1EETA

Hiv-1 reverse transcriptase in complex with the inhibitor msc204
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Urea-PETT compounds as a new class of HIV-1 reverse transcriptase inhibitors. 3. Synthesis and further structure-activity relationship studies of PETT analogues.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 153
structure length 542
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1eetA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1eetA05
3OL6A 5K14A 3HPGA 3S9HA 4CJSA 4ED0A 1C0TA 2QE5A 2DFEA 4ED6A 1RBTA 3QETA 1ZBUA 3ULDA 3WNFA 3CG7A 4IH7A 4HCCA 3KOAA 4DQPA 1DTQA 3IRXB 3LP1A 4TLRA 4KO0A 4B9NA 2P5GA 3SQ4A 4O3PA 4ECUA 4FBTA 4H8KA 2W9CA 1GOAA 5F8GA 3DLKB 1RDCA 1OS5A 1I6JA 1J54A 1U09A 1XHXA 5KFEA 4Z4GA 1T94A 1NJWA 4KTQA 3RTVA 4Q8FA 3GV5B 4FW2A 4J2AA 3SQ2A 5KFOA 1WAFA 1KVAA 2IDOA 1TL3A 3OYGA 4RW9B 4BDPA 3DM2B 4ED7A 5I42A 4FJ9A 4DL7A 3TVKA 3AA5X 5JS1A 3ISND 3OYCA 4DSLA 3GYNA 4E0DA 1HQUB 3LAKA 3O4NA 3H08A 1Q9YA 5DG8A 2IBKA 3D0PA 3CYMA 5C42B 4M3ZA 3NF6A 4K4VA 2UVRA 1KVCA 2XWYA 5KFWA 4ECZA 4Q5VA 4CESA 1RYSA 1UA0A 3PVXA 2KZMA 4CJRA 1S9GA 2E6MA 3D28A 2VA2A 1RT6B 3T1AA 3VQPA 3QO9A 3PW4A 4ZHRB 2HVHA 1WAJA 4BWJA 4B3OA 3I5AA 2BANB 4FM1A 5F9LA 4WZQA 2OPQA 3HPOA 3N6LA 2VG5B 2I5JA 4C8LA 2XY7A 4CEDA 4XO0A 3QEVA 4EZ6A 2YNGB 4XIUA 2HNYB 1S0OA 2ILZA 5F8HA 4FVMA 4CHOA 2KZZA 2AX0A 2VA3A 2V0NA 4KHRA 2FBTA 2OYQA 1LAVA 3NAEA 2KQ2A 4IFVA 2YKMA 1NK8A 4CF1A 3SI8A 4TXSA 2X78A 4ID5B 5J2PA 2ZQBA 2BQUA 4IOBA 3F9KA 4BDYA 1KHWA 2J6TA 4KSEB 4M3WA 3OYFA 4KO0B 4QWEA 1C2PA 2IM3A 3QIPB 4DS4A 1D8YA 3V4IA 1XI1A 1FKOB 1EXQA 3KLEB 1N5YA 4ICLA 3HPHA 3B6PA 4Z4IA 2IJFA 4DLGA 3VQDA 2GIRA 2G8IA 2AJQA 3SYZA 2Z1IA 2VG7A 3A2FA 5F8NA 1KVBA 4J2DA 3L3UA 4O3NA 2OPPB 2D5RA 2BE2A 4ZP8A 4DU1A 3RB3A 2RKIB 2OH2A 4EEYA 2B4JA 3MR5A 4RZRA 4FJIA 4FZZA 2R8KA 4F8RA 1JXLA 1D0EA 3TAGA 2KFZA 4ECQA 1RYRA 2ZE2A 4W5RA 4E1MA 4FLUA 3K5OA 1RT1B 2YKNA 3V9UA 3NKYA 3SUPA 2W9CB 3WNEA 4CGGA 3DRSB 5KFFA 3ALYA 4AHRA 1NKCA 2JC0A 3GIKA 5KFHA 1CZBA 1QAJA 1BI4B 2WHOA 5KGWA 3IAYA 3AVIA 2Y1IA 3DLBA 4J9MA 2ASLA 2X6NA 5HRRA 3CIZA 1RTJB 2FBXA 1DLOB 2IC3A 3KHGA 3NF9A 5KGXA 1RBRA 4TYAA 1SUQB 1QHTA 2KTQA 1RT5B 1BIZA 5KG5A 1ASVA 1S6PA 1SL2A 1F21A 2HMIA 1VRUA 4NLPA 4CHYA 1KRPA 3CFOA 3C6UA 2IJNA 3OYMA 3OYJA 2IS3A 2Y1JA 1UWBA 3IGNA 3UQSA 2E9ZA 4J9NA 2ZE2B 3HO1A 2E9RX 4DFJA 4FK4A 3N6MA 3C6TB 1NHVA 4B9LA 5J2MA 3BJYA 4RNFA 4J9LA 5L1KA 3OL9A 2XI2A 3V9XA 4FJJA 4IFVB 4OLBA 4I2QA 4LSLA 4OKEA 3KMSA 2IA6A 4M94A 1JL1A 1VSJA 4DSFA 1T03B 4CJQA 3BR9A 2VWJA 1K6YA 5T14A 2DPJA 4NYZA 3OYDA 4EYHB 4IG3A 3BSOA 4LQ3A 1N6QB 1UAXA 3TARA 4ZTFA 4DQRA 1BIUA 1ZBIA 3V4IB 4WXOA 4QWAA 1N5YB 1VSIA 2D0BA 4FJ5A 3M8QB 2A1RA 3GILA 3AVCA 3DOKA 2C22A 3TAPA 4CGDA 1L3SA 4I7FA 3VQ5A 3MEDA 2D41A 3V6JA 3NHGA 4LD0A 3IS9B 1NOYA 1GX5A 3MF5A 3AO3A 5KFQA 2C2RA 3NH1A 1RDBA 2HWIA 4NLXA 3CO9A 2G8VA 3ZT2A 3IGVA 2WK4A 4N56A 4BDZA 4E7KA 3RB4A 3ZSWA 2C28A 3KK3A 1LW2A 4RNMA 4UQGA 1RTIA 4J2BA 1VSEA 3DMJA 3M8SA 1LW2B 4N5SA 1S6QA 3ZSRA 2HNZA 3TAMB 4NLSA 5KT2A 2BR0A 4TQSA 3P1GA 4M41A 4KI4A 4C8NA 1JLEB 5HRNA 3K59A 3DYAB 2EX3A 2W9BB 3VA0A 4CE9A 4Z4CA 1ASUA 4OPKA 3HP6A 1WNSA 4CECA 1HQEB 5D3GA 1HQUA 2Z1HA 4ZPDA 4J9OA 2FVQA 1VSDA 5HP1B 2OPPA 4IR9A 3MAQA 4LY7A 2HVIA 2WOMA 1QQCA 2YHBA 5DGAA 5DLFA 3PV8A 4MFBA 4CJPA 1HYSA 1TGOA 3JYTA 3AO5A 4U6PA 5FRMA 4O44A 4BWMA 1VRTA 2BGGA 1QAIA 3UDLA 1LWEA 3GV7B 4FM0A 5KTQA 2LSNA 4ZP7A 3FFIB 1BQMA 2FJVA 1XR6A 1U48A 3RAQA 1RA7A 4EP5A 3NFAA 1HQEA 3LP0B 5CYMA 4J9RA 3CJ0A 2J6SA 4MH8A 1RT4B 4R0EA 4Y2AA 3L3VA 4DTJA 4DTPA 3DDKA 5I3UB 5HLFB 2D0AA 3ZCMA 1FKPB 1HYSB 2ATLA 2QXFA 4FJ7A 5DGBA 3V9SA 1VRUB 1L5UA 2WOMB 3OLAA 2HHUA 1LWCB 1C0MA 2OPSB 5HROB 2QKKA 4NLQA 1NK4A 3SJJA 4F4XA 2FVRA 3V6DA 1IO2A 3KLIA 4ZHRA 4KB1A 3T5JA 3VQ8A 1JLFA 2X74A 1S9GB 5C5JA 4DMNA 2PYLA 3H59A 3LZJA 3KTQA 4JLHA 1RT4A 3RBEA 3TAMA 3AO2A 2YNFB 1N4LA 1K1QA 3I0SB 1MU2A 3LP2A 2HHVA 4KTWA 4KFBB 3MXMA 4FK2A 3P5JA 3IRXA 4CEEA 3PX4A 4B9UA 3BSCA 4KAIA 5KT6A 1RBSA 5EWFA 3ZSOA 4HTUA 4J9QA 4EBCA 5J2QB 4Y1DA 5I42B 3N6NA 1JLAA 3ICLA 3LPTA 1J5OA 5KG6A 3CFRA 1D5AA 2F8SA 3H5XA 4ZTJA 2E9TA 4MK9A 1B9FA 1REVA 4FS2A 4H4MB 4J9SA 2ASDA 1X9MA 1EX4A 1A5VA 3HT3A 4Y3CA 4Q43A 1TK8A 2BANA 4M3TA 1WLJA 5J2NA 3DOLB 5KFVA 1S49A 2FLLA 3KK1A 4KKOA 1S48A 5L1JA 1RT1A 2HNDB 3CDWA 1BCOA 4QOZB 3QYYA 3L2VA 4OLAA 4PWDA 3KD5E 5F8LA 5HBMA 5C42A 4NLWA 1ZETA 4H4MA 2IGIA 3M8RA 4ID1A 3QEWA 4WZMA 4CIGA 5FROA 3RMCA 1C6VA 4DFMA 4DTRA 4F3OA 1IKXA 5JUMA 2XGPA 4OGCA 5J2MB 5J2QA 2R8JA 2GV9A 1VSHA 1T05B 3I8DA 4E19A 3RBDA 4QPXA 4FJNA 3MTKA 3NE6A 1YT3A 4KHUA 5EUHA 4DFPA 1SH2A 3QNOA 1JLEA 4FJ8A 5SWMA 4PA1A 4Q45A 1RT7B 2OZMA 1JLGB 4CJ5A 3DRSA 3IG1B 3DLKA 1HNVA 4TY9A 1TK0A 1NJXA 3ITHA 3KLFB 3V1OA 4E3SA 2IM0A 3I0RB 4FZYA 1CZ9A 1S10A 3DLHA 1RT5A 3H5YA 5L1LA 4BE1A 2AGPA 2V4RA 1S4FA 4DTNA 1HYZA 1IKYA 3RB0A 4FK0A 2RF2A 4RW8A 1Z25A 4W5OA 4AHSA 1JLBA 4LH4A 1XC9A 4K8XA 3GQCA 1W9HA 3SNNA 3DI6B 2CJQA 3M8PA 2GBZA 4M42A 4N41A 4FBUA 4EZ9A 3OSPA 5C25A 4KHMA 3SCXA 5KFTA 4ECSA 4FXDA 2FJXA 2ZKUA 2JEJA 3OYLA 3QZ7A 3OJSA 1VSMA 1CXUA 2DFFA 4E89A 2OPRB 4G1QA 3MECB 3SPZA 1FKOA 4RNHA 2B43A 1JKHA 4NLVA 5JS2A 5L1IA 4DL2A 3V81A 3LWLA 4Q44A 3PR4A 2UVVA 3AO4A 2HB5A 4G3IA 2I1RA 5CZ2A 3LP1B 1X9SA 5KT4A 1HARA 4E7IA 4FLXA 5KFRA 4FJXA 1T03A 2XC9A 2OA8A 4QCLA 1O1WA 2HHQA 2YNHB 4KHSA 1TAQA 4ICLB 4TYBA 3VQ7A 4KI6A 1DTTB 4CEFA 5KFYA 3AVJA 3C6TA 1HYVA 2W9AA 5DK5A 3ZSVA 2IMWP 4MIAA 3OS2A 3CDEA 4WFXA 2BRKA 4Q0BA 2WCXA 3ASMA 2XCPA 2UVWA 4CEOA 3BGRB 2R2RA 3H5UA 2VG6B 2WONB 4N47A 2W7PA 3ZSYA 4MIBA 3QERA 3Q8PB 2W9BA 2KFNA 4B8CA 1C0UB 4G1QB 1ITGA 2R8HA 3TAFA 2HMIB 4KBIA 3M9NB 1CXQA 4RNOA 3WNGA 1WSIA 3OJUA 3SUNA 1YVFA 2YNHA 4K4TA 4MQ3A 4IKAA 3OHBA 4EYIB 4LSNA 4KHYA 4FJKA 3MR3A 3KMQA 1RTIB 2G8FA 5DLGA 3V1QA 4L8RB 2UUTA 4Y2CA 1BI4A 2XRIA 2VG7B 4DTXA 3PUFA 3NDKA 3EYZA 3QO9B 1RDDA 5F8JA 1RT6A 1L3TA 4ED8A 1ZTWA 1S1VB 3PJWA 1RILA 5FDLB 3BSNA 1C1BB 3K57A 3JSMB 3PX0A 4CGHA 4FJGA 2FJWA 3QIPA 4O0JA 4OL8A 4B08A 3DYAA 1QSLA 1UOCA 2W8KA 2HNDA 1EKEA 1U47A 3LP0A 5CYMB 4URGA 3KKRA 4Z4EA 4YR2A 2QV6A 4QW9A 2D0CA 1TQLA 1X9WA 1KCFA 3PW5A 4O3QA 2IAJA 1TAUA 3HYFA 4CFBA 1R0AA 4RW4A 3QINA 1S6QB 1NOZA 3M8QA 4IKFA 2O4IA 3DM2A 1IKXB 2PY5A 3PR5B 1RDAA 1KFSA 1U04A 3BSAA 3K5MA 4IDKA 4FJMA 4DQQA 2VWKA 2DPIA 5EWGA 4RW6B 5KFPA 4HCBA 4LSLB 4I2PA 2ITGA 2C2EA 3LZIA 4CHNA 3IG1A 4NLYA 2YKNB 1FXXA 3PO4A 1LW0A 3HKWA 1RT2A 2B6AB 2EC0A 4O3RA 1Z26A 4MK7A 1QSYA 2WRMA 3MEGB 3FQLA 4PUOA 3NAHA 3ZT0A 1D1UA 3BQ0A 4K4WA 3T5KA 1HMVA 3NGYA 4FLYA 3K5NA 1XR7A 2Z1GA 3I5BA 3UIQA 1S1TB 1S5JA 4ZVEA 4ECWA 4ECVA 4CFAA 3SUOA 2F8EX 4DQIA 1C1CA 3LP3A 1SH3A 4I9QA 1QTMA 1JLQB 1S1XB 3G86A 1TVRA 4U7CA 2FLPA 1LWCA 3DLGA 1IM4A 2XY8A 1TKDA 1NJZA 4NCGB 1FK9B 1C1AA 1S1WB 4K4YA 1SV5B 1TKTB 1IH7A 3O3GA 4GVMA 3HM9A 3F73A 3PW0A 3OL7A 3NF8A 3LP2B 4NLTA 4WYWA 3NL0A 2QKBA 1WN7A 1TKZB 4DQSA 2PZSA 5KFKA 3V9ZA 3EZUA 1ZYQA 3FQKA 4CEZA 2YKMB 3RMDA 4AHVA 1VSLA 3TI0A 3OVNA 4CGJA 1BQNA 4IFYB 3MFIA 1NK7A 2QK9A 4CEBA 4RW6A 4YR3A 4F4YA 3T19A 2YV0X 3QEIA 1ZBLA 4DL3A 3AVNA 4FW1A 1TKTA 3TAEA 3S3NA 1S1WA 4H4OB 4FZXC 1N6QA 4Q8EA 4CJTA 1TV6B 4CHPA 2XCAA 2R8GA 4TSXA 1KTQA 1EP4B 3T5HA 4M3XA 1C1CB 4CIEA 1MU2B 4NZ0A 4TY8B 2ASJA 4LH5A 4DLEA 3OYEA 1IKVA 3VA3A 3KJVB 2HHSA 1TKZA 3OY9A 3OYBA 1EETB 4DG1B 2BRLA 1LW0B 4F2SA 4W5QA 3AVMA 2HW3A 3KLIB 3GIJA 1I39A 1U49A 4C8KA 4ID5A 4CJLA 1NK6A 1KLNA 5KFSA 3VN5A 4LSNB 4C8OA 1SH0A 4AHUA 4NCAA 4RNNA 3HVRA 3G10A 3QLHA 4ZVFA 5KG3A 4CGIA 4MKAA 1TKXA 5KFZA 4E7JA 5KG1A 5KFXA 4PY5A 4DTUA 1LAWA 4W5TA 3VQ4A 1EETA 3QESA 4ECYA 3TAQA 4ZP6A 4ZP9A 2VG6A 2WONA 1K1SA 3B6OA 3HL8A 5KG4A 3QEPA 4ZVGA 3E01A 4FJLA 3QIDA 4KB0A 2HHTA 2XGQA 1SL0A 1NHUA 3MFHA 1WSFA 3VQCA 1XWLA 4KE5A 4BACA 4AH9A 3CM6A 4FM2A 3OLBA 3BDPA 3LPUA 3QIOA 3KLGB 3ZT1A 4NLOA 2HNZB 2IC3B 3WNHA 4MFBB 4F2RA 1JLBB 5K14B 1U4BA 2VG5A 3NH0A 4LQ9A 3U3GA 3PX6A 1WSGA 2FLNA 3V81B 3LALA 4E7LA 1HMVB 1JLGA 5CZ1A 4DF4A 4PUOB 4NLRA 4O3SA 3SUQA 3DLEB 1Z4UA 3KIOA 1N56A 2JEGA 3ZSXA 4JUZA 4CJUA 3KJVA 4F50A 1S9FA 3NGIA 4KAZA 4TN2A 3BQ1A 4YMEA 3OYKA 4ZPBA 3OS1A 2D3ZA 3UPFA 3FFIA 4ZMMA 4QWDA 3M8PB 5CY4A 1JIHA 5DQIA 3FDSA 1BCMA 2G8WA 4O0IA 3ISNC 4OJRA 3NCIA 2WB4A 2FBYA 4I9LA 4J9PA 4XPCA 5KFDA 4KHNA 1TV6A 1I3AA 3DRRA 1L3VA 1RTJA 4OKKA 5KFMA 3L2WA 1Q8IA 3CJ5A 4IRCA 4IG0A 3HK2A 1KFDA 1XR5A 3QZ8A 4HUFA 4AILC 5KFCA 1ZBFA 1MMLA 3HXMA 1BHLA 3VQBA 2GC8A 4DL6A 3OYAA 4ELTA 4O3OA 3BQ2A 4Z4FA 4WE1B 1TKXB 3CJ2A 2BQRA 1DTTA 4KV8A 4RUAA 5DQGA 1S1VA 3Q8QB 4B9VA 4ZVHA 2HNYA 1ASWA 3SQ1A 1NK9A 3MXIA 4AHCA 4CEQA 3DLGB 4NCBA 2W7OA 5KFIA 4M3RA 3DI6A 5HRPA 3G6VA 4CJEA 4R8UA 4KFBA 4YR0A 2ETJA 2V9WA 2DFHA 2AX1A 3OYIA 4K50A 1NJYA 3CQ8A 4DG1A 1C0UA 2WTFA 4B9SA 4R5PA 3KLEA 5DG9A 4ECXA 3JSMA 4CFCA 3H4DA 1HNVB 4NLGA 3T3FA 1TP7A 5KFJA 4MKBA 1EP4A 4Z4HA 4FS1A 3PW7A 3SFUA 3DRRB 1YTUA 2GIQA 2P51A 5KFGA 4XPEA 4BE2A 4RUCA 1YVUA 3JYTB 1RTDA 3RWUA 2XHBA 5J1EB 4M3YA 2F8TA 4DU4A 2FVCA 3HVTA 4H54A 5KRSA 4WXWA 3UR0A 3O3HA 4Y1CA 2R2SA 2R2TA 3TANA 1IG9A 4KREA 4NYNA 3SV4A 2FC0A 2XY6A 4FCYA 4ELUA 3I5CA 5F8MA 1BQNB 3NGDA 4NRUA 3KLFA 3NBPB 3KNAA 3HVWA 5DQHA 4ECTA 2X6SA 4OVLA 2JEIA 1TL1A 5C24B 4JRQA 4RU9A 4DS5A 4ELVA 1G15A 2BDPA 3U6FA 4CHQA 4FJHA 3GV8B 2E6LA 4DSJA 2BE2B 3V9WA 2DTUA 4FLVA 3U3YA 2RDIA 4DF8A 1JX4A 4CF8A 3KLHA 1JLQA 1S0NA 2P5OA 1VSFA 3AA2A 1S97A 5J1EA 2D7SA 1T7PA 5HP1A 3KHRA 2YNIA 3NGZA 5HBMB 3H4BA 4CF2A 2O5DA 3RMAA 5CYQB 3KHLA 4HKQA 4KV8B 2CKWA 3C94A 1JKHB 3PO5A 4NLDA 2UVUA 3G6XA 4NRTA 2ZD1A 2J6UA 2GUIA 1IKVB 3E01B 3C95A 3CVKA 2A1SA 3MEDB 1QSSA 1LWEB 4EBDA 1KLMB 1KHVA 4Q0BB 2R8IA 3L2QA 3M9MB 1IKWA 2O4GA 1T3NA 1HRHA 3EY1A 3AVLA 3E51A 3RAXA 4IDKB 3KKSA 3NMAA 3TR8A 3VQ9A 2YNGA 5KT3A 4PQUA 2JLEA 4RW9A 1L3UA 2G8KA 3AA4A 3SQ0A 3SFGA 3HP9A 4IFYA 4IRDA 4TQRA 3EPGA 3H40A 4KRFA 1W0HA 3QEXA 4W5NA 4FLZA 3QGHA 3VQQA 3QGGA 2B5JA 4I7FB 3MR2A 2KW4A 3PY8A 3DOLA 1ZTTA 3LAMA 3V6HA 4YFUA 4F4ZA 4K4ZA 1TL1B 5C24A 1QUVA 1FK9A 2OPRA 4IRKA 2RPIA 1GOCA 5FRNA 3QLHB 4GC6A 3PHEA 3SI6A 4HHTA 5KI6A 3K2PA 4JV1A 4FYDA 3D45A 2AWZA 1S0MA 3RR8A 1RTDB 4RW7B 4C8MA 1IKYB 4QW8A 1JXEA 4CJVA 3MEEB 4YP3A 4JV0A 3KLVA 1JLAB 1FKPA 4ZPAA 5KFLA 3G6YA 2AGQA 4F4KA 3CFPA 2E4LA 1D9FA 5L9XA 4RW4B 4DSKA 4EO6A 4B9TA 2R7YA 3ZT4A 4J9KA 1RT2B 2B6AA 2ILYA 2PYJA 5KT7A 4ED1A 4KHWA 3AVHA 3L8BA 3NH2A 4I2PB 4J2EA 1RA6A 2XO7A 1GOBA 2FVPA 4CCHA 4IG0B 3K5LA 1HJRA 4JS5A 4CFDA 4CIFA 4RG8A 4CK2A 1ZBHA 1S6PB 4O4RA 3HHKA 4DFKA 3OHAA 4DWIA 5EDWA 5F8IA 3MXJA 4EP4A 3OSNA 4HUGA 2I5JB 1N48A 1X1PA 2OPQB 4I2QB 3VQSA 1S1XA 3G0ZA 4KTZA 1HNIB 4ED2A 3HVAA 2R2UA 4DEZA 2IAJB 3KK3B 1R0AB 3ZT3A 2HAIA 1KLMA 4MK8A 3K58A 5D3GB 2ALZA 3H2LA 1S1TA 2ATQA 4DTSA 5KFBA 2G8HA 2XY5A 3MEGA 2FVSA 3EPIA 3M9OB 2ZD1B 1HPZA 4KB7A 1QE1B 4EBEA 1NK0A 2RN2A 3H5SA 1JXBA 5KFAA 3MR6A 5KFUA 2HHXA 2UUWA 5EWEA 5KRTA 2RKIA 5KT5A 3DOKB 1RTHA 3VQ6A 3CJ4A 2OPSA 5HROA 4CEAA 3CJ3A 2Q3SA 1RCHA 3RMBA 4Z0UA 3KK2B 2OZSA 3KLHB 3HVTB 4K4UA 4KHQA 4WFYA 4ZPCA 3EZ5A 2FBVA 1J5OB 2IM1A 5KFNA 4B8AB 1SKWA 1S9EB 5KG0A 3LANA 3NAIA 3RRHA 3PZPA 2AQ4A 5I3UA 4OGEA 3DRPB 4DL4A 4B9MA 3P83D 4JRPA 4YQWA 3BGRA 3THVA 3QNNA 1RNHA 4CK1A 1B9DA 3IS9A 1A5WA 4WFZA 1UA1A 5E41A 1NK5A 3RR7A 1D9DA 1RDRA 4GC7A 4IH5A 2B5JB 1RT3A 2V4QA 1VRTB 4QWCA 1RBVA 1JLFB 3MECA 1SL1A 3MEEA 2XI3A 4NLUA 3C6UB 3V6KA 3AVAA 4O5BA 4CHZA 1SV5A 3AVBA 3PJXA 3NF7A 4OKJA 1S1UB 4K4XA 4PQUB 3DMJB 2RDJA 4IBNA 4CJ3A 1DLOA 2HWHA 3HJFA 4DSEA 1BL3A 4B3OB 5F9NA 4DSIA 3SPYA 1W25A 3GIIA 4CF9A 4K8ZA 1B92A 3SZ2A 4DL5A 1IKWB 4URQU 4JV2A 3AVFA 1RT3B 1LWFB 3TQ1A 1RBUA 4CK3A 1QS4A 2W42A 5SZTA 1SKRA 4GW6A 1RT7A 1LV5A 4O55A 1WSJA 2D3UA 3LDSA 5JXSA 4IQXA 1VK0A 4R8UB 1BQMB 4O4GA 4IH6A 1JL2A 4QAGA 4HUEA 1T8EA 4DU3A 4GMJB 4RW7A 4O44B 5C25B 2G8UA 3FSIA 1RAJA 3O4QA 3ZSZA 2RF2B 4RW8B 4CJ4A 3FRZA 4IG3B 4HVJA 3KK2A 3VQEA 1CLQA 1NKBA 4WE1A 3OYNA 1XHZA 4CJKA 3TABA 4X2BA 1RTHB 4HYKA 4CJWA 4PWDB 4FLWA 2AU0A 3SV3A 3DLRA 3ZSQA 3IN5A 3DLEA 3O3FA 4URSA 2EHGA 4KPYA 4IR1A 4F4WA 5T7BA 1UWBB 4KKOB 3L2UA 2DY4A 5J2NB 5FDLA 1WSHA 1A5XA 5J2PB 3CM5A 3CDUA 5DMRA 3S3MA 2YNIB 3NBPA 1C0TB 4NYFA 1J9AA 1TVRB 1J53A 1SUQA 3AVGA 3AA3A 4JS4A 2AGOA 1HNIA 2JEFA 3OL8A 4M3UA 4CERA 2F96A 1GX6A 4M95A 2BQ3A 3Q8SB 5EU7A 4QWBA 2YHAA 5HLFA 3KLGA 3BREA 4F3TA 1NNDA 3L2RA 3I0RA 3OS0A 1Q9XA 3TWHA 2JC1A 2C2DA 1U45A 2NUBA 4M45A 4WYLA 3KK1B 2YNFA 3RRGA 1QE1A 3AVKA 1WNEA 3HSTB 1DTQB 3V1RA 5HRSA 2IM2A 3VQAA 1LWFA 4CF0A 1C1BA 3AO1A 4R5PB 5KG7A 1SKSA 2JGUA 3OYHA 1T05A 5CYQA 1S9EA 3PW2A 1BGXT 1REVB 1KSPA 4H4OA 3KHHA 4DTOA 1TK5A 4AHTA 3T5LA 3CWJA 3GIMA 4O4GB 4CGFA 4OPJA 2P1JA 3Q8RB 3QGIA 4N76A 4K4SA 4DTMA 1NKEA 4ED3A 4Y34A 1Y97A 1TL3B 3ITHB 1BISA 3AV9A 3S3OA 1WSEA 1CSJA 1VSKA 4ECRA 3I0SA 3D5MA 1YTAA 3KD1E 1JLCB 4YNQA 2HHWA 1HPZB 3RB6A 4FLTA 1JLCA 5DG7A 5KG2A 4E7HA 3V6DB 4E1NA 3LWMA 4NCGA 4EO8A 4BE0A 4TY8A 2W8LA 2IOCA 2Z1JA 1S1UA 3H98A 4CJFA 3DRPA
chains in the Genus database with same CATH superfamily
3BPDA 5K14A 4CJSA 4ED0A 2YKPA 2QE5A 3FUYA 4ED6A 1RK8A 2Q36A 2W41A 1QY7A 5AFUH 2CQPA 1U1QA 4DQPA 2V63A 1DTQA 2YWHA 2YWEA 5FJ4A 4DPUA 1M90O 1IUJA 4K7QA 1X0PA 2RU3A 2W9CA 2LU1A 3DLKB 1JJ2R 1OS5A 5HVHA 1XHXA 1U09A 3PTWA 3TTDA 4ZK7M 1T94A 4FPBA 3OW2R 3GBTA 4PKIA 4RX6A 1AZSA 1RWUA 1WAFA 1RBLA 4GO7X 3HFZB 3TRGA 4OI4A 1N5SA 2CPDA 5BXIA 2E1PA 2JWLA 3AA5X 5LJWA 3ISND 2CZ4A 5SUHA 1HQUB 3O4NA 2EBGA 3FZMA 3D0PA 3U1MA 3BBCA 2EC2A 1KVCA 4HWIA 2NYHA 2HZCA 5KFWA 4CESA 4OZ2A 3SCJE 1UA0A 1SC1B 2ROGA 3D28A 1OKJA 3T1AA 4HDGA 3VQPA 3PW4A 4ZA1A 4H5TA 1WAJA 4B3OA 3CW2C 2V8GA 4WZQA 5IS2A 4IYQA 1FJEB 2H48B 4OPHA 4CEDA 3QEVA 4EZ6A 5KPTA 3CETA 3TJ8A 4XIUA 2HNYB 1S0OA 5F8HA 2ZNZA 3PACA 1ATRA 3ZYYX 3EE3A 1MN7A 1RWVB 1AUSL 2FBTA 2X78A 4ID5B 5J2PA 1D4XA 2ZQBA 1NMNA 1Q8LA 2ITMA 4F04B 3BN4A 4G6VB 4M3WA 2DXFA 3OVSA 2IM3A 4DS4A 1D8YA 2OJ3A 4WQ4C 3I4HX 1XI1A 1EXQA 4HT5A 1N5YA 2IJFA 1IWAA 3AD7C 2VKRA 2Z1IA 2VG7A 1N5TA 5F8NA 4FVUA 1RWMB 2QWRA 2N7CA 1D8ZA 4W98A 4O3NA 2R7RA 2RSQA 2D5RA 3HSGA 1WG4A 3GJRB 3RB3A 4UOCA 2VQFK 4ZVOB 2CQHA 2OH2A 3CMES 3MR5A 1NBEB 4ZVUB 5ETSA 1YIJS 2KFZA 1H2TZ 5BJRA 4XH1A 4FLUA 2GVZA 2ZHAA 2OANA 1N33K 1WACA 2R7WA 3X3UA 4Q7AA 3JSYA 4OJ1A 3ALYA 2XB2D 1IV0A 1BD6A 3PEHA 2E2QA 4U96A 2J9CA 2JRSA 3AVIA 5AQOA 1FWPA 5BRHA 1SXLA 4XEIA 2ATCB 1KQSM 1Y5LB 1JJCB 3CIZA 3TO8A 3GTYX 1DLOB 1RBRA 4TYAA 4A8OA 4CH0S 4K43A 1SUQB 1S6PA 3NGRA 3O2IA 2HMIA 3QMQA 1ZAVA 1KRPA 4OFZA 1YVNA 2KHDA 1SJ1A 2FHJA 2HZVA 3OYMA 3UQSA 3K89A 2GV1A 3QWUA 3VQTA 4F0MA 2VV5A 1PC5A 2HVDA 3OD2A 1YRTA 5EX0A 2E9RX 4LJMA 3VHQA 3IFEA 2LECA 5L1KA 2DNLA 3K0SA 2V7ZA 3J81U 3V9XA 4C48A 3Q8UA 2VQEJ 3Q23A 4LSLA 2IA6A 1W97L 3VERA 2GHWA 1T03B 3QJJA 4JKFA 5GADU 2J4RA 3OYDA 4LF6K 3TARA 3BS9A 1VCTA 3NNHA 4QWAA 3MCAB 1MROA 3I32A 4C3LA 4JI8J 3CCWA 3UDVA 4HHJA 3ZX3A 3TAPA 3BO4A 4CGDA 3VQ5A 3NHGA 4PRFA 1HKGA 3W64A 1NOYA 1GX5A 3EN9A 2VDIA 2COLA 5LXYA 2VC1A 2C2RA 3NH1A 4AFFA 1XBWA 3KWMA 2HWIA 2Q2RA 5JJBA 4YOTA 3SSQA 3KK7A 1HBNB 3H2UB 1U1KA 3D6MB 5F0XA 5DS7A 4R0JA 4N56A 4HH1A 4BC4A 2G1HA 3FGVA 3R1LA 3U9ZA 1YRXA 1U0HB 4UQGA 1MWYA 4AM7A 2KO1A 1V4TA 1VSEA 3CCQN 4J2BA 1NSPA 1TL7A 1M1KO 2LA6A 1MWMA 3M4XA 4B1VA 2BR0A 3BB5A 3FBCA 3ILLA 4TQSA 3VENA 3ELHA 1KQFB 3DYAB 4OLPA 3IMQJ 2ZGZA 4N7TA 3HP6A 1HQUA 2Z1HA 3IR7B 4ZPDA 4L72B 3ZETB 5HP1B 1VBXA 4NLBA 2HVIA 4EUVA 1HI1A 4DV1F 2YKQA 2YHBA 1I5OB 2ZH4A 3DGVA 4FWQA 5FPNA 1TGOA 4H4KC 3JYTA 4A46A 1QAYA 2XMMA 3CHWA 3CSKA 3AQPA 1D09B 4O44A 4BWMA 1HNWJ 1VRTA 1YZ7A 2QX0A 4ZP7A 2F9TA 2LVWA 5A8RA 4EP5A 5F0UA 1HQEA 3LP0B 2J6SA 4MH8A 1RT4B 2RILA 1R0BG 4Y2AA 8AT1B 1O13A 3EVWA 4PXBA 5M2PA 4OJHA 2QLXA 4M5DA 1QZ6A 1FA0A 2YX1A 1OQ6A 5HO4A 3DLLQ 5LL6Z 3PIOL 2P9UB 5GMEA 4ANCA 3O8WA 4OHZA 3FCHA 1VQPS 2V6AA 2OPSB 5HROB 2QKKA 3MM5B 1M1HA 2W4DA 2FVRA 5JVHQ 3ZXWA 1H38A 5AQPA 3L6QA 4QBUA 4MLEA 5CCLA 3MMBB 2HBKA 2DR7A 1FFGB 2L48A 1SJ3P 2FDNA 1K9MO 4FWPA 3TAMA 3AO2A 2DB1A 3ONQA 3LP2A 3IRXA 2M70A 2FF3B 3DKDA 1NGDA 5AXNA 5AZJA 5HANA 2FHKA 1RLDA 4HTUA 4Y1DA 1JLAA 1U1LA 1BWEA 3LPTA 1FJCA 3H5XA 4YB7A 2D0PA 3W2WA 3LTOA 1FRLA 5GAGU 3GFXA 3AY9A 4WQ5C 1EX4A 3QWPA 4Q43A 2W6LA 2QRRA 2BANA 1Z1ZA 1OQ3A 4EAHD 2YKAA 2FIUA 2Y3YA 1WLJA 3DOLB 5KFVA 5ELZA 4DR4J 1S48A 4Y2IA 3P96A 1WELA 3THXA 1YX2A 4OZ0A 2HNDB 2C3PA 1RU2A 2QMXA 2D9OA 3CDWA 4JKBA 2MLZA 4PWDA 3AH6A 1TFYA 5HBMA 5C42A 5HK4A 3HHLD 2HSEB 3RAMA 3M1FA 3MX2A 1VISA 1L3KA 4NXMK 2OMOA 4U8VA 3RMCA 3VOVA 3DC2A 4DFMA 2PN6A 4DTRA 4OX7A 2V2VA 5JUMA 2FD2A 3NG8A 4FXWA 2GV9A 1T05B 4FJNA 3MTKA 3NE6A 2ZC3A 2V4JA 2NZTA 5EUHA 4DFPA 2QA4N 1FRKA 4P9SA 1JLEA 3SDEA 1HNWK 5SWMA 4Q45A 2OZMA 4L6V3 1JLGB 3DLKA 1HNVA 3HJVA 2W2OP 3F44A 3DOMA 2CZ9A 2EVZA 1NJXA 4C97A 2PFFB 3H1QA 3Q8YA 4YOVA 2C42A 1S10A 4P74A 1S57A 1S4FA 4FK0A 1IKYA 2XMKA 3VALA 4AHSA 3A1YG 2NS1B 4ILHA 3B4MA 2P5VA 2GBZA 4FBUA 4KH0B 3OSPA 3RZAA 1GQEA 3SCXA 5G0RB 4OX9J 3EGWB 2ADCA 4FXDA 4IOCQ 4LUBA 4CIOA 2ZKUA 2JEJA 3OJSA 4X65K 1X5SA 4E89A 2DGTA 1E6YB 4G1QA 1B0PA 2XZDB 4RNHA 1CJTA 4Y2MA 4Z7CA 3V81A 1NGEA 5J1NA 1N36K 4QIVA 3OQ2A 4CLSA 2HS0A 4FJXA 1T03A 4PHTX 3DRXA 1O1WA 2HHQA 3AAPA 4DPTA 4QQBA 3O9QA 3C16B 2VU5A 2D74B 4A4JA 1GAOA 4CEFA 2MEWA 3E8OA 2VFUA 3F0NA 1OWXA 3UKUA 2IMWP 2BRKA 1HWUA 3R5GA 1GMWD 4MO5A 4LBIA 1X4CA 3ZSYA 2C2ZB 2RT3A 4S0MA 4WQ4A 1B7YB 2QSFA 5CABA 1T95A 1SCJB 3NNAA 1VQLN 3D68A 2JNJA 2XSJA 3JAMU 3OJUA 2NRZA 1YVFA 2BKPA 3PIPQ 4LF9F 2WAQD 4EYIB 3KFWX 4X62F 3MR3A 4USUA 2P9NA 2DPNA 2DITA 3MTJA 1GLJO 4DTXA 3NDKA 4DUZJ 2YVSA 5F8JA 4DN0A 4IEIA 4ED8A 1ZTWA 3I33A 3PJWA 4PKHA 5FDLB 1C1BB 1F5CA 4FJGA 5HQLA 4O0JA 3IFRA 1RFQA 3O9UA 2W8KA 3W3SA 1EKEA 3LP0A 3KKRA 4KH5A 3TUIC 3U1LA 1DARA 2QV6A 2UXCF 5K8NA 3PW5A 2IAJA 1B99A 1TAUA 1YI2S 4GY2B 2CVEA 3PKYA 4CFBA 4XH5A 4CW7B 3D0GE 3UE2A 3M8QA 2QTWA 3P3DA 4LVNP 2PY5A 3BSAA 4BROA 5D4OA 4JEPA 2EKYA 4DQQA 1WOSA 2FGCA 4ILJA 3UDCA 4HCBA 2DHSA 4I2PA 4MT1A 3P49B 2K8GA 3TQEA 3L4IA 4EGLA 1G1XA 4OLOA 3BYPA 3RW6A 4JI5J 1SQFA 1RT2A 3CCLS 2EC0A 4MK7A 1DAXA 3PRDA 1YKWA 1CLFA 4NL5A 4FLYA 3RSEA 1XR7A 2Z1GA 3HZEA 1S1TB 4CM2A 3MAHA 1S5JA 3UN3A 4ECWA 4ECVA 3D6HB 4CFAA 3H8YA 4ZJQA 4UY85 3LP3A 2DRDA 3FK4A 1QQNA 3SK3A 4BVPA 3G86A 1TVRA 4CWBA 4U7CA 3SQGB 3E66A 1OH6A 1FK9B 3QFHA 4ZCKA 7FDRA 3O3GA 3VVTA 1UFLA 2A40A 2I9SA 3LP2B 2M4MA 2QWLA 5A0YB 1FNOA 4DQSA 3V9ZA 2XMUA 2JFDA 1ZYQA 5CA5A 4CEZA 3M32B 5C10A 2YKMB 4ZLPA 2M5YA 1VSLA 4B1YB 2MSSA 2KKHA 3CCES 5E2QA 2CZVC 4F4YA 3CCRN 4DL3A 2YPYA 3TAEA 3S3NA 1S1WA 4WFBL 1A6LA 4KT0C 4JKAA 3Q89A 2R8GA 2AYMA 1FCAA 4X66K 4JI2F 1C1CB 4AQYJ 1U8WA 1MU2B 4Z2XA 4CIEA 1RHKB 1RCOB 5E3QA 4TY8B 3CCVS 2P9KB 1IKVA 3KJVB 3D54A 2GHPA 3ULEA 3LGMA 1DRZA 3QJLA 1IM6A 3RJMB 1EETB 2RD5C 4W5QA 1EZZB 3I4PA 3KLIB 4C6AA 3GIJA 4CLLA 1I39A 1U49A 4C8KA 1EARA 5B0FA 4ZKAA 4LSNB 5FPDA 4ZVSB 5BRDA 1T9YA 3HD2A 4ZVFA 1FNMA 3PFOA 2WBRA 4UUXA 1LQ9A 5KFXA 1EETA 3QESA 3TAQA 2CFXA 2C3YA 1FDDA 3QEPA 2E5JA 2L3MA 1FDNA 4Y0FA 2ASOA 2NRRA 3T6JA 4LBPA 3QIDA 2XGQA 5IT4A 1NHUA 3MFHA 3VAHA 4NMLA 2C2OB 4KE5A 2QSWA 3CM6A 3LPUA 2U2FA 3WNHA 4FWMA 2IC3B 1EJ7L 4DCPB 4BRNA 4KYZA 1U2VB 5K14B 2M3DA 3THWB 2BACA 3NH0A 1NCLA 3OTOK 2NREA 4JV5K 4YHHF 3MUVP 3NS5A 2O8FA 2WVCA 2H51B 3WUHA 5BPMA 2FLNA 3V81B 4W90B 1NBWA 4X4VA 1JLGA 1VR6A 4PUOB 1ATNA 2O8BA 4O3SA 1Z4UA 4DR3J 4ERDA 1N56A 2H4YB 4LF6J 3D2FB 1YZ6A 3FFIA 4QWDA 3PLAA 3T9NA 1BCMA 4DUZK 4O0IA 5GMKa 2YTCA 4OJRA 3D7EO 4CLFA 2FBYA 4CRJA 4DX5A 1NGIA 1F3VA 2AW0A 2QMWA 2CQ0A 3DRRA 1L3VA 3VTHA 1RTJA 5KFMA 1KVJA 1FE4A 3MCOA 1KFDA 4GVBA 3VCDA 5AFUA 1RDUA 3OUYB 4HHHA 2DGWA 4P7TA 1URNA 2GW8A 5KFCA 1RAGB 3HXMA 1BXNA 2GC8A 5AQHA 2QLBB 5ETVA 3ENWA 1PCAA 3THYB 5BN9A 2OMLA 2YJFA 4DR1J 1IR1A 2HGMA 1S1VA 3IR5B 2GO8A 3TA1A 3D2EA 2Q3PA 3MXIA 3VEOA 3MPUB 3DLGB 4M3RA 1UPPA 4CJEA 3CCEN 5AR0A 4KFBA 2V9WA 3OYIA 1ZM2A 2JOQA 2R3VA 3Q7CA 4K50A 4DG1A 4L73A 3D4JA 4B9SA 1LCUA 4P2MA 2MYFA 3H4DA 1GXUA 2WW4A 1TP7A 3KKFA 2O8CB 5KFJA 2BJ9A 2NPIA 2XMVA 4FS1A 1Z2ZA 3R7SB 3QT5A 2UUAJ 1UZDA 4G1IA 2PI4A 4OI6A 4QIWD 1PSDA 2JZ5A 2MKHA 3RWUA 3T1HF 2FSKA 2FVCA 3HVTA 4H54A 3O3HA 2R2SA 2R2TA 3TANA 4Y1CA 4DV0F 2J7UA 3SV4A 4ZJOA 3I5CA 3TW0A 3LGHA 4NRUA 3KLFA 1ZA1B 3NBPB 3MR7A 4UOGA 1YK9A 3EGNA 2A6AA 4ECTA 2N7YA 3H45C 4DL0C 4OVLA 2JEIA 3Q22A 4JRQA 1MG7A 1TMJA 2CPZA 3CJSA 4Y00A 4A57A 5IM0A 1M0SA 4M5NA 3C15A 2E1ZA 2OD6A 1I1GA 1CPZA 2RS2A 2BE2B 3I82A 4WFAL 3V9WA 2DTUA 2NR0A 3K2YA 4DF8A 1YITS 3LGNA 4CF8A 2A42A 2P5OA 1ZPVA 2CJKA 4X4NA 3X1LB 3AA2A 2P9LB 1WF2A 3IBWA 2D7SA 4ZITA 1Q79A 3M30A 3VR1A 1YI2N 5HBMB 3OBWA 3H4BA 3MM8A 1CJUA 4HKQA 1WSRA 2GX8A 2XTJP 2CKWA 1JKHB 3QSYB 2VC0A 3MCNA 2ZD1A 4ZIWA 3CCZA 1IKVB 1XC3A 3OW2M 3E01B 4Z94A 3O5TB 3NRBA 3TX8A 1QSSA 2WC9A 4I6MA 2VICA 1LWEB 4DOZA 1KLMB 2XMWA 1X0FA 3UFCX 1NB2A 1VRQC 5M1NA 2WBMA 1I94K 3RAXA 4IDKB 4CO5A 4QIFA 3KKSA 4WKRA 1H73A 2OFGX 2YNGA 2CVIA 2J8AA 1L3UA 2G8KA 4PG5A 2YHYA 1RE1B 5CZVA 2ZWPA 3SFGA 2CWXA 4GV6A 1K8KA 1HWIA 1WEYA 3SCKE 3PIOQ 4W5NA 3BBFA 1G7CB 3QGGA 2H3EB 2OCEA 3MR2A 5LMNF 2O8DB 4DR6J 3LAMA 3HULA 5C15A 2D69A 1TL1B 1GOCA 1N32F 5FRNA 2W2QP 1REGX 2CYYA 5B0GA 3SI6A 4KGXB 3QBWA 3ZZRA 4OZ1A 4FYDA 1HR0F 2E2PA 3R7BB 4JKGA 2B9YA 1V6HA 1FKPA 4ZPAA 2R7OA 3FR0A 1D9FA 5L9XA 5AXKA 4DPOA 1JQGA 3RYLA 3LA0A 1JNRB 4J9KA 2B6AA 2MGZA 1BOTO 5KOWA 4RCHA 3NH2A 1RA6A 1MN9A 4X64K 1KQKA 1M5KC 4CCHA 4KH6A 1ICEB 3DN9A 4LFCK 3WC2A 4IG0B 3KUEA 4UUWA 4OYAA 2W4PA 2KG1A 3M6UA 1HNWF 2VIHA 4O4RA 3AOBA 4DFKA 2QEXS 4EP4A 2I5JB 4A8XA 1N48A 2OPQB 4I2QB 3VQSA 3G0ZA 4C1NI 4ED2A 1HLUA 4DEZA 3LM9A 4DV7K 2EBEA 4M8LA 1R0AB 2HAIA 2P9GA 3D67A 4B3MJ 5B0AA 5AQGA 3H2LA 2ATQA 1NZ8A 3FGUA 1HIYA 3Q8VA 1VBZA 1HI8A 3MEGA 1YQHA 1CQMA 1WC4A 4EBEA 2O66A 1WORA 1YITN 2V2ZA 3OHRA 3S01A 1WDTA 2HSTA 5AQYA 2HHXA 3WQPA 3VEXA 2Y0SD 3VQ6A 1FD8A 4M7XA 3D0HE 2W25A 4JI6K 1RCHA 2MKSA 1VGYA 1ZS6A 3C14B 3KLHB 5L39A 4ZPCA 3HSDA 1J5OB 2IM1A 4B8AB 4X65F 1SKWA 3T1YF 5KG0A 1W2IA 3LANA 3NAIA 3KDOA 3CT9A 1X9JA 2B7BB 2AQ4A 4OGEA 1RWNB 4OYXA 3EKUA 4DR5J 1MMDA 1ZM4A 3BGRA 4D3HA 1B9DA 5E41A 1QJHA 3G25A 1H3DA 2HIYA 4GC7A 2B5JB 1RT3A 1VRTB 4QWCA 1FKAF 2OIHA 3QRPA 3MEEA 2XI3A 2UUBF 3V6KA 4A61A 3N4PA 5LL6d 4O5BA 2ZVSA 3C8YA 3AVBA 2QC3A 1ITPA 4X4SA 3NF7A 4OKJA 5HMXA 1TU0B 3PDNA 2Z2LA 2WUSA 2HFOA 4WP8A 3FRYA 4NWBA 3C15B 2CIMA 3IWXA 4YDXA 1BWVA 2GELA 1XMOK 3ZTSA 3IO1A 4K8ZA 1B92A 1NJIT 2QWOA 4URQU 1FXRA 3CJ1A 2KRRA 3G87A 1XNRJ 2PT0A 4D3GA 4J5OA 2DVIA 4O55A 1PJ6A 1E6YA 1DJ0A 4R8UB 4IH6A 4M5GA 1U02A 4Y65A 5IV4A 4I1TA 3IBFB 2G8UA 3FSIA 1RAJA 3O4WA 3NMUA 4IG3B 1CLQA 3WQUA 2PD1A 4WE1A 1PAEX 3GDQA 3OA9A 3TJ9A 4I69A 4X2BA 2J5AA 5B0CA 4HYKA 1FHTA 3SMZA 1X4FA 3ULHA 4JYAF 2BJDA 3DLRA 4A5BA 4V1Ak 1ZZNA 3ZTRA 3O3FA 3SBGA 3KJFB 1UWBB 3MPVA 2DHGA 4CLUA 1CULA 3SAGA 3FSYA 4JD2A 3CDUA 4L76A 3S3MA 1W2BM 1E4FT 4K59A 1I94J 5KQ8A 4HVZA 3FEXB 4ZDNA 1XMQF 4CERA 1NDLA 1GX6A 5EU7A 4QWBA 3KLGA 2B9EA 2E29A 3A8JA 4RPFA 2FC8A 2CG4A 1OY6A 2C2DA 4JOUA 2OSQA 3KK1B 1RGIA 2FB0A 3V5RA 3AVKA 1UW4A 4YOYA 2XM3A 2FXUA 3FZBA 4M63C 1LWFA 2OLWA 1C1BA 4TNOA 1EKRA 2IVFB 5CYQA 2I6WA 1MROB 3AODA 2XLIA 1REVB 1WEZA 3VAFA 4PAAA 2L9DA 1KSPA 2G1DA 4H4OA 3KHHA 1N54B 3AY0A 4BRGA 4DTOA 2CPFA 3VEZA 2ZH5A 4DHYA 3JXUA 1BQXA 4O4GB 4OPJA 3Q8RB 4N76A 4Y34A 3CCUN 3UI3A 4X65J 3P4UB 4YOWA 4YORA 3GG4A 4R79A 2MKYA 2M8HA 2UZAA 3R9PA 4FLTA 4GMKA 4B1XB 1HHSA 2VYPA 3CD6N 5DG7A 2Y8YA 4OIXA 2K7JA 1IJJA 5KG2A 3CDBA 4EO8A 3CXCR 4BE0A 1KVKA 4CYUA 3QQCD 2ZH6A 1QQOA 4P2FA 3IA0A 3HPGA 1R8AA 4OHXA 2BOPA 3S9HA 4LREA 2E5HA 1KEKA 3ZFVA 2DFEA 3CD5A 1ZBUA 2WSCC 4UW2A 2EFVA 4DV5F 4IH7A 3KOAA 2HPUA 2GS8A 4OI0A 3IRXB 1TUVA 3LP1A 4TLRA 1W7WA 3SQ4A 4O3PA 4ECUA 2ZBIA 1LK5A 4FBTA 1WUUA 3SSRA 4H8KA 1GOAA 3MK6A 3VAJA 3VETA 1Y5NB 1J54A 1CG2A 4Z4GA 2CJXB 2CXEA 1RZMA 1NJWA 4KTQA 1SZ2A 4Q8FA 3GV5B 2FYXA 4ZVQB 4FF4A 1HHQA 1U1MA 2OTLS 2HFNA 1KVAA 3OYGA 4RW9B 3E9PA 4CI6A 5CHIA 5I42A 2UXDK 4A2AA 2I38A 4MYUA 5IC4B 3CJ9A 1TYQB 3OYCA 3LAKA 3J7AN 5D8HB 2XEXA 1Q9YA 2PBDA 4ILRA 3CYMA 2BEFA 3NF6A 2MQOA 4Q5VA 2DNYA 4CJRA 2EFQA 4IFEA 2E6MA 1URRA 4JI4K 3CMEN 2HVHA 1XMOF 4AD6A 1UMJA 4LF4K 2DR8A 2BANB 3VWSA 2W01A 4F4AA 5GIPA 3T7ZA 1HKBA 2OPQA 3B54A 1KC8O 3N6LA 4C8LA 1RJJA 5T41A 4RO0A 2YNGB 3W66A 1DHMA 4FVMA 4CHOA 2FZCB 2LDYA 5KPZA 3W8GA 3IAS9 2V0NA 3GFHA 1HHTP 2HQ3A 2HMPA 1QVGM 2FY1A 1Y7PA 4IFVA 1HWLA 2YKMA 4TXSA 2W1BA 2Z8QA 3AT1B 2G0CA 4BDYA 3NVKA 2NNWA 3D1OA 2J6TA 2KLAA 5A0YA 2J9EA 1C2PA 4JBCA 2IVYA 3QIPB 5AQFA 3V4IA 1RAAB 3TZZA 1FKOB 2YHWA 3HPHA 2CADA 4Z4IA 2GNKA 2DTJA 2E5LK 3VEWA 2DJWA 3GFYA 2AJQA 3SYZA 2P9LA 1NEEA 2IVMA 1AXQA 4J2DA 2GEMA 4I0WA 4N8OA 3L3UA 2GO9A 2NPFA 1U1PA 2E88A 2OPPB 1S99A 2BE2A 1W26A 2ZZNA 2WVEA 2QZ8A 4DX7A 2QIFA 2V2QA 1N0UA 4DR7F 2R8KA 2GGPB 4F8RA 4P2XA 4ECQA 1RYRA 3W1YC 1NGAA 1F6TA 4E1MA 1ZM9A 4DV6F 2RUGA 3HOSA 3ULEB 4WTOB 5ADXA 2MGZB 3NKYA 3SUPA 4CGGA 1E3MA 5KFFA 3ET6B 2E8AA 3LDPA 2MKJA 4AHRA 4YN3B 5KFHA 4WF9Q 1NJIO 3IAYA 2Y1IA 3D1QA 3DLBA 2ASLA 3T1YJ 2FF6A 3LM2A 4QS9A 3NS6A 5HRRA 3Q7BA 1T6DA 4H5WA 2FBXA 3LDOA 5KGXA 2B4UA 1FWKA 1XERA 2H4WB 1HD1A 1SJQA 2ZM6K 3VGUA 5BREA 3TSQA 2Q31A 3GIRA 2E20A 2CRLA 1VRUA 1RU1A 2VJUA 4FOIA 4CHYA 2Z30B 2QYCA 3OR2A 2VODA 3RUBL 2Y1JA 5I3PA 2X1FA 3M2UA 2IS3A 1UWBA 1KP6A 4PKGA 5HMYA 4J9NA 2ZE2B 3MM7A 3JB9k 1RHMB 4RBTA 2NUHA 1NGFA 1KOHA 2P9IB 4UY8O 1XUPO 5K8PA 2NXEA 4FK4A 3C6TB 5J2MA 3BJYA 3A8KA 4QR0A 1K44A 5M2UA 1HNZK 4OX8A 2XI2A 4FJJA 4OLBA 5D77A 4CJQA 3BR9A 2VWJA 2DPJA 5T14A 4EYHB 5H9EJ 4LQ3A 1UAXA 4OI3A 5IV3A 2MY8A 4MDBA 2ABYA 1ZBIA 3EEQA 3UVJA 3QFUA 3GILA 4NE9C 4CO0A 1HPMA 3AVCA 3DOKA 1O5JA 2C22A 2PE8A 4I7FA 3MEDA 3V6JA 2YWWA 1VQNS 2HWTA 4LD0A 4P71A 5A6WA 1ESVA 3D2WA 2ZH7A 5KFQA 2X1GA 2JVRA 3E3XA 1I94F 3PXGa 6FDRA 1PBUA 2IRYA 2WVBA 3KHYA 2QWMA 3NGKA 3C3LA 4XTTA 4BDZA 3ID8A 3RB4A 3MN9A 3ZSWA 1LW2A 4OQJA 4BRHA 1RB0A 1T9XA 2LU2A 3KVGA 2VFRA 2YX4A 1LW2B 4N5SA 1U2FA 3ZSRA 3U1NA 4FYVB 1NM1A 2V52B 2QA4G 4NLSA 5IT9U 4M41A 2ERRA 3NCRA 5HRNA 1N32J 1NU4A 5C2CA 1NGHA 2W9BB 2DR5A 3N5FA 2FC9A 4WPAA 4LF4F 4OPKA 2B8PA 1WNSA 4CECA 3SLCA 1HQEB 2W7AA 2BYCA 3P5BP 2IVNA 4J9OA 2MSTA 4C8YA 2BMBA 5J1PA 3CERA 2FUG9 5F0WA 4LY7A 3HI0A 2F4VK 2EFNA 5HL7Q 1UJ5A 5DGAA 3LDLA 3DGPB 2QL5B 5FLXU 4DV6K 1IBMK 3KG4A 3HX9A 3AO5A 4U6PA 4DX6A 2RRBA 4DB3A 1QAIA 3FFIB 4CD3A 2FJVA 4BHQA 1XR6A 5JVGL 3O9SA 3N5BA 4I4BA 4DR6F 1J6ZA 4BBYA 1BWFO 1O6XA 1LFPA 3ZEUA 5HLFB 1LEOA 3M7VA 1YBUA 3CCQS 2GTDA 3VF4A 2C2NA 2CQ4A 1HYSB 2ATLA 4JI4F 2QXFA 3WX8A 4X66F 2B56A 1WG5A 1L5UA 1SIZA 2CA9A 1C0MA 3I87A 3W5ZA 3R97A 2GMLA 3LUYA 1TTHB 2QWQA 2ZBPA 4V19S 5HQMA 3V6DA 1IO2A 3KLIA 3SEOA 3BGFA 3N4QA 5EX3A 1IG8A 1PKUA 3SCLE 4CT9A 3MUMP 5C5JA 4UOFA 3EJMA 7AT1B 4HH0A 2V9KA 1WB9A 2GVZB 4JI7J 1MU2A 2H5JB 3AQOA 3MXMA 4FK2A 4MLHA 4CEEA 4B9UA 2KN4A 2CQDA 2YCHA 3J80O 1CJUB 5HVFA 2V69A 1GTEA 2QYGA 2F8SA 5KG6A 3CFRA 2B4VA 1KN6A 1SC6A 3T69A 2V94A 1UEUA 1VQ4N 3MMAB 4FS2A 1E4GT 4J9SA 4YB5A 3ZEUB 4TU9A 2IDLA 2A3JA 4I6MB 2E2NA 3TX0A 5J2NA 2FLLA 4IJNA 3KK1A 5FPEA 1WUAA 1K47A 1QLNA 3S1TA 3QSIA 1VQOS 1JCEA 4F3QA 4FWOA 1AW0A 5CD4H 3THXB 1WC5A 3ZZUA 5IFMA 5M1FA 3MOJB 1IBKJ 3L2VA 5IT0A 1M5PC 3MM8B 2E1CA 1T9UA 1T02A 3K0JA 1R8HA 2IGIA 4LFCF 4A5AA 1RBAA 1T9WA 4QPTA 3VGLA 4WZMA 5ETLA 1JB0C 1CULB 1WHYA 3IWNC 3TNVA 2XGPA 4OGCA 1IBMJ 1FJ7A 1GXTA 5J2MB 4OZNA 5J2QA 2BZ2A 2R8JA 1VSHA 4E19A 4CH7A 3RBDA 4Y28C 1ZM3A 4LRCA 3CMQA 2XMTA 3P8BB 4F26A 1SH2A 4JI7F 4WKYA 2FJBB 4U9RA 4FJ8A 2PMWA 4PA1A 3AB4B 2YY3A 3IG1B 4HTJA 1CC8A 1TK0A 4LR8A 4ZVTB 3EVMA 2IM0A 2CQIA 4FZYA 3FZFA 1CZ9A 5AQTA 1XMOJ 1T3VA 1VQ5N 3H5YA 5L1LA 2VONA 2V4RA 2LKZA 1HYZA 3RB0A 4JKGB 3EXCX 4RW8A 1Z25A 2VFTA 4QU7A 2RIJA 4CLZA 3DXBA 1W9HA 3DI6B 2CJQA 2XYPB 5E33A 4N41A 4EZ9A 2KFYA 5D0RA 2V7YA 3OFEA 5KFTA 1HKAA 2MZJA 3OYLA 1EHWA 1VSMA 5AQRA 1HW9A 1W2BR 2QEXN 2MB0B 3QFWA 3MECB 2O8BB 4MDAA 1M1KT 4RU2A 4RKUC 4DKWA 5L1IA 2NZCA 2ZC4A 3GR1A 4UQTA 2UVVA 2CQBA 2I0XA 4BRLA 2XSFA 1JMTA 3W2VA 4LF5F 3MWTA 1FI4A 5HL7L 2A1BA 3UCZP 3VGVA 1XJWB 2DD8S 2XC9A 2OA8A 2ZH9A 5JMVA 4ZLJA 5IOLA 2XYHB 3VQ7A 2VKZG 3LDNA 3WZ0A 4OJ3A 4GKKJ 5KQDA 2BJ7A 3ETMA 5F3ZA 3CDEA 4JV5F 1HBUB 4Q0BA 2WCXA 3G82A 1RADB 3AXMA 3MAAA 1X4EA 4CEOA 4DCHA 4LC9B 2R2RA 3H5UA 2VG6B 2WONB 2EG2A 4N47A 2W7PA 1R8PA 4MIBA 4FO0A 1HBUA 3SXLA 2W9BA 5A2QY 5BPNA 2DNHA 1VQ8S 2R8HA 4KBIA 4BQZA 1CXQA 1WSIA 5EGYA 3HMJG 2ZJRQ 4DV4F 4DR6K 2YNHA 1X5OA 4PXCA 4K4TA 4MQ3A 1G6BA 1GEHA 4FJKA 3ZZYA 4K0KK 2JJ4D 4WFNL 1RTIB 2G8FA 1M5OC 1X5TA 4L8RB 1WDDA 2VG7B 1FE0A 2BM1A 3NCPA 1U2RA 4YOUA 1C4CA 2W4CA 1RDDA 2J7WA 4KHPK 1R6YA 1S1VB 3M5RA 3BSNA 3K57A 3L4QA 4CGHA 2FJWA 5JVHL 4OL8A 3THYA 5LJ5Y 4JNEA 2HIQA 4Z4EA 2DNPA 3W61A 4FOEA 1Y11A 2WZ1A 3ILOA 1TQLA 1NB7A 1X9WA 4O3QA 1BO5O 4JYAK 2X1BA 2GX9A 4RWXA 3HYFA 4RW4A 3MD3A 2EI5A 1S6QB 2D0OA 2OAUA 3DM2A 2ZF5O 4B3MK 2V8VA 1AUDA 5THWA 1KFSA 1RDAA 1U04A 4UY8T 5EWGA 4RW6B 3UKRA 5KFPA 1N34F 3IR6B 2I2YA 3T1HK 1Y64A 1QM9A 4JI1F 4X4OA 4NLYA 3A12A 1FXXA 3PO4A 1VQLS 2LQ8A 3HKWA 5E3PA 2UV8A 1ROFA 5B09A 1YRUA 1I51B 3NAHA 3ZT0A 4CI0B 2CQ1A 2DISA 2EFPA 3TSPA 3NGYA 3T9ZA 1GMUA 4K2JA 4ZVEA 2DXEA 2OEKA 3SMSA 5JLHA 1QZ5A 4DQIA 1C1CA 2E2OA 3MCMA 1JLQB 4PCQA 3ENHA 4LF9K 2SXLA 4KQZA 4OZ5A 2XY8A 3QPIA 4NCGB 1C1AA 1S1WB 1ULRA 4K4YA 1SV5B 4OHVA 1IH7A 3AGKA 1EAYC 4XAKA 3TUPA 3F73A 3PW0A 1CJTB 2UXCK 5JICA 4DCOB 1U25A 4TU7A 2HK3A 2OD4A 4ILGB 3NL0A 1WN7A 5KFKA 3EZUA 4I67A 2DKOB 3RMDA 4PQAA 3ZNUA 4AHVA 4BS2A 3U9DA 1NK7A 4JI4J 4CEBA 1NRKA 3K8VA 2G2YA 2YV0X 3OT9A 1GT8A 4CJTA 1FRIA 3VF6A 2IIHA 1DEJA 2XCAA 2PGCA 3R1XA 2AJ1A 4JI0F 3H46O 2QN6B 2AA4A 3VAMA 3JS9A 1Z6RA 4AXIA 1F2GA 3OR1B 2UUCF 4JD2B 4W4MA 3R5CA 2EXUA 3WEEB 3OYBA 4JI5F 1T11A 5EXWA 3M2UB 1E6VA 3UD4P 1UPMB 4A47A 4UZCA 1SVDA 2ZDOA 1NK6A 4LRDA 1AT1B 3PM9A 2KYZA 3PSFA 4AHUA 4NCAA 4RNNA 2IRXA 3HVRA 2ZHBA 4LF9J 3A13A 1Q82T 1RAHB 3O5BA 4MKAA 1TKXA 1R59O 5KG1A 4JK8A 2GCFA 3OFGA 1LAWA 1HNXF 4W5TA 3VQ4A 4PPZA 4QIEA 1CZAN 3HHNB 1VDHA 4ZP9A 1K1SA 4BRIA 3B6OA 5KG4A 1VQ6S 3VGTA 2DRAA 1ZXOA 3GYGA 2HHTA 4KB0A 2ASPA 1SL0A 4ED5A 1EO1A 1RCXB 3BDPA 3E9LA 2LA4A 1BUPA 2F4FA 5E26A 3T6BA 1HNZJ 1P1LA 2B0GA 4F2RA 3PG9A 1JLBB 3CNQP 2ZOMA 4KGVB 3FZ2A 2GIFA 1FJGF 1KQGB 2VG5A 1KONA 1OJ4A 4KBOA 2Q6CA 2BABA 1U7LA 2N4CA 4LQ9A 4U7UD 1X7VA 2VCPA 3W8PA 2PFUA 3PX6A 4KHPF 2ZH8A 3P6YC 3S8SA 4AT1B 1N5VA 1HMVB 2BH1A 5CZ1A 3BV8A 1YG0A 5E7OB 3RSEB 4FDFA 3HI9A 3N0VA 4C1NK 4LR7A 3DLEB 1VMBA 1J5EF 2JEGA 3ZSXA 4LRAA 2HF3A 1EIYB 3Q2SC 4F50A 4YMEA 4DPYA 3EE9A 3EKSA 1OVQA 1B0VA 1GTHA 3SQGA 2D3ZA 2H54B 4DV1K 4ZMMA 3DDNA 1BA1A 2K1RA 3A4TA 5AQWA 4DBQA 1JJHA 3ISNC 3WC0A 2WB4A 2DGUA 4CZKA 4I9LA 4J9PA 2F9JA 1GK8A 4XPCA 1R43A 4A8KA 2WVFA 1TV6A 3D2EB 3EZOA 1AB8A 3CCTA 4BRCA 4DR1F 3TTFA 5GAGP 2QM1A 4IRCA 2Q0UA 3TUJC 2VBWA 3H25A 1XR5A 2F5GA 3PSIA 2ZJPL 2YHXA 1MMLA 3HDSA 2IIRA 1FRMA 2GZOA 3OYAA 4YS2A 4ELTA 4NXNF 4O3OA 3BQ2A 4Z4FA 4WE1B 2ZDPA 1DTTA 4YY3J 5HATA 4B9VA 4ZVHA 1IR0A 2LLZA 1YXQA 2MKKA 3SQ1A 1ZAXA 2CNOB 5DETA 4CEQA 2BKOA 1X4DA 5GAEP 1KR4A 5KFIA 2KXFA 3CCJN 4B9QA 4FF2A 3U4LA 4R8UA 2AEMA 1AROP 2HQDA 1NJYA 1IWGA 1ZZFA 2YI1A 3CQ8A 4USKA 1C0UA 1KBRA 2WTFA 3MM9B 2GA7A 1WJ9A 3JSMA 4CFCA 1V9OA 3O1LA 2HBLA 1WEXA 2AF6A 3CTRA 2GFFA 2RDDA 2X3DA 4HT7A 4MKBA 2ZH3A 3RVCA 3AARA 1KTVA 3LOUA 5KFGA 2HZAA 1RAIB 4RUCA 2OI2A 5KRSA 1IG9A 1NHKL 2XY6A 2D3O1 1CJVA 4ZVPB 5F8MA 4B3TJ 4AL6A 3SCIE 4ED4A 2F8MA 4G1PA 5DQHA 1RWXB 1TL1A 2PA3A 4DS5A 1G15A 1RQ0A 2RQMA 5BYSA 4Z37A 1H74A 2GGPA 1HJOA 1SS6A 1VHXA 3G6EN 2P2CB 5HJXA 3G2XA 1VOMA 1XMQK 3U3YA 1EX8A 1JX4A 4IOAL 4C0HA 1JLQA 2PFDA 2KHOA 1VSFA 1VBKA 1TUUA 1S97A 3GP9A 3C0BA 4DMZA 1F60B 3KHRA 1GH8A 1R8CA 2KXHA 4E98A 2O5DA 4CF2A 2HHHJ 3DCAA 5CYQB 5FLXO 1EB0A 3HKZD 4FN5A 3QT7A 2B3TB 4KV8B 2MKIA 2UVUA 3G6XA 2XNQA 4CLKA 1HBOB 2P9EA 2HBMA 4ZVRB 4JHDA 1K8KB 3P45B 2LP4A 3MEDB 1CVJA 1HBOA 5T7LB 2R8IA 3I9ZA 1IKWA 1T3NA 2GAHC 3FNNA 3HZGA 3E51A 3ZZZA 3DHWC 4YUDA 3NMAA 1NLKL 2QGFB 5EOYA 4P2SA 1Q81O 2MKCA 1WOOA 2EWSA 4PQUA 1F5AA 4C0OC 2HKEA 1U1OA 2Q1NA 4WFAQ 1KD1T 2KI2A 2H65B 2E5IA 3H40A 4OV6A 1W0HA 4DV5K 4DX8H 4J8FA 4I7FB 4N8NA 3TR5A 4PL8A 1ZTTA 3R1HA 3LPEA 4YFUA 3V6HA 1FW6A 4F4ZA 5C24A 3M6GA 1QUVA 1NWKA 4IRKA 4QYZK 2Z4PA 4JI2J 1FVSA 2AMCB 1H98A 4RBVA 3OTCA 1YIJN 4C0BA 1H7WA 4HHTA 4GV3A 4DJBA 5KI6A 3HFVA 3D45A 2MQ8A 1NAQA 1PAUB 1F3FA 1N5QA 2AWZA 1X3MA 4UZBA 4RW7B 4QW8A 4YP3A 5AXLA 3KLVA 5KFLA 5FLXY 2AGQA 4EIAA 4EO6A 3EZWA 4FXVA 4YDDB 1SQKA 1VQ5S 5KT7A 1N88A 3L8BA 4I2PB 3EGVA 3C6HA 2XO7A 3HOTA 4N77A 1RWOB 3K5LA 1HJRA 1MLAA 2KB2A 4JS5A 4BRQA 1RSCA 2JLGA 1WHWA 4X4PA 1ZBHA 4IUFA 3THTA 2VGMA 5EDWA 3MXJA 2LYVA 3OSNA 4HUGA 3S41A 4FZVA 3F2KA 1SQEA 4NEYA 4ILMA 3G6ES 1PYTA 2IJRA 1XK8A 2IAJB 2CJYB 2CPYA 2AKWB 4WBFA 2E7XA 3ZT3A 3K9KA 4LFAF 3CB4A 4MK8A 1GLLO 3OBYA 3PKMA 1S1TA 3MMJA 4I6YA 4CZLA 2XLJA 1T0TV 3TVYA 2FVSA 1WC0A 1WOPA 4DI6A 2LFVA 5LY3A 1HPZA 1PGZA 2R42A 2RN2A 2ZBRA 2I8EA 5M1KA 3MURP 2YWFA 5KFAA 2UU9F 3MR6A 3CPWM 2UUWA 5KRTA 3MXHP 1RTHA 2CG8A 3A5OC 2Q3SA 4DN9A 2VHGA 2OZSA 3HVTB 4K4UA 4WFYA 5CXTA 2VD3A 4GVLA 2X51A 3THPA 2FBVA 5M1OA 1HR0J 1S9EB 4ANDA 4B9MA 4FWKA 2DGSA 2RNEA 4PWUA 3THVA 3M1VA 3FCVA 3IS9A 1KKHA 2YH1A 2FZGB 1U1RA 2CQCA 5AT1B 1D9DA 4DR3K 4DHVA 4M7YA 4X64F 1H0HB 1P90A 2JFKA 3BEGB 3MMCA 3MOZA 2JSXA 1SJ4P 5DDRC 4OYWA 3PJXA 4F36A 5H1SQ 3DMJB 3MCPA 2Q43A 5LOQA 2HFUA 2HWHA 1BL3A 4DSIA 2CNKB 4JB8B 4X4UA 4DXLA 3GIIA 2XHCA 4OYPA 5ETTA 3NEKA 1ZPWX 4ZPTR 1IKWB 3AVFA 1HBNA 1NPPA 1LWFB 3TQ1A 1RBUA 2ZEJA 1QS4A 2KDOA 1VIXA 2PMZD 1SKRA 3HT0A 3L9ZA 4U95A 3ZNJ1 2GQCA 4CZEA 3IC1A 1GLAG 3LDSA 5JXSA 1VK0A 1QHAA 1BQMB 3C7NA 3UVJB 2K2PA 2NRWA 1WC1A 1IBLJ 1ZAWA 1YJ9S 3O4QA 2QJ3A 4FYXB 4RW8B 2VPWB 2ZNYA 2DK2A 3KK2A 2MQLA 3OYNA 4B3MF 1QDUB 5DDQC 4CJKA 1P6TA 3TABA 4MMOA 1F9FA 4PPDA 5LJ3Y 4BR4A 2YKOA 2UUBK 2AU0A 1CJKA 3SV3A 3W65A 4GO5X 4URSA 4FF3A 1B3TA 1XTZA 1G4CA 3G8QA 4AM6A 4IR1A 4KKOB 3L2UA 5IQ6A 3TVZA 3OTOF 1KAYA 5TKYA 3HZ6A 1JJ2M 2XWXA 4JKEA 1J9AA 1HNZF 3J7YU 2I7PA 2DGVA 4HI1A 3AA3A 3OV7A 1N34K 1HNIA 2BE9B 4CD1A 2KM8C 2JEFA 5D4NA 1UETA 3OL8A 4M3UA 2Z2ZA 3MN7A 4PYDA 1YWXA 1KOOA 2N4DA 1RHRB 3BREA 1Q8KA 4A8QA 3OS0A 1MSWD 4USJC 4L75A 4DR4F 2Q1LA 4E1JA 1U45A 1K0VA 4FWLA 2RMLA 4WYLA 3BZKA 2GHVC 3R5JB 3HSTB 1AYEA 1DTQB 3DXSX 1HD0A 2CJ9A 3VQAA 4CF0A 4H03B 3ISZA 4R5PB 1SKSA 1CQNA 4HL9A 1Y4ZB 4J9VA 1J2VA 1HNXJ 4B17A 2B9WA 1I3OB 4H5VA 3U27A 2VOPA 3CWJA 4A8MP 4CYUB 5LXRA 2F8HA 5GIOA 4DTMA 4ED3A 1PJ7A 3ITHB 3CCMN 3I56S 4ECRA 1NGJA 2XULA 3D5MA 1YTAA 4K0KJ 3F9MA 2JWKA 3RB6A 1LXJA 1V4SA 2A18A 1FFWB 2NRXA 3LWMA 3C19A 3T41A 2DR6A 4LF7J 1LK7A 3W2WB 2A5XA 1R27B 1C0TA 3BO3A 1V5VA 1RBTA 3ULDA 3WNFA 4JAXA 4J9UE 4B9NA 2NLWA 1ZBTA 2P5GA 5AJ3K 3IWLA 2A41A 1D9AA 3O80A 2HEKA 3DXKA 1UP1A 2VZ9A 4OI2A 2QO3A 3VF2A 4CZCA 2H5IB 2IHR1 2F40A 3RTVA 4PL7A 2HF4A 4FW2A 2DNNA 3O9RA 4YDUA 2R7SA 5KFOA 5AQKA 5DM7Q 3CCMS 4H0TB 3U7JA 1X31C 2M0GB 1TL3A 1UFKA 4BDPA 2PO4A 3DM2B 1VJQA 3GFZA 4ED7A 4FJ9A 4DL7A 2HOEA 3CIMA 1RAOA 3JQKA 4E0DA 4DSLA 2U1AA 4FKXA 3H08A 2LXFA 2UXDJ 5DG8A 2IBKA 5C42B 4DR2F 4M3ZA 3OXFA 5CE3A 5C0YA 5DM6L 4K4VA 5H1SV 4I6AA 2J0WA 2FSNA 3OPKA 3RBXA 2VASA 2KZMA 2LEBA 4ZIVA 1S9GA 1RT6B 1SJFA 5AQXA 3QO9A 3VGMA 4MTPA 2ZH2A 2L08A 4BWJA 4EWTA 3TEHB 3M2VA 5L46A 3PYFA 1YJ7A 4JI1J 3HPOA 2MZQA 2HS3A 3DRYA 2MTLA 3J8AA 3N79A 3K9JA 4M5HA 2RB7A 2ILZA 2KZZA 2AX0A 2XHWA 2DGQA 4QJVA 4KHRA 4MYTA 2ACYA 1N33F 4USIA 3NAEA 3ET6A 1LOUA 1NK8A 4CF1A 3SI8A 2R4FA 4IOBA 2MMYA 5HOOA 4HR2A 4JHDB 2CDQA 3GJQB 4KSEB 4YDUC 3D7SB 2LEPA 4KO0B 4JI7K 3AOAA 3VTIA 3KLEB 4ICLA 4ZJLA 3B6PA 4DLGA 3KUGA 3VQDA 3DDIA 3AGRA 4WFBQ 3M30B 4TVAB 4J90A 2Z56B 3A2FA 1KVBA 5C2GA 1V3ZA 4DR1K 3SIPB 4JYAJ 3BKUA 2VQEF 3TZYA 4DCJB 4DPWA 4KC5A 4DU1A 2OEMA 3QAEA 3UR3C 1FFSB 4FJIA 3SBMA 4C3KA 1JXLA 1D0EA 3W9HA 3TAGA 1Q86T 1Q82O 2ZE2A 3CJAA 4W5RA 4BY9C 1Z05A 2GMHA 3K5OA 3BH6B 2OTLN 5BR8J 4IEEA 2YKNA 4GKKF 4C9DA 2M9KA 2VBYA 1NKCA 4K8RA 4KJIA 4LFBJ 2DH7A 3GIKA 1BI4B 3ID6A 4JK7A 2WHOA 3UKUB 5KGWA 2MHNA 1S72N 4J9MA 2X6NA 2F4VJ 1RWPB 4H0YB 1RTJB 4B3TF 1WF1A 3C65A 2IC3A 3NF9A 3CCVN 1QHTA 3HFKA 1BIZA 1SI9A 1SL2A 2K1RB 4DV2K 3ENVA 4NLPA 4LT6A 3C6UA 2IJNA 4H0VB 3ADAC 3CDAA 3OYJA 3IGNA 3MPWA 4MAKA 3MPDA 2QT7A 3WX4A 3AHPA 3HO1A 2OTJS 1Q53A 1XNRK 3N6MA 1NDKA 4RNFA 4J9LA 3LDQA 2PEBA 3ZZPA 4GVBB 4IZ9A 1VQSA 4RBUA 2F9DA 4I2QA 5AQUA 4L3QA 1VC5A 1QVFM 1IJEB 2ZZTA 2EWHA 1PO6A 1K6YA 4DV4K 1G99A 3BSOA 3J81O 4DQRA 1BIUA 1OPZA 2GQQA 3HRGA 2BJ3A 1N5YB 5LMUJ 4FJ5A 3M8QB 2A1RA 1ZA2B 1NUEA 3QT8A 2N3LA 3W63A 2FGOA 2G0IA 3R5AA 3IS9B 3MF5A 2XS7A 3TA2A 1IBCB 1RDBA 4NLXA 3MM9A 3CO9A 1DZ5A 2VPZB 3ZT2A 3IGVA 1YJWS 2WK4A 3T1HJ 2KXNB 4BRKA 3E9OA 2AJ2A 2MZSA 5LMNK 3N28A 3DGPA 4RNMA 1DFDA 2NQPA 1RTIA 2MHEA 3CXCM 2RH3A 4KGZB 4Y0WA 3DMJA 1YBAA 2Y0BB 2HNZA 2DNRA 3UO0A 5CHCB 2KT2A 3TAMB 3NVMA 5KT2A 3P1GA 4KI4A 3OXLA 1LOTB 4C8NA 1TUWA 2EX3A 5B0EA 3VA0A 4GRSA 3M6VA 3BYRA 4CE9A 4RWTA 4Z4CA 4QYZJ 1ASUA 2Z58B 3V4MA 1T9VA 2XZTB 3A0IX 5D3GA 3CCLN 1U6ZA 4WTYA 3DNCA 1VSDA 2V34A 2HHPA 3GMGA 4CBXA 2BW2A 1PILA 2CJAA 3MMAA 3H7HB 3PV8A 2NXNA 4CJPA 1HYSA 3WXLA 1WHVA 3G71S 1A9NB 3UDLA 4H0OA 2ZOFA 5KTQA 2LSNA 5E3RA 3J81Y 4A8FA 3EICA 2FLOA 3D6FB 2RQ4A 1O0PA 3RAQA 1WG1A 1XNQJ 2A2CA 4J9RA 3CJ0A 4ITSA 5AZIB 4DTJA 4ZCMA 4CP5A 5I3UB 2GVDB 4ZS6A 4RL1A 4CZGA 2FQQB 4EFAC 3AAQA 4FJ7A 5DGBA 1D3WA 4CTAB 4JV5J 1VHFA 4FVCA 2WOMB 1K8AT 1VQMN 2RHKA 2GJFA 4LBHA 3SJJA 5C12A 2O67A 3O1BA 4PG4A 2D3OR 1E6VB 4WCEQ 4ISGA 1SBRA 3PJ9A 4KB1A 1JLFA 2W2PP 4X84A 2X74A 1S9GB 1QAXA 4DMNA 3VV2B 3MM7B 3H59A 3LZJA 3KTQA 4JLHA 2AYBA 3RBEA 2ASYA 4LFBK 3I0SB 4CLWA 4P52A 3P5JA 3PX4A 3D9BA 2HYIB 3BSCA 4KAIA 1U0HA 3ZSOA 4J9QA 4EBCA 5J2QB 3ICLA 4LF5J 1Y3JA 2MQPA 2PI5A 4NMXA 4LF7K 2F4VF 4FNIA 4MK9A 2AJ4A 1S0VA 1REVA 1Q1KA 2AEFA 2ASDA 4JI3J 8ATCB 1A5VA 4Y3CA 1TK8A 3BM7A 2W6KA 2L41A 1VLYA 2ZH1A 3GB0A 4USWA 2OKQA 4Y6IA 2EEYA 1S49A 4KKOA 1U2CA 2VDHA 1YTYA 4LF4J 4I68A 2DGXA 3QYYA 2RRNA 3C2PA 4WCEL 3KD5E 5F8LA 1QUPA 1S59A 2JX2A 4NLWA 3VAGA 4C8ZA 2XQCA 4UOHA 1C0GA 2QA4S 4FP9A 3M8RA 4BRFA 4ID1A 1RHJB 1IKXA 3I9V9 2VBZA 3NGTA 3I8DA 4B3TK 3S6EA 4QPXA 3CD6S 1ZH5A 4JI0K 3A3NB 3L95X 3R3LA 5U47A 2VJVA 5ETKA 1M90T 3VESA 2WB1D 1JK9B 1CC7A 1RT7B 4I64A 2UUAF 5GAEI 4Q2MA 4LRFA 4USTA 3AA8A 3V1OA 3P39A 3I0RB 3QJPA 3A8EA 4BE1A 1YUWA 1RI7A 2AGPA 3M3ZA 5ADXH 1UVKA 2KH9A 3TSUA 3NNCA 1RKJA 2RF2A 1JLBA 4BCAA 3BGUA 2VBXA 4K8XA 3GQCA 3SNNA 4ETXA 2CDRB 1WTBA 5C25A 1S6OA 2ZBCA 2AYEA 4ER8A 3BH7B 1GFWB 3H20A 2CGLA 4ECSA 2FJXA 3A8IA 2DFFA 2WTUA 4FPIA 3BF3A 5HJYA 2JVOA 3UN2A 3HSJA 4Q2LA 1IN0A 1OO0B 4A8WA 3SPZA 3J7AP 2RU9A 4DR2J 3DFEA 4DL2A 1F5BA 3LWLA 4Q44A 3PR4A 3O9TA 3AO4A 2HFZA 2HB5A 4KGKA 5M2RA 1SAZA 3LP1B 3M05A 1X9SA 1DQ9A 2AHOB 5KT4A 1V3SA 4E7IA 2VFSA 3FC9A 4CDIA 1K9MT 1B70B 5FPMA 2YNHB 2B4OA 5LMUF 4ID8A 4TYBA 1DTTB 2P9SB 2FSJA 3AVJA 1HYVA 3MDQA 2NXCA 2W9AA 3GG0A 5DK5A 3ZSVA 1X5PA 3FVYA 2UVWA 5IXUA 2OGUA 3D3CJ 3BGRB 1WI8A 2DNMA 2Z57B 3GSIA 3Q8PB 3ZZTA 5D78A 2A6OA 2IVPA 3CD0A 2KFNA 2MZ1A 1ZC6A 1ITGA 2HURA 2HMIB 4HACB 3M9NB 3WNGA 3R6GB 4X62K 1VYAA 2JL9A 3IXQA 4IOXA 1MW7A 1KXPA 3W9JA 3HCXA 4IKAA 4BQLA 4LSNA 1RWKB 2KKZA 4KHYA 3CJCA 1UJ4A 2LQBA 1AFJA 1TFWA 4XDDA 2AT1B 1EKSA 3H1VX 5DLGA 4YB6A 1NGCA 2XRIA 1H6KX 3PEJA 3QBCA 2J9DE 3W5XA 3EYZA 2V8PA 1RT6A 1L3TA 4BG9A 2CH5A 2NUUG 3JSMB 3QIPA 3DOMB 3BGLA 3AJDA 3M8WA 1QSLA 1IQZA 2HNDA 1U47A 4URGA 4YR2A 2RVJA 4QW9A 3VEVA 2HQCA 1R6VA 5AQIA 2XNRA 2RQKA 1TUGB 2ZZMA 4A2BA 3QINA 1U26A 1NOZA 1KC8T 4IKFA 1F1BB 2O4IA 1FWLA 3UD3P 1SC3B 4LFBF 4CTAA 5ETOA 2DXDA 3K5MA 4IDKA 2DPIA 3R9LA 3G9CA 2KVQE 2CAJA 5H9FK 1VAZA 2VQFJ 5AQNA 4LSLB 5BR8K 1HW8A 2ITGA 2C2EA 4CHNA 4DUYJ 3IG1A 2YKNB 4TLQA 4WK3A 5DM6Q 5LSRA 2B6AB 1UVNA 4O3RA 5K20B 3C46A 2WRMA 2NRVA 3FQLA 1D1UA 1CJKB 4K4WA 4JKCA 2AZ3A 3UIQA 2V50A 3SUOA 3L4BC 4M5LA 4I9QA 1QTMA 4UTGA 1S1XB 3HF5A 3OTOJ 1LWCA 1IM4A 1TKDA 1T44A 1NJZA 1LXNA 4EHTA 2JHEA 1YDLA 2XS5A 1TKTB 4NXNJ 2MZRA 2F7TA 2OTJN 4IDHA 2ZUAA 4MIWA 2EK6A 4PYAA 2NSBA 3OL7A 3NF8A 3SMPA 1WBDA 3VVUA 4V19J 2KU7A 4NLTA 3SJHA 4WYWA 4LF8K 2QKBA 3WEEA 4C11A 1H1VA 3R5BA 5L38A 3AB2B 5KAKA 2AEJA 3NCQA 4CGJA 4U7UK 3CI5A 3MFIA 3OR2B 2QK9A 2E1YA 3M8YA 3VMFB 4YR3A 3T19A 1NDCA 2ZHOA 3QEIA 1ZBLA 2MXYA 3AVNA 1HQ2A 4YEAA 5AE1A 1TKTA 4FW1A 4KR0B 4H4OB 3O44A 1TV6B 3CCSN 4DR5F 4CHPA 3TU5A 1AZSB 1TL5A 1EP4B 2YJEA 3T5HA 2EW9A 2K7KA 1NPRA 3J7A1 2ASJA 4LH5A 1RGVA 3WXJA 4JN4A 3VA3A 4LIRA 4GVEA 3JAMO 2HHSA 1FF2A 2MJUA 1TKZA 3KDNA 3AD9C 4WIQA 4DG1B 4USVA 1WC6A 1LW0B 2LQ5A 4F2SA 2HW3A 3CQYA 4LMZA 4ID5A 1BUXA 1KLNA 2E1MC 4J37A 1SB6A 1NSQA 1FDAA 5GADP 4KH4A 2YPZA 4DR7J 1KWMA 3G10A 4IOCL 5KG3A 3J7ZT 4DV7J 4KPCA 1OH7A 1VK8A 4CGIA 4ILLA 3QBXA 4CLTA 5KFZA 1X60A 4PY5A 2HLUA 4PG7A 1YJUA 4DV6J 2AP1A 3MM6B 1OYDA 5AZJB 4ECYA 4ZP6A 4ES2A 4LIWA 2VG6A 2WONA 2KT3A 4GKKK 3HL8A 3TOQA 1YAGA 1GLEG 1DQAA 4ZN3A 3KUHA 2R9LA 2E1AA 3VQCA 5BN8A 3E2EA 4AH9A 4FM2A 4A59A 3J81j 2A2DA 2FY8A 5A2QU 1FXDA 4NLOA 4NA1A 4ATNA 1U4BA 1NH8A 1XMQJ 5AQQA 3VF0B 2A10A 1VC6A 5B8HA 1O8BA 1VS3A 3LALA 4DV3F 4CM0A 4E7LA 1R0CB 4NLRA 5LMUK 2O8EA