1EETA

Hiv-1 reverse transcriptase in complex with the inhibitor msc204
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
542
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Urea-PETT compounds as a new class of HIV-1 reverse transcriptase inhibitors. 3. Synthesis and further structure-activity relationship studies of PETT analogues.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, transferase
total genus 153
structure length 542
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1eetA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1eetA05
3C6UA 4ELVA 4DG1B 3E01B 4CJLA 4CGGA 3DMJA 1C0TB 2D41A 3BSAA 1WSHA 5EU7A 4KPYA 4KHRA 5FROA 1XR5A 1GOCA 1LW0B 1W9HA 5KFTA 1XHXA 3HPHA 4R5PA 3TANA 4KFBA 3M8PA 4DQIA 1XR7A 2UVVA 5KFPA 3HVWA 3LDSA 3RRHA 4EZ6A 1C1BA 1SL0A 4NLDA 3DLEB 3OHAA 1KVBA 4KB1A 3ICLA 1JLQB 3HXMA 4M41A 4ED3A 3ZT3A 2G8UA 1SKSA 3NF9A 3PR4A 4AHVA 3RMBA 2JLEA 5F8LA 2W7OA 2A1RA 5JXSA 2D7SA 4DFKA 5C24B 3KOAA 1T3NA 1JLAB 3FSIA 4N56A 2ETJA 3LP2A 3TR8A 4N5SA 5SWMA 3LP0A 4E89A 4E19A 3UQSA 4JV0A 5CY4A 2KZZA 3RTVA 4NYZA 5HROB 1JX4A 4XO0A 5KFWA 3RBEA 1XC9A 3I0SA 3NAHA 2OPSA 2FLPA 4TSXA 3OJUA 4NCGA 3KLVA 1FKPA 3ITHB 1C0UA 3SQ4A 4RNHA 5KG7A 4EO6A 5DK5A 3AVAA 4OKEA 2VA3A 4C8NA 3K5OA 3JYTB 4EP5A 4TLRA 1B9DA 3C94A 4F4YA 1LAVA 1KLMA 1SH2A 4PQUA 4AHTA 4ZP8A 2Y1IA 3L2VA 3SUOA 4ECYA 3VQ9A 4O4GA 4JS5A 2HAIA 2YNHB 5CYQA 1N4LA 4KE5A 4F50A 4J9LA 1WAFA 2BGGA 3OYAA 4M3WA 4ZPCA 3I0RB 1NK9A 3N6NA 2WRMA 1RDBA 2VG5A 2FLLA 2X74A 3DRPB 5J2QA 1IKWA 5K14A 1RT1B 4ED2A 3MXIA 1RT2A 2JGUA 4ELUA 4PUOB 4M3YA 1BL3A 4ID5A 2FJVA 3AO3A 2ILZA 3IAYA 3RB4A 3BREA 4ECWA 1ZBIA 2E4LA 3RMAA 4EZ9A 2QKKA 3IN5A 5L1JA 3L2UA 4TXSA 3DLBA 3E01A 5J2PB 3AA2A 2HVIA 4HHTA 3RRGA 3VQ8A 1SKWA 3ZT2A 5HP1B 1S1UA 3MF5A 1T03A 3VQCA 3PW4A 1C1CA 3RAQA 4W5TA 4GC7A 5FRNA 4IG0B 3KMSA 2HWIA 5HRNA 5KFIA 3GQCA 4CK1A 5KFDA 3AVCA 4ECXA 3VA0A 2YKMB 1ASUA 1CXUA 5KG5A 4FJJA 3OJSA 2F8SA 1K1QA 3ZSVA 1JLQA 4Q0BB 2YHAA 4B9VA 1K6YA 2DFFA 3NHGA 5HBMB 1WN7A 4MQ3A 3HVAA 3MECB 4ED8A 3KLIB 4I7FB 1SL1A 3PO4A 2WOMB 1KSPA 4Z0UA 2P1JA 3K5MA 4YQWA 5F8HA 3RWUA 4FZZA 4J2DA 4RW9A 3MEGB 3HPGA 1LW2A 2ZD1B 4M94A 4B9UA 3DRRB 5DGAA 3N6MA 4K4ZA 4BE1A 4E7JA 2HVHA 2B5JB 2HHQA 5L9XA 1S0MA 3QO9A 1C0MA 2P51A 3CQ8A 1SKRA 1FXXA 4DQRA 2YNGA 1BISA 2R8JA 1NK0A 2HHWA 4CJTA 3M8QB 4XPCA 4OLBA 2BANA 4EYIB 2IOCA 3VN5A 2UVRA 4NYNA 4CJ5A 4JS4A 2XI2A 2W8KA 2FVPA 3IS9A 1DTTB 5EDWA 4QWAA 1WSFA 3NCIA 3JYTA 4FBTA 1TK8A 2QV6A 4TY8A 3UPFA 3NF7A 3ZSWA 1UA1A 4E7IA 4LQ9A 3AV9A 1XR6A 3WNHA 3M9OB 4I2QA 2YNHA 3KK1B 4DL2A 4W5OA 4I9LA 2P5GA 4NLPA 4KV8A 4NYFA 1RTDA 4DU4A 4DSLA 2A1SA 4OKKA 4IOBA 4ED0A 3V1RA 1A5VA 1Q9YA 3QZ8A 2GBZA 3BQ0A 1RT3A 3GV7B 3AVBA 4PUOA 3H40A 4O3QA 3OS2A 3HP9A 1QAJA 5C25A 3QEWA 4M3RA 4NCAA 1JLFA 3H59A 4DU1A 3G10A 3VA3A 4Q5VA 1JLEB 3NGZA 1BQNB 3FQKA 1NNDA 1N48A 2QKBA 4FJLA 4R8UB 5J2PA 3CO9A 2AX1A 3SQ1A 4ECSA 4LSLA 3B6PA 4DTXA 4ZMMA 4WYLA 2BQUA 5KG3A 3RMCA 4QWEA 2IS3A 4OLAA 3CDEA 3QERA 1D9FA 5KFFA 3OLAA 3SUQA 4EBDA 1YVUA 3L2RA 1BIUA 3I5BA 5DG7A 1U49A 2ALZA 5F8JA 2HHTA 5CZ2A 4YR3A 2R8IA 2PY5A 4C8MA 3MEEB 1D5AA 2YKMA 5KT6A 4DEZA 2HHVA 2AGPA 4CF2A 2ZQBA 3V9ZA 4DL7A 4Q0BA 4MFBA 2IA6A 3OYKA 2HHXA 1REVA 4FS2A 3NH0A 3ZSQA 1IM4A 1HPZB 1ZBFA 2YKNB 4BDPA 4N47A 3JSMB 3CDUA 4K4TA 1LV5A 1S1TB 3CJ2A 1RTHB 1S97A 3MEGA 3BDPA 2ZD1A 1TKTA 3EPIA 1GOAA 5KG2A 3QGHA 3SI8A 4IFYB 2O5DA 4KRFA 4KI4A 1ASVA 3I5AA 2AGQA 3LZJA 3M8QA 3C95A 1S1XA 3RBDA 2VA2A 4N76A 3F73A 4J2BA 2BDPA 4K4YA 4DFPA 3NH1A 3V6KA 1DTTA 1LWCA 4Q8FA 3V6DA 2UUTA 3DLKB 3L2QA 2E6LA 4I9QA 1TKZB 4FZXC 2WHOA 3QIPB 2X6NA 4CCHA 4IG3A 3OYJA 4IQXA 3DOKB 1JXBA 3SFUA 4Y2CA 3AA5X 3VQDA 1VRTA 3EZUA 1ASWA 2I5JB 3D5MA 3KK1A 4GVMA 3AVKA 1ZYQA 1FKOB 3Q8SB 4IH5A 2NUBA 1RA6A 3KLFB 2G8VA 4CFDA 1S1WB 2YNIA 4ED1A 2CJQA 4K8XA 3PZPA 1JLBB 3AO5A 2OZSA 3NAEA 4E7KA 3K57A 3U6FA 3NMAA 3TAPA 1WLJA 1L3SA 2FBVA 1BCMA 3V6HA 3V9SA 1BQMB 1EETA 2XC9A 1RYRA 4YMEA 2RF2B 4O55A 3M8RA 1WSJA 1BQNA 3E51A 4OGEA 3MFIA 4F2SA 1HNIB 3OYLA 3V4IB 2HNYA 1U09A 2VG7B 4LD0A 3ZCMA 3O3HA 3DLGA 3SQ0A 4M42A 4GMJB 3KNAA 2XY7A 2IC3B 1VSKA 2OZMA 3C6TB 2KFZA 3EZ5A 3SQ2A 3GILA 1VSFA 4DF4A 3VQAA 5KFSA 1QE1B 3D45A 1NK7A 2FVRA 3HT3A 3DYAB 2D5RA 3VQ6A 4LQ3A 4DMNA 5KG6A 4E7HA 4Z4CA 2X6SA 3QETA 4DSKA 4RW8B 1IKXB 4YFUA 1TV6B 4QAGA 4HCBA 5HLFB 4URSA 1GX6A 3DM2B 4M3UA 3S3NA 1VRUB 2R2SA 3NF8A 3ZSYA 4KHQA 1TP7A 3KIOA 1UOCA 4BDYA 5J2MB 2DPIA 3MR5A 4MKBA 4NLXA 1ZETA 3V81A 3VQEA 1RDCA 5D3GB 2X78A 2DPJA 2RDJA 2YKNA 3H98A 4IRCA 1NJZA 2B6AA 4Y34A 3DI6A 4CIEA 1RDDA 4CGIA 5KFAA 1MU2B 3G6VA 3BQ1A 2RKIA 3FQLA 4O4RA 1HYVA 1B9FA 1K1SA 3IRXA 4NLSA 4J9QA 4BWJA 4NRTA 4ZHRA 5SZTA 3QESA 1CXQA 3NBPB 1KHWA 1EXQA 3DRSA 4O3RA 5F8IA 2BRKA 4WFYA 3DLHA 4B3OA 2EHGA 2FBXA 3OL8A 3PW2A 4ECUA 2XY8A 1JLGB 4E1NA 3AVMA 4DL4A 5DQIA 1HQUA 3I5CA 1HYSB 4NLGA 2EX3A 3LP1B 4CHZA 2XCAA 2XY6A 3DOKA 2ZE2A 4KI6A 4CHQA 3AA4A 1QQCA 4H54A 1WNEA 1BI4B 5J1EA 4FS1A 1FKOA 5KFKA 1JL2A 2W7PA 4CE9A 2GIQA 2HHSA 4Q45A 1S6QB 5L1IA 2XCPA 4KHMA 3H4BA 4HUGA 1JLBA 4FM1A 3AVHA 1S9GB 2AU0A 3OYIA 1VSEA 3PW5A 1RTIA 2ATQA 1QAIA 1BQMA 2ILYA 1X1PA 1BHLA 3BSCA 4RW6A 1JLCB 5DLFA 3V4IA 2BE2A 1YT3A 1S6PB 2YNFA 3NL0A 4FLYA 4FJHA 2J6TA 1GX5A 4J9MA 2HNDB 2BQ3A 4ZTJA 1U04A 4QWDA 4ECRA 3H2LA 3LWMA 4TQRA 1S49A 3KHRA 4LH5A 3C6TA 4TY9A 5HRRA 5KFXA 1IKVA 4DF8A 4F4ZA 3PW7A 2DFHA 3GV5B 4CERA 3HL8A 4CEOA 2W9BB 4CJUA 1N6QA 2D0CA 4ECTA 1IKXA 1YTUA 3L2WA 1S10A 4NLVA 4Q43A 5HLFA 3PY8A 3MXJA 4ZVFA 5I3UB 2WONB 3EY1A 5FRMA 5CYMA 2G8FA 4BACA 1S48A 2P5OA 2HMIB 2B43A 5T7BA 3PVXA 1RBUA 4MK8A 1D9DA 1Q8IA 4TQSA 4CJRA 4MK7A 3DOLB 5KI6A 4UQGA 3EPGA 2R8KA 5KG4A 2PYLA 1HNVB 3AVGA 3T19A 4CHOA 2IAJA 4W5RA 3KLEB 2FBYA 1RBSA 3V1QA 2I1RA 2R8HA 1JIHA 3KKSA 2R8GA 3OYHA 2WCXA 1T7PA 3N6LA 4RG8A 2OYQA 3G6YA 1J54A 1Q9XA 2C28A 3SJJA 4TYBA 5J2NA 1SH3A 4FBUA 1X9WA 1HQEB 2AJQA 3B6OA 4FK2A 3WNFA 1JLGA 1TKXA 4DL3A 4YR2A 4ED6A 3ZSRA 4IR1A 4K4WA 2XWYA 1X9SA 3ULDA 1QSYA 1S9EB 2DY4A 4ZVEA 2XGQA 4DG1A 3Q8PB 4KTQA 4IBNA 3BSOA 3WNGA 4F4KA 1C0TA 1I6JA 2OPPB 3LP3A 4CJ3A 4CK2A 4Y1CA 2O4IA 3VQ4A 4HCCA 1LW0A 2C2RA 3PR5B 5F9LA 3KLGB 4H8KA 4CFAA 4NCBA 2G8HA 4RNOA 4ZPDA 3CWJA 4ZTFA 3SUNA 1L5UA 4L8RB 1C2PA 4FJIA 4CEFA 3BQ2A 2HW3A 2KZMA 1RBVA 1KHVA 5JUMA 3DLEA 2E9RX 5KFNA 4CJ4A 4CEEA 4KHYA 4CHNA 3M8SA 3OL6A 2OPRB 4RW7B 2J6SA 1NKCA 3QYYA 4NLQA 1D8YA 3RAXA 1DTQB 1S6PA 4B9TA 4G1QB 3PJWA 3OLBA 4MH8A 4ZPAA 3FFIB 2V4RA 5C24A 4FK4A 1JLAA 2V4QA 3ALYA 5L1LA 1RT7B 4ZVHA 1DLOB 3QLHB 3OHBA 4RW4B 5DQHA 4EYHB 4F4WA 1L3TA 4QOZB 4PY5A 4QPXA 2W9BA 5HROA 2G8IA 4NLTA 2Z1JA 2Z1HA 3QIOA 1JXLA 3CVKA 3ITHA 2ASJA 4ECZA 4QW8A 4HKQA 3AO2A 3O3GA 2W42A 1LWEB 5DGBA 4NLOA 4DLGA 1TVRB 3IGNA 3MEDB 2QK9A 1KVCA 4LSNB 2R2RA 4ICLB 1S5JA 5C42B 4OVLA 4TN2A 3L3UA 3OYDA 3DLRA 4H4OB 3QZ7A 1HMVB 1S9FA 3HVTB 3I0RA 3MR6A 4ECQA 3P1GA 3DRPA 3CYMA 1I3AA 1RT1A 2FVQA 2E6MA 3VQBA 4I2PB 1BCOA 2YHBA 3T3FA 1QUVA 5KFUA 1HQEA 5DG9A 3ZT1A 3NGYA 4EBEA 3KJVB 1IKYB 1L3VA 1TL3B 3CJ4A 4TYAA 1T05B 4X2BA 3L8BA 1NOYA 3H5XA 3LALA 3AVNA 3HVRA 3VQ5A 2RDIA 5HP1A 5F9NA 5I42B 5EWFA 5KFYA 3LAKA 4JRQA 4J9RA 3CJ3A 3MR3A 4O44B 4IG0A 1TK5A 3T5KA 1JXEA 1UWBB 4DSFA 3P5JA 1Z4UA 1L3UA 4AHSA 3BSNA 4RU9A 3KHGA 2ITGA 4WXWA 3CIZA 4B9MA 4ECVA 3ISNC 1WNSA 4W5NA 4CHYA 5HBMA 4M3TA 3UR0A 1VSDA 1DTQA 3CG7A 3MECA 4DTUA 3KLIA 1HYZA 4I7FA 1KVAA 4FM0A 2KW4A 2WOMA 4CGHA 3OL9A 4H4MB 3SPZA 4Z4FA 1T8EA 3HYFA 3QEVA 1RT7A 4JUZA 3H08A 4CFBA 3RB6A 4HVJA 1XI1A 4LH4A 4RW4A 3DRRA 1KFSA 2B5JA 2JEFA 2WB4A 4FLZA 1ITGA 3MR2A 1WSIA 1C6VA 3LWLA 5KGXA 3Q8RB 3V6JA 4O3OA 5KT2A 4HUEA 4BE0A 4M3ZA 4CEQA 3LZIA 4E7LA 1NK6A 1U48A 2IJFA 2HHUA 5KFCA 3G6XA 3GYNA 1IO2A 1ZTWA 4DS5A 3RMDA 4RZRA 2W8LA 4HYKA 1RNHA 4YNQA 4GW6A 3HP6A 5KT3A 4CJFA 4CEDA 2C2EA 2HNZB 4QWCA 2E9ZA 1O1WA 3AA3A 4RNNA 1RCHA 5JS2A 4FLVA 2IBKA 5KFLA 3HVTA 4NRUA 3V9UA 4O5BA 3C6UB 1RDRA 3RR8A 4MIBA 2AX0A 3KMQA 3TABA 4AHRA 3TAQA 4I2PA 4DTOA 4FJKA 4R5PB 3PV8A 1IKYA 1JLEA 3NF6A 1S0OA 3LANA 4C8KA 3G86A 4KFBB 2Z1GA 3M8PB 5KFVA 1YTAA 1R0AB 4RUAA 4IR9A 3BR9A 4DFJA 4CK3A 1BGXT 4R8UA 3T5JA 4JRPA 2FLNA 4U7CA 4QW9A 3O4NA 1UAXA 4CEAA 1UA0A 1TAQA 5I42A 2WK4A 4Z4GA 1TAUA 2F96A 4KHNA 1KTQA 1VSJA 2D3UA 3H5SA 4K4SA 2JEIA 3TAMB 1KRPA 4PWDB 2LSNA 4KTZA 2XHBA 4WZQA 2OA8A 1RT4B 3MXMA 3MEEA 2D3ZA 4B9NA 3S9HA 4B9SA 4URGA 3KHHA 2PYJA 4GC6A 4KAZA 3KHLA 3I0SB 2OPSB 1N5YB 1HPZA 4URQU 1TKDA 4NCGB 3QNNA 2GV9A 2C2DA 1S1VB 3JSMA 4H4MA 1YVFA 4DL6A 1VSMA 5EWEA 4RNMA 1S1TA 1RTHA 1C0UB 3G0ZA 3IG1B 3TAGA 4J9NA 5KFJA 1HJRA 5KRSA 1WSEA 5KTQA 3VQPA 1U47A 1ZBHA 4CF0A 1KLMB 4PQUB 4IFYA 3ZSOA 1XHZA 2J6UA 1KFDA 4O4GB 5CYQB 1T94A 4W5QA 2WTFA 3HKWA 3GIMA 3SI6A 3Q8QB 5DQGA 1QS4A 1LAWA 4B9LA 3VQ7A 4QCLA 2VG5B 2FBTA 5J2QB 2BQRA 3DLKA 2IM0A 3LPTA 5KFZA 1TKZA 4EBCA 1RT2B 3QIPA 1RT5B 2FJXA 1C1AA 4YP3A 4CGJA 3OYCA 1D1UA 5KFQA 4DTPA 1U4BA 1SL2A 2I5JA 4FYDA 4KKOB 4CGDA 4O0JA 1B92A 4FLTA 3F9KA 5KG1A 4ED7A 2GIRA 3KLFA 3MTKA 1S1WA 2ZKUA 5EWGA 4CJEA 4ELTA 4JV2A 3NGDA 1W25A 3CFOA 4NLWA 1S1UB 1VSHA 3AVJA 5KFBA 1T03B 3OSNA 1C1CB 2HB5A 4OL8A 2FVSA 2RF2A 3RB3A 3AVLA 4IKAA 5HRPA 1MMLA 1I39A 1HNIA 5KGWA 3TAFA 3K5LA 2VG7A 3OYGA 1R0AA 4KHSA 3SV4A 3OY9A 2XI3A 2IC3A 3GIIA 3PX4A 3VQSA 4KTWA 2Y1JA 1QTMA 4NLYA 1VSIA 4CF1A 1TL1B 4CF9A 1QE1A 2GC8A 2IM3A 1BIZA 2IM2A 2JEJA 4K8ZA 3DYAA 1ZBUA 3V1OA 4FJGA 4C8OA 3TAMA 4E3SA 4DS4A 4PWDA 3SZ2A 4RW8A 3CJ0A 3PX6A 4DQSA 3ZT4A 3BJYA 1TV6A 4RW9B 1RT4A 3DM2A 1LW2B 4IRKA 1VRUA 3KD1E 5J2MA 4AHUA 1F21A 5C5JA 2QE5A 4J9PA 4CEBA 2B4JA 3QO9B 5D3GA 2YNGB 2Z1IA 1N5YA 3RR7A 3S3MA 1S1VA 1KCFA 3VQQA 2BANB 1NJWA 1RDAA 4CGFA 4ZP9A 4PA1A 3K59A 3TAEA 3IG1A 4Z4EA 4N41A 1VSLA 4NLUA 1MU2A 4FJXA 3IS9B 4WE1B 4MIAA 4DSJA 3TARA 4IDKB 5F8NA 3H5UA 3MAQA 4M95A 5KT4A 5DMRA 4TY8B 3EYZA 4CJQA 4CF8A 4G3IA 5T14A 4J2EA 1RYSA 3NBPA 4I2QB 3K5NA 3DDKA 5KFRA 4F3OA 1RA7A 2F8EX 4Q44A 4KV8B 3D28A 4Z4HA 1RTDB 2XGPA 1JL1A 4OKJA 4CJVA 2V0NA 5KG0A 3OYFA 1HARA 4KBIA 1RT3B 2IMWP 1HYSA 1RT5A 3LP1A 3OL7A 1OS5A 4O0IA 1NJXA 5C25B 1JLFB 4KKOA 4Y1DA 1BI4A 3QEXA 3PUFA 1SV5B 2PZSA 3V9WA 3CM6A 4O3SA 4WXOA 1S6QA 4CIFA 2IM1A 1LWFB 5KT7A 1XWLA 1S9GA 2XRIA 4OJRA 5CZ1A 3K58A 4LSLB 3HPOA 3RB0A 4E1MA 2XO7A 5JS1A 2GUIA 2CKWA 1EKEA 4DQQA 3AO4A 1JLCA 4DTNA 2DFEA 4CECA 4JLHA 3NFAA 3I8DA 3SPYA 2EC0A 4FW2A 2AQ4A 4CJKA 3UIQA 2HNDA 2W9CB 4MFBB 2QXFA 4ZVGA 1TL1A 1REVB 1SUQB 5F8GA 1RBTA 3TVKA 4AILC 3D0PA 4FW1A 3T5LA 4B8CA 3NGIA 3OS1A 2D0BA 4IFVB 5F8MA 4K50A 3IGVA 2C22A 5I3UA 1NK4A 2WONA 3NE6A 4FM2A 1TKTB 2D0AA 2HMIA 4JV1A 5FDLB 1A5WA 3H4DA 1Z25A 4WFZA 3DOLA 4OPKA 4IRDA 1GOBA 1J53A 4O3PA 1CSJA 2IDOA 1S1XB 2OPQB 3OYNA 1HNVA 4CHPA 4CJSA 4FJ7A 3KLEA 2BRLA 4AH9A 1LWCB 4WE1A 4CIGA 3HHKA 4IDKA 5DG8A 3V6DB 3CFPA 1RILA 2VWKA 4IKFA 2R2UA 4ID1A 4IG3B 1RTJB 4Q8EA 3LAMA 1NK5A 3OS0A 1VRTB 4RNFA 4DTRA 2AWZA 3TI0A 3CM5A 3T5HA 3NKYA 3SNNA 3KK2B 3TWHA 3KD5E 3AVFA 3KKRA 2YNIB 1G15A 3KLHB 4MK9A 1S9EA 1IG9A 1D0EA 5KFMA 3HJFA 2F8TA 3QEPA 1RT6B 4EEYA 2JC1A 3TQ1A 2OPPA 1EETB 4DSIA 4CEZA 3M9MB 1SV5A 3ZSXA 4DSEA 2JC0A 1S4FA 3KLGA 2HNYB 4EP4A 5L1KA 4AHCA 1FK9B 3DLGB 4DTMA 3A2FA 1LWFA 4EO8A 1KLNA 3KK3B 1S0NA 4CJPA 3HO1A 4J9OA 4FK0A 1ZTTA 1EP4B 1VK0A 2OPRA 4CESA 4RW7A 3OYEA 4KO0B 1ZBLA 1QSSA 4FZYA 5KRTA 4G1QA 1WSGA 1J9AA 4F8RA 4QWBA 4BE2A 1RBRA 5DLGA 4BWMA 3FFIA 4XPEA 5KFGA 4DWIA 3SFGA 2W9CA 1J5OB 4KAIA 3CFRA 1DLOA 1SUQA 3V81B 4NZ0A 3QLHA 3SUPA 4K4XA 4ZP7A 4O3NA 4WFXA 3HK2A 4KB0A 3BGRB 2ATLA 4FJNA 2VG6B 2B6AB 3DI6B 2R7YA 2E9TA 2IGIA 4IFVA 1Y97A 1U45A 3CDWA 2UUWA 2XY5A 4K4VA 2ASDA 3QINA 4RUCA 2RKIB 3S3OA 1NKEA 4WZMA 2KFNA 4J9SA 4CJWA 5FDLA 3CJ5A 3IRXB 3QGGA 3M9NB 3U3YA 1LWEA 3PX0A 4ZHRB 4F3TA 1A5XA 4Z4IA 3DRSB 4K4UA 4J9KA 2FVCA 2HWHA 1TVRA 4DQPA 4B3OB 4BDZA 2G8KA 1JKHB 3MEDA 2OPQA 4XIUA 4LSNA 4F2RA 4KHUA 4ICLA 4KHWA 2OH2A 2DTUA 5C42A 2YV0X 4H4OA 1QSLA 1HMVA 5KT5A 1CZ9A 4KB7A 1HQUB 3AO1A 3O4QA 3ZSZA 3QGIA 1RTJA 1CZBA 3V9XA 2ZE2B 2BR0A 2UVUA 3DMJB 2RN2A 1N56A 2JEGA 3T1AA 3QEIA 4C8LA 5J1EB 3K2PA 4Y2AA 3P83D 4KSEB 4FLUA 2FJWA 3KK2A 4YR0A 3KJVA 5E41A 3U3GA 3NDKA 3GV8B 3PJXA 1TL3A 4J2AA 3KLHA 1Z26A 3FDSA 1T05A 1EX4A 1C1BB 3SCXA 4DLEA 1RT6A 3ISND 2IJNA 3PW0A 3AVIA 4CFCA 2KTQA 1RTIB 4DTSA 1TK0A 3PHEA 4B8AB 4RW6B 4DU3A 3HM9A 2BE2B 4OGCA 2UVWA 1FK9A 2YNFB 4O44A 4LY7A 3NH2A 5KFEA 1NHVA 1UWBA 2ASLA 2RPIA 3KK3A 2W9AA 4IH6A 3GIKA 3LP2B 3FRZA 2VWJA 4DFMA 3LP0B 1IKVB 4MKAA 4R0EA 4IH7A 3OYBA 4HUFA 1EP4A 4FJ9A 1W0HA 1N6QB 4FLWA 5KFHA 1IH7A 4F4XA 3QNOA 4KO0A 1TGOA 2G8WA 3SYZA 2KQ2A 3WNEA 1SH0A 2FC0A 3KTQA 4Y3CA 3L3VA 4OPJA 4FJMA 5EUHA 4HTUA 4FJ5A 1FKPB 4FXDA 1QHTA 1TQLA 5CYMB 5KFOA 1HRHA 4DTJA 1J5OA 4ZPBA 4M3XA 4ZP6A 1RAJA 3HSTB 3SV3A 1X9MA 4NLRA 1NJYA 3BGRA 3O3FA 4M45A 2VG6A 4U6PA 3ASMA 3GIJA 2IAJB 3THVA 3NAIA 3PO5A 3QIDA 1NK8A 1NHUA 4WYWA 4B08A 3OYMA 4FJ8A 1NOZA 4KREA 1IKWB 2R2TA 5K14B 2V9WA 2O4GA 4FVMA 4ID5B 4FCYA 3H5YA 4E0DA 5J2NB 1JKHA 2AGOA 2HNZA 5HRSA 1NKBA 3UDLA 3LPUA 4DL5A 1TKXB 3MFHA 3OSPA 3ZT0A 3OVNA 2Q3SA 1CLQA 4FLXA 1WAJA
chains in the Genus database with same CATH superfamily
4ELVA 3LDQA 1WKLA 2JLGA 4CJLA 2CJKA 3BSAA 1WSHA 4KHRA 1VC6A 5FROA 1NBWA 1DRZA 2NLXA 5KFTA 4P71A 1XHXA 3GFZA 2HHHF 1T9UA 2N4CA 4KFBA 3DGVA 3M8PA 2O8DB 1GLFO 2V4JA 5KFPA 1K9MT 1M5HA 4K43A 1VLYA 2VFVA 4JB8B 3RRHA 1HHSA 4FOIA 1KVBA 3MUVP 3AA9A 1IR0A 4OHVA 1OO0B 4ZVOB 4K2JA 3DOMB 3RZAA 2ABYA 4M63C 1XC3A 3BH6B 5E3QA 3TUJC 3QGPA 2C42A 2W7OA 5DM6Q 3T1HF 2ASMA 3K0SA 3ZFVA 3P39A 2BM1A 4YN3B 2E1PA 4B17A 2ETJA 3GG4A 2FY1A 2B9YA 4PPZA 3QATA 3UQSA 1U1LA 4L75A 4G65A 1B0PA 5KFWA 3N9UC 2BX6A 1U24A 3RBEA 1MSWD 3I0SA 3OJUA 3KLVA 4OYIA 3TTFA 3NVMA 1Q4RA 2HBKA 3SQ4A 4RNHA 5KG7A 4DHYA 2VA3A 1Q82O 3C94A 2RVJA 1LAVA 5J1NA 2OTJN 1KLMA 1SH2A 4YOUA 4AHTA 2Y1IA 4ECYA 1GFWB 5CXTA 1AA1B 5CYQA 1N4LA 2CYYA 1EIYB 4F50A 3E9PA 3OYAA 1VQ6N 1KQFB 2VBXA 3I0RB 3K7RA 4OLOA 4I6MB 3GMGA 2Q97A 2GZOA 2FLLA 3DRPB 4NXMF 1Q81O 1IKWA 1W26A 1RT1B 1KC8T 3FCWA 2GVZA 2HHPA 1WI8A 1ZAVA 3QJLA 2R3VA 2G2YA 2FJVA 2ILZA 3IAYA 1ZA1B 4ECWA 1ZBIA 1VJWA 2JSXA 3EEQA 3RMAA 1HWLA 5MLCV 4PHTX 1SPBP 2LU2A 5EHHA 2K1RB 2UUAJ 4TXSA 4BRAA 3H2UB 2F8MA 4L3NA 1VC0A 1WTFA 3S1TA 1UEVA 3ZT2A 1S1UA 2BKPA 1T03A 2ITMA 4CO4A 3VQCA 2OGUA 3W7BA 3EE3A 3CJQA 3RAQA 4QYZJ 4JHDA 2QLXA 4GC7A 1B7FA 3M5RA 2OEJA 5KFIA 3GQCA 4DR6K 1FW6A 3D7EO 3CCJS 4QIVA 3VA0A 1HR0F 4FJJA 1R0CB 4DR3F 3A3NB 4B3RF 1TL4A 5BR8J 2MQNA 1J6ZA 3ZSVA 1ATRA 2XNRA 2YHAA 1Q7YT 2HK3A 3GP9A 1Q5YA 2QFJA 2A42A 1WN7A 4QR1A 2GVDA 3GU0A 4FZZA 4J2DA 4RW9A 3MX2A 3G25A 3FEXB 4N77A 3BB5A 6AT1B 3IM9A 4M94A 5MAOA 3D1QA 2EC2A 4DV5J 3BZQA 4K4ZA 3NLCA 4YB5A 5L9XA 1S0MA 5E5NA 9ATCB 3J81U 1SKRA 4TU8A 1FXXA 3CMEN 2HKEA 2RUSA 5BYQA 3GYXB 1W2BM 2WFBA 3O9RA 2BANA 2DCLA 2XMMA 5M2UA 4NYNA 3THWB 2WSEC 8RUCA 4LF9J 2Q6BA 2FVPA 3VEYA 2CJXB 1N33J 3EWGA 3HHLA 1TMJA 5CZXA 2QV6A 4KGVB 1MWKA 3FMWA 3AV9A 1XR6A 5HI7A 1AZSA 2LXFA 5T41A 3PIPL 2YNHA 4RJVA 1BWVA 2ZH3A 2P5GA 4NLPA 4GKJF 1QD1A 3CC4S 3HFKA 4DUYF 5LSRA 4OKKA 5E3RA 4ED0A 5AXNA 1B64A 1AB8A 3H2VE 5IC6B 3CCMS 4PUOA 3H40A 3PRDA 4K2XA 2DH9A 4JKGA 3N5BA 2JWKA 1UW9A 3VA3A 3GONA 1JLEB 5AE1A 3MMBA 3QBCA 1XNQF 3T41A 1X4BA 1NNDA 3OVSA 3M8ZA 1S12A 1UAWA 4R8UB 5J2PA 3I8BA 5HVFA 4CO1A 1BY9A 4LSLA 4ECSA 2DNKA 3RMCA 2KL8A 2V6AA 4LF6F 4K25A 4HLBA 4JK9A 4X62F 3J7YU 3QERA 5GIPA 2NNWA 3T6JA 4JI7F 4NA1A 1SQEA 3B82A 3SMSA 5F8JA 2HHTA 5CZ2A 3IWLA 2OKQA 5B0BA 2YKMA 1K9MO 3IBFB 1SS6A 1LNQA 3I82A 2NZTA 1REVA 4JI8K 4FS2A 1GNKA 3ZSQA 5E2QA 3G8SA 1ZBFA 2FZKB 5LT5A 4KH1B 1U1NA 2G0JA 2J9CA 4OYZA 3N4QA 2O66A 3FKBA 5AQUA 3BDPA 2VBYA 5IZHA 1TKTA 4PKHA 3C7NB 4IOAL 5KG2A 3SI8A 3ZZPA 3DLJA 2W6KA 4KRFA 1ASVA 3KVGA 3LQVA 4YY3F 4B02A 3C95A 4B1XB 4OX6A 3RBDA 2R7VA 5BRFA 2XMJA 1SC1B 4DPXA 4LF8F 3V6KA 3VERA 3MM5A 2F9TA 1EHWA 4Q8FA 4RTFD 3DLKB 1FNMA 4I9QA 4X64J 5BR9A 2DEIA 3GSDA 4IQXA 1JXBA 2CVEA 3NGUA 3NP5A 4NO7A 3AA5X 4H5RA 5I4MA 3US5A 5AQXA 2B9WA 4X66J 1MG7A 1ZYQA 3Q8SB 4IH5A 3K5PA 1RA6A 1WHVA 5ADXA 3GSIA 2VFUA 3IMQJ 4K8XA 3OVAA 1QY7A 2HEKA 4PR6A 3AB4B 1EQ0A 4CH0S 3U6FA 2HVDA 1KC8O 1IBLJ 1MWQA 3TAPA 2ASOA 1UFWA 2QMUB 1BCMA 3V6HA 1BQMB 2NCKL 2XC9A 1QDUB 3M8RA 3TR5A 2QO3A 1K8KA 3OYLA 2HNYA 4M42A 5GADP 5H9FK 3VEVA 5A8RA 3AGRA 1A7GE 1X7VA 1CQNA 2QLWA 2WW8A 1U2VB 1PAUB 1U2CA 1QE1B 1NK7A 2KYZA 5KG6A 1E6VA 4PXEA 4YFUA 4DPWA 1TV6B 4DR1J 1QVGM 4HCBA 5HLFB 3CUNA 4I6AA 2LXUA 3D1HA 3NF8A 2KG0A 2CQCA 4DV6K 1YRUA 3A1YG 5J2MB 4BDYA 4F0HA 1HBMB 1H2VZ 5CYJA 3CETA 1QZ5A 2M9KA 1RDCA 2I0XA 3VGSA 3JSYA 4A8WA 1HI8A 2YKNA 4X4VA 2B6AA 4Y34A 2Z57B 1VDHA 4BY9C 2AIRB 1VQSA 4MO4A 1FJGF 5JVHL 4CGIA 1P6TA 2DHAA 3BQ1A 3SMZA 2Y9HA 4F67A 1HNZJ 1RAEB 2DH7A 5GADI 2GHVC 1DKGD 3C0BA 1GMWA 4W98A 2BRKA 2HIYA 4WFYA 3O6WA 5AQNA 2EHGA 4M5KA 3O1LA 2I9SA 4YOTA 3L0QA 5D0RA 4E1NA 2DPNA 4OV1A 3UFCX 4DN0A 2WC9A 3UN5A 4DL4A 4WFBL 3I5CA 5GIOA 3UDVA 3LP1B 3F2KA 2XY6A 4ID8A 2M4MA 3DOKA 3ZEUB 1SCJB 3DU5A 3I6PA 4CHQA 1PBUA 2BZ2A 2HF3A 4FS1A 2ZZTA 4OX9K 3VEOA 3JAMO 4CE9A 2GIQA 4NEYA 4C48A 5CAAA 4BBYA 4WIIA 5L1IA 5GAGP 2YQ0A 4NXNJ 3ET6B 3JS9A 4HDGA 1EQMA 4WF9L 1NGAA 4CJ7A 3PW5A 1H7XA 3I56S 4KJIA 1X1PA 1NLVA 1OH7A 1YT3A 1SJQA 1BU6O 4P2XA 3ZZTA 2GX8A 3TSUA 1Z05A 3SCLE 2BQ3A 1MN9A 2KH9A 3C6HA 2M52A 4TQRA 3DDNA 3C6TA 4YB6A 5KFXA 1DHMA 4I4BA 4DF8A 3DXSX 3CCLN 2DGSA 2QJ3A 4CEOA 1CJVB 3U8XA 4CJUA 3NCRA 2P5VA 4CLPA 2RQKA 1IKXA 2RNEA 3A5NC 3GG0A 3CJ8A 1FD2A 1HBUB 4JI5K 3MPWA 4ZVFA 5I3UB 4IO9Q 4QS7A 2V8HA 1S48A 1VI7A 2P5OA 5L38A 1VQNS 3O1WA 3VWSA 1ATNA 2B43A 1RE1B 1BDGA 2GA7A 4TQSA 4MK7A 2ZM6J 3HOSA 1KEKA 5FPMA 5GAGI 3SQOP 4EMDA 1YKWA 3I87A 2E1CA 3W5ZA 4JI2F 3T19A 4CHOA 3KWIA 3PG9A 1TUUA 3O9TA 4C11B 3E2EA 2OHDA 2M5YA 2ZEJA 2I1RA 2G4BA 4QS9A 3OYHA 3RYLA 3QNWB 2RRAA 4FKYA 1HKGA 4R79A 2QMXA 4X4RA 5IT9U 3ULEA 3IKMA 3CC7S 2B56A 5A6PA 2Z2LA 3DRYA 1X9WA 4M7XA 2LA4A 3BDEA 5LMNJ 3BH7B 1TKXA 4MO5A 3ZSRA 4IR1A 2XWYA 3CCQN 1X9SA 1S9EB 2H5IB 2HLUA 4DG1A 2VF3A 1BUPA 4IJNA 4WQ5A 2HBZB 3R5AA 3BSOA 3WNGA 1I6JA 2OPPB 4CJ3A 3ZTRA 2MGZB 3KK7A 2P6TA 3PIOQ 2VASA 1KOHA 2O4IA 4HCCA 1VOMA 2B3TB 3BBFA 3PR5B 4H8KA 4CFAA 1RLDA 1N5VA 2OELA 4J8FA 1JJ4A 4X65F 4CEFA 2KZMA 3GR0A 3WDOA 5CE3A 2VQFF 4ZPWR 3UE2A 4CEEA 3OL6A 2M3DA 2LQBA 2HRYA 3TJ8A 1NKCA 3QYYA 3H0PA 3TJ9A 1DTQB 2GAHC 2NREA 4USVA 3U1LA 3M30A 4MH8A 1WF1A 3ONQA 1RT7B 3J81j 5M2RA 3CT9A 2D0OA 4FWPA 3VHQA 5L8RC 5DQHA 3MWBA 4OZ2A 3W9HA 2W9BA 3O8WA 3VAFA 3J7AN 4L72B 2MY8A 2Z1JA 2Z1HA 5B7WA 5C0YA 2EEYA 1V3RA 3ITHA 3CVKA 2VGNA 1NGFA 2ASJA 2KN4A 2ZC4A 4DR2K 4HKQA 3AO2A 3O3GA 4DR7K 1S6OA 1LWEB 5E33A 2MZQA 2NXCA 2ZBPA 5HJXA 1UMJA 1EKRA 3IGNA 2HZVA 2BKNA 3MEDB 2P9NB 4CZCA 5GMKa 2IVMA 3QZ7A 1OSDA 1HMVB 1RHRB 3HVTB 2QWNA 3TEGA 2H65B 3EVOA 1I3AA 3KG0A 3OTOJ 2P9PB 4I2PB 1BCOA 1QUVA 3D3CJ 1MWMA 2HOEA 5KPRA 1RCOB 3OFFA 2HHHJ 3Q89A 1UEUA 2WZ1A 2L9DA 3A8IA 1S76D 4BGBA 2AYBA 3MEKA 3HZEA 3TJAA 2GJIA 3MAHA 3CC2S 3O1BA 4IG0A 1XEZA 3J8AA 3L7OA 2AZ3A 1UWBB 3MAAA 3TEHB 3H7HB 1Z4UA 3BGLA 4ILLA 2FF3B 2XQCA 3BSNA 2XTJP 4B9MA 1VQLN 1WNSA 1FNOA 4TU7A 1H3DA 4RWXA 1I1GA 3UR0A 1YITS 1IJJA 4PZVA 5DDQC 4I7FA 1NGDA 2VPYB 3OL9A 4H4MB 1ULRA 2GQCA 2JWLA 1T8EA 2HQGA 2CH6A 1HNXK 3BGFA 4CFBA 1U6BA 5JVGL 1WDDA 2IRYA 3TZZA 4LH4A 4NI2A 4LBPA 4CLYA 3DRRA 2H54B 1H73A 2J9EA 4NASA 2ZBCA 3R27A 2LKZA 1VISA 2VFTA 1DY3A 1WSIA 3VV2B 3ZXWA 3UD4P 3CPEA 1PAEX 5LY3A 8AT1B 3Q8RB 4O3OA 4HUEA 4M3ZA 4OJ1A 4FKXA 1U48A 2IJFA 1O6XA 1TL7B 4JI0F 2HHUA 4OYXA 5KFCA 2Q0UA 3G6XA 5M2PA 1FJCA 2PFFB 4RZRA 2QEXN 3GJTB 3CJBA 1R8PA 1NLKL 1YHQS 2WVDA 3LW5C 4GW6A 1CG2A 3HP6A 2DRAA 3BPSP 4CJFA 4OJHA 2C2EA 4HT5A 4NXMJ 2CNNB 2E1MC 5GADU 1O1WA 2P9LB 4RNNA 3P6YC 2BJ3A 2IBKA 5KFLA 3C6UB 1P8ZA 1T11A 1K8AT 1OQ3A 1RDRA 3V5RA 3OBIA 3POTB 2AX0A 3TABA 4AHRA 3TAQA 1H74A 3R1HA 3P38A 4CT8A 4FJKA 4R5PB 4A5BA 1NRKA 4Y28C 5DM7Q 4DCHA 1KVIA 2R7TA 3LANA 3G86A 2YJFA 5ADXH 2MEWA 1R0AB 1BG3A 2CNOB 2EI5A 3CJ7A 5HL7L 3OBYA 4M5DB 2CQ3A 2ZVIA 5A6WA 3O4NA 2B7CB 1LQ9A 1TAUA 1NPRA 1HR0J 3VGVA 1VSJA 1FX4A 3H5SA 4B3RJ 1CJTA 4DV0K 1KRPA 5BPMA 2DT9A 4DR3K 4I6WA 2JWNA 2UUBK 3VAJA 3MMAA 3MEEA 2RT3A 4WBFA 1KD1O 1Q86T 2F3JA 3RJMB 2D1CA 3J80U 4M1KA 2PYJA 4RBUA 4KAZA 2LXIA 4YOEA 2PA8D 3A8EA 1S1VB 1YVFA 4DL6A 1VSMA 1T0TV 1RAOA 4RNMA 4FWRA 1RQ0A 1R8HA 1C0UB 2N4DA 5KRSA 1WSEA 2YX4A 3ADAC 2XYPB 1U47A 4BR4A 4CF0A 2AYGA 2NSCA 3ZSOA 5RUBA 2XMAA 2AKWB 2B4UA 3TUPA 4EI2A 4FXWA 4NMLA 1YJTA 3Q8QB 3U4LA 5DQGA 2BJ8A 4B9LA 5D8HB 1VHIA 2FBTA 4ITSA 3TWZA 2BQRA 3VEWA 4GKJJ 5KFZA 1RT2B 1JB0C 1VQ4N 1WTBA 1D1UA 4CLKA 4BRKA 4FYDA 4KKOB 4JI3J 3F9KA 4ILJA 2W2PP 4QYRA 3QDKA 4B1UB 1HKBA 4JI1K 1LK5A 3UN2A 1M90T 2KO1A 4ELTA 4FZVA 4JV2A 1NXIA 4USMA 2IYGA 1XNQJ 3CFOA 2F63A 5KPZA 3AVJA 3BYPA 3OSNA 4N7TA 4QIWD 1C1CB 3UR3C 2HB5A 2FVSA 2VZ9A 3GG1A 1YDLA 4IKAA 3ZZYA 1OVQA 5KGWA 3K5LA 3C14A 4UOFA 2AJFE 5K20B 3GIIA 4HHHA 1QTMA 1WD6A 1VSIA 5J1PA 1I51B 2YHWA 1B4SA 4DUZF 2A3JA 1ZBUA 2XMTA 2W01A 3MI7X 1S72N 3TAMA 4DS4A 4PWDA 4RW8A 1UZDA 1F5BA 3BJYA 1G2EA 4OPAA 4WQ4C 4DQ8A 2ZJQL 1RT4A 2WAQD 3DM2A 1BD6A 3NS7B 3C15B 3VAKA 4YDUA 1LW2B 1VRUA 4J91A 3NS5A 3ZETA 3KD1E 5A8KB 1WC3A 5C5JA 1I94F 1SKUB 3FMBA 2BUNA 4C1NI 3QO9B 1KQSR 1N5YA 4GVBB 3EGWB 2HBMA 2I7PA 1RDAA 4YOYA 1XNRF 4O23A 4ZP9A 3EZOA 3TAEA 4CH7A 4NLUA 4FJXA 3G6EN 4WE1B 3TARA 4YY3J 3PKMA 1HL6A 4TY8B 5AJ3J 4JYAF 2YWWA 1KQKA 1WSVA 1HQ2A 2RHSB 4LF8J 2NRWA 4I2QB 3K5NA 3CJ1A 1MDUB 1YJ9N 3VENA 2UXDK 5AZJA 1URNA 1JL1A 4CJVA 2V0NA 5LXRA 3CTRA 4LFCK 4EK2A 4H0XB 2B7BB 3D2EB 3O2IA 2HBLA 1RT3B 2IMWP 3NCPA 2CPHA 5AQZA 2EFNA 1RT5A 3DGPB 3I96A 2Q31A 1KVJA 4TLQA 4NE9C 3VZHA 3D6HB 1IN0A 1EX8A 4M5IA 4Y1DA 3QEXA 3VTHA 1X0PA 1YJWS 5B0EA 2BV3A 3MR7A 2GO8A 1S6QA 1PJ5A 2PI5A 4CIFA 2IM1A 1LWFB 1U0HA 5KT7A 2ZGZA 1K8AO 2XRIA 1NDKA 5CZ1A 2KM8B 5K8MA 3RB0A 4E1MA 2XO7A 2GUIA 4OLPA 1EKEA 4P75A 3ZTSA 2I2YA 2ASYA 3UDEA 1FERA 1RK8A 5JLFA 1IJFB 3K9KA 4CJKA 2R7XA 3UIQA 4GV6A 5A8WB 4YOXA 1VQMS 3ZLJA 3JTOA 1VQ9N 3K0JA 2W9CB 2QXFA 5D4LA 3HF5A 3M2VB 2LVWA 2H3EB 1Y10A 4FW1A 3OBWA 4B8CA 4USTA 1RAHB 2D0BA 2J7WA 4CT9A 2AP1A 3IGVA 2C22A 2Q43A 1NK4A 2KYXA 3FZLA 2QC3A 4FM2A 2D0AA 2VONA 1DFDA 1UVMA 5FDLB 1HD0A 2J5AA 1FJGJ 1Z25A 3DOLA 4MAKA 4IRDA 5BYSA 1J53A 2P9UB 1IBKK 4O3PA 1N34F 4QQBA 2QTDA 3MHYA 1RCXB 3GWCA 4CO2A 3OD2A 2YH1A 3CI5A 5AQGA 5CA5A 3KLEA 2BRLA 3JAMY 3FCHA 3SCJE 2UXCK 1DZ5A 1LWCB 2MHEA 4CIGA 4DX6A 3V6DB 3CFPA 4I1TA 1FFGB 2Z8QA 1KXPA 3DXMB 1RTJB 1WKKA 4UOHA 3Q2SC 2AWZA 3TI0A 3WC0A 5CQGA 2GTDA 2HQCA 3MM9A 3BKUA 1RKIA 2ACMA 2V2ZA 3KD5E 3AVFA 1BWFO 1WHXA 3W63A 1D0EA 5KFMA 2BMBA 2MQPA 3S6EA 3QEPA 1RT6B 4EEYA 1QLNA 1IBCB 2MKCA 3TQ1A 7FD1A 1RGIA 1FFSB 2VQEK 1EETB 3SSRA 3MCAB 3M9MB 3AFGA 4HACB 1SV5A 4FYVB 1FRMA 3KLGA 3R6LB 5E3AA 3OFGA 4ZN3A 1FK9B 1WHYA 2BJ9A 1N32F 4FWNA 4JBCA 4DTMA 3FK4A 3CJAA 4B1YB 1ZBTA 1M90O 3PRBA 3HSJA 3MUTP 1H2TZ 2QLJB 1SJ1A 3HO1A 5DJBA 2ZUGA 4JI8J 1YUWA 4MYUA 4FK0A 2VC0A 2H48B 2AJ0A 1VK0A 2ZJPL 2GWJA 2MLYA 1N8RT 3QRPA 5KRTA 1W2BR 3UB5A 5ETMA 4BE2A 3VGUA 3W5YA 4ISEA 3OW2R 2RD5C 1F3VA 3FFIA 2BW7A 5KFGA 4FNIA 4DWIA 3SFGA 2J0XA 3RRKA 1RU1A 3LDNA 3QT8A 3SUPA 3V81B 4K4XA 5IM0A 2Q36A 4USHA 1MWZA 2E1AA 2HK2A 4N8NA 4L74A 1TZ0A 3F5TA 4FJNA 3KUGA 3N79A 1V3SA 3MPDA 3CB4A 4IOCQ 2ZUAA 2XY5A 3O08A 4K4VA 3QINA 4RUCA 3W9JA 4JI2J 4W90B 2Q79A 2D0PA 1A5XA 4CYUB 2APOA 3O9SA 1FRKA 3DRSB 4DV3J 1ESVA 1FWLA 2AD9A 2CIMA 4DQPA 4B3OB 4BDZA 1OY9A 3CD6S 2DHGA 4XIUA 3GR1A 2DTUA 3LA0A 1Q8KA 5D0HA 4DOZA 4P6QA 1APSA 2BBEA 1R0BG 3W2WB 3CCUN 1WUAA 4PG5A 3L4IA 3ZSZA 3T1YK 3V9XA 4IZ9A 4PABA 2NXNA 1O5JA 2RN2A 2CWKA 4LFBK 2PD1A 2ZJRQ 4KSEB 3KK2A 1C0FA 4F9OA 3HHDA 1Q1KA 1TL3A 4J2AA 1T05A 3TOQA 3FLCO 2NXUA 3ISND 4X65J 4ZJOA 2KM8C 1CS4A 3VZIA 2L9WA 2KVIA 3PHEA 4C3LA 1T6CA 2YNFB 2IHR1 1NUEA 3PSFA 2RB7A 3Q8YA 1DT9A 4LY7A 4WKRA 2RIJA 3LPYA 1NHVA 2CQ1A 1EB0A 2QWMA 1BUXA 1JWWA 1S99A 5ETSA 4R0EA 3P5BP 1EP4A 4FJ9A 1ZPVA 2I38A 1RHJB 6FD1A 1W0HA 4FLWA 5KFHA 1V6HA 4DCJB 2G8WA 2CJAA 5BPLA 3L3VA 4F0KA 3PIPQ 5AQOA 2VYPA 4HTUA 4BQZA 2CJYB 2YQ1A 1AFJA 1GMUA 8ATCB 1TQLA 5CYMB 5KFOA 1HRHA 1R31A 4DTJA 3IO1A 4M3XA 4ZP6A 3ILOA 3IUCA 4YHHJ 2F8HA 2VG6A 2A41A 4BRPA 1VAZA 4CO5A 4AF1A 3ASMA 1OYDA 2DNYA 2P9SA 3THVA 1JK9B 3NAIA 3QIDA 4JI4F 2VPZB 1NK8A 5G4DA 4LF7K 1IKWB 2R2TA 2CZ4A 1XMQF 2N3OA 3GOIA 3D2FA 2CPYA 3O5BA 4HT7A 2HNZA 5HRSA 3Q86A 3MFHA 4X4UA 3OSPA 3OVNA 2DNHA 2Q3SA 4F36A 1WEYA 1QQOA 1GT8A 3A5LC 2O01C 2BE7D 5BJRA 1KBRA 4CGGA 1C0TB 2DRBA 2F40A 4KPYA 4UUXA 4YUDA 1XERA 4J90A 1YJRA 2HFNA 2YKOA 2VU5A 2NUUG 1SXLA 4CBUA 3ZX3A 2VGMA 3HVWA 3LDSA 1CLFA 1C1BA 1JCFA 5LJ3Y 4P7VA 3DLEB 2MDAA 4KB1A 4C1NK 1WI6A 1XIQA 1GAOA 4FSVA 2XSJA 2QI2A 3RMBA 2JLEA 3CPWR 1FESA 4PQAA 1JLAB 3NGTA 4LIRA 4N56A 4NOHA 2JDJA 3VAGA 4E89A 1WKJA 4OYOA 4E19A 3I9V9 4JV0A 2KZZA 1W7WA 3HDSA 4XO0A 5LMUK 2WBNA 2OPSA 1KKHA 4TSXA 4NCGA 3VMFB 1FKPA 3OFEA 4CM0A 2DNGA 2XYHB 1RWKB 4Y2IA 2DXFA 3BO3A 1KDNA 1RGVA 3CJSA 2GFFA 4OKEA 4C8NA 1W7AA 1WG1A 2V51B 4EP5A 1HLWA 4PQUA 4ZP8A 3WC2A 3L2VA 4JI0J 1Q78A 4JS5A 2HAIA 2YNHB 1FI4A 5HMWA 3AA8A 1E4FT 4M3WA 4ZPCA 3NNCA 1NGIA 3I55S 1NK9A 3N6NA 2WRMA 2VG5A 1GTHA 4CH1A 5J2QA 1LEOA 1YRTA 1WBDA 1VBXA 3VF6A 4EFAC 3HM8A 2PEHA 2ZBIA 4PUOB 4ID5A 2PFUA 3SCKE 3BREA 1YIJN 1VLOA 2E4LA 4JI6K 2XULA 2QKKA 1ZM3A 3O9QA 4CZEA 5T7LB 4DR5K 4DU8A 1FRJA 5L1JA 1FE0A 4DPUA 3E01A 5J2PB 2W7AA 2HVIA 3RRGA 3BKTA 1SKWA 5HP1B 5ELZA 1MMNA 4ILMA 2MZJA 1PBAA 3ZZRA 2CWXA 5FRNA 3ISZA 3HCXA 1HLUA 5HRNA 4G6VB 4CK1A 4ECXA 5JVHQ 2KHCA 3RSEA 2YKMB 1VRQC 1ASUA 4B3TK 3FR0A 3L7UA 1CJUB 1K1QA 3E66A 2QSFA 4ZCLA 4DV4K 4B9VA 1K6YA 3NHGA 3W61A 4DB3A 5AQFA 3CXCR 2C1EB 1M5SA 2CNLB 3D4JA 3HVAA 3MECB 4ED8A 3KLIB 2J7KA 4DZ6A 3WXMB 3P49B 3G82B 3NNAA 3ZZOA 3TVZA 4B1WB 4YQWA 1B7YB 1OSCA 1ZOTA 1VBYA 2R7RA 2HQ3A 4WFBQ 5FJ4A 3AD8C 4E7JA 4DZDA 1LKZA 2B5JB 2OTJS 2P51A 4BQLA 2D9OA 2YNGA 1RZMA 2DITA 2R8JA 1NK0A 4CNYA 3GTYX 3V2UC 2ROEA 1RDUA 4XPCA 3VN5A 3SAGA 2PO4A 1NBEB 2XI2A 2W8KA 4RO0A 1VQ6S 4I0WA 3IS9A 3FE1A 2ZF5O 2J8AA 2AA4A 4FBTA 1TK8A 1WDTA 3ZSWA 2VODA 2WUSA 3UD3P 3WNHA 3M9OB 4WF9Q 5D4NA 4NYOA 5FPEA 2QX0A 2ASPA 4W5OA 2J9DA 4I9LA 3EE8A 5CZVA 4KV8A 3SAHA 4CD3A 2DRDA 4XTTA 3QAEA 1QVFR 3V1RA 1A5VA 2VKRA 3FCVA 3BQ0A 4XH4A 3AVBA 3KYLA 3OS2A 3HP9A 3R1LA 1Y5IB 4NCAA 1JLFA 5D4OA 3NVKA 3WQPA 1NB2A 1S7IA 3OV7A 2F9JA 1N36K 1NSAA 1N48A 2QKBA 3MK6A 2OJ3A 4OZNA 1RDWX 1RFQA 2EW9A 1E6YA 2UP1A 5U47A 4WYLA 5KG3A 4QWEA 1MN7A 2ALYB 1D9FA 5KFFA 4KHPJ 1E6VB 4EBDA 1YVUA 1U49A 2HBQB 1WOPA 2KT3A 4C8MA 4AYBD 1S57A 1TFWA 2E2QA 4DEZA 4CLSA 2FGOA 2ZQBA 3V9ZA 4Q0BA 3OYKA 3IC1A 2ZDOA 1FXLA 3C46A 3NH0A 3CMES 1IM4A 1HPZB 3SBGA 2YKNB 3MMCA 4BDPA 1F5AA 4H0YB 4ER8A 1LV5A 1S1TB 2PEBA 2R7UA 1S97A 3MEGA 1I94K 2PGCA 3CIMA 1NDLA 3G87A 4LR8A 4EWTA 1XNRJ 2HIQA 2E88A 2UUCF 2VV5A 1RBLA 3HHLC 3CCVN 4Z7YA 1RI7A 2Y0BB 4XAKA 4NWBA 2QM1A 3ZC4A 1RBAA 1B99A 1PC4A 3I5AA 3CCEN 3M8QA 3JQJA 4FL9A 1S1XA 2VA2A 3F73A 4DU7A 3GJSB 1DTTA 1JNZB 3F0NA 3L2QA 2E6LA 3VTIA 4PPDA 1TKZB 4FZXC 2DR6A 3QIPB 4CCHA 1U8SA 3DOKB 5F3ZA 1NO8A 3VQDA 1VRTA 3LDLA 2I5JB 2VKZG 3KK1A 3AVKA 1V3ZA 3VEZA 4EIAA 4IO9L 1Y64A 1SI9A 3KLFB 2G8VA 4CFDA 3TVYA 2X51A 1FJ7A 3PZPA 2O8EA 1PYSB 4E7KA 4JD2A 4WFAQ 3K57A 3CMAN 2MQMA 3WZ0A 5SUHA 1WLJA 1RWOB 3G8QA 2FBVA 5DZ7A 1Q79A 3V9SA 1RYRA 2RF2B 4OI4A 1ZC6A 1WSJA 3E51A 2JX2A 1HNIB 3R5GA 4DV0J 2A2CA 5D77A 1U09A 3SQ0A 4BRGA 3TA1A 4OI0A 4AXIA 3KNAA 2FF6A 4LRDA 3DU6A 1NNEA 1H2UX 3C6TB 3EZ5A 4B3SF 3JB9k 3ATVA 3D45A 3JXOA 3HT3A 3DYAB 3CSKA 4LQ3A 1YG0A 5ETQA 4E2FB 4Z4CA 1AFIA 2C2KB 1MMDA 4WK1A 5L46A 4DSKA 2E2PA 1IKXB 1UVLA 4DX5A 1X9JA 5AQTA 4QAGA 1K0VA 4URSA 1GX6A 2C3YA 5AQQA 3THTA 2CFXA 4M3UA 2R2SA 1HIYA 3ZSYA 2RRNA 1X60A 1FF2A 2QZ8A 3MM8A 2DPIA 3VVUA 4DX8H 1QTNB 1ZETA 3VQEA 1DQAA 3R5JB 1SBRA 3U02A 1NGJA 2DXDA 3DHXA 4B1VA 3H98A 3IAM9 1NJZA 3D9BA 3DI6A 3KZBA 1RDDA 3THYB 2OO4A 3G6VA 2DNOA 2POKA 3ENHA 2RKIA 3FQLA 3CD0A 4O4RA 1XMOJ 1HYVA 1HBOB 2I7NA 1B9FA 1K1SA 4PXCA 3EDQB 4ZHRA 1NJIT 4XH5A 3QESA 3IR6B 4LF9F 1CXQA 2KHOA 3NBPB 1CPZA 2QW9A 3ULEB 3CCZA 2NR0A 1WEZA 3P96A 4I69A 2GV1A 1C4CA 2HFVA 5AXKA 2FBXA 1G99A 2LDIA 1U02A 3R6MA 1Y5LB 1YBAA 3AVMA 1LFPA 2A2DA 2QGFB 3CJKB 1VQ7N 2ZOGA 2EX3A 2XCAA 3HSZA 5H9EK 1P27B 2ZE2A 1RAIB 2ZVSA 4KI6A 4PL7A 4A46A 3GLJA 5J1EA 2HFSA 2P9IB 1FKOA 1OPIA 2ZHOA 1JL2A 4LF5K 4LF4K 2W7PA 1AROP 5HQ8A 2XWXA 1O51A 5AQLA 2X1FA 1VMBA 1JLBA 1QAYA 2CQ4A 2W2NP 2X7IA 4J37A 2AU0A 3VETA 5D15A 1N32J 1IVZA 4OHZA 2HLTA 1QAIA 4EUVA 2ILYA 3CCSS 5EX0A 4RW6A 1JLCB 2N7YA 2F4VF 4DR4K 1DAXA 3KKFA 1H0HB 4B3MF 3NL0A 4FJHA 3O3LA 5F1XA 4J9MA 3H2LA 1IKVA 1Z1ZA 4F4ZA 1T6DA 2AEFA 3KXDA 2DFHA 3LGNA 4CERA 2AEMA 3QFHA 2W9BB 1N6QA 4GNIA 3IWXA 2D0CA 5GINA 3L2WA 1VQKS 1R89A 1HNWK 3PY8A 2WONB 5FRMA 2G8FA 4BACA 3MCPA 4BR7A 2HMIB 4GY2B 1GTEA 1RBUA 1D9DA 5KI6A 4QIFA 3EPGA 2CUYA 2R8KA 2BUPA 1NGGA 5KG4A 2VL1A 3D0HE 3VR1A 1X4GA 2IAJA 2ZWPA 5A76A 1ZXOA 4W5RA 4GKKK 3DLLQ 1AT1B 4BRHA 2FBYA 1RBSA 2UXBJ 2R8HA 3KKSA 1JIHA 1YZ6A 4LFCJ 3B54A 4D3GA 2R8GA 1FWPA 2WCXA 3RGIA 3N6LA 4RG8A 1RWXB 2OYQA 2C2OB 3SBTA 1RHQB 3GCXP 5HL7Q 5DZ6A 3M2RA 1H98A 2C28A 3FZKA 1MNEA 4TYBA 4X64F 4FK2A 3WNFA 4J9UE 1HI0P 1VYAA 2HFOA 1RJJA 4ED6A 4K4WA 3MWPA 4GVEA 2DY4A 3H46O 4ZVEA 3Q8PB 1R43A 4KTQA 4IBNA 2R7WA 4BRFA 3THXB 2K2PA 2CPDA 3CJTA 4CK2A 5E26A 1NDCA 4LC9B 4U67L 2ATCB 4RNOA 4ZPDA 5GAEP 3CWJA 4ZTFA 3FGUA 4EHUA 2O8DA 1KHVA 1HWIA 3SLCA 2FTRA 1Y3KA 3TTCA 1M1HA 2KXHA 4CJ4A 5KFNA 4KHYA 2QA4N 3CCLS 3M8SA 2OPRB 3EUNA 2M88A 4EGLA 3P4UB 5IWAK 2E5LK 2AZ1A 3A4TA 1N0UA 2QN6B 4UY8O 3RAXA 4NX9A 2YWHA 5AXMA 1S6PA 4B9TA 4G1QB 3OLBA 5AXLA 3TA0A 2V4QA 3H1QA 4FWQA 3KDOA 5L1LA 1M1KO 3OHBA 4EYHB 3BF4A 5DM7L 2G8IA 3V4MA 4OZ1A 4LUBA 1KOOA 1T9VA 3QIOA 2AHOB 1R8BA 2XZDB 1SJRA 1DARA 4ECZA 2QT7A 2DKOB 5GAEI 4H0TB 2W42A 4CLZA 5DGBA 4JI4J 1RWPB 3TSQA 1UJ4A 4NLOA 3UNYA 1TVRB 1KN6A 5ETKA 4R0JA 2QK9A 1KVCA 2W24A 4ZCKA 1Y11A 3L3UA 4H4OB 3H3OB 3OXLA 5A2QY 2E8AA 3CCQS 3I0RA 3MR6A 4I6MA 1D9AA 3BPDA 3DRPA 1RT1A 2FVQA 2C3PA 3O6QA 3VQBA 2ZZMA 4WQ5C 2YHBA 4IEEA 4PG6A 3KJVB 1BMQB 2LQ5A 3VESA 4OYMA 4TYAA 4WCEL 4N8OA 1X31C 3W1YC 3ETMA 1X5TA 3M7VA 3KJNB 3H5XA 3HVRA 1NDPA 5F9NA 4MLHA 3EN9A 5KFYA 4NMXA 4JRQA 4M5HA 4NXNF 2M8DB 3M1VA 5HSPA 1KAYA 1CJTB 3MR3A 4O44B 1TK5A 1JXEA 2IVFB 4DSFA 1GLCG 3P5JA 1KAZA 1L3UA 4MMOA 3MMAB 3A0IX 2F9WA 4WXWA 2A1BA 4CVNE 2U1AA 3CIZA 2IRUA 4ECVA 1IQZA 3ILLA 2GMJA 3KG4A 1VSDA 3CG7A 1KVAA 2UU9F 2HVEA 1CC8A 4GRSA 4AQYF 2N82B 4JUZA 2OD4A 4HVJA 3RB6A 1WF2A 1XI1A 2YH0A 2O67A 4ILHA 1U26A 4BRQA 3AD9C 1K73T 4RLEA 3OR1B 1YQHA 2WB4A 3ZX0A 4FLZA 4KH6A 1TUYA 1ITGA 5TKYA 3MR2A 4LFAJ 2QIFA 1C6VA 2FJAB 3H45C 4JKBA 5KGXA 2O8FB 2ZM6F 1UKUA 3LZIA 3UD5A 1A0OB 4E7LA 2NZ4A 1NK6A 4BC2A 4PXBA 3HFVA 4DS5A 4ZVUB 4Q2MA 4OX8A 2LU1A 2W8LA 4HYKA 4YNQA 4FF4A 3IDHA 3FZFA 3TUZC 1Q5VA 3MM6A 1LXNA 1VQYA 3A13A 4G1PA 4DMZA 2A0FB 3BV8A 1Q0NA 3DJCA 3HHEA 1Z2ZA 1WUUA 4O5BA 1UVNA 5HMYA 2JLFA 5E0OA 1XK8A 1WOOA 3RR8A 5C12A 5LMNF 2Q2RA 1ROFA 3N01A 2QWPA 2IRXA 1IKYA 1JLEA 2ZBQA 4C0BA 4UY85 3NF6A 1S0OA 5EOYA 2BM0A 2VFSA 4RUAA 4IR9A 1H72C 2CQBA 4R8UA 1ZAXA 3T5JA 4JRPA 4A57A 3NOCA 1VQLS 1UA0A 5I42A 4AM7A 4Z4GA 2F96A 2DISA 3TSPA 4KHNA 3UDCA 3UE5A 2A3ZA 3TAMB 4PWDB 3AJDA 4LRFA 4KTZA 4H4KA 2XHBA 2DGVA 4IQMA 4WZQA 1RT4B 3VF4A 3GB0A 4KGZB 2DK2A 3ZETB 3BKFA 4B9NA 3S9HA 2FC8A 3D6MB 5CD4A 4B9SA 3KHHA 2RS8A 4GC6A 2RSQA 1N5QA 1N5YB 4URQU 1VQ5S 4BC4A 2GV9A 2XEXA 2C2DA 3K9JA 3G0ZA 2BA9A 3R8EA 2CGJA 3OUYB 5KFJA 1HJRA 5IQQA 4YEAA 2R7SA 3AOAA 3C7NA 5BYRA 5C7PA 2QEXS 1XHZA 2E7VA 1KFDA 4O4GB 1DEJA 1FA0A 3K89A 1T94A 4W5QA 3EM1A 5AZJB 3ZYYX 4DKWA 3GIMA 1RAAB 5THWA 1QS4A 4DV1K 4FF2A 5D0GA 1XJWB 1LAWA 1O8BA 1A9NB 3DLKA 5G0RA 2F1FA 1RT5B 2M0GB 1RB0A 4CGJA 3W3SA 4DTPA 1U4BA 1SL2A 4R25A 4U7UD 3CULA 4AT1B 3OA9A 3OTOF 2DEJA 1F60B 4LVNP 3AH6A 4ED7A 1W97L 3MTKA 3I32A 4FYWB 3CF5Q 2YBVA 2NQPA 4C4WA 1VQ8N 3QMQA 4OI1A 1W25A 1TR0A 4NLWA 1VSHA 4FP9A 5KFBA 2XLKA 2WVBA 2EVZA 1R59O 3IBCB 3F9MA 2E44A 3D3BJ 3OYGA 3C2PA 3H6EA 3VAIA 3OY9A 2N3LA 3PX4A 2Y1JA 3JQMA 5AQJA 4FPIA 3R8YA 1SVDA 2OEMA 2ZZNA 5K8NA 2BTFA 1QE1A 5LMUJ 1BIZA 3GFYA 3V1OA 3MUMP 1RWMB 2GHPA 3PKYA 3AAQA 1IR1A 2WB1D 1TV6A 3HSDA 3UKUB 1SC6A 2C3UA 2XSFA 5J2MA 1U1OA 2GWKA 1JMTA 2AYMA 1HBMA 4QR2A 3Q23A 4DV7K 3KHYA 3S3MA 3O4WA 2YKQA 4U8YA 2UUCJ 1OMSA 3VQQA 3P3DA 2MKSA 1NJWA 4CGFA 1RISA 3K59A 5I3QA 3IG1A 4N41A 1TELA 3EO3A 4DSJA 1GK8A 5F8NA 3NWGA 2YCHA 3MAQA 4M95A 5LJVA 1WSRA 4KGMA 2DNZA 4ZOSA 4KH0B 1B0TA 4JV5F 4J2EA 1RYSA 5GAEU 5KFRA 4K0KK 1RA7A 1HPMA 5IC4B 4JI6J 3D28A 5C15A 4Z4HA 1RTDB 2MLZA 2C3MA 2J9DE 3R9LA 3MN7A 7FDRA 2NRHA 2CNKB 1RAGB 4KBIA 3RAMA 4ATNA 3LP1A 3FZBA 7AT1B 3ZEUA 3PXGa 5C25B 2JFDA 2XLJA 2VOPA 2KXFA 3RG6A 1SV5B 4IOCL 2O8BA 3TU5A 4USUA 1FRHA 3CM6A 3ENOA 1V9OA 4RUHA 1B3TA 2D3OR 2J7UA 2UUAK 2E7WA 2H9ZA 2W40A 1R6YA 2CGKA 4B3TJ 1H38A 4OJRA 2YWEA 3K58A 1FWKA 1HI1A 4RBTA 4OYPA 2XS7A 2CADA 3AO4A 1S72S 5JLHA 4DTNA 4NA3A 4B3SJ 4FF3A 3NFAA 3SPYA 2IVOA 1J5EJ 2EC0A 4FW2A 5FPNA 4YDUC 2FC9A 4MFBB 1X3MA 5BR8K 4ZJQA 5F8GA 2ZJRL 2W2OP 2VPXB 3LH2S 1CJVA 4AILC 3IMXA 1RHUB 1WF0A 4DV2J 4J9VA 4I67A 3NGIA 3QB0A 2HGNA 2YQ3A 4K50A 1HBUA 1YX2A 4NL5A 5I3UA 3NE6A 3G6ES 1EO1A 2R4FA 2KRBA 5C2GA 2CAJA 4DV5K 1FXRA 3TX8A 1GOBA 5BN8A 1YJ9S 3LGMA 2OANA 3NMRA 3GBTA 4ETZA 4C11A 2J0WA 3BM7A 3O5TB 3BEXA 4ZCIA 4LF9K 1WACA 2DVIA 1VBZA 1N33K 3R7BB 2I6WA 2R2UA 5DO2A 4ID1A 4IG3B 4L3KA 3NRBA 4L76A 4NLCA 4DTRA 2ZBRA 3T5HA 3NKYA 2DNMA 4FPAA 3M32A 3KK2B 2UZAA 3TWHA 1KAXA 2RUGA 2DGXA 3PYGA 2YNIB 5GAHP 3DXKA 1ACMB 4CZIA 5HAOA 1S9EA 1IG9A 4JI3F 2QRRA 3EKUA 3MN5A 1WWHA 2HAFA 2OPPA 4BG8A 2MGZA 3GDQA 3ZSXA 3TTDA 1S4FA 4MTPA 5AZIB 4EP4A 5L1KA 4AHCA 3DLGB 5EXWA 2BJ7A 4FPBA 2VFRA 1M5VC 4QU6A 1KLNA 2F4VJ 1HHTP 1VQ9S 4CJPA 3UCZP 3P45B 4B3MJ 4BGAA 3PCOB 4J9OA 1EP4B 2ZH1A 2KU7A 1NMDA 3OYEA 1F9HA 4JKHA 1S0VA 1QSSA 2LLZA 2BE9B 3WT0A 2PE8A 2B4PA 4XPEA 3M6WA 1G1XA 4PWUA 2XO6A 4MKVA 4NYPA 4NZ0A 4OPHA 3E9LA 5GAHI 2HQFA 1LFWA 4KB0A 3C19A 2VG6B 1WG4A 4IFVA 2P9SB 1FRIA 2LA6A 4TKTA 3M6UA 4CJWA 3BN4A 3IRXB 3QGGA 2G9OA 3PX0A 1LWEA 3ZX2A 2E20A 2G1HA 3VOVA 4Z4IA 1O13A 3EICA 4J9KA 4W4MA 2LP4A 2RMLA 2FVCA 2HWHA 4PWWA 3UCGA 4CZFA 5JMVA 3MEDA 3WXJA 2XMUA 5AJ3F 1NM2A 3KUEA 3HHNB 4KHWA 2OH2A 1Z2LA 1HMVA 1CZAN 5KT5A 3OTCA 4KB7A 1UJ5A 1HQUB 3O4QA 3GE1A 1RWUA 3QGIA 1CZBA 4IYQA 2UVUA 4CLFA 1WELA 1SIWB 4BVPA 1OIAA 3P83D 2IBOA 2FJWA 3GE9A 4C97A 4X66K 4C2MA 4M5GA 3U3GA 3OTEA 3GV8B 3KLHA 1UFKA 1Z26A 4RUBA 3D0IE 1IBMJ 1EX4A 1C1BB 1ZM9A 2IJNA 3AVIA 1IBLK 1RTIB 4A48A 3Q24A 4DTSA 2CQ2A 4MT1A 1VR6A 1Q8BA 4DU3A 3HM9A 2BE2B 2JJ4D 2XSJB 3QWPA 1NEEA 3MWTA 2B8QA 3O9UA 1QJHA 1Q7LB 1UWBA 2RPIA 3KK3A 4BRMA 2VWJA 2D74B 4DFMA 2RHKA 1Y5NB 2OI2A 4OI3A 3R5DA 3UW1A 4F4XA 1NPKA 3QNOA 1RLCL 3SYZA 2FJBB 1SH0A 4Y3CA 2YX1A 3C66A 5EUHA 1FKPB 3EGNA 4FXDA 1QHTA 4DR1K 4FF1A 3CCRN 2FZCB 3AQOA 2UYTA 1J5OA 4ZPBA 2BH1A 1Q7YO 1YWXA 3SV3A 5CD4H 2V8PA 4JAXA 4F3MA 1P9QC 3BGRA 2O1PA 2K3IA 4LF1A 2XS2A 4M45A 2PDAA 3EL2A 3I31A 4U6PA 3GIJA 3BZKA 4A8XA 4ENOA 2EFGA 2OTLN 1NHUA 3R2CJ 5ETLA 2NUHA 3VGTA 1TL7A 1HNZK 3CCUS 2C2MB 1K44A 3QAUA 1FVSA 2ROGA 4FVMA 2O4GA 2FHJD 2VICA 2FHMA 2OLWA 4ID5B 1YJ7A 4E0DA 3PYEA 5J2NB 1JKHA 2YVSA 2DB1A 4LR9A 4LF4J 1CLQA 3QPIA 3W64A 2A10A 5F3TA 3C6UA 1N0VC 5HVGA 3O8MA 4CLLA 3E01B 1CULA 4LVOP 2JOQA 4DPTA 1QQNA 3POTA 3IWNC 3DMJA 2D41A 4WIQA 5EU7A 5M1OA 1TU0B 1XR5A 1GOCA 2JL9A 1LW0B 3MN9A 2DNRA 4R5PA 5KQ8A 1UCNA 4FWMA 4DQIA 1RP5A 1ZBSA 1OPZA 3CDBA 2FD2A 2IIRA 1SL0A 4NLDA 2PMHA 3OHAA 4NXNK 4M5DA 3ICLA 3EMTA 3HXMA 3WXIA 4M41A 2ZKTA 4KPCA 2WTUA 4A47A 4ED3A 3ZT3A 2G8UA 2IMOA 3NF9A 4AHVA 5F8LA 2A1RA 4JI8F 3B4DA 4MJKA 5C24B 1T3NA 1T95A 3FSIA 4UZBA 2UU9J 4M8LA 4YOWA 1RUSA 5SWMA 1RXOB 1NHKL 1NWKA 4H5VA 2VD3A 3RTVA 2RHQB 5HROB 2HBRB 5CHCB 4AQYJ 2G0IA 4MLEA 4QZVB 1B70B 4GKKJ 1C0UA 1DURA 1U2RA 1VQON 3AVAA 4TLRA 1ELOA 4F4YA 2Q1NA 3SUOA 2QXLA 1JXVA 4CBWA 3VAHA 3J7A1 4J9LA 1WAFA 4ERDA 1TYQB 3MCOA 3THPA 4DV3F 2NYIA 4ZCMA 2O8CB 1RDBA 2X74A 3DAWA 4M7YA 1RT2A 3DHWC 2JGUA 4ELUA 4OFZA 4M3YA 3U7JA 3AO3A 3FGVA 3RB4A 4E1JA 4P73A 3IN5A 2X3GA 1OJ4A 3L2UA 1M0SA 2M70A 3M2UA 3DLBA 3X3UA 2FY8A 2ZOFA 3AA2A 3VGMA 1YVNA 1AYEA 3R2DJ 1S7HA 3J81O 3HJVA 3HRGA 2E1ZA 3MF5A 1LXJA 3PW4A 1C1CA 1YJVA 1GLLO 5HK4A 4W5TA 3W5XA 2HWIA 4WP3A 3BBCA 5F0WA 1HFEL 1ITPA 5KG5A 2W4PA 2BW2A 2F8SA 2CH5A 3HD1A 1JLQA 4Q0BB 1OYEA 2DFFA 5HBMB 1YJNN 2V52B 3SEOA 5BXIA 4DV6F 4Z7CA 3PO4A 2WOMB 1KSPA 3WQUA 4Z0UA 2P1JA 3RWUA 1S6UA 4O5FA 4WFAL 3NXZA 3WEEB 3FEZA 3MEGB 5C10A 1NGCA 3C15A 3HI0A 1LW2A 4FPRA 4NEZA 1IWAA 5A8KA 1Q95G 5DGAA 3N6MA 2QLBB 5HMZA 2HHQA 2Q1LA 3QO9A 3CQ8A 4DQRA 1XN9A 4GVBA 4CRJA 5BRHA 2WSFC 4CJTA 3M8QB 5GAHU 5EN1A 4EYIB 2IOCA 2UVRA 2FXUA 4JS4A 1FEHA 1NGEA 4YHHF 2ZH5A 3WHIA 1DTTB 3D54A 5EDWA 2Q6CA 4QWAA 1WSFA 3NCIA 2DCUB 3M4XA 3JYTA 2H4YB 2I8EA 4LBHA 4TY8A 3UPFA 4E7IA 3H20A 2ZOMA 2H3GX 4H0VB 4BRIA 4I2QA 2E5IA 1YIJS 3KK1B 1JQGA 2LQ9A 3AGKA 1M5KC 3SQGB 1GEHA 2ERRA 1NZAA 5FIIA 2J0SD 1IV0A 1EQYA 3D2EA 4MIWA 1Q9YA 3QZ8A 2GBZA 1RT3A 5D0EA 3GV7B 3DGPA 3VF2A 2PFDA 4O3QA 1QAJA 2HZCA 3QEWA 4M3RA 4BREA 3TZYA 2LMIA 4Q5VA 3A8JA 2E29A 3L3CA 3CO9A 2CVIA 3SQ1A 4S0MA 2HHHK 1UTAA 3B6PA 3BO4A 2V2VA 2IS3A 3CDEA 1ZPWX 3FSXA 3L6QA 3QICA 1VIOA 5HVHA 2VJUA 3OLAA 3SUQA 1PSDA 2ALZA 4ISFA 2HQIA 4BR9A 1OH8A 2EG1A 1D5AA 4CZMA 3BEGB 2FQQB 5A8WA 2W25A 2MKHA 2AGPA 3FBEA 4CF2A 4DCPB 4P2SA 2IA6A 3MM8B 2HHXA 3T1HK 3HSGA 2JVOA 3AAWB 2X3DA 1Q82T 4N47A 2FSJA 3JSMB 3FZHA 4O0NA 3CDUA 4C0OC 1RTHB 3QFUA 4E8UA 3ID8A 3WXKA 2ZD1A 3BGOP 1KP6A 4CNZA 2ZGYA 3SCIE 4I68A 3QGHA 2AW0A 4IFYB 2GHWA 1VBKA 1NB7A 2KKHA 3CQYA 3GPAA 4QU7A 1HBNA 3W60A 1X4EA 1OY6A 2VIHA 3MPVA 5EGYA 1W2IA 3B4MA 5AT1B 4U67Q 4N76A 4JV5J 4FVCA 2EBGA 4J2BA 2BDPA 4H5TA 2H1YA 1LWCA 2GAGC 3V6DA 2UUTA 4WJBA 4ZIWA 2WVFA 2X6NA 4HDHA 3CNQP 5BRDA 3SFUA 4Y2CA 4Y2MA 3PM9A 4CW7B 1ASWA 3AJ1A 3D5MA 1I3OB 3HBTA 4FVUA 1FKOB 5M1KA 4NXMK 2NUBA 2OIHA 4Y0WA 5A0YA 2CQIA 2LQJA 2XZWA 3M3ZA 1S1WB 1F2GA 2CJQA 1JLBB 3IP0A 2OZSA 3KWGA 2ZDPA 3NAEA 1X4DA 2ZHAA 1FRLA 9RUBA 4PAAA 2KT2A 3NMAA 3MN6A 1L3SA 2EKYA 2V8VA 4PXDA 1EETA 4HACA 2KJWA 2GGPB 3DLLL 1BQNA 4OGEA 3MFIA 4EAHD 4LD0A 2D69A 2VG7B 5B8HA 2CGLA 3B8HA 2E5HA 1HWKA 4C98A 2IC3B 3NCQA 2OFHX 3LM2A 1FTCA 1VSKA 2KFZA 1NMEB 3SQ2A 4DF4A 3VQAA 4OV6A 4GO7X 2Z0GA 4ZITA 3ENBA 2RU9A 4AUKA 2OCEA 1HR0K 5TKWA 4B3RK 1T44A 4P52A 3S3NA 4I64A 1TP7A 1HUXA 3KIOA 4RL1A 1UOCA 1WEXA 2E5GA 4NLXA 3V81A 3CCVS 5D3GB 2X78A 4KR0B 2DBBA 4DR2F 1X4CA 2NPIA 1B0VA 4DR7F 3T7ZA 4KH4A 3DXBA 1E4GT 4CIEA 5IXUA 1DQ8A 1MU2B 3C16A 5IQ6A 4WCEQ 3QBXA 4NLSA 4I6YA 4J9QA 4BWJA 1LWXA 4TVAB 1EXQA 2PN6A 3DRSA 1FDAA 1X3NA 1KQSM 1UEKA 2ZFHA 5F8IA 4B3OA 3ZNJ1 2A40A 2XY8A 1RABB 4FN5A 5DQIA 1HYSB 3CMAS 3HT0A 3L7PA 1EAYC 4GKJK 3WX4A 3PDNA 2J76E 1U2FA 2QA1A 4DUYK 1QQCA 1KVKA 4H54A 1ZZNA 1WNEA 1BI4B 2NRZA 1X4FA 3EE9A 1NH7A 3DNCA 4X4OA 5KFKA 4JI3K 1RWVB 4FWLA 2EBEA 4DPYA 4Q45A 2L41A 3F56A 2L3MA 5DS7A 2XCPA 1F9EB 3H4BA 4KY3A 5I3PA 4FM1A 3AVHA 1S9GB 4M5LA 5FLXY 4P2FA 3OYIA 3FFKB 5B0GA 1XNQK 1VSEA 1H7WA 3OVBA 2YPYA 2ATQA 3QWUA 2Q0RA 1BHLA 3BSCA 4JK7A 3P4IA 5DLFA 3V4IA 1S6PB 2YNFA 4FLYA 2J6TA 2YJEA 3K8WA 4ZTJA 2HNDB 1U04A 4ECRA 2GO9A 4QWDA 3SMPA 4LF6K 1S49A 4X62K 4KHPF 5IT9O 4DI6A 4JI7K 1M5OC 3PW7A 3GV5B 1FDBA 4Q2LA 1NMNA 4DV7J 1HNXF 1U25A 1C4AA 5ETRA 2MY7A 3M8WA 4I56A 6FDRA 1V5IB 3JAMU 3MXJA 5CYMA 2BOAA 5GMEA 2V7YA 4A5AA 2Z56B 5T7BA 4USIA 3PVXA 2FJEB 4HH1A 1X4HA 3B6BA 4K5SA 3TUIC 4C3KA 4BR2A 4UTGA 4UQGA 1WG5A 4K0KJ 4HHUA 2MJUA 1TTHB 1HNVB 1DBDA 1M5PC 3AVGA 3DFEA 3RVCA 4BHQA 5AQYA 4OZLA 1Q18A 2IVPA 1KWMA 2A5XA 2HYIB 4YY3K 1VQ7S 1PJ7A 5AJ3K 3WIVA 1D8ZA 4LF8K 1TFYA 3EZWA 3I4HX 4XH1A 2NLWA 3MCMA 1JLGA 2NYHA 4YR2A 5ETOA 2X1BA 2MQ8A 4A62A 1QSYA 3D6TB 2XGQA 5F0UA 1DJ0A 3ZTQA 4F4KA 1C0TA 3FUYA 1IG8A 4KH5A 2PBDA 1FCAA 2AMCB 4V19S 2DO0A 4DJBA 5F9LA 4NCBA 2AJ4A 2G8HA 3M1VB 3DDIA 1L5UA 4DR6J 4L8RB 1C2PA 4J5OA 3SDEB 4FJIA 2HW3A 1T9XA 1PJ6A 4YORA 4FYYB 3CMQA 3M8YA 4XK8C 4DV0F 3G4SN 3DLEA 1UPPA 1IUJA 1DGKN 4RW7B 2J6SA 2UUBF 3QT6A 2MZRA 4NLQA 1D8YA 2DGWA 1X5OA 2FJDB 4ZPAA 2V4RA 3AOCA 4FK4A 1JLAA 3ALYA 2N7CA 4ZVHA 1DLOB 1U1QA 3QLHB 2RILA 2R7QA 1NSQA 5B0AA 5JMNA 4TNOA 4QOZB 2V2KA 2BVZA 3MM7B 4NLTA 2J0QD 1OH6A 2MPUA 2VCPA 4GO5X 2LYVA 2HSEB 4LRBA 4CI0B 4CZJA 3OW2M 1Q86O 3CD7A 5HQMA 2ZWHA 5DRKA 1FJGK 1NU0A 3UVJA 5HANA 4DLGA 2LDYA 2HS3A 1XMOF 3MM6B 4LSNB 5HJYA 2LCWA 1XUPO 4ICLB 1S5JA 5C42B 5HATA 3OYDA 3DLRA 2VBZA 1EWQA 5M1NA 4FO0A 3ZZ0A 5E84A 4A2BA 2E6MA 4JI1F 2HFUA 3QJPA 4F25A 3T3FA 5KFUA 1HQEA 4X4QA 3NGYA 1IKYB 1L3VA 5T7LA 2BEFA 2DXEA 4CTAB 4WP9A 3CJ4A 3QFPA 2FSKA 4X2BA 2GCFA 1YRXA 2YHXA 5IFMA 3TPQA 1RAFB 3L8BA 3LL3A 3U9DA 3LALA 1P8GA 5AFUH 2RDIA 2QA4S 5HP1A 4F4AA 2NPFA 5I42B 1WHWA 2K06A 2F5GA 3LAKA 3NOGA 1VQPN 3QMLA 2XYGB 3MZIA 3T5KA 4NZ7A 4HTIA 3CGIA 4AHSA 4RU9A 3KHGA 2Z30B 1YZ7A 1CJUA 1CBKA 5DDOC 1G3OA 3MECA 4PYDA 3KLIA 1HYZA 4FM0A 2KW4A 3CF5L 4DX7A 3G82A 4YDXA 3CJCA 2KI2A 2IY5B 3PFEA 1ZM2A 3HYFA 4H5NA 4ZLJA 1UVIA 4RW4A 4P2MA 1GH8A 2B5JA 4QBUA 1WOSA 1SQKA 2Y1RI 3Q22A 3PSIA 3V6JA 4JP8A 4BE0A 2DIUA 2JH3A 5ADZA 3PHTA 2F65A 3ZZZA