2JWLA

Solution structure of periplasmic domain of tolr from h. influenzae with saxs data
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tolR
publication title The Periplasmic Domain of TolR from Haemophilus influenzae Forms a Dimer with a Large Hydrophobic Groove: NMR Solution Structure and Comparison to SAXS Data.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
total genus 19
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.270 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2jwlA00
2JWLA 2PFUA 2JWKA
chains in the Genus database with same CATH superfamily
5EXWA 4BRDA 1QSSA 3V81A 3C0BA 3TAQA 3OYBA 3S3MA 2GUIA 4FOEA 1C0TA 3T1AA 3RMBA 2ZGZA 3CCSN 1TK0A 4BRKA 4WQ4A 3NFAA 3MX2A 4EIAA 3K59A 2XRIA 1VQKN 4JI4K 3RSEA 4CE9A 4CHYA 1JLAA 1S3XA 2KTQA 3ID6A 4B9UA 4IEEA 4CK2A 5J2QA 3THVA 4YOWA 4M3XA 4BACA 3O6WA 5GAGP 4WCEL 3S9HA 2JGUA 3KVGA 3HP9A 1WB9A 3R6MA 1BA0A 4KPYA 5FROA 2PYLA 2W6KA 2KLAA 2UXCK 4BREA 4FWLA 3B6OA 4ELTA 1ASWA 3FLCO 4IBNA 1WBDA 3L3VA 3K5OA 4FJNA 2W6LA 1NJZA 4AHCA 3VQEA 2KHOA 1Z05A 3SJJA 3DWLA 3O5BA 2DFEA 1ASVA 2PZSA 2PAVA 2CH6A 2EX3A 4CCHA 4A2BA 1LCUA 4RW8A 1HR0K 1NKCA 2HHTA 3ZLJA 3QO9A 3VGMA 1RTIA 1RT4A 1BCMA 3C95A 5BRFA 3OW2M 4FVMA 2E2PA 4N41A 3EE8A 4CEDA 2D0AA 4BC3A 4CJ4A 3AO4A 3WXJA 2NLXA 3DYAA 5FPDA 1EQYA 1OH5A 5IT9O 2QWNA 1KFDA 4CBUA 5BRHA 3OYIA 3AA2A 4M3TA 1NK9A 2ITGA 4I9LA 3CQ8A 1NJXA 1B9DA 4H0YB 2PBDA 2YNFA 5HBMA 2AJQA 4JKBA 4B1WB 2QXFA 5C12A 4FJXA 4Y1DA 5T7BA 4RW7A 1Q86O 5KPZA 1U04A 3UKUA 4J2EA 1HYZA 4H5WA 1VSDA 4DR1K 1JCGA 2E8AA 3NF8A 1K6YA 3VF4A 2P9NA 1WAJA 3W0LA 2FF3B 1IKXA 1YJNN 4RG8A 4DLEA 3OS2A 3ZSZA 1ZBUA 3HT3A 4YOTA 3MN5A 1B9FA 3QFUA 1RBTA 1Z26A 2YI1A 4B1XB 3R1XA 3ENOA 5DM7L 2D0CA 5JVHL 1VSEA 1KLNA 1WN7A 4DQIA 3OYFA 4KBOA 2ZQBA 4B9NA 5DMRA 4Z0UA 3IFRA 3D7EO 2O4IA 4C8KA 1NGFA 1WSIA 4ZTJA 2RF2A 3BZKA 4OPKA 3P83D 5C42A 1R0AA 2P1JA 4KTWA 4CJ7A 2VYPA 1Z6RA 5LJWA 5LJVA 1RGIA 4MO5A 3UKUB 4YOYA 1Q7YO 4HTLA 1ILYA 4YY3K 4Z4HA 3AGRA 2P9NB 4DKWA 4RTFD 4ID5A 3KLIA 3QERA 3CCLN 2HNYA 3AVBA 1HLUA 3MAQA 3HSTB 3CG7A 1X1PA 1ATNA 3SYZA 3UKRB 5BREA 2IVOA 1NGEA 3VQ5A 3BZCA 2HVIA 5A2QO 1GOAA 1QHAA 4E0DA 4YDUA 4EHUA 1F21A 2B5JA 2JWKA 1HX1A 3UB5A 1LW0A 3T7ZA 4CHQA 2WONA 3J7YP 3L4IA 2GELA 1UA1A 2E88A 2HMPA 1NK5A 4FJLA 4HHTA 1BOTO 4BRLA 3SV3A 3MXMA 1G99A 1VQLN 3SBGA 5KPTA 1CXUA 5FPMA 4AM7A 1IKWA 3L2QA 3CFPA 1TK8A 1K73O 4JI8K 4DUZK 1DT9A 1JLGA 3D2FA 2A1RA 3D6RA 4BGBA 4IEIA 4O0IA 3PIPL 4F4KA 4CF8A 4AHUA 4DLGA 4IJAA 2GWKA 3LP1A 5EU7A 3JXUA 3LP3A 2YNIA 1Q18A 3OBYA 4JK7A 4O8UA 1T3VA 2RE2A 5CYMA 1XC3A 3F9MA 1SQKA 2WC9A 3AO2A 1U45A 4KHPK 1RT6A 1TKZA 4YHHK 3VEZA 1FKOA 3O9RA 3LDSA 3GL1A 1NGDA 4FPAA 3SZ2A 4X65K 1YVUA 4B3SK 3T69A 1DLOA 2KFZA 4DQRA 2E1YA 1QHTA 3PLAA 3IKMA 3DXKA 3LDPA 1ESVA 2E20A 1VQ4N 3DLRA 1KXPA 1JL2A 1S6PA 1JLFA 4FJJA 3BF3A 4B3TK 3ZETA 4JKGA 3CYMA 4BG8A 2ZJPL 4CJ5A 4C8MA 2UUCK 3KLGA 1J5EK 1QZ6A 2QWMA 4GVMA 2X78A 2R7YA 4DCHA 4DSKA 2QEXN 2GX9A 3WNFA 5KGWA 5ADXH 4DU3A 4W5NA 4Z4IA 4FK2A 2HMIA 4DB3A 1OKJA 2PFUA 2QA4N 1J5OA 4JI5K 1JJ2M 3MCPA 4NLCA 5AQZA 3I55N 2YKNA 3QIPA 3AA3A 4FK0A 3ATVA 3HK2A 1NJIO 5FRNA 4FZXC 3DRPA 4B8AB 3SUPA 1J9AA 4KFBA 1C0GA 3LAMA 1YT3A 4DTOA 4BE0A 1NGJA 2UUAK 2ATQA 1OH6A 3L3UA 3G10A 1HNXK 4EFHA 2O8BB 1NK0A 5AQWA 3AO5A 1JXEA 3ZT1A 4M3UA 4PHTX 1T7PA 4CBXA 4LFAK 1ASUA 1GLEG 3W3DA 5F2RA 3A8YA 5KQ8A 3QMLA 4FM1A 4AILC 2O8FA 2HHWA 1GLBG 4QS8A 1TL1A 2XO7A 1GLFO 4DV7K 4Q5VA 1LWEA 4CI6A 1U4BA 1HKBA 1FJGK 4AF1A 2P9PA 1KCFA 4XH1A 5KPRA 3WQTA 5GIPA 3EL2A 4X66K 1HPMA 1JLCA 4KH5A 2D4WA 1CXQA 2FBVA 4CF9A 1EO1A 4CJRA 4ILGB 1TYQA 4DTSA 3KK3A 3AAPA 2YCHA 3TAFA 4N47A 3ITHA 1QSYA 3QLHA 5HRRA 5F1XA 4C8OA 3FGUA 5AQXA 1IG9A 3AVAA 4CIEA 1QVGM 2A40A 2GBZA 4PL7A 3ZEUA 1NWKA 2OPRA 2HBJA 3L2UA 3EEQA 1G15A 1I94K 1QSLA 1BHLA 4OX9K 2O8FB 5AQSA 4BC4A 4R5PA 3THXA 3SK3A 4DHYA 1J6ZA 4DS5A 4W5RA 3KWGA 1ZYQA 3MK6A 2D1KA 3AVKA 2P9IA 1GLAG 3WXMB 4J2AA 3KD5E 2YNHA 3THYA 3AVLA 4PWDA 5KRSA 4B08A 4DTXA 4JKAA 2Q3SA 1U47A 3SQ1A 1NGBA 4BQLA 3QEVA 4BC2A 1TYQB 4JD2A 1OH8A 2NRWA 1N34K 2WTUA 4CGFA 4A5BA 4B9LA 1VSFA 4QS9A 4PA1A 3CCMN 3MXJA 2WUSA 2G8UA 5AR0A 2VWJA 1BISA 4LH4A 5AQFA 1YJWN 4YOUA 3ZEUB 1KFSA 4FJKA 4A61A 3I33A 3CHWA 5KRTA 4GKJK 3CMAN 4FLVA 1S72N 4KHQA 3MECA 2YKMA 3Q7CA 4FLUA 4E7HA 2RHKA 3THXB 1FKPA 2QK9A 3ALYA 1EP4A 5GAEP 3DLEA 2IAJA 2P9IB 4E1NA 3TARA 3WEEB 1GLLO 4ELVA 3HPOA 1SL2A 3VEXA 2GV9A 1TUYA 4H4OA 1CZBA 4CD1A 2OANA 5J2MA 4DTUA 2DFHA 3ULEA 4JI7K 2XHBA 3T1HK 4H4MA 3QEWA 4LY7A 2A42A 2ZF5O 3TSPA 2KFNA 4K43A 3C65A 2V7ZA 1ZXOA 2QWOA 3G6EN 1VSHA 5E26A 1NBWA 1K8KA 5ADXA 3LDLA 4CJTA 3J81O 4YOXA 4DFJA 3CQYA 1NGAA 4CEZA 3LM2A 3ZX3A 1TAUA 4FXDA 4GKKK 3HI0A 3O1WA 4H8KA 3KK2A 4IOCL 1VQMN 3NAEA 1NGGA 4AM6A 4FYDA 1RDWX 3QBWA 3KLHA 5K14A 2QM1A 4K25A 3T19A 1HMVA 4MQ3A 3U3GA 3J80O 4WYBA 3CJ7A 5C15A 1X9JA 1Q81O 4LD0A 2VG7A 5HRSA 5GAHP 4FWPA 3RVCA 3ZT4A 2E2OA 4N5SA 4FZZA 1GLCG 2DPNA 4ILJA 4JRQA 1QZ5A 1L3TA 4B3MK 3PO5A 1CLQA 4CZGA 5E41A 5FDLA 3OA9A 1WUAA 3OYMA 2A6AA 4MDBA 2E1ZA 4V19S 1XMQK 2OPSA 4CEEA 5GADP 3DI6A 3ENHA 4BDYA 5CZ1A 1K8KB 3ZT3A 2F4VK 3NH2A 1SL0A 2F9WA 2ITMA 4E89A 2YX6A 5AQHA 1T03A 1HNZK 3ZT2A 4DSFA 4CFCA 4CZFA 3PY8A 2HBKA 3K0SA 3O8MA 3ZSVA 1KQSM 2YHAA 4CEOA 4FOIA 5AQYA 3O9TA 4QAGA 4EP4A 4FWSA 2QWPA 3C6AA 4DQ8A 4CEBA 2FSNA 4H5VA 5C25A 1BQMA 4KKOA 1BWFO 4IG3A 3CCUN 1D8YA 1RTHA 4JAXA 3FZKA 2ZD1A 5FLXO 3O3FA 5HL7L 3A0IX 5C10A 4IZ9A 4O5BA 2B4JA 1JL1A 2UYTA 3NH0A 3P5JA 1HRHA 1VSLA 2CGJA 2VCPA 4Z4GA 3AO1A 3BY5A 3V1RA 1JLBA 3DLHA 1RT2A 3VTHA 1Q82O 3KK7A 1EX4A 3DOLA 4K42A 4FWMA 5CE3A 3J7ZO 4FWQA 3C94A 2GTDA 4DR4K 3FFIA 1HKCA 1VQ9N 2DTUA 3CPEA 4PQUA 1TKTA 4Z94A 3HVTA 4LF8K 1VQ7N 4YORA 5AZIA 1IBKK 3IG1A 1KAXA 2XY6A 4CEFA 1YXQA 3O08A 2DFFA 3CJCA 1E4FT 4BC5A 3OYJA 4DQQA 1LWFA 4GY2B 3QBXA 4E7IA 3VMFB 2O8DA 3RSEB 3HO1A 1VRTA 1NKBA 1EWRA 1RNHA 1NK6A 3DM2A 3G4SN 4FL9A 4I7FA 4B9MA 4LH5A 4BE2A 1ITGA 3VA0A 3TTDA 3ID8A 1KC8O 1P90A 4O5FA 2ETJA 1N5YA 4XEIA 2IIRA 2E4LA 4HVJA 3M6GA 1U48A 3QEIA 4FCYA 3C6HA 4KTQA 1N36K 2HBLA 1IBLK 4L3QA 3EE9A 2ASOA 4X62K 1A5XA 1A5WA 3TAMA 4IJNA 1QQCA 3MMVA 4JLHA 1K8AO 3ENBA 4DV2K 1S1XA 4HUEA 2QI2A 3HPHA 5JS1A 1VSJA 4DFKA 3VTIA 4IXCA 1YVNA 4MDAA 4BR0A 4HCBA 5AQRA 2HB5A 3I8DA 1IBMK 2HVHA 2F96A 5DK5A 4FJ5A 5BN8A 1FXXA 4Z4CA 3O80A 3HPGA 4QS7A 4CVNE 1TGOA 1Z25A 4LF6K 4I2PA 1VQPN 2OPPA 1D5AA 1C1BA 3EO3A 5I42A 4CZLA 3KJVA 1ATRA 5H1SQ 2I7PA 4F2RA 3K5NA 1NGHA 3MN7A 3HL8A 5AQVA 2H3GX 2V7YA 4OO1J 3PX0A 4I6MA 1JKHA 4RW9A 3KTQA 4KB1A 4BWMA 4IG0A 1MA9B 1EKEA 2YHXA 4Y0WA 3VEYA 3HM8A 1NK4A 3HYFA 4JKCA 4CFBA 2Z1IA 1HPZA 1NJYA 3AVJA 4LSLA 1KAZA 1TV6A 3VQPA 3H6EA 1VQ6N 5AFUH 4EP5A 2HHQA 3AA5X 3LM9A 1NGCA 3DRSA 4FPBA 5TKYA 3HJFA 3SLCA 3LWMA 5FPEA 3F2KA 4FJGA 1NKEA 1EXQA 4LF5K 1LW2A 1BU6O 3O4NA 3D0PA 2XY5A 4BROA 5BRDA 1EETA 3RMDA 3ULDA 3EKUA 2HHVA 4F3TA 4CZJA 1KSPA 2HW3A 2VQFK 1RTDA 3L2VA 3CCQN 3CIPA 3TAGA 1N6QA 4MO4A 4O55A 3J7AP 1C1CA 4FWRA 2P9SA 1KVCA 3NF6A 3ATUA 5AQOA 3TU5A 1XC9A 4LF4K 2BH1A 2P9UA 5AQLA 2NRXA 1J53A 1N8RO 4CGDA 4BRFA 4EAHD 4ELUA 5BR8K 1IKYA 4B1UB 1MDUB 1WNSA 2Z1JA 1KLMA 4JKEA 4CJQA 3JAMO 3RMAA 1RFQA 2O8EA 4NCAA 3E9PA 5AQUA 4LF7K 2HF4A 1KD1O 3VQDA 5C0YA 4FJ7A 4IDKA 4OVLA 5JS2A 2DY4A 5KQDA 2ZJQL 1LWCA 2E5LK 1IKVA 3QFPA 4IKFA 1WLJA 3P1GA 1ZBSA 1NOYA 4BE1A 2ASMA 2O8CA 3AAQA 2HNDA 3EYZA 2OYQA 4RW4A 4DFPA 3ZSXA 1IV0A 3CCEN 2ZJRL 5M1NA 5I3UA 1LAWA 4E3SA 3AARA 3H08A 3O9UA 1SKRA 4JYAK 4CZHA 1ZBIA 2CGKA 2UXDK 2IVNA 2NRRA 5GIOA 4ISEA 4HUFA 3CM6A 1RCHA 3L0QA 2VGMA 1VQ5N 2YV0X 1WAFA 4A57A 1XNRK 1I3AA 4A59A 1NM1A 3RTVA 3CPWM 4LFBK 5M1FA 5C2DA 3VEOA 1C1AA 2FBXA 3D2FB 1UAXA 4J2DA 2XY8A 1JCEA 4GMJB 3KKSA 2V51B 4DS4A 2UUBK 1RTJA 3V4IA 3SUQA 3RRGA 4C8NA 2KZMA 1Q9XA 2O8CB 1D4XA 4DWIA 1JXBA 3BUZB 2HHHK 1NMNA 3GDQA 3LZJA 5MLCQ 2F9TA 3A5LC 3OS1A 4C1NK 4CHOA 1YI2N 4DMNA 3NHGA 1VQNN 2I7NA 1HNWK 1HJRA 4LFCK 4H03B 4IFEA 1RDDA 2KW4A 4IFVA 5KTQA 1IJJA 3SMPA 4W5TA 1TL3A 4NCBA 2E2NA 5ELZA 1YTUA 4JEPA 3EZWA 1TAQA 4BR5A 4RW6A 3VQ6A 1LV5A 3DAWA 1HQUA 4M3RA 3GE1A 4EHTA 4MLEA 3DXKB 3GG4A 3ZCMA 4OLAA 1C0FA 1YJ9N 4OGEA 4KAZA 4IO9L 3CJ1A 5BPLA 3LDNA 2NNWA 3SUOA 3ZETB 4JKGB 4BRNA 4GV6A 2D0PA 1HYVA 2P9LA 1XWLA 3K5MA 4CZMA 3CF5L 4DSIA 4CD3A 4QCLA 3OS0A 4JV5K 3AGKA 1RILA 1KVBA 4CZIA 5JVGL 3NF7A 3QEXA 3HP6A 3N4PA 5AFUA 3QDKA 5BN9A 1RDBA 1ZC6A 1RT7A 3VETA 3L8BA 4E7LA 3PX4A 1NOZA 3OBWA 4CEAA 5AQQA 5HP1A 4DTPA 4JN4A 5F0XA 4NYNA 4G1QA 4JK8A 2Y1IA 2X6NA 1XQSC 1BG3A 3SQ0A 3O4QA 3IMXA 4Z4EA 3O9QA 4RCHA 3VEVA 2QWLA 3V1QA 5CYQA 1FK9A 4ICLA 1XI1A 3OYDA 1ZBFA 4JI0K 3SNNA 2P9LB 3VEWA 4JHDA 4CK1A 2VQEK 3BGRA 1BQNA 3HTVA 1GOCA 2IGIA 2HHSA 3SQ4A 3LWLA 3DOKA 4KI6A 3KKRA 2UU9K 4CJ3A 3U8XA 3FZFA 4L8RB 5AQMA 2FLOA 1X3MA 2P9PB 3CERA 1S6QA 3M8SA 3QINA 5LMNK 1E3MA 4MLHA 5LY3A 2OZMA 2WOMA 2QXLA 3HXMA 1LOTB 3WXKA 2YNGA 3BDPA 3MN9A 1L3VA 1JLQA 1V4SA 1TVRA 3M3ZA 3O1BA 2Q2RA 1TUUA 4WF9L 2HHXA 3VQCA 1SV5A 3SPYA 3NGIA 3OYKA 3QICA 4B1YB 1RBUA 2AP1A 4JS4A 5CZ2A 3RWUA 5AZJA 3OYAA 4FJHA 3M8RA 3ZT0A 4KB0A 1VAZA 4WQ5C 2FBTA 1N32K 3OYGA 1IO2A 4C23A 4BG9A 4J2BA 2P9KA 2Q0RA 2A41A 2QTDA 4I9QA 4KTZA 1XHXA 4BR7A 3EZ5A 2NRTA 1DTTA 1JLEA 3THYB 4B9TA 4K8ZA 3VENA 3QEPA 5BPNA 5CHIA 3V9XA 4BRCA 2GWJA 3CCJN 1XNQK 1D9DA 3OHRA 4JI3K 2YHBA 4KHSA 1YITN 3NH1A 1C0UA 4JD2B 5LMUK 3E9LA 3SMSA 2D5RA 3RRHA 3P38A 3M5RA 3KHYA 3SPZA 3I0RA 4OKJA 1RBRA 1Q8IA 4W5QA 4CJWA 3ASMA 2E6LA 5HRNA 4DTRA 2W40A 1ZBLA 3VQQA 5AQGA 4A5AA 4BR4A 3HSCA 2VGNA 4BR2A 1U2VA 4BQZA 3WNHA 4FLWA 1YAGA 3C6TA 2P9KB 3AVMA 4X64K 3THWA 4C1NI 3WQUA 4CERA 2VWKA 2BUPA 3CETA 1O13A 4IFYA 1YF5L 1T6CA 3VF6A 2G8FA 3PUFA 1MU2A 4BDZA 3RMCA 1NK7A 3R8EA 3E01A 3ULEB 5JMVA 1B92A 4OPAA 3LALA 4KH4A 4CJVA 1BUPA 3O9SA 4CJEA 4BWJA 1ZBHA 1TKXA 2CGLA 3CC4N 1FW6A 4H5RA 4WE1A 4CFAA 3OYCA 4ZTFA 3DRRA 3U9ZA 3O3HA 1SL1A 4CZKA 4E19A 2GEMA 4JI6K 1GLJO 4FVUA 3TI0A 4M41A 3VQ7A 4B3RK 1QS4A 1S1VA 1S9GA 3P31A 3ISNC 3HM9A 3J8AA 4E1JA 4FW1A 4JI1K 1HNVA 3SBTA 3V9WA 4DV3K 3S41A 2D0OA 3AA4A 4DQPA 2GUPA 3AVCA 4PUOA 4B1ZA 3F5TA 5JLFA 3MEEA 2EWSA 4FJMA 1U6ZA 3G25A 4CJFA 5AJ3K 4K8XA 3BP8A 5FPNA 3DLLL 1U49A 1N33K 1VSMA 4CECA 4BRMA 4BRQA 1WSHA 3VQ8A 1BDGA 3AVFA 3FE1A 5I9EB 2P5GA 1YUWA 1S9EA 1SAZA 3M1FA 4CFDA 4CF1A 3ZSOA 3KLFA 3C6UA 2Z1GA 3HZ6A 1S1UA 2HF3A 3TR8A 4CHNA 4DU1A 2UXBK 3WXLA 3I0SA 4XIUA 4CJLA 4H0VB 2ZGYA 3OJUA 3VQ9A 3VPZA 3CMEN 4FLTA 3L4QA 2W42A 5BR9A 4FW2A 3Q7BA 5M1KA 1Q9YA 2KZZA 4CGIA 5AQKA 4CGGA 3IRXA 4GW6A 3A5NC 4YNQA 5HRPA 3L2WA 2P51A 4KHWA 2QKKA 1XUPO 4DR7K 2F8SA 4CIFA 1QQOA 3LPTA 2A1SA 2G8KA 2IS3A 1YHQN 1LAVA 2BGGA 4DTJA 5C24A 1WSJA 1DEJA 1W7AA 3SAFA 4H5NA 3GOIA 3KZBA 3AVNA 4NO7A 4HUGA 1C6VA 2YJFA 3IDHA 2RPIA 2ZE2A 3CFOA 5AZIB 3KK1A 1TK5A 4IO8A 1HJOA 1YIJN 1T05A 3OY9A 5JLHA 2RKIA 3DLBA 3OVNA 4JKDA 2O8DB 3SAHA 5M1QA 4C8LA 1I39A 3TTFA 5B8HA 5J1EA 4AHTA 4UQGA 1YTAA 3F73A 3T3FA 3LPUA 3VGLA 4FJ9A 3WNEA 4FSVA 2BANA 5C2FA 3D2EA 1W97L 1SKWA 3ZSYA 4BGAA 2Q1NA 3SQ2A 4NB4A 1HNIA 3QESA 1X3NA 3EKSA 4KREA 4IDHA 1BCOA 3HVRA 2ASPA 1J54A 1JCFA 3A5OC 4HCCA 4BRAA 3SJHA 4DSEA 4DTNA 4OPJA 4M7XA 4CHPA 3OTOK 4DUYK 4IOAL 4NXNK 2YHWA 2YHYA 4ID1A 3CQXA 4XH4A 1V4TA 3CJAA 1BL3A 3UKRA 3T1YK 4O8KA 3O4WA 3P4IA 2D0BA 5SZTA 1RT5A 4WQ4C 4E1MA 4F9OA 3PO4A 3VGKA 3LL3A 4M63C 3U4LA 1X9MA 4LF9K 4KO0A 3LAKA 1REVA 3U6FA 4PL8A 3LP0A 3QNOA 3VESA 3OYLA 2IOCA 4M42A 3AY9A 3AO3A 4BRHA 4AHSA 1W0HA 4N76A 3TPQA 3D2EB 3WUHA 1NG9A 4BVOA 1KAYA 4FJIA 2Z1HA 3UE5A 3DLKA 4I6MB 3VN5A 4KHUA 4OJRA 2RN2A 3NDKA 1RBVA 4NYFA 4AQYK 1MWKA 4KHNA 3BEXA 3MN6A 1S1TA 3U3YA 4DU4A 1IH7A 2FBYA 2WFBA 4O4GA 4R79A 1R59O 5D3GA 3PIOL 4MFBA 4JS5A 2IDOA 4PY5A 1NJWA 5CY4A 2FC0A 1DGKN 1VSIA 3K9JA 4KH6A 3WNGA 3JSMA 2G8IA 2VG5A 5TKWA 3DLGA 4DV5K 2HNZA 1OVYA 1KVAA 3F9KA 3H3NO 3CCRN 3FR0A 3I8BA 3BF1A 4BDPA 1QVFM 1GOBA 3AV9A 4HWIA 5AQNA 4M7YA 3PV8A 4A62A 3GBTA 3CCVN 3LANA 3MEGA 3MWTA 4DF4A 2AA4A 3K2PA 2KQ2A 2F8TA 4CBWA 5AQTA 2P9SB 3SI6A 2OTLN 2BTFA 3H3OB 1VK0A 1MWMA 3V9UA 2CH5A 2P9UB 1W2BM 3HRGA 4DV1K 4JKHA 4H5TA 3S3NA 3SCXA 3OYHA 5M1PA 4JI2K 3PSFA 5AQIA 5HOOA 4DFMA 3CC7N 4DSLA 3OJSA 2VWBA 2O8EB 1T6DA 3VQ4A 4ZHRA 4FWNA 4DV0K 4IOXA 3PX6A 1BIZA 3K5LA 2I5JA 2B6AA 4DG1A 2PYJA 1DTQA 4CZEA 1QTMA 3TABA 3EY1A 4J8FA 4KV8A 3QIOA 4PKHA 4HTUA 4ISGA 3V6DA 1K9MO 3TTCA 4NCGA 1RT1A 3TAEA 4UY8O 3MCAB 1RT3A 2A3ZA 5AQJA 3EN9A 1S22A 3ZSWA 3VOVA 3VF2A 1VRUA 2OZSA 3NE6A 5JICA 5SWMA 4IWVA 1DKGD 1X9SA 3D45A 3VERA 4H0TB 2P5OA 4CF2A 4B9QA 3H46O 3HBTA 4B8CA 3VA3A 4W5OA 3SUNA 3P39A 5CR4A 3DJCA 2O8BA 3IUCA 2QWRA 4M45A 3OYNA 3N4QA 4WFBL 1NK8A 4GV3A 1C0MA 4PKIA 3LZIA 2G8HA 3B6PA 3FFKB 3H1VX 4F3OA 3B8AX 4FO0A 1NMDA 4WQ5A 3NVKA 4GNIA 1CZ9A 4PKGA 3R3LA 5EOYA 1XHZA 2F7TA 3OYEA 1L5UA 3KWIA 2OA8A 2Q0UA 4CHZA 4CJUA 4OKEA 3U9DA 1EWQA 2HHUA 3NF9A 2NZTA 1SZ2A 3HOTA 3NGZA 3E1YA 3LP2A 2IC3A 3H1QA 1BI4A 4CIGA 3NCIA 4M3ZA 3E9OA 4DR2K 2VG6A 1L3UA 3FZLA 4F2SA 4U67L 1SUQA 3A2FA 5EVZA 4YDUC 3ZSQA 4A2AA 2BDPA 3R9PA 1S1WA 3CI5A 1Y97A 2W41A 4JK9A 3I56N 1KRPA 1M1KO 3FZMA 3QB0A 4ILHA 2J4RA 4CW7B 3NBPA 1VSKA 4U7BA 1X9WA 1T44A 4DQSA 3ZYYX 3CJ9A 5AQPA 4EZ9A 1OVQA 2Q97A 3V9ZA 4F8RA 2G8WA 4O0JA 2FSKA 1T8EA 2YJEA 2NRVA 3KIOA 5LL6Z 1SS6A 1QE1A 2OCEA 1BA1A 3ZX0A 1P8ZA 4H0OA 2KKZA 3SV4A 3M8PA 4Z4FA 5FRMA 4Y1CA 1BI4B 4OPHA 4DV4K 4DR3K 4E7JA 1HKGA 4FM2A 5KI6A 3AVGA 4B1VA 4OKKA 4YOVA 1S5JA 3VQBA 3MWPA 3NVMA 5HROA 3CD6N 3TSQA 3ZSRA 2O4GA 4FJ8A 4ISFA 2ZWHA 3IAYA 4FZYA 4AHRA 4BRIA 2LSNA 3G71N 4LC9B 5GINA 1RDCA 1VQON 3MEDA 3AVHA 3RR8A 4O44A 5HLFA 4DR5K 3UIQA 5J2PA 1NU0A 5EX5A 4CGJA 4FWOA 4NLBA 2Y1JA 4M3YA 4FK4A 1WBBA 4BRPA 3WEEA 4CJPA 4N56A 4B9VA 5BPMA 3HOSA 4JHDB 1WSGA 4FLZA 1WSFA 2QW9A 3KD1E 2HBMA 1SKSA 4KRFA 4OLBA 1XMOK 2OPQA 2HSTA 1IG8A 2NRZA 2V52B 1VHXA 3DXMA 3C7NA 4CEQA 2Q36A 3QETA 4M3WA 3K57A 4OGCA 4YFUA 3V1OA 4AH9A 1H1VA 4H0XB 2XY7A 3JS6A 1UA0A 1L3SA 4JRPA 2X6SA 1WSEA 1HQEA 2QWQA 2G8VA 3CC2N 2OTJN 1HYSA 4BY9C 1NGIA 3WT0A 3A5MC 3CFRA 4KI4A 1BGXT 1CZAN 4DR6K 3O3GA 3CXCM 3MX5A 3DMJA 4CJSA 2JLEA 3IS9A 3LDQA 2ZM6K 3L6QA 3LDOA 2PY5A 4DTMA 3CJBA 5EY4A 1UOCA 3TAPA 2NRHA 4I2QA 4CJKA 4BR9A 3SAGA 4FM0A 5AZJB 5IWAK 1HUXA 2JWLA 2IVPA 1QQNA 3V9SA 2FXUA 1D9FA 1QQMA 1Y64A 1BIUA 3DXMB 3C7NB 3K9KA 3K58A 3WXIA 4G9ZA 4B9SA 2EHGA 3NMUA 4WFNL 4AHVA 1KTQA 3FZHA 3KLEA 5KGXA 4CF0A 2WBNA 4JKFA 1A5VA 1RBSA 4DV6K 4FLYA 4JNEA 4CGHA 3AVIA 4BVPA 4GVEA 3H45C 3L2RA 2NUBA 5J2NA 4Q0BA 3MDQA 3PSIA 1O1WA 3NGYA 1TKDA 4QOZB 1VQ8N 3RR7A 1RDUA 2FSJA 3VQAA 5E84A 2BE2A 2A5XA 4LSNA 1BO5O 3E66A 1WOQA 2X74A 4TSXA 5DM6L 4H0PA 4EZ6A 4K0KK 1NLVA 3TWHA 1U2VB 4FWKA 4KHYA 4FLXA 2FF6A 4DF8A 3M8QA 1OH7A 3THWB 3JYTA 2E6MA 4CK3A 3TSUA 4BRGA 4WFAL 1ATSA 1GLDG 2Q31A 1UWBA 3ZX2A 4GV9A 2QKBA 3CM5A 4DSJA 3MXIA 4B3OA 4NXMK 3G0ZA 5M1OA 3S3OA 4K41A 4CESA 1E4GT 3TANA 4E7KA 1NNEA 2E2QA 1RDAA 1M90O 2HOEA 4RWTA 4XH5A 1W9HA 3QNNA
chains in the Genus database with same CATH topology
5EXWA 3CJAA 4BRDA 2NRWA 4A5BA 3UKRA 4O8KA 4QS9A 3O4WA 3C0BA 3P4IA 4FOEA 3CCMN 3GDQA 2WUSA 4WQ4C 5MLCQ 2F9TA 5AR0A 3A5LC 4F9OA 4C1NK 1YI2N 3VGKA 5AQFA 2ZGZA 1YJWN 1VQNN 2I7NA 3LL3A 4YOUA 3ZEUB 4M63C 3U4LA 3CCSN 4BRKA 4WQ4A 4PL8A 3MX2A 4EIAA 4H03B 4IFEA 1VQKN 4A61A 3RSEA 1IJJA 3I33A 3VESA 3SMPA 3CHWA 2E2NA 3AY9A 5ELZA 4BRHA 1S3XA 3CMAN 4JEPA 3ID6A 3EZWA 4BR5A 1S72N 4IEEA 3DAWA 3D2EB 3Q7CA 3TPQA 3WUHA 2RHKA 4BVOA 3GE1A 1KAYA 4EHTA 4MLEA 3DXKB 3UE5A 4YOWA 4I6MB 5GAEP 3GG4A 3O6WA 5GAGP 1C0FA 4WCEL 1YJ9N 2P9IB 3KVGA 3WEEB 4IO9L 3CJ1A 3R6MA 1GLLO 3LDNA 1BA0A 2NNWA 5BPLA 1MWKA 3BEXA 3ZETB 4JKGB 3VEXA 4BRNA 4GV6A 2KLAA 3MN6A 2D0PA 4BREA 4FWLA 1TUYA 2P9LA 4CD1A 2WFBA 4R79A 2OANA 1R59O 3FLCO 4CZMA 3CF5L 3PIOL 4CD3A 4KH6A 1DGKN 3K9JA 3ULEA 3AGKA 5TKWA 4CZIA 5JVGL 2KHOA 1Z05A 3DWLA 1OVYA 3O5BA 2A42A 2ZF5O 3TSPA 3H3NO 4K43A 3C65A 2PAVA 2V7ZA 3N4PA 3CCRN 1ZXOA 2CH6A 2QWOA 3BF1A 3FR0A 3I8BA 3QDKA 5BN9A 5AFUA 3G6EN 1QVFM 5E26A 1ZC6A 1NBWA 1K8KA 4HWIA 4A2BA 3LDLA 4M7YA 5AQNA 1LCUA 5ADXA 4YOXA 3VETA 3CQYA 1NGAA 3LM2A 3ZX3A 3OBWA 4A62A 3GBTA 3CCVN 3HI0A 3O1WA 3MWTA 5AQQA 2AA4A 3VGMA 4IOCL 1VQMN 1NGGA 4AM6A 4JN4A 1RDWX 3QBWA 5F0XA 2QM1A 4K25A 4CBWA 5BRFA 3OW2M 2E2PA 4JK8A 3EE8A 5AQTA 1XQSC 3CJ7A 4WYBA 5C15A 1X9JA 2P9SB 1BG3A 1Q81O 3IMXA 4XH4A 2OTLN 2BTFA 3O9QA 4RCHA 4BC3A 3VEVA 2NLXA 2QWLA 3WXJA 3H3OB 1MWMA 5GAHP 4FWPA 3RVCA 1EQYA 5FPDA 2CH5A 2P9UB 2E2OA 1W2BM 2QWNA 3HRGA 1GLCG 4JKHA 2DPNA 4CBUA 2P9LB 4ILJA 4H5TA 3VEWA 5BRHA 1QZ5A 4JHDA 5M1PA 5AQIA 4CZGA 4H0YB 3OA9A 2PBDA 5HOOA 3HTVA 1WUAA 3CC7N 2A6AA 2VWBA 4MDBA 1T6DA 2E1ZA 4FWNA 4JKBA 4B1WB 4IOXA 3U8XA 3FZFA 5C12A 5GADP 5AQMA 3ENHA 4CZEA 1Q86O 2FLOA 5KPZA 4J8FA 1X3MA 4PKHA 1K8KB 2P9PB 3CERA 4ISGA 3UKUA 3TTCA 1K9MO 2F9WA 2ITMA 4H5WA 1JCGA 2E8AA 4UY8O 2YX6A 3MCAB 2A3ZA 5AQHA 5AQJA 3EN9A 1S22A 3VF4A 4MLHA 2P9NA 5LY3A 3VOVA 3W0LA 2FF3B 3VF2A 4CZFA 1YJNN 5JICA 2HBKA 2QXLA 1DKGD 4IWVA 1LOTB 3O8MA 3VERA 3WXKA 3MN9A 4H0TB 1KQSM 4YOTA 3MN5A 1V4SA 4B9QA 3H46O 3HBTA 3M3ZA 3O1BA 2Q2RA 3QFUA 4FOIA 1TUUA 3P39A 5AQYA 4WF9L 3O9TA 2YI1A 4FWSA 2QWPA 3C6AA 4B1XB 4DQ8A 3R1XA 3ENOA 2FSNA 4H5VA 5CR4A 5DM7L 3DJCA 5JVHL 3IUCA 2QWRA 3QICA 4B1YB 1BWFO 2AP1A 3CCUN 3N4QA 4WFBL 4GV3A 4JAXA 3FZKA 4KBOA 5AZJA 5HL7L 3A0IX 5C10A 3IFRA 3D7EO 4IZ9A 1VAZA 4PKIA 4WQ5C 3FFKB 1NGFA 3H1VX 4C23A 2UYTA 2CGJA 4BG9A 2VCPA 3B8AX 4FO0A 1NMDA 4WQ5A 2P9KA 4CJ7A 2Q0RA 2A41A 2VYPA 2QTDA 3KK7A 3VTHA 1Q82O 3NVKA 1Z6RA 4GNIA 5LJWA 5LJVA 4K42A 4PKGA 1RGIA 2NRTA 3R3LA 2F7TA 5EOYA 4FWMA 4MO5A 4BR7A 5CE3A 3KWIA 3J7ZO 3UKUB 2Q0UA 4FWQA 2GTDA 4YOYA 1Q7YO 3U9DA 4HTLA 3VENA 1ILYA 5BPNA 5CHIA 2NZTA 1SZ2A 1HKCA 3AGRA 4BRCA 3HOTA 1VQ9N 2P9NB 2GWJA 3E1YA 4DKWA 3CCJN 3CPEA 3OHRA 3H1QA 4RTFD 3CCLN 3E9OA 1YITN 4Z94A 1HLUA 4JD2B 1VQ7N 4YORA 5AZIA 3E9LA 3FZLA 3SMSA 1ATNA 4U67L 3P38A 3M5RA 5EVZA 3UKRB 2IVOA 3KHYA 1NGEA 4YDUC 1KAXA 5BREA 4A2AA 1YXQA 3R9PA 3O08A 1QHAA 3CI5A 3CJCA 2W41A 4YDUA 4EHUA 4JK9A 3I56N 1E4FT 4BC5A 1M1KO 3FZMA 4GY2B 3QBXA 2JWKA 1HX1A 3QB0A 3VMFB 2W40A 3UB5A 5AQGA 4ILHA 4A5AA 3RSEB 3HSCA 2J4RA 3T7ZA 2VGNA 4BR4A 3L4IA 3G4SN 2GELA 4FL9A 1U2VA 4BR2A 4BQZA 4U7BA 1T44A 2E88A 2HMPA 3TTDA 3ID8A 3ZYYX 1KC8O 1P90A 3CJ9A 1YAGA 5AQPA 2P9KB 1BOTO 4O5FA 2Q97A 4BRLA 4XEIA 4C1NI 1G99A 2IIRA 1VQLN 3WQUA 2FSKA 3SBGA 5KPTA 5FPMA 4AM7A 3M6GA 2YJEA 2NRVA 2BUPA 3C6HA 1SS6A 1O13A 3CETA 1K73O 2HBLA 1YF5L 1DT9A 1T6CA 3D2FA 3VF6A 3D6RA 4L3QA 1BA1A 4BGBA 3EE9A 4IEIA 3ZX0A 1P8ZA 2ASOA 2KKZA 4H0OA 3PIPL 4IJAA 4OPHA 4IJNA 3MMVA 2GWKA 3R8EA 1K8AO 3JXUA 1HKGA 3ENBA 3ULEB 2QI2A 5JMVA 4B1VA 4KH4A 4OPAA 4YOVA 1Q18A 3OBYA 4JK7A 4O8UA 3MWPA 3NVMA 3VTIA 1T3VA 3CD6N 2RE2A 1BUPA 1YVNA 3O9SA 4IXCA 4MDAA 3TSQA 4BR0A 1XC3A 3F9MA 1SQKA 2CGLA 2WC9A 5AQRA 4ISFA 3CC4N 4H5RA 2ZWHA 3U9ZA 5BN8A 3VEZA 4BRIA 4CZKA 3O9RA 2GEMA 3O80A 3G71N 4LC9B 3GL1A 4QS7A 5GINA 1VQON 1GLJO 1NGDA 4FPAA 4FVUA 1VQPN 3EO3A 4CZLA 1ATRA 3T69A 5H1SQ 3P31A 2I7PA 5EX5A 1NGHA 2E1YA 3MN7A 5AQVA 3PLAA 3IKMA 3J8AA 4FWOA 3DXKA 2H3GX 2V7YA 3LDPA 4NLBA 4OO1J 4I6MA 4E1JA 1ESVA 2E20A 1VQ4N 3SBTA 1KXPA 3S41A 2D0OA 4BRPA 3WEEA 2GUPA 4B1ZA 3F5TA 3BF3A 3ZETA 4JKGA 5BPMA 5JLFA 4BG8A 1MA9B 2EWSA 2ZJPL 3HOSA 4JHDB 1U6ZA 2QW9A 2YHXA 3G25A 4Y0WA 3VEYA 3HM8A 4JKCA 2HBMA 3BP8A 5FPNA 3DLLL 1QZ6A 2QWMA 4BRMA 4BRQA 1KAZA 4DCHA 2HSTA 3H6EA 2QEXN 1IG8A 1BDGA 2NRZA 2V52B 5AFUH 1VQ6N 3DXMA 3C7NA 3FE1A 2GX9A 5I9EB 1YUWA 2Q36A 3LM9A 1NGCA 1SAZA 4FPBA 5ADXH 3M1FA 5TKYA 3SLCA 4DB3A 1OKJA 2PFUA 2QA4N 5FPEA 1H1VA 4H0XB 3F2KA 1JJ2M 3MCPA 4NLCA 3HZ6A 3JS6A 5AQZA 3I55N 2HF3A 1BU6O 2QWQA 3ATVA 4BROA 1NJIO 3CC2N 2OTJN 5BRDA 4BY9C 1NGIA 3EKUA 3WXLA 3WT0A 4CZJA 3A5MC 1C0GA 4H0VB 3CCQN 3CIPA 1CZAN 2ZGYA 3CXCM 4MO4A 3MX5A 4FWRA 3VPZA 3CMEN 2P9SA 3L4QA 1NGJA 3LDQA 3L6QA 3LDOA 5BR9A 3ATUA 5AQOA 3Q7BA 3TU5A 4EFHA 5M1KA 3CJBA 2BH1A 5EY4A 5AQWA 2P9UA 5AQLA 2NRXA 2NRHA 1N8RO 5AQKA 4BR9A 3SAGA 4BRFA 4PHTX 4EAHD 5AZJB 4CBXA 1HUXA 3A5NC 2JWLA 4B1UB 1GLEG 2IVPA 3W3DA 1QQNA 5F2RA 1MDUB 2FXUA 3A8YA 5KQ8A 1XUPO 3QMLA 4JKEA 1QQMA 1QQOA 1GLBG 1Y64A 3DXMB 3C7NB 1RFQA 4QS8A 3K9KA 3WXIA 4G9ZA 3E9PA 1GLFO 5AQUA 1YHQN 3NMUA 2HF4A 1KD1O 4CI6A 4WFNL 5C0YA 1DEJA 1HKBA 3FZHA 4AF1A 3SAFA 2P9PA 4XH1A 5KQDA 5KPRA 2ZJQL 3WQTA 2WBNA 5GIPA 4JKFA 3EL2A 4H5NA 1HPMA 3GOIA 3QFPA 4KH5A 3KZBA 4NO7A 2D4WA 4JNEA 1EO1A 2YJFA 1ZBSA 3IDHA 4ILGB 2ASMA 4BVPA 4GVEA 5AZIB 3AAQA 1TYQA 3H45C 3AAPA 3MDQA 2YCHA 4IO8A 1HJOA 1VQ8N 3CCEN 2ZJRL 5M1NA 1YIJN 1RDUA 2FSJA 5F1XA 3AARA 3FGUA 5JLHA 3O9UA 5E84A 5AQXA 2A5XA 1BO5O 3E66A 1WOQA 4CZHA 2CGKA 1QVGM 2A40A 4JKDA 4PL7A 2IVNA 1NWKA 2NRRA 3ZEUA 3SAHA 5GIOA 4ISEA 2HBJA 5M1QA 3L0QA 5DM6L 2VGMA 4H0PA 3TTFA 5B8HA 1VQ5N 1NLVA 1U2VB 4FWKA 4A57A 5AQSA 3VGLA 2FF6A 4BC4A 4A59A 1NM1A 4FSVA 3CPWM 5C2FA 3D2EA 1W97L 5M1FA 3TSUA 2Q1NA 4BGAA 4BRGA 3SK3A 3VEOA 4DHYA 4NB4A 1J6ZA 5C2DA 4WFAL 1ATSA 1GLDG 2Q31A 3KWGA 1X3NA 3EKSA 3ZX2A 4GV9A 3MK6A 4IDHA 2D1KA 2P9IA 1GLAG 3WXMB 3D2FB 2ASPA 1JCEA 1JCFA 3A5OC 2V51B 5M1OA 4K41A 4BRAA 4JKAA 3SJHA 1E4GT 4M7XA 2E2QA 1NGBA 1M90O 4BQLA 2HOEA 4IOAL 1D4XA 2YHWA 4XH5A 4RWTA 2YHYA 4BC2A 1TYQB 3CQXA 1V4TA 4JD2A 3BUZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWL A;  2PFU A;  2JWK A; 
#chains in the Genus database with same CATH topology
 5EXW A;  4BRD A;  1QSS A;  3V81 A;  3C0B A;  3TAQ A;  3OYB A;  3S3M A;  2GUI A;  4FOE A;  1C0T A;  3T1A A;  3RMB A;  2ZGZ A;  3CCS N;  1TK0 A;  4BRK A;  4WQ4 A;  3NFA A;  3MX2 A;  4EIA A;  3K59 A;  2XRI A;  1VQK N;  4JI4 K;  3RSE A;  4CE9 A;  4CHY A;  1JLA A;  1S3X A;  2KTQ A;  3ID6 A;  4B9U A;  4IEE A;  4CK2 A;  5J2Q A;  3THV A;  4YOW A;  4M3X A;  4BAC A;  3O6W A;  5GAG P;  4WCE L;  3S9H A;  2JGU A;  3KVG A;  3HP9 A;  1WB9 A;  3R6M A;  1BA0 A;  4KPY A;  5FRO A;  2PYL A;  2W6K A;  2KLA A;  2UXC K;  4BRE A;  4FWL A;  3B6O A;  4ELT A;  1ASW A;  3FLC O;  4IBN A;  1WBD A;  3L3V A;  3K5O A;  4FJN A;  2W6L A;  1NJZ A;  4AHC A;  3VQE A;  2KHO A;  1Z05 A;  3SJJ A;  3DWL A;  3O5B A;  2DFE A;  1ASV A;  2PZS A;  2PAV A;  2CH6 A;  2EX3 A;  4CCH A;  4A2B A;  1LCU A;  4RW8 A;  1HR0 K;  1NKC A;  2HHT A;  3ZLJ A;  3QO9 A;  3VGM A;  1RTI A;  1RT4 A;  1BCM A;  3C95 A;  5BRF A;  3OW2 M;  4FVM A;  2E2P A;  4N41 A;  3EE8 A;  4CED A;  2D0A A;  4BC3 A;  4CJ4 A;  3AO4 A;  3WXJ A;  2NLX A;  3DYA A;  5FPD A;  1EQY A;  1OH5 A;  5IT9 O;  2QWN A;  1KFD A;  4CBU A;  5BRH A;  3OYI A;  3AA2 A;  4M3T A;  1NK9 A;  2ITG A;  4I9L A;  3CQ8 A;  1NJX A;  1B9D A;  4H0Y B;  2PBD A;  2YNF A;  5HBM A;  2AJQ A;  4JKB A;  4B1W B;  2QXF A;  5C12 A;  4FJX A;  4Y1D A;  5T7B A;  4RW7 A;  1Q86 O;  5KPZ A;  1U04 A;  3UKU A;  4J2E A;  1HYZ A;  4H5W A;  1VSD A;  4DR1 K;  1JCG A;  2E8A A;  3NF8 A;  1K6Y A;  3VF4 A;  2P9N A;  1WAJ A;  3W0L A;  2FF3 B;  1IKX A;  1YJN N;  4RG8 A;  4DLE A;  3OS2 A;  3ZSZ A;  1ZBU A;  3HT3 A;  4YOT A;  3MN5 A;  1B9F A;  3QFU A;  1RBT A;  1Z26 A;  2YI1 A;  4B1X B;  3R1X A;  3ENO A;  5DM7 L;  2D0C A;  5JVH L;  1VSE A;  1KLN A;  1WN7 A;  4DQI A;  3OYF A;  4KBO A;  2ZQB A;  4B9N A;  5DMR A;  4Z0U A;  3IFR A;  3D7E O;  2O4I A;  4C8K A;  1NGF A;  1WSI A;  4ZTJ A;  2RF2 A;  3BZK A;  4OPK A;  3P83 D;  5C42 A;  1R0A A;  2P1J A;  4KTW A;  4CJ7 A;  2VYP A;  1Z6R A;  5LJW A;  5LJV A;  1RGI A;  4MO5 A;  3UKU B;  4YOY A;  1Q7Y O;  4HTL A;  1ILY A;  4YY3 K;  4Z4H A;  3AGR A;  2P9N B;  4DKW A;  4RTF D;  4ID5 A;  3KLI A;  3QER A;  3CCL N;  2HNY A;  3AVB A;  1HLU A;  3MAQ A;  3HST B;  3CG7 A;  1X1P A;  1ATN A;  3SYZ A;  3UKR B;  5BRE A;  2IVO A;  1NGE A;  3VQ5 A;  3BZC A;  2HVI A;  5A2Q O;  1GOA A;  1QHA A;  4E0D A;  4YDU A;  4EHU A;  1F21 A;  2B5J A;  2JWK A;  1HX1 A;  3UB5 A;  1LW0 A;  3T7Z A;  4CHQ A;  2WON A;  3J7Y P;  3L4I A;  2GEL A;  1UA1 A;  2E88 A;  2HMP A;  1NK5 A;  4FJL A;  4HHT A;  1BOT O;  4BRL A;  3SV3 A;  3MXM A;  1G99 A;  1VQL N;  3SBG A;  5KPT A;  1CXU A;  5FPM A;  4AM7 A;  1IKW A;  3L2Q A;  3CFP A;  1TK8 A;  1K73 O;  4JI8 K;  4DUZ K;  1DT9 A;  1JLG A;  3D2F A;  2A1R A;  3D6R A;  4BGB A;  4IEI A;  4O0I A;  3PIP L;  4F4K A;  4CF8 A;  4AHU A;  4DLG A;  4IJA A;  2GWK A;  3LP1 A;  5EU7 A;  3JXU A;  3LP3 A;  2YNI A;  1Q18 A;  3OBY A;  4JK7 A;  4O8U A;  1T3V A;  2RE2 A;  5CYM A;  1XC3 A;  3F9M A;  1SQK A;  2WC9 A;  3AO2 A;  1U45 A;  4KHP K;  1RT6 A;  1TKZ A;  4YHH K;  3VEZ A;  1FKO A;  3O9R A;  3LDS A;  3GL1 A;  1NGD A;  4FPA A;  3SZ2 A;  4X65 K;  1YVU A;  4B3S K;  3T69 A;  1DLO A;  2KFZ A;  4DQR A;  2E1Y A;  1QHT A;  3PLA A;  3IKM A;  3DXK A;  3LDP A;  1ESV A;  2E20 A;  1VQ4 N;  3DLR A;  1KXP A;  1JL2 A;  1S6P A;  1JLF A;  4FJJ A;  3BF3 A;  4B3T K;  3ZET A;  4JKG A;  3CYM A;  4BG8 A;  2ZJP L;  4CJ5 A;  4C8M A;  2UUC K;  3KLG A;  1J5E K;  1QZ6 A;  2QWM A;  4GVM A;  2X78 A;  2R7Y A;  4DCH A;  4DSK A;  2QEX N;  2GX9 A;  3WNF A;  5KGW A;  5ADX H;  4DU3 A;  4W5N A;  4Z4I A;  4FK2 A;  2HMI A;  4DB3 A;  1OKJ A;  2PFU A;  2QA4 N;  1J5O A;  4JI5 K;  1JJ2 M;  3MCP A;  4NLC A;  5AQZ A;  3I55 N;  2YKN A;  3QIP A;  3AA3 A;  4FK0 A;  3ATV A;  3HK2 A;  1NJI O;  5FRN A;  4FZX C;  3DRP A;  4B8A B;  3SUP A;  1J9A A;  4KFB A;  1C0G A;  3LAM A;  1YT3 A;  4DTO A;  4BE0 A;  1NGJ A;  2UUA K;  2ATQ A;  1OH6 A;  3L3U A;  3G10 A;  1HNX K;  4EFH A;  2O8B B;  1NK0 A;  5AQW A;  3AO5 A;  1JXE A;  3ZT1 A;  4M3U A;  4PHT X;  1T7P A;  4CBX A;  4LFA K;  1ASU A;  1GLE G;  3W3D A;  5F2R A;  3A8Y A;  5KQ8 A;  3QML A;  4FM1 A;  4AIL C;  2O8F A;  2HHW A;  1GLB G;  4QS8 A;  1TL1 A;  2XO7 A;  1GLF O;  4DV7 K;  4Q5V A;  1LWE A;  4CI6 A;  1U4B A;  1HKB A;  1FJG K;  4AF1 A;  2P9P A;  1KCF A;  4XH1 A;  5KPR A;  3WQT A;  5GIP A;  3EL2 A;  4X66 K;  1HPM A;  1JLC A;  4KH5 A;  2D4W A;  1CXQ A;  2FBV A;  4CF9 A;  1EO1 A;  4CJR A;  4ILG B;  1TYQ A;  4DTS A;  3KK3 A;  3AAP A;  2YCH A;  3TAF A;  4N47 A;  3ITH A;  1QSY A;  3QLH A;  5HRR A;  5F1X A;  4C8O A;  3FGU A;  5AQX A;  1IG9 A;  3AVA A;  4CIE A;  1QVG M;  2A40 A;  2GBZ A;  4PL7 A;  3ZEU A;  1NWK A;  2OPR A;  2HBJ A;  3L2U A;  3EEQ A;  1G15 A;  1I94 K;  1QSL A;  1BHL A;  4OX9 K;  2O8F B;  5AQS A;  4BC4 A;  4R5P A;  3THX A;  3SK3 A;  4DHY A;  1J6Z A;  4DS5 A;  4W5R A;  3KWG A;  1ZYQ A;  3MK6 A;  2D1K A;  3AVK A;  2P9I A;  1GLA G;  3WXM B;  4J2A A;  3KD5 E;  2YNH A;  3THY A;  3AVL A;  4PWD A;  5KRS A;  4B08 A;  4DTX A;  4JKA A;  2Q3S A;  1U47 A;  3SQ1 A;  1NGB A;  4BQL A;  3QEV A;  4BC2 A;  1TYQ B;  4JD2 A;  1OH8 A;  2NRW A;  1N34 K;  2WTU A;  4CGF A;  4A5B A;  4B9L A;  1VSF A;  4QS9 A;  4PA1 A;  3CCM N;  3MXJ A;  2WUS A;  2G8U A;  5AR0 A;  2VWJ A;  1BIS A;  4LH4 A;  5AQF A;  1YJW N;  4YOU A;  3ZEU B;  1KFS A;  4FJK A;  4A61 A;  3I33 A;  3CHW A;  5KRT A;  4GKJ K;  3CMA N;  4FLV A;  1S72 N;  4KHQ A;  3MEC A;  2YKM A;  3Q7C A;  4FLU A;  4E7H A;  2RHK A;  3THX B;  1FKP A;  2QK9 A;  3ALY A;  1EP4 A;  5GAE P;  3DLE A;  2IAJ A;  2P9I B;  4E1N A;  3TAR A;  3WEE B;  1GLL O;  4ELV A;  3HPO A;  1SL2 A;  3VEX A;  2GV9 A;  1TUY A;  4H4O A;  1CZB A;  4CD1 A;  2OAN A;  5J2M A;  4DTU A;  2DFH A;  3ULE A;  4JI7 K;  2XHB A;  3T1H K;  4H4M A;  3QEW A;  4LY7 A;  2A42 A;  2ZF5 O;  3TSP A;  2KFN A;  4K43 A;  3C65 A;  2V7Z A;  1ZXO A;  2QWO A;  3G6E N;  1VSH A;  5E26 A;  1NBW A;  1K8K A;  5ADX A;  3LDL A;  4CJT A;  3J81 O;  4YOX A;  4DFJ A;  3CQY A;  1NGA A;  4CEZ A;  3LM2 A;  3ZX3 A;  1TAU A;  4FXD A;  4GKK K;  3HI0 A;  3O1W A;  4H8K A;  3KK2 A;  4IOC L;  1VQM N;  3NAE A;  1NGG A;  4AM6 A;  4FYD A;  1RDW X;  3QBW A;  3KLH A;  5K14 A;  2QM1 A;  4K25 A;  3T19 A;  1HMV A;  4MQ3 A;  3U3G A;  3J80 O;  4WYB A;  3CJ7 A;  5C15 A;  1X9J A;  1Q81 O;  4LD0 A;  2VG7 A;  5HRS A;  5GAH P;  4FWP A;  3RVC A;  3ZT4 A;  2E2O A;  4N5S A;  4FZZ A;  1GLC G;  2DPN A;  4ILJ A;  4JRQ A;  1QZ5 A;  1L3T A;  4B3M K;  3PO5 A;  1CLQ A;  4CZG A;  5E41 A;  5FDL A;  3OA9 A;  1WUA A;  3OYM A;  2A6A A;  4MDB A;  2E1Z A;  4V19 S;  1XMQ K;  2OPS A;  4CEE A;  5GAD P;  3DI6 A;  3ENH A;  4BDY A;  5CZ1 A;  1K8K B;  3ZT3 A;  2F4V K;  3NH2 A;  1SL0 A;  2F9W A;  2ITM A;  4E89 A;  2YX6 A;  5AQH A;  1T03 A;  1HNZ K;  3ZT2 A;  4DSF A;  4CFC A;  4CZF A;  3PY8 A;  2HBK A;  3K0S A;  3O8M A;  3ZSV A;  1KQS M;  2YHA A;  4CEO A;  4FOI A;  5AQY A;  3O9T A;  4QAG A;  4EP4 A;  4FWS A;  2QWP A;  3C6A A;  4DQ8 A;  4CEB A;  2FSN A;  4H5V A;  5C25 A;  1BQM A;  4KKO A;  1BWF O;  4IG3 A;  3CCU N;  1D8Y A;  1RTH A;  4JAX A;  3FZK A;  2ZD1 A;  5FLX O;  3O3F A;  5HL7 L;  3A0I X;  5C10 A;  4IZ9 A;  4O5B A;  2B4J A;  1JL1 A;  2UYT A;  3NH0 A;  3P5J A;  1HRH A;  1VSL A;  2CGJ A;  2VCP A;  4Z4G A;  3AO1 A;  3BY5 A;  3V1R A;  1JLB A;  3DLH A;  1RT2 A;  3VTH A;  1Q82 O;  3KK7 A;  1EX4 A;  3DOL A;  4K42 A;  4FWM A;  5CE3 A;  3J7Z O;  4FWQ A;  3C94 A;  2GTD A;  4DR4 K;  3FFI A;  1HKC A;  1VQ9 N;  2DTU A;  3CPE A;  4PQU A;  1TKT A;  4Z94 A;  3HVT A;  4LF8 K;  1VQ7 N;  4YOR A;  5AZI A;  1IBK K;  3IG1 A;  1KAX A;  2XY6 A;  4CEF A;  1YXQ A;  3O08 A;  2DFF A;  3CJC A;  1E4F T;  4BC5 A;  3OYJ A;  4DQQ A;  1LWF A;  4GY2 B;  3QBX A;  4E7I A;  3VMF B;  2O8D A;  3RSE B;  3HO1 A;  1VRT A;  1NKB A;  1EWR A;  1RNH A;  1NK6 A;  3DM2 A;  3G4S N;  4FL9 A;  4I7F A;  4B9M A;  4LH5 A;  4BE2 A;  1ITG A;  3VA0 A;  3TTD A;  3ID8 A;  1KC8 O;  1P90 A;  4O5F A;  2ETJ A;  1N5Y A;  4XEI A;  2IIR A;  2E4L A;  4HVJ A;  3M6G A;  1U48 A;  3QEI A;  4FCY A;  3C6H A;  4KTQ A;  1N36 K;  2HBL A;  1IBL K;  4L3Q A;  3EE9 A;  2ASO A;  4X62 K;  1A5X A;  1A5W A;  3TAM A;  4IJN A;  1QQC A;  3MMV A;  4JLH A;  1K8A O;  3ENB A;  4DV2 K;  1S1X A;  4HUE A;  2QI2 A;  3HPH A;  5JS1 A;  1VSJ A;  4DFK A;  3VTI A;  4IXC A;  1YVN A;  4MDA A;  4BR0 A;  4HCB A;  5AQR A;  2HB5 A;  3I8D A;  1IBM K;  2HVH A;  2F96 A;  5DK5 A;  4FJ5 A;  5BN8 A;  1FXX A;  4Z4C A;  3O80 A;  3HPG A;  4QS7 A;  4CVN E;  1TGO A;  1Z25 A;  4LF6 K;  4I2P A;  1VQP N;  2OPP A;  1D5A A;  1C1B A;  3EO3 A;  5I42 A;  4CZL A;  3KJV A;  1ATR A;  5H1S Q;  2I7P A;  4F2R A;  3K5N A;  1NGH A;  3MN7 A;  3HL8 A;  5AQV A;  2H3G X;  2V7Y A;  4OO1 J;  3PX0 A;  4I6M A;  1JKH A;  4RW9 A;  3KTQ A;  4KB1 A;  4BWM A;  4IG0 A;  1MA9 B;  1EKE A;  2YHX A;  4Y0W A;  3VEY A;  3HM8 A;  1NK4 A;  3HYF A;  4JKC A;  4CFB A;  2Z1I A;  1HPZ A;  1NJY A;  3AVJ A;  4LSL A;  1KAZ A;  1TV6 A;  3VQP A;  3H6E A;  1VQ6 N;  5AFU H;  4EP5 A;  2HHQ A;  3AA5 X;  3LM9 A;  1NGC A;  3DRS A;  4FPB A;  5TKY A;  3HJF A;  3SLC A;  3LWM A;  5FPE A;  3F2K A;  4FJG A;  1NKE A;  1EXQ A;  4LF5 K;  1LW2 A;  1BU6 O;  3O4N A;  3D0P A;  2XY5 A;  4BRO A;  5BRD A;  1EET A;  3RMD A;  3ULD A;  3EKU A;  2HHV A;  4F3T A;  4CZJ A;  1KSP A;  2HW3 A;  2VQF K;  1RTD A;  3L2V A;  3CCQ N;  3CIP A;  3TAG A;  1N6Q A;  4MO4 A;  4O55 A;  3J7A P;  1C1C A;  4FWR A;  2P9S A;  1KVC A;  3NF6 A;  3ATU A;  5AQO A;  3TU5 A;  1XC9 A;  4LF4 K;  2BH1 A;  2P9U A;  5AQL A;  2NRX A;  1J53 A;  1N8R O;  4CGD A;  4BRF A;  4EAH D;  4ELU A;  5BR8 K;  1IKY A;  4B1U B;  1MDU B;  1WNS A;  2Z1J A;  1KLM A;  4JKE A;  4CJQ A;  3JAM O;  3RMA A;  1RFQ A;  2O8E A;  4NCA A;  3E9P A;  5AQU A;  4LF7 K;  2HF4 A;  1KD1 O;  3VQD A;  5C0Y A;  4FJ7 A;  4IDK A;  4OVL A;  5JS2 A;  2DY4 A;  5KQD A;  2ZJQ L;  1LWC A;  2E5L K;  1IKV A;  3QFP A;  4IKF A;  1WLJ A;  3P1G A;  1ZBS A;  1NOY A;  4BE1 A;  2ASM A;  2O8C A;  3AAQ A;  2HND A;  3EYZ A;  2OYQ A;  4RW4 A;  4DFP A;  3ZSX A;  1IV0 A;  3CCE N;  2ZJR L;  5M1N A;  5I3U A;  1LAW A;  4E3S A;  3AAR A;  3H08 A;  3O9U A;  1SKR A;  4JYA K;  4CZH A;  1ZBI A;  2CGK A;  2UXD K;  2IVN A;  2NRR A;  5GIO A;  4ISE A;  4HUF A;  3CM6 A;  1RCH A;  3L0Q A;  2VGM A;  1VQ5 N;  2YV0 X;  1WAF A;  4A57 A;  1XNR K;  1I3A A;  4A59 A;  1NM1 A;  3RTV A;  3CPW M;  4LFB K;  5M1F A;  5C2D A;  3VEO A;  1C1A A;  2FBX A;  3D2F B;  1UAX A;  4J2D A;  2XY8 A;  1JCE A;  4GMJ B;  3KKS A;  2V51 B;  4DS4 A;  2UUB K;  1RTJ A;  3V4I A;  3SUQ A;  3RRG A;  4C8N A;  2KZM A;  1Q9X A;  2O8C B;  1D4X A;  4DWI A;  1JXB A;  3BUZ B;  2HHH K;  1NMN A;  3GDQ A;  3LZJ A;  5MLC Q;  2F9T A;  3A5L C;  3OS1 A;  4C1N K;  4CHO A;  1YI2 N;  4DMN A;  3NHG A;  1VQN N;  2I7N A;  1HNW K;  1HJR A;  4LFC K;  4H03 B;  4IFE A;  1RDD A;  2KW4 A;  4IFV A;  5KTQ A;  1IJJ A;  3SMP A;  4W5T A;  1TL3 A;  4NCB A;  2E2N A;  5ELZ A;  1YTU A;  4JEP A;  3EZW A;  1TAQ A;  4BR5 A;  4RW6 A;  3VQ6 A;  1LV5 A;  3DAW A;  1HQU A;  4M3R A;  3GE1 A;  4EHT A;  4MLE A;  3DXK B;  3GG4 A;  3ZCM A;  4OLA A;  1C0F A;  1YJ9 N;  4OGE A;  4KAZ A;  4IO9 L;  3CJ1 A;  5BPL A;  3LDN A;  2NNW A;  3SUO A;  3ZET B;  4JKG B;  4BRN A;  4GV6 A;  2D0P A;  1HYV A;  2P9L A;  1XWL A;  3K5M A;  4CZM A;  3CF5 L;  4DSI A;  4CD3 A;  4QCL A;  3OS0 A;  4JV5 K;  3AGK A;  1RIL A;  1KVB A;  4CZI A;  5JVG L;  3NF7 A;  3QEX A;  3HP6 A;  3N4P A;  5AFU A;  3QDK A;  5BN9 A;  1RDB A;  1ZC6 A;  1RT7 A;  3VET A;  3L8B A;  4E7L A;  3PX4 A;  1NOZ A;  3OBW A;  4CEA A;  5AQQ A;  5HP1 A;  4DTP A;  4JN4 A;  5F0X A;  4NYN A;  4G1Q A;  4JK8 A;  2Y1I A;  2X6N A;  1XQS C;  1BG3 A;  3SQ0 A;  3O4Q A;  3IMX A;  4Z4E A;  3O9Q A;  4RCH A;  3VEV A;  2QWL A;  3V1Q A;  5CYQ A;  1FK9 A;  4ICL A;  1XI1 A;  3OYD A;  1ZBF A;  4JI0 K;  3SNN A;  2P9L B;  3VEW A;  4JHD A;  4CK1 A;  2VQE K;  3BGR A;  1BQN A;  3HTV A;  1GOC A;  2IGI A;  2HHS A;  3SQ4 A;  3LWL A;  3DOK A;  4KI6 A;  3KKR A;  2UU9 K;  4CJ3 A;  3U8X A;  3FZF A;  4L8R B;  5AQM A;  2FLO A;  1X3M A;  2P9P B;  3CER A;  1S6Q A;  3M8S A;  3QIN A;  5LMN K;  1E3M A;  4MLH A;  5LY3 A;  2OZM A;  2WOM A;  2QXL A;  3HXM A;  1LOT B;  3WXK A;  2YNG A;  3BDP A;  3MN9 A;  1L3V A;  1JLQ A;  1V4S A;  1TVR A;  3M3Z A;  3O1B A;  2Q2R A;  1TUU A;  4WF9 L;  2HHX A;  3VQC A;  1SV5 A;  3SPY A;  3NGI A;  3OYK A;  3QIC A;  4B1Y B;  1RBU A;  2AP1 A;  4JS4 A;  5CZ2 A;  3RWU A;  5AZJ A;  3OYA A;  4FJH A;  3M8R A;  3ZT0 A;  4KB0 A;  1VAZ A;  4WQ5 C;  2FBT A;  1N32 K;  3OYG A;  1IO2 A;  4C23 A;  4BG9 A;  4J2B A;  2P9K A;  2Q0R A;  2A41 A;  2QTD A;  4I9Q A;  4KTZ A;  1XHX A;  4BR7 A;  3EZ5 A;  2NRT A;  1DTT A;  1JLE A;  3THY B;  4B9T A;  4K8Z A;  3VEN A;  3QEP A;  5BPN A;  5CHI A;  3V9X A;  4BRC A;  2GWJ A;  3CCJ N;  1XNQ K;  1D9D A;  3OHR A;  4JI3 K;  2YHB A;  4KHS A;  1YIT N;  3NH1 A;  1C0U A;  4JD2 B;  5LMU K;  3E9L A;  3SMS A;  2D5R A;  3RRH A;  3P38 A;  3M5R A;  3KHY A;  3SPZ A;  3I0R A;  4OKJ A;  1RBR A;  1Q8I A;  4W5Q A;  4CJW A;  3ASM A;  2E6L A;  5HRN A;  4DTR A;  2W40 A;  1ZBL A;  3VQQ A;  5AQG A;  4A5A A;  4BR4 A;  3HSC A;  2VGN A;  4BR2 A;  1U2V A;  4BQZ A;  3WNH A;  4FLW A;  1YAG A;  3C6T A;  2P9K B;  3AVM A;  4X64 K;  3THW A;  4C1N I;  3WQU A;  4CER A;  2VWK A;  2BUP A;  3CET A;  1O13 A;  4IFY A;  1YF5 L;  1T6C A;  3VF6 A;  2G8F A;  3PUF A;  1MU2 A;  4BDZ A;  3RMC A;  1NK7 A;  3R8E A;  3E01 A;  3ULE B;  5JMV A;  1B92 A;  4OPA A;  3LAL A;  4KH4 A;  4CJV A;  1BUP A;  3O9S A;  4CJE A;  4BWJ A;  1ZBH A;  1TKX A;  2CGL A;  3CC4 N;  1FW6 A;  4H5R A;  4WE1 A;  4CFA A;  3OYC A;  4ZTF A;  3DRR A;  3U9Z A;  3O3H A;  1SL1 A;  4CZK A;  4E19 A;  2GEM A;  4JI6 K;  1GLJ O;  4FVU A;  3TI0 A;  4M41 A;  3VQ7 A;  4B3R K;  1QS4 A;  1S1V A;  1S9G A;  3P31 A;  3ISN C;  3HM9 A;  3J8A A;  4E1J A;  4FW1 A;  4JI1 K;  1HNV A;  3SBT A;  3V9W A;  4DV3 K;  3S41 A;  2D0O A;  3AA4 A;  4DQP A;  2GUP A;  3AVC A;  4PUO A;  4B1Z A;  3F5T A;  5JLF A;  3MEE A;  2EWS A;  4FJM A;  1U6Z A;  3G25 A;  4CJF A;  5AJ3 K;  4K8X A;  3BP8 A;  5FPN A;  3DLL L;  1U49 A;  1N33 K;  1VSM A;  4CEC A;  4BRM A;  4BRQ A;  1WSH A;  3VQ8 A;  1BDG A;  3AVF A;  3FE1 A;  5I9E B;  2P5G A;  1YUW A;  1S9E A;  1SAZ A;  3M1F A;  4CFD A;  4CF1 A;  3ZSO A;  3KLF A;  3C6U A;  2Z1G A;  3HZ6 A;  1S1U A;  2HF3 A;  3TR8 A;  4CHN A;  4DU1 A;  2UXB K;  3WXL A;  3I0S A;  4XIU A;  4CJL A;  4H0V B;  2ZGY A;  3OJU A;  3VQ9 A;  3VPZ A;  3CME N;  4FLT A;  3L4Q A;  2W42 A;  5BR9 A;  4FW2 A;  3Q7B A;  5M1K A;  1Q9Y A;  2KZZ A;  4CGI A;  5AQK A;  4CGG A;  3IRX A;  4GW6 A;  3A5N C;  4YNQ A;  5HRP A;  3L2W A;  2P51 A;  4KHW A;  2QKK A;  1XUP O;  4DR7 K;  2F8S A;  4CIF A;  1QQO A;  3LPT A;  2A1S A;  2G8K A;  2IS3 A;  1YHQ N;  1LAV A;  2BGG A;  4DTJ A;  5C24 A;  1WSJ A;  1DEJ A;  1W7A A;  3SAF A;  4H5N A;  3GOI A;  3KZB A;  3AVN A;  4NO7 A;  4HUG A;  1C6V A;  2YJF A;  3IDH A;  2RPI A;  2ZE2 A;  3CFO A;  5AZI B;  3KK1 A;  1TK5 A;  4IO8 A;  1HJO A;  1YIJ N;  1T05 A;  3OY9 A;  5JLH A;  2RKI A;  3DLB A;  3OVN A;  4JKD A;  2O8D B;  3SAH A;  5M1Q A;  4C8L A;  1I39 A;  3TTF A;  5B8H A;  5J1E A;  4AHT A;  4UQG A;  1YTA A;  3F73 A;  3T3F A;  3LPU A;  3VGL A;  4FJ9 A;  3WNE A;  4FSV A;  2BAN A;  5C2F A;  3D2E A;  1W97 L;  1SKW A;  3ZSY A;  4BGA A;  2Q1N A;  3SQ2 A;  4NB4 A;  1HNI A;  3QES A;  1X3N A;  3EKS A;  4KRE A;  4IDH A;  1BCO A;  3HVR A;  2ASP A;  1J54 A;  1JCF A;  3A5O C;  4HCC A;  4BRA A;  3SJH A;  4DSE A;  4DTN A;  4OPJ A;  4M7X A;  4CHP A;  3OTO K;  4DUY K;  4IOA L;  4NXN K;  2YHW A;  2YHY A;  4ID1 A;  3CQX A;  4XH4 A;  1V4T A;  3CJA A;  1BL3 A;  3UKR A;  3T1Y K;  4O8K A;  3O4W A;  3P4I A;  2D0B A;  5SZT A;  1RT5 A;  4WQ4 C;  4E1M A;  4F9O A;  3PO4 A;  3VGK A;  3LL3 A;  4M63 C;  3U4L A;  1X9M A;  4LF9 K;  4KO0 A;  3LAK A;  1REV A;  3U6F A;  4PL8 A;  3LP0 A;  3QNO A;  3VES A;  3OYL A;  2IOC A;  4M42 A;  3AY9 A;  3AO3 A;  4BRH A;  4AHS A;  1W0H A;  4N76 A;  3TPQ A;  3D2E B;  3WUH A;  1NG9 A;  4BVO A;  1KAY A;  4FJI A;  2Z1H A;  3UE5 A;  3DLK A;  4I6M B;  3VN5 A;  4KHU A;  4OJR A;  2RN2 A;  3NDK A;  1RBV A;  4NYF A;  4AQY K;  1MWK A;  4KHN A;  3BEX A;  3MN6 A;  1S1T A;  3U3Y A;  4DU4 A;  1IH7 A;  2FBY A;  2WFB A;  4O4G A;  4R79 A;  1R59 O;  5D3G A;  3PIO L;  4MFB A;  4JS5 A;  2IDO A;  4PY5 A;  1NJW A;  5CY4 A;  2FC0 A;  1DGK N;  1VSI A;  3K9J A;  4KH6 A;  3WNG A;  3JSM A;  2G8I A;  2VG5 A;  5TKW A;  3DLG A;  4DV5 K;  2HNZ A;  1OVY A;  1KVA A;  3F9K A;  3H3N O;  3CCR N;  3FR0 A;  3I8B A;  3BF1 A;  4BDP A;  1QVF M;  1GOB A;  3AV9 A;  4HWI A;  5AQN A;  4M7Y A;  3PV8 A;  4A62 A;  3GBT A;  3CCV N;  3LAN A;  3MEG A;  3MWT A;  4DF4 A;  2AA4 A;  3K2P A;  2KQ2 A;  2F8T A;  4CBW A;  5AQT A;  2P9S B;  3SI6 A;  2OTL N;  2BTF A;  3H3O B;  1VK0 A;  1MWM A;  3V9U A;  2CH5 A;  2P9U B;  1W2B M;  3HRG A;  4DV1 K;  4JKH A;  4H5T A;  3S3N A;  3SCX A;  3OYH A;  5M1P A;  4JI2 K;  3PSF A;  5AQI A;  5HOO A;  4DFM A;  3CC7 N;  4DSL A;  3OJS A;  2VWB A;  2O8E B;  1T6D A;  3VQ4 A;  4ZHR A;  4FWN A;  4DV0 K;  4IOX A;  3PX6 A;  1BIZ A;  3K5L A;  2I5J A;  2B6A A;  4DG1 A;  2PYJ A;  1DTQ A;  4CZE A;  1QTM A;  3TAB A;  3EY1 A;  4J8F A;  4KV8 A;  3QIO A;  4PKH A;  4HTU A;  4ISG A;  3V6D A;  1K9M O;  3TTC A;  4NCG A;  1RT1 A;  3TAE A;  4UY8 O;  3MCA B;  1RT3 A;  2A3Z A;  5AQJ A;  3EN9 A;  1S22 A;  3ZSW A;  3VOV A;  3VF2 A;  1VRU A;  2OZS A;  3NE6 A;  5JIC A;  5SWM A;  4IWV A;  1DKG D;  1X9S A;  3D45 A;  3VER A;  4H0T B;  2P5O A;  4CF2 A;  4B9Q A;  3H46 O;  3HBT A;  4B8C A;  3VA3 A;  4W5O A;  3SUN A;  3P39 A;  5CR4 A;  3DJC A;  2O8B A;  3IUC A;  2QWR A;  4M45 A;  3OYN A;  3N4Q A;  4WFB L;  1NK8 A;  4GV3 A;  1C0M A;  4PKI A;  3LZI A;  2G8H A;  3B6P A;  3FFK B;  3H1V X;  4F3O A;  3B8A X;  4FO0 A;  1NMD A;  4WQ5 A;  3NVK A;  4GNI A;  1CZ9 A;  4PKG A;  3R3L A;  5EOY A;  1XHZ A;  2F7T A;  3OYE A;  1L5U A;  3KWI A;  2OA8 A;  2Q0U A;  4CHZ A;  4CJU A;  4OKE A;  3U9D A;  1EWQ A;  2HHU A;  3NF9 A;  2NZT A;  1SZ2 A;  3HOT A;  3NGZ A;  3E1Y A;  3LP2 A;  2IC3 A;  3H1Q A;  1BI4 A;  4CIG A;  3NCI A;  4M3Z A;  3E9O A;  4DR2 K;  2VG6 A;  1L3U A;  3FZL A;  4F2S A;  4U67 L;  1SUQ A;  3A2F A;  5EVZ A;  4YDU C;  3ZSQ A;  4A2A A;  2BDP A;  3R9P A;  1S1W A;  3CI5 A;  1Y97 A;  2W41 A;  4JK9 A;  3I56 N;  1KRP A;  1M1K O;  3FZM A;  3QB0 A;  4ILH A;  2J4R A;  4CW7 B;  3NBP A;  1VSK A;  4U7B A;  1X9W A;  1T44 A;  4DQS A;  3ZYY X;  3CJ9 A;  5AQP A;  4EZ9 A;  1OVQ A;  2Q97 A;  3V9Z A;  4F8R A;  2G8W A;  4O0J A;  2FSK A;  1T8E A;  2YJE A;  2NRV A;  3KIO A;  5LL6 Z;  1SS6 A;  1QE1 A;  2OCE A;  1BA1 A;  3ZX0 A;  1P8Z A;  4H0O A;  2KKZ A;  3SV4 A;  3M8P A;  4Z4F A;  5FRM A;  4Y1C A;  1BI4 B;  4OPH A;  4DV4 K;  4DR3 K;  4E7J A;  1HKG A;  4FM2 A;  5KI6 A;  3AVG A;  4B1V A;  4OKK A;  4YOV A;  1S5J A;  3VQB A;  3MWP A;  3NVM A;  5HRO A;  3CD6 N;  3TSQ A;  3ZSR A;  2O4G A;  4FJ8 A;  4ISF A;  2ZWH A;  3IAY A;  4FZY A;  4AHR A;  4BRI A;  2LSN A;  3G71 N;  4LC9 B;  5GIN A;  1RDC A;  1VQO N;  3MED A;  3AVH A;  3RR8 A;  4O44 A;  5HLF A;  4DR5 K;  3UIQ A;  5J2P A;  1NU0 A;  5EX5 A;  4CGJ A;  4FWO A;  4NLB A;  2Y1J A;  4M3Y A;  4FK4 A;  1WBB A;  4BRP A;  3WEE A;  4CJP A;  4N56 A;  4B9V A;  5BPM A;  3HOS A;  4JHD B;  1WSG A;  4FLZ A;  1WSF A;  2QW9 A;  3KD1 E;  2HBM A;  1SKS A;  4KRF A;  4OLB A;  1XMO K;  2OPQ A;  2HST A;  1IG8 A;  2NRZ A;  2V52 B;  1VHX A;  3DXM A;  3C7N A;  4CEQ A;  2Q36 A;  3QET A;  4M3W A;  3K57 A;  4OGC A;  4YFU A;  3V1O A;  4AH9 A;  1H1V A;  4H0X B;  2XY7 A;  3JS6 A;  1UA0 A;  1L3S A;  4JRP A;  2X6S A;  1WSE A;  1HQE A;  2QWQ A;  2G8V A;  3CC2 N;  2OTJ N;  1HYS A;  4BY9 C;  1NGI A;  3WT0 A;  3A5M C;  3CFR A;  4KI4 A;  1BGX T;  1CZA N;  4DR6 K;  3O3G A;  3CXC M;  3MX5 A;  3DMJ A;  4CJS A;  2JLE A;  3IS9 A;  3LDQ A;  2ZM6 K;  3L6Q A;  3LDO A;  2PY5 A;  4DTM A;  3CJB A;  5EY4 A;  1UOC A;  3TAP A;  2NRH A;  4I2Q A;  4CJK A;  4BR9 A;  3SAG A;  4FM0 A;  5AZJ B;  5IWA K;  1HUX A;  2JWL A;  2IVP A;  1QQN A;  3V9S A;  2FXU A;  1D9F A;  1QQM A;  1Y64 A;  1BIU A;  3DXM B;  3C7N B;  3K9K A;  3K58 A;  3WXI A;  4G9Z A;  4B9S A;  2EHG A;  3NMU A;  4WFN L;  4AHV A;  1KTQ A;  3FZH A;  3KLE A;  5KGX A;  4CF0 A;  2WBN A;  4JKF A;  1A5V A;  1RBS A;  4DV6 K;  4FLY A;  4JNE A;  4CGH A;  3AVI A;  4BVP A;  4GVE A;  3H45 C;  3L2R A;  2NUB A;  5J2N A;  4Q0B A;  3MDQ A;  3PSI A;  1O1W A;  3NGY A;  1TKD A;  4QOZ B;  1VQ8 N;  3RR7 A;  1RDU A;  2FSJ A;  3VQA A;  5E84 A;  2BE2 A;  2A5X A;  4LSN A;  1BO5 O;  3E66 A;  1WOQ A;  2X74 A;  4TSX A;  5DM6 L;  4H0P A;  4EZ6 A;  4K0K K;  1NLV A;  3TWH A;  1U2V B;  4FWK A;  4KHY A;  4FLX A;  2FF6 A;  4DF8 A;  3M8Q A;  1OH7 A;  3THW B;  3JYT A;  2E6M A;  4CK3 A;  3TSU A;  4BRG A;  4WFA L;  1ATS A;  1GLD G;  2Q31 A;  1UWB A;  3ZX2 A;  4GV9 A;  2QKB A;  3CM5 A;  4DSJ A;  3MXI A;  4B3O A;  4NXM K;  3G0Z A;  5M1O A;  3S3O A;  4K41 A;  4CES A;  1E4G T;  3TAN A;  4E7K A;  1NNE A;  2E2Q A;  1RDA A;  1M90 O;  2HOE A;  4RWT A;  4XH5 A;  1W9H A;  3QNN A; 
#chains in the Genus database with same CATH homology
 5EXW A;  3CJA A;  4BRD A;  2NRW A;  4A5B A;  3UKR A;  4O8K A;  4QS9 A;  3O4W A;  3C0B A;  3P4I A;  4FOE A;  3CCM N;  3GDQ A;  2WUS A;  4WQ4 C;  5MLC Q;  2F9T A;  5AR0 A;  3A5L C;  4F9O A;  4C1N K;  1YI2 N;  3VGK A;  5AQF A;  2ZGZ A;  1YJW N;  1VQN N;  2I7N A;  3LL3 A;  4YOU A;  3ZEU B;  4M63 C;  3U4L A;  3CCS N;  4BRK A;  4WQ4 A;  4PL8 A;  3MX2 A;  4EIA A;  4H03 B;  4IFE A;  1VQK N;  4A61 A;  3RSE A;  1IJJ A;  3I33 A;  3VES A;  3SMP A;  3CHW A;  2E2N A;  3AY9 A;  5ELZ A;  4BRH A;  1S3X A;  3CMA N;  4JEP A;  3ID6 A;  3EZW A;  4BR5 A;  1S72 N;  4IEE A;  3DAW A;  3D2E B;  3Q7C A;  3TPQ A;  3WUH A;  2RHK A;  4BVO A;  3GE1 A;  1KAY A;  4EHT A;  4MLE A;  3DXK B;  3UE5 A;  4YOW A;  4I6M B;  5GAE P;  3GG4 A;  3O6W A;  5GAG P;  1C0F A;  4WCE L;  1YJ9 N;  2P9I B;  3KVG A;  3WEE B;  4IO9 L;  3CJ1 A;  3R6M A;  1GLL O;  3LDN A;  1BA0 A;  2NNW A;  5BPL A;  1MWK A;  3BEX A;  3ZET B;  4JKG B;  3VEX A;  4BRN A;  4GV6 A;  2KLA A;  3MN6 A;  2D0P A;  4BRE A;  4FWL A;  1TUY A;  2P9L A;  4CD1 A;  2WFB A;  4R79 A;  2OAN A;  1R59 O;  3FLC O;  4CZM A;  3CF5 L;  3PIO L;  4CD3 A;  4KH6 A;  1DGK N;  3K9J A;  3ULE A;  3AGK A;  5TKW A;  4CZI A;  5JVG L;  2KHO A;  1Z05 A;  3DWL A;  1OVY A;  3O5B A;  2A42 A;  2ZF5 O;  3TSP A;  3H3N O;  4K43 A;  3C65 A;  2PAV A;  2V7Z A;  3N4P A;  3CCR N;  1ZXO A;  2CH6 A;  2QWO A;  3BF1 A;  3FR0 A;  3I8B A;  3QDK A;  5BN9 A;  5AFU A;  3G6E N;  1QVF M;  5E26 A;  1ZC6 A;  1NBW A;  1K8K A;  4HWI A;  4A2B A;  3LDL A;  4M7Y A;  5AQN A;  1LCU A;  5ADX A;  4YOX A;  3VET A;  3CQY A;  1NGA A;  3LM2 A;  3ZX3 A;  3OBW A;  4A62 A;  3GBT A;  3CCV N;  3HI0 A;  3O1W A;  3MWT A;  5AQQ A;  2AA4 A;  3VGM A;  4IOC L;  1VQM N;  1NGG A;  4AM6 A;  4JN4 A;  1RDW X;  3QBW A;  5F0X A;  2QM1 A;  4K25 A;  4CBW A;  5BRF A;  3OW2 M;  2E2P A;  4JK8 A;  3EE8 A;  5AQT A;  1XQS C;  3CJ7 A;  4WYB A;  5C15 A;  1X9J A;  2P9S B;  1BG3 A;  1Q81 O;  3IMX A;  4XH4 A;  2OTL N;  2BTF A;  3O9Q A;  4RCH A;  4BC3 A;  3VEV A;  2NLX A;  2QWL A;  3WXJ A;  3H3O B;  1MWM A;  5GAH P;  4FWP A;  3RVC A;  1EQY A;  5FPD A;  2CH5 A;  2P9U B;  2E2O A;  1W2B M;  2QWN A;  3HRG A;  1GLC G;  4JKH A;  2DPN A;  4CBU A;  2P9L B;  4ILJ A;  4H5T A;  3VEW A;  5BRH A;  1QZ5 A;  4JHD A;  5M1P A;  5AQI A;  4CZG A;  4H0Y B;  3OA9 A;  2PBD A;  5HOO A;  3HTV A;  1WUA A;  3CC7 N;  2A6A A;  2VWB A;  4MDB A;  1T6D A;  2E1Z A;  4FWN A;  4JKB A;  4B1W B;  4IOX A;  3U8X A;  3FZF A;  5C12 A;  5GAD P;  5AQM A;  3ENH A;  4CZE A;  1Q86 O;  2FLO A;  5KPZ A;  4J8F A;  1X3M A;  4PKH A;  1K8K B;  2P9P B;  3CER A;  4ISG A;  3UKU A;  3TTC A;  1K9M O;  2F9W A;  2ITM A;  4H5W A;  1JCG A;  2E8A A;  4UY8 O;  2YX6 A;  3MCA B;  2A3Z A;  5AQH A;  5AQJ A;  3EN9 A;  1S22 A;  3VF4 A;  4MLH A;  2P9N A;  5LY3 A;  3VOV A;  3W0L A;  2FF3 B;  3VF2 A;  4CZF A;  1YJN N;  5JIC A;  2HBK A;  2QXL A;  1DKG D;  4IWV A;  1LOT B;  3O8M A;  3VER A;  3WXK A;  3MN9 A;  4H0T B;  1KQS M;  4YOT A;  3MN5 A;  1V4S A;  4B9Q A;  3H46 O;  3HBT A;  3M3Z A;  3O1B A;  2Q2R A;  3QFU A;  4FOI A;  1TUU A;  3P39 A;  5AQY A;  4WF9 L;  3O9T A;  2YI1 A;  4FWS A;  2QWP A;  3C6A A;  4B1X B;  4DQ8 A;  3R1X A;  3ENO A;  2FSN A;  4H5V A;  5CR4 A;  5DM7 L;  3DJC A;  5JVH L;  3IUC A;  2QWR A;  3QIC A;  4B1Y B;  1BWF O;  2AP1 A;  3CCU N;  3N4Q A;  4WFB L;  4GV3 A;  4JAX A;  3FZK A;  4KBO A;  5AZJ A;  5HL7 L;  3A0I X;  5C10 A;  3IFR A;  3D7E O;  4IZ9 A;  1VAZ A;  4PKI A;  4WQ5 C;  3FFK B;  1NGF A;  3H1V X;  4C23 A;  2UYT A;  2CGJ A;  4BG9 A;  2VCP A;  3B8A X;  4FO0 A;  1NMD A;  4WQ5 A;  2P9K A;  4CJ7 A;  2Q0R A;  2A41 A;  2VYP A;  2QTD A;  3KK7 A;  3VTH A;  1Q82 O;  3NVK A;  1Z6R A;  4GNI A;  5LJW A;  5LJV A;  4K42 A;  4PKG A;  1RGI A;  2NRT A;  3R3L A;  2F7T A;  5EOY A;  4FWM A;  4MO5 A;  4BR7 A;  5CE3 A;  3KWI A;  3J7Z O;  3UKU B;  2Q0U A;  4FWQ A;  2GTD A;  4YOY A;  1Q7Y O;  3U9D A;  4HTL A;  3VEN A;  1ILY A;  5BPN A;  5CHI A;  2NZT A;  1SZ2 A;  1HKC A;  3AGR A;  4BRC A;  3HOT A;  1VQ9 N;  2P9N B;  2GWJ A;  3E1Y A;  4DKW A;  3CCJ N;  3CPE A;  3OHR A;  3H1Q A;  4RTF D;  3CCL N;  3E9O A;  1YIT N;  4Z94 A;  1HLU A;  4JD2 B;  1VQ7 N;  4YOR A;  5AZI A;  3E9L A;  3FZL A;  3SMS A;  1ATN A;  4U67 L;  3P38 A;  3M5R A;  5EVZ A;  3UKR B;  2IVO A;  3KHY A;  1NGE A;  4YDU C;  1KAX A;  5BRE A;  4A2A A;  1YXQ A;  3R9P A;  3O08 A;  1QHA A;  3CI5 A;  3CJC A;  2W41 A;  4YDU A;  4EHU A;  4JK9 A;  3I56 N;  1E4F T;  4BC5 A;  1M1K O;  3FZM A;  4GY2 B;  3QBX A;  2JWK A;  1HX1 A;  3QB0 A;  3VMF B;  2W40 A;  3UB5 A;  5AQG A;  4ILH A;  4A5A A;  3RSE B;  3HSC A;  2J4R A;  3T7Z A;  2VGN A;  4BR4 A;  3L4I A;  3G4S N;  2GEL A;  4FL9 A;  1U2V A;  4BR2 A;  4BQZ A;  4U7B A;  1T44 A;  2E88 A;  2HMP A;  3TTD A;  3ID8 A;  3ZYY X;  1KC8 O;  1P90 A;  3CJ9 A;  1YAG A;  5AQP A;  2P9K B;  1BOT O;  4O5F A;  2Q97 A;  4BRL A;  4XEI A;  4C1N I;  1G99 A;  2IIR A;  1VQL N;  3WQU A;  2FSK A;  3SBG A;  5KPT A;  5FPM A;  4AM7 A;  3M6G A;  2YJE A;  2NRV A;  2BUP A;  3C6H A;  1SS6 A;  1O13 A;  3CET A;  1K73 O;  2HBL A;  1YF5 L;  1DT9 A;  1T6C A;  3D2F A;  3VF6 A;  3D6R A;  4L3Q A;  1BA1 A;  4BGB A;  3EE9 A;  4IEI A;  3ZX0 A;  1P8Z A;  2ASO A;  2KKZ A;  4H0O A;  3PIP L;  4IJA A;  4OPH A;  4IJN A;  3MMV A;  2GWK A;  3R8E A;  1K8A O;  3JXU A;  1HKG A;  3ENB A;  3ULE B;  2QI2 A;  5JMV A;  4B1V A;  4KH4 A;  4OPA A;  4YOV A;  1Q18 A;  3OBY A;  4JK7 A;  4O8U A;  3MWP A;  3NVM A;  3VTI A;  1T3V A;  3CD6 N;  2RE2 A;  1BUP A;  1YVN A;  3O9S A;  4IXC A;  4MDA A;  3TSQ A;  4BR0 A;  1XC3 A;  3F9M A;  1SQK A;  2CGL A;  2WC9 A;  5AQR A;  4ISF A;  3CC4 N;  4H5R A;  2ZWH A;  3U9Z A;  5BN8 A;  3VEZ A;  4BRI A;  4CZK A;  3O9R A;  2GEM A;  3O80 A;  3G71 N;  4LC9 B;  3GL1 A;  4QS7 A;  5GIN A;  1VQO N;  1GLJ O;  1NGD A;  4FPA A;  4FVU A;  1VQP N;  3EO3 A;  4CZL A;  1ATR A;  3T69 A;  5H1S Q;  3P31 A;  2I7P A;  5EX5 A;  1NGH A;  2E1Y A;  3MN7 A;  5AQV A;  3PLA A;  3IKM A;  3J8A A;  4FWO A;  3DXK A;  2H3G X;  2V7Y A;  3LDP A;  4NLB A;  4OO1 J;  4I6M A;  4E1J A;  1ESV A;  2E20 A;  1VQ4 N;  3SBT A;  1KXP A;  3S41 A;  2D0O A;  4BRP A;  3WEE A;  2GUP A;  4B1Z A;  3F5T A;  3BF3 A;  3ZET A;  4JKG A;  5BPM A;  5JLF A;  4BG8 A;  1MA9 B;  2EWS A;  2ZJP L;  3HOS A;  4JHD B;  1U6Z A;  2QW9 A;  2YHX A;  3G25 A;  4Y0W A;  3VEY A;  3HM8 A;  4JKC A;  2HBM A;  3BP8 A;  5FPN A;  3DLL L;  1QZ6 A;  2QWM A;  4BRM A;  4BRQ A;  1KAZ A;  4DCH A;  2HST A;  3H6E A;  2QEX N;  1IG8 A;  1BDG A;  2NRZ A;  2V52 B;  5AFU H;  1VQ6 N;  3DXM A;  3C7N A;  3FE1 A;  2GX9 A;  5I9E B;  1YUW A;  2Q36 A;  3LM9 A;  1NGC A;  1SAZ A;  4FPB A;  5ADX H;  3M1F A;  5TKY A;  3SLC A;  4DB3 A;  1OKJ A;  2PFU A;  2QA4 N;  5FPE A;  1H1V A;  4H0X B;  3F2K A;  1JJ2 M;  3MCP A;  4NLC A;  3HZ6 A;  3JS6 A;  5AQZ A;  3I55 N;  2HF3 A;  1BU6 O;  2QWQ A;  3ATV A;  4BRO A;  1NJI O;  3CC2 N;  2OTJ N;  5BRD A;  4BY9 C;  1NGI A;  3EKU A;  3WXL A;  3WT0 A;  4CZJ A;  3A5M C;  1C0G A;  4H0V B;  3CCQ N;  3CIP A;  1CZA N;  2ZGY A;  3CXC M;  4MO4 A;  3MX5 A;  4FWR A;  3VPZ A;  3CME N;  2P9S A;  3L4Q A;  1NGJ A;  3LDQ A;  3L6Q A;  3LDO A;  5BR9 A;  3ATU A;  5AQO A;  3Q7B A;  3TU5 A;  4EFH A;  5M1K A;  3CJB A;  2BH1 A;  5EY4 A;  5AQW A;  2P9U A;  5AQL A;  2NRX A;  2NRH A;  1N8R O;  5AQK A;  4BR9 A;  3SAG A;  4BRF A;  4PHT X;  4EAH D;  5AZJ B;  4CBX A;  1HUX A;  3A5N C;  2JWL A;  4B1U B;  1GLE G;  2IVP A;  3W3D A;  1QQN A;  5F2R A;  1MDU B;  2FXU A;  3A8Y A;  5KQ8 A;  1XUP O;  3QML A;  4JKE A;  1QQM A;  1QQO A;  1GLB G;  1Y64 A;  3DXM B;  3C7N B;  1RFQ A;  4QS8 A;  3K9K A;  3WXI A;  4G9Z A;  3E9P A;  1GLF O;  5AQU A;  1YHQ N;  3NMU A;  2HF4 A;  1KD1 O;  4CI6 A;  4WFN L;  5C0Y A;  1DEJ A;  1HKB A;  3FZH A;  4AF1 A;  3SAF A;  2P9P A;  4XH1 A;  5KQD A;  5KPR A;  2ZJQ L;  3WQT A;  2WBN A;  5GIP A;  4JKF A;  3EL2 A;  4H5N A;  1HPM A;  3GOI A;  3QFP A;  4KH5 A;  3KZB A;  4NO7 A;  2D4W A;  4JNE A;  1EO1 A;  2YJF A;  1ZBS A;  3IDH A;  4ILG B;  2ASM A;  4BVP A;  4GVE A;  5AZI B;  3AAQ A;  1TYQ A;  3H45 C;  3AAP A;  3MDQ A;  2YCH A;  4IO8 A;  1HJO A;  1VQ8 N;  3CCE N;  2ZJR L;  5M1N A;  1YIJ N;  1RDU A;  2FSJ A;  5F1X A;  3AAR A;  3FGU A;  5JLH A;  3O9U A;  5E84 A;  5AQX A;  2A5X A;  1BO5 O;  3E66 A;  1WOQ A;  4CZH A;  2CGK A;  1QVG M;  2A40 A;  4JKD A;  4PL7 A;  2IVN A;  1NWK A;  2NRR A;  3ZEU A;  3SAH A;  5GIO A;  4ISE A;  2HBJ A;  5M1Q A;  3L0Q A;  5DM6 L;  2VGM A;  4H0P A;  3TTF A;  5B8H A;  1VQ5 N;  1NLV A;  1U2V B;  4FWK A;  4A57 A;  5AQS A;  3VGL A;  2FF6 A;  4BC4 A;  4A59 A;  1NM1 A;  4FSV A;  3CPW M;  5C2F A;  3D2E A;  1W97 L;  5M1F A;  3TSU A;  2Q1N A;  4BGA A;  4BRG A;  3SK3 A;  3VEO A;  4DHY A;  4NB4 A;  1J6Z A;  5C2D A;  4WFA L;  1ATS A;  1GLD G;  2Q31 A;  3KWG A;  1X3N A;  3EKS A;  3ZX2 A;  4GV9 A;  3MK6 A;  4IDH A;  2D1K A;  2P9I A;  1GLA G;  3WXM B;  3D2F B;  2ASP A;  1JCE A;  1JCF A;  3A5O C;  2V51 B;  5M1O A;  4K41 A;  4BRA A;  4JKA A;  3SJH A;  1E4G T;  4M7X A;  2E2Q A;  1NGB A;  1M90 O;  4BQL A;  2HOE A;  4IOA L;  1D4X A;  2YHW A;  4XH5 A;  4RWT A;  2YHY A;  4BC2 A;  1TYQ B;  3CQX A;  1V4T A;  4JD2 A;  3BUZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...