3O9UA

Effector domain of influenza a/pr/8/34 ns1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
SRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 32
structure length 116
sequence length 116
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9uA00
3P38A 3EE8A 2GX9A 3KWGA 3RVCA 3O9TA 3M5RA 3P31A 3KWIA 3L4QA 3O9QA 3O9SA 3O9UA 2RHKA 4OPAA 3P39A 4OPHA 3F5TA 3OA9A 3EE9A 3D6RA 3O9RA 2KKZA
chains in the Genus database with same CATH superfamily
1VQ8N 5FPEA 3DLKA 4DKWA 3C95A 3SAFA 1BUPA 2E6MA 1WSGA 4FLXA 1YIJN 3ZYYX 4DFMA 3SBTA 2Q3SA 3B6PA 2A40A 5J2MA 3AVBA 1XNRK 3DXKA 3HOSA 3K57A 1KVBA 1XHZA 1LW0A 3CM5A 1NK0A 1VSJA 5BRFA 4FO0A 4FWKA 5EVZA 4BRLA 1TK8A 2HB5A 1BWFO 2QWNA 2RE2A 2P5GA 1C1BA 3A5MC 2HMIA 2G8FA 5HP1A 4IFVA 1GLBG 4NXNK 3UKUA 5KRSA 4O44A 1RTIA 4FZXC 3OBWA 3B8AX 2BUPA 3WXMB 1S5JA 2NRWA 4DR2K 1RT1A 2G8HA 2HOEA 4YORA 3FE1A 3IS9A 5KI6A 4CI6A 3MCPA 4IOCL 2OPRA 4Q5VA 1WBBA 2ZQBA 5E41A 4FM2A 1DLOA 2W41A 4BVOA 4B3OA 3IUCA 3UIQA 1OH6A 3E9OA 1EP4A 1NGGA 1X9JA 4H5WA 4CJSA 5E84A 3CCVN 1BI4A 3WQTA 3WNEA 1XC9A 5AQVA 1HMVA 3RMBA 3THXB 3OJUA 4OGCA 5KRTA 1NKEA 1EWQA 3NF7A 4FK2A 4QS9A 2WONA 3LL3A 3CQXA 4B1UB 3OVNA 1Y97A 4A59A 1ATNA 2E8AA 4E3SA 3OYLA 2F7TA 3SQ4A 5CR4A 1YI2N 4YOVA 3OYBA 3M8QA 4ISEA 3JXUA 5FPNA 2D4WA 2XY8A 4DTMA 4M41A 3JSMA 3ID6A 3MCAB 1TGOA 1NWKA 2KHOA 2W40A 5AQZA 2Z1GA 5HRRA 4OGEA 1VSDA 3NH0A 4NLBA 2GX9A 5AQIA 3KZBA 3SMSA 4FJ5A 1U49A 5C25A 4DTNA 4CECA 4JHDA 1OH8A 1NG9A 1JLAA 3O3HA 1YAGA 4CERA 4ELUA 4FJKA 4FVUA 3Q7CA 4MDBA 4CFBA 3C6HA 5AZIB 2F8TA 4J8FA 4ZTJA 3K9JA 4MO5A 4M3ZA 2UYTA 3U9ZA 4FL9A 1SL0A 1N32K 4A2AA 4DMNA 4B3TK 3LWMA 3D45A 4CGFA 4FK4A 4LH5A 5LMUK 4KHPK 3VPZA 4DHYA 4O8KA 1LAWA 3IG1A 4DR1K 5BPNA 3OYDA 4ILHA 3CYMA 3T1AA 3NH2A 3SYZA 3K5OA 3VA0A 1BCOA 1Q9YA 2VQEK 1OKJA 1Q9XA 3TTDA 4WQ4A 1J5OA 4BE0A 1GLCG 2E2NA 2F9WA 1VQ7N 4GW6A 1XHXA 4BC4A 2VCPA 3LDLA 5CE3A 3CMAN 4LF5K 1CZBA 2NZTA 3NBPA 3V1RA 1RDCA 2A41A 4B1YB 3C65A 4JS4A 4BE1A 2HBMA 1MWKA 1ZBUA 2YJEA 1N34K 2ASMA 2A5XA 1D9DA 1TL1A 2O8BA 1C0FA 2G8WA 3QIOA 4DSLA 5M1KA 1YVUA 3AO5A 1BDGA 3QEXA 1ATRA 1BOTO 3GL1A 4RW6A 4YNQA 3V1QA 2CH5A 3DI6A 3CD6N 5HBMA 2YKMA 1SV5A 4KREA 4KTWA 3IFRA 3DJCA 1KTQA 4B1ZA 4FVMA 4KPYA 4DSFA 2HMPA 4JLHA 1OVYA 1TK0A 5BREA 1YJ9N 3P5JA 2QWPA 3EE9A 5SWMA 3C6AA 1MDUB 4CJ3A 3FZHA 3OYFA 4KHWA 1LV5A 3I0RA 4FJHA 3KK3A 3AAPA 1HYSA 3J80O 3SBGA 1HX1A 2B5JA 1CZAN 2P9IA 5AQFA 4L3QA 1FW6A 2JLEA 4NCGA 4K8ZA 2HVHA 4YOUA 2YNIA 2I5JA 3ZEUB 3KK2A 2P51A 3CJ1A 2P9PA 3OHRA 5EY4A 5BR8K 3U8XA 4EZ9A 3CQ8A 3UKRA 4FLZA 3V9UA 1JCGA 4CJRA 4BREA 4B9LA 1Z05A 1TKDA 2YKNA 3OY9A 1EX4A 2X6NA 2QKBA 5J2PA 4JKAA 4M7XA 3C94A 3HSTB 3TAMA 1BHLA 3CJCA 4JI5K 3AA2A 2E1YA 4JI2K 4M45A 4GV9A 4HWIA 3NAEA 2P5OA 3SUQA 3AVKA 4JI4K 4CK2A 2RKIA 4WE1A 1ZBHA 3HI0A 5KGXA 3V81A 3VF4A 4RW9A 3KD1E 2VG7A 3PLAA 4J2BA 3O08A 3K59A 5SZTA 3H08A 2WUSA 4JKGA 4B8CA 3MAQA 3SV3A 5LJWA 4H0OA 3HXMA 4XIUA 1JCEA 2RN2A 1BU6O 4I6MB 5F1XA 1NU0A 1QQMA 2V7ZA 1HNIA 3C6UA 4KHYA 3FLCO 4R79A 1X1PA 1WSJA 3CF5L 3DLGA 5AQHA 2O8DB 3CCQN 3UB5A 3WUHA 1IKWA 3AV9A 2YNFA 4O8UA 1FJGK 1ZBLA 3AO3A 4ILJA 4BR2A 2P9UB 1HYZA 2Z1JA 3HVRA 3VQDA 4BWMA 1T6CA 4QOZB 2PFUA 4PWDA 3CFPA 1HQEA 4B9SA 1CLQA 4WQ5A 1LCUA 4FJ8A 1S1WA 2VWBA 1Q86O 2KZZA 3M5RA 5M1OA 4DQRA 5CYMA 1TAQA 4JKEA 4KB1A 5CZ2A 3HBTA 1HNZK 2GUIA 4CEBA 4CJWA 4IXCA 3DXMB 3DLEA 2Q2RA 3WNGA 3ZSXA 4H03B 3QFUA 3G4SN 5LJVA 1NLVA 1YVNA 3RMAA 4BRFA 1W0HA 4E1NA 2CGLA 4E19A 3QEIA 2OTLN 2XO7A 3L4QA 4FJ9A 2QM1A 4O55A 3TAPA 1BQMA 4YOWA 2JWLA 4DSIA 3RMDA 2I7PA 4CJTA 4JK9A 4I2QA 3VEOA 5JICA 4DLGA 4CEAA 3O3GA 1IBMK 3QLHA 1C0UA 3J7ZO 1JL2A 4FZZA 4LF7K 4R5PA 1RNHA 4OKJA 2QWRA 3C7NB 4C8MA 2BE2A 2PAVA 1NGBA 2X78A 3RTVA 1HKGA 3CERA 4KH6A 3D2EB 1NK6A 3HT3A 4C8LA 3VQ8A 4IOAL 3RSEB 1RTJA 3K0SA 3ISNC 4F3TA 2Z1HA 4OPKA 4IO9L 3VQBA 1SKWA 3OA9A 4JKDA 4JS5A 4M63C 2FSJA 4NYNA 4C8OA 3QIPA 3CG7A 1OVQA 1NK9A 5DMRA 4BG8A 4B9VA 2A1SA 3O5BA 4DTXA 1S9GA 4CJKA 5KQDA 4FPAA 4CD1A 2P1JA 1YXQA 3KJVA 2YJFA 3MN5A 3KLEA 3AVHA 1EO1A 3KTQA 4I7FA 3P39A 2XHBA 3CCRN 4BVPA 2E88A 2HNDA 4FOEA 3OS1A 1QVFM 2XRIA 4FWPA 4OKKA 4JNEA 1BIUA 1KLNA 1VQKN 4CJQA 5J2QA 4CHNA 4LF8K 1R59O 2Q36A 3NDKA 2NRXA 1ASVA 1QHAA 3TI0A 3LPTA 4H5RA 5C0YA 1ZBSA 2HBKA 5LMNK 4DFJA 1VQ9N 3PO5A 3NFAA 3AVCA 5DK5A 4IFYA 3M3ZA 5M1PA 5BR9A 3H45C 4CHQA 2HVIA 3ZEUA 4BC2A 1U4BA 4M3TA 3QINA 3LAKA 5AQMA 4B9MA 3LP2A 3G6EN 2FBYA 1VQ6N 4ELTA 3ULEA 3BEXA 3MXIA 1T8EA 3O9UA 3O8MA 4W5TA 3WNFA 3TAFA 3CETA 3JYTA 2BGGA 1JJ2M 2IIRA 1RDUA 3OYCA 4E7IA 1LWEA 4IEIA 1VQLN 1VSEA 1Q82O 2NRZA 4MDAA 1RDDA 3ATUA 2ITMA 2YNGA 1LWCA 1N8RO 4FSVA 1RBSA 4LSLA 3OS0A 3QO9A 2UXDK 3CCSN 4KKOA 3PO4A 3FZKA 4B1XB 2O4GA 1KVCA 1J6ZA 4KAZA 4BRIA 3CFRA 3HZ6A 2A42A 1QQCA 4B1VA 2KQ2A 1NGIA 2JWKA 1W2BM 5IT9O 4ISGA 4YY3K 4FCYA 1VSMA 1U47A 3VESA 3HSCA 3DLRA 2XY6A 4Z4GA 3OYMA 1TYQA 4OPHA 1P90A 3I8BA 4M3UA 2P9UA 4IJNA 4GNIA 4FWLA 3EE8A 3VOVA 4CZIA 4LF6K 3VQQA 5EU7A 4WFAL 3J8AA 1VSFA 4BACA 5GIOA 4OJRA 4CIGA 2RPIA 4WQ4C 3TR8A 3ZLJA 1M1KO 4BR0A 3BGRA 3ZT3A 1HNWK 4PQUA 4FM0A 2KW4A 3TAQA 1W7AA 4KHUA 3LM9A 1J53A 2NLXA 4BGAA 5AQRA 3SJJA 5AQUA 1SZ2A 4FM1A 1NK5A 2HF3A 2O4IA 2FXUA 3T7ZA 4IKFA 2F8SA 4CF0A 3U6FA 4BG9A 4FJXA 4FYDA 1FKPA 3V1OA 1A5WA 3QEPA 5I3UA 3ZSQA 3DLLL 2Q0RA 3FZMA 4EZ6A 1QS4A 1BGXT 3TARA 1GOAA 4DV7K 1DKGD 1K6YA 2O8EA 1E3MA 1MU2A 1HKBA 2V51B 4AQYK 1Y64A 3DOKA 3ENOA 3R8EA 4CZEA 5BRHA 4JRPA 2OPPA 3SUOA 4N76A 3CM6A 2IGIA 2D0CA 3FFKB 1HR0K 3QEVA 1HNXK 3J7YP 4PKIA 5C24A 1K8AO 4JI7K 3IAYA 3NE6A 2BANA 2VG6A 4NXMK 3D2EA 1O1WA 4CESA 1SKRA 4F2RA 1XNQK 2HBLA 3OYKA 1MA9B 2IOCA 4DSKA 3MWPA 3TAEA 3TAGA 1RDAA 1T05A 3TTCA 3A0IX 3K5MA 2W42A 3VERA 1N36K 1NNEA 4AHTA 1OH7A 5TKWA 3HYFA 3CPWM 1D5AA 4HUFA 1BA1A 3OBYA 3O9TA 1UAXA 3TSPA 2O8CB 4Z4HA 3G0ZA 3QBWA 2QWMA 4CHZA 2ZGZA 1NKCA 3H6EA 5HRPA 4DV5K 4DR6K 1RFQA 4B9QA 5JMVA 5KPZA 1YJNN 1HJRA 4IJAA 5C12A 2QXFA 4RW4A 1ITGA 3RMCA 2QWQA 4CJVA 1KFSA 1KXPA 4QS8A 2IC3A 2D0PA 3F9KA 4KH5A 5BN9A 2EWSA 3OYNA 2HHQA 4JD2A 3WXLA 2QWLA 2F9TA 3M8SA 5AQPA 1SL2A 4FJJA 3BY5A 3KK7A 5DM6L 1NK8A 2ZM6K 1D8YA 1ZC6A 1KCFA 4CCHA 1Q81O 5CZ1A 4CFAA 2P9KA 1RBTA 4AHCA 3KD5E 3QDKA 2QKKA 3P1GA 1X9MA 3LDOA 5E26A 4JKHA 1JLQA 4JKCA 3SUNA 4QS7A 1VQMN 4J2DA 4BDYA 4N5SA 3AVMA 3CFOA 3P83D 1Q7YO 3QNNA 1T6DA 3G10A 1VQON 3CXCM 4DV3K 2Y1IA 5F0XA 4HCBA 3SI6A 1NGAA 3TPQA 2P9LB 5AFUA 5AQWA 1S3XA 2V7YA 3LPUA 3IDHA 1VAZA 4WQ5C 2ZWHA 3IMXA 2GWJA 1BA0A 2UU9K 5AQYA 1T03A 5KQ8A 2IVOA 4LD0A 1KAYA 3H1QA 4AM7A 2QEXN 2ZGYA 5GAGP 3I33A 1FKOA 3P4IA 4PA1A 3L6QA 4BRHA 1VQ5N 1K9MO 1FK9A 3HRGA 1YHQN 3QESA 1RT5A 4XH1A 1S1TA 4Z4EA 1WSEA 3TSQA 2J4RA 5FLXO 2D0AA 4G9ZA 4Y0WA 1V4TA 2P9SB 4B08A 5AZJB 4F9OA 3DAWA 3EY1A 3N4QA 3ZSOA 3VGKA 3L2VA 4EP5A 5C15A 4B9NA 2OPSA 3THYB 3VQAA 1XMOK 4CJUA 1I39A 3CJAA 3TABA 4Y1DA 3VMFB 1UA0A 5ADXA 1HKCA 4IWVA 2OANA 1GLEG 1GOCA 2Q97A 2KZMA 2IAJA 4AM6A 3D7EO 1GLAG 3CIPA 1Z26A 4FWRA 4H8KA 3QFPA 4BRPA 3K58A 3AVLA 1VSHA 3VEYA 2HHHK 1JLGA 3KHYA 3ZCMA 2GWKA 3EKSA 4Z94A 4I2PA 4KRFA 1QQNA 4H4OA 1RDWX 4DCHA 4EFHA 2QW9A 4Z0UA 2HHUA 3PUFA 1I3AA 2NRVA 4FJNA 4WCEL 4FZYA 3R6MA 5GAEP 1KSPA 1GLJO 3E1YA 2AJQA 2O8FB 4BQZA 4O5FA 1WSHA 5EOYA 3O1WA 3LDNA 4ZHRA 1SAZA 2D1KA 3LDPA 4WYBA 4DV1K 5ELZA 3V9XA 3CHWA 3MEEA 3S9HA 1LWFA 4X66K 3O4QA 4YHHK 4RCHA 2AP1A 2ETJA 3NHGA 2ASPA 3G71N 5HRNA 1S22A 3QETA 3LM2A 1S9EA 5FROA 3GG4A 3ZSRA 3OYHA 1HNVA 4A62A 3ENHA 4GV3A 2FLOA 1BISA 3LP0A 4JAXA 3KIOA 3SPZA 3KWGA 2DFHA 3HTVA 3Q7BA 3DLHA 1JLEA 3KWIA 1EQYA 3NGZA 3HK2A 4RW8A 4JV5K 3L2UA 1HQUA 4DFKA 2RHKA 4GKJK 1RBUA 4CEZA 3J81O 2IDOA 4OLBA 4FWNA 3LALA 2UXBK 1RT2A 1EETA 1R0AA 3THXA 3FR0A 1C1AA 1CXQA 1NGFA 3PSFA 5HROA 4FLVA 5AR0A 4IOXA 3PY8A 1IBKK 4BC3A 2ZD1A 4JK7A 3W0LA 1I94K 2KTQA 3SAHA 2QWOA 3AY9A 1T3VA 3SQ0A 1W9HA 4KI6A 4N41A 3S3MA 3L8BA 1YITN 4CJPA 4KH4A 2UXCK 4DSEA 1NOYA 4Q0BA 4AHSA 4U67L 4H5NA 1ZXOA 2E2PA 3KKSA 2YHWA 3MEGA 3O3FA 3OYGA 4KFBA 3IRXA 2F96A 3DM2A 4KHSA 4UQGA 1BIZA 1TVRA 3O1BA 4CJ4A 4HTUA 4CEEA 4DU3A 4I9QA 2NNWA 5GAHP 5EX5A 3HM8A 4DG1A 1S6PA 1QE1A 1QSYA 2E2QA 1TAUA 5H1SQ 4JI0K 3THWB 4H5VA 5AZIA 5BPLA 1S1XA 3ZETB 3ZSZA 3CCLN 4OLAA 3S3OA 1IO2A 3BF3A 5AQXA 3NF8A 4DQQA 5D3GA 2CGJA 1ZYQA 4KB0A 4WFBL 1QHTA 4LY7A 3M8RA 3I55N 1NBWA 5AQTA 1GLFO 3ULDA 4E7LA 2Q1NA 3WXIA 3DRSA 4DB3A 1L3UA 4CJFA 4OX9K 1UWBA 4NYFA 1NGJA 3DRRA 4E0DA 4KBOA 4EHUA 1HJOA 4IFEA 4F3OA 1WBDA 1NMNA 2WC9A 3S3NA 1NGEA 2YHXA 4K25A 3SK3A 3TANA 4DR7K 4FWQA 3VQPA 4AHVA 1NJYA 2A6AA 3PIOL 3CQYA 2V52B 3MX5A 1SL1A 3LP3A 2P9SA 3I56N 3OS2A 2ZJPL 4CZLA 4JI3K 1ESVA 3M1FA 4CZJA 1TUYA 3L4IA 4MO4A 1BG3A 5J2NA 3HVTA 3EEQA 4N47A 3ZT1A 3OYEA 4FK0A 1CZ9A 2VWJA 1WB9A 1IG9A 3AO2A 3T69A 4X64K 4YFUA 4DTUA 3HO1A 5FRNA 1YTUA 5HOOA 3HPGA 1NGCA 4C8NA 4XH4A 4J2EA 1TK5A 3VTHA 4RG8A 4PL7A 3U3GA 4NB4A 1VSLA 1JXEA 4JI1K 3H3OB 4CVNE 4CHPA 2W6KA 4DU4A 4OO1J 1IBLK 2XY5A 2AA4A 3GE1A 1YTAA 3MN7A 1WSFA 1T7PA 1BI4B 3VA3A 5GADP 4BR7A 3BF1A 2I7NA 5A2QO 4HUGA 1NM1A 4BRGA 1XMQK 3WNHA 1N5YA 4BROA 1KRPA 3WEEB 3MDQA 2NRRA 2FBVA 2KKZA 3B6OA 3W3DA 3SQ2A 5JS2A 4IDKA 3U3YA 2G8UA 4V19S 4ISFA 1JLFA 1ZBFA 3D0PA 1VSKA 1X3MA 1RILA 3T19A 3ZT2A 2NUBA 1E4GT 3OJSA 3HPHA 5BN8A 2FC0A 3AA5X 4DV6K 3CI5A 2VGMA 1J54A 4FOIA 3GBTA 4G1QA 4ID1A 2E20A 3A5NC 2YHAA 2E2OA 1SKSA 2DPNA 1JL1A 4JHDB 1Z25A 2IVPA 2GEMA 4EHTA 3VQEA 4DQSA 1YF5L 3WT0A 1WAJA 2GV9A 3ZX2A 5C2DA 4CJ7A 4A5AA 3OYAA 1NK4A 2H3GX 4CK1A 1QSSA 3VEVA 3CJBA 3E9PA 4CK3A 4RTFD 3LDQA 1C0TA 4BR4A 4DTJA 3AO1A 4IZ9A 4FXDA 4KV8A 1ASWA 3SNNA 4I6MA 2X6SA 4CZMA 4BRDA 5GIPA 3F73A 1WAFA 4PY5A 5AQQA 3O80A 4LSNA 2B4JA 2O8DA 1WLJA 3NCIA 4NO7A 4QCLA 1VQPN 3F2KA 4MLEA 4ICLA 1QZ6A 4DF8A 5C10A 4DS4A 3A5OC 4DTSA 3MWTA 2HHXA 3VQCA 1SS6A 3ZSVA 3QERA 5FPDA 1VQ4N 3CC7N 1EWRA 3RR8A 3VEXA 3PX6A 4LH4A 1T44A 1IKXA 4LF9K 2QA4N 4A57A 4C23A 5M1FA 5JS1A 4FW1A 2HHSA 3V4IA 1HLUA 2DTUA 4KHQA 2YV0X 1QTMA 3DYAA 1VRTA 1A5XA 3R9PA 4KO0A 3HM9A 3QB0A 4H0PA 3DXMA 4Y1CA 3VEWA 5JLFA 3AVNA 1F21A 4BDZA 3RVCA 1B9FA 3AVIA 3AGRA 3AO4A 4CZGA 4KI4A 3ZETA 5JLHA 5MLCQ 4MLHA 4E7KA 4IDHA 5AQGA 3CPEA 1XQSC 4DR3K 1SUQA 2HHTA 2P9IB 3SJHA 2G8IA 3KLFA 2A3ZA 4PUOA 1GLLO 4E1MA 2KFZA 1M90O 3RR7A 4CJLA 3C7NA 1HPMA 2OCEA 1HUXA 2P9PB 3T3FA 4BWJA 4BE2A 4DV0K 5KGWA 4M7YA 3DOLA 3UKRB 3SAGA 3I8DA 1KD1O 3VQ5A 2FF3B 3RWUA 3RSEA 2UUBK 1KAZA 4DV2K 1KLMA 2GTDA 2HHVA 1W97L 3WXKA 1WSIA 4ZTFA 3ENBA 4W5QA 2E6LA 2HF4A 4A61A 4DTRA 2A1RA 3MK6A 3LZIA 4CBUA 1BCMA 3T1HK 4C8KA 3QNOA 4PHTX 4B9TA 4CEOA 3VN5A 1RT7A 2YI1A 2Z1IA 3L3VA 3VTIA 2E4LA 1C6VA 5BPMA 4IBNA 1K8KB 4K8XA 5JVGL 3FZLA 1VHXA 3D6RA 3V9WA 4CGJA 2E5LK 2ZJQL 2PZSA 5C42A 4E89A 4CJ5A 4QAGA 5J1EA 4GKKK 4NLCA 2OTJN 1WUAA 3SPYA 4JKGB 5CY4A 4LFAK 3BZCA 2YX6A 4BGBA 3L2QA 2VGNA 3U4LA 4DQPA 1J9AA 5HRSA 2YCHA 3MX2A 4K41A 4BY9C 4KTZA 5KTQA 5AQKA 4WF9L 1ATSA 4HTLA 4HVJA 1HYVA 4DQIA 3K5NA 1RBVA 1NKBA 1TL3A 2PYLA 4DSJA 4RW7A 4L8RB 4DLEA 1U45A 2VYPA 1TKZA 3WEEA 4CEFA 2FSNA 3EN9A 4DV4K 4M3YA 4IO8A 4GVMA 2GELA 1S1VA 4F4KA 4XH5A 3WQUA 3O6WA 1C1CA 3GDQA 4LFBK 4WFNL 3EYZA 4JKFA 3UE5A 1K73O 4X62K 4A2BA 4CF9A 1U6ZA 1Q8IA 3SCXA 5FDLA 4B1WB 4X65K 3KVGA 4A5BA 3AVFA 3ATVA 5KPRA 5BRDA 1GOBA 4K42A 3V9ZA 1KAXA 3C6TA 4CBWA 1X9SA 1IKVA 1P8ZA 3MN6A 1NOZA 4JN4A 2P9NB 1YT3A 4CIFA 4LC9B 4E7JA 4BDPA 3DLBA 3PX4A 4RWTA 2OPQA 2NRTA 3OYJA 3FFIA 4CZFA 2UUCK 3PIPL 3DMJA 3KK1A 1JKHA 4YDUA 3VETA 5AQJA 3ZX0A 4B9UA 1RBRA 1EKEA 1UA1A 1XC3A 4JKBA 4LF4K 1HRHA 4BC5A 1NJIO 4BRMA 2PY5A 2YHYA 1NK7A 1E4FT 3V9SA 4DF4A 2XY7A 1RT6A 1ASUA 2W6LA 4OPAA 3T1YK 4JI6K 5C2FA 2ASOA 4J2AA 4JRQA 1O13A 1JLBA 4CFDA 1DTTA 3KLIA 1NGHA 3ITHA 4K0KK 1IG8A 2CH6A 1U48A 2IS3A 4CJEA 3HP9A 3P31A 3O4NA 5GINA 4MFBA 5EXWA 3VQ4A 1LW2A 3ZT4A 4AHRA 2CGKA 3NH1A 5T7BA 2YHBA 2ZE2A 2KLAA 1NJZA 2QXLA 4JEPA 4IEEA 4EP4A 3QBXA 1LOTB 5JVHL 3A5LC 1WNSA 2BTFA 4CHOA 4CF2A 5FPMA 4W5NA 4CGDA 3QEWA 4CF8A 1RCHA 3HJFA 4O5BA 2HHWA 3OW2M 2FSKA 2E1ZA 3LP1A 3THVA 4O4GA 4CZHA 1NJWA 3VGLA 3HOTA 2WFBA 1LAVA 3NMUA 4JK8A 2GBZA 2GUPA 2QTDA 3MECA 4FJLA 1JXBA 3CJ7A 1U2VB 5LY3A 2JGUA 4IG3A 4DS5A 4DWIA 2ITGA 3CCEN 1TKXA 2HBJA 3WXJA 4DQ8A 1VK0A 2VQFK 3HPOA 2VWKA 3JS6A 4OVLA 4C1NK 4EIAA 3CCMN 4C1NI 2QI2A 3ULEB 4E7HA 3NGIA 2D5RA 2DFFA 2VG5A 2D0OA 4BRQA 3AA4A 4ID5A 4DU1A 2Y1JA 3L2WA 1FXXA 1CXUA 3VENA 1SQKA 4DR4K 4CFCA 2O8CA 4FJ7A 2OZMA 1DT9A 3E01A 3VQ6A 1K8KA 1XWLA 3RRHA 3KLGA 3HP6A 3QICA 2WOMA 4B8AB 2PBDA 1BO5O 4H0VB 3MXJA 1L3TA 3DRPA 5AFUH 4CIEA 4Z4IA 3SQ1A 3D2FB 3I0SA 3HL8A 4O0IA 1L3SA 4DUYK 1L3VA 4CF1A 5AQOA 4NCAA 3JAMO 4HCCA 3F5TA 4KTQA 2LSNA 4K43A 2HW3A 4AILC 1B92A 4Z4CA 3IKMA 4FWSA 3OYIA 3KKRA 1KVAA 4H0XB 4I9LA 4M42A 1QQOA 3TWHA 1XI1A 2G8KA 4TSXA 2EHGA 3AVAA 1RT3A 1TYQB 1BL3A 3DWLA 1RGIA 2FBXA 1TKTA 4H0YB 4B3RK 3CJ9A 4PKGA 5AQLA 5AJ3K 3CC2N 1D4XA 4CD3A 3S41A 3L0QA 4CGHA 1D9FA 3MEDA 3NVMA 1X3NA 4GVEA 4M3WA 5ADXH 2G8VA 5I9EB 3AARA 4LFCK 2IVNA 4OKEA 3AAQA 3FGUA 3CCJN 3O9QA 4DTOA 3AVGA 2P9LA 3VF6A 3ZT0A 3M8PA 3TTFA 3L2RA 4FJIA 4AH9A 4O0JA 1RDBA 1Z6RA 3VF2A 2P9NA 2WTUA 5IWAK 3KLHA 3VQ9A 3VEZA 3A2FA 4PL8A 4DTPA 5K14A 4M3RA 3P38A 3GOIA 4H4MA 4CGGA 3SLCA 2R7YA 3K9KA 3PV8A 4BQLA 3CC4N 1HPZA 2ZF5O 3DXKB 3E9LA 1S72N 2FBTA 1L5UA 3TSUA 2O8EB 4MQ3A 2QK9A 3C0BA 4FWMA 3O9SA 1KC8O 1YUWA 1JLCA 3LZJA 2OYQA 1RT4A 1ZBIA 4E1JA 4W5RA 3AA3A 2DY4A 1U04A 5AZJA 4W5OA 3UKUB 2PYJA 1NJXA 4GY2B 1JCFA 3CMEN 1QSLA 3THYA 1VSIA 3NF6A 2Q0UA 3K5LA 3QMLA 4DR5K 1G15A 1IKYA 2KFNA 4GV6A 1EXQA 1TV6A 5B8HA 3R3LA 2OZSA 2HNYA 3U9DA 1DGKN 5DM7L 3BDPA 4Z4FA 1G99A 1RTDA 2BDPA 1S6QA 4FLTA 1RTHA 4FLUA 3BZKA 4BRNA 4BRCA 2OA8A 3F9MA 2YNHA 5HL7L 1NMDA 1V4SA 4UY8O 1IJJA 5FRMA 4F8RA 3H3NO 3PSIA 4CEQA 4CHYA 1REVA 1DTQA 1YJWN 4B3MK 1KQSM 3J7AP 1VRUA 2DFEA 2D0BA 3EL2A 5CYQA 1NGDA 5I42A 3N4PA 4FJGA 3MMVA 3BUZB 4EAHD 4JD2B 5TKYA 1N6QA 2O8FA 3ZSWA 2WBNA 1DEJA 4XEIA 1U2VA 4FLYA 1TUUA 2RF2A 4YOXA 3SZ2A 1B9DA 2P9KB 3G25A 5AQNA 1KFDA 1MWMA 3O4WA 1VQNN 3TU5A 4F2SA 1WOQA 1C0GA 1J5EK 4CBXA 4BRKA 4FWOA 4M3XA 3R1XA 3MXMA 1WN7A 4CE9A 4FLWA 3K2PA 3RRGA 5M1QA 4ILGB 3L3UA 1ILYA 1A5VA 3SMPA 3LWLA 4AHUA 3AGKA 4KHNA 1IV0A 3VQ7A 1QZ5A 1XUPO 1S1UA 3EO3A 3O9RA 1OH5A 3LANA 4YOTA 4CEDA 4FPBA 5M1NA 3ID8A 4B3SK 3ALYA 4HHTA 3SV4A 4JYAK 4CW7B 5KPTA 3PX0A 3A8YA 4BRAA 2ATQA 4DFPA 4OPJA 5HLFA 2UUAK 3D2FA 4AF1A 4GMJB 4IG0A 4HUEA 3EZ5A 2EX3A 2ZJRL 4H0TB 4FW2A 4YOYA 1QVGM 4N56A 3OTOK 1C0MA 4H5TA 3NGYA 3E66A 4YDUC 3ZSYA 2Q31A 5F2RA 3H46O 3CCUN 3V6DA 1X9WA 3M6GA 4CZKA 1GLDG 1BQNA 1UOCA 4DUZK 2F4VK 2B6AA 3BP8A 2O8BB 3NF9A 2NRHA 5AQSA 4NCBA 3ZX3A 5LL6Z 3MN9A 2HNZA 4JI8K 1H1VA 1IH7A 2HSTA 2FF6A 3FZFA 3LDSA 4CGIA 5CHIA 2BH1A 4PKHA 3ASMA 1N33K 4BR5A 3H1VX 3LAMA 4U7BA 3THWA 2X74A 4FJMA 3AVJA 4BR9A 4ELVA 3EZWA 1Q18A 3NVKA 3SUPA 3VGMA 3EKUA
chains in the Genus database with same CATH topology
4YDUA 4JNEA 1VQ8N 3VETA 5FPEA 5AQJA 3ZX0A 4DKWA 3SAFA 1BUPA 1YIJN 3ZYYX 1VQKN 3FR0A 1NGFA 1XC3A 1R59O 4JKBA 3SBTA 2Q36A 5AR0A 4IOXA 2A40A 2NRXA 1QHAA 4BC3A 4BC5A 1NJIO 4H5RA 4JK7A 3DXKA 4BRMA 3W0LA 3HOSA 2YHYA 5C0YA 1E4FT 1ZBSA 2HBKA 3SAHA 2QWOA 3AY9A 1VQ9N 1T3VA 4OPAA 5BRFA 3M3ZA 4FO0A 5M1PA 5BR9A 3H45C 3ZEUA 4BC2A 4FWKA 5EVZA 5C2FA 2ASOA 5AQMA 1O13A 4BRLA 1YITN 4KH4A 1BWFO 2QWNA 2RE2A 3G6EN 1NGHA 3A5MC 4U67L 1VQ6N 3ULEA 1IG8A 4H5NA 2CH6A 1ZXOA 2E2PA 3BEXA 1GLBG 3P31A 5GINA 3UKUA 2YHWA 5EXWA 3O9UA 2CGKA 3OBWA 3B8AX 2BUPA 3O8MA 3WXMB 2KLAA 2QXLA 3O1BA 4JEPA 4IEEA 2NRWA 2NNWA 2HOEA 3CETA 3QBXA 5EX5A 1LOTB 5GAHP 3HM8A 4YORA 3FE1A 1JJ2M 5JVHL 2IIRA 4CI6A 2E2QA 3MCPA 1RDUA 3A5LC 5H1SQ 4IOCL 2BTFA 4H5VA 5FPMA 5AZIA 5BPLA 3ZETB 4IEIA 3CCLN 1VQLN 2W41A 4BVOA 3IUCA 3BF3A 5AQXA 3E9OA 3OW2M 2NRZA 2FSKA 1Q82O 4MDAA 2ITMA 1NGGA 2E1ZA 1X9JA 3ATUA 4H5WA 5E84A 2CGJA 1N8RO 3CCVN 4CZHA 4WFBL 4FSVA 3WQTA 5AQVA 3I55N 1NBWA 5AQTA 1GLFO 3VGLA 3HOTA 3CCSN 2WFBA 3FZKA 4B1XB 2Q1NA 4QS9A 3WXIA 4DB3A 3NMUA 1J6ZA 4JK8A 3LL3A 2GUPA 2QTDA 3CQXA 4B1UB 4BRIA 1NGJA 3CJ7A 3HZ6A 4KBOA 1U2VB 4A59A 1HJOA 4EHUA 5LY3A 1ATNA 4IFEA 2E8AA 2A42A 2F7TA 4B1VA 5CR4A 1YI2N 2WC9A 4YOVA 3CCEN 1NGEA 1NGIA 2JWKA 2YHXA 1W2BM 4ISGA 2HBJA 4K25A 3WXJA 4DQ8A 4ISEA 3SK3A 3VESA 3JXUA 4FWQA 3HSCA 2A6AA 2D4WA 5FPNA 3JS6A 3PIOL 3CQYA 2V52B 1TYQA 3ID6A 4C1NK 3MX5A 3MCAB 2W40A 1NWKA 2KHOA 2P9SA 4OPHA 1P90A 3I8BA 5AQZA 4EIAA 3I56N 4C1NI 2QI2A 3ULEB 2ZJPL 4CZLA 1ESVA 2P9UA 4IJNA 4GNIA 3M1FA 3EE8A 4FWLA 4NLBA 3VOVA 2GX9A 1TUYA 3L4IA 4MO4A 1BG3A 5AQIA 4CZJA 3KZBA 3SMSA 4WFAL 2D0OA 4BRQA 3J8AA 3T69A 5GIOA 4WQ4C 5HOOA 1M1KO 4JHDA 1NGCA 4BR0A 4XH4A 3VTHA 3VENA 1SQKA 4PL7A 4NB4A 1YAGA 3H3OB 4FWNA 3LM9A 2NLXA 4FVUA 4BGAA 4OO1J 3Q7CA 4MDBA 1DT9A 5AQRA 5AQUA 1SZ2A 3C6HA 5AZIB 1K8KA 2HF3A 3QICA 4J8FA 2FXUA 3T7ZA 3K9JA 2AA4A 4BG9A 3GE1A 4MO5A 2PBDA 2UYTA 3U9ZA 4FL9A 1BO5O 4H0VB 4A2AA 3DLLL 2Q0RA 3MN7A 3FZMA 5AFUH 3VPZA 4DHYA 3D2FB 4O8KA 5GADP 4BR7A 3BF1A 5BPNA 2I7NA 4ILHA 1DKGD 1NM1A 4BRGA 5AQOA 3VGMA 1HKBA 2V51B 4BROA 1Y64A 3F5TA 3WEEB 3MDQA 4K43A 2NRRA 3ENOA 2KKZA 3R8EA 4CZEA 5BRHA 1OKJA 3IKMA 4FWSA 3TTDA 4WQ4A 3W3DA 4H0XB 1GLCG 2E2NA 3FFKB 2F9WA 4ISFA 4PKIA 1VQ7N 1K8AO 1QQOA 4BC4A 2VCPA 1X3MA 3LDLA 5CE3A 1TYQB 3CMAN 2NZTA 1E4GT 3D2EA 3DWLA 2A41A 4B1YB 3C65A 1RGIA 5BN8A 2HBMA 1MWKA 2YJEA 4H0YB 2ASMA 2A5XA 2HBLA 3CI5A 1MA9B 3CJ9A 2VGMA 3MWPA 4PKGA 3CCMN 5AQLA 4FOIA 3TTCA 3GBTA 3A0IX 1D4XA 3CC2N 1C0FA 4CD3A 3VERA 3S41A 2E20A 3L0QA 3A5NC 5TKWA 5M1KA 2E2OA 2DPNA 1BDGA 3CPWM 4JHDB 3NVMA 1X3NA 4GVEA 1ATRA 1BOTO 2GEMA 2IVPA 3GL1A 4EHTA 1YF5L 5ADXH 5I9EB 1BA1A 3AARA 3WT0A 2IVNA 2CH5A 3O9TA 3OBYA 3ZX2A 3AAQA 5C2DA 3CD6N 3FGUA 3TSPA 4CJ7A 3CCJN 3O9QA 4A5AA 3IFRA 2QWMA 3DJCA 3QBWA 2ZGZA 4B1ZA 2P9LA 3VF6A 3TTFA 2H3GX 3VEVA 2HMPA 3CJBA 1Z6RA 3E9PA 1OVYA 3VF2A 3H6EA 2P9NA 4RTFD 5BREA 1YJ9N 2QWPA 3EE9A 3VEZA 3C6AA 1RFQA 4B9QA 4PL8A 3LDQA 5JMVA 5KPZA 1YJNN 1MDUB 4BR4A 3FZHA 3P38A 3GOIA 4IJAA 3SLCA 5C12A 3AAPA 3K9KA 4BQLA 4IZ9A 3CC4N 2ZF5O 3DXKB 3SBGA 2QWQA 3E9LA 1HX1A 4I6MA 1CZAN 4CZMA 1S72N 3TSUA 2P9IA 1KXPA 4BRDA 4QS8A 5AQFA 5GIPA 5BN9A 2D0PA 4KH5A 4L3QA 2EWSA 3C0BA 4FWMA 3O9SA 1KC8O 1YUWA 5AQQA 3O80A 4YOUA 4JD2A 3WXLA 3ZEUB 2QWLA 2F9TA 3CJ1A 2P9PA 3OHRA 4NO7A 5AQPA 5EY4A 4E1JA 3U8XA 3KK7A 1VQPN 5DM6L 3F2KA 4MLEA 3UKRA 5AZJA 1JCGA 1QZ6A 4BREA 1ZC6A 5C10A 1Q81O 1Z05A 3UKUB 2P9KA 3A5OC 3MWTA 4GY2B 1JCFA 3CMEN 3QDKA 1SS6A 2Q0UA 5FPDA 3QMLA 4JKAA 4M7XA 1VQ4N 3LDOA 3CC7N 5E26A 4JKHA 3VEXA 3CJCA 4GV6A 1T44A 4JKCA 2E1YA 2QA4N 4QS7A 1VQMN 4A57A 4C23A 5M1FA 5B8HA 3U9DA 1HLUA 1Q7YO 4GV9A 4HWIA 1DGKN 5DM7L 1T6DA 1VQON 1G99A 3CXCM 3R9PA 3HI0A 5F0XA 3QB0A 4H0PA 3DXMA 3VEWA 4BRNA 1NGAA 4BRCA 5JLFA 3TPQA 2P9LB 3VF4A 3RVCA 3F9MA 5AFUA 3AGRA 5AQWA 5HL7L 1S3XA 3PLAA 2V7YA 1NMDA 4CZGA 1V4SA 3IDHA 3O08A 4UY8O 1VAZA 4WQ5C 2ZWHA 1IJJA 3ZETA 3IMXA 5JLHA 2GWJA 3H3NO 2WUSA 1BA0A 4JKGA 5AQYA 5MLCQ 5LJWA 4H0OA 5KQ8A 4CZIA 2IVOA 1YJWN 1KAYA 3H1QA 4MLHA 4AM7A 1JCEA 4IDHA 1KQSM 5AQGA 3CPEA 1BU6O 4I6MB 5F1XA 1QQMA 1XQSC 2QEXN 2P9IB 2ZGYA 3SJHA 3EL2A 5GAGP 3I33A 2V7ZA 1NGDA 3P4IA 2A3ZA 3L6QA 3N4PA 4BRHA 1VQ5N 1K9MO 3MMVA 1GLLO 3HRGA 3FLCO 4R79A 1YHQN 1M90O 3BUZB 3CF5L 4EAHD 4JD2B 3C7NA 1HPMA 5AQHA 4XH1A 5TKYA 3CCQN 1HUXA 2P9PB 3UB5A 3WUHA 3TSQA 2J4RA 2WBNA 1DEJA 4XEIA 4G9ZA 1U2VA 4Y0WA 1V4TA 2P9SB 5AZJB 4M7YA 4O8UA 3UKRB 3SAGA 4F9OA 1TUUA 3DAWA 1KD1O 2FF3B 3N4QA 4ILJA 4BR2A 3RSEA 3VGKA 2P9UB 4YOXA 1KAZA 2P9KB 3G25A 2GTDA 5AQNA 5C15A 1MWMA 1W97L 3O4WA 3TU5A 1T6CA 3WXKA 2PFUA 1VQNN 3ENBA 1WOQA 1C0GA 2HF4A 4A61A 3CJAA 4CBXA 4BRKA 4FWOA 4WQ5A 3R1XA 3VMFB 1LCUA 5ADXA 1HKCA 3MK6A 4IWVA 2OANA 1GLEG 4CBUA 2Q97A 2VWBA 1Q86O 3M5RA 4PHTX 4AM6A 3D7EO 5M1OA 5M1QA 4ILGB 1GLAG 2YI1A 3CIPA 1ILYA 4JKEA 4FWRA 3SMPA 3VTIA 3HBTA 5BPMA 1K8KB 3QFPA 3AGKA 4BRPA 5JVGL 1QZ5A 1XUPO 3FZLA 3EO3A 4IXCA 3D6RA 3DXMB 3O9RA 3VEYA 2Q2RA 4H03B 3QFUA 4YOTA 3KHYA 4FPBA 2ZJQL 2GWKA 5M1NA 3EKSA 3G4SN 5LJVA 1NLVA 3ID8A 4Z94A 1YVNA 4BRFA 4NLCA 2OTJN 1WUAA 2CGLA 1QQNA 4JKGB 2OTLN 2YX6A 1RDWX 3L4QA 4DCHA 2QM1A 4BGBA 2VGNA 3U4LA 4EFHA 5KPTA 2QW9A 2YCHA 2JWLA 3MX2A 4K41A 4YOWA 4BY9C 3A8YA 2I7PA 5AQKA 4BRAA 4WF9L 4JK9A 1ATSA 4HTLA 3VEOA 5JICA 2NRVA 3D2FA 4AF1A 3J7ZO 4WCEL 3R6MA 5GAEP 2QWRA 3C7NB 2ZJRL 1GLJO 4H0TB 3E1YA 4YOYA 2VYPA 1QVGM 3WEEA 2PAVA 4BQZA 1NGBA 2FSNA 4O5FA 3EN9A 4H5TA 1HKGA 5EOYA 3CERA 3O1WA 3D2EB 4IO8A 4KH6A 3LDNA 3E66A 4YDUC 2Q31A 5F2RA 3RSEB 4IOAL 1SAZA 2GELA 2D1KA 3H46O 3LDPA 3CCUN 4WYBA 3M6GA 4CZKA 4XH5A 1GLDG 3CHWA 5ELZA 3WQUA 3O6WA 3BP8A 4RCHA 2NRHA 3GDQA 5AQSA 2AP1A 3ZX3A 4IO9L 2ASPA 3G71N 1S22A 4WFNL 3OA9A 4JKDA 4JKFA 3UE5A 4M63C 3LM2A 2FSJA 1K73O 3GG4A 3MN9A 4A2BA 4A62A 1H1VA 3ENHA 4GV3A 1U6ZA 2FLOA 2FF6A 2HSTA 3FZFA 4B1WB 4JAXA 4BG8A 3KVGA 4A5BA 3ATVA 5CHIA 3KWGA 2BH1A 5KPRA 3O5BA 5BRDA 4PKHA 3HTVA 3Q7BA 4K42A 1KAXA 4BR5A 4CBWA 5KQDA 3H1VX 3KWIA 1EQYA 1P8ZA 4U7BA 3MN6A 4FPAA 4CD1A 4JN4A 2P9NB 1YXQA 4LC9B 2YJFA 3MN5A 4RWTA 2RHKA 1EO1A 2NRTA 4BR9A 3P39A 3CCRN 4BVPA 2E88A 3EZWA 4FOEA 4CZFA 1Q18A 1QVFM 3NVKA 3PIPL 4FWPA 3R3LA 3EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P38 A;  3EE8 A;  2GX9 A;  3KWG A;  3RVC A;  3O9T A;  3M5R A;  3P31 A;  3KWI A;  3L4Q A;  3O9Q A;  3O9S A;  3O9U A;  2RHK A;  4OPA A;  3P39 A;  4OPH A;  3F5T A;  3OA9 A;  3EE9 A;  3D6R A;  3O9R A;  2KKZ A; 
#chains in the Genus database with same CATH topology
 1VQ8 N;  5FPE A;  3DLK A;  4DKW A;  3C95 A;  3SAF A;  1BUP A;  2E6M A;  1WSG A;  4FLX A;  1YIJ N;  3ZYY X;  4DFM A;  3SBT A;  2Q3S A;  3B6P A;  2A40 A;  5J2M A;  3AVB A;  1XNR K;  3DXK A;  3HOS A;  3K57 A;  1KVB A;  1XHZ A;  1LW0 A;  3CM5 A;  1NK0 A;  1VSJ A;  5BRF A;  4FO0 A;  4FWK A;  5EVZ A;  4BRL A;  1TK8 A;  2HB5 A;  1BWF O;  2QWN A;  2RE2 A;  2P5G A;  1C1B A;  3A5M C;  2HMI A;  2G8F A;  5HP1 A;  4IFV A;  1GLB G;  4NXN K;  3UKU A;  5KRS A;  4O44 A;  1RTI A;  4FZX C;  3OBW A;  3B8A X;  2BUP A;  3WXM B;  1S5J A;  2NRW A;  4DR2 K;  1RT1 A;  2G8H A;  2HOE A;  4YOR A;  3FE1 A;  3IS9 A;  5KI6 A;  4CI6 A;  3MCP A;  4IOC L;  2OPR A;  4Q5V A;  1WBB A;  2ZQB A;  5E41 A;  4FM2 A;  1DLO A;  2W41 A;  4BVO A;  4B3O A;  3IUC A;  3UIQ A;  1OH6 A;  3E9O A;  1EP4 A;  1NGG A;  1X9J A;  4H5W A;  4CJS A;  5E84 A;  3CCV N;  1BI4 A;  3WQT A;  3WNE A;  1XC9 A;  5AQV A;  1HMV A;  3RMB A;  3THX B;  3OJU A;  4OGC A;  5KRT A;  1NKE A;  1EWQ A;  3NF7 A;  4FK2 A;  4QS9 A;  2WON A;  3LL3 A;  3CQX A;  4B1U B;  3OVN A;  1Y97 A;  4A59 A;  1ATN A;  2E8A A;  4E3S A;  3OYL A;  2F7T A;  3SQ4 A;  5CR4 A;  1YI2 N;  4YOV A;  3OYB A;  3M8Q A;  4ISE A;  3JXU A;  5FPN A;  2D4W A;  2XY8 A;  4DTM A;  4M41 A;  3JSM A;  3ID6 A;  3MCA B;  1TGO A;  1NWK A;  2KHO A;  2W40 A;  5AQZ A;  2Z1G A;  5HRR A;  4OGE A;  1VSD A;  3NH0 A;  4NLB A;  2GX9 A;  5AQI A;  3KZB A;  3SMS A;  4FJ5 A;  1U49 A;  5C25 A;  4DTN A;  4CEC A;  4JHD A;  1OH8 A;  1NG9 A;  1JLA A;  3O3H A;  1YAG A;  4CER A;  4ELU A;  4FJK A;  4FVU A;  3Q7C A;  4MDB A;  4CFB A;  3C6H A;  5AZI B;  2F8T A;  4J8F A;  4ZTJ A;  3K9J A;  4MO5 A;  4M3Z A;  2UYT A;  3U9Z A;  4FL9 A;  1SL0 A;  1N32 K;  4A2A A;  4DMN A;  4B3T K;  3LWM A;  3D45 A;  4CGF A;  4FK4 A;  4LH5 A;  5LMU K;  4KHP K;  3VPZ A;  4DHY A;  4O8K A;  1LAW A;  3IG1 A;  4DR1 K;  5BPN A;  3OYD A;  4ILH A;  3CYM A;  3T1A A;  3NH2 A;  3SYZ A;  3K5O A;  3VA0 A;  1BCO A;  1Q9Y A;  2VQE K;  1OKJ A;  1Q9X A;  3TTD A;  4WQ4 A;  1J5O A;  4BE0 A;  1GLC G;  2E2N A;  2F9W A;  1VQ7 N;  4GW6 A;  1XHX A;  4BC4 A;  2VCP A;  3LDL A;  5CE3 A;  3CMA N;  4LF5 K;  1CZB A;  2NZT A;  3NBP A;  3V1R A;  1RDC A;  2A41 A;  4B1Y B;  3C65 A;  4JS4 A;  4BE1 A;  2HBM A;  1MWK A;  1ZBU A;  2YJE A;  1N34 K;  2ASM A;  2A5X A;  1D9D A;  1TL1 A;  2O8B A;  1C0F A;  2G8W A;  3QIO A;  4DSL A;  5M1K A;  1YVU A;  3AO5 A;  1BDG A;  3QEX A;  1ATR A;  1BOT O;  3GL1 A;  4RW6 A;  4YNQ A;  3V1Q A;  2CH5 A;  3DI6 A;  3CD6 N;  5HBM A;  2YKM A;  1SV5 A;  4KRE A;  4KTW A;  3IFR A;  3DJC A;  1KTQ A;  4B1Z A;  4FVM A;  4KPY A;  4DSF A;  2HMP A;  4JLH A;  1OVY A;  1TK0 A;  5BRE A;  1YJ9 N;  3P5J A;  2QWP A;  3EE9 A;  5SWM A;  3C6A A;  1MDU B;  4CJ3 A;  3FZH A;  3OYF A;  4KHW A;  1LV5 A;  3I0R A;  4FJH A;  3KK3 A;  3AAP A;  1HYS A;  3J80 O;  3SBG A;  1HX1 A;  2B5J A;  1CZA N;  2P9I A;  5AQF A;  4L3Q A;  1FW6 A;  2JLE A;  4NCG A;  4K8Z A;  2HVH A;  4YOU A;  2YNI A;  2I5J A;  3ZEU B;  3KK2 A;  2P51 A;  3CJ1 A;  2P9P A;  3OHR A;  5EY4 A;  5BR8 K;  3U8X A;  4EZ9 A;  3CQ8 A;  3UKR A;  4FLZ A;  3V9U A;  1JCG A;  4CJR A;  4BRE A;  4B9L A;  1Z05 A;  1TKD A;  2YKN A;  3OY9 A;  1EX4 A;  2X6N A;  2QKB A;  5J2P A;  4JKA A;  4M7X A;  3C94 A;  3HST B;  3TAM A;  1BHL A;  3CJC A;  4JI5 K;  3AA2 A;  2E1Y A;  4JI2 K;  4M45 A;  4GV9 A;  4HWI A;  3NAE A;  2P5O A;  3SUQ A;  3AVK A;  4JI4 K;  4CK2 A;  2RKI A;  4WE1 A;  1ZBH A;  3HI0 A;  5KGX A;  3V81 A;  3VF4 A;  4RW9 A;  3KD1 E;  2VG7 A;  3PLA A;  4J2B A;  3O08 A;  3K59 A;  5SZT A;  3H08 A;  2WUS A;  4JKG A;  4B8C A;  3MAQ A;  3SV3 A;  5LJW A;  4H0O A;  3HXM A;  4XIU A;  1JCE A;  2RN2 A;  1BU6 O;  4I6M B;  5F1X A;  1NU0 A;  1QQM A;  2V7Z A;  1HNI A;  3C6U A;  4KHY A;  3FLC O;  4R79 A;  1X1P A;  1WSJ A;  3CF5 L;  3DLG A;  5AQH A;  2O8D B;  3CCQ N;  3UB5 A;  3WUH A;  1IKW A;  3AV9 A;  2YNF A;  4O8U A;  1FJG K;  1ZBL A;  3AO3 A;  4ILJ A;  4BR2 A;  2P9U B;  1HYZ A;  2Z1J A;  3HVR A;  3VQD A;  4BWM A;  1T6C A;  4QOZ B;  2PFU A;  4PWD A;  3CFP A;  1HQE A;  4B9S A;  1CLQ A;  4WQ5 A;  1LCU A;  4FJ8 A;  1S1W A;  2VWB A;  1Q86 O;  2KZZ A;  3M5R A;  5M1O A;  4DQR A;  5CYM A;  1TAQ A;  4JKE A;  4KB1 A;  5CZ2 A;  3HBT A;  1HNZ K;  2GUI A;  4CEB A;  4CJW A;  4IXC A;  3DXM B;  3DLE A;  2Q2R A;  3WNG A;  3ZSX A;  4H03 B;  3QFU A;  3G4S N;  5LJV A;  1NLV A;  1YVN A;  3RMA A;  4BRF A;  1W0H A;  4E1N A;  2CGL A;  4E19 A;  3QEI A;  2OTL N;  2XO7 A;  3L4Q A;  4FJ9 A;  2QM1 A;  4O55 A;  3TAP A;  1BQM A;  4YOW A;  2JWL A;  4DSI A;  3RMD A;  2I7P A;  4CJT A;  4JK9 A;  4I2Q A;  3VEO A;  5JIC A;  4DLG A;  4CEA A;  3O3G A;  1IBM K;  3QLH A;  1C0U A;  3J7Z O;  1JL2 A;  4FZZ A;  4LF7 K;  4R5P A;  1RNH A;  4OKJ A;  2QWR A;  3C7N B;  4C8M A;  2BE2 A;  2PAV A;  1NGB A;  2X78 A;  3RTV A;  1HKG A;  3CER A;  4KH6 A;  3D2E B;  1NK6 A;  3HT3 A;  4C8L A;  3VQ8 A;  4IOA L;  3RSE B;  1RTJ A;  3K0S A;  3ISN C;  4F3T A;  2Z1H A;  4OPK A;  4IO9 L;  3VQB A;  1SKW A;  3OA9 A;  4JKD A;  4JS5 A;  4M63 C;  2FSJ A;  4NYN A;  4C8O A;  3QIP A;  3CG7 A;  1OVQ A;  1NK9 A;  5DMR A;  4BG8 A;  4B9V A;  2A1S A;  3O5B A;  4DTX A;  1S9G A;  4CJK A;  5KQD A;  4FPA A;  4CD1 A;  2P1J A;  1YXQ A;  3KJV A;  2YJF A;  3MN5 A;  3KLE A;  3AVH A;  1EO1 A;  3KTQ A;  4I7F A;  3P39 A;  2XHB A;  3CCR N;  4BVP A;  2E88 A;  2HND A;  4FOE A;  3OS1 A;  1QVF M;  2XRI A;  4FWP A;  4OKK A;  4JNE A;  1BIU A;  1KLN A;  1VQK N;  4CJQ A;  5J2Q A;  4CHN A;  4LF8 K;  1R59 O;  2Q36 A;  3NDK A;  2NRX A;  1ASV A;  1QHA A;  3TI0 A;  3LPT A;  4H5R A;  5C0Y A;  1ZBS A;  2HBK A;  5LMN K;  4DFJ A;  1VQ9 N;  3PO5 A;  3NFA A;  3AVC A;  5DK5 A;  4IFY A;  3M3Z A;  5M1P A;  5BR9 A;  3H45 C;  4CHQ A;  2HVI A;  3ZEU A;  4BC2 A;  1U4B A;  4M3T A;  3QIN A;  3LAK A;  5AQM A;  4B9M A;  3LP2 A;  3G6E N;  2FBY A;  1VQ6 N;  4ELT A;  3ULE A;  3BEX A;  3MXI A;  1T8E A;  3O9U A;  3O8M A;  4W5T A;  3WNF A;  3TAF A;  3CET A;  3JYT A;  2BGG A;  1JJ2 M;  2IIR A;  1RDU A;  3OYC A;  4E7I A;  1LWE A;  4IEI A;  1VQL N;  1VSE A;  1Q82 O;  2NRZ A;  4MDA A;  1RDD A;  3ATU A;  2ITM A;  2YNG A;  1LWC A;  1N8R O;  4FSV A;  1RBS A;  4LSL A;  3OS0 A;  3QO9 A;  2UXD K;  3CCS N;  4KKO A;  3PO4 A;  3FZK A;  4B1X B;  2O4G A;  1KVC A;  1J6Z A;  4KAZ A;  4BRI A;  3CFR A;  3HZ6 A;  2A42 A;  1QQC A;  4B1V A;  2KQ2 A;  1NGI A;  2JWK A;  1W2B M;  5IT9 O;  4ISG A;  4YY3 K;  4FCY A;  1VSM A;  1U47 A;  3VES A;  3HSC A;  3DLR A;  2XY6 A;  4Z4G A;  3OYM A;  1TYQ A;  4OPH A;  1P90 A;  3I8B A;  4M3U A;  2P9U A;  4IJN A;  4GNI A;  4FWL A;  3EE8 A;  3VOV A;  4CZI A;  4LF6 K;  3VQQ A;  5EU7 A;  4WFA L;  3J8A A;  1VSF A;  4BAC A;  5GIO A;  4OJR A;  4CIG A;  2RPI A;  4WQ4 C;  3TR8 A;  3ZLJ A;  1M1K O;  4BR0 A;  3BGR A;  3ZT3 A;  1HNW K;  4PQU A;  4FM0 A;  2KW4 A;  3TAQ A;  1W7A A;  4KHU A;  3LM9 A;  1J53 A;  2NLX A;  4BGA A;  5AQR A;  3SJJ A;  5AQU A;  1SZ2 A;  4FM1 A;  1NK5 A;  2HF3 A;  2O4I A;  2FXU A;  3T7Z A;  4IKF A;  2F8S A;  4CF0 A;  3U6F A;  4BG9 A;  4FJX A;  4FYD A;  1FKP A;  3V1O A;  1A5W A;  3QEP A;  5I3U A;  3ZSQ A;  3DLL L;  2Q0R A;  3FZM A;  4EZ6 A;  1QS4 A;  1BGX T;  3TAR A;  1GOA A;  4DV7 K;  1DKG D;  1K6Y A;  2O8E A;  1E3M A;  1MU2 A;  1HKB A;  2V51 B;  4AQY K;  1Y64 A;  3DOK A;  3ENO A;  3R8E A;  4CZE A;  5BRH A;  4JRP A;  2OPP A;  3SUO A;  4N76 A;  3CM6 A;  2IGI A;  2D0C A;  3FFK B;  1HR0 K;  3QEV A;  1HNX K;  3J7Y P;  4PKI A;  5C24 A;  1K8A O;  4JI7 K;  3IAY A;  3NE6 A;  2BAN A;  2VG6 A;  4NXM K;  3D2E A;  1O1W A;  4CES A;  1SKR A;  4F2R A;  1XNQ K;  2HBL A;  3OYK A;  1MA9 B;  2IOC A;  4DSK A;  3MWP A;  3TAE A;  3TAG A;  1RDA A;  1T05 A;  3TTC A;  3A0I X;  3K5M A;  2W42 A;  3VER A;  1N36 K;  1NNE A;  4AHT A;  1OH7 A;  5TKW A;  3HYF A;  3CPW M;  1D5A A;  4HUF A;  1BA1 A;  3OBY A;  3O9T A;  1UAX A;  3TSP A;  2O8C B;  4Z4H A;  3G0Z A;  3QBW A;  2QWM A;  4CHZ A;  2ZGZ A;  1NKC A;  3H6E A;  5HRP A;  4DV5 K;  4DR6 K;  1RFQ A;  4B9Q A;  5JMV A;  5KPZ A;  1YJN N;  1HJR A;  4IJA A;  5C12 A;  2QXF A;  4RW4 A;  1ITG A;  3RMC A;  2QWQ A;  4CJV A;  1KFS A;  1KXP A;  4QS8 A;  2IC3 A;  2D0P A;  3F9K A;  4KH5 A;  5BN9 A;  2EWS A;  3OYN A;  2HHQ A;  4JD2 A;  3WXL A;  2QWL A;  2F9T A;  3M8S A;  5AQP A;  1SL2 A;  4FJJ A;  3BY5 A;  3KK7 A;  5DM6 L;  1NK8 A;  2ZM6 K;  1D8Y A;  1ZC6 A;  1KCF A;  4CCH A;  1Q81 O;  5CZ1 A;  4CFA A;  2P9K A;  1RBT A;  4AHC A;  3KD5 E;  3QDK A;  2QKK A;  3P1G A;  1X9M A;  3LDO A;  5E26 A;  4JKH A;  1JLQ A;  4JKC A;  3SUN A;  4QS7 A;  1VQM N;  4J2D A;  4BDY A;  4N5S A;  3AVM A;  3CFO A;  3P83 D;  1Q7Y O;  3QNN A;  1T6D A;  3G10 A;  1VQO N;  3CXC M;  4DV3 K;  2Y1I A;  5F0X A;  4HCB A;  3SI6 A;  1NGA A;  3TPQ A;  2P9L B;  5AFU A;  5AQW A;  1S3X A;  2V7Y A;  3LPU A;  3IDH A;  1VAZ A;  4WQ5 C;  2ZWH A;  3IMX A;  2GWJ A;  1BA0 A;  2UU9 K;  5AQY A;  1T03 A;  5KQ8 A;  2IVO A;  4LD0 A;  1KAY A;  3H1Q A;  4AM7 A;  2QEX N;  2ZGY A;  5GAG P;  3I33 A;  1FKO A;  3P4I A;  4PA1 A;  3L6Q A;  4BRH A;  1VQ5 N;  1K9M O;  1FK9 A;  3HRG A;  1YHQ N;  3QES A;  1RT5 A;  4XH1 A;  1S1T A;  4Z4E A;  1WSE A;  3TSQ A;  2J4R A;  5FLX O;  2D0A A;  4G9Z A;  4Y0W A;  1V4T A;  2P9S B;  4B08 A;  5AZJ B;  4F9O A;  3DAW A;  3EY1 A;  3N4Q A;  3ZSO A;  3VGK A;  3L2V A;  4EP5 A;  5C15 A;  4B9N A;  2OPS A;  3THY B;  3VQA A;  1XMO K;  4CJU A;  1I39 A;  3CJA A;  3TAB A;  4Y1D A;  3VMF B;  1UA0 A;  5ADX A;  1HKC A;  4IWV A;  2OAN A;  1GLE G;  1GOC A;  2Q97 A;  2KZM A;  2IAJ A;  4AM6 A;  3D7E O;  1GLA G;  3CIP A;  1Z26 A;  4FWR A;  4H8K A;  3QFP A;  4BRP A;  3K58 A;  3AVL A;  1VSH A;  3VEY A;  2HHH K;  1JLG A;  3KHY A;  3ZCM A;  2GWK A;  3EKS A;  4Z94 A;  4I2P A;  4KRF A;  1QQN A;  4H4O A;  1RDW X;  4DCH A;  4EFH A;  2QW9 A;  4Z0U A;  2HHU A;  3PUF A;  1I3A A;  2NRV A;  4FJN A;  4WCE L;  4FZY A;  3R6M A;  5GAE P;  1KSP A;  1GLJ O;  3E1Y A;  2AJQ A;  2O8F B;  4BQZ A;  4O5F A;  1WSH A;  5EOY A;  3O1W A;  3LDN A;  4ZHR A;  1SAZ A;  2D1K A;  3LDP A;  4WYB A;  4DV1 K;  5ELZ A;  3V9X A;  3CHW A;  3MEE A;  3S9H A;  1LWF A;  4X66 K;  3O4Q A;  4YHH K;  4RCH A;  2AP1 A;  2ETJ A;  3NHG A;  2ASP A;  3G71 N;  5HRN A;  1S22 A;  3QET A;  3LM2 A;  1S9E A;  5FRO A;  3GG4 A;  3ZSR A;  3OYH A;  1HNV A;  4A62 A;  3ENH A;  4GV3 A;  2FLO A;  1BIS A;  3LP0 A;  4JAX A;  3KIO A;  3SPZ A;  3KWG A;  2DFH A;  3HTV A;  3Q7B A;  3DLH A;  1JLE A;  3KWI A;  1EQY A;  3NGZ A;  3HK2 A;  4RW8 A;  4JV5 K;  3L2U A;  1HQU A;  4DFK A;  2RHK A;  4GKJ K;  1RBU A;  4CEZ A;  3J81 O;  2IDO A;  4OLB A;  4FWN A;  3LAL A;  2UXB K;  1RT2 A;  1EET A;  1R0A A;  3THX A;  3FR0 A;  1C1A A;  1CXQ A;  1NGF A;  3PSF A;  5HRO A;  4FLV A;  5AR0 A;  4IOX A;  3PY8 A;  1IBK K;  4BC3 A;  2ZD1 A;  4JK7 A;  3W0L A;  1I94 K;  2KTQ A;  3SAH A;  2QWO A;  3AY9 A;  1T3V A;  3SQ0 A;  1W9H A;  4KI6 A;  4N41 A;  3S3M A;  3L8B A;  1YIT N;  4CJP A;  4KH4 A;  2UXC K;  4DSE A;  1NOY A;  4Q0B A;  4AHS A;  4U67 L;  4H5N A;  1ZXO A;  2E2P A;  3KKS A;  2YHW A;  3MEG A;  3O3F A;  3OYG A;  4KFB A;  3IRX A;  2F96 A;  3DM2 A;  4KHS A;  4UQG A;  1BIZ A;  1TVR A;  3O1B A;  4CJ4 A;  4HTU A;  4CEE A;  4DU3 A;  4I9Q A;  2NNW A;  5GAH P;  5EX5 A;  3HM8 A;  4DG1 A;  1S6P A;  1QE1 A;  1QSY A;  2E2Q A;  1TAU A;  5H1S Q;  4JI0 K;  3THW B;  4H5V A;  5AZI A;  5BPL A;  1S1X A;  3ZET B;  3ZSZ A;  3CCL N;  4OLA A;  3S3O A;  1IO2 A;  3BF3 A;  5AQX A;  3NF8 A;  4DQQ A;  5D3G A;  2CGJ A;  1ZYQ A;  4KB0 A;  4WFB L;  1QHT A;  4LY7 A;  3M8R A;  3I55 N;  1NBW A;  5AQT A;  1GLF O;  3ULD A;  4E7L A;  2Q1N A;  3WXI A;  3DRS A;  4DB3 A;  1L3U A;  4CJF A;  4OX9 K;  1UWB A;  4NYF A;  1NGJ A;  3DRR A;  4E0D A;  4KBO A;  4EHU A;  1HJO A;  4IFE A;  4F3O A;  1WBD A;  1NMN A;  2WC9 A;  3S3N A;  1NGE A;  2YHX A;  4K25 A;  3SK3 A;  3TAN A;  4DR7 K;  4FWQ A;  3VQP A;  4AHV A;  1NJY A;  2A6A A;  3PIO L;  3CQY A;  2V52 B;  3MX5 A;  1SL1 A;  3LP3 A;  2P9S A;  3I56 N;  3OS2 A;  2ZJP L;  4CZL A;  4JI3 K;  1ESV A;  3M1F A;  4CZJ A;  1TUY A;  3L4I A;  4MO4 A;  1BG3 A;  5J2N A;  3HVT A;  3EEQ A;  4N47 A;  3ZT1 A;  3OYE A;  4FK0 A;  1CZ9 A;  2VWJ A;  1WB9 A;  1IG9 A;  3AO2 A;  3T69 A;  4X64 K;  4YFU A;  4DTU A;  3HO1 A;  5FRN A;  1YTU A;  5HOO A;  3HPG A;  1NGC A;  4C8N A;  4XH4 A;  4J2E A;  1TK5 A;  3VTH A;  4RG8 A;  4PL7 A;  3U3G A;  4NB4 A;  1VSL A;  1JXE A;  4JI1 K;  3H3O B;  4CVN E;  4CHP A;  2W6K A;  4DU4 A;  4OO1 J;  1IBL K;  2XY5 A;  2AA4 A;  3GE1 A;  1YTA A;  3MN7 A;  1WSF A;  1T7P A;  1BI4 B;  3VA3 A;  5GAD P;  4BR7 A;  3BF1 A;  2I7N A;  5A2Q O;  4HUG A;  1NM1 A;  4BRG A;  1XMQ K;  3WNH A;  1N5Y A;  4BRO A;  1KRP A;  3WEE B;  3MDQ A;  2NRR A;  2FBV A;  2KKZ A;  3B6O A;  3W3D A;  3SQ2 A;  5JS2 A;  4IDK A;  3U3Y A;  2G8U A;  4V19 S;  4ISF A;  1JLF A;  1ZBF A;  3D0P A;  1VSK A;  1X3M A;  1RIL A;  3T19 A;  3ZT2 A;  2NUB A;  1E4G T;  3OJS A;  3HPH A;  5BN8 A;  2FC0 A;  3AA5 X;  4DV6 K;  3CI5 A;  2VGM A;  1J54 A;  4FOI A;  3GBT A;  4G1Q A;  4ID1 A;  2E20 A;  3A5N C;  2YHA A;  2E2O A;  1SKS A;  2DPN A;  1JL1 A;  4JHD B;  1Z25 A;  2IVP A;  2GEM A;  4EHT A;  3VQE A;  4DQS A;  1YF5 L;  3WT0 A;  1WAJ A;  2GV9 A;  3ZX2 A;  5C2D A;  4CJ7 A;  4A5A A;  3OYA A;  1NK4 A;  2H3G X;  4CK1 A;  1QSS A;  3VEV A;  3CJB A;  3E9P A;  4CK3 A;  4RTF D;  3LDQ A;  1C0T A;  4BR4 A;  4DTJ A;  3AO1 A;  4IZ9 A;  4FXD A;  4KV8 A;  1ASW A;  3SNN A;  4I6M A;  2X6S A;  4CZM A;  4BRD A;  5GIP A;  3F73 A;  1WAF A;  4PY5 A;  5AQQ A;  3O80 A;  4LSN A;  2B4J A;  2O8D A;  1WLJ A;  3NCI A;  4NO7 A;  4QCL A;  1VQP N;  3F2K A;  4MLE A;  4ICL A;  1QZ6 A;  4DF8 A;  5C10 A;  4DS4 A;  3A5O C;  4DTS A;  3MWT A;  2HHX A;  3VQC A;  1SS6 A;  3ZSV A;  3QER A;  5FPD A;  1VQ4 N;  3CC7 N;  1EWR A;  3RR8 A;  3VEX A;  3PX6 A;  4LH4 A;  1T44 A;  1IKX A;  4LF9 K;  2QA4 N;  4A57 A;  4C23 A;  5M1F A;  5JS1 A;  4FW1 A;  2HHS A;  3V4I A;  1HLU A;  2DTU A;  4KHQ A;  2YV0 X;  1QTM A;  3DYA A;  1VRT A;  1A5X A;  3R9P A;  4KO0 A;  3HM9 A;  3QB0 A;  4H0P A;  3DXM A;  4Y1C A;  3VEW A;  5JLF A;  3AVN A;  1F21 A;  4BDZ A;  3RVC A;  1B9F A;  3AVI A;  3AGR A;  3AO4 A;  4CZG A;  4KI4 A;  3ZET A;  5JLH A;  5MLC Q;  4MLH A;  4E7K A;  4IDH A;  5AQG A;  3CPE A;  1XQS C;  4DR3 K;  1SUQ A;  2HHT A;  2P9I B;  3SJH A;  2G8I A;  3KLF A;  2A3Z A;  4PUO A;  1GLL O;  4E1M A;  2KFZ A;  1M90 O;  3RR7 A;  4CJL A;  3C7N A;  1HPM A;  2OCE A;  1HUX A;  2P9P B;  3T3F A;  4BWJ A;  4BE2 A;  4DV0 K;  5KGW A;  4M7Y A;  3DOL A;  3UKR B;  3SAG A;  3I8D A;  1KD1 O;  3VQ5 A;  2FF3 B;  3RWU A;  3RSE A;  2UUB K;  1KAZ A;  4DV2 K;  1KLM A;  2GTD A;  2HHV A;  1W97 L;  3WXK A;  1WSI A;  4ZTF A;  3ENB A;  4W5Q A;  2E6L A;  2HF4 A;  4A61 A;  4DTR A;  2A1R A;  3MK6 A;  3LZI A;  4CBU A;  1BCM A;  3T1H K;  4C8K A;  3QNO A;  4PHT X;  4B9T A;  4CEO A;  3VN5 A;  1RT7 A;  2YI1 A;  2Z1I A;  3L3V A;  3VTI A;  2E4L A;  1C6V A;  5BPM A;  4IBN A;  1K8K B;  4K8X A;  5JVG L;  3FZL A;  1VHX A;  3D6R A;  3V9W A;  4CGJ A;  2E5L K;  2ZJQ L;  2PZS A;  5C42 A;  4E89 A;  4CJ5 A;  4QAG A;  5J1E A;  4GKK K;  4NLC A;  2OTJ N;  1WUA A;  3SPY A;  4JKG B;  5CY4 A;  4LFA K;  3BZC A;  2YX6 A;  4BGB A;  3L2Q A;  2VGN A;  3U4L A;  4DQP A;  1J9A A;  5HRS A;  2YCH A;  3MX2 A;  4K41 A;  4BY9 C;  4KTZ A;  5KTQ A;  5AQK A;  4WF9 L;  1ATS A;  4HTL A;  4HVJ A;  1HYV A;  4DQI A;  3K5N A;  1RBV A;  1NKB A;  1TL3 A;  2PYL A;  4DSJ A;  4RW7 A;  4L8R B;  4DLE A;  1U45 A;  2VYP A;  1TKZ A;  3WEE A;  4CEF A;  2FSN A;  3EN9 A;  4DV4 K;  4M3Y A;  4IO8 A;  4GVM A;  2GEL A;  1S1V A;  4F4K A;  4XH5 A;  3WQU A;  3O6W A;  1C1C A;  3GDQ A;  4LFB K;  4WFN L;  3EYZ A;  4JKF A;  3UE5 A;  1K73 O;  4X62 K;  4A2B A;  4CF9 A;  1U6Z A;  1Q8I A;  3SCX A;  5FDL A;  4B1W B;  4X65 K;  3KVG A;  4A5B A;  3AVF A;  3ATV A;  5KPR A;  5BRD A;  1GOB A;  4K42 A;  3V9Z A;  1KAX A;  3C6T A;  4CBW A;  1X9S A;  1IKV A;  1P8Z A;  3MN6 A;  1NOZ A;  4JN4 A;  2P9N B;  1YT3 A;  4CIF A;  4LC9 B;  4E7J A;  4BDP A;  3DLB A;  3PX4 A;  4RWT A;  2OPQ A;  2NRT A;  3OYJ A;  3FFI A;  4CZF A;  2UUC K;  3PIP L;  3DMJ A;  3KK1 A;  1JKH A;  4YDU A;  3VET A;  5AQJ A;  3ZX0 A;  4B9U A;  1RBR A;  1EKE A;  1UA1 A;  1XC3 A;  4JKB A;  4LF4 K;  1HRH A;  4BC5 A;  1NJI O;  4BRM A;  2PY5 A;  2YHY A;  1NK7 A;  1E4F T;  3V9S A;  4DF4 A;  2XY7 A;  1RT6 A;  1ASU A;  2W6L A;  4OPA A;  3T1Y K;  4JI6 K;  5C2F A;  2ASO A;  4J2A A;  4JRQ A;  1O13 A;  1JLB A;  4CFD A;  1DTT A;  3KLI A;  1NGH A;  3ITH A;  4K0K K;  1IG8 A;  2CH6 A;  1U48 A;  2IS3 A;  4CJE A;  3HP9 A;  3P31 A;  3O4N A;  5GIN A;  4MFB A;  5EXW A;  3VQ4 A;  1LW2 A;  3ZT4 A;  4AHR A;  2CGK A;  3NH1 A;  5T7B A;  2YHB A;  2ZE2 A;  2KLA A;  1NJZ A;  2QXL A;  4JEP A;  4IEE A;  4EP4 A;  3QBX A;  1LOT B;  5JVH L;  3A5L C;  1WNS A;  2BTF A;  4CHO A;  4CF2 A;  5FPM A;  4W5N A;  4CGD A;  3QEW A;  4CF8 A;  1RCH A;  3HJF A;  4O5B A;  2HHW A;  3OW2 M;  2FSK A;  2E1Z A;  3LP1 A;  3THV A;  4O4G A;  4CZH A;  1NJW A;  3VGL A;  3HOT A;  2WFB A;  1LAV A;  3NMU A;  4JK8 A;  2GBZ A;  2GUP A;  2QTD A;  3MEC A;  4FJL A;  1JXB A;  3CJ7 A;  1U2V B;  5LY3 A;  2JGU A;  4IG3 A;  4DS5 A;  4DWI A;  2ITG A;  3CCE N;  1TKX A;  2HBJ A;  3WXJ A;  4DQ8 A;  1VK0 A;  2VQF K;  3HPO A;  2VWK A;  3JS6 A;  4OVL A;  4C1N K;  4EIA A;  3CCM N;  4C1N I;  2QI2 A;  3ULE B;  4E7H A;  3NGI A;  2D5R A;  2DFF A;  2VG5 A;  2D0O A;  4BRQ A;  3AA4 A;  4ID5 A;  4DU1 A;  2Y1J A;  3L2W A;  1FXX A;  1CXU A;  3VEN A;  1SQK A;  4DR4 K;  4CFC A;  2O8C A;  4FJ7 A;  2OZM A;  1DT9 A;  3E01 A;  3VQ6 A;  1K8K A;  1XWL A;  3RRH A;  3KLG A;  3HP6 A;  3QIC A;  2WOM A;  4B8A B;  2PBD A;  1BO5 O;  4H0V B;  3MXJ A;  1L3T A;  3DRP A;  5AFU H;  4CIE A;  4Z4I A;  3SQ1 A;  3D2F B;  3I0S A;  3HL8 A;  4O0I A;  1L3S A;  4DUY K;  1L3V A;  4CF1 A;  5AQO A;  4NCA A;  3JAM O;  4HCC A;  3F5T A;  4KTQ A;  2LSN A;  4K43 A;  2HW3 A;  4AIL C;  1B92 A;  4Z4C A;  3IKM A;  4FWS A;  3OYI A;  3KKR A;  1KVA A;  4H0X B;  4I9L A;  4M42 A;  1QQO A;  3TWH A;  1XI1 A;  2G8K A;  4TSX A;  2EHG A;  3AVA A;  1RT3 A;  1TYQ B;  1BL3 A;  3DWL A;  1RGI A;  2FBX A;  1TKT A;  4H0Y B;  4B3R K;  3CJ9 A;  4PKG A;  5AQL A;  5AJ3 K;  3CC2 N;  1D4X A;  4CD3 A;  3S41 A;  3L0Q A;  4CGH A;  1D9F A;  3MED A;  3NVM A;  1X3N A;  4GVE A;  4M3W A;  5ADX H;  2G8V A;  5I9E B;  3AAR A;  4LFC K;  2IVN A;  4OKE A;  3AAQ A;  3FGU A;  3CCJ N;  3O9Q A;  4DTO A;  3AVG A;  2P9L A;  3VF6 A;  3ZT0 A;  3M8P A;  3TTF A;  3L2R A;  4FJI A;  4AH9 A;  4O0J A;  1RDB A;  1Z6R A;  3VF2 A;  2P9N A;  2WTU A;  5IWA K;  3KLH A;  3VQ9 A;  3VEZ A;  3A2F A;  4PL8 A;  4DTP A;  5K14 A;  4M3R A;  3P38 A;  3GOI A;  4H4M A;  4CGG A;  3SLC A;  2R7Y A;  3K9K A;  3PV8 A;  4BQL A;  3CC4 N;  1HPZ A;  2ZF5 O;  3DXK B;  3E9L A;  1S72 N;  2FBT A;  1L5U A;  3TSU A;  2O8E B;  4MQ3 A;  2QK9 A;  3C0B A;  4FWM A;  3O9S A;  1KC8 O;  1YUW A;  1JLC A;  3LZJ A;  2OYQ A;  1RT4 A;  1ZBI A;  4E1J A;  4W5R A;  3AA3 A;  2DY4 A;  1U04 A;  5AZJ A;  4W5O A;  3UKU B;  2PYJ A;  1NJX A;  4GY2 B;  1JCF A;  3CME N;  1QSL A;  3THY A;  1VSI A;  3NF6 A;  2Q0U A;  3K5L A;  3QML A;  4DR5 K;  1G15 A;  1IKY A;  2KFN A;  4GV6 A;  1EXQ A;  1TV6 A;  5B8H A;  3R3L A;  2OZS A;  2HNY A;  3U9D A;  1DGK N;  5DM7 L;  3BDP A;  4Z4F A;  1G99 A;  1RTD A;  2BDP A;  1S6Q A;  4FLT A;  1RTH A;  4FLU A;  3BZK A;  4BRN A;  4BRC A;  2OA8 A;  3F9M A;  2YNH A;  5HL7 L;  1NMD A;  1V4S A;  4UY8 O;  1IJJ A;  5FRM A;  4F8R A;  3H3N O;  3PSI A;  4CEQ A;  4CHY A;  1REV A;  1DTQ A;  1YJW N;  4B3M K;  1KQS M;  3J7A P;  1VRU A;  2DFE A;  2D0B A;  3EL2 A;  5CYQ A;  1NGD A;  5I42 A;  3N4P A;  4FJG A;  3MMV A;  3BUZ B;  4EAH D;  4JD2 B;  5TKY A;  1N6Q A;  2O8F A;  3ZSW A;  2WBN A;  1DEJ A;  4XEI A;  1U2V A;  4FLY A;  1TUU A;  2RF2 A;  4YOX A;  3SZ2 A;  1B9D A;  2P9K B;  3G25 A;  5AQN A;  1KFD A;  1MWM A;  3O4W A;  1VQN N;  3TU5 A;  4F2S A;  1WOQ A;  1C0G A;  1J5E K;  4CBX A;  4BRK A;  4FWO A;  4M3X A;  3R1X A;  3MXM A;  1WN7 A;  4CE9 A;  4FLW A;  3K2P A;  3RRG A;  5M1Q A;  4ILG B;  3L3U A;  1ILY A;  1A5V A;  3SMP A;  3LWL A;  4AHU A;  3AGK A;  4KHN A;  1IV0 A;  3VQ7 A;  1QZ5 A;  1XUP O;  1S1U A;  3EO3 A;  3O9R A;  1OH5 A;  3LAN A;  4YOT A;  4CED A;  4FPB A;  5M1N A;  3ID8 A;  4B3S K;  3ALY A;  4HHT A;  3SV4 A;  4JYA K;  4CW7 B;  5KPT A;  3PX0 A;  3A8Y A;  4BRA A;  2ATQ A;  4DFP A;  4OPJ A;  5HLF A;  2UUA K;  3D2F A;  4AF1 A;  4GMJ B;  4IG0 A;  4HUE A;  3EZ5 A;  2EX3 A;  2ZJR L;  4H0T B;  4FW2 A;  4YOY A;  1QVG M;  4N56 A;  3OTO K;  1C0M A;  4H5T A;  3NGY A;  3E66 A;  4YDU C;  3ZSY A;  2Q31 A;  5F2R A;  3H46 O;  3CCU N;  3V6D A;  1X9W A;  3M6G A;  4CZK A;  1GLD G;  1BQN A;  1UOC A;  4DUZ K;  2F4V K;  2B6A A;  3BP8 A;  2O8B B;  3NF9 A;  2NRH A;  5AQS A;  4NCB A;  3ZX3 A;  5LL6 Z;  3MN9 A;  2HNZ A;  4JI8 K;  1H1V A;  1IH7 A;  2HST A;  2FF6 A;  3FZF A;  3LDS A;  4CGI A;  5CHI A;  2BH1 A;  4PKH A;  3ASM A;  1N33 K;  4BR5 A;  3H1V X;  3LAM A;  4U7B A;  3THW A;  2X74 A;  4FJM A;  3AVJ A;  4BR9 A;  4ELV A;  3EZW A;  1Q18 A;  3NVK A;  3SUP A;  3VGM A;  3EKU A; 
#chains in the Genus database with same CATH homology
 4YDU A;  4JNE A;  1VQ8 N;  3VET A;  5FPE A;  5AQJ A;  3ZX0 A;  4DKW A;  3SAF A;  1BUP A;  1YIJ N;  3ZYY X;  1VQK N;  3FR0 A;  1NGF A;  1XC3 A;  1R59 O;  4JKB A;  3SBT A;  2Q36 A;  5AR0 A;  4IOX A;  2A40 A;  2NRX A;  1QHA A;  4BC3 A;  4BC5 A;  1NJI O;  4H5R A;  4JK7 A;  3DXK A;  4BRM A;  3W0L A;  3HOS A;  2YHY A;  5C0Y A;  1E4F T;  1ZBS A;  2HBK A;  3SAH A;  2QWO A;  3AY9 A;  1VQ9 N;  1T3V A;  4OPA A;  5BRF A;  3M3Z A;  4FO0 A;  5M1P A;  5BR9 A;  3H45 C;  3ZEU A;  4BC2 A;  4FWK A;  5EVZ A;  5C2F A;  2ASO A;  5AQM A;  1O13 A;  4BRL A;  1YIT N;  4KH4 A;  1BWF O;  2QWN A;  2RE2 A;  3G6E N;  1NGH A;  3A5M C;  4U67 L;  1VQ6 N;  3ULE A;  1IG8 A;  4H5N A;  2CH6 A;  1ZXO A;  2E2P A;  3BEX A;  1GLB G;  3P31 A;  5GIN A;  3UKU A;  2YHW A;  5EXW A;  3O9U A;  2CGK A;  3OBW A;  3B8A X;  2BUP A;  3O8M A;  3WXM B;  2KLA A;  2QXL A;  3O1B A;  4JEP A;  4IEE A;  2NRW A;  2NNW A;  2HOE A;  3CET A;  3QBX A;  5EX5 A;  1LOT B;  5GAH P;  3HM8 A;  4YOR A;  3FE1 A;  1JJ2 M;  5JVH L;  2IIR A;  4CI6 A;  2E2Q A;  3MCP A;  1RDU A;  3A5L C;  5H1S Q;  4IOC L;  2BTF A;  4H5V A;  5FPM A;  5AZI A;  5BPL A;  3ZET B;  4IEI A;  3CCL N;  1VQL N;  2W41 A;  4BVO A;  3IUC A;  3BF3 A;  5AQX A;  3E9O A;  3OW2 M;  2NRZ A;  2FSK A;  1Q82 O;  4MDA A;  2ITM A;  1NGG A;  2E1Z A;  1X9J A;  3ATU A;  4H5W A;  5E84 A;  2CGJ A;  1N8R O;  3CCV N;  4CZH A;  4WFB L;  4FSV A;  3WQT A;  5AQV A;  3I55 N;  1NBW A;  5AQT A;  1GLF O;  3VGL A;  3HOT A;  3CCS N;  2WFB A;  3FZK A;  4B1X B;  2Q1N A;  4QS9 A;  3WXI A;  4DB3 A;  3NMU A;  1J6Z A;  4JK8 A;  3LL3 A;  2GUP A;  2QTD A;  3CQX A;  4B1U B;  4BRI A;  1NGJ A;  3CJ7 A;  3HZ6 A;  4KBO A;  1U2V B;  4A59 A;  1HJO A;  4EHU A;  5LY3 A;  1ATN A;  4IFE A;  2E8A A;  2A42 A;  2F7T A;  4B1V A;  5CR4 A;  1YI2 N;  2WC9 A;  4YOV A;  3CCE N;  1NGE A;  1NGI A;  2JWK A;  2YHX A;  1W2B M;  4ISG A;  2HBJ A;  4K25 A;  3WXJ A;  4DQ8 A;  4ISE A;  3SK3 A;  3VES A;  3JXU A;  4FWQ A;  3HSC A;  2A6A A;  2D4W A;  5FPN A;  3JS6 A;  3PIO L;  3CQY A;  2V52 B;  1TYQ A;  3ID6 A;  4C1N K;  3MX5 A;  3MCA B;  2W40 A;  1NWK A;  2KHO A;  2P9S A;  4OPH A;  1P90 A;  3I8B A;  5AQZ A;  4EIA A;  3I56 N;  4C1N I;  2QI2 A;  3ULE B;  2ZJP L;  4CZL A;  1ESV A;  2P9U A;  4IJN A;  4GNI A;  3M1F A;  3EE8 A;  4FWL A;  4NLB A;  3VOV A;  2GX9 A;  1TUY A;  3L4I A;  4MO4 A;  1BG3 A;  5AQI A;  4CZJ A;  3KZB A;  3SMS A;  4WFA L;  2D0O A;  4BRQ A;  3J8A A;  3T69 A;  5GIO A;  4WQ4 C;  5HOO A;  1M1K O;  4JHD A;  1NGC A;  4BR0 A;  4XH4 A;  3VTH A;  3VEN A;  1SQK A;  4PL7 A;  4NB4 A;  1YAG A;  3H3O B;  4FWN A;  3LM9 A;  2NLX A;  4FVU A;  4BGA A;  4OO1 J;  3Q7C A;  4MDB A;  1DT9 A;  5AQR A;  5AQU A;  1SZ2 A;  3C6H A;  5AZI B;  1K8K A;  2HF3 A;  3QIC A;  4J8F A;  2FXU A;  3T7Z A;  3K9J A;  2AA4 A;  4BG9 A;  3GE1 A;  4MO5 A;  2PBD A;  2UYT A;  3U9Z A;  4FL9 A;  1BO5 O;  4H0V B;  4A2A A;  3DLL L;  2Q0R A;  3MN7 A;  3FZM A;  5AFU H;  3VPZ A;  4DHY A;  3D2F B;  4O8K A;  5GAD P;  4BR7 A;  3BF1 A;  5BPN A;  2I7N A;  4ILH A;  1DKG D;  1NM1 A;  4BRG A;  5AQO A;  3VGM A;  1HKB A;  2V51 B;  4BRO A;  1Y64 A;  3F5T A;  3WEE B;  3MDQ A;  4K43 A;  2NRR A;  3ENO A;  2KKZ A;  3R8E A;  4CZE A;  5BRH A;  1OKJ A;  3IKM A;  4FWS A;  3TTD A;  4WQ4 A;  3W3D A;  4H0X B;  1GLC G;  2E2N A;  3FFK B;  2F9W A;  4ISF A;  4PKI A;  1VQ7 N;  1K8A O;  1QQO A;  4BC4 A;  2VCP A;  1X3M A;  3LDL A;  5CE3 A;  1TYQ B;  3CMA N;  2NZT A;  1E4G T;  3D2E A;  3DWL A;  2A41 A;  4B1Y B;  3C65 A;  1RGI A;  5BN8 A;  2HBM A;  1MWK A;  2YJE A;  4H0Y B;  2ASM A;  2A5X A;  2HBL A;  3CI5 A;  1MA9 B;  3CJ9 A;  2VGM A;  3MWP A;  4PKG A;  3CCM N;  5AQL A;  4FOI A;  3TTC A;  3GBT A;  3A0I X;  1D4X A;  3CC2 N;  1C0F A;  4CD3 A;  3VER A;  3S41 A;  2E20 A;  3L0Q A;  3A5N C;  5TKW A;  5M1K A;  2E2O A;  2DPN A;  1BDG A;  3CPW M;  4JHD B;  3NVM A;  1X3N A;  4GVE A;  1ATR A;  1BOT O;  2GEM A;  2IVP A;  3GL1 A;  4EHT A;  1YF5 L;  5ADX H;  5I9E B;  1BA1 A;  3AAR A;  3WT0 A;  2IVN A;  2CH5 A;  3O9T A;  3OBY A;  3ZX2 A;  3AAQ A;  5C2D A;  3CD6 N;  3FGU A;  3TSP A;  4CJ7 A;  3CCJ N;  3O9Q A;  4A5A A;  3IFR A;  2QWM A;  3DJC A;  3QBW A;  2ZGZ A;  4B1Z A;  2P9L A;  3VF6 A;  3TTF A;  2H3G X;  3VEV A;  2HMP A;  3CJB A;  1Z6R A;  3E9P A;  1OVY A;  3VF2 A;  3H6E A;  2P9N A;  4RTF D;  5BRE A;  1YJ9 N;  2QWP A;  3EE9 A;  3VEZ A;  3C6A A;  1RFQ A;  4B9Q A;  4PL8 A;  3LDQ A;  5JMV A;  5KPZ A;  1YJN N;  1MDU B;  4BR4 A;  3FZH A;  3P38 A;  3GOI A;  4IJA A;  3SLC A;  5C12 A;  3AAP A;  3K9K A;  4BQL A;  4IZ9 A;  3CC4 N;  2ZF5 O;  3DXK B;  3SBG A;  2QWQ A;  3E9L A;  1HX1 A;  4I6M A;  1CZA N;  4CZM A;  1S72 N;  3TSU A;  2P9I A;  1KXP A;  4BRD A;  4QS8 A;  5AQF A;  5GIP A;  5BN9 A;  2D0P A;  4KH5 A;  4L3Q A;  2EWS A;  3C0B A;  4FWM A;  3O9S A;  1KC8 O;  1YUW A;  5AQQ A;  3O80 A;  4YOU A;  4JD2 A;  3WXL A;  3ZEU B;  2QWL A;  2F9T A;  3CJ1 A;  2P9P A;  3OHR A;  4NO7 A;  5AQP A;  5EY4 A;  4E1J A;  3U8X A;  3KK7 A;  1VQP N;  5DM6 L;  3F2K A;  4MLE A;  3UKR A;  5AZJ A;  1JCG A;  1QZ6 A;  4BRE A;  1ZC6 A;  5C10 A;  1Q81 O;  1Z05 A;  3UKU B;  2P9K A;  3A5O C;  3MWT A;  4GY2 B;  1JCF A;  3CME N;  3QDK A;  1SS6 A;  2Q0U A;  5FPD A;  3QML A;  4JKA A;  4M7X A;  1VQ4 N;  3LDO A;  3CC7 N;  5E26 A;  4JKH A;  3VEX A;  3CJC A;  4GV6 A;  1T44 A;  4JKC A;  2E1Y A;  2QA4 N;  4QS7 A;  1VQM N;  4A57 A;  4C23 A;  5M1F A;  5B8H A;  3U9D A;  1HLU A;  1Q7Y O;  4GV9 A;  4HWI A;  1DGK N;  5DM7 L;  1T6D A;  1VQO N;  1G99 A;  3CXC M;  3R9P A;  3HI0 A;  5F0X A;  3QB0 A;  4H0P A;  3DXM A;  3VEW A;  4BRN A;  1NGA A;  4BRC A;  5JLF A;  3TPQ A;  2P9L B;  3VF4 A;  3RVC A;  3F9M A;  5AFU A;  3AGR A;  5AQW A;  5HL7 L;  1S3X A;  3PLA A;  2V7Y A;  1NMD A;  4CZG A;  1V4S A;  3IDH A;  3O08 A;  4UY8 O;  1VAZ A;  4WQ5 C;  2ZWH A;  1IJJ A;  3ZET A;  3IMX A;  5JLH A;  2GWJ A;  3H3N O;  2WUS A;  1BA0 A;  4JKG A;  5AQY A;  5MLC Q;  5LJW A;  4H0O A;  5KQ8 A;  4CZI A;  2IVO A;  1YJW N;  1KAY A;  3H1Q A;  4MLH A;  4AM7 A;  1JCE A;  4IDH A;  1KQS M;  5AQG A;  3CPE A;  1BU6 O;  4I6M B;  5F1X A;  1QQM A;  1XQS C;  2QEX N;  2P9I B;  2ZGY A;  3SJH A;  3EL2 A;  5GAG P;  3I33 A;  2V7Z A;  1NGD A;  3P4I A;  2A3Z A;  3L6Q A;  3N4P A;  4BRH A;  1VQ5 N;  1K9M O;  3MMV A;  1GLL O;  3HRG A;  3FLC O;  4R79 A;  1YHQ N;  1M90 O;  3BUZ B;  3CF5 L;  4EAH D;  4JD2 B;  3C7N A;  1HPM A;  5AQH A;  4XH1 A;  5TKY A;  3CCQ N;  1HUX A;  2P9P B;  3UB5 A;  3WUH A;  3TSQ A;  2J4R A;  2WBN A;  1DEJ A;  4XEI A;  4G9Z A;  1U2V A;  4Y0W A;  1V4T A;  2P9S B;  5AZJ B;  4M7Y A;  4O8U A;  3UKR B;  3SAG A;  4F9O A;  1TUU A;  3DAW A;  1KD1 O;  2FF3 B;  3N4Q A;  4ILJ A;  4BR2 A;  3RSE A;  3VGK A;  2P9U B;  4YOX A;  1KAZ A;  2P9K B;  3G25 A;  2GTD A;  5AQN A;  5C15 A;  1MWM A;  1W97 L;  3O4W A;  3TU5 A;  1T6C A;  3WXK A;  2PFU A;  1VQN N;  3ENB A;  1WOQ A;  1C0G A;  2HF4 A;  4A61 A;  3CJA A;  4CBX A;  4BRK A;  4FWO A;  4WQ5 A;  3R1X A;  3VMF B;  1LCU A;  5ADX A;  1HKC A;  3MK6 A;  4IWV A;  2OAN A;  1GLE G;  4CBU A;  2Q97 A;  2VWB A;  1Q86 O;  3M5R A;  4PHT X;  4AM6 A;  3D7E O;  5M1O A;  5M1Q A;  4ILG B;  1GLA G;  2YI1 A;  3CIP A;  1ILY A;  4JKE A;  4FWR A;  3SMP A;  3VTI A;  3HBT A;  5BPM A;  1K8K B;  3QFP A;  3AGK A;  4BRP A;  5JVG L;  1QZ5 A;  1XUP O;  3FZL A;  3EO3 A;  4IXC A;  3D6R A;  3DXM B;  3O9R A;  3VEY A;  2Q2R A;  4H03 B;  3QFU A;  4YOT A;  3KHY A;  4FPB A;  2ZJQ L;  2GWK A;  5M1N A;  3EKS A;  3G4S N;  5LJV A;  1NLV A;  3ID8 A;  4Z94 A;  1YVN A;  4BRF A;  4NLC A;  2OTJ N;  1WUA A;  2CGL A;  1QQN A;  4JKG B;  2OTL N;  2YX6 A;  1RDW X;  3L4Q A;  4DCH A;  2QM1 A;  4BGB A;  2VGN A;  3U4L A;  4EFH A;  5KPT A;  2QW9 A;  2YCH A;  2JWL A;  3MX2 A;  4K41 A;  4YOW A;  4BY9 C;  3A8Y A;  2I7P A;  5AQK A;  4BRA A;  4WF9 L;  4JK9 A;  1ATS A;  4HTL A;  3VEO A;  5JIC A;  2NRV A;  3D2F A;  4AF1 A;  3J7Z O;  4WCE L;  3R6M A;  5GAE P;  2QWR A;  3C7N B;  2ZJR L;  1GLJ O;  4H0T B;  3E1Y A;  4YOY A;  2VYP A;  1QVG M;  3WEE A;  2PAV A;  4BQZ A;  1NGB A;  2FSN A;  4O5F A;  3EN9 A;  4H5T A;  1HKG A;  5EOY A;  3CER A;  3O1W A;  3D2E B;  4IO8 A;  4KH6 A;  3LDN A;  3E66 A;  4YDU C;  2Q31 A;  5F2R A;  3RSE B;  4IOA L;  1SAZ A;  2GEL A;  2D1K A;  3H46 O;  3LDP A;  3CCU N;  4WYB A;  3M6G A;  4CZK A;  4XH5 A;  1GLD G;  3CHW A;  5ELZ A;  3WQU A;  3O6W A;  3BP8 A;  4RCH A;  2NRH A;  3GDQ A;  5AQS A;  2AP1 A;  3ZX3 A;  4IO9 L;  2ASP A;  3G71 N;  1S22 A;  4WFN L;  3OA9 A;  4JKD A;  4JKF A;  3UE5 A;  4M63 C;  3LM2 A;  2FSJ A;  1K73 O;  3GG4 A;  3MN9 A;  4A2B A;  4A62 A;  1H1V A;  3ENH A;  4GV3 A;  1U6Z A;  2FLO A;  2FF6 A;  2HST A;  3FZF A;  4B1W B;  4JAX A;  4BG8 A;  3KVG A;  4A5B A;  3ATV A;  5CHI A;  3KWG A;  2BH1 A;  5KPR A;  3O5B A;  5BRD A;  4PKH A;  3HTV A;  3Q7B A;  4K42 A;  1KAX A;  4BR5 A;  4CBW A;  5KQD A;  3H1V X;  3KWI A;  1EQY A;  1P8Z A;  4U7B A;  3MN6 A;  4FPA A;  4CD1 A;  4JN4 A;  2P9N B;  1YXQ A;  4LC9 B;  2YJF A;  3MN5 A;  4RWT A;  2RHK A;  1EO1 A;  2NRT A;  4BR9 A;  3P39 A;  3CCR N;  4BVP A;  2E88 A;  3EZW A;  4FOE A;  4CZF A;  1Q18 A;  1QVF M;  3NVK A;  3PIP L;  4FWP A;  3R3L A;  3EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...