3V81A

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and the nonnucleoside inhibitor nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v81A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v81A05
1ITGA 2XRIA 1RT2B 4YP3A 2Y1JA 2I1RA 3WNEA 4PQUB 4MKBA 4FYDA 4KO0B 3H59A 1L3UA 3IG1B 3HO1A 3D5MA 2IM3A 3OYEA 3SPYA 3MECA 5J2NA 4Q5VA 1RT4B 4NLWA 4I2QA 3G6XA 4K4XA 2RDJA 3AO2A 1IKYA 5KFRA 3CQ8A 2DPJA 1JX4A 2OZSA 2FJXA 4DFMA 2G8FA 2GIRA 1RT1B 2WOMA 3G86A 1EP4B 1KVAA 4XIUA 2FLNA 3ZSZA 3HP6A 2F8SA 4YR3A 3AVKA 3IAYA 4CJWA 2DFFA 3HP9A 4WZQA 4KB0A 4FJNA 5C25B 1SUQA 2FC0A 4DS4A 5KRSA 4R0EA 5KFXA 4FS1A 4FW2A 1CLQA 4PUOA 1TKXB 3KLIA 4IKAA 5KFMA 5KFNA 5KT5A 2C2DA 3PZPA 4B9LA 1FKOA 4ED8A 5L1IA 4J9OA 1HMVA 4W5OA 1JLAB 1U04A 1S9EB 2FJWA 2EC0A 4FW1A 5KG6A 3DLKA 2R8HA 3OYNA 4KI6A 2XWYA 4FJMA 3F9KA 5KFHA 2R8IA 3LWLA 4IFVA 1KVCA 4JUZA 3NMAA 3AVJA 3M8QA 1WSGA 3IGVA 3LPUA 1J5OB 1JLGB 1NHUA 1X9MA 2YNFB 4JS5A 3H08A 1LW2A 1WAJA 1GOAA 3AVLA 4Z4EA 2IC3A 3C6TB 1T05A 3OS0A 5JS1A 4AHVA 4DLGA 4CJ3A 2YKMB 4K4SA 3LP2A 4M3ZA 2D3ZA 3P5JA 3SUPA 1IKVB 5J2PB 3RAQA 4LQ3A 2XCPA 1S4FA 5DGBA 4J9MA 1HQUB 3AA2A 4AHTA 1RTIB 5CZ2A 1XWLA 3ZSOA 4ZPCA 3OL7A 3V9ZA 4FLWA 3CJ5A 5SZTA 3NKYA 1NJZA 3UPFA 4DQSA 3I5CA 4EYHB 1BIUA 3AA4A 4B3OA 1TKZA 4JV2A 3KJVA 3RR7A 3AO5A 4FK4A 1NOZA 3DOKB 3HVWA 5FRNA 2JGUA 3LP0A 3ZSVA 5HROB 3HVRA 1KRPA 3ZT4A 5CYMB 3CFOA 2G8WA 1L3VA 2RKIB 4Q43A 1CSJA 3HL8A 3S9HA 4FXDA 1WSFA 5KFKA 1BIZA 3GQCA 1TL3A 2B4JA 3VQPA 3LP1B 5FDLA 3V9SA 4O3PA 4WYLA 3PX4A 4MIAA 3TAPA 3UQSA 4QWEA 4O55A 4DFPA 4IR1A 4RUAA 4FBTA 2X6NA 4I7FA 1RDDA 3PW7A 3C94A 3NHGA 4B9NA 5EWEA 1S97A 4N76A 4O4RA 5DK5A 1Z4UA 1QSLA 3OHBA 3HYFA 1WAFA 2OZMA 3ZSQA 2E9RX 2JLEA 1RBTA 2IOCA 4URGA 3TR8A 1RT3B 1KHWA 4EO8A 3MEGB 5CY4A 1TKTB 1FK9B 3CIZA 5KT6A 4RW6B 4W5TA 5F9NA 2IBKA 4M3UA 3I0SB 3KHGA 1NKBA 1S5JA 1CXUA 5KFLA 3ZSXA 4YNQA 4M42A 1S9FA 3PO4A 3LAMA 3QEVA 4JRQA 5KFYA 1YTUA 3D0PA 3SPZA 4O4GB 1RBVA 4ED3A 3TAGA 3MR6A 4ZP7A 3SCXA 3TABA 1HNVB 2HHSA 4LD0A 2RN2A 4PA1A 3HPGA 3JSMB 3ULDA 1UWBA 2VG6A 4DSLA 2YNHA 4J9KA 3QEWA 4XPCA 3RR8A 3QZ7A 4IOBA 3O4NA 4RW4A 3AVCA 3HXMA 4CFCA 4LSLA 2BE2A 5KT7A 3KK2B 3ITHB 3KK3B 4EBCA 2HNDA 1RYSA 2I5JA 4FLUA 2E9ZA 4FM2A 4DTOA 2OPQB 4NCBA 4DL4A 4CIGA 4KHSA 3RMAA 4ECXA 1SV5A 3DLEA 1KFSA 4Q0BA 1S6QB 2ATQA 2P5OA 3HK2A 3RTVA 4ZTFA 4Z4IA 5L1LA 2C22A 4TQSA 4BE1A 3ASMA 5KFZA 1C1CA 4GC7A 4DTMA 4KHYA 1T03B 3OL8A 3QIPB 3JYTA 4H54A 3RRGA 2JEGA 3OS1A 4OKEA 5HP1A 2C28A 2V9WA 3QEPA 2R2UA 4MQ3A 2W7PA 4B9MA 3UR0A 3B6OA 3DLGA 3NDKA 4CEAA 4YR0A 4F4XA 4DSFA 1ZTWA 1NNDA 4FK0A 1D1UA 4IG3A 1JLCB 5F8JA 3VQQA 1WSEA 3OJUA 5KFUA 3PR4A 1S48A 1ZBFA 1CZ9A 1RTJB 2KW4A 2R8JA 4OGCA 3V81A 4PWDA 2LSNA 3GIKA 4HHTA 3THVA 5C42A 1HNIA 1LAWA 3T5JA 2BRLA 2HAIA 1RTDB 3DLHA 1RTHB 5KTQA 4Q8EA 4CJTA 3AVMA 4K4WA 1RILA 2XI2A 3KLHA 3NAIA 4OPJA 1UA0A 3KKSA 1SL2A 3Q8SB 4NYFA 1FXXA 2HVIA 1N6QA 3OJSA 5KFOA 1TVRB 3SYZA 1JLQA 2QK9A 1CZBA 5EWGA 3L2WA 1C0UA 1L3SA 3PUFA 2W8LA 5J1EB 3QLHB 3KLGB 4ZP6A 3BQ1A 4DQIA 3OYHA 4JLHA 1TL1B 2A1RA 4BE2A 1N56A 4E7HA 4K8XA 4CFAA 4N47A 3CYMA 3KTQA 3V1QA 2OPPA 4NLDA 3NAEA 4RNNA 4Y1CA 3ICLA 4TXSA 4IG0B 2ZKUA 4QCLA 4KAZA 4WE1A 4O3NA 3H40A 3AVFA 2BQUA 3H5SA 1DTQB 3PJWA 4RNMA 3LZJA 1GOCA 4OL8A 5K14A 2BANA 2ZQBA 4RW9A 3RWUA 2BR0A 5J2QA 4R5PA 2ZE2B 1VRUB 3FQLA 4AHCA 1S1XB 3QEXA 4WFXA 4H4MA 4F3OA 4K4YA 4CJQA 4QWAA 2RF2A 4FLTA 4IH5A 4ED6A 4HYKA 4CJ5A 3FSIA 1KVBA 1IH7A 3OS2A 2HMIA 2B6AA 1IKXA 2FLPA 1C1BA 2OA8A 4CHNA 3KMQA 4N5SA 2YNIB 3I8DA 4J9NA 4CEOA 3M9MB 1NKCA 3AV9A 3SI6A 2V4RA 1T7PA 3HVTA 1VSLA 2RDIA 2C2EA 4FS2A 2R8GA 1JLEA 4IFYB 4Y2CA 3M9NB 2QXFA 3QNNA 1KLMB 2QV6A 1LWCA 3V9WA 4IKFA 2XGPA 4DQQA 1U47A 4AH9A 4CJVA 4CF1A 3SFGA 4J2EA 3DRPB 4KFBB 3MEDB 3OYIA 3U6FA 3OYBA 4F4YA 2EX3A 1IO2A 4YQWA 3DM2A 2Z1GA 1WSJA 1RT6B 4DTUA 1LW0A 1C6VA 4YR2A 3BGRA 1VSJA 5HBMB 3OYLA 3QGIA 5KI6A 4IH7A 4R8UA 3GIIA 4OLBA 3KK1B 4EBDA 2P1JA 1N5YA 2FVSA 3QO9B 2E6LA 3ZSYA 3DYAB 4DU3A 1OS5A 2AGPA 4MH8A 4DF4A 4URSA 4FJIA 3QGGA 1A5XA 5I3UB 4F4KA 4ZVHA 3PJXA 3K2PA 4DLEA 4MFBB 1ASWA 1L3TA 1R0AA 5J2MA 5C5JA 2A1SA 3WNHA 2QKKA 5DQHA 3V9XA 3BQ2A 4ZHRB 4NYZA 3ZCMA 2UVVA 3K58A 4NCGB 4DEZA 4RW7B 2WK4A 4I2PA 4CHZA 4LSNA 1RYRA 1RAJA 5FRMA 5KFIA 1MU2B 3I5AA 1DTTB 4K4UA 4QOZB 2J6UA 5DG9A 4DTRA 4O0JA 3KLEB 2HNYA 3TAMB 4KV8B 1VSIA 4RZRA 3NF7A 3HPHA 4Q45A 1YVUA 4FCYA 2VG7B 2OPRA 4B9UA 4DTNA 3SV4A 3DMJB 1JIHA 2GBZA 4MKAA 1RT2A 2BQ3A 3BSNA 4PQUA 2F96A 4CGHA 4DFKA 1JKHB 4B08A 4Y2AA 3VA0A 1S0NA 4KO0A 4NLGA 5J2NB 3IG1A 4K4ZA 1B92A 4LQ9A 2NUBA 1RT4A 4B8CA 2R2RA 4ZVGA 2OH2A 3A2FA 3M9OB 3QEIA 3ZT2A 1D8YA 3KHRA 3IGNA 3TVKA 4DSIA 4M3YA 4I9QA 3NE6A 2IMWP 1EP4A 4F2RA 3AA3A 3CDUA 3D28A 5F9LA 3N6MA 5KT3A 3V6JA 1QE1B 3K5LA 3QIOA 5C25A 4E7LA 1RDRA 3AVHA 3NBPB 4B8AB 4QW9A 1REVB 2FJVA 4ZP8A 1TKXA 4W5QA 4GVMA 1BQMA 4DQRA 2F8EX 2XY7A 1HMVB 4BWMA 3KNAA 2G8KA 4F8RA 2JEIA 4EZ6A 4WXOA 1B9DA 3Q8PB 4CJRA 1JLAA 4Q8FA 1S9EA 4CEBA 5F8LA 3CO9A 3N6NA 4IFVB 2E9TA 3RAXA 4KHMA 4IQXA 4IRDA 4JS4A 1XR7A 4FLXA 3NCIA 3G0ZA 4QWDA 4J2DA 4ICLB 1JXLA 3LDSA 4H8KA 2Z1IA 3TAFA 1JLGA 1KCFA 2YV0X 1NJWA 2YNFA 1T94A 3MFHA 2X78A 1HQEB 2HB5A 4I9LA 4DU4A 5DG8A 3CG7A 2YKMA 4EZ9A 1W25A 4J9QA 2F8TA 2AJQA 1RBSA 1IKVA 4ED0A 2IM2A 3EPGA 5EUHA 3PW0A 1JLBA 3LANA 4NYNA 1KTQA 4X2BA 1HQUA 4CHPA 3NGIA 4RW8B 4TSXA 2D7SA 4H4OA 5D3GB 3H98A 1RTIA 5I42A 4WZMA 4FJJA 4NLSA 4ECVA 3D45A 4HCBA 1QAIA 1LWEB 3BJYA 1HPZB 3SJJA 4B9VA 1MMLA 1YTAA 3C6UB 3V6DA 1A5VA 4E89A 3DOKA 3HT3A 1EXQA 4W5RA 3CJ0A 4TQRA 5HROA 2X74A 1VRTA 2P51A 3EY1A 4ZPBA 4FZYA 1TK8A 4BDZA 2RKIA 1NK5A 3RB0A 1RDBA 4G1QB 5FDLB 3UIQA 1RDCA 2QE5A 4RNFA 4TYBA 3HVAA 2V4QA 3LP1A 2UVWA 3H5XA 4FJ5A 1EETB 3OYFA 1HYSB 5C24B 2AGOA 4MIBA 4F2SA 3V1RA 2DFEA 3MEEB 2XI3A 3PW4A 1ASVA 3LZIA 4CJUA 3EZ5A 4RU9A 1QQCA 1WSIA 3VQAA 1RT7B 1QUVA 3SFUA 2AQ4A 4E1NA 1S9GA 4IH6A 5DG7A 1EX4A 1RT5B 3V4IA 1J9AA 3HKWA 4DTXA 4IRCA 3NAHA 1S1TA 3NF9A 4ECZA 3MXJA 1RT3A 3CJ4A 4CESA 3MEGA 4AHSA 1TKTA 1FK9A 3QIDA 3CDEA 3KLFB 3FQKA 3TI0A 3I0SA 2V0NA 1XR5A 1X1PA 3PR5B 2EHGA 1BL3A 3TAEA 4W5NA 4FJ7A 2IM1A 2FVQA 4DL3A 2W9AA 2FVPA 4O4GA 4QWBA 1IKWB 4GMJB 5KRTA 4FM1A 2ZD1B 3H5UA 5KG0A 4RUCA 1EKEA 1ZYQA 1HNVA 1U49A 1UWBB 3K5OA 4CJLA 1NK6A 4CEQA 2J6TA 2VWKA 3RB4A 3L2QA 1J53A 1C0TB 4FJXA 2W9BB 1TKDA 3Q8QB 3IS9B 4KI4A 2Y1IA 3FFIB 4LSLB 1UA1A 4CERA 1JLFB 3CFRA 1GX5A 1ZTTA 2HNDB 4HUEA 3KK2A 3ITHA 3KK3A 4NZ0A 2R2TA 2WHOA 3BREA 3CVKA 2GUIA 1L5UA 4FJKA 4HKQA 2HNZB 2YNGB 4ZPAA 2BRKA 1N4LA 2OPQA 3SI8A 3ISNC 3OYDA 2Z1JA 2UVUA 3DOLB 2WONA 3CJ2A 3GV7B 1X9WA 3OYCA 3OSPA 2W8KA 1A5WA 1F21A 3RMBA 4YMEA 3DI6B 2O4IA 3T19A 4NLRA 4E7JA 4ELTA 4E1MA 3TARA 3TQ1A 4M94A 1RA7A 5HP1B 2WB4A 3K57A 2AWZA 1T03A 4ED7A 5L1KA 3QIPA 1NJYA 1W9HA 1SH3A 1D0EA 3RB3A 4O5BA 4KTWA 4DL5A 4DG1A 3DLGB 4L8RB 3ISND 4CHYA 3L3VA 2CJQA 4F50A 1U45A 4KB7A 1Q9XA 4CEFA 4KHNA 4ECQA 1W0HA 1WLJA 1BI4B 1I3AA 3BSAA 1SL1A 3H2LA 1RA6A 2HW3A 1HNIB 5E41A 2W7OA 1RTJA 5KG7A 3QERA 3DRSB 1SH0A 4DFJA 3AA5X 4F3TA 3CM5A 2IJFA 3S3NA 3OLAA 1RTDA 3SUQA 4J2BA 1RTHA 2UVRA 4AILC 3CDWA 3VQ5A 1BCMA 4DSEA 3GIJA 1JXBA 2B5JA 3SQ4A 1XHXA 1B9FA 1VSFA 2ILZA 3GV5B 1TVRA 1C0UB 5DMRA 2UUTA 3OYKA 3PVXA 1VSDA 3V1OA 4ED2A 4O44B 1RCHA 3AVIA 1IG9A 2IAJB 3M8PB 5J1EA 3QLHA 3KLGA 4CEZA 2BQRA 4HCCA 1TL1A 2OPPB 2J6SA 3IRXB 3TANA 4WFYA 4QWCA 2HHQA 2CKWA 4WFZA 1GX6A 4KKOB 5DLGA 5HLFB 2YHBA 2W42A 1Y97A 3MFIA 4IG0A 4FK2A 5K14B 3KHHA 4YFUA 5HRPA 5J2QB 3SQ2A 1LV5A 3MF5A 2ZE2A 1VRUA 4NRTA 2VA3A 3GYNA 1S1XA 3CWJA 4NRUA 4O3QA 1RBRA 2R2SA 1QSYA 4Y3CA 2R7YA 1VSHA 2XC9A 4KREA 4DU1A 5HRRA 3V6KA 1WN7A 5JS2A 2HWIA 4KTQA 5KGWA 5KFGA 4CCHA 1ZBIA 2FBXA 1QHTA 4BDYA 4E7IA 4ZPDA 2X6SA 3RB6A 4DF8A 1D9DA 4NLYA 4JRPA 2WTFA 5CYQB 1KLMA 2GV9A 4EYIB 2HHXA 4CGIA 3OYMA 1TV6B 3U3YA 1C1AA 3NGZA 3AO4A 2ATLA 3DRPA 5EDWA 4KFBA 4ZVEA 3MEDA 1KSPA 5HRSA 4TY8A 2Z1HA 1SH2A 2HWHA 3ZT1A 1UOCA 4KTZA 1XI1A 3O3FA 3RMCA 3GV8B 4M3XA 3IN5A 4UQGA 5HBMA 1S1VB 4KHWA 4ID5B 1S6PB 3PY8A 4IDKB 1FKPB 3KK1A 3OLBA 3MR5A 3L2RA 2XY6A 4FLYA 1VSMA 1YT3A 3SUNA 3QO9A 3I0RB 4F4ZA 5SWMA 3E01B 3ZSRA 3DYAA 1RBUA 1Q8IA 5KFQA 2D0BA 1NK8A 2ALZA 2W9CB 3DDKA 1S49A 3ZT3A 4Z4CA 2PY5A 5I3UA 5KFCA 4U7CA 4OLAA 1S1WB 1DLOB 4MFBA 2IM0A 4Z0UA 2VG5B 1HRHA 4CIEA 2YKNB 2P5GA 1BQNB 3BSCA 3VA3A 4ZHRA 1TAUA 1U4BA 1S1UB 1LWFA 3PHEA 4NCGA 4RW7A 5KFJA 4I2PB 4AHRA 1IM4A 4GW6A 4FJLA 3MXIA 4AHUA 2KZMA 1KLNA 1MU2A 3QINA 5KFBA 3AO3A 4CEEA 1DTTA 3KD5E 4C8LA 1Z26A 1XHZA 3KLEA 3DRRB 4CF0A 3HM9A 2ASLA 3MXMA 3TAMA 4KAIA 2OPSA 4KV8A 1BCOA 1JL2A 4CGDA 3F73A 2D5RA 3Q8RB 2DFHA 2O4GA 1TQLA 2IJNA 1KHVA 2Q3SA 4NLQA 4CFBA 2VG7A 3K59A 3MECB 2KFZA 3OSNA 1UAXA 1SKSA 3DMJA 3WNGA 1S10A 4CHOA 4I2QB 2OYQA 1IKYB 3DLRA 1K6YA 4DMNA 1JKHA 3OY9A 1BHLA 2JC0A 3U3GA 1S0OA 3P1GA 2WOMB 3OL6A 1WNSA 2XCAA 2IDOA 3TAQA 2VWJA 3QESA 1TK5A 4RG8A 1RT1A 4G3IA 4FLVA 4XO0A 3E51A 2YHAA 1Z25A 1SUQB 4J9PA 3NGYA 4PUOB 3KLIB 4DSJA 3NH2A 4CECA 3GIMA 3RRHA 2AX1A 1FKOB 5KG5A 4TYAA 1QE1A 5DQIA 1ASUA 4ZVFA 3NBPA 2KTQA 1BQMB 2FVRA 4Y34A 3VQBA 1NK9A 2G8HA 2FBVA 1REVA 3DLKB 1ZBHA 4E7KA 3G6YA 1S0MA 2IGIA 3RMDA 3M8QB 4M45A 3NGDA 2KZZA 4NLOA 5F8IA 4KHUA 1LW2B 1J5OA 2FVCA 4KBIA 3DLBA 2IC3B 3AVGA 1T05B 2PYLA 3V9UA 4DL6A 3MAQA 1K1QA 4LH4A 3LPTA 3LP2B 3C6TA 4LH5A 1NJXA 3KD1E 2E4LA 4ICLA 5KFTA 3PX0A 1TGOA 5FROA 3G10A 1TAQA 3WNFA 5J2PA 3FRZA 4E3SA 3H5YA 5JXSA 1HQEA 2D3UA 4J9LA 4CGFA 3CM6A 2R8KA 1I6JA 5F8HA 3SUOA 4NLTA 4N41A 3PV8A 1JLBB 5KFAA 4ED1A 4CJSA 1GOBA 3TWHA 4BWJA 4H4OB 4CHQA 1D9FA 4K4VA 1SKRA 2FLLA 4B3OB 4CF8A 5I42B 4RW8A 1TKZB 3KJVB 3OYJA 5D3GA 4RNOA 1QSSA 2D41A 2IS3A 4CF9A 3LP0B 4JV0A 4QW8A 4ECWA 4CJ4A 2DY4A 3KLVA 1LWEA 1HPZA 3V6DB 2HHVA 4ID1A 1D5AA 3MR2A 3C6UA 2C2RA 5HRNA 5CYMA 5T14A 2AGQA 3BQ0A 4TY9A 5KG2A 2ITGA 5DGAA 3S3OA 4M95A 1TL3B 1VRTB 4N56A 4MK8A 3KHLA 4B9SA 2E6MA 4CJKA 1SL0A 3VQ4A 3OYAA 4BDPA 4I7FB 3NF8A 4G1QA 2XO7A 3EYZA 4FBUA 2XY5A 3SQ0A 3BSOA 3SZ2A 1C2PA 3HJFA 4M3RA 1EETA 2ILYA 3T1AA 1XR6A 3VQ7A 2PYJA 1HYSA 5C24A 5KT2A 1O1WA 3O3HA 3RBDA 4OJRA 3MEEA 4CGGA 2FBTA 1S9GB 2XY8A 3OVNA 1RT7A 3L2VA 3V4IB 1HJRA 4O3RA 4Z4FA 1N48A 1U48A 1S1TB 1RT5A 3ZSWA 4RW6A 3SQ1A 4FZXC 1ZETA 4OVLA 1JXEA 1U09A 3NH0A 4K8ZA 4OKKA 5KGXA 2G8UA 3KLFA 4ELUA 2QKBA 3M8RA 4XPEA 4LY7A 1ZBLA 1NHVA 2XGQA 4FVMA 4PY5A 4M41A 2VG6B 4DTSA 1IKWA 2YNHB 2VA2A 3JSMA 4EP5A 1RDAA 2ZD1A 1T3NA 2GC8A 1C0MA 3SNNA 4RW4B 4IR9A 2G8VA 4EO6A 3VQ8A 2O5DA 2BE2B 5KT4A 3NFAA 4J9RA 1C0TA 4TLRA 4OGEA 4MK7A 2W9BA 3ALYA 3L2UA 2I5JB 3LALA 1YVFA 5KFVA 3EZUA 3H4BA 3PW2A 3IS9A 4FJHA 2DTUA 3M8SA 3KIOA 3FFIA 5EU7A 4C8KA 1JLFA 3MR3A 1SV5B 3DLEB 4M3TA 4Q0BB 2HHWA 1LAVA 3LP3A 3P83D 3L8BA 2UUWA 2AU0A 4WYWA 4DTJA 1S6QA 2JEJA 4EEYA 2RPIA 2HNZA 2YNGA 2JEFA 4C8NA 4C8MA 2WONB 5F8NA 4ZTJA 1C1CB 5KFDA 3ZT0A 3QNOA 1VSEA 4E19A 4GC6A 3DOLA 3JYTB 4FM0A 4DWIA 2GIQA 3UDLA 3DI6A 3C95A 4QAGA 4ECTA 3GILA 4DS5A 2ASJA 3O3GA 4QPXA 4IG3B 3SV3A 4DG1B 4Z4HA 4NLUA 4ELVA 3RBEA 1VK0A 1I39A 1JLCA 4TN2A 3H4DA 2DPIA 4KPYA 4O3SA 3V81B 4E0DA 4PWDB 5KG1A 5DQGA 5F8MA 4ECYA 5C42B 1QS4A 4M3WA 2KQ2A 3O4QA 4Z4GA 2WRMA 3QETA 3KOAA 1BI4A 1NOYA 4CJEA 3CJ3A 1K1SA 5KFSA 4CE9A 3KLHB 1NKEA 3T3FA 3DRSA 2ASDA 1N6QB 3K5NA 4HUFA 5CZ1A 3VQ6A 4ECRA 4FLZA 1JLQB 3L3UA 4NLXA 3AVNA 1HARA 3QGHA 4FZZA 5KG4A 5JUMA 2B5JB 5DLFA 1CXQA 4IBNA 2BDPA 1X9SA 4U6PA 1HYVA 3VQEA 4KE5A 3VQCA 1NK7A 1VSKA 3VN5A 4FJ9A 4Q44A 1QTMA 4MK9A 4CF2A 4O44A 1HYZA 2IAJA 4Y1DA 3M8PA 2HHTA 3I5BA 3QYYA 3N6LA 2BGGA 4WE1B 2D0CA 3NF6A 3IRXA 3HSTB 1J54A 1XC9A 2BANB 4RW9B 3VQDA 4NLVA 4KKOA 4CEDA 1DTQA 3T5HA 5HLFA 4CJPA 4R5PB 5KFEA 4URQU 4H4MB 3EPIA 1JL1A 1KFDA 2RF2B 3NL0A 2HMIB 2B43A 2B6AB 1TP7A 4IRKA 1IKXB 4RNHA 3S3MA 1C1BB 4CJFA 4O3OA 3K5MA 3BDPA 4DL2A 5KFWA 3KMSA 4F4WA 2YNIA 3T5LA 4HUGA 3CFPA 3HVTB 1QAJA 1SKWA 2ETJA 2XHBA 2D0AA 1JLEB 3LWMA 4J9SA 4KSEB 2IA6A 4BACA 4IFYA 1LWCB 4EBEA 1NK0A 4DSKA 1TK0A 2PZSA 3VQ9A 3AVBA 5KG3A 4O0IA 1Q9YA 4C8OA 4HTUA 3DM2B 4BE0A 2G8IA 5CYQA 5T7BA 3OHAA 4KB1A 4CIFA 1LW0B 1TV6A 3BGRB 1RT6A 4CK1A 4TY8B 4ZMMA 4R8UB 2WCXA 3FDSA 4CGJA 1N5YB 1WNEA 3HPOA 1BISA 4KHRA 4KRFA 3PO5A 3T5KA 4DTPA 5KFPA 5L1JA 1WSHA 4CFDA 1S1VA 5L9XA 4ID5A 1S6PA 2AX0A 4IDKA 1FKPA 3BR9A 2HVHA 4ZP9A 1R0AB 3I0RA 5J2MB 3NH1A 3E01A 2JC1A 4K4TA 3MTKA 1RNHA 4WXWA 4JV1A 4OKJA 3QZ8A 4KHQA 2W9CA 3V6HA 3PW5A 3OL9A 3AO1A 3LAKA 3HHKA 4EP4A 1T8EA 1S1WA 1BGXT 1DLOA 2HHUA 1G15A 5EWFA 2VG5A 4FJGA 2YKNA 5F8GA 3AVAA 4LSNB 3VQSA 4J2AA 4ECSA 4FJ8A 1BQNA 1LWFB 4ECUA 4NCAA 3KKRA 1ZBUA 5KFFA 1S1UA 2HNYB 2KFNA 4K50A 2FBYA 4OPKA 4DL7A 1NK4A 3G6VA 3PX6A 4B9TA 4CK2A 4CK3A 4HVJA 4DQPA 3B6PA 2OPRB 3DRRA 2OPSB 4NLPA 3OYGA
chains in the Genus database with same CATH superfamily
4DPYA 4E8UA 1ITGA 2QLBB 5H9FK 2VICA 2V8DA 1FVQA 3PIOQ 4DUYJ 1VQ5N 2XBPA 1M0SA 2LU1A 4MKBA 1GQEA 2MTLA 2XMKA 3ULEB 5DZ7A 2IM3A 3ZZRA 3SPYA 3MECA 3AB4B 1FFGB 3I9V9 5JVGQ 1FA0A 3NGRA 4CZLA 3NS5A 1OVYA 4N8NA 4K4XA 1FWLA 1OYDA 2DPJA 4BRHA 2FJXA 2G8FA 4RUHA 4CDIA 1NGGA 2WAQD 4JKEA 3HF5A 3HDSA 4OYAA 2DFFA 1OYEA 4WZQA 3K5PA 4CIOA 5C25B 4DS4A 3CDBA 4FW2A 1CLQA 4WIIA 4AD6A 4IKAA 1CJUA 2V50A 5KFMA 1CC8A 4QYRA 4BCAA 2ZH7A 3M8ZA 4J9OA 4W5OA 1S9EB 3DLLL 5KG6A 3DLKA 4KYZA 4RO0A 2DR5A 3OYNA 1FJ7A 4FJMA 4L3QA 2R8IA 1KVCA 4JUZA 3VVTA 1TUGB 3M8QA 3LPUA 1YJRA 1SBRA 2YNFB 4JS5A 3C8YA 1GOAA 3AVLA 2FJDB 1VQ9N 5HL7L 3C6TB 1IQZA 2UXDF 5JS1A 3I9ZA 2D3ZA 3W9IA 3SUPA 1WBDA 1DURA 3HHLD 3IP0A 3CI5A 4JN4A 5DGBA 3QDKA 3MDQA 2WBNA 4H0OA 2YI1A 3HOSA 1AFIA 4AHTA 3AXKA 4KC5A 2YKOA 4A57A 3V9ZA 4FLWA 1M1KO 1BMQB 3NKYA 1VCTA 3I5CA 2KG1A 3UDCA 5GADU 1BIUA 1X5SA 3KJVA 5FRNA 1KR4A 2OCEA 2CQGA 1J5EJ 3HVRA 1KRPA 1HI0P 3ZT4A 3D6TB 1RHKB 5CYMB 2D74B 4F3QA 2G8WA 4JI2J 2RKIB 1CSJA 1VQSA 2Z2ZA 5KFKA 3PFOA 4I4BA 3O3LA 2JWKA 1TL3A 2B4JA 2QL9B 3MM5B 3LP1B 5FDLA 3P38A 3V9SA 4RWTA 3PX4A 1VISA 1X0PA 2EKNA 2LQ5A 5IOLA 4DFPA 4RUAA 1SC1B 4PG6A 4I7FA 4FPAA 4DJBA 4DN0A 3PW7A 1M1KT 3OBIA 2B4UA 2HAFA 3CEDA 3CPWR 5DDPC 1VQ8N 3A3OB 1NSQA 2CQDA 4EUVA 1K8KA 4B1XB 1MA9B 1RBTA 4WJBA 2F4VK 3HHDA 1YF5L 2IOCA 2HURA 5DDOC 3FMBA 1TKTB 1FK9B 3CIZA 4ETZA 2A1BA 3QJJA 3GJQB 1NKBA 2XS7A 3CJSA 3G6EN 5BR8F 4BRIA 3ZSXA 1S9FA 3PO4A 3LAMA 5KFYA 3HHEA 3HSGA 4O4GB 5HMZA 4WFNQ 1GMVA 5K9FA 2CJ9A 4A8KA 1XC3A 4J8FA 3TUIC 2KKZA 1R8BA 2ZZTA 1H2TZ 3TABA 1YG0A 2RQ4A 2VJVA 3CPWM 2RN2A 4PA1A 1YBAA 2W01A 4DSLA 3MTJA 4X65J 4AYBD 4XPCA 1RWUA 3P8BB 4X62J 5F41A 4NYOA 4CZKA 2YJEA 2NLWA 3R97A 1YVNA 3O9UA 3G71S 3HXMA 4HWIA 4CFCA 2IVFB 5KT7A 1W2BR 4K2XA 4PKIA 3H2VE 4F04B 5E2QA 5HQLA 3PYGA 4NCBA 1FCAA 4E2FB 4L75A 2FHJA 5HK4A 3ZYYX 4KHSA 3D0GE 1VBZA 1FE4A 3DLEA 2NZCA 3W65A 1BE4A 4ZTFA 4TQSA 4BE1A 4ZCMA 5KFZA 5D0RA 3GFHA 3BP8A 2YVSA 4KHYA 2F5GA 1BQXA 3OL8A 3QIPB 3JYTA 4H54A 3RRGA 3OS1A 2PD1A 4NEZA 4OKEA 1SJ1A 3N9UC 4P2SA 4X4PA 2N3LA 2F9WA 4LF5F 3O6QA 2LQ8A 4B9MA 4LF1A 4K8RA 2P9IB 1YJUA 4CEAA 1NNDA 3H3OB 2Z58B 1WSEA 4JYAJ 1TFYA 2XYGB 2RH3A 3PR4A 5AJ3F 1CZ9A 3MR7A 1RTJB 4OYPA 5A8KB 4OGCA 3L7PA 4HHTA 1RHJB 3POTB 1QQMA 3T5JA 3CE8A 4MAKA 2O8FA 4JI1K 4ZIVA 4WU3A 6FD1A 2WB1D 2QEXN 3FC9A 4NXMJ 2HVIA 3UNGC 1FXXA 4CTAA 2HQGA 5KFOA 3VF0B 4U95A 1C0UA 3LGNA 1YSJA 3ILOA 4FWNA 3QLHB 3GSDA 4BS2A 1ZC6A 1TL1B 4DR2J 5CABA 4H5WA 2DHHA 3UKRB 4E7HA 4DV4F 4CFAA 2LYVA 4AFFA 5CA5A 1TYQA 3KTQA 3CYMA 3T7ZA 2Y1RI 4RU2A 1OY6A 2KXHA 2B9EA 1NU4A 2AYBA 1FDDA 2HFUA 2LXFA 1GEHA 2OFHX 1D4XA 1HI1A 3HD2A 4ES3A 4IG0B 4QCLA 4KAZA 3MPUB 1VLOA 4O3NA 2D9OA 1HNXF 1BO5O 1UW9A 1DTQB 3AD8C 3CSKA 3OFEA 3TRGA 4OL8A 5E3CA 4QR2A 3PIOL 4EIAA 4LVNP 4I6AA 2ZE2B 1WTFA 5IV4A 4K4YA 4CJQA 4QWAA 3C46A 2YY3A 4IH5A 1RBAA 4ED6A 4CJ5A 1E6VB 2QWMA 2HMIA 4CD1A 5JVGL 3M2RA 4OHXA 1C1BA 2OA8A 4CHNA 3KMQA 2LLZA 2YNIB 4EFAC 4CEOA 3N4WA 3GG4A 4BC9A 3MWPA 3HVTA 1VSLA 4YB7A 2R8GA 3CCUN 4IFYB 4Y2CA 2L08A 3QNNA 1KLMB 2J0WA 1LWCA 4IKFA 1MNEA 4DQQA 4MO4A 4CJVA 2HKEA 2DNQA 3SIPB 1FJCA 2Z1GA 1MWMA 1CVJA 4JK9A 3VPZA 4DTUA 1LW0A 1C6VA 3DC2A 3BGRA 1AW0A 1VSJA 3OYLA 3KK1B 2P1JA 5BN8A 3FNNA 2CPHA 3D67A 5L8RC 2A3JA 1N5TA 4MH8A 1NGHA 2LMIA 3QGGA 1VS3A 1A5XA 1IUJA 4LFBF 2E1MC 5I3UB 3PJXA 3QNWB 2B3TB 4C1NI 1K9MT 1ASWA 1MWKA 4FF2A 1R8AA 2Z2LA 2UZAA 2F4FA 2GJ2A 2A1SA 3WNHA 4JP8A 5AQXA 3THWB 4ZHRB 2YKAA 4DEZA 2VFTA 2V8GA 5AQTA 4AM7A 5F2RA 4LSNA 5FRMA 5KFIA 1BWEA 1MU2B 2A6MA 4BC3A 1NUEA 1WELA 4R0JA 3T1HF 2HQ3A 1EWRA 2J6UA 4AL7A 3W0LA 3MM8A 4O0JA 4IFEA 4QIGA 5AXLA 2JWLA 2Z2MA 2C3UA 2QLJB 1I94K 3BPSP 2X1GA 4RZRA 1W97L 3ZX0A 4B3SK 4KGKA 2QL5B 2Z2YB 4LRCA 2OEKA 3R7BB 4IOXA 1XEZA 3NXZA 3SV4A 3DMJB 1JIHA 3VMFB 4MKAA 1Q7LB 1RT2A 4RTFD 3BSNA 4U7UD 1XBWA 2MZ1A 4HLBA 2UUCF 2XMWA 2W4PA 3AAQA 1AZSB 3OV7A 3UNYA 2NUBA 1RT4A 3MUVP 3AD9C 1VMBA 2CQIA 4IEIA 1D8YA 2F7TA 3R2DJ 3IWNC 3QFUA 4DV0K 4BRDA 1NDPA 5A6WA 2EFQA 2LU2A 4OI1A 3V6JA 2CQCA 3ID8A 3NOCA 2BACA 3WQUA 1FX2A 1RDRA 4B8AB 3LDQA 1AT1B 5C12A 1TKXA 1HR0J 4GVMA 1BQMA 1QD1A 2MZRA 4DQRA 2SXLA 1ZA2B 1VR6A 4WFNL 4BWMA 1G4CA 2E1YA 1NH7A 3KNAA 2MDAA 4DR1J 2ASMA 4F8RA 3GMGA 3LPEA 2VPZB 4EZ6A 1HWJA 3PTWA 1B9DA 2DITA 4Q8FA 3IBFB 3M2UA 2G2YA 3RAXA 1XR7A 4FLXA 3Q86A 3NCIA 1VQLS 4J2DA 2VQFJ 3TZWA 2U2FA 2XLKA 4B17A 3MPYA 1T94A 2X78A 3TSUA 4F4AA 3CG7A 2YKMA 5CQGA 1R3NA 3HFKA 2VF3A 2DB1A 2P9UA 4A8FA 1JLBA 4NYNA 1HQUA 4TSXA 2DGQA 5D3GB 1GTEA 4OI2A 3VALA 3EO3A 5I42A 4WZMA 5A6PA 4NLSA 2IMOA 4CD3A 2XMTA 2XZWA 2HFVA 2ATCB 4OZ2A 3MWTA 4YY3J 1YTAA 4KGXB 3W8PA 3K0JA 4E89A 4YDDB 1CJVA 2ZC4A 5D4LA 3MPVA 2X74A 1RQ0A 2UXDK 1VC5A 4UOFA 4JNEA 1RDBA 5FDLB 1N34J 3UIQA 3GU0A 2ABYA 2HHPA 2QE5A 4C1NK 4RNFA 4J90A 2UVWA 1EETB 1HYSB 2H4WB 1BG3A 2EK1A 1JNZB 2I0XA 3LZIA 2OEMA 3BPDA 1QQCA 1RT7B 2O8DB 1JCEA 3SFUA 4HDHA 3SAGA 5AQZA 4DV5F 3UKUB 2BUNA 3L7OA 3V4IA 3BYPA 3FCHA 1J9AA 3NAHA 1WD6A 3CC2N 4O5FA 1PBAA 4CESA 3MEGA 4CO2A 3KLFB 2BW7A 3CUNA 5E33A 3I0SA 5B8HA 1W7AA 3QT6A 1BL3A 3OQ2A 2COLA 4W5NA 4FJ7A 5BYRA 3TX8A 2FVQA 1EKSA 3VVUA 2W9AA 4W92B 2FVPA 2NRZA 2NRRA 2E20A 2VOOA 1GNKA 1Y11A 4GMJB 4FM1A 1Q95G 4USVA 4QR1A 1C0GA 4RUCA 3TVYA 1EKEA 1HNVA 4A2BA 2FYXA 4MLEA 2CQBA 5C10A 4FJXA 1PO6A 2UU9J 1VBXA 1NU0A 3IRWP 4KI4A 2XYPB 3J7YI 1VFJA 2HYIB 4DV3J 3OBYA 1FTCA 2IRYA 4KHPF 1E6YA 2K2PA 3F44A 1N5SA 3BREA 5BR8K 3CVKA 3F2KA 1BHNA 2OPQA 1V6HA 2L41A 3CJ2A 2R7XA 1F21A 3GJSB 5FPMA 1B64A 1HBMA 3JSRA 4E1MA 4FNHA 5AZJA 3H46O 5F0UA 3K57A 1T03A 4ED7A 3ETMA 2XLJA 1D0EA 2HRUA 3CJKA 4XH4A 1X31C 4DG1A 4L8RB 3ZEUB 4CHYA 2KU7A 4KB7A 1QM9A 1Q9XA 1RP5A 4LUBA 3TJ8A 1I3AA 2ZWPA 4ZJQA 4C11B 3H2LA 1U2RA 3LL3A 5GAEP 2QMWA 2W7OA 5GAHP 2QLFB 4DPTA 2VV5A 4DFJA 5HMXA 3ZLJA 3S3NA 2M3DA 1HBNB 4XAKA 1RTHA 1G99A 3ZZZA 3LA0A 1VLYA 3JTOA 3LOUA 4ZJOA 1VQMS 1TL5A 1JXBA 1FXDA 2B5JA 1WC0A 5AXKA 4YDXA 2ILZA 1C0UB 5DMRA 1FRLA 2UUTA 4LF5K 4TU9A 3PVXA 1Y0HA 3V1OA 2RIJA 4AT1B 4BC4A 3MD1A 4O44B 3AVIA 1IG9A 1U1MA 5J1EA 4CEZA 4LR8A 2CPFA 2CG4A 3IRXB 3TANA 3DLJA 5AJ3K 2MY7A 4WFZA 2KG0A 4LSZB 5DLGA 4I64A 4J9VA 1BC6A 2YHBA 2G9OA 2Y9HA 1Y97A 4N8OA 2G0IA 1NBWA 1YJNS 4FK2A 2K3IA 3KHHA 1YZ7A 3QFHA 3SQ2A 2QYGA 2FC9A 3MF5A 1S1XA 1NSKL 3D3BJ 4NRUA 4O3QA 3EVOA 3CCRN 3M2RB 4NXNJ 4Y3CA 5IM0B 1QHAA 1VSHA 5AQHA 2R7YA 4ZLPA 2PFFB 4KREA 1K8AT 3PSIA 3L4QA 4DV4K 5KGWA 2JDJA 5KFGA 4DCJB 1ZBIA 2FBXA 3W66A 3TUZC 4CO0A 4JI6F 4OYZA 4DF8A 1J6ZA 3FJ2A 4JRPA 4WF9Q 5ADZA 2HSTA 3SSRA 1X7VA 2GV9A 1TV6B 5T41A 1HNXK 3AO4A 1M1GA 5A0YA 2CPDA 3TW0A 2HWHA 2PMZD 4KTZA 1U6ZA 4FVCA 4PL8A 5AQSA 2LP4A 3IN5A 4UQGA 5HBMA 1S1VB 2VC1A 4ID5B 4IDKB 1FKPB 2HFOA 3MR5A 3TNVA 2XY6A 1YT3A 2V34A 4F4ZA 2R7RA 1RBUA 1Q8IA 2D0BA 5HI7A 2D1KA 1Y10A 1XNQJ 1NDLA 1V4TA 3EGZA 1Z05A 1YXQA 2IM0A 4Z0UA 1F2GA 2VG5B 2N4CA 4USMA 5L9NA 2YKNB 2DNPA 2DNHA 1RAEB 3HFVA 1BQNB 2BBEA 3BSCA 3VA3A 4ZLLA 1HBUA 2DISA 1LWFA 2IHR1 3M6GA 4OX6A 3ZTQA 4DUTA 4GW6A 2J8AA 1ZOTA 2XS2A 6FDRA 3A8YA 3TSQA 3MM8B 2KRBA 5KFBA 5BR9A 2CVIA 1DTTA 8RUCA 3G8QA 2XMMA 2ASLA 2DJWA 4KAIA 2OPSA 2CXEA 4V19X 1JL2A 4ALZA 4FKYA 4LFBK 2GZOA 5AQYA 2JWNA 1KNZA 4NLQA 1Q18A 2GVDA 1NSPA 2Y0SD 4UUXA 4TU8A 3OSNA 3VGLA 3WNGA 1VGYA 1S10A 4I2QB 3US5A 1K6YA 3U4LA 3UI3A 3OY9A 2JC0A 4PR6A 2WOMB 1WNSA 1FE0A 3TAQA 3QESA 1VQON 5J1PA 4RG8A 2QWOA 1YBUA 3T1HK 2GQCA 4BRQA 2GWKA 5DO2A 3R3LA 2YHAA 1XMQF 5C0YA 1SUQB 3ENQA 1FD2A 2HBKA 1RXOB 1N36F 3CD0A 4GKJF 4PUOB 3FEXB 1U2VB 3GIMA 2AX1A 1OSCA 5EX3A 3W63A 5BRHA 4XTTA 4JI8J 4OZLA 1Q8LA 2P9SB 3OR2B 2KTQA 1BQMB 3S6EA 1REVA 2HS0A 1ZBHA 2OANA 1PJ6A 4XDDA 4JD2B 5CHCB 4ILGB 2UUCK 3OXGA 2BX6A 3J7A1 3KJFB 3PRVA 4M45A 3KWIA 4BQZA 4KHUA 3ZTSA 1UZHA 5LSRA 5K8NA 3DLBA 1V5IB 2IC3B 2DHGA 1F9HA 4HT7A 1K1QA 3LDLA 1NJXA 4LH5A 4DOZA 3R3TA 4ICLA 5KFTA 4UF4A 1LNQA 4OJ3A 5J2PA 1UL3A 2K8GA 5E3QA 1UVMA 2FSJA 3CCSS 4ZITA 3I4PA 4J9LA 5GADP 3CM6A 3B6BA 2R8KA 4RWXA 5F8HA 3RUBL 4WK3A 1WC4A 2J8SA 1JLBB 5KFAA 3L3CA 3IFEA 5B0DA 1D9FA 1SKRA 5I42B 3N4QA 3OR1A 1TKZB 1LKZA 5M1KA 3OYJA 2VUGA 4CF9A 2OMLA 4ECWA 4FYXB 3KLVA 3TUJC 1LWEA 3AXMA 5ETOA 3MAAA 2HHVA 3N0VA 3MR2A 4KR0B 4USKA 1TUYA 2NXUA 2CA9A 3BQ0A 3M2VB 1CJVB 4TY9A 5KG2A 2FD2A 2VQEF 4M95A 1GT8A 3T9ZA 4N56A 4MK8A 1QAXA 4BR2A 1R27B 4L3KA 4FPBA 1ZM4A 5LY3A 1SL0A 3VQ4A 3EJMA 3EZWA 1SQKA 4J9UE 2XY5A 2H48B 2PIIA 4IOCQ 3ENOA 3HJFA 4M3RA 4CZEA 1FW6A 1XR6A 5EGYA 3MGJA 2ZJRQ 4C98A 2F9JA 3JQJA 3MCAB 3RBDA 4OJRA 3MEEA 3FGVA 2GO8A 4HDGA 4TLQA 1N33J 2XY8A 3OVNA 1GTHA 3LDOA 3V4IB 4HL9A 1YIJN 4Z4FA 2NLXA 4FWOA 1RT5A 2BJ3A 4RW6A 2EXUA 2BJEA 2FDNA 2HSEB 3PYFA 5JVHQ 3ADAC 3THYB 2HEKA 3C14B 3TA0A 2P9NA 2AJFE 1Q16B 4Z37A 4PY5A 4M41A 1TZ0A 3CCLS 2VG6B 2XS5A 1IKWA 4DTSA 2VA2A 1XNRF 3JSMA 2ZD1A 3DCAA 2R3VA 3GWCA 1NB2A 2QWPA 4IR9A 2G8VA 3QWUA 2O5DA 5KT4A 2E5GA 3RZAA 1XQSC 3R27A 5EHHA 5IQQA 2VBWA 5AQNA 3KUGA 2Q97A 3WXLA 2RE1A 3B8HA 3KIOA 1KS2A 1YBTA 4H4KC 2BKOA 4Q0BB 3FE1A 3LP3A 3K17A 2EFPA 1BUXA 2QMXA 3FSYA 2YNGA 4C8NA 1SZ2A 1T9YA 4ZTJA 1T11A 5ITHA 3DOLA 3MUMP 2UUAF 3AGRA 4WF9L 3UDLA 1X0FA 1T6DA 4QAGA 4OV1A 5G0RB 2YKQA 3J81O 4IG3B 3SV3A 1F9EB 4DG1B 2AJ1A 3WUHA 2QSWA 1I39A 2CWKA 3M1VB 4TN2A 4KPYA 4E0DA 5KG1A 4ECYA 4KHPK 2JJ4D 1HX1A 3O8WA 5HOOA 2MZSA 4P2FA 3QETA 5H9FJ 3WXIA 5KFSA 4CE9A 3KLHB 1NKEA 3WEEB 3T3FA 3GSIA 2NYHA 2Q0RA 1T02A 3BBFA 4ECRA 4FLZA 1JLQB 3W60A 4YDUA 3OTEA 3EZOA 2B5JB 3OTOF 3CD6N 3GJTB 1DRZA 1N0VC 4MYUA 3VQCA 4FJ9A 2DRAA 4MK9A 3MMJA 2IAJA 4Y1DA 2RU3A 4GRSA 1HNWF 3A8IA 4CLZA 2AZ1A 2O66A 2MQOA 3NF6A 2IVOA 2ZOGA 3PNIA 2QSFA 1KD1O 2VHGA 3T5HA 4NMLA 2QW9A 3NVMA 4URQU 2J9DE 1Y3JA 4F25A 3CF5Q 4H4MB 1Y5NB 2BMBA 1JL1A 2CDQA 2RF2B 4QIFA 3NL0A 1PYTA 4ZVRB 5D0HA 4U67Q 1ZZNA 3JQKA 4CVNE 1AROP 2HG4A 3VEYA 4AL5A 2CJKA 1HKCA 3I31A 3EM1A 1OWXA 1QAJA 4UY8T 1B0PA 2IA6A 3GIRA 1NK0A 1OPZA 4DSKA 1TK0A 4OX9F 3VQ9A 3SJHA 1H74A 3AVBA 3FZBA 3D2EB 2DHXA 2JNJA 4OX7A 3EVWA 1ITPA 1WOQA 5CYQA 5RUBA 4KB1A 4CIFA 3IMXA 3BKTA 5D0EA 5A0YB 2HIQA 3O9RA 3Q23A 1RT6A 3CJRA 4BRAA 4CK1A 4ZMMA 2ZH9A 4HH1A 1N5YB 2N82B 2OD4A 4DZDA 5BYSA 3FBEA 1WACA 3T5KA 4GVBA 4DR4J 1WSHA 3HZGA 4M5DB 3O9QA 3C15B 5KPRA 5J2MB 1G3OA 2XEXA 4NYPA 3NH1A 1NMDA 4K4TA 1RNHA 4JV1A 4JI6K 3OL9A 2AHOB 2QWLA 3UCGA 2GELA 1BGXT 2MY8A 1G15A 4FJGA 3TTFA 4ECSA 2VPXB 1LWFB 4ECUA 3CC4N 1Q86O 2W4CA 5KFFA 3TSPA 1S1UA 2DGSA 2F4VJ 1WHYA 3HHLB 2HNYB 4DR6F 2NCKL 4PAAA 2I6WA 3BGOP 4N77A 3HHNB 4B9TA 3KXDA 4CK3A 2J9EA 4U7UK 2OPSB 1YHQN 4NLPA 2VBXA 2VU5A 5BN9A 2XRIA 2ZH5A 3MM6A 2I1RA 1YJNN 3WXJA 4KO0B 4BVOA 3HO1A 3DXSX 4GV6A 3IA0A 4Q5VA 4IOCL 3HJVA 3QGPA 3G6XA 2CJBA 2DR9A 3AO2A 2VFRA 5KFRA 2G0CA 3EKUA 1JX4A 4JI4F 2ZJRL 2GIRA 3G86A 1LXNA 1EP4B 3TZYA 2QWNA 2WTUA 2FLNA 3ZSZA 2JFDA 1YRXA 3UWTA 2G1HA 3GFXA 4KB0A 2DRBA 4PXDA 4FJNA 3CJ8A 3MI7X 2RUGA 4FS1A 3M32A 4GO5X 1ZBTA 5LT5A 2C2DA 4MO5A 1S5ZA 5JVHL 1FKOA 3QBWA 1NBEB 3JAMO 2V69A 3IUCA 3PEJA 2FJWA 2V4JB 1GAOA 2R9LA 1ATNA 3DXMB 2QZ8A 3D0HE 2R8HA 4KI6A 2BJ8A 4NI2A 2B7BB 1P9YA 3NMAA 3AVJA 3MK6A 4UOGA 1WSGA 3HRGA 3J81Y 3T1YJ 1JLGB 4DN9A 1X9MA 3H08A 2PEHA 1WAJA 2QGFB 4Z4EA 1T05A 3WQPA 1XMQK 2MQMA 3L4BC 1N36K 2HGLA 4K4SA 4M3ZA 1VHFA 4U9RA 4GKJK 1IKVB 5J2PB 1UKUA 4CLYA 2KYXA 4JAXA 1JJCB 1VQ4S 3CCWA 2GCFA 3AA2A 1XWLA 3ZSOA 4JI1J 3CJ5A 4YOTA 1HJOA 4DQSA 1RDUA 4XH5A 3PXGa 3MOJB 1VYAA 4B3OA 2RD5C 4BG9A 3RR7A 3AO5A 4FK4A 2DNMA 3DOKB 3HVWA 2NUHA 3ZSVA 4USJC 4ZPWR 5HROB 2AJ2A 4CYUB 2HZCA 3Q7CA 4OZJA 1T9VA 1WI8A 3GYXB 4WTYA 1L3VA 3ENBA 2A10A 3MN5A 3CIPA 4Q43A 2YX4A 1BIZA 2AYGA 2X3GA 4WYLA 1FRXA 4XK8C 3AH6A 3UQSA 4KGMA 2KLAA 4QWEA 2CNKB 1M5VC 2X6NA 4S0MA 3MPWA 1H73A 2ZGZA 3NHGA 1IJJA 5EWEA 1U25A 3TUPA 5DK5A 1Z4UA 3WBZA 1QSLA 3OHBA 2ACYA 4MKVA 2P6SA 4IO8A 4M5KA 3W5ZA 4A8XA 3Q22A 2RT3A 3W2VA 5ETSA 2JLEA 1S7HA 3LDNA 2M8DB 1BA1A 1R43A 3EN9A 1FD8A 1GLDG 3SXLA 4OHYA 1N8RO 3SCKE 5KT6A 4RW6B 3P96A 4H0XB 3EXCX 4IDHA 5F9NA 2IBKA 4M3UA 3FZHA 4FF1A 2VQEK 1S5JA 1YJ9N 5GAGP 3JTPA 4KH4A 2BW2A 4JRQA 4M5HA 1YTUA 3QICA 3ENHA 4GO7X 3SPZA 4LF6F 3MCSA 3D2WA 3F56A 3MR6A 2ASOA 2EK6A 3VF2A 5AQJA 2BJ7A 3VTHA 1AA1B 2W2MP 5B0EA 2HHSA 4LD0A 4CO3A 2OTLN 3JSMB 3ULDA 1UWBA 1RTZA 4USUA 5AFUA 2KJVA 2CQ0A 4FSVA 2BM0A 3CF5L 4IOBA 1JJHA 3AVCA 1DBDA 4U67L 3TTCA 1D9AA 3KUEA 4JKGA 2I5JA 4FLUA 4ID8A 2E9ZA 3J8AA 3CCSN 1CJTA 4CIGA 4K0KJ 1SV5A 5BPNA 2A6AA 2ATQA 4LFAF 2GUPA 5EX5A 1M5KC 5F3TA 4Z4IA 3MMBA 2C22A 3DKDA 3D1OA 2DY9A 1C1CA 4GC7A 2MKHA 1XNRK 2HHHF 1S7IA 1RHUB 3WXMB 4ES1A 1J5EF 3UR0A 4OZ0A 4JI2F 3E2EA 4M5LA 3NDKA 4F4XA 4DSFA 2OI2A 4FK0A 2WW8A 5F8JA 1EKRA 2PO4A 3VQQA 5KFUA 5IT9Y 4EI2A 4ZLNA 5AQFA 1GLEG 3H42A 1ZBFA 4LJMA 3CCQS 2R8JA 3V81A 4PWDA 2LSNA 1ZM9A 5C42A 4YN3B 1HNIA 1LAWA 3CMAS 3B8AX 4DV2J 2EW9A 2EG1A 2BRLA 4DPUA 2W25A 5KTQA 4M5MA 3HOTA 2CQ3A 2XI2A 3VAMA 4JKCA 2BVZA 2DNGA 3NAIA 2V8PA 4B1ZA 2UUAK 1N6QA 1DQ9A 2Z8QA 2J7WA 4YORA 2HWTA 4CW7B 4RCHA 1CZBA 1R8HA 1RAGB 2C2KB 3KLGB 3BQ1A 4HI1A 4CZIA 3OYHA 2Q2RA 4BE2A 3ZNJ1 1N56A 2YQ0A 2E66A 3G25A 4DV0J 4BLGA 2IYIA 3V1QA 2EEYA 3SBTA 2HQFA 4DV1J 1HLUA 4ZCIA 4Y1CA 4WTOB 4USTA 3AJ2A 1S72N 2YQ1A 3AVFA 1M5SA 3OPKA 3S7RA 2CPXA 4RNMA 2VJUA 5K14A 1SJQA 2FJEB 4RW9A 1FNOA 4X62F 5K8MA 1NB7A 2BR0A 5J2QA 1Y3KA 1VRUB 4K5SA 9RUBA 4CM2A 3QEXA 1JJ2R 5CAAA 2DR7A 1PG5B 3KHYA 2HFZA 4FLTA 3DGPB 4HYKA 3FSIA 3CMEN 2B9YA 2GMHA 1RKJA 4I0WA 2B6AA 3OTOK 1IKXA 3ENVA 3OA9A 3MD3A 3Q8VA 4BRPA 4J9NA 3M9MB 1RLCL 3MMVA 4ZVUB 3UR3C 3IM9A 3AV9A 2F8MA 1T7PA 2PN6A 2RDIA 3QMLA 7AT1B 3K8WA 4QQBA 3M9NB 5AXMA 2QXFA 2W41A 1HNWK 2FSNA 1ZZFA 1Q7YT 1A9NB 3J81U 1YDLA 2ZEJA 1RJJA 3I8BA 4J2EA 4KFBB 3MEDB 3OYIA 4CLUA 1ATSA 3OYBA 2EX3A 1UCNA 1H98A 4NLBA 2MQ8A 3ZZUA 2J76E 5BRFA 1RT6B 1LWXA 1JJ2M 1CJKA 3EGWB 3MN7A 4X66F 4O8KA 3N28A 3R5AA 4CLLA 2Q36A 3GIIA 4OLBA 1DQAA 1KTVA 4PKGA 2VODA 2MEWA 5H1SQ 2R7UA 4HTJA 1YWXA 1OS5A 4JK8A 2RHQB 4DF4A 4FJIA 5HATA 1DT9A 4YOEA 1H2UX 3JS9A 2V7YA 1NM2A 2AYEA 4MFBB 2ASPA 4LT6A 4WFAQ 1CLFA 4CBXA 2MSTA 4OX9K 1TL4A 2QKKA 2W2PP 4CH1A 3I55S 4NXMF 1UWAA 5DQHA 5ETLA 3VGTA 2W4DA 4RW7B 3VENA 1B7YB 3VERA 4ZK7M 2D69A 3GBTA 5TKYA 4GKKF 2J7UA 2ZUGA 4K4UA 3O5BA 2XNQA 5DG9A 2FZCB 3K89A 5BRDA 5D8HB 3SAFA 3TAMB 4KV8B 2J4RA 4OI6A 1VSIA 3CJTA 3W2WA 1SJ3P 1WHXA 5KAKA 3HPHA 4Q45A 1YVUA 1YITS 2LA6A 4LBIA 5B09A 1FDAA 1PCAA 3D2FA 4DTNA 1FNXH 1ZM2A 2GBZA 4OLPA 4ZCKA 4ILHA 1QY7A 4BRGA 3DOMB 5CCMA 2RQMA 4DFKA 3H6EA 2OUGA 5DZ6A 3ULEA 4K4ZA 1B92A 2RQKA 2ZH3A 1MWZA 4B8CA 1ZA1B 3A2FA 2GJFA 3SCLE 3Q2TC 3M9OB 1R8CA 4DR6K 3JTNA 2R7TA 3TVKA 3BEGB 4M3YA 4I9QA 3NE6A 2XQCA 4LBPA 3AA3A 3LM2A 3U27A 1VC0A 3N6MA 5BR8J 4JB8B 1RWNB 2K3KA 3M32B 2PI4A 3K5LA 5C25A 3AVHA 4QW9A 3NCRA 3DXKB 1V5VA 4B1UB 1SQEA 2F8EX 2XY7A 3CDAA 4P72A 2CIMA 2MMYA 5B0CA 4FL9A 2ZWOA 2I7NA 4CJRA 2CAJA 2KHOA 1S9EA 1EAYC 4NE9C 4BGAA 1TELA 4CEBA 5F8LA 3HFZB 2GQ2A 4IQXA 1SPBP 4DKWA 2RNEA 2E29A 4MYTA 4QWDA 2E7WA 3H2UB 5IWAJ 3FZLA 2R42A 4ZJLA 2FB0A 4CO1A 2Z1IA 3A5NC 2YV0X 1H7WA 4CP5A 2YNFA 3O2IA 5AZIA 1FDNA 4FDFA 1HQEB 5LOQA 2DPNA 3TEGA 4I9LA 3AD7C 1CZAN 3VAJA 5HJXA 1RBSA 1P1LA 4ED0A 2DNLA 3OVBA 3EPGA 5EUHA 2OIHA 1DJ0A 3LANA 4X2BA 1SCJB 3CCJN 4KY3A 2MSSA 1VDHA 5DM7Q 3CCVN 1VQKS 4NA1A 1QAIA 1HPZB 3TOQA 4F7VA 3C6UB 2A3ZA 1RI7A 1V3SA 1B0TA 1EXQA 3HLUA 5AE3A 1KC8O 3CJ0A 1UVKA 3QWPA 4ENOA 2I7PA 1VRTA 2CH5A 2P51A 3EY1A 4ZPBA 4FZYA 1W26A 1RGVA 2UV8A 2YXLA 2RKIA 3RB0A 2E1CA 4G1QB 1UJ6A 2MLZA 3HVAA 2V4QA 3MM5A 3LP1A 4CLFA 3C7NB 4F2SA 3V1RA 2CPJA 2F7VA 2YHWA 5F1XA 1BXNA 4DL0C 3EZ5A 1X4AA 2ZVSA 4B3TJ 3VQAA 1RAAB 4E1NA 1QVFR 4IH6A 2ZGYA 3ISZA 1WC5A 3P5TL 4PG7A 3HKWA 3T41A 2XSJB 1S1TA 3JAMU 3NF9A 1TUVA 2QLWA 3TYTA 3SCIE 2JVOA 1TKTA 1FK9A 1JQGA 5H9EK 3BDEA 3TI0A 2V0NA 1XR5A 1T9UA 3PR5B 3TAEA 4WP8A 4EFHA 4DL3A 1U6BA 2F9DA 1SB6A 3TEHB 4LF9J 3HULA 3P4IA 3KG0A 4O4GA 3WQTA 3ZETB 4QWBA 2VB6A 1GFWB 1HNXJ 2D0OA 4QS8A 4HTLA 1ZYQA 5BPLA 1UWBB 3K5OA 1SC6A 2D9PA 2VWKA 3L2QA 2MKCA 2GX8A 1J53A 1C0TB 1QVFM 3O1LA 3RVCA 2P2CB 1A7GE 4JV5F 2ZM6J 1LCUA 3IS9B 4NPOA 4DXLA 2R7QA 3CJBA 3FFIB 3FCWA 1UA1A 5M1OA 4CERA 2ZNZA 1JLFB 2OAUA 3CFRA 2EVZA 4USWA 3I6PA 4JKBA 3JSBA 3W61A 3UDEA 4NZ0A 4CI6A 5FPEA 1GLBG 3T9NA 1L5UA 3EGVA 2CGJA 1LQ9A 3ISNC 3OYDA 4W4MA 5EVZA 2DNOA 3GV7B 2WONA 4LF6K 1VQPN 2IFXA 2K7JA 4ER8A 4RLEA 3OSPA 1A5WA 3K0SA 3RMBA 2ZNYA 5BJRA 4BR0A 2WC9A 4YY3F 4Z94A 1FESA 4NLRA 3TARA 4C0OC 4M94A 1RA7A 2ASYA 2CZ4A 2GHVC 3TQ1A 3FR0A 4OLOA 3QIPA 1NJYA 3CCMN 3OTBA 3FCVA 2H3EB 1W9HA 4WU2A 1SH3A 5D78A 2I8EA 2EFVA 3UCZP 3CNQP 2ZOFA 4CNYA 5LMNF 4B9QA 3ET6A 4KTWA 5FIIA 1ATRA 3MCPA 1YGYA 5GAEI 3BY5A 2YH0A 4F50A 2CFXA 4EHTA 3L6QA 1U45A 2P9IA 3CJ9A 4HHJA 3H8YA 1SJFA 2BV3A 2ZBRA 1T9WA 1WLJA 3AODA 2CPEA 4LFBJ 3QT7A 1SL1A 4YOYA 3X3UA 4BR4A 1RA6A 1U2FA 1HNIB 4E1JA 1RTJA 5A8KA 2D4WA 3DRSB 5GMDA 4F3TA 4LFAK 3C6HA 3CM5A 3OLAA 4WFAL 2UVRA 3LF0A 2C3OA 4AILC 3CDWA 1P90A 1D09B 5A8RA 4CZFA 4OPHA 4WCEQ 5GAHU 1GXUA 2HHHK 1XHXA 1B9FA 1NGFA 1VSFA 1J5EK 3QT5A 1KN6A 2I2YA 3OYKA 1NGCA 3T1HJ 4ED2A 4JI2K 2E2QA 2W24A 5CD4H 8ATCB 2FHOB 4OZNA 3TWZA 3QLHA 3H3NO 4HCCA 2BOPA 1TL1A 1TUWA 3UKRA 1IBKF 1KQFB 4WFYA 1GX6A 4RJVA 3HT0A 4KKOB 1RADB 5HLFB 2CGKA 4IG0A 4KQZA 3H0PA 5K14B 4YFUA 2YWFA 5J2QB 4X64F 1XMOF 3PEHA 1LV5A 2ZE2A 1RBRA 4DV3F 1QSYA 1VBYA 5HMYA 3TA2A 1E6VA 1DEJA 3N4PA 5FLXO 4FOEA 1JMTA 2PSZA 4CCHA 1QZ6A 2J0QD 3Q89A 3EEQA 4E7IA 1D9DA 2DH9A 5M1PA 2WTFA 1RZMA 4YDUC 4XDCA 1KLMA 2HHXA 4CGIA 3QFPA 3CC7N 3NGUA 2ATLA 2H51B 5EDWA 4A4JA 3MEKA 3SDEB 2Z4PA 4X62K 1SH2A 2P9GA 4USIA 3ZT1A 3L4IA 5JLFA 3O3FA 4RX6A 4CLKA 5IS2A 1S6PB 3KK1A 3P49B 4BROA 5AQWA 1HIYA 2GTDA 3I0RB 1X5PA 2PEBA 5KFQA 3AY9A 1NK8A 2ZKTA 2ALZA 2W9CB 2HBRB 1MN7A 3PYDA 2XNRA 1H72C 5I3UA 5KFCA 2HFSA 2HIYA 2XULA 4DR5F 4OLAA 1VJWA 3VZIA 4OX8A 1HD1A 2VDIA 2P5GA 4A8SA 1FEHA 3DDIA 3WC2A 4I69A 1F3VA 3UN2A 1OVQA 3THWA 3FVYA 4ZHRA 1KONA 2K1RB 5DM7L 4G9ZA 1RAIB 4X66K 1IM4A 4C3KA 1R0BG 1WSVA 1MU2A 2KRRA 4ZA1A 4JYAK 3KD5E 1KDNA 1Z26A 1XTZA 4CF0A 3DRRB 3HM9A 1FEEA 3I96A 4CNZA 2A18A 1IM6A 1RCOB 1BCOA 1IN0A 4CLTA 4MIWA 3Q8RB 3VHQA 3TVZA 2VH7A 2Q31A 4CLSA 3SSSA 2Q3SA 3PRBA 4G1IA 5C2DA 4F36A 2KFZA 3CETA 3DMJA 2HZAA 1DQ8A 3LH2S 4NXMK 4CHOA 1IKYB 1ZPVA 3DLRA 2LXUA 2P9EA 2IDLA 1R89A 2WZ1A 4WFBQ 4NXNF 4QYZK 2D1CA 2FY1A 5DDQC 2XCAA 1AZSA 1VOMA 3HZEA 1TK5A 1RT1A 3U1LA 4DV5J 4FLVA 2VASA 1VQ7N 4GKKK 1KAYA 3ATVA 3IR7B 3RGIA 3AB2B 2JZ5A 4J9PA 3NGYA 2ZBCA 4L74A 5AR0A 4LIRA 3KLIB 3H7HB 3W9JA 2M88A 4C3MA 1WEZA 2J9CA 1NO8A 3KWMA 2X1AA 4BRCA 3SMPA 1CS4B 2G8HA 3ZNUA 1UVJA 4PYDA 2CQHA 2A41A 1P8ZA 3OFHA 5HANA 2R7OA 2VFVA 1GMWD 2NRHA 1X9JA 5FJ4A 5F8IA 2BKPA 3P6YC 4MKYA 4B1VA 4PG8A 1LW2B 2ZHBA 3O9TA 5E84A 1I1GA 5CYJA 2PYLA 3V9UA 3UD5A 3N01A 4BC2A 3LP2B 2QA4G 1ROFA 5IV3A 5GADI 5AZIB 4KHPJ 3BGUA 4BRNA 5FROA 4K41A 3LDPA 1TAQA 3CCES 1F1BB 3FRZA 3H5YA 5JXSA 3BZKA 2D3UA 2QI2A 4NLTA 4QPTA 1F5CA 4C48A 3H90A 4ED1A 3H45C 2I9SA 1GOBA 4CJSA 3TWHA 1BLUA 5CZVA 4PWWA 2FLLA 4CF8A 1SC3B 5D3GA 2RB7A 3LP0B 1TUUA 2DY4A 3LM9A 4CH7A 3AAPA 4DCHA 2ZF5O 2FJBB 5HRNA 5T14A 4ANCA 4A59A 1KEKA 3S3OA 1VRTB 4PYAA 3T6BA 2AT1B 2O1PA 3KHLA 2OSQA 3OYAA 3B4MA 2XO7A 1NNEA 3DU6A 3PSFA 3SZ2A 3SK3A 2PI5A 1EETA 3VQ7A 2PYJA 1HYSA 1RHRB 4H4KA 3O3HA 1RE1B 2MKIA 1ZS6A 4CJ7A 2FBTA 2B9XA 2A5XA 2CNNB 5B08A 3HI9A 1RT7A 3L2VA 2O8DA 1HJRA 2WBMA 4WCEL 2V9KA 1CPZA 2Q43A 1IQTA 1IBMF 2DT9A 3UKUA 1S1TB 2HK3A 3CT9A 4PQAA 1ZETA 2YWWA 2IVNA 5FLXY 1JXEA 1EO1A 1U09A 3B82A 4K8ZA 1X5TA 4JI8F 2VWBA 4OKKA 5KGXA 2ZC3A 3KLFA 3G2XA 1UJ4A 2QKBA 4A8WA 2XGQA 4FVMA 1G1XA 1M5OC 1BWVA 3A12A 1FRHA 4JI5F 1NJIO 2HRTA 2YNHB 4DX6A 4EP5A 5E3PA 1T3NA 1GLLO 2GC8A 4UTGA 2O67A 1X8DA 4RW4B 3SNNA 4QR0A 2BJ9A 2BE2B 1P1TA 4HHHA 3NFAA 1YUWA 4TLRA 4MK7A 1WC1A 4DX7A 3MM9B 1E4FT 1YVFA 3EZUA 3PW2A 5LJ5Y 3CGIA 2DTUA 3M8SA 2HMPA 3J7YP 3CD5A 3FBBA 2E1RA 3NNAA 3OFFA 2UUWA 2AU0A 4WYWA 1S6QA 1HI8A 3N5FA 4EEYA 3JB9k 2RPIA 4Y2KA 2WONB 2RJZA 4TVAB 3ZT0A 3QNOA 4JOUA 2ZHAA 4I68A 1AXQA 4DWIA 3E9OA 2GIQA 3U9ZA 1N88A 2ZVIA 2HGNA 3ET6B 4JV5K 1Y64A 2P5VA 4Z4HA 2QM1A 3RBEA 4J91A 2VBZA 5LJVA 2DPIA 3ZEUA 1G6BA 4JI7F 4WWSA 3O4QA 2WFBA 1TFWA 2ALYB 1FWKA 1BWFO 3GL1A 1R0CB 4CJEA 2FGCA 4C11A 1T3OA 5GIOA 3X1LB 3CJCA 3U1MA 4QU6A 3SLCA 5IT0A 3WX8A 3PJ9A 1GLCG 2DNZA 1O6XA 1HBNA 5A8RB 5L46A 4NLXA 3L3UA 4YY3K 1R6YA 3KDOA 5K5MA 2IY5B 1CXQA 4IBNA 2UXBF 3SQGB 2BDPA 1X9SA 5AQMA 4U6PA 1HYVA 4BREA 1VSKA 2Y1LB 3VN5A 1KBRA 5LMNK 1ESVA 1CULB 5M2UA 4BR9A 4M1KA 2J5AA 4L3NA 2YTCA 2BKNA 4O44A 2CNOB 2OD6A 1GK8A 3I5BA 4GMKA 4WE1B 3IRXA 4OZ1A 1VQ5S 4K2JA 1U1PA 3FMWA 3HSTB 1Q81O 4USHA 5D77A 2BANB 3I4HX 5HVGA 1QQOA 4CJPA 4R5PB 3O6WA 2Q0UA 1RWPB 4RBTA 2FHJD 4A5BA 1FDBA 3EPIA 1KFDA 3ZX3A 3MCMA 2B43A 4RNHA 4OJ1A 3F5TA 2P9KB 1SS6A 4CJFA 2FLOA 1SJ4P 3MX5A 5KFWA 1BU6O 2RHSB 2H54B 4WFBL 2F65A 3T5LA 5IM0A 1E3MA 2D0AA 1JLEB 1XMQJ 2DNRA 2VBYA 2AD9A 1N36J 4GKJJ 1KQKA 1S6OA 1YLXA 3G4SS 1IBKK 2L3MA 3M05A 1JB0C 1IWAA 2QL7B 4C8OA 1Y5IB 2BTFA 3BBBA 1JCGA 3WZ0A 4HTUA 3DM2B 3R5CA 3VEWA 2ZJQQ 3OHAA 4JK7A 3DHXA 4ETXA 1TV6A 3M8YA 4R8UB 4X64K 1CBKA 3FDSA 3NS6A 1XMOK 1NXIA 2RQCA 1AYEA 1WNEA 2QA4S 4KHRA 3PO5A 1PC5A 4DV3K 4DTPA 2HBJA 3EX7B 5L1JA 1VQ9S 3AOBA 2YBVA 3A5LC 1S1VA 3Q8YA 3R9PA 4ID5A 4IDKA 1FKPA 3BR9A 2J0SD 4F26A 1NGIA 3LPYA 3VGVA 1R0AB 2JC1A 4OKJA 4NZ6A 5KQDA 2WVCA 1KXPA 2PFUA 3BGFA 3HHKA 4EP4A 1T8EA 1WJ9A 3D4JA 5T7LB 4DCPB 2VG5A 1Q82O 4QIVA 3ZZOA 2YKNA 4ERDA 4MJKA 4FJ8A 5M1FA 1BQNA 4NCAA 2GVZB 3L7UA 1FFWB 4V1Ak 3AQOA 2CPYA 5KOWA 5BYQA 4IEEA 2JLGA 2NRVA 2V2QA 3QRRA 2ITMA 4RKUC 2VOPA 4FWLA 4HVJA 2OPRB 3OYGA 3VEOA 3BN4A 2L48A 3VEXA 4YB5A 4DV6F 2Y1JA 5A8WA 1KVJA 2NUUG 4DR5K 1YJTA 3WNEA 4PQUB 2FZGB 3IG1B 1VQ8S 2E1AA 3OYEA 2D0PA 5FLXU 5J2NA 1SI9A 1HWKA 3FBCA 2YWHA 4I2QA 2RDJA 2GS8A 4TKTA 2OZSA 4A8YA 3J7AP 4DFMA 2BUPA 1X3NA 1RT1B 2WOMA 2QIFA 1MROB 3HP6A 3G6ES 3AVKA 4CJWA 3GDQA 3HP9A 1Q5VA 1SUQA 4R0EA 5KFXA 2LECA 4PUOA 2PDAA 1U2VA 5KFNA 2A40A 3I56S 5KT5A 2CQ2A 3PZPA 3BH7B 5L1IA 2KXNB 1HMVA 2P9SA 1JLAB 3OR2A 1U04A 3U1NA 4PEOA 3V4MA 1XNRJ 2DEJA 2MQPA 5LM7E 1UEKA 3A4TA 2M4MA 1M90O 4JD2A 2BE7D 4C6AA 4NX9A 2XHCA 3AJ1A 4IFVA 4DR4F 4NXNK 3FBFA 1GLJO 3W9HA 5D4PA 1S77D 3IGVA 5AQQA 1VQYA 1N32J 3AT1B 1NHUA 1ACMB 2BOAA 4JI0J 1V3ZA 2IC3A 3OS0A 4DLGA 2PC6A 5L39A 4CJ3A 3ILLA 4LQ3A 1IVZA 1S4FA 1YTYA 1FJGJ 4B02A 2GJIA 4DU8A 4J9MA 4LMZA 2ZH8A 5THWA 2JHEA 1RTIB 5LJWA 5A76A 3OL7A 2H5JB 2FTRA 3FFKB 2KH9A 4GVLA 3IAS9 3IBWA 3UPFA 5HVHA 1AUDA 2WW4A 3W7BA 1TKZA 1NOZA 2B7CB 2JGUA 4IZ9A 3G96A 2ZOMA 3NGTA 2R4FA 2RMLA 1WTBA 2JX2A 4CBWA 4GVEA 1RCXB 3CFOA 2OTJN 4OI3A 4DUZF 3HL8A 4FWRA 4FXDA 3M2VA 3D3CJ 3GQCA 2AIRB 3VQPA 2X7IA 1QJHA 2QFIA 3QBXA 2NYIA 4AXIA 2PAVA 1F5BA 3BR8A 4O55A 4IR1A 2CUYA 3KNGA 1WF1A 2QEXS 1O0PA 3C94A 1ZXOA 1S97A 4O4RA 3JXUA 3UFCX 1EQ0A 2ZBIA 1IR1A 3HYFA 3AARA 1JJ4A 1WAFA 3EXYA 4B3MJ 4DR7F 1TL7B 1H6KX 4H0PA 4URGA 1RT3B 2AP6A 5CY4A 2XHWA 4BC7A 5LMUJ 2OLWA 3KHGA 4RWWA 4OHWA 2KT3A 1CXUA 1SXLA 4M42A 5M1NA 1HNWJ 3D0PA 4WPAA 2VL1A 3PRDA 2EG2A 1Q1KA 1JWWA 2O8EB 3THYA 4DBQA 3C14A 2Y0BB 5DM6Q 4X4OA 2G2ZA 3TU5A 1N0UA 3PYEA 4A8OA 5GAGU 3HPGA 1LOUA 1YJ7A 1X4HA 1Q79A 2VG6A 1DKGD 4J9KA 2GA7A 1T95A 3RR8A 2HQDA 3QZ7A 3T1YF 1Y4ZB 4BG8A 1E4GT 4PXEA 3T69A 2NXNA 2C2ZB 3LW5C 3KK2B 3ITHB 3KK3B 1U1LA 2E88A 3M5RA 4RL1A 2W6KA 2HNDA 2IDEA 2AW0A 1IBMK 2MQLA 2DIUA 2RRAA 1IR0A 4FM2A 2HVDA 6AT1B 1KP6A 4LF7J 4Q2MA 4UZCA 4JI8K 2Y8YA 4ECXA 3QAUA 4Q0BA 5AQPA 4OX9J 1S6QB 1NGEA 4I6MB 3NCPA 3DXBA 3DWLA 3HK2A 3DGVA 3RTVA 4CI0B 3A0IX 3VAGA 4BC5A 1Z6RA 4DTMA 4JI5K 2EFOA 2ZH2A 2JEGA 1FRIA 1VI7A 1U1OA 1K0TA 1WBBA 5HP1A 3IAM9 3CO0P 2C28A 3P39A 2ZJQL 2V9WA 3QEPA 4U7BA 2DHSA 1S22A 2R2UA 2UXCF 2O8CB 3ZZ0A 3I82A 4MT1A 5AXNA 5G0RA 4FYWB 3DLGA 4YOWA 4YR0A 3Q0AA 3UDVA 2VONA 1D1UA 2E5IA 4IG3A 8AT1B 1SIWB 1U8SA 3CPEA 3UO0A 1HL6A 3M1VA 2KW4A 2IBOA 3GIKA 2HLUA 4OJGA 3THVA 1WHVA 2IIRA 1QAYA 2CVEA 4CLPA 1WDTA 2HAIA 1RTDB 5IFMA 4CJTA 2E7VA 2FXUA 1YRUA 3AVMA 1OMSA 4K4WA 3KG4A 3KLHA 3E3XA 1UA0A 3WEEA 2AMCB 4QBUA 3OJSA 1Q5YA 1TVRB 3VZHA 1NCLA 1JLQA 1FERA 2QK9A 4KH0B 2D3OR 5EWGA 3OW2M 3VETA 3PUFA 2W8LA 5ADXH 1OIAA 3EE3A 2XMJA 1YZ6A 2CQPA 2AJ4A 2DO4A 3NAEA 4JI7K 4OYIA 1NM1A 2V68A 1F6TA 3A8JA 3ICLA 1N54B 4TXSA 2ZKUA 2G2OA 1BA0A 3H40A 2YPYA 2BQUA 3ENWA 1EQYA 1RB0A 4I1TA 1GOCA 2M52A 2ZQBA 3KK7A 4IXCA 1FX4A 1ZAXA 4ILLA 2HPUA 4F0MA 3UE2A 1O51A 3FQLA 1U26A 4B3RJ 4AHCA 1N33K 4O8UA 4H4MA 4F3OA 2UV8G 2PGCA 3VCDA 2RF2A 3OS2A 1KVBA 1IH7A 2FLPA 4JI4J 2UXBK 3I8DA 4IQMA 3G71N 3BO2A 1NKCA 4ZVQB 1FNMA 3CCTA 2V4RA 1UEUA 4K0KF 5CH7B 3VTIA 4FS2A 4FKXA 1IR2A 1U47A 4AH9A 4CF1A 3SFGA 3DRPB 3D2EA 3U6FA 3VR1A 2IIHA 2P9LB 2Q3PA 3MPDA 3THXB 4YQWA 1WSJA 2DKOB 2B4VA 4P2MA 5HMWA 1B7FA 3LUYA 3W1YC 1WF2A 3HSCA 4YR2A 1XJWB 4EBDA 1FHTA 1HQ2A 1WUUA 2DNNA 1TTHB 1N5YA 2FVSA 3QO9B 2E6LA 1R7IA 2VKZG 3AGKA 5B0BA 4LFCJ 3DYAB 2AGPA 4DX5A 4URSA 3FGUA 4M5DA 4DV2F 1B3TA 4ZVHA 2H65B 3C15A 3K2PA 4C7QA 4K25A 1L3TA 5IC6B 1T44A 5J2MA 4U8VA 2V8VA 4PWUA 2VFUA 3M8WA 4DHYA 5GINA 3V9XA 1BUPA 3GONA 2MB0B 1HWIA 2UVVA 3K58A 4NCGB 2WK4A 2ADCA 2IYGA 2G1DA 3ULHA 2XM3A 4CHZA 1RYRA 1N5VA 2P9PB 2HBQB 4H5RA 1Q53A 3E66A 3I5AA 4DTRA 1RHMB 3Q24A 3KLEB 3HHLA 3DJCA 2HNYA 3CTRA 2DGVA 1XIQA 2MGZA 4DV1F 3HZ6A 3GLJA 4IO1A 5FPNA 2A42A 3MMCB 3RSEB 5B0AA 4OPAA 3TP2A 3NRBA 2RU9A 4QJVA 2EFGA 2VG7B 4ISFA 4PHTX 4FWQA 4MDAA 5A8WB 4P7VA 2BQ3A 3CQYA 3LQVA 1U0HB 4CLWA 3A8KA 1HBOB 1JKHB 3IFRA 4KO0A 1XUPO 5J2NB 1BOTO 3GR1A 4KT0C 4PKHA 1B0VA 1NMEB 4O23A 1ZAWA 3J7Z5 2R2RA 2F9TA 1EWQA 3ZT2A 3A1YG 3BO4A 3CC2S 3IGNA 3OTDA 2IMWP 3CXCM 4ZN1A 1EP4A 1S12A 2AEFA 3CDUA 2PFDA 3QAEA 3S41A 1H3DA 1UETA 3G4SN 5KT3A 1QE1B 1XQIA 4E7LA 4Y2IA 3HM8A 3NBPB 1FF2A 4LF6J 4JHDB 4ZP8A 4DV6K 2BA9A 2NZ4A 2YQ3A 4DR3F 4DV7F 1HMVB 4CT8A 4QZVB 5H1SV 5MAOA 2G8KA 1R6VA 2JEIA 3BF3A 3PKYA 2V4JA 5DM6L 4UUWA 2QA4N 3MWBA 3DXMA 4GY2B 4KH6A 1JK9B 4IFVB 2E9TA 2XTJP 4IRDA 4JS4A 1PYOB 2ACMA 4WKRA 1UTAA 3DFEA 2ERRA 3MHYA 3TAFA 1JLGA 1KCFA 2J7KA 3NMUA 5I4MA 2HB5A 2QA1A 3EMTA 4V19S 5K8PA 1W25A 3IC1A 1MMNA 2AJQA 1RAFB 2OFGX 1IKVA 2IM2A 1EX8A 4OI4A 4LFAJ 2CYYA 2F1FA 4H0VB 3TZZA 4CHPA 1R8PA 3NGIA 4RW8B 2D7SA 2K06A 5ETMA 4FJJA 1W7WA 2YH1A 4ECVA 3D45A 2HHHJ 5B0GA 1Z2LA 3UD3P 4P6QA 2EWHA 3UVJB 1GH8A 1MMLA 3V6DA 4DR4K 1A5VA 3DOKA 3HT3A 4RBUA 1XMBA 3RYLA 3UN3A 4W5RA 1XERA 1NAQA 4TQRA 5HROA 2W2QP 3EICA 3MZIA 4CYUA 2KVIA 5HJYA 4BDZA 1NK5A 3PKMA 1U02A 1RDCA 3TZXA 3KKFA 1S79A 1WEYA 4FJ5A 2E1PA 5C24B 4ZVPB 2AGOA 4MIBA 3CJ7A 2DFEA 1J27A 2XI3A 4FXVA 1PJ7A 2Y8WA 4CJUA 5IC4B 4RU9A 1WSIA 1QUVA 2AQ4A 1S9GA 5DG7A 1EX4A 3S01A 2E5LJ 1JCFA 3C65A 4DTXA 5GIPA 3TJ9A 3MXJA 3HSDA 3CJ4A 4AHSA 3CDEA 4DUZK 5IT4A 3EDRB 3FQKA 1OY8A 4FYVB 1VRQC 3FKBA 2IM1A 7FDRA 3I56N 1ULRA 4E98A 3N5BA 3EGNA 3NEKA 2KO1A 5KRTA 2CRLA 4WQ5A 3FRYA 4NEYA 4K59A 3OUYB 1BD6A 3P5BP 1GLFO 4EWTA 5KG0A 1U49A 4CJLA 2J6TA 3FEZA 3RB4A 3CCRS 2W9BB 5IWAF 1TKDA 3Q8QB 4DR7K 2Y1IA 3BF4A 4BRKA 3NWGA 1URRA 2BJ1A 5E3RA 1ZTTA 2HNDB 1VBKA 2J9DA 2YWEA 1VQLN 2CNLB 2PBDA 2JOQA 3GG1A 1N52B 2DNKA 3MM7A 3D2FB 2R2TA 2FF6A 2WHOA 2CWXA 3C16B 4C23A 3NY0A 4FJKA 2HNZB 2BRKA 3SI8A 3PHTA 2XLIA 2Z1JA 2MLYA 5ETPA 2UVUA 3G82B 3OYCA 5KQ8A 2W8KA 3H25A 4YMEA 3DI6B 1V9OA 2O4IA 4H03B 3VF4A 4FN5A 4E7JA 5J1NA 3LTOA 4DB3A 5HP1B 2WB4A 2AWZA 2ZITA 4X66J 3BB5A 5L1KA 2V6AA 1W2BM 3BGLA 3RB3A 3T1YK 4O5BA 1EARA 3D6MB 3DLGB 4PPZA 1T9XA 3ISND 1IBLF 4AM6A 1RLDA 3MMAB 1S59A 3EE9A 2RHKA 3SBGA 1BI4B 4PXBA 5CE3A 3U02A 5KG7A 3QERA 1SH0A 3GOIA 4DZ6A 3AA5X 2A2CA 3R6LB 2IJFA 5HQ8A 2A6OA 2B0GA 3SUQA 4B3TF 2QX0A 3OFGA 4JKHA 3VQ5A 3RU0A 4NOHA 2B4OA 3A13A 4QYZJ 4KH5A 1NZAA 1MSWD 3R7SB 1I51B 3D7EO 3GV5B 1WSRA 2UXCK 2C3YA 2CJYB 4GKKJ 2GV1A 4WYBA 1QZ5A 1RCHA 4UT4A 2ZUAA 3M8PB 3KLGA 3M6UA 1G2EA 2DO0A 5AE1A 1F5AA 1FKAF 2J6SA 3IM8A 4LF9F 4QWCA 2HHQA 2XMUA 2NXJA 2CJXB 2WVDA 2UUBF 3A3PB 4YOVA 2HQCA 3MFIA 2ZBQA 4LF4F 4YOUA 4NLCA 1HW9A 1YX2A 2N3OA 2L9NA 2PMWA 4YHHF 3R8YA 2ZM6F 2O8BB 1VRUA 1VQOS 3GYNA 3CWJA 1UZDA 2C2NA 5MLCQ 2R2SA 4JI3F 3DGPA 3M4XA 2VDHA 2AYMA 3R1LA 5HRRA 1WN7A 2OEJA