1S1WA

Crystal structure of v106a mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
536
structure length
524
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1wA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1wA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1wA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1wA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1wA05
3TI0A 4EO8A 3MXJA 3KK3B 1D5AA 1LAWA 2BE2B 3RB6A 3I0RB 4MKBA 4NLRA 4WE1B 1NNDA 3SV3A 1NOYA 2ASLA 4H4MA 2ILYA 4CECA 3DYAA 4G1QA 4RG8A 3VQBA 2RKIA 3AA2A 4CFCA 4IH7A 2PYJA 4Q43A 3NAEA 4ECQA 4EO6A 5CYQB 2BR0A 3GIKA 4K4XA 4R8UA 2VG5B 4IDKB 4NCAA 4FW1A 2HNYA 2R8IA 3CJ5A 5DGAA 4ZHRB 1KHVA 4N5SA 2UUTA 3NMAA 3DYAB 3DLGB 3DLEB 4IG0B 3U6FA 4CF1A 2IMWP 1NK7A 1TL1B 4FJXA 2ZQBA 2P5OA 5KT5A 3QEPA 4O44A 4N47A 4LH5A 3LDSA 5EWFA 1VSMA 2HMIB 2E9RX 4BE0A 1L3SA 1X9MA 4IG3A 2FBXA 4ECZA 4JV0A 1S9FA 4FJ9A 3LWMA 4ECYA 4F2RA 4OGEA 4MK9A 1IKVA 4Q0BB 1T3NA 3H4BA 4DLEA 1L3VA 3DRRB 2O4IA 1J53A 1IM4A 1CXQA 4KV8B 3I5BA 3CFRA 3LP0A 3NBPA 1NOZA 3H2LA 2VG6B 3LAKA 1KTQA 1JIHA 1XR7A 3K5NA 1MMLA 4J9RA 5F8GA 5KFKA 4LSLB 4F3OA 3DRSA 1ASWA 3UR0A 1UWBB 4DTXA 4YMEA 1RTHA 3ALYA 2R2UA 3OYLA 2IOCA 1RTJA 2GC8A 1JLGB 4EBCA 2I5JA 2B5JA 4R5PA 4F4ZA 2G8FA 4BDPA 1XHZA 2UVVA 2KZZA 5DLGA 5J1EB 1JLBB 3VQDA 1RTIB 3BR9A 2JGUA 4IRKA 2XI2A 3DM2A 3CWJA 4NLPA 1HMVB 3KHLA 3PV8A 3SQ1A 1N5YB 3KK1B 4K4SA 1ASVA 4CFDA 3NH1A 1TV6A 2FC0A 2AGQA 4CEAA 3C95A 3DLKA 4CJFA 4DTJA 1MU2A 1N4LA 2IM3A 1S9GB 1ZBUA 2IDOA 4OKJA 1I3AA 3PUFA 4DEZA 2D0AA 1S0OA 3KLFA 1HNVB 4Z4GA 4M41A 3HHKA 2GUIA 3MTKA 5J2NB 1RBUA 4AHRA 3KK2A 5KFMA 4AH9A 1K1SA 5EWEA 4IH5A 4FZZA 5EWGA 2IA6A 4DSIA 2W9AA 2OPRB 4MIBA 4MK8A 1JL1A 3OYJA 4KTQA 4B9UA 3V6DA 2Z1GA 1Y97A 3RWUA 4WFXA 1VSIA 1G15A 4ECSA 5CYMA 4TSXA 3SCXA 4AHCA 4L8RB 2AGPA 2XGPA 1LW0B 4FCYA 3CDWA 3M8RA 4H54A 5KFCA 1D1UA 1ZYQA 4NCGA 4CHQA 3MEGB 4I2PB 2QKKA 5JXSA 3MEEB 2JC1A 1CZBA 1EXQA 2R2SA 1TKZB 3NGZA 3KD5E 2V9WA 3D0PA 3LP2B 2D5RA 1SL1A 4ELVA 4DL5A 1NK4A 2VG7A 4O4RA 2WB4A 1QSYA 4IQXA 4EP4A 3MAQA 4FK2A 1YTAA 4CJLA 5KG7A 4BWMA 2GV9A 3IS9B 5HRNA 1XC9A 1RT7A 2Z1HA 4WZMA 1DTTA 3HVTB 5KT3A 2FJWA 4ED3A 3LALA 2Z1JA 4K8XA 4ZTJA 3VQAA 2FVQA 4CJUA 3BSAA 3HVRA 2DFEA 4CHZA 5J2MB 4TXSA 1S9EB 4CESA 3P1GA 2WOMB 3QNNA 3VQEA 5F8HA 1QE1B 1DTTB 3QERA 3KLGA 3L2VA 4B3OB 4LQ3A 3L3VA 3SYZA 4DFJA 1CZ9A 4U6PA 3SI6A 2UVUA 3AA4A 4TLRA 3TARA 3NH2A 1S1VB 1VRTB 1TP7A 3CJ2A 4U7CA 2C28A 1S49A 4DU3A 1S1XA 4B9SA 4IFVB 2AX1A 3PY8A 2D41A 1RT2A 5HRRA 4YP3A 1JLCA 4M95A 1NK0A 5C42B 2X6SA 5HLFA 4O0JA 4JUZA 1HQUA 2Z1IA 4ECVA 3FFIB 1D8YA 2E6LA 4ZVGA 3AVMA 4ELTA 1LW2A 5F8IA 3QIDA 2OZMA 1L5UA 3T5LA 4CIFA 3K2PA 2KQ2A 1REVB 4TYBA 4NYNA 3BGRA 4ZVFA 3M9NB 1S0MA 1ZBFA 3V9XA 2XO7A 3SZ2A 3PVXA 4NLVA 3IG1B 3KLHB 1FKOB 2ZE2B 3GIIA 3ISND 4DG1A 4IRCA 4RNMA 3V6JA 3C6UB 1RBTA 3MF5A 4YR3A 4KAIA 1SH0A 4FLVA 3IN5A 3M8QB 5KFWA 3U3GA 2HWHA 2D3ZA 3D5MA 2YNFA 3HXMA 4M45A 3OJSA 1C0UA 4URQU 4FK0A 3SUOA 2F8TA 2P51A 3GILA 1T8EA 2HNZA 2YNGA 5HROA 2R8KA 4J9KA 4J9PA 3ZSOA 3AO4A 1IKXA 3T19A 3AVFA 3TAFA 4ICLA 3NF6A 3TAEA 4CFBA 4QW9A 4CEZA 4RNFA 4J2DA 3OYCA 1JLFB 5L1LA 2BQ3A 3S3OA 3MECB 2FBTA 3RBEA 3IRXB 4CGHA 1BISA 2ASJA 4DSJA 1FKPA 5HROB 4O3PA 1ZBHA 3H08A 5KG4A 3CVKA 4NLYA 3ZSVA 1RYRA 4CIEA 1J9AA 1SUQA 1U48A 3PJWA 1BQNB 5KFDA 4FM1A 5KFNA 4ZMMA 4QPXA 3OSPA 4HCCA 1D9FA 3RBDA 3AO2A 2OYQA 4RW6A 4EEYA 4FYDA 1ZBLA 1TGOA 1C0TB 1S1WA 2FLLA 3WNHA 1CXUA 5C24A 2EC0A 1TVRB 5J2PA 3V9ZA 4KI6A 3PR5B 3VQPA 4FLTA 4IOBA 2BQRA 4H4OA 1RT5B 3KD1E 4E7IA 4NRUA 4IFYA 2RN2A 4DSFA 4M94A 1RAJA 3SQ2A 3ZT1A 4CK3A 3BSNA 4H4OB 3RRHA 3KHHA 4DFKA 4CHOA 2XWYA 4B08A 3U3YA 3QIPA 3QGGA 2YKMB 3UPFA 4ED1A 5FDLB 1S1UB 2XY8A 1XR5A 3OL8A 2BANB 1SL2A 1DLOB 1RTDB 2W9BB 1BCMA 2D7SA 4YNQA 3F9KA 2AWZA 2RDIA 5FROA 5KG5A 4KFBA 4PWDA 1FK9B 4EYHB 4FJ5A 3UDLA 3KLIA 5DQGA 2OPQB 1ZTWA 2RF2A 1W0HA 3PJXA 4ID1A 4DL4A 4E1MA 3NGYA 2W9CA 4AHUA 1NJZA 1BI4A 1VSHA 4CEQA 2IJNA 4RNOA 1RT3B 4AHSA 4RW9B 4RNNA 1RDCA 1EX4A 3DI6B 1XWLA 2X78A 1Q9XA 2R8JA 3VN5A 3PW4A 3PO4A 3EPIA 5HRSA 2HWIA 1S6PA 2W9CB 3PR4A 3OL6A 3M8PB 4PUOA 1ZETA 4F8RA 4CJQA 1NHVA 1VRUA 4Y3CA 4Y1CA 4XPEA 4IKFA 4PQUB 3O3FA 2XC9A 3TQ1A 4J2EA 4MKAA 3QYYA 3T5HA 5F9NA 3AVHA 1N6QA 2X6NA 3CJ4A 4DL6A 1JXBA 4GMJB 5J2QA 2O4GA 3G6XA 2IAJA 3V1QA 2OPSB 4FJLA 3QEWA 1TAQA 3ZSWA 1RBSA 4OLBA 2DPIA 3RR8A 4Z4FA 2WONA 1VSEA 4B8CA 1HNIA 1RT1B 5HBMB 3SJJA 3TAMB 1N56A 4RW4B 4CJ3A 4KHSA 2HHWA 4E7LA 4CJTA 1JLQA 3MEDA 3MXIA 5KG0A 3KTQA 3OHBA 4DFPA 3OYIA 3G86A 2DPJA 3AVIA 3RTVA 4DTSA 1Z26A 4H4MB 3V1RA 4R0EA 4EBDA 1VSKA 2XY5A 4KREA 3L8BA 4G1QB 1B92A 3CJ0A 2RKIB 5KT2A 5DQIA 3GYNA 3WNEA 4HVJA 2IBKA 2QK9A 4IR9A 3VA3A 2G8WA 4TQSA 3MFIA 4B9MA 4N41A 4R8UB 2KW4A 2HVHA 3PO5A 1X9SA 3BSOA 1X1PA 3KJVA 2HNYB 1RNHA 4CJ5A 2ETJA 4M3YA 1HYZA 1EETA 2G8HA 2VA3A 3CO9A 4NLUA 2RDJA 4I9QA 1RCHA 1GOBA 3L2RA 4O44B 4Y2CA 1S0NA 1JKHA 5KFOA 3NCIA 2ZKUA 4XPCA 3OYEA 1ITGA 4IG3B 2XY7A 2LSNA 3GIJA 4FK4A 4ZPDA 1LWCA 2QV6A 3OHAA 1HYSA 4DMNA 1IKVB 1VSJA 4TY8A 3FQLA 2JEGA 4WFYA 4DQQA 1LWEA 2QE5A 4KBIA 1TQLA 4ID5A 1SKWA 1T03A 3QLHA 3LP0B 3NBPB 3TR8A 3LZJA 4DF8A 3V4IA 3OYGA 1S1TA 4O4GA 3N6LA 4FW2A 4K4VA 4NLTA 4RW8A 2D0CA 4CCHA 3DRPA 5KRTA 4KHWA 1R0AA 4IRDA 5DQHA 3DRSB 3THVA 2IM1A 4FJMA 1WSGA 1J54A 3V4IB 1RTHB 3RMDA 1HJRA 1RTJB 3BQ0A 2IM2A 4HCBA 2WCXA 4NRTA 3BJYA 4FM2A 2I5JB 1KLMA 2OH2A 4E7HA 5F8JA 2B5JB 1R0AB 4Y2AA 1QSLA 1HQEA 1KVCA 4R5PB 4KAZA 5FRNA 2AX0A 4KHUA 4QOZB 3UIQA 3JSMA 3OS0A 5KFZA 2G8VA 3E01A 1TKDA 1Q9YA 3DM2B 4KTZA 1GOCA 4GW6A 1NK5A 1TV6B 4Q8EA 3RRGA 4ECXA 4ZPBA 4EZ6A 3DLKB 2BDPA 3MFHA 3QINA 1MU2B 3LPTA 4IKAA 2AJQA 3OYKA 1HARA 2C2DA 3SV4A 3KLFB 2D0BA 3MR2A 1C1CA 4LD0A 4DQRA 3NL0A 3NF9A 3LP1A 3T5KA 3KK2B 5DLFA 2IS3A 3QZ8A 1SKSA 1JLEA 4HUGA 4HUEA 3SPYA 1K1QA 1RT6A 3SUQA 4YQWA 4I7FA 4M3RA 1UA0A 1NK9A 4HKQA 5KFJA 3V6DB 4DL7A 2R8GA 4AHVA 4MFBA 1Q8IA 5C25A 4JV2A 1JLEB 3KLVA 3I5CA 1J5OA 4KTWA 4OLAA 5CYMB 4CJSA 3AV9A 5KFFA 1RYSA 2BRLA 1U47A 5KGXA 3BQ1A 3HO1A 5KFSA 4CE9A 5HP1A 3ITHA 5L1JA 4WFZA 3OYDA 3H5UA 1IG9A 4J2BA 4NCGB 1HPZA 1SL0A 1QAJA 3ASMA 1RDDA 1JLAA 3VQ6A 2E9TA 2UVRA 2FLPA 3NKYA 4ECTA 4JRQA 4NLXA 2DFHA 4KKOA 4W5NA 1C0MA 1SKRA 3O3GA 2Y1JA 4CHNA 1IKWA 2VG7B 4DQPA 4CGIA 4OPJA 4TYAA 1YTUA 1EP4A 3PX0A 5D3GA 3S3MA 1LWFA 1RT7B 1RILA 3QEIA 3QGHA 4F4XA 4YFUA 4K4YA 2B6AA 3JYTA 2BRKA 3CYMA 3N6MA 2ATQA 4NLDA 2F8EX 5KFPA 3H5XA 4FS1A 3HPHA 3SFGA 3DDKA 3KLGB 1Z25A 3ULDA 4WYLA 3HSTB 4ED8A 2PY5A 1NJWA 5CZ1A 4O3NA 3ZSZA 4NLSA 3Q8QB 4QWBA 1WLJA 1U4BA 3GV5B 1TKTA 4E89A 4CGGA 4W5TA 1WAFA 2VA2A 4OGCA 1IO2A 1TKXA 1U04A 4FJNA 3AO1A 4MIAA 5KI6A 1S1XB 5KFAA 4ECRA 4ELUA 1RT2B 1YVFA 2XGQA 5EDWA 1A5XA 2HNDA 3OS1A 1JLCB 3N6NA 5KT6A 1I6JA 2W8LA 2E9ZA 5F8NA 1JX4A 3OLAA 2FVPA 3QO9A 4OL8A 2C22A 5HLFB 3T5JA 3QIOA 3K59A 1HQUB 1KRPA 2V4QA 4B9VA 3NGDA 1BIZA 1BL3A 2E6MA 1LW2B 2RPIA 3SNNA 5KFEA 2V4RA 3H5YA 3H59A 4F3TA 5L1IA 5FRMA 4EBEA 4FJHA 2W7OA 3BGRB 1S97A 4J9NA 5KFQA 3NAIA 3SPZA 3OY9A 4NCBA 3K5LA 4DTRA 4DG1B 4CF0A 5KFVA 1ZBIA 2YKNA 4XIUA 2P5GA 4B9TA 1VSFA 4ED7A 3ZT0A 3GV8B 4F4KA 3RB0A 3TAGA 5KTQA 4NLWA 2G8IA 2YNFB 3PHEA 3CJ3A 3QNOA 1C0UB 4LSNA 4KO0A 4DTOA 2HNZB 1BHLA 1KVBA 2YNGB 2DTUA 3LANA 3M8SA 3TAQA 4CF2A 4ZP7A 2O5DA 1IKXB 3C6TA 4RUCA 3MR3A 3V81A 4ICLB 2J6SA 5K14A 1RT4A 1JXLA 4OVLA 1LV5A 2HHTA 4G3IA 5L9XA 4RUAA 3VQ7A 2FVRA 4CJ4A 2OPPA 1FKPB 2B43A 4DL2A 4FLWA 2HHSA 2G8KA 4URGA 2FBYA 4TQRA 4DTPA 1SUQB 2P1JA 2Q3SA 4CJWA 1UAXA 4B8AB 2XHBA 2ZD1A 3RMCA 4ED0A 3VQ5A 2FJXA 5T14A 1A5WA 4RW6B 1VSLA 2A1SA 3PW7A 3LZIA 2OZSA 3C94A 2YNHA 3AA3A 3AO3A 3OYBA 1S1WB 1BIUA 4M3TA 4KHQA 5KG3A 1QUVA 1S48A 2XI3A 4CJEA 3CQ8A 4CJVA 5C24B 4DTNA 3VQQA 3DOKA 4FLYA 3OVNA 1SV5A 3BSCA 1BQMA 5J2PB 4Z0UA 4CEOA 3IGNA 4KHYA 4I2QA 2YNHB 1S5JA 2CKWA 2R7YA 4JS4A 4JS5A 3DLRA 5E41A 3BDPA 4IFYB 2JEIA 4DQIA 3S3NA 4M42A 2YNIA 4NYZA 5EUHA 4K4TA 2XY6A 3AVJA 3KLEA 3H98A 5F8MA 4N56A 4LQ9A 3VQCA 3SUNA 4KB0A 3QIPB 3PW2A 2W42A 3M9OB 4NZ0A 3KKSA 3ZT2A 5C5JA 5KGWA 2FBVA 4KI4A 4F2SA 2IC3A 4RW7A 5HRPA 2ASDA 3NF7A 4YR0A 1QSSA 5I3UA 1HYVA 4M3WA 3QETA 4KFBB 4PWDB 2GIRA 1TL3A 3KNAA 3DOLA 1T05A 2AGOA 2HAIA 3RB4A 3OL9A 3KLIB 1IKYA 2RF2B 3HPGA 1GX6A 4W5RA 4Q8FA 5KFLA 3V6HA 5I3UB 1SH3A 2V0NA 1BI4B 4M3ZA 1LAVA 1DTQA 3HVWA 3DMJA 1T05B 4IH6A 4O3OA 1S6QA 2DY4A 4ZPAA 3CDUA 1I39A 3L2UA 1U45A 3CDEA 3H40A 4EYIB 1QS4A 3MR6A 1VK0A 4KB1A 2HHUA 4WYWA 1S6PB 4KHRA 1KSPA 2PZSA 4I9LA 4PUOB 4J9QA 4FBUA 4ZPCA 1VRUB 4BWJA 4DTMA 4FZYA 5CY4A 4NLGA 4XO0A 1UA1A 3KK3A 2BE2A 3I0RA 1BCOA 3IAYA 1N6QB 3WNFA 5J2QB 5KFHA 5I42A 3Q8RB 2BGGA 4WE1A 2IAJB 4JLHA 3E51A 3OS2A 1D9DA 2F96A 4FXDA 4TN2A 3RB3A 4ZP9A 3IGVA 3WNGA 3ZT3A 1NHUA 4FLZA 2R8HA 5CYQA 3EPGA 3I8DA 4GC6A 4LH4A 2GIQA 3P83D 1KLNA 1VSDA 3K58A 2VG5A 2WONB 4IDKA 2CJQA 5I42B 1S4FA 5KFGA 4HYKA 1HNIB 4CHYA 4ZHRA 3FSIA 3Q8PB 4HHTA 4B9LA 2ITGA 3DLGA 3DLEA 4IG0A 2ILZA 4C8NA 4C8KA 1TL1A 1JLQB 3MEDB 3ZCMA 4BE2A 4DS5A 2HB5A 5JUMA 2HMIA 4K4WA 3KIOA 4CF9A 3BREA 3O4QA 3B6OA 4CIGA 3HJFA 3G6VA 1RA6A 4MH8A 3EY1A 4E7JA 3HP6A 4BDYA 4KHNA 3GQCA 4Q0BA 3SUPA 3QEVA 3DRRA 3KJVB 2JEFA 5DGBA 4CJPA 5DG8A 4FLUA 1EETB 4KV8A 5KFUA 4Q5VA 2BQUA 3O4NA 3ZSRA 2VG6A 3LPUA 3TAPA 1C1AA 3ZSQA 2KTQA 1QAIA 1JKHB 4F50A 5KFRA 4LSLA 2ALZA 1WAJA 2XCAA 1N48A 1KVAA 2FJVA 1UWBA 4DS4A 1WSIA 3TVKA 1LWCB 1W25A 1CLQA 3DLHA 1HYSB 2FVCA 4NLQA 3AO5A 3SQ4A 1JL2A 3B6PA 4TY8B 1XI1A 3KMSA 3F73A 1LWEB 1JLGA 2JC0A 3RMBA 1D0EA 1L3UA 4FM0A 4ID5B 4F4YA 1T03B 3QLHB 4DU1A 2WK4A 2AQ4A 1S1TB 4O4GB 2HW3A 5J1EA 1JLBA 1RTIA 1TK5A 2IM0A 3GIMA 4FLXA 4CGJA 3DLBA 4J9MA 4RW8B 1S10A 4O3SA 3DRPB 1JXEA 2E4LA 3AVLA 1HMVA 1XHXA 4K8ZA 1N5YA 3KK1A 4O3QA 1NKCA 1RDRA 2JLEA 1S9GA 3PW0A 4O5BA 1YT3A 4KSEB 2G8UA 1KLMB 1HNVA 4EP5A 3O3HA 4HUFA 1HQEB 4LY7A 1T7PA 4ZP6A 1F21A 5J2NA 2UVWA 3OYHA 3SI8A 3JSMB 4KE5A 3NHGA 3OYFA 4DFMA 5KFYA 1QTMA 4FJIA 3L2WA 3I5AA 3E01B 3EZUA 4O3RA 2OPRA 4DSLA 4QCLA 3SQ0A 1XR6A 4DQSA 3KHRA 1NKBA 4OPKA 4CK2A 3PZPA 4PY5A 3KHGA 3D28A 5DG7A 3PX6A 4Y1DA 4E0DA 3VQ4A 3HL8A 4O0IA 1LW0A 1C1CB 3V1OA 1GX5A 1KFDA 2IGIA 5KFBA 1RA7A 3LP1B 3OYAA 3I0SA 1HRHA 3KMQA 4M3XA 4GC7A 3AVGA 1RT6B 3MEGA 1KFSA 4I2PA 4QW8A 2JEJA 4I7FB 4ZVHA 4IR1A 2WTFA 1EKEA 1NK6A 3MEEA 3D45A 1YVUA 2QKBA 3FDSA 1TKZA 3G10A 4ED6A 4E7KA 3FQKA 5T7BA 1GOAA 3I0SB 3LP2A 4MFBB 5SZTA 5C25B 2YHAA 2Y1IA 3RR7A 3PW5A 1NK8A 1T94A 1J5OB 4UQGA 4CJRA 3TWHA 4E1NA 3H4DA 1WNSA 4CERA 2OA8A 3IS9A 2EHGA 1C2PA 5HP1B 3ITHB 4FZXC 3HVTA 4M3UA 4WXOA 5KFTA 4J9SA 4RZRA 1HPZB 3TABA 4FJKA 3L2QA 4AILC 3MXMA 1JLAB 4PA1A 5J2MA 3RMAA 1S9EA 4JV1A 2WOMA 4W5QA 4CFAA 1QE1A 4FS2A 4B3OA 4Q45A 5JS1A 4KKOB 2X74A 3NGIA 2PYLA 4GVMA 1IKWB 4DLGA 3T3FA 3ZSYA 1UOCA 1EP4B 3BQ2A 5D3GB 2J6UA 3NE6A 2R2TA 1LWFB 3V9UA 1S1VA 1VRTA 4Q44A 3V9SA 4FJ8A 2B6AB 4IFVA 3JYTB 3HPOA 5KT4A 4K4UA 5KG6A 4QWAA 2IJFA 4NLOA 2KFZA 3OYNA 2XRIA 1KCFA 3VQ8A 4CJKA 4FVMA 1QQCA 4C8MA 3EZ5A 5C42A 4MQ3A 4ZTFA 2KZMA 2VWJA 4IBNA 3SFUA 3FFIA 3NH0A 3GV7B 3QEXA 1ZTTA 1TKTB 4CEEA 1TKXB 4Z4CA 4KB7A 3OLBA 4URSA 1REVA 5F9LA 3AVAA 2KFNA 5JS2A 3IG1A 3KLHA 1FKOA 2VWKA 2ZE2A 4N76A 2HNDB 5KRSA 3C6UA 4CF8A 3LAMA 3S9HA 4CEFA 2R2RA 4BACA 3QO9B 4QWCA 4FJJA 3T1AA 3M8QA 4QWEA 4C8OA 4Z4IA 4RU9A 1ASUA 1W9HA 3HP9A 1L3TA 1WNEA 4DSEA 1X9WA 1O1WA 1WSHA 4DWIA 1WSJA 4CEDA 3Q8SB 1JLFA 2EX3A 3MECA 3AA5X 4DF4A 1U09A 3KKRA 1C6VA 5KFXA 4OKEA 3IRXA 4FJ7A 4CK1A 2UUWA 2YKNB 3NF8A 3AVKA 5DG9A 3OL7A 4ECWA 4FJGA 3VQSA 4NYFA 4ED2A 1B9FA 4YR2A 4E3SA 2YHBA 1BQNA 4DL3A 4LSNB 4KO0B 3FRZA 1BGXT 3V6KA 3K57A 4OJRA 3C6TB 3G0ZA 1IH7A 1C0TA 3V81B 1NJXA 5KFIA 4BDZA 5CZ2A 4J2AA 2HVIA 4H8KA 1CSJA 5K14B 3P5JA 2FVSA 1RT4B 5L1KA 4E19A 1SH2A 1OS5A 1K6YA 3L3UA 4RNHA 3AVBA 5KT7A 2OPPB 4JRPA 3TANA 3LP3A 4AHTA 1TVRA 3OJUA 3PX4A 3A2FA 1TK0A 4O55A 4X2BA 1RT5A 4QAGA 3ZT4A 3MR5A 1RDAA 2ZD1B 2HHVA 3CM6A 3CFPA 1WSEA 2QXFA 4Y34A 4MK7A 3G6YA 3ZSXA 2WRMA 2AU0A 4K4ZA 3AVNA 2FLNA 2HHQA 3KOAA 4HTUA 3HT3A 5KG1A 2W7PA 3NFAA 1A5VA 3VQ9A 1QHTA 4OKKA 1NJYA 1WSFA 3K5OA 3RAQA 2F8SA 2NUBA 4CGFA 3QZ7A 3V9WA 4DTUA 3CG7A 3CM5A 2YKMA 3HKWA 5FDLA 3DOKB 1SV5B 1BQMB 1S1UA 4FBTA 3M9MB 1RBRA 2BANA 4I2QB 1DLOA 1RTDA 4KHMA 2C2RA 4K50A 4WZQA 2W9BA 3EYZA 3NDKA 4C8LA 5DK5A 4BE1A 4WXWA 3HVAA 4TY9A 1NKEA 4W5OA 3K5MA 1KHWA 1FK9A 2YNIB 4Z4EA 5SWMA 2I1RA 3UQSA 5EU7A 3HM9A 3ISNC 4J9LA 2OPQA 1C1BA 3KLEB 1FXXA 1TAUA 2YV0X 4ZP8A 1WN7A 5DMRA 3RAXA 1B9DA 1RT3A 4RW9A 2B4JA 3ICLA 2IC3B 4RW7B 2A1RA 4CGDA 3DI6A 1C1BB 3LWLA 1Z4UA 2J6TA 3M8PA 4ECUA 3CIZA 1TL3B 2C2EA 3NAHA 4EZ9A 3DOLB 5F8LA 2DFFA 4KPYA 1RBVA 4DU4A 3CFOA 3HK2A 1IKYB 4PQUA 4B9NA 2D3UA 4DSKA 3QGIA 3AVCA 1TK8A 2W8KA 2XCPA 1DTQB 4KRFA 3DMJB 1S6QB 2OPSA 2ATLA 3QESA 3HYFA 4J9OA 4CEBA 4F4WA 4QWDA 4CHPA 4ZVEA 2GBZA 1U49A 2HHXA 3OYMA 4Z4HA 3H5SA 1RDBA 3OSNA 1RT1A 5HBMA 5KG2A 3TAMA 2WHOA 3VA0A 4RW4A
chains in the Genus database with same CATH superfamily
2OMLA 3H45C 1C4CA 2LXIA 2O8CA 1LAWA 3RB6A 5EX3A 1XNQJ 2OLWA 3SAHA 3H42A 1NNDA 3A13A 1CJUA 3GB0A 3SV3A 1XMOJ 1NOYA 2ASLA 3FNNA 4CECA 3PNIA 3DYAA 2MY7A 5C12A 4IH7A 2A6OA 3DXBA 1R31A 2DGVA 1O13A 2GVDA 3EGNA 4K4XA 5ETVA 4QJVA 4R8UA 4IDKB 3PYEA 2XULA 4PQAA 5DGAA 2UUTA 3NMAA 3DYAB 4IG0B 2P5OA 3NVMA 4MTPA 3P6YC 4QIGA 4DPOA 1VSMA 2BKPA 2BTFA 4DCHA 1H74A 1NJIT 5HMYA 1ITPA 4JV0A 1S9FA 1NDCA 5HVGA 4MK9A 1VQSA 3NXZA 3H4BA 1J53A 2FDNA 3H7HB 9ATCB 2Z2YB 4U67Q 1RU2A 3MZIA 1CXQA 3W64A 3NBPA 2IVPA 4JEPA 4N7TA 2F3JA 5D6GA 1SQGA 2PMWA 1KTQA 2B8PA 2FSKA 1NSKL 4HDHA 3K5NA 1MMLA 1UEUA 2KT3A 5IT9O 2V6AA 5F8GA 5B0GA 3ZTOA 4Z37A 3UR0A 3D9BA 1OKJA 4CYUA 1HHQA 3ALYA 4WPAA 1UVKA 2IOCA 1RTJA 5EVZA 2AJFE 1XTZA 3DU6A 4EBCA 4DPWA 4DR4F 2I5JA 3VEOA 2Z30B 2B5JA 3SSRA 4F4ZA 2OAUA 1MDUB 2UVVA 4DV6K 2C2OB 3W61A 1JLBB 5H9FJ 4RL1A 2KM8B 3BR9A 3EGWB 2JGUA 2M8HA 3OQ2A 3AA8A 2CPJA 1H38A 3DM2A 4NLPA 1HMVB 3K0JA 2XEXA 3VGLA 2C42A 2J9DA 3NH1A 2FC0A 2AGQA 3Q24A 2VONA 5B0CA 5LJWA 4KGVB 4DR7K 1V4SA 4DTJA 2A40A 1S9GB 1UCNA 2IDOA 2DGSA 2XHWA 2A5XA 1WG5A 4Z4GA 2DYAA 2VC0A 3VEXA 1KWMA 2DR6A 3BEXA 3UNYA 3WIUA 1HLUA 2F4FA 2CNOB 4IH5A 1VQ6N 5LMNJ 4J37A 1SB6A 3GONA 2QW9A 3JAMU 4YOVA 2UUCK 1LXJA 4KR0B 3V6DA 1E6YA 2RS8A 2L9NA 4ZVTB 4PXCA 4WFXA 4ENOA 4F3MA 3QBCA 4PG4A 4AHCA 2R7UA 2AGPA 4NMLA 2V2QA 2MZ1A 4NEYA 5M1QA 3CDWA 3M8RA 1UETA 4CO1A 1RAOA 1D1UA 1ZYQA 4NCGA 3NP5A 2V2ZA 2V69A 1VOMA 5JXSA 1EXQA 3HTVA 2CQ0A 3D0PA 3OXLA 1N34K 3G6ES 4YOEA 3D4JA 4BS2A 1SL1A 4ELVA 5CE3A 1NK4A 2VG7A 1FF2A 2WB4A 2FZGB 2HIQA 1QSYA 3ID6A 5ETQA 4BWMA 4KHPJ 5HRNA 2Z1HA 4GY2B 3RJMB 4WZMA 3HVTB 5DDOC 1BXNA 4ED3A 2AF6A 2VQFF 3UKUA 2FUG9 3CCQN 3LL3A 2VH7A 3HVRA 2DFEA 5J2MB 4DDFA 3QNNA 3VQEA 1KAZA 3L2VA 3JQMA 1E4GT 4LQ3A 1CZ9A 3GLJA 1HW8A 2HVZA 1N33F 2XMVA 1NH8A 4A8QA 2WZ1A 4DU7A 5IC6B 3TJ8A 3CJ2A 4U7CA 3CXCR 3EVWA 3BO3A 3S8SA 1IBLF 4AE5A 1RT2A 4OHWA 2J8AA 4LF2A 4YP3A 5IQ6A 2D74B 2XS2A 3QWUA 5C42B 2X6SA 5GAEU 1HQUA 4PCQA 5DM7Q 2Z1IA 4C7QA 1IM6A 3Q7CA 4P2XA 1LW2A 2IRUA 2HFUA 1KVJA 3K2PA 1REVB 4TYBA 3KWIA 5AQPA 3QGPA 3H90A 4ILRA 3D2EA 2XM3A 1ATNA 4Y28C 3ISND 3DU5A 1PC4A 3IDHA 4DV1K 4LBPA 3H1QA 3FR0A 1FVSA 2UUAK 3I4PA 3BZQA 5KFWA 3AAPA 1NGBA 2V4JA 4FK0A 3TA0A 3SUOA 2F8TA 3GILA 4JI7J 3VWSA 1JB0C 4B3MK 2V8VA 1RADB 3OTCA 3TX8A 3CD7A 5GIOA 3GJRB 4QR2A 3H2VE 4UOGA 5L1LA 3D54A 2VPXB 3PKMA 3OXFA 3QJJA 5AQWA 4OI3A 3CCSS 1SJRA 2FHJA 2OJ3A 4NLYA 3V5RA 1U48A 1KDNA 3MPUB 1IBMF 4HCCA 2FHKA 1B0VA 3S7RA 4OLPA 3OTOF 3JS9A 1C0TB 2DBBA 1HWKA 2MQLA 1WTFA 3NCRA 1S6OA 3T69A 5C24A 1GLEG 4B3SJ 2D69A 4FLTA 3MM6A 2E7XA 1NU4A 3KD1E 4E7IA 1VBXA 1NGGA 5HOOA 3OFGA 2CFXA 1NDKA 2XMKA 4OYMA 4QU6A 3AARA 3BSNA 3BF3A 2QGFB 3VEZA 1R27B 3J81O 4HH1A 3KHHA 4YORA 4CHOA 5THWA 4B08A 4P75A 1F2HA 1CJTB 2EKNA 4QS8A 2YKMB 1X4HA 2XY8A 2RQCA 1SL2A 3V2UC 2F7VA 4M1KA 2CQHA 3ATUA 1BCMA 4JI1J 1QZ6A 2AWZA 2A3JA 2R7OA 2YKAA 2ZBPA 1SJFA 2GA7A 3QAEA 1Y11A 1FK9B 5K8MA 1MSWD 5DQGA 3IA0A 1GEHA 3EGZA 2YPYA 2OTLS 4X4SA 2A18A 1W0HA 2BJ7A 4E1MA 1OY9A 2B4PA 5FLXO 1XK8A 4AHUA 1QQNA 1WC1A 2FYXA 1ZZNA 1IV0A 5AQJA 1HNXK 2OUGA 1FE4A 1RDCA 1EX4A 4WJBA 2P9SB 1ZAVA 4DMZA 1I94K 4DV0F 2ZBQA 1KOOA 3G96A 3PW4A 3SQGB 3VN5A 2DNNA 3M8PB 2VDHA 4PUOA 4FP9A 4RU2A 1VRUA 4Y3CA 3D6RA 2EBEA 3MCSA 4IKFA 3CCLS 5AQFA 4PQUB 5K8PA 4BRKA 3O3FA 2HFOA 3TQ1A 3MM5B 3AVHA 2X6NA 4GKJF 3G6XA 3E3XA 4X4UA 3OR1B 1NGIA 1G6BA 3VZIA 1YRTA 2G0IA 1YITS 1SIWB 2RIJA 3DC2A 1R59O 2V5HG 3D3BJ 3KUGA 2YWGA 4B3TF 4Z4FA 1NAQA 2E5JA 1VSEA 1RT1B 4ZS6A 1UEVA 5AQNA 2CZ9A 3FJ2A 5JLHA 4CJTA 4MKVA 3MEDA 5HATA 3IKMA 2P6TA 2OD4A 3KZBA 2I38A 3AVIA 3DCAA 4YDUA 4DTSA 2HBMA 4H4MB 2EWHA 4R0EA 2XY5A 1FRJA 1VC5A 3V1RA 3SXLA 1B92A 2RKIB 5DQIA 3GYNA 3EN9A 3CJ7A 1SJQA 1N0UA 2IBKA 4HVJA 4DQ8A 2HVHA 2GJ2A 3PO5A 2HNYB 4CJ5A 4F25A 2VA3A 2QJ3A 3CO9A 4BQLA 1E3MA 4X66J 4O44B 3FZMA 3CCUS 5C7PA 1JKHA 5KFOA 1RAIB 1BE4A 1L3KA 1ITGA 3ZLJA 4JKHA 1M5KC 4DR2K 3M32A 2QV6A 3MI7X 1T0TV 5LMUJ 2ASPA 1VSJA 2CPDA 2JEGA 4WFYA 4DQQA 4C2MA 2ZM6J 2CQIA 1ZAWA 1TQLA 2C3MA 4WIQA 1Q18A 1SKWA 1T03A 3LP0B 3TR8A 2Q3PA 1VQ5N 3TA2A 3RUBL 1FX4A 3N6LA 3HSDA 1MN9A 4NX9A 5G4DA 1RWUA 5FLXY 3OBYA 4CCHA 2JWLA 3DRPA 4BC2A 2F9JA 3DRSB 2IM1A 4FJMA 1S77D 2CPFA 1Z05A 2CJYB 5AQUA 3A5LC 5FPMA 3N4QA 4M63A 3M2UB 3BJYA 1KLMA 3KDOA 2P9KA 1PAEX 1KVCA 1DHMA 2O8DB 1FT8A 4LF8F 4KAZA 1YITN 4KHUA 3PCOB 4L75A 5DETA 1FI4A 3DGPA 3OS0A 1J5EJ 2NXNA 4BHQA 3TUPA 2QM1A 1Q9YA 4AT1B 1NK5A 1F5BA 4ECXA 4ZPBA 2F7TA 3DLKB 2BDPA 4CTAA 3R5DA 1MU2B 2AJQA 3M1FA 2CGJA 5H9EK 3MR2A 1VQ4N 1C1CA 3AB4B 3NL0A 2ZVSA 3NF9A 3LP1A 3I31A 3KK2B 2ROEA 4CDIA 4LF4J 4FWKA 2QL5B 1E6VB 1K1QA 1A7GE 3J7ZT 2J5AA 2PA3A 4A61A 2JL9A 3J7YI 4PAAA 5D4NA 2JZ5A 3BV8A 2CUYA 3NCPA 3NS5A 3BGFA 4QR1A 3BZKA 2DNOA 1NGDA 1CC8A 1J5OA 1FRXA 3SMPA 1S4EA 4JAXA 1U47A 1U6BA 5KGXA 3LA0A 2FJAB 1GK8A 5KFSA 5AXMA 2GVZB 2IVMA 3BO4A 3H5UA 4LF9F 4J2BA 3R7SB 1HPZA 1Y7PA 1QAJA 3FC9A 1SS6A 1HNZJ 2AYEA 4YOWA 2UVRA 1VLOA 2FLPA 1O5JA 4P73A 2ZZNA 3CMES 2WUSA 1JJ4A 4LBHA 4PKHA 5JVHQ 4KKOA 4AXIA 1YI2S 1SKRA 5IV4A 4DQPA 1S12A 4TYAA 2DVIA 4HT7A 3LOUA 4D3HA 2VUGA 1RILA 3CGIA 3QGHA 2AV5A 3MUTP 5D8HB 4UY8T 2VKZG 2KYZA 2BRKA 3U9DA 4NLDA 2PA8D 1TR0A 2XHCA 5KFPA 3H5XA 1ZBSA 4DX6A 1R0CB 1N36K 2ZUGA 3DDKA 1Z25A 5IWAK 3ULDA 2FD2A 4FZVA 4ED8A 1SCJB 3ZSZA 1AXQA 4QWBA 2W01A 4JKEA 3GV5B 3GMGA 2VA2A 1IO2A 3ZTPA 1NSQA 5J1PA 4FPBA 4OX6A 2GWJA 4C9DA 1S1XB 2CH6A 1P8GA 3L7UA 3M1VB 1OH6A 5EDWA 1U24A 2HNDA 3OS1A 2OSRA 4FYWB 2ROGA 1JX4A 2FVPA 2O67A 3T5JA 1FDBA 2YX1A 3K59A 1KRPA 1S6UA 2X51A 4L73A 4H4KA 2V4QA 1OY6A 3ULHA 3NGDA 3MGJA 2E6MA 1D09B 2EFQA 2NRXA 1AZSB 5LL6Z 2AYBA 2W2QP 2V4RA 1KQSM 2XS7A 2E5LF 1BUPA 1N8RO 3KWMA 2W7OA 3FBFA 3CXCM 1NBWA 4TVAB 4J9NA 5KFQA 2HHHF 3NAIA 1J2VA 4NCBA 2GO8A 2LQJA 5IXUA 4NI2B 3TUZC 4PRFA 4XIUA 1VSFA 4MLHA 2YXLA 3C65A 4F4KA 2KM8C 4NLWA 4NWBA 3R97A 3PHEA 3WT0A 3HZGA 3DNCA 3M5RA 3P4IA 3CCRN 2I7NA 4DTOA 2HNZB 1JJ2R 2YNGB 3M8SA 2MQOA 5EOYA 3FE1A 1HBUB 5KOWA 1VS3A 1RUSA 3HSCA 2W25A 4C11B 2HHTA 1HNWK 5JMVA 4RUAA 4CJ4A 2OPPA 1W2IA 2KT2A 4DL2A 1MWMA 3AY9A 1QQOA 2FBYA 4TQRA 3RRKA 4DV4F 2XMUA 1M90T 5JICA 1SUQB 4M8LA 1EQ0A 2LDIA 3N5BA 4DR4J 2DH9A 2DNHA 2I2YA 3MN6A 4ED0A 3VQ5A 5T14A 3PW7A 3LZIA 3AA3A 4F7VA 1FJCA 3O3LA 1EAYC 2E20A 3ISZA 5KG3A 2NPIA 3CJAA 4FOIA 2XI3A 4CJEA 3CQ8A 4CO5A 1WUAA 2NNWA 4CJVA 1WF0A 4ZJQA 2JWKA 3ATVA 4Z0UA 3D0GE 4CEOA 4DU8A 4DX5A 3C16A 3I82A 1ZM3A 4MAKA 2D0PA 4H0PA 4KQZA 4C3KA 2W2PP 4NYZA 2H65B 2VQEK 5GVQA 3AVJA 1DAXA 1B64A 3H98A 3UWTA 2J0WA 3T9ZA 3I6PA 4LJMA 4CZMA 3MPYA 4KB0A 3QIPB 1WEXA 3ZNJ1 1EJ7L 2NSCA 3ZT2A 5GAEP 1VIOA 1ZBTA 3PIPQ 4RW7A 2HFVA 4BRNA 1RACB 3NF7A 4YR0A 3HZ6A 2Z4PA 2XZDB 5LY3A 1HW9A 4YY3K 2R7QA 4DUZF 4PWDB 2EEYA 1YVNA 3K9KA 3KNAA 3DOLA 2AGOA 3RB4A 3NEKA 3NY0A 4JI0F 3ULEA 3D6MB 1IKYA 1V6HA 4PG6A 2H48B 2WSCC 3CE8A 3T41A 1WOSA 2BJ9A 3LQVA 3AFGA 1SQFA 1M1GA 1LAVA 3HVWA 2W7AA 3DMJA 2DNYA 3N4WA 1I39A 3L2UA 4FWNA 3DXSX 5E2QA 2HKEA 4W92B 3MR6A 4LFBK 1KQKA 2U1AA 3GFHA 1RGIA 4YHHF 5F0UA 4J9QA 4FBUA 2LLZA 4ES1A 2LECA 4DTMA 4OYXA 1IBCB 2UXCF 1X4BA 2BE2A 1FXLA 3I0RA 2VQFJ 2V9KA 4ZVQB 2ZFHA 3I55N 3GR1A 2IAJB 4JLHA 4OZ3A 1D9DA 2F96A 5GAHI 4USUA 1WF1A 3J80O 1FE0A 1PC5A 4X4TA 3IGVA 3MPVA 4DR6J 2JSXA 4IO8A 5KAKA 4OHVA 3VGMA 4ZITA 1KLNA 1N33J 2J7KA 2CJQA 4HYKA 1HNIB 4CHYA 4ZHRA 2I9SA 5HMXA 4B9LA 2A0FB 1I51B 1IBLJ 4C8KA 2AJ1A 1JLQB 3RZAA 2RUGA 1GTEA 4A4JA 4PXBA 2GQCA 3LPEA 5JUMA 4MO4A 4ZJLA 2DHHA 2Q0UA 3G6VA 1KVIA 4MH8A 3A5OC 2HBKA 5F3TA 3EWGA 4Q0BA 3SUPA 1UZHA 3DRRA 3KJVB 5DGBA 1OPIA 2FJEB 2Q2RA 4WKYA 3D68A 1N5TA 1PG5B 3TAPA 3O08A 3D3CJ 4JI2F 1GLJO 1C1AA 3ZSQA 1D4XA 2KTQA 2R7RA 2CQ2A 9RUBA 2ZUAA 1BA1A 1WAJA 1KVAA 4KGZB 3MWBA 3R5AA 2FJVA 5AR0A 4JD2A 4TY8B 3F73A 1JLGA 4USHA 1PSDA 4DU1A 2MQMA 2DXFA 2VBZA 3HOTA 2HW3A 5J1EA 3OUYB 1RTIA 1ZXOA 2D4WA 4QIVA 3L09A 3NMUA 2K7JA 2E4LA 3VAFA 1N5YA 1G7CB 2HWTA 1HR0K 1BUXA 2DR8A 3G82B 3FCWA 1K9MT 3GSIA 3SJHA 1YT3A 4ISEA 2HQGA 2G8UA 1IBMJ 2KU7A 4KYZA 1VQPN 4LFCK 1PYOB 4LY7A 1YJRA 3OTOJ 1F21A 1LWXA 4XH5A 5J2NA 5H1SQ 1X8DA 2E1AA 3HHEA 1TUVA 2PMZD 2HQFA 1WKLA 4O3RA 2OPRA 1VQ8S 4DR7F 3LDPA 5B0DA 3U27A 3SQ0A 1XR6A 2MGZB 3J80Y 4C1NI 3N28A 3CMAS 2ASYA 2HHPA 1NKBA 4C97A 4CK2A 2QMUB 3HHLB 4BLGA 2ZH4A 2BW7A 2HFSA 5DG7A 1MWQA 5C2GA 5MAOA 4E0DA 4WP8A 2O8FA 1LW0A 1X60A 3F41A 5D0GA 1RA7A 1AFJA 2C2NA 2M52A 4DHVA 1AW0A 3DLJA 2HRYA 3CTRA 2F4VK 1IQZA 4A62A 3PXGa 1DQ8A 4TLQA 2W6LA 3MEGA 4PG7A 2CNKB 4I7FB 4ZVHA 4P6QA 1A9NB 3VPZA 3G8QA 4FNIA 4NA3A 1RWNB 2YQ1A 2QA4G 4ED6A 4E7KA 2XMJA 3HMJG 4WF9L 4UOHA 3TP2A 5C15A 4GVEA 3GFXA 1CS4B 1XMQK 3H4DA 4H0VB 3C46A 4OYZA 1NMNA 1Y64A 4TU9A 2DXDA 3MM7B 1C2PA 5HP1B 2XBPA 5KFTA 1QZ5A 3DAWA 1HBNB 3TABA 5DZ7A 1RKJA 2KVQE 1X31C 1PKUA 3TPQA 3M3ZA 3RMAA 2WOMA 4W5QA 1QE1A 4FS2A 4JI3K 4PXDA 2L08A 4DV0J 4B3OA 5JS1A 1I1GA 1ZA1B 2Q66A 1GLLO 1CJKB 1UOCA 3BQ2A 5D3GB 2J6UA 2AP6A 5AZIB 3V9UA 1BO5O 1S1VA 4CNZA 4C0OC 2B6AB 4IFVA 3JYTB 1U2RA 4DXLA 2KB2A 4GKJJ 3OYNA 5I3QA 4CJKA 3TZZA 4FVMA 3MN9A 4U7UD 2ZITA 1QQCA 3I87A 2XSJA 2G0CA 2KZMA 1DEJA 2LFVA 5M2UA 4B3TJ 2AEJA 2I8EA 3W8GA 4LIWA 1X9JA 2CRLA 3MCOA 3THWB 3A3NB 1MN7A 1HI8A 4FF3A 5D78A 5F9LA 3I56N 5AJ3K 2Z57B 3Q2TC 2DEJA 1MLAA 2VWKA 4IOAQ 2KKHA 3VVTA 5KRSA 3C6UA 3EVMA 2QWRA 2MQPA 4QWCA 4JI4F 4DN0A 4MYTA 3CIMA 2YWHA 4P9SA 3R27A 2QIFA 1O8BA 4FWSA 5FJ4A 3FMWA 3ZNUA 1ASUA 4ALZA 1W9HA 1GTHA 3HP9A 1OSCA 4DSEA 1WBDA 2MY8A 2PFUA 2SXLA 4DWIA 1ZA2B 2O1PA 4DV1F 1WSJA 4WK3A 3F5TA 2H4WB 4DBQA 2UUAF 4IJAA 3AA5X 1MNEA 2O3DA 3UB5A 5KFXA 4OKEA 2UUWA 2YKNB 1N32J 3PM9A 3ZX3A 1RE1B 3R8EA 3VQSA 2OHDA 1U2VB 3THXA 4EU0A 5A0YA 4Z94A 4YR2A 4E3SA 2YHBA 2BXJA 2QTWA 3OR2A 2I0XA 1XNRK 4B3MF 2KH9A 2E88A 3CERA 4LSNB 1RXOB 2WBNA 3T6JA 2M7SA 3K57A 2DHGA 4E1JA 4AYBD 1LOTB 3C6TB 3G0ZA 4YN3B 2IIRA 1CSJA 2ZWOA 2FVSA 1RT4B 3UE2A 4MMOA 4E19A 4NPOA 1K6YA 5A2QU 3L3UA 5KT7A 4KBOA 1TVRA 3OJUA 2LXFA 2RILA 2QYCA 2HMPA 1TK0A 4O55A 3DXKA 2DITA 2VICA 1RT5A 3D6HB 4X2BA 1SAZA 4QAGA 2ZJQL 5B08A 3W7BA 3ZTRA 3CM6A 2QXFA 4Y34A 4MK7A 1JJ2M 2WRMA 3P38A 4LF8J 3HFKA 2HHQA 2XSFA 3KOAA 2DNKA 3W1YC 3NFAA 1A5VA 3VQ9A 3QBWA 1WSFA 3C15B 2F8SA 2J7UA 4CGFA 3V9WA 1OVYA 1IJEB 3CM5A 3HKWA 2VODA 1BQMB 3OTEA 2BANA 1NO8A 1RTDA 4KHMA 4R25A 4FWQA 1OH5A 3CC7S 5MLCV 2N3LA 4DR5F 3FRYA 3NDKA 4ZOSA 3KG4A 4BE1A 3HVAA 5BR8F 1NKEA 5I9EB 4ZLJA 4W5OA 1ULRA 3BN4A 1U1PA 5EU7A 3HM9A 2QSFA 2W2MP 1C1BA 2BUNA 1FWPA 2VIHA 3MN5A 1TAUA 3UD5A 2J9EA 4DB3A 4JKBA 4ZP8A 3GWCA 5DMRA 5GIPA 2WAQD 3CCVS 3C14B 2HBJA 3CF5Q 1RLDA 5AQTA 4WK1A 1C1BB 1SIZA 3LWLA 2ZH3A 2MPUA 3W2WB 4YB5A 1TL7A 4EZ9A 3US5A 3O9QA 1M5SA 4GO7X 2DFFA 2IMOA 4HHUA 4YS2A 4EHUA 2E1RA 3JTNA 4EHTA 4LF9J 1I5OB 4JYAF 4GKKK 1N88A 2W8KA 3CJSA 4DCJB 1I94F 1U1RA 2KHCA 4OX9J 3DOMA 4J9OA 4CEBA 2JH3A 3KXDA 1KTVA 3T1YK 3MAAA 1YIJS 4ZVEA 3R6LB 2HHXA 4ZVOB 2Y0BB 3OYMA 3QFHA 4Y2IA 3MMBB 1V3RA 3VA0A 4EO8A 1DFDA 3KK3B 4I6WA 4Q2LA 1CEZA 3THPA 3HJVA 3W5ZA 3KVGA 2P9PA 2BJ8A 4MKBA 4NLRA 4WE1B 3UI3A 2XTJP 3QRQA 2GQQA 2DEIA 2ILYA 3SQOP 2J7WA 1IBKF 1GMVA 3VOVA 4G1QA 3VQBA 3DFEA 4Q43A 2MEWA 3QT7A 4IO9Q 3K17A 3AXMA 5LSOA 2G9OA 2QEXN 2VG5B 2AKWB 4NCAA 4DV5F 5LL6d 4N5SA 3L6QA 3OFFA 3NMRA 4LF7F 3DLEB 4WQ5A 4I1TA 2V52B 1Q8KA 1TL1B 4FJXA 1W26A 4N47A 4CZLA 3UO0A 3O9SA 3ZEUB 4LH5A 1YGYA 5KPZA 2P9EA 1U0SA 2P9LB 2CDQA 3D67A 1L3SA 3AJDA 4BE0A 1AA1B 2W4CA 3BKFA 4IG3A 3CJBA 2FBXA 4FYXB 4FJ9A 4ECYA 4OGEA 1IKVA 2CQPA 3CJKB 5DS7A 2DRDA 2RRBA 1IM4A 3U1NA 4CZEA 2GTDA 2E5LJ 3UVJA 1FD8A 4NA2A 3I5BA 2YWKA 3H2LA 2VG6B 5M1NA 2HHHJ 5HVHA 1K8KA 3FBBA 4WCEL 2VPYB 3OFEA 2ZNYA 1R8CA 1OVQA 4J9RA 4DR2F 5KFKA 4QYRA 1YHQS 4KT0C 3TO8A 1PGZA 3PLAA 4F3OA 1CULA 4L3KA 1UWBB 4DTXA 4DV2F 1OY8A 4DX8H 2R2UA 1RI7A 4DZ6A 2XZWA 3EM1A 4JV5F 2PI4A 4LT6A 2OFHX 3H2UB 1NPRA 2FF6A 1Y5LB 3ZZUA 1BWVA 2G8FA 3HRGA 3VQDA 1YJWN 5AQOA 4L76A 1YIJN 4UZCA 4OO1J 4ETXA 4IRKA 1QAXA 4WTOB 3CWJA 5CCLA 2CPXA 3KK1B 1W7WA 1W97L 4CFDA 1FEEA 4DV4J 5HL7Q 3P5TL 1WSRA 1QLNA 4OI0A 3RVCA 4I0WA 4HT5A 5EXWA 1ZBUA 3MEKA 4OPAA 3PUFA 3DHWC 1HNVB 3PACA 3RYLA 4A2BA 4FWLA 2NCKL 4UQTA 3CQXA 2YJFA 5BYSA 3N0VA 3NS7B 2AZ1A 3C3LA 5KFMA 3P3DA 1K1SA 5EWGA 4DSIA 2W9AA 3WQTA 2CG4A 2OFGX 3TUIC 5BXIA 1SC6A 5ADXA 4BRDA 1YBUA 3O8WA 2RMLA 7FD1A 3VAHA 2ASMA 1V3ZA 3MCAB 2DIUA 3LGMA 1NLKL 3F2KA 4XTTA 1Q53A 3EZOA 4DV7F 3PYFA 4ZK7M 3MEEB 2BUPA 2R2SA 1TKZB 4LRDA 4M5KA 1FO1A 2H3GX 1VLYA 2QWLA 2CYYA 3LP2B 1BWEA 4DL5A 2LEPA 4DUZJ 2HS4A 4IQXA 1X0PA 4I64A 4JI0J 2GV9A 1XC9A 1RT7A 4K41A 3UW1A 1XERA 3FZHA 1XMOK 3JSBA 1Q82T 2Q97A 2RJZA 3VQAA 2LQ5A 3QSYB 4GVBB 4CHZA 1F9FA 1VHFA 4TXSA 4CESA 2EPIA 5F8HA 3LDNA 2IY5B 3KLGA 4DR3J 4YHHJ 4ZVRB 3AA4A 1YXQA 3MX2A 3CCWA 3WZ0A 3NH2A 2JHEA 1VRTB 1JJHA 1P9QC 1UZDA 2UXCJ 2ZOGA 4B9SA 2AX1A 2HGNA 1V3SA 2E1ZA 1YJNS 2HG4A 1YTYA 2PO4A 3WXJA 5LXYA 3K5PA 5AZJA 5HLFA 3CD6S 4ECVA 5C2FA 3FFIB 1D8YA 1Q81T 2KYXA 4ELTA 3H6EA 2OZMA 4CO4A 2HVEA 3T6BA 4C3MA 3O9TA 4BRMA 1NWKA 2KQ2A 3AGKA 3BGRA 4ZVFA 1S0MA 5L39A 2X1BA 2QN6B 3PVXA 3IG1B 3LDLA 3KLHB 4IDHA 1FKOB 4DG1A 4RNMA 3V6JA 2NYIA 3D1OA 3MF5A 4YR3A 2B51A 4KAIA 3ILLA 4KH5A 3MMCB 2DNZA 3M8QB 3EDRB 4X4NA 2D3ZA 4A8YA 1TMMA 3W9JA 2HBRB 4QQBA 1SC1B 1IJFB 2P51A 4U95A 1T8EA 5LJVA 5H9FK 1ZAXA 5A8KA 4J9PA 1OSDA 3TYTA 3AVFA 4WTYA 4JI2J 3TAEA 1R89A 2LQBA 4CFBA 1MROA 4QW9A 4RNFA 2K1RB 4WFBQ 4OFZA 4RBTA 4J2DA 2BQ3A 3S3OA 2ROPA 3EL2A 4B9QA 2AYGA 1P1TA 1WF2A 3IRXB 5U47A 4H5RA 3AJ2A 3I8BA 2ASJA 4DSJA 3H0PA 1FKPA 5GADI 2ABYA 4O3PA 1JMTA 3HSGA 3CVKA 2JFKA 1NXIA 3C0BA 1NH7A 4C0HA 4CIEA 1EZZB 1J9AA 3PJWA 5KFDA 5KPRA 4YUDA 5KFNA 1Q78A 4ZMMA 3BUZB 4PEOA 2CJBA 2OYQA 2B7CB 3G71N 1HNWF 3CD0A 1TUUA 1WUUA 1U0HB 4KC5A 2RU9A 1BWFO 1RHQB 3PR5B 3W60A 5L38A 1TELA 4NLBA 4CLSA 3I33A 3CCEN 1YJNN 1UFKA 3G9CA 1U6ZA 4IFYA 1KQGB 2RN2A 1RAJA 3SQ2A 2OEMA 2D9PA 3B82A 4HR2A 2VD3A 3TTFA 4BRLA 2MZSA 3SCLE 3U3YA 2RB7A 3M2VA 2QWQA 4DR7J 5FDLB 4MDBA 1XR5A 2Q31A 4ILJA 1WORA 2W9BB 4KHPK 2MSTA 4H5NA 2VQEF 3DLLQ 3M2VB 2RDIA 4I68A 4KH6A 5KG5A 3R5GA 3POTB 4EYHB 3CCJN 3W0LA 4FJ5A 3KLIA 1CQMA 3MMAA 2OPQB 2RF2A 1VQ9N 4UOCA 3PJXA 4ID1A 2FHJD 3HDSA 4DL4A 5AQLA 4B3RK 5IZHA 4K42A 1NJZA 3HFZB 4MKYA 1BI4A 4RBUA 1VSHA 2IJNA 3W65A 4RW9B 2W4DA 1Q8BA 3ZZPA 1NGAA 3EDQB 2ZVIA 1XWLA 2C1EB 1M1KO 1FESA 4F9OA 3PO4A 1S6PA 4I6MB 3OL6A 1OMSA 5JVGL 1SI9A 1KP6A 2BMBA 3ZFVA 1ZETA 2M0GB 1NHVA 4NXNK 2GWKA 4XPEA 2R7WA 3CQYA 1UVLA 3QYYA 4H03B 1N6QA 3CJ4A 3D6TB 4CQ1A 4DL6A 1SJ4P 4JI8K 1Y0HA 5D0HA 3V1QA 1YX2A 4FJLA 3HSJA 1RHKB 2CWXA 1NB2A 4JHDA 2XNRA 1TAQA 4S0MA 3ZSWA 4A5BA 3OPKA 3THYA 5F41A 3RR8A 4BG8A 2DRAA 2DJWA 2G4BA 3BBCA 4R0JA 4B8CA 4RJVA 4OV1A 1N56A 4RW4B 2NRWA 2RVJA 4CJ3A 4KHSA 4WFNQ 2HHWA 2I6WA 4M7XA 2MTLA 3UDVA 5KG0A 3OHBA 2Q1NA 3K7RA 1RGVA 2IDEA 3JTOA 4CIOA 2HK2A 2DPJA 4K59A 4I67A 3RTVA 1VSKA 4KREA 2DGUA 3TTCA 1IVZA 3RSEA 5LT5A 1QTNB 2RU3A 1WEYA 3VESA 1FCAA 3H8YA 2QTDA 3AOAA 4NLCA 1UJ6A 3VA3A 2G8WA 1KD1T 3VGUA 4B9MA 1TU0B 2L3MA 2DHSA 2OTJN 3SAFA 1X1PA 2G0JA 2ETJA 1EETA 1IR2A 1GXUA 3TSQA 4KJIA 4HTLA 1DQ9A 3GSDA 2BOPA 4MYUA 3LH2S 3MD1A 4WQ4A 2CQ3A 2LSNA 4JI4J 2JLGA 1LWCA 5G0RB 3I9ZA 1HYSA 4DMNA 3EUNA 1YDLA 1LWEA 2QE5A 4KBIA 3AA9A 1R8BA 4I69A 4W98A 1ICEB 4DV1J 3CJTA 1GLDG 3K0SA 3M30B 4O4GA 1K73O 5CAAA 2UUAJ 4B3SK 5BRDA 3P4UB 1FDAA 4K4VA 4RW8A 3J7YU 2V7YA 4P7TA 2IRYA 3ET6B 4CRJA 2DXEA 1J54A 1A0OB 1RTHB 3GJTB 1PBAA 3T7ZA 3UFCX 3WEEA 1OIAA 1HJRA 4B3MJ 1SC3B 3D2WA 1NM2A 4FM2A 2OH2A 3E66A 4Y2AA 2HZVA 1HQEA 2AJ2A 4R5PB 1G3OA 5FRNA 2AX0A 1ZS6A 3VR1A 3UIQA 3CW2C 2B9EA 1HR0F 1T6DA 3QB0A 5F0XA 3E01A 1G99A 1N5SA 4JI1K 4LRFA 4A8KA 4KY3A 4GW6A 2ZKTA 1TV6B 4EZ6A 4DUTA 1FA0A 4OZNA 5GAGI 1TL4A 2MKYA 1FRKA 3QINA 3W8PA 4IKAA 1HARA 5IM0B 4WKRA 3KLFB 4NB4A 2JJ4D 4F67A 4LD0A 2LU1A 5IQQA 4CH1A 3SEOA 1G2EA 2IS3A 3UD4P 4HUGA 1RISA 1RWKB 4PWUA 1RT6A 2E2OA 4KH4A 5A2QO 1UA0A 2FC8A 4OHYA 4BGBA 4C98A 4HKQA 3VGKA 2R8GA 4DR5J 4AHVA 4MFBA 1Q8IA 4JV2A 4RWXA 5IC4B 4KTWA 4OLAA 5CYMB 4CJSA 3AV9A 5KFFA 1RYSA 1VQMS 3G2XA 3O8MA 2F4VF 4QIEA 2VJVA 2VL1A 3OW2M 3ITHA 3EJMA 2V2KA 4WFZA 3EEQA 1HPMA 1SL0A 3ZZTA 4Q7AA 4B1XB 1JLAA 4HDGA 3OBWA 2P9CA 2XMMA 1PJ7A 3ENVA 3C7NA 4JRQA 2DR5A 5TKYA 5AQVA 4KH0B 2DH8A 2ZC4A 1C0MA 3O3GA 1IKWA 4JN4A 1NG9A 2CWKA 3DJCA 4JKCA 1KD1O 2APOA 1VQNN 2C2ZB 1N5VA 2WVDA 2JOQA 2XMAA 3QEIA 4F4XA 1HNXJ 3KUHA 2P9GA 4YDUC 4JYAJ 3MDQA 1K0TA 4JI3F 5AQIA 1I94J 2F8EX 3AY0A 3M6WA 4HI2A 4FS1A 3RW6A 3U7JA 2NS1B 3SFGA 1R7IA 5CQGA 4ISFA 3HSTB 2PY5A 5CZ1A 1RBLA 4NLSA 3D2FA 3Q8QB 2ZH5A 1TKTA 4E89A 4CGGA 4CLWA 1H73A 4LF1A 1WAFA 3H46O 3SSSA 1U04A 4FJNA 3BF1A 1G1XA 3AO1A 4H0OA 1DJ0A 1ZM4A 3EXYA 4OYWA 3LDQA 3SCIE 5KPTA 3OBIA 3D2FB 1B3TA 1WI6A 2DHXA 2XGQA 1A5XA 1JLCB 1X4CA 5LMUK 1IBKJ 5DM6L 3M2RA 1O6XA 2BABA 4OYPA 3W9IA 2ZJRL 3QRRA 5BPLA 2MKSA 1X3NA 5AJ3F 4M5LA 4EBEA 1FERA 4LF7J 4DV3F 4LIRA 2IVNA 3FEZA 3QT8A 1Q5VA 1S97A 2MKCA 1SJ3P 5E0OA 4BY9C 2E1YA 2Y9HA 3K5LA 4DTRA 5K20B 1GLAG 5E3AA 2ZM6F 5AFUA 1YJTA 2G8IA 1ZPVA 4OI6A 2YNFB 1HHSA 3CJ3A 2Q36A 1ATSA 1NMEB 5B0FA 1C0UB 1UFWA 4KO0A 1BHLA 2EFPA 2GCFA 1KVBA 2MSSA 5T7LB 2O5DA 1IKXB 2X7IA 3V81A 4ICLB 1LXNA 1SKUB 3BB5A 1JXLA 1RFQA 2W2NP 1LV5A 4G3IA 4DR2J 1N5QA 3DXMB 4USVA 3VQ7A 2O8EA 3FBCA 2FVRA 1TYQB 3D0IE 5ETNA 4FLWA 2G8KA 4DV2J 1FRHA 2CG8A 5IV3A 4NXMF 3OT9A 5L9NA 4JV5J 2ZD1A 3H3OB 2P5VA 4M5IA 4LF4K 1A5WA 4RW6B 4ISGA 1T9UA 2OZSA 2YNHA 4RLEA 3AO3A 2WVBA 3OYBA 1S1WB 1BIUA 1Z6RA 3U02A 1F60B 4KHQA 1QUVA 2XYGB 3VEYA 4FOEA 2H3EB 4UZBA 3LGHA 1WHVA 1QAYA 4DTNA 4LREA 3ZETB 3OVNA 3R7NB 5J2PB 2WVEA 3SDEA 4KHYA 4P2FA 4I2QA 2YNHB 1KKHA 2CKWA 4FSVA 1HI0P 4ES3A 5M1OA 3QQCD 4NMXA 1Z2ZA 3FLCO 3EE9A 3HOSA 4AD6A 4XH1A 3GJQB 3BDPA 4AUKA 2BJ1A 5TKWA 4ZLPA 3KLEA 3VVUA 5F8MA 4LQ9A 3VQCA 3BY5A 2VC1A 1IWGA 1YZ7A 1WB9A 1ATRA 2HLTA 2NXEA 2P9NA 2W42A 2XNQA 5GAHU 4IOCL 5C5JA 2OD6A 5KGWA 3PRBA 2W24A 2IC3A 2YHYA 2PDAA 4KIAA 4ZN1A 4ZCIA 3TJAA 1QSSA 4GV3A 4QOTA 1HYVA 4KFBB 2GIRA 4C0BA 3Q8VA 5IT0A 4K0KK 3MK6A 3JSYA 4A5AA 2MJUA 5AXNA 4DV7J 1FDDA 8RUCA 3K2YA 5LSLA 4HACA 2V0NA 4M3ZA 3B6BA 1DTQA 1BQXA 5J1NA 3VALA 5HI7A 4IH6A 4O3OA 1S6QA 1F3FA 2DY4A 3R6MA 3CDUA 2LA6A 1U45A 2EVZA 1ILYA 4X4QA 1VK0A 4FF2A 1RWOB 1P6TA 1KSPA 3J8AA 2PZSA 2XQCA 4HACB 2ZGYA 1TZ0A 4BWJA 4FZYA 5CY4A 4NLGA 1VAZA 2G2ZA 4XO0A 1F1BB 3C2PA 4GKKF 2YHWA 3MM9B 5J2QB 4NA1A 3J7AN 1ESVA 1UPPA 1R8HA 3CUNA 1SZ2A 3E51A 1GH8A 4H4KC 1RCXB 3EVOA 3T1YF 3PFOA 4FXDA 3RB3A 2P9UB 4ZP9A 1HQ2A 2IRXA 2AW0A 1NHUA 3PJ9A 4FLZA 2R8HA 3PHTA 4Y2KA 3I8DA 1NMDA 4GC6A 4YDDB 1VSDA 4NE9C 2WONB 4IDKA 1PYSB 2CDRB 3FCHA 1NGJA 5KFGA 2C2MB 4DCPB 2A2DA 3Q8PB 4HHTA 3MM8B 4M5HA 4IG0A 2ZWPA 4JI5F 3QFWA 1BA0A 4BE2A 4PYAA 4DS5A 1HWUA 2HB5A 5IWAJ 1VQ6S 4RTFD 4CLTA 3O4QA 2O66A 3TVZA 4CIGA 3HJFA 3BBFA 3NRBA 2GQ2A 3IO1A 3G4SN 2ZJPQ 4ED4A 2KVIA 2MQNA 4CJPA 4FLUA 1H6KX 4IQMA 5LSRA 1WBBA 4Q5VA 2NZCA 4OZ1A 5HQMA 4BRGA 3LPUA 3A8YA 3A5NC 5AQZA 1XN9A 4NZ7A 5KFRA 5BREA 2ALZA 3KWGA 4HHJA 3SIPB 4BCAA 1PCAA 1WSIA 3TVKA 1W25A 5LOQA 2UXBK 3O44A 3DLHA 4NLQA 3AO5A 3D7EO 2KXFA 3UKRB 1XI1A 3KMSA 3Q89A 2JC0A 3VGSA 1D0EA 4ID5B 4RO0A 4F4YA 3QLHB 1OWXA 2WK4A 1WDTA 4JK7A 5I3PA 1S1TB 1KQFB 2H5IB 1JLBA 3CCQS 2HZCA 2IM0A 1RQ0A 3R2CJ 1Q8LA 4FLXA 4CGJA 3DLBA 2GV1A 1S10A 1JXEA 1EWRA 4G6VB 3U1LA 1HMVA 4K8ZA 1FNMA 4O3QA 3W3DA 1NKCA 1CC7A 2KL8A 3M6GA 2JLEA 2HK3A 3T9NA 3CC2N 1S9GA 2I7PA 2J9DE 2CAJA 4JKAA 3SMZA 3O3HA 4HUFA 4ZP6A 4LUBA 2HGLA 1HNWJ 3OYHA 1X4GA 2HS0A 4P52A 1JCGA 3JSMB 2V8DA 3NHGA 2VFRA 1QTMA 3QFPA 4FJIA 2JWNA 1X5TA 2WSFC 2MLYA 4D3GA 4DSLA 2F8MA 4X62F 3KHRA 4F04B 2EI5A 4OPKA 3KHGA 1HD0A 3SK3A 3BGOP 2AJ4A 1URNA 2E5HA 3CDAA 3CC4N 1RHUB 3VHQA 3H25A 3CULA 3VQ4A 3V1OA 4OJ3A 2P9IA 3ZX0A 5KFBA 4TNOA 1HRHA 3KMQA 4GC7A 1HBMB 1TUWA 2QLXA 8ATCB 1JCEA 4QW8A 4IR1A 1EKEA 2YKPA 1YVUA 2QKBA 3FDSA 1EX8A 3C6HA 3FQKA 2P9IB 5C25B 3RR7A 2VQEJ 3PW5A 4WP9A 1T94A 4GMKA 4UQGA 1NK8A 1KAXA 1TL5A 4X4PA 3OVBA 5AQMA 1O0PA 3Q23A 4FZXC 3HVTA 4WXOA 4CO0A 1X5SA 5J2MA 4JV1A 2IFXA 3VAMA 4CFAA 3SMSA 1NU0A 1N33K 1GXTA 2NRVA 4U67L 3R6GB 3QSIA 1PBUA 3ZSYA 1EP4B 3HHLD 3PRVA 3NE6A 5IT9Y 4Y0FA 4NL5A 1LWFB 4P10A 1K0VA 3P45B 1GNKA 4DR6F 4LR8A 5ITHA 2XRIA 3QAUA 3G87A 3ETOA 3J7YP 4JI6K 2W4PA 4C8MA 2LXUA 1WC5A 4GNIA 3O5BA 5C42A 2IJRA 1FJGF 1T3VA 2VWJA 4HWIA 2PE8A 3GV7B 5IT9U 1ZTTA 4LF6K 3L4QA 1N0VC 4X64K 1TKXB 3D7SB 3OLBA 5LXRA 4IUFA 1REVA 2W1BA 4PR6A 2KFNA 4H5TA 4DPTA 7FDRA 1NGCA 2BKOA 4N76A 4CEFA 4BACA 2POKA 3QO9B 1RZMA 5H1SV 3NLCA 5JVGQ 2N4DA 4BQZA 1VHIA 4C8OA 2Y8WA 1RWVB 3VAKA 3ZZZA 3PSFA 5ETOA 2HZAA 3IBWA 1WNEA 3I96A 1HWIA 5KQDA 4DF4A 2W2OP 4FJ7A 3AVKA 4I56A 4FYYB 1VI7A 4FJGA 2VBWA 2UU9K 4ED2A 3FZFA 2DGXA 3OTOK 4ZDNA 1RHRB 3HI9A 2ZZMA 3FRZA 2NR0A 5A8WB 3V6KA 2G1HA 2E44A 1YJ9N 1C0TA 5ADZA 4IEIA 4J2AA 2HVIA 5FPNA 5K14B 2NRRA 4LF5K 4UUXA 4RNHA 2J4RA 4CT9A 4USMA 1WKJA 3LP3A 4AHTA 3M6XA 2DIVA 2K7KA 3CPEA 1IN0A 4WU2A 3TEGA 1X5PA 3GYXB 3MR5A 1RDAA 2JFDA 2ZH1A 1U1NA 1YAGA 5CD4A 1Q7LB 4K4ZA 3ZYYX 1Q5YA 5HO4A 1QHTA 3RAQA 3ZTQA 1HR0J 2NUBA 1CJTA 3CG7A 1KN6A 2YKMA 5ETSA 3LTOA 3DOKB 4M7YA 1B4SA 1XMBA 2RSQA 1SV5B 4NASA 4DPXA 1ZM9A 4J9VA 3O1BA 2C2RA 2J0XA 2M9KA 4WZQA 2Z8QA 4C8LA 2QG9B 1RB0A 2H9ZA 2XO6A 1U2FA 1FK9A 2YNIB 4M5NA 5SWMA 5LM7E 3UQSA 2O8BB 2MZQA 3ISNC 1C4AA 2AP1A 4EFHA 2YV0X 5DM7L 1AB8A 3IWXA 2MDAA 1LOUA 4YOTA 3WXLA 3CNQP 3VTIA 1X7VA 4CGDA 4J91A 4OZLA 4OZJA 2P9SA 3SQGA 2JLFA 2P6SA 2B4UA 3M8PA 3HHNB 1TL3B 2PAVA 2F4VJ 5F8LA 1DZ5A 4GKJK 4B3RF 4KPYA 1K8AO 1VQ5S 2V63A 3Q83A 4DU4A 4PQUA 4B9NA 1OH8A 2NXUA 3S1TA 3MM5A 4NZ6A 2BEFA 2QSWA 3QGIA 3AVCA 4WFAQ 2XCPA 1IR1A 4CD3A 2A2CA 2HURA 3OR1A 4B3TK 4Q2MA 3AAWB 1WHXA 3ID8A 3HHDA 4NXNF 4U9RA 1WD6A 1U8SA 4PG8A 1RT1A 5KG2A 2WHOA 5ETKA 4AM6A 2A6AA 4JI8F 4KGKA 3TI0A 3MXJA 1D5AA 3RAMA 2PD1A 2N7CA 1B0TA 4MDAA 6FD1A 3VF0B 1H7WA 4JI3J 2F63A 3A8KA 4LFAK 2DCUB 4HVZA 4BROA 1Z1ZA 4H4MA 5B09A 3UD3P 4USWA 2RKIA 1F3VA 4CFCA 2H4YB 4PPZA 2PYJA 5ETTA 3NAEA 2QYGA 3SBTA 1YSJA 5CYQB 2BR0A 2EFOA 4Y65A 2HNYA 2R8IA 3CJ5A 1VQ4S 1KHVA 3DLGB 1UVJA 3U6FA 4CF1A 2IMWP 1NK7A 2ZQBA 1WG1A 4O44A 7AT1B 3IMQJ 5EWFA 2HMIB 1G4CA 3P49B 2Y8YA 2W41A 1X9MA 3E1YA 3B4MA 1VGYA 2QFIA 1ZC6A 3LWMA 5L46A 1VC0A 4LRCA 2IVOA 1MWKA 1NZAA 2LMIA 3J81Y 1T3NA 3JTPA 1L3VA 2O4IA 5AJ3J 4DV3J 1N32F 4KV8B 3LP0A 1JK9B 1U1KA 1NOZA 3GU0A 3LAKA 1S57A 1XR7A 2OI2A 2C3YA 5GAHP 4LSLB 2F9TA 4HTIA 4B1UB 3DRSA 5AQXA 1HKGA 1R3NA 2NYHA 2PT0A 3FZKA 1VQLN 3EICA 1FX2A 2H51B 1HA1A 4TU8A 3A3OB 2EXUA 3M2UA 3JQKA 1MWZA 4IOXA 5L8RC 3AT1B 4IYQA 3GG1A 2O8DA 3FBEA 1XHZA 1DQAA 3BPDA 5DLGA 4CZFA 3EX7B 4CZKA 4L72B 1U1MA 4CVNE 1YJVA 2GGPB 1N8RT 3MOZA 3PV8A 2R7TA 4K4SA 5CZVA 4CEAA 3C95A 3DLKA 4NXMJ 2VPWB 1MU2A 5FLXU 2IM3A 3W5YA 1F9EB 4WWSA 5EX0A 1S0OA 2BBEA 2CQGA 5EX5A 2GUIA 3MN7A 4J9UE 1RBUA 2EG2A 1X3MA 2KFYA 3CPWR 3BDEA 4JKFA 3KK2A 2QFJA 3AD9C 4PKGA 1E6VA 1S0VA 4AH9A 4FZZA 1RBOB 4MIBA 4MK8A 1JL1A 3OYJA 4BR7A 4YB7A 4Y0WA 2IVFB 4QIWD 4B9UA 3J7A1 4BR0A 2Z1GA 1Y97A 3O6WA 1VSIA 4PWWA 1IQTA 1G15A 4JP8A 4ECSA 4TSXA 3NVKA 3L9ZA 4L8RB 4GV6A 4LF9K 4OX8A 1WHYA 2BH1A 4OZ5A 4V19X 4FCYA 2GVZA 2RRAA 2JNJA 1U26A 3PFEA 5KFCA 2CA9A 2K2PA 4CHQA 1PO6A 4I2PB 1QY7A 1T9TA 2VFTA 1ZOTA 3NGZA 2D5RA 4O23A 3R2DJ 3CCRS 4O4RA 4GV9A 3IAM9 3MAQA 3CD5A 4FK2A 2ZHAA 4CJLA 5KG7A 1URRA 3IS9B 1M0SA 1MMDA 1BY9A 2CIMA 4Z2XA 1DTTA 4OX9F 3LALA 4OYOA 2Z1JA 4K8XA 3ENQA 4ILMA 1S9EB 3P1GA 2CQBA 2IIHA 3P39A 5ETPA 4ID8A 1DTTB 1VISA 3QERA 2QT7A 3Q86A 5C2DA 3HLUA 3SYZA 4DFJA 4U6PA 2UVUA 1Y00A 2OANA 2IDLA 2ACMA 4WQ5C 1KONA 1TP7A 2C28A 1S49A 4CD1A 2E66A 4GKKJ 2UUBF 5KOXA 1S1XA 3QDKA 5LJ3Y 2MB0B 3A0IX 4HLBA 3M1VA 4USTA 4OPHA 1NCLA 1VQ7S 3T1YJ 4M95A 5GADU 4O0JA 4JUZA 1AFIA 4AF1A 2DH7A 2CQ1A 2DY9A 5F8IA 1AZSA 2YH0A 3QIDA 1AROP 2HQDA 4NYNA 3NOCA 4K5RA 4JI5J 4UOFA 3M9NB 1ZBFA 1CZAN 1WOQA 1RHMB 4NLVA 3LDOA 1ELOA 3VTHA 2ZE2B 3GIIA 4IRCA 4NI2A 2FTRA 3PIOQ 2QA4N 1S7IA 1SH0A 3DWLA 4FLVA 3IN5A 5C0YA 4OQJA 1VQON 3U3GA 1RAEB 2HWHA 3WXIA 2AHOB 3D5MA 5A8RB 2BM1A 3HXMA 1YJUA 4M45A 2IYIA 4URQU 1JQGA 3TSUA 2HNZA 1YRXA 4ER8A 2YNGA 5HROA 1V5VA 4J9KA 3AO4A 1RCOB 1HBUA 2N4CA 2AIRB 3AOCA 1Y3KA 8AT1B 2JVRA 1JLFB 4C11A 3MECB 2FBTA 4ZLNA 2U2FA 3RBEA 1CLFA 4B02A 1F6TA 5AQYA 1BISA 1HKCA 2K3IA 5HROB 3H08A 3AD7C 5KG4A 3ZSVA 3BP8A 1SUQA 4ZCLA 2E7VA 3GFYA 2EKYA 5IFMA 1BQNB 3KJFB 2RRNA 3HKZD 4FM1A 4A8XA 1D9FA 3RBDA 1NPKA 4CLKA 1RP5A 4FYDA 1RABB 1TGOA 4RUHA 1N54B 2FLLA 3MPDA 3I55S 3WNHA 1BD6A 1IUJA 5JVHL 1CXUA 2R9LA 2LP4A 3AOBA 2EC0A 5B0EA 2XG8A 4KI6A 3VQPA 2CQ4A 4IOBA 4PYDA 1MW7A 2CQCA 2QWPA 4DKWA 2GUPA 4DSFA 1UKUA 3UR3C 4P7VA 4IJNA 1VQ7N 2A1BA 2ADBA 2OMOA 3IAS9 3FMBA 3CJ8A 3QIPA 2CJXB 3QGGA 3UPFA 3VQTA 1S1UB 2BE7D 4X62J 3L7PA 1DLOB 1NDLA 2V94A 4K2XA 4DUZK 2MJNA 1HBOB 3G8TA 5EY4A 2GO9A 3KJQB 3R3LA 4FKXA 5FROA 2HS3A 4DR1K 4PWDA 3TRGA 1HWJA 3MUMP 3IR5B 1ZTWA 4M5DB 1EQMA 3NCQA 5A6PA 2KKZA 3NGYA 5HAOA 2D1CA 1VJQA 3L7OA 1CJVB 4ILHA 4CEQA 5D77A 1RT3B 2JVOA 3MOJB 4GO5X 3NNHA 2F1FA 4YHHK 1TFWA 2ZH7A 3DI6B 1P8ZA 2UP1A 4JKGB 4FNHA 2X78A 1Q9XA 2R8JA 2GHPA 3EPIA 1FTCA 2HWIA 2K8GA 3VEVA 4K0KF 4G1PA 2BKNA 4RWTA 4F8RA 3VF6A 4CJQA 2VOOA 1NRKA 2DK2A 3JAMO 4J2EA 4MKAA 4KPCA 3PKYA 3T5HA 5GINA 2M3DA 4DR3F 2BM0A 1JXBA 1K47A 1T02A 3NNCA 4AQYF 2DHAA 2XYPB 2IAJA 3CT9A 1NGEA 3BF4A 2E1MC 3EZWA 2OPSB 2ZBIA 4OJHA 3R9PA 3QEWA 2J9CA 2ZOFA 5CA5A 1RBSA 4OLBA 2DPIA 1QHAA 1VQPS 1XQIA 1HFEL 1HNIA 5HBMB 3TAMB 4OJGA 2MKKA 2O8CB 1Y9OA 2RQMA 2PC6A 3NNAA 1KXPA 3AJ1A 1JLQA 3QRPA 3CMQA 3KTQA 4DFPA 4DN9A 3UDEA 3OYIA 3G86A 1CJUB 3AH6A 2WFBA 3UDCA 4EBDA 3KHYA 1FJGJ 3L8BA 2ZNZA 3CJ0A 5KT2A 1BOTO 4LVOP 3BZCA 2GVDB 2QK9A 4TQSA 3MFIA 3G8SA 1R6VA 4R8UB 2RH3A 3ZZYA 3KJVA 3AGRA 4JI2K 1RNHA 4O8KA 3GCWP 2G8HA 2V67A 4NLUA 2RDJA 4Y2CA 5BYQA 3S6EA 4RWWA 1SPBP 4XPCA 4WIIA 3OYEA 4YOXA 4BR9A 4FK4A 5GAGU 2WB1D 3EXCX 3OHAA 3IFEA 4FVUA 2XMTA 1RAFB 4TY8A 3FQLA 3C19A 1R8PA 4A8FA 3NBPB 3LZJA 1F2GA 4FWOA 3V4IA 1TMJA 3OYGA 1DARA 4ZPVR 3W66A 3OUYA 4FW2A 1LEOA 3PIPL 2F65A 2FJDB 4ZPTR 2UXBF 5DDQC 4NLTA 4KHWA 5KRTA 1FKAF 4IRDA 3THVA 3M8WA 3RG6A 3FSXA 4CYUB 3JB9k 3V4IB 3TSPA 4H5WA 2HBLA 1RTJB 3G82A 1X5OA 2IM2A 3BQ0A 4PHTX 1Q86O 1OJ4A 3R3TA 4DUYK 2I5JB 2B5JB 1QSLA 2CPZA 2D3OR 3L4IA 3JAMY 2LU2A 2ADCA 4QOZB 3N79A 1Q7YO 2YWWA 5KFZA 3FVYA 1RDWX 2G8VA 2FPHX 3O1WA 4DV6F 4PKDB 5BJRA 2LQ8A 3DM2B 5AQQA 4KTZA 3MR7A 2LKZA 2MGZA 2YPZA 1HKAA 3WQPA 3MFHA 3EGVA 3HHLA 4G9ZA 3OYKA 2C2DA 3SV4A 2CNLB 3ILIA 3I56S 2DGWA 4BC3A 3VV2B 3AHPA 3HX9A 1JNZB 3QZ8A 1SKSA 3FEYB 1JLEA 2CGKA 4HUEA 1WC4A 3SPYA 3R1XA 3SUQA 2ZWHA 4YQWA 4I7FA 4M3RA 4C8ZA 4QS7A 5AXLA 1U1OA 1FJEB 4CLUA 2DKOB 1JNRB 5KFJA 2F9WA 3V6DB 4DL7A 1E6YB 3UE5A 4ZN3A 4OJ1A 1JLEB 3VERA 2CNNB 1CS4A 2UUCF 4H0XB 3HO1A 5ETMA 3J80U 4CE9A 3ILOA 4FPRA 3MM7A 5HP1A 5L1JA 3OYDA 3ZZRA 1IG9A 3CPWM 4NCGB 1HBNA 1M5HA 3HULA 2QA2A 3TR5A 1SVDA 2E9TA 4A59A 1VQYA 2WVFA 4KRWA 2Q0RA 3O6QA 2D1KA 3NKYA 4ECTA 1C0FA 1DY3A 3GP9A 2HIYA 4NLXA 3BGLA 2DFHA 4W5NA 2Y1JA 2VG7B 4CGIA 2CJAA 1CJKA 4OPJA 3GE9A 3PX0A 5D3GA 1N34F 3S3MA 5AZIA 4B3RJ 2DGOA 1RAGB 1NJIO 4K4YA 3T1HK 2B6AA 3JYTA 3UKUB 2HFNA 2ATQA 1KQSR 2UXDK 1H2TZ 2GELA 3F44A 3HPHA 2MQQA 2G2OA 1NJWA 2DNQA 4NXNJ 1M5OC 2V8HA 2EW9A 5CH7B 4CZCA 2KHDA 3PSIA 4JI8J 3THWA 4TU7A 2W6KA 5KFAA 1P27B 4ECRA 1Y10A 4JI6F 1RT2B 5BPNA 3A1YG 2G13A 3GOIA 4DX7A 5AQHA 4I4BA 4WQ4C 1VIXA 4PZVA 3WHIA 3D1HA 4CLZA 4JI4K 3FZLA 5KT6A 3OLAA 4OL8A 1VJWA 3QIOA 1HQUB 3MD3A 4LF6F 4B9VA 1ACMB 1V5IB 4X64F 2XYHB 2ZH9A 4EMDA 1LW2B 1T11A 2JRSA 3IM9A 3SNNA 3UN2A 2YKQA 4F3TA 5L1IA 4USIA 1FVQA 4FJHA 1B7FA 4R79A 3D2EB 5AE2A 3OY9A 4FN5A 4CF0A 3CETA 3IUCA 5KFVA 2GEMA 2YKNA 2OSQA 4MIWA 2P5GA 4B9TA 3P31A 3HT0A 2PIIA 5DDPC 2HSEB 3RB0A 3TAGA 5KTQA 1U2VA 3G6EN 3L0QA 3QNOA 2EFVA 2VGMA 4GVLA 2V4JB 4LSNA 2DGQA 4HTJA 1B0PA 5E84A 1GMUA 4QYZJ 4ATNA 3C6TA 3MR3A 3AQOA 1SXLA 1RLCL 2PFFB 1RT4A 4OYIA 3GR0A 4OZ0A 2UU9F 2HRTA 4ZLLA 4F4AA 2KHOA 3KNGA 2DRBA 2B43A 3TZXA 2NLXA 4JB8B 3M7VA 2Q3SA 1UAXA 1RU1A 3NGUA 1EWQA 5DO2A 5E3QA 3TZYA 4X65K 2HBQB 4LF5F 4OX7A 2F40A 3EO3A 4OHZA 4BBYA 2EC2A 4M3TA 3ELHA