2JWLA

Solution structure of periplasmic domain of tolr from h. influenzae with saxs data
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Periplasmic Domain of TolR from Haemophilus influenzae Forms a Dimer with a Large Hydrophobic Groove: NMR Solution Structure and Comparison to SAXS Data.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
molecule keywords Protein tolR
total genus 19
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.270 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2jwlA00
2PFUA 2JWLA 2JWKA
chains in the Genus database with same CATH superfamily
2V52B 1WSGA 1Y64A 1FW6A 2VWBA 5LMUK 4H0PA 2ZM6K 4JS4A 3SLCA 3NH2A 4KI4A 1SKRA 3AO4A 3A5NC 1HLUA 5TKYA 3OYFA 5F1XA 3LDQA 4CEQA 1WB9A 1DTQA 1NGBA 3VERA 5KQ8A 1ASVA 4DUYK 4DTPA 5C0YA 2HHVA 2FBVA 1K73O 3ID6A 2HMIA 3RMBA 4GMJB 3QEIA 4BR4A 3WXLA 2J4RA 1ASUA 1IG8A 3MWPA 3HSCA 3HTVA 3TAGA 5GINA 3A0IX 3P1GA 1K9MO 3L2VA 4CIGA 2BDPA 5E84A 4CHOA 4YOYA 4G1QA 4IFYA 1QQNA 1ATNA 3Q7CA 3L2WA 2ETJA 1U2VB 3ZSOA 2IVNA 4O0IA 3BF3A 1GLBG 4FO0A 1XI1A 4KREA 1NK6A 5HL7L 2FF3B 3WXIA 3QO9A 1TK0A 4BR7A 1LWCA 4M7YA 3MWTA 2O8FA 5EY4A 4F9OA 1VQNN 5AQRA 2X78A 4KH6A 5KPZA 3D6RA 4E7LA 2UYTA 1RBTA 1C1BA 4MLEA 4FVUA 2KW4A 3LPUA 1JL1A 1U2VA 2HMPA 4IG0A 4L3QA 1W2BM 3R6MA 3SJJA 4DSLA 3QETA 1KFDA 3K2PA 4CHPA 1ATRA 2NRZA 2VQEK 2XRIA 3IDHA 4OPKA 4AH9A 3CIPA 3U8XA 3T7ZA 1X9SA 1XMOK 3WNFA 1X3MA 3OYGA 3TAQA 4ID5A 4JYAK 3KKSA 3G6EN 3BF1A 1QQCA 2HNZA 3VGKA 3MMVA 4FWPA 5F2RA 3LP1A 1KSPA 4IEIA 4KBOA 4QS7A 2O8DB 4K0KK 4H5VA 5BR8K 5I9EB 4X65K 4B9QA 3PLAA 1LW0A 2G8KA 2WUSA 3THYA 4CGJA 1VQ6N 5LL6Z 1HYVA 3QFPA 4OVLA 1RT2A 4DSIA 3PSFA 4WF9L 4Z4IA 4JI8K 3ZX0A 4CJFA 4YNQA 4FJ7A 1H1VA 5KPRA 1WNSA 5I42A 3DXMA 3TTFA 2XO7A 4KRFA 3C7NA 1XNQK 3QLHA 3DLRA 1A5XA 4PHTX 4M3UA 3S3MA 3BGRA 3E66A 4DSKA 5KGXA 3H3NO 3ULEA 1NK5A 4RCHA 2QEXN 1FKPA 3ZT2A 2HBLA 1T8EA 3VQDA 2QWQA 3OJSA 3CC7N 1OH7A 4DV0K 4X62K 3V4IA 3U9ZA 5LJWA 1BIUA 3CFRA 4DWIA 1KXPA 4LFBK 4A59A 3M5RA 5M1FA 3M6GA 2YKNA 2OPQA 4CK1A 3VEWA 4CEOA 3O1BA 2FSKA 3D0PA 4PKIA 4HTLA 1K8KA 1S1UA 5ADXH 2GWKA 4AHRA 3L2UA 3AY9A 2F9WA 1NM1A 4H8KA 4CJTA 1NKCA 5AJ3K 1VQ7N 3NAEA 3S41A 4IZ9A 3CJ9A 3SJHA 1YIJN 2QK9A 4FLTA 1Z05A 5KRTA 3T69A 4F2RA 4CJKA 2P9SB 3BZCA 1S6QA 3FE1A 3DI6A 3VEXA 4DTJA 4K8ZA 3PO5A 2PYJA 2QWNA 3EYZA 2E2NA 3V9ZA 3LP3A 3VGLA 4M3RA 1HPZA 5EXWA 4CZKA 1XHXA 4B1UB 5F0XA 2IOCA 3CMEN 4OLBA 3F73A 1NOYA 5AFUH 3SYZA 4CJLA 4NCAA 2ATQA 4CJVA 3M1FA 4A61A 1HX1A 2ZGZA 1T7PA 1KFSA 1NMDA 3IG1A 3KWGA 3CCRN 3H46O 2FLOA 3O3GA 5ADXA 3CHWA 3E9PA 3C6TA 2RE2A 3AVKA 4WCEL 3SNNA 3WXJA 3MX2A 2VWKA 2D0CA 1T3VA 2W6KA 4C8MA 5AFUA 2W40A 3NCIA 4CEFA 3AO2A 4PA1A 4NLBA 3V9XA 2YHBA 1JLBA 4IDKA 4BDPA 3GE1A 1SUQA 4EZ9A 3SBGA 4DU3A 2NRRA 4C8OA 2X6NA 1QSSA 1QTMA 3TTCA 4CK2A 3P83D 1VRUA 3CERA 3C0BA 3CFPA 4BDYA 1K8KB 4GW6A 3CC2N 4C8KA 2QTDA 3OYJA 4PUOA 3HT3A 1GOCA 1BDGA 1SKWA 3CFOA 3SBTA 2ZE2A 3CQ8A 5A2QO 4AHSA 3HPGA 5HOOA 4KTQA 1UAXA 3DXKA 4UQGA 2G8IA 1RNHA 2A42A 4CEBA 4CZGA 4BACA 1RTIA 4ZTFA 4BDZA 3ULEB 4CZIA 4M41A 1XC9A 4Z94A 4DU4A 4B9MA 3CQYA 5B8HA 1J9AA 4WFBL 5I3UA 1T6CA 4E7IA 2HF3A 4LC9B 1RBUA 3DXMB 4B1ZA 1JXEA 5ELZA 4YHHK 4JV5K 4FOEA 4DHYA 3WNGA 3IS9A 1R59O 5GADP 2NRTA 5M1OA 4CIFA 3NFAA 1RBVA 4CJRA 2V51B 1NGJA 4JNEA 1X1PA 4E89A 4CZEA 2V7YA 1TL1A 3DYAA 1T6DA 1HUXA 4NCBA 4DCHA 1Q9XA 1C0UA 1SS6A 5JS2A 3VA0A 1IG9A 3AV9A 4JI4K 1ATSA 4GKKK 1B9FA 3MEDA 4DR2K 1YTAA 4KTZA 3AAQA 3MEGA 1EQYA 1BO5O 4OGCA 2NRWA 3I0SA 5AQJA 4AM6A 4PL7A 5AQTA 2NZTA 1BA0A 1TKXA 3NH1A 2P1JA 5CR4A 1X3NA 1QSYA 1NOZA 3O08A 5FPDA 1I39A 4DR5K 3JS6A 3CPWM 4DV2K 1S72N 3HM9A 1VQMN 4DR4K 1NGDA 1DLOA 1EX4A 5M1KA 4IKFA 4B08A 3MN6A 4OPJA 1BG3A 1B9DA 3DJCA 1KVCA 1BCMA 4RW4A 3TSUA 4YORA 4CHNA 4MDBA 4FWOA 4WE1A 2ZWHA 4OKJA 3T1YK 3A5LC 4E1NA 4FJHA 4H5TA 5AZIA 3K58A 2QA4N 1RTJA 4DR6K 4WFNL 3DLHA 4JKCA 4W5TA 2HF4A 1RDAA 4BY9C 4I6MB 3OYNA 5D3GA 1RCHA 1GOBA 1IKWA 3CG7A 1S1WA 3WQTA 3V9SA 4NLCA 1QHTA 1KVAA 2E2OA 2P9SA 1T44A 3OVNA 2WBNA 3K57A 3ZSZA 5C2DA 1S1VA 3TAMA 1HR0K 1XWLA 2HNDA 2KHOA 2E6LA 4E1MA 2JWKA 4IO9L 5DM6L 5CHIA 2BGGA 4BRCA 4FLYA 3MCAB 1Q7YO 2V7ZA 1L3TA 4CHQA 3AVLA 3M8RA 1S22A 3E9LA 1VQKN 1NKEA 1BQMA 1TV6A 4CJ4A 3GDQA 4CFDA 5KPTA 3VQBA 4B1YB 3EL2A 2AP1A 2EHGA 4Y1DA 1GLFO 3IMXA 3FLCO 3AVCA 4LD0A 4O4GA 3VEVA 4B9TA 3MECA 1RT5A 4BR9A 4GV6A 1ITGA 4J8FA 4H0VB 1QZ5A 1J5EK 1NK7A 4CGFA 4B1VA 4DTXA 3SUQA 4BR2A 2P9PB 1VSHA 4DQRA 4F8RA 3QBWA 1N6QA 1G15A 3AO3A 1VSLA 4KI6A 1HNVA 1YVNA 2IIRA 2HHTA 2WTUA 1SL0A 4DV3K 3O5BA 3ZSWA 4Z4HA 5DK5A 2KZZA 2P9KB 2YHYA 2BE2A 5JS1A 3AAPA 4CGGA 4GV3A 2AJQA 3C7NB 4A57A 4H0YB 1S5JA 5CZ2A 2B6AA 3HI0A 2DTUA 4GV9A 1GLLO 4J2BA 3KLGA 4ICLA 4N56A 2UUCK 3PY8A 2OPSA 3SAHA 2VG7A 3QERA 3WT0A 3VEZA 2G8FA 4NXNK 4CHYA 3V6DA 2F9TA 5C12A 1UA0A 5DM7L 3C65A 3EEQA 3EO3A 3D7EO 3IAYA 2IDOA 3ZLJA 2CGKA 4R79A 2O8EB 3DLGA 4CBXA 1ASWA 1YTUA 4CF9A 2PFUA 1SAZA 4HCBA 2GUPA 4F3OA 2Z1HA 2FXUA 1GLCG 4CJQA 3HBTA 2X74A 3LDLA 3C94A 3UKUA 1VSKA 3AVHA 3DLKA 1IO2A 4BRGA 1BUPA 3L4IA 4J2DA 3QMLA 4CGIA 1V4SA 5M1PA 2QWOA 4PL8A 2GELA 1RT3A 2OZMA 3MK6A 4EZ6A 2YX6A 4I7FA 2VGMA 5BR9A 4A62A 4FVMA 1SZ2A 2WONA 1EO1A 3OTOK 5AQYA 3P4IA 2D0OA 5AQOA 3NGIA 2A5XA 2PBDA 3KK3A 3QESA 2E5LK 2O8CB 1NGHA 1OH6A 4XH1A 2UU9K 3MN5A 3WUHA 3FGUA 4HWIA 2PAVA 3OYBA 2FBXA 2XHBA 1N5YA 4IEEA 4FJ8A 4DTOA 5C24A 2E4LA 4E1JA 5JICA 5C10A 4CHZA 4BROA 3ASMA 1EXQA 1CLQA 1JL2A 3GG4A 4IJNA 4DV4K 4HUGA 1GLAG 4DSJA 4NO7A 4A2BA 4XIUA 1EWQA 3AA4A 4BE0A 1S9EA 4DTUA 1A5WA 1ZBFA 4KO0A 3O9SA 4KHYA 4O0JA 5M1NA 3L2QA 3VQEA 2P9IB 1N8RO 1KLNA 3TARA 1NU0A 3OYMA 2A1SA 1YHQN 1ZBHA 4BQLA 2VGNA 2JGUA 1LWFA 4FLXA 3U3GA 3OYAA 1NGCA 3SUPA 3VTHA 1IV0A 1ESVA 2BUPA 3LWLA 3AA5X 2HB5A 3J80O 1YJ9N 3VA3A 3KJVA 3B8AX 1QVFM 1SKSA 3OYLA 3O9RA 3AARA 3V1QA 3VQ7A 3DLBA 3BDPA 3VQ4A 4UY8O 4NYNA 1NJWA 1W9HA 1ZXOA 4AM7A 3HOSA 3LM2A 1R0AA 2RF2A 3K9KA 4KH5A 4LF8K 1K6YA 3L6QA 4MLHA 3J81O 3QICA 4GVMA 3O9TA 4K25A 3R1XA 2PYLA 1NK0A 2G8WA 1VQPN 1HNXK 3KD5E 3NGZA 3SUOA 3ALYA 3TAPA 4B3MK 2RPIA 3G10A 4FOIA 3RMDA 4ELUA 4MFBA 3FZMA 4FW2A 4WQ4A 3OYEA 3O3FA 4YY3K 3SZ2A 4DQIA 1E4GT 1BI4A 1JLEA 2P9LA 3LANA 4N5SA 4LF9K 2ZQBA 3AO1A 4B1XB 4JK8A 4KB0A 3KVGA 3N4PA 3NH0A 4OJRA 3NF9A 2WOMA 4LF6K 2QKKA 4Q0BA 4CJ5A 5FROA 3SPYA 2Q0RA 1KC8O 1QVGM 4B9LA 1YITN 3U4LA 3ZT0A 2VCPA 1TKTA 1NJXA 1LAVA 4LF4K 4FZZA 4I9QA 3KZBA 2F7TA 1QQMA 4PKGA 3RTVA 5HRPA 2UUAK 4C8NA 1L3UA 2FBYA 5HROA 3A8YA 4CFBA 4M63C 1VSDA 4FWMA 4MQ3A 5EOYA 4CBWA 2QKBA 3K5OA 1KAZA 3VF6A 2O8BA 4JD2B 4JKFA 2Q0UA 3QNOA 4FJLA 3BY5A 4F2SA 4KV8A 4FZXC 1F21A 2VQFK 2W6LA 1NGFA 3E01A 2IAJA 2GX9A 2YNIA 4FJIA 4M3TA 4H0XB 4CJPA 4DLGA 3U6FA 1KD1O 4E7KA 1WN7A 3VENA 1Z26A 1GOAA 4CEZA 2A1RA 4FJ9A 3PIPL 3ZYYX 3UE5A 4EHUA 2NNWA 2BANA 4CEDA 1TK8A 1C6VA 4CD1A 3F9MA 1LAWA 1VQ9N 1LCUA 2Q3SA 4EP4A 4X64K 2P51A 1UOCA 5AQQA 4IOCL 4CCHA 1T05A 2HHXA 4W5QA 1TKZA 4WFAL 3OYDA 4H5NA 1WBBA 4O8KA 2UUBK 2OA8A 3D2FA 4ILGB 4CJSA 1NMNA 1S1XA 3ZEUA 4CW7B 4JRQA 3ATVA 3D2EA 3NF6A 4CFAA 3S3OA 1ZBLA 2GEMA 1WAFA 1ZYQA 2KFNA 4OPAA 1V4TA 3S3NA 3ZCMA 3ZSXA 1XMQK 3O4WA 2YJFA 1RDUA 4L8RB 4EP5A 2YHXA 4B3TK 3M3ZA 3TTDA 3OYKA 4FYDA 4YDUA 3B6OA 3VOVA 1JCEA 4BREA 1KAYA 1G99A 3R8EA 1XC3A 3ZX3A 3TANA 1GLDG 4MO4A 1VK0A 4PY5A 3ZETB 2VG6A 3TAEA 2BTFA 4IOXA 5HRRA 4WQ5A 4QCLA 3CC4N 5KI6A 1BCOA 1HRHA 1KRPA 4KAZA 1HQEA 3PO4A 2YHAA 1HNIA 3WEEA 4JLHA 4CFCA 3RR8A 3TSPA 2O4IA 4I9LA 4AHUA 1UA1A 5JLHA 3RSEB 2F8TA 4DR7K 2ASOA 3H08A 1VQ5N 3G25A 2O4GA 2CH5A 3T1AA 1S3XA 1NK9A 1NG9A 2JWLA 3MEEA 2FSNA 3OS0A 3HP6A 2YHWA 3CM6A 5AQZA 4BRQA 1IH7A 2GBZA 1BGXT 1JKHA 5BPLA 3O1WA 5SWMA 1ZBIA 5AQUA 4YFUA 4M3XA 1BU6O 4O55A 4BRNA 2E1ZA 4BGBA 1P90A 1FK9A 3AGKA 4B9VA 3D45A 3LWMA 3NVMA 5CZ1A 4A2AA 2KZMA 3VQQA 2FF6A 1KCFA 4H4OA 3HYFA 2RKIA 3C6HA 4M45A 3FR0A 2YJEA 3VESA 5C15A 1T03A 3SI6A 4DU1A 1BA1A 3EE8A 3UKRB 4JK7A 5AQWA 4ISFA 4CZFA 4ILJA 3DRSA 3V9WA 1EETA 4JK9A 2IS3A 3LP0A 1WLJA 3P39A 4IXCA 1YUWA 4BRMA 3CCVN 3THWA 1KLMA 4XH5A 3U9DA 4DFPA 4M42A 4FJMA 5JMVA 3TPQA 2Z1GA 2IVOA 5HLFA 4ISEA 3HO1A 1FKOA 4FWKA 5M1QA 3HSTB 3HK2A 1J54A 5AQFA 4W5NA 1JCGA 4EIAA 1TYQB 2QWMA 4JI0K 4KPYA 3GOIA 3BEXA 3NHGA 2D0PA 3I8DA 4ID1A 1TUUA 3NDKA 2OPPA 3NF8A 5SZTA 3AA3A 5J2PA 1HNZK 4RW9A 1K8AO 1P8ZA 2Q97A 4KH4A 1LW2A 2D1KA 5CE3A 4KHPK 1MWKA 3ENHA 1KQSM 1HPMA 3K0SA 3LDNA 1TK5A 4JHDA 1WSJA 3LAKA 2YNFA 4LFCK 2Q1NA 3NBPA 5BN8A 1RDBA 1YJWN 5C42A 2DFHA 3AVBA 4BGAA 4BQZA 4JI3K 3DRRA 4WYBA 4O44A 3AGRA 3MN7A 1B92A 1BWFO 4DF4A 1QS4A 4LFAK 4K8XA 3THXB 4NCGA 3LZJA 2P9NA 3SMSA 2LSNA 1OH5A 1DGKN 3I55N 3DOLA 3QBXA 1Q18A 4LF5K 2E20A 3M8PA 1Z25A 2YV0X 1HJRA 4MDAA 1NK4A 2IVPA 4BRIA 3BP8A 4IDHA 4RTFD 5GAHP 3CF5L 5AZJA 4FPBA 4BE1A 3CMAN 4B9SA 2NRVA 5BPNA 1JLQA 3KKRA 4K42A 3LL3A 3HL8A 1OVQA 4E19A 3RMAA 5AQNA 4CIEA 2BH1A 1RDCA 3KWIA 4OKEA 3AVIA 4CK3A 4OLAA 4Z4CA 2JLEA 5BRHA 2DPNA 1NGIA 3WQUA 3ZSYA 4FK0A 5GAEP 1M90O 3RVCA 1C1AA 4F3TA 2D0BA 3J7YP 2YI1A 2X6SA 4JKDA 4JKEA 5AQHA 1NK8A 4WQ4C 2XY6A 4DV6K 3PX6A 5KQDA 1O1WA 3JYTA 3U3YA 5BPMA 3V9UA 2WC9A 4X66K 3O9UA 4BVOA 1BI4B 2P9LB 3ZSRA 3MN9A 3KD1E 4JKAA 4DV5K 1VSIA 1JLGA 3PX4A 5EU7A 1XQSC 3O6WA 4FWQA 4FLZA 5FRMA 1BIZA 4NXMK 2Z1JA 1Q82O 3CCQN 3ZT3A 2Y1IA 3O80A 1WSHA 4DFKA 4JI7K 1OKJA 1RGIA 4LY7A 3ZETA 2FBTA 3HOTA 3K5LA 2HHSA 4FPAA 4KHWA 1HKBA 3PV8A 3MXIA 4PWDA 1IKXA 3CCUN 3CJ1A 3SQ1A 1CXUA 2IC3A 4AHTA 3TWHA 4JI1K 2I7PA 4FM0A 2HNYA 1SL2A 5MLCQ 2ASMA 1SQKA 4K43A 4XEIA 3L4QA 4F4KA 4DR3K 4FZYA 4YOWA 4JKGB 5BRDA 4EFHA 1Q86O 4BG8A 3OS1A 3OJUA 4BR5A 1VQ8N 1VQON 4K41A 3V1OA 4JN4A 4B3SK 5BREA 4JS5A 5BN9A 4OX9K 4FSVA 3F9KA 2XY8A 3CJAA 5H1SQ 3PUFA 1W0HA 1U6ZA 3QDKA 4CJ7A 1HMVA 3RWUA 3EZWA 4IOAL 3CETA 1KTQA 4CJWA 2UXDK 4GVEA 5AQIA 2HW3A 3SMPA 2RHKA 2FC0A 1U48A 1M1KO 1QQOA 3HM8A 1W97L 4ELVA 5AR0A 1VSFA 3NF7A 4CGHA 4FJJA 4CERA 2ZF5O 3R9PA 2D4WA 1S6PA 4CEAA 3RRGA 3I8BA 3NE6A 1EWRA 4HUFA 2HHQA 2A40A 4CI6A 4BRKA 4AQYK 4KHSA 2O8BB 2Q31A 4M7XA 4OPHA 3E9OA 1BQNA 4ISGA 3FFKB 1BL3A 1UWBA 2F96A 3K59A 3H1VX 5CYQA 2W42A 2OANA 4HUEA 4IFVA 5JVHL 1VSEA 2HBMA 1C0TA 1N36K 4KFBA 3FZFA 5C25A 3H3OB 5AQGA 4DFMA 3HP9A 4B9UA 4DQSA 4G9ZA 5AQSA 4WQ5C 4IJAA 1QE1A 3L3VA 2HOEA 1N32K 1Q8IA 4DB3A 1DTTA 4BE2A 3EKSA 1NJZA 3ZT4A 3CI5A 5GIOA 1OH8A 1IBMK 4CZHA 2E8AA 3F2KA 4YOVA 4FM1A 2XY7A 1IJJA 1WSFA 5LJVA 3LDOA 4KKOA 3FZKA 4BWMA 4DTNA 3I0RA 4CZJA 2XY5A 2NUBA 3KK2A 3HVRA 1BOTO 3K5NA 3A2FA 2NLXA 3O8MA 1U45A 4BRDA 1JLAA 3A5OC 5TKWA 4Z4EA 4FWLA 4GKJK 3VQ6A 3VMFB 3GL1A 2ASPA 1BHLA 4BC5A 3MDQA 2A6AA 3MXJA 3VETA 2D5RA 2D0AA 4EHTA 4JRPA 1RT1A 1Q81O 2E88A 3TU5A 1Z6RA 2YNHA 5K14A 3MXMA 4ZTJA 1D9FA 4QOZB 3CCEN 3P31A 4FCYA 3M8SA 4DS5A 4CESA 3OBYA 1NJIO 4FW1A 4JI6K 3G4SN 2P5OA 3QIPA 1SL1A 4DFJA 2P9NB 1OVYA 4DLEA 2P9PA 3THXA 5FRNA 3CJ7A 3G0ZA 1EKEA 4NYFA 4JI5K 1IKVA 3L2RA 2PZSA 1TL3A 1HJOA 4C1NK 3HPHA 4JKHA 2RN2A 1E3MA 1RILA 4B8AB 3CJCA 3KK7A 1TAQA 2EX3A 3AVGA 4CEEA 4CF1A 3OYHA 4FXDA 2P9IA 4DQQA 3G71N 3CCLN 4AF1A 3DOKA 3T19A 4Q5VA 4B9NA 2PY5A 1QHAA 1GLEG 4BRAA 4W5OA 3M8QA 3QIOA 3K9JA 4J2EA 1RT6A 3VEOA 2HHWA 3AO5A 4RG8A 1NGEA 2G8UA 1RT4A 4C1NI 1TYQA 2GTDA 3FZHA 3Q7BA 2E2QA 4ILHA 1HYSA 4PKHA 3TR8A 4IBNA 3TI0A 3ZSQA 1C0FA 2NRHA 3HJFA 4JKGA 4KHUA 2NRXA 4I6MA 4Y1CA 5KGWA 3OA9A 4E0DA 1DKGD 3NVKA 2O8CA 1D4XA 1KVBA 3NMUA 4AHCA 5AQVA 5AZIB 3KLHA 4FK4A 4Z4GA 4FWRA 3QINA 3UKRA 2Z1IA 4A5BA 2F4VK 4OKKA 3BZKA 2VG5A 1LOTB 2P5GA 3OHRA 2UXBK 4A5AA 3T1HK 1C0GA 1YT3A 3SCXA 1Q9YA 1CZBA 3OY9A 5HRNA 4FL9A 1JXBA 3ULDA 5AQXA 3J7AP 2ZD1A 3CM5A 5BRFA 3VQ5A 3KLEA 4IG3A 2DFEA 2DFFA 1X9MA 3LALA 5GIPA 4O5FA 3LAMA 3AVAA 2YCHA 3GBTA 2O8EA 4FJNA 5JVGL 1XHZA 3ENOA 2QWRA 1J6ZA 4CVNE 3DLLL 1WUAA 3SAGA 1S1TA 1IBLK 4DKWA 3S9HA 2E1YA 3HRGA 3C6UA 1U47A 4HHTA 3P5JA 1NWKA 4OO1J 1KAXA 1MA9B 4U67L 4IFEA 2OZSA 2HBKA 4NB4A 4BRHA 1HKCA 4R5PA 3IKMA 2VYPA 3AVMA 1J5OA 3OYCA 5CY4A 4IWVA 3CPEA 4DUZK 3QEXA 3E1YA 3VPZA 3FZLA 4PQUA 5JLFA 4JAXA 5E41A 2E6MA 3ENBA 1NNEA 1I94K 2OTJN 4KHNA 1TUYA 3CYMA 5AZJB 1WAJA 3K5MA 1VSMA 3QFUA 4QAGA 3V1RA 3KTQA 5FPNA 4H03B 1RBSA 4DR1K 4KTWA 3SUNA 2KKZA 3VQPA 4Y0WA 4FWSA 3H1QA 5GAGP 2Y1JA 3F5TA 5AQPA 4B3RK 1DT9A 4H5WA 2OYQA 1XUPO 1RTHA 1JCFA 3IFRA 3RR7A 3LDSA 3KLFA 4YDUC 3SV3A 3WXMB 4CZLA 4BRLA 1VQ4N 1FXXA 3I33A 2QWPA 5J2QA 1RTDA 4JHDB 3AVFA 3O4NA 3ZEUB 1REVA 2B5JA 3PSIA 4DS4A 4I2QA 3D2FB 5FPMA 3QB0A 4CF0A 3OS2A 4FWNA 5J1EA 1RDWX 4TSXA 3UIQA 4H5RA 3DRPA 4FLWA 1NKBA 3AVJA 2G8HA 3T3FA 1S9GA 1HQUA 3NGYA 4JKBA 4N76A 3WNHA 3VEYA 2W41A 4OGEA 3JSMA 3J7ZO 3CCJN 3LZIA 3ZT1A 2AA4A 3LPTA 1HKGA 5LY3A 1NBWA 3QEVA 4E7JA 4BC2A 3W0LA 2CGLA 1MDUB 1RBRA 3HXMA 3AA2A 3THWB 3VQCA 4BC4A 3CCSN 3QEPA 3DAWA 3SV4A 3VTIA 1U49A 4H0TB 4E7HA 4N47A 2IGIA 4E3SA 1XNRK 3HVTA 1VSJA 4IO8A 4JD2A 4RW8A 3ZSVA 3SQ2A 3JXUA 4C8LA 3ZX2A 4FLUA 4V19S 2HBJA 1D9DA 4M3WA 2OCEA 1W7AA 3SAFA 2FSJA 1N33K 4CECA 5IT9O 4FM2A 1ZC6A 1VQLN 3PX0A 1Y97A 4CF2A 4BG9A 4CGDA 4MO5A 4B1WB 1HYZA 2EWSA 4RW7A 2OPRA 2KQ2A 3VF4A 4GY2B 4AILC 1RFQA 4W5RA 4O5BA 1O13A 1YF5L 4DQ8A 2UXCK 1CXQA 4H4MA 3IUCA 2KTQA 1TVRA 2A41A 3KK1A 5IWAK 3DMJA 1QZ6A 5HP1A 2CH6A 2ITMA 3VGMA 1YVUA 5AQMA 2OTLN 3PIOL 1HNWK 1VRTA 3UB5A 3QEWA 3SPZA 3RSEA 5FPEA 2F8SA 4BR0A 3SQ4A 4H0OA 3H6EA 3LM9A 4DF8A 3OYIA 2KLAA 3WEEB 2QXFA 3FFIA 5EX5A 2ZJRL 3JAMO 1YAGA 2QI2A 4LSLA 3RRHA 2GWJA 1WSEA 5AQKA 1YI2N 3BUZB 4DTMA 4BC3A 4C23A 1JLFA 3CJBA 1YJNN 3O4QA 3SQ0A 4DTRA 2YNGA 3RMCA 1YXQA 3DM2A 2YKMA 1U04A 3R3LA 3C6AA 4JEPA 4ELTA 4LSNA 1TGOA 1IKYA 3DXKB 2ITGA 3J8AA 1TAUA 3O9QA 3EN9A 3KIOA 2CGJA 3CD6N 1ILYA 1NJYA 3CQXA 1ZBSA 5KTQA 1WBDA 4CZMA 4AHVA 2HHHK 2KFZA 4JI2K 3WNEA 3C95A 1TKDA 4BRFA 3LP2A 4M3ZA 3D2EB 4DTSA 2O8DA 3VQ9A 3IRXA 5HRSA 3V81A 4RW6A 1WOQA 1JLCA 4O8UA 2G8VA 4B3OA 3CXCM 1L3VA 1D8YA 3EZ5A 1NGAA 2Q2RA 4QS8A 4CD3A 2R7YA 1J53A 3HPOA 3SK3A 3B6PA 1FJGK 1ZBUA 3P38A 3KHYA 4FJXA 1RDDA 2HVHA 1DEJA 1L3SA 4FJKA 2HSTA 2WFBA 5E26A 4J2AA 5AQLA 1MWMA 3CCMN 1VAZA 1A5VA 5J2NA 1I3AA 5J2MA 4BVPA 1VHXA 3OW2M 2DY4A 1NGGA 4Z0UA 1WSIA 2Q36A 4QS9A 5HBMA 4BRPA 4U7BA 4CJ3A 2O8FB 1E4FT 3LDPA 4BWJA 4DV7K 4DQPA 4CE9A 4KHQA 4RWTA 4Z4FA 4HVJA 3TAFA 4HCCA 4DV1K 3EKUA 1X9WA 2QXLA 3L0QA 3A5MC 4LH5A 4M3YA 3DWLA 1C0MA 3MCPA 1LV5A 3I56N 2B4JA 4YOXA 1BISA 1D5AA 2ZGYA 5DMRA 5FDLA 2VWJA 3THVA 2H3GX 2I5JA 5CYMA 3TSQA 3UKUB 1CZ9A 4CBUA 4GNIA 5KRSA 3L3UA 4KB1A 3EE9A 2ZJQL 3AVNA 2HHUA 1RT7A 2QW9A 1C1CA 4DSFA 5T7BA 1CZAN 1L5UA 1N34K 2ZJPL 1GLJO 4FK2A 3N4QA 1MU2A 4LH4A 4FJ5A 3MX5A 3WXKA 4N41A 4EAHD 1IBKK 1EP4A 4DMNA 4ZHRA 3DLEA 4I2PA 3ISNC 4DG1A 3ID8A 1SV5A 5EVZA 3W3DA 4YOTA 4B8CA 1QSLA 2QM1A 3KLIA 4CJEA 4FLVA 4FJGA 5C2FA 3OBWA 3VF2A 4CF8A 2QWLA 3VQAA 3HZ6A 1U4BA 2I7NA 3L8BA 2E2PA 4XH4A 3ITHA 5FLXO 1JJ2M 1NLVA 1X9JA 4CJUA 2P9UB 3EY1A 2P9UA 2A3ZA 3H45C 4LF7K 4YOUA 2P9KA 2GUIA 3ATUA 3VN5A 4HTUA 1LWEA 4DSEA 3O3HA 3MAQA 3VQ8A 5LMNK 2HVIA 2GV9A 3QNNA 3THYB 3TABA
chains in the Genus database with same CATH topology
2V52B 4FWRA 1Y64A 3NVMA 3MCAB 1Q7YO 2V7ZA 3UKRA 2VWBA 4A5BA 4H0PA 4A2AA 1S22A 3E9LA 2FF6A 1VQKN 3SLCA 1LOTB 3GDQA 3OHRA 4A5AA 1C0GA 3C6HA 5KPTA 4B1YB 3EL2A 3FR0A 2AP1A 2YJEA 1GLFO 3IMXA 3A5NC 1HLUA 5TKYA 3VESA 5C15A 5F1XA 3LDQA 3FLCO 4FL9A 3VEVA 5AQXA 1BA1A 1NGBA 3EE8A 3VERA 4BR9A 5KQ8A 3UKRB 4GV6A 5C0YA 4JK7A 5AQWA 4J8FA 4ISFA 4H0VB 1QZ5A 4CZFA 3ID6A 4ILJA 5BRFA 1K73O 4B1VA 4BR2A 4JK9A 4BR4A 2P9PB 3WXLA 2J4RA 1IG8A 3QBWA 3MWPA 3HSCA 5GIPA 3HTVA 4O5FA 5GINA 3A0IX 3P39A 4IXCA 1YUWA 2YCHA 1YVNA 3GBTA 4BRMA 2IIRA 3CCVN 5JVGL 1K9MO 3ENOA 2QWRA 1J6ZA 4XH5A 3U9DA 3O5BA 5E84A 1WUAA 3TPQA 2IVOA 5JMVA 4ISEA 3SAGA 4YOYA 3DLLL 4DKWA 1QQNA 2P9KB 1ATNA 2YHYA 4FWKA 2E1YA 5M1QA 3AAPA 3HRGA 3Q7CA 4GV3A 5AQFA 3C7NB 1U2VB 4A57A 4H0YB 1JCGA 2IVNA 4EIAA 1NWKA 1TYQB 2QWMA 3BF3A 1GLBG 3GOIA 4FO0A 4OO1J 3HI0A 3BEXA 1KAXA 1MA9B 4U67L 5HL7L 2D0PA 2FF3B 3WXIA 4GV9A 1GLLO 4IFEA 4BR7A 1TUUA 2HBKA 4M7YA 4NB4A 4BRHA 3MWTA 1HKCA 5EY4A 3IKMA 4F9OA 3SAHA 1VQNN 5AQRA 2VYPA 1K8AO 1P8ZA 4IWVA 4KH6A 5KPZA 2Q97A 3D6RA 4KH4A 3WT0A 2D1KA 3CPEA 5CE3A 1MWKA 3ENHA 3VEZA 2UYTA 3E1YA 1KQSM 1HPMA 3VPZA 3FZLA 4MLEA 4FVUA 2F9TA 3LDNA 5C12A 5JLFA 4JAXA 5DM7L 1U2VA 2HMPA 4L3QA 4JHDA 1W2BM 2OTJN 3ENBA 3R6MA 1TUYA 3C65A 3EO3A 2Q1NA 3D7EO 5AZJB 1ATRA 3QFUA 2NRZA 5BN8A 1YJWN 2CGKA 4R79A 4CBXA 5FPNA 4BGAA 4H03B 4BQZA 3IDHA 4WYBA 3AGRA 2PFUA 3CIPA 1SAZA 1BWFO 3MN7A 2KKZA 3T7ZA 3U8XA 2GUPA 4Y0WA 1X3MA 4FWSA 3H1QA 5GAGP 2FXUA 3F5TA 1GLCG 2P9NA 3SMSA 5AQPA 1DT9A 3HBTA 4H5WA 1DGKN 3I55N 3LDLA 1XUPO 3UKUA 1VQ4N 4BRGA 3QBXA 1JCFA 1BUPA 3IFRA 3G6EN 1Q18A 3BF1A 2E20A 3L4IA 3VGKA 3MMVA 4FWPA 5F2RA 4MDAA 4IEIA 4YDUC 4KBOA 2IVPA 3WXMB 3BP8A 4IDHA 4RTFD 3QMLA 4BRIA 4BRLA 4FPBA 4CZLA 5AZJA 5GAHP 1V4SA 3I33A 3CMAN 4QS7A 5M1PA 2QWPA 2QWOA 4PL8A 2GELA 4JHDB 2NRVA 5BPNA 3MK6A 3ZEUB 4H5VA 4K42A 2YX6A 3LL3A 2VGMA 5BR9A 4A62A 3D2FB 1SZ2A 5AQNA 2BH1A 3QB0A 5FPMA 4B9QA 5I9EB 4FWNA 3PLAA 1RDWX 2WUSA 3KWIA 1EO1A 4H5RA 5AQYA 3P4IA 2D0OA 1VQ6N 5AQOA 3QFPA 2A5XA 2PBDA 2DPNA 1NGIA 5BRHA 4WF9L 4JKBA 1NGHA 3WQUA 3VEYA 4XH1A 3ZX0A 3MN5A 5GAEP 2W41A 1M90O 3CF5L 3RVCA 3WUHA 1H1VA 3J7ZO 5KPRA 3FGUA 4HWIA 3CCJN 2PAVA 3DXMA 2YI1A 3TTFA 3C7NA 4JKDA 4JKEA 2AA4A 5AQHA 1HKGA 4WQ4C 4PHTX 5LY3A 1NBWA 4IEEA 5KQDA 4BC2A 3E66A 3W0LA 5BPMA 2CGLA 2WC9A 4E1JA 1MDUB 2P9LB 3O9UA 4BVOA 5JICA 3MN9A 3H3NO 3ULEA 5C10A 4BROA 2QEXN 4RCHA 4BC4A 3CCSN 4JKAA 2HBLA 3DAWA 2QWQA 3GG4A 3CC7N 4IJNA 3VTIA 1GLAG 4NO7A 3U9ZA 4A2BA 5LJWA 4H0TB 1XQSC 3O6WA 1KXPA 4FWQA 3O9SA 4A59A 3M5RA 5M1FA 3M6GA 1Q82O 4IO8A 5M1NA 4JD2A 3CCQN 3O80A 2P9IB 1N8RO 3VEWA 3O1BA 3JXUA 2FSKA 3ZX2A 1OKJA 1YHQN 2HBJA 1RGIA 4BQLA 2VGNA 4HTLA 4PKIA 3ZETA 1K8KA 2FSJA 3SAFA 5ADXH 2GWKA 3HOTA 4FPAA 1ZC6A 1NGCA 1HKBA 3VTHA 1VQLN 1ESVA 2BUPA 3AY9A 4BG9A 2F9WA 1NM1A 3CCUN 1YJ9N 4MO5A 3B8AX 3CJ1A 4B1WB 1QVFM 2EWSA 1VQ7N 2I7PA 3S41A 3VF4A 4GY2B 5MLCQ 4IZ9A 3O9RA 3AARA 2ASMA 1SQKA 3CJ9A 4K43A 3SJHA 1YIJN 1RFQA 4XEIA 3L4QA 1Z05A 1O13A 1YF5L 4DQ8A 4YOWA 4UY8O 4JKGB 3IUCA 3T69A 5BRDA 2A41A 4EFHA 2P9SB 1ZXOA 4BG8A 4AM7A 1QZ6A 1Q86O 3FE1A 4BR5A 2CH6A 1VQON 3HOSA 1VQ8N 3LM2A 2ITMA 3VGMA 3VEXA 4K41A 5AQMA 2OTLN 3K9KA 4JN4A 2QWNA 4KH5A 3PIOL 5BREA 3L6QA 2E2NA 4MLHA 5BN9A 3UB5A 4FSVA 3QICA 3RSEA 3CJAA 3O9TA 5FPEA 4BR0A 5H1SQ 4H0OA 3VGLA 4K25A 3R1XA 3H6EA 5EXWA 1U6ZA 1VQPN 4CZKA 3QDKA 3LM9A 4CJ7A 5F0XA 4B1UB 2KLAA 3WEEB 3EZWA 4IOAL 3CMEN 5EX5A 4FOIA 2ZJRL 3CETA 3FZMA 5AFUH 1YAGA 4GVEA 5AQIA 2QI2A 3SMPA 2RHKA 4WQ4A 2GWJA 3M1FA 5AQKA 1YI2N 4A61A 1HX1A 1M1KO 3BUZB 1QQOA 2ZGZA 3HM8A 4BC3A 1W97L 1E4GT 4C23A 3CJBA 1YJNN 1NMDA 2P9LA 3CCRN 3KWGA 5AR0A 3H46O 2FLOA 1YXQA 4B1XB 5ADXA 3CHWA 3E9PA 2ZF5O 2RE2A 4JK8A 3R3LA 3R9PA 4WCEL 3C6AA 4JEPA 2D4WA 3WXJA 3MX2A 3DXKB 1T3VA 3J8AA 3KVGA 3EN9A 3N4PA 3I8BA 3O9QA 5AFUA 2W40A 2CGJA 3CD6N 1ILYA 2A40A 3CQXA 1ZBSA 4CI6A 4CZMA 4BRKA 2Q31A 4NLBA 4M7XA 2Q0RA 4OPHA 1KC8O 1QVGM 3GE1A 3E9OA 4ISGA 1YITN 3FFKB 3U4LA 3SBGA 2NRRA 2VCPA 4BRFA 3H1VX 2OANA 3TTCA 3D2EB 5JVHL 2HBMA 3KZBA 2F7TA 1QQMA 4PKGA 3CERA 3C0BA 3FZFA 1K8KB 1WOQA 3CC2N 3H3OB 3A8YA 4O8UA 4M63C 4FWMA 3CXCM 2QTDA 5EOYA 5AQGA 4G9ZA 1NGAA 2Q2RA 4QS8A 5AQSA 4WQ5C 4CBWA 1KAZA 4IJAA 3VF6A 4JD2B 4JKFA 2Q0UA 2HOEA 4CD3A 1BDGA 3SK3A 4DB3A 3SBTA 3EKSA 3P38A 3CI5A 3KHYA 5GIOA 5HOOA 4CZHA 3DXKA 2E8AA 1NGFA 3F2KA 4YOVA 2A42A 2GX9A 4CZGA 1IJJA 5LJVA 3LDOA 4H0XB 1DEJA 3FZKA 1KD1O 3ULEB 4CZIA 4CZJA 2HSTA 2WFBA 5E26A 4Z94A 5AQLA 3CQYA 3VENA 1MWMA 3CCMN 1VAZA 5B8HA 3PIPL 3ZYYX 3UE5A 4EHUA 2NNWA 4BVPA 4WFBL 1T6CA 1BOTO 2HF3A 2NLXA 4CD1A 4LC9B 3F9MA 3O8MA 3OW2M 3DXMB 4B1ZA 4BRDA 1NGGA 1LCUA 3A5OC 5TKWA 4FWLA 5ELZA 1VQ9N 3VMFB 3GL1A 2Q36A 2ASPA 4FOEA 4QS9A 4DHYA 4BC5A 1R59O 3MDQA 5AQQA 4IOCL 5GADP 2NRTA 5M1OA 4BRPA 2A6AA 4WFAL 4U7BA 3VETA 1E4FT 2V51B 3LDPA 4H5NA 1NGJA 4O8KA 4JNEA 3D2FA 2V7YA 4CZEA 4EHTA 4RWTA 4ILGB 1Q81O 2E88A 1T6DA 1HUXA 3TU5A 1Z6RA 3ZEUA 3ATVA 3D2EA 3EKUA 2QXLA 3L0QA 3CCEN 3A5MC 4DCHA 3DWLA 3P31A 1SS6A 3MCPA 3I56N 4YOXA 3OBYA 1NJIO 2GEMA 1ATSA 2ZGYA 2H3GX 4OPAA 1V4TA 3TSQA 3UKUB 4CBUA 4GNIA 3G4SN 3AAQA 3O4WA 2P9NB 1EQYA 1OVYA 1RDUA 2P9PA 1BO5O 2YHXA 2YJFA 3EE9A 2ZJQL 2NRWA 3M3ZA 5AQJA 3TTDA 4AM6A 4PL7A 4YDUA 3CJ7A 2QW9A 5AQTA 1JCEA 3VOVA 4BREA 1KAYA 1G99A 3R8EA 2NZTA 1BA0A 1XC3A 3ZX3A 1CZAN 5CR4A 1GLDG 1HJOA 1X3NA 4MO4A 4C1NK 4JKHA 2ZJPL 3O08A 5FPDA 1GLJO 3JS6A 3N4QA 3ZETB 3CPWM 3CJCA 1S72N 1VQMN 2BTFA 3KK7A 1NGDA 4IOXA 3MX5A 4WQ5A 3CC4N 3WXKA 4EAHD 5M1KA 2P9IA 3G71N 3CCLN 3MN6A 1BG3A 4AF1A 3DJCA 3ID8A 5EVZA 3TSUA 3W3DA 4YOTA 3WEEA 4YORA 2QM1A 4MDBA 4FWOA 2ZWHA 1QHAA 1GLEG 3A5LC 4BRAA 5C2FA 4H5TA 3TSPA 3OBWA 5AZIA 3VF2A 2QA4N 2QWLA 4WFNL 4JKCA 3K9JA 5JLHA 2HF4A 3HZ6A 3VEOA 4BY9C 4I6MB 3RSEB 2ASOA 1NGEA 1VQ5N 3G25A 2I7NA 2E2PA 4XH4A 4C1NI 1JJ2M 1TYQA 2GTDA 3FZHA 1NLVA 1X9JA 2CH5A 2E2QA 3Q7BA 3WQTA 2P9UB 1S3XA 4NLCA 2JWLA 4ILHA 2P9UA 2A3ZA 3H45C 4YOUA 2P9KA 4PKHA 2FSNA 3ATUA 2E2OA 2P9SA 1C0FA 1T44A 2NRHA 2YHWA 2WBNA 5AQZA 4JKGA 4BRQA 2NRXA 4I6MA 3OA9A 5BPLA 1DKGD 5C2DA 3NVKA 1D4XA 3O1WA 5AQUA 3NMUA 1BU6O 5AQVA 4BRNA 5AZIB 2E1ZA 2KHOA 4BGBA 1P90A 3AGKA 2JWKA 4IO9L 5DM6L 5CHIA 4BRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFU A;  2JWL A;  2JWK A; 
#chains in the Genus database with same CATH topology
 2V52 B;  1WSG A;  1Y64 A;  1FW6 A;  2VWB A;  5LMU K;  4H0P A;  2ZM6 K;  4JS4 A;  3SLC A;  3NH2 A;  4KI4 A;  1SKR A;  3AO4 A;  3A5N C;  1HLU A;  5TKY A;  3OYF A;  5F1X A;  3LDQ A;  4CEQ A;  1WB9 A;  1DTQ A;  1NGB A;  3VER A;  5KQ8 A;  1ASV A;  4DUY K;  4DTP A;  5C0Y A;  2HHV A;  2FBV A;  1K73 O;  3ID6 A;  2HMI A;  3RMB A;  4GMJ B;  3QEI A;  4BR4 A;  3WXL A;  2J4R A;  1ASU A;  1IG8 A;  3MWP A;  3HSC A;  3HTV A;  3TAG A;  5GIN A;  3A0I X;  3P1G A;  1K9M O;  3L2V A;  4CIG A;  2BDP A;  5E84 A;  4CHO A;  4YOY A;  4G1Q A;  4IFY A;  1QQN A;  1ATN A;  3Q7C A;  3L2W A;  2ETJ A;  1U2V B;  3ZSO A;  2IVN A;  4O0I A;  3BF3 A;  1GLB G;  4FO0 A;  1XI1 A;  4KRE A;  1NK6 A;  5HL7 L;  2FF3 B;  3WXI A;  3QO9 A;  1TK0 A;  4BR7 A;  1LWC A;  4M7Y A;  3MWT A;  2O8F A;  5EY4 A;  4F9O A;  1VQN N;  5AQR A;  2X78 A;  4KH6 A;  5KPZ A;  3D6R A;  4E7L A;  2UYT A;  1RBT A;  1C1B A;  4MLE A;  4FVU A;  2KW4 A;  3LPU A;  1JL1 A;  1U2V A;  2HMP A;  4IG0 A;  4L3Q A;  1W2B M;  3R6M A;  3SJJ A;  4DSL A;  3QET A;  1KFD A;  3K2P A;  4CHP A;  1ATR A;  2NRZ A;  2VQE K;  2XRI A;  3IDH A;  4OPK A;  4AH9 A;  3CIP A;  3U8X A;  3T7Z A;  1X9S A;  1XMO K;  3WNF A;  1X3M A;  3OYG A;  3TAQ A;  4ID5 A;  4JYA K;  3KKS A;  3G6E N;  3BF1 A;  1QQC A;  2HNZ A;  3VGK A;  3MMV A;  4FWP A;  5F2R A;  3LP1 A;  1KSP A;  4IEI A;  4KBO A;  4QS7 A;  2O8D B;  4K0K K;  4H5V A;  5BR8 K;  5I9E B;  4X65 K;  4B9Q A;  3PLA A;  1LW0 A;  2G8K A;  2WUS A;  3THY A;  4CGJ A;  1VQ6 N;  5LL6 Z;  1HYV A;  3QFP A;  4OVL A;  1RT2 A;  4DSI A;  3PSF A;  4WF9 L;  4Z4I A;  4JI8 K;  3ZX0 A;  4CJF A;  4YNQ A;  4FJ7 A;  1H1V A;  5KPR A;  1WNS A;  5I42 A;  3DXM A;  3TTF A;  2XO7 A;  4KRF A;  3C7N A;  1XNQ K;  3QLH A;  3DLR A;  1A5X A;  4PHT X;  4M3U A;  3S3M A;  3BGR A;  3E66 A;  4DSK A;  5KGX A;  3H3N O;  3ULE A;  1NK5 A;  4RCH A;  2QEX N;  1FKP A;  3ZT2 A;  2HBL A;  1T8E A;  3VQD A;  2QWQ A;  3OJS A;  3CC7 N;  1OH7 A;  4DV0 K;  4X62 K;  3V4I A;  3U9Z A;  5LJW A;  1BIU A;  3CFR A;  4DWI A;  1KXP A;  4LFB K;  4A59 A;  3M5R A;  5M1F A;  3M6G A;  2YKN A;  2OPQ A;  4CK1 A;  3VEW A;  4CEO A;  3O1B A;  2FSK A;  3D0P A;  4PKI A;  4HTL A;  1K8K A;  1S1U A;  5ADX H;  2GWK A;  4AHR A;  3L2U A;  3AY9 A;  2F9W A;  1NM1 A;  4H8K A;  4CJT A;  1NKC A;  5AJ3 K;  1VQ7 N;  3NAE A;  3S41 A;  4IZ9 A;  3CJ9 A;  3SJH A;  1YIJ N;  2QK9 A;  4FLT A;  1Z05 A;  5KRT A;  3T69 A;  4F2R A;  4CJK A;  2P9S B;  3BZC A;  1S6Q A;  3FE1 A;  3DI6 A;  3VEX A;  4DTJ A;  4K8Z A;  3PO5 A;  2PYJ A;  2QWN A;  3EYZ A;  2E2N A;  3V9Z A;  3LP3 A;  3VGL A;  4M3R A;  1HPZ A;  5EXW A;  4CZK A;  1XHX A;  4B1U B;  5F0X A;  2IOC A;  3CME N;  4OLB A;  3F73 A;  1NOY A;  5AFU H;  3SYZ A;  4CJL A;  4NCA A;  2ATQ A;  4CJV A;  3M1F A;  4A61 A;  1HX1 A;  2ZGZ A;  1T7P A;  1KFS A;  1NMD A;  3IG1 A;  3KWG A;  3CCR N;  3H46 O;  2FLO A;  3O3G A;  5ADX A;  3CHW A;  3E9P A;  3C6T A;  2RE2 A;  3AVK A;  4WCE L;  3SNN A;  3WXJ A;  3MX2 A;  2VWK A;  2D0C A;  1T3V A;  2W6K A;  4C8M A;  5AFU A;  2W40 A;  3NCI A;  4CEF A;  3AO2 A;  4PA1 A;  4NLB A;  3V9X A;  2YHB A;  1JLB A;  4IDK A;  4BDP A;  3GE1 A;  1SUQ A;  4EZ9 A;  3SBG A;  4DU3 A;  2NRR A;  4C8O A;  2X6N A;  1QSS A;  1QTM A;  3TTC A;  4CK2 A;  3P83 D;  1VRU A;  3CER A;  3C0B A;  3CFP A;  4BDY A;  1K8K B;  4GW6 A;  3CC2 N;  4C8K A;  2QTD A;  3OYJ A;  4PUO A;  3HT3 A;  1GOC A;  1BDG A;  1SKW A;  3CFO A;  3SBT A;  2ZE2 A;  3CQ8 A;  5A2Q O;  4AHS A;  3HPG A;  5HOO A;  4KTQ A;  1UAX A;  3DXK A;  4UQG A;  2G8I A;  1RNH A;  2A42 A;  4CEB A;  4CZG A;  4BAC A;  1RTI A;  4ZTF A;  4BDZ A;  3ULE B;  4CZI A;  4M41 A;  1XC9 A;  4Z94 A;  4DU4 A;  4B9M A;  3CQY A;  5B8H A;  1J9A A;  4WFB L;  5I3U A;  1T6C A;  4E7I A;  2HF3 A;  4LC9 B;  1RBU A;  3DXM B;  4B1Z A;  1JXE A;  5ELZ A;  4YHH K;  4JV5 K;  4FOE A;  4DHY A;  3WNG A;  3IS9 A;  1R59 O;  5GAD P;  2NRT A;  5M1O A;  4CIF A;  3NFA A;  1RBV A;  4CJR A;  2V51 B;  1NGJ A;  4JNE A;  1X1P A;  4E89 A;  4CZE A;  2V7Y A;  1TL1 A;  3DYA A;  1T6D A;  1HUX A;  4NCB A;  4DCH A;  1Q9X A;  1C0U A;  1SS6 A;  5JS2 A;  3VA0 A;  1IG9 A;  3AV9 A;  4JI4 K;  1ATS A;  4GKK K;  1B9F A;  3MED A;  4DR2 K;  1YTA A;  4KTZ A;  3AAQ A;  3MEG A;  1EQY A;  1BO5 O;  4OGC A;  2NRW A;  3I0S A;  5AQJ A;  4AM6 A;  4PL7 A;  5AQT A;  2NZT A;  1BA0 A;  1TKX A;  3NH1 A;  2P1J A;  5CR4 A;  1X3N A;  1QSY A;  1NOZ A;  3O08 A;  5FPD A;  1I39 A;  4DR5 K;  3JS6 A;  3CPW M;  4DV2 K;  1S72 N;  3HM9 A;  1VQM N;  4DR4 K;  1NGD A;  1DLO A;  1EX4 A;  5M1K A;  4IKF A;  4B08 A;  3MN6 A;  4OPJ A;  1BG3 A;  1B9D A;  3DJC A;  1KVC A;  1BCM A;  4RW4 A;  3TSU A;  4YOR A;  4CHN A;  4MDB A;  4FWO A;  4WE1 A;  2ZWH A;  4OKJ A;  3T1Y K;  3A5L C;  4E1N A;  4FJH A;  4H5T A;  5AZI A;  3K58 A;  2QA4 N;  1RTJ A;  4DR6 K;  4WFN L;  3DLH A;  4JKC A;  4W5T A;  2HF4 A;  1RDA A;  4BY9 C;  4I6M B;  3OYN A;  5D3G A;  1RCH A;  1GOB A;  1IKW A;  3CG7 A;  1S1W A;  3WQT A;  3V9S A;  4NLC A;  1QHT A;  1KVA A;  2E2O A;  2P9S A;  1T44 A;  3OVN A;  2WBN A;  3K57 A;  3ZSZ A;  5C2D A;  1S1V A;  3TAM A;  1HR0 K;  1XWL A;  2HND A;  2KHO A;  2E6L A;  4E1M A;  2JWK A;  4IO9 L;  5DM6 L;  5CHI A;  2BGG A;  4BRC A;  4FLY A;  3MCA B;  1Q7Y O;  2V7Z A;  1L3T A;  4CHQ A;  3AVL A;  3M8R A;  1S22 A;  3E9L A;  1VQK N;  1NKE A;  1BQM A;  1TV6 A;  4CJ4 A;  3GDQ A;  4CFD A;  5KPT A;  3VQB A;  4B1Y B;  3EL2 A;  2AP1 A;  2EHG A;  4Y1D A;  1GLF O;  3IMX A;  3FLC O;  3AVC A;  4LD0 A;  4O4G A;  3VEV A;  4B9T A;  3MEC A;  1RT5 A;  4BR9 A;  4GV6 A;  1ITG A;  4J8F A;  4H0V B;  1QZ5 A;  1J5E K;  1NK7 A;  4CGF A;  4B1V A;  4DTX A;  3SUQ A;  4BR2 A;  2P9P B;  1VSH A;  4DQR A;  4F8R A;  3QBW A;  1N6Q A;  1G15 A;  3AO3 A;  1VSL A;  4KI6 A;  1HNV A;  1YVN A;  2IIR A;  2HHT A;  2WTU A;  1SL0 A;  4DV3 K;  3O5B A;  3ZSW A;  4Z4H A;  5DK5 A;  2KZZ A;  2P9K B;  2YHY A;  2BE2 A;  5JS1 A;  3AAP A;  4CGG A;  4GV3 A;  2AJQ A;  3C7N B;  4A57 A;  4H0Y B;  1S5J A;  5CZ2 A;  2B6A A;  3HI0 A;  2DTU A;  4GV9 A;  1GLL O;  4J2B A;  3KLG A;  4ICL A;  4N56 A;  2UUC K;  3PY8 A;  2OPS A;  3SAH A;  2VG7 A;  3QER A;  3WT0 A;  3VEZ A;  2G8F A;  4NXN K;  4CHY A;  3V6D A;  2F9T A;  5C12 A;  1UA0 A;  5DM7 L;  3C65 A;  3EEQ A;  3EO3 A;  3D7E O;  3IAY A;  2IDO A;  3ZLJ A;  2CGK A;  4R79 A;  2O8E B;  3DLG A;  4CBX A;  1ASW A;  1YTU A;  4CF9 A;  2PFU A;  1SAZ A;  4HCB A;  2GUP A;  4F3O A;  2Z1H A;  2FXU A;  1GLC G;  4CJQ A;  3HBT A;  2X74 A;  3LDL A;  3C94 A;  3UKU A;  1VSK A;  3AVH A;  3DLK A;  1IO2 A;  4BRG A;  1BUP A;  3L4I A;  4J2D A;  3QML A;  4CGI A;  1V4S A;  5M1P A;  2QWO A;  4PL8 A;  2GEL A;  1RT3 A;  2OZM A;  3MK6 A;  4EZ6 A;  2YX6 A;  4I7F A;  2VGM A;  5BR9 A;  4A62 A;  4FVM A;  1SZ2 A;  2WON A;  1EO1 A;  3OTO K;  5AQY A;  3P4I A;  2D0O A;  5AQO A;  3NGI A;  2A5X A;  2PBD A;  3KK3 A;  3QES A;  2E5L K;  2O8C B;  1NGH A;  1OH6 A;  4XH1 A;  2UU9 K;  3MN5 A;  3WUH A;  3FGU A;  4HWI A;  2PAV A;  3OYB A;  2FBX A;  2XHB A;  1N5Y A;  4IEE A;  4FJ8 A;  4DTO A;  5C24 A;  2E4L A;  4E1J A;  5JIC A;  5C10 A;  4CHZ A;  4BRO A;  3ASM A;  1EXQ A;  1CLQ A;  1JL2 A;  3GG4 A;  4IJN A;  4DV4 K;  4HUG A;  1GLA G;  4DSJ A;  4NO7 A;  4A2B A;  4XIU A;  1EWQ A;  3AA4 A;  4BE0 A;  1S9E A;  4DTU A;  1A5W A;  1ZBF A;  4KO0 A;  3O9S A;  4KHY A;  4O0J A;  5M1N A;  3L2Q A;  3VQE A;  2P9I B;  1N8R O;  1KLN A;  3TAR A;  1NU0 A;  3OYM A;  2A1S A;  1YHQ N;  1ZBH A;  4BQL A;  2VGN A;  2JGU A;  1LWF A;  4FLX A;  3U3G A;  3OYA A;  1NGC A;  3SUP A;  3VTH A;  1IV0 A;  1ESV A;  2BUP A;  3LWL A;  3AA5 X;  2HB5 A;  3J80 O;  1YJ9 N;  3VA3 A;  3KJV A;  3B8A X;  1QVF M;  1SKS A;  3OYL A;  3O9R A;  3AAR A;  3V1Q A;  3VQ7 A;  3DLB A;  3BDP A;  3VQ4 A;  4UY8 O;  4NYN A;  1NJW A;  1W9H A;  1ZXO A;  4AM7 A;  3HOS A;  3LM2 A;  1R0A A;  2RF2 A;  3K9K A;  4KH5 A;  4LF8 K;  1K6Y A;  3L6Q A;  4MLH A;  3J81 O;  3QIC A;  4GVM A;  3O9T A;  4K25 A;  3R1X A;  2PYL A;  1NK0 A;  2G8W A;  1VQP N;  1HNX K;  3KD5 E;  3NGZ A;  3SUO A;  3ALY A;  3TAP A;  4B3M K;  2RPI A;  3G10 A;  4FOI A;  3RMD A;  4ELU A;  4MFB A;  3FZM A;  4FW2 A;  4WQ4 A;  3OYE A;  3O3F A;  4YY3 K;  3SZ2 A;  4DQI A;  1E4G T;  1BI4 A;  1JLE A;  2P9L A;  3LAN A;  4N5S A;  4LF9 K;  2ZQB A;  3AO1 A;  4B1X B;  4JK8 A;  4KB0 A;  3KVG A;  3N4P A;  3NH0 A;  4OJR A;  3NF9 A;  2WOM A;  4LF6 K;  2QKK A;  4Q0B A;  4CJ5 A;  5FRO A;  3SPY A;  2Q0R A;  1KC8 O;  1QVG M;  4B9L A;  1YIT N;  3U4L A;  3ZT0 A;  2VCP A;  1TKT A;  1NJX A;  1LAV A;  4LF4 K;  4FZZ A;  4I9Q A;  3KZB A;  2F7T A;  1QQM A;  4PKG A;  3RTV A;  5HRP A;  2UUA K;  4C8N A;  1L3U A;  2FBY A;  5HRO A;  3A8Y A;  4CFB A;  4M63 C;  1VSD A;  4FWM A;  4MQ3 A;  5EOY A;  4CBW A;  2QKB A;  3K5O A;  1KAZ A;  3VF6 A;  2O8B A;  4JD2 B;  4JKF A;  2Q0U A;  3QNO A;  4FJL A;  3BY5 A;  4F2S A;  4KV8 A;  4FZX C;  1F21 A;  2VQF K;  2W6L A;  1NGF A;  3E01 A;  2IAJ A;  2GX9 A;  2YNI A;  4FJI A;  4M3T A;  4H0X B;  4CJP A;  4DLG A;  3U6F A;  1KD1 O;  4E7K A;  1WN7 A;  3VEN A;  1Z26 A;  1GOA A;  4CEZ A;  2A1R A;  4FJ9 A;  3PIP L;  3ZYY X;  3UE5 A;  4EHU A;  2NNW A;  2BAN A;  4CED A;  1TK8 A;  1C6V A;  4CD1 A;  3F9M A;  1LAW A;  1VQ9 N;  1LCU A;  2Q3S A;  4EP4 A;  4X64 K;  2P51 A;  1UOC A;  5AQQ A;  4IOC L;  4CCH A;  1T05 A;  2HHX A;  4W5Q A;  1TKZ A;  4WFA L;  3OYD A;  4H5N A;  1WBB A;  4O8K A;  2UUB K;  2OA8 A;  3D2F A;  4ILG B;  4CJS A;  1NMN A;  1S1X A;  3ZEU A;  4CW7 B;  4JRQ A;  3ATV A;  3D2E A;  3NF6 A;  4CFA A;  3S3O A;  1ZBL A;  2GEM A;  1WAF A;  1ZYQ A;  2KFN A;  4OPA A;  1V4T A;  3S3N A;  3ZCM A;  3ZSX A;  1XMQ K;  3O4W A;  2YJF A;  1RDU A;  4L8R B;  4EP5 A;  2YHX A;  4B3T K;  3M3Z A;  3TTD A;  3OYK A;  4FYD A;  4YDU A;  3B6O A;  3VOV A;  1JCE A;  4BRE A;  1KAY A;  1G99 A;  3R8E A;  1XC3 A;  3ZX3 A;  3TAN A;  1GLD G;  4MO4 A;  1VK0 A;  4PY5 A;  3ZET B;  2VG6 A;  3TAE A;  2BTF A;  4IOX A;  5HRR A;  4WQ5 A;  4QCL A;  3CC4 N;  5KI6 A;  1BCO A;  1HRH A;  1KRP A;  4KAZ A;  1HQE A;  3PO4 A;  2YHA A;  1HNI A;  3WEE A;  4JLH A;  4CFC A;  3RR8 A;  3TSP A;  2O4I A;  4I9L A;  4AHU A;  1UA1 A;  5JLH A;  3RSE B;  2F8T A;  4DR7 K;  2ASO A;  3H08 A;  1VQ5 N;  3G25 A;  2O4G A;  2CH5 A;  3T1A A;  1S3X A;  1NK9 A;  1NG9 A;  2JWL A;  3MEE A;  2FSN A;  3OS0 A;  3HP6 A;  2YHW A;  3CM6 A;  5AQZ A;  4BRQ A;  1IH7 A;  2GBZ A;  1BGX T;  1JKH A;  5BPL A;  3O1W A;  5SWM A;  1ZBI A;  5AQU A;  4YFU A;  4M3X A;  1BU6 O;  4O55 A;  4BRN A;  2E1Z A;  4BGB A;  1P90 A;  1FK9 A;  3AGK A;  4B9V A;  3D45 A;  3LWM A;  3NVM A;  5CZ1 A;  4A2A A;  2KZM A;  3VQQ A;  2FF6 A;  1KCF A;  4H4O A;  3HYF A;  2RKI A;  3C6H A;  4M45 A;  3FR0 A;  2YJE A;  3VES A;  5C15 A;  1T03 A;  3SI6 A;  4DU1 A;  1BA1 A;  3EE8 A;  3UKR B;  4JK7 A;  5AQW A;  4ISF A;  4CZF A;  4ILJ A;  3DRS A;  3V9W A;  1EET A;  4JK9 A;  2IS3 A;  3LP0 A;  1WLJ A;  3P39 A;  4IXC A;  1YUW A;  4BRM A;  3CCV N;  3THW A;  1KLM A;  4XH5 A;  3U9D A;  4DFP A;  4M42 A;  4FJM A;  5JMV A;  3TPQ A;  2Z1G A;  2IVO A;  5HLF A;  4ISE A;  3HO1 A;  1FKO A;  4FWK A;  5M1Q A;  3HST B;  3HK2 A;  1J54 A;  5AQF A;  4W5N A;  1JCG A;  4EIA A;  1TYQ B;  2QWM A;  4JI0 K;  4KPY A;  3GOI A;  3BEX A;  3NHG A;  2D0P A;  3I8D A;  4ID1 A;  1TUU A;  3NDK A;  2OPP A;  3NF8 A;  5SZT A;  3AA3 A;  5J2P A;  1HNZ K;  4RW9 A;  1K8A O;  1P8Z A;  2Q97 A;  4KH4 A;  1LW2 A;  2D1K A;  5CE3 A;  4KHP K;  1MWK A;  3ENH A;  1KQS M;  1HPM A;  3K0S A;  3LDN A;  1TK5 A;  4JHD A;  1WSJ A;  3LAK A;  2YNF A;  4LFC K;  2Q1N A;  3NBP A;  5BN8 A;  1RDB A;  1YJW N;  5C42 A;  2DFH A;  3AVB A;  4BGA A;  4BQZ A;  4JI3 K;  3DRR A;  4WYB A;  4O44 A;  3AGR A;  3MN7 A;  1B92 A;  1BWF O;  4DF4 A;  1QS4 A;  4LFA K;  4K8X A;  3THX B;  4NCG A;  3LZJ A;  2P9N A;  3SMS A;  2LSN A;  1OH5 A;  1DGK N;  3I55 N;  3DOL A;  3QBX A;  1Q18 A;  4LF5 K;  2E20 A;  3M8P A;  1Z25 A;  2YV0 X;  1HJR A;  4MDA A;  1NK4 A;  2IVP A;  4BRI A;  3BP8 A;  4IDH A;  4RTF D;  5GAH P;  3CF5 L;  5AZJ A;  4FPB A;  4BE1 A;  3CMA N;  4B9S A;  2NRV A;  5BPN A;  1JLQ A;  3KKR A;  4K42 A;  3LL3 A;  3HL8 A;  1OVQ A;  4E19 A;  3RMA A;  5AQN A;  4CIE A;  2BH1 A;  1RDC A;  3KWI A;  4OKE A;  3AVI A;  4CK3 A;  4OLA A;  4Z4C A;  2JLE A;  5BRH A;  2DPN A;  1NGI A;  3WQU A;  3ZSY A;  4FK0 A;  5GAE P;  1M90 O;  3RVC A;  1C1A A;  4F3T A;  2D0B A;  3J7Y P;  2YI1 A;  2X6S A;  4JKD A;  4JKE A;  5AQH A;  1NK8 A;  4WQ4 C;  2XY6 A;  4DV6 K;  3PX6 A;  5KQD A;  1O1W A;  3JYT A;  3U3Y A;  5BPM A;  3V9U A;  2WC9 A;  4X66 K;  3O9U A;  4BVO A;  1BI4 B;  2P9L B;  3ZSR A;  3MN9 A;  3KD1 E;  4JKA A;  4DV5 K;  1VSI A;  1JLG A;  3PX4 A;  5EU7 A;  1XQS C;  3O6W A;  4FWQ A;  4FLZ A;  5FRM A;  1BIZ A;  4NXM K;  2Z1J A;  1Q82 O;  3CCQ N;  3ZT3 A;  2Y1I A;  3O80 A;  1WSH A;  4DFK A;  4JI7 K;  1OKJ A;  1RGI A;  4LY7 A;  3ZET A;  2FBT A;  3HOT A;  3K5L A;  2HHS A;  4FPA A;  4KHW A;  1HKB A;  3PV8 A;  3MXI A;  4PWD A;  1IKX A;  3CCU N;  3CJ1 A;  3SQ1 A;  1CXU A;  2IC3 A;  4AHT A;  3TWH A;  4JI1 K;  2I7P A;  4FM0 A;  2HNY A;  1SL2 A;  5MLC Q;  2ASM A;  1SQK A;  4K43 A;  4XEI A;  3L4Q A;  4F4K A;  4DR3 K;  4FZY A;  4YOW A;  4JKG B;  5BRD A;  4EFH A;  1Q86 O;  4BG8 A;  3OS1 A;  3OJU A;  4BR5 A;  1VQ8 N;  1VQO N;  4K41 A;  3V1O A;  4JN4 A;  4B3S K;  5BRE A;  4JS5 A;  5BN9 A;  4OX9 K;  4FSV A;  3F9K A;  2XY8 A;  3CJA A;  5H1S Q;  3PUF A;  1W0H A;  1U6Z A;  3QDK A;  4CJ7 A;  1HMV A;  3RWU A;  3EZW A;  4IOA L;  3CET A;  1KTQ A;  4CJW A;  2UXD K;  4GVE A;  5AQI A;  2HW3 A;  3SMP A;  2RHK A;  2FC0 A;  1U48 A;  1M1K O;  1QQO A;  3HM8 A;  1W97 L;  4ELV A;  5AR0 A;  1VSF A;  3NF7 A;  4CGH A;  4FJJ A;  4CER A;  2ZF5 O;  3R9P A;  2D4W A;  1S6P A;  4CEA A;  3RRG A;  3I8B A;  3NE6 A;  1EWR A;  4HUF A;  2HHQ A;  2A40 A;  4CI6 A;  4BRK A;  4AQY K;  4KHS A;  2O8B B;  2Q31 A;  4M7X A;  4OPH A;  3E9O A;  1BQN A;  4ISG A;  3FFK B;  1BL3 A;  1UWB A;  2F96 A;  3K59 A;  3H1V X;  5CYQ A;  2W42 A;  2OAN A;  4HUE A;  4IFV A;  5JVH L;  1VSE A;  2HBM A;  1C0T A;  1N36 K;  4KFB A;  3FZF A;  5C25 A;  3H3O B;  5AQG A;  4DFM A;  3HP9 A;  4B9U A;  4DQS A;  4G9Z A;  5AQS A;  4WQ5 C;  4IJA A;  1QE1 A;  3L3V A;  2HOE A;  1N32 K;  1Q8I A;  4DB3 A;  1DTT A;  4BE2 A;  3EKS A;  1NJZ A;  3ZT4 A;  3CI5 A;  5GIO A;  1OH8 A;  1IBM K;  4CZH A;  2E8A A;  3F2K A;  4YOV A;  4FM1 A;  2XY7 A;  1IJJ A;  1WSF A;  5LJV A;  3LDO A;  4KKO A;  3FZK A;  4BWM A;  4DTN A;  3I0R A;  4CZJ A;  2XY5 A;  2NUB A;  3KK2 A;  3HVR A;  1BOT O;  3K5N A;  3A2F A;  2NLX A;  3O8M A;  1U45 A;  4BRD A;  1JLA A;  3A5O C;  5TKW A;  4Z4E A;  4FWL A;  4GKJ K;  3VQ6 A;  3VMF B;  3GL1 A;  2ASP A;  1BHL A;  4BC5 A;  3MDQ A;  2A6A A;  3MXJ A;  3VET A;  2D5R A;  2D0A A;  4EHT A;  4JRP A;  1RT1 A;  1Q81 O;  2E88 A;  3TU5 A;  1Z6R A;  2YNH A;  5K14 A;  3MXM A;  4ZTJ A;  1D9F A;  4QOZ B;  3CCE N;  3P31 A;  4FCY A;  3M8S A;  4DS5 A;  4CES A;  3OBY A;  1NJI O;  4FW1 A;  4JI6 K;  3G4S N;  2P5O A;  3QIP A;  1SL1 A;  4DFJ A;  2P9N B;  1OVY A;  4DLE A;  2P9P A;  3THX A;  5FRN A;  3CJ7 A;  3G0Z A;  1EKE A;  4NYF A;  4JI5 K;  1IKV A;  3L2R A;  2PZS A;  1TL3 A;  1HJO A;  4C1N K;  3HPH A;  4JKH A;  2RN2 A;  1E3M A;  1RIL A;  4B8A B;  3CJC A;  3KK7 A;  1TAQ A;  2EX3 A;  3AVG A;  4CEE A;  4CF1 A;  3OYH A;  4FXD A;  2P9I A;  4DQQ A;  3G71 N;  3CCL N;  4AF1 A;  3DOK A;  3T19 A;  4Q5V A;  4B9N A;  2PY5 A;  1QHA A;  1GLE G;  4BRA A;  4W5O A;  3M8Q A;  3QIO A;  3K9J A;  4J2E A;  1RT6 A;  3VEO A;  2HHW A;  3AO5 A;  4RG8 A;  1NGE A;  2G8U A;  1RT4 A;  4C1N I;  1TYQ A;  2GTD A;  3FZH A;  3Q7B A;  2E2Q A;  4ILH A;  1HYS A;  4PKH A;  3TR8 A;  4IBN A;  3TI0 A;  3ZSQ A;  1C0F A;  2NRH A;  3HJF A;  4JKG A;  4KHU A;  2NRX A;  4I6M A;  4Y1C A;  5KGW A;  3OA9 A;  4E0D A;  1DKG D;  3NVK A;  2O8C A;  1D4X A;  1KVB A;  3NMU A;  4AHC A;  5AQV A;  5AZI B;  3KLH A;  4FK4 A;  4Z4G A;  4FWR A;  3QIN A;  3UKR A;  2Z1I A;  4A5B A;  2F4V K;  4OKK A;  3BZK A;  2VG5 A;  1LOT B;  2P5G A;  3OHR A;  2UXB K;  4A5A A;  3T1H K;  1C0G A;  1YT3 A;  3SCX A;  1Q9Y A;  1CZB A;  3OY9 A;  5HRN A;  4FL9 A;  1JXB A;  3ULD A;  5AQX A;  3J7A P;  2ZD1 A;  3CM5 A;  5BRF A;  3VQ5 A;  3KLE A;  4IG3 A;  2DFE A;  2DFF A;  1X9M A;  3LAL A;  5GIP A;  4O5F A;  3LAM A;  3AVA A;  2YCH A;  3GBT A;  2O8E A;  4FJN A;  5JVG L;  1XHZ A;  3ENO A;  2QWR A;  1J6Z A;  4CVN E;  3DLL L;  1WUA A;  3SAG A;  1S1T A;  1IBL K;  4DKW A;  3S9H A;  2E1Y A;  3HRG A;  3C6U A;  1U47 A;  4HHT A;  3P5J A;  1NWK A;  4OO1 J;  1KAX A;  1MA9 B;  4U67 L;  4IFE A;  2OZS A;  2HBK A;  4NB4 A;  4BRH A;  1HKC A;  4R5P A;  3IKM A;  2VYP A;  3AVM A;  1J5O A;  3OYC A;  5CY4 A;  4IWV A;  3CPE A;  4DUZ K;  3QEX A;  3E1Y A;  3VPZ A;  3FZL A;  4PQU A;  5JLF A;  4JAX A;  5E41 A;  2E6M A;  3ENB A;  1NNE A;  1I94 K;  2OTJ N;  4KHN A;  1TUY A;  3CYM A;  5AZJ B;  1WAJ A;  3K5M A;  1VSM A;  3QFU A;  4QAG A;  3V1R A;  3KTQ A;  5FPN A;  4H03 B;  1RBS A;  4DR1 K;  4KTW A;  3SUN A;  2KKZ A;  3VQP A;  4Y0W A;  4FWS A;  3H1Q A;  5GAG P;  2Y1J A;  3F5T A;  5AQP A;  4B3R K;  1DT9 A;  4H5W A;  2OYQ A;  1XUP O;  1RTH A;  1JCF A;  3IFR A;  3RR7 A;  3LDS A;  3KLF A;  4YDU C;  3SV3 A;  3WXM B;  4CZL A;  4BRL A;  1VQ4 N;  1FXX A;  3I33 A;  2QWP A;  5J2Q A;  1RTD A;  4JHD B;  3AVF A;  3O4N A;  3ZEU B;  1REV A;  2B5J A;  3PSI A;  4DS4 A;  4I2Q A;  3D2F B;  5FPM A;  3QB0 A;  4CF0 A;  3OS2 A;  4FWN A;  5J1E A;  1RDW X;  4TSX A;  3UIQ A;  4H5R A;  3DRP A;  4FLW A;  1NKB A;  3AVJ A;  2G8H A;  3T3F A;  1S9G A;  1HQU A;  3NGY A;  4JKB A;  4N76 A;  3WNH A;  3VEY A;  2W41 A;  4OGE A;  3JSM A;  3J7Z O;  3CCJ N;  3LZI A;  3ZT1 A;  2AA4 A;  3LPT A;  1HKG A;  5LY3 A;  1NBW A;  3QEV A;  4E7J A;  4BC2 A;  3W0L A;  2CGL A;  1MDU B;  1RBR A;  3HXM A;  3AA2 A;  3THW B;  3VQC A;  4BC4 A;  3CCS N;  3QEP A;  3DAW A;  3SV4 A;  3VTI A;  1U49 A;  4H0T B;  4E7H A;  4N47 A;  2IGI A;  4E3S A;  1XNR K;  3HVT A;  1VSJ A;  4IO8 A;  4JD2 A;  4RW8 A;  3ZSV A;  3SQ2 A;  3JXU A;  4C8L A;  3ZX2 A;  4FLU A;  4V19 S;  2HBJ A;  1D9D A;  4M3W A;  2OCE A;  1W7A A;  3SAF A;  2FSJ A;  1N33 K;  4CEC A;  5IT9 O;  4FM2 A;  1ZC6 A;  1VQL N;  3PX0 A;  1Y97 A;  4CF2 A;  4BG9 A;  4CGD A;  4MO5 A;  4B1W B;  1HYZ A;  2EWS A;  4RW7 A;  2OPR A;  2KQ2 A;  3VF4 A;  4GY2 B;  4AIL C;  1RFQ A;  4W5R A;  4O5B A;  1O13 A;  1YF5 L;  4DQ8 A;  2UXC K;  1CXQ A;  4H4M A;  3IUC A;  2KTQ A;  1TVR A;  2A41 A;  3KK1 A;  5IWA K;  3DMJ A;  1QZ6 A;  5HP1 A;  2CH6 A;  2ITM A;  3VGM A;  1YVU A;  5AQM A;  2OTL N;  3PIO L;  1HNW K;  1VRT A;  3UB5 A;  3QEW A;  3SPZ A;  3RSE A;  5FPE A;  2F8S A;  4BR0 A;  3SQ4 A;  4H0O A;  3H6E A;  3LM9 A;  4DF8 A;  3OYI A;  2KLA A;  3WEE B;  2QXF A;  3FFI A;  5EX5 A;  2ZJR L;  3JAM O;  1YAG A;  2QI2 A;  4LSL A;  3RRH A;  2GWJ A;  1WSE A;  5AQK A;  1YI2 N;  3BUZ B;  4DTM A;  4BC3 A;  4C23 A;  1JLF A;  3CJB A;  1YJN N;  3O4Q A;  3SQ0 A;  4DTR A;  2YNG A;  3RMC A;  1YXQ A;  3DM2 A;  2YKM A;  1U04 A;  3R3L A;  3C6A A;  4JEP A;  4ELT A;  4LSN A;  1TGO A;  1IKY A;  3DXK B;  2ITG A;  3J8A A;  1TAU A;  3O9Q A;  3EN9 A;  3KIO A;  2CGJ A;  3CD6 N;  1ILY A;  1NJY A;  3CQX A;  1ZBS A;  5KTQ A;  1WBD A;  4CZM A;  4AHV A;  2HHH K;  2KFZ A;  4JI2 K;  3WNE A;  3C95 A;  1TKD A;  4BRF A;  3LP2 A;  4M3Z A;  3D2E B;  4DTS A;  2O8D A;  3VQ9 A;  3IRX A;  5HRS A;  3V81 A;  4RW6 A;  1WOQ A;  1JLC A;  4O8U A;  2G8V A;  4B3O A;  3CXC M;  1L3V A;  1D8Y A;  3EZ5 A;  1NGA A;  2Q2R A;  4QS8 A;  4CD3 A;  2R7Y A;  1J53 A;  3HPO A;  3SK3 A;  3B6P A;  1FJG K;  1ZBU A;  3P38 A;  3KHY A;  4FJX A;  1RDD A;  2HVH A;  1DEJ A;  1L3S A;  4FJK A;  2HST A;  2WFB A;  5E26 A;  4J2A A;  5AQL A;  1MWM A;  3CCM N;  1VAZ A;  1A5V A;  5J2N A;  1I3A A;  5J2M A;  4BVP A;  1VHX A;  3OW2 M;  2DY4 A;  1NGG A;  4Z0U A;  1WSI A;  2Q36 A;  4QS9 A;  5HBM A;  4BRP A;  4U7B A;  4CJ3 A;  2O8F B;  1E4F T;  3LDP A;  4BWJ A;  4DV7 K;  4DQP A;  4CE9 A;  4KHQ A;  4RWT A;  4Z4F A;  4HVJ A;  3TAF A;  4HCC A;  4DV1 K;  3EKU A;  1X9W A;  2QXL A;  3L0Q A;  3A5M C;  4LH5 A;  4M3Y A;  3DWL A;  1C0M A;  3MCP A;  1LV5 A;  3I56 N;  2B4J A;  4YOX A;  1BIS A;  1D5A A;  2ZGY A;  5DMR A;  5FDL A;  2VWJ A;  3THV A;  2H3G X;  2I5J A;  5CYM A;  3TSQ A;  3UKU B;  1CZ9 A;  4CBU A;  4GNI A;  5KRS A;  3L3U A;  4KB1 A;  3EE9 A;  2ZJQ L;  3AVN A;  2HHU A;  1RT7 A;  2QW9 A;  1C1C A;  4DSF A;  5T7B A;  1CZA N;  1L5U A;  1N34 K;  2ZJP L;  1GLJ O;  4FK2 A;  3N4Q A;  1MU2 A;  4LH4 A;  4FJ5 A;  3MX5 A;  3WXK A;  4N41 A;  4EAH D;  1IBK K;  1EP4 A;  4DMN A;  4ZHR A;  3DLE A;  4I2P A;  3ISN C;  4DG1 A;  3ID8 A;  1SV5 A;  5EVZ A;  3W3D A;  4YOT A;  4B8C A;  1QSL A;  2QM1 A;  3KLI A;  4CJE A;  4FLV A;  4FJG A;  5C2F A;  3OBW A;  3VF2 A;  4CF8 A;  2QWL A;  3VQA A;  3HZ6 A;  1U4B A;  2I7N A;  3L8B A;  2E2P A;  4XH4 A;  3ITH A;  5FLX O;  1JJ2 M;  1NLV A;  1X9J A;  4CJU A;  2P9U B;  3EY1 A;  2P9U A;  2A3Z A;  3H45 C;  4LF7 K;  4YOU A;  2P9K A;  2GUI A;  3ATU A;  3VN5 A;  4HTU A;  1LWE A;  4DSE A;  3O3H A;  3MAQ A;  3VQ8 A;  5LMN K;  2HVI A;  2GV9 A;  3QNN A;  3THY B;  3TAB A; 
#chains in the Genus database with same CATH homology
 2V52 B;  4FWR A;  1Y64 A;  3NVM A;  3MCA B;  1Q7Y O;  2V7Z A;  3UKR A;  2VWB A;  4A5B A;  4H0P A;  4A2A A;  1S22 A;  3E9L A;  2FF6 A;  1VQK N;  3SLC A;  1LOT B;  3GDQ A;  3OHR A;  4A5A A;  1C0G A;  3C6H A;  5KPT A;  4B1Y B;  3EL2 A;  3FR0 A;  2AP1 A;  2YJE A;  1GLF O;  3IMX A;  3A5N C;  1HLU A;  5TKY A;  3VES A;  5C15 A;  5F1X A;  3LDQ A;  3FLC O;  4FL9 A;  3VEV A;  5AQX A;  1BA1 A;  1NGB A;  3EE8 A;  3VER A;  4BR9 A;  5KQ8 A;  3UKR B;  4GV6 A;  5C0Y A;  4JK7 A;  5AQW A;  4J8F A;  4ISF A;  4H0V B;  1QZ5 A;  4CZF A;  3ID6 A;  4ILJ A;  5BRF A;  1K73 O;  4B1V A;  4BR2 A;  4JK9 A;  4BR4 A;  2P9P B;  3WXL A;  2J4R A;  1IG8 A;  3QBW A;  3MWP A;  3HSC A;  5GIP A;  3HTV A;  4O5F A;  5GIN A;  3A0I X;  3P39 A;  4IXC A;  1YUW A;  2YCH A;  1YVN A;  3GBT A;  4BRM A;  2IIR A;  3CCV N;  5JVG L;  1K9M O;  3ENO A;  2QWR A;  1J6Z A;  4XH5 A;  3U9D A;  3O5B A;  5E84 A;  1WUA A;  3TPQ A;  2IVO A;  5JMV A;  4ISE A;  3SAG A;  4YOY A;  3DLL L;  4DKW A;  1QQN A;  2P9K B;  1ATN A;  2YHY A;  4FWK A;  2E1Y A;  5M1Q A;  3AAP A;  3HRG A;  3Q7C A;  4GV3 A;  5AQF A;  3C7N B;  1U2V B;  4A57 A;  4H0Y B;  1JCG A;  2IVN A;  4EIA A;  1NWK A;  1TYQ B;  2QWM A;  3BF3 A;  1GLB G;  3GOI A;  4FO0 A;  4OO1 J;  3HI0 A;  3BEX A;  1KAX A;  1MA9 B;  4U67 L;  5HL7 L;  2D0P A;  2FF3 B;  3WXI A;  4GV9 A;  1GLL O;  4IFE A;  4BR7 A;  1TUU A;  2HBK A;  4M7Y A;  4NB4 A;  4BRH A;  3MWT A;  1HKC A;  5EY4 A;  3IKM A;  4F9O A;  3SAH A;  1VQN N;  5AQR A;  2VYP A;  1K8A O;  1P8Z A;  4IWV A;  4KH6 A;  5KPZ A;  2Q97 A;  3D6R A;  4KH4 A;  3WT0 A;  2D1K A;  3CPE A;  5CE3 A;  1MWK A;  3ENH A;  3VEZ A;  2UYT A;  3E1Y A;  1KQS M;  1HPM A;  3VPZ A;  3FZL A;  4MLE A;  4FVU A;  2F9T A;  3LDN A;  5C12 A;  5JLF A;  4JAX A;  5DM7 L;  1U2V A;  2HMP A;  4L3Q A;  4JHD A;  1W2B M;  2OTJ N;  3ENB A;  3R6M A;  1TUY A;  3C65 A;  3EO3 A;  2Q1N A;  3D7E O;  5AZJ B;  1ATR A;  3QFU A;  2NRZ A;  5BN8 A;  1YJW N;  2CGK A;  4R79 A;  4CBX A;  5FPN A;  4BGA A;  4H03 B;  4BQZ A;  3IDH A;  4WYB A;  3AGR A;  2PFU A;  3CIP A;  1SAZ A;  1BWF O;  3MN7 A;  2KKZ A;  3T7Z A;  3U8X A;  2GUP A;  4Y0W A;  1X3M A;  4FWS A;  3H1Q A;  5GAG P;  2FXU A;  3F5T A;  1GLC G;  2P9N A;  3SMS A;  5AQP A;  1DT9 A;  3HBT A;  4H5W A;  1DGK N;  3I55 N;  3LDL A;  1XUP O;  3UKU A;  1VQ4 N;  4BRG A;  3QBX A;  1JCF A;  1BUP A;  3IFR A;  3G6E N;  1Q18 A;  3BF1 A;  2E20 A;  3L4I A;  3VGK A;  3MMV A;  4FWP A;  5F2R A;  4MDA A;  4IEI A;  4YDU C;  4KBO A;  2IVP A;  3WXM B;  3BP8 A;  4IDH A;  4RTF D;  3QML A;  4BRI A;  4BRL A;  4FPB A;  4CZL A;  5AZJ A;  5GAH P;  1V4S A;  3I33 A;  3CMA N;  4QS7 A;  5M1P A;  2QWP A;  2QWO A;  4PL8 A;  2GEL A;  4JHD B;  2NRV A;  5BPN A;  3MK6 A;  3ZEU B;  4H5V A;  4K42 A;  2YX6 A;  3LL3 A;  2VGM A;  5BR9 A;  4A62 A;  3D2F B;  1SZ2 A;  5AQN A;  2BH1 A;  3QB0 A;  5FPM A;  4B9Q A;  5I9E B;  4FWN A;  3PLA A;  1RDW X;  2WUS A;  3KWI A;  1EO1 A;  4H5R A;  5AQY A;  3P4I A;  2D0O A;  1VQ6 N;  5AQO A;  3QFP A;  2A5X A;  2PBD A;  2DPN A;  1NGI A;  5BRH A;  4WF9 L;  4JKB A;  1NGH A;  3WQU A;  3VEY A;  4XH1 A;  3ZX0 A;  3MN5 A;  5GAE P;  2W41 A;  1M90 O;  3CF5 L;  3RVC A;  3WUH A;  1H1V A;  3J7Z O;  5KPR A;  3FGU A;  4HWI A;  3CCJ N;  2PAV A;  3DXM A;  2YI1 A;  3TTF A;  3C7N A;  4JKD A;  4JKE A;  2AA4 A;  5AQH A;  1HKG A;  4WQ4 C;  4PHT X;  5LY3 A;  1NBW A;  4IEE A;  5KQD A;  4BC2 A;  3E66 A;  3W0L A;  5BPM A;  2CGL A;  2WC9 A;  4E1J A;  1MDU B;  2P9L B;  3O9U A;  4BVO A;  5JIC A;  3MN9 A;  3H3N O;  3ULE A;  5C10 A;  4BRO A;  2QEX N;  4RCH A;  4BC4 A;  3CCS N;  4JKA A;  2HBL A;  3DAW A;  2QWQ A;  3GG4 A;  3CC7 N;  4IJN A;  3VTI A;  1GLA G;  4NO7 A;  3U9Z A;  4A2B A;  5LJW A;  4H0T B;  1XQS C;  3O6W A;  1KXP A;  4FWQ A;  3O9S A;  4A59 A;  3M5R A;  5M1F A;  3M6G A;  1Q82 O;  4IO8 A;  5M1N A;  4JD2 A;  3CCQ N;  3O80 A;  2P9I B;  1N8R O;  3VEW A;  3O1B A;  3JXU A;  2FSK A;  3ZX2 A;  1OKJ A;  1YHQ N;  2HBJ A;  1RGI A;  4BQL A;  2VGN A;  4HTL A;  4PKI A;  3ZET A;  1K8K A;  2FSJ A;  3SAF A;  5ADX H;  2GWK A;  3HOT A;  4FPA A;  1ZC6 A;  1NGC A;  1HKB A;  3VTH A;  1VQL N;  1ESV A;  2BUP A;  3AY9 A;  4BG9 A;  2F9W A;  1NM1 A;  3CCU N;  1YJ9 N;  4MO5 A;  3B8A X;  3CJ1 A;  4B1W B;  1QVF M;  2EWS A;  1VQ7 N;  2I7P A;  3S41 A;  3VF4 A;  4GY2 B;  5MLC Q;  4IZ9 A;  3O9R A;  3AAR A;  2ASM A;  1SQK A;  3CJ9 A;  4K43 A;  3SJH A;  1YIJ N;  1RFQ A;  4XEI A;  3L4Q A;  1Z05 A;  1O13 A;  1YF5 L;  4DQ8 A;  4YOW A;  4UY8 O;  4JKG B;  3IUC A;  3T69 A;  5BRD A;  2A41 A;  4EFH A;  2P9S B;  1ZXO A;  4BG8 A;  4AM7 A;  1QZ6 A;  1Q86 O;  3FE1 A;  4BR5 A;  2CH6 A;  1VQO N;  3HOS A;  1VQ8 N;  3LM2 A;  2ITM A;  3VGM A;  3VEX A;  4K41 A;  5AQM A;  2OTL N;  3K9K A;  4JN4 A;  2QWN A;  4KH5 A;  3PIO L;  5BRE A;  3L6Q A;  2E2N A;  4MLH A;  5BN9 A;  3UB5 A;  4FSV A;  3QIC A;  3RSE A;  3CJA A;  3O9T A;  5FPE A;  4BR0 A;  5H1S Q;  4H0O A;  3VGL A;  4K25 A;  3R1X A;  3H6E A;  5EXW A;  1U6Z A;  1VQP N;  4CZK A;  3QDK A;  3LM9 A;  4CJ7 A;  5F0X A;  4B1U B;  2KLA A;  3WEE B;  3EZW A;  4IOA L;  3CME N;  5EX5 A;  4FOI A;  2ZJR L;  3CET A;  3FZM A;  5AFU H;  1YAG A;  4GVE A;  5AQI A;  2QI2 A;  3SMP A;  2RHK A;  4WQ4 A;  2GWJ A;  3M1F A;  5AQK A;  1YI2 N;  4A61 A;  1HX1 A;  1M1K O;  3BUZ B;  1QQO A;  2ZGZ A;  3HM8 A;  4BC3 A;  1W97 L;  1E4G T;  4C23 A;  3CJB A;  1YJN N;  1NMD A;  2P9L A;  3CCR N;  3KWG A;  5AR0 A;  3H46 O;  2FLO A;  1YXQ A;  4B1X B;  5ADX A;  3CHW A;  3E9P A;  2ZF5 O;  2RE2 A;  4JK8 A;  3R3L A;  3R9P A;  4WCE L;  3C6A A;  4JEP A;  2D4W A;  3WXJ A;  3MX2 A;  3DXK B;  1T3V A;  3J8A A;  3KVG A;  3EN9 A;  3N4P A;  3I8B A;  3O9Q A;  5AFU A;  2W40 A;  2CGJ A;  3CD6 N;  1ILY A;  2A40 A;  3CQX A;  1ZBS A;  4CI6 A;  4CZM A;  4BRK A;  2Q31 A;  4NLB A;  4M7X A;  2Q0R A;  4OPH A;  1KC8 O;  1QVG M;  3GE1 A;  3E9O A;  4ISG A;  1YIT N;  3FFK B;  3U4L A;  3SBG A;  2NRR A;  2VCP A;  4BRF A;  3H1V X;  2OAN A;  3TTC A;  3D2E B;  5JVH L;  2HBM A;  3KZB A;  2F7T A;  1QQM A;  4PKG A;  3CER A;  3C0B A;  3FZF A;  1K8K B;  1WOQ A;  3CC2 N;  3H3O B;  3A8Y A;  4O8U A;  4M63 C;  4FWM A;  3CXC M;  2QTD A;  5EOY A;  5AQG A;  4G9Z A;  1NGA A;  2Q2R A;  4QS8 A;  5AQS A;  4WQ5 C;  4CBW A;  1KAZ A;  4IJA A;  3VF6 A;  4JD2 B;  4JKF A;  2Q0U A;  2HOE A;  4CD3 A;  1BDG A;  3SK3 A;  4DB3 A;  3SBT A;  3EKS A;  3P38 A;  3CI5 A;  3KHY A;  5GIO A;  5HOO A;  4CZH A;  3DXK A;  2E8A A;  1NGF A;  3F2K A;  4YOV A;  2A42 A;  2GX9 A;  4CZG A;  1IJJ A;  5LJV A;  3LDO A;  4H0X B;  1DEJ A;  3FZK A;  1KD1 O;  3ULE B;  4CZI A;  4CZJ A;  2HST A;  2WFB A;  5E26 A;  4Z94 A;  5AQL A;  3CQY A;  3VEN A;  1MWM A;  3CCM N;  1VAZ A;  5B8H A;  3PIP L;  3ZYY X;  3UE5 A;  4EHU A;  2NNW A;  4BVP A;  4WFB L;  1T6C A;  1BOT O;  2HF3 A;  2NLX A;  4CD1 A;  4LC9 B;  3F9M A;  3O8M A;  3OW2 M;  3DXM B;  4B1Z A;  4BRD A;  1NGG A;  1LCU A;  3A5O C;  5TKW A;  4FWL A;  5ELZ A;  1VQ9 N;  3VMF B;  3GL1 A;  2Q36 A;  2ASP A;  4FOE A;  4QS9 A;  4DHY A;  4BC5 A;  1R59 O;  3MDQ A;  5AQQ A;  4IOC L;  5GAD P;  2NRT A;  5M1O A;  4BRP A;  2A6A A;  4WFA L;  4U7B A;  3VET A;  1E4F T;  2V51 B;  3LDP A;  4H5N A;  1NGJ A;  4O8K A;  4JNE A;  3D2F A;  2V7Y A;  4CZE A;  4EHT A;  4RWT A;  4ILG B;  1Q81 O;  2E88 A;  1T6D A;  1HUX A;  3TU5 A;  1Z6R A;  3ZEU A;  3ATV A;  3D2E A;  3EKU A;  2QXL A;  3L0Q A;  3CCE N;  3A5M C;  4DCH A;  3DWL A;  3P31 A;  1SS6 A;  3MCP A;  3I56 N;  4YOX A;  3OBY A;  1NJI O;  2GEM A;  1ATS A;  2ZGY A;  2H3G X;  4OPA A;  1V4T A;  3TSQ A;  3UKU B;  4CBU A;  4GNI A;  3G4S N;  3AAQ A;  3O4W A;  2P9N B;  1EQY A;  1OVY A;  1RDU A;  2P9P A;  1BO5 O;  2YHX A;  2YJF A;  3EE9 A;  2ZJQ L;  2NRW A;  3M3Z A;  5AQJ A;  3TTD A;  4AM6 A;  4PL7 A;  4YDU A;  3CJ7 A;  2QW9 A;  5AQT A;  1JCE A;  3VOV A;  4BRE A;  1KAY A;  1G99 A;  3R8E A;  2NZT A;  1BA0 A;  1XC3 A;  3ZX3 A;  1CZA N;  5CR4 A;  1GLD G;  1HJO A;  1X3N A;  4MO4 A;  4C1N K;  4JKH A;  2ZJP L;  3O08 A;  5FPD A;  1GLJ O;  3JS6 A;  3N4Q A;  3ZET B;  3CPW M;  3CJC A;  1S72 N;  1VQM N;  2BTF A;  3KK7 A;  1NGD A;  4IOX A;  3MX5 A;  4WQ5 A;  3CC4 N;  3WXK A;  4EAH D;  5M1K A;  2P9I A;  3G71 N;  3CCL N;  3MN6 A;  1BG3 A;  4AF1 A;  3DJC A;  3ID8 A;  5EVZ A;  3TSU A;  3W3D A;  4YOT A;  3WEE A;  4YOR A;  2QM1 A;  4MDB A;  4FWO A;  2ZWH A;  1QHA A;  1GLE G;  3A5L C;  4BRA A;  5C2F A;  4H5T A;  3TSP A;  3OBW A;  5AZI A;  3VF2 A;  2QA4 N;  2QWL A;  4WFN L;  4JKC A;  3K9J A;  5JLH A;  2HF4 A;  3HZ6 A;  3VEO A;  4BY9 C;  4I6M B;  3RSE B;  2ASO A;  1NGE A;  1VQ5 N;  3G25 A;  2I7N A;  2E2P A;  4XH4 A;  4C1N I;  1JJ2 M;  1TYQ A;  2GTD A;  3FZH A;  1NLV A;  1X9J A;  2CH5 A;  2E2Q A;  3Q7B A;  3WQT A;  2P9U B;  1S3X A;  4NLC A;  2JWL A;  4ILH A;  2P9U A;  2A3Z A;  3H45 C;  4YOU A;  2P9K A;  4PKH A;  2FSN A;  3ATU A;  2E2O A;  2P9S A;  1C0F A;  1T44 A;  2NRH A;  2YHW A;  2WBN A;  5AQZ A;  4JKG A;  4BRQ A;  2NRX A;  4I6M A;  3OA9 A;  5BPL A;  1DKG D;  5C2D A;  3NVK A;  1D4X A;  3O1W A;  5AQU A;  3NMU A;  1BU6 O;  5AQV A;  4BRN A;  5AZI B;  2E1Z A;  2KHO A;  4BGB A;  1P90 A;  3AGK A;  2JWK A;  4IO9 L;  5DM6 L;  5CHI A;  4BRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...