3V81A

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and the nonnucleoside inhibitor nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v81A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v81A05
2C2RA 4JS4A 1I6JA 1S4FA 2HWHA 3GIMA 1KCFA 3DRRA 1FK9B 4CGIA 2P5GA 1S9EB 4U7CA 4CF0A 1D9FA 1QSYA 3DYAA 4I9QA 3RMAA 3CM6A 4BE1A 3V4IB 3GIIA 2ZE2B 1ASWA 1EETA 2HMIB 3QIPA 3KTQA 3O3HA 3UIQA 2XWYA 1L3SA 1LWCB 4FXDA 4EYHB 4PA1A 5EWGA 2VA3A 1U45A 5HRRA 2YV0X 3L2WA 1JKHA 3NBPA 2W8LA 3GIKA 2FC0A 3I5AA 1JL2A 4ELVA 4IKFA 3L2RA 4JRQA 4DLGA 1WSEA 2R8KA 4NYNA 3BJYA 1RYSA 5KGXA 2IM3A 4Q8EA 4M45A 1S1WA 2BRLA 1U48A 1RT3A 3IG1B 1RTIA 2AX0A 4G3IA 5F9NA 1TKZB 5CYQA 2HHSA 1NK8A 4FJ7A 3G0ZA 1BIUA 4JRPA 1XR7A 3LAKA 4CHPA 1ZBLA 1HRHA 2C28A 1SKRA 2HHWA 1WNSA 2WHOA 3ISNC 4J9OA 4TYBA 3PW2A 5KFIA 1LW2B 3FRZA 4QCLA 3WNEA 2AU0A 1FK9A 1ITGA 4CHYA 5FRMA 1TGOA 1W0HA 1S9EA 1N48A 4R8UB 1NNDA 4Y3CA 4QWEA 4CGFA 4CHZA 2IJNA 4OLBA 3HJFA 3VQCA 3V4IA 2ZE2A 3LWMA 2FJVA 4E0DA 3PX6A 4HKQA 2HMIA 1IKXB 3AVGA 3V6DB 1TV6B 1BIZA 4HTUA 1YTAA 1LWCA 2ASDA 1RTHB 4J2AA 1FKOB 5I3UB 2ILZA 2C2DA 1TK0A 3AO2A 4FJXA 3RB6A 4BE2A 3AVIA 4DEZA 4K4YA 2IS3A 3CDUA 3NGZA 5J2PB 4DFKA 1IG9A 2HHVA 5HRNA 5DGAA 1JIHA 4CJVA 1U47A 2QKBA 3IG1A 4NCGB 1X9WA 4K50A 4FJ8A 4JV0A 4CGJA 1TQLA 4FJHA 1S0MA 3DDKA 3I5CA 4O4GB 3KD5E 2YNFA 1TKZA 2FJXA 1S1TB 1WNEA 2VG5B 1NK4A 4N56A 1C1CB 2QKKA 3E01A 1WLJA 1QSSA 2X74A 3OVNA 3BQ1A 4ICLA 4DL5A 1GOAA 4IG0B 1VRUB 2XGPA 2CKWA 1KVCA 2RKIB 1LW2A 1EX4A 1D8YA 4MIAA 1QAIA 4AHTA 4CJRA 1S9FA 4FLUA 4DTPA 4R8UA 5KFTA 4M3WA 3PW0A 1K1SA 3NH1A 2HWIA 1SUQB 1QQCA 4O5BA 4IH7A 4IOBA 3KKRA 4ELTA 1VSIA 1IKXA 3FQKA 3V6DA 1TV6A 2HB5A 4MQ3A 4IDKB 4FLVA 4TQSA 4QOZB 5HRPA 1RTHA 1FKOA 5I3UA 4Y1DA 3QINA 3G86A 2GIQA 3HHKA 3PW5A 5DK5A 4CEEA 4FBUA 3QNNA 1GX5A 4CJPA 1VSKA 2I5JB 5J2PA 4CF9A 4DQSA 2F8TA 4ECTA 5EDWA 3GIJA 3VQ4A 2R8IA 2WONB 3H5UA 4O4GA 4ID1A 4FLTA 3SFUA 4FBTA 4AH9A 1YTUA 1S1TA 2FVPA 1Z4UA 2VG5A 3EYZA 1C1CA 3H4BA 2RPIA 1T94A 3FQLA 3GV5B 1ZYQA 4FJ9A 4IG0A 1VRUA 5C25B 2RKIA 4CFCA 3CFPA 3LDSA 2BQ3A 4CHNA 4ED7A 3K2PA 3ZSZA 3M8SA 1RT5B 1SUQA 4HUEA 4KB0A 3T5KA 5EWFA 5KFMA 1C1BB 4FJMA 3T5LA 4FJJA 4F3TA 4IDKA 1XWLA 4CJ4A 5L1KA 4B8AB 3HK2A 4JV2A 3OYCA 4M3RA 2DFHA 2JEIA 3TR8A 2JGUA 3BSAA 1UOCA 2IM2A 1QHTA 2I5JA 3H5SA 1EKEA 5KFSA 4ED1A 4NLYA 4RNFA 3UDLA 4B9UA 3P5JA 2OPSB 4QWCA 4CJWA 2V9WA 3KOAA 3VQPA 4DSFA 3LZIA 3TANA 1T8EA 4EP4A 4B9TA 2WONA 4ECUA 2BDPA 4O55A 4EBCA 1JLBB 5DQHA 4CFBA 3AA4A 2RN2A 4UQGA 3MXIA 4N5SA 1NK9A 1ZTWA 4CECA 4F2SA 4ZVEA 1U49A 4DSEA 3QEVA 1BISA 1IO2A 4RW9B 4RNNA 5C25A 3NGDA 4CFAA 1RAJA 4KRFA 3TARA 3KLEB 3KJVB 4C8MA 4Z4FA 4LSNB 4RNMA 5L1IA 3V81B 1BI4B 2ZKUA 1GOCA 4OKKA 1TL3B 1EXQA 4N41A 1RT5A 4YQWA 4FLYA 1NJYA 3KKSA 3BSOA 3SQ1A 4ZTFA 3PJWA 4IRCA 1C1BA 3EZ5A 3T1AA 4B8CA 2PYLA 3ZSVA 2RF2B 4F4XA 2KW4A 2R2TA 1RA7A 4BE0A 4FJKA 4AHSA 2Z1IA 3I0SB 2XY8A 3BQ2A 2KQ2A 5EWEA 4O0IA 1N56A 2JEJA 3F73A 4N76A 2HHTA 4GMJB 1RTJB 2HHUA 1JX4A 4F4KA 3VQ9A 1RDDA 1S6PB 4E19A 4HUGA 2YNGA 4CF8A 2OPSA 3RMDA 2JC1A 4DQPA 5F8NA 1BHLA 4HYKA 3H4DA 3OS0A 3K58A 5L9XA 3OJUA 1WSIA 1JLBA 3SV4A 1G15A 4JUZA 4K4TA 3QGGA 1RT1B 3OYKA 1RBUA 1K1QA 5KFJA 5CZ2A 3SCXA 3CJ0A 4RW9A 3OHAA 3K5LA 3TAQA 4NLVA 2X6SA 3MFHA 5F8IA 1Z25A 3CWJA 5J2NB 3KLEA 3KJVA 5KG4A 2DY4A 1C0TB 4KHYA 4GVMA 4LSNA 3IGNA 3V81A 1S1XB 1BI4A 2D5RA 3AO3A 3RAXA 4DU1A 1ASVA 1TL3A 2Z1HA 4HVJA 3SFGA 3HVAA 3V6JA 1NOZA 5KI6A 4FM2A 3QETA 1WSFA 3JYTB 4NLWA 2XC9A 2FLLA 4J9RA 1FXXA 2R2RA 4CJ5A 3BGRB 1NHVA 4ED0A 2RF2A 1S10A 4RNOA 4GW6A 2GC8A 4B9MA 3E51A 3I0SA 4DTSA 3G6XA 4F4WA 3MECB 3NH0A 3HVRA 3C94A 1RTJA 4M94A 1RBTA 1D1UA 1S6PA 4Q44A 1Z26A 1XHXA 1QE1B 4CF2A 1KVAA 1XR5A 3KK1B 2UVWA 5KFBA 3DLBA 3NF6A 3DOLB 1RT1A 5T7BA 4F4ZA 5F8HA 3OYIA 3VQSA 3LP3A 4PWDB 5KFAA 4HHTA 4FLZA 3OYMA 1U4BA 4Z4CA 4W5OA 4DTXA 4K8XA 3RAQA 1L5UA 4EBEA 1LWEB 3KHHA 3O3GA 1LV5A 5J2NA 1TK8A 3THVA 4J9SA 1C0TA 3PW7A 2VWJA 1S6QB 1S1XA 1RBSA 4I7FB 4B9LA 3KLIB 4DL6A 2OA8A 4LSLB 4OL8A 2R8HA 4TLRA 4J9LA 2Z1GA 2FLNA 3JYTA 4ED3A 4FLXA 3BGRA 2PZSA 1KFDA 4TY9A 1SL2A 5KRTA 3CJ3A 2B6AB 4PUOB 3PX0A 3H08A 1JL1A 4ZP6A 3MECA 4AILC 4FLWA 5KG2A 2HHQA 3OYJA 3N6NA 1VSDA 5KFXA 4QWAA 1QE1A 3AA3A 1SL1A 3K59A 3KK1A 3ZSXA 2XY5A 1HJRA 3DOLA 1TAQA 4XPCA 4FJIA 3RWUA 5KT4A 3ICLA 4K4VA 4PWDA 4CJLA 1BQMB 4YR0A 3ASMA 3P83D 3QO9B 3KHRA 2ATQA 4FZZA 2HNZB 4DL4A 3KK3B 1IM4A 4E3SA 4O4RA 1LWEA 1QAJA 4PQUB 2W7OA 5KFUA 4ED8A 1S6QA 3CJ5A 1TKXB 3AO4A 4I7FA 3KLIA 4MKAA 3KMSA 4LSLA 3OL7A 2C22A 2KZZA 3TAPA 4E1NA 3PY8A 3GYNA 2P1JA 2FVSA 4DU3A 4FYDA 2WTFA 4NCBA 1KVBA 3H98A 4CJ3A 1D0EA 2FVRA 4C8KA 2B6AA 5KFKA 4PUOA 2PYJA 3RB0A 1GOBA 5KTQA 1RT4B 4WFYA 5F8LA 2BANB 4J9PA 2FJWA 4DL7A 4IRDA 3DLRA 5KFHA 4BWJA 4J2EA 3MXMA 1RBRA 4ZP9A 3MEGB 2YNFB 2A1SA 3BSNA 4QWBA 2XI2A 3K5OA 3VA3A 3ISND 1TK5A 2OPPB 3E01B 4E89A 2IM1A 3N6MA 3AA2A 3FSIA 4ICLB 1D5AA 3M8QB 4EEYA 1BQMA 4M3YA 3SV3A 4M3ZA 3JSMB 4RNHA 3QO9A 2XI3A 2Q3SA 2HNZA 4O3RA 3KK3A 5KT3A 3ZSRA 4ZPCA 3G10A 3PR4A 4PQUA 2ZD1B 1W9HA 3FDSA 3SYZA 4RW7B 1HYVA 1TKXA 3V1OA 4CJUA 4WXOA 3DI6B 4FJLA 1Y97A 3LZJA 1HNVB 3GQCA 4FK4A 2BR0A 1B92A 4FVMA 1DTQB 4RW8B 3L2VA 4H8KA 1RT4A 4KO0B 5KT7A 2BANA 4J9NA 2FBVA 1N5YB 3PUFA 4DTUA 1RT2B 3CIZA 1JLCB 4K4ZA 3ZT0A 3WNGA 3SJJA 3KD1E 3KLGB 3WNFA 4E7IA 4O3OA 4YFUA 3MEGA 3SPZA 1RT6B 4URSA 3VQ7A 1L3TA 2XCAA 1SH0A 3MFIA 3HVWA 3DLKB 5HLFB 4FW1A 2F8SA 4NLDA 2OPPA 4H4OB 3S9HA 4K4XA 2G8UA 4WYLA 4XIUA 4KI4A 1IKWB 1IH7A 3QZ7A 3M8QA 2W9BB 4R5PB 1BGXT 4RW4B 2HW3A 2IC3B 5DG7A 3JSMA 2ETJA 2IGIA 1RDRA 5J2MB 4KTZA 4NRTA 3RB4A 3HYFA 4YR2A 1KFSA 4KAZA 4N47A 3OYAA 2ZD1A 2YNHB 2FVQA 3KHGA 2WCXA 4RW7A 2F96A 5JS1A 3NAEA 1Q8IA 4EZ6A 3OSNA 3OYGA 3DI6A 1HNVA 3FFIB 3LWLA 4URQU 3T5HA 3TWHA 1X9SA 2D3ZA 1DTQA 3DM2B 4RW8A 3HKWA 3OSPA 4KO0A 1CZBA 1HQEB 1N5YA 3ZT3A 1RT2A 3KLHB 1JLCA 3CVKA 3PHEA 5KFZA 3ZCMA 3MR6A 3GILA 3VQ6A 5KFOA 1VSMA 5JXSA 4CJEA 2I1RA 3KLGA 5KFEA 4I2PB 3CFOA 4HUFA 1RT6A 4C8OA 2KZMA 2WK4A 3QLHB 3ZSOA 1NK6A 3DLKA 5HLFA 2XY6A 3CO9A 3NL0A 1A5VA 4IG3B 4H4OA 3PJXA 1ZBIA 3NMAA 2JLEA 1NKCA 4DQIA 1IKWA 3HL8A 4WYWA 4CESA 2W9BA 4R5PA 2HNYB 4FM1A 4RW4A 2IC3A 1UAXA 4EO8A 4DS5A 3TQ1A 4OLAA 2HVIA 4O3PA 3ZSQA 4CGHA 2VG6B 4XPEA 2VG7B 5J2MA 2GUIA 4YMEA 1RDBA 4M42A 2YNHA 4Y1CA 2PY5A 1HYZA 5F8JA 2ZQBA 1C0UB 4ZVGA 2R8JA 4KHSA 4NLOA 3VQBA 5HP1B 5FRNA 4TN2A 3SI8A 1CXQA 4FW2A 4DFJA 4TSXA 4CCHA 3CJ2A 3NAIA 4NYZA 3O3FA 4K4UA 3S3MA 3FFIA 4WE1B 3V9ZA 2ITGA 4IFVB 4LQ9A 4NLTA 3DM2A 3MEEB 3MR2A 4JS5A 1HQEA 1B9FA 2YNGB 2G8IA 3KLHA 4FZXC 3MXJA 3KLVA 3DLGB 4I2PA 4YNQA 2E9ZA 3KHLA 3AVFA 3QLHA 1C2PA 4IR1A 4J9QA 2DPJA 4IG3A 3QIDA 4ZPDA 4LH5A 3SI6A 4W5NA 3PVXA 3DRSB 5KFYA 5KFQA 3OYEA 2HNYA 1SL0A 2E9RX 1HYSB 4WFXA 4Q5VA 3NCIA 4I2QB 3TABA 3PO4A 1IKVB 2VG6A 2VG7A 5KFPA 4OKJA 3I8DA 4DS4A 3U3GA 4CIGA 4CEZA 1HMVB 2ASJA 1C0UA 1S5JA 3AVNA 3QEIA 4KHWA 3ZT4A 4AHRA 5HP1A 2DFEA 4KB1A 4NYFA 5D3GB 3BREA 2X6NA 1MMLA 4RUCA 4KPYA 2EX3A 4OGCA 3PV8A 4WE1A 3AO5A 4IFVA 5KG5A 2D0CA 4HCCA 4WZMA 4OGEA 4CHQA 4B9NA 5C42B 4IKAA 4FJGA 3MEEA 3ZSYA 3PW4A 4OJRA 4O3SA 3DLHA 2KFNA 3QESA 1K6YA 3K5NA 2B43A 2FLPA 2IOCA 3B6PA 3DLGA 5FDLB 3OL6A 3LP0B 2VA2A 5HROB 3EY1A 5KGWA 4CGDA 4ZP7A 1TP7A 2AWZA 4CEBA 1U09A 4U6PA 4DMNA 2Y1JA 4NLSA 3MR3A 1A5XA 3HXMA 3M9NB 4ELUA 1S97A 3DRSA 1ZBFA 1A5WA 3ZT1A 4NLRA 4KE5A 4CEFA 1HYSA 4I2QA 2BRKA 4CK3A 3IAYA 1IKVA 1TL1B 4KREA 3RRHA 3QYYA 1HMVA 2E6LA 3VA0A 4IH5A 2E9TA 1SKWA 2E6MA 2OH2A 3I0RB 1I3AA 2XCPA 5JS2A 4ECZA 5D3GA 1SH3A 3NFAA 4O44B 4H54A 4CJFA 1JXEA 1UA1A 1KHVA 4WXWA 1LAVA 3HPGA 5C42A 3OLAA 1S9GB 3OS2A 3HVTB 1RDAA 3SUOA 1J54A 2UUWA 5DQIA 2O4GA 3D0PA 4YP3A 2DFFA 1JLEB 3V1QA 1ZETA 5DGBA 1RA6A 5FDLA 4K4WA 2R8GA 3LP0A 3M8RA 5HROA 4FS1A 2QK9A 2GBZA 4O0JA 1NK5A 2G8FA 3SUPA 4EP5A 3TI0A 4NLXA 4LY7A 4FK0A 2EHGA 3OHBA 2D41A 4Q0BB 5KFRA 4TQRA 5SZTA 2EC0A 3CDWA 1KLNA 1JLAB 2YHBA 2IJFA 1TL1A 3SQ0A 2XHBA 3U3YA 2RDIA 1BL3A 3AVLA 1VK0A 5DLFA 1QSLA 4CIEA 3AVCA 1T03B 1SH2A 3K5MA 3I0RA 2IM0A 4IR9A 2YKMB 3RBEA 3NGIA 3SZ2A 1RCHA 1L3UA 2G8KA 4O44A 3VQ5A 3HT3A 3TAFA 4URGA 1WAFA 4FJNA 4DG1B 5KG1A 4BDZA 4FS2A 4FJ5A 1CLQA 4FZYA 5I42B 1S9GA 1RNHA 4E7LA 3HVTA 3UPFA 4BDPA 2D0BA 1RT7B 1R0AB 5L1JA 3CFRA 1JLEA 2FVCA 4NRUA 5KG7A 4ZPBA 1S0NA 2C2EA 4CEDA 3BR9A 2BE2B 4DU4A 2OYQA 4MH8A 3OLBA 5DMRA 4ZHRB 1NJZA 1J5OB 4DFMA 1REVB 1QTMA 5KG3A 4K4SA 4DTJA 4Q0BA 2J6TA 3TAMB 4CHOA 4CF1A 1MU2B 5J1EB 2P51A 3NGYA 2YNIB 2CJQA 2JEGA 4XO0A 4ZTJA 4C8LA 2VWKA 4BDYA 5KFVA 1JLAA 4DSLA 4E7HA 5KFCA 4IBNA 5JUMA 3NF7A 1X1PA 3ZSWA 4BACA 3M9OB 1O1WA 3KLFB 3EPGA 1T03A 3MF5A 2KTQA 4G1QB 4OPKA 2YKMA 2UUTA 4RZRA 2Y1IA 2R2SA 3C6TB 4EBDA 4DG1A 4TYAA 2ASLA 2W9AA 1DLOB 3VN5A 4ZP8A 5C5JA 3B6OA 5KG6A 1XC9A 1WSHA 1RTDB 4DFPA 3O4QA 4J2BA 5I42A 4DF4A 5KFFA 4KTWA 4TXSA 4B3OB 1RT7A 1R0AA 2V0NA 3AA5X 2DTUA 5F8MA 4IRKA 4E7JA 4BWMA 1J9AA 2O5DA 3Q8PB 2BE2A 1NKBA 4DTNA 2QV6A 4CJTA 3CYMA 4X2BA 5CYMB 3QGIA 5F8GA 4ZHRA 4RU9A 2HAIA 1J5OA 1U04A 4IFYB 3RMCA 3HP9A 2O4IA 1REVA 4Q45A 4CK1A 1VSFA 3OJSA 4ECXA 4PY5A 3TAMA 4KHUA 3KIOA 1MU2A 5J1EA 2FBTA 4DSJA 4Z0UA 4CFDA 5C24B 2YNIA 4Y2CA 3RB3A 3SNNA 5KT5A 2B5JB 4ECSA 3F9KA 4MK9A 3UQSA 3HPHA 1VRTB 3Q8RB 3MR5A 3IS9B 3KLFA 4WFZA 2OZSA 2A1RA 2D3UA 4G1QA 4MKBA 4DL2A 1YVUA 2HNDB 3M8PB 2NUBA 3C6TA 2WB4A 3BQ0A 2W7PA 3G6VA 1DLOA 2B4JA 1S0OA 2QE5A 4ED2A 1WSGA 2DPIA 2E4LA 1S48A 4KHNA 1RTDA 4I9LA 4MIBA 1D9DA 3L8BA 4B3OA 1TVRB 4KV8B 4LD0A 2IBKA 4CJQA 2OZMA 1RILA 3TAEA 3AVAA 2BGGA 2WRMA 1WAJA 4ECRA 1NOYA 5CYMA 3CG7A 4OVLA 4QW9A 4OKEA 4KHMA 4IFYA 2UVRA 5EU7A 1DTTB 2D7SA 2W9CB 2LSNA 3D28A 3LP1B 3ALYA 1JLFB 4KSEB 4DTMA 5DQGA 3LPUA 1VSEA 5C24A 4F2RA 3NDKA 3ULDA 1JLGB 2J6UA 2B5JA 5KT6A 3D5MA 4IQXA 3HM9A 1IKYB 4ID5B 2ALZA 1S1VB 3UR0A 3A2FA 1VRTA 1OS5A 3PR5B 3L3VA 4K8ZA 3IS9A 4KBIA 4MFBB 3KNAA 3V9UA 4ECWA 3CM5A 3MTKA 1RYRA 4Y34A 2F8EX 4CEOA 2FBXA 2HNDA 3M8PA 1HQUB 3IGVA 4Q43A 1UWBB 5CZ1A 1SKSA 3KK2B 5KFGA 4QW8A 3V6KA 1XR6A 3H5YA 3H40A 1GX6A 2V4QA 1TVRA 5KT2A 4KV8A 1C1AA 1RBVA 3LPTA 3NF9A 1TKDA 4ZVHA 3S3NA 4NCGA 4R0EA 4J9KA 4CGGA 2XRIA 1DTTA 2IAJB 3T3FA 3SUQA 3DRPB 2W9CA 4Z4IA 4KI6A 3TVKA 1KLMB 3LP1A 4KHRA 4CE9A 3H2LA 1JLFA 1TKTB 4RW6B 4MK7A 2W42A 1NHUA 5KFWA 4LQ3A 3OYNA 1JLGA 3HO1A 3CJ4A 4DQRA 4TY8B 3OS1A 3RTVA 1IKYA 4ID5A 3SQ2A 1S1VA 3MEDB 1VSLA 4EO6A 1VSJA 1N4LA 1XHZA 1NK0A 1Q9YA 5DG8A 2XO7A 4MFBA 3CDEA 3AVJA 1J53A 3QIOA 1QS4A 1LW0B 3HP6A 3OL9A 1KRPA 1ZBHA 2GIRA 5CY4A 5HBMB 1HQUA 3QEXA 4LH4A 3QEWA 3BDPA 1UWBA 1NJWA 3OYLA 4DQQA 5K14B 1ZBUA 4Z4HA 3KK2A 4ZVFA 3RRGA 1C6VA 2G8HA 4JV1A 1T7PA 4NLPA 3RBDA 4MK8A 4DF8A 3QGHA 3S3OA 3NKYA 4M41A 3Q8SB 3PZPA 1LWFB 2AJQA 4M3TA 4CJKA 3OYBA 3TAGA 3QEPA 5DLGA 3V1RA 4WZQA 3AVMA 3C6UB 1S1UB 4DWIA 2AGPA 4JLHA 5KFLA 5L1LA 3DMJB 2IAJA 4NLUA 4O3NA 3DRPA 3SPYA 3MAQA 1KLMA 3RR7A 3VQAA 4QWDA 4E1MA 4F3OA 3N6LA 1TKTA 4RW6A 3OYDA 1TAUA 5T14A 4J9MA 3NAHA 1NKEA 2R2UA 5J2QB 3T5JA 1EP4B 3G6YA 4CIFA 4TY8A 2X78A 2G8VA 3VQEA 1YVFA 5KRSA 3C95A 1ZTTA 4EYIB 1XI1A 3MEDA 2FBYA 2AX1A 1LAWA 4CERA 3AVKA 3Q8QB 1S49A 3OY9A 4ZPAA 2ILYA 4F4YA 4KFBB 3AVBA 1NK7A 1LW0A 4YR3A 5SWMA 1Q9XA 5HBMA 4CEAA 3D45A 4DTOA 3NE6A 1X9MA 4FM0A 1JXLA 2XY7A 5K14A 1SV5B 3LANA 2ATLA 4C8NA 4AHUA 3HPOA 1UA0A 2W8KA 1QUVA 1BQNB 5E41A 3VQDA 2QXFA 3CQ8A 1KTQA 4F8RA 3P1GA 1RDCA 2G8WA 2IMWP 2IA6A 2J6SA 5KFDA 2YKNB 3OYHA 4CK2A 3V9XA 3WNHA 2BQUA 1LWFA 4ECYA 5KG0A 2OPRB 2V4RA 4F50A 3M9MB 3C6UA 1S1UA 4FK2A 2JEFA 3DMJA 4ECQA 1B9DA 3IRXB 3ITHB 3DLEB 1T05B 3HSTB 1HPZB 4KHQA 4KKOB 4E7KA 4ECVA 4NLGA 5J2QA 4DSIA 1T3NA 1EP4A 2OPQB 3OL8A 2AGOA 3NHGA 4H4MB 4DLEA 4L8RB 3ZT2A 4GC6A 4OPJA 4HCBA 3U6FA 2XGQA 2RDJA 5DG9A 4ZMMA 3DOKB 4KFBA 5FROA 3PX4A 4W5TA 2HVHA 3IN5A 3LP2B 2AQ4A 1SV5A 4GC7A 4NCAA 3AO1A 1BQNA 3VQ8A 3RR8A 3QERA 3V6HA 4B9SA 4RUAA 2D0AA 3GV8B 3L3UA 1ASUA 1W25A 1FKPB 4W5RA 4KTQA 3H5XA 2YKNA 2JC0A 4FCYA 1VSHA 3LALA 3PO5A 4CEQA 1HNIB 2OPRA 4AHCA 3O4NA 4M95A 3T19A 2AGQA 3K57A 4Z4EA 4RG8A 4O3QA 4AHVA 2R7YA 3V9SA 1CZ9A 1HARA 1N6QB 2GV9A 1JLQB 2KFZA 4IH6A 2WOMB 4QPXA 3IRXA 5F9LA 3ITHA 3DLEA 1T05A 3GV7B 3L2QA 3NF8A 1HPZA 4KKOA 4CJSA 1C0MA 3SQ4A 2OPQA 4KAIA 3H59A 1L3VA 3DRRB 2UVVA 1BCMA 2YHAA 4H4MA 3KMQA 5HRSA 4J2DA 4ED6A 4B08A 1KHWA 1WN7A 3DYAB 4NLQA 4M3UA 4QAGA 3DOKA 1NJXA 4W5QA 4EZ9A 3L2UA 1EETB 4DTRA 3LAMA 3QIPB 3LP2A 2P5OA 4NZ0A 3I5BA 3AVHA 4M3XA 1JKHB 3NBPB 3OYFA 3QNOA 2HHXA 3NH2A 2BQRA 1FKPA 3AV9A 5KFNA 3EPIA 3RMBA 1HNIA 1S1WB 1RT3B 4DL3A 1F21A 1I39A 1RTIB 1JXBA 5EUHA 4B9VA 1CXUA 4Q8FA 3SUNA 3EZUA 3VQQA 1BCOA 5CYQB 4DSKA 1N6QA 4Y2AA 4KB7A 1JLQA 1CSJA 2WOMA 1WSJA 3V9WA 3QZ8A 1YT3A 4Z4GA 2Z1JA 1KSPA 2UVUA 2IDOA 3BSCA
chains in the Genus database with same CATH superfamily
2LP4A 4FYVB 3CD7A 1A6LA 1S4FA 3ZZTA 1VQKN 4LR9A 1Q82T 4U7CA 4UUWA 1UCNA 3CC2N 4OO1J 3M1VB 4NYPA 3W9JA 4FXWA 3GIIA 3HKZD 1K8AT 1EETA 3BGFA 4KGZB 4OZ5A 2ZJRQ 4EYHB 1WHYA 1BA1A 5EWGA 1U45A 1B64A 5HRRA 3L2WA 1NPRA 4GV3A 2W8LA 3M30B 5K8OA 4IKFA 3L2RA 3BGOP 1XMOK 3HT0A 2R8KA 2HF3A 4NYNA 4LF2A 3BJYA 3TW0A 5KGXA 1RHKB 3IG1B 4P2FA 5F9NA 3AJ2A 4UOFA 3UN2A 5CYQA 4W92B 3KKFA 4JRPA 3D2EA 4CHPA 1HRHA 4A2AA 1SKRA 1GLAG 4UOHA 1NSPA 4J9OA 1SJQA 3PW2A 5IM0A 4JHDB 2ZWHA 4QCLA 3WNEA 4ZLLA 1FK9A 5FRMA 4ES3A 1Y7PA 4RL1A 1NNDA 4CGFA 1S6UA 2IJNA 4OLBA 3V4IA 3HM8A 3G8TA 2ZE2A 4X66J 4E0DA 2MJNA 3LF0A 4QS8A 1NLKL 4G65A 1X4BA 4YS2A 1LWCA 1RTHB 4M1KA 4ZLPA 4J2AA 2ILZA 1QD1A 4FJXA 1JJCB 2ZEJA 3CDAA 4OZ2A 5CD4A 1HWUA 1ICEB 3NGZA 4DFKA 4FWRA 4F26A 5DGAA 2IMOA 1WI6A 3NWRA 4FJHA 3I5CA 4O4GB 2NUUG 1R43A 3VGUA 4P72A 2FJXA 3QT6A 4CLFA 2JFKA 1S1TB 4PABA 1R59O 2VG5B 2DCUB 2C3YA 2Q36A 5SUHA 2FDNA 5D4NA 3H20A 2CKWA 1GLEG 1NPPA 2O8DB 1YF5L 2MYFA 3MM7B 1EX4A 4JI5J 3GL1A 2J7KA 3O9RA 3RVCA 1WC4A 4JB8B 2QWLA 1OQ6A 4FLUA 4R8UA 3HDSA 2HWIA 3RAMA 1QM9A 3D7SB 1B0PA 1CLFA 1UPMB 2HKEA 4BC9A 4DCOB 1S4EA 4BQLA 4MDBA 3BN4A 3ZX0A 2MTLA 2HB5A 4IDKB 4TQSA 4WTYA 2EXUA 1KD1O 4DV4K 1QVFR 4ALZA 4DCPB 3N4PA 4DUYJ 1KQKA 3QINA 3EM1A 1X4DA 2BZ2A 3G86A 3UNYA 3PW5A 2ZZMA 5DK5A 3DWLA 1VSKA 1WOSA 2O1PA 1FRXA 3PFOA 3I56S 3CIMA 2I7NA 4FLTA 2FVPA 5DS7A 3FZBA 2M2BA 3J8AA 1VQPS 3M8WA 4EFHA 2ITMA 3IUCA 2RPIA 3GV5B 1ZYQA 1CJTA 1FWPA 3BEXA 2VV5A 4QIVA 2D1KA 3P6YC 1WF1A 5CHIA 2Y0SD 1ILYA 2RKIA 5A8WA 3S7RA 3OBYA 4Z94A 3MMBA 3A5OC 4L72B 2W7AA 3JSYA 4NMLA 5LJ5Y 2KH9A 1HHTP 4ED7A 3K2PA 1RT5B 2H48B 3PIPL 4DV6F 4KH1B 4CO2A 5L38A 4LJMA 3SAHA 3MX5A 4YDDB 5KFMA 2DCLA 3GYGA 4CH1A 1XWLA 3ZETB 3VEXA 5BR9A 2OFGX 4ER8A 3EVOA 4M3RA 1T11A 1WOPA 2JEIA 2CQHA 2IM2A 2E1AA 3A8KA 2H4WB 4TKTA 1Y00A 2HAFA 2YPYA 2H5JB 3KNGA 4JNEA 2DGTA 4DSFA 1XIQA 2WONA 2QLWA 1TL7B 4CZMA 5THWA 3AFGA 3P4IA 4CFBA 2NZTA 5BN9A 2F9DA 2GO9A 2Y8YA 4N5SA 1NK9A 1ZTWA 2KXFA 3A0IX 3L09A 2LEAA 3UD4P 4LF5J 4JD2A 4BR5A 3N79A 1LEOA 3HHDA 4QYZK 4CFAA 4KRFA 4BRMA 3MMAB 4P2SA 4UOCA 3KJVB 3EUNA 3V81B 4RBUA 1XNQJ 1AW0A 4N41A 1NJYA 3KKSA 3EGWB 3AXMA 1S0VA 2GQCA 1C1BA 4TNOA 1BWVA 2PFDA 2GMHA 3ZSVA 3UE2A 2KW4A 1VQMN 1U1LA 5LMUF 4TU9A 2DJWA 4IOCQ 2AT1B 3CCLS 5I3PA 4DR5F 4RLEA 2JEJA 3F73A 3HSGA 1V6HA 4N76A 2HHTA 1UVNA 4DQ8A 1YK9A 4B3RJ 2LMIA 1H1VA 2HLUA 4QIGA 4CF8A 4DV1J 2WVBA 4DX8H 3BBFA 4OPHA 5HL7Q 2JC1A 2LA4A 4CZGA 1KXPA 4YORA 3BYRA 5L9XA 2R3VA 2QYCA 3QQCD 5GAGP 3NEKA 4WPAA 2FTRA 3UWTA 1YWXA 1UVLA 2UUAJ 2JOQA 3LA0A 2OGUA 4U7UD 4BREA 2CVEA 1X4GA 3W0LA 3DOMB 2PIIA 2CH5A 1P1TA 5E2QA 2NUHA 4B1ZA 2E5LF 3V6JA 1NOZA 1YJ7A 3EXYA 4J9RA 3VWSA 5GADP 3MM5B 4RNOA 2M70A 2GC8A 1TL4A 2QMXA 4B9MA 4JKGB 3I0SA 3FFKB 4F4WA 3MECB 1VQ9S 5AXMA 3HVRA 2FSNA 1G6BA 1MW7A 3GG4A 1Z26A 3K0SA 1Q95G 3OVAA 1GLCG 4OI4A 2GA7A 4NZ7A 4DL0C 1MWZA 1N33F 1V5IB 5T7BA 5B0CA 4PG8A 4FLZA 5DDPC 4ID8A 4Z4CA 4DTXA 2EG1A 2V4JA 2P9NA 2VKZG 1FNOA 5DO2A 4UQTA 2UUCJ 2MDAA 1LWEB 3O3GA 5J2NA 2QYGA 2K06A 1U1NA 2DYAA 3PW7A 3P3DA 5LSLA 1YJNN 1VIXA 4LSLB 4DR7J 3OFGA 5BRDA 4ED3A 3BGRA 2PZSA 1KFDA 5DZ6A 2W24A 3MAAB 1UFLA 2E7XA 1HD1A 1M1KT 3H08A 1JL1A 4JYAK 1X3MA 2V8PA 4IO1A 3Q24A 3EMTA 2P9SB 2YWWA 4ETZA 1VSDA 5KFXA 2QT7A 5AE3A 1VR6A 4ENOA 2CADA 1FRLA 1HI8A 2JVRA 3UE5A 3MUTP 1R6YA 1QE1A 1SL1A 4DV2F 3UNGC 3THYB 3K59A 3G96A 3ENWA 1FF2A 5ETSA 1RACB 2R7QA 1FWKA 2H54B 1S12A 1TAQA 1FVSA 4K4VA 2FJAB 3FBEA 3IWLA 3MCPA 3P83D 4H0YB 3KHRA 4FZZA 1RJJA 2E5JA 2KHCA 2DGSA 1IBMK 4ZVOB 1QAJA 2NXEA 3L7UA 3NP5A 2AP1A 3L0QA 3TA0A 1TKXB 3TR5A 3AO4A 4I7FA 1WBBA 4DHVA 3TAPA 3PY8A 5BPMA 2LU2A 3WBZA 5ETLA 4DU3A 2WTFA 2QFJA 1KVBA 2HFNA 3ZZZA 1D0EA 5KFKA 4PUOA 1I3OB 1RT4B 4LFBF 2F3JA 4WP8A 3R2CJ 3P5TL 2LKZA 3IDHA 3K2YA 4DL7A 3DLRA 5BYSA 2LEPA 4J2EA 1N32K 4JI2K 3AXKA 2HEKA 2YKPA 3MEGB 2GVZA 1XQIA 2NSBA 2R7WA 5LJVA 4LFCK 5AZIB 3WUHA 2CQIA 2IM1A 3VVUA 3CC7N 4NWBA 2KU7A 1NGCA 1BQMA 4M3YA 1QVGR 1TU0B 1FDDA 4O3RA 1IR2A 3ZSRA 1WHXA 3ZTQA 2Z56B 2ZD1B 2NSCA 4RPFA 2HMPA 5MAOA 2J5AA 4K7QA 4HI2A 5CCLA 4RW7B 1KQFB 1XMQF 2O3DA 1NB7A 2F7TA 2XMVA 1FJGJ 1QHAA 3D6FB 1UZDA 1HWIA 4GKKJ 3TTFA 3DI6B 2KM8C 2GGPA 4FK4A 1SIWB 4A59A 4IDHA 3MPVA 2Q1NA 2AD9A 2YQ1A 4FVMA 3ULEA 3QFUA 3L2VA 3ATVA 2A2CA 3GWCA 4DV3K 1KKHA 1JXVA 4M5DA 3OXLA 1RCXB 3ZT0A 3WNGA 2QMWA 4N7TA 2B4UA 5GADI 4O3OA 3HZ6A 4YFUA 3VQ7A 1Y4ZB 2FLOA 1TUUA 3C65A 3J7ZT 4FW1A 4DR1J 2KHDA 2OPPA 3S9HA 2VFVA 4J91A 3IXQA 1IKWB 1GMUA 4U7UK 3VF6A 1LQ9A 1N52B 5B0AA 1WELA 3M2RA 5DG7A 3R9PA 5AQLA 4YHHJ 3G4SS 1RDRA 2EBGA 2B0GA 1VBKA 2Z30B 4LRFA 3RB4A 4YR2A 1MA9B 3OYAA 2HK2A 1OJ4A 2VBXA 3LDNA 3X3UA 3NAEA 1WTFA 2C2OB 4LREA 3D2FA 1Q8IA 2ZC4A 3H2UB 5GVQA 2UXDF 1HNVA 2O8BB 3ADAC 1HQ2A 2CPIA 4LRBA 1HJOA 2J8AA 4Q2MA 4H0OA 1ZA2B 1X9SA 5ETKA 4RW8A 1VQSA 2FHJA 4BLGA 1KD1T 4KO0A 1TL5A 3EZWA 2LU1A 5I3QA 4BRKA 1PGZA 1JLCA 4NXMK 3MR6A 2F4VJ 4MO4A 4CJEA 3KLGA 5KFEA 4LF4J 4ZJQA 4HUFA 4C8OA 2KZMA 1GT8A 1I94F 3T1HF 4ANCA 3CCQN 3R3LA 1B7YB 1NGBA 3U9ZA 3NMAA 2HZCA 4BRIA 2W9BA 5GINA 3UCGA 5B0BA 4BQZA 4RW4A 2A0FB 3RRKA 1XUPO 3PRBA 2IC3A 4DS5A 1NGGA 1GEHA 3OD2A 4ED4A 3TQ1A 1LFWA 1FWLA 1UEUA 3FBFA 4O3PA 3ZSQA 4XPEA 3TUZC 1X7VA 2FHMA 3IP0A 2PY5A 5F8JA 1C0UB 4NLOA 3M6XA 4I1TA 5HP1B 3BPSP 5FRNA 4JKHA 5AQIA 3SI8A 4FW2A 4TSXA 3NAIA 3NCPA 3O3FA 2F5GA 3FFIA 4A5BA 3V9ZA 3S8SA 4NLTA 4H5RA 2HBMA 3MEEB 1Q5YA 4JS5A 1R89A 1HQEA 4S0MA 1HKCA 1WKKA 9ATCB 1O5JA 3MXJA 2IDEA 3GR1A 4JI7J 3ENVA 3KHLA 2E9ZA 1N88A 3AVFA 1TTHB 2RUGA 1HBOA 2H5EA 2RILA 3CETA 4LH5A 2KT5A 5KOWA 3FGUA 3DRSB 2D1CA 1RWOB 3OYEA 3R5JB 2E9RX 1HYSB 3ENAA 4WFXA 5F3TA 4I2QB 4FOEA 1YJWS 1VGYA 3FCWA 1IKVB 4GKJF 4JV5K 2MQOA 2VPZB 2QLFB 1RSCA 2ASJA 1M1HA 3BB5A 5L9NA 1TUGB 1K8KB 2Y1LB 1HBNA 1S5JA 4KHWA 3ENHA 2DBBA 2M8HA 5JMNA 5AQFA 2MQQA 4NYFA 3BREA 4OYZA 2JWKA 4RUCA 1F2GA 3O9UA 4RJVA 3PV8A 2MKSA 5KG5A 2D0CA 4OGEA 3PM9A 4FJGA 2UXBF 3PW4A 3DLHA 3GSIA 2R7VA 3M6GA 2KFNA 1V4TA 3VOVA 1GXUA 5HQ8A 2FLPA 3TJAA 4I6MB 4ERDA 5ETOA 3DLGA 2NYIA 3LP0B 3JB9k 2P8IA 2YJFA 1OSCA 2FZCB 4CEBA 3IWNC 4UY8T 4DMNA 5AQVA 5FIIA 3MR3A 3HXMA 1CC7A 3FEXB 1A5WA 1TUWA 1H72C 4AYBD 2ZBRA 2QWRA 3UD3P 3BO4A 5M1PA 2E1RA 3CCVS 4DU7A 4NE9C 3RRHA 2OTJN 1HMVA 2E6LA 4M5HA 1SKWA 3CJTA 1I51B 3PYFA 2HBQB 4K5RA 5JS2A 5D3GA 2DY9A 1J5EK 4F02A 1JXEA 3NVMA 2V2ZA 4KHPF 3C7NA 4BRFA 2B9YA 3OLAA 1S9GB 1E3MA 2V63A 2U1AA 4NI2B 3O1WA 1U2CA 2K7JA 3EXCX 2HVDA 4I0WA 5DGBA 1RA6A 5FDLA 3CCMN 1HX1A 3M8RA 2QK9A 1X5TA 4EP5A 4NZ6A 2CQBA 3VAKA 1FI4A 1J2VA 5I4MA 1N36K 2QSFA 4ZJLA 1R8PA 4RWWA 2EC0A 3E1YA 3ID8A 3CMES 1Y5NB 1KP6A 1KLNA 4OV6A 1JLAB 2YHBA 2VU5A 1TL1A 2XMJA 5BYQA 1A7GE 4ZCMA 4JKBA 3U1MA 1BL3A 1VK0A 3AOCA 4LF6J 1SH2A 5E26A 1CVJA 4DHYA 5LMNK 2J7UA 3R5BA 2DNYA 4P52A 3MM8B 4O44A 2UZAA 1SC4B 3VQ5A 3TAFA 4DG1B 3HF5A 4DZ6A 1SBRA 4JI8F 5G4DA 1X60A 3RJMB 1RNHA 1RBAA 1OH8A 3UPFA 4Y65A 1R0AB 5L1JA 1JLEA 4NRUA 4X62J 5E0OA 1TZ0A 5KG7A 4ZPBA 1S0NA 4A46A 3TU5A 2MGZB 5K8MA 3BBCA 3TPQA 2OYQA 1NJZA 3J81j 2PBDA 1REVB 1QTMA 1BUPA 4K4SA 2I7PA 1PAUB 4Q0BA 2J6TA 2XYHB 4CF1A 2JSXA 4B1UB 2YNIB 2GWKA 4DSLA 2ZUGA 1FCAA 2CQ4A 1X1PA 3ZSWA 1JQGA 1A9NB 4WFNL 1C4AA 3AA9A 3KJFB 4GVBB 3RU0A 2YKMA 3MMVA 4G1IA 4X65F 3GDQA 1U1PA 1BG3A 2ASLA 4ZP8A 5C5JA 2HIYA 3QDKA 3B6OA 1WSHA 1LXNA 2CQGA 4DBQA 5I42A 2OHDA 3H42A 1RCOB 3DDNA 4TXSA 2WVCA 3QRQA 3MOZA 1J9AA 1CULB 5IS2A 2CXEA 3Q8PB 4CD1A 1WEXA 4DTNA 2QV6A 5ITHA 3CYMA 4RR5A 3WXJA 2O4IA 4Q45A 4CK1A 1JWWA 3D9BA 4FF2A 1H2TZ 3GE1A 4ZLJA 4ECXA 2ACMA 3KIOA 1MU2A 3CMAN 4CFDA 3SNNA 5DM7Q 4NXNK 2P5VA 3O8WA 3F9KA 5GAGU 1BDGA 2MKIA 3HPHA 2F8MA 1EAYC 1VQNN 1U0HB 3BUZB 3GZ7A 3MR5A 4WFAL 3QJLA 4LIWA 3K9JA 1X31C 5B0FA 4MKBA 1YAGA 1KDNA 1H2UX 2PO4A 3M8PB 3OTCA 3CCUN 1Q16B 5CH7B 2DGVA 2W7PA 3Q2TC 1OYEA 3EICA 4BR0A 2B4JA 1U25A 4ED2A 3IC1A 3POTA 4I9LA 5GADU 1GMVA 3HULA 2IVYA 4MIBA 1D9DA 4LD0A 1DFDA 2AZ1A 2XULA 4BC3A 1DURA 1UPPA 4GV6A 2BGGA 1WAJA 4ECRA 5CYMA 4OVLA 1GLBG 2VQFF 4OKEA 3X1LB 4JK7A 5ETNA 4IFYA 1GMWD 2BE9B 1BA0A 1DTTB 2D7SA 5A0YA 2W9CB 2Q3PA 2JRSA 7AT1B 2YI1A 2RS2A 2RRAA 4A8FA 2GHVC 4ZIWA 2FZKB 4BC4A 3ILIA 3Q2SC 2ALZA 4TVAB 4OX9J 1VRTA 2QW9A 1VQ5N 3L3VA 1E6VA 5FJ4A 5CZXA 3RSEB 2DNZA 3V9UA 2DH7A 2H5IB 4USJC 3M5RA 2F8EX 4DUZJ 4BCAA 3AHPA 4CNZA 3E8OA 3ZLJA 3ZEUB 5F41A 1VQON 1Y9OA 3RBZA 4L6V3 4B17A 3H5YA 4QYRA 3MMCB 3L4IA 1N8RO 2E1PA 4DOZA 2MY7A 3IR7B 2OANA 1P6TA 1TKDA 3P38A 2CJKA 2BMBA 3OTOF 2W40A 4R0EA 4CGGA 2XRIA 3T3FA 4LF7K 2JX2A 4PKGA 2BKNA 4Z4IA 3TVKA 1KLMB 3LP1A 4KHRA 4MMOA 5E33A 2MZQA 3QGPA 4CE9A 4LF9K 1NO8A 2MQLA 1RHQB 4LQ3A 1JLGA 1MMDA 3RW6A 3OS1A 1RU1A 4A8WA 5GMKa 4ID5A 3TZXA 3SQ2A 1S1VA 3HSJA 3W5YA 4ILRA 4EO6A 4WQ4C 1XHZA 1JJ4A 5DG8A 3OW2M 2E29A 2HGNA 1IBKJ 2PE8A 1QS4A 4HTIA 2BJ1A 1KRPA 1ZBHA 3U27A 4QS9A 3OVSA 4JI5F 1DGKN 4OHYA 5M2UA 3MCAB 1UWBA 2EKYA 4DQQA 5K14B 2F40A 4LFAJ 3G25A 2KKZA 3GOIA 1RWWB 5BN8A 3SQGA 2KDOA 3KG1A 3RBDA 2RMLA 3QGHA 2DXDA 1PYTA 1W2BR 3PHTA 4M41A 3CQXA 1LWFB 3J7AP 4CJKA 3IR5B 2MQ8A 2VD3A 3A1YG 1CJKB 2H1YA 5DLGA 4DV5J 3V1RA 1XK8A 4FF4A 2E1ZA 3FE1A 5L1LA 2FF3B 2IAJA 4O3NA 3DRPA 4OI0A 1T9VA 3SPYA 3N6LA 2FSKA 3OYDA 1TAUA 1JJ2M 3NAHA 4K41A 4FNIA 4H0XB 1EP4B 4CIFA 4EMDA 3UO0A 2EVZA 2X78A 1YVFA 4DJBA 3ZX3A 3MEDA 2FBYA 2LFVA 3AVKA 4RUHA 4LVOP 4B9QA 1HFEL 4F4YA 4CLTA 1NK7A 3ZTRA 3JQJA 1KR4A 4DR6J 1LXJA 3D45A 1X9MA 1JXLA 1OSDA 2ATLA 3LANA 1YJRA 1XN9A 3HPOA 4ZVSB 3KWIA 3AOAA 5E41A 4CBXA 1R27B 2G8WA 2A1BA 4QIEA 1WUUA 3T1YJ 4CK2A 3V9XA 4DV7F 2EC2A 3EVWA 2BM1A 3HFVA 1FRMA 4WQ5A 2HBJA 3B8HA 2L08A 3UD5A 3C6UA 1S1UA 4FK2A 2C3UA 2POKA 1HBMB 4IOAQ 1B9DA 3FRYA 4DR2J 1S99A 3IRXB 2YWKA 4OJ3A 3IBCB 1NM2A 2LQJA 1OVQA 3BH6B 1T05B 3D67A 1X0FA 1XBWA 4KKOB 1ZZFA 1ZBSA 2VBZA 4DSIA 5J2QA 5BR8F 2VIHA 6FDRA 2FJDB 3ZT2A 2A18A 4GC6A 4OPJA 3M32A 3L6QA 3J7A1 4GY2B 3U6FA 2RDJA 2PEBA 1R8AA 1Y10A 3PX4A 5FROA 2HVHA 3LP2B 4ILHA 1G3OA 2AYGA 5C15A 2UU9J 2GHPA 3DCAA 1T0TV 2C2ZB 3RR8A 3V6HA 3HOSA 4B9SA 1FTCA 3FNNA 1HPMA 2PMWA 2QWQA 1ELOA 2NLXA 3L3UA 1FKPB 4Z37A 4KTQA 4EHTA 2YKNA 3LALA 2ZBQA 2OPRA 4WCEL 1BO5O 3K89A 3JAMY 4LF8F 4AHCA 2HQGA 1N34J 2M0GB 3T19A 4Z4EA 2C3PA 1M0SA 4AHVA 1HARA 2GV9A 1JLQB 3AJ1A 3EGVA 3DLEA 4CTAA 1C0MA 2RH3A 3D54A 2HRTA 1NGFA 3SBTA 3B54A 3H59A 5HVGA 2YHAA 5HRSA 3OV7A 4P71A 5E3QA 2EFPA 1KHWA 1PYOB 4HDGA 2IVNA 3DYAB 4PHTX 4FYWB 4JP8A 3RG6A 3OR2A 3LGMA 1B0VA 3EL2A 3P31A 4U67Q 1NJXA 1XNRF 1Z2ZA 2ZWOA 3BN7A 1ZXOA 2MQPA 2MSSA 3AVHA 1APSA 3OYFA 3QNOA 2MPUA 1NUEA 2BQRA 2ADCA 2JLGA 4CO3A 5KFNA 4UOGA 1KQSM 1F21A 1RTIB 1YBAA 4F0MA 4AQYF 2NNWA 2CYYA 3NXZA 3EZUA 2VQEK 3T6BA 1K73O 4MLEA 1S7IA 4F0KA 4DSKA 4Y2AA 4JI0F 1CSJA 3L7OA 2WSFC 3FEZA 1YT3A 4W4MA 4Z4GA 1KSPA 2UVUA 3BSCA 3AAPA 4X4SA 4WP9A 2MMYA 2PI5A 1I6JA 2JHEA 1VQMS 2N7CA 3DRRA 1VS3A 4CGIA 2P5GA 1D9FA 1WC0A 4ZA1A 4M7YA 1FNMA 4RKUC 1VFJA 4ES2A 2D74B 1VAZA 4M5MA 3CM6A 4BE1A 3FUYA 3LPYA 5M2RA 1EARA 4CO4A 1IG8A 1ASWA 4PWWA 2ZOFA 3QIPA 4K5SA 3ZZUA 3O3HA 3UIQA 2XWYA 3QMLA 4FXDA 2ZC3A 4PA1A 1RHMB 2IIRA 2YV0X 2NXJA 4YY3K 2QJ3A 3THWA 1JL2A 2KFYA 2KHOA 2R42A 4FPIA 2I2YA 3V2UC 2IM3A 3N5FA 3P4UB 4Q8EA 1W97L 1S1WA 2BRLA 1U48A 3PNIA 3ATUA 3C8YA 2AX0A 5ETMA 2MHNA 2AYBA 1NGEA 2ZH1A 1HNXK 3G8SA 1NK8A 1VJQA 5FLXO 3LAKA 4OZ1A 4DCJB 2C28A 1NB2A 3CNQP 4IQMA 2KKHA 5D15A 4JV5J 3OR1A 2ZOGA 3AARA 5KFIA 1LW2B 5T41A 1RU2A 2PC6A 3JSBA 3SSSA 3LM2A 3JS6A 3MOJB 1RP5A 1N48A 2HF4A 2MEWA 5IQ6A 3M1VA 2P9GA 4Y3CA 4RUBA 4M7XA 4DX7A 2XMMA 4YB6A 3WEEB 3AVGA 1TV6B 2RHQB 1BIZA 4HTUA 2ASDA 3MPYA 2PEHA 4CWBA 3LDPA 2LDIA 5D4LA 5AJ3K 2DXFA 3M30A 2RRNA 3CDUA 2RD5C 5J2PB 2GX9A 1IG9A 4QIFA 5A2QU 3U1NA 5HRNA 2V8GA 4Y00A 3SSQA 1X0PA 4EUVA 3UFCX 1U47A 2HFZA 2IVPA 3IG1A 4K50A 1TQLA 1UEVA 1S0MA 4PWUA 2B7CB 3KD5E 1LWXA 1YJNS 4BRNA 4N56A 4JOUA 3U1LA 1WLJA 2RB7A 4ICLA 1WG4A 4BC5A 3PACA 1FA0A 3TWZA 1K9MT 1C4CA 4JHDA 4L74A 3MUVP 4HDHA 3CI5A 2O8CB 2MZ1A 4DV6J 4JI4K 3R97A 1KWMA 1S9FA 2CJYB 5IC4B 4DTPA 2VDIA 3C3LA 3O8MA 2VCPA 2X51A 2V2VA 2NRRA 2QLXA 3MD1A 3BKUA 4ELTA 1UKUA 1RTZA 3FQKA 2ACYA 5KPZA 1AUSL 4QOZB 5HRPA 1PCAA 1RTHA 3F44A 1OY8A 3VAHA 4B3MF 4H5VA 5IWAK 4P10A 2GVDB 3JTPA 4FYXB 1IQTA 4DB3A 2FQQB 3QNNA 3GFYA 1WOQA 2I5JB 4CF9A 5E3RA 5HMYA 5E84A 1FXRA 4UTGA 2BJ7A 5C2DA 3CCES 3NNAA 3FZ2A 3DU5A 3M05A 5JVGL 1AZSB 5IV4A 4O4GA 4ILJA 1WBDA 1RXOB 2KVIA 4FBTA 1S1TA 2VG5A 1VI7A 3ZZOA 1T94A 2VBWA 3NOGA 2O8DA 2H9ZA 5B8HA 5C25B 4CFCA 4I6AA 1HHQA 3MM7A 5AQUA 4P9SA 4C8ZA 1IUJA 3LDSA 4CHNA 2OEJA 1RE1B 2OJ3A 2HQDA 1OO0B 1U1KA 5LMUJ 2ZFHA 2DXEA 3WDOA 3T5KA 5EWFA 5FPMA 4ZVUB 4PKIA 2ZGZA 4DR5J 4ISEA 4FJJA 4IDKA 4PEOA 4CJ4A 2UXCK 2ZH5A 3K9KA 5L1KA 4B8AB 2CQPA 4B3TK 2OAUA 5LT5A 2GTDA 4MYUA 4MKYA 3BSAA 1UOCA 3CC7S 2QL9B 2ZH9A 4RNFA 2Y3YA 1P8ZA 1RAEB 1WDDA 4B9UA 4YN3B 4E1JA 4QWCA 2HHHK 1SC3B 4EP4A 4B9TA 1S22A 4O55A 2WB1D 2XLIA 5AXKA 3AA4A 5B0EA 2RN2A 4UQGA 3MXIA 3BEGB 4CECA 2RE1A 3EN9A 1U49A 3ILJA 4DSEA 4A8KA 1IO2A 2KRRA 2DNNA 4NMXA 3CJ7A 4J9UE 3ETOA 4HHHA 3MM6B 2HFUA 2E5LJ 4KC5A 4A8QA 4PL7A 1HR0F 2D9OA 4C8MA 4Z4FA 4LSNB 4RNMA 5E3CA 5L1IA 5FD1A 2OEKA 3SDEB 4CO5A 4DXLA 1BI4B 1GOCA 1TL3B 4I6WA 1RT5A 4FLYA 2Q79A 3TOQA 3FCHA 4P6QA 3BSOA 3SQ1A 3GP9A 3T1AA 3QSYB 1UL3A 2RF2B 4K2JA 3PJ9A 2VICA 3THXB 3ZETA 3W66A 4FJKA 2XZTB 2Z1IA 3CF5L 5GIOA 3BQ2A 3D1OA 4JKAA 2KQ2A 3BZCA 3CUNA 3OW2R 1U6ZA 3IRWP 1JX4A 4F4KA 3VQ9A 1RDDA 1S6PB 1SQEA 3HHLC 1N33J 2N3OA 4YEAA 3IWXA 3UKUB 4HYKA 3H4DA 2HFOA 2W41A 2BYCA 1TL7A 2W01A 1IBLK 1A0OB 1J27A 2PD1A 1HNWK 1RT1B 3OYKA 2HOEA 4P75A 1K1QA 3OHRA 2BM0A 3SCXA 4QBUA 3CJ0A 4KJIA 4OIXA 3DXMB 3K0JA 3TAQA 4NLVA 4OYOA 2DNMA 4WKYA 4IZ9A 2OUGA 4CZIA 5F8IA 3WQUA 3TA1A 3CWJA 3MMAA 3KJVA 1C0TB 1M5OC 1HI0P 3LO3A 2VWBA 4F25A 3V81A 3AO3A 1ASVA 2DNPA 2CNNB 5AQWA 3SFGA 3HVAA 1WC6A 2ZBPA 5KI6A 3DC2A 1M90T 2QWMA 3MCSA 3JQKA 1JJ2R 2VDHA 3FC9A 3MPWA 1S10A 4QR0A 2VJUA 4GW6A 3Q86A 2R7XA 2VFSA 3E51A 4DTSA 1BUXA 3G6XA 3CCQS 2Z4PA 1KOOA 4DV2J 3CCZA 1ESVA 3Q83A 1XMOF 5IV3A 2RQCA 1XHXA 2DIUA 3VGMA 1ZPVA 5EX5A 3VF4A 1DARA 4DPOA 2VFRA 3NF6A 2FJEB 3VAJA 3KVGA 5F8HA 3OYIA 3GJQB 4CLSA 1IV0A 3BV8A 4HHTA 5AQXA 5HQLA 3OYMA 4W5OA 3TA2A 4K8XA 3CXCM 1Q79A 2HGLA 5LXYA 4N77A 2J0SD 3DOMA 3MM9B 1LV5A 3L4QA 1TK8A 2FHJD 1S6QB 4R0JA 3A3OB 3KLIB 4D3GA 4NOHA 4Q7AA 4TLRA 2Z1GA 4USMA 4LFBJ 4DPXA 2EWHA 3M4XA 4TY9A 4HTJA 3H45C 4PL8A 3MM5A 5KRTA 2B6AB 4GO5X 4K43A 4JKGA 3J7YP 3MECA 4FLWA 2OI2A 5GAEI 4DV0K 4TLQA 2HHQA 3OYJA 5A8RB 5EN1A 4HWIA 3F56A 1RADB 3DXKB 2X1BA 3D7EO 2J0QD 3VZIA 3VEWA 3FZFA 5BPLA 3VTIA 3MTJA 3DNCA 5G0RB 1Q53A 3QO9B 4CD3A 3DLJA 3HCXA 1FEEA 1XMQJ 2HNZB 4DL4A 1KAXA 2CPJA 3KK3B 2IDLA 3KG0A 4E3SA 3MN7A 4O4RA 1LWEA 2XZDB 2W7OA 5KFUA 5AQPA 3CJ5A 1NDLA 4LSLA 2C22A 3ZZYA 4G6VB 3GYNA 3I31A 2DNHA 1K8AO 4KGVB 3UI3A 2DR7A 3EWGA 4FYDA 5LM7E 3THPA 3H98A 4CJ3A 2CDRB 3MAAA 3RB0A 3N5BA 4KR0B 2XNRA 2BANB 4J9PA 4HR2A 1MN9A 4HACB 4C0HA 4DV4F 3P39A 2FJWA 4IRDA 1BU6O 3GR0A 2YWEA 4JI3K 2P9SA 1RBRA 1B4SA 5AQSA 1CEZA 2QWPA 2A1SA 3BSNA 4QWBA 2XI2A 2Z2YB 3HFZB 1P1LA 1NSAA 3JS9A 3UVJB 3ENOA 3ZFVA 3ISND 2AEMA 4YOEA 2V8DA 3ULHA 3THYA 4U9RA 2OTJS 3FSIA 3NGTA 3M8QB 3E9OA 1IQZA 2RRBA 1U6FA 3AOBA 2RSQA 3SV3A 4RNHA 1OY6A 4P7VA 4JK8A 2RU9A 2ROGA 2XI3A 4CT8A 3FJ2A 1KQSR 3I8BA 3FDSA 2YCHA 2UXDJ 1TKXA 3SMSA 4CJUA 2AYMA 5DDOC 3H7HB 3FCVA 3GQCA 3CCMS 2QC3A 1DTQB 5HJXA 1RT4A 3AGRA 4J9NA 4RTFD 4WF9L 3WZ0A 2MZSA 3PUFA 1RT2B 4K4ZA 1I94J 3T1HJ 1NSKL 3WNFA 3Q7CA 1H98A 4E7IA 3MEGA 3SPZA 1SH0A 2GJ2A 2DK2A 5HLFB 2U2FA 5AZIA 4NLDA 1OY9A 4K4XA 4WYLA 4XIUA 4KI4A 1IH7A 2DO0A 3QZ7A 1CBKA 3NCRA 4PR6A 1SB6A 2A41A 2RQKA 2ZWPA 2CPEA 1CZAN 1KFSA 1PSDA 2ZD1A 4B1VA 2YNHB 2FVQA 2A2DA 4RW7A 2F96A 3ENBA 2EWSA 2PMHA 4ZLNA 3CPEA 2NXNA 5F0XA 5EY4A 4DR3K 4Y28C 4OHZA 3DI6A 3W3DA 1EKSA 3LWLA 1O6XA 4URQU 3TWHA 5D78A 1O8BA 3DM2B 3HKWA 1W26A 5FPNA 5A8KB 3W61A 3AAWB 1CZBA 3CHWA 2DGOA 3ZT3A 3PHEA 3O5BA 2DD8S 3GILA 3C15B 5KFOA 2I1RA 1AROP 4I2PB 3CFOA 2YX4A 2OIHA 1VJWA 3QLHB 3D0HE 1NK6A 1UVIA 3ZSOA 3CO9A 2V8VA 1ZAWA 4B1XB 3J7YI 4IG3B 1A5VA 4CIOA 2G13A 2JLEA 1NKCA 1IKWA 3QWPA 4MTPA 4NL5A 3HL8A 3QFPA 4CESA 3QB0A 1NNEA 4GKJJ 4JKEA 4EO8A 4A47A 2HVIA 2IRYA 1N5VA 3PIOL 4CGHA 2VG6B 2VG7B 5GIPA 1OH6A 4QIWD 2NYHA 1RKJA 2NPIA 3S41A 2UYTA 4OYXA 2VODA 1HYZA 1VQLN 4ZVGA 2R8JA 3Q23A 1LK7A 3AB4B 3QNWB 4DFJA 3CJ2A 2M3DA 3M6WA 3R1XA 2UXBJ 4NYZA 2NRZA 2O8BA 2ITGA 4IFVB 2Q1LA 1R0BG 5AQTA 3CW2C 2F65A 1NMDA 4P2XA 4WWSA 1B9FA 1BE4A 2G8IA 3GLJA 4PCQA 3CMAS 3F2KA 1F5AA 4OYAA 4YNQA 2OMLA 4CW7B 2N4DA 3D3CJ 2QO3A 3CCSN 4J9QA 2DPJA 1VQNS 3FSXA 3BKTA 1T9WA 2B4VA 4W5NA 1REGX 3PVXA 2FUG9 3T69A 4A4JA 1NCLA 3C6HA 1SL0A 2OELA 4Q5VA 3PO4A 1R8BA 2WSEC 2GS8A 4OKJA 3EE8A 4XEIA 3U3GA 4CEZA 1UJ6A 4C3LA 1C0UA 1X5SA 3UW1A 5ELZA 3ZT4A 4AHRA 5HP1A 4KHPJ 1HKBA 4CVNE 2BKOA 4KB1A 2G2ZA 5J1NA 5AE2A 4W90B 2EX3A 2LEBA 3AO5A 2LDYA 2OKQA 4CHQA 4B9NA 2FYXA 4IKAA 1TMMA 4BRPA 5E7OB 3CJ9A 3MEEA 1DKGD 4O3SA 1YRTA 4OZLA 1Q8LA 1K6YA 3K5NA 2P9KB 2HBLA 2B43A 3B8AX 1Y64A 3BF4A 2IOCA 2QWNA 2CZ4A 3B6PA 4Y2MA 4OPAA 5HROB 2IPOB 4PG7A 3W9IA 5GMEA 5KGWA 3HX9A 2WUSA 3VHQA 2Y1JA 1RAHB 3PCOB 4ISFA 4ELUA 3DRSA 5K9FA 1X5PA 5IQQA 2CQ1A 3ZT1A 1RGVA 4CEFA 2FY8A 1HYSA 4I2QA 2MZTA 2IVMA 3IAYA 3W63A 1VQOS 1IKVA 3MWTA 4G1PA 2E2NA 3VAGA 4ILMA 3P8BB 2BV3A 3LDQA 1GMWA 4C3KA 3VA0A 2E9TA 1K8KA 1IBMF 3IR6B 1RWVB 1K0VA 1EX8A 1KEKA 2GWJA 4JI8J 3IBWA 2RT3A 4WXWA 3QT8A 3MX2A 4A62A 5DDRC 2XMKA 5AFUH 1PKUA 3CCJS 4CRJA 3DN9A 4C97A 8ATCB 1VQ8N 2DFFA 2QA1A 4I6MA 3BBBA 4M5GA 4K4WA 2R8GA 1HWJA 3LP0A 2W4PA 3TNVA 5D0RA 1N32F 4JI2F 2G8FA 3IKMA 3TI0A 3VEOA 2P9CA 4CH0S 4PAAA 4J7CA 4C0BA 2EHGA 4LFCF 3OHBA 1RHUB 2D41A 5KFRA 4TQRA 3CDWA 1FE4A 2LA6A 3I6PA 5F1XA 3U3YA 4A57A 5EGYA 4YOXA 5DLFA 1QSLA 3CT9A 4CIEA 3AVCA 3EX7B 5AQZA 3K5MA 4RWXA 4B3SK 2QM1A 1M5HA 1WB9A 4DU8A 3NGIA 3SZ2A 1VC5A 3PYDA 4YB1P 2LECA 5H9FK 5KG1A 4BDZA 5CCMA 4JI1K 3P5BP 3R6MA 3GJSB 2QLJB 4EK2A 1ZH5A 1CLQA 2AMCB 1WEYA 3MPDA 4FZYA 4ZPTR 1S9GA 3WQPA 5JICA 1M1KO 4NI2A 5AQRA 4BDPA 1RT7B 4DV3F 4PYAA 4FWNA 4F7VA 3BR9A 2BE2B 5AQGA 3ZZPA 4DU4A 3OLBA 1D4XA 3IFRA 5DMRA 4ZHRB 3C2PA 1J5OB 4KGMA 4FOIA 4IEIA 4YOTA 4IOCL 4OFZA 3JQMA 2Y0BB 1DY3A 3TAMB 2JNJA 3WC2A 4XO0A 1AXQA 5AQQA 4ZPWR 2VWKA 1U2RA 5HL7L 2DHXA 1JLAA 1FRIA 1UEKA 1VQPN 1B70B 2YHYA 1VHIA 3D1QA 3DRYA 4ZK7M 3F5TA 3KDOA 2KTQA 4G1QB 5LJWA 3CC4N 1JNRB 1KAZA 2F9JA 4B3TJ 3C6TB 3MM8A 4DG1A 4JI6K 4TYAA 3UN5A 2W9AA 3CXCR 3C6AA 1DLOB 3VN5A 2WW8A 4PKHA 3KWGA 1BWEA 1RTDB 4DFPA 4J2BA 4KH4A 4BRQA 4DF4A 1OH7A 2D0PA 1R0AA 2V0NA 3AA5X 2VQFJ 4IRKA 4I69A 4BWMA 2CQCA 2DIVA 2V5HG 2ZDOA 1Y0HA 3TSQA 2ZJQQ 1NKBA 4NXMF 4CJTA 2MGZA 4X2BA 3TTDA 4RU9A 1U04A 1REVA 1W7WA 1KOHA 2Z58B 3GFXA 2BA9A 1VSFA 2A3JA 4PY5A 1UVJA 3I55N 5C24B 2YNIA 2R7TA 4C48A 2B5JB 2YQ0A 3UQSA 4CZJA 2DPNA 1X5OA 3G2XA 1XJWB 3IS9B 3I4PA 2RNEA 4GVBA 2QA4S 2NREA 2HNDB 2WB4A 2O8FB 1KONA 1D3WA 1R0CB 4NLBA 3L7PA 1WSVA 2VONA 3W60A 2DPIA 1WSGA 2E4LA 4KHNA 4BRDA 1F9FA 1VK8A 5CD4H 2IIHA 1HWLA 5HO4A 4KV8B 1RI7A 3OTOJ 1VLOA 2XYPB 2XS5A 2DEIA 4CJQA 1CULA 2KYZA 8AT1B 2ZHAA 2WRMA 2RQMA 3CG7A 3J7ZO 3MCNA 4D3HA 3R27A 5EU7A 5HI7A 3A8YA 2J9CA 2P9EA 2LSNA 3D28A 4ZN1A 2GAHC 1WHVA 3ALYA 1W7AA 4KSEB 5DQGA 3OXGA 5D0GA 4F2RA 1F1BB 3ULDA 1QJHA 4L3QA 4FF3A 4IQXA 1IKYB 4OYWA 3UR0A 1U0HA 1VC6A 3A2FA 1Q4RA 3EEQA 3PR5B 2Q0RA 3GCWP 1ZAXA 4MFBB 1S79A 3TEGA 4JV5F 3CM5A 3CD6N 2GIFA 1DQAA 2CJXB 3I82A 3M8PA 3IGVA 4Q43A 2RJZA 2UUBK 4USUA 5AQKA 1IWGA 3QAEA 4NB4A 3V6KA 2UV8A 3D0GE 2ZVIA 1MG7A 1Q18A 2ZUAA 2XYGB 3H40A 4K0KK 2WVEA 1GX6A 3I4HX 4MYTA 3O6QA 5KT2A 2QL5B 1C1AA 4LMZA 3UKRB 1RBVA 1U8SA 3MD3A 2Q0UA 3PKMA 1BD6A 3U9DA 3J7YU 3LPTA 4WU2A 3WXIA 1F6TA 3HLUA 1JCGA 1S7HA 3S3NA 1VQ9N 1FD8A 4NCGA 4J9KA 1DTTA 3SUQA 5AR0A 2W9CA 3H46O 2DNQA 3BR8A 1ZM9A 2MLXA 1TKTB 4RW6B 4ANDA 4ZN3A 5CQGA 3OYNA 3CJ4A 4DQRA 4X64K 2H4YB 1N5TA 2E8AA 1UTAA 4ZPVR 3ZTPA 1VSLA 2MZJA 3VTHA 1VSJA 1N4LA 3TEHB 3LUYA 3AVJA 3RSEA 1NHKL 3QIOA 4FPRA 3OL9A 3GU0A 1JNZB 1YJVA 3QEXA 4LBIA 3ZEUA 2YKAA 5F0UA 4U96A 2KM8B 4WP3A 4YDUA 1J5EF 2W1BA 4XH1A 4YOVA 4FP9A 2ASOA 4C98A 4DV7J 2G1HA 3MMCA 1T7PA 1F60B 3EE9A 4MK8A 1EJ7L 4XAKA 3PZPA 2AJQA 1NGIA 4OI2A 5T7LB 2WSCC 2CQ3A 3OYBA 2CPHA 3HI9A 1F9HA 3TAGA 1DBDA 3ZNUA 1XC3A 4DWIA 2AGPA 3O5TB 4JKCA 3MAQA 1KC8T 1KLMA 4E1MA 5BR8J 4F3OA 5T14A 4J9MA 1F0XA 1N36F 2V68A 4Y2KA 2ZJPL 4BG9A 2GNKA 1T9YA 2WZ1A 2ZH4A 1Q1KA 4CBUA 5KRSA 4EYIB 1I1GA 1XI1A 2AX1A 4CERA 3OY9A 4PPZA 1GFWB 2ILYA 2DNOA 2CIMA 2J7WA 2EFGA 4YR3A 2VPWB 5SWMA 1Q9XA 4X66K 4CEAA 5LMNF 4V19X 2XG8A 4HI1A 5K14A 3DXSX 2W8KA 1R8CA 1BQNB 2MSTA 3VQDA 3CQ8A 4X4TA 3P1GA 2J6SA 4LF8J 1SAZA 1VLYA 3AQPA 2M9KA 4F3MA 5KFDA 5H9EJ 3W5XA 4FXVA 3ETMA 3WNHA 5C2GA 2BQUA 4ECYA 1LWFA 2E5GA 1V9OA 4KYZA 2ZM6K 3VEYA 1O51A 1CJKA 4LUBA 1G4CA 2PN6A 1OPIA 3OQ2A 2JEFA 5AXNA 1TFYA 4UY8O 4ECQA 2ZNZA 2ROEA 3V4MA 4RBVA 3ITHB 1U26A 1HPZB 4ECVA 3W3SA 1DJ0A 1EP4A 1IWAA 1RLCL 2OPQB 1YRUA 3OL8A 1GTHA 4UW2A 4H4MB 4L8RB 1XNRJ 1E6YB 3L95X 4HCBA 1ZZNA 4DX5A 4G9ZA 3O6WA 5DG9A 4ZMMA 3DOKB 1NG9A 2QIFA 3I9ZA 1FX2A 5LY3A 2AP6A 3E9PA 1T3OA 1YGYA 4NCAA 3VQ8A 3QERA 4DUYK 4F9OA 4XK8C 4AE5A 4RUAA 1HKGA 4AQYJ 1KTVA 4MT1A 2GX8A 3PO5A 4WFBQ 4JI0J 3O4NA 2AGQA 3K57A 1VK3A 3WC0A 2R7YA 3ZXWA 1CZ9A 2MKJA 1SJ4P 1PILA 3VAMA 4QPXA 3IRXA 1T05A 2JJ4D 3GV7B 3NF8A 4KKOA 3EGZA 4W98A 4I4BA 5EX0A 1BCMA 4NXNF 2B4OA 4ED6A 1WN7A 3EDQB 2J9DE 4NPOA 4XTTA 4M3UA 4W5QA 4EZ9A 3L2UA 2R4FA 3LAMA 3LP2A 2MQMA 2DH9A 2HQIA 1JKHB 2HVZA 4WK3A 3NBPB 4J8FA 3PG9A 2AJ0A 3NH2A 1XMBA 1ATSA 1FKPA 5DM6L 3ZTSA 3EPIA 3RMBA 1RT3B 4CZHA 4E8UA 1JXBA 3MEKA 1P90A 4OHXA 4FF1A 5ADXH 2O8EB 1OVYA 1JLQA 1QQMA 1T95A 1WSJA 1U2VB 3QZ8A 2Z1JA 2I9SA 1TP7A 4LF5K 1WUAA 4JS4A 4IWVA 2F7VA 3FEYB 3GIMA 2IYGA 1KCFA 3AGKA 1S9EB 4HL9A 4CF0A 2YH1A 4X4VA 3DYAA 5AT1B 4I9QA 2FZGB 1XNQK 5LSRA 4I64A 5C7PA 2Q6CA 2ZOMA 1NGAA 2HMIB 1VIOA 4LRAA 5AZJB 5JVGQ 4OLOA 3QWUA 4P7TA 1KVIA 2C2MB 3Q22A 5F2RA 2FC0A 3I5AA 4ELVA 5TKWA 4DLGA 2QSWA 1WSEA 3KJNB 2DHSA 5D4PA 1RYSA 4B3RK 4M45A 4WIQA 1VDHA 4DV1K 1RTIA 1PC4A 3MI7X 3G8QA 2P9UB 1TKZB 4UZCA 1YJ9S 4BVPA 3G0ZA 2CWXA 5IT9U 1P9YA 1XR7A 3C19A 4LF7F 1DQ8A 4BR4A 3ISNC 3G87A 1NMEB 2UUAK 4LF9F 1BWFO 2Z0GA 2AU0A 3HOTA 4CHYA 3VGSA 3A4TA 1W0HA 1YXQA 3US5A 4CHZA 1SI9A 4V1Ak 1CJVB 4ZVRB 5HMZA 1YZ6A 5GAGI 2FJVA 3LWMA 3PX6A 2F4FA 4HKQA 2HGMA 4B3MJ 1IKXB 3V6DB 1YTAA 3C0BA 5DJBA 1FKOB 5I3UB 2C2DA 3AO2A 2Q6BA 4BE2A 2XNQA 2CPXA 4DEZA 4K4YA 4JEPA 5F3ZA 4K42A 4C1NK 4FPAA 1QDUB 2HHVA 5D0HA 1YKWA 2WFBA 2CGLA 3VF0B 2D9PA 5A6WA 4JV0A 3I33A 4CGJA 1FRJA 3DDKA 5K8PA 1NRKA 1YRXA 4FN5A 2YNFA 4I67A 4BR7A 1NEEA 1EWQA 4GRSA 3HFKA 1C1CB 2D4WA 2QKKA 3E01A 3SXLA 3OVNA 3BQ1A 1K44A 2FIUA 4DL5A 4IG0B 3O4WA 4EI2A 1VRUB 2XGPA 3HHNB 1KVCA 1LW2A 4FL9A 1H7WA 2Y8WA 4BC7A 1D8YA 4CJRA 2UUCK 4A48A 3SMZA 1PYSB 5KFTA 3PW0A 4P73A 1K1SA 3NH1A 2KXNB 2ZH6A 5LOQA 1NGHA 1SUQB 1RAOA 2XHWA 4O5BA 3DGPB 4IH7A 4DR7K 4AXIA 1VSIA 3WEEA 1W2BM 5M1QA 4FDFA 1TV6A 3R1LA 4FLVA 1C0GA 4KGKA 5A2QY 4BR9A 3MK6A 2VKRA 4CEEA 1U24A 4CJPA 3U8XA 2DH8A 5J2PA 4DQSA 2F8TA 1VHFA 4WK1A 5L46A 3FZLA 2CJBA 1CPZA 3TZYA 2E2QA 5HVHA 2Z2MA 3H5UA 1S72N 1HHSA 4GNIA 1LK5A 1MLAA 2F8HA 4AH9A 1YTUA 2HWTA 3K17A 4QQBA 3EYZA 3Q89A 3H4BA 4XH4A 3NVKA 1HR0J 4YOUA 4RWTA 4CT9A 2DVIA 3HJVA 2O8CA 1AFJA 4P74A 4JKFA 4WKRA 2Z2LA 1HI1A 2AYEA 4JN4A 4DR4K 3ZSZA 3NGRA 3M8SA 4BGBA 4FPBA 3BM7A 4HUEA 1W2IA 4FJMA 1NSQA 3LH2S 2VFUA 3RYLA 2HYIB 3BGUA 2YQ3A 2AA4A 3OYCA 2D0OA 1CC8A 2DFHA 4HVZA 2GVDA 3N01A 3C14B 3TR8A 1QHTA 5GAHP 2I5JA 4ED1A 4NLYA 4HTLA 4CI0B 2KG0A 2OPSB 4CZKA 4CJWA 3W2VB 3KOAA 3VQPA 3CULA 1AZSA 1LNQA 2KRBA 1JLBB 5DQHA 1RAGB 2OD4A 4AM7A 2FGOA 4RCHA 4F2SA 3QEVA 3G6ES 1EQMA 4RW9B 2DNRA 2J9DA 5C25A 1RAJA 4O23A 2D3OR 3TARA 3KLEB 3TRGA 3QRRA 2VBYA 1U2FA 2GFFA 4YOWA 1IR1A 2R9LA 3CERA 4YQWA 1FJGK 3NLCA 2EEYA 4ZTFA 3EZ5A 4ZVTB 4B8CA 4GKKK 2DITA 1M5VC 2AEJA 4F4XA 1RA7A 4BE0A 2F9WA 2E20A 1MNEA 4JAXA 1XMOJ 4ES1A 2CQDA 3ZTOA 1N56A 3BP8A 3CJ8A 2AKWB 3CJRA 3BZKA 2E5HA 1RTJB 4V19S 4HUGA 2YNGA 2GHWA 2EKNA 2BW2A 1RBLA 4DQPA 1BHLA 2V7ZA 1RQ0A 4FSVA 4BGAA 3SV4A 4DR1K 1G15A 4K4TA 3DGVA 1RBUA 2VQEF 3MWBA 5KFJA 5A2QO 3K5LA 2X6SA 3MFHA 3BH7B 4AUKA 4ILGB 4YHHK 1S76D 3MM6A 3VQTA 3OFHA 4IEEA 3BZQA 3QPIA 2HZVA 4JK9A 2DY4A 4KHYA 4LSNA 3IGNA 4KH0B 1S1XB 1BI4A 3SDEA 3HMJG 2D5RA 3NCQA 4EAHD 4DU1A 1TL3A 2Z1HA 4HVJA 3A5NC 3QETA 1WSFA 3JYTB 2FLLA 1FESA 1FXXA 1Q81T 2J4RA 2R2RA 4CJ5A 2AW0A 2RF2A 5AFUA 3IFEA 3THXA 2YTCA 1IJEB 3NH0A 5IOLA 5GMDA 4KH5A 4YY3F 1TUYA 5B0DA 4FVCA 1D1UA 5IT0A 1S6PA 2F4VK 4LF4K 4CF2A 2G0IA 3UKUA 1UETA 3TP2A 3KK1B 3U4LA 2UVWA 5KFBA 3DLBA 3UCZP 3DOLB 5B0GA 1RT1A 1VQLS 2RVJA 3LOUA 3OUYB 4GV9A 3VQSA 4PWDB 2BVZA 5KFAA 1TMJA 1HNXF 5I9EB 3ELHA 3CMQA 3DXMA 3SCLE 1Q8KA 2KN4A 1L5UA 4EBEA 3AD7C 2E1YA 2CGKA 1PAEX 5LSOA 1EHWA 3J80U 2ZF5O 3PYGA 1AYEA 1C0TA 4KY3A 4WIIA 4B9LA 2JFDA 4H5WA 2CJAA 4K8RA 2WBMA 2FLNA 2DRBA 3SCKE 4FLXA 4DV4J 1VQ6S 4CNYA 1SL2A 2ZH7A 4BRAA 5FPDA 3W7BA 3P49B 1ATNA 3K8VA 2E88A 1HD0A 2AJ1A 3VAFA 4AILC 2KLAA 2LXUA 4LR8A 4BRHA 5AJ3F 3N6NA 2XEXA 1SC1B 1RHJB 3G71N 2DRDA 1PG5B 4JI7K 3TZWA 2M8DB 4KGXB 2ZH2A 3UN3A 2XY5A 2EFOA 5GAHI 4FJIA 3RWUA 3O80A 1CS4B 3ICLA 3NS7B 4C3MA 1ATRA 1NDKA 1URRA 1UVKA 2XSJB 3MM9A 4PQUB 4DPWA 4IOAL 4ED8A 3D0IE 1S6QA 5IC6B 2HZAA 4A61A 3KLIA 4MKAA 4JI4F 2KZZA 4DN9A 4E1NA 1WF2A 1DAXA 2QZ8A 2P1JA 2FVSA 2XO6A 4NCBA 3M1FA 2DGXA 3DAWA 3J7Z5 3OPKA 2B6AA 2IY5B 2JDJA 3IAS9 1KQGB 5KQ8A 1SJRA 5KFHA 4CM2A 2CPDA 5IWAF 2M4MA 5HOOA 5A8RA 3MXMA 4BRLA 2XQCA 3PIOQ 4QU6A 3DXKA 3NGSA 3K5OA 1I5OB 5EX3A 2QI2A 1TK5A 2X1FA 4IJNA 4LC9B 3O2IA 4E89A 2BW7A 3N6MA 1X9JA 4PRFA 3AA2A 4ICLB 4A5AA 2IHR1 2EK1A 4FKYA 2MKYA 5KPTA 5G0RA 3D68A 3JSMB 4C11B 1GLFO 3SJHA 3QO9A 2YX7A 3H3OB 4QYZJ 2CGJA 2HNZA 4OHWA 1HNZK 3L3CA 1Q7YT 3KK3A 5KT3A 4ZPCA 3G10A 3BO2A 1W9HA 1SS6A 1N54B 2QL7B 3SYZA 4M5KA 3DLLQ 1HYVA 4CLUA 5D0EA 3V1OA 3W1YC 4O5FA 3BDEA 1VQ8S 3KFWX 2A3ZA 4WXOA 1Q0NA 4FJLA 1Y97A 2BR0A 3SSRA 2CRLA 3ZX2A 2BX6A 2HS0A 4ZVPB 5KT7A 2BANA 2UXCF 4HACA 4OYBA 2FBVA 1N5YB 1NGJA 3S6EA 4B3TF 4CH7A 2ZM6J 3A12A 4U67L 5A6PA 4EGLA 4WQ5C 3O9QA 1LCUA 1RT6B 1L3TA 2XCAA 3MFIA 1DEJA 1UZHA 2X3GA 3DLKB 3UVJA 4CYUB 3TTCA 3M2UB 4H4OB 2G8UA 2HHHF 3PSIA 3R3TA 1R8HA 2NRTA 3M8QA 2X1AA 2B51A 4DN0A 4R5PB 1HUXA 2V69A 2FSJA 3CO0P 2IGIA 1K9MO 3R5DA 5AQJA 2CQ0A 5J2MB 4KTZA 4NRTA 3HYFA 3Q8YA 4JKDA 1YITS 1T02A 1QAYA 4A8OA 5JS1A 3CJ1A 4CLPA 4LF6K 4ANEA 3OYGA 1TFWA 3T5HA 1UAWA 3EKUA 4Y6IA 3EKSA 3VV2B 4USWA 4IOXA 2D3ZA 1DTQA 1VYAA 2I6WA 2FHKA 2AJFE 3PSFA 3NOCA 1DRZA 1Y3JA 1ZM3A 1RT2A 3KLHB 3CVKA 5KFZA 3VEVA 3ZCMA 1VQ7S 4HH0A 4X62K 3KK7A 5CE3A 1U0SA 2VPXB 5HLFA 2XY6A 3NL0A 5M1OA 4AD6A 1BLUA 4A8MP 1O0PA 3TVZA 4DQIA 1P9QC 4DUTA 1VQKS 4WYWA 2HBKA 3NNCA 1IBLF 3CC4S 2HNYB 1HNWF 1FXDA 2IYIA 3CC2S 1OKJA 3U7JA 3HSDA 2KI2A 2V67A 3AQOA 4LRDA 5AQHA 2GUIA 4YMEA 4M42A 2YNHA 3CE8A 3TX8A 4Y1CA 1AT1B 4KHSA 3H1VX 5HMWA 3A8IA 4TN2A 3NMRA 1CXQA 5JLFA 2P6TA 4IXCA 3SEOA 1VBZA 4WE1B 1CQNA 1FW6A 3EDRB 3JTOA 4JYAJ 3DM2A 5A8KA 3PEHA 2DHAA 1OPZA 3MR2A 4UY85 4PQAA 2NLWA 3AY9A 3AD9C 2AHOB 4X4PA 2DR6A 4CLZA 2VJVA 3C15A 3KLVA 3I55S 2YVSA 4I2PA 3QLHA 2IA0A 3TUJC 4IR1A 1RABB 4IG3A 1AA1B 3SI6A 3M2VB 2G4BA 1GNKA 4NO7A 2ADBA 5KFYA 1YSJA 3T9ZA 1B0TA 2HFSA 2ABYA 3HRGA 1DT9A 1IBMJ 2VG6A 2BJ9A 2VG7A 5KFPA 1HL6A 2FD2A 3I8DA 2WBRA 4DPTA 3BS9A 4FWMA 4B02A 4CP5A 3H1QA 3QEIA 1SXLA 1NJIT 1CJUB 2X6NA 1MMLA 4OGCA 4IFVA 2MZRA 1M5PC 4HCCA 4WZMA 2JL9A 3OTDA 5C42B 4OZJA 5AQNA 2QRRA 2J9EA 5HSPA 3CJKB 1YJUA 2V94A 1HIYA 4PYDA 1N32J 4JI2J 3K5PA 3I9V9 4DV0F 4LFCJ 3OL6A 3IM9A 2VA2A 4M8LA 4ZP7A 2AWZA 3OTBA 3E2EA 1U09A 4U8VA 4U6PA 2W2MP 1Q86T 2JLFA 1A5XA 1Q8BA 3WIUA 1S97A 3T6JA 4QR1A 4FWSA 4NLRA 3CD6S 5LXRA 1OIAA 3IO1A 1IR0A 5HVFA 2JWNA 4CDIA 1M1GA 5KQDA 3AAQA 1H3DA 2GCFA 3QYYA 1PC5A 4OX9K 2OH2A 2JVOA 3I0RB 3Q8VA 1KVJA 2WVDA 1FDAA 2RDDA 4H54A 1M90O 1UA1A 3WT0A 4DUZK 1MWYA 4XH5A 3PLAA 1LAVA 4DV3J 2W2QP 2G0CA 3OS2A 3HVTB 1RDAA 1WG5A 3SUOA 1PBUA 1J54A 2KYXA 2A42A 2XMAA 3ET6B 4DX6A 2B9XA