3O9UA

Effector domain of influenza a/pr/8/34 ns1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
SRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Nonstructural protein 1
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
total genus 32
structure length 116
sequence length 116
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9uA00
3L4QA 4OPHA 3O9RA 3RVCA 3O9SA 3EE9A 2GX9A 2RHKA 4OPAA 3O9TA 2KKZA 3KWIA 3M5RA 3O9UA 3D6RA 3KWGA 3P31A 3EE8A 3P39A 3O9QA 3F5TA 3P38A 3OA9A
chains in the Genus database with same CATH superfamily
4B9SA 1FW6A 3O9RA 4DU1A 3ZSZA 3DXKB 1E3MA 2NUBA 4UQGA 3MECA 4H03B 1NK0A 4BC4A 3LP2A 5LY3A 3H45C 2ASMA 4K25A 3D6RA 2GUIA 1SQKA 3KD1E 3SUOA 2P9KB 4YNQA 1ZBSA 3SBTA 3QIPA 2HBKA 3M8SA 4JYAK 2WUSA 3JSMA 1HYZA 3PLAA 5BPLA 3ZSQA 4BC5A 3CG7A 4DFKA 4GKKK 4FL9A 1U2VA 1RGIA 1TGOA 2BGGA 4ILGB 3TR8A 3F9MA 2JLEA 2OZMA 3UKRB 4IO8A 2YJFA 4FJNA 4LF9K 3CM5A 1P90A 2GEMA 2R7YA 1E4GT 4LH4A 3ID8A 4CHQA 4RW9A 1RT7A 4CJ4A 5E84A 1HQUA 5AQLA 3SPYA 5C12A 1IO2A 4M7YA 4B8CA 1LAVA 1NG9A 4OPAA 3MCAB 1RNHA 4WYBA 1JCFA 3DAWA 4DTXA 2VQFK 4C8OA 4M3UA 5M1PA 2EHGA 4ISEA 3QEPA 3MWPA 5BN9A 5JS1A 3I55N 4CJEA 1KLNA 1Q9YA 3AVKA 3PSIA 3QNNA 3HSCA 5JVHL 1N32K 1VSEA 3AO5A 4FVUA 1HX1A 2O8BA 2E2QA 3CQYA 2HHUA 2HB5A 3SQ1A 2I5JA 3ZCMA 3VQEA 3HOSA 3BUZB 2ATQA 1K73O 4FPAA 2P9IB 4HVJA 5TKYA 4BVPA 4CJTA 2JWKA 3DI6A 3OYMA 2X6NA 1N8RO 4E7IA 3WQUA 1HUXA 3P83D 3CCEN 1VQ9N 3AY9A 3CI5A 1GLLO 1HNVA 4WCEL 3RMAA 4E3SA 4YFUA 4XEIA 3OYLA 3DLRA 1P8ZA 2YX6A 4CERA 5F2RA 3OY9A 1HYSA 4IOCL 3LWLA 2G8KA 4J2EA 4QOZB 3AO2A 3KZBA 4H5VA 1JL2A 2QW9A 3VGLA 4WQ5C 3J80O 4M3TA 4CZJA 5AQSA 2D4WA 3GG4A 1UWBA 4BR2A 5AJ3K 1E4FT 3VEWA 4AH9A 2F9TA 4CHYA 1RT4A 2RKIA 1X9JA 1D8YA 1DT9A 1LAWA 3CQ8A 3HM8A 3QERA 3DXMA 5LL6Z 1WLJA 3PX0A 1IBKK 3J81O 2YNHA 2FLOA 4DLEA 3H6EA 3RRGA 3L4QA 3HVRA 3QB0A 4DSJA 3JS6A 1WSGA 1FJGK 1CZAN 4L3QA 3DLLL 3G71N 3WXLA 3PX6A 3AVNA 3K5NA 3QNOA 3FZLA 5CHIA 1S1TA 4H0VB 1Q82O 2A40A 4B3MK 4ILJA 1KRPA 5HRRA 3QIOA 3VPZA 4A2BA 4I7FA 4IG0A 4BE0A 1NK7A 3H3NO 2YKMA 4MDBA 2O8CB 1WAJA 4FWMA 3SUPA 1D9FA 3MCPA 3CQXA 2HHTA 3THYB 4CIFA 2QKBA 1YI2N 1SAZA 4BE1A 4U67L 4BQLA 1BIZA 1BUPA 4GV6A 3OS2A 3RMDA 5F0XA 3QBXA 4DV2K 5H1SQ 1QTMA 1QHAA 3OYCA 3JAMO 1FK9A 3G0ZA 5CR4A 2QWLA 1D4XA 3A0IX 3THWB 3SJJA 1ZBLA 2YNGA 2Z1GA 1JCGA 2ZJQL 3HBTA 1UAXA 3U6FA 2UUAK 4KHUA 3AGRA 2IOCA 3MXMA 1NGGA 5BRDA 4OGCA 4HUEA 3EE8A 1NGFA 3HRGA 2GTDA 2P9SA 4IKFA 3VQQA 2NRVA 5HRNA 3P38A 1VQ6N 4DMNA 1U6ZA 1C1AA 1NBWA 1NKBA 4I6MB 3TAEA 1W2BM 3ZT2A 3J7ZO 4CE9A 3Q7CA 4DS5A 3MEGA 4JNEA 2W42A 1A5WA 1NK4A 3UIQA 4FZYA 5CZ1A 1UA0A 4N76A 4W5TA 1HKGA 2UU9K 4DCHA 1QS4A 2E1ZA 4BRHA 1XWLA 1IBLK 4Q0BA 2OCEA 3HO1A 2V52B 2GELA 1Q18A 3T1AA 4JI2K 5AQOA 3AO3A 1J54A 3MEDA 4M3XA 2OPSA 5KGXA 4PHTX 3L8BA 1Z05A 3N4PA 1QVGM 1ASVA 4GV9A 4BRFA 2DFHA 1DEJA 3KLFA 3DLHA 2QKKA 2FSNA 3P39A 2ZJPL 2NRXA 4TSXA 4BDZA 3S3OA 3O80A 5FRNA 1YUWA 4B8AB 3F9KA 4EP4A 3R8EA 2OANA 3VGKA 1Z25A 5GINA 2E2OA 3JYTA 3PUFA 3VA0A 3QEIA 4JKCA 4KRFA 1HRHA 4YORA 4CFBA 2IIRA 3VGMA 2HBJA 2W40A 4KHQA 2PBDA 1RT1A 4DFPA 4CEFA 4IBNA 2KZZA 3AVGA 2A42A 5DM7L 2V7YA 4WQ4C 4XIUA 3OTOK 4DF4A 1BL3A 3NF7A 2UXBK 2HHQA 5HL7L 3WXJA 3L0QA 4Z4HA 4U7BA 5EX5A 3SBGA 3K9KA 1D5AA 5A2QO 2Z1IA 3ISNC 3R6MA 4B1WB 3VQ5A 3EYZA 1WUAA 1VQ5N 2A1SA 5GAGP 4CFCA 3DXKA 4DR1K 1IG9A 1WSJA 1NGCA 3ZSWA 2E4LA 4YOXA 3TAFA 1S9GA 4I2PA 3S9HA 4WFNL 1JLEA 2P9KA 1X9SA 5AFUA 3RSEB 2XY6A 4JKFA 1XHZA 4LF5K 3VQ8A 3EZWA 3CCLN 1TKZA 3F73A 4LFCK 1LW0A 4W5QA 4M3ZA 1H1VA 1KQSM 2QK9A 1VHXA 4A57A 4MO4A 4B08A 4C8NA 1Q81O 1WB9A 3CFOA 1D9DA 3UKRA 1RCHA 3BZCA 4ZHRA 2IAJA 5HROA 4YOTA 3EEQA 2BUPA 1JXEA 4DS4A 2GWKA 2CH5A 2IVNA 4NLBA 4ELTA 5CZ2A 4CIGA 3EO3A 1BI4B 1DTTA 2BDPA 4CZFA 3A5LC 5KGWA 1S3XA 4KHNA 4FJMA 3CJAA 4B9MA 5KPZA 5AQYA 4H0XB 1L3TA 2D0OA 3VN5A 4CGDA 1KCFA 4DTPA 1XNRK 4CF9A 2V7ZA 2F7TA 5CY4A 4KB0A 4CGIA 3S3NA 4Y0WA 4I9LA 1IBMK 3WXKA 2P9LB 3FZHA 3IMXA 4KFBA 2J4RA 4CZMA 4EFHA 2UXDK 5FPDA 2A3ZA 3SJHA 1V4SA 2X6SA 3D2FB 3DM2A 3OA9A 5DM6L 2UUBK 3VQ6A 3G10A 2P9IA 4CHZA 3PX4A 3L2RA 1NKCA 2HBMA 4CEOA 2F9WA 2RPIA 3O9TA 4JRQA 1XHXA 3FR0A 3BDPA 4FLYA 3MK6A 4AHSA 1F21A 1OH8A 2D0PA 3NAEA 3VQ4A 1ZXOA 3CJCA 4IO9L 5HRPA 5FPMA 3TAQA 3RR8A 3L2UA 3LP0A 3CXCM 1RDDA 5F1XA 1NWKA 4CJ7A 4RW6A 3VQCA 2FC0A 3LP1A 3P1GA 3TAPA 3QO9A 4ID5A 3VENA 3DOLA 4R5PA 4CJKA 1KFDA 4JKDA 1JJ2M 1S6PA 2O4IA 2IDOA 4NXMK 2O8EB 1W97L 3V1QA 4KHSA 4DTRA 1BA1A 3DOKA 4X66K 2YCHA 4KI4A 3ZSXA 3U9DA 4Z4IA 4LC9B 2Q2RA 5JMVA 1QQCA 1VSMA 1S22A 4QCLA 2HVHA 4JI8K 3E1YA 1T3VA 4L8RB 3FLCO 2P9UB 4CGHA 4X64K 4CZHA 1YHQN 1S1VA 3FFIA 1GOAA 1QSLA 4KB1A 5C24A 3PO5A 1OKJA 2P5GA 2XY8A 5AQIA 4JI4K 1QQNA 5JLFA 4JLHA 3WNGA 1TUYA 1OH7A 3L6QA 2Z1HA 5AQQA 4FWPA 4FCYA 5E26A 4F3OA 4DKWA 3AVFA 5AQUA 4WE1A 1SL2A 3VEOA 3SV3A 4K8ZA 4IOXA 1MA9B 3DRPA 3FZKA 1U45A 4E7LA 2QWOA 2O8CA 5AQGA 4DQQA 3T19A 1K8AO 4F2RA 1O13A 5HOOA 3VEYA 3THYA 5EOYA 4KV8A 2IVPA 1I3AA 3D0PA 4DG1A 4FO0A 4JKHA 3B6PA 4M63C 5AZJB 3TARA 3RRHA 2ZGYA 4AM7A 3QEXA 4LF8K 3SAHA 2W41A 3H46O 3QLHA 4ID1A 1KFSA 1BO5O 1KAYA 4NCAA 2YNIA 4C8KA 1WNSA 3HYFA 2WONA 4MLEA 4BVOA 5M1OA 2HHHK 2D5RA 3THWA 3NFAA 4V19S 3ZSOA 3IUCA 1WSHA 2QEXN 5GAHP 2OTJN 5AQMA 1SUQA 3L2QA 1XMQK 3NVMA 4DSEA 4JS4A 1I94K 3I8BA 4NCGA 3AO1A 5CE3A 5GIPA 2E2PA 5EXWA 3OBYA 1REVA 1WN7A 3P4IA 1WBDA 4GW6A 3HI0A 3SUQA 1YXQA 3CPWM 2LSNA 4B3SK 4I6MA 3K58A 2E1YA 4HTLA 4KKOA 4DQIA 2VWBA 3EL2A 4JK7A 3HJFA 2HHVA 3KK1A 4OPHA 1KXPA 3O4QA 3I0RA 3OS1A 1VRUA 1RBSA 3VA3A 3V9UA 1Y64A 1HPZA 3HPHA 4W5RA 1M1KO 1LWCA 3NH2A 3KKRA 3NF6A 3ZEUB 5C2FA 3KWIA 3OS0A 4JI7K 2HF3A 5EVZA 2VWJA 3EY1A 2XY7A 3SCXA 1JLGA 4HCCA 1C0FA 3KLGA 3NGYA 3CMEN 3DWLA 3VQ7A 4CZLA 3QFUA 5T7BA 1ITGA 4XH4A 3ZX0A 1A5VA 3CJ1A 4KBOA 4IFYA 3J7AP 2KQ2A 1L3VA 4FJGA 4DQPA 3UE5A 3E01A 3SPZA 3U4LA 4CF0A 1HLUA 3V1OA 4OGEA 3DLKA 4DR5K 3P31A 4PWDA 3IRXA 3O3HA 1RT6A 3HT3A 3M1FA 4H0YB 4IDKA 1IG8A 4JI3K 5GAEP 5I9EB 3KK2A 5AQHA 3G4SN 2GV9A 1RDCA 1TYQA 1VSJA 1XQSC 5KPRA 3MXJA 3THXB 3SQ2A 4QAGA 1CLQA 4BR7A 3HOTA 5AQXA 3ZSRA 1C0TA 4CGJA 4WFAL 3VQPA 1BA0A 3SQ4A 4DQSA 4B9QA 1SL1A 2ASOA 3HL8A 3OYDA 2F96A 1SKRA 4B3OA 1VSHA 1CXUA 4JS5A 1TKDA 2HHXA 2BH1A 1U04A 1EWRA 4HUFA 3SK3A 4CD1A 4B9UA 2F8SA 1NMNA 1DGKN 3LDQA 4GNIA 4LFBK 3MAQA 3MMVA 4CGFA 4NLCA 1VQ8N 1T7PA 1VAZA 3SAGA 3DJCA 1BWFO 2KLAA 3PY8A 1U48A 3Q7BA 1L3SA 4BRPA 5AFUH 4RW8A 2HMPA 4E19A 3RSEA 4J2AA 4KH6A 2I7NA 2NRTA 4O5FA 2YHWA 3KKSA 4WFBL 4KREA 4WQ4A 3D2EB 1YTUA 1C1BA 1I39A 3AVHA 3GOIA 4GVEA 2GUPA 4A5BA 1IJJA 1X3MA 4PY5A 4J2BA 4FK0A 5GIOA 4H8KA 2DFFA 3CCUN 3HVTA 3VTHA 4PKIA 2CGKA 3TABA 4KHYA 3CMAN 4KH5A 3V4IA 4F3TA 4CHOA 1X3NA 3O4WA 3KVGA 1U47A 3EKSA 3C0BA 3L3VA 3EE9A 4DV6K 1BI4A 4IOAL 3PIOL 3M3ZA 3TANA 1N33K 4FWLA 4FK2A 3AV9A 1OVYA 2E20A 4GVMA 1N6QA 3T1HK 4LH5A 2ZD1A 4CHNA 3LZJA 1LCUA 4DR7K 3CCRN 2E5LK 3OHRA 2A1RA 4IJAA 3O1BA 1HMVA 4FJLA 2P9LA 1T8EA 5EU7A 2RHKA 1NGBA 1HYVA 4Z4CA 5J1EA 1VQPN 2PYLA 1U49A 5KPTA 3D2FA 1SKSA 5ELZA 4KPYA 1XMOK 4PKGA 4G9ZA 4JKGB 4CJQA 5SWMA 3O5BA 4AHVA 2VGMA 3C7NB 3HXMA 3RWUA 3OBWA 3TAGA 3RMBA 4BQZA 2QA4N 3L3UA 4NYFA 2A6AA 4BROA 2GX9A 3VESA 2VG6A 3CJ9A 3KIOA 3BF1A 4JI6K 2HMIA 1NGDA 4OKJA 2P1JA 2CH6A 4O44A 4E1NA 4BRGA 3V9ZA 4CD3A 5E41A 3TSUA 4ELUA 1J6ZA 2PY5A 3ATVA 4FOIA 3V1RA 1TKXA 3WEEB 1KAZA 1HNWK 1C0GA 3T1YK 1LOTB 4M41A 4BRLA 4BY9C 2WBNA 4CECA 3NH0A 3HP9A 4CIEA 2O8EA 4JD2B 4R79A 1YJNN 5JVGL 4CJ5A 3C6TA 5M1NA 5C0YA 3M5RA 2VYPA 3VETA 1QVFM 1HJOA 4BDPA 3V9XA 1VQKN 4AHCA 4FJHA 1RTJA 1XC9A 1OVQA 4MQ3A 1UOCA 2F4VK 1WSEA 3CHWA 4JKEA 1ZBFA 3HSTB 3C6AA 4H0TB 2ZQBA 3ZYYX 1HPMA 1YT3A 4ZTJA 3RMCA 4BACA 2P9UA 2OPQA 1G99A 4M42A 3AVLA 4CJFA 2YJEA 4ZTFA 1KTQA 4B9VA 4FK4A 3J8AA 3KK7A 1O1WA 4FWQA 2Q36A 1T05A 4FM0A 2Y1IA 3UKUB 1YIJN 3ULEB 1JCEA 1S72N 4FWSA 3SV4A 4YOUA 4OVLA 3M6GA 3WNEA 2NRHA 2QI2A 2QWMA 2G8IA 2KTQA 1NK8A 4FXDA 5KQ8A 2VG5A 4DB3A 5BR9A 3KTQA 5FDLA 1YJWN 4CJWA 4CZGA 1OH5A 5EY4A 2OA8A 3QDKA 1GLDG 1IKVA 5KI6A 2PZSA 1YTAA 1QZ5A 3SI6A 4JI0K 3HPGA 1JLQA 4IXCA 1ZYQA 4Z0UA 5AZJA 4CEQA 4K41A 2QM1A 4H0PA 4N56A 3ASMA 4K8XA 3V9SA 4FSVA 4YOYA 1OH6A 3CC4N 4CJSA 4EHTA 1KVBA 3GE1A 1Q8IA 4LF4K 2ASPA 3RVCA 3PIPL 1S1XA 3LAKA 1BU6O 1S1WA 5M1QA 3S41A 1DKGD 4YHHK 3DLBA 4LF6K 3QETA 4N41A 5BRHA 2NNWA 5BRFA 1C1CA 3WT0A 3F5TA 4DV1K 3HM9A 2O4GA 4CJVA 2Z1JA 4K43A 4DSLA 2PYJA 4AF1A 4BRCA 1RDUA 1ILYA 3TPQA 4B1YB 4BR0A 2FF3B 4HWIA 1EWQA 2YI1A 1NK5A 1HR0K 1QQOA 1W7AA 3L2VA 2DPNA 2W6KA 1GLCG 4CJLA 1NU0A 4IFEA 2ZGZA 4H5WA 2AA4A 1GLAG 3MN6A 1Z26A 4OJRA 1QQMA 3FFKB 3N4QA 4CI6A 1KVCA 1Y97A 3K5LA 3QESA 3ZEUA 2H3GX 3AVJA 1LW2A 5BN8A 3KK3A 2D1KA 4H5NA 4M3WA 3A2FA 1TUUA 3K0SA 1JXBA 3R3LA 5C42A 2D0BA 4W5NA 3O3GA 2AJQA 4C8LA 3LDOA 4CBXA 1T6DA 1BOTO 3AVMA 2E88A 4MO5A 1JLAA 4C8MA 3I56N 1EP4A 5JLHA 3L4IA 3LP3A 4JI1K 4DSKA 3JXUA 1XNQK 4BRDA 1TK0A 3F2KA 3AVIA 1K8KB 3E9PA 4JHDB 3PV8A 5AQVA 4E1JA 2O8FB 1IH7A 3CERA 1WOQA 4BWJA 1FXXA 4ELVA 3AGKA 3THXA 3ZSVA 3LALA 3BP8A 3CCJN 3C94A 4DV7K 2P51A 1C0UA 3AVBA 1EKEA 1G15A 3MX2A 3T7ZA 5AQPA 2I7PA 5HBMA 1ZBUA 2IVOA 3LZIA 3HZ6A 2D0CA 1BCOA 4IJNA 4OPJA 4CEDA 1VQMN 4DV3K 1EETA 1NJXA 4BR4A 2DY4A 3M8QA 3DLGA 3U8XA 2KZMA 1VQ4N 3K5OA 4IEEA 5HP1A 3A5MC 3RTVA 4CFAA 1NM1A 3ZETB 5IT9O 4DU4A 3SAFA 1KSPA 4FLVA 3PSFA 3WXMB 4B1XB 5J2QA 2B4JA 3B6OA 4JKBA 3D2EA 3CJ7A 3ULDA 1VSDA 1GLFO 2FF6A 3OYGA 1TVRA 4B9LA 2Q1NA 2XO7A 4K42A 4J8FA 5AQFA 4NO7A 3CC2N 3ZLJA 3QFPA 2FSKA 3A8YA 1RT3A 3O3FA 3AA5X 4CZEA 3NVKA 1KAXA 2UYTA 3ZT3A 1GLJO 2VGNA 1EQYA 2BTFA 2ZWHA 3TI0A 4OX9K 4CW7B 1MDUB 4IEIA 2YV0X 5HRSA 1JLCA 4RW4A 1VRTA 5BR8K 3HPOA 5DK5A 3K57A 4Z4FA 4DR6K 3R9PA 3O08A 4WF9L 1K6YA 1ATSA 4A2AA 3HP6A 3WUHA 3I33A 2WFBA 4F2SA 1RT2A 4JN4A 3TAMA 1TAQA 3VEXA 4CJUA 4YY3K 3LDNA 4FJIA 5LMUK 1Q86O 1GOBA 2OZSA 5K14A 5HLFA 1BIUA 4CK2A 5AQJA 3TSQA 2P9NB 4CJ3A 1S6QA 4F4KA 3KHYA 3CCVN 4O8UA 3ENBA 5AQZA 4E7HA 3T69A 2VCPA 4DSFA 4JKGA 4BC2A 2JGUA 3AA4A 5FRMA 4DWIA 5IWAK 4BR5A 3CCSN 1ASWA 3C7NA 1VSFA 3VEVA 3OYIA 1BGXT 2FXUA 4DR3K 3VQ9A 2NLXA 4EHUA 3LPUA 5I3UA 4A62A 3SNNA 4ISFA 3NE6A 2ITGA 1ZBHA 3O4NA 2G8VA 1WAFA 1VQLN 3WEEA 3ID6A 3AA3A 4DUYK 1RBVA 3DRRA 3VEZA 3V9WA 1KC8O 2G8UA 4FWKA 3TTCA 4HUGA 4AILC 1VSLA 4JD2A 5AR0A 3SUNA 3I0SA 1VQNN 1NLVA 4YOVA 3MWTA 4CEAA 4M3YA 3MX5A 4FJ8A 3HTVA 1RT5A 3NDKA 3KD5E 4KHWA 4KTWA 3CD6N 4DTJA 3NH1A 2QWQA 3OYEA 3AAQA 4PA1A 1VSKA 3A5OC 2QTDA 1NK9A 1QSYA 1W0HA 2OPPA 1S5JA 4AM6A 1BDGA 3T3FA 2IC3A 3K5MA 3BF3A 4OKEA 1LV5A 2G8FA 3RR7A 2UUCK 1CXQA 3K2PA 5ADXA 4CESA 1K9MO 3M8RA 1YAGA 3UKUA 2UXCK 3H3OB 3ULEA 4LY7A 1NNEA 1RILA 3O9SA 3TSPA 1ATNA 3L2WA 3MN9A 4LD0A 1BQNA 1XC3A 4DSIA 1GLBG 1X9MA 3VERA 1SKWA 3OJUA 4IG3A 2E6MA 1IKXA 1N34K 3EKUA 4DQRA 5FROA 4BR9A 2ZM6K 4FLWA 3VQAA 3OYNA 2A5XA 3CM6A 3O8MA 4NB4A 3GDQA 4O5BA 5FPNA 3IS9A 4CEBA 4Z4GA 2O8DB 1NK6A 1C6VA 4AHUA 4DR4K 4IDHA 4DQ8A 3QMLA 1J9AA 1N36K 4BRAA 4N47A 4DTOA 3U9ZA 3WNHA 4XH5A 4CBWA 1JLFA 1S1UA 4FOEA 4QS9A 4B1VA 1YITN 1IKYA 2QXFA 4DLGA 3LDLA 2OTLN 4FM1A 2HHSA 4M45A 3SLCA 2ITMA 3O6WA 4ILHA 3G6EN 4E89A 1IV0A 2P9PB 2RN2A 4C23A 4DTMA 4AQYK 3BEXA 2WC9A 3C6UA 3O1WA 3ZT1A 3DRSA 2AP1A 3NBPA 3E9OA 3UB5A 1SL0A 4GKJK 5J2NA 1XI1A 4JEPA 2NRZA 1R59O 1WSFA 4DR2K 1YVNA 4O8KA 3OYFA 1C0MA 4MFBA 2OYQA 3C65A 3QBWA 4YDUC 1HNXK 1ESVA 5JICA 2F8TA 3BZKA 1MWMA 4H0OA 3MN7A 4A5AA 1ATRA 2WTUA 3E9LA 4F9OA 3H08A 2Q3SA 4FJ7A 1BG3A 3VTIA 1YJ9N 1DLOA 4I2QA 4JV5K 3ITHA 5C15A 3KJVA 4CCHA 1VQON 1NOZA 1TL3A 3NF9A 4PUOA 2EX3A 1K8KA 4JHDA 4PKHA 2O8FA 4OLAA 4FLXA 3W3DA 3NHGA 1TK8A 1NKEA 4DV4K 1EXQA 4Y1CA 3LDPA 4W5OA 3V6DA 4M3RA 1UA1A 3WQTA 1IKWA 2Q0UA 1KLMA 1X9WA 4DV5K 3GBTA 4CZIA 1EO1A 1HKCA 1ZBIA 2QXLA 3ENOA 3LANA 2VQEK 4EZ9A 3LDSA 1MWKA 2FBTA 4JK9A 1NGAA 1HJRA 2HNZA 3SZ2A 1NOYA 3QICA 1A5XA 3P5JA 3QEWA 2HW3A 5LMNK 2G8HA 5KTQA 2V51B 4N5SA 1HNIA 2GBZA 2XY5A 5AZIB 1T44A 2PFUA 5KQDA 4BWMA 4EZ6A 2HVIA 3ZETA 4CEEA 1RBUA 3DMJA 3IG1A 2HF4A 4M7XA 1DTQA 4XH1A 3GL1A 4ISGA 3FGUA 3TWHA 2P5OA 1NGIA 4DTSA 4JK8A 4RWTA 2Q0RA 1NGEA 4H5RA 5AQNA 5FPEA 2E6LA 3LM9A 3AA2A 3SMSA 4CBUA 3WXIA 4RCHA 4EIAA 3CIPA 3H1QA 4FJKA 4FWOA 2Q97A 4CJRA 3OW2M 2BANA 3CFPA 1M90O 1RTDA 4BC3A 4DUZK 2G8WA 1FKOA 4BRKA 2EWSA 5AQRA 2Y1JA 5M1FA 5BREA 5BPNA 4FJXA 4FJJA 3K9JA 3ATUA 4KTQA 1QE1A 5KRSA 1RDBA 3IKMA 1NJIO 1SS6A 3ZX2A 4IFVA 3KWGA 1RTHA 5GADP 4X65K 1J5EK 3ENHA 3EZ5A 1B92A 3ZSYA 5LJVA 4Z4EA 1V4TA 1T6CA 1U2VB 4BG8A 4QS7A 3CCMN 3TTDA 1NJWA 4CF1A 4E7JA 3B8AX 3CJBA 5FLXO 4CHPA 1GOCA 4Z94A 2P9NA 3FZMA 3LPTA 1FKPA 3KLIA 4G1QA 4QS8A 4DFJA 5M1KA 3KLEA 3CYMA 3CC7N 2NRRA 2QWNA 4FJ9A 1RDAA 4CJPA 4FLZA 3TTFA 2FBVA 3LWMA 4DV0K 4Y1DA 2YHYA 4FM2A 1VK0A 4YOWA 3QEVA 1RFQA 4RW7A 3AAPA 3OVNA 4OPKA 1ASUA 3W0LA 2KFNA 3A5NC 1TYQB 2IGIA 2W6LA 1HKBA 2HOEA 1SZ2A 4B1UB 4NCBA 2O8BB 1RTIA 2ZE2A 2OPRA 5LJWA 3ZX3A 3C6HA 3SYZA 2NRWA 2DFEA 2X78A 2HHWA 2XRIA 3K59A 4H5TA 1YF5L 1TL1A 3KLHA 4O0JA 3FE1A 4CF8A 3VF4A 5CYMA 2ZF5O 1RBRA 4KAZA 3MN5A 3THVA 3V81A 4A59A 2E8AA 3WNFA 4FLTA 4OLBA 4FW1A 1BISA 4BRNA 4BDYA 3G25A 3U3GA 5DMRA 4BG9A 5ADXH 2YHXA 4BE2A 1TKTA 4FVMA 3MXIA 3BY5A 3MDQA 1NJYA 4AHRA 5AQTA 1BQMA 1HQEA 4HCBA 4F8RA 1JKHA 3E66A 2A41A 3D45A 3VMFB 4JI5K 1RDWX 2HSTA 4A61A 4H4MA 2CGLA 4JRPA 3OYJA 4EAHD 2RE2A 2DTUA 3DXMB 4C1NK 3AVAA 2FBXA 3R1XA 4BRQA 1B9DA 4O55A 1X1PA 5J2MA 1NMDA 2HBLA 1TV6A 2PAVA 4H4OA 4JAXA 3J7YP 5KRTA 1KVAA 4LF7K 4BRIA 1NJZA 4BGAA 1TAUA 3NCIA 4FWRA 4KTZA 4EP5A 4GY2B 1KD1O 2JWLA 2O8DA 1YVUA 4DF8A 4OO1J 4C1NI 4FW2A 3VQDA 3H1VX 4PQUA 1J53A 1LWFA 1T03A 4BREA 3PO4A 1B9FA 2XHBA 3AO4A 2VG7A 2CGJA 3D7EO 3IDHA 4KH4A 4LFAK 3VF6A 4B3RK 1R0AA 4CEZA 1L3UA 2VWKA 3U3YA 4MLHA 3TU5A 4MDAA 4BRMA 4CZKA 3OYKA 2WOMA 4CK1A 2RF2A 2P9PA 1BHLA 1ZC6A 4UY8O 5SZTA 4LSLA 4FLUA 1BCMA 4OKKA 2X74A 2FBYA 1QSSA 3SMPA 5JS2A 1GLEG 2ETJA 3OYBA 3NGIA 5C25A 4FYDA 2D0AA 5AQKA 3ZT4A 3NGZA 4O0IA 2KFZA 3BGRA 1QHTA 4RTFD 3ALYA 5MLCQ 2QWRA 1S9EA 3IAYA 2YKNA 4E0DA 4ICLA 5AQWA 4IWVA 2YHBA 5C2DA 2P9SB 3OYAA 2KW4A 1LWEA 4DHYA 1NGHA 3O9UA 3AVCA 1N5YA 4KI6A 1CZ9A 3C95A 4DTNA 1SV5A 1Q7YO 4IZ9A 2BE2A 3OYHA 1Z6RA 4PL8A 4NYNA 4CGGA 4BGBA 3AARA 2YNFA 4I9QA 4CK3A 3FZFA 2HNYA 1CZBA 4DTUA 4AHTA 3VOVA 1HNZK 1U4BA 5CYQA 4B9NA 1EX4A 3CPEA 2HNDA 3DYAA 2Q31A 4LSNA 3LAMA 3MEEA 1QZ6A 4YDUA 1J5OA 2E2NA 4WQ5A 2KHOA 1VSIA 5B8HA 3M8PA 4HTUA 3ZT0A 3HK2A 2GWJA 5C10A 4NXNK 3CETA 4DU3A 5BPMA 4KHPK 4E1MA 4FJ5A 1W9HA 4CFDA 1L5UA 3QINA 5J2PA 3DLEA 4FZXC 2KKZA 3OJSA 2YHAA 1WBBA 1XUPO 4O4GA 5I42A 4J2DA 3I8DA 5D3GA 2NZTA 4GV3A 4JKAA 4PL7A 1JLBA 3NF8A 3O9QA 4FWNA 4CVNE 4K0KK 3S3MA 4B1ZA 3IFRA 3VQBA 3CCQN 2B5JA 1MU2A 4GMJB 2IS3A 5AZIA 4KO0A 5TKWA 3CF5L 2FSJA 3VF2A 1JL1A 3CFRA 4B9TA 2ZJRL 2B6AA 3SQ0A 4Q5VA 1NGJA 4E7KA 1WSIA 4DFMA 2QWPA 4B3TK 1TK5A 1RBTA 1VQ7N 4HHTA 3EN9A 3NMUA 1Q9XA 4FZZA 3LM2A 3LL3A 4X62K 4FPBA 4CF2A 4RG8A
chains in the Genus database with same CATH topology
4A5AA 1ATRA 2P9IA 5KQ8A 4DB3A 5BR9A 3E9LA 3O9RA 4F9OA 1YJWN 4CZGA 2HBMA 5EY4A 1BG3A 2F9WA 3DXKB 3VTIA 3QDKA 3O9TA 1YJ9N 1GLDG 4H03B 4BC4A 1QZ5A 5LY3A 3FR0A 4IXCA 3H45C 2ASMA 4K25A 3D6RA 3MK6A 5AZJA 5C15A 1SQKA 2D0PA 4K41A 2QM1A 4H0PA 2P9KB 1VQON 1ZXOA 1ZBSA 3CJCA 4FSVA 3SBTA 4YOYA 4IO9L 3CC4N 1K8KA 5FPMA 4EHTA 2HBKA 2WUSA 3GE1A 4JHDA 3CXCM 4PKHA 3PLAA 5BPLA 5F1XA 2ASPA 4BC5A 3RVCA 3W3DA 1NWKA 4CJ7A 3PIPL 3LDPA 1BU6O 4FL9A 1U2VA 3VENA 1RGIA 3WQTA 4ILGB 5M1QA 4JKDA 3F9MA 3S41A 1JJ2M 3UKRB 2Q0UA 1DKGD 4IO8A 2YJFA 3GBTA 1P90A 4CZIA 2GEMA 1EO1A 5BRHA 1HKCA 1E4GT 2NNWA 1W97L 3ID8A 5BRFA 3WT0A 3F5TA 2QXLA 3ENOA 5E84A 1MWKA 1BA1A 4JK9A 5AQLA 1NGAA 4K43A 4AF1A 2YCHA 4BRCA 1RDUA 1ILYA 3TPQA 4B1YB 4BR0A 3QICA 2FF3B 3U9DA 4M7YA 5C12A 4HWIA 4OPAA 3MCAB 4LC9B 2Q2RA 5JMVA 1S22A 2V51B 4WYBA 1JCFA 2YI1A 3DAWA 3E1YA 5AZIB 1T44A 1T3VA 3FLCO 5M1PA 1QQOA 2PFUA 5KQDA 2P9UB 4ISEA 2DPNA 4CZHA 1GLCG 3MWPA 4IFEA 5BN9A 2ZGZA 4H5WA 3ZETA 1YHQN 2AA4A 1GLAG 3MN6A 3I55N 2HF4A 4M7XA 4XH1A 1OKJA 3GL1A 1QQMA 3FFKB 3N4QA 4ISGA 4CI6A 3FGUA 5AQIA 1NGIA 4JK8A 3ZEUA 1QQNA 4RWTA 2H3GX 5JLFA 2Q0RA 1NGEA 4H5RA 1TUYA 5AQNA 3L6QA 5AQQA 5FPEA 4FWPA 5BN8A 3HSCA 3LM9A 5E26A 5JVHL 4DKWA 5AQUA 4FVUA 3VEOA 3SMSA 1HX1A 2E2QA 3CQYA 4CBUA 2D1KA 4H5NA 4IOXA 4RCHA 3WXIA 4EIAA 3CIPA 3H1QA 1MA9B 3BUZB 3HOSA 1TUUA 1K73O 4FWOA 2Q97A 3FZKA 3R3LA 4FPAA 2P9IB 3OW2M 2QWOA 5TKYA 4BVPA 5AQGA 2JWKA 3LDOA 4CBXA 1T6DA 1N8RO 1BOTO 1K8AO 1M90O 2E88A 1O13A 4MO5A 5HOOA 3VEYA 3WQUA 5EOYA 4BC3A 3I56N 1HUXA 2IVPA 3CCEN 5JLHA 3L4IA 4FO0A 1VQ9N 4JKHA 3AY9A 3CI5A 1GLLO 4M63C 2EWSA 5AQRA 5AZJB 4BRKA 3JXUA 4WCEL 2ZGYA 4AM7A 5M1FA 5BREA 4BRDA 5BPNA 3SAHA 4XEIA 3F2KA 3K9JA 2W41A 3H46O 1K8KB 1BO5O 3ATUA 1KAYA 3E9PA 1P8ZA 2YX6A 5F2RA 4JHDB 4MLEA 5AQVA 4E1JA 3IKMA 4IOCL 1NJIO 4BVOA 1SS6A 3CERA 1WOQA 5M1OA 3ZX2A 3KWGA 3AGKA 3KZBA 4H5VA 5GADP 3ENHA 2QW9A 3BP8A 3VGLA 3CCJN 4WQ5C 5LJVA 1V4TA 1T6CA 1U2VB 3IUCA 4BG8A 4CZJA 2D4WA 4QS7A 3GG4A 5AQSA 3CCMN 3TTDA 4BR2A 3MX2A 3T7ZA 3B8AX 3CJBA 5AQPA 2QEXN 1E4FT 3VEWA 2I7PA 2F9TA 5GAHP 2OTJN 5AQMA 2IVOA 1X9JA 3NVMA 2P9NA 4Z94A 3FZMA 3HZ6A 3I8BA 1DT9A 4QS8A 4IJNA 5CE3A 5M1KA 2E2PA 5GIPA 5EXWA 3HM8A 3OBYA 1VQMN 3CC7N 2NRRA 4BR4A 3P4IA 3DXMA 2QWNA 3HI0A 1YXQA 3CPWM 3U8XA 4I6MA 3TTFA 2E1YA 4HTLA 1VQ4N 2YHYA 2FLOA 2VWBA 3EL2A 4JK7A 4YOWA 3H6EA 4IEEA 3A5MC 3L4QA 1NM1A 1RFQA 4OPHA 1KXPA 3ZETB 3QB0A 3JS6A 3SAFA 3AAPA 1CZAN 1Y64A 4L3QA 3DLLL 3G71N 3WXMB 3WXLA 1M1KO 4B1XB 3W0LA 3FZLA 3A5NC 3ZEUB 3KWIA 5C2FA 5CHIA 1TYQB 2HF3A 4H0VB 2A40A 1Q82O 4JKBA 5EVZA 3D2EA 3CJ7A 1HKBA 1GLFO 2FF6A 2HOEA 1C0FA 1SZ2A 4ILJA 4B1UB 3CMEN 2Q1NA 3DWLA 4CZLA 3VPZA 4A2BA 3QFUA 4K42A 4J8FA 4XH4A 3H3NO 5LJWA 5AQFA 4NO7A 3ZX3A 3CC2N 4MDBA 3C6HA 3QFPA 3ZX0A 2FSKA 3A8YA 2NRWA 3CJ1A 4FWMA 4KBOA 4CZEA 3NVKA 1KAXA 3MCPA 2UYTA 3CQXA 1GLJO 3UE5A 2VGNA 4H5TA 1YF5L 1EQYA 2BTFA 2ZWHA 3U4LA 3FE1A 3VF4A 2ZF5O 1MDUB 4IEIA 1YI2N 1HLUA 1SAZA 4U67L 3MN5A 3P31A 4BQLA 4A59A 2E8AA 1BUPA 3R9PA 4GV6A 3O08A 3QBXA 3M1FA 4H0YB 5F0XA 4WF9L 5H1SQ 1QHAA 1ATSA 4A2AA 4BRNA 1IG8A 5GAEP 5CR4A 5I9EB 3WUHA 2QWLA 5AQHA 1D4XA 3G4SN 3A0IX 1TYQA 3I33A 1XQSC 2WFBA 5KPRA 4JN4A 1JCGA 3VEXA 4BR7A 3HOTA 3G25A 5AQXA 2ZJQL 3HBTA 3LDNA 4BG9A 5ADXH 2YHXA 4WFAL 1BA0A 1Q86O 4B9QA 3MDQA 2ASOA 5AQTA 3AGRA 1NGGA 5BRDA 3EE8A 1NGFA 3HRGA 3E66A 5AQJA 2GTDA 3TSQA 2A41A 2P9NB 2P9SA 2BH1A 2NRVA 3VMFB 1RDWX 2HSTA 3P38A 4A61A 2CGLA 3SK3A 3KHYA 3CCVN 4O8UA 1VQ6N 3ENBA 4CD1A 5AQZA 4EAHD 4GNIA 1DGKN 2RE2A 3LDQA 3DXMB 2VCPA 3T69A 4C1NK 4JKGA 1U6ZA 4BC2A 3MMVA 1NBWA 3R1XA 4H0OA 4NLCA 4I6MB 4BRQA 1W2BM 1VQ8N 1VAZA 3SAGA 3J7ZO 1NMDA 2HBLA 3DJCA 3Q7CA 1BWFO 4JNEA 2PAVA 2KLAA 4BR5A 3CCSN 4JAXA 3C7NA 3Q7BA 3VEVA 2FXUA 5AFUH 4BRPA 1HKGA 4BRIA 4DCHA 2HMPA 4BGAA 2E1ZA 4BRHA 2NLXA 3RSEA 4KH6A 2I7NA 2NRTA 4FWRA 4O5FA 2V52B 4GY2B 2YHWA 2JWLA 4EHUA 1KD1O 2GELA 1Q18A 4WFBL 4OO1J 4WQ4A 3D2EB 5AQOA 4A62A 4C1NI 4ISFA 4GVEA 3GOIA 2GUPA 4A5BA 1IJJA 1X3MA 5GIOA 4PHTX 3H1VX 3CCUN 1Z05A 3N4PA 1VQLN 3WEEA 3ID6A 4BREA 1QVGM 4GV9A 4BRFA 3VTHA 1DEJA 4PKIA 3VEZA 2CGKA 2CGJA 1KC8O 4FWKA 3D7EO 3TTCA 3CMAN 4KH5A 2FSNA 3P39A 3IDHA 4JD2A 4KH4A 2NRXA 2ZJPL 5AR0A 3VF6A 1X3NA 1VQNN 1NLVA 3O4WA 3O80A 4YOVA 3MWTA 3KVGA 3MX5A 4MLHA 3TU5A 3HTVA 1YUWA 4MDAA 4BRMA 3EKSA 3C0BA 3R8EA 2OANA 3VGKA 3CD6N 4CZKA 3EE9A 2E2OA 2QWQA 3AAQA 5GINA 4IOAL 3A5OC 2QTDA 3PIOL 2P9PA 1ZC6A 3M3ZA 4UY8O 4JKCA 4FWLA 4YORA 2IIRA 3VGMA 3SMPA 1GLEG 4AM6A 2HBJA 2W40A 1BDGA 1OVYA 2E20A 2PBDA 3BF3A 5AQKA 1LCUA 5ADXA 3CCRN 1K9MO 4RTFD 3OHRA 2A42A 5MLCQ 2QWRA 1YAGA 5DM7L 4IJAA 3O1BA 3UKUA 2V7YA 3H3OB 4WQ4C 3ULEA 5AQWA 4IWVA 2P9LA 3O9SA 5C2DA 2P9SB 2RHKA 3TSPA 5HL7L 3WXJA 1ATNA 1NGBA 3L0QA 3MN9A 4U7BA 4DHYA 5EX5A 1VQPN 5KPTA 3D2FA 3SBGA 3K9KA 1NGHA 3O9UA 5ELZA 4PKGA 4G9ZA 3R6MA 4JKGB 4B1WB 1XC3A 1GLBG 1WUAA 3O5BA 1VQ5N 2VGMA 3VERA 5GAGP 1Q7YO 3DXKA 4IZ9A 1NGCA 1Z6RA 4PL8A 3EKUA 4BGBA 4BR9A 3AARA 3C7NB 4YOXA 3FZFA 3OBWA 4WFNL 4BQZA 2QA4N 2A5XA 4BROA 2A6AA 2P9KA 2GX9A 3O8MA 5AFUA 3VOVA 3VESA 4NB4A 3CJ9A 3GDQA 3RSEB 3BF1A 5FPNA 4JKFA 3CPEA 1NGDA 4IDHA 4DQ8A 3QMLA 2Q31A 4BRAA 1QZ6A 4YDUA 2CH6A 2E2NA 3U9ZA 3EZWA 4WQ5A 4BRGA 2KHOA 3CCLN 5B8HA 4XH5A 4CD3A 3TSUA 1J6ZA 2GWJA 5C10A 3ATVA 4FOIA 4CBWA 3CETA 1H1VA 3WEEB 5BPMA 1KQSM 1KAZA 4A57A 1C0GA 4MO4A 1LOTB 4FOEA 4BRLA 1Q81O 4BY9C 4QS9A 2WBNA 3UKRA 4B1VA 1YITN 4JD2B 4R79A 1YJNN 2KKZA 5JVGL 4YOTA 5C0YA 5M1NA 1XUPO 2BUPA 3LDLA 3M5RA 2VYPA 3VETA 2OTLN 1QVFM 2GWKA 2NZTA 4GV3A 1HJOA 2CH5A 2IVNA 4JKAA 4NLBA 4PL7A 3SLCA 3EO3A 2ITMA 1VQKN 3O9QA 4FWNA 3O6WA 4ILHA 3G6EN 4B1ZA 2P9PB 3A5LC 4CZFA 3IFRA 1S3XA 3CCQN 4C23A 3CHWA 3CJAA 4JKEA 5KPZA 5AQYA 5AZIA 3C6AA 3BEXA 2WC9A 4H0TB 4H0XB 1HPMA 3O1WA 3ZYYX 2P9UA 5TKWA 2AP1A 2FSJA 1G99A 2D0OA 3CF5L 3VF2A 3E9OA 3UB5A 2YJEA 2ZJRL 2V7ZA 2F7TA 3J8AA 3KK7A 2NRZA 4JEPA 1R59O 4Y0WA 4FWQA 1NGJA 2Q36A 1YVNA 4O8KA 3UKUB 2QWPA 1YIJN 3ULEB 1JCEA 3C65A 3QBWA 2P9LB 3WXKA 4YDUC 4FWSA 3FZHA 1S72N 1VQ7N 4YOUA 3IMXA 1ESVA 2J4RA 4CZMA 3M6GA 5JICA 3EN9A 4EFHA 2NRHA 5FPDA 2A3ZA 3SJHA 1V4SA 2QI2A 2QWMA 3NMUA 3D2FB 3OA9A 3LM2A 3LL3A 5DM6L 1MWMA 4FPBA 3MN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4Q A;  4OPH A;  3O9R A;  3RVC A;  3O9S A;  3EE9 A;  2GX9 A;  2RHK A;  4OPA A;  3O9T A;  2KKZ A;  3KWI A;  3M5R A;  3O9U A;  3D6R A;  3KWG A;  3P31 A;  3EE8 A;  3P39 A;  3O9Q A;  3F5T A;  3P38 A;  3OA9 A; 
#chains in the Genus database with same CATH topology
 4B9S A;  1FW6 A;  3O9R A;  4DU1 A;  3ZSZ A;  3DXK B;  1E3M A;  2NUB A;  4UQG A;  3MEC A;  4H03 B;  1NK0 A;  4BC4 A;  3LP2 A;  5LY3 A;  3H45 C;  2ASM A;  4K25 A;  3D6R A;  2GUI A;  1SQK A;  3KD1 E;  3SUO A;  2P9K B;  4YNQ A;  1ZBS A;  3SBT A;  3QIP A;  2HBK A;  3M8S A;  4JYA K;  2WUS A;  3JSM A;  1HYZ A;  3PLA A;  5BPL A;  3ZSQ A;  4BC5 A;  3CG7 A;  4DFK A;  4GKK K;  4FL9 A;  1U2V A;  1RGI A;  1TGO A;  2BGG A;  4ILG B;  3TR8 A;  3F9M A;  2JLE A;  2OZM A;  3UKR B;  4IO8 A;  2YJF A;  4FJN A;  4LF9 K;  3CM5 A;  1P90 A;  2GEM A;  2R7Y A;  1E4G T;  4LH4 A;  3ID8 A;  4CHQ A;  4RW9 A;  1RT7 A;  4CJ4 A;  5E84 A;  1HQU A;  5AQL A;  3SPY A;  5C12 A;  1IO2 A;  4M7Y A;  4B8C A;  1LAV A;  1NG9 A;  4OPA A;  3MCA B;  1RNH A;  4WYB A;  1JCF A;  3DAW A;  4DTX A;  2VQF K;  4C8O A;  4M3U A;  5M1P A;  2EHG A;  4ISE A;  3QEP A;  3MWP A;  5BN9 A;  5JS1 A;  3I55 N;  4CJE A;  1KLN A;  1Q9Y A;  3AVK A;  3PSI A;  3QNN A;  3HSC A;  5JVH L;  1N32 K;  1VSE A;  3AO5 A;  4FVU A;  1HX1 A;  2O8B A;  2E2Q A;  3CQY A;  2HHU A;  2HB5 A;  3SQ1 A;  2I5J A;  3ZCM A;  3VQE A;  3HOS A;  3BUZ B;  2ATQ A;  1K73 O;  4FPA A;  2P9I B;  4HVJ A;  5TKY A;  4BVP A;  4CJT A;  2JWK A;  3DI6 A;  3OYM A;  2X6N A;  1N8R O;  4E7I A;  3WQU A;  1HUX A;  3P83 D;  3CCE N;  1VQ9 N;  3AY9 A;  3CI5 A;  1GLL O;  1HNV A;  4WCE L;  3RMA A;  4E3S A;  4YFU A;  4XEI A;  3OYL A;  3DLR A;  1P8Z A;  2YX6 A;  4CER A;  5F2R A;  3OY9 A;  1HYS A;  4IOC L;  3LWL A;  2G8K A;  4J2E A;  4QOZ B;  3AO2 A;  3KZB A;  4H5V A;  1JL2 A;  2QW9 A;  3VGL A;  4WQ5 C;  3J80 O;  4M3T A;  4CZJ A;  5AQS A;  2D4W A;  3GG4 A;  1UWB A;  4BR2 A;  5AJ3 K;  1E4F T;  3VEW A;  4AH9 A;  2F9T A;  4CHY A;  1RT4 A;  2RKI A;  1X9J A;  1D8Y A;  1DT9 A;  1LAW A;  3CQ8 A;  3HM8 A;  3QER A;  3DXM A;  5LL6 Z;  1WLJ A;  3PX0 A;  1IBK K;  3J81 O;  2YNH A;  2FLO A;  4DLE A;  3H6E A;  3RRG A;  3L4Q A;  3HVR A;  3QB0 A;  4DSJ A;  3JS6 A;  1WSG A;  1FJG K;  1CZA N;  4L3Q A;  3DLL L;  3G71 N;  3WXL A;  3PX6 A;  3AVN A;  3K5N A;  3QNO A;  3FZL A;  5CHI A;  1S1T A;  4H0V B;  1Q82 O;  2A40 A;  4B3M K;  4ILJ A;  1KRP A;  5HRR A;  3QIO A;  3VPZ A;  4A2B A;  4I7F A;  4IG0 A;  4BE0 A;  1NK7 A;  3H3N O;  2YKM A;  4MDB A;  2O8C B;  1WAJ A;  4FWM A;  3SUP A;  1D9F A;  3MCP A;  3CQX A;  2HHT A;  3THY B;  4CIF A;  2QKB A;  1YI2 N;  1SAZ A;  4BE1 A;  4U67 L;  4BQL A;  1BIZ A;  1BUP A;  4GV6 A;  3OS2 A;  3RMD A;  5F0X A;  3QBX A;  4DV2 K;  5H1S Q;  1QTM A;  1QHA A;  3OYC A;  3JAM O;  1FK9 A;  3G0Z A;  5CR4 A;  2QWL A;  1D4X A;  3A0I X;  3THW B;  3SJJ A;  1ZBL A;  2YNG A;  2Z1G A;  1JCG A;  2ZJQ L;  3HBT A;  1UAX A;  3U6F A;  2UUA K;  4KHU A;  3AGR A;  2IOC A;  3MXM A;  1NGG A;  5BRD A;  4OGC A;  4HUE A;  3EE8 A;  1NGF A;  3HRG A;  2GTD A;  2P9S A;  4IKF A;  3VQQ A;  2NRV A;  5HRN A;  3P38 A;  1VQ6 N;  4DMN A;  1U6Z A;  1C1A A;  1NBW A;  1NKB A;  4I6M B;  3TAE A;  1W2B M;  3ZT2 A;  3J7Z O;  4CE9 A;  3Q7C A;  4DS5 A;  3MEG A;  4JNE A;  2W42 A;  1A5W A;  1NK4 A;  3UIQ A;  4FZY A;  5CZ1 A;  1UA0 A;  4N76 A;  4W5T A;  1HKG A;  2UU9 K;  4DCH A;  1QS4 A;  2E1Z A;  4BRH A;  1XWL A;  1IBL K;  4Q0B A;  2OCE A;  3HO1 A;  2V52 B;  2GEL A;  1Q18 A;  3T1A A;  4JI2 K;  5AQO A;  3AO3 A;  1J54 A;  3MED A;  4M3X A;  2OPS A;  5KGX A;  4PHT X;  3L8B A;  1Z05 A;  3N4P A;  1QVG M;  1ASV A;  4GV9 A;  4BRF A;  2DFH A;  1DEJ A;  3KLF A;  3DLH A;  2QKK A;  2FSN A;  3P39 A;  2ZJP L;  2NRX A;  4TSX A;  4BDZ A;  3S3O A;  3O80 A;  5FRN A;  1YUW A;  4B8A B;  3F9K A;  4EP4 A;  3R8E A;  2OAN A;  3VGK A;  1Z25 A;  5GIN A;  2E2O A;  3JYT A;  3PUF A;  3VA0 A;  3QEI A;  4JKC A;  4KRF A;  1HRH A;  4YOR A;  4CFB A;  2IIR A;  3VGM A;  2HBJ A;  2W40 A;  4KHQ A;  2PBD A;  1RT1 A;  4DFP A;  4CEF A;  4IBN A;  2KZZ A;  3AVG A;  2A42 A;  5DM7 L;  2V7Y A;  4WQ4 C;  4XIU A;  3OTO K;  4DF4 A;  1BL3 A;  3NF7 A;  2UXB K;  2HHQ A;  5HL7 L;  3WXJ A;  3L0Q A;  4Z4H A;  4U7B A;  5EX5 A;  3SBG A;  3K9K A;  1D5A A;  5A2Q O;  2Z1I A;  3ISN C;  3R6M A;  4B1W B;  3VQ5 A;  3EYZ A;  1WUA A;  1VQ5 N;  2A1S A;  5GAG P;  4CFC A;  3DXK A;  4DR1 K;  1IG9 A;  1WSJ A;  1NGC A;  3ZSW A;  2E4L A;  4YOX A;  3TAF A;  1S9G A;  4I2P A;  3S9H A;  4WFN L;  1JLE A;  2P9K A;  1X9S A;  5AFU A;  3RSE B;  2XY6 A;  4JKF A;  1XHZ A;  4LF5 K;  3VQ8 A;  3EZW A;  3CCL N;  1TKZ A;  3F73 A;  4LFC K;  1LW0 A;  4W5Q A;  4M3Z A;  1H1V A;  1KQS M;  2QK9 A;  1VHX A;  4A57 A;  4MO4 A;  4B08 A;  4C8N A;  1Q81 O;  1WB9 A;  3CFO A;  1D9D A;  3UKR A;  1RCH A;  3BZC A;  4ZHR A;  2IAJ A;  5HRO A;  4YOT A;  3EEQ A;  2BUP A;  1JXE A;  4DS4 A;  2GWK A;  2CH5 A;  2IVN A;  4NLB A;  4ELT A;  5CZ2 A;  4CIG A;  3EO3 A;  1BI4 B;  1DTT A;  2BDP A;  4CZF A;  3A5L C;  5KGW A;  1S3X A;  4KHN A;  4FJM A;  3CJA A;  4B9M A;  5KPZ A;  5AQY A;  4H0X B;  1L3T A;  2D0O A;  3VN5 A;  4CGD A;  1KCF A;  4DTP A;  1XNR K;  4CF9 A;  2V7Z A;  2F7T A;  5CY4 A;  4KB0 A;  4CGI A;  3S3N A;  4Y0W A;  4I9L A;  1IBM K;  3WXK A;  2P9L B;  3FZH A;  3IMX A;  4KFB A;  2J4R A;  4CZM A;  4EFH A;  2UXD K;  5FPD A;  2A3Z A;  3SJH A;  1V4S A;  2X6S A;  3D2F B;  3DM2 A;  3OA9 A;  5DM6 L;  2UUB K;  3VQ6 A;  3G10 A;  2P9I A;  4CHZ A;  3PX4 A;  3L2R A;  1NKC A;  2HBM A;  4CEO A;  2F9W A;  2RPI A;  3O9T A;  4JRQ A;  1XHX A;  3FR0 A;  3BDP A;  4FLY A;  3MK6 A;  4AHS A;  1F21 A;  1OH8 A;  2D0P A;  3NAE A;  3VQ4 A;  1ZXO A;  3CJC A;  4IO9 L;  5HRP A;  5FPM A;  3TAQ A;  3RR8 A;  3L2U A;  3LP0 A;  3CXC M;  1RDD A;  5F1X A;  1NWK A;  4CJ7 A;  4RW6 A;  3VQC A;  2FC0 A;  3LP1 A;  3P1G A;  3TAP A;  3QO9 A;  4ID5 A;  3VEN A;  3DOL A;  4R5P A;  4CJK A;  1KFD A;  4JKD A;  1JJ2 M;  1S6P A;  2O4I A;  2IDO A;  4NXM K;  2O8E B;  1W97 L;  3V1Q A;  4KHS A;  4DTR A;  1BA1 A;  3DOK A;  4X66 K;  2YCH A;  4KI4 A;  3ZSX A;  3U9D A;  4Z4I A;  4LC9 B;  2Q2R A;  5JMV A;  1QQC A;  1VSM A;  1S22 A;  4QCL A;  2HVH A;  4JI8 K;  3E1Y A;  1T3V A;  4L8R B;  3FLC O;  2P9U B;  4CGH A;  4X64 K;  4CZH A;  1YHQ N;  1S1V A;  3FFI A;  1GOA A;  1QSL A;  4KB1 A;  5C24 A;  3PO5 A;  1OKJ A;  2P5G A;  2XY8 A;  5AQI A;  4JI4 K;  1QQN A;  5JLF A;  4JLH A;  3WNG A;  1TUY A;  1OH7 A;  3L6Q A;  2Z1H A;  5AQQ A;  4FWP A;  4FCY A;  5E26 A;  4F3O A;  4DKW A;  3AVF A;  5AQU A;  4WE1 A;  1SL2 A;  3VEO A;  3SV3 A;  4K8Z A;  4IOX A;  1MA9 B;  3DRP A;  3FZK A;  1U45 A;  4E7L A;  2QWO A;  2O8C A;  5AQG A;  4DQQ A;  3T19 A;  1K8A O;  4F2R A;  1O13 A;  5HOO A;  3VEY A;  3THY A;  5EOY A;  4KV8 A;  2IVP A;  1I3A A;  3D0P A;  4DG1 A;  4FO0 A;  4JKH A;  3B6P A;  4M63 C;  5AZJ B;  3TAR A;  3RRH A;  2ZGY A;  4AM7 A;  3QEX A;  4LF8 K;  3SAH A;  2W41 A;  3H46 O;  3QLH A;  4ID1 A;  1KFS A;  1BO5 O;  1KAY A;  4NCA A;  2YNI A;  4C8K A;  1WNS A;  3HYF A;  2WON A;  4MLE A;  4BVO A;  5M1O A;  2HHH K;  2D5R A;  3THW A;  3NFA A;  4V19 S;  3ZSO A;  3IUC A;  1WSH A;  2QEX N;  5GAH P;  2OTJ N;  5AQM A;  1SUQ A;  3L2Q A;  1XMQ K;  3NVM A;  4DSE A;  4JS4 A;  1I94 K;  3I8B A;  4NCG A;  3AO1 A;  5CE3 A;  5GIP A;  2E2P A;  5EXW A;  3OBY A;  1REV A;  1WN7 A;  3P4I A;  1WBD A;  4GW6 A;  3HI0 A;  3SUQ A;  1YXQ A;  3CPW M;  2LSN A;  4B3S K;  4I6M A;  3K58 A;  2E1Y A;  4HTL A;  4KKO A;  4DQI A;  2VWB A;  3EL2 A;  4JK7 A;  3HJF A;  2HHV A;  3KK1 A;  4OPH A;  1KXP A;  3O4Q A;  3I0R A;  3OS1 A;  1VRU A;  1RBS A;  3VA3 A;  3V9U A;  1Y64 A;  1HPZ A;  3HPH A;  4W5R A;  1M1K O;  1LWC A;  3NH2 A;  3KKR A;  3NF6 A;  3ZEU B;  5C2F A;  3KWI A;  3OS0 A;  4JI7 K;  2HF3 A;  5EVZ A;  2VWJ A;  3EY1 A;  2XY7 A;  3SCX A;  1JLG A;  4HCC A;  1C0F A;  3KLG A;  3NGY A;  3CME N;  3DWL A;  3VQ7 A;  4CZL A;  3QFU A;  5T7B A;  1ITG A;  4XH4 A;  3ZX0 A;  1A5V A;  3CJ1 A;  4KBO A;  4IFY A;  3J7A P;  2KQ2 A;  1L3V A;  4FJG A;  4DQP A;  3UE5 A;  3E01 A;  3SPZ A;  3U4L A;  4CF0 A;  1HLU A;  3V1O A;  4OGE A;  3DLK A;  4DR5 K;  3P31 A;  4PWD A;  3IRX A;  3O3H A;  1RT6 A;  3HT3 A;  3M1F A;  4H0Y B;  4IDK A;  1IG8 A;  4JI3 K;  5GAE P;  5I9E B;  3KK2 A;  5AQH A;  3G4S N;  2GV9 A;  1RDC A;  1TYQ A;  1VSJ A;  1XQS C;  5KPR A;  3MXJ A;  3THX B;  3SQ2 A;  4QAG A;  1CLQ A;  4BR7 A;  3HOT A;  5AQX A;  3ZSR A;  1C0T A;  4CGJ A;  4WFA L;  3VQP A;  1BA0 A;  3SQ4 A;  4DQS A;  4B9Q A;  1SL1 A;  2ASO A;  3HL8 A;  3OYD A;  2F96 A;  1SKR A;  4B3O A;  1VSH A;  1CXU A;  4JS5 A;  1TKD A;  2HHX A;  2BH1 A;  1U04 A;  1EWR A;  4HUF A;  3SK3 A;  4CD1 A;  4B9U A;  2F8S A;  1NMN A;  1DGK N;  3LDQ A;  4GNI A;  4LFB K;  3MAQ A;  3MMV A;  4CGF A;  4NLC A;  1VQ8 N;  1T7P A;  1VAZ A;  3SAG A;  3DJC A;  1BWF O;  2KLA A;  3PY8 A;  1U48 A;  3Q7B A;  1L3S A;  4BRP A;  5AFU H;  4RW8 A;  2HMP A;  4E19 A;  3RSE A;  4J2A A;  4KH6 A;  2I7N A;  2NRT A;  4O5F A;  2YHW A;  3KKS A;  4WFB L;  4KRE A;  4WQ4 A;  3D2E B;  1YTU A;  1C1B A;  1I39 A;  3AVH A;  3GOI A;  4GVE A;  2GUP A;  4A5B A;  1IJJ A;  1X3M A;  4PY5 A;  4J2B A;  4FK0 A;  5GIO A;  4H8K A;  2DFF A;  3CCU N;  3HVT A;  3VTH A;  4PKI A;  2CGK A;  3TAB A;  4KHY A;  3CMA N;  4KH5 A;  3V4I A;  4F3T A;  4CHO A;  1X3N A;  3O4W A;  3KVG A;  1U47 A;  3EKS A;  3C0B A;  3L3V A;  3EE9 A;  4DV6 K;  1BI4 A;  4IOA L;  3PIO L;  3M3Z A;  3TAN A;  1N33 K;  4FWL A;  4FK2 A;  3AV9 A;  1OVY A;  2E20 A;  4GVM A;  1N6Q A;  3T1H K;  4LH5 A;  2ZD1 A;  4CHN A;  3LZJ A;  1LCU A;  4DR7 K;  3CCR N;  2E5L K;  3OHR A;  2A1R A;  4IJA A;  3O1B A;  1HMV A;  4FJL A;  2P9L A;  1T8E A;  5EU7 A;  2RHK A;  1NGB A;  1HYV A;  4Z4C A;  5J1E A;  1VQP N;  2PYL A;  1U49 A;  5KPT A;  3D2F A;  1SKS A;  5ELZ A;  4KPY A;  1XMO K;  4PKG A;  4G9Z A;  4JKG B;  4CJQ A;  5SWM A;  3O5B A;  4AHV A;  2VGM A;  3C7N B;  3HXM A;  3RWU A;  3OBW A;  3TAG A;  3RMB A;  4BQZ A;  2QA4 N;  3L3U A;  4NYF A;  2A6A A;  4BRO A;  2GX9 A;  3VES A;  2VG6 A;  3CJ9 A;  3KIO A;  3BF1 A;  4JI6 K;  2HMI A;  1NGD A;  4OKJ A;  2P1J A;  2CH6 A;  4O44 A;  4E1N A;  4BRG A;  3V9Z A;  4CD3 A;  5E41 A;  3TSU A;  4ELU A;  1J6Z A;  2PY5 A;  3ATV A;  4FOI A;  3V1R A;  1TKX A;  3WEE B;  1KAZ A;  1HNW K;  1C0G A;  3T1Y K;  1LOT B;  4M41 A;  4BRL A;  4BY9 C;  2WBN A;  4CEC A;  3NH0 A;  3HP9 A;  4CIE A;  2O8E A;  4JD2 B;  4R79 A;  1YJN N;  5JVG L;  4CJ5 A;  3C6T A;  5M1N A;  5C0Y A;  3M5R A;  2VYP A;  3VET A;  1QVF M;  1HJO A;  4BDP A;  3V9X A;  1VQK N;  4AHC A;  4FJH A;  1RTJ A;  1XC9 A;  1OVQ A;  4MQ3 A;  1UOC A;  2F4V K;  1WSE A;  3CHW A;  4JKE A;  1ZBF A;  3HST B;  3C6A A;  4H0T B;  2ZQB A;  3ZYY X;  1HPM A;  1YT3 A;  4ZTJ A;  3RMC A;  4BAC A;  2P9U A;  2OPQ A;  1G99 A;  4M42 A;  3AVL A;  4CJF A;  2YJE A;  4ZTF A;  1KTQ A;  4B9V A;  4FK4 A;  3J8A A;  3KK7 A;  1O1W A;  4FWQ A;  2Q36 A;  1T05 A;  4FM0 A;  2Y1I A;  3UKU B;  1YIJ N;  3ULE B;  1JCE A;  1S72 N;  4FWS A;  3SV4 A;  4YOU A;  4OVL A;  3M6G A;  3WNE A;  2NRH A;  2QI2 A;  2QWM A;  2G8I A;  2KTQ A;  1NK8 A;  4FXD A;  5KQ8 A;  2VG5 A;  4DB3 A;  5BR9 A;  3KTQ A;  5FDL A;  1YJW N;  4CJW A;  4CZG A;  1OH5 A;  5EY4 A;  2OA8 A;  3QDK A;  1GLD G;  1IKV A;  5KI6 A;  2PZS A;  1YTA A;  1QZ5 A;  3SI6 A;  4JI0 K;  3HPG A;  1JLQ A;  4IXC A;  1ZYQ A;  4Z0U A;  5AZJ A;  4CEQ A;  4K41 A;  2QM1 A;  4H0P A;  4N56 A;  3ASM A;  4K8X A;  3V9S A;  4FSV A;  4YOY A;  1OH6 A;  3CC4 N;  4CJS A;  4EHT A;  1KVB A;  3GE1 A;  1Q8I A;  4LF4 K;  2ASP A;  3RVC A;  3PIP L;  1S1X A;  3LAK A;  1BU6 O;  1S1W A;  5M1Q A;  3S41 A;  1DKG D;  4YHH K;  3DLB A;  4LF6 K;  3QET A;  4N41 A;  5BRH A;  2NNW A;  5BRF A;  1C1C A;  3WT0 A;  3F5T A;  4DV1 K;  3HM9 A;  2O4G A;  4CJV A;  2Z1J A;  4K43 A;  4DSL A;  2PYJ A;  4AF1 A;  4BRC A;  1RDU A;  1ILY A;  3TPQ A;  4B1Y B;  4BR0 A;  2FF3 B;  4HWI A;  1EWQ A;  2YI1 A;  1NK5 A;  1HR0 K;  1QQO A;  1W7A A;  3L2V A;  2DPN A;  2W6K A;  1GLC G;  4CJL A;  1NU0 A;  4IFE A;  2ZGZ A;  4H5W A;  2AA4 A;  1GLA G;  3MN6 A;  1Z26 A;  4OJR A;  1QQM A;  3FFK B;  3N4Q A;  4CI6 A;  1KVC A;  1Y97 A;  3K5L A;  3QES A;  3ZEU A;  2H3G X;  3AVJ A;  1LW2 A;  5BN8 A;  3KK3 A;  2D1K A;  4H5N A;  4M3W A;  3A2F A;  1TUU A;  3K0S A;  1JXB A;  3R3L A;  5C42 A;  2D0B A;  4W5N A;  3O3G A;  2AJQ A;  4C8L A;  3LDO A;  4CBX A;  1T6D A;  1BOT O;  3AVM A;  2E88 A;  4MO5 A;  1JLA A;  4C8M A;  3I56 N;  1EP4 A;  5JLH A;  3L4I A;  3LP3 A;  4JI1 K;  4DSK A;  3JXU A;  1XNQ K;  4BRD A;  1TK0 A;  3F2K A;  3AVI A;  1K8K B;  3E9P A;  4JHD B;  3PV8 A;  5AQV A;  4E1J A;  2O8F B;  1IH7 A;  3CER A;  1WOQ A;  4BWJ A;  1FXX A;  4ELV A;  3AGK A;  3THX A;  3ZSV A;  3LAL A;  3BP8 A;  3CCJ N;  3C94 A;  4DV7 K;  2P51 A;  1C0U A;  3AVB A;  1EKE A;  1G15 A;  3MX2 A;  3T7Z A;  5AQP A;  2I7P A;  5HBM A;  1ZBU A;  2IVO A;  3LZI A;  3HZ6 A;  2D0C A;  1BCO A;  4IJN A;  4OPJ A;  4CED A;  1VQM N;  4DV3 K;  1EET A;  1NJX A;  4BR4 A;  2DY4 A;  3M8Q A;  3DLG A;  3U8X A;  2KZM A;  1VQ4 N;  3K5O A;  4IEE A;  5HP1 A;  3A5M C;  3RTV A;  4CFA A;  1NM1 A;  3ZET B;  5IT9 O;  4DU4 A;  3SAF A;  1KSP A;  4FLV A;  3PSF A;  3WXM B;  4B1X B;  5J2Q A;  2B4J A;  3B6O A;  4JKB A;  3D2E A;  3CJ7 A;  3ULD A;  1VSD A;  1GLF O;  2FF6 A;  3OYG A;  1TVR A;  4B9L A;  2Q1N A;  2XO7 A;  4K42 A;  4J8F A;  5AQF A;  4NO7 A;  3CC2 N;  3ZLJ A;  3QFP A;  2FSK A;  3A8Y A;  1RT3 A;  3O3F A;  3AA5 X;  4CZE A;  3NVK A;  1KAX A;  2UYT A;  3ZT3 A;  1GLJ O;  2VGN A;  1EQY A;  2BTF A;  2ZWH A;  3TI0 A;  4OX9 K;  4CW7 B;  1MDU B;  4IEI A;  2YV0 X;  5HRS A;  1JLC A;  4RW4 A;  1VRT A;  5BR8 K;  3HPO A;  5DK5 A;  3K57 A;  4Z4F A;  4DR6 K;  3R9P A;  3O08 A;  4WF9 L;  1K6Y A;  1ATS A;  4A2A A;  3HP6 A;  3WUH A;  3I33 A;  2WFB A;  4F2S A;  1RT2 A;  4JN4 A;  3TAM A;  1TAQ A;  3VEX A;  4CJU A;  4YY3 K;  3LDN A;  4FJI A;  5LMU K;  1Q86 O;  1GOB A;  2OZS A;  5K14 A;  5HLF A;  1BIU A;  4CK2 A;  5AQJ A;  3TSQ A;  2P9N B;  4CJ3 A;  1S6Q A;  4F4K A;  3KHY A;  3CCV N;  4O8U A;  3ENB A;  5AQZ A;  4E7H A;  3T69 A;  2VCP A;  4DSF A;  4JKG A;  4BC2 A;  2JGU A;  3AA4 A;  5FRM A;  4DWI A;  5IWA K;  4BR5 A;  3CCS N;  1ASW A;  3C7N A;  1VSF A;  3VEV A;  3OYI A;  1BGX T;  2FXU A;  4DR3 K;  3VQ9 A;  2NLX A;  4EHU A;  3LPU A;  5I3U A;  4A62 A;  3SNN A;  4ISF A;  3NE6 A;  2ITG A;  1ZBH A;  3O4N A;  2G8V A;  1WAF A;  1VQL N;  3WEE A;  3ID6 A;  3AA3 A;  4DUY K;  1RBV A;  3DRR A;  3VEZ A;  3V9W A;  1KC8 O;  2G8U A;  4FWK A;  3TTC A;  4HUG A;  4AIL C;  1VSL A;  4JD2 A;  5AR0 A;  3SUN A;  3I0S A;  1VQN N;  1NLV A;  4YOV A;  3MWT A;  4CEA A;  4M3Y A;  3MX5 A;  4FJ8 A;  3HTV A;  1RT5 A;  3NDK A;  3KD5 E;  4KHW A;  4KTW A;  3CD6 N;  4DTJ A;  3NH1 A;  2QWQ A;  3OYE A;  3AAQ A;  4PA1 A;  1VSK A;  3A5O C;  2QTD A;  1NK9 A;  1QSY A;  1W0H A;  2OPP A;  1S5J A;  4AM6 A;  1BDG A;  3T3F A;  2IC3 A;  3K5M A;  3BF3 A;  4OKE A;  1LV5 A;  2G8F A;  3RR7 A;  2UUC K;  1CXQ A;  3K2P A;  5ADX A;  4CES A;  1K9M O;  3M8R A;  1YAG A;  3UKU A;  2UXC K;  3H3O B;  3ULE A;  4LY7 A;  1NNE A;  1RIL A;  3O9S A;  3TSP A;  1ATN A;  3L2W A;  3MN9 A;  4LD0 A;  1BQN A;  1XC3 A;  4DSI A;  1GLB G;  1X9M A;  3VER A;  1SKW A;  3OJU A;  4IG3 A;  2E6M A;  1IKX A;  1N34 K;  3EKU A;  4DQR A;  5FRO A;  4BR9 A;  2ZM6 K;  4FLW A;  3VQA A;  3OYN A;  2A5X A;  3CM6 A;  3O8M A;  4NB4 A;  3GDQ A;  4O5B A;  5FPN A;  3IS9 A;  4CEB A;  4Z4G A;  2O8D B;  1NK6 A;  1C6V A;  4AHU A;  4DR4 K;  4IDH A;  4DQ8 A;  3QML A;  1J9A A;  1N36 K;  4BRA A;  4N47 A;  4DTO A;  3U9Z A;  3WNH A;  4XH5 A;  4CBW A;  1JLF A;  1S1U A;  4FOE A;  4QS9 A;  4B1V A;  1YIT N;  1IKY A;  2QXF A;  4DLG A;  3LDL A;  2OTL N;  4FM1 A;  2HHS A;  4M45 A;  3SLC A;  2ITM A;  3O6W A;  4ILH A;  3G6E N;  4E89 A;  1IV0 A;  2P9P B;  2RN2 A;  4C23 A;  4DTM A;  4AQY K;  3BEX A;  2WC9 A;  3C6U A;  3O1W A;  3ZT1 A;  3DRS A;  2AP1 A;  3NBP A;  3E9O A;  3UB5 A;  1SL0 A;  4GKJ K;  5J2N A;  1XI1 A;  4JEP A;  2NRZ A;  1R59 O;  1WSF A;  4DR2 K;  1YVN A;  4O8K A;  3OYF A;  1C0M A;  4MFB A;  2OYQ A;  3C65 A;  3QBW A;  4YDU C;  1HNX K;  1ESV A;  5JIC A;  2F8T A;  3BZK A;  1MWM A;  4H0O A;  3MN7 A;  4A5A A;  1ATR A;  2WTU A;  3E9L A;  4F9O A;  3H08 A;  2Q3S A;  4FJ7 A;  1BG3 A;  3VTI A;  1YJ9 N;  1DLO A;  4I2Q A;  4JV5 K;  3ITH A;  5C15 A;  3KJV A;  4CCH A;  1VQO N;  1NOZ A;  1TL3 A;  3NF9 A;  4PUO A;  2EX3 A;  1K8K A;  4JHD A;  4PKH A;  2O8F A;  4OLA A;  4FLX A;  3W3D A;  3NHG A;  1TK8 A;  1NKE A;  4DV4 K;  1EXQ A;  4Y1C A;  3LDP A;  4W5O A;  3V6D A;  4M3R A;  1UA1 A;  3WQT A;  1IKW A;  2Q0U A;  1KLM A;  1X9W A;  4DV5 K;  3GBT A;  4CZI A;  1EO1 A;  1HKC A;  1ZBI A;  2QXL A;  3ENO A;  3LAN A;  2VQE K;  4EZ9 A;  3LDS A;  1MWK A;  2FBT A;  4JK9 A;  1NGA A;  1HJR A;  2HNZ A;  3SZ2 A;  1NOY A;  3QIC A;  1A5X A;  3P5J A;  3QEW A;  2HW3 A;  5LMN K;  2G8H A;  5KTQ A;  2V51 B;  4N5S A;  1HNI A;  2GBZ A;  2XY5 A;  5AZI B;  1T44 A;  2PFU A;  5KQD A;  4BWM A;  4EZ6 A;  2HVI A;  3ZET A;  4CEE A;  1RBU A;  3DMJ A;  3IG1 A;  2HF4 A;  4M7X A;  1DTQ A;  4XH1 A;  3GL1 A;  4ISG A;  3FGU A;  3TWH A;  2P5O A;  1NGI A;  4DTS A;  4JK8 A;  4RWT A;  2Q0R A;  1NGE A;  4H5R A;  5AQN A;  5FPE A;  2E6L A;  3LM9 A;  3AA2 A;  3SMS A;  4CBU A;  3WXI A;  4RCH A;  4EIA A;  3CIP A;  3H1Q A;  4FJK A;  4FWO A;  2Q97 A;  4CJR A;  3OW2 M;  2BAN A;  3CFP A;  1M90 O;  1RTD A;  4BC3 A;  4DUZ K;  2G8W A;  1FKO A;  4BRK A;  2EWS A;  5AQR A;  2Y1J A;  5M1F A;  5BRE A;  5BPN A;  4FJX A;  4FJJ A;  3K9J A;  3ATU A;  4KTQ A;  1QE1 A;  5KRS A;  1RDB A;  3IKM A;  1NJI O;  1SS6 A;  3ZX2 A;  4IFV A;  3KWG A;  1RTH A;  5GAD P;  4X65 K;  1J5E K;  3ENH A;  3EZ5 A;  1B92 A;  3ZSY A;  5LJV A;  4Z4E A;  1V4T A;  1T6C A;  1U2V B;  4BG8 A;  4QS7 A;  3CCM N;  3TTD A;  1NJW A;  4CF1 A;  4E7J A;  3B8A X;  3CJB A;  5FLX O;  4CHP A;  1GOC A;  4Z94 A;  2P9N A;  3FZM A;  3LPT A;  1FKP A;  3KLI A;  4G1Q A;  4QS8 A;  4DFJ A;  5M1K A;  3KLE A;  3CYM A;  3CC7 N;  2NRR A;  2QWN A;  4FJ9 A;  1RDA A;  4CJP A;  4FLZ A;  3TTF A;  2FBV A;  3LWM A;  4DV0 K;  4Y1D A;  2YHY A;  4FM2 A;  1VK0 A;  4YOW A;  3QEV A;  1RFQ A;  4RW7 A;  3AAP A;  3OVN A;  4OPK A;  1ASU A;  3W0L A;  2KFN A;  3A5N C;  1TYQ B;  2IGI A;  2W6L A;  1HKB A;  2HOE A;  1SZ2 A;  4B1U B;  4NCB A;  2O8B B;  1RTI A;  2ZE2 A;  2OPR A;  5LJW A;  3ZX3 A;  3C6H A;  3SYZ A;  2NRW A;  2DFE A;  2X78 A;  2HHW A;  2XRI A;  3K59 A;  4H5T A;  1YF5 L;  1TL1 A;  3KLH A;  4O0J A;  3FE1 A;  4CF8 A;  3VF4 A;  5CYM A;  2ZF5 O;  1RBR A;  4KAZ A;  3MN5 A;  3THV A;  3V81 A;  4A59 A;  2E8A A;  3WNF A;  4FLT A;  4OLB A;  4FW1 A;  1BIS A;  4BRN A;  4BDY A;  3G25 A;  3U3G A;  5DMR A;  4BG9 A;  5ADX H;  2YHX A;  4BE2 A;  1TKT A;  4FVM A;  3MXI A;  3BY5 A;  3MDQ A;  1NJY A;  4AHR A;  5AQT A;  1BQM A;  1HQE A;  4HCB A;  4F8R A;  1JKH A;  3E66 A;  2A41 A;  3D45 A;  3VMF B;  4JI5 K;  1RDW X;  2HST A;  4A61 A;  4H4M A;  2CGL A;  4JRP A;  3OYJ A;  4EAH D;  2RE2 A;  2DTU A;  3DXM B;  4C1N K;  3AVA A;  2FBX A;  3R1X A;  4BRQ A;  1B9D A;  4O55 A;  1X1P A;  5J2M A;  1NMD A;  2HBL A;  1TV6 A;  2PAV A;  4H4O A;  4JAX A;  3J7Y P;  5KRT A;  1KVA A;  4LF7 K;  4BRI A;  1NJZ A;  4BGA A;  1TAU A;  3NCI A;  4FWR A;  4KTZ A;  4EP5 A;  4GY2 B;  1KD1 O;  2JWL A;  2O8D A;  1YVU A;  4DF8 A;  4OO1 J;  4C1N I;  4FW2 A;  3VQD A;  3H1V X;  4PQU A;  1J53 A;  1LWF A;  1T03 A;  4BRE A;  3PO4 A;  1B9F A;  2XHB A;  3AO4 A;  2VG7 A;  2CGJ A;  3D7E O;  3IDH A;  4KH4 A;  4LFA K;  3VF6 A;  4B3R K;  1R0A A;  4CEZ A;  1L3U A;  2VWK A;  3U3Y A;  4MLH A;  3TU5 A;  4MDA A;  4BRM A;  4CZK A;  3OYK A;  2WOM A;  4CK1 A;  2RF2 A;  2P9P A;  1BHL A;  1ZC6 A;  4UY8 O;  5SZT A;  4LSL A;  4FLU A;  1BCM A;  4OKK A;  2X74 A;  2FBY A;  1QSS A;  3SMP A;  5JS2 A;  1GLE G;  2ETJ A;  3OYB A;  3NGI A;  5C25 A;  4FYD A;  2D0A A;  5AQK A;  3ZT4 A;  3NGZ A;  4O0I A;  2KFZ A;  3BGR A;  1QHT A;  4RTF D;  3ALY A;  5MLC Q;  2QWR A;  1S9E A;  3IAY A;  2YKN A;  4E0D A;  4ICL A;  5AQW A;  4IWV A;  2YHB A;  5C2D A;  2P9S B;  3OYA A;  2KW4 A;  1LWE A;  4DHY A;  1NGH A;  3O9U A;  3AVC A;  1N5Y A;  4KI6 A;  1CZ9 A;  3C95 A;  4DTN A;  1SV5 A;  1Q7Y O;  4IZ9 A;  2BE2 A;  3OYH A;  1Z6R A;  4PL8 A;  4NYN A;  4CGG A;  4BGB A;  3AAR A;  2YNF A;  4I9Q A;  4CK3 A;  3FZF A;  2HNY A;  1CZB A;  4DTU A;  4AHT A;  3VOV A;  1HNZ K;  1U4B A;  5CYQ A;  4B9N A;  1EX4 A;  3CPE A;  2HND A;  3DYA A;  2Q31 A;  4LSN A;  3LAM A;  3MEE A;  1QZ6 A;  4YDU A;  1J5O A;  2E2N A;  4WQ5 A;  2KHO A;  1VSI A;  5B8H A;  3M8P A;  4HTU A;  3ZT0 A;  3HK2 A;  2GWJ A;  5C10 A;  4NXN K;  3CET A;  4DU3 A;  5BPM A;  4KHP K;  4E1M A;  4FJ5 A;  1W9H A;  4CFD A;  1L5U A;  3QIN A;  5J2P A;  3DLE A;  4FZX C;  2KKZ A;  3OJS A;  2YHA A;  1WBB A;  1XUP O;  4O4G A;  5I42 A;  4J2D A;  3I8D A;  5D3G A;  2NZT A;  4GV3 A;  4JKA A;  4PL7 A;  1JLB A;  3NF8 A;  3O9Q A;  4FWN A;  4CVN E;  4K0K K;  3S3M A;  4B1Z A;  3IFR A;  3VQB A;  3CCQ N;  2B5J A;  1MU2 A;  4GMJ B;  2IS3 A;  5AZI A;  4KO0 A;  5TKW A;  3CF5 L;  2FSJ A;  3VF2 A;  1JL1 A;  3CFR A;  4B9T A;  2ZJR L;  2B6A A;  3SQ0 A;  4Q5V A;  1NGJ A;  4E7K A;  1WSI A;  4DFM A;  2QWP A;  4B3T K;  1TK5 A;  1RBT A;  1VQ7 N;  4HHT A;  3EN9 A;  3NMU A;  1Q9X A;  4FZZ A;  3LM2 A;  3LL3 A;  4X62 K;  4FPB A;  4CF2 A;  4RG8 A; 
#chains in the Genus database with same CATH homology
 4A5A A;  1ATR A;  2P9I A;  5KQ8 A;  4DB3 A;  5BR9 A;  3E9L A;  3O9R A;  4F9O A;  1YJW N;  4CZG A;  2HBM A;  5EY4 A;  1BG3 A;  2F9W A;  3DXK B;  3VTI A;  3QDK A;  3O9T A;  1YJ9 N;  1GLD G;  4H03 B;  4BC4 A;  1QZ5 A;  5LY3 A;  3FR0 A;  4IXC A;  3H45 C;  2ASM A;  4K25 A;  3D6R A;  3MK6 A;  5AZJ A;  5C15 A;  1SQK A;  2D0P A;  4K41 A;  2QM1 A;  4H0P A;  2P9K B;  1VQO N;  1ZXO A;  1ZBS A;  3CJC A;  4FSV A;  3SBT A;  4YOY A;  4IO9 L;  3CC4 N;  1K8K A;  5FPM A;  4EHT A;  2HBK A;  2WUS A;  3GE1 A;  4JHD A;  3CXC M;  4PKH A;  3PLA A;  5BPL A;  5F1X A;  2ASP A;  4BC5 A;  3RVC A;  3W3D A;  1NWK A;  4CJ7 A;  3PIP L;  3LDP A;  1BU6 O;  4FL9 A;  1U2V A;  3VEN A;  1RGI A;  3WQT A;  4ILG B;  5M1Q A;  4JKD A;  3F9M A;  3S41 A;  1JJ2 M;  3UKR B;  2Q0U A;  1DKG D;  4IO8 A;  2YJF A;  3GBT A;  1P90 A;  4CZI A;  2GEM A;  1EO1 A;  5BRH A;  1HKC A;  1E4G T;  2NNW A;  1W97 L;  3ID8 A;  5BRF A;  3WT0 A;  3F5T A;  2QXL A;  3ENO A;  5E84 A;  1MWK A;  1BA1 A;  4JK9 A;  5AQL A;  1NGA A;  4K43 A;  4AF1 A;  2YCH A;  4BRC A;  1RDU A;  1ILY A;  3TPQ A;  4B1Y B;  4BR0 A;  3QIC A;  2FF3 B;  3U9D A;  4M7Y A;  5C12 A;  4HWI A;  4OPA A;  3MCA B;  4LC9 B;  2Q2R A;  5JMV A;  1S22 A;  2V51 B;  4WYB A;  1JCF A;  2YI1 A;  3DAW A;  3E1Y A;  5AZI B;  1T44 A;  1T3V A;  3FLC O;  5M1P A;  1QQO A;  2PFU A;  5KQD A;  2P9U B;  4ISE A;  2DPN A;  4CZH A;  1GLC G;  3MWP A;  4IFE A;  5BN9 A;  2ZGZ A;  4H5W A;  3ZET A;  1YHQ N;  2AA4 A;  1GLA G;  3MN6 A;  3I55 N;  2HF4 A;  4M7X A;  4XH1 A;  1OKJ A;  3GL1 A;  1QQM A;  3FFK B;  3N4Q A;  4ISG A;  4CI6 A;  3FGU A;  5AQI A;  1NGI A;  4JK8 A;  3ZEU A;  1QQN A;  4RWT A;  2H3G X;  5JLF A;  2Q0R A;  1NGE A;  4H5R A;  1TUY A;  5AQN A;  3L6Q A;  5AQQ A;  5FPE A;  4FWP A;  5BN8 A;  3HSC A;  3LM9 A;  5E26 A;  5JVH L;  4DKW A;  5AQU A;  4FVU A;  3VEO A;  3SMS A;  1HX1 A;  2E2Q A;  3CQY A;  4CBU A;  2D1K A;  4H5N A;  4IOX A;  4RCH A;  3WXI A;  4EIA A;  3CIP A;  3H1Q A;  1MA9 B;  3BUZ B;  3HOS A;  1TUU A;  1K73 O;  4FWO A;  2Q97 A;  3FZK A;  3R3L A;  4FPA A;  2P9I B;  3OW2 M;  2QWO A;  5TKY A;  4BVP A;  5AQG A;  2JWK A;  3LDO A;  4CBX A;  1T6D A;  1N8R O;  1BOT O;  1K8A O;  1M90 O;  2E88 A;  1O13 A;  4MO5 A;  5HOO A;  3VEY A;  3WQU A;  5EOY A;  4BC3 A;  3I56 N;  1HUX A;  2IVP A;  3CCE N;  5JLH A;  3L4I A;  4FO0 A;  1VQ9 N;  4JKH A;  3AY9 A;  3CI5 A;  1GLL O;  4M63 C;  2EWS A;  5AQR A;  5AZJ B;  4BRK A;  3JXU A;  4WCE L;  2ZGY A;  4AM7 A;  5M1F A;  5BRE A;  4BRD A;  5BPN A;  3SAH A;  4XEI A;  3F2K A;  3K9J A;  2W41 A;  3H46 O;  1K8K B;  1BO5 O;  3ATU A;  1KAY A;  3E9P A;  1P8Z A;  2YX6 A;  5F2R A;  4JHD B;  4MLE A;  5AQV A;  4E1J A;  3IKM A;  4IOC L;  1NJI O;  4BVO A;  1SS6 A;  3CER A;  1WOQ A;  5M1O A;  3ZX2 A;  3KWG A;  3AGK A;  3KZB A;  4H5V A;  5GAD P;  3ENH A;  2QW9 A;  3BP8 A;  3VGL A;  3CCJ N;  4WQ5 C;  5LJV A;  1V4T A;  1T6C A;  1U2V B;  3IUC A;  4BG8 A;  4CZJ A;  2D4W A;  4QS7 A;  3GG4 A;  5AQS A;  3CCM N;  3TTD A;  4BR2 A;  3MX2 A;  3T7Z A;  3B8A X;  3CJB A;  5AQP A;  2QEX N;  1E4F T;  3VEW A;  2I7P A;  2F9T A;  5GAH P;  2OTJ N;  5AQM A;  2IVO A;  1X9J A;  3NVM A;  2P9N A;  4Z94 A;  3FZM A;  3HZ6 A;  3I8B A;  1DT9 A;  4QS8 A;  4IJN A;  5CE3 A;  5M1K A;  2E2P A;  5GIP A;  5EXW A;  3HM8 A;  3OBY A;  1VQM N;  3CC7 N;  2NRR A;  4BR4 A;  3P4I A;  3DXM A;  2QWN A;  3HI0 A;  1YXQ A;  3CPW M;  3U8X A;  4I6M A;  3TTF A;  2E1Y A;  4HTL A;  1VQ4 N;  2YHY A;  2FLO A;  2VWB A;  3EL2 A;  4JK7 A;  4YOW A;  3H6E A;  4IEE A;  3A5M C;  3L4Q A;  1NM1 A;  1RFQ A;  4OPH A;  1KXP A;  3ZET B;  3QB0 A;  3JS6 A;  3SAF A;  3AAP A;  1CZA N;  1Y64 A;  4L3Q A;  3DLL L;  3G71 N;  3WXM B;  3WXL A;  1M1K O;  4B1X B;  3W0L A;  3FZL A;  3A5N C;  3ZEU B;  3KWI A;  5C2F A;  5CHI A;  1TYQ B;  2HF3 A;  4H0V B;  2A40 A;  1Q82 O;  4JKB A;  5EVZ A;  3D2E A;  3CJ7 A;  1HKB A;  1GLF O;  2FF6 A;  2HOE A;  1C0F A;  1SZ2 A;  4ILJ A;  4B1U B;  3CME N;  2Q1N A;  3DWL A;  4CZL A;  3VPZ A;  4A2B A;  3QFU A;  4K42 A;  4J8F A;  4XH4 A;  3H3N O;  5LJW A;  5AQF A;  4NO7 A;  3ZX3 A;  3CC2 N;  4MDB A;  3C6H A;  3QFP A;  3ZX0 A;  2FSK A;  3A8Y A;  2NRW A;  3CJ1 A;  4FWM A;  4KBO A;  4CZE A;  3NVK A;  1KAX A;  3MCP A;  2UYT A;  3CQX A;  1GLJ O;  3UE5 A;  2VGN A;  4H5T A;  1YF5 L;  1EQY A;  2BTF A;  2ZWH A;  3U4L A;  3FE1 A;  3VF4 A;  2ZF5 O;  1MDU B;  4IEI A;  1YI2 N;  1HLU A;  1SAZ A;  4U67 L;  3MN5 A;  3P31 A;  4BQL A;  4A59 A;  2E8A A;  1BUP A;  3R9P A;  4GV6 A;  3O08 A;  3QBX A;  3M1F A;  4H0Y B;  5F0X A;  4WF9 L;  5H1S Q;  1QHA A;  1ATS A;  4A2A A;  4BRN A;  1IG8 A;  5GAE P;  5CR4 A;  5I9E B;  3WUH A;  2QWL A;  5AQH A;  1D4X A;  3G4S N;  3A0I X;  1TYQ A;  3I33 A;  1XQS C;  2WFB A;  5KPR A;  4JN4 A;  1JCG A;  3VEX A;  4BR7 A;  3HOT A;  3G25 A;  5AQX A;  2ZJQ L;  3HBT A;  3LDN A;  4BG9 A;  5ADX H;  2YHX A;  4WFA L;  1BA0 A;  1Q86 O;  4B9Q A;  3MDQ A;  2ASO A;  5AQT A;  3AGR A;  1NGG A;  5BRD A;  3EE8 A;  1NGF A;  3HRG A;  3E66 A;  5AQJ A;  2GTD A;  3TSQ A;  2A41 A;  2P9N B;  2P9S A;  2BH1 A;  2NRV A;  3VMF B;  1RDW X;  2HST A;  3P38 A;  4A61 A;  2CGL A;  3SK3 A;  3KHY A;  3CCV N;  4O8U A;  1VQ6 N;  3ENB A;  4CD1 A;  5AQZ A;  4EAH D;  4GNI A;  1DGK N;  2RE2 A;  3LDQ A;  3DXM B;  2VCP A;  3T69 A;  4C1N K;  4JKG A;  1U6Z A;  4BC2 A;  3MMV A;  1NBW A;  3R1X A;  4H0O A;  4NLC A;  4I6M B;  4BRQ A;  1W2B M;  1VQ8 N;  1VAZ A;  3SAG A;  3J7Z O;  1NMD A;  2HBL A;  3DJC A;  3Q7C A;  1BWF O;  4JNE A;  2PAV A;  2KLA A;  4BR5 A;  3CCS N;  4JAX A;  3C7N A;  3Q7B A;  3VEV A;  2FXU A;  5AFU H;  4BRP A;  1HKG A;  4BRI A;  4DCH A;  2HMP A;  4BGA A;  2E1Z A;  4BRH A;  2NLX A;  3RSE A;  4KH6 A;  2I7N A;  2NRT A;  4FWR A;  4O5F A;  2V52 B;  4GY2 B;  2YHW A;  2JWL A;  4EHU A;  1KD1 O;  2GEL A;  1Q18 A;  4WFB L;  4OO1 J;  4WQ4 A;  3D2E B;  5AQO A;  4A62 A;  4C1N I;  4ISF A;  4GVE A;  3GOI A;  2GUP A;  4A5B A;  1IJJ A;  1X3M A;  5GIO A;  4PHT X;  3H1V X;  3CCU N;  1Z05 A;  3N4P A;  1VQL N;  3WEE A;  3ID6 A;  4BRE A;  1QVG M;  4GV9 A;  4BRF A;  3VTH A;  1DEJ A;  4PKI A;  3VEZ A;  2CGK A;  2CGJ A;  1KC8 O;  4FWK A;  3D7E O;  3TTC A;  3CMA N;  4KH5 A;  2FSN A;  3P39 A;  3IDH A;  4JD2 A;  4KH4 A;  2NRX A;  2ZJP L;  5AR0 A;  3VF6 A;  1X3N A;  1VQN N;  1NLV A;  3O4W A;  3O80 A;  4YOV A;  3MWT A;  3KVG A;  3MX5 A;  4MLH A;  3TU5 A;  3HTV A;  1YUW A;  4MDA A;  4BRM A;  3EKS A;  3C0B A;  3R8E A;  2OAN A;  3VGK A;  3CD6 N;  4CZK A;  3EE9 A;  2E2O A;  2QWQ A;  3AAQ A;  5GIN A;  4IOA L;  3A5O C;  2QTD A;  3PIO L;  2P9P A;  1ZC6 A;  3M3Z A;  4UY8 O;  4JKC A;  4FWL A;  4YOR A;  2IIR A;  3VGM A;  3SMP A;  1GLE G;  4AM6 A;  2HBJ A;  2W40 A;  1BDG A;  1OVY A;  2E20 A;  2PBD A;  3BF3 A;  5AQK A;  1LCU A;  5ADX A;  3CCR N;  1K9M O;  4RTF D;  3OHR A;  2A42 A;  5MLC Q;  2QWR A;  1YAG A;  5DM7 L;  4IJA A;  3O1B A;  3UKU A;  2V7Y A;  3H3O B;  4WQ4 C;  3ULE A;  5AQW A;  4IWV A;  2P9L A;  3O9S A;  5C2D A;  2P9S B;  2RHK A;  3TSP A;  5HL7 L;  3WXJ A;  1ATN A;  1NGB A;  3L0Q A;  3MN9 A;  4U7B A;  4DHY A;  5EX5 A;  1VQP N;  5KPT A;  3D2F A;  3SBG A;  3K9K A;  1NGH A;  3O9U A;  5ELZ A;  4PKG A;  4G9Z A;  3R6M A;  4JKG B;  4B1W B;  1XC3 A;  1GLB G;  1WUA A;  3O5B A;  1VQ5 N;  2VGM A;  3VER A;  5GAG P;  1Q7Y O;  3DXK A;  4IZ9 A;  1NGC A;  1Z6R A;  4PL8 A;  3EKU A;  4BGB A;  4BR9 A;  3AAR A;  3C7N B;  4YOX A;  3FZF A;  3OBW A;  4WFN L;  4BQZ A;  2QA4 N;  2A5X A;  4BRO A;  2A6A A;  2P9K A;  2GX9 A;  3O8M A;  5AFU A;  3VOV A;  3VES A;  4NB4 A;  3CJ9 A;  3GDQ A;  3RSE B;  3BF1 A;  5FPN A;  4JKF A;  3CPE A;  1NGD A;  4IDH A;  4DQ8 A;  3QML A;  2Q31 A;  4BRA A;  1QZ6 A;  4YDU A;  2CH6 A;  2E2N A;  3U9Z A;  3EZW A;  4WQ5 A;  4BRG A;  2KHO A;  3CCL N;  5B8H A;  4XH5 A;  4CD3 A;  3TSU A;  1J6Z A;  2GWJ A;  5C10 A;  3ATV A;  4FOI A;  4CBW A;  3CET A;  1H1V A;  3WEE B;  5BPM A;  1KQS M;  1KAZ A;  4A57 A;  1C0G A;  4MO4 A;  1LOT B;  4FOE A;  4BRL A;  1Q81 O;  4BY9 C;  4QS9 A;  2WBN A;  3UKR A;  4B1V A;  1YIT N;  4JD2 B;  4R79 A;  1YJN N;  2KKZ A;  5JVG L;  4YOT A;  5C0Y A;  5M1N A;  1XUP O;  2BUP A;  3LDL A;  3M5R A;  2VYP A;  3VET A;  2OTL N;  1QVF M;  2GWK A;  2NZT A;  4GV3 A;  1HJO A;  2CH5 A;  2IVN A;  4JKA A;  4NLB A;  4PL7 A;  3SLC A;  3EO3 A;  2ITM A;  1VQK N;  3O9Q A;  4FWN A;  3O6W A;  4ILH A;  3G6E N;  4B1Z A;  2P9P B;  3A5L C;  4CZF A;  3IFR A;  1S3X A;  3CCQ N;  4C23 A;  3CHW A;  3CJA A;  4JKE A;  5KPZ A;  5AQY A;  5AZI A;  3C6A A;  3BEX A;  2WC9 A;  4H0T B;  4H0X B;  1HPM A;  3O1W A;  3ZYY X;  2P9U A;  5TKW A;  2AP1 A;  2FSJ A;  1G99 A;  2D0O A;  3CF5 L;  3VF2 A;  3E9O A;  3UB5 A;  2YJE A;  2ZJR L;  2V7Z A;  2F7T A;  3J8A A;  3KK7 A;  2NRZ A;  4JEP A;  1R59 O;  4Y0W A;  4FWQ A;  1NGJ A;  2Q36 A;  1YVN A;  4O8K A;  3UKU B;  2QWP A;  1YIJ N;  3ULE B;  1JCE A;  3C65 A;  3QBW A;  2P9L B;  3WXK A;  4YDU C;  4FWS A;  3FZH A;  1S72 N;  1VQ7 N;  4YOU A;  3IMX A;  1ESV A;  2J4R A;  4CZM A;  3M6G A;  5JIC A;  3EN9 A;  4EFH A;  2NRH A;  5FPD A;  2A3Z A;  3SJH A;  1V4S A;  2QI2 A;  2QWM A;  3NMU A;  3D2F B;  3OA9 A;  3LM2 A;  3LL3 A;  5DM6 L;  1MWM A;  4FPB A;  3MN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...