1EETA

Hiv-1 reverse transcriptase in complex with the inhibitor msc204
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Urea-PETT compounds as a new class of HIV-1 reverse transcriptase inhibitors. 3. Synthesis and further structure-activity relationship studies of PETT analogues.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 153
structure length 542
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1eetA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1eetA05
2WONB 3DLKB 2VG5B 3V6DB 2HWIA 2FBVA 1S1TA 1RT6A 3OL6A 1FKPB 4KRFA 2V9WA 2ASJA 5KFTA 1G15A 4LSLA 3B6PA 5HROA 4MIBA 4C8OA 3VQEA 1TKTB 3ULDA 1N5YB 1NJZA 3VQDA 2ILZA 1IH7A 3K2PA 3HM9A 3I5CA 3QGHA 3NGDA 3H40A 4K4ZA 1J9AA 2GUIA 4DQQA 3DLRA 2XGQA 1RT5B 1YVFA 4ZVHA 4YP3A 2DY4A 4HUFA 3WNHA 1LWEB 2OPPB 1JLAA 3T5JA 3AVIA 3OYJA 3OL8A 4DTJA 4Y1DA 3LWMA 3AVLA 2IJNA 4R8UA 1RTHA 2Z1GA 3F73A 5CYMA 3AVBA 5C24B 5KFWA 3AA2A 3G10A 1TV6A 3BSCA 3HYFA 1JLBA 3HL8A 3AVHA 2XC9A 4OKJA 3CIZA 4ZVFA 2IGIA 2ITGA 4ECSA 3QGIA 3QEWA 4FJJA 3KKRA 4RW7A 1RDCA 4ECRA 5KG2A 1RTIB 2ZD1A 2OZSA 3Q8SB 2VWKA 4ECZA 1LW2B 2AX0A 4F3TA 5SZTA 4K8XA 3PR5B 2UUTA 3ZT4A 4RNFA 2ETJA 3V81A 2HB5A 1S6QB 2QK9A 2BRLA 3AVNA 1DTTB 3NGZA 4E7HA 4O4GB 3AA5X 2VG5A 3V6DA 4IFVB 2QV6A 3ZSXA 1FKPA 1BI4B 4N56A 2BE2B 1S6PB 4CHPA 4DFJA 2IM2A 2IS3A 4GW6A 3VQ4A 1C1CB 4NLGA 4FS2A 4B8AB 4ZVGA 4KREA 2VA3A 1EETB 3NAEA 4WE1B 1Q8IA 4OL8A 1XR5A 1N5YA 3CDWA 3TABA 3V4IB 2G8UA 4ECYA 5DLGA 4KSEB 3MR6A 4M3ZA 2VG6B 3RR7A 1GOAA 2IJFA 2XY8A 4E89A 2C28A 3JYTB 4NLUA 1JXBA 3V6JA 4ZTFA 4TSXA 3P1GA 1S5JA 1RT5A 3OSPA 3SCXA 1L3UA 1ZBHA 1XWLA 1LWEA 4RU9A 4DTPA 2OPPA 4QOZB 2B6AB 1T3NA 2BGGA 4CGJA 1HNIB 3M9NB 1Q9YA 4KHMA 3CG7A 3CJ5A 4JS5A 4KFBB 4FLUA 2Z1IA 3LP3A 2B43A 3AVKA 5C24A 1J54A 3OVNA 4QPXA 1TGOA 5KFGA 2FBTA 1HQEB 4F4KA 2RDJA 1T7PA 3KNAA 4CJTA 4Y3CA 4F50A 2WRMA 2DPIA 3PJXA 1NKBA 1JL2A 3O3HA 1SKSA 3F9KA 4GC7A 1RTIA 4NLRA 1NK0A 3BJYA 3BQ0A 1BHLA 1S6QA 3T5KA 3OL9A 4K8ZA 1S9EB 5KG4A 2IAJB 4IR1A 1DTTA 3N6NA 5KFFA 2FJVA 1TL1A 4IFVA 4FCYA 2A1RA 3G6YA 3D28A 1IKWB 1BI4A 1GX5A 5HRNA 4B9NA 4DSKA 2WK4A 1YTAA 3D5MA 4NLWA 4C8KA 2P51A 1EP4B 1REVB 3DRSA 1UA1A 1TK8A 1FXXA 4WE1A 2X6SA 2HNZB 4AHTA 4ED7A 4ECQA 2Y1IA 5F8HA 1X9SA 3V4IA 3NH2A 3OYLA 4FS1A 2VG6A 4IDKB 1JXEA 3OHBA 2YNGB 1NNDA 1JLEA 3JYTA 3MEDB 4QCLA 4FLWA 2X74A 4ED3A 3I8DA 4UQGA 3HVAA 3LP1B 1S1UA 3K57A 4CEZA 3LAMA 4N76A 4NYNA 2B4JA 4I2PB 2B6AA 3SQ1A 4M3WA 4NLYA 4ECUA 3MTKA 4KHQA 1HNIA 5I3UA 4PWDB 3O4NA 4XPEA 4B8CA 3NL0A 1KVBA 4KFBA 4PQUB 2YNIB 4QWDA 3G6XA 2BANB 2IMWP 4ELVA 2F8SA 4F4YA 1TQLA 2JEJA 1HQEA 4ZPCA 3KLIA 2DFEA 2ASDA 1ZBLA 4IH5A 4CGGA 3GQCA 4M3YA 2UVUA 4FYDA 2GIQA 4CHQA 3S3OA 2IOCA 1UAXA 3RBEA 4W5TA 1NKEA 4BDYA 3ZSRA 1S9EA 4HCBA 1BGXT 3NAHA 4GVMA 2E6LA 2IAJA 3QZ7A 4QWAA 1KVCA 4JLHA 2ZE2B 1WNEA 3LANA 4JV0A 5EWFA 4NLVA 3ALYA 1RBRA 3FRZA 5KI6A 1T03B 5FRMA 3UR0A 3ZSZA 3RMDA 4JUZA 3PW4A 1SUQA 2YNFB 2PYJA 2WTFA 1REVA 4J2AA 4M94A 5KG3A 3H4DA 2HNZA 4RW4B 4CFAA 2YKMB 2XI2A 2DPJA 3NDKA 4DU1A 1IKYB 4IDKA 4AHSA 3I0RA 2YNGA 4CJSA 3MAQA 4FJ5A 4Z4CA 3MEDA 4H4MB 5KG5A 2IM1A 1BQMB 1N6QB 1ZTTA 1HYZA 1RTJB 3PX0A 4WYLA 1RBUA 4NCAA 3TAFA 2W9CB 1BISA 4YR2A 3DMJB 4PWDA 2W7PA 2Z1HA 5KFHA 2G8HA 3ZT3A 4DFPA 3CFOA 4CGFA 4M95A 2YNIA 4RW6B 1VRUB 4BDZA 1VSMA 3ISND 1NK6A 4DTSA 3OJSA 1JXLA 1BQNB 1IKXA 2VG7B 4DLGA 3KLHA 1X9MA 3L2QA 1Z25A 4FJIA 3NBPB 1C1AA 4CJ4A 1WNSA 3CWJA 2BRKA 4JV2A 4NCGB 5DQHA 1W25A 1HMVB 4K4VA 2JLEA 4JV1A 4ZP8A 4RW9B 3LALA 3NHGA 2ZE2A 3EZUA 4DTXA 1VRTB 3QLHA 4DL5A 4CCHA 1T03A 1HARA 1C0MA 1ZBUA 1N4LA 2E9RX 2YNFA 3HPOA 4DU4A 4DSJA 3TVKA 4RW4A 3FDSA 3L3UA 2YKMA 4ZPBA 2F8EX 1LWFA 4YR3A 3OL7A 4B08A 3DRRB 1JLFA 5C42B 3HP9A 5KFAA 3KKSA 1X9WA 3T1AA 3AVMA 2YNHB 4KO0A 3PW7A 1BQMA 1ZBIA 1N6QA 3NFAA 3VQ8A 3CDEA 2W9CA 3DMJA 1TK0A 1VSDA 5KFQA 1SH0A 4TY9A 4Y34A 3IG1B 4OKKA 3CDUA 4RW6A 4IRCA 4JRQA 4MIAA 4FW1A 1WLJA 3DM2B 3KK3B 3T5LA 3BQ2A 2J6UA 5F8NA 2DTUA 4EP5A 3AVJA 2AJQA 1BQNA 2W8LA 2VG7A 2HAIA 3OYIA 2FBXA 4CGDA 3PVXA 3OYEA 5KG0A 3L2VA 1RDAA 2V4RA 4KE5A 1ASWA 1CZ9A 4KTQA 4NCGA 3M8PB 3BSAA 1HMVA 3SNNA 1S1WA 2RF2B 2A1SA 5DMRA 1RNHA 1NKCA 4KHWA 1IM4A 4NLSA 2IBKA 4IKAA 1VRTA 1WSEA 3RRGA 3G86A 4EEYA 1RDDA 2XY5A 2FVPA 2W8KA 4NLQA 4CFBA 4M41A 2FLNA 3DOLB 3LAKA 1BCOA 2O5DA 4Z0UA 4CIEA 4MKAA 2GIRA 3M8SA 1J5OB 1XI1A 3RBDA 3T3FA 4FBUA 2CKWA 3DRRA 2DFFA 2XRIA 3M8QB 3LPTA 3BSOA 4CEQA 4DQPA 3HO1A 5C42A 3CM5A 2BR0A 1HYSB 4NRUA 2YNHA 1R0AA 3I0SA 1S49A 3E01B 3S9HA 1RBVA 2X6NA 4ELUA 4N41A 1TKXB 4ZPAA 3LDSA 1NK5A 4O44B 4O3RA 4EBCA 3FQLA 1I6JA 1RBSA 3RAQA 4DL6A 4CEAA 4CJWA 3IG1A 3V1RA 1DLOB 2UVRA 4ZTJA 4URGA 5EWEA 3KK3A 4RNMA 3I5AA 3VQQA 1LW0B 2OZMA 1RT4B 2D7SA 4B9SA 3HK2A 3PO4A 4B9VA 3MFIA 4Y1CA 4BWMA 4EO6A 4NYFA 4ECTA 2PY5A 3AA3A 5KT6A 1U47A 5F9LA 5FROA 3V9SA 1CLQA 4O55A 5F8GA 1S9GB 5KT5A 1CSJA 4DSEA 3M8PA 3CM6A 3H98A 4CF8A 5D3GB 3NF9A 2RF2A 1B9DA 2HWHA 4DSLA 4LY7A 1SKWA 2ATQA 1TAQA 3PX6A 4ED2A 3QEVA 5KFYA 3K5LA 3A2FA 3VQPA 1VSJA 2KFNA 4DL7A 4E7LA 2FVRA 2ALZA 1J5OA 3MXIA 3AO3A 1RT2B 1C0UB 4J9PA 3NF6A 3M8QA 3IS9A 5EUHA 4FK2A 4Z4GA 3OYHA 5CY4A 1QUVA 1HYSA 1NK4A 5CYQB 2R8IA 1HJRA 5KFCA 3IN5A 2QKKA 1S1VB 3E01A 2R2RA 4E0DA 3KLFB 4ZP7A 1TKXA 1C2PA 4J9SA 3PW5A 2HMIB 4RNOA 3KIOA 3H5XA 1O1WA 4CJ5A 1TAUA 2JC1A 3Q8QB 2AU0A 4CECA 1QAJA 1LAVA 1HPZB 4Z4HA 4H8KA 4KBIA 3MEEB 1N48A 4R0EA 4MKBA 5KFZA 3PR4A 3OYNA 3SQ0A 2WOMB 4RUCA 1NJXA 2O4GA 1D0EA 3O4QA 4J2BA 3TARA 3H5UA 4W5QA 3VQ7A 1FK9A 3NF7A 4CJVA 5J2NA 2WONA 1S9GA 3DLKA 4ID5B 4Q0BB 1CXUA 4CJKA 4NLDA 4I9QA 4MK7A 5KT2A 5D3GA 4KAZA 2F96A 2C2EA 2Z1JA 3V9UA 3RR8A 3SJJA 1BIUA 5DQIA 3SQ2A 4J9LA 4NLOA 1TKTA 4M3UA 4KTWA 4JRPA 4URSA 2KW4A 2KQ2A 1ASUA 3L2WA 3AO2A 5I42B 1RT2A 1C0UA 4CJUA 2YHAA 3VQ5A 4KHSA 4CE9A 4Q44A 3EPGA 3V9ZA 4ECXA 2E9TA 5CYQA 4TN2A 5DGBA 4CIGA 2R7YA 1EX4A 1A5XA 4CJQA 3OYMA 3QIOA 3OYKA 2O4IA 1S1VA 4FJLA 3HT3A 4J2DA 2HMIA 3ZT2A 4O3QA 4NLXA 4FLZA 1U04A 4CHOA 4TY8B 3PW2A 4DU3A 5DGAA 3VQ9A 4Q43A 5KGWA 1JX4A 4E7IA 3KLGB 5E41A 3MEEA 4DTRA 2W7OA 3TAEA 2UVWA 2HNDB 3QERA 4O3NA 3PHEA 1WSHA 3CJ3A 2W42A 3HVRA 4IRDA 3C94A 4LH4A 1LW2A 3MR2A 3MF5A 1HNVB 1HQUB 3TI0A 5F8IA 4I7FB 2JC0A 3GILA 4FJXA 3VQCA 4BDPA 3ZSOA 2GBZA 1MMLA 2D5RA 1U45A 2QE5A 1NOZA 4K4YA 4FJKA 4O4GA 4JS4A 4F4XA 4Q0BA 3MECB 5FDLB 4CF0A 5J1EB 1WAFA 4MQ3A 2BE2A 4G1QB 3QEPA 1S6PA 4IOBA 4IQXA 1C1CA 2XO7A 5DLFA 4CEDA 3IAYA 4KHRA 2I5JB 1S9FA 5L1JA 3L2UA 3KHHA 1EETA 4AHCA 1W9HA 3N6MA 5EDWA 2RDIA 3VQSA 4YMEA 2BDPA 5KG7A 4DSIA 4H54A 4PY5A 4B3OB 4EBEA 3U3GA 3TWHA 5I42A 4HKQA 1K1SA 5KG1A 4W5RA 3BR9A 3MEGB 4PUOB 2R8JA 4H4OB 3DDKA 5HRRA 2AGPA 4CIFA 3UQSA 1J53A 3SI6A 3AVFA 3N6LA 3GV5B 4IH6A 3OJUA 5KGXA 2HNYB 3UPFA 3OYDA 4CHYA 3LP2B 4AILC 3H5SA 3MXMA 3KLGA 2XGPA 3P5JA 4NLTA 2HHWA 2ILYA 4ED1A 1WSIA 4OPKA 3FQKA 4FLTA 4MFBB 5HBMB 3OYFA 4J9OA 2R2SA 3VA3A 4DTMA 1RTDB 1HQUA 2CJQA 3WNEA 4FVMA 1NJWA 3Q8PB 4I7FA 3T5HA 3IGVA 2QXFA 3OS2A 4QWBA 4I2QB 3KLEB 5F8LA 4FW2A 4KI6A 1QQCA 2C2DA 3THVA 1JKHB 5FDLA 1IKWA 4N47A 4AH9A 3RMBA 5J1EA 4IR9A 4IRKA 2YV0X 4HCCA 2I5JA 2XCAA 4CK3A 4KI4A 1EP4A 5J2MB 1VSEA 3AO5A 2FJWA 3V1QA 4M3XA 4LQ3A 4OVLA 3BREA 1RT3B 3ZT1A 3ZSWA 4EO8A 3FFIB 5DG8A 1S1XB 5JS2A 1SL2A 1LWCB 5L1LA 1B9FA 4B9UA 1X1PA 4N5SA 3MEGA 4PUOA 3LP1A 4DQSA 1TVRB 2LSNA 3H2LA 2BQRA 4IG3B 3DLHA 3DYAB 3TR8A 3PY8A 4I2PA 1QSLA 2C22A 5KFJA 4DEZA 4KAIA 2FVCA 5DG9A 4PQUA 1QS4A 3PV8A 2HHXA 4CGIA 4ID1A 2BANA 1GOBA 1Z4UA 3LP2A 2I1RA 4KV8B 3M8RA 5CZ2A 4C8LA 2IA6A 1SH2A 3KHRA 1JIHA 5HBMA 2D0CA 1RAJA 5L1KA 4FM0A 4O3PA 3KMQA 3T19A 1RTDA 2XY7A 1C1BB 2JEFA 2W9BB 1S97A 3KLEA 1F21A 4K4XA 3NH0A 1ZYQA 3TAPA 4FXDA 3CJ0A 1KCFA 1JKHA 3LPUA 3O3FA 2FC0A 5KFPA 4OJRA 4DS4A 4DL2A 1L3VA 5J2MA 4DL4A 3RAXA 1CXQA 4KB0A 3GIJA 2AWZA 3BGRB 2HVIA 4J2EA 4DLEA 4KHNA 5KFIA 4G3IA 1L3TA 1IKYA 3RMCA 3UIQA 5JS1A 4XIUA 3FFIA 1SKRA 5HLFB 3EYZA 2YHBA 4H4MA 3NF8A 5F8MA 3HVTB 4ED8A 1TKDA 4FM1A 4FJNA 2P5OA 1TVRA 2GV9A 4FM2A 1RTJA 2X78A 4PA1A 3ZT0A 4O0JA 5J2QB 3DYAA 2OPQB 4K4SA 2EX3A 2P5GA 4E3SA 1QAIA 5KFVA 3C6UB 2Q3SA 1VRUA 3DLGB 5HRSA 1L3SA 4DTNA 4ZVEA 3PUFA 4XPCA 3QO9B 1D5AA 2FLLA 2E9ZA 2WB4A 1D9DA 3PO5A 4J9QA 5CZ1A 4HUEA 3BDPA 4O4RA 1KHWA 2RPIA 2B5JB 3QNNA 2V0NA 1SL1A 4OGEA 3NBPA 3AVGA 3QNOA 1NOYA 3KMSA 1S0NA 3K5OA 2W9BA 5F9NA 3L3VA 4IBNA 3C6TB 4CHZA 5KG6A 3DRPB 1U48A 2KFZA 4HYKA 4M45A 3EY1A 4RW9A 4FK4A 4GC6A 2OA8A 3L2RA 3OYGA 2Y1JA 2FJXA 4YFUA 3V9XA 1T94A 1JLQB 3KHLA 3IRXB 4TQSA 3JSMB 1OS5A 3BGRA 3RMAA 3RB6A 1NHVA 3SV3A 2YKNB 2AQ4A 3VQAA 4F8RA 3K5MA 4FZYA 1KVAA 5HLFA 2HHTA 2F8TA 2EHGA 2HHSA 1HRHA 4DMNA 2GC8A 4W5NA 3AVCA 4YQWA 1WN7A 1K1QA 5J2QA 4BWJA 3PW0A 2OPQA 2J6TA 4FJGA 1RDRA 3C6UA 4OLBA 1KSPA 2HHVA 3TAQA 3FSIA 3DLGA 2D0AA 2FBYA 3DM2A 3QO9A 4DTOA 1U09A 1VK0A 4FK0A 2R8GA 4LH5A 2VA2A 3K5NA 4BACA 2NUBA 3HXMA 4CEBA 4KTZA 3LWLA 3CFRA 4RZRA 5EU7A 4LQ9A 3ICLA 1VSKA 1WAJA 3SUQA 1WSFA 2ZQBA 3OY9A 3SUPA 3DLBA 3TAMB 3CVKA 1VSIA 1D9FA 4DS5A 3MFHA 3KHGA 2ZD1B 3C6TA 3V6HA 3DRPA 4ZHRB 4Q8EA 1S0OA 1RA7A 3V81B 4BE2A 4CJPA 5F8JA 4CFCA 3KTQA 1TKZB 2XWYA 2JGUA 3L8BA 3QYYA 4QWEA 3IRXA 3JSMA 3DOLA 2KZMA 2IM3A 2YKNA 3S3MA 3ITHB 5HRPA 3AVAA 4FBTA 4KPYA 3D45A 2IM0A 1QE1B 1MU2B 4MH8A 1QSYA 4EZ9A 1NHUA 1EXQA 2XCPA 4J9NA 5KFEA 4URQU 4DL3A 2AGOA 1TP7A 4EYIB 4FLVA 4O44A 1A5VA 5KTQA 4CK1A 1K6YA 4CGHA 1GX6A 1Q9XA 5JUMA 3DI6B 1N56A 1C6VA 1DLOA 3TQ1A 1S0MA 4NLPA 4DFKA 1L5UA 3NCIA 3SV4A 1LW0A 5HP1B 1RT4A 4B9LA 4NRTA 1TL3B 4TLRA 5T14A 3C95A 3RRHA 4KB7A 4TYBA 1U4BA 4Y2AA 3OS1A 1S10A 3EPIA 4E1NA 3TAMA 2E6MA 1TK5A 2PYLA 4E7KA 3VQ6A 4ZHRA 4E7JA 3EZ5A 4EBDA 2RN2A 1SV5B 3P83D 3V9WA 4RG8A 1XR7A 2PZSA 1TKZA 4K4WA 5DK5A 2ATLA 1KHVA 3QETA 4DSFA 3SPYA 4B9MA 1TL1B 5KFOA 4B9TA 4DTUA 5L1IA 5KFXA 2IC3B 3ITHA 1RILA 4YR0A 5KRTA 3DRSB 3OLBA 3H4BA 3HSTB 4RNNA 3KD5E 4CEFA 1QE1A 3LZIA 1MU2A 4CJRA 3SI8A 2R8HA 3M9OB 4KB1A 2P1JA 4XO0A 1KTQA 1JLEB 1RT7B 3KLFA 3ZSVA 3QIPB 4L8RB 4CJ3A 4OGCA 1WSGA 3SQ4A 3V6KA 1Y97A 4ICLB 1HPZA 1S1UB 3UDLA 4MK9A 2UUWA 2OYQA 4QW9A 3DI6A 3KD1E 3OHAA 4DG1B 4IG0B 5I3UB 4RNHA 4FLXA 5KT7A 4J9RA 5HP1A 1LV5A 2WOMA 5KFUA 1TL3A 1T05B 4MK8A 4WXOA 4ECWA 3KLIB 3NGIA 2KTQA 4TYAA 1S4FA 4ID5A 4ED0A 1RYSA 4K4UA 3CYMA 3HPHA 2D3UA 4FJHA 1SV5A 4J9KA 2AGQA 2RKIB 1B92A 4QAGA 1BL3A 4RUAA 3PX4A 3HKWA 4DF4A 3CFPA 1NK9A 1CZBA 1RA6A 3U6FA 2R2UA 3NMAA 3OYAA 2G8VA 4CF9A 4Y2CA 2J6SA 3KOAA 2IC3A 1IG9A 3OSNA 1SUQB 5KFKA 4FJ8A 2JEIA 4K4TA 4W5OA 1NK7A 4Z4IA 4R5PB 1VSLA 3WNGA 4ZP9A 4HUGA 1JLCB 3RB3A 3I0RB 3QINA 4WFYA 1RT7A 3QIPA 3QGGA 3WNFA 4C8NA 1SL0A 3BSNA 1I3AA 4F4WA 4TY8A 3V1OA 3DOKB 4ICLA 2QKBA 4TXSA 1RDBA 4CFDA 2R8KA 2ASLA 4IFYB 3NKYA 3AO1A 1LAWA 3E51A 1RYRA 2R2TA 3H5YA 3TANA 4DG1A 2D41A 4IG0A 2HNDA 5C5JA 4ELTA 1ASVA 4O3OA 1HNVA 3VN5A 2D0BA 1D1UA 3MR5A 4AHVA 4IH7A 4TQRA 1WSJA 4AHRA 5L9XA 1QTMA 5FRNA 1T05A 1XC9A 3BQ1A 5T7BA 2FLPA 4F2RA 3GIKA 1IO2A 3CJ4A 4Q45A 4O0IA 2HHQA 1IKXB 4F4ZA 3HJFA 2BQ3A 4CESA 3KLHB 4ECVA 3MECA 5K14B 3KK1B 2C2RA 4G1QA 2V4QA 3RB4A 1XHZA 4KHYA 3G0ZA 3M9MB 3ZSYA 2RKIA 3TAGA 3AV9A 4J9MA 1KFSA 3KLVA 2DFHA 4B3OA 3CJ2A 3QLHB 2G8KA 3DLEB 4CEEA 2OPSB 4Q8FA 1XHXA 1UOCA 4GMJB 4E19A 1FKOB 5KFDA 4H4OA 3QIDA 2XHBA 4R5PA 1LWFB 4KHUA 4CERA 1C0TB 3CO9A 4Q5VA 3NH1A 2VWJA 1JLCA 1QSSA 3Q8RB 2HVHA 4ZMMA 1JLFB 2HNYA 4EYHB 5C25B 3RB0A 5KT3A 2OPRB 4KKOB 1UA0A 4KO0B 5KFMA 1A5WA 3DOKA 1UWBB 4AHUA 4CF2A 3PJWA 4E1MA 3HHKA 2D3ZA 4IFYA 4OPJA 2WHOA 3H08A 4K50A 5DG7A 3SYZA 3ZSQA 2AX1A 3MR3A 4MFBA 4O3SA 2G8WA 4M3RA 4FZZA 4F2SA 2G8FA 2HHUA 4QW8A 4DWIA 4M42A 4I2QA 3KK2B 3KJVB 1YTUA 3H59A 2E4LA 5J2PB 3SPZA 2UVVA 3VA0A 5K14A 3KK1A 1D8YA 4CEOA 4F3OA 3S3NA 4QWCA 4EZ6A 1HYVA 4FJMA 3ASMA 3QZ8A 5EWGA 1IKVB 1S1WB 4HHTA 1RT3A 4NCBA 1DTQB 2EC0A 4ZP6A 1S1XA 3DLEA 1KLMB 3QEIA 2KZZA 3GIMA 1LWCA 2OPSA 1ITGA 1T8EA 3RTVA 1FKOA 1I39A 3QEXA 4IG3A 1C0TA 4CJFA 4LSNB 3ISNC 4U6PA 1VSFA 5SWMA 3LP0B 3IGNA 4FJ7A 4O5BA 1KRPA 3D0PA 5C25A 4WZQA 2OPRA 4KKOA 1R0AB 3I0SB 5KRSA 1JLGB 3K58A 5KFBA 3GV8B 1UWBA 1JL1A 4KV8A 3K59A 4OKEA 3OYCA 4WYWA 2XY6A 4X2BA 3B6OA 1EKEA 4FLYA 5KFNA 4CF1A 4IKFA 3O3GA 3OLAA 3GV7B 3CQ8A 1YVUA 1BCMA 1C1BA 1NK8A 4C8MA 3KK2A 3QESA 3KJVA 4U7CA 5J2PA 1RBTA 3NGYA 1RT1B 4DF8A 3I5BA 1ZBFA 4WZMA 1QHTA 4EP4A 5KT4A 2BQUA 4DQIA 3GYNA 4RW8B 5KFRA 4FJ9A 4Z4EA 3AA4A 4NYZA 1SH3A 1S1TB 4LD0A 4CK2A 1RT6B 3HPGA 1IKVA 4ED6A 2ZKUA 2OH2A 1NJYA 3HVWA 4WFZA 4LSLB 5HROB 4BE1A 1DTQA 4Z4FA 3SZ2A 3GIIA 1ZTWA 2G8IA 3SUNA 1KLMA 2IDOA 4M3TA 4HTUA 3HVTA 4OLAA 1U49A 3SFUA 3LZJA 3SFGA 4LSNA 2JEGA 3G6VA 1GOCA 3LP0A 3IS9B 4DFMA 5JXSA 4ZPDA 3SUOA 2FVQA 4FZXC 1VSHA 5DQGA 5KFSA 1JLAB 2WCXA 1JLGA 2HW3A 1KLNA 3MXJA 4R8UB 4WFXA 1RTHB 3PZPA 5CYMB 3OYBA 3ZCMA 2FVSA 3NAIA 3AO4A 4HVJA 1TV6B 4WXWA 2B5JA 1JLBB 1XR6A 4CHNA 1BIZA 3RWUA 5KFLA 1RCHA 1W0HA 3OS0A 4CJEA 4I9LA 1ZETA 4BE0A 4NZ0A 4RW7B 2XI3A 3VQBA 1YT3A 4CJLA 3U3YA 1Z26A 3NE6A 4YNQA 4DQRA 1S48A 2W9AA 1RT1A 3HP6A 1FK9B 1KFDA 1JLQA 5J2NB 4RW8A
chains in the Genus database with same CATH superfamily
3A5OC 2HWIA 3VTIA 4JI4J 1DFDA 1YHQN 2QI2A 2V9WA 2ASJA 4DPOA 1G15A 2AEMA 1S5ZA 4OX6A 1GLEG 5HK4A 3UVJA 2CQ2A 3FEXB 1TKTB 3CW2C 1HR0K 3VQDA 3DJCA 3CQXA 1IH7A 1KQSM 3QGHA 1S4EA 2D69A 4X4NA 1J9AA 2CPZA 4DQQA 1CBKA 1UZDA 2PDAA 2DY4A 4HUFA 2X1AA 4EFAC 2K1RB 3OL8A 2X7IA 4CZEA 4Z7YA 4Y1DA 2I8EA 2VDHA 2IJNA 1WORA 2IRYA 2CGKA 4DR5K 5CYMA 5C24B 1LFPA 1MMDA 3HYFA 2FUG9 4IDHA 1IVZA 2XC9A 4ZVFA 2IGIA 3K2YA 4DZ6A 4ECSA 3AODA 5A8WA 2HKEA 3QEWA 4JI0F 1YLXA 4UY8O 4JI7J 1RDCA 4ECRA 5KG2A 2NSBA 2VWKA 3MMCA 2Q79A 2ROPA 2BABA 3ZT4A 3NVKA 4RNFA 3Q2TC 2W1BA 5DDOC 3NS6A 4P73A 1Z05A 4E7HA 4FYYB 4G65A 2VG5A 2Y8WA 1VBXA 2F63A 2HS4A 5F0WA 1YSJA 2ZITA 4CTAB 1DJ0A 1S77D 4DFJA 3VQ4A 1C1CB 1HA1A 5SUHA 4ZVGA 4ERDA 1XNQK 3CDWA 2YX4A 2G8UA 3V4IB 2ZJPQ 1CJKB 5DLGA 4KSEB 3MR6A 2N3OA 2HQFA 1SC3B 3I8BA 2YQ3A 2A6MA 2Z4PA 2QWLA 5C12A 2OLWA 3PYDA 4NLUA 4A4JA 2LQJA 1RP5A 3B4DA 1NPRA 4K8RA 1NGIA 3Q2SC 4O23A 1CJTA 3PXGa 2DISA 2L9NA 2VPZB 5D8HB 2CPHA 4RU9A 3HULA 4QOZB 2B6AB 1VQ7N 2BGGA 5AQFA 3VEOA 1Q9YA 4U7UK 2QYCA 4KHMA 4KFBB 3MMVA 5AR0A 3CCWA 3EDRB 2CA9A 3OVNA 2O8BB 3CCLN 1FFGB 1T7PA 4ZA1A 2XS7A 3MM6B 2GMLA 4NYPA 4Y3CA 1AFIA 3G4SS 3MM9B 1RAEB 3ULEA 1NK0A 3BJYA 3BQ0A 1RISA 5ETTA 3T5KA 4K8ZA 3R5GA 3R5DA 4IR1A 3SBTA 2QLXA 1F5AA 2M0GB 2M70A 3G6YA 2JZ5A 1OY8A 5B0FA 4MO4A 3QICA 2WK4A 4NLWA 1EP4B 1REVB 4CZHA 2FPHX 1UA1A 1TK8A 2UXCK 4WE1A 2X6SA 3M32B 4ED7A 1D4XA 2Y1IA 3TUIC 3QMQA 1X9SA 1QTNB 1TFWA 4K41A 1Q7LB 2E1CA 1JXEA 2KH9A 3OHBA 2CJ9A 3M2VB 3JYTA 2QL9B 4CP5A 2FF6A 1RZMA 5C15A 2EBEA 4ED3A 1YQHA 1DQ8A 4LFAJ 2UV8A 3DGPB 2B4JA 3SQ1A 3DHXA 2DNYA 2ZDPA 4DV6J 4A46A 3D0GE 1HNIA 2QMUB 2OFHX 4F04B 4B8CA 3NL0A 4F26A 4QWDA 1GK8A 2PD1A 1MW7A 2CJXB 4F4YA 2JEJA 1HQEA 1IUJA 2N3LA 5C7PA 1HUXA 3U9ZA 1RWXB 4ZPCA 3T1YK 3KJNB 1FNXH 5HI7A 5BXIA 2GWJA 4IH5A 1YXQA 1CVJA 1VQKS 2YWHA 3R9LA 3T7ZA 4DJBA 4CHQA 2KB2A 3SSQA 4N77A 1NKEA 1J5EK 2HF4A 2ZH3A 1RQ0A 4FL9A 2D3OR 5B8HA 2E6LA 2VL1A 2AYGA 2W7AA 4B3RF 2E2PA 2Q31A 1V4SA 4LF7J 4P7VA 3SXLA 2MHEA 3ZSZA 1H0HB 3PW4A 1Y5LB 1VHIA 1IBKJ 3UCGA 2DNQA 2PYJA 4M7XA 1U25A 3PDNA 2HNZA 1CJUB 4ANDA 2RRNA 2XI2A 3KYLA 4IDKA 3D2EA 2CXEA 2C2NA 2ZVSA 1YBTA 4FJ5A 2H3GX 5FIIA 4Z4CA 5KG5A 3JQKA 2RS8A 1WC0A 4GKKJ 1RTJB 2J4RA 4QOTA 2A1BA 1RBUA 3MZIA 4NCAA 3EZWA 2W9CB 3AAPA 1WDTA 5GMEA 3CFOA 4C3KA 2YNIA 4CO5A 1VRUB 1VJWA 1VSMA 3J81Y 2W4DA 2ZEJA 3BZQA 3G8TA 2EXUA 5I3PA 3W9HA 1JXLA 5JJBA 4ZLJA 3IBFB 3W1YC 3FUYA 3H45C 1Y10A 2LYVA 4FWSA 2F1FA 4UUXA 2WW8A 2WVEA 2W4CA 4RW9B 4ZCKA 1VRTB 2JHEA 1YI2S 5CHCB 1JJ4A 3BN4A 4KHPJ 1HARA 4BC7A 3TZYA 1ZBUA 1N4LA 2E9RX 5AQMA 4DU4A 1HD0A 4DSJA 1ATRA 2RQMA 4ZPBA 1XMQF 4YR3A 4HH1A 4USKA 5BR9A 1JLFA 4WU3A 4IOAL 5C42B 2OCEA 5KFAA 4KO0A 2KDOA 3PW7A 1U1QA 1ZBIA 3LM2A 1VQPN 5GAEI 3CDEA 3EX7B 3EL2A 4OIXA 3DMJA 2PC6A 3THXA 4EI2A 1PC4A 1VSDA 4TY9A 1ZS6A 1QQNA 4MIAA 4BC4A 3HBTA 5ETRA 3KK3B 5F8NA 3ID8A 1E4GT 2AJQA 3AVJA 1EAYC 2VCPA 2O8FA 3UD4P 2FBXA 1IQZA 3PVXA 2P9NB 1RDAA 4ZKAA 2V4RA 4A62A 1CZ9A 1VC0A 2PEBA 3VV2B 3FNNA 2N7CA 2E7XA 1HMVA 1S59A 3ET6A 2RF2B 1LOTB 5DMRA 1IM4A 3BN7A 4NLSA 2IBKA 4IKAA 3B8HA 3VGVA 3UCUP 2V7YA 1RDDA 2V8PA 3J7A1 4CFBA 2VPYB 3W3DA 3M8WA 4M5JA 2DNMA 1XI1A 4JI2K 1G1XA 3QPIA 4DR6J 3B4MA 3P31A 3DRRA 1SCJB 1Y4ZB 5AJ3F 2BR0A 4J7CA 1HYSB 4NRUA 4FYWB 4JV5J 4B3MJ 1TYQA 4AL7A 1R0AA 4GNIA 3E01B 4F36A 4N41A 4ELUA 3RU0A 1TKXB 4QIVA 4WFBL 3LDSA 2C42A 4QZVB 1RBSA 4DL6A 4CJWA 2NRHA 5HANA 1RTZA 2J7WA 4CH7A 4LF9K 4PABA 4HTLA 3V1RA 2CADA 5H9EJ 3GP9A 4HHUA 1PYSB 1X60A 5T7LB 3GSIA 4CM0A 4RNMA 3WC2A 3BDEA 4BR5A 1RWPB 4X66K 2DGUA 3HK2A 3LPYA 2QA2A 1WG4A 4MAKA 2NRTA 4DR1K 5I3QA 2GAGC 1HPMA 1CLQA 3C7NB 1FJCA 1CSJA 4BVOA 5TKWA 3ILOA 1GXUA 5H1SV 2XB2D 3O5BA 1GMVA 3WXLA 4ZOSA 4DSLA 3OR2B 1OIAA 1GLAG 4WTOB 4NZ7A 2HBRB 2QWQA 5LXYA 3PX6A 4WQ4A 4EGLA 3RSEA 2CQHA 2Z2MA 2KFNA 4WQ5C 1KD1O 1M1GA 5LMUK 1J5OA 4FO0A 3BF4A 4FK2A 4Z4GA 1NJIT 4WWSA 4DV0F 2M8HA 5KFCA 5E3AA 1X4CA 4RNOA 3NCRA 1YITN 1TAUA 2AU0A 1Y11A 1QAJA 2CH5A 2OTLS 1N48A 4R0EA 3QMLA 2BA9A 5KFZA 3NVMA 1CJVA 2RUGA 2KYZA 5L8RC 4HACB 1HJOA 1IBLJ 6FDRA 4J2BA 4AL6A 1X9JA 3NF7A 4M63A 1OH8A 3P38A 2HBZB 4OJ1A 3ZETB 1S9GA 1PC5A 1E6VB 1TMMA 4I9QA 4BR7A 3O1BA 4BCAA 3V9UA 1WEYA 3SJJA 1Y0HA 5DQIA 3JB9k 3THWA 2A0FB 4PYDA 3AARA 1TKTA 2K7KA 1YJNN 3VAMA 4KGMA 4JKAA 2ZNZA 3EO3A 3NGRA 2YKOA 2KW4A 1RCXB 1BQXA 1YIJN 1MDUB 4HT7A 2P6SA 3AO2A 5KPTA 3WZ0A 4IO1A 4KHSA 2W4PA 4USHA 4Q44A 1GH8A 2VBZA 4YY3J 3V9ZA 1WKKA 3VEZA 2E9TA 5GINA 5DGBA 2K1RA 4OX9K 1EX4A 3QIOA 3OYKA 3MDFA 1H74A 1IWGA 4P52A 4GKJJ 1P8GA 4J2DA 3GJQB 3GE9A 1U04A 1RWUA 2HS3A 4DU3A 3GJSB 3RW7A 3SAGA 5DGAA 2BKPA 3CCVS 4Q43A 5KGWA 5M2RA 2DNOA 5LXRA 5CAAA 4C11A 3KUGA 2W7OA 2DVIA 2UVWA 2HNDB 4O3NA 4OJGA 3PHEA 2W42A 2NREA 4IRDA 3MF5A 3DXKB 5F8IA 3UD3P 4Y2MA 2JC0A 3VHQA 2GQCA 2KT3A 2VKRA 4LUBA 3VQCA 2RVJA 2GBZA 5F3TA 3L4QA 4WFAQ 1RHMB 4FJKA 4H5TA 2FJAB 1IM6A 3DRYA 5F3ZA 4F4XA 3GJTB 2DRBA 5FDLB 4CF0A 3JSBA 5J1EB 1NZ8A 1WAFA 4MQ3A 4G1QB 3QEPA 4UOCA 3TSPA 4IOBA 3DOMA 4B17A 1C1CA 1HWUA 2JDJA 4CEDA 3IAYA 2LEBA 3L2UA 2VJUA 2VBXA 2QXLA 2J0WA 4YMEA 1CJKA 2O8DB 4B3OB 4DUZJ 1WUAA 5E7OB 4K0KF 4MO5A 3NGTA 1N32F 1K1SA 5KG1A 3IR6B 2VQFF 5K8MA 5DZ6A 3Q8YA 3L7UA 2NUHA 5HRRA 2AGPA 1HBUB 1T9WA 1U1PA 1J53A 3SI6A 2HQDA 3AVFA 3GV5B 4DV2F 1N33J 5KGXA 2RSQA 3UPFA 3BH7B 3UE5A 3OYDA 2CGJA 2YHYA 2E66A 2R7OA 4CHYA 3MM6A 3H5SA 2KLAA 3L3CA 2BM0A 4RWWA 1WSIA 1RAOA 3LF0A 3FGVA 2OKQA 1HW9A 3MM9A 2V8DA 3VA3A 4FPIA 1RTDB 1HQUA 3BYPA 4Z7CA 3Q8PB 3T5HA 3OS2A 4LRAA 3KUEA 3HRGA 3N4WA 1G6BA 4KI6A 3OBYA 4HH0A 2CG8A 3BF1A 1YJWN 5IWAJ 3CDBA 3DU6A 1X31C 1AUSL 3QT6A 2VHGA 4LF8J 4IR9A 3C66A 1I3OB 5DM6L 2YV0X 1EP4A 3CT9A 1BC6A 1VSEA 2HMPA 3H1VX 3LPEA 1N34F 3O9QA 3ZSWA 3WT0A 4ZPVR 4C1NI 5LSLA 1FWKA 1LWCB 4RUHA 4XH1A 3U27A 1FW6A 1KOHA 3SCLE 3MEGA 1TVRB 2CUYA 3H2LA 1VLYA 3PY8A 2BJ7A 4DPUA 3NCQA 1FX4A 4KGVB 4MT1A 2PEHA 4RCHA 1EHWA 2PA3A 2HHXA 1SJ1A 1Z4UA 4AM7A 2AZ3A 3JS9A 2I1RA 2LU2A 5A8RB 2UXBK 2CH6A 2MZTA 5EVZA 2D0CA 1S76D 3KMQA 1BG3A 4ZCIA 2K3IA 1WC3A 1C1BB 1GEHA 2W9BB 3C8YA 3KLEA 3Q7CA 5ETQA 3NH0A 1ZYQA 4I6YA 3CJ0A 1JKHA 3AY0A 3IKMA 3O3FA 2FC0A 3H1QA 4XDCA 2O8CA 2UUBJ 5A2QU 4DUYK 2LQ9A 1CXQA 4KB0A 3GIJA 2AWZA 3BGRB 2HVIA 4DLEA 1IJFB 5KFIA 4X65F 1RGVA 2QYGA 4G3IA 3D68A 2DPNA 2QSFA 4ETXA 3EYZA 3C6HA 3NF8A 5B0BA 3MWPA 4ED8A 1TKDA 4FJNA 2RD5C 2MYFA 2P5OA 1RTJA 4BRIA 2ALYB 2EX3A 1R31A 1QAIA 2B8QA 2NS1B 3ZZPA 1VRUA 1DGKN 3R9PA 2LQBA 4ZVEA 4XPCA 1RK8A 3QO9B 4JKEA 1D5AA 2FLLA 2E9ZA 1IQTA 1NBWA 1D9DA 1QVGR 3PO5A 3OPKA 4J9QA 4KH6A 1KN6A 4HUEA 4FZVA 4P2FA 3I96A 2RPIA 3AAWB 1SL1A 3IRWP 4BRQA 2CQCA 4DBQA 2UXDF 4CD3A 2Z30B 3C6TB 4BR9A 3OA9A 2HHHJ 4HYKA 2DT9A 4RW9A 4IEEA 2OA8A 3K8WA 2Y1JA 3OYGA 3CXCR 4GO7X 3LDQA 4PKIA 3JSMB 3W8GA 3RMAA 4DR5J 1NHVA 1I1GA 3FR0A 2ZJPL 4E2FB 1U2RA 4F8RA 3H2UB 3OXFA 4GY2B 2QMXA 5BRHA 4YB6A 1HWIA 2CQBA 1KC8T 2HHSA 2H5IB 1MWKA 4AUKA 1Q81T 2MJUA 4NEYA 4YQWA 5J2QA 4K2XA 2GX8A 2CPYA 1RDRA 2FB0A 1RDWX 2NYIA 5AQXA 2FHJD 3DLGA 3C19A 4OYXA 1VK0A 1CULA 3CCLS 2V9KA 3BGFA 3GPAA 4ID8A 2ZZMA 2NUBA 2DR7A 4CEBA 2R7QA 3OVSA 2GTDA 3CFRA 2ADCA 2QSWA 2Q36A 3DDIA 3SUQA 1TTHB 3DLBA 2MKYA 2X1BA 1VGYA 3CVKA 4CLUA 2OP5A 3NNAA 5IC4B 3MUVP 1IWAA 3V6HA 1ELOA 4ZHRB 2ZWPA 3MMJA 4UQTA 1NH7A 4NEZA 1URRA 1RHRB 4BE2A 3VOVA 4IWVA 4BY9C 3VENA 1TKZB 1X4FA 3RUBL 1TL7B 3D1QA 2W25A 2PE8A 2DGQA 2XMAA 5E3QA 4QIGA 2ASOA 2V6AA 2EG2A 1W2BR 1N36J 1VBKA 3R5CA 4KPYA 3D45A 2IM0A 3VERA 1R8BA 5GIOA 4BROA 2L9DA 3AAQA 4EZ9A 2ASMA 1LXJA 5IFMA 2XCPA 5IT9U 1FJGF 1ZZFA 4USVA 1WKLA 4DL3A 2AGOA 2EEYA 3NMUA 3U9DA 4EYIB 4AD6A 4OZJA 2VOPA 3CJRA 1GX6A 1Q9XA 2NRWA 2XZWA 4RBVA 3H90A 3DI6B 1C6VA 2KL8A 5CR4A 3MCPA 5T7LA 3ZZ0A 1L5UA 2D0OA 1NLVA 1U7LA 5JLHA 4JI5F 2H48B 2NXJA 2UXCJ 2CJKA 2PBDA 5T14A 3C95A 5GAEU 1UEVA 4YUDA 3FZMA 4P10A 2PYLA 2E5LF 3VQ6A 2XSFA 4PKDB 1R59O 2G2ZA 1SV5B 5ETSA 4RG8A 1UETA 4I56A 2PZSA 2ATLA 4DV5F 2ZJQQ 2WSEC 4P71A 3SPYA 2DR5A 1O13A 1X8DA 2MY7A 4B9TA 4DTUA 1VQ8S 2D0PA 2EFPA 3GSDA 3EE3A 4OI1A 3OLBA 3H4BA 3ILJA 3KD5E 4CEFA 5AZJA 1X4BA 4F0KA 1MU2A 4XTTA 4CJRA 1O5JA 3HHDA 4NLBA 3G87A 2P1JA 2CDQA 2PFFB 1KTQA 1BA0A 1J5EJ 3I56S 1NGDA 3V6KA 1YVNA 1DZ5A 4ICLB 1QVGM 2QG9B 4MK9A 2P9KA 4JI8F 1ZPWX 1NSKL 3MN5A 2LEAA 3O80A 4A5AA 4J91A 4DR3F 4K42A 4TU9A 1NWKA 2IRXA 5KFUA 2W2PP 3CJ7A 4JI1K 3NGIA 3UB5A 5GAHI 1XQIA 3LL3A 3CXCM 3R7BB 5HOOA 4YS2A 3J7Z5 4UT4A 3HPHA 1UVNA 3MM8A 2FD2A 3UE2A 4ATNA 2DNLA 2AGQA 2RKIB 3VGUA 3PX4A 3HKWA 3CERA 3U6FA 2R2UA 2R9LA 3MR7A 4PYAA 3G71N 4F0HA 4ZVTB 1RADB 3GG1A 2IC3A 1N8RO 1AROP 2JEIA 1R3NA 1NK7A 1N0UA 3BH6B 2YQ1A 4W92B 3CCUN 4R5PB 1VSLA 3WNGA 4ZP9A 5AE2A 5IT9Y 2MQ8A 3WNFA 4OHVA 2MQPA 1IJEB 2LP4A 3M6WA 2QKBA 4TXSA 1RDBA 2ASLA 1QJHA 1LAWA 4DR4F 2R2TA 3WX8A 2F4VJ 4JN4A 4IG0A 2HNDA 5C5JA 1DHMA 4ELTA 1XMQK 2GVDA 1ASVA 3MR5A 4CLWA 4IH7A 4TQRA 4AHRA 9RUBA 4NB4A 2ZH1A 3H7HB 4PAAA 1M5HA 3VVTA 4F2RA 1YZ7A 2DTJA 1IO2A 2P9UA 4O0IA 3JAMO 1IKXB 3HJFA 4ED4A 4BRGA 3Q83A 3GBTA 1Y5IB 5LJ5Y 3AFGA 1VS3A 1O6XA 2C2RA 4A8KA 3K0JA 4G1QA 1XHZA 4CZCA 3IA0A 1F1BB 1IR1A 1U1MA 3LA0A 3G0ZA 4JK9A 1MWQA 4LR7A 5AQPA 1NAQA 1W2BM 5K20B 1Q82T 4LFBF 3KLVA 3P4IA 4B3OA 2G8KA 2YPYA 3DLEB 2GHWA 4Q8FA 3R8YA 4NO7A 2D1KA 1UOCA 3ENWA 4JEPA 3QIDA 3E3XA 3U1LA 2XHBA 3BPDA 1C0TB 2B4UA 1HBUA 3MD1A 1QSSA 4CD1A 4ZMMA 2COLA 2ZFHA 1F2HA 1UA0A 2Q6BA 1FFWB 4IFYA 4OPJA 4C98A 3H08A 4K50A 1E3MA 4ZLNA 1KEKA 4HHHA 4KPCA 4QR1A 4M3RA 1VIOA 3B82A 1OQ6A 1XEZA 5KPZA 2AEJA 3C15B 4D3GA 4HI2A 4JI2J 5J2PB 1DQ9A 1MLAA 2XNRA 5K14A 4CLPA 4F3OA 1F6TA 4S0MA 2MKCA 4CYUB 4QWCA 4EZ6A 3X1LB 1HYVA 3ASMA 1T9UA 1Q4RA 5EWGA 4IEIA 3H42A 2QC3A 2F9WA 1FT8A 4LF9J 1RACB 2ABYA 3WXKA 2YWEA 1VQ6N 2J9CA 1RKJA 1LWCA 4P2SA 1FKOA 4A61A 4X66J 2YKQA 1Q8BA 1S22A 3G9CA 4CJFA 2FHMA 1G99A 3ISNC 3LP0B 2E5IA 1KRPA 4O5BA 3I0SB 3K58A 5KFBA 5BR8F 1A0OB 3K59A 5A8RA 3QATA 1RCOB 4WYWA 5IV4A 4DKWA 1FNMA 5IM0A 4ILRA 4OLOA 1NH8A 2FZGB 3OLAA 2DD8S 3GV7B 1BU6O 1JK9B 3TQEA 1BCMA 1C1BA 3A12A 1Y9OA 1HNZF 4YEAA 3GCWP 2CQ1A 3KK2A 2QA4N 3W3SA 4DV0K 2GGPA 3PYFA 2HBJA 3AJDA 1RBTA 3NGYA 4K43A 3K9KA 5L39A 1ZBFA 1QHTA 3VF0B 2BQUA 4V19X 3GYNA 1YF5L 5GVQA 1JB0C 5FLXO 3AA4A 1SH3A 1S1TB 1RT6B 4B3TJ 3R3LA 1X7VA 1NJYA 2MQNA 3GIRA 2ZBCA 3T1HK 1GLLO 1DTQA 4Z4FA 1U26A 4AQYJ 4DPYA 2G8IA 4QIWD 1YIJS 2B51A 4Y0FA 4M1KA 1Y3KA 2KKZA 5AQGA 4C2MA 4H5NA 3NXZA 2YH0A 2QX0A 2JEGA 2OSQA 2J9DE 2FF3B 2L08A 1GOCA 1XNRJ 5JXSA 4YB1P 1JLAB 3LTOA 4P2XA 1FRMA 3MXJA 1RTHB 2CWKA 5D78A 2DXFA 3NAIA 4HVJA 4QPTA 1TV6B 5AXLA 1JLBB 2QN6B 1VIXA 2O8EB 5G0RB 1W0HA 4I9LA 2VFVA 1ZETA 2NXEA 4PPZA 3TA2A 2XI3A 4CO4A 3VQBA 1RI7A 4CJLA 1R8HA 2UU9K 3NE6A 1RWNB 4WFAL 1GFWB 2MPUA 4JYAK 1TUWA 1FK9B 1HFEL 1KFDA 2DK2A 4OX9J 1HI8A 2F8HA 3V6DB 2FBVA 1CS4B 1HBOA 2Y3YA 3OL6A 1HWKA 1FKPB 3PEJA 2XLJA 3OBIA 3M6VA 3U1NA 4LSLA 2UZAA 5HROA 5JVGQ 3LGNA 3J81j 3A3PB 4A8MP 1X3NA 3TOQA 1EWQA 3K2PA 3TJ8A 3HM9A 3W62A 5AXMA 4YHHF 4OZ2A 3NGDA 1G2EA 3K8VA 1E6YA 1QHAA 4K4ZA 4L73A 3TO8A 5FPEA 1RAGB 3TRGA 5GAGI 4BC9A 2ZH6A 4GV9A 4C23A 3ZEUB 4DTJA 3RYLA 4R8UA 3O6QA 4FWRA 4I4BA 1NDLA 1RFQA 1XUPO 4MDAA 3G10A 2P9EA 4OKJA 5DM7L 3DNCA 1N32K 4Y28C 2VQFK 3ETOA 4RW7A 2V68A 2OZSA 3Q8SB 3IWXA 3PR5B 4OPHA 2BJDA 2UUTA 1UVKA 2ETJA 3SSRA 2QEXS 4DV2K 2M9KA 4LF1A 1YJWS 2R7XA 2BRLA 1TL7A 1ITPA 3U4LA 1FDNA 3D1OA 1CLFA 5CABA 2J0SD 4IFVB 4A8SA 5LJVA 4I6WA 5CQGA 4CHPA 2IM2A 1M5SA 4WFNQ 3BBCA 4KREA 2CNKB 3BB5A 1HI0P 2VA3A 3NAEA 1Q8IA 1N5YA 2IFXA 3G82A 4M3ZA 2VG6B 4WP9A 1GOAA 2IJFA 3GFYA 2XWXA 2C28A 4DPTA 2LEPA 3DFEA 2ZKTA 4ZTFA 2W2QP 2AJFE 4P75A 4LF4F 3P1GA 1RT5A 1S5JA 1V3ZA 4GVLA 1FXRA 3OFFA 1LWEA 4PWUA 3RGIA 1XMOK 4DCHA 5HSPA 2OPPA 2E2NA 1T3NA 4RTFD 4LJMA 1ZC6A 2WVDA 4NWBA 3CJ5A 4FLUA 4DU7A 1N34K 2Z1IA 3E9LA 1HKAA 2A6OA 4QPXA 1TGOA 3DRXA 3RBZA 2FBTA 1S72N 5LMNK 4F4KA 2RDJA 4CLFA 1WOSA 1NNEA 4F50A 2AHOB 1JL2A 5D4OA 3W7BA 3O3HA 2MGZA 1UWAA 3F9KA 4C97A 4GC7A 1RTIA 2DGXA 3R1XA 1JWWA 3UW1A 1BHLA 3BBBA 1K73T 1S6QA 3OL9A 1S9EB 3MM5B 5KG4A 2AP6A 3QNWB 2V4JA 3NGUA 1DTTA 1VQ5S 4NA3A 4Y0WA 2B9EA 2FJVA 4X62F 2ZM6F 1S0VA 2CQIA 4P6QA 4FCYA 2A1RA 1BI4A 1MWMA 1GX5A 1O0PA 1KAZA 2DIUA 5D0GA 3KZBA 1T0TV 1FXXA 1LEOA 4AHTA 1GMWA 1FERA 4JOUA 4FS1A 1OWXA 2KHDA 4ILHA 3L4BC 4PKHA 3MEDB 4QCLA 2XNQA 2X74A 3LP1B 5DETA 1JJCB 4NYNA 4I2PB 2UUCF 4M3WA 4ECUA 4KHQA 2Z56B 2VFTA 4PWDB 5C2GA 1KVBA 4X65K 1HNWK 3HZ6A 4LF5K 4PG5A 3HZEA 4ELVA 3QWPA 5JICA 1TQLA 1TFYA 3EGWB 2RE2A 2OI2A 3QQCD 2ITMA 4CGGA 3QFPA 2I7NA 3GQCA 4M3YA 4DR7F 4Q2MA 2GIQA 2KT2A 4NXMF 3MWTA 3RBEA 2B7BB 4F9OA 4BDYA 1KOOA 4FKXA 4CT8A 2LDIA 2IAJA 3MAAA 3QZ7A 4JI4F 1EKRA 3ZO7A 3CSKA 5THWA 4JLHA 4U67Q 1QAXA 2ZE2B 1OYEA 2J9DA 1WNEA 2MKSA 4NLVA 1T03B 5FRMA 4GO5X 1KXPA 2MSSA 1F5BA 1KQGB 3ZTSA 4J90A 3CE8A 4RW4B 1QZ6A 4CFAA 2YKMB 1Y7PA 3JTNA 2DPJA 4HI1A 2UXDK 3IR7B 3DGVA 3R97A 3THYB 2YNGA 4M5KA 3DAWA 3MAQA 2VC1A 1YJ9S 2BJ1A 4A8WA 4YOUA 2V5HG 5A0YA 2FSNA 8RUCA 5K5MA 1BQMB 1N6QB 1DQAA 2QLWA 2RS2A 1XIQA 4QS7A 3PX0A 4WYLA 3O9UA 4I69A 4KC5A 1BISA 5AQUA 2K3KA 4RW6B 1D3WA 1YRXA 4U8YA 2HFVA 3D6FB 4JI7F 4KH1B 1BQNB 1IKXA 2F3JA 2MZSA 2VG7B 1UVJA 2HBQB 1NBEB 3L2QA 1Z25A 2BXJA 3G4SN 1C1AA 4L75A 4BS2A 4CJ4A 1WNSA 2BRKA 1SBRA 5DQHA 2BYCA 1QQMA 4ZCLA 4JNEA 3O9RA 4ZP8A 5D0HA 3LALA 2KT5A 5ELZA 4DOZA 2Y1RI 3ULHA 1DEJA 3ENQA 4DL5A 3AD7C 1C0MA 2YNFA 1VC6A 1TUYA 3D2FA 2F8EX 4B1YB 2ACMA 4CZGA 1Q5VA 4BG9A 1Z2LA 3SDEB 2CPIA 4ER8A 3L0QA 3EMTA 3OVBA 3HP9A 1H2TZ 3T1AA 5GMKa 2YNHB 2HG4A 2HGNA 3EVMA 5AQQA 2Z0GA 2IVYA 4I67A 1LNQA 1N54B 3C14B 4Y34A 4NPOA 3HFZB 4C48A 4JRQA 1EARA 2DEJA 5F41A 5IT0A 1WLJA 1JCGA 3DM2B 1RLCL 3T5LA 4EP5A 5D4PA 2F4FA 1FJGK 2W8LA 2HAIA 3PSIA 4CGDA 3IWLA 3OYEA 5KG0A 4KIAA 4KE5A 1VQKN 4CYUA 4CI0B 4J9UE 4NCGA 3M8PB 1U1LA 2YWKA 1WC6A 4HR2A 5L9NA 2BE9B 2A1SA 4KHWA 2VWBA 4JKFA 2BOPA 2DY1A 3CC4S 1WSEA 2CQPA 1W97L 2W8KA 4NLQA 4NX9A 1PBUA 1YBUA 2FLNA 3DOLB 2O5DA 4Z0UA 2Q0UA 1SJFA 2E5LK 1S12A 2K7JA 3M8QB 3BSOA 3PLAA 2FXUA 4N7TA 2DYAA 4LFAF 1U1KA 5LJ3Y 3I0SA 1S49A 3FCVA 4DV6F 4DV5K 1RBVA 3ZZOA 5DRKA 1V3RA 5AQOA 2ZBIA 5BN9A 4CWBA 4O3RA 4EBCA 3AY9A 1I6JA 3RAQA 4CEAA 3IG1A 2P9GA 3DC2A 4NI2A 2O01C 1DLOB 4ZTJA 1WHVA 3IWNC 5EWEA 3AT1B 2XEXA 2A6AA 2C2ZB 3HHLA 4B9VA 1OH7A 5HMYA 4BWMA 4EO6A 2FJEB 2PY5A 3AA3A 5KT6A 1U47A 3GOIA 1ZAXA 3V9SA 3EGVA 5F8GA 4FWKA 2F7VA 3CM6A 1M1KO 2EK6A 1GMUA 1WSRA 4LRDA 4JI8K 5D3GB 1REGX 3NF9A 1B9DA 4LF7F 3FRYA 1SIZA 4LT6A 3Q7BA 2GS8A 4LY7A 1SKWA 2PSZA 1IBKF 3CQYA 4ED2A 1W7WA 1Q79A 4DR3K 3MMAA 2GUPA 1YI2N 2HFOA 3CCRS 1T11A 2FVRA 2ALZA 3MXIA 1RT2B 1EQ0A 4J9PA 2BACA 3NG8A 4DV4J 2O1PA 3VESA 4JI1J 4RJVA 3NF6A 5EUHA 1FI4A 3OYHA 3JTOA 1QUVA 3NNHA 1NK4A 2ZH2A 5CYQB 4GKKF 1HJRA 3CC7S 2QKKA 1PO6A 2R2RA 4E0DA 3KLFB 1C2PA 3PW5A 1O1WA 4CJ5A 2JC1A 1MA9B 1N5TA 2W6KA 1EQMA 5CXTA 1HPZB 8ATCB 3EDQB 4H8KA 2O8EA 4PKGA 1ZOTA 3MEEB 3R5BA 3OYNA 1SJ4P 2HSTA 4DV7K 3SQ0A 5E5NA 4YOXA 1NJXA 2JSXA 1N5QA 2Z58B 4WQ4C 5E0OA 1D0EA 3H5UA 4W5QA 3UD5A 3VQ7A 3UN2A 1FK9A 1RUSA 2W2MP 1ZA1B 3VGMA 3POTA 4ANCA 4Q0BB 2VUGA 1CXUA 1CS4A 4NLDA 1MG7A 3CGIA 4MK7A 1NU4A 5KT2A 4KAZA 3VTHA 4V19J 2C2EA 4Z2XA 4KHPF 2J5AA 1BIUA 4J9LA 1Y00A 2HEKA 3IM8A 5RUBA 1Q18A 4JRPA 4URSA 3SCJE 2KQ2A 4KH4A 1FE0A 3T69A 1C0UA 1APSA 4OZ5A 4CJUA 2JVOA 2CQDA 5U47A 2FY8A 4ECXA 3PG9A 3FBFA 1OSCA 4ZN1A 4CJQA 2O4IA 3ZEUA 1S1VA 5HQMA 3OV7A 2OD4A 4FJLA 3C0BA 1YJRA 2HMIA 1GQEA 4M63C 3FBCA 1RXOB 4TY8B 4OO1J 1V4TA 4A8QA 4A2BA 3W2WA 4WFBQ 4L6V3 4LSZB 4EHUA 3KLGB 1K8KA 5E41A 4DTRA 3CCES 2CAJA 3OR1B 5BYSA 4FYXB 3C94A 3US5A 1HNVB 2WBMA 2VGNA 4I7FB 3GILA 2XO6A 4ILGB 3UKUA 2D5RA 1U45A 3IBCB 2HZAA 3M4XA 3EJMA 3MECB 1RE1B 3RBXA 3CC2S 4FPBA 2Q3PA 1JCEA 1WTFA 3QFHA 2LU1A 3KHHA 2PI5A 3OUYB 1W9HA 4CIOA 3VQSA 2BDPA 5KG7A 4DSIA 5AFUH 5CD4H 4EBEA 3U3GA 1Q86O 2GAHC 5AQVA 2ZH4A 4DR6F 3KXDA 3P4UB 3ENAA 3ATUA 3HTVA 3TWHA 2EPIA 4L3NA 1WELA 5I42A 5D4LA 2JOQA 2B4VA 3VAIA 4JV5F 4PUOB 4B3MF 4H4OB 3DDKA 1HBMB 2DIVA 3F5TA 1S57A 1QDUB 3T9NA 4CIFA 2G2OA 2RRBA 2CPJA 3OJUA 5AZIA 3L9ZA 2BMBA 3G8QA 4LVNP 4C6AA 1ZPVA 1M5PC 4RL1A 2MEWA 2GQ2A 4ED1A 2B56A 3VCDA 3VETA 4OPKA 3FQKA 4TNOA 5HBMB 3OYFA 2CIMA 2R2SA 2VPXB 2CJQA 1BLUA 1NJWA 1WHYA 3LOUA 2IVNA 2NCKL 3BEXA 3MM5A 1TELA 1J6ZA 2M8DB 3A3OB 3IMXA 1KD1T 1FJEB 4X4UA 3C3LA 2E2QA 1RHUB 5HAOA 2LECA 3Q89A 1B0PA 2I5JA 4CK3A 3KNGA 1U0SA 1OJ4A 3LGMA 1F9HA 4LQ3A 3BREA 2DH7A 3BBFA 4ZPTR 3NMRA 1RB0A 1DBDA 2LQ8A 3LP1A 4DQSA 4DV0J 2LSNA 1OY6A 3DYAB 3DLHA 4I2PA 2HSEB 3TU5A 1RSCA 3KG1A 4I6AA 2VU5A 2FVCA 3ZTPA 4ES1A 1N5VA 3HSGA 3LP2A 3T1HJ 1Q8LA 3NWRA 3M8RA 1K44A 3HSZA 3I4PA 4FWQA 3CCVN 3P96A 2N7YA 3GZ7A 3P5TL 1V3SA 4CLLA 1IBLF 4MMOA 5L1KA 4Y65A 4QIEA 3T19A 2RHKA 3EKUA 5GADI 2YJEA 2G13A 1F21A 3U02A 4K4XA 4F3MA 1MMNA 3IFRA 3UDVA 1PAUB 2GWKA 3TAPA 3QFWA 3FZ2A 2Q43A 4DL2A 1BWFO 5J2MA 2IVFB 1RWMB 5JVGL 1ZA2B 2AMCB 2DGVA 1L3TA 3RMCA 4XIUA 3FFIA 1N88A 5HLFB 3ZX2A 2YHBA 4TU8A 4YY3F 1NMDA 2UU9J 4FM2A 3ZT0A 4GKJF 4JYAJ 1NGBA 4K4SA 2GJFA 5KFVA 9ATCB 3C6UB 4QR2A 2NNWA 5HO4A 3HMJG 2F40A 3ADAC 3EZOA 5HRSA 2F65A 1FESA 2NZ4A 4DTNA 1GXLA 3PUFA 3J7YP 3O8WA 3GG4A 4FF2A 4ZN3A 3MCMA 1Q7YO 5DO2A 5K8PA 3BDPA 5K8OA 1M5VC 2WVFA 1HIYA 3QNNA 2V0NA 4FWLA 4OGEA 1NOYA 3KMSA 3UI3A 4FP9A 2MMYA 4ZVOB 5KQDA 5HQLA 5F9NA 4NLCA 4G1IA 3FMWA 2OFGX 3D3CJ 1XC3A 3J8AA 3Q8VA 4Q7AA 4YFUA 5E3RA 3HHNB 1AW0A 4K25A 1CG2A 4WFNL 3OTDA 4FVCA 2HIYA 4DUZF 2YKNB 2H1YA 5A2QO 4QYZK 3B6BA 3GG0A 5A8KB 1FKAF 4AE5A 2JWNA 3H3OB 3KDNA 1KVAA 4H0YB 2OAUA 2LKZA 1HRHA 1U2VB 2GC8A 3Q86A 4BRHA 1PILA 4P74A 1K1QA 2ZJRQ 3PW0A 4CI6A 2OPQA 2J6TA 1N33F 1X5SA 2FGOA 3O4WA 5C0YA 1Q53A 1M5KC 2P9SB 4G6VB 2ZHAA 2W2OP 2HHVA 3TAQA 3R2DJ 3NCPA 2FBYA 4L74A 2OD6A 2YWWA 3DM2A 5F2RA 4OI2A 1TUGB 2R8GA 2FHKA 3QT7A 2EWSA 3HXMA 2KJWA 1WHXA 3EWGA 1VBYA 2QWMA 1K0TA 5EU7A 2QL7B 1WSFA 2E20A 2ZQBA 1X4HA 4EFHA 1YBAA 2X51A 3MMBB 4JKGB 4LF4K 3D0HE 4QBUA 1D9FA 4NXNK 4DS5A 1IXKA 2CRLA 2QT7A 5IWAF 2Y9HA 3DRPA 4Q8EA 1V5VA 5B0AA 1S0OA 2ZUGA 4LF8F 4IYQA 3G96A 1RA7A 3D6HB 3MCAB 1I94K 4CJPA 5HATA 4CFCA 2XWYA 2JGUA 1XMOJ 5AFUA 5CD4A 3P5BP 2Y0SD 3QYYA 4QWEA 3IRXA 4FN5A 4UOFA 3L4IA 3DOLA 2RRAA 3ITHB 5LMNJ 3L7OA 3ZZTA 4LFCJ 2XMWA 1QE1B 5KOXA 2QWRA 2Y0BB 1QSYA 2E88A 3KVGA 5KFEA 2VKZG 3AOCA 3W2VA 3CMQA 3ZZZA 3H46O 4JI3J 1TP7A 4BR0A 2ZWHA 3P8BB 4FLVA 4X62K 2ZM6K 1K6YA 2XBPA 4CGHA 4OJHA 2HLUA 1E4FT 4LRCA 1BD6A 5JUMA 1N56A 1DLOA 5CCLA 2CZ4A 3WEEB 4IOCQ 3SV4A 1SJRA 2E44A 5HP1B 3CI5A 2DCLA 3NP5A 3QJPA 4WK3A 3I4HX 3BR8A 4ZK7M 1RGIA 3TP2A 3CULA 4KB7A 4TYBA 1HNXJ 4B3SJ 2HK2A 4E1NA 3TAMA 3BS9A 1D8ZA 4IXCA 2NYHA 3D9BA 4BBYA 4I6MB 2UUCK 1YWXA 3WBZA 4EBDA 2QW9A 2RN2A 4U67L 1YAGA 3V9WA 3OTCA 1XR7A 2UUBF 4K4WA 5DK5A 2XLKA 2V2VA 5BYQA 1B99A 1NPKA 3RJMB 1FRJA 1TL1B 3E8OA 4X65J 1HNWJ 4LF5J 2HWTA 3MAHA 2QTWA 2DCUB 1ZZNA 2R7TA 1N52B 4NOHA 4RNNA 4DR7K 1IN0A 1AUDA 3VGSA 4NXMK 1P6TA 4KB1A 3HKZD 1U8SA 3KLFA 1RT7B 3QIPB 4OZ3A 2GHPA 4L8RB 4MKVA 3NOCA 4CJ3A 3CJAA 5DZ7A 3CF5Q 3EE8A 1PYOB 1HPZA 4LF6K 3UDLA 3OHAA 4DG1B 3R8EA 3TX0A 1QQOA 5IQQA 1UW4A 4X4QA 2KHCA 2K2PA 2UUAJ 3J81U 4ZVRB 3W5YA 5LSRA 1TL3A 1T05B 4MK8A 3VEXA 4ECWA 4X64K 4V19S 2IDEA 3R6MA 3NS5A 3KLIB 1RAHB 2EKNA 4HWIA 1WEXA 2HHHF 1RYSA 4K4UA 2DITA 2MDAA 1AZSA 4F4AA 1X5PA 3HD2A 2HIQA 7FD1A 1B92A 1BL3A 4RUAA 2V94A 3CJ1A 5CZXA 4DR5F 1ATSA 1B7FA 3NMAA 4CF9A 4JI7K 2EBGA 2JLFA 5KFKA 1WDDA 4K4TA 4W5OA 4GV3A 3M1VA 4Z4IA 2Z2ZA 2OMOA 4EU0A 1HKBA 1JLCB 3HSJA 3I0RB 3QINA 3GDQA 3D6TB 1TUUA 2L9WA 4C8NA 3BSNA 3CTRA 4F4WA 4TY8A 1NGGA 3V1OA 3DOKB 2EKYA 1NXIA 2IPOB 1RYRA 3TANA 2LQ5A 3MCSA 3W8PA 3PIOL 1X3MA 2IJRA 4WPAA 1EO1A 1HNVA 1D1UA 2C3OA 5MAOA 5L9XA 5FRNA 2CJBA 4BRKA 4WBFA 1NB2A 3GIKA 4DI6A 1FA0A 1RLDA 2HHQA 2BW2A 2BQ3A 4PL8A 2KM8C 4ECVA 2Q1NA 3MECA 2IYGA 2K06A 4GVBA 2XS2A 2V4QA 1YGYA 1U6BA 3SSSA 2J7UA 4JI6K 2RDDA 1VDHA 1K9MT 3AV9A 4DR2J 1KFSA 3DKDA 1HX1A 1N36F 4CEEA 2OPSB 3UO0A 1XHXA 1AXQA 1P1TA 4CLZA 3EM1A 1VQ8N 1C4AA 5KFDA 3QFUA 4H4OA 3AJ2A 2WC9A 4KHUA 4CERA 2HZVA 1GLBG 2BM1A 4Q5VA 3LDPA 1H3DA 2EI5A 2MHNA 3PYEA 3P39A 1T9XA 4EYHB 5KT3A 2OPRB 2I9SA 4KKOB 4M5GA 1VBZA 5KFMA 4AHUA 3PJWA 3I56N 2MKJA 3J7AN 2D3ZA 2FC9A 2QRRA 4LR9A 4WIQA 3SYZA 3TEHB 5KOWA 2AX1A 2UXCF 4B1VA 3GYGA 2GVZB 3SCKE 2RILA 1WF0A 2IA0A 2G8FA 4DWIA 4HTJA 2RH3A 4M42A 2EFNA 1YX2A 4OX8A 1WF2A 3HT0A 2OUGA 1VJQA 2E4LA 2LA4A 3QGPA 2DH8A 2RUSA 4F25A 4JKHA 3SPZA 3QRRA 4DV6K 3HX9A 3KK1A 2LFVA 4OHWA 1O51A 2CQ3A 4MYTA 2HAFA 4MDBA 3J7YI 3A3NB 3QZ8A 2QMWA 3CJCA 1IKVB 1S1WB 3ZLJA 2H54B 2AJ2A 4NCBA 3TUZC 5I9EB 2P9LA 1Q5YA 8AT1B 4X4PA 3KKFA 1KLMB 2KZZA 2LLZA 1T8EA 4FF1A 3PRVA 5EX0A 1Q78A 1J5EF 4U6PA 1NRKA 3H3NO 1RHQB 2N4CA 4LF7K 2XSJB 5C25A 2FTRA 5M2UA 3MD3A 4DV3K 5KRSA 3D6RA 3GV8B 1UWBA 1JL1A 1WHWA 4DCOB 1GTHA 3J80U 2XY6A 1RWWB 5HMWA 1WOPA 4OI3A 4CF1A 2D9PA 3E1YA 1AT1B 3O3GA 4IO9Q 2LXIA 3CQ8A 1YVUA 3E9PA 3QESA 3HOSA 3KJVA 2VH7A 4GKKK 1UZHA 3IAS9 1N8RT 2QWOA 1JNRB 5HMXA 2GNKA 3THTA 4DQIA 3QB0A 4RW8B 1N0VC 3SBGA 4Z4EA 5AXKA 4LD0A 4CK2A 4DV1K 2WW4A 1U2FA 3SZ2A 1WSVA 2O3DA 2RQCA 1VQSA 3GIIA 4KRWA 3UVJB 3SUNA 3U7JA 2ASYA 4DV7J 4HTUA 4ZVPB 1U49A 3SFUA 4F02A 1L3KA 4LSNA 3QBXA 2G0IA 4FYVB 3BYRA 3SUOA 2HVEA 3VEYA 4KHPK 2WCXA 1JLGA 1KLNA 2F4VF 2QM1A 2Q1LA 4H03B 3H25A 5CYMB 3ZCMA 4EAHD 3FK4A 2BVZA 1T95A 3MUTP 3N79A 2MB0B 1KVIA 1YTYA 1NGEA 1RCHA 3OS0A 5A8WB 2J7KA 2XMJA 3MCNA 1FF2A 4O8KA 4L72B 1BY9A 3MMCB 1G7CB 2OO4A 2W9AA 4MIWA 1RT1A 2VJVA 1EJ7L 5J2NB 2Y1LB 4ISEA 2VG5B 2DBBA 3VAGA 4KRFA 2U1AA 3ONQA 2B4OA 4AYBD 5GADU 2D4WA 2MZQA 4WKRA 3B6PA 5BJRA 4WP3A 4MIBA 4C8OA 1OY9A 3VQEA 3Q22A 2HURA 1GLFO 4YB5A 2ILZA 3MWBA 1GT8A 1FJ7A 3LH2S 4YDXA 5EHHA 3I5CA 2CJAA 3H40A 3OTOK 2GUIA 2GW8A 4RO0A 2XGQA 2YX7A 1YVFA 5E3CA 4ZVHA 2M52A 1CJTB 4O5FA 1ESVA 3FKBA 3T5JA 3AVIA 3VAJA 3LWMA 3AVLA 1R8CA 4RBUA 2Z1GA 3F73A 2NRRA 3AVBA 2AJ0A 5KFWA 3AA2A 3J80Y 2G2YA 1UTAA 3BSCA 2WAQD 1EWRA 4DR6K 2RIJA 3HL8A 3AVHA 2DXDA 2VONA 2CQ4A 2V2ZA 3CIZA 4DQ8A 2P9CA 2MQMA 5JLFA 3QGIA 2A2CA 2Z8QA 4JI2F 4B3MK 2NXNA 3ULEB 3K7RA 2VFSA 4ECZA 1LW2B 2AX0A 3LDLA 4F3TA 5SZTA 4OHXA 3CUNA 2QK9A 1TU0B 3IP0A 4HEA9 4ZJOA 3VMFB 3AQPA 4O4GB 5H9EK 4C4WA 3PJ9A 2NXCA 1YUWA 1HWJA 3CD5A 4Y2KA 3ZSXA 3O2IA 4LF9F 4GW6A 4NLGA 3N01A 4FS2A 1H1VA 1D9AA 4USJC 4WE1B 3PIPQ 3MPVA 3AXMA 4X66F 4ECYA 2EWHA 4OYIA 2GMHA 1AYEA 3JYTB 2GIFA 2IRUA 1JXBA 3ENBA 4ZDNA 2EFQA 4TSXA 2VB6A 2BEFA 2ATCB 4H4KA 1RAFB 4BG8A 1ZBHA 4OYWA 4DTPA 2OIHA 2I0XA 4ILLA 3V2UC 4J5OA 4CGJA 1HNIB 3WEEA 3M9NB 4JS5A 4ZJLA 5D6GA 2ZOFA 5C24A 2MXYA 1HQEB 4P9SA 4U8VA 2OEKA 2VFUA 3CCSS 1T6DA 2H51B 4CJTA 2DPIA 3PJXA 1QAYA 1KVKA 1FRKA 4NLRA 2IVOA 3FSXA 3TSUA 1R8PA 4G1PA 3M5RA 1CEZA 1OPZA 2CPXA 2DR6A 5AQKA 1YDLA 2VIHA 4IOXA 4WP8A 3N6NA 4B3TF 2BTFA 4A47A 5KFFA 4C3MA 1TL1A 3D28A 1IKWB 1UEUA 2ZBRA 4X84A 4CTAA 4FWNA 4BGAA 4DSKA 5HRNA 1YTAA 3SMPA 1T02A 4AQYF 1SC4B 4C8KA 1ILYA 1LFWA 2P51A 5AQSA 3HLUA 4OYPA 5K9FA 2E7VA 2HNZB 4CVNE 4ECQA 4UY85 1TL5A 3CPWR 3SIPB 3V4IA 1PYTA 3OYLA 4IDKB 1NNDA 4X4VA 4C3LA 4FOEA 2KG0A 1XNRF 3VPZA 4IJAA 3WXMB 3I8DA 3HVAA 3K0SA 4CEZA 3LAMA 1B0TA 4N76A 2B6AA 4NLYA 2ZH5A 3MTKA 5BPMA 3CCJN 4EK2A 4KFBA 3F2KA 2YNIB 1R6YA 2AIRB 3A8EA 3QWUA 2BANB 1IBMK 2IMWP 2O8BA 4C8ZA 2F8SA 1T3VA 3KLIA 4CZLA 1RBLA 4LREA 2ZC4A 5T41A 3R7SB 2UVUA 2QTDA 3BZKA 5DM7Q 1DURA 2IOCA 2PAVA 4W5TA 3ZZRA 4OX9F 3NAHA 2NPIA 4QWAA 2MJNA 3BGOP 2QEXN 3CMAN 3S1TA 3FEZA 1NMNA 3ALYA 5EGYA 1RBRA 1V6HA 1NSAA 1OO0B 4OLPA 3RMDA 2GHVC 1REVA 4J2AA 4I0WA 5KG3A 3H4DA 3M32A 4DCPB 4MKYA 3FC9A 3NDKA 3I9V9 3PRDA 1F0XA 4DU1A 1IKYB 4AHSA 3I0RA 2DO0A 2R7UA 3M2VA 3IC1A 3NWGA 2PFDA 4TVAB 2J9EA 2ZJRL 4H4MB 2IM1A 2MLYA 3FCWA 3F0NA 2CDRB 3DGPA 2QWNA 4CLTA 3SQGB 3DMJB 2W7PA 3THXB 4BHQA 2G8HA 4DFPA 1B3TA 2V69A 1KONA 3HFVA 2GX9A 4ENOA 4CNYA 4BDZA 4B1XB 3Q24A 1NDPA 3QAEA 3JAMY 3ISND 1NK6A 4DTSA 3OJSA 4QYZJ 2F9TA 2W41A 1XK8A 3W60A 4ED5A 4DLGA 4Z94A 1X9MA 3FJ2A 1HLUA 2UYTA 3G6ES 3CWJA 1OSDA 4WIIA 1W25A 1HMVB 4K4VA 2JLEA 4JV1A 4YOEA 2NSCA 3ET6B 2W01A 3CJSA 4H5WA 2KN4A 4BQLA 3EZUA 1V9OA 4DTXA 1VQ5N 2A40A 3ILLA 4OZLA 4CCHA 3EE9A 5AE1A 1F3FA 1GLJO 3HPOA 1CJUA 3FDSA 3L3UA 1KTVA 3OL7A 1U6FA 4H0VB 5IWAK 3DRRB 2XMTA 5D77A 4LF4J 4JHDB 3ZZYA 3KKSA 2BBEA 4CNZA 4NXNJ 5B0EA 1TYQB 3AVMA 3BKTA 2MZJA 2XZTB 3BGLA 3NFAA 1UVMA 3C16B 4DPWA 1I94J 2W9CA 4YOYA 5D0EA 3IMQJ 1TK0A 1CZAN 2IVMA 3EXYA 4IOCL 5KFQA 4OKKA 3CDUA 4DB3A 1P8ZA 2P6TA 3BQ2A 2B9YA 2FSKA 2BE7D 1VISA 2V52B 3LM9A 1HR0J 4YDUA 4WKYA 3N5BA 4CJ7A 3TTCA 4IQMA 3DXBA 4LRFA 5M1FA 2HFUA 3MHYA 4M8LA 2DHGA 1S1WA 4RPFA 2RNEA 2KHOA 1NKCA 5ADXA 1VQ9N 3AQOA 4FF4A 5HVHA 1VRTA 5LM7E 3CPWM 2ZNYA 1SC6A 3L09A 4UW2A 2MY8A 3EXCX 2FVPA 5HJXA 3RSEB 4AXJA 4DUTA 1YJ7A 3GFXA 4M41A 3LAKA 2OTJS 4CIEA 4MKAA 2GIRA 1J5OB 1B70B 2YKAA 1S7HA 4JI0K 3MTJA 3T3FA 3WXIA 4FBUA 4X4RA 2DFFA 1VCTA 3CB4A 4DQPA 3HO1A 4CEQA 5C42A 4KH5A 3CF5L 1SVDA 2JH3A 2ROEA 3GTYX 5EX5A 2UUBK 1KVJA 1YJ9N 1FFSB 2L48A 4ZPAA 3O6WA 3BUZB 1GNKA 4O44B 1NK5A 4YOTA 3LW5C 1OVYA 1K8AO 2FHJA 5C2FA 3FQLA 1SS6A 3W0LA 4KH0B 1F60B 1VQNN 2DHSA 2G1HA 3PRBA 4PXEA 3KK3A 2UP1A 3VQQA 2XHCA 3E2EA 3NRBA 2D7SA 4B9SA 3PO4A 3MFIA 4Y1CA 1XNQJ 2P9NA 5FLXY 5F9LA 5FROA 4O55A 1WD6A 1S9GB 2DHHA 4DSEA 3E9OA 4CF8A 1KDNA 2RF2A 3RVCA 2V8VA 4LF6J 2BJ9A 2HBKA 3UDEA 1RBAA 3THWB 3QEVA 2RAQA 3QT5A 5KFYA 3K5LA 2CQ0A 2PGCA 3VQPA 5M1NA 1VSJA 2KXHA 1IR0A 4DL7A 3A8IA 3AO3A 3J7YU 3S01A 1M0SA 2HHHK 2QLBB 4X64J 3U8XA 5AQNA 1HYSA 4NMLA 3HHLC 2R8IA 3E01A 1VQYA 3QBCA 1TKXA 1ROFA 4J9SA 4PG7A 3A8KA 1U0HB 4I64A 3D2WA 4CECA 2VFRA 4KT0C 1H2UX 4Z4HA 3TZZA 3T41A 3I33A 1IR2A 4C11B 4KBIA 3GYXB 1PJ6A 3W65A 1C0FA 5G4DA 2ZUAA 3A0IX 2H9ZA 4WU2A 2VQEF 2WOMB 2XMUA 2O4GA 3ZTOA 2WBRA 3O4QA 1VI7A 4CLSA 4KGKA 3TARA 2HYIB 4CJVA 2Q66A 3HZGA 5J2NA 4W98A 5F1XA 3C7NA 1YK9A 1FVQA 2X3DA 1DRZA 3OR2A 3DOMB 2F96A 1VMBA 5I4MA 4BREA 2QLFB 2W24A 3SQ2A 4NLOA 4O0NA 2CZ9A 5M1KA 3EEQA 3MOZA 3CC4N 2PFUA 4BC2A 4RUBA 5B08A 2VBYA 1ASUA 2BX6A 1ZH5A 2YHAA 2CVEA 3VQ5A 4CE9A 3T1YJ 1LK5A 3EPGA 3BF3A 4CZKA 4CIGA 2R7YA 2AV5A 1M90O 2HGMA 3FVYA 5FPMA 1W2IA 3HT3A 1J27A 5MLCQ 4B3RK 2B9XA 3ZT2A 4NLXA 4FLZA 1ZBSA 2YX1A 4JI6J 3CCQS 3W61A 3PW2A 3VQ9A 2QA1A 1N36K 1SIWB 4CLYA 5FPNA 5BN8A 4E7IA 1S3XA 4DU8A 2HQIA 3TAEA 3VZIA 1T3OA 3QERA 1YRTA 2RJZA 4A8YA 3TJ9A 1WSHA 3CJ3A 4HACA 4LH4A 1LW2A 3MR2A 1HQUB 4Y00A 5H1SQ 2GCFA 2PMHA 2NLWA 1MMLA 2Q2RA 3O8MA 1NCLA 2QE5A 3ZETA 4O4GA 4JS4A 3DU5A 1FD2A 2EFGA 1E6VA 3MN6A 1PJ7A 1NSPA 2F7TA 2LVWA 4IQXA 4YB7A 3TX8A 5DLFA 1X5TA 4KHRA 2V8GA 4YOWA 2P9PB 4AHCA 4CH1A 1H2VZ 1X0PA 2F5GA 1FO1A 5JMNA 4PY5A 1WOQA 1WKJA 5LJWA 1H38A 3MX2A 3CCRN 2IHR1 4HKQA 3NLCA 3MEGB 2R8JA 1QM9A 1FRXA 2Z2YB 1VHXA 3UQSA 3N6LA 2J8AA 5JVHQ 4IH6A 4IO8A 5DS7A 2ZGYA 4CM2A 3CC7N 2ACYA 2PMZD 2WUSA 2HVDA 3JXOA 2CYYA 1F3VA 2VODA 3M8YA 1M1KT 3UFCX 4AILC 3MXMA 4IO9L 2HHWA 4FLTA 2XS5A 2VPWB 1RWOB 4DTMA 3ID6A 3DXKA 3WNEA 1RKIA 2G0JA 1NG9A 4QQBA 3KLEB 5F8LA 1NGCA 4FW2A 3IFEA 3THVA 1FE4A 2HRTA 4OYBA 1SJ3P 1JKHB 1UJ4A 5FDLA 1IKWA 4AH9A 3RMBA 5J1EA 5B09A 5LOQA 2R7SA 1DAXA 4MLHA 4DV3J 2O8CB 4HCCA 2XCAA 4KI4A 1RJJA 1IJJA 2HRYA 1RT3B 5LL6Z 2O8DA 1PSDA 3ZT1A 3SAHA 3OHRA 4EO8A 1S1XB 4DV4F 4ES2A 4JI1F 3HSDA 4YN3B 3WIVA 1B9FA 4B9UA 4RR5A 3X3UA 2MKHA 4CZIA 3TR8A 1QSLA 2DHXA 5DG9A 1DT9A 3QDKA 1QS4A 3PV8A 3O44A 3RW6A 2BANA 2W40A 1GOBA 2A42A 4DV1J 2V7ZA 4UF4A 2FQQB 3BO3A 5CZ2A 2ZHBA 2NZTA 2IA6A 1ZBTA 3KHRA 3ZX0A 4FM0A 4PG4A 4RKUC 1RTDA 3CCEN 2HBMA 2C1EB 4WYBA 3QJJA 4R0JA 1BWVA 5AQIA 5M1PA 5AJ3K 2C3PA 4XH4A 2E1MC 3QRQA 3AA9A 4FXDA 2I7PA 2F4VK 1KCFA 1A7GE 4H0TB 3LPUA 2C2KB 4DS4A 2R42A 1L3VA 3C2PA 4ZVUB 4ZVSB 3W63A 4DL4A 4J8FA 3RAXA 1FXDA 1SI9A 2AYMA 4ALZA 3CC2N 2HZCA 2XG8A 3V4MA 3IUCA 1FHTA 4M5HA 2A2DA 3UIQA 1IKYA 5JS1A 2FYXA 1JCFA 4QS8A 2H3EB 3M2RB 5JMVA 1WOOA 1U02A 4PG8A 3MXHP 5ETLA 4H4MA 2RU9A 5F8MA 3D66A 3OVAA 1VQMN 1FEEA 1TVRA 2GV9A 2X78A 4P7TA 5J2QB 2XQCA 2P5GA 4DR1J 3SQGA 3F56A 3TZXA 2Q3SA 3DLGB 2AW0A 1LCUA 3IXQA 2H4WB 3OBWA 1UEKA 4NL5A 2WB4A 3PKYA 3TNVA 2BJ3A 1CULB 5CZ1A 3IDHA 4O4RA 4LVOP 2M7SA 3AVGA 1YZ6A 1BOTO 2W9BA 2Q6CA