1S1WA

Crystal structure of v106a mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 140
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1wA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1wA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1wA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1wA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s1wA05
2E6LA 4M3XA 1RCHA 5L9XA 3L3VA 4JV1A 2HHXA 4CIEA 1DTQB 1LWCB 4IRKA 3VQSA 4OLAA 2VWJA 3V9WA 1JXLA 4AHCA 2QV6A 1DTQA 1LWCA 3LZIA 3SQ1A 1D9DA 1L3TA 1S9GB 5L1LA 4OKJA 4Y1CA 2OA8A 1S9GA 4QCLA 4M3WA 3NGIA 5F8HA 3PV8A 2Z1HA 4YFUA 1TK8A 4RNMA 1U48A 2KZMA 4BE2A 3EY1A 4KKOB 4DFJA 3NKYA 2HW3A 4KKOA 4ED1A 4IDKB 4CHOA 2R8GA 3O4QA 2RDJA 3OL8A 3IAYA 2R2TA 2HVIA 4NYFA 4IDKA 3VN5A 2HAIA 3D45A 2G8WA 2BRKA 1B92A 3SPZA 1D5AA 4DF8A 3EYZA 2IM1A 3GIKA 1HRHA 2KFZA 4RNHA 1B9DA 1C2PA 3RBDA 1S1TB 3KIOA 4W5QA 3V9SA 3SI8A 1WN7A 1TVRB 4AHVA 1S1TA 4HUEA 1J5OB 3KLHB 4O0IA 3CYMA 1ZBHA 1TVRA 4AHUA 4DFKA 1J5OA 3KLHA 3MFIA 1RBTA 4NYZA 3L3UA 5DG7A 5J2QB 4ZPCA 4HCBA 1MU2B 4KHSA 2PZSA 5J2QA 3IG1B 3HSTB 4DU1A 3FRZA 4M3RA 3THVA 1NOYA 1MU2A 3HPGA 3IG1A 3U3GA 4KHWA 1TAUA 4NCGB 4FJGA 1ITGA 4K4WA 4WE1B 4NCGA 1W9HA 4RW9B 4N41A 4XPCA 2Y1IA 2J6SA 2FVRA 4WE1A 4YP3A 3QEXA 4RW9A 2AQ4A 2A1RA 3RMDA 1JLQB 4AHTA 5KFBA 4ZPAA 2P1JA 4F2RA 4NLGA 4KI4A 1JLQA 3KLGB 4CEEA 4CGHA 4FJKA 2WHOA 1JLFB 4EZ6A 3SQ2A 1Q9YA 1WSFA 3KLGA 3AA2A 1TKDA 5KFMA 2JC1A 4B3OB 4KHQA 1JLFA 4CJSA 1N5YB 4DTOA 1WLJA 4B3OA 3AO1A 1HMVB 4FS1A 2XY7A 4C8OA 3OSNA 1N5YA 1O1WA 1HMVA 4CE9A 4IQXA 2HHUA 4ED0A 2XO7A 1VK0A 4URGA 1TV6B 4KB1A 3AVKA 3HK2A 4FXDA 4OPKA 1TV6A 3PW2A 2QKKA 3HJFA 5DG8A 4ZVGA 2NUBA 3AVJA 1QS4A 5KFUA 5CZ1A 1XR6A 4JRPA 3VQDA 4CF0A 1S9FA 3NMAA 3NF6A 3UR0A 4J9MA 1CXQA 4DL4A 4KB7A 4EYIB 2JEJA 5F8IA 4ED2A 1N4LA 1KHVA 4J2DA 3NGZA 1WSHA 2W7PA 2O4GA 2LSNA 1J54A 1VSKA 4FJIA 4FBUA 3M9NB 2UUWA 1JLBB 4QWCA 5KFDA 5KFVA 3K2PA 1HYVA 3U6FA 2VG5B 1JLBA 3Q8RB 4CEZA 2JEIA 1UAXA 2D3ZA 4FBTA 2VG5A 4TSXA 4IG3B 2F8EX 4N5SA 1ZTTA 4I7FB 4IR9A 2B43A 1ZTWA 4DLGA 4IG3A 3CDUA 4R0EA 4I7FA 3OYJA 4CJFA 2P5GA 4Y2AA 4EYHB 2FLPA 5F9NA 4LH5A 1KLMB 3P83D 1RDRA 1XWLA 4OKKA 2C2RA 4HYKA 3M8QB 4CJVA 1U49A 1KLMA 1RTJB 3M8QA 1T7PA 3RB3A 2YHBA 1RTJA 2X6NA 4FW2A 2FVSA 3BSAA 3ZSXA 1BCOA 1LW0B 2IBKA 3T3FA 4KRFA 1DTTB 1L3UA 2G8UA 3NAHA 3RMAA 1RT4B 3OSPA 1QAIA 1LW0A 2VWKA 1DTTA 4NRTA 4H4OB 5KFLA 3AVGA 4YQWA 1RT4A 4RG8A 2VA2A 1RDAA 3AO2A 1ASWA 4CK1A 4H4OA 3WNHA 4Z4CA 4CHQA 1Z26A 4FM1A 1SH3A 4ZP6A 3I8DA 3A2FA 5C25B 2IA6A 4OKEA 4KTWA 3ZCMA 1UA1A 3RB0A 3T5HA 5C25A 2XCPA 2WK4A 3VQ8A 4JV2A 1WSIA 3VQQA 1HPZB 2HNYA 3OYCA 2W7OA 4FZZA 3MXIA 1S6QB 3M9MB 1HPZA 3QZ7A 4DTSA 3OHAA 1S6QA 4LSLB 4JLHA 2EHGA 2XC9A 5KG3A 3QETA 1W0HA 3H2LA 1KSPA 3GV7B 4LSLA 3LWMA 2W8LA 3KHGA 4J2AA 1JL2A 4O0JA 1JX4A 4EBEA 4FJ7A 3AVAA 1KCFA 4WXWA 3QGIA 4DTPA 4J9LA 4I2QB 3TANA 1S9EB 1RBVA 2J6UA 4E89A 3AV9A 4NLUA 4LY7A 4I2QA 1S9EA 4Q8EA 3CJ4A 4OPJA 4DTXA 4MK8A 3KLIB 4KHRA 3KK3B 1D9FA 4DSKA 2D5RA 2B5JB 4FJMA 4ZHRB 4FW1A 3KLIA 3KK3A 3CFOA 2XHBA 3OYNA 4ZHRA 4CF1A 3UDLA 2FVQA 3CO9A 3PW4A 1QSLA 1RTDB 3H4BA 3OS1A 5T7BA 4DEZA 1K1SA 2O5DA 5KFXA 4FJLA 5EWEA 4CGJA 5KT4A 3QESA 5SWMA 1RTDA 3CDEA 1G15A 2ASDA 2HHQA 4NLXA 2BQ3A 1Z4UA 4ELUA 4Y2CA 1RILA 4CJRA 4FJ5A 1S1UB 3AA3A 3K5NA 2BR0A 4DWIA 3DYAB 5HLFB 1CZ9A 3P5JA 1S1UA 4IRCA 2AJQA 4KTZA 5C5JA 3RR8A 4DQPA 4NLTA 4FLYA 3DYAA 5HLFA 5KFTA 3QEPA 3LDSA 3DOLB 5JXSA 4Y1DA 1WSGA 3S9HA 2DPIA 3PY8A 3DOLA 1A5VA 2FVPA 3V9XA 4IH5A 4NLRA 4J9KA 2BDPA 3NL0A 5KT7A 3H5XA 2KFNA 4PQUB 2GBZA 4L8RB 4IG0B 3LANA 3OHBA 3SUNA 4NYNA 3TAPA 2PYLA 3AVCA 3MECB 4CHZA 4PQUA 4JV0A 1SH2A 3PR4A 1TKXB 4IG0A 4QWEA 1Q8IA 3BJYA 1LWFB 1HQUB 5KFSA 1NK8A 4K4VA 4ZP9A 3MECA 5KT3A 5KG5A 3ITHA 3S3NA 1TKXA 2D0BA 5HRNA 5HRSA 4B9LA 1LWFA 1HQUA 4Q5VA 5EDWA 1GX5A 4W5NA 4H4MB 3KLVA 5KT6A 5KRTA 1IM4A 5KFOA 5J1EB 5KFHA 4IH7A 2AX1A 1SL2A 4H4MA 4ECUA 4CGDA 1S1XB 5J1EA 4RNOA 3K5OA 4FCYA 4NLWA 2D7SA 3ZT2A 4FZXC 3K5MA 1S1XA 1RBSA 4QWBA 3WNEA 1VSJA 3VQ7A 1RT3B 3PR5B 3BGRB 2AWZA 3WNFA 1RT3A 3CVKA 4DL6A 4KTQA 2IDOA 1SL1A 4OJRA 4M94A 3OYKA 3V9UA 1K1QA 1XR7A 5T14A 3QO9B 1JLAB 4ZVFA 3UQSA 4DS5A 3QO9A 1C1BB 1JLAA 2C28A 4ECVA 1C1BA 3ZT1A 4O3RA 4CF8A 1NK7A 1EP4B 1HQEB 1HYZA 4DQQA 3EZ5A 3C6UB 1QTMA 1EP4A 4CGGA 4ECTA 1HQEA 3G0ZA 4TY9A 3C94A 3M8RA 1TL3B 3C6UA 4I2PB 1JLEB 3CJ3A 5I42B 1NHUA 5DMRA 1TL3A 4I2PA 1RA6A 2KTQA 1JLEA 1XHXA 5I42A 4IR1A 1WAJA 2GV9A 4O3PA 4CHNA 3F9KA 4Q8FA 4KI6A 2IAJB 1S49A 3WNGA 4J9PA 1LWEB 3ZSVA 4DTUA 3OJUA 5KFFA 5DK5A 2Q3SA 3NF7A 2IAJA 4ZPBA 1LWEA 4M3TA 2BQUA 3G6XA 1OS5A 2G8KA 2FJXA 5FDLB 3MAQA 2HHSA 5F8GA 4FJJA 2IC3B 1U45A 3ASMA 2R8KA 1CZBA 5FDLA 4BWMA 5EWFA 5J2PB 1J53A 1S1WB 1U09A 3H5SA 1GOBA 4E19A 2IC3A 4TYBA 4CF9A 1NNDA 2VG7B 2R7YA 5J2PA 4E7KA 1S1WA 4NRUA 4ED6A 3H59A 4FJNA 2VG7A 1T8EA 2W8KA 3AO4A 3OYEA 2VG6A 3ZSOA 3PJXA 3RBEA 3SUPA 3LP2B 4XPEA 3MR3A 4M3YA 1JL1A 2FBVA 2XGQA 3SZ2A 2I5JB 3LP2A 4CJLA 3FDSA 2FC0A 2IM2A 1HNVB 2I5JA 1IO2A 2OH2A 3KD5E 4Z4IA 4J9SA 5JS2A 2P51A 4J2BA 1VSIA 5J2NB 4YR0A 2ILYA 1HNVA 3RTVA 4M3ZA 5KT5A 4N47A 5KFJA 5J2NA 3BSNA 3S3MA 4CK2A 4EZ9A 4FLXA 5CY4A 4DLEA 1R0AB 1TKZB 2ASLA 2QKBA 3HVWA 4F4KA 4DU4A 3QGHA 5DQGA 4LSNB 4CJ3A 4RU9A 3I0RB 2EC0A 4QAGA 1R0AA 4W5TA 5KG0A 1TKZA 1JLGB 4DS4A 3QINA 4LSNA 3VQCA 2IOCA 1RTHB 2YNGB 3MR5A 3I0RA 1BHLA 4BWJA 1JLGA 3HL8A 2I1RA 4FJHA 3LZJA 1RTHA 2YNGA 1KLNA 1VSHA 4FJ8A 4E1MA 1KVAA 3L2UA 1RBRA 1SKRA 3CM5A 1YTUA 1X9SA 1N48A 4RW6B 3VQ6A 2J6TA 4M95A 2AX0A 4O55A 4F3TA 1C0MA 4CJUA 4K4TA 3LALA 4CJPA 3OL6A 4RW6A 2A1SA 3O3GA 5SZTA 3RB4A 1Z25A 1UOCA 2F8TA 4J9NA 4K4UA 3TAFA 1IKVB 5FROA 1EKEA 1TP7A 3GIIA 1NJZA 5KG6A 2QXFA 1IKVA 3MR2A 2DY4A 1YVUA 1T94A 3GQCA 3GILA 2X6SA 4FLUA 2XI2A 3AA5X 2PY5A 3HT3A 3EPGA 1NK0A 1QUVA 3T19A 2GC8A 2X78A 4C8NA 1EX4A 2CKWA 4DL7A 3G6YA 4WFZA 2Z1IA 4DSLA 3AVNA 3NHGA 5KFYA 3OL7A 2E9TA 3MXJA 4CEAA 1L3VA 1JLCB 1S5JA 1U47A 4KHMA 1JLCA 2FJWA 4DTRA 3SUOA 3EPIA 2PYJA 3QEIA 3HVAA 4JS5A 4CFDA 2GIRA 4FLTA 5DLGA 3IGNA 2G8HA 1C0TB 3SUQA 1S97A 4MKAA 3SNNA 2DTUA 1C0TA 4Z0UA 5CYQB 3D28A 3ZSZA 3RRHA 3B6OA 5CYQA 3AVHA 5KG1A 4DL2A 1XHZA 3KJVB 4F4WA 1T03B 1WNSA 5F8JA 2JGUA 1XC9A 3KJVA 1D8YA 3VA3A 4K4XA 1T03A 3ZT0A 4OGCA 3TAQA 1QHTA 4EO6A 3ZSYA 1NJWA 3V4IB 4BDZA 3JSMB 3G6VA 2XGPA 3DI6A 3V4IA 3JSMA 3CDWA 1FKPB 3AVFA 3LPUA 4M3UA 2ASJA 4ZTFA 3QEWA 4ECRA 1D1UA 4I9QA 4Q0BB 3TAEA 1UA0A 1FKPA 3V9ZA 5F8NA 4N76A 1S0NA 4Q0BA 2XRIA 3T5JA 3VQ4A 4ZPDA 4K8ZA 4O44B 4B9MA 3Q8QB 3O3FA 5L1IA 4WYLA 3LPTA 4O44A 4DSIA 2W9AA 2IMWP 1RDCA 4ZTJA 2CJQA 1S48A 1WAFA 1RT5B 1T3NA 4E7LA 5KFEA 3TVKA 3ULDA 1RT5A 3DRRB 2D41A 2W9CB 2WTFA 4DG1B 1T05B 2HNYB 3DLGB 3DRRA 4IKFA 3LP0B 5F8MA 1QQCA 2BE2B 1D0EA 3MR6A 2W9CA 3VQBA 4CEBA 3QNNA 4DG1A 4C8LA 1T05A 3DLGA 4MKBA 4ECSA 3LP0A 4YNQA 3DLKB 4Q43A 4ED7A 3KK2A 2BE2A 4IFVB 3QGGA 1GOCA 1TAQA 4C8MA 4AILC 1SKWA 3PX6A 3OS0A 2ALZA 2HMIB 1VSLA 3S3OA 3DLKA 2C2EA 4IFVA 3PUFA 4FLZA 4CIFA 1KVBA 4R8UB 2HMIA 1BIZA 3BSCA 1EETB 3RAQA 3KHLA 4R8UA 4KREA 5EWGA 1EETA 3SQ0A 4FS2A 3LP1B 3DLRA 2ILZA 2IJFA 3OJSA 4O5BA 1FK9B 3SI6A 1LW2B 3LP1A 1RDDA 4EEYA 1DLOB 4Z4FA 3DLBA 1FK9A 1LW2A 3NCIA 1DLOA 5HRRA 1KHWA 2XY5A 4KB0A 1SKSA 4NCAA 4URQU 4EP5A 4CEDA 3KHHA 3V1OA 3U3YA 3L2WA 4KAZA 2W42A 1SL0A 4J9OA 2HNDB 4CHYA 2IJNA 1NKEA 1RYRA 2C2DA 3AO3A 3LWLA 3SV3A 2HNDA 4W5OA 1SH0A 4KHNA 2IM0A 4CJ5A 3HVTB 2F96A 2Z1GA 3DLEB 4F8RA 4NLYA 4NZ0A 2XCAA 4F50A 2V4QA 3HVTA 3H98A 3DLEA 2HHTA 5KFNA 2R8HA 1TGOA 2JLEA 3M8SA 3PX0A 4Z4EA 5KFQA 3TAMB 4WFXA 4G1QB 5KFCA 4JRQA 4EBCA 4O4GB 4KBIA 4ECXA 4NLQA 1IH7A 4HUGA 2C22A 1ZBUA 3NF8A 3TAMA 5KRSA 3FSIA 4DL3A 2BANB 4G1QA 3O3HA 2KW4A 4O4GA 5L1KA 3B6PA 5DGAA 1RT6A 2BANA 4C8KA 1NJYA 1C6VA 4F4YA 4BACA 3KLFB 4BE1A 4B8AB 4CGIA 1QAJA 3MF5A 4GC7A 4MQ3A 3KLFA 4U7CA 4BDYA 1C0UB 4RZRA 2FBTA 4R5PB 2ZKUA 3ITHB 3KK1B 3K59A 3RAXA 4B9NA 2R2UA 1C0UA 1A5XA 4R5PA 3ZSQA 1RAJA 3KK1A 3HVRA 5HROB 3KLEB 5D3GB 2O4IA 4GVMA 1QSSA 3KLEA 5HROA 5D3GA 3H5UA 5CYMB 1VRUB 2W9BB 3OS2A 4GC6A 5CYMA 1VRUA 4EP4A 2W9BA 1NKCA 3D5MA 4MK7A 5KGWA 2DFFA 3OVNA 3OYGA 5DGBA 5DQIA 3ALYA 3VQ5A 3TARA 3I5CA 4CFCA 2HVHA 4K4ZA 5K14B 2V0NA 1RNHA 2FVCA 4DF4A 3OYAA 5K14A 4F4XA 4MIBA 2E6MA 2HWHA 3V6JA 3KTQA 3VQ9A 4UQGA 5KFAA 3FQKA 4QW9A 4KSEB 4QWDA 4PUOB 3C95A 5HRPA 4TY8B 4RNFA 1I6JA 4DTNA 3PJWA 4TXSA 4PUOA 3T5LA 3NAIA 3CIZA 4TY8A 3OYDA 2AU0A 3PO5A 1YT3A 3I5AA 1VSMA 3ICLA 4HVJA 3AVMA 2ATQA 2ZE2B 4FJXA 3E01B 3T1AA 2WB4A 3DLHA 3H40A 2WOMB 1KFDA 2B4JA 3UIQA 3L2RA 3PX4A 1TK0A 1S4FA 2ZE2A 4LD0A 2IM3A 3RR7A 3E01A 4NLSA 2JC0A 2WOMA 4Y34A 5HP1B 4ECYA 3CWJA 1FXXA 4KHYA 4NLVA 5KTQA 1C1AA 5HP1A 2UVRA 3HO1A 5KFGA 3KD1E 5CZ2A 4IH6A 4DTJA 2YHAA 4OL8A 1Q9XA 1XI1A 1X9WA 4KPYA 2D0CA 4K4YA 1WSEA 2OPSB 3CJ0A 2G8FA 4RW4B 2KZZA 4DQSA 5EUHA 3SYZA 4DMNA 2OPSA 1L3SA 4PWDB 4RW7B 4RW4A 1RYSA 1YVFA 3K58A 1KFSA 3H08A 2UUTA 5C24B 1QSYA 4PWDA 1SV5B 4RW7A 4NLPA 3KHRA 4KAIA 2B6AB 2VG6B 5C24A 1REVB 4WYWA 1SV5A 2B6AA 3ZSWA 1NHVA 1REVA 3BQ2A 1LAWA 4RUCA 3G86A 2HHWA 3GV5B 4O3NA 3OYFA 5HBMB 3BDPA 3BSOA 5F8LA 1N56A 5JS1A 4KO0B 4CIGA 3AVLA 5HBMA 5KG2A 3HP9A 1VRTB 4KO0A 4E7IA 4O4RA 1VSEA 3OYIA 4F4ZA 3AVBA 1S0MA 4CERA 1VRTA 5KFWA 4B9TA 2WONB 3NF9A 3NH0A 2YNFB 1BI4B 4HUFA 3MEEB 5DLFA 3MEDB 2WONA 2YNFA 1BQMB 1BI4A 4E1NA 3MEEA 3GIJA 2D3UA 3NDKA 3VQPA 3MEDA 4OLBA 3V1RA 1BQMA 4EO8A 1CLQA 4KE5A 3QLHB 4ZVHA 4DQIA 5F9LA 3HXMA 4FM2A 3QLHA 3HP6A 4EBDA 3AVIA 4DU3A 3H5YA 4BE0A 2ZD1B 3SV4A 2YKNB 3L8BA 4HHTA 2OZMA 3MTKA 4CEQA 4BDPA 4ID5B 1JXBA 2ZD1A 2YKNA 4CFAA 3L2QA 4ID5A 2FLLA 2DFHA 3HPHA 3LP3A 4JUZA 4WXOA 5KG7A 3HM9A 3O4NA 3ZT3A 3DMJB 4W5RA 4J9QA 4J2EA 2EX3A 3PW0A 4E0DA 4U6PA 4OVLA 1HNIB 3V6KA 4TQRA 3OYLA 1NKBA 1S6PB 1F21A 2OPRB 3DMJA 2FBYA 4J9RA 1IKXB 1K6YA 3OL9A 1HNIA 3DRSB 1EXQA 1S6PA 2OPRA 3ZSRA 3CQ8A 5KFKA 1IKXA 2AGPA 4OGEA 3DRSA 3F73A 5E41A 4CECA 1QE1B 3KKRA 5FRMA 2XY8A 2OYQA 4NLDA 1QE1A 1RT1B 2QE5A 3M9OB 1CSJA 4ED3A 2Y1JA 3KKSA 4DSEA 4DQRA 5DQHA 1RT1A 4YR3A 1JXEA 4CJWA 2VA3A 4B8CA 4HTUA 2RPIA 3DRPB 5KGXA 3I5BA 1HJRA 4IKAA 1S10A 3NAEA 2FJVA 2AGOA 4WZQA 4MK9A 4NLOA 2YNHB 1TKTB 3DRPA 3PO4A 5L1JA 1LV5A 2RDIA 4MH8A 2YNHA 1TKTA 4ZMMA 2ATLA 3KMSA 4B9UA 4URSA 2ZQBA 2XI3A 2G8IA 4CGFA 2R2RA 3V6HA 4M45A 3Q8SB 3SJJA 4CHPA 4ELVA 3NH1A 3G10A 1A5WA 3Q8PB 2YNIB 1RA7A 4GMJB 2BQRA 2IS3A 1TL1B 3N6MA 1TK5A 2YNIA 2P5OA 1ZBLA 1LAVA 3TR8A 4DFPA 1TL1A 2R2SA 4F2SA 3L2VA 1ZYQA 3T5KA 4K4SA 3DI6B 1NK9A 1GX6A 1VSFA 3QIOA 2WRMA 1X1PA 4TN2A 3LAKA 1BGXT 1RT7B 2V9WA 5KFPA 1UWBB 1U4BA 3FFIB 2AGQA 4ID1A 1S1VB 1RT7A 2D0AA 4HCCA 5C42B 1UWBA 4IRDA 4DSFA 3FFIA 4TLRA 4MFBB 1GOAA 3QIPB 3MXMA 1S1VA 1J9AA 3KNAA 4B08A 5C42A 1BQNB 5DG9A 4MFBA 1TQLA 3QIPA 1NK4A 4CJEA 2RF2B 5KG4A 4FJ9A 1BQNA 1FKOB 1KVCA 4GW6A 4I9LA 3C6TB 4G3IA 3SFUA 3HPOA 2XWYA 1N6QB 3M8PB 1NJXA 4ZP8A 1WNEA 1ZBFA 2RF2A 3CJ2A 3HHKA 1FKOA 3C6TA 1IG9A 3PW5A 3OY9A 3EZUA 1N6QA 3M8PA 4M41A 2YKMB 4FZYA 2ETJA 2GIQA 1NK5A 5KI6A 2ITGA 3QEVA 4DL5A 4ED8A 2YKMA 4TQSA 3BR9A 1MMLA 3MFHA 3OLBA 2BRLA 2HB5A 3K5LA 3ISNC 3KMQA 3LAMA 1BCMA 2F8SA 3KK2B 3BREA 4IBNA 5KFRA 3BQ0A 3RB6A 3QIDA 3TAGA 4ZVEA 2Z1JA 4KFBB 4PA1A 4CEFA 4O3SA 4CJKA 1X9MA 1KRPA 1RBUA 4CESA 2JEGA 3HKWA 4KFBA 4DSJA 1RT2B 2UVVA 4MIAA 4E3SA 2XY6A 3GYNA 3CG7A 3V81B 2DFEA 3RMBA 1RT2A 4YMEA 1IKWB 1U04A 3V81A 5KFIA 4K8XA 1BISA 1HYSB 4PY5A 3RWUA 4CFBA 4FK0A 4KHUA 1IKWA 4FLVA 2HNZB 4FM0A 4CEOA 4FK2A 2E9ZA 3D0PA 1HYSA 1ZBIA 1IKYB 3MEGB 3N6NA 2HNZA 1S0OA 3OYMA 3SPYA 3NBPB 3I0SB 1I39A 3PVXA 3IS9B 1IKYA 1WSJA 2FLNA 4Y3CA 3MEGA 3CFRA 3TQ1A 4ECZA 2OPQB 3NBPA 3I0SA 2GUIA 3SQ4A 4FYDA 3V1QA 3CJ5A 3IS9A 3FQLA 1JKHB 3CM6A 2FBXA 4XO0A 3PHEA 2OPQA 1B9FA 3AA4A 3N6LA 1RTIB 4QWAA 1JKHA 4LQ9A 3ISND 4QW8A 2IGIA 3OLAA 1KTQA 3AO5A 2OPPB 1RTIA 1ASUA 3QNOA 4ELTA 4KV8B 1I3AA 4H8KA 3OYHA 2OPPA 4WZMA 2OZSA 4KV8A 4FVMA 2HWIA 3DM2B 3VQEA 2B5JA 1C1CB 4O3QA 3RRGA 4N56A 4AH9A 3DM2A 3JYTB 1C1CA 4B9SA 3V6DB 4CJ4A 4K50A 1BIUA 3P1GA 3JYTA 4DFMA 1HARA 3V6DA 3K57A 4E7HA 2UVWA 4O3OA 3RMCA 4F3OA 1BL3A 4IOBA 3TI0A 1RT6B 3ZT4A 4RW8B 3E51A 4FLWA 3BQ1A 5I3UA 3UPFA 3QZ8A 2KQ2A 2RN2A 4RW8A 3HYFA 4ECQA 4IFYB 2QK9A 4QPXA 4YR2A 3QYYA 1RDBA 3PZPA 4DTMA 4IFYA 5JUMA 1L5UA 4CF2A 2E9RX 4AHSA 3NGDA 3DOKB 2DPJA 4Z4HA 3TWHA 1YTAA 3NGYA 2HHVA 3IN5A 3DOKA 4JS4A 1XR5A 3NFAA 3NE6A 1W25A 1CXUA 3TABA 1VSDA 4LH4A 4XIUA 4ECWA 3IGVA 4B9VA 4CK3A 3CFPA 3PW7A 4E7JA 4Z4GA 1NOZA 3QERA 4CJTA 5J2MB 2R8IA 2WCXA 3NH2A 4LQ3A 2E4LA 5EU7A 5J2MA 3OYBA 2X74A 4FK4A 2RKIB 4ICLB 4RNNA 5KFZA 4RUAA 4CJQA 4NCBA 3SCXA 3SFGA 1ZETA 2RKIA 4ICLA 4Q44A 2G8VA 3DDKA 1Y97A 2UVUA 4AHRA 5FRNA 2YV0X 4ZP7A 3GIMA 3KOAA 1JIHA 4M42A 4CCHA 1ASVA 3IRXB 3VA0A 1NK6A 2JEFA 3VQAA 4HKQA 1SUQB 4Q45A 2V4RA 2BGGA 3IRXA 4X2BA 5KT2A 4QOZB 3GV8B 3BGRA 5I3UB 1SUQA 2R8JA 4TYAA 3H4DA 4WFYA 4H54A
chains in the Genus database with same CATH superfamily
2YX1A 3CMQA 1HLUA 4N77A 3P6YC 1BWVA 3B4MA 2Q0UA 4H0OA 2NPIA 5BN9A 2W25A 4CIEA 3VQSA 3MPWA 5A8KB 4OLAA 3ZTOA 2VWJA 4BC5A 4IEIA 2VDHA 1RHJB 2QV6A 1DTQA 3Q7BA 4BROA 2BW7A 2G4BA 1ZC6A 1IR1A 2I9SA 4FF4A 1N5QA 5LT5A 5L1LA 1Y5IB 5E3PA 2NXEA 5CH7B 4OKJA 3THPA 4GVEA 2KFYA 3G9CA 1S9GA 5LMNK 4X4SA 4USHA 2XMUA 3OUYB 3NGIA 3M32B 3PV8A 4RNMA 4BE2A 2OI2A 1YI2S 4ENOA 4JHDA 3EY1A 4ZCIA 3OVAA 2MEWA 2PMZD 5DM6Q 5HMXA 2HF4A 4KKOA 4IDKB 4HT5A 1E4GT 3F41A 4XDCA 3IR6B 3BF4A 2HVIA 3M7VA 4B1XB 1B92A 1UVJA 2AV5A 4J7CA 4NWBA 2KFZA 3CETA 3GONA 4GV9A 2HBQB 3I6PA 1YJ9N 2B4VA 1C2PA 3P96A 3B8HA 1VHXA 2BYCA 2CQ1A 2F4VJ 1TVRB 4LBHA 4AHVA 1S1TA 3KLHB 1QDUB 1KAYA 2QA4G 1UVKA 3OBWA 2MZRA 4AHUA 2CH6A 1T02A 4C2MA 3MK6A 1RBTA 4CM0A 2KT5A 3IM9A 2OLWA 1S12A 4ZPCA 5LMUF 3D6FB 3D3BJ 4EIAA 5IM0A 2WVFA 4KHSA 3H90A 4DX8H 5DM6L 3IG1B 1N5TA 1MU2A 3HOTA 3K9KA 3JTOA 4JI3K 1TAUA 3MUTP 4N8OA 1UFLA 3TZZA 3MPDA 1KDNA 4RW9B 4HR2A 3C46A 1QVFM 4ZITA 4WFAQ 2XM3A 4WE1A 3L4QA 2A1RA 4IFEA 5HATA 2LQJA 4DU7A 1XNQJ 2ZH8A 1JLQA 4KY3A 1S5ZA 4X4TA 1F5BA 4CGHA 3TX0A 1D9AA 4M5LA 3F44A 3R7SB 1ZOTA 4JI2K 1HBMB 5KFMA 1JLFA 3MN9A 3HZGA 2DGVA 3F9MA 5AXKA 1HMVB 4FS1A 5LMNJ 4DR3F 1F5CA 3LGMA 2WVDA 2F9WA 1KEKA 5GAEP 4QZVB 5A6WA 1HNWF 4JI7K 2B9YA 5DDPC 4KB1A 1FEHA 4GO7X 4ANEA 4A8XA 5LJ3Y 3HJFA 3PW2A 3CJKA 5DG8A 4HHJA 1NRKA 1Y10A 1QS4A 2F4FA 2UXBF 1T11A 5C2CA 3NF6A 4WFAL 4O0NA 3R3TA 3HKZD 1XQSC 3D7SB 1EQ0A 3MMBB 4EYIB 1U1PA 1N4LA 4J2DA 3E1YA 2HGNA 1JK9B 4CLLA 3FZ2A 3HZEA 1RKJA 2O4GA 2XHWA 2XTJP 1VSKA 3NGRA 4PPZA 1JLBB 3HMJG 3QQCD 4DXLA 1HYVA 3U6FA 1Y5NB 2LQ5A 3M1FA 4MMOA 2D3ZA 4FBTA 4JYAF 1KAZA 2VG5A 4TSXA 2F8EX 2VASA 4CYUA 5AQUA 1YZ7A 4J9UE 3O08A 4I7FA 2XLJA 3ZZ0A 3BP8A 3JQKA 1C0GA 2QX0A 4NX9A 1KN6A 3OHRA 4W90B 4OKKA 2C2RA 4JI3J 1KLMA 1Y3KA 4WKRA 1H74A 5A8WA 1LQ9A 1UJ6A 1FHTA 3AY0A 1YBAA 2FVSA 1OSCA 1YLXA 4CLFA 1N0UA 3BEGB 1LW0B 2OELA 4LF4F 3T3FA 4YN3B 2K3IA 3NAHA 4C11B 3EM1A 2P9UA 3OSPA 4C8ZA 3AOCA 1FRIA 1DTTA 4NRTA 3I55S 4H4OB 5AQNA 2CPYA 3R5GA 1RT4A 3FZLA 2VA2A 3OR1B 2V5HG 4AE5A 5ETNA 4JI2J 3DCAA 2HG4A 3HOSA 4DMZA 1YITN 1HKGA 3A2FA 2GVZA 4A57A 1QAYA 2GX8A 4PABA 5A2QU 5C25A 3VEVA 4BRQA 2XCPA 2WK4A 5LJWA 4B1UB 4X4QA 2WBMA 3L4BC 2BH1A 4X64K 4GO5X 3A5MC 1UEVA 3QZ7A 4DTSA 1RWKB 2CPZA 4JLHA 2P9LA 5KG3A 1PAEX 3QETA 1KSPA 3PKMA 2VFTA 3LWMA 2W8LA 3VESA 3M1VB 4Y2MA 3QGIA 4F02A 3VVTA 1P9QC 3TANA 4MO4A 4LY7A 3FZHA 1ELOA 4V1Ak 4Q8EA 2G2ZA 1HUXA 4M8LA 4P74A 4DTXA 1D9FA 2R7OA 4ZHRB 1DQ9A 4FW1A 3KLIA 1I3OB 4FPIA 3CFOA 1QJHA 2O8FA 2ZJPQ 2OTLS 3OYNA 1CVJA 5EXWA 3EE3A 1FERA 3J7YP 2BOPA 2FVQA 1JNRB 2GEMA 1K1SA 2O5DA 2OCEA 2EFPA 2QL7B 5EWEA 3QESA 4CDIA 3I4HX 4QU6A 4JD2A 2ASDA 2HHQA 1FFGB 3CIMA 5F0WA 3D0HE 2AEJA 5CXTA 2EW9A 1D8ZA 1RILA 4HVZA 4F9OA 1JJ2M 3LM9A 1S1UB 4JKGB 4I4BA 3N79A 5HLFB 3ZNUA 3UD3P 4FWOA 3FEYB 4DQPA 4IUFA 4FWRA 1AUSL 4NLTA 3TO8A 3LDSA 4Y1DA 3TSPA 1VQLS 3TOQA 4Z37A 3ILLA 1RTZA 3AA9A 2E20A 1SCJB 4H0PA 2POKA 5KT7A 4ZKAA 2XSFA 2GBZA 3R97A 3BYRA 3LANA 1FD2A 3TAPA 2ZJPL 3IDHA 3PR4A 4QWEA 1HQUB 5KFSA 4ZP9A 3ITHA 4HTIA 4USWA 2W7AA 1TKXA 2D0BA 5EDWA 1GLCG 2DCUB 2E1CA 5L8RC 2Y1LB 4H4MB 5KRTA 4Q2LA 4ITSA 5J1EB 2LYVA 1M0SA 4X64J 3BZCA 2YWFA 4LF1A 2CFXA 2ROEA 4E98A 4RNOA 4NLWA 3LA0A 1X5OA 3R6GB 4WP8A 4U96A 4QWBA 3CJBA 1RT3B 1P1LA 4ISEA 4BRDA 3CCSS 3MI7X 2W2MP 4FWLA 3THYB 4I6AA 3CE8A 4DR6K 3VETA 3A4TA 3QJLA 2QWOA 4M94A 1XR7A 4V19S 3N4WA 1JLAB 1FA0A 1R0BG 1YJ7A 1HD1A 4ZVFA 3UQSA 1SBRA 4DS5A 2W2OP 5HOOA 2FGCA 5FPNA 1C1BA 5ADXH 3L4IA 3I56N 3O5TB 4O3RA 3BZQA 2DNZA 4JI4F 1F3FA 1KR4A 1HI0P 3EXYA 4CBWA 2FZCB 1WKJA 1HQEA 4TY9A 1TL3B 2UZAA 3CCMN 1JLEB 2RB7A 3D2FB 3C2PA 2BE9B 1DY3A 3NXZA 2C3YA 2AP1A 1WAJA 4IR1A 4PKDB 2MZ1A 3NMRA 3P39A 4FVCA 1VIXA 1HR0F 4J9PA 3ZSVA 2ASPA 2WUSA 2GX9A 3MEKA 2B0GA 2AJ2A 5AQLA 1KOOA 3G6XA 2JWLA 3VEWA 2FJXA 1VYAA 4TU8A 4FJJA 2B4OA 1U45A 2R8KA 5FDLA 1S1WB 1QZ6A 3H5SA 1VK3A 2IC3A 4CF9A 4CLSA 3VALA 3C3LA 4CRJA 3BV8A 2BJ7A 2HS3A 4ZLPA 2C3OA 2OANA 1FJGF 2P9IB 3PSFA 2P8IA 2NPFA 1B99A 2EWSA 4QOTA 2W8KA 3AO4A 3OYEA 1MMNA 1S72N 2UXDK 3ZNJ1 1S0VA 3SUPA 1PJ7A 1EQMA 3MR3A 3SZ2A 2XGQA 1DJ0A 3LP2A 4CJLA 4DU8A 2FC0A 1MN9A 4RL1A 1HW8A 2P51A 4J2BA 4C1NI 3MM5B 2OMLA 4N47A 2BBEA 3BSNA 1VI7A 2WBRA 4CK2A 1RABB 3SJHA 1GMWD 4DR6J 3NS5A 2R9LA 1R0AB 2OMOA 5L39A 2QT7A 1ZA1B 1Y4ZB 1UP1A 5DZ6A 3PYEA 2GMLA 4NO7A 2AHOB 3QINA 1BXNA 1RTHB 2A2DA 2NNWA 1KONA 3EL2A 1BHLA 4BWJA 1BDGA 4R79A 3OBIA 1U7LA 1VSHA 4RO0A 4DV3K 2OUGA 5ITHA 1YTUA 1X9SA 4U7UD 3DRYA 1AXQA 3ZXWA 4O55A 4F3TA 1T9XA 3GSIA 2A1SA 2DT9A 4CLPA 3W66A 5FROA 1FXDA 2ZH4A 1OH5A 4B1YB 3MM7A 3T1HF 1YVUA 1PIEA 3GILA 4B1ZA 5HQLA 4KR0B 4A4JA 2ZH9A 3MDQA 2KDOA 1NK0A 2KHCA 2BKOA 3T19A 5AE2A 2X78A 5JVHQ 4C8NA 4X4UA 2WAQD 4DL7A 2YWKA 3G6YA 2Z1IA 2V6AA 3QGPA 4DSLA 2BJ9A 3THXA 5KFYA 3MXJA 2HQ3A 1UW4A 3TQEA 1S5JA 2IVYA 2P9PA 3QDKA 2CDRB 1KNZA 2MKKA 3EPIA 3JSBA 4A5AA 3SBTA 1YJWS 4NYPA 2HFZA 1NNEA 2LXFA 3SNNA 5C2FA 1C0TA 5CYQB 3D28A 4P9SA 3ZSZA 4Z7YA 3BYPA 1KS2A 2C1EB 1CZAN 4EAHD 2X1BA 9RUBA 5KG1A 2YKAA 3ZC4A 3ZEUA 3KJVB 1B3TA 1UVNA 3DOMB 3KUHA 4MIWA 1T03B 4OYMA 2H9ZA 3VEOA 2IIRA 1WNSA 2YWGA 1HHSA 1YJVA 1XC9A 3VAMA 1GTHA 2AW0A 4OGCA 1AT1B 5A0YA 3VZIA 3V4IB 4BDZA 5JVHL 3NY0A 2WC9A 4JK7A 4ETXA 3GG1A 3AVFA 4FWSA 4M3UA 4ZTFA 5D6GA 2OKQA 1UA0A 1ULRA 2CQ0A 4FWPA 2RQMA 3R2CJ 3V9ZA 3IWNC 4HWIA 3T5JA 4ZPDA 3PJ9A 4O44B 4DV3J 5L1IA 4XH1A 3LPTA 1RE1B 4RUHA 4JN4A 3C6HA 1RDCA 3HSDA 2CJQA 3DGVA 4I64A 3DAWA 1PYOB 1T3NA 1SJRA 1OY8A 2NYIA 2FPHX 5BXIA 1VQON 1RT5A 2D41A 1RCXB 4M1KA 3DRRA 2FHKA 4HI1A 2XS5A 3CDBA 1W2BM 4Q43A 4ED7A 2R7SA 3KK2A 4NXMF 4IFVB 3QGGA 3D1HA 4C8MA 1YJNN 3QJPA 4UOGA 2HMIB 2IFXA 2K1RA 1Q82O 4CIFA 3BN4A 4R8UB 3GYXB 3UE5A 5MLCQ 1EETB 3K8VA 4KREA 3IWLA 3VZHA 3A5OC 4WWSA 3SQ0A 4FS2A 3BM7A 2CPDA 3LP1B 2DIVA 2RVJA 2ILZA 3DN9A 3BN7A 2C2NA 2IJFA 3P8BB 3OJSA 2M70A 2NXUA 2N7CA 2KLAA 4B3MF 4EEYA 2QLJB 3CC7N 1NLKL 2V2KA 1WKKA 4Z4FA 3VERA 3RRKA 2EFQA 3KDNA 2XY5A 3SK3A 2IA0A 3TSQA 1RAOA 5D0HA 4AF1A 3V1OA 1T6DA 4ZPTR 1CS4B 3IFEA 5BPNA 3KG1A 1E6YB 3CCJN 1TELA 4CZJA 2J0WA 3LWLA 3NG8A 3MPYA 1SH0A 2CDQA 2F3JA 4LRAA 3H3OB 2ZC3A 4CJ5A 1V4TA 2F96A 2Z1GA 3L3CA 2K7KA 3WEEA 2MKSA 4F50A 2V4QA 1M5PC 2ZDPA 3DLEA 2HHTA 1U1OA 2ZKTA 1H72C 2R8HA 1NG9A 1UKUA 5KFQA 5B7WA 1HLWA 4O4GB 3CJRA 3N5FA 5KPZA 4NLQA 4HUGA 2C22A 3TAMA 4HACB 2BANB 4G1QA 3MN5A 3O3HA 3WXJA 2QL5B 1JJCB 1HKCA 3IAS9 1AZSA 1BMQB 1N32K 3UR3C 3KK7A 2EKYA 5DDRC 1NJYA 4BACA 1Y5LB 3EEQA 1JWWA 4MQ3A 3SXLA 4U7CA 2W41A 4RZRA 1WTBA 5AQPA 3KK1B 1SC4B 2QRRA 4DV5K 2O67A 3ZTPA 5D3GB 2HLUA 3KNGA 5ETTA 5HROA 3BZKA 2BMBA 3H5UA 5HVFA 3LW5C 1OMSA 3EKSA 1EQYA 5CABA 3KWGA 1YSJA 1DRZA 5CYMA 1VRUA 2XYGB 2RRAA 1BA0A 3QBCA 3ALYA 2KM8C 3WXIA 3TARA 3DWLA 3I5CA 1SKUB 3VV2B 1B0VA 1WELA 2F8HA 4X66K 1F9EB 1L3KA 2CVIA 2V0NA 1U2FA 2WVBA 5H9FK 4OFZA 3L7PA 5LXYA 2QA4N 3A3PB 5K14A 2QJ3A 4F4XA 2V68A 1FEEA 3AOBA 3VQ9A 1RWXB 1VQ5S 4W98A 5B0EA 3R2DJ 4UT4A 4UQGA 3CNQP 2OAUA 5A6PA 3ENOA 2HS4A 4QW9A 4RKUC 3C15A 5HRPA 1CC8A 4PXBA 4ZPWR 1T9WA 1WSRA 2V2ZA 3T5LA 3W62A 3HCXA 5LL6d 4DV0K 4UZCA 3LM2A 4JI5K 1PC5A 1RQ0A 1MLAA 4HVJA 1T44A 2QXLA 4CLZA 2OD6A 2WB4A 2WOMB 3CCUS 2O8EB 4DN9A 3J7AN 3RR7A 1T3OA 2VGMA 3DLLQ 3E01A 3QAEA 1QY7A 1OH6A 3K17A 3PEJA 4LF9K 1RWWB 4DPTA 2FY1A 3Q8VA 4KHYA 3TTCA 3AODA 2UVRA 2N3OA 3FZBA 1UEKA 4DTJA 2HK3A 5K8MA 2I8EA 3QSIA 1Q9XA 3CQXA 4DV7F 2UYTA 3G87A 4K4YA 1WSEA 2C2MB 1LFPA 1N32J 3HULA 4EHTA 4RW4B 2KZZA 1H73A 1L3SA 4RW7B 1IUJA 3OXLA 5F2RA 3K58A 4LFCJ 3CO0P 2CH5A 2E5HA 2UUTA 3R8YA 5LJ5Y 1SV5B 2LEAA 3I8BA 3KHRA 4KAIA 1IN0A 5IZHA 2H51B 4DV5J 1REVB 3HFVA 2PA3A 3U1MA 4H5VA 3CD6S 4RUCA 3G86A 1Q8LA 2HHWA 4M5GA 4O3NA 3OYFA 1JCFA 1G99A 4CIGA 3DLLL 1FDDA 5HBMA 3HP9A 4CD1A 5E33A 1WOSA 3FC9A 4OV6A 2B7BB 4K2XA 3TZXA 2WONB 3NF9A 3NH0A 2X3GA 3EUNA 3VAIA 3MXHP 5DLFA 2UUBK 3ULEA 5H9FJ 1NDLA 1BLUA 2UP1A 4OLBA 3MEDA 3GYGA 3M2UB 1CLQA 2E2QA 5DRKA 4RWXA 4ZVHA 2L48A 1FO1A 2JSXA 2KHOA 4A8FA 3HP6A 3AVIA 3CPEA 3H5YA 1FWLA 3SV4A 3DHXA 2C2OB 2YKNB 3L8BA 4HHTA 2OZMA 3CCVN 3IMXA 4L76A 1ZAXA 3MTKA 4ID5B 4U7UK 2KYXA 1JXBA 4USTA 1NM2A 1YVNA 3M4XA 4DV0J 1DBDA 2H5IB 4QJVA 2DFHA 1FFSB 3LP3A 2FYXA 1TUUA 4OI4A 2ZDOA 5HMYA 3HM9A 4KH5A 5H9EJ 1IQZA 5DETA 4DV1F 2HIYA 3T1YJ 1HNXK 1SQFA 3PW0A 4TQRA 3ET6A 1N8RT 2FBYA 2OPRB 3DMJA 3CB4A 5L46A 1IKXB 3OL9A 3TEHB 2IYGA 2JDJA 1EXQA 2A3JA 4LF9J 3AD7C 1S6PA 3CQ8A 3L9ZA 3FBCA 3DRSA 3FMBA 3IUCA 3FCVA 1UPMB 1XERA 3DKDA 1GEHA 1QE1A 2ZVIA 2GUPA 2QC3A 4DQRA 3GP9A 1RK8A 1WUUA 1JJHA 1TUYA 3PRVA 1ATNA 4YUDA 3CC4S 3BPSP 3M2VA 3NAEA 4WZQA 2CQ4A 2LMIA 3MTJA 5CR4A 2CA9A 4MH8A 3DXKB 1TKTA 1K73T 2ATLA 4OIXA 5FIIA 4DDFA 3ZX2A 3CQYA 4CGFA 4AXJA 4ZA1A 4YY3K 3SDEA 2RQ4A 3ZTSA 3SJJA 3G10A 2RDDA 4F0HA 4P2FA 4CO4A 1Q81O 3W8GA 3WBZA 2L08A 1TK5A 2AJ0A 1TL1A 1N0VC 4KHPJ 2UUBJ 6FD1A 3AT1B 1ZAVA 2WRMA 4L3QA 3MWPA 2RSQA 1X1PA 5T7LB 3GSDA 4I56A 4ID1A 2D0AA 5AQSA 4EHUA 5C42B 1UWBA 4DSFA 2VQFK 1U02A 3PIPQ 3CJ8A 3MXMA 1K0VA 1SC6A 3KNAA 1BQNB 1M1GA 3AY9A 4N8NA 1CULA 5LSLA 1GTEA 2CJYB 1ZBFA 4KBOA 2RF2A 2IPOB 3TA2A 4M41A 4OJHA 2YKMB 2GTDA 3OQ2A 5IFMA 1FE0A 2ETJA 4KYZA 1CLFA 2ITGA 1HNXJ 2GELA 4DL5A 5AZJB 5KAKA 4DR1K 3BKTA 3BR9A 3POTA 1U0HA 3MCAB 5ETMA 3NNHA 3AB4B 3CCRS 1Q7YT 2A10A 1VFJA 3EX7B 4CEFA 4O3SA 1X9MA 4CJKA 1KRPA 3CCZA 1IR2A 1RGIA 2GA7A 4KFBA 4DSJA 4RR5A 2UVVA 4H0XB 2XY6A 2DFEA 4JI6K 2P6SA 4LF5J 1OIAA 2RHKA 3PIPL 4QR0A 2XQCA 1CQNA 5ETPA 4Z94A 1BISA 4X65K 4FK0A 4KHUA 1IKWA 2HBLA 3PXGa 1IR0A 2DCLA 3MN6A 4CEOA 4FK2A 2E9ZA 1HYSA 1ZBIA 5K9FA 3N6NA 3Q24A 3NBPB 1V6HA 4ZVOB 2MGZA 4LREA 1IKYA 3VGSA 2D0OA 2FLNA 1X7VA 4Y3CA 3GE1A 2YJEA 3QFPA 2QGFB 4FPBA 2XMTA 2JLGA 3ID8A 3V1QA 2MZSA 3CJ5A 4UTGA 4B3RK 1JKHB 3CM6A 1VJWA 4YY3J 1FE4A 3PHEA 1B9FA 1B7FA 3N6LA 4QWAA 4QW8A 4C4WA 2ZWHA 1CJUB 3CPWM 3I32A 2XYHB 1PILA 3G71S 3QNOA 1VQKS 1U1LA 3ZETA 2OPPA 2YWHA 3AAWB 4JKCA 1KD1O 1WHXA 1FI4A 4KV8A 2ASYA 1RWNB 3BGFA 2HWIA 4LR7A 4N56A 1XNRF 4AH9A 3DM2A 4C8YA 4ANCA 3GBTA 4B9SA 3V6DB 3P1GA 3JYTA 1B7YB 4RX6A 4LRDA 2CQ2A 4O3OA 1QLNA 3I33A 3RMCA 4F3OA 1MWZA 2VQFJ 4RW8B 3MPUB 3BQ1A 3MAAB 1VBKA 2KQ2A 2V2QA 2RN2A 2RE2A 3HYFA 4HEA9 3LPYA 4IFYB 4QPXA 1G4CA 3LPEA 3B78A 5ADXA 4DTMA 5U47A 2OTLN 4USJC 1JCEA 3RSEA 5ELZA 1URNA 2NRHA 4AHSA 4K25A 3DOKB 2EXUA 5GAGI 3IN5A 3NE6A 1YJRA 1VSDA 1MNEA 4XIUA 3PDNA 4I0WA 3X3UA 3IGVA 1SQKA 3PW7A 3NVMA 4Z4GA 1NOZA 2A41A 4AXIA 4FKYA 5E3CA 2R8IA 3KDOA 5AE3A 1BUPA 4YB7A 2P5VA 2D69A 2E4LA 5K8NA 4JI6J 2QWNA 5J2MA 3HSZA 4ICLB 4RNNA 4RUAA 4CJQA 2BUPA 3BKUA 4X65J 3SFGA 2MKYA 2RNEA 3MMCA 3I82A 1VQLN 4UQTA 3AAQA 4F0MA 1Y97A 3TYTA 4ZP7A 2LVWA 1KC8T 2LLZA 1VQ9S 2L9NA 2HQFA 1ASVA 5M1OA 2JEFA 4B3RJ 4Q45A 1F0XA 3CSKA 3GV8B 5I3UB 2VWBA 4TYAA 4DR2K 2YWEA 4FYVB 4BBYA 4H54A 3CC2S 2IRYA 2E29A 1Y7PA 3ZX3A 1RCHA 2ZHBA 3L3VA 2HHXA 2Z2MA 3WUHA 1IWAA 1RZMA 1HX1A 3EWGA 3H1VX 3V9WA 5A8KA 2YQ3A 1T3VA 2IY5B 1M1KT 1F1BB 1OYDA 3M6VA 4B17A 1G2EA 1HBNB 3CCLS 2B8QA 1VC6A 4M3WA 4JV5J 2ASMA 1CQMA 4YFUA 2Z1HA 3EE8A 1U48A 2V34A 2VJUA 3OUYA 2VC0A 3M32A 3ZZTA 4PKIA 2ZH3A 3GJSB 4CO1A 4LBIA 3NKYA 1KBRA 2VYPA 3GTYX 4UY8T 4ED1A 4DJBA 1LOUA 2V8DA 1N34K 1RB0A 2R8GA 4IDKA 3VN5A 4LMZA 2FC9A 4IOXA 2BRKA 2BJ8A 4DF8A 2O8DB 3VAHA 4OX8A 4LT6A 4DOZA 1MWYA 2XLKA 2DHXA 3V9SA 2ADCA 1TYQB 1JJ4A 1P8GA 5HSPA 1KVKA 2VB6A 1J5OB 3FR0A 2L3MA 1TZ0A 3CYMA 1ZBHA 1TVRA 4PZVA 2DR7A 3TUJC 1VMBA 3ZZZA 3KLHA 4AL5A 2VGNA 3MFIA 2MZTA 4NYZA 2FF6A 2Q31A 1Y3JA 3UD5A 1G3OA 4ER8A 1F5AA 3CJ1A 4JI8F 2CQPA 4CLYA 2PZSA 2XB2D 2G13A 4L3KA 1NOYA 4AD6A 3WQUA 3IG1A 4KHWA 1LXNA 3O1LA 4NCGB 3Q22A 5BJRA 4FJGA 4DR2J 3UDVA 1S59A 2FHJA 4M5JA 3VVUA 5BRFA 3FKBA 2UUAJ 4N41A 4XPCA 5M2PA 2J6SA 5B0AA 2M2BA 3QEXA 1UAWA 4RW9A 4BRHA 4KIAA 3RMDA 3CMAS 3JB9k 2AJ4A 2PT0A 4ZPAA 2QA2A 2CQCA 4NLGA 3JAMU 4CEEA 4FJKA 2UU9K 2G0JA 4EZ6A 3U1LA 3SQ2A 1TKDA 4PKGA 2YPZA 3L6QA 4TNOA 3L7UA 2ITMA 4CJSA 1N5YB 4DTOA 1HBMA 4EWTA 2DNNA 2XY7A 3OSNA 4DL0C 1X4AA 1NMNA 1HMVA 2HHUA 4IQXA 5EHHA 1TV6B 3R9PA 4KH1B 4OPKA 1RISA 5A76A 3EE9A 3AVJA 4CBUA 1EZZB 4OZNA 3R9LA 5KFUA 5CZ1A 4DUYK 1XMOK 5C15A 2E5LK 2IYIA 4JRPA 3VQDA 4CF0A 1N34J 3UR0A 1YRXA 1IBKK 5RUBA 4J9MA 1NHKL 4DL4A 4DR7K 2EI5A 2UUCF 2JEJA 5F8IA 3SAFA 3MMBA 3KVGA 1AA1B 4A8QA 5BN8A 4CT9A 1MW7A 4FYWB 3RBZA 5IWAJ 5HI7A 2LSNA 4QQBA 4LFAF 3NP5A 4FJIA 4K8RA 2GIFA 3N0VA 4BCAA 3TVZA 2DKOB 4WFBQ 4QWCA 3NCRA 2QIFA 3SBMA 2HOEA 1JLBA 3Q8RB 4CEZA 3VOVA 3DDNA 4IG3B 1PKUA 5THWA 4IR9A 1RHKB 1ZTWA 2CNNB 3TTFA 3WXKA 3GL1A 4Y2AA 2E7WA 2FLPA 4FNIA 3CIPA 4B9QA 2JOQA 2YHBA 3AB2B 4XK8C 3HT0A 5FLXU 3BSAA 3ZSXA 4CP5A 4XH5A 2G8UA 1M5KC 3DDIA 1LW0A 2D74B 4FYYB 1GLFO 4C11A 2IBOA 5LMNF 3AO2A 2Z56B 4CK1A 4WFBL 4H4OA 3WNHA 4U7BA 3OR1A 2MJUA 3UB5A 3UO0A 2VCPA 3VCDA 4CZMA 1M5SA 4CH0S 4CZCA 1Q8BA 2ZC4A 1NLVA 3RB0A 1H38A 3H25A 1K8AT 1TTHB 3ULHA 2F9TA 4UUWA 2ZUAA 2O66A 1WSIA 1HPZB 2HNYA 4PYAA 2CZ9A 3MXIA 4BRFA 4U67Q 4ZVRB 1TR0A 2AYMA 4QBUA 3F5TA 1XMOJ 5IQQA 5T41A 2E5LJ 4OI6A 4AQYJ 1QVGM 3KHGA 4DUZF 3UKUB 1IBKJ 1JL2A 1YXQA 4O0JA 4FJ7A 1KCFA 4WXWA 3M1VA 4J9LA 3HX9A 4I2QB 1WOQA 1S9EB 3NGSA 1NSPA 1RFQA 3FZKA 3UW1A 3AV9A 5G0RB 5LMUK 3UN2A 3R7BB 4NLUA 3TR5A 1KQSR 2FUG9 1JQGA 5AQVA 2YQ0A 5CZVA 3CJ4A 1MG7A 3KK3B 4PHTX 1GK8A 4DSKA 2D5RA 2GFFA 2BM0A 3R5AA 2XZDB 1VQ8S 1SJ1A 2XHBA 3P31A 4YOWA 4JKDA 3W9IA 1HWJA 3ENHA 4ZHRA 2WW4A 2HZCA 4CF1A 3CO9A 3PW4A 1QSLA 3OS1A 3U7JA 4FJLA 3MMJA 4CGJA 3AA8A 4I6WA 3CDEA 1VQMS 4C0OC 4U67L 3A5NC 4NLBA 2XULA 1Z4UA 4ELUA 2DEJA 1EB0A 2I2YA 2PEHA 4FJ5A 2X7IA 3AA3A 5GAEI 1LK5A 4CO0A 3EJMA 4XAKA 3P5JA 1S1UA 1WF0A 4M5NA 3D68A 4JKGA 4HTJA 5C5JA 2ZZNA 5HLFA 3CT9A 4FLYA 4ISGA 4YDUC 2NZTA 1H1VA 1A9NB 4JI2F 4QPTA 3HBTA 1YKWA 4BQLA 3P4UB 1HNWK 4IH5A 4MJKA 1HNZF 3K7RA 4CH1A 4CJ7A 3O1BA 4L8RB 4IG0B 2CADA 3SUNA 5FJ4A 3ID6A 3W0LA 3A1YG 2PYLA 3AVCA 3MECB 4JV0A 3WHIA 3K0SA 1SH2A 3M8ZA 1S7IA 2U2FA 4JI7F 1FJ7A 3QSYB 4RTFD 1XTZA 3WIVA 2MSTA 1ZPWX 1KVJA 4DX7A 2A42A 5KG5A 2OO4A 2W4DA 3LTOA 5HRSA 1YWXA 3S6EA 1HQUA 1GX5A 4MYTA 4ILRA 1BQXA 2FSKA 3KLVA 4OX9F 5BR8F 1IM4A 3GG4A 4YDUA 5KFOA 3AOAA 3RJMB 3FZFA 4GV3A 2AX1A 2YHWA 4H4MA 3BH6B 4ECUA 4CGDA 1S1XB 5J1EA 1NB2A 5EGYA 1CEZA 2D7SA 5AQFA 4CZKA 4WU3A 1NGDA 4ES1A 1X5TA 3TWZA 4OI3A 4QS9A 4IXCA 1HPMA 3BGRB 5AQKA 1PGZA 3WNFA 1RT3A 3IBWA 2NRRA 3CVKA 3QMQA 4GKJK 3THYA 4P10A 5IC6B 5LMUJ 3OYKA 1J5EK 1X4EA 3MZIA 4DR4F 1YRTA 2Z8QA 4MAKA 5I4MA 1JLAA 2C28A 4WF9Q 3BGOP 3BF3A 5EX3A 4CF8A 5EOYA 1NK7A 4OHXA 2QZ8A 2VOPA 3EDRB 1WI8A 4DQQA 3C6UB 1QTMA 4ECTA 4LF4K 3HF5A 1T9VA 2VQEF 3M8RA 1F9HA 4PRFA 1Z6RA 3CJ3A 5I42B 1NHUA 5DMRA 1TL3A 2KTQA 1JLEA 5GMEA 1VQ5N 4ES2A 3D2FA 5KOXA 2JVRA 2GV9A 4BRAA 4O3PA 5E26A 4CO3A 2IAJB 1S49A 1LWEB 1HIYA 3AARA 3VR1A 4WP9A 4OYPA 3NF7A 1VQ4S 5JVGQ 3LQVA 2J0QD 4M3TA 3O5BA 1FX4A 3VF2A 1HNWJ 2XWXA 1KVIA 3MAQA 4WF9L 1T0TV 3R6LB 4JI1K 3L7OA 3HSJA 5CZXA 3ASMA 1CZBA 1BO5O 1LCUA 4X4VA 1S1WA 2UXBJ 4NRUA 3H59A 4X64F 5CE3A 3O6WA 2FSNA 4FJNA 4ATNA 3VPZA 2P9IA 3ZSOA 1O0PA 3BH7B 1SJ3P 5A2QO 2MQPA 3Q8UA 3RBEA 4KT0C 2DXFA 3M2RB 4M3YA 1JL1A 2FBVA 1RAAB 2FJAB 1YF5L 3P5TL 3J7YI 2GVDB 2HBKA 5M2RA 1HNVB 5AJ3F 1VQ7S 2OH2A 1IO2A 4NXNK 4Z4IA 4LRCA 3DXMB 3J7A1 5J2NB 1RACB 5GAGU 4BRNA 5JVGL 2LXUA 1R0CB 2H4WB 3MM5A 4EZ9A 4JYAJ 2YPYA 5CY4A 1GH8A 4OYOA 1TKZB 2ASLA 1J5EJ 3CD6N 4F4KA 4DU4A 2QTDA 1EIYB 4LSNB 3I0RB 3SAHA 4QAGA 1R0AA 3RG6A 3W1YC 4ILHA 3DC2A 2DH7A 3QICA 2M9KA 3HL8A 1O5JA 4FJHA 3LZJA 1RTHA 3F56A 1KLNA 1RBRA 5AQOA 3G6ES 3W3SA 4WPAA 3CM5A 2F7TA 4PXCA 3HI9A 4RW6B 2J6TA 4M95A 1NJIO 4F7VA 3MX2A 4C23A 4CJPA 3OL6A 4LF4J 3RAMA 4X4PA 1H7XA 4BR4A 4F3MA 4GRSA 2LDIA 2XS7A 4G9ZA 3ETMA 2HHPA 4EU0A 1EKEA 2BX6A 1NJZA 2CJXB 5B0GA 3MR2A 4NYOA 2DBBA 2DY4A 5KQ8A 4A8KA 3GQCA 2ROPA 4FLUA 2CAJA 3D66A 3VGVA 2GNKA 3EPGA 1NGGA 1WBBA 1UW9A 4Z7CA 4RLEA 4K0KF 2CKWA 2HBYB 3VAJA 4O5FA 3NNCA 1HWUA 1HWKA 3NHGA 4BRGA 3OL7A 4FDFA 2E9TA 1X3NA 2VICA 1L3VA 1U47A 4WK1A 4QIVA 3BBCA 3QT8A 2FJWA 4DTRA 2PFFB 5GAGP 5D77A 3QEIA 2LU2A 3H2UB 2KT2A 4FLTA 5BRDA 2G8HA 4F04B 2BVZA 3E9PA 3RRHA 3M30B 3IR7B 2CXEA 2EKNA 2QMUB 5CYQA 4DR6F 4F4WA 3AD8C 3O8WA 2BOAA 2JJ4D 4NXNJ 4UY85 2W01A 2JGUA 3KJVA 1D8YA 3DOMA 4K4XA 1T03A 1E6VB 3ZT0A 3TAQA 1K47A 5HVGA 3RZAA 4JI4K 3G6VA 3D6TB 4CI0B 4P7TA 5K20B 3V4IA 1FKPB 1E4FT 3QEWA 3HSGA 3HFKA 1D1UA 2DNYA 4Q0BB 3W61A 3KJFB 1S0NA 4DV6K 2XRIA 3VQ4A 4K8ZA 2MQLA 1BHNA 4USVA 2FD2A 2E1MC 2XS2A 3Q8QB 3FVYA 4QIFA 3O3FA 4O44A 4JK9A 4DSIA 1A0OB 2W9AA 2CNLB 2WVEA 3BGUA 3MMAB 1NGJA 2IMWP 4ZTJA 1S48A 1NSKL 2DK2A 5EX0A 1R43A 3OTBA 2HKEA 1Q86T 3QAUA 3TVKA 1VBZA 2RU9A 4NOHA 4JKFA 1IQTA 2QWPA 2EEYA 4DG1B 1T05B 3M6GA 5C10A 3LP0B 5F8MA 3SQOP 2ZF5O 2ABYA 4AM6A 3MR6A 1QZ5A 3VQBA 3QNNA 4C8LA 2O8BB 4IWVA 3BEXA 3DLKB 2QG9B 3NWGA 5AE1A 1TAQA 3C66A 1T6CA 3OS0A 2ALZA 4YS2A 1WI6A 4IFVA 3AJ1A 1J6ZA 4FLZA 1KVBA 4DB3A 2HMIA 4CLUA 1XEZA 1WJ9A 3KHLA 1I94F 2KXFA 3KG4A 3UDCA 3LL3A 4R8UA 1KWMA 1EX8A 4J5OA 1EETA 3D4JA 2UXDF 1AUDA 1UEUA 4O5BA 1FK9B 1LW2B 3IFRA 3LP1A 1DGKN 4CW7B 1RDDA 1DLOB 3MUMP 3CCRN 3NCIA 1KHWA 4KB0A 1SKSA 4NCAA 2M3DA 3EVWA 2CZVC 4URQU 3KHHA 2N3LA 3HHLD 2E1YA 2W42A 2HNDB 3R5CA 2AZ3A 5DDQC 5ETVA 1CS4A 2VH7A 2XNQA 3CXCR 2OP5A 4ZCMA 1V9OA 1E6YA 3J7AP 1Z2ZA 4YHHF 4KHNA 1OQ3A 2IM0A 3A5LC 4DKWA 2XMVA 3HVTB 2DEIA 2I7PA 3OBYA 3QATA 5B0FA 2W2PP 1O13A 3QT5A 1LEOA 4JI4J 4K41A 1SPBP 5KFNA 3J7ZO 1K9MO 5HAOA 4OZJA 4F0KA 4JKBA 2V7YA 2PBDA 4DV3F 4WFXA 2JVOA 1MWKA 1ZBUA 5KRSA 1ATSA 1IJJA 4O4GA 2VONA 5L1KA 3D67A 4HACA 1N36F 5C0YA 1RT6A 2BANA 3W60A 3T1HK 2DHAA 4RWWA 3TJ9A 3J80U 2QA1A 1M90T 4BE1A 4OYIA 1IBMF 4ZOSA 2HBJA 1C4CA 4KH6A 2J0XA 5I3QA 5D4PA 4LF7F 2V2VA 1C0UB 3CJTA 4R5PB 3ITHB 1F60B 2XMJA 4DX5A 2HPUA 3K59A 3H1QA 2R2UA 3U1NA 1A5XA 4J37A 3NGKA 3KK1A 4V19J 3HVRA 4UF4A 2O4IA 3KWMA 4LRBA 2IRUA 1QSSA 2V7ZA 5D3GA 2BJ3A 4OHVA 2W9BB 4ZN3A 3OS2A 3G82A 5D0GA 3LDNA 4HLBA 2B51A 1LK7A 2ACMA 3D5MA 2E66A 4MK7A 5KGWA 2QSWA 2DFFA 3BS9A 3OVNA 4OPHA 3THWB 4FL9A 4BVPA 2HRUA 4WKYA 2V94A 3OYGA 4X4RA 3A8IA 4BRCA 3VQ5A 1ICEB 5F0XA 5LSOA 4USKA 2P9SB 1SJQA 4DF4A 3D9BA 3B4DA 2HSEB 3LGNA 1WBDA 2R7WA 1WEYA 7FD1A 3MGJA 3V6JA 4OHYA 4HT7A 3TU5A 1OPIA 2N4DA 1F3VA 1S76D 1LXJA 1YUWA 5D4NA 3FQKA 1MMDA 5JMVA 2CWXA 1NPRA 2CGLA 4TY8B 3UCZP 4RNFA 1OH8A 4DTNA 3PJWA 4TXSA 1GLEG 3CIZA 3TEGA 2ZJRQ 4DUTA 1VSMA 4AT1B 4LIRA 2ATQA 2UXCF 5F3ZA 2CPEA 1XNQK 3DLHA 2JHEA 2B4JA 3PX4A 2BJ1A 1S4FA 4USUA 1WDTA 2Q43A 2WOMA 2F63A 2QYCA 2O8EA 1VQ9N 2QWQA 3CWJA 2MLXA 2RQCA 2CGJA 2CNOB 3TA0A 3HO1A 5KFGA 2VKRA 3NNAA 4IH6A 2YHAA 1X9WA 2DHHA 1FESA 4KPYA 1W2BR 2D0CA 1ZH5A 2OPSB 3NCQA 3T1HJ 3CC2N 2B7CB 5EUHA 3SYZA 1UFWA 2O3DA 1RYSA 4RW4A 1YVFA 2VFRA 1CJVB 1QSYA 2VBWA 4NLPA 4RW7A 2OJ3A 3Q2TC 2ZJRL 2B9XA 2B6AB 2ZEJA 2YHXA 2RU3A 4F67A 1SV5A 4Y2IA 2NZ4A 3PTWA 3ZSWA 1QQMA 1REVA 3BQ2A 3W63A 4PWUA 3GV5B 3Q83A 2Y8WA 4FPRA 5F8LA 5GAEU 4KO0B 2V4JB 2VUGA 3CCLN 3OXFA 3LDOA 2E5IA 1H2UX 3OFHA 5KG2A 1HKAA 4O4RA 2WFBA 3OYIA 5I3PA 3AVBA 4CERA 4UZBA 4CO2A 5KFWA 1BI4B 4HUFA 2U1AA 3DNCA 3MEEB 2WONA 4DV2F 3EO3A 1BQMB 2K2PA 4H5NA 4E1NA 3HFZB 2LXIA 3W9HA 4EO8A 3DGPB 4NE9C 3R3LA 3M2UA 5GAHU 1H3DA 4RWTA 1REGX 4P72A 5JICA 1U6ZA 3DLJA 2ZD1B 2KG1A 3MAHA 2QI2A 2N4CA 5AQYA 4BDPA 4CEQA 5GMDA 4IJNA 2YKNA 2BEFA 3TW0A 4BRKA 4CFAA 4ID5A 2DNRA 4GVLA 3KUGA 3HPHA 2NLXA 4WXOA 3R1HA 3ZT3A 4W5RA 4E0DA 4U6PA 1HNIB 3V6KA 1NKBA 1HQ2A 4C6AA 2YWWA 3A8JA 2OPRA 2M8HA 1IKXA 3QFUA 3H45C 2E1AA 1ZM3A 2CJBA 3S8SA 3F73A 5E41A 2MHEA 4OJGA 3NMUA 2XY8A 4R0JA 2OYQA 3C16B 4ILJA 4XDDA 4NLDA 1RT1B 4ED3A 3HD2A 4DZDA 1VQ6S 4WJBA 3IAM9 1JXEA 1IJEB 4WQ4C 4CJWA 3D0GE 4HTUA 2DH9A 4NXMJ 3I5BA 2FSJA 4IKAA 2AEMA 1RAEB 3CMAN 2FJVA 4NLOA 3KZBA 4WTYA 4PEOA 3MOZA 3P38A 2J5AA 2RDIA 1GLBG 3C19A 5AQRA 3DXKA 3JQMA 1M5VC 5EX5A 2XI3A 1MWMA 2R2RA 5GAHP 3V6HA 5LL6Z 4X66F 1ZM2A 5GINA 2C3UA 3F2KA 4A62A 2YNIB 4GMJB 1RWOB 1HJOA 2BQRA 2IS3A 3N6MA 4DQ8A 2CQBA 4ZVPB 1ZBLA 3TR8A 2ADBA 4F2SA 1RKIA 3FLCO 3AQOA 3T5KA 5E3RA 5M1PA 1XK8A 1NK9A 1VSFA 2LP4A 4OLPA 3P3DA 3D6RA 3LAKA 1RT7B 2V9WA 5KFPA 1PSDA 4EFHA 1V3SA 5T7LA 1X31C 2A3ZA 2EPIA 4JI5F 4HCCA 2NCKL 4MFBB 3QIPB 4OYZA 1J9AA 5C42A 2DNGA 3CF5Q 4QR1A 1BQNA 2QM1A 3VTHA 3SFUA 1RI7A 2XWYA 3M8PB 4TU9A 4PL7A 1GT8A 3CJ2A 3PW5A 3J7YU 4U8VA 4LF9F 3EZUA 3W5YA 4YOYA 4HH0A 3U27A 3QEVA 1FNXH 2HRYA 2YKMA 5JJBA 3G4SN 2ZM6F 3MFHA 4LR9A 5AZJA 1B0PA 2VBZA 3PG9A 1HHQA 3KMQA 3AHPA 2EG2A 5ADZA 3KK2B 4IBNA 5KFRA 3QIDA 2Z1JA 2AA4A 1FRHA 2A5XA 2HS0A 4NI2B 3GE9A 2JFKA 2NLWA 4BC4A 4CESA 1VLOA 2CQDA 4MIAA 4E3SA 3V81B 3RMBA 3SCLE 4YMEA 3OV7A 3UE2A 5KFIA 3BPDA 3RWUA 4CFBA 2HHHF 3M8WA 3CF5L 3Q89A 2NR0A 3MEGB 3SPYA 3I0SB 2OHDA 1ILYA 1T95A 3IS9B 2XBPA 2VZ9A 3CFRA 3VAKA 1ZPVA 2OPQB 3NBPA 5SUHA 2BKPA 3SQ4A 4OQJA 3FQLA 4BREA 2QFJA 2MJNA 5CQGA 2FJDB 2R4FA 4A8WA 1JKHA 2AP6A 5JMNA 2IGIA 4DCJB 4OZ3A 2ZWPA 3FNNA 1U2RA 3AO5A 1FDBA 2AZ1A 2OFGX 4V19X 3PEHA 2OD4A 1CJUA 2Y1RI 4H8KA 2OZSA 1HWLA 2DGSA 1S99A 1TL7B 2B5JA 1C1CB 1K9MT 3MURP 4M5DB 2QW9A 1FW6A 2HK2A 3TA1A 5TKYA 3QBXA 4CJ4A 1AYEA 1IVZA 1HBUB 4WIIA 1TMJA 3E2EA 1R31A 4AM7A 4DV1K 3BBBA 3V6DA 2FDNA 4E7HA 3OFFA 2Q6CA 1BL3A 3KUEA 3H42A 4IOBA 3CHWA 3R1LA 2HQDA 1YHQS 4OX7A 4M5IA 2Z57B 1GXLA 3E51A 5L9NA 2EK6A 1FRLA 4RW8A 3OR2B 4PL8A 3PYGA 5HJXA 3MAAA 1RDBA 3MMVA 4P7VA 1IBCB 4L73A 5K8PA 4IFYA 1FKAF 4OI1A 1L5UA 2Q97A 2V8HA 3H7HB 1CJTB 3RVCA 1NSAA 2W1BA 2XYPB 2HHVA 3DOKA 1XR5A 3NFAA 1W25A 4DPXA 3QBWA 1VQMN 4LH4A 3RU0A 4P6QA 4B9VA 1JCGA 1S57A 2LFVA 4OYBA 4P73A 3NH2A 4LQ3A 4L74A 5EU7A 2X1GA 1R8PA 2GJ2A 2C3MA 2RKIB 4A2BA 2LA6A 5KFZA 2XMKA 1PG5B 1HD0A 4J9VA 1K0TA 5F0UA 3VGMA 3FEZA 4ICLA 3UWTA 3GWCA 4FWKA 2CQIA 2LDYA 4YY3F 4AHRA 2KKHA 4M42A 3ENBA 4KPCA 3IRXB 1NK6A 4KH4A 3VQAA 4HKQA 1SUQB 2V4RA 2OSQA 2EWHA 2RAQA 3S41A 4YB6A 1RHMB 3W2VB 5I3UA 2E6LA 4Y65A 4M3XA 4O23A 3D2EB 4NPOA 1QQNA 2QYGA 4LFBF 4B3SF 3ENQA 4JV1A 2HGMA 1LWCB 1XMQF 4IRKA 1Q16B 3MCMA 1CJKB 3OFGA 1AB8A 1OSDA 4MKYA 2CYYA 4AHCA 1RAHB 3BO2A 5AZIB 3SQ1A 5CYJA 2ZWOA 1RBOB 1ZZFA 4DV1J 4USMA 1S72S 2BUNA 5D15A 1Q18A 5L38A 2OA8A 8RUCA 4FXWA 4NZ7A 2H3EB 3H3NO 1HWIA 5GADI 2L9WA 1QQOA 1HA1A 2DNKA 5F8HA 1HBNA 1XIQA 4DR1F 1TK8A 2Q1LA 2HZAA 4X4NA 2ZOFA 3K89A 2BE7D 4B3TF 2HW3A 1PJ6A 4WTOB 5F41A 1RAIB 2RMLA 3K8WA 4BC7A 1TUGB 4CHOA 3C14B 3O4QA 2RDJA 3OL8A 3IAYA 4ZJOA 1WKLA 4NYFA 2K7JA 5BYRA 2HAIA 2IVNA 3D45A 2PFDA 3SPZA 2W6KA 1D5AA 3EYZA 2IM1A 1FX2A 2RRBA 3GIKA 3UKRA 4DCHA 1BC6A 1B9DA 2O8DA 4GV6A 3RBDA 3KIOA 2HF3A 4Y6IA 4NEYA 1FWKA 1I51B 4CTAB 3SI8A 5AQWA 3CPWR 1FT8A 3W2WB 2KB2A 4O0IA 1VQ4N 1RLDA 2HMPA 1J5OA 4IYQA 3SQGB 1GMWA 1RHUB 3VAGA 3L3UA 5DG7A 1D3WA 4LJMA 5J2QB 1NM1A 3FSXA 3HSTB 4DU1A 3FRZA 4M3RA 3THVA 3SAGA 1FNMA 3GFYA 3U3GA 1JB0C 3ENWA 2YH0A 3F0NA 1WF2A 6AT1B 2ZBPA 4I68A 5CCMA 3TZYA 5BR9A 4NCGA 4X62F 2SXLA 2F5GA 1K8KB 4YP3A 1HI1A 1P27B 2AQ4A 3M6WA 5AQHA 4AHTA 5KFBA 4F2RA 3LDPA 1XJWB 3KLGB 1VQ7N 4P71A 1NXIA 4BC2A 1WSFA 3AA2A 2ZITA 2JC1A 4B3OB 4KHQA 1ZBTA 2DO0A 4ZVQB 2NUUG 2RUSA 5AQIA 3EVOA 1N5YA 1O1WA 4CE9A 3FEXB 4ED0A 3FZMA 2XO7A 5K8OA 1VK0A 3CCWA 3OD2A 1FTRA 4JB8B 4BGAA 4FXDA 1TV6A 5DM7Q 2D3OR 2QKKA 1DQAA 4ZVGA 2NUBA 4F3QA 3AXMA 2GMHA 1S9FA 3NMAA 2MY8A 1YRUA 2ERRA 4ZS6A 4OZ1A 1GLDG 3MX5A 3AJ2A 1ACMB 4CH7A 3SSRA 2MQ8A 4PG5A 3NGZA 2VL1A 1WSHA 5MLCV 1Q8KA 2VBYA 3UCGA 3EKUA 3GJRB 2FLOA 3M9NB 3N4PA 3VF6A 4KC5A 4KGVB 5BRHA 5HK4A 4ALZA 1UAXA 1VQOS 3DXSX 1B4SA 5TKWA 4ZN1A 1FJCA 4WBFA 4N5SA 4BRIA 5CCLA 4ISFA 1N88A 4DLGA 4DR2F 1BE4A 4IG3A 1NBWA 5DM7L 2P5GA 2YKPA 3LOUA 1Z1ZA 4OPAA 1PAUB 4EYHB 1NDCA 5F9NA 3PRDA 3P83D 1XWLA 4NASA 2L41A 4CBXA 5D0RA 3M8QB 1VBXA 2W2QP 3FGUA 2QWLA 5IV3A 1RTJB 2EFNA 3J81U 3OVBA 1Z05A 4OJ1A 2Q0RA 3RB3A 2FQQB 1NPKA 2E2NA 3C6AA 3MR7A 4DV4F 1L3UA 4GY2B 3QFHA 2PEBA 4OYWA 1QAIA 1ESVA 2GS8A 3GFZA 5KFLA 5DS7A 4RG8A 3MM6B 3CC7S 1ASWA 4PXEA 3IRWP 4CHQA 2Z2YB 3N9UC 2J9DA 3UNGC 4ZP6A 3JS6A 3MOJB 3I8DA 3WC0A 2IA6A 2F40A 4KTWA 3R5DA 4ZJLA 3CCJS 2ZBCA 3T5HA 5IS2A 3VQ8A 4JV2A 2KU7A 3OYCA 2W7OA 5ETLA 1S6QB 1QTNB 2VPZB 2J9EA 1HPZA 4LC9B 3AH6A 1W7WA 3GPAA 4LSLB 3ADAC 2XC9A 5EVZA 1W0HA 1X4FA 1SS6A 1LWXA 3IXQA 4ILLA 4YORA 3KJNB 2DNQA 4J2AA 2QLFB 5FPMA 1IBLF 4RBTA 4EBEA 1JX4A 1H0HB 3HHLB 3OA9A 3UKUA 5AQGA 1RBVA 4U8YA 1QD1A 2J6UA 1ZM9A 4CZHA 2VPYB 4I2QA 1S9EA 2BKNA 3EXCX 1TL5A 2ZFHA 5G0RA 1VGYA 1AFJA 1R7IA 4OPJA 4FKXA 4KHRA 3VHQA 3Q23A 4BR5A 5FPEA 1VQNN 4RBVA 4FJMA 3GJTB 3KK3A 4H0TB 5AQQA 1X4GA 2GMJA 1N33F 1RTDB 3H4BA 2MLZA 5T7BA 4DEZA 5KFXA 4H03B 5KT4A 2ZZTA 5SWMA 1G15A 4QIGA 2AYGA 4AFFA 3MDFA 2BQ3A 3ATUA 2BJDA 4I1TA 2R42A 1ZXOA 1P1TA 4CJRA 4IJAA 1QUPA 5IT9U 2AJFE 3DYAB 3ZYYX 1RGVA 3NGTA 3BKFA 3RR8A 4MDAA 2UU9F 3GOIA 2ZHOA 3A12A 3QEPA 3DOLB 2YQ1A 2BABA 3S9HA 3TRGA 2MYFA 1NB7A 2DPIA 2VC1A 4YEAA 1AFIA 2HVEA 3PY8A 1DZ5A 1A5VA 3JQJA 2NSBA 2BDPA 3NL0A 4DPOA 3H5XA 3G8SA 4PQUB 3JAMO 4LFCK 2JRSA 4UOFA 4CHZA 3JSYA 4IG0A 2DO4A 1Q8IA 3Q86A 2QEXS 1LWFB 3EMTA 3MECA 1WTFA 4PWWA 3S3NA 3G25A 3T69A 4JKHA 4Q5VA 2UUCK 3IKMA 4DUYF 4C97A 7FDRA 3CCTA 3GIRA 4IEEA 4UOCA 3LDQA 2DXDA 3SEOA 1J2VA 2DITA 2ZNZA 4DR7F 4CNZA 3CEDA 3CI5A 3D54A 4FCYA 3K5OA 4LFAK 2G9OA 4FZXC 3K5MA 1S1XA 3J81j 2PI4A 1RBSA 2GO8A 3UI3A 4H5RA 3MCOA 3WNEA 1MN7A 1U1KA 4M5MA 1V3RA 1IG8A 3U9ZA 5AFUA 4FF3A 2ZOMA 2AWZA 2MZJA 4NZ6A 4JK8A 2E1RA 4G1PA 4DL6A 2IDOA 1SL1A 4OJRA 1DEJA 4JI8J 3NWRA 1K1QA 3CJSA 5T14A 3QO9B 2CQHA 1VQPN 5LM7E 3B6BA 3DXBA 2HLTA 2EBEA 3NVKA 4OZ2A 2FJBB 3CW2C 4OJ3A 3T41A 4ECVA 4DBQA 2A6AA 3A8EA 3ZT1A 1NBEB 5AQTA 3O2IA 1EP4B 2AKWB 4PAAA 3VWSA 4IO9Q 3FJ2A 1M5HA 1HYZA 3QB0A 3Q8YA 1YBUA 3EZ5A 2R7XA 1YIJN 5H9EK 1URRA 3T1YK 1N54B 4I6YA 3C6UA 4I2PB 2AJ1A 3DHWC 2J8SA 1U1MA 1XHXA 5I42A 2NXJA 3GFHA 2YXLA 1NU4A 5KOWA 2PO4A 1BWEA 2DGWA 4LSZB 1W2IA 3WNGA 5H1SQ 4DTUA 4ZVTB 3OJUA 2DGXA 1FRXA 1T9UA 2IAJA 5FLXO 1X5SA 1LWEA 4DCOB 3MCSA 2BQUA 3HD1A 4WYBA 2G8KA 2HGLA 3J7Z5 3WQTA 5ETQA 3G2XA 4ZLJA 1XUPO 2O8CB 2J9CA 3Q2SC 4KQZA 4BWMA 5J2PB 3HLUA 1RADB 1GOBA 3TSUA 9ATCB 1QVGR 4E19A 2VG7B 4E7KA 4CIOA 4IO9L 3CCVS 5F3TA 2WVCA 1VISA 2ROGA 2PE8A 4DUZK 4P75A 5AXNA 2RUGA 2HRTA 1T8EA 3NLCA 2UUCJ 4QYZK 2VG6A 4A8OA 4MO5A 3PJXA 1NAQA 4CQ1A 3FE1A 1HBOA 2YCHA 1WOPA 3GB0A 4XPEA 3JAMY 2CJKA 3TUIC 2I5JB 3M2RA 4LFAJ 1P9YA 1RWPB 1R89A 3KD5E 2GVDA 4J9SA 5JS2A 1YI2N 4WQ5C 1HL6A 2ATCB 4KHPK 2ILYA 1KQSM 1HNVA 3RTVA 4M3ZA 5KT5A 3DXMA 1WD6A 5J2NA 3UVJB 3S3MA 4CT8A 1P8ZA 5AXLA 4HI2A 1Y11A 4QS8A 1SJ4P 3HVWA 2PMHA 5DQGA 3JSRA 1VC5A 1APSA 3MM9B 4RU9A 3R27A 1TKZA 1JLGB 4WP3A 2A18A 4F25A 4LSNA 3VQCA 2YNGB 1MWQA 3MR5A 3I0RA 3PYDA 2CJ9A 4CM2A 4M7XA 2I1RA 4YOVA 4LVOP 4FF1A 3IBCB 1V5VA 1SKRA 1ZM4A 4AL6A 4WQ5A 4XH4A 1F9FA 2DRBA 1MROB 2ZH2A 4CJUA 3LALA 4RW6A 1WC0A 4DX6A 2F8TA 4FWQA 1HNZK 4K4UA 3TAFA 1IKVB 1TFWA 3IP0A 1EHWA 1TP7A 3GIIA 1G7CB 1RDUA 4MT1A 2D1KA 3FBEA 4ZCLA 1CC7A 1QM9A 1T94A 5AQMA 2JX2A 3UCUP 2X6SA 2XI2A 4A47A 3AA5X 4H0YB 2PY5A 4LF6F 3HT3A 2V63A 3GFXA 3W7BA 4Z2XA 2P9NB 4OX9K 1U2VB 4LF5K 5BR8K 2DHSA 4FVUA 4WFZA 3AVNA 5DJBA 4P2XA 4CEAA 5LY3A 1JLCB 4KHMA 3T9ZA 1KQGB 4KGKA 3VGLA 2GGPB 2HYIB 3SUOA 3BUZB 2V9KA 2DVIA 4DUZJ 4JS5A 3WXMB 5DDOC 2X51A 5FLXY 2QN6B 4RU2A 3IGNA 4QYZJ 3KJQB 3LDLA 3IC1A 4CLKA 1S97A 5GADU 3HM8A 4MKAA 1WHYA 2FXUA 3SCIE 3H0PA 5A8RB 2EFGA 2DTUA 4Z0UA 4DR4K 1DT9A 3B6OA 3V5RA 5E5NA 5D8HB 4LF8K 3AVHA 2I6WA 2MPUA 2PN6A 4DL2A 3CMES 1XHZA 1VQ6N 3M30A 2Q66A 4GKJF 3R5JB 1J5EF 1PYSB 2H5JB 1Q0NA 3SIPB 4EO6A 2QO3A 3JSMB 1E6VA 2XGPA 3DI6A 2JWNA 2NQPA 3U9DA 3CDWA 2VQEK 1YK9A 2ASJA 4BR9A 4ECRA 3BO3A 4I9QA 2PFUA 1BOTO 1X60A 1FKPA 1WB9A 4KGZB 5F8NA 4Q0BA 1BG3A 4P52A 4EI2A 3L0QA 4F4AA 2HZVA 4JBCA 4WYLA 4C0HA 4BS2A 3C7NB 2YI1A 1H98A 1YZ6A 1YTYA 1IM6A 1GMVA 4E7LA 3MMAA 2NRTA 4B1WB 1HNZJ 5IT0A 2A2CA 1GXUA 3O9QA 4ILMA 2CG4A 3ELHA 2W9CB 4OLOA 2HNYB 3DLGB 5M1QA 5I9EB 4BR0A 4IKFA 2BE2B 1D0EA 5LOQA 4DG1A 4JI7J 1T05A 4MKBA 3LP0A 3WX4A 5HQ8A 1Q82T 4D3GA 4JI1F 4AILC 2O8BA 4CZLA 3PX6A 3UFCX 1X0FA 4DPWA 1VSLA 3DLKA 3G8TA 5GADP 3AXKA 2C2EA 3U8XA 3PUFA 2QWMA 3HJVA 1XBWA 3FBBA 4OX9J 1BIZA 2DTJA 5BR8J 3RAQA 1YBTA 5EWGA 3HDSA 1JNZB 3W64A 3ZTQA 3DLRA 3IMQJ