1EETA

Hiv-1 reverse transcriptase in complex with the inhibitor msc204
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Urea-PETT compounds as a new class of HIV-1 reverse transcriptase inhibitors. 3. Synthesis and further structure-activity relationship studies of PETT analogues.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, transferase
total genus 153
structure length 542
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1eetA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1eetA05
1S9FA 4DSJA 3OS0A 4FJNA 4OKEA 3NKYA 3V1QA 2I1RA 3NF9A 3K58A 2R2TA 3V6KA 4KPYA 1RBTA 3DRPB 2W42A 1JLQA 1WAFA 3KK2A 3CDUA 5KFOA 2UUWA 2O4IA 2B5JA 2CKWA 2KZMA 3CJ0A 3PW7A 1TL3A 3QNNA 1WAJA 5L1KA 3DM2A 4K8ZA 3L3VA 5DLGA 1VSKA 2BANB 4RUAA 1S9GB 3VA3A 1RTJB 4BDYA 4ZVGA 4U6PA 3OYDA 2OPSB 4YNQA 1WLJA 3OYCA 1XR5A 4CHOA 4DLEA 2KTQA 4ZP9A 3G6XA 1JXBA 1R0AA 3V1RA 3MEGA 1VK0A 2WOMB 3ZSOA 3T1AA 2LSNA 2D41A 3VQCA 3IAYA 4QWBA 4CCHA 1TV6A 3UPFA 3LP0B 2HVIA 4G1QB 1C0TB 3QLHB 4NLUA 2ITGA 4HVJA 1YVUA 4CHNA 1TKZA 4M3YA 4N47A 4QWDA 4IH6A 3H5SA 4J2DA 1HYSB 1BIUA 2YNHB 4CGDA 3GV5B 3PX0A 1JLAA 5EWFA 3SFUA 4CEDA 4E89A 2HNDB 3SV3A 1DTTB 4F4ZA 1TKTA 4DU3A 3KK1A 1C2PA 1MMLA 4NYFA 3LZIA 3RB6A 4DQIA 4DU1A 4Q0BB 2EX3A 2Z1JA 3CDWA 3CQ8A 4J9OA 3ITHA 2A1RA 4K4ZA 3THVA 3NF8A 1NK4A 1I6JA 3VQPA 4FM1A 3ISND 3IGNA 4DF8A 2E4LA 5KFEA 1U48A 1NK5A 1RT2B 2FLPA 4M3XA 4KTWA 4F4KA 3OLAA 1TK8A 4Z4GA 1ZBUA 4I2QB 2OPQB 3V9WA 1RDBA 2VA3A 3G10A 5E41A 3MECA 1S0MA 1CXQA 1JLCB 3WNHA 5HP1A 3HO1A 3TANA 2HHVA 4KREA 2XGQA 3BGRA 4Q8FA 1S49A 4HUEA 5J1EB 4TYBA 3NH2A 3MR2A 4QAGA 4QWAA 2OH2A 4Q43A 4ECSA 4FLVA 1XR6A 3M9OB 4FJIA 4DS5A 3ZSRA 1WSHA 3CVKA 2DPIA 1HNVA 2HB5A 1S10A 3CWJA 3PW4A 5HLFB 3DOLA 2R8HA 1F21A 3TR8A 5C5JA 2DY4A 3M9NB 4M3ZA 4XIUA 1JLQB 3VN5A 3HK2A 5JS2A 4IG0A 3KK2B 4ZP8A 4ZTFA 2O4GA 2W8LA 4DSFA 3PO4A 2B5JB 4EEYA 2JGUA 4IR9A 1U09A 1DLOA 4F4YA 3IS9A 1U47A 4MK8A 1D8YA 3KNAA 1TL3B 5KFRA 1ZBHA 3DM2B 1SKWA 1SH0A 1RAJA 3OYIA 2OA8A 5F8GA 3F9KA 5KG2A 3K59A 1R0AB 3MEGB 4NLYA 5KFGA 4CEEA 5KFKA 1VSFA 4NLRA 1RTDA 1A5VA 1TV6B 3M8QA 3M8SA 3E01A 3A2FA 5KFZA 4TY9A 3K5NA 3CFRA 1TKZB 4ECUA 3OYLA 4AHCA 3QEPA 4YQWA 4TN2A 4M3UA 4JV1A 3TAMA 1NK8A 1C6VA 4HTUA 4CHQA 1JLAB 2AU0A 3UR0A 4W5OA 3PR4A 4PA1A 1C0UA 1LWFA 3G86A 1TKTB 4FM0A 3KK1B 3PHEA 1C0MA 1XC9A 5K14A 4ECYA 4E7HA 2R8KA 2PYJA 4KHNA 3KOAA 4CF0A 1JIHA 1SH3A 2BRKA 3ITHB 1WNEA 3L2RA 1VSMA 4DSEA 1RT6A 4B9LA 4QWEA 4E1NA 1NKCA 1W25A 3IGVA 2YV0X 1ZBFA 3AVMA 1A5WA 1BQNA 3K5LA 2RN2A 1KLNA 1TP7A 4CGGA 1VRUA 4BDPA 4KFBA 3SQ4A 5D3GA 4E19A 4CJVA 4DTXA 2D3UA 2VWJA 1LV5A 4NLTA 3B6PA 4DFMA 3MECB 2Q3SA 2V4RA 3U3YA 5HP1B 3D5MA 1JLBA 4ZHRA 5KT2A 4NLPA 3PUFA 4E3SA 3ZSVA 2DTUA 2KQ2A 4CJWA 3BGRB 3OJSA 2W7PA 2OZMA 1UOCA 4FM2A 4J2BA 2FVRA 3KLHA 5JS1A 2XWYA 2HNYA 4RU9A 4H4OA 3S3NA 1NOYA 3NGZA 1BCOA 1UAXA 3VQ6A 2BE2A 2BR0A 4PWDA 4GC6A 1HNVB 3NHGA 3H2LA 5EUHA 2Z1IA 3DOLB 3LWLA 4KHSA 3OLBA 1RDAA 1BCMA 2IJFA 4CJQA 1NOZA 4RZRA 3PJWA 5HLFA 4O55A 3NGYA 3BQ1A 4CEZA 3D28A 1JL2A 2XY6A 3BSCA 2FBYA 4FLZA 4IG0B 4QOZB 4CF1A 3V81A 2KW4A 2HHQA 1UWBA 1CZBA 1TKDA 4LQ3A 4ZP7A 1DLOB 2ZD1A 3P5JA 1RBRA 3IS9B 4Q5VA 1KSPA 1QSSA 5KFMA 4F4WA 3KLGA 4CFAA 3I0RA 1J53A 1HQUA 1KTQA 3C94A 4RW4A 2DPJA 4NCBA 3RMAA 4DSKA 4G3IA 4I7FA 3O3HA 1RTDB 4DL3A 2F8EX 3M8QB 4WXOA 3BREA 3SZ2A 3E01B 2P5OA 1QQCA 4YFUA 4EYIB 3VQAA 4MIAA 3AA4A 3LP3A 3OYFA 2B43A 5JUMA 3TAEA 5HROA 3SPYA 3TAMB 5KFNA 3AO5A 3V6HA 2X6NA 4WFYA 4EBCA 2P51A 4FJ8A 3QEIA 3MXJA 2C22A 3AA5X 2BQ3A 2IDOA 1C0UB 1LWFB 5I3UA 1RTHA 3OS2A 2JEGA 3ICLA 2FVQA 5K14B 5KT5A 1BGXT 4FLWA 2DFHA 1LWCA 4CF9A 2C28A 4EP5A 1T05A 3QIDA 1RT6B 4O4RA 2FJWA 4OPKA 3PY8A 1BQNB 2GBZA 1MU2A 3FFIA 4ZP6A 3KJVA 1VRUB 5I42A 4C8MA 4KFBB 4GVMA 2ATLA 4FJJA 5D3GB 2XGPA 1GOCA 1REVA 2G8HA 4TLRA 1ZBLA 4PY5A 1U49A 5KG1A 4JLHA 1KLMA 4WFXA 1JLBB 4ZHRB 4KTQA 1X9WA 4CFDA 2GIQA 2OPPA 3Q8RB 4CJEA 3KLHB 3DLEA 2HNYB 4FBTA 4ED2A 5CZ2A 3PW0A 1D9FA 3ZT1A 4WYLA 4EP4A 2AJQA 2BE2B 4FLYA 4OL8A 4PWDB 4CK3A 1D9DA 3VQ5A 1FXXA 3KTQA 2XY5A 4DLGA 1N4LA 1LAVA 3QERA 3VQBA 4O5BA 1D5AA 4KBIA 3QESA 3TI0A 4CGIA 3OSNA 3L3UA 5KG6A 3V81B 1BIZA 2R8IA 3GILA 1UWBB 5KT4A 3SYZA 4CJ3A 3O3GA 1L3UA 2ZD1B 1Q9XA 4KKOA 4CF8A 4ZTJA 3KLGB 4RW9A 4GMJB 4TQRA 3I0RB 4M3TA 1HQUB 3TABA 1WNSA 2IM3A 2XC9A 3HM9A 3PO5A 4RW4B 1VSDA 1WSEA 3H5XA 1BL3A 4FK4A 5DQIA 3OYAA 4I7FB 3HSTB 3U6FA 4F2SA 3UQSA 1JLEA 1S6QA 4J9LA 3O4QA 3MR3A 3BDPA 2D7SA 3PJXA 1S1XA 2JEFA 3DLHA 4E1MA 5HROB 2AWZA 1BHLA 1BISA 3HT3A 2XCPA 1SL2A 1K1QA 1ZTTA 4LH5A 4IG3A 4FLTA 4K4SA 2FVPA 4KSEB 4FBUA 5KG0A 3T5LA 5I3UB 2R7YA 5KFSA 1RTHB 2ALZA 2YHAA 1UA0A 4NLSA 3O4NA 5J2PA 4AH9A 3OSPA 2IC3A 1LAWA 1LWCB 3CDEA 1GX6A 4Y3CA 4J9SA 1T05B 4X2BA 2HHTA 3RBEA 4WZMA 2P1JA 4EZ6A 3FQKA 2FJXA 4FVMA 3L2VA 3GQCA 4EZ9A 3SNNA 3OS1A 1MU2B 3NH1A 3KJVB 3ZSYA 3MFHA 2E9TA 3KLFA 5I42B 3CM5A 4KO0A 2KFZA 2JC0A 3V6JA 3OJUA 3ALYA 4K4VA 2DFFA 1ZYQA 1REVB 4N56A 4CHZA 3TAFA 1TKXA 2ASJA 1NNDA 3DLRA 1KLMB 4NLWA 3QIOA 1RA7A 4BACA 4O4GA 5KFYA 2OPPB 1RT5A 3LWMA 2BQRA 2C2DA 3DLEB 4AHTA 4JRPA 3QIPA 3H40A 2AGOA 4YMEA 4ZVFA 3PW5A 2IA6A 5HRSA 5EWEA 1OS5A 5HRNA 2HVHA 4Y34A 3HP6A 4DL4A 3RB3A 1JLFA 1NJYA 2HW3A 3AO3A 1NK9A 4M41A 4NCAA 4KHMA 2VG6A 4MK7A 4B9TA 2Z1GA 1RYSA 3KMSA 1ITGA 4FLXA 4IRKA 3AVJA 4H8KA 3BSNA 3RWUA 4B3OA 2RDIA 3HP9A 3ULDA 4BE2A 1RBVA 3RR7A 3HVWA 4KKOB 1LWEA 3ZT0A 4F4XA 3AVKA 3MTKA 4RW9B 3OL6A 4WFZA 3H4BA 4CEBA 2YKMA 3MEDA 4NRUA 2UVRA 4R5PA 2HHXA 3DRSA 3MAQA 4LD0A 2R2SA 1EX4A 3AV9A 4IDKA 5DQGA 4WXWA 4ED8A 4ID1A 3T5HA 3RMCA 4M3WA 3MF5A 4DQRA 1T3NA 1JLEB 1S6QB 3PX6A 3V4IA 3LP2A 1B9FA 3AVGA 3K2PA 3VQEA 2P5GA 4KHQA 1S1XB 4FZYA 3RRHA 3DOKA 1T7PA 2YKNA 4FW1A 1C1BA 1VSLA 3ZSXA 4N76A 4LSNA 4IG3B 3LDSA 2X74A 1CZ9A 4J9QA 4HUGA 4KHUA 1W9HA 4ECXA 4J9RA 5L9XA 1WSIA 3MXMA 5J2PB 3ZT2A 3DRRA 2IC3B 1IO2A 1JX4A 2RPIA 4FXDA 3NAIA 4DQPA 5KFWA 1S1WA 1SL1A 5KFUA 2UVWA 5SWMA 2XI2A 4K4WA 3NE6A 3SI6A 4RNFA 5F8NA 2ILYA 3NF6A 3V9XA 1NK0A 1FK9A 3KLFB 4ELVA 4IR1A 3TAPA 4KO0B 2D0BA 3BSOA 1UA1A 2PZSA 3JYTA 5KFLA 3NFAA 1RT4A 3OYKA 4LQ9A 4B9UA 2YNGA 4QW8A 3KLEA 1TKXB 1XHZA 1JLGA 3Q8SB 4CESA 1SL0A 1EKEA 4O4GB 3RMBA 1HQEA 1RT5B 3QYYA 2FVSA 4KB7A 4IH7A 3FDSA 3H5UA 4DTSA 4O3QA 4HYKA 3QIPB 4NLGA 2FBXA 4FJGA 4KRFA 4AHSA 1FKOA 3E51A 4J9KA 1JLFB 5F8LA 1J54A 4URGA 3KD5E 1IM4A 3RB4A 2VG6B 3AVFA 1HARA 1HYZA 2VWKA 1XI1A 3V1OA 3EZ5A 5SZTA 4HHTA 4CJKA 1WSFA 3OY9A 4B3OB 3MXIA 2QE5A 4C8OA 3IRXA 4ID5A 1LWEB 4HCBA 1JKHA 3SJJA 2ZKUA 1LW2A 4M3RA 1N48A 2FBVA 3PW2A 4Q45A 4DQQA 2YKMB 4DS4A 3MEDB 3TWHA 4R5PB 1QE1A 1TAQA 3CIZA 4M45A 3OYMA 3DRSB 4B9SA 4MH8A 1ZETA 2F8SA 3HVTA 4KHRA 4IDKB 4KB0A 2W7OA 3V4IB 3SQ0A 2QXFA 3LP2B 2IBKA 4ED3A 3DOKB 2YKNB 1C1BB 4EBDA 4ED1A 4LSNB 1S4FA 4EO8A 3LPUA 4DTJA 2KFNA 3HPOA 4E0DA 2OZSA 2VA2A 4CF2A 4Z4HA 1Q8IA 4OLBA 1KFSA 2XY7A 4O3OA 3DRRB 3H08A 2W9CA 3DI6A 4Y1CA 2JEIA 4CJ4A 3BQ0A 3D45A 1S1WB 1TK5A 5KG7A 1TGOA 4FJXA 1S5JA 3GIIA 2WK4A 1S9EA 3LAKA 5KFCA 4U7CA 3LALA 4FJKA 4CJLA 5T14A 3OHBA 3OYBA 2HMIA 1FK9B 3SCXA 3HL8A 3EPIA 2YNIA 3AVAA 1RILA 1I3AA 3RMDA 3JYTB 5L1JA 3H5YA 3I5BA 3TAGA 1RT4B 4J2EA 5KFBA 3OL7A 2XRIA 2YNGB 3KLEB 1JLGB 1ZTWA 4ZPBA 2ILZA 2V9WA 1NK6A 4YP3A 1S6PA 4NLVA 4DTPA 3DLKA 1HQEB 2E9RX 1NJXA 4DL6A 1VSHA 5KFQA 1ZBIA 3L2UA 1S1TA 1FKOB 1RDDA 5F9LA 1JXEA 4KAIA 1QUVA 4BWJA 3WNFA 1IG9A 1KFDA 4CK2A 3UIQA 4DSIA 4NLDA 4RW8A 4HCCA 2IGIA 3G6VA 3SI8A 3S3MA 3ISNC 3QEXA 2F96A 4CJTA 5DK5A 4OVLA 3KKSA 2FJVA 4O0JA 3VQ9A 3IRXB 4ID5B 1JKHB 1KVAA 4I9LA 4KAZA 1VSJA 1LW2B 2A1SA 3EZUA 5F8MA 4OKJA 4CJ5A 2ZE2A 1TVRA 1QE1B 2Y1JA 4DFJA 4ZMMA 4QWCA 4F8RA 2GC8A 1GOBA 4RG8A 3KLIA 5HBMA 3HVTB 1QHTA 3DMJA 4ZPDA 5DG9A 3CO9A 2ZQBA 4KI6A 4DL5A 4MKAA 4WZQA 3ZCMA 1SUQA 2HHSA 5KFDA 3EPGA 2R8GA 4CE9A 3JSMA 5EU7A 3VQ4A 1TQLA 2WONA 3I5AA 4BWMA 4OGEA 4C8LA 3M8PA 2W9CB 3DI6B 1RTIA 4XPCA 4RW7A 3AA2A 4J2AA 4W5QA 2VG7A 4RNHA 4TY8A 3S9HA 4O3SA 4C8NA 4K50A 1S9EB 1TAUA 2VG5A 3OL9A 5J2NA 2JLEA 3CYMA 3S3OA 3F73A 4CJPA 2HMIB 4ECRA 3BJYA 1KHWA 1S1UA 3CM6A 2YNIB 3I5CA 1HNIA 4ELTA 2BGGA 3RBDA 5L1IA 1NJWA 4JS4A 2WTFA 3WNEA 5KT6A 3OHAA 3GIJA 4ECWA 3P83D 3QGIA 3I8DA 4NLXA 3VQSA 1JL1A 1S6PB 3ZT3A 4F50A 3FQLA 4TQSA 4DTUA 3DLKB 5DQHA 4OGCA 1RBSA 3RRGA 4IKAA 4ED0A 4AILC 3EYZA 2PYLA 4CFBA 4ED7A 1S1TB 3VQ8A 5JXSA 3KMQA 3CJ2A 4DG1A 1WSJA 4AHVA 3OYJA 4HUFA 3MR5A 1S1VA 4ZVHA 4BE1A 2KZZA 2ATQA 3TVKA 4Y2AA 4RW8B 2V0NA 5KFPA 1N5YA 2YHBA 4L8RB 4FW2A 4JV2A 4FCYA 5KFFA 4Q44A 1I39A 3KHGA 3ZSQA 3SUOA 3OVNA 2XY8A 4ECTA 2PY5A 4IQXA 4FYDA 3T19A 2ZE2B 3BSAA 3DDKA 2XHBA 1TVRB 5CYMA 4K8XA 3QETA 1IKXA 1IKVA 1KVBA 3V9UA 4H54A 1LW0A 3KLIB 5HBMB 2XI3A 4W5TA 2FVCA 3DMJB 4PUOA 1NHUA 1W0HA 2Z1HA 1TK0A 3NGDA 4OLAA 3LPTA 4CGFA 1SUQB 1Y97A 4DL7A 4CJUA 2QKKA 3JSMB 1IH7A 3KD1E 1YTUA 4B9VA 2WONB 4IKFA 2QV6A 5KI6A 1O1WA 5KFVA 3NH0A 3SPZA 4FJLA 4Z4EA 2UVUA 3NCIA 4Z4IA 3M8PB 5CYQB 3VQQA 2IMWP 1RTIB 3ZSWA 3NL0A 4LY7A 1U4BA 4FJ7A 4RW7B 3Q8PB 4FZXC 2VG7B 4TY8B 2IOCA 1L3TA 2VG5B 5J2NB 4RW6A 1HMVA 4F3OA 2FLNA 4URQU 3LZJA 1S1UB 2J6UA 4CGHA 3V6DA 4Z4CA 1HNIB 5KTQA 4FS2A 3QGHA 1YVFA 2IM1A 2IM2A 4FJ5A 2FLLA 3K57A 1SV5A 4B8AB 5T7BA 1Z25A 5KFIA 2HAIA 3ASMA 2O5DA 3MFIA 3SV4A 4DF4A 1KCFA 4KE5A 5C24A 4YR3A 5DG7A 2BDPA 1HJRA 3AVCA 5DGAA 4DU4A 2IAJA 3U3GA 4K4YA 4CK1A 3ZT4A 4K4UA 4E7JA 3HYFA 4JS5A 4J9MA 4E7LA 5HRRA 2RKIA 4DG1B 4B8CA 1S1VB 4AHUA 4DQSA 2R8JA 1RT7A 5KFHA 1L3SA 3AVBA 2YNFA 3HVRA 3CFPA 4I9QA 1BI4A 5FDLA 1S0OA 2AGQA 1N5YB 4E7KA 4DTRA 3NF7A 2UVVA 2FBTA 4TSXA 3C6UA 3NMAA 3EY1A 3PZPA 2E6LA 5KG4A 4KI4A 5C42A 3OL8A 3HPHA 4DFKA 3SUQA 4ZPAA 2V4QA 3PVXA 1G15A 1CXUA 5CYMB 4UQGA 4F2RA 3DLBA 1C1CA 1IKXB 1IKVB 2UUTA 5F8HA 1VRTA 1LW0B 1RA6A 4E7IA 3VQ7A 1HPZA 4Y1DA 3VA0A 2RF2A 4PUOB 4Z0UA 3KHRA 3QGGA 3HJFA 3RAQA 4ELUA 3CJ4A 3SFGA 3MR6A 3SUNA 4Z4FA 3OYEA 4AHRA 5C25A 1RT1B 5EWGA 5KRTA 2W9BA 2IM0A 2XO7A 2W8KA 2Y1IA 1J9AA 3C6TA 4N41A 3KK3A 4KTZA 2ETJA 2WHOA 4MK9A 2GV9A 2G8UA 1T94A 4CEFA 1ASWA 2X6SA 1N56A 3HHKA 2DFEA 1T03A 4NRTA 1QSLA 4C8KA 2JEJA 5CZ1A 3HXMA 4LSLA 3CJ3A 2RDJA 4RW6B 1HMVB 4IOBA 4NCGA 2AGPA 2E9ZA 4DWIA 2JC1A 4QW9A 4O3RA 4B08A 3V6DB 4NLOA 4KB1A 1C1AA 5DLFA 3QO9A 4CEAA 5KG3A 3NDKA 1SV5B 3SQ1A 1ASUA 4F3TA 2HHUA 2GUIA 1D0EA 3WNGA 3QEVA 2HHWA 4MKBA 2QK9A 5C24B 4Y2CA 4DMNA 4ICLA 3B6OA 1B92A 5FRNA 4EBEA 3T5JA 5KG5A 4J9NA 3AVIA 3N6LA 4NYZA 3RB0A 4MIBA 2IAJB 4DSLA 3N6NA 4YR2A 3CFOA 4QCLA 4O0IA 2C2RA 3GV8B 1IKYA 2RKIB 1GX5A 2D5RA 3QNOA 3PV8A 3BR9A 4CEQA 1SKSA 1RT7B 3AVHA 4MQ3A 5J2MA 2AQ4A 3G6YA 2NUBA 2YNFB 4IFVA 1KVCA 1YT3A 1BI4B 5FDLB 3KHLA 4RNOA 5DGBA 5KFXA 5KGXA 2G8WA 2J6TA 3C6UB 1FKPA 3DYAA 4B9MA 2IS3A 2B6AA 4K4TA 4CHYA 3UDLA 5C42B 3NAEA 1SH2A 1K6YA 2AX0A 2BQUA 1XWLA 3KLVA 5F9NA 1QSYA 1C1CB 3G0ZA 2W9AA 1VRTB 4XO0A 1RYRA 1HPZB 4ECVA 1RNHA 2RF2B 3SUPA 4TXSA 2OYQA 4PQUA 3GV7B 1KHVA 1JXLA 3FSIA 3C95A 4R8UA 2E6MA 3NAHA 1XR7A 4HKQA 5C25B 3I0SA 4FZZA 1VSEA 4K4XA 1IKWA 4GW6A 2B4JA 1NK7A 2W9BB 2X78A 4DEZA 5DMRA 4M42A 5EDWA 3C6TB 4W5NA 2XCAA 3KK3B 4OJRA 4XPEA 4I2PA 4J9PA 3GIMA 1YTAA 3AO1A 4KV8A 4ZPCA 3OYGA 1B9DA 4MFBA 1T03B 4N5SA 1CSJA 1S48A 4WE1A 4GC7A 4LSLB 3IG1A 3MEEA 2WRMA 1L5UA 1DTQA 2GIRA 4RNMA 4NCGB 3H59A 3L2QA 2R2UA 2D0CA 2I5JA 4R0EA 3KHHA 1EP4A 3OYNA 2HNZA 1X1PA 2F8TA 5F8JA 5HRPA 3Q8QB 4CJSA 3HPGA 4LH4A 4TYAA 2EC0A 3O3FA 3QZ7A 4ECQA 1EETA 3QO9B 1BQMA 3K5OA 5FRMA 1RT3A 1TL1A 4URSA 3NBPA 1RDRA 1ASVA 4ECZA 2D3ZA 4NYNA 4H4MA 2R2RA 4ICLB 2OPRA 4O44A 3QZ8A 2G8FA 3DLGA 3ZSZA 4KHWA 4M95A 4FK2A 4CIFA 2D0AA 4CIEA 3V9SA 3LANA 1XHXA 4FJHA 3VQDA 2EHGA 3LP1A 4CECA 1IKYB 3T5KA 1NJZA 5L1LA 4IFYA 1J5OA 1GOAA 5J2MB 1NKEA 4IFVB 1QAIA 4W5RA 1N6QA 3V9ZA 3RR8A 3CJ5A 1FKPB 3DYAB 1WN7A 1KRPA 3KIOA 3H98A 2B6AB 4OPJA 3AA3A 1U04A 3P1GA 4DL2A 1K1SA 1HRHA 4IRCA 5J2QA 5FROA 3GIKA 2ASLA 3HVAA 3RTVA 4WYWA 5CYQA 2G8KA 3DRPA 4OKKA 3IN5A 4EO6A 4FS1A 1SKRA 2AX1A 3AO2A 3AVLA 3T3FA 2HWIA 4FJMA 5KFAA 4PQUB 3HKWA 4R8UB 1HYVA 3L2WA 2J6SA 2BANA 1S9GA 2WCXA 4FJ9A 4H4OB 3I0SB 4CFCA 1RTJA 5KRSA 4O3NA 1IKWB 2OPSA 4FLUA 5KT3A 2G8VA 3N6MA 1U45A 5DG8A 4Q8EA 2WOMA 3D0PA 1EXQA 4I2PB 3TARA 4CGJA 1RBUA 1RCHA 4KV8B 1A5XA 3KKRA 4NZ0A 3LP0A 4FK0A 4MFBB 4G1QA 1C0TA 3QLHA 3CG7A 4CERA 3PX4A 4B9NA 4WE1B 5KGWA 3OYHA 1HYSA 4JUZA 2YNHA 3IG1B 3MEEB 1DTQB 3FRZA 2C2EA 2I5JB 2HNDA 1EP4B 4JRQA 3H4DA 2HNZB 1DTTA 4CJFA 3M8RA 3AO4A 4YR0A 1X9MA 1D1UA 1EETB 1BQMB 2CJQA 1QAJA 3L8BA 1RT3B 1TL1B 4DTOA 4Q0BA 1QS4A 1Z4UA 3NGIA 3NBPB 4EYHB 3LAMA 4BDZA 1S0NA 4ZVEA 3K5MA 2QKBA 5KFJA 1VSIA 4H4MB 4CEOA 1QTMA 2WB4A 2OPRB 4O44B 1L3VA 5KFTA 3SQ2A 3DLGB 1NKBA 1T8EA 4DFPA 4JV0A 1NHVA 1CLQA 3PR5B 3RAXA 1Z26A 4DTMA 1RT2A 3M9MB 3LP1B 2IJNA 4IBNA 4QPXA 4I2QA 5CY4A 4IFYB 1J5OB 2OPQA 4M94A 2G8IA 3QEWA 5KT7A 4BE0A 3TQ1A 2ASDA 1RDCA 3AVNA 2HWHA 1JLCA 4ED6A 2FC0A 3TAQA 1N6QB 4CIGA 4IRDA 4IH5A 5J1EA 4CJRA 1Q9YA 3BQ2A 1X9SA 4RUCA 1WSGA 4O3PA 1RT1A 4DTNA 3QINA 4KHYA 4NLQA 1S97A 5J2QB 2BRLA 4CHPA 5F8IA 4RNNA 3FFIB 3GYNA
chains in the Genus database with same CATH superfamily
1GLLO 4DSJA 5AQZA 2QMUB 3NKYA 2RH3A 2I1RA 4KPYA 3K58A 1YITS 1RBTA 3DRPB 1DQAA 4TU7A 4NYPA 4H0XB 4Y00A 1ZC6A 2UUWA 4H0TB 4CRJA 4PG7A 5F3ZA 3WX4A 3JSBA 5GAHI 3PW7A 1H6KX 1FJCA 3TOQA 2N3OA 5AZIA 5AQRA 4RUAA 2VBZA 4ZVGA 4U6PA 2E2PA 3C3LA 2D74B 4DLEA 2KTQA 4ZP9A 4JNEA 4DHVA 1R0AA 4UZCA 3MEGA 3V1RA 4BC4A 4ZPVR 4BVPA 1S7HA 3VQCA 1ZBSA 2E5GA 2XHWA 4NA1A 3R5GA 2HVIA 4LFBJ 2ITGA 1YVUA 5C2GA 4M3YA 4N47A 4J2DA 1WF2A 1H7WA 3SMSA 1HNXK 2AP6A 4Z2XA 3ILIA 3GV5B 2RJZA 4DU7A 2NUHA 3QJLA 3D2FB 2HNDB 2YPZA 2Q36A 1DTTB 3QAEA 3KK1A 1VQ9N 4CLSA 4RWTA 4DX8H 4BQZA 4UT4A 3LZIA 2C3PA 5BREA 1P27B 2PMZD 2CQHA 3VGTA 1CQMA 3CQ8A 3ITHA 4CO0A 4B02A 3VQPA 3D1HA 3EGZA 1R0CB 2ZH8A 2QMWA 4OYPA 4LT6A 4U7UD 4X65J 2CDRB 3VAJA 2FGCA 5DM7Q 1YXQA 1RT2B 2QFIA 3GCWP 1AXQA 2LU2A 1V3ZA 1ZBUA 1OYEA 2G2YA 1CXQA 5GIOA 1GFWB 5I3PA 1CJTA 1XNRF 4HUEA 1S49A 3W60A 4DV2F 4QWAA 1CULB 5AQHA 4JEPA 2OH2A 2YH0A 3A8YA 4IJNA 5GADU 3L4IA 4E1JA 4ECSA 3MPWA 1HKCA 1WSHA 1W2IA 1U0HB 1DAXA 5IT9U 3PW4A 2AKWB 3FCVA 3Q89A 3EN9A 2O8DB 1NDLA 1SKUB 2MKIA 4XIUA 1WORA 1S79A 3TNVA 3KK2B 2VU5A 2B5JB 4EEYA 3HBTA 2QM1A 2UV8G 4LF9F 1U09A 3RBXA 1DQ9A 3OR1A 3VAIA 5KFRA 4Y6IA 3DM2B 2Z58B 1SKWA 1NAQA 1SH0A 4A61A 3VALA 3HSCA 4AL7A 2KYXA 3OXGA 5KG2A 3DGVA 4DR2K 2A5XA 2PFDA 3GR1A 2M8DB 5KFGA 1VSFA 1RDUA 1NZAA 1A5VA 2DNGA 1TV6B 3M8QA 3A2FA 3VAMA 3CJTA 1SJ1A 3CFRA 4YQWA 4JI3J 2OCEA 3IDHA 4HTUA 2ZZNA 5DM6Q 1JLAB 3OVAA 4W5OA 2DO4A 1NBWA 5HVHA 3PR4A 1MMDA 1BU6O 1AUDA 2M70A 5B09A 2OAUA 3T6BA 4E7HA 4ZKAA 2BRKA 1IBKK 3K7RA 2YI1A 3A8EA 3ZX3A 4E1NA 4KGKA 4ZOSA 3M1VA 2QLJB 5AT1B 3AVMA 4EAHD 1A5WA 1MROA 2HAFA 1KLNA 4V19J 2M4MA 1TP7A 1HLUA 2CPXA 2V52B 4KFBA 2W2NP 4ZVUB 3CCLS 3BGUA 4CJVA 1HFEL 5ADZA 2AYGA 3IBFB 2D3UA 4NLTA 2XLJA 4GO5X 3U3YA 3OTDA 1XMOJ 4NLPA 3ZSVA 2ASYA 4CJWA 3BGRB 4X66J 3UD4P 4WP3A 3GBTA 3RZAA 1XNQF 5JS1A 2HNYA 4I64A 5AJ3J 3S3NA 1NOYA 4FNIA 4PWDA 4ZVQB 3R9LA 2E44A 4YDXA 4ISGA 5ETNA 3HT0A 3OBWA 4CLWA 1CVJA 5LMUK 3TUJC 4HDGA 3SAFA 3O8WA 4KHPF 4O8UA 2FBYA 5IT9Y 2KW4A 3EUNA 4RTFD 3CC4S 4BRMA 1CJVB 2VBWA 2X1AA 3BN4A 4BHQA 4Q5VA 3CCVS 4PG5A 4PKIA 4HHHA 3E3XA 4DR7K 1QLNA 3D54A 1HQUA 4HHJA 3HZEA 2ZBPA 3C94A 4RW4A 3PIPL 2ZDOA 1VQLS 2F8EX 1NMNA 3BUZB 4LF2A 2VHGA 1VQSA 2M2BA 3E01B 3I6PA 4YFUA 4EYIB 1VCTA 3OYFA 2DNPA 2PFUA 1HNXJ 1EHWA 3G2XA 4FJ8A 3QEIA 2VC0A 3ZTOA 2PO4A 2BQ3A 1LWFB 1MLAA 3AA5X 3HHEA 1TMJA 1RTHA 2AJ4A 5K20B 4ZDNA 2F65A 3GMGA 1LWCA 4CF9A 2C28A 1QUPA 4EP5A 1T05A 2MDAA 1YJUA 2RE2A 2FJWA 1BQNB 5CA5A 2ZWPA 5JICA 3X3UA 3QRPA 4ZP6A 1VRUB 1Y11A 5I42A 4C8MA 5I3QA 5D3GB 1AFIA 5LJWA 1FTCA 1REVA 1DRZA 3SCLE 3OTOF 4AYBD 4PY5A 5KG1A 5D4PA 2Q6BA 1JLBB 4ZHRB 1G3OA 5D6GA 1FCAA 1FTRA 4CTAA 4CFDA 3M32B 2GIQA 3BF4A 3M2UA 1FKAF 3QJJA 4ED2A 5L9NA 2FGOA 3SQGA 4MLEA 4FLYA 3THYA 2KHCA 1FXXA 2M7SA 2XY5A 5FLXO 2GX8A 3QB0A 1XC3A 2Y0BB 3ETMA 3AY0A 3OSNA 1HHSA 3ZNUA 1OH6A 2AHOB 1FWKA 5KT4A 3SYZA 4CJ3A 3O3GA 4DU8A 1X0PA 8AT1B 4ZTJA 2FZCB 3HFKA 2W01A 4WJBA 3I0RB 5D4NA 4O23A 2DJWA 4BR9A 2AJ2A 4A8SA 5HVGA 2O8FB 1NO8A 4JI5F 3AJ2A 3T1HF 3OYAA 3U6FA 1DQ8A 1JLEA 2GWJA 3VVTA 2EK6A 3BDPA 2UU9K 2D7SA 4A5AA 1YSJA 1HNWF 2P5VA 2A6AA 3TW0A 3DLHA 5HROB 3W2VB 1FRJA 5LXYA 1WWHA 3R7NB 2XCPA 2RNEA 4WTOB 3CJ9A 4LF5F 4FLTA 2G1DA 3N4WA 2PD1A 2FVPA 4FBUA 2J9DE 3TU5A 3T5LA 4OI0A 2R7YA 3OUYA 2ALZA 3O4NA 5J2PA 3IBCB 4FVUA 5D0GA 2FSKA 2IC3A 1LAWA 2UUCK 1N36F 5ADXA 3WXKA 1KQSM 4X2BA 2HHTA 4P74A 1IBKJ 5B8HA 2P1JA 2CG4A 2FJXA 2F1FA 2DGXA 2PMHA 4U67Q 3KJVB 3T41A 4JI8F 3DOMA 1IQTA 1YJ7A 2V4JB 4GNIA 1SI9A 1M90T 3V6JA 4F04B 2MKYA 1SIWB 4N56A 4LRDA 3DRXA 4DV6F 1WC4A 2RUGA 1RA7A 3UW1A 4O4GA 4R0JA 2OPPB 4FWKA 1RT5A 2IYIA 3D7EO 1S5ZA 2C2DA 3DLJA 4N8OA 3DLEB 3AAWB 2CQGA 3CCTA 3G71S 4G65A 3GG0A 1B4SA 3PW5A 4CZLA 4Y34A 4DL4A 1RU2A 1WI8A 4ATNA 1BO5O 5LMUJ 4KHMA 3B6BA 2YJEA 3GJRB 1M90O 1K0VA 1ITGA 2V2VA 3RWUA 2RDIA 3HP9A 3ULDA 5E3QA 2EWHA 3TR5A 5AQIA 4KKOB 2KL8A 2C42A 1LWEA 4OZNA 3TEGA 4F4XA 3AVKA 4DR7J 4LMZA 4WFZA 2LECA 3K0SA 4IO9L 1RWNB 4CEBA 4JK7A 3ZX0A 1OPZA 2IHR1 4U9RA 4LD0A 2R2SA 2A3JA 4JBCA 3L9ZA 1Q78A 4ID1A 4M3WA 4CO5A 3V4IA 4OHYA 3LP2A 3FSYA 4JI2F 3AVGA 4A2BA 3VGVA 2P5GA 1CQNA 1S1XB 4FZYA 5IV4A 3ZSXA 2JWNA 4IG3B 3PYDA 2QTWA 3OXLA 1I94F 3EE8A 3AGRA 5L9XA 2OUGA 3LOUA 3E9LA 2OEMA 3M5RA 4TNOA 4FXDA 5B0BA 2RMLA 4IOAL 4FWSA 2ZH5A 4P72A 1R0BG 3SAHA 3BY5A 2UVWA 1NGHA 4DR6K 4K4WA 1SJ4P 3KG4A 5C0YA 5D78A 4CZGA 4OLOA 3JAMY 2Y9HA 3V9XA 2P9PB 1RDWX 1YDLA 4RPFA 2V34A 4YS2A 3TAPA 3R3LA 3BSOA 1UA1A 3PHTA 3R5AA 3BGLA 3H45C 3HTVA 4B1UB 3ZEUA 4DV1J 1XHZA 1SL0A 1EKSA 1NH7A 3RBZA 2YHXA 3D3CJ 4AL5A 4H4KC 4QJVA 4A5BA 1HQEA 2FVSA 3FUYA 3JQMA 4YB7A 1MWYA 2VUGA 2NPFA 3G6EN 1HQ2A 4DR4K 1VQ4S 3H3OB 4FJGA 4QS9A 1DJ0A 3WXLA 3BEXA 1JLFB 2QL5B 3Q23A 1UZHA 2V6AA 4C0OC 3E9PA 3RB4A 4OHWA 2BKOA 4F0HA 1ZM9A 4RBVA 1HYZA 1NCLA 2ZZTA 1XI1A 2V7ZA 1N5TA 1WSFA 1IR1A 4GKJK 3LQVA 3NNCA 3MXIA 4C8OA 3M2VA 3EE9A 4ID5A 2MKCA 2ROEA 2AMCB 1KN6A 1QQOA 5EN1A 1Q18A 3SJJA 5HK4A 1QAYA 5GAHU 4QZVB 2QXLA 4DQQA 4Q45A 2YKMB 3MEDB 1SC3B 4DHYA 3WC2A 3VZHA 1QE1A 3QPIA 1KQSR 3CIZA 4M45A 1X5OA 3DRSB 2AA4A 4CIOA 2F8SA 1UJ6A 1PCAA 4IDKB 1IBLF 1LCUA 2GZOA 1HD1A 2DR5A 3L7OA 3D3BJ 3EDRB 3THTA 4H5WA 3FZ2A 1FFWB 2H1YA 2W2MP 2UU9J 4ED3A 4USIA 4BR2A 4DUTA 2QYCA 4TU9A 2UXCJ 1C1BB 2MZQA 2ZEJA 4ISEA 4ETXA 1S4FA 3LPUA 2VODA 5HL7L 3RUBL 3MMJA 4E0DA 3K2YA 3D67A 1H72C 1NPRA 1IBMJ 1HBUA 2XY7A 4O3OA 5FPNA 3H08A 3DI6A 3KDNA 2UUCJ 5IS2A 3BQ0A 2ROGA 4FWOA 3D1OA 1JCFA 1VQYA 3VGUA 1ATRA 4OI3A 5KG7A 2LU1A 4OZ5A 1TGOA 4FJXA 2VKZG 2WK4A 3VF2A 3TWZA 3G82B 3OFGA 1OPIA 2UXDJ 3OHBA 2C2NA 3UE2A 2W25A 3G4SN 1UVKA 1U6ZA 4BRPA 2C3MA 3TAGA 1FESA 1H0HB 4J2EA 4YOYA 3OL7A 2KJWA 5IT9O 3KLEB 1LXNA 5BYQA 2MSTA 1NK6A 1Y10A 1FE4A 1N8RT 2JH3A 4CBXA 3DLKA 2KN4A 1YG0A 2E9RX 4X4RA 1UJ5A 1NJXA 1ZOTA 2QTDA 3K17A 4C8YA 1ZBIA 1S1TA 3KWIA 2MZTA 1RDDA 2HFVA 3O9UA 1F2HA 4CP5A 4CLPA 2H48B 5F9LA 2VQFK 4KT0C 1QUVA 4PZVA 2UUBF 1KFDA 1VQ7N 3PYEA 4RW8A 3SSQA 4XH1A 1IN0A 3U8XA 4NASA 2F96A 2F9TA 4BCAA 4ZVSB 3VQ9A 4AUKA 3AB4B 2XQCA 1KVAA 1N8RO 2A1SA 1RHUB 3FMBA 4CZMA 1I1GA 2Z2MA 3CCWA 4DFJA 2E88A 2GC8A 1IQZA 4DCPB 1GOBA 4CYUA 1BWEA 3OT9A 3UB5A 5CZXA 1QHTA 4ZPDA 5AQXA 2ZQBA 4KI6A 2WAQD 2P9EA 4IXCA 1T6DA 1FEEA 4B3RF 2CQ0A 1BA0A 5KFDA 4CE9A 3ELHA 4YB5A 1ZA1B 1CG2A 2NRZA 1TQLA 3WEEA 3I5AA 2MLXA 1BWFO 2R7RA 3VOVA 4AD6A 2RQ4A 2W9CB 4XPCA 1FHTA 3GTYX 4RNHA 3TX0A 2P6TA 1H38A 4GKKF 1FRKA 4K50A 3EO3A 2VG5A 1VISA 2CQBA 3L4QA 4DV7K 1HBMA 1BHNA 1UAWA 3S3OA 5BR8J 4JI7J 2CQIA 2VH7A 4ECRA 1KC8T 1KHWA 3EMTA 3I5CA 3ZZUA 3CMAS 3RBDA 5L1IA 2GX9A 4UTGA 1NJWA 5J1PA 4AXIA 2WTFA 2UUAK 3GIJA 2UZAA 3P83D 4LRCA 3QGIA 4OI6A 3SSSA 4KYZA 4J8FA 3K0JA 5DDPC 5DQHA 2HQGA 2KVIA 4NXMF 2BM1A 2OO4A 3HJVA 1S77D 3PRBA 2PYLA 2CAJA 3CGIA 4ED7A 3OVSA 2LEBA 2B4UA 3KMQA 4BVOA 4DG1A 4ZJOA 4AHVA 4BRIA 3FRYA 4BE1A 1KC8O 3VF0B 2CRLA 2E5IA 3TVKA 2V0NA 1FDAA 3HSGA 1N5YA 1NUEA 3VV2B 4GKJJ 4FCYA 4Q44A 4KR0B 3OVNA 5GMEA 2CNLB 3C0BA 4G1IA 3HZGA 3MM9B 2BJ7A 1KWMA 3QETA 2ZJRQ 9RUBA 3ZX2A 3RJMB 2XI3A 3KLIB 5HBMB 1TR0A 4PYDA 3H3NO 3S01A 3U1NA 1HPMA 1SJFA 4ETZA 5GAGP 2LQ8A 3UDEA 2BV3A 2KYZA 1NZ8A 1RABB 4RWXA 3OFFA 2CQCA 2ZJPL 3HOSA 1YTUA 2WONB 3FSXA 4DPXA 1QY7A 5KI6A 1S0VA 3SPZA 2KKZA 4CZIA 3UCZP 1X4GA 3S41A 3M8PB 3C2PA 3VQQA 3FBEA 3ZSWA 1U4BA 1VR6A 2JWLA 4FZXC 2VG7B 3TRGA 4TY8B 3MN5A 2I38A 3BS9A 2BKPA 5CD4A 1FRMA 1QAXA 1YITN 1WG4A 3SEOA 5J2NB 1U2FA 2ZUGA 1B99A 1NG9A 1HMVA 4DX6A 4URQU 2J6UA 4CGHA 3GE1A 2OTLS 5IT4A 5E2QA 1FERA 4MDBA 3K57A 3NVKA 2HAIA 3AOAA 2O5DA 4BQLA 3SBGA 4OIXA 4YR3A 5ETSA 5DG7A 4BY9C 4USHA 1VQKS 2IAJA 4K4YA 3I96A 4E7JA 3HYFA 3GWCA 3UDVA 3MM7B 3VF6A 5HRRA 1DHMA 4YDDB 1S1VB 1FJGJ 4AHUA 3CIMA 1RT7A 3AVBA 3WZ0A 3ULEA 4I9QA 1BI4A 5FDLA 2P9UB 3FNNA 3DLLQ 2AGQA 4DTRA 3VEOA 5K8PA 2E6LA 2HBYB 4WCEQ 1CBKA 1NPKA 3OL8A 5CCLA 4Y2MA 3MPYA 4C97A 4AQYF 3SUQA 1HI8A 1U6BA 5CYMB 2VJVA 3I56N 1C1CA 1IKVB 5F0UA 3DFEA 3CMES 1K44A 5AFUA 3VQ7A 1RHRB 4FPBA 5GIPA 4H5TA 3KHRA 2W4DA 4MAKA 4EMDA 1SQGA 1HBOB 4DPYA 2GVZB 4JV5J 4OI2A 4GVBB 5C25A 1RT1B 1N32J 1AROP 1GXLA 4ERDA 2WW4A 2WHOA 3CJRA 1RCOB 2QWMA 4NLCA 2G8UA 3O1WA 1T94A 1N0UA 4CEFA 4JI4F 3ET6A 2ADCA 1WKKA 3LUYA 2Y3YA 4NRTA 1QSLA 1OVYA 4OMFG 4CD1A 1FVQA 5A8WA 2D1KA 1AUSL 2NS1B 1RWXB 4B3TK 4DUZF 4RW6B 4DWIA 3FFKB 2YWKA 2G4BA 1NGCA 1KTVA 1VDHA 4NLOA 2RILA 3I9V9 3OR2A 1FI4A 4CEAA 4PKGA 3NDKA 1SV5B 4MO4A 4LF8F 2UUAJ 3G8QA 2NXCA 2WTUA 2HHWA 3SSRA 1T95A 1YQHA 5AXMA 2YHYA 3ZTSA 5C24B 4R79A 1KVIA 2KG0A 1B92A 4K42A 3N6LA 3MZIA 1UWAA 4MIBA 2CNKB 2OMLA 4YR2A 3T1YF 1M5HA 5AQWA 3M05A 5M2PA 2VQEK 4FWQA 2RKIB 4C3KA 2D5RA 3T7ZA 2CQ3A 2FB0A 5J2MA 4A8KA 2NUBA 2VZ9A 4IFVA 4YOWA 1YT3A 2YXLA 3KHLA 1X8DA 5KFXA 2G1HA 4TLQA 1ESVA 4B9MA 4NLBA 3FBCA 2HGNA 2IS3A 4K4TA 1F1BB 3UDLA 4OZLA 3NAEA 2VPZB 4O0NA 2B8QA 3KLVA 5F9NA 3Q0AA 2MGZB 2EBGA 4XO0A 3E1YA 3NMUA 4USKA 1HPZB 4ECVA 1EB0A 2RF2B 2NXJA 5BXIA 3CCLN 3CCRS 2FF3B 3R1XA 1JXLA 5D4OA 3QFUA 4EK2A 1LNQA 2F4VK 4HKQA 4G6VB 5AQUA 5JMVA 4NA2A 4DUYJ 1H98A 4KY3A 1VBXA 3AH6A 3QICA 3C6TB 2XCAA 3KK3B 3HI9A 4OO1J 3EXCX 3AODA 1R8CA 4ZPCA 1J5EF 1T03B 2QGFB 2NRVA 1CSJA 4EGLA 1IR2A 2MHNA 1OQ6A 2YWWA 1DTQA 2GIRA 4ANCA 3H59A 3TTDA 4FO0A 2L9WA 2VPXB 3CC4N 5F8JA 3Q8QB 4CJSA 3HPGA 4HTIA 4LH4A 4TYAA 2OKQA 3PKMA 2N4CA 2BMBA 3CXCM 1D09B 1UVMA 3O3LA 3QO9B 3VEXA 1BQMA 1JB0C 3WDOA 5FRMA 2QW9A 1Y3KA 3HULA 1WF0A 3NBPA 4LC9B 3T9ZA 4ECZA 2WBRA 1N33J 2A0FB 2NLWA 2D3ZA 4NYNA 3I33A 4QPTA 1T0TV 2RRBA 3DLGA 4NA3A 2EEYA 4NE9C 3J7AP 3BH6B 2D0AA 3V9SA 4FJHA 3VQDA 3R7BB 4CECA 4FF3A 4M5KA 1NJZA 3GFZA 4USMA 1GOAA 3CW2C 4XDDA 1GLJO 1YJWS 3FBFA 4C6AA 1T11A 3RR8A 4LFAF 3M8ZA 1QVGR 4K0KJ 1FKPB 2RS2A 3DYAB 2W24A 3VEWA 3H98A 2DNRA 1A7GE 2EK1A 2CVEA 3RRKA 4HLBA 3VAFA 3IUCA 1HRHA 5AQMA 1RADB 4IRCA 3LPEA 2B51A 2EXUA 4N8NA 3OBYA 2YX7A 3DXMB 4BROA 3IN5A 2RHSB 2OELA 4FS1A 4DZDA 2XBPA 2XMAA 2HRUA 1D8ZA 2HWIA 4N7TA 4FJMA 4PQUB 3HKWA 4NX9A 4PKHA 2HBKA 2NR0A 1HYVA 2DEJA 4OJHA 3NNHA 2NREA 2CPHA 1S9GA 2DXDA 4C7QA 3I0SB 2NRWA 2P9LA 1YBAA 1RTJA 2CA9A 1X4DA 1HLWA 1LK7A 4A4JA 2G8VA 1U45A 3H1QA 3A8KA 2WOMA 2XEXA 2BABA 1EX8A 2I8EA 1RBUA 4KV8B 1A5XA 1E4GT 3KKRA 1B64A 4FWMA 4U7UK 4OV6A 3G25A 4OYMA 3KDOA 4WU3A 1O8BA 3IG1B 3FRZA 2CQ2A 3QMQA 4WF9Q 4ZVPB 2AF6A 1M0SA 2BJ9A 3H4DA 3I82A 4CJFA 3MMCB 4P73A 3EX7B 4Z94A 5DDQC 1X9MA 2B9XA 1P8GA 3F44A 1QAJA 2QFJA 2QWLA 1ZXOA 1QS4A 3NGIA 4PXEA 4LREA 1KQKA 1VJQA 5MLCQ 1S0NA 2QKBA 5KFJA 3NGUA 2P9NB 1HKGA 4X62F 4IJAA 5DZ7A 1OKJA 5K5MA 2VOOA 2OPRB 4O44B 1L3VA 2CZ9A 3ILJA 3SQ2A 1XNRK 1T8EA 4JV0A 2Q0UA 1TYQA 4DV2K 2BBEA 3PR5B 5GAEP 4PL8A 2VQEJ 3LP1B 2IJNA 4C8ZA 4QPXA 4I2QA 3CHWA 5CY4A 2OPQA 4A48A 4JP8A 3HZ6A 3IFEA 3ILLA 5KT7A 2MZ1A 1WC0A 2HWHA 1QQNA 2FC0A 1N6QB 4P2SA 5J1EA 3OQ2A 1D4XA 4JKBA 4ZLNA 3MM5A 3TA0A 4RUCA 1WSGA 3EVWA 3DU5A 2VGMA 3L95X 1Q82T 5LSOA 3PKYA 4LF9K 5J2QB 1UPMB 1WEZA 2BRLA 4CHPA 2E20A 3FFIB 4JYAF 3UVJB 3ZETA 3V6KA 5AQLA 1R8AA 4A8XA 1HR0J 1JLQA 1LQ9A 3WQPA 1EQYA 2WVEA 1RAAB 3CJ0A 3LH2S 3FR0A 1FFSB 1REGX 5LOQA 3OFEA 3QNNA 2XMKA 4K8ZA 3CXCR 2HKEA 5DLGA 2EG2A 3PRDA 4OZ2A 1VSKA 4JKHA 1SQEA 4NZ6A 3LW5C 3VA3A 3FVYA 3TUZC 2R7WA 2P9SA 4YNQA 5C2DA 4KC5A 1Q82O 3M3ZA 1JXBA 3G71N 3O80A 5BYSA 3OBIA 1SXLA 2LSNA 2D41A 3TZYA 1E3MA 2KVQE 3P4IA 4QWBA 1ATNA 2DGQA 1RE1B 4G1QB 3QLHB 4LJMA 4ER8A 2K1RB 4HVJA 4CHNA 4IH6A 1HYSB 4CNYA 3I55N 3MAAA 1VMBA 5EWFA 5LMNF 2HQDA 3SMPA 2WBNA 4F4ZA 1TKTA 5AQFA 4NYFA 2P9IB 3MUTP 1Z2ZA 2Z1JA 5C2FA 4K4ZA 1MSWD 3VGKA 2XMWA 3NOGA 4NXNF 3DC2A 2HZVA 3VQTA 3IGNA 5LL6d 2K8GA 2MKHA 2E4LA 2YTCA 1GNKA 3JTOA 2ZBCA 4Q2MA 4WFAQ 3J81U 1TZ0A 1MN9A 5MLCV 4LRFA 4ED5A 1XNQK 3ZZPA 4AL6A 4KTWA 4X4VA 2DT9A 2XB2D 5ETRA 3LDNA 4USTA 4ANEA 4FWNA 1HWKA 3V9WA 1RDBA 3G10A 1G6BA 2WSEC 5HP1A 3HO1A 4KREA 3F0NA 4Q8FA 2ACYA 3NH2A 1TTHB 4Q43A 1VGYA 4KHPK 4FLVA 4NI2A 1HNVA 1S10A 1EZZB 1PKUA 4ZN3A 5CD4H 3DU6A 1VC6A 3DOLA 3IRWP 3MCOA 3PJ9A 2I7NA 3TR8A 2FHKA 5C5JA 2V2ZA 3EGWB 4XTTA 1APSA 1TFYA 5IWAJ 5JS2A 4IG0A 3HSZA 2W8LA 2ASMA 4ZCMA 1IJEB 4EFHA 3BGFA 1DLOA 3L09A 1BQXA 1NGDA 2YH1A 1BWVA 2CPIA 5AZIB 2HBLA 1M1HA 2M52A 1XMQF 2YWEA 3OYIA 3F9KA 2ZH7A 4ISFA 4F67A 3K59A 1R0AB 3MEGB 4FNHA 4NLYA 1VQ4N 3VTIA 3O08A 5KFKA 5BPNA 3ZLJA 2QWPA 5KFZA 1F9FA 3SCKE 1XIQA 2E1MC 3QEPA 3WIVA 4C11A 3TAMA 4LF4F 3R7SB 2CJYB 3UR0A 2DGSA 3QWPA 2DITA 4I4BA 3SBTA 2E1PA 2V8VA 1X4HA 1C0UA 5T7LA 3G86A 4FM0A 3KK1B 3PHEA 1C0MA 1ZS6A 1WOSA 3MMAA 1XC9A 2E1YA 4L6V3 4ECYA 2PYJA 4F7VA 4KHNA 1SH3A 3ITHB 2UXBJ 4DSEA 4B9LA 4QWEA 3OTOK 3IGVA 1FNXH 2X1GA 3TYTA 4CGGA 1XNRJ 4BDPA 4I6MA 2E7VA 1VHFA 2RHKA 1RHMB 1WUAA 4E19A 1S4EA 2BM0A 2GQQA 3WHIA 3MCNA 3I4PA 3B6PA 2Q3SA 2V4RA 2XZWA 5KT2A 4V19X 1CJTB 2DYAA 3X1LB 2KQ2A 2OZMA 1UOCA 4FM2A 1RI7A 4JKDA 2XWYA 1KP6A 1K0TA 1XQIA 4RU9A 2HVDA 5D77A 3W5ZA 3NGZA 2D69A 1BCOA 2BE2A 3CF5L 3H2LA 2HBQB 2H3GX 4KHSA 3OLBA 1RDAA 1QZ5A 8ATCB 1BCMA 1R89A 4O55A 3NGYA 3BSCA 4QOZB 1RTZA 3V81A 5C10A 5B0EA 4H5VA 4JI5K 3T1HK 3H90A 3V5RA 1RBRA 2IVYA 3OR1B 1RJJA 4B3SF 4F4WA 2O3DA 4RBTA 3QT6A 4ZVTB 3IC1A 1HNWK 4B1VA 1KTQA 1P9QC 1AB8A 2NYIA 2E5LF 4DR1F 4OZ0A 4K59A 2DPJA 4NCBA 3RMAA 1YZ6A 4LF5K 4JKEA 4I7FA 2N4DA 4QR2A 1RCXB 4DCJB 2GELA 3CEDA 3M8QB 3US5A 2YHWA 3L6QA 1AT1B 2Q79A 3LF0A 4K7QA 1N36K 1HL6A 3MEKA 3V6HA 4WFYA 4PYAA 2XNRA 3VWSA 2VICA 2C22A 1WB9A 4IOCL 4JI0F 4C98A 2HIYA 4DX7A 1B0PA 3B4MA 2FVQA 2QIFA 4NMLA 3M1FA 5KT5A 4JI8K 2DFHA 3P45B 2Y1LB 4XK8C 5RUBA 3EEQA 1CPZA 3Q8UA 2A6OA 3ETOA 3CDBA 3GG1A 1FWLA 1NDCA 4PG6A 4DV6K 3M1VB 2DPNA 3C6HA 1MROB 4JN4A 2CJBA 4KFBB 1GQEA 4X84A 4C1NK 1CJUA 5HOOA 2PA3A 3EZWA 4LR9A 2G8HA 1YK9A 1RWVB 2JOQA 1U49A 4WFXA 2A40A 4YB6A 1PJ7A 1QTNB 2IDEA 2VC1A 2HNYB 4FBTA 2YQ1A 4KHPJ 5CZ2A 4DV5F 4EP4A 2BOAA 4OL8A 4PWDB 4CK3A 3EKUA 3KTQA 2GAGC 1TU0B 5EX3A 4DZ6A 2M3DA 1EARA 4KBIA 4ZPWR 2N7YA 4CGIA 3C14A 5AQTA 3L3UA 5CZVA 4C0BA 1N34F 3H20A 2OHDA 3CMAN 3N4QA 4YORA 4I67A 1Q9XA 4P71A 1SBRA 3NGRA 4ZCKA 4CF8A 4WFNL 3WQUA 2RSQA 4OHZA 1SZ2A 4GMJB 1KXPA 4PABA 3BKUA 4TQRA 1ATSA 4JI2K 1HQUB 1T9UA 3J80U 3TABA 2HQIA 1F9HA 2XC9A 3P3DA 4RW4B 1LFWA 4EFAC 3H5XA 1OH8A 3L7UA 5FPEA 1VQMN 2DRAA 3HSTB 2PDAA 1I94K 1S6QA 2QC3A 2XS2A 4LSZB 2BZ2A 1RWOB 2JEFA 5GADI 2AWZA 1JK9B 1BHLA 1BISA 1SL2A 3FE1A 1K1QA 1ILYA 3U27A 4DN9A 2DHHA 1M5OC 3O1BA 4XEIA 1KD1T 2DHXA 1AZSA 1RTHB 3A5OC 1UA0A 3CPEA 2Z2ZA 2ZZMA 1LWCB 4J9SA 1T05B 5AR0A 4WZMA 5ETQA 4EZ6A 2IMOA 1SQKA 2IIHA 3L2VA 1U0HA 4CO3A 2JWKA 2ZH3A 1W7AA 2I0XA 5CAAA 3H8YA 3ZSYA 1J27A 4IUFA 5M2UA 5I42B 3CM5A 2G9OA 2LMIA 4KO0A 3NG8A 5EXWA 3MX5A 5D0EA 5MAOA 3OJUA 5BPLA 1ZYQA 1REVB 3A5MC 3TAFA 3DNCA 4NLWA 4CTAB 3AA9A 3NY0A 4FVCA 4KGMA 4MIWA 3M2UB 3VPZA 1RXOB 4LFCJ 3SLCA 3QIPA 3H40A 2AGOA 3LTOA 3GZ7A 3SQGB 3B78A 2CWKA 5LSLA 3VHQA 2EKYA 3QDKA 3THYB 5HRNA 3RB3A 1V3SA 2XYPB 4ID8A 3AO3A 4PAAA 1NK9A 4M41A 2KB2A 4MK7A 4CZFA 1FX4A 3VMFB 1RQ0A 9ATCB 2OTLN 1ITPA 4B3OA 2J9EA 4BE2A 2HHHF 5A0YA 1Y0HA 1RISA 3HVWA 1IBLK 3TVYA 2E1ZA 1ROFA 4PRFA 4PWWA 1HNWJ 4XDCA 2UVRA 4DMZA 4J5OA 2LQ5A 4R5PA 4JI3F 2HQCA 1VQKN 3MAQA 3PDNA 2CJ9A 4PPZA 2HZAA 3AV9A 4F36A 2R3VA 2DY1A 2HIQA 4FKYA 3MF5A 3PX6A 1JLEB 1T3NA 5BYRA 2PIIA 1SVDA 3THWA 1T7PA 2YKNA 4FW1A 2YX6A 3D6TB 3LO3A 4JB8B 2X74A 5FIIA 4J9QA 1T9VA 5HSPA 2YCHA 1W9HA 4QR0A 2PEBA 4ED4A 4J9RA 3MI7X 3PG9A 4WFBQ 1T9XA 3OUYB 3MXMA 3MN6A 5J2PB 1RAFB 2IC3B 1UFWA 2RPIA 3DGPA 3NAIA 4DQPA 5KFWA 2M5YA 5KFUA 1K73T 2MQPA 2GS8A 3MR7A 4QIVA 2J8AA 3F56A 4DV6J 1G99A 5F8NA 2IJRA 3O9QA 1OY8A 3W63A 4Y65A 4ELVA 3DOMB 2HFUA 2D0BA 2FD2A 5JVHQ 5KFLA 3NFAA 5AJ3F 1AYEA 2XO6A 4LQ9A 4B9UA 2YNGA 4QW8A 1JLGA 3Q8SB 3HHLA 2MQNA 4O4GB 4HL9A 3QYYA 1RT5B 3LGMA 2UUBK 2XMJA 4IH7A 3FDSA 4UQTA 3W66A 4O3QA 1K73O 3JQJA 2PE8A 3A8IA 4C3MA 1BE4A 4AHSA 2ZJQL 1FKOA 2CH5A 3MX2A 4J9KA 4ILHA 2IBOA 2GMLA 2ZH1A 3EZOA 2R7XA 3TJ9A 4FYXB 3VEYA 2VWKA 3VENA 4WWSA 3EZ5A 2FF6A 5SZTA 4HHTA 2DISA 3UKRA 3RYLA 5SUHA 2QMXA 4U8YA 1URRA 3PEJA 3AD9C 4KBOA 2BA9A 3IRXA 4ZIVA 4CI6A 4J37A 1Q5YA 1WHWA 1WKLA 1LWEB 4HCBA 1JKHA 3B82A 4FF1A 4WPAA 3K89A 2IPOB 3MWTA 3K8WA 4DS4A 1BY9A 4B3RK 3TZWA 1FO1A 2OEKA 1C4AA 2ASPA 4A2AA 4MH8A 2H51B 1ZETA 3HVTA 1GXTA 1I94J 1H3DA 3V4IB 4R25A 2QXFA 3LP2B 3O9RA 4JKFA 1Z05A 2EFGA 4CLYA 3GLJA 2WBMA 1WJ9A 3CETA 4GKKK 2PC6A 4CZHA 3HPOA 2G2ZA 3D0IE 3J81O 1NEEA 1Q8IA 4LIWA 4OLBA 3NMRA 3HOTA 1XEZA 3DN9A 1XUPO 4YHHJ 1CEZA 4Y1CA 3OVBA 3BGOP 1TK5A 2ZITA 3MCSA 3AGKA 1TMMA 3JXUA 2JNJA 1AW0A 4RWWA 4U7CA 1Z1ZA 2HMIA 2E2OA 3SCXA 2ATCB 4DV3J 3EPIA 2YNIA 3AVAA 4NXMK 1I3AA 5ETMA 3IWLA 3CCRN 3NS5A 5CXTA 1NGGA 3BKTA 2Q2RA 3TUPA 5KFBA 1U0SA 3ZEUB 1ZTWA 1P9YA 2ILZA 2V9WA 2WVBA 3SCJE 4YP3A 3DCAA 1S6PA 5HMWA 2O8EA 3AA8A 3AHPA 1HQEB 1U1RA 2RUSA 1GLBG 3B8HA 2XM3A 1KVJA 1NSKL 3IR7B 2DHSA 5IC4B 1E4FT 4H5NA 1GMWD 4DSIA 2MHEA 2GO8A 2L9NA 2VPYB 2DNYA 3S3MA 1VQON 2ZM6F 3QEXA 4CJTA 3OHRA 1SJRA 2VF3A 2FJVA 2YWHA 3M2VB 4ID5B 4BC7A 5HI7A 4X4PA 4KAZA 4I9LA 1VSJA 2MKKA 2RQKA 5KOWA 3D6FB 1Q4RA 2ZE2A 3NGSA 5M1KA 1QE1B 2Y1JA 5HMZA 1C0FA 1IG8A 2K7JA 4BRNA 4CZJA 5BPMA 3QQCD 3VGSA 2W2QP 2X7IA 3DMJA 4ZJQA 5DG9A 5AZJA 4UZBA 2LP4A 3D0GE 2DGUA 3KJNB 4ZCLA 4WYBA 3IM8A 1L3KA 4L74A 2QL7B 1NXIA 1SUQA 3JSMA 4EWTA 2K2PA 5EU7A 3GL1A 1VQ8N 3H2VE 1SJQA 2R7QA 2QG9B 1PBUA 1HBUB 1K8KA 3DI6B 4MYUA 1BD6A 3PSIA 1RTIA 4WQ5A 1TL5A 1VIOA 4ZITA 2KFYA 2FHJA 1GH8A 3KHYA 2J7UA 3CJ8A 3CJKA 2VONA 2BJDA 4JK8A 3SK3A 3P49B 3CYMA 4FP9A 5EVZA 1GT8A 3BO2A 2KXFA 4TKTA 2VGNA 3CM6A 1V5VA 2DK2A 2NPIA 4DOZA 4MYTA 2BGGA 5TKYA 3W3SA 4D3HA 2FPHX 3QT7A 3R97A 1YUWA 3WNEA 5KT6A 3C46A 4OV1A 3GB0A 3POTA 3VQSA 1WBBA 1JL1A 2GJ2A 4DBQA 2BTFA 1NGFA 3DLKB 5AQPA 4OGCA 5A8KA 1RBSA 2UUBJ 4IKAA 2CDQA 2AEMA 4AILC 4CFBA 4PQAA 3CSKA 1S1TB 3CJ2A 1WSJA 4HUFA 3MR5A 1U1NA 2NUUG 4A8QA 2FJBB 3TPQA 2YQ3A 4RW8B 4AQYK 3U9DA 2Y0SD 2XLIA 1A6LA 2IVFB 4L8RB 5TKWA 1EIYB 4JV2A 2V8GA 4WIIA 2CFXA 3SUOA 1Q95G 5GADP 2MXYA 2PY5A 5H9EK 2CPYA 2FHJD 2QN6B 5E7OB 2ZWHA 1HNZF 3BSAA 4B3RJ 1PBAA 4K8XA 3V9UA 1Q16B 1LW0A 2Z2LA 4CYUB 4IO8A 4QIGA 4PUOA 4K25A 1NHUA 1M1KT 1TUYA 2Z1HA 3NGDA 3CD6N 4FOIA 4OLAA 1CZAN 1U2RA 4M5IA 3LPTA 1H2TZ 4JI4K 3PFOA 4X4QA 3SIPB 1YTYA 3EVOA 1Y97A 4CJUA 2IVOA 4GKKJ 4OHVA 1IH7A 3BZCA 2VFSA 3WEEB 4DUZK 4A47A 2QV6A 1O1WA 2F3JA 2EVZA 4QYZK 4DPTA 2VFTA 3NCIA 4Z4IA 3GJSB 5CYQB 4ENOA 3TP2A 4FJ7A 4V1Ak 4U8VA 5B0FA 3DXKA 4RCHA 2IDLA 4LF8K 2VG5B 4DB3A 3C8YA 3L0QA 4DV1F 1HBMB 3HFVA 2F8HA 3PIPQ 1M1KO 4F3OA 4ES2A 2D3OR 4DI6A 3MN9A 1U02A 4NXMJ 5KTQA 1ZH5A 2NZCA 4OX7A 1YVFA 4FJ5A 3T1YK 1Z25A 3ASMA 3R6MA 3MFIA 2QA4S 3MXHP 1KCFA 4KE5A 1XMBA 1UP1A 2Z8QA 1HJRA 3AVCA 5DGAA 4DU4A 3W3DA 3ZT4A 2V2KA 4CO1A 2XMUA 4DG1B 1ZPWX 5L8RC 3J80O 3A4TA 3D2WA 4CT8A 3R27A 2BACA 1M5VC 3HVRA 4B1ZA 4RUHA 1O51A 1S0OA 1N5YB 4E7KA 4DV0J 5A2QY 2UVVA 4TSXA 3OA9A 3NMAA 2YY3A 3EY1A 1N0VC 1YJNN 1N5VA 2B7CB 3H0PA 5HJYA 3I56S 2MZJA 3HPHA 3UE5A 2V4QA 1G15A 1SIZA 2C2OB 4ILRA 2ZH6A 2UXCF 2UUTA 1KKHA 4F02A 1QD1A 3ENWA 4P7TA 5CH7B 5CE3A 4E7IA 2K3KA 3F41A 3A3NB 2C3OA 1IBMF 4IEIA 4ELUA 1I5OB 5L39A 3CJ4A 1J5EK 3MR6A 4Z4FA 2OD6A 1URNA 1VJWA 5EWGA 3FZLA 3BBCA 2W9BA 1I51B 2W8KA 2QLBB 4KH1B 2UXDF 4BC3A 4KTZA 1WKJA 1JMTA 1HKAA 3KUEA 3QT8A 1VYAA 1WHXA 2X6SA 2CYYA 1FRLA 4C8KA 1NU0A 4L73A 5KQDA 3KZBA 4GVLA 4JHDB 2KDOA 1HMVB 1NB2A 4JKGA 2AGPA 2E9ZA 4QW9A 3HX9A 4B08A 1B0TA 3UCGA 1C1AA 5DLFA 4UY85 2ZDPA 4PCQA 4OX9F 2ERRA 1D0EA 3QEVA 3DRYA 2VPWB 2MQMA 4ICLA 3M8WA 2QA2A 4JI1J 1F9EB 4EBEA 2R4FA 4J9NA 3AVIA 1RZMA 2ITMA 1JJ2M 4LFAK 2IAJB 2DHAA 2OD4A 1IXKA 4USWA 3F9MA 4WF9L 1IKYA 3GPAA 2Z2YB 2Q31A 3J7YU 3BR9A 1GAOA 3W2WA 1RT7B 4MQ3A 1TL7A 4W92B 3D9BA 3QBCA 3ULEB 1ZZFA 1BI4B 5FDLB 4RNOA 3UN2A 5DGBA 2G8WA 2J6TA 3J8AA 4DV4J 4J91A 3GR0A 1W26A 2W2PP 1NM1A 4E2FB 2HF4A 1V4TA 2ZBQA 2AX0A 2BQUA 3O5TB 3BYPA 1LOTB 2APOA 4J9VA 3PTWA 4B3MF 3RU0A 1C1CB 2Z0GA 3W7BA 2PEHA 1B0VA 3N5BA 4TXSA 1FNMA 3ZC4A 4NWBA 4YOEA 3GV7B 3HLUA 2E7WA 3FSIA 3C95A 4R8UA 4PPDA 4JI4J 1RB0A 4LF6J 2E6MA 2VFUA 3NAHA 3JSYA 5C25B 1X3MA 4P2MA 3KUHA 4FZZA 1IKWA 4GW6A 2B4JA 1NK7A 4DUZJ 2WB1D 3QGPA 4DEZA 4M42A 5EDWA 3LDQA 3CDAA 3EGNA 2A2DA 4QYZJ 4OJRA 5BR8F 4JI7F 2FJDB 1ULRA 4I2PA 3M30A 2A2CA 2ZOGA 3ET6B 2CJKA 1YAGA 4IO9Q 5A8WB 4WE1A 1XBWA 4LF8J 3RG6A 3MEEA 1L5UA 2CVIA 4WP8A 2C3YA 1IV0A 4ZLPA 2BJ3A 2I5JA 4R0EA 2HK3A 3KHHA 2V51B 3DWLA 3OYNA 4X62K 2HNZA 1X1PA 2F8TA 2F63A 3QZ7A 3OR2B 1EETA 4BRFA 3K5OA 1J2VA 1TL1A 4BR0A 5F0WA 1RDRA 2WUSA 3CC2N 4USJC 4H4MA 2R2RA 2L3MA 4K5SA 4UOFA 4BS2A 1X5PA 3ZSZA 3D0HE 3QSYB 1YLXA 4FK2A 3MUMP 4OJGA 4A8FA 4CIEA 3LANA 2EHGA 2B8PA 4CH7A 4IOAQ 1IJJA 5L1LA 3W5XA 1KEKA 1VHIA 3THXA 5J2MB 1NKEA 1YJ9N 4IFVB 1QAIA 2VFRA 3O6QA 3KG1A 3V9ZA 2V8HA 4JYAK 3CJ5A 4M5DA 5LJVA 3DJCA 3KIOA 2GO9A 1YF5L 3VEVA 1U04A 2GGPA 1FVSA 2HVZA 5C15A 3HM8A 4HR2A 1G1XA 1NHKL 3RTVA 4IDHA 1WOPA 2V94A 2G8KA 1WD6A 4OKKA 2FDNA 5IOLA 2E5JA 1YRTA 4EO6A 3CCQS 1YBUA 2AX1A 3D68A 3R8YA 1QQMA 1KVKA 2F7VA 4UOGA 3MCPA 3FGVA 1GTEA 2KXHA 4OQJA 2F9DA 3M2RA 2D9OA 3GCXP 5DJBA 2J6SA 2HMPA 2BANA 4H4OB 3BH7B 4CFCA 1OQ3A 5KRSA 4O3NA 1B7YB 4K41A 2OPSA 1RHQB 4RUBA 3N6MA 5LMNK 4Q8EA 3D0PA 1EXQA 3TARA 1G2EA 2A41A 3H7HB 1Q1KA 4NZ0A 3LP0A 2BJ1A 4FK0A 4X4OA 1C0TA 1JJ2R 3PX4A 1T6CA 2WVFA 5KGWA 5BN9A 1X9JA 2YNHA 1DTQB 2C2EA 1Z6RA 4FWLA 4NXNK 4JRQA 1TL4A 2HHPA 3ZNJ1 3ULHA 1D1UA 3KUGA 1BQMB 1X5SA 2FTRA 5D0RA 4JD2A 1R3NA 4Q0BA 4DR2J 3NBPB 1ACMB 2XHCA 3LAMA 4ZVEA 3K5MA 4CJ7A 3N0VA 5M1FA 5HL7Q 1RFQA 3NWGA 5AQSA 1ZAXA 1FJGF 4CEOA 3HHLC 4CZEA 2GHVC 3C15A 2C2MB 1UEVA 3DLGB 3MMVA 3VGMA 1CLQA 3RAXA 1H74A 4DL0C 1WC5A 4M1KA 3T9NA 2G8IA 3O1LA 4LVNP 3KJQB 3CCJS 4BE0A 3CTRA 2ASDA 3AVNA 1JLCA 3TAQA 3JAMU 3JTPA 1Q9YA 1F3FA 2MLYA 2GUPA 1X9SA 1RT1A 2H65B 3TTCA 4WU2A 4DTNA 3QINA 4KHYA 3CCUS 4NLQA 5F8IA 4DF8A 5HLFA 3GYNA 2VYPA 4FJNA 2ZBIA 3EGVA 3NF9A 2R2TA 2DGOA 1XMQK 2W42A 2M0GB 2XMMA 1RGIA 2EFOA 6FD1A 2RB7A 2CKWA 1DEJA 1O5JA 2KZMA 1N32F 5B08A 3MGJA 4CLLA 1TL3A 3F5TA 1WAJA 5L1KA 5F2RA 3LGNA 3L3VA 1S9GB 3QSIA 4CNZA 3D6MB 3ZFVA 5M2RA 2P9LB 5GAHP 1RTJB 4BDYA 2O67A 4LF4K 1YVNA 3OYCA 3H2UB 1XR5A 3OV7A 3D2EA 1VK0A 2WOMB 3ZSOA 3T1AA 1PIEA 1KBRA 4FPRA 5AQJA 3IAYA 1YWXA 4CCHA 3UPFA 1NU4A 3I55S 1TKZA 2PSZA 1MWMA 3O2IA 1VRQC 1WACA 3NWRA 1BLUA 4QWDA 1GMVA 1PC4A 2Y8WA 2DRDA 1BIUA 2MKSA 3PX0A 2BUPA 4GV3A 4CEDA 1YJTA 3SV3A 4X62J 3AXMA 3H25A 1KQFB 2MQQA 1MMLA 4MLHA 3RB6A 5K8NA 3RGIA 1KS2A 4F25A 2EX3A 5IFMA 3AD8C 3CDWA 4A8WA 1A9NB 2E8AA 1RHJB 1LXJA 1PJ5A 2A1RA 2PI4A 3LDOA 3NF8A 1I6JA 4ZVOB 2FUG9 4C9DA 2ZOFA 3ISND 2DNLA 2L48A 5HO4A 5KFEA 1FDNA 5D15A 1NK5A 3P31A 3W5YA 1TYQB 2Z57B 5HANA 5IC6B 2FLPA 4M3XA 2O8BA 4RKUC 1Q0NA 4F4KA 3O4WA 4RBUA 3ISZA 4I2QB 3I31A 2OPQB 1F3VA 1JXVA 2KXNB 3MECA 1S0MA 3WNHA 2R7TA 2CQDA 5JLHA 3TANA 1DT9A 4JYAJ 2XGQA 2Q66A 5J1EB 4YN3B 2V69A 3MM5B 4F0KA 1KOOA 3M9OB 2IA0A 4UUWA 2J8SA 3ZSRA 5JLFA 3UKUA 2RE1A 2HB5A 3O6WA 3CWJA 1UMJA 2R8HA 4B3SK 3QMLA 3ZETB 2VDHA 2DY4A 3C16A 1HW8A 2EW9A 2UV8A 4M3ZA 1JLQB 3VN5A 2E5LK 1NBEB 4DR1K 4ZTFA 2Q6CA 3B54A 3CJ1A 2EFPA 2JGUA 4F4YA 3IS9A 4MK8A 1D8YA 3KNAA 4HTJA 1ZBHA 4KPCA 2HBMA 4HACA 3CJBA 2IVPA 2W6LA 2MEWA 2RU9A 1R43A 4QS8A 2OA8A 2SXLA 1FEHA 1VAZA 4U95A 1AFJA 2P9SB 3GJQB 1S12A 1U8SA 5IZHA 4CEEA 5AQNA 2ZBRA 4NLRA 1RTDA 3KNGA 3KG0A 1NH8A 1F5AA 5A8RA 4AFFA 1CC8A 4JI0K 1W97L 2YKQA 3K5NA 3OYLA 4IWVA 4AHCA 4TN2A 4WQ5C 4M3UA 3TTFA 1XTZA 4JV1A 1NK8A 1C6VA 4CHQA 3MAAB 2C2ZB 3GYXB 1O0PA 3C66A 4IZ9A 1N33F 2MKJA 4PA1A 1KQGB 4L3QA 2QYGA 5E0OA 1VQNN 4RL1A 3SMZA 1TKTB 3IFRA 5HVFA 5K14A 5LY3A 4I1TA 3W61A 3KOAA 2MZSA 1JIHA 2H9ZA 1WNEA 2ZJPQ 3UWTA 4WK3A 1FWPA 1RT6A 2A42A 2YV0X 1ZBFA 2MQLA 3K5LA 2RN2A 2YKAA 4B1YB 1IUJA 2HS4A 4K0KF 3HD2A 4DV5K 4KQZA 3OXFA 4DTXA 2NQPA 4JOUA 3FCHA 1LV5A 4FSVA 4DFMA 2B56A 3R2DJ 5IM0A 3ZZ0A 3LA0A 5HP1B 1Q7LB 3D5MA 5THWA 1KONA 2QSWA 3OJSA 2W7PA 2IRXA 2FVRA 3U4LA 4ES3A 3KLHA 5AQVA 2LA4A 2XNQA 2DR6A 4NI2B 1N34K 3VQ6A 1UVLA 1S72S 2BR0A 4GC6A 1HNVB 5JVGL 2RAQA 3IWNC 3DOLB 3AB2B 3LWLA 3KWMA 2KKHA 2A10A 1ICEB 2IJFA 3VEZA 3PYFA 2DCLA 2XTJP 2HS0A 3D28A 1JL2A 2HPUA 4CEZA 4IG0B 3UNGC 2GVDA 4CF1A 2D3O1 2LDYA 1UWBA 1CZBA 2DNNA 5E3AA 1TKDA 1DLOB 2ZD1A 2PT0A 3P5JA 3Q7BA 1KSPA 1QSSA 4HT5A 5CCMA 3KLGA 4CFAA 1BDGA 3P38A 1J53A 3CCSN 3ZZOA 1S3XA 4LF4J 5H1SQ 1DGKN 1FRIA 2RD5C 4Y0FA 4DL3A 4LF1A 2DXFA 1Y9OA 2DGVA 3BREA 3U02A 3F2KA 2ADBA 2P5OA 1Y7PA 3VQAA 3LP3A 3AA4A 3UI3A 2GHPA 3TAEA 4C11B 1MMNA 3TAMB 5KFNA 3SPYA 1MNEA 3SDEA 2P51A 2DNKA 1SC1B 2EFVA 3MXJA 5T7LB 1C0UB 1CS4A 5I3UA 1PC5A 4BRDA 3OS2A 4Q2LA 2JEGA 1TUWA 2D4WA 1BXNA 1Y5LB 4FLWA 3W9IA 1EWRA 4MMOA 3QIDA 2N82B 2VIHA 4RX6A 3PY8A 1EO1A 1MU2A 3FFIA 4I6MB 3I87A 5B0DA 4GVMA 4FJJA 2DTJA 1UVNA 2H3EB 3QFWA 4TLRA 2P9GA 4BG8A 3EM1A 4CVNE 2N7CA 4ZVRB 3A5LC 2ZUAA 4CW7B 4JLHA 1KLMA 4BRHA 4WK1A 3HSJA 4QU6A 3Q8RB 1KAZA 4NZ7A 3MN7A 4CJEA 4DKWA 1HR0F 3PW0A 4CWBA 3NLCA 3ZT1A 2AJQA 4DR6J 2BE2B 3R9PA 2J7KA 1D9DA 3VQ5A 2HHHK 4E8UA 2CQ4A 4YY3F 1HKBA 4KJIA 2Q0RA 2DY9A 2IRUA 2KM8C 1LAVA 3VQBA 1ZAVA 2Z4PA 2NLXA 1NNEA 3QESA 5JVHL 3VGLA 5KG6A 2E5LJ 3V81B 4JI3K 2R8IA 2MJNA 1MWQA 3UNYA 5LJ5Y 1SC6A 8RUCA 4RW9A 3Q7CA 4M3TA 4DR4J 2IM3A 2P9IA 1VQMS 2V5HG 4DN0A 1VSDA 4U7BA 1TUGB 4LR8A 4P52A 2IIRA 3AT1B 4FK4A 4I7FB 1NSQA 4F2SA 2OP5A 3IR6B 3O4QA 4ITSA 4JI0J 3MR3A 3CT9A 2HSTA 3PJXA 4C3LA 2MQOA 2J7WA 4NB4A 4DR5F 3FZFA 3HT3A 3LL3A 1PYTA 1SS6A 1ZTTA 4LH5A 5KG0A 2J9DA 4HHUA 4OZ3A 1IWAA 2YHAA 4AH9A 3CDEA 4YOTA 1GX6A 4Y3CA 2LCWA 5AJ3K 2GMHA 1H2UX 2ZGYA 3MOZA 1EWQA 3GQCA 4EZ9A 1UVJA 2LQ9A 3SNNA 2WSFC 2XG8A 4BRQA 2E9TA 3KLFA 3O44A 2O8CA 2KFZA 3HI0A 1CJUB 1HD0A 1UETA 4DV5J 3ALYA 2GIFA 5DRKA 3CCEN 5FPDA 1TKXA 2A6MA 2LDIA 3AAQA 3FJ2A 2ASJA 1NNDA 3TVZA 3TZZA 3DLRA 5C2CA 4BACA 3NP5A 3LWMA 1ZPVA 4OPAA 4AHTA 2R7OA 5IWAF 1N34J 4YMEA 1R31A 5HRSA 2AW0A 4K5RA 2HVHA 2JL9A 3HP6A 2VJUA 1NJYA 1RU1A 2VG6A 3LM9A 3C14B 4ZA1A 1KDNA 4IRKA 3CULA 3BSNA 2W2OP 4K2XA 4PG4A 2QWNA 3QRRA 4NMXA 1U2CA 4OYOA 1ZZNA 2OEJA 3RR7A 3IO1A 2F7TA 1E6YA 3ZT0A 1NGIA 2QA4N 3QBXA 3ID8A 3WIUA 4NRUA 4A8MP 5AXNA 3CD5A 2QO3A 2BEFA 1ZAWA 2VQFJ 1B70B 4P2XA 1MDUB 2RT3A 1EX4A 2RDDA 5DQGA 4ED8A 3RMCA 2HFNA 4DQRA 1S6QB 1OY6A 1VBYA 3K2PA 3VQEA 1U1MA 1V9OA 4FWPA 3RRHA 3DOKA 1RBLA 4N76A 5AXKA 4LSNA 3LDSA 2UXBF 1RLDA 2VASA 4HUGA 3MPDA 1AZSB 4F9OA 1WSIA 3DRRA 3U9ZA 2FSJA 1IO2A 1RAOA 4MKYA 3CD7A 1R6VA 3EICA 1S1WA 1SL1A 4CI0B 1UFLA 2GQCA 1JCGA 5SWMA 4PXDA 2XI2A 2HBJA 4RNFA 2JVOA 3JAMO 2GW8A 2LVWA 1FK9A 2VKRA 1E6VA 2RQMA 4KO0B 2PZSA 3JYTA 5B0CA 2PMWA 1RT4A 2Q3PA 2JDJA 1U1OA 2LA6A 5HJXA 4DX5A 4HI1A 3N4PA 4F0MA 4XH5A 3MD1A 1RWWB 2FHOB 4C0HA 3RMBA 4JI6F 1X4EA 4HYKA 3QIPB 2ZM6K 4NLGA 3DHWC 1NMEB 2AIRB 4KRFA 4DV7J 2F5GA 4QIEA 4OI1A 2HHHJ 6AT1B 5A6WA 3CQYA 1J54A 3BBFA 2V67A 1GLDG 1IM4A 3C19A 1OH5A 3DXBA 3AVFA 1HARA 2BXJA 2LLZA 2EKNA 4HDHA 3QNWB 4CJKA 3SXLA 4K43A 5CQGA 4B3OB 2DH8A 5EX5A 5LT5A 5A0YB 4M63A 2ZKUA 1LW2A 4M3RA 4KIAA 1WF1A 4MJKA 2FBVA 3DXSX 2HVEA 1X4CA 3PW2A 2DIVA 1RSCA 4QQBA 3DAWA 4R5PB 3OYMA 4B9SA 3IAM9 5HQ8A 4KHRA 2B4OA 3S8SA 1JWWA 1NLVA 2W4CA 1LK5A 3SQ0A 2QI2A 3MWPA 3BZQA 3BEGB 4BGBA 3THWB 2YKNB 2NRHA 1FW6A 5ETTA 4EBDA 2I7PA 2EPIA 3W8GA 4PL7A 1UKUA 4DTJA 4DCOB 2OZSA 3MDFA 4ILMA 5HQMA 2JX2A 4Z4HA 1XQSC 1KFSA 2Q43A 3JXOA 2XYGB 2JEIA 2HLTA 4GY2B 3DGPB 2UYTA 3LM2A 2JLFA 3PIOL 1K9MT 2NYHA 1VQ5S 3GIIA 4OHXA 1UJ4A 1S9EA 3LAKA 3ILOA 5KFCA 4P6QA 3BO3A 3LALA 4OYBA 4CJLA 5T14A 1S6OA 4KRWA 2OIHA 3OTCA 3CD0A 1RILA 5KPZA 3RMDA 2KHDA 5L1JA 3H5YA 3I5BA 3Q2TC 5D0HA 2YNGB 1JLGB 4ZPBA 4LF7F 3HHLB 2VWBA 3TSUA 4ZK7M 1X31C 2RRNA 3EDQB 1K9MO 5E5NA 4W90B 4YDUA 3G96A 2VD3A 1FKOB 2F8MA 2MQ8A 4PR6A 1HWJA 3R5JB 4USVA 2BUNA 4LRAA 4BG9A 1VQOS 4BWJA 1IG9A 4BC9A 4CK2A 1U7LA 2IGIA 1HNZK 3UKRB 3ISNC 5DK5A 4OVLA 3KKSA 5D4LA 3WXMB 3D6RA 3IRXB 1BUXA 1JKHB 3MM8A 4OYIA 5F8MA 4OKJA 2BX6A 1FXDA 1OWXA 3BBBA 4CJ5A 4DQ8A 3C65A 1TVRA 1YJVA 4ZMMA 2K3IA 3K5PA 1B3TA 3HVTB 3FK4A 2E1RA 3FLCO 1PSDA 1XJWB 4H03B 1VQ8S 1X60A 1Y00A 4WZQA 3HHNB 3EPGA 1WBDA 2R8GA 3C7NA 2HG4A 2DR9A 2NSBA 5ETLA 4DV1K 3MPVA 3P5BP 4BWMA 2IVNA 1U2VA 1SCJB 4RW7A 3PSFA 5DM7