3KLHA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to post-translocation aztmp-terminated dna (complex p)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 129
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klhA05
3AO2A 5KFNA 4Q5VA 4H4OB 1CXQA 4FM0A 4MKBA 4RW7B 2FJXA 4NLWA 4ELVA 3RMCA 3LP0B 4CGHA 4AHCA 1ZBHA 1U45A 4URSA 3PX6A 5C42B 3KLIA 4IG0A 1QTMA 5CY4A 4TLRA 2XI2A 4C8NA 4CHZA 4CK1A 4OLBA 3GQCA 3HVTB 4M41A 4FJJA 1RDBA 2D41A 2HWHA 3KLFA 1YTAA 4M3YA 2E4LA 4DL7A 4DTMA 3OYBA 2ASJA 3NBPA 1LWFB 4ZVGA 3TABA 2YHBA 3VQDA 5C5JA 3KLGA 1QAJA 4QWDA 4BE1A 2YNHA 3M8PA 1NHUA 1T94A 5KFAA 1NJYA 3MEGB 3KD5E 4FJMA 1QSLA 5KG5A 4Q43A 4B8AB 4I2QA 4DL3A 3PW0A 4B3OB 2HNYB 3P5JA 1L5UA 3P83D 4OPJA 3GIJA 1RYRA 3SYZA 4NLOA 3ZT4A 3OY9A 1KLNA 4UQGA 1BQMA 5T7BA 1IKVA 4E89A 1OS5A 2UVUA 2ITGA 5CYQA 2ATLA 2WONA 5KTQA 3MTKA 4KHUA 1RT2B 4RNMA 3GIMA 4FJ8A 1TKZA 1YVUA 5KFDA 3GV7B 2J6SA 2YKMA 4NRUA 3DLKA 1Q8IA 1L3TA 3PW7A 1NKCA 2BQ3A 3GILA 3V6DB 4K4UA 3SJJA 5I3UB 3OL9A 1KLMB 3UIQA 1VSHA 4O3NA 5JS1A 4BACA 3ZT3A 2V9WA 4FJHA 1HPZA 1WSIA 3L3VA 4HUFA 4K4WA 3I0RA 4CFBA 4CCHA 2W7PA 4CGFA 4YP3A 2Z1GA 4KI6A 4TSXA 4DQIA 5DLGA 3HO1A 1C1CB 2I1RA 4Y1CA 3NH0A 3OYIA 4IKFA 1N5YA 3GV8B 3AO1A 1S9GA 4OJRA 4TYBA 1RBUA 3VQEA 2IGIA 1JL1A 1UWBA 4N76A 3IAYA 1FKPA 1JXEA 3RAQA 1HQEA 1G15A 3C94A 3K59A 2AGPA 3V4IB 2PYLA 3EZUA 4ID5A 1GX5A 2OPPA 2FJVA 2B6AA 4R5PB 1J54A 4FJNA 3DI6A 3F9KA 2XY5A 4YQWA 2WB4A 4DF4A 4XIUA 2AJQA 1TP7A 1IM4A 2XC9A 4E7HA 4J9RA 4I9QA 4EYIB 4O4GA 4W5TA 3RMDA 4CEQA 3ASMA 2JEFA 4QW8A 1JL2A 2UUTA 3RR7A 1RTJA 1BIZA 4ZTFA 3KHLA 2GIRA 3FDSA 3AVLA 1MMLA 3KK3A 3CJ2A 4OGEA 3HKWA 5EWFA 4QWAA 1JLGB 3IS9A 1KRPA 3DRRB 2XWYA 2JEIA 2YHAA 4AHTA 4DS4A 1JXBA 5KFHA 3KLFB 1WNSA 4CECA 2G8WA 4QOZB 1D8YA 1D1UA 4Q0BA 3SFUA 2PZSA 3KLGB 4DMNA 4NYZA 3T19A 1QHTA 1WSGA 3M8PB 4OGCA 3HYFA 3OS1A 3ICLA 3V9XA 4F50A 1D9FA 4YR3A 1N6QA 2ASLA 2HMIA 4Y1DA 2ZD1B 2D0AA 1QE1A 3LP1B 3H98A 1B9FA 4ELTA 4DLGA 3OHAA 2FVPA 3IG1B 1TKXA 5F9NA 1HYZA 4HUEA 3LPTA 4BWMA 5KFKA 3QIOA 2DFEA 3QEVA 1DTTB 3AVAA 1KSPA 4W5NA 4TN2A 3GIIA 1S49A 2WONB 1S1TA 2IM3A 4CF9A 3LP3A 1HNVA 5C25A 3SI8A 3K5OA 2XCPA 4WXOA 1L3SA 4NCBA 3ISND 2WK4A 1NK5A 4FLXA 3MECA 3AVJA 3C95A 5L1JA 3D28A 4CF0A 4IFYA 3V1QA 2FVQA 5EU7A 3L2UA 4FM1A 2Z1HA 5KT7A 1LAWA 4JV2A 3CG7A 4FCYA 5KFQA 2W7OA 4FJ5A 3DOLA 3EY1A 3TARA 3PW2A 2YNFA 3TAMA 2HHWA 4YNQA 2IM1A 4M45A 4RW9B 2W9CB 5KI6A 5HRPA 3ZSRA 4KPYA 4CJTA 5J2PB 2FBYA 3PR5B 4AILC 4AHVA 3L2VA 1FKOA 4DTJA 1S9GB 1VSEA 2DFFA 1U48A 1REVB 4OKJA 3M8SA 2OH2A 3AO3A 1FKPB 2HNZA 2DPIA 3WNEA 1JLAB 4FLTA 4EEYA 1HYSB 5HLFA 3OLAA 4ZP8A 4DL5A 3H5YA 4Z4IA 4I7FA 4FBTA 4DSEA 3HVRA 4FZZA 1JKHB 5J1EA 2BANA 1RA6A 3SPYA 3L8BA 5SZTA 2R2UA 4CIFA 3OVNA 4JRQA 2IAJA 4IRDA 1VRTA 3VQ7A 4N5SA 4OLAA 1K1QA 4TY8B 2GBZA 1ZYQA 4O4GB 4EZ9A 2RKIA 4ZPDA 3NE6A 4NLUA 1CSJA 3E01B 5KFJA 3JYTB 3NDKA 1UA0A 3DOKA 4ZP7A 4EP4A 3KK3B 4FJ7A 4K50A 3I0SB 4NLYA 4RNFA 3IS9B 4KAZA 3CJ0A 5L1KA 3OJUA 3QETA 3OSPA 3KK1A 4IFVA 1T7PA 4ED7A 4BE2A 4KHSA 4QW9A 4CJUA 2WRMA 3PX0A 1DLOA 4M94A 4ZMMA 3SV3A 1LWCB 1VSDA 4Q0BB 2C22A 3CM6A 4E1NA 3SUOA 1RT1A 1S0OA 3ZT1A 4O3PA 2OPQA 2RF2B 3PY8A 3IGVA 1XI1A 1NOZA 3CFPA 1WAJA 2J6TA 4FLZA 1TL3A 3HHKA 5HROB 4EP5A 3NMAA 1J53A 4HUGA 1EETA 4JV1A 1I39A 2HMIB 3HP6A 1QE1B 4M3ZA 2UVRA 4CHQA 3RWUA 4DQPA 2HNDA 4IH6A 4M42A 1TKXB 3CYMA 1WLJA 1N48A 4KB7A 2OPSA 5J2MA 1WSHA 4F2SA 1RTDA 5KGXA 4LQ3A 1W0HA 4AH9A 3QEXA 5KFVA 3MFIA 4MKAA 1QS4A 4CJQA 2F8TA 3D5MA 1DTQA 1WN7A 1S1TB 3Q8RB 3KK2B 3M9NB 1HNVB 1WSFA 1F21A 3SUQA 4KHYA 4Z4HA 4Q44A 4GMJB 5J2NA 4JLHA 3H4BA 4CJSA 3QLHA 4NYNA 3MAQA 2Z1JA 1S97A 3MR3A 2AX1A 3N6MA 4KB0A 5E41A 2YNFB 3WNHA 3DRSA 3TAMB 5KT3A 4K4SA 1J9AA 5D3GB 3HK2A 3QZ8A 1HQUA 3THVA 4WXWA 3K5NA 1ZBFA 1BI4A 4KO0B 1S1VB 5DMRA 3VQ9A 4NLRA 1CZBA 2IJFA 4ECRA 1C1BA 3BGRA 4FS2A 4BWJA 1S6QA 1FKOB 2P51A 4DFPA 2DY4A 3LWLA 4C8OA 4NLDA 5HP1A 4O3QA 5HLFB 4B08A 3LANA 4CIGA 3VQ6A 1NK0A 4E7LA 4B9TA 3O3FA 3ISNC 1T05A 3TI0A 5J1EB 2BANB 3KJVB 3H40A 3RRGA 4C8LA 2D0CA 3VQ8A 3FFIB 1RT7A 3VA0A 4ELUA 2IAJB 1WSEA 5DLFA 3AA5X 1RT5B 3M8QA 1SL0A 3D45A 1IG9A 3MXIA 4PQUA 4CJ4A 2RKIB 4CEDA 4ZTJA 4ZPBA 3DOKB 1K1SA 3SUNA 5CYMA 3K2PA 1SH2A 2IDOA 2XY6A 2AGQA 3AO5A 3KK1B 4IFVB 3CQ8A 4LD0A 1R0AA 2AU0A 1HNIA 1GOBA 3SPZA 2HAIA 4F3TA 1BIUA 2I5JA 3M9OB 3TANA 2YNGA 1C6VA 5C24A 4K4XA 1RT1B 4ED8A 4DF8A 3Q8SB 4LSLA 2R2TA 4RW6B 4J9QA 4B9NA 2FVRA 4OL8A 4C8MA 2JLEA 2JEGA 5KT2A 3SNNA 1EXQA 1KFDA 3PJXA 2XHBA 2HNDB 4ED0A 2RDJA 4E1MA 1S1WB 2OPSB 4FJ9A 1S1XB 2VG6A 3DRPB 3G6YA 1XHZA 1RTDB 5DG9A 2CKWA 1LWEA 3H59A 5KG1A 2ZE2A 1UA1A 4RW8B 1QSSA 4KHMA 1XHXA 4J9PA 4K4TA 2W9AA 2YNIB 4IR1A 3CFRA 4B9MA 1HYVA 4DSJA 5L9XA 4KV8B 4EBDA 1JLBB 1C0MA 4OKKA 4Q45A 1IO2A 3UQSA 2P5OA 4N47A 4CHYA 2CJQA 1BQNB 4B8CA 4FJLA 4FJGA 1S0NA 4KTWA 1Z25A 3HP9A 4WYLA 4E7JA 1FK9A 4DTNA 3T3FA 3VQSA 5KFBA 1YT3A 3IN5A 3RMBA 2VG5B 3BSOA 3U3YA 1RDRA 3ZSVA 3FQKA 1CXUA 3MXJA 4KB1A 1A5VA 4FLUA 4CHPA 4HYKA 3VQAA 3OL6A 1MU2B 1L3UA 3IRXA 2FLNA 1T03B 2O5DA 1JLEA 5HP1B 3ZSQA 2KTQA 4R8UA 2ILYA 1Q9YA 3SUPA 1TL1A 4YFUA 4CJ5A 3BJYA 2A1RA 3OS0A 5KG7A 1NJXA 4E7IA 3QEWA 2V4QA 5I42B 3QO9A 1RT4A 3I5CA 3G10A 1RT6A 3V1RA 1ZBIA 3NFAA 4LSNA 5F8NA 4Y3CA 4M3WA 4DSKA 2HHTA 1QQCA 4RW4A 4ECYA 4GC6A 2BRLA 4JS4A 1JIHA 3NF8A 2HB5A 3OYKA 2GC8A 4TQSA 4ED2A 2KZZA 5CYMB 4IG3A 3TAQA 4IDKA 1Z26A 1X9MA 2FC0A 2G8UA 2FLLA 1RDAA 2XY8A 4CGIA 4CGGA 4Z0UA 3CDUA 2QKBA 2VG7A 1BCOA 4Z4GA 2I5JB 3KLIB 2YNGB 4IG0B 4F4WA 5C24B 4CJWA 4Z4CA 4IKAA 1RBSA 1VRUA 3OL7A 3QEIA 2OA8A 4LSLB 4DTXA 1S1UA 3QERA 4DTOA 3BR9A 1BCMA 4DQQA 3AVHA 3UR0A 4B9LA 1EP4A 2OZMA 3QIPA 3NBPB 3M8RA 2IC3A 4O0JA 4DQSA 3MEEA 4NCGA 2R2SA 3BQ1A 2WHOA 2X6NA 1TK0A 4K8XA 2IM2A 3QGHA 2XY7A 2YNHB 3T5JA 2VG6B 4KKOA 3HPHA 4ECUA 4WZQA 4WFYA 4K8ZA 5F8IA 4OKEA 4LH5A 4I2QB 3U3GA 2HHXA 3TAPA 3SQ1A 2HHVA 4CJ3A 3CWJA 3RBDA 5KFYA 2ZQBA 3RR8A 2IBKA 2IJNA 2QK9A 3BREA 2FJWA 5KFIA 1BQMB 1IKVB 1Q9XA 1ZTTA 4NRTA 5CYQB 4EBEA 4F8RA 3ZSZA 2C2DA 2IS3A 3D0PA 4YR0A 4CJPA 5EWGA 2ZKUA 2G8KA 2UVVA 2C2RA 3CJ5A 4ID1A 4E7KA 2ETJA 3TAGA 4TXSA 5KFWA 1TKZB 3V6HA 5KFLA 2QKKA 2YKMB 2GIQA 3TAEA 2W9BA 1RT3A 3DLKB 3OL8A 3OYMA 3AVGA 1KVBA 4FW1A 3AVNA 4CGDA 1NK9A 2PYJA 1BHLA 2FBTA 4NLGA 3N6LA 1SH0A 3OYFA 2P5GA 3KHHA 4CERA 1HPZB 3DMJA 4WE1A 4K4VA 4KTQA 3I0RB 3SZ2A 2E9TA 4IOBA 3L3UA 4DG1A 3IRXB 3NAIA 1TK5A 4ECZA 4DFJA 1U4BA 4RG8A 3BQ2A 4AHRA 4CK3A 3DDKA 3V6KA 1N5YB 3V1OA 3O4QA 4XPCA 1UWBB 3HVAA 1KFSA 3QGIA 1HQEB 1RTIA 4KBIA 2WTFA 3QO9B 1RT4B 1T8EA 1ASWA 2Y1IA 1RT6B 4CEOA 3AO4A 4ID5B 1HJRA 3AA4A 1NK8A 2OPPB 4RW4B 4RUCA 2B6AB 1VSLA 4H54A 3OYNA 5DK5A 1JLCA 3DI6B 4LQ9A 3PW4A 5FRMA 1TV6A 1HMVA 3VQBA 1TKTA 2B5JA 4IRKA 1WSJA 1KTQA 5F8JA 4J2DA 3DLRA 4O4RA 5FDLA 2C28A 1S9EA 4NLPA 4X2BA 3KLEA 5KGWA 1SUQA 1S10A 2OYQA 4J9KA 4ECQA 2ALZA 2RDIA 4DSFA 3K5MA 4KREA 1RTJB 4QWEA 2VA3A 4BE0A 2VG7B 4PWDA 4FK2A 3DLGA 4ECXA 3LP2A 2R8KA 1RDDA 3T1AA 2F96A 2FLPA 2OPRA 1NK6A 4FM2A 2KZMA 4PY5A 3MR5A 1U04A 4PUOA 1RBRA 1S1UB 3ZSOA 5HBMA 1IKXA 3ZSXA 2G8VA 1W9HA 1EP4B 4KFBA 5FROA 2IC3B 3KLHA 4NLSA 3KMQA 3NF7A 4NCGB 3NAEA 4ECVA 3LAKA 4CGJA 3SQ4A 2ATQA 1SV5A 4H4OA 3ZSYA 5KFPA 1L3VA 1TGOA 2IOCA 2BR0A 3LP0A 4QWBA 1N6QB 4CJEA 2R2RA 2ILZA 3HVWA 1KVAA 3AVBA 5FRNA 4CFCA 3EPGA 1NKBA 5KRTA 4HCCA 4KHNA 4O3OA 4DFMA 2C2EA 4AHUA 4N56A 1WAFA 4KHQA 3B6OA 3BDPA 4ICLA 3NCIA 4TYAA 3OJSA 1UAXA 1VSMA 3V81A 1SKWA 2WOMA 4RU9A 5C25B 3NH2A 1LW0A 1RYSA 3ZT0A 3HM9A 3MECB 3V9SA 1ASUA 2AX0A 4O3RA 1QAIA 4IFYB 5KFFA 4RUAA 4FLYA 2G8HA 1GOCA 3VQPA 4O5BA 4F4KA 5L1IA 3B6PA 4DTUA 3DOLB 3WNFA 1C1AA 3NF9A 3S3NA 4CEEA 1XR5A 3OYAA 1D0EA 5KFRA 1ASVA 4DG1B 2ASDA 1RDCA 2D3UA 4F4YA 1EKEA 1A5XA 5F9LA 4NLXA 3HXMA 4H4MA 3HPGA 2HW3A 3QYYA 3GV5B 3RB4A 4J2EA 2HNZB 1NK7A 1RTIB 1VSJA 1XR7A 5DG7A 5I3UA 1X9WA 1C0UA 4EZ6A 2NUBA 3L2RA 3KKSA 3KD1E 1GX6A 2DFHA 4I7FB 1D9DA 4J9NA 4ED1A 4ED6A 3Q8QB 3NF6A 4GVMA 4CEAA 1CZ9A 1TV6B 4KRFA 3AVKA 4KE5A 1TKTB 4F3OA 4MK7A 4I2PA 1C1CA 3QNNA 3BSAA 3Q8PB 3JSMA 2XGPA 1S6PA 3KLEB 1VRTB 1ZBLA 3IGNA 1I6JA 1VSIA 4GC7A 4HTUA 4FZYA 3T5LA 3BQ0A 3CVKA 3V4IA 4KHWA 5KFXA 4CJRA 3VQQA 1VSKA 4QCLA 3DLGB 4NCAA 3RAXA 3ZSWA 3QIDA 4J9MA 2GV9A 2HVHA 2R8GA 3LZJA 5J2QA 4R5PA 4DWIA 1LW2A 2G8FA 3AVFA 1S5JA 2IM0A 1RAJA 2PY5A 4DTRA 5HBMB 1IKXB 1DLOB 1ITGA 2FBXA 1HARA 1T3NA 1U49A 3CJ4A 2UUWA 2FVCA 4K4YA 1U09A 4IH7A 2OPQB 3KNAA 3NGIA 3SV4A 1SV5B 3KKRA 1J5OA 5KT6A 4DSLA 4TY9A 3H4DA 3LDSA 3NGDA 3FQLA 2D0BA 1TL3B 2EX3A 1EETB 2XI3A 2V4RA 5HRNA 5T14A 4M3RA 2HVIA 4IR9A 2KQ2A 2O4GA 3SQ2A 1JLGA 3DRRA 2FBVA 5J2MB 4BDPA 3OYHA 4QPXA 4OPKA 1BL3A 1YVFA 4DFKA 3P1GA 4WFZA 3BSNA 4HVJA 1NJWA 2VA2A 5KFSA 4RNOA 4ICLB 4U7CA 1NJZA 1K6YA 4YR2A 3V81B 4W5OA 1DTQB 2WOMB 3RB6A 4NYFA 5EWEA 5JS2A 1LW0B 3S9HA 2R8JA 3MF5A 4E19A 1HRHA 5J2NB 5DQIA 3G6XA 4NZ0A 3QLHB 1ZETA 2D5RA 4RZRA 1SL2A 4LH4A 4HHTA 2ZD1A 3LP1A 4H8KA 4IRCA 4DEZA 3VA3A 3G6VA 3K57A 3RRHA 3IG1A 3PO4A 3DRSB 1TVRA 4FK0A 4W5RA 2X78A 1SH3A 2XCAA 3N6NA 1HQUB 4B9SA 2F8EX 1DTTA 5DGAA 1BI4B 3S3MA 4CESA 3UPFA 1UOCA 4MH8A 3O4NA 1SKRA 2EC0A 5KFGA 5F8HA 1C1BB 3EYZA 3BGRB 1S6QB 5DQHA 2BRKA 2R8HA 1A5WA 4IBNA 4LY7A 5L1LA 4H4MB 5KG2A 2Y1JA 1KCFA 4CEZA 2W8KA 3VN5A 4FYDA 1IH7A 4EO8A 2BQUA 4MFBA 4WZMA 4MK9A 1S0MA 1C0UB 3MEDA 4MIBA 4CK2A 1SKSA 1N56A 3G0ZA 3OLBA 4FLVA 5HRSA 2QV6A 1T05B 3V9WA 1TKDA 5SWMA 3PX4A 4RW9A 2W9CA 4L8RB 2AGOA 4J9SA 2RN2A 2R8IA 4I2PB 1RT7B 3CM5A 4J9LA 5J2PA 4NLTA 3VQ4A 3JSMB 3DLHA 4JS5A 4FJKA 5KFCA 1S6PB 1REVA 3RTVA 3KTQA 3M8QB 3S3OA 4PQUB 4JRPA 2HHUA 1JLAA 2W8LA 1S4FA 2IA6A 5F8MA 2KFZA 5KFTA 1HYSA 4OVLA 4CJFA 2HHSA 2FVSA 2GUIA 2OZSA 2JC1A 4O44A 1VK0A 1WNEA 5KFEA 3T5HA 4GW6A 5J2QB 3QESA 1LW2B 1JKHA 1JLQA 3FSIA 1R0AB 3DM2A 1HNIB 1IKYA 3ITHA 3QINA 4MK8A 2O4IA 1RCHA 4DSIA 3QNOA 3OHBA 4C8KA 4KTZA 1S48A 3BSCA 4ZP9A 3QZ7A 2J6UA 1IKWA 5F8LA 4RNNA 3K58A 4TY8A 4ZHRA 1J5OB 2BGGA 3DLEA 1S9FA 2E9RX 4JUZA 2X74A 3O3GA 3E01A 4ZP6A 3DYAA 4ZPCA 2JC0A 3JYTA 3PO5A 2W42A 4CF1A 4EO6A 2AWZA 4XO0A 4IH5A 3I0SA 3H08A 3OYCA 4Y2CA 4J2AA 2YKNA 4N41A 3V6JA 5KG0A 5DG8A 2BQRA 4Y34A 3PW5A 4FXDA 1LWEB 4Q8EA 1Y97A 5KT4A 2ZE2B 3LAMA 5DQGA 2BDPA 3U6FA 4G1QA 1LWCA 3E51A 3LWMA 2BE2A 2RF2A 3HJFA 4DTSA 4F4ZA 3WNGA 1CLQA 4CF8A 3OYLA 3MR2A 5JUMA 5HROA 4NLVA 3O3HA 1C0TA 3HL8A 1I3AA 4NLQA 3FRZA 4CJKA 3NKYA 3OYGA 1NKEA 4MIAA 1JX4A 3RBEA 1TVRB 3H2LA 3PHEA 2UVWA 3OYJA 3H5UA 4J9OA 1FK9B 3KMSA 4DLEA 4AHSA 3CDWA 3RMAA 3KK2A 3KHRA 1JLFA 2P1JA 5KFOA 1X1PA 4KHRA 4ECTA 2E9ZA 3KOAA 3TAFA 4TQRA 4DL4A 3LPUA 2HHQA 1N4LA 4EBCA 4E0DA 1TAUA 2X6SA 4O3SA 4CFDA 4KI4A 1JLEB 4JV0A 4MFBB 2KFNA 4R8UB 3MEDB 1KHVA 5D3GA 3I5AA 4FJXA 5KG3A 5CZ1A 5KT5A 2V0NA 1TL1B 3PR4A 2B4JA 3CIZA 4KO0A 3V9UA 4ZVFA 1NNDA 5KFZA 5KG4A 4DU4A 4CIEA 1S1VA 5JXSA 1W25A 3CDEA 1XWLA 4CHNA 4DTPA 3M9MB 3TR8A 4LSNB 4O0IA 3SCXA 4G3IA 3OS2A 3ZCMA 3VQ5A 4CJLA 3AVCA 1EX4A 3NGYA 1B9DA 4B9UA 5KFMA 3OYDA 5KRSA 4FK4A 4O44B 4IG3B 2B43A 5K14A 4IDKB 4WFXA 5DGBA 3TVKA 1VSFA 4ZVHA 4HKQA 4ECSA 3KJVA 1JLQB 4E3SA 3DM2B 1Z4UA 3FFIA 1IKYB 3ITHB 3CFOA 4F2RA 1YTUA 4WYWA 4QWCA 2RPIA 1RT5A 1XR6A 3H5SA 4M3TA 1IKWB 3NL0A 3G86A 1VRUB 2JGUA 4ZHRB 3DLEB 4B9VA 4MQ3A 1NK4A 1RTHA 3NHGA 1TK8A 3DYAB 2E6MA 2VWJA 3C6TA 4YMEA 3UDLA 3EZ5A 3QIPB 3C6UA 3MEEB 1O1WA 4IQXA 1TAQA 1LV5A 4M3UA 4Z4EA 5HRRA 3L2WA 2YKNB 4RW7A 2JEJA 4KKOB 3V9ZA 3NAHA 1KHWA 3LALA 3ZT2A 1RBTA 4K4ZA 5C42A 2QXFA 4G1QB 4FZXC 3GIKA 4PA1A 2A1SA 4Z4FA 2BE2B 3RB3A 3HVTA 2AQ4A 4XPEA 4RW6A 3F73A 1B92A 1JXLA 3A2FA 3T5KA 3QEPA 2Z1IA 1X9SA 4CFAA 4Q8FA 1TQLA 1C0TB 3H5XA 1RA7A 3L2QA 1LAVA 1LWFA 3QGGA 1RNHA 3OYEA 4U6PA 1NOYA 2DTUA 1S1WA 3PJWA 2Q3SA 4FJIA 1S1XA 3DRPA 4KSEB 3AVIA 3AVMA 1GOAA 3MEGA 2W9BB 1RT3B 4I9LA 4DU3A 4B3OA 2QE5A 4CF2A 2HNYA 4RW8A 4FS1A 4DS5A 1JLFB 1QUVA 3ULDA 2YNIA 3AA3A 4Y2AA 1ZBUA 4CE9A 3DMJB 3RB0A 4WE1B 4KAIA 4URQU 1BISA 4O55A 4KV8A 1NHVA 1JLBA 4CJVA 5EUHA 2F8SA 3CJ3A 3CO9A 2G8IA 5F8GA 1D5AA 4FVMA 1RILA 2YV0X 1BQNA 1RT2A 4DU1A 3DLBA 2XGQA 3LZIA 2LSNA 4DL2A 3OSNA 4M3XA 3I8DA 1SL1A 2KW4A 3GYNA 4URGA 2E6LA 3I5BA 3NH1A 3SI6A 2VG5A 4BDZA 3V6DA 1BGXT 3AV9A 2R7YA 3MXMA 1KLMA 4F4XA 1QSYA 4HCBA 5KFUA 4CEFA 3MR6A 3PZPA 5EDWA 2DPJA 2IMWP 4W5QA 2XRIA 2XO7A 4BDYA 4R0EA 4FLWA 4ZVEA 1JLCB 1C2PA 1MU2A 4FBUA 4EYHB 1HMVB 2B5JB 2EHGA 3HSTB 1T03A 1FXXA 1XC9A 5FDLB 1ZTWA 3PUFA 2VWKA 1S9EB 5CZ2A 3KIOA 1RBVA 5K14B 4CHOA 3NGZA 4ECWA 1SUQB 3KLVA 3TQ1A 4M95A 2D7SA 4FW2A 3VQCA 4DQRA 1U47A 3PVXA 5I42A 3KHGA 3EPIA 3MFHA 4PWDB 3K5LA 4ZPAA 3TWHA 3SQ0A 4CEBA 2HWIA 3HPOA 3LP2B 4QAGA 4ED3A 4DL6A 2OPRB 5KG6A 3PV8A 4PUOB 3SFGA 1KVCA 1RTHB 3ALYA 2WCXA 4RNHA 3C6TB 4KFBB 3AA2A 3C6UB 3KLHB 2D3ZA 3HT3A 4J2BA
chains in the Genus database with same CATH superfamily
1N36K 2MQ8A 5KFNA 4Q5VA 4FM0A 2FJXA 3FC9A 4DV3K 4FWPA 3ZZTA 3RMCA 2AZ1A 1T9VA 3QJPA 1ZBHA 1W2BM 3TWZA 4ILRA 4TLRA 4B1YB 4CHZA 4JKGB 5GAEU 3T7ZA 5B0EA 4KH0B 4YORA 5D77A 1YTAA 4M3YA 4DTMA 1RXOB 1RKJA 2ASJA 1VQ7N 1RJJA 3OW2R 1FJ7A 4CH7A 2Q0RA 4MO4A 3EX7B 2HRTA 3VVUA 2IVYA 3MEGB 5KG5A 2MY7A 3BO4A 4AXJA 1YJ7A 2CGLA 4OZ0A 2KH9A 4QS7A 1WOQA 3GIJA 1RYRA 3ZT4A 1KLNA 2QM1A 5T7BA 4DV5K 1OS5A 5HAOA 1ELOA 4GNIA 4CZFA 6AT1B 3MTKA 4KHUA 1RT2B 4IOAQ 1E6VB 4K0KK 2ZWOA 2UXCJ 1I51B 2ASOA 3GIMA 4FJ8A 1DY3A 5KFDA 1RAHB 1B0VA 1VQ6S 4DI6A 5E2QA 1B3TA 5L46A 2EPIA 4K4UA 3OL9A 1KLMB 1O13A 4NMXA 4FJHA 3IR7B 1HPZA 1F2HA 4JI7K 2DNGA 5C7PA 2JLFA 1WSIA 3L3VA 5I3QA 4K4WA 1Y64A 4CFBA 1Q0NA 4TSXA 3HO1A 2FJAB 2H1YA 2HLUA 3VQEA 2CH5A 3CDAA 1UWBA 4CT9A 3MMJA 1FKPA 1BU6O 2W40A 3GLJA 3QGPA 3RAQA 4A8OA 2D9PA 2BKNA 1DQ8A 4I4BA 2ZJRL 4UY85 3R5AA 4PXBA 2QTDA 5BR8J 3WQUA 1YRTA 3ENOA 3GB0A 1GXLA 2FJVA 3L4QA 2B6AA 1VAZA 1YVNA 3DI6A 2XY5A 3TQEA 4YQWA 4X66F 3QRQA 3EMTA 4WK3A 4O23A 3SDEA 2ZZNA 4CEQA 5D78A 4PKIA 1IJEB 1JL2A 2LMIA 1QAYA 1J5EF 3FDSA 4A2BA 1MMLA 1QQMA 3CJKA 5IT9O 5EWFA 4PCQA 1KRPA 3MGJA 3WEEB 2P6SA 5AQFA 3S41A 1NDPA 2YHAA 4NI2B 5CZXA 3P8BB 5IV4A 1WNSA 5A76A 4K59A 4LF4J 4O5FA 1D8YA 4FWQA 5JVHQ 4DPYA 1ZZFA 4YY3F 1J2VA 2K7KA 3CCMS 3ILOA 4B02A 2K7JA 3L6QA 1X4BA 1KOOA 3BH6B 3LDNA 1D9FA 1S99A 1N5VA 2ASLA 4Y1DA 4H4KA 3LP1B 3GCWP 4DLGA 3G6ES 3OHAA 3IG1B 2QT7A 1ACMB 3LPTA 3DDNA 4OZ3A 3QIOA 2D74B 3AVAA 3ENQA 4X4SA 2WONB 2JFKA 1S1TA 3LP3A 1N36J 3OTDA 2RRAA 2EFQA 2X3DA 4JHDB 4NCBA 2DNYA 3GDQA 3IMXA 3D28A 5E0OA 4CF0A 3V1QA 1OO0B 3H1VX 2H65B 4EIAA 3QSYB 4L76A 3TARA 3PW2A 2BJDA 2YNFA 3S01A 1V3SA 1HBOA 3EVOA 1GTEA 2GAHC 3TZXA 3W1YC 3MPVA 1XNQK 3O9SA 3VAMA 3EO3A 3LL3A 2E1CA 2HVDA 3I4HX 4CJTA 3SCJE 2FBYA 4FYXB 1S9GB 2DFFA 1REVB 4GMKA 4OKJA 9ATCB 2EK6A 1WSVA 4ES2A 2OAUA 2D3O1 4P52A 3CC2N 2B4OA 4DV4J 2FB0A 4NO7A 3OLAA 3ZTOA 4AQYK 4MLHA 5BN9A 3AJDA 3NGUA 1JKHB 3W8GA 4DV5J 1RA6A 2R2UA 2OFHX 5AT1B 4Y0WA 4K0KJ 1UPMB 3KJQB 2HHHJ 2DNNA 4KGZB 3A8JA 1VRTA 3VQ7A 2LDYA 1IM6A 5IWAF 2XM3A 2GS8A 1CSJA 3E01B 3JYTB 1UA0A 3DOKA 2VKRA 3H3OB 3KK3B 4FJ7A 5HMXA 1QHAA 3CCUN 4RWTA 2VZ9A 5L1KA 3OJUA 4I6AA 4BE2A 2JH3A 4KHSA 3LOUA 2VCPA 2H9ZA 3EE9A 1XK8A 4X65F 5IFMA 3VEWA 4JI0J 1P1TA 3BKFA 3CM6A 3SUOA 1RT1A 2OPQA 2Q3PA 3IGVA 3RVCA 3W0LA 2B3TB 3AXMA 4CZKA 1WAJA 2J6TA 1FFGB 3I56N 2P9UA 4RO0A 4EP5A 1YJNS 1J53A 3I4PA 1I39A 1E4GT 4FOIA 3ZTPA 2GA7A 3OBWA 1QE1B 4M3ZA 4L72B 2XLJA 2WW8A 3VAHA 4EWTA 2J4RA 3CYMA 2O8DB 3RBZA 2L3MA 3EGWB 3E66A 3THPA 3QEXA 5KFVA 4AT1B 1QS4A 4AM6A 3D54A 2F8TA 5FPMA 2NS1B 2A41A 2PMWA 1J27A 3PJ9A 1HNVB 3JB9k 1WSFA 2H3GX 3BEGB 3RJMB 2VQEJ 4NYNA 1U1KA 4C1NI 3W2VB 2RD5C 1ULRA 3N28A 3N6MA 1N0VC 3DRYA 4V19S 2YQ0A 3OTOF 3QZ8A 4FWSA 3THWB 3K5NA 1WG5A 2XMUA 4OX8A 4ANDA 3KK7A 4YOYA 5CCMA 1R7IA 2E5LF 1CULA 4A5BA 3OVAA 4BRNA 1Q7YT 3IR6B 1HBUA 1XMQK 1VK8A 1P1LA 4C8OA 6FD1A 1RHQB 4F3QA 5ETVA 4YS2A 5K8NA 4B08A 1Q8KA 4LFAJ 1NK0A 1XEZA 2QA2A 3FUYA 4B9TA 2W2MP 2OTJN 2NXCA 4M1KA 4EUVA 4C98A 3O3FA 3TVZA 3G4SS 3KJVB 3H40A 2J9EA 2CNKB 1NSKL 2GGPB 3AD8C 3M6WA 3VA0A 2IAJB 5A8RB 1TTHB 1TU0B 2Q36A 3AA5X 1RT5B 3GYXB 4P9SA 4JI1J 3M8QA 1SL0A 1EZZB 5F0UA 5H1SQ 1IG9A 3MXIA 3CIPA 2RKIB 3R3LA 2K1RA 3HZGA 1UCNA 1XC3A 3MXHP 1FRLA 2E88A 3CCLN 1M1HA 3K2PA 4L3KA 1G7CB 4CLUA 5HI7A 3KK1B 1SQFA 1XNQJ 1R0AA 1SI9A 3Q89A 4Q2MA 4LRBA 1BIUA 1UMJA 1KAZA 3EKUA 2YNGA 3M8ZA 3K8WA 4K4XA 2GJFA 4DF8A 1ZM4A 4RW6B 1NGDA 4CZHA 4JK8A 2DR5A 2AD9A 2B9XA 3PG9A 4C8MA 1U8WA 4IFEA 1HWLA 3SNNA 1KFDA 4AQYJ 4FWRA 3CCVS 2VC1A 3SSRA 3D0HE 2HBQB 3VGUA 4FJ9A 4BG8A 2K2PA 5AZIA 4X4PA 3H59A 2YQ1A 4CNZA 1S7HA 4QIVA 1UA1A 2DGSA 5F1XA 4O8KA 2XBPA 1VIOA 5B0FA 3VTHA 2VH7A 3HSCA 5GMKa 3V4MA 2XS2A 2W9AA 1U24A 4LBPA 5JLHA 3CFRA 3BKUA 4KV8B 1JLBB 1C0MA 1SQEA 3VEVA 4Q45A 3KWIA 2CJQA 1BQNB 2EEYA 4B8CA 3A5OC 2OANA 3V5RA 2X51A 4BQZA 3PRBA 2I9SA 1FK9A 1JJCB 1F1BB 3UI3A 1YT3A 3GP9A 1EB0A 3IN5A 2VG5B 3GTYX 1K0TA 3CXCR 4C11B 3UKRB 4OFZA 5JVGQ 1Q7YO 3ZEUB 3MXJA 4CZIA 1NGHA 1RISA 1KEKA 3HHLA 3W3SA 4LR7A 1NGFA 3G82A 1IJFB 3M1VB 3ZNUA 1ZM2A 1L3UA 4IJAA 3I55S 5HP1B 5LOQA 1RB0A 2ILYA 3SUPA 2UUAJ 3VZHA 1TL1A 4CJ5A 4QQBA 4BGBA 2MLZA 2X7IA 2EFGA 2D9OA 1O5JA 5F8NA 3VGMA 4M3WA 4A8FA 3THYB 3LH2S 3FZ2A 1JIHA 1NU4A 2ZH4A 1VIXA 4JAXA 1B99A 5LMNK 2GC8A 5JMVA 4TQSA 3MM8A 2V8HA 3ZYYX 1RBOB 1SKUB 4P6QA 3U1MA 3Q2TC 3HDSA 1ZAWA 4P71A 2XB2D 1BD6A 2V34A 3TAQA 4IDKA 2R4FA 3CCJS 3AH6A 1X9MA 2H4YB 2FC0A 1D3WA 4FL9A 2HHPA 1N32K 4IO8A 1LOUA 4XEIA 4K2XA 4Z4GA 2I5JB 2GJIA 5C24B 1V3ZA 1SIZA 4IKAA 4OYPA 3QEIA 2ZZMA 5AFUH 2ZOMA 4FF1A 3QERA 3LO3A 2YPYA 3VEOA 4FSVA 1EP4A 2VUGA 2LU2A 7FDRA 3MEEA 2IRUA 2WHOA 4DV1J 4K8XA 2IM2A 3G4SN 4Z7CA 3L3CA 3OPKA 1U1RA 4NWBA 4H5WA 4PAAA 3W9IA 1WELA 3PIOL 4BC9A 4ES1A 1AROP 5GADI 4M5DA 4WQ4A 5KFYA 5BPLA 4LBIA 2IBKA 4AM7A 2XSJA 4OO1J 1KDNA 1BQMB 1IKVB 1ZTTA 5FLXU 4HH1A 3ZSZA 3MDFA 1VS3A 2CH6A 3LDPA 2ZKUA 4IXCA 4YOVA 3UDEA 3EZOA 3C14A 4CJ7A 2UV8G 2W9BA 3TAEA 3P4IA 1SIWB 3OYMA 2YWWA 1RSCA 3CI5A 2PYJA 4DN0A 5IT0A 3RRKA 3N6LA 2P5GA 4CP5A 4EFHA 3I0RB 5GIOA 4IOBA 3L3UA 3J7YP 4OPAA 3IUCA 1TK5A 1U4BA 2HF3A 3V6KA 2ZJPL 1NLKL 3PRDA 1KFSA 2HQDA 3X3UA 4PABA 4KBIA 2WTFA 3HBTA 4CW7B 2MZJA 4C97A 1RLDA 1PC4A 2QLBB 4ID5B 1HJRA 2BV3A 2DYAA 1VSLA 3MHYA 4H54A 5DK5A 1HKAA 4LQ9A 3BO2A 4IO9L 1TKTA 4BY9C 2R7WA 3HSDA 2VB6A 1WSJA 1KTQA 5F8JA 1FJGF 3MUMP 4O4RA 1HQ2A 2K3KA 1S9EA 2QLWA 4NLPA 2E2NA 3KLEA 2DVIA 3MZIA 1SUQA 5IZHA 1VQKS 4MT1A 4BVOA 1FX2A 1M1KT 4DUZJ 4DV7F 3K5MA 2ZGZA 2VA3A 4BE0A 2VG7B 4PWDA 3CQXA 4FK2A 4ECXA 3NGTA 2DR6A 2YWEA 3HFZB 5AR0A 2OUGA 2JHEA 2BJ3A 4FM2A 2KZMA 4PY5A 2RB7A 2XWXA 3IAS9 1RBRA 1S1UB 3OR1A 3ZSOA 4Y00A 4X62K 4HHJA 1JJHA 3A3PB 1X9JA 2D3OR 2OSQA 5FROA 4NLSA 4NCGB 3A3NB 4ECVA 3POTA 4BRMA 3NWRA 4CGJA 4WP8A 1WSRA 2DBBA 2Q31A 4C3MA 4BR2A 2IOCA 4WP9A 3JXUA 4QWBA 1EQYA 1CJTB 2QMWA 5F3ZA 2ITMA 3BN7A 1JNZB 3UDCA 3AVBA 5FRNA 2PI4A 1NKBA 3Q2SC 2EBEA 1F9HA 4JKGA 1XERA 3WIUA 1WAFA 5LMNJ 3N5BA 4ETZA 3BDPA 2GWJA 3NCIA 2GX8A 3OJSA 1UAXA 3W65A 2WVDA 1N54B 1SJ4P 1SKWA 1S3XA 1LW0A 3TZYA 3W2WA 2FHJD 1OQ3A 1RYSA 3ZT0A 1NSPA 5DETA 5FPEA 4O3RA 3BS9A 3V2UC 2NLWA 3MMAB 1GOCA 3B6PA 2G2OA 1VI7A 1Q81T 1GLAG 3C65A 1URRA 2A6MA 3S3NA 3VF2A 4BREA 3LPYA 5KFRA 2ZDOA 1ASVA 2PO4A 2ASDA 4P2FA 3T9NA 3D68A 2J9DA 5F9LA 2BJ1A 4I56A 2GNKA 4OYOA 3QYYA 4JI6F 2HNZB 4CLPA 1U1PA 5D6GA 1VSJA 1YBTA 5DG7A 3CC4N 1E6YB 3HFVA 2XYPB 4OYZA 2NUBA 3KKSA 1GX6A 4C48A 4I7FB 1D9DA 3GPAA 3Q8QB 5AQUA 1VOMA 1CZ9A 2RJZA 3C46A 5DDRC 2DISA 1T6DA 1X4CA 1N34F 4NA2A 4KH4A 2MY8A 4Q7AA 4G65A 3G87A 3JSMA 1M1KO 3VESA 1ZBLA 2NYHA 3C2PA 2CJKA 4GC7A 1E3MA 2F9DA 3GFXA 1ZM9A 2ZHBA 4FPRA 4KHWA 3ZSWA 1IV0A 3QIDA 2R8GA 1X7VA 4DWIA 2G8FA 3TA1A 3C8YA 1PC5A 2WSFC 2HF4A 4DTRA 1IKXB 4BC3A 4BRIA 2YBVA 2APOA 5ETQA 5CHCB 4U95A 2UXBF 3CDBA 2RU3A 3CJ4A 5E84A 3BZQA 2DEJA 3NWGA 2L41A 4ZKAA 3RYLA 1P8GA 1SV5B 3KKRA 4TY9A 5AQQA 3W9HA 3LM2A 3FQLA 2PSZA 4OLPA 1K8KB 2D0BA 4PPDA 5AQIA 3JTOA 4G1PA 2QWOA 3GU0A 3VAFA 3CCRS 4A2AA 5AQWA 4DR3K 2HBZB 4OJ3A 4BDPA 3OYHA 3D6RA 4CTAB 1BL3A 4DFKA 1R6VA 4NI2A 4WFZA 4HVJA 5KFSA 4RNOA 3ENVA 1NJZA 2BKPA 3T1YF 4YR2A 2WOMB 4NYFA 1EQMA 4U7BA 3VGVA 4B3MF 2MLYA 5CA5A 2DHHA 1NGJA 4CLWA 2R8JA 3DCAA 1MW7A 2BXJA 3QLHB 2D5RA 4LH4A 2WVCA 5FD1A 1Q81O 5A2QY 1U02A 4HHTA 3LP1A 1EX8A 2CQ3A 4IRCA 3OW2M 3K57A 3IG1A 3PO4A 3M30B 4FK0A 2X78A 3D4JA 4X62J 4WQ5C 3S3MA 2P9LB 2JDJA 4CESA 1TUYA 2XULA 1UOCA 1IWGA 2CZ4A 3JTNA 1J6ZA 3QJLA 5KFGA 5F8HA 1C1BB 4JHDA 2A18A 4MDBA 1VBYA 2Q79A 2ZH2A 1NGGA 4JI8F 2G2YA 3MPYA 2W8KA 3VZIA 5L8RC 1VHFA 4JV5F 1EHWA 2BQUA 4A57A 4B3SF 2V94A 1Y3KA 3TYTA 1NXIA 1LNQA 1N56A 2UUCK 5HRSA 5BJRA 5IT9U 1NWKA 2QWNA 3PX4A 4KH5A 4WBFA 3JQKA 2AYGA 2DRDA 4I2PB 4J9LA 2MZSA 2Q1NA 2QIFA 2LXFA 3DLHA 4FJKA 2QC3A 5KFCA 1REVA 2DH9A 2LDIA 4PQUB 4BHQA 3B8AX 1QVGR 4H0YB 2MEWA 2IA6A 4CM0A 5KFTA 4OVLA 4ISFA 3WT0A 5C12A 3D2EB 1Z1ZA 1VK0A 5KFEA 2C3PA 1VQLS 1JKHA 2KLAA 1J5EK 4FWLA 1VQSA 1H38A 1HNIB 3QINA 1UVIA 2O8CA 3JSBA 2KL8A 1RCHA 1U26A 1EARA 5ETSA 4P2XA 3OHBA 4RBVA 4C8KA 4LVNP 2CPEA 4ZP9A 1IKWA 4RNNA 1KR4A 3N5FA 4DCJB 3MR7A 2MZRA 1GXTA 2BGGA 2O1PA 3DLEA 1NM1A 3WQPA 5A6PA 2RHKA 3E01A 2DR7A 3JYTA 3MOJB 3M2UB 1RBAA 2P6TA 4DR7J 5AQOA 4EO6A 4YY3K 3CJRA 4M63A 4IH5A 3OXFA 4WFNL 3C6AA 3QSIA 1U6FA 3D0IE 2YKNA 1U25A 3SAHA 5A2QU 5KG0A 4NE9C 2BQRA 3VGKA 5LJ3Y 2FY8A 3LAMA 1YG0A 4JBCA 1SAZA 3E51A 3MMCB 2BOPA 3TJ9A 2BE2A 4ANCA 5EHHA 4DTSA 1GLJO 4CF8A 5JUMA 5B09A 4TU8A 1IBLK 1YK9A 4GKKF 3HL8A 1OPZA 4IEIA 2MQOA 1VC5A 1RAFB 3NKYA 2H5IB 3FE1A 4HTIA 4JB8B 3ZETA 1NKEA 4F02A 4U8YA 4U7UK 2O8DA 1CVJA 4FNHA 4QIFA 3PXGa 3H2LA 3PHEA 5GMEA 4LF8K 2HOEA 1G6BA 4ENOA 3BR8A 4JK9A 2KRBA 2QA1A 2CG8A 4KHRA 2CQ0A 3WC2A 3SSQA 4ERDA 1N4LA 3ET6B 4OJ1A 4EBCA 4E0DA 3GYGA 1Q78A 5AQPA 2X6SA 3W2VA 2MTLA 5A8WA 5HATA 1JLEB 2OLWA 1CJVA 2MGZB 4DR3J 4QIEA 1VQ5S 3I5AA 4CRJA 2ZEJA 3THWA 4ZVFA 1NNDA 5KFZA 5KG4A 3U8XA 5JXSA 2WVBA 3UN5A 4ZLJA 3TR8A 4LSNB 5M1FA 2B56A 4G3IA 1Q1KA 1OIAA 2QA4N 4QIGA 3ZCMA 5AFUA 1OYDA 1PYTA 2DNKA 2LQJA 1ZS6A 1FFSB 1B9DA 1QZ6A 3M2RB 3NVKA 4O44B 3MCSA 3RUBL 5AQXA 4IG3B 2HBRB 1X4FA 3TVKA 4F3MA 1VSFA 4ECSA 4DB3A 3KJVA 2ZH7A 1JLQB 3DM2B 3F2KA 3ITHB 4F2RA 3CFOA 1YTUA 2GGPA 3J80U 4I6MB 2PEHA 1Y0HA 4L74A 2L48A 3I33A 5A8RA 3UCZP 1WHYA 1RT5A 2IBOA 3CD7A 1SCJB 3NL0A 2PC6A 1TR0A 4X65K 1XN9A 5D4PA 3UNYA 1T9XA 3DYAB 4CDIA 2VWJA 1RAGB 2IJRA 1X3NA 3QIPB 3LA0A 3C6UA 1C4AA 4FF4A 1O1WA 2UUCJ 4TNOA 4ED5A 1TAQA 4LF7K 4JKAA 5HRRA 3E9LA 3L2WA 4W92B 1AW0A 4UUWA 1HKBA 2QWLA 2GHVC 4B1WB 2V8PA 4IZ9A 2X3GA 1PYSB 3LALA 1HBNB 5CZVA 2OJ3A 4JI5K 3W3DA 2Z57B 4FZXC 4PA1A 4DR6K 2BM0A 2NYIA 2UXDK 4C4WA 5AQGA 4RW6A 1ZOTA 1B92A 2FJBB 1X9SA 4EU0A 4CFAA 4Q8FA 2UXCF 1C0TB 1DBDA 3SSSA 4I6YA 2MXYA 1VISA 3J7A1 1VQLN 3QGGA 2CPXA 3B4DA 5HJYA 4CLLA 2B9WA 2CVEA 3NCPA 1UP1A 2Q3SA 4FJIA 1T9TA 3AVIA 3AVMA 2GMLA 3NNHA 1RT3B 3LGNA 4DKWA 4B3OA 2QE5A 4CF2A 3DOMA 3WDOA 1QUVA 3ULDA 4USHA 3UR3C 1U7LA 1ZBUA 1YRUA 2NUUG 4USVA 4WE1B 2FSNA 5GAHI 3IDHA 4QYRA 4KV8A 1NHVA 1JLBA 3ULHA 4CJVA 2F8SA 4DOZA 2HQIA 1NBWA 4GVBA 4LRDA 1RILA 2YV0X 1BQNA 1M1GA 3VEZA 4DU1A 3DLBA 2XGQA 3O9QA 4DL2A 2RT3A 4BBYA 3I8DA 2HFSA 1RU1A 1IBMK 3I5BA 2VG5A 8ATCB 2R7YA 5AZJA 3QPIA 4C11A 1WC1A 2J0WA 1QSYA 3UKRA 3CCQS 4HCBA 2PMZD 3ZEUA 2NRWA 3QICA 3PZPA 2NPIA 3NG8A 1IBLJ 1C2PA 1UEVA 4H5TA 4EYHB 3M1VA 1H1VA 3BZKA 3W9JA 2B5JB 1FXXA 3PUFA 1NH7A 3KIOA 1RBVA 4LF8J 3Q22A 2P9CA 1X5SA 2QMUB 1VQ4S 1U47A 3PVXA 3WIVA 3OBYA 3F0NA 5MLCV 2Y8WA 2ZBCA 3CMAS 1TZ0A 1P9YA 4CEBA 2WBRA 1BWFO 4FPAA 4NLCA 2G4BA 2WZ1A 4DL6A 2OPRB 4LF4F 3AARA 3M8WA 1UZHA 2PMHA 2WCXA 2Z58B 1H2TZ 4KFBB 2F9JA 1K44A 4NYPA 1NEEA 9RUBA 4TVAB 4OYMA 3ENWA 4KJIA 4NLWA 4ELVA 4K5SA 2Q1LA 5IM0B 4CGHA 4AHCA 1RGVA 1VQ9N 4URSA 1QTMA 5CY4A 5A0YB 1FRHA 3CGIA 1BY9A 4CK1A 4OLBA 2FHJA 4KIAA 1UAWA 2MMYA 1RDBA 2D41A 1N36F 3M6XA 2HWHA 2E4LA 3PRVA 3MWTA 3QATA 2FC8A 3UN3A 1Q4RA 2IDLA 3VQDA 3KLGA 1QAJA 3TJAA 3BYRA 4QWDA 3M8PA 3SAGA 2M4MA 1APSA 1NJYA 4FJMA 1HX1A 4Q43A 1JCEA 4DL3A 3SMZA 2HNYB 2X1BA 2I8EA 3P5JA 2YWHA 5D4NA 3M2VB 5E3RA 2DXFA 5HSPA 4OPJA 3SYZA 3MUTP 3OY9A 3DFEA 1BQMA 4LUBA 2Q43A 2DJWA 4Y2IA 1IKVA 4JI2K 2C2NA 2UVUA 2ITGA 3MM9A 4J91A 3EZWA 4RNMA 1T95A 1FXRA 4LF7J 3CJTA 4DV4F 2LCWA 3QNWB 2KT2A 3GV7B 2J6SA 4JI5J 1OY6A 4NRUA 1SJRA 2DD8S 1L3TA 3O6QA 2VFUA 3IM8A 5I3UB 1FERA 4DR6J 4DV5F 2UXDJ 5C15A 2ZJRQ 4BACA 1KOHA 3F56A 4HUFA 3FKBA 2UU9J 1SXLA 3I0RA 4K0KF 4K7QA 4UOGA 3ZX0A 4F0HA 2KN4A 2W7PA 4EI2A 4KI6A 5DLGA 1C1CB 4QR1A 4Y1CA 2IVMA 3NH0A 4D3GA 2RAQA 2NZCA 3GV8B 2POKA 3AO1A 1XTZA 4TYBA 2VPWB 2IGIA 2VICA 1JXEA 4JI7F 4CNYA 3K59A 3CF5L 3ELHA 3EZUA 1HLUA 4ID5A 3FGVA 1WDDA 3IBFB 2VV5A 2P9SB 1RUSA 2OGUA 4JI0F 3F9KA 3VCDA 1S57A 2KU7A 4GY2B 2VHGA 3O6WA 3MCMA 1IM4A 3UKUB 4E7HA 4M5GA 2H54B 2DHAA 1ZAXA 4J9RA 3RSEA 2X1FA 3LW5C 4O4GA 1IBMJ 5J1NA 4RWXA 3DC2A 4QW8A 2UUTA 1QZ5A 2HSEB 1BIZA 3KNGA 5BYQA 2GIRA 2DNPA 4OGEA 1U6BA 4H5NA 2DR9A 3IS9A 1R8PA 3DRRB 3NLCA 1GLCG 1U2CA 3G9CA 5KFHA 2CQBA 4NMLA 4CECA 3QAEA 4OX9J 1VHIA 4NASA 2DNOA 2VQEF 1HI0P 3GE1A 2FF3B 2PZSA 1O51A 2JJ4D 2WSCC 4NZ7A 1AYEA 5GAGP 3V9XA 4YR3A 2HMIA 1CJTA 4OI3A 4RPFA 2D0AA 1DAXA 5ETLA 4ELTA 2AJFE 2GWKA 1TKXA 1F3FA 5F9NA 1HYZA 1HNZJ 2ZGYA 3R9LA 3FBCA 1R0CB 3QEVA 5ETOA 4W5NA 4TN2A 4OYAA 1BHNA 1L3KA 1AXQA 2IM3A 3GJSB 1DRZA 4G6VB 2WK4A 2DNRA 1NK5A 3ZTSA 4FLXA 1H2UX 1MSWD 4LJMA 2FVQA 3L2UA 3MMAA 2MHNA 4KBOA 1LAWA 4LFAF 2W7OA 2OEJA 5LJWA 2OFGX 2VPXB 3TAMA 2AYBA 2HHWA 1VQOS 2VPZB 3KHYA 1H98A 1ZBSA 4M45A 3KJFB 1OH6A 4RW9B 2W9CB 4JKBA 4JI1F 5HL7L 3CSKA 3C15B 5HRPA 3ZSRA 3QRPA 3PR5B 1PJ6A 4AHVA 1NPRA 5GADU 3AO3A 1FKPB 2HNZA 3WNEA 3R3TA 4FLTA 2YXLA 3AJ1A 2E7XA 1HYSB 2HIQA 4DL5A 4OZ5A 2PFUA 4Z4IA 1XNQF 4DV7K 4I7FA 5HO4A 4NXNK 4DSEA 3HVRA 4FP9A 5J1EA 4JI2J 2BANA 4WU2A 4ZCMA 5SZTA 1ZZNA 5KPRA 1YGYA 2RRBA 1NH8A 4CIFA 2LXIA 4JRQA 4QBUA 4ED4A 5HJXA 2DEIA 4IRDA 3BEXA 1YI2S 1FT8A 2GBZA 3SDEB 4AQYF 1VQNS 3OR2B 3SXLA 3NE6A 3T9ZA 2QN6B 4HHHA 5KFJA 4F9OA 3NDKA 4AL6A 1NSQA 1XMOJ 3I0SB 4RNFA 3VOVA 3CJ0A 3NOCA 2CJ9A 3OSPA 4IFVA 1T7PA 2BVZA 2CJAA 5HANA 3GL1A 3GG0A 3PX0A 4ZMMA 1MNEA 1LWCB 1VSDA 4E1NA 3ZT1A 4BLGA 3TUIC 2RQCA 1K8KA 3VPZA 3HHKA 3NMAA 3US5A 1QDUB 4CHQA 1FRIA 2DCUB 3RWUA 4IH6A 1RWNB 4KB7A 1V5VA 3S7RA 4ZVTB 4DPTA 5LSOA 4CTAA 2B9EA 4F2SA 1WSHA 3PIPL 2BUNA 5KGXA 2HPUA 2E2PA 3MCAB 4LQ3A 4AH9A 3MFIA 2RS8A 4MKAA 2GX9A 2DGWA 5B7WA 2KVQE 3BUZB 1S1TB 3M9NB 3HULA 3SUQA 4Z4HA 1YIJN 2IYGA 3IFRA 4Q44A 2RE2A 4BRCA 3H4BA 4CJSA 3QLHA 1ILYA 2EKNA 3MAQA 2CPZA 4NYOA 2AX1A 2UUAF 1VQMS 2AEJA 2YNFB 3WNHA 4JI6K 5D3GB 1JMTA 4WFBL 3THTA 5DJBA 3THVA 2MQNA 2BW2A 4UOHA 2PBDA 3PYDA 1CJUB 2NXNA 3HLUA 4LIRA 1X5OA 4NLRA 1Q18A 4BRKA 5DZ7A 4KR0B 2IJFA 4ECRA 1C1BA 2KXHA 4FS2A 5M1OA 2P51A 4DFPA 1Q79A 3HD1A 4UF4A 2XMJA 1WC0A 2DGOA 2WVFA 1EKRA 3AB4B 3U9DA 2HFNA 3VQTA 4O3QA 1S77D 3G25A 2G0JA 4UT4A 1G99A 3T1HK 1SB6A 4C8LA 2D0CA 3FCVA 2B7CB 4B3TJ 2HLTA 4ELUA 3OV7A 5CHIA 5H9EK 4ZVQB 4PQUA 2OMOA 4RUHA 3NCQA 4DV1F 5EXWA 3DOKB 2Q66A 3L0QA 1K1SA 2MPUA 1HD1A 1S72S 2CZ9A 1NZAA 3GSDA 3CQ8A 3AODA 4LD0A 2AU0A 2SXLA 1HNIA 2QFIA 1GOBA 3SPZA 4DX8H 2HAIA 3UD3P 3TANA 2P9PB 5K20B 1WOPA 1RT1B 3DJCA 5JLFA 2ZWPA 2R2TA 1X4DA 3EUNA 2FVRA 2EWHA 4QZVB 2JEGA 4B3MK 5KT2A 4ILGB 4FZVA 1EXQA 1EWRA 5ETKA 4NXNJ 2EG1A 2RDJA 2BTFA 4ILHA 1S1XB 2VG6A 3DRPB 3G6YA 2DHSA 2OIHA 1M90T 1S76D 2XZTB 3MWBA 1YI2N 1QSSA 1HPMA 1XHXA 1GH8A 2AJ0A 3WX8A 2KYZA 4RR5A 2UP1A 1YBAA 2CDQA 4DSJA 5L9XA 4DPWA 1DGKN 5CD4H 2EC2A 4OKKA 2GUPA 3M6UA 2I7NA 4JYAK 1F2GA 2KFYA 4CHYA 3AAWB 1NB7A 1HKCA 3DRXA 4FJGA 3D6MB 2HGLA 1WHVA 4KTWA 3LPEA 1MROB 4JV5K 1EO1A 3IBCB 3T3FA 3VQSA 3BSOA 3VGLA 1XMBA 3P38A 1CJKB 1RAAB 3HHEA 1RDRA 3FQKA 3EGVA 4WCEL 4FLUA 1HBUB 3VQAA 1DJ0A 3ET6A 5KAKA 2DR8A 1JLEA 2FLOA 5IC4B 3O80A 2MGZA 4DUZF 1NMNA 1FRKA 2GQ2A 1Q9YA 3EXCX 1MWQA 2N4CA 2UYTA 4PRFA 3QEWA 3QMLA 5I42B 1UVJA 1RT4A 4USJC 4I68A 1ZBIA 1T44A 3R6GB 3NFAA 4LSNA 2V9KA 2HHTA 4RW4A 4GC6A 3RAMA 2BRLA 4QOTA 4R79A 3K9KA 2E29A 3SBGA 1SC6A 3M2RA 1KBRA 1W7AA 1T9UA 5CXTA 4IG3A 2AEMA 1H7XA 2M8HA 1JJ4A 1QVGM 4CGIA 3VF4A 2QKBA 3UNGC 2JVOA 3KLIB 2YNGB 4IG0B 5LMNF 2L9NA 4NPOA 3PIOQ 4MYUA 2NRXA 1RTZA 5AQTA 4ZN1A 2BJEA 4TU7A 2NLXA 4IOCL 2JRSA 3BR9A 3CCZA 4USIA 1K0VA 3AVHA 2ZOFA 4NXMK 1PBAA 2YKQA 3QIPA 5E3PA 1VQ8S 1N32F 2IC3A 5G0RB 1VBZA 2ZH3A 1N33K 2R2SA 3A8KA 3BQ1A 2X6NA 1TK0A 4YB6A 3WXIA 3QGHA 1FW6A 1M90O 4E98A 1KS2A 4CLTA 4GKKK 2QLJB 4ECUA 3T1HJ 5AZIB 2M7SA 5ETRA 3QAUA 4OKEA 5M1KA 4LH5A 3C16B 4M5KA 5H9EJ 3LQVA 2HHVA 4CJ3A 1Z05A 2RE1A 3RR8A 3BREA 1Z2ZA 2FJWA 3CPWR 2DXEA 3UD5A 4DQ8A 4EHTA 1RE1B 4CYUB 5BPNA 4HTJA 4EBEA 4WIIA 4YR0A 4CJPA 5DRKA 5EWGA 2AKWB 1SS6A 1B0TA 3CJ5A 3HF5A 2ZVIA 3Q8UA 1TKZB 5HVFA 5HMWA 2ZJPQ 3V6HA 3VMFB 2YKMB 2GIQA 4WFAL 1RT3A 2QEXN 3DLKB 2QSWA 1XNRJ 1KVBA 3VAKA 3AVNA 1JCGA 4FW1A 4DPOA 4CGDA 2MKIA 1BLUA 2QLFB 2PGCA 3QFPA 2FBTA 4NLGA 3QMQA 3OYFA 3KHHA 4CERA 2IRXA 2KDOA 4WE1A 1F3VA 5JJBA 4K4VA 3CB4A 4N8NA 2UUBK 4CBWA 5AQKA 1HR0J 2O8BB 1WF0A 4IO9Q 4RG8A 3WC0A 3BQ2A 4AHRA 1WI6A 3GFHA 3O4QA 1R3NA 4CZCA 3BF4A 1RTIA 1SBRA 2FZKB 1CQMA 1NDKA 1ZPVA 2Y1IA 4CEOA 3C66A 2VBWA 2J8AA 1U8SA 4LF5K 3VAIA 4RUCA 4QU6A 4CZJA 4P75A 4JI4K 1TV6A 4X4OA 2R9LA 2B5JA 4JYAJ 2WAQD 1N5QA 3C19A 3DLRA 3A3OB 3KYLA 3FCHA 1LK5A 2C28A 1RADB 4H4KC 3R5GA 1BC6A 1VQ7S 1UPPA 4B3RJ 4J9KA 2RDIA 2CPFA 2ASPA 2DXDA 4DSFA 2BJ8A 1RTJB 4QWEA 3B78A 3KWMA 2LXUA 2PEBA 1PYOB 3DLGA 3JAMY 2R8KA 4BC5A 1IR0A 2NXUA 2OPRA 1U04A 3ZZOA 5HBMA 5C2CA 4JKDA 4ZCLA 4UY8T 1W9HA 1EP4B 4KFBA 1R8HA 2ATQA 4BC2A 2KKZA 5KFPA 4I69A 1FDDA 1N6QB 5F2RA 2ILZA 2QWQA 3HVWA 2ADCA 3L4IA 1OH5A 4X62F 5A0YA 5KRTA 4KHNA 5ETTA 1S0VA 4DFMA 1P8ZA 4I64A 1U1MA 2F4VK 4UUXA 2J5AA 2DY9A 2OTLN 3BZCA 3I6PA 2MQMA 3PDNA 1VSMA 2D0OA 2IPOB 2Z2YB 4ZCKA 3HI0A 3GSIA 1VQYA 3MECB 3V9SA 4JI3J 2AX0A 4IDHA 5AQHA 2ZWHA 1QAIA 1UFKA 2G8HA 2V63A 4FLYA 4PG8A 4CVNE 1HWJA 2D4WA 2CRLA 5L1IA 4K5RA 3DOLB 5BR8K 3M2VA 3GCXP 5D0HA 3ETOA 4HHUA 1VCTA 2FGCA 3W64A 1ATNA 3MI7X 2D3UA 1N33J 3TSQA 5HVHA 1A5XA 4B1ZA 3HXMA 4N77A 3IP0A 3NOGA 1ZC6A 3GV5B 3M8YA 4J37A 3RB4A 2WFBA 2JX2A 2WW4A 2E5IA 2BZ2A 2NREA 1XR7A 3TEHB 4LFBJ 1R43A 5I3UA 3FZFA 1C0UA 5BRHA 3I9ZA 1N88A 5GAEI 4ED1A 1LWXA 2DO4A 2VD3A 2CIMA 3GG4A 1TKTB 4F3OA 4MK7A 1C1CA 1RHUB 3AFGA 3BSAA 1SC4B 2WC9A 3CHWA 2XGPA 4K2JA 1NUEA 3KLEB 3R8EA 4DR7F 3HHLD 5HQ8A 5GAHU 2P8IA 1X4AA 4LF9J 2ZH1A 2P9GA 4GV6A 4R0JA 4FVUA 2CQ2A 5DDOC 3TW0A 4C0HA 2EWSA 2GV9A 2HVHA 5J2QA 1LW2A 4YB1P 2UUBJ 4LFCJ 4GO7X 1S5JA 4UY8O 3OR1B 4F67A 1DLOB 1ITGA 4ZVSB 3FZKA 3CUNA 1DT9A 4X4NA 1V3RA 1DFDA 3JS6A 1KQGB 3JAMO 1J5OA 4ZVPB 4AL5A 3LDSA 1MN7A 1M5VC 4FKYA 3M1FA 3TOQA 3W7BA 3L7UA 2ACMA 2GVDB 2HVIA 3H0PA 4LF5J 2E1MC 3DRRA 3WBZA 2CPIA 4GV3A 4DL0C 4JI4J 4PR6A 3PKYA 2QSFA 2VA2A 4U7CA 3P96A 1LQ9A 5AQVA 3UD4P 5ETNA 3RB6A 2QZ8A 4EAHD 1LW0B 3S9HA 3W2WB 3MF5A 1RHMB 4W98A 4E19A 1HRHA 3PHTA 5DQIA 3G6XA 4DR3F 1SL2A 3CC7N 3RU0A 4DV4K 4H8KA 1KTVA 3G6VA 2QTWA 2AT1B 3CC2S 3AXKA 3DRSB 2AIRB 2H4WB 1TVRA 3DXBA 1SH3A 2XCAA 1HI8A 3N6NA 4B9SA 1S4EA 1BI4B 3CJCA 2FJEB 2PAVA 1G1XA 3UPFA 2JLGA 4B1XB 1EKSA 2GQCA 3O4NA 4FXWA 1SKRA 3EYZA 3BGRB 1D09B 2W2PP 1S6QB 3DXMA 2YKOA 2HHHK 5KG2A 2Y1JA 4NOHA 4XH4A 1KCFA 3Q83A 4YB7A 2Z2MA 4CI6A 3MEDA 3EVWA 3C3LA 4CK2A 2F4VJ 3G0ZA 3VF0B 2MQPA 1U0SA 4HDGA 1T05B 1TKDA 4P7VA 4RW9A 3CCUS 2W9CA 4CD1A 4L8RB 2VKZG 4PKDB 4J9SA 3I82A 3C15A 1Q8BA 2YTCA 5HMYA 4JI0K 3JSMB 1MWYA 2O67A 2XZWA 4OHWA 3CCSN 1UJ6A 2MHEA 2UUCF 1MWKA 4EGLA 1WF1A 1XIQA 1HYSA 3AB2B 3I56S 4BVPA 2JC1A 4OYIA 1JJ2R 3T5HA 1SVDA 3QESA 4WFNQ 3BB5A 3QWPA 4WIQA 4V19J 4OMFG 3UN2A 5LXYA 1K9MT 4MK8A 1LFPA 1LK7A 2O4IA 4DSIA 3GE9A 4IOXA 3BBCA 1X3MA 2QW9A 5ETMA 3K7RA 5F8LA 2YWKA 4ZHRA 2HAFA 3H2VE 2ZH9A 4AFFA 3OR2A 2FTRA 4YOTA 4JUZA 4G9ZA 2IMOA 2X74A 5D0RA 3O3GA 2CFXA 3IC1A 5CD4A 2VQEK 5EGYA 5L39A 4BCAA 5HOOA 2AWZA 2GIFA 3I0SA 1WKLA 3OYCA 1U0HA 2HS4A 5A8KB 4K8RA 4N41A 3V6JA 4I0WA 4Y34A 3PW5A 4FXDA 3HHLC 2A3JA 1LWCA 3OXGA 2YX7A 1PAEX 2YX1A 3C6HA 3M05A 1AFJA 1GXUA 3R8YA 1UVNA 4LF6K 2DGXA 3O3HA 2HSTA 4OJGA 3FZBA 4LMZA 4CD3A 2HG4A 1UVLA 1UFWA 2FSKA 4HDHA 2OKQA 3RBEA 1REGX 3P3DA 4YDUA 1MDUB 4FDFA 4HL9A 1RWWB 3H5UA 3MN7A 4J9OA 4LFAK 2FZCB 1QY7A 3HTVA 2OTJS 5BYRA 1IBLF 4QS9A 2P1JA 4QU7A 4FWKA 2M88A 3JXOA 2E9ZA 3GJQB 4JI1K 1FD8A 3FR0A 4RU2A 3KOAA 3TAFA 2XMTA 4DL4A 1JNRB 4KGMA 4KY3A 4LF8F 5C0YA 4JV0A 1K73T 3R6MA 4R8UB 2HQCA 5EOYA 1KHVA 5D3GA 3LM9A 3CCLS 2EFOA 1CJUA 4CIEA 4CLFA 3ZX2A 1XQIA 4M5LA 1XWLA 3M9MB 1T9YA 2IA0A 5MLCQ 4ZLPA 2CQ4A 2EXUA 3NGSA 3F44A 1T02A 5GAEP 5D0EA 2NRVA 3VQ5A 1ITPA 2DNMA 4DU7A 3NGYA 4B9UA 4FK4A 3QJJA 5KOXA 4FVCA 4HH0A 5ADZA 4A8WA 3HRGA 8AT1B 4WQ4C 1K9MO 3QWUA 4ZVHA 1Q5YA 3HT0A 5LMUK 3BDEA 2O8CB 4QWCA 3Q0AA 2RPIA 3KWGA 3LDLA 1OWXA 3H5SA 3OQ2A 1B7YB 1IKWB 4BS2A 1V4TA 4HT5A 1VRUB 2K8GA 4UW2A 1H3DA 1QLNA 3DLEB 4MQ3A 2LEBA 4CT8A 2CQ1A 2E6MA 3UDLA 3UVJA 4PHTX 3FNNA 2YWFA 6FDRA 1GLBG 4M3UA 2YKNB 4RW7A 2GV1A 2ZUAA 3T41A 2JEJA 4KKOB 1HUXA 1TL7B 2CQHA 5D4OA 3ZT2A 1AA1B 1R8CA 5C42A 4PPZA 2P9PA 2LA6A 5GMDA 3FEYB 5IC6B 1WJ9A 2QMXA 4GKJJ 4Z4FA 2BE2B 3IM9A 3RB3A 2YHWA 3HVTA 4BR0A 4XPEA 1NZ8A 3A2FA 3HX9A 3CD6N 3QEPA 4LF7F 4JKCA 2Y3YA 2HKEA 1TQLA 1YITN 1FA0A 2XQCA 5HK4A 1LAVA 1LWFA 2GTDA 3OYEA 2DGTA 4JI5F 2W6LA 1HNXK 3ZETB 3HMJG 2DTUA 3PJWA 1S1XA 3DRPA 1YX2A 4P2SA 3MN5A 4DR6F 2UUAK 2UXDF 2B4PA 2R42A 1XQSC 3CIMA 4DU3A 3LUYA 2UU9F 2XZDB 2RU9A 3TTDA 3DLJA 3DMJB 1DARA 1K73O 2F9WA 3O1WA 1D5AA 4FVMA 5A8WB 2KI2A 3D9BA 1CJVB 5C2GA 5BRDA 1A9NB 1KAXA 4J9VA 4B17A 1EAYC 1MROA 3OSNA 4M3XA 1F5CA 3J7YI 3BM7A 2KW4A 4WP3A 2UZAA 1HA1A 2QWRA 3NH1A 4BDZA 3V6DA 1BGXT 4MJKA 1CJKA 3MXMA 3NS5A 4F4XA 5CR4A 3L09A 4CEFA 1CS4A 2DPJA 2IMWP 4LF6J 4BDYA 4R0EA 5B0CA 4FLWA 4ZVEA 3KFWX 1JLCB 4F7VA 1F60B 1V5IB 2PFDA 4F25A 2Y9HA 3VEXA 2FHOB 1B64A 3U1NA 1IBMF 1WACA 3EWGA 3FFKB 4ISGA 4DV1K 4CHOA 4ECWA 2F8MA 3BGUA 1I94K 1UJ5A 3KLVA 3FRYA 3TQ1A 3VQCA 5I42A 4DX6A 3KHGA 2FF6A 3EPIA 1PGZA 3MFHA 2J7WA 3MCPA 3SQ0A 3HPOA 2C1EB 1F0XA 2DHXA 2HYIB 4NEZA 4V19X 4OX9F 1T11A 5KG6A 2N3OA 4L3QA 4PUOB 4A8YA 5KPZA 2V2VA 4RNHA 1CEZA 3C6UB 3ADAC 3KLHB 2D3ZA 3HT3A 4J2BA 3SBMA 1D9AA 3AO2A 3QFUA 5B08A 3LP0B 4DHYA 1HNZF 4DR2K 1U45A 2VJVA 3PX6A 2ZM6J 2XO6A 3KLIA 4IG0A 4H5VA 5L9NA 2GMHA 4AE5A 3A8IA 4LT6A 3EXYA 3CQYA 2EW9A 3KLFA 3BF1A 2MKSA 4DL7A 3D67A 5G0RA 3D0GE 1M0SA 2YHBA 2HQ3A 4PG7A 2H5EA 2RNEA 1KN6A 2J0XA 2C2KB 3PSFA 1HBMA 5LMUJ 1MG7A 1T94A 5KFAA 3KD5E 2H3EB 1GMWA 1YHQN 2HBYB 2W25A 3PW0A 4B3OB 3C16A 1H0HB 4CWBA 3DOMB 2AP1A 3JQMA 1L5UA 3GJTB 3P83D 2FUG9 4OLOA 1LCUA 2N3LA 2ASYA 4NLOA 2BABA 3CMEN 2HRUA 4CYUA 2BJ7A 4E89A 3ATUA 3CEDA 4GVBB 3AA8A 3I32A 5KTQA 2HFZA 1GFWB 4MDAA 4H0TB 1W2IA 2F7VA 2YY3A 2RQ4A 1TKZA 1TFYA 5BPMA 4F4AA 3J81j 3NS7B 2YKMA 4OX6A 4DJBA 3DLKA 5CE3A 4DUZK 1Q8IA 5M2PA 3PW7A 2BQ3A 1ZA1B 3GR0A 3SJJA 5AZJB 3KUGA 3EDRB 4JI2F 3CF5Q 3SLCA 2ZZTA 5JS1A 1ICEB 5FLXY 5FPNA 4OI6A 4CBUA 3L7PA 1UVMA 4LVOP 3DXKB 2V2KA 4A8KA 4CCHA 4CGFA 2LEPA 1H2VZ 4YP3A 2O8BA 1N8RT 2HGMA 1HNXJ 2DY1A 4BR9A 4A62A 2R7UA 3O8MA 1JL1A 4U7UD 1XMOF 3PSIA 3FBFA 2D1CA 1G15A 3QRRA 4GO5X 3D1QA 2WSEC 1ESVA 2PYLA 3F41A 2AJ1A 4OI2A 5AQZA 1UEKA 1J54A 1A0OB 1RU2A 2RIJA 4OHZA 3UE2A 3IWNC 2WB4A 4XIUA 2AJQA 1MWZA 2LLZA 2XS5A 4MYTA 2MKCA 3TTCA 4EYIB 2ATCB 3RMDA 3MDQA 3ASMA 4S0MA 2AV5A 2MDAA 4ZIWA 1RTJA 4RKUC 3FEXB 1KNZA 1O0PA 3H3NO 1P9QC 5LJ5Y 1RAIB 1JLGB 2JNJA 4A47A 3CJ1A 2CQDA 2XWYA 2JEIA 4AHTA 1ZPWX 5THWA 5AQRA 4BRGA 4QOZB 1X5PA 4Q0BA 4M7YA 2KJVA 3P49B 3KLGB 1RKIA 3T19A 1I94J 2UXBJ 3BGLA 3M8PB 4OGCA 3CETA 2E5HA 3D7EO 4F50A 4NB4A 1N6QA 1B9FA 1OSDA 3PM9A 5CYJA 3OBIA 2E7VA 3CC4S 3R5BA 4HUEA 4DR4K 1WEZA 2OD4A 3HM8A 1HI1A 2DFEA 4Z7YA 5DS7A 4C3KA 2PI5A 5BREA 3MM9B 2LQ8A 4CF9A 4LF1A 5HL7Q 2FHMA 1HNWK 2XCPA 4WXOA 3D1OA 4DBQA 1L3SA 3CPWM 2X1GA 3MECA 1JWWA 2IVPA 5EU7A 1RWMB 4FM1A 4DR2J 2MJNA 3CG7A 4FCYA 5KFQA 3DOLA 3EY1A 3TRGA 1YBUA 1UETA 4B3TF 4CIOA 4YNQA 5J1PA 1TYQA 1N8RO 1YJUA 2IM1A 3HI9A 4B9QA 2ZNZA 2O8FB 3FLCO 1RDUA 1BWEA 2AJ4A 4X4RA 4KPYA 2JFDA 5J2PB 2NR0A 2JWKA 3EL2A 4AILC 3L2VA 4DHVA 2PT0A 1FKOA 4DTJA 4M63C 2NZ4A 2HFOA 2J7UA 3M8SA 5FLXO 2OH2A 2DPIA 3WQTA 2E5GA 1NGBA 2CJYB 5HLFA 2LA4A 3NGKA 5FIIA 2ABYA 3A0IX 2ZUGA 3W60A 3G8TA 3DNCA 4DV2J 4GRSA 1WG1A 1FEEA 3L8BA 3IWLA 1P6TA 3NXZA 1EWQA 3BGFA 4N5SA 2MZTA 4OLAA 3RSEB 4O4GB 4EZ9A 3R27A 2P9NB 2HZAA 4CLSA 4NXNF 1Z2LA 2V7ZA 3A8YA 1CQNA 2CQGA 1WC4A 4NLYA 3IS9B 3HSZA 3QETA 3QBCA 2RRNA 3PEJA 4CJUA 2DNQA 1YJWN 3PIPQ 1DLOA 3SV3A 5BYSA 1S0OA 4O3PA 3J81U 3PY8A 4ILMA 1IQTA 2PFFB 2E2QA 2RSQA 4FLZA 5HROB 4HUGA 4JV1A 2HMIB 2GVDA 2VONA 2UVRA 3ATVA 3MWPA 1CLFA 4DQPA 2OO4A 4QPTA 4OZLA 2HNDA 4M42A 3LTOA 1TMMA 1TKXB 1EQ0A 1WLJA 2OPSA 1M5PC 4ZPVR 3OA9A 1RTDA 1C0GA 4WFBQ 1SJ3P 1W0HA 3R1LA 5D15A 5L38A 4CJQA 4M7XA 3R5CA 1TFWA 3ZZ0A 3D5MA 2E1YA 1WN7A 3Q8RB 1DURA 2E8AA 4KHYA 1VQPN 3TJ8A 2CDRB 4XDCA 3VEYA 4GMJB 2IRYA 2EFPA 3TUZC 3GMGA 2Z1JA 1S97A 1RCOB 5IQQA 2K3IA 3DRSA 3TAMB 5KT3A 4K4SA 1J9AA 4ALZA 3IAM9 1K47A 4WXWA 4MAKA 1BI4A 5LM7E 2AP6A 1GAOA 3MD1A 3VQ9A 2GJ2A 2OELA 2XNQA 2C2ZB 3BGRA 2IDEA 2AA4A 1S6QA 2DY4A 5E5NA 5LT5A 1N5SA 4MMOA 1LEOA 1NPPA 3VWSA 3W5YA 1MMNA 4DR7K 3SAFA 3NP5A 2HZVA 4DR4J 1RWPB 3P5TL 2A40A 4CIGA 4Y2MA 4E7LA 3CE8A 3Q86A 1T05A 3TX8A 5J1EB 1PG5B 2BANB 3A5NC 3JSYA 2NRZA 3H90A 3VQ8A 3FFIB 2QI2A 1HNWJ 1GLFO 1WSEA 5DLFA 4AXIA 3W61A 2DRAA 2KYXA 3BV8A 2WBNA 1KVIA 4CJ4A 3MMBA 3O5TB 4KHPJ 5IT9Y 3CCEN 4DCHA 3T1HF 5CYMA 2A6AA 2GMJA 4OX7A 4CO3A 4WF9L 2CZVC 2XY6A 4MLEA 2M0GB 4IFVB 2E20A 4N7TA 4OIXA 2J9CA 2ZFHA 1YKWA 3O1BA 4F3TA 1LXNA 3HOSA 1TL5A 4HVZA 5AXLA 2DIUA 2BACA 3D6HB 4KPCA 3Q8SB 3WXKA 3PNIA 2Q6BA 3CPEA 4LSLA 2BYCA 3TSUA 4DPUA 1S22A 3OVBA 1JCFA 3M4XA 4PKHA 1X0PA 4DZ6A 2O8EA 1G3OA 2XHBA 1XNRF 4AYBD 4ED0A 3SQOP 1S1WB 2MQLA 5A8KA 3J7Z5 4E1MA 2KXNB 1XHZA 2CKWA 5KG1A 4OV6A 3EVMA 4KGKA 2J0QD 1WC6A 2DT9A 3ZNJ1 4J9PA 1IBKJ 2N4DA 1HR0F 1F9FA 4IR1A 2R7QA 4B9MA 4WCEQ 4EBDA 5I4MA 1Q16B 2QA4S 3H8YA 4ILJA 5IOLA 1YJ9N 4FJLA 2YHXA 1S0NA 5EX0A 1OMSA 1NCLA 1Z25A 1PKUA 3J7AP 3CJ8A 5K8MA 5KFBA 5BRFA 3O4WA 4USMA 4C7QA 4HLBA 3U3YA 1Y9OA 3MM6B 3IBWA 4JYAF 3D6FB 2VFSA 1TUWA 4CHPA 4HYKA 2YH1A 4NX9A 3OL6A 3QFHA 4XAKA 1MU2B 1BWVA 5E3AA 3IRXA 1T03B 2O5DA 4KQZA 4B3RF 3ZSQA 2BX6A 3PLAA 2KTQA 4R8UA 3KDNA 1ZXOA 4PXEA 4X64K 4RCHA 4YFUA 3BJYA 3IMQJ 3U27A 3OS0A 5KG7A 3IO1A 1NJXA 3EGNA 4J7CA 4E7IA 2V4QA 1FDAA 4H0PA 3QO9A 1HWUA 3RG6A 3RW7A 3I5CA 1RT6A 1RLCL 3THXB 4OI1A 3P45B 3ULEB 1CBKA 5CABA 4Y3CA 1DZ5A 1QQCA 2VGMA 4ECYA 1ZA2B 3P6YC 3G71N 2LECA 3ILIA 3OYKA 4ZLLA 4IOCQ 4E2FB 2KZZA 5BR9A 4DR1K 4PG4A 2G0CA 3HJVA 5DM7L 3X1LB 1Z26A 5JMNA 1D8ZA 2OP5A 1BE4A 2FLLA 2XY8A 4CGGA 4Z0UA 3OTCA 3CDUA 1BCOA 2CWXA 1U1NA 1JJ2M 2HQFA 2HK2A 3AD9C 4Z4CA 2NRHA 3Q24A 3IFEA 1VRUA 3GZ7A 2PDAA 2ZC3A 2O66A 3ZZZA 5F0WA 3Q8YA 4DQQA 1BCMA 3UR0A 4B9LA 2JSXA 3NBPB 1HHTP 3M8RA 4O0JA 4GVLA 4JI3F 4IUFA 2DCLA 1B0PA 3J80Y 2XY7A 2YNHB 2VG6B 1RK8A 4KKOA 5B8HA 4WZQA 4WFYA 1TL7A 3RW6A 4ZOSA 3E3XA 5F8IA 2CPDA 2K06A 1RWVB 4WFAQ 4I2QB 2UV8A 3U3GA 2HVEA 4LIWA 4PG5A 4BRDA 1KD1T 3SQ1A 2B9YA 4NXMF 4WTYA 2V5HG 3CWJA 4CBXA 2ZQBA 4F0MA 1N33F 4BC7A 3S6EA 1NG9A 1WF2A 3ZO7A 2FJDB 4B1UB 2CJXB 4FO0A 1N5TA 1YZ6A 1ZM3A 4M5MA 1Q9XA 3MD3A 4NZ6A 3CMQA 2Z0GA 5CYQB 3O8WA 4F8RA 2IS3A 1M5HA 3D0PA 3D2FB 1M5KC 4E8UA 3K0SA 2G8KA 2UVVA 4E7KA 2ETJA 2GO8A 3SMSA 4DV3J 4LFBF 4TXSA 5KFWA 4HTLA 3M6GA 2KRRA 4MIWA 4BC4A 2HK3A 3AVGA 1R0BG 1KQSM 2L9WA 1GLEG 5K8OA 4AD6A 5A2QO 3ZZPA 1SH0A 2F1FA 3DMJA 2V6AA 2Z8QA 4CZEA 3DGPA 3SZ2A 4DG1A 1OY9A 3D3CJ 4RBTA 1U2FA 2ZBPA 2VBYA 2LKZA 3NAIA 4DFJA 2KHOA 3UO0A 5AQLA 2FYXA 3DDKA 1N5YB 4LF9F 3V1OA 2I6WA 4P2MA 4IJNA 4EFAC 1CC8A 4XPCA 1SQKA 3EE8A 1HW9A 1TUGB 1C4CA 3QGIA 1HQEB 2QGFB 3A5LC 1RT4B 1T8EA 2UUBF 4D3HA 4LFCF 2CVIA 2GHPA 1WEXA 2D1KA 4CO5A 5GINA 1TUVA 1VQ9S 2OPPB 4WK1A 4RW4B 3EN9A 3L95X 3OYNA 1JLCA 1DKGD 4CZMA 3VQBA 5G4DA 1PSDA 1YXQA 4IRKA 2C3MA 1VQ6N 4X2BA 4GVEA 5KGWA 1Y10A 1S10A 2ALZA 3P4UB 4LF5F 1R31A 4KREA 3ID8A 2G13A 1H74A 3D2WA 4JI4F 2RVJA 2VJUA 3HZEA 2I0XA 2VWBA 1KKHA 1AB8A 4JI7J 4LREA 4QR0A 3JS9A 1RDDA 2FLPA 3P39A 2XYGB 3PFEA 1Q7LB 4A8QA 4PUOA 1GQEA 3G96A 1DQAA 2MKKA 5E3QA 3ZSXA 3A4TA 2G8VA 1RGIA 4OZ1A 1VC0A 2IC3B 3KLHA 2RQKA 3NF7A 3NAEA 1OJ4A 4X64J 4C9DA 3SQ4A 2J7KA 4LC9B 1QAXA 3ZSYA 2AEFA 3LGHA 1TGOA 3GR1A 2YH0A 1KD1O 3T6JA 4ZJQA 2BR0A 3LP0A 1IVZA 1XBWA 4CJEA 1FVQA 3EPGA 1QM9A 4DUYK 4O3OA 3QFWA 5AE3A 1HKGA 2GW8A 2C2EA 5GAGI 4AHUA 1GK8A 1HHQA 1X4GA 3J80O 4KHQA 2UU9K 3B6OA 4ICLA 4TYAA 2B8QA 4DR1J 2BH1A 3WUHA 4HACB 2EI5A 4JN4A 3V81A 2A2CA 4L3NA 2DIVA 4P74A 5C25B 1AUSL 3HKZD 1TUUA 1UW4A 3HM9A 3GOIA 4DR5K 1YSJA 2HZCA 4IFYB 5KFFA 2V4JA 4V1Ak 3OUYB 2F4VF 4O5BA 4F4KA 4QS8A 5AJ3K 4X84A 3WNFA 3NF9A 1WEYA 3RGIA 3N4QA 4CEEA 1W97L 1XR5A 5AXNA 2VFRA 3MN6A 2W2NP 1BG3A 2NRTA 4F4YA 3O9TA 3L9ZA 3CCMN 1EKEA 4XK8C 3IXQA 2W01A 4NLXA 5KPTA 2CUYA 4H4MA 1IQZA 4LRCA 2HW3A 5BR8F 4J2EA