2JWLA

Solution structure of periplasmic domain of tolr from h. influenzae with saxs data
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tolR
publication title The Periplasmic Domain of TolR from Haemophilus influenzae Forms a Dimer with a Large Hydrophobic Groove: NMR Solution Structure and Comparison to SAXS Data.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
total genus 19
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.270 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2jwlA00
2JWLA 2PFUA 2JWKA
chains in the Genus database with same CATH superfamily
4EP4A 1IV0A 3MXMA 2Z1HA 1S72N 3SI6A 3P4IA 3KWGA 3P83D 4XH4A 3W3DA 3D2EA 2GBZA 2Q0RA 3MK6A 3RRHA 4MFBA 4ILHA 1BI4A 4OKKA 1TGOA 1ZBUA 2VYPA 3KK2A 4ELTA 3VQBA 2VWBA 4DV0K 1K6YA 4ICLA 4EHUA 4Z94A 3U8XA 1BIUA 3HP9A 4DV2K 4JN4A 1NWKA 3D2EB 4DMNA 1RBSA 4KRFA 3EZWA 2QI2A 4H03B 5CZ2A 1NJXA 1X9JA 2NUBA 1BI4B 1NJWA 1C0MA 3JXUA 1TL3A 4DSLA 4FW1A 1WAFA 3I8DA 3AY9A 2EHGA 3P38A 2YHAA 2P9NB 1ATNA 3HZ6A 4CJ5A 4LSLA 3OVNA 2Z1JA 4CF0A 4JI4K 1VAZA 3AVGA 4ELUA 4CZKA 4PHTX 3KLIA 4HUEA 3K59A 4BRHA 2E1ZA 3CMAN 4B3RK 4KHWA 4AHSA 2ASPA 1EO1A 2OTLN 1T8EA 5BRHA 4JI6K 4FJMA 3VEXA 1JCGA 4BE0A 1XNQK 4FW2A 3VOVA 3VETA 1RBRA 4IEEA 4B9SA 4HUFA 4CE9A 4CJVA 5KPTA 3AVHA 1BQNA 5DM7L 1E4FT 3QESA 4K8ZA 3SUNA 3OYEA 5D3GA 3VEWA 3M5RA 3SAHA 4EP5A 2KKZA 1YUWA 3HO1A 2G8IA 1RT3A 2KZMA 1T44A 3I33A 4QS7A 1VSKA 4JKEA 3N4PA 3CM5A 3G4SN 2CGKA 3ZX2A 4YDUC 3K57A 3BGRA 3WNHA 1VQKN 1ASVA 4CBWA 1T3VA 3HTVA 4H5WA 3F5TA 1MWMA 4GV3A 4DLEA 1C1BA 1C6VA 4HHTA 4E7KA 3CM6A 1V4TA 3DLGA 1HQEA 4FK4A 3AVFA 3NF9A 2F8SA 3LDPA 5HROA 1TAUA 2UXDK 2XO7A 1LWCA 1ZBIA 2D0CA 3ZX0A 2E2PA 1NOYA 5AFUA 5F2RA 3J7ZO 4KTWA 4F4KA 3HP6A 3MN9A 4Y1DA 3FZKA 1SL2A 3CD6N 2F96A 3AVLA 3J8AA 3C6TA 3K2PA 3IRXA 2X74A 2XHBA 2P51A 3P1GA 4CK1A 2B5JA 3M1FA 3THXA 1KTQA 3IS9A 3PX0A 4FLWA 4IOAL 1VSIA 4DLGA 4MLHA 4DV6K 4BREA 4B1VA 1NK5A 3LP2A 3R9PA 4DSJA 2F9TA 3BZCA 1WB9A 4BC4A 1JLEA 4CIGA 5CYQA 4FPAA 4JNEA 4CGJA 3GG4A 1J5EK 1SZ2A 2G8KA 4OKJA 3O8MA 3H08A 4JRQA 3NVKA 4IDHA 3CCEN 1UOCA 2GV9A 1K8AO 3QIPA 4E1MA 1KQSM 3NGYA 3ZCMA 4A5AA 1WLJA 3PLAA 2Z1GA 3ENBA 4CGDA 1X9WA 2PZSA 4B9QA 3MDQA 1EXQA 2I7PA 4M41A 4R79A 5AQKA 4KAZA 4KV8A 3SZ2A 4LF4K 1NKBA 1HYSA 1ZYQA 2FC0A 3VQAA 2HHUA 2FF6A 5AQZA 2CGLA 1KLMA 2X6NA 5GAGP 3L2WA 2AJQA 4Z4CA 1N8RO 4NCGA 3QBXA 3R1XA 2ZJQL 5GAHP 2VCPA 3ZT2A 3W0LA 4NO7A 5LJVA 1NK7A 5JVHL 3VA0A 4LH5A 1JLQA 1OVYA 4CJ3A 3F9KA 3EE8A 3NE6A 4O55A 2AA4A 4DQSA 4FL9A 3H1VX 3OA9A 3QO9A 4CCHA 2I7NA 1VRUA 3AA4A 4PQUA 1KD1O 2RKIA 4FZZA 4BY9C 4JK8A 3UKRA 5HRRA 1Q86O 2V52B 3VQEA 3HXMA 2XY7A 1NGAA 4O8KA 1EQYA 4ILJA 1S1TA 3LL3A 3EY1A 3DRRA 2QWNA 3I0RA 5LMNK 5BPNA 2P9PA 3OW2M 1HJOA 3KLHA 5AQUA 2RHKA 2O8CA 4YHHK 4CERA 4FJHA 3VN5A 2FLOA 3C0BA 1QSSA 1UWBA 4DU1A 3HRGA 5I42A 3UKRB 5AQPA 1N32K 4CJUA 1P8ZA 3FZHA 4BR7A 4E3SA 1DLOA 2HHTA 3TU5A 2W6LA 4H0VB 4C1NK 2F9WA 3RMBA 5FPMA 4BRNA 1QQMA 1EWRA 2P9PB 4UQGA 1WSGA 3PIOL 3ENHA 2B4JA 4X66K 4BACA 3G71N 3AA3A 5BR9A 2O8CB 3KIOA 3ULEA 1OH6A 3H45C 1N34K 1C0GA 1DEJA 5BRFA 2KHOA 3DAWA 2WOMA 3IAYA 1GOCA 3D6RA 3BP8A 3DYAA 5CR4A 3S3NA 1E4GT 1YJWN 1LCUA 1R0AA 4E0DA 3TSPA 3HJFA 4JI1K 3EO3A 4JS5A 3VEZA 1KAZA 4DFMA 4H5VA 1QS4A 3HSTB 1HUXA 3ULEB 4BRDA 5TKWA 4F3OA 3GBTA 4BC3A 2J4RA 4PL8A 5AQOA 5KRTA 3O9UA 5GINA 1HLUA 2E88A 4LF8K 3GDQA 4A62A 4FO0A 3HT3A 2PYLA 3AVBA 4GKJK 4KB1A 4Z4IA 3ZT3A 4BR4A 5C42A 3SV4A 5E41A 2ZQBA 3F73A 4HTUA 3S9HA 1YITN 4JI0K 3DOLA 5DMRA 1NG9A 2RN2A 3P39A 3OS1A 1KLNA 2O8FB 1NGIA 5J2PA 2I5JA 3B6OA 2A5XA 4I7FA 4B3SK 5LMUK 2V7ZA 1HQUA 4CEOA 3CC4N 1VSFA 4DSEA 2P5GA 3TTCA 4YNQA 5T7BA 4KHQA 4PWDA 3R6MA 3V9UA 4M42A 3KTQA 1NOZA 3LWMA 3K58A 1NJIO 3PSIA 4CEZA 4F2SA 5C2FA 3LDSA 1CXUA 2NLXA 5KPZA 4BWMA 1S9GA 4CIEA 4I9QA 1R59O 2D5RA 3CJAA 4J2DA 3E9LA 2FBYA 4CW7B 4CZFA 3O9TA 1S22A 2P9SB 1T7PA 2QWOA 4IZ9A 4KI4A 2Q36A 5EY4A 3BY5A 2A6AA 4CEBA 2G8HA 4KPYA 1NU0A 4LF6K 4JI8K 3ZT0A 1J53A 3ZT1A 5C15A 4DTRA 3MXIA 4M7YA 5C12A 4DUYK 3LALA 1I3AA 4EFHA 3O3HA 3LP0A 5KTQA 1A5XA 2QK9A 4WQ5A 1MA9B 4J2AA 1ZBSA 1KAXA 2UXCK 4LC9B 2OTJN 4JKDA 2EWSA 1U48A 1EWQA 2KFZA 3K5NA 3UE5A 1RTHA 3ZSRA 4MO5A 4E1NA 4C8NA 1BG3A 2YX6A 5LJWA 3THWA 4FVUA 2QXLA 2E6LA 2YHWA 4JI5K 4M45A 4LH4A 4H5NA 4QS8A 3O9RA 4K8XA 4CK2A 4J8FA 4FZXC 3L3UA 2FBXA 1RGIA 2D0PA 4CEEA 3QEVA 2O8BA 3IDHA 4XH1A 4Z4HA 1QSYA 5E26A 4H5RA 1EKEA 3LZIA 3LM9A 1QHAA 5HLFA 3C65A 1Z6RA 3N4QA 4OVLA 5FRMA 1K73O 3THWB 1X3NA 4CK3A 5FPNA 4OPAA 2GWJA 3WNFA 1KFSA 1S1VA 2IVPA 4O0JA 3OHRA 4CGFA 2HMPA 4FLYA 2QW9A 2A40A 2PBDA 2G8WA 4FJ8A 4B9TA 2O8BB 4DV7K 2VG6A 3OBWA 4B1UB 3U9ZA 3HI0A 3S3MA 3KD5E 3EKUA 3CERA 5KGWA 1VSJA 3SCXA 1RTIA 3FFIA 1I94K 2YNIA 4GVEA 1VHXA 3V4IA 1ZBFA 2HMIA 2YHBA 1A5VA 2HBLA 1HJRA 3L4IA 1IKVA 4FCYA 4DQRA 1MWKA 3JSMA 2UYTA 3EZ5A 4OJRA 4CFCA 1VQLN 3NDKA 3U6FA 4WQ4C 2VQEK 1CZAN 1X3MA 4AHTA 1D9FA 2ATQA 4BRMA 1YVUA 4ISFA 1YAGA 1BQMA 3SQ0A 4CGIA 2Q3SA 5DM6L 3G0ZA 4NXMK 3VGLA 1LWEA 3QINA 4BVOA 5JS1A 2QWPA 3KD1E 5FPEA 4N41A 4JKAA 2GUIA 3FR0A 1KC8O 1BCOA 1GLAG 1IH7A 3MCAB 1OVQA 5ELZA 2BUPA 1RT6A 4M3YA 1VQ9N 3DRPA 4DFPA 2CGJA 1QTMA 4Y1CA 3O3FA 1BL3A 4CECA 3G6EN 2ZWHA 4DFKA 4PUOA 3F2KA 3A5MC 1YTUA 2QA4N 3M8RA 4BVPA 2YNHA 4O4GA 4JKGA 1QZ6A 5AR0A 1HPMA 3DLRA 3DLBA 2ASOA 4UY8O 3VQ5A 2D0AA 3O9SA 5HRNA 3NF7A 5AZIA 4O5BA 1XI1A 1FKPA 1KVBA 4F8RA 4NCBA 2DTUA 3AGRA 3OYNA 1JCEA 1RFQA 1U4BA 3QFUA 3CJBA 1Y64A 5M1PA 1Q7YO 2RE2A 3KLGA 4NLCA 4H4MA 4DF8A 3L2UA 2KFNA 4KH6A 3GOIA 4A57A 3E9OA 5AQMA 3WXKA 4U67L 3K5LA 3VTHA 4DU3A 4GVMA 4DR1K 1K9MO 4RW4A 3T69A 5AZIB 3VF2A 1RILA 3WUHA 1X1PA 1VRTA 2NRVA 4FJJA 4NXNK 4MO4A 4FPBA 3OJUA 3V6DA 3MN6A 4W5OA 3E01A 2JWLA 3SLCA 3HBTA 1XMQK 1JLCA 1DTTA 2YI1A 1BA1A 2HHQA 1JL1A 3UKUA 3PIPL 2F7TA 3CI5A 3KKRA 4MQ3A 3CCSN 3T19A 1ASUA 4FLXA 1T6CA 1WSFA 4FWQA 4XEIA 3SUPA 2FXUA 4KKOA 2GUPA 1QQOA 3QNOA 1WSEA 4W5QA 1YI2N 1JJ2M 4EHTA 2W6KA 2DPNA 4JKBA 4I6MA 1KVCA 1RDWX 4FOEA 4Z4FA 2ZF5O 4RW7A 3UKUB 3MEGA 5GIPA 3AO5A 1YT3A 2OANA 4FZYA 1TKZA 5AQXA 1SL0A 4Q0BA 1JLAA 4BRQA 4FJ5A 4CHQA 1U49A 3OS0A 2HNDA 3DLEA 5TKYA 3NBPA 5C10A 4W5RA 3HM9A 4BDZA 3MX2A 3SNNA 3CF5L 3DI6A 3VESA 3BF3A 4QOZB 1XWLA 4B9NA 3H3OB 2BANA 1RT4A 1D5AA 3VA3A 3FZFA 2YHYA 2GELA 5AQSA 4PKIA 4I6MB 2E2NA 3OTOK 4I2PA 2NRXA 3RVCA 2QM1A 3ZSQA 1EP4A 2LSNA 2IIRA 3CHWA 4DHYA 4BGAA 2HHSA 1XQSC 1S5JA 4H0YB 5M1KA 3OYDA 4YDUA 4DTNA 3AAPA 1OH8A 3CCMN 3A5NC 1WSHA 2D0BA 4JK7A 3C6UA 4DR2K 3O6WA 1NK8A 2O4GA 4H0TB 3CCJN 2E8AA 3HL8A 3TAGA 2HNZA 3L2RA 4M3XA 4B9UA 3THXB 5AQRA 3T7ZA 1RDCA 3RSEA 4YOWA 1KSPA 4FLUA 4E89A 1Z05A 3DXKA 2WTUA 4CBXA 1RTJA 2W41A 1KFDA 4CEQA 4M3ZA 3I8BA 4IFYA 4BQZA 3CFPA 1D4XA 4IBNA 1HNIA 4YOUA 1NM1A 1DT9A 4F3TA 5M1FA 3CFRA 3QIOA 1NGEA 3CIPA 4DFJA 5BRDA 4IFEA 3RSEB 1WSJA 3QEIA 1RT1A 4RW6A 1QVGM 4PY5A 3NF8A 4BGBA 5KI6A 1S3XA 3UB5A 4DV5K 3HVTA 1A5WA 4JAXA 3LDNA 3K9KA 5AQLA 1S1XA 2OPPA 4BE2A 1C0TA 1IKYA 3QFPA 3VF6A 4BRFA 4DTXA 3VEOA 3RRGA 3EYZA 3O4WA 3KVGA 5GADP 3K9JA 5DK5A 3H6EA 4ID5A 4CJ4A 3JAMO 3OYGA 4CHOA 4FWSA 3TAQA 3FZMA 2YNFA 1ZXOA 2D1KA 3U3GA 3V1QA 1RDDA 2O4IA 4U7BA 4B8AB 5ADXH 1TK8A 4JYAK 3RMCA 4G1QA 4IWVA 4CJFA 4DTMA 3BZKA 1BDGA 5JMVA 3NGZA 3CC7N 4RWTA 2P9IA 1IJJA 4WCEL 4CZJA 4ELVA 4CIFA 1LOTB 1TKTA 1L3SA 4CZEA 1WBBA 1IBLK 1VQPN 4CI6A 4FJXA 1UAXA 5KGXA 4O8UA 2W40A 4CJPA 4JI7K 4IXCA 3NH1A 1XNRK 1BOTO 3LANA 3AGKA 3J80O 2XY6A 3H1QA 5CYMA 4FWPA 5H1SQ 3OYMA 4Z0UA 3TWHA 3OYIA 3BF1A 4BROA 4B1XB 2P9IB 3U9DA 1U2VA 4KHSA 3HVRA 2HVHA 3LP3A 2ETJA 2WBNA 4JKHA 3TPQA 4G9ZA 1VSEA 1EX4A 2FBVA 3OYFA 1D9DA 2DFFA 4JD2A 2YJEA 1JLGA 4J2EA 4PA1A 4BR9A 3TAMA 4HWIA 4RG8A 1ATSA 3DLKA 5IT9O 2IAJA 4LF5K 3VERA 1UA0A 2VGNA 2CH5A 1SL1A 3MWPA 3KK1A 2G8FA 4M3TA 1U2VB 4K0KK 1VSDA 4JEPA 5EX5A 3NMUA 1HPZA 4EAHD 4EZ6A 2BGGA 2VG7A 4NYFA 4CJKA 4CF9A 4PKGA 4AM6A 2VWKA 4BC2A 2Q31A 3TAEA 4B3MK 3I56N 4GKKK 5M1QA 1RT5A 5AQQA 3K0SA 3O08A 4O0IA 4CJRA 3KLFA 2A3ZA 3WQTA 4B1YB 3RMAA 5AQHA 1BGXT 4B9MA 3L8BA 4DV1K 1HNWK 3JS6A 4DF4A 3ZSWA 3LDOA 1W0HA 3ZYYX 4M3WA 3B8AX 5HBMA 4XH5A 4DSFA 3WXJA 5IWAK 1NGHA 4DR4K 5AQYA 3SV3A 1T03A 3CMEN 3QETA 2UU9K 3L2QA 4BRCA 3HPOA 1V4SA 4I9LA 2O8DA 3DXMA 3O9QA 4KB0A 2Q1NA 1S6PA 3AVCA 1B92A 3A5OC 1E3MA 3NFAA 4B1ZA 1YXQA 4CJLA 5SZTA 1W9HA 3TTFA 1LW2A 4DQQA 3VQPA 1IG8A 5M1NA 3MN5A 3HM8A 4IDKA 5CZ1A 2OZSA 4HCCA 3VGMA 5HOOA 3PV8A 3VF4A 3EN9A 1ILYA 5FLXO 1NJYA 2YNGA 3B6PA 3SQ1A 4CZIA 4H0XB 4CHPA 4KHYA 2O8DB 3DXMB 2E1YA 4O5FA 2KTQA 4FJIA 3ID6A 2FSJA 3TI0A 1CLQA 1L3UA 5CHIA 3HK2A 3MXJA 3EL2A 4KHUA 1HRHA 1OKJA 3CC2N 1RBTA 1HX1A 2Q2RA 1YJ9N 5JLFA 1MU2A 4DTOA 3AV9A 5FDLA 1RDAA 3SBGA 3PO4A 4CF2A 3WEEA 4M3UA 2WFBA 1VSLA 3WNGA 5GIOA 1HYZA 1L3VA 2IVOA 3RWUA 3TSQA 2HVIA 4HTLA 5AQWA 1JKHA 5GAEP 1IKXA 4JS4A 3C6HA 1BA0A 2OPSA 4OO1J 4DR5K 1ZC6A 3WQUA 3IMXA 3OYCA 2YCHA 3LDQA 5KQDA 1NGCA 2YKNA 1BU6O 1NK4A 3H3NO 2QTDA 4IG0A 4RW8A 3DM2A 3D2FA 5AQVA 2HNYA 3OYJA 4YOVA 3VTIA 3T3FA 1W7AA 1N5YA 1BUPA 2OZMA 3QB0A 3CJ7A 3WEEB 1FK9A 2UUCK 3AVMA 3ATVA 3KK3A 4CJEA 2PYJA 4DV3K 3SJHA 3H46O 2VQFK 5M1OA 2BTFA 4CHYA 4E7LA 3RMDA 4ZTJA 2E20A 1FXXA 3DJCA 3TR8A 3TANA 5SWMA 4V19S 3A5LC 2OYQA 3K5MA 4E7HA 1YJNN 2VGMA 4FM1A 3MECA 5HRSA 4L8RB 2YV0X 3D2FB 3NHGA 4GMJB 4YORA 2UXBK 3VMFB 4CF8A 2HHWA 3AVKA 4OX9K 1KAYA 3D45A 3R3LA 4FLTA 2ZJRL 4KHPK 4DR7K 4CHNA 2QWQA 1ITGA 3HSCA 1T05A 1LWFA 4L3QA 4KTQA 5JS2A 3RR7A 3NCIA 1WNSA 4C8KA 3VQ4A 1XC3A 3KWIA 1TVRA 1NGFA 5AFUH 4AF1A 2HBKA 3LPUA 2DFEA 4KH5A 3MEEA 1IBKK 4W5NA 1ZBLA 1W2BM 1LW0A 5I3UA 2P5OA 4AHVA 3O1BA 4W5TA 2OA8A 1KXPA 3EKSA 1RDBA 3L6QA 2ZJPL 2FF3B 1M1KO 1U6ZA 1JCFA 1SKWA 2HOEA 3NH2A 4KH4A 2YJFA 1FJGK 3OYBA 1S9EA 3LDLA 5BPMA 4NYNA 3V9SA 2ZE2A 2XRIA 1C0FA 5A2QO 4KFBA 2ZM6K 1L5UA 3ZSVA 4DQIA 3V9WA 1NK9A 5CE3A 3ZX3A 5BN8A 3ZSXA 2KQ2A 4FWRA 4AILC 2P9LA 1QQNA 1BO5O 5JICA 4ZTFA 3AO2A 1SKSA 3VQ7A 2HF4A 2RF2A 4IG3A 2P1JA 4C23A 4YOTA 3WXIA 3TARA 1VQ5N 3M8SA 3QEXA 5LY3A 4RTFD 3NAEA 2FBTA 2HBMA 4BRGA 4CFAA 3U3YA 4Q5VA 5F0XA 1Q81O 4LFBK 1JLFA 1CZBA 2QKKA 4M63C 3M8QA 2P9LB 3M6GA 1QVFM 2JWKA 3HOSA 4CESA 1SV5A 3CETA 4KI6A 3RTVA 3DMJA 2ZGZA 3NF6A 1HNVA 4A2BA 1TV6A 1WOQA 3WNEA 1Y97A 1RNHA 3L2VA 2PY5A 1QQCA 3LAMA 4N56A 4R5PA 2E5LK 3VPZA 5AQNA 3BDPA 2ZD1A 3SAFA 1NLVA 4H0PA 3QBWA 4KO0A 4E19A 3ZLJA 3MAQA 4IO9L 2GEMA 4NB4A 3EEQA 1VQ7N 4N76A 5C2DA 3QDKA 1C1CA 1TK5A 4BR5A 1G99A 2P9NA 4XIUA 3SK3A 3AVNA 4KREA 4M7XA 3D7EO 2HF3A 1EETA 2NRZA 4JKGB 1Q9XA 2GX9A 1TYQA 3ZEUA 1J9AA 4X62K 4JLHA 4LD0A 4M3RA 2B6AA 5J1EA 1BCMA 3TTDA 4QS9A 1WN7A 4CJWA 2XY8A 3CQXA 1GLCG 2D0OA 4CHZA 1J54A 5LL6Z 4YOYA 3ASMA 4BDPA 3AA2A 3M3ZA 2IGIA 3BEXA 4CJQA 1XHXA 1X9SA 4FJ9A 1Q82O 4YFUA 2NRHA 1RT2A 4RCHA 4IOCL 4I2QA 3ENOA 2YKMA 2R7YA 1OH7A 5FRNA 2QWMA 1HMVA 4BRPA 1TYQB 3ZEUB 3P5JA 2A42A 3E1YA 2WUSA 5AQFA 3AA5X 2NZTA 1Z26A 1BHLA 2X78A 4LFAK 1GLJO 5AZJA 2G8UA 4K42A 3IKMA 3IUCA 4C8OA 4BRLA 2NRWA 3SPZA 3THYA 1CZ9A 3PY8A 1TAQA 4CGGA 4JV5K 2XY5A 3VQCA 4CJTA 1RT7A 3MEDA 2IOCA 2O8EA 4BC5A 4JRPA 1XUPO 3E66A 1X9MA 1GOAA 3L3VA 4N5SA 1DKGD 1ATRA 2NRRA 4GNIA 4FWMA 3A0IX 1C1AA 5CY4A 4DQ8A 3O4NA 3ZSZA 4IO8A 4E7IA 3VGKA 4DCHA 3QLHA 2Z1IA 3LWLA 5AZJB 1QSLA 3FFKB 2KLAA 2KW4A 1D8YA 3AO4A 2X6SA 5EXWA 1NJZA 3HOTA 4DR3K 3THYB 5JLHA 4A2AA 3V1OA 3E9PA 4C1NI 4OPHA 2PFUA 2A41A 2O8EB 4F9OA 3TABA 3A8YA 4K43A 5MLCQ 1N6QA 4Y0WA 2A1SA 1MDUB 2YHXA 4WYBA 1NGDA 2NRTA 5BR8K 1WUAA 3U4LA 1SQKA 4FOIA 4EIAA 2RPIA 1M90O 4FWLA 2ITMA 3QERA 1SS6A 4C8LA 4CEFA 3C6AA 1NMDA 4OPJA 4E1JA 4DTPA 2KZZA 1RCHA 3ISNC 1VQ4N 3Q7CA 2ITGA 1WBDA 3F9MA 3VQ8A 4CBUA 1GLEG 3NGIA 3PX4A 3PX6A 1T6DA 1TL1A 4GW6A 4A61A 2AP1A 4CD3A 3R8EA 3V9ZA 1BWFO 1WAJA 4FLVA 2F4VK 3CQ8A 1KCFA 1NGBA 4BR2A 1TK0A 5C24A 1JL2A 3S3OA 1TKDA 4JI2K 3SUQA 4ISEA 1QE1A 2BDPA 1KVAA 1YTAA 1WSIA 4CFDA 4DV4K 3THVA 3CPEA 3A2FA 4CFBA 2W42A 3LAKA 3DLLL 1XHZA 4CF1A 3OYHA 1QZ5A 2E4LA 4KBOA 4Z4EA 3CCQN 4IJAA 3OYLA 3DXKB 1HR0K 3O5BA 4DSIA 3ULDA 4GV9A 4BRAA 5AQTA 4DG1A 3CFOA 2QKBA 4FSVA 4MDAA 3M8PA 4JK9A 3LM2A 3QEWA 4DB3A 1Q18A 3AVAA 3CPWM 4MLEA 1GOBA 4OGEA 4B3OA 3BUZB 4IFVA 4ISGA 3ZSYA 3DRSA 4IOXA 3WXMB 4CJSA 1IKWA 2QEXN 4X64K 3CYMA 1VSMA 3KHYA 2VWJA 3OBYA 3KJVA 4GY2B 1P90A 4CEAA 5EU7A 1G15A 3ZETA 2IDOA 3P31A 1SAZA 1IO2A 4OLAA 3C7NA 4FJLA 2HHHK 4IJNA 3QICA 4DQPA 1VQMN 4YY3K 3D0PA 3ALYA 1J6ZA 2P9KA 4BG8A 3AAQA 1IG9A 2HBJA 2Y1IA 5C0YA 4E7JA 4FK2A 4CEDA 4KHNA 4NLBA 3CG7A 3SMPA 4CZMA 1S1UA 4B9VA 2OPRA 2E2OA 1S1WA 1OH5A 3ZETB 4WF9L 4B3TK 1NGJA 3C7NB 3SQ4A 2ASMA 3SAGA 1NBWA 1YF5L 1VSHA 2P9KB 4FWOA 3CCRN 1TUYA 1L3TA 3FGUA 1SKRA 4LF9K 5BREA 2QWLA 4CZHA 4BE1A 2NNWA 3O3GA 3VEVA 5HL7L 3ATUA 3C95A 5J2MA 2HB5A 4H4OA 4CGHA 1RDUA 3DWLA 2Q0UA 4JKCA 3HPHA 1RBUA 4LSNA 1IBMK 5EVZA 4LF7K 1DTQA 2FSNA 3VQ9A 1SUQA 3O1WA 2EX3A 1GLBG 3HPGA 1HNXK 4QAGA 4DTUA 4B9LA 4DSKA 2DY4A 1GLLO 4JD2B 4BR0A 3HYFA 1HKCA 3T1AA 3MN7A 3CJ1A 1ASWA 3SQ2A 4ZHRA 3TSUA 4X65K 5J2QA 3LZJA 5HRPA 1LV5A 1RBVA 4AHRA 4LY7A 4FJNA 4BG9A 4FJKA 1ZBHA 2UUAK 1B9DA 5I9EB 1NMNA 4OGCA 2IVNA 3WXLA 2IC3A 2E6MA 5AJ3K 4BWJA 1GLDG 1VQ8N 3AVIA 1W97L 3QEPA 2HHVA 2CH6A 4PL7A 2WC9A 1U47A 3ZSOA 3VQQA 4FM2A 2H3GX 5FROA 3CJ9A 1NK6A 2HW3A 3UIQA 5AQJA 4N47A 3RR8A 2O8FA 4F2RA 5FPDA 4FJ7A 3PSFA 2OPQA 3J81O 1ESVA 3FZLA 1H1VA 4ILGB 2FSKA 3VEYA 2UUBK 4YOXA 3NH0A 4MDBA 4FM0A 1JXEA 4H5TA 2G8VA 3OJSA 5HP1A 4DS4A 4BRKA 4CZGA 4FVMA 3J7YP 5JVGL 4OLBA 3IG1A 2V51B 1I39A 1GLFO 3T1YK 3PUFA 3VQ6A 4K25A 2A1RA 4WE1A 2HSTA 5KPRA 4CZLA 3AVJA 1XMOK 1NK0A 5EOYA 3CCLN 2P9SA 2Q97A 4WFAL 3MMVA 4DUZK 3O80A 4B08A 4JKFA 3G25A 1B9FA 3TAPA 1U04A 1NGGA 4DR6K 1QHTA 2IS3A 2VG5A 4QCLA 4K41A 3ZT4A 4WQ5C 3G10A 4AH9A 4OPKA 4WFBL 4GV6A 3OS2A 4A5BA 4JI3K 3V81A 4CJ7A 4BRIA 3I0SA 2DFHA 3IFRA 4AQYK 3L4QA 1TUUA 4B8CA 4C8MA 5KQ8A 1O1WA 3SUOA 2JGUA 3VENA 3JYTA 1C0UA 2JLEA 1LAVA 1BIZA 4CD1A 5BN9A 4HUGA 3OYAA 3O4QA 4CVNE 1U45A 4WFNL 3ID8A 4J2BA 1O13A 3KLEA 4HCBA 3CJCA 3LP1A 4H0OA 2QXFA 3NVMA 4DU4A 4B1WB 3OYKA 5C25A 1F21A 2WONA 3SMSA 3SPYA 3PO5A 4AHCA 1XC9A 4OKEA 2BH1A 1Z25A 1VQNN 3KZBA 5F1XA 2F8TA 1UA1A 5ADXA 4FJGA 5K14A 4A59A 4IKFA 3SYZA 1HNZK 1JLBA 1FKOA 3ITHA 5BPLA 4FLZA 1BISA 1K8KA 1N36K 2HHXA 3MCPA 3MX5A 1FW6A 4NCAA 1VK0A 4IEIA 1Q9YA 4TSXA 1VQ6N 2P9UA 1YHQN 3FE1A 3VQDA 1TKXA 4BQLA 1VQON 1JXBA 4HVJA 4Z4GA 3T1HK 1RTDA 1CXQA 3CQYA 4DWIA 3QMLA 3EE9A 3AARA 5AQGA 4AHUA 1J5OA 2E2QA 1K8KB 4DS5A 4AM7A 3AO3A 4PKHA 1HKGA 3WT0A 3GE1A 2OCEA 3CCUN 3I55N 4FWNA 2Y1JA 3Q7BA 1NNEA 2P9UB 1HKBA 3TAFA 3SBTA 1N33K 4LFCK 1Q8IA 4RW9A 3MWTA 4FWKA 4BDYA 2GTDA 4FXDA 3CXCM 3CCVN 4DKWA 1YVNA 5J2NA 4H8KA 4O44A 3FLCO 3K5OA 3J7AP 3L0QA 1DGKN 4JHDA 2ZGYA 3S41A 5KRSA 4DTJA 2PAVA 3LPTA 5AQIA 2QWRA 3KKSA 1NKCA 3DOKA 2V7YA 2BE2A 3KK7A 3V1RA 4FYDA 1KRPA 2GWKA 4FK0A 1LAWA 1HYVA 2D4WA 3AO1A 4KTZA 3C94A 5E84A 3DLHA 3V9XA 1REVA 4EZ9A 4JHDB 3QNNA 3OY9A 1S6QA 1YIJN 4WQ4A 3GL1A 3SJJA 5B8HA 1NKEA 4DTSA 4ID1A
chains in the Genus database with same CATH topology
4WYBA 1NGDA 2NRTA 2YJEA 4JD2A 1WUAA 5C15A 1S72N 3U4LA 1SQKA 4M7YA 4BR9A 3P4IA 5C12A 3KWGA 4HWIA 4FOIA 1ATSA 4EIAA 4XH4A 1M90O 4EFHA 3W3DA 3D2EA 4FWLA 2ITMA 1SS6A 3VERA 2Q0RA 2VGNA 2CH5A 3MK6A 3C6AA 4WQ5A 3MWPA 4ILHA 1NMDA 1MA9B 4E1JA 1ZBSA 1KAXA 3TPQA 4LC9B 1VQ4N 2OTJN 3Q7CA 2VYPA 4JKDA 2EWSA 3F9MA 4CBUA 1GLEG 1U2VB 3NMUA 4JEPA 1T6DA 2VWBA 5EX5A 4EAHD 4A61A 2AP1A 3UE5A 4CD3A 3R8EA 4EHUA 4Z94A 4PKGA 3U8XA 4AM6A 1BWFO 4MO5A 4BC2A 1BG3A 2Q31A 2YX6A 4BR2A 1NGBA 5LJWA 3I56N 4JN4A 5M1QA 4FVUA 2QXLA 1NWKA 3D2EB 5AQQA 2YHWA 3O08A 4ISEA 4H5NA 2A3ZA 2QI2A 3EZWA 4H03B 3WQTA 4QS8A 3O9RA 5AQHA 4B1YB 1X9JA 4J8FA 3CPEA 3JS6A 3JXUA 1RGIA 2D0PA 3IDHA 3LDOA 4XH1A 3DLLL 3ZYYX 3B8AX 3AY9A 5E26A 3P38A 1QZ5A 4H5RA 4KBOA 3CCQN 2P9NB 4XH5A 4IJAA 1ATNA 3HZ6A 3WXJA 3DXKB 3LM9A 3O5BA 1QHAA 1NGHA 3C65A 1Z6RA 3N4QA 5AQYA 4GV9A 1VAZA 1K73O 3CMEN 4BRAA 4CZKA 5AQTA 4PHTX 4RWTA 1X3NA 4FSVA 4MDAA 5FPNA 4OPAA 2GWJA 4JK9A 4BRCA 4BRHA 3LM2A 2IVPA 2E1ZA 4DB3A 3CMAN 1Q18A 1V4SA 3CPWM 4MLEA 3OHRA 2ASPA 3DXMA 1EO1A 3O9QA 3BUZB 4ISGA 2HMPA 2OTLN 2Q1NA 2QW9A 2A40A 2PBDA 5BRHA 4IOXA 3WXMB 3VEXA 1JCGA 3A5OC 2QEXN 3VOVA 3VETA 3KHYA 4B1ZA 3OBWA 3OBYA 4IEEA 4B1UB 1YXQA 3U9ZA 4GY2B 3HI0A 3TTFA 1P90A 3EKUA 3CERA 1IG8A 3ZETA 3P31A 5M1NA 5KPTA 1SAZA 3MN5A 4GVEA 3HM8A 3C7NA 3VGMA 5HOOA 4IJNA 3QICA 3VF4A 1E4FT 3EN9A 5DM7L 1ILYA 1VQMN 2HBLA 1J6ZA 2P9KA 3L4IA 4BG8A 4CZIA 3AAQA 4H0XB 3VEWA 3M5RA 3SAHA 2HBJA 1MWKA 2E1YA 3DXMB 4O5FA 2KKZA 1YUWA 2UYTA 5C0YA 1VQLN 1T44A 3I33A 3ID6A 2FSJA 4NLBA 4WQ4C 3SMPA 4QS7A 4JKEA 5CHIA 3N4PA 1CZAN 4CZMA 2CGKA 1X3MA 3EL2A 4YDUC 3ZX2A 3G4SN 1OKJA 3CC2N 4BRMA 2E2OA 1VQKN 4ISFA 1YAGA 1T3VA 3HTVA 1HX1A 4H5WA 2Q2RA 4CBWA 3F5TA 5DM6L 1MWMA 3ZETB 4GV3A 3VGLA 4WF9L 1YJ9N 5JLFA 1NGJA 3C7NB 4BVOA 2ASMA 3SBGA 1V4TA 2QWPA 3WEEA 3SAGA 1NBWA 1YF5L 2P9KB 2WFBA 3LDPA 5FPEA 4JKAA 4FWOA 5GIOA 3CCRN 1TUYA 3FGUA 3FR0A 2IVOA 1KC8O 3TSQA 1GLAG 5BREA 3MCAB 4HTLA 5ELZA 5AQWA 3ZX0A 2E2PA 2QWLA 5GAEP 5AFUA 5F2RA 3J7ZO 2BUPA 3C6HA 1BA0A 4CZHA 2NNWA 1VQ9N 4OO1J 1ZC6A 3MN9A 3FZKA 3IMXA 3WQUA 2YCHA 2CGJA 3J8AA 3VEVA 3CD6N 5HL7L 3ATUA 3LDQA 3M1FA 1NGCA 5KQDA 1RDUA 1BU6O 3DWLA 2Q0UA 2QTDA 3H3NO 4JKCA 4IOAL 5AQVA 2ZWHA 3D2FA 3G6EN 4MLHA 4YOVA 3VTIA 5EVZA 3F2KA 3A5MC 4BREA 4B1VA 2QA4N 2FSNA 1BUPA 3R9PA 2F9TA 3QB0A 3CJ7A 4BC4A 4BVPA 3WEEB 3O1WA 1GLBG 4FPAA 4JKGA 1QZ6A 4JNEA 3GG4A 1SZ2A 3ATVA 5AR0A 1HPMA 3SJHA 3H46O 5M1OA 2BTFA 1GLLO 2ASOA 4JD2B 4UY8O 4BR0A 1HKCA 3O8MA 2E20A 3MN7A 3CJ1A 3NVKA 3O9SA 3DJCA 4IDHA 3CCEN 5AZIA 3A5LC 1K8AO 3AGRA 3TSUA 1KQSM 1YJNN 2VGMA 1JCEA 1RFQA 3D2FB 3QFUA 4A5AA 3CJBA 4BG9A 1Y64A 4YORA 5M1PA 2RE2A 1Q7YO 3PLAA 3VMFB 3ENBA 5I9EB 4NLCA 2IVNA 3WXLA 1GLDG 4B9QA 1KAYA 1VQ8N 3MDQA 2I7PA 4R79A 4KH6A 5AQKA 1W97L 3R3LA 2ZJRL 3GOIA 4A57A 3E9OA 5AQMA 2CH6A 3WXKA 4PL7A 2WC9A 4U67L 2QWQA 3HSCA 3VTHA 2H3GX 4L3QA 3CJ9A 2FF6A 1K9MO 3T69A 3VF2A 5AZIB 3WUHA 5AQZA 2CGLA 5AQJA 2NRVA 1XC3A 3KWIA 5GAGP 4MO4A 1NGFA 5AFUH 4AF1A 2HBKA 4FPBA 5FPDA 1N8RO 3QBXA 3MN6A 1ESVA 3FZLA 1H1VA 3R1XA 4KH5A 2ZJQL 2JWLA 3SLCA 3HBTA 4ILGB 2FSKA 3VEYA 5GAHP 2VCPA 3W0LA 4YOXA 4MDBA 1W2BM 2YI1A 1BA1A 4NO7A 4H5TA 3UKUA 5LJVA 3PIPL 2F7TA 3O1BA 5JVHL 3CI5A 1KXPA 3EKSA 1OVYA 3L6QA 2ZJPL 3EE8A 4BRKA 3CCSN 2FF3B 4CZGA 1QVGM 1M1KO 1U6ZA 1JCFA 5JVGL 1T6CA 2HOEA 4FWQA 4KH4A 2V51B 2YJFA 1GLFO 2AA4A 4FL9A 3H1VX 3LDLA 4XEIA 5BPMA 3OA9A 4K25A 2FXUA 2GUPA 2HSTA 5KPRA 1QQOA 2I7NA 4CZLA 1C0FA 1YI2N 1JJ2M 4EHTA 2DPNA 4JKBA 4I6MA 1RDWX 5EOYA 5CE3A 4FOEA 3ZX3A 5BN8A 2ZF5O 3CCLN 3UKUB 4FWRA 2P9SA 2Q97A 5GIPA 2P9LA 4WFAL 1KD1O 3MMVA 1QQNA 2OANA 3O80A 4BY9C 1BO5O 4JKFA 3G25A 4JK8A 1NGGA 5JICA 3UKRA 5AQXA 1Q86O 2V52B 2HF4A 4BRQA 4K41A 1NGAA 4O8KA 1EQYA 4C23A 5C10A 5TKYA 4WQ5C 4YOTA 4ILJA 3MX2A 4WFBL 3LL3A 3WXIA 4GV6A 4A5BA 1VQ5N 3CF5L 4CJ7A 5LY3A 3VESA 2QWNA 3BF3A 4RTFD 4BRIA 4BRGA 2HBMA 3H3OB 5BPNA 2P9PA 3FZFA 3OW2M 3IFRA 5F0XA 1HJOA 2YHYA 3L4QA 1TUUA 2GELA 5AQSA 1Q81O 4PKIA 4I6MB 2E2NA 5AQUA 2RHKA 5KQ8A 3VENA 2NRXA 3RVCA 2QM1A 4M63C 1QVFM 2P9LB 2FLOA 3M6GA 2JWKA 3C0BA 4CD1A 3HOSA 5BN9A 2IIRA 3CHWA 3CETA 4DHYA 4BGAA 1XQSC 3HRGA 2ZGZA 3ID8A 3UKRB 4H0YB 5AQPA 1O13A 4A2BA 5M1KA 4WFNL 3CJCA 1P8ZA 1WOQA 3FZHA 4YDUA 4BR7A 4H0OA 3AAPA 3NVMA 3TU5A 4B1WB 3CCMN 3A5NC 4H0VB 4C1NK 2F9WA 3VPZA 5AQNA 5FPMA 3SMSA 3SAFA 1NLVA 4H0PA 4BRNA 1QQMA 2P9PB 3PIOL 4JK7A 3ENHA 3QBWA 3O6WA 2BH1A 3G71N 1VQNN 5BR9A 4H0TB 3CCJN 2E8AA 3ULEA 3H45C 3KZBA 4IO9L 2GEMA 5F1XA 1C0GA 5AQRA 4NB4A 3T7ZA 1DEJA 5ADXA 5BRFA 1VQ7N 2KHOA 5C2DA 3RSEA 3QDKA 3DAWA 4YOWA 4BR5A 1G99A 4A59A 2P9NA 1Z05A 3SK3A 3DXKA 3D6RA 5BPLA 4M7XA 3D7EO 2HF3A 3BP8A 2NRZA 1K8KA 4JKGB 5CR4A 4CBXA 1E4GT 2GX9A 1LCUA 1TYQA 3ZEUA 2W41A 3MCPA 3MX5A 1YJWN 3TSPA 3EO3A 4IEIA 3VEZA 3I8BA 3TTDA 4QS9A 4BQZA 3CQXA 1GLCG 2D0OA 1KAZA 1D4XA 4H5VA 4YOYA 4YOUA 1NM1A 1HUXA 1VQ6N 3ULEB 2P9UA 1YHQN 1DT9A 4BRDA 3FE1A 5M1FA 5TKWA 3M3ZA 3BEXA 4BQLA 3GBTA 1NGEA 1VQON 4BC3A 2J4RA 3CIPA 5BRDA 4PL8A 4IFEA 5AQOA 3RSEB 1Q82O 3CQYA 3O9UA 2NRHA 5GINA 1HLUA 2E88A 3QMLA 3GDQA 4RCHA 4A62A 3EE9A 4BGBA 4IOCL 4FO0A 3AARA 3ENOA 5AQGA 2E2QA 1S3XA 3UB5A 1K8KB 2QWMA 4BRPA 4JAXA 1TYQB 3ZEUB 4AM7A 3LDNA 2A42A 3E1YA 4BR4A 3K9KA 4PKHA 5AQLA 1HKGA 2WUSA 3GE1A 5AQFA 3WT0A 3CCUN 3QFPA 3VF6A 4BRFA 4FWNA 3I55N 3VEOA 2NZTA 1YITN 5B8HA 3Q7BA 1GLJO 3O4WA 2P9UB 3KVGA 5AZJA 1HKBA 5GADP 3P39A 4K42A 3IKMA 3K9JA 1NGIA 3IUCA 3H6EA 3SBTA 4BRLA 2NRWA 3MWTA 4FWSA 2A5XA 3FZMA 4FWKA 1ZXOA 2GTDA 2V7ZA 2D1KA 3CC4N 3CXCM 3CCVN 4U7BA 5ADXH 4DKWA 1YVNA 3TTCA 4IWVA 3FLCO 1BDGA 4BC5A 5JMVA 1XUPO 3E66A 3L0QA 3R6MA 1DGKN 3CC7N 1DKGD 4JHDA 1ATRA 2NRRA 4GNIA 2P9IA 1IJJA 3A0IX 4FWMA 2ZGYA 3S41A 4DQ8A 4IO8A 4WCEL 3VGKA 4DCHA 2PAVA 4CZJA 5AQIA 1NJIO 2QWRA 5AZJB 1LOTB 5C2FA 3FFKB 2KLAA 2NLXA 5KPZA 4CZEA 5EXWA 1VQPN 1R59O 4CI6A 2V7YA 3HOTA 3CJAA 3KK7A 5JLHA 2GWKA 4O8UA 2W40A 4A2AA 3E9LA 3E9PA 4IXCA 1BOTO 4OPHA 4C1NI 4CZFA 2PFUA 3AGKA 3O9TA 1S22A 3H1QA 2D4WA 2A41A 2P9SB 5E84A 2QWOA 4FWPA 5H1SQ 4IZ9A 2Q36A 3BF1A 5EY4A 4F9OA 4BROA 4JHDB 3A8YA 4B1XB 2P9IB 4K43A 1YIJN 2A6AA 3U9DA 1U2VA 4WQ4A 4Y0WA 3GL1A 5MLCQ 1MDUB 2WBNA 2YHXA 4JKHA 4G9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWL A;  2PFU A;  2JWK A; 
#chains in the Genus database with same CATH topology
 4EP4 A;  1IV0 A;  3MXM A;  2Z1H A;  1S72 N;  3SI6 A;  3P4I A;  3KWG A;  3P83 D;  4XH4 A;  3W3D A;  3D2E A;  2GBZ A;  2Q0R A;  3MK6 A;  3RRH A;  4MFB A;  4ILH A;  1BI4 A;  4OKK A;  1TGO A;  1ZBU A;  2VYP A;  3KK2 A;  4ELT A;  3VQB A;  2VWB A;  4DV0 K;  1K6Y A;  4ICL A;  4EHU A;  4Z94 A;  3U8X A;  1BIU A;  3HP9 A;  4DV2 K;  4JN4 A;  1NWK A;  3D2E B;  4DMN A;  1RBS A;  4KRF A;  3EZW A;  2QI2 A;  4H03 B;  5CZ2 A;  1NJX A;  1X9J A;  2NUB A;  1BI4 B;  1NJW A;  1C0M A;  3JXU A;  1TL3 A;  4DSL A;  4FW1 A;  1WAF A;  3I8D A;  3AY9 A;  2EHG A;  3P38 A;  2YHA A;  2P9N B;  1ATN A;  3HZ6 A;  4CJ5 A;  4LSL A;  3OVN A;  2Z1J A;  4CF0 A;  4JI4 K;  1VAZ A;  3AVG A;  4ELU A;  4CZK A;  4PHT X;  3KLI A;  4HUE A;  3K59 A;  4BRH A;  2E1Z A;  3CMA N;  4B3R K;  4KHW A;  4AHS A;  2ASP A;  1EO1 A;  2OTL N;  1T8E A;  5BRH A;  4JI6 K;  4FJM A;  3VEX A;  1JCG A;  4BE0 A;  1XNQ K;  4FW2 A;  3VOV A;  3VET A;  1RBR A;  4IEE A;  4B9S A;  4HUF A;  4CE9 A;  4CJV A;  5KPT A;  3AVH A;  1BQN A;  5DM7 L;  1E4F T;  3QES A;  4K8Z A;  3SUN A;  3OYE A;  5D3G A;  3VEW A;  3M5R A;  3SAH A;  4EP5 A;  2KKZ A;  1YUW A;  3HO1 A;  2G8I A;  1RT3 A;  2KZM A;  1T44 A;  3I33 A;  4QS7 A;  1VSK A;  4JKE A;  3N4P A;  3CM5 A;  3G4S N;  2CGK A;  3ZX2 A;  4YDU C;  3K57 A;  3BGR A;  3WNH A;  1VQK N;  1ASV A;  4CBW A;  1T3V A;  3HTV A;  4H5W A;  3F5T A;  1MWM A;  4GV3 A;  4DLE A;  1C1B A;  1C6V A;  4HHT A;  4E7K A;  3CM6 A;  1V4T A;  3DLG A;  1HQE A;  4FK4 A;  3AVF A;  3NF9 A;  2F8S A;  3LDP A;  5HRO A;  1TAU A;  2UXD K;  2XO7 A;  1LWC A;  1ZBI A;  2D0C A;  3ZX0 A;  2E2P A;  1NOY A;  5AFU A;  5F2R A;  3J7Z O;  4KTW A;  4F4K A;  3HP6 A;  3MN9 A;  4Y1D A;  3FZK A;  1SL2 A;  3CD6 N;  2F96 A;  3AVL A;  3J8A A;  3C6T A;  3K2P A;  3IRX A;  2X74 A;  2XHB A;  2P51 A;  3P1G A;  4CK1 A;  2B5J A;  3M1F A;  3THX A;  1KTQ A;  3IS9 A;  3PX0 A;  4FLW A;  4IOA L;  1VSI A;  4DLG A;  4MLH A;  4DV6 K;  4BRE A;  4B1V A;  1NK5 A;  3LP2 A;  3R9P A;  4DSJ A;  2F9T A;  3BZC A;  1WB9 A;  4BC4 A;  1JLE A;  4CIG A;  5CYQ A;  4FPA A;  4JNE A;  4CGJ A;  3GG4 A;  1J5E K;  1SZ2 A;  2G8K A;  4OKJ A;  3O8M A;  3H08 A;  4JRQ A;  3NVK A;  4IDH A;  3CCE N;  1UOC A;  2GV9 A;  1K8A O;  3QIP A;  4E1M A;  1KQS M;  3NGY A;  3ZCM A;  4A5A A;  1WLJ A;  3PLA A;  2Z1G A;  3ENB A;  4CGD A;  1X9W A;  2PZS A;  4B9Q A;  3MDQ A;  1EXQ A;  2I7P A;  4M41 A;  4R79 A;  5AQK A;  4KAZ A;  4KV8 A;  3SZ2 A;  4LF4 K;  1NKB A;  1HYS A;  1ZYQ A;  2FC0 A;  3VQA A;  2HHU A;  2FF6 A;  5AQZ A;  2CGL A;  1KLM A;  2X6N A;  5GAG P;  3L2W A;  2AJQ A;  4Z4C A;  1N8R O;  4NCG A;  3QBX A;  3R1X A;  2ZJQ L;  5GAH P;  2VCP A;  3ZT2 A;  3W0L A;  4NO7 A;  5LJV A;  1NK7 A;  5JVH L;  3VA0 A;  4LH5 A;  1JLQ A;  1OVY A;  4CJ3 A;  3F9K A;  3EE8 A;  3NE6 A;  4O55 A;  2AA4 A;  4DQS A;  4FL9 A;  3H1V X;  3OA9 A;  3QO9 A;  4CCH A;  2I7N A;  1VRU A;  3AA4 A;  4PQU A;  1KD1 O;  2RKI A;  4FZZ A;  4BY9 C;  4JK8 A;  3UKR A;  5HRR A;  1Q86 O;  2V52 B;  3VQE A;  3HXM A;  2XY7 A;  1NGA A;  4O8K A;  1EQY A;  4ILJ A;  1S1T A;  3LL3 A;  3EY1 A;  3DRR A;  2QWN A;  3I0R A;  5LMN K;  5BPN A;  2P9P A;  3OW2 M;  1HJO A;  3KLH A;  5AQU A;  2RHK A;  2O8C A;  4YHH K;  4CER A;  4FJH A;  3VN5 A;  2FLO A;  3C0B A;  1QSS A;  1UWB A;  4DU1 A;  3HRG A;  5I42 A;  3UKR B;  5AQP A;  1N32 K;  4CJU A;  1P8Z A;  3FZH A;  4BR7 A;  4E3S A;  1DLO A;  2HHT A;  3TU5 A;  2W6L A;  4H0V B;  4C1N K;  2F9W A;  3RMB A;  5FPM A;  4BRN A;  1QQM A;  1EWR A;  2P9P B;  4UQG A;  1WSG A;  3PIO L;  3ENH A;  2B4J A;  4X66 K;  4BAC A;  3G71 N;  3AA3 A;  5BR9 A;  2O8C B;  3KIO A;  3ULE A;  1OH6 A;  3H45 C;  1N34 K;  1C0G A;  1DEJ A;  5BRF A;  2KHO A;  3DAW A;  2WOM A;  3IAY A;  1GOC A;  3D6R A;  3BP8 A;  3DYA A;  5CR4 A;  3S3N A;  1E4G T;  1YJW N;  1LCU A;  1R0A A;  4E0D A;  3TSP A;  3HJF A;  4JI1 K;  3EO3 A;  4JS5 A;  3VEZ A;  1KAZ A;  4DFM A;  4H5V A;  1QS4 A;  3HST B;  1HUX A;  3ULE B;  4BRD A;  5TKW A;  4F3O A;  3GBT A;  4BC3 A;  2J4R A;  4PL8 A;  5AQO A;  5KRT A;  3O9U A;  5GIN A;  1HLU A;  2E88 A;  4LF8 K;  3GDQ A;  4A62 A;  4FO0 A;  3HT3 A;  2PYL A;  3AVB A;  4GKJ K;  4KB1 A;  4Z4I A;  3ZT3 A;  4BR4 A;  5C42 A;  3SV4 A;  5E41 A;  2ZQB A;  3F73 A;  4HTU A;  3S9H A;  1YIT N;  4JI0 K;  3DOL A;  5DMR A;  1NG9 A;  2RN2 A;  3P39 A;  3OS1 A;  1KLN A;  2O8F B;  1NGI A;  5J2P A;  2I5J A;  3B6O A;  2A5X A;  4I7F A;  4B3S K;  5LMU K;  2V7Z A;  1HQU A;  4CEO A;  3CC4 N;  1VSF A;  4DSE A;  2P5G A;  3TTC A;  4YNQ A;  5T7B A;  4KHQ A;  4PWD A;  3R6M A;  3V9U A;  4M42 A;  3KTQ A;  1NOZ A;  3LWM A;  3K58 A;  1NJI O;  3PSI A;  4CEZ A;  4F2S A;  5C2F A;  3LDS A;  1CXU A;  2NLX A;  5KPZ A;  4BWM A;  1S9G A;  4CIE A;  4I9Q A;  1R59 O;  2D5R A;  3CJA A;  4J2D A;  3E9L A;  2FBY A;  4CW7 B;  4CZF A;  3O9T A;  1S22 A;  2P9S B;  1T7P A;  2QWO A;  4IZ9 A;  4KI4 A;  2Q36 A;  5EY4 A;  3BY5 A;  2A6A A;  4CEB A;  2G8H A;  4KPY A;  1NU0 A;  4LF6 K;  4JI8 K;  3ZT0 A;  1J53 A;  3ZT1 A;  5C15 A;  4DTR A;  3MXI A;  4M7Y A;  5C12 A;  4DUY K;  3LAL A;  1I3A A;  4EFH A;  3O3H A;  3LP0 A;  5KTQ A;  1A5X A;  2QK9 A;  4WQ5 A;  1MA9 B;  4J2A A;  1ZBS A;  1KAX A;  2UXC K;  4LC9 B;  2OTJ N;  4JKD A;  2EWS A;  1U48 A;  1EWQ A;  2KFZ A;  3K5N A;  3UE5 A;  1RTH A;  3ZSR A;  4MO5 A;  4E1N A;  4C8N A;  1BG3 A;  2YX6 A;  5LJW A;  3THW A;  4FVU A;  2QXL A;  2E6L A;  2YHW A;  4JI5 K;  4M45 A;  4LH4 A;  4H5N A;  4QS8 A;  3O9R A;  4K8X A;  4CK2 A;  4J8F A;  4FZX C;  3L3U A;  2FBX A;  1RGI A;  2D0P A;  4CEE A;  3QEV A;  2O8B A;  3IDH A;  4XH1 A;  4Z4H A;  1QSY A;  5E26 A;  4H5R A;  1EKE A;  3LZI A;  3LM9 A;  1QHA A;  5HLF A;  3C65 A;  1Z6R A;  3N4Q A;  4OVL A;  5FRM A;  1K73 O;  3THW B;  1X3N A;  4CK3 A;  5FPN A;  4OPA A;  2GWJ A;  3WNF A;  1KFS A;  1S1V A;  2IVP A;  4O0J A;  3OHR A;  4CGF A;  2HMP A;  4FLY A;  2QW9 A;  2A40 A;  2PBD A;  2G8W A;  4FJ8 A;  4B9T A;  2O8B B;  4DV7 K;  2VG6 A;  3OBW A;  4B1U B;  3U9Z A;  3HI0 A;  3S3M A;  3KD5 E;  3EKU A;  3CER A;  5KGW A;  1VSJ A;  3SCX A;  1RTI A;  3FFI A;  1I94 K;  2YNI A;  4GVE A;  1VHX A;  3V4I A;  1ZBF A;  2HMI A;  2YHB A;  1A5V A;  2HBL A;  1HJR A;  3L4I A;  1IKV A;  4FCY A;  4DQR A;  1MWK A;  3JSM A;  2UYT A;  3EZ5 A;  4OJR A;  4CFC A;  1VQL N;  3NDK A;  3U6F A;  4WQ4 C;  2VQE K;  1CZA N;  1X3M A;  4AHT A;  1D9F A;  2ATQ A;  4BRM A;  1YVU A;  4ISF A;  1YAG A;  1BQM A;  3SQ0 A;  4CGI A;  2Q3S A;  5DM6 L;  3G0Z A;  4NXM K;  3VGL A;  1LWE A;  3QIN A;  4BVO A;  5JS1 A;  2QWP A;  3KD1 E;  5FPE A;  4N41 A;  4JKA A;  2GUI A;  3FR0 A;  1KC8 O;  1BCO A;  1GLA G;  1IH7 A;  3MCA B;  1OVQ A;  5ELZ A;  2BUP A;  1RT6 A;  4M3Y A;  1VQ9 N;  3DRP A;  4DFP A;  2CGJ A;  1QTM A;  4Y1C A;  3O3F A;  1BL3 A;  4CEC A;  3G6E N;  2ZWH A;  4DFK A;  4PUO A;  3F2K A;  3A5M C;  1YTU A;  2QA4 N;  3M8R A;  4BVP A;  2YNH A;  4O4G A;  4JKG A;  1QZ6 A;  5AR0 A;  1HPM A;  3DLR A;  3DLB A;  2ASO A;  4UY8 O;  3VQ5 A;  2D0A A;  3O9S A;  5HRN A;  3NF7 A;  5AZI A;  4O5B A;  1XI1 A;  1FKP A;  1KVB A;  4F8R A;  4NCB A;  2DTU A;  3AGR A;  3OYN A;  1JCE A;  1RFQ A;  1U4B A;  3QFU A;  3CJB A;  1Y64 A;  5M1P A;  1Q7Y O;  2RE2 A;  3KLG A;  4NLC A;  4H4M A;  4DF8 A;  3L2U A;  2KFN A;  4KH6 A;  3GOI A;  4A57 A;  3E9O A;  5AQM A;  3WXK A;  4U67 L;  3K5L A;  3VTH A;  4DU3 A;  4GVM A;  4DR1 K;  1K9M O;  4RW4 A;  3T69 A;  5AZI B;  3VF2 A;  1RIL A;  3WUH A;  1X1P A;  1VRT A;  2NRV A;  4FJJ A;  4NXN K;  4MO4 A;  4FPB A;  3OJU A;  3V6D A;  3MN6 A;  4W5O A;  3E01 A;  2JWL A;  3SLC A;  3HBT A;  1XMQ K;  1JLC A;  1DTT A;  2YI1 A;  1BA1 A;  2HHQ A;  1JL1 A;  3UKU A;  3PIP L;  2F7T A;  3CI5 A;  3KKR A;  4MQ3 A;  3CCS N;  3T19 A;  1ASU A;  4FLX A;  1T6C A;  1WSF A;  4FWQ A;  4XEI A;  3SUP A;  2FXU A;  4KKO A;  2GUP A;  1QQO A;  3QNO A;  1WSE A;  4W5Q A;  1YI2 N;  1JJ2 M;  4EHT A;  2W6K A;  2DPN A;  4JKB A;  4I6M A;  1KVC A;  1RDW X;  4FOE A;  4Z4F A;  2ZF5 O;  4RW7 A;  3UKU B;  3MEG A;  5GIP A;  3AO5 A;  1YT3 A;  2OAN A;  4FZY A;  1TKZ A;  5AQX A;  1SL0 A;  4Q0B A;  1JLA A;  4BRQ A;  4FJ5 A;  4CHQ A;  1U49 A;  3OS0 A;  2HND A;  3DLE A;  5TKY A;  3NBP A;  5C10 A;  4W5R A;  3HM9 A;  4BDZ A;  3MX2 A;  3SNN A;  3CF5 L;  3DI6 A;  3VES A;  3BF3 A;  4QOZ B;  1XWL A;  4B9N A;  3H3O B;  2BAN A;  1RT4 A;  1D5A A;  3VA3 A;  3FZF A;  2YHY A;  2GEL A;  5AQS A;  4PKI A;  4I6M B;  2E2N A;  3OTO K;  4I2P A;  2NRX A;  3RVC A;  2QM1 A;  3ZSQ A;  1EP4 A;  2LSN A;  2IIR A;  3CHW A;  4DHY A;  4BGA A;  2HHS A;  1XQS C;  1S5J A;  4H0Y B;  5M1K A;  3OYD A;  4YDU A;  4DTN A;  3AAP A;  1OH8 A;  3CCM N;  3A5N C;  1WSH A;  2D0B A;  4JK7 A;  3C6U A;  4DR2 K;  3O6W A;  1NK8 A;  2O4G A;  4H0T B;  3CCJ N;  2E8A A;  3HL8 A;  3TAG A;  2HNZ A;  3L2R A;  4M3X A;  4B9U A;  3THX B;  5AQR A;  3T7Z A;  1RDC A;  3RSE A;  4YOW A;  1KSP A;  4FLU A;  4E89 A;  1Z05 A;  3DXK A;  2WTU A;  4CBX A;  1RTJ A;  2W41 A;  1KFD A;  4CEQ A;  4M3Z A;  3I8B A;  4IFY A;  4BQZ A;  3CFP A;  1D4X A;  4IBN A;  1HNI A;  4YOU A;  1NM1 A;  1DT9 A;  4F3T A;  5M1F A;  3CFR A;  3QIO A;  1NGE A;  3CIP A;  4DFJ A;  5BRD A;  4IFE A;  3RSE B;  1WSJ A;  3QEI A;  1RT1 A;  4RW6 A;  1QVG M;  4PY5 A;  3NF8 A;  4BGB A;  5KI6 A;  1S3X A;  3UB5 A;  4DV5 K;  3HVT A;  1A5W A;  4JAX A;  3LDN A;  3K9K A;  5AQL A;  1S1X A;  2OPP A;  4BE2 A;  1C0T A;  1IKY A;  3QFP A;  3VF6 A;  4BRF A;  4DTX A;  3VEO A;  3RRG A;  3EYZ A;  3O4W A;  3KVG A;  5GAD P;  3K9J A;  5DK5 A;  3H6E A;  4ID5 A;  4CJ4 A;  3JAM O;  3OYG A;  4CHO A;  4FWS A;  3TAQ A;  3FZM A;  2YNF A;  1ZXO A;  2D1K A;  3U3G A;  3V1Q A;  1RDD A;  2O4I A;  4U7B A;  4B8A B;  5ADX H;  1TK8 A;  4JYA K;  3RMC A;  4G1Q A;  4IWV A;  4CJF A;  4DTM A;  3BZK A;  1BDG A;  5JMV A;  3NGZ A;  3CC7 N;  4RWT A;  2P9I A;  1IJJ A;  4WCE L;  4CZJ A;  4ELV A;  4CIF A;  1LOT B;  1TKT A;  1L3S A;  4CZE A;  1WBB A;  1IBL K;  1VQP N;  4CI6 A;  4FJX A;  1UAX A;  5KGX A;  4O8U A;  2W40 A;  4CJP A;  4JI7 K;  4IXC A;  3NH1 A;  1XNR K;  1BOT O;  3LAN A;  3AGK A;  3J80 O;  2XY6 A;  3H1Q A;  5CYM A;  4FWP A;  5H1S Q;  3OYM A;  4Z0U A;  3TWH A;  3OYI A;  3BF1 A;  4BRO A;  4B1X B;  2P9I B;  3U9D A;  1U2V A;  4KHS A;  3HVR A;  2HVH A;  3LP3 A;  2ETJ A;  2WBN A;  4JKH A;  3TPQ A;  4G9Z A;  1VSE A;  1EX4 A;  2FBV A;  3OYF A;  1D9D A;  2DFF A;  4JD2 A;  2YJE A;  1JLG A;  4J2E A;  4PA1 A;  4BR9 A;  3TAM A;  4HWI A;  4RG8 A;  1ATS A;  3DLK A;  5IT9 O;  2IAJ A;  4LF5 K;  3VER A;  1UA0 A;  2VGN A;  2CH5 A;  1SL1 A;  3MWP A;  3KK1 A;  2G8F A;  4M3T A;  1U2V B;  4K0K K;  1VSD A;  4JEP A;  5EX5 A;  3NMU A;  1HPZ A;  4EAH D;  4EZ6 A;  2BGG A;  2VG7 A;  4NYF A;  4CJK A;  4CF9 A;  4PKG A;  4AM6 A;  2VWK A;  4BC2 A;  2Q31 A;  3TAE A;  4B3M K;  3I56 N;  4GKK K;  5M1Q A;  1RT5 A;  5AQQ A;  3K0S A;  3O08 A;  4O0I A;  4CJR A;  3KLF A;  2A3Z A;  3WQT A;  4B1Y B;  3RMA A;  5AQH A;  1BGX T;  4B9M A;  3L8B A;  4DV1 K;  1HNW K;  3JS6 A;  4DF4 A;  3ZSW A;  3LDO A;  1W0H A;  3ZYY X;  4M3W A;  3B8A X;  5HBM A;  4XH5 A;  4DSF A;  3WXJ A;  5IWA K;  1NGH A;  4DR4 K;  5AQY A;  3SV3 A;  1T03 A;  3CME N;  3QET A;  2UU9 K;  3L2Q A;  4BRC A;  3HPO A;  1V4S A;  4I9L A;  2O8D A;  3DXM A;  3O9Q A;  4KB0 A;  2Q1N A;  1S6P A;  3AVC A;  1B92 A;  3A5O C;  1E3M A;  3NFA A;  4B1Z A;  1YXQ A;  4CJL A;  5SZT A;  1W9H A;  3TTF A;  1LW2 A;  4DQQ A;  3VQP A;  1IG8 A;  5M1N A;  3MN5 A;  3HM8 A;  4IDK A;  5CZ1 A;  2OZS A;  4HCC A;  3VGM A;  5HOO A;  3PV8 A;  3VF4 A;  3EN9 A;  1ILY A;  5FLX O;  1NJY A;  2YNG A;  3B6P A;  3SQ1 A;  4CZI A;  4H0X B;  4CHP A;  4KHY A;  2O8D B;  3DXM B;  2E1Y A;  4O5F A;  2KTQ A;  4FJI A;  3ID6 A;  2FSJ A;  3TI0 A;  1CLQ A;  1L3U A;  5CHI A;  3HK2 A;  3MXJ A;  3EL2 A;  4KHU A;  1HRH A;  1OKJ A;  3CC2 N;  1RBT A;  1HX1 A;  2Q2R A;  1YJ9 N;  5JLF A;  1MU2 A;  4DTO A;  3AV9 A;  5FDL A;  1RDA A;  3SBG A;  3PO4 A;  4CF2 A;  3WEE A;  4M3U A;  2WFB A;  1VSL A;  3WNG A;  5GIO A;  1HYZ A;  1L3V A;  2IVO A;  3RWU A;  3TSQ A;  2HVI A;  4HTL A;  5AQW A;  1JKH A;  5GAE P;  1IKX A;  4JS4 A;  3C6H A;  1BA0 A;  2OPS A;  4OO1 J;  4DR5 K;  1ZC6 A;  3WQU A;  3IMX A;  3OYC A;  2YCH A;  3LDQ A;  5KQD A;  1NGC A;  2YKN A;  1BU6 O;  1NK4 A;  3H3N O;  2QTD A;  4IG0 A;  4RW8 A;  3DM2 A;  3D2F A;  5AQV A;  2HNY A;  3OYJ A;  4YOV A;  3VTI A;  3T3F A;  1W7A A;  1N5Y A;  1BUP A;  2OZM A;  3QB0 A;  3CJ7 A;  3WEE B;  1FK9 A;  2UUC K;  3AVM A;  3ATV A;  3KK3 A;  4CJE A;  2PYJ A;  4DV3 K;  3SJH A;  3H46 O;  2VQF K;  5M1O A;  2BTF A;  4CHY A;  4E7L A;  3RMD A;  4ZTJ A;  2E20 A;  1FXX A;  3DJC A;  3TR8 A;  3TAN A;  5SWM A;  4V19 S;  3A5L C;  2OYQ A;  3K5M A;  4E7H A;  1YJN N;  2VGM A;  4FM1 A;  3MEC A;  5HRS A;  4L8R B;  2YV0 X;  3D2F B;  3NHG A;  4GMJ B;  4YOR A;  2UXB K;  3VMF B;  4CF8 A;  2HHW A;  3AVK A;  4OX9 K;  1KAY A;  3D45 A;  3R3L A;  4FLT A;  2ZJR L;  4KHP K;  4DR7 K;  4CHN A;  2QWQ A;  1ITG A;  3HSC A;  1T05 A;  1LWF A;  4L3Q A;  4KTQ A;  5JS2 A;  3RR7 A;  3NCI A;  1WNS A;  4C8K A;  3VQ4 A;  1XC3 A;  3KWI A;  1TVR A;  1NGF A;  5AFU H;  4AF1 A;  2HBK A;  3LPU A;  2DFE A;  4KH5 A;  3MEE A;  1IBK K;  4W5N A;  1ZBL A;  1W2B M;  1LW0 A;  5I3U A;  2P5O A;  4AHV A;  3O1B A;  4W5T A;  2OA8 A;  1KXP A;  3EKS A;  1RDB A;  3L6Q A;  2ZJP L;  2FF3 B;  1M1K O;  1U6Z A;  1JCF A;  1SKW A;  2HOE A;  3NH2 A;  4KH4 A;  2YJF A;  1FJG K;  3OYB A;  1S9E A;  3LDL A;  5BPM A;  4NYN A;  3V9S A;  2ZE2 A;  2XRI A;  1C0F A;  5A2Q O;  4KFB A;  2ZM6 K;  1L5U A;  3ZSV A;  4DQI A;  3V9W A;  1NK9 A;  5CE3 A;  3ZX3 A;  5BN8 A;  3ZSX A;  2KQ2 A;  4FWR A;  4AIL C;  2P9L A;  1QQN A;  1BO5 O;  5JIC A;  4ZTF A;  3AO2 A;  1SKS A;  3VQ7 A;  2HF4 A;  2RF2 A;  4IG3 A;  2P1J A;  4C23 A;  4YOT A;  3WXI A;  3TAR A;  1VQ5 N;  3M8S A;  3QEX A;  5LY3 A;  4RTF D;  3NAE A;  2FBT A;  2HBM A;  4BRG A;  4CFA A;  3U3Y A;  4Q5V A;  5F0X A;  1Q81 O;  4LFB K;  1JLF A;  1CZB A;  2QKK A;  4M63 C;  3M8Q A;  2P9L B;  3M6G A;  1QVF M;  2JWK A;  3HOS A;  4CES A;  1SV5 A;  3CET A;  4KI6 A;  3RTV A;  3DMJ A;  2ZGZ A;  3NF6 A;  1HNV A;  4A2B A;  1TV6 A;  1WOQ A;  3WNE A;  1Y97 A;  1RNH A;  3L2V A;  2PY5 A;  1QQC A;  3LAM A;  4N56 A;  4R5P A;  2E5L K;  3VPZ A;  5AQN A;  3BDP A;  2ZD1 A;  3SAF A;  1NLV A;  4H0P A;  3QBW A;  4KO0 A;  4E19 A;  3ZLJ A;  3MAQ A;  4IO9 L;  2GEM A;  4NB4 A;  3EEQ A;  1VQ7 N;  4N76 A;  5C2D A;  3QDK A;  1C1C A;  1TK5 A;  4BR5 A;  1G99 A;  2P9N A;  4XIU A;  3SK3 A;  3AVN A;  4KRE A;  4M7X A;  3D7E O;  2HF3 A;  1EET A;  2NRZ A;  4JKG B;  1Q9X A;  2GX9 A;  1TYQ A;  3ZEU A;  1J9A A;  4X62 K;  4JLH A;  4LD0 A;  4M3R A;  2B6A A;  5J1E A;  1BCM A;  3TTD A;  4QS9 A;  1WN7 A;  4CJW A;  2XY8 A;  3CQX A;  1GLC G;  2D0O A;  4CHZ A;  1J54 A;  5LL6 Z;  4YOY A;  3ASM A;  4BDP A;  3AA2 A;  3M3Z A;  2IGI A;  3BEX A;  4CJQ A;  1XHX A;  1X9S A;  4FJ9 A;  1Q82 O;  4YFU A;  2NRH A;  1RT2 A;  4RCH A;  4IOC L;  4I2Q A;  3ENO A;  2YKM A;  2R7Y A;  1OH7 A;  5FRN A;  2QWM A;  1HMV A;  4BRP A;  1TYQ B;  3ZEU B;  3P5J A;  2A42 A;  3E1Y A;  2WUS A;  5AQF A;  3AA5 X;  2NZT A;  1Z26 A;  1BHL A;  2X78 A;  4LFA K;  1GLJ O;  5AZJ A;  2G8U A;  4K42 A;  3IKM A;  3IUC A;  4C8O A;  4BRL A;  2NRW A;  3SPZ A;  3THY A;  1CZ9 A;  3PY8 A;  1TAQ A;  4CGG A;  4JV5 K;  2XY5 A;  3VQC A;  4CJT A;  1RT7 A;  3MED A;  2IOC A;  2O8E A;  4BC5 A;  4JRP A;  1XUP O;  3E66 A;  1X9M A;  1GOA A;  3L3V A;  4N5S A;  1DKG D;  1ATR A;  2NRR A;  4GNI A;  4FWM A;  3A0I X;  1C1A A;  5CY4 A;  4DQ8 A;  3O4N A;  3ZSZ A;  4IO8 A;  4E7I A;  3VGK A;  4DCH A;  3QLH A;  2Z1I A;  3LWL A;  5AZJ B;  1QSL A;  3FFK B;  2KLA A;  2KW4 A;  1D8Y A;  3AO4 A;  2X6S A;  5EXW A;  1NJZ A;  3HOT A;  4DR3 K;  3THY B;  5JLH A;  4A2A A;  3V1O A;  3E9P A;  4C1N I;  4OPH A;  2PFU A;  2A41 A;  2O8E B;  4F9O A;  3TAB A;  3A8Y A;  4K43 A;  5MLC Q;  1N6Q A;  4Y0W A;  2A1S A;  1MDU B;  2YHX A;  4WYB A;  1NGD A;  2NRT A;  5BR8 K;  1WUA A;  3U4L A;  1SQK A;  4FOI A;  4EIA A;  2RPI A;  1M90 O;  4FWL A;  2ITM A;  3QER A;  1SS6 A;  4C8L A;  4CEF A;  3C6A A;  1NMD A;  4OPJ A;  4E1J A;  4DTP A;  2KZZ A;  1RCH A;  3ISN C;  1VQ4 N;  3Q7C A;  2ITG A;  1WBD A;  3F9M A;  3VQ8 A;  4CBU A;  1GLE G;  3NGI A;  3PX4 A;  3PX6 A;  1T6D A;  1TL1 A;  4GW6 A;  4A61 A;  2AP1 A;  4CD3 A;  3R8E A;  3V9Z A;  1BWF O;  1WAJ A;  4FLV A;  2F4V K;  3CQ8 A;  1KCF A;  1NGB A;  4BR2 A;  1TK0 A;  5C24 A;  1JL2 A;  3S3O A;  1TKD A;  4JI2 K;  3SUQ A;  4ISE A;  1QE1 A;  2BDP A;  1KVA A;  1YTA A;  1WSI A;  4CFD A;  4DV4 K;  3THV A;  3CPE A;  3A2F A;  4CFB A;  2W42 A;  3LAK A;  3DLL L;  1XHZ A;  4CF1 A;  3OYH A;  1QZ5 A;  2E4L A;  4KBO A;  4Z4E A;  3CCQ N;  4IJA A;  3OYL A;  3DXK B;  1HR0 K;  3O5B A;  4DSI A;  3ULD A;  4GV9 A;  4BRA A;  5AQT A;  4DG1 A;  3CFO A;  2QKB A;  4FSV A;  4MDA A;  3M8P A;  4JK9 A;  3LM2 A;  3QEW A;  4DB3 A;  1Q18 A;  3AVA A;  3CPW M;  4MLE A;  1GOB A;  4OGE A;  4B3O A;  3BUZ B;  4IFV A;  4ISG A;  3ZSY A;  3DRS A;  4IOX A;  3WXM B;  4CJS A;  1IKW A;  2QEX N;  4X64 K;  3CYM A;  1VSM A;  3KHY A;  2VWJ A;  3OBY A;  3KJV A;  4GY2 B;  1P90 A;  4CEA A;  5EU7 A;  1G15 A;  3ZET A;  2IDO A;  3P31 A;  1SAZ A;  1IO2 A;  4OLA A;  3C7N A;  4FJL A;  2HHH K;  4IJN A;  3QIC A;  4DQP A;  1VQM N;  4YY3 K;  3D0P A;  3ALY A;  1J6Z A;  2P9K A;  4BG8 A;  3AAQ A;  1IG9 A;  2HBJ A;  2Y1I A;  5C0Y A;  4E7J A;  4FK2 A;  4CED A;  4KHN A;  4NLB A;  3CG7 A;  3SMP A;  4CZM A;  1S1U A;  4B9V A;  2OPR A;  2E2O A;  1S1W A;  1OH5 A;  3ZET B;  4WF9 L;  4B3T K;  1NGJ A;  3C7N B;  3SQ4 A;  2ASM A;  3SAG A;  1NBW A;  1YF5 L;  1VSH A;  2P9K B;  4FWO A;  3CCR N;  1TUY A;  1L3T A;  3FGU A;  1SKR A;  4LF9 K;  5BRE A;  2QWL A;  4CZH A;  4BE1 A;  2NNW A;  3O3G A;  3VEV A;  5HL7 L;  3ATU A;  3C95 A;  5J2M A;  2HB5 A;  4H4O A;  4CGH A;  1RDU A;  3DWL A;  2Q0U A;  4JKC A;  3HPH A;  1RBU A;  4LSN A;  1IBM K;  5EVZ A;  4LF7 K;  1DTQ A;  2FSN A;  3VQ9 A;  1SUQ A;  3O1W A;  2EX3 A;  1GLB G;  3HPG A;  1HNX K;  4QAG A;  4DTU A;  4B9L A;  4DSK A;  2DY4 A;  1GLL O;  4JD2 B;  4BR0 A;  3HYF A;  1HKC A;  3T1A A;  3MN7 A;  3CJ1 A;  1ASW A;  3SQ2 A;  4ZHR A;  3TSU A;  4X65 K;  5J2Q A;  3LZJ A;  5HRP A;  1LV5 A;  1RBV A;  4AHR A;  4LY7 A;  4FJN A;  4BG9 A;  4FJK A;  1ZBH A;  2UUA K;  1B9D A;  5I9E B;  1NMN A;  4OGC A;  2IVN A;  3WXL A;  2IC3 A;  2E6M A;  5AJ3 K;  4BWJ A;  1GLD G;  1VQ8 N;  3AVI A;  1W97 L;  3QEP A;  2HHV A;  2CH6 A;  4PL7 A;  2WC9 A;  1U47 A;  3ZSO A;  3VQQ A;  4FM2 A;  2H3G X;  5FRO A;  3CJ9 A;  1NK6 A;  2HW3 A;  3UIQ A;  5AQJ A;  4N47 A;  3RR8 A;  2O8F A;  4F2R A;  5FPD A;  4FJ7 A;  3PSF A;  2OPQ A;  3J81 O;  1ESV A;  3FZL A;  1H1V A;  4ILG B;  2FSK A;  3VEY A;  2UUB K;  4YOX A;  3NH0 A;  4MDB A;  4FM0 A;  1JXE A;  4H5T A;  2G8V A;  3OJS A;  5HP1 A;  4DS4 A;  4BRK A;  4CZG A;  4FVM A;  3J7Y P;  5JVG L;  4OLB A;  3IG1 A;  2V51 B;  1I39 A;  1GLF O;  3T1Y K;  3PUF A;  3VQ6 A;  4K25 A;  2A1R A;  4WE1 A;  2HST A;  5KPR A;  4CZL A;  3AVJ A;  1XMO K;  1NK0 A;  5EOY A;  3CCL N;  2P9S A;  2Q97 A;  4WFA L;  3MMV A;  4DUZ K;  3O80 A;  4B08 A;  4JKF A;  3G25 A;  1B9F A;  3TAP A;  1U04 A;  1NGG A;  4DR6 K;  1QHT A;  2IS3 A;  2VG5 A;  4QCL A;  4K41 A;  3ZT4 A;  4WQ5 C;  3G10 A;  4AH9 A;  4OPK A;  4WFB L;  4GV6 A;  3OS2 A;  4A5B A;  4JI3 K;  3V81 A;  4CJ7 A;  4BRI A;  3I0S A;  2DFH A;  3IFR A;  4AQY K;  3L4Q A;  1TUU A;  4B8C A;  4C8M A;  5KQ8 A;  1O1W A;  3SUO A;  2JGU A;  3VEN A;  3JYT A;  1C0U A;  2JLE A;  1LAV A;  1BIZ A;  4CD1 A;  5BN9 A;  4HUG A;  3OYA A;  3O4Q A;  4CVN E;  1U45 A;  4WFN L;  3ID8 A;  4J2B A;  1O13 A;  3KLE A;  4HCB A;  3CJC A;  3LP1 A;  4H0O A;  2QXF A;  3NVM A;  4DU4 A;  4B1W B;  3OYK A;  5C25 A;  1F21 A;  2WON A;  3SMS A;  3SPY A;  3PO5 A;  4AHC A;  1XC9 A;  4OKE A;  2BH1 A;  1Z25 A;  1VQN N;  3KZB A;  5F1X A;  2F8T A;  1UA1 A;  5ADX A;  4FJG A;  5K14 A;  4A59 A;  4IKF A;  3SYZ A;  1HNZ K;  1JLB A;  1FKO A;  3ITH A;  5BPL A;  4FLZ A;  1BIS A;  1K8K A;  1N36 K;  2HHX A;  3MCP A;  3MX5 A;  1FW6 A;  4NCA A;  1VK0 A;  4IEI A;  1Q9Y A;  4TSX A;  1VQ6 N;  2P9U A;  1YHQ N;  3FE1 A;  3VQD A;  1TKX A;  4BQL A;  1VQO N;  1JXB A;  4HVJ A;  4Z4G A;  3T1H K;  1RTD A;  1CXQ A;  3CQY A;  4DWI A;  3QML A;  3EE9 A;  3AAR A;  5AQG A;  4AHU A;  1J5O A;  2E2Q A;  1K8K B;  4DS5 A;  4AM7 A;  3AO3 A;  4PKH A;  1HKG A;  3WT0 A;  3GE1 A;  2OCE A;  3CCU N;  3I55 N;  4FWN A;  2Y1J A;  3Q7B A;  1NNE A;  2P9U B;  1HKB A;  3TAF A;  3SBT A;  1N33 K;  4LFC K;  1Q8I A;  4RW9 A;  3MWT A;  4FWK A;  4BDY A;  2GTD A;  4FXD A;  3CXC M;  3CCV N;  4DKW A;  1YVN A;  5J2N A;  4H8K A;  4O44 A;  3FLC O;  3K5O A;  3J7A P;  3L0Q A;  1DGK N;  4JHD A;  2ZGY A;  3S41 A;  5KRS A;  4DTJ A;  2PAV A;  3LPT A;  5AQI A;  2QWR A;  3KKS A;  1NKC A;  3DOK A;  2V7Y A;  2BE2 A;  3KK7 A;  3V1R A;  4FYD A;  1KRP A;  2GWK A;  4FK0 A;  1LAW A;  1HYV A;  2D4W A;  3AO1 A;  4KTZ A;  3C94 A;  5E84 A;  3DLH A;  3V9X A;  1REV A;  4EZ9 A;  4JHD B;  3QNN A;  3OY9 A;  1S6Q A;  1YIJ N;  4WQ4 A;  3GL1 A;  3SJJ A;  5B8H A;  1NKE A;  4DTS A;  4ID1 A; 
#chains in the Genus database with same CATH homology
 4WYB A;  1NGD A;  2NRT A;  2YJE A;  4JD2 A;  1WUA A;  5C15 A;  1S72 N;  3U4L A;  1SQK A;  4M7Y A;  4BR9 A;  3P4I A;  5C12 A;  3KWG A;  4HWI A;  4FOI A;  1ATS A;  4EIA A;  4XH4 A;  1M90 O;  4EFH A;  3W3D A;  3D2E A;  4FWL A;  2ITM A;  1SS6 A;  3VER A;  2Q0R A;  2VGN A;  2CH5 A;  3MK6 A;  3C6A A;  4WQ5 A;  3MWP A;  4ILH A;  1NMD A;  1MA9 B;  4E1J A;  1ZBS A;  1KAX A;  3TPQ A;  4LC9 B;  1VQ4 N;  2OTJ N;  3Q7C A;  2VYP A;  4JKD A;  2EWS A;  3F9M A;  4CBU A;  1GLE G;  1U2V B;  3NMU A;  4JEP A;  1T6D A;  2VWB A;  5EX5 A;  4EAH D;  4A61 A;  2AP1 A;  3UE5 A;  4CD3 A;  3R8E A;  4EHU A;  4Z94 A;  4PKG A;  3U8X A;  4AM6 A;  1BWF O;  4MO5 A;  4BC2 A;  1BG3 A;  2Q31 A;  2YX6 A;  4BR2 A;  1NGB A;  5LJW A;  3I56 N;  4JN4 A;  5M1Q A;  4FVU A;  2QXL A;  1NWK A;  3D2E B;  5AQQ A;  2YHW A;  3O08 A;  4ISE A;  4H5N A;  2A3Z A;  2QI2 A;  3EZW A;  4H03 B;  3WQT A;  4QS8 A;  3O9R A;  5AQH A;  4B1Y B;  1X9J A;  4J8F A;  3CPE A;  3JS6 A;  3JXU A;  1RGI A;  2D0P A;  3IDH A;  3LDO A;  4XH1 A;  3DLL L;  3ZYY X;  3B8A X;  3AY9 A;  5E26 A;  3P38 A;  1QZ5 A;  4H5R A;  4KBO A;  3CCQ N;  2P9N B;  4XH5 A;  4IJA A;  1ATN A;  3HZ6 A;  3WXJ A;  3DXK B;  3LM9 A;  3O5B A;  1QHA A;  1NGH A;  3C65 A;  1Z6R A;  3N4Q A;  5AQY A;  4GV9 A;  1VAZ A;  1K73 O;  3CME N;  4BRA A;  4CZK A;  5AQT A;  4PHT X;  4RWT A;  1X3N A;  4FSV A;  4MDA A;  5FPN A;  4OPA A;  2GWJ A;  4JK9 A;  4BRC A;  4BRH A;  3LM2 A;  2IVP A;  2E1Z A;  4DB3 A;  3CMA N;  1Q18 A;  1V4S A;  3CPW M;  4MLE A;  3OHR A;  2ASP A;  3DXM A;  1EO1 A;  3O9Q A;  3BUZ B;  4ISG A;  2HMP A;  2OTL N;  2Q1N A;  2QW9 A;  2A40 A;  2PBD A;  5BRH A;  4IOX A;  3WXM B;  3VEX A;  1JCG A;  3A5O C;  2QEX N;  3VOV A;  3VET A;  3KHY A;  4B1Z A;  3OBW A;  3OBY A;  4IEE A;  4B1U B;  1YXQ A;  3U9Z A;  4GY2 B;  3HI0 A;  3TTF A;  1P90 A;  3EKU A;  3CER A;  1IG8 A;  3ZET A;  3P31 A;  5M1N A;  5KPT A;  1SAZ A;  3MN5 A;  4GVE A;  3HM8 A;  3C7N A;  3VGM A;  5HOO A;  4IJN A;  3QIC A;  3VF4 A;  1E4F T;  3EN9 A;  5DM7 L;  1ILY A;  1VQM N;  2HBL A;  1J6Z A;  2P9K A;  3L4I A;  4BG8 A;  4CZI A;  3AAQ A;  4H0X B;  3VEW A;  3M5R A;  3SAH A;  2HBJ A;  1MWK A;  2E1Y A;  3DXM B;  4O5F A;  2KKZ A;  1YUW A;  2UYT A;  5C0Y A;  1VQL N;  1T44 A;  3I33 A;  3ID6 A;  2FSJ A;  4NLB A;  4WQ4 C;  3SMP A;  4QS7 A;  4JKE A;  5CHI A;  3N4P A;  1CZA N;  4CZM A;  2CGK A;  1X3M A;  3EL2 A;  4YDU C;  3ZX2 A;  3G4S N;  1OKJ A;  3CC2 N;  4BRM A;  2E2O A;  1VQK N;  4ISF A;  1YAG A;  1T3V A;  3HTV A;  1HX1 A;  4H5W A;  2Q2R A;  4CBW A;  3F5T A;  5DM6 L;  1MWM A;  3ZET B;  4GV3 A;  3VGL A;  4WF9 L;  1YJ9 N;  5JLF A;  1NGJ A;  3C7N B;  4BVO A;  2ASM A;  3SBG A;  1V4T A;  2QWP A;  3WEE A;  3SAG A;  1NBW A;  1YF5 L;  2P9K B;  2WFB A;  3LDP A;  5FPE A;  4JKA A;  4FWO A;  5GIO A;  3CCR N;  1TUY A;  3FGU A;  3FR0 A;  2IVO A;  1KC8 O;  3TSQ A;  1GLA G;  5BRE A;  3MCA B;  4HTL A;  5ELZ A;  5AQW A;  3ZX0 A;  2E2P A;  2QWL A;  5GAE P;  5AFU A;  5F2R A;  3J7Z O;  2BUP A;  3C6H A;  1BA0 A;  4CZH A;  2NNW A;  1VQ9 N;  4OO1 J;  1ZC6 A;  3MN9 A;  3FZK A;  3IMX A;  3WQU A;  2YCH A;  2CGJ A;  3J8A A;  3VEV A;  3CD6 N;  5HL7 L;  3ATU A;  3LDQ A;  3M1F A;  1NGC A;  5KQD A;  1RDU A;  1BU6 O;  3DWL A;  2Q0U A;  2QTD A;  3H3N O;  4JKC A;  4IOA L;  5AQV A;  2ZWH A;  3D2F A;  3G6E N;  4MLH A;  4YOV A;  3VTI A;  5EVZ A;  3F2K A;  3A5M C;  4BRE A;  4B1V A;  2QA4 N;  2FSN A;  1BUP A;  3R9P A;  2F9T A;  3QB0 A;  3CJ7 A;  4BC4 A;  4BVP A;  3WEE B;  3O1W A;  1GLB G;  4FPA A;  4JKG A;  1QZ6 A;  4JNE A;  3GG4 A;  1SZ2 A;  3ATV A;  5AR0 A;  1HPM A;  3SJH A;  3H46 O;  5M1O A;  2BTF A;  1GLL O;  2ASO A;  4JD2 B;  4UY8 O;  4BR0 A;  1HKC A;  3O8M A;  2E20 A;  3MN7 A;  3CJ1 A;  3NVK A;  3O9S A;  3DJC A;  4IDH A;  3CCE N;  5AZI A;  3A5L C;  1K8A O;  3AGR A;  3TSU A;  1KQS M;  1YJN N;  2VGM A;  1JCE A;  1RFQ A;  3D2F B;  3QFU A;  4A5A A;  3CJB A;  4BG9 A;  1Y64 A;  4YOR A;  5M1P A;  2RE2 A;  1Q7Y O;  3PLA A;  3VMF B;  3ENB A;  5I9E B;  4NLC A;  2IVN A;  3WXL A;  1GLD G;  4B9Q A;  1KAY A;  1VQ8 N;  3MDQ A;  2I7P A;  4R79 A;  4KH6 A;  5AQK A;  1W97 L;  3R3L A;  2ZJR L;  3GOI A;  4A57 A;  3E9O A;  5AQM A;  2CH6 A;  3WXK A;  4PL7 A;  2WC9 A;  4U67 L;  2QWQ A;  3HSC A;  3VTH A;  2H3G X;  4L3Q A;  3CJ9 A;  2FF6 A;  1K9M O;  3T69 A;  3VF2 A;  5AZI B;  3WUH A;  5AQZ A;  2CGL A;  5AQJ A;  2NRV A;  1XC3 A;  3KWI A;  5GAG P;  4MO4 A;  1NGF A;  5AFU H;  4AF1 A;  2HBK A;  4FPB A;  5FPD A;  1N8R O;  3QBX A;  3MN6 A;  1ESV A;  3FZL A;  1H1V A;  3R1X A;  4KH5 A;  2ZJQ L;  2JWL A;  3SLC A;  3HBT A;  4ILG B;  2FSK A;  3VEY A;  5GAH P;  2VCP A;  3W0L A;  4YOX A;  4MDB A;  1W2B M;  2YI1 A;  1BA1 A;  4NO7 A;  4H5T A;  3UKU A;  5LJV A;  3PIP L;  2F7T A;  3O1B A;  5JVH L;  3CI5 A;  1KXP A;  3EKS A;  1OVY A;  3L6Q A;  2ZJP L;  3EE8 A;  4BRK A;  3CCS N;  2FF3 B;  4CZG A;  1QVG M;  1M1K O;  1U6Z A;  1JCF A;  5JVG L;  1T6C A;  2HOE A;  4FWQ A;  4KH4 A;  2V51 B;  2YJF A;  1GLF O;  2AA4 A;  4FL9 A;  3H1V X;  3LDL A;  4XEI A;  5BPM A;  3OA9 A;  4K25 A;  2FXU A;  2GUP A;  2HST A;  5KPR A;  1QQO A;  2I7N A;  4CZL A;  1C0F A;  1YI2 N;  1JJ2 M;  4EHT A;  2DPN A;  4JKB A;  4I6M A;  1RDW X;  5EOY A;  5CE3 A;  4FOE A;  3ZX3 A;  5BN8 A;  2ZF5 O;  3CCL N;  3UKU B;  4FWR A;  2P9S A;  2Q97 A;  5GIP A;  2P9L A;  4WFA L;  1KD1 O;  3MMV A;  1QQN A;  2OAN A;  3O80 A;  4BY9 C;  1BO5 O;  4JKF A;  3G25 A;  4JK8 A;  1NGG A;  5JIC A;  3UKR A;  5AQX A;  1Q86 O;  2V52 B;  2HF4 A;  4BRQ A;  4K41 A;  1NGA A;  4O8K A;  1EQY A;  4C23 A;  5C10 A;  5TKY A;  4WQ5 C;  4YOT A;  4ILJ A;  3MX2 A;  4WFB L;  3LL3 A;  3WXI A;  4GV6 A;  4A5B A;  1VQ5 N;  3CF5 L;  4CJ7 A;  5LY3 A;  3VES A;  2QWN A;  3BF3 A;  4RTF D;  4BRI A;  4BRG A;  2HBM A;  3H3O B;  5BPN A;  2P9P A;  3FZF A;  3OW2 M;  3IFR A;  5F0X A;  1HJO A;  2YHY A;  3L4Q A;  1TUU A;  2GEL A;  5AQS A;  1Q81 O;  4PKI A;  4I6M B;  2E2N A;  5AQU A;  2RHK A;  5KQ8 A;  3VEN A;  2NRX A;  3RVC A;  2QM1 A;  4M63 C;  1QVF M;  2P9L B;  2FLO A;  3M6G A;  2JWK A;  3C0B A;  4CD1 A;  3HOS A;  5BN9 A;  2IIR A;  3CHW A;  3CET A;  4DHY A;  4BGA A;  1XQS C;  3HRG A;  2ZGZ A;  3ID8 A;  3UKR B;  4H0Y B;  5AQP A;  1O13 A;  4A2B A;  5M1K A;  4WFN L;  3CJC A;  1P8Z A;  1WOQ A;  3FZH A;  4YDU A;  4BR7 A;  4H0O A;  3AAP A;  3NVM A;  3TU5 A;  4B1W B;  3CCM N;  3A5N C;  4H0V B;  4C1N K;  2F9W A;  3VPZ A;  5AQN A;  5FPM A;  3SMS A;  3SAF A;  1NLV A;  4H0P A;  4BRN A;  1QQM A;  2P9P B;  3PIO L;  4JK7 A;  3ENH A;  3QBW A;  3O6W A;  2BH1 A;  3G71 N;  1VQN N;  5BR9 A;  4H0T B;  3CCJ N;  2E8A A;  3ULE A;  3H45 C;  3KZB A;  4IO9 L;  2GEM A;  5F1X A;  1C0G A;  5AQR A;  4NB4 A;  3T7Z A;  1DEJ A;  5ADX A;  5BRF A;  1VQ7 N;  2KHO A;  5C2D A;  3RSE A;  3QDK A;  3DAW A;  4YOW A;  4BR5 A;  1G99 A;  4A59 A;  2P9N A;  1Z05 A;  3SK3 A;  3DXK A;  3D6R A;  5BPL A;  4M7X A;  3D7E O;  2HF3 A;  3BP8 A;  2NRZ A;  1K8K A;  4JKG B;  5CR4 A;  4CBX A;  1E4G T;  2GX9 A;  1LCU A;  1TYQ A;  3ZEU A;  2W41 A;  3MCP A;  3MX5 A;  1YJW N;  3TSP A;  3EO3 A;  4IEI A;  3VEZ A;  3I8B A;  3TTD A;  4QS9 A;  4BQZ A;  3CQX A;  1GLC G;  2D0O A;  1KAZ A;  1D4X A;  4H5V A;  4YOY A;  4YOU A;  1NM1 A;  1HUX A;  1VQ6 N;  3ULE B;  2P9U A;  1YHQ N;  1DT9 A;  4BRD A;  3FE1 A;  5M1F A;  5TKW A;  3M3Z A;  3BEX A;  4BQL A;  3GBT A;  1NGE A;  1VQO N;  4BC3 A;  2J4R A;  3CIP A;  5BRD A;  4PL8 A;  4IFE A;  5AQO A;  3RSE B;  1Q82 O;  3CQY A;  3O9U A;  2NRH A;  5GIN A;  1HLU A;  2E88 A;  3QML A;  3GDQ A;  4RCH A;  4A62 A;  3EE9 A;  4BGB A;  4IOC L;  4FO0 A;  3AAR A;  3ENO A;  5AQG A;  2E2Q A;  1S3X A;  3UB5 A;  1K8K B;  2QWM A;  4BRP A;  4JAX A;  1TYQ B;  3ZEU B;  4AM7 A;  3LDN A;  2A42 A;  3E1Y A;  4BR4 A;  3K9K A;  4PKH A;  5AQL A;  1HKG A;  2WUS A;  3GE1 A;  5AQF A;  3WT0 A;  3CCU N;  3QFP A;  3VF6 A;  4BRF A;  4FWN A;  3I55 N;  3VEO A;  2NZT A;  1YIT N;  5B8H A;  3Q7B A;  1GLJ O;  3O4W A;  2P9U B;  3KVG A;  5AZJ A;  1HKB A;  5GAD P;  3P39 A;  4K42 A;  3IKM A;  3K9J A;  1NGI A;  3IUC A;  3H6E A;  3SBT A;  4BRL A;  2NRW A;  3MWT A;  4FWS A;  2A5X A;  3FZM A;  4FWK A;  1ZXO A;  2GTD A;  2V7Z A;  2D1K A;  3CC4 N;  3CXC M;  3CCV N;  4U7B A;  5ADX H;  4DKW A;  1YVN A;  3TTC A;  4IWV A;  3FLC O;  1BDG A;  4BC5 A;  5JMV A;  1XUP O;  3E66 A;  3L0Q A;  3R6M A;  1DGK N;  3CC7 N;  1DKG D;  4JHD A;  1ATR A;  2NRR A;  4GNI A;  2P9I A;  1IJJ A;  3A0I X;  4FWM A;  2ZGY A;  3S41 A;  4DQ8 A;  4IO8 A;  4WCE L;  3VGK A;  4DCH A;  2PAV A;  4CZJ A;  5AQI A;  1NJI O;  2QWR A;  5AZJ B;  1LOT B;  5C2F A;  3FFK B;  2KLA A;  2NLX A;  5KPZ A;  4CZE A;  5EXW A;  1VQP N;  1R59 O;  4CI6 A;  2V7Y A;  3HOT A;  3CJA A;  3KK7 A;  5JLH A;  2GWK A;  4O8U A;  2W40 A;  4A2A A;  3E9L A;  3E9P A;  4IXC A;  1BOT O;  4OPH A;  4C1N I;  4CZF A;  2PFU A;  3AGK A;  3O9T A;  1S22 A;  3H1Q A;  2D4W A;  2A41 A;  2P9S B;  5E84 A;  2QWO A;  4FWP A;  5H1S Q;  4IZ9 A;  2Q36 A;  3BF1 A;  5EY4 A;  4F9O A;  4BRO A;  4JHD B;  3A8Y A;  4B1X B;  2P9I B;  4K43 A;  1YIJ N;  2A6A A;  3U9D A;  1U2V A;  4WQ4 A;  4Y0W A;  3GL1 A;  5MLC Q;  1MDU B;  2WBN A;  2YHX A;  4JKH A;  4G9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...