1EETA

Hiv-1 reverse transcriptase in complex with the inhibitor msc204
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
557
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTQLQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Urea-PETT compounds as a new class of HIV-1 reverse transcriptase inhibitors. 3. Synthesis and further structure-activity relationship studies of PETT analogues.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 153
structure length 542
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1eetA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1eetA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1eetA05
5KT2A 1HNVA 2I1RA 4DQPA 1DTTB 3HKWA 2OPSA 3PZPA 3HO1A 4ECRA 3MEEA 1JLFB 1LWFB 3L2UA 4LSNB 1IO2A 3O4NA 2YNFB 3QEPA 4CJSA 4EO6A 1BHLA 3QINA 3MECA 4KTQA 3QZ7A 3IRXB 4OJRA 4QWCA 5L9XA 1HYZA 4ED6A 3OHAA 3S3MA 4K4UA 4TSXA 3MAQA 3M8PA 4FLZA 2XCPA 3SQ4A 4HCCA 2R7YA 1UA0A 4LH5A 3AVKA 4QWEA 1BGXT 4OLBA 3LP2A 2YNHA 1ASVA 1VRUA 2IJNA 4Q0BA 4CJEA 1JLCA 4IH5A 4DU3A 3DOLB 1D9DA 4DSIA 1CZ9A 1VSDA 4JS5A 1JLAA 2JLEA 4I7FA 2C2DA 3CJ0A 3C6TB 2FLLA 1ZBFA 3D28A 3ALYA 3AVMA 3HVTB 2XGQA 4DF8A 1IKYB 1WAFA 1DTQB 4ID5B 1FXXA 3D45A 4B9LA 3H4DA 4ECTA 3SQ1A 4NCBA 4FBUA 1T7PA 4ELVA 4DF4A 5J2NB 4FLVA 4CHZA 3OJSA 2ZD1A 3DRRA 3OYMA 3DYAA 3OLAA 4CFCA 4CK3A 3DRPA 3RRGA 1S97A 4KHNA 2B6AA 4CJWA 4E1NA 2HAIA 1N6QB 2GUIA 4DFJA 3PO4A 5DK5A 3DLBA 4Q5VA 1J54A 3MTKA 1XHXA 3V81B 4ZVEA 2QXFA 1BI4A 1RDRA 4K50A 3TAMB 1C0TB 4NRTA 3RB3A 2NUBA 1MU2B 1S1TB 5HP1A 1RDBA 2R8HA 2IMWP 1X1PA 4BDPA 5KFHA 2UVVA 3T1AA 4DSLA 3H4BA 4NCAA 5HP1B 1S1TA 1MU2A 4CJPA 1N56A 4RZRA 5J2PA 3QLHA 4G1QB 3NH1A 2ASLA 4M94A 1I39A 2RKIA 3CDUA 1EETA 4B9NA 2VWJA 4X2BA 3BSNA 3MEGA 2R8KA 3OYCA 3OL7A 4YNQA 4QWBA 4B9UA 5KGXA 2HHWA 4DTNA 5FROA 1UWBA 5CY4A 2DFHA 2UVWA 5HROA 5JUMA 1ZBHA 4Z4FA 5FDLB 4KB1A 4O0IA 3O3GA 2R8JA 3ITHB 5FDLA 4B08A 2R8IA 1GX6A 3VQCA 4KV8B 4CGGA 3ZSRA 3KJVA 3AVGA 3K5LA 2W42A 4IDKA 1J53A 3TABA 4HVJA 2Q3SA 2B43A 1IKVA 4NLXA 4NLTA 4WFZA 3NH2A 1RTHB 2RKIB 4O3RA 3IGVA 1BQNA 1NK7A 1U45A 4KAIA 2YKNB 4Q0BB 1RT5B 1VRUB 4J9PA 2FBYA 2BR0A 3NL0A 2HNZA 2B5JA 3EZ5A 3SCXA 2XWYA 2ASJA 1HJRA 3ZT4A 3V6KA 3C6UA 1S9EA 4Y34A 3M8PB 2OPPA 1OS5A 3AO1A 4CIEA 3Q8QB 2BANB 4GW6A 1BI4B 5DGAA 2IC3A 2X6SA 4IBNA 1QAJA 1ZTTA 1YT3A 2ZKUA 1SUQA 4BACA 4WFYA 1JLFA 1TAQA 4RG8A 3OHBA 4EYIB 1D1UA 4BWMA 1JLEB 2JEGA 3NF6A 1LWEA 4CFAA 4O5BA 3OYIA 2XI3A 2E6MA 5I3UB 3NKYA 5T7BA 4RW9A 1HARA 4DG1A 1SV5B 4ZVGA 1TKTA 3H98A 2XHBA 3H59A 2HHTA 4DL7A 3PR5B 4I2PA 2LSNA 1JXEA 3DMJA 4RW8B 4F4YA 2R2RA 3P1GA 3CG7A 4CGDA 2V9WA 3NDKA 3RBEA 4N76A 3DLKB 4AHCA 4CEDA 1RT2B 1U47A 3TQ1A 4I7FB 4CHYA 3KD1E 2ALZA 4FZYA 5KRTA 2BDPA 1KFSA 4Z4EA 2UVUA 2G8IA 5KFYA 4CJ3A 3DOKB 4O4RA 5JXSA 2KZZA 4NLQA 3K2PA 3G6XA 4R8UB 2ASDA 2W9AA 2XC9A 3ZSQA 5KT7A 2V4QA 3NH0A 1HRHA 4HKQA 1C0UA 5F9NA 1BL3A 4DTRA 1WSHA 1HPZA 4MQ3A 1SH2A 1W0HA 3RRHA 2P5GA 1FKPA 3WNHA 3L2RA 3M8QB 3KTQA 3GILA 3T5LA 4I9LA 4J2BA 3AVIA 1EX4A 3HK2A 4FJMA 2QE5A 3OSPA 3JSMB 3IS9A 1IKWB 1EP4B 3KK1A 1F21A 4M41A 3IS9B 3JSMA 3BSAA 3TR8A 1RNHA 4ED1A 2VA3A 3KK2B 2P51A 4WZMA 3OYFA 4CHPA 3UIQA 3QEXA 4ECUA 1EXQA 1RT2A 3LPUA 2OZSA 3TAQA 4AHTA 4M3XA 2Z1GA 3NAEA 4ELTA 3K59A 4IR1A 1TP7A 1RA7A 2AU0A 3KK3B 4FJGA 4CF2A 2EHGA 4IFVB 2FLPA 4FK0A 1O1WA 1BQMA 4H4OB 1X9MA 3PO5A 3NHGA 4DFMA 2FBVA 3PX4A 3RR7A 2IM0A 4QW9A 3AO2A 3ZT2A 3T5KA 2ZE2A 2HMIB 3OYJA 5E41A 3AVCA 5CYMA 1KVBA 4PUOB 4H8KA 3VA0A 2PY5A 4KRFA 1JLEA 5L1JA 4HUFA 1CZBA 4ICLA 2BQRA 1SUQB 5C42B 4QAGA 5KFAA 3DMJB 3OYAA 2IC3B 5EUHA 4I2PB 1QAIA 4YP3A 2DPIA 1JLQB 4OPJA 5KFUA 1VRTA 3QIPB 1RTIB 5EU7A 1NOZA 1Z25A 3L3VA 3T5HA 2YNGA 5C24B 1K1SA 3U3YA 1LW2A 4FJKA 3AVLA 2HNZB 3LP0A 4ELUA 3BQ1A 4FK2A 1RT5A 3V1RA 4GMJB 4FJJA 4O3OA 4WXWA 1XWLA 4B8CA 5CZ1A 2FJVA 3RR8A 3L8BA 1TKZB 5J2MA 3HM9A 3SUQA 5DG7A 1S1UB 4ED2A 4KTWA 2BE2B 4E7LA 3GIJA 5KFNA 1IH7A 1KHVA 1BIZA 2EC0A 4HTUA 3CJ5A 5KT3A 3LP1B 4AHUA 4CEQA 4Y1CA 2VG5A 4Q8FA 2HVIA 3C6UB 4XIUA 4O4GA 3P5JA 2R2UA 3BJYA 4NLYA 1DLOA 1T94A 1T05B 1KFDA 3NGDA 4OVLA 4KHMA 4JV0A 3CYMA 2I5JB 5KFRA 4KPYA 3DM2A 4K4YA 2XY5A 4YQWA 5KFFA 3LZIA 3MEDA 4PA1A 4RW4B 5HRRA 2J6TA 3HHKA 3PJXA 5HBMA 4KFBA 2P1JA 4IG3A 3QLHB 4G1QA 1KVAA 3I0RA 4BE0A 2PYJA 4RNNA 1VSMA 2IOCA 5KG4A 3HL8A 1TKXA 4TN2A 4FW2A 5J1EA 5HLFA 2D3ZA 4K8ZA 3PX0A 4RNMA 3VQ4A 2PZSA 4ECZA 2D0CA 4DS4A 4O3NA 4MKAA 2DPJA 4KTZA 3VQ8A 4ZTJA 5DLGA 3OLBA 5DMRA 3CFRA 5K14A 4MFBA 1C1CA 3HP6A 4F4XA 3G0ZA 3ISNC 4CJRA 1GOAA 4ZPDA 4GC6A 3KLGB 4DL6A 1RTJB 2V4RA 4FM0A 1RAJA 4GVMA 2BRKA 3KHGA 3RB6A 1U04A 2FJXA 2B6AB 1JL1A 5KFXA 4OPKA 5SZTA 2ATQA 2XY7A 4OL8A 1CSJA 4M42A 5CZ2A 3GV8B 4FLTA 1D5AA 5J2NA 4CHNA 4BWJA 3UR0A 4URQU 1C0TA 2JC0A 3SQ2A 2IJFA 4M3ZA 1VSHA 5CYQA 3NE6A 1GX5A 4ZP7A 3KHLA 1KRPA 2OH2A 4IG3B 3PV8A 4JUZA 4LQ3A 3HVTA 3LPTA 1SL0A 1XC9A 4RW4A 3E51A 4XPCA 1RT1B 3PX6A 4DL5A 3KHRA 4TY8A 1ZBLA 3KHHA 1NK8A 3SFUA 4J9OA 2UUWA 3SUNA 2C22A 4RU9A 3U3GA 1DLOB 4ECWA 3DRRB 1LWCB 2VG7A 3PUFA 3M9MB 2IM2A 4FJIA 1IKXB 4EEYA 4CF9A 4ID1A 4KHSA 4EP4A 1KSPA 1XR5A 4CF1A 1RT3A 4CIFA 3OL6A 1L3UA 3OS1A 1ZBIA 4ED0A 1GOBA 1KLMA 3D5MA 1XHZA 2G8WA 4JV2A 5EWGA 1JLAB 1S1UA 1KLMB 4LSNA 2FBTA 4JS4A 1LWFA 2WOMA 1RTDB 3EY1A 4URGA 3CVKA 4CJLA 3CO9A 2IGIA 3VQEA 1S6PB 4BE1A 3AV9A 3FQKA 4CJTA 4LSLA 3ZT3A 3NAHA 3QETA 3IG1A 5HRSA 3KLFB 1QUVA 1QTMA 3D0PA 1LW0A 3VQ5A 3FFIB 4EZ6A 3NBPA 4EO8A 3IRXA 1REVB 3DI6A 1NK0A 3ULDA 2E6LA 2W9BA 5KFWA 4DFKA 3C95A 4B9VA 4DS5A 1RBSA 4E3SA 2JC1A 4ZMMA 4CIGA 2RDJA 1WN7A 3VQPA 3RAQA 3V9XA 4IQXA 3NAIA 3VQ6A 2X78A 2HW3A 3M9OB 2ZE2B 2HMIA 3FQLA 4CF0A 3OYLA 3SV4A 4KHRA 2QKBA 2FJWA 1RT7B 1RT6A 2W8LA 4HUEA 4H4MA 3BSOA 4AILC 1JKHB 4ZP9A 3BGRB 3TARA 4OGEA 1VSKA 1JLGB 4C8KA 1C1BB 4CJ5A 3ZT1A 3BDPA 4TQSA 3RAXA 3KLGA 3QEWA 4DTOA 5KFGA 1S5JA 1C1CB 2KQ2A 3OS0A 1HYSB 1S1VA 1QSSA 3VQDA 4N41A 1T8EA 2O5DA 1GOCA 2BQ3A 4NLSA 4FS1A 4ZHRB 3CFOA 2X6NA 4C8LA 2B4JA 1SL1A 2HNDB 4NCGB 3ZSXA 1S1XB 3PW7A 2G8HA 1SKWA 1S4FA 1FKPB 3TAFA 4CGIA 1HNIB 3AA4A 4F4WA 4FLXA 5DQHA 3MEDB 1YTUA 1TL3A 2YKMB 1A5WA 3KLHB 1L3TA 2HHQA 1W25A 1C0UB 5KG5A 5KFIA 4WXOA 4CHOA 4PQUB 3NMAA 2IDOA 1TVRB 1RT4A 3V6DA 2ZQBA 2XO7A 4FLWA 3WNGA 2ATLA 5C25A 3VA3A 2HHSA 4O44B 2GC8A 3I0SB 3MXMA 3TAGA 2HHXA 4CEEA 5C5JA 4B3OB 5I42A 4C8OA 4CF8A 5KFVA 1KTQA 5KFMA 2G8UA 3LP1A 4YFUA 3BQ2A 2YV0X 3DLKA 3LWLA 4WYLA 1FKOA 3SPYA 3KLIA 1WSJA 4KI6A 3PY8A 1QS4A 4IFYB 4DQIA 3V4IA 2BRLA 3B6PA 1S0NA 2W8KA 4EYHB 3DLGA 4JRQA 3L3UA 2D5RA 2UVRA 3AA3A 3QNOA 4PWDB 4ECVA 4DG1B 2Z1IA 1C2PA 2WCXA 2JEFA 4IRDA 5C24A 4NLVA 1N4LA 2YNGB 1Q9YA 4NYFA 4CK2A 4YMEA 3SYZA 4RW7B 3LDSA 1XI1A 3QO9B 4NZ0A 5KGWA 4PWDA 3VQAA 5KFQA 3H5YA 4TY9A 4NLRA 1QHTA 2AJQA 3MR2A 3KD5E 4FK4A 1S9FA 3QERA 4IFYA 4M3YA 1L5UA 5D3GB 3OVNA 1ZYQA 2RPIA 4E7JA 3I5AA 1RCHA 4R0EA 3QYYA 3PJWA 2E9ZA 3GQCA 4IH7A 4E89A 4ECSA 1WAJA 1WLJA 3HVRA 3I0SA 2VG6B 3CIZA 4O44A 3B6OA 1QSYA 1RILA 2A1RA 4J2DA 4NYNA 1NHUA 1RDAA 2ITGA 1CLQA 4WE1B 5FRNA 3GV7B 4O0JA 4E19A 3OYGA 4RNOA 3EPGA 3V9ZA 1NK5A 3NF7A 5KG6A 5DGBA 1FKOB 1SH0A 2DFEA 4FXDA 5KFZA 2FLNA 3KJVB 5F8LA 1JXLA 1B9DA 4QWDA 1S1XA 4FJ5A 4KBIA 5I42B 4CGJA 3HSTB 2HNDA 4CE9A 4CJKA 4B3OA 3KK2A 1HQEB 4B8AB 4HYKA 1BCOA 1S10A 3AA5X 1ZETA 3WNFA 4NLWA 1QSLA 3OY9A 1EP4A 4YR2A 4K8XA 4W5NA 1RBUA 4CEBA 4OGCA 4CJQA 2OYQA 4W5TA 3PW5A 4F3OA 2HWHA 2OA8A 4W5OA 3OYDA 1Q9XA 4O3PA 3K58A 3CWJA 4KO0B 2Z1JA 3GIIA 1L3SA 4DSJA 2X74A 3DLEA 4KKOB 4CFBA 3KLHA 4OKJA 1J5OB 1A5VA 2D41A 5F8MA 1EETB 4Z4GA 1K6YA 2A1SA 3VN5A 3CQ8A 5KG2A 3RBDA 3MR3A 4CGFA 4NRUA 3GV5B 4IG0A 4R5PA 4FM2A 4DWIA 1VK0A 4R8UA 4ZHRA 5DG8A 3SNNA 3TAPA 5KFTA 4CESA 1SL2A 3RMAA 3LAMA 3OYEA 1TV6B 2KW4A 4TYBA 3N6LA 3FDSA 4W5QA 3SI6A 5L1IA 1L3VA 4Q43A 4CFDA 3TAMA 3RMDA 3S3NA 5KT4A 1S6QB 4QCLA 4DSFA 3O4QA 4FCYA 4CECA 3V81A 5HRPA 1ITGA 4NLGA 4J9SA 1C1BA 1JLGA 4FLYA 1S0OA 3MFIA 3H08A 3AO5A 3Q8RB 3DRPB 3PHEA 4Z4CA 4H4MB 1TL1A 2IA6A 1RT6B 3KLEB 3A2FA 4LSLB 2YNIB 5KFOA 2O4IA 4B9SA 4FBTA 1NK6A 1WSFA 2E9TA 2F8TA 4FJ8A 4MK9A 4MK7A 4JV1A 1RTDA 2FVCA 4FYDA 3TAEA 2KFNA 3P83D 3ZSZA 1HMVB 1REVA 1LV5A 4E7KA 5EWFA 4FJNA 3VQBA 4ZPBA 5KG3A 3H40A 3OL9A 1NNDA 1JLCB 4FZXC 4LH4A 4E1MA 4TLRA 3K5NA 4IOBA 4XO0A 3LP2B 1S9EB 2F8SA 3E01B 3AVNA 4TXSA 3KLFA 2AX1A 3DLHA 3HJFA 1IKXA 1S6PA 1U49A 4R5PB 1NKCA 3MXJA 1NK9A 1LWCA 2VG7B 4CHQA 3KKRA 4AH9A 3TANA 4ZTFA 1BQNB 2R2TA 5KFDA 3M9NB 4C8NA 3NF9A 1S9GA 1HMVA 4QPXA 1TKDA 2OPQB 1XR7A 3KMSA 2YNFA 4F8RA 2IM3A 4DU4A 2QK9A 4TQRA 1BIUA 2WTFA 3HYFA 3HVWA 1DTTA 1QQCA 4ZVFA 4RNHA 1TK5A 3ITHA 4M3WA 1YTAA 5HROB 3ZSYA 4Y1DA 4AHVA 4MIAA 3SV3A 1I3AA 1TL1B 3SI8A 1UOCA 3BSCA 3EPIA 4KI4A 4Y2CA 3DDKA 2WONA 2AGPA 3RWUA 3MEGB 2JEJA 4B9TA 4JRPA 2F8EX 3H5SA 1NJZA 3M8RA 4MFBB 2IM1A 5K14B 2JEIA 5CYQB 3ASMA 5F8HA 2WHOA 3PVXA 2FBXA 5KFCA 2HNYA 4DQSA 1NK4A 1TV6A 4N5SA 4I2QA 4ZVHA 3GIMA 4U7CA 4LY7A 1JIHA 3PW4A 3QGGA 1VSEA 4DL3A 4K4XA 3SZ2A 3V1OA 1JLBB 1WSGA 5HRNA 2XI2A 2GV9A 4URSA 2JGUA 1RYRA 3S9HA 3Q8SB 4K4TA 4KKOA 3DLEB 3NCIA 3VQQA 2GIQA 3T5JA 5KI6A 2CJQA 3QO9A 5JS1A 4RW7A 4I9QA 4LD0A 1R0AA 3O3HA 4DQRA 3AO3A 4FS2A 2ZD1B 5HLFB 1TKXB 2ILZA 1KCFA 2DFFA 1Y97A 3PW0A 2VG5B 3I0RB 1RDDA 4O55A 3H2LA 1Q8IA 4EZ9A 2KFZA 3NFAA 2J6UA 2D0BA 1IKYA 5HBMB 4J9QA 3QESA 3ZSVA 3L2QA 3DM2B 3S3OA 5KFBA 1A5XA 2WB4A 4JLHA 4E7IA 1UAXA 2YHAA 3TWHA 2YNHB 1T05A 3LP0B 1LAWA 3RTVA 1T3NA 1NHVA 3M8SA 3OS2A 2WRMA 3N6NA 3V9UA 1RT4B 3V6DB 3RMCA 1RBVA 1R0AB 2C2RA 5KT6A 4EBDA 1LAVA 4DLGA 3QIPA 4Z0UA 4HHTA 4K4WA 2BGGA 4PY5A 3CM6A 1WSEA 1D9FA 2OZMA 3OSNA 4F4KA 3EZUA 1WSIA 3NF8A 3PR4A 1ZTWA 4KSEB 5J2MB 4ED8A 3MEEB 1ZBUA 4KAZA 4IKAA 1NJWA 5KFSA 4PUOA 2W7PA 1BISA 4FVMA 4O3QA 4BDZA 5F8IA 1BCMA 4I2QB 2R8GA 2FVSA 3LP3A 4HCBA 4M3TA 1RTIA 2RF2B 1VRTB 3CJ4A 3KLVA 1BQMB 4H4OA 3JYTA 4K4VA 3OYHA 3LAKA 1T03B 4WFXA 3V6JA 3QZ8A 4M45A 1TK8A 3F73A 1U09A 4DMNA 5C42A 2P5OA 2YHBA 3V9SA 4Z4IA 1J9AA 4DQQA 2BQUA 5CYMB 4Q8EA 3HPHA 2W7OA 4M3UA 4LQ9A 2HHUA 1RBRA 2O4GA 4CK1A 1U48A 1XR6A 4Y3CA 2E9RX 2HNYB 1VSIA 1KVCA 1CXQA 5C25B 1C0MA 1IKWA 4CEAA 3Q8PB 4J2AA 4CJ4A 3QGHA 1Z4UA 4Q45A 3LWMA 4CGHA 4J9RA 5KG0A 4J9LA 4E7HA 3NGZA 4ZPCA 1S48A 2WONB 2Z1HA 2AQ4A 2HHVA 3QNNA 3NBPB 4B9MA 1FK9A 3CM5A 3L2VA 1SKSA 3SUPA 1U4BA 1LW0B 4RUAA 1S1WA 1RA6A 3AVJA 5SWMA 3T3FA 2XGPA 3THVA 5J2QA 1D8YA 2G8VA 3G86A 3T19A 2GIRA 2QKKA 4RNFA 3AA2A 3QIDA 3DOKA 2IBKA 3CJ3A 3GIKA 3HXMA 4J9KA 1YVUA 5F8JA 3MXIA 2WOMB 4NLPA 3M8QA 3UQSA 3V6HA 2W9CB 1RBTA 2OPQA 4L8RB 1S0MA 1S9GB 1NJXA 4WYWA 4KREA 3KIOA 4IR9A 3NGIA 3EYZA 2C28A 2VWKA 1HPZB 3CJ2A 3HVAA 3MF5A 2HB5A 1WNEA 4FZZA 4E0DA 4RW8A 4Y2AA 1S49A 4IRCA 3TVKA 1RT3B 3OYKA 3QEIA 2EX3A 3L2WA 4H54A 5KG1A 4DEZA 4DLEA 4RW9B 3ZCMA 3E01A 3CDEA 4DSKA 5KG7A 1QE1A 2XY6A 1LWEB 3AVFA 5JS2A 4DL4A 3DRSA 3SUOA 1RT1A 2XCAA 3I5BA 4MK8A 3BQ0A 5FRMA 3G6YA 1IG9A 2W9BB 4J9MA 4WZQA 1KLNA 3DI6B 1TQLA 2BANA 4DSEA 2RN2A 5DLFA 3SPZA 3UDLA 3VQ7A 4QOZB 3FFIA 1KHWA 5DQIA 1QE1B 3TI0A 4ZP8A 2YNIA 4EP5A 1TKTB 4MKBA 1SV5A 3KLEA 3GYNA 4F2RA 4KHWA 2Y1IA 3DLRA 3WNEA 1NKBA 1TGOA 3FRZA 2B5JB 4DTJA 1CXUA 2J6SA 1RYSA 4KB7A 4CEFA 2HVHA 4ECXA 3ZSOA 3LZJA 2YKNA 3K5OA 2IAJA 3UPFA 4KHYA 1RTHA 4DL2A 1X9SA 1W9HA 1VSJA 5DG9A 4F3TA 4RW6B 4IH6A 1RDCA 3V9WA 1N48A 2OPRB 4FJHA 2RDIA 1J5OA 2DY4A 1C1AA 1S6QA 2V0NA 2W9CA 5KFPA 4F50A 3C94A 2QV6A 5T14A 4KHQA 2OPPB 3BR9A 4CERA 2XRIA 4DTMA 3SFGA 3V1QA 4OLAA 5J1EB 2FVPA 3QIOA 2FVQA 4CJFA 2E4LA 4CEOA 1HQEA 3ICLA 4IG0B 1S1WB 1N5YA 4FJ7A 1UWBB 4ECQA 4CJVA 4TYAA 1B9FA 1FK9B 3VQSA 4KFBB 4TY8B 4NYZA 1ASUA 1IKVB 3H5UA 4KO0A 4IDKB 3SJJA 3RB0A 1JX4A 2XY8A 4KV8A 1N5YB 3N6MA 4O4GB 1NOYA 3KOAA 4M3RA 2KTQA 1JL2A 4FJLA 4C8MA 5KT5A 4O3SA 4ED3A 3OYBA 4IKFA 3IGNA 1Z26A 1NJYA 2FVRA 4F2SA 2BE2A 1RTJA 2OPRA 3AO4A 3ZT0A 4RW6A 5KFKA 2D7SA 1TKZA 2AWZA 4K4ZA 2ILYA 2IAJB 1VSFA 1N6QA 1UA1A 5J2PB 4WE1A 4QWAA 3JYTB 3BREA 3IAYA 1LW2B 3I5CA 1NKEA 2VG6A 3RB4A 1JXBA 2G8FA 3G6VA 3CFPA 1D0EA 4CJUA 1SKRA 3DLGB 3CDWA 4DU1A 2DTUA 5D3GA 3QEVA 2Y1JA 3V4IB 4W5RA 3HP9A 4MH8A 4OKEA 3KLIB 4ICLB 4DTUA 4HUGA 3DRSB 4DTSA 2ETJA 2I5JA 2GBZA 3DYAB 1X9WA 4EBEA 2WK4A 1K1QA 2CKWA 3AVHA 4DTPA 4FW1A 5KRSA 3NGYA 1SH3A 4FM1A 4YR3A 1TVRA 5L1LA 4PQUA 4FLUA 2C2EA 4ID5A 1DTQA 1TK0A 4N56A 3IN5A 2YKMA 1TL3B 3MR6A 5F8GA 1C6VA 4AHRA 3MECB 4XPEA 2D0AA 4CCHA 5F9LA 3C6TA 4NLOA 1G15A 1HNIA 4G3IA 4EBCA 4J2EA 4GC7A 3DOLA 3F9KA 4RUCA 3KNAA 3LANA 2PYLA 3G10A 4FJ9A 3U6FA 3HPGA 4ECYA 4BDYA 1ASWA 1HNVB 4DFPA 1TAUA 4QW8A 3KK1B 5J2QB 1IM4A 2AX0A 3ZSWA 3OJUA 2UUTA 3HT3A 4IRKA 4ZP6A 4DTXA 3OL8A 3RMBA 4KE5A 4Q44A 1I6JA 1JLQA 4U6PA 1WNSA 4UQGA 3O3FA 3MR5A 2IS3A 1YVFA 2G8KA 5KFJA 1JLBA 4J9NA 3H5XA 1EKEA 2KZMA 3KMQA 2AGOA 4OKKA 4NCGA 4F4ZA 3I8DA 3BGRA 2OPSB 1JKHA 4KB0A 4ZPAA 3AVBA 5KTQA 5L1KA 5EDWA 4FJXA 1RT7A 3MFHA 4BE2A 5KFEA 2HWIA 4YR0A 2F96A 3SQ0A 4NLUA 2VA2A 4AHSA 2R2SA 4N47A 3OYNA 4Z4HA 5DQGA 4K4SA 1S1VB 3AVAA 4NLDA 1HYSA 4M95A 2FC0A 4IFVA 3K57A 3KK3A 1HQUA 1VSLA 3QGIA 4CEZA 3HPOA 5F8NA 1HQUB 3LALA 1MMLA 5KFLA 2D3UA 4MIBA 5EWEA 1T03A 3PW2A 3ISND 2RF2A 2AGQA 3K5MA 4ED7A 3IG1B 3KKSA 5I3UA 1B92A 3VQ9A 3FSIA 1HYVA 4KHUA
chains in the Genus database with same CATH superfamily
2H4YB 5KT2A 2KM8B 2CPXA 2E44A 1IQZA 4ECRA 3MEEA 3CXCM 1JLFB 2DR8A 5EY4A 1YJ9N 1IO2A 1XC3A 3QEPA 4CJSA 4PABA 1MROA 2HQFA 5JLHA 2E29A 2V8DA 5L9XA 4QWCA 1IR2A 1H98A 1XTZA 3OHAA 3S3MA 1MN9A 1U1MA 4K4UA 4TSXA 3M8PA 5I3QA 3JSBA 2GW8A 2CQ3A 1UA0A 1YSJA 3PEHA 2QN6B 3NNHA 3LP2A 2M3DA 4PCQA 2UXDJ 1UPMB 1Y4ZB 4CJEA 3MM9B 1QVFM 3FK4A 4U8VA 2B9EA 4DSIA 4JS5A 2VPYB 1JLAA 1VGYA 3ZZRA 4JK8A 1PKUA 1HI0P 2XGQA 2D0PA 3QSIA 3RBZA 1FXLA 4F67A 1WAFA 2A6OA 2A1BA 3DU6A 5J2NB 4USJC 4HTLA 3LA0A 3L09A 3AARA 3O5BA 4CFCA 4F25A 4CK3A 4U96A 1ILYA 2Q97A 2B6AA 3D7SB 2RVJA 4E1NA 1DT9A 4CLPA 1AXQA 3O1BA 3RJMB 1RADB 3CCRN 3DLBA 2V69A 1J54A 3R97A 4CZFA 4K50A 2V7YA 5GINA 3TAMB 2QA4G 1MU2B 5K8PA 2BKNA 5KFHA 2UVVA 5AQWA 4K2JA 1WUAA 3UD4P 5L8RC 5C2FA 5AQNA 4RZRA 4WQ5A 5J2PA 2RKIA 3TTCA 4OJ3A 3MEGA 2R8KA 2GIFA 1BA1A 1W26A 2ZOFA 1YHQN 1NDCA 1K8AO 1UWBA 1UAWA 2V68A 5CY4A 2QEXN 4TNOA 2PI4A 1VDHA 3D2WA 5JUMA 1ZBHA 1NGDA 4Z4FA 5FDLB 4KB1A 4O0IA 2FGOA 1CS4A 2HFZA 1H2VZ 5KOXA 3IM8A 2DNLA 4KV8B 4CGGA 1RQ0A 3KJVA 2W42A 2R3VA 4CP5A 3AQPA 2KFYA 2GVZA 2I7PA 2W6LA 1NMDA 2DO0A 1OIAA 2B43A 2HQIA 1RWPB 2QL9B 4NLXA 5HMYA 4ISEA 2YWFA 4O3RA 3IGVA 1BQNA 4EI2A 3FZBA 1ZC6A 4Q0BB 1VRUB 5AQXA 2BR0A 1OH5A 2GO8A 3BZKA 4K59A 3H3NO 2B7BB 4JP8A 3F9MA 2AJ4A 1RAEB 1EKSA 3J7YU 3O1LA 1HJRA 3V6KA 3C6UA 3TVYA 3HHLB 4QZVB 2OPPA 1OS5A 2C3UA 3A8EA 2E1AA 3ILOA 4CIEA 1FTRA 1D8ZA 2DHSA 5D4OA 1CJKA 1MROB 4LF8F 2IC3A 2HHPA 2CGLA 4JOUA 3D3CJ 2RU3A 3OHBA 3VAKA 1Q95G 4BWMA 4WKRA 3AOCA 1UP1A 2JEGA 2FSNA 4ZVOB 4GY2B 2AYMA 3P31A 4OMFG 5M1PA 4AD6A 4RW9A 2VODA 2ZOGA 1TKTA 1IJEB 2XLIA 5F3TA 5BN9A 1WHVA 4QIVA 1VQ9S 2LSNA 5SUHA 2I7NA 3DMJA 4F4YA 3ZZOA 3P1GA 3OFGA 3THYB 1GMVA 2AW0A 3GFHA 3VTHA 3M3ZA 4IZ9A 5KRTA 2R7WA 1Z2LA 4Z4EA 5IWAF 1UFWA 5KFYA 4CJ3A 2X1BA 4NLQA 2E66A 2J7KA 2MKSA 4R8UB 1N36K 2W9AA 1N34K 2XC9A 3F56A 2HS3A 1HRHA 3FC9A 1YITS 4OX8A 4ZN1A 1BL3A 3CJBA 1HPZA 1OPIA 4C1NK 1BE4A 3RRHA 2FDNA 1UPPA 3WNHA 5FPEA 3M8QB 3KTQA 3GILA 2CDQA 2Z2MA 3FLCO 1EX4A 4N77A 3U1LA 1SZ2A 4P6QA 3HK2A 3J7YI 2QE5A 3SMPA 1IKWB 3KK1A 5B0CA 5DM6L 2BABA 4L3NA 3IS9B 1N5TA 3TR8A 1RNHA 2ACYA 2H3GX 2O1PA 2CNNB 3ZETB 3VF2A 2YVSA 5H9FK 2LVWA 2M0GB 4CHPA 1IWAA 2GVDB 4PKGA 1DBDA 3VGMA 4ECUA 1EXQA 3QEXA 3LPUA 1GT8A 3TAQA 2FB0A 3A0IX 4G65A 1VJQA 4ZLJA 2CPIA 3TRGA 5HK4A 3NMRA 3NHGA 4DFMA 2IM0A 5HMWA 2QWRA 1FKAF 2GQCA 1G6BA 2RQ4A 6AT1B 1WDDA 4RR5A 1RACB 1CVJA 3AVCA 3I4PA 3GPAA 3HMJG 3CCWA 3E66A 3K8WA 3O3LA 4ICLA 2GUPA 1SUQB 1W97L 4KGVB 5MLCV 3AB4B 4LRBA 5A8RA 1P9QC 2Z0GA 4MLEA 3QSYB 1RTIB 3FZ2A 3T5HA 4PYAA 5C24B 4MLHA 2J4RA 5C7PA 2HNZB 4OYIA 3BQ1A 1RT5A 3V1RA 4HH1A 4WXWA 1Q86T 4B8CA 2FJVA 4ZITA 1HBNB 3SUQA 5DG7A 5BRFA 1S1UB 4J9UE 2IIHA 3WUHA 4ISFA 5HANA 3GIJA 5AQPA 2DIVA 3Q8VA 1MWKA 4HTUA 3LP1B 3CPEA 3UVJB 1YG0A 4Q8FA 4Z37A 2J7WA 4DR6J 4PYDA 5F41A 2F40A 2N4CA 2QI2A 2MSSA 3RBXA 4BRKA 4CBXA 2ZM6F 3P5JA 3CULA 3QAEA 5HOOA 4OYZA 5K20B 3WQUA 3NGDA 4ATNA 4LF5J 4KHMA 1FO1A 3FBBA 5GAHI 2GHVC 3S8SA 3CYMA 3KNGA 2B9YA 3TJAA 5KFRA 3QPIA 4YN3B 5T41A 4ER8A 4BROA 4DR7J 3MDQA 2F5GA 4YQWA 3MEDA 3NOCA 3V2UC 5HRRA 2BKPA 4FZVA 4K0KF 1IXKA 2YX1A 2IVYA 3QLHB 4FN5A 3I0RA 4BY9C 3G6ES 2PYJA 4MKYA 3AH6A 3BH6B 1KVKA 2WW8A 5F0XA 2E2NA 4RNMA 1FDAA 1YQHA 4JI6F 1V9OA 3AY0A 1KKHA 2GEMA 2ZNYA 4O3NA 2R9LA 2DPJA 1WG5A 5DMRA 1FERA 4GKJJ 3ISNC 5A0YB 4ZPDA 3IUCA 4DBQA 3CD6N 2IVFB 2NCKL 1FXRA 2MQMA 4CD3A 1RWKB 2CFXA 4HWIA 1HW8A 4WIIA 3D0HE 4DV2F 2LA4A 4USHA 2AEJA 1N33F 3CGIA 3UR0A 1C0TA 1REGX 2HFNA 3SQ2A 3IXQA 3KHLA 1KRPA 1O13A 4ILGB 4LQ3A 1XC9A 2PA8D 3E51A 4XPCA 3VPZA 1RT1B 2OMLA 2UXDK 4DL5A 1F9HA 4CNYA 1ZBLA 3I56N 4M5DB 1NK8A 4JKHA 3X1LB 3IA0A 2E5HA 2C22A 3O4WA 3U3GA 3IRWP 2ZJQQ 4ECWA 3DRRB 1LWCB 4IO8A 2J8SA 2E7WA 2FF6A 2IM2A 4FJIA 1OKJA 1IKXB 4TVAB 4B1YB 1KSPA 1YDLA 2K3IA 1WC6A 1RT3A 1RCXB 4CIFA 1HR0K 1OY9A 2LXFA 9ATCB 2ZH9A 1GOBA 3I55N 4GVBB 1XHZA 2F8MA 3R5GA 1P9YA 4H5WA 4JV2A 1S1UA 2QJ3A 5E3AA 3MMVA 1LWFA 2XM3A 5E26A 3JS9A 3AGKA 3FR0A 5IM0B 1HWJA 3CO9A 4LSLA 1XBWA 3ZT3A 2CPHA 3NAHA 2CWKA 3C3LA 1IBCB 3QWPA 2KH9A 4DUYJ 1QTMA 4H0XB 1LW0A 3FVYA 2C3PA 4EFAC 2CJ9A 4JI1F 2JLFA 2YBVA 2QYGA 1VLYA 2Z56B 1NEEA 1Q8KA 2FHJA 1REVB 5HSPA 1NK0A 3ULDA 2MY8A 4DFKA 3FGUA 1X4AA 3C95A 2UUBK 3PEJA 2CQDA 2E5IA 2W25A 2XMKA 1WN7A 3W60A 3R1XA 3V9XA 1VBKA 2HW3A 2ZE2B 3PYEA 4XAKA 2O8BA 1ZBTA 2PMWA 2ZBQA 4C2MA 4MYUA 3BGRB 4LF1A 1JLGB 3UNGC 1JNZB 5DM7Q 3QEWA 1FJGK 1G1XA 5A8KB 3TA0A 2DXFA 3FZLA 3W66A 4N8OA 1TFYA 4JI0K 4N41A 4YHHJ 2YQ0A 1T8EA 1X3NA 2O5DA 2VQFK 3FCHA 2BQ3A 4L74A 2MMYA 2X6NA 1ZAVA 3E8OA 3G8QA 2FSKA 2HNDB 1S1XB 2Y8WA 1SKWA 4N7TA 3CMEN 3MMCA 1VI7A 2AEFA 4KH0B 4RWXA 2QWQA 4F4WA 4O8UA 5F2RA 1E4GT 1KAXA 3D66A 3M2UA 1TL3A 2R7RA 1L3TA 4LBPA 3WT0A 2HHQA 3HULA 3TOQA 5B0BA 1GK8A 3EVWA 4CHOA 5EVZA 2IDOA 5EX0A 4OI3A 1RT4A 2A18A 2XO7A 3ZC4A 1N5SA 1KDNA 1B0VA 4RPFA 1RWOB 3MXMA 4CEEA 1VMBA 1VQ6N 4XH1A 1FE4A 4IO9Q 3UI3A 2DK2A 5KFVA 3BQ2A 1KOOA 1B99A 1FESA 4C3LA 3JAMU 3SPYA 1R0BG 2D1CA 1CULA 3OBIA 4DQIA 1K0TA 3MPWA 3B6PA 5J1NA 1S0NA 3MMBB 5ADXA 3MPVA 2UVRA 2NXNA 2RU9A 1K9MO 1C2PA 5C24A 1WKJA 4CK2A 4YMEA 3SYZA 3UKUB 3D6RA 3W61A 3W3DA 4PWDA 2F7VA 4EK2A 2BW2A 1VC0A 4PL8A 4EUVA 2OI2A 1S9FA 3QERA 4LF7F 4P71A 4AXJA 5M2RA 4ZLLA 4WQ4A 5A2QU 5D3GB 3OVNA 1ZYQA 2ASYA 3WHIA 3SMSA 3PJWA 3HHLA 5BPLA 3O8MA 4E89A 4HT7A 4YB5A 1WLJA 2K3KA 3I0SA 3CIZA 2A1RA 4J2DA 1GLJO 4G6VB 1VQ8N 2ITGA 2Z8QA 3OFHA 2AF6A 2JX2A 2VBYA 4WFAQ 4K8RA 4RNOA 2GNKA 1C4AA 2KJWA 1FT8A 3MMAA 3NF7A 5KG6A 1DY3A 5AQSA 4FXDA 2C3OA 1FXDA 2Q43A 4TKTA 2PI5A 2KDOA 3KJVB 1UETA 4GV6A 1B9DA 4FJ5A 5I42B 4P52A 2UUBF 4CE9A 1HQEB 2V8GA 4HYKA 4P75A 3WNFA 4LJMA 2IVPA 4OGCA 2P9NA 3Q0AA 5HAOA 2OSQA 3J7ZO 2OA8A 3H3OB 2R4FA 3CWJA 3BZQA 3G4SS 2GMJA 3GIIA 3C2PA 1J2VA 4DSJA 1RK8A 5AE3A 3B4DA 4KKOB 1A5VA 2D41A 1NMNA 1S6UA 4EWTA 3UKRB 3EEQA 3RBDA 3CQYA 4CGFA 4NRUA 3SSSA 4YHHK 3N28A 5HQLA 3IBFB 1RHMB 4R8UA 2ZZMA 3TAPA 2MKCA 1AZSB 3D2FB 4FWLA 3P5BP 1UTAA 4LR9A 4A2AA 1F6TA 1WF2A 5GIPA 3B6BA 1P90A 5LSRA 2P9UB 1LK7A 5A8WA 4JKCA 4KBOA 3FDSA 5I9EB 4W5QA 5L1IA 4Q43A 1O6XA 2K7JA 3C0BA 3TAMA 1CJTA 3PIOL 1F2GA 1R8HA 3AA8A 4FCYA 4CECA 2AJFE 3FE1A 3GYXB 4CZIA 3BDEA 4FYVB 2HBRB 2OTLN 3N4WA 3TTDA 5AQHA 1S0OA 1JJ2M 3AO5A 3BYRA 3PHEA 4DR7K 2J0WA 1U0SA 1TL1A 2IA6A 4M5GA 2YWHA 3A2FA 1RLCL 1SAZA 5BR8F 3A8IA 1NK6A 5FLXO 1TL4A 2BA9A 2O8CA 2V4JB 1NU0A 1WSFA 3FGVA 4NLBA 4FJ8A 4Q2MA 1MNEA 2KO1A 1HMVB 1LV5A 4E7KA 2ZUAA 2NRWA 3H40A 2KT2A 3OL9A 1NNDA 2B4OA 3M8YA 1V3RA 4FYXB 4QIFA 4YDXA 1IWGA 1CLFA 3CIPA 1IJJA 3FZMA 2DGWA 1XNQF 3DXBA 1U49A 4R5PB 3MXJA 1WG4A 5DO2A 3MZIA 4YHHF 4CHQA 3D4JA 4AH9A 3GG1A 1I51B 2YWWA 4ZTFA 1BQNB 3M9NB 4RBVA 3NF9A 1TKDA 2AYBA 3KMSA 2IM3A 4DU4A 2RS2A 2QK9A 4BR2A 3IKMA 4TQRA 4KHPK 2P8IA 1BIUA 3HYFA 4C4WA 4ZVFA 1VQ5N 1MWZA 2C3MA 4RKUC 1TK5A 2VHGA 2P9SA 2RB7A 4LF7J 3TSPA 1X5SA 2XG8A 1TL1B 2RAQA 3SI8A 1HNZJ 5KQDA 1FRXA 2BJ9A 3D9BA 5THWA 3NGRA 4JNEA 4OLOA 2OTJS 2CQ0A 4JRPA 2D74B 2FYXA 3VV2B 1NJZA 3M8RA 4MFBB 4YOXA 4CYUB 2HLUA 2W2PP 1PSDA 1NO8A 2CAJA 1NK4A 1TV6A 3CPWR 4N5SA 3LW5C 1FFSB 4FPRA 1AZSA 1BUPA 3GMGA 4BRNA 1JIHA 3I9V9 4F26A 2GHPA 2ZVSA 1IBLJ 4GRSA 3LOUA 3MM7B 1HBOA 4DL3A 3SZ2A 3V1OA 1C4CA 1LFWA 5HRNA 3E9PA 2E1RA 2QZ8A 2VWBA 1RYRA 3S9HA 1YGYA 2ATCB 3NGSA 3SSRA 1S99A 4KKOA 3NCIA 4BRGA 2RRBA 3VQQA 1S76D 2GIQA 3CF5Q 2QA2A 5KI6A 4ZIVA 4X84A 4B3TF 3QO9A 3VHQA 4RW7A 2MHNA 4LD0A 2CXEA 2VPZB 3CJAA 1NJIO 4A8QA 4FS2A 4TU7A 3HFZB 1KN6A 2DO4A 2HBYB 5I4MA 4M5NA 4QJVA 2DFFA 3PW0A 1U6BA 1AFJA 3VENA 2VG5B 3H2LA 3UN2A 1ATRA 3GYGA 2D0BA 4DPXA 2QTWA 4M8LA 3VEYA 3QESA 4TU8A 2M4MA 5AJ3F 3L2QA 1XK8A 1X5TA 3S3OA 4GNIA 1M1KT 3MGJA 2WB4A 2YHAA 4Y2MA 1T05A 3I31A 4IQMA 3RTVA 1T3NA 3N6NA 4W92B 3V9UA 2UXCJ 3V6DB 1BG3A 1T9XA 1R0AB 4UQTA 2NRRA 5MAOA 3QIPA 1WI6A 4PG7A 4OIXA 4HHTA 4K4WA 2XBPA 2AT1B 3DHXA 2VJUA 5KOWA 1RBAA 3EZUA 4E2FB 3NF8A 3HSJA 5GAHP 3MEEB 4IKAA 3GCWP 4PUOA 5G0RB 3S1TA 1BISA 1KS2A 4FVMA 4O3QA 5F8IA 3BEGB 1HLWA 4WIQA 2FVSA 5F0WA 2GV1A 1BY9A 3MWTA 4H4OA 3T1HK 4WFXA 5BR9A 2VFSA 3W65A 2E1PA 1FJGF 4M45A 1TK8A 4AL5A 2BM0A 3UCGA 1U09A 1S7HA 3BN7A 3V9SA 4J9VA 3X3UA 3N5BA 4Q8EA 1RBRA 2ZJPL 2HZAA 2CQ1A 4CK1A 4RWTA 2UV8A 1U02A 3NY0A 1XR6A 4USVA 2EPIA 1KVCA 3PFEA 1WC0A 1CXQA 5C25B 3TEGA 3HBTA 3MCPA 4CEAA 2F4VJ 2RRNA 4BR7A 3MXHP 5KQ8A 5I3PA 4E7HA 2OELA 3OW2R 4ZPCA 1YX2A 1R8BA 3GCXP 3MUTP 4C8ZA 1IBKK 2WONB 2Z1HA 1SBRA 2ROEA 1T11A 2R7VA 3IC1A 5C2CA 3CM5A 4LBHA 2ZM6J 1FCAA 3JXOA 4IEEA 2UP1A 4RUAA 3A5NC 3HCXA 2EFGA 3AVJA 3TWZA 5SWMA 4M5MA 2XGPA 3DRXA 3THVA 2P9SB 2W4CA 2GIRA 2QKKA 2WVCA 3HHEA 1QZ5A 2IBKA 4J9KA 1YVUA 1XMQF 3RZAA 2VBZA 3UQSA 2W9CB 5D78A 5A8KA 4L8RB 3ET6B 4WYWA 1VK8A 3EYZA 1KQSR 3HVAA 4L3QA 1PBUA 1HBUA 2HB5A 2ZOMA 2G2YA 1S49A 3HHDA 3TVKA 1HHTP 1VQ5S 3CJCA 1N8RO 4ZKAA 4AL7A 5EOYA 1S72S 5KG1A 1NBWA 4DSKA 1FDNA 2P5VA 2QRRA 1XNRK 3VF0B 1QE1A 3CEDA 3F2KA 1VFJA 3HFKA 2DGUA 1LWEB 3AVFA 1CC8A 2HBKA 2UXDF 5M1QA 1Q82O 2AZ3A 2IRXA 4PL7A 4WZQA 1TQLA 2BANA 4ZCLA 3SPZA 2O8CB 4FF4A 3FFIA 4ZP8A 2H5IB 3GJTB 4DV3K 2VV5A 4EP5A 3HOSA 4MKBA 2OTJN 3NWGA 3R5AA 2Y1IA 3TJ9A 1FJCA 1TGOA 3FRZA 2B5JB 2ZJRL 1RYSA 1FFGB 4JI1J 5LMUF 2E20A 1R8AA 2YTCA 1BDGA 4OZ5A 3UPFA 4DUYF 1X9SA 4RW6B 1RDCA 3V9WA 2GQ2A 1N8RT 4F50A 1XMBA 3G8SA 4PXDA 2IY5B 5J1EB 5CD4A 2FVPA 4U7UD 2FVQA 4HH0A 4CJFA 1F3FA 1WC4A 4F9OA 1S1WB 1N5YA 3M6UA 4TYAA 3VQSA 4KFBB 1OPZA 2LEBA 4LFBF 1F60B 4PXBA 4NA1A 2PN6A 3QWUA 4OYMA 1VLOA 1SC3B 4KO0A 4H4KC 4C11A 4KH4A 3RB0A 1NZAA 2GAHC 3MCNA 3N6MA 5DJBA 2BBEA 3DLLQ 3LO3A 2FHOB 4DMZA 2L9DA 4RBUA 5JJBA 2OGUA 2RJZA 2AKWB 4C8MA 2VFUA 4O3SA 2N4DA 1NJYA 5AZIA 4F2SA 2F4VF 4LF5K 1ACMB 3KJNB 2AWZA 2H1YA 3W3SA 4ZVQB 2WVBA 3JYTB 4JKGA 1X4GA 2I9SA 3VVTA 1LW2B 2FJEB 1IBMK 4U9RA 1JXBA 2RMLA 3CFPA 2NPIA 2UUAF 3M5RA 4DR4J 4BGBA 2LQBA 1SKRA 4CJUA 2KG1A 3CDWA 1UVLA 3QEVA 1SXLA 2Y1JA 4WCEQ 1LQ9A 3KG4A 3QICA 1R89A 3HP9A 3NP5A 4Y65A 4DV0J 3PYDA 1I3OB 3PTWA 2MZ1A 2VGNA 2XMMA 2X1FA 1NWKA 2WK4A 2DNKA 3O5TB 1M5VC 4YOTA 3PIPL 3MMBA 2C2EA 2IHR1 3KFWX 4EAHD 5ETVA 1C6VA 3MECB 2V2ZA 2D0AA 4CO2A 3C6TA 1G15A 1HNIA 4GC7A 4DV5K 3LANA 2PYLA 2ZGYA 1GEHA 4FJ9A 1U2VB 2VGMA 4ECYA 4BDYA 3ZTPA 1HNVB 3THXA 1TAUA 5LOQA 2AYEA 3KG1A 2HEKA 4CI6A 2IVMA 2ZH3A 1URRA 4WFNL 3SSQA 3KDNA 3OTOF 2DH8A 2VASA 3GR1A 4D3HA 1PC4A 3OL8A 4DTXA 3RMBA 5E33A 4Q44A 1I6JA 4GMKA 4U6PA 5CYJA 2GGPB 2IS3A 1Y5IB 3AJ1A 2WSFC 2Q79A 3HSZA 1KC8O 3MOJB 1JLBA 4DR5F 4J9NA 1QM9A 2AGOA 5AQTA 2OPSB 4KB0A 4ZPAA 3AVBA 1EQYA 2A5XA 2C2NA 2JSXA 1M5PC 3QNWB 2Z2ZA 4UF4A 3SQ0A 4NLUA 4AHSA 2R2SA 1TYQA 4B9QA 5CHIA 5H1SQ 4X62J 3EMTA 3MOZA 1Q81T 5LM7E 3NG8A 1M90O 4QR2A 2GA7A 3KK3A 1HQUA 3IO1A 3QGIA 1HQUB 3LALA 2Q6CA 3VAHA 2QLXA 2UUCJ 1S72N 3ZZTA 3BP8A 3HRGA 4DR3F 4JV5K 2O8BB 1U1RA 2RF2A 2AGQA 3K5MA 2UUBJ 3IG1B 3KKSA 3NVKA 3Q7BA 3P38A 3GONA 3ELHA 3ETOA 1HYVA 4JI5F 2JZ5A 3CCJS 4DQPA 1DTTB 1VQ6S 2OPSA 3PZPA 3HO1A 2GWJA 1LWFB 5BPMA 3O4NA 3M6GA 4YY3K 4M5KA 3QINA 3MM8A 3MECA 3UW1A 2GGPA 4OJRA 1HYZA 4WU3A 4ED6A 3DOMB 5B0AA 2QWOA 4FLZA 2XCPA 2O8EA 4PG5A 2ROGA 1PYTA 3ILIA 5BYQA 5CHCB 4LMZA 2MJUA 4I6YA 4LVNP 4OLBA 1FE0A 1ASVA 4OPHA 2IJNA 1JLCA 2XSJB 4DU3A 3ZX0A 4DCOB 1CZ9A 2C2DA 3C6TB 2FLLA 3ALYA 3AVMA 3CB4A 4MT1A 4KGXB 4CLWA 1DTQB 1ZM4A 3O8WA 2MXYA 3SQ1A 4FBUA 3M6WA 2D1KA 1D09B 1NDKA 4CHZA 4CLFA 2ZD1A 1OMSA 4R25A 3VZIA 1H2UX 1S97A 3CC7S 4KHNA 1AROP 4I6AA 1O8BA 2BEFA 2R7XA 2D9PA 4F7VA 1NPKA 1D4XA 3MTKA 1X4HA 2XMJA 1NLVA 3MPYA 4ZVEA 4B3RF 2N3LA 1RDRA 1BMQB 2NUBA 5HP1A 3P39A 1IJFB 2YX4A 2IMWP 1X1PA 4OZ2A 1X5OA 4WF9Q 3U8XA 5K8OA 2CQGA 4HDGA 1SQKA 3L0QA 3H20A 3EGNA 2HSEB 3A3OB 4X4TA 2B4UA 1VBXA 4G1QB 1FDDA 2HRUA 5DETA 3CJ8A 2ZH5A 6FD1A 1RU2A 4H0YB 3C14B 4X2BA 3BSNA 1SB6A 3OBYA 4YNQA 3T9NA 3VAFA 3KUEA 1T9UA 4Y2KA 1VQPN 4C98A 4JI7K 4CLTA 4FYYB 1F5CA 2R8IA 4CZHA 1NZ8A 3TJ8A 3KYLA 1GLAG 1BWEA 2DRAA 2QIFA 2YQ1A 4UT4A 5GMEA 1QVFR 5DS7A 4DKWA 3TABA 1B4SA 4HVJA 2Q3SA 3TTFA 1IKVA 4RJVA 2HS0A 4U95A 2CZVC 3EE8A 4CZGA 4WFZA 3NH2A 2RKIB 2ZH6A 3CDBA 4WK3A 2XS7A 4J9PA 1VQ9N 2KJVA 2HNZA 3M4XA 4JI2K 4HL9A 3D6FB 4WWSA 4DR3J 1YWXA 2B5JA 4LVOP 3EZ5A 4PXCA 3ZT4A 1Q8LA 4AM7A 2UUCF 4UW2A 1RGVA 3LDNA 3RG6A 3W9HA 2AZ1A 3GZ7A 2BANB 4BRQA 2J8AA 2RHSB 2X6SA 4IBNA 4FOIA 4NI2A 1ZTTA 1YT3A 2VQEJ 1FW6A 1TAQA 2LDYA 4RG8A 1D1UA 3U4LA 4TU9A 1T6DA 1LWEA 4CFAA 3OYIA 2JOQA 5DM7L 5I3UB 2OJ3A 1N32K 3C19A 1HARA 4DG1A 2KLAA 3H90A 4ZVGA 2NS1B 1Q8BA 3VF4A 4DX8H 4OLPA 4DR2F 2Y9HA 2CA9A 1JXEA 2L9WA 1KEKA 4CIOA 2R2RA 3QBXA 4Y0WA 4CGDA 3IAM9 3NDKA 4N76A 5JMNA 3TQ1A 5EX5A 2GVDA 1FJEB 5IV4A 1VQSA 1KFSA 2EI5A 1EIYB 4WFBQ 1ATNA 4I67A 4O4RA 2XYHB 5A2QO 4GV3A 4U7BA 1X7VA 2IRUA 2V4QA 1TFWA 2HYIB 3NH0A 1C0UA 2VQFJ 2CPZA 3OBWA 3WIVA 3CCMS 1FD2A 4DTRA 5E3CA 3T1HJ 4MQ3A 4DQ8A 4OHWA 1VQKN 2LEAA 2CVIA 3ET6A 5HMXA 4X65J 2Y3YA 2BJ8A 1U1QA 3T5LA 4J2BA 1R7IA 1RLDA 2VIHA 3OPKA 4FJMA 3IS9A 4P2SA 1F21A 2GMHA 3BSAA 3CCEN 2Z58B 4ED1A 4QR0A 5U47A 2VA3A 3SIPB 2GZOA 4LF6J 1ZA2B 2QLBB 4M5LA 2PEBA 3ZNUA 4XH5A 1RT2A 4F36A 2OZSA 2IVOA 3NAEA 1AW0A 4ETZA 3R1LA 3VEZA 4FJGA 2O67A 2FLPA 2DNPA 2RUSA 4ZVPB 3WXIA 4H4OB 1X9MA 3RR7A 4P74A 1XNQK 2NXEA 4QW9A 3ZT2A 3T5KA 2HHHJ 2HMIB 3THWA 3ULEB 4F02A 1TL5A 1BQXA 5AXKA 2W2QP 5E41A 2MYFA 2IMOA 2WTUA 2PDAA 4XK8C 4MDBA 3W8GA 3D1OA 3BF3A 3VA0A 3UE5A 1JLEA 1RE1B 1FRIA 4JBCA 3BM7A 4HUFA 3T6JA 3S41A 2CRLA 1CZBA 2FIUA 2CJKA 2W40A 2DITA 3DMJB 3ZO7A 2IC3B 2PMHA 1PC5A 2LKZA 1YJWN 5HVHA 1MMDA 4U67Q 3JQKA 2J76E 3PYFA 4YP3A 3ID8A 3CJ7A 3QIPB 1NOZA 1Y3KA 4CTAB 1WEZA 3L3VA 2YNGA 1EQ0A 4OYXA 1NRKA 1SI9A 5B0DA 3FBEA 2IFXA 3NNCA 2DEIA 4DL0C 2OD6A 1XWLA 5CZ1A 3RR8A 5J2MA 2AJ2A 2E8AA 1HQ2A 2HZVA 4B3TJ 4ZK7M 3D1HA 4J7CA 3CMES 2KRBA 2BUPA 3AOAA 1IH7A 1KHVA 1BIZA 4H5VA 5CA5A 2EVZA 3CJ5A 4GO5X 1BUXA 4OPAA 1HKAA 4Y1CA 3QT6A 2VG5A 2MEWA 3OT9A 4Q7AA 3J8AA 4MTPA 3A5OC 3C15A 2PE8A 2F9JA 4O4GA 4C0OC 3CSKA 4BRCA 3BJYA 3N9UC 1DLOA 1T94A 1T05B 1VBZA 4B1XB 2MKIA 1SIWB 1IR1A 4Q2LA 2I5JB 3H42A 2GFFA 3AD8C 1HNXF 4QPTA 1NH7A 3ZEUB 4PA1A 2J6TA 2GVZB 1N0VC 3CXCR 5HBMA 4KFBA 1UVMA 2ASPA 1DEJA 2CQBA 4IG3A 4ZJOA 4DX5A 3H1VX 3QFPA 2HFOA 4RNNA 1VSMA 3QT7A 4YY3J 2IOCA 3A8YA 1IN0A 4FW2A 3FBFA 4ECZA 4ZPTR 4MKAA 4KTZA 4UOGA 3VQ8A 4ZTJA 3OLBA 5LXRA 5K14A 4MFBA 4QR1A 1C1CA 1JNRB 3H8YA 3TYTA 4GC6A 1VAZA 3KLGB 5HL7L 1RTJB 1UW9A 2V4RA 2BRKA 1U04A 1NH8A 2XZTB 2XY7A 4OL8A 1M5OC 1CSJA 4P72A 1X4FA 4JI4K 2LXUA 2KXFA 5L46A 2FZKB 1NDLA 4CH1A 4CHNA 1K9MT 5F1XA 1MWMA 2XO6A 4A57A 4BRMA 2HHHK 5B08A 2GHWA 3NE6A 4A48A 2OH2A 4IG3B 3PV8A 4JHDA 1YUWA 1SL0A 1OO0B 1YRXA 4RW4A 2AP6A 1NGHA 3PX6A 2XNRA 5D4LA 5AT1B 3KHRA 4CRJA 4BRFA 4TY8A 3BGOP 3KHHA 2XWXA 4J9OA 2UUWA 2GO9A 4RU9A 1DLOB 1I5OB 3PUFA 4WPAA 2XLJA 1S5ZA 2RQCA 3LM2A 4CF9A 3C15B 2D4WA 3LDQA 4KIAA 4GO7X 5DDRC 1VC6A 2Q36A 2RT3A 1XR5A 1M1HA 2XMVA 2QLJB 4ED5A 3D5MA 4B1UB 2G8WA 2W1BA 1NB2A 4OV1A 1RCOB 5EWGA 1JLAB 2EW9A 1Q0NA 1KLMB 3OR1B 3KG0A 1UL3A 3W64A 3CVKA 4CJLA 1F0XA 2AP1A 5B0FA 3AV9A 3FQKA 1DFDA 4CJTA 3QETA 3KLFB 3EM1A 1TU0B 2UU9F 5HMZA 1DGKN 2OUGA 3HT0A 3NBPA 1BWVA 3AFGA 3RSEB 3OA9A 3DI6A 3OQ2A 2E6LA 2W9BA 5KFWA 4DUZK 4BC7A 1M5SA 1RP5A 1NGBA 2FY8A 1XEZA 4ZMMA 2Q2RA 4RUBA 4C0HA 1VR6A 4BQZA 1O0PA 4ZPWR 3VQPA 3CCUN 1KWMA 3W5XA 1YTYA 5CQGA 3NAIA 3M9OB 1ICEB 4CF0A 3SV4A 3OYLA 1QJHA 2LMIA 5K8NA 1RT7B 2B8PA 3VAIA 1XERA 1G99A 2W8LA 3I33A 4UUXA 1P8ZA 4O5FA 3TARA 2GS8A 4A8KA 4W98A 1C1BB 3ZNJ1 4CJ5A 2CDRB 3BDPA 3ZT1A 3K9KA 4TQSA 2E88A 4DTOA 1VQ7N 1NM1A 2JH3A 5M2UA 1UZDA 5LJ3Y 3BEXA 1QSSA 2NZTA 2Q0UA 4FWQA 4K41A 3GTYX 3POTB 2K8GA 3R5CA 3GFXA 4NLSA 4FS1A 4ZHRB 4C8LA 1U6FA 1SL1A 4P7VA 4NCGB 3ZSXA 1H3DA 3PW7A 1TMJA 2G8HA 3UO0A 1S4FA 2LQ9A 1R8PA 3TAFA 4CGIA 4CT9A 5DQHA 4X4NA 2MY7A 2YKMB 2YKQA 4PG6A 3NS6A 2FD2A 3NMAA 4B02A 3V6DA 1WHWA 3R6MA 2ZQBA 2ZZNA 5AQLA 4NA2A 2ATLA 4B3SF 2FC9A 4O44B 2GC8A 3US5A 5GAHU 2Z4PA 3TAGA 1WC3A 4LF2A 2HHXA 5C5JA 3AXKA 5I42A 4C8OA 4JI4F 2QA4N 5KFMA 4LFCJ 1B7FA 1V3ZA 4YFUA 3FBCA 3KLIA 3IFRA 1UEKA 1QS4A 4C48A 4IFYB 2M2BA 3V4IA 2BRLA 1T44A 3DXSX 1RHKB 2W8KA 1VQNN 3SMZA 4RBTA 4KJIA 4XH4A 4DG1B 1WD6A 4IRDA 4NLVA 2YNGB 3NCQA 1Q9YA 4B1VA 4NYFA 4DOZA 2V63A 4RW7B 1XI1A 3QO9B 1UEVA 2CNOB 3VQAA 5KFQA 3O9UA 4K25A 5ETTA 2VPXB 1GNKA 1QHTA 4IUFA 5LL6Z 1LWXA 4FK4A 4M3YA 3OD2A 4DV6F 1V3SA 1OY6A 4A59A 4X4OA 2DNYA 3UE2A 2MLXA 1W7AA 3EUNA 4E7JA 3SBMA 1VBYA 2QL7B 3QYYA 1U1PA 1VHXA 2NRXA 1ZPWX 2XQCA 3AAQA 3KXDA 2RHKA 1SJFA 1RILA 3UN5A 4LT6A 1RDAA 2FY1A 3CD5A 4W90B 5FLXU 3GV7B 4E19A 2MLZA 1MWYA 1BO5O 3V9ZA 2NQPA 3M05A 2NRTA 2ABYA 2VKRA 3FZFA 1SH0A 2LDIA 3BBCA 2F7TA 1GAOA 1JXLA 4K5RA 4NXMF 1BCOA 4A8OA 1LOUA 3AA5X 3OY9A 2VJVA 3M30B 1EP4A 1RBUA 3DGPB 4OJHA 4YOEA 4W5OA 3OYDA 1SCJB 4O3PA 1L3SA 2JHEA 1XNQJ 3KLHA 4OKJA 1J5OB 1KP6A 2PAVA 3IR5B 1X4CA 2KXNB 5B7WA 4FWNA 5K5MA 3MR3A 4LFBK 1LXNA 3O9QA 1VQPS 5D77A 3H2VE 4DWIA 3T1YF 4UY85 2YI1A 2OCEA 1VS3A 1SL2A 3ID6A 2F4VK 3N6LA 2Y0SD 4CFDA 1QTNB 1UJ6A 4UY8O 1S6QB 4QCLA 4J8FA 3O4QA 3V81A 2N3OA 5HRPA 2MGZA 1ITGA 1ZOTA 1YZ7A 4J9SA 1Y00A 4JYAJ 4U7UK 3H08A 2P9PB 3KJQB 3Q8RB 4USKA 4BLGA 4A8FA 2J0QD 4PG8A 4Z4CA 2DR5A 4H4MB 3Q24A 3RGIA 3I32A 2IYIA 1I94K 3KLEB 4LSLB 2YNIB 1BD6A 5KFOA 2O4IA 4ZLNA 2QMXA 4FBTA 2BJEA 4JB8B 3P8BB 4O0NA 3AXMA 3FCWA 2FZGB 2E9TA 2F8TA 1FWPA 2UZAA 4MK9A 2DHAA 4KHPF 5D6GA 5DRKA 3CJ1A 2KFNA 4JEPA 1REVA 3THTA 5EWFA 1KAYA 4FJNA 3CCQS 5LMNF 3VQBA 4LBIA 3VALA 2XSJA 1JLCB 1RAHB 4A8XA 4TLRA 3K5NA 1Q53A 1S9EB 1HI1A 4TXSA 3D2FA 2AX1A 5B09A 2OTLS 3DLHA 5DZ6A 3GIRA 3VZHA 1IKXA 3D7EO 4V1Ak 2MKJA 2VG7B 3R7SB 3TANA 3NS7B 2R2TA 3B78A 3EVMA 3LL3A 3BGLA 2G9OA 3G9CA 2OEMA 2YNFA 4F8RA 4ALZA 3UWTA 4O8KA 2ZC3A 4F4AA 2BVZA 4EHUA 3HVWA 1DTTA 1QQCA 3D6TB 3UD3P 3BKFA 1OYDA 3CC4S 3ITHA 4M3WA 1YTAA 4L3KA 5HROB 3ZSYA 4Y1DA 3TUPA 4AHVA 3SV3A 1UOCA 3VETA 3TVZA 2ZHBA 2IBOA 2DD8S 4Y2CA 3DDKA 2AGPA 1FTCA 4LF6F 3RWUA 1UFKA 4B9TA 1FRJA 4J5OA 3TZWA 5BN8A 2F8EX 3H6EA 4B3MK 2IM1A 4NMXA 3QJLA 5CYQB 1RHRB 2V50A 2WHOA 5CCLA 3S6EA 2CH6A 2YWGA 3L9ZA 5KFCA 2HNYA 3B4MA 4I2QA 3GIMA 1YLXA 4U7CA 4LFAF 3BYPA 1XN9A 3QGGA 1A9NB 1PO6A 1VSEA 3ZZPA 1N5QA 4K4XA 3OTOJ 1UKUA 4OX6A 1JLBB 1WSGA 2XI2A 1TL7A 2LEPA 3ENAA 4K4TA 3DLEB 2B9XA 3T5JA 2YXLA 2XYGB 2MQQA 2QWMA 2CJQA 2VFTA 5EN1A 2M52A 3R9LA 1X4EA 3DU5A 3O3HA 4BRHA 2M8HA 2HIQA 2ZD1B 2DGTA 5HLFB 3VGVA 2ILZA 3K0SA 2B3TB 4RU2A 1KCFA 2HK2A 5B8HA 3R6LB 2LCWA 2VC0A 4O55A 1Q8IA 2KFZA 3NFAA 1IKYA 3W9IA 1XQIA 1YF5L 4KH1B 1NMEB 3GDQA 1K0VA 5KFBA 4JI2F 2NREA 1A5XA 4ZS6A 2FPHX 4JLHA 3TEHB 3R5DA 1HKGA 2H5EA 2VQEF 2Q0RA 3OS2A 1H74A 1S6OA 1NJIT 5KT6A 1LAVA 4BR4A 2O8EB 2KN4A 1IM6A 1WEYA 4OV6A 4PY5A 3CM6A 1WSEA 3WEEB 1YBUA 3M2UB 1H73A 3MM8B 3DNCA 4A46A 4LF6K 1TL7B 3I55S 4KSEB 4ED8A 2DGSA 4KAZA 1NJWA 2XYPB 5KPTA 5C10A 3TSUA 1FWKA 2PA3A 4CLYA 1SJ1A 4DJBA 4I2QB 2R8GA 2O66A 5AXLA 1AUDA 3HFVA 3CPWM 2RF2B 4WQ4C 1X9JA 2RHQB 3OXFA 3JYTA 4LF4F 3OYHA 4AE5A 2HFVA 1HX1A 3V6JA 3H7HB 4PKIA 2QWLA 3N0VA 4FWOA 4FPAA 1Q7YO 2CPYA 2XB2D 1YHQS 3AY9A 4Z4IA 5D0GA 3ZYYX 1J9AA 2VU5A 4DQQA 4DX7A 2O4GA 2KKZA 3E9OA 4BRIA 1Q4RA 3ZZYA 2HNYB 3R8EA 1CC7A 5F3ZA 1C0MA 3T9ZA 1WBBA 4CJ4A 3PDNA 3LWMA 4CGHA 1HWLA 2N7YA 4P2XA 1U1KA 1X3MA 1M5HA 5KG0A 2DGOA 2Q1LA 1S0VA 2WVEA 2ZJQL 2C2MB 2HHVA 4LR7A 5E7OB 1SKSA 1R59O 4W4MA 3AJDA 1LW0B 2CJBA 3TZZA 1QQOA 1BXNA 3HOTA 4B3RJ 4PQAA 4JI5K 3ATUA 1D8YA 2G8VA 3PM9A 1SC1B 3EXYA 3QIDA 4H03B 3GIKA 2KYZA 4DZ6A 2EFQA 3ATVA 1RAOA 3MTJA 4NLPA 3SJHA 3FEYB 3P4UB 3T41A 1RBTA 3FSXA 1NJXA 4KREA 5ADZA 4WFAL 1H1VA 2C28A 1HPZB 3CJ2A 2G0IA 4OYWA 2K7KA 3QBWA 3MF5A 4C6AA 3EL2A 4E0DA 4RW8A 4IRCA 1RT3B 4RCHA 1WOOA 2F9TA 3K89A 3L2WA 4DLEA 2V9KA 4RW9B 1RHJB 3CDEA 3ZCMA 3DJCA 1HBMB 4M5HA 3A8KA 3S7RA 5KG7A 4R79A 2M9KA 2XY6A 8ATCB 3SUOA 4ILRA 1RT1A 2QA1A 3MDFA 3I5BA 4MK8A 3VEXA 4JI3F 4OHYA 3G6YA 2AIRB 4ANEA 3NGTA 2VH7A 3DI6B 2RN2A 3LH2S 3B8AX 5DQIA 1KHWA 2WC9A 3TI0A 2MZRA 2CIMA 1M1KO 1TKTB 2MHEA 3KLEA 4KHWA 2RS8A 1A7GE 2J6SA 2OKQA 2HVHA 2BUNA 4JKGB 4DR7F 3RRKA 2YKNA 5FIIA 4KHYA 1HKBA 3VAMA 8AT1B 3Q2SC 1VSJA 3OR1A 5DG9A 1GH8A 4FJHA 2DTJA 1J5OA 3EXCX 5IT4A 3HZGA 2W9CA 5KFPA 1R6YA 3C94A 3FZHA 5T14A 4HACA 3V5RA 3BR9A 1YKWA 2CQCA 4DTMA 4OLAA 2ZJRQ 3QIOA 2JFDA 1ATSA 3TZYA 4FJ7A 1BWFO 4YB6A 4CJVA 1B9FA 2JDJA 2WAQD 3ZZ0A 4LIWA 1HHSA 4NYZA 5LL6d 1EO1A 1R6VA 4DR1K 4RLEA 3G82A 7FDRA 2ZBCA 5FPDA 1JX4A 5AZJB 2XY8A 4KV8A 3U1MA 3WDOA 1PJ6A 2EWHA 4DV5F 3MUMP 4HVZA 4JKEA 3KOAA 3M1FA 1JL2A 1WBDA 4ED3A 4BVPA 2FVRA 2MZSA 5E84A 5ETPA 1RTJA 3ZT0A 4RW6A 2P9LA 4EFHA 2ZWHA 5GAGP 1TKZA 5IZHA 3D6MB 4K4ZA 2IAJB 1VSFA 1N6QA 5J2PB 4QWAA 2U1AA 4A62A 5IFMA 3Q8UA 2PT0A 5D0RA 4ZOSA 1NKEA 2VG6A 1IV0A 3RB4A 2JJ4D 3G6VA 4M63C 2GWKA 3DDIA 4KY3A 3VEVA 4DU1A 3SLCA 3HF5A 2VL1A 1VQYA 4V19J 3LTOA 3V4IB 4UOHA 4M5JA 4DPOA 4PHTX 3TR5A 1P1LA 4MH8A 3S01A 3B8HA 4OKEA 1N36J 2F63A 2WFBA 1CJVB 5ETSA 4HUGA 3DRSB 1ELOA 2JVOA 3IDHA 2I5JA 3NMUA 1X9WA 2HWTA 1K1QA 2OD4A 1WSVA 3AVHA 3LDLA 5LSOA 5GMDA 4FW1A 1SH3A 1TUWA 3DXKA 1C0GA 1TVRA 5IC6B 4AF1A 1P1TA 3R9PA 4FLUA 2W6KA 3HD1A 1V5VA 4ZVTB 1TK0A 4N56A 4BG9A 2YKMA 3MR6A 4QIEA 5ETKA 1AT1B 3QMQA 4C9DA 1S12A 1ULRA 4BRPA 4NLOA 1RWMB 4KGZB 4EBCA 1XIQA 2E7VA 3JSYA 4RUCA 4DV7F 2QO3A 3U6FA 2KU7A 3D54A 1NGGA 1V5IB 1LNQA 4P2MA 4QW8A 1RABB 4IJNA 1LXJA 2P9KB 3JAMY 3OJUA 1T95A 4IRKA 3M8ZA 4ANDA 2JWLA 4IFEA 1MG7A 3MR5A 5JMVA 2EXUA 1YVFA 2CPFA 2G8KA 5KFJA 2D3OR 2ZF5O 1LEOA 3M32A 3PHTA 1EKEA 2KI2A 3KMQA 3I56S 4OYOA 4NCGA 3QFWA 2ACMA 3W5YA 2KHDA 1V6HA 1RU1A 3G6EN 3GR0A 2DR9A 5L1KA 5EDWA 1RT7A 3MFHA 3WXJA 5KFEA 3PRVA 3TO8A 3BGFA 2F96A 4N47A 3E2EA 4Z4HA 4DV7K 4AQYK 4K4SA 4V19S 4A8YA 2O3DA 5G4DA 2OEKA 1N52B 4ID8A 1NB7A 2DEJA 1W7WA 4CEZA 2LLZA 1GLCG 3HPOA 5F8NA 4NZ7A 5KFLA 3ZTSA 1U2FA 2FTRA 3ISND 4ZJLA 1F1BB 4ENOA 4FPIA 3WX8A 3TA1A 3ISZA 2VDIA 1R0CB 2I1RA 3R7BB 2FF3B 4DV0F 1Y5NB 1IG8A 3L2UA 4LSNB 1DQ9A 3AD7C 4CJ7A 2WVFA 4AUKA 4EO6A 1U1LA 4DV4F 2CQ2A 4KTQA 3QZ7A 5IQQA 2V8VA 1WC1A 5ETQA 5JVGQ 3SQ4A 5IS2A 1KBRA 4LH5A 1HNXK 5DM6Q 2OSRA 2EEYA 4B3MF 3AVKA 2Q1NA 3QAUA 3U9DA 3CCVN 1FEEA 4DUTA 3BGUA 1DHMA 2YNHA 2BMBA 4GKJK 1VRUA 4Q0BA 2KVQE 1T02A 4IH5A 5EGYA 3EE3A 4QIWD 4I7FA 5GAEU 1JJ2R 2X3DA 3ILJA 3HVTB 4ZVUB 3BPSP 1RGIA 1BU6O 4BREA 1FXXA 4B9LA 3D45A 4ECTA 1I94J 4NCBA 1T7PA 1HR0F 2QMWA 4ELVA 4H0PA 1WEXA 3KUHA 4FLVA 3DYAA 3OLAA 3RRGA 4LFCK 3NCPA 3TUZC 1G4CA 1TMMA 2HAIA 1CJVA 1N6QB 2GUIA 1OH8A 5DK5A 1ZAXA 2HRYA 4Q5VA 3RAMA 2P9LB 4X66J 1XHXA 3AJ2A 3GFZA 2QXFA 3CCRS 4NRTA 1FWLA 4LFAK 2KKHA 3OXLA 2HBJA 1RDBA 1WKLA 4DPUA 2R8HA 2A6AA 3T1AA 4Y28C 3H4BA 4NCAA 4NEYA 1MU2A 4CJPA 1SS6A 3QJPA 4HLBA 3L4QA 1S4EA 2E2QA 1RWVB 4M94A 3W1YC 3TX8A 1I39A 3CDUA 4FWKA 3G82B 1EETA 5GVQA 1D3WA 1MN7A 4AM6A 3LGNA 4B9NA 2VWJA 3BZCA 5M1FA 3CNQP 2EFPA 4DTNA 2PGCA 3SQOP 3MWBA 1FVSA 2P9NB 2J7UA 4OQJA 4M5IA 4WP9A 1FJGJ 2M88A 1WWHA 4LRFA 2WUSA 1RSCA 4ES1A 2ASMA 4HACB 3K5LA 5D4NA 4IDKA 1J53A 2HIYA 2R7OA 2A6MA 4JV5F 1VC5A 1HL6A 2DCUB 2UUAK 4NLTA 1FEHA 3NVMA 1RTHB 1SQEA 4CLSA 1U45A 4KAIA 2YKNB 3TNVA 4CWBA 3NL0A 4NYPA 3OV7A 3D67A 4CO0A 3UB5A 3OUYB 4HI1A 1W2BM 2XWYA 5D8HB 7AT1B 4CTAA 4Y34A 2WB1D 3M8PB 3D0IE 3P45B 1PAEX 3AO1A 5CXTA 3BO4A 2G1HA 2HZCA 3Q8QB 3QRQA 3SAFA 1BI4B 2V34A 1GMWD 4BACA 3VGKA 4WFYA 1JLFA 4EYIB 1HUXA 4AL6A 1JLEB 3TUJC 2G0CA 3J7AP 1UVIA 4JD2B 1VCTA 4CZLA 1DQ8A 2V4JA 5F0UA 8RUCA 3Q89A 4DV5J 4O5BA 3UKUA 2XI3A 4AXIA 2E6MA 5AQYA 5AQVA 2FLOA 1YJ7A 3H98A 3MD3A 5BR8K 2XHBA 3H59A 4DL7A 3UDVA 3CJQA 1R43A 3PR5B 4I2PA 1Q81O 1KVIA 3JQMA 2VUGA 4RW8B 1CULB 2ZH8A 2FZCB 3RBEA 3DLKB 2MDAA 4AHCA 4CEDA 1RT2B 4CT8A 1H0HB 3KD1E 2N7CA 2ALZA 4C0BA 1T6CA 2LA6A 2BDPA 4M7XA 2VPWB 2DH7A 1GFWB 4M7YA 1NGCA 3DOKB 2ZWPA 5JXSA 3F0NA 2O8DA 3K2PA 2CUYA 2ASDA 2CG8A 4DV6K 3OTDA 4YOWA 4DV1J 3BO3A 1IBLK 4I1TA 2HQ3A 4TLQA 1RTZA 2EFVA 2GMLA 4HR2A 5HN0A 1KQFB 4I9LA 1FJ7A 3AVIA 2XZDB 1IUJA 2C2KB 3MCAB 2P9KA 3CI5A 3JSMB 4NXMK 4M41A 3Q8YA 2YH0A 5B0EA 5FLXY 3FEZA 4Y6IA 1T0TV 4YOUA 4WZMA 4DV1K 2YQ3A 3OYFA 5H9EJ 3ZX3A 2EFNA 1AA1B 2D3O1 2XULA 4AHTA 1KD1T 2EWSA 4ELTA 3VAJA 2Z1GA 3K59A 3LUYA 1TP7A 1RA7A 2AU0A 3KK3B 4CF2A 2EHGA 3SQGA 4PWUA 3EVOA 4BC3A 3IMXA 4I0WA 4C97A 2ZE2A 4BS2A 3CTRA 1LKZA 2YJFA 5CYMA 1KVBA 4H8KA 3HHLD 1OQ3A 2PY5A 2HFUA 1HLUA 2DPNA 3HM8A 4ES2A 5C42B 4DU8A 2QT7A 2XMAA 3OYAA 2DB1A 3IWXA 1FRKA 2DPIA 3VWSA 5KFUA 1SKUB 3PG9A 2XEXA 2R7TA 2LQ8A 2P9IA 4CBWA 1Z25A 3WXLA 1K1SA 3U3YA 2PFUA 1RBOB 4QQBA 1VQMN 3AVLA 2A2DA 4ELUA 1NLKL 1YBAA 1X0FA 4GMJB 2DJWA 1TUGB 1TKZB 1RUSA 3HM9A 3CJTA 3GLJA 2BE2B 1EWQA 4BRAA 1VQLN 5KFNA 5FD1A 3WX4A 3I96A 4KR0B 3J80U 2ZHOA 5KT3A 2VOPA 4AHUA 1CQNA 4CEQA 3NWRA 2HVIA 4JAXA 3TW0A 3M6XA 3CJSA 5E3QA 3A4TA 3CD6S 4M5DA 2DH9A 4PG4A 4AQYJ 3GG0A 3BUZB 2KHOA 5KFFA 3LZIA 1YJRA 3PJXA 2KG0A 2EKNA 3MMCB 2MTLA 5JVHQ 1RZMA 4G1QA 2VZ9A 2F3JA 1GXUA 4JI8J 2C2ZB 3SDEA 5KG4A 1TKXA 2LQJA 4TN2A 2D3ZA 5HLFA 4K8ZA 2Q3PA 4HHHA 1N5VA 1NGIA 5KAKA 2PZSA 1F9FA 1K8AT 1NAQA 4ZCMA 4X4VA 2D0CA 2HGLA 4DS4A 3CCVS 2QW9A 3A12A 4CJRA 4E8UA 3KDOA 4GV9A 1GOAA 4DL6A 4FKYA 1XNRJ 4DHVA 1RAJA 2EK1A 3HD2A 2FJXA 3MM5A 4Y2IA 1JL1A 2CZ9A 4KYZA 2RQKA 3MEKA 3OVBA 2ATQA 2E1ZA 2NRVA 1KQSM 3G71S 4M42A 2NPFA 3GV8B 3VAGA 4FLTA 1WHYA 3PNIA 4CI0B 5AE2A 4DV0K 1Q5VA 3VGSA 3SDEB 3NS5A 2AA4A 4USTA 4URQU 2JC0A 4M3ZA 1VSHA 4I6MA 5CYQA 2GELA 1UVJA 1S57A 4C11B 3LPTA 2NSBA 4NYOA 2EFOA 4QS7A 2F9DA 3EE9A 1IBKF 3SFUA 2HBZB 3RVCA 3SUNA 1NXIA 3FFKB 3OTEA 2VG7A 3DC2A 3CF5L 3VERA 4I56A 4EEYA 3K8VA 4KHSA 4EP4A 2JWKA 4H5RA 5IM0A 5AJ3J 4RX6A 3OL6A 3OS1A 5LJVA 5LMNJ 4ED0A 4IDHA 4I4BA 5T7LB 3OHRA 2YX6A 4CM0A 4GVBA 2FBTA 4JS4A 2UXBK 3EY1A 2Q66A 4URGA 2A41A 2IGIA 2ERRA 4IJAA 2SXLA 1S6PB 1ZZFA 3QDKA 4WKYA 1U2CA 4BRLA 1R31A 3IG1A 4CH7A 2ZHAA 4BR5A 4FVUA 3D0PA 4DU7A 2QC3A 4NEZA 1N34J 5K8MA 3FFIB 3IRXA 3ZFVA 2X3GA 2MSTA 1Y7PA 3G71N 4USWA 4B9VA 4DS5A 1RBSA 3M6VA 2H65B 4E3SA 2D69A 4CBUA 3CE8A 2HSTA 1JWWA 3UDEA 2DXDA 4KRWA 3VQ6A 3L95X 2OMOA 2G0JA 3GP9A 4KHRA 3P3DA 5D15A 2FJWA 2J9DE 1Z2ZA 5BJRA 4HUEA 4H4MA 1MMNA 4EMDA 1A6LA 3SQGB 2VICA 4AILC 2GTDA 1JKHB 4ZP9A 3SAHA 5HJYA 1TUUA 1W2BR 3C66A 2EBEA 3CMQA 1VSKA 3UCZP 2DRDA 4C8KA 1VQ8S 1FF2A 3RAXA 5AXMA 4DX6A 1AYEA 5BPNA 4ZLPA 2G1DA 2CADA 2ZBRA 1UMJA 3O9SA 3HKZD 3MMJA 3OTBA 4IOCQ 4MJKA 1HYSB 4C3KA 3QQCD 4XEIA 3NOGA 3BF1A 3M1VA 3I8BA 3MHYA 3VQDA 2ZH4A 2DXEA 3ZETA 1NUEA 5JVHL 1H38A 1FVQA 1GOCA 4KGMA 2HS4A 3CFOA 3AHPA 1LOTB 1DZ5A 1BOTO 1GLBG 4OZ0A 5LT5A 2HVZA 2P9GA 1HNIB 1CJUB 2NR0A 3AA4A 4FLXA 3MEDB 4CO3A 3CJKA 2OO4A 1A5WA 3KLHB 3BKUA 3WEEA 2MZJA 1U26A 1W25A 3VF6A 3LPYA 3DN9A 3EDQB 5KG5A 4PZVA 5KFIA 3OVSA 3N79A 5A2QY 1E3MA 2WSEC 4FLWA 2FC8A 2IA0A 5C25A 3VA3A 2HHSA 1YIJS 2DGXA 3QBCA 1YRTA 2JL9A 3ZX2A 2PEHA 1WOQA 4A5AA 1KTQA 2G8UA 5AQQA 3MN9A 3LP1A 2NLWA 3EX7B 4LF5F 3VESA 2C1EB 4NLCA 1WTFA 3R27A 3DLKA 3L7PA 4WYLA 1FKOA 2ZJPQ 3EZWA 4BHQA 3JTPA 4KI6A 2W4PA 4M1KA 5BR8J 2J9CA 5C2DA 3VQTA 3HSDA 1QQNA 3L3UA 3SEOA 2D5RA 3GWCA 3AA3A 3QNOA 1JJ4A 1K8KB 2RE1A 4ECVA 1RHQB 1BC6A 2Z1IA 2JEFA 3OTOK 1N4LA 3PFOA 1X4DA 2NUUG 3PSIA 1FRHA 4I69A 2NRHA 3LDSA 1M90T 1APSA 5KGWA 4JD2A 5A8RB 3H5YA 5HJXA 3QFHA 4TY9A 4NLRA 4JI3K 3FRYA 2AJQA 1BA0A 3MR2A 2ZZTA 2AJ1A 4IFYA 1SJQA 3ENWA 4DV3F 1AB8A 4IO1A 1QY7A 2E1MC 2UXBJ 4JI7J 2BM1A 2OFHX 3K5PA 4B1ZA 2RPIA 3ZZUA 4NB4A 3I5AA 1HD0A 1RCHA 3GQCA 3HDSA 4IH7A 4ECSA 2HMPA 4BRDA 4O44A 3B6OA 4L76A 1RKIA 3D0GE 1NHUA 1CLQA 1GTEA 4B3SK 4CVNE 3RU0A 1NK5A 1URNA 2BH1A 2DFEA 3UN3A 1YVNA 2FLNA 3W7BA 1N32F 3QB0A 1F5BA 1HIYA 4KBIA 4CGJA 2XZWA 4B3OA 4B8AB 3W2WA 1JCGA 1HKCA 3L7UA 1ZETA 3C16A 4NLWA 2ZH2A 2VDHA 2NYHA 4K8XA 1PBAA 2HBLA 2H5JB 2UYTA 2QLFB 4CEBA 4CM2A 4CJQA 1YJ9S 2OYQA 1HNWJ 4W5TA 1S59A 3PRBA 1XQSC 4DV2J 1Q9XA 4KO0B 2Z1JA 1VQKS 1B64A 3AB2B 5M1NA 2BJ7A 2X74A 4FWRA 3CDAA 2RQMA 5CH7B 5F8MA 3CCMN 1EETB 2V8PA 1Q7LB 4QIGA 2A1SA 3CQ8A 3KK7A 5KG2A 3A3PB 2CQPA 1XNRF 4J91A 4OHVA 3H2UB 4IG0A 2ZWOA 4FM2A 3BN4A 4ZHRA 2PFFB 3DXMA 3MPUB 4CESA 3RMAA 4DR2J 3LAMA 4X4SA 5IT9U 3OYEA 1TV6B 2KW4A 4XDDA 4AQYF 1NSKL 3S3NA 1NPPA 5KT4A 2VKZG 3I9ZA 2VB6A 4OHZA 3FEXB 3THYA 4JI8K 1IR0A