1S1WA

Crystal structure of v106a mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 140
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1wA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1wA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1wA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1wA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1wA05
4URSA 4I7FA 4RW4B 4ED6A 4R8UB 4FLTA 2QE5A 1ZBIA 5KGXA 3KLIB 2GIQA 4GC7A 5KGWA 2HHXA 4CFBA 4HVJA 1RT2A 3G86A 4FJKA 3IS9A 4FZZA 1JIHA 2RKIB 1SKWA 1KLMA 3NF8A 3L2VA 4NYNA 3HPGA 4NLTA 3OS1A 1TKZA 3KJVA 2YV0X 2ETJA 2R2SA 4Y2AA 3EPGA 4KREA 4KAZA 4QW8A 1IKVA 2R8HA 1QHTA 1KLNA 2OZMA 2WOMB 2BE2A 3Q8QB 3MEGA 3BQ2A 3KD1E 5HROB 3ZSRA 1RNHA 3AV9A 3SYZA 4DSKA 3HKWA 2EHGA 3CYMA 1REVB 2R8GA 5CYQB 1HYSB 3D5MA 5SWMA 2FBVA 5KFWA 4YP3A 4JV2A 4MFBA 1RILA 4CFAA 3OLBA 1L3TA 4Q43A 3TI0A 4FM2A 4RW9A 1HNIB 4O44A 4HCBA 4I2PA 4JUZA 4CF2A 3AVMA 2JEJA 2XY6A 3MXMA 4LQ3A 3DRPA 1WNSA 1N6QA 1FKOA 3H4DA 5J1EB 2IMWP 4O3RA 4ECXA 4CHNA 1S6QA 1C1CB 5KFRA 3N6NA 4FBUA 4CEFA 2QXFA 4DG1B 4Y1DA 1SH0A 4CEQA 3OS0A 4PQUA 3RMBA 3LP1B 3MECA 3V6JA 4CHOA 1S6PA 4W5NA 3I5AA 2GV9A 3QLHB 5KFQA 3ITHA 4OPJA 3LP2B 4PWDA 3MF5A 1XI1A 1ZBUA 2HVIA 3AVHA 3HM9A 4DTJA 3ZCMA 4OLAA 4DSEA 4IG3B 4AH9A 4HUEA 4MIAA 4ED3A 1WSFA 2YKNA 3BDPA 5KFSA 3OYAA 4OL8A 1WSEA 4ELTA 1NKCA 2G8FA 4FK2A 1JX4A 1EX4A 4FK0A 4QWAA 2DFHA 3QGHA 3V9ZA 1B92A 1RTHB 3GQCA 2XCPA 3C6UB 4CGFA 4AHRA 3KK1A 4BE0A 5F8IA 1BQMB 4FJ5A 2D3ZA 3DRRB 2XGQA 2YNGA 1I3AA 5L1KA 1ZBHA 4QPXA 2OPQA 3TQ1A 3SQ1A 3S3OA 1L3VA 2IM1A 4OVLA 4IG0B 2ZQBA 4F2SA 3GIMA 4CFDA 4RW4A 4R8UA 4M3ZA 4O3NA 4XIUA 1TK5A 4FJNA 4J9MA 3A2FA 4J9PA 4KHRA 3KLIA 1ZTTA 1RYRA 5J2MB 3H4BA 3SUQA 3AVJA 3HO1A 3PUFA 1RAJA 3NKYA 2RKIA 2C2EA 1RDBA 1NK6A 3DOKB 2W9BB 3V1RA 4FJ7A 2Y1IA 4NLQA 2DFEA 1LV5A 1WSJA 3CFOA 1KTQA 3T3FA 3PV8A 2R2TA 4J9QA 2FBYA 3NGDA 1QSYA 2WOMA 1OS5A 4CK1A 3PHEA 2QK9A 5HROA 3SZ2A 1D9DA 2KFZA 1QQCA 4B9UA 4DL5A 1JKHB 5CYQA 3KK2B 2FJXA 1HYSA 3ZSYA 4O0JA 2J6SA 1XHXA 3KLEB 4F3TA 4EZ6A 2RF2A 4NZ0A 3CJ4A 1S49A 3AVFA 4DL3A 4CF8A 3RBDA 4CJKA 3QZ8A 3OVNA 5DQHA 5F9NA 1NJWA 1QUVA 3T5HA 5F8LA 1C0UB 5DG9A 5FDLA 3K2PA 2KFNA 4CJ3A 3M9NB 4EO8A 4M3TA 5J1EA 2FVCA 4CJFA 3HVAA 1C1CA 1NOYA 4DG1A 1TAQA 3Q8PB 2YNFA 4FJXA 4IRDA 4M3RA 3LP1A 3NH2A 3KHRA 4IFYB 3HYFA 3QLHA 3MR6A 4QW9A 2ILZA 3BJYA 4FLZA 3V9SA 4OKKA 3LP2A 5FRMA 2FVPA 4E7JA 4M3WA 4M42A 3BGRB 3OSPA 3CQ8A 4TN2A 2R8IA 4K4UA 4EP5A 4IG3A 4CHZA 4O55A 4EBDA 1VSIA 2FJVA 1W0HA 4WZQA 4C8LA 3C94A 2DFFA 3H59A 4G1QB 4IH7A 5KFYA 2E9TA 3CDWA 4CJTA 1RBVA 1RTHA 3VN5A 4NLYA 3OYEA 4PA1A 2HVHA 3C6UA 4H4OA 4DTRA 1N48A 5KFVA 3K57A 2PY5A 1U04A 1Z4UA 1BQMA 1JLCA 1RTJB 3DRRA 2RN2A 2GC8A 3TANA 3K5OA 4CGDA 3ULDA 4IG0A 5EDWA 1WNEA 1C0TA 4E19A 3N6MA 3TWHA 4C8KA 2ZE2A 4K4VA 2F8SA 3KMQA 2C2RA 1JLFB 1NOZA 1RA7A 4K4SA 3K5MA 2VG6B 5KG6A 4CJ4A 3SNNA 4FS1A 3QGGA 3KD5E 3DOKA 5KFOA 4WZMA 4O0IA 1KFSA 4BWJA 1IKXB 4CERA 2D5RA 4CHPA 2W9BA 4EP4A 1U4BA 5FRNA 3FRZA 1HPZB 3KLFB 3M9MB 4L8RB 5L1LA 1N4LA 4Q5VA 4DS5A 3DOLA 1JXLA 4GMJB 4I9QA 3PO4A 4FK4A 4BE1A 1WAFA 5DK5A 2QV6A 1D0EA 2V4RA 2X6SA 3WNFA 5DLFA 1EXQA 1DTTA 4LY7A 1JKHA 2VG7B 3KK2A 3DLKB 3UR0A 3L3VA 4RU9A 3QNNA 5EUHA 2Z1IA 3KLEA 1XWLA 3VQ8A 5C5JA 2D0BA 1QTMA 1UAXA 1S1TB 4IRCA 4KPYA 1KFDA 3TABA 4KTQA 2HHVA 1C0UA 2W9AA 4ECVA 2XY7A 3QEWA 3DLEB 4M3XA 4LH4A 1L5UA 3RWUA 3GYNA 2CJQA 4FW1A 4CFCA 4JV0A 5L1JA 2R7YA 4E3SA 3SFGA 3NCIA 3RB4A 1JXEA 2B43A 2HAIA 4JRPA 3DMJB 1RDRA 4IFYA 1SH3A 5J2QB 3U6FA 3MFHA 3RB6A 2JEGA 3BGRA 4RW9B 2XO7A 4ECWA 3NE6A 2AQ4A 3PW7A 3BREA 4CIEA 4CEZA 2R2RA 5C42A 3SQ4A 2YHAA 3PVXA 3WNHA 3UDLA 4NLOA 4CGHA 4G1QA 2XWYA 1RDAA 3S9HA 2WHOA 2AGQA 1ASVA 3GIJA 4N56A 3ZT4A 3O3GA 3K59A 1RTJA 4U7CA 1ITGA 2HNZB 2E9ZA 3CJ0A 1U45A 2UVUA 3KK3B 4YNQA 1VRTA 3KNAA 4IRKA 4FLVA 1Q8IA 1RBSA 1F21A 4HUGA 4ZPCA 1JLFA 4F4XA 2PZSA 2ASDA 5F9LA 2HHQA 1KRPA 2IM2A 2VG6A 2UUWA 2YNHA 3KIOA 4M3UA 4QCLA 3SI8A 4B3OB 1K1SA 3MEEA 1WAJA 4AHVA 1IKXA 1SV5B 4XO0A 4EYIB 1GX5A 3BQ0A 1IG9A 1HPZA 3KLFA 2W8LA 1TAUA 3VQ6A 4K8ZA 4R5PB 2C22A 2WONB 4DL7A 1JLBB 5C25B 3M8SA 2YNGB 3I0RB 4FW2A 5KG0A 3CO9A 1JLGB 3QETA 2JGUA 4DTXA 4RZRA 2VG7A 3OHBA 3BSOA 2WK4A 3DLKA 4CEBA 3L2RA 3O4QA 1TP7A 3QEVA 3PX0A 3V4IB 2FLNA 4DU4A 3DLHA 5FROA 5KFDA 4CE9A 3RRGA 1ZBFA 4ID5A 1S1XB 5HBMA 2OPSB 4IH5A 4DTOA 1S1TA 2ATLA 3NAIA 4EYHB 4IBNA 3AO1A 1BCOA 1YVFA 4N41A 2R2UA 3FSIA 3QERA 4M41A 3JSMB 4J9OA 3G0ZA 2JEIA 2GUIA 3SQ0A 3RR7A 4ZVHA 3DLEA 4CGGA 3DLGB 4JV1A 3NHGA 4Z0UA 4ICLB 5L1IA 4F50A 3BSCA 1DTQB 1N56A 1W9HA 4E7HA 4ZVGA 5JS2A 1TV6B 2NUBA 2XRIA 3CJ2A 1L3UA 2BR0A 1T05B 2V0NA 5HLFB 3DMJA 4B08A 5J2QA 3HP6A 3ZT0A 2YKMB 2RF2B 3OYDA 5KFFA 4F4ZA 1BL3A 4NLVA 4CJ5A 2PYJA 1QE1B 3TAGA 3VQEA 3TR8A 3BR9A 1TL1B 1RT4B 3I5CA 4LH5A 5HRPA 3UQSA 1TQLA 3TAMB 1KHWA 2I1RA 5FDLB 4W5RA 4W5OA 3I5BA 2P5OA 3TAFA 2BQ3A 4OJRA 1RA6A 2IM0A 4FS2A 3VQBA 3T5KA 4CJQA 1LW0B 2BGGA 4AHSA 4DL4A 4DF8A 3WNEA 3LALA 4RUAA 2JLEA 1D9FA 2AGPA 3M8RA 2YNFB 3FDSA 1EKEA 4DMNA 4OKEA 3CJ5A 4EBCA 3AVAA 4DLEA 4YMEA 4HCCA 2HNZA 4RW8B 4O4GB 3OS2A 3NGZA 1U09A 3KLGA 3KK3A 3IG1B 4DQIA 3RTVA 5F8JA 1HYZA 2J6UA 2XI2A 4O4RA 4FBTA 4EBEA 1QS4A 2AX1A 2P51A 2IBKA 1KHVA 1HMVB 1BIZA 2V9WA 4NLDA 4B3OA 2DPJA 4DFKA 1HARA 1C1BB 1SV5A 2FVQA 4NLWA 4IR1A 4H4OB 4N47A 4FJJA 4Q8EA 3PY8A 2IC3A 4O3PA 4R5PA 1RBTA 2WONA 1JLCB 1JLBA 5C25A 4ZVEA 3H5UA 4TYBA 4NYFA 2F8EX 3I0RA 4KB1A 2CKWA 1JLGA 1WLJA 1BQNB 1C0TB 1S9EB 1RTDB 3N6LA 3QESA 4HHTA 2KW4A 1FK9B 2ZE2B 1S10A 2BRKA 2F96A 4J2DA 3V4IA 3VQSA 3ZSVA 2AWZA 4DTPA 4K4XA 2YNIB 1S1XA 2OPSA 2OPPA 2HW3A 2EC0A 3HVTB 4Y34A 2W9CA 2HB5A 3CM5A 1SUQA 3CWJA 1KSPA 4C8MA 3KTQA 3JSMA 4AHUA 4ECSA 1U49A 4Q0BB 4TQSA 2B4JA 3DOLB 4K4ZA 3RMAA 2FBTA 3ALYA 3DLGA 2EX3A 4ICLA 1DTQA 1BI4B 1XC9A 2VWKA 1NHVA 4BDPA 1DTTB 1TV6A 4ZP8A 3M9OB 1T05A 3QGIA 3TARA 5HLFA 4WFYA 1D5AA 3MR5A 4BWMA 4KHNA 3KHGA 2YKMA 3ZT3A 3B6OA 3DDKA 4CF0A 1A5XA 1RT6B 1QE1A 3F73A 2JEFA 1TL1A 4I9LA 1IH7A 1RT4A 1SL0A 3G10A 2E9RX 5KG7A 3AO2A 3OLAA 3PW5A 3TAMA 4B9MA 4KE5A 4DSFA 3KLHB 4PUOB 1RT7B 3ASMA 2D41A 3V6HA 5T14A 1LW0A 4ED8A 1VSDA 4CECA 1CLQA 3NGIA 3DRSB 5KFMA 3HPHA 4MIBA 4KHMA 2DY4A 1BIUA 1ZETA 1J54A 1Q9XA 3VA3A 4MKBA 2I5JB 4KV8B 3IRXB 3T19A 2HWHA 1VSEA 2ITGA 4MKAA 3DM2B 4RW8A 4RNMA 3P5JA 3SCXA 4O4GA 3AVCA 1SL2A 2D0CA 1C0MA 5KT5A 4CJRA 2UVVA 3AVGA 1ASWA 3IG1A 2GIRA 3LZIA 4O3SA 3HP9A 3MR3A 5JUMA 4F4YA 3CM6A 4J9SA 4KB7A 2XI3A 3BSAA 1RT3B 3GV7B 2O4IA 1HMVA 5DQIA 2IM3A 4B9VA 5C42B 5KFEA 1Z26A 3VQ9A 1S0OA 1TK8A 5KFZA 3LP0B 3LWLA 4KRFA 3V81B 4FZXC 4Z4GA 1C1BA 3HL8A 4JRQA 1X1PA 4FJ9A 3HPOA 1B9DA 5EWGA 1TK0A 1IKWA 3Q8SB 4J2AA 3AVNA 4E7IA 1NJYA 3RAQA 4FXDA 1IO2A 4B9TA 4NCGB 1S4FA 1VK0A 1BQNA 2FLPA 3NFAA 1VRTB 5CZ2A 1YTUA 5KT6A 1S9EA 1RTDA 4DQSA 4LSLB 1FK9A 1XR5A 2FVRA 1VSMA 3OJUA 4CEDA 3TAQA 2IS3A 4FJ8A 4FJGA 3AVKA 4EZ9A 3PX4A 2YNIA 3IGNA 4DS4A 2OH2A 2YNHB 4ED0A 4WYWA 2X6NA 2IGIA 2OZSA 3HVTA 4J9LA 3BSNA 3NH0A 3MEEB 1HNVB 1S97A 1J9AA 4DQPA 4J2EA 3V1OA 4KBIA 4DSLA 4Q0BA 4ID1A 2IJFA 3ICLA 1K1QA 3GV8B 1VRUA 1SL1A 4CEOA 4ZVFA 1BI4A 3H5YA 4DF4A 2D0AA 3AO4A 4IQXA 1S1UB 1DLOB 4DFMA 3MTKA 4DTNA 2VG5B 1D8YA 2IA6A 4CJEA 1NK4A 4B8AB 1ZYQA 3LP3A 2YHBA 3KKRA 5I42B 3HSTB 3H98A 1L3SA 3RBEA 1RT6A 4NLPA 4FJMA 2XY5A 4ID5B 5HBMB 2Z1GA 2F8TA 4FLUA 2WB4A 4Y2CA 1S0NA 4Q45A 3FQKA 3HT3A 3OL9A 3KLHA 4PUOA 1RT7A 4EEYA 4FM1A 3TAEA 3QZ7A 3V1QA 4ECZA 1HJRA 3RB0A 3MR2A 3DRSA 1JLAB 4CIGA 2AGOA 3PR4A 1IKYB 3CVKA 2A1RA 1HRHA 2I5JA 4KV8A 3IRXA 2KTQA 4ZHRB 3DM2A 3M8PB 1O1WA 3OYGA 3KMSA 4RW7B 3L8BA 2WTFA 2Z1JA 4B9SA 3G6XA 1YTAA 4HUFA 3CDEA 2QKKA 3RR8A 5F8GA 1KVAA 1RT3A 4CEAA 4KSEB 2G8HA 1CSJA 4DSIA 2D3UA 4KO0B 1Y97A 3LPTA 3LP0A 4NLRA 3V81A 1Z25A 1EETB 3OYIA 4CCHA 2PYLA 5CYMB 1S0MA 2G8WA 2UVWA 1T7PA 2FC0A 3P83D 3NAEA 3CDUA 1YVUA 3SQ2A 3DLBA 5DQGA 5K14A 3CIZA 1RBRA 2W42A 1NK0A 5KFIA 4NCGA 2B6AA 4GC6A 4XPEA 1R0AB 3KLGB 4NLGA 4QWEA 3AA4A 1LAWA 1TL3B 4WYLA 1CZ9A 4LSLA 2ATQA 3AA3A 4W5QA 4BDYA 4Y3CA 3F9KA 4CJWA 1BGXT 3K58A 3MEDB 2RDJA 5CY4A 1WSHA 4AILC 5CZ1A 3LDSA 3PO5A 4MK8A 3E01B 4CK3A 3HVWA 1HNVA 3VQ7A 3TVKA 1FXXA 2Y1JA 2IC3B 1TVRB 1TGOA 4KHWA 1LW2B 4DU3A 2VA3A 4IFVB 5DGAA 5KT2A 2ZD1A 3C6TB 4MQ3A 5F8MA 5KFCA 4TSXA 4TLRA 3MAQA 4FLXA 1S1UA 1LWEB 1DLOA 1TKDA 2VG5A 4NCBA 1EP4B 4DL2A 4B9LA 4NLXA 2XY8A 1JLQB 2IDOA 3AO3A 2HWIA 4RNHA 3LAMA 4F2RA 5I42A 3B6PA 4OGEA 3OYFA 1LWFB 5J2PB 2OPPB 3SJJA 3PJXA 4URQU 5KFKA 3CJ3A 2HHTA 2W9CB 2C28A 4K4YA 1X9SA 1TKXB 1NK8A 1J5OB 1SUQB 1JXBA 1MU2B 1QAIA 2LSNA 3S3NA 4WFXA 3MFIA 2G8KA 3RRHA 3VQAA 3K5LA 5KG4A 1C1AA 1JLAA 2E6LA 4E0DA 1BCMA 4CJLA 4TXSA 1IKYA 4CHQA 4DTSA 3SFUA 1MMLA 4URGA 4QAGA 4WXOA 2AX0A 4IKFA 1UOCA 3GIKA 4ZHRA 2OA8A 1RT1A 4DTUA 4O3QA 3M8PA 1I39A 1ZTWA 4RW7A 3O4NA 3ZT2A 4Z4HA 1HQEA 3ZSXA 4CJVA 1T3NA 2HHSA 1NK5A 3NDKA 1SKSA 4MK7A 1RBUA 2G8VA 4N5SA 2IAJB 2KQ2A 3UPFA 4KO0A 3L3UA 2FBXA 4DU1A 2HNDB 4NCAA 1EETA 1T8EA 3UIQA 4H8KA 4AHCA 4YQWA 4OLBA 5CYMA 5HRNA 4ZMMA 2JC1A 2GBZA 3G6YA 4OGCA 1D1UA 4IDKA 4I2QB 3OYHA 3LWMA 1U47A 3ZSOA 4M94A 4B9NA 4WE1B 3OSNA 3FFIA 1NKBA 4LSNB 3QO9A 3L2UA 5F8NA 3GIIA 3KKSA 4CEEA 3SUOA 2KZZA 4W5TA 2BQUA 4YFUA 3AVBA 1R0AA 4ECYA 3OYJA 1TL3A 2DPIA 4O5BA 2R8JA 2HHWA 4CF9A 3V9UA 1S9GB 3HJFA 4YR0A 5KT7A 3MEDA 5KG3A 1HYVA 3L2QA 4E1MA 3OJSA 1B9FA 3E51A 4RUCA 3E01A 1CZBA 5KRSA 4Q44A 2ASLA 3WNGA 5DG8A 2ZKUA 3HXMA 4TY9A 3V6DB 2R8KA 3NBPA 3RAXA 1BHLA 3KOAA 4TQRA 1TKTB 1IKWB 2UVRA 3CG7A 1TVRA 3SI6A 4JLHA 3KLVA 3K5NA 3LAKA 1LW2A 5KFPA 4IFVA 3SV4A 4F4KA 3C6TA 4C8NA 3H40A 4G3IA 3TAPA 3DYAB 3PW2A 1LWEA 5D3GA 4RG8A 1EP4A 2FJWA 3ZSWA 1JLQA 1X9MA 3IGVA 3S3MA 5KT3A 5KG1A 2RDIA 3IAYA 4KHYA 5HP1B 3L2WA 4FZYA 1YT3A 3CFPA 1LWFA 1RTIB 4CHYA 2OYQA 3QEPA 5J2PA 4NRUA 1NJXA 3OL7A 3VQQA 4E1NA 3HVRA 3PX6A 1A5VA 1JLEA 1JL2A 4DSJA 2XCAA 2ASJA 4ZP9A 1TKXA 4KI6A 1J5OA 2C2DA 5DG7A 1MU2A 2A1SA 2FLLA 3OYCA 3BQ1A 1S1VB 1RT5B 2WRMA 2FVSA 3AA2A 3OYMA 2P5GA 2HHUA 1VRUB 2W7PA 4DEZA 4R0EA 1S1WB 3QEXA 1ASUA 2O5DA 3RMCA 4E89A 3QIPB 4DQQA 4JS4A 5EU7A 1QSLA 3RMDA 2XHBA 3D45A 5KFAA 3GV5B 3ZSQA 1SKRA 2HNYB 3H2LA 4F8RA 4IOBA 4J9KA 4ELVA 1U48A 5KT4A 3DLRA 2Z1HA 3M8QB 3VQCA 4NLSA 4MK9A 4ZTJA 1REVA 1NNDA 1UA0A 5E41A 5KFHA 3I0SB 2IAJA 4B8CA 3NL0A 4CK2A 2HNDA 4K50A 3JYTB 4K4TA 4HTUA 4ZPAA 5I3UB 4ZP6A 4RNFA 1XR7A 3NAHA 4Z4FA 1HNIA 3ISNC 1GOAA 3OHAA 4I2QA 1S9FA 4TY8B 4RW6B 2G8UA 4WE1A 2QKBA 3SPYA 3AA5X 4LSNA 1LWCB 1S48A 4E7KA 1WN7A 5F8HA 4DL6A 1Q9YA 4ZPDA 4BDZA 3V9XA 4PY5A 5KFTA 3VQ4A 1QAJA 5HRSA 1T03B 1NKEA 1WSIA 3OYBA 1RCHA 4FLYA 3Q8RB 4ECQA 4FYDA 4Y1CA 1HQUB 1LAVA 1S9GA 3RB3A 3AVLA 1CXUA 3V6KA 3T1AA 1VSJA 1VSHA 3VQDA 3SUPA 1G15A 4FVMA 3CFRA 1ZBLA 2AJQA 4FJIA 4M45A 2B5JB 1FKPB 3KHLA 3V6DA 4F4WA 2J6TA 5T7BA 1TKTA 4IH6A 1BISA 1KVBA 3G6VA 3P1GA 4NYZA 5KFJA 3H08A 2HMIB 4CGIA 2BANB 3MXIA 5K14B 2W8KA 4KAIA 3DI6B 3NF7A 1CXQA 3U3GA 2B6AB 4M95A 3DYAA 4EO6A 2D7SA 4UQGA 3EPIA 4CGJA 3PJWA 4ZTFA 3ZT1A 3KHHA 1GX6A 5KG5A 1UA1A 4H4MB 4FCYA 5HP1A 4KKOB 2BQRA 1XR6A 4E7LA 5EWEA 4ZPBA 1C2PA 4TYAA 4Z4CA 2WCXA 2VA2A 1RTIA 3MXJA 2RPIA 3AO5A 1VSFA 3OL8A 4YR2A 4QWCA 2AU0A 1GOBA 3V9WA 4J9RA 3VQPA 4F3OA 1A5WA 1S1VA 1JL1A 1RT5A 1RDCA 4Z4IA 4CJUA 1UWBB 5J2MA 4CESA 4LD0A 4BACA 4ECUA 1X9WA 4M3YA 4ZP7A 3LZJA 1S1WA 3H5XA 2OPRB 2ZD1B 3QINA 3QIPA 5C24B 3HK2A 5EWFA 5J2NB 5L9XA 3QNOA 1N5YB 5KI6A 5KG2A 2V4QA 4ED1A 4N76A 4QWDA 4Z4EA 2HNYA 4ED2A 4DLGA 3QIDA 5JXSA 1XHZA 4X2BA 3SPZA 4KFBB 4KB0A 5DGBA 3FQLA 3M8QA 3QYYA 5KFLA 1S5JA 4H54A 1KVCA 2DTUA 4OKJA 4JS5A 4KHQA 2JC0A 4I7FB 3I0SA 1GOCA 3GILA 5SZTA 5KFXA 4WFZA 4NRTA 3T5JA 4KHUA 2X74A 3C95A 3JYTA 5KFGA 3LPUA 5I3UA 5DLGA 1RT2B 3IS9B 3NF6A 1NHUA 4DQRA 4KTZA 4CF1A 1KLMB 4BE2A 1QSSA 4TY8A 4RW6A 3OYKA 3AVIA 4QOZB 3O3HA 1LWCA 1TKZB 3KJVB 4IR9A 4K4WA 2X78A 3T5LA 1RT1B 1IKVB 2E4LA 2BE2B 3MEGB 1T03A 1HQEB 2UUTA 3U3YA 2KZMA 1IM4A 4Q8FA 2P1JA 5KFBA 1HQUA 1T94A 2XGPA 4MH8A 5HRRA 1KCFA 1VSLA 4HKQA 2IJNA 3OYLA 4MFBB 4ECRA 5DMRA 3OYNA 3ISND 3IN5A 3SUNA 3PZPA 4WXWA 2BRLA 4GVMA 3PW4A 2XC9A 2B5JA 1FKPA 1I6JA 4YR3A 4O44B 4I2PB 2IOCA 4IDKB 3VQ5A 3EYZA 3EZ5A 3DRPB 2HMIA 3OL6A 1RDDA 4FM0A 3FFIB 4DFJA 3H5SA 2BANA 3QO9B 3PR5B 1N6QB 1FKOB 3DI6A 4CJSA 3QIOA 5JS1A 2VWJA 4LQ9A 1S6QB 2O4GA 4CJPA 4DFPA 4J9NA 4J2BA 4DWIA 1W25A 3I8DA 4FJHA 4FJLA 4H4MA 1J53A 3EZUA 3D0PA 4PQUB 4U6PA 4KKOA 1WSGA 2ILYA 4KI4A 4FLWA 3NGYA 3MECB 3PW0A 1NJZA 4QWBA 1S6PB 4ELUA 4K8XA 3ITHB 4KHSA 1SH2A 4IKAA 4PWDB 2BDPA 1C6VA 4ED7A 4O3OA 4DTMA 3NBPB 1RYSA 4AHTA 1UWBA 2ALZA 5KTQA 2YKNB 2OPRA 4KTWA 5C24A 4RNNA 5KFNA 4C8OA 5KFUA 5J2NA 1N5YA 2G8IA 4XPCA 1NK9A 5D3GB 4RNOA 3HHKA 1K6YA 4CIFA 3O3FA 2W7OA 3KK1B 3LANA 3NMAA 3NF9A 3D28A 3EY1A 3QEIA 4KFBA 4NLUA 3VA0A 5KRTA 1VSKA 2E6MA 4GW6A 4HYKA 1NK7A 4OPKA 2Q3SA 3THVA 2OPQB 4ECTA 3OY9A 3NH1A 3ZSZA 3SV3A 1JLEB
chains in the Genus database with same CATH superfamily
5H9FK 1J2VA 4KH4A 3SCJE 2GIQA 5KGWA 2B8PA 5F0UA 4LREA 4HVJA 4OHZA 3HZGA 2RKIB 5L9NA 1KLMA 4DUZJ 4ER8A 4XH5A 3OUYA 3HPGA 2YV0X 4QW8A 1QHTA 2OZMA 1VIXA 2WOMB 2BE2A 3GIRA 3HOTA 2XMKA 3KD1E 3MM7B 3ZSRA 2O8CA 4A61A 4FF2A 4DSKA 3J7YU 1LK7A 4M5JA 3CYMA 1REVB 4BRCA 1VC5A 5CYQB 3TU5A 2VWBA 2FBVA 1HI8A 3RW6A 1R8BA 2ZOGA 4HTLA 3OLBA 4KIAA 2DR9A 1AT1B 4Q43A 2MB0B 2C2OB 2B4PA 2RB7A 1HNIB 5IV3A 4A5BA 4JUZA 3AD7C 1VQ6S 3D2FA 2W4PA 1FXLA 3G6ES 1CULA 2KI2A 4O3RA 2YKOA 1OVQA 4FNIA 3N6NA 2G0JA 1DURA 4DG1B 4CBUA 3DC2A 3R5BA 2K7KA 4NEYA 3LP1B 3VHQA 2HKEA 4CHOA 1S6PA 2ZGZA 2A18A 3JS6A 2RSQA 4ZN1A 3HF5A 2DIVA 4PWDA 3MF5A 1IN0A 2HSEB 4M5KA 2KKZA 1R31A 4F0KA 3O9TA 2FJEB 3AVHA 2C1EB 3U9DA 4CI0B 4P9SA 1UAWA 2BACA 1F2GA 4Q2MA 2F7TA 1VS3A 1HNZK 4A4JA 4BR4A 4A5AA 3VTIA 5DETA 1OSCA 1VQ5N 4MIAA 1BUXA 2LEAA 3IR5B 2A5XA 4ELTA 1IJFB 3HFVA 1YBUA 2G8FA 5AXNA 4FK2A 5HL7L 1NSKL 3W62A 1B92A 1RTHB 1NGGA 5EHHA 2XCPA 1N32F 4LF4J 5BPNA 4E2FB 3C6UB 4JI2F 1BQMB 1FRIA 4FJ5A 3P45B 3VGMA 3MN7A 5L8RC 2YNGA 2UUAK 4C4WA 2QMWA 3NXZA 4QPXA 5D77A 2X3DA 2OPQA 4RBVA 3TQ1A 5KOWA 2IM1A 2BJ8A 1ZM3A 4F2SA 3B82A 4CFDA 4R8UA 4XIUA 1OH6A 4UOCA 4LFBF 3C14B 2HIQA 5E33A 4B3TF 3KLIA 1U24A 3D9BA 3GJSB 1RYRA 2LQ8A 2CVIA 3H4BA 3POTB 3WEEB 3PUFA 4PL8A 4DU7A 1RDBA 3PIPQ 1M1KO 1GLDG 1Z6RA 3OVSA 2Y1IA 4JI7K 3ZZYA 1XERA 2R2TA 1QSYA 4M1KA 5C2FA 4CK1A 2HHHJ 2AD9A 3AODA 5HROA 2YWWA 3SZ2A 1D9DA 3DAWA 2MQOA 2E5JA 5B0GA 1VQOS 1JKHB 4ED5A 4DCJB 1HYSA 3N79A 3ZSYA 1TELA 2CPEA 4EZ6A 1RAHB 3FEXB 4C6AA 4CF8A 4FWLA 3QZ8A 3WXMB 2OI2A 1WOSA 3OVNA 5DQHA 5IM0B 5K20B 4UY8O 3QT6A 5CD4A 5FDLA 3MK6A 2WC9A 4YHHF 2NRRA 5GVQA 4CJ3A 5FLXY 3M9NB 4GKKF 4B1WB 2RUSA 3TZXA 4CJFA 3MN6A 1M5OC 5IFMA 3U4LA 2OHDA 4HR2A 3W9HA 3Q8PB 4FJXA 4M3RA 2IIHA 4GVLA 4X4UA 1U8SA 3VENA 2GHPA 3HYFA 3MR6A 3M8ZA 1RHRB 4OKKA 3LP2A 2DXDA 3UCUP 4FOEA 5FRMA 2IA0A 4GV9A 2XS2A 4M3WA 4M42A 3ZZPA 3AOAA 3C15B 3FZFA 4K4UA 2CJAA 3R5AA 4O55A 1U1PA 5G0RA 3QATA 2W2QP 1ZM9A 2MQ8A 2PC6A 4WZQA 2E1AA 3C94A 3VVUA 5KFYA 5IV4A 1RBVA 3CSKA 1G1XA 3VN5A 1OPZA 3N01A 2HVHA 1QVFM 4H4OA 4DTRA 1EIYB 1N48A 2A6OA 5KFVA 1BXNA 3GMGA 1Z4UA 1MWMA 4OV6A 1RTJB 1N5TA 2GC8A 5ETVA 4B3RK 3K5OA 2GIFA 1JCGA 4JI8J 1GLFO 3JSYA 4I6WA 4YB5A 1HWJA 2XTJP 1AUSL 4DR2J 4LF7F 3KMQA 2C2RA 2ZEJA 1UVMA 3M6XA 1RA7A 2C3UA 4RJVA 1T9UA 3GTYX 4D3HA 4QU6A 3R2DJ 1Q81T 3KD5E 2VU5A 4OI1A 3DOKA 4C11A 1HNWF 4JKCA 2W9BA 5ETNA 1U4BA 4WTYA 1HPZB 2QL5B 3OT9A 1N4LA 3W9JA 3AARA 3DOLA 1OMSA 4GMJB 2NZCA 3WDOA 2V4RA 2M0GB 1VQ5S 4WJBA 3FKBA 3FK4A 1RGIA 2OTLN 2MZ1A 1T9TA 3KK2A 3DLKB 3GJRB 2CQIA 4RU9A 5KAKA 2CQ3A 1XWLA 2PN6A 3PYEA 1FDDA 1LNQA 4DR5J 1QTMA 3JB9k 4JI4F 1UAXA 1NSQA 2I0XA 4K5RA 4KPYA 2E44A 1KFDA 3KWGA 4JI6K 4FF4A 3O9QA 4CIOA 2VL1A 3MM8A 4C23A 4P7VA 2CA9A 1GXUA 1L5UA 3RWUA 5DDRC 2Z2YB 3QWPA 4JV0A 2UU9J 2R7YA 1YJWN 3BZQA 3ILLA 4E3SA 3AAQA 1JXEA 1RBAA 2B43A 3DMJB 1SH3A 4U9RA 2UXBF 4LF1A 3QDKA 2QJ3A 3RB6A 3CCMN 1E3MA 3U1LA 2DB1A 4DV2J 3HHLB 2AJ2A 3D2FB 4CEZA 2R2RA 5C42A 4P2FA 3OTOF 1HD0A 4G1QA 4JBCA 2XWYA 2YVSA 5EGYA 3S9HA 2WHOA 3U7JA 4K2XA 1IBKJ 1HW9A 3IMXA 4LF2A 3O3GA 1Y11A 2C3YA 1ATRA 2GAHC 4GKJJ 1N33F 1QHAA 2BVZA 4H5RA 2HNZB 2LP4A 4CZMA 3CJ0A 1U2RA 3O6QA 2GV1A 1LOTB 1T3OA 3SQGA 1B7YB 1OJ4A 4FLVA 1P9QC 1Q8IA 5K8PA 1F21A 3TUPA 4CLTA 2CJYB 1JLFA 1WWHA 5CA5A 4F4XA 4CO4A 2HHQA 3OFFA 4ZIVA 4KGKA 2DTJA 2U1AA 4K59A 1VJQA 3MEEA 1XIQA 3UKUB 3DKDA 4EYIB 3GG0A 3KLFA 1T9XA 2E7VA 2CWKA 4K8ZA 2B9WA 2CGLA 4X4QA 2WONB 1FJGK 4ZPTR 2EPIA 2CJKA 2YNGB 4DR3J 4A59A 1UFLA 1E6YB 4DTXA 4RZRA 2VG7A 3ENAA 1N0UA 3OHBA 3BSOA 2WK4A 2WTUA 2MKSA 3AA9A 1BUPA 1HKGA 2OKQA 1DQ8A 3H20A 3QSIA 3PX0A 2JFKA 3V4IB 3CF5L 2MZJA 3ZEUB 2FLNA 4DU4A 1SJQA 2I9SA 5KFDA 4PEOA 1ZBFA 5HBMA 3QFUA 1S1TA 1YJ7A 3JQKA 1BCOA 1G4CA 2UXCJ 1S22A 4M41A 1NZ8A 4KH5A 3VQTA 5AQWA 1N8RT 3NVMA 1FNXH 2VONA 2DY9A 1DTQB 1P90A 8RUCA 2GWJA 4BR7A 3LF0A 4X66K 4F9OA 5HQLA 5JS2A 1XMQJ 1TV6B 3G8QA 3CJ2A 3NGRA 3X3UA 5HLFB 3VAKA 2F5GA 4B08A 2EK6A 1NO8A 2MQLA 1VGYA 3OYDA 4CJ5A 4EUVA 1QE1B 1KWMA 4B02A 4HH1A 5GADI 4NXNF 4LR8A 5HRPA 1MNEA 3UQSA 1TQLA 4YORA 3TAMB 1HFEL 2OTLS 5FDLB 3I5BA 5AQXA 2P5OA 2XS7A 5M2PA 4OJRA 4FS2A 1LW0B 1FX4A 4DL4A 4JI1K 4H0TB 4A62A 3LALA 5ETTA 2L08A 2R42A 4CZHA 3TJ9A 1DQAA 2P9IA 1YITS 2X51A 3H42A 3M8RA 1YRXA 1S5ZA 4ETXA 3I55S 3FDSA 2RRAA 1NJIO 3CJ5A 1VFJA 2WB1D 2XG8A 3AVAA 3CJCA 4HCCA 3A12A 1R8PA 5A6WA 2D1KA 5E2QA 4DQIA 4OX8A 4B1UB 5M1QA 3R97A 4O4RA 2O1PA 2ROEA 1HNXF 1QS4A 2AX1A 2R7VA 1YJWS 1NZAA 2P51A 2IBKA 5LMUF 2DR8A 4NLDA 1WOOA 4B3OA 2PMZD 4DPTA 1SV5A 2FVQA 4NLWA 4H4OB 4PXCA 3PY8A 2BOAA 2IC3A 4NEZA 4R5PA 3LPEA 3CCMS 1AXQA 3MWPA 4ZVEA 2V2KA 3I0RA 3V2UC 3IBCB 4KB1A 1JLGA 3J81Y 1PO6A 1BQNB 3HM8A 5GAEP 1S9EB 1RU2A 4NA3A 1S10A 2F96A 5AFUH 3BPSP 3ZSVA 4DTPA 2CQGA 4K4XA 2YNIB 4DV4K 3L7OA 2ZBIA 1F0XA 4NB4A 4U95A 4Y34A 4B3MK 2GVZA 3P31A 3LW5C 3CCZA 4DDFA 1KSPA 4C8MA 3KTQA 4PL7A 5HK4A 4ZVOB 1VI7A 4M5DA 3DOLB 4QYRA 2OSRA 2B56A 2DGSA 2QTDA 1MA9B 4GV3A 2CH5A 3D3CJ 1MDUB 2HQCA 3QGIA 3TARA 3H1QA 1D5AA 3M6UA 2QZ8A 4KHNA 1EKRA 3K89A 2KU7A 4KC5A 3VGTA 1VAZA 2V9KA 3B6OA 4CF0A 2HQFA 2EBGA 1RT6B 4YDDB 3HFZB 1TL1A 1SL0A 3G10A 2E9RX 5KG7A 2QLBB 4DR2K 3TVZA 3KZBA 4IOAL 1CS4B 4KE5A 4ZKAA 3MM8B 5C0YA 3TO8A 3K17A 1G99A 1T44A 2XM3A 3V6HA 3R9PA 1LCUA 1GQEA 1S76D 2NXCA 1CLQA 4W4MA 5HMXA 3UN5A 1RDWX 2Q0RA 2DY4A 3JS9A 1ZETA 4FPBA 4DR4J 4ILGB 3Q2SC 2ITGA 3F0NA 3P5JA 4O4GA 3AVCA 4WFAL 3W2VA 3B8HA 5A8WA 1SL2A 2RRBA 2FD2A 3AVGA 2AYMA 3FBBA 1ASWA 2GIRA 4E8UA 3MMCA 3MR3A 4RWTA 1N5QA 3MOJB 3BN7A 5GAHU 3Q83A 2DNMA 3UI3A 4KB7A 4MAKA 5L46A 2Z2MA 1RT3B 4F67A 1EQ0A 5IT4A 1YKWA 2IM3A 5C42B 1MN7A 1KONA 1TK8A 3VQ9A 5KFZA 1R8AA 3V81B 4Z4GA 1GMWD 1WEXA 2YPYA 4DPWA 1FD8A 1WHXA 3BF4A 1IKWA 4LFAJ 4CYUB 1JCFA 4OI0A 2F4VJ 3WQPA 4JYAJ 1IO2A 1SJ4P 4LVNP 1V4TA 4OYIA 1YTUA 1RTDA 2UU9K 1FK9A 3OJUA 1SVDA 3K8VA 5CHCB 1SQGA 3J80Y 3PFOA 3IGNA 2VHGA 2H5EA 4WYWA 1NAQA 2IGIA 3HVTA 2DPNA 2V94A 5A8KA 2NXUA 3BSNA 3MEEB 4AD6A 4J2EA 2DNHA 4WWSA 4KBIA 3UDCA 2VFTA 4Q0BA 3OD2A 3ICLA 3SLCA 2V8VA 3QGPA 3J7A1 4ZVPB 4FNHA 4X65F 3RSEB 1IBCB 3NNAA 3AO4A 4DTNA 1GMUA 3R8YA 3VZHA 2P8IA 3S01A 4QZVB 4CO5A 2YHBA 3KKRA 5I42B 1CQNA 2M8HA 4PG6A 2CJBA 4FJMA 1HBMB 3IWNC 5HBMB 1F6TA 3R1XA 4OMFG 1FNOA 4DV3J 2RU3A 3AY0A 2B9XA 4UUWA 2ZGYA 2WB4A 4A47A 4Y2CA 4Q45A 4DCHA 4PUOA 1RT7A 2NRZA 4EEYA 1KKHA 1U1LA 3M05A 1WHVA 3A8JA 2N4CA 2JDJA 3V1QA 2DCUB 4DCOB 1HJRA 1VQNN 4XDCA 1JLAB 3NGUA 2IRYA 3KJQB 2KT2A 2A1RA 3PYDA 2I5JA 4KV8A 1TUVA 3DGVA 2KTQA 1GTEA 4AQYJ 3QT7A 2FTRA 4JKHA 2Z1JA 4L76A 1R27B 5MLCV 1U2VB 4HUFA 1LFWA 2W2OP 2EKNA 4ZVUB 4G9ZA 1IBMJ 2VASA 7AT1B 1KBRA 5F8GA 1KVAA 2ROPA 4I6MA 4KSEB 2HMPA 2D3UA 1NBEB 3LPTA 3I56N 1YZ7A 1FDAA 4OLPA 3WBZA 2RE1A 1XNRJ 2VQEF 1HWUA 4X84A 3MAAA 3CMAN 4ILHA 3QSYB 4ISEA 3P83D 4IZ9A 4USKA 2WBNA 3IR6B 1RBRA 2J8SA 1MROB 1AROP 2C2KB 4LMZA 1NK0A 1NGBA 2B6AA 1YGYA 3D1OA 4GC6A 1KD1T 4XPEA 3WHIA 3X1LB 3JAMO 2B3TB 1CZ9A 3CJ1A 3MMVA 1UJ5A 3BF1A 1FA0A 3K58A 3BZKA 3VEZA 1M5SA 3H45C 4PWUA 2LDIA 3PO5A 4WQ4C 4D3GA 2UXDJ 4C0BA 2MKKA 2LA6A 1KR4A 3VQ7A 2IDLA 2FGCA 2N7CA 2JWNA 1FXXA 1U02A 5BREA 3A3OB 2IC3B 4JP8A 1TVRB 3HHLD 1TGOA 4F3QA 1LW2B 3WUHA 5DGAA 2YY3A 5BYSA 5KT2A 1AB8A 5F8MA 4F36A 4TLRA 3P49B 4WCEL 3CJSA 3THYA 1DLOA 1TKDA 1HWIA 2FPHX 2VG5A 2VQFF 1SPBP 3HDSA 2ADCA 2HWIA 3LAMA 3GYGA 1WACA 2VKRA 2MZRA 3EGNA 5K5MA 4OGEA 3L4IA 1NNEA 3OYFA 1U0HB 4P10A 3CJ3A 4K4YA 3W65A 4CZCA 1X9SA 4OZ2A 2GVZB 3BBBA 1TL5A 1JXBA 1QAIA 1RAFB 3KG0A 3WC2A 3VGSA 3MFIA 1X8DA 2C3PA 1EJ7L 1VQPN 3C66A 1C1AA 3J7AP 3I4PA 2RMLA 3R1LA 4ZLJA 3BR8A 3L7PA 4CJLA 1IKYA 4QYZJ 3SFUA 4URGA 4QAGA 4BVOA 4WXOA 1Y9OA 2DGWA 1R0BG 2KHDA 1HL6A 3GIKA 3VF6A 4OX7A 3M8PA 1B4SA 1CZAN 1SBRA 1HQEA 4BRNA 5M1KA 3ZSXA 1HR0J 1NH8A 4E98A 5BRFA 4BHQA 1NK5A 1SKSA 2NRHA 3CD6N 1Q16B 2AEFA 3VZIA 2HBJA 4K0KJ 5FLXU 2XO6A 2FBXA 4DU1A 2HNDB 3MMBA 1E6VB 1T8EA 3EWGA 4LF8J 4H8KA 1Q79A 3AGKA 5LJ5Y 3SEOA 1KC8O 4OGCA 2NRXA 2AIRB 1RCXB 1FT8A 2Q6BA 4B9NA 3OSNA 2M70A 3KKFA 4LSNB 3QO9A 4UY8T 4JI0J 2GJIA 1W97L 1K0VA 3SUOA 1Q5YA 4W5TA 1JK9B 2YPZA 3PCOB 3AH6A 1R0AA 5MLCQ 2XNRA 2L41A 3Q86A 1VQNS 4BR5A 5AQPA 4O5BA 2WAQD 2HHWA 1VC6A 4YR0A 3T7ZA 3GZ7A 4DHYA 4X62K 1RFQA 3NNHA 1R89A 1S77D 2XQCA 3E01A 2OFGX 1CZBA 2Z8QA 2HYIB 3F56A 3FZMA 4M5NA 4TY9A 3BBCA 1YHQN 5AQSA 3V6DB 3UFCX 3NBPA 4EWTA 1R3NA 3UDEA 1IKWB 2UVRA 3CG7A 2NNWA 1NG9A 4TKTA 3LAKA 3QBWA 4IFVA 3D6HB 2OFHX 3TYTA 3WXLA 4P52A 1LWEA 3I56S 2QL9B 4OO1J 3VVTA 4DR4K 1X9MA 3W66A 1WC5A 5B08A 4IO8A 5KG1A 2RDIA 4NMXA 4KHYA 5HP1B 4FPIA 2ZOMA 4JD2B 1IWGA 5C10A 1JNRB 1EWRA 4JNEA 1LWFA 4CHYA 1ZH5A 3WXIA 4NRUA 2VPYB 5DM7L 1NJXA 1ZS6A 3HVRA 3A5MC 1JLEA 2XCAA 4TU7A 4ZP9A 5A8KB 2B8QA 4KI6A 1DFDA 1DAXA 2CNKB 4MDAA 3ILIA 4OX9F 1XUPO 1RWMB 2W7PA 1X4BA 5HSPA 2HBKA 4ZJQA 3RMCA 5HMZA 3R7SB 1FD2A 2YH1A 1RB0A 4JI3K 4HTJA 1QSLA 3Q0AA 2XHBA 3WQTA 3ZSQA 1SKRA 2D9PA 3CDBA 3W60A 2R7UA 1U48A 2IY5B 6FD1A 1K0TA 3CJKB 2EWSA 4PG8A 2CH6A 3AOBA 3JTPA 4PXDA 5CH7B 4KT0C 4ZK7M 2VOOA 5HO4A 2QL7B 5KFHA 3IR7B 5HJYA 4JHDA 2RVJA 4JV5K 4B8CA 2X1GA 1WKLA 4M5LA 4HTUA 1T6CA 4ZP6A 4WYBA 4RNFA 4Z4FA 2UUAF 3HOSA 2J7WA 2ERRA 1R6YA 2G8UA 4WE1A 1UVJA 2QKBA 4PR6A 4E7KA 2VC1A 5F8HA 1EHWA 1QZ6A 2JFDA 4PY5A 5ETMA 1T03B 1NKEA 1PAUB 2DHGA 1VQPS 3J8AA 4IFEA 4ECQA 4FYDA 1XNQJ 1N54B 2VPXB 3RB3A 4CD3A 1VR6A 3LTOA 3AVLA 3AJDA 2BJ1A 1CXUA 4I6MB 5AQMA 4JI7F 2GUPA 3PJ9A 1G15A 2UUCJ 2FJAB 2GO9A 3CFRA 5E26A 1G7CB 2W41A 4M45A 2NREA 2CPXA 3FJ2A 4V19X 1YJUA 5T7BA 1BISA 1KVBA 4PPDA 5E3RA 3OBIA 4NL5A 4NYZA 4DX6A 3NEKA 3MXIA 4L6V3 4C97A 4KAIA 3CD6S 3DI6B 2CUYA 3HHLC 3NF7A 4CZEA 2B6AB 5HQMA 3EPIA 2ASPA 2P9GA 4CGJA 3PJWA 2ZWOA 3KHHA 4YUDA 2MQQA 4IOCL 3O9RA 2NLWA 4X64F 1DZ5A 3SMPA 4FCYA 2CQCA 5B0DA 3JSBA 1TL4A 2WCXA 1I94F 4RKUC 1N34J 2KVQE 1MN9A 2D0PA 2BXJA 1VSFA 1X4GA 3OL8A 1NUEA 1U1KA 4FYXB 4DV0F 4QWCA 1TL7A 3I87A 4OIXA 4LBHA 2ACYA 1FTRA 5D78A 1RT5A 1XN9A 5J2MA 2MY7A 4HI2A 4CESA 4CWBA 4H03B 2BW7A 4ECUA 2HSTA 5GADU 3H5XA 3QIPA 2G2OA 5J2NB 2IYGA 5L9XA 2W1BA 4ED1A 4HI1A 2RDDA 1XHZA 1YHQS 1Q18A 3BEXA 1EKSA 2P9NA 1TFWA 4B1XB 1KEKA 2XSJB 1S5JA 1NGIA 2W6LA 3VESA 4I7FB 4I4BA 2PEBA 4NRTA 2X74A 3C95A 5D4OA 1U7LA 1SAZA 2YWHA 4DQRA 4ZCLA 4KTZA 1GMVA 5I3PA 2XLIA 2UUBJ 1H7XA 3TUIC 1FX2A 4RW6A 4QR2A 2J0SD 1LWCA 1RAIB 4K4WA 1X5OA 1IKVB 1RKJA 4LJMA 2E4LA 2IPOB 2V8PA 2AJFE 1HQEB 2UUTA 1X4EA 3U3YA 2AJ0A 3W5YA 1IM4A 4Q8FA 3MMAB 2HQGA 5KFBA 3CDAA 3G71N 5GMKa 2XGPA 1UVLA 2XEXA 4DJBA 4RCHA 1HW8A 2ATCB 3SMSA 3ID6A 4M63C 3J7ZO 1P1LA 1Y10A 5FJ4A 3IN5A 4JKAA 1LEOA 2V8GA 4QPTA 1FKPA 5JMNA 3D7EO 1FJEB 1T0TV 1YSJA 3EZ5A 5LSOA 2HMIA 2CQBA 4FM0A 4EK2A 2RNEA 3QO9B 3CPWR 1FKOB 4AF1A 4OYOA 1P8ZA 4LRFA 1UTAA 4LQ9A 4CJPA 2OP5A 2G4BA 4J9NA 2GGPA 4QYZK 1FWPA 4DWIA 3EM1A 3IA0A 3NMUA 4FJHA 3Q23A 4IOXA 4H4MA 2BEFA 4KKOA 1WSGA 1JXVA 2ILYA 4KI4A 1NJIT 2YJEA 2HURA 5T41A 3ITHB 2QA1A 2VICA 1VLOA 1C6VA 1VLYA 4ED7A 3WIVA 1Y4ZB 1YX2A 3A13A 1WEZA 2QM1A 3NBPB 1RYSA 1EO1A 4YB6A 2ZH3A 1FEEA 4FKYA 4I64A 3QMLA 5KTQA 3TZWA 4TNOA 2MHEA 4NXMJ 2YKNB 4ANDA 2OPRA 1VHFA 4OYWA 4RNNA 4C8OA 1JNZB 3ENQA 3J81U 1NK9A 3UVJA 1K6YA 5HAOA 3HULA 2KXNB 3CQXA 1X5TA 3KK1B 3QEIA 3NF9A 3EY1A 4NLUA 2JRSA 3N9UC 2XS5A 1R0CB 3MUVP 4WU3A 4HYKA 4H4KC 2EC2A 3ZSZA 3SV3A 3CMQA 1JLEB 3HZ6A 2VD3A 4ED6A 4DUZF 1ZBIA 1K73T 2HHXA 4YS2A 4HHHA 5LMNK 5EN1A 1Z1ZA 3EKUA 3D0HE 3C7NA 3HT0A 2VODA 3L2VA 2LQ5A 3A5OC 2ETJA 3EPGA 2VIHA 3TSQA 1KLNA 3Q8QB 3MEGA 5JICA 3Q2TC 1K44A 3DFEA 4FZVA 4XH4A 4C2MA 1NGEA 2N4DA 3SYZA 3LO3A 2P9KA 2Q1NA 3W8GA 2PIIA 1TZ0A 1H73A 2NRWA 5SWMA 1FFGB 3DHWC 2K3KA 4JV2A 4MFBA 4JHDB 3TWZA 2DXFA 2QA4N 3U1NA 3R6MA 1NRKA 1L3TA 2DH9A 1OYEA 2L9WA 3H6EA 4G65A 4AE5A 4RW9A 4A8WA 4O44A 4I2PA 3W64A 3AVMA 1WDTA 3DRPA 3ELHA 2ZVSA 2CGKA 3QFWA 5AXLA 5J1EB 4R25A 1H0HB 1FXRA 4CHNA 1C1CB 4FBUA 4JEPA 4CEFA 1V3ZA 2QXFA 4QR0A 4NLCA 1SH0A 3T1YJ 1NDLA 4PQUA 4OZ3A 3IMQJ 1OH5A 3RMBA 4YOVA 2PEHA 3MECA 2HWTA 1NEEA 2QLXA 4W5NA 3QLHB 4X4VA 1F9FA 2KYXA 8AT1B 1X31C 4IWVA 3TX8A 3SCKE 4AYBD 1YJNN 3HM9A 3R7NB 4OLAA 4DSEA 4IG3B 4Z37A 1FTCA 3THXA 2XMJA 3G71S 2ROGA 3BDPA 4QR1A 1GNKA 3TUJC 4QQBA 2NZTA 2XHWA 1EX4A 4FK0A 2GO8A 2DFHA 3BN4A 3LM9A 1GLBG 1M1HA 4CRJA 4CGFA 2NR0A 2DNNA 5LMUJ 2QWPA 5JLFA 4BE0A 4ISGA 5DS7A 3J80U 3C3LA 4WK3A 1L3VA 4RW4A 4WPAA 4O3NA 1TK5A 1VMBA 2CYYA 4DHVA 4J9MA 1V3SA 4KHRA 4J9PA 3CB4A 1EAYC 3C46A 2L48A 2DO0A 5J2MB 3UWTA 3HO1A 3AVJA 4LF6J 2JZ5A 2C2EA 2HHHF 5E3CA 3I32A 4A8OA 1BLUA 4YOXA 2XMAA 3PIOL 2DY1A 1LV5A 2DFEA 1WSJA 3ZLJA 3D7SB 3T3FA 1QY7A 2RQ4A 3R1HA 2FBYA 3NGDA 1HWLA 2CPFA 3MWBA 1RE1B 4B1VA 1HWKA 4BGAA 1W2IA 4DL5A 1HIYA 3M6VA 1QVGM 2V52B 3FZKA 4GVBA 4JB8B 2J9CA 3O5TB 5M1PA 4I6YA 2DNRA 9ATCB 2E5IA 3AVFA 2MLYA 1ATNA 3KXDA 3HCXA 2CZ9A 3PTWA 2GFFA 1NJWA 1E4GT 5AQFA 2DKOB 4JN4A 5DG9A 2OSQA 3K2PA 2KFNA 1FO1A 4ZVTB 3WIUA 2M88A 3L0QA 1NOYA 5BR8J 3K7RA 1K47A 3BH7B 1TAQA 2FQQB 2MLZA 2VB6A 3ISZA 4C0HA 2YNFA 3RJMB 3V4MA 4B3MF 5H9EK 3KHRA 4IFYB 4LR7A 4QW9A 2ILZA 3BJYA 2QYCA 3TW0A 1P8GA 4WFBL 3HX9A 4TN2A 2R8IA 1YRTA 4RR5A 4CO1A 1EQMA 3HLUA 5FD1A 4EBDA 1VSIA 3U02A 2E1RA 1RDUA 2H5IB 4C3MA 3L6QA 2QA4S 2E9TA 3CDWA 3OYEA 4DV6J 4EFAC 3OFGA 4JI8F 2NLXA 2ZH4A 3DXKB 5LJ3Y 3HI9A 4DR2F 3DRRA 2FLOA 2RN2A 1ZM4A 5EX0A 1IBLK 2FY1A 3ULEB 2X1FA 1RGVA 4DV7J 2ZH9A 2XMTA 2F1FA 3ULDA 4IG0A 1WNEA 1R8HA 2Z2ZA 3T1HJ 1BMQB 4IEIA 3FFKB 3MM5B 2MEWA 2MKHA 2XLKA 2CNNB 1X3NA 3RG6A 1WELA 3SNNA 1QJHA 2WBMA 2H48B 5KFOA 4A48A 4BWJA 1IKXB 4CERA 4CHPA 3MPUB 1YK9A 4OZ5A 4EP4A 1Q7YO 5FRNA 3M9MB 4L8RB 5L1LA 2I38A 2HRYA 5K8NA 1JXLA 1YJNS 4FK4A 1WAFA 5DK5A 3MAHA 2HS0A 4DR5F 2IYIA 2F40A 2H51B 4L3KA 3UR0A 3L3VA 2Z1IA 3KLEA 1YF5L 2Q2RA 5C5JA 2D0BA 4JI5K 2ZJQL 4X65J 1D3WA 2XMVA 2YJFA 4IRCA 4P2SA 4JKDA 4CLSA 2BJ7A 1RBLA 4NPOA 2HHVA 1C0UA 5DM6L 4UOFA 1Q1KA 4JK9A 5HMWA 3MR7A 3BDEA 2UU9F 1SQEA 4OFZA 4NXMK 4CLLA 4ECVA 2OTJN 3DLEB 4M3XA 1WC3A 1SJ3P 2CQHA 4MJKA 4DR7K 3I4HX 3BGFA 2FB0A 5L1JA 1IR0A 3EVWA 4NYPA 2P9KB 3MPDA 3SFGA 1YBAA 3RB4A 3THWA 2HAIA 1RDRA 4DV2F 3QRQA 1LXNA 6AT1B 1HBUB 4NOHA 2G1HA 3AQOA 4DV5J 3CCWA 3M30B 2FY8A 4I0WA 2K7JA 3BGRA 4RW9B 4GVEA 5D6GA 3PW7A 1IBKF 3GSIA 1FRJA 5BRHA 1HI0P 5T7LB 3EE9A 1D09B 4DPOA 4B3SJ 3WNHA 4GKJF 4BLGA 4ZA1A 3UDLA 1RU1A 3C65A 2NXEA 2QEXN 1VRQC 2AGQA 4DB3A 3FRYA 3SBTA 1ASVA 2B4UA 1RTZA 2CQDA 3GIJA 4N56A 1XMOJ 3EKSA 3GOIA 3ZNUA 1KN6A 3HHDA 4U7CA 1ITGA 2HBRB 1CJKA 2VQEJ 1XEZA 1U45A 2UVUA 1JQGA 3MUMP 2DITA 4HUGA 1S99A 1WBBA 3J7YP 3CIPA 2XYPB 3FZBA 1J5EJ 2G2ZA 4BQZA 5F9LA 3AXMA 1KRPA 3THXB 2QC3A 2VG6A 3O4WA 3D3BJ 3VEVA 3TEHB 5ADZA 2BUPA 1UW4A 4NA2A 3W1YC 3VAFA 3SSQA 4DR3F 2KHOA 1LKZA 4XO0A 2GQ2A 5AQJA 3BQ0A 1IG9A 1YI2N 1TAUA 4HACB 2QIFA 2C22A 3CERA 2IDEA 1WKKA 4JKGB 1JLBB 5C25B 1IWAA 2HVZA 4FYWB 4I6AA 3M8SA 1WUAA 5EY4A 4FDFA 4FW2A 1IR2A 5KG0A 4M7XA 1HKAA 2JGUA 2H3EB 2ZFHA 3GG1A 4CEBA 3O4QA 3KHYA 2UXCF 2E2QA 1RI7A 2J76E 1P9YA 1B0PA 3PNIA 2MLXA 4CE9A 2OPSB 4DTOA 3KK7A 4EYHB 4IBNA 5AQNA 4P2MA 1GLCG 3GPAA 1Q82O 2VBYA 3JSMB 2ZJRQ 5AZJA 1XMQF 4DPUA 3RR7A 1RCOB 2FSNA 2FHMA 3DLGB 2W4DA 3NHGA 4Z0UA 4ICLB 3GSDA 3BSCA 1DRZA 4BR9A 2I7NA 3PYFA 4ZVGA 2XRIA 1Y5LB 2V0NA 3PSFA 1AZSB 5J2QA 4OYZA 4NLBA 1KQSM 3FBFA 4F4ZA 1BL3A 2PYJA 3AD9C 3TR8A 3CT9A 1NDCA 3I5CA 2AP6A 4FVUA 2KXHA 5AQHA 1KHWA 2APOA 1QVFR 1T11A 3H3NO 4PKDB 4CJQA 3T5KA 2BGGA 1YRUA 4DF8A 4IUFA 3HSDA 3BO2A 4RUAA 2JLEA 2AGPA 2YNFB 1EKEA 4CO2A 2J8AA 4RBUA 4OKEA 4EBCA 4DLEA 2ABYA 1QQNA 4C3KA 3OS2A 2V2QA 5D4NA 3MPVA 5CD4H 3NGZA 1U09A 3KK3A 1GXTA 2OTJS 1OIAA 2E8AA 1B70B 3G4SS 2VCPA 4H0PA 5H9FJ 1IR1A 2GCFA 4CLKA 3PIPL 1ZPVA 4OZNA 3Q7CA 4FBTA 4EBEA 2G1DA 1BIZA 3W0LA 5KQ8A 1IXKA 3PEHA 1Y3KA 1UPPA 3S7RA 3JAMY 1AYEA 1C1BB 4I69A 4FJJA 2DIUA 4DUYK 1WD6A 2V2ZA 4A57A 4PKHA 4CT8A 3H5UA 4TYBA 1OSDA 2EFQA 4ILLA 1Y7PA 2UV8A 3ET6B 2DO4A 4LF9K 1IUJA 1SZ2A 2QEXS 2WSCC 4HHTA 2KW4A 2BRKA 4WQ5C 3B4MA 2Y9HA 2R9LA 2V50A 1S1XA 2OPPA 1RACB 3WX8A 3ENOA 3I6PA 2PBDA 4LF5K 3N28A 3CWJA 3GCWP 2SXLA 1HBNA 2HF4A 4ILRA 2B4JA 3MUTP 3Q8VA 1RWWB 1ZBTA 4Z2XA 3GG4A 1HJOA 4A8SA 1XC9A 2VWKA 4KYZA 1NHVA 4BDPA 2ZKTA 2OEMA 1U1MA 1F3VA 1T05A 5IXUA 3MR5A 4BWMA 4WFNL 3KHGA 2YKMA 1YI2S 2MGZA 4CBXA 4CDIA 4CLUA 1IH7A 3NG8A 1RT4A 2O8FB 9RUBA 3BYPA 2JVRA 1QTNB 1RHJB 4B9MA 1HNZJ 1S72N 3O5BA 3UNGC 4DSFA 4DR4F 3KLHB 3ASMA 1KTVA 2VFVA 3FLCO 4ED8A 1CJTA 3NGIA 3PYGA 4RWXA 2MHNA 4H0XB 4MIBA 1HPMA 1S7HA 1BIUA 5C2CA 1WC4A 1J54A 1Q9XA 1ATSA 5CHIA 3VA3A 4MKBA 4PPZA 2FHJA 4MKAA 4RW8A 1T95A 3SCXA 2AJ4A 3MGJA 2M7SA 2D3O1 2UUAJ 1C0MA 3UCZP 2HK3A 3IG1A 3PIOQ 3LZIA 3CCUN 5AQUA 4O3SA 3HP9A 3HSGA 4F4YA 2E5LK 3FEZA 1NB2A 3M1FA 5ITHA 2QWNA 4BG8A 4LFAF 3ZZOA 3OR2B 3GV7B 1HMVA 1SIWB 2BYCA 3J7ZT 1DT9A 2F4VF 3TJAA 1S0OA 2QFJA 4KRFA 4JYAF 1Y0HA 1X1PA 2ZF5O 3QFPA 4C8YA 5EWGA 1TK0A 4JI7J 2YX4A 3PRBA 3MN9A 3AVNA 3MM9A 5IC6B 3K0SA 2RHKA 1ZA2B 3TVYA 1LXJA 1CJKB 4NCGB 1UFWA 2YKQA 3CGIA 5DJBA 3GFXA 3PACA 1S4FA 2DR5A 4X4OA 3QPIA 5CZ2A 4G6VB 5KT6A 4DQSA 4LSLB 1XR5A 1VSMA 3TAQA 2E5GA 3K0JA 3M32A 4FJ8A 4RUBA 3AB4B 4FJGA 3AVKA 3LDOA 4EZ9A 1Q8LA 3PX4A 4QIFA 1OKJA 3A5LC 3BUZB 2OH2A 1UCNA 2PD1A 2X6NA 4WP8A 3NH0A 1VQ4N 2ZH6A 4BC9A 1J9AA 3BY5A 1VYAA 4DQPA 5KOXA 2DRAA 3V1OA 4ID1A 1PCAA 5KPZA 4C9DA 1VRUA 3DGPA 3G82A 4ZVFA 1O8BA 2AV5A 4CEOA 4CI6A 2Z0GA 2KG1A 1G2EA 1BI4A 2CPHA 2D0AA 4IQXA 1K9MO 4DFMA 4EI2A 3UR3C 4DV3F 4B8AB 1Q8KA 1ZYQA 1FHTA 3LP3A 3UN2A 5A6PA 3KWMA 2CPJA 3H98A 3S1TA 3RBEA 4NLPA 4K41A 2QT7A 5DO2A 3VEOA 2C3OA 3QAEA 1WTBA 4CP5A 5THWA 1S0NA 2LLZA 3L09A 1IQZA 5BXIA 3TAEA 3QZ7A 3DRSA 2MXYA 4I68A 4MIWA 2ZH8A 2QMXA 3PR4A 3CVKA 3A3PB 1QQOA 3C16A 3IRXA 3C0BA 4CLPA 2ZHOA 4ZHRB 4ZS6A 3DM2A 1IBMF 4LIWA 2F65A 1O1WA 3KMSA 2F9DA 4B3RJ 3L8BA 2DNOA 1Q95G 4ZVSB 2MMYA 2J0XA 1ROFA 1UZHA 3IM8A 3ZXWA 1V3RA 1WF0A 5M2RA 3RR8A 4C3LA 2R7TA 3IBWA 2P9CA 1CSJA 5A0YA 3L9ZA 4W92B 3BGUA 2EWHA 4PRFA 2Z57B 1ZOTA 3UN3A 1TTHB 4KO0B 3JXOA 3LP0A 4NLRA 4USVA 4P73A 3OQ2A 3OR1A 4CCHA 2DISA 1S0MA 2UVWA 2GA7A 3NAEA 1YVUA 3SQ2A 3EGVA 4C8ZA 2W42A 3TEGA 5L38A 1M5VC 2EEYA 1S72S 2M3DA 1GLAG 4P71A 1B3TA 5DM6Q 2DBBA 2UXDF 3AA4A 4WYLA 2ATQA 1C4CA 3UB5A 4BDYA 3F9KA 1BGXT 3MEDB 5CY4A 4AILC 5CZ1A 3LDSA 1PJ7A 3MWTA 1D4XA 1RJJA 5D4LA 1A7GE 2XSFA 4HL9A 3CCVS 2HZCA 1CVJA 3HVWA 3M6GA 1HNVA 4U67L 2FIUA 2QLFB 4JI6J 3TVKA 3CCUS 4OJ3A 4KHWA 3MXHP 3PG9A 2IVPA 4XTTA 2VC0A 1HKBA 2ZD1A 3LGNA 4MQ3A 5ETLA 1RAAB 4Y2MA 3MAQA 4FLXA 1S1UA 4YDUC 4UQTA 1GLEG 1EP4B 3W3SA 4B9LA 4USUA 3Q8YA 1UZDA 3ATVA 4RNHA 2AF6A 1X0PA 5BR9A 4FOIA 3B6PA 1X4DA 3B54A 3NGSA 1QAYA 2OPPB 3CD0A 3PJXA 5KFKA 4KRWA 3VAGA 2A3JA 3M8WA 1TKXB 2BX6A 1MU2B 2RQCA 2KJWA 4CTAA 3RRHA 2A6MA 2NSBA 2E6LA 3W61A 1P6TA 4CHQA 4U7BA 1MMLA 2HFOA 1HR0F 4CM0A 1N5SA 1N88A 4EAHD 4IKFA 1M5PC 1VQ4S 1XMBA 3ZX3A 4DTUA 2M2BA 4O3QA 1I39A 1ZTWA 4RW7A 4DL0C 3ZT2A 5BN8A 5FLXO 5GAGI 4L73A 4K0KF 2AT1B 1N32K 1T3NA 2PFUA 1ITPA 1TMJA 4JI2K 4R0JA 3NDKA 4LF8F 2HRTA 1MWZA 3UW1A 1RBUA 2P6TA 2NZ4A 4MO4A 3A8KA 2ZC4A 4K2JA 1WORA 3UPFA 3L3UA 3EICA 4OJGA 4NI2B 4NCAA 1SJRA 4JI0F 1EETA 3UIQA 4AHCA 4YQWA 4OLBA 5CYMA 5AQZA 4LFBK 1H6KX 3HHNB 2GBZA 3VEYA 4B3TK 1D1UA 4UY85 2YX6A 3ZX0A 2VV5A 1U47A 4M94A 3FFIA 2P9PB 2V7YA 3L7UA 1FJGJ 2PI4A 1GK8A 2BQUA 3AVBA 4RO0A 2XWXA 1TL3A 3W9IA 2DPIA 4P75A 3HJFA 5KG3A 1OYDA 2J7UA 4UOGA 1BY9A 1HYVA 1PBUA 3P38A 3L2QA 1G6BA 4E1MA 3CNQP 1S3XA 2YHYA 2M9KA 3BO3A 5KRSA 1DGKN 2ASLA 2V51B 5AQLA 2PDAA 3HXMA 3KOAA 3O2IA 1RAEB 1B0TA 3FNNA 3GJQB 3MCMA 2IFXA 2P5VA 3SCLE 3LDQA 3SV4A 3C6TA 5M1FA 3KFWX 4MO5A 3H40A 4X66J 2P9SA 4G3IA 3PW2A 2KRRA 3BBFA 1PC5A 1MSWD 4YHHK 3OTBA 2FJWA 1JLQA 4GKKK 3RBXA 3S3MA 2X1BA 2DNQA 3G25A 1ESVA 2KFYA 2XHCA 1YT3A 2O8DA 2FGOA 1X4AA 3QEPA 5J2PA 2JOQA 3OL7A 2QI2A 3RRKA 2AYEA 1J5OA 3P4IA 5GAHP 3OYCA 3BQ1A 1S1VB 2PSZA 4NZ7A 2FZKB 3DXMA 2ZZMA 3AA2A 2KKHA 3D6MB 5H1SV 1VRUB 4DEZA 4R0EA 4LT6A 1S1WB 4M5MA 3QEXA 4JI1J 4DR6J 3TP2A 3FCVA 4JS4A 2DK2A 5HOOA 2C3MA 3EN9A 3E8OA 1NBWA 1S7IA 3GV5B 2R3VA 3TA1A 4J9VA 1YTYA 1MWYA 3R5DA 2HNYB 3HD1A 3CCEN 1Q7YT 1UEUA 4OYPA 4J9KA 4ZLLA 5KT4A 3MCAB 3DLRA 1K8KB 2Z1HA 4PG4A 4LSZB 4AL6A 2E1ZA 1NNDA 3CCJN 3MURP 4FVCA 3VERA 3VOVA 2IAJA 3NL0A 4C48A 5LL6Z 5JVGL 3J81j 3CETA 4CK2A 2FHOB 3JYTB 4K4TA 4J91A 1XR7A 3D6RA 3IFRA 1WI8A 3BM7A 3ISNC 4LF7K 2K06A 4I2QA 3D4JA 5JJBA 1O0PA 1S57A 3AA5X 2OD6A 1S48A 1XNQF 2ZNZA 1WN7A 5HVFA 5LL6d 4DL6A 2DNPA 1VQMN 3G87A 4BRGA 3SIPB 4ZITA 5KFTA 3VQ4A 3QB0A 1QAJA 1HNWK 2UUCF 1RCHA 4ZOSA 1FNMA 4Y1CA 1HQUB 1S9GA 5ADXA 2KHCA 3V6KA 3IKMA 5A0YB 2C2MB 3UNYA 1VSHA 1CJVA 2DNGA 3KWIA 4DV4J 2V68A 2HIYA 3EE8A 1VISA 2NUHA 4WFNQ 3FZHA 2B5JB 4B3MJ 3DOMA 3P39A 3SSSA 1TKTA 4IH6A 4XDDA 1S6UA 4LRCA 3P1GA 5KFJA 3H08A 2HHPA 2BANB 3M4XA 4JI4K 4GV6A 4KY3A 1RISA 2RU9A 3LH2S 4KR0B 3U3GA 1FWLA 4M95A 3DYAA 1XC3A 3UCGA 1N34F 2D7SA 3DRYA 3C8YA 1FJ7A 4ZTFA 1T6DA 2HK2A 1UA1A 2O8EA 3GLJA 2BQRA 1XR6A 4BR0A 4ALZA 5E5NA 3MN5A 3A8IA 1RTIA 3IAS9 4C0OC 3K2YA 2BE9B 4F4AA 3ZZZA 1WB9A 4ETZA 4DX8H 4Y65A 4J9RA 2ITMA 4LBPA 4F3OA 5B7WA 1LQ9A 5AT1B 4PKIA 3OW2M 1RDCA 4Z4IA 2UXBK 3ZETA 1UWBB 4LD0A 4BACA 3HHEA 4A8XA 1X9WA 4M3YA 3BEGB 4ZP7A 3LZJA 2E88A 2ZD1B 4OZJA 3HK2A 1OY6A 3NCRA 3HKZD 3QNOA 1N5YB 5E0OA 1SQFA 5KG2A 1SQKA 3R5CA 1RABB 2BOPA 5C2DA 4Z4EA 5B0AA 3OTOK 5JXSA 3B8AX 4X2BA 4BBYA 3SPZA 3FQLA 3M8QA 3BPDA 3MX2A 3M1VB 4ZVRB 3US5A 2AP1A 1KVCA 3ZTPA 2MTLA 3W3DA 1N33K 4KHQA 2JC0A 4L3NA 2EFPA 3I0SA 2UUBF 1V6HA 2V69A 5L39A 5SZTA 3M2UA 1EB0A 4UTGA 5H1SQ 4ZCIA 1HD1A 5I3UA 2NPIA 5DLGA 2HBYB 2C42A 1ZAXA 3NF6A 1KLMB 3N4QA 2R7RA 4TY8A 3M2RA 3OYKA 2CQ2A 3AVIA 3OUYB 4KGVB 1SIZA 1Q82T 3GR1A 2VUGA 4HT5A 1VK8A 2B7CB 3AJ1A 2BE2B 3FCWA 4C1NI 2RIJA 2GX8A 2KZMA 2O8CB 1T94A 2KM8B 4MH8A 3VF2A 4HKQA 1YJTA 2GQCA 4IYQA 1NM2A 3Q89A 2I6WA 1DBDA 3SUNA 3CCES 3CC2N 2BRLA 4PYDA 3M2VA 3Q7BA 4GVMA 4ZPWR 1I6JA 2RE2A 2RJZA 3AB2B 4OX6A 5M1OA 3VETA 3EYZA 4IDHA 3FFIB 3CCJS 3CHWA 2L3MA 1CULB 3F44A 2MKIA 1W26A 4TU8A 4DFPA 1ZA1B 5CCMA 3TRGA 1W25A 1WC1A 5BJRA 4CNYA 4U6PA 1A6LA 1H2VZ 4FLWA 4QWBA 1S6PB 1Q81O 4NXMF 4IKAA 4PWDB 1VQMS 1UVIA 3JAMU 4O3OA 2GAGC 4Q7AA 2ALZA 3R5GA 4KH6A 1VQYA 5C24A 4NXNK 5KFNA 5KFUA 2OEJA 2XYGB 3ZTSA 2E1YA 2G8IA 3HI0A 3LA0A 2W2NP 4CVNE 3W8PA 3AA8A 3VMFB 3LANA 3LOUA 4KFBA 3SAGA 3VA0A 3AOCA 1M90O 3NWRA 2ZHAA 3F41A 1Z2ZA 2IRXA 2R7OA 5B09A 4OPAA 4OPKA 5D8HB 2OPQB 5A2QO 2OGUA 4OJ1A 3QRPA 4PZVA 1DKGD 5HN0A 4URSA 4R8UB 4FLTA 3DLLQ 1NGJA 2QE5A 3C19A 3KLIB 4BR2A 3DXMB 3CPEA 1RT2A 3G86A 3IS9A 4FZZA 1JIHA 2ZZTA 1SKWA 1JJCB 3MM6A 2E29A 2YXLA 3NF8A 1HNXK 4NLTA 3OS1A 3GR0A 1TKZA 3KJVA 1OO0B 2R2SA 4Y2AA 3SCIE 1HQ2A 1WKJA 3SK3A 5AXMA 2R8HA 3SAFA 4U67Q 1WG5A 1N0VC 3FSYA 5HROB 1JWWA 2FSJA 2CIMA 2MZSA 3DRXA 1RNHA 3AV9A 2EKYA 1WOQA 2R8GA 1HYSB 3D5MA 5KFWA 4CFAA 5GMDA 5MAOA 3I9V9 2D3OR 2ASYA 3W2WA 1FKAF 3TI0A 2E7XA 3CD7A 1CPZA 1V5IB 1T9VA 4O8KA 1UFKA 4MLEA 2K1RA 5LY3A 4CF2A 2VBXA 2JEJA 2UP1A 3L4BC 3NCPA 4JK8A 3G96A 3T1YF 1FF2A 1R43A 1NMNA 1N6QA 2XMUA 2IVFB 2DEJA 3H4DA 1V4SA 4ILJA 3OFHA 4ECXA 1S6QA 3JQMA 4DR6K 2B4VA 5IWAK 1U26A 2IJRA 4Y1DA 3OS0A 1SI9A 2RQMA 3MDFA 5DDPC 1I5OB 1YVNA 2O8BA 3R6GB 2GV9A 5KFQA 4OPJA 5CZXA 3EO3A 4ZCMA 3LP2B 5AQVA 1XI1A 4O23A 4P74A 2HVIA 4Y2KA 1HBOA 3THPA 3DOMB 4P2XA 7FD1A 5G0RB 3FBCA 3HMJG 4ED3A 1WSFA 5AQYA 5KFSA 5F3TA 3OYAA 3ZX2A 4OL8A 1WSEA 1WUUA 4UZCA 2OANA 3BKFA 1JX4A 4QWAA 3QGHA 3V9ZA 2LQJA 4WP3A 3VF4A 4IQMA 2O8EB 5F8IA 3P3DA 2FHJD 3I9ZA 1ZBHA 3VGUA 3JXUA 3S3OA 3SQ1A 4LF6F 1YBTA 3GIMA 2WSFC 1W2BM 4FJNA 1AUDA 3A2FA 3SXLA 3H2UB 1RSCA 1NGCA 1F5CA 3SUQA 2KG0A 3T41A 1RAJA 1VHIA 1Z2LA 2RKIA 1KQFB 1S59A 3DOKB 3GONA 4C11B 3DU5A 2W9BB 1OVYA 2WOMA 1OS5A 2HS3A 2Z4PA 2AA4A 4Y6IA 1B7FA 2LMIA 3MM7A 4CH0S 2KFZA 1QQCA 3QQCD 4B9UA 2O66A 5CYQA 3KK2B 2FJXA 3FGVA 4J7CA 4X62J 2J6SA 5AZIA 4F3TA 2WW8A 3M2UB 2RF2A 4NZ0A 4PKGA 1S49A 3RBDA 2YWGA 1QUVA 3T5HA 2WSEC 2AHOB 5F8LA 2Q0UA 1TUUA 5BR8F 3MPWA 5IQQA 4EO8A 4M3TA 3HVAA 1GT8A 4KBOA 3R5JB 5JVHQ 5GADP 4DG1A 4WQ4A 4IRDA 3TA0A 3LP1A 5TKYA 3ZZRA 2VKZG 1VQ8N 3CD5A 2BKOA 4TLQA 3RZAA 3CQ8A 1RWNB 4DV6F 4CHZA 3OTEA 4FO0A 1FFSB 4C8LA 2DFFA 3U8XA 4G1QB 2Y3YA 1OH8A 4DV7F 1RTHA 4NLYA 4JI3J 4MKVA 4UF4A 3NMRA 3C6UA 2D69A 5JVGQ 6FDRA 1BDGA 3T1HF 1U04A 1BQMA 4K7QA 3PSIA 3CEDA 3TANA 2DH7A 2OO4A 4CGDA 4RTFD 3SQGB 4XK8C 5EDWA 3E2EA 3ZFVA 1C0TA 3HTVA 3OBWA 4E19A 3CE8A 4C8KA 1N5VA 3TWHA 4EHUA 4K4VA 3C14A 1JLFB 1NOZA 4JV5J 5GAGU 3POTA 3U1MA 3K5MA 3A3NB 2VBZA 1NCLA 2EW9A 1YG0A 3FVYA 2W2MP 2BJEA 2ZBQA 1KFSA 3CJBA 1FE4A 3FRZA 4USTA 2YWFA 4LBIA 3KLFB 2LEPA 2E5LF 4WKYA 3AGRA 2EG2A 4I9QA 2QV6A 1D0EA 3CUNA 1HUXA 2PI5A 3Q24A 3BP8A 3WNFA 1B99A 1JKHA 2VG7B 1KOHA 4FWMA 4WU2A 5TKWA 3G6EN 5CQGA 3QNNA 1YAGA 2EVZA 3LQVA 1SB6A 2PGCA 3KUHA 2GTDA 3ZNJ1 1S1TB 2ADBA 2F3JA 4UOHA 2WW4A 2IBOA 4FP9A 3OXFA 2MQMA 5IM0A 1YXQA 3TABA 2QWLA 2IRUA 3PKYA 4EGLA 2YTCA 3BZCA 2W9AA 4DXLA 4ATNA 4LH4A 2VH7A 4OJHA 3GYNA 1FCAA 4OLOA 4DV5F 4FW1A 1Q78A 2LA4A 4O8UA 2ZVIA 3CW2C 3WXJA 2ZH2A 1YUWA 3UD4P 2GELA 3U6FA 3IFEA 3MFHA 4B3SF 1RWKB 2QN6B 2VQFK 4ANEA 1C4AA 2AZ3A 4NZ6A 4ECWA 3C15A 4PQAA 2AQ4A 1RWVB 4AL5A 1BA1A 3BKUA 3JSRA 4ZJOA 4FYYB 2IVNA 3BREA 3D0IE 4CIEA 1XMOF 3PVXA 4CGHA 1ZPWX 3UKRA 5BN9A 2DGVA 1KQGB 1PYTA 3ZT4A 2N3LA 1ACMB 1ZXOA 2P9IB 3K59A 1RTJA 2YX7A 4DI6A 1IJJA 1WJ9A 1BE4A 1J5EF 2BV3A 4YNQA 4LIRA 2LECA 5AQTA 2PMHA 1Y5NB 2A3ZA 4ZPCA 4NX9A 2PZSA 2ASDA 2IIRA 2X1AA 4YDXA 2A41A 2IM2A 2YBVA 4EIAA 4M3UA 2K8GA 4QCLA 3DU6A 4B3OB 1K1SA 1Q53A 2DT9A 1SV5B 1GX5A 1HPZA 3O6WA 3CC4N 1N36J 2MJNA 4R5PB 5GAHI 4X4TA 1QVGR 1BO5O 3OPKA 2W4CA 2XNQA 4DL7A 3P5BP 4JKEA 1QQMA 2GQQA 3I0RB 4GMKA 4RX6A 2P9EA 3CO9A 1JLGB 1TFYA 1RBOB 2QWRA 3HD2A 4M5HA 3DLKA 4XAKA 1TP7A 2CZVC 1WHWA 3ONQA 4QS7A 4J90A 3TTFA 2W2PP 3S41A 5CE3A 5FROA 4BRQA 5EVZA 3ZZ0A 4H0VB 4IH5A 4ZN3A 2Q66A 3NAIA 2XBPA 2RS2A 1WEYA 2CDQA 1YVFA 3HSJA 4N41A 2R2UA 3H0PA 4A8YA 5IZHA 2E1MC 3H7HB 2JVOA 2JEIA 3O8WA 4DUTA 3SQ0A 4M5DB 4PHTX 4CGGA 4JV1A 5CZVA 1SKUB 3KUGA 4YY3J 5L1IA 3KNGA 4F50A 5LM7E 1VBXA 1K8AO 2EBEA 3AD8C 1M1KT 1L3UA 2BR0A 3A8YA 5AE1A 3DMJA 5AZIB 2ZH1A 3ZT0A 2YHWA 2RF2B 3R7BB 3FZLA 3H25A 2HFZA 3TAGA 1TL1B 2H3GX 4LH5A 1UEKA 2FJDB 3HHLA 1UMJA 1KXPA 4PYAA 1IV0A 2I1RA 4W5RA 3TAFA 2BQ3A 5E84A 1RA6A 1KD1O 3OBYA 1FESA 4CH7A 1JMTA 5D0RA 2XULA 2ZDOA 4AHSA 2M5YA 4CT9A 2F4FA 1HHTP 2WVFA 4WBFA 2Q36A 3FGUA 4OX9K 3EEQA 4DMNA 2HNZA 2PFDA 4O4GB 1U0SA 3W2VB 4CZJA 5A8WB 1KAXA 5AR0A 4PABA 3MMCB 2RHQB 3RTVA 5F8JA 2XI2A 1UKUA 3AT1B 5AE2A 2V63A 4ERDA 1WDDA 5LMNJ 5IT9Y 2DPJA 4BREA 4DFKA 2DGQA 1HARA 5AJ3K 1WSVA 3UKUA 2V8DA 5LOQA 4IR1A 1SC4B 4N47A 1X4CA 1RBTA 2CADA 2WONA 2D9OA 1OY9A 2F8EX 5BPMA 3ADAC 3E9PA 1E6YA 1WLJA 1FERA 2PO4A 1C0TB 1RTDB 2IVYA 3N6LA 3QESA 2HFSA 1FK9B 5FPDA 5HMYA 4J2DA 3CMAS 3V4IA 1EWQA 3VQSA 5F0WA 3ZEUA 2V2VA 2EC0A 2HW3A 2JWKA 4QOTA 3CO0P 3M7VA 4Y0WA 3HVTB 5CXTA 3OV7A 2QYGA 1HKCA 4FWNA 3NOGA 4ECSA 1OWXA 4Q0BB 3RMAA 2IVMA 2V8HA 3ALYA 1DTQA 3K8WA 1FRHA 2DRDA 4M63A 2AYBA 3NOCA 1KAYA 2HFVA 5GIOA 1TV6A 3FE1A 1NLKL 1U6ZA 5HLFA 3FBEA 1RADB 3GU0A 3N5BA 3ZT3A 1HNZF 3DDKA 5IS2A 2YHXA 3CC4S 1SC3B 5LSLA 1QE1A 5C15A 2JEFA 2KL8A 1IM6A 4I9LA 4WK1A 4X64K 3OLAA 3OVBA 4C7QA 3TAMA 4AXIA 5I4MA 1I94K 4HVZA 4PUOB 1RT7B 2D41A 5T14A 1LW0A 1RKIA 2RAQA 4CLYA 4DV0K 4LRBA 4J9UE 1H7WA 5KFMA 4P6QA 4UT4A 3MCNA 4KHMA 3BV8A 4DZ6A 2I5JB 4KV8B 2ZBRA 2HWHA 2D0CA 2WZ1A 5KT5A 4CJRA 3MCPA 2UVVA 3IC1A 2GZOA 5JUMA 2NXJA 4USWA 4HH0A 4YOYA 1H72C 4JKBA 2XI3A 4N77A 3BSAA 3G8SA 2MKCA 3J7Z5 1OY8A 5DQIA 1WC0A 1JB0C 3NS6A 2KM8C 3CCRN 3LWLA 4FZXC 4USJC 1RLDA 3PLAA 3UKRB 4JRQA 4RU2A 4IO9L 3VAHA 5A8RA 1M1GA 1FEHA 4LFCJ 4FJ9A 2GMJA 3HPOA 3MAAB 2JLGA 2V4JA 1NGHA 4H4KA 1TYQA 2Q97A 4J2AA 4E7IA 1NJYA 4OYXA 4PAAA 4B9TA 4DR1J 3QJLA 2EFOA 1VK0A 1BQNA 3NFAA 2J0QD 1S9EA 3TA2A 3CJTA 2FVRA 1WTFA 2WVDA 2F63A 4DV1J 2YNIA 4DS4A 4IEEA 4ED0A 1W7WA 2OUGA 4J9LA 3EUNA 4GY2B 5LXYA 1S97A 1VJWA 2RS8A 4DSLA 3LGHA 4AM6A 3GV8B 2RHSB 4OZ0A 1SL1A 5FPEA 3W63A 5DDQC 3BYRA 4DF4A 3OHRA 3MI7X 3WQUA 4OZLA 3THYB 1DLOB 1KQSR 4B9QA 2VG5B 1D8YA 3N0VA 2IA6A