1EETA

Hiv-1 reverse transcriptase in complex with the inhibitor msc204
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Urea-PETT compounds as a new class of HIV-1 reverse transcriptase inhibitors. 3. Synthesis and further structure-activity relationship studies of PETT analogues.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 153
structure length 542
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1eetA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1eetA05
1SUQA 4QCLA 4J2AA 1BI4A 2G8FA 4ECTA 2KFZA 1ASVA 4QPXA 3MR2A 3CFRA 1IKYB 4B9UA 4DTUA 3NL0A 4CJ3A 2E9TA 4E1MA 2ATLA 4O44B 4IQXA 5EWGA 1HNIB 4KPYA 3H08A 5CYQA 5D3GA 4CK1A 3AVBA 4ZVHA 1UA0A 3HSTB 4CJKA 1RDCA 2IGIA 4K4YA 3DI6A 1HPZB 4YR0A 1BCMA 1BCOA 4W5TA 4IKFA 1KVAA 4KHQA 2HVIA 4ED2A 3IS9A 1MMLA 3BSAA 5KFTA 4CHZA 3BSNA 2OPPB 3RMDA 1HQUA 2C28A 4J9SA 4H8KA 1WN7A 5C25A 3C95A 3MTKA 2V4RA 3RB0A 1SKWA 3TAEA 5HRRA 1NKEA 3ZSVA 3G6YA 4NLGA 1RT2A 4YQWA 3DLEA 1XHXA 4OJRA 4Z4EA 4KREA 3FQLA 3GILA 3V6DA 4MFBB 3F73A 3PX6A 4DQRA 1ZTWA 5L1IA 3SPZA 4OKKA 2W7PA 2AGPA 4FJXA 2FBTA 3KLEB 1KCFA 3DI6B 3VQ8A 5J1EA 4LH5A 4ECVA 3OJSA 1U47A 1W0HA 4IFVA 3CDUA 2OYQA 5J1EB 3OSNA 3CJ4A 3GQCA 4C8MA 1G15A 1L3SA 1TAQA 3KJVB 2YNFB 4QWBA 1VSHA 4CFAA 3T5KA 4O4GB 1RTJB 4EYIB 3GIMA 1NK8A 2AGQA 3DYAA 1RT2B 4EZ9A 5K14A 1N5YB 3C6TA 4B3OA 1U09A 3TANA 2KW4A 2I5JA 5C24B 3T5JA 3QZ8A 3PW0A 4FW1A 2W9CA 4CJ5A 3RBEA 1KFDA 3I0SA 4RW7A 4DFMA 5HP1A 2YV0X 2ASDA 2BR0A 1C0TA 3AVGA 1D8YA 3H5SA 4DL7A 2WCXA 3AVCA 5I42B 3BSCA 5KGWA 2OPQA 4CEEA 1N6QB 4LY7A 4FXDA 2R8JA 2WRMA 3L2RA 4EYHB 3V6JA 2FLPA 3AVJA 4ZMMA 4IRDA 3PW2A 1I6JA 1WSJA 1JLAB 3L3VA 4QAGA 5HRNA 3K59A 4FLZA 2HHSA 2ILYA 3MEGB 3KK1B 1IKVB 4CEQA 3NGZA 2VG5B 4CGDA 5CYMA 4NLUA 3O4NA 4KV8B 4PY5A 3DOKA 3UR0A 5HROA 4EBCA 4IG0A 4CERA 4R0EA 1F21A 4M3RA 4HTUA 4O3NA 1S9GB 1FK9A 1RTJA 4BACA 3OYAA 3B6PA 2BQ3A 3ISNC 1XR6A 1T8EA 2IS3A 3G6XA 1NJYA 3QO9B 4CF2A 4C8NA 2D0AA 4CESA 3LP1B 1L5UA 2JC1A 3CIZA 3JSMA 3EY1A 3I5CA 2FJVA 4FK4A 2YNHB 2R7YA 3DLHA 4DFPA 3H5XA 4CHOA 2QKBA 1FXXA 3SI6A 5KFWA 4H4OB 2I1RA 4OGCA 3MR5A 3VQ4A 1C1BB 1QAJA 1DTQA 4R5PB 2F8SA 3QLHA 2XY6A 3LAMA 1S1WB 4N47A 4FM2A 1RT7A 2WK4A 4ZPCA 2F8TA 1IKWA 2V9WA 2ZKUA 4R8UB 5KFQA 5DQGA 2FVQA 2LSNA 5KI6A 4E19A 3QLHB 1I3AA 3KHRA 4URQU 1T7PA 4Q8EA 4I2PB 4DQIA 4IRKA 5J2PA 4B8AB 3NH2A 4DTNA 4NLQA 2ITGA 2RDIA 1WSIA 1N56A 1KLMA 1BL3A 4PUOB 1BQMB 3PY8A 3OS1A 2R8IA 2B5JB 3VA3A 3LZJA 4OVLA 4DL5A 3VQAA 1QQCA 4ID5A 3NF7A 5SWMA 4BDZA 1CXQA 1LAWA 1NOZA 1BQMA 1QAIA 3NKYA 3PR5B 4CK2A 3OYHA 3SFGA 1D5AA 4CEFA 4CJEA 3SFUA 1BGXT 1JLBB 3SQ2A 1A5VA 3NGIA 4CJLA 4M3XA 5I3UB 2D0CA 4CGIA 1T05A 4RW6B 3ZSWA 3QESA 3DRSA 1JLAA 3V9UA 4O44A 4FLWA 4GVMA 1S1TB 2VA2A 1RCHA 3H40A 3S3NA 4CCHA 5EUHA 4CGHA 1LW0A 2VWKA 4RNOA 5KG4A 3LZIA 3HVTA 5J2QA 4NLYA 4QWAA 3DM2A 1NHUA 2HWHA 1RBUA 3I0RA 1GOCA 2Y1IA 4MK9A 4AILC 4OPKA 4Y1CA 2XCPA 1NNDA 5FROA 4KBIA 2D0BA 3HO1A 3M8QB 1LW0B 4ZVFA 3CJ0A 2GBZA 4J9NA 4DL6A 1RBVA 1IKXA 3OL7A 4ECYA 1ASWA 2ZD1A 1N6QA 4ZHRB 3HKWA 4HYKA 4IFVB 3BQ2A 3I0RB 3MXJA 3M8SA 3TR8A 3L2UA 1IH7A 4RW4A 5KFSA 2DFFA 4EO6A 2UVRA 4H54A 4FK0A 4TQSA 4M3YA 4NZ0A 4AHTA 4PQUB 2X74A 1SH2A 1NJXA 3ZT4A 1YTAA 4TYBA 1LWCA 4YR3A 3ITHA 3GV5B 5C25B 5KFHA 2YKMA 4RUCA 4IG3B 2DFHA 3HK2A 3ZT3A 3OS2A 3MXIA 3QNOA 4RW9A 3NBPB 4QWDA 4G3IA 4GMJB 2O5DA 2D3ZA 4NLRA 2YNFA 4KHUA 3DRRA 3V6KA 4IR1A 1KTQA 4OLBA 4PA1A 1RILA 1C2PA 3ZSOA 2Y1JA 2IAJB 2EC0A 1FKPA 3H2LA 3I8DA 3LP3A 4AHUA 4M95A 4KO0B 3IG1B 4DQPA 2XRIA 4O0JA 3AO5A 1RYSA 3KMQA 2IM3A 1HNVA 4BWJA 2KZMA 1GX6A 1GOBA 1LW2A 4F2RA 4DTOA 4K4XA 2DY4A 4O3OA 4W5RA 5KG3A 1Q9XA 2HVHA 2C2RA 4BDPA 2AX0A 4FJGA 3MEGA 4MFBA 2B4JA 3DMJA 2FBVA 2HHWA 4ICLB 4FS1A 4IG3A 1TKTB 2FJXA 4MH8A 1RT3A 3DOLB 4RZRA 4J9KA 4CEBA 3QIPB 3ZSYA 5KFZA 2R2RA 3OYNA 1Y97A 4BE1A 3LDSA 1GOAA 1VSIA 4FK2A 1XWLA 3U3GA 4KAZA 3QNNA 3B6OA 3WNHA 2B43A 3UPFA 1BQNA 3BQ1A 4FLTA 1CLQA 2D7SA 1RT7B 5HROB 1KHWA 5KFCA 2W8LA 2E9ZA 2FVRA 4DTJA 5KFMA 5FRNA 3G86A 2V4QA 1JLQB 3V1QA 1TL3A 3L2WA 4EP5A 3OHBA 1RT4B 3AVLA 1WSEA 1SH0A 4FS2A 3E51A 3VQSA 1QSLA 1K1SA 3PR4A 3Q8RB 2A1SA 1KSPA 4KAIA 2BQRA 1YTUA 4ECSA 3TAFA 1QUVA 2OPSA 1JLEB 3ASMA 3TAMB 2QXFA 4CJRA 4ZTJA 4KI6A 1RTIB 3OLAA 3C6UA 4ZPBA 2P51A 1S97A 1HRHA 2HHVA 1WAFA 2ATQA 4K4UA 3C6TB 4B3OB 4JRQA 3V9SA 4CF0A 5EDWA 3PVXA 4YNQA 3L8BA 2UVWA 1RTHA 4FJNA 3RB6A 3ZCMA 2XGQA 4Q44A 4JV2A 5KFOA 3M9OB 1C1CB 3RB3A 3SQ4A 3ZSZA 4Q0BA 2KQ2A 2UVUA 3OYDA 1D0EA 4BE2A 1RYRA 2FVCA 3MFHA 3MEDA 5DMRA 3V4IA 1BIUA 4TYAA 3GV8B 1MU2A 1QHTA 4LSLA 2HNYA 3JYTB 4O3QA 3NBPA 1DTTA 2GIRA 2XY5A 4URGA 4R5PA 1SKRA 2XY7A 5J2MB 2X6NA 2X78A 4NCGA 4JUZA 4PWDA 3DLBA 2J6UA 4W5OA 2WOMA 3V6DB 1RAJA 5KRSA 1IKXB 4RNNA 5CZ2A 3O3FA 1LAVA 3LPUA 1T03A 2P5GA 3DLKA 3VQBA 4KKOB 1Q8IA 3PX4A 2ZE2B 2DTUA 4WFYA 4OL8A 1T03B 2KZZA 5KRTA 3HVTB 5J2QB 3V1OA 3T3FA 3CO9A 4ID1A 3IN5A 3O3HA 5EWEA 4DMNA 2HNZA 1CZBA 3IAYA 4CHPA 1HNVB 1S0NA 3TQ1A 1NK0A 4M94A 3OL8A 5KFDA 2ZD1B 4Z4CA 1S1TA 4KHYA 4N5SA 2E4LA 4F4YA 1U45A 1SL2A 4OKEA 3OYGA 2WTFA 4KTZA 4FLXA 4FJ8A 1TVRB 4ED3A 4O5BA 4EP4A 1BI4B 2F8EX 3CJ3A 2HHXA 1VRUA 4H4MA 4WXWA 4N41A 3BREA 2RF2A 4DG1A 3OS0A 2CJQA 1UAXA 1Z4UA 4FBTA 3KLIA 5FDLA 4KI4A 3QEWA 1S9GA 3P83D 2G8IA 3PUFA 1D1UA 1L3TA 5F9NA 1GX5A 4KHMA 2QK9A 2BRLA 3KLFA 4ED6A 4DTXA 4Q43A 2QE5A 4AHCA 3AO3A 2BE2A 5JS1A 1HYVA 2YNHA 4FLVA 5KG1A 2P1JA 3K2PA 3RRGA 3TABA 4J2EA 3MECB 2P5OA 2XY8A 3RAQA 4B9SA 3TWHA 3G0ZA 1QE1A 2AGOA 3V9XA 3DM2B 3PJXA 5C5JA 3BQ0A 3ZT2A 5KFRA 2G8WA 3HVAA 2I5JB 4N56A 3T5LA 5KFAA 2VG7B 4F4WA 4HUGA 4FZXC 4ELUA 1VRUB 4H4MB 2Q3SA 4CJFA 3PW5A 1HJRA 4EO8A 3QZ7A 3KD1E 1REVA 4CK3A 5C42B 2FLLA 4ZP6A 2BRKA 3CM5A 1VK0A 4JRPA 3S9HA 4FJJA 4DFKA 1J53A 2Z1JA 2B6AA 4DF8A 3U3YA 4MIAA 2D3UA 4FJKA 4YP3A 5DG7A 5KG5A 4F4XA 4E7LA 2UUTA 4M3WA 1B9DA 3KTQA 4DU3A 3EPIA 1SV5B 4N76A 1QSSA 5DLGA 1TKZA 3UDLA 4U7CA 2OH2A 3AA2A 4HCBA 1TKTA 3DLEB 4NLVA 3EPGA 5F8MA 1RT5B 3MF5A 5FRMA 4O55A 4KFBA 3KLGA 1SH3A 3V81B 1RT5A 3SV3A 2BANA 4F4KA 4XO0A 4OLAA 5HLFA 4CHYA 3T5HA 4I2QA 3AA3A 1LWFA 3KNAA 3SJJA 4HHTA 4DTMA 4X2BA 4G1QA 3G10A 2IC3B 3BGRB 2E9RX 1Q9YA 2WOMB 4ELTA 4CEAA 3OYMA 4FLUA 1C0UB 3A2FA 3D28A 3P1GA 4Q45A 3ZT1A 4HCCA 4NLXA 3E01B 1WNEA 4TQRA 4BWMA 4CJSA 4M45A 3ULDA 4QWCA 4ZTFA 2IJFA 3AO4A 3KLHA 4K8ZA 3DRRB 4CIFA 2O4IA 4CHNA 1JXLA 4CJTA 3NFAA 2ILZA 3RMCA 1KFSA 3OYFA 4DQQA 3GIKA 2IA6A 4O0IA 5CYMB 3OL6A 4DL4A 3KOAA 3HL8A 1JLGB 1K1QA 5JS2A 1B92A 4PQUA 3D0PA 1NK6A 4ECQA 3TVKA 3AVHA 3RMBA 1QSYA 3HVRA 4Y3CA 4IKAA 4CGFA 1NOYA 4E0DA 2HB5A 4O3SA 2IC3A 2JLEA 1VRTB 2HHTA 3IGNA 5EU7A 3NHGA 5KG0A 4KRFA 1T94A 1QTMA 1TGOA 2EHGA 1CXUA 1FK9B 3DOLA 4JV0A 2W8KA 1U4BA 4CJPA 3QEXA 3DLRA 3U6FA 4DFJA 2FVPA 3VQ7A 4C8OA 3RAXA 3GIJA 4URSA 2HMIA 4LQ9A 4KO0A 1MU2B 3BDPA 3QINA 3MEDB 1UA1A 1TVRA 4J9QA 1KHVA 3OHAA 4LD0A 3HJFA 4AHSA 3MR3A 4O4RA 4E3SA 4QOZB 3NDKA 4Q8FA 1X9MA 5KG6A 4RG8A 1XR7A 2G8KA 1L3VA 1VSMA 4FW2A 1TK0A 3HYFA 4WYLA 1VSEA 1RDDA 2ZE2A 1NK5A 2O4GA 1FKOB 4CFBA 5KGXA 1X9SA 3KIOA 5L9XA 3M9MB 2RPIA 2V0NA 4CJQA 1CSJA 1YT3A 1EP4B 4DLGA 3UIQA 3HVWA 3IGVA 4DSJA 3OSPA 1IKYA 1BISA 5KFVA 4DWIA 3MEEB 4ED8A 3NAEA 1C1BA 4OGEA 1C6VA 2R2TA 2D5RA 1J5OB 4GC6A 5L1LA 1TKDA 4J9PA 2F96A 5CYQB 1JL1A 3NGYA 4I2PA 1JKHA 3PHEA 3PV8A 1JLCB 3QO9A 5F8IA 3RBDA 3M8PB 4EEYA 4CGGA 4AHVA 3PZPA 1JLQA 1S9FA 4Y2CA 3MXMA 2IJNA 4R8UA 1REVB 1N4LA 4TSXA 3LWMA 4M41A 4L8RB 4E1NA 4ZP9A 1BHLA 1TKXB 1U48A 2IM2A 1TAUA 1RTDA 4E7JA 4KB0A 4B08A 1S6QA 1DLOA 3LP1A 4IBNA 3QEVA 2HNYB 4MKBA 1JLEA 4FM1A 3MECA 4KHNA 1EETB 4CFDA 3HPGA 4J2BA 5KT5A 4Z4HA 3ITHB 4TN2A 1A5WA 4F50A 3AVFA 1EXQA 3C6UB 3K57A 1S0MA 4Y1DA 2XC9A 5DG8A 5DGBA 4IFYA 5D3GB 3SUPA 4CIGA 1OS5A 1ZTTA 4IFYB 2PYJA 2QV6A 2VG6A 3M8QA 2YNGA 3WNFA 1KRPA 3PW4A 4WZQA 5KFGA 3FFIB 4WFZA 2R2SA 5KG2A 3LP2A 3VQQA 4ZHRA 2ZQBA 4QWEA 4TLRA 5KFBA 1RT1A 3V6HA 5K14B 2DFEA 2BDPA 1WSFA 2FBYA 3AVAA 4K4TA 3RR8A 2RDJA 3BGRA 1R0AB 2E6LA 4IDKB 5DK5A 1ZBLA 2FJWA 2JEJA 2YHAA 4FJ5A 4TY9A 2HAIA 1VRTA 3SV4A 4LSLB 3JYTA 4J2DA 3BJYA 4WE1A 4CJUA 3QYYA 4LSNB 1LWEA 1S9EB 4C8KA 3RB4A 2JGUA 1NHVA 2AJQA 1JLBA 5I42A 2JEIA 3QERA 1NK9A 3KLHB 4B9NA 4DLEA 3UQSA 3S3MA 4FM0A 3DMJB 2ASLA 4ECRA 3IRXB 1WSGA 4IH6A 1C0MA 4DSKA 4FBUA 4ZPAA 1LWFB 2HNDA 2HWIA 3OYLA 3O3GA 3I5AA 1QS4A 3L3UA 4MK7A 3WNEA 2W9BA 4J9RA 4FJIA 3KKSA 2IBKA 5KT7A 1S6PB 1RA7A 4DSFA 4ED7A 5JUMA 2PZSA 1T3NA 1S10A 1VSDA 3DDKA 5JXSA 4DS4A 4CJVA 4BE0A 2DPIA 3AVNA 2W7OA 3IG1A 4KSEB 2XI3A 2ALZA 1XR5A 3ZSQA 4IDKA 3ZSXA 5DGAA 4M3UA 4E89A 4CECA 4FJ7A 2VWJA 3VA0A 1WSHA 4DSIA 3CFOA 1TV6B 3D5MA 3EYZA 1RBSA 2A1RA 5KFYA 4RW9B 2FBXA 5HLFB 1RT4A 4I2QB 3HM9A 1HPZA 1SL1A 3LWLA 5CY4A 4Z4FA 3H98A 3IRXA 2D41A 4F4ZA 1U04A 4CJWA 2OPSB 4FYDA 5F8JA 2YKNA 4F3OA 4B9MA 4ELVA 4WXOA 3DOKB 2UUWA 1TK8A 1VSKA 2OPQB 1RTIA 3FDSA 3NH0A 3DRPA 4DEZA 3SUQA 4Z4GA 1QE1B 4DSLA 1EX4A 3P5JA 2KTQA 3K58A 1ZBFA 4LH4A 3VQ5A 3KK2A 4I7FB 2KFNA 3QGIA 3DLGB 4JS4A 1WLJA 4CEZA 1HMVB 3SQ0A 1IKWB 1SL0A 3CG7A 4AHRA 3N6NA 3OYEA 1TL3B 3LP2B 5HRPA 2R8KA 3F9KA 4ED1A 4ICLA 2CKWA 2BGGA 4B8CA 1BQNB 5C42A 4IR9A 1SKSA 5CZ1A 2XO7A 1S1UB 5SZTA 3LP0B 1HYZA 4FZYA 4B9TA 4FJHA 2DPJA 3T1AA 4ZP7A 4K4SA 3SUOA 3AV9A 4E7KA 3NH1A 4TY8A 1Z26A 3QIDA 5KFNA 1LWEB 1W9HA 1N5YA 5KT2A 1Z25A 1JXBA 3VN5A 1ZBIA 4F2SA 4TXSA 3AO2A 2OPRB 2BQUA 1ASUA 3BSOA 1JXEA 5DLFA 1EP4A 4CF8A 2XGPA 1HMVA 5HP1B 5HBMB 4TY8B 3DLKB 2IMWP 3NAHA 2JEGA 4DS5A 4ZVGA 4IH5A 4ZVEA 4NLWA 2AQ4A 4NYFA 4NLSA 4KFBB 4AH9A 4IG0B 4QW8A 3KLVA 4DL3A 5KFLA 4KHSA 1RBRA 3SQ1A 3KLFB 4RNHA 3D45A 3NF9A 2R8HA 1NKBA 4H4OA 4ZP8A 3LANA 3ICLA 2IM0A 3OYBA 5KFPA 5J2PB 4CEOA 5KFFA 1J54A 4CF1A 1I39A 4CHQA 3CJ5A 1DTTB 2Z1GA 3VQPA 3RR7A 3TAMA 1S1VA 4FJ9A 1NJZA 4NRTA 1XC9A 1S1VB 3HPHA 2HW3A 3KK3B 4CIEA 2PY5A 3ALYA 2BANB 1NKCA 3K5MA 1JL2A 1RT1B 4DF4A 2QKKA 4K8XA 2WONA 3THVA 1ZBHA 3KKRA 5J2MA 5KFUA 2FLNA 3I5BA 3T19A 3KK1A 2YNGB 1S1XB 3OYKA 5KFEA 2OZMA 1RA6A 1VSJA 1RT6B 1HQEA 1IM4A 3OYJA 4QW9A 1ZYQA 1S1WA 1RBTA 1TK5A 1IG9A 4WE1B 4RU9A 4LSNA 5L1JA 4KHRA 4EZ6A 3PO5A 3KK3A 3RWUA 5KT3A 1TL1B 2IDOA 3SI8A 4DTSA 3C94A 1UWBB 3OYCA 1TL1A 4RW6A 2BE2B 2GIQA 4KB7A 4E7IA 1S48A 4Z4IA 3OVNA 3QETA 2R2UA 2FC0A 1S1UA 2X6SA 5KTQA 3AA4A 4JV1A 3LPTA 3GV7B 3FFIA 2IM1A 3CVKA 3V9WA 4HVJA 2OPPA 3FQKA 4NLDA 1YVUA 4LQ3A 2WHOA 4RW8A 2GC8A 3KLIB 3AA5X 3HHKA 3QEPA 3AVMA 2R8GA 4YR2A 4I7FA 5T14A 4K50A 1NJWA 4J9OA 2YHBA 1KVCA 3N6LA 3OYIA 4I9LA 5T7BA 3SPYA 4MIBA 2FVSA 4EBEA 4ED0A 4IRCA 5KFJA 2VG6B 3VQCA 1HARA 1RDBA 4YMEA 1O1WA 3HXMA 3VQEA 4DU4A 1T05B 4FVMA 5FDLB 3TAQA 1TKXA 5I3UA 3O4QA 1JIHA 3KLGB 3CQ8A 3CDEA 1VSFA 1KLMB 5F8NA 4KB1A 2AX1A 1RNHA 1EETA 4O4GA 3M9NB 2VG5A 1HYSB 3ZT0A 1S0OA 3V9ZA 4WFXA 1D9DA 1X9WA 4ID5B 3RMAA 1N48A 4KTQA 5F9LA 1NK4A 1LW2B 5J2NB 3Q8PB 3EZ5A 4DL2A 4NYNA 1J5OA 4CJ4A 4OPJA 3CDWA 5F8GA 1RDAA 1ZBUA 1RT3B 4BDYA 3CFPA 1JLFA 4IOBA 1J9AA 3L2VA 3Q8SB 3HT3A 1U49A 3M8PA 2B6AB 1SV5A 4GW6A 5F8HA 3K5NA 5J2NA 1JLFB 2G8UA 4I9QA 3LALA 4CE9A 2XHBA 2G8VA 4RW4B 3DRPB 3QIPA 1FKPB 3HP9A 3KLEA 4NCBA 2HNDB 4JS5A 3V81A 4CGJA 1X1PA 4ECWA 2VG7A 3PO4A 4FLYA 3K5OA 4O3RA 4K4ZA 1TKZB 3IS9B 5EWFA 4JLHA 3TI0A 3KD5E 4K4VA 3V1RA 4FCYA 1DTQB 1RDRA 3NF8A 3K5LA 4DTPA 2GV9A 4DTRA 2B5JA 1JX4A 1C0UA 2HHQA 3NAIA 3KK2B 1S9EA 1KVBA 4G1QB 5HRSA 4U6PA 3TARA 3KHLA 3JSMB 2W42A 1VSLA 4CEDA 1KLNA 1D9FA 3OL9A 4XIUA 3CJ2A 1LV5A 3NCIA 1C1AA 2YKNB 4FJMA 2W9AA 3LP0A 2W9BB 3G6VA 5KG7A 1K6YA 4KTWA 3FRZA 3L2QA 4OKJA 5DG9A 1TQLA 4C8LA 4B9LA 4KV8A 4NLPA 4J9LA 4Z0UA 5KT6A 4F3TA 2OPRA 1W25A 3Q8QB 4GC7A 4CFCA 4DSEA 3GIIA 4HUEA 4ECZA 4O3PA 1TV6A 3I0SB 3DLGA 5DQHA 4E7HA 2W9CB 1C0TB 1S49A 1TP7A 2C2EA 2XI2A 2J6TA 3SYZA 2HHUA 1XHZA 3ISND 4FZZA 4ZPDA 4RW7B 1WNSA 5E41A 3LAKA 1S1XA 3HP6A 4NYZA 2XWYA 3QIOA 4M3ZA 2RN2A 5C24A 1R0AA 3NGDA 3SZ2A 1RT6A 2Z1HA 2IOCA 4J9MA 2ASJA 3WNGA 3KJVA 4YFUA 3E01A 3TAPA 4RUAA 3AVKA 2C2DA 2OA8A 3DYAB 3QGGA 3VQDA 1YVFA 4MQ3A 5KFKA 1UWBA 2ETJA 3RRHA 1JKHB 4DQSA 4Y2AA 4M3TA 4DG1B 2WONB 4WZMA 3H4DA 2EX3A 4FJLA 4MKAA 4XPCA 4Q0BB 3VQ9A 2HNZB 4EBDA 2GUIA 1A5XA 3DRSB 5KT4A 4W5QA 1JLGA 4M42A 2J6SA 2IAJA 1BIZA 2RKIB 5KFIA 3MFIA 3NE6A 3QEIA 3V4IB 2YNIA 1RTHB 4NCAA 1FKOA 3AO1A 2AU0A 1HQEB 3NMAA 2C22A 3KHHA 3SNNA 3TAGA 4PWDB 2RKIA 3OY9A 5F8LA 1S5JA 1ZETA 2PYLA 1HQUB 3QGHA 5L1KA 3KMSA 1WAJA 4Q5VA 5HBMA 4KHWA 4KKOA 4NLOA 3CYMA 5KFXA 3S3OA 3MAQA 3BR9A 3NF6A 4ECXA 3RTVA 4W5NA 1ITGA 2G8HA 5DQIA 3KHGA 2NUBA 4NRUA 3SCXA 3FSIA 1C1CA 4NLTA 2HMIB 1CZ9A 3MEEA 1B9FA 3PW7A 4RW8B 1SUQB 4B9VA 4XPEA 3H4BA 3EZUA 1LWCB 3OJUA 1S6PA 3H5UA 1S4FA 3N6MA 4Y34A 2YKMB 3CWJA 2RF2B 3GYNA 2OZSA 2YNIB 3HPOA 2VA3A 4IH7A 4NCGB 4RNFA 4HUFA 3ZSRA 4ECUA 3H59A 3VQ6A 4KE5A 1IKVA 1HYSA 1L3UA 2UVVA 1JLCA 3PX0A 3MR6A 1S6QB 3PJWA 4K4WA 2JC0A 2JEFA 2XCAA 4HKQA 1XI1A 4DU1A 4MK8A 2Z1IA 2WB4A 1HNIA 4WYWA 2AWZA 1UOCA 1EKEA 3H5YA 3AVIA 1IO2A 4CF9A 3M8RA 3SUNA 4RNMA 1DLOB 1RTDB 4F8RA 3OLBA 3CM6A 4UQGA 1NK7A 2E6MA 4PUOA
chains in the Genus database with same CATH superfamily
2YBVA 1SUQA 3IR5B 4QCLA 1ZAWA 2G8FA 4ECTA 3BZCA 5AE1A 4QPXA 3CFRA 1ATRA 4WQ5A 4YB1P 1S7HA 4B9UA 4CJ3A 4E1MA 4O44B 1U0HB 1MW7A 2GJ2A 2HFNA 4C4WA 1YRTA 2ZUGA 4KPCA 4A8OA 3H08A 3UWTA 4CYUB 1OYDA 3BH6B 3MWBA 1CG2A 4YR0A 1BCMA 3RRKA 1E6VA 4W5TA 4IKFA 3J81O 2HVIA 1J2VA 2HVEA 2OPPB 3VR1A 1BHNA 2MKYA 1HBNA 1BUPA 2LEPA 3C95A 2CZVC 2V4RA 1SKWA 5HRRA 3ZSVA 2C2NA 4JI1J 1VGYA 2OCEA 3GILA 1ZTWA 3CCUN 2ROPA 4DJBA 2GELA 2FBTA 3N4PA 3VQ8A 1GMUA 3FBBA 1KP6A 4FNHA 1D09B 1NZAA 4ZN1A 1RWVB 2WVEA 3KDOA 2MQMA 5GINA 2AKWB 1OQ6A 1K8AO 1HNXK 1L3SA 3QICA 2ZOMA 3KJVB 5B0DA 3MM6B 3OXFA 3T5KA 4O4GB 1NK8A 1KS2A 3H90A 4EZ9A 5K14A 3C6TA 4B3OA 1U1OA 2BZ2A 4DR4F 5I9EB 3TANA 2I5JA 1SC3B 3DN9A 4QIVA 1KQSM 3T5JA 3QZ8A 3GFXA 3TX8A 2QFIA 2W9CA 4CJ5A 2GGPB 1FEHA 2CH5A 2CQBA 3P5TL 2I7PA 2ASDA 4LIRA 1C0TA 3AVCA 1VI7A 1RDUA 5BPLA 4CH7A 5KGWA 5FLXO 4F25A 1WC3A 1NDPA 4FXDA 2R8JA 3L2RA 3HOSA 3V6JA 2QYGA 1YBUA 3ATVA 3EX7B 3BGOP 2HHSA 2MZJA 4FLZA 3K59A 1M1KO 2BACA 3LTOA 3BV8A 3O4NA 3I82A 2R9LA 1U6ZA 2SXLA 4EBCA 1WI8A 4R0EA 1F21A 3B54A 4M3RA 3BGFA 4WWSA 4O3NA 4WCEL 5AXLA 2IRUA 2EI5A 3GFHA 4USUA 3G6XA 3AOAA 4UY85 2YHXA 4CF2A 4NYOA 1N5SA 2P9SB 3WT0A 4DU7A 1VQPN 3IAM9 4B3SF 2NRHA 1U1NA 3EM1A 3HSZA 2FJVA 4FK4A 1MMDA 4DFPA 2W4PA 2COLA 3H5XA 2QKBA 2M5YA 5C7PA 5KFWA 4H4OB 2I1RA 4OGCA 3P45B 4KGVB 1QAJA 3EGZA 2YWFA 2XY6A 2ASMA 4QIFA 3P3DA 1RT7A 1BG3A 1IKWA 1FWKA 4R8UB 1X3MA 1DKGD 5KFQA 5EX5A 5HJYA 1YJRA 3GJTB 4LC9B 1O13A 4BVPA 2VPXB 4LF7J 4DV7J 3DGPB 4A46A 5L38A 4DQIA 5GADU 4B8AB 4X84A 4DUZK 4NZ6A 4I6MA 3R5JB 3R2CJ 1Y00A 3GCXP 3M6VA 3PY8A 3OS1A 3VA3A 3VERA 3OR2B 1FTCA 4OVLA 1RHKB 4DL5A 1QQCA 3CETA 3RSEB 5SWMA 4USMA 2GQCA 3SCLE 3WIVA 3IFEA 5L46A 3NG8A 1NOZA 4JKBA 4OQJA 1U8SA 1BGXT 4LF6K 1JLBB 1KKHA 3SQ2A 1SJ3P 4C2MA 1BLUA 1NMNA 4RW6B 1QM9A 4CTAB 2AYMA 4LRDA 3NEKA 2CJBA 3TO8A 2BX6A 4NXMF 2PBDA 3MDFA 3QRPA 4GVMA 1FEEA 3H40A 3S3NA 4NMXA 4IO8A 1N8RT 3G6EN 3J80O 2R7QA 2YY3A 1PYTA 1NPRA 1LW0A 2F9DA 2FB0A 3TR5A 4NLYA 4QWAA 1V3RA 1XMOK 1NHUA 1BD6A 3TUIC 4AM7A 3SQGA 4MK9A 3Q8YA 4KBIA 2V67A 3EEQA 4DXLA 3GBTA 1IKXA 1ASWA 1WBDA 4ZHRB 3ETMA 2UUBJ 3BQ2A 3M8SA 3MXJA 2ZZTA 2UXBF 2DFFA 2V9KA 1N33F 4R79A 1RDWX 4BY9C 4AHTA 2WTUA 3ZTSA 3AQPA 3PYGA 4I69A 1TFWA 3IXQA 2FF6A 1NJXA 5B0GA 3K7RA 5FJ4A 4X64J 4C0OC 4CM2A 2AZ3A 3C15A 2DFHA 2JDJA 3MXIA 3W60A 3SSQA 3W2WB 4QWDA 4Y2KA 2YNFA 4U67L 4E98A 2WVCA 2FYXA 4OLBA 2X51A 2V8GA 3A5LC 2IAJB 4NPOA 4F0HA 1FKPA 1XJWB 1WG1A 4ZPVR 3LP3A 4AHUA 4M95A 4ES1A 2EPIA 1FDBA 3EGVA 3BEGB 4BRFA 3NRBA 2CA9A 3EE3A 1RYSA 3A5NC 5A0YA 3DWLA 3N28A 2B4UA 1R43A 3BYPA 1GX6A 4H4KA 2HHPA 4F2RA 4DTOA 1VOMA 5KG3A 2PGCA 1M0SA 4ILHA 2C2RA 3FSXA 3MEGA 5LT5A 3QB0A 2FBVA 2HHWA 1FE0A 4FS1A 2UYTA 4DZDA 1TELA 2FJXA 4HT7A 1GLLO 3DOLB 3H7HB 1RISA 2CDQA 2GJFA 4A48A 3CJSA 3CPEA 3NCRA 4ISEA 1XWLA 2PD1A 2OTJS 3HSCA 3UPFA 5U47A 4CLLA 5DM6Q 1CLQA 3OHRA 2YVSA 1ZA1B 4FZVA 1UVJA 3BB5A 3OQ2A 2W8LA 2E9ZA 2FVRA 1YWXA 2W40A 4JI1K 3AD8C 3G86A 2V4QA 5AQXA 3G4SS 4K25A 2V34A 2OANA 3AVLA 1ZXOA 1H2UX 1SH0A 2B0GA 2FHMA 4HHJA 5BXIA 3W63A 1UAWA 3W62A 3VQSA 2A40A 5AQHA 3ENOA 3PR4A 2VQFF 1KSPA 2AYEA 2OPSA 1PJ7A 3TAMB 1E3MA 2YX7A 1HX1A 4QS7A 2QXFA 5A2QO 3R27A 1IBLF 1BA1A 1VFJA 5BRFA 5LOQA 4JI5F 1S97A 1HRHA 1K0VA 2XO6A 4KT0C 4JRQA 4AYBD 3BKUA 2WVFA 1X4DA 2CPZA 3GYXB 4CWBA 2UVWA 3RB6A 4KYZA 3ZCMA 4U9RA 5EX0A 2KDOA 4DHYA 4M5DA 1F2HA 3HULA 4Q44A 5KFOA 1C1CB 3RB3A 2EXUA 3ZSZA 1FX2A 3QT5A 5E3RA 1D0EA 3MX5A 3PNIA 3MEDA 4ZKAA 4K42A 1HWLA 2DO0A 2BMBA 2UXBJ 3NBPA 1DTTA 3KUEA 3LDQA 4FWSA 4WK3A 2CXEA 2LECA 3MXHP 4PWDA 3DLBA 4LF5F 3VETA 2WOMA 5KRSA 4DV0J 4RNNA 5CZ2A 3O3FA 2IDLA 3H2VE 4OX9K 1T03A 3DLKA 3EJMA 2V8PA 4KKOB 4YDXA 2NNWA 5BN8A 5CYJA 5ETVA 3PX4A 2ZE2B 3ULEB 1T03B 1R3NA 3T3FA 5TKYA 2XS5A 3H6EA 4M5GA 3W5YA 4BR7A 1RAEB 4FPAA 5HL7L 3T1HK 1XNQK 4IOCQ 1S79A 4DMNA 4CHPA 1S0NA 4O8UA 1QTNB 3TQ1A 2Z58B 5IS2A 1NK0A 3ISZA 2ZD1B 2E4LA 1U45A 1VS3A 4KGKA 3OYGA 3OW2M 2Q3PA 2C2ZB 2QGFB 2WTFA 4FLXA 4JB8B 5IT9O 3JAMO 4DV6J 4ED3A 1Q81O 4HWIA 3CJ3A 4WXWA 4N41A 3BREA 2RF2A 4DG1A 3EKUA 4FBTA 2KJWA 3W61A 1XNRF 3QEWA 1R6VA 4HH1A 4QPTA 5D0HA 3P83D 4JI6K 3D67A 4CZIA 3PUFA 2NXUA 5J1NA 1XERA 1B0PA 2BRLA 1SBRA 5E3PA 4DN0A 1XIQA 2MKHA 4BRDA 1QQMA 3MMVA 4ERDA 3UDEA 2BE2A 4JKAA 4NO7A 1UJ6A 3O6WA 4FLVA 4FXWA 5KG1A 5D78A 2BOPA 1BWEA 3TABA 4B9SA 3G0ZA 7FD1A 4HT5A 1KQFB 5L8RC 3DM2B 3BQ0A 3ZT2A 4XDCA 4DPXA 2P2CB 3X3UA 3TTFA 2A1BA 2Y1RI 4N56A 3Q22A 4C11A 2NPIA 3W64A 1Y64A 4ETZA 4H4MB 2XS2A 2KM8C 3IBWA 3KD1E 2FLLA 2BVZA 2BRKA 1VK0A 4JRPA 2HBRB 4MO4A 3UCZP 1J53A 4NLBA 1S72N 4P2XA 4JI8J 3TW0A 2AJ0A 4UZBA 2Q97A 4LFBJ 4MIAA 2BJ7A 1X4BA 5DG7A 1X4AA 4F4XA 1HW9A 3M8YA 2NRWA 2G1HA 2E5IA 3KWIA 1V6HA 4FSVA 4MDAA 2OP5A 1VRQC 3IR6B 3CERA 3OXLA 1NH7A 3EPIA 1SIWB 3I8BA 5DLGA 3JQJA 3AA2A 4QU7A 1X4HA 3CCZA 3EPGA 5FRMA 1YX2A 4KFBA 3O3LA 2KVQE 2KKHA 4F4KA 2HHHF 4CHYA 3T5HA 4K43A 1T9TA 1HNZF 3ADAC 2CVIA 3KNAA 4OLPA 1QHAA 1GXLA 3OT9A 4G1QA 3AAPA 1U7LA 4OLOA 4BCAA 2CQCA 3KFWX 1HBOA 1C0UB 3D28A 5B09A 1KC8O 3FZBA 4D3GA 3ZT1A 4DR2K 4CP5A 1Q53A 1WNEA 1FNMA 1NLVA 4CJSA 4M45A 3ULDA 4DZ6A 3VALA 4ZTFA 3AO4A 3IUCA 2J7UA 4F67A 1EZZB 4CIFA 4PKHA 1FFWB 1JXLA 4B3RK 2ILZA 4M5JA 1YJVA 3OYFA 2J0SD 5AQJA 1WI6A 4USIA 3HL8A 1EWRA 3L6QA 2B56A 3OW2R 1ZAXA 4F4AA 3BGUA 1KEKA 3CJKB 2IVOA 3RMBA 3IWLA 4Y3CA 4OJHA 2EBGA 3QAUA 3VWSA 1NGAA 5HI7A 3CCTA 3EVOA 2HQCA 5DDOC 5HQ8A 5EU7A 2KL8A 3NHGA 4I56A 3B82A 1N5TA 1CXUA 1FK9B 4JV0A 1U4BA 1VDHA 4YOUA 1VAZA 3TX0A 4AD6A 4CJPA 3QEXA 3HF5A 3NP5A 1TL7A 2L48A 2FVPA 4BQZA 3MMBA 2MQQA 3NGUA 4I6MB 2HMIA 4KO0A 2IHR1 5DZ6A 3BDPA 1IWAA 5GADI 2Q6CA 3GZ7A 1QQNA 2E8AA 1TVRA 2AZ1A 1UA1A 3CMQA 4LT6A 2N3OA 3FEXB 4A62A 4EU0A 4LD0A 4C3KA 1KXPA 3GE9A 3MR3A 1S0VA 2H5JB 1X9MA 2BUPA 2MLZA 2PA8D 1S6OA 2ZJPL 3M6WA 2DITA 3CCMN 3NGRA 3PSFA 3J7Z5 3ZX2A 5LY3A 4PG6A 4FVUA 4WYLA 1LOUA 4KGMA 1GNKA 3W8PA 3KJFB 4WP8A 2NR0A 5KGXA 1JJ2M 3W8GA 4ANDA 4XEIA 1OJ4A 1SKUB 4ID8A 1WTBA 1CSJA 1HLWA 1YT3A 2VBYA 4RWTA 2CPIA 2OSRA 1AW0A 4RUBA 3IR7B 4PG4A 4DWIA 4DV4K 3D6MB 4CQ1A 4DX7A 3NAEA 1C1BA 1N52B 4OGEA 1C6VA 5FPEA 1NBWA 2OTLS 2D5RA 4ISFA 3F9MA 2LQ9A 3VEXA 4LFBF 2VV5A 2F96A 1S12A 2UXCJ 3F56A 2DGUA 3OFEA 1JKHA 4WU2A 1ITPA 3ZZTA 1JLCB 1VQ8N 5IOLA 4CLKA 3M8PB 1U2FA 4DR3F 3PZPA 4Y2CA 3WZ0A 2QA1A 2IJNA 2X1GA 3U4LA 2D74B 2W4DA 3M2VB 1ZBSA 2VQEF 4CO3A 1Q86O 1U48A 2Q0UA 1UCNA 3MUTP 2IVYA 5E26A 4EK2A 4KB0A 2ZH8A 1GLCG 3EO3A 4IBNA 3QEVA 4OYPA 2R4FA 4JI0J 2EVZA 2G2OA 4RL1A 3W5ZA 4F50A 1EXQA 3AB2B 2MZQA 2Q1LA 3SUPA 2GA7A 1CJVA 1N36K 1QAXA 1OS5A 1YK9A 3A4TA 2HZCA 1C0GA 3VGUA 2Q31A 3WNFA 3MURP 1KRPA 3MUMP 4X64K 3I56S 5KFGA 3OTEA 3AY9A 4X64F 3MM6A 1U1RA 5KG2A 4EFAC 3VQQA 4AQYK 4F0KA 4QWEA 4TLRA 1RT1A 2BDPA 2VYPA 1WSFA 2FBYA 4LF1A 3RR8A 2RDJA 3BGRA 1NGBA 5DK5A 2EK6A 3GG0A 2JEJA 3SIPB 2YHAA 4TY9A 3T1YF 5IC6B 4LSLB 3JYTA 3VAIA 3LQVA 1FJGK 3BJYA 2OEKA 3QYYA 4LSNB 4BRPA 4C8KA 3M4XA 3RB4A 2JGUA 4EHUA 2JEIA 3ZXWA 3QERA 2BEFA 3S3MA 3I9V9 1G1XA 2ASLA 2P9IA 1C0MA 1D3WA 1IR2A 3E9PA 3I5AA 1QS4A 3D0GE 2B3TB 3C6AA 3WC2A 2HK2A 4J9RA 5AQQA 3KKSA 5KT7A 1S6PB 1RA7A 4OJGA 4PHTX 3AVNA 3BEXA 4B1VA 4C98A 2ALZA 4NXMK 4JV5J 3W3DA 3THXB 2V52B 3O9RA 1HR0J 5FPDA 2AJ4A 3CQXA 5LJWA 2VWJA 4FJ7A 1TV6B 4Q2LA 1VK3A 2GV1A 2XMVA 3LDNA 5HLFB 2GO9A 2P5VA 2CGKA 4JAXA 3IRXA 4L72B 4F4ZA 1U04A 2FHOB 3MMAA 1TUWA 3CCVN 2OPSB 4AL5A 2YKNA 3SDEA 4B9MA 1Q7YT 4JI4K 2DH7A 1VQPS 4LF7K 1JJCB 1VQ9N 2OPQB 1D8ZA 5AJ3J 1RTIA 4L3NA 5B7WA 1VIOA 1VQ6S 4ITSA 4DEZA 1YKWA 3SUQA 4IZ9A 3GJSB 2KTQA 1ZBFA 4LH4A 2F40A 3KK2A 1TYQA 2UXDJ 2ZH2A 2V2ZA 5E84A 3QGIA 2J9DA 3FNNA 1HMVB 3SQ0A 4AHRA 2UU9F 2R8KA 4JBCA 3F9KA 4ICLA 2CKWA 3EICA 1BQNB 5C42A 3R6LB 5H1SV 1NCLA 1CJTB 1KR4A 3RW6A 5CZ1A 1YJ9S 2XO7A 1DARA 3GTYX 5F2RA 3T1AA 4K4SA 3SUOA 4E7KA 2NZ4A 5KT2A 2GAHC 1JXBA 3AO2A 4FWMA 4BREA 2OPRB 4AXIA 4G6VB 2JOQA 5HP1B 4FP9A 3CXCR 3S7RA 2CPEA 2IMWP 4U96A 3NAHA 2P8IA 2JEGA 4Z37A 1YJNN 2HLTA 4HHHA 4AH9A 4IG0B 4P52A 3KLVA 5D4OA 3TA1A 1S22A 3DLLQ 2MKJA 1RBRA 3L7PA 3D45A 3P31A 3TZZA 4OX9F 4DV0F 3MOZA 1WHYA 2RE1A 5AQPA 4CEOA 1J54A 2F8HA 1I39A 4CHQA 3IBCB 3HZEA 3RR7A 4LR7A 2A2DA 4LR9A 1NJZA 4X4VA 5AQMA 3PSIA 2DKOB 2B4PA 1S1VB 4CIEA 2PY5A 4LF9J 2UUAK 1PYOB 3K5MA 1TUUA 2QKKA 4JI1F 2WONA 3V5RA 3A1YG 5MLCQ 3CC4N 3HSGA 1JQGA 1ZBHA 1Y3JA 3CC2S 1SJFA 2POKA 5J2MA 2FLNA 3MCNA 3I5BA 4DUYF 1S1XB 2ATCB 3GSDA 3OYKA 2OZMA 5A6WA 3NNCA 3J80Y 4UW2A 1H6KX 3CJ7A 3SLCA 1S1WA 1OQ3A 1IG9A 3SCKE 1O6XA 5EHHA 1UFKA 4KHRA 4EZ6A 3T1YJ 3RWUA 5KT3A 2IDOA 2DNZA 3UKUA 2M8HA 1UWBB 2RVJA 4C23A 3C14B 4KR0B 4RW6A 2E44A 4KB7A 3OVNA 3QETA 4X65J 1B3TA 2A6MA 3AA4A 1S57A 2ZJRL 5A8RB 1MDUB 2ZGZA 3CVKA 3ILIA 2KM8B 3V9WA 2X3DA 2IRYA 4HVJA 5GMDA 1NGFA 2N4CA 3MPWA 3O8WA 1NZ8A 4FWKA 3QEPA 5T14A 4K50A 3CJBA 2DNGA 2YHBA 2VOOA 4OYXA 4I9LA 3VHQA 1RK8A 3SPYA 4G65A 2F4FA 4KY3A 4ANCA 2DEIA 1SI9A 5AQTA 1O1WA 3UR3C 2F65A 1XMQJ 5CQGA 5FDLB 3TZYA 1N0UA 1Q7YO 2F9TA 1FXDA 1JIHA 2FSJA 3KLGB 2QWNA 3CDEA 3EE9A 1U02A 3HI9A 1RE1B 3NGSA 5F8NA 2AX1A 1EETA 4O4GA 2DNHA 2VG5A 2QYCA 3KJQB 2UUBK 3ZT0A 3V9ZA 1OYEA 1X9WA 4Z7YA 2ZBCA 1N48A 2QTWA 1B7FA 5F9LA 1NK4A 4FYYB 3EZ5A 5GAEI 5AQIA 4F3QA 3CDWA 1M5HA 4GKKF 1AYEA 3QSIA 3MN7A 1HWUA 5AJ3F 3CFPA 1SC6A 2H51B 2LMIA 2ZFHA 3N4QA 2B6AB 2BA9A 1IJJA 2QWMA 3DRPB 3HP9A 3KLEA 4NCBA 4PABA 2D9OA 4I68A 1N0VC 4DR2F 4CGJA 3GFYA 4OZLA 5IT9U 4FLYA 3BZQA 2XMUA 1TKZB 1XC3A 1R6YA 2RJZA 2J9EA 3DRXA 3V1RA 2W41A 4FCYA 3K5LA 4H4KC 3WXKA 4ES3A 3LW5C 1K44A 1C0UA 4MDBA 2HHQA 2OUGA 2G0CA 2ZGYA 1SC1B 4P2FA 3L4IA 2KN4A 1KVBA 1KVKA 2A0FB 4YOYA 5HRSA 2PMWA 3H0PA 3TARA 4JI8F 2W42A 1KLNA 3L4BC 2HBKA 2BJ1A 3O9QA 2ZJQL 4DV5K 1C1AA 4DCHA 3LP0A 2W9BB 3R5BA 2NZCA 3MEKA 1QUPA 2DYAA 4CLTA 1YXQA 3UN2A 4OKJA 5DG9A 1GT8A 1AT1B 4OX9J 4B1WB 2CZ4A 4F3TA 1R59O 4CFCA 1KAXA 4OJ3A 2OHDA 2I9SA 3DLGA 1Z2ZA 4OX7A 3ZYYX 5IT9Y 1S49A 3R7SB 2J6TA 3J80U 4RW7B 3FZMA 3W2VA 4AFFA 1RQ0A 5HVHA 3LAKA 2HYIB 2MY7A 2RN2A 2H48B 3QMQA 1YBAA 2C42A 2UUBF 2QG9B 2ZUAA 2IOCA 5ADZA 5AQNA 4MYTA 2ZOFA 4WQ4A 1CULB 4YFUA 3TAPA 4B17A 2CFXA 3DYAB 4WFAL 2DNLA 3QGGA 3D0IE 4C8YA 1UWBA 4CO0A 3RRHA 3ZZZA 1FE4A 4Y2AA 4M3TA 1KVJA 2WONB 2I6WA 1SZ2A 1S4EA 2KHOA 2GS8A 4LBIA 3AJ1A 1XNRK 2NLXA 1IJFB 3OUYA 3DRSB 5KT4A 2HWTA 2IY5B 1YIJS 4M5MA 2IAJA 3WX8A 4NB4A 3MDQA 2E1MC 2O01C 4NCAA 5BYQA 3CC2N 4BC9A 2GZOA 2Y0SD 3D1OA 4JD2A 2CUYA 2C22A 3KHHA 3GPAA 1XMOF 3BF4A 4TVAB 2HVZA 3PIPQ 4B3TF 2RKIA 1AUSL 5F8LA 3QT7A 5LL6Z 2CZ9A 1TL4A 3KMSA 1WAJA 3DLLL 4Q5VA 3EKSA 4KKOA 4ED4A 3VF6A 3IM9A 2NPFA 2GQ2A 3CYMA 2E2OA 5ETRA 2CPYA 4WPAA 2RHKA 4JKCA 3ENHA 2YX4A 3KHGA 1BC6A 3FSIA 4CD3A 4NLTA 1B9FA 2KRRA 2C2OB 1Z2LA 2R7WA 4B9VA 4CZJA 4LF8K 1FT8A 2KFYA 3N6MA 2VPYB 4E1JA 5T7LB 3CWJA 2QLXA 3GYNA 3W2WA 4IH7A 3SAFA 2CPHA 3QFHA 1HYSA 1JK9B 3UKUB 1JLCA 4KC5A 3GYGA 1NO8A 1X4EA 3PX0A 3MR6A 1FKAF 1VJWA 3W9JA 3TQEA 3Q8VA 4HKQA 1WORA 2Z1IA 2WB4A 1RTZA 3KXDA 2BJDA 4JI5K 3SCIE 3UVJA 3UD3P 2K3KA 1JCEA 4CVNE 4CT8A 4CF9A 2LVWA 1GXTA 4I0WA 1ATSA 1ZZNA 3SAHA 2UZAA 2RAQA 1N32J 4DR3J 1BOTO 4LFAF 1ZOTA 2Q6BA 3D1HA 2KFZA 2F7TA 1ASVA 2VWBA 2RU9A 3MR2A 2NZTA 2I8EA 4H5WA 3CJ8A 4DTUA 3NL0A 2E9TA 1CS4B 1GQEA 5LSLA 4A47A 4IQXA 1BDGA 3A3NB 3R2DJ 1QQOA 2NSBA 4KPYA 3M2UB 4CK1A 1X4FA 3J7YP 1UA0A 1RLDA 3M2UA 1ELOA 4CJKA 1U2VA 3CJKA 5KOWA 2GVZB 4JOUA 4PKIA 2HPUA 5DO2A 1KVAA 2Z56B 3R8YA 1QAYA 1RU2A 2C28A 4J9SA 1DBDA 3ELHA 3LPEA 5A8WA 3CCEN 1I94K 3RB0A 2QXLA 4B1UB 1NKEA 2VDHA 3G6YA 5AQGA 4NLGA 1RT2A 5CZXA 4OJRA 3C66A 2BH1A 4Z4EA 1SPBP 3F73A 1U1KA 5IFMA 5IT0A 3FK4A 2W7PA 2ERRA 3PYDA 2JVRA 3AGKA 3IRWP 3DI6B 2GIFA 5J1EA 4LH5A 4ECVA 3OV7A 1U47A 2E5LJ 2OYQA 5J1EB 2Q36A 4OO1J 2EFPA 3W5XA 3A5MC 5LMUF 1N5VA 4CLWA 1J6ZA 1TAQA 2YNFB 1VSHA 4CFAA 2GWKA 4EYIB 3I55S 4HEA9 1RT2B 2FPHX 1BUXA 5C24B 4P71A 1WHVA 3PW0A 3I0SA 4RW7A 2ASPA 2PT0A 2BR0A 2G0IA 3VAJA 3AVGA 4DR6K 3H5SA 2WCXA 4MIWA 1G99A 1JMTA 3C0BA 4ZPWR 2M8DB 1N6QB 1NNEA 3NS7B 2WRMA 4FKXA 4J7CA 2MQPA 1U24A 3FMBA 3WHIA 4QYRA 4LRCA 2FLPA 3N79A 4IRDA 2CQPA 3M2RB 4BRCA 3L3VA 1P1LA 4WFBQ 2VBWA 2ILYA 3JTOA 4OZ2A 4JHDB 3KK1B 1RWNB 5CYMA 4NLUA 1XMQK 1GEHA 3UO0A 4KV8B 4PY5A 4XK8C 3UR0A 4LF8J 5HROA 1XNQJ 1LOTB 4B3TJ 2CG4A 1S9GB 3UDVA 1FK9A 3EVWA 3B6PA 1H7WA 2EEYA 5IC4B 1XR6A 2IS3A 3R7BB 3VZIA 1B0VA 3QO9B 5I3PA 3EXCX 4CESA 4ZOSA 1N34F 2GGPA 3CIZA 3JSMA 2K7JA 4OV6A 3EGWB 5BRDA 4PPZA 4CHOA 2HQIA 2QSWA 1FXXA 3SI6A 5A8WB 3MR5A 1C1BB 2JJ4D 3Q7BA 5DM6L 1CJTA 1DTQA 3F41A 2GWJA 2MKIA 2O1PA 1F3FA 4R5PB 2F8SA 3LA0A 3LAMA 1Q8LA 5E3CA 4FM2A 2WK4A 4ZPCA 2A18A 3HDSA 3DHWC 2CQ2A 5DQGA 1FJ7A 2LSNA 4DV5F 1E6YB 3VAKA 1I3AA 3KHRA 4C3MA 2VBZA 4IRKA 4ZIVA 4QOTA 1FERA 1Q78A 1UEKA 4A2AA 2HFZA 4P7TA 2FTRA 2Q43A 1N56A 4JKEA 4YDUA 2B5JB 3THYB 4UY8T 3LZJA 2KYZA 1IM6A 5C12A 3MPDA 3CJQA 4BDZA 2W25A 1P9YA 4H0TB 1RBAA 1HWJA 3NKYA 4CK2A 2ROGA 3SFGA 1D5AA 4BRQA 4CEFA 4CJEA 1CZAN 1A5VA 4CJLA 4FYXB 4M3XA 2D0CA 2K1RB 4USJC 1T05A 4P72A 1FNOA 1JNZB 1Y5IB 3U9DA 3R1HA 4B3SJ 1JB0C 1IBMJ 2O8FB 2K1RA 2HRTA 5B8HA 4NLCA 4ZVRB 3MM7A 5FLXY 1S1TB 2VA2A 1VR6A 5EUHA 3F5TA 3HD1A 4NA3A 3CCQN 3PIOQ 4DR1J 4RNOA 3ILOA 3P39A 3LZIA 1HNXF 3CC4S 3DAWA 2MLYA 3QQCD 1OWXA 2HWHA 3I0RA 1GOCA 3CW2C 4LF9F 4NE9C 2K7KA 4AILC 2UUCJ 1IVZA 1LWXA 4RCHA 3CJ0A 2GBZA 4J9NA 3OL7A 2QWQA 3DXMB 2ZD1A 1N6QA 3FGVA 5D8HB 1CJKA 2XNRA 4GKKK 2V8DA 4YB7A 2UXDK 4FK0A 4P75A 2PN6A 3O6QA 4M63C 1SH2A 3I4HX 4HVZA 2PEBA 3ZT4A 3FMWA 1VQOS 1LWCA 3KDNA 4A57A 1HBNB 1X5SA 4W90B 3ZT3A 4HTIA 1BMQB 1Q5YA 3QNOA 5M1FA 1XTZA 2RRBA 4X65F 2O5DA 2D3ZA 1X0FA 3J7AN 4IR1A 1PBAA 1BWFO 3D7EO 2F9WA 2DT9A 2APOA 2XMMA 1HHTP 2C1EB 3TUJC 4KO0B 3IG1B 3OVBA 3V2UC 1E6VB 2DNOA 2NXCA 2H4WB 3UFCX 2O66A 3AO5A 3HBTA 4YOTA 2KRBA 3TZWA 2YJFA 2IM3A 3R5CA 1HNVA 4AM6A 3FBEA 3NS6A 3FVYA 2F8MA 4W5RA 4PG7A 2M2BA 5AE2A 4BDPA 2GUPA 1NGCA 4A8XA 3DMJA 3R1LA 3H3NO 1AZSB 2YKPA 2QA2A 3DKDA 4MH8A 2C2MB 4C1NI 4OPAA 4CLFA 4RZRA 4J9KA 1MA9B 4CEBA 5JMVA 4KHPK 4LR8A 4HACA 3OYNA 2MMYA 4BE1A 1GOAA 4FVCA 1HD1A 4DR1K 1VSIA 2ABYA 4KAZA 4RJVA 5C2GA 5J1PA 3BQ1A 4QS9A 3WXLA 1UVNA 2OI2A 5HROB 3LL3A 1NGEA 3FSYA 5A2QU 2WFBA 5AXNA 1TL3A 3QRRA 4G1IA 3ZLJA 1H74A 1UP1A 4OHZA 2GMJA 3C6HA 1WSEA 2KKZA 4FS2A 4GY2B 2HEKA 4FPRA 4OYMA 5M1KA 3Q8RB 4A8KA 1W7AA 2RE2A 4EGLA 2BQRA 1WF2A 3CDAA 1JLEB 1RCOB 2YX1A 4JI2F 3O80A 4ZS6A 2VJUA 2AF6A 4M5NA 4ZTJA 3D2FB 4KI6A 1RTIB 1B70B 1GK8A 2P51A 4WQ5C 3UNGC 1HBMA 1UEUA 5M2PA 2PMZD 3V9SA 4YNQA 3L8BA 4FJNA 4IJAA 1S76D 4ZPTR 2XGQA 4USVA 4DPUA 1I94F 4DOZA 3SQ4A 2RQCA 3U02A 4Q0BA 1QVGM 3LGMA 2UVUA 3OYDA 4DCJB 4QIWD 1ZH5A 1YRUA 2OAUA 1BIUA 3MCSA 4TYAA 1FF2A 4O3QA 2ADCA 2XY5A 4URGA 1V3ZA 4DR6F 2J6UA 3PKYA 1HKAA 1IKXB 3O5TB 3LPUA 3QRQA 4AT1B 4B02A 2DTUA 2B7CB 4OL8A 3N01A 3PHTA 2HBZB 5KRTA 3HVTB 5J2QB 3V1OA 3IN5A 3O3HA 2VFRA 4DX8H 3POTB 2HNZA 3TJ8A 3IAYA 3M30A 1HNVB 2BUNA 2CGLA 3VGMA 4KH6A 3OL8A 4Z4CA 1TFYA 4KHYA 4FF3A 4N5SA 3THWA 1XQSC 4OKEA 2DRDA 4KTZA 2E66A 4O0NA 3J7ZT 1XBWA 2HFUA 1BI4B 1RBLA 1WC4A 2F8EX 5HMWA 2HHXA 1VQKN 3I55N 4FN5A 3OS0A 1UAXA 3KG1A 4BC5A 3KLIA 1RFQA 4U67Q 1NEEA 2G8IA 3ZETB 3G4SN 2QK9A 4OPHA 1TR0A 1RWXB 1Y0HA 4AHCA 3WEEB 3WQTA 1M90T 2QWLA 2LXIA 4DR4K 4MTPA 2EFOA 4X4OA 2NRRA 3C65A 2P1JA 2XY8A 3RAQA 1QE1A 3V9XA 3PJXA 2GNKA 2V2KA 2Z2MA 2G0JA 1WDDA 3HVAA 3KUHA 3QJLA 2VG7B 4F4WA 4HUGA 4FZXC 4ELUA 1A7GE 4CJFA 3PW5A 5FD1A 1HJRA 4OX6A 3OVAA 3QZ7A 1REVA 4DV3F 4CK3A 5C42B 1TUGB 4X4PA 1RJJA 2PI4A 5A0YB 1S3XA 3HZGA 1BY9A 1RKJA 1IG8A 2OO4A 3CD0A 3RBZA 2D3UA 1N36F 4YP3A 3FCWA 3WQPA 1JJHA 1TZ0A 2UUTA 4M3WA 1URRA 2XM3A 1YI2N 1SV5B 4N76A 4YHHJ 2JFDA 3TPQA 3UDLA 2OH2A 3O4WA 3MMJA 3KNGA 5ETNA 2LEBA 2M7SA 4CW7B 4EI2A 5F8MA 3N5BA 3MF5A 5DDQC 4O55A 1NXIA 2MQLA 1SH3A 4M5IA 2ZM6J 3SV3A 2RB7A 2JX2A 4J8FA 4OLAA 5HLFA 1LWFA 3D7SB 4X2BA 1YHQS 4G9ZA 3G10A 4CZMA 5K8NA 4CYUA 2IC3B 4P2MA 3BF1A 2E9RX 1Q9YA 2WOMB 2ZNYA 1RWPB 2E1YA 5CH7B 4FLUA 2B9XA 2LEAA 3DOMB 2ZBRA 4PYDA 2VODA 1DAXA 3P1GA 1TUVA 4Q45A 4HCCA 4NLXA 3CMAN 3MMCA 4TQRA 4BWMA 5HSPA 2DIUA 4QWCA 2OFGX 2AYBA 2CIMA 4UOCA 2IJFA 3KLHA 4K8ZA 3C16B 4GVEA 3DRRB 4HTJA 2QWOA 3NFAA 2QIFA 2LDYA 1N5QA 4O0IA 3GIKA 3N9UC 2IA6A 5JICA 3OL6A 3B78A 4DL4A 2BW2A 1U1QA 3M3ZA 1OPZA 1B92A 3TUPA 4PQUA 4CBXA 2PC6A 1NK6A 1NG9A 4DR5F 3AA9A 5D4NA 4ETXA 3TVKA 1EKSA 3ILLA 1RXOB 3HVRA 2M3DA 4IKAA 4YY3J 3PG9A 1WOSA 2IC3A 3G87A 3R9LA 3ZETA 5CAAA 1VRTB 5BREA 1FDDA 4R0JA 2IBOA 4KRFA 4H0YB 2UUAF 5AZJB 1QTMA 2RH3A 1TGOA 2EHGA 1R8HA 4GNIA 2W8KA 2L41A 3M6GA 3THPA 4MO5A 4IOCL 2L9DA 2WC9A 1Q81T 2NSCA 3J7ZO 1VBXA 4UUWA 2VBXA 3ONQA 1MU2B 2FJDB 3THWB 2YWWA 3R7NB 3MEDB 4BLGA 2MXYA 4QIGA 3OHAA 1H3DA 5EX3A 3DC2A 3PYFA 4QOZB 1I5OB 3ULHA 3AOCA 3FJ2A 4R25A 4ILJA 1XR7A 1NDKA 5D0GA 1SQKA 1VQ4N 1WHWA 4KBOA 1VSMA 3CIMA 4FW2A 4O5FA 4P73A 3VZHA 1RDDA 2ZE2A 3ULEA 2NXNA 2ZH5A 2O4GA 1FKOB 4CFBA 1F0XA 2A5XA 1YQHA 3KIOA 4JD2B 5L9XA 3M9MB 2RPIA 2V0NA 1K47A 4EWTA 1UTAA 5ETTA 3E9LA 4U95A 4X4UA 2MZSA 3IGVA 1HWKA 2B7BB 2EK1A 3OSPA 1IKYA 1BISA 4AL6A 3MEEB 1Q7LB 4UUXA 1J5OB 4UTGA 5LMNF 4GC6A 1TKDA 3AGRA 4CH0S 4I2PA 2RQMA 4K41A 1QVGR 3RBDA 1N34J 3LH2S 4DMZA 3ZNUA 3MXMA 2AJ2A 3VCDA 2DH8A 2DH9A 4L8RB 4E1NA 4ZP9A 1BHLA 3TYTA 2IRXA 2IM2A 2QMXA 4E7JA 3TOQA 1YGYA 4B08A 2KLAA 1S6QA 2VFVA 2J0XA 2HNYB 4MKBA 3MECA 4X62K 2E5LF 2LYVA 4JI4J 1XUPO 4JNEA 5KT5A 2NYIA 1V4SA 4Z4HA 3ITHB 1MWQA 4OYZA 3AVFA 5ETSA 3C6UB 4C97A 2G4BA 4KH5A 5DG8A 5DGBA 5D3GB 3GMGA 2E1AA 2FGOA 3NVMA 4QQBA 2PYJA 4PR6A 1PAEX 3NWGA 1V5VA 4WFBL 3HMJG 1QLNA 3DCAA 1W2BR 4WZQA 3MPYA 4DV2F 2OMLA 4OI3A 3BKFA 2R2SA 1JWWA 2ZQBA 1MMNA 4OZ5A 2ZJQQ 4K4TA 4V19X 1DT9A 1R0AB 3KVGA 1WBBA 1ZBLA 4FJ5A 2HAIA 3W9HA 3CF5L 3TSUA 3SV4A 3OTOJ 1CJUB 3JTNA 4DR7K 1AB8A 4WE1A 5LM7E 2UXCF 1R8AA 2VHGA 4U7UD 2DXDA 1NHVA 3H8YA 2E1CA 1NK9A 1VHXA 4B9NA 4DLEA 3UQSA 4FM0A 2NQPA 3DMJB 4L74A 4ECRA 3BM7A 3LM2A 2GW8A 3OBIA 4DSKA 2L08A 4FBUA 4PL7A 1LWFB 2DGSA 1F60B 2HNDA 4RR5A 1V3SA 2KXFA 1FWPA 4B3TK 5B0FA 3CDBA 3L3UA 2W2MP 5LJVA 1V9OA 3WNEA 1NU0A 1K73O 2N7CA 4DSFA 4YHHF 1T3NA 2YCHA 1VSDA 4DS4A 1HWIA 3T6BA 2W7OA 3IG1A 2N7YA 1PJ6A 4KSEB 2XI3A 3CJTA 5LMNJ 1Q18A 2YKQA 4JYAJ 4GV6A 2Y8YA 2DD8S 3ZSXA 5DGAA 3DHXA 3ZZUA 1UVIA 1WSHA 2I38A 3EYZA 2A1RA 4Q2MA 4ZIWA 2RNEA 3O5BA 1RT4A 2YQ1A 4I2QB 3HM9A 4FPBA 4JK8A 2I0XA 2D41A 2P9IB 4F3OA 4ELVA 5CE3A 2GAGC 4WXOA 3NVKA 2YX6A 4ZDNA 1VSKA 2Z8QA 4P9SA 5G4DA 3HFKA 2N3LA 2KG0A 5BRHA 3L4QA 3NH0A 2QTDA 2QRRA 4Z4GA 2HK3A 5EGYA 3VEVA 1EX4A 4FXVA 2KFNA 5AQFA 2MYFA 5GAGI 4CEZA 3L7OA 1RGVA 1IKWB 1SL0A 3N6NA 4NOHA 4JEPA 2JSXA 2Y1LB 1YJWS 2BGGA 2BXJA 5IXUA 4LF5K 3SEOA 1SKSA 4FL9A 5SZTA 4FZYA 3OFFA 4FJHA 1NB7A 3AV9A 3I31A 1IR1A 1HBOB 3NH1A 4X66J 2R7OA 1VQMN 1Z26A 3QIDA 5KFNA 2CVEA 3CI5A 1DZ5A 1ZBIA 2ZKTA 2UXCK 3VF2A 1ASUA 2FC8A 1JXEA 2VH7A 3UD5A 1EP4A 2HURA 5HBMB 5IV3A 2F63A 1HR0F 3CMEN 1HFEL 3S41A 4DV7K 2WSEC 1EB0A 5JLHA 2QZ8A 4NLSA 2FF3B 4LF6F 2U2FA 1B0TA 2VFTA 4KHSA 5BYSA 3SQ1A 3KLFB 3PCOB 3VAGA 3B8AX 1NKBA 3SBMA 3L09A 4ZP8A 3WUHA 3DLJA 1BA0A 1Q82T 2E1PA 3ICLA 5E2QA 3OYBA 5J2PB 5KFFA 2QA4S 1HPMA 5GAHU 4RX6A 3TA0A 3CJ5A 5BPNA 2Z1GA 2PSZA 2FHKA 3TAMA 2YWKA 1F6TA 4FJ9A 1CS4A 3R1XA 3HPHA 4DV4J 2OD6A 1YJ9N 5F3TA 2EKNA 1NKCA 2YI1A 4LFCK 1RT1B 4DF4A 2DNMA 5CD4H 5KFUA 4FF2A 3QFWA 3UI3A 3MHYA 2O8BB 4DBQA 2YNGB 3R5DA 1FFSB 3HJVA 5KFEA 1KD1O 4G1PA 2HVDA 1RT6B 3OYJA 1PG5B 2ZZNA 1EIYB 2EG1A 1RBTA 3TU5A 2H1YA 4WE1B 4RU9A 4LSNA 3PO5A 2BKPA 3DXMA 3VENA 3J8AA 4DTSA 3FEZA 5HJXA 3OYCA 2RS8A 3K9JA 4LF4J 2EW9A 3RW7A 4E7IA 1S48A 1F5AA 1V5IB 3JAMU 2R2UA 2FC0A 4NZ7A 3LPTA 3GV7B 4M1KA 1XK8A 3M8ZA 4HTLA 4JKGA 2OPPA 3FQKA 6FDRA 3K9KA 3NY0A 2WHOA 2FJBB 2P9UB 4PL8A 2GC8A 1PGZA 1OVYA 3HHKA 3AVMA 4YOVA 4PG8A 1NJWA 4B3MF 3S6EA 2OSQA 3N6LA 4WF9L 4MIBA 4ED0A 1KDNA 3GR0A 3MPUB 3R97A 5KFJA 3G8TA 2CPFA 2VG6B 1RDBA 3HXMA 4DPTA 1HKBA 3DDIA 1Q16B 4FVMA 2V51B 1TKXA 5I3UA 4DX6A 4ENOA 5CR4A 4D3HA 2B51A 4DCOB 2EG2A 1K9MT 3Q8UA 3MM5A 1D9DA 1R8CA 4YDUC 3UKRA 4X4RA 3RMAA 4ZLJA 2E88A 4DR6J 5J2NB 2XHWA 3M7VA 4JI7F 4BDYA 3HHLA 4IOBA 2QFJA 4CT9A 1U49A 1SV5A 3H2UB 3NXZA 3CC7N 3DDNA 4PG5A 3JXUA 3LALA 4CE9A 3IWXA 2G8VA 2E7VA 4BHQA 2HIQA 4ECWA 2VG7A 1FXLA 3VTHA 4UY8O 4O3RA 4BROA 4IO9Q 4K4ZA 5EWFA 5T41A 4X4TA 4K4VA 5KQDA 1DTQB 5M2RA 4ATNA 2GV9A 2B5JA 3GU0A 2ACYA 1JX4A 2L3MA 1Q1KA 3CCMS 5HVFA 4OMFG 3ZZPA 1S9EA 4KJIA 5AFUH 4U6PA 1OSDA 1VQNS 4JI3J 2D1CA 1RADB 4OZ1A 1KD1T 4XIUA 4UF4A 1B64A 1LV5A 3ATUA 1VHIA 1EQ0A 1F9FA 1WC1A 1HUXA 5CABA 2W9AA 2W6KA 2LXUA 4OZ3A 4PZVA 1RLCL 4KTWA 3FRZA 3L2QA 1EAYC 1TQLA 4B9LA 4NLPA 4ZA1A 4Z0UA 4ZJQA 2HF3A 4DDFA 3MM9A 3Q8QB 2IJRA 4GC7A 4Q7AA 4HUEA 4N8NA 3U27A 2XMWA 2H5IB 4YOEA 1C0TB 1QVFR 2XI2A 4ZLPA 3A3PB 2R7VA 1Y10A 5JVGL 1WNSA 5E41A 3HX9A 2QMUB 3AT1B 4MAKA 1S1XA 3HP6A 4DV3J 4NYZA 3QIOA 4M3ZA 1NBEB 3JS9A 3WDOA 4XH4A 1Q86T 2ASJA 3CCLS 1FDAA 3KJVA 4OIXA 3E01A 3TZXA 2IVMA 5FLXU 2OA8A 3UB5A 1IBMK 2ETJA 1G4CA 1JKHB 2KT3A 5F1XA 4WZMA 3H4DA 2EX3A 1W2BM 4Q0BB 3NGTA 3VQ9A 3CULA 2HNZB 4EBDA 1A5XA 4OYIA 3VMFB 2YQ3A 2ZM6F 2KXHA 4KH0B 1BIZA 1FRXA 3R9PA 2XYGB 1NLKL 2QL7B 1WWHA 3V4IB 2YNIA 5E0OA 3G9CA 1FKOA 1PCAA 3K0SA 4JI7K 3PXGa 3IDHA 3X1LB 2WAQD 3SNNA 1X4GA 4BRGA 4CO5A 1IBLJ 5BJRA 5BR8J 4CDIA 3OY9A 1HHSA 2PYLA 1HQUB 5L1KA 1DJ0A 4DHVA 4NLOA 1U6BA 3S3OA 3BR9A 3NF6A 4A8MP 3JXOA 5AJ3K 1TL7B 2RHQB 3IM8A 2OMOA 2YXLA 3M30B 1NSAA 1IV0A 1CZ9A 3BDEA 2OD4A 1AFIA 3ENBA 3C19A 2H9ZA 4CZCA 4Y2MA 3PDNA 3HHLD 3H4BA 1LWCB 3MM8A 1YHQN 4C6AA 1S4FA 1WUAA 4Y34A 3CPWM 2RDDA 3HPOA 2VA3A 3IP0A 4RNFA 4HUFA 3VQ6A 1IKVA 3MN9A 3A0IX 1IJEB 1SCJB 2BE9B 2CPDA 4U7UK 3MGJA 3PJWA 1MWZA 2JC0A 4DV1F 1RAOA 3CJRA 3GR1A 4N8OA 3CCJN 1R31A 4DU1A 2HGMA 3CD5A 2AWZA 4BG8A 3AVIA 1IO2A 3M8RA 1R8BA 4RNMA 4PYAA 1QZ6A 1RTDB 4RBVA 3CM6A 2DNYA 4W92B 1TL5A 4OHWA 4UQGA 1NK7A 4J2AA 3D1QA 1BI4A 2HBMA 4ZCLA 1IKYB 3W2VB 3SQOP 2ATLA 2VGNA 2QEXN 4K7QA 4FF4A 2V94A 3UW1A 2HBLA 3G71S 3ILJA 1OPIA 2QLBB 1UETA 4ZVHA 4USHA 1FRLA 4B3RF 3DI6A 4YB5A 1HPZB 3QAEA 3B6BA 4WCEQ 3FZKA 4B1ZA 4ED2A 1MMLA 1I94J 3BSAA 5KFTA 4CHZA 2ZWOA 1YAGA 4ZCMA 1J5EF 4BRLA 4H8KA 1WN7A 5C25A 2K2PA 1K8KA 3OTDA 1AXQA 2IIRA 3TAEA 5G0RB 4H5TA 4YQWA 1M5VC 2ZHBA 3DLEA 3QATA 3FQLA 4MFBB 4QYZK 3EZWA 3T1YK 1T95A 4BRNA 4OKKA 2G13A 5AT1B 1WKKA 2PA3A 3GG1A 3EDRB 2XMTA 2CQIA 3OJSA 3OXGA 1YZ6A 1W0HA 2GMLA 1GTHA 3TJ9A 2NS1B 3OPKA 4IFVA 4CLPA 3I96A 3CDUA 2PI5A 3OSNA 1FNXH 5C15A 1IWGA 2UV8A 2XQCA 3GQCA 3O9SA 1UKUA 4C8MA 5I3QA 1G15A 1CQMA 2Z30B 3NMUA 4QWBA 2W2NP 4X65K 1RTJB 3PRDA 3NCPA 2HS3A 4L3KA 2BJ3A 2HGNA 1U09A 3WQUA 4Z2XA 1VQNN 3GL1A 4BVOA 3E1YA 1FW6A 1HBUA 2HBYB 3GJQB 1BQXA 3U1MA 5GIPA 5HP1A 2YV0X 1Q8KA 4OJ1A 5AQLA 4DL7A 3DU6A 3MMBB 3BSCA 2OPQA 5GVQA 4CEEA 2D9PA 2D4WA 4L76A 4EYHB 4TU8A 2MZTA 2DRAA 1Y3KA 1NGHA 3AVJA 3UDCA 3WIUA 3PW2A 1Q82O 3BS9A 2BJEA 1X8DA 1YTYA 1JLAB 3MEGB 2XEXA 1IKVB 2MB0B 4CEQA 3NGZA 2VG5B 4CGDA 1K73T 3D0HE 3VEYA 4GVLA 4YHHK 3DOKA 1R27B 2YH0A 3G6ES 3CCSN 1BO5O 4HTUA 2AW0A 3U7JA 4BACA 3IWNC 3OYAA 3HHDA 4DPYA 2BQ3A 4NL5A 2JWLA 2ZM6K 2W2OP 4RBTA 5A2QY 3G8QA 2MQOA 1FX4A 2JC1A 3WBZA 3EY1A 2KB2A 1EARA 1QY7A 2YNHB 3T6JA 1ZPWX 3LDPA 4C1NK 3DLHA 2R7YA 4X66F 2ZH7A 2ASOA 2UU9K 3H20A 4IO1A 3Q24A 3VQ4A 1XNRJ 1NHKL 4TKTA 1NGJA 3QLHA 4X62F 3THTA 3OFGA 1S1WB 4NA2A 2F8TA 2B4OA 2PIIA 2GQQA 2VC0A 3NS5A 2FVQA 2DCLA 4CH1A 4WKRA 2OJ3A 1NRKA 3TVZA 3TEGA 2JL9A 2M4MA 3CO0P 4CLYA 3NH2A 2BJ9A 3J7A1 2ITGA 2RDIA 2IIHA 1KLMA 1DQAA 1P1TA 1BL3A 3AARA 4I6WA 4DI6A 4PUOB 1BQMB 1FWLA 1U25A 4UOHA 2F1FA 3VQAA 1OY8A 2BV3A 4CM0A 4DV0K 5IV4A 4CO2A 3CPWR 4ZCKA 1J5EJ 4DKWA 1CXQA 1RWKB 3PR5B 3OYHA 3ZEUA 3AD9C 1WC0A 4DN9A 1O51A 3SFUA 2H4YB 3MUVP 2LKZA 4OV1A 1KC8T 4ZN3A 3NGIA 1OIAA 2H5EA 3VF0B 5I3UB 2YKAA 4BC4A 3QESA 4MLHA 1RAHB 3UE5A 2KHDA 3V9UA 4O44A 1U0HA 4DV6K 3BY5A 1RCHA 2GTDA 4CCHA 1FRHA 1U6FA 5ADXH 4CGHA 2YKOA 3ID6A 1RAIB 3HHNB 4FYWB 4JI6J 3HVTA 5J2QA 2VFUA 2QLJB 4ANEA 3DM2A 1RBUA 3D68A 3AAQA 2Z0GA 4OPKA 4Y1CA 2WVDA 1NNDA 1H2VZ 2D0BA 1UVMA 1LW0B 4IOAQ 3M32A 4DL6A 1FVQA 3NGKA 3HKWA 2NREA 3CGIA 5HANA 5CCMA 5LSOA 1IH7A 1QVFM 4RW4A 5KFSA 4EO6A 2VOPA 1TMMA 2UVRA 4JKHA 2B9WA 4H54A 4CZKA 4TQSA 4M3YA 1YI2S 3BP8A 4PQUB 2BBEA 3PM9A 2X74A 4ZLLA 2NRTA 3HT0A 2WW4A 1YTAA 1MROB 4TYBA 4CJ7A 4J37A 2RQKA 3ITHA 1RGIA 2YQ0A 3GV5B 5KFHA 2YKMA 4IG3B 3UKRB 1NH8A 2CQHA 4RW9A 4B9QA 1VMBA 5AXMA 4GMJB 3GCWP 3BO2A 4ILGB 5JLFA 3V6KA 2C3OA 2KT5A 1VBKA 1IBLK 1C2PA 3K8VA 2Y1JA 3ZSOA 3Q83A 2IVFB 3I8DA 2OFHX 4YORA 2FIUA 4DPWA 4IEEA 4C0HA 1N36J 2DR5A 1T02A 1EO1A 4WFNQ 3E8OA 2XRIA 2DHAA 2J9DE 3FZLA 4O0JA 3KMQA 1C0FA 2YHWA 1WUUA 3QJJA 2HF4A 4BWJA 4M5HA 2RIJA 3G82A 3ZZYA 1HNXJ 2P9UA 2ZHAA 1RWMB 2HVHA 2P9NB 2AX0A 3D2WA 1UW9A 3CEDA 1T9YA 2B4JA 3DGVA 4ICLB 3HHLB 4IG3A 4NXNJ 1KNZA 1TKTB 1R7IA 4IJNA 4MT1A 2DR9A 3QIPB 3UNYA 1RBOB 2GHPA 5KFZA 2FXUA 2KHCA 1HLUA 1Y97A 5F0WA 3K8WA 1VQ7N 4HACB 3ZTRA 5GAGP 3U3GA 2X1AA 3LDLA 1BQNA 5TKWA 4FLTA 1HL6A 1RKIA 1P8ZA 4H0OA 2D7SA 1RT7B 3MD3A 1BE4A 4BG9A 4DTJA 3M32B 3OD2A 2HZVA 4DR3K 3Q0AA 1JLQB 3V1QA 1FXRA 3L2WA 4WK1A 1YJUA 3D54A 2DHSA 3OHBA 1MN9A 2RUSA 2W2QP 2AMCB 3CUNA 7AT1B 2NYHA 3P96A 3DOMA 5F3ZA 1J5EK 5EOYA 3CE8A 4HL9A 1QSLA 1UVKA 1K1SA 2A1SA 4WF9Q 4KAIA 3S1TA 1CVJA 2KU7A 4ECSA 3PACA 1QUVA 4C0BA 4O8KA 2FGCA 3SSSA 3O9TA 4CJRA 3UN3A 2D0OA 3OLAA 3I9ZA 2DNNA 3DXKA 2HHVA 5GAEP 1WAFA 3KG4A 2WZ1A 4K4UA 3C6TB 4B3OB 1ZZFA 2JH3A 5DM7Q 1RCXB 4ALZA 4LSZB 4J9UE 2C3MA 4QR0A 2E7XA 3BO4A 3M9OB 3M5RA 2WBMA 4BC2A 4BE2A 2FVCA 3E3XA 5DMRA 3O2IA 1MU2A 1QHTA 4MJKA 4QS8A 4LSLA 3JYTB 2W24A 2GIRA 2MKSA 4QU6A 2XY7A 2X78A 1ZM9A 4NCGA 4JUZA 1YJTA 3FC9A 4PQAA 4K2JA 3V6DB 1RAJA 1RP5A 2QO3A 2RRAA 4A61A 5HN0A 5BN9A 1WEZA 2LDIA 4IQMA 4RPFA 1SJQA 3VQBA 4FOIA 5LJ3Y 4FF1A 4WFYA 3FZFA 2KZZA 3CO9A 1SJ4P 4OFZA 1D4XA 1CZBA 1OKJA 4F04B 2IPOB 4M94A 3QNWB 5KFDA 2HFSA 1S1TA 3R8EA 2P6SA 2XYPB 4JI2J 2IFXA 4ZVTB 1SL2A 2PE8A 3CCSS 4IDHA 4FJ8A 2OLWA 3QWPA 4EP4A 3M1FA 1HHQA 1VRUA 2X1FA 1Z4UA 1RWOB 2Z2ZA 5FDLA 3S8SA 6FD1A 2O8EB 3BBFA 1O5JA 1L3TA 3NOGA 5F9NA 2D3OR 5AFUA 3C46A 2RT3A 3KLFA 2VPWB 2AP6A 4DTXA 1E4GT 2CWKA 2QE5A 3J81Y 2JLFA 3SK3A 3HSJA 1GTEA 4GRSA 3AO3A 1HYVA 3D2EA 3UCUP 4PAAA 3RRGA 3MECB 1M5KC 2D0PA 3TWHA 2ASYA 4OX8A 1EJ7L 3ZNJ1 5C5JA 1RU1A 5KFRA 4BRAA 4EIAA 1B4SA 1KQSR 1AZSA 4ILMA 2J5AA 2O8DA 1UL3A 5E7OB 4EHTA 5HQLA 1WEXA 2RU3A 4KHPJ 2R7SA 4ZP6A 4P6QA 4UQTA 3CM5A 2PAVA 3S9HA 4FJJA 4JK9A 2B6AA 4DF8A 4WBFA 4PXCA 3I6PA 1X3NA 3U3YA 2IVNA 2LU1A 3MAHA 2U1AA 4FJKA 5MAOA 1UPMB 2ITMA 4E7LA 3SBTA 3WEEA 3T1HF 5BR8F 3KTQA 4DU3A 2EFGA 2J8AA 1TKZA 4U7CA 3SMSA 4HCBA 1TKTA 3DLEB 2DNQA 4K5SA 4I64A 3EE8A 1RT5B 1XN9A 3EVMA 3KLGA 3V81B 1WG5A 5LL6d 1Q8BA 2BM0A 3E9OA 3LF0A 2CQ1A 1CJUA 4I2QA 1WTFA 1RHRB 3SJJA 4HHTA 4DV4F 4DTMA 1PBUA 2MY8A 5HMZA 3MCOA 4ELTA 2VJVA 4JYAF 3EXYA 5A8KA 3A2FA 1N34K 5L9NA 2P9PB 2HZAA 2YWHA 4CBUA 4Z7CA 3JQKA 1NGDA 3OR1A 5M1QA 2CG8A 3MWPA 1S59A 3C8YA 4PCQA 4BBYA 2AEMA 1URNA 2YPYA 2W7AA 1TU0B 2O4IA 4CHNA 4CJTA 1T9XA 3RMCA 2V4JB 4A8SA 3CD7A 3CQYA 4DQQA 3Q7CA 5HVGA 3CCJS 4LFBK 1ZM4A 1VQ5N 1CJKB 4USWA 1JLGB 1K1QA 1VQLS 3ZFVA 2AD9A 3D0PA 3QBWA 2MHNA 3CJAA 4YY3F 1YF5L 2HIYA 4I6AA 3DXBA 4GVBB 3UN5A 4CGFA 1NOYA 1YLXA 1LFWA 2A2CA 4O3SA 5GMEA 2JLEA 2JNJA 3IGNA 5F0XA 2GFFA 4UOGA 5CA5A 1T94A 3DOLA 4PRFA 3UD4P 4ZCIA 2LQ8A 2BW7A 3DLRA 1UEVA 3A8KA 3U6FA 4BC7A 4URSA 4DV1J 1M1GA 4Y28C 4DR7J 1VQ6N 3IMQJ 3QINA 1PYSB 4J9QA 1G7CB 3OBYA 4GO7X 4CRJA 8RUCA 4O4RA 3OA9A 4E3SA 1HNZK 4Q8FA 1NM2A 3HHEA 3O8MA 4DV5J 5KG6A 4XTTA 4LBPA 1LK5A 1M90O 2CADA 1L3VA 4MYUA 2YPZA 3J81j 3HYFA 1Y4ZB 1VSEA 2UV8G 3CF5Q 2KG1A 1NK5A 2HGLA 2X3GA 1X9SA 4QZVB 1B7YB 2OIHA 2K8GA 4U7BA 4DLGA 4LF4F 4LF4K 3O9UA 2DPNA 2LFVA 3G25A 3ID8A 5L1LA 5D77A 3D66A 3CIPA 5CYQB 2OGUA 1JL1A 3DGPA 3PHEA 1EHWA 2VQEK 3QO9A 5F8IA 4EFHA 3FZHA 1RAGB 4CGGA 1S9FA 3EGNA 2UUAJ 4R8UA 1REVB 1N4LA 4TSXA 1T9VA 3VGKA 3LWMA 1YBTA 3QBXA 4QYZJ 2VDIA 1TAUA 1RTDA 2CNLB 3D2EB 4A8YA 1DLOA 4Y0WA 3LP1A 3TVYA 4CI6A 2R7RA 4CFDA 4W98A 3AXMA 4RLEA 4J2BA 4FYVB 1VQMS 5ETOA 1A5WA 3R6MA 1VC5A 5AQKA 4K59A 2BKNA 4IFYA 4CIGA 3BZKA