3V81A

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and the nonnucleoside inhibitor nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v81A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v81A05
5F8IA 2F8TA 1IKXA 4NRTA 3S9HA 4ELUA 2JEGA 1S9EA 4N5SA 3KD1E 2XY6A 2C2EA 2WONB 3BJYA 4BACA 4FK2A 1ZTTA 1ZBIA 4NYFA 3T19A 1RT5A 3K57A 4LQ3A 3SNNA 4CFBA 3PUFA 1JLQA 2IS3A 3OL6A 2R8KA 1HMVB 2BGGA 2ILYA 3CYMA 2FVCA 1TKXB 2OPPB 3JYTB 3ZSOA 3GYNA 3H98A 3OJSA 4QWBA 1BI4A 1HARA 4RU9A 3EPGA 1C2PA 2HMIB 1TP7A 1C0UB 4DTJA 4YR0A 3C95A 1KHWA 3MR6A 4ED8A 5K14B 4FBTA 4JV2A 2BANB 3I5CA 4YR2A 4ECSA 1TL1A 5KFZA 4O4GB 2OPPA 1C1CA 4B9NA 4RW8A 1ZBLA 1JKHB 3DMJB 4FJ9A 3NL0A 1FKOB 1HNIA 3KHRA 4NYZA 1C0UA 2C2RA 2HHSA 3QIDA 3HPGA 3N6NA 5C25A 3DLKA 3OYMA 3C6TB 1S9FA 5KTQA 2E9TA 3BQ2A 1QAIA 1W9HA 3PW5A 4BDPA 1UA0A 3QNNA 4ZPAA 4DSEA 4J9RA 1IKWA 1NJYA 4Q45A 1J54A 4ICLB 4HHTA 1BQNA 3CIZA 1KSPA 5I3UA 3QNOA 5DMRA 1GOBA 3AVIA 2ASJA 1JLAA 4MIAA 3DOKA 2BE2A 2FLPA 1RT3B 1LWCB 3OJUA 2Z1GA 4IG0B 4CCHA 5F8GA 4KB1A 1JLEA 1RT2A 1SUQB 2AGPA 2V9WA 3AVBA 5J2QB 2V4RA 3MFHA 4Y3CA 4CHYA 2X6SA 4URQU 4CJSA 2HHTA 1EP4A 5KFPA 3LP1B 1TK5A 3IRXB 2ZE2A 4FM1A 4CEAA 4CJPA 2UUWA 4ZVEA 4ID1A 3DOKB 4U7CA 4L8RB 2RDIA 4O0IA 2GV9A 4FM0A 1HJRA 4J9KA 1JLGA 3RMAA 5KFWA 2WOMB 5KG4A 4JS5A 4PWDA 3HXMA 3SPYA 2W9BB 2HB5A 1QSSA 4WFZA 4M3ZA 3L2RA 3LP0A 5CZ2A 4K8XA 3CWJA 5L1LA 3HP9A 5KFQA 3V6JA 4K4ZA 3VQ6A 2RF2B 4DL6A 4O3NA 1DTTA 2XCAA 3OYAA 4M3XA 3HO1A 1S6PB 3FQLA 4DU4A 3HKWA 1S1TB 4O44B 2XY5A 4CEQA 5KFHA 3ISNC 2ASDA 1QAJA 4ED0A 3OYLA 1SH3A 1NK4A 3T5JA 2VG6A 1VRUB 5I3UB 1NK7A 4C8MA 4RW7B 4LSNB 4CGHA 5F8MA 2GIRA 5KG7A 2HVHA 4O3QA 5C24A 3MECB 4IRKA 3KK2B 3V4IB 3LPUA 5KRSA 1WAFA 1X9WA 4EBDA 1X1PA 4I2QA 5KT6A 5CY4A 3B6OA 3RB3A 3KLHB 3V81A 1S97A 3L3UA 3IRXA 1S6QA 3NGZA 2IOCA 4ECWA 1JKHA 4Q8FA 3TAFA 4J9SA 4KAIA 2BR0A 4ECVA 3DLKB 5KFCA 1G15A 5HRSA 2W7OA 3L2VA 2FVRA 4TYAA 2WRMA 4CEDA 4OGEA 3TAMB 3HT3A 4DSKA 4FLVA 3MEEB 1VRTB 2ZQBA 3AVLA 4DQQA 5HROB 1B9DA 2R8HA 1BIZA 1RDDA 4DU3A 1TKXA 1JL2A 3HJFA 2YKNA 4MFBB 2HAIA 2X74A 3MTKA 3PW4A 1L5UA 1ZYQA 4E7HA 2J6UA 1TKZB 2X6NA 5J2MA 3PY8A 3LP2A 3AVJA 1WSJA 3NF8A 4ZHRA 4M95A 4FS2A 2OH2A 1VRTA 1UOCA 3AO3A 4FVMA 1RTJA 3DOLB 1LWFA 4IQXA 4W5QA 4W5TA 2IJNA 4QWDA 1BCOA 1ZBUA 3CG7A 2DY4A 1RT4B 4O3OA 3OYDA 1WSIA 3CJ3A 4EYIB 3RR8A 3PJXA 1XWLA 2KTQA 1HQEB 1I39A 3IN5A 3OS1A 3H4DA 1ZBFA 4ZMMA 4ELTA 2J6SA 2YNGB 5E41A 4B8CA 4J2AA 3KHHA 5KGXA 5KG0A 2Z1HA 3SPZA 1UWBA 3E01A 3KLHA 2AWZA 1NKBA 2CJQA 3D28A 2YV0X 1I3AA 3KLFB 4AHCA 1BQMA 2OPSA 4FJXA 1R0AA 1VK0A 3KLEB 1KLMA 4DTNA 3MECA 4CK3A 2VWKA 3ZT1A 4FW1A 3MR3A 4DTMA 1C6VA 3IGNA 4OKEA 4KHRA 3OYKA 1WN7A 1KVCA 1RT5B 4CHZA 2F8SA 1RT6A 4MKBA 4KKOA 2XWYA 3CQ8A 1BIUA 3ZSRA 4CFDA 1Q9YA 4UQGA 1RBTA 1RDAA 1NK6A 3TANA 1JLEB 1SUQA 5EWFA 1KTQA 2UUTA 3RMDA 1NK0A 2G8HA 1SKRA 1HQUB 3DDKA 2HHQA 5C42A 4NYNA 4B3OB 2A1RA 3A2FA 3H40A 4CJEA 3OYFA 3G6XA 4KKOB 3O4NA 1B9FA 4RUCA 4QOZB 4CJRA 1JLGB 1XC9A 2G8IA 4PWDB 2OA8A 3N6MA 2WHOA 1DLOA 5KFYA 1EETA 3RRGA 4ZP7A 4M94A 3H59A 3KKSA 4C8NA 3DRSB 5EWGA 4Z4CA 5KFLA 1D9FA 3G10A 4W5OA 3VA3A 4M3RA 4DS5A 1XR6A 4F4XA 2YNGA 1RBUA 3BGRA 4YQWA 1YVFA 4CJQA 2D7SA 1UA1A 3AVAA 2FLLA 4DTPA 4E89A 3MFIA 4KAZA 1RT2B 4Q0BB 4XIUA 1RT6B 1RT3A 1LW0A 4MFBA 2HWIA 1JLAB 3I8DA 1TQLA 5DGBA 3MEGA 1S48A 4K4WA 5HROA 3MXIA 4E1MA 3QEWA 3OL9A 5HP1A 1TKZA 2HNZB 5JUMA 4NLUA 3QIOA 3ZT0A 4CESA 4KPYA 4ID5B 4CIFA 1SKSA 2FBTA 3CJ4A 3BSNA 4IFVA 2G8WA 5J2NA 1RT7A 2EC0A 3OLBA 3AV9A 3AO5A 4FJHA 1SL0A 5KFXA 4KTZA 4KSEB 4KB0A 1KFDA 4IKAA 3QGGA 1W25A 4H4MA 4KREA 3TABA 2V0NA 1DLOB 3IS9B 3CFOA 4WZMA 3UIQA 4YP3A 3KJVB 2FJWA 5KT4A 2JEIA 4Y34A 3ZCMA 2IMWP 4Y2CA 1C1BA 1LW2A 3G6YA 2YNFB 4R0EA 2VG6B 1WAJA 4HKQA 3UPFA 3AVMA 2F96A 4ZTFA 4B9LA 2XGQA 1KCFA 3GV7B 4E7KA 3WNFA 1RTHA 4KO0A 4MQ3A 5CYMB 3TVKA 1VSKA 4B9VA 3L2QA 3NBPB 3QEVA 2BQRA 4ZVGA 3AVNA 1S1UB 4FJGA 1L3TA 3BR9A 3VQ5A 2RKIB 4CEFA 4QWCA 3MEGB 2R2SA 1IO2A 4EZ6A 4HUGA 1C0TA 4QPXA 4U6PA 4K4YA 5KFNA 3KK3B 3PO4A 1VSIA 3TI0A 5T14A 4J2EA 4ZPDA 2AU0A 3T1AA 5D3GB 2QKBA 4F8RA 5KT3A 4WFYA 3LAMA 3MXJA 1S1XB 5DG7A 2HNYB 4R5PA 4RNFA 3MF5A 2OPQB 1JLCA 4IH6A 5DQIA 2BE2B 3GQCA 4NLQA 1SH2A 3NF7A 1T94A 4NLWA 5JXSA 3DLGB 4ED2A 4CJ5A 2CKWA 2HHWA 1IG9A 3EY1A 1SV5A 5KFUA 2QV6A 4OVLA 2YKMA 3QIPA 2I5JB 1IM4A 2WB4A 1N4LA 3SYZA 4NLRA 3JSMA 4DTRA 5FRNA 3M8QB 1HRHA 4QWAA 1KFSA 4F3TA 4Q43A 2WCXA 3NE6A 5DG8A 3H08A 3V81B 2IM3A 3FDSA 1MMLA 1RTDB 4M41A 2ASLA 3QGIA 4FLXA 2HW3A 3FFIB 1HPZB 3BSOA 3PX4A 4ICLA 4IBNA 2YKMB 1RTHB 4KO0B 2Y1IA 4ECXA 4FM2A 4DL7A 5DLFA 1JLBB 2FJXA 4Z4HA 4IFYB 2EX3A 3K5NA 1S1VB 1Z26A 4RG8A 3LAKA 4RW6B 1QUVA 3NHGA 4MKAA 4DFJA 4YR3A 4O4GA 3SQ1A 4F2SA 4DF4A 3K5MA 4Z0UA 2BANA 3H4BA 4OJRA 4RNMA 4H4OB 4J9PA 3DRRB 3KK1A 3B6PA 2FVQA 3CJ5A 1C1CB 1S1XA 3DRSA 2XHBA 3DMJA 1D5AA 2O4GA 1QTMA 3AVKA 4TYBA 3TAEA 1Y97A 1S1WB 3QINA 3G86A 1FK9B 4FLUA 4KV8A 1L3SA 5KT7A 4DSIA 4KBIA 4NLYA 1WLJA 4M3WA 1SL1A 3TWHA 1TKTA 2VG5A 3TAPA 1VSHA 4CJ4A 2B43A 4PQUB 1U48A 4NLOA 3I0RA 4IG3B 1IKYB 1A5XA 2P51A 3BSAA 2QE5A 2KQ2A 5SWMA 2YNHB 1U45A 3FSIA 4TXSA 4KHMA 1XR7A 3HPOA 5C42B 4IG0A 3K58A 3JYTA 2VA3A 4E3SA 3TAGA 1T7PA 2YKNB 1EP4B 4ID5A 3HVTB 2E9ZA 4CGDA 1JLFB 3OL8A 4TLRA 1EKEA 2ILZA 3OYHA 2ITGA 1RT1A 1L3UA 3NH0A 3ZT3A 3KLVA 3M8RA 5KI6A 4H54A 4KB7A 1TV6A 2ZD1A 4LH5A 1QE1B 4PA1A 2KZZA 3HK2A 1FXXA 4H4MB 3RB0A 1L3VA 2JEJA 1C0MA 2GBZA 4H4OA 3KK2A 4K4UA 5J1EA 5CYQA 4N56A 2UVVA 5C25B 4CJKA 2B4JA 1IKWB 4NLGA 4B8AB 3RMBA 1VSMA 3LWMA 3VQQA 3M9MB 2BRLA 3HVWA 2XY7A 3UR0A 1JXBA 2XI2A 2O4IA 4CGGA 3QESA 2VWJA 3RRHA 4WE1A 3QGHA 3S3OA 1OS5A 2I1RA 1JL1A 1LWCA 4IOBA 3JSMB 5SZTA 4BDYA 2ZKUA 4WYWA 3ITHB 1A5WA 1C1AA 1RTDA 4RW7A 4Y1DA 2QKKA 3SUQA 3M8QA 4LSLB 4O3PA 1IKXB 1VSFA 4ECUA 2D3UA 1FKPB 4IFYA 1QS4A 1DTQA 1NHUA 2Z1IA 3P1GA 5C5JA 3MR2A 4K4VA 3KOAA 4LD0A 4JS4A 2YNIB 2IAJB 1ZTWA 4CF9A 3SUNA 3V1OA 4J9OA 1W0HA 2FC0A 3BQ1A 2R2RA 3U3GA 4Z4GA 1CXQA 1JIHA 2VG7B 1HYZA 4KHYA 2HNYA 1TKDA 4CGIA 4Q8EA 2FBVA 3KD5E 3CM5A 3SQ4A 3NGIA 4GC6A 4M42A 1WNEA 4AHVA 1JLCB 4CHQA 1BL3A 3OVNA 3C6UB 1FK9A 3M8PA 1HYVA 5KFMA 2DFHA 3QEIA 4FBUA 4MK7A 4DL4A 5DK5A 3HHKA 3VN5A 4F2RA 1Q9XA 4IR9A 3UQSA 4NCBA 2R8JA 5CYQB 1VSJA 3OYCA 4OLBA 1X9MA 3EPIA 1WSEA 1T05A 3PW7A 4QW8A 5J2MB 3SI8A 3NF6A 2FBYA 3G0ZA 1J9AA 5FROA 3MEDB 3I0SB 5J2PA 3HP6A 4BWMA 4DF8A 3LZIA 1WNSA 3V6HA 3DM2B 3AA5X 3PX0A 2WTFA 3Q8QB 1S0MA 1S1WA 4Y2AA 1F21A 3DLHA 4QCLA 1CLQA 3CVKA 4O5BA 4CJVA 2R7YA 3K5LA 1X9SA 1BQNB 5HBMB 3KK1B 4E7IA 3TR8A 4N41A 4URGA 4CF2A 3SUPA 4ED3A 1S10A 1KLMB 2KFZA 1S6QB 4M45A 4OPKA 4CEEA 2GIQA 4K4SA 2KFNA 3HSTB 3SUOA 4EYHB 3M9NB 2AGQA 2B5JA 3DI6A 4DTOA 2W7PA 4RW9B 4AHUA 4NRUA 4FW2A 1TL1B 4RNOA 3LZJA 3LDSA 3KHGA 4LSNA 3HM9A 3V6DA 4WXWA 1CZ9A 3MAQA 3U3YA 5KT5A 4ECZA 4O55A 3LPTA 4EBEA 3KMQA 4CK1A 2W9CA 1RTJB 3ALYA 3F73A 3VQBA 2ATLA 1WSHA 1RT1B 3U6FA 4J9NA 1NK8A 3SQ2A 3HVTA 5J2PB 2JC1A 1QSLA 1Q8IA 2HNDB 4F4YA 2HHXA 4KHUA 3OYBA 4Z4IA 3HPHA 4DL3A 3OS2A 4XO0A 3L2WA 4KE5A 1D0EA 4NLDA 5KFVA 1TGOA 4QWEA 1VSLA 4OLAA 4YMEA 1KRPA 3TAMA 3CDWA 3ICLA 3KLEA 4CGJA 1GOCA 2VG5B 2E4LA 4DQPA 2D0BA 3Q8PB 3V9ZA 4N76A 3LWLA 4CF0A 5C24B 1ASWA 3D45A 5HLFA 1BHLA 2IBKA 1SH0A 4I9QA 4B08A 2G8FA 1BGXT 4FJKA 2B6AA 3KNAA 3FQKA 4ZTJA 2J6TA 4M3YA 1RTIB 4E0DA 3AO2A 1BI4B 1RCHA 3SV3A 3DLRA 5JS1A 2IAJA 4C8KA 5KG1A 5HRNA 1SL2A 4Z4EA 3I0SA 3H5XA 4RNNA 5F8HA 3QYYA 2P5GA 1FKPA 3M9OB 3V9UA 2AQ4A 2PYLA 1S6PA 4DG1B 4Q5VA 1Z4UA 3DRPA 4PY5A 5KFKA 4ECTA 3M8PB 3MEEA 2DFFA 1R0AB 3CM6A 4DWIA 3C6TA 3VQCA 3IS9A 1TVRB 3RAXA 4GW6A 4DQSA 4PUOA 3V9WA 4O3SA 2QK9A 2IJFA 4NLTA 1RNHA 2GUIA 4HCCA 3P5JA 4GMJB 3D5MA 4ZHRB 2FJVA 4TN2A 3OYNA 2HHVA 2BDPA 4B9MA 4RW4A 2IDOA 1JX4A 5EDWA 4DLEA 1N6QA 3PR5B 5KFRA 3QO9B 4CIGA 5L1JA 3DOLA 4IRDA 4M3UA 4QW9A 3K2PA 3VQPA 3ZSWA 3CFPA 2OZMA 1IH7A 1QSYA 5KFBA 3NMAA 3VQ9A 1S1UA 1ZETA 2W9CB 3VQAA 2PYJA 5K14A 1EETB 1DTQB 4CEOA 2JLEA 3CO9A 3KKRA 4FJ5A 1U47A 3MEDA 3HYFA 1GX6A 4TY8B 4I9LA 3GIJA 4KHNA 3PZPA 1REVB 4FLTA 4FJMA 2F8EX 3PVXA 4HUEA 3RTVA 3H5SA 1LAVA 2WONA 3CDUA 3SV4A 5HRPA 4EZ9A 2OPRA 3AVCA 3VQEA 4CE9A 3LALA 4G1QB 5EWEA 1FKOA 4DLGA 1LV5A 3NH1A 2YNHA 1J5OB 3PO5A 5EU7A 3BSCA 4OL8A 5KFIA 2RDJA 3ZSZA 1NK9A 4CECA 1LW2B 1IKVA 4RUAA 4AHRA 1TVRA 4JRPA 1HYSA 4NLVA 4CERA 2YNFA 3OHAA 1Z25A 4DQIA 5KG3A 4BE2A 2X78A 4ECQA 1K1QA 4KV8B 3M8SA 3RB6A 5FRMA 1RT7B 3EYZA 4BE0A 4ZPCA 5KFDA 4E7LA 2HMIA 1IKVB 2XRIA 4JRQA 1TL3A 4WFXA 1KLNA 3T3FA 4EP4A 4B9TA 2E9RX 3VQDA 3FFIA 2UVRA 1HNVB 3GIMA 4DFPA 4KTQA 3LP2B 3GIKA 3EZUA 3IG1B 1S9EB 4DMNA 3K59A 5KG6A 5JS2A 4CHOA 3WNHA 1REVA 1B92A 5FDLA 1JLBA 4HCBA 3S3NA 2D0CA 1LWFB 4TY8A 5KT2A 5DQGA 2XCPA 1YVUA 4Q0BA 3NAHA 3FRZA 2HWHA 3SJJA 5F8NA 1LW0B 4F4ZA 4JUZA 4CFAA 2WOMA 3QLHB 1HQEA 1NJZA 1J53A 2HVIA 3ITHA 4H8KA 2RPIA 5I42A 1RA7A 2P5OA 3LP0B 3P83D 3G6VA 2D5RA 2DTUA 4KHWA 3S3MA 4DSJA 3GILA 4ECRA 4FXDA 3O3FA 4C8OA 1NK5A 3SFGA 1K6YA 4FK0A 1NJWA 4ZP9A 4EO8A 4CJWA 3Q8SB 3BQ0A 2XO7A 2UVWA 4IH5A 3RBEA 4IKFA 4KI4A 1NJXA 3ASMA 2OYQA 1S49A 3Q8RB 1TK8A 5F8LA 3RR7A 2W8LA 1S0NA 3AA2A 4EO6A 1GX5A 1HPZA 4FJ8A 3KLGA 4K8ZA 4ED7A 3C94A 1D8YA 2IC3A 4CJUA 3NGDA 3GV8B 2JEFA 4DG1A 3CFRA 3OSNA 2WK4A 2D0AA 4AHTA 4HUFA 4J9QA 4K50A 4B3OA 4JV1A 5KFSA 4DTSA 4CK2A 5KGWA 3IG1A 3MR5A 4DTXA 5HRRA 1HNVA 2E6MA 2IC3B 3ZSVA 4XPCA 3LANA 3CJ2A 4DL2A 3VA0A 5FDLB 2I5JA 4FK4A 3NCIA 3DYAA 4CF1A 3NDKA 3KMSA 1SV5B 4KRFA 1K1SA 4MH8A 4KHQA 1D1UA 4IDKB 3NAEA 5HLFB 3F9KA 4HVJA 3BDPA 3SCXA 3OS0A 4YNQA 4J2BA 1RBRA 3KK3A 3GV5B 1HYSB 4EBCA 3OHBA 3ZT4A 3PW0A 2NUBA 4O0JA 4J9LA 4F50A 1RDBA 5DG9A 2RKIA 4LQ9A 1VSEA 2PZSA 3UDLA 3LP1A 5DGAA 4W5RA 2G8VA 1HMVA 1VSDA 3AA3A 5KFTA 3KLGB 4DL5A 1S5JA 1ASVA 1JLFA 4DU1A 1RT4A 5F9NA 3ZSXA 4FJIA 2HHUA 4AHSA 2OPRB 2RN2A 2E6LA 1U04A 4FJNA 2DPJA 5KFFA 2BQUA 2W9AA 2HNZA 3PJWA 1QHTA 2BRKA 3EZ5A 2OZSA 1RDRA 3VQ8A 1NOZA 4KFBA 4KTWA 5EUHA 2G8UA 3OYIA 1XI1A 2IM1A 2YHAA 3QZ7A 1TV6B 3RB4A 2FVPA 3RWUA 5KFGA 1RILA 3O3GA 1S4FA 4CJTA 3C6UA 2R8IA 3NBPA 2ALZA 3NH2A 2XI3A 2FVSA 3T5LA 4IG3A 2FBXA 3L3VA 5L1IA 4RW4B 1N6QB 3RAQA 1RDCA 3DLEB 4CGFA 4TSXA 2O5DA 2VA2A 4YFUA 4CF8A 3V6KA 5D3GA 1U09A 2FLNA 2KZMA 2D3ZA 4F4WA 5KFJA 4I2QB 1ZBHA 3OYGA 4BWJA 2KW4A 4GVMA 4I7FB 4IDKA 4URSA 1NOYA 2AX0A 1S9GA 4JV0A 4CEBA 4CJFA 2YHBA 3CJ0A 1U4BA 4FYDA 4EP5A 2AJQA 4ZP8A 2D41A 3DM2A 4ECYA 3DRRA 2YNIA 3IAYA 4EEYA 3TQ1A 1N56A 3PHEA 4F4KA 4G1QA 4CHPA 4XPEA 5F8JA 5HBMA 3V1QA 3NKYA 1LWEA 1GOAA 3D0PA 4FZXC 3KIOA 1KVBA 3H2LA 4E19A 5J2NB 3V9XA 1NHVA 1VRUA 1J5OA 2XY8A 1NNDA 1MU2A 4FZZA 1RTIA 4ELVA 3BGRB 3DYAB 4PQUA 2IA6A 4WYLA 3NFAA 2W9BA 4WXOA 4DTUA 3L8BA 4ZVFA 4FJ7A 2DFEA 5DLGA 4LSLA 2OPQA 2JC0A 3KLIB 1CZBA 3AO4A 1RBSA 4RZRA 2EHGA 4E7JA 1QE1A 4DSLA 3KTQA 1YTAA 4LH4A 3VQ4A 3O4QA 4QAGA 1UWBB 3E01B 4FCYA 5J1EB 4NZ0A 3RBDA 3OYJA 4CEZA 4FS1A 2Y1JA 1S0OA 2VG7A 2IGIA 3QEXA 4F3OA 5L1KA 4R8UA 1C0TB 3DLBA 1EXQA 1N5YA 4DFMA 2HNDA 1QQCA 2AGOA 4DFKA 4OKKA 1XHXA 5KRTA 1TK0A 5L9XA 1T03B 2BQ3A 1LWEB 3QLHA 3AVGA 3QO9A 2XC9A 4NLXA 3WNEA 3OY9A 4KI6A 3OYEA 3KJVA 3HVRA 1SKWA 1ASUA 4KFBB 4K4XA 2Z1JA 4WE1B 3T5HA 4NLSA 1HQUA 1C1BB 3VQSA 2B5JB 3DI6B 5CZ1A 2PY5A 2C28A 3DLGA 3OSPA 3K5OA 2XGPA 4PUOB 3AVFA 3DLEA 3V6DB 4Y1CA 4TQSA 2AX1A 1BISA 1XR5A 3PX6A 2IM2A 1RYRA 4IFVB 3PR4A 5T7BA 1CXUA 5KFEA 4C8LA 4I2PA 3MXMA 4B9SA 4Z4FA 4CFCA 3HL8A 3I5BA 4OKJA 2DPIA 4NCGB 2V4QA 4OPJA 4TQRA 4DEZA 4HYKA 4O4RA 4BDZA 5F9LA 4FLYA 4OGCA 1I6JA 1CSJA 4IR1A 4GC7A 3HVAA 2LSNA 4CIEA 3AA4A 3ZSQA 4IRCA 1N5YB 4CJLA 3AVHA 1RAJA 3THVA 3SQ0A 4NLPA 2RF2A 4R8UB 4DQRA 3PV8A 1T03A 2R2UA 3VQ7A 1A5VA 2C2DA 1S1TA 4O44A 4TY9A 5KG5A 1DTTB 1T05B 1JLQB 4DS4A 3PW2A 4JLHA 3OL7A 4B9UA 4N47A 3V1RA 5KG2A 4E1NA 3NAIA 1WSGA 2B6AB 4FLWA 1ITGA 5KFOA 2W8KA 4NCAA 3QEPA 1TAUA 3H5YA 2R8GA 2P1JA 2G8KA 3I0RB 3QERA 2UVUA 3QETA 1IKYA 3SFUA 4CJ3A 3L2UA 1TKTB 1RYSA 3NF9A 1KHVA 3KLIA 3KLFA 5KFAA 4CHNA 4Q44A 3ZSYA 4G3IA 4MK8A 3QZ8A 3GIIA 2ZE2B 4I2PB 5DQHA 3ISND 3WNGA 1S1VA 1KVAA 2JGUA 5I42B 4RW6A 4ZVHA 1N48A 4RW9A 3N6LA 4AH9A 3ULDA 1D9DA 1TAQA 3CDEA 3IGVA 4WZQA 4R5PB 3RMCA 4ED1A 1MU2B 4MIBA 1RA6A 1T3NA 1BCMA 3BREA 1WSFA 4K4TA 3DRPB 4FJJA 4BE1A 2QXFA 1YTUA 4J9MA 3SZ2A 1EX4A 2Q3SA 4NCGA 4M3TA 5CYMA 2W42A 3I5AA 4J2DA 1T8EA 4X2BA 4HTUA 1BQMB 2OPSB 1YT3A 4MK9A 3QIPB 1NKCA 2ETJA 4FJLA 3KHLA 4KHSA 1JXLA 3NGYA 1U49A 1XHZA 4ZPBA 4DSFA 1S9GB 3TARA 1NKEA 4FZYA 5J2QA 2GC8A 3O3HA 4I7FA 4AILC 1JXEA 1TL3B 3T5KA 4ED6A 3V9SA 1HNIB 3ZT2A 3E51A 3SI6A 4O3RA 2R2TA 4LY7A 3TAQA 1O1WA 4RW8B 4ZP6A 4FLZA 4IH7A 1UAXA 2IM0A 4W5NA 4RNHA 2C22A 3AO1A 1RBVA 5HP1B 3LP3A 1LAWA 2ZD1B 3H5UA 2A1SA 2ATQA 3V4IA 3OLAA
chains in the Genus database with same CATH superfamily
2JL9A 5BYRA 1PCAA 2JSXA 4JI0F 1T95A 4N5SA 3NVMA 5DM7Q 3KD1E 3KDOA 5AQLA 5CYJA 2HLTA 2BUPA 1NGDA 3N9UC 1F3VA 1RT5A 4LQ3A 1ZAWA 3SNNA 4X66F 3PUFA 1JLQA 2IS3A 5DDOC 4AYBD 2R8KA 4HVZA 3PEHA 4V1Ak 1B0TA 1N0VC 2RNEA 1T9YA 2JLGA 3QRPA 4FP9A 3I32A 4QWBA 1XMQJ 1C2PA 1WDTA 4DTJA 3WX8A 2UXDK 2RRNA 1IG8A 1HNWF 4LF6J 4YR2A 2DXDA 1GT8A 1TL1A 4FKYA 2G0CA 2OPPA 4DUYK 2EPIA 4JOUA 1C1CA 3CF5Q 2ATCB 1JKHB 2JFDA 2MJNA 4Y28C 2YTCA 1R0CB 1ATRA 1FKOB 1HNIA 4WBFA 2UUBJ 3ENBA 4A8YA 1VLYA 3I4HX 2RSQA 3FEXB 3QIDA 4U95A 1IR1A 3OYMA 3C6TB 2HFVA 1XK8A 4OX9F 1T3VA 3BQ2A 4LF8F 4ZITA 3PW5A 1YG0A 4BDPA 4WQ4C 1BDGA 3DRXA 4ZPAA 3OUYB 2C3UA 2RQMA 4HHTA 2W2PP 3HKZD 2AKWB 2FZKB 2PC6A 3R97A 3DXKA 4IO9L 3CIZA 1Q8BA 2ZHAA 4JI5K 1OPZA 1F5CA 3QNOA 1GOBA 4WP8A 3UD3P 4MIAA 4HWIA 5F0UA 1RT3B 2LQJA 3ZTSA 2V8PA 4ZIWA 4F3MA 5FLXO 1HNZK 1DAXA 2HHTA 5GMEA 3LP1B 1TK5A 4GKJK 1D9AA 1SC1B 4CEAA 4LF6F 2ZBQA 1XBWA 2NZ4A 4CJPA 5FPDA 1VQPS 1XTZA 1JJHA 4EUVA 4L73A 4BQLA 2CWKA 2WOMB 3WC0A 3THYB 3HXMA 2M7SA 2HB5A 2BKPA 3TPQA 1CJUA 4QR1A 4YOWA 5CZ2A 2LQ8A 3CWJA 5L1LA 4DV4K 5JVHQ 4UTGA 4JP8A 5KFQA 2HSTA 1SJQA 5GADP 4MT1A 4DL6A 2Q2RA 5HVFA 4O3NA 2LEPA 5AT1B 1DTTA 1U0SA 3HO1A 1NHKL 3R3LA 1NU4A 3HKWA 2XY5A 2MQMA 4CEQA 4C11B 2FZGB 5KFHA 2DO0A 3CQXA 1VQLS 2ASDA 1GMVA 5HVGA 3OYLA 2HAFA 3HOTA 4EHUA 1R8PA 1HKAA 2ZBCA 2LU1A 3ZZOA 1KAYA 5I3UB 1WKLA 1JB0C 5F8MA 3MAAB 4EAHD 5KG7A 5C24A 3MWTA 1N8RO 3LPUA 5KRSA 1X1PA 4KH0B 1WI6A 2XZWA 5KT6A 2MQPA 1N32F 3B6OA 5CY4A 3KLHB 3M1VA 5EOYA 1S97A 4DR6K 3PIOQ 4B3TK 3IRXA 1S6QA 1SJ1A 4OI6A 2FLOA 1JKHA 2JNJA 3MN7A 3TAFA 2Q0RA 3FEZA 4XDDA 2W40A 2UUAK 5AQRA 1WF2A 2FVRA 4TYAA 1P8GA 4MKYA 2PBDA 1VLOA 4U9RA 1RHJB 3UNYA 3P3DA 3MEEB 1NMEB 3AVLA 4DQQA 4NL5A 1B9DA 1RDDA 4CW7B 1PBUA 2E1AA 3Q7BA 5AZIB 1CULA 2CNKB 2YKNA 1VQ7N 1JCEA 4E7HA 2IYIA 1HW8A 3MCPA 3PY8A 2VBYA 1B4SA 4M95A 2FDNA 2OH2A 2RDDA 4Z7CA 2QA4S 1RTJA 7AT1B 1FNXH 4LFAK 4QWDA 4JI8F 6AT1B 2CG4A 2DY4A 4O3OA 1PBAA 3CJ3A 2DNRA 2L9NA 1XWLA 2OMOA 1HQEB 1PKUA 2IPOB 3OS1A 2J6SA 4B8CA 1RXOB 2HPUA 1AUDA 2Z1HA 3E01A 3MCSA 4FF4A 2AWZA 3QJPA 1U2FA 2CQPA 3HTVA 1WSRA 4Q2MA 1IQZA 1YUWA 4H5WA 2OPSA 4FJXA 1R0AA 3KLEB 4FO0A 3MECA 1K8KA 2J9EA 2LYVA 1UJ6A 2PGCA 3ET6B 4DTMA 4C23A 4BRIA 1VIXA 3VF2A 3BGLA 2Z2ZA 3DNCA 3IGNA 5IT4A 2W2QP 4DR2K 4KHRA 3OYKA 3MPDA 2AJ4A 4IFEA 4CHZA 1JK9B 2F8SA 1RT6A 4MKBA 5HL7L 5CD4H 3S01A 2XWYA 1BIUA 5H9EJ 2E2NA 1IUJA 3TANA 2ZH1A 4OI1A 2HKEA 2N3LA 1SKRA 3WEEA 3VEYA 3R6GB 2X3DA 2D74B 2A1RA 5F1XA 4CJEA 4ZPVR 1U8SA 3ZXWA 1B9FA 2ZC3A 4DV0J 4QOZB 9ATCB 1A6LA 1JLGB 1XC9A 2CQ3A 5GMKa 1D4XA 1MDUB 3E1YA 4CBUA 2G8IA 3IM8A 1JJ2M 4DR5J 1EETA 4JBCA 2QLWA 3RRGA 1ZA1B 4M94A 4A8MP 4JI1F 3H59A 3RBXA 2M52A 5K5MA 3DRSB 1X31C 4W98A 3CCSS 5KFLA 4QJVA 4Z4CA 3WQTA 3OA9A 5LY3A 2WAQD 4W5OA 4QPTA 1OSDA 2DNMA 1FRKA 2CADA 3MM7B 4JHDB 1XR6A 1KQKA 1RBUA 3BGRA 3SEOA 1YVFA 3KG1A 1Y5IB 4NWBA 4DHYA 4WKYA 2D7SA 1HI8A 1UA1A 1KR4A 2MKSA 3MFIA 3I55N 2GQCA 4A8OA 1RT3A 3CCJN 2BEFA 5M2RA 2GNKA 1S48A 1BO5O 3MXIA 2YWGA 2QIFA 1YJWN 2G1HA 4NB4A 5JJBA 1JWWA 2QEXS 1JJCB 2N7CA 3F41A 3HSGA 3ZT0A 4CESA 4PWWA 3BSNA 3R5GA 3PNIA 1REGX 4V19J 1RT7A 1NB7A 4XEIA 3M2VB 1PJ5A 2KT3A 3VEOA 1DQ9A 1F60B 4YS2A 2D9PA 1F0XA 3ZNUA 1UWAA 5ETLA 2XHCA 4P71A 4ETZA 4C1NI 4KREA 2ROEA 5AXMA 1FDNA 2ZUAA 5EX0A 5MAOA 2FF6A 4NXNJ 3KJVB 3WIVA 3ZCMA 4PL7A 4Y2CA 1LW2A 3G6YA 1E6YB 1NDLA 4G6VB 3TQEA 1WAJA 4ZTFA 1UZDA 2LMIA 2XGQA 3MMCB 3NP5A 4PG5A 3GV7B 1KCFA 2JWKA 5A2QO 5CABA 3IR6B 4KO0A 1R3NA 4KGMA 3L3CA 3PG9A 4FWRA 1U1OA 3QQCD 2I2YA 2DXEA 3L2QA 3NBPB 1TMJA 4HTIA 1S1UB 2W01A 2RKIB 3MEGB 2VC1A 5C0YA 1GTEA 5GAGP 3TTFA 3CE8A 2GFFA 1VISA 4K4YA 4CO4A 2CUYA 3TJ8A 2Q31A 2OEMA 3T1AA 3O1BA 2A2CA 1URRA 4P75A 1O8BA 3P49B 4AFFA 1VQSA 5AQWA 4R5PA 1YHQS 3MF5A 8AT1B 2HOEA 3EE3A 2OPQB 2BE7D 1XMOK 1FVSA 3PSFA 4NLQA 1T94A 4NLWA 1NDCA 5JXSA 3DLGB 5GADI 4CJ5A 2HHWA 1G7CB 3ZZRA 4P2FA 1WSVA 4OVLA 4IOAQ 4A61A 2CQHA 1IM4A 2E8AA 2WB4A 1N4LA 3AB2B 1CQNA 4DTRA 4ZPWR 4F02A 2V63A 4UW2A 2WCXA 5ETKA 3NE6A 5ITHA 1Y4ZB 5DG8A 3ILIA 1QVFR 4KGXB 4KPCA 1MMLA 1RLCL 1MLAA 2OTJS 3W8GA 3EGVA 4BC4A 4YB1P 1M1KO 3ZZPA 4JI6K 4FM2A 1YK9A 4DL7A 4J37A 4Z4HA 2QWMA 4BRHA 2EX3A 3K5NA 2M9KA 2XMUA 1Z6RA 1S1VB 2XLKA 3DHXA 3QBCA 4MKAA 4O4GA 4F2SA 1S12A 2RH3A 1XQSC 4XTTA 2OTLN 4PG6A 4ES1A 4H4OB 3TUPA 1S1XA 3SAHA 4LT6A 2WSEC 1RZMA 1CS4B 3MPUB 2O4GA 3HZEA 1QTMA 1X4GA 1W2BR 2NLWA 3G86A 1L3SA 1UMJA 4NLYA 1R89A 1TL4A 4XAKA 1FWLA 5E3AA 4FYVB 4NLOA 3I0RA 3VGUA 5M1KA 1IKYB 3BSAA 2VKRA 2XM3A 4AQYJ 3GTYX 2KQ2A 5SWMA 2YNHB 3O9RA 1VK8A 5C42B 3NS5A 4IG0A 5CR4A 3K58A 2W7AA 4OZ0A 3CD7A 4USMA 2YKNB 2ASPA 4ID5A 1ELOA 4CGDA 1LXNA 3KJNB 2C3OA 1RWUA 2CXEA 3OYHA 3CJ7A 1RDUA 3ENWA 4OIXA 2FXUA 5IQQA 3KLVA 3M8RA 1FO1A 4JKCA 4PA1A 2AZ3A 2VFRA 2B8QA 4H4MB 3RB0A 1L3VA 1PJ6A 1C0MA 3PXGa 4TU9A 1RAHB 5J1EA 1S57A 5CYQA 3AOBA 5C25B 2UVVA 1EO1A 1J27A 1PIEA 2B4JA 2RE1A 2K06A 3RMBA 3OR2A 4X66J 5B8HA 4U8YA 4JI1K 4M5DB 2VHGA 3M9MB 2OMLA 2BRLA 4RX6A 3GFHA 4RBUA 2XY7A 3FCHA 3IRWP 2XI2A 4CGGA 5H1SQ 3BKFA 4P9SA 2YWWA 2DT9A 3RRHA 4EFHA 3C2PA 1YBUA 3THTA 2OANA 2HRTA 5B0CA 3F9MA 1C1AA 4CRJA 2IIRA 3SUQA 2PAVA 4LSLB 4J91A 1IKXB 2WZ1A 2KG1A 4A8SA 1VSFA 5GINA 2VIHA 1KD1T 1FKPB 4IFYA 1QS4A 1HBOA 3AT1B 1CZAN 1QZ6A 4X4UA 4JS4A 4CF9A 4DX8H 3W62A 4J9OA 1W0HA 3DJCA 3UI3A 4DN0A 1CXQA 3J7ZO 5D4PA 1HYZA 5THWA 4UF4A 5T7LA 5ADXH 1UVLA 3EICA 3TX0A 2J9DE 4GC6A 4M42A 1A9NB 4IOXA 2GGPB 3OVNA 1SJRA 1FD8A 4FBUA 1HNWK 4DL4A 2ZITA 3NXZA 2HFZA 3EGZA 2QFIA 1HI1A 4BLGA 2G1DA 3R5BA 1WHVA 4P2XA 2QX0A 4LF8K 3GWCA 1X9MA 1T05A 3VERA 2EVZA 4QW8A 2E2PA 4WF9Q 3G4SS 5CHIA 2FBYA 5FROA 1V3SA 3HFKA 5LT5A 2C2NA 4DF8A 3LZIA 1MROA 1GXTA 1S0MA 4Y2AA 1VQ9N 3D3CJ 4H5TA 1F21A 3OHRA 3DLHA 2N4CA 5HO4A 4QCLA 3H6EA 1CLQA 1M0SA 3CVKA 2R7YA 3K5LA 4JI2F 4DUZF 1URNA 2ZEJA 3J80O 3TR8A 4N41A 4CF2A 3SUPA 5HANA 5A2QU 1NZ8A 4E2FB 3GONA 3OFHA 3Q0AA 2BE9B 1DURA 2KFNA 3SBTA 4CLWA 4Y6IA 3BF3A 4DX7A 2B5JA 1UZHA 4DTOA 3MM5A 3U9DA 1T9UA 2KM8C 3CCJS 4BRGA 4ZVQB 3TSQA 4OV1A 1RAFB 1CZ9A 2V2ZA 1N88A 4O55A 3OTOF 1K8AO 2DNYA 2QMUB 3F73A 3BP8A 2MPUA 4ZLNA 2ATLA 4P7TA 4ED4A 1NK8A 1VBZA 4S0MA 5J2PB 2JC1A 2MHNA 1QSLA 3GG1A 2BKNA 2GQQA 3AFGA 5D6GA 1E6VA 1CG2A 3HPHA 3OS2A 4RWWA 3AD9C 1X4BA 2XLJA 2UP1A 1FFSB 4JKHA 4NLDA 2DPNA 1TGOA 1ZM9A 3IP0A 2RIJA 2GWJA 2LQBA 2DIVA 2MQNA 2I7PA 4CGJA 2ZM6F 1MN7A 3OXLA 5BR8F 2E4LA 3O9QA 4FKXA 3LWLA 2F8MA 4CF0A 9RUBA 1BHLA 2G2OA 2Q43A 2JWLA 1BGXT 5H1SV 4FJKA 2B6AA 4RU2A 4FVUA 4F0MA 4DUYJ 1R8BA 1RTIB 1WORA 2VFTA 3AO2A 2JLFA 3I55S 1EWRA 2NS1B 2QJ3A 1U26A 3DKDA 1SL2A 5HRNA 2MKJA 3W8PA 2X1FA 5F8HA 4WTYA 2DNLA 3G6EN 2V67A 1K8KB 1FWKA 3LA0A 1ATNA 3CJKA 3IFRA 2P9SA 3ZETB 5E3QA 3VAIA 2CZVC 3WIUA 4PY5A 3OR1A 4KRWA 1R0AB 4PKDB 4DWIA 3VQCA 3IS9A 3ILLA 4PUOA 3AXMA 3V9WA 3CMEN 3S41A 1OYEA 3GP9A 3MDFA 4HCCA 1NWKA 2K3IA 2J0SD 3D5MA 4TN2A 3FZBA 3JTPA 4FF1A 4PR6A 3OYNA 1H2UX 1QZ5A 1VQ7S 1S6OA 4DUZK 1YGYA 2VZ9A 4QIFA 2QM1A 2OZMA 5CE3A 2W9CB 2D3O1 5K14A 1EETB 4CM0A 4CEOA 1RWMB 1UW9A 2V8GA 1U47A 3MEDA 3PYFA 3GL1A 1EZZB 5AE1A 1ZBSA 4GV3A 4DV1K 4BG8A 4HUEA 5A76A 2OHDA 1NGFA 3K5PA 3IM9A 2WONA 4EMDA 3DLLQ 4G1PA 1UFWA 1I94J 2MZSA 2YKPA 3TUJC 3SBMA 3VQEA 4QR2A 4OYAA 2L9DA 5A6WA 2DRBA 3LGHA 1LV5A 2H48B 2H4YB 5LL6Z 5KFIA 3BPDA 1NK9A 2RHSB 1TVRA 2O8EB 1U1KA 2U2FA 4NLVA 4DQIA 5KG3A 4USIA 2X78A 3SAFA 4WQ4A 1K1QA 1RT7B 4ZPCA 2HMIA 4JN4A 4NASA 1IKVB 2XRIA 3CHWA 2BH1A 3CJCA 1AZSB 3N01A 4B9TA 3T1HK 3VQDA 1FDAA 3LP2B 3GIKA 2DNNA 2M3DA 5KG6A 2QL5B 5AZJA 3S3NA 4TY8A 3OFFA 1V4SA 1YVUA 1FF2A 1N36F 2AIRB 4ER8A 5F8NA 2VDIA 4CFAA 2HHPA 4CT9A 5GAGU 4KH6A 1J53A 2GA7A 2DNZA 3GFYA 2CIMA 3GILA 3CCTA 4JYAF 4C8OA 1NK5A 1K6YA 4LFBJ 4FK0A 1NJWA 3BBCA 5G0RB 1RAAB 1PO6A 1I94F 4LFCF 3ASMA 2OYQA 4LF4F 3OR2B 3BF1A 1TK8A 3WBZA 3WXMB 1RDWX 2RE2A 5C10A 1R6VA 4DR4F 1U0HB 3KLGA 1QTNB 3C94A 5HOOA 3VF0B 3O80A 1FXRA 1WUUA 2IVPA 3U27A 4DG1A 3CFRA 4OX9J 4HUFA 2P8IA 4K50A 3D2FB 4B3OA 3IG1A 1Q86O 7FDRA 1HLUA 5KQDA 2FHOB 4DTXA 2FJAB 4H0TB 5HRRA 1G3OA 2IDLA 4XPCA 1DBDA 5DZ6A 4CVNE 3CJ2A 2CPEA 3Q86A 1VQ6S 4FK4A 1HHQA 1G4CA 5CA5A 5LMNJ 2VKZG 1RU2A 3G71S 3KMSA 4IOCL 4LRDA 4UQTA 3W5ZA 1M5SA 3ET6A 3GFZA 5HLFB 4GKKF 3FCWA 4B1WB 1QY7A 3SCXA 2E1MC 1RBRA 3KK3A 2JHEA 4EBCA 3HD1A 3OHBA 3AODA 1R8CA 5IZHA 3PW0A 4C98A 3UDVA 4QIVA 4C1NK 3HI0A 4PXDA 2X3GA 2DB1A 5IT9O 3UDLA 3LP1A 1RABB 1VSDA 2P9NA 5KFTA 4DL5A 4RTFD 2QWOA 1JLFA 3H25A 1RT4A 2YJFA 4A59A 1M1HA 4JI0J 4FJIA 2RN2A 2E6LA 4HI1A 1ZAVA 1Q79A 1U04A 4GRSA 2DPJA 1FI4A 1IVZA 2BRKA 3EZ5A 2VV5A 2P2CB 5ETTA 3T1YK 4KFBA 4CP5A 4L3QA 4BC5A 3VTHA 1Y0HA 2RAQA 2RILA 1CQMA 4I4BA 3QJLA 4A5BA 2I38A 1UVMA 4CJTA 2KO1A 2ALZA 3DDNA 4FN5A 4NXNF 1K47A 2P9IA 4L75A 2FBXA 5D15A 4JHDA 4CWBA 3RAQA 1S7IA 4CGFA 2E1ZA 4TSXA 2PFFB 1R7IA 2VA2A 5G0RA 5D3GA 1VR6A 2VWBA 1PILA 3TUZC 1ZBHA 3M6GA 2F5GA 4IDKA 2AX0A 4BC3A 3E9LA 2QI2A 1BQXA 1U4BA 4GNIA 2MSTA 2IYGA 2BX6A 4K2XA 4Z7YA 4ZP8A 4ECYA 1HJOA 4ILLA 2RQCA 3TQ1A 3PHEA 4F4KA 3CUNA 3AA8A 4IZ9A 5IQ6A 3V1QA 3NKYA 5JLFA 2OI2A 3UR3C 3BUZB 1VRUA 2ZWHA 3MPWA 4DV6J 2HS0A 2YKQA 2D9OA 3PHTA 1MU2A 3FZHA 1VQ8N 1O5JA 2VBWA 4PRFA 4PQUA 2IA6A 4JI7K 3CT9A 4ZVFA 3UNGC 1FX2A 3SQOP 4OZ3A 2J9DA 4JI1J 4LSLA 5ETQA 3O6QA 2JC0A 1U1RA 1UKUA 1YTAA 4TU8A 1HD0A 3A8JA 2ZJRQ 5M1FA 3E01B 2XMVA 2NQPA 1E4FT 4FCYA 1VJQA 4BRCA 1FESA 1WTBA 5EVZA 4FS1A 2Y1JA 4ZN3A 2UZAA 3A5MC 5CAAA 3ZC4A 3R7SB 2VG7A 5SUHA 5H9FJ 5L1KA 3QFWA 4DR3F 4TKTA 1KN6A 4WU3A 4X65K 1N5YA 4QU7A 5GAGI 1MA9B 3MCOA 1XHXA 2CYYA 4IOAL 3QLHA 5JMVA 5IT9U 2FSNA 3QO9A 3B78A 2PEBA 4X4SA 3OY9A 2P9SB 5ETVA 3HVRA 2Z1JA 4WE1B 3T5HA 3UCZP 3DI6B 3M6XA 3DXKB 2PY5A 3A3OB 3DLGA 3HULA 4NZ6A 2UXCK 4M7XA 4DUZJ 4KBOA 4CO3A 3CIPA 4PUOB 3FRYA 3V6DB 5K8NA 4ZCMA 4UZBA 3ZLJA 3NLCA 1BE4A 4OPAA 1AFIA 2ZWPA 1KS2A 5DDPC 5JVGL 4BC2A 4UOFA 5LM7E 1VMBA 1NBEB 1NPKA 4O4RA 4H0XB 2K1RA 1CSJA 2D69A 3KFWX 1S4EA 4GC7A 3HVAA 2LSNA 3ZSQA 1H72C 4IRCA 1QM9A 2CPJA 2NUUG 2O8BB 5M1PA 1M5OC 2B7CB 3SQ0A 2DCLA 4NLPA 1T03A 4Y2IA 3O6WA 2FIUA 1RBLA 2CZ4A 1V3RA 3DCAA 1ATSA 2WW4A 2DISA 1X60A 4FLWA 1TAUA 3OTEA 3P45B 2R8GA 2P1JA 2G8KA 3R1XA 3I0RB 3QETA 1IKYA 2RU9A 2VC0A 3SFUA 4CJ3A 2E2OA 2A2DA 3FBBA 3H42A 3VR1A 1T6CA 1D8ZA 1RB0A 4CHNA 4Q44A 4G3IA 3MDQA 3QZ8A 2ZE2B 4XH1A 3J7AP 2ZDPA 2P9KB 4RW6A 2VQFK 4C3KA 3ISZA 1HX1A 3QRQA 4RW9A 3N6LA 4CH1A 4AH9A 3CDEA 1F1BB 3IGVA 3D68A 3RMCA 3GE1A 2XS2A 2W25A 3BREA 2XMJA 3W9HA 3EVMA 1VQKS 2Q3SA 2JRSA 4M3TA 2W42A 4BRAA 3CCVS 3I4PA 4B3TJ 4A8KA 1YT3A 3GR1A 2ZHBA 4FVCA 1I5OB 3ILOA 4FJLA 4E8UA 5EX5A 2EFGA 3J80Y 4DXLA 1JXLA 1HR0F 1XHZA 3W65A 1YJ9N 4FZYA 3WHIA 3CCMN 4GKKK 4I7FA 1N32K 1C4AA 1JXEA 3T5KA 3Q8YA 4ED6A 3KUEA 3SI6A 2ZWOA 1H7XA 3TZXA 3GZ7A 2IM0A 2VFUA 4IUFA 3AO1A 1FW6A 3EO3A 3NGSA 3CD6N 1LAWA 2WBNA 3PFEA 4CZFA 2DY1A 5F8IA 4NX9A 5AQPA 1IKXA 4ELUA 2KDOA 3IAM9 1X5OA 1N33F 2XY6A 2PA8D 3O2IA 2C2EA 3OVSA 4BACA 2E1PA 2KLAA 5AQHA 3MWBA 2D0OA 4KJIA 1Q1KA 5LSRA 1ZTTA 3NGRA 3R1LA 4NYFA 4CYUA 1HMVB 2BGGA 3WXJA 2EEYA 3CC7S 2EG1A 4H4KC 4YOUA 2OPPB 3ZSOA 3FKBA 1LNQA 4ISGA 3GYNA 3H98A 1P27B 2DHHA 1HARA 2HMIB 1TP7A 4DCJB 4BVOA 3FJ2A 5AFUA 4X62F 1HBNB 3A5LC 2F9TA 5AQYA 3MR6A 1Z2ZA 4ED8A 5K14B 1U6FA 1CJUB 2M8HA 2BUNA 1VQLN 3HCXA 5K8PA 4XK8C 3I5CA 4NXMF 5KFZA 4DV3K 1VGYA 3KJFB 4RW8A 3NL0A 2MMYA 4DR7J 4NYZA 4F25A 3VPZA 3X3UA 2H4WB 2Z58B 5BRHA 3CC4S 1HKGA 3H1QA 3R5CA 3W63A 1QQNA 2E9TA 1GMWD 1FWPA 1MWQA 1ZM2A 2R7VA 1T9WA 2BZ2A 1W9HA 2O8CA 1AYEA 1MROB 3T6BA 1FHTA 1R6YA 4K5SA 1NJYA 3VV2B 3OVAA 1BUPA 5A2QY 4GV9A 1KSPA 2FJDB 5BREA 4X65J 3AVIA 4JV5J 1CJVB 1RCOB 2J9CA 3JAMO 2BE2A 5AJ3K 1NJIO 2FLPA 1DY3A 3ZX2A 3NRBA 2VH7A 4IG0B 4KB1A 1FRIA 4DV2K 2AGPA 2V9WA 5J2QB 4USJC 3CJSA 2X6SA 4K7QA 3SMSA 2GEMA 4FM1A 3EUNA 1NGGA 2BJ8A 4NPOA 2UUWA 4ZVEA 4M63A 2EI5A 1RWWB 4L8RB 2JX2A 1Z2LA 2AV5A 4O0IA 3EGNA 2GV9A 4FM0A 4DR3J 1IBMF 4J9KA 5GAHP 2HYIB 2ADCA 3KVGA 3G82A 4PWDA 2Z30B 2NZCA 4DV5J 1NJIT 1QSSA 4WFZA 3GCWP 2MHEA 2OEJA 1KBRA 1YIJS 3HP9A 5GMDA 4FPIA 5HI7A 2ZOGA 4H0YB 2APOA 1HBMA 1FNMA 2XCAA 2Z2LA 4DU4A 3FQLA 2GVZA 3EVWA 2R7RA 4LF1A 3SIPB 1LWXA 2G0IA 4ED0A 4JI0K 2WFBA 1V5VA 2DGVA 4UOGA 2BTFA 4JKAA 5CCLA 1V3ZA 1J5EJ 1VRUB 4ZA1A 3EEQA 1NGJA 3WXKA 1ZPWX 5C7PA 1NK7A 2LXFA 3CMES 1GQEA 2A6AA 2HVHA 4OYWA 2DCUB 2KRRA 3MECB 1TYQB 3MMVA 2B3TB 3UN2A 4KIAA 4L72B 4I2QA 3AJDA 3V81A 3ZTRA 3L3UA 3TRGA 3FGVA 4Q8FA 3DLKB 3WDOA 5KFCA 3IA0A 1G15A 2HQIA 5AQTA 5DJBA 2WRMA 3ENAA 4CEDA 3B6BA 4OGEA 3HT3A 4ZJQA 1RBAA 2DTJA 2ZQBA 5HMYA 4RJVA 1U1PA 2GELA 1JL2A 1L3KA 1KEKA 2CJAA 1XMBA 5DS7A 3PW4A 4DBQA 1ZYQA 2KKZA 4XH4A 2EKNA 2X6NA 4IEEA 4P72A 3NF8A 1VRTA 3AO3A 1FJ7A 1DJ0A 4W5QA 4DR7K 2FB0A 3FZMA 4EYIB 3RR8A 3PJXA 4FDFA 3IN5A 3I87A 3H4DA 4J2AA 2NZTA 2Q36A 4WWSA 1RHMB 5KG0A 4LF7K 1XNRK 3KLHA 2B56A 1NKBA 2GWKA 3D28A 4UY8O 5GAHU 2DVIA 5D0GA 1I3AA 4AHCA 4ZN1A 4DTNA 4CK3A 3ZT1A 5I3QA 1F6TA 3MMBB 4B3RF 3MMAA 5HJXA 1C6VA 2N7YA 2KH9A 1H7WA 3JSYA 3WXIA 2ZC4A 5CZVA 1LK5A 2LDIA 4XDCA 1FKAF 4DCPB 4CFDA 1Q9YA 2VU5A 5HMWA 5KPTA 1LOUA 1NK6A 3A8YA 1SJ3P 2UUTA 3RMDA 5GIOA 3CI5A 2H5JB 3EJMA 3DDKA 5C42A 2J8SA 3NGKA 2NRRA 1NXIA 1AUSL 2MKKA 1G6BA 2VPZB 3OYFA 2QMWA 4ZLPA 1MN9A 4WFAL 2GTDA 1UP1A 1FDBA 4CJRA 4OI3A 1VQ8S 1U8WA 2RS8A 1NH8A 4F36A 1X4CA 2W4DA 3CW2C 1HHTP 2Z4PA 3SJHA 3D66A 1KOOA 1OPIA 2E5IA 1B3TA 4C8NA 4M5JA 5BYSA 3NNHA 2JWNA 1D9FA 4CI6A 2HBKA 1Y11A 4K43A 2MJUA 2XMMA 2RUGA 4H03B 2YNGA 4MMOA 2RRAA 4YQWA 4CJQA 3PYDA 4I6WA 1RTZA 3MTJA 5AZJB 4OYXA 2HWTA 2AW0A 5AQUA 2QYCA 1NSAA 2KVQE 4E89A 3FLCO 4KAZA 1RT2B 3W2VA 1RT6B 2CNOB 3R9LA 4F0KA 4CZLA 1NH7A 3LDLA 1UFKA 1JLAB 1PSDA 1TQLA 5DGBA 5HROA 2W2OP 3I56N 3QEWA 1IWGA 3A5OC 2HNZB 4OPHA 4NLUA 3QIOA 2YQ0A 1SKSA 2FBTA 1CJTA 3UB5A 2YJEA 2G8WA 3JQMA 2ZJRL 1U1QA 2NRVA 3HZGA 3R5DA 3AV9A 1FJCA 1NPRA 2AZ1A 1SL0A 3K0JA 1KFDA 2Y0BB 3PRDA 4IKAA 4M5NA 1KWMA 3U4LA 1SQFA 4CZIA 2YWFA 2CH6A 3D1QA 3M1FA 4H4MA 5B0DA 2V0NA 3OPKA 1DLOB 3IS9B 3UIQA 1RHRB 3LOUA 3G9CA 2FGCA 3ENVA 3T9NA 2JEIA 2PSZA 4Y34A 2XMKA 2AEMA 4NEZA 4P6QA 3NNAA 3HD2A 2YNFB 1UTAA 4R0EA 4HKQA 3UPFA 3AVMA 3M8WA 4DU8A 3WNFA 2DHAA 1S3XA 2W6LA 4I6YA 2A0FB 3TZYA 1VBYA 3RZAA 1U2CA 4JYAJ 4F7VA 4JNEA 1C0FA 4OX6A 2UV8G 4EK2A 3RUBL 2BQRA 3QEVA 3UKRB 1SAZA 1UPPA 4FJGA 3CCLS 3VQ5A 4H5RA 1NEEA 4RL1A 2V52B 2QA4G 2IFXA 4NXMK 1IO2A 4EZ6A 3HDSA 3O9UA 1C0TA 3POTA 3KK3B 4P2MA 4J2EA 5A8RB 4ZPDA 2QKBA 4LF2A 5IM0B 4F8RA 8RUCA 2C2MB 4RNFA 4ED5A 3HHLC 5D0HA 2E1YA 4MAKA 1JLCA 4IH6A 4AUKA 2YX4A 3NF7A 1YRTA 2OEKA 4ED2A 5D0EA 4U67L 1IG9A 1XMQF 3J81U 1FD2A 1SV5A 3EY1A 5KFUA 5AQOA 4PG4A 2OP5A 1E4GT 4H4KA 3M8QB 2CPDA 3RU0A 1HRHA 4QWAA 1KFSA 3M6VA 4Q7AA 1B64A 2EW9A 3H08A 3DLLL 4USWA 1RTDB 1UFLA 2MQOA 2HW3A 4FLXA 2MQQA 4FWMA 1NGCA 4ZVTB 5CCMA 2YKMB 1RTHB 1OIAA 4ECXA 1S72N 5DLFA 2FJXA 2HK2A 3F5TA 4OFZA 5IXUA 2M0GB 2XNQA 1Z26A 1XJWB 3LAKA 4M5DA 4WCEL 4I6AA 4YR3A 2NXEA 2P9KA 2WVBA 1KVIA 3K5MA 4HH0A 2YKAA 4Z94A 5K8OA 2UUBK 4DV5K 4J9PA 2CJ9A 2HHHF 3AAWB 5F3TA 4TYBA 3TAEA 3QINA 2CH5A 1VQ6N 1FK9B 4FLUA 4KV8A 4I0WA 2LA4A 3K8WA 1UW4A 4M3WA 3C14B 4I69A 2BBEA 1X4HA 1TKTA 1VSHA 1VJWA 2B43A 4IQMA 5C2CA 3T9ZA 1ACMB 3IR7B 1A5XA 2PA3A 3I31A 2P51A 4X4RA 3HHEA 4WKRA 4BBYA 5A6PA 2C2KB 4TXSA 4KHMA 5IWAF 1SC3B 1UJ5A 3CCZA 4KH1B 3EZWA 1S5ZA 2IVFB 3MI7X 3TEHB 1EP4B 3NS7B 4OV6A 3MUVP 4J5OA 3HVTB 3N28A 3QFHA 1EIYB 1RSCA 2ILZA 5ETNA 1RT1A 4HLBA 1L3UA 1XMOF 2CQGA 3ZT3A 4KB7A 3VAKA 3TWZA 3TA0A 1IXKA 3HK2A 1FXXA 3DAWA 4B1XB 2GBZA 4H4OA 1S99A 3KWGA 1F9EB 1A0OB 3VEXA 4A8WA 3VQQA 4NE9C 2UXCJ 4OYZA 2NPIA 3UR0A 1JXBA 3MHYA 3QGHA 3S3OA 5D0RA 1BXNA 2CGLA 4H0PA 1OS5A 2ASMA 3D1HA 3K2YA 2LEAA 4WYWA 3ITHB 3Q2SC 4HHUA 1A5WA 3FR0A 2MQLA 1KDNA 4RW7A 1RGVA 4Y1DA 2Q3PA 1T9TA 3BR8A 1FRLA 4O3PA 2H5IB 4B3SK 2P9LA 1X8DA 2POKA 2KXFA 1JJ2R 5ADZA 5IWAK 2COLA 2RQ4A 4K4VA 1KONA 2IBOA 2YNIB 1RJJA 3L09A 2FC0A 3BQ1A 3U3GA 4Z4GA 5HATA 2H65B 1TTHB 4KHYA 4QIWD 1NCLA 3KD5E 4DCHA 3SQ4A 3NGIA 1BL3A 2RUSA 1FK9A 5KFMA 3QEIA 1KQGB 1FRXA 4M5IA 3JB9k 4QS9A 4IR9A 1RACB 2R4FA 2CQIA 3UQSA 3EXYA 3MM8A 3FCVA 2R8JA 4DR6F 2EFVA 1VSJA 3OYCA 4JI6J 3KG0A 3Q89A 4WU2A 1LFPA 2UV8A 1YIJN 3G0ZA 1X4DA 2F1FA 1N34F 2ACYA 4ZK7M 1MG7A 3CPWR 2IHR1 4CNZA 1GK8A 1WNSA 4HT7A 3Q8QB 1S1WA 1KC8T 2MKIA 1NPPA 4JI2J 1WEXA 1HBMB 1BQNB 5HBMB 3KK1B 2MLZA 3SLCA 2BJ1A 4E7IA 4URGA 4X64K 4WFBQ 4DV7J 3OQ2A 2ZOMA 3Q8VA 1S10A 2KFZA 3P4IA 4FXWA 1K44A 2GMLA 4M45A 4OPKA 4CEEA 4PCQA 1E3MA 4K4SA 4ILHA 3HSTB 4BRKA 3SUOA 3M9NB 5E0OA 2AGQA 4LF4K 2UXBK 3BGFA 3HMJG 4RW9B 4FW2A 4TNOA 2YWHA 1TYQA 6FD1A 5KT5A 1RWOB 2FHJD 4CK1A 1BA0A 3CCLN 3VQBA 4J9NA 2E5HA 2ADBA 1WEZA 4ATNA 2VCPA 1Q8IA 2OTLS 2MGZA 2HHXA 2JOQA 3OYBA 4Z4IA 2FSKA 3D2FA 3LDQA 1ZC6A 3JSBA 3L2WA 1UPMB 1IBLF 1YZ6A 5CH7B 1VSLA 4YMEA 1KRPA 2PD1A 4KH4A 1QQMA 2QWNA 3KLEA 4NXNK 1GOCA 1X9JA 4CH0S 3BY5A 3Q8PB 3T1HJ 1G1XA 2CRLA 4OX9K 3M30B 4JI8K 5LJ5Y 3WXLA 5HLFA 2A5XA 1Q7LB 2M2BA 3ZYYX 3QBWA 4JI3J 2XSJA 3KNAA 3TJAA 1J6ZA 4ILJA 3P38A 4E0DA 1OWXA 4USHA 1BI4B 3SV3A 1PYSB 3PEJA 4FWSA 2IAJA 4Z4EA 4KGVB 1VBKA 3J80U 3I0SA 4Y0FA 4RNNA 5GAEU 2P5GA 1FKPA 3M9OB 2E7VA 3B4MA 1HBOB 2QLJB 1M90O 4MO5A 1HIYA 2CQ2A 3QMQA 2AQ4A 5M1NA 2PYLA 1S6PA 3MN5A 2KYXA 3NWRA 2F4VF 2O8DB 3DRPA 4F9OA 2DFFA 1YX2A 3CM6A 4LUBA 4KHPK 4B3TF 1YJNS 3HT0A 2E88A 2F7VA 2R7TA 1Q8KA 3CJTA 3UKUA 2XG8A 1J2VA 2F9WA 2E2QA 3DXMB 2QK9A 1RNHA 4NLTA 1S0VA 1VQKN 1S59A 2GHVC 3OW2R 4DV2J 4HHHA 2NPFA 1UVJA 2BDPA 1X4AA 1JX4A 4C48A 3AGRA 2W24A 5EDWA 4DLEA 5LSLA 3W7BA 4JEPA 2PMWA 1YJNN 2E5LF 3PR5B 3CJ1A 3MD3A 4IRDA 4M3UA 4G65A 1HFEL 4CLZA 1IH7A 1QSYA 5AR0A 1VC0A 1W97L 2XZTB 2LXUA 2PYJA 3TSUA 4FJ5A 3GIJA 1ZS6A 4KHNA 5D4NA 4X4PA 3PZPA 2Z56B 4HEA9 4WFNQ 1VQNN 1REVB 4FLTA 4PAAA 4HT5A 5FLXU 1SJ4P 3LPYA 4DR2J 1I1GA 5HRPA 4EZ9A 1HR0J 1FJGJ 4HACB 4AL7A 4A8FA 7FD1A 3H2VE 4CE9A 1YJTA 5EWEA 3IWLA 3D7SB 1F5BA 2ALYB 2YNHA 1ZM4A 4FZVA 4BRQA 3BSCA 3CCVN 4LF6K 2W4PA 2YY3A 2HS4A 4WK3A 2R7UA 1BOTO 1OYDA 1IKVA 2OJ3A 2ZGZA 4V19S 1DKGD 4ZS6A 2EXUA 1HYSA 4M8LA 5C2FA 4CERA 4LC9B 4BCAA 1Z25A 3W5XA 1ZZFA 3RGIA 4KV8B 3M8SA 5FRMA 3EYZA 2GO8A 3HOSA 2LDYA 4EIAA 4E7LA 1VDHA 1UJ4A 3M2VA 3DGPA 1RAIB 4LBPA 3A8KA 4FYWB 5AQXA 5IFMA 2R42A 3EM1A 4PKHA 2E9RX 3FFIA 2HBYB 3GIMA 1FA0A 2OD6A 3EZUA 4DX5A 4CHOA 1B92A 4FWKA 1WEYA 3NCQA 5H9EK 2D0CA 5BN9A 4QZVB 4Q0BA 1YHQN 3FRZA 4JI4F 2HWHA 3G8SA 1LW0B 2DGOA 1QQOA 3E66A 4H5NA 3QLHB 1HQEA 1NJZA 2WVFA 4WJBA 2HVIA 4JI3K 2RPIA 2DNPA 1T9VA 3LP0B 3Q8UA 2DTUA 2Q6BA 4RPFA 1FT8A 4F0HA 4DSJA 4FXDA 2BA9A 3O3FA 4QIGA 4OO1J 1N5SA 2CA9A 4ZP9A 2W6KA 4EO8A 3Q8SB 2XO7A 1H2VZ 4X64J 4Z2XA 3MOJB 3OT9A 4KI4A 1NJXA 4DL0C 3RR7A 2W8LA 1S0NA 3AA2A 1OVQA 4EO6A 1GX5A 1IBCB 1HPZA 4FJ8A 2J7KA 4K8ZA 4ED7A 3CCSN 2D1CA 3UWTA 3NGDA 4PEOA 1MW7A 3LDNA 3J81j 1IBMK 4O0NA 3R8YA 4JV1A 1ZZNA 1IJJA 3BZKA 1OQ3A 3K89A 3MR5A 1HNVA 3OR1B 3EE8A 2Y8YA 2IC3B 3ULEB 3ZSVA 2FYXA 2I0XA 3VA0A 5FDLB 5IV4A 2QL7B 4ZJLA 5LMUF 3CULA 1XNQJ 2E7XA 3DYAA 3QDKA 3M2UA 3QAUA 2E44A 3NDKA 5ELZA 1SV5B 4RUHA 2DGSA 4KRFA 2OSQA 4OX7A 4KHQA 4IDKB 3MMBA 3FSYA 4MTPA 4XH5A 5BN8A 4DR6J 1YITN 1EKSA 4JK8A 2XMWA 1HYSB 3ZT4A 1R0BG 2NUBA 1GLJO 4O0JA 4F50A 4P74A 1RDBA 3NMRA 2RKIA 4UY85 2CNNB 4P73A 2PZSA 4OHVA 2G8VA 3QFUA 2QWLA 3KLGB 1S5JA 2VASA 4M5KA 4DU1A 5DETA 1SB6A 3ZSXA 3LF0A 1HA1A 4AHSA 4Y0WA 4FJNA 2BQUA 5F0WA 1QHTA 2P9IB 3H2UB 2OZSA 3U7JA 1RDRA 5AQKA 1PJ7A 3NNCA 4KTWA 4PXBA 3O9SA 2G8UA 5HL7Q 4F3QA 1K9MO 1TV6B 3RB4A 4IO8A 2K7KA 3C16B 2R8IA 3EKSA 2UXBF 5B0GA 2ZM6K 3MX2A 3E2EA 1J5EF 3CETA 4LF9F 4RW4B 2O8EA 1Q7YO 1WC3A 1VCTA 1RDCA 4M5HA 4JKFA 3K9JA 2MLYA 5C15A 3X1LB 1U6BA 4LJMA 4YFUA 3O1WA 2YXLA 1U09A 1YRUA 3LGNA 3AHPA 1E6YA 4F4WA 4I2QB 2ZH3A 2KW4A 4GVMA 3NG8A 2QTDA 4I7FB 3UVJA 2KL8A 4URSA 2DGUA 4X62K 2GX9A 1TELA 5CD4A 4BRDA 4CEBA 3THXB 3FC9A 3G87A 4RWXA 4A4JA 4FYDA 3VGLA 1FFWB 2AJQA 3JS6A 4CLYA 2D41A 2GCFA 1D3WA 3I82A 4EEYA 2AJ1A 5MLCV 2IRYA 2GJFA 3KHYA 1IN0A 1GOAA 3KIOA 4CI0B 5HSPA 4L3NA 5B08A 3V9XA 4KGKA 4R25A 1NHVA 5I9EB 3HLUA 2XY8A 2LQ9A 3IFEA 1RTIA 1NDKA 4IO1A 3DYAB 1BWEA 2W9BA 4WXOA 1PG5B 4ZLJA 2YWKA 4YORA 2J8AA 2OPQA 3KLIB 5LJWA 3H46O 3GOIA 3KTQA 1GTHA 4WCEQ 1VQ5S 4YUDA 4W4MA 4CZEA 1QD1A 4QAGA 2XSFA 2VQEK 2HQ3A 3RBDA 5BPNA 2O8BA 3OYJA 4O23A 1RAEB 5L8RC 4R8UA 1C0TB 3POTB 4I67A 1TR0A 2DJWA 2WUSA 4CLPA 1GLFO 3B8AX 1KQSR 4DQ8A 4PWUA 3IWXA 1X7VA 3R5AA 2AD9A 2XC9A 3EMTA 2EG2A 4X62J 2HZCA 3VOVA 4KI6A 4O8UA 5LMNF 3LUYA 1MMDA 3HRGA 4K4XA 3UDCA 4NLSA 1C1BB 4I1TA 5IC4B 2O8CB 3SMPA 1WACA 2VQFF 2QL9B 2B4OA 4TVAB 2Z0GA 3OSPA 1W7AA 1T3OA 2XGPA 2A41A 2Y0SD 4TQSA 3DN9A 4ZCLA 5ETMA 1XR5A 3PX6A 2IM2A 3VEWA 3M2RB 5T7BA 5KFEA 3RVCA 4I2PA 3MXMA 1U25A 2F8HA 2RMLA 2ZJQL 3I5BA 3C6HA 2V4QA 5AQNA 1N0UA 1V6HA 4ZVSB 5F9LA 2OFGX 4FLYA 1I6JA 1VC5A 1ZM3A 3AA4A 1QDUB 4ILMA 1N5YB 3AVHA 2XBPA 3DFEA 5AE3A 4DQRA 2VPWB 5AQGA 1A5VA 1KTVA 2QGFB 2F9DA 5KG5A 1JLQB 3OL7A 1M1GA 4E1NA 3ZTQA 3TJ9A 1Q86T 2W8KA 4NCAA 3H5YA 3RJMB 1Q5YA 1SCJB 4RBVA 3QERA 3A13A 4JKDA 3D67A 2UUBF 4YHHF 3L2UA 1GXLA 1TKTB 1VQON 1RYSA 4LF5F 3NF9A 1G99A 4B1YB 4FPBA 2NNWA 3V4MA 1WHXA 3K9KA 4MK8A 2MGZB 5IS2A 4JAXA 3WNGA 3N0VA 1KVAA 1FNOA 4QU6A 4F04B 1N48A 3B54A 1AFJA 5AQJA 4FOIA 5L46A 3SXLA 1MU2B 4MIBA 5M2PA 2DGXA 5AQQA 2ZJPL 1U1LA 1RA6A 4NA3A 3T7ZA 3TOQA 4BE1A 1S79A 2XS7A 4NCGA 5IT9Y 2YX6A 4X2BA 1BMQB 2RU3A 2OPSB 5F41A 4MK9A 3QIPB 2ETJA 1VQ9S 3ADAC 2QLFB 3LPEA 3CJ8A 4DSFA 1S9GB 1IBKF 1P9QC 3D2EA 3Q2TC 2KJWA 4DCOB 1MWKA 4LFCK 2ERRA 3WUHA 4NI2B 1IR0A 1TL3B 3FUYA 1HNIB 3ATVA 3JS9A 4MLHA 3LO3A 1Y5NB 5AE2A 2R2TA 2PFUA 4WQ5A 3ZO7A 2C3PA 4Z37A 3KK7A 2C22A 4J8FA 3A5NC 5HP1B 2GO9A 2ZD1B 3H5UA 4K2JA 2XQCA 3OLAA 2VONA 2WC9A 1BWFO 4DV6K 1WC6A 3C15A 3LGMA 2JEGA 2O01C 1S9EA 2Q66A 2VGNA 2AP1A 4M5GA 4WFAQ 3DU5A 2CPYA 3L4IA 3RW6A 3K57A 3D6RA 3HF5A 4CFBA 2ILYA 3CYMA 3GJRB 1TKXB 2ZZNA 3JYTB 3TSPA 4CNYA 5I3PA 1YJWS 3OJSA 3OV7A 2E7WA 4FPAA 1KHWA 3I9V9 3C8YA 1O6XA 3L6QA 4U67Q 3CDBA 1B70B 4FBTA 2HS3A 3MM5B 4KGZB 4JV2A 4B02A 4ECSA 3MCNA 3OFEA 2ZVSA 5JVHL 4B9NA 4MJKA 1ZXOA 1NM1A 4PPZA 2Y1LB 1AB8A 1C0UA 4MO4A 2C2RA 3EWGA 3HPGA 1FJEB 1RWPB 5IV3A 3O1LA 3UD5A 5KTQA 3W9IA 1P1LA 5E2QA 5HAOA 1NDPA 3QT7A 1T6DA 4DSEA 2HHHK 1IKWA 4WQ5C 1EQYA 4KYZA 4Q45A 2MB0B 4B17A 3UFCX 3VZIA 2HQGA 5C12A 1BQNA 4AE5A 5I3UA 2VJUA 5DMRA 1FXDA 3MAAA 1V4TA 2ASJA 2I7NA 5M2UA 3M3ZA 4CJ7A 1JLAA 5ADXA 2YPYA 4F26A 3IMQJ 3IR5B 1YWXA 3OJUA 4K8RA 4CCHA 2V8VA 4UY8T 1JLEA 1RT2A 1SUQB 3W2VB 2QXLA 4QYZJ 1HD1A 3EKUA 3MFHA 4RCHA 1YITS 4JKGB 4URQU 4CJSA 1EP4A 3MN9A 2W1BA 3IRXB 4CZCA 2ZE2A 3GYXB 1Q82O 2B9EA 4ES3A 3FVYA 5KOWA 5DDRC 4ID1A 1P90A 3FGUA 3DOKB 4FWNA 4YOYA 3MN6A 4LFAJ 1HJRA 2LKZA 5KFWA 5KG4A 4KR0B 3GSDA 4M3ZA 4ZKAA 3LP0A 4CLFA 5DZ7A 3S1TA 5E33A 4K4ZA 3V6JA 3VQ6A 4NEYA 2XYGB 2R7QA 1OO0B 3OYAA 1GNKA 5DM7L 4O44B 5U47A 4CH7A 4EGLA 2N3OA 2V69A 3JAMU 4K0KK 1QAJA 2GV1A 1SH3A 4LMZA 5LL6d 3T5JA 1CJVA 3O44A 2LCWA 3VWSA 4RW7B 4CDIA 4LSNB 2LFVA 1CLFA 2GIRA 4YDDB 2ZOFA 4O3QA 4K59A 3M30A 4IRKA 1ZA2B 4NA1A 4NMXA 4DV4F 1WAFA 4EBDA 2GUPA 2MZ1A 3QSYB 3FZKA 3RB3A 2E1CA 4DR1F 3CD6S 2HZAA 3ZEUA 3QWPA 3J7YP 3NGZA 2BOPA 4KHPJ 4A2AA 2DGWA 1CJTB 3NEKA 4KAIA 2DITA 3D3BJ 1IBMJ 4ECVA 1JMTA 2W7OA 1HKCA 3L2VA 2DHSA 4GY2B 2XYPB 5KPRA 2FUG9 3CMAS 4BRPA 1WF1A 3GR0A 3TAMB 1Z1ZA 4DSKA 3C16A 4FLVA 4L74A 1VRTB 2DH8A 2DR6A 2NRTA 4DU3A 4MYTA 3KNGA 3HJFA 3AAQA 4MFBB 1AROP 3MTKA 1U1NA 2X74A 3H1VX 1HNZJ 5E84A 2J6UA 2EC2A 4CZMA 2O66A 4JI5F 4CLUA 5J2MA 1OH5A 1GAOA 1WSJA 4FS2A 2R9LA 3G71N 4FVMA 2R7WA 2AEFA 3DRYA 2V2QA 3DOLB 5CHCB 1LWFA 3R27A 2IJNA 4N7TA 4Y2MA 3OBIA 1ZBUA 4DB3A 4RWTA 1RT4B 2D3OR 3PIPL 3L7OA 4NXMJ 3JSRA 1C4CA 2ZHOA 2KTQA 1XEZA 3IC1A 2OIHA 1ZBFA 4ZMMA 4ELTA 2YNGB 1N5VA 3CD5A 1RISA 3KHHA 5KGXA 3RW7A 1UWBA 4DV1F 1GLDG 2CJQA 4X4OA 4BQZA 1MWYA 2YV0X 4H0VB 1BQMA 1VK0A 5FPNA 1KLMA 2PI5A 3BS9A 2VWKA 1FTCA 5FPEA 1XUPO 4FW1A 3MR3A 4E1JA 4CIOA 2UXDF 3L9ZA 2JJ4D 4OYMA 3AJ2A 1FCAA 2DNKA 3QBXA 1RDAA 3G8TA 4PG7A 3AGKA 5EWFA 1NK0A 2G8HA 1HQUB 3VVUA 2HHQA 3PFOA 3PKYA 2C42A 3R2DJ 1ROFA 4LVNP 3G6XA 4KKOB 4W92B 2HK3A 4OZ5A 1VBXA 2FHMA 4PWDB 2OA8A 2EFNA 3BO3A 4YHHJ 1WDDA 2OAUA 4F67A 4OYPA 3D9BA 2E5LJ 2IIHA 3RRKA 2AJFE 1YLXA 3KUGA 3VGTA 4LRCA 1R27B 3VA3A 3HHLA 2AF6A 2ZH8A 1HNWJ 4DS5A 1UETA 4F4XA 2MZJA 3MURP 4WPAA 1KKHA 2HSEB 2BYCA 4JI5J 5A8WB 2FLLA 4YB5A 4DTPA 4OQJA 2V5HG 4Q0BB 4XIUA 4QBUA 1LW0A 3TVZA 4MFBA 1TU0B 2Q6CA 3MEGA 4K4WA 3GJQB 4E1MA 4DN9A 3FZLA 3OL9A 1Y5LB 5JUMA 4KPYA 1UEKA 3PACA 1Q18A 3CJ4A 4IFVA 1YBTA 1KAXA 4MDAA 4FJHA 2Q97A 2HGMA 2LVWA 3A0IX 4KSEB 2YHXA 1RP5A 2WBRA 2QTWA 5B0BA 3CDAA 3TABA 1RHKB 1RFQA 4CLTA 4IJNA 3C0BA 4DU7A 3RBZA 5BR8K 5EN1A 4YP3A 2L41A 2LA6A 2J4RA 1NUEA 4JB8B 2E20A 3AY9A 2JFKA 2VG6B 2IVNA 4B9QA 1K0TA 4FL9A 3A3PB 1O13A 1Y64A 1Q7YT 3Q24A 2RJZA 4PYDA 2DD8S 5BR9A 2IJRA 1M5VC 1DGKN 2CQCA 1VSKA 4B9VA 2WSFC 3ZZUA 4ZVGA 1WOQA 2OSRA 3OBWA 3ATUA 1L3TA 3BR9A 4HL9A 4CEFA 1X5SA 4FF2A 2R2SA 3H3OB 1HI0P 3TA2A 4YDXA 2NR0A 4HUGA 3C6AA 4YDUC 3PO4A 4FPRA 1VSIA 2C2ZB 2ZNYA 3R1HA 2AU0A 4FWOA 1WG1A 5D3GB 1JNRB 1RQ0A 5KT3A 4WFYA 3MXJA 3JAMY 3R3TA 5DG7A 2HNYB 1H3DA 3GJTB 2ZH5A 1ZH5A 2BE2B 3GQCA 3P8BB 2V9KA 3U02A 2QV6A 3HZ6A 2E5JA 2YKMA 3QIPA 4JI2K 4NLRA 3JSMA 1SXLA 5FRNA 4HR2A 4Q43A 2P9PA 5K9FA 3CNQP 3NVKA 4C3MA 3FDSA 2HFUA 2ASLA 3FFIB 3O9TA 2DNOA 3DGPB 4KO0B 2Y1IA 3VTIA 2CJKA 4IFYB 2I6WA 4RG8A 1H1VA 4RW6B 3NHGA 2XS5A 4DFJA 2OELA 3ID8A 2AEJA 4DF4A 3P31A 2BANA 3H4BA 1CBKA 3THXA 2GAHC 3DRRB 3KK1A 3B6PA 2FC8A 2HFNA 3CJ5A 2XHBA 3DMJA 1D5AA 3AVKA 1XNQK 1S1WB 3MGJA 2ASOA 3GYGA 4LR9A 1KVKA 2H1YA 4DV7K 1WKKA 4W90B 4KBIA 1WLJA 1SQKA 4EI2A 2VG5A 1R31A 1DRZA 4JK9A 3TAPA 4CJ4A 2YX7A 3CB4A 3CCQS 1N54B 2XTJP 4I56A 3GU0A 2M5YA 4EHTA 4DI6A 3I56S 1U45A 3FSIA 3GJSB 4WTOB 2FSJA 2VB6A 3H20A 4OHYA 1T7PA 4BHQA 4YOVA 1Q53A 1NBWA 2E9ZA 1JLFB 3OL8A 3NGUA 3NS6A 3ZZ0A 2AYMA 2RB7A 2ZD1A 3D4JA 2KZZA 1B0VA 4X64F 1SVDA 3G82B 3B82A 4ZVRB 1YJ7A 2VFVA 3C46A 4LVOP 4K4UA 4N56A 4FWQA 4CJKA 2ZBIA 2EWSA 1IKWB 4NLGA 1WC4A 1NO8A 3M2UB 3LWMA 3MPYA 2HVEA 2YX1A 3MZIA 1TFWA 5B0EA 3VVTA 2VWJA 1PC5A 1W2IA 5EHHA 3UKUB 2UUCK 2J7UA 2AYBA 2P6TA 3DXMA 1JL1A 3PYGA 3OUYA 3FFKB 3JSMB 3CEDA 3TEGA 3VHQA 4BR0A 3TTDA 1TMMA 3QICA 1H38A 1Z05A 3FE1A 3US5A 2MTLA 3G4SN 4ECUA 3IBWA 4I6MB 2D3UA 2F4VK 1TL5A 1DTQA 1FX4A 5C5JA 3MR2A 3NWGA 2VOPA 4QQBA 4B3MF 2IAJB 2RT3A 1ZPVA 1R8HA 3SUNA 2VBZA 2R2RA 4JD2A 1A7GE 1JIHA 1FEHA 5KPZA 1LEOA 4ANCA 1DEJA 1TKDA 4C0BA 4CGIA 4Q8EA 3EVOA 3RAMA 4AHVA 1JLCB 1LXJA 2C2OB 3CCMS 1HYVA 1LCUA 4MK7A 2A18A 5DK5A 3MCAB 4LFCJ 4WFBL 4ILGB 5L39A 4C9DA 3SAGA 2A1BA 4NA2A 4OLBA 5BRFA 4WIIA 2ZVIA 3IO1A 3ZX0A 3NF6A 5LSOA 2VPYB 1G2EA 3A12A 3CXCR 2CDRB 2HIYA 4NYPA 4K25A 3CCUS 3OD2A 2HFSA 5J1NA 2P9LB 3JTOA 1X5PA 3N5FA 4Q2LA 3DM2B 3V6HA 3PX0A 2WTFA 2FQQB 3WX4A 4DR2F 1UEUA 3OXGA 4P10A 1VC6A 4NZ7A 1HWIA 4NMLA 1X9SA 3GPAA 4PL8A 1R43A 2ACMA 4C97A 1FERA 1W26A 4M5LA 1IM6A 3W3DA 3MM6A 4WFNL 3S7RA 2CQDA 1S6QB 1U6ZA 1UVIA 3THWB 1HWLA 2P9GA 2E66A 2QYGA 4DMZA 4CD3A 2ZFHA 2V51B 4EYHB 5DM6Q 3DI6A 4C8YA 3VCDA 4AQYF 4AHUA 4NRUA 2KG0A 4P2SA 4QOTA 1TL1B 2KRBA 4LSZB 3LZJA 1EJ7L 5LOQA 3UW1A 1YJ9S 2LQ5A 3HM9A 3V6DA 3BEGB 3FSXA 4WXWA 3MAQA 3E9PA 4ECZA 3U3YA 1HWUA 1X3NA 3LPTA 4EBEA 4C4WA 3AAPA 2DXFA 3KMQA 3PTWA 2W9CA 1RTJB 4AM6A 1WSHA 1RT1B 1SQGA 3U6FA 1ZBTA 2AHOB 3NGTA 3SQ2A 3HVTA 2HURA 4DPYA 2AMCB 4F4YA 3TO8A 1W7WA 3RSEA 4DL3A 4XO0A 3D7EO 4BS2A 2V4JB 4BC7A 5KFVA 2X1AA 5BXIA 4USUA 4OLAA 3ICLA 1KQFB 2QA4N 3HSCA 3U1LA 1QVFM 2VG5B 1FRHA 3VEVA 2GGPA 4C3LA 4DQPA 4IDHA 4N76A 2B0GA 5T7LB 2G9OA 3D45A 3I6PA 2QW9A 2IBKA 1SH0A 4I9QA 4B08A 1FEEA 2VL1A 2BW2A 1HBUB 1GLLO 3FQKA 2Y9HA 3N4QA 2J6TA 2GZOA 5AXLA 1CJKB 4M3YA 2GIFA 2QZ8A 1S22A 1Q5VA 1O0PA 1AZSA 1Q82T 2CQ0A 3H8YA 4CTAA 1OQ6A 3H5XA 5KAKA 3JTNA 3QYYA 3O5TB 3SK3A 4HTJA 1Q8LA 2NXJA 2EK6A 4BR2A 2A6OA 1Z4UA 4C11A 1I3OB 3M8ZA 5KFKA 3P6YC 1NM2A 3M8PB 1N5TA 2X1GA 3QT5A 4C2MA 4CLLA 4B3SF 1GLAG 1OSCA 2LECA 3G2XA 3C6TA 1I94K 1NU0A 1TVRB 1VHIA 4O3SA 2GMJA 3ENQA 3L7PA 2IJFA 2GUIA 3HFVA 5RUBA 1Y9OA 3V2UC 1WJ9A 3W2WB