3KLHA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to post-translocation aztmp-terminated dna (complex p)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 129
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klhA05
3D0PA 3HM9A 3CG7A 2V9WA 3OJSA 1RYRA 3CYMA 4WXWA 2OPRB 3CM5A 4IKFA 1SUQA 4QAGA 3SQ0A 3LPUA 2WTFA 1NHVA 2IM1A 5EWFA 3M8PB 3C6TA 1EP4B 3VQSA 3KLHA 1JLEA 4H54A 2P5OA 4YR2A 3KLEA 3F73A 1RT5B 4WE1B 4ECYA 2OZMA 4FLUA 1MU2A 2Z1JA 1RDBA 4E89A 2QE5A 3NF6A 1F21A 1QSLA 2VG7B 3L3UA 1S9GA 1DLOB 4JV1A 4KHSA 4FJ7A 3SNNA 2YKMA 3TAMA 4L8RB 1CXQA 4W5OA 4URQU 2J6TA 4YNQA 5HRNA 2B6AA 2XY7A 4ZP6A 3NHGA 2RDIA 2FBYA 1R0AB 3BSNA 4OPKA 3OYCA 4E7IA 1Q9XA 5KFDA 3V1RA 4M95A 1LWFB 4OLAA 2HW3A 5KGXA 2BQRA 3KLIB 5KG3A 1U45A 4WZQA 1S1WA 4CJRA 3MEGA 1L3TA 2GV9A 4M45A 1FKPA 1SKSA 2RF2A 4TY8B 3ISND 4M3YA 3PO4A 5HRSA 4NLVA 1IM4A 1LW0A 1VSMA 4F4ZA 1B9FA 3VA3A 3H4DA 4KRFA 4NLGA 2E6LA 1N5YA 4AHTA 4BWMA 1X9WA 3DLEB 3OSPA 4ELVA 5J2MA 3V9UA 1BQMA 1S9EA 4J9LA 3O3FA 1Q8IA 1K1QA 2JGUA 2HWIA 1TAQA 3HXMA 4H4OA 3KKSA 3IGNA 2G8VA 2QK9A 2C2EA 2Y1JA 2HMIA 4IRKA 3QEIA 1LAVA 4HCCA 2HB5A 3MR3A 1TL3B 5KFSA 1LWEB 2OPPA 1JLCA 4FM1A 1GOAA 4CEOA 1RNHA 2QV6A 3ALYA 2KZZA 1IO2A 2PYJA 3VQAA 1GOCA 1TK0A 2F8TA 1S49A 1QS4A 3SZ2A 1SL2A 4EP5A 3OL9A 4BDPA 4J9NA 4TYAA 3OYJA 2IDOA 1LWCB 1ZBHA 3BREA 1KFDA 3IG1B 4Q5VA 4IFYB 1KTQA 1QAJA 4TN2A 3TAQA 1JL1A 3DRSB 3CIZA 4RW8B 1TL1A 4FJ8A 4O3OA 2R2UA 4RW6A 3OLBA 3NCIA 1RILA 1T05B 3MXIA 4O3SA 3VQCA 5J2NB 3IRXA 3AA4A 3DYAB 1C1CB 2GBZA 4NCGB 5HP1A 1TKZB 3SV4A 4DF8A 4CEEA 1SV5B 5KFKA 1W9HA 4E19A 3QLHA 4KB7A 4NYNA 2OPSA 4CCHA 1HYVA 4N41A 3KJVB 3NGIA 3DDKA 1T03A 1RBRA 5KFCA 2XGPA 4U7CA 3DRPB 1HMVB 3DLKB 3CFRA 3AVMA 2V0NA 4ZP9A 4CGIA 2VG5B 3BR9A 5F8HA 4WFXA 3SUQA 4FVMA 3ZSVA 1JLAA 3KHRA 5HRRA 4KFBB 5I3UB 5JUMA 3NE6A 3SFGA 2HNDB 4G1QB 3OL6A 5FROA 1TAUA 2HHWA 4E0DA 2BGGA 2AX0A 4O44B 1U48A 3M8RA 4FJNA 2GC8A 4N76A 4DMNA 3NF9A 3FDSA 4ZHRA 3U3GA 4I7FB 1JIHA 1XHZA 4FLYA 1W25A 2W8KA 3TWHA 4ZVEA 4R8UA 2AU0A 2I5JA 4FLWA 3QGHA 3E01A 4XPCA 4RW7A 4FLVA 2YKNB 5KT4A 4ECWA 1RBVA 1TVRB 1JLQB 2IJFA 4O4RA 3NMAA 1S1TA 4LSNB 3HVTB 3KLGA 4K4WA 3AVCA 4RU9A 1S1UA 4KAIA 3OS2A 4FJ9A 5J1EB 4RNOA 2DFHA 3CQ8A 1X9SA 2VG6B 4ECQA 3RB4A 4E7KA 5J2PA 1D9FA 2YNHA 3THVA 4RUAA 5KG1A 3K5MA 1BIUA 4XPEA 4BE2A 4YR3A 4FBUA 3PW0A 4IDKB 4O5BA 2CJQA 4IRCA 2XI2A 2EC0A 1C0MA 3VQ5A 1SH0A 2WONA 4OVLA 1JXLA 4DSKA 3CFPA 4TSXA 2QKBA 1C2PA 4AHVA 5E41A 3DLGA 3O3HA 4K8XA 3SUPA 3OYAA 5KG6A 4J9QA 5KG4A 3ZT3A 1KFSA 2R8JA 2G8KA 4BWJA 2HNZB 3MF5A 4M3UA 4Y3CA 2O4GA 4KKOB 4NLOA 1WAFA 3TANA 1G15A 4CF2A 1RT3A 4KI6A 3DOLB 4AHUA 1RA6A 3TAFA 2V4QA 1NKBA 4QWDA 3V4IB 4PUOA 5KT7A 2Z1IA 4Z4IA 1RTJA 2C2RA 4CJUA 3JSMB 4CHQA 3OYKA 3VQ4A 4M3TA 3V1QA 1L3VA 2BRLA 5DLFA 3VQ7A 1IKXB 4DU1A 3OYMA 3AA2A 5KFYA 2XCAA 1HYSB 5CYQB 3WNGA 1IKWB 3OYNA 4RW9A 1BCOA 4CJSA 4ZMMA 1MMLA 1S97A 1LW2B 2XI3A 4URSA 1C1BB 3AVLA 3I0RA 3N6MA 1L5UA 1KHVA 3P1GA 1VSKA 3HPOA 3RMDA 1HQUA 3SQ4A 3BSAA 2R8HA 2OPQA 4NCAA 3MTKA 2XHBA 2D5RA 5HLFA 2ZD1B 4IH6A 2W8LA 3PV8A 4O4GB 2IA6A 4CJPA 3RAQA 5KG2A 4Z4CA 4N5SA 4B9MA 5HBMB 2D3UA 4KPYA 3ZT2A 4IG3A 3LZJA 4K4ZA 4WZMA 4ZVGA 4X2BA 3ZSYA 1D9DA 5I42A 3IS9A 1TKXB 4HYKA 4KTZA 4AILC 1QUVA 3ICLA 1UWBB 4R5PB 4RNFA 2WCXA 3CM6A 1REVA 3OYEA 1KVAA 2O4IA 3RTVA 3HVWA 3KK3B 3AVNA 3S3MA 1CSJA 4NLTA 2QKKA 2ILYA 2DFFA 2BANB 3V9XA 4B3OB 1HQEB 3MEDA 5CYMB 4CF0A 3FRZA 1CXUA 4FJJA 1DTQA 2RN2A 4W5TA 4LQ9A 3VQ8A 3OYBA 4U6PA 3QIDA 3QETA 1RTIA 5L1IA 3K59A 3QINA 3MFIA 1A5XA 3LP2B 3V81A 5KG0A 4ED3A 4ECTA 5F8JA 5C42A 3RB0A 4C8MA 2YNGA 3SJJA 5F8GA 4XO0A 4KTWA 5EUHA 4I9QA 4NRTA 3DI6A 4E7LA 1JXBA 3KLFA 3AVFA 1BL3A 4ED2A 3H08A 2AGPA 1RA7A 4CK1A 1JLBB 3I0SB 3V6HA 1C0TA 2YNFA 4KHWA 5KFRA 4HUGA 4CHNA 1VSHA 4Z4GA 3TVKA 1JKHA 4NLSA 4CERA 3LZIA 2P1JA 3ITHB 3DM2B 4MFBB 4J2DA 4KE5A 3TQ1A 3U6FA 4OKKA 4O3QA 4URGA 1J9AA 1HJRA 4K50A 4CGHA 1Z4UA 1HRHA 3MR5A 4IG0A 2YV0X 4CEQA 4CHYA 1SL1A 4QWCA 4CGJA 3QGGA 3KKRA 3EPIA 4ZPDA 1RT7B 1JLFB 2AX1A 4LH5A 4J9OA 4O0JA 2VWKA 4EEYA 4NYZA 2XRIA 3QGIA 3MXJA 1S6QB 3BGRA 1HNVA 4DQQA 4W5QA 4OGCA 4DU3A 3OJUA 1RTDB 1WSFA 2O5DA 3HT3A 1EETB 2OYQA 3RBDA 4ED0A 3KHGA 4FLXA 4KHMA 4LSLB 3MECB 3Q8SB 5K14B 4FK4A 3NBPB 3NGZA 2BE2B 4B9VA 1ZTTA 2OPRA 4LY7A 1UOCA 4ZTJA 1HPZB 1RTHA 4CJ5A 1TGOA 1NK5A 1EP4A 4DTSA 2WOMB 4EYIB 4KHQA 3PVXA 4WE1A 2B43A 1FK9A 4CGDA 4ED6A 2ALZA 5L1KA 3I8DA 3SPZA 4WFZA 3GYNA 1VK0A 2HHXA 2XO7A 3Q8QB 4Y2CA 3RB3A 1DLOA 2X74A 1S1XA 4FZXC 3CO9A 4PQUB 3CFOA 4FJ5A 5KFHA 4KREA 4KHUA 3HL8A 2C22A 4RNNA 4JUZA 3IGVA 5KFMA 3QZ8A 1XWLA 1IKVB 3NL0A 3AO2A 2Z1GA 4B9TA 3KK1A 1R0AA 2VWJA 5KFPA 3VQBA 4CGFA 1LWFA 3LPTA 5SZTA 1I3AA 4Q0BB 2F8SA 3I5BA 3GV5B 3LP1A 1SUQB 4J9SA 3ZSZA 2ZQBA 4TY8A 3EZUA 3QIPB 4K4SA 3F9KA 2DFEA 2Q3SA 4FW1A 3QYYA 1WSIA 3G86A 2HHUA 5FRMA 1IKYB 1WLJA 4CECA 4TQRA 3AVJA 3LDSA 3EY1A 4CEDA 5KFBA 1D0EA 4EO6A 4CFDA 3T3FA 3L8BA 3MR2A 3DLEA 1DTTA 3N6NA 4E1MA 3C6UB 3SCXA 2Y1IA 2B6AB 3OL8A 1UA0A 1IG9A 4RW4B 4IR9A 3B6PA 4YMEA 2UUWA 1XC9A 1T7PA 1WNEA 3S3OA 3GV8B 1C6VA 4BDZA 1SKRA 1YTUA 4J2AA 1S6PB 4ECZA 3MXMA 3D5MA 4Z4EA 1FKPB 1TL3A 2AQ4A 1TK5A 1Z26A 4O3PA 4F3OA 4DL2A 2BDPA 3T5JA 1YVUA 4DQSA 1TKTB 4F4YA 4EZ9A 3H5UA 3N6LA 4FK0A 3CJ4A 5C5JA 4QCLA 3G0ZA 3NGDA 4RZRA 4IFVB 3IG1A 4IFYA 4DSEA 3KHLA 4EBEA 3T5LA 4CJ3A 1WSJA 5DLGA 4CFCA 3UR0A 3HJFA 3DMJA 1BQMB 3SI6A 4M94A 4DL6A 3LP3A 4CFBA 1S5JA 1ASUA 1TK8A 3OHAA 5DG8A 3HVAA 5EU7A 2JC0A 4BE0A 1T05A 1ITGA 3CDWA 5J2NA 5KFAA 3PUFA 3DYAA 1C1CA 5L9XA 1S10A 1TKZA 4AH9A 1SV5A 2HMIB 5KFGA 2ZKUA 1NK8A 3OS0A 4CJQA 1D8YA 3K5NA 3KJVA 2KW4A 4YR0A 3IN5A 2OPPB 4JRPA 5DGAA 2G8UA 3GV7B 3T19A 2W7OA 2KTQA 4GC6A 3ULDA 3DLKA 1NK6A 4DLGA 2VG5A 4TLRA 4IOBA 2Z1HA 2BR0A 4KFBA 5I3UA 4TQSA 2HNDA 4G1QA 4NYFA 4I2PB 1TL1B 4ID5A 1QE1B 4FJXA 4KI4A 4WFYA 3L2UA 2EX3A 4NRUA 2HVHA 2R2RA 1S1VB 4O44A 3H2LA 2AWZA 4Y2AA 4AHCA 1SKWA 2RKIB 5C25B 3QIOA 1NKEA 1BI4A 2IMWP 4I7FA 3ZSRA 4DTRA 3T5KA 4ECRA 2KZMA 4KV8B 4FCYA 4NCBA 2FC0A 3L2RA 4J9MA 3NAEA 4DG1A 3H40A 1KCFA 4I2QB 1I6JA 1BHLA 4DTNA 1D1UA 1QSSA 2JEIA 4ECXA 1JLAB 1RAJA 4FJGA 1TVRA 1JLQA 1A5VA 3PJWA 5KFZA 3OS1A 4DTJA 1T3NA 4LSNA 4ICLA 1NOYA 2FLNA 4DF4A 4RNHA 2AGQA 3PX6A 2BQ3A 4UQGA 1GOBA 3M8QB 2PZSA 4ZPBA 1CZ9A 4Z4HA 2ZE2A 3P83D 5J1EA 4ZVFA 1VSFA 1T94A 2W9AA 4OGEA 3O3GA 5KFUA 3EYZA 2VG6A 3E51A 1XHXA 5FRNA 2F96A 3H5XA 4DSJA 1NJZA 4IKAA 3PZPA 3AO4A 1J5OB 2BQUA 1KLMA 2VA2A 1S0NA 1O1WA 3HP9A 3NF7A 1NK4A 4IDKA 4CF1A 2D7SA 4F4KA 3M9NB 2FVQA 5J2QB 1ZYQA 3OHBA 5L1LA 4OJRA 3RAXA 1WNSA 4F8RA 3B6OA 1NKCA 3PW5A 1TKDA 3G6YA 1S1TB 4FZZA 3PX0A 2ILZA 3V6DA 5FDLB 3ZT1A 2A1SA 1S1UB 4GMJB 2DPIA 4F4XA 4IH7A 4MKAA 4KKOA 2FVSA 4EYHB 3RRHA 1RT2A 1JLGA 5KGWA 4DWIA 4CEBA 3DOLA 2P5GA 5J2PB 4EZ6A 4FK2A 2E4LA 3V4IA 1KVBA 2IC3B 1KLNA 4FXDA 4G3IA 4DL3A 4HVJA 3PR5B 3G10A 2HHTA 4QOZB 4DS5A 2UUTA 2D0CA 1KSPA 3NF8A 2WONB 1EX4A 4W5NA 5KT2A 1HYSA 5CYQA 4DFJA 1IKWA 4DTMA 4OLBA 2AGOA 3DLGB 5HROB 4CFAA 1LW2A 5DGBA 3SUOA 4I9LA 2B4JA 4F3TA 1VRUA 4KSEB 3HSTB 4E7HA 4N56A 4EP4A 4Q44A 1RBSA 3SV3A 2XY5A 2ZD1A 2P51A 4DU4A 5D3GB 4O4GA 2XY8A 2JLEA 4O3RA 3OLAA 4B9UA 1CLQA 3T5HA 3H4BA 1LV5A 1X9MA 5HBMA 1C0UB 4TXSA 2G8HA 4MK8A 4RG8A 4FZYA 4CJLA 1TKXA 3CJ0A 3MR6A 4JV0A 3O4NA 4XIUA 4KHYA 2A1RA 4R5PA 4E3SA 2W9BB 4O3NA 3VQ9A 4BDYA 4Q45A 2JEFA 1HNIB 4RW9B 3KK2B 1S0OA 4M3XA 3AVGA 4ZPCA 2F8EX 3HK2A 3PW4A 2BANA 3C94A 4B3OA 1HQEA 1RT6B 5CYMA 4CESA 3LP0A 3BQ2A 2OPQB 1ZTWA 2R8GA 1QTMA 1VSDA 3JYTB 3LP2A 1S4FA 3RR7A 4ECVA 1QSYA 1KVCA 2RDJA 4RNMA 1HYZA 3ZSOA 4M42A 3RB6A 2R8IA 4IG3B 4FBTA 1ZETA 4FM2A 1BIZA 5F8NA 3ZT4A 2G8FA 4EBDA 1RDAA 4W5RA 1NNDA 4JV2A 4E7JA 3AVHA 3QO9B 3HPGA 3HVRA 3ZSQA 5KG5A 3LAKA 4CJ4A 3NH0A 2YNIB 3I0SA 4DQIA 3ASMA 5C24B 3NAIA 1ASWA 2IJNA 4Q8EA 4OPJA 5KT5A 2G8WA 1ZBFA 3GIJA 1BQNA 5EDWA 5L1JA 3MEDB 3T1AA 2XY6A 3DRRB 3KLVA 1DTQB 2IOCA 4C8KA 4RUCA 3U3YA 4CF9A 2OH2A 1OS5A 4JRQA 4GVMA 4K8ZA 3AVIA 3QEVA 4H4MA 5C42B 1RDDA 3OY9A 1VSJA 5KFWA 2E6MA 1RBTA 4ZTFA 2X78A 4YFUA 4KHRA 2XWYA 3CJ5A 1UAXA 1JLFA 1GX6A 4K4VA 1RT1B 2HNYA 2IAJA 5SWMA 3FQLA 4LD0A 4FJMA 1J53A 3HYFA 4MK7A 2W9CA 3WNEA 1N6QA 1WSGA 2XGQA 2FVRA 1S6QA 2FBTA 5T14A 3OYIA 3SQ2A 2ETJA 1FXXA 1RTDA 5T7BA 2YNFB 4OKJA 2D0BA 1RT4B 4KO0B 3D28A 1JKHB 3MEEB 4LSLA 3MECA 5K14A 3FFIA 2ASLA 4TY9A 5KG7A 2IGIA 1VSEA 2BE2A 1ZBUA 4DTXA 4Y1CA 1VRTB 4F2RA 4DS4A 2GIQA 1HPZA 5KFFA 2DPJA 2HVIA 2FJWA 2J6SA 3AV9A 3AVKA 4CIGA 5F8MA 2WOMA 3BSCA 3CDUA 4EBCA 4NLYA 4YQWA 3L3VA 3V1OA 2V4RA 5KFNA 1FKOB 2QXFA 4OKEA 3VA0A 2AJQA 2GIRA 2CKWA 4DTPA 3VQ6A 4B9LA 2WRMA 3M8PA 4NLRA 5DG9A 1RT5A 1TV6B 5KRTA 2B5JB 3K5LA 4PQUA 1QAIA 1NHUA 2FBVA 4CIEA 3RMBA 3KIOA 2XCPA 3DOKB 5EWGA 1HNVB 5DMRA 2UVWA 2OA8A 2VG7A 2ITGA 4LH4A 3M8SA 4PWDB 4MIBA 4DTUA 4Q0BA 1NK0A 3TI0A 4KBIA 3OYHA 3V6KA 1VSIA 3SUNA 1RTHB 3M9MB 3V9WA 4HCBA 3QIPA 3PR4A 3KNAA 5KFXA 3WNHA 2VA3A 2W42A 1SH3A 4QW9A 4AHRA 3KLIA 3PHEA 1IKYA 1FK9B 4JS4A 4EO8A 4FLZA 3OL7A 4QWEA 3C6TB 3KLHB 1JLEB 1WN7A 5KFLA 2FBXA 3KLEB 1IH7A 1S1XB 4NLPA 1U49A 4K4UA 3UPFA 1MU2B 3BQ0A 4FM0A 5KFOA 3C6UA 1S9GB 3VQDA 4RW4A 3KK1B 2DTUA 3ISNC 2WK4A 3PW7A 3OYGA 4KB1A 3Q8PB 3NKYA 5KI6A 2YKMB 3TAMB 2EHGA 4FW2A 4F50A 1S6PA 3LP1B 5F8IA 4GC7A 3AVAA 4Y1DA 4FYDA 4R0EA 2ATQA 5DK5A 4HUEA 2ASJA 3TARA 3L2WA 3TAEA 3UDLA 1WSEA 1GX5A 1TKTA 4CHOA 4NLXA 1S1WB 3MEGB 3KD1E 2KQ2A 2RF2B 3QNOA 2FJXA 3TR8A 1LWEA 4IFVA 4H8KA 2FVPA 2WB4A 3LAMA 3IAYA 4Z0UA 5CY4A 3K2PA 4J9PA 1LW0B 5DQIA 1DTTB 5CZ2A 3OYLA 4E1NA 3BDPA 3UIQA 4ZPAA 4YP3A 2DY4A 4ZP8A 4BE1A 1N5YB 1LWCA 1S0MA 1BGXT 1VSLA 4ED1A 4CJEA 3HHKA 5J2MB 3V9ZA 3DRSA 4C8OA 4RW8A 3A2FA 3CJ2A 1S9EB 3QZ7A 4DLEA 4C8LA 4NZ0A 2D3ZA 3KOAA 4HHTA 4KHNA 3FQKA 4H4OB 1JX4A 1N48A 4NCGA 3S3NA 4M3RA 2I1RA 4MK9A 3QESA 2JEGA 3GIKA 2HHVA 4IBNA 3KTQA 1JLCB 3QNNA 1KRPA 4DSFA 4Y34A 4J2EA 3QEXA 3DRPA 1HMVA 2YHBA 3PW2A 3DMJB 4I2PA 5KT6A 5KFTA 3MAQA 1B92A 2OZSA 3EPGA 4GW6A 1QE1A 3RWUA 4QPXA 4DQPA 1S1VA 3CDEA 2R2SA 3CJ3A 1RYSA 4ID1A 4M3WA 2RKIA 3TAGA 5C25A 1I39A 5KFVA 2PYLA 3BJYA 4RW6B 1XI1A 3CWJA 4KV8A 4J9KA 1C1AA 3P5JA 1XR6A 3IRXB 2HHQA 4DSLA 5KFEA 1S48A 3BQ1A 5HP1B 4I2QA 1N56A 4IRDA 3QLHB 1YT3A 4JS5A 4DL5A 2OPSB 1T03B 2YHAA 4FS2A 4BACA 4N47A 3MFHA 5JS1A 1TQLA 4DQRA 2D0AA 1CZBA 4CHZA 1NOZA 1RDRA 4F2SA 3C95A 1LAWA 3M8QA 1X1PA 1Y97A 4ID5B 2YKNA 4ED8A 2C28A 1SL0A 4ED7A 5KTQA 3EZ5A 1SH2A 4DFPA 1A5WA 3HVTA 4M3ZA 4IH5A 4J9RA 1ASVA 1BI4B 4B8AB 2J6UA 3LALA 1J5OA 3QEWA 3KMQA 5KFQA 4ZP7A 4ZHRB 2HAIA 1J54A 2D41A 3D45A 4DG1B 3LWLA 1L3SA 3NH1A 4MH8A 1K1SA 3HPHA 5J2QA 4HKQA 3KHHA 1NJWA 2KFNA 3I5AA 2PY5A 3NAHA 1TP7A 3H59A 4R8UB 5F9LA 2I5JB 2FVCA 3SYZA 4ICLB 5FDLA 3E01B 1JL2A 4RW7B 4KTQA 4ZVHA 2ZE2B 4ELTA 3AVBA 4OL8A 1YVFA 3NGYA 3KLGB 3KD5E 4DTOA 1QQCA 3SQ1A 4Q8FA 5EWEA 2HNZA 4ECUA 4FJIA 3CVKA 4B9SA 4F4WA 1KLMB 2IC3A 3K57A 4C8NA 3H5SA 3HP6A 1Z25A 1YTAA 3LWMA 2GUIA 3HO1A 3OYFA 3GQCA 2YNHB 1K6YA 2HWHA 4NLQA 4HUFA 4FJHA 3TABA 3JSMA 5HROA 4FJLA 2NUBA 3SFUA 4M41A 3L2VA 3V6DB 3VN5A 1IKXA 3Q8RB 3ZSWA 4AHSA 1Q9YA 3AA5X 2G8IA 4LQ3A 3ZCMA 2E9RX 5JS2A 3AO5A 4CJWA 1RT2B 3S9HA 1JLGB 3AO1A 1C1BA 5D3GA 1JXEA 3BSOA 3VQEA 4QWBA 3QERA 4WYLA 1XR5A 1C0UA 4O0IA 3HKWA 1S9FA 1QHTA 5DQHA 2IS3A 1NJYA 1EXQA 4HTUA 1RT3B 1EKEA 4DL4A 2E9TA 4Z4FA 5JXSA 2W9BA 3RMCA 3PO5A 4ECSA 4PUOB 1RTJB 4QWAA 1WAJA 2FLPA 1HNIA 2IM0A 3KK2A 4IR1A 1U09A 4MQ3A 1U04A 3SI8A 5DG7A 1UWBA 1RT6A 1VRUB 3L2QA 4WYWA 3SPYA 1KHWA 4FLTA 5HRPA 4KAZA 3KK3A 2E9ZA 1RDCA 3FSIA 2UVUA 2LSNA 2ATLA 1ZBLA 4QW8A 4J2BA 4DSIA 2JEJA 4CJKA 2KFZA 3M9OB 3AA3A 2C2DA 3JYTA 3I0RB 4MKBA 3KMSA 3LANA 4DFKA 1U4BA 3H98A 4CIFA 1HQUB 1BISA 1RCHA 3GILA 1RBUA 4CF8A 4DFMA 5HLFB 2UVRA 5KFIA 4B9NA 3GIIA 2JC1A 4FJKA 5KT3A 3QO9A 3ZSXA 4CE9A 2FJVA 2RPIA 2UVVA 2WHOA 4NLDA 2YNIA 2ASDA 2IBKA 5C24A 5I42B 3ZT0A 3IS9B 1D5AA 3PJXA 1REVB 3DRRA 2X6SA 4WXOA 4B08A 3LP0B 2R7YA 3UQSA 4CK2A 4DEZA 1JLBA 4MIAA 3RR8A 1ZBIA 2XC9A 4TYBA 2BRKA 5F8LA 3NDKA 3ITHA 3DM2A 3VQPA 4MFBA 1WSHA 3G6VA 4Q43A 3RBEA 1RTIB 3NFAA 3QEPA 1U47A 3V81B 3NH2A 1HARA 4PA1A 2FLLA 1RT1A 3TAPA 2YNGB 3RRGA 5KFJA 4K4TA 4CK3A 5F9NA 1L3UA 4CJVA 3DI6B 4CGGA 4B8CA 1RT7A 3KLFB 2X6NA 3O4QA 3OSNA 1BQNB 1RT4A 4KO0A 3DLHA 4CJTA 1XR7A 3MEEA 3VQQA 4NLWA 2IM3A 3K5OA 3V9SA 4ELUA 3AO3A 1VRTA 1C0TB 3DLBA 4JLHA 1EETA 4FS1A 2R8KA 4H4MB 4DL7A 2IM2A 3NBPA 3GIMA 1N4LA 4IQXA 1BCMA 3OVNA 4CEFA 1FKOA 1B9DA 4CEAA 1NK7A 5KRSA 2R2TA 4NLUA 3H5YA 4IG0B 3K58A 1T8EA 2HNYB 2IAJB 1TV6A 2B5JA 4K4XA 4CEZA 2W7PA 2W9CB 4K4YA 4O55A 3WNFA 3RMAA 1N6QB 4PY5A 3G6XA 1W0HA 3DOKA 4CHPA 1NJXA 4KB0A 3PX4A 3PY8A 3OYDA 4PWDA 3FFIB 3I5CA 3V6JA 3BGRB 5CZ1A 5DQGA 4CJFA 1IKVA 1NK9A 3DLRA 1UA1A 2HHSA
chains in the Genus database with same CATH superfamily
5A0YB 1TUUA 1V5VA 2E5HA 4WXWA 4IKFA 3CCES 3GWCA 4DPXA 3Q89A 2FZCB 2WTFA 3AJ2A 3QNWB 3VQSA 3KLHA 1DURA 3FMWA 1MMDA 3TRGA 4FWRA 3DDNA 3KJQB 1ATSA 2ZBPA 2I0XA 2DK2A 4E89A 3NF6A 2VG7B 2EBEA 4CP5A 1I94F 3SNNA 3J7AN 2J6TA 4YNQA 4PYAA 3BN7A 4C3MA 5HRNA 4DR6K 2B6AA 4IYQA 2XY7A 4ZP6A 4JI2F 4N77A 4CBUA 2OFHX 5KFDA 1LWFB 2YKQA 1C4AA 2VQFJ 1NWKA 5KGXA 3M2UA 3KLIB 2EKYA 4J90A 4DV6J 1JK9B 1U45A 1WC0A 4CJRA 3MEGA 5HQ8A 2N7CA 1L3TA 3CC7N 3PYDA 1SKSA 4TY8B 3ISND 5E26A 3R5CA 2RD5C 5HRSA 4IWVA 3CC2N 2RQMA 3D4JA 3WZ0A 2B8QA 2Q1LA 3VA3A 3EXCX 2V4JB 3VAJA 1SCJB 1IBKF 3MR7A 2C2NA 2DH9A 2DB1A 3UE5A 3VHQA 4C3LA 2DNKA 1KVKA 3DLEB 4ELVA 5J2MA 1FDDA 1RWPB 1IQTA 4F0KA 5T7LB 1VIXA 4CH0S 5AQIA 2KI2A 2JGUA 3HXMA 4H4OA 2MGZA 5AZJA 1JNZB 5HMWA 2CWXA 2FSNA 4IRKA 2O67A 1LAVA 3HI0A 2HBQB 1XBWA 2BE7D 3MR3A 4ZVPB 2OPPA 5D4NA 1RNHA 3G6EN 4FXWA 2W4DA 2KZZA 3ALYA 1NCLA 2PYJA 4QYZK 1QS4A 5TKYA 2D1CA 4EP5A 1KC8O 4BDPA 2A40A 2IDOA 1U2FA 1PO6A 3VAIA 1Q78A 1QAJA 3TAQA 3DRSB 2AJFE 3TZWA 3LL3A 1Y4ZB 4O0NA 2FIUA 2XYGB 3D2EA 3LOUA 1WG5A 2YX6A 1T05B 4JI8K 5A8KA 2XB2D 3DWLA 3VQCA 3DYAB 2DH7A 2DNQA 4E19A 5FPEA 4ZK7M 2AW0A 4CCHA 3HLUA 5DETA 1T03A 2UU9K 3TEGA 3VEXA 1UL3A 4FYXB 5ETOA 2RHQB 5LMUK 2HGLA 5EN1A 3AVMA 3SAFA 2GAHC 2BKPA 5DM7L 1JLAA 3GIRA 3LM2A 3KHRA 3O44A 2OANA 5I3UB 1CJVB 4BRNA 3NE6A 3SFGA 4AXJA 3X3UA 2ZUAA 3TQEA 1YJ7A 4PPDA 2H1YA 2Q0RA 3KXDA 4FJNA 1R6YA 3BO3A 3FDSA 4ZHRA 4M5GA 2MZTA 2VD3A 4I7FB 1JIHA 4FLYA 1XNRJ 7FD1A 4F25A 1W25A 2GNKA 3RUBL 4DZ6A 4DHVA 5BYRA 5LSOA 2OMLA 4ID8A 2FGOA 3ZTPA 2OJ3A 3KG4A 3H3NO 2YKNB 5KT4A 1YKWA 1JLQB 3DRYA 4M7YA 4IEEA 5GAGP 2HHHF 2AYBA 4JKFA 5JVHL 1APSA 4KAIA 2YBVA 5J1EB 3QWUA 2NXUA 1X9SA 1JMTA 1UP1A 3SQGB 3BKTA 5E5NA 3QAUA 5KG1A 3W63A 4XPEA 4BE2A 1UJ5A 2J0WA 4JI5F 4JI1F 3EN9A 2CJQA 2XI2A 4NXNF 1N36K 4TSXA 4AHVA 3DLGA 2PFFB 1AZSB 5KG6A 4YY3J 2R8JA 1QAXA 3ENVA 4KKOB 4NLOA 1U8SA 1OVYA 1J5EF 4KI6A 2K3KA 3JXUA 3TW0A 5KT7A 1Q8LA 2VFVA 3M30B 1LCUA 1RKJA 2UXCF 1BC6A 3VQ4A 2V69A 5A2QO 2ZWPA 3HCXA 2ROGA 4J9VA 4LSZB 4P6QA 1TUVA 3OYMA 3AA2A 2F4FA 3PFOA 1WDDA 2NS1B 5KFYA 4LFAF 1WELA 4JI6K 5DDRC 3IWNC 3D54A 1NGFA 1C1BB 3FGUA 3BEXA 1VSKA 3RMDA 1ILYA 1HQUA 3SQ4A 3DC2A 2W4CA 4DR6J 3QRQA 3HHLC 1KBRA 5HLFA 1Q79A 4O4GB 3HD1A 3RAQA 1S59A 3MGJA 3PJ9A 5A76A 5HBMB 4BRIA 1BOTO 3BBBA 4WZMA 1D9DA 3ZSYA 1TKXB 2CPXA 4HYKA 2K7JA 1WF1A 3VF6A 2E1MC 3A1YG 3ICLA 2L41A 3ZZRA 1XNQF 3RTVA 1YGYA 4JI2K 3S3MA 3OTCA 1B3TA 1X0PA 3BKFA 2RILA 2ILYA 1FEEA 1V4TA 4TNOA 1HQEB 1BA1A 3MEDA 3H25A 1S4EA 1T0TV 4L75A 2RN2A 4LQ9A 2I9SA 3KDNA 3TA0A 3OYBA 2W25A 3QIDA 3TSQA 2DGSA 1HBMA 2KN4A 2AMCB 5F8JA 3CW2C 1TR0A 4C8MA 4RUHA 4M5JA 4OYMA 3DI6A 4E7LA 4JD2B 3C2PA 2Q2RA 1X4HA 2AD9A 4AM7A 1RA7A 5ETLA 4BC7A 1JLBB 4H5NA 3BZQA 3HBTA 3V6HA 2KDOA 1JJ4A 2YNFA 5KFRA 1YXQA 1VSHA 3OXGA 4J91A 4FWKA 4J2DA 1NPRA 2H48B 1PKUA 1J9AA 2V9KA 3CCJN 3AJDA 2VU5A 4CGHA 4JI8J 1Z4UA 2HQFA 3MR5A 2ZHAA 1KEKA 3BBFA 3FRYA 3IFRA 4CHYA 3I32A 4HR2A 2NPFA 3LGMA 1URRA 3QGGA 3EPIA 2CNOB 1RT7B 2UU9J 1OH7A 3D6RA 4J9OA 4MO5A 4O0JA 3QQCD 1GAOA 1B4SA 5AFUH 1N34F 3G82B 2E1RA 4K5RA 4IOCQ 3QGIA 4KHPJ 4WQ5C 1RTDB 4NMXA 1WSFA 3I82A 4C11A 2ZFHA 3K9JA 2F4VK 4ERDA 1SKUB 1KS2A 4LSLB 3NGZA 1ZTTA 4I69A 4CH1A 4LY7A 3O1BA 3KYLA 4ZTJA 1FFWB 2IFXA 3OBYA 2A2DA 1EP4A 2LQ9A 2OUGA 2DEIA 2QRRA 3HFZB 2QSFA 4DDFA 4I68A 5GMKa 3UKRB 1DKGD 2ALZA 3GONA 5L1KA 2R7VA 3VF0B 3RSEB 3I8DA 4UF4A 1G3OA 2FZGB 4FWSA 4OYIA 4FYVB 5F3ZA 1S1XA 1O5JA 2O66A 3O5TB 3NOCA 3J7YI 4KHUA 1SXLA 2B4UA 1VQ8N 2C22A 2J8SA 4EHUA 1IKVB 1NSAA 3MUMP 2DVIA 1NJIT 3VQBA 4OI2A 2HBYB 1I3AA 4Q0BB 3I5BA 2GX8A 2JVRA 2XS2A 3S41A 3W2VB 2WVDA 1YRTA 5D0EA 2DFEA 4A8SA 2HHUA 1EJ7L 2P9EA 5AQJA 5LJWA 5B8HA 4CECA 4W92B 1VC5A 2HHHK 2WVEA 1CULB 4A8MP 1W26A 1VQ9S 1D0EA 4EO6A 1UW4A 3AD8C 2VB6A 2Z2ZA 3C6UB 1Q16B 5E0OA 1N36J 1OIAA 3PRBA 1UA0A 1VGYA 2HRTA 5SUHA 1EARA 4IR9A 3C3LA 3B6PA 4MDBA 2QMUB 2E7VA 1N0UA 1T7PA 1C6VA 2KJVA 1N5TA 2UUAJ 3HOSA 1BMQB 1CBKA 3FEXB 2V8DA 1HNZF 1M0SA 4JI1K 1FKPB 1TK5A 4F3OA 4DL2A 3A3OB 1YVUA 4DQSA 1TKTB 4B3TF 3M1FA 3N6LA 5C5JA 5DZ7A 2AZ3A 3ILLA 4KPCA 2XZTB 4DL0C 3CJ1A 1FNMA 1VDHA 4EBEA 3T5LA 4CJ3A 4CFCA 3UR0A 3PNIA 3OFFA 2DR5A 2AA4A 5A8WA 4CFBA 3OHAA 5DG8A 4JI6J 3HT0A 2FF3B 2B7BB 4BE0A 2ROEA 1VOMA 3GJRB 2GCFA 1BUPA 2W6LA 1TKZA 2UXCK 1UEUA 2MKJA 5KFGA 1D8YA 4WQ4A 1HNWF 5DGAA 2RQKA 3GV7B 2BUPA 2IVNA 1VJWA 2M3DA 2Y0BB 1H2UX 4JV5F 2KTQA 3V4MA 4GC6A 2KB2A 3FZFA 2IBOA 3GZ7A 5LJ3Y 1RI7A 2F8MA 2XS5A 4TQSA 2E66A 4Y28C 3UW1A 1H72C 3J7YU 1YZ6A 1TL1B 1FDBA 2W2PP 2XSJA 1QE1B 4RU2A 3L2UA 1FFSB 4FSVA 1S1VB 2ZOFA 1G4CA 2QA4G 4LFBF 4Y2AA 3D1OA 1SKWA 4RBVA 5G0RA 4DTRA 4CO1A 1N52B 3LDOA 2YTCA 3O8WA 2KZMA 3L2RA 4I56A 1XNQK 3MK6A 3H40A 2VODA 5EX0A 1C0FA 2NRVA 4I2QB 1I6JA 2XMTA 3R6LB 1M5HA 1BHLA 2APOA 4ECXA 3ET6B 3QWPA 1RAJA 3IM8A 1T3NA 2AYMA 4LSNA 3K17A 2ZBRA 3PX6A 1GQEA 2D3O1 2QW9A 3ZNUA 4Z4HA 2ZE2A 2GX9A 3CULA 4BQZA 1VSFA 2EBGA 2CDRB 4ES2A 5A2QY 2OTJS 4L73A 4C1NK 4DSJA 1YRXA 1NJZA 5ETRA 4X4SA 3Q8UA 4KGMA 1S0NA 3HP9A 3WX4A 3NF7A 1NK4A 4CI0B 1NB7A 1BXNA 2E1YA 2HRYA 3M9NB 2ZDOA 1VLYA 5J2QB 1M5OC 4ILLA 2DNOA 2AEMA 5AQWA 3RAXA 5HK4A 1F60B 1MWKA 2V94A 2ILZA 3ZX0A 3J81U 4C0BA 1FVSA 2VPZB 1HBUB 1PJ5A 4F4XA 2FVSA 3ILIA 4EYHB 3EDRB 1PJ7A 3FLCO 2F4VJ 2J9EA 4CEBA 2P5GA 2ZH4A 1ZZNA 2E4LA 5AXMA 3QB0A 4HH0A 2IVMA 5AQPA 2CVIA 3CMES 2B9YA 3F9MA 2AHOB 1N34K 3G10A 3M7VA 5I9EB 5KOXA 4QOZB 4Z7CA 1VK8A 3ID8A 1BWEA 1HYSA 5K8MA 1KR4A 2R7SA 4OLBA 1F1BB 5HROB 2OTLS 3DGPA 4CFAA 4NA3A 3A5MC 5DGBA 3CC4S 4PL8A 1X60A 1VRUA 1YG0A 3MUVP 4N56A 4ZJLA 3GG1A 4Q44A 4LREA 3PEJA 3Q2TC 1HWLA 1RBSA 3SV3A 3K9KA 4C9DA 4DU4A 2IPOB 4OHXA 2XY8A 4WP8A 3GG0A 2H4YB 1CLQA 1B0PA 3T5HA 1LV5A 2B9EA 2GHWA 2G8HA 4MK8A 1D09B 3CE8A 3JTNA 5M2RA 2DGOA 3VAGA 3CJ0A 1KNZA 4KHYA 4RJVA 4R5PA 1HHSA 2HZCA 4L6V3 4DN0A 1HNIB 4RW9B 3KK2B 3VMFB 2CJKA 4DR5J 1VQ7N 2KRRA 5BR9A 4CESA 1K0TA 2OPQB 3H2UB 4C1NI 3SMPA 3D2WA 2F9TA 1CQNA 4LMZA 3M8ZA 1QVGR 3CIPA 1S4FA 4KBOA 2CPFA 3ZX2A 3T41A 3RR7A 2V52B 2CXEA 1QSYA 2J0QD 1KVCA 1HYZA 1HBNA 3ZZOA 1ZETA 3ZT4A 2FXUA 2O8CB 2UXBF 3CCQN 4JV2A 4CM0A 5KPZA 3DXMA 2LEPA 4E7JA 2YVSA 4USWA 4HTJA 2RUSA 3L4BC 1LK5A 3O3LA 2YNIB 3I0SA 5AXNA 1KQGB 2V8GA 2G8WA 2YHXA 1BQNA 1GMWD 3ZC4A 3TVYA 3RJMB 4RUCA 2W6KA 4CF9A 3QGPA 1KQFB 4GVMA 1WDTA 5C42B 3PEHA 1T11A 4B3TK 1M5VC 1RWXB 4PCQA 5A6PA 3CCLN 1VSJA 1U6BA 1Q95G 1HLUA 1QY7A 3QRPA 2X78A 3CJQA 3VAMA 4KHRA 2RH3A 1NDLA 2Z4PA 4K4VA 2IAJA 3N01A 2H3GX 2QMXA 3VVTA 4BRDA 3UD3P 4A48A 3EWGA 2Q31A 1N6QA 2XGQA 3EGNA 3LA0A 1YITS 1HFEL 1S6QA 1WOOA 2FBTA 3OYIA 3G71S 4KT0C 1FXXA 5T7BA 1K8KA 3T1HF 1CJTA 3W9JA 4N8NA 3LO3A 4TY9A 3HZEA 1GTHA 1TELA 2RB7A 4Y1CA 1HNWK 1RU1A 1Y3JA 2WW4A 4MYTA 3LDLA 2OEKA 4JV5K 3AVKA 5F8MA 2ZC4A 5D4PA 4H5WA 4YQWA 2H54B 2D3OR 1LEOA 3VA0A 4F67A 1QVFR 2CKWA 4DTPA 1EHWA 1FDNA 2E2OA 1XNQJ 2YX4A 2DNYA 2VICA 2B5JB 3R1LA 5IZHA 4PQUA 1ELOA 4I1TA 5CH7B 2FBVA 4CIEA 3F2KA 4A62A 2V7YA 5DMRA 4LFBK 2QWPA 2VV5A 2VG7A 2BVZA 4CRJA 2QIFA 2ITGA 2V63A 3KK7A 5TKWA 1NK0A 3TI0A 4KBIA 1ESVA 3SUNA 1VSIA 1JJ2M 4A8OA 3R6GB 4EU0A 3M9MB 3EGVA 3V9WA 2DGQA 4LVOP 4HCBA 3PR4A 3KNAA 5IXUA 3WNHA 4CD3A 3KLIA 5CYJA 1UFKA 2DNZA 5AQTA 5ETPA 4EO8A 4Z37A 2NRWA 3OL7A 2FHOB 4OMFG 4A2AA 4NLPA 1U49A 2Y8YA 2LLZA 1SC1B 2W7AA 4OZJA 2V4JA 1NM1A 1GXUA 4BHQA 3DRXA 1IN0A 4ZLLA 3OTOF 4E1JA 4OJGA 2DTUA 2ZBIA 2J5AA 3TAMB 3BYPA 2VWBA 4FF4A 3FZBA 3LP1B 3AVAA 1OSDA 4FYDA 4OZ3A 1UJ6A 3NNAA 3L2WA 1IXKA 1WSEA 2BM1A 4NLXA 2XMWA 1PG5B 4CLLA 3KD1E 4BGBA 4IFVA 4ED4A 2WB4A 3LAMA 3CB4A 5CY4A 4J9PA 3CCTA 3O08A 3AH6A 5AT1B 3TUPA 2WUSA 4A57A 2CGJA 2BE9B 4YOUA 4WP9A 3SCLE 1BGXT 3HHKA 4C8OA 3V9ZA 3DRSA 3VESA 2CNKB 2DXDA 1WC1A 2CH5A 2D3ZA 5HMYA 3JB9k 4QIGA 1G2EA 3CQYA 2HQGA 2Q6BA 1PYSB 3NP5A 4OV1A 2MQNA 4M3RA 2O8EA 1NGIA 3W3SA 2CQCA 3W5XA 3QESA 2XBPA 1JLCB 3JTPA 3QEXA 4CI6A 2LXUA 2NXEA 4I2PA 4QIWD 5E3RA 3MAQA 3R27A 3CIMA 3EPGA 4GW6A 3R2CJ 4A8QA 2C2ZB 4ID1A 4M3WA 2V51B 2GFFA 3ENOA 2O8DB 3NEKA 3FZKA 1XI1A 1S6OA 4PKGA 1C1AA 3IRXB 1S76D 5KFEA 3BQ1A 5HP1B 4BGAA 1KWMA 2DNLA 1K9MO 4B1VA 1Q5YA 2OPSB 4W4MA 2QA1A 4B3SK 3QFUA 4FS2A 3DU6A 1IBLJ 4N47A 2ZITA 5JS1A 1TQLA 1UFWA 1CZBA 4KIAA 4CHZA 4NZ7A 3C95A 3M8QA 1X1PA 4IOCL 2YKNA 2WBMA 4H0XB 1SL0A 5B0FA 3ADAC 4JNEA 1SH2A 2HK2A 2KVIA 4DR7J 2HHPA 3MMAB 3PXGa 1REGX 5RUBA 3M2RB 2UXBK 5F3TA 4ZA1A 5KFQA 3SQGA 2FHKA 4ZP7A 4B3TJ 2HAIA 1FTCA 3QT6A 1Y9OA 1RSCA 2ZEJA 1NZAA 3SIPB 1S5ZA 3NAHA 4R8UB 2I5JB 4XAKA 1RAGB 4PWWA 2PMZD 1QJHA 4RW7B 3IRWP 3MX5A 2ZJPQ 3M2VB 3CCVS 5CCMA 2D1KA 4OL8A 3KD5E 4DTOA 3L3CA 3EMTA 1A6LA 2L3MA 3CNQP 3F5TA 3AA9A 3CVKA 1FWKA 5IM0B 4B9SA 2I2YA 1Q7LB 2LEAA 2IC3A 4DR1F 3W5YA 4C8NA 1TFYA 2VIHA 4JV5J 1HKAA 1HD1A 3VTHA 1M5SA 3MAAA 1OPZA 2J9DE 3FNNA 4OI0A 1S3XA 3M30A 2FC9A 4DR2F 4LIWA 4U8VA 2NUBA 4CH7A 4UQTA 4M41A 3FSYA 3V6DB 3VN5A 1UVKA 1CPZA 3IWXA 4JKAA 2VBYA 1ZAWA 3AA5X 3FZ2A 3ATVA 4LQ3A 1H98A 3HSDA 2YWHA 1A0OB 1RT2B 3H90A 4LJMA 3S9HA 4GO7X 1C1BA 1GMUA 5D3GA 1JXEA 3VQEA 3GJQB 4B1XB 5I3QA 4E98A 3CJ8A 1FRJA 4ANCA 3I9V9 2BJEA 3AXMA 2IS3A 3BF3A 1Q8KA 2C3YA 2HWTA 2A10A 4X62F 4DL4A 3THXB 4UUXA 1NDPA 2W9BA 4OPAA 1OQ3A 2IVFB 4QWAA 5FPMA 2Z0GA 1WAJA 3NGUA 3US5A 3NNCA 5C7PA 4BLGA 1KC8T 4PG7A 1NEEA 1MWQA 1U04A 4QZVB 1U1LA 4FLTA 1TFWA 4WKRA 3B54A 2ATLA 2HVDA 1ZBLA 4QW8A 4J2BA 4LF6J 4G1IA 4D3HA 4BRPA 1U2VA 3AA3A 1IVZA 2C2DA 1WHYA 3F0NA 2BOAA 4OFZA 1RWUA 2QG9B 4DPWA 3GILA 4CO4A 2PEBA 3OW2R 2CNNB 2IVOA 2H5IB 2VGMA 5AQYA 4V1Ak 3R9LA 2A5XA 2RAQA 3W60A 4B9NA 5CZVA 1FF2A 1VHIA 5KT3A 3ZSXA 4CE9A 1SC4B 4EK2A 2QX0A 2ASDA 3I33A 3PJXA 5CE3A 3DRRA 4B08A 3LP0B 1JLBA 1FCAA 5HATA 2B9WA 2V2KA 1QD1A 3DHXA 3HZ6A 1B7FA 2OLWA 3O2IA 1JNRB 4K8RA 1JCGA 2ACYA 3R5BA 1FT8A 3ENQA 3MCNA 1RTIB 1YX2A 1U47A 4WTOB 2FLLA 3RBZA 5HL7L 5HVFA 2CDQA 4LF8K 4MLHA 3BGLA 2V2VA 1L3UA 4CJVA 2FB0A 4ZLNA 1UJ4A 3D0GE 3CCSS 2HOEA 1RT7A 1Q7YO 2YPYA 2X6NA 2JWLA 4CJTA 1XQSC 2YJFA 1XR7A 3MEEA 3NWGA 2IM3A 3G82A 3W9IA 3V9SA 4MAKA 3AO3A 3OUYA 2PIIA 3BH6B 1OYEA 1T9TA 3DLBA 5IOLA 3D6FB 5DO2A 4FS1A 3EL2A 2R8KA 4JAXA 3GIMA 2RU9A 3HOTA 4CEFA 1RBOB 1FKOA 2D4WA 5K8OA 1VBYA 1U1KA 3T6BA 2R2TA 1IJEB 1N5QA 1U6FA 3SAGA 3IBCB 3B4MA 3W9HA 1TV6A 2MLXA 1VQNN 3MM6B 4K4YA 2Q43A 3RMAA 3G6XA 1FERA 3RSEA 4B3SJ 3I6PA 3MMCB 2AJ4A 4RWXA 1QUPA 3CETA 3OYDA 2QEXS 4L3QA 3ENAA 5GAHP 5BR8F 1UMJA 3V6JA 1NGJA 8AT1B 4WIQA 5HANA 1V9OA 2NR0A 1BQXA 1IKVA 2CFXA 1NK9A 3CD5A 1HNXF 3HM9A 3CG7A 1FJEB 2V9WA 3JQMA 3CYMA 2OPRB 3PM9A 3CM5A 1YJTA 2UXBJ 4QAGA 1HKGA 4B3RK 1VR6A 4FN5A 3ZZZA 2BJDA 3KLEA 3F73A 1VHFA 4ECYA 4FLUA 1MU2A 2VCPA 4OPHA 1VQ5S 3JSRA 2QE5A 2HLTA 1QSLA 1CULA 1RZMA 4ZPTR 1S9GA 4USJC 4K5SA 5C10A 1H3DA 4URQU 4BROA 2GGPB 1LOTB 2RDIA 4OPKA 1R0AB 3BSNA 4E7IA 1FRHA 3V1RA 1K47A 4M95A 1R31A 3PHTA 3O5BA 3WEEB 1FO1A 2HW3A 2KG0A 1F9HA 2ZHBA 4WZQA 1YI2S 1WF0A 4MLEA 4M45A 5FPNA 1FKPA 4P72A 4M3YA 1UCNA 3PO4A 2C3PA 1LW0A 1VSMA 4H5VA 3GMGA 3RBXA 3BKUA 1EX8A 1DQ8A 3KKFA 4FWPA 1N5YA 4AT1B 4H0TB 4WU3A 3C0BA 3RZAA 1S9EA 2J9CA 2PEHA 3HHDA 4DR1K 3CCUN 4H5RA 4XDDA 2HWIA 1SZ2A 3N5FA 1SIWB 2QK9A 4IJNA 3GLJA 5KPRA 2VF3A 1DEJA 3UCUP 2ZM6F 4YHHF 3MN5A 1FNOA 3KFWX 1TL3B 1GLAG 3W8GA 4M5DA 2H9ZA 4FM1A 2FPHX 4CEOA 3DLLQ 1IO2A 2YQ3A 4NYPA 4YORA 4P2FA 1TK0A 1GLEG 1SL2A 3E9OA 2PBDA 3OYJA 1X3NA 1KFDA 5MAOA 3IG1B 4BC3A 3ZETB 1TZ0A 4PG8A 4TN2A 2V6AA 5H9EK 1U1OA 2F63A 1TL1A 4K43A 2Z30B 3OLBA 3NCIA 1RDWX 2BX6A 4DV5J 5J2NB 2MZRA 3GG4A 2E20A 2OI2A 2MZQA 3GOIA 1C1CB 4V19X 4F3QA 4DF8A 2C1EB 4YDXA 3QMLA 2Z2LA 3IR7B 1HYVA 3KJVB 3NGIA 1P6TA 4JI3F 2P9IA 2DNGA 1ZZFA 4JB8B 3DRPB 2V2QA 1T3VA 2KYXA 4DR3F 3L4QA 1N33F 4DUYK 4ZP9A 4ZKAA 3Q8YA 3SMZA 2VG5B 5FLXO 3ET6A 1YHQN 5HRRA 3TEHB 4KFBB 3EE3A 2RVJA 5JUMA 3EICA 4K41A 2HNDB 2HVZA 2HFZA 2ZH9A 2J7KA 2DIUA 5M1FA 3AOCA 4E0DA 2BGGA 2B7CB 2AX0A 4O44B 5AZIB 5BPNA 1U48A 3M8RA 3P38A 2GC8A 2V50A 4Z7YA 2CQ3A 1XHZA 3ZLJA 2QWQA 5IS2A 3CTRA 4CNYA 5AQUA 2DO0A 3ULEB 2YQ1A 3UKUA 2QO3A 4NO7A 3MM9B 4LF8J 3VGSA 4GKJF 5H1SV 1FNXH 1MN9A 2VQEF 1T6CA 5DM6L 4FLVA 4DV4K 3PYGA 1TVRB 5K8NA 3NMAA 4P71A 2QA4S 1JXVA 4K4WA 1Z1ZA 3AVCA 3ZZ0A 3CJBA 1H2TZ 1YI2N 2DFHA 3TO8A 4TU8A 1RWVB 1D9FA 2KLAA 2R7XA 4RUAA 2FZKB 3IMQJ 2JNJA 4YR3A 4H0PA 4IDKB 1ZM2A 4IRCA 2EC0A 4FKYA 3VGKA 3O6WA 3SDEB 3GB0A 5GAHU 1LFWA 3CFPA 3L9ZA 5E41A 2HIQA 2NQPA 4K8XA 3EE8A 1OYDA 4CLZA 1SJRA 1PYTA 3H1VX 2G8KA 1YIJN 4BWJA 3S7RA 2HNZB 2E29A 2KJWA 2V8HA 5JMNA 2MQPA 5DDQC 2YY3A 3CCRN 1WAFA 3TANA 4CLTA 1YJNN 4QOTA 3EGZA 2BH1A 1O8BA 1RA6A 2DPNA 1AROP 2DD8S 1NKBA 4QWDA 4P52A 1RTJA 1QQMA 4B3RJ 2C2RA 3N0VA 1HD0A 2BMBA 2P9LA 3V1QA 4OZNA 2PN6A 3CD6S 5DLFA 3CERA 2HGMA 2ACMA 3VQ7A 4NA1A 3Q2SC 1U25A 3HHLA 4OZ0A 5I4MA 3WNGA 5HSPA 4RW9A 4I6YA 1HNXK 1MMLA 1LW2B 3I4PA 1T6DA 1NU0A 4JN4A 3AVLA 2C3MA 3I0RA 4C3KA 5IT9U 4FOEA 4DV7F 1U2RA 2JL9A 2DIVA 4C48A 3HPOA 3MWBA 3C15A 3R9PA 4DXLA 2OPQA 2R8HA 2XHBA 2ZD1B 2XNRA 3PV8A 2QSWA 1R89A 3GTYX 4OV6A 5GADP 1RWOB 3I31A 2O3DA 3CMAS 4C8ZA 4JI7J 3HZGA 5D4OA 2A3JA 3IAM9 1FJCA 1JCFA 2RRBA 3THWB 4F02A 4RNFA 2EXUA 2WCXA 1REVA 3OYEA 1KVAA 2WW8A 4CZJA 4GO5X 2O4IA 3L95X 2NYIA 1CSJA 4M5MA 3VGUA 1KAZA 2BANB 4Q7AA 5CYMB 4RLEA 3QBWA 1Z2ZA 2VBXA 1S0VA 3VQ8A 4U6PA 3QETA 2F7VA 4F0MA 2QMWA 4FWMA 1V6HA 4FPRA 2UP1A 4X4VA 5C42A 3LTOA 2YNGA 1KQSR 1GXLA 3SJJA 1UPPA 1WACA 4ANDA 1M5KC 4XO0A 4KTWA 2MQOA 4I9QA 1TYQA 4NRTA 3D9BA 1JXBA 3KLFA 5IT9Y 1X9JA 4OZ1A 1FTRA 1HHTP 2M0GB 2OO4A 3J7A1 3H08A 3FFKB 2NRTA 2UXDJ 4PG4A 2DH8A 3K0JA 3U4LA 4CK1A 2E5GA 2KKHA 3NS7B 4LUBA 3PRVA 2Z8QA 4EFHA 1X7VA 4KHWA 4HUGA 1CZAN 3TVKA 2E7WA 4CERA 1EKRA 3BY5A 3ITHB 2GQCA 4KE5A 1R8AA 3U6FA 3BEGB 3H7HB 4URGA 1NH7A 5LOQA 4K50A 1BD6A 2FLOA 3RU0A 1HRHA 3VAHA 4IG0A 1FRMA 2IRUA 2K8GA 3DCAA 3IR6B 2GTDA 4WQ5A 1YVNA 2MKYA 3V5RA 4CGJA 5E84A 1JLFB 2AX1A 3NS6A 3E1YA 1MN7A 3QBCA 3UB5A 4DUYJ 2XRIA 4GV9A 3BGRA 1ROFA 4OGCA 2O5DA 3HT3A 5IV3A 1EETB 4PXDA 2ZJPL 4ED0A 2I6WA 3CJKB 4EMDA 2CYYA 4KHMA 2FGCA 2N7YA 3U1NA 3MECB 4RBUA 2MKKA 5K14B 2CPHA 1ZA1B 4B9VA 1I51B 2YWEA 1TL7A 1HPZB 3BN4A 4Q2MA 1NK5A 5E7OB 5H9FK 1N33K 2WOMB 3UVJB 3MEKA 4WE1A 1KONA 1XMQF 3IFEA 4CGDA 5G4DA 3SPZA 2HHXA 2R7QA 1CS4B 5HQMA 1S72S 1DLOA 2RE1A 2X74A 5BJRA 4FZXC 5HVGA 3CPWR 3J7ZO 3CFOA 5KFHA 4WCEQ 2D0PA 4KREA 5JVHQ 2D9PA 4H03B 2F1FA 5THWA 2LFVA 5M1KA 4QU6A 2ITMA 4RNNA 4JUZA 2H51B 3QZ8A 4DV4J 1VBKA 4HDGA 1WOQA 3PKYA 2Z1GA 1OPIA 2C3UA 3IBWA 2ASYA 5AJ3K 4CGFA 1RB0A 1RHJB 4WBFA 2GWJA 4KJIA 2NLWA 2HG4A 3GU0A 1TUGB 2AP6A 5BYQA 3GV5B 2F8SA 3LP1A 1S79A 2UV8G 2OSQA 2HZAA 4LRFA 2HKEA 3ZSZA 3W1YC 4FW1A 3G86A 5K9FA 2VQEK 3TX0A 1IKYB 2P9SB 5HAOA 1UVMA 1V3SA 1H2VZ 4TQRA 4P9SA 4BC2A 1LFPA 5ETQA 2QN6B 1F5BA 3FBCA 2I8EA 4P74A 3T3FA 4OI1A 1E4FT 3N6NA 4E1MA 2G1DA 1S6UA 3SCXA 2Y1IA 5IWAJ 4RW4B 1MWYA 2HRUA 2UUWA 2GZOA 1XC9A 1SKRA 4IOAL 3QT7A 1WC4A 1S6PB 3GCXP 4ECZA 3MXMA 3D5MA 2COLA 5FLXY 5L9NA 3KDOA 2AYEA 2AQ4A 4KH4A 3QFHA 4FYYB 4F3MA 1N5SA 2EG1A 4AD6A 3ENBA 2BDPA 3T5JA 1QZ6A 5BRFA 4F4YA 4FK0A 5C2GA 1P27B 3H8YA 3NGDA 4JKBA 4IFYA 4DSEA 3PSFA 1BQMB 4M94A 3MCOA 1GNKA 4RUBA 4I4BA 1HR0F 5EU7A 2JC0A 5D0RA 3F44A 1ITGA 1Y64A 3H0PA 4KY3A 3B82A 5L9XA 5A6WA 5GADU 4PHTX 1SV5A 2HMIB 3VEOA 5K8PA 2ZKUA 2AKWB 3OS0A 2O8FB 4GNIA 1B0TA 4JRPA 2G8UA 3UNYA 3T19A 4ETZA 3W0LA 2W7OA 3BH7B 4K0KF 3ULDA 3DLKA 4CBWA 4DLGA 4CYUA 4TLRA 4FWLA 2GMLA 4G1QA 1UVJA 3ENHA 4NYFA 2NZCA 5HMXA 3WC2A 4QQBA 3MOZA 2XMAA 4KI4A 2QZ8A 3P5BP 2HVHA 2R2RA 2AWZA 4AHCA 1Y11A 2IVPA 1NKEA 2IMWP 4C4WA 5ITHA 3ZSRA 2E5LJ 3M2RA 4F26A 4DV1F 2WBRA 4FCYA 4J5OA 1VQ4S 4CW7B 3IMXA 4NXMF 2LA4A 3MAHA 1D1UA 1QSSA 2JEIA 5LSRA 2CVEA 2BTFA 3TJAA 4RBTA 4FJGA 4C7QA 3PDNA 1HUXA 3PJWA 5AE1A 1RWWB 2KT5A 2X51A 4H4KC 3BGOP 1OO0B 2OGUA 3BF4A 5M1NA 4RNHA 3JQKA 2BQ3A 3G87A 1GOBA 3P83D 1WEXA 2HQ3A 4ZVFA 3O3GA 2MZJA 3MWTA 5KFUA 3POTB 3EYZA 2VG6A 5GMDA 4KYZA 2DEJA 4NOHA 4M1KA 2DNPA 3PZPA 5IM0A 3P96A 1RAHB 1X5OA 2BQUA 2E88A 5MLCV 5LMNF 1T3OA 2VA2A 2ATCB 5IV4A 1O1WA 4JYAF 3BYRA 4KH6A 4F4KA 2CPIA 2GJ2A 3BV8A 2DNRA 4CT8A 2Y3YA 1ZYQA 3VV2B 1FXRA 4F8RA 3J8AA 2V7ZA 3ZZPA 3B6OA 3PW5A 2ROPA 4NX9A 3G6YA 1H1VA 2J7WA 3PX0A 1X31C 2HGNA 3V6DA 3ZT1A 1YLXA 3QDKA 1HIYA 1RCXB 2DPIA 2VL1A 5FJ4A 2GAGC 4P10A 2P8IA 1M1GA 1Q1KA 1RT2A 1FVQA 2CQ0A 2V34A 1UZDA 1BUXA 3DOLA 4JOUA 2IA0A 1OJ4A 3U27A 3V4IA 2JOQA 4X64F 3G4SN 3RW7A 4HH1A 4G3IA 3THXA 4HVJA 3PR5B 1MROB 4B02A 2IVYA 2Q3PA 2AV5A 2RS2A 5CYQA 2I7PA 4DFJA 4ZLJA 1IKWA 4I0WA 3JQJA 2AGOA 1NM2A 1E6YB 4Q2LA 3GR1A 4KSEB 2GQQA 1ICEB 4OHYA 4EP4A 3THYB 4DKWA 2X3DA 2YH0A 3HSZA 2W1BA 2XY5A 3R3LA 2P51A 3W66A 5AJ3J 3UE2A 2FF6A 3PIOL 1XMQK 3OLAA 4CZIA 2XMJA 3H4BA 1X9MA 2ZC3A 2GVZA 1VJQA 2QFIA 3EXYA 4RG8A 5EOYA 1NSKL 4BR7A 4CLSA 1NAQA 1F5AA 3MPDA 3O4NA 2CQBA 3AB4B 4RR5A 2YHWA 3DLLL 2LCWA 1VQLN 3HHLD 4GVBB 2JEFA 1X4GA 1S0OA 4BRGA 3AVGA 2WSFC 3MMBA 3PW4A 4B3OA 5ADZA 1RT6B 1FRKA 4O5FA 1VQ6N 1GEHA 3LP0A 4DV2F 2YI1A 4QIVA 3AAQA 1QTMA 3M6XA 3JYTB 3LP2A 3OBIA 4OJHA 3CCMS 9RUBA 1GTEA 4RNMA 1IBMF 3OFEA 3MPVA 5A8RB 2XMMA 3CC7S 3U9ZA 4IG3B 4FM2A 5CD4H 4OX8A 3QT5A 1K9MT 2G8FA 4EBDA 1RDAA 1KTVA 2EFVA 4W5RA 4ES1A 3CC2S 1NNDA 3CHWA 4OYAA 3G8QA 4L3KA 3QO9B 4KGKA 4DV3F 1T9VA 2NPIA 1VQMN 3SBTA 1DQ9A 2CQDA 4DQIA 5E33A 3SSRA 3NAIA 1ASWA 3W2WB 4OPJA 1FE0A 5L1JA 1F0XA 2CA9A 1OY8A 3MZIA 3C65A 3EDQB 5BRDA 1DTQB 1P1LA 2IOCA 4C8KA 2XTJP 3U3YA 1K0VA 1OS5A 4K8ZA 4WK3A 4AYBD 4M5LA 5CCLA 1VC0A 3P4IA 1RAFB 3OY9A 4DX6A 3U1LA 4LF4J 4C8YA 1EB0A 4FXVA 2XWYA 1DGKN 2OIHA 2EK1A 3G6ES 1GX6A 1RT1B 1FWLA 3OBWA 2AJ1A 2HQCA 3WQUA 2CQ4A 3UFCX 4MK7A 2RMLA 1WSGA 1HR0K 4X4PA 1V5IB 3VEYA 2YKOA 3R8YA 1UVNA 3MMCA 4OKJA 2D0BA 1F3FA 1RT4B 1NDKA 1Q8BA 2GO9A 2EFGA 1JKHB 1QQNA 2EK6A 3ZZTA 4PG5A 1VSEA 2O8BB 2BE2A 1Q86O 4DS4A 1T9XA 1WHWA 4UZBA 4YOTA 3AV9A 4K0KK 4GRSA 2CPYA 5BPMA 4B1ZA 3V1OA 2HS4A 4OKEA 2QC3A 1J6ZA 3VQ6A 2WRMA 2IDLA 3BO4A 4NLRA 5DG9A 5KRTA 4IDHA 1QAIA 4RKUC 5CA5A 3HSJA 3MCPA 3VR1A 3KIOA 3IC1A 5EWGA 1HNVB 2P9KA 1AW0A 4DPUA 1QVFM 4B3MF 2OA8A 4LFCF 4CTAA 1YJ9N 1ZOTA 1GH8A 4ISEA 4FWOA 4USHA 4LH4A 3C8YA 4DV1K 3V6KA 1Y10A 5C0YA 4JI4F 3VENA 1SVDA 4GKKK 1TUWA 4H0OA 3QIPA 4BR0A 4NXMK 5KFXA 2W42A 4AHRA 2XNQA 4DUZF 3ZO7A 4JS4A 2G2OA 2EI5A 3OR2B 4QWEA 2PMHA 3R5AA 3KLHB 5KFLA 3DHWC 3M4XA 4IUFA 5D0GA 2P9NA 3BQ0A 4DPYA 3VQDA 3KK1B 4HLBA 3CD7A 1G6BA 3PW7A 3EZOA 4KB1A 3Q8PB 1BO5O 5KI6A 2EHGA 4USIA 5C2DA 3CCMN 4JKGA 5LMNK 1BG3A 5F8IA 3LQVA 1AXQA 4IO9L 5DK5A 1KVJA 1WKLA 3TPQA 3M2UB 4ILHA 4QR0A 3NVKA 3O9RA 3TP2A 3MEGB 1X4FA 2JWNA 2FJXA 1DT9A 2QXLA 5DQIA 1DTTB 4FWNA 2CUYA 1O0PA 3HFKA 3AD9C 3BDPA 3UIQA 4ZPAA 1FESA 5L38A 4YP3A 1FJGJ 4DR4F 3NXZA 1K73O 2DY4A 4ZP8A 1U1RA 1S0MA 3B8AX 3ZETA 4ED1A 1VQON 5J2MB 3LPEA 2YJEA 4QIFA 2YWGA 4DLEA 3KOAA 1D8ZA 1QDUB 3FQKA 4LF7J 4H4OB 5AZJB 4ALZA 1AFIA 3NCRA 3S3NA 5AFUA 2I1RA 1XMBA 5B0DA 4X65J 1J2VA 4LF5J 4CT9A 2HHVA 1URNA 4PXCA 4Y34A 4J2EA 3TSUA 1Q7YT 3DRPA 3O80A 2G4BA 4YB5A 1ZPWX 3PW2A 3DMJB 1WC6A 5B08A 3GPAA 5KT6A 2E8AA 5KFTA 2UUCF 4QPXA 1CJUA 4WJBA 3CDEA 1T95A 4WF9Q 2RKIA 5C25A 1I39A 2QWMA 3NGKA 2XZWA 3D2EB 3UD4P 3DN9A 3CWJA 2DR9A 2DR6A 2QM1A 4KV8A 1OH5A 3OXFA 3P5JA 5A8KB 4DSLA 1F2HA 3GFHA 2Y9HA 5DS7A 2Q97A 4C2MA 1NMNA 3DNCA 1YT3A 4DL5A 3TUZC 1T03B 3KNGA 2FHJA 3MTJA 4DV2K 3MFHA 4DQRA 4IQMA 1NOZA 3OQ2A 1IM6A 3BB5A 4ZVTB 2WB1D 4AQYF 4ED7A 3FBFA 5KTQA 2C2MB 1H74A 1IBMK 1A5WA 3MD1A 1HJOA 2ZOMA 4MYUA 4IH5A 1ASVA 1BI4B 3QMQA 3NNHA 2A41A 4HI1A 1J5OA 2DGVA 2W2NP 2XMVA 1N32F 2PAVA 4DV3K 4ZHRB 2D41A 2HAFA 2GMJA 2XYPB 1R7IA 4OLOA 5DZ6A 1L3SA 3NH1A 4MH8A 3HPHA 4F04B 2MLZA 3TZZA 4ZDNA 3UDCA 4IJAA 3T69A 4BRMA 3WIVA 3H59A 1K8AO 4HHJA 5FDLA 4CVNE 2HBZB 4USVA 1HR0J 4WCEL 5K20B 3GCWP 2HURA 4ELTA 1X5PA 4H0YB 1EWQA 3AVBA 3A3NB 3BGFA 1U24A 3KUGA 4TU7A 1Z05A 1YVFA 2JHEA 2NRZA 2HNZA 4ZVRB 1WEZA 3CCJS 4I64A 3QPIA 3S01A 1YBTA 1Z25A 4BQLA 3LWMA 3T1YF 3A12A 5M1QA 1X4CA 1VISA 4KH1B 3HO1A 3GQCA 1K6YA 3EGWB 4JI0K 4FJHA 4DV0J 3TABA 2IRXA 4FJLA 2LEBA 2WAQD 3GDQA 2HVEA 3L2VA 4O23A 3Q8RB 3W7BA 3VGTA 3ZCMA 2KM8B 3AO5A 4NYOA 1WUAA 3BR8A 2RNEA 4NA2A 1WUUA 3D67A 4YOXA 3ILJA 3ILOA 1C0UA 3HKWA 4OX9F 3OFHA 5DQHA 3I55N 1SPBP 4GKKJ 4HTUA 1U0SA 4NXMJ 4ISGA 3QICA 3C14A 5LL6Z 3A8YA 4CO2A 2W2OP 4PABA 4B3MK 4ECSA 2BXJA 4LFCK 3ZZUA 4BRHA 3M1VA 4IR1A 2UUBF 3THWA 4LR7A 2NSBA 1VQ8S 3L2QA 1KHWA 4QBUA 2E9ZA 1RDCA 3ZTOA 2LSNA 4JI4K 4DSIA 1LXNA 2JEJA 4OI6A 3LANA 4DUZK 3H98A 1HQUB 1Q81O 1W7AA 4DZDA 4AUKA 5HLFB 3LF0A 2UVRA 1IBCB 1I94K 3WX8A 3VERA 3IWLA 2LQ8A 2JC1A 1NSPA 3C6AA 3D68A 1HKCA 4EHTA 2QL9B 3VTIA 3OW2M 3MPYA 2Q0UA 3BM7A 2IBKA 5C24A 3VPZA 1HA1A 3J7YP 2R7YA 3HSCA 2F9WA 4CK2A 4PQAA 4DEZA 2DHHA 1F3VA 3DKDA 3GJSB 1JCEA 3H46O 2XC9A 3IUCA 2BRKA 3M6GA 2WVCA 4HEA9 3ITHA 1IBKK 3I4HX 1TMJA 1EZZB 4Q43A 3QEPA 4O8UA 2KG1A 3NH2A 1HARA 2IY5B 4LR8A 4PA1A 3RRGA 2LXIA 4NWBA 4Y65A 4CK3A 2P9CA 4QYZJ 2VQFF 3BF1A 3DDIA 2F8HA 2AP1A 3DI6B 1W2BR 2VPXB 4M5KA 3OSNA 3J81O 1EQYA 1S99A 4KO0A 3DLHA 4OX7A 4G6VB 4ED5A 3K5OA 4ELUA 1VRTA 2MQLA 1EETA 2FD2A 1N88A 4DL7A 2IM2A 1FRIA 4CEAA 3A3PB 1R6VA 4OJ1A 3K58A 3MHYA 1T8EA 1SQFA 2Q6CA 3UVJA 5LMUJ 4ITSA 2W7PA 1NPPA 3TUIC 2UUCK 1M1KO 4PY5A 4P73A 4ILMA 3DOKA 5HQLA 2K1RA 2ZHOA 3U02A 1X5SA 3OXLA 3P3DA 2E1AA 4PWDA 3FFIB 3I5CA 1RUSA 5CZ1A 4C11B 3SXLA 4HTLA 4PKHA 3R1XA 2HHSA 3D0PA 1UETA 3OJSA 2ASOA 2GIFA 2N3OA 3JAMU 1S12A 3SQ0A 3LPUA 3MCAB 1HL6A 2FUG9 5EWFA 2IM1A 1C4CA 3PLAA 3C6TA 1EP4B 2MTLA 2PFDA 1JLEA 1YSJA 4YR2A 1RT5B 4B9QA 4ES3A 1AB8A 2P9SA 2BUNA 2WVBA 2L9DA 4AQYK 2VDIA 3L3UA 2VKZG 3RGIA 4JV1A 2JSXA 3WQTA 2YKMA 3ULHA 2L48A 3ZFVA 4W5OA 2OAUA 3WIUA 3OYCA 2P9GA 5E3QA 2AEJA 2W2MP 2BQRA 4M7XA 1S1WA 4H0VB 2RF2A 3WQPA 4OI3A 2W24A 4NLVA 1SS6A 3R1HA 2MY8A 3PYFA 2VPYB 1B9FA 4JI0J 4KRFA 1XNRF 2E6LA 2KXHA 3HHEA 3KUEA 4BWMA 1O13A 1X9WA 3FMBA 3V9UA 1BQMA 5AQVA 5ETNA 5B7WA 4HVZA 4J9LA 1NGGA 1Q8IA 1IQZA 3T1YK 4JI5K 3ZYYX 1TTHB 2LVWA 4BREA 1SIZA 2P6SA 3CSKA 3IGNA 3KKSA 4NXNK 3M32B 2Y1JA 4CWBA 2HMIA 3QEIA 3ZEUA 2O8FA 1NGHA 4BG9A 5KFSA 4JKEA 1U8WA 1GOAA 1OKJA 2NSCA 4G9ZA 2QV6A 3VCDA 3GFXA 1X4BA 3VQAA 1GOCA 3KVGA 2LQJA 2F8TA 1S49A 4IOXA 1VCTA 3OL9A 1HI1A 4J9NA 4TYAA 2LQBA 1LWCB 1ZBHA 3BREA 4YN3B 1J5EK 1LWXA 3WXIA 3A4TA 2R7WA 5A8WB 4OX9K 4EGLA 2F5GA 3NG8A 4JKDA 4YOWA 4O3OA 4JI4J 1SC6A 4RW6A 3KWMA 1RILA 3MXIA 4O3SA 1VHXA 1P90A 3IM9A 2GBZA 2YXLA 4NCGB 1R8HA 4YY3F 4LFAK 1TKZB 3SV4A 5KFKA 1TU0B 1W9HA 3QLHA 1T9UA 4KB7A 3R5DA 4NYNA 2UUBK 1L3KA 1RBRA 3TJ8A 5KFCA 1I94J 2H3EB 2XGPA 3NS5A 4U7CA 2DXEA 4CZLA 2PO4A 3CFRA 3D66A 2RT3A 1RKIA 2RIJA 3BR9A 5F8HA 4JI2J 5JJBA 3SUQA 2NYHA 4FVMA 3ZSVA 1VQ7S 1S7IA 4ZPVR 2W01A 3FBBA 4G1PA 1NNEA 1VAZA 4D3GA 5FROA 2MHEA 4BBYA 2KFYA 1TAUA 3HDSA 4NE9C 3A0IX 1MNEA 2B0GA 1V3ZA 2HBRB 4FVCA 2VZ9A 4N76A 2H5JB 5HL7Q 1Q4RA 4GY2B 2BACA 3NF9A 3U3GA 1IBKJ 1ZBTA 5G0RB 3W8PA 5IQQA 2N4DA 3CCQS 3TWHA 3AGKA 4ZVEA 4DR6F 3O9SA 2BJ3A 3MPWA 5EX5A 2AU0A 3KHYA 4FLWA 1WBBA 3QGHA 3N4PA 4MTPA 4IO8A 3E01A 3OR1B 4UZCA 3J7ZT 3O6QA 4M8LA 4O4RA 2G2YA 5T41A 4LSNB 2GV1A 1S22A 3HVTB 3FKBA 3KLGA 1R8CA 3IP0A 4RU9A 1ULRA 1WSRA 2NUUG 1X3MA 3DAWA 4FJ9A 2MZSA 3GSIA 5J1PA 3CQ8A 1EWRA 1BLUA 4I6MB 4BVOA 3CCLS 3TA2A 3TUJC 5BN8A 3RB4A 2YNHA 1OH6A 1KAYA 3PTWA 1BIUA 2CIMA 4FBUA 3PW0A 2CGLA 4ZIVA 3U7JA 1YF5L 3MM8B 4JKCA 4XH1A 3MM7A 3VQ5A 1SH0A 4ZN3A 1F5CA 2RDDA 3SUPA 3OYAA 3KZBA 5KG4A 3ZT3A 4XDCA 1KFSA 2Q66A 4FPAA 4QIEA 2VPWB 4WFNQ 2BJ8A 2Y8WA 4M3UA 4Y3CA 1NGCA 2O4GA 3AODA 2WTUA 4UOCA 3VF2A 4CF2A 3J80U 1YRUA 3FBEA 1RT3A 2QTWA 3TTCA 4AHUA 4YB1P 4Y0FA 4BRQA 4PUOA 3LDNA 4IFEA 4Z4IA 1XJWB 1KDNA 5AQNA 1T9WA 3JSMB 4CHQA 4M3TA 2CNLB 2PFUA 5ETMA 4B1YB 3SCIE 2HF3A 1L3VA 2D0OA 1NU4A 2BRLA 4JI8F 1IKXB 2P9UB 2A2CA 2W2QP 3AHPA 3Q0AA 2Z2YB 1HYSB 2CZ9A 3SK3A 2F3JA 3QAEA 2XM3A 4OYPA 2D74B 4U96A 3DGPB 1S97A 2WSCC 2XI3A 3NMRA 2MY7A 3N6MA 1KHVA 3P1GA 3RVCA 3CJ9A 2XQCA 4NCAA 3MTKA 3FCHA 1NB2A 5EVZA 4KHPF 3C46A 2M8DB 1NBEB 2IA6A 3J81Y 2L08A 5KG2A 4B9MA 2D3UA 5DJBA 3C16A 4IG3A 3NOGA 4K4ZA 4ZVGA 4X2BA 2ZJQQ 3T9NA 5I42A 2ZH5A 3Q22A 2HHHJ 3IS9A 4AILC 2EEYA 2G0JA 2NRXA 1UWBB 4R5PB 1GMVA 4CO0A 2E2QA 2ZNYA 1SJ4P 2M5YA 4NLTA 3TYTA 5D78A 3J80Y 3AAWB 1GK8A 2LP4A 2QKKA 2MKHA 2WC9A 4LF9F 1T44A 4WF9L 3HKZD 2WFBA 4CF0A 4ETXA 3FRZA 5GAEP 1CXUA 3CGIA 4FJJA 1DTQA 4W5TA 1DFDA 1TMMA 5L46A 3CI5A 3T1YJ 4JI5J 3K59A 4JI1J 4CIOA 3V81A 5KG0A 3RB0A 4NXNJ 5F8GA 4EI2A 2P9PB 1SQKA 1NDCA 3M8YA 1XNRK 4P2XA 2YPZA 5CABA 3QJLA 5EUHA 2A6MA 2W4PA 3OVSA 1BL3A 1RLDA 3CJAA 4ED2A 3DXMB 2AGPA 2ABYA 1KQSM 3U1MA 3QATA 1RACB 1U0HA 4XTTA 2A3ZA 1HNZK 3I0SB 4NL5A 4U7UD 3MI7X 2ZZNA 4LT6A 1HWIA 1C0TA 1J5EJ 1RFQA 4CHNA 1JKHA 4NLSA 4PXBA 1IUJA 2P1JA 3DM2B 4OX9J 1QHAA 4MFBB 3TQ1A 2UXCJ 2RUGA 2O8BA 4OKKA 3QJJA 4NEYA 1SI9A 1YJWN 1M90O 3VWSA 1N36F 2Y1LB 2YV0X 4M5NA 1SB6A 4LFAJ 1HBOA 1PSDA 1RLCL 2JX2A 1SL1A 3IDHA 2UUAF 2UUBJ 4QWCA 3KKRA 4GV6A 1ATNA 3HMJG 2HSTA 3DOMA 5KAKA 1H6KX 2PMWA 2VWKA 3MM5A 5LXRA 1XN9A 4NYZA 4U67Q 1SC3B 1S6QB 1HNVA 2Z57B 4DQQA 4DU3A 3OJUA 4UY85 1GLFO 1K8KB 2OYQA 4OZ2A 2JLGA 3TA1A 3RBDA 3KHGA 2GVDB 4YY3K 4FLXA 1CJTB 5A0YA 4FK4A 3K7RA 1FI4A 2GJFA 2LECA 1G1XA 1UOCA 4CBXA 2VBWA 4CJ5A 2FQQB 4JI6F 1HI0P 3O9QA 3AJ1A 2DYAA 2WVFA 4KHQA 3PVXA 1P1TA 2LMIA 2POKA 4ED6A 5DM6Q 5AQXA 2YWFA 2R3VA 2VUGA 3OR2A 1CC7A 2KXFA 4WFZA 3GL1A 3S8SA 4F0HA 5F2RA 2UV8A 2XO7A 3Q8QB 3RB3A 4DOZA 4PQUB 4FJ5A 2AJ0A 5GAEI 2H5EA 5AXKA 1PILA 3EVWA 3IGVA 5KFMA 2BJ9A 1XWLA 3CEDA 4U8YA 3AO2A 2IMOA 4B9TA 3KK1A 5GVQA 2VWJA 1BE4A 5ETSA 1LWFA 3HSGA 3LPTA 3CPWM 2ASMA 1FEHA 3I8BA 1SUQB 4DCPB 3NCPA 4J9SA 3L4IA 4TY8A 4NPOA 4X84A 4K4SA 4X4RA 3QYYA 1WSIA 4DCHA 4U95A 1I1GA 5M1PA 3MUTP 5L8RC 2WBNA 1WLJA 5AQOA 3LDSA 2KYZA 3RRKA 2BA9A 3CDAA 4CFDA 2LDIA 3MR2A 3DLEA 3L8BA 1WHVA 1DTTA 1V3RA 2HSEB 2VFUA 5T7LA 2BM0A 4BR4A 2ZH8A 2NCKL 1DJ0A 3OL8A 2VDHA 3S1TA 1RWNB 4YMEA 3VEWA 3B6BA 3CXCR 4OZLA 1WNEA 3S3OA 3GV8B 1P9YA 9ATCB 2HBJA 2R7RA 4NEZA 1Z26A 1N34J 4O3PA 1MLAA 2CPDA 4EZ9A 3CJ4A 4QCLA 1MA9B 3A5NC 4IFVB 3KHLA 2IYGA 1TL5A 1WSJA 5DLGA 1VIOA 2CQPA 3DMJA 4RO0A 4BRLA 3SI6A 4X4QA 1S5JA 1ASUA 1TK8A 4LF2A 3HVAA 4ZOSA 2QYCA 1LK7A 1T05A 2CAJA 5KFAA 5C12A 3DYAA 2DGUA 1S10A 1ZC6A 2BKOA 1NK8A 1W2IA 5LT5A 3K5NA 2PI4A 3DGVA 2I7NA 1BWFO 4QR2A 3G9CA 2BV3A 2F4VF 5E3PA 2O8EB 1NK6A 1EKSA 4IOBA 1XC3A 2B9XA 4K2XA 5I3UA 1CJVA 4KGXB 4KR0B 4XH4A 4I2PB 5ADXH 2OP5A 3HM8A 4QYRA 5GAEU 4OYXA 4KHPK 3PIPQ 4FJXA 4WFYA 4CNZA 4DX5A 2EX3A 3I56N 1Q86T 2JLFA 3H2LA 4PEOA 2JFKA 5E3CA 2VH7A 2C42A 4MKVA 1BI4A 1KXPA 4I7FA 3BZCA 4ILGB 4ECRA 2HEKA 3CCEN 2VFRA 4H4KA 3BBCA 1KCFA 2CQIA 4WP3A 5ETVA 4DTNA 3GYXB 1NHKL 3G2XA 4BRAA 4XH5A 2J8AA 4LF9K 3D7SB 1GXTA 4PZVA 1UFLA 4WWSA 1JLQA 1A5VA 3QSYB 4DTJA 2KVQE 1H7XA 4CZMA 2V8VA 2FLNA 4DF4A 1HNZJ 3M8QB 3AD7C 4ZPBA 5E2QA 2QWNA 5J1EA 3SEOA 1LOUA 1T94A 4UT4A 4OGEA 1FFGB 2DNNA 3DXKB 3MPUB 4DR5F 1XHXA 1CQMA 2F96A 3VVUA 1XERA 3AO4A 1EIYB 1R8BA 4QU7A 2C2OB 4A8KA 4CF1A 2YQ0A 1F9EB 3G25A 3VALA 3CF5L 3PFEA 3GBTA 2GEMA 5L1LA 3ETOA 1S1TB 1WJ9A 1AZSA 1NRKA 3M05A 1PYOB 2JJ4D 3NGTA 3A8KA 1S1UB 1FD2A 3OHRA 4KKOA 1HNWJ 1ATRA 4DB3A 5ETKA 2GUPA 2HPUA 4DWIA 4H5TA 2UUAK 5J2PB 2U2FA 4FK2A 3D7EO 1Q18A 3HHNB 1G99A 1KVBA 2IC3B 1FJ7A 3T1HK 4FXDA 1W97L 2FJEB 1VQNS 3MAAB 1CJKB 2LDYA 4DS5A 2D0CA 1IV0A 3FEYB 5AE2A 3CUNA 1KSPA 3NF8A 2WONB 1EX4A 5KT2A 5AQQA 1IJFB 4UW2A 3W61A 4LFBJ 1K73T 2X1BA 2B4JA 2YKAA 2OD6A 3N4QA 2KO1A 2MSTA 3AQOA 4NMLA 2QLWA 4HI2A 4FO0A 3MURP 5D3GB 4O4GA 5HI7A 5HBMA 1KD1O 4TXSA 1YK9A 1DARA 2BW2A 2HS0A 1TKXA 3MR6A 4XIUA 2PA8D 4E3SA 2W9BB 4O3NA 3TR5A 3VQ9A 4KH0B 4BRKA 4Q45A 3K8WA 5D0HA 4ENOA 3M5RA 2HZVA 4ZPCA 2F7TA 5GAGI 4P75A 2F8EX 3HK2A 1Q53A 4IEIA 3C94A 1HQEA 3P4UB 2EPIA 3D2FB 4IOAQ 3AOBA 2DY1A 1EQ0A 4XK8C 4OHZA 2X1AA 4OI4A 1U2VB 1GMWA 3IKMA 1WORA 1RBAA 2G1HA 2RDJA 1NUEA 1X4EA 3ZSOA 1Q82O 3VGLA 1IWGA 2R8IA 1YJVA 3OTOK 1JJHA 2E44A 2M52A 5F8NA 2IYIA 4CLKA 1FXLA 4CZCA 4JD2A 2DITA 4MMOA 2E2PA 1CEZA 2E2NA 2YWWA 3LAKA 2M4MA 3NH0A 2QL7B 4TKTA 2J9DA 2M8HA 3O1WA 4WFAQ 4Q8EA 3SQOP 5KT5A 1ZBFA 3GIJA 3D3CJ 3DRRB 4UTGA 3CCUS 2IHR1 2JZ5A 1NLVA 5F0XA 3B8HA 2CAD