3H1QA

Crystal structure of ethanolamine utilization protein eutj from carboxydothermus hydrogenoformans
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
271
structure length
268
Chain Sequence
NAMELEQKLNLLNDLIVREIVNPLPPPYKVGVDLGTADIVLVVTDQEGIPVAGALKWASVVKDGLVVDYIGAIQIVRELKAKVERLLGSELFQAATAIPPGTNAEACGHVVAGAGLELVTLVDEPVAAARALGINDGIVVDIGGGTTGIAVIEKGKITATFDEPTGGTHLSLVLAGSYKIPFEEAETIKKDFSRHREIMRVVRPVIEKMALIVKEVIKNYDQTLPVYVVGGTAYLTGFSEEFSRFLGKEVQVPIHPLLVTPLGIALFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ethanolamine utilization protein EutJ
publication title Crystal structure of ethanolamine utilization protein EutJ from Carboxydothermus hydrogenoformans
rcsb
source organism Carboxydothermus hydrogenoformans z-2901
total genus 68
structure length 268
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14450 FtsA Cell division protein FtsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3h1qA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3h1qA02
1EQYA 5EY4A 2P9KB 5AQLA 5I9EB 3BF3A 2W41A 5AQSA 4H03B 3VF4A 1HUXA 3M1FA 4KBOA 5BR9A 1NGHA 4PKIA 4H5WA 5AQYA 4BVPA 1E4GT 2QXLA 2BUPA 3CHWA 1IG8A 4DB3A 4B1UB 4I6MA 3HZ6A 2V52B 1SQKA 3DXMA 4O5FA 4JD2B 4EHUA 2HMPA 1NGAA 2YHWA 4A2BA 2CH6A 3LM2A 4DQ8A 1K8KA 4M7XA 3D2FB 4BRMA 4FWLA 3QICA 1S22A 2YHXA 4ISEA 5AFUH 4BVOA 4CD3A 2NRHA 2A3ZA 2A5XA 3W0LA 4CD1A 1LOTB 2PAVA 2QW9A 2A6AA 3MN5A 4H0TB 2ZGYA 3TU5A 3MN9A 3VESA 3WQUA 5FPNA 1GLAG 4XEIA 3WQTA 4CZLA 1MWMA 1MA9B 3FZLA 3D2EB 3L0QA 3CIPA 1LCUA 3H45C 3WEEA 3VEWA 2W40A 4B1XB 3VF2A 1BWFO 4BQLA 4RWTA 4QS9A 1QQOA 4XH1A 4JHDB 3G25A 4H5VA 5JMVA 5AQNA 4H0OA 1GLLO 4J8FA 4O8KA 4B9QA 5F1XA 3RSEB 2UYTA 3L6QA 1QQNA 3F9MA 4FPAA 4BGBA 5FPDA 3HSCA 1XUPO 5KPZA 3JXUA 4FWRA 1ATNA 1U2VA 5AQJA 4BC3A 1HPMA 3GE1A 4FWPA 5EX5A 4CBUA 1SZ2A 1WUAA 3S41A 5BREA 2P9NA 3QBWA 3ULEB 2P9LA 2FLOA 5EOYA 4FWQA 3DAWA 3WXIA 1DKGD 3O1BA 2A41A 3H3NO 2F9WA 2A42A 2D0PA 3O6WA 3ZEUB 2AP1A 4BRDA 2FSNA 5AQUA 3R8EA 2P9KA 4GY2B 5AQTA 3WXLA 3B8AX 2CGKA 1S3XA 4PL8A 4XH4A 1ZXOA 2YJFA 2QWRA 4WQ4A 3I33A 3CETA 3A5MC 3EN9A 4EAHD 4K42A 3MMVA 2D1KA 3AARA 4BG8A 4JNEA 5BRHA 3DXKB 3WXKA 5AR0A 4IO8A 4CZKA 3ZX0A 3LM9A 1BG3A 1HX1A 4JD2A 4IJNA 3ZETB 2PBDA 5AQFA 4BRPA 2I7NA 1JCEA 1R59O 2ITMA 3O8MA 2Q0UA 3D2FA 2ZF5O 1BOTO 1CZAN 3QDKA 4A62A 4CJ7A 1E4FT 3VF6A 2QM1A 1KAYA 2WUSA 3KZBA 2ASPA 3QB0A 1NGDA 5F2RA 3M6GA 4CZHA 1NGJA 5ADXH 3VEXA 1X3NA 3D2EA 4BR0A 4B1YB 5AQMA 3SK3A 1U6ZA 5AZIB 1NBWA 3KHYA 1J6ZA 3CERA 4WQ4C 3TPQA 4BREA 3LDQA 4JHDA 4EHTA 4RCHA 3LDLA 3O5BA 2DPNA 4H0PA 2QWQA 1HKGA 3CI5A 3MCPA 4H5NA 4WYBA 3CQXA 4ISFA 5LJWA 2YJEA 4CZFA 3SMPA 3UKRB 2Q36A 2QWOA 2NZTA 1TYQB 5EVZA 3RSEA 4Z94A 5AQQA 3D7EO 2GWKA 4H0VB 5ELZA 1G99A 3QMLA 2FSJA 3SLCA 3ENOA 4FO0A 5KPTA 2GELA 2E1ZA 3GBTA 2NLXA 2VWBA 2VYPA 3C0BA 3A5OC 4K43A 3DJCA 5FPMA 1NLVA 3VEVA 4DHYA 4CBWA 3BEXA 1NGFA 4K41A 3H6EA 3VEOA 2QWMA 3VPZA 2P9PB 4FWMA 3BUZB 3CJAA 4NO7A 4WQ5C 1NGGA 3IMXA 4B1WB 1RDWX 3O4WA 3H1VX 4BC2A 3FZFA 5KPRA 2P9SB 3ZEUA 2Q97A 1Z05A 1BUPA 1ATRA 3GG4A 4A61A 4FWOA 2QWNA 1X3MA 1YUWA 2FF3B 3VEZA 4BRKA 3A5LC 4YDUC 3UE5A 1JCFA 1QHAA 4EFHA 3C7NB 1V4SA 3DXKA 3FZKA 2GWJA 3WXJA 4MO5A 2H3GX 1Z6RA 1C0GA 1YVNA 2EWSA 5AZJB 1GLEG 4PKHA 4FOIA 3FR0A 2IVPA 3VGLA 3AAQA 3ZETA 5CE3A 2CGJA 5LJVA 1YAGA 5AQIA 2CH5A 1D4XA 3ENHA 1NGIA 1T6CA 1GLJO 1ATSA 3O1WA 3EZWA 4BR5A 4CZJA 3FE1A 3HM8A 4QS8A 4IJAA 4A2AA 2ZGZA 3EKUA 3AAPA 3MN7A 2ZWHA 3HTVA 3ZX3A 4BG9A 3HI0A 3SMSA 3WUHA 1BA0A 4MLEA 2OANA 1TUUA 4FWKA 5BPNA 1XC3A 1DGKN 1ZBSA 3P4IA 4FL9A 4CBXA 1MDUB 4BRCA 1QZ6A 2GUPA 4MLHA 2P9IB 3AY9A 5AZIA 4AM7A 3UB5A 3R6MA 4FWSA 3LDPA 4HTLA 5AFUA 4MO4A 3M3ZA 4M7YA 3ATUA 4E1JA 4H0YB 1QZ5A 4BRQA 3UKRA 1TYQA 3FGUA 3VGMA 3WT0A 3VERA 1H1VA 2A40A 1HJOA 3A8YA 3W3DA 3UKUB 2E2QA 4M63C 2ASMA 3LDNA 1YXQA 2IIRA 1U2VB 5FPEA 3MN6A 4FSVA 2P9UB 3FFKB 3GL1A 4WQ5A 4EIAA 2I7PA 1HKBA 2FXUA 2P9PA 3CJ9A 3QFPA 2YI1A 1RFQA 4PL7A 3QFUA 4BQZA 3DWLA 2AA4A 2E2OA 3IDHA 2E2NA 5BRFA 3A5NC 2P9SA 4CZMA 1XQSC 4BRIA 2D4WA 5TKYA 1KXPA 4YDUA 3ZX2A 1SAZA 3A0IX 4BR7A 2GEMA 2J4RA 2GTDA 4IXCA 4C23A 1GLBG 3CJBA 2V7YA 5JLHA 3C7NA 2QWLA 3O80A 3GDQA 2IVNA 3FLCO 5LY3A 4QS7A 3EL2A 5AZJA 3U4LA 2V51B 1GLDG 2HF4A 4IWVA 4BRNA 3LL3A 2E1YA 1QQMA 1Q18A 1TUYA 5E84A 4RTFD 3OHRA 3ULEA 5B8HA 1BDGA 5KQ8A 2E88A 3U9DA 1NMDA 4XH5A 5AQVA 3VETA 4BR2A 1NGEA 4H0XB 3EKSA 3VENA 4K25A 4BRAA 2Q0RA 5AQPA 2D0OA 4CZIA 1KAZA 3ATVA 2Q31A 4FWNA 1GLFO 4LC9B 4BR9A 3H46O 1Y64A 3IFRA 1T44A 1DEJA 1NWKA 3FZMA 3VOVA 2QWPA 5F0XA 5AQZA 4CZGA 3L4IA 5AQRA 3U8XA 3HBTA 2P9IA 5KQDA 3KVGA 3CQYA 3IUCA 4PKGA 1BA1A 4CI6A 2KHOA 2FSKA 1BO5O 2YHYA 3R9PA 3J8AA 4IZ9A 2V7ZA 4I6MB 5AQWA 2HF3A 1RGIA 2F9TA 4BR4A 3DXMB 2BTFA 5BN9A 1NM1A 5E26A 3MK6A 1BU6O 1IJJA 3CJ1A 3MDQA 2E2PA 1K8KB 2E20A 4BRFA 3BF1A 5AQOA 3LDOA 5ADXA 3UKUA 5EXWA 3ID8A 4BRGA 1OKJA 2P9UA 2Q1NA 5BPMA 2HOEA 1NGBA 1C0FA 4BC5A 5BRDA 1V4TA 3WEEB 3H3OB 4FPBA 1HKCA 4B1ZA 1ESVA 3O08A 4BRLA 5BPLA 5AQKA 4Y0WA 4L3QA 4JN4A 4BC4A 4AM6A 1KAXA 1NGCA 5AQGA 3FZHA 4FOEA 1MWKA 3H1QA 5AQHA 2Q2RA 4H5TA 4JAXA 1JCGA 1GLCG 2E8AA 1HLUA 4ISGA 4GNIA 4BGAA 3BP8A 3VEYA 4NB4A 4B1VA 4CZEA 5JLFA 3EO3A 4BRHA 3SJHA 1P8ZA 2CGLA 4F9OA 5JICA 4H5RA 4HWIA 2IVOA 1ZC6A 3QBXA 1T6DA 2VCPA 3CJCA 3CJ7A 2P9NB 2P9LB 2ASOA 5BN8A 2YCHA 3GOIA 3JS6A 5AQXA 3VGKA 2FF6A 1X9JA 3U9ZA 1WOQA 4DCHA 3I8BA 4BROA
chains in the Genus database with same CATH superfamily
5FRMA 5EY4A 5I9EB 3BF3A 5AQSA 1IBMK 3VF4A 3M1FA 5BR9A 1NGHA 2X74A 1HNXK 4Z4HA 5I3UA 2QXLA 3MCAB 1GOBA 4IG3A 3AA2A 3L2QA 1IG8A 3CM6A 4CJ4A 3NHGA 5AJ3K 3DXMA 4A5BA 3PIOL 4BWMA 3SUOA 3Q7BA 3ZSQA 1NMNA 2WTUA 1DTQA 3RRGA 3P83D 2KQ2A 3KKSA 1IBKK 4W5OA 1S22A 4LFCK 4IG0A 1OH6A 4CD3A 2NRHA 2A5XA 3W0LA 3KD1E 3LAKA 3MN5A 4H0TB 2ZGYA 3SQ4A 3MN9A 3T1YK 3CCEN 3PY8A 4XEIA 4I9QA 4DSFA 3D2EB 3CIPA 3PLAA 1BI4B 3F2KA 4E7IA 2O8DB 1QQOA 4JHDB 3DLEA 3EZ5A 4DU4A 3RSEB 2UYTA 3ZSVA 1HMVA 4CGGA 1QQNA 4AH9A 3QNNA 3HSCA 1XUPO 4DTPA 1OH8A 3JXUA 4OO1J 1U2VA 2AJQA 4BC3A 1HPMA 1N34K 3NF7A 4CBUA 3ASMA 1WUAA 3ULEB 1RT6A 1OH5A 4B3SK 4FWQA 3DM2A 1HYVA 3DAWA 3WXIA 2D0PA 2ATQA 3OYNA 2FSNA 4GY2B 2RKIA 4YFUA 1Z25A 4CEEA 4WFBL 3LP1A 2HHHK 2YJFA 3I33A 3CETA 1TV6A 2NRWA 3A5MC 4EAHD 2WFBA 4K42A 3G71N 2D1KA 3AARA 4BG8A 2HNZA 4M3ZA 4B9UA 4X66K 1BCOA 4IO8A 1ASWA 1YTUA 3LM9A 2UXDK 4KB0A 1KD1O 1RTHA 4IJNA 1W97L 5AQFA 2I7NA 2RE2A 4FZYA 4KHUA 1LWFA 3O8MA 4WFNL 4DTJA 2O8CB 4E7JA 1CZAN 4A62A 4M3YA 4B3TK 3NGYA 2DFEA 4HVJA 3MEDA 3THVA 4FLTA 2RPIA 3QB0A 4KREA 4CZHA 3E1YA 1NGJA 4OJRA 1JJ2M 1S6PA 3D2EA 4QCLA 4JK9A 4A5AA 2IAJA 4KHNA 1BGXT 3LP3A 2GUIA 1RBRA 4CJPA 1K8AO 3TSPA 4DU1A 3N4QA 3CD6N 2O8DA 4JHDA 3M8SA 2F4VK 4E3SA 4CF8A 2OTLN 3CF5L 3RSEA 1TYQB 3MXIA 4Z94A 2WC9A 1G99A 2YNHA 3QMLA 3ZT1A 3CCUN 2FSJA 3P1GA 5KPTA 2GELA 2FBVA 4DTRA 1T3VA 4ELVA 2NLXA 3C0BA 5FPMA 2HHTA 3O4QA 4JLHA 2UUAK 1NGFA 3BUZB 5GAHP 1N32K 3CJAA 1BQMA 4WQ5C 4DTNA 4B1WB 4JRQA 3PUFA 3KLFA 4DF8A 3FZFA 4FLWA 2P9SB 5C10A 1VSIA 1UWBA 3O3GA 4CEAA 1U45A 3JAMO 1SS6A 3OYGA 4KH5A 4LSLA 1X3MA 4J2AA 2GV9A 4OKJA 4PUOA 1JCFA 1IH7A 1V4SA 3IS9A 3CG7A 4FJGA 1Z6RA 1S72N 5AZJB 2EWSA 3Q7CA 4M42A 3KLHA 1WNSA 3CFRA 1SKRA 2IVPA 2WONA 3TTDA 5LJVA 2W42A 3AVHA 3VQBA 4F3TA 5AQIA 2CH5A 5J1EA 1L3VA 5M1PA 3O1WA 4OPAA 2KFNA 3HM8A 4B9MA 2O8CA 3EKUA 3PSIA 5C2FA 3IRXA 3HVTA 3SQ1A 3ZSWA 3L3VA 1A5WA 3LP2A 2OPPA 4Z4FA 4FXDA 3AO5A 4M41A 1XC3A 3SZ2A 1JXBA 2UU9K 3AVGA 5J2NA 2B6AA 4FVUA 3R6MA 4PWDA 3LDPA 2KFZA 3U3GA 3RVCA 1YJWN 4DSLA 3CCJN 2XY7A 3M3ZA 1QZ5A 1J5EK 1TYQA 3U6FA 4C8KA 3FGUA 3VGMA 3AO2A 4B8CA 3AO4A 4CGFA 3A8YA 4M63C 4CGIA 4YY3K 4CJVA 2YV0X 2IIRA 1FKPA 3CC2N 1LWCA 4FK2A 4AF1A 2G8KA 5JS2A 2UUCK 2I7PA 1E3MA 1VK0A 3K5OA 1REVA 5GIPA 3ZSOA 3CYMA 2PZSA 3QFPA 3QFUA 3NH2A 1CXQA 1EX4A 5C42A 1N6QA 3IDHA 2YHAA 2P9SA 4CZMA 4BRIA 2D4WA 4BE1A 3VTIA 4CESA 4YOYA 3A0IX 2HNYA 5CYQA 4I2PA 4Q5VA 3CJBA 3ITHA 3ZCMA 2QWLA 3O80A 3FLCO 1D5AA 5LY3A 1RDBA 1IKXA 4JI8K 3MEEA 5AZJA 4Z4IA 2V51B 4IWVA 4BRNA 4FK4A 1J54A 3NF6A 1Q8IA 4G1QA 1S1WA 4DS5A 4C8MA 1JLCA 1UOCA 5KQ8A 3VETA 5E41A 1NK4A 1NGEA 4H0XB 3EKSA 3MX2A 4YORA 4K25A 4PQUA 3SV3A 2Q0RA 4DS4A 4KTZA 4ICLA 3OYEA 2Q31A 3TANA 3OA9A 3QLHA 2UUBK 1XI1A 3H46O 1YVUA 4KTQA 4Q0BA 5IWAK 2QWPA 3ZLJA 5SWMA 2VG6A 3SAHA 3DLBA 5CY4A 2KHOA 2NRVA 5FDLA 3R9PA 3AVFA 3VQQA 1RGIA 3KTQA 1G15A 2YX6A 4DG1A 2KLAA 4QAGA 1IJJA 3HRGA 3CJ1A 3RMAA 3VQ6A 5AQOA 3LDOA 4HUEA 5EXWA 3HPOA 4FM2A 4CHPA 1JL2A 2HOEA 5FROA 1NK0A 1C0FA 4WCEL 4CVNE 4FK0A 1TL3A 4IKFA 1V4TA 4I2QA 4N56A 4FJLA 3QESA 5IT9O 4IDHA 1NK9A 2IC3A 4EZ9A 4DLGA 1Q7YO 4JKDA 1KAXA 4GV9A 4H5TA 1BL3A 4HCBA 4CFAA 1X9MA 2O8EB 2E8AA 1VRTA 4GNIA 3M8RA 1BQNA 4B1VA 4FLZA 1WLJA 4DV4K 4BRHA 4OGCA 1VSKA 2FBTA 4M3TA 3AVNA 4H5RA 4HWIA 5HRRA 3OYCA 1T6DA 2VCPA 3CJCA 1X9WA 1Q9XA 4MDAA 3RMCA 4JKBA 3GOIA 3VGKA 4O5BA 2YNIA 4NXNK 3I8BA 5DM6L 4DV7K 2IS3A 3QEIA 2D0AA 3TI0A 2GBZA 4CJKA 2QKBA 5AQLA 3SUQA 2W41A 4CJTA 1L3TA 4KBOA 5AQYA 1TKTA 4H5WA 4DUZK 4BVPA 4J2DA 1E4GT 4BDZA 1EKEA 4NLCA 3VTHA 3F73A 4W5RA 3HJFA 3QINA 1JXEA 4B1UB 3NGIA 3AVLA 1CZBA 1SQKA 4E89A 3MAQA 2R7YA 3OJUA 2HMPA 4LFAK 3TARA 4CHNA 2D0BA 3HP6A 3SI6A 2CH6A 3LM2A 4JI2K 3KWIA 5GINA 4BRMA 2YHXA 4ISEA 4GW6A 3LWLA 2O8BB 4DTUA 1NJXA 4O8UA 4OKKA 4DSKA 4LF4K 2D5RA 5SZTA 3QNOA 3O3HA 1GLAG 4CK3A 3VQ5A 4CZLA 1RBTA 3F9KA 5C2DA 1KSPA 1LCUA 2W40A 4DMNA 4IO9L 4W5QA 3WNFA 3ZYYX 4RWTA 3OYDA 1XMQK 3G25A 3V81A 1I3AA 5J2MA 4H0OA 3PO5A 3E9LA 1GLLO 1Q81O 1IKYA 2P1JA 4KO0A 4B9QA 1FK9A 2O8EA 4CF1A 1QQCA 3K59A 5JVHL 4B9NA 4FZXC 3TAPA 4LF6K 4FWRA 4DQPA 5AQJA 3GE1A 4FWPA 1S9GA 4DV1K 3CXCM 4DR7K 3NFAA 3O9QA 1SZ2A 2HNDA 4CIEA 5GADP 3V9XA 5BREA 3QBWA 3OYAA 3HPHA 4LF9K 3O4NA 1SKWA 4CECA 3O6WA 2YNFA 2AP1A 4LH4A 4BRDA 3NMUA 5AQUA 5AQTA 3WXLA 1P90A 3B8AX 3NCIA 1S3XA 4JV5K 1QHTA 3A2FA 4XH4A 2A1SA 1QTMA 1ZXOA 2QWRA 3OYFA 3N4PA 2F96A 4U67L 1BHLA 1RT2A 2HHWA 3HO1A 3LWMA 2X78A 4JNEA 3OYHA 4CK1A 1RDUA 3WXKA 4CF2A 1BCMA 5AR0A 3KLGA 3K57A 1NNEA 3S3OA 4IEIA 1EETA 1L5UA 4CE9A 3ZETB 2PBDA 1EWRA 4CJEA 4CJSA 3SAFA 1VQPN 1NK8A 4FJIA 4CJ7A 3TSUA 3VF6A 2QM1A 4W5TA 5HBMA 3DRRA 3KZBA 4IDKA 3T69A 5DK5A 2HHSA 3MX5A 2FBYA 3C6UA 2DFFA 4IEEA 3THYA 3SQ2A 4N41A 4BR0A 5AQMA 3CERA 3L3UA 1KC8O 3TPQA 2ZJPL 4DKWA 3LDLA 3E66A 2W6LA 4B3RK 3CI5A 1HKGA 4JYAK 4PHTX 4FLUA 5KGWA 5LJWA 3RWUA 2YJEA 4CZFA 3UKRB 2NZTA 5EVZA 5GAEP 5HRSA 2EHGA 1YTAA 2HBMA 4FO0A 2UXBK 1JKHA 4FLYA 2A1RA 1KVBA 2VYPA 4GKJK 1NKEA 3FFIA 4DHYA 3AGKA 1VQ5N 3BEXA 4DU3A 4EP5A 3H6EA 5KTQA 4FWMA 2HBJA 4AQYK 1RTIA 3T1HK 1RDWX 3O4WA 5C15A 5KGXA 4CJ3A 4ILGB 4JKHA 5KPRA 2Q97A 1Z05A 4IFEA 1ATRA 3GG4A 3IKMA 4A61A 2Q3SA 1WSJA 4OKEA 4RG8A 1IV0A 2QXFA 1YUWA 2FF3B 4AILC 3V9SA 3A5LC 4YDUC 3UE5A 4H8KA 2Y1JA 1Q82O 4DV3K 4PKHA 2YKMA 4YOTA 2YKNA 3ZETA 3SUPA 1D4XA 1TK8A 3ENHA 1RDCA 1IKVA 3CQ8A 4DV6K 4UY8O 4DR5K 3FE1A 4H4OA 4IJAA 4CJFA 3OYLA 4KAZA 3ZX3A 4BG9A 1FXXA 1ZBIA 4O0JA 2JWKA 3THXB 4DV5K 1RT7A 4JI6K 3WUHA 3DI6A 4CGJA 2OANA 1RTJA 1VQLN 1QE1A 1DGKN 1QZ6A 2GUPA 4MLHA 2P9IB 1B9FA 1JLAA 3MECA 4AM7A 4DF4A 3HVRA 1WSHA 1VQ8N 1RILA 1C0MA 5AFUA 1O13A 1JLBA 4H0YB 3UKRA 2XHBA 3AVCA 1BISA 3ZSYA 2XY6A 3TAQA 3WT0A 3VERA 1H1VA 2A40A 1SKSA 3UKUB 3LDNA 3QIOA 4RW8A 1YT3A 2P9UB 3GL1A 3ZSRA 4WQ5A 1QSLA 4DR4K 2FXUA 4JI0K 3OTOK 1BI4A 1SV5A 4F2RA 3RMDA 3BY5A 2XY5A 4O0IA 4NCGA 4DSIA 3SUNA 1SAZA 4ELUA 1XNQK 4HUFA 4BR7A 2GEMA 2J4RA 3L2WA 4NLBA 4IXCA 3VQCA 1GLBG 1C1AA 5C12A 1O1WA 3JYTA 4FJKA 5CHIA 1Z26A 2IVNA 2B4JA 4QS7A 3EL2A 4OVLA 3LL3A 3PO4A 5H1SQ 1Q18A 1TUYA 4ELTA 4RTFD 3I0SA 3OJSA 2RF2A 3ULEA 3S3NA 1BDGA 4XH5A 3R3LA 3HK2A 1WBDA 3VENA 3MEGA 4AHCA 4BRAA 1KAZA 3K5NA 2PFUA 3ATVA 3KJVA 4FWNA 2QK9A 4KB1A 4JS4A 3P38A 5GIOA 1WSIA 1TAUA 1W0HA 1XNRK 2YNGA 4CHQA 1DTTA 5AQZA 5AQRA 2P9IA 5KQDA 1TL1A 4PKGA 4FM1A 4M3WA 2FSKA 1BO5O 1WB9A 2YHYA 1C0UA 2V7ZA 1GOCA 1RT4A 3VQ8A 2HF3A 5AQWA 2O8FB 5E26A 1KRPA 1TK5A 1BU6O 3AA3A 2IGIA 3NGZA 4GV6A 2HVHA 2ZD1A 1K8KB 4JK7A 1HPZA 4E7KA 4FZZA 3SJJA 3JSMA 3HXMA 2QEXN 3UKUA 2ZE2A 3ID8A 1N36K 1YJNN 2P9UA 4FJMA 5BPMA 3CMAN 3VQ7A 3HOTA 4BC5A 5BRDA 3E01A 3G10A 1U47A 2E6LA 2F7TA 5BPLA 4FPBA 4DR2K 3PX4A 4L3QA 3I8DA 5HP1A 1N5YA 3G0ZA 3FZHA 4FOEA 1MWKA 3H1QA 5C24A 5LL6Z 1W7AA 3DLRA 4G9ZA 4MFBA 3RMBA 4BGAA 3BP8A 3QEVA 2HSTA 3J7ZO 4GMJB 4FW1A 3KK2A 3SJHA 1EO1A 5HLFA 3QBXA 3BGRA 4N76A 2P9NB 2P9LB 3VN5A 2ASOA 5LMUK 2E5LK 5CR4A 3JS6A 5AQXA 3LPTA 1X9JA 2E4LA 4LFBK 4DCHA 2GX9A 1LWEA 1EQYA 2P9KB 3L2RA 5M1FA 1S6QA 3OYIA 4H03B 1HUXA 1KCFA 3KKRA 1T7PA 2BUPA 4KI4A 3CHWA 4CF9A 4O44A 2F8TA 4DB3A 1KFSA 1YF5L 2ETJA 3PX0A 3KK1A 3OBYA 3CCVN 1QS4A 2KTQA 3PV8A 2O8FA 4O5FA 4JD2B 4K8XA 1JLFA 3VQAA 3CCMN 2HB5A 3WNHA 1NGAA 2YHWA 3AVKA 4NYFA 3KIOA 1K8KA 1IG9A 4M7XA 2KZMA 3D2FB 3ID6A 5AFUH 4BVOA 3J80O 2A3ZA 4IFVA 4CD1A 1NU0A 2A6AA 2QW9A 4W5NA 4KH4A 2EX3A 1NOZA 4M3UA 3RR8A 1KTQA 5FPNA 1YITN 4CFBA 3FZLA 3O3FA 3EYZA 3L0QA 1VSFA 3TAGA 3VF2A 1JLGA 4CJWA 2WOMA 1WSFA 1ZBUA 3O9RA 1RT5A 4IFYA 5AQNA 4J8FA 4O8KA 2OA8A 4FJHA 3C6AA 4FPAA 4BGBA 5FPDA 5D3GA 3HOSA 4DFMA 2I5JA 4AHTA 4YOVA 1B92A 4JKEA 1VQ9N 5EX5A 4R79A 1CXUA 2P9NA 4KHSA 2P9LA 3NH1A 3M5RA 1RBUA 2BDPA 4TSXA 5EOYA 2JLEA 3VQEA 2HHQA 3THWB 3UIQA 2DY4A 4JI7K 2QTDA 4JI5K 2G8VA 3ZEUB 3R8EA 2P9KA 1VSEA 4HCCA 2OPQA 1NKBA 5K14A 4WQ4A 4CK2A 2XRIA 2YHBA 4Z0UA 2VQFK 3T3FA 4B3OA 4Z4EA 1NK7A 1HRHA 3LPUA 2F8SA 4JI3K 4IOXA 4JD2A 4ID5A 1RT1A 3C6TA 2O4GA 1R59O 4B3MK 4OPKA 2ITMA 3C6HA 2VWJA 1S1TA 3D2FA 2ZF5O 3AVBA 4CFDA 3G6EN 3O9TA 1E4FT 2DTUA 1KAYA 2WUSA 4IOCL 2OCEA 4B9LA 2ASPA 4DTXA 1OVQA 1UA0A 3M6GA 4CERA 4FLXA 2KW4A 3L2UA 3C94A 1RBVA 3AO1A 4B9TA 2VG7A 4KI6A 1X3NA 2JGUA 4DLEA 3DOKA 4B1YB 3SK3A 2QI2A 1RTDA 1NBWA 3DLKA 1J6ZA 4E7HA 1NJYA 3EE8A 4WQ4C 4AHRA 4CJLA 4BREA 3LDQA 1U04A 3NH0A 4L8RB 1WBBA 5HL7L 3O5BA 4CHZA 2DPNA 4H0PA 2QWQA 2HHXA 4ISFA 3KK3A 2HW3A 3K2PA 3QO9A 4RW9A 3SMPA 1Q9YA 2ZJRL 1VQ6N 4AHVA 1X9SA 5FLXO 4LSNA 3D7EO 2GWKA 3WNGA 4H0VB 4E19A 5ELZA 4EZ6A 1VSHA 3ENOA 3SLCA 2UXCK 3VMFB 3A5OC 4K43A 3QEPA 1S9EA 3VEOA 4K41A 4F8RA 2QWMA 3KLIA 2P9PB 1U4BA 4H4MA 3CC4N 3D45A 1X1PA 1KFDA 3THWA 1J9AA 1IO2A 4BC2A 3EEQA 3OS2A 4F2SA 3ZEUA 1MU2A 3L4QA 1M90O 1BUPA 2JWLA 4J2BA 4DR1K 4AHSA 4FWOA 4KHWA 2QWNA 3LAMA 1NOYA 5C0YA 3QERA 3BZKA 4EFHA 3FZKA 2XY8A 4B9SA 2H3GX 1C0GA 1YVNA 1GLEG 4A57A 3FR0A 2IDOA 4FJ5A 3VGLA 5CE3A 2CGJA 3CM5A 3K9JA 3CCSN 4FJ9A 1NK5A 1VAZA 3EZWA 3F5TA 4BR5A 1WAJA 4A2AA 4KFBA 2ZGZA 3AAPA 2ZWHA 1TVRA 3HTVA 1YJ9N 3OY9A 3HI0A 2VWKA 1WSGA 4N5SA 2VGMA 2FBXA 1VSLA 4JI1K 3OVNA 5HRNA 3V9ZA 4FWKA 3ENBA 1ZBSA 3P4IA 3ULDA 4BRCA 1XWLA 3AY9A 5T7BA 3IAYA 3UB5A 1XC9A 4OPHA 4FWSA 1U48A 3VA0A 4MQ3A 3ATUA 1CZ9A 4E1JA 4BRQA 4PA1A 3WXMB 3T7ZA 1BIUA 2PYLA 4DR6K 1XHXA 2O8BA 1ZYQA 1K9MO 1HJOA 1SL2A 5HRPA 1ASUA 1U2VB 5FPEA 4JEPA 1KLMA 1TKZA 4CHYA 1T03A 4CGHA 5M1OA 2P9PA 4LD0A 1CLQA 2YI1A 1RFQA 4PL7A 4BQZA 1Y97A 1F21A 3DWLA 5BR8K 2AA4A 4NCAA 3HPGA 2E2OA 1W2BM 5BRFA 4YOWA 1XQSC 4JKFA 1LAWA 4CEDA 3NBPA 1C0TA 4YDUA 2KZZA 1RBSA 3ZSXA 2GTDA 5M1NA 4C23A 4F4KA 2V7YA 5JLHA 4BWJA 3DOLA 3KLEA 3GDQA 4RW4A 4FJXA 4JKGB 1C1BA 3D6RA 3CPWM 4O55A 5DMRA 3U4LA 3P39A 4CEQA 2E1YA 3HP9A 1QQMA 4O4GA 1LV5A 5E84A 3OW2M 3OHRA 3C65A 5B8HA 4C8LA 3U9DA 3M8QA 4GV3A 2XO7A 4WFAL 3AA4A 1L3SA 2D0OA 4CZIA 1QSYA 2OPSA 4LC9B 4BR9A 1UAXA 1ASVA 4IBNA 1Y64A 1FJGK 3IFRA 3M8PA 1T44A 3V1OA 3V4IA 3VOVA 3MWPA 1YIJN 4DTSA 3V1RA 3L4IA 1Q86O 3HBTA 2Z1GA 3EY1A 1OH7A 2G8IA 3CQYA 3IUCA 4ZTJA 1U49A 1XMOK 4DR3K 3ZT2A 3SV4A 3J8AA 4I6MB 4BR4A 3OBWA 2F9TA 1TKDA 2BTFA 3NVMA 3MK6A 3KWGA 3NDKA 4HHTA 3AGRA 4A59A 4DQIA 4CJQA 2BGGA 3BF1A 4K0KK 3DLHA 4JKCA 5ADXA 1TKXA 4CHOA 4BRGA 1OKJA 2QA4N 4FJ8A 2VGNA 3AVAA 4ZTFA 3D0PA 5C25A 1NGBA 3OYBA 3U3YA 1I39A 3L8BA 3WEEB 1HKCA 4KV8A 3O08A 4BRLA 3TR8A 4J2EA 4Y0WA 1KLNA 4KHYA 4JN4A 4BC4A 1LAVA 1HJRA 4AM6A 3TABA 1VQ4N 4V19S 1NGCA 4EP4A 4AHUA 1LW0A 2NUBA 5AQHA 1M1KO 2O4IA 2Q2RA 4JAXA 1JCGA 1GLCG 4FM0A 4OX9K 1HLUA 3P31A 1VRUA 3VA3A 3VEYA 4DFPA 4IOAL 4NB4A 4CZEA 4JKGA 4M3XA 3S3MA 1S1VA 4F9OA 5KRTA 3K0SA 1RDDA 4GVEA 5JICA 1R0AA 2IVOA 3E9PA 5HOOA 4BY9C 4U7BA 3PSFA 5BN8A 2YCHA 4KTWA 2FF6A 4ILJA 3NF8A 5EU7A 3U9ZA 1WOQA 1VQMN 4BROA 4GVMA 4KHQA 3NAEA 2ZQBA 2NRXA 5KI6A 2B5JA 4KHPK 3VQDA 1K6YA 3CCQN 2PY5A 3I0RA 1HQUA 4FJJA 4PKIA 5FRNA 3SAGA 2OPRA 3E9OA 4ZHRA 4DQRA 4X64K 5I42A 4I6MA 3HZ6A 2V52B 4EHUA 2X6SA 4B8AB 3AVMA 4A2BA 3T19A 1WN7A 4DQ8A 4CEFA 4FWLA 3QICA 1RNHA 1K73O 1IBLK 2NNWA 1VSMA 4F3OA 1A5XA 4DV0K 4DFKA 3THXA 1LOTB 2PAVA 4FVMA 3B6PA 4DQSA 3TU5A 4OPJA 3VESA 3WQUA 4Y1DA 2ITGA 5A2QO 3WQTA 1S5JA 3PX6A 1VQ7N 1MWMA 3ZT0A 3AVIA 1MA9B 1L3UA 3NF9A 4RW6A 3QEWA 5TKWA 3H45C 3WEEA 4B1XB 3VEWA 1BWFO 2HBKA 4FJNA 4YOUA 4BQLA 3K5MA 4QS9A 4XH1A 4JRPA 4DSEA 2OYQA 3SPZA 4H5VA 4FLVA 5JMVA 4NCBA 4BDYA 2IOCA 5KRSA 4X62K 1J5OA 3VQ9A 4DSJA 5F1XA 4JKAA 4KH6A 3L6QA 3F9MA 1WSEA 3V9UA 1C6VA 5KPZA 4C8OA 4BACA 4NYNA 1ATNA 4YNQA 3KD5E 3SBGA 3J7AP 4YOXA 4FW2A 2OZMA 1TGOA 4OLAA 2E6MA 2NRTA 3S41A 3OS1A 3HT3A 1DT9A 1S1UA 3L2VA 2FLOA 4OLBA 1KQSM 4DTMA 3NVKA 3AO3A 3QEXA 1DKGD 3KK7A 3O1BA 3LZIA 1GOAA 1ZBLA 2A41A 3H3NO 1VSJA 2F9WA 2A42A 2VQEK 2PYJA 4HUGA 1EXQA 4CEBA 2CGKA 1QVGM 3O9UA 4NXMK 4PL8A 4GKKK 4QOZB 3I56N 4FYDA 3EN9A 1HNWK 3MMVA 4CW7B 5BRHA 4MDBA 3DXKB 4OGEA 4CZKA 3CMEN 1W9HA 3ZX0A 1BG3A 1TK0A 1HX1A 3ALYA 2Z1HA 3G4SN 3SYZA 4BRPA 2NRRA 3HSTB 2OTJN 1JCEA 3T1AA 2Y1IA 2Q0UA 1VQKN 1BOTO 4X65K 3QDKA 1TAQA 3DMJA 1OVYA 3ISNC 2G8UA 1NGDA 5F2RA 4K8ZA 4E7LA 1D8YA 5ADXH 3VEXA 1KVAA 1JLEA 4CJRA 1U6ZA 1HYSA 5AZIB 3ZT4A 1D9FA 3KHYA 2D0CA 3H08A 2ZM6K 4EHTA 4RCHA 2G8WA 3TWHA 1FKOA 3MCPA 4H5NA 5M1KA 4WYBA 1N8RO 3CQXA 3VQPA 1HR0K 4Y1CA 2Q36A 2QWOA 1VQNN 3R1XA 5AQQA 3SNNA 4Z4CA 4BE0A 3CCRN 2WBNA 2E1ZA 3HYFA 3GBTA 2VWBA 4DTOA 4CIFA 3DJCA 1NLVA 3VEVA 4DUYK 1QSSA 1B9DA 3RR7A 4CBWA 4CFCA 3TTFA 3VPZA 3QETA 3MXMA 1NJZA 3OYKA 4NO7A 1BIZA 1NGGA 4YHHK 3IMXA 4B9VA 3H1VX 5CZ2A 3HM9A 3SPYA 2BH1A 4JS5A 3LZJA 3CC7N 3VEZA 4CEZA 2RN2A 4BRKA 1QHAA 3C7NB 3OYJA 3DXKA 3WXJA 2GWJA 4MO5A 2QKKA 3CFPA 4FOIA 3LALA 5MLCQ 4DV2K 3AAQA 1YAGA 1C1CA 3AA5X 3TAEA 1NGIA 1T6CA 1GLJO 1ATSA 1RCHA 4CZJA 4XIUA 4M3RA 4C1NI 4QS8A 1ILYA 1ZBFA 3MN7A 1HQEA 2Z1IA 4E0DA 3SMSA 2W6KA 4UQGA 3DRPA 3K58A 3TAFA 1EP4A 1SL1A 1T8EA 1BA0A 1S1XA 4MLEA 3V9WA 1TUUA 5BPNA 2RHKA 1I94K 4FL9A 4CBXA 1MDUB 4DFJA 5DM7L 5AZIA 4N47A 1JLQA 3AV9A 3OS0A 4LH5A 1VHXA 4FJ7A 4M45A 2NRZA 4HTLA 4R5PA 4WF9L 4MO4A 5CZ1A 2HHVA 4M7YA 1UA1A 3DRSA 2HMIA 4DQQA 2BE2A 3ZSZA 2P51A 1HNVA 3W3DA 1QVFM 2E2QA 3SBTA 2ASMA 1YXQA 3PIPL 4HTUA 4E1MA 3SQ0A 3MN6A 4FSVA 3FFKB 2G8HA 4EIAA 1J53A 4JK8A 1HKBA 2X6NA 3TAMA 3V6DA 3CJ9A 4CJUA 4WE1A 3DYAA 1SL0A 1NKCA 3IG1A 4CEOA 5JS1A 1HYZA 2E2NA 3CCLN 3A5NC 3OYMA 1YI2N 3V1QA 5TKYA 3CFOA 3I55N 1KXPA 3ZX2A 1HNZK 1RT3A 1NG9A 4ILHA 3C7NA 5HROA 4E1NA 1RDAA 5GAGP 2BANA 1WAFA 4CGDA 1GLDG 4KRFA 2HF4A 3LANA 5JVGL 3WNEA 3O9SA 2E88A 4I7FA 1NMDA 2Z1JA 5AQVA 1HNIA 4BR2A 3AVJA 4LF5K 1KVCA 3QIPA 5AQPA 3TSQA 3ZT3A 3EE9A 1LW2A 2OZSA 3BDPA 1GLFO 2G8FA 1DEJA 1NWKA 3FZMA 4CIGA 4LY7A 5F0XA 3THYB 4JI4K 4CCHA 4CZGA 3U8XA 3KVGA 4LF8K 4B08A 1BA1A 5M1QA 4CI6A 3RTVA 2FC0A 4IZ9A 4KPYA 3DXMB 5BN9A 1NJWA 2P5OA 1NM1A 4CF0A 3MDQA 3LDSA 2E2PA 4BRFA 2E20A 4I9LA 3S9HA 4C8NA 4PY5A 3CPEA 4CJ5A 1EWQA 1ZBHA 1NJIO 2P5GA 3P5JA 1D9DA 1ITGA 3J7YP 2VG5A 4FCYA 2Q1NA 1VSDA 3NE6A 3K9KA 1DLOA 1SUQA 4Z4GA 3BZCA 5J2QA 3RRHA 4KKOA 3H3OB 4B1ZA 1ESVA 3K5LA 1NK6A 5AQKA 3VQ4A 4BDPA 3MXJA 3HL8A 3TTCA 3DLLL 4RW7A 2HHUA 3B6OA 5LMNK 3C95A 5AQGA 3LP0A 1T05A 1JL1A 4C1NK 4BE2A 4ISGA 4ID1A 1FW6A 5JLFA 1XHZA 2HVIA 3EO3A 3MWTA 3J81O 1VQON 1A5VA 1P8ZA 2CGLA 3SCXA 4DWIA 1IKWA 2HBLA 5J2PA 1ZC6A 3DLGA 2KKZA 3CJ7A 2DFHA 1YHQN 2ZJQL 2LSNA 4LF7K 5CYMA 1N33K
chains in the Genus database with same CATH topology
1EQYA 5EY4A 2P9KB 5AQLA 5I9EB 5M1FA 3BF3A 2W41A 5AQSA 3CCQN 4H03B 3VF4A 1HUXA 3M1FA 4KBOA 5BR9A 1NGHA 4PKIA 4H5WA 5AQYA 4BVPA 1E4GT 3SAGA 2QXLA 4NLCA 3VTHA 3E9OA 3MCAB 2BUPA 3CHWA 1IG8A 4DB3A 1YF5L 4B1UB 4I6MA 3HZ6A 2V52B 3OBYA 1SQKA 3CCVN 3DXMA 4O5FA 4JD2B 4A5BA 4EHUA 3PIOL 2HMPA 3Q7BA 3CCMN 1NGAA 2YHWA 4A2BA 2CH6A 3LM2A 4DQ8A 3KWIA 1K8KA 5GINA 4M7XA 3D2FB 4BRMA 4FWLA 3QICA 1S22A 2YHXA 3ID6A 4ISEA 5AFUH 1K73O 4BVOA 2NNWA 4CD3A 2NRHA 2A3ZA 2A5XA 3W0LA 4CD1A 1LOTB 2PAVA 2QW9A 2A6AA 3MN5A 4O8UA 4H0TB 4KH4A 2ZGYA 3TU5A 3MN9A 3VESA 3WQUA 3CCEN 5FPNA 1GLAG 4XEIA 3WQTA 1YITN 4CZLA 1VQ7N 1MWMA 1MA9B 3FZLA 5C2DA 3D2EB 3L0QA 5TKWA 3CIPA 1LCUA 3H45C 3WEEA 3VEWA 2W40A 4B1XB 3VF2A 3PLAA 1BWFO 2HBKA 4YOUA 4IO9L 4BQLA 3F2KA 4RWTA 3ZYYX 4QS9A 1QQOA 4XH1A 3O9RA 4JHDB 3G25A 4H5VA 5JMVA 5AQNA 4H0OA 3E9LA 1GLLO 4J8FA 4O8KA 1Q81O 4B9QA 5F1XA 4JKAA 4KH6A 2UYTA 3RSEB 3L6QA 3C6AA 1QQNA 3F9MA 4FPAA 4BGBA 5FPDA 5JVHL 3HOSA 3HSCA 1XUPO 5KPZA 4YOVA 3JXUA 4FWRA 1ATNA 1U2VA 5AQJA 3SBGA 4OO1J 4BC3A 1HPMA 4JKEA 3GE1A 4YOXA 4FWPA 1VQ9N 3CXCM 5EX5A 4CBUA 3O9QA 1SZ2A 1WUAA 2NRTA 3S41A 5GADP 4R79A 5BREA 2P9NA 1DT9A 3QBWA 3ULEB 2P9LA 2FLOA 3M5RA 5EOYA 4FWQA 1KQSM 3NVKA 3DAWA 3WXIA 1DKGD 3KK7A 3O1BA 2QTDA 2A41A 3H3NO 2F9WA 2A42A 2D0PA 3O6WA 3I56N 3ZEUB 2AP1A 4BRDA 3NMUA 2FSNA 5AQUA 3R8EA 2P9KA 4GY2B 5AQTA 3WXLA 1P90A 3B8AX 2CGKA 4WFBL 1QVGM 1S3XA 3O9UA 4PL8A 4XH4A 1ZXOA 5MLCQ 2YJFA 2QWRA 3N4PA 4WQ4A 3I33A 3CETA 2NRWA 3A5MC 3EN9A 4EAHD 2WFBA 4K42A 3MMVA 4U67L 3G71N 2D1KA 3AARA 4BG8A 4JNEA 5BRHA 4MDBA 1RDUA 3DXKB 3WXKA 5AR0A 4IO8A 4CZKA 3CMEN 3ZX0A 3LM9A 1BG3A 4IEIA 1HX1A 4IOXA 1KD1O 4JD2A 4IJNA 3ZETB 3G4SN 1W97L 2PBDA 5AQFA 4BRPA 2NRRA 2I7NA 2RE2A 2OTJN 1JCEA 1R59O 2ITMA 3O8MA 3C6HA 4WFNL 2Q0UA 3SAFA 3D2FA 1VQKN 2ZF5O 1VQPN 1BOTO 3G6EN 1CZAN 3O9TA 3QDKA 3TSUA 1E4FT 4A62A 4CJ7A 3VF6A 2QM1A 1KAYA 2WUSA 4IOCL 3KZBA 2ASPA 3T69A 1OVYA 3QB0A 3MX5A 1NGDA 5F2RA 3M6GA 4CZHA 3E1YA 1NGJA 4IEEA 5ADXH 3VEXA 1JJ2M 1X3NA 3D2EA 4BR0A 4B1YB 4JK9A 4A5AA 5AQMA 3SK3A 1U6ZA 2QI2A 5AZIB 1NBWA 3KHYA 1J6ZA 3CERA 1KC8O 1K8AO 3EE8A 4WQ4C 3TPQA 3TSPA 3N4QA 3CD6N 4BREA 3LDQA 2ZJPL 4DKWA 4JHDA 4EHTA 5HL7L 4RCHA 3LDLA 3O5BA 3E66A 2DPNA 4H0PA 2QWQA 1HKGA 3CI5A 3MCPA 4H5NA 4WYBA 4PHTX 5M1KA 1N8RO 3CQXA 4ISFA 5LJWA 2YJEA 4CZFA 3SMPA 3UKRB 2Q36A 3CF5L 2OTLN 2QWOA 2NZTA 1TYQB 5EVZA 3RSEA 5GAEP 2ZJRL 1VQ6N 1VQNN 4Z94A 3R1XA 5AQQA 2WC9A 2GWKA 3D7EO 4H0VB 5ELZA 1G99A 3QMLA 3CCUN 2FSJA 2HBMA 3CCRN 3SLCA 3ENOA 4FO0A 2WBNA 5KPTA 2GELA 2E1ZA 1T3VA 3GBTA 2NLXA 2VWBA 2VYPA 3C0BA 3A5OC 3VMFB 4K43A 3DJCA 5FPMA 1NLVA 3VEVA 4DHYA 4CBWA 3AGKA 1VQ5N 3BEXA 1NGFA 4K41A 3H6EA 3TTFA 2QWMA 3VEOA 3VPZA 2P9PB 4FWMA 3BUZB 2HBJA 5GAHP 3CJAA 4NO7A 3CC4N 4WQ5C 1NGGA 3IMXA 4B1WB 1RDWX 3O4WA 5C15A 3H1VX 4ILGB 4JKHA 3FZFA 4BC2A 5KPRA 2P9SB 3ZEUA 2Q97A 1Z05A 4IFEA 3L4QA 5C10A 1BUPA 2JWLA 1M90O 1ATRA 3GG4A 2BH1A 3IKMA 4A61A 4FWOA 2QWNA 1SS6A 4KH5A 3CC7N 1X3MA 1YUWA 2FF3B 3VEZA 5C0YA 4BRKA 3A5LC 4YDUC 3UE5A 1JCFA 1QHAA 1Q82O 4EFHA 3C7NB 1V4SA 3DXKA 3FZKA 2GWJA 3WXJA 4MO5A 2H3GX 1Z6RA 1S72N 1C0GA 1YVNA 2EWSA 3Q7CA 1GLEG 4PKHA 4YOTA 4FOIA 5AZJB 4A57A 3FR0A 2IVPA 3TTDA 3VGLA 3AAQA 3ZETA 5CE3A 2CGJA 5LJVA 1YAGA 5AQIA 2CH5A 3K9JA 1D4XA 3CCSN 3ENHA 1NGIA 1T6CA 1VAZA 1GLJO 1ATSA 5M1PA 3O1WA 3EZWA 3F5TA 4BR5A 4CZJA 4OPAA 4UY8O 3FE1A 4C1NI 3HM8A 4QS8A 4IJAA 4A2AA 1ILYA 2ZGZA 3EKUA 3AAPA 3MN7A 2ZWHA 3HTVA 3ZX3A 4BG9A 1YJ9N 3HI0A 2JWKA 5C2FA 3SMSA 3WUHA 2VGMA 1BA0A 4MLEA 2OANA 1TUUA 1VQLN 4FWKA 5BPNA 1XC3A 1DGKN 2RHKA 1ZBSA 3ENBA 3P4IA 4FL9A 4CBXA 1MDUB 4BRCA 1QZ6A 2GUPA 4MLHA 2P9IB 3AY9A 5AZIA 5DM7L 4AM7A 3UB5A 3R6MA 4FVUA 4OPHA 4FWSA 3LDPA 1VQ8N 3RVCA 2NRZA 1YJWN 4HTLA 5AFUA 4WF9L 1O13A 4MO4A 3CCJN 3M3ZA 4M7YA 3ATUA 4E1JA 4H0YB 1QZ5A 4BRQA 3WXMB 3T7ZA 3UKRA 1TYQA 3FGUA 3VGMA 3WT0A 3VERA 1H1VA 2A40A 1K9MO 1HJOA 3A8YA 3W3DA 3UKUB 2E2QA 4M63C 3SBTA 1QVFM 2ASMA 3LDNA 1YXQA 2IIRA 3PIPL 1U2VB 5FPEA 4JEPA 3MN6A 4FSVA 3CC2N 2P9UB 3FFKB 3GL1A 4AF1A 4WQ5A 4EIAA 4JK8A 2I7PA 1HKBA 2FXUA 5M1OA 2P9PA 5GIPA 3CJ9A 3QFPA 2YI1A 1RFQA 4PL7A 3QFUA 4BQZA 3DWLA 2AA4A 2E2OA 3IDHA 2E2NA 1W2BM 3CCLN 5BRFA 3A5NC 2P9SA 4CZMA 4YOWA 1YI2N 1XQSC 4JKFA 4BRIA 2D4WA 5TKYA 3I55N 3VTIA 1KXPA 4YDUA 3ZX2A 1SAZA 3A0IX 4YOYA 4BR7A 2GEMA 2J4RA 2GTDA 5M1NA 4NLBA 4IXCA 4C23A 1GLBG 3CJBA 2V7YA 5JLHA 4ILHA 5C12A 3C7NA 2QWLA 3O80A 5CHIA 3GDQA 2IVNA 3FLCO 5LY3A 4JKGB 3D6RA 3EL2A 4QS7A 5GAGP 3CPWM 5AZJA 3U4LA 2V51B 1GLDG 3P39A 2HF4A 4IWVA 4BRNA 3LL3A 2E1YA 5H1SQ 1QQMA 1Q18A 1TUYA 5E84A 3OW2M 4RTFD 3OHRA 3C65A 3ULEA 5B8HA 5JVGL 1BDGA 3O9SA 2E88A 3U9DA 1NMDA 4XH5A 5AQVA 3R3LA 3VETA 5KQ8A 4BR2A 4GV3A 1NGEA 4H0XB 3EKSA 3MX2A 4YORA 4K25A 3VENA 4WFAL 4BRAA 2Q0RA 5AQPA 3TSQA 2D0OA 4CZIA 1KAZA 3EE9A 2PFUA 3ATVA 2Q31A 3OA9A 4FWNA 1GLFO 4LC9B 4BR9A 3P38A 3H46O 1Y64A 5GIOA 3IFRA 1T44A 1DEJA 1NWKA 3FZMA 3VOVA 3MWPA 2QWPA 5F0XA 1YIJN 5AQZA 4CZGA 3L4IA 5AQRA 3SAHA 3U8XA 3HBTA 1Q86O 2P9IA 5KQDA 3KVGA 3CQYA 3IUCA 4PKGA 1BA1A 5M1QA 4CI6A 2KHOA 2FSKA 2NRVA 1BO5O 2YHYA 3R9PA 3J8AA 4IZ9A 2V7ZA 4I6MB 5AQWA 2HF3A 1RGIA 2F9TA 3OBWA 4BR4A 3DXMB 2BTFA 2YX6A 5BN9A 3NVMA 1NM1A 5E26A 2KLAA 3MK6A 3KWGA 1BU6O 1IJJA 3HRGA 3AGRA 3CJ1A 3MDQA 4A59A 4GV6A 2E2PA 1K8KB 2E20A 4BRFA 3BF1A 4JK7A 5AQOA 3LDOA 4JKCA 3CPEA 5ADXA 2QEXN 3UKUA 5EXWA 1NJIO 3ID8A 1YJNN 4BRGA 1OKJA 2P9UA 2QA4N 2Q1NA 3K9KA 5BPMA 2VGNA 3CMAN 2HOEA 3HOTA 1NGBA 1C0FA 4WCEL 4BC5A 5BRDA 1V4TA 2F7TA 3H3OB 4FPBA 1HKCA 3WEEB 1ESVA 3O08A 4B1ZA 4BRLA 5AQKA 5BPLA 4Y0WA 4L3QA 4JN4A 3TTCA 4IDHA 3DLLL 4BC4A 4AM6A 1VQ4N 1Q7YO 4JKDA 1KAXA 1NGCA 5AQGA 3FZHA 4FOEA 1MWKA 3H1QA 5AQHA 1M1KO 4GV9A 2Q2RA 4H5TA 4JAXA 1JCGA 1GLCG 4C1NK 4G9ZA 2E8AA 1HLUA 3P31A 4GNIA 4ISGA 4BGAA 3BP8A 3VEYA 4IOAL 4NB4A 4B1VA 4CZEA 5JLFA 3EO3A 4JKGA 3MWTA 2HSTA 3J7ZO 1VQON 4BRHA 3SJHA 1P8ZA 2CGLA 4F9OA 1EO1A 4GVEA 5JICA 4H5RA 4HWIA 2HBLA 2IVOA 1ZC6A 3QBXA 1T6DA 2VCPA 3CJCA 2KKZA 3CJ7A 3E9PA 5HOOA 2P9NB 4BY9C 4U7BA 2P9LB 4MDAA 4JKBA 2ASOA 5BN8A 2YCHA 3GOIA 5CR4A 3JS6A 5AQXA 3VGKA 2ZJQL 1YHQN 2FF6A 4ILJA 1X9JA 3U9ZA 1WOQA 4DCHA 1VQMN 2GX9A 3I8BA 4BROA 5DM6L 2NRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQY A;  5EY4 A;  2P9K B;  5AQL A;  5I9E B;  3BF3 A;  2W41 A;  5AQS A;  4H03 B;  3VF4 A;  1HUX A;  3M1F A;  4KBO A;  5BR9 A;  1NGH A;  4PKI A;  4H5W A;  5AQY A;  4BVP A;  1E4G T;  2QXL A;  2BUP A;  3CHW A;  1IG8 A;  4DB3 A;  4B1U B;  4I6M A;  3HZ6 A;  2V52 B;  1SQK A;  3DXM A;  4O5F A;  4JD2 B;  4EHU A;  2HMP A;  1NGA A;  2YHW A;  4A2B A;  2CH6 A;  3LM2 A;  4DQ8 A;  1K8K A;  4M7X A;  3D2F B;  4BRM A;  4FWL A;  3QIC A;  1S22 A;  2YHX A;  4ISE A;  5AFU H;  4BVO A;  4CD3 A;  2NRH A;  2A3Z A;  2A5X A;  3W0L A;  4CD1 A;  1LOT B;  2PAV A;  2QW9 A;  2A6A A;  3MN5 A;  4H0T B;  2ZGY A;  3TU5 A;  3MN9 A;  3VES A;  3WQU A;  5FPN A;  1GLA G;  4XEI A;  3WQT A;  4CZL A;  1MWM A;  1MA9 B;  3FZL A;  3D2E B;  3L0Q A;  3CIP A;  1LCU A;  3H45 C;  3WEE A;  3VEW A;  2W40 A;  4B1X B;  3VF2 A;  1BWF O;  4BQL A;  4RWT A;  4QS9 A;  1QQO A;  4XH1 A;  4JHD B;  3G25 A;  4H5V A;  5JMV A;  5AQN A;  4H0O A;  1GLL O;  4J8F A;  4O8K A;  4B9Q A;  5F1X A;  3RSE B;  2UYT A;  3L6Q A;  1QQN A;  3F9M A;  4FPA A;  4BGB A;  5FPD A;  3HSC A;  1XUP O;  5KPZ A;  3JXU A;  4FWR A;  1ATN A;  1U2V A;  5AQJ A;  4BC3 A;  1HPM A;  3GE1 A;  4FWP A;  5EX5 A;  4CBU A;  1SZ2 A;  1WUA A;  3S41 A;  5BRE A;  2P9N A;  3QBW A;  3ULE B;  2P9L A;  2FLO A;  5EOY A;  4FWQ A;  3DAW A;  3WXI A;  1DKG D;  3O1B A;  2A41 A;  3H3N O;  2F9W A;  2A42 A;  2D0P A;  3O6W A;  3ZEU B;  2AP1 A;  4BRD A;  2FSN A;  5AQU A;  3R8E A;  2P9K A;  4GY2 B;  5AQT A;  3WXL A;  3B8A X;  2CGK A;  1S3X A;  4PL8 A;  4XH4 A;  1ZXO A;  2YJF A;  2QWR A;  4WQ4 A;  3I33 A;  3CET A;  3A5M C;  3EN9 A;  4EAH D;  4K42 A;  3MMV A;  2D1K A;  3AAR A;  4BG8 A;  4JNE A;  5BRH A;  3DXK B;  3WXK A;  5AR0 A;  4IO8 A;  4CZK A;  3ZX0 A;  3LM9 A;  1BG3 A;  1HX1 A;  4JD2 A;  4IJN A;  3ZET B;  2PBD A;  5AQF A;  4BRP A;  2I7N A;  1JCE A;  1R59 O;  2ITM A;  3O8M A;  2Q0U A;  3D2F A;  2ZF5 O;  1BOT O;  1CZA N;  3QDK A;  4A62 A;  4CJ7 A;  1E4F T;  3VF6 A;  2QM1 A;  1KAY A;  2WUS A;  3KZB A;  2ASP A;  3QB0 A;  1NGD A;  5F2R A;  3M6G A;  4CZH A;  1NGJ A;  5ADX H;  3VEX A;  1X3N A;  3D2E A;  4BR0 A;  4B1Y B;  5AQM A;  3SK3 A;  1U6Z A;  5AZI B;  1NBW A;  3KHY A;  1J6Z A;  3CER A;  4WQ4 C;  3TPQ A;  4BRE A;  3LDQ A;  4JHD A;  4EHT A;  4RCH A;  3LDL A;  3O5B A;  2DPN A;  4H0P A;  2QWQ A;  1HKG A;  3CI5 A;  3MCP A;  4H5N A;  4WYB A;  3CQX A;  4ISF A;  5LJW A;  2YJE A;  4CZF A;  3SMP A;  3UKR B;  2Q36 A;  2QWO A;  2NZT A;  1TYQ B;  5EVZ A;  3RSE A;  4Z94 A;  5AQQ A;  3D7E O;  2GWK A;  4H0V B;  5ELZ A;  1G99 A;  3QML A;  2FSJ A;  3SLC A;  3ENO A;  4FO0 A;  5KPT A;  2GEL A;  2E1Z A;  3GBT A;  2NLX A;  2VWB A;  2VYP A;  3C0B A;  3A5O C;  4K43 A;  3DJC A;  5FPM A;  1NLV A;  3VEV A;  4DHY A;  4CBW A;  3BEX A;  1NGF A;  4K41 A;  3H6E A;  3VEO A;  2QWM A;  3VPZ A;  2P9P B;  4FWM A;  3BUZ B;  3CJA A;  4NO7 A;  4WQ5 C;  1NGG A;  3IMX A;  4B1W B;  1RDW X;  3O4W A;  3H1V X;  4BC2 A;  3FZF A;  5KPR A;  2P9S B;  3ZEU A;  2Q97 A;  1Z05 A;  1BUP A;  1ATR A;  3GG4 A;  4A61 A;  4FWO A;  2QWN A;  1X3M A;  1YUW A;  2FF3 B;  3VEZ A;  4BRK A;  3A5L C;  4YDU C;  3UE5 A;  1JCF A;  1QHA A;  4EFH A;  3C7N B;  1V4S A;  3DXK A;  3FZK A;  2GWJ A;  3WXJ A;  4MO5 A;  2H3G X;  1Z6R A;  1C0G A;  1YVN A;  2EWS A;  5AZJ B;  1GLE G;  4PKH A;  4FOI A;  3FR0 A;  2IVP A;  3VGL A;  3AAQ A;  3ZET A;  5CE3 A;  2CGJ A;  5LJV A;  1YAG A;  5AQI A;  2CH5 A;  1D4X A;  3ENH A;  1NGI A;  1T6C A;  1GLJ O;  1ATS A;  3O1W A;  3EZW A;  4BR5 A;  4CZJ A;  3FE1 A;  3HM8 A;  4QS8 A;  4IJA A;  4A2A A;  2ZGZ A;  3EKU A;  3AAP A;  3MN7 A;  2ZWH A;  3HTV A;  3ZX3 A;  4BG9 A;  3HI0 A;  3SMS A;  3WUH A;  1BA0 A;  4MLE A;  2OAN A;  1TUU A;  4FWK A;  5BPN A;  1XC3 A;  1DGK N;  1ZBS A;  3P4I A;  4FL9 A;  4CBX A;  1MDU B;  4BRC A;  1QZ6 A;  2GUP A;  4MLH A;  2P9I B;  3AY9 A;  5AZI A;  4AM7 A;  3UB5 A;  3R6M A;  4FWS A;  3LDP A;  4HTL A;  5AFU A;  4MO4 A;  3M3Z A;  4M7Y A;  3ATU A;  4E1J A;  4H0Y B;  1QZ5 A;  4BRQ A;  3UKR A;  1TYQ A;  3FGU A;  3VGM A;  3WT0 A;  3VER A;  1H1V A;  2A40 A;  1HJO A;  3A8Y A;  3W3D A;  3UKU B;  2E2Q A;  4M63 C;  2ASM A;  3LDN A;  1YXQ A;  2IIR A;  1U2V B;  5FPE A;  3MN6 A;  4FSV A;  2P9U B;  3FFK B;  3GL1 A;  4WQ5 A;  4EIA A;  2I7P A;  1HKB A;  2FXU A;  2P9P A;  3CJ9 A;  3QFP A;  2YI1 A;  1RFQ A;  4PL7 A;  3QFU A;  4BQZ A;  3DWL A;  2AA4 A;  2E2O A;  3IDH A;  2E2N A;  5BRF A;  3A5N C;  2P9S A;  4CZM A;  1XQS C;  4BRI A;  2D4W A;  5TKY A;  1KXP A;  4YDU A;  3ZX2 A;  1SAZ A;  3A0I X;  4BR7 A;  2GEM A;  2J4R A;  2GTD A;  4IXC A;  4C23 A;  1GLB G;  3CJB A;  2V7Y A;  5JLH A;  3C7N A;  2QWL A;  3O80 A;  3GDQ A;  2IVN A;  3FLC O;  5LY3 A;  4QS7 A;  3EL2 A;  5AZJ A;  3U4L A;  2V51 B;  1GLD G;  2HF4 A;  4IWV A;  4BRN A;  3LL3 A;  2E1Y A;  1QQM A;  1Q18 A;  1TUY A;  5E84 A;  4RTF D;  3OHR A;  3ULE A;  5B8H A;  1BDG A;  5KQ8 A;  2E88 A;  3U9D A;  1NMD A;  4XH5 A;  5AQV A;  3VET A;  4BR2 A;  1NGE A;  4H0X B;  3EKS A;  3VEN A;  4K25 A;  4BRA A;  2Q0R A;  5AQP A;  2D0O A;  4CZI A;  1KAZ A;  3ATV A;  2Q31 A;  4FWN A;  1GLF O;  4LC9 B;  4BR9 A;  3H46 O;  1Y64 A;  3IFR A;  1T44 A;  1DEJ A;  1NWK A;  3FZM A;  3VOV A;  2QWP A;  5F0X A;  5AQZ A;  4CZG A;  3L4I A;  5AQR A;  3U8X A;  3HBT A;  2P9I A;  5KQD A;  3KVG A;  3CQY A;  3IUC A;  4PKG A;  1BA1 A;  4CI6 A;  2KHO A;  2FSK A;  1BO5 O;  2YHY A;  3R9P A;  3J8A A;  4IZ9 A;  2V7Z A;  4I6M B;  5AQW A;  2HF3 A;  1RGI A;  2F9T A;  4BR4 A;  3DXM B;  2BTF A;  5BN9 A;  1NM1 A;  5E26 A;  3MK6 A;  1BU6 O;  1IJJ A;  3CJ1 A;  3MDQ A;  2E2P A;  1K8K B;  2E20 A;  4BRF A;  3BF1 A;  5AQO A;  3LDO A;  5ADX A;  3UKU A;  5EXW A;  3ID8 A;  4BRG A;  1OKJ A;  2P9U A;  2Q1N A;  5BPM A;  2HOE A;  1NGB A;  1C0F A;  4BC5 A;  5BRD A;  1V4T A;  3WEE B;  3H3O B;  4FPB A;  1HKC A;  4B1Z A;  1ESV A;  3O08 A;  4BRL A;  5BPL A;  5AQK A;  4Y0W A;  4L3Q A;  4JN4 A;  4BC4 A;  4AM6 A;  1KAX A;  1NGC A;  5AQG A;  3FZH A;  4FOE A;  1MWK A;  3H1Q A;  5AQH A;  2Q2R A;  4H5T A;  4JAX A;  1JCG A;  1GLC G;  2E8A A;  1HLU A;  4ISG A;  4GNI A;  4BGA A;  3BP8 A;  3VEY A;  4NB4 A;  4B1V A;  4CZE A;  5JLF A;  3EO3 A;  4BRH A;  3SJH A;  1P8Z A;  2CGL A;  4F9O A;  5JIC A;  4H5R A;  4HWI A;  2IVO A;  1ZC6 A;  3QBX A;  1T6D A;  2VCP A;  3CJC A;  3CJ7 A;  2P9N B;  2P9L B;  2ASO A;  5BN8 A;  2YCH A;  3GOI A;  3JS6 A;  5AQX A;  3VGK A;  2FF6 A;  1X9J A;  3U9Z A;  1WOQ A;  4DCH A;  3I8B A;  4BRO A; 
#chains in the Genus database with same CATH topology
 5FRM A;  5EY4 A;  5I9E B;  3BF3 A;  5AQS A;  1IBM K;  3VF4 A;  3M1F A;  5BR9 A;  1NGH A;  2X74 A;  1HNX K;  4Z4H A;  5I3U A;  2QXL A;  3MCA B;  1GOB A;  4IG3 A;  3AA2 A;  3L2Q A;  1IG8 A;  3CM6 A;  4CJ4 A;  3NHG A;  5AJ3 K;  3DXM A;  4A5B A;  3PIO L;  4BWM A;  3SUO A;  3Q7B A;  3ZSQ A;  1NMN A;  2WTU A;  1DTQ A;  3RRG A;  3P83 D;  2KQ2 A;  3KKS A;  1IBK K;  4W5O A;  1S22 A;  4LFC K;  4IG0 A;  1OH6 A;  4CD3 A;  2NRH A;  2A5X A;  3W0L A;  3KD1 E;  3LAK A;  3MN5 A;  4H0T B;  2ZGY A;  3SQ4 A;  3MN9 A;  3T1Y K;  3CCE N;  3PY8 A;  4XEI A;  4I9Q A;  4DSF A;  3D2E B;  3CIP A;  3PLA A;  1BI4 B;  3F2K A;  4E7I A;  2O8D B;  1QQO A;  4JHD B;  3DLE A;  3EZ5 A;  4DU4 A;  3RSE B;  2UYT A;  3ZSV A;  1HMV A;  4CGG A;  1QQN A;  4AH9 A;  3QNN A;  3HSC A;  1XUP O;  4DTP A;  1OH8 A;  3JXU A;  4OO1 J;  1U2V A;  2AJQ A;  4BC3 A;  1HPM A;  1N34 K;  3NF7 A;  4CBU A;  3ASM A;  1WUA A;  3ULE B;  1RT6 A;  1OH5 A;  4B3S K;  4FWQ A;  3DM2 A;  1HYV A;  3DAW A;  3WXI A;  2D0P A;  2ATQ A;  3OYN A;  2FSN A;  4GY2 B;  2RKI A;  4YFU A;  1Z25 A;  4CEE A;  4WFB L;  3LP1 A;  2HHH K;  2YJF A;  3I33 A;  3CET A;  1TV6 A;  2NRW A;  3A5M C;  4EAH D;  2WFB A;  4K42 A;  3G71 N;  2D1K A;  3AAR A;  4BG8 A;  2HNZ A;  4M3Z A;  4B9U A;  4X66 K;  1BCO A;  4IO8 A;  1ASW A;  1YTU A;  3LM9 A;  2UXD K;  4KB0 A;  1KD1 O;  1RTH A;  4IJN A;  1W97 L;  5AQF A;  2I7N A;  2RE2 A;  4FZY A;  4KHU A;  1LWF A;  3O8M A;  4WFN L;  4DTJ A;  2O8C B;  4E7J A;  1CZA N;  4A62 A;  4M3Y A;  4B3T K;  3NGY A;  2DFE A;  4HVJ A;  3MED A;  3THV A;  4FLT A;  2RPI A;  3QB0 A;  4KRE A;  4CZH A;  3E1Y A;  1NGJ A;  4OJR A;  1JJ2 M;  1S6P A;  3D2E A;  4QCL A;  4JK9 A;  4A5A A;  2IAJ A;  4KHN A;  1BGX T;  3LP3 A;  2GUI A;  1RBR A;  4CJP A;  1K8A O;  3TSP A;  4DU1 A;  3N4Q A;  3CD6 N;  2O8D A;  4JHD A;  3M8S A;  2F4V K;  4E3S A;  4CF8 A;  2OTL N;  3CF5 L;  3RSE A;  1TYQ B;  3MXI A;  4Z94 A;  2WC9 A;  1G99 A;  2YNH A;  3QML A;  3ZT1 A;  3CCU N;  2FSJ A;  3P1G A;  5KPT A;  2GEL A;  2FBV A;  4DTR A;  1T3V A;  4ELV A;  2NLX A;  3C0B A;  5FPM A;  2HHT A;  3O4Q A;  4JLH A;  2UUA K;  1NGF A;  3BUZ B;  5GAH P;  1N32 K;  3CJA A;  1BQM A;  4WQ5 C;  4DTN A;  4B1W B;  4JRQ A;  3PUF A;  3KLF A;  4DF8 A;  3FZF A;  4FLW A;  2P9S B;  5C10 A;  1VSI A;  1UWB A;  3O3G A;  4CEA A;  1U45 A;  3JAM O;  1SS6 A;  3OYG A;  4KH5 A;  4LSL A;  1X3M A;  4J2A A;  2GV9 A;  4OKJ A;  4PUO A;  1JCF A;  1IH7 A;  1V4S A;  3IS9 A;  3CG7 A;  4FJG A;  1Z6R A;  1S72 N;  5AZJ B;  2EWS A;  3Q7C A;  4M42 A;  3KLH A;  1WNS A;  3CFR A;  1SKR A;  2IVP A;  2WON A;  3TTD A;  5LJV A;  2W42 A;  3AVH A;  3VQB A;  4F3T A;  5AQI A;  2CH5 A;  5J1E A;  1L3V A;  5M1P A;  3O1W A;  4OPA A;  2KFN A;  3HM8 A;  4B9M A;  2O8C A;  3EKU A;  3PSI A;  5C2F A;  3IRX A;  3HVT A;  3SQ1 A;  3ZSW A;  3L3V A;  1A5W A;  3LP2 A;  2OPP A;  4Z4F A;  4FXD A;  3AO5 A;  4M41 A;  1XC3 A;  3SZ2 A;  1JXB A;  2UU9 K;  3AVG A;  5J2N A;  2B6A A;  4FVU A;  3R6M A;  4PWD A;  3LDP A;  2KFZ A;  3U3G A;  3RVC A;  1YJW N;  4DSL A;  3CCJ N;  2XY7 A;  3M3Z A;  1QZ5 A;  1J5E K;  1TYQ A;  3U6F A;  4C8K A;  3FGU A;  3VGM A;  3AO2 A;  4B8C A;  3AO4 A;  4CGF A;  3A8Y A;  4M63 C;  4CGI A;  4YY3 K;  4CJV A;  2YV0 X;  2IIR A;  1FKP A;  3CC2 N;  1LWC A;  4FK2 A;  4AF1 A;  2G8K A;  5JS2 A;  2UUC K;  2I7P A;  1E3M A;  1VK0 A;  3K5O A;  1REV A;  5GIP A;  3ZSO A;  3CYM A;  2PZS A;  3QFP A;  3QFU A;  3NH2 A;  1CXQ A;  1EX4 A;  5C42 A;  1N6Q A;  3IDH A;  2YHA A;  2P9S A;  4CZM A;  4BRI A;  2D4W A;  4BE1 A;  3VTI A;  4CES A;  4YOY A;  3A0I X;  2HNY A;  5CYQ A;  4I2P A;  4Q5V A;  3CJB A;  3ITH A;  3ZCM A;  2QWL A;  3O80 A;  3FLC O;  1D5A A;  5LY3 A;  1RDB A;  1IKX A;  4JI8 K;  3MEE A;  5AZJ A;  4Z4I A;  2V51 B;  4IWV A;  4BRN A;  4FK4 A;  1J54 A;  3NF6 A;  1Q8I A;  4G1Q A;  1S1W A;  4DS5 A;  4C8M A;  1JLC A;  1UOC A;  5KQ8 A;  3VET A;  5E41 A;  1NK4 A;  1NGE A;  4H0X B;  3EKS A;  3MX2 A;  4YOR A;  4K25 A;  4PQU A;  3SV3 A;  2Q0R A;  4DS4 A;  4KTZ A;  4ICL A;  3OYE A;  2Q31 A;  3TAN A;  3OA9 A;  3QLH A;  2UUB K;  1XI1 A;  3H46 O;  1YVU A;  4KTQ A;  4Q0B A;  5IWA K;  2QWP A;  3ZLJ A;  5SWM A;  2VG6 A;  3SAH A;  3DLB A;  5CY4 A;  2KHO A;  2NRV A;  5FDL A;  3R9P A;  3AVF A;  3VQQ A;  1RGI A;  3KTQ A;  1G15 A;  2YX6 A;  4DG1 A;  2KLA A;  4QAG A;  1IJJ A;  3HRG A;  3CJ1 A;  3RMA A;  3VQ6 A;  5AQO A;  3LDO A;  4HUE A;  5EXW A;  3HPO A;  4FM2 A;  4CHP A;  1JL2 A;  2HOE A;  5FRO A;  1NK0 A;  1C0F A;  4WCE L;  4CVN E;  4FK0 A;  1TL3 A;  4IKF A;  1V4T A;  4I2Q A;  4N56 A;  4FJL A;  3QES A;  5IT9 O;  4IDH A;  1NK9 A;  2IC3 A;  4EZ9 A;  4DLG A;  1Q7Y O;  4JKD A;  1KAX A;  4GV9 A;  4H5T A;  1BL3 A;  4HCB A;  4CFA A;  1X9M A;  2O8E B;  2E8A A;  1VRT A;  4GNI A;  3M8R A;  1BQN A;  4B1V A;  4FLZ A;  1WLJ A;  4DV4 K;  4BRH A;  4OGC A;  1VSK A;  2FBT A;  4M3T A;  3AVN A;  4H5R A;  4HWI A;  5HRR A;  3OYC A;  1T6D A;  2VCP A;  3CJC A;  1X9W A;  1Q9X A;  4MDA A;  3RMC A;  4JKB A;  3GOI A;  3VGK A;  4O5B A;  2YNI A;  4NXN K;  3I8B A;  5DM6 L;  4DV7 K;  2IS3 A;  3QEI A;  2D0A A;  3TI0 A;  2GBZ A;  4CJK A;  2QKB A;  5AQL A;  3SUQ A;  2W41 A;  4CJT A;  1L3T A;  4KBO A;  5AQY A;  1TKT A;  4H5W A;  4DUZ K;  4BVP A;  4J2D A;  1E4G T;  4BDZ A;  1EKE A;  4NLC A;  3VTH A;  3F73 A;  4W5R A;  3HJF A;  3QIN A;  1JXE A;  4B1U B;  3NGI A;  3AVL A;  1CZB A;  1SQK A;  4E89 A;  3MAQ A;  2R7Y A;  3OJU A;  2HMP A;  4LFA K;  3TAR A;  4CHN A;  2D0B A;  3HP6 A;  3SI6 A;  2CH6 A;  3LM2 A;  4JI2 K;  3KWI A;  5GIN A;  4BRM A;  2YHX A;  4ISE A;  4GW6 A;  3LWL A;  2O8B B;  4DTU A;  1NJX A;  4O8U A;  4OKK A;  4DSK A;  4LF4 K;  2D5R A;  5SZT A;  3QNO A;  3O3H A;  1GLA G;  4CK3 A;  3VQ5 A;  4CZL A;  1RBT A;  3F9K A;  5C2D A;  1KSP A;  1LCU A;  2W40 A;  4DMN A;  4IO9 L;  4W5Q A;  3WNF A;  3ZYY X;  4RWT A;  3OYD A;  1XMQ K;  3G25 A;  3V81 A;  1I3A A;  5J2M A;  4H0O A;  3PO5 A;  3E9L A;  1GLL O;  1Q81 O;  1IKY A;  2P1J A;  4KO0 A;  4B9Q A;  1FK9 A;  2O8E A;  4CF1 A;  1QQC A;  3K59 A;  5JVH L;  4B9N A;  4FZX C;  3TAP A;  4LF6 K;  4FWR A;  4DQP A;  5AQJ A;  3GE1 A;  4FWP A;  1S9G A;  4DV1 K;  3CXC M;  4DR7 K;  3NFA A;  3O9Q A;  1SZ2 A;  2HND A;  4CIE A;  5GAD P;  3V9X A;  5BRE A;  3QBW A;  3OYA A;  3HPH A;  4LF9 K;  3O4N A;  1SKW A;  4CEC A;  3O6W A;  2YNF A;  2AP1 A;  4LH4 A;  4BRD A;  3NMU A;  5AQU A;  5AQT A;  3WXL A;  1P90 A;  3B8A X;  3NCI A;  1S3X A;  4JV5 K;  1QHT A;  3A2F A;  4XH4 A;  2A1S A;  1QTM A;  1ZXO A;  2QWR A;  3OYF A;  3N4P A;  2F96 A;  4U67 L;  1BHL A;  1RT2 A;  2HHW A;  3HO1 A;  3LWM A;  2X78 A;  4JNE A;  3OYH A;  4CK1 A;  1RDU A;  3WXK A;  4CF2 A;  1BCM A;  5AR0 A;  3KLG A;  3K57 A;  1NNE A;  3S3O A;  4IEI A;  1EET A;  1L5U A;  4CE9 A;  3ZET B;  2PBD A;  1EWR A;  4CJE A;  4CJS A;  3SAF A;  1VQP N;  1NK8 A;  4FJI A;  4CJ7 A;  3TSU A;  3VF6 A;  2QM1 A;  4W5T A;  5HBM A;  3DRR A;  3KZB A;  4IDK A;  3T69 A;  5DK5 A;  2HHS A;  3MX5 A;  2FBY A;  3C6U A;  2DFF A;  4IEE A;  3THY A;  3SQ2 A;  4N41 A;  4BR0 A;  5AQM A;  3CER A;  3L3U A;  1KC8 O;  3TPQ A;  2ZJP L;  4DKW A;  3LDL A;  3E66 A;  2W6L A;  4B3R K;  3CI5 A;  1HKG A;  4JYA K;  4PHT X;  4FLU A;  5KGW A;  5LJW A;  3RWU A;  2YJE A;  4CZF A;  3UKR B;  2NZT A;  5EVZ A;  5GAE P;  5HRS A;  2EHG A;  1YTA A;  2HBM A;  4FO0 A;  2UXB K;  1JKH A;  4FLY A;  2A1R A;  1KVB A;  2VYP A;  4GKJ K;  1NKE A;  3FFI A;  4DHY A;  3AGK A;  1VQ5 N;  3BEX A;  4DU3 A;  4EP5 A;  3H6E A;  5KTQ A;  4FWM A;  2HBJ A;  4AQY K;  1RTI A;  3T1H K;  1RDW X;  3O4W A;  5C15 A;  5KGX A;  4CJ3 A;  4ILG B;  4JKH A;  5KPR A;  2Q97 A;  1Z05 A;  4IFE A;  1ATR A;  3GG4 A;  3IKM A;  4A61 A;  2Q3S A;  1WSJ A;  4OKE A;  4RG8 A;  1IV0 A;  2QXF A;  1YUW A;  2FF3 B;  4AIL C;  3V9S A;  3A5L C;  4YDU C;  3UE5 A;  4H8K A;  2Y1J A;  1Q82 O;  4DV3 K;  4PKH A;  2YKM A;  4YOT A;  2YKN A;  3ZET A;  3SUP A;  1D4X A;  1TK8 A;  3ENH A;  1RDC A;  1IKV A;  3CQ8 A;  4DV6 K;  4UY8 O;  4DR5 K;  3FE1 A;  4H4O A;  4IJA A;  4CJF A;  3OYL A;  4KAZ A;  3ZX3 A;  4BG9 A;  1FXX A;  1ZBI A;  4O0J A;  2JWK A;  3THX B;  4DV5 K;  1RT7 A;  4JI6 K;  3WUH A;  3DI6 A;  4CGJ A;  2OAN A;  1RTJ A;  1VQL N;  1QE1 A;  1DGK N;  1QZ6 A;  2GUP A;  4MLH A;  2P9I B;  1B9F A;  1JLA A;  3MEC A;  4AM7 A;  4DF4 A;  3HVR A;  1WSH A;  1VQ8 N;  1RIL A;  1C0M A;  5AFU A;  1O13 A;  1JLB A;  4H0Y B;  3UKR A;  2XHB A;  3AVC A;  1BIS A;  3ZSY A;  2XY6 A;  3TAQ A;  3WT0 A;  3VER A;  1H1V A;  2A40 A;  1SKS A;  3UKU B;  3LDN A;  3QIO A;  4RW8 A;  1YT3 A;  2P9U B;  3GL1 A;  3ZSR A;  4WQ5 A;  1QSL A;  4DR4 K;  2FXU A;  4JI0 K;  3OTO K;  1BI4 A;  1SV5 A;  4F2R A;  3RMD A;  3BY5 A;  2XY5 A;  4O0I A;  4NCG A;  4DSI A;  3SUN A;  1SAZ A;  4ELU A;  1XNQ K;  4HUF A;  4BR7 A;  2GEM A;  2J4R A;  3L2W A;  4NLB A;  4IXC A;  3VQC A;  1GLB G;  1C1A A;  5C12 A;  1O1W A;  3JYT A;  4FJK A;  5CHI A;  1Z26 A;  2IVN A;  2B4J A;  4QS7 A;  3EL2 A;  4OVL A;  3LL3 A;  3PO4 A;  5H1S Q;  1Q18 A;  1TUY A;  4ELT A;  4RTF D;  3I0S A;  3OJS A;  2RF2 A;  3ULE A;  3S3N A;  1BDG A;  4XH5 A;  3R3L A;  3HK2 A;  1WBD A;  3VEN A;  3MEG A;  4AHC A;  4BRA A;  1KAZ A;  3K5N A;  2PFU A;  3ATV A;  3KJV A;  4FWN A;  2QK9 A;  4KB1 A;  4JS4 A;  3P38 A;  5GIO A;  1WSI A;  1TAU A;  1W0H A;  1XNR K;  2YNG A;  4CHQ A;  1DTT A;  5AQZ A;  5AQR A;  2P9I A;  5KQD A;  1TL1 A;  4PKG A;  4FM1 A;  4M3W A;  2FSK A;  1BO5 O;  1WB9 A;  2YHY A;  1C0U A;  2V7Z A;  1GOC A;  1RT4 A;  3VQ8 A;  2HF3 A;  5AQW A;  2O8F B;  5E26 A;  1KRP A;  1TK5 A;  1BU6 O;  3AA3 A;  2IGI A;  3NGZ A;  4GV6 A;  2HVH A;  2ZD1 A;  1K8K B;  4JK7 A;  1HPZ A;  4E7K A;  4FZZ A;  3SJJ A;  3JSM A;  3HXM A;  2QEX N;  3UKU A;  2ZE2 A;  3ID8 A;  1N36 K;  1YJN N;  2P9U A;  4FJM A;  5BPM A;  3CMA N;  3VQ7 A;  3HOT A;  4BC5 A;  5BRD A;  3E01 A;  3G10 A;  1U47 A;  2E6L A;  2F7T A;  5BPL A;  4FPB A;  4DR2 K;  3PX4 A;  4L3Q A;  3I8D A;  5HP1 A;  1N5Y A;  3G0Z A;  3FZH A;  4FOE A;  1MWK A;  3H1Q A;  5C24 A;  5LL6 Z;  1W7A A;  3DLR A;  4G9Z A;  4MFB A;  3RMB A;  4BGA A;  3BP8 A;  3QEV A;  2HST A;  3J7Z O;  4GMJ B;  4FW1 A;  3KK2 A;  3SJH A;  1EO1 A;  5HLF A;  3QBX A;  3BGR A;  4N76 A;  2P9N B;  2P9L B;  3VN5 A;  2ASO A;  5LMU K;  2E5L K;  5CR4 A;  3JS6 A;  5AQX A;  3LPT A;  1X9J A;  2E4L A;  4LFB K;  4DCH A;  2GX9 A;  1LWE A;  1EQY A;  2P9K B;  3L2R A;  5M1F A;  1S6Q A;  3OYI A;  4H03 B;  1HUX A;  1KCF A;  3KKR A;  1T7P A;  2BUP A;  4KI4 A;  3CHW A;  4CF9 A;  4O44 A;  2F8T A;  4DB3 A;  1KFS A;  1YF5 L;  2ETJ A;  3PX0 A;  3KK1 A;  3OBY A;  3CCV N;  1QS4 A;  2KTQ A;  3PV8 A;  2O8F A;  4O5F A;  4JD2 B;  4K8X A;  1JLF A;  3VQA A;  3CCM N;  2HB5 A;  3WNH A;  1NGA A;  2YHW A;  3AVK A;  4NYF A;  3KIO A;  1K8K A;  1IG9 A;  4M7X A;  2KZM A;  3D2F B;  3ID6 A;  5AFU H;  4BVO A;  3J80 O;  2A3Z A;  4IFV A;  4CD1 A;  1NU0 A;  2A6A A;  2QW9 A;  4W5N A;  4KH4 A;  2EX3 A;  1NOZ A;  4M3U A;  3RR8 A;  1KTQ A;  5FPN A;  1YIT N;  4CFB A;  3FZL A;  3O3F A;  3EYZ A;  3L0Q A;  1VSF A;  3TAG A;  3VF2 A;  1JLG A;  4CJW A;  2WOM A;  1WSF A;  1ZBU A;  3O9R A;  1RT5 A;  4IFY A;  5AQN A;  4J8F A;  4O8K A;  2OA8 A;  4FJH A;  3C6A A;  4FPA A;  4BGB A;  5FPD A;  5D3G A;  3HOS A;  4DFM A;  2I5J A;  4AHT A;  4YOV A;  1B92 A;  4JKE A;  1VQ9 N;  5EX5 A;  4R79 A;  1CXU A;  2P9N A;  4KHS A;  2P9L A;  3NH1 A;  3M5R A;  1RBU A;  2BDP A;  4TSX A;  5EOY A;  2JLE A;  3VQE A;  2HHQ A;  3THW B;  3UIQ A;  2DY4 A;  4JI7 K;  2QTD A;  4JI5 K;  2G8V A;  3ZEU B;  3R8E A;  2P9K A;  1VSE A;  4HCC A;  2OPQ A;  1NKB A;  5K14 A;  4WQ4 A;  4CK2 A;  2XRI A;  2YHB A;  4Z0U A;  2VQF K;  3T3F A;  4B3O A;  4Z4E A;  1NK7 A;  1HRH A;  3LPU A;  2F8S A;  4JI3 K;  4IOX A;  4JD2 A;  4ID5 A;  1RT1 A;  3C6T A;  2O4G A;  1R59 O;  4B3M K;  4OPK A;  2ITM A;  3C6H A;  2VWJ A;  1S1T A;  3D2F A;  2ZF5 O;  3AVB A;  4CFD A;  3G6E N;  3O9T A;  1E4F T;  2DTU A;  1KAY A;  2WUS A;  4IOC L;  2OCE A;  4B9L A;  2ASP A;  4DTX A;  1OVQ A;  1UA0 A;  3M6G A;  4CER A;  4FLX A;  2KW4 A;  3L2U A;  3C94 A;  1RBV A;  3AO1 A;  4B9T A;  2VG7 A;  4KI6 A;  1X3N A;  2JGU A;  4DLE A;  3DOK A;  4B1Y B;  3SK3 A;  2QI2 A;  1RTD A;  1NBW A;  3DLK A;  1J6Z A;  4E7H A;  1NJY A;  3EE8 A;  4WQ4 C;  4AHR A;  4CJL A;  4BRE A;  3LDQ A;  1U04 A;  3NH0 A;  4L8R B;  1WBB A;  5HL7 L;  3O5B A;  4CHZ A;  2DPN A;  4H0P A;  2QWQ A;  2HHX A;  4ISF A;  3KK3 A;  2HW3 A;  3K2P A;  3QO9 A;  4RW9 A;  3SMP A;  1Q9Y A;  2ZJR L;  1VQ6 N;  4AHV A;  1X9S A;  5FLX O;  4LSN A;  3D7E O;  2GWK A;  3WNG A;  4H0V B;  4E19 A;  5ELZ A;  4EZ6 A;  1VSH A;  3ENO A;  3SLC A;  2UXC K;  3VMF B;  3A5O C;  4K43 A;  3QEP A;  1S9E A;  3VEO A;  4K41 A;  4F8R A;  2QWM A;  3KLI A;  2P9P B;  1U4B A;  4H4M A;  3CC4 N;  3D45 A;  1X1P A;  1KFD A;  3THW A;  1J9A A;  1IO2 A;  4BC2 A;  3EEQ A;  3OS2 A;  4F2S A;  3ZEU A;  1MU2 A;  3L4Q A;  1M90 O;  1BUP A;  2JWL A;  4J2B A;  4DR1 K;  4AHS A;  4FWO A;  4KHW A;  2QWN A;  3LAM A;  1NOY A;  5C0Y A;  3QER A;  3BZK A;  4EFH A;  3FZK A;  2XY8 A;  4B9S A;  2H3G X;  1C0G A;  1YVN A;  1GLE G;  4A57 A;  3FR0 A;  2IDO A;  4FJ5 A;  3VGL A;  5CE3 A;  2CGJ A;  3CM5 A;  3K9J A;  3CCS N;  4FJ9 A;  1NK5 A;  1VAZ A;  3EZW A;  3F5T A;  4BR5 A;  1WAJ A;  4A2A A;  4KFB A;  2ZGZ A;  3AAP A;  2ZWH A;  1TVR A;  3HTV A;  1YJ9 N;  3OY9 A;  3HI0 A;  2VWK A;  1WSG A;  4N5S A;  2VGM A;  2FBX A;  1VSL A;  4JI1 K;  3OVN A;  5HRN A;  3V9Z A;  4FWK A;  3ENB A;  1ZBS A;  3P4I A;  3ULD A;  4BRC A;  1XWL A;  3AY9 A;  5T7B A;  3IAY A;  3UB5 A;  1XC9 A;  4OPH A;  4FWS A;  1U48 A;  3VA0 A;  4MQ3 A;  3ATU A;  1CZ9 A;  4E1J A;  4BRQ A;  4PA1 A;  3WXM B;  3T7Z A;  1BIU A;  2PYL A;  4DR6 K;  1XHX A;  2O8B A;  1ZYQ A;  1K9M O;  1HJO A;  1SL2 A;  5HRP A;  1ASU A;  1U2V B;  5FPE A;  4JEP A;  1KLM A;  1TKZ A;  4CHY A;  1T03 A;  4CGH A;  5M1O A;  2P9P A;  4LD0 A;  1CLQ A;  2YI1 A;  1RFQ A;  4PL7 A;  4BQZ A;  1Y97 A;  1F21 A;  3DWL A;  5BR8 K;  2AA4 A;  4NCA A;  3HPG A;  2E2O A;  1W2B M;  5BRF A;  4YOW A;  1XQS C;  4JKF A;  1LAW A;  4CED A;  3NBP A;  1C0T A;  4YDU A;  2KZZ A;  1RBS A;  3ZSX A;  2GTD A;  5M1N A;  4C23 A;  4F4K A;  2V7Y A;  5JLH A;  4BWJ A;  3DOL A;  3KLE A;  3GDQ A;  4RW4 A;  4FJX A;  4JKG B;  1C1B A;  3D6R A;  3CPW M;  4O55 A;  5DMR A;  3U4L A;  3P39 A;  4CEQ A;  2E1Y A;  3HP9 A;  1QQM A;  4O4G A;  1LV5 A;  5E84 A;  3OW2 M;  3OHR A;  3C65 A;  5B8H A;  4C8L A;  3U9D A;  3M8Q A;  4GV3 A;  2XO7 A;  4WFA L;  3AA4 A;  1L3S A;  2D0O A;  4CZI A;  1QSY A;  2OPS A;  4LC9 B;  4BR9 A;  1UAX A;  1ASV A;  4IBN A;  1Y64 A;  1FJG K;  3IFR A;  3M8P A;  1T44 A;  3V1O A;  3V4I A;  3VOV A;  3MWP A;  1YIJ N;  4DTS A;  3V1R A;  3L4I A;  1Q86 O;  3HBT A;  2Z1G A;  3EY1 A;  1OH7 A;  2G8I A;  3CQY A;  3IUC A;  4ZTJ A;  1U49 A;  1XMO K;  4DR3 K;  3ZT2 A;  3SV4 A;  3J8A A;  4I6M B;  4BR4 A;  3OBW A;  2F9T A;  1TKD A;  2BTF A;  3NVM A;  3MK6 A;  3KWG A;  3NDK A;  4HHT A;  3AGR A;  4A59 A;  4DQI A;  4CJQ A;  2BGG A;  3BF1 A;  4K0K K;  3DLH A;  4JKC A;  5ADX A;  1TKX A;  4CHO A;  4BRG A;  1OKJ A;  2QA4 N;  4FJ8 A;  2VGN A;  3AVA A;  4ZTF A;  3D0P A;  5C25 A;  1NGB A;  3OYB A;  3U3Y A;  1I39 A;  3L8B A;  3WEE B;  1HKC A;  4KV8 A;  3O08 A;  4BRL A;  3TR8 A;  4J2E A;  4Y0W A;  1KLN A;  4KHY A;  4JN4 A;  4BC4 A;  1LAV A;  1HJR A;  4AM6 A;  3TAB A;  1VQ4 N;  4V19 S;  1NGC A;  4EP4 A;  4AHU A;  1LW0 A;  2NUB A;  5AQH A;  1M1K O;  2O4I A;  2Q2R A;  4JAX A;  1JCG A;  1GLC G;  4FM0 A;  4OX9 K;  1HLU A;  3P31 A;  1VRU A;  3VA3 A;  3VEY A;  4DFP A;  4IOA L;  4NB4 A;  4CZE A;  4JKG A;  4M3X A;  3S3M A;  1S1V A;  4F9O A;  5KRT A;  3K0S A;  1RDD A;  4GVE A;  5JIC A;  1R0A A;  2IVO A;  3E9P A;  5HOO A;  4BY9 C;  4U7B A;  3PSF A;  5BN8 A;  2YCH A;  4KTW A;  2FF6 A;  4ILJ A;  3NF8 A;  5EU7 A;  3U9Z A;  1WOQ A;  1VQM N;  4BRO A;  4GVM A;  4KHQ A;  3NAE A;  2ZQB A;  2NRX A;  5KI6 A;  2B5J A;  4KHP K;  3VQD A;  1K6Y A;  3CCQ N;  2PY5 A;  3I0R A;  1HQU A;  4FJJ A;  4PKI A;  5FRN A;  3SAG A;  2OPR A;  3E9O A;  4ZHR A;  4DQR A;  4X64 K;  5I42 A;  4I6M A;  3HZ6 A;  2V52 B;  4EHU A;  2X6S A;  4B8A B;  3AVM A;  4A2B A;  3T19 A;  1WN7 A;  4DQ8 A;  4CEF A;  4FWL A;  3QIC A;  1RNH A;  1K73 O;  1IBL K;  2NNW A;  1VSM A;  4F3O A;  1A5X A;  4DV0 K;  4DFK A;  3THX A;  1LOT B;  2PAV A;  4FVM A;  3B6P A;  4DQS A;  3TU5 A;  4OPJ A;  3VES A;  3WQU A;  4Y1D A;  2ITG A;  5A2Q O;  3WQT A;  1S5J A;  3PX6 A;  1VQ7 N;  1MWM A;  3ZT0 A;  3AVI A;  1MA9 B;  1L3U A;  3NF9 A;  4RW6 A;  3QEW A;  5TKW A;  3H45 C;  3WEE A;  4B1X B;  3VEW A;  1BWF O;  2HBK A;  4FJN A;  4YOU A;  4BQL A;  3K5M A;  4QS9 A;  4XH1 A;  4JRP A;  4DSE A;  2OYQ A;  3SPZ A;  4H5V A;  4FLV A;  5JMV A;  4NCB A;  4BDY A;  2IOC A;  5KRS A;  4X62 K;  1J5O A;  3VQ9 A;  4DSJ A;  5F1X A;  4JKA A;  4KH6 A;  3L6Q A;  3F9M A;  1WSE A;  3V9U A;  1C6V A;  5KPZ A;  4C8O A;  4BAC A;  4NYN A;  1ATN A;  4YNQ A;  3KD5 E;  3SBG A;  3J7A P;  4YOX A;  4FW2 A;  2OZM A;  1TGO A;  4OLA A;  2E6M A;  2NRT A;  3S41 A;  3OS1 A;  3HT3 A;  1DT9 A;  1S1U A;  3L2V A;  2FLO A;  4OLB A;  1KQS M;  4DTM A;  3NVK A;  3AO3 A;  3QEX A;  1DKG D;  3KK7 A;  3O1B A;  3LZI A;  1GOA A;  1ZBL A;  2A41 A;  3H3N O;  1VSJ A;  2F9W A;  2A42 A;  2VQE K;  2PYJ A;  4HUG A;  1EXQ A;  4CEB A;  2CGK A;  1QVG M;  3O9U A;  4NXM K;  4PL8 A;  4GKK K;  4QOZ B;  3I56 N;  4FYD A;  3EN9 A;  1HNW K;  3MMV A;  4CW7 B;  5BRH A;  4MDB A;  3DXK B;  4OGE A;  4CZK A;  3CME N;  1W9H A;  3ZX0 A;  1BG3 A;  1TK0 A;  1HX1 A;  3ALY A;  2Z1H A;  3G4S N;  3SYZ A;  4BRP A;  2NRR A;  3HST B;  2OTJ N;  1JCE A;  3T1A A;  2Y1I A;  2Q0U A;  1VQK N;  1BOT O;  4X65 K;  3QDK A;  1TAQ A;  3DMJ A;  1OVY A;  3ISN C;  2G8U A;  1NGD A;  5F2R A;  4K8Z A;  4E7L A;  1D8Y A;  5ADX H;  3VEX A;  1KVA A;  1JLE A;  4CJR A;  1U6Z A;  1HYS A;  5AZI B;  3ZT4 A;  1D9F A;  3KHY A;  2D0C A;  3H08 A;  2ZM6 K;  4EHT A;  4RCH A;  2G8W A;  3TWH A;  1FKO A;  3MCP A;  4H5N A;  5M1K A;  4WYB A;  1N8R O;  3CQX A;  3VQP A;  1HR0 K;  4Y1C A;  2Q36 A;  2QWO A;  1VQN N;  3R1X A;  5AQQ A;  3SNN A;  4Z4C A;  4BE0 A;  3CCR N;  2WBN A;  2E1Z A;  3HYF A;  3GBT A;  2VWB A;  4DTO A;  4CIF A;  3DJC A;  1NLV A;  3VEV A;  4DUY K;  1QSS A;  1B9D A;  3RR7 A;  4CBW A;  4CFC A;  3TTF A;  3VPZ A;  3QET A;  3MXM A;  1NJZ A;  3OYK A;  4NO7 A;  1BIZ A;  1NGG A;  4YHH K;  3IMX A;  4B9V A;  3H1V X;  5CZ2 A;  3HM9 A;  3SPY A;  2BH1 A;  4JS5 A;  3LZJ A;  3CC7 N;  3VEZ A;  4CEZ A;  2RN2 A;  4BRK A;  1QHA A;  3C7N B;  3OYJ A;  3DXK A;  3WXJ A;  2GWJ A;  4MO5 A;  2QKK A;  3CFP A;  4FOI A;  3LAL A;  5MLC Q;  4DV2 K;  3AAQ A;  1YAG A;  1C1C A;  3AA5 X;  3TAE A;  1NGI A;  1T6C A;  1GLJ O;  1ATS A;  1RCH A;  4CZJ A;  4XIU A;  4M3R A;  4C1N I;  4QS8 A;  1ILY A;  1ZBF A;  3MN7 A;  1HQE A;  2Z1I A;  4E0D A;  3SMS A;  2W6K A;  4UQG A;  3DRP A;  3K58 A;  3TAF A;  1EP4 A;  1SL1 A;  1T8E A;  1BA0 A;  1S1X A;  4MLE A;  3V9W A;  1TUU A;  5BPN A;  2RHK A;  1I94 K;  4FL9 A;  4CBX A;  1MDU B;  4DFJ A;  5DM7 L;  5AZI A;  4N47 A;  1JLQ A;  3AV9 A;  3OS0 A;  4LH5 A;  1VHX A;  4FJ7 A;  4M45 A;  2NRZ A;  4HTL A;  4R5P A;  4WF9 L;  4MO4 A;  5CZ1 A;  2HHV A;  4M7Y A;  1UA1 A;  3DRS A;  2HMI A;  4DQQ A;  2BE2 A;  3ZSZ A;  2P51 A;  1HNV A;  3W3D A;  1QVF M;  2E2Q A;  3SBT A;  2ASM A;  1YXQ A;  3PIP L;  4HTU A;  4E1M A;  3SQ0 A;  3MN6 A;  4FSV A;  3FFK B;  2G8H A;  4EIA A;  1J53 A;  4JK8 A;  1HKB A;  2X6N A;  3TAM A;  3V6D A;  3CJ9 A;  4CJU A;  4WE1 A;  3DYA A;  1SL0 A;  1NKC A;  3IG1 A;  4CEO A;  5JS1 A;  1HYZ A;  2E2N A;  3CCL N;  3A5N C;  3OYM A;  1YI2 N;  3V1Q A;  5TKY A;  3CFO A;  3I55 N;  1KXP A;  3ZX2 A;  1HNZ K;  1RT3 A;  1NG9 A;  4ILH A;  3C7N A;  5HRO A;  4E1N A;  1RDA A;  5GAG P;  2BAN A;  1WAF A;  4CGD A;  1GLD G;  4KRF A;  2HF4 A;  3LAN A;  5JVG L;  3WNE A;  3O9S A;  2E88 A;  4I7F A;  1NMD A;  2Z1J A;  5AQV A;  1HNI A;  4BR2 A;  3AVJ A;  4LF5 K;  1KVC A;  3QIP A;  5AQP A;  3TSQ A;  3ZT3 A;  3EE9 A;  1LW2 A;  2OZS A;  3BDP A;  1GLF O;  2G8F A;  1DEJ A;  1NWK A;  3FZM A;  4CIG A;  4LY7 A;  5F0X A;  3THY B;  4JI4 K;  4CCH A;  4CZG A;  3U8X A;  3KVG A;  4LF8 K;  4B08 A;  1BA1 A;  5M1Q A;  4CI6 A;  3RTV A;  2FC0 A;  4IZ9 A;  4KPY A;  3DXM B;  5BN9 A;  1NJW A;  2P5O A;  1NM1 A;  4CF0 A;  3MDQ A;  3LDS A;  2E2P A;  4BRF A;  2E20 A;  4I9L A;  3S9H A;  4C8N A;  4PY5 A;  3CPE A;  4CJ5 A;  1EWQ A;  1ZBH A;  1NJI O;  2P5G A;  3P5J A;  1D9D A;  1ITG A;  3J7Y P;  2VG5 A;  4FCY A;  2Q1N A;  1VSD A;  3NE6 A;  3K9K A;  1DLO A;  1SUQ A;  4Z4G A;  3BZC A;  5J2Q A;  3RRH A;  4KKO A;  3H3O B;  4B1Z A;  1ESV A;  3K5L A;  1NK6 A;  5AQK A;  3VQ4 A;  4BDP A;  3MXJ A;  3HL8 A;  3TTC A;  3DLL L;  4RW7 A;  2HHU A;  3B6O A;  5LMN K;  3C95 A;  5AQG A;  3LP0 A;  1T05 A;  1JL1 A;  4C1N K;  4BE2 A;  4ISG A;  4ID1 A;  1FW6 A;  5JLF A;  1XHZ A;  2HVI A;  3EO3 A;  3MWT A;  3J81 O;  1VQO N;  1A5V A;  1P8Z A;  2CGL A;  3SCX A;  4DWI A;  1IKW A;  2HBL A;  5J2P A;  1ZC6 A;  3DLG A;  2KKZ A;  3CJ7 A;  2DFH A;  1YHQ N;  2ZJQ L;  2LSN A;  4LF7 K;  5CYM A;  1N33 K; 
#chains in the Genus database with same CATH homology
 1EQY A;  5EY4 A;  2P9K B;  5AQL A;  5I9E B;  5M1F A;  3BF3 A;  2W41 A;  5AQS A;  3CCQ N;  4H03 B;  3VF4 A;  1HUX A;  3M1F A;  4KBO A;  5BR9 A;  1NGH A;  4PKI A;  4H5W A;  5AQY A;  4BVP A;  1E4G T;  3SAG A;  2QXL A;  4NLC A;  3VTH A;  3E9O A;  3MCA B;  2BUP A;  3CHW A;  1IG8 A;  4DB3 A;  1YF5 L;  4B1U B;  4I6M A;  3HZ6 A;  2V52 B;  3OBY A;  1SQK A;  3CCV N;  3DXM A;  4O5F A;  4JD2 B;  4A5B A;  4EHU A;  3PIO L;  2HMP A;  3Q7B A;  3CCM N;  1NGA A;  2YHW A;  4A2B A;  2CH6 A;  3LM2 A;  4DQ8 A;  3KWI A;  1K8K A;  5GIN A;  4M7X A;  3D2F B;  4BRM A;  4FWL A;  3QIC A;  1S22 A;  2YHX A;  3ID6 A;  4ISE A;  5AFU H;  1K73 O;  4BVO A;  2NNW A;  4CD3 A;  2NRH A;  2A3Z A;  2A5X A;  3W0L A;  4CD1 A;  1LOT B;  2PAV A;  2QW9 A;  2A6A A;  3MN5 A;  4O8U A;  4H0T B;  4KH4 A;  2ZGY A;  3TU5 A;  3MN9 A;  3VES A;  3WQU A;  3CCE N;  5FPN A;  1GLA G;  4XEI A;  3WQT A;  1YIT N;  4CZL A;  1VQ7 N;  1MWM A;  1MA9 B;  3FZL A;  5C2D A;  3D2E B;  3L0Q A;  5TKW A;  3CIP A;  1LCU A;  3H45 C;  3WEE A;  3VEW A;  2W40 A;  4B1X B;  3VF2 A;  3PLA A;  1BWF O;  2HBK A;  4YOU A;  4IO9 L;  4BQL A;  3F2K A;  4RWT A;  3ZYY X;  4QS9 A;  1QQO A;  4XH1 A;  3O9R A;  4JHD B;  3G25 A;  4H5V A;  5JMV A;  5AQN A;  4H0O A;  3E9L A;  1GLL O;  4J8F A;  4O8K A;  1Q81 O;  4B9Q A;  5F1X A;  4JKA A;  4KH6 A;  2UYT A;  3RSE B;  3L6Q A;  3C6A A;  1QQN A;  3F9M A;  4FPA A;  4BGB A;  5FPD A;  5JVH L;  3HOS A;  3HSC A;  1XUP O;  5KPZ A;  4YOV A;  3JXU A;  4FWR A;  1ATN A;  1U2V A;  5AQJ A;  3SBG A;  4OO1 J;  4BC3 A;  1HPM A;  4JKE A;  3GE1 A;  4YOX A;  4FWP A;  1VQ9 N;  3CXC M;  5EX5 A;  4CBU A;  3O9Q A;  1SZ2 A;  1WUA A;  2NRT A;  3S41 A;  5GAD P;  4R79 A;  5BRE A;  2P9N A;  1DT9 A;  3QBW A;  3ULE B;  2P9L A;  2FLO A;  3M5R A;  5EOY A;  4FWQ A;  1KQS M;  3NVK A;  3DAW A;  3WXI A;  1DKG D;  3KK7 A;  3O1B A;  2QTD A;  2A41 A;  3H3N O;  2F9W A;  2A42 A;  2D0P A;  3O6W A;  3I56 N;  3ZEU B;  2AP1 A;  4BRD A;  3NMU A;  2FSN A;  5AQU A;  3R8E A;  2P9K A;  4GY2 B;  5AQT A;  3WXL A;  1P90 A;  3B8A X;  2CGK A;  4WFB L;  1QVG M;  1S3X A;  3O9U A;  4PL8 A;  4XH4 A;  1ZXO A;  5MLC Q;  2YJF A;  2QWR A;  3N4P A;  4WQ4 A;  3I33 A;  3CET A;  2NRW A;  3A5M C;  3EN9 A;  4EAH D;  2WFB A;  4K42 A;  3MMV A;  4U67 L;  3G71 N;  2D1K A;  3AAR A;  4BG8 A;  4JNE A;  5BRH A;  4MDB A;  1RDU A;  3DXK B;  3WXK A;  5AR0 A;  4IO8 A;  4CZK A;  3CME N;  3ZX0 A;  3LM9 A;  1BG3 A;  4IEI A;  1HX1 A;  4IOX A;  1KD1 O;  4JD2 A;  4IJN A;  3ZET B;  3G4S N;  1W97 L;  2PBD A;  5AQF A;  4BRP A;  2NRR A;  2I7N A;  2RE2 A;  2OTJ N;  1JCE A;  1R59 O;  2ITM A;  3O8M A;  3C6H A;  4WFN L;  2Q0U A;  3SAF A;  3D2F A;  1VQK N;  2ZF5 O;  1VQP N;  1BOT O;  3G6E N;  1CZA N;  3O9T A;  3QDK A;  3TSU A;  1E4F T;  4A62 A;  4CJ7 A;  3VF6 A;  2QM1 A;  1KAY A;  2WUS A;  4IOC L;  3KZB A;  2ASP A;  3T69 A;  1OVY A;  3QB0 A;  3MX5 A;  1NGD A;  5F2R A;  3M6G A;  4CZH A;  3E1Y A;  1NGJ A;  4IEE A;  5ADX H;  3VEX A;  1JJ2 M;  1X3N A;  3D2E A;  4BR0 A;  4B1Y B;  4JK9 A;  4A5A A;  5AQM A;  3SK3 A;  1U6Z A;  2QI2 A;  5AZI B;  1NBW A;  3KHY A;  1J6Z A;  3CER A;  1KC8 O;  1K8A O;  3EE8 A;  4WQ4 C;  3TPQ A;  3TSP A;  3N4Q A;  3CD6 N;  4BRE A;  3LDQ A;  2ZJP L;  4DKW A;  4JHD A;  4EHT A;  5HL7 L;  4RCH A;  3LDL A;  3O5B A;  3E66 A;  2DPN A;  4H0P A;  2QWQ A;  1HKG A;  3CI5 A;  3MCP A;  4H5N A;  4WYB A;  4PHT X;  5M1K A;  1N8R O;  3CQX A;  4ISF A;  5LJW A;  2YJE A;  4CZF A;  3SMP A;  3UKR B;  2Q36 A;  3CF5 L;  2OTL N;  2QWO A;  2NZT A;  1TYQ B;  5EVZ A;  3RSE A;  5GAE P;  2ZJR L;  1VQ6 N;  1VQN N;  4Z94 A;  3R1X A;  5AQQ A;  2WC9 A;  2GWK A;  3D7E O;  4H0V B;  5ELZ A;  1G99 A;  3QML A;  3CCU N;  2FSJ A;  2HBM A;  3CCR N;  3SLC A;  3ENO A;  4FO0 A;  2WBN A;  5KPT A;  2GEL A;  2E1Z A;  1T3V A;  3GBT A;  2NLX A;  2VWB A;  2VYP A;  3C0B A;  3A5O C;  3VMF B;  4K43 A;  3DJC A;  5FPM A;  1NLV A;  3VEV A;  4DHY A;  4CBW A;  3AGK A;  1VQ5 N;  3BEX A;  1NGF A;  4K41 A;  3H6E A;  3TTF A;  2QWM A;  3VEO A;  3VPZ A;  2P9P B;  4FWM A;  3BUZ B;  2HBJ A;  5GAH P;  3CJA A;  4NO7 A;  3CC4 N;  4WQ5 C;  1NGG A;  3IMX A;  4B1W B;  1RDW X;  3O4W A;  5C15 A;  3H1V X;  4ILG B;  4JKH A;  3FZF A;  4BC2 A;  5KPR A;  2P9S B;  3ZEU A;  2Q97 A;  1Z05 A;  4IFE A;  3L4Q A;  5C10 A;  1BUP A;  2JWL A;  1M90 O;  1ATR A;  3GG4 A;  2BH1 A;  3IKM A;  4A61 A;  4FWO A;  2QWN A;  1SS6 A;  4KH5 A;  3CC7 N;  1X3M A;  1YUW A;  2FF3 B;  3VEZ A;  5C0Y A;  4BRK A;  3A5L C;  4YDU C;  3UE5 A;  1JCF A;  1QHA A;  1Q82 O;  4EFH A;  3C7N B;  1V4S A;  3DXK A;  3FZK A;  2GWJ A;  3WXJ A;  4MO5 A;  2H3G X;  1Z6R A;  1S72 N;  1C0G A;  1YVN A;  2EWS A;  3Q7C A;  1GLE G;  4PKH A;  4YOT A;  4FOI A;  5AZJ B;  4A57 A;  3FR0 A;  2IVP A;  3TTD A;  3VGL A;  3AAQ A;  3ZET A;  5CE3 A;  2CGJ A;  5LJV A;  1YAG A;  5AQI A;  2CH5 A;  3K9J A;  1D4X A;  3CCS N;  3ENH A;  1NGI A;  1T6C A;  1VAZ A;  1GLJ O;  1ATS A;  5M1P A;  3O1W A;  3EZW A;  3F5T A;  4BR5 A;  4CZJ A;  4OPA A;  4UY8 O;  3FE1 A;  4C1N I;  3HM8 A;  4QS8 A;  4IJA A;  4A2A A;  1ILY A;  2ZGZ A;  3EKU A;  3AAP A;  3MN7 A;  2ZWH A;  3HTV A;  3ZX3 A;  4BG9 A;  1YJ9 N;  3HI0 A;  2JWK A;  5C2F A;  3SMS A;  3WUH A;  2VGM A;  1BA0 A;  4MLE A;  2OAN A;  1TUU A;  1VQL N;  4FWK A;  5BPN A;  1XC3 A;  1DGK N;  2RHK A;  1ZBS A;  3ENB A;  3P4I A;  4FL9 A;  4CBX A;  1MDU B;  4BRC A;  1QZ6 A;  2GUP A;  4MLH A;  2P9I B;  3AY9 A;  5AZI A;  5DM7 L;  4AM7 A;  3UB5 A;  3R6M A;  4FVU A;  4OPH A;  4FWS A;  3LDP A;  1VQ8 N;  3RVC A;  2NRZ A;  1YJW N;  4HTL A;  5AFU A;  4WF9 L;  1O13 A;  4MO4 A;  3CCJ N;  3M3Z A;  4M7Y A;  3ATU A;  4E1J A;  4H0Y B;  1QZ5 A;  4BRQ A;  3WXM B;  3T7Z A;  3UKR A;  1TYQ A;  3FGU A;  3VGM A;  3WT0 A;  3VER A;  1H1V A;  2A40 A;  1K9M O;  1HJO A;  3A8Y A;  3W3D A;  3UKU B;  2E2Q A;  4M63 C;  3SBT A;  1QVF M;  2ASM A;  3LDN A;  1YXQ A;  2IIR A;  3PIP L;  1U2V B;  5FPE A;  4JEP A;  3MN6 A;  4FSV A;  3CC2 N;  2P9U B;  3FFK B;  3GL1 A;  4AF1 A;  4WQ5 A;  4EIA A;  4JK8 A;  2I7P A;  1HKB A;  2FXU A;  5M1O A;  2P9P A;  5GIP A;  3CJ9 A;  3QFP A;  2YI1 A;  1RFQ A;  4PL7 A;  3QFU A;  4BQZ A;  3DWL A;  2AA4 A;  2E2O A;  3IDH A;  2E2N A;  1W2B M;  3CCL N;  5BRF A;  3A5N C;  2P9S A;  4CZM A;  4YOW A;  1YI2 N;  1XQS C;  4JKF A;  4BRI A;  2D4W A;  5TKY A;  3I55 N;  3VTI A;  1KXP A;  4YDU A;  3ZX2 A;  1SAZ A;  3A0I X;  4YOY A;  4BR7 A;  2GEM A;  2J4R A;  2GTD A;  5M1N A;  4NLB A;  4IXC A;  4C23 A;  1GLB G;  3CJB A;  2V7Y A;  5JLH A;  4ILH A;  5C12 A;  3C7N A;  2QWL A;  3O80 A;  5CHI A;  3GDQ A;  2IVN A;  3FLC O;  5LY3 A;  4JKG B;  3D6R A;  3EL2 A;  4QS7 A;  5GAG P;  3CPW M;  5AZJ A;  3U4L A;  2V51 B;  1GLD G;  3P39 A;  2HF4 A;  4IWV A;  4BRN A;  3LL3 A;  2E1Y A;  5H1S Q;  1QQM A;  1Q18 A;  1TUY A;  5E84 A;  3OW2 M;  4RTF D;  3OHR A;  3C65 A;  3ULE A;  5B8H A;  5JVG L;  1BDG A;  3O9S A;  2E88 A;  3U9D A;  1NMD A;  4XH5 A;  5AQV A;  3R3L A;  3VET A;  5KQ8 A;  4BR2 A;  4GV3 A;  1NGE A;  4H0X B;  3EKS A;  3MX2 A;  4YOR A;  4K25 A;  3VEN A;  4WFA L;  4BRA A;  2Q0R A;  5AQP A;  3TSQ A;  2D0O A;  4CZI A;  1KAZ A;  3EE9 A;  2PFU A;  3ATV A;  2Q31 A;  3OA9 A;  4FWN A;  1GLF O;  4LC9 B;  4BR9 A;  3P38 A;  3H46 O;  1Y64 A;  5GIO A;  3IFR A;  1T44 A;  1DEJ A;  1NWK A;  3FZM A;  3VOV A;  3MWP A;  2QWP A;  5F0X A;  1YIJ N;  5AQZ A;  4CZG A;  3L4I A;  5AQR A;  3SAH A;  3U8X A;  3HBT A;  1Q86 O;  2P9I A;  5KQD A;  3KVG A;  3CQY A;  3IUC A;  4PKG A;  1BA1 A;  5M1Q A;  4CI6 A;  2KHO A;  2FSK A;  2NRV A;  1BO5 O;  2YHY A;  3R9P A;  3J8A A;  4IZ9 A;  2V7Z A;  4I6M B;  5AQW A;  2HF3 A;  1RGI A;  2F9T A;  3OBW A;  4BR4 A;  3DXM B;  2BTF A;  2YX6 A;  5BN9 A;  3NVM A;  1NM1 A;  5E26 A;  2KLA A;  3MK6 A;  3KWG A;  1BU6 O;  1IJJ A;  3HRG A;  3AGR A;  3CJ1 A;  3MDQ A;  4A59 A;  4GV6 A;  2E2P A;  1K8K B;  2E20 A;  4BRF A;  3BF1 A;  4JK7 A;  5AQO A;  3LDO A;  4JKC A;  3CPE A;  5ADX A;  2QEX N;  3UKU A;  5EXW A;  1NJI O;  3ID8 A;  1YJN N;  4BRG A;  1OKJ A;  2P9U A;  2QA4 N;  2Q1N A;  3K9K A;  5BPM A;  2VGN A;  3CMA N;  2HOE A;  3HOT A;  1NGB A;  1C0F A;  4WCE L;  4BC5 A;  5BRD A;  1V4T A;  2F7T A;  3H3O B;  4FPB A;  1HKC A;  3WEE B;  1ESV A;  3O08 A;  4B1Z A;  4BRL A;  5AQK A;  5BPL A;  4Y0W A;  4L3Q A;  4JN4 A;  3TTC A;  4IDH A;  3DLL L;  4BC4 A;  4AM6 A;  1VQ4 N;  1Q7Y O;  4JKD A;  1KAX A;  1NGC A;  5AQG A;  3FZH A;  4FOE A;  1MWK A;  3H1Q A;  5AQH A;  1M1K O;  4GV9 A;  2Q2R A;  4H5T A;  4JAX A;  1JCG A;  1GLC G;  4C1N K;  4G9Z A;  2E8A A;  1HLU A;  3P31 A;  4GNI A;  4ISG A;  4BGA A;  3BP8 A;  3VEY A;  4IOA L;  4NB4 A;  4B1V A;  4CZE A;  5JLF A;  3EO3 A;  4JKG A;  3MWT A;  2HST A;  3J7Z O;  1VQO N;  4BRH A;  3SJH A;  1P8Z A;  2CGL A;  4F9O A;  1EO1 A;  4GVE A;  5JIC A;  4H5R A;  4HWI A;  2HBL A;  2IVO A;  1ZC6 A;  3QBX A;  1T6D A;  2VCP A;  3CJC A;  2KKZ A;  3CJ7 A;  3E9P A;  5HOO A;  2P9N B;  4BY9 C;  4U7B A;  2P9L B;  4MDA A;  4JKB A;  2ASO A;  5BN8 A;  2YCH A;  3GOI A;  5CR4 A;  3JS6 A;  5AQX A;  3VGK A;  2ZJQ L;  1YHQ N;  2FF6 A;  4ILJ A;  1X9J A;  3U9Z A;  1WOQ A;  4DCH A;  1VQM N;  2GX9 A;  3I8B A;  4BRO A;  5DM6 L;  2NRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...