2JWLA

Solution structure of periplasmic domain of tolr from h. influenzae with saxs data
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Protein tolR
publication title The Periplasmic Domain of TolR from Haemophilus influenzae Forms a Dimer with a Large Hydrophobic Groove: NMR Solution Structure and Comparison to SAXS Data.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 19
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.270 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2jwlA00
2PFUA 2JWLA 2JWKA
chains in the Genus database with same CATH superfamily
3RMAA 2BE2A 4DV6K 4DWIA 1A5VA 4JK9A 3P31A 3WNFA 3HBTA 1TL1A 4XIUA 2QWPA 1W2BM 1ZBFA 1T03A 2W6KA 3OYEA 3OJSA 4BDYA 3ZT4A 4FLUA 1KXPA 1SL1A 1BHLA 3CETA 2DY4A 4KFBA 1WOQA 4BQLA 1SAZA 1NMNA 3I8DA 2P9IA 4YHHK 4AM6A 1SKSA 3CERA 4NLBA 3ZT3A 4BGAA 3FGUA 1L3TA 2IVNA 1GLAG 4DG1A 1WBBA 3TI0A 4I9QA 1NGGA 2QWQA 3L2VA 1RILA 2X74A 1X9JA 4WYBA 2HB5A 3WXMB 3ZX0A 3O3FA 4HUEA 3B6PA 3O4WA 4KV8A 3T1YK 3T19A 1NOZA 1YJNN 1XQSC 2PBDA 3OY9A 4CD3A 4E89A 4J2BA 3ISNC 1BISA 3W3DA 2IDOA 4IJNA 3KD5E 3V4IA 2VG7A 4AH9A 1X3MA 3PX0A 1Q8IA 4FCYA 1Z6RA 5DK5A 2XY6A 5JS1A 1KC8O 4JKDA 2HHSA 2NRXA 4XEIA 4BRNA 2XHBA 3A2FA 3S3NA 1H1VA 3LPUA 1BI4B 4KHNA 3F73A 3SQ1A 4I2PA 3TARA 4AHVA 1DTQA 3TTCA 4Z0UA 4Z4GA 4O44A 5J2QA 3SNNA 5HRPA 2OA8A 3A5OC 2B6AA 3CFOA 4CHQA 2WC9A 5KTQA 2W42A 3FR0A 4KKOA 1VSJA 4CBWA 1NK8A 5KQ8A 4DF8A 2D0AA 5LY3A 3QEPA 3MK6A 3QBXA 4YDUC 3AY9A 3RWUA 4BROA 3VQ9A 4OKEA 1X9SA 4BRQA 1L3VA 3KKRA 2E6LA 3HM8A 4FWNA 3KK7A 3SMPA 3FFIA 3EKSA 5FPMA 2NRTA 4DFJA 5ADXA 4JKFA 2AA4A 3ZEUB 3ID6A 1C0UA 1J9AA 4QS8A 3CC7N 4FJKA 1QS4A 4B1UB 1S72N 3WQUA 3J80O 2HF3A 3LL3A 3DI6A 3OYKA 1SUQA 4LF6K 5D3GA 3VF2A 4A5AA 4DKWA 3ATUA 1VQ8N 3M8PA 2G8IA 3AVHA 1RBVA 4H4OA 3NE6A 4CGIA 1TUUA 3CMAN 4WFAL 1VQNN 3VA0A 1KVAA 2D0BA 5C10A 1T3VA 4GKKK 4BR4A 1U6ZA 1DLOA 1S1XA 3MAQA 1A5XA 4DTUA 4M3YA 4BACA 4DTMA 1RCHA 4CK3A 3CYMA 3B8AX 1JLEA 2XY8A 3ASMA 3IKMA 1JCGA 5LMNK 1HQEA 3N4PA 4FM0A 4B9UA 2KHOA 3VQAA 4DQ8A 3SUQA 1EWRA 3ZT1A 3CJ1A 4H03B 1TL3A 2BH1A 1ILYA 2HVHA 3KWGA 1Y64A 5BN9A 3B6OA 4X65K 2HMPA 4E7JA 3HP6A 3WQTA 5JLFA 1VQPN 4E7IA 3J81O 1XNRK 1VHXA 1B92A 1UAXA 2UXCK 1GLJO 4LFCK 1VSHA 5J2MA 1RT4A 4OPAA 3U8XA 3RR7A 4JRPA 1RDWX 2OTLN 4B8AB 5KGWA 4FYDA 3C94A 1GOAA 4YOWA 2Q0RA 1KLMA 1WAFA 2E5LK 2P1JA 4NCAA 3S9HA 1VQMN 3HVRA 2E1ZA 4IJAA 4H5WA 3GG4A 3THYB 2P9UB 1XI1A 4WQ5C 3C0BA 5JLHA 1BU6O 3PO4A 2KW4A 4CERA 1TKDA 2ZF5O 1S5JA 4FM1A 3ZSQA 1YI2N 3NH0A 2IC3A 3HYFA 4OGCA 1N6QA 3VQDA 2OTJN 3VEOA 2VYPA 3BZKA 3TR8A 3WXJA 4DUZK 3C6HA 4M7XA 1JCEA 4DLEA 3U6FA 3GBTA 1QZ5A 3MCAB 4B1VA 4DR4K 4JI8K 2I7PA 3SAHA 3ZETB 2G8WA 4MQ3A 2QEXN 3PSFA 4U7BA 4BY9C 1D5AA 4DV3K 1ZXOA 2V7YA 2ZGZA 2GELA 2QXFA 1TAQA 4C1NI 3K5OA 2E8AA 5EVZA 4JD2B 4JI4K 2VQFK 3ULEA 3P83D 4JKHA 4CZIA 1SZ2A 2QI2A 3VERA 2Z1IA 4DQIA 1M90O 4RWTA 5DM6L 5AZIA 4IFVA 5AQFA 4CIEA 5AQGA 5GIPA 2HHVA 2HHQA 4CK1A 3TABA 2NRVA 4RW8A 1SL2A 4KTWA 5AQNA 1E3MA 1X3NA 2GTDA 1YHQN 1YVNA 4ILHA 4B8CA 4ILJA 4CJ5A 4B1XB 2G8FA 1SKRA 2HNDA 4JHDA 3P4IA 1TK8A 4IOAL 1NWKA 4GMJB 1XWLA 3D45A 4E7LA 4DR6K 1OVQA 2GWKA 5ADXH 4KPYA 4OX9K 3K5MA 3I8BA 3VN5A 2HHHK 3AVIA 5C42A 3TAEA 4DR1K 1RT1A 4DV7K 2G8KA 3L2QA 4JAXA 5CYMA 5CHIA 3F9MA 4OGEA 2E88A 1Q86O 3GL1A 3O9UA 2IVPA 2O8BA 3HL8A 3QINA 4H8KA 3CCLN 4BRPA 4BR0A 1ZC6A 5BREA 3V9ZA 3O80A 4F3OA 2W40A 2YNGA 3AAQA 1T44A 1FW6A 1QQOA 3J8AA 1VSFA 2A3ZA 5BRFA 1FK9A 4YOUA 1RDAA 3CCRN 2AP1A 2F96A 4FW2A 4CJ4A 3NHGA 1NJWA 1YXQA 4KHPK 3PUFA 3CMEN 3VPZA 4FZZA 2VWKA 3OJUA 1DKGD 5LJVA 1LW0A 1YJWN 1ZBHA 1NNEA 3DOKA 4O0IA 1Z05A 4B9QA 2X6SA 2YV0X 4KHWA 3BDPA 1R0AA 4O0JA 4GVMA 1EX4A 3CJ9A 1EQYA 3QNOA 2VGMA 4OKKA 1S22A 4CGDA 3DRSA 2Q97A 2O4IA 5BR8K 4YNQA 3L4QA 4CIGA 3LZIA 4DTRA 4CJLA 4IZ9A 3SQ2A 1ZBSA 4A2AA 5A2QO 1ZBIA 1OH6A 4CESA 3VEVA 3IFRA 1RGIA 1LCUA 1RNHA 2BUPA 2Z1HA 3OS0A 4Z4HA 1EXQA 2E2QA 4DR2K 1NGIA 1RTJA 3A8YA 3K9JA 1BA0A 3AVFA 2NZTA 1T7PA 1HMVA 1I3AA 2Q31A 2WFBA 4YDUA 4B9LA 4H5VA 4DV0K 2YKMA 2XY5A 4JI6K 3DXKB 4IDKA 2D4WA 5AFUA 4KHQA 1IBLK 3FZLA 3E01A 3EEQA 4BR5A 3C7NB 5C12A 4E19A 5LJWA 3HSCA 3HP9A 3CQ8A 2O8DB 2IGIA 1EETA 2GBZA 2FBVA 4IFYA 3LAKA 4CZJA 2O8CA 3DLGA 3AVLA 3G4SN 3LALA 4XH4A 3HPGA 1VQ9N 4CJSA 1QQNA 1QQMA 5BPLA 1Z26A 1BWFO 4GV6A 1NMDA 2FBXA 5AQUA 3SV4A 4BQZA 3VGKA 4RW7A 4BVPA 4NXMK 3WNGA 3CCQN 1S1TA 4W5TA 5GINA 1E4GT 2GV9A 3L2UA 4MDAA 3ZEUA 4F8RA 4FJ5A 2E1YA 1IJJA 1HNXK 3VA3A 4FPAA 5AZJB 2BANA 3E9OA 3SUNA 3DRPA 2A5XA 4BC2A 1BQMA 1CXUA 3S41A 3D2EB 2JGUA 3OS2A 3M6GA 5M1QA 3NF9A 3AARA 3THVA 3O9TA 3UB5A 2FLOA 2HBJA 3G10A 3L2RA 3O08A 4JS5A 2IVOA 4RW6A 3RSEB 1NJZA 1ASUA 2PFUA 4FJLA 2P9NB 4Y1CA 4B3MK 5CR4A 1QHTA 1TV6A 4KH6A 3NCIA 1BOTO 2P5OA 4KB0A 1ZBLA 1KFSA 4DQRA 4GNIA 4DU4A 2KTQA 5AQLA 4K42A 4O8UA 4CK2A 1CZBA 1NGHA 3KLGA 2NRZA 3TAQA 2HW3A 4CZEA 5LMUK 3M8RA 2NUBA 4FWRA 4I6MB 1J6ZA 2KKZA 1HRHA 4BREA 3V9XA 4FJXA 1RT2A 3H46O 3OYNA 1NK6A 3TPQA 1NM1A 5M1NA 2HHTA 2XY7A 1R59O 4YFUA 3IUCA 4O4GA 4CE9A 1NK5A 4FWSA 3AAPA 4CEAA 3OYAA 3CQYA 4FK0A 3QEIA 5FPEA 1BO5O 3ENBA 4BC3A 4JK7A 3NGIA 1OH8A 2HOEA 1K8KB 3LDSA 1BGXT 3MXJA 2IIRA 5GADP 3NGZA 3LANA 3AVJA 4H0VB 2WBNA 3EZWA 2ZJQL 1J53A 1I39A 5AQZA 2OZSA 2ZGYA 1GLDG 2P9SB 3T69A 4MLEA 5E84A 1NGJA 4F3TA 5I9EB 2JLEA 4DSEA 4OLBA 1BUPA 1EKEA 4B08A 4CFDA 3NAEA 4LF8K 4BE0A 3LP3A 4DSKA 4C8OA 1VK0A 4JI3K 2HBMA 5AQTA 3HOTA 3N4QA 3UKRB 4A57A 4CECA 1IBKK 2FBTA 2H3GX 4CF0A 3CCUN 4E1MA 5AFUH 3QEVA 1N5YA 1NK9A 2V7ZA 2UU9K 3SMSA 4CGJA 5GAEP 3TAFA 4C8NA 3E9LA 3FZMA 2QTDA 2GUIA 1P90A 2VCPA 4MO4A 3R9PA 5HOOA 3OYDA 2P9PB 3RTVA 3CD6N 3GE1A 4JKEA 1KAYA 4K25A 1L3UA 3BF1A 1RT3A 4FJHA 3F9KA 2FC0A 5IWAK 3P39A 3D6RA 5AQHA 2O4GA 1RBSA 3SPYA 3D7EO 4O8KA 4JKBA 3AVKA 3O3HA 3T1HK 4HTUA 2OCEA 4YOTA 4JI1K 1VRTA 2CH5A 1REVA 3K9KA 2O8FA 1JCFA 2BGGA 3VETA 1LAVA 3G0ZA 1VSDA 4CHYA 3JSMA 3DJCA 4EFHA 4FJ8A 3D2FA 1NJYA 3KIOA 4NCBA 1C0FA 4IBNA 4JI0K 5AQQA 1QQCA 2HF4A 1L3SA 3ZX2A 2VG6A 1RT6A 1N8RO 3C6AA 3OA9A 3ZSYA 1YTAA 1MA9B 2FBYA 3DWLA 4JEPA 1VSIA 3DLLL 3TAGA 3TTFA 3KKSA 4FWLA 4CZMA 3TSQA 3TAMA 4OPJA 5FLXO 1UA0A 1KSPA 4WQ4C 4C23A 4YORA 4CEBA 4LF9K 1JL1A 4K41A 1F21A 3HO1A 4B9TA 1NU0A 4FW1A 4AILC 1B9DA 4K8ZA 2O8EB 3FE1A 3O4NA 3KTQA 4LSNA 4CJUA 2QWOA 4BG8A 2E4LA 4CHZA 1S9GA 3E66A 1IBMK 4LD0A 4IXCA 3THXB 3JS6A 1JLCA 4PL8A 1W0HA 4Z4EA 4CW7B 3PIPL 1WLJA 4GW6A 5H1SQ 3PX4A 5J2PA 1FKPA 1SS6A 3CG7A 5AQKA 5T7BA 5DM7L 4DUYK 2Z1JA 3AVMA 5FPNA 5KI6A 5AQOA 4FLYA 3VQ6A 3KLIA 2OPSA 2B5JA 2UXBK 4E3SA 3SJJA 3TSPA 1GLLO 4KH4A 5J1EA 3QEWA 2Y1JA 2P9LB 1U48A 1C6VA 3E1YA 3VMFB 4DU1A 3K57A 4DCHA 4DHYA 1WAJA 1G99A 5HRRA 1WBDA 3CC2N 5C0YA 3BP8A 1HNVA 2CGKA 3SUPA 3CJBA 3IRXA 4NYNA 3AVAA 4FWOA 4O5BA 1SKWA 2VWJA 4QOZB 1XNQK 1WUAA 2YCHA 4HCBA 1KLNA 2NLXA 1TYQA 2P9KA 1S1VA 3H08A 4H0TB 4KTQA 1N33K 3ZSZA 1WSEA 1JLAA 4UQGA 1U45A 3JXUA 1XC3A 4U67L 4HUFA 4TSXA 2YHAA 1W9HA 2KFZA 2QW9A 1VQLN 4F2RA 1TUYA 5F1XA 3AVCA 3G71N 4DF4A 4DSFA 5EU7A 3M1FA 1WN7A 1D4XA 1IO2A 2YI1A 1GLEG 1EO1A 3F2KA 2I7NA 3UKUA 4M3ZA 4DMNA 4B3TK 3ALYA 5TKYA 4BE1A 3V1RA 4QCLA 2YX6A 3O1WA 2VG5A 5CZ1A 3SI6A 2D0OA 3QMLA 3K5NA 1QSYA 1S3XA 1ASVA 1MU2A 3HVTA 1RDDA 3D2EA 4C1NK 1U04A 1KFDA 3QFUA 4N41A 4LFBK 2DFEA 3DAWA 2D5RA 1RDCA 4JI2K 2HBKA 1B9FA 4FSVA 5KPTA 1NK7A 4CJ7A 3S3MA 3MWTA 4N5SA 4EP5A 3LAMA 1X9WA 1HNZK 3C65A 5MLCQ 1C0TA 5AQRA 1OKJA 3VGLA 4HUGA 4E7HA 4FL9A 3M5RA 1WSIA 4FOEA 4CJRA 4GKJK 4B3SK 1LWFA 1XUPO 3KJVA 3PIOL 2QK9A 2OZMA 1NGBA 5JS2A 5EXWA 1EP4A 1GLFO 1D9FA 4JI5K 2EHGA 1RT5A 2F7TA 4GVEA 4LH4A 3CJ7A 4Y1DA 4B3OA 3LP1A 4FK2A 5AQXA 4RW4A 3CCVN 4CZLA 4DV2K 1GLCG 2E2PA 2PZSA 5KPZA 5AQVA 3TSUA 1HQUA 3R6MA 3EZ5A 4ELVA 1LW2A 3DLEA 3FLCO 4KTZA 3VENA 4XH1A 2KLAA 1DTTA 3CM6A 3P38A 4B9SA 2FXUA 3V9SA 3W0LA 2KFNA 1V4SA 4PWDA 1Q7YO 3M3ZA 4DS5A 3QIOA 2W41A 2A41A 3AA5X 1ATRA 3HTVA 3AVBA 1IG8A 1K8KA 4CGGA 4H0YB 1QTMA 1HNWK 4A61A 3AGRA 4CJEA 4FWMA 3QERA 1N34K 3MMVA 1HJRA 3F5TA 3M8SA 2ZJRL 2P9SA 3KHYA 4KREA 3A5NC 4IWVA 4NYFA 4OPKA 3AGKA 1NGEA 4EZ9A 3O6WA 1NGFA 3VESA 5C15A 5EOYA 4CEOA 5CY4A 5KRTA 4CJTA 5AQPA 4OVLA 4CJWA 5KPRA 3VQ8A 4CJFA 4B1ZA 4DTJA 3CQXA 3V9WA 1BIZA 5HRNA 1NG9A 2OPQA 5AQYA 3VTIA 4CCHA 1BL3A 5AQIA 4E0DA 2KZMA 4OKJA 3UKRA 4CHOA 4ISGA 5AQMA 4DTNA 3TAPA 4GV3A 4ID5A 2OYQA 2Q0UA 2F9TA 1ASWA 4DTSA 5HROA 1IH7A 3VQCA 2HNZA 3O9SA 2FF6A 3C6UA 1BIUA 1KVCA 3CCMN 1NGAA 3OYJA 2HBLA 4HHTA 3NF8A 3QO9A 5AJ3K 2ASPA 1M1KO 3ZSWA 3NF7A 4CFCA 4ELUA 4H0XB 3AO2A 3KK1A 5SZTA 2F8SA 1WNSA 2ASMA 4DR3K 1VQKN 4DU3A 4CFAA 5BPNA 1S6PA 4LF4K 4WCEL 2YKNA 4H5TA 3ENOA 4FPBA 5KGXA 3KK2A 2W6LA 3WNEA 4BE2A 1IG9A 3A0IX 1NK4A 4I2QA 3VEZA 1XC9A 3WXKA 4BRLA 1SV5A 4LF7K 1O1WA 3OYMA 4WQ4A 3EN9A 1ZBUA 2HMIA 1GOBA 2J4RA 4F2SA 3HM9A 3QLHA 3ZT0A 4JN4A 3ZSXA 4FJMA 3SK3A 3MN6A 1BI4A 1HKBA 2XO7A 1VAZA 1XMQK 3EO3A 2BTFA 5HP1A 4DQQA 4ELTA 4KI4A 1C1AA 4IEEA 4AHRA 4DTXA 5M1KA 1QHAA 1YIJN 4I7FA 5JMVA 3T7ZA 3TTDA 1HJOA 1HKGA 1IKVA 2WTUA 4NXNK 3OBYA 3OYGA 4FWQA 4IDHA 4FJNA 4E1JA 3CC4N 3AVGA 5F2RA 1TK5A 4C8MA 2YHWA 3KLFA 1JXEA 1QVGM 2CH6A 4O55A 3SCXA 3THXA 1S6QA 3DRRA 4DTOA 2CGJA 3MX5A 1TK0A 4FLXA 1J5OA 3VQPA 1VSLA 3K58A 1E4FT 2PYJA 1UWBA 4DSLA 3AA3A 2A6AA 2HSTA 4BDPA 2E2NA 5AQJA 4Z94A 1U47A 4DR5K 5BRHA 2RPIA 2P9LA 4BG9A 3VEXA 2I5JA 3CFRA 4CEQA 4BC5A 2QWRA 4FJ9A 3VQEA 4RG8A 3QESA 3MX2A 1TAUA 1RTDA 3BZCA 2FSKA 3H45C 3KLHA 3SAGA 4AM7A 3DYAA 4FVUA 1HYVA 1YVUA 3K0SA 4CF2A 4J2AA 3MDQA 5LL6Z 4BGBA 3MWPA 3SYZA 1QVFM 1NJIO 3WEEB 4FZYA 5AQSA 1FKOA 2ETJA 3L6QA 3QBWA 4K43A 3MCPA 4H4MA 2DTUA 4CJPA 3R8EA 3U9DA 1JKHA 2OANA 1Q9YA 4YY3K 1SQKA 4F9OA 3E9PA 1X9MA 1HYZA 5FROA 4DSJA 3HXMA 2G8HA 1O13A 4KB1A 2YJEA 5BN8A 4Z4CA 2UUAK 3DLKA 5JICA 2ZE2A 1NJXA 1FJGK 4PUOA 4CD1A 3BF3A 4EZ6A 4Z4FA 3JAMO 2YJFA 3IMXA 5EX5A 2X78A 3DM2A 3LM2A 5AZIB 1BCOA 1OH7A 4HCCA 4BRMA 4CF8A 4BR7A 4HWIA 3THYA 2P9UA 4J8FA 1TVRA 3MN9A 3VQ7A 3NFAA 1J54A 4DV4K 5AQWA 3V6DA 3ENHA 4DTPA 1BA1A 4MFBA 4H5NA 3OBWA 3CPWM 3C95A 2QXLA 4CJVA 4RW9A 4KBOA 2CGLA 1J5EK 1W97L 3OTOK 4PY5A 2PY5A 3OHRA 3I0SA 3ZETA 3C6TA 4DFKA 3EE8A 3VQBA 3WUHA 2JWKA 3MECA 3VGMA 3CIPA 3A5LC 5I3UA 2HHUA 2O8BB 4CEZA 3QICA 3U3YA 4FJIA 4AHTA 3IAYA 1YITN 4M3XA 3KWIA 1VQ7N 2OPPA 4JD2A 1WSHA 3I55N 1LWEA 3DXMB 1BDGA 2DFHA 1Q82O 2F9WA 1NOYA 3AV9A 2UXDK 4KAZA 3NH2A 1KCFA 3J7AP 1VQ6N 2FF3B 1XMOK 1RBTA 2HNYA 3J7ZO 1RTIA 5BR9A 4M45A 1JL2A 3QNNA 5GAGP 2EWSA 2PAVA 3AA2A 3GDQA 4IO8A 1IV0A 1S9EA 4DFMA 1IKXA 3DLRA 2G8VA 3ZCMA 4BRFA 4DLGA 3UIQA 1YT3A 1Q18A 3O1BA 1S1UA 5KQDA 1WB9A 3OYHA 1JJ2M 5HL7L 3KK3A 4W5QA 4XH5A 4B1YB 4AQYK 5I42A 4BRGA 2D0CA 4FM2A 4EIAA 4BR9A 3NGYA 4JS4A 4HVJA 3ZX3A 2VQEK 2WOMA 3SV3A 1T8EA 4X64K 3CCSN 3ATVA 4LY7A 3H1QA 4Q5VA 2QWMA 3UE5A 4B9MA 1KVBA 3VF4A 3WT0A 4V19S 3A5MC 1C1BA 4QAGA 2QM1A 3CXCM 1CXQA 4K0KK 2ASOA 2KZZA 4RTFD 3HPHA 1T6CA 4FWKA 4Z4IA 1HLUA 4OO1J 5HBMA 3RMBA 1VSEA 2V51B 4UY8O 2B4JA 3RVCA 4DS4A 5CYQA 1ZYQA 1JLGA 1SL0A 3LDLA 4YOVA 4JKAA 2O8CB 2E2OA 3CCEN 4JNEA 5CE3A 3ZLJA 3HK2A 1NKEA 3HJFA 3AO3A 1W7AA 3KLEA 2ZD1A 4IG3A 3I33A 4Q0BA 2D0PA 1V4TA 4CF1A 3OS1A 4BC4A 4AF1A 3BUZB 1HUXA 2Q1NA 4O5FA 4YOYA 4AHCA 4ISFA 2HHWA 3OYCA 4CIFA 1NGCA 1I94K 2P5GA 2Q36A 4NCGA 3QB0A 4R5PA 3IS9A 3OYLA 3FZHA 4IEIA 4PQUA 3DXKA 5CZ2A 4CEFA 2YNIA 4JKGB 3V9UA 3DOLA 1K9MO 3L0QA 4NO7A 4CF9A 2X6NA 3C7NA 4Y0WA 2UUBK 3SQ4A 2NRRA 4M63C 1LAWA 2WONA 3NVMA 3L2WA 4B1WB 4FOIA 2O8DA 1YJ9N 4PKHA 5GIOA 1RT7A 4M7YA 4PHTX 2QWLA 4BDZA 1U2VB 4HTLA 4H0OA 4EAHD 4PKIA 4A59A 1WSJA 4AHSA 3HI0A 1L5UA 3O3GA 5BRDA 1YUWA 4KHUA 2YNFA 1RDUA 1RBRA 3V1OA 3SAFA 4OPHA 4KI6A 4KO0A 1EWQA 5B8HA 1JLQA 4M3TA 4JYAK 4CHPA 4ISEA 3T1AA 3SBTA 3KVGA 3QETA 2RKIA 3HOSA 3BGRA 1A5WA 1HPZA 3P5JA 4MDBA 2ZWHA 5AZJA 4ICLA 2HVIA 3CCJN 1MDUB 3EL2A 2D1KA 3QIPA 3CJCA 4FJ7A 2Q2RA 2GWJA 3BEXA 4BRKA 3THWB 1LOTB 4DQSA 3H6EA 3PY8A 4BRCA 3O4QA 4G9ZA 5BPMA 1XHZA 1WSFA 4CEDA 4RCHA 4IKFA 4N47A 3RSEA 5FDLA 2P9NA 2VWBA 3L4IA 3RMCA 3TANA 5C24A 3P1GA 4DV5K 1KQSM 1VQ5N 3R1XA 4ID1A 2UYTA 1K6YA 3H1VX 2Z1GA 3LM9A 3WEEA 1ITGA 4X62K 4C8LA 2RE2A 4A5BA 5KRSA 4I9LA 3HZ6A 3L3UA 3RRHA 2FSJA 3HSTB 2ZQBA 4IG0A 1CLQA 3CF5L 4PA1A 2E20A 2RF2A 4I6MA 4C8KA 1CZ9A 1OVYA 3ID8A 5ELZA 1RBUA 1HNIA 3RRGA 3SLCA 3HT3A 4DFPA 2BDPA 5M1PA 1YTUA 3LWMA 3MN5A 1KTQA 2ATQA 3VOVA 3MEDA 2ZJPL 4IFEA 4WFBL 2YNHA 4CVNE 2P9IB 3EE9A 1QSSA 3LPTA 3OW2M 3NBPA 4KH5A 4KHSA 5E41A 3LDOA 2QA4N 3ZYYX 4CZHA 2IS3A 5J2NA 2GEMA 3FFKB 4H0PA 4CJ3A 1OH5A 1VRUA 3SJHA 3ZSRA 3WXLA 4E1NA 4W5RA 3CPEA 1X1PA 1KAXA 1HYSA 4ZTJA 5K14A 1ESVA 3NDKA 3LDNA 5M1FA 1JLFA 3L8BA 4MLHA 1KD1O 1NGDA 4J2DA 3OYFA 3PSIA 2A1RA 3HRGA 2OPRA 2XRIA 3DLHA 5C2DA 4JI7K 3EYZA 4LF5K 2O8FB 3K59A 2Q3SA 3IG1A 4FLVA 2ITMA 4BRDA 3LZJA 3CM5A 3OVNA 3QFPA 3MN7A 3Q7BA 4FLWA 2G8UA 4J2EA 3RMDA 2QKBA 4WF9L 4CZFA 4B3RK 1VSKA 3D2FB 1JLBA 2PYLA 3SUOA 4CHNA 1NKBA 5M1OA 5E26A 2A1SA 1RDBA 2A40A 2YHBA 3LDPA 3AO1A 4H5RA 3DXMA 4M3RA 2F8TA 4W5OA 4BRIA 4M3UA 2P9PA 4PKGA 3AO4A 4FZXC 1GLBG 3GOIA 3G25A 4LSLA 3O8MA 2DPNA 3D0PA 4JLHA 1P8ZA 5HRSA 1TKTA 2DFFA 4IOXA 3ZSVA 1K73O 4CJKA 4FK4A 5C2FA 1T6DA 3AO5A 4B9NA 4N76A 4OLAA 3SZ2A 2E6MA 1UA1A 4M41A 4CI6A 5GAHP 2NRHA 1VSMA 4A62A 3HPOA 2IAJA 5IT9O 1LV5A 4LH5A 2IOCA 4GV9A 4DSIA 3JYTA 4B9VA 4X66K 4AHUA 1NBWA 1ATSA 1N36K 5HLFA 1Y97A 4BWJA 1BCMA 4NLCA 3ZT2A 2EX3A 1N32K 3VEYA 1NK0A 3MXIA 1NKCA 1TKXA 5TKWA 3J7YP 3KD1E 3LDQA 1WSGA 3AA4A 1Z25A 1GOCA 4N56A 1G15A 3U4LA 5JVGL 3VQ5A 2UUCK 1D9DA 3M8QA 3KZBA 3LP0A 4FJJA 3PV8A 3IDHA 4QS7A 4F4KA 3O9QA 4DR7K 1KAZA 1T05A 3U3GA 1QSLA 2AJQA 5AR0A 2Y1IA 3SPZA 1VQON 3NF6A 3VQQA 2QKKA 1MWMA 4BRHA 3V81A 2O8EA 2WUSA 1TYQB 2P9KB 4DB3A 4CZKA 3VTHA 2NNWA 2F4VK 3AVNA 3MEEA 3I56N 4FJGA 4BWMA 3QDKA 3ZSOA 4CJQA 3O9RA 4CFBA 4DQPA 4E7KA 3NVKA 4FWPA 4IO9L 1QE1A 2FSNA 2QWNA 4L3QA 4NB4A 4FO0A 4M42A 4JRQA 4BR2A 3LWLA 4G1QA 4JKCA 4BRAA 4LFAK 5FRNA 4CGHA 2ITGA 1C0GA 2A42A 1TKZA 1FXXA 1UOCA 3UKUB 1DGKN 3LP2A 5SWMA 3PO5A 1VQ4N 1TGOA 3NMUA 4EHTA 4ILGB 3CI5A 3CJAA 1Q81O 3EY1A 1D8YA 1U49A 4KHYA 4CZGA 1C0MA 3TWHA 5F0XA 3MEGA 3PLAA 5EY4A 1IKWA 5DMRA 3Q7CA 3T3FA 5C25A 4JKGA 3FZKA 4MO5A 4JK8A 4KRFA 3H3NO 3O5BA 1HX1A 2HHXA 4M3WA 5JVHL 4R79A 4QS9A 1BG3A 2VGNA 1ATNA 3FZFA 4OJRA 3TU5A 3SBGA 3RR8A 5FRMA 2KQ2A 2JWLA 4LC9B 1U2VA 2RHKA 4A2BA 4BVOA 4CBXA 2GUPA 2R7YA 3V1QA 4CGFA 1QZ6A 5FPDA 1DEJA 3DLBA 3H3OB 3DMJA 1S1WA 1C1CA 1XHXA 4EHUA 4CEEA 2GX9A 1Q9XA 3I0RA 2ZM6K 4WE1A 3NH1A 4FVMA 1RTHA 3K2PA 3SQ0A 1HR0K 2V52B 3ULEB 1HKCA 3G6EN 3OYIA 1CZAN 1BQNA 1U4BA 3VEWA 1K8AO 4WFNL 4IOCL 4WQ5A 1YF5L 4L8RB 1IKYA 4EP4A 4FLTA 4JV5K 4DV1K 2NRWA 3THWA 1JXBA 1LWCA 3ULDA 3VF6A 4ZHRA 4PL7A 4FLZA 1HPMA 4K8XA 3WNHA 3CHWA 3MXMA 4JHDB 3PX6A 3CFPA 1DT9A 1MWKA 4YOXA 3VQ4A 4GY2B 3S3OA 2RN2A 1NLVA 2YHXA 3BY5A 2P51A 2LSNA 3R3LA 4CBUA 3ITHA 3WXIA 2YHYA 1RFQA 4ZTFA 3U9ZA 1YAGA 3OYBA 3K5LA 3L3VA 1KRPA 3EKUA 3QEXA 4FXDA 4W5NA
chains in the Genus database with same CATH topology
3G4SN 4XH4A 1ATRA 3FZHA 1VQ9N 4JK9A 3P31A 1QQNA 3HTVA 1IG8A 1QQMA 1K8KA 4IEIA 5BPLA 1BWFO 3DXKA 1NMDA 3HBTA 4GV6A 4H0YB 2QWPA 5AQUA 1W2BM 4BQZA 3VGKA 4JKGB 4A61A 3AGRA 1K9MO 3L0QA 4FWMA 4BVPA 3MMVA 4NO7A 3CCQN 3F5TA 1KXPA 3C7NA 3CETA 4Y0WA 2NRRA 4M63C 2ZJRL 3NVMA 2P9SA 3KHYA 5GINA 1E4GT 4B1WB 1WOQA 3A5NC 4IWVA 4BQLA 1SAZA 4FOIA 4MDAA 1YJ9N 4PKHA 5GIOA 3ZEUA 3AGKA 2E1YA 1NGEA 1IJJA 2P9IA 4M7YA 4FPAA 4PHTX 5AZJB 3O6WA 3E9OA 1NGFA 3VESA 5C15A 2QWLA 2A5XA 4BC2A 3S41A 1U2VB 3D2EB 5EOYA 4HTLA 4H0OA 4EAHD 4AM6A 4PKIA 3M6GA 3CERA 5M1QA 4A59A 4NLBA 5AQPA 5KPRA 3HI0A 3AARA 4B1ZA 3O9TA 3CQXA 1YUWA 3UB5A 5BRDA 2FLOA 1RDUA 2HBJA 3SAFA 4BGAA 3FGUA 5AQYA 3VTIA 2IVNA 1GLAG 4OPHA 5AQIA 1NGGA 2QWQA 3O08A 3UKRA 5B8HA 4ISGA 1X9JA 4WYBA 5AQMA 3WXMB 2IVOA 3ZX0A 4ISEA 3O4WA 3SBTA 3KVGA 4GV3A 3RSEB 2PFUA 2Q0UA 3HOSA 4MDBA 2P9NB 2ZWHA 2F9TA 5AZJA 1YJNN 1XQSC 2PBDA 3CCJN 1MDUB 5CR4A 3O9SA 2FF6A 3EL2A 4CD3A 2D1KA 4KH6A 3CCMN 3CJCA 1NGAA 1BOTO 2HBLA 2GWJA 2Q2RA 3BEXA 3W3DA 4BRKA 1LOTB 4IJNA 4GNIA 2ASPA 3H6EA 1M1KO 5AQLA 4K42A 4O8UA 4BRCA 4G9ZA 1X3MA 4H0XB 1Z6RA 1NGHA 2NRZA 5BPMA 2ASMA 1KC8O 4JKDA 1VQKN 2NRXA 4XEIA 4BRNA 4RCHA 4CZEA 3RSEA 5BPNA 4FWRA 1H1VA 2P9NA 4I6MB 1J6ZA 4WCEL 2VWBA 2KKZA 3L4IA 4H5TA 4BREA 3ENOA 4FPBA 3H46O 3TPQA 1NM1A 5M1NA 3TTCA 1VQ5N 1KQSM 3A0IX 3R1XA 1R59O 2UYTA 3VEZA 3IUCA 3A5OC 3H1VX 3WXKA 4BRLA 2WC9A 4FWSA 3AAPA 3FR0A 3LM9A 3CQYA 4WQ4A 3WEEA 3EN9A 5FPEA 2RE2A 4A5BA 1BO5O 4CBWA 5KQ8A 3HZ6A 3ENBA 4BC3A 2FSJA 2J4RA 4JK7A 5LY3A 3MK6A 3QBXA 4JN4A 4YDUC 3AY9A 3CF5L 2HOEA 1K8KB 4BROA 2IIRA 4BRQA 2E20A 3SK3A 5GADP 4I6MA 3MN6A 1HKBA 1OVYA 3ID8A 5ELZA 1VAZA 2WBNA 3EZWA 3HM8A 4H0VB 3SLCA 2ZJQL 3EO3A 2BTFA 4FWNA 3KK7A 5AQZA 3SMPA 2ZGYA 4IEEA 1GLDG 3EKSA 5FPMA 5M1PA 3MN5A 5M1KA 1QHAA 2P9SB 2NRTA 3T69A 1YIJN 3VOVA 4MLEA 5E84A 1NGJA 5ADXA 4JKFA 2AA4A 2ZJPL 5JMVA 4IFEA 3ZEUB 3ID6A 3T7ZA 5I9EB 3TTDA 4WFBL 1BUPA 4QS8A 2P9IB 3EE9A 3CC7N 1HKGA 1HJOA 4B1UB 3OBYA 1S72N 3OW2M 4FWQA 4KH5A 4IDHA 3WQUA 2HF3A 3LL3A 3LDOA 2QA4N 3ZYYX 4CZHA 2GEMA 3FFKB 4H0PA 3VF2A 4E1JA 3CC4N 3SJHA 4A5AA 2HBMA 3ATUA 4DKWA 1VQ8N 5F2RA 5AQTA 3HOTA 3WXLA 1TUUA 3CMAN 4WFAL 1VQNN 5C10A 3CPEA 3N4QA 2YHWA 1KAXA 3UKRB 4A57A 1T3VA 2H3GX 1QVGM 3CCUN 5AFUH 2CH6A 1ESVA 4BR4A 1U6ZA 3LDNA 2V7ZA 5M1FA 2CGJA 3MX5A 3SMSA 4MLHA 5GAEP 3B8AX 1NGDA 1KD1O 3HRGA 3IKMA 1JCGA 5C2DA 1E4FT 3N4PA 3E9LA 3FZMA 2QTDA 2VCPA 1P90A 4MO4A 3R9PA 5HOOA 2P9PB 3CD6N 2KHOA 2A6AA 3GE1A 4DQ8A 2HSTA 2ITMA 4BRDA 2E2NA 3QFPA 3MN7A 3Q7BA 4JKEA 1KAYA 5AQJA 4K25A 3CJ1A 3BF1A 4H03B 4Z94A 4WF9L 2BH1A 4CZFA 1ILYA 5BRHA 3KWGA 1Y64A 2P9LA 4BG9A 5BN9A 3D2FB 3VEXA 4BC5A 3P39A 2QWRA 3D6RA 2HMPA 5AQHA 3D7EO 3WQTA 5JLFA 3MX2A 4O8KA 1VQPN 2FSKA 3H45C 4JKBA 5M1OA 3SAGA 5E26A 4AM7A 2A40A 3LDPA 4YOTA 4H5RA 3DXMA 4FVUA 2CH5A 3K9KA 4BRIA 2P9PA 4PKGA 1GLJO 1JCFA 3MDQA 1GLBG 3GOIA 3G25A 4BGBA 3MWPA 3O8MA 2DPNA 4OPAA 1P8ZA 3VETA 1NJIO 1QVFM 3WEEB 3U8XA 5AQSA 3L6QA 3DJCA 1RDWX 4IOXA 4EFHA 2OTLN 3QBWA 3D2FA 4K43A 1K73O 1C0FA 3MCPA 4YOWA 2Q0RA 5AQQA 5C2FA 3R8EA 1T6DA 2HF4A 3ZX2A 3U9DA 1N8RO 3C6AA 3OA9A 2OANA 2NRHA 4CI6A 5GAHP 1VQMN 4A62A 1SQKA 2E1ZA 4IJAA 4F9OA 4H5WA 3E9PA 4GV9A 3GG4A 1MA9B 3DLLL 3DWLA 4JEPA 2P9UB 4WQ5C 3C0BA 5JLHA 1BU6O 1O13A 3TTFA 4FWLA 2YJEA 1NBWA 5BN8A 1ATSA 4CZMA 3TSQA 2ZF5O 5JICA 1YI2N 4NLCA 2OTJN 3VEYA 4WQ4C 3BF3A 4CD1A 5TKWA 3VEOA 4C23A 2YJFA 2VYPA 3IMXA 4YORA 5EX5A 3LDQA 3WXJA 3C6HA 4M7XA 1JCEA 4K41A 3GBTA 1QZ5A 3MCAB 4B1VA 3U4LA 3LM2A 5JVGL 2I7PA 3SAHA 5AZIB 3ZETB 3FE1A 2QEXN 4BRMA 2QWOA 3KZBA 4BG8A 4BR7A 4HWIA 2P9UA 4U7BA 4J8FA 4BY9C 3IDHA 3MN9A 3E66A 4QS7A 1ZXOA 4IXCA 2V7YA 5AQWA 3JS6A 2ZGZA 2GELA 3ENHA 4PL8A 3O9QA 1BA1A 4H5NA 1KAZA 3OBWA 3CPWM 4C1NI 2QXLA 2E8AA 5EVZA 5AR0A 4JD2B 3PIPL 3ULEA 4KBOA 2CGLA 1VQON 4JKHA 5H1SQ 1W97L 1SS6A 5AQKA 4CZIA 5DM7L 1SZ2A 1MWMA 4BRHA 2QI2A 5FPNA 3OHRA 3VERA 5AQOA 1M90O 4RWTA 5DM6L 2WUSA 5AZIA 1TYQB 2P9KB 3ZETA 4DB3A 5AQFA 4CZKA 5AQGA 3VTHA 5GIPA 2NNWA 3EE8A 3WUHA 2JWKA 3TSPA 1GLLO 3I56N 4KH4A 3VGMA 3CIPA 3A5LC 3QDKA 2P9LB 2NRVA 3O9RA 3E1YA 3VMFB 3NVKA 4FWPA 4IO9L 3QICA 4DCHA 5AQNA 4DHYA 2FSNA 1G99A 1YITN 1X3NA 2QWNA 3CC2N 2GTDA 4L3QA 4NB4A 1YVNA 1YHQN 4ILHA 5C0YA 3KWIA 4FO0A 4ILJA 4B1XB 4JHDA 4BR2A 3BP8A 2CGKA 3P4IA 1VQ7N 4JKCA 1NWKA 3CJBA 4JD2A 4BRAA 4IOAL 3I55N 4FWOA 1C0GA 2A42A 2GWKA 3DXMB 5ADXH 1BDGA 1Q82O 2F9WA 3UKUB 1DGKN 3I8BA 1WUAA 2YCHA 2NLXA 1TYQA 2P9KA 4H0TB 4JAXA 1VQ4N 1VQ6N 2FF3B 3NMUA 4EHTA 5CHIA 3F9MA 3J7ZO 4ILGB 2E88A 3CI5A 3CJAA 3GL1A 3O9UA 2IVPA 5BR9A 1Q86O 3JXUA 1XC3A 4U67L 1Q81O 3CCLN 4BRPA 4BR0A 1ZC6A 5GAGP 2EWSA 2PAVA 3O80A 4CZGA 5BREA 3GDQA 2QW9A 4IO8A 2W40A 5F0XA 1VQLN 3AAQA 1T44A 1TUYA 5F1XA 3PLAA 5EY4A 3G71N 1QQOA 3J8AA 3M1FA 3Q7CA 1D4XA 2A3ZA 5BRFA 4BRFA 2YI1A 1GLEG 4JKGA 1EO1A 3FZKA 4YOUA 3F2KA 2I7NA 3UKUA 4MO5A 4JK8A 1Q18A 3CCRN 2AP1A 3H3NO 3O1BA 3O5BA 1HX1A 5KQDA 5JVHL 4R79A 5TKYA 1JJ2M 4QS9A 1YXQA 5HL7L 2YX6A 3O1WA 3CMEN 1BG3A 3VPZA 2D0OA 3QMLA 4XH5A 2VGNA 4B1YB 4BRGA 1ATNA 1S3XA 3FZFA 3TU5A 3SBGA 1DKGD 4EIAA 5LJVA 4BR9A 2JWLA 4LC9B 1U2VA 3D2EA 2RHKA 3ZX3A 4A2BA 4BVOA 4C1NK 1YJWN 1Z05A 4CBXA 2GUPA 4B9QA 3QFUA 3DAWA 1QZ6A 5FPDA 3CCSN 1DEJA 1EQYA 2HBKA 3ATVA 3CJ9A 3H3OB 4FSVA 5KPTA 3H1QA 4CJ7A 3MWTA 2QWMA 3UE5A 4EHUA 2GX9A 2VGMA 3VF4A 3C65A 1S22A 3WT0A 5MLCQ 5AQRA 1OKJA 2Q97A 3VGLA 3L4QA 4FL9A 3M5RA 2V52B 4FOEA 3A5MC 3ULEB 4IZ9A 1HKCA 1ZBSA 3G6EN 1XUPO 2QM1A 4A2AA 1CZAN 3CXCM 3PIOL 3VEWA 1K8AO 2ASOA 3IFRA 3VEVA 4WFNL 4IOCL 4WQ5A 1YF5L 4RTFD 1RGIA 1LCUA 1T6CA 2BUPA 4FWKA 1HLUA 1NGBA 4OO1J 5EXWA 1GLFO 2NRWA 2V51B 4UY8O 3RVCA 3VF6A 2F7TA 2E2QA 4GVEA 4PL7A 3CJ7A 1HPMA 1NGIA 3A8YA 3LDLA 5AQXA 3K9JA 1BA0A 3CCVN 4YOVA 2NZTA 4JKAA 2E2OA 3CCEN 4CZLA 4JNEA 5CE3A 3CHWA 2Q31A 2WFBA 4YDUA 4H5VA 1GLCG 4JHDB 2E2PA 3DXKB 5KPZA 5AQVA 3TSUA 1DT9A 2D4WA 3R6MA 1MWKA 5AFUA 3FLCO 4YOXA 3I33A 4GY2B 3VENA 2D0PA 1V4TA 1NLVA 2KLAA 3FZLA 2YHXA 4XH1A 4BR5A 3P38A 3C7NB 3R3LA 5C12A 4CBUA 2FXUA 3WXIA 2YHYA 3BUZB 4AF1A 4BC4A 5LJWA 1HUXA 3HSCA 1RFQA 3W0LA 2Q1NA 1V4SA 4O5FA 4YOYA 3U9ZA 1YAGA 4ISFA 1Q7YO 3M3ZA 1NGCA 3EKUA 2Q36A 4CZJA 3QB0A 2W41A 2A41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFU A;  2JWL A;  2JWK A; 
#chains in the Genus database with same CATH topology
 3RMA A;  2BE2 A;  4DV6 K;  4DWI A;  1A5V A;  4JK9 A;  3P31 A;  3WNF A;  3HBT A;  1TL1 A;  4XIU A;  2QWP A;  1W2B M;  1ZBF A;  1T03 A;  2W6K A;  3OYE A;  3OJS A;  4BDY A;  3ZT4 A;  4FLU A;  1KXP A;  1SL1 A;  1BHL A;  3CET A;  2DY4 A;  4KFB A;  1WOQ A;  4BQL A;  1SAZ A;  1NMN A;  3I8D A;  2P9I A;  4YHH K;  4AM6 A;  1SKS A;  3CER A;  4NLB A;  3ZT3 A;  4BGA A;  3FGU A;  1L3T A;  2IVN A;  1GLA G;  4DG1 A;  1WBB A;  3TI0 A;  4I9Q A;  1NGG A;  2QWQ A;  3L2V A;  1RIL A;  2X74 A;  1X9J A;  4WYB A;  2HB5 A;  3WXM B;  3ZX0 A;  3O3F A;  4HUE A;  3B6P A;  3O4W A;  4KV8 A;  3T1Y K;  3T19 A;  1NOZ A;  1YJN N;  1XQS C;  2PBD A;  3OY9 A;  4CD3 A;  4E89 A;  4J2B A;  3ISN C;  1BIS A;  3W3D A;  2IDO A;  4IJN A;  3KD5 E;  3V4I A;  2VG7 A;  4AH9 A;  1X3M A;  3PX0 A;  1Q8I A;  4FCY A;  1Z6R A;  5DK5 A;  2XY6 A;  5JS1 A;  1KC8 O;  4JKD A;  2HHS A;  2NRX A;  4XEI A;  4BRN A;  2XHB A;  3A2F A;  3S3N A;  1H1V A;  3LPU A;  1BI4 B;  4KHN A;  3F73 A;  3SQ1 A;  4I2P A;  3TAR A;  4AHV A;  1DTQ A;  3TTC A;  4Z0U A;  4Z4G A;  4O44 A;  5J2Q A;  3SNN A;  5HRP A;  2OA8 A;  3A5O C;  2B6A A;  3CFO A;  4CHQ A;  2WC9 A;  5KTQ A;  2W42 A;  3FR0 A;  4KKO A;  1VSJ A;  4CBW A;  1NK8 A;  5KQ8 A;  4DF8 A;  2D0A A;  5LY3 A;  3QEP A;  3MK6 A;  3QBX A;  4YDU C;  3AY9 A;  3RWU A;  4BRO A;  3VQ9 A;  4OKE A;  1X9S A;  4BRQ A;  1L3V A;  3KKR A;  2E6L A;  3HM8 A;  4FWN A;  3KK7 A;  3SMP A;  3FFI A;  3EKS A;  5FPM A;  2NRT A;  4DFJ A;  5ADX A;  4JKF A;  2AA4 A;  3ZEU B;  3ID6 A;  1C0U A;  1J9A A;  4QS8 A;  3CC7 N;  4FJK A;  1QS4 A;  4B1U B;  1S72 N;  3WQU A;  3J80 O;  2HF3 A;  3LL3 A;  3DI6 A;  3OYK A;  1SUQ A;  4LF6 K;  5D3G A;  3VF2 A;  4A5A A;  4DKW A;  3ATU A;  1VQ8 N;  3M8P A;  2G8I A;  3AVH A;  1RBV A;  4H4O A;  3NE6 A;  4CGI A;  1TUU A;  3CMA N;  4WFA L;  1VQN N;  3VA0 A;  1KVA A;  2D0B A;  5C10 A;  1T3V A;  4GKK K;  4BR4 A;  1U6Z A;  1DLO A;  1S1X A;  3MAQ A;  1A5X A;  4DTU A;  4M3Y A;  4BAC A;  4DTM A;  1RCH A;  4CK3 A;  3CYM A;  3B8A X;  1JLE A;  2XY8 A;  3ASM A;  3IKM A;  1JCG A;  5LMN K;  1HQE A;  3N4P A;  4FM0 A;  4B9U A;  2KHO A;  3VQA A;  4DQ8 A;  3SUQ A;  1EWR A;  3ZT1 A;  3CJ1 A;  4H03 B;  1TL3 A;  2BH1 A;  1ILY A;  2HVH A;  3KWG A;  1Y64 A;  5BN9 A;  3B6O A;  4X65 K;  2HMP A;  4E7J A;  3HP6 A;  3WQT A;  5JLF A;  1VQP N;  4E7I A;  3J81 O;  1XNR K;  1VHX A;  1B92 A;  1UAX A;  2UXC K;  1GLJ O;  4LFC K;  1VSH A;  5J2M A;  1RT4 A;  4OPA A;  3U8X A;  3RR7 A;  4JRP A;  1RDW X;  2OTL N;  4B8A B;  5KGW A;  4FYD A;  3C94 A;  1GOA A;  4YOW A;  2Q0R A;  1KLM A;  1WAF A;  2E5L K;  2P1J A;  4NCA A;  3S9H A;  1VQM N;  3HVR A;  2E1Z A;  4IJA A;  4H5W A;  3GG4 A;  3THY B;  2P9U B;  1XI1 A;  4WQ5 C;  3C0B A;  5JLH A;  1BU6 O;  3PO4 A;  2KW4 A;  4CER A;  1TKD A;  2ZF5 O;  1S5J A;  4FM1 A;  3ZSQ A;  1YI2 N;  3NH0 A;  2IC3 A;  3HYF A;  4OGC A;  1N6Q A;  3VQD A;  2OTJ N;  3VEO A;  2VYP A;  3BZK A;  3TR8 A;  3WXJ A;  4DUZ K;  3C6H A;  4M7X A;  1JCE A;  4DLE A;  3U6F A;  3GBT A;  1QZ5 A;  3MCA B;  4B1V A;  4DR4 K;  4JI8 K;  2I7P A;  3SAH A;  3ZET B;  2G8W A;  4MQ3 A;  2QEX N;  3PSF A;  4U7B A;  4BY9 C;  1D5A A;  4DV3 K;  1ZXO A;  2V7Y A;  2ZGZ A;  2GEL A;  2QXF A;  1TAQ A;  4C1N I;  3K5O A;  2E8A A;  5EVZ A;  4JD2 B;  4JI4 K;  2VQF K;  3ULE A;  3P83 D;  4JKH A;  4CZI A;  1SZ2 A;  2QI2 A;  3VER A;  2Z1I A;  4DQI A;  1M90 O;  4RWT A;  5DM6 L;  5AZI A;  4IFV A;  5AQF A;  4CIE A;  5AQG A;  5GIP A;  2HHV A;  2HHQ A;  4CK1 A;  3TAB A;  2NRV A;  4RW8 A;  1SL2 A;  4KTW A;  5AQN A;  1E3M A;  1X3N A;  2GTD A;  1YHQ N;  1YVN A;  4ILH A;  4B8C A;  4ILJ A;  4CJ5 A;  4B1X B;  2G8F A;  1SKR A;  2HND A;  4JHD A;  3P4I A;  1TK8 A;  4IOA L;  1NWK A;  4GMJ B;  1XWL A;  3D45 A;  4E7L A;  4DR6 K;  1OVQ A;  2GWK A;  5ADX H;  4KPY A;  4OX9 K;  3K5M A;  3I8B A;  3VN5 A;  2HHH K;  3AVI A;  5C42 A;  3TAE A;  4DR1 K;  1RT1 A;  4DV7 K;  2G8K A;  3L2Q A;  4JAX A;  5CYM A;  5CHI A;  3F9M A;  4OGE A;  2E88 A;  1Q86 O;  3GL1 A;  3O9U A;  2IVP A;  2O8B A;  3HL8 A;  3QIN A;  4H8K A;  3CCL N;  4BRP A;  4BR0 A;  1ZC6 A;  5BRE A;  3V9Z A;  3O80 A;  4F3O A;  2W40 A;  2YNG A;  3AAQ A;  1T44 A;  1FW6 A;  1QQO A;  3J8A A;  1VSF A;  2A3Z A;  5BRF A;  1FK9 A;  4YOU A;  1RDA A;  3CCR N;  2AP1 A;  2F96 A;  4FW2 A;  4CJ4 A;  3NHG A;  1NJW A;  1YXQ A;  4KHP K;  3PUF A;  3CME N;  3VPZ A;  4FZZ A;  2VWK A;  3OJU A;  1DKG D;  5LJV A;  1LW0 A;  1YJW N;  1ZBH A;  1NNE A;  3DOK A;  4O0I A;  1Z05 A;  4B9Q A;  2X6S A;  2YV0 X;  4KHW A;  3BDP A;  1R0A A;  4O0J A;  4GVM A;  1EX4 A;  3CJ9 A;  1EQY A;  3QNO A;  2VGM A;  4OKK A;  1S22 A;  4CGD A;  3DRS A;  2Q97 A;  2O4I A;  5BR8 K;  4YNQ A;  3L4Q A;  4CIG A;  3LZI A;  4DTR A;  4CJL A;  4IZ9 A;  3SQ2 A;  1ZBS A;  4A2A A;  5A2Q O;  1ZBI A;  1OH6 A;  4CES A;  3VEV A;  3IFR A;  1RGI A;  1LCU A;  1RNH A;  2BUP A;  2Z1H A;  3OS0 A;  4Z4H A;  1EXQ A;  2E2Q A;  4DR2 K;  1NGI A;  1RTJ A;  3A8Y A;  3K9J A;  1BA0 A;  3AVF A;  2NZT A;  1T7P A;  1HMV A;  1I3A A;  2Q31 A;  2WFB A;  4YDU A;  4B9L A;  4H5V A;  4DV0 K;  2YKM A;  2XY5 A;  4JI6 K;  3DXK B;  4IDK A;  2D4W A;  5AFU A;  4KHQ A;  1IBL K;  3FZL A;  3E01 A;  3EEQ A;  4BR5 A;  3C7N B;  5C12 A;  4E19 A;  5LJW A;  3HSC A;  3HP9 A;  3CQ8 A;  2O8D B;  2IGI A;  1EET A;  2GBZ A;  2FBV A;  4IFY A;  3LAK A;  4CZJ A;  2O8C A;  3DLG A;  3AVL A;  3G4S N;  3LAL A;  4XH4 A;  3HPG A;  1VQ9 N;  4CJS A;  1QQN A;  1QQM A;  5BPL A;  1Z26 A;  1BWF O;  4GV6 A;  1NMD A;  2FBX A;  5AQU A;  3SV4 A;  4BQZ A;  3VGK A;  4RW7 A;  4BVP A;  4NXM K;  3WNG A;  3CCQ N;  1S1T A;  4W5T A;  5GIN A;  1E4G T;  2GV9 A;  3L2U A;  4MDA A;  3ZEU A;  4F8R A;  4FJ5 A;  2E1Y A;  1IJJ A;  1HNX K;  3VA3 A;  4FPA A;  5AZJ B;  2BAN A;  3E9O A;  3SUN A;  3DRP A;  2A5X A;  4BC2 A;  1BQM A;  1CXU A;  3S41 A;  3D2E B;  2JGU A;  3OS2 A;  3M6G A;  5M1Q A;  3NF9 A;  3AAR A;  3THV A;  3O9T A;  3UB5 A;  2FLO A;  2HBJ A;  3G10 A;  3L2R A;  3O08 A;  4JS5 A;  2IVO A;  4RW6 A;  3RSE B;  1NJZ A;  1ASU A;  2PFU A;  4FJL A;  2P9N B;  4Y1C A;  4B3M K;  5CR4 A;  1QHT A;  1TV6 A;  4KH6 A;  3NCI A;  1BOT O;  2P5O A;  4KB0 A;  1ZBL A;  1KFS A;  4DQR A;  4GNI A;  4DU4 A;  2KTQ A;  5AQL A;  4K42 A;  4O8U A;  4CK2 A;  1CZB A;  1NGH A;  3KLG A;  2NRZ A;  3TAQ A;  2HW3 A;  4CZE A;  5LMU K;  3M8R A;  2NUB A;  4FWR A;  4I6M B;  1J6Z A;  2KKZ A;  1HRH A;  4BRE A;  3V9X A;  4FJX A;  1RT2 A;  3H46 O;  3OYN A;  1NK6 A;  3TPQ A;  1NM1 A;  5M1N A;  2HHT A;  2XY7 A;  1R59 O;  4YFU A;  3IUC A;  4O4G A;  4CE9 A;  1NK5 A;  4FWS A;  3AAP A;  4CEA A;  3OYA A;  3CQY A;  4FK0 A;  3QEI A;  5FPE A;  1BO5 O;  3ENB A;  4BC3 A;  4JK7 A;  3NGI A;  1OH8 A;  2HOE A;  1K8K B;  3LDS A;  1BGX T;  3MXJ A;  2IIR A;  5GAD P;  3NGZ A;  3LAN A;  3AVJ A;  4H0V B;  2WBN A;  3EZW A;  2ZJQ L;  1J53 A;  1I39 A;  5AQZ A;  2OZS A;  2ZGY A;  1GLD G;  2P9S B;  3T69 A;  4MLE A;  5E84 A;  1NGJ A;  4F3T A;  5I9E B;  2JLE A;  4DSE A;  4OLB A;  1BUP A;  1EKE A;  4B08 A;  4CFD A;  3NAE A;  4LF8 K;  4BE0 A;  3LP3 A;  4DSK A;  4C8O A;  1VK0 A;  4JI3 K;  2HBM A;  5AQT A;  3HOT A;  3N4Q A;  3UKR B;  4A57 A;  4CEC A;  1IBK K;  2FBT A;  2H3G X;  4CF0 A;  3CCU N;  4E1M A;  5AFU H;  3QEV A;  1N5Y A;  1NK9 A;  2V7Z A;  2UU9 K;  3SMS A;  4CGJ A;  5GAE P;  3TAF A;  4C8N A;  3E9L A;  3FZM A;  2QTD A;  2GUI A;  1P90 A;  2VCP A;  4MO4 A;  3R9P A;  5HOO A;  3OYD A;  2P9P B;  3RTV A;  3CD6 N;  3GE1 A;  4JKE A;  1KAY A;  4K25 A;  1L3U A;  3BF1 A;  1RT3 A;  4FJH A;  3F9K A;  2FC0 A;  5IWA K;  3P39 A;  3D6R A;  5AQH A;  2O4G A;  1RBS A;  3SPY A;  3D7E O;  4O8K A;  4JKB A;  3AVK A;  3O3H A;  3T1H K;  4HTU A;  2OCE A;  4YOT A;  4JI1 K;  1VRT A;  2CH5 A;  1REV A;  3K9K A;  2O8F A;  1JCF A;  2BGG A;  3VET A;  1LAV A;  3G0Z A;  1VSD A;  4CHY A;  3JSM A;  3DJC A;  4EFH A;  4FJ8 A;  3D2F A;  1NJY A;  3KIO A;  4NCB A;  1C0F A;  4IBN A;  4JI0 K;  5AQQ A;  1QQC A;  2HF4 A;  1L3S A;  3ZX2 A;  2VG6 A;  1RT6 A;  1N8R O;  3C6A A;  3OA9 A;  3ZSY A;  1YTA A;  1MA9 B;  2FBY A;  3DWL A;  4JEP A;  1VSI A;  3DLL L;  3TAG A;  3TTF A;  3KKS A;  4FWL A;  4CZM A;  3TSQ A;  3TAM A;  4OPJ A;  5FLX O;  1UA0 A;  1KSP A;  4WQ4 C;  4C23 A;  4YOR A;  4CEB A;  4LF9 K;  1JL1 A;  4K41 A;  1F21 A;  3HO1 A;  4B9T A;  1NU0 A;  4FW1 A;  4AIL C;  1B9D A;  4K8Z A;  2O8E B;  3FE1 A;  3O4N A;  3KTQ A;  4LSN A;  4CJU A;  2QWO A;  4BG8 A;  2E4L A;  4CHZ A;  1S9G A;  3E66 A;  1IBM K;  4LD0 A;  4IXC A;  3THX B;  3JS6 A;  1JLC A;  4PL8 A;  1W0H A;  4Z4E A;  4CW7 B;  3PIP L;  1WLJ A;  4GW6 A;  5H1S Q;  3PX4 A;  5J2P A;  1FKP A;  1SS6 A;  3CG7 A;  5AQK A;  5T7B A;  5DM7 L;  4DUY K;  2Z1J A;  3AVM A;  5FPN A;  5KI6 A;  5AQO A;  4FLY A;  3VQ6 A;  3KLI A;  2OPS A;  2B5J A;  2UXB K;  4E3S A;  3SJJ A;  3TSP A;  1GLL O;  4KH4 A;  5J1E A;  3QEW A;  2Y1J A;  2P9L B;  1U48 A;  1C6V A;  3E1Y A;  3VMF B;  4DU1 A;  3K57 A;  4DCH A;  4DHY A;  1WAJ A;  1G99 A;  5HRR A;  1WBD A;  3CC2 N;  5C0Y A;  3BP8 A;  1HNV A;  2CGK A;  3SUP A;  3CJB A;  3IRX A;  4NYN A;  3AVA A;  4FWO A;  4O5B A;  1SKW A;  2VWJ A;  4QOZ B;  1XNQ K;  1WUA A;  2YCH A;  4HCB A;  1KLN A;  2NLX A;  1TYQ A;  2P9K A;  1S1V A;  3H08 A;  4H0T B;  4KTQ A;  1N33 K;  3ZSZ A;  1WSE A;  1JLA A;  4UQG A;  1U45 A;  3JXU A;  1XC3 A;  4U67 L;  4HUF A;  4TSX A;  2YHA A;  1W9H A;  2KFZ A;  2QW9 A;  1VQL N;  4F2R A;  1TUY A;  5F1X A;  3AVC A;  3G71 N;  4DF4 A;  4DSF A;  5EU7 A;  3M1F A;  1WN7 A;  1D4X A;  1IO2 A;  2YI1 A;  1GLE G;  1EO1 A;  3F2K A;  2I7N A;  3UKU A;  4M3Z A;  4DMN A;  4B3T K;  3ALY A;  5TKY A;  4BE1 A;  3V1R A;  4QCL A;  2YX6 A;  3O1W A;  2VG5 A;  5CZ1 A;  3SI6 A;  2D0O A;  3QML A;  3K5N A;  1QSY A;  1S3X A;  1ASV A;  1MU2 A;  3HVT A;  1RDD A;  3D2E A;  4C1N K;  1U04 A;  1KFD A;  3QFU A;  4N41 A;  4LFB K;  2DFE A;  3DAW A;  2D5R A;  1RDC A;  4JI2 K;  2HBK A;  1B9F A;  4FSV A;  5KPT A;  1NK7 A;  4CJ7 A;  3S3M A;  3MWT A;  4N5S A;  4EP5 A;  3LAM A;  1X9W A;  1HNZ K;  3C65 A;  5MLC Q;  1C0T A;  5AQR A;  1OKJ A;  3VGL A;  4HUG A;  4E7H A;  4FL9 A;  3M5R A;  1WSI A;  4FOE A;  4CJR A;  4GKJ K;  4B3S K;  1LWF A;  1XUP O;  3KJV A;  3PIO L;  2QK9 A;  2OZM A;  1NGB A;  5JS2 A;  5EXW A;  1EP4 A;  1GLF O;  1D9F A;  4JI5 K;  2EHG A;  1RT5 A;  2F7T A;  4GVE A;  4LH4 A;  3CJ7 A;  4Y1D A;  4B3O A;  3LP1 A;  4FK2 A;  5AQX A;  4RW4 A;  3CCV N;  4CZL A;  4DV2 K;  1GLC G;  2E2P A;  2PZS A;  5KPZ A;  5AQV A;  3TSU A;  1HQU A;  3R6M A;  3EZ5 A;  4ELV A;  1LW2 A;  3DLE A;  3FLC O;  4KTZ A;  3VEN A;  4XH1 A;  2KLA A;  1DTT A;  3CM6 A;  3P38 A;  4B9S A;  2FXU A;  3V9S A;  3W0L A;  2KFN A;  1V4S A;  4PWD A;  1Q7Y O;  3M3Z A;  4DS5 A;  3QIO A;  2W41 A;  2A41 A;  3AA5 X;  1ATR A;  3HTV A;  3AVB A;  1IG8 A;  1K8K A;  4CGG A;  4H0Y B;  1QTM A;  1HNW K;  4A61 A;  3AGR A;  4CJE A;  4FWM A;  3QER A;  1N34 K;  3MMV A;  1HJR A;  3F5T A;  3M8S A;  2ZJR L;  2P9S A;  3KHY A;  4KRE A;  3A5N C;  4IWV A;  4NYF A;  4OPK A;  3AGK A;  1NGE A;  4EZ9 A;  3O6W A;  1NGF A;  3VES A;  5C15 A;  5EOY A;  4CEO A;  5CY4 A;  5KRT A;  4CJT A;  5AQP A;  4OVL A;  4CJW A;  5KPR A;  3VQ8 A;  4CJF A;  4B1Z A;  4DTJ A;  3CQX A;  3V9W A;  1BIZ A;  5HRN A;  1NG9 A;  2OPQ A;  5AQY A;  3VTI A;  4CCH A;  1BL3 A;  5AQI A;  4E0D A;  2KZM A;  4OKJ A;  3UKR A;  4CHO A;  4ISG A;  5AQM A;  4DTN A;  3TAP A;  4GV3 A;  4ID5 A;  2OYQ A;  2Q0U A;  2F9T A;  1ASW A;  4DTS A;  5HRO A;  1IH7 A;  3VQC A;  2HNZ A;  3O9S A;  2FF6 A;  3C6U A;  1BIU A;  1KVC A;  3CCM N;  1NGA A;  3OYJ A;  2HBL A;  4HHT A;  3NF8 A;  3QO9 A;  5AJ3 K;  2ASP A;  1M1K O;  3ZSW A;  3NF7 A;  4CFC A;  4ELU A;  4H0X B;  3AO2 A;  3KK1 A;  5SZT A;  2F8S A;  1WNS A;  2ASM A;  4DR3 K;  1VQK N;  4DU3 A;  4CFA A;  5BPN A;  1S6P A;  4LF4 K;  4WCE L;  2YKN A;  4H5T A;  3ENO A;  4FPB A;  5KGX A;  3KK2 A;  2W6L A;  3WNE A;  4BE2 A;  1IG9 A;  3A0I X;  1NK4 A;  4I2Q A;  3VEZ A;  1XC9 A;  3WXK A;  4BRL A;  1SV5 A;  4LF7 K;  1O1W A;  3OYM A;  4WQ4 A;  3EN9 A;  1ZBU A;  2HMI A;  1GOB A;  2J4R A;  4F2S A;  3HM9 A;  3QLH A;  3ZT0 A;  4JN4 A;  3ZSX A;  4FJM A;  3SK3 A;  3MN6 A;  1BI4 A;  1HKB A;  2XO7 A;  1VAZ A;  1XMQ K;  3EO3 A;  2BTF A;  5HP1 A;  4DQQ A;  4ELT A;  4KI4 A;  1C1A A;  4IEE A;  4AHR A;  4DTX A;  5M1K A;  1QHA A;  1YIJ N;  4I7F A;  5JMV A;  3T7Z A;  3TTD A;  1HJO A;  1HKG A;  1IKV A;  2WTU A;  4NXN K;  3OBY A;  3OYG A;  4FWQ A;  4IDH A;  4FJN A;  4E1J A;  3CC4 N;  3AVG A;  5F2R A;  1TK5 A;  4C8M A;  2YHW A;  3KLF A;  1JXE A;  1QVG M;  2CH6 A;  4O55 A;  3SCX A;  3THX A;  1S6Q A;  3DRR A;  4DTO A;  2CGJ A;  3MX5 A;  1TK0 A;  4FLX A;  1J5O A;  3VQP A;  1VSL A;  3K58 A;  1E4F T;  2PYJ A;  1UWB A;  4DSL A;  3AA3 A;  2A6A A;  2HST A;  4BDP A;  2E2N A;  5AQJ A;  4Z94 A;  1U47 A;  4DR5 K;  5BRH A;  2RPI A;  2P9L A;  4BG9 A;  3VEX A;  2I5J A;  3CFR A;  4CEQ A;  4BC5 A;  2QWR A;  4FJ9 A;  3VQE A;  4RG8 A;  3QES A;  3MX2 A;  1TAU A;  1RTD A;  3BZC A;  2FSK A;  3H45 C;  3KLH A;  3SAG A;  4AM7 A;  3DYA A;  4FVU A;  1HYV A;  1YVU A;  3K0S A;  4CF2 A;  4J2A A;  3MDQ A;  5LL6 Z;  4BGB A;  3MWP A;  3SYZ A;  1QVF M;  1NJI O;  3WEE B;  4FZY A;  5AQS A;  1FKO A;  2ETJ A;  3L6Q A;  3QBW A;  4K43 A;  3MCP A;  4H4M A;  2DTU A;  4CJP A;  3R8E A;  3U9D A;  1JKH A;  2OAN A;  1Q9Y A;  4YY3 K;  1SQK A;  4F9O A;  3E9P A;  1X9M A;  1HYZ A;  5FRO A;  4DSJ A;  3HXM A;  2G8H A;  1O13 A;  4KB1 A;  2YJE A;  5BN8 A;  4Z4C A;  2UUA K;  3DLK A;  5JIC A;  2ZE2 A;  1NJX A;  1FJG K;  4PUO A;  4CD1 A;  3BF3 A;  4EZ6 A;  4Z4F A;  3JAM O;  2YJF A;  3IMX A;  5EX5 A;  2X78 A;  3DM2 A;  3LM2 A;  5AZI B;  1BCO A;  1OH7 A;  4HCC A;  4BRM A;  4CF8 A;  4BR7 A;  4HWI A;  3THY A;  2P9U A;  4J8F A;  1TVR A;  3MN9 A;  3VQ7 A;  3NFA A;  1J54 A;  4DV4 K;  5AQW A;  3V6D A;  3ENH A;  4DTP A;  1BA1 A;  4MFB A;  4H5N A;  3OBW A;  3CPW M;  3C95 A;  2QXL A;  4CJV A;  4RW9 A;  4KBO A;  2CGL A;  1J5E K;  1W97 L;  3OTO K;  4PY5 A;  2PY5 A;  3OHR A;  3I0S A;  3ZET A;  3C6T A;  4DFK A;  3EE8 A;  3VQB A;  3WUH A;  2JWK A;  3MEC A;  3VGM A;  3CIP A;  3A5L C;  5I3U A;  2HHU A;  2O8B B;  4CEZ A;  3QIC A;  3U3Y A;  4FJI A;  4AHT A;  3IAY A;  1YIT N;  4M3X A;  3KWI A;  1VQ7 N;  2OPP A;  4JD2 A;  1WSH A;  3I55 N;  1LWE A;  3DXM B;  1BDG A;  2DFH A;  1Q82 O;  2F9W A;  1NOY A;  3AV9 A;  2UXD K;  4KAZ A;  3NH2 A;  1KCF A;  3J7A P;  1VQ6 N;  2FF3 B;  1XMO K;  1RBT A;  2HNY A;  3J7Z O;  1RTI A;  5BR9 A;  4M45 A;  1JL2 A;  3QNN A;  5GAG P;  2EWS A;  2PAV A;  3AA2 A;  3GDQ A;  4IO8 A;  1IV0 A;  1S9E A;  4DFM A;  1IKX A;  3DLR A;  2G8V A;  3ZCM A;  4BRF A;  4DLG A;  3UIQ A;  1YT3 A;  1Q18 A;  3O1B A;  1S1U A;  5KQD A;  1WB9 A;  3OYH A;  1JJ2 M;  5HL7 L;  3KK3 A;  4W5Q A;  4XH5 A;  4B1Y B;  4AQY K;  5I42 A;  4BRG A;  2D0C A;  4FM2 A;  4EIA A;  4BR9 A;  3NGY A;  4JS4 A;  4HVJ A;  3ZX3 A;  2VQE K;  2WOM A;  3SV3 A;  1T8E A;  4X64 K;  3CCS N;  3ATV A;  4LY7 A;  3H1Q A;  4Q5V A;  2QWM A;  3UE5 A;  4B9M A;  1KVB A;  3VF4 A;  3WT0 A;  4V19 S;  3A5M C;  1C1B A;  4QAG A;  2QM1 A;  3CXC M;  1CXQ A;  4K0K K;  2ASO A;  2KZZ A;  4RTF D;  3HPH A;  1T6C A;  4FWK A;  4Z4I A;  1HLU A;  4OO1 J;  5HBM A;  3RMB A;  1VSE A;  2V51 B;  4UY8 O;  2B4J A;  3RVC A;  4DS4 A;  5CYQ A;  1ZYQ A;  1JLG A;  1SL0 A;  3LDL A;  4YOV A;  4JKA A;  2O8C B;  2E2O A;  3CCE N;  4JNE A;  5CE3 A;  3ZLJ A;  3HK2 A;  1NKE A;  3HJF A;  3AO3 A;  1W7A A;  3KLE A;  2ZD1 A;  4IG3 A;  3I33 A;  4Q0B A;  2D0P A;  1V4T A;  4CF1 A;  3OS1 A;  4BC4 A;  4AF1 A;  3BUZ B;  1HUX A;  2Q1N A;  4O5F A;  4YOY A;  4AHC A;  4ISF A;  2HHW A;  3OYC A;  4CIF A;  1NGC A;  1I94 K;  2P5G A;  2Q36 A;  4NCG A;  3QB0 A;  4R5P A;  3IS9 A;  3OYL A;  3FZH A;  4IEI A;  4PQU A;  3DXK A;  5CZ2 A;  4CEF A;  2YNI A;  4JKG B;  3V9U A;  3DOL A;  1K9M O;  3L0Q A;  4NO7 A;  4CF9 A;  2X6N A;  3C7N A;  4Y0W A;  2UUB K;  3SQ4 A;  2NRR A;  4M63 C;  1LAW A;  2WON A;  3NVM A;  3L2W A;  4B1W B;  4FOI A;  2O8D A;  1YJ9 N;  4PKH A;  5GIO A;  1RT7 A;  4M7Y A;  4PHT X;  2QWL A;  4BDZ A;  1U2V B;  4HTL A;  4H0O A;  4EAH D;  4PKI A;  4A59 A;  1WSJ A;  4AHS A;  3HI0 A;  1L5U A;  3O3G A;  5BRD A;  1YUW A;  4KHU A;  2YNF A;  1RDU A;  1RBR A;  3V1O A;  3SAF A;  4OPH A;  4KI6 A;  4KO0 A;  1EWQ A;  5B8H A;  1JLQ A;  4M3T A;  4JYA K;  4CHP A;  4ISE A;  3T1A A;  3SBT A;  3KVG A;  3QET A;  2RKI A;  3HOS A;  3BGR A;  1A5W A;  1HPZ A;  3P5J A;  4MDB A;  2ZWH A;  5AZJ A;  4ICL A;  2HVI A;  3CCJ N;  1MDU B;  3EL2 A;  2D1K A;  3QIP A;  3CJC A;  4FJ7 A;  2Q2R A;  2GWJ A;  3BEX A;  4BRK A;  3THW B;  1LOT B;  4DQS A;  3H6E A;  3PY8 A;  4BRC A;  3O4Q A;  4G9Z A;  5BPM A;  1XHZ A;  1WSF A;  4CED A;  4RCH A;  4IKF A;  4N47 A;  3RSE A;  5FDL A;  2P9N A;  2VWB A;  3L4I A;  3RMC A;  3TAN A;  5C24 A;  3P1G A;  4DV5 K;  1KQS M;  1VQ5 N;  3R1X A;  4ID1 A;  2UYT A;  1K6Y A;  3H1V X;  2Z1G A;  3LM9 A;  3WEE A;  1ITG A;  4X62 K;  4C8L A;  2RE2 A;  4A5B A;  5KRS A;  4I9L A;  3HZ6 A;  3L3U A;  3RRH A;  2FSJ A;  3HST B;  2ZQB A;  4IG0 A;  1CLQ A;  3CF5 L;  4PA1 A;  2E20 A;  2RF2 A;  4I6M A;  4C8K A;  1CZ9 A;  1OVY A;  3ID8 A;  5ELZ A;  1RBU A;  1HNI A;  3RRG A;  3SLC A;  3HT3 A;  4DFP A;  2BDP A;  5M1P A;  1YTU A;  3LWM A;  3MN5 A;  1KTQ A;  2ATQ A;  3VOV A;  3MED A;  2ZJP L;  4IFE A;  4WFB L;  2YNH A;  4CVN E;  2P9I B;  3EE9 A;  1QSS A;  3LPT A;  3OW2 M;  3NBP A;  4KH5 A;  4KHS A;  5E41 A;  3LDO A;  2QA4 N;  3ZYY X;  4CZH A;  2IS3 A;  5J2N A;  2GEM A;  3FFK B;  4H0P A;  4CJ3 A;  1OH5 A;  1VRU A;  3SJH A;  3ZSR A;  3WXL A;  4E1N A;  4W5R A;  3CPE A;  1X1P A;  1KAX A;  1HYS A;  4ZTJ A;  5K14 A;  1ESV A;  3NDK A;  3LDN A;  5M1F A;  1JLF A;  3L8B A;  4MLH A;  1KD1 O;  1NGD A;  4J2D A;  3OYF A;  3PSI A;  2A1R A;  3HRG A;  2OPR A;  2XRI A;  3DLH A;  5C2D A;  4JI7 K;  3EYZ A;  4LF5 K;  2O8F B;  3K59 A;  2Q3S A;  3IG1 A;  4FLV A;  2ITM A;  4BRD A;  3LZJ A;  3CM5 A;  3OVN A;  3QFP A;  3MN7 A;  3Q7B A;  4FLW A;  2G8U A;  4J2E A;  3RMD A;  2QKB A;  4WF9 L;  4CZF A;  4B3R K;  1VSK A;  3D2F B;  1JLB A;  2PYL A;  3SUO A;  4CHN A;  1NKB A;  5M1O A;  5E26 A;  2A1S A;  1RDB A;  2A40 A;  2YHB A;  3LDP A;  3AO1 A;  4H5R A;  3DXM A;  4M3R A;  2F8T A;  4W5O A;  4BRI A;  4M3U A;  2P9P A;  4PKG A;  3AO4 A;  4FZX C;  1GLB G;  3GOI A;  3G25 A;  4LSL A;  3O8M A;  2DPN A;  3D0P A;  4JLH A;  1P8Z A;  5HRS A;  1TKT A;  2DFF A;  4IOX A;  3ZSV A;  1K73 O;  4CJK A;  4FK4 A;  5C2F A;  1T6D A;  3AO5 A;  4B9N A;  4N76 A;  4OLA A;  3SZ2 A;  2E6M A;  1UA1 A;  4M41 A;  4CI6 A;  5GAH P;  2NRH A;  1VSM A;  4A62 A;  3HPO A;  2IAJ A;  5IT9 O;  1LV5 A;  4LH5 A;  2IOC A;  4GV9 A;  4DSI A;  3JYT A;  4B9V A;  4X66 K;  4AHU A;  1NBW A;  1ATS A;  1N36 K;  5HLF A;  1Y97 A;  4BWJ A;  1BCM A;  4NLC A;  3ZT2 A;  2EX3 A;  1N32 K;  3VEY A;  1NK0 A;  3MXI A;  1NKC A;  1TKX A;  5TKW A;  3J7Y P;  3KD1 E;  3LDQ A;  1WSG A;  3AA4 A;  1Z25 A;  1GOC A;  4N56 A;  1G15 A;  3U4L A;  5JVG L;  3VQ5 A;  2UUC K;  1D9D A;  3M8Q A;  3KZB A;  3LP0 A;  4FJJ A;  3PV8 A;  3IDH A;  4QS7 A;  4F4K A;  3O9Q A;  4DR7 K;  1KAZ A;  1T05 A;  3U3G A;  1QSL A;  2AJQ A;  5AR0 A;  2Y1I A;  3SPZ A;  1VQO N;  3NF6 A;  3VQQ A;  2QKK A;  1MWM A;  4BRH A;  3V81 A;  2O8E A;  2WUS A;  1TYQ B;  2P9K B;  4DB3 A;  4CZK A;  3VTH A;  2NNW A;  2F4V K;  3AVN A;  3MEE A;  3I56 N;  4FJG A;  4BWM A;  3QDK A;  3ZSO A;  4CJQ A;  3O9R A;  4CFB A;  4DQP A;  4E7K A;  3NVK A;  4FWP A;  4IO9 L;  1QE1 A;  2FSN A;  2QWN A;  4L3Q A;  4NB4 A;  4FO0 A;  4M42 A;  4JRQ A;  4BR2 A;  3LWL A;  4G1Q A;  4JKC A;  4BRA A;  4LFA K;  5FRN A;  4CGH A;  2ITG A;  1C0G A;  2A42 A;  1TKZ A;  1FXX A;  1UOC A;  3UKU B;  1DGK N;  3LP2 A;  5SWM A;  3PO5 A;  1VQ4 N;  1TGO A;  3NMU A;  4EHT A;  4ILG B;  3CI5 A;  3CJA A;  1Q81 O;  3EY1 A;  1D8Y A;  1U49 A;  4KHY A;  4CZG A;  1C0M A;  3TWH A;  5F0X A;  3MEG A;  3PLA A;  5EY4 A;  1IKW A;  5DMR A;  3Q7C A;  3T3F A;  5C25 A;  4JKG A;  3FZK A;  4MO5 A;  4JK8 A;  4KRF A;  3H3N O;  3O5B A;  1HX1 A;  2HHX A;  4M3W A;  5JVH L;  4R79 A;  4QS9 A;  1BG3 A;  2VGN A;  1ATN A;  3FZF A;  4OJR A;  3TU5 A;  3SBG A;  3RR8 A;  5FRM A;  2KQ2 A;  2JWL A;  4LC9 B;  1U2V A;  2RHK A;  4A2B A;  4BVO A;  4CBX A;  2GUP A;  2R7Y A;  3V1Q A;  4CGF A;  1QZ6 A;  5FPD A;  1DEJ A;  3DLB A;  3H3O B;  3DMJ A;  1S1W A;  1C1C A;  1XHX A;  4EHU A;  4CEE A;  2GX9 A;  1Q9X A;  3I0R A;  2ZM6 K;  4WE1 A;  3NH1 A;  4FVM A;  1RTH A;  3K2P A;  3SQ0 A;  1HR0 K;  2V52 B;  3ULE B;  1HKC A;  3G6E N;  3OYI A;  1CZA N;  1BQN A;  1U4B A;  3VEW A;  1K8A O;  4WFN L;  4IOC L;  4WQ5 A;  1YF5 L;  4L8R B;  1IKY A;  4EP4 A;  4FLT A;  4JV5 K;  4DV1 K;  2NRW A;  3THW A;  1JXB A;  1LWC A;  3ULD A;  3VF6 A;  4ZHR A;  4PL7 A;  4FLZ A;  1HPM A;  4K8X A;  3WNH A;  3CHW A;  3MXM A;  4JHD B;  3PX6 A;  3CFP A;  1DT9 A;  1MWK A;  4YOX A;  3VQ4 A;  4GY2 B;  3S3O A;  2RN2 A;  1NLV A;  2YHX A;  3BY5 A;  2P51 A;  2LSN A;  3R3L A;  4CBU A;  3ITH A;  3WXI A;  2YHY A;  1RFQ A;  4ZTF A;  3U9Z A;  1YAG A;  3OYB A;  3K5L A;  3L3V A;  1KRP A;  3EKU A;  3QEX A;  4FXD A;  4W5N A; 
#chains in the Genus database with same CATH homology
 3G4S N;  4XH4 A;  1ATR A;  3FZH A;  1VQ9 N;  4JK9 A;  3P31 A;  1QQN A;  3HTV A;  1IG8 A;  1QQM A;  1K8K A;  4IEI A;  5BPL A;  1BWF O;  3DXK A;  1NMD A;  3HBT A;  4GV6 A;  4H0Y B;  2QWP A;  5AQU A;  1W2B M;  4BQZ A;  3VGK A;  4JKG B;  4A61 A;  3AGR A;  1K9M O;  3L0Q A;  4FWM A;  4BVP A;  3MMV A;  4NO7 A;  3CCQ N;  3F5T A;  1KXP A;  3C7N A;  3CET A;  4Y0W A;  2NRR A;  4M63 C;  2ZJR L;  3NVM A;  2P9S A;  3KHY A;  5GIN A;  1E4G T;  4B1W B;  1WOQ A;  3A5N C;  4IWV A;  4BQL A;  1SAZ A;  4FOI A;  4MDA A;  1YJ9 N;  4PKH A;  5GIO A;  3ZEU A;  3AGK A;  2E1Y A;  1NGE A;  1IJJ A;  2P9I A;  4M7Y A;  4FPA A;  4PHT X;  5AZJ B;  3O6W A;  3E9O A;  1NGF A;  3VES A;  5C15 A;  2QWL A;  2A5X A;  4BC2 A;  3S41 A;  1U2V B;  3D2E B;  5EOY A;  4HTL A;  4H0O A;  4EAH D;  4AM6 A;  4PKI A;  3M6G A;  3CER A;  5M1Q A;  4A59 A;  4NLB A;  5AQP A;  5KPR A;  3HI0 A;  3AAR A;  4B1Z A;  3O9T A;  3CQX A;  1YUW A;  3UB5 A;  5BRD A;  2FLO A;  1RDU A;  2HBJ A;  3SAF A;  4BGA A;  3FGU A;  5AQY A;  3VTI A;  2IVN A;  1GLA G;  4OPH A;  5AQI A;  1NGG A;  2QWQ A;  3O08 A;  3UKR A;  5B8H A;  4ISG A;  1X9J A;  4WYB A;  5AQM A;  3WXM B;  2IVO A;  3ZX0 A;  4ISE A;  3O4W A;  3SBT A;  3KVG A;  4GV3 A;  3RSE B;  2PFU A;  2Q0U A;  3HOS A;  4MDB A;  2P9N B;  2ZWH A;  2F9T A;  5AZJ A;  1YJN N;  1XQS C;  2PBD A;  3CCJ N;  1MDU B;  5CR4 A;  3O9S A;  2FF6 A;  3EL2 A;  4CD3 A;  2D1K A;  4KH6 A;  3CCM N;  3CJC A;  1NGA A;  1BOT O;  2HBL A;  2GWJ A;  2Q2R A;  3BEX A;  3W3D A;  4BRK A;  1LOT B;  4IJN A;  4GNI A;  2ASP A;  3H6E A;  1M1K O;  5AQL A;  4K42 A;  4O8U A;  4BRC A;  4G9Z A;  1X3M A;  4H0X B;  1Z6R A;  1NGH A;  2NRZ A;  5BPM A;  2ASM A;  1KC8 O;  4JKD A;  1VQK N;  2NRX A;  4XEI A;  4BRN A;  4RCH A;  4CZE A;  3RSE A;  5BPN A;  4FWR A;  1H1V A;  2P9N A;  4I6M B;  1J6Z A;  4WCE L;  2VWB A;  2KKZ A;  3L4I A;  4H5T A;  4BRE A;  3ENO A;  4FPB A;  3H46 O;  3TPQ A;  1NM1 A;  5M1N A;  3TTC A;  1VQ5 N;  1KQS M;  3A0I X;  3R1X A;  1R59 O;  2UYT A;  3VEZ A;  3IUC A;  3A5O C;  3H1V X;  3WXK A;  4BRL A;  2WC9 A;  4FWS A;  3AAP A;  3FR0 A;  3LM9 A;  3CQY A;  4WQ4 A;  3WEE A;  3EN9 A;  5FPE A;  2RE2 A;  4A5B A;  1BO5 O;  4CBW A;  5KQ8 A;  3HZ6 A;  3ENB A;  4BC3 A;  2FSJ A;  2J4R A;  4JK7 A;  5LY3 A;  3MK6 A;  3QBX A;  4JN4 A;  4YDU C;  3AY9 A;  3CF5 L;  2HOE A;  1K8K B;  4BRO A;  2IIR A;  4BRQ A;  2E20 A;  3SK3 A;  5GAD P;  4I6M A;  3MN6 A;  1HKB A;  1OVY A;  3ID8 A;  5ELZ A;  1VAZ A;  2WBN A;  3EZW A;  3HM8 A;  4H0V B;  3SLC A;  2ZJQ L;  3EO3 A;  2BTF A;  4FWN A;  3KK7 A;  5AQZ A;  3SMP A;  2ZGY A;  4IEE A;  1GLD G;  3EKS A;  5FPM A;  5M1P A;  3MN5 A;  5M1K A;  1QHA A;  2P9S B;  2NRT A;  3T69 A;  1YIJ N;  3VOV A;  4MLE A;  5E84 A;  1NGJ A;  5ADX A;  4JKF A;  2AA4 A;  2ZJP L;  5JMV A;  4IFE A;  3ZEU B;  3ID6 A;  3T7Z A;  5I9E B;  3TTD A;  4WFB L;  1BUP A;  4QS8 A;  2P9I B;  3EE9 A;  3CC7 N;  1HKG A;  1HJO A;  4B1U B;  3OBY A;  1S72 N;  3OW2 M;  4FWQ A;  4KH5 A;  4IDH A;  3WQU A;  2HF3 A;  3LL3 A;  3LDO A;  2QA4 N;  3ZYY X;  4CZH A;  2GEM A;  3FFK B;  4H0P A;  3VF2 A;  4E1J A;  3CC4 N;  3SJH A;  4A5A A;  2HBM A;  3ATU A;  4DKW A;  1VQ8 N;  5F2R A;  5AQT A;  3HOT A;  3WXL A;  1TUU A;  3CMA N;  4WFA L;  1VQN N;  5C10 A;  3CPE A;  3N4Q A;  2YHW A;  1KAX A;  3UKR B;  4A57 A;  1T3V A;  2H3G X;  1QVG M;  3CCU N;  5AFU H;  2CH6 A;  1ESV A;  4BR4 A;  1U6Z A;  3LDN A;  2V7Z A;  5M1F A;  2CGJ A;  3MX5 A;  3SMS A;  4MLH A;  5GAE P;  3B8A X;  1NGD A;  1KD1 O;  3HRG A;  3IKM A;  1JCG A;  5C2D A;  1E4F T;  3N4P A;  3E9L A;  3FZM A;  2QTD A;  2VCP A;  1P90 A;  4MO4 A;  3R9P A;  5HOO A;  2P9P B;  3CD6 N;  2KHO A;  2A6A A;  3GE1 A;  4DQ8 A;  2HST A;  2ITM A;  4BRD A;  2E2N A;  3QFP A;  3MN7 A;  3Q7B A;  4JKE A;  1KAY A;  5AQJ A;  4K25 A;  3CJ1 A;  3BF1 A;  4H03 B;  4Z94 A;  4WF9 L;  2BH1 A;  4CZF A;  1ILY A;  5BRH A;  3KWG A;  1Y64 A;  2P9L A;  4BG9 A;  5BN9 A;  3D2F B;  3VEX A;  4BC5 A;  3P39 A;  2QWR A;  3D6R A;  2HMP A;  5AQH A;  3D7E O;  3WQT A;  5JLF A;  3MX2 A;  4O8K A;  1VQP N;  2FSK A;  3H45 C;  4JKB A;  5M1O A;  3SAG A;  5E26 A;  4AM7 A;  2A40 A;  3LDP A;  4YOT A;  4H5R A;  3DXM A;  4FVU A;  2CH5 A;  3K9K A;  4BRI A;  2P9P A;  4PKG A;  1GLJ O;  1JCF A;  3MDQ A;  1GLB G;  3GOI A;  3G25 A;  4BGB A;  3MWP A;  3O8M A;  2DPN A;  4OPA A;  1P8Z A;  3VET A;  1NJI O;  1QVF M;  3WEE B;  3U8X A;  5AQS A;  3L6Q A;  3DJC A;  1RDW X;  4IOX A;  4EFH A;  2OTL N;  3QBW A;  3D2F A;  4K43 A;  1K73 O;  1C0F A;  3MCP A;  4YOW A;  2Q0R A;  5AQQ A;  5C2F A;  3R8E A;  1T6D A;  2HF4 A;  3ZX2 A;  3U9D A;  1N8R O;  3C6A A;  3OA9 A;  2OAN A;  2NRH A;  4CI6 A;  5GAH P;  1VQM N;  4A62 A;  1SQK A;  2E1Z A;  4IJA A;  4F9O A;  4H5W A;  3E9P A;  4GV9 A;  3GG4 A;  1MA9 B;  3DLL L;  3DWL A;  4JEP A;  2P9U B;  4WQ5 C;  3C0B A;  5JLH A;  1BU6 O;  1O13 A;  3TTF A;  4FWL A;  2YJE A;  1NBW A;  5BN8 A;  1ATS A;  4CZM A;  3TSQ A;  2ZF5 O;  5JIC A;  1YI2 N;  4NLC A;  2OTJ N;  3VEY A;  4WQ4 C;  3BF3 A;  4CD1 A;  5TKW A;  3VEO A;  4C23 A;  2YJF A;  2VYP A;  3IMX A;  4YOR A;  5EX5 A;  3LDQ A;  3WXJ A;  3C6H A;  4M7X A;  1JCE A;  4K41 A;  3GBT A;  1QZ5 A;  3MCA B;  4B1V A;  3U4L A;  3LM2 A;  5JVG L;  2I7P A;  3SAH A;  5AZI B;  3ZET B;  3FE1 A;  2QEX N;  4BRM A;  2QWO A;  3KZB A;  4BG8 A;  4BR7 A;  4HWI A;  2P9U A;  4U7B A;  4J8F A;  4BY9 C;  3IDH A;  3MN9 A;  3E66 A;  4QS7 A;  1ZXO A;  4IXC A;  2V7Y A;  5AQW A;  3JS6 A;  2ZGZ A;  2GEL A;  3ENH A;  4PL8 A;  3O9Q A;  1BA1 A;  4H5N A;  1KAZ A;  3OBW A;  3CPW M;  4C1N I;  2QXL A;  2E8A A;  5EVZ A;  5AR0 A;  4JD2 B;  3PIP L;  3ULE A;  4KBO A;  2CGL A;  1VQO N;  4JKH A;  5H1S Q;  1W97 L;  1SS6 A;  5AQK A;  4CZI A;  5DM7 L;  1SZ2 A;  1MWM A;  4BRH A;  2QI2 A;  5FPN A;  3OHR A;  3VER A;  5AQO A;  1M90 O;  4RWT A;  5DM6 L;  2WUS A;  5AZI A;  1TYQ B;  2P9K B;  3ZET A;  4DB3 A;  5AQF A;  4CZK A;  5AQG A;  3VTH A;  5GIP A;  2NNW A;  3EE8 A;  3WUH A;  2JWK A;  3TSP A;  1GLL O;  3I56 N;  4KH4 A;  3VGM A;  3CIP A;  3A5L C;  3QDK A;  2P9L B;  2NRV A;  3O9R A;  3E1Y A;  3VMF B;  3NVK A;  4FWP A;  4IO9 L;  3QIC A;  4DCH A;  5AQN A;  4DHY A;  2FSN A;  1G99 A;  1YIT N;  1X3N A;  2QWN A;  3CC2 N;  2GTD A;  4L3Q A;  4NB4 A;  1YVN A;  1YHQ N;  4ILH A;  5C0Y A;  3KWI A;  4FO0 A;  4ILJ A;  4B1X B;  4JHD A;  4BR2 A;  3BP8 A;  2CGK A;  3P4I A;  1VQ7 N;  4JKC A;  1NWK A;  3CJB A;  4JD2 A;  4BRA A;  4IOA L;  3I55 N;  4FWO A;  1C0G A;  2A42 A;  2GWK A;  3DXM B;  5ADX H;  1BDG A;  1Q82 O;  2F9W A;  3UKU B;  1DGK N;  3I8B A;  1WUA A;  2YCH A;  2NLX A;  1TYQ A;  2P9K A;  4H0T B;  4JAX A;  1VQ4 N;  1VQ6 N;  2FF3 B;  3NMU A;  4EHT A;  5CHI A;  3F9M A;  3J7Z O;  4ILG B;  2E88 A;  3CI5 A;  3CJA A;  3GL1 A;  3O9U A;  2IVP A;  5BR9 A;  1Q86 O;  3JXU A;  1XC3 A;  4U67 L;  1Q81 O;  3CCL N;  4BRP A;  4BR0 A;  1ZC6 A;  5GAG P;  2EWS A;  2PAV A;  3O80 A;  4CZG A;  5BRE A;  3GDQ A;  2QW9 A;  4IO8 A;  2W40 A;  5F0X A;  1VQL N;  3AAQ A;  1T44 A;  1TUY A;  5F1X A;  3PLA A;  5EY4 A;  3G71 N;  1QQO A;  3J8A A;  3M1F A;  3Q7C A;  1D4X A;  2A3Z A;  5BRF A;  4BRF A;  2YI1 A;  1GLE G;  4JKG A;  1EO1 A;  3FZK A;  4YOU A;  3F2K A;  2I7N A;  3UKU A;  4MO5 A;  4JK8 A;  1Q18 A;  3CCR N;  2AP1 A;  3H3N O;  3O1B A;  3O5B A;  1HX1 A;  5KQD A;  5JVH L;  4R79 A;  5TKY A;  1JJ2 M;  4QS9 A;  1YXQ A;  5HL7 L;  2YX6 A;  3O1W A;  3CME N;  1BG3 A;  3VPZ A;  2D0O A;  3QML A;  4XH5 A;  2VGN A;  4B1Y B;  4BRG A;  1ATN A;  1S3X A;  3FZF A;  3TU5 A;  3SBG A;  1DKG D;  4EIA A;  5LJV A;  4BR9 A;  2JWL A;  4LC9 B;  1U2V A;  3D2E A;  2RHK A;  3ZX3 A;  4A2B A;  4BVO A;  4C1N K;  1YJW N;  1Z05 A;  4CBX A;  2GUP A;  4B9Q A;  3QFU A;  3DAW A;  1QZ6 A;  5FPD A;  3CCS N;  1DEJ A;  1EQY A;  2HBK A;  3ATV A;  3CJ9 A;  3H3O B;  4FSV A;  5KPT A;  3H1Q A;  4CJ7 A;  3MWT A;  2QWM A;  3UE5 A;  4EHU A;  2GX9 A;  2VGM A;  3VF4 A;  3C65 A;  1S22 A;  3WT0 A;  5MLC Q;  5AQR A;  1OKJ A;  2Q97 A;  3VGL A;  3L4Q A;  4FL9 A;  3M5R A;  2V52 B;  4FOE A;  3A5M C;  3ULE B;  4IZ9 A;  1HKC A;  1ZBS A;  3G6E N;  1XUP O;  2QM1 A;  4A2A A;  1CZA N;  3CXC M;  3PIO L;  3VEW A;  1K8A O;  2ASO A;  3IFR A;  3VEV A;  4WFN L;  4IOC L;  4WQ5 A;  1YF5 L;  4RTF D;  1RGI A;  1LCU A;  1T6C A;  2BUP A;  4FWK A;  1HLU A;  1NGB A;  4OO1 J;  5EXW A;  1GLF O;  2NRW A;  2V51 B;  4UY8 O;  3RVC A;  3VF6 A;  2F7T A;  2E2Q A;  4GVE A;  4PL7 A;  3CJ7 A;  1HPM A;  1NGI A;  3A8Y A;  3LDL A;  5AQX A;  3K9J A;  1BA0 A;  3CCV N;  4YOV A;  2NZT A;  4JKA A;  2E2O A;  3CCE N;  4CZL A;  4JNE A;  5CE3 A;  3CHW A;  2Q31 A;  2WFB A;  4YDU A;  4H5V A;  1GLC G;  4JHD B;  2E2P A;  3DXK B;  5KPZ A;  5AQV A;  3TSU A;  1DT9 A;  2D4W A;  3R6M A;  1MWK A;  5AFU A;  3FLC O;  4YOX A;  3I33 A;  4GY2 B;  3VEN A;  2D0P A;  1V4T A;  1NLV A;  2KLA A;  3FZL A;  2YHX A;  4XH1 A;  4BR5 A;  3P38 A;  3C7N B;  3R3L A;  5C12 A;  4CBU A;  2FXU A;  3WXI A;  2YHY A;  3BUZ B;  4AF1 A;  4BC4 A;  5LJW A;  1HUX A;  3HSC A;  1RFQ A;  3W0L A;  2Q1N A;  1V4S A;  4O5F A;  4YOY A;  3U9Z A;  1YAG A;  4ISF A;  1Q7Y O;  3M3Z A;  1NGC A;  3EKU A;  2Q36 A;  4CZJ A;  3QB0 A;  2W41 A;  2A41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...