QEVA 3L3VA 5J2QA 4K43A 3A0IX 4FWPA 3PV8A 1WN7A 4Z94A 4JAXA 2IAJA 2A1SA 3QLHA 2QTDA 3RVCA 1QHTA 5HBMA 4CJVA 1XWLA 3CMAN 1VQ5N 4DV6K 1VQ4N 3THYA 5LMUK 1N5YA 4LFAK 5IWAK 2DFHA 3OYBA 4GKKK 1JL1A 3LDQA 3NGZA 4B3SK 3LDPA 1ZBFA 2VQFK 2PFUA 1S5JA 2IVNA 3KZBA 3PIOL 3ITHA 3IDHA 4JKHA 1YVNA 4B3MK 3N4PA 5GAEP 3UB5A 3O3GA 2V51B 4CF1A 4BG9A 2FLOA 4M45A 5FLXO 2UYTA 4Z4CA 3KK7A 3AVGA 1HQUA 2RKIA 2ZWHA 4M7YA 4WQ4C 4NLBA 5E41A 5CHIA 2DPNA 4IO9L 1Q9XA 3RSEB 3CJBA 2P9NA 4B1YB 2X6NA 4BRAA 3OYLA 2P9SA 4CZIA 2NRVA 1T6CA 4AHSA 1VQON 3UKRB 3H08A 1LAWA 4B1UB 1D4XA 4K0KK 4BRCA 4RW8A 1S1TA 1Q81O 5BN8A 4F3OA 4B9VA 1K73O 3ZSWA 2O8DA 3D2EA 3H3NO 2DY4A 3OBYA 2QWQA 5M1QA 2G8KA 1SZ2A 1YJWN 4H5VA 4BRHA 3LWMA 3KLIA 3MECA 3TAQA 3SAHA 3G6EN 4KH4A 4RCHA 3OYFA 5CYQA 4IDHA 5AQRA 1OH8A 4OGCA 1RT2A 2HHXA 5KGWA 3RMBA 4CHQA 4JLHA 4B9LA 3CMEN 3LDSA 3T1YK 2HHWA 2YJEA 4H5RA 4QS8A 5BR9A 5BRDA 3CM5A 3SNNA 4FPBA 4JI0K 3R9PA 3V9SA 2DTUA 2QWRA 5KRSA 1NGIA 2HVHA 4DV1K 3F9MA 2OA8A 3OVNA 4NCGA 3NAEA 4W5RA 1L5UA 3SQ2A 4WQ4A 1QE1A 4DU3A 2I5JA 4LFBK 4ELVA 2Q36A 4FJ8A 2VGMA 4FJLA 3P31A 4XH5A 3OA9A 4EZ6A 3DLLL 3CFOA 4O8UA 3TU5A 3KLHA 1NJWA 4XEIA 3CD6N 1C0GA 1VSMA 1CZBA 1EXQA 4KHNA 3DXMA 2A40A 2IOCA 4WE1A 5AQVA 3VF4A 1T7PA 3MDQA 1WSFA 3T69A 1YXQA 4EIAA 1VQKN 2NLXA 3QEWA 2VQEK 3AA2A 3ZEUA 2OANA 1IKXA 4JRQA 5MLCQ 3I0SA 3L2WA 2Q2RA 2OZSA 2OPSA 4CEOA 3THXA 1TYQB 1NK8A 3S3OA 4KFBA 3WXKA 5I42A 5ADXA 1J53A 2E1ZA 5IT9O 1T03A 3SQ0A 4DF8A 4E0DA 4C1NK 1XQSC 3OJSA 5CE3A 4FLUA 4H0YB 2KZMA 3LP0A 3KIOA 4I9QA 1J9AA 2RPIA 1REVA 4GW6A 5FPDA 3AVHA 3LP2A 4JI4K 3SZ2A 4B9SA 4HWIA 4JS4A 4GY2B 3HXMA 4EAHD 4FW2A 2O8BA 1HYVA 4DV7K 2P51A 4FM2A 2HF3A 3AV9A 1JXEA 3ATUA 1YT3A 4OKEA 1DTQA 4CJLA 3Q7CA 1L3VA 1LCUA 4CEBA 4NLCA 4X66K 4CZEA 4EHUA 1X9WA 3KHYA 5AZIA 3A5LC 1UOCA 3CG7A 1YHQN 3OYIA 1SL0A 2VG6A 4N47A 3C6TA 1T8EA 3SAFA 4CEZA 4O0IA 4B9UA 2P1JA 3TTFA 1NK5A 2QWOA 5EVZA 5JS2A 5AQUA 1XMQK 5AR0A 1GLBG 3LDNA 4DR7K 5HRSA 4ILGB 1VSDA 4ELUA 3JS6A 4CZFA 3OYCA 2KTQA 1A5WA 2DFFA 3SAGA 2IDOA 4BVOA 3KWGA 3QIPA 4RWTA 3QFPA 4JNEA 4CGDA 1FK9A 5GIOA 5AQGA 5M1OA 1Z6RA 1JLAA 1VSIA 3SPYA 1DGKN 3VQ6A 2NRWA 4OPHA 4M7XA 4H0OA 3J8AA 3RR7A 1NGGA 2W6KA 3CHWA 1RTIA 3BEXA 1VQ6N 1S1XA 1ATSA 4DFMA 4PL8A 1Y97A 1BIUA 3HYFA 5LY3A 2ZF5O 4W5TA 1L3UA 2QKBA 4PL7A 3ZSYA 3A5OC 3D45A 2H3GX 3M8QA 1NJXA 5AQJA 2OZMA 4DFJA 4AM6A 5JLHA 4Q0BA 4C8KA 4DSKA 2A5XA 3KK3A 1W0HA 3J7AP 4EHTA 5AQLA 5C2DA 3DYAA 3AO4A 3SJHA 4DTPA 3VGKA 3CCSN 4F8RA 3KKSA 3VQDA 5CR4A 3BP8A 4CIGA 3QEPA 3DRSA 4LSLA 4CE9A 3H3OB 4GV3A 2HW3A 3WNGA 4DMNA 3PX4A 4B08A 4JKCA 1KVAA 4RW7A 4DTJA 5BREA 4U67L 2CGJA 4FJNA 4LF5K 1GLLO 3HO1A 3CJ7A 4FWQA 4ID5A 1HMVA 4H5TA 5ADXH 4OPKA 1U48A 3MN6A 2WFBA 3TTCA 1RBVA 3OYEA 2OPQA 3KLFA 2HMIA 1IO2A 1GLAG 4G9ZA 2HMPA 4WCEL 3DRRA 1VSFA 1X9JA 5C25A 1QTMA 3EZ5A 3RRGA 3VGLA 2G8IA 5TKYA 3V1RA 4AHRA 3SUPA 2VYPA 4ISGA 4BR4A 4E3SA 3RMAA 5D3GA 1NM1A 3KLEA 1JL2A 3ALYA 4CJFA 1K8AO 3ZSXA 1ZC6A 3CFRA 1LWFA 2E1YA 1RGIA 1TUYA 2GWJA 4MLHA 4CGJA 2JWLA 3RWUA 4J2BA 3HSCA 3LANA 3P1GA 2O8FA 1EO1A 3D7EO 5E84A 4F9OA 2IIRA 1X3MA 4FJJA 1Z26A 3KD1E 2HSTA 4RW6A 4QS9A 1KVBA 4PWDA 3ID6A 4O8KA 4Q5VA 3KLGA 3H1QA 4OLBA 3NMUA 1HKBA 4DU4A 2RN2A 4CEFA 1D9FA 3MXJA 4A57A 4IOCL 3ULEA 5C24A 1FKOA 3MX5A 1K8KB 1D8YA 2E8AA 4CJ4A 3WNEA 4IO8A 4BE0A 3UE5A 1Q82O 4YOVA 4BRNA 4K8XA 1IBKK 3ZT1A 1XI1A 1TK5A 1VRTA 1U47A 3K5LA 4JI5K 4N76A 1JCEA 2WOMA 4CFAA 3OYHA 4EP4A 3BGRA 1Q9YA 3V9WA 4Z4FA 3A8YA 2QEXN 1BI4B 3C6UA 3DM2A 3LAMA 3U4LA 1U6ZA 5BN9A 4BC2A 4KRFA 3CQXA 4JI8K 3FFKB 3BZCA 3TAEA 4ICLA 3EYZA 3DOLA 1ASWA 3CC7N 3E9LA 5M1NA 1DT9A 2HVIA 2FBYA 2WC9A 1C0UA 4W5QA 2XY7A 3MN9A 3PO5A 4IBNA 3VQQA 1BL3A 1XMOK 3LAKA 2LSNA 4J8FA 3T1AA 1QZ5A 3JXUA 3LPUA 3HOSA 4X62K 3VGMA 4K42A 4DSIA 3QBWA 4HCCA 5BPLA 3RTVA 3IG1A 4N56A 1HJOA 2BANA 4EFHA 3ZX2A 2FSNA 5KPTA 4NYFA 4AQYK 2P9PB 1VSHA 1U2VB 4I2PA 4DB3A 1VSKA 4RG8A 1NG9A 4OX9K 2ATQA 1J5EK 4NCBA 1S9GA 4DQIA 2GUIA 2I7PA 2AP1A 1TL3A 4R5PA 3ZT0A 4MDAA 1G15A 4B3OA 3L4IA 2BUPA 3OYJA 5J2NA 1YUWA 2PBDA 3PSFA 2IC3A 3ZEUB 3QINA 5C42A 1WUAA 3P38A 4DR1K 3SPZA 4KHWA 2HBMA 4MDBA 4FLXA 1B9DA 1A5VA 3RRHA 3LDLA 1WSEA 4G1QA 1YIJN 3CJCA 1SL1A 4N5SA 5JMVA 4FLYA 2KZZA 4YDUC 2W42A 4Z4HA 3VPZA 3JYTA 4KPYA 1YJ9N 4FJGA 5F0XA 3DXKA 3V9UA 4I6MA 1RDDA 3E1YA 4IEEA 4H5NA 2FF6A 4DSLA 3H45C 5I9EB 3TWHA 4CJQA 1T3VA 3SMSA 1QSSA 2OTLN 1OKJA 4I7FA 3VF6A 2VWJA 5GAHP 2Q3SA 1N36K 3HPHA 4IJAA 1R0AA 4FJHA 2GBZA 1HR0K 2BH1A 4W5OA 1NOYA 3VQBA 4FO0A 4BC3A 2QWNA 3EL2A 4CERA 5BPNA 1KSPA 3OW2M 4B1ZA 4B3TK 1RNHA 3R6MA 2D5RA 3G71N 3EKUA 4C8NA 1WAJA 1QHAA 3GE1A 2UUAK 3NVKA 2E2NA 3OY9A 4E19A 4CHYA 1XC3A 2V7ZA 5KI6A 4TSXA 4CEDA 1JKHA 1RILA 4UQGA 3QIOA 1Z05A 1K8KA 1S6PA 4IFYA 3R3LA 3AARA 4BR2A 4DQ8A 4DR3K 4KAZA 4GVMA 3ZT3A 4IFEA 3ZX0A 4N41A 1F21A 3IKMA 1Q7YO 2Z1JA 3A2FA 4C23A 3FZFA 5CYMA 5LJWA 1NGDA 3O9UA 4BC4A 4C8OA 2X6SA 4PA1A 2ZGYA 2YNIA 1W7AA 1MU2A 1YTAA 4ELTA 3C7NA 3P83D 4CJRA 3I8DA 3IS9A 4DV0K 4M3TA 3VQ8A 1RT5A 4AHVA 2XY6A 4M3RA 5AQFA 3AVJA 4XH4A 4YOTA 3KK2A 5HP1A 3AO2A 4MO4A 3UIQA 3PX0A 2XY8A 1C6VA 1NMDA 2W6LA 5EX5A 5GINA 2F4VK 4ZHRA 3V1OA 3EE8A 2B5JA 1TL1A 2HOEA 4H0VB 4BVPA 1GOAA 1C1AA 2ZD1A 4CJKA 3V4IA 1C1BA 1SL2A 4IZ9A 5K14A 3WNHA 2JGUA 4BRKA 4FM0A 2YNFA 3QEIA 4ISEA 2O8CA 1BCMA 5DM7L 1W2BM 4YOXA 4KREA 1KLMA 1MDUB 5J2MA 5GADP 1QVGM 1S6QA 1O13A 1X1PA 3NCIA 3TARA 1ATNA 1LWCA 4OVLA 1BIZA 4JS5A 1RBUA 1U2VA 3ZSQA 4XH1A 1V4SA 1K6YA 2P9UA 4CZKA 4FSVA 4DQSA 4DV2K 1TUUA 1P8ZA 5FROA 3TAMA 4HTLA 4FWMA 1HNVA 4LH4A 3FZMA 1BOTO 5T7BA 4DQPA 3DMJA 3HPGA 2YI1A 4U7BA 4FWOA 3TTDA 1KAZA 2VCPA 4CK2A 2IS3A 5AQKA 1T44A 4LF8K 4CJ5A 3J81O 2A3ZA 3L6QA 4KHYA 4PKHA 3UKUA 1BHLA 3T19A 1JLEA 2NRXA 4FYDA 1RT4A 3C6AA 4KO0A 2E6MA 3CJAA 4GMJB 1WSHA 4BACA 4FK0A 3KVGA 3I33A 2O8FB 3KWIA 4DWIA 2Q1NA 5BPMA 4AHTA 3BF3A 3D2FB 1NGAA 4JKBA 3VQAA 1YTUA 4E7IA 1GOCA 4BRIA 3VQ7A 3ZSOA 3J80O 5EOYA 4PHTX 2IGIA 1NU0A 4OGEA 2GELA 3HM8A 4Y1CA 4CGIA 2O4IA 1VQPN 4JI7K 4HHTA 1U04A 1UAXA 2WBNA 1NNEA 3ULEB 3M8PA 1ATRA 4FW1A 3S9HA 4KI4A 1EWQA 2V7YA 2D0PA 5FPNA 4F3TA 2RE2A 3QNOA 4B1XB 1NGFA 3OTOK 3M8RA 3CCMN 2FF3B 4OO1J 1TV6A 2KLAA 1JCGA 1MA9B 3NH2A 4M3XA 4LY7A 4JRPA 2W41A 3HVTA 3TANA 4PKIA 4CGHA 4IEIA 4IWVA 1K9MO 3F2KA 3CCRN 4CJWA 4JK8A 1LW2A 2GWKA 1D9DA 1TKZA 3ID8A 4LFCK 4BREA 3DI6A 3ZYYX 3ULDA 3O3HA 3V1QA 2E5LK 4CECA 1U49A 3QBXA 3KD5E 1N6QA 3J7YP 5KPRA 3EKSA 2FSKA 3OYKA 4JD2B 3NF9A 3HZ6A 2XY5A 3CERA 1NK4A 1QVFM 3OYMA 4O55A 3WUHA 5KGXA 4DSJA 4ILJA 3ASMA 1E3MA 3O9TA 4CGGA 1WNSA 4FJMA 3M5RA 1HKCA 1U4BA 1IH7A 1KTQA 3K9JA 1DEJA 3ZCMA 3K57A 2ZQBA 1P90A 5BRFA 1EWRA 1NMNA 2IVPA 1IBLK 1C0FA 2F9WA 5GAGP 3AY9A 1J6ZA 1HKGA 2EWSA 4FOEA 3CCEN 3ENBA 1BQNA 4BRLA 2HB5A 3O80A 3SCXA 1X3NA 2F96A 3ATVA 3GL1A 2O8CB 3SBGA 4FJ5A 1IBMK 3L2VA 4V19S 4CK3A 5AQIA 1S3XA 4NO7A 4YFUA 3CQYA 3VEZA 3GOIA 4IXCA 3WXMB 4B9NA 5SZTA 3ZSRA 4B9TA 2YCHA 1BO5O 4QCLA 4IOXA 4KH6A 1WB9A 3NF7A 1WOQA 1WBDA 3HP6A 3HT3A 3SV4A 2ZM6K 4CESA 1KVCA 4JI1K 4BWMA 1R59O 4FPAA 4DS5A 1KQSM 5BR8K 1NJYA 4QOZB 1TYQA 5AZJA 2YHBA 4J2AA 3LALA 5LMNK 2RF2A 3QB0A 1XHZA 4DQQA 3DRPA 4M3ZA 1IV0A 1ASVA 3ZETB 3M1FA 1DLOA 1TAUA 1RT7A 1TVRA 5KQ8A 3FGUA 3H1VX 4H0XB 3O4QA 2G8HA 2ITMA 1S1UA 3K5OA 1VSLA 4FVMA 1QSYA 3DLBA 4CJEA 4EP5A 5H1SQ 3OHRA 4YY3K 3C95A 3LM9A 3D0PA 3O4NA 4JYAK 4FLTA 1CXUA 2Z1GA 2XRIA 5LJVA 1MWMA 3VA0A 5FPEA 1YJNN 1SKWA 1HYZA 3HK2A 5AQOA 3PIPL 2NRTA 3M3ZA 3SK3A 2QXLA 1ITGA 4CI6A 1GLDG 4QS7A 3ENOA 2HF4A 4DTSA 5C10A 4BDZA 3SUQA 4BRDA 1JLCA 1B9FA 3VQ5A 3DLGA 3U8XA 3M8SA 3QO9A 3LL3A 4FWNA 4NXMK 4DR6K 3FE1A 4BDYA 2F8SA 4KI6A 3WT0A 2Q97A 4ZTJA 3HVRA 4E7KA 1BA0A 2HNZA 4KHUA 3E66A 3O6WA 3SYZA 3AA5X 4CK1A 3CCQN 3E01A 3WQUA 1C1CA 3MEEA 1KAXA 3O9QA 2D0BA 3O3FA 3CPEA 3A5MC 2OTJN 3VQPA 3C7NB 4DQRA 4FXDA 2Q0RA 3CXCM 2YHAA 1I3AA 1KFDA 3LZJA 2CH6A 4E7HA 4DS4A 4JN4A 4Z0UA 2O8EB 1GLJO 3CCLN 1ZYQA 1XNRK 4LF6K 2FBTA 3TAPA 2BE2A 3SUNA 2YKMA 4OJRA 5HRPA 3O1BA 4JK9A 4O4GA 2XO7A 2OYQA 3ZT4A 3OYDA 3LPTA 4HCBA 1QSLA 3QETA 4CEAA 2KQ2A 3G25A 1GLFO 3VEWA 4BR7A 2FC0A 3AVMA 3O1WA 5F1XA 1ESVA 2E2QA 2YHYA 4OPAA 3CCUN 2JWKA 4A2AA 3VMFB 4H4MA 4BDPA 2UUBK 3CC2N 3CCVN 1BGXT 1RBRA 3F73A 4Z4GA 3VN5A 1QS4A 4CZJA 1NGEA 1KRPA 3TPQA 4IDKA 5AQHA 2CGKA 4DR2K 3SV3A 3TAGA 3L2RA 5KTQA 4QAGA 4E7JA 2F7TA 3AO3A 4JI3K 2P5OA 3ISNC 1KXPA 4ZTFA 1NK7A 4F4KA 3PO4A 1YI2N 5A2QO 1YAGA 5JS1A 3THXB 4RW9A 5AQNA 2GEMA 3SMPA 3WNFA 1QQOA 3VTIA 4E1JA 3SJJA 5AZIB 3F5TA 5HRRA 2OCEA 1LAVA 3RR8A 4DLEA 2ZJRL 2QA4N 5KPZA 1HJRA 3RSEA 1WSJA 4PKGA 3WQTA 2B4JA 2P9NB 4O5BA 4CZLA 4CZHA 3R1XA 1IKYA 3DLHA 1A5XA 4KB0A 3L3UA 3OYGA 2IVOA 3IAYA 5CZ2A 2E2OA 3MXMA 4J2EA 3CPWM 2R7YA 3S3NA 3DLEA 3V9XA 4L3QA 3G4SN 1HPMA 4C8LA 5AZJB 4YORA 2D0OA 2FSJA 3K9KA 3M6GA 1NKBA 1GLEG 3PY8A 2FBXA 3VETA 1ZBLA 2PYLA 1OVYA 4DCHA 5E26A 2PAVA 4IOAL 2ETJA 5BRHA 5SWMA 4WFNL 3G0ZA 4H4OA 5HRNA 4CIEA 1G99A 3LDOA 3T1HK 1VQ8N 3CM6A 4LD0A 3T7ZA 4CF8A 4I2QA 1T05A 3P5JA 2A42A 4DKWA 4FJIA 3K5MA 4DTOA 1Q8IA 4DUZK 3HPOA 3B8AX 5ELZA 4BQZA 1E4GT 3QICA 1JLFA 3TSPA 5AQSA 4IFVA 4CZMA 1HNZK 5AQZA 4YDUA 3AVCA 2QI2A 4CHPA 5DM6L 5M1KA 1O1WA 3PX6A 2O4GA 4FZXC 2QWLA 3HSTB 1NKEA 5B8HA 2HBLA 3C6HA 3N4QA 1RDWX 2FXUA 1RDUA 2YX6A 1WAFA 3VQ4A 4FZZA 1NJZA 1L3TA 4IJNA 1NGCA 4FWSA 1BI4A 1HRHA 2HNDA 4CFBA 4BRQA 3JAMO 1TKXA 1JJ2M 3OYNA 3B6PA 5EU7A 4B1VA 3DLKA 4JD2A 2HHUA 4OKJA 1OH5A 4AM7A 3ENHA 1ZBIA 3U3YA 3SQ4A 1KCFA 3VESA 4BE2A 2X78A 4CW7B 1Y64A 2QK9A 1SV5A 2KHOA 4DFPA 1TKTA 1Q86O 3CI5A 3SBTA 4CBUA 3GBTA 3VERA 4E7LA 4CJSA 4YOWA 1SAZA 5AQYA 2HHSA 4H0PA 4C8MA 5FPMA 4W5NA 1HUXA 1HQEA 4M3YA 4YHHK 5LL6Z 1ILYA 5AFUA 3AAPA 3OS2A 1JLBA 2Q0UA 5AQWA 2ZJPL 1VQNN 4JKEA 4FWKA 2WUSA 1TAQA 1H1VA 2E2PA 4LC9B 4BY9C 4FLWA 2GTDA 4CCHA 3HM9A 4BE1A 3NHGA 2F8TA 1NGJA 1XHXA 1WSIA 2P9PA 1ZBHA 4A62A 4CFCA 5JLFA 3GDQA 1DKGD 4DTNA 3K0SA 1CLQA 3AA4A 4DLGA 1UA1A 2YV0X 2KFZA 1U45A 1N34K 1ASUA 1IKVA 3DOKA 3FZKA 4ID1A 2QWPA 4CFDA 4Y0WA 4DTMA 3LWLA 2GX9A 3Q7BA 4OLAA 3HRGA 3CJ9A 5KRTA 3O5BA 1JLGA 5EXWA 3MN5A 1XUPO 3MEDA 4PY5A 3VEOA 4JKAA 4KTWA 2HHVA 1IKWA 3VA3A 2A1RA 4J2DA 4WFBL 5AJ3K 1FXXA 3EEQA 3QERA 2P9LA 5J1EA 1BG3A 1BQMA 3BDPA 3ZETA 1QQCA 3IMXA 3AVIA 3DAWA 2UU9K 3AAQA 2X74A 3THWB 4CBXA 4B9QA 4CHZA 2BDPA 4BGAA 4FJXA 4LSNA 2HNYA 4H0TB 4I6MB 1RTJA 3FZLA 3THVA 5AQTA 5HL7L 2J4RA 2OPRA 3S41A 2E4LA 3H46O 4BQLA 5HLFA 3U9DA 1BDGA 1S1WA 4A59A 1OVQA 1RCHA 3QMLA 1X9SA 3L2UA 3OJUA 5F2RA 4JV5K 3NH0A 3VEVA 4H5WA 3QESA 3C65A 4CF9A 1S1VA 2P5GA 4WFAL 2KW4A 3KK1A 1T6DA 3NF6A 4DHYA 2NRHA 3TR8A 5HOOA 3C0BA 1SUQA 1W97L
chains in the Genus database with same CATH topology
1ZBUA 3TAEA 4ICLA 5SZTA 3ZSRA 3EYZA 4B9TA 1UWBA 3DOLA 3QEVA 1DTTA 3OS1A 1ASWA 2Z1HA 3L3VA 4CIFA 2FBYA 5J2QA 4QCLA 2HVIA 3PV8A 1WN7A 2IAJA 2A1SA 1RDCA 3NF7A 3QLHA 4XIUA 3HP6A 3HT3A 1C0UA 3SV4A 4W5QA 4CESA 2XY7A 1QHTA 1KVCA 5HBMA 4CJVA 1XWLA 4BWMA 3PO5A 4DS5A 4IBNA 3VQQA 1BL3A 4FK2A 3ZSZA 1NJYA 4QOZB 3CYMA 3LAKA 3S3MA 1N5YA 2LSNA 3T1AA 3QEXA 2YHBA 4J2AA 2DFHA 1CZ9A 3LALA 2RF2A 3OYBA 3V81A 1JL1A 1HNIA 4IG3A 3NGZA 4DQQA 1XHZA 4EZ9A 1ZBFA 3DRPA 4M3ZA 3LPUA 1ASVA 4IG0A 1S5JA 4DSIA 4YNQA 4HCCA 1DLOA 1TAUA 1RT7A 1TVRA 3RTVA 3IG1A 3ITHA 3O4QA 3EY1A 2G8HA 2DFEA 4N56A 1S1UA 3K5OA 1VSLA 2GV9A 3MXIA 4AILC 2BANA 4FVMA 1QSYA 3O3GA 3DLBA 3NE6A 4CJEA 4EP5A 4CF1A 4M45A 4Z4CA 4HTUA 3HJFA 4NYFA 3AVGA 1HQUA 2RKIA 3C95A 1VSHA 3D0PA 3O4NA 4I2PA 1VSKA 2VWKA 4RG8A 4FLTA 1CXUA 2Z1GA 3TAFA 4NCAA 2ATQA 4M3TA 1BISA 5E41A 3MAQA 2EX3A 2XRIA 4FJ7A 1Q9XA 1X9MA 4NCBA 1S9GA 3AVLA 2GUIA 1FKPA 3VA0A 2X6NA 4DQIA 3NGIA 1SKWA 1HYZA 3OYLA 1LWEA 1TL3A 4R5PA 3ZT0A 3HK2A 1D5AA 1G15A 4HUFA 4KKOA 4KHSA 4B3OA 4DG1A 4AHSA 3OYJA 1ITGA 5J2NA 1EKEA 3H08A 3LZIA 1LAWA 4E1MA 4DTSA 2IC3A 5C42A 3QINA 4BDZA 3SUQA 3SPZA 1SKRA 4KHWA 3LP1A 1JLCA 1B9FA 4RW8A 1L3SA 1S1TA 3VQ5A 3DLGA 1RT1A 3M8SA 4F2SA 3QO9A 4FLXA 5J2PA 3KJVA 3RMCA 1B9DA 4CHNA 4E1NA 4F3OA 4BDYA 4DSEA 4B9VA 1KLNA 2F8SA 4KI6A 1EETA 4AHCA 1A5VA 4ZTJA 1BCOA 3ZSWA 3HVRA 3RRHA 4E7KA 1WSEA 4G1QA 2AJQA 3IRXA 2HNZA 4FCYA 4KHUA 3SYZA 3AA5X 2DY4A 4CK1A 3AA3A 1SL1A 2G8KA 3VQ9A 3E01A 4N5SA 1C1CA 3LWMA 3AVAA 3KLIA 3MEEA 4FLYA 2KZZA 1NK9A 2W42A 4Z4HA 3MECA 3AVKA 3TAQA 1LV5A 2KFNA 2D0BA 3O3FA 2QXFA 3JYTA 3OYFA 5CYQA 4KPYA 4FJGA 4OGCA 1WSGA 1RT2A 3VQPA 1LW0A 1HPZA 2HHXA 5KGWA 3RMBA 3V9UA 4DQRA 4CHQA 4JLHA 3K58A 4FXDA 1RDDA 4B9LA 2YHAA 3LDSA 1I3AA 1KFDA 3LZJA 2HHWA 4OKKA 4E7HA 4DS4A 3CM5A 3SNNA 4Z0UA 4DSLA 3V9SA 2DTUA 3TWHA 3AO5A 5KRSA 5I3UA 2HVHA 2G8FA 1ZYQA 2OA8A 3OVNA 4CJQA 4NCGA 3NAEA 4W5RA 2YNGA 2FBTA 1QSSA 1L5UA 4Z4EA 3SQ2A 2BE2A 4I7FA 3TAPA 2VWJA 1QE1A 4DU3A 1GOBA 2Q3SA 2I5JA 3SUNA 2YKMA 4OJRA 4NYNA 5HRPA 4O4GA 4DFKA 4BWJA 3SI6A 3HPHA 5DK5A 3L2QA 4ELVA 2XO7A 4FJ8A 1R0AA 2OYQA 4FJLA 3ZT4A 1RTHA 3OYDA 4FJHA 4CGFA 2GBZA 3FFIA 3LPTA 4W5OA 1NOYA 3KTQA 1RDBA 4EZ6A 3VQBA 3CFOA 1NJWA 4HCBA 3KLHA 3QETA 1QSLA 4CEAA 4CEQA 2OPPA 1VSMA 2KQ2A 4CERA 4L8RB 1CZBA 1EXQA 1KSPA 4KHNA 2IOCA 1RNHA 4WE1A 1RT3A 2D5RA 1T7PA 4C8NA 1WSFA 1WAJA 2FC0A 3AVMA 2PZSA 3L8BA 3OY9A 4M3UA 3NF8A 3QEWA 1W9HA 5FDLA 4FM1A 3AA2A 4E19A 2Y1JA 4CHYA 5KI6A 1IKXA 4H4MA 4MQ3A 4TSXA 4CEDA 1TK0A 4I9LA 2ITGA 4JRQA 4BDPA 1JKHA 4DSFA 1BGXT 1RBRA 3I0SA 3L2WA 1RILA 3F73A 3TABA 3VN5A 4Z4GA 4UQGA 3QIOA 2OZSA 4PUOA 2OPSA 4CEOA 1S6PA 4IFYA 4CEEA 3U6FA 2QKKA 1NK8A 1QS4A 1RBSA 3CQ8A 1KRPA 4O44A 2PY5A 2FBVA 4GVMA 4IDKA 4KAZA 3ZT3A 3S3OA 4KFBA 5I42A 3SV3A 2XHBA 3TAGA 3L2RA 5KTQA 4QAGA 1J53A 4E7JA 4N41A 2D0CA 3AO3A 1T03A 3SQ0A 2P5OA 1F21A 4DF8A 2Z1JA 3ISNC 3OS0A 3A2FA 4CHOA 4E0DA 4ZTFA 1NK7A 4F4KA 4Z4IA 5CYMA 4O0JA 3PO4A 3OJSA 4C8OA 2X6SA 4PA1A 2YNIA 4FLUA 2KZMA 1MU2A 3LP0A 3KIOA 1YTAA 4ELTA 4I9QA 1J9AA 5JS1A 2RPIA 1REVA 3P83D 4GW6A 4RW9A 4CJRA 3AVHA 3LP2A 3I8DA 3SZ2A 4PQUA 3IS9A 3WNFA 4B9SA 1NOZA 3VQ8A 1WLJA 1RT5A 4AHVA 3HXMA 4JS4A 4M3RA 2XY6A 3SJJA 5HRRA 4FW2A 3AVJA 3KKRA 1LAVA 4E89A 3KK2A 1HYVA 5HP1A 3RR8A 3AO2A 2P51A 4DLEA 4FM2A 4HUGA 3HL8A 2XY8A 1C6VA 4DU1A 3PX0A 3UIQA 4ZHRA 1HJRA 3V1OA 3AV9A 1JXEA 1WSJA 2B4JA 4B8CA 4O5BA 3U3GA 3AO1A 1IKYA 2B5JA 1TL1A 3NH1A 1A5XA 2PYJA 3DLHA 1YT3A 4KB0A 3V9ZA 3L3UA 4OKEA 5DMRA 3C94A 1DTQA 4CJLA 3OYGA 1L3VA 1GOAA 4FZYA 1C1AA 2E6LA 4CEBA 3IAYA 4KTQA 3K5NA 2ZD1A 5CZ2A 3MXMA 1TGOA 1X9WA 1KFSA 4J2EA 1RT6A 3PUFA 3VQEA 4B8AB 4CJKA 2R7YA 3DLEA 3V4IA 3S3NA 3V9XA 3CG7A 1UOCA 1C1BA 3OYIA 3NBPA 1SL2A 4C8LA 1SL0A 5K14A 2WONA 2VG6A 3WNHA 4N47A 3C6TA 2B6AA 1T8EA 2JGUA 4CEZA 1NKBA 4O0IA 3PY8A 4B9UA 2P1JA 2FBXA 4FM0A 1NK5A 2YNFA 1ZBLA 3QEIA 2PYLA 5JS2A 4F2RA 1BCMA 2G8UA 4KREA 5HRSA 1KLMA 4DF4A 2ETJA 1UA0A 5J2MA 5SWMA 3MEGA 1S6QA 1VSDA 3G0ZA 4ELUA 3OYCA 2KTQA 1I39A 1A5WA 1X1PA 2DFFA 3NCIA 2IDOA 3TARA 4H4OA 5HRNA 2VG7A 4CIEA 1TKDA 4KV8A 3QIPA 1LWCA 4OVLA 5FRMA 1BIZA 3CM6A 4CGDA 5FRNA 4JS5A 4LD0A 1FK9A 1RBUA 4I2QA 3ZSQA 1VSEA 4CF8A 1T05A 1K6YA 3P5JA 4FK4A 3B6OA 4FJIA 1JLAA 1VSIA 3AVFA 3SPYA 3TI0A 1XC9A 4DQSA 3VQ6A 3K5MA 4DTOA 1Q8IA 3F9KA 4FJKA 3HPOA 4LH5A 5FROA 3DLRA 3TAMA 3QNNA 2EHGA 3RR7A 4FLVA 1RTIA 1JLFA 1HNVA 4LH4A 2JLEA 4IFVA 4KHQA 1S1XA 2D0AA 4DFMA 1Y97A 5T7BA 4FLZA 3DMJA 1BIUA 3HYFA 4W5TA 1L3UA 3HPGA 3AVCA 4CHPA 4DQPA 2HHTA 2QKBA 3VQCA 1O1WA 3PX6A 2O4GA 4CK2A 4FZXC 3ZSYA 2IS3A 1J54A 3D45A 3M8QA 3HSTB 3OYAA 1NJXA 1TK8A 4CJ5A 1NKEA 2OZMA 1VK0A 2YNHA 4DFJA 4KHYA 4Q0BA 4C8KA 4DSKA 1BHLA 3T19A 1JLEA 3VQ4A 1WAFA 1RTDA 1CXQA 4FZZA 1NJZA 1L3TA 4FYDA 1RT4A 2BGGA 3KK3A 1BI4A 1HRHA 1W0HA 2E6MA 2HNDA 4KO0A 3ZSVA 1TKXA 4CFBA 1NK6A 3OYNA 3B6PA 4GMJB 5EU7A 3JSMA 1WSHA 3DYAA 4BACA 3AO4A 5HROA 3DLKA 2HHUA 4DTUA 4KB1A 4FK0A 1VRUA 4OKJA 4DTPA 4M41A 4DWIA 4F8RA 1RBTA 3KKSA 3U3YA 2G8WA 3VQDA 3SQ4A 1ZBIA 1KCFA 4CIGA 3QEPA 1JLQA 4AHTA 3DRSA 4LSLA 4BE2A 4CE9A 1RDAA 3VQAA 2NUBA 2X78A 3NGYA 2QK9A 1SV5A 2HW3A 3WNGA 4DFPA 1YTUA 4DMNA 4E7IA 1GOCA 4B08A 3VQ7A 1KVAA 1TKTA 4RW7A 3ZSOA 4CJ3A 3PX4A 2IGIA 4OGEA 4E7LA 4DTJA 3SUOA 4Y1CA 4CJSA 4CGIA 1S9EA 4FJNA 2O4IA 3ZT2A 3HO1A 2HHSA 4C8MA 4HHTA 1U04A 3SQ1A 4W5NA 1JXBA 1UAXA 2ZE2A 1HQEA 4M3YA 4K8ZA 3M8PA 4ID5A 1HMVA 1U48A 4OPKA 4FW1A 3S9HA 1J5OA 4KI4A 3OS2A 1JLBA 1RBVA 3OYEA 2OPQA 3KLFA 2HMIA 4F3TA 3NDKA 1IO2A 1TAQA 3QNOA 4FJ9A 4AH9A 3DRRA 4FLWA 3M8RA 1VSFA 2VG5A 4CCHA 3HM9A 4BE1A 4HVJA 1C0TA 3NHGA 2F8TA 1XHXA 1TV6A 4M42A 1WSIA 3NH2A 4M3XA 4LY7A 3K2PA 5C25A 4JRPA 1QTMA 3EZ5A 2YKNA 3HVTA 1ZBHA 3TANA 3RRGA 3NFAA 4CGHA 4CF2A 2G8IA 4AHRA 3V1RA 3SUPA 4CFCA 4CJWA 4IKFA 4DTNA 4E3SA 1CLQA 3RMDA 3RMAA 3AA4A 4DLGA 1UA1A 1LW2A 4MFBA 1D9DA 2YV0X 3KLEA 5D3GA 1U45A 1TKZA 1JL2A 3ALYA 4CJFA 2KFZA 4H8KA 1Z25A 3AVBA 3DI6A 1ASUA 3ZSXA 3ULDA 3CFRA 1IKVA 3DOKA 4HUEA 3O3HA 4ID1A 3V1QA 4CFDA 4DTXA 1NK0A 4CECA 4DTMA 3LWLA 1LWFA 3V6DA 4Y1DA 1U49A 3KD5E 1N6QA 4OLAA 4CGJA 1YVUA 3I0RA 3RWUA 3OYKA 5KRTA 4J2BA 4RW4A 3LANA 3P1GA 3NF9A 1JLGA 2XY5A 1EX4A 1NK4A 3MEDA 3OYMA 4O55A 4PY5A 4KTWA 4FJJA 1Z26A 5KGXA 4DSJA 3KD1E 4OPJA 2HHVA 1IKWA 4RW6A 3VA3A 2A1RA 4J2DA 1KVBA 4DTRA 4PWDA 3ASMA 1HYSA 1FXXA 4Q5VA 4CGGA 3KLGA 1WNSA 3QERA 1NKCA 4OLBA 4FJMA 4KTZA 5J1EA 4DU4A 2Y1IA 1BQMA 2RN2A 3BDPA 1QQCA 1U4BA 1IH7A 1KTQA 4CEFA 3AVIA 1D9FA 4CF0A 3MXJA 2X74A 3ZCMA 5C24A 1FKOA 4CHZA 3K57A 2ZQBA 2BDPA 4FJXA 4M3WA 2Z1IA 4LSNA 4AHUA 1D8YA 2HNYA 4CJ4A 3WNEA 4BE0A 1RTJA 3THVA 1IG9A 1B92A 4K8XA 3AVNA 2OPRA 3LP3A 1C0MA 4B9MA 3ZT1A 2E4LA 5HLFA 1XI1A 1TK5A 3T3FA 1VRTA 1S1WA 1U47A 3K5LA 1BQNA 1RCHA 3K59A 4N76A 3HP9A 2HB5A 2WOMA 4CFAA 5CZ1A 3OYHA 3L2UA 1X9SA 3OJUA 4EP4A 3BGRA 3SCXA 4CJTA 1Q9YA 3NH0A 3V9WA 2F96A 3G10A 3QESA 4Z4FA 3CFPA 4CF9A 2G8VA 1VSJA 4FJ5A 1S1VA 2P5GA 3L2VA 2HHQA 4CJUA 1BI4B 2KW4A 4CK3A 3C6UA 3DM2A 3KK1A 1EP4A 3LAMA 3NF6A 3TR8A 4CJPA 4YFUA 1SKSA 4KRFA 5CY4A 1SUQA 4B9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBU A;  3TAE A;  4ICL A;  5SZT A;  3ZSR A;  3EYZ A;  4B9T A;  1UWB A;  3DOL A;  3QEV A;  1DTT A;  3OS1 A;  1ASW A;  2Z1H A;  3L3V A;  4CIF A;  2FBY A;  5J2Q A;  4QCL A;  2HVI A;  3PV8 A;  1WN7 A;  2IAJ A;  2A1S A;  1RDC A;  3NF7 A;  3QLH A;  4XIU A;  3HP6 A;  3HT3 A;  1C0U A;  3SV4 A;  4W5Q A;  4CES A;  2XY7 A;  1QHT A;  1KVC A;  5HBM A;  4CJV A;  1XWL A;  4BWM A;  3PO5 A;  4DS5 A;  4IBN A;  3VQQ A;  1BL3 A;  4FK2 A;  3ZSZ A;  1NJY A;  4QOZ B;  3CYM A;  3LAK A;  3S3M A;  1N5Y A;  2LSN A;  3T1A A;  3QEX A;  2YHB A;  4J2A A;  2DFH A;  1CZ9 A;  3LAL A;  2RF2 A;  3OYB A;  3V81 A;  1JL1 A;  1HNI A;  4IG3 A;  3NGZ A;  4DQQ A;  1XHZ A;  4EZ9 A;  1ZBF A;  3DRP A;  4M3Z A;  3LPU A;  1ASV A;  4IG0 A;  1S5J A;  4DSI A;  4YNQ A;  4HCC A;  1DLO A;  1TAU A;  1RT7 A;  1TVR A;  3RTV A;  3IG1 A;  3ITH A;  3O4Q A;  3EY1 A;  2G8H A;  2DFE A;  4N56 A;  1S1U A;  3K5O A;  1VSL A;  2GV9 A;  3MXI A;  4AIL C;  2BAN A;  4FVM A;  1QSY A;  3O3G A;  3DLB A;  3NE6 A;  4CJE A;  4EP5 A;  4CF1 A;  4M45 A;  4Z4C A;  4HTU A;  3HJF A;  4NYF A;  3AVG A;  1HQU A;  2RKI A;  3C95 A;  1VSH A;  3D0P A;  3O4N A;  4I2P A;  1VSK A;  2VWK A;  4RG8 A;  4FLT A;  1CXU A;  2Z1G A;  3TAF A;  4NCA A;  2ATQ A;  4M3T A;  1BIS A;  5E41 A;  3MAQ A;  2EX3 A;  2XRI A;  4FJ7 A;  1Q9X A;  1X9M A;  4NCB A;  1S9G A;  3AVL A;  2GUI A;  1FKP A;  3VA0 A;  2X6N A;  4DQI A;  3NGI A;  1SKW A;  1HYZ A;  3OYL A;  1LWE A;  1TL3 A;  4R5P A;  3ZT0 A;  3HK2 A;  1D5A A;  1G15 A;  4HUF A;  4KKO A;  4KHS A;  4B3O A;  4DG1 A;  4AHS A;  3OYJ A;  1ITG A;  5J2N A;  1EKE A;  3H08 A;  3LZI A;  1LAW A;  4E1M A;  4DTS A;  2IC3 A;  5C42 A;  3QIN A;  4BDZ A;  3SUQ A;  3SPZ A;  1SKR A;  4KHW A;  3LP1 A;  1JLC A;  1B9F A;  4RW8 A;  1L3S A;  1S1T A;  3VQ5 A;  3DLG A;  1RT1 A;  3M8S A;  4F2S A;  3QO9 A;  4FLX A;  5J2P A;  3KJV A;  3RMC A;  1B9D A;  4CHN A;  4E1N A;  4F3O A;  4BDY A;  4DSE A;  4B9V A;  1KLN A;  2F8S A;  4KI6 A;  1EET A;  4AHC A;  1A5V A;  4ZTJ A;  1BCO A;  3ZSW A;  3HVR A;  3RRH A;  4E7K A;  1WSE A;  4G1Q A;  2AJQ A;  3IRX A;  2HNZ A;  4FCY A;  4KHU A;  3SYZ A;  3AA5 X;  2DY4 A;  4CK1 A;  3AA3 A;  1SL1 A;  2G8K A;  3VQ9 A;  3E01 A;  4N5S A;  1C1C A;  3LWM A;  3AVA A;  3KLI A;  3MEE A;  4FLY A;  2KZZ A;  1NK9 A;  2W42 A;  4Z4H A;  3MEC A;  3AVK A;  3TAQ A;  1LV5 A;  2KFN A;  2D0B A;  3O3F A;  2QXF A;  3JYT A;  3OYF A;  5CYQ A;  4KPY A;  4FJG A;  4OGC A;  1WSG A;  1RT2 A;  3VQP A;  1LW0 A;  1HPZ A;  2HHX A;  5KGW A;  3RMB A;  3V9U A;  4DQR A;  4CHQ A;  4JLH A;  3K58 A;  4FXD A;  1RDD A;  4B9L A;  2YHA A;  3LDS A;  1I3A A;  1KFD A;  3LZJ A;  2HHW A;  4OKK A;  4E7H A;  4DS4 A;  3CM5 A;  3SNN A;  4Z0U A;  4DSL A;  3V9S A;  2DTU A;  3TWH A;  3AO5 A;  5KRS A;  5I3U A;  2HVH A;  2G8F A;  1ZYQ A;  2OA8 A;  3OVN A;  4CJQ A;  4NCG A;  3NAE A;  4W5R A;  2YNG A;  2FBT A;  1QSS A;  1L5U A;  4Z4E A;  3SQ2 A;  2BE2 A;  4I7F A;  3TAP A;  2VWJ A;  1QE1 A;  4DU3 A;  1GOB A;  2Q3S A;  2I5J A;  3SUN A;  2YKM A;  4OJR A;  4NYN A;  5HRP A;  4O4G A;  4DFK A;  4BWJ A;  3SI6 A;  3HPH A;  5DK5 A;  3L2Q A;  4ELV A;  2XO7 A;  4FJ8 A;  1R0A A;  2OYQ A;  4FJL A;  3ZT4 A;  1RTH A;  3OYD A;  4FJH A;  4CGF A;  2GBZ A;  3FFI A;  3LPT A;  4W5O A;  1NOY A;  3KTQ A;  1RDB A;  4EZ6 A;  3VQB A;  3CFO A;  1NJW A;  4HCB A;  3KLH A;  3QET A;  1QSL A;  4CEA A;  4CEQ A;  2OPP A;  1VSM A;  2KQ2 A;  4CER A;  4L8R B;  1CZB A;  1EXQ A;  1KSP A;  4KHN A;  2IOC A;  1RNH A;  4WE1 A;  1RT3 A;  2D5R A;  1T7P A;  4C8N A;  1WSF A;  1WAJ A;  2FC0 A;  3AVM A;  2PZS A;  3L8B A;  3OY9 A;  4M3U A;  3NF8 A;  3QEW A;  1W9H A;  5FDL A;  4FM1 A;  3AA2 A;  4E19 A;  2Y1J A;  4CHY A;  5KI6 A;  1IKX A;  4H4M A;  4MQ3 A;  4TSX A;  4CED A;  1TK0 A;  4I9L A;  2ITG A;  4JRQ A;  4BDP A;  1JKH A;  4DSF A;  1BGX T;  1RBR A;  3I0S A;  3L2W A;  1RIL A;  3F73 A;  3TAB A;  3VN5 A;  4Z4G A;  4UQG A;  3QIO A;  2OZS A;  4PUO A;  2OPS A;  4CEO A;  1S6P A;  4IFY A;  4CEE A;  3U6F A;  2QKK A;  1NK8 A;  1QS4 A;  1RBS A;  3CQ8 A;  1KRP A;  4O44 A;  2PY5 A;  2FBV A;  4GVM A;  4IDK A;  4KAZ A;  3ZT3 A;  3S3O A;  4KFB A;  5I42 A;  3SV3 A;  2XHB A;  3TAG A;  3L2R A;  5KTQ A;  4QAG A;  1J53 A;  4E7J A;  4N41 A;  2D0C A;  3AO3 A;  1T03 A;  3SQ0 A;  2P5O A;  1F21 A;  4DF8 A;  2Z1J A;  3ISN C;  3OS0 A;  3A2F A;  4CHO A;  4E0D A;  4ZTF A;  1NK7 A;  4F4K A;  4Z4I A;  5CYM A;  4O0J A;  3PO4 A;  3OJS A;  4C8O A;  2X6S A;  4PA1 A;  2YNI A;  4FLU A;  2KZM A;  1MU2 A;  3LP0 A;  3KIO A;  1YTA A;  4ELT A;  4I9Q A;  1J9A A;  5JS1 A;  2RPI A;  1REV A;  3P83 D;  4GW6 A;  4RW9 A;  4CJR A;  3AVH A;  3LP2 A;  3I8D A;  3SZ2 A;  4PQU A;  3IS9 A;  3WNF A;  4B9S A;  1NOZ A;  3VQ8 A;  1WLJ A;  1RT5 A;  4AHV A;  3HXM A;  4JS4 A;  4M3R A;  2XY6 A;  3SJJ A;  5HRR A;  4FW2 A;  3AVJ A;  3KKR A;  1LAV A;  4E89 A;  3KK2 A;  1HYV A;  5HP1 A;  3RR8 A;  3AO2 A;  2P51 A;  4DLE A;  4FM2 A;  4HUG A;  3HL8 A;  2XY8 A;  1C6V A;  4DU1 A;  3PX0 A;  3UIQ A;  4ZHR A;  1HJR A;  3V1O A;  3AV9 A;  1JXE A;  1WSJ A;  2B4J A;  4B8C A;  4O5B A;  3U3G A;  3AO1 A;  1IKY A;  2B5J A;  1TL1 A;  3NH1 A;  1A5X A;  2PYJ A;  3DLH A;  1YT3 A;  4KB0 A;  3V9Z A;  3L3U A;  4OKE A;  5DMR A;  3C94 A;  1DTQ A;  4CJL A;  3OYG A;  1L3V A;  1GOA A;  4FZY A;  1C1A A;  2E6L A;  4CEB A;  3IAY A;  4KTQ A;  3K5N A;  2ZD1 A;  5CZ2 A;  3MXM A;  1TGO A;  1X9W A;  1KFS A;  4J2E A;  1RT6 A;  3PUF A;  3VQE A;  4B8A B;  4CJK A;  2R7Y A;  3DLE A;  3V4I A;  3S3N A;  3V9X A;  3CG7 A;  1UOC A;  1C1B A;  3OYI A;  3NBP A;  1SL2 A;  4C8L A;  1SL0 A;  5K14 A;  2WON A;  2VG6 A;  3WNH A;  4N47 A;  3C6T A;  2B6A A;  1T8E A;  2JGU A;  4CEZ A;  1NKB A;  4O0I A;  3PY8 A;  4B9U A;  2P1J A;  2FBX A;  4FM0 A;  1NK5 A;  2YNF A;  1ZBL A;  3QEI A;  2PYL A;  5JS2 A;  4F2R A;  1BCM A;  2G8U A;  4KRE A;  5HRS A;  1KLM A;  4DF4 A;  2ETJ A;  1UA0 A;  5J2M A;  5SWM A;  3MEG A;  1S6Q A;  1VSD A;  3G0Z A;  4ELU A;  3OYC A;  2KTQ A;  1I39 A;  1A5W A;  1X1P A;  2DFF A;  3NCI A;  2IDO A;  3TAR A;  4H4O A;  5HRN A;  2VG7 A;  4CIE A;  1TKD A;  4KV8 A;  3QIP A;  1LWC A;  4OVL A;  5FRM A;  1BIZ A;  3CM6 A;  4CGD A;  5FRN A;  4JS5 A;  4LD0 A;  1FK9 A;  1RBU A;  4I2Q A;  3ZSQ A;  1VSE A;  4CF8 A;  1T05 A;  1K6Y A;  3P5J A;  4FK4 A;  3B6O A;  4FJI A;  1JLA A;  1VSI A;  3AVF A;  3SPY A;  3TI0 A;  1XC9 A;  4DQS A;  3VQ6 A;  3K5M A;  4DTO A;  1Q8I A;  3F9K A;  4FJK A;  3HPO A;  4LH5 A;  5FRO A;  3DLR A;  3TAM A;  3QNN A;  2EHG A;  3RR7 A;  4FLV A;  1RTI A;  1JLF A;  1HNV A;  4LH4 A;  2JLE A;  4IFV A;  4KHQ A;  1S1X A;  2D0A A;  4DFM A;  1Y97 A;  5T7B A;  4FLZ A;  3DMJ A;  1BIU A;  3HYF A;  4W5T A;  1L3U A;  3HPG A;  3AVC A;  4CHP A;  4DQP A;  2HHT A;  2QKB A;  3VQC A;  1O1W A;  3PX6 A;  2O4G A;  4CK2 A;  4FZX C;  3ZSY A;  2IS3 A;  1J54 A;  3D45 A;  3M8Q A;  3HST B;  3OYA A;  1NJX A;  1TK8 A;  4CJ5 A;  1NKE A;  2OZM A;  1VK0 A;  2YNH A;  4DFJ A;  4KHY A;  4Q0B A;  4C8K A;  4DSK A;  1BHL A;  3T19 A;  1JLE A;  3VQ4 A;  1WAF A;  1RTD A;  1CXQ A;  4FZZ A;  1NJZ A;  1L3T A;  4FYD A;  1RT4 A;  2BGG A;  3KK3 A;  1BI4 A;  1HRH A;  1W0H A;  2E6M A;  2HND A;  4KO0 A;  3ZSV A;  1TKX A;  4CFB A;  1NK6 A;  3OYN A;  3B6P A;  4GMJ B;  5EU7 A;  3JSM A;  1WSH A;  3DYA A;  4BAC A;  3AO4 A;  5HRO A;  3DLK A;  2HHU A;  4DTU A;  4KB1 A;  4FK0 A;  1VRU A;  4OKJ A;  4DTP A;  4M41 A;  4DWI A;  4F8R A;  1RBT A;  3KKS A;  3U3Y A;  2G8W A;  3VQD A;  3SQ4 A;  1ZBI A;  1KCF A;  4CIG A;  3QEP A;  1JLQ A;  4AHT A;  3DRS A;  4LSL A;  4BE2 A;  4CE9 A;  1RDA A;  3VQA A;  2NUB A;  2X78 A;  3NGY A;  2QK9 A;  1SV5 A;  2HW3 A;  3WNG A;  4DFP A;  1YTU A;  4DMN A;  4E7I A;  1GOC A;  4B08 A;  3VQ7 A;  1KVA A;  1TKT A;  4RW7 A;  3ZSO A;  4CJ3 A;  3PX4 A;  2IGI A;  4OGE A;  4E7L A;  4DTJ A;  3SUO A;  4Y1C A;  4CJS A;  4CGI A;  1S9E A;  4FJN A;  2O4I A;  3ZT2 A;  3HO1 A;  2HHS A;  4C8M A;  4HHT A;  1U04 A;  3SQ1 A;  4W5N A;  1JXB A;  1UAX A;  2ZE2 A;  1HQE A;  4M3Y A;  4K8Z A;  3M8P A;  4ID5 A;  1HMV A;  1U48 A;  4OPK A;  4FW1 A;  3S9H A;  1J5O A;  4KI4 A;  3OS2 A;  1JLB A;  1RBV A;  3OYE A;  2OPQ A;  3KLF A;  2HMI A;  4F3T A;  3NDK A;  1IO2 A;  1TAQ A;  3QNO A;  4FJ9 A;  4AH9 A;  3DRR A;  4FLW A;  3M8R A;  1VSF A;  2VG5 A;  4CCH A;  3HM9 A;  4BE1 A;  4HVJ A;  1C0T A;  3NHG A;  2F8T A;  1XHX A;  1TV6 A;  4M42 A;  1WSI A;  3NH2 A;  4M3X A;  4LY7 A;  3K2P A;  5C25 A;  4JRP A;  1QTM A;  3EZ5 A;  2YKN A;  3HVT A;  1ZBH A;  3TAN A;  3RRG A;  3NFA A;  4CGH A;  4CF2 A;  2G8I A;  4AHR A;  3V1R A;  3SUP A;  4CFC A;  4CJW A;  4IKF A;  4DTN A;  4E3S A;  1CLQ A;  3RMD A;  3RMA A;  3AA4 A;  4DLG A;  1UA1 A;  1LW2 A;  4MFB A;  1D9D A;  2YV0 X;  3KLE A;  5D3G A;  1U45 A;  1TKZ A;  1JL2 A;  3ALY A;  4CJF A;  2KFZ A;  4H8K A;  1Z25 A;  3AVB A;  3DI6 A;  1ASU A;  3ZSX A;  3ULD A;  3CFR A;  1IKV A;  3DOK A;  4HUE A;  3O3H A;  4ID1 A;  3V1Q A;  4CFD A;  4DTX A;  1NK0 A;  4CEC A;  4DTM A;  3LWL A;  1LWF A;  3V6D A;  4Y1D A;  1U49 A;  3KD5 E;  1N6Q A;  4OLA A;  4CGJ A;  1YVU A;  3I0R A;  3RWU A;  3OYK A;  5KRT A;  4J2B A;  4RW4 A;  3LAN A;  3P1G A;  3NF9 A;  1JLG A;  2XY5 A;  1EX4 A;  1NK4 A;  3MED A;  3OYM A;  4O55 A;  4PY5 A;  4KTW A;  4FJJ A;  1Z26 A;  5KGX A;  4DSJ A;  3KD1 E;  4OPJ A;  2HHV A;  1IKW A;  4RW6 A;  3VA3 A;  2A1R A;  4J2D A;  1KVB A;  4DTR A;  4PWD A;  3ASM A;  1HYS A;  1FXX A;  4Q5V A;  4CGG A;  3KLG A;  1WNS A;  3QER A;  1NKC A;  4OLB A;  4FJM A;  4KTZ A;  5J1E A;  4DU4 A;  2Y1I A;  1BQM A;  2RN2 A;  3BDP A;  1QQC A;  1U4B A;  1IH7 A;  1KTQ A;  4CEF A;  3AVI A;  1D9F A;  4CF0 A;  3MXJ A;  2X74 A;  3ZCM A;  5C24 A;  1FKO A;  4CHZ A;  3K57 A;  2ZQB A;  2BDP A;  4FJX A;  4M3W A;  2Z1I A;  4LSN A;  4AHU A;  1D8Y A;  2HNY A;  4CJ4 A;  3WNE A;  4BE0 A;  1RTJ A;  3THV A;  1IG9 A;  1B92 A;  4K8X A;  3AVN A;  2OPR A;  3LP3 A;  1C0M A;  4B9M A;  3ZT1 A;  2E4L A;  5HLF A;  1XI1 A;  1TK5 A;  3T3F A;  1VRT A;  1S1W A;  1U47 A;  3K5L A;  1BQN A;  1RCH A;  3K59 A;  4N76 A;  3HP9 A;  2HB5 A;  2WOM A;  4CFA A;  5CZ1 A;  3OYH A;  3L2U A;  1X9S A;  3OJU A;  4EP4 A;  3BGR A;  3SCX A;  4CJT A;  1Q9Y A;  3NH0 A;  3V9W A;  2F96 A;  3G10 A;  3QES A;  4Z4F A;  3CFP A;  4CF9 A;  2G8V A;  1VSJ A;  4FJ5 A;  1S1V A;  2P5G A;  3L2V A;  2HHQ A;  4CJU A;  1BI4 B;  2KW4 A;  4CK3 A;  3C6U A;  3DM2 A;  3KK1 A;  1EP4 A;  3LAM A;  3NF6 A;  3TR8 A;  4CJP A;  4YFU A;  1SKS A;  4KRF A;  5CY4 A;  1SUQ A;  4B9N A; 
#chains in the Genus database with same CATH topology
 2AA4 A;  1DTT A;  3OS1 A;  1QQN A;  3DWL A;  2Z1H A;  4CIF A;  1E4F T;  4JI6 K;  4GNI A;  1RDC A;  5M1F A;  4XIU A;  1BA1 A;  4CJ7 A;  4JKG B;  3P4I A;  4FK2 A;  3ZSZ A;  2W40 A;  3CYM A;  3S3M A;  3L0Q A;  3QEX A;  3VOV A;  1CZ9 A;  3V81 A;  1HNI A;  4IG3 A;  4EZ9 A;  4A2B A;  2GUP A;  4IG0 A;  4ISF A;  1ZXO A;  1YIT N;  4YNQ A;  3MN7 A;  3EY1 A;  2DFE A;  2GV9 A;  3MXI A;  1IJJ A;  4AIL C;  2O8E A;  3NE6 A;  4HTU A;  4BRM A;  4FL9 A;  3HJF A;  2V52 B;  2HBK A;  1N8R O;  4BR5 A;  3MK6 A;  1RFQ A;  2VWK A;  4KBO A;  3TSU A;  3TAF A;  4NCA A;  1BIS A;  3MAQ A;  4FJ7 A;  2EX3 A;  4BC5 A;  3CF5 L;  4WYB A;  1HNW K;  4BRO A;  1X9M A;  2NRZ A;  3AVL A;  1FKP A;  2ASM A;  3NGI A;  1LWE A;  4DUY K;  3WEE B;  3O4W A;  1KD1 O;  1BWF O;  1D5A A;  4HUF A;  4KKO A;  4KHS A;  4DG1 A;  4LF4 K;  2P9K B;  3PLA A;  1EKE A;  3LZI A;  1S72 N;  4E1M A;  3VEN A;  3EZW A;  2UXC K;  3CET A;  2Q31 A;  2CH5 A;  2D1K A;  1SKR A;  3LP1 A;  1L3S A;  3SLC A;  5KQD A;  4F2S A;  1RT1 A;  4BR9 A;  1HNX K;  5J2P A;  3KJV A;  3RMC A;  4CHN A;  4E1N A;  4DSE A;  1KLN A;  1EET A;  4AHC A;  1BCO A;  3BY5 A;  3A5N C;  3D6R A;  2AJQ A;  3IRX A;  4FCY A;  2F9T A;  4CVN E;  3AA3 A;  1BU6 O;  3BZK A;  3FLC O;  3VQ9 A;  4LF9 K;  4AF1 A;  3AVA A;  1NK9 A;  4JKF A;  5C12 A;  3AVK A;  1LV5 A;  4DV3 K;  2KFN A;  2QXF A;  3IFR A;  3L4Q A;  3AGK A;  1WSG A;  1LW0 A;  1HPZ A;  4CD3 A;  2HHH K;  3QDK A;  3I56 N;  3K58 A;  1OH6 A;  3O8M A;  4C1N I;  4NXN K;  1KC8 O;  4FOI A;  4OKK A;  1NWK A;  3AO5 A;  5I3U A;  1VHX A;  5AQQ A;  2G8F A;  4Z4E A;  2YNG A;  1FW6 A;  5AQP A;  1GOB A;  4R79 A;  4JHD A;  4NYN A;  3SI6 A;  4DFK A;  4BWJ A;  5DK5 A;  3L2Q A;  3HBT A;  3DXK B;  2QWM A;  4BR0 A;  3FZH A;  1RTH A;  4CGF A;  4WF9 L;  1GLC G;  3FFI A;  3KTQ A;  1N32 K;  1RDB A;  4JI2 K;  4NB4 A;  4CEQ A;  2OPP A;  4L8R B;  3CCJ N;  3VEX A;  4CD1 A;  5EY4 A;  3CIP A;  3O9R A;  1RT3 A;  4A5B A;  2P9L B;  1JCF A;  2PZS A;  3L8B A;  4M3U A;  3NF8 A;  1W9H A;  2ZGZ A;  5FDL A;  4FM1 A;  2Y1J A;  3VTH A;  2UUC K;  4MQ3 A;  1TK0 A;  4I9L A;  2ITG A;  3MCP A;  4DSF A;  3THW A;  3TAB A;  2E88 A;  3PSI A;  4PUO A;  4RTF D;  3AGR A;  4CEE A;  3U6F A;  2QKK A;  3D2E B;  1RBS A;  3CQ8 A;  2PY5 A;  4O44 A;  2FBV A;  5TKW A;  3VF2 A;  3EE9 A;  1VQL N;  2XHB A;  1CZA N;  1QZ6 A;  4CBW A;  2D0C A;  5JVH L;  3OS0 A;  4Z4I A;  4CHO A;  4X64 K;  4JKD A;  4O0J A;  1ZBS A;  3U9Z A;  5AQM A;  3I8B A;  1XNQ K;  4PQU A;  1NOZ A;  1WLJ A;  1LOT B;  3KKR A;  4E89 A;  5JVG L;  3BUZ B;  4HUG A;  3HL8 A;  4DU1 A;  3O08 A;  3BF1 A;  3NVM A;  4B8C A;  3U3G A;  3AO1 A;  3NH1 A;  2PYJ A;  1M90 O;  3HOT A;  3V9Z A;  5DMR A;  3C94 A;  3O9S A;  4FZY A;  2E6L A;  4KTQ A;  4BRP A;  4YOU A;  2YJF A;  3K5N A;  4CZG A;  1TGO A;  1KFS A;  1RT6 A;  3PUF A;  3VQE A;  4JKG A;  4B8A B;  1VQ9 N;  3TSQ A;  3LM2 A;  2P9I B;  3NBP A;  1NLV A;  3ZX3 A;  3DJC A;  2WON A;  3DXM B;  3EN9 A;  4FWR A;  2B6A A;  1WBB A;  4GKJ K;  4KHP K;  1V4T A;  2P9U B;  1S22 A;  4DV4 K;  4B1W B;  4F2R A;  1Q18 A;  1NBW A;  3MWP A;  2G8U A;  4DF4 A;  1UA0 A;  3MEG A;  3HTV A;  2CGL A;  5AFU H;  1HX1 A;  1I39 A;  2D4W A;  3EO3 A;  5C2F A;  2VG7 A;  1TKD A;  4KV8 A;  3P39 A;  5FRM A;  1KAY A;  3E9P A;  5FRN A;  1VSE A;  4FK4 A;  4MLE A;  4GV9 A;  2RHK A;  3B6O A;  2NNW A;  3AVF A;  1XC9 A;  3TI0 A;  3WXJ A;  4FJK A;  3F9K A;  2UXD K;  5JIC A;  1VQ7 N;  4LH5 A;  3DLR A;  3QNN A;  2EHG A;  3I55 N;  1YF5 L;  2VGN A;  4FLV A;  3UKU B;  3WEE A;  4KHQ A;  3THY B;  2JLE A;  1SQK A;  2D0A A;  4WQ5 C;  4GVE A;  1I94 K;  4FLZ A;  2HHT A;  2P9K A;  3VQC A;  1NGH A;  1J54 A;  3OYA A;  1TK8 A;  3CJ1 A;  1VK0 A;  2YNH A;  4FWL A;  4K25 A;  1RTD A;  1CXQ A;  2VWB A;  4BGB A;  2BGG A;  3ZSV A;  1NK6 A;  5C15 A;  3JSM A;  4JEP A;  1M1K O;  5HRO A;  4DTU A;  4KB1 A;  2NRR A;  1VRU A;  5C0Y A;  4M41 A;  3H6E A;  1RBT A;  2WTU A;  2G8W A;  3W0L A;  1JLQ A;  2ASP A;  2P9S B;  1RDA A;  3E9O A;  2NUB A;  3NGY A;  3WXL A;  4CJ3 A;  5GIP A;  4YOY A;  3UKR A;  3WXI A;  3SUO A;  1S9E A;  4WQ5 A;  3ZT2 A;  3SQ1 A;  4JK7 A;  1JXB A;  2ZE2 A;  4BRG A;  4K8Z A;  4GV6 A;  3W3D A;  4JHD B;  1J5O A;  3R8E A;  3D2F A;  1FJG K;  3HI0 A;  2A41 A;  2HBJ A;  2BTF A;  3OBW A;  2O8D B;  4BRF A;  2ZJQ L;  4K41 A;  3NDK A;  4FJ9 A;  4AH9 A;  4MO5 A;  1SS6 A;  2VG5 A;  1VAZ A;  4HVJ A;  1C0T A;  3J7Z O;  4M42 A;  2QW9 A;  3K2P A;  3VEY A;  2A6A A;  2YKN A;  2YHX A;  4B3R K;  3NFA A;  2NZT A;  1QQM A;  4CF2 A;  4UY8 O;  4IKF A;  3RMD A;  3MX2 A;  4BG8 A;  4MFB A;  1IG8 A;  2I7N A;  2YHW A;  3MWT A;  4DR5 K;  4H8K A;  1Z25 A;  3AVB A;  3CC4 N;  4HUE A;  1NK0 A;  4DTX A;  3V6D A;  4Y1D A;  4FVU A;  1YVU A;  3I0R A;  4RW4 A;  1HLU A;  1EX4 A;  4H03 B;  1N33 K;  5AQX A;  4OPJ A;  1HYS A;  4DTR A;  2KKZ A;  4A61 A;  1NKC A;  1EQY A;  4KTZ A;  2Y1I A;  3FR0 A;  1NJI O;  4LF7 K;  4A5A A;  5M1P A;  4CF0 A;  4O5F A;  1OH7 A;  2QM1 A;  4M3W A;  2Z1I A;  4AHU A;  3MCA B;  1IG9 A;  1B92 A;  3AVN A;  3LP3 A;  1C0M A;  4B9M A;  3ZLJ A;  2UXB K;  3T3F A;  2P9I A;  3GG4 A;  4X65 K;  3K59 A;  3HP9 A;  2ASO A;  3MMV A;  5CZ1 A;  3QFU A;  4ILH A;  4CJT A;  3G10 A;  2E20 A;  1NGB A;  1BUP A;  4DR4 K;  3CFP A;  2G8V A;  1VSJ A;  2HHQ A;  4CJU A;  1MWK A;  3IUC A;  1EP4 A;  4M63 C;  2O8B B;  4CJP A;  1VQM N;  1SKS A;  5CY4 A;  1ZBU A;  1UWB A;  4DV5 K;  4KH5 A;  3QEV A;  3L3V A;  5J2Q A;  4K43 A;  3A0I X;  4FWP A;  3PV8 A;  1WN7 A;  4Z94 A;  4JAX A;  2IAJ A;  2A1S A;  3QLH A;  2QTD A;  3RVC A;  1QHT A;  5HBM A;  4CJV A;  1XWL A;  3CMA N;  1VQ5 N;  4DV6 K;  1VQ4 N;  3THY A;  5LMU K;  1N5Y A;  4LFA K;  5IWA K;  2DFH A;  3OYB A;  4GKK K;  1JL1 A;  3LDQ A;  3NGZ A;  4B3S K;  3LDP A;  1ZBF A;  2VQF K;  2PFU A;  1S5J A;  2IVN A;  3KZB A;  3PIO L;  3ITH A;  3IDH A;  4JKH A;  1YVN A;  4B3M K;  3N4P A;  5GAE P;  3UB5 A;  3O3G A;  2V51 B;  4CF1 A;  4BG9 A;  2FLO A;  4M45 A;  5FLX O;  2UYT A;  4Z4C A;  3KK7 A;  3AVG A;  1HQU A;  2RKI A;  2ZWH A;  4M7Y A;  4WQ4 C;  4NLB A;  5E41 A;  5CHI A;  2DPN A;  4IO9 L;  1Q9X A;  3RSE B;  3CJB A;  2P9N A;  4B1Y B;  2X6N A;  4BRA A;  3OYL A;  2P9S A;  4CZI A;  2NRV A;  1T6C A;  4AHS A;  1VQO N;  3UKR B;  3H08 A;  1LAW A;  4B1U B;  1D4X A;  4K0K K;  4BRC A;  4RW8 A;  1S1T A;  1Q81 O;  5BN8 A;  4F3O A;  4B9V A;  1K73 O;  3ZSW A;  2O8D A;  3D2E A;  3H3N O;  2DY4 A;  3OBY A;  2QWQ A;  5M1Q A;  2G8K A;  1SZ2 A;  1YJW N;  4H5V A;  4BRH A;  3LWM A;  3KLI A;  3MEC A;  3TAQ A;  3SAH A;  3G6E N;  4KH4 A;  4RCH A;  3OYF A;  5CYQ A;  4IDH A;  5AQR A;  1OH8 A;  4OGC A;  1RT2 A;  2HHX A;  5KGW A;  3RMB A;  4CHQ A;  4JLH A;  4B9L A;  3CME N;  3LDS A;  3T1Y K;  2HHW A;  2YJE A;  4H5R A;  4QS8 A;  5BR9 A;  5BRD A;  3CM5 A;  3SNN A;  4FPB A;  4JI0 K;  3R9P A;  3V9S A;  2DTU A;  2QWR A;  5KRS A;  1NGI A;  2HVH A;  4DV1 K;  3F9M A;  2OA8 A;  3OVN A;  4NCG A;  3NAE A;  4W5R A;  1L5U A;  3SQ2 A;  4WQ4 A;  1QE1 A;  4DU3 A;  2I5J A;  4LFB K;  4ELV A;  2Q36 A;  4FJ8 A;  2VGM A;  4FJL A;  3P31 A;  4XH5 A;  3OA9 A;  4EZ6 A;  3DLL L;  3CFO A;  4O8U A;  3TU5 A;  3KLH A;  1NJW A;  4XEI A;  3CD6 N;  1C0G A;  1VSM A;  1CZB A;  1EXQ A;  4KHN A;  3DXM A;  2A40 A;  2IOC A;  4WE1 A;  5AQV A;  3VF4 A;  1T7P A;  3MDQ A;  1WSF A;  3T69 A;  1YXQ A;  4EIA A;  1VQK N;  2NLX A;  3QEW A;  2VQE K;  3AA2 A;  3ZEU A;  2OAN A;  1IKX A;  4JRQ A;  5MLC Q;  3I0S A;  3L2W A;  2Q2R A;  2OZS A;  2OPS A;  4CEO A;  3THX A;  1TYQ B;  1NK8 A;  3S3O A;  4KFB A;  3WXK A;  5I42 A;  5ADX A;  1J53 A;  2E1Z A;  5IT9 O;  1T03 A;  3SQ0 A;  4DF8 A;  4E0D A;  4C1N K;  1XQS C;  3OJS A;  5CE3 A;  4FLU A;  4H0Y B;  2KZM A;  3LP0 A;  3KIO A;  4I9Q A;  1J9A A;  2RPI A;  1REV A;  4GW6 A;  5FPD A;  3AVH A;  3LP2 A;  4JI4 K;  3SZ2 A;  4B9S A;  4HWI A;  4JS4 A;  4GY2 B;  3HXM A;  4EAH D;  4FW2 A;  2O8B A;  1HYV A;  4DV7 K;  2P51 A;  4FM2 A;  2HF3 A;  3AV9 A;  1JXE A;  3ATU A;  1YT3 A;  4OKE A;  1DTQ A;  4CJL A;  3Q7C A;  1L3V A;  1LCU A;  4CEB A;  4NLC A;  4X66 K;  4CZE A;  4EHU A;  1X9W A;  3KHY A;  5AZI A;  3A5L C;  1UOC A;  3CG7 A;  1YHQ N;  3OYI A;  1SL0 A;  2VG6 A;  4N47 A;  3C6T A;  1T8E A;  3SAF A;  4CEZ A;  4O0I A;  4B9U A;  2P1J A;  3TTF A;  1NK5 A;  2QWO A;  5EVZ A;  5JS2 A;  5AQU A;  1XMQ K;  5AR0 A;  1GLB G;  3LDN A;  4DR7 K;  5HRS A;  4ILG B;  1VSD A;  4ELU A;  3JS6 A;  4CZF A;  3OYC A;  2KTQ A;  1A5W A;  2DFF A;  3SAG A;  2IDO A;  4BVO A;  3KWG A;  3QIP A;  4RWT A;  3QFP A;  4JNE A;  4CGD A;  1FK9 A;  5GIO A;  5AQG A;  5M1O A;  1Z6R A;  1JLA A;  1VSI A;  3SPY A;  1DGK N;  3VQ6 A;  2NRW A;  4OPH A;  4M7X A;  4H0O A;  3J8A A;  3RR7 A;  1NGG A;  2W6K A;  3CHW A;  1RTI A;  3BEX A;  1VQ6 N;  1S1X A;  1ATS A;  4DFM A;  4PL8 A;  1Y97 A;  1BIU A;  3HYF A;  5LY3 A;  2ZF5 O;  4W5T A;  1L3U A;  2QKB A;  4PL7 A;  3ZSY A;  3A5O C;  3D45 A;  2H3G X;  3M8Q A;  1NJX A;  5AQJ A;  2OZM A;  4DFJ A;  4AM6 A;  5JLH A;  4Q0B A;  4C8K A;  4DSK A;  2A5X A;  3KK3 A;  1W0H A;  3J7A P;  4EHT A;  5AQL A;  5C2D A;  3DYA A;  3AO4 A;  3SJH A;  4DTP A;  3VGK A;  3CCS N;  4F8R A;  3KKS A;  3VQD A;  5CR4 A;  3BP8 A;  4CIG A;  3QEP A;  3DRS A;  4LSL A;  4CE9 A;  3H3O B;  4GV3 A;  2HW3 A;  3WNG A;  4DMN A;  3PX4 A;  4B08 A;  4JKC A;  1KVA A;  4RW7 A;  4DTJ A;  5BRE A;  4U67 L;  2CGJ A;  4FJN A;  4LF5 K;  1GLL O;  3HO1 A;  3CJ7 A;  4FWQ A;  4ID5 A;  1HMV A;  4H5T A;  5ADX H;  4OPK A;  1U48 A;  3MN6 A;  2WFB A;  3TTC A;  1RBV A;  3OYE A;  2OPQ A;  3KLF A;  2HMI A;  1IO2 A;  1GLA G;  4G9Z A;  2HMP A;  4WCE L;  3DRR A;  1VSF A;  1X9J A;  5C25 A;  1QTM A;  3EZ5 A;  3RRG A;  3VGL A;  2G8I A;  5TKY A;  3V1R A;  4AHR A;  3SUP A;  2VYP A;  4ISG A;  4BR4 A;  4E3S A;  3RMA A;  5D3G A;  1NM1 A;  3KLE A;  1JL2 A;  3ALY A;  4CJF A;  1K8A O;  3ZSX A;  1ZC6 A;  3CFR A;  1LWF A;  2E1Y A;  1RGI A;  1TUY A;  2GWJ A;  4MLH A;  4CGJ A;  2JWL A;  3RWU A;  4J2B A;  3HSC A;  3LAN A;  3P1G A;  2O8F A;  1EO1 A;  3D7E O;  5E84 A;  4F9O A;  2IIR A;  1X3M A;  4FJJ A;  1Z26 A;  3KD1 E;  2HST A;  4RW6 A;  4QS9 A;  1KVB A;  4PWD A;  3ID6 A;  4O8K A;  4Q5V A;  3KLG A;  3H1Q A;  4OLB A;  3NMU A;  1HKB A;  4DU4 A;  2RN2 A;  4CEF A;  1D9F A;  3MXJ A;  4A57 A;  4IOC L;  3ULE A;  5C24 A;  1FKO A;  3MX5 A;  1K8K B;  1D8Y A;  2E8A A;  4CJ4 A;  3WNE A;  4IO8 A;  4BE0 A;  3UE5 A;  1Q82 O;  4YOV A;  4BRN A;  4K8X A;  1IBK K;  3ZT1 A;  1XI1 A;  1TK5 A;  1VRT A;  1U47 A;  3K5L A;  4JI5 K;  4N76 A;  1JCE A;  2WOM A;  4CFA A;  3OYH A;  4EP4 A;  3BGR A;  1Q9Y A;  3V9W A;  4Z4F A;  3A8Y A;  2QEX N;  1BI4 B;  3C6U A;  3DM2 A;  3LAM A;  3U4L A;  1U6Z A;  5BN9 A;  4BC2 A;  4KRF A;  3CQX A;  4JI8 K;  3FFK B;  3BZC A;  3TAE A;  4ICL A;  3EYZ A;  3DOL A;  1ASW A;  3CC7 N;  3E9L A;  5M1N A;  1DT9 A;  2HVI A;  2FBY A;  2WC9 A;  1C0U A;  4W5Q A;  2XY7 A;  3MN9 A;  3PO5 A;  4IBN A;  3VQQ A;  1BL3 A;  1XMO K;  3LAK A;  2LSN A;  4J8F A;  3T1A A;  1QZ5 A;  3JXU A;  3LPU A;  3HOS A;  4X62 K;  3VGM A;  4K42 A;  4DSI A;  3QBW A;  4HCC A;  5BPL A;  3RTV A;  3IG1 A;  4N56 A;  1HJO A;  2BAN A;  4EFH A;  3ZX2 A;  2FSN A;  5KPT A;  4NYF A;  4AQY K;  2P9P B;  1VSH A;  1U2V B;  4I2P A;  4DB3 A;  1VSK A;  4RG8 A;  1NG9 A;  4OX9 K;  2ATQ A;  1J5E K;  4NCB A;  1S9G A;  4DQI A;  2GUI A;  2I7P A;  2AP1 A;  1TL3 A;  4R5P A;  3ZT0 A;  4MDA A;  1G15 A;  4B3O A;  3L4I A;  2BUP A;  3OYJ A;  5J2N A;  1YUW A;  2PBD A;  3PSF A;  2IC3 A;  3ZEU B;  3QIN A;  5C42 A;  1WUA A;  3P38 A;  4DR1 K;  3SPZ A;  4KHW A;  2HBM A;  4MDB A;  4FLX A;  1B9D A;  1A5V A;  3RRH A;  3LDL A;  1WSE A;  4G1Q A;  1YIJ N;  3CJC A;  1SL1 A;  4N5S A;  5JMV A;  4FLY A;  2KZZ A;  4YDU C;  2W42 A;  4Z4H A;  3VPZ A;  3JYT A;  4KPY A;  1YJ9 N;  4FJG A;  5F0X A;  3DXK A;  3V9U A;  4I6M A;  1RDD A;  3E1Y A;  4IEE A;  4H5N A;  2FF6 A;  4DSL A;  3H45 C;  5I9E B;  3TWH A;  4CJQ A;  1T3V A;  3SMS A;  1QSS A;  2OTL N;  1OKJ A;  4I7F A;  3VF6 A;  2VWJ A;  5GAH P;  2Q3S A;  1N36 K;  3HPH A;  4IJA A;  1R0A A;  4FJH A;  2GBZ A;  1HR0 K;  2BH1 A;  4W5O A;  1NOY A;  3VQB A;  4FO0 A;  4BC3 A;  2QWN A;  3EL2 A;  4CER A;  5BPN A;  1KSP A;  3OW2 M;  4B1Z A;  4B3T K;  1RNH A;  3R6M A;  2D5R A;  3G71 N;  3EKU A;  4C8N A;  1WAJ A;  1QHA A;  3GE1 A;  2UUA K;  3NVK A;  2E2N A;  3OY9 A;  4E19 A;  4CHY A;  1XC3 A;  2V7Z A;  5KI6 A;  4TSX A;  4CED A;  1JKH A;  1RIL A;  4UQG A;  3QIO A;  1Z05 A;  1K8K A;  1S6P A;  4IFY A;  3R3L A;  3AAR A;  4BR2 A;  4DQ8 A;  4DR3 K;  4KAZ A;  4GVM A;  3ZT3 A;  4IFE A;  3ZX0 A;  4N41 A;  1F21 A;  3IKM A;  1Q7Y O;  2Z1J A;  3A2F A;  4C23 A;  3FZF A;  5CYM A;  5LJW A;  1NGD A;  3O9U A;  4BC4 A;  4C8O A;  2X6S A;  4PA1 A;  2ZGY A;  2YNI A;  1W7A A;  1MU2 A;  1YTA A;  4ELT A;  3C7N A;  3P83 D;  4CJR A;  3I8D A;  3IS9 A;  4DV0 K;  4M3T A;  3VQ8 A;  1RT5 A;  4AHV A;  2XY6 A;  4M3R A;  5AQF A;  3AVJ A;  4XH4 A;  4YOT A;  3KK2 A;  5HP1 A;  3AO2 A;  4MO4 A;  3UIQ A;  3PX0 A;  2XY8 A;  1C6V A;  1NMD A;  2W6L A;  5EX5 A;  5GIN A;  2F4V K;  4ZHR A;  3V1O A;  3EE8 A;  2B5J A;  1TL1 A;  2HOE A;  4H0V B;  4BVP A;  1GOA A;  1C1A A;  2ZD1 A;  4CJK A;  3V4I A;  1C1B A;  1SL2 A;  4IZ9 A;  5K14 A;  3WNH A;  2JGU A;  4BRK A;  4FM0 A;  2YNF A;  3QEI A;  4ISE A;  2O8C A;  1BCM A;  5DM7 L;  1W2B M;  4YOX A;  4KRE A;  1KLM A;  1MDU B;  5J2M A;  5GAD P;  1QVG M;  1S6Q A;  1O13 A;  1X1P A;  3NCI A;  3TAR A;  1ATN A;  1LWC A;  4OVL A;  1BIZ A;  4JS5 A;  1RBU A;  1U2V A;  3ZSQ A;  4XH1 A;  1V4S A;  1K6Y A;  2P9U A;  4CZK A;  4FSV A;  4DQS A;  4DV2 K;  1TUU A;  1P8Z A;  5FRO A;  3TAM A;  4HTL A;  4FWM A;  1HNV A;  4LH4 A;  3FZM A;  1BOT O;  5T7B A;  4DQP A;  3DMJ A;  3HPG A;  2YI1 A;  4U7B A;  4FWO A;  3TTD A;  1KAZ A;  2VCP A;  4CK2 A;  2IS3 A;  5AQK A;  1T44 A;  4LF8 K;  4CJ5 A;  3J81 O;  2A3Z A;  3L6Q A;  4KHY A;  4PKH A;  3UKU A;  1BHL A;  3T19 A;  1JLE A;  2NRX A;  4FYD A;  1RT4 A;  3C6A A;  4KO0 A;  2E6M A;  3CJA A;  4GMJ B;  1WSH A;  4BAC A;  4FK0 A;  3KVG A;  3I33 A;  2O8F B;  3KWI A;  4DWI A;  2Q1N A;  5BPM A;  4AHT A;  3BF3 A;  3D2F B;  1NGA A;  4JKB A;  3VQA A;  1YTU A;  4E7I A;  1GOC A;  4BRI A;  3VQ7 A;  3ZSO A;  3J80 O;  5EOY A;  4PHT X;  2IGI A;  1NU0 A;  4OGE A;  2GEL A;  3HM8 A;  4Y1C A;  4CGI A;  2O4I A;  1VQP N;  4JI7 K;  4HHT A;  1U04 A;  1UAX A;  2WBN A;  1NNE A;  3ULE B;  3M8P A;  1ATR A;  4FW1 A;  3S9H A;  4KI4 A;  1EWQ A;  2V7Y A;  2D0P A;  5FPN A;  4F3T A;  2RE2 A;  3QNO A;  4B1X B;  1NGF A;  3OTO K;  3M8R A;  3CCM N;  2FF3 B;  4OO1 J;  1TV6 A;  2KLA A;  1JCG A;  1MA9 B;  3NH2 A;  4M3X A;  4LY7 A;  4JRP A;  2W41 A;  3HVT A;  3TAN A;  4PKI A;  4CGH A;  4IEI A;  4IWV A;  1K9M O;  3F2K A;  3CCR N;  4CJW A;  4JK8 A;  1LW2 A;  2GWK A;  1D9D A;  1TKZ A;  3ID8 A;  4LFC K;  4BRE A;  3DI6 A;  3ZYY X;  3ULD A;  3O3H A;  3V1Q A;  2E5L K;  4CEC A;  1U49 A;  3QBX A;  3KD5 E;  1N6Q A;  3J7Y P;  5KPR A;  3EKS A;  2FSK A;  3OYK A;  4JD2 B;  3NF9 A;  3HZ6 A;  2XY5 A;  3CER A;  1NK4 A;  1QVF M;  3OYM A;  4O55 A;  3WUH A;  5KGX A;  4DSJ A;  4ILJ A;  3ASM A;  1E3M A;  3O9T A;  4CGG A;  1WNS A;  4FJM A;  3M5R A;  1HKC A;  1U4B A;  1IH7 A;  1KTQ A;  3K9J A;  1DEJ A;  3ZCM A;  3K57 A;  2ZQB A;  1P90 A;  5BRF A;  1EWR A;  1NMN A;  2IVP A;  1IBL K;  1C0F A;  2F9W A;  5GAG P;  3AY9 A;  1J6Z A;  1HKG A;  2EWS A;  4FOE A;  3CCE N;  3ENB A;  1BQN A;  4BRL A;  2HB5 A;  3O80 A;  3SCX A;  1X3N A;  2F96 A;  3ATV A;  3GL1 A;  2O8C B;  3SBG A;  4FJ5 A;  1IBM K;  3L2V A;  4V19 S;  4CK3 A;  5AQI A;  1S3X A;  4NO7 A;  4YFU A;  3CQY A;  3VEZ A;  3GOI A;  4IXC A;  3WXM B;  4B9N A;  5SZT A;  3ZSR A;  4B9T A;  2YCH A;  1BO5 O;  4QCL A;  4IOX A;  4KH6 A;  1WB9 A;  3NF7 A;  1WOQ A;  1WBD A;  3HP6 A;  3HT3 A;  3SV4 A;  2ZM6 K;  4CES A;  1KVC A;  4JI1 K;  4BWM A;  1R59 O;  4FPA A;  4DS5 A;  1KQS M;  5BR8 K;  1NJY A;  4QOZ B;  1TYQ A;  5AZJ A;  2YHB A;  4J2A A;  3LAL A;  5LMN K;  2RF2 A;  3QB0 A;  1XHZ A;  4DQQ A;  3DRP A;  4M3Z A;  1IV0 A;  1ASV A;  3ZET B;  3M1F A;  1DLO A;  1TAU A;  1RT7 A;  1TVR A;  5KQ8 A;  3FGU A;  3H1V X;  4H0X B;  3O4Q A;  2G8H A;  2ITM A;  1S1U A;  3K5O A;  1VSL A;  4FVM A;  1QSY A;  3DLB A;  4CJE A;  4EP5 A;  5H1S Q;  3OHR A;  4YY3 K;  3C95 A;  3LM9 A;  3D0P A;  3O4N A;  4JYA K;  4FLT A;  1CXU A;  2Z1G A;  2XRI A;  5LJV A;  1MWM A;  3VA0 A;  5FPE A;  1YJN N;  1SKW A;  1HYZ A;  3HK2 A;  5AQO A;  3PIP L;  2NRT A;  3M3Z A;  3SK3 A;  2QXL A;  1ITG A;  4CI6 A;  1GLD G;  4QS7 A;  3ENO A;  2HF4 A;  4DTS A;  5C10 A;  4BDZ A;  3SUQ A;  4BRD A;  1JLC A;  1B9F A;  3VQ5 A;  3DLG A;  3U8X A;  3M8S A;  3QO9 A;  3LL3 A;  4FWN A;  4NXM K;  4DR6 K;  3FE1 A;  4BDY A;  2F8S A;  4KI6 A;  3WT0 A;  2Q97 A;  4ZTJ A;  3HVR A;  4E7K A;  1BA0 A;  2HNZ A;  4KHU A;  3E66 A;  3O6W A;  3SYZ A;  3AA5 X;  4CK1 A;  3CCQ N;  3E01 A;  3WQU A;  1C1C A;  3MEE A;  1KAX A;  3O9Q A;  2D0B A;  3O3F A;  3CPE A;  3A5M C;  2OTJ N;  3VQP A;  3C7N B;  4DQR A;  4FXD A;  2Q0R A;  3CXC M;  2YHA A;  1I3A A;  1KFD A;  3LZJ A;  2CH6 A;  4E7H A;  4DS4 A;  4JN4 A;  4Z0U A;  2O8E B;  1GLJ O;  3CCL N;  1ZYQ A;  1XNR K;  4LF6 K;  2FBT A;  3TAP A;  2BE2 A;  3SUN A;  2YKM A;  4OJR A;  5HRP A;  3O1B A;  4JK9 A;  4O4G A;  2XO7 A;  2OYQ A;  3ZT4 A;  3OYD A;  3LPT A;  4HCB A;  1QSL A;  3QET A;  4CEA A;  2KQ2 A;  3G25 A;  1GLF O;  3VEW A;  4BR7 A;  2FC0 A;  3AVM A;  3O1W A;  5F1X A;  1ESV A;  2E2Q A;  2YHY A;  4OPA A;  3CCU N;  2JWK A;  4A2A A;  3VMF B;  4H4M A;  4BDP A;  2UUB K;  3CC2 N;  3CCV N;  1BGX T;  1RBR A;  3F73 A;  4Z4G A;  3VN5 A;  1QS4 A;  4CZJ A;  1NGE A;  1KRP A;  3TPQ A;  4IDK A;  5AQH A;  2CGK A;  4DR2 K;  3SV3 A;  3TAG A;  3L2R A;  5KTQ A;  4QAG A;  4E7J A;  2F7T A;  3AO3 A;  4JI3 K;  2P5O A;  3ISN C;  1KXP A;  4ZTF A;  1NK7 A;  4F4K A;  3PO4 A;  1YI2 N;  5A2Q O;  1YAG A;  5JS1 A;  3THX B;  4RW9 A;  5AQN A;  2GEM A;  3SMP A;  3WNF A;  1QQO A;  3VTI A;  4E1J A;  3SJJ A;  5AZI B;  3F5T A;  5HRR A;  2OCE A;  1LAV A;  3RR8 A;  4DLE A;  2ZJR L;  2QA4 N;  5KPZ A;  1HJR A;  3RSE A;  1WSJ A;  4PKG A;  3WQT A;  2B4J A;  2P9N B;  4O5B A;  4CZL A;  4CZH A;  3R1X A;  1IKY A;  3DLH A;  1A5X A;  4KB0 A;  3L3U A;  3OYG A;  2IVO A;  3IAY A;  5CZ2 A;  2E2O A;  3MXM A;  4J2E A;  3CPW M;  2R7Y A;  3S3N A;  3DLE A;  3V9X A;  4L3Q A;  3G4S N;  1HPM A;  4C8L A;  5AZJ B;  4YOR A;  2D0O A;  2FSJ A;  3K9K A;  3M6G A;  1NKB A;  1GLE G;  3PY8 A;  2FBX A;  3VET A;  1ZBL A;  2PYL A;  1OVY A;  4DCH A;  5E26 A;  2PAV A;  4IOA L;  2ETJ A;  5BRH A;  5SWM A;  4WFN L;  3G0Z A;  4H4O A;  5HRN A;  4CIE A;  1G99 A;  3LDO A;  3T1H K;  1VQ8 N;  3CM6 A;  4LD0 A;  3T7Z A;  4CF8 A;  4I2Q A;  1T05 A;  3P5J A;  2A42 A;  4DKW A;  4FJI A;  3K5M A;  4DTO A;  1Q8I A;  4DUZ K;  3HPO A;  3B8A X;  5ELZ A;  4BQZ A;  1E4G T;  3QIC A;  1JLF A;  3TSP A;  5AQS A;  4IFV A;  4CZM A;  1HNZ K;  5AQZ A;  4YDU A;  3AVC A;  2QI2 A;  4CHP A;  5DM6 L;  5M1K A;  1O1W A;  3PX6 A;  2O4G A;  4FZX C;  2QWL A;  3HST B;  1NKE A;  5B8H A;  2HBL A;  3C6H A;  3N4Q A;  1RDW X;  2FXU A;  1RDU A;  2YX6 A;  1WAF A;  3VQ4 A;  4FZZ A;  1NJZ A;  1L3T A;  4IJN A;  1NGC A;  4FWS A;  1BI4 A;  1HRH A;  2HND A;  4CFB A;  4BRQ A;  3JAM O;  1TKX A;  1JJ2 M;  3OYN A;  3B6P A;  5EU7 A;  4B1V A;  3DLK A;  4JD2 A;  2HHU A;  4OKJ A;  1OH5 A;  4AM7 A;  3ENH A;  1ZBI A;  3U3Y A;  3SQ4 A;  1KCF A;  3VES A;  4BE2 A;  2X78 A;  4CW7 B;  1Y64 A;  2QK9 A;  1SV5 A;  2KHO A;  4DFP A;  1TKT A;  1Q86 O;  3CI5 A;  3SBT A;  4CBU A;  3GBT A;  3VER A;  4E7L A;  4CJS A;  4YOW A;  1SAZ A;  5AQY A;  2HHS A;  4H0P A;  4C8M A;  5FPM A;  4W5N A;  1HUX A;  1HQE A;  4M3Y A;  4YHH K;  5LL6 Z;  1ILY A;  5AFU A;  3AAP A;  3OS2 A;  1JLB A;  2Q0U A;  5AQW A;  2ZJP L;  1VQN N;  4JKE A;  4FWK A;  2WUS A;  1TAQ A;  1H1V A;  2E2P A;  4LC9 B;  4BY9 C;  4FLW A;  2GTD A;  4CCH A;  3HM9 A;  4BE1 A;  3NHG A;  2F8T A;  1NGJ A;  1XHX A;  1WSI A;  2P9P A;  1ZBH A;  4A62 A;  4CFC A;  5JLF A;  3GDQ A;  1DKG D;  4DTN A;  3K0S A;  1CLQ A;  3AA4 A;  4DLG A;  1UA1 A;  2YV0 X;  2KFZ A;  1U45 A;  1N34 K;  1ASU A;  1IKV A;  3DOK A;  3FZK A;  4ID1 A;  2QWP A;  4CFD A;  4Y0W A;  4DTM A;  3LWL A;  2GX9 A;  3Q7B A;  4OLA A;  3HRG A;  3CJ9 A;  5KRT A;  3O5B A;  1JLG A;  5EXW A;  3MN5 A;  1XUP O;  3MED A;  4PY5 A;  3VEO A;  4JKA A;  4KTW A;  2HHV A;  1IKW A;  3VA3 A;  2A1R A;  4J2D A;  4WFB L;  5AJ3 K;  1FXX A;  3EEQ A;  3QER A;  2P9L A;  5J1E A;  1BG3 A;  1BQM A;  3BDP A;  3ZET A;  1QQC A;  3IMX A;  3AVI A;  3DAW A;  2UU9 K;  3AAQ A;  2X74 A;  3THW B;  4CBX A;  4B9Q A;  4CHZ A;  2BDP A;  4BGA A;  4FJX A;  4LSN A;  2HNY A;  4H0T B;  4I6M B;  1RTJ A;  3FZL A;  3THV A;  5AQT A;  5HL7 L;  2J4R A;  2OPR A;  3S41 A;  2E4L A;  3H46 O;  4BQL A;  5HLF A;  3U9D A;  1BDG A;  1S1W A;  4A59 A;  1OVQ A;  1RCH A;  3QML A;  1X9S A;  3L2U A;  3OJU A;  5F2R A;  4JV5 K;  3NH0 A;  3VEV A;  4H5W A;  3QES A;  3C65 A;  4CF9 A;  1S1V A;  2P5G A;  4WFA L;  2KW4 A;  3KK1 A;  1T6D A;  3NF6 A;  4DHY A;  2NRH A;  3TR8 A;  5HOO A;  3C0B A;  1SUQ A;  1W97 L; 
#chains in the Genus database with same CATH homology
 1ZBU A;  3TAE A;  4ICL A;  5SZT A;  3ZSR A;  3EYZ A;  4B9T A;  1UWB A;  3DOL A;  3QEV A;  1DTT A;  3OS1 A;  1ASW A;  2Z1H A;  3L3V A;  4CIF A;  2FBY A;  5J2Q A;  4QCL A;  2HVI A;  3PV8 A;  1WN7 A;  2IAJ A;  2A1S A;  1RDC A;  3NF7 A;  3QLH A;  4XIU A;  3HP6 A;  3HT3 A;  1C0U A;  3SV4 A;  4W5Q A;  4CES A;  2XY7 A;  1QHT A;  1KVC A;  5HBM A;  4CJV A;  1XWL A;  4BWM A;  3PO5 A;  4DS5 A;  4IBN A;  3VQQ A;  1BL3 A;  4FK2 A;  3ZSZ A;  1NJY A;  4QOZ B;  3CYM A;  3LAK A;  3S3M A;  1N5Y A;  2LSN A;  3T1A A;  3QEX A;  2YHB A;  4J2A A;  2DFH A;  1CZ9 A;  3LAL A;  2RF2 A;  3OYB A;  3V81 A;  1JL1 A;  1HNI A;  4IG3 A;  3NGZ A;  4DQQ A;  1XHZ A;  4EZ9 A;  1ZBF A;  3DRP A;  4M3Z A;  3LPU A;  1ASV A;  4IG0 A;  1S5J A;  4DSI A;  4YNQ A;  4HCC A;  1DLO A;  1TAU A;  1RT7 A;  1TVR A;  3RTV A;  3IG1 A;  3ITH A;  3O4Q A;  3EY1 A;  2G8H A;  2DFE A;  4N56 A;  1S1U A;  3K5O A;  1VSL A;  2GV9 A;  3MXI A;  4AIL C;  2BAN A;  4FVM A;  1QSY A;  3O3G A;  3DLB A;  3NE6 A;  4CJE A;  4EP5 A;  4CF1 A;  4M45 A;  4Z4C A;  4HTU A;  3HJF A;  4NYF A;  3AVG A;  1HQU A;  2RKI A;  3C95 A;  1VSH A;  3D0P A;  3O4N A;  4I2P A;  1VSK A;  2VWK A;  4RG8 A;  4FLT A;  1CXU A;  2Z1G A;  3TAF A;  4NCA A;  2ATQ A;  4M3T A;  1BIS A;  5E41 A;  3MAQ A;  2EX3 A;  2XRI A;  4FJ7 A;  1Q9X A;  1X9M A;  4NCB A;  1S9G A;  3AVL A;  2GUI A;  1FKP A;  3VA0 A;  2X6N A;  4DQI A;  3NGI A;  1SKW A;  1HYZ A;  3OYL A;  1LWE A;  1TL3 A;  4R5P A;  3ZT0 A;  3HK2 A;  1D5A A;  1G15 A;  4HUF A;  4KKO A;  4KHS A;  4B3O A;  4DG1 A;  4AHS A;  3OYJ A;  1ITG A;  5J2N A;  1EKE A;  3H08 A;  3LZI A;  1LAW A;  4E1M A;  4DTS A;  2IC3 A;  5C42 A;  3QIN A;  4BDZ A;  3SUQ A;  3SPZ A;  1SKR A;  4KHW A;  3LP1 A;  1JLC A;  1B9F A;  4RW8 A;  1L3S A;  1S1T A;  3VQ5 A;  3DLG A;  1RT1 A;  3M8S A;  4F2S A;  3QO9 A;  4FLX A;  5J2P A;  3KJV A;  3RMC A;  1B9D A;  4CHN A;  4E1N A;  4F3O A;  4BDY A;  4DSE A;  4B9V A;  1KLN A;  2F8S A;  4KI6 A;  1EET A;  4AHC A;  1A5V A;  4ZTJ A;  1BCO A;  3ZSW A;  3HVR A;  3RRH A;  4E7K A;  1WSE A;  4G1Q A;  2AJQ A;  3IRX A;  2HNZ A;  4FCY A;  4KHU A;  3SYZ A;  3AA5 X;  2DY4 A;  4CK1 A;  3AA3 A;  1SL1 A;  2G8K A;  3VQ9 A;  3E01 A;  4N5S A;  1C1C A;  3LWM A;  3AVA A;  3KLI A;  3MEE A;  4FLY A;  2KZZ A;  1NK9 A;  2W42 A;  4Z4H A;  3MEC A;  3AVK A;  3TAQ A;  1LV5 A;  2KFN A;  2D0B A;  3O3F A;  2QXF A;  3JYT A;  3OYF A;  5CYQ A;  4KPY A;  4FJG A;  4OGC A;  1WSG A;  1RT2 A;  3VQP A;  1LW0 A;  1HPZ A;  2HHX A;  5KGW A;  3RMB A;  3V9U A;  4DQR A;  4CHQ A;  4JLH A;  3K58 A;  4FXD A;  1RDD A;  4B9L A;  2YHA A;  3LDS A;  1I3A A;  1KFD A;  3LZJ A;  2HHW A;  4OKK A;  4E7H A;  4DS4 A;  3CM5 A;  3SNN A;  4Z0U A;  4DSL A;  3V9S A;  2DTU A;  3TWH A;  3AO5 A;  5KRS A;  5I3U A;  2HVH A;  2G8F A;  1ZYQ A;  2OA8 A;  3OVN A;  4CJQ A;  4NCG A;  3NAE A;  4W5R A;  2YNG A;  2FBT A;  1QSS A;  1L5U A;  4Z4E A;  3SQ2 A;  2BE2 A;  4I7F A;  3TAP A;  2VWJ A;  1QE1 A;  4DU3 A;  1GOB A;  2Q3S A;  2I5J A;  3SUN A;  2YKM A;  4OJR A;  4NYN A;  5HRP A;  4O4G A;  4DFK A;  4BWJ A;  3SI6 A;  3HPH A;  5DK5 A;  3L2Q A;  4ELV A;  2XO7 A;  4FJ8 A;  1R0A A;  2OYQ A;  4FJL A;  3ZT4 A;  1RTH A;  3OYD A;  4FJH A;  4CGF A;  2GBZ A;  3FFI A;  3LPT A;  4W5O A;  1NOY A;  3KTQ A;  1RDB A;  4EZ6 A;  3VQB A;  3CFO A;  1NJW A;  4HCB A;  3KLH A;  3QET A;  1QSL A;  4CEA A;  4CEQ A;  2OPP A;  1VSM A;  2KQ2 A;  4CER A;  4L8R B;  1CZB A;  1EXQ A;  1KSP A;  4KHN A;  2IOC A;  1RNH A;  4WE1 A;  1RT3 A;  2D5R A;  1T7P A;  4C8N A;  1WSF A;  1WAJ A;  2FC0 A;  3AVM A;  2PZS A;  3L8B A;  3OY9 A;  4M3U A;  3NF8 A;  3QEW A;  1W9H A;  5FDL A;  4FM1 A;  3AA2 A;  4E19 A;  2Y1J A;  4CHY A;  5KI6 A;  1IKX A;  4H4M A;  4MQ3 A;  4TSX A;  4CED A;  1TK0 A;  4I9L A;  2ITG A;  4JRQ A;  4BDP A;  1JKH A;  4DSF A;  1BGX T;  1RBR A;  3I0S A;  3L2W A;  1RIL A;  3F73 A;  3TAB A;  3VN5 A;  4Z4G A;  4UQG A;  3QIO A;  2OZS A;  4PUO A;  2OPS A;  4CEO A;  1S6P A;  4IFY A;  4CEE A;  3U6F A;  2QKK A;  1NK8 A;  1QS4 A;  1RBS A;  3CQ8 A;  1KRP A;  4O44 A;  2PY5 A;  2FBV A;  4GVM A;  4IDK A;  4KAZ A;  3ZT3 A;  3S3O A;  4KFB A;  5I42 A;  3SV3 A;  2XHB A;  3TAG A;  3L2R A;  5KTQ A;  4QAG A;  1J53 A;  4E7J A;  4N41 A;  2D0C A;  3AO3 A;  1T03 A;  3SQ0 A;  2P5O A;  1F21 A;  4DF8 A;  2Z1J A;  3ISN C;  3OS0 A;  3A2F A;  4CHO A;  4E0D A;  4ZTF A;  1NK7 A;  4F4K A;  4Z4I A;  5CYM A;  4O0J A;  3PO4 A;  3OJS A;  4C8O A;  2X6S A;  4PA1 A;  2YNI A;  4FLU A;  2KZM A;  1MU2 A;  3LP0 A;  3KIO A;  1YTA A;  4ELT A;  4I9Q A;  1J9A A;  5JS1 A;  2RPI A;  1REV A;  3P83 D;  4GW6 A;  4RW9 A;  4CJR A;  3AVH A;  3LP2 A;  3I8D A;  3SZ2 A;  4PQU A;  3IS9 A;  3WNF A;  4B9S A;  1NOZ A;  3VQ8 A;  1WLJ A;  1RT5 A;  4AHV A;  3HXM A;  4JS4 A;  4M3R A;  2XY6 A;  3SJJ A;  5HRR A;  4FW2 A;  3AVJ A;  3KKR A;  1LAV A;  4E89 A;  3KK2 A;  1HYV A;  5HP1 A;  3RR8 A;  3AO2 A;  2P51 A;  4DLE A;  4FM2 A;  4HUG A;  3HL8 A;  2XY8 A;  1C6V A;  4DU1 A;  3PX0 A;  3UIQ A;  4ZHR A;  1HJR A;  3V1O A;  3AV9 A;  1JXE A;  1WSJ A;  2B4J A;  4B8C A;  4O5B A;  3U3G A;  3AO1 A;  1IKY A;  2B5J A;  1TL1 A;  3NH1 A;  1A5X A;  2PYJ A;  3DLH A;  1YT3 A;  4KB0 A;  3V9Z A;  3L3U A;  4OKE A;  5DMR A;  3C94 A;  1DTQ A;  4CJL A;  3OYG A;  1L3V A;  1GOA A;  4FZY A;  1C1A A;  2E6L A;  4CEB A;  3IAY A;  4KTQ A;  3K5N A;  2ZD1 A;  5CZ2 A;  3MXM A;  1TGO A;  1X9W A;  1KFS A;  4J2E A;  1RT6 A;  3PUF A;  3VQE A;  4B8A B;  4CJK A;  2R7Y A;  3DLE A;  3V4I A;  3S3N A;  3V9X A;  3CG7 A;  1UOC A;  1C1B A;  3OYI A;  3NBP A;  1SL2 A;  4C8L A;  1SL0 A;  5K14 A;  2WON A;  2VG6 A;  3WNH A;  4N47 A;  3C6T A;  2B6A A;  1T8E A;  2JGU A;  4CEZ A;  1NKB A;  4O0I A;  3PY8 A;  4B9U A;  2P1J A;  2FBX A;  4FM0 A;  1NK5 A;  2YNF A;  1ZBL A;  3QEI A;  2PYL A;  5JS2 A;  4F2R A;  1BCM A;  2G8U A;  4KRE A;  5HRS A;  1KLM A;  4DF4 A;  2ETJ A;  1UA0 A;  5J2M A;  5SWM A;  3MEG A;  1S6Q A;  1VSD A;  3G0Z A;  4ELU A;  3OYC A;  2KTQ A;  1I39 A;  1A5W A;  1X1P A;  2DFF A;  3NCI A;  2IDO A;  3TAR A;  4H4O A;  5HRN A;  2VG7 A;  4CIE A;  1TKD A;  4KV8 A;  3QIP A;  1LWC A;  4OVL A;  5FRM A;  1BIZ A;  3CM6 A;  4CGD A;  5FRN A;  4JS5 A;  4LD0 A;  1FK9 A;  1RBU A;  4I2Q A;  3ZSQ A;  1VSE A;  4CF8 A;  1T05 A;  1K6Y A;  3P5J A;  4FK4 A;  3B6O A;  4FJI A;  1JLA A;  1VSI A;  3AVF A;  3SPY A;  3TI0 A;  1XC9 A;  4DQS A;  3VQ6 A;  3K5M A;  4DTO A;  1Q8I A;  3F9K A;  4FJK A;  3HPO A;  4LH5 A;  5FRO A;  3DLR A;  3TAM A;  3QNN A;  2EHG A;  3RR7 A;  4FLV A;  1RTI A;  1JLF A;  1HNV A;  4LH4 A;  2JLE A;  4IFV A;  4KHQ A;  1S1X A;  2D0A A;  4DFM A;  1Y97 A;  5T7B A;  4FLZ A;  3DMJ A;  1BIU A;  3HYF A;  4W5T A;  1L3U A;  3HPG A;  3AVC A;  4CHP A;  4DQP A;  2HHT A;  2QKB A;  3VQC A;  1O1W A;  3PX6 A;  2O4G A;  4CK2 A;  4FZX C;  3ZSY A;  2IS3 A;  1J54 A;  3D45 A;  3M8Q A;  3HST B;  3OYA A;  1NJX A;  1TK8 A;  4CJ5 A;  1NKE A;  2OZM A;  1VK0 A;  2YNH A;  4DFJ A;  4KHY A;  4Q0B A;  4C8K A;  4DSK A;  1BHL A;  3T19 A;  1JLE A;  3VQ4 A;  1WAF A;  1RTD A;  1CXQ A;  4FZZ A;  1NJZ A;  1L3T A;  4FYD A;  1RT4 A;  2BGG A;  3KK3 A;  1BI4 A;  1HRH A;  1W0H A;  2E6M A;  2HND A;  4KO0 A;  3ZSV A;  1TKX A;  4CFB A;  1NK6 A;  3OYN A;  3B6P A;  4GMJ B;  5EU7 A;  3JSM A;  1WSH A;  3DYA A;  4BAC A;  3AO4 A;  5HRO A;  3DLK A;  2HHU A;  4DTU A;  4KB1 A;  4FK0 A;  1VRU A;  4OKJ A;  4DTP A;  4M41 A;  4DWI A;  4F8R A;  1RBT A;  3KKS A;  3U3Y A;  2G8W A;  3VQD A;  3SQ4 A;  1ZBI A;  1KCF A;  4CIG A;  3QEP A;  1JLQ A;  4AHT A;  3DRS A;  4LSL A;  4BE2 A;  4CE9 A;  1RDA A;  3VQA A;  2NUB A;  2X78 A;  3NGY A;  2QK9 A;  1SV5 A;  2HW3 A;  3WNG A;  4DFP A;  1YTU A;  4DMN A;  4E7I A;  1GOC A;  4B08 A;  3VQ7 A;  1KVA A;  1TKT A;  4RW7 A;  3ZSO A;  4CJ3 A;  3PX4 A;  2IGI A;  4OGE A;  4E7L A;  4DTJ A;  3SUO A;  4Y1C A;  4CJS A;  4CGI A;  1S9E A;  4FJN A;  2O4I A;  3ZT2 A;  3HO1 A;  2HHS A;  4C8M A;  4HHT A;  1U04 A;  3SQ1 A;  4W5N A;  1JXB A;  1UAX A;  2ZE2 A;  1HQE A;  4M3Y A;  4K8Z A;  3M8P A;  4ID5 A;  1HMV A;  1U48 A;  4OPK A;  4FW1 A;  3S9H A;  1J5O A;  4KI4 A;  3OS2 A;  1JLB A;  1RBV A;  3OYE A;  2OPQ A;  3KLF A;  2HMI A;  4F3T A;  3NDK A;  1IO2 A;  1TAQ A;  3QNO A;  4FJ9 A;  4AH9 A;  3DRR A;  4FLW A;  3M8R A;  1VSF A;  2VG5 A;  4CCH A;  3HM9 A;  4BE1 A;  4HVJ A;  1C0T A;  3NHG A;  2F8T A;  1XHX A;  1TV6 A;  4M42 A;  1WSI A;  3NH2 A;  4M3X A;  4LY7 A;  3K2P A;  5C25 A;  4JRP A;  1QTM A;  3EZ5 A;  2YKN A;  3HVT A;  1ZBH A;  3TAN A;  3RRG A;  3NFA A;  4CGH A;  4CF2 A;  2G8I A;  4AHR A;  3V1R A;  3SUP A;  4CFC A;  4CJW A;  4IKF A;  4DTN A;  4E3S A;  1CLQ A;  3RMD A;  3RMA A;  3AA4 A;  4DLG A;  1UA1 A;  1LW2 A;  4MFB A;  1D9D A;  2YV0 X;  3KLE A;  5D3G A;  1U45 A;  1TKZ A;  1JL2 A;  3ALY A;  4CJF A;  2KFZ A;  4H8K A;  1Z25 A;  3AVB A;  3DI6 A;  1ASU A;  3ZSX A;  3ULD A;  3CFR A;  1IKV A;  3DOK A;  4HUE A;  3O3H A;  4ID1 A;  3V1Q A;  4CFD A;  4DTX A;  1NK0 A;  4CEC A;  4DTM A;  3LWL A;  1LWF A;  3V6D A;  4Y1D A;  1U49 A;  3KD5 E;  1N6Q A;  4OLA A;  4CGJ A;  1YVU A;  3I0R A;  3RWU A;  3OYK A;  5KRT A;  4J2B A;  4RW4 A;  3LAN A;  3P1G A;  3NF9 A;  1JLG A;  2XY5 A;  1EX4 A;  1NK4 A;  3MED A;  3OYM A;  4O55 A;  4PY5 A;  4KTW A;  4FJJ A;  1Z26 A;  5KGX A;  4DSJ A;  3KD1 E;  4OPJ A;  2HHV A;  1IKW A;  4RW6 A;  3VA3 A;  2A1R A;  4J2D A;  1KVB A;  4DTR A;  4PWD A;  3ASM A;  1HYS A;  1FXX A;  4Q5V A;  4CGG A;  3KLG A;  1WNS A;  3QER A;  1NKC A;  4OLB A;  4FJM A;  4KTZ A;  5J1E A;  4DU4 A;  2Y1I A;  1BQM A;  2RN2 A;  3BDP A;  1QQC A;  1U4B A;  1IH7 A;  1KTQ A;  4CEF A;  3AVI A;  1D9F A;  4CF0 A;  3MXJ A;  2X74 A;  3ZCM A;  5C24 A;  1FKO A;  4CHZ A;  3K57 A;  2ZQB A;  2BDP A;  4FJX A;  4M3W A;  2Z1I A;  4LSN A;  4AHU A;  1D8Y A;  2HNY A;  4CJ4 A;  3WNE A;  4BE0 A;  1RTJ A;  3THV A;  1IG9 A;  1B92 A;  4K8X A;  3AVN A;  2OPR A;  3LP3 A;  1C0M A;  4B9M A;  3ZT1 A;  2E4L A;  5HLF A;  1XI1 A;  1TK5 A;  3T3F A;  1VRT A;  1S1W A;  1U47 A;  3K5L A;  1BQN A;  1RCH A;  3K59 A;  4N76 A;  3HP9 A;  2HB5 A;  2WOM A;  4CFA A;  5CZ1 A;  3OYH A;  3L2U A;  1X9S A;  3OJU A;  4EP4 A;  3BGR A;  3SCX A;  4CJT A;  1Q9Y A;  3NH0 A;  3V9W A;  2F96 A;  3G10 A;  3QES A;  4Z4F A;  3CFP A;  4CF9 A;  2G8V A;  1VSJ A;  4FJ5 A;  1S1V A;  2P5G A;  3L2V A;  2HHQ A;  4CJU A;  1BI4 B;  2KW4 A;  4CK3 A;  3C6U A;  3DM2 A;  3KK1 A;  1EP4 A;  3LAM A;  3NF6 A;  3TR8 A;  4CJP A;  4YFU A;  1SKS A;  4KRF A;  5CY4 A;  1SUQ A;  4B9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...