3V81A

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and the nonnucleoside inhibitor nevirapine
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 137
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v81A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v81A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v81A05
2KZMA 2C2RA 4FJIA 3DLGA 4LSLB 2OPQB 3KHLA 1QAJA 2W8KA 3M9OB 2OPRB 4RW7A 3IRXA 4O3PA 1L3UA 1SL2A 1IKVA 3VQ4A 3K2PA 3QIDA 3HK2A 2RKIA 2W8LA 4CF9A 1CSJA 3VQ6A 2HNYA 1S0NA 3VQ9A 1RYRA 4ZVEA 4C8NA 1IKXB 3Q8SB 3DRRA 4J9QA 2BQUA 1BHLA 1G15A 1KLMB 4RUAA 5KFIA 3QINA 1SUQB 4IH5A 1N48A 4CE9A 4NLPA 2OPSB 4ZPDA 1XI1A 4QPXA 3VQ5A 4CK2A 4E0DA 5JS1A 1SKSA 2D0BA 3AVGA 3EPGA 1TK5A 2BE2B 3V6DB 4G3IA 1J9AA 4ZPAA 4ED3A 3LANA 3BR9A 3DLKA 3EY1A 4O4RA 5C5JA 4IOBA 3G86A 3Q8RB 3DMJA 1IKWA 3KNAA 1QHTA 2Z1HA 3VA0A 2AJQA 1BCOA 3KOAA 3BQ2A 1TKXB 5KGXA 4OL8A 4TYAA 2D41A 2A1RA 4I2PB 5KTQA 2VG7B 4KPYA 4LSNB 5C25B 2QK9A 5HLFB 1BGXT 5K14A 1KTQA 4CJ5A 2QV6A 2UUWA 2C2DA 2Z1GA 1HNVA 3ZSQA 3BDPA 4IG3A 2JEIA 1NKBA 1HMVB 3NF6A 3DLGB 2FVCA 3OVNA 4DS4A 4FJJA 3HP6A 3D0PA 2AGPA 4DTPA 3OYCA 3IRXB 4IFYA 4B9LA 3OYLA 1S1WA 2FBYA 1SL0A 4DTXA 3AVHA 2RKIB 1ZBLA 4FM2A 4NLDA 1N5YA 4MK8A 4GC7A 3DRRB 1LW0A 4FLWA 4LH5A 1U48A 5KFGA 1TK8A 3CFOA 3GILA 5J2QA 3DRSA 2I1RA 3WNGA 1UOCA 4O3NA 1NJWA 3GV7B 3OS1A 4DG1A 3V6HA 3M8RA 4RNHA 3DLKB 4NLUA 1K1QA 3HVWA 2G8WA 5KT4A 2WCXA 5DQHA 4FLXA 3PVXA 3QEIA 4J9SA 3RWUA 4FJ8A 3H40A 2FJVA 3DMJB 4IFVB 4K4WA 1IKWB 2HHWA 3IGVA 4RNFA 4DSJA 3SPZA 5DQGA 2V9WA 4Y34A 1TAUA 3LP3A 4CF1A 4QWAA 4JV1A 5L1JA 4OGEA 4CEQA 2ATLA 3DOLB 4C8LA 4XO0A 1A5VA 5L9XA 5K14B 4KREA 1EX4A 3SI6A 3K5LA 1HNVB 4FJMA 4OLBA 4U6PA 1CZ9A 1D9FA 2R8JA 4Z4FA 4AHVA 3PR4A 4KHWA 2WOMA 1S1WB 2BQRA 4CGDA 3NGZA 1DTQA 5KGWA 5KFAA 4CJTA 5I42B 2XI3A 2HHXA 4K4SA 1BISA 5KFWA 3AO1A 1U49A 3CQ8A 1N5YB 3ZSVA 1NKCA 1LW0B 4Y2AA 4F3TA 3RB6A 5KT6A 3M8QA 2C2EA 3DYAB 1YT3A 2FBXA 1NJZA 1U4BA 4I2QA 4ECQA 4CF2A 4ZP7A 3V1RA 3DLEA 3T5LA 1SH2A 4DWIA 3T5HA 4DG1B 2V0NA 4O4GA 2WRMA 3NF8A 3ISNC 4FBTA 4J2BA 5KG7A 4ECUA 3TARA 4GVMA 3SQ4A 2G8FA 4JUZA 3CDEA 5HP1B 4IRCA 4NYZA 5F8GA 3VQCA 3I5AA 4HCCA 1XC9A 2E6LA 1TV6A 4OKKA 2KFZA 4HUGA 4J9PA 3LWMA 1B92A 2YKMA 1KLNA 3TAEA 3M9NB 1S6PA 2R2UA 3T5JA 2JGUA 4M41A 4DL3A 1WN7A 4WZQA 1LWEA 2ITGA 2DFHA 1HYVA 4C8MA 1JLQA 2IAJA 4YR0A 3PO4A 1HQEA 4CGIA 2I5JB 4DTRA 3OHBA 2AX1A 3VQQA 4JRQA 2WOMB 2ILZA 4TQRA 3OHAA 3E01A 4W5OA 3V6JA 2EX3A 1XR5A 4HUFA 3VN5A 2RDIA 5FDLA 3OYGA 5KFXA 1VRTB 1WSFA 2WTFA 3AVAA 3L3VA 4DU4A 1EP4B 2YV0X 1GX5A 3H08A 4Q5VA 4CJLA 2QKBA 1JLFA 4JS4A 1RT7A 3TAPA 3RB4A 2XCPA 4O4GB 3QEXA 1NNDA 3ALYA 4ZPCA 3BSCA 2IGIA 4FJ7A 4QAGA 3H59A 3NH1A 4RW4B 3OYDA 4K8ZA 3OS2A 2OZSA 1WNEA 2AU0A 1L3SA 2ZKUA 4F4WA 4O0IA 2GBZA 2XCAA 1TV6B 2UVUA 4AHTA 2XY8A 4EEYA 1QSYA 1HQUB 3MR5A 2IC3A 5EWGA 4CHPA 3D28A 3S3OA 1S6PB 3AV9A 3KLIA 1C6VA 2FVRA 3U3GA 2W7PA 3SI8A 4OPJA 1HARA 3ITHA 4O44B 2AX0A 1LWEB 4FW2A 2R8KA 1S97A 3MTKA 3QYYA 3SCXA 1HQEB 3HSTB 1IKYA 4PUOA 3GYNA 1SKRA 2BDPA 3H5YA 4NRUA 4DLEA 2G8UA 2EC0A 1WSGA 4NCAA 1Z26A 3JSMA 1HRHA 3AA2A 1HJRA 4Q8EA 3UQSA 3HPHA 4FS1A 4CCHA 1DLOA 4J2AA 4DQQA 4F4YA 1VSEA 1JXEA 3QLHA 1NK7A 4KB1A 1JLEA 3CWJA 3UDLA 1XR7A 4EP4A 3V4IA 1IO2A 1NK6A 2HVIA 3FDSA 1C0UA 2W9AA 1B9DA 3AA4A 1T03A 1JLFB 1WSHA 3ZSYA 2VWJA 1RT7B 4KV8A 3HHKA 4Q43A 4NLGA 4Z4HA 4AHRA 3C6TA 2DFFA 1YVUA 3PX4A 1XWLA 3RRGA 2KZZA 2VA2A 4ED7A 2Q3SA 5JS2A 3HM9A 4LSLA 2OPQA 3TAQA 4EYHB 4N41A 3TAFA 1GX6A 2GIQA 2OPRA 4FJXA 1ASUA 1RDDA 1SKWA 4K4VA 2QXFA 3V1OA 2IC3B 2IM2A 4F4ZA 1NJXA 2HWIA 3TAMA 4ZP8A 3KHRA 4BDYA 1ZBHA 4ZTJA 4Q8FA 3KLVA 4Z4CA 3HVTB 3ITHB 1S4FA 1MMLA 4R8UA 3CO9A 1WSEA 3PW7A 1IKXA 4R5PB 4FLTA 2ETJA 3HXMA 1IKYB 4NZ0A 4LY7A 1SUQA 4CIFA 3VQ8A 1SH3A 4PUOB 1O1WA 3K5OA 4CJQA 1KVCA 5KT2A 4NLXA 3JYTA 1SH0A 4ZVGA 4I7FB 4CK1A 2ALZA 1T7PA 3LZIA 3JSMB 5JXSA 3UR0A 5EDWA 2PZSA 3F9KA 2PYLA 5HBMA 4ECTA 1JIHA 1DLOB 4FW1A 3KMSA 4ID5A 2KTQA 2CJQA 5HRNA 4FLVA 4FYDA 3MEDA 1LAWA 4OPKA 3QLHB 3QIPA 2ASLA 1JLEB 5KFTA 5KFRA 3KK1A 3H5XA 3V4IB 1D8YA 3OJSA 3QERA 1TKXA 1R0AA 4DQPA 4IKAA 4ELUA 2O4IA 3LP2A 1C0UB 3GIKA 4FLUA 4AILC 3CIZA 1T03B 1T8EA 4TSXA 5KG0A 4I2PA 4FBUA 3NL0A 4E1MA 4M42A 4KV8B 1Y97A 4DL2A 4YQWA 1U47A 4LSNA 2D3UA 1Q8IA 1MU2A 3C6TB 3AVIA 4YR2A 2IMWP 3BSNA 3SNNA 1NK4A 1UWBA 3HVRA 3IG1A 3C95A 1HMVA 1UA0A 2JEFA 2HHUA 3SUPA 1JL2A 3KKRA 2YKNA 1S6QB 2ILYA 3VQ7A 4CGJA 3CJ3A 5HRSA 4H54A 3MR3A 4M3XA 2F8TA 1S0MA 4QWBA 3NH0A 2IOCA 4Q45A 3TAMB 3AVLA 3DLHA 4MFBA 4FJHA 2HW3A 1ITGA 3RMBA 5KFCA 4R8UB 3HKWA 2P51A 4CF0A 3MECA 1TGOA 4CHNA 3OS0A 4LH4A 4JV2A 4ED2A 3WNHA 1RT6B 3FRZA 2V4QA 4CFBA 5SWMA 4M3WA 3T1AA 5KRTA 5CZ1A 3JYTB 3K59A 3BSAA 1A5WA 3ZT1A 2X6SA 3L2UA 1F21A 3PV8A 3AO4A 3UPFA 5HBMB 2XC9A 3KLEA 4O55A 4DSKA 4MKBA 1N6QA 2FVQA 4TYBA 4ECWA 5KI6A 5KG2A 4ID5B 1IM4A 5L1IA 1RDCA 3ZSWA 4DFMA 3MEDB 1TL3A 3LAKA 4IFVA 5C24A 2XGQA 5KG6A 3QIPB 1UA1A 4PWDA 3CJ5A 3KK1B 3QNNA 5DK5A 1R0AB 3LP2B 2HMIA 1S9FA 4J9OA 4IRDA 3NFAA 4Y3CA 3DOLA 4B9MA 3NF9A 2E9RX 4GW6A 3LPUA 1MU2B 3L8BA 4CJFA 3V9WA 4RNMA 2W9BA 3SQ0A 4DL6A 4RNNA 1UWBB 3IG1B 2PY5A 4IH6A 3SJJA 4ZVFA 5CYQA 1GOBA 1KSPA 4ECYA 4IH7A 4RUCA 1SV5A 2YKNB 3ZT2A 1NK8A 2FBTA 2IDOA 4CJ3A 3LDSA 4PY5A 1S1UA 1EETA 3MEGA 1T94A 4YR3A 2NUBA 1ZBUA 5L1KA 3N6NA 5I42A 4MFBB 4KHRA 3RMCA 3AO5A 3BGRB 1VSKA 1WNSA 3AVNA 1D5AA 3OL6A 3MECB 2J6TA 1A5XA 4HYKA 1XHXA 2O4GA 1JL1A 3OJUA 3DYAA 1KVAA 3TQ1A 3EYZA 1KRPA 4DL4A 3Q8PB 1Q9XA 4IKFA 2HNZA 4CGFA 2A1SA 2IM1A 1JLAB 2XHBA 1RDBA 1KFSA 4URQU 1OS5A 5T7BA 3LALA 4DSFA 1U45A 3C6UB 3KLEB 3EZ5A 5KG4A 1N6QB 5JUMA 3OLAA 3CDUA 4FLYA 3SQ1A 4NCBA 5HP1A 3VQDA 1TL3B 4ED0A 1C2PA 3TAGA 5C24B 4PWDB 3QETA 3NKYA 4OGCA 4ECSA 4CHYA 2P1JA 3K5MA 3NAEA 4KFBA 2HMIB 4KTQA 1J53A 1TP7A 3V9ZA 4F2SA 4AH9A 2DTUA 5KT5A 1TVRA 2O5DA 3H4DA 2G8HA 2W9BB 3KKSA 2FJWA 1TKTA 4PQUA 2BANB 2I5JA 3OYIA 5CYQB 4OLAA 1SV5B 3ZSZA 2AGOA 5DQIA 3NE6A 3S3MA 4IQXA 2G8VA 3MEEA 4CEDA 1S1UB 1EETB 3MEGB 3P83D 3ISND 4R0EA 4WXWA 1RAJA 3KK3A 4IG0A 4KB7A 4FJKA 4HHTA 4MK9A 2IM0A 5DGBA 4B9NA 3CDWA 1NK5A 4IR1A 2JEGA 2VG5A 1VRTA 1EP4A 4RW9A 3RBDA 3PZPA 2HNZB 1ASWA 4OJRA 2G8IA 2F8EX 2GUIA 4CECA 4CJEA 2HHSA 1TKZA 4CIGA 3TABA 1HNIA 4RW4A 1D9DA 1BQMA 3RBEA 4DTSA 4AHUA 3AVFA 3G10A 2W9CA 3T19A 4QW9A 1VRUA 3IGNA 5DG7A 2QE5A 4CEEA 1W25A 4DSEA 1HQUA 3P1GA 1RYSA 3VQSA 4Q44A 4KFBB 4W5RA 4FS2A 3K58A 2HHVA 3SQ2A 4C8KA 3L2WA 4M3RA 1C1BB 4O44A 1TVRB 2KFNA 2CKWA 4QCLA 3RAXA 2R2RA 3GIMA 3GQCA 3KLGA 1TKTB 4BACA 4WYWA 4PQUB 2DPJA 1S1XA 1S1TA 2YNFA 3OYKA 3AO3A 4NYNA 1BL3A 4DTMA 1C1CA 2X74A 3QEPA 1CZBA 5KFHA 4DLGA 3MEEB 2YNIA 3CG7A 3G6VA 1QSLA 4FJGA 4UQGA 4FZYA 3KK3B 4IG0B 1X1PA 5KFUA 4WFYA 4CFAA 2FC0A 3ZT4A 2E4LA 3ZT0A 1L3VA 4XPEA 4DEZA 4EYIB 2ASJA 3H5UA 5F9LA 1S9GA 2VG5B 3TR8A 4RW9B 4JS5A 3OLBA 3I8DA 2YHBA 4O3QA 4EZ6A 3BSOA 1BIUA 3NAHA 3HPOA 1IG9A 4WYLA 3TVKA 4F2RA 3B6PA 2Y1JA 1RTHB 1TKZB 5F8MA 1LWFA 1HNIB 4W5TA 3RAQA 1JKHA 1ZYQA 3OL9A 4X2BA 4KHSA 4ZMMA 4EBDA 1RDRA 1BQMB 3NGYA 4CESA 1WAJA 1TQLA 2W9CB 1FKPA 1VRUB 1Q9YA 1XR6A 1JX4A 4LQ3A 3PW4A 5F8JA 1RTDA 4WE1A 4CJPA 4M3YA 1I6JA 4IR9A 4ZP6A 4M45A 2RF2A 2J6SA 3PO5A 1U04A 2FLLA 3CYMA 4OKEA 3G6XA 2XY5A 3PX0A 2DFEA 2UUTA 3M9MB 2WHOA 2XY6A 3HVTA 4DL7A 4CJVA 3ZSOA 4KAIA 4R5PA 3QNOA 2IBKA 1VSMA 3KLGB 4BE0A 1S1XB 1S1TB 4J9KA 2YNFB 2FVPA 4F50A 1DTTA 3OL8A 1C1CB 2R2SA 4BE1A 5KFJA 4U7CA 4I7FA 4CJWA 2YNIB 3CFRA 2DPIA 4NLRA 4ICLA 4B9SA 4ZVHA 1RBTA 3DLRA 3U6FA 1KHVA 4WFXA 2B5JA 3M8PB 1UAXA 4DF4A 3H98A 1S9GB 3HYFA 5J2PA 3CJ0A 4LD0A 3SYZA 4O5BA 4E7LA 3IN5A 4CERA 1KVBA 2XI2A 3F73A 3KD1E 3PHEA 5DGAA 1WLJA 2P5GA 4KO0B 1KFDA 4ID1A 4CFDA 4NLTA 1KHWA 3H4BA 2JEJA 5E41A 2BRKA 2IS3A 1LWFB 4Y2CA 4FZXC 1JKHB 2C22A 4E7JA 1RT3A 2KQ2A 1SL1A 3SZ2A 4YMEA 4MIBA 1FKPB 3NF7A 5KFEA 4KHNA 1S6QA 1RTDB 4WE1B 3MXIA 4H8KA 3S9HA 3TWHA 1S49A 1L5UA 2RF2B 4QOZB 3MXMA 1BQNA 2BQ3A 3WNEA 3ICLA 5SZTA 2WB4A 4KE5A 4DTJA 2E9ZA 1N4LA 2ATQA 3TANA 4DMNA 3LWLA 2XRIA 4KHMA 5EUHA 2D0CA 1GOAA 2HVHA 4BDPA 4J9NA 4EP5A 2E9TA 4E89A 1RT6A 4KKOA 4ED6A 1C0TB 3ULDA 5FRMA 1JLCB 4ECVA 1DTTB 1VSIA 3UIQA 3OYJA 1GOCA 1RT1B 4NLSA 1L3TA 3SV3A 4ICLB 2FLPA 2RN2A 3HL8A 5HROA 4N56A 4E7IA 1BI4B 2B5JB 5F8NA 3DOKA 3VQAA 4K4XA 4E3SA 4F4KA 4DL5A 4EO6A 3Q8QB 1RA7A 4ZP9A 3MR6A 4ED8A 3CM6A 4Z4EA 3CVKA 5J2PB 1RILA 2DY4A 4TY8A 4ECZA 1VSJA 1FK9A 1JLGB 2X6NA 1ZBIA 1HPZA 4NLOA 3HT3A 3CJ2A 4TQSA 4B3OB 3HVAA 1EXQA 2YNHA 3KMQA 2Z1IA 1NOYA 3OYFA 1J54A 4C8OA 3H5SA 3KHHA 3DDKA 1HYZA 1RT3B 4TLRA 3O3GA 4CF8A 1LAVA 2ZQBA 4MKAA 3KD5E 3AA3A 3PW0A 5FROA 3C94A 1N56A 1EKEA 3KLFA 1WSIA 5CYMB 4DQIA 5KG3A 3QZ7A 4YP3A 1BQNB 4O0JA 2D7SA 5KFNA 2R8HA 3U3YA 1BCMA 4DSLA 2JLEA 3MXJA 4NRTA 2B43A 2R8GA 4RW6B 2J6UA 3BGRA 1I3AA 3AVKA 1S48A 4CJUA 2UVWA 3KLHA 3AVCA 3VA3A 4EO8A 1CXQA 4CEAA 3I0RA 2HNDB 2F8SA 4KKOB 2D5RA 1RBVA 3L2RA 1C0MA 4CGHA 1QSSA 3H2LA 4CFCA 4M95A 4B9VA 1JLAA 4WXOA 3D5MA 1W0HA 4AHCA 3EZUA 4FK0A 5J2NA 3I5CA 2UVRA 1T05A 1BIZA 3C6UA 5HROB 2FBVA 3OY9A 3E51A 3LP0B 3MAQA 1VSLA 4E7HA 3QEWA 2B4JA 3DOKB 4RNOA 4J2DA 2FLNA 1W9HA 1WAFA 4TY8B 4CEBA 2GV9A 1FK9B 5F9NA 4MH8A 3LZJA 4KHQA 3NBPA 1B9FA 1RTJB 1TKDA 1HPZB 2GIRA 2IJFA 3MR2A 3K57A 2YNHB 2W42A 5KFBA 4OKJA 5FRNA 1QE1A 2HHQA 5KRSA 1RT2A 3P5JA 4J9MA 4FZZA 4K50A 3O3FA 1K6YA 3OYNA 4M3TA 3QZ8A 2PYJA 2BANA 2FVSA 5HRRA 1ZBFA 1NJYA 4CJKA 4CHZA 4IRKA 3QEVA 3KLFB 1X9MA 3DI6A 2OYQA 4BDZA 4I9QA 1CXUA 4ZTFA 5DLGA 4RZRA 3KJVA 4QWCA 2XWYA 4K4TA 3VQBA 1FXXA 1QTMA 4M94A 3MF5A 4JLHA 2G8KA 3KLHB 5F8HA 1K1SA 5KFMA 4RW7B 4KTWA 3I0RB 4JRPA 4CEZA 1VSDA 4K8XA 4EZ9A 3PJWA 5HRPA 1IKVB 2ZD1A 3SV4A 2OA8A 2W7OA 4Z4IA 3QGIA 1RT4A 2HNYB 1D0EA 1QQCA 1QS4A 3VQPA 5J2NB 3PJXA 1T05B 3GIJA 3O3HA 4WZMA 3RR8A 1FKOA 3RB3A 1NHUA 3KHGA 1NK9A 4DF8A 3WNFA 5T14A 4DTNA 2RPIA 2B6AA 3OYEA 4DS5A 4J9LA 4KTZA 2FJXA 2C28A 3NBPB 4MIAA 4FJ9A 3IAYA 3O4QA 3OL7A 2IJNA 4G1QA 4DQSA 5I3UA 3PY8A 4IDKA 4URSA 1C1BA 5D3GA 1QE1B 1NKEA 3D45A 4DU3A 3NHGA 4O3OA 4RG8A 1RT2B 4FJLA 3SUNA 1ZETA 3VQEA 4FJNA 3KIOA 2RDJA 4ZPBA 1C1AA 3RB0A 4DTUA 4DFKA 4KHYA 2AQ4A 3DI6B 3DM2A 1TL1A 3G0ZA 3CM5A 2OPPA 5KFDA 4RW8A 3KJVB 1QAIA 1QUVA 1VSFA 4PA1A 4IG3B 3LPTA 1ZTTA 4CJSA 5EWFA 4CIEA 4F8RA 4EBCA 4IFYB 3LP1A 4CEFA 4B8CA 2ZD1B 2OZMA 3MFIA 2VA3A 4KHUA 3BQ0A 3AA5X 4M3UA 3FQLA 5KFVA 1RT4B 4CHOA 3LAMA 4Y1DA 1RTHA 2GC8A 3A2FA 2R8IA 1FKOB 4WFZA 3ASMA 4NLQA 1WSJA 3KK2A 3V81A 4CGGA 5J2QB 2B6AB 4FVMA 4QWDA 3DRSB 4RU9A 4URGA 2R7YA 3SFUA 1RCHA 2ZE2A 4O3SA 5KFQA 1Z4UA 1YVFA 3BREA 1XHZA 3V1QA 3I5BA 4G1QB 2IA6A 1NOZA 5I3UB 4IDKB 1RBRA 4FK4A 3N6MA 5KFFA 5D3GB 4DFPA 4F3OA 5KFYA 3PX6A 4HTUA 5J2MA 2YNGA 3NCIA 3L3UA 3L2QA 4K4ZA 4O3RA 3BQ1A 4IBNA 5L1LA 5KT7A 3SFGA 2V4RA 4K4YA 4H4MA 4DSIA 3DM2B 1TL1B 4I9LA 4NCGA 1VK0A 2OPPB 3NH2A 5DG8A 2E6MA 4RW8B 3BJYA 2HWHA 4HUEA 1TAQA 3THVA 3O4NA 3FSIA 4QWEA 4N47A 3M8PA 1KCFA 3NDKA 3LP1B 3PW2A 4BE2A 4DFJA 2AWZA 1RTIA 4Z4GA 4FK2A 2VWKA 1DTQB 4MQ3A 3OYAA 4KO0A 4BWJA 1YTUA 4DTOA 3EPIA 3OSPA 4W5QA 3N6LA 3FFIA 3M8QB 4FJ5A 3HPGA 5KFSA 1REVA 3KK2B 3V81B 4I2QB 4CK3A 2AGQA 4LQ9A 2Y1IA 4Y1CA 3L2VA 2WK4A 5F8IA 3DLEB 2JC0A 3T5KA 2ZE2B 4BWMA 4Q0BA 1JLBA 3RMDA 3ZCMA 1T3NA 2VG6A 3QGGA 4Z0UA 4YNQA 4ELTA 4AHSA 1D1UA 3SPYA 4JV0A 3ZSRA 4KI4A 3S3NA 1NK0A 1RA6A 3HJFA 3AVJA 1JXBA 4B08A 2KW4A 5C42A 2XO7A 4M3ZA 4B8AB 1RBSA 4E7KA 2YKMB 5J2MB 2YNGB 4GC6A 4GMJB 1C0TA 4KSEB 3GV8B 4B9TA 5J1EA 3V6KA 1JLCA 3DLBA 3M8SA 1RT5A 4CEOA 1S1VA 4DU1A 2HHTA 3OYMA 2QKKA 4H4MB 5EWEA 1RT1A 3IS9A 4CJRA 4NCGB 1JLQB 3QIOA 4E1NA 5CZ2A 2IAJB 1RDAA 2HAIA 4HVJA 1BI4A 1LW2A 4FXDA 3TI0A 2Z1JA 3V9UA 5KFKA 4MK7A 4NLWA 4NYFA 3AO2A 1RTIB 3MFHA 1JLGA 4CJ4A 3E01B 3I0SA 1ASVA 4K4UA 1U09A 1NHVA 4H4OA 1LWCA 4B3OA 5KFOA 5KG5A 5FDLB 2X78A 2WONA 4J2EA 4CHQA 4ELVA 2JC1A 2BGGA 5KFLA 4N5SA 4KAZA 2F96A 3PUFA 3FFIB 1HYSA 5F8LA 1ZTWA 4FLZA 4ECXA 4HCBA 4QW8A 1S9EA 1REVB 4B9UA 4HKQA 3V9XA 3OYBA 4XPCA 3V9SA 1J5OA 4DQRA 4ED1A 4ZHRA 3GIIA 3NMAA 3DRPA 4TXSA 3QO9A 3AVBA 4F4XA 5DLFA 4Q0BB 5CYMA 5CY4A 1JLBB 4ECRA 1S10A 2VG6B 3SUOA 1LV5A 3PR5B 2R2TA 5KT3A 1RNHA 4OVLA 1IH7A 3ZSXA 5KFZA 1JXLA 1X9WA 4RW6A 2HB5A 5C42B 3RR7A 4KBIA 3KTQA 3G6YA 4FM1A 4TN2A 1RBUA 4NLVA 2HNDA 2D3ZA 3GV5B 4W5NA 1X9SA 3OSNA 2OH2A 5J1EB 4TY9A 3KLIB 1RT5B 1Z25A 3AVMA 1S1VB 1CLQA 4N76A 3IS9B 1S5JA 4EBEA 3SUQA 3B6OA 2EHGA 1KLMA 3LP0A 3HP9A 3QGHA 3NGIA 2XGPA 1VSHA 1LW2B 2OPSA 5DG9A 3NGDA 2BR0A 1S0OA 2D0AA 2XY7A 3NAIA 5DMRA 1YTAA 3T3FA 2BE2A 3V6DA 3QESA 2IM3A 3I0SB 4FCYA 1RTJA 4H4OB 5EU7A 4YFUA 1LWCB 3K5NA 5KG1A 2UVVA 2WONB 4L8RB 4XIUA 1HYSB 3OYHA 3CFPA 3RTVA 2P5OA 1S9EB 2ASDA 1I39A 4KI6A 3RRHA 2LSNA 3RMAA 3FQKA 3PW5A 1J5OB 4ZHRB 4E19A 3DRPB 3QO9B 2VG7A 2BRLA 1TK0A 4NLYA 5KFPA 5C25A 4KB0A 4J9RA 3ZT3A 4KRFA 5HLFA 3HO1A 3CJ4A 2YHAA 4FM0A
chains in the Genus database with same CATH superfamily
1XTZA 2M70A 3EM1A 1UFWA 3IC1A 2AYGA 3F9MA 3SCKE 1DZ5A 3J80O 3KHLA 4RW7A 1FWLA 1EX8A 1L3UA 3CD6S 2G0JA 2HLUA 4CM2A 3M3ZA 4PZVA 3LH2S 3JAMY 2YX7A 1CSJA 4LF6F 3VQ9A 1HHQA 3BO2A 4C8NA 5TKYA 3TVZA 1DY3A 2O1PA 2CGLA 1KLMB 4ES2A 3KG0A 4CE9A 5H1SQ 4P74A 5JS1A 3CJTA 4BRPA 3GCXP 1XBWA 3EPGA 4M5DA 3Q0AA 3DJCA 4QU6A 2BE2B 2CJAA 4KBOA 4P9SA 1G99A 3EY1A 5C5JA 4CO3A 2BXJA 3TP2A 3G86A 5BYSA 4U7UD 4F0MA 3DMJA 4DR2J 1IKWA 3HHEA 4K5SA 1WC4A 1QHTA 3VA0A 3A3NB 3BQ2A 4TYAA 2D41A 2Y0SD 1UW4A 4DUYJ 5KTQA 2VG7B 3QWUA 2DNOA 4MYTA 5C25B 3C16B 2QK9A 2E44A 1KTQA 1BGXT 1MG7A 2BMBA 2C2DA 2Z1GA 2VC1A 4DR3K 3OVNA 4X66J 3SMZA 4DTPA 4B9LA 3Q24A 3MN6A 4FKYA 1FESA 4Q7AA 1UVMA 3CJKA 2P2CB 3AVHA 3CDAA 2MKSA 2AP6A 2H4YB 1ZBLA 1IUJA 4NLDA 3I4PA 2EKYA 2GO8A 4MK8A 4GC7A 5HMYA 1NSAA 5ETMA 2OTJS 5KFGA 3PFOA 2WVDA 2DNHA 3Q2TC 4ZLJA 2R3VA 4U7UK 1UEKA 2I1RA 1NZAA 2XYPB 1RDWX 1IJEB 3SMPA 5D4NA 4YDUA 1RXOB 4RNHA 3DLKB 2BUPA 3QEIA 3RWUA 3NVMA 3A12A 4IFVB 4F0HA 3IGVA 1N52B 4DSJA 4BRIA 2QM1A 3MR7A 5HATA 2KXNB 3IBWA 4DUTA 2V9WA 3R7SB 1UL3A 3E8OA 3VGTA 1ZZNA 3BGFA 4L3NA 1NJIT 1F3FA 2E66A 4OGEA 4CEQA 4UZCA 3DOLB 4XO0A 2BX6A 5L9XA 5GIOA 2MZJA 4KREA 2E1PA 1EX4A 2OAUA 2H4WB 8ATCB 2HVZA 4NYPA 1CZ9A 3R3TA 3KVGA 4AHVA 1OH8A 3HFKA 2J9DA 1FVSA 3NRBA 2ZZNA 3VEXA 1YBTA 3BP8A 3O08A 3I6PA 3NGZA 5KGWA 4ER8A 5I42B 1DQAA 1BISA 4JKHA 1U49A 1N5YB 3ZSVA 3BF1A 4KH6A 1LW0B 2A6MA 2AJFE 5KT6A 3M8QA 2C2EA 3FGUA 4AM6A 5BPLA 2VASA 5EY4A 2K1RB 3LGHA 4I64A 2NQPA 2RT3A 2GV1A 3UE5A 1KQGB 2MQOA 4DWIA 1BUXA 2WRMA 4FBTA 4J2BA 5KG7A 5B0DA 1VQ9N 1K73T 3SQ4A 5KOXA 3GIRA 2XMMA 2J9DE 5A8WB 4JV5K 4IRCA 3D2FA 1S79A 4HCCA 4K25A 2E6LA 3LWMA 1AUDA 2BA9A 2AZ3A 3NMRA 2JGUA 3T5JA 2HFSA 4H5VA 2J9EA 2V2ZA 4LIWA 4M41A 4B3TK 3QT6A 2DNRA 1WN7A 2NRVA 4WZQA 1LWEA 2ITGA 2JWNA 1HYVA 1E3MA 4C8MA 1JLQA 5AZJB 2FZKB 5AQZA 1HQEA 4DTRA 3HDSA 4BRQA 4CLTA 2ZHBA 4HT7A 4C3MA 2M7SA 1EB0A 4PG5A 4TQRA 3V6JA 4IWVA 2IDEA 3O8WA 1VQ5S 1LK5A 4LF6K 1VFJA 2APOA 2RDIA 5FDLA 4AE5A 3M6UA 2WVEA 2I6WA 2FXUA 9ATCB 2MGZB 2QA4N 1X0PA 3OFGA 1GFWB 3I55N 2YV0X 3SMSA 1VQSA 4YB1P 2AJ2A 3HOSA 1WOQA 1RAGB 3RB4A 4O4GB 1SAZA 3BSCA 1V3RA 3H59A 4BRMA 1C4CA 2HLTA 3OYDA 1H0HB 4CVNE 4LFAF 2AU0A 2ZKUA 4O0IA 4UQTA 4X4NA 3KUEA 2GBZA 5T41A 1OSDA 2XY8A 3U27A 2P9UB 1UPMB 5BR8F 3DHXA 4EI2A 3AV9A 2FVRA 1HWKA 1NU0A 3NMUA 3VWSA 1CJVA 3SI8A 3ITHA 2AX0A 1KR4A 4LC9B 4J8FA 4BY9C 1FJGF 2E7VA 1J5EK 2WBNA 1SKRA 2CJYB 3H5YA 2IYIA 4NRUA 3B78A 4DV3F 2Q6CA 2K06A 3RG6A 3PYGA 5A0YA 1RUSA 1X60A 4BRCA 4Q8EA 4I0WA 5AQXA 3ZZPA 4ZOSA 4PXEA 1ZS6A 3HI9A 4OZLA 5GAGP 1VSEA 1XR7A 1UVLA 4FF4A 1NK6A 3F2KA 4C6AA 5HVFA 3FSYA 2W9AA 1Q86O 1V9OA 3ZSYA 2VWJA 5IOLA 1RT7B 3R3LA 1RSCA 3BEXA 4MYUA 4ZITA 4Z4HA 4AHRA 3C6TA 3D2WA 2D3O1 4M63A 5BR9A 2A42A 2NZTA 2DRBA 4N41A 1B64A 5CAAA 1F5BA 2E5GA 3FBFA 1HWLA 4CZIA 3THXB 2QXFA 2H1YA 1NRKA 3V1OA 2IC3B 3T1HF 3ISZA 2YI1A 1XMQK 2XMVA 4X4QA 4I6AA 4BDYA 1ZBHA 5LJ3Y 4ZTJA 4P72A 2HK3A 1KAXA 1WSEA 3PW7A 2RNEA 3OW2M 4JK7A 1VQNS 2XLKA 1IKYB 1RAEB 1EAYC 2ZC4A 4OYXA 1K0VA 2OEJA 2JWLA 4BR5A 4FP9A 1KVCA 5KT2A 1S72N 1SH0A 2LDYA 4I7FB 1DGKN 4A8FA 3LZIA 3JSMB 2PZSA 2IYGA 2PYLA 5HBMA 5AQMA 3HSJA 2KXHA 1XQSC 2IRXA 2MQMA 1DLOB 4U8YA 1W2BM 3KMSA 3ETMA 4XAKA 2CJQA 2F7TA 5H9FJ 2NLXA 3CXCM 2V6AA 3CC7S 4HTIA 3VF6A 3BUZB 1A6LA 1G7CB 1MDUB 1JLEB 3MPDA 5KFRA 2DR8A 3RU0A 3V4IB 2B8QA 3K9JA 1AW0A 5G4DA 2O4IA 4WF9Q 4DQPA 4BQLA 3L7OA 3AGKA 3K0SA 3WEEB 4WQ4C 2V63A 5KG0A 2QLWA 5SUHA 3TPQA 1LQ9A 2R7WA 5K8MA 2KH9A 4LSNA 2N4DA 1BA0A 1MU2A 5DS7A 3AVIA 2NXCA 3EVMA 4V19J 3PTWA 1PJ7A 1VJQA 1HMVA 2ZOFA 4AD6A 3DU6A 2G4BA 4DR5K 4FWLA 4X64K 4OYZA 4QWBA 2GCFA 1ZBSA 1TL4A 1PAUB 1Z05A 3AVLA 2GAHC 2B4OA 4FJHA 1WC5A 3MMJA 1ITGA 3RMBA 4R8UB 1Q53A 2P51A 1IWAA 3OS0A 4XH5A 2VHGA 5L9NA 2V4QA 3H3OB 5KRTA 1HKAA 5CZ1A 1FRXA 5HMWA 1NO8A 3ZT1A 3WX4A 2BJ8A 3UPFA 5M2RA 3BKFA 4RWXA 2K7KA 2ZUAA 3W2VA 3ZSWA 5J1PA 3MHYA 1TL3A 4BC5A 5C24A 3QIPB 1UA1A 4PWDA 1VQOS 3KK1B 1VQLN 3LGMA 4USWA 1J2VA 1RI7A 1R0AB 2HMIA 5AE3A 1S9FA 4JI7F 2E1MC 3VV2B 4GKJK 4IRDA 1TL5A 1XMBA 4LRFA 1RBOB 2O8DB 1HIYA 1XEZA 3C7NA 2XHCA 2UUCJ 3NF9A 4CJFA 1NB2A 2IHR1 1U6ZA 3SQ0A 4DL6A 2ZBRA 3D7EO 8RUCA 2Q0UA 2PY5A 3CW2C 4ECYA 3ZT2A 4C1NK 2QLJB 1EJ7L 3P3DA 2MKYA 2RQKA 5BR8K 4PY5A 1T9TA 3R5AA 1S1UA 1BMQB 1YRUA 3T69A 3C2PA 2VBZA 2DGQA 5L1KA 2LP4A 1YDLA 3QJPA 4OJGA 1WNSA 3AVNA 3TUZC 3OL6A 4DV1J 4HYKA 3U8XA 3OJUA 3M30A 2WTUA 3A8KA 3DYAA 2ERRA 1KVAA 1FXRA 1FJGK 4DL4A 1C0FA 3UWTA 4IKFA 1VQ6N 4QIVA 1R31A 2A1SA 5ELZA 2IM1A 1FVQA 1RDBA 1I94F 5GAEP 5CYJA 4DSFA 5EOYA 3GG1A 3EZ5A 5KG4A 3DLJA 3R2DJ 3SQ1A 2W7AA 2C3OA 3VQDA 1QVFM 4UTGA 5LSRA 1RJJA 4L74A 1MMNA 4OGCA 3FZMA 4ECSA 4C11A 1NDKA 2D9PA 2JFDA 3MM5A 3QBWA 3V9ZA 2PIIA 4PL8A 4DHYA 5LL6Z 3CCUN 4AH9A 2DTUA 3O9RA 1U02A 1TVRA 3SAFA 3EKUA 1HNXK 4ZVUB 1NGJA 3MEKA 1TKTA 2OFHX 5KPZA 3UN3A 2ZOMA 1SV5B 2XLIA 3OXFA 2AGOA 3NE6A 3D3CJ 2DTJA 1IBLJ 1EETB 3MEGB 3K7RA 3P83D 2P9GA 2HBYB 3MCSA 3WT0A 1OH7A 4KB7A 1ITPA 3OUYA 2F1FA 1VQKS 2C2MB 2A5XA 3GMGA 3GFYA 1NK5A 2V50A 3NWGA 4LF4J 2Q0RA 3R7NB 1K8AO 2HNZB 1ASWA 2CQBA 2HQDA 4NLCA 1VQ4S 1TL7A 5F0XA 2ZJQL 4WPAA 3QFWA 3J7AN 5AQQA 3LGNA 5IXUA 1GMWD 2W9CA 3T19A 3A5MC 4JI4K 4CZLA 3SBTA 4X65K 2QE5A 1GLAG 4DSEA 1RYSA 2AT1B 2GJ2A 2FYXA 2GHPA 4ETZA 3KJNB 2HSEB 4AL5A 5AE1A 2EFOA 2K3KA 1GQEA 2O66A 3U1NA 1RWPB 3D6RA 4U96A 1CQNA 4N77A 2KFNA 3RAXA 1WEZA 3H8YA 3D2EA 4WYWA 1RAIB 3DXBA 2YNFA 3FNNA 3MCMA 1BL3A 3CJSA 2F8MA 3IDHA 3PSFA 2EW9A 2CAJA 2YNIA 3CI5A 3ULEB 4XK8C 3CG7A 4FJGA 1D9AA 4FZYA 1GLEG 4XPEA 2PO4A 1X4EA 2EFNA 4NXNF 3JXOA 5F9LA 3TR8A 2Q31A 4FVCA 4OO1J 5DJBA 5BRHA 1S3XA 3OTCA 2LYVA 1K44A 4F25A 2NLWA 3NCPA 1FCAA 1NGIA 5A2QY 4F2RA 3N4PA 4M7YA 1WSRA 5E3PA 4W5TA 1JKHA 1ZYQA 4U9RA 4X2BA 4KHSA 4ZMMA 2W4CA 1BQMB 1VRUB 3A0IX 2JZ5A 1XNRJ 2EXUA 4M3YA 3PW4A 3IMQJ 2UXDJ 2V4JA 2ZNYA 2ZFHA 5LMUF 3G6XA 3CCRS 3PX0A 2OANA 5ITHA 2DFEA 3I31A 2X1BA 3M9MB 4NI2A 2ZJPL 4WQ5A 1UAWA 4W98A 3ZSOA 3GG4A 2QTWA 4KAIA 4R5PA 4LFCJ 4YY3K 4BR9A 3KLGB 1S77D 1H6KX 4DV7J 2E1AA 1S1XB 1QLNA 1YJNN 4J9KA 3JAMU 2O8CA 2P9SB 1Q78A 2B7CB 4MKVA 5D8HB 2OD6A 4BE1A 3FZLA 1RABB 4CJWA 3CFRA 4NLRA 3CMAN 1TUWA 2HRTA 3W60A 3U6FA 1OIAA 1SB6A 2D0PA 3Q2SC 3M6XA 5A8RA 1RWMB 1VI7A 4CERA 5AXNA 3PHEA 4KO0B 4ID1A 4CFDA 4NLTA 3DXKB 4PCQA 3H4BA 4E98A 5E41A 2BRKA 1E4FT 1WSVA 3QB0A 4QR0A 1WHXA 4YMEA 4GY2B 1FKPB 1D8ZA 5CZXA 5KFEA 4KHNA 3M8ZA 4WE1B 4H8KA 5GADU 2L48A 3GP9A 3J81j 1BQNA 2BQ3A 3WNEA 3WIVA 4MO4A 3V5RA 4JEPA 5SZTA 2E9ZA 1N4LA 4ISGA 3TANA 1CC8A 1NSPA 3THYB 5EUHA 2JNJA 3D54A 4ED6A 1C0TB 5FRMA 1FFWB 2N7YA 2XLJA 1GOCA 2OSRA 2W4DA 1V5VA 5AXLA 3NEKA 3TQEA 3VAIA 1ICEB 2A18A 4CZCA 3TUPA 4R79A 4E7IA 1IXKA 1BI4B 1TFYA 3DOKA 2PDAA 4CZEA 3L95X 3Q8QB 4ZP9A 4DN9A 3MR6A 3CM6A 5J2PB 2HWTA 2BVZA 4B17A 1FK9A 3MM7A 1GTEA 1ZBIA 4NLOA 1FDNA 4C98A 3MAHA 3ET6A 4B3OB 3HVAA 4JI1F 2YNHA 2UU9K 2BKPA 3OYFA 1UJ6A 1T44A 2HGMA 1F2GA 1HYZA 4TLRA 3O3GA 1UZDA 1LAVA 1SQGA 4MKAA 3O5BA 1N56A 3AOCA 4OZ0A 1YVNA 1WSIA 3P31A 5KG3A 2JRSA 2MB0B 2C2NA 3H7HB 2XMWA 3C3LA 2O8EA 4FYWB 3MXJA 3TX8A 4NRTA 1Q5VA 2B43A 2R8GA 3GSDA 2O3DA 4DR1J 1I3AA 1PILA 3PYFA 4CJUA 3LW5C 3HD2A 1RGIA 3VGUA 1F3VA 1C0MA 1KAZA 1O6XA 3H3NO 1QSSA 1S7IA 4QR2A 1XUPO 4DV6K 3KYLA 3DOMA 2M3DA 5J2NA 4F67A 1T05A 4I68A 2QEXS 4O0NA 5DZ6A 2ZDPA 3PHTA 2M8DB 3QRQA 2AYBA 2FLNA 4OJ1A 4LVNP 5IM0B 5F9NA 1MA9B 4MH8A 3FZBA 3KUHA 1B9FA 3T1YF 1TKDA 3K57A 3M1FA 4RBUA 2NZCA 5KFBA 3FJ2A 2AEJA 3UI3A 1QE1A 3OTDA 4FZVA 2VKRA 3NVKA 2IJRA 3CCWA 1K6YA 4M3TA 3QZ8A 3U1LA 1NJYA 2YPZA 4CJKA 3TX0A 2Z0GA 1OH5A 4IYQA 1XN9A 4UT4A 1ROFA 1U0HA 1X9MA 3DI6A 4YOVA 2OYQA 3IFRA 3WZ0A 2LXUA 4I9QA 2ZWPA 5DLGA 3BH6B 4RZRA 3KJVA 1U2VB 2FJBB 3VQBA 4K5RA 1QTMA 2CPHA 2B9XA 4LF8J 2XS5A 4A8SA 3MF5A 4P7VA 1QDUB 5KFMA 4F04B 5FPEA 4JRPA 1X7VA 4CEZA 2LU2A 3AD9C 2MKIA 4FWPA 1N34F 3PJWA 5HRPA 1IKVB 2ZD1A 2DGTA 3QNWB 1FTCA 4HR2A 1S6UA 2M0GB 3KWGA 1ZA1B 2W7OA 3A8YA 2HNYB 1KN6A 3CF5Q 1QQCA 3SLCA 3VQPA 4CH0S 1NGEA 3DC2A 3R8EA 1X4BA 4JKCA 1QQNA 1P90A 3RUBL 3UVJB 2AMCB 4J37A 4K2XA 3KDNA 5CCMA 5KOWA 4L3QA 4KTZA 4AF1A 4N8OA 3NBPB 3QAUA 2P5VA 3IAYA 3PDNA 4G1QA 4PKGA 3JTNA 4FPBA 3EXYA 5D3GA 1IJFB 4DU3A 3P45B 4NASA 3SUNA 2KU7A 2B7BB 4FNIA 3PM9A 2RDJA 1JNZB 5CHCB 4ZPBA 1C1AA 4LF5K 3R5CA 3PSIA 4A5BA 4MDAA 4DTUA 4KHYA 2AQ4A 1QAIA 2LQJA 4B1VA 1N32K 1LKZA 2F8HA 3R5DA 4PA1A 3LPTA 2CPJA 4LBHA 3RAMA 4JHDB 4IFYB 4LIRA 4KH1B 3LP1A 1Z6RA 2PMWA 4CEFA 3VEWA 3W5XA 4KHUA 1FT8A 5B0CA 3AA5X 3FQLA 2ZM6J 2ADCA 1RT4B 2DO0A 1WTBA 1RTHA 3A2FA 1TYQA 4KGMA 4EIAA 2AYMA 3ASMA 1WSJA 3V81A 3N5FA 1RE1B 1VQ9S 1IBKJ 2FSJA 4C8YA 2JX2A 2R7YA 3CCTA 3SFUA 1LOTB 4O3SA 5FLXY 1Z4UA 1WG5A 1YVFA 4DR6J 3TYTA 2A2DA 1NSQA 3V1QA 1LXJA 3I5BA 2CQIA 2R7SA 2YWHA 4E2FB 5ETPA 4ZN3A 3ILJA 2D3OR 3J8AA 3CJ7A 4ZJOA 5HQLA 3H46O 4KC5A 4YHHJ 2MPUA 4DR2F 5EX3A 2GVDA 3CULA 4HTJA 3A4TA 5KT7A 5BRDA 1BG3A 1BXNA 2OPPB 2I7NA 3NH2A 4MT1A 1NGAA 2HWHA 3F56A 2G2ZA 2DBBA 2K2PA 2Q2RA 1N5QA 3THVA 1Q7YT 3AA9A 1FNMA 1HW9A 2VONA 3FSIA 3CJ8A 1HBUB 3KJQB 1PCAA 3M8PA 2Z2ZA 4YN3B 4BE2A 4YS2A 4UZBA 2BABA 4KH4A 4Z4GA 2VWKA 2FJDB 4X66F 2QA4S 3LDNA 3I55S 4M7XA 3HHLC 4DTOA 1NG9A 4U8VA 2ZH5A 4ZCLA 3P8BB 4A2AA 4FJ5A 1QHAA 5KFSA 1E6VA 1REVA 2GVZA 1RAAB 2ZJQQ 4LQ9A 2Y1IA 4QOTA 1N36K 3CMEN 3DLEB 2JC0A 4NMLA 5ADZA 3OV7A 1JLBA 5AZIA 3RMDA 4DV5J 1T3NA 4YNQA 3T1YK 4BC7A 1GLCG 5F3TA 4JV0A 3ZSRA 4KI4A 3S3NA 3Q7CA 1YJTA 2ZZMA 4WBFA 2R7RA 3AVJA 3QJJA 2QL5B 2BE9B 5E5NA 1JXBA 1J27A 2KHDA 1IR2A 4WIQA 1X5PA 4BR7A 2UZAA 1IQZA 1OWXA 4PYAA 4M3ZA 4B8AB 4GC6A 5J2MB 2YNGB 2KXFA 5IV4A 2HVDA 2OFGX 2F9JA 4F0KA 3PKYA 3GV8B 2QA2A 3OA9A 5MLCQ 4AT1B 4DOZA 1RT1A 2QLFB 4FOIA 5T7LA 4CJRA 5L38A 1UMJA 4QS7A 1YZ7A 3G82B 5M1KA 5CZ2A 1RDAA 2WVFA 4HVJA 4KH5A 2MY7A 1NCLA 2C3UA 4DPYA 4YUDA 5EX0A 3WC2A 4MK7A 2KO1A 2JHEA 4NYFA 4OYPA 3RW7A 5DDQC 4ILHA 2ZC3A 3JAMO 3E01B 2CUYA 1ASVA 1FEHA 4H4OA 1LWCA 2LDIA 1SJ1A 5KG5A 2WONA 4ILJA 4CHQA 4ZVRB 4N5SA 3UKUB 3OTOF 4DJBA 1FJCA 3FFIB 2NRHA 1EO1A 4RR5A 1KP6A 1FA0A 4B9UA 2QJ3A 3ZEUB 3OYBA 1BHNA 3V9SA 2DY1A 4ZHRA 3VAHA 3QO9A 1DURA 4OI3A 5DLFA 4Q0BB 5CYMA 5CY4A 2WZ1A 2CIMA 3O5TB 4A2BA 2ZDOA 3PR5B 2XZWA 2DH7A 3HJVA 4JB8B 1NBWA 3KFWX 3OTEA 3IAS9 1JXLA 2DNGA 2HB5A 3CT9A 3JSYA 2ZJPQ 4KBIA 1AA1B 3KTQA 2KB2A 1RDUA 2E88A 4IQMA 1K9MO 4W5NA 3EDQB 5KAKA 3WXIA 3SAGA 4TY9A 5KPTA 1S1VB 2NYHA 3ZTOA 2OIHA 1YG0A 3TWZA 4OI0A 1LNQA 3MPVA 2ZEJA 3W2WA 3E9OA 5CABA 2DGVA 2QWPA 1LW2B 2L41A 2OPSA 5DG9A 3NGDA 1NDLA 4P2MA 1R27B 1FFGB 1NZ8A 1SJQA 3J7A1 3C65A 3RSEB 2F4FA 3QWPA 3VGLA 4ERDA 2DPNA 3I0SB 4G9ZA 3IUCA 1YX2A 3MM9A 1HNZJ 5EU7A 2XHWA 4YFUA 3VGMA 4B3SJ 2FC8A 5E0OA 3PLAA 1M0SA 3ILOA 3GJQB 1HYSB 2B0GA 1LEOA 2E20A 3HX9A 2GEMA 3OYHA 3GJTB 3OBWA 2N3LA 3HLUA 2V51B 2J4RA 2RHKA 5GAHU 2V34A 2HS4A 3MCPA 5GMKa 3JQKA 5ETTA 4EHUA 4KRFA 1M5KC 4WCEQ 1H2VZ 2KRBA 3ILIA 5K8NA 2P9LB 1WBDA 2KZMA 3PCOB 2Q79A 5D0RA 4FJIA 4LSLB 4CZGA 2QRRA 1H2UX 3Q8YA 1QAJA 3M9OB 2OPRB 4O3PA 3IRXA 1FX2A 3OFEA 1RCOB 1CJKA 1K8KA 4DR2K 2BW7A 3VQ4A 2C2ZB 2MHEA 4LR7A 3QIDA 3HK2A 2RKIA 4DZ6A 2XMAA 3E2EA 4GKKK 3EKSA 3ULHA 1SC1B 1UJ4A 2LXFA 1RYRA 1RZMA 2W40A 1IKXB 2ZVSA 3DRRA 4DUYK 3EICA 3WIUA 2D1KA 1ZAXA 3QINA 1SUQB 4IH5A 1N48A 1WG1A 4ZPDA 3DDNA 1XI1A 1SKSA 1KS2A 4WP3A 1TK5A 3IR6B 4USUA 4X66K 4ZIWA 2MKKA 2A6AA 1NM1A 1PO6A 2HGLA 2FDNA 2H5EA 2M52A 4YOEA 4FWSA 4K41A 2EVZA 2CH5A 3TA0A 2OKQA 1TKXB 5KGXA 3JTOA 4OL8A 4Y2IA 2A1RA 5JVGL 4OYWA 3O9QA 4Z94A 2D4WA 5KQDA 1KDNA 2QL7B 4BLGA 3J7Z5 2YKQA 4CJ5A 4R0JA 2QV6A 4Y2KA 1ZPWX 2I9SA 3QT8A 4Z7YA 1HNVA 3BDPA 1RWUA 4IG3A 1NKBA 3DGPA 3QBCA 1X4CA 3ENWA 4FYYB 4DS4A 2F4VJ 3D0PA 2OELA 4C97A 2AJ4A 2CRLA 2W01A 3IMXA 5HVGA 3J7ZO 2IVFB 3SSQA 4B1WB 4EHTA 1VQ6S 3ZETA 2LQ5A 4QZVB 1GTHA 5BYRA 3DRXA 4LVOP 2VPXB 3L7UA 3CFOA 1YQHA 3GILA 5J2QA 4P2XA 3NGKA 3DRSA 3CJRA 2G9OA 3TJ9A 3AODA 4M5DB 3FSXA 3HSZA 1NJWA 5A2QU 3UN2A 3GV7B 2E1RA 3L3CA 1Q82O 4CQ1A 4I1TA 3M8RA 2EFPA 4NLUA 5D4LA 3HVWA 2G8WA 2HBJA 2WCXA 3O9SA 5DQHA 2XO6A 4A8WA 3H40A 2QWOA 1KD1T 4WFAL 3DMJB 4K4WA 1IKWB 1N33K 3CCUS 5JICA 2LU1A 1HKGA 3FCVA 3FMWA 4BQZA 2BJ3A 3SQOP 3N0VA 2C2OB 4CF1A 4JV1A 4DR4J 1RAFB 1RWKB 2Q36A 2PSZA 5BXIA 3NNHA 3ZX0A 2HS0A 2YWEA 4H4KA 3K5LA 2NYIA 1DBDA 2Y8WA 3UCGA 2W2PP 3UKRB 2JLGA 4OLBA 4V19S 3PYDA 2R8JA 5IT4A 4Z4FA 2EFVA 1MSWD 3M1VA 1DEJA 4CLWA 1QZ6A 2V2QA 1RWVB 2KM8B 1DTQA 1Q0NA 2WVCA 2XI3A 1DRZA 4K4SA 5KFWA 5FIIA 1T11A 4A8QA 1NKCA 2FBXA 3CJ9A 1U4BA 3GONA 1PC4A 1G4CA 3UNYA 4ZP7A 2HZVA 1FJEB 2VQFJ 2Y0BB 3BV8A 1SH2A 2V0NA 2P9KA 4X62J 2RMLA 2G8FA 2HKEA 1AZSA 1T6DA 2X3DA 4NYZA 4NEYA 4JKAA 1XC9A 3EMTA 3UW1A 4D3GA 2GHWA 4PR6A 4OKKA 4J9PA 1N5VA 2YKMA 1KLNA 5U47A 4JP8A 3NS6A 3FRYA 1HR0J 1PSDA 2GX8A 4TU9A 2V68A 3FCWA 3SIPB 4FYVB 3I33A 4NXMK 1MN7A 4DL3A 2GQ2A 2W4PA 5IZHA 2DXDA 2COLA 2IAJA 2DK2A 2UUCF 4A62A 5CQGA 4I56A 1U25A 4AUKA 1N54B 3EZWA 1QVGR 2XSFA 3L7PA 3OHAA 1WDTA 3M5RA 2HQGA 3LL3A 4OHXA 1X3NA 1NHKL 2F5GA 5KFXA 3KWMA 1VRTB 2E7XA 1WEXA 4Q5VA 1ELOA 4DV1F 2ZH6A 4TLQA 3MN5A 3SEOA 3KHYA 1XNQK 4CH1A 2XNQA 4B3MF 1HI8A 1VBZA 1W2BR 1HD1A 3TEHB 3RW6A 3CXCR 1WNEA 1L3SA 3D2FB 1U26A 3MOZA 3UDEA 3D7SB 4PHTX 1I1GA 2XCAA 2UVUA 1EQYA 4HTLA 5EWGA 1TZ0A 3D28A 2CQ3A 3S3OA 3J7YP 1YJNS 1C6VA 2VGMA 3U3GA 4DI6A 4ATNA 4O44B 3C66A 1LWEB 2W2MP 4C3KA 3EZOA 3IR5B 1S97A 2R8KA 4FW2A 2M9KA 1JCEA 3SCXA 3CMAS 1HQEB 3CSKA 1X4GA 3VAFA 2J8SA 3TZYA 4JI6J 4PUOA 4G6VB 3C14B 1JJ2M 3BGLA 2BDPA 3CTRA 1SS6A 2I0XA 4DLEA 2G8UA 1WSGA 1HRHA 3AA2A 4OZJA 3HPHA 4FS1A 4CCHA 3LF0A 4F4YA 1YJRA 1IBLF 1WUAA 1NAQA 4PKIA 3QLHA 4QS8A 4KB1A 4WFBL 3JQMA 4Y2MA 1ATNA 1TUYA 1C0UA 1B9DA 1T03A 2Z30B 3MURP 4J9UE 1WSHA 4LF4F 4PYDA 3LPYA 1VDHA 1PAEX 4LF9J 1DARA 1WORA 1YVUA 1KC8T 2F9WA 4DV0J 1XWLA 3FGVA 2XNRA 4BG9A 3HM9A 1FRIA 5HSPA 2CGKA 3OT9A 3AXMA 1GX6A 2GIQA 2JLFA 5H9FK 4LT6A 2QWLA 1NB7A 4PXCA 1SCJB 3CCQN 2HWIA 3TAMA 3KHRA 1OO0B 1CJVB 4NA1A 3KLVA 1YJVA 3HVTB 3ITHB 1S4FA 4AXJA 2E2QA 1MMLA 2GAGC 2BW2A 4A4JA 4FLTA 1FXLA 1JMTA 4QPTA 3BGUA 1N5TA 4F4AA 4CIFA 5HQ8A 5AQTA 1U1NA 4JI3K 4KH0B 3JYTA 4CYUA 2V8GA 3UR3C 4FPRA 1RBLA 3IBFB 4CK1A 2ALZA 5E3AA 2E5LJ 5EDWA 1CLFA 3TA2A 4H0PA 4A5AA 3ATUA 1RBAA 1KOOA 4FW1A 4ID5A 2RS8A 5HRNA 4FYDA 3MEDA 2GMLA 3P4UB 2ASLA 4CNYA 4OZ5A 5KFTA 4W90B 3OJSA 3LP2A 2HRYA 2CQPA 3CIZA 3W61A 3K9KA 1EARA 4FKXA 4FBUA 4E1MA 2HMPA 4YQWA 2XYHB 4ISEA 1U47A 4BC2A 3B4MA 3C6TB 5GADI 5D15A 1NK4A 1UWBA 3HVRA 2KJWA 2JEFA 4UOCA 1JL2A 2H5IB 2YKNA 1S6QB 2ILYA 3PNIA 2RJZA 3CJ3A 1HWJA 4Z37A 4H54A 3MR3A 2G1HA 1S0MA 1Y7PA 1XNRF 2WBMA 4DB3A 3M2UB 4MFBA 4C7QA 2UXDF 2UXBK 4WP9A 3L4BC 4CF0A 2K8GA 4EAHD 5C15A 1VK8A 4LH4A 4JV2A 4OPHA 4ED2A 1RT6B 2U2FA 1ZH5A 2UUCK 4LFBJ 4B3RK 3UCZP 1Y5NB 4J5OA 5THWA 4LFCF 4HDHA 2D0OA 3CD7A 2GMHA 2V52B 4DV7F 1R0BG 2Y3YA 4NB4A 2WSFC 3PV8A 1F6TA 5HBMB 3Q8VA 4DSKA 4O55A 1N6QA 4ED5A 1K8AT 1IM4A 4NPOA 1TMJA 3LAKA 4IFVA 2XGQA 3VHQA 2PMZD 3T9NA 4CDIA 4JKDA 2FUG9 2EK1A 1NMEB 2YY3A 3VEOA 4J91A 4M8LA 2FJAB 4NZ7A 4DR7J 2M4MA 3DOLA 3LO3A 1SC3B 4GW6A 1M90T 3LPUA 1MU2B 1AROP 3L8BA 4ZCMA 4A59A 1R89A 2W9BA 2KT3A 4IH6A 2YQ3A 3SJJA 4WTOB 1KSPA 1GOBA 4IH7A 4QYRA 3VAMA 2IDOA 2KLAA 4CJ3A 1FHTA 2DNNA 2V7ZA 4X4UA 4LR8A 2Y8YA 2HQIA 2ZKTA 1RHJB 2OGUA 4YR3A 2CH6A 1MNEA 5I42A 1QD1A 2Z8QA 5HJXA 3BGRB 2NRWA 1D5AA 4OZNA 2J6TA 1A5XA 1FEEA 1KRPA 3ZO7A 1Q9XA 4CGFA 3TJAA 2C42A 4URQU 5T7BA 2YPYA 2J7KA 4DX5A 4JI8K 4BR0A 4MLEA 3K89A 4Q2MA 3C6UB 3DFEA 4M5GA 2AKWB 3VGKA 3TA1A 3TUJC 5CD4H 2DJWA 4WWSA 2VF3A 1TL3B 2CNLB 3AA8A 5C24B 4NL5A 4PWDB 5LMUJ 1PC5A 3NKYA 1NH8A 2DNMA 3HULA 1CPZA 4WIIA 4CHYA 4KFBA 2HMIB 3B6BA 1Y5IB 2X51A 4PAAA 5A2QO 2JWKA 1XMOK 5KT5A 4QQBA 1O13A 2YXLA 5DDPC 2QX0A 3AJ2A 2BANB 1YXQA 4USHA 1SC4B 1JJHA 2CYYA 1S99A 1GMWA 2HBKA 2FIUA 4IQXA 2G8VA 3MEEA 1S1UB 3H2UB 3O44A 3KK3A 4IG0A 2A40A 2GIFA 4HHTA 2MLYA 3DLLL 3ZXWA 5GAEU 2FGCA 2F7VA 4IR1A 3P4IA 3HKZD 4DR1F 4RW9A 2CQDA 2WW4A 4Z2XA 1PGZA 1YITN 5DDRC 2DIUA 3U1MA 1G3OA 2GUIA 2G0IA 2R4FA 4CECA 3TABA 4L75A 3RGIA 1HNIA 1PJ6A 4JD2A 2DO4A 4AHUA 3E9PA 3NGSA 2ACYA 3IGNA 2H3GX 2IIRA 2VODA 1FDAA 2P9UA 1NM2A 3RJMB 5LMNJ 4IOXA 3VAGA 4C11B 3VQSA 1J6ZA 4J9VA 2MY8A 2V94A 4W5RA 3FEXB 1F5CA 3UNGC 2FB0A 2HURA 4KHPJ 4ILGB 1SJFA 3QAEA 3L2WA 3CJCA 4LF2A 2Q3PA 1TVRB 5L46A 2LLZA 4QCLA 3AJDA 3GIMA 4OI1A 3GQCA 4QR1A 3IXQA 1TKTB 1VC6A 4BC3A 4BR4A 3OYKA 4NYNA 2MZ1A 3THWB 5ETNA 1C1CA 3QEPA 1CZBA 5KFHA 3D9BA 4JV5J 1XNRK 2ZBPA 5KFUA 3OUYB 4UY8T 4CFAA 2C3MA 4B1UB 2UP1A 4PG8A 4KRWA 3VESA 1S9GA 3T6JA 1SC6A 3KDOA 4PL7A 4WFNL 4PG4A 4LF8F 4JS5A 4ZLLA 2CQ2A 3BSOA 1BIUA 1IG9A 4DV7K 4ED4A 3CMES 4P7TA 4WYLA 4ANDA 3CO0P 5F8MA 1LWFA 3UD4P 3NGYA 3F0NA 1WAJA 2CJBA 2W9CB 1NJIO 2P9EA 1U2CA 4JK8A 3BYPA 1RTDA 2B3TB 2EEYA 2UV8G 1I6JA 4GVBA 4IR9A 3AY9A 4ZP6A 2J6SA 1HLWA 4BROA 5AXKA 3BS9A 2FLLA 4OKEA 3QQCD 4CLLA 2RILA 2HBLA 2PI5A 4DL7A 1PYOB 5ADXH 3DXMA 2IBKA 1UFLA 3O9TA 1R8HA 4BE0A 1MLAA 2YNFB 2FVPA 2G2OA 4CP5A 1DTTA 3NNAA 2POKA 5D4OA 2QMWA 2MLXA 2YKOA 3QGPA 4I7FA 1VCTA 2YNIB 4XH1A 2DPIA 4ICLA 2BACA 1FNOA 1IR0A 3R1XA 3GBTA 5I9EB 4GO7X 5ETKA 1N0UA 3R2CJ 4XH4A 1KXPA 1UAXA 4DF4A 3HYFA 2RSQA 3AD8C 4GVEA 4I67A 1VAZA 2OUGA 3GSIA 2XI2A 2A3JA 4FWNA 1K73O 1MROA 5DGAA 1FRLA 3HD1A 3WEEA 3OTBA 1RHQB 4WQ4A 2JEJA 1J5EJ 3BN4A 1QQMA 4F3MA 4FZXC 2ZM6F 1JKHB 2C22A 2QW9A 1SL1A 5LXYA 3ATVA 4OX7A 3BGOP 1GXUA 2QA4G 5LSLA 2CQ4A 1G1XA 1H74A 2DGOA 3MXIA 3SQGA 3S9HA 3CE8A 1IBKF 3M6GA 2CG8A 3MM8B 1L5UA 2VYPA 2V4JB 4RWTA 3ZZTA 3B8HA 2DHSA 1CULB 2WB4A 4JI2J 4NI2B 1VIXA 4DR6F 2ATQA 1U1RA 4MJKA 2ZBQA 5HL7L 2IBOA 2HVHA 4BDPA 4EP5A 4DCPB 4KKOA 1F2HA 1QUPA 3CETA 5D0HA 5BYQA 1JLCB 4AYBD 3THTA 2O8CB 2ZBIA 5EX5A 1U1OA 2RQ4A 3EGWB 3N01A 5E7OB 3SK3A 4YHHF 4NLSA 2XBPA 3VF4A 2FLPA 3OR1A 2XYGB 5HROA 1TR0A 1C4AA 4A8KA 4QS9A 4E3SA 2LXIA 3H42A 4DL5A 3IR7B 4F26A 3EE8A 5IT9O 4Z4EA 1RISA 5A8RB 1XMQJ 2ZH7A 1JLGB 2X6NA 2QYCA 1DKGD 3A5OC 2YH1A 3CJ2A 4CZFA 2DHXA 3PFEA 1EXQA 3KMQA 3I56N 2Z1IA 1J54A 3ENHA 5AJ3K 3QBXA 2KFYA 1CVJA 2D74B 2KI2A 4QBUA 3GR0A 2VU5A 1BWVA 5A8KA 3PW0A 4WKYA 1B7YB 3KLFA 1FD2A 1VQPN 2Y9HA 1URNA 1GK8A 1HJOA 1BQNB 2D7SA 5KFNA 1BCMA 2JLEA 1D4XA 4DV5F 4RW6B 3EEQA 1S48A 1HPMA 2UVWA 3AVCA 2KVIA 4Y6IA 4EO8A 1FWPA 4HHHA 2HNDB 1JJCB 3CD0A 2G0CA 3L2RA 3ZZ0A 3ID6A 4WJBA 2MQQA 3R27A 3D5MA 1W0HA 4AHCA 2DNQA 4FK0A 3NNCA 1BIZA 3OY9A 2YKPA 3LP0B 3MAQA 1VSLA 4DR5J 4ZDNA 3DOKB 4RNOA 1AT1B 4X64J 4J2DA 2J0QD 4K7QA 3R1LA 4YOWA 5KPRA 2GV9A 1FK9B 4LF8K 2UXCJ 1RTJB 1Z2LA 3GJSB 3DHWC 3ET6B 4CWBA 2YNHB 4LR9A 3HFZB 2W42A 5AR0A 4BRHA 3P39A 3N9UC 5GAHI 5FRNA 4DUZJ 4ZS6A 2VH7A 4OYBA 4K50A 2PYJA 5HRRA 1ZBFA 3FZFA 2J0XA 4IRKA 1VLOA 1RCXB 5FLXO 1YRTA 1MW7A 4BDZA 2QSWA 5F3ZA 4ZTFA 3PRDA 1FE4A 5ETOA 4PQAA 1KKHA 2VFRA 1FXXA 3KWIA 3IWXA 1KVKA 1Z1ZA 3WQUA 3M32A 3WX8A 2DNKA 1VSDA 3N5BA 4GKJJ 2MKHA 2W25A 2ASYA 4Z4IA 5D4PA 3DOMB 1EKRA 5J2NB 1T05B 4FYXB 1R43A 3GIJA 3QJLA 3O3HA 1X4DA 2QA1A 3RR8A 3RB3A 1NHUA 3KHGA 4DF8A 3WNFA 1X4HA 5T14A 2RPIA 2ZZTA 4CLZA 2B6AA 4ES3A 4DS5A 4J9LA 2F65A 1PYSB 3LDPA 1Q18A 3E1YA 4NWBA 2DXFA 4GV3A 1S12A 4MIAA 3PY8A 3O8MA 2YHWA 3BKTA 4IDKA 3DXSX 2HBZB 1QE1B 1NKEA 1HNZF 3D45A 3NHGA 4A8YA 4B3SF 1RHRB 4LREA 1GNKA 3VQEA 4H03B 1S6OA 4FJNA 2EKNA 2W41A 3KIOA 1QM9A 3R6MA 3W5ZA 3RB0A 4DFKA 1U0HB 3DI6B 3DM2A 3N79A 1TL1A 2UUAJ 3G0ZA 3CM5A 4RW8A 3J7AP 3KJVB 2AD9A 1OY8A 4FWRA 4JKGB 1VSFA 3L09A 4DR6K 4CJSA 3FZKA 1VIOA 3RBZA 2VBXA 4CIEA 3BZKA 2NREA 4JNEA 2ZD1B 2VA3A 3OTOJ 3VR1A 3BQ0A 2DGSA 1HBOA 4R25A 3OPKA 3FK4A 1HNXJ 1M1GA 3LAMA 1Q7LB 4Y1DA 3IAM9 2ASPA 2RU9A 4ZPVR 5AQLA 2R8IA 4ETXA 4WU2A 3OFHA 4CGGA 5HOOA 1EKSA 3UDCA 2XZTB 4BRNA 4RU9A 4X4TA 2IVMA 4URGA 1NSKL 1SKUB 2VKZG 5E26A 5FD1A 5A6PA 1CEZA 3VOVA 1NGGA 5AE2A 3VEYA 3RVCA 3NWRA 5CA5A 2RB7A 2VICA 4G1QB 2IA6A 1K0TA 3CERA 2GGPB 3N6MA 5D3GB 1B0PA 4DFPA 4FOEA 3NCIA 4JYAJ 4I4BA 3TSQA 4K4ZA 4O3RA 3RRKA 5L1LA 2P9SA 1AFJA 2JJ4D 3SFGA 4H4MA 1KQKA 4OX9K 5DG8A 1H2TZ 4JI4J 3O4NA 2GJIA 3UCUP 4X65J 2Q97A 2MZQA 4QWEA 4N47A 3G25A 3DLLQ 1YKWA 4CH7A 3NDKA 3LP1B 1KNZA 1X8DA 1ZC6A 2FZCB 2F4VF 2AEMA 5HI7A 5AQKA 5B8HA 4KO0A 3H45C 3EPIA 1SJ4P 3N6LA 2E8AA 3PIPL 2HFVA 3W9HA 2DH9A 1TYQB 3O4WA 1FF2A 3EUNA 4H0YB 3V81B 4I2QB 2CWXA 2UUBJ 2R7XA 2Z2MA 4Y1CA 2WK4A 2FY8A 2Z57B 1BU6O 2ZVIA 4BWMA 2G1DA 5DZ7A 2VG6A 4AHSA 3SPYA 3BH7B 1NK0A 4XDCA 3HJFA 3SCIE 1HL6A 3AJ1A 4YOTA 5C42A 1RBSA 2N3OA 5D77A 1C0TA 4KSEB 4IFEA 5J1EA 2GVDB 1RT5A 4CEOA 1QY7A 4DN0A 5EWEA 3GFXA 3IS9A 2RRNA 2VDIA 1MN9A 3SDEA 2YQ0A 4E1NA 4DR4F 1OSCA 4NX9A 1RWXB 1BI4A 3TI0A 1C0GA 4U95A 3V9UA 3KXDA 4NLWA 3CCLN 5M1QA 3AO2A 2VOOA 4CI6A 3M8WA 1NHVA 4WFNQ 1SIZA 4B3OA 5KFOA 4YY3J 1T3VA 4J2EA 4ELVA 2BGGA 2GUPA 5AQWA 4FLZA 5AQOA 1DHMA 2Y1RI 1REVB 5K9FA 1NGFA 2GVZB 3A5LC 3FZHA 4BS2A 4AM7A 2YX4A 4XPCA 1J5OA 1H7XA 4NLBA 3GYGA 1WACA 1AUSL 3DRPA 3NMAA 2QT7A 3PIOL 1JLBB 2H9ZA 5HK4A 4F9OA 2PEHA 2VQFF 1A0OB 2RE1A 1RNHA 2VPZB 3CCQS 4UF4A 4M5HA 3ZSXA 4L76A 1X9WA 3N28A 1HNZK 4X62F 4YDXA 3RR7A 4B3SK 2KVQE 3VERA 3G6YA 1IN0A 4TN2A 3V2UC 4NLVA 3OSNA 2OH2A 3KLIB 1PBAA 4FWQA 3K8VA 5IV3A 3HZ6A 1FRMA 4LF1A 1HR0F 1TUGB 2H54B 2IVNA 2B8PA 3ETOA 3HP9A 3QGHA 4AQYJ 2XGPA 2OMLA 1S0OA 2D0AA 3ZFVA 5IWAJ 1YTAA 3V6DA 5IM0A 2PAVA 3QESA 1NBEB 4CT9A 2DT9A 4H4OB 2HBRB 4CO5A 1LWCB 5KG1A 2CA9A 2FQQB 2WONB 2XWXA 3IRWP 4JI0F 3VEZA 3WXJA 2VV5A 4JN4A 5EN1A 2P5OA 1I39A 2A2CA 1WF2A 3D68A 3RRHA 2LSNA 1Q81T 3RMAA 3PW5A 1ZOTA 4ZHRB 4E19A 2W6KA 3QO9B 1VQMN 4AL6A 4H5RA 5HLFA 3HO1A 4K59A 1NU4A 3CJ4A 2LCWA 3JS9A 2EBGA 1W97L 2HS3A 2C2RA 3BEGB 3DLGA 2PEBA 4ALZA 2OPQB 2W8KA 2CPIA 2CNOB 3US5A 2UU9J 1SL2A 1TUVA 1IKVA 3K2PA 2HNYA 4BRDA 2BZ2A 3N4WA 1WJ9A 1S5ZA 5GAGI 3Q8SB 2ZH1A 4HHUA 3DRYA 3P6YC 1BHLA 1G15A 1D09B 4RUAA 4NLPA 2OPSB 3R6LB 3UVJA 4E0DA 4DPTA 2D0BA 3M7VA 3AVGA 4CO4A 4Z7CA 4G3IA 1J9AA 4JI6F 4ED3A 2VFSA 2E2OA 2RE2A 2F4VK 3BR9A 4MIWA 3DAWA 4O4RA 3MM9B 4TVAB 2NZ4A 2VUGA 3Q8RB 2ITMA 3KNAA 3L4IA 2VFVA 2ZNZA 3FE1A 2AJQA 2YCHA 3KOAA 3P38A 4DV6J 1BY9A 3TU5A 3JSBA 1K47A 3CQYA 5BJRA 1S0VA 4KYZA 2YX6A 4I2PB 1DFDA 2IVOA 4ZN1A 3TOQA 3BY5A 2DY9A 5K14A 4ZVSB 2ALYB 2RHQB 2AYEA 1NGCA 3ZSQA 4LFAK 4EU0A 4LF9F 5I3PA 3HP6A 3PG9A 2AGPA 4BGAA 4DV0F 1WWHA 3IRXB 4IFYA 4ZVOB 2JH3A 4O23A 1K8KB 2FD2A 1S1WA 2FBYA 2RKIB 2Y1LB 3AY0A 3A3PB 3HZEA 4FM2A 4KGXB 5IS2A 3H90A 2W1BA 3DRRB 2CJXB 4FLWA 4DR4K 4LH5A 3MMCA 4USIA 3LM9A 1TK8A 2V8DA 3GFZA 1RHUB 4B3MJ 5ETRA 3SAHA 3Q86A 4B1ZA 1UOCA 4DV3K 4O3NA 1KWMA 4DG1A 2FHJA 1VHFA 4G65A 4CLKA 5KT4A 2E5LF 4FLXA 3PVXA 5DM7L 1W7AA 2QWNA 4FJ8A 5M2UA 2FJVA 2C1EB 1GEHA 4RNFA 2Q66A 2LEBA 4Y34A 1TAUA 3HI0A 4TU8A 2E1YA 2FSNA 5L1JA 1YJ9N 2QWMA 1FRJA 4RJVA 3TEGA 5CCLA 3FLCO 2DVIA 4C8LA 2HFNA 3G9CA 2BUNA 4IJAA 2BH1A 2VQFK 1LWXA 3SI6A 1NUEA 1HNVB 4FPIA 3DGPB 1U8SA 4M5KA 2E2NA 4X62K 1SZ2A 3K8WA 5ETLA 4U7BA 4KHWA 2XM3A 4AXIA 2WOMA 3T1HK 6FDRA 1ZA2B 2RUSA 3TZWA 4H0VB 4CJTA 4OV6A 2HHXA 3ZETB 1YITS 3HHLA 1IV0A 4Y2AA 4LBPA 2Q6BA 3RB6A 2CQHA 2QLXA 4CBWA 3EVWA 4IOAL 3H0PA 1JJ2R 3M2RB 1RK8A 2YWKA 1E6YB 2DR9A 3DLEA 5FJ4A 4FWOA 2VGNA 3T5LA 1N32J 4LFBF 1R3NA 2HZCA 3WHIA 3NF8A 3ISNC 3R9PA 2QYGA 3S41A 3BDEA 4ECUA 4GVMA 4G1IA 4JUZA 3CDEA 5AQUA 5HP1B 1P1LA 4HT5A 5F8GA 3FBEA 1TV6A 5AQYA 5K8OA 4C8ZA 3MMBB 4CIOA 2Z4PA 3TAEA 4IEEA 1IJJA 1S6PA 2R2UA 4IOCL 3AHPA 4X4VA 2L3MA 4AL7A 1YK9A 1RLDA 2DFHA 4DR7F 4NEZA 2I5JB 5E84A 2ASOA 3OHBA 3I82A 1P8ZA 1DQ9A 3M1VB 3VQQA 3ENVA 3NGRA 5GAEI 3D6HB 3AB2B 1TMMA 3E01A 4ES1A 1XR5A 2N82B 3IBCB 1BUPA 2DISA 4JKBA 3VQTA 3RBXA 3EE9A 3TSPA 1VJWA 1VBYA 3W0LA 1WSFA 2WTFA 3AVAA 3L3VA 4DU4A 2O67A 1EP4B 3ZEUA 3H08A 3M6VA 4CJLA 1RB0A 2QKBA 4LBIA 2CNNB 2AIRB 4WU3A 1JLFA 4JS4A 3TAPA 3OXGA 2MQ8A 2P9KB 3QEXA 3ALYA 4ZPCA 5F0WA 2IGIA 4CTAA 4QAGA 4FJ7A 3R9LA 4RW4B 3WXLA 4K8ZA 3OS2A 3CGIA 4CD1A 2MKCA 2P9NB 2DH8A 1UFKA 1HNWJ 1GH8A 1N88A 1HQUB 2HHHJ 3MR5A 1Q8BA 3ELHA 2MHNA 5K20B 4JI7K 2XZDB 3IM9A 5H9EK 2HK2A 3I9V9 2RIJA 2FF3B 5J1NA 1RKJA 1N36J 3QYYA 3IFEA 3CC2N 2QN6B 1WELA 5AQJA 4LF9K 3HSTB 1U6BA 3QICA 1SIWB 4CO0A 3A1YG 4MTPA 5C2GA 4DV0K 1AFIA 2CNKB 5DETA 2EC0A 3VMFB 3O3LA 3ZZUA 5CR4A 3RSEA 2MTLA 2EC2A 3L4QA 3ZTPA 1Y64A 4A8MP 1NDCA 3BM7A 1B0TA 4J2AA 3BO3A 2DKOB 2OTLN 3VALA 5I3QA 2GW8A 4PPZA 1JXEA 5D78A 4KT0C 4WF9L 2MQPA 3UDLA 1ZPVA 1KQSM 1IO2A 5D6GA 2JOQA 8AT1B 2ZOGA 2YHXA 2HVIA 3FDSA 2L9NA 4DPUA 1I94K 4USVA 4ZIVA 4KV8A 1EWQA 4Y00A 5F2RA 2IMOA 1VHIA 4JAXA 1WKLA 2IFXA 3AAWB 2E5LK 2XULA 2Q3SA 4ED7A 3IKMA 4OHYA 1R0CB 4LSLA 4EYHB 3TAFA 3G71N 1B4SA 2OPRA 1ASUA 4K4VA 3W62A 1X9JA 4Y65A 2HGNA 1Q7YO 4ZP8A 1U7LA 5LMNF 1LCUA 3FEYB 2V7YA 4IJNA 4Q8FA 4Z4CA 3QMQA 1M1KT 1IKXA 3EO3A 4KHPF 1HI0P 3MOJB 4N8NA 4NZ0A 4LY7A 1SUQA 2A6OA 4PUOB 3K5OA 1O1WA 5TKWA 2ROPA 3C15A 4NLXA 4ZVGA 2A41A 1V3SA 1T7PA 3SJHA 3UR0A 3F9KA 3FR0A 4ECTA 1WHWA 2V2KA 3QATA 4K0KJ 1JIHA 2KTQA 5AFUH 3POTB 2NUUG 4P73A 1CQMA 4FLVA 4JV5F 1LAWA 4I6MA 4OZ3A 3QLHB 4UUWA 3I56S 1M1HA 4BVPA 1D8YA 1T0TV 3QERA 1TKXA 1C0UB 4AILC 1T03B 1H38A 1T8EA 4TSXA 2QO3A 4M42A 5JLFA 2NSCA 4LFBK 3H1VX 2MSSA 2NXJA 1Q8IA 1VQPS 4OV1A 5HO4A 2MXYA 2IMWP 3BSNA 3CCVN 3SNNA 1B70B 3IG1A 1UA0A 2CDQA 4W92B 1RACB 2HHUA 2NR0A 3KKRA 1WC6A 3VQ7A 4IO1A 5HRSA 2KL8A 4M3XA 3M4XA 2BYCA 3TAMB 1TTHB 3CIMA 3DLHA 2H5JB 5K5MA 5KFCA 4CRJA 3MECA 1TGOA 4DR7K 4CHNA 1UP1A 3WNHA 2XS7A 2KKZA 2HSTA 4CFBA 5SWMA 4X4RA 3T1AA 2DR7A 4H5WA 3JYTB 4CYUB 3TR5A 3R5GA 4A48A 4MDBA 1A5WA 4I6WA 2X6SA 2QZ8A 2QEXN 1EQMA 1F21A 3AO4A 3SSSA 3H1QA 3OBYA 3KLEA 2J76E 2FVQA 2DCLA 4TYBA 5KI6A 4ID5B 4TNOA 2CQ1A 4NXNK 4DFMA 3MEDB 5KG6A 3TJ8A 2QI2A 2QFIA 4GKKJ 3LPEA 2HQ3A 2O8BA 3LP2B 4J9OA 3I96A 5KQ8A 5A6WA 3NFAA 4QYZK 2VL1A 1MWKA 4BC9A 4B9MA 2J7UA 3D0GE 2E9RX 2BM1A 2D1CA 1RAOA 4JK9A 1TU0B 3V9WA 4RNMA 2FPHX 4OX6A 4RNNA 1UWBB 3UKRA 1N8RT 5CYQA 2OP5A 1J5EF 2YKNB 1NK8A 3J81Y 1UVJA 2GMJA 3LDSA 1PBUA 3ENQA 4ZKAA 5LMUK 2NUBA 1ZBUA 3N6NA 2ZGYA 3H2VE 4MFBB 3NOGA 4KHRA 3RMCA 3DDIA 1VSKA 1QTNB 1XHXA 3KKFA 2MLZA 4JI2F 2KJVA 2YWWA 2EFQA 3TQ1A 1P1TA 3EYZA 4HACA 3Q8PB 4V19X 1JLAB 2XHBA 1KFSA 1OS5A 3EX7B 5IT0A 3EXCX 1WI8A 3HSGA 2VOPA 1N6QB 5JUMA 4I6YA 2ZH3A 3OLAA 1ESVA 1BD6A 3HHNB 4NCBA 2MZTA 4ITSA 5E3QA 1C2PA 1KQFB 1I5OB 2A10A 2KRRA 2P1JA 3K5MA 3Q8UA 3NAEA 1I3OB 4KTQA 2X1AA 1J53A 2CPEA 1XMQF 4Q2LA 4M5IA 2O5DA 1VBKA 2MZRA 3CNQP 2ZH8A 2W9BB 4O8KA 2WVBA 4PQUA 4FXVA 3OYIA 1VQ8N 1OPZA 1SI9A 4OLAA 3ZSZA 5LM7E 3BF3A 3S3MA 3D0IE 3JXUA 3ISND 4R0EA 1RAJA 3GE1A 2CVIA 4FJKA 3B54A 2OO4A 1N33J 2W2OP 5LMNK 1QQOA 2IM0A 4B9NA 4FO0A 2VIHA 1EQ0A 4KHPK 2JEGA 2QC3A 2VG5A 1VRTA 3PZPA 2AF6A 3MDQA 2ZJRL 1IG8A 4PG7A 2IVPA 1VK3A 1DAXA 3Q7BA 2G8IA 2F8EX 4DU7A 2HFUA 1TKZA 2HHSA 2KHOA 4B9QA 1L3KA 3GG0A 4BRFA 4DX8H 3I8BA 1D9DA 1YTYA 2QTDA 4PPDA 3CCSN 3GPAA 3RBEA 1OJ4A 3AVFA 4MMOA 3G10A 4QW9A 3VTIA 5DG7A 5AQFA 5DM7Q 4LMZA 3T41A 5CXTA 4DR5F 1YJWN 1W26A 4X64F 3P1GA 2JFKA 4KFBB 3R7BB 2DGWA 4DX7A 4JI1K 3K58A 2JDJA 3CDBA 2UXCF 1O0PA 4M3RA 5BPNA 1C1BB 4O44A 1T95A 2N7CA 4BACA 2DPJA 1S1TA 4DUZF 3C14A 2O8FA 1BC6A 4IDHA 3MEEB 3FVYA 2DB1A 1QSLA 3KK3B 4IG0B 1X1PA 5GINA 4M5MA 4L3KA 2FC0A 3ZT4A 2E4LA 3ZT0A 3GOIA 1L3VA 2ASJA 2K7JA 1HBNB 4FPAA 4RW9B 3A8EA 4DV4J 3OLBA 3I8DA 5E3CA 4O3QA 4NXMJ 4EZ6A 2NUHA 3NAHA 3HPOA 4IOAQ 5MLCV 2XSJB 2J9CA 2NXEA 4GKJF 1KD1O 3CPEA 3Q23A 3B6PA 3MPYA 4A47A 2Q1NA 2LVWA 2ZH4A 5C7PA 1AB8A 1HNIB 3OL9A 3JSRA 3NOCA 1X5SA 4EBDA 1RDRA 2PFFB 4CESA 4JD2B 4YOUA 3ADAC 4FSVA 3G6EN 1TQLA 4KGVB 2P8IA 2GFFA 5HQMA 1Q9YA 2DGXA 2R7QA 1JX4A 4CJPA 1S57A 3EGZA 4M45A 2X1GA 2RF2A 1F60B 2C3YA 5LSOA 2XMKA 3CYMA 5EGYA 4YB5A 2XY5A 1CJTA 2WHOA 2XY6A 4IOCQ 1HLUA 5C12A 3HVTA 1YJ7A 1VC5A 4DQ8A 1U6FA 4CJVA 3S7RA 3UE2A 2VQEJ 1U24A 2CQ0A 1IM6A 2IPOB 4U67L 3D1HA 1PIEA 4F50A 3VETA 3OL8A 1XNQJ 1C1CB 4XEIA 3LOUA 1W7WA 5KFJA 4U7CA 4OMFG 3CCLS 3T7ZA 4B9SA 4ZVHA 1RBTA 1KHVA 2UUAF 1F9EB 4CLPA 4WFXA 2HG4A 2B5JA 3H25A 2RDDA 1U8WA 3N4QA 3VVTA 1S9GB 4JI2K 3CJ0A 3RYLA 3SYZA 1N34K 2CZVC 3KUGA 3F73A 1WLJA 1KHWA 2GQQA 2E1CA 3CCJN 1WB9A 3MCAB 1CS4A 4P2FA 5B7WA 1LWFB 1ZM9A 4Y2CA 3MAAA 1U1LA 5M1NA 1RT3A 1HNXF 1HWIA 4X4PA 2AHOB 1M5OC 5GIPA 1S6QA