3V81A

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and the nonnucleoside inhibitor nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v81A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v81A05
3SUOA 4H4MB 5F9LA 1SL2A 4PUOA 4KFBA 1KTQA 2ETJA 4NLDA 3VQCA 2W8KA 5E41A 3B6PA 2KFZA 3DLEB 4NLPA 3Q8PB 3VQDA 4CGJA 4BE0A 4LQ9A 3HJFA 4M95A 2AJQA 3S3NA 3QZ8A 1IKXA 3NGZA 4DFKA 3G6VA 1WAFA 3BQ1A 3EZ5A 4FCYA 2Z1JA 1RT7B 3K2PA 3DLEA 4KHQA 1WLJA 3NAIA 1RTIA 4AILC 4PQUB 4DLGA 4CHQA 1BQNB 3T3FA 4Y2CA 5KRSA 4GMJB 3SNNA 3AV9A 1RT6B 2Y1IA 4KI6A 2ASJA 1YTAA 3K5LA 1HYZA 3H5SA 3SQ0A 3BSCA 1QUVA 3K5OA 4NLGA 2IM3A 2OZMA 1RT7A 3V9SA 1WAJA 4O3PA 4RNNA 1C1BA 3JYTA 1RBUA 4PQUA 4CJVA 4ZPCA 3VQ6A 3H5YA 3GV7B 2YV0X 3P5JA 4JLHA 3SPZA 2E9RX 1RT6A 3D45A 3F73A 3L2VA 3PX6A 2HHVA 3DM2B 3OSNA 1KLNA 1ASVA 1O1WA 5I3UA 4RNOA 4KTZA 4OGCA 4WYLA 2XY5A 3GV5B 5FRMA 4CJTA 4DQIA 3KK3A 2HNDB 4U7CA 2YHAA 4NCAA 4AHVA 2IBKA 4WFYA 4MK8A 2ASDA 5FRNA 3EPGA 2CJQA 3OS2A 4DFMA 4DG1B 3KLGB 3VN5A 1RT1B 3DLHA 2AWZA 4J9NA 2Z1IA 5KRTA 1G15A 4M3WA 3SJJA 4NLRA 3AVJA 2RF2A 4WYWA 4K4SA 3N6LA 1IKYB 4R0EA 3V1RA 4ELVA 4LSLA 3FFIB 4ECUA 4DTUA 4DFPA 2F8EX 1RT1A 4RU9A 2JEFA 3D5MA 3SYZA 3TI0A 2J6UA 5EU7A 4LH4A 4Q0BA 5HRNA 4J9OA 3HYFA 2UVVA 5KFGA 4NRTA 2QXFA 3KMQA 4URGA 4NLXA 3DMJB 3EPIA 3IG1B 3HHKA 5C24A 1TKZB 3RBEA 3ZSXA 4N5SA 1RT4A 4B9UA 3AA4A 2J6SA 4EYHB 5KT7A 4FLXA 4RUCA 3AVLA 4FJ7A 3V9ZA 2XCPA 3A2FA 3DMJA 1B9DA 4NLYA 2HHUA 3OL6A 3ZSYA 3SZ2A 3L2UA 3QGGA 4CJLA 5HRSA 4WE1A 4KKOB 1J5OB 1QS4A 5F8IA 4CFAA 4FZYA 2JC1A 1T03B 5CY4A 1EX4A 2LSNA 3MECA 4FJJA 3C6UB 5KFDA 2IM0A 4CGDA 1ZBIA 3S9HA 4Y3CA 1WSEA 2IJFA 4ZPBA 2XI3A 2D0BA 4KHRA 4CIEA 5C42A 1UA1A 4DF4A 4CESA 4KI4A 4OLBA 3KK1B 2GUIA 1S1XA 4IFYA 4WE1B 4RNHA 5KT5A 2C2DA 5L1JA 4LSNA 3V6DB 5KFYA 3ZSQA 1QSYA 5KFBA 3KIOA 4W5RA 3NH0A 1ZBFA 4QW8A 4JS5A 4DSEA 1FKPA 3LANA 3PZPA 1J53A 2XI2A 1VRUA 2G8KA 1UOCA 1S6QB 3NF7A 3JYTB 4ECYA 4KO0A 4CCHA 2E6MA 3DI6A 3SUQA 4LSNB 3V6DA 1QE1B 1A5XA 1U45A 1L3TA 2DPJA 1C1CA 1NK4A 4BDZA 4IG0A 3U3GA 4I7FA 4F50A 5I3UB 1X9SA 2FBYA 1TV6A 3TVKA 3F9KA 2OYQA 1D5AA 1JXEA 4B8AB 5DG7A 2G8VA 3L3UA 4ECQA 4N56A 3OY9A 5J2QB 3FSIA 4AH9A 2R7YA 1C1CB 3T1AA 3KJVA 3SFGA 4QW9A 1Q9XA 4Q8EA 1CLQA 4I7FB 1S6PA 2JEIA 4BWMA 1C0UB 2QE5A 4CK3A 5HROB 2HHXA 2WONA 3DOKB 2R2SA 4C8LA 2JC0A 1HNVB 3LP2B 4FW1A 3IGVA 2VG6A 4FLTA 2F96A 1TKDA 2V4RA 3FRZA 3I5AA 4DS4A 3MR3A 4J9QA 4F4KA 2BDPA 4BDPA 4K4VA 2DFFA 4Y1DA 3PHEA 3GYNA 3AO2A 1LW0B 3DOKA 3RWUA 4WXOA 2WCXA 4DTNA 4OGEA 4NLOA 1U47A 1U48A 1QHTA 3PW0A 3AO3A 1SH2A 3IG1A 4O3OA 2AQ4A 4N47A 4KE5A 1VSKA 1WNSA 3P1GA 5KG7A 4OPJA 1RT4B 4ID5A 1KLMA 4TY8B 4IRKA 1LW2B 1HQEB 3PR5B 1T94A 1Z25A 1L5UA 3RR7A 1U49A 3ISNC 1S10A 1RILA 4CECA 4DSFA 4DTSA 5EWFA 1T05B 1S1TA 1HMVA 1JL2A 3NGDA 2BE2A 1U04A 1LWCB 1KHWA 2HHSA 3MEDB 2ZD1B 4I2PA 3GILA 4J9MA 4O44A 3OYGA 4B3OB 2B5JB 4TXSA 4ED3A 3NAHA 3S3OA 3M8QB 3MECB 4IG3B 4DU3A 5EUHA 3VQPA 1T7PA 3O4NA 4NYNA 4CGFA 5KFVA 2VWJA 5KFHA 4Z4EA 3OYDA 4ID1A 3NF9A 3TWHA 3MEEA 2NUBA 3CJ2A 1S1XB 4F2RA 2QV6A 5KT2A 4HVJA 4NLWA 5CYMA 2W9AA 3AO5A 2XHBA 3OLBA 1Y97A 1JLBA 1BHLA 5JS2A 4L8RB 4JV1A 1FKPB 4E1MA 4O3SA 1FKOB 4E0DA 4HKQA 1KHVA 2AGOA 2G8IA 1NKCA 4DL4A 3SQ1A 2HNZA 2YNHB 4K8XA 1S4FA 3OYJA 3AVKA 3AA3A 4I2QB 4FJ8A 2ALZA 2D3ZA 2ILYA 3HL8A 2G8WA 4FBTA 1SKSA 4QAGA 5KFTA 5KTQA 3KHGA 4FZZA 4H8KA 3QO9A 5CYQA 5J1EA 4LY7A 1C1AA 3GIJA 1KCFA 4DQRA 5KGWA 3IS9A 3V6HA 1NJYA 4N76A 5DQHA 2AGPA 3VQ8A 1TK5A 3H4DA 4RW8A 2W7OA 1S6PB 4M42A 1QSSA 4BE1A 4B9NA 4WZMA 2YNGB 3AVFA 1S1UB 1L3SA 1TL1A 5DG9A 4F3TA 2X6NA 1RT2B 4JV2A 1I39A 2VG6B 4E1NA 2ASLA 3MR6A 1YTUA 1NHVA 3OYFA 3H5XA 2YKNB 3FQLA 2RDIA 4CJKA 4Z4FA 3RR8A 1CZ9A 3MXJA 2V4QA 1RTHB 2GC8A 5KG4A 3V6JA 3NH1A 4CE9A 5K14B 2XO7A 3V4IA 1TVRB 1RCHA 3BSNA 4FLZA 2UVUA 3MFIA 2HWIA 3HVRA 3OL9A 1RT2A 4JUZA 1HPZA 1OS5A 1JL1A 1RNHA 3SQ4A 3O3FA 4NRUA 3CM5A 2FVQA 1N56A 4J2AA 4MK9A 4CIFA 2J6TA 3CYMA 4EO8A 5K14A 4ED6A 3M8PA 3HVAA 3L3VA 1R0AA 2C28A 1LW2A 3PO5A 4RW9B 2G8HA 4JRPA 1REVA 1SV5A 4FXDA 2P51A 4E89A 2VG5B 5KFWA 2E9ZA 3PVXA 1T05A 1TP7A 4ECSA 3KMSA 2BE2B 3G10A 2IC3B 1N48A 3SQ2A 3RRGA 4Y34A 4W5OA 3H98A 5F9NA 4RW4A 5L1IA 5KG3A 3WNHA 1ZYQA 3WNFA 3BSOA 4DL6A 4CJWA 3QGIA 1RT5B 4C8MA 4DU1A 3KLVA 3NMAA 3U6FA 3BDPA 3PR4A 4KB0A 3CM6A 4M3YA 4DQPA 3DRRA 3L8BA 2KZMA 2I5JB 3DRPA 1GOCA 5DLFA 4E3SA 1N6QB 3OHBA 4ZVHA 3V6KA 3B6OA 3C94A 2XWYA 4DTPA 1XR6A 5F8LA 4DTMA 5KFRA 4OKKA 4MFBB 5L1LA 2RN2A 5CZ2A 4DLEA 1JLGA 1JLBB 5FDLB 2W9CB 4FZXC 1KFSA 4CJSA 2A1RA 3BQ0A 3DLKA 1RYRA 4CF8A 3DDKA 1DTQB 1RDRA 4HCCA 1W9HA 4IH5A 1N6QA 1X9MA 2WHOA 1BL3A 4OLAA 2XCAA 2WOMB 1TGOA 1KVCA 3PX0A 4IH7A 4KSEB 1BISA 5KFKA 5FDLA 3PW2A 1WSIA 1SKRA 3UIQA 4I2QA 1ZTTA 4RNMA 3T5HA 1T3NA 4R5PA 4CEOA 2VG7B 1K1QA 4ZPDA 3DLKB 1RAJA 4KAZA 3CDEA 3KHHA 1HRHA 3CDWA 1JLQB 4K4WA 4DTXA 2HVIA 3IRXB 5J1EB 4NZ0A 2ZKUA 2R8HA 1SUQA 1U09A 1NJXA 4K50A 3DOLB 3OYHA 4KB1A 3FQKA 3IS9B 4KV8B 2WRMA 1TK8A 3I5BA 5J2PB 3OYBA 3LZJA 4FJ5A 3Q8SB 4DTJA 4FM0A 3KLFA 3E51A 2AU0A 1LWFB 5J2MA 4KTQA 4FK2A 3HVTB 4E7LA 1VSHA 2DFHA 3Q8RB 1TKTA 3KLEB 2YNFB 5HP1B 3THVA 2YKNA 3NFAA 1RTHA 4KTWA 4RW7A 4ECRA 4CHZA 2HHTA 5KT6A 3NF8A 5J2PA 2IAJB 4GVMA 4W5NA 3EYZA 2A1SA 3QEWA 3QESA 4DSKA 3VA3A 4O4RA 5F8MA 4QWEA 4DL7A 3OJUA 4KHMA 1IKVB 2XY6A 1IH7A 4EBCA 2FBTA 1XHXA 4ICLA 3OHAA 4KHUA 3PJWA 4KAIA 1WSHA 2BGGA 3DLGA 5D3GB 2HNYA 3HK2A 1DTTB 3RB3A 1BI4B 2IAJA 3AA5X 3AA2A 3KKRA 4IDKB 3VQ4A 1CXUA 4RW9A 1IM4A 1NK7A 3GV8B 4HTUA 1REVB 4ELUA 1S5JA 1SV5B 1D9DA 1HNIB 2VG5A 1RDAA 4FW2A 4DTRA 1RBVA 4BWJA 3JSMA 1J9AA 4DL3A 3OLAA 3O3GA 1LAWA 3KHLA 2OPSA 2KQ2A 4RW6A 2WB4A 1QSLA 4FJ9A 1HNIA 3MEGA 5KFCA 4W5QA 3VQAA 3RB6A 1HQUB 3HKWA 4FK0A 3DRRB 1JIHA 3QZ7A 3TQ1A 4R8UA 3DLBA 4DFJA 5KFJA 2R8GA 2OPSB 2RKIB 4HUEA 4FM1A 1S1VB 1IO2A 1IKYA 4K4ZA 1S9GB 2R2UA 2WTFA 3KD5E 2FVPA 5I42B 2QKKA 2XGPA 3G6XA 2FVSA 3VQSA 2AX1A 4QWCA 4J9RA 3I0SA 4CEQA 4CJEA 4OKEA 3EZUA 4FLVA 2IM1A 1C0TA 1ASUA 3IAYA 1FXXA 4CFCA 1GX5A 4J2BA 1B9FA 2CKWA 1ZETA 3NKYA 3PO4A 5HLFA 4KFBB 2VG7A 4DMNA 3BJYA 3L2WA 4BDYA 5KFIA 4NYFA 5KFUA 3TANA 1JLQA 1N5YA 4Y2AA 1RDDA 5J2NA 1RTDB 4W5TA 3GQCA 3V9UA 3DOLA 3ZSOA 4FJIA 3NF6A 3HP6A 1JLEA 2FJXA 3OYNA 4CERA 3GIKA 1RTJA 3KLFB 1WN7A 4C8NA 1LWFA 5J2MB 1Z4UA 3PY8A 3KNAA 3ALYA 1GX6A 1SH3A 4KKOA 5KG5A 2E6LA 5HP1A 5J2NB 3TAFA 4O0IA 3PW4A 2D7SA 1Q8IA 4FS1A 1EP4A 4XPCA 4IRCA 5JS1A 3ZSRA 3HPGA 2ILZA 4YP3A 4FJNA 5KG1A 1QQCA 1C1BB 4E19A 4IFYB 1XWLA 4CJPA 3CWJA 3H08A 5F8NA 1D9FA 4PA1A 4ZHRB 3G0ZA 4DWIA 1RA7A 1IKXB 3DLGB 4IQXA 3ITHA 4J9KA 4AHSA 4M3XA 4CFBA 1LV5A 3AVNA 1EP4B 1RBTA 5JXSA 3Q8QB 3RMDA 3V9WA 3OS1A 4IDKA 4F2SA 4NCGA 3K57A 2QKBA 4Z4CA 3KTQA 4FLYA 3NDKA 3CJ3A 3UQSA 3PJXA 4CGGA 4KHSA 1QE1A 4Z4IA 4BACA 3DLRA 4ZVFA 4ZTFA 4B08A 4URQU 4B9VA 1KVAA 1RBRA 4KRFA 4TQSA 1FK9B 3H4BA 1NNDA 1HYSB 2FVCA 5KFZA 4FJGA 5EDWA 2RF2B 4FYDA 3T5JA 4J2DA 4CHNA 4YR0A 4CEZA 2FJWA 1ZBUA 1C6VA 3MEGB 5J2QA 5KFNA 1JXBA 3NH2A 2HMIB 3AVAA 4G3IA 4LSLB 3BGRB 3ZT4A 3SV4A 5F8JA 5HROA 3LP3A 4J9SA 4IH6A 1HNVA 3LP2A 3ZCMA 3LDSA 3QIDA 2HNDA 1QAJA 3MR5A 3BREA 3NHGA 1RA6A 4ED8A 5KG0A 1I6JA 2HMIA 3LAKA 4Y1CA 3PW5A 5I42A 4CF0A 4WFXA 1VSFA 5HRPA 1TKZA 2D41A 3AO4A 4OJRA 1LW0A 3TARA 1HJRA 1VSMA 2XY8A 2Z1GA 1C0TB 3KHRA 1IKWA 4O3NA 2B4JA 4XPEA 1W25A 5T14A 5SZTA 3CJ5A 3N6NA 3KKSA 2JLEA 2ZQBA 2W7PA 3FFIA 2ITGA 2P5OA 5HLFB 4CF1A 2KFNA 4FS2A 3ZSVA 2R8KA 3D28A 4Z0UA 3CFPA 1UA0A 2XGQA 2AGQA 1J5OA 2HVHA 3OSPA 5KFLA 1T03A 2FLPA 2E9TA 4M94A 1JLEB 2C2EA 1NK9A 1S49A 1S1TB 4RZRA 3N6MA 3UPFA 3M8RA 1RTJB 1LWCA 3UR0A 2O4GA 3MEDA 5KFEA 1GOBA 1YVUA 2O5DA 2FLLA 3CG7A 2UVRA 3U3YA 4ED7A 4KHNA 2EC0A 3TR8A 3CIZA 2RPIA 3VQ9A 5KI6A 3TAPA 4CJ4A 4DS5A 3GIMA 4FLWA 4FJXA 3LAMA 4MK7A 3TAMB 4QWBA 1S6QA 3AVGA 4FM2A 5HBMA 4B9SA 1TL3A 3SV3A 4KO0B 3ZSWA 3AO1A 1BCMA 3HT3A 2I1RA 1WSFA 4HCBA 3ITHB 3OYKA 2KW4A 2GIRA 1LAVA 1U4BA 4IG0B 4JRQA 5JUMA 1IG9A 3TAMA 1FKOA 4EP5A 3M8SA 5C42B 3TAQA 4TYAA 1WSJA 2IJNA 3O4QA 4NCGB 3H40A 4HUFA 3SUNA 3KK1A 1NOYA 3AVMA 4Q8FA 1RT3A 4YR2A 2HNZB 1BCOA 1VRTA 3RMBA 2B43A 4WXWA 3RAQA 3NCIA 3T5KA 1RDCA 3L2QA 3VQ7A 3DM2A 3BQ2A 1X1PA 4H4OB 3CJ4A 5DGAA 4FJLA 4YNQA 4QOZB 3QINA 2WONB 2FC0A 5F8HA 3ZSZA 3MXIA 1TKXB 4NLQA 3QO9B 1ZBLA 3KK3B 1RDBA 2AX0A 3OYCA 4AHTA 3KLIB 2IDOA 4U6PA 3SPYA 5DK5A 2BR0A 4EBDA 4YFUA 1JXLA 3QIOA 3RMAA 1T8EA 2WK4A 1S0MA 3OYLA 1KVBA 4O4GA 2C2RA 4CHYA 3BGRA 4J9LA 1TV6B 4RG8A 3PV8A 4DSLA 4O5BA 3GIIA 5DG8A 1S1UA 4KB7A 3I0RB 3RB0A 3S3MA 3SUPA 4TQRA 4ZVEA 2OPRA 1L3UA 3PUFA 3TABA 1VSIA 4NLUA 2KZZA 2FLNA 3NE6A 4Q0BB 1HQEA 1MMLA 4ZP6A 3OYIA 4YMEA 3QGHA 1EKEA 3M8PB 5C24B 3CDUA 4TY9A 1S0NA 1K1SA 5KFMA 2W9BA 4MQ3A 2RDJA 3WNGA 2FBVA 2ZD1A 4I2PB 4KHYA 4ED1A 2OA8A 4XIUA 1TK0A 4TSXA 3UDLA 3C95A 2UUTA 1W0HA 3LWLA 3T19A 3M8QA 5KFQA 4IG3A 4CIGA 2DFEA 4CHOA 4BE2A 4ZP8A 3LALA 2FVRA 4H54A 4NLVA 5KG6A 1C2PA 2OPPB 3LP0B 4ZVGA 5KGXA 4ID5B 3MEEB 1KLMB 4TY8A 4K8ZA 1XR7A 4ECXA 4LD0A 5CYMB 1WSGA 4CK1A 2HHWA 3VQQA 3QIPA 4KREA 4M3RA 3C6UA 2BQUA 2P5GA 3CO9A 2IS3A 1XI1A 4Q44A 1HMVB 3DRPB 1D8YA 2OPPA 4XO0A 3V81B 4E7KA 4QWAA 4O0JA 1NJWA 1ASWA 1S9FA 5HBMB 1TL3B 4O44B 3QNNA 4B3OA 4MFBA 1TQLA 3OL7A 2XC9A 3SI6A 4CEBA 1KFDA 4TN2A 2W9CA 4K4YA 1JKHA 4M3UA 4EZ6A 3C6TB 4M3ZA 1VK0A 3TAEA 3K58A 1DLOA 4ZMMA 1VRUB 4ELTA 1X9WA 4F3OA 2HB5A 2FBXA 4QPXA 1RT3B 3DI6B 2OH2A 1VRTB 3RMCA 1KRPA 1EXQA 1NKEA 1JKHB 1JLAB 4ECTA 4H4OA 2HAIA 1JLCA 3AVCA 3OYAA 1DLOB 3M9OB 3RTVA 4IFVA 4CEEA 3OYMA 4B8CA 1TKXA 3IRXA 3LPUA 2Q3SA 1SKWA 2JGUA 3CJ0A 3KLIA 2E4LA 4QWDA 2R8IA 1HYVA 3K5NA 2V0NA 4B9TA 4KV8A 1S97A 1S48A 3KJVB 4O4GB 4M41A 4WFZA 4ED2A 1N4LA 3V4IB 1TVRA 5DQIA 4F4ZA 4CGIA 1C0UA 4GC7A 1NK5A 2D0AA 3OJSA 4G1QA 4DSIA 2EX3A 3I0RA 1TKTB 4QCLA 3KLEA 1RBSA 4F4WA 2OPRB 1KSPA 3MF5A 4F4YA 4C8OA 4KBIA 2YNIA 4NLTA 2PZSA 3HM9A 3LZIA 1QTMA 4ZP9A 4RW8B 3WNEA 2X6SA 3E01B 2OZSA 4PY5A 3H2LA 3NGYA 3QERA 3IGNA 1D0EA 4ICLB 1XR5A 3T5LA 3I5CA 4RNFA 4C8KA 4TYBA 5KFSA 4OKJA 1D1UA 1CXQA 2YNIB 1DTTA 1BI4A 2OPQA 4FJMA 4I9QA 1NKBA 3ICLA 2W42A 2W9BB 2P1JA 4DSJA 3E01A 3MXMA 1NK0A 4GC6A 3HPHA 1C0MA 4ZPAA 2YHBA 4MIAA 3CFRA 4CK2A 2BRKA 2G8FA 3NBPA 2DPIA 2BRLA 3H59A 4URSA 4LQ3A 1BIZA 4MKBA 2ZE2A 4FBUA 3QETA 4M45A 1JLFA 4LH5A 1HARA 3IN5A 1VSJA 3I8DA 3SCXA 4DQSA 2OPQB 3ZT3A 2VA3A 3JSMB 3LP0A 1R0AB 5DQGA 2XRIA 4DL2A 2VWKA 4OL8A 3QLHB 3NBPB 1S1WB 1UAXA 2B5JA 1ZBHA 4RW6B 5CZ1A 3P83D 3QIPB 2ZE2B 4IKAA 5KFOA 3OYEA 4NLSA 2Y1JA 3VQ5A 3HO1A 1Z26A 4X2BA 3CQ8A 3LPTA 3HP9A 4F4XA 2IC3A 2C22A 4NCBA 2PYJA 2GV9A 3V81A 2R2RA 4E7JA 4CHPA 4R8UB 3V1OA 3D0PA 2O4IA 4RW4B 2XY7A 3ZT1A 1NHUA 1JX4A 5KFXA 1S1VA 3AVIA 4PWDA 2F8SA 3OL8A 4CJFA 1RT5A 4DEZA 4CJ5A 3QNOA 4ZTJA 4CEFA 3RAXA 1QAIA 3C6TA 5KG2A 3QEPA 4F8RA 3RBDA 3K5MA 4IBNA 3I0SB 2JEJA 1BQMA 4KHWA 3MAQA 3QYYA 1WNEA 5DMRA 2R8JA 2YNHA 3AVHA 4GW6A 5KT3A 3TAGA 1JLAA 2YKMA 1L3VA 4IKFA 2PY5A 1JLCB 4HUGA 1ZTWA 4MIBA 4YQWA 2FJVA 3RB4A 3HXMA 1DTQA 3CVKA 3SFUA 4DF8A 2B6AB 4IFVB 4O55A 5L9XA 3HVTA 4Q5VA 3KOAA 5C5JA 5CYQB 1EETA 4IRDA 2WOMA 2HWHA 1RTDA 3OVNA 4OVLA 2BQ3A 4K4TA 1BGXT 2EHGA 3ZT2A 4CJRA 4ECVA 4MH8A 3SI8A 4H4MA 4FVMA 1ITGA 4PUOB 4Q43A 2D5RA 1VSDA 1SL1A 4MKAA 3KD1E 5T7BA 2YNGA 4K4XA 3PW7A 4Z4HA 1TL1B 2IA6A 4FJKA 4G1QB 1LWEA 2UVWA 1A5VA 1EETB 3EY1A 1I3AA 4CEAA 5EWGA 4ED0A 1SUQB 2V9WA 4KPYA 3LWMA 4FK4A 4ECZA 1SH0A 4J2EA 2DY4A 4N41A 2GIQA 5D3GA 4CEDA 3BR9A 3HPOA 2D3UA 1NOZA 4EO6A 4IR9A 3KLHA 1LWEB 1RTIB 4YR3A 2YNFA 4O3QA 1NK6A 2F8TA 1YT3A 1HPZB 4ZHRA 1K6YA 1UWBA 5F8GA 1BQNA 2BQRA 4CJUA 2HHQA 4RW7B 5KFAA 4TLRA 3MTKA 3KK2A 4CGHA 1VSEA 4ZP7A 1VSLA 1BIUA 1YVFA 4EEYA 4HHTA 4DL5A 4IOBA 3M9NB 3KLHB 3V1QA 1F21A 1IKVA 3FDSA 3L2RA 5C25A 1CZBA 3BSAA 2X74A 1UWBB 1S9EB 3AVBA 1TAUA 3G86A 2JEGA 3M9MB 2IGIA 4M3TA 2R2TA 1HQUA 3VQBA 1Q9YA 1JLFB 4E7HA 2HNYB 4CF2A 4DTOA 3KK2B 1MU2A 5DLGA 3K59A 3CFOA 2D0CA 3ASMA 5EWEA 1SL0A 4HYKA 3VQEA 2BANA 4EP4A 1FK9A 1HYSA 2HW3A 3DRSA 4AHCA 2W8LA 4JS4A 4NYZA 5DGBA 3QLHA 4AHUA 4O3RA 3QEVA 5C25B 5KFPA 4I9LA 1S1WA 1GOAA 3RRHA 2UUWA 1S9EA 1S9GA 2KTQA 3HVWA 3H5UA 4AHRA 4EBEA 1NK8A 5KT4A 2ATQA 1J54A 2QK9A 1MU2B 1RYSA 3QEIA 4DG1A 3KLGA 4JV0A 2IMWP 2I5JA 4RUAA 2G8UA 2PYLA 4EZ9A 4K4UA 4OPKA 2BANB 1B92A 2IM2A 3DRSB 3NL0A 1NJZA 4Q45A 3LP1A 3MFHA 4J9PA 4CF9A 3ULDA 4B9MA 2ATLA 2GBZA 4CFDA 5HRRA 4DU4A 4PWDB 4FLUA 3V9XA 1JLGB 2VA2A 1CSJA 5FROA 5SWMA 2Z1HA 1XC9A 3ISND 1TAQA 3G6YA 4CJ3A 1BQMB 4Z4GA 3LP1B 1N5YB 5KFFA 5L1KA 3NGIA 3DYAA 2RKIA 1IKWB 4EYIB 4FJHA 4ECWA 4E7IA 2DTUA 1S0OA 2YKMB 4R5PB 3QEXA 4B9LA 4WZQA 1XHZA 3PX4A 3OS0A 2B6AA 3MR2A 3ZT0A 3NAEA 3VA0A 4IR1A 3O3HA 4DQQA 3DYAB 2IOCA 1A5WA 2X78A 4UQGA 4CJQA 3HSTB
chains in the Genus database with same CATH superfamily
1O5JA 5F9LA 4LF7K 1RWWB 3WZ0A 3VEXA 2A2DA 5LMNJ 3M2RB 2KFZA 2UU9J 3KJQB 4OX7A 3VQDA 3IWNC 2QT7A 3BYRA 3HJFA 4M95A 3S3NA 2XSFA 3PSIA 3NGZA 4AL6A 3EZ5A 2ROPA 4A8WA 1RLDA 1VQ6N 1UWAA 3J7ZO 3K2PA 4WP9A 4KHQA 2DH7A 3CMES 4PQUB 3CCVS 1CJKB 1NM2A 3T3FA 1V4TA 1VQSA 3SSQA 2H9ZA 1F9EB 1NPRA 3W5ZA 2VJVA 3TP2A 3NNCA 5DDPC 3SQ0A 1FWKA 2UYTA 3IBFB 2IM3A 3V9SA 2XMTA 2QFJA 1OYEA 1WAJA 4NA2A 4O3PA 2PC6A 2ZEJA 2XLIA 2FZKB 4BC7A 1X3MA 4CJVA 2GMLA 3VQ6A 3H5YA 2YV0X 1RADB 4JLHA 2E9RX 3F73A 2X7IA 2HHVA 4JYAF 3CC4S 5BYRA 3M30A 1XERA 5CR4A 2G1HA 4X4TA 1DQ9A 3D2WA 3JQMA 2VFTA 2KI2A 4FPIA 1T02A 2K7KA 4MK8A 5FRNA 3GB0A 2J9DA 4DR1F 4FWRA 2ZH8A 4RLEA 5HL7L 4M8LA 1ZZFA 3BO2A 4LFCK 3AVJA 5ADXH 2RF2A 2W1BA 2GA7A 4HI2A 4GKJK 4H5WA 2CYYA 2Z57B 3VF6A 3V1RA 2DNOA 4ELVA 4LSLA 3VEOA 1RT1A 2PIIA 4CBXA 3CTRA 1N0UA 1XQIA 3TI0A 5DRKA 4LH4A 2IVNA 2ZOMA 3GCXP 2UVVA 5KFGA 3KMQA 2YQ0A 3E9PA 4NLXA 3EPIA 1FX2A 3OXGA 1TKZB 1DZ5A 3ZSXA 3UD3P 1HBNB 4B3MF 3O44A 4F02A 4QIWD 4JK8A 3AA4A 1IBLF 5DM7Q 1NEEA 2Q0RA 5AQJA 3THYB 5KT7A 1R6YA 3AVLA 3V9ZA 4MDAA 1NH8A 4A48A 2HBRB 3OL6A 2RS2A 4I67A 4LT6A 3VOVA 4FO0A 5HRSA 2OTLS 4WE1A 4CFAA 1QS4A 1V5VA 2O01C 2ZC3A 4I6MA 1WTFA 5CY4A 2LSNA 2QG9B 5AXMA 1ZBIA 3S9HA 2FHJA 3O2IA 2YPZA 4Y3CA 1HLUA 2E1YA 4KHRA 3J80Y 4CO0A 4GO7X 3KK1B 5AZJB 2C2DA 4X4UA 2RSQA 3ZSQA 2BUPA 1VDHA 5EOYA 3SQGB 3AH6A 1R7IA 4EFHA 5GAEI 5IT4A 3CJ1A 1SC6A 1S6QB 3NF7A 4UZBA 1IWAA 4KO0A 3GLJA 4CCHA 4N7TA 3V6DA 3NRBA 3UCUP 3R5BA 4FP9A 4F3MA 3NOCA 3U3GA 4I7FA 1X9SA 4H0VB 3FMBA 3W2VB 2P2CB 5FD1A 2YTCA 1NGIA 3N01A 4C0HA 2VDHA 5DG7A 5F0UA 2G8VA 1KD1O 4CO1A 3L3UA 2BBEA 1NLKL 3BR8A 3E3XA 1BLUA 2WUSA 2DR7A 2ZZNA 4IOCQ 5J2QB 1SJQA 3FSIA 4WTYA 4DCPB 1N8RT 2VCPA 1CLQA 2JEIA 2B4OA 2WONA 3DOKB 5U47A 1Q8KA 2YWGA 4FW1A 3VPZA 3UDVA 4FPBA 2VG6A 4FLTA 3H3NO 4GO5X 2F96A 2HGNA 1S6UA 3EE8A 1GLBG 1VQYA 2LQ5A 1WC5A 4FDFA 3GE9A 4K4VA 4Q7AA 2ZJQQ 3MOJB 1T9TA 1HBOB 1LW0B 2HURA 4U7UK 4RBVA 1CEZA 4QR0A 2WCXA 4DTNA 4OGEA 1SJ4P 3G25A 3MCAB 1R3NA 4LF1A 1IM6A 1YX2A 2H4WB 5EGYA 1WC1A 2BJ7A 1RZMA 2VQFK 3PW0A 2A3JA 1KWMA 3IG1A 4O3OA 2AQ4A 4M7YA 4CZLA 2JLFA 1E6YB 3CXCM 3O5BA 1FNMA 1TFYA 4OPJA 1KLMA 1LW2B 1CJTB 2Q3PA 4K0KJ 1T94A 2LU2A 3PIPL 3D9BA 1Z25A 1U49A 4WYBA 4Z7CA 1PYOB 1RILA 3BKFA 2CNOB 2IYIA 4F0KA 3J7AP 4LSZB 1T05B 1R8AA 1HMVA 4BRPA 2BE2A 1PJ7A 2GWKA 2MKIA 3MEDB 1ELOA 4I2PA 4DV6J 1VQ4N 5GMEA 4OJ3A 2QI2A 4L3QA 1B0VA 2F40A 2ZVSA 3MECB 1FRXA 1H2UX 4HEA9 4YB6A 1C4CA 4ETZA 1UPPA 1KNZA 2UXCK 3FUYA 3OYDA 4JI1K 2IY5B 3TWHA 3MEEA 2FIUA 4S0MA 2NUBA 3O9SA 3CJ2A 1S1XB 4IEIA 1BOTO 5KT2A 2W9AA 5I3PA 4DR2J 2UXCF 1REGX 3OLBA 1Y97A 5HO4A 1PILA 4B1VA 3VETA 3NWGA 4E1MA 1JJCB 1QVGM 3KDNA 2EWHA 1M5OC 1NKCA 5K8PA 4DL4A 2ZUAA 3RVCA 1YVNA 2EFGA 3QMLA 1S4FA 3OTOK 3HZGA 3BPSP 2VDIA 1FDDA 3AGKA 2ALZA 2QO3A 1VQMS 4EUVA 4H0PA 4FBTA 2DTJA 2DGWA 4J90A 1P8GA 2QA2A 5CYQA 4DR2K 3ONQA 1VQ5N 3R97A 3IXQA 1KCFA 5KGWA 3V6HA 2QWRA 2H4YB 5DQHA 3THWA 3IM9A 1S6PB 2N4DA 3H0PA 4M42A 4B9NA 3AVFA 2YNGB 1YJWN 3OVBA 1I39A 2VBYA 3P4IA 3H5XA 4ZVOB 3FQLA 3RR8A 1CZ9A 4NXNJ 2UUCJ 4MO4A 2XO7A 2M2BA 1TVRB 1RCHA 4BRNA 4Y6IA 2IRXA 4TU7A 1SQFA 3K5PA 3MFIA 2HWIA 3DDIA 3DXMA 4MJKA 2MQOA 1X4FA 1RT2A 3HHNB 4JUZA 1HPZA 1RNHA 3SQ4A 2MKHA 4NRUA 2ZNZA 3PIOL 2J6TA 4EO8A 2X51A 1N36F 3L3VA 2ZH7A 1BQXA 1CULA 1R0AA 2C28A 2W7AA 4RW9B 2G8HA 1K8AT 2BJ1A 1ZM2A 2DISA 2RS8A 4E89A 2VG5B 3A4TA 3FSXA 3HZEA 2VQEF 4ECSA 1QVGR 4CIOA 1N48A 2H5EA 1YBUA 3NCRA 3T1YF 4W5OA 5F9NA 4RW4A 2HVZA 1VJQA 1VIOA 4C48A 2ZKTA 2FLOA 3WNFA 4PABA 4DL6A 3QGIA 4DU1A 3PRVA 3KLVA 4FYWB 1OY6A 3PYDA 3CPWR 1FI4A 2I5JB 3DRPA 2D4WA 4JI7K 2F4FA 3BGFA 4QIEA 3B6OA 5TKWA 2R7RA 4KT0C 3OBYA 5FLXY 4KH1B 1SPBP 4NYOA 4DTPA 5F8LA 2F1FA 4DN0A 2LMIA 3BGLA 2RN2A 1JLBB 2ASYA 5FDLB 4JI5K 1F1BB 4GKKJ 4CJSA 2GUPA 1RYRA 3BBCA 3CCWA 1W9HA 1XNQF 1VRQC 1X9MA 2ZJPQ 2V8PA 1BL3A 2XCAA 1N8RO 1N33J 2YX7A 3UIQA 5DDRC 3AHPA 1SKRA 1FXLA 4GKJF 1T3NA 1RAJA 1WBBA 3AJ2A 3KHHA 4DV6F 3OA9A 3R5GA 1UMJA 4AL5A 5J1EB 4NZ0A 1SUQA 1CS4B 5DM6Q 4KB1A 4GVBA 2WRMA 4OX9F 4NL5A 2GHVC 4FM0A 1FD2A 2RT3A 4B9QA 4CQ1A 1GLFO 4BC3A 3KLEB 3JSRA 2YNFB 1O0PA 3CJCA 2K3KA 2YKNA 3N79A 4RW7A 4ECRA 2QEXS 3E9LA 3NF8A 1IBKK 4A8SA 3A8KA 3D6RA 5IM0A 3L95X 3HCXA 1ILYA 3VA3A 3MDFA 5F8MA 4GVEA 4OYWA 4KHMA 1IKVB 2XY6A 4EBCA 1CQNA 2AJ0A 1XHXA 2J0QD 2VPZB 4KAIA 1WSHA 2BGGA 1NG9A 2W4CA 3QNWB 2XLKA 3K7RA 5D78A 3Q2TC 3NOGA 4LBPA 2J8AA 3NLCA 3KKRA 1VAZA 3VQ4A 3DRYA 1IM4A 3KYLA 1REVB 1LFPA 1S5JA 1FD8A 3VAGA 4DPWA 4YOYA 4QYZK 4KY3A 4A46A 1E4GT 2Z2MA 1ZZNA 1RHUB 1Q78A 3JSMA 5HVFA 3O3GA 2KQ2A 2WB4A 5D0HA 3PM9A 1KQKA 2EI5A 2ZITA 2BA9A 4DUYF 3RB6A 3W3SA 2O8BB 3TSPA 4PXEA 3CCLS 1A9NB 4LFBF 4Y2IA 1Q5VA 3PFEA 3FR0A 3UDEA 3O9UA 2GVDB 3P39A 2I7NA 5KFJA 3I82A 4ENOA 3KZBA 1OY8A 1Y64A 2R2UA 4PCQA 2WTFA 2RAQA 2M9KA 2VOOA 5A0YB 1SCJB 2FVPA 2XGPA 1Y3KA 4JHDB 4QWCA 4J9RA 3KHYA 5AT1B 1NGCA 2N7YA 2GJFA 3NG8A 1B64A 1C0GA 1GLEG 1ASUA 2XTJP 1R8CA 2BZ2A 3JTNA 3E1YA 4J2BA 1NZAA 4KFBB 1FXDA 1FWPA 3L2WA 4BDYA 4OI6A 2J76E 5DM6L 1JLQA 1RDDA 5M1OA 4QZVB 5A8KA 1F9HA 2QTWA 1FJGJ 2LDYA 3BV8A 3VF2A 3TQEA 3ZSOA 1FNOA 3NF6A 2DGUA 1EJ7L 3KLFB 3W5XA 2QZ8A 1LWFA 5J2MB 3PY8A 3ALYA 1GX6A 1SH3A 4JAXA 4H5NA 4KKOA 4O8KA 1TL7B 3MGJA 2FSNA 1S72N 2E5GA 1AUDA 4FKXA 4Q2MA 2J7WA 1I3OB 5FJ4A 3FCWA 2B7CB 1S7HA 4JKCA 4G9ZA 3ZSRA 3HPGA 1ULRA 1MSWD 4TNOA 1OKJA 1QQCA 4E19A 4CJPA 3H08A 5F8NA 5GAGU 1D9FA 3C65A 4ZHRB 5LJVA 4OX6A 3HD1A 1IKXB 2VV5A 5K8OA 1LV5A 2OFGX 2CDRB 2XHCA 1WF0A 1XMQF 3V9WA 3L09A 5KQDA 4IDKA 5A6PA 3KG4A 2JWLA 4OI4A 4FLYA 2BMBA 3PJXA 1QE1A 3SCJE 2UXDK 4HR2A 3CEDA 3W7BA 3DKDA 3ID8A 4URQU 3LW5C 1Q95G 1HYSB 2FVCA 2H51B 1U8SA 3D2FB 2AYGA 4U67L 2OI2A 3Q7CA 4X65F 4J2DA 4YR0A 3TUPA 4CEZA 1ZBUA 1C6VA 4C6AA 5KFNA 3H3OB 4X64K 5C0YA 4W4MA 1N34F 5GADU 4BQLA 1QAYA 3MN9A 1TZ0A 4J9SA 1S72S 2ZM6F 1HNVA 3LP2A 3ZCMA 3LDSA 3HM8A 4CLUA 3GBTA 4DR6F 4C11A 2COLA 5JVGL 1R89A 5KG0A 2W41A 1NPPA 2DR8A 5F0XA 3LAKA 2RUSA 3EDQB 3PW5A 1W2IA 3MURP 4B3TJ 2XMWA 5LMUJ 2D41A 5AQTA 2ZVIA 1HJRA 4HLBA 3D7SB 1HWKA 3KHRA 2WSCC 3TR5A 3NXZA 4OMFG 3OR2A 4XPEA 3CCMS 1W25A 2P9KA 3A8JA 3N6NA 2GAGC 1S0VA 1VBXA 2QL7B 4FXVA 3WIVA 3FFIA 2KFNA 3LTOA 2R8KA 3R5DA 3CFPA 3VQTA 1FF2A 5IQ6A 3CDAA 2MHEA 5I4MA 3H1QA 3BEGB 4FWQA 3A8EA 3DLLL 1T6DA 3ENWA 2E9TA 1RABB 1JLEB 2OTJS 1JK9B 3KUGA 4DMZA 3D0GE 1RTZA 3M8RA 1YJUA 2ERRA 4FOIA 3UR0A 5KOXA 4NXMF 3M2RA 5KFEA 1YVUA 5AQPA 2ZH2A 1YLXA 4J37A 2NPFA 3ET6A 4M5IA 4A2BA 4JNEA 3VQ9A 4KC5A 1F2GA 3ISZA 1X5PA 3TAPA 4MAKA 2Y0SD 3ZETA 1YUWA 3ID6A 1VC5A 2CIMA 1RJJA 4FM2A 2C2MB 2V7ZA 3I4PA 2UXBK 1TELA 2W25A 3QT5A 4ZVRB 1NLVA 2Z58B 1LK7A 3CQXA 2GIRA 2N82B 1LAVA 3OR1A 2XYHB 3AB2B 1IG9A 3TAMA 4YDDB 5C42B 4NCGB 2KT5A 3H40A 2O8DB 1NOYA 5DO2A 2MEWA 1VQ8N 5CD4H 3R9LA 2DGSA 3RMBA 3M6UA 4CZGA 2B43A 1DURA 3L2QA 2YBVA 4H4OB 2E5HA 8ATCB 2OANA 4YNQA 2YHWA 5MAOA 5IOLA 2HS0A 4IYQA 3MXIA 4BRQA 3CJBA 1TKXB 3QO9B 2R7QA 3CCUS 4QIFA 4FF1A 4U6PA 5DK5A 3MMBA 2BACA 2E1CA 1N0VC 2X1AA 4KGZB 2XZTB 1BWEA 4HHHA 4O4GA 4JEPA 2C2RA 4FVCA 1GNKA 4RG8A 5IWAK 4O5BA 3GIIA 4GV6A 5DG8A 3UCZP 3I0RB 3SUPA 4CO3A 4ZVEA 2VFSA 2OPRA 4ZN3A 1CJVB 4B3SK 3CC7S 5BRDA 1K73O 2Q79A 4BR9A 2PMWA 5GIOA 1VSIA 2E7XA 2BEFA 3KNGA 2XB2D 2V8HA 2QXLA 4A8KA 2XYGB 2POKA 4ZCKA 4BRCA 4AL7A 2I6WA 1N52B 3LF0A 3DLLQ 3S6EA 2FZCB 2GJ2A 3R1HA 3RUBL 4CNZA 4TSXA 3OXLA 3UDLA 1B0TA 1UVKA 3LUYA 1G7CB 3LWLA 3M8QA 1LOTB 1RWXB 5AQSA 1UAWA 2MXYA 3LALA 1CJUB 4E8UA 4UY8T 2WTUA 1C2PA 2W24A 2OPPB 3FEXB 3LM9A 2LU1A 4ZVGA 4LRBA 4BVPA 1LFWA 4WQ4C 3IR6B 1XR7A 1WI8A 3NNAA 3CT9A 4LD0A 3HFVA 4M5JA 4CK1A 2LQ8A 2UUCF 4KREA 4M3RA 3ZX2A 1MWYA 2DGVA 2P5GA 4Q44A 4RR5A 4XO0A 4G1PA 4JI8J 1S22A 4QWAA 2ZC4A 1NJWA 5IT9Y 1WC4A 3QNNA 1TQLA 2DT9A 3TSUA 1PJ5A 1VFJA 2HQFA 3ETOA 4K4YA 3DGPA 1X5OA 3C6TB 5IT0A 3D6FB 3K58A 1MNEA 3HSJA 4UOFA 3KJNB 1X9WA 4V19S 4QPXA 1OJ4A 5BPLA 1NUEA 1P9YA 2DNZA 4OZ1A 4ECTA 4WFAL 5BR8K 3AVCA 3K9JA 1DLOB 3IUCA 2WVCA 5E3CA 2CVIA 2I9SA 4ZPWR 4B8CA 1NJIT 1MROB 3LA0A 2Q3SA 3CW2C 2Z0GA 3KLIA 3H1VX 2R8IA 3UNYA 3K5NA 3GJQB 4B9TA 4KV8A 3W9IA 4X4PA 3G8SA 2UXCJ 1DKGD 1NSPA 2R7TA 5DQIA 2DR9A 4CGIA 1FE4A 4GC7A 4PXCA 3OJSA 2D0AA 2CJBA 3L7PA 2XBPA 1SIZA 1E3MA 1S6OA 2QFIA 1N33F 2MQ8A 3MF5A 1TL4A 4IXCA 1PG5B 4NLTA 3PG9A 4RW8B 4CH7A 1RP5A 2X6SA 5J1PA 3FNNA 2HK2A 4DCHA 3QERA 1UVJA 1D0EA 1BHNA 3PRDA 3I5CA 5ETVA 3OBIA 4JYAK 4TKTA 3N4PA 2OPQA 2MLYA 3BPDA 3ICLA 2W9BB 4F26A 4OO1J 1NK0A 4GC6A 3HPHA 4ZPAA 5HMWA 5E84A 1CJTA 4USHA 4MIAA 3CFRA 4AYBD 2BRKA 3NBPA 1CLFA 2DPIA 1Z6RA 1ESVA 1BIZA 4L75A 2BRLA 4URSA 2ZE2A 4ERDA 3QETA 4M45A 2UV8A 1JLFA 3T9NA 1ACMB 3LP0A 3GOIA 3OHRA 4X4QA 2XRIA 1JJ2R 3IFRA 1BC6A 3VGLA 2UXDJ 1S1WB 4RW6B 3P83D 1P1LA 4IKAA 2ZJPL 3VGSA 2BW2A 3VQ5A 3FZKA 3HO1A 1B99A 4PL7A 4X2BA 2RRBA 3IMQJ 3S1TA 2IC3A 2QA4N 4NCBA 2GV9A 3DXBA 4DUZK 1BA0A 4R8UB 2ATCB 3JQKA 2W2OP 3MMCA 3J7Z5 1YBAA 1BWFO 3BBFA 1S1VA 1HNXF 4DV5J 2F8SA 2XS2A 4DEZA 3H2UB 3MX5A 3QEPA 5AQXA 3R5CA 2MKKA 4ILRA 2JEJA 3U9ZA 1XMQJ 1WNEA 5DMRA 3OFGA 4CI6A 4GW6A 3ILOA 3CULA 2LKZA 3TAGA 4EFAC 1UETA 1N32K 2PY5A 2HGLA 4HUGA 4MIBA 4OHVA 4YQWA 5BN9A 2VFUA 1BMQB 1VQMN 2OCEA 3BGOP 4IFVB 4DR4F 2H1YA 3ENVA 5L9XA 4O55A 4LF5K 3HVTA 4E1JA 2DNGA 5GMDA 5C5JA 5CYQB 3C16A 2WOMA 1MMNA 1NGEA 4CJRA 5H9EJ 5CA5A 4MH8A 5AQOA 2V8DA 4H4MA 1ITGA 5B7WA 2HFUA 2FHOB 2G1DA 3AB4B 4MKAA 4WTOB 3KD1E 2P5VA 2YNGA 4RWWA 4K4XA 1WHYA 4FJKA 2EBEA 2FF3B 4PEOA 4FPRA 4CEAA 2OMOA 4KPYA 2KHCA 4N41A 3MM6A 3NGTA 1WF2A 5D3GA 3BR9A 4IFEA 2D3UA 3CCRN 5IZHA 1SC1B 7FDRA 3LGHA 4RL1A 4LF5J 3DXMB 2DNHA 5C2GA 5C10A 4YR3A 2ZDPA 4OZLA 4I64A 1HPZB 2FGCA 3UN2A 4DR2F 1YJRA 4Y28C 2CG8A 4CBWA 5BR8F 3H2VE 3KDOA 2MGZA 1LNQA 5ETRA 2QL5B 3A3PB 4ZP7A 4KYZA 1KD1T 1BIUA 2DYAA 2K2PA 2OTJN 5D4NA 3V1QA 1QQNA 2CH5A 2B7BB 3LM2A 2IVOA 5GAGP 2ZBCA 3FEYB 1GTHA 2MZQA 4OPHA 2LXUA 4BR4A 1TAUA 4RPFA 4ITSA 1HNWK 2CNLB 2IGIA 4M3TA 2NUUG 3SAHA 3G8QA 2GFFA 3CFOA 2D0CA 5EWEA 2NRWA 3R3TA 5E7OB 1FK9A 3DRSA 3DXKA 2U2FA 1XK8A 2XLJA 2FSJA 4NYZA 4AHUA 3QLHA 1KQSM 4O3RA 2ZH9A 5C25B 1RBLA 3SDEA 3WXJA 5KFPA 3PEHA 2GW8A 2LVWA 3G87A 3RRHA 2UUWA 3O1BA 4DUYJ 3HVWA 3H5UA 2V5HG 1R31A 4PXDA 5KT4A 4DV3J 1J54A 4FWPA 4DG1A 3KLGA 4DZDA 1FESA 2I5JA 2G8UA 3GWCA 2IM2A 3NL0A 4DV2J 1NJZA 3LP1A 2BJDA 3HMJG 4J9PA 4KH6A 3ULDA 4C4WA 2CQDA 4NOHA 1BE4A 1CSJA 5SWMA 3BF4A 3TVYA 1XC9A 3T1HF 2CUYA 2KKZA 1UFKA 1SS6A 4CJ3A 1T9VA 2G9OA 5DZ7A 4DN9A 5LY3A 4OZNA 3QBXA 3CMAS 3DYAA 2RKIA 2HFOA 2KXHA 4OFZA 4USUA 2I2YA 4FKYA 1D3WA 2NRRA 1S0OA 3QB0A 5HVGA 1X31C 5HJXA 3QEXA 4X84A 3PX4A 5GAEP 3OS0A 2B6AA 3UD4P 4CDIA 2WFBA 5GAHI 2A5XA 2VQFF 4DUZF 1UW4A 3DXSX 4ZCMA 3CD7A 1GMVA 3IKMA 4DR6K 2P9LA 3HSTB 4KH5A 1SL2A 1YG0A 4PUOA 1H3DA 3CJ8A 1S99A 2KJVA 4DPYA 4L3NA 2W8KA 3U7JA 4NLPA 3Q8PB 1KQFB 3D1HA 2A0FB 3QZ8A 1EKRA 5E5NA 3MCNA 3BQ1A 4DR5J 3CCSS 3THPA 2B9EA 4YOWA 1CPZA 2OKQA 5FLXO 3VAMA 4USWA 4JKFA 4FYVB 1RTIA 2ZH3A 4AILC 1RUSA 4DLGA 2D0PA 1Y5LB 1BQNB 3FC9A 4Y2CA 3SNNA 1V3RA 2OIHA 3AV9A 2ASJA 3K5LA 1YRUA 3H5SA 2HOEA 3UKUA 5HOOA 3BSCA 1QUVA 1GQEA 3M4XA 2OEKA 4RNNA 1EX8A 1C1BA 3JYTA 1QLNA 2CRLA 3M6GA 1FXRA 1UJ4A 3QFHA 3JAMU 2RU3A 4LC9B 1WELA 3OSNA 1QM9A 2LA4A 2YXLA 1ASVA 1YDLA 3TNVA 5I3UA 1ZM3A 1DAXA 4B02A 4WYLA 1QQOA 3GJTB 1IBMF 2ZUGA 4F9OA 2MQNA 4CJTA 2AJ4A 2B3TB 4L3KA 4NCAA 4AHVA 1P27B 1FHTA 2L9NA 4PG6A 2O8BA 3EPGA 1UZDA 3M2VA 1RT1B 1K0TA 3DLHA 2CNNB 2MYFA 5B0DA 4J9NA 2QWQA 4OJHA 4PG4A 2WVBA 5KRTA 4M3WA 3RW6A 2OEMA 4K4SA 4WYWA 2DRBA 2Q6BA 3U1NA 3DU6A 3QRQA 5A0YA 4LR9A 2F8EX 4QPTA 3W62A 4DR5K 2XNQA 1R27B 3R5AA 4CLZA 2HFZA 3FVYA 3FZLA 5AE1A 2IDLA 1NGHA 1N5TA 3CD5A 3MAHA 4NRTA 5IT9U 2WAQD 4WQ4A 5FPDA 3MMAA 3QWPA 1F0XA 9ATCB 4DCJB 3HHKA 2B4VA 1Z2ZA 3GYGA 2HQ3A 3BKTA 1X4GA 4B9UA 3BF1A 4BRMA 2J6SA 4EYHB 1XNRJ 1OQ6A 2JWNA 1DGKN 2Y8WA 3FZ2A 2RILA 1YJVA 2XCPA 3DMJA 2UUBK 1FE0A 2P6SA 3ZZRA 3KUHA 4ANDA 1MWZA 3QGGA 2HVEA 2B4UA 4LRFA 3POTB 4KKOB 1J5OB 4FZYA 2O67A 3GE1A 1XJWB 2JC1A 1F5CA 2O8EB 4V19X 4J8FA 2VC0A 2IM0A 2MLZA 1ZAWA 4DV0F 3QFWA 3VGMA 2XI3A 2D0BA 4CIEA 4CESA 4KI4A 1U8WA 3Q89A 1IJFB 1YJ9N 4RNHA 5L1JA 1Y0HA 3C15A 3V6DB 1FVQA 2J9DE 4W5RA 1GMWA 1DRZA 2XM3A 3EMTA 4DSEA 3LANA 5AQFA 1HBMB 4X62J 3CPWM 2IYGA 1VRUA 5B8HA 1UOCA 1CVJA 4ECYA 3UB5A 3DI6A 1QE1B 5DM7L 2ZM6K 1L3TA 2J5AA 1HNZK 4BDZA 4IG0A 3AXKA 5LMNF 4F50A 2FQQB 5ETKA 1QVFR 1TV6A 3TZXA 4U7BA 4ECQA 4HL9A 2ZH1A 5K20B 2M70A 3VZIA 3OY9A 2E1ZA 2CPIA 4KGVB 3PTWA 3AA9A 2R7YA 4LFAJ 3T1AA 3UW1A 3P5TL 3I87A 3NS7B 3A5LC 4YY3J 2GX9A 1EKSA 3EJMA 3M8YA 2DXEA 1HNVB 3LP2B 1WG5A 3LDQA 2V4RA 3FRZA 2R7WA 3WXLA 3CGIA 4J9QA 2YI1A 3QJPA 8AT1B 4NMLA 3GMGA 4JP8A 4BDPA 1GFWB 2KRBA 1BA1A 4KH0B 4Y1DA 2CQ2A 3PHEA 3GYNA 2Q31A 3TJ8A 1OSDA 2ZWPA 1NNEA 3G4SS 2BV3A 2V63A 3DLJA 4XH4A 3H20A 4RUBA 4PPZA 1SH2A 1TYQB 4ZLPA 3GG4A 5E3AA 4N47A 3D68A 4KE5A 3ATUA 3P1GA 1TU0B 3A5MC 1RT4B 4ID5A 4IRKA 2GQQA 2QWPA 1HQEB 4JD2A 4P75A 2L48A 2JFDA 3B82A 1L5UA 3RR7A 2RDDA 3GR1A 3ISNC 1S10A 3CCVN 2R42A 4DSFA 4WCEL 3NCPA 2RQ4A 2KYZA 1HR0K 2VKRA 2Z2YB 1KHWA 3J80O 2BXJA 2ZD1B 5A6WA 3Q0AA 4IOAQ 4NLCA 2F9JA 1FJCA 3M32A 2F4VJ 3OYGA 4B3OB 5F1XA 2PSZA 3NAHA 1GAOA 2ZOFA 4IG3B 3PYGA 3DAWA 2NXNA 2ROGA 1XIQA 1D9AA 2NRTA 2LDIA 5KFVA 2QWMA 2YKAA 3H90A 4F04B 3L0QA 2VWJA 1VR6A 3NF9A 3UVJB 3EZOA 4KBOA 1VQKS 1VK8A 4F2RA 4NLWA 5CYMA 1KAYA 1IG8A 2GTDA 1U2RA 1BHLA 5JS2A 5BXIA 2A1BA 3R7NB 1SJ1A 3T41A 1FKPB 3MCSA 2CWKA 2XMJA 2HRTA 3KFWX 4C0OC 4CP5A 1AYEA 2ZDOA 2N3OA 4JI8K 4FF4A 2ZWHA 4HTLA 4BC2A 4L6V3 1HLWA 4K8XA 2C3MA 3OYJA 5AFUA 1FW6A 3NNHA 2DO0A 2YH0A 2GO9A 2G8WA 4IO8A 1SKSA 3GDQA 3JSYA 1IR1A 2F9DA 2YHXA 5KFTA 4QAGA 3QO9A 4JI6K 5ETSA 5LOQA 4DCOB 3M05A 3GIJA 1XMOJ 4LREA 3Q22A 4DQRA 3IS9A 3PLAA 2AGPA 4WIQA 3Q23A 3CXCR 2RHQB 1QSSA 1WG1A 4CLLA 4BE1A 3Q8UA 3HSZA 4WZMA 5A8WB 1L3SA 3MM5B 3IBCB 4LF9K 1Q86T 2KHOA 2IBOA 1RT2B 1T95A 4JV2A 3T7ZA 3BZCA 3MR6A 2F65A 3QPIA 1W2BM 2V4QA 1RTHB 2IMOA 2GC8A 5KG4A 3NH1A 4C0BA 4DV1F 1AT1B 3BSNA 4FLZA 5AFUH 1FEHA 2FY1A 4RWTA 1TUYA 2DNLA 2JVOA 2FVQA 1T11A 3BP8A 2E5IA 2E66A 3CNQP 5K14A 2VOPA 1ICEB 3V4MA 1U02A 4PR6A 2ASOA 2GGPB 3UCGA 2Q1NA 2V2VA 3PO5A 2VPXB 1J27A 2KO1A 1SV5A 4ZVTB 1YJNS 2P51A 5KFWA 2EPIA 4K5SA 3G82B 1M5HA 2HZVA 1VHIA 1PKUA 2MPUA 3KK7A 2IPOB 4OX9K 4ZVUB 1BWVA 4MLEA 1ZS6A 1U7LA 3H98A 2QIFA 5L1IA 3WNHA 2KKHA 1ZYQA 3BSOA 2H48B 3MD1A 4CJWA 2AA4A 3N4WA 2AYEA 4C8MA 5AXNA 3U6FA 2ITMA 3UI3A 3PR4A 4YY3K 4B3TF 4M3YA 2GHPA 3DRRA 4BQZA 1XMOK 4E3SA 1HKAA 1M1GA 3DU5A 4PAAA 4OKKA 1N5QA 2IA0A 1U6BA 1PYSB 1EQ0A 4OZ3A 3ENOA 4HT7A 3RAMA 1X4BA 2A1RA 3PIOQ 3BQ0A 1DTQB 1RDRA 1N6QA 4P52A 2ZH4A 4OZ0A 4X65J 4OLAA 5E26A 1EB0A 2P9NA 3PX0A 2CJYB 2V51B 5KFKA 3FEZA 1VQOS 4I2QA 3T5HA 4P2SA 5ETNA 3Q83A 4R5PA 4CEOA 1K1QA 3DLKB 5B0GA 1UVNA 3MR7A 3CDWA 4MO5A 1P6TA 4DTXA 3TVZA 4JI3J 3HHLD 2ZKUA 2R8HA 5B08A 3OYHA 1YITS 4KV8B 2BW7A 3Q2SC 1TK8A 2OEJA 3LDLA 2QMWA 1DQ8A 2FC9A 4ZITA 5HK4A 1IVZA 2DFHA 4IJAA 4B1UB 3ZZZA 1UVMA 5HP1B 1Q8BA 4JBCA 1VC0A 1YJ9S 2JHEA 3D66A 2A3ZA 4KTWA 2HHTA 5J2PA 4GVMA 4W5NA 2XMUA 2WVFA 1CQMA 1BUPA 2A1SA 2V2KA 4JI8F 4O4RA 3OJUA 2I8EA 1F3FA 4CZCA 2FBTA 3MPUB 4TLQA 2PA8D 4FWOA 1F5AA 4DR3K 3HK2A 4WU3A 3CPEA 3RB3A 2IAJA 3BS9A 1VLOA 2VQEK 1FX4A 2NYIA 3WQTA 3WQPA 4BR7A 1YRTA 4CD3A 3GV8B 1WOPA 4ZVQB 3U1MA 4R79A 3VEZA 3LH2S 3Q7BA 3WXKA 4YS2A 2ZOGA 4FW2A 4BWJA 5HANA 3P3DA 2ZGZA 4G6VB 2L3MA 3HHEA 3EVWA 3DWLA 2ALYB 1LAWA 1RLCL 2VL1A 2C2ZB 2YJEA 3RZAA 3M3ZA 2AV5A 4W90B 4RW6A 4JI1F 2D9PA 4B3MJ 1HNIA 2I7PA 3MEGA 1VBZA 4W5QA 1U0HB 1HQUB 2CPDA 1UKUA 4LFCJ 4YORA 4DV1K 3Q8VA 3N28A 2YCHA 2D3O1 1AW0A 4R8UA 2E44A 3DLBA 4DXLA 2B4PA 3KWMA 1Q82T 4N77A 4JI1J 2R8GA 1S1VB 1H7WA 4PZVA 4K4ZA 2DCLA 1S9GB 1WUUA 2VC1A 4DDFA 4L76A 5GAEU 1KTVA 2PFUA 4QS7A 3KD5E 4M5MA 5HMZA 2CPHA 1KQGB 2FVSA 1R0CB 5FPMA 2C42A 2AX1A 1YRXA 3VV2B 3J81Y 5FIIA 4OKEA 3CB4A 3HTVA 2IM1A 1C0TA 4EIAA 3O08A 3WEEB 3B8AX 1X4HA 1GX5A 5E0OA 2CKWA 3NKYA 3PO4A 4UY85 5HLFA 4CTAB 2VG7A 3W65A 4NYFA 4JYAJ 2VJUA 2K1RB 1U1QA 3O6WA 4CVNE 2ZHOA 3TTFA 3DOLA 4FJIA 2Z2ZA 3HP6A 2LLZA 3HJVA 5RUBA 3OYNA 4IWVA 4KH4A 4BRAA 3GIKA 2MMYA 1RTJA 1WN7A 4C8NA 2V52B 1FRMA 3THXA 1QZ5A 3T1YK 5J2NB 2V34A 4EWTA 4O0IA 3R1LA 2D7SA 4FS1A 2OJ3A 4XPCA 1LEOA 3GFZA 3WX8A 5KG1A 3BH7B 1XWLA 2GNKA 1WEZA 2J0SD 3G0ZA 4DWIA 2E88A 2ZJQL 2HFSA 3DLGB 2ZWOA 3ITHA 2VODA 4AHSA 4M3XA 3J7YP 4CFBA 1Q82O 3AVNA 3TUZC 3CJ7A 2CQHA 2YVSA 3Q8QB 3RMDA 5AQYA 1RAGB 4JI4J 3OS1A 4A59A 4HT5A 1Q5YA 2QKBA 1AFJA 1CJKA 3NDKA 4CGGA 4KHSA 3C46A 4BACA 1YJTA 4NB4A 3DLRA 3FJ2A 4B08A 4B9VA 2R7UA 4RWXA 3M1VB 2F8HA 4TQSA 1FK9B 3PKMA 4FJGA 3TA1A 2PN6A 1N33K 4RBUA 2G13A 2O3DA 4CHNA 3SQOP 2QSFA 1SJFA 5KPZA 5ETQA 2AKWB 4U9RA 2E8AA 3SV4A 4WP8A 3K8WA 2P9SB 1OH8A 3HDSA 4IH6A 4G1IA 2W2NP 3NMUA 1UEKA 3NHGA 4WK1A 1N54B 4ED8A 2JFKA 1X4DA 2Z2LA 2HMIA 4DR6J 5I42A 3G6ES 1HJOA 1YK9A 3ULEA 1VSFA 5HRPA 3FZFA 5LMUF 3N9UC 4OLOA 2GQ2A 3TZWA 3TARA 1VSMA 3L4QA 3F0NA 2FHJD 2Z1GA 3ZC4A 4YHHJ 4LR7A 5AJ3F 5T14A 1NPKA 5SZTA 3CJ5A 3U4LA 3L3CA 2VGNA 2JLEA 2P5OA 4CF1A 3EEQA 4FS2A 2A6OA 4O0NA 2KFYA 2DRDA 3ZSVA 3D28A 1V4SA 3H42A 4UQTA 3GYXB 3MUTP 5KPTA 3OSPA 1IBKF 2DY9A 5MLCQ 4IO9L 2VGMA 2P9IB 1T03A 3ZNJ1 2A10A 2FLPA 2CH6A 4OYOA 3AOCA 1P8ZA 1S49A 4RZRA 2HIYA 3CD0A 2AD9A 5LSOA 2LEAA 3UPFA 1Q53A 3ZETB 2O4GA 5L38A 3CC2N 2BJ3A 1B7YB 3D6TB 4ZPVR 3U3YA 3VZHA 3CIZA 2RPIA 4PQAA 3BZKA 2YWWA 4CJ4A 3CCRS 1ATRA 3OR1B 1X5SA 4FLWA 3LAMA 1U2VB 3TAMB 4AQYJ 4LF6K 2JZ5A 1ZH5A 2O8DA 3AVGA 5HBMA 4B9SA 1ATSA 3MCOA 1WSFA 2PBDA 3V2UC 2K06A 4JRQA 1H74A 1GLDG 5H9FK 1N5VA 3SUNA 3KK1A 2OELA 3AVMA 1FEEA 1RT3A 4YR2A 1VRTA 1YAGA 3RAQA 3T5KA 1UFLA 1QTNB 2L41A 1RGVA 4DR4J 3VQ7A 3ZX0A 3BQ2A 1X1PA 3CJ4A 1T9UA 1YBTA 3WBZA 2VUGA 3ZSZA 1UCNA 1RDBA 2AX0A 3OYCA 3SPYA 1K9MO 2J9CA 4GMKA 2BR0A 2YY3A 4EBDA 1OPZA 1JXLA 1OY9A 3RMAA 3BYPA 1F5BA 1KOHA 2YWKA 3W8GA 1KVKA 3JXUA 3BGRA 2EFPA 4YB5A 3CSKA 3W2VA 3PV8A 4P74A 4KB7A 4JKGA 2EW9A 3W8PA 1RCXB 5EX5A 1APSA 2DR6A 4ED4A 4QU6A 2EFOA 1FFSB 2XULA 1S76D 1RQ0A 1H2TZ 2CJAA 3RW7A 5M1FA 3ZTSA 2ZBIA 3ZEUB 1YXQA 2VFVA 4CO2A 3GL1A 2H54B 1V6HA 3D67A 1K8KA 4FWKA 3HOTA 1G6BA 3B54A 4Z2XA 1WSVA 3MMAB 3QGHA 1IJJA 4DR5F 1CJUA 3M8PB 3CDUA 1K1SA 1HBOA 1VQON 2NZCA 4KHYA 3G2XA 2FUG9 4HACB 4XIUA 1TK0A 3W9JA 4DR1J 3G8TA 3C95A 2P9GA 2UUTA 3SBMA 4CIGA 1H0HB 4LF9J 4CHOA 4BE2A 1WF1A 2FVRA 4H54A 3GG1A 1Q81T 1KLMB 2MQQA 2ZNYA 3CCTA 3ZZPA 4K8ZA 5IFMA 3QIPA 4YUDA 3TUJC 1F6TA 2BQUA 4JI6F 1QQMA 4LRDA 3PACA 1HMVB 1FWLA 3SBGA 4X66J 1D8YA 2VWBA 3ILIA 3V81B 5B0CA 4O0JA 3GP9A 4X66F 1TL3B 1FFGB 4A47A 2VU5A 4JI6J 5B0FA 2AJ1A 4K2JA 3SI6A 1FFWB 1T9XA 2XSJA 4M3UA 4EZ6A 4M3ZA 1VK0A 2FB0A 1DLOA 4CYUB 1HBMA 3WX4A 1VRUB 3HFKA 3VTHA 3A1YG 1YJNN 1O6XA 4OYIA 4IUFA 2HB5A 4OX9J 4CZKA 1WC6A 3DI6B 4PRFA 2O66A 4EK2A 1EXQA 3MN6A 3DOMA 4B3RF 1JKHB 1JLAB 3AD8C 1T9YA 3AT1B 3MCPA 3JS6A 3WUHA 2DXDA 2HPUA 3CQYA 3VGVA 3OYMA 4M5DB 3IRXA 2G2OA 4QWDA 4LVOP 1B7FA 2G0IA 1HYVA 2MKCA 2V0NA 4LMZA 2MKJA 1S48A 2YH1A 4WP3A 1SQKA 1N4LA 3V4IB 3P38A 3W2WA 4NI2A 2J0WA 1NO8A 4G1QA 4DSIA 2E7VA 2SXLA 1TKTB 3BEXA 2DD8S 1RBSA 1V5IB 1WOQA 1KSPA 3VGTA 4M1KA 4F4YA 3J81j 3UDCA 2P9PA 4KBIA 1SJRA 4DV3K 3MWBA 1NMNA 1QTMA 4UTGA 2NQPA 1FO1A 2F63A 2DPNA 4DV4J 3TA0A 5AZIB 4CLSA 5KPRA 3H2LA 4OIXA 1WORA 4DR7F 1XR5A 1YTYA 1U24A 5AR0A 4OZ2A 5KFSA 4UOGA 3AAQA 1HHTP 4ILMA 1CXQA 2CZ9A 3D1OA 4ATNA 1DTTA 5BRHA 1IR0A 1BI4A 1VQNS 4I9QA 1G3OA 2ZGYA 1XMOF 3C3LA 1RBAA 3H7HB 2V50A 3MXMA 3PRBA 4AXIA 1E4FT 1VI7A 3EKUA 1DY3A 1RXOB 4CK2A 2HF3A 4DV7F 1GLJO 2A42A 1Y7PA 4FBUA 2HBZB 5K9FA 2KU7A 4LH5A 2XZWA 2VA3A 1RAEB 1R0AB 2M8DB 5DQGA 3AY9A 4DL2A 2O8FA 4NZ7A 1W26A 1RSCA 4EHUA 1ZBHA 4JV5K 4AQYF 2BX6A 5CZ1A 1N32J 2GX8A 4OQJA 3OQ2A 2Y1JA 4BGBA 3OW2M 4PHTX 3LPTA 1HHSA 4DI6A 4F4XA 2KVQE 2A18A 2C22A 1HPMA 5C15A 2QA4S 4E7JA 3UVJA 2OAUA 2O4IA 5E3RA 4ILGB 1VIXA 4RW4B 2OD4A 3K0JA 2MLXA 2OGUA 3WC0A 4WQ5A 4ZTJA 3JQJA 1RBOB 4UT4A 2PA3A 4ILHA 3K5MA 4IBNA 2YX1A 3MAAA 1BQMA 2O1PA 4KHWA 3NP5A 4YEAA 3M5RA 2BKPA 3EGNA 3VAKA 1FNXH 4NXNF 2KYXA 3QJLA 2CQIA 1LCUA 3MM8B 2R8JA 3CCUN 1FRHA 3K2YA 5G0RB 2YKMA 2CWXA 4Y0WA 3C2PA 1JLCB 1A6LA 5JJBA 1ZTWA 2FJVA 1OSCA 3MM9A 2KH9A 3RB4A 4A62A 4O8UA 5AJ3J 3IFEA 1V3SA 1VQNN 1XBWA 4Q5VA 4B17A 2YWEA 1HD1A 4H0OA 1RTDA 4K4TA 1BGXT 2EHGA 3AJ1A 3ZT2A 5IV4A 1D4XA 2IJRA 2FJEB 4CZIA 2KB2A 2D5RA 4G65A 1SL1A 2Q2RA 1V3ZA 3L7UA 5T7BA 4Y65A 2ZJRL 2VPWB 2PD1A 1XC3A 3NMRA 3MM5A 1KOOA 3HSCA 2CJ9A 5A8RB 1EETB 3EY1A 5EWGA 1SUQB 2HLUA 2CAJA 4UZCA 3LWMA 3HHLC 4ECZA 1SH0A 1HR0J 3QDKA 4FK4A 2DY4A 2NXEA 2UUCK 1M1HA 3ZO7A 2EVZA 3HPOA 3T1HK 1LKZA 3VCDA 6FD1A 3GJRB 1R6VA 3SBTA 4IR9A 3HI9A 1LWEB 3N5FA 2YNFA 4CZFA 4O3QA 4YDUC 2F8TA 1YT3A 1K6YA 2HHQA 3PSFA 2G4BA 4RW7B 4TLRA 3MTKA 4CI0B 2ABYA 3DC2A 3KXDA 3EVMA 1VOMA 1VSEA 4U7UD 1YVFA 4P10A 3KLHB 3ENQA 3C14B 2HF4A 1IKVA 3K8VA 1XNQK 5BRFA 3FDSA 5C25A 3SDEB 4JKBA 1UWBB 3CCJS 3AVBA 2JEGA 1H38A 2DJWA 1U6ZA 1Q9YA 4E7HA 4M5LA 2M5YA 4DTOA 4K0KF 1J6ZA 4GKKF 2RJZA 1T6CA 4FXWA 3ASMA 2YWFA 1HR0F 2HW3A 1WHXA 2W8LA 3R7SB 1HFEL 5DGBA 3QEVA 3EKSA 1S9EA 2PO4A 4AHRA 2PFDA 2GMHA 3SCLE 2W2QP 1PYTA 1MU2B 3QEIA 1YJWS 4RUAA 4K4UA 4BCAA 1WD6A 1IQTA 2L9DA 4KQZA 2CXEA 5HRRA 4ZJLA 2OTLN 3TO8A 3SMSA 4DU4A 4PWDB 3V9XA 1TFWA 3X3UA 2VA2A 2VH7A 3G6YA 1JCEA 4PG8A 4GRSA 5HN0A 3U02A 5KAKA 3WXIA 1XN9A 4YOXA 3SK3A 4Z4GA 1N5YB 5L1KA 4CM2A 4DZ6A 1IKWB 1SC4B 1RWMB 5K8MA 3BGUA 4ECWA 5CABA 5LM7E 2DEJA 1PBAA 2RIJA 4R5PB 4B9LA 5JICA 4YDXA 5I9EB 3QT6A 3NAEA 3BO3A 4KGXB 1HUXA 2W4PA 4IR1A 4JI4K 1FDAA 3EGWB 2E5JA 2X78A 5T7LB 1ZBSA 3A3OB 2GV1A 4ES1A 4DV7K 3C7NB 1ZA2B 4KFBA 1BO5O 1KTQA 2ETJA 4NLDA 4W92B 3GIRA 1QY7A 5E41A 3B6PA 3E8OA 5HMXA 2JDJA 1NJIO 4CGJA 1ZPWX 2BH1A 4NXNK 4CBUA 4DV5F 2AJQA 1UW9A 4A5BA 4DFKA 1WAFA 3GG0A 4DU8A 2Z1JA 5SUHA 4MMOA 3TWZA 2CGLA 3IBWA 3DLEA 4OYZA 5AXKA 1WLJA 1KC8O 3NAIA 1YHQN 3HHLB 1VBYA 3D2EA 1WB9A 4CHQA 4DR3F 4CZMA 4KI6A 4ZVPB 4ZLNA 4LFAK 4KHPJ 3SQGA 3FFKB 3QT8A 3K5OA 3ZZUA 1RT7A 3LPYA 5K8NA 3CCQS 1X4AA 1RBUA 3GV7B 3SPZA 2F9TA 1RT6A 2RE2A 2Q6CA 5IWAF 3L2VA 3A8IA 3DM2B 4JK7A 1ITPA 1KLNA 3M1FA 1O1WA 4WIIA 3O9QA 1T3VA 3MTJA 4KTZA 2UP1A 5FRMA 4DQIA 1TUUA 3R8EA 2C2KB 1VJWA 2HNDB 2YHAA 2FSKA 2IBKA 2AZ1A 4WFYA 3R6GB 2BM1A 2XMMA 1K8AO 2CJQA 3VN5A 3GZ7A 1G15A 2ZHAA 4O5FA 3SJJA 1S3XA 3LL3A 1DBDA 4J9UE 2EFVA 3QRPA 3VHQA 4QOTA 2QLJB 4ECUA 3UE2A 4DFPA 4DTUA 4X62K 3M2UA 3TX0A 4RU9A 2JEFA 4H4KA 2J6UA 5EU7A 1I94F 2RVJA 4Q0BA 1FVSA 4J9OA 5HRNA 1WDTA 4LRAA 3HYFA 4URGA 4CZEA 1VQ9S 3DMJB 2C3UA 1NM1A 1O8BA 3IG1B 5C24A 4H5TA 3RBEA 2VB6A 1NBWA 4N5SA 2L9WA 1RAAB 4AQYK 3MMJA 3I55S 1LQ9A 4A8QA 3NCQA 4RUCA 2P9KB 1HWJA 3K89A 5M1KA 4FJ7A 4C1NK 1B9DA 3O1WA 4L72B 2DNPA 3SZ2A 4NEZA 3DFEA 2NZ4A 5C2CA 3E66A 3M8ZA 1K9MT 3THXB 5F8IA 4ZK7M 3SCIE 1PO6A 3KUEA 1EX4A 3L4IA 3MECA 2JOQA 3MI7X 4FJJA 2JSXA 3C6UB 5KFDA 3T1HJ 4CRJA 5M1QA 2KM8C 5AQVA 2IJFA 2D0OA 3MEKA 5AQMA 4H5RA 2RMLA 4DF4A 3IR5B 4OLBA 2AJFE 1S1XA 3TRGA 2FHKA 3SAGA 3M6VA 4LBIA 1RWOB 1RHRB 5KFYA 1QSYA 3PDNA 5KFBA 4X64J 4JS5A 4FPAA 1J53A 4QR2A 2XI2A 2EC2A 3R5JB 4HI1A 2WSEC 4BC5A 3NY0A 3HSDA 4ES3A 1VQ9N 4A8XA 2E6MA 4LSNB 5FPNA 1A5XA 1U45A 2DPJA 2UU9F 3I56N 3CDBA 1WJ9A 1RHMB 1HNWJ 1NK4A 3TJAA 1NU4A 5BN8A 3M1VA 2FBYA 3F9KA 2OYQA 1JXEA 4B8AB 1R59O 2NXCA 3AAWB 3MM7A 2IVPA 2DNMA 2WSFC 3ZZ0A 4DV7J 3D0IE 3J7YI 3EE9A 3VEYA 4JI4F 4AH9A 1C1CB 3KJVA 2E2OA 3LDPA 4QW9A 4ETXA 1Q9XA 4Q8EA 1AROP 4LF4J 1S6PA 2IRUA 2QE5A 2AEJA 4CK3A 2HHXA 2R2SA 1YZ7A 2DHHA 3P5BP 3NVKA 4K7QA 4ISEA 3MMBB 3MWPA 3MR3A 4F4KA 2BDPA 1WKLA 2AJ2A 1OPIA 2EK1A 2DFFA 3ULEB 2HBMA 5D0EA 2XZDB 3AO2A 5L9NA 2B9WA 2CA9A 3RWUA 3DNCA 1ZC6A 2VF3A 1QVFM 3M6XA 2EK6A 3H46O 1NMEB 1PBUA 1VCTA 4DR3J 4NWBA 4USVA 3BBBA 1FA0A 2MZRA 1CULB 1VSKA 3WXMB 5KG7A 4TY8B 1JB0C 1VC6A 1OQ3A 3UE5A 4UOCA 3PR5B 5HQMA 4Y00A 3THYA 3CJAA 3EDRB 4BRHA 3DGVA 4XH1A 4DBQA 4CECA 1UPMB 4DTSA 5EWFA 3W66A 1ZM4A 2HVDA 4DPTA 3NGDA 1URNA 3IWXA 4JI0J 2DITA 1U04A 1Q4RA 2YQ1A 5ETMA 2DNQA 3CCSN 4OI2A 4O44A 1YGYA 5D6GA 4TXSA 4ED3A 3IMXA 4DV4K 2YKPA 3A3NB 2X3GA 4KGMA 4DR1K 3M8QB 3QRRA 5AE2A 3FE1A 4X65K 4U95A 2ZZTA 1GLLO 5EUHA 1T7PA 3O4NA 5D4LA 4CGFA 1U2VA 4LF4F 4ID1A 2C2NA 4J5OA 2D1KA 1IUJA 2R7SA 3VEVA 2F4VF 4CO5A 3T6BA 3OUYB 1SVDA 3CCJN 2QV6A 5AZJA 3AO5A 3NGUA 1IBLK 2XHBA 1JLBA 1AXQA 4I6AA 2OD6A 2RRNA 1YSJA 4O3SA 1Z05A 2AGOA 4KIAA 1GLCG 5AE3A 3HI0A 3GSIA 2YNHB 1IR2A 2FYXA 2LQJA 2R4FA 1FRKA 2B9YA 3AVKA 3AA3A 3AD7C 5AQIA 3TJ9A 1H1VA 4V1Ak 2HZCA 2ILYA 2V8VA 1UVLA 3EVOA 5KTQA 3KHGA 4FZZA 3HT0A 2YKOA 5J1EA 1F9FA 4LY7A 1C1AA 4BROA 3C66A 1EWQA 1CS4A 3B8HA 2NR0A 1NJYA 1U2FA 1RWVB 2G0JA 2W7OA 5I3QA 2CQ0A 2GWJA 4ILLA 4F3TA 2X6NA 3VEWA 1MROA 2VG6B 2JWKA 3KG1A 1YTUA 4BVOA 1NHVA 3OYFA 2YKNB 2RDIA 2VONA 3THTA 4ANEA 3MXJA 4WBFA 4RUHA 3N5BA 1TMMA 1M5PC 5K14B 5H1SV 3PIPQ 2E2PA 3MWTA 1RAHB 2J7KA 3L9ZA 4BR0A 1W7AA 3HVRA 2GGPA 1EAYC 3ZEUA 5M2UA 1AFIA 3O3FA 3HZ6A 2Q97A 3CM5A 1N56A 2QWLA 1D09B 3RYLA 2OSRA 1K44A 1NSQA 1FCAA 4E2FB 3M8PA 4ED6A 1JWWA 1X4CA 3IC1A 4B3RJ 2DKOB 1LW2A 2HSTA 4HACA 1N36K 4JRPA 4I6YA 1REVA 1ATNA 2N3LA 1U1LA 3FRYA 2LQBA 3AODA 2MZSA 4Y2KA 1T05A 1TP7A 3P49B 2WW4A 3KMSA 2BE2B 1QAXA 3G10A 1FTRA 5GADI 1PAEX 3SQ2A 1HIYA 2HS3A 1FERA 2HAFA 2P8IA 3G4SN 1KVIA 1RT5B 3TEGA 2JJ4D 2MJUA 3BDPA 2DHGA 4DV0J 3CM6A 4DQPA 3L8BA 1RB0A 1GOCA 5DLFA 3MDQA 2AT1B 4XTTA 4A4JA 1JQGA 1N6QB 2CG4A 1KN6A 1W2BR 5AJ3K 2R9LA 3E2EA 1XR6A 3AAPA 2RE1A 4DLEA 1JLGA 4CNYA 2NLXA 4CLWA 1KFSA 3OTBA 1KR4A 3DLKA 4HH0A 1PC4A 3DDKA 1BU6O 4JI5F 4IH5A 4LF9F 2WVDA 3QSIA 4ZOSA 4IO9Q 3MMCB 2WHOA 1NGDA 4JI7J 3LPEA 1TGOA 2EXUA 4IH7A 5GAGI 4KSEB 4YB7A 1GK8A 3DOMB 3WT0A 2UXBF 2QGFB 4RNMA 1XUPO 5M1PA 3ENAA 1U2CA 4ZPDA 3UFCX 3CDEA 3VGKA 2CPFA 4QU7A 1HRHA 2V9KA 4M5DA 1JLQB 7AT1B 4CH1A 4K4WA 5ETLA 4KHPF 3IRXB 3CERA 4K50A 3FQKA 1OO0B 3ZZOA 1KBRA 5J2PB 3OYBA 1Q18A 1MW7A 3KLFA 3E51A 4O23A 1LWFB 5J2MA 2AU0A 1FJ7A 2AMCB 4IEEA 4FK2A 3HVTB 1VSHA 2G2YA 2B0GA 4PPDA 1WKJA 4R0JA 1TKTA 1Q79A 4OHWA 1TL7A 1FDBA 1YITN 2KXFA 4B1XB 4CHZA 5KT6A 2QL9B 2IAJB 1NU0A 5AQZA 3VAHA 4JI2J 4JV5J 3QEWA 3JTPA 4DSKA 2UZAA 2IVMA 2RUGA 4YN3B 4KHUA 3PJWA 4ZPTR 5D3GB 1YKWA 2YX6A 1UVIA 2HNYA 1DTTB 1BI4B 1DJ0A 3JB9k 4NASA 3AA2A 1MWQA 4IDKB 2MKSA 4RW9A 1SB6A 3CCZA 1NK7A 4HTUA 3R6LB 3BO4A 2AIRB 4RKUC 1EQMA 3QFPA 2DHAA 1HNIB 2VG5A 1U0HA 2VBWA 3RSEA 3D7EO 4CO4A 4DV5K 1VK3A 4DTRA 1U1OA 1RBVA 4LVNP 1HL6A 1J9AA 2RD5C 3OLAA 2ADCA 2PAVA 4B3TK 2O8FB 1S79A 1VYAA 1HNWF 1QSLA 4FJ9A 5KFCA 3VQAA 2HBLA 1R8PA 4FK0A 5L46A 3T69A 2P6TA 3A13A 3RBXA 5M2PA 2KG0A 3L6QA 2QC3A 2OPSB 1IO2A 1IKYA 4C8YA 2IHR1 4CD1A 2B8PA 3DHXA 3OT9A 4FOEA 2HHHJ 1KONA 3G6XA 4U67Q 1VQ4S 3VQSA 4ZJOA 1Q7LB 2JH3A 4CEQA 2XMVA 4FLVA 4FVUA 2XMKA 1RAIB 1S5ZA 3SXLA 2NXJA 4NPOA 4OJGA 1FXXA 4CFCA 2DNYA 2GJIA 3Q8YA 1B9FA 3RRKA 1ZETA 1GMUA 3H8YA 3BJYA 5KFIA 2DB1A 4H0YB 2E2QA 3AD9C 4BHQA 4WF9L 1GXLA 2CJKA 1MA9B 3CF5L 4Y2AA 1QD1A 1EARA 1MG7A 5DJBA 5J2NA 1RTDB 2IRYA 2C3OA 3LDOA 3HKZD 3GQCA 2HQCA 1URRA 4OYMA 1JLEA 2FJXA 2OMLA 2APOA 1UJ5A 4CERA 2YPYA 2VKZG 1Z4UA 2Q66A 4AFFA 5KG5A 2E6LA 3JXOA 3GCWP 3PXGa 2DIUA 3TAFA 2P9LB 3QAEA 4ZIVA 4DV3F 2LA6A 5JS1A 2Z30B 3B78A 1EO1A 1YJ7A 1WI6A 2ILZA 4FJNA 2V4JB 1RAOA 3IO1A 3W64A 4IFYB 5CQGA 1JNRB 1QUPA 1HQ2A 2H3GX 1CC7A 1SI9A 1BUXA 1LK5A 3EICA 4V19J 3OTOF 4PA1A 2M7SA 4Q2LA 2XNRA 2CADA 1RA7A 1KVJA 1QJHA 4J9KA 3M30B 3FCVA 2CDQA 4P9SA 1EP4B 3EXCX 1KAXA 2W4DA 5JXSA 4NCGA 3BB5A 1TUWA 4I6WA 3OVSA 1SQGA 3IRWP 2QWNA 1HI8A 1WEYA 2PT0A 2E5LK 4Z4IA 4AE5A 2CJXB 2Z56B 2ACMA 2HZAA 1HBUB 3CD6N 4ZTFA 1KVAA 1RBRA 4BLGA 2M8HA 5E33A 3W61A 2BM0A 5EDWA 3UWTA 2LCWA 2RF2B 3T5JA 1VQPS 3H25A 1HW9A 4PKHA 4BC9A 3EGVA 3D54A 1U1MA 3N4QA 2HMIB 3U9DA 4P73A 2V7YA 4LSLB 4K42A 2F7VA 3ZT4A 2MKYA 1YIJS 5HROA 3LP3A 4LF5F 5C2DA 4LUBA 4QYZJ 2QMXA 3I6PA 2NS1B 4HTIA 1N32F 1VMBA 3AQOA 3SEOA 2AEMA 3BREA 4OI3A 4P2MA 2V2QA 1I6JA 4Y1CA 2IVYA 1TKZA 4C3LA 1GEHA 3AO4A 3FZHA 4NA3A 1ZM9A 2MHNA 2E1MC 4DUTA 2WB1D 1IKWA 3WIUA 1HKCA 1VQPN 4C97A 4CH0S 4H5VA 2BVZA 2B8QA 2VHGA 3TZZA 4Z0UA 3J8AA 2QTDA