3V81A

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and the nonnucleoside inhibitor nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v81A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v81A05
2O4IA 4DSFA 1D8YA 3MAQA 2AGQA 2BRLA 1Y97A 4FM2A 4JLHA 4PQUA 3S9HA 4FJXA 5T14A 3HT3A 1Q8IA 3SUQA 4IG0A 1JLQA 4Q0BA 3RRHA 1K6YA 3JSMA 1KTQA 4C8NA 3DLEA 3U3GA 1RA7A 4WE1A 4ZPBA 1RT5A 1S1TA 3O3FA 3QIPA 4KHNA 3NBPB 3QO9B 4O44B 4E19A 4CESA 3QETA 2FJWA 4YR3A 1C0MA 3LP0A 2AWZA 3MEGA 1CXQA 1HMVA 5CZ2A 5CYQB 4FJ9A 1T8EA 1TL3B 3OYBA 3M9NB 4I2PA 4ZTJA 3KK3B 3CJ0A 1FXXA 1S1XB 4FW1A 5HRSA 3F73A 3HM9A 3NAIA 2R8JA 1S1UA 4CHNA 4CGGA 2VWKA 3OLBA 5KFNA 5E41A 3V1QA 1RT3B 3HVTB 1NOYA 3H4DA 5C25B 3PW4A 4O0JA 5I42A 5F8LA 4Q8FA 3I0RB 3AVJA 3QIDA 1S1VA 1S9EB 3HJFA 4KTQA 2DFHA 3M9OB 3V81A 1N6QB 2D41A 1SKWA 1JLBA 3IGVA 2R8KA 2I1RA 1S49A 2FVRA 3DRPA 4KHSA 5KT3A 2RDIA 4CJQA 4E7JA 2OPPA 1YTUA 1S9GA 1WLJA 3IG1B 4CE9A 1RT1B 4CF0A 4DSEA 4CJTA 4E0DA 3AVFA 3MECA 3L2QA 1S5JA 1IO2A 2X78A 3M8QB 4ED7A 1HQEA 3KMQA 2YNHB 1J5OB 5HRRA 4J9OA 3LPTA 3KD5E 4RW6A 3MFHA 2OZMA 1GX6A 4YR2A 2HWIA 4AH9A 2OA8A 4TY8B 4ID5A 3PR5B 4J2AA 5HLFA 3QZ8A 5D3GA 4MKAA 2HNZA 1WSEA 4ED1A 4LQ3A 1NKEA 1VRUB 5KG6A 1LW0A 1RYRA 2WTFA 4CIEA 1S0MA 3ZSRA 3DRSA 3RTVA 4CIFA 4YNQA 4CIGA 5DMRA 2GIQA 4IDKB 5EDWA 4KHMA 5KT5A 4CJEA 4I2QA 3OYDA 3KK1A 4FK4A 1I6JA 5KFBA 3AA2A 1GX5A 3HPOA 4WZMA 2QK9A 4FLZA 1KVAA 1SV5B 4JS5A 3AVGA 2YNIA 3PJWA 2KZZA 1XR5A 4B3OB 3DYAA 3WNFA 1FKPA 4FS2A 3QNNA 3KLGB 5F8NA 4KHRA 3NF8A 4DFMA 3Q8SB 2FVPA 4RW4A 4F4ZA 2VG5B 1JLFB 4BE1A 3QIOA 1KHVA 2QKBA 4ECRA 4NCBA 4RUAA 3JSMB 3EZ5A 2WOMA 3DLEB 4KB7A 4KHUA 4WE1B 1JKHA 3BREA 1RT5B 3M8PB 4J9NA 4W5QA 3IRXA 1LW2B 1N56A 4CJSA 1RBTA 4Q45A 4I9LA 3CJ4A 3SI8A 3MEGB 1HMVB 4CFAA 3VQ4A 4ZTFA 5KRSA 4O5BA 2UUWA 3TANA 4DG1A 5KG3A 1Z4UA 2UUTA 4I2PB 1JLCB 5KFJA 3PZPA 1JL1A 1XR7A 4I7FB 4K8XA 4M42A 3RWUA 3GIKA 5F9LA 1WNSA 3RR8A 1C0TA 4ELVA 2D0CA 1QE1B 1Z25A 5KG4A 2QXFA 3TAPA 5KFGA 3QLHA 2BE2A 3CVKA 5I42B 1L3VA 4FS1A 3HKWA 4BE0A 2PY5A 4DL7A 3MEDA 4M3RA 4LH4A 1SH3A 4Q8EA 2I5JB 1JLBB 3LP1A 4CF8A 4NLRA 3TAFA 1O1WA 5J1EB 4OVLA 4MH8A 3QERA 1RT7A 3QEXA 1S9GB 2BANA 1QQCA 4FM0A 3KLHB 1RTIA 1QS4A 1VSEA 4IG3B 4DL3A 3CIZA 5DGAA 5KFUA 3MECB 5KG5A 3SI6A 2C2DA 4DSIA 3U6FA 2HAIA 1B92A 3TAQA 2JC1A 3H59A 3Q8QB 3ZSQA 3OYFA 2R2SA 1TK0A 3ISNC 4KV8A 4BACA 1VSLA 3SQ0A 5HLFB 5CY4A 5J2QB 1DTQA 4CGDA 5D3GB 4BE2A 2HNZB 3F9KA 4EP4A 3BSNA 2P1JA 1FK9A 2W7PA 1S1WA 3A2FA 2KTQA 2ETJA 3DRRA 4FCYA 4URQU 3CWJA 1S0OA 1BQMA 3QGHA 3OL9A 4DTSA 4K4ZA 3RB4A 4DU1A 3I0SA 1CXUA 1ZBUA 4NRUA 1WAJA 2BRKA 5KFLA 4KI4A 4NLWA 2Z1JA 4CFDA 4LQ9A 4I2QB 1ZETA 1TGOA 5KFFA 4Z4IA 4KAIA 2IC3B 1B9FA 1TVRB 4I9QA 3QZ7A 2EC0A 1Q9YA 5FROA 3DI6B 2VG7A 3ZSXA 4PWDA 3OYGA 1L3TA 3LPUA 1FKPB 1JXBA 5EU7A 2IM1A 4DTUA 2FJVA 3ASMA 3HP6A 1VRTA 3ICLA 1VSMA 4YQWA 3SPZA 1K1QA 4RNHA 4F3TA 1KFSA 4M3YA 4XPEA 1N5YA 3BSAA 1LWFB 2HNYB 4RNOA 3GILA 2FBYA 2HW3A 3IS9A 3NE6A 1S6PA 2GIRA 4IH6A 4ICLB 2GC8A 4Z4CA 5I3UA 1JKHB 2XCPA 4K4WA 4CF9A 3IRXB 1RDAA 1NK8A 4G1QB 1QSSA 4CHZA 2VWJA 4NLQA 2R8HA 4B9UA 5HBMB 3UPFA 3EPGA 4DTNA 4QWEA 3MR3A 4ZHRA 3L2WA 3AA5X 1RBRA 4DTPA 4DSKA 3DLRA 2V0NA 1ZBLA 4F8RA 1HNIA 5EWGA 2UVVA 2OPSB 1RAJA 1NK0A 3KLIB 2FBXA 5KG7A 4PA1A 1D1UA 4HCBA 2BE2B 2F8TA 2W9CB 3CFOA 4DSLA 4J9KA 4HVJA 2EHGA 2V9WA 1RCHA 3CQ8A 2AGOA 3V9ZA 1TK5A 3C6UB 4C8LA 1J9AA 5J2PA 4KHYA 1XC9A 1HRHA 3OSPA 3ZSOA 4E1MA 3PW5A 2R2RA 3OYNA 2R8GA 3NGIA 1ZBHA 4CERA 3VQ6A 3BR9A 3SJJA 3SQ4A 4B9VA 3BSOA 1DLOB 3RMAA 1XHXA 1RTIB 2WCXA 5KT6A 4BDZA 3TABA 5FRNA 3M9MB 1NK6A 4ECUA 2RF2A 2VA3A 2Z1IA 4CJFA 4DQQA 1QTMA 4RNMA 3MXIA 5HRNA 3MTKA 5DQHA 4RW8B 1U04A 1ASWA 4NLDA 1RBUA 4J2DA 3E01A 4TSXA 4MK8A 4ECVA 2Y1JA 2DFFA 3O3GA 5EWEA 5KGXA 5KG2A 3KK2A 2D0AA 4DLGA 2AX0A 3NF7A 4B08A 4O3OA 3L3VA 1UOCA 2AU0A 4HTUA 3LP2A 3DRRB 2YKMA 1WSGA 3N6NA 1BQMB 3TAGA 4CEDA 2FBTA 4EEYA 3I0SB 3SPYA 2HWHA 4OL8A 1QAIA 5F8MA 2G8HA 3D5MA 5JXSA 1I39A 4RUCA 1GOAA 2VG6B 3G6XA 3H5YA 4CJ4A 2BQRA 1WN7A 1TKZB 4IRDA 3AVKA 4RW9A 2JEFA 3NFAA 4DLEA 5KI6A 2YHBA 1MU2A 4PWDB 4CEOA 3NKYA 1HPZA 2D7SA 1JXEA 5KFXA 4DTOA 2F96A 4H8KA 4IKFA 1NJWA 1J54A 3MXMA 2AGPA 3PX0A 1BGXT 1R0AA 1NHUA 5C42A 1IKYA 4NLGA 1KFDA 4CJUA 3DOKA 3BJYA 3NL0A 5L1LA 2E4LA 2KQ2A 4CJWA 3SQ2A 4NCGB 3IS9B 5L1IA 1NK5A 1S6PB 2UVRA 4K4SA 4QWDA 1L3UA 5L1JA 4ECZA 4M94A 3UQSA 3SV3A 2KZMA 1RYSA 4F4XA 3HSTB 1KLMB 4O3PA 2E9ZA 2D0BA 4LD0A 1SUQB 3C6TA 1S6QB 3T5KA 4WYLA 3L8BA 1C1CA 2R2TA 5HP1A 3DLGA 4QOZB 4ZHRB 1JLAA 3TR8A 3QEVA 4FBUA 4ZP8A 5FDLA 2IAJA 1RT4A 1RTJA 3V6DA 2CKWA 1NJYA 2GBZA 1SL1A 5EWFA 2B5JB 1X9SA 3CFRA 3L2VA 2YNFA 3JYTB 4HUGA 2DPIA 3LAKA 2FLNA 1VSKA 3G6YA 4C8KA 5KFPA 1QHTA 3H5UA 3HO1A 2WB4A 1DTTB 3FFIA 2LSNA 1IKVB 3PO5A 4IH5A 4O3NA 5T7BA 4IRKA 1HNVB 5J2PB 4O4GB 1NKBA 3H08A 1RTHB 4IFVA 1WAFA 1TK8A 1T7PA 2ILYA 4NLUA 1TP7A 2W9BA 2CJQA 3V9SA 1TAUA 4L8RB 4CHOA 4OLAA 1N4LA 4CEBA 3NHGA 4CF1A 4CJLA 1RT6B 3S3MA 4B9MA 4Z4GA 4GC6A 1BQNB 5KFYA 4ECSA 3AVMA 1T05A 3MEEA 2F8SA 2OYQA 4FJ7A 1CLQA 3MR5A 2G8VA 2RKIB 3DMJA 3I5AA 3QESA 2ZE2B 4Y2CA 3VQBA 3QNOA 3CM6A 4OPJA 3EZUA 4WXWA 4QWAA 1WSFA 1BL3A 3O4QA 1QSLA 1KRPA 3L2RA 4O4RA 4IFYA 3QGIA 3AO4A 3OYIA 3OYLA 3PR4A 3P1GA 3DLKA 1SL0A 4JRQA 1W9HA 1VK0A 2OPRA 2IOCA 3LALA 1W25A 4NLPA 4CCHA 1ASVA 1U09A 3N6LA 2XCAA 4X2BA 4YFUA 4K50A 1JIHA 4RNFA 4FZZA 3CG7A 1SKSA 2PYLA 3T3FA 4Z0UA 1BIZA 3AVIA 5KTQA 3KHLA 4DFPA 3C95A 3RAXA 5KRTA 2HHTA 1IKYB 1QSYA 3CJ3A 1HQUA 1UWBA 4R8UA 3NH1A 2FVQA 4TQRA 3RMBA 2HHUA 1IKWB 1NK4A 3AVCA 4E1NA 4CHQA 1TL1B 3TAMB 2D5RA 4FZXC 1LWEA 1TKTA 1K1SA 3PW7A 4DSJA 4PQUB 1C1CB 4UQGA 2A1SA 4ZPCA 5KGWA 1EETA 5HP1B 1B9DA 1LWCA 1XWLA 3KNAA 3Q8PB 4W5OA 4IG0B 3KJVA 3MFIA 4CFBA 4KAZA 1JLQB 4Q0BB 3V6JA 5HROA 4O3QA 1VSDA 4W5RA 1RT4B 1RTJB 1S1TB 1JLGA 3QIPB 2HMIA 3D45A 2E6LA 3LWLA 1MMLA 1HYSA 4LSNA 1KLNA 3OYHA 1ITGA 3HVAA 1NNDA 4FLVA 3KMSA 3LP0B 2YNFB 3CJ5A 3PX4A 4DFJA 1WSIA 4NYNA 1SH0A 1WSHA 1RBSA 5F8GA 3GV5B 4DTXA 3Q8RB 1C1BA 4FJMA 1T3NA 1N48A 3ZT4A 4ECXA 4ED2A 3ZT2A 2Q3SA 5KFSA 3RB6A 3DLHA 3K57A 1S1UB 2W9BB 4FJJA 3ITHA 2KW4A 4CK1A 3L2UA 2WHOA 1RA6A 2ASDA 2C22A 2XY5A 5DLGA 2B4JA 2IBKA 2ZD1A 3AVHA 3MXJA 1S1VB 4CJ3A 4M3XA 3AO2A 3DDKA 4OPKA 4Z4EA 2OZSA 3V81B 2D3UA 1VSJA 3KHRA 5DG8A 1G15A 4FJHA 3KD1E 5L1KA 3DRPB 4E89A 5KFWA 4B9NA 2OPPB 2OH2A 4AHVA 4DQIA 4RZRA 1C0UA 4R0EA 2X6NA 4WFYA 4KFBA 3AV9A 1HYVA 1C6VA 4EYIB 1LAVA 4CF2A 3KKRA 1YTAA 4O3SA 1HQEB 2HB5A 2VA2A 4RW6B 3EY1A 4J2BA 3QGGA 3T5LA 3RAQA 4ID5B 4M3WA 1L3SA 3ZSYA 4MQ3A 2QKKA 3V6HA 3CM5A 5KFKA 4LH5A 3NGYA 3PW2A 2HHVA 1LW0B 1U4BA 3NF9A 4HHTA 1ASUA 3ZSVA 3DRSB 3SQ1A 3C94A 3VQ5A 4N76A 3DM2A 1REVA 1FKOA 4R8UB 4RNNA 3OYAA 4CGHA 3CYMA 4ZVFA 3ZT3A 4EZ6A 3KK1B 3QEIA 1EX4A 3SCXA 4LSLA 3HVWA 5KFCA 4JV1A 2Z1HA 4KB0A 4ECQA 3V1OA 1LWEB 2YNIB 4N41A 4NZ0A 4NCAA 4Q5VA 1TKTB 3FQKA 2YKNA 5KG0A 3GV7B 4KHWA 3HHKA 3DYAB 2HHXA 5KT2A 2A1RA 4K4TA 2B6AA 4JRPA 2XO7A 4RW4B 4CJKA 1QAJA 1LWCB 4XPCA 4HYKA 3NCIA 3KJVB 4ECWA 3K5NA 4HUEA 3KLEA 4KKOA 2HVHA 5HROB 1S9FA 2ZQBA 2XHBA 3NDKA 2WOMB 5J2NA 3VN5A 4GC7A 4W5NA 2F8EX 3AO5A 4FVMA 4RU9A 2IMWP 3U3YA 5JUMA 1HYSB 2WONA 4O0IA 4IH7A 4OKJA 5JS2A 3NGZA 4KO0A 4W5TA 5KFTA 1RTDA 1GOBA 1YT3A 1TKXA 2FLPA 2BDPA 1CZ9A 1U49A 4IKAA 4DG1B 4ZVHA 3HL8A 1C1BB 3IGNA 4NLVA 5KFQA 3G10A 3DOLA 3OJUA 4CEAA 1NJXA 5KT4A 2BR0A 2JLEA 1KSPA 5JS1A 1C0TB 4M3TA 4N5SA 2IJNA 2W8KA 3ITHB 3P5JA 4R5PA 3QLHB 5J2MA 2ZD1B 4KSEB 4MK9A 4EZ9A 3WNEA 5KFHA 3RMDA 3VA0A 3MEDB 1NOZA 1XR6A 4MK7A 1JL2A 4K4YA 1RNHA 3LP1B 4QWCA 2YV0X 3I5CA 4FJKA 1RDCA 3VQ9A 4FXDA 3QO9A 1RT7B 3OL7A 2HHWA 2BANB 4KFBB 3NAEA 1RBVA 3NGDA 5CYQA 4DL6A 1TL3A 2QV6A 2HHSA 4N56A 5SWMA 3LWMA 3KK3A 4O3RA 1S1XA 4HKQA 4BWMA 3O4NA 4ZMMA 3KTQA 4KV8B 3G86A 4BWJA 5DGBA 4AHSA 2J6TA 2XY6A 1RT3A 1DTQB 2NUBA 5C25A 4RW7A 4URGA 5DQIA 1SL2A 1FK9B 3VQ8A 4WZQA 5KFZA 3ULDA 4EYHB 1S1WB 3I0RA 2X6SA 1S9EA 4F2RA 3DLBA 2W9AA 2IDOA 3PY8A 1D9DA 4FLYA 2XI3A 4BDYA 2QE5A 4KB1A 1HJRA 4MKBA 4PY5A 3PVXA 3V9XA 1UAXA 2OPQA 4DQRA 5KFMA 1RT1A 4EBEA 3ALYA 3ZT1A 2BQ3A 2IJFA 3OL8A 2YHAA 4F4KA 4FK0A 3PW0A 2VG7B 3M8QA 3PO4A 4M41A 4TXSA 3OL6A 3HPGA 3HK2A 2YNHA 1J5OA 4OGEA 2AQ4A 2B6AB 3G6VA 1VRTB 3FDSA 5KFRA 4NLYA 4WYWA 2UVUA 3RBDA 1N5YB 4IR9A 4WFZA 1VRUA 3KHHA 4C8MA 3KOAA 5J2NB 1OS5A 2RN2A 1IKXA 4TYAA 4FM1A 3HXMA 5I3UB 4JV0A 3GIMA 4FLWA 1UA1A 4H4MA 5HRPA 3VQEA 3H2LA 1RT2A 3V6KA 4E7LA 4H54A 2AJQA 3KHGA 3CDWA 1TAQA 2JGUA 4KO0B 1VSFA 1RTDB 4DU3A 4ELTA 1TKXB 4DTRA 5KFVA 1NK9A 2FJXA 3KLFA 2WRMA 5KFAA 1NKCA 5KFOA 3ZSWA 1IM4A 4ED8A 3OYEA 4B3OA 3KLGA 1HNIB 2FVCA 1JX4A 4J9LA 3OS0A 4KRFA 4KE5A 2P5GA 2HHQA 4R5PB 2HVIA 2VG5A 1JLFA 5L9XA 5J2MB 3SZ2A 3E51A 1X1PA 3TARA 4FJLA 2XI2A 3CFPA 3LANA 1S0NA 3RB3A 1KVCA 4M3UA 4QW9A 4JS4A 2FBVA 3IAYA 3M8PA 3LAMA 4U7CA 3HPHA 3V1RA 1LW2A 3VQQA 4DU4A 3BGRA 4FLXA 4F50A 3T19A 4NYZA 3OSNA 4J9MA 3MR6A 5SZTA 4J9PA 3O3HA 2RF2B 4CEEA 1JLCA 3GQCA 4B9TA 4ELUA 4Z4FA 1UA0A 2KFZA 4U6PA 4I7FA 5EUHA 4CECA 3V9WA 3E01B 2R7YA 5DG9A 4DEZA 3VQDA 4XIUA 2AX1A 1TQLA 3OYCA 1QE1A 5K14A 4FJNA 3KK2B 3QEPA 2IM0A 4RW7B 3OYMA 3TVKA 3UIQA 3LP2B 4Y3CA 2YKMB 4YR0A 2P5OA 1ZBIA 3QINA 4CJRA 4N47A 2I5JA 4NLTA 4AHUA 4QW8A 5J1EA 2XY7A 4J9RA 4AHRA 3SV4A 2OPQB 3EPIA 2Z1GA 3KLHA 4CHYA 1LV5A 4ECTA 4IG3A 3UR0A 1NK7A 3GV8B 4RW9B 1J53A 1CZBA 1MU2B 1HPZB 4WFXA 3V9UA 3H5SA 3RR7A 4DMNA 1BCOA 4O55A 2DTUA 3TI0A 1R0AB 1I3AA 5C42B 4E7KA 2HNDA 5J2QA 3HYFA 1NHVA 4KTZA 1CSJA 3K5OA 4DQPA 4E3SA 3DOKB 3PV8A 4ZPAA 3SFUA 1Z26A 3RB0A 1KHWA 2C28A 3HP9A 1IKXB 5C5JA 1ZTTA 3VQSA 2UVWA 3S3NA 3K2PA 2DPJA 4H4MB 1RT2B 1F21A 5DK5A 3CDUA 4ZPDA 3WNGA 4AHCA 3AVLA 1S48A 3OS1A 3C6TB 4QWBA 3V4IA 4GW6A 2IC3A 2V4RA 1TVRA 4KBIA 4F3OA 4K8ZA 3NMAA 3THVA 3GIIA 3DLGB 3KLFB 3DI6A 1JLAB 4Q44A 2B43A 4YP3A 3OVNA 5FDLB 4M95A 3PHEA 2ZKUA 3PX6A 2IAJB 2R2UA 3V6DB 4ZVGA 4CGJA 4OLBA 1ZTWA 4Z4HA 1RDDA 5DG7A 1YVFA 4XO0A 3OHBA 1BCMA 2JEIA 1LWFA 2HNYA 3LDSA 2IM2A 2PZSA 3SUOA 4DQSA 1ZBFA 1VSHA 4ICLA 3FFIB 4EO6A 3KKSA 4F2SA 5KFEA 1SKRA 4EBCA 1C2PA 3ZT0A 4FJ8A 3BGRB 4G1QA 4IFVB 1IH7A 2G8IA 1LAWA 3H98A 4LY7A 3TAEA 2O5DA 1HYZA 2RDJA 5HBMA 5FRMA 4J9SA 1YVUA 2XGPA 4B8CA 5KT7A 2IGIA 3BDPA 3SUNA 1S4FA 4DTMA 3S3OA 1T05B 4G3IA 3MEEB 4IBNA 2JEJA 4IQXA 5CYMA 2E6MA 2D3ZA 2OPSA 3GIJA 1JXLA 4FLTA 3KLIA 3DMJB 5K14B 1D5AA 3L3UA 4NLXA 3MF5A 2W9CA 3TWHA 4DL2A 1BIUA 4CK3A 3NAHA 1QUVA 1W0HA 3AO3A 4IFYB 3RBEA 2EX3A 3DLKB 1BI4A 3C6UA 3SYZA 5KFIA 4ZP6A 2OPRB 1A5VA 4H4OA 2IM3A 3PJXA 1DLOA 4DS4A 4OKKA 5F9NA 1XHZA 2Y1IA 4CEZA 2ALZA 5KG1A 4E7HA 1SH2A 3QYYA 4DL4A 4NLSA 1L5UA 4RW8A 1A5WA 1T03A 1X9MA 3MR2A 3ZCMA 4F4YA 4ZP9A 5DLFA 4QAGA 2IA6A 2HNDB 3I8DA 4M3ZA 2DFEA 1HQUB 2BQUA 1UWBB 2FLLA 4CEFA 4IR1A 3H40A 4HCCA 3OHAA 4Y34A 4FZYA 2WK4A 3KLVA 2XY8A 3B6PA 3LZJA 4EP5A 4CJPA 4TLRA 3RMCA 3AVNA 2E9RX 3OYKA 3D0PA 1U48A 4ED6A 1GOCA 4E7IA 4RG8A 3VQ7A 2KFNA 2R8IA 2YNGA 3H4BA 4QPXA 4HUFA 4J9QA 2VG6A 3V4IB 1TV6A 1KCFA 4MFBA 4MIAA 1TKZA 1EETB 2JEGA 1JLEA 1EP4A 3WNHA 3P83D 4GMJB 3KIOA 2ASLA 4K4UA 3FQLA 1S10A 4IOBA 1EKEA 4Y1CA 3T5JA 3K5MA 5F8JA 4CJ5A 4DTJA 2G8WA 4FW2A 1JLGB 2FVSA 2HMIB 4PUOA 2W42A 3CDEA 2ASJA 3SUPA 4LSNB 3NH2A 4GVMA 4OGCA 4KREA 1EXQA 4TN2A 2RPIA 4Y1DA 4EO8A 3VQPA 4NCGA 3BQ1A 3LP3A 2G8FA 3ZSZA 1U47A 2O4GA 5F8HA 1RILA 2X74A 5C24A 3BSCA 4DL5A 2ATLA 4OKEA 2DY4A 3NF6A 4CGIA 2FC0A 1KLMA 2W7OA 3AVBA 4M45A 1SUQA 4C8OA 1S6QA 1WSJA 3BQ0A 4F4WA 3GYNA 2J6SA 3H5XA 1TKDA 4CK2A 3D28A 1Q9XA 4FYDA 4DS5A 4TY9A 4FJ5A 4B9SA 4BDPA 4QCLA 5F8IA 4K4XA 3VQAA 4TQSA 3AO1A 5CYMB 1XI1A 4IRCA 5DQGA 4FK2A 2P51A 4KPYA 3SNNA 2B5JA 4NYFA 3NBPA 4O44A 1X9WA 3CJ2A 1C0UB 4NRTA 3AVAA 4FLUA 2ILZA 3ISND 3JYTA 3T5HA 4FBTA 2IS3A 2PYJA 4DFKA 1WNEA 1HARA 1DTTA 3NH0A 4CJVA 1IKVA 3M8RA 3LZIA 1BI4B 1NJZA 1HNVA 3G0ZA 4O4GA 1RTHA 4KI6A 4H4OB 3B6OA 1A5XA 4ED3A 2JC0A 3M8SA 3I5BA 4CFCA 4TYBA 2GUIA 3HVTA 1BHLA 2C2RA 2XWYA 1RT6A 1D0EA 4J2EA 1BQNA 1T03B 3OY9A 4JV2A 2C2EA 3IN5A 4ZP7A 4CHPA 1N6QA 3VA3A 4CGFA 4MIBA 2RKIA 4NLOA 2G8KA 3DM2B 2ZE2A 1REVB 3AA4A 1FKOB 1VSIA 4YMEA 1C1AA 2ITGA 4KTWA 3OJSA 3K5LA 4ED0A 1RDBA 1S97A 3IG1A 3BQ2A 3N6MA 2XC9A 4LSLB 4CEQA 4B9LA 4OJRA 2BGGA 2E9TA 3RRGA 1IG9A 5CZ1A 3CO9A 4K4VA 4ID1A 3VQCA 2YKNB 1BISA 4AILC 2YNGB 3K58A 1ZYQA 3T1AA 1T94A 2XRIA 1TV6B 3OYJA 2GV9A 4TY8A 4MFBB 4Q43A 2ATQA 1U45A 3PUFA 1JLEB 1EP4B 4Y2AA 3OS2A 2J6UA 4ZVEA 2W8LA 5KFDA 4WXOA 2G8UA 3KLEB 3QEWA 4KKOB 4DF8A 4DF4A 4KHQA 1KVBA 3HVRA 4JUZA 4AHTA 3OLAA 4FJIA 3FSIA 4PUOB 2XGQA 1RDRA 4IDKA 4EBDA 3EYZA 2WONB 4FJGA 3FRZA 4URSA 4DWIA 3K59A 1IKWA 2V4QA 4ECYA 1D9FA 3TQ1A 5C24B 4B8AB 1TL1A 1SV5A 3TAMA 3UDLA 3AA3A 3SFGA 3DOLB
chains in the Genus database with same CATH superfamily
1EQYA 4DSFA 2P9IB 4DB3A 2E5JA 4ID8A 1SJQA 2M5YA 2QRRA 2MQNA 1FKAF 3VOVA 3HT3A 3L6QA 1K6YA 3GFYA 3MOJB 3GYXB 3DLEA 3TRGA 1IBKF 1J6ZA 4KHNA 3QIPA 2HMPA 3B6BA 4X62J 2CIMA 4X64J 2X3GA 4C4WA 3GE9A 3QFUA 3H25A 2GTDA 2FJWA 4YR3A 3LP0A 2D0PA 3MEGA 5CR4A 1HMVA 4M5DA 2J9EA 4WTOB 2ZFHA 1IV0A 3ZXWA 2X1BA 2KB2A 1S22A 3UN3A 4B3RF 3EWGA 2FIUA 1RAEB 4ZTJA 1KAYA 1S1XB 2F9JA 3F73A 5JMVA 2UUBF 4RU2A 2VONA 1IR2A 2VWKA 4AQYK 4B1UB 3OLBA 3J80O 4XAKA 5E41A 1D4XA 2JHEA 1U7LA 5C25B 3IR7B 1NCLA 1O51A 3WXKA 4O0JA 5BXIA 5F8LA 3I0RB 2QM1A 3AFGA 3CPWM 1HD1A 5AQQA 3HJFA 3SSSA 4C11A 5HANA 5IT9U 1BUXA 2NYIA 3B78A 1Z05A 2FVRA 4M63C 3HX9A 2Z30B 3QFWA 5KT3A 3BYRA 4E7JA 5A6PA 1YTUA 3IG1B 3SSQA 2P9EA 2IYIA 4CLPA 4LREA 2IVOA 3MPWA 3CC4S 3KMQA 3I4HX 5AQUA 4J9OA 4RW6A 3N79A 2HWIA 1HPMA 1PGZA 2BJ8A 2ATCB 5HLFA 5D3GA 1HR0J 4OV1A 4FP9A 2VV5A 1SXLA 4CBUA 3CD0A 2Z2ZA 5KG6A 1LW0A 2VGNA 4CIEA 3ZSRA 1QVFM 4CIGA 5DMRA 1U2FA 1N34F 2GIQA 5LJ5Y 4IDKB 1H2TZ 1YWXA 1XMBA 5KT5A 2Y0SD 2DHGA 1U0SA 4ISEA 2G9OA 4L3NA 4MKYA 3H45C 2B9EA 3D2EB 3DLLQ 2YNIA 1OVYA 2BUPA 4ZIVA 2KZZA 3THYA 4B3OB 2IRYA 4HDGA 1XMQJ 2UXCK 1MROB 2A2DA 4DFMA 4W98A 2FVPA 2A0FB 4F4ZA 3WQTA 1Y0HA 3QIOA 1IBMJ 2W2MP 3HD1A 3UR3C 8ATCB 3PYDA 3M8PB 4MLHA 4LF7J 4W5QA 3JTOA 3BZQA 3C16A 4FF1A 4I9LA 3EEQA 3EVWA 4CFAA 1W7WA 4ZTFA 2M0GB 2HK3A 3UWTA 5BN9A 4OYBA 5D6GA 3M6GA 1P6TA 1Q7YO 1XR7A 3GU0A 4LF8J 1S79A 3UFCX 4IDHA 1R6YA 2IHR1 2NRTA 3RR8A 4FPAA 4NO7A 5EHHA 2IJRA 3HT0A 5KG4A 2P9SB 3PACA 4I6WA 3AJ1A 1WKLA 3CT9A 1U0HB 3EZWA 4M3RA 4JKHA 1SH3A 4Q8EA 2UUCF 2I5JB 3CJ1A 3LP1A 3H42A 2BXJA 3M1VA 3TAFA 4DV5F 1HNZF 1O1WA 1AFJA 2CQHA 4DV1K 3ATUA 2BANA 1YRXA 4C8YA 1QQCA 3AODA 4GKJJ 1PAEX 1QS4A 4PEOA 5DGAA 3QNWB 2HBYB 2O3DA 2DNRA 5KG5A 3MN7A 2YPZA 2C2DA 1RWPB 1U1MA 3TAQA 4WK3A 3QT5A 3EVOA 2QTDA 4DHYA 2LLZA 3Q8QB 1N88A 2NRHA 4GV9A 4X4OA 1Q4RA 3ISNC 6FD1A 3CJSA 4B9QA 4L3QA 5CY4A 5J2QB 2O1PA 2V8PA 1HIYA 4Z7YA 4BE2A 2LMIA 3F9KA 1T6CA 2IDEA 2V50A 1SIZA 3QRRA 5ETPA 1S1WA 3A2FA 4WF9L 2ETJA 3DRRA 4YN3B 1S0OA 3GPAA 4K4ZA 1WC5A 2DRBA 4DCJB 1GFWB 5M2RA 5KFLA 4C3MA 2E5LF 2Z1JA 4CO4A 4CFDA 1AROP 5DM7L 4PG4A 2O8CB 1JWWA 4KAIA 2KXFA 2P9NA 4K41A 1VQ8S 4BY9C 4USWA 2N82B 2VC0A 5FROA 2FC8A 4OJHA 3TSQA 2L9NA 5D4OA 2DY1A 4PG6A 1L3TA 1ZM2A 1KWMA 1N32J 2CJKA 1JXBA 4DTUA 3QATA 2ZKTA 3ICLA 3Q7CA 3SPZA 2PE8A 4Y0WA 4O0NA 3H6EA 1N5QA 2KM8B 1KFSA 1ZBSA 3ILOA 4JYAJ 3IRWP 2FBYA 1U6ZA 4ICLB 1K44A 3W2VA 4CF9A 3IRXB 1FRIA 3CERA 3CQYA 4G1QB 1T9XA 3W1YC 2MQLA 2C1EB 2UV8G 2X51A 4GO7X 3UO0A 4OZ3A 2XZWA 4DTNA 4IYQA 3PSIA 3A5MC 3L2WA 3ZZ0A 2VUGA 3DLRA 5GAHI 1OKJA 1ZBLA 1NMDA 2FHJD 1HNIA 2IPOB 5EWGA 2UVVA 2VYPA 5A2QY 2VJVA 3SBGA 4HCBA 2WVCA 2CZVC 1HBMA 5DS7A 3ET6A 4U96A 2VQFF 4J9KA 1JJHA 2B7CB 2XYHB 2V9WA 1HLUA 3N4PA 3ZO7A 1YHQS 1G7CB 1U2RA 1TK5A 3HKZD 4C8LA 2RHSB 5J2PA 3SDEB 2HFOA 4HTJA 1Q95G 4RLEA 2CAJA 4BRKA 3NGIA 4CERA 1NDKA 3SJJA 4B9VA 1ATRA 2WCXA 4BDZA 1QHAA 3M9MB 2UXBJ 5IM0A 3FBEA 2VA3A 2Z1IA 1QTMA 2NUHA 2Q43A 5DQHA 3BUZB 1U04A 5E5NA 4DR3J 3VPZA 3E01A 3DXSX 3BPDA 4P6QA 4MK8A 1W2IA 1H38A 1JQGA 5EWEA 4LFAJ 2NXJA 4O3OA 4H4KC 3L3VA 5CABA 1IG8A 1TUUA 1WTFA 1WJ9A 1WSGA 4LF9J 4QPTA 2W2OP 4YOVA 1FEHA 1QZ5A 4Y2IA 5E26A 4QYRA 3FBCA 1PJ7A 1QAIA 1CEZA 1I39A 1YIJN 1GOAA 5IQQA 4M5GA 2B0GA 2K2PA 3G6XA 4W90B 4JI4F 1U1NA 4JV5F 2CFXA 4DN0A 1NWKA 3I82A 2YHBA 1K9MT 1XTZA 4PWDB 2BZ2A 4CEOA 5B0AA 2GAGC 4IKFA 2H51B 1R0AA 2XYPB 1KFDA 2O8BB 2OEKA 2CQ0A 1ZZFA 3NL0A 2E4LA 4FKXA 4H5NA 3NLCA 2NZCA 5L1IA 3Q2TC 4K4SA 3UI3A 1WC1A 4QWDA 4FL9A 2GWJA 3UQSA 3SV3A 4K2JA 4H0YB 4OI0A 1SUQB 1S6QB 3L8BA 1R8CA 3BB5A 3TR5A 2UUAK 2A2CA 4I6MB 5HP1A 4B3MJ 3C2PA 1SPBP 4L72B 3DLGA 2R7QA 3ETMA 4QOZB 3QEVA 4OYZA 3I32A 5H1SV 2DR5A 3ILIA 3V6DA 1NJYA 5F3ZA 4K25A 2C3YA 2XZDB 3ZX2A 3CFRA 2BJ1A 3NRBA 3UVJA 2FLOA 2YNFA 3JYTB 3HOTA 1VSKA 4C8KA 5BR9A 3H5UA 1WD6A 2WB4A 3CCTA 2C2ZB 4IRKA 4NI2B 3MMBA 1NKBA 1I1GA 1YJ9N 4YOYA 1TK8A 1T7PA 2ILYA 3FZHA 1TP7A 2CJQA 4KRWA 1FD8A 1N4LA 4CEBA 3NHGA 2CA9A 2V4JB 4CF1A 4CJLA 4F0MA 2PO4A 1M90T 5SUHA 2CVEA 1YGYA 3VENA 2QWMA 1FCAA 5KFYA 3PIOQ 2AJ4A 2F8SA 4TVAB 4DUYK 4DUZK 3D6TB 4EWTA 4X65F 1HA1A 3TW0A 2A1BA 3O3LA 1CLFA 2YQ1A 1DEJA 4OPJA 3JQMA 1WSFA 1BL3A 2QA2A 3P5TL 1QSLA 3L2RA 2MLZA 3QGIA 3OYIA 5L46A 4DR4J 3B4MA 5A2QO 5GAEI 1W9HA 3SMZA 3J7YI 4KHPJ 2RUGA 1VK0A 3DOMB 3LALA 2ZWPA 4ZLNA 1RAAB 2MYFA 4CCHA 1U09A 2DNZA 5B0CA 2QWNA 1EARA 4K50A 3QT8A 1AW0A 4RNFA 2NXNA 1E4GT 1SKSA 2MZRA 3AVIA 2OTLN 3B4DA 4NX9A 5KTQA 4DFPA 3C95A 2HHTA 1IKYB 2JWNA 1QSYA 4OYOA 1RHQB 3G8SA 3CCRS 3CJ3A 3R5JB 3NH1A 1UVMA 4CD1A 2FVQA 2HHUA 3GG4A 3R2DJ 2OLWA 3AVCA 4E1NA 5KQ8A 4CI6A 5BR8K 1FJCA 1M5VC 5M1NA 4ES2A 8RUCA 4OX6A 3UCGA 3PW7A 4DPTA 5E3RA 1RE1B 2W6KA 1GT8A 1C1CB 2A1SA 1VQ5N 4ZPCA 4DX7A 3SCLE 4LBPA 2IVFB 2I0XA 2UXCF 4W5OA 3MFIA 2MKYA 2L48A 3U8XA 4O3QA 4K0KJ 2WBMA 3I55S 4OZNA 4BG8A 4PYAA 2E6LA 3LWLA 1MMLA 1VRQC 4USIA 5L8RC 1ITGA 3HVAA 1NNDA 4FLVA 3H2UB 3KMSA 3P4IA 2W2NP 2QXLA 4DFJA 3E66A 2QLJB 2DGXA 1R8PA 3C66A 3ULEA 4DTXA 3SBTA 4W92B 1T3NA 1N48A 2FSJA 4ECXA 4ED2A 3T1HK 2MSTA 1NLKL 3PYEA 5AZJB 3G25A 3CJCA 1YJTA 2RHKA 2W9BB 1NZ8A 1FXDA 2CJ9A 1BD6A 4DPOA 5IZHA 4NXNK 4CO1A 3ISZA 3M8YA 1RA6A 3THWA 1QAXA 3NGRA 5DLGA 4CLYA 3AVHA 5E3QA 1VQKS 3MXJA 3MCSA 4WTYA 3AO2A 4OPKA 2OZSA 1VSJA 3H2VE 2R7XA 4CH0S 1G15A 2RHQB 3DRPB 5KPRA 4E89A 2UV8A 2OPPB 4XTTA 3D68A 4RZRA 3I56N 1C0UA 1C0GA 2HSTA 5HOOA 1E6YA 1LAVA 4DV1F 2HB5A 2FD2A 2FHMA 3EY1A 2DNNA 2GZOA 2YWWA 3QGGA 3T5LA 4JI3J 3ZSYA 2BYCA 1C4CA 2QKKA 2P9GA 2W25A 3H20A 3KWIA 5BPNA 1D09B 3JSBA 4YEAA 3GG0A 3C6HA 1TZ0A 2B4PA 3ZSVA 4BR9A 1YXQA 5AQJA 3SQ1A 3AJ2A 3W3DA 3C94A 3WEEB 1KD1O 1GLCG 1REVA 4R8UB 1XNRK 1FD2A 1KNZA 3OYAA 4ZVFA 3KK1B 2F3JA 4UUWA 2XZTB 1S59A 3SCXA 4BVPA 4F3QA 4JV1A 1ZAXA 1VQ8N 4BRAA 4ECQA 2YKNA 3GV7B 5U47A 5F1XA 4YDUC 2A1RA 1FTCA 4CLFA 1BWFO 4OX9K 3OW2M 2DRAA 2XS2A 4CYUA 1MWKA 2GQQA 1GXTA 1Y7PA 4YB5A 4ECWA 3IBWA 3DCAA 2HVHA 2WFBA 1KS2A 2XHBA 3NDKA 3SQOP 2DKOB 4FVMA 3AO5A 1T95A 2M8HA 3TUIC 2E44A 4M5NA 2IMWP 2ASOA 4DR5K 4WKRA 3T41A 1HYSB 4DV0K 4IH7A 1RHUB 3GTYX 3M6XA 5CD4A 3FSXA 1FE0A 5IFMA 2Q31A 3NCQA 4ZVHA 1CULB 1XN9A 1ZM4A 2B8QA 1NPKA 1OY9A 3FCHA 3TU5A 2P6TA 4LBHA 1CJVB 4OZ0A 2QGFB 2R7OA 3ID8A 1HBNB 5A6WA 4LF6K 1X5PA 3C0BA 3BS9A 5ETMA 2W8KA 4C0OC 3GONA 3Q7BA 2LP4A 3CCWA 4R5PA 5HQMA 3LGMA 4JHDA 3VF6A 2OTJN 3FMBA 2ZD1B 2G13A 1RGIA 4MK9A 4OYWA 4JI0F 1GMVA 1NSKL 4UOFA 4K4YA 1VQ4S 2XHCA 1RDCA 3ZEUA 4FXDA 1BMQB 3ENHA 3RU0A 1FXLA 3GSIA 3CIPA 2LEBA 3H46O 5SWMA 4LF4K 1RHRB 2A42A 3O4NA 4DR6K 1MSWD 1KQKA 3BGLA 2YKAA 4ZMMA 4KV8B 3EN9A 3AOAA 3O80A 1HNXK 4URGA 2DHSA 3G71S 1FK9B 4WZQA 3ULDA 4A4JA 3UD5A 2X6SA 1IBLF 2OMOA 3CXCM 3PY8A 2YHWA 4FLYA 2XI3A 3P96A 4USJC 4BDYA 1HJRA 4KB1A 2RU3A 1YRUA 1P8ZA 3X1LB 4DQRA 1UAXA 2MY7A 4USVA 1RT1A 1HX1A 1RDWX 1MLAA 3D6HB 1V5VA 2BQ3A 2IJFA 2VFTA 3PW0A 4FK0A 3NMUA 2VG7B 5H9FJ 4FZVA 4TXSA 3HK2A 2YNHA 1J5OA 2AQ4A 4K59A 1VRTB 1RU1A 1WORA 2Q3PA 4NLYA 4WYWA 3I8BA 2EC2A 5ETNA 1T6DA 1WHVA 1N33K 2VFVA 1NH7A 2FB0A 1VRUA 3O9TA 3KOAA 2RN2A 2HRTA 4RUHA 2FJBB 3GIMA 3A3OB 1GLJO 4H4MA 3VQEA 3H2LA 2M8DB 2YPYA 5T7LB 2AJQA 3KHGA 4KO0B 1PILA 1RTDB 4Y2MA 3DN9A 3SXLA 3OVBA 1VC0A 5A8WA 2DCUB 4HHHA 1DJ0A 2IVMA 2FJXA 1UFLA 3TJ8A 3KLFA 2DO4A 4BRHA 4DV4K 2NNWA 3KG4A 2HFZA 2UUAF 2GX9A 4G65A 2PA3A 3OS0A 2P5GA 3MK6A 2VG5A 1JLFA 5L9XA 4QS7A 4QIEA 2CPDA 3E51A 3TARA 2VOOA 2DH9A 3OTDA 3LANA 4J9UE 3FGUA 2K3KA 2LECA 4M3UA 2DEIA 1ZBTA 3K17A 3BPSP 4CZHA 1ZA2B 3MPDA 4DU4A 3UCZP 3ULHA 3HSDA 4JKDA 3UKRB 3HFVA 3O3HA 2RF2B 4OHXA 1KR4A 2WBNA 2KFZA 4U6PA 3HHLA 4LFBK 4I7FA 2LKZA 2DNQA 4PZVA 3EGNA 3CJKA 1CJUB 1U2VA 2LXFA 2NLXA 4NA1A 5K8PA 1TQLA 1QE1A 4JK7A 2IM0A 3TVKA 2WAQD 4EIAA 4K5RA 2F63A 1VQ6S 1T9VA 4DUYF 4DUZF 4DN9A 3OA9A 4Y3CA 1NDCA 3PLAA 4LUBA 4NLTA 1X5SA 2FSNA 4AHUA 3QT7A 5J1EA 2L08A 4AHRA 3K8VA 4B1XB 1TFWA 1EB0A 1NJIT 4IG3A 3C3LA 2Q2RA 2MZTA 2NPIA 1N54B 1KVKA 2FXUA 1Q0NA 4FDFA 2LDIA 1K0VA 2BE7D 1BC6A 3G4SN 1MN7A 1WEXA 4DMNA 4JI2J 4O55A 3TI0A 4NA2A 2ZVIA 5C42B 2BACA 4YB6A 3HYFA 3K5OA 2A18A 4ZPAA 2ZBPA 1TL7B 3HP9A 3POTB 3VQSA 1AUDA 2HK2A 5DK5A 4ZPDA 2H65B 3WDOA 1S48A 3OTBA 4RX6A 3ATVA 2DEJA 3OS1A 2JOQA 4GW6A 1E3MA 2IC3A 1FJ7A 4KBIA 1HJOA 3A5OC 4HTIA 4ALZA 3DI6A 1G99A 1WHWA 2ZH7A 4M95A 3PHEA 2ZKUA 4X4QA 2YKOA 1FVQA 2IAJB 2R2UA 3WXLA 1O5JA 2ZOFA 3L3CA 1YI2N 1T9TA 1BCMA 2JEIA 3HI9A 1QVGM 2B9XA 1M5PC 4A8KA 1DQ9A 1XBWA 2DNOA 4CTAA 2JJ4D 3Q24A 5H9EJ 1R43A 4DQSA 2DXEA 1TL5A 1I94F 2WVBA 3KKSA 3QBWA 4PHTX 4LRCA 4LFCJ 1U25A 2O8EB 2W41A 4DUTA 2QLBB 1LAWA 3H98A 3F56A 2O5DA 8AT1B 2HFUA 2XMAA 3T1HF 1UAWA 3JS6A 2MPUA 3CCUS 1BA0A 2XGPA 4B8CA 3VZIA 3BDPA 2VODA 3SUNA 5A0YB 4DTMA 2VPZB 2UXDK 5CYMA 2OPSA 1UJ6A 4FPBA 1JXLA 4FLTA 3PKMA 3KLIA 2UU9F 3U4LA 5G0RA 1D5AA 9RUBA 2CXEA 4NLXA 4LRDA 3MF5A 2W9CA 4DL2A 1BIUA 3IBCB 3NAHA 1IBKJ 3DU6A 2RUSA 2QL9B 3RBEA 3DLKB 4QYZJ 3C6UA 3L7OA 4ZP6A 2IY5B 3PJXA 2DGSA 1VQNN 3QGPA 4OKKA 1KQGB 2JVRA 4B3RJ 3DHWC 2Y1IA 2ALZA 4CEZA 3FNNA 3CE8A 1SH2A 2WTUA 2DGTA 1UETA 4RW8A 1A5WA 4DZ6A 5HVFA 2UUBJ 5JJBA 4ETZA 2YWEA 5H1SQ 4F4YA 2ASPA 5DLFA 4QAGA 1RLDA 3I8DA 2HNDB 2YX7A 1Y64A 4I4BA 2FLLA 3CD6S 4B3TF 1HBOA 3AGRA 4Y34A 5IOLA 3ENQA 5AZIB 2NYHA 1X4FA 3B6PA 3LZJA 4CJPA 1VK3A 2FDNA 5HMYA 4TLRA 3ID6A 3AVNA 3OYKA 2FZKB 4BC2A 2ROPA 3CC7N 2KFNA 3QQCD 3FE1A 5BYSA 4J9QA 3V4IB 4RWWA 2OFHX 4E98A 1TKZA 1EETB 4EFHA 1JLEA 2XMKA 3R7NB 5BRHA 2OEJA 4V1Ak 1E6VB 3FQLA 1S10A 4KH4A 1EKEA 1WHXA 4GVEA 4CJ5A 4DTJA 4AM6A 2DRDA 3CDEA 1MG7A 5L38A 1MWMA 5GAEU 2VBXA 2K3IA 4TN2A 3J7YU 4NCGA 1L3KA 2V2VA 1NGIA 2O4GA 5F8HA 4FOIA 3BSCA 4ILLA 2L9WA 3KDNA 4BQLA 1KLMA 4OJ1A 2Z0GA 4I68A 3AA9A 4I1TA 2P9IA 2D1CA 4C8OA 1JJ4A 4DR1F 1CC7A 1GLBG 1GLEG 4NWBA 1RCOB 2LCWA 3KKFA 3D28A 3L4BC 2CQDA 3ZYYX 3WIUA 2XBPA 4LF6F 2B56A 3UDVA 3HHNB 3CSKA 4FK2A 2AW0A 1PC4A 4XDDA 2AEMA 1DURA 3IC1A 1RLCL 5C2DA 1X9WA 4NRTA 2ILZA 3ISND 3T5HA 2IS3A 4CRJA 1V4TA 2W2QP 4USUA 4BC3A 1RTHA 4H4OB 4JI1J 3G8TA 3M8SA 2FQQB 1FERA 3MM9B 4CFCA 5AR0A 2GJ2A 4LF4F 1BHLA 2C2RA 5IV4A 3R7BB 2VQEK 4DR6F 1FJGK 1BQNA 3AOBA 3OY9A 5FPEA 1N5SA 3S41A 4ZP7A 2CQIA 3NNHA 4NLOA 3DM2B 3IKMA 2ZE2A 1S57A 1FKOB 1T0TV 4KTWA 3OJSA 4CZKA 3ZZRA 4ED0A 3AB4B 3IP0A 3IG1A 2MKJA 4LSLB 4B1ZA 3JSRA 2EFGA 2UUCJ 3RRGA 2E9TA 4JNEA 4DV5J 2NXEA 4ID1A 1SKUB 3DWLA 3OTOK 2AF6A 1NZAA 2FTRA 2XRIA 3OYJA 3WUHA 2GV9A 2YKPA 4MFBB 1RJJA 2MDAA 1EAYC 1OO0B 4NXMK 3NS6A 3PUFA 1EP4B 4FKYA 4Y2AA 3OS2A 2YX1A 3KG1A 4P52A 2G8UA 3CJ7A 3GDQA 1YJ7A 3M30B 5HL7Q 1OH7A 3QEWA 2VL1A 2CGLA 1HQ2A 1VIOA 3OD2A 4HWIA 4DF4A 2WW4A 3TYTA 4JUZA 4AHTA 1FI4A 3OLAA 3CMAN 4EBDA 4IDKA 4UOHA 1N33F 2A40A 4FJGA 1PYSB 2H5JB 4URSA 4DWIA 4FYXB 2H54B 2OUGA 4MKVA 3TQ1A 1AUSL 1RTZA 3GR1A 2EW9A 4M63A 4BC7A 2EFQA 3D2EA 3UDLA 4V19J 1JCFA 3DOLB 2E5LJ 4UOCA 3W2WA 2QLXA 3SAFA 1M1HA 3QMQA 1MROA 3J7ZT 4PQUA 3VZHA 3S9HA 2AZ1A 2HHPA 3CCEN 4HEA9 2XG8A 4DV4F 1IR0A 2HQIA 4A46A 1QQOA 1Q8IA 3SUQA 1WOOA 4IG0A 5E7OB 3G82B 2XSJB 4C8NA 1OYDA 1RA7A 2EBEA 5JLHA 2DT9A 1S1TA 4OHZA 2FC9A 3U02A 3TQEA 1C0MA 2AWZA 2Q79A 3CGIA 3DKDA 1FNXH 1FESA 5CZ2A 5CYQB 4FJ9A 1TL3B 3Q89A 3OYBA 3FK4A 4AUKA 2CPFA 2QA4N 1UW4A 3MPYA 5HRSA 1O6XA 3NAIA 1S1UA 4CHNA 2VF3A 4CGGA 4LRBA 4LR8A 3HVTB 1TUGB 3H4DA 3M2RB 4LFBF 1WF1A 4OI4A 4DV7K 1YJNN 1S1VA 1VQ6N 2RS2A 3M9OB 3V81A 1WG4A 2NPFA 3KK7A 2RQMA 1S49A 5E33A 1RZMA 5LJVA 3J7A1 2VQFJ 2P9KB 1ITPA 4GVBB 3N5BA 2J7KA 4NPOA 3AVFA 1SCJB 2X78A 2GHPA 1HQEA 2VOPA 4JKGB 2HIQA 3O6QA 3SQGA 3RW7A 1H7WA 7AT1B 2W40A 4YOTA 3QZ8A 3MD3A 3MM5B 1J2VA 4KH5A 2ZC4A 4ED1A 1NKEA 1Y5NB 3A0IX 2CNLB 2WTFA 3EKUA 1NGGA 5LSOA 3RG6A 2HSEB 4KHMA 2DNPA 4CJEA 3OYDA 2O8CA 3SCIE 2MZSA 4OX8A 5B0DA 5KFBA 3BKFA 1GX5A 2CG4A 4WZMA 2EWHA 3JSYA 3IAS9 3WHIA 3O5BA 1WTBA 4LR9A 3DGVA 1D8ZA 2NRXA 2ZM6K 3DYAA 1UVLA 3QNNA 4LVOP 3KLGB 4JI4J 2Q6CA 4JV5J 4C9DA 4DPXA 3H8YA 1KHVA 3EVMA 3NVKA 3MMVA 1SJFA 4NCBA 2K7KA 3JSMB 4U67L 3GP9A 4WE1B 3TJ9A 1RI7A 1FRKA 1YJWS 3IRXA 1BA1A 2WVEA 2KRBA 1C0FA 1X4BA 1RBTA 3CJ4A 2MMYA 2W24A 4GKKK 1HKGA 3VQ4A 3MMJA 1TFYA 4KGVB 2UUWA 3TANA 4FOEA 4KT0C 2QT7A 2UUTA 5ETOA 5M1QA 1S77D 1JLCB 5KFJA 2YCHA 1TUVA 2DXFA 4K8XA 2FJDB 3RBXA 2CZ9A 1C0TA 1VS3A 1Z25A 1VQ7N 2H1YA 2VBZA 2GFFA 3IMXA 5I42B 4C1NK 3ADAC 3HKWA 2QWOA 2LXIA 2MHNA 4LH4A 1JLBB 4KYZA 5RUBA 1F9EB 3SDEA 3E1YA 4OVLA 3MCNA 2JFDA 3QERA 3QEXA 1S9GB 5THWA 3RYLA 4FM0A 3KLHB 3SMPA 2V67A 3CIZA 2W6LA 3PIPL 3UNYA 3MECB 2ZNZA 4DSIA 2HZCA 3CI5A 3VV2B 3H1VX 3H59A 3LL3A 1TK0A 3OYFA 4BR2A 3SQ0A 1DTQA 3C65A 4FPRA 3BF1A 4EP4A 4PAAA 3BSNA 3W5XA 3QRQA 4A57A 4RJVA 2KTQA 3HZEA 2JH3A 4PXBA 1UW9A 4X65J 1ZOTA 3LA0A 3BV8A 1G3OA 2VFUA 4NLWA 4I2QB 2JWLA 2MKSA 1RAGB 4Z4IA 2HZAA 3EX7B 3J7Z5 2ZEJA 3QZ7A 2EC0A 4B3SJ 1SZ2A 4X62K 2JNJA 4PWDA 1PYOB 1V3ZA 3LPUA 1GH8A 5EU7A 3P4UB 3JAMY 3HP6A 3ASMA 4H0VB 3ZX3A 4YQWA 1K1QA 4K43A 1B70B 2O8BA 1BU6O 2X1AA 4NEYA 4LF5F 1N5YA 2AYBA 1LWFB 4RNOA 1N5VA 2YH0A 3NE6A 3HZGA 1HNWF 3VVUA 2GC8A 4Z4CA 3VAFA 5I3UA 4K4WA 3Q8UA 4GMKA 1AB8A 1Q81O 1RKIA 3C7NA 1T9YA 1NK8A 1RDAA 3CCSS 4CHZA 3O2IA 2VWJA 3F5TA 2CPIA 4NLQA 2R8HA 4B9UA 3MTJA 4UY8O 4BR7A 4QWEA 5LMUJ 4NMXA 2U2FA 3AA5X 4J9VA 4DTPA 2ZH6A 4F8RA 2DNGA 4WU3A 4WFBL 2OMLA 3LQVA 1W97L 1D1UA 5ETQA 2UXCJ 2W1BA 3D7SB 2BMBA 1WBBA 3QSYB 5BPMA 4DSLA 3D1OA 4BHQA 4HVJA 2EHGA 3AT1B 1Y5LB 3MEKA 5LMNJ 2EKNA 4O5FA 1XC9A 4QBUA 1GTEA 3OSPA 3FZKA 3PW5A 2R2RA 4FWNA 3SQ4A 1IXKA 5FRNA 5KT6A 5G4DA 1KQSR 3P49B 4C1NI 2V4JA 2D69A 2Q0UA 3MXIA 5HRNA 1MA9B 4CT9A 3VEXA 4NLDA 1RBUA 1EKSA 3EM1A 4J2DA 4BQZA 4TSXA 4YORA 3LDQA 2Y1JA 2DFFA 3FEZA 3EXCX 4L73A 1FO1A 2VQEF 2B7BB 5KG2A 2D0AA 1FJGF 1K8KA 5JVHL 3UW1A 4IWVA 1WKJA 1UOCA 4HTUA 4X4TA 3LP2A 1VQON 4UF4A 1RGVA 3TAGA 2IDLA 2P5VA 2RIJA 3WC0A 3MM7A 3I0SB 4I0WA 1XMOK 2G8HA 4P2FA 4PABA 5JXSA 4RUCA 1RBOB 2VG6B 1DHMA 3JB9k 1IBMK 3DRYA 3I9ZA 4QZVB 3FR0A 1S76D 5K8OA 4IRDA 3QJJA 4RW9A 3NFAA 4DV1J 2P9PB 5KI6A 2E1ZA 1MU2A 4LF7K 3OTOF 1TYQB 3NKYA 1HPZA 1DQ8A 2E1RA 3MPUB 2F96A 1TUYA 4H8KA 4NXMF 1J54A 4PPDA 5A76A 1BGXT 1NHUA 2HGNA 1IKYA 2XQCA 2DNYA 3W61A 5B09A 2BOAA 4ILJA 3DOKA 4LR7A 3HLUA 1OH8A 4CJWA 2KQ2A 4FWKA 4LF8K 3IS9B 2NRZA 1NK5A 1S6PB 3BBCA 5L1JA 4ECZA 4M94A 4F4XA 2LVWA 5D0RA 3HSTB 1NB2A 5EX0A 1APSA 2ADCA 2BH1A 1HKAA 4EI2A 3ONQA 3C6TA 2C3OA 3T5KA 1IN0A 4P74A 3U27A 1NO8A 1C1CA 4X4PA 3IO1A 4WCEQ 4JI8F 4ZHRB 4MT1A 3TR8A 5L9NA 4FBUA 4P75A 2YQ0A 1VQPS 3OUYB 1YVNA 3AQOA 2L41A 5EY4A 3MR7A 4IQMA 4IEIA 2CKWA 4GKJK 2GBZA 1HKCA 5EWFA 2B5JB 2P6SA 3L2VA 1SQFA 4Z37A 1ZC6A 5LXYA 1WC6A 1M0SA 4LIWA 2FLNA 5KFPA 3MM6A 1DTTB 2XEXA 1IKVB 2LSNA 3JAMO 5A8RB 4OHWA 1Q82T 4O3NA 3KG0A 1Z2LA 4NMLA 4O4GB 5AZJA 4IFVA 2C3UA 1YJRA 3MMCB 1ULRA 3G96A 4K8RA 4NLUA 2W9BA 4PQAA 4QIVA 4CHOA 3SAHA 3WT0A 4OLAA 2FY8A 1RT6B 2MTLA 4Z4GA 3W65A 4BRFA 4GC6A 2CNKB 2KXNB 3ZNUA 4LRAA 3MEEA 4ZKAA 1ZPVA 4Y6IA 1U26A 5AQHA 2OYQA 1CLQA 5AQKA 1LEOA 3CB4A 2RKIB 3AGKA 2DBBA 3QESA 1AA1B 4Y2CA 2IVPA 2AP6A 3C15A 4JI0J 3O4QA 1N32K 3AO4A 4FF2A 3P1GA 3QBXA 2HHHF 1UL3A 3E9LA 5I4MA 4X4VA 3JQKA 2O67A 4DKWA 2VU5A 1VHIA 4ED5A 2I2YA 4JYAK 1ASVA 2DNMA 3HSGA 3W60A 1H3DA 2L3MA 2EFVA 1CPZA 2D4WA 1HW9A 4FZZA 3CG7A 1S72S 5K8NA 4KH1B 2PYLA 2ZOMA 1U1OA 5M1PA 3TUZC 4I6YA 2E8AA 3TNVA 5KRTA 3WEEA 4FF3A 5EX5A 5AQLA 3MM8B 1UWBA 4R8UA 3AARA 5M1KA 3UN5A 1KDNA 3LTOA 1IBLJ 2YXLA 1TL1B 3TAMB 2R7SA 2D5RA 4FZXC 3I4PA 1K1SA 3S6EA 3TO8A 1UVJA 2I7PA 3HHLC 1PIEA 2HYIB 4R0JA 4DSJA 4Z2XA 5FD1A 5KGWA 1SC4B 1Q16B 2RT3A 3KNAA 2ZM6F 3Q8PB 2ASYA 3AOCA 2E7VA 3MAHA 4W5RA 3NS7B 1RTJB 3MMAB 1JLGA 3QIPB 2HMIA 3G87A 5FPDA 1HYSA 4LSNA 3EGZA 1KLNA 3OYHA 3LP0B 3CJ5A 3PX4A 5ADXA 4AL7A 2NXCA 4ZPTR 1WSIA 5HVGA 2C2OB 4O8KA 1FRLA 4M5DB 4DR3K 3HTVA 4CLLA 2HFNA 3WZ0A 4FJMA 1RADB 3CD5A 1VAZA 2XLJA 1CJVA 5KFSA 4EHTA 4MMOA 4LFAK 2WBRA 1UWAA 3EE3A 1LFWA 4IOXA 3WIVA 2DR9A 2KW4A 1LK5A 4LF9K 1PKUA 2NZTA 2CPZA 2ASDA 2C22A 2XY5A 2IBKA 2ZD1A 1RP5A 2VKZG 4CJ3A 4M3XA 4HI2A 3LO3A 2BJEA 4PR6A 4C11B 1VQMN 3DDKA 2RMLA 4IOAQ 2QI2A 5DG8A 1BHNA 3OR1A 1PCAA 5L1KA 3KDOA 2OGUA 2APOA 4B9NA 2OH2A 3OT9A 2PIIA 2X6NA 2ZBRA 3QFPA 1VQSA 2V51B 2J4RA 4EYIB 1KVIA 4Y00A 4EK2A 3CQXA 4O3SA 3JXOA 2VA2A 3QWPA 1X4EA 4RW6B 4F4AA 5AQWA 3KYLA 2LEAA 4M3WA 1L3SA 1WF0A 2W7AA 4MQ3A 3U9ZA 1R8BA 3T9NA 4LH5A 1N52B 4ZOSA 2U1AA 2VDIA 1ICEB 3NGYA 5AT1B 2KHOA 2HHVA 1LW0B 2GJIA 2HS4A 5LOQA 2F40A 3NGUA 1ASUA 1KQFB 4BGAA 5KAKA 1W26A 2M9KA 2ALYB 4GV6A 2PD1A 4CO3A 4EHUA 3BZKA 1V3SA 2F4VK 2QTWA 4B3MK 4RNNA 5AQZA 3A8YA 4KGKA 4CGHA 3CYMA 2KDOA 4EZ6A 3ZT3A 4MO5A 3H3OB 4DUZJ 1EX4A 3E9OA 4P7TA 2EVZA 2PMHA 4OV6A 3MX5A 5DM6Q 4KB0A 4H5TA 2YNIB 4N41A 3HFZB 4NCAA 1S6UA 4Q5VA 3DGPA 3R2CJ 3O8WA 3THYB 2CUYA 5KT2A 4K4TA 3B82A 4C7QA 5GAGP 2G0JA 1W7AA 5FLXY 2VBYA 2XO7A 1KC8T 2FUG9 3QSIA 3FRYA 3GZ7A 3JTNA 2CNNB 2CQBA 3LF0A 4Q2LA 3CO0P 4HUEA 3K5NA 1FDDA 5HROB 4CLZA 3UKUA 4W5NA 2F8EX 2FHKA 3U3YA 1FNOA 5JUMA 4GY2B 4O0IA 3KWGA 5FIIA 3UE2A 1ZPWX 5T7LA 2ZJRQ 5JS2A 4KO0A 5KFTA 1RTDA 1SI9A 1JJCB 3M7VA 4U67Q 1K9MO 2J0QD 1YT3A 4Q7AA 2D1KA 2E1MC 1GMWA 3IGNA 3THXB 5KFQA 3G10A 5DDPC 3LOUA 4KIAA 3A13A 3LGHA 2CJXB 1RAHB 1NJXA 3UN2A 1JCGA 2V68A 5KT4A 2BR0A 2QWLA 4JN4A 5JS1A 4M3TA 3ZZPA 2DB1A 3P5JA 4CZFA 5GMKa 4DR4K 1FDNA 5I3PA 3IBFB 2YJFA 4KSEB 4EZ9A 3RMDA 3VA0A 2QSWA 1SVDA 4KHPK 2D3O1 3LP1B 4QWCA 3M1VB 1OQ3A 4LSZB 3I5CA 4FJKA 1EZZB 3QO9A 2ZJPL 4X4RA 1M5HA 1NU4A 2HHWA 2BANB 4QIWD 4KFBB 2V63A 3EGVA 1I94J 5AE2A 4DL6A 2HHSA 4N56A 3MWTA 3LWMA 3KK3A 4X4UA 4CVNE 2C42A 5D8HB 4BWJA 2J6TA 1RT3A 3VTHA 2CPYA 5AFUA 2HEKA 2AYGA 2WVDA 5DQIA 4ILMA 3IA0A 3T1YK 2BJ3A 1S1WB 1S9EA 4F2RA 3CCJS 3J81U 2KN4A 1X0FA 2UU9J 3BEXA 2IDOA 4TU8A 4BRPA 3CJ8A 1Q7LB 3GOIA 4MDAA 4PY5A 4H0PA 3PVXA 4IO9L 1M90O 3VMFB 2M88A 2P9NB 1K8AT 1V4SA 3NXZA 4K0KK 4OYAA 4EBEA 2ADBA 4BVOA 1XMOF 3DXBA 2YHAA 4F4KA 3M8QA 2NRWA 3VWSA 4FVCA 3L0QA 2OCEA 2B6AB 3KJNB 3V4MA 2CGKA 3D2FB 4BREA 2CGJA 2JLGA 2LQJA 2UVUA 3RBDA 1X0PA 3R97A 1NGHA 2DISA 4IR9A 4PL8A 2KJVA 4FWSA 2XB2D 3CMEN 4HH1A 4TYAA 3HXMA 2DYAA 4PXEA 1TMMA 1QZ6A 4JV0A 2RB7A 1YZ7A 1UA1A 4QU6A 1SJRA 4B3TJ 3RSEA 5ADXH 1TAQA 3CDWA 4NL5A 1VSFA 4DU3A 1RAIB 1NK9A 4CLSA 1OH5A 4RR5A 4G9ZA 4XK8C 2WRMA 1R8HA 5KFAA 1H6KX 1V5IB 2MQMA 5KFOA 3OYEA 3G6EN 3CF5Q 1HNIB 3RJMB 1NB7A 1JX4A 4J9LA 2NS1B 2GIFA 1N36J 1GK8A 3DHXA 5J2MB 3LUYA 4HHUA 2BVZA 3R3TA 2XI2A 4OZ2A 3BGUA 4GKJF 3RB3A 4JI3K 5J1NA 2FBVA 1MWYA 2HGMA 1WUAA 3HPHA 5FLXO 2O8DB 4ANCA 1LW2A 5C2CA 4OHVA 5HI7A 2CPEA 4NYZA 3R5AA 3OSNA 5LT5A 5F2RA 2XMJA 5IM0B 4CM2A 4HH0A 1WELA 3GQCA 1CG2A 5EUHA 5A0YA 4CECA 3E01B 4DR1J 5DG9A 3FVYA 1Q79A 4XIUA 2AX1A 4FJNA 3HCXA 2ERRA 5IT9Y 3OYMA 2YWHA 2RQCA 4YOWA 3QAUA 2QWRA 4WFNL 3N4QA 1ZBIA 3QINA 4CJRA 4N47A 3CCQS 3C19A 1A7GE 3U7JA 1BDGA 5JVHQ 4NLCA 3SV4A 1RWXB 2OPQB 3KHYA 3R27A 2Z1GA 3BO2A 4ECTA 2AEJA 3UR0A 1WDTA 4AYBD 2WW8A 1J53A 5GIPA 3V9UA 4JYAF 1PJ5A 4ZDNA 4RBTA 3VQTA 1BCOA 3GWCA 4C0HA 2DTUA 1NDPA 5B8HA 1R0AB 1I3AA 4LF4J 2HNDA 3DXMA 3W9HA 2A5XA 4KTZA 4CWBA 2BABA 4DR6J 3R1XA 2IMOA 5HQLA 3W0LA 3RB0A 1FW6A 5AZIA 5ETTA 1KHWA 2C28A 3F2KA 5C5JA 2P8IA 4MYUA 1S4EA 3K2PA 3PFOA 4C48A 4WWSA 1RT2B 1SJ3P 1QJHA 1UP1A 3CDUA 1KOHA 3WNGA 1KXPA 2OP5A 3AVLA 1GMUA 2CWXA 2OANA 3V4IA 5ITHA 4FWRA 1TVRA 4F3OA 2OELA 4K8ZA 2IFXA 3DLGB 3O5TB 3CEDA 5C12A 3M2VA 4Y65A 1E6VA 1X4HA 3ENVA 2E1YA 4LF2A 3V6DB 4JI6F 4ZVGA 4ZA1A 1ZA1B 4FWLA 4Z4HA 3P31A 1RDDA 5DG7A 2Y3YA 1YVFA 3OHBA 3UVJB 1E4FT 1FF2A 2ZH1A 1UPMB 1HUXA 2HNYA 2IM2A 2PZSA 3SUOA 2W01A 5JICA 1ZBFA 1OH6A 2HS0A 3P5BP 1RB0A 4XH5A 4ZCIA 3W9JA 1N33J 1IR1A 1SKRA 4EBCA 3NP5A 1OY8A 1C2PA 3ZT0A 4FJ8A 3MMBB 2JDJA 2G8IA 3BF4A 4LY7A 3D1QA 3TAEA 3S1TA 5HBMA 3G9CA 2ZH3A 1SJ1A 3S3OA 3S8SA 4IBNA 2CWKA 4YY3F 2M3DA 2QLWA 4DV4J 5K14B 2GNKA 2LQ8A 3GCXP 5FJ4A 3BR8A 4BRMA 1ATNA 1NGFA 5H9FK 3A8JA 2QLFB 4CK3A 4J37A 3R6LB 1F9HA 4DV3J 1QUVA 4MLEA 3AO3A 4JB8B 3NWRA 1CBKA 3F44A 4LRFA 4UUXA 3Q22A 4H4OA 2HBKA 2MGZB 2DHHA 4HR2A 1DLOA 3WX8A 4FXWA 2JRSA 1XHZA 2GHVC 4PYDA 1VQLN 2E7WA 2RILA 2RVJA 3QYYA 3SJHA 3G8QA 2KM8C 2QMWA 2GO9A 3MR2A 1FRJA 2K1RB 3TOQA 1HWUA 4M3ZA 3CDBA 1RQ0A 4OLOA 2H5IB 4IR1A 3H40A 4HCCA 5ETVA 1YBUA 1UEUA 2XO6A 2WK4A 1PBAA 1X31C 2YI1A 2EFPA 4EP5A 2AA4A 1X5TA 2F4VF 3RMCA 2E9RX 3IXQA 5LSRA 4WBFA 4B3MF 3OR2A 4G1IA 1NSQA 4ED6A 1GOCA 1CJTA 1WOPA 1HHQA 4CH7A 4M7XA 3TA2A 5IT9O 4QPXA 4PCQA 3KFWX 2PN6A 4DXLA 1KCFA 4MFBA 3ZTPA 5LSLA 1EP4A 2H3EB 2R7UA 2V34A 1HI0P 2YHYA 2AJ2A 2LDYA 4Y1CA 1Y3JA 2GQCA 2BUNA 3W3SA 5F8JA 3ZETB 2E2NA 2G8WA 4FW2A 1SC6A 2GW8A 2FF3B 2W42A 3SUPA 3NH2A 1FJEB 2DO0A 3PM9A 5CHCB 4KREA 2ZUGA 1NM2A 1YRTA 3E8OA 1H74A 1VQ9S 4Y1DA 3CCVS 4B1WB 2C3MA 3U1LA 3FZBA 3ULEB 1QTNB 1Q5VA 1RILA 2X74A 3RBZA 5DZ7A 3IUCA 4TKTA 1R0BG 4CGIA 2FC0A 1VOMA 1F3FA 2W7OA 5D4PA 4RTFD 3AVBA 4P2XA 2HQGA 3PRDA 3QRPA 4PXDA 4DX6A 4FNIA 3H5XA 1TKDA 4CK2A 1Q9XA 4FYDA 3GFXA 4BDPA 4QCLA 2QEXN 1BLUA 3JXUA 3NEKA 3N5FA 2XSJA 1DRZA 4IRCA 5DQGA 4RUBA 3B54A 3CC2S 2BX6A 4J91A 4NYFA 4IXCA 3ZZOA 3CJ2A 1C0UB 3BF3A 2PYJA 4PG5A 4WQ4C 2QA1A 1F2GA 1HARA 1E6YB 2B4UA 1F5CA 1SC1B 4CJVA 4JI2K 3HSJA 1BI4B 2DNHA 5AQSA 1HNVA 2RQKA 4KI6A 3B6OA 4ED3A 4HACA 3FSYA 4G1PA 3HVTA 3M2RA 1N0VC 5HSPA 1LFPA 2KO1A 1D0EA 3VAHA 5IV3A 2D0OA 3AAWB 2O01C 1T03B 4K5SA 1NRKA 2FHOB 4JI7F 3GG1A 1VHFA 3CCJN 4CHPA 3VA3A 4CGFA 5AQMA 2Z57B 4MIBA 2G8KA 3T1YF 1REVB 1K47A 1GLAG 5IQ6A 3CCLS 1RDBA 2XULA 3ZZZA 1S97A 4ZCLA 5HMZA 2A3ZA 4J7CA 3E9PA 2GEMA 2CJAA 5A8KA 1G6BA 4DX5A 4EFAC 5CZ1A 4K4VA 3VQCA 2YKNB 1BISA 4CZEA 2KU7A 2YNGB 3K58A 1ZYQA 2GGPA 1M5KC 5GIOA 4K0KF 1W2BR 5IWAF 5H9EK 3OQ2A 4CYUB 4H0OA 4P10A 4I67A 4BG9A 1N8RT 2BM0A 2JSXA 1ZXOA 1YUWA 4LFCK 4DF8A 1WKKA 2XS7A 3TUPA 1KVBA 4FJIA 4HT7A 2FJEB 2KH9A 4ZK7M 3FSIA 4PUOB 3EYZA 1NJIO 3R6MA 4OZ5A 1RABB 1WUUA 4C3KA 3RZAA 4D3GA 2IRUA 1IKWA 2YY3A 1JK9B 1RWNB 5C24B 2VASA 2VPXB 5GVQA 5BRDA 2I6WA 2MJNA 5AQXA 2O4IA 5JMNA 4G6VB 1D8YA 3MAQA 1Y97A 1NEEA 1RDUA 5ETKA 4JLHA 1A6LA 1ESVA 3IDHA 4M5HA 2F8HA 4DI6A 4R79A 1OSDA 4FJXA 2N4DA 1DQAA 1B4SA 4QYZK 1JLQA 4Q0BA 2Z8QA 3JSMA 4AE5A 4WE1A 1FWLA 4ZPBA 1NSAA 1CZAN 3GJQB 3NBPB 3BKTA 4LF5J 2ZH2A 4E19A 1HI8A 1OWXA 4CESA 3QETA 3MD1A 1UJ4A 1HNWJ 2UUBK 5B0FA 1T8EA 5EXWA 2W4PA 1Q1KA 4KH0B 3D0HE 4WU2A 1FXXA 2ZJPQ 4FW1A 2VB6A 3HM9A 3MCOA 2R8JA 1X3MA 4K7QA 1YJVA 4CT8A 3V1QA 1NOYA 1P9QC 4FWOA 3PW4A 5I42A 4Q8FA 4JI5K 4DU7A 2DH8A 4AQYF 5CCMA 2E2OA 3TVYA 1Q18A 4KTQA 2DFHA 2F7VA 1UZDA 2D41A 1SKWA 1JLBA 3IGVA 2R8KA 3RW6A 2I1RA 2K06A 4KHSA 4K42A 4DCOB 1S9GA 3AY0A 1RT1B 2VJUA 1ELOA 4DSEA 4CJTA 2KT2A 4NYPA 3MECA 1S5JA 1IO2A 1VI7A 2AYEA 1WEYA 4ATNA 3CC4N 2YNHB 1J5OB 5HRRA 2BTFA 3KD5E 2OZMA 1GX6A 3LM9A 3CMQA 2X1GA 4A8YA 4ID5A 1JXVA 4J2AA 2R7TA 2R42A 4FWQA 1WSEA 4LQ3A 1VRUB 1YF5L 1S0MA 3WC2A 2V6AA 3DRSA 3RTVA 4CIFA 4YNQA 2VQEJ 1KP6A 2G1DA 1MWQA 5D15A 1FJGJ 5EDWA 4LMZA 4I2QA 4PXCA 4FK4A 5AJ3K 1TUWA 1I6JA 4RPFA 4IEEA 3HPOA 4FLZA 4LIRA 1NLVA 1F5BA 5A8WB 2LU2A 4I64A 3VEYA 3PJWA 1CS4A 1CVJA 2J8AA 1XR5A 2MJUA 2QG9B 3TZZA 3WNFA 3O44A 4FS2A 5F8NA 4KHRA 2LXUA 4LF1A 1V9OA 4RW4A 2VG5B 1CJKA 1JLFB 4BE1A 3IFEA 2W4DA 4ECRA 4OI1A 3SBMA 4KGXB 5GAGI 4NXMJ 2WOMA 1QQNA 2IYGA 4KB7A 4JI1K 2KYZA 3BREA 4AXIA 1RT5B 2COLA 3VEOA 4A62A 3TTFA 3BGFA 4DV2J 1N56A 4CJSA 1DT9A 4WFAL 3PYGA 3LDOA 3P39A 4U7UD 2CJYB 3SI8A 4N77A 2AIRB 2ZC3A 2A10A 2MKKA 4QS9A 5KRSA 4DG1A 5KG3A 5IC4B 4I2PB 2KHCA 2I38A 1JL1A 3HHLB 2F9WA 4I7FB 5EVZA 1U2VB 3GIKA 2R7RA 5F9LA 1WNSA 4JK9A 5K20B 3GBTA 1QE1B 4C2MA 3W8GA 1OPZA 4ISGA 4JI8J 3W62A 3QLHA 2HBZB 3CVKA 2GMHA 4A2AA 4ES3A 2HKEA 1L3VA 1UJ5A 1YDLA 4BE0A 2PY5A 3MEDA 4FXVA 2DNKA 2PFUA 4CLWA 4CF8A 4NLRA 1CC8A 3O9SA 5J1EB 4MH8A 3O4WA 1RT7A 3OV7A 2RD5C 3QWUA 4BR0A 4WFNQ 4QIGA 4IG3B 4DL3A 2J7UA 4O23A 4ILHA 3PXGa 2V2KA 3U6FA 2HAIA 4RWTA 4DV6J 1V6HA 2JC1A 2L9DA 1IQZA 3ZSQA 1CQNA 2R2SA 1URNA 1EKRA 1VK8A 3J8AA 4BACA 3MURP 1BWEA 2MQPA 4FSVA 5BYRA 1HL6A 4A8MP 2HNZB 3HHLD 1NMNA 2JX2A 2P1JA 1T44A 2W7PA 1X7VA 3D1HA 3CWJA 2DHXA 3OL9A 2ROEA 2V8HA 4CBWA 3L4QA 4U9RA 3OVAA 3I0SA 1CXUA 1ZBUA 1WAJA 4KI4A 2M70A 4OYPA 2V2QA 2PMZD 3Q0AA 1ZETA 1TGOA 2ASMA 1HHTP 2IC3B 1B9FA 5M2PA 2OO4A 2GAHC 2EG2A 2GV1A 2HHHJ 3DI6B 1BE4A 3OYGA 1HD0A 2HFVA 4ANDA 2CQ3A 1FKPB 3K7RA 1REGX 1QAYA 2IM1A 4CZIA 4ZLJA 1VSMA 1YX2A 3O8MA 2YBVA 4PWUA 4XPEA 2WUSA 3SK3A 4CTAB 3BSAA 5CXTA 2HW3A 3GILA 3IS9A 1S6PA 2VCPA 1JKHB 2Q1LA 4P7VA 3PEHA 3M2UB 4KC5A 3J80U 1QSSA 1GXLA 3QDKA 4LC9B 3ZZTA 4P9SA 3CUNA 4C0BA 1RBLA 5HJYA 3N0VA 4CO0A 2HVEA 2ZDOA 1VIXA 3UPFA 2HBRB 3W64A 3MR3A 4ZHRA 3ENAA 3VTIA 3JTPA 2DR6A 4WIIA 4DSKA 3MN5A 2BM1A 2VQFK 3PKYA 3UB5A 3ILJA 2B9WA 1NUEA 1QD1A 2OPSB 4ZIWA 1RAJA 1NK0A 3KLIB 5KG7A 5G0RB 1J5EJ 2JWKA 1Y5IB 2BE2B 4CM0A 2W9CB 3CHWA 2CQ4A 2QSFA 1QUPA 4U95A 3VETA 3V9ZA 3MOZA 3C14A 4E8UA 3HBTA 3C6UB 3J7ZO 1YHQN 4ZN3A 3NG8A 1PSDA 1O0PA 4JEPA 1NSPA 3I33A 1HWLA 3KJQB 3VQ6A 3PIOL 2EI5A 3BR9A 4PWWA 2M52A 1X9JA 3O1LA 2UP1A 3RMAA 3C6AA 4JI2F 1XHXA 1RTIB 3TABA 4XH1A 1IUJA 5D0EA 2J0SD 1Y4ZB 4ECUA 4DPUA 4RNMA 5KQDA 4RW8B 3D0GE 1ASWA 4QU7A 4JKBA 2EK1A 4QR2A 2NSCA 4B1VA 1SIWB 1XNQK 5KGXA 3KK2A 2RRBA 3Q23A 4DLGA 5I3QA 2AX0A 5ELZA 4ILRA 2CPJA 4B08A 3NCRA 2KG0A 1HBOB 3J7AP 4AF1A 2KI2A 2X3DA 2AU0A 4DBQA 1FX4A 1X5OA 2YKMA 1BQMB 2E7XA 4CEDA 4JI4K 3M1FA 2R7WA 2EPIA 4BLGA 4JV5K 1YIJS 3GCWP 5F8MA 3D5MA 3EKSA 4FPIA 5K9FA 4OMFG 2P9LB 4WF9Q 4CJ4A 2BQRA 5AXMA 1WN7A 2Q1NA 4JD2A 1A0OB 1TKZB 7FDRA 3MGJA 3AVKA 4DLEA 3O1BA 3M8ZA 4F36A 4UTGA 1F9FA 4AD6A 5E2QA 5KFXA 2KHDA 5DM7Q 3HRGA 1NJWA 3MXMA 2HFSA 1SQKA 1FWPA 4CJUA 4ANEA 2Q97A 4CLUA 1TMJA 2GHWA 4NOHA 1AT1B 1RWUA 5ETLA 4M1KA 3K0JA 3SQ2A 4NCGB 2B8PA 5JLFA 2KT3A 2CDQA 3H7HB 4PRFA 1L3UA 3EE8A 5BREA 2KZMA 3BH6B 2MKIA 2OSQA 1KLMB 3SEOA 2E9ZA 2D0BA 3FCVA 2GJFA 4LD0A 4YOXA 2LQBA 1WG1A 4WYLA 1PC5A 3LGNA 1SC3B 2BW2A 2EWSA 1ZZNA 3D6RA 1JLAA 4ZJQA 4JKAA 2YVSA 1Y9OA 1HWJA 5FDLA 1RTJA 3MMAA 3OXGA 3BZCA 1X9SA 4CLTA 4J8FA 5LJ3Y 1ACMB 2NXUA 4ETXA 4HUGA 3LAKA 2MLXA 2XMWA 4RBVA 2Z2YB 1F2HA 3FFIA 3L7UA 2XNRA 3PTWA 5HMXA 4IH5A 1YJ9S 5T7BA 2K7JA 2FPHX 3CCZA 2E1PA 3F0NA 1RTHB 3H08A 1WAFA 2N4CA 1Q86T 1GTHA 1LNQA 4UZBA 3P45B 3V9SA 4BRCA 2ACMA 2A3JA 4X65K 3S3MA 1BQNB 2E20A 3GYGA 3R7SB 1T05A 4FJ7A 1IJEB 2G8VA 3CTRA 3DMJA 3I5AA 1H73A 2ZE2B 1S99A 4JI5F 4B3SK 4YS2A 3EZUA 4WXWA 2A6OA 1QY7A 4RL1A 3IR5B 2ZH4A 1S7IA 4O4RA 4IFYA 4M5IA 5KPTA 3IAM9 2ZF5O 3PR4A 3OYLA 1SL0A 3M32B 5IC6B 2P2CB 3UDEA 2OPRA 1PO6A 4NLPA 3Q2SC 3CJTA 3HDSA 2XCAA 4H0TB 4X2BA 2MHEA 1JMTA 4ZVPB 1JIHA 1LKZA 1OSCA 4I56A 2OTLS 3T3FA 4Z0UA 1BIZA 4HI1A 3HI0A 1DY3A 1RFQA 2B4VA 6AT1B 4PKHA 1HQUA 3CCRN 2DGUA 4X84A 4TQRA 3A8IA 3RMBA 5LMUK 2QN6B 3R6GB 4WQ5C 1NK4A 1YITS 4CHQA 2OD4A 3D6FB 3PYFA 2DPNA 1MDUB 3VEVA 5AJ3F 4DR7K 2RNEA 3W2WB 1NBEB 4EUVA 5CD4H 1VJQA 1VQ5S 4RO0A 2MQOA 5BR8F 2O8FA 5AQRA 4PQUB 3CPWR 4UQGA 1XMOJ 3GFZA 1G2EA 1XWLA 4YUDA 5LMNK 4IG0B 4KAZA 3V6JA 5HROA 1UEKA 4QS8A 2IIRA 3G2XA 1U6FA 1RT4B 1S1TB 3FEYB 3E2EA 3I55N 3D45A 4ILGB 2QYGA 4X66K 1KN6A 5AQYA 3MCMA 5B7WA 4JI1F 1SH0A 4KBOA 2HLTA 2CZ4A 5F8GA 3GV5B 3THTA 3VEZA 3Q8RB 3MZIA 1T3OA 3THXA 3ZT2A 1U1LA 3ZX0A 1AZSA 3RB6A 3K57A 1OPIA 3HULA 4Y28C 1S1UB 3AHPA 3ZTOA 4FJJA 3M4XA 2VBWA 1QVFR 2HGLA 3L2UA 3GL1A 1RWOB 1S12A 2MKHA 3I6PA 3R1LA 2N3LA 1S1VB 5HATA 1VDHA 2GQ2A 2VWBA 1VQKN 3V81B 1KBRA 3KHRA 4NXNF 4OHYA 4FJHA 2KKHA 3I56S 4V19S 3H0PA 2E66A 2YHXA 5J1PA 4DQIA 4R0EA 2GO8A 4WFYA 4KFBA 1C6VA 2OSRA 3SLCA 2ZBIA 4L74A 3T6BA 4CF2A 1WHYA 3KKRA 4USKA 3HZ6A 1HQEB 3SQGB 2E5HA 1IWAA 4UY85 5DDOC 3RAQA 4ERDA 1I3OB 4AL5A 3ENOA 3V6HA 3CM5A 5KFKA 1S5ZA 3DLJA 3PW2A 3R5CA 4C8ZA 1U4BA 3AJDA 3NF9A 4HHTA 3A8EA 3I9V9 4OLPA 5ADZA 1KAZA 1VFJA 1F5AA 1UCNA 4N76A 1X8DA 3R3LA 4YOEA 2C2MB 1HWKA 1UZHA 2ZHBA 4ZPWR 3QEIA 1K73T 2CQCA 2C2KB 2FZCB 2EG1A 1LWEB 1XNRF 4NZ0A 4MJKA 3MDQA 1TKTB 5FPMA 5KG0A 4KHWA 3HHKA 3DYAB 2HHXA 4ZVSB 2B6AA 1Y11A 4Z7CA 1RCXB 1EJ7L 3D2FA 4OI3A 2WB1D 1QAJA 1LWCB 1RAFB 3KJVB 7FD1A 3KLEA 2GVDA 4KKOA 4OX9F 1S9FA 1GLFO 1QQMA 2ZQBA 1G4CA 4GC7A 1EIYB 3KUGA 4HTLA 3HFKA 2WONA 2DGOA 1YG0A 2GVZA 1FFWB 2YH1A 1R59O 1GOBA 2B51A 4FF4A