3O9UA

Effector domain of influenza a/pr/8/34 ns1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
SRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 32
structure length 116
sequence length 116
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9uA00
2GX9A 3OA9A 3KWIA 3D6RA 4OPHA 3O9SA 3P31A 3EE9A 4OPAA 3RVCA 3L4QA 3P39A 3O9TA 3F5TA 3O9UA 3KWGA 3O9QA 3EE8A 3M5RA 2KKZA 3P38A 2RHKA 3O9RA
chains in the Genus database with same CATH superfamily
3KKSA 3JSMA 1X9JA 1JCFA 1X9WA 1RGIA 1D9FA 2HHQA 4DFJA 4TSXA 3TARA 3WEEB 2YI1A 3SV3A 4DTSA 4NO7A 1U48A 3RMCA 4B1WB 3D45A 1BWFO 3K57A 4Y1CA 2QKKA 3FZMA 4DTXA 2QW9A 1RT7A 4BR2A 3AVCA 1VQKN 3NGYA 1YJNN 3CXCM 3QEXA 4JKDA 2QM1A 2Q31A 1A5XA 2VGMA 1D8YA 4HUGA 4L8RB 4B9MA 2R7YA 1A5VA 4HWIA 2O8EA 2JLEA 4CJVA 3THYB 1RTHA 1K73O 4CJ4A 2OCEA 1VQ8N 4DQSA 1LW0A 4N56A 3L2UA 1IBLK 2E20A 3KD1E 4DR1K 2ZGYA 1EKEA 2E5LK 3UKRB 4CEBA 4B1XB 3DXKA 3CJ1A 1G15A 3CQ8A 4LFAK 1RDUA 2WTUA 3BUZB 2JGUA 1Z25A 3P5JA 4CHNA 2JWKA 1NKBA 2VG6A 1P8ZA 1WNSA 2ZWHA 3BGRA 4LC9B 2YNGA 4BR0A 4NXMK 4X62K 1S72N 3KHYA 3AA3A 3V4IA 1NK8A 3D6RA 4EP5A 4N41A 3LAMA 4YOYA 3EEQA 5AZJB 4DSIA 1HR0K 2P51A 3LZIA 3OBYA 3CQYA 4KO0A 4O44A 5A2QO 5HRNA 1KVBA 3HPGA 1TV6A 1BIZA 3EE8A 3VEYA 4W5RA 3KK3A 3NHGA 4DTRA 3AVBA 1TKXA 3L2WA 4DG1A 3AARA 5AQMA 2CGLA 3QBWA 4W5OA 3ZSQA 2QWMA 3THYA 4CZGA 3M8SA 3FFKB 3ZSVA 3U9ZA 4B1VA 4FL9A 1GLFO 4JKBA 4JKCA 1ZC6A 3CQXA 3UB5A 1X1PA 3FGUA 4CIGA 4A2AA 1W2BM 2BDPA 2WC9A 1NKEA 3VQ4A 2W41A 3JYTA 3CM6A 5AQHA 2HHVA 3E1YA 3WNFA 2ETJA 4AM7A 3VQCA 5EOYA 4I6MA 4E1MA 3LDQA 3LDPA 4JRQA 1IJJA 1NNEA 2XY8A 3VGMA 2H3GX 4O55A 2KKZA 4BGAA 5JVHL 1ZBFA 4KH4A 2E6MA 3K5NA 5CY4A 4BRFA 4FYDA 3CCLN 3HJFA 5AZJA 3HPOA 5HBMA 3VEOA 3MAQA 4BR5A 2BE2A 3V9XA 1N34K 1ZYQA 3ZX0A 3I8BA 3OS1A 5FLXO 1XHZA 2O8BB 5CR4A 3IDHA 4MFBA 4GMJB 4IG3A 4M41A 4Y0WA 4BE0A 1L5UA 4WYBA 3NF8A 2E8AA 2NRWA 4WE1A 5AJ3K 4FM1A 1S5JA 1EWRA 4N76A 1ZXOA 4DU1A 3LPTA 3VQ9A 1B9FA 4DUYK 1BI4A 3VGLA 4ISGA 5DM7L 1U47A 4DTUA 1NK6A 3NH0A 3QNOA 2UYTA 3VQQA 1HKGA 2ATQA 4BREA 3ULEB 3M8RA 4A5AA 3J80O 4OGCA 4FM0A 2P9KA 1NJXA 4JI3K 3V6DA 1QQOA 3GDQA 4H0XB 1S9EA 1BUPA 4X64K 1SV5A 4K42A 4YOXA 1NJIO 4FXDA 1VSLA 2KFZA 2Z1GA 4HCCA 4BR7A 2IIRA 1SKWA 1T44A 1K8KB 5HRRA 4QS7A 3IS9A 3WNEA 1HJRA 3H1QA 5M1OA 4HUEA 3M3ZA 2RPIA 2IAJA 4B1UB 5JLFA 3F73A 5AR0A 4ISEA 3VERA 5BN8A 5J2PA 1J54A 1W0HA 5AQRA 2IC3A 2I5JA 3TTCA 4V19S 1B92A 4JLHA 5I9EB 1KC8O 1XC3A 3NF7A 3AVMA 4ID5A 3SMSA 5ELZA 2RE2A 3RRGA 3CPWM 1NGEA 4DKWA 4B9UA 3LANA 4PKGA 1XMQK 2O8BA 3SPZA 1RBUA 2HF4A 1TKTA 3UKUB 3MN5A 5KPTA 1LV5A 4FWOA 3ZT4A 4JS4A 3U3YA 3UIQA 4OGEA 1IG8A 1VQNN 2NRXA 4A62A 3CMAN 4IKFA 4A2BA 1SAZA 1UOCA 2KLAA 4AHVA 2QTDA 4JV5K 4CZKA 1KCFA 1C0FA 1VSHA 4NLCA 3VPZA 3DLLL 4X65K 1MWKA 3AO4A 4GVEA 2DFHA 1E4GT 4CGJA 3BZKA 4ZHRA 4LF8K 2WONA 4BACA 1Q82O 2FSNA 2D0OA 2Q0UA 3H08A 4G1QA 3MXIA 3PX6A 4JI6K 3MXJA 2KHOA 4DLGA 1RFQA 4FVMA 3O9SA 4FLWA 1IG9A 1NMDA 5EU7A 3HBTA 3EZ5A 1IKYA 4IFEA 4BWJA 4CHQA 2Z1HA 5ADXH 3MCPA 1OH5A 5AQSA 2YJFA 4DR2K 1BOTO 4B3MK 2EX3A 3EN9A 5J2MA 1JCEA 1SQKA 1FJGK 3MXMA 4E1NA 4B3RK 2ZM6K 5KQDA 5TKWA 3V9WA 4AF1A 2P9UA 4PY5A 1NK5A 2WBNA 3E66A 3UKUA 1QSSA 4ILGB 1WSHA 3G6EN 4CZHA 1HUXA 5HL7L 4GV9A 3CM5A 3IMXA 3OYHA 4Z4FA 3WUHA 3ZT1A 2ZJRL 3OVNA 4CGGA 5TKYA 1RTJA 3HI0A 1QTMA 1NBWA 1XHXA 3HRGA 4KHNA 1CLQA 2HNDA 3SV4A 2PYJA 2ZE2A 3D7EO 3RRHA 3MEEA 1DTQA 3L3VA 1MDUB 4HVJA 3ATUA 3VEXA 4E7HA 3MEGA 2QWQA 4H0TB 3ZSXA 1HYVA 5BPMA 3ENBA 4PKHA 4I9QA 4YOWA 5J2QA 4NLBA 3SI6A 2E1YA 1KAYA 1O13A 4BRLA 3TTDA 1RBTA 2D0CA 2D0AA 3G4SN 4RW4A 3CPEA 4HUFA 2D0PA 1I94K 4DWIA 3GBTA 3P4IA 4AHSA 3OYDA 4FJJA 1JLGA 2UXCK 3A0IX 4YHHK 4OPKA 4M63C 3AGKA 1HKBA 3AO1A 1HNXK 1TK0A 2WFBA 3WT0A 4CEZA 2PZSA 3HK2A 2I7NA 4PQUA 4JI8K 4LFCK 4RCHA 2XY5A 3RMAA 1RILA 2GV9A 4IJNA 4ELTA 3ZX2A 2YKNA 2P9IA 2YNFA 3CFPA 4DSJA 3HPHA 4XIUA 4CW7B 2GTDA 1RBSA 1VSKA 1LAVA 4RW7A 2IVNA 3C94A 1HJOA 3QB0A 4DTNA 2PAVA 3THXB 4JS5A 1FKPA 4A59A 4YORA 3O1WA 2PFUA 1VSJA 3I8DA 1U49A 3D2FB 3VQ7A 1S6PA 5FDLA 3NBPA 3KLEA 1QQMA 3DXMB 4DQIA 1IBKK 4CF8A 2YNHA 5BRFA 5C0YA 3C6TA 3LP2A 3ALYA 2B5JA 4Z4EA 3PY8A 1LAWA 5ADXA 2OPPA 5KGWA 3CF5L 1RT4A 3NH1A 4CEAA 2ZGZA 4DSLA 2QKBA 5KQ8A 1S6QA 5B8HA 3J7AP 1DT9A 1EXQA 3MMVA 4C1NI 4CFBA 1BDGA 4HTUA 1Q9XA 5KPRA 2W6KA 3O3HA 2XO7A 5SWMA 4FJXA 3WNGA 4CF2A 3A5OC 3CJAA 4GKJK 2QWNA 4IG0A 4BRDA 1EWQA 1U45A 1V4SA 2P1JA 3NF6A 3U9DA 4M3YA 4QAGA 5JLHA 2OA8A 3LDLA 4WQ5C 1XNQK 3TAPA 2D5RA 5M1PA 4R79A 2G8WA 3F2KA 5KI6A 1ESVA 3ENOA 1NK4A 2V51B 2ZJQL 4DV7K 1JLBA 1QQNA 1DKGD 1S1TA 3MN6A 2O8EB 3SUNA 1VHXA 1RDDA 2KZMA 1VQ5N 4IFVA 5C42A 5KGXA 3DLGA 4CZEA 2F9WA 3P38A 4ICLA 4YNQA 3ID6A 3HO1A 4CFDA 5GAEP 4FW2A 1MU2A 1U4BA 1HPMA 3ZSZA 1GLJO 5BRDA 1T3VA 4MLEA 4H5VA 4JK8A 1VQ6N 4CI6A 1FK9A 1IO2A 4DTPA 4FWQA 5AQTA 2P9SA 1OH7A 3HP9A 4BRMA 4A57A 3O4QA 4Z4GA 2YNIA 5FPEA 1S1UA 2A1RA 4JI0K 4XEIA 4BWMA 3CYMA 2Q1NA 3MN7A 4Z94A 1ATRA 3QIOA 4DUZK 1RDBA 3OYMA 3NMUA 1NJZA 1KQSM 3O5BA 3PX0A 3HSCA 5KRSA 5C2DA 4CJPA 1JXEA 4AILC 3KKRA 2RN2A 3QICA 5EVZA 1K8AO 2D0BA 5C12A 3OYGA 3ZEUA 3F9KA 1HRHA 4MLHA 4JKEA 1JJ2M 3RMDA 3KJVA 3CERA 1HNIA 2HHTA 3HM9A 3VQEA 3ASMA 4FJGA 2HHSA 3SZ2A 4HHTA 4H5WA 1P90A 4B3SK 3VF2A 4BC2A 1YAGA 5BN9A 1T03A 3ZCMA 2NLXA 4PHTX 1NK7A 4CEOA 3E9OA 2FXUA 4W5NA 1SKSA 4GW6A 1WOQA 2FBXA 1I39A 1TYQA 4CVNE 3D2EB 4M7YA 4XH1A 5M1QA 4BG8A 1YVNA 1S1VA 3DOKA 4DTJA 2E1ZA 4CJFA 2UUBK 1KRPA 1KVCA 4DR6K 1WBDA 2VYPA 4X66K 1LWEA 4PUOA 1DTTA 3KLIA 4I6MB 3JS6A 4KI4A 1QHTA 1TAQA 3AVGA 3ZSOA 1BCMA 2YX6A 2PBDA 1SS6A 4IWVA 2W42A 1NJYA 1Z05A 4PWDA 1YT3A 3WXMB 1HQEA 4BRAA 3CMEN 3BDPA 4FLTA 5AQGA 3MWTA 3SUQA 2XY7A 4C8OA 2QXLA 1KXPA 3QETA 1L3UA 2E88A 2HHHK 3TABA 2HOEA 1X3NA 2QK9A 1F21A 4CIEA 3AA5X 3WNHA 5LMNK 3DRPA 3DWLA 3BF3A 4EZ6A 3QFPA 4FLYA 2F4VK 4CCHA 1XWLA 3TAMA 3VENA 1BA1A 4ZTFA 1BI4B 4JI7K 1WSJA 3LP3A 4FJ9A 4BC4A 4FJ7A 2VWJA 3O9TA 5C10A 4KB1A 4OLAA 4IJAA 3O4NA 2P5GA 1CZ9A 3R3LA 3HP6A 4JHDB 2P9KB 5GADP 3D2EA 4BC5A 3S3MA 3ZSWA 1GLLO 1NGAA 3OTOK 2HMPA 1UWBA 4BC3A 3CETA 3G0ZA 1NJWA 1N5YA 4CZJA 3FZKA 2OPSA 3RTVA 4EZ9A 3HL8A 2QWPA 3DLKA 3C65A 3OYFA 3KLGA 1X9SA 4C8LA 3CCUN 3VQAA 4DLEA 1IKXA 4DHYA 4FK0A 1XUPO 2P9NA 5KTQA 4FM2A 3BZCA 3T7ZA 2DTUA 1HKCA 4CK2A 2NUBA 1WB9A 2PYLA 2O4GA 5JMVA 1NGGA 5H1SQ 2QWLA 4E7KA 4JI5K 2E2QA 2FBYA 1EX4A 3DM2A 4OLBA 2P9LA 1XQSC 1LWCA 2WUSA 4JK9A 3AAPA 3O80A 4F2RA 5GAGP 2HHWA 1SKRA 1Q7YO 4CF1A 3AVFA 3C6AA 2A42A 2IVPA 1U2VA 1NGBA 2OPRA 3KK1A 3RR7A 1RBVA 1FW6A 1ASVA 1VQMN 4LSNA 4XH4A 3PIPL 4K41A 4E1JA 4C8KA 4CZFA 3TAGA 4JKGB 5HRSA 2A41A 5E84A 1LWFA 4EAHD 5AQNA 4DFKA 4OKJA 5AQUA 3L6QA 5EY4A 3D0PA 3MEDA 3ZYYX 4ELUA 2CGKA 3TSPA 3O1BA 3C95A 3VQ8A 5M1KA 4KTWA 1YJWN 1D5AA 3A5MC 2ZD1A 3SAGA 1NK0A 1QSYA 1NGHA 3DJCA 4JHDA 4BVPA 5HLFA 3CJ9A 4M3XA 3SJHA 2A6AA 4M7XA 3ULDA 4DQ8A 3OS2A 3ID8A 5CYMA 1SUQA 1ITGA 3M8QA 5AQLA 3I56N 3EO3A 1WUAA 4ILHA 4KHSA 5BREA 3P31A 4WFBL 1NGIA 3S41A 3JXUA 3G25A 2IVOA 4OVLA 5BPNA 4WQ4C 1VSIA 3L0QA 1TK5A 1Q8IA 3U6FA 4N5SA 1RT1A 5AQWA 4BR9A 4DQPA 3C0BA 3LDNA 4OPHA 1BA0A 3EE9A 4PL8A 1L3VA 1WN7A 2FSKA 4KH5A 1VQ9N 1TVRA 2P9UB 4IDKA 1BQNA 2UXDK 3NGIA 2A1SA 1CXUA 3VQPA 5MLCQ 1IKWA 4JKGA 4E7LA 1Z6RA 3EKUA 5AFUH 3VQ6A 3MECA 5LMUK 4O4GA 3VESA 3TAEA 3L2RA 2HMIA 3FFIA 4FPBA 2YV0X 5HP1A 1YTAA 3QEWA 2KZZA 2BH1A 1XI1A 1ZBUA 4QS8A 4B1ZA 3PLAA 3SK3A 3P83D 4FJNA 4BRCA 1TKDA 3N4PA 1ATNA 4YDUC 1O1WA 1LCUA 4FK2A 2IDOA 4IOAL 1RT6A 3G71N 3J7YP 1N8RO 4FJ5A 2BTFA 2YHYA 4B9TA 1X3MA 4R5PA 3NAEA 3K2PA 4Z4HA 2DFEA 3UE5A 4CEQA 3A2FA 4O8KA 3GE1A 3F9MA 5F1XA 1GOBA 3DOLA 1TGOA 3E01A 3CJCA 1C0GA 2VG7A 1HPZA 4BE2A 3CC7N 4FJLA 1TL1A 5CHIA 2Q3SA 5FPMA 4KPYA 2YHAA 3LDOA 3V1OA 1ASWA 4RW8A 4KRFA 3OW2M 4FJKA 4LF6K 2FF6A 4NCGA 4FSVA 3SBGA 1VSMA 1E4FT 2BGGA 4E3SA 3DAWA 3L8BA 2P9IB 3HOSA 3DLRA 3AAQA 4BDPA 4FPAA 2NRZA 3QEVA 4Q5VA 2CGJA 4K43A 4KB0A 5E41A 3OY9A 2QWOA 4G9ZA 4U7BA 4DSFA 2J4RA 1J5OA 3ZSRA 4CJ3A 3I55N 4CHOA 2WOMA 1E3MA 4CEEA 3T1HK 2HBKA 3JAMO 5HRPA 1JLCA 4PL7A 5LJVA 2PY5A 3L3UA 3CCRN 3MX5A 3LAKA 3H46O 3Q7CA 3K9JA 1BHLA 3QEPA 4DFMA 4DU4A 2LSNA 5AQPA 4CJ5A 2GWJA 1QVGM 3SQ2A 3NGZA 2KFNA 3MN9A 1S1WA 2X74A 1C1BA 2HF3A 3HSTB 3VOVA 4JD2A 1C0MA 1YIJN 5FPDA 2X6NA 3SJJA 2OZSA 4CERA 3QNNA 4B8AB 4BRQA 3SQ4A 1RBRA 1BIUA 4BRIA 3WXKA 3NCIA 3TAQA 4KHWA 3IAYA 1TAUA 4FJMA 1M90O 4IZ9A 2V52B 4CHPA 2QEXN 2Z1IA 4RW6A 3O3GA 2IOCA 4CGHA 4C8MA 1U6ZA 4DSKA 4F4KA 3TWHA 3HVRA 1VAZA 3I0RA 3I33A 4EP4A 1UA1A 4BDYA 1TUYA 4DQQA 1J6ZA 5AFUA 5FROA 1IKVA 3CJ7A 1M1KO 3AA2A 3LZJA 4OKEA 2XHBA 1KLMA 3M6GA 1JLAA 3TPQA 4DTMA 3QBXA 4YOVA 3IG1A 1CXQA 1A5WA 3KK2A 2F8SA 3SNNA 1JKHA 4KHPK 3EY1A 1RT5A 2RF2A 2VG5A 4FOIA 4LSLA 4OO1J 3HZ6A 5AQIA 4B9NA 2FLOA 3VQDA 3O6WA 3HTVA 5AQZA 4DV1K 1KSPA 2HSTA 2E6LA 1ASUA 3LDSA 3B6PA 4QOZB 4B3TK 3PUFA 1VQPN 3KLHA 2HNYA 3WXJA 3T1AA 1HQUA 4CHYA 4OJRA 3VQBA 2UUCK 1YTUA 3IFRA 4M3WA 4KHUA 2AP1A 3K5LA 4H0YB 3CFRA 1C0UA 3SUOA 4BRPA 3OYEA 4DU3A 1IBMK 4NCBA 1C6VA 1J5EK 3L2QA 4H5RA 4A61A 2P9SB 3KWGA 3VN5A 3BEXA 4GVMA 4CEFA 4LF4K 4O0JA 3V9SA 3E9LA 2ZF5O 1S3XA 3AVKA 5CE3A 1R0AA 1KFSA 4CIFA 4DR4K 4GKKK 3ATVA 2HB5A 4FLVA 2A40A 4O5FA 4I2QA 3CCVN 1EETA 4JAXA 4M42A 3ZEUB 4UY8O 4AHTA 3M5RA 4CF0A 4MDBA 3QLHA 3V9ZA 4YY3K 3PIOL 4AQYK 2DPNA 4M45A 1N32K 1YVUA 4Y1DA 2G8FA 3O3FA 5LJWA 2QXFA 2XRIA 4F9OA 3ZETA 2EHGA 4BGBA 1K6YA 1RDCA 4RW9A 1R59O 3AVAA 3AGRA 4DF8A 1GLDG 1BISA 1ZBSA 3SMPA 2Y1IA 3CC2N 4B9VA 3TR8A 2ASOA 2YHBA 3KK7A 4N47A 3THWB 4CJEA 1JLQA 4DS4A 3T1YK 3HVTA 3C7NA 1TYQB 3BP8A 3W3DA 4FO0A 1MWMA 5D3GA 4FJHA 4FVUA 2Q97A 5M1FA 4DV3K 4Z0UA 4CFCA 3OJUA 2HBJA 1KAXA 5DM6L 1NKCA 5IWAK 4KAZA 3LPUA 2QA4N 3FZFA 3WXIA 4WFNL 3SBTA 1S22A 4CJTA 1ZBLA 3RWUA 5KRTA 2NNWA 4CBWA 3O9RA 4MO4A 5AQFA 1NLVA 4M3ZA 1T6CA 1T05A 3NDKA 3NH2A 3EZWA 1OVYA 5F2RA 4AH9A 2NRRA 2IS3A 5GIPA 4IFYA 3RVCA 4CZIA 2DY4A 4EFHA 4IEEA 1WSGA 2W40A 2X78A 1TL3A 3SAFA 3TI0A 1J53A 2OTLN 5M1NA 3FLCO 4WQ5A 3U8XA 4OX9K 2QI2A 5C24A 4BE1A 4EIAA 4DR7K 3QERA 4C8NA 4CZLA 1JL2A 2F9TA 4PA1A 3OA9A 4JI2K 2FBVA 3J81O 4DR5K 5AQQA 2O8DB 1RT2A 1DLOA 4MO5A 1ZBIA 4BVOA 1RDAA 2FF3B 1VQ7N 4IXCA 4KFBA 4CD3A 4NYFA 2F8TA 2BUPA 1VQLN 4BRHA 2VWBA 2GUPA 2Q0RA 1WSFA 2P9PA 4Q0BA 4FWLA 3THWA 4QCLA 3VEZA 4CEDA 3VTIA 2D1KA 3SYZA 4RG8A 2HVHA 4U67L 3N4QA 5HROA 2E2PA 3U3GA 5BRHA 3IUCA 4FWRA 4DF4A 3H6EA 3NF9A 2OPQA 4AHRA 1Q9YA 3GG4A 2NRVA 1N33K 2KQ2A 3SQ0A 2P9NB 1B9DA 3A8YA 4RWTA 1NMNA 4GNIA 1TK8A 1BG3A 3O08A 1UA0A 1L3TA 2UXBK 3H3NO 2F7TA 3TSUA 1T6DA 4CJLA 3R6MA 3QINA 3QEIA 1WSIA 3LP0A 2P9LB 1HYSA 1ZBHA 5FPNA 3NE6A 3OYJA 3FZLA 3AO5A 2ASPA 4MQ3A 1U2VB 1Z26A 3OS0A 4FWMA 4H0OA 3HXMA 5E26A 3SPYA 4L3QA 1WAJA 2HHUA 1QHAA 3DMJA 4M3RA 2E2OA 1QE1A 2EWSA 3H1VX 1NU0A 4J2EA 4WCEL 4PKIA 4CE9A 3VGKA 3AY9A 2O8DA 1ILYA 4DQRA 1QS4A 3WEEA 4FLZA 4ELVA 3SCXA 4C1NK 4F8RA 4YOUA 1GLCG 2HW3A 1G99A 1NGCA 3CG7A 3DLEA 3CD6N 1QSLA 2RHKA 1XNRK 3DRRA 2JWLA 2FC0A 3ITHA 3QMLA 5KPZA 3VTHA 3K59A 4F2SA 4H03B 1HX1A 3OJSA 4JNEA 3SUPA 4Z4CA 4CJKA 4RTFD 4LF9K 4LF5K 3AVJA 3H3OB 5AQKA 5CZ1A 4M3TA 5AZIB 3UKRA 1YI2N 4JEPA 1HNVA 1HMVA 3AV9A 3O8MA 1VSFA 3OYLA 3K5MA 2HBMA 3FZHA 2AA4A 4J2AA 1S9GA 4DV0K 4CJQA 4JKHA 5LL6Z 4B9QA 3C6HA 3PO4A 1YJ9N 3K0SA 5JS2A 4WFAL 2HBLA 4BRNA 4CJRA 4BROA 2A3ZA 5IT9O 4LH4A 4H5TA 1KTQA 3V9UA 1BO5O 3VQ5A 4I2PA 4IBNA 3DI6A 4GV6A 1HNWK 1BQMA 4IO8A 2O4IA 3B6OA 3AO3A 3KD5E 4JK7A 4H8KA 4EHUA 5BR8K 1N6QA 2YCHA 3K9KA 4O0IA 4FWKA 5AQJA 1W7AA 1FKOA 1JLFA 4H0VB 3MDQA 3CIPA 4JRPA 4K8XA 1LOTB 3OBWA 4CF9A 3THVA 1JCGA 3OYNA 3I0SA 3T19A 3IRXA 3AO2A 3PSFA 4KBOA 3FE1A 5LY3A 2ZQBA 5AQYA 3VF4A 3VA3A 3OHRA 1JL1A 1NGJA 3K5OA 5AZIA 4I7FA 1SL2A 4J8FA 3ZT3A 4QS9A 2VQFK 1TUUA 1VRTA 3DLHA 1HLUA 2G8KA 4IEIA 2AJQA 1SL1A 4GY2B 4KHYA 4CESA 3O4WA 2O8FB 5AQXA 4DV4K 4BY9C 4K0KK 4O8UA 2V7ZA 1C1AA 3LWMA 1NGDA 1U04A 3PSIA 3P1GA 5GAHP 3J7ZO 2Y1JA 1QZ6A 3GOIA 2ITGA 4KTQA 1YHQN 1S1XA 2YJEA 5C2FA 3SAHA 3ZT2A 4IOCL 4FZXC 3KZBA 3V81A 3P39A 4KTZA 1SL0A 3SLCA 4KV8A 4LFBK 4I9LA 4DCHA 3O9QA 1H1VA 4W5TA 4DS5A 1RCHA 3C6UA 4FWNA 4JN4A 3TAFA 4NYNA 1WAFA 3IKMA 4H4MA 1NG9A 4DV2K 3HOTA 3WQTA 1HNZK 3LP1A 4CK1A 3CCMN 3RSEB 4MDAA 1VQ4N 4BDZA 4CBUA 4F3TA 2FBTA 4OPAA 2KTQA 2CH6A 4JD2B 5AQVA 3ULEA 4JKFA 4BRGA 5BPLA 4WQ4A 3L4IA 3PO5A 2G8IA 4H4OA 4KREA 3B8AX 3KLFA 2NZTA 4DSEA 4FLXA 4CZMA 5GIOA 1NWKA 4FK4A 2D4WA 1CZAN 1DEJA 4B3OA 3HYFA 1KD1O 4LH5A 4E0DA 4C23A 1Y97A 1X9MA 1K8KA 4EHTA 2O8FA 2OTJN 1BU6O 5J1EA 2B6AA 2YHXA 3W0LA 3A5NC 1VQON 1LW2A 2B4JA 2OYQA 1EP4A 1GLBG 2GBZA 5EX5A 3F5TA 4HCBA 3KTQA 4CJUA 3L2VA 5K14A 3TU5A 3DYAA 1WSEA 3KIOA 5C15A 4K8ZA 1ATSA 4FW1A 3Q7BA 3CCSN 1QZ5A 3V1QA 3NVMA 3V1RA 3PX4A 3LM9A 1NOYA 4KKOA 3NVKA 4JI4K 4CBXA 3KWIA 1GOAA 3ZSYA 3CFOA 1FXXA 3CHWA 1NM1A 5FRMA 3TTFA 3OYKA 5J2NA 4E89A 3BY5A 4A5BA 2GEMA 3TSQA 4E19A 1XMOK 1Q86O 4CGDA 1DGKN 5I42A 1VRUA 1NOZA 1IV0A 4YDUA 4CHZA 4NCAA 5C25A 2ASMA 5CYQA 4YFUA 1GOCA 3RSEA 4LY7A 2GX9A 3CC4N 4DFPA 3M1FA 1MA9B 1Y64A 2O8CB 2KW4A 1K9MO 4FZYA 2GELA 4UQGA 1EQYA 4IO9L 3MK6A 2XY6A 4FJ8A 4YOTA 2Q2RA 1N36K 2NRTA 5AQOA 2Q36A 1KAZA 4JKAA 4HTLA 4H0PA 4GV3A 1JLEA 5JICA 4W5QA 3RMBA 3CCEN 4ID1A 1JXBA 1BGXT 1RT3A 4IDHA 2YKMA 3ISNC 3S9HA 4FLUA 2VCPA 4J2DA 4FZZA 3DLBA 4WF9L 3EKSA 4FCYA 3QDKA 1Q18A 4FWSA 3TANA 2UUAK 4NXNK 2W6LA 5GINA 3EL2A 4K25A 3RR8A 1WBBA 1KLNA 1V4TA 1VSDA 3NFAA 3ZETB 3QESA 2DFFA 4BG9A 1C1CA 3VEVA 2GWKA 3O9UA 1QQCA 4KHQA 3WXLA 2VWKA 4FJIA 1BL3A 1RTDA 3LWLA 4BRKA 3ENHA 1CZBA 4JYAK 3OYBA 1OH6A 4IOXA 2G8VA 2P5OA 3E9PA 2O8CA 3LL3A 4LF7K 1OKJA 1W97L 3QFUA 3QIPA 3OYIA 3C7NB 2GUIA 3A5LC 2BANA 2E4LA 5T7BA 4CGFA 3K58A 2QWRA 2VQEK 4CJ7A 1EO1A 5HOOA 2G8UA 3WQUA 3EYZA 2OANA 5EXWA 2UU9K 5I3UA 5JS1A 1GLAG 5FRNA 4B08A 2IGIA 1TKZA 5CZ2A 3OYCA 3MWPA 2F96A 1OH8A 4FOEA 4FWPA 2HHXA 3VEWA 4JI1K 1IH7A 4B8CA 3QO9A 5JVGL 3U4LA 1C0TA 3VF6A 3AA4A 3R8EA 4B9SA 3L4QA 3AVLA 4M3UA 4CK3A 3H45C 4BR4A 1VSEA 3VA0A 3AVIA 2Z1JA 3AVNA 3J8AA 4AHUA 4ILJA 2HVIA 1NGFA 1XC9A 2YHWA 2OZMA 5F0XA 1VK0A 4OPJA 4AHCA 2V7YA 3CJBA 4LD0A 2ZJPL 1OVQA 1YF5L 4ZTJA 1KVAA 4Z4IA 3GL1A 4E7JA 5DK5A 3S3NA 3CCQN 3ZT0A 3T3FA 3VETA 4KI6A 4AM6A 4B1YB 3ZX3A 1D9DA 3KVGA 2ITMA 1T8EA 1WLJA 1SZ2A 4DMNA 1RNHA 3M8PA 2E2NA 3LALA 2G8HA 3MX2A 3HM8A 2P9PB 4H5NA 4CJWA 3S3OA 2VGNA 5SZTA 3THXA 1RDWX 4F3OA 3CCJN 2A5XA 3G10A 1NK9A 1Q81O 3FR0A 4B9LA 4E7IA 4XH5A 4DR3K 4NB4A 4CECA 1YXQA 3D2FA 1UAXA 4KH6A 3T69A 4OKKA 2RKIA 3MCAB 3SQ1A 3VMFB 3DXMA 1T7PA 4CGIA 4BQLA 4ISFA 4CFAA 1L3SA 1RTIA 1KFDA 3R9PA 1W9HA 1YUWA 2I7PA 1GLEG 2CH5A 1YITN 3CI5A 3OYAA 2NRHA 5DMRA 3AVHA 4DB3A 2X6SA 3DXKB 1I3AA 3PV8A 2HNZA 4J2BA 1BCOA 4DV5K 1REVA 3LM2A 1QVFM 4CJSA 4O5BA 4CD1A 4BQZA 5BR9A 1J9AA 3BF1A 4DTOA 3HT3A 1HYZA 4DV6K 1D4XA 2FSJA 3ZLJA 3DRSA 3R1XA
chains in the Genus database with same CATH topology
1HJOA 3QB0A 4YDUC 3O8MA 1LCUA 1X9JA 1JCFA 2PAVA 1RGIA 4A59A 4YORA 4IOAL 3O1WA 2PFUA 3G71N 2HBMA 3FZHA 2AA4A 1N8RO 2BTFA 2YHYA 1X3MA 3WEEB 4JKHA 2YI1A 3D2FB 3UE5A 4B9QA 3C6HA 4O8KA 3GE1A 4NO7A 4B1WB 1YJ9N 3F9MA 5F1XA 1BWFO 1QQMA 3DXMB 3CJCA 2HBLA 1C0GA 3FZMA 4BRNA 4WFAL 3CC7N 2QW9A 5CHIA 4BROA 4BR2A 1VQKN 2A3ZA 1YJNN 5BRFA 3CXCM 5FPMA 4H5TA 5C0YA 4JKDA 2QM1A 3LDOA 2Q31A 1BO5O 2VGMA 3OW2M 4GV6A 2FF6A 4HWIA 4IO8A 5ADXA 4FSVA 3CF5L 3SBGA 1E4FT 1K73O 4JK7A 1VQ8N 4EHUA 3DAWA 2P9IB 3HOSA 3AAQA 2YCHA 2ZGZA 3K9KA 2NRZA 4FPAA 4FWKA 2E20A 2CGJA 5KQ8A 4K43A 5AQJA 5B8HA 1DT9A 3MMVA 4C1NI 2ZGYA 2QWOA 1K8AO 4G9ZA 4U7BA 1BDGA 4H0VB 3MDQA 3CIPA 2J4RA 3UKRB 1LOTB 4B1XB 3I55N 3DXKA 3OBWA 5KPRA 3CJ1A 1JCGA 1RDUA 2HBKA 3A5OC 3CJAA 4KBOA 4PL7A 5LJVA 3FE1A 5LY3A 2QWNA 3BUZB 5AQYA 3VF4A 3CCRN 3MX5A 3H46O 3Q7CA 2JWKA 4BRDA 3OHRA 3K9JA 1NGJA 5AZIA 4J8FA 1P8ZA 4QS9A 1V4SA 2ZWHA 4LC9B 3U9DA 1TUUA 5JLHA 3LDLA 4WQ5C 1HLUA 5AQPA 5M1PA 4R79A 4BR0A 2GWJA 3F2KA 4IEIA 1S72N 1ESVA 1QVGM 3ENOA 3KHYA 3MN9A 2V51B 4GY2B 3D6RA 2HF3A 2ZJQL 1QQNA 3O4WA 3VOVA 5AQXA 4JD2A 1DKGD 4YOYA 4BY9C 5AZJB 1YIJN 4O8UA 5FPDA 3MN6A 2V7ZA 1NGDA 3OBYA 3J7ZO 5GAHP 1QZ6A 3CQYA 3GOIA 4BRQA 1VQ5N 3EE8A 3VEYA 4BRIA 3WXKA 4CZEA 2F9WA 3P38A 1YHQN 3ID6A 5GAEP 3AARA 1M90O 4IZ9A 1HPMA 2YJEA 5AQMA 2V52B 2CGLA 3QBWA 1GLJO 2QEXN 5C2FA 5BRDA 1T3VA 3SAHA 2QWMA 4MLEA 4H5VA 1U6ZA 4IOCL 4JK8A 1VQ6N 4CI6A 3KZBA 4CZGA 3P39A 4FWQA 5AQTA 2P9SA 3SLCA 3FFKB 1VAZA 4B1VA 3U9ZA 3I33A 1TUYA 4FL9A 1J6ZA 1GLFO 4DCHA 5AFUA 4JKBA 3CJ7A 1ZC6A 3O9QA 4JKCA 4A57A 4BRMA 1H1VA 3CQXA 1M1KO 5FPEA 4FWNA 3UB5A 3FGUA 4JN4A 3M6GA 3IKMA 4A2AA 1W2BM 4XEIA 3HOTA 2WC9A 3WQTA 3TPQA 3QBXA 4YOVA 2W41A 2Q1NA 3MN7A 4Z94A 3CCMN 3RSEB 1ATRA 4MDAA 1VQ4N 3NMUA 4FOIA 3O5BA 5AQHA 4CBUA 1KQSM 3HSCA 4OO1J 3HZ6A 5AQIA 5C2DA 2FLOA 3E1YA 4OPAA 3O6WA 4AM7A 3QICA 2CH6A 3HTVA 5EVZA 4JD2B 5AQVA 5AQZA 4JKFA 3ULEA 4BRGA 2HSTA 3L4IA 4WQ4A 5EOYA 3ZEUA 5BPLA 5C12A 3B8AX 4I6MA 3LDQA 4MLHA 3LDPA 4JKEA 1IJJA 1JJ2M 3CERA 3VGMA 1VQPN 2H3GX 2KKZA 3WXJA 4BGAA 5JVHL 2NZTA 4CZMA 5GIOA 4KH4A 1NWKA 3IFRA 2D4WA 1CZAN 1DEJA 1KD1O 2AP1A 4H5WA 1P90A 4C23A 4BRFA 5GADP 3VF2A 1K8KA 1YAGA 4H0YB 4BC2A 4EHTA 3CCLN 5BN9A 2OTJN 1BU6O 5AZJA 4BRPA 2NLXA 3VEOA 2YHXA 3W0LA 4PHTX 4BR5A 3A5NC 1VQON 3ZX0A 3I8BA 1GLBG 4H5RA 4A61A 5EX5A 3F5TA 5CR4A 3IDHA 2P9SB 4Y0WA 3KWGA 3E9OA 2FXUA 3TU5A 3BEXA 5C15A 4WYBA 1ATSA 1WOQA 2E8AA 2NRWA 3Q7BA 1QZ5A 3CCSN 3NVMA 3LM9A 1TYQA 2ZF5O 3D2EB 3E9LA 4M7YA 1S3XA 4XH1A 1ZXOA 3NVKA 5CE3A 5M1QA 4CBXA 3KWIA 4BG8A 1YVNA 3CHWA 1NM1A 3VGLA 4ISGA 3TTFA 5DM7L 3ATVA 2E1ZA 2A40A 4A5BA 2GEMA 3TSQA 2UYTA 1HKGA 4O5FA 2VYPA 1Q86O 4BREA 3ULEB 3CCVN 1DGKN 4A5AA 4JAXA 3ZEUB 4UY8O 2P9KA 3M5RA 4I6MB 3JS6A 4MDBA 4YDUA 1QQOA 3PIOL 3GDQA 4H0XB 2DPNA 1BUPA 2YX6A 2ASMA 2PBDA 1SS6A 4IWVA 4K42A 4YOXA 3RSEA 2GX9A 3CC4N 1Z05A 3M1FA 1MA9B 5LJWA 1Y64A 1NJIO 4F9OA 3ZETA 3WXMB 4BGBA 4BRAA 3CMEN 4BR7A 2IIRA 1R59O 1T44A 1K8KB 3AGRA 1K9MO 5AQGA 3MWTA 4QS7A 1GLDG 2GELA 3H1QA 1EQYA 5M1OA 4IO9L 3M3ZA 2QXLA 3MK6A 1KXPA 4B1UB 1ZBSA 4YOTA 5JLFA 2Q2RA 2E88A 5AR0A 3SMPA 4ISEA 3VERA 2NRTA 5AQOA 5BN8A 2Q36A 1KAZA 4JKAA 5AQRA 4HTLA 3TTCA 2HOEA 3CC2N 1X3NA 2ASOA 3KK7A 4H0PA 5I9EB 1KC8O 4GV3A 1XC3A 3DWLA 5JICA 3BF3A 3CCEN 3C7NA 1TYQB 3QFPA 3BP8A 3SMSA 4IDHA 5ELZA 3W3DA 2RE2A 4FO0A 1MWMA 3CPWM 3VENA 1BA1A 1NGEA 4FVUA 4DKWA 2Q97A 5M1FA 2VCPA 4PKGA 4BC4A 2HBJA 1KAXA 3O9TA 5C10A 5DM6L 2HF4A 4IJAA 4WF9L 3EKSA 2QA4N 3FZFA 3WXIA 3QDKA 1Q18A 4FWSA 3UKUB 3SBTA 1S22A 4WFNL 3R3LA 3MN5A 2NNWA 4CBWA 5KPTA 3O9RA 2P9KB 4JHDB 4MO4A 1NLVA 3D2EA 1T6CA 5AQFA 3EL2A 4FWOA 4K25A 4BC5A 1NGAA 1GLLO 2HMPA 4BC3A 3EZWA 3CETA 1V4TA 1IG8A 1OVYA 2NRXA 3FZKA 5F2RA 4CZJA 1VQNN 2QWPA 4A62A 3CMAN 3C65A 2NRRA 4A2BA 5GIPA 1SAZA 3ZETB 3RVCA 4CZIA 2KLAA 3CCUN 4DHYA 4EFHA 1XUPO 2P9NA 2QTDA 4IEEA 3VEVA 2GWKA 2W40A 4BG9A 4CZKA 1C0FA 3SAFA 4NLCA 3T7ZA 1HKCA 3VPZA 3O9UA 3DLLL 1MWKA 5M1NA 2OTLN 3FLCO 3WXLA 5JMVA 1NGGA 4WQ5A 5H1SQ 4GVEA 3U8XA 1E4GT 4BRKA 2QI2A 2QWLA 3ENHA 4EIAA 4CZLA 4IOXA 2E2QA 2F9TA 1Q82O 2FSNA 3E9PA 2D0OA 2P9LA 2Q0UA 3LL3A 1XQSC 1OKJA 1W97L 3OA9A 2WUSA 4JK9A 3AAPA 3QFUA 3O80A 3C7NB 3A5LC 5GAGP 5AQQA 2KHOA 1RFQA 4MO5A 4BVOA 3O9SA 1Q7YO 2FF3B 1VQ7N 2QWRA 3C6AA 4IXCA 2A42A 2IVPA 4CJ7A 1U2VA 1NGBA 1NMDA 4CD3A 1EO1A 5HOOA 2BUPA 3HBTA 1VQLN 4BRHA 3WQUA 2VWBA 2GUPA 2OANA 5EXWA 2Q0RA 4IFEA 2P9PA 4FWLA 1VQMN 1GLAG 4XH4A 3VEZA 3PIPL 5ADXH 3VTIA 3MWPA 3MCPA 4K41A 4FOEA 5AQSA 2D1KA 4FWPA 2YJFA 4E1JA 4CZFA 3VEWA 1BOTO 4U67L 4JKGB 3N4QA 2A41A 2E2PA 3EN9A 5E84A 5BRHA 3IUCA 4EAHD 4FWRA 5AQNA 5AQUA 5JVGL 3U4LA 1JCEA 1SQKA 3H6EA 3L6QA 3VF6A 5EY4A 3R8EA 3ZYYX 3L4QA 5KQDA 5TKWA 3GG4A 2CGKA 2NRVA 3TSPA 4AF1A 3O1BA 2P9UA 5M1KA 1YJWN 2P9NB 3H45C 4BR4A 2WBNA 3A5MC 3J8AA 3E66A 3UKUA 3A8YA 4ILJA 3SAGA 4ILGB 4GNIA 1NGFA 4RWTA 2YHWA 1NGHA 3G6EN 3DJCA 4JHDA 4BVPA 5F0XA 3CJ9A 1BG3A 3SJHA 3O08A 4CZHA 2A6AA 4M7XA 2V7YA 3CJBA 4DQ8A 3ID8A 1HUXA 5HL7L 4GV9A 2ZJPL 3H3NO 2F7TA 3TSUA 1T6DA 1YF5L 3IMXA 5AQLA 3I56N 3R6MA 3EO3A 1WUAA 3WUHA 2ZJRL 3GL1A 2P9LB 4ILHA 5TKYA 3CCQN 3HI0A 1NBWA 3HRGA 3VETA 5BREA 5FPNA 3P31A 4AM6A 4B1YB 3ZX3A 4WFBL 3KVGA 1NGIA 3FZLA 3D7EO 2ITMA 3S41A 3JXUA 2ASPA 3G25A 1SZ2A 1U2VB 2IVOA 5BPNA 4FWMA 1MDUB 2E2NA 4H0OA 3ATUA 4WQ4C 5E26A 3VEXA 2QWQA 3MX2A 4H0TB 4L3QA 5BPMA 1QHAA 3ENBA 2P9PB 3HM8A 4H5NA 4PKHA 3L0QA 2E2OA 4YOWA 2VGNA 2EWSA 4NLBA 2E1YA 3H1VX 1KAYA 1O13A 4BRLA 3TTDA 1RDWX 4WCEL 4PKIA 2A5XA 5AQWA 4BR9A 3CCJN 3VGKA 3G4SN 3AY9A 3CPEA 1Q81O 3C0BA 3FR0A 2D0PA 1ILYA 4XH5A 4NB4A 3LDNA 4OPHA 3GBTA 3P4IA 1BA0A 3EE9A 3WEEA 4C1NK 1YXQA 3D2FA 4KH6A 4PL8A 3T69A 2FSKA 3A0IX 4YOUA 4M63C 4KH5A 3AGKA 3MCAB 1GLCG 3VMFB 1VQ9N 1HKBA 2P9UB 3DXMA 1G99A 1NGCA 4BQLA 3CD6N 4ISFA 2RHKA 2WFBA 3R9PA 2JWLA 3WT0A 1YUWA 2I7PA 1GLEG 5MLCQ 2CH5A 2I7NA 3QMLA 4JKGA 1Z6RA 5KPZA 3VTHA 1YITN 3CI5A 4H03B 1HX1A 2NRHA 5GINA 3EKUA 4RCHA 5AFUH 4DB3A 3DXKB 4JNEA 4IJNA 3LM2A 3VESA 1QVFM 3ZX2A 2P9IA 4RTFD 4FPBA 4CD1A 4BQZA 5BR9A 3H3OB 2BH1A 3BF1A 5AQKA 5AZIB 4QS8A 4B1ZA 1D4XA 2FSJA 3UKRA 2GTDA 3SK3A 4JEPA 1YI2N 3PLAA 3R1XA 2IVNA 4BRCA 3N4PA 1ATNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GX9 A;  3OA9 A;  3KWI A;  3D6R A;  4OPH A;  3O9S A;  3P31 A;  3EE9 A;  4OPA A;  3RVC A;  3L4Q A;  3P39 A;  3O9T A;  3F5T A;  3O9U A;  3KWG A;  3O9Q A;  3EE8 A;  3M5R A;  2KKZ A;  3P38 A;  2RHK A;  3O9R A; 
#chains in the Genus database with same CATH topology
 3KKS A;  3JSM A;  1X9J A;  1JCF A;  1X9W A;  1RGI A;  1D9F A;  2HHQ A;  4DFJ A;  4TSX A;  3TAR A;  3WEE B;  2YI1 A;  3SV3 A;  4DTS A;  4NO7 A;  1U48 A;  3RMC A;  4B1W B;  3D45 A;  1BWF O;  3K57 A;  4Y1C A;  2QKK A;  3FZM A;  4DTX A;  2QW9 A;  1RT7 A;  4BR2 A;  3AVC A;  1VQK N;  3NGY A;  1YJN N;  3CXC M;  3QEX A;  4JKD A;  2QM1 A;  2Q31 A;  1A5X A;  2VGM A;  1D8Y A;  4HUG A;  4L8R B;  4B9M A;  2R7Y A;  1A5V A;  4HWI A;  2O8E A;  2JLE A;  4CJV A;  3THY B;  1RTH A;  1K73 O;  4CJ4 A;  2OCE A;  1VQ8 N;  4DQS A;  1LW0 A;  4N56 A;  3L2U A;  1IBL K;  2E20 A;  3KD1 E;  4DR1 K;  2ZGY A;  1EKE A;  2E5L K;  3UKR B;  4CEB A;  4B1X B;  3DXK A;  3CJ1 A;  1G15 A;  3CQ8 A;  4LFA K;  1RDU A;  2WTU A;  3BUZ B;  2JGU A;  1Z25 A;  3P5J A;  4CHN A;  2JWK A;  1NKB A;  2VG6 A;  1P8Z A;  1WNS A;  2ZWH A;  3BGR A;  4LC9 B;  2YNG A;  4BR0 A;  4NXM K;  4X62 K;  1S72 N;  3KHY A;  3AA3 A;  3V4I A;  1NK8 A;  3D6R A;  4EP5 A;  4N41 A;  3LAM A;  4YOY A;  3EEQ A;  5AZJ B;  4DSI A;  1HR0 K;  2P51 A;  3LZI A;  3OBY A;  3CQY A;  4KO0 A;  4O44 A;  5A2Q O;  5HRN A;  1KVB A;  3HPG A;  1TV6 A;  1BIZ A;  3EE8 A;  3VEY A;  4W5R A;  3KK3 A;  3NHG A;  4DTR A;  3AVB A;  1TKX A;  3L2W A;  4DG1 A;  3AAR A;  5AQM A;  2CGL A;  3QBW A;  4W5O A;  3ZSQ A;  2QWM A;  3THY A;  4CZG A;  3M8S A;  3FFK B;  3ZSV A;  3U9Z A;  4B1V A;  4FL9 A;  1GLF O;  4JKB A;  4JKC A;  1ZC6 A;  3CQX A;  3UB5 A;  1X1P A;  3FGU A;  4CIG A;  4A2A A;  1W2B M;  2BDP A;  2WC9 A;  1NKE A;  3VQ4 A;  2W41 A;  3JYT A;  3CM6 A;  5AQH A;  2HHV A;  3E1Y A;  3WNF A;  2ETJ A;  4AM7 A;  3VQC A;  5EOY A;  4I6M A;  4E1M A;  3LDQ A;  3LDP A;  4JRQ A;  1IJJ A;  1NNE A;  2XY8 A;  3VGM A;  2H3G X;  4O55 A;  2KKZ A;  4BGA A;  5JVH L;  1ZBF A;  4KH4 A;  2E6M A;  3K5N A;  5CY4 A;  4BRF A;  4FYD A;  3CCL N;  3HJF A;  5AZJ A;  3HPO A;  5HBM A;  3VEO A;  3MAQ A;  4BR5 A;  2BE2 A;  3V9X A;  1N34 K;  1ZYQ A;  3ZX0 A;  3I8B A;  3OS1 A;  5FLX O;  1XHZ A;  2O8B B;  5CR4 A;  3IDH A;  4MFB A;  4GMJ B;  4IG3 A;  4M41 A;  4Y0W A;  4BE0 A;  1L5U A;  4WYB A;  3NF8 A;  2E8A A;  2NRW A;  4WE1 A;  5AJ3 K;  4FM1 A;  1S5J A;  1EWR A;  4N76 A;  1ZXO A;  4DU1 A;  3LPT A;  3VQ9 A;  1B9F A;  4DUY K;  1BI4 A;  3VGL A;  4ISG A;  5DM7 L;  1U47 A;  4DTU A;  1NK6 A;  3NH0 A;  3QNO A;  2UYT A;  3VQQ A;  1HKG A;  2ATQ A;  4BRE A;  3ULE B;  3M8R A;  4A5A A;  3J80 O;  4OGC A;  4FM0 A;  2P9K A;  1NJX A;  4JI3 K;  3V6D A;  1QQO A;  3GDQ A;  4H0X B;  1S9E A;  1BUP A;  4X64 K;  1SV5 A;  4K42 A;  4YOX A;  1NJI O;  4FXD A;  1VSL A;  2KFZ A;  2Z1G A;  4HCC A;  4BR7 A;  2IIR A;  1SKW A;  1T44 A;  1K8K B;  5HRR A;  4QS7 A;  3IS9 A;  3WNE A;  1HJR A;  3H1Q A;  5M1O A;  4HUE A;  3M3Z A;  2RPI A;  2IAJ A;  4B1U B;  5JLF A;  3F73 A;  5AR0 A;  4ISE A;  3VER A;  5BN8 A;  5J2P A;  1J54 A;  1W0H A;  5AQR A;  2IC3 A;  2I5J A;  3TTC A;  4V19 S;  1B92 A;  4JLH A;  5I9E B;  1KC8 O;  1XC3 A;  3NF7 A;  3AVM A;  4ID5 A;  3SMS A;  5ELZ A;  2RE2 A;  3RRG A;  3CPW M;  1NGE A;  4DKW A;  4B9U A;  3LAN A;  4PKG A;  1XMQ K;  2O8B A;  3SPZ A;  1RBU A;  2HF4 A;  1TKT A;  3UKU B;  3MN5 A;  5KPT A;  1LV5 A;  4FWO A;  3ZT4 A;  4JS4 A;  3U3Y A;  3UIQ A;  4OGE A;  1IG8 A;  1VQN N;  2NRX A;  4A62 A;  3CMA N;  4IKF A;  4A2B A;  1SAZ A;  1UOC A;  2KLA A;  4AHV A;  2QTD A;  4JV5 K;  4CZK A;  1KCF A;  1C0F A;  1VSH A;  4NLC A;  3VPZ A;  3DLL L;  4X65 K;  1MWK A;  3AO4 A;  4GVE A;  2DFH A;  1E4G T;  4CGJ A;  3BZK A;  4ZHR A;  4LF8 K;  2WON A;  4BAC A;  1Q82 O;  2FSN A;  2D0O A;  2Q0U A;  3H08 A;  4G1Q A;  3MXI A;  3PX6 A;  4JI6 K;  3MXJ A;  2KHO A;  4DLG A;  1RFQ A;  4FVM A;  3O9S A;  4FLW A;  1IG9 A;  1NMD A;  5EU7 A;  3HBT A;  3EZ5 A;  1IKY A;  4IFE A;  4BWJ A;  4CHQ A;  2Z1H A;  5ADX H;  3MCP A;  1OH5 A;  5AQS A;  2YJF A;  4DR2 K;  1BOT O;  4B3M K;  2EX3 A;  3EN9 A;  5J2M A;  1JCE A;  1SQK A;  1FJG K;  3MXM A;  4E1N A;  4B3R K;  2ZM6 K;  5KQD A;  5TKW A;  3V9W A;  4AF1 A;  2P9U A;  4PY5 A;  1NK5 A;  2WBN A;  3E66 A;  3UKU A;  1QSS A;  4ILG B;  1WSH A;  3G6E N;  4CZH A;  1HUX A;  5HL7 L;  4GV9 A;  3CM5 A;  3IMX A;  3OYH A;  4Z4F A;  3WUH A;  3ZT1 A;  2ZJR L;  3OVN A;  4CGG A;  5TKY A;  1RTJ A;  3HI0 A;  1QTM A;  1NBW A;  1XHX A;  3HRG A;  4KHN A;  1CLQ A;  2HND A;  3SV4 A;  2PYJ A;  2ZE2 A;  3D7E O;  3RRH A;  3MEE A;  1DTQ A;  3L3V A;  1MDU B;  4HVJ A;  3ATU A;  3VEX A;  4E7H A;  3MEG A;  2QWQ A;  4H0T B;  3ZSX A;  1HYV A;  5BPM A;  3ENB A;  4PKH A;  4I9Q A;  4YOW A;  5J2Q A;  4NLB A;  3SI6 A;  2E1Y A;  1KAY A;  1O13 A;  4BRL A;  3TTD A;  1RBT A;  2D0C A;  2D0A A;  3G4S N;  4RW4 A;  3CPE A;  4HUF A;  2D0P A;  1I94 K;  4DWI A;  3GBT A;  3P4I A;  4AHS A;  3OYD A;  4FJJ A;  1JLG A;  2UXC K;  3A0I X;  4YHH K;  4OPK A;  4M63 C;  3AGK A;  1HKB A;  3AO1 A;  1HNX K;  1TK0 A;  2WFB A;  3WT0 A;  4CEZ A;  2PZS A;  3HK2 A;  2I7N A;  4PQU A;  4JI8 K;  4LFC K;  4RCH A;  2XY5 A;  3RMA A;  1RIL A;  2GV9 A;  4IJN A;  4ELT A;  3ZX2 A;  2YKN A;  2P9I A;  2YNF A;  3CFP A;  4DSJ A;  3HPH A;  4XIU A;  4CW7 B;  2GTD A;  1RBS A;  1VSK A;  1LAV A;  4RW7 A;  2IVN A;  3C94 A;  1HJO A;  3QB0 A;  4DTN A;  2PAV A;  3THX B;  4JS5 A;  1FKP A;  4A59 A;  4YOR A;  3O1W A;  2PFU A;  1VSJ A;  3I8D A;  1U49 A;  3D2F B;  3VQ7 A;  1S6P A;  5FDL A;  3NBP A;  3KLE A;  1QQM A;  3DXM B;  4DQI A;  1IBK K;  4CF8 A;  2YNH A;  5BRF A;  5C0Y A;  3C6T A;  3LP2 A;  3ALY A;  2B5J A;  4Z4E A;  3PY8 A;  1LAW A;  5ADX A;  2OPP A;  5KGW A;  3CF5 L;  1RT4 A;  3NH1 A;  4CEA A;  2ZGZ A;  4DSL A;  2QKB A;  5KQ8 A;  1S6Q A;  5B8H A;  3J7A P;  1DT9 A;  1EXQ A;  3MMV A;  4C1N I;  4CFB A;  1BDG A;  4HTU A;  1Q9X A;  5KPR A;  2W6K A;  3O3H A;  2XO7 A;  5SWM A;  4FJX A;  3WNG A;  4CF2 A;  3A5O C;  3CJA A;  4GKJ K;  2QWN A;  4IG0 A;  4BRD A;  1EWQ A;  1U45 A;  1V4S A;  2P1J A;  3NF6 A;  3U9D A;  4M3Y A;  4QAG A;  5JLH A;  2OA8 A;  3LDL A;  4WQ5 C;  1XNQ K;  3TAP A;  2D5R A;  5M1P A;  4R79 A;  2G8W A;  3F2K A;  5KI6 A;  1ESV A;  3ENO A;  1NK4 A;  2V51 B;  2ZJQ L;  4DV7 K;  1JLB A;  1QQN A;  1DKG D;  1S1T A;  3MN6 A;  2O8E B;  3SUN A;  1VHX A;  1RDD A;  2KZM A;  1VQ5 N;  4IFV A;  5C42 A;  5KGX A;  3DLG A;  4CZE A;  2F9W A;  3P38 A;  4ICL A;  4YNQ A;  3ID6 A;  3HO1 A;  4CFD A;  5GAE P;  4FW2 A;  1MU2 A;  1U4B A;  1HPM A;  3ZSZ A;  1GLJ O;  5BRD A;  1T3V A;  4MLE A;  4H5V A;  4JK8 A;  1VQ6 N;  4CI6 A;  1FK9 A;  1IO2 A;  4DTP A;  4FWQ A;  5AQT A;  2P9S A;  1OH7 A;  3HP9 A;  4BRM A;  4A57 A;  3O4Q A;  4Z4G A;  2YNI A;  5FPE A;  1S1U A;  2A1R A;  4JI0 K;  4XEI A;  4BWM A;  3CYM A;  2Q1N A;  3MN7 A;  4Z94 A;  1ATR A;  3QIO A;  4DUZ K;  1RDB A;  3OYM A;  3NMU A;  1NJZ A;  1KQS M;  3O5B A;  3PX0 A;  3HSC A;  5KRS A;  5C2D A;  4CJP A;  1JXE A;  4AIL C;  3KKR A;  2RN2 A;  3QIC A;  5EVZ A;  1K8A O;  2D0B A;  5C12 A;  3OYG A;  3ZEU A;  3F9K A;  1HRH A;  4MLH A;  4JKE A;  1JJ2 M;  3RMD A;  3KJV A;  3CER A;  1HNI A;  2HHT A;  3HM9 A;  3VQE A;  3ASM A;  4FJG A;  2HHS A;  3SZ2 A;  4HHT A;  4H5W A;  1P90 A;  4B3S K;  3VF2 A;  4BC2 A;  1YAG A;  5BN9 A;  1T03 A;  3ZCM A;  2NLX A;  4PHT X;  1NK7 A;  4CEO A;  3E9O A;  2FXU A;  4W5N A;  1SKS A;  4GW6 A;  1WOQ A;  2FBX A;  1I39 A;  1TYQ A;  4CVN E;  3D2E B;  4M7Y A;  4XH1 A;  5M1Q A;  4BG8 A;  1YVN A;  1S1V A;  3DOK A;  4DTJ A;  2E1Z A;  4CJF A;  2UUB K;  1KRP A;  1KVC A;  4DR6 K;  1WBD A;  2VYP A;  4X66 K;  1LWE A;  4PUO A;  1DTT A;  3KLI A;  4I6M B;  3JS6 A;  4KI4 A;  1QHT A;  1TAQ A;  3AVG A;  3ZSO A;  1BCM A;  2YX6 A;  2PBD A;  1SS6 A;  4IWV A;  2W42 A;  1NJY A;  1Z05 A;  4PWD A;  1YT3 A;  3WXM B;  1HQE A;  4BRA A;  3CME N;  3BDP A;  4FLT A;  5AQG A;  3MWT A;  3SUQ A;  2XY7 A;  4C8O A;  2QXL A;  1KXP A;  3QET A;  1L3U A;  2E88 A;  2HHH K;  3TAB A;  2HOE A;  1X3N A;  2QK9 A;  1F21 A;  4CIE A;  3AA5 X;  3WNH A;  5LMN K;  3DRP A;  3DWL A;  3BF3 A;  4EZ6 A;  3QFP A;  4FLY A;  2F4V K;  4CCH A;  1XWL A;  3TAM A;  3VEN A;  1BA1 A;  4ZTF A;  1BI4 B;  4JI7 K;  1WSJ A;  3LP3 A;  4FJ9 A;  4BC4 A;  4FJ7 A;  2VWJ A;  3O9T A;  5C10 A;  4KB1 A;  4OLA A;  4IJA A;  3O4N A;  2P5G A;  1CZ9 A;  3R3L A;  3HP6 A;  4JHD B;  2P9K B;  5GAD P;  3D2E A;  4BC5 A;  3S3M A;  3ZSW A;  1GLL O;  1NGA A;  3OTO K;  2HMP A;  1UWB A;  4BC3 A;  3CET A;  3G0Z A;  1NJW A;  1N5Y A;  4CZJ A;  3FZK A;  2OPS A;  3RTV A;  4EZ9 A;  3HL8 A;  2QWP A;  3DLK A;  3C65 A;  3OYF A;  3KLG A;  1X9S A;  4C8L A;  3CCU N;  3VQA A;  4DLE A;  1IKX A;  4DHY A;  4FK0 A;  1XUP O;  2P9N A;  5KTQ A;  4FM2 A;  3BZC A;  3T7Z A;  2DTU A;  1HKC A;  4CK2 A;  2NUB A;  1WB9 A;  2PYL A;  2O4G A;  5JMV A;  1NGG A;  5H1S Q;  2QWL A;  4E7K A;  4JI5 K;  2E2Q A;  2FBY A;  1EX4 A;  3DM2 A;  4OLB A;  2P9L A;  1XQS C;  1LWC A;  2WUS A;  4JK9 A;  3AAP A;  3O80 A;  4F2R A;  5GAG P;  2HHW A;  1SKR A;  1Q7Y O;  4CF1 A;  3AVF A;  3C6A A;  2A42 A;  2IVP A;  1U2V A;  1NGB A;  2OPR A;  3KK1 A;  3RR7 A;  1RBV A;  1FW6 A;  1ASV A;  1VQM N;  4LSN A;  4XH4 A;  3PIP L;  4K41 A;  4E1J A;  4C8K A;  4CZF A;  3TAG A;  4JKG B;  5HRS A;  2A41 A;  5E84 A;  1LWF A;  4EAH D;  5AQN A;  4DFK A;  4OKJ A;  5AQU A;  3L6Q A;  5EY4 A;  3D0P A;  3MED A;  3ZYY X;  4ELU A;  2CGK A;  3TSP A;  3O1B A;  3C95 A;  3VQ8 A;  5M1K A;  4KTW A;  1YJW N;  1D5A A;  3A5M C;  2ZD1 A;  3SAG A;  1NK0 A;  1QSY A;  1NGH A;  3DJC A;  4JHD A;  4BVP A;  5HLF A;  3CJ9 A;  4M3X A;  3SJH A;  2A6A A;  4M7X A;  3ULD A;  4DQ8 A;  3OS2 A;  3ID8 A;  5CYM A;  1SUQ A;  1ITG A;  3M8Q A;  5AQL A;  3I56 N;  3EO3 A;  1WUA A;  4ILH A;  4KHS A;  5BRE A;  3P31 A;  4WFB L;  1NGI A;  3S41 A;  3JXU A;  3G25 A;  2IVO A;  4OVL A;  5BPN A;  4WQ4 C;  1VSI A;  3L0Q A;  1TK5 A;  1Q8I A;  3U6F A;  4N5S A;  1RT1 A;  5AQW A;  4BR9 A;  4DQP A;  3C0B A;  3LDN A;  4OPH A;  1BA0 A;  3EE9 A;  4PL8 A;  1L3V A;  1WN7 A;  2FSK A;  4KH5 A;  1VQ9 N;  1TVR A;  2P9U B;  4IDK A;  1BQN A;  2UXD K;  3NGI A;  2A1S A;  1CXU A;  3VQP A;  5MLC Q;  1IKW A;  4JKG A;  4E7L A;  1Z6R A;  3EKU A;  5AFU H;  3VQ6 A;  3MEC A;  5LMU K;  4O4G A;  3VES A;  3TAE A;  3L2R A;  2HMI A;  3FFI A;  4FPB A;  2YV0 X;  5HP1 A;  1YTA A;  3QEW A;  2KZZ A;  2BH1 A;  1XI1 A;  1ZBU A;  4QS8 A;  4B1Z A;  3PLA A;  3SK3 A;  3P83 D;  4FJN A;  4BRC A;  1TKD A;  3N4P A;  1ATN A;  4YDU C;  1O1W A;  1LCU A;  4FK2 A;  2IDO A;  4IOA L;  1RT6 A;  3G71 N;  3J7Y P;  1N8R O;  4FJ5 A;  2BTF A;  2YHY A;  4B9T A;  1X3M A;  4R5P A;  3NAE A;  3K2P A;  4Z4H A;  2DFE A;  3UE5 A;  4CEQ A;  3A2F A;  4O8K A;  3GE1 A;  3F9M A;  5F1X A;  1GOB A;  3DOL A;  1TGO A;  3E01 A;  3CJC A;  1C0G A;  2VG7 A;  1HPZ A;  4BE2 A;  3CC7 N;  4FJL A;  1TL1 A;  5CHI A;  2Q3S A;  5FPM A;  4KPY A;  2YHA A;  3LDO A;  3V1O A;  1ASW A;  4RW8 A;  4KRF A;  3OW2 M;  4FJK A;  4LF6 K;  2FF6 A;  4NCG A;  4FSV A;  3SBG A;  1VSM A;  1E4F T;  2BGG A;  4E3S A;  3DAW A;  3L8B A;  2P9I B;  3HOS A;  3DLR A;  3AAQ A;  4BDP A;  4FPA A;  2NRZ A;  3QEV A;  4Q5V A;  2CGJ A;  4K43 A;  4KB0 A;  5E41 A;  3OY9 A;  2QWO A;  4G9Z A;  4U7B A;  4DSF A;  2J4R A;  1J5O A;  3ZSR A;  4CJ3 A;  3I55 N;  4CHO A;  2WOM A;  1E3M A;  4CEE A;  3T1H K;  2HBK A;  3JAM O;  5HRP A;  1JLC A;  4PL7 A;  5LJV A;  2PY5 A;  3L3U A;  3CCR N;  3MX5 A;  3LAK A;  3H46 O;  3Q7C A;  3K9J A;  1BHL A;  3QEP A;  4DFM A;  4DU4 A;  2LSN A;  5AQP A;  4CJ5 A;  2GWJ A;  1QVG M;  3SQ2 A;  3NGZ A;  2KFN A;  3MN9 A;  1S1W A;  2X74 A;  1C1B A;  2HF3 A;  3HST B;  3VOV A;  4JD2 A;  1C0M A;  1YIJ N;  5FPD A;  2X6N A;  3SJJ A;  2OZS A;  4CER A;  3QNN A;  4B8A B;  4BRQ A;  3SQ4 A;  1RBR A;  1BIU A;  4BRI A;  3WXK A;  3NCI A;  3TAQ A;  4KHW A;  3IAY A;  1TAU A;  4FJM A;  1M90 O;  4IZ9 A;  2V52 B;  4CHP A;  2QEX N;  2Z1I A;  4RW6 A;  3O3G A;  2IOC A;  4CGH A;  4C8M A;  1U6Z A;  4DSK A;  4F4K A;  3TWH A;  3HVR A;  1VAZ A;  3I0R A;  3I33 A;  4EP4 A;  1UA1 A;  4BDY A;  1TUY A;  4DQQ A;  1J6Z A;  5AFU A;  5FRO A;  1IKV A;  3CJ7 A;  1M1K O;  3AA2 A;  3LZJ A;  4OKE A;  2XHB A;  1KLM A;  3M6G A;  1JLA A;  3TPQ A;  4DTM A;  3QBX A;  4YOV A;  3IG1 A;  1CXQ A;  1A5W A;  3KK2 A;  2F8S A;  3SNN A;  1JKH A;  4KHP K;  3EY1 A;  1RT5 A;  2RF2 A;  2VG5 A;  4FOI A;  4LSL A;  4OO1 J;  3HZ6 A;  5AQI A;  4B9N A;  2FLO A;  3VQD A;  3O6W A;  3HTV A;  5AQZ A;  4DV1 K;  1KSP A;  2HST A;  2E6L A;  1ASU A;  3LDS A;  3B6P A;  4QOZ B;  4B3T K;  3PUF A;  1VQP N;  3KLH A;  2HNY A;  3WXJ A;  3T1A A;  1HQU A;  4CHY A;  4OJR A;  3VQB A;  2UUC K;  1YTU A;  3IFR A;  4M3W A;  4KHU A;  2AP1 A;  3K5L A;  4H0Y B;  3CFR A;  1C0U A;  3SUO A;  4BRP A;  3OYE A;  4DU3 A;  1IBM K;  4NCB A;  1C6V A;  1J5E K;  3L2Q A;  4H5R A;  4A61 A;  2P9S B;  3KWG A;  3VN5 A;  3BEX A;  4GVM A;  4CEF A;  4LF4 K;  4O0J A;  3V9S A;  3E9L A;  2ZF5 O;  1S3X A;  3AVK A;  5CE3 A;  1R0A A;  1KFS A;  4CIF A;  4DR4 K;  4GKK K;  3ATV A;  2HB5 A;  4FLV A;  2A40 A;  4O5F A;  4I2Q A;  3CCV N;  1EET A;  4JAX A;  4M42 A;  3ZEU B;  4UY8 O;  4AHT A;  3M5R A;  4CF0 A;  4MDB A;  3QLH A;  3V9Z A;  4YY3 K;  3PIO L;  4AQY K;  2DPN A;  4M45 A;  1N32 K;  1YVU A;  4Y1D A;  2G8F A;  3O3F A;  5LJW A;  2QXF A;  2XRI A;  4F9O A;  3ZET A;  2EHG A;  4BGB A;  1K6Y A;  1RDC A;  4RW9 A;  1R59 O;  3AVA A;  3AGR A;  4DF8 A;  1GLD G;  1BIS A;  1ZBS A;  3SMP A;  2Y1I A;  3CC2 N;  4B9V A;  3TR8 A;  2ASO A;  2YHB A;  3KK7 A;  4N47 A;  3THW B;  4CJE A;  1JLQ A;  4DS4 A;  3T1Y K;  3HVT A;  3C7N A;  1TYQ B;  3BP8 A;  3W3D A;  4FO0 A;  1MWM A;  5D3G A;  4FJH A;  4FVU A;  2Q97 A;  5M1F A;  4DV3 K;  4Z0U A;  4CFC A;  3OJU A;  2HBJ A;  1KAX A;  5DM6 L;  1NKC A;  5IWA K;  4KAZ A;  3LPU A;  2QA4 N;  3FZF A;  3WXI A;  4WFN L;  3SBT A;  1S22 A;  4CJT A;  1ZBL A;  3RWU A;  5KRT A;  2NNW A;  4CBW A;  3O9R A;  4MO4 A;  5AQF A;  1NLV A;  4M3Z A;  1T6C A;  1T05 A;  3NDK A;  3NH2 A;  3EZW A;  1OVY A;  5F2R A;  4AH9 A;  2NRR A;  2IS3 A;  5GIP A;  4IFY A;  3RVC A;  4CZI A;  2DY4 A;  4EFH A;  4IEE A;  1WSG A;  2W40 A;  2X78 A;  1TL3 A;  3SAF A;  3TI0 A;  1J53 A;  2OTL N;  5M1N A;  3FLC O;  4WQ5 A;  3U8X A;  4OX9 K;  2QI2 A;  5C24 A;  4BE1 A;  4EIA A;  4DR7 K;  3QER A;  4C8N A;  4CZL A;  1JL2 A;  2F9T A;  4PA1 A;  3OA9 A;  4JI2 K;  2FBV A;  3J81 O;  4DR5 K;  5AQQ A;  2O8D B;  1RT2 A;  1DLO A;  4MO5 A;  1ZBI A;  4BVO A;  1RDA A;  2FF3 B;  1VQ7 N;  4IXC A;  4KFB A;  4CD3 A;  4NYF A;  2F8T A;  2BUP A;  1VQL N;  4BRH A;  2VWB A;  2GUP A;  2Q0R A;  1WSF A;  2P9P A;  4Q0B A;  4FWL A;  3THW A;  4QCL A;  3VEZ A;  4CED A;  3VTI A;  2D1K A;  3SYZ A;  4RG8 A;  2HVH A;  4U67 L;  3N4Q A;  5HRO A;  2E2P A;  3U3G A;  5BRH A;  3IUC A;  4FWR A;  4DF4 A;  3H6E A;  3NF9 A;  2OPQ A;  4AHR A;  1Q9Y A;  3GG4 A;  2NRV A;  1N33 K;  2KQ2 A;  3SQ0 A;  2P9N B;  1B9D A;  3A8Y A;  4RWT A;  1NMN A;  4GNI A;  1TK8 A;  1BG3 A;  3O08 A;  1UA0 A;  1L3T A;  2UXB K;  3H3N O;  2F7T A;  3TSU A;  1T6D A;  4CJL A;  3R6M A;  3QIN A;  3QEI A;  1WSI A;  3LP0 A;  2P9L B;  1HYS A;  1ZBH A;  5FPN A;  3NE6 A;  3OYJ A;  3FZL A;  3AO5 A;  2ASP A;  4MQ3 A;  1U2V B;  1Z26 A;  3OS0 A;  4FWM A;  4H0O A;  3HXM A;  5E26 A;  3SPY A;  4L3Q A;  1WAJ A;  2HHU A;  1QHA A;  3DMJ A;  4M3R A;  2E2O A;  1QE1 A;  2EWS A;  3H1V X;  1NU0 A;  4J2E A;  4WCE L;  4PKI A;  4CE9 A;  3VGK A;  3AY9 A;  2O8D A;  1ILY A;  4DQR A;  1QS4 A;  3WEE A;  4FLZ A;  4ELV A;  3SCX A;  4C1N K;  4F8R A;  4YOU A;  1GLC G;  2HW3 A;  1G99 A;  1NGC A;  3CG7 A;  3DLE A;  3CD6 N;  1QSL A;  2RHK A;  1XNR K;  3DRR A;  2JWL A;  2FC0 A;  3ITH A;  3QML A;  5KPZ A;  3VTH A;  3K59 A;  4F2S A;  4H03 B;  1HX1 A;  3OJS A;  4JNE A;  3SUP A;  4Z4C A;  4CJK A;  4RTF D;  4LF9 K;  4LF5 K;  3AVJ A;  3H3O B;  5AQK A;  5CZ1 A;  4M3T A;  5AZI B;  3UKR A;  1YI2 N;  4JEP A;  1HNV A;  1HMV A;  3AV9 A;  3O8M A;  1VSF A;  3OYL A;  3K5M A;  2HBM A;  3FZH A;  2AA4 A;  4J2A A;  1S9G A;  4DV0 K;  4CJQ A;  4JKH A;  5LL6 Z;  4B9Q A;  3C6H A;  3PO4 A;  1YJ9 N;  3K0S A;  5JS2 A;  4WFA L;  2HBL A;  4BRN A;  4CJR A;  4BRO A;  2A3Z A;  5IT9 O;  4LH4 A;  4H5T A;  1KTQ A;  3V9U A;  1BO5 O;  3VQ5 A;  4I2P A;  4IBN A;  3DI6 A;  4GV6 A;  1HNW K;  1BQM A;  4IO8 A;  2O4I A;  3B6O A;  3AO3 A;  3KD5 E;  4JK7 A;  4H8K A;  4EHU A;  5BR8 K;  1N6Q A;  2YCH A;  3K9K A;  4O0I A;  4FWK A;  5AQJ A;  1W7A A;  1FKO A;  1JLF A;  4H0V B;  3MDQ A;  3CIP A;  4JRP A;  4K8X A;  1LOT B;  3OBW A;  4CF9 A;  3THV A;  1JCG A;  3OYN A;  3I0S A;  3T19 A;  3IRX A;  3AO2 A;  3PSF A;  4KBO A;  3FE1 A;  5LY3 A;  2ZQB A;  5AQY A;  3VF4 A;  3VA3 A;  3OHR A;  1JL1 A;  1NGJ A;  3K5O A;  5AZI A;  4I7F A;  1SL2 A;  4J8F A;  3ZT3 A;  4QS9 A;  2VQF K;  1TUU A;  1VRT A;  3DLH A;  1HLU A;  2G8K A;  4IEI A;  2AJQ A;  1SL1 A;  4GY2 B;  4KHY A;  4CES A;  3O4W A;  2O8F B;  5AQX A;  4DV4 K;  4BY9 C;  4K0K K;  4O8U A;  2V7Z A;  1C1A A;  3LWM A;  1NGD A;  1U04 A;  3PSI A;  3P1G A;  5GAH P;  3J7Z O;  2Y1J A;  1QZ6 A;  3GOI A;  2ITG A;  4KTQ A;  1YHQ N;  1S1X A;  2YJE A;  5C2F A;  3SAH A;  3ZT2 A;  4IOC L;  4FZX C;  3KZB A;  3V81 A;  3P39 A;  4KTZ A;  1SL0 A;  3SLC A;  4KV8 A;  4LFB K;  4I9L A;  4DCH A;  3O9Q A;  1H1V A;  4W5T A;  4DS5 A;  1RCH A;  3C6U A;  4FWN A;  4JN4 A;  3TAF A;  4NYN A;  1WAF A;  3IKM A;  4H4M A;  1NG9 A;  4DV2 K;  3HOT A;  3WQT A;  1HNZ K;  3LP1 A;  4CK1 A;  3CCM N;  3RSE B;  4MDA A;  1VQ4 N;  4BDZ A;  4CBU A;  4F3T A;  2FBT A;  4OPA A;  2KTQ A;  2CH6 A;  4JD2 B;  5AQV A;  3ULE A;  4JKF A;  4BRG A;  5BPL A;  4WQ4 A;  3L4I A;  3PO5 A;  2G8I A;  4H4O A;  4KRE A;  3B8A X;  3KLF A;  2NZT A;  4DSE A;  4FLX A;  4CZM A;  5GIO A;  1NWK A;  4FK4 A;  2D4W A;  1CZA N;  1DEJ A;  4B3O A;  3HYF A;  1KD1 O;  4LH5 A;  4E0D A;  4C23 A;  1Y97 A;  1X9M A;  1K8K A;  4EHT A;  2O8F A;  2OTJ N;  1BU6 O;  5J1E A;  2B6A A;  2YHX A;  3W0L A;  3A5N C;  1VQO N;  1LW2 A;  2B4J A;  2OYQ A;  1EP4 A;  1GLB G;  2GBZ A;  5EX5 A;  3F5T A;  4HCB A;  3KTQ A;  4CJU A;  3L2V A;  5K14 A;  3TU5 A;  3DYA A;  1WSE A;  3KIO A;  5C15 A;  4K8Z A;  1ATS A;  4FW1 A;  3Q7B A;  3CCS N;  1QZ5 A;  3V1Q A;  3NVM A;  3V1R A;  3PX4 A;  3LM9 A;  1NOY A;  4KKO A;  3NVK A;  4JI4 K;  4CBX A;  3KWI A;  1GOA A;  3ZSY A;  3CFO A;  1FXX A;  3CHW A;  1NM1 A;  5FRM A;  3TTF A;  3OYK A;  5J2N A;  4E89 A;  3BY5 A;  4A5B A;  2GEM A;  3TSQ A;  4E19 A;  1XMO K;  1Q86 O;  4CGD A;  1DGK N;  5I42 A;  1VRU A;  1NOZ A;  1IV0 A;  4YDU A;  4CHZ A;  4NCA A;  5C25 A;  2ASM A;  5CYQ A;  4YFU A;  1GOC A;  3RSE A;  4LY7 A;  2GX9 A;  3CC4 N;  4DFP A;  3M1F A;  1MA9 B;  1Y64 A;  2O8C B;  2KW4 A;  1K9M O;  4FZY A;  2GEL A;  4UQG A;  1EQY A;  4IO9 L;  3MK6 A;  2XY6 A;  4FJ8 A;  4YOT A;  2Q2R A;  1N36 K;  2NRT A;  5AQO A;  2Q36 A;  1KAZ A;  4JKA A;  4HTL A;  4H0P A;  4GV3 A;  1JLE A;  5JIC A;  4W5Q A;  3RMB A;  3CCE N;  4ID1 A;  1JXB A;  1BGX T;  1RT3 A;  4IDH A;  2YKM A;  3ISN C;  3S9H A;  4FLU A;  2VCP A;  4J2D A;  4FZZ A;  3DLB A;  4WF9 L;  3EKS A;  4FCY A;  3QDK A;  1Q18 A;  4FWS A;  3TAN A;  2UUA K;  4NXN K;  2W6L A;  5GIN A;  3EL2 A;  4K25 A;  3RR8 A;  1WBB A;  1KLN A;  1V4T A;  1VSD A;  3NFA A;  3ZET B;  3QES A;  2DFF A;  4BG9 A;  1C1C A;  3VEV A;  2GWK A;  3O9U A;  1QQC A;  4KHQ A;  3WXL A;  2VWK A;  4FJI A;  1BL3 A;  1RTD A;  3LWL A;  4BRK A;  3ENH A;  1CZB A;  4JYA K;  3OYB A;  1OH6 A;  4IOX A;  2G8V A;  2P5O A;  3E9P A;  2O8C A;  3LL3 A;  4LF7 K;  1OKJ A;  1W97 L;  3QFU A;  3QIP A;  3OYI A;  3C7N B;  2GUI A;  3A5L C;  2BAN A;  2E4L A;  5T7B A;  4CGF A;  3K58 A;  2QWR A;  2VQE K;  4CJ7 A;  1EO1 A;  5HOO A;  2G8U A;  3WQU A;  3EYZ A;  2OAN A;  5EXW A;  2UU9 K;  5I3U A;  5JS1 A;  1GLA G;  5FRN A;  4B08 A;  2IGI A;  1TKZ A;  5CZ2 A;  3OYC A;  3MWP A;  2F96 A;  1OH8 A;  4FOE A;  4FWP A;  2HHX A;  3VEW A;  4JI1 K;  1IH7 A;  4B8C A;  3QO9 A;  5JVG L;  3U4L A;  1C0T A;  3VF6 A;  3AA4 A;  3R8E A;  4B9S A;  3L4Q A;  3AVL A;  4M3U A;  4CK3 A;  3H45 C;  4BR4 A;  1VSE A;  3VA0 A;  3AVI A;  2Z1J A;  3AVN A;  3J8A A;  4AHU A;  4ILJ A;  2HVI A;  1NGF A;  1XC9 A;  2YHW A;  2OZM A;  5F0X A;  1VK0 A;  4OPJ A;  4AHC A;  2V7Y A;  3CJB A;  4LD0 A;  2ZJP L;  1OVQ A;  1YF5 L;  4ZTJ A;  1KVA A;  4Z4I A;  3GL1 A;  4E7J A;  5DK5 A;  3S3N A;  3CCQ N;  3ZT0 A;  3T3F A;  3VET A;  4KI6 A;  4AM6 A;  4B1Y B;  3ZX3 A;  1D9D A;  3KVG A;  2ITM A;  1T8E A;  1WLJ A;  1SZ2 A;  4DMN A;  1RNH A;  3M8P A;  2E2N A;  3LAL A;  2G8H A;  3MX2 A;  3HM8 A;  2P9P B;  4H5N A;  4CJW A;  3S3O A;  2VGN A;  5SZT A;  3THX A;  1RDW X;  4F3O A;  3CCJ N;  2A5X A;  3G10 A;  1NK9 A;  1Q81 O;  3FR0 A;  4B9L A;  4E7I A;  4XH5 A;  4DR3 K;  4NB4 A;  4CEC A;  1YXQ A;  3D2F A;  1UAX A;  4KH6 A;  3T69 A;  4OKK A;  2RKI A;  3MCA B;  3SQ1 A;  3VMF B;  3DXM A;  1T7P A;  4CGI A;  4BQL A;  4ISF A;  4CFA A;  1L3S A;  1RTI A;  1KFD A;  3R9P A;  1W9H A;  1YUW A;  2I7P A;  1GLE G;  2CH5 A;  1YIT N;  3CI5 A;  3OYA A;  2NRH A;  5DMR A;  3AVH A;  4DB3 A;  2X6S A;  3DXK B;  1I3A A;  3PV8 A;  2HNZ A;  4J2B A;  1BCO A;  4DV5 K;  1REV A;  3LM2 A;  1QVF M;  4CJS A;  4O5B A;  4CD1 A;  4BQZ A;  5BR9 A;  1J9A A;  3BF1 A;  4DTO A;  3HT3 A;  1HYZ A;  4DV6 K;  1D4X A;  2FSJ A;  3ZLJ A;  3DRS A;  3R1X A; 
#chains in the Genus database with same CATH homology
 1HJO A;  3QB0 A;  4YDU C;  3O8M A;  1LCU A;  1X9J A;  1JCF A;  2PAV A;  1RGI A;  4A59 A;  4YOR A;  4IOA L;  3O1W A;  2PFU A;  3G71 N;  2HBM A;  3FZH A;  2AA4 A;  1N8R O;  2BTF A;  2YHY A;  1X3M A;  3WEE B;  4JKH A;  2YI1 A;  3D2F B;  3UE5 A;  4B9Q A;  3C6H A;  4O8K A;  3GE1 A;  4NO7 A;  4B1W B;  1YJ9 N;  3F9M A;  5F1X A;  1BWF O;  1QQM A;  3DXM B;  3CJC A;  2HBL A;  1C0G A;  3FZM A;  4BRN A;  4WFA L;  3CC7 N;  2QW9 A;  5CHI A;  4BRO A;  4BR2 A;  1VQK N;  2A3Z A;  1YJN N;  5BRF A;  3CXC M;  5FPM A;  4H5T A;  5C0Y A;  4JKD A;  2QM1 A;  3LDO A;  2Q31 A;  1BO5 O;  2VGM A;  3OW2 M;  4GV6 A;  2FF6 A;  4HWI A;  4IO8 A;  5ADX A;  4FSV A;  3CF5 L;  3SBG A;  1E4F T;  1K73 O;  4JK7 A;  1VQ8 N;  4EHU A;  3DAW A;  2P9I B;  3HOS A;  3AAQ A;  2YCH A;  2ZGZ A;  3K9K A;  2NRZ A;  4FPA A;  4FWK A;  2E20 A;  2CGJ A;  5KQ8 A;  4K43 A;  5AQJ A;  5B8H A;  1DT9 A;  3MMV A;  4C1N I;  2ZGY A;  2QWO A;  1K8A O;  4G9Z A;  4U7B A;  1BDG A;  4H0V B;  3MDQ A;  3CIP A;  2J4R A;  3UKR B;  1LOT B;  4B1X B;  3I55 N;  3DXK A;  3OBW A;  5KPR A;  3CJ1 A;  1JCG A;  1RDU A;  2HBK A;  3A5O C;  3CJA A;  4KBO A;  4PL7 A;  5LJV A;  3FE1 A;  5LY3 A;  2QWN A;  3BUZ B;  5AQY A;  3VF4 A;  3CCR N;  3MX5 A;  3H46 O;  3Q7C A;  2JWK A;  4BRD A;  3OHR A;  3K9J A;  1NGJ A;  5AZI A;  4J8F A;  1P8Z A;  4QS9 A;  1V4S A;  2ZWH A;  4LC9 B;  3U9D A;  1TUU A;  5JLH A;  3LDL A;  4WQ5 C;  1HLU A;  5AQP A;  5M1P A;  4R79 A;  4BR0 A;  2GWJ A;  3F2K A;  4IEI A;  1S72 N;  1ESV A;  1QVG M;  3ENO A;  3KHY A;  3MN9 A;  2V51 B;  4GY2 B;  3D6R A;  2HF3 A;  2ZJQ L;  1QQN A;  3O4W A;  3VOV A;  5AQX A;  4JD2 A;  1DKG D;  4YOY A;  4BY9 C;  5AZJ B;  1YIJ N;  4O8U A;  5FPD A;  3MN6 A;  2V7Z A;  1NGD A;  3OBY A;  3J7Z O;  5GAH P;  1QZ6 A;  3CQY A;  3GOI A;  4BRQ A;  1VQ5 N;  3EE8 A;  3VEY A;  4BRI A;  3WXK A;  4CZE A;  2F9W A;  3P38 A;  1YHQ N;  3ID6 A;  5GAE P;  3AAR A;  1M90 O;  4IZ9 A;  1HPM A;  2YJE A;  5AQM A;  2V52 B;  2CGL A;  3QBW A;  1GLJ O;  2QEX N;  5C2F A;  5BRD A;  1T3V A;  3SAH A;  2QWM A;  4MLE A;  4H5V A;  1U6Z A;  4IOC L;  4JK8 A;  1VQ6 N;  4CI6 A;  3KZB A;  4CZG A;  3P39 A;  4FWQ A;  5AQT A;  2P9S A;  3SLC A;  3FFK B;  1VAZ A;  4B1V A;  3U9Z A;  3I33 A;  1TUY A;  4FL9 A;  1J6Z A;  1GLF O;  4DCH A;  5AFU A;  4JKB A;  3CJ7 A;  1ZC6 A;  3O9Q A;  4JKC A;  4A57 A;  4BRM A;  1H1V A;  3CQX A;  1M1K O;  5FPE A;  4FWN A;  3UB5 A;  3FGU A;  4JN4 A;  3M6G A;  3IKM A;  4A2A A;  1W2B M;  4XEI A;  3HOT A;  2WC9 A;  3WQT A;  3TPQ A;  3QBX A;  4YOV A;  2W41 A;  2Q1N A;  3MN7 A;  4Z94 A;  3CCM N;  3RSE B;  1ATR A;  4MDA A;  1VQ4 N;  3NMU A;  4FOI A;  3O5B A;  5AQH A;  4CBU A;  1KQS M;  3HSC A;  4OO1 J;  3HZ6 A;  5AQI A;  5C2D A;  2FLO A;  3E1Y A;  4OPA A;  3O6W A;  4AM7 A;  3QIC A;  2CH6 A;  3HTV A;  5EVZ A;  4JD2 B;  5AQV A;  5AQZ A;  4JKF A;  3ULE A;  4BRG A;  2HST A;  3L4I A;  4WQ4 A;  5EOY A;  3ZEU A;  5BPL A;  5C12 A;  3B8A X;  4I6M A;  3LDQ A;  4MLH A;  3LDP A;  4JKE A;  1IJJ A;  1JJ2 M;  3CER A;  3VGM A;  1VQP N;  2H3G X;  2KKZ A;  3WXJ A;  4BGA A;  5JVH L;  2NZT A;  4CZM A;  5GIO A;  4KH4 A;  1NWK A;  3IFR A;  2D4W A;  1CZA N;  1DEJ A;  1KD1 O;  2AP1 A;  4H5W A;  1P90 A;  4C23 A;  4BRF A;  5GAD P;  3VF2 A;  1K8K A;  1YAG A;  4H0Y B;  4BC2 A;  4EHT A;  3CCL N;  5BN9 A;  2OTJ N;  1BU6 O;  5AZJ A;  4BRP A;  2NLX A;  3VEO A;  2YHX A;  3W0L A;  4PHT X;  4BR5 A;  3A5N C;  1VQO N;  3ZX0 A;  3I8B A;  1GLB G;  4H5R A;  4A61 A;  5EX5 A;  3F5T A;  5CR4 A;  3IDH A;  2P9S B;  4Y0W A;  3KWG A;  3E9O A;  2FXU A;  3TU5 A;  3BEX A;  5C15 A;  4WYB A;  1ATS A;  1WOQ A;  2E8A A;  2NRW A;  3Q7B A;  1QZ5 A;  3CCS N;  3NVM A;  3LM9 A;  1TYQ A;  2ZF5 O;  3D2E B;  3E9L A;  4M7Y A;  1S3X A;  4XH1 A;  1ZXO A;  3NVK A;  5CE3 A;  5M1Q A;  4CBX A;  3KWI A;  4BG8 A;  1YVN A;  3CHW A;  1NM1 A;  3VGL A;  4ISG A;  3TTF A;  5DM7 L;  3ATV A;  2E1Z A;  2A40 A;  4A5B A;  2GEM A;  3TSQ A;  2UYT A;  1HKG A;  4O5F A;  2VYP A;  1Q86 O;  4BRE A;  3ULE B;  3CCV N;  1DGK N;  4A5A A;  4JAX A;  3ZEU B;  4UY8 O;  2P9K A;  3M5R A;  4I6M B;  3JS6 A;  4MDB A;  4YDU A;  1QQO A;  3PIO L;  3GDQ A;  4H0X B;  2DPN A;  1BUP A;  2YX6 A;  2ASM A;  2PBD A;  1SS6 A;  4IWV A;  4K42 A;  4YOX A;  3RSE A;  2GX9 A;  3CC4 N;  1Z05 A;  3M1F A;  1MA9 B;  5LJW A;  1Y64 A;  1NJI O;  4F9O A;  3ZET A;  3WXM B;  4BGB A;  4BRA A;  3CME N;  4BR7 A;  2IIR A;  1R59 O;  1T44 A;  1K8K B;  3AGR A;  1K9M O;  5AQG A;  3MWT A;  4QS7 A;  1GLD G;  2GEL A;  3H1Q A;  1EQY A;  5M1O A;  4IO9 L;  3M3Z A;  2QXL A;  3MK6 A;  1KXP A;  4B1U B;  1ZBS A;  4YOT A;  5JLF A;  2Q2R A;  2E88 A;  5AR0 A;  3SMP A;  4ISE A;  3VER A;  2NRT A;  5AQO A;  5BN8 A;  2Q36 A;  1KAZ A;  4JKA A;  5AQR A;  4HTL A;  3TTC A;  2HOE A;  3CC2 N;  1X3N A;  2ASO A;  3KK7 A;  4H0P A;  5I9E B;  1KC8 O;  4GV3 A;  1XC3 A;  3DWL A;  5JIC A;  3BF3 A;  3CCE N;  3C7N A;  1TYQ B;  3QFP A;  3BP8 A;  3SMS A;  4IDH A;  5ELZ A;  3W3D A;  2RE2 A;  4FO0 A;  1MWM A;  3CPW M;  3VEN A;  1BA1 A;  1NGE A;  4FVU A;  4DKW A;  2Q97 A;  5M1F A;  2VCP A;  4PKG A;  4BC4 A;  2HBJ A;  1KAX A;  3O9T A;  5C10 A;  5DM6 L;  2HF4 A;  4IJA A;  4WF9 L;  3EKS A;  2QA4 N;  3FZF A;  3WXI A;  3QDK A;  1Q18 A;  4FWS A;  3UKU B;  3SBT A;  1S22 A;  4WFN L;  3R3L A;  3MN5 A;  2NNW A;  4CBW A;  5KPT A;  3O9R A;  2P9K B;  4JHD B;  4MO4 A;  1NLV A;  3D2E A;  1T6C A;  5AQF A;  3EL2 A;  4FWO A;  4K25 A;  4BC5 A;  1NGA A;  1GLL O;  2HMP A;  4BC3 A;  3EZW A;  3CET A;  1V4T A;  1IG8 A;  1OVY A;  2NRX A;  3FZK A;  5F2R A;  4CZJ A;  1VQN N;  2QWP A;  4A62 A;  3CMA N;  3C65 A;  2NRR A;  4A2B A;  5GIP A;  1SAZ A;  3ZET B;  3RVC A;  4CZI A;  2KLA A;  3CCU N;  4DHY A;  4EFH A;  1XUP O;  2P9N A;  2QTD A;  4IEE A;  3VEV A;  2GWK A;  2W40 A;  4BG9 A;  4CZK A;  1C0F A;  3SAF A;  4NLC A;  3T7Z A;  1HKC A;  3VPZ A;  3O9U A;  3DLL L;  1MWK A;  5M1N A;  2OTL N;  3FLC O;  3WXL A;  5JMV A;  1NGG A;  4WQ5 A;  5H1S Q;  4GVE A;  3U8X A;  1E4G T;  4BRK A;  2QI2 A;  2QWL A;  3ENH A;  4EIA A;  4CZL A;  4IOX A;  2E2Q A;  2F9T A;  1Q82 O;  2FSN A;  3E9P A;  2D0O A;  2P9L A;  2Q0U A;  3LL3 A;  1XQS C;  1OKJ A;  1W97 L;  3OA9 A;  2WUS A;  4JK9 A;  3AAP A;  3QFU A;  3O80 A;  3C7N B;  3A5L C;  5GAG P;  5AQQ A;  2KHO A;  1RFQ A;  4MO5 A;  4BVO A;  3O9S A;  1Q7Y O;  2FF3 B;  1VQ7 N;  2QWR A;  3C6A A;  4IXC A;  2A42 A;  2IVP A;  4CJ7 A;  1U2V A;  1NGB A;  1NMD A;  4CD3 A;  1EO1 A;  5HOO A;  2BUP A;  3HBT A;  1VQL N;  4BRH A;  3WQU A;  2VWB A;  2GUP A;  2OAN A;  5EXW A;  2Q0R A;  4IFE A;  2P9P A;  4FWL A;  1VQM N;  1GLA G;  4XH4 A;  3VEZ A;  3PIP L;  5ADX H;  3VTI A;  3MWP A;  3MCP A;  4K41 A;  4FOE A;  5AQS A;  2D1K A;  4FWP A;  2YJF A;  4E1J A;  4CZF A;  3VEW A;  1BOT O;  4U67 L;  4JKG B;  3N4Q A;  2A41 A;  2E2P A;  3EN9 A;  5E84 A;  5BRH A;  3IUC A;  4EAH D;  4FWR A;  5AQN A;  5AQU A;  5JVG L;  3U4L A;  1JCE A;  1SQK A;  3H6E A;  3L6Q A;  3VF6 A;  5EY4 A;  3R8E A;  3ZYY X;  3L4Q A;  5KQD A;  5TKW A;  3GG4 A;  2CGK A;  2NRV A;  3TSP A;  4AF1 A;  3O1B A;  2P9U A;  5M1K A;  1YJW N;  2P9N B;  3H45 C;  4BR4 A;  2WBN A;  3A5M C;  3J8A A;  3E66 A;  3UKU A;  3A8Y A;  4ILJ A;  3SAG A;  4ILG B;  4GNI A;  1NGF A;  4RWT A;  2YHW A;  1NGH A;  3G6E N;  3DJC A;  4JHD A;  4BVP A;  5F0X A;  3CJ9 A;  1BG3 A;  3SJH A;  3O08 A;  4CZH A;  2A6A A;  4M7X A;  2V7Y A;  3CJB A;  4DQ8 A;  3ID8 A;  1HUX A;  5HL7 L;  4GV9 A;  2ZJP L;  3H3N O;  2F7T A;  3TSU A;  1T6D A;  1YF5 L;  3IMX A;  5AQL A;  3I56 N;  3R6M A;  3EO3 A;  1WUA A;  3WUH A;  2ZJR L;  3GL1 A;  2P9L B;  4ILH A;  5TKY A;  3CCQ N;  3HI0 A;  1NBW A;  3HRG A;  3VET A;  5BRE A;  5FPN A;  3P31 A;  4AM6 A;  4B1Y B;  3ZX3 A;  4WFB L;  3KVG A;  1NGI A;  3FZL A;  3D7E O;  2ITM A;  3S41 A;  3JXU A;  2ASP A;  3G25 A;  1SZ2 A;  1U2V B;  2IVO A;  5BPN A;  4FWM A;  1MDU B;  2E2N A;  4H0O A;  3ATU A;  4WQ4 C;  5E26 A;  3VEX A;  2QWQ A;  3MX2 A;  4H0T B;  4L3Q A;  5BPM A;  1QHA A;  3ENB A;  2P9P B;  3HM8 A;  4H5N A;  4PKH A;  3L0Q A;  2E2O A;  4YOW A;  2VGN A;  2EWS A;  4NLB A;  2E1Y A;  3H1V X;  1KAY A;  1O13 A;  4BRL A;  3TTD A;  1RDW X;  4WCE L;  4PKI A;  2A5X A;  5AQW A;  4BR9 A;  3CCJ N;  3VGK A;  3G4S N;  3AY9 A;  3CPE A;  1Q81 O;  3C0B A;  3FR0 A;  2D0P A;  1ILY A;  4XH5 A;  4NB4 A;  3LDN A;  4OPH A;  3GBT A;  3P4I A;  1BA0 A;  3EE9 A;  3WEE A;  4C1N K;  1YXQ A;  3D2F A;  4KH6 A;  4PL8 A;  3T69 A;  2FSK A;  3A0I X;  4YOU A;  4M63 C;  4KH5 A;  3AGK A;  3MCA B;  1GLC G;  3VMF B;  1VQ9 N;  1HKB A;  2P9U B;  3DXM A;  1G99 A;  1NGC A;  4BQL A;  3CD6 N;  4ISF A;  2RHK A;  2WFB A;  3R9P A;  2JWL A;  3WT0 A;  1YUW A;  2I7P A;  1GLE G;  5MLC Q;  2CH5 A;  2I7N A;  3QML A;  4JKG A;  1Z6R A;  5KPZ A;  3VTH A;  1YIT N;  3CI5 A;  4H03 B;  1HX1 A;  2NRH A;  5GIN A;  3EKU A;  4RCH A;  5AFU H;  4DB3 A;  3DXK B;  4JNE A;  4IJN A;  3LM2 A;  3VES A;  1QVF M;  3ZX2 A;  2P9I A;  4RTF D;  4FPB A;  4CD1 A;  4BQZ A;  5BR9 A;  3H3O B;  2BH1 A;  3BF1 A;  5AQK A;  5AZI B;  4QS8 A;  4B1Z A;  1D4X A;  2FSJ A;  3UKR A;  2GTD A;  3SK3 A;  4JEP A;  1YI2 N;  3PLA A;  3R1X A;  2IVN A;  4BRC A;  3N4P A;  1ATN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...