3KLHA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to post-translocation aztmp-terminated dna (complex p)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
558
structure length
558
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
molecule tags Transferase/dna
source organism Human immunodeficiency virus type 1
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
total genus 129
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klhA05
2HHQA 3FDSA 2YHAA 3V9WA 5EWEA 4K50A 3JYTB 5HRSA 2LSNA 5T7BA 3MR6A 3SQ2A 5KT2A 3OHBA 3OYBA 4URGA 3PW0A 4DTJA 3OYJA 4N41A 3DLBA 3IRXB 1TK5A 3N6MA 3QNNA 3CJ2A 3H5SA 4GVMA 4ZTJA 4FXDA 2HHVA 3NBPB 4Y34A 4DL7A 3A2FA 1U4BA 3NH1A 5KI6A 4DU3A 4KHWA 1QE1B 1S6QA 4QWBA 4FLWA 4ED7A 1LW2A 4WZQA 2B5JB 1ZTTA 4CJEA 4KSEB 3AO5A 1D0EA 2EC0A 3DRRA 3LWMA 1RT3B 2BANB 1BHLA 3RAXA 2B5JA 1RBRA 1LW2B 1VRUA 2KQ2A 1SH2A 4NLXA 3RTVA 1O1WA 1TKZB 1S1TB 4IFYA 1C1CA 4I2PA 5KFAA 1FXXA 4M3RA 3CIZA 3UR0A 3Q8SB 1KLNA 1RDRA 4B9SA 4PUOB 4EBEA 5K14A 4CECA 2V4QA 1WSHA 3K5MA 4B9MA 5J2MA 3UQSA 3KK2B 3AVFA 3TAMA 3KLFA 4E7JA 1S1VA 4J9QA 3K57A 3OL9A 3AA2A 3G10A 4PA1A 3WNGA 4KFBA 1TVRB 5L9XA 1VSLA 3PR4A 3LP0B 3KK3B 2FBYA 2FVRA 2DY4A 2GBZA 4I7FB 3VQ4A 3KHGA 1JLEB 3V4IA 2JLEA 3D0PA 2BGGA 3QIPA 3KTQA 5HROB 3MR3A 1X1PA 4NLVA 5KFMA 4EO6A 2F96A 5KG5A 3IG1B 3MEEB 2X6SA 3T5KA 3OYLA 3M8SA 4CESA 2OPRB 2YNFB 3MTKA 1SKWA 3T1AA 3NF7A 3ZSXA 5K14B 3AVMA 3ZSRA 1KCFA 1RDBA 4Z0UA 4IRKA 3G0ZA 3OYIA 1Q9XA 2G8IA 3BJYA 2FLNA 1RDAA 5F8NA 1TKZA 4FLYA 3RR8A 4EP4A 4KB7A 4FCYA 2D7SA 3HVAA 5KFZA 2QKKA 4M95A 3QGGA 1HNVA 4QWEA 1S97A 4B9NA 3HVWA 2DPJA 1UOCA 3DRRB 2B6AA 2ZD1B 4IDKA 2R2RA 2HB5A 4HUEA 1WSIA 1RAJA 3SUNA 4DTXA 4AHSA 1S4FA 3RR7A 1HYVA 2FVQA 1TQLA 5FDLA 2ATQA 1NK8A 2FBXA 2XO7A 1QSLA 1RA6A 3CQ8A 4JLHA 3NGYA 5HRNA 3K59A 1QQCA 1LWEB 3K5OA 3V9XA 5KT5A 1MU2B 1I6JA 3CYMA 3BQ2A 4KHSA 4WXWA 2PZSA 4KFBB 3DRPB 1FKOA 2VA2A 4DTSA 4RW8B 3OJUA 2DFEA 4OLAA 4CGFA 1HJRA 3BQ0A 4Q44A 3HSTB 3WNHA 4AHUA 2DTUA 4R8UA 3OS0A 1KFDA 1RYRA 5DG8A 1ZBLA 3KK1B 4NCBA 3FRZA 1NJZA 5HRRA 3KLIA 3AVIA 4OGEA 4W5TA 3I5BA 2P5GA 4RNOA 3GQCA 3QLHB 1B92A 1S1VB 4CGJA 1J5OA 4HYKA 4C8NA 1TV6B 1WSFA 3U6FA 3KLGB 2IC3B 3CVKA 1CZ9A 3PW7A 3LP1B 5EWGA 2OH2A 3L2UA 4H4OB 1MU2A 1NOYA 2R8KA 3KMQA 4K8ZA 3P1GA 2BRKA 3OL6A 5DGAA 3IAYA 4ZVEA 5FRMA 4KRFA 4JV0A 3WNEA 2RKIA 4I2PB 1BQMA 1REVA 4B3OA 3KLIB 1DTQA 5KFRA 4KTQA 4J2BA 4Y2AA 1S9EB 1A5VA 4ELVA 4I2QB 4E7IA 1S9GA 4R8UB 4CIGA 4ELUA 1RT3A 3NAIA 1C1AA 4CFAA 1DTTB 2O4IA 4CIFA 4DU4A 5HLFA 5L1IA 3L8BA 4H8KA 1XHXA 4KHMA 4IG0B 4Q8EA 2AJQA 1BCMA 4IRDA 3AA3A 3M8PB 4JRPA 1S9FA 4HHTA 2KFNA 5KG3A 4O4GB 5KFYA 2Z1GA 4RNNA 4PQUB 3RAQA 2B6AB 4DLEA 1RBTA 2P51A 1HNVB 4H54A 3T3FA 4E1MA 5KG6A 4E1NA 4ZMMA 2QV6A 3HXMA 1W25A 3H2LA 3JYTA 4DFJA 4IH6A 1RTJA 4FYDA 4CEFA 1Z26A 1RTIA 1ZBUA 2D3UA 3H5YA 1VSJA 4EZ9A 4CJFA 2JEIA 1ZTWA 4FBUA 1SH3A 4O0JA 2IM3A 2BQUA 3C95A 3KMSA 3LWLA 3SPZA 3DYAB 2XRIA 5KRSA 1WN7A 1BIUA 3Q8QB 4DQIA 2OPRA 1EETB 3NF6A 3ISNC 4TY9A 1N48A 3DM2B 3PZPA 5FRNA 4AHCA 4MIBA 4J9OA 2YNFA 5KFTA 4IG3B 4CJ5A 1NJXA 3OYDA 3L3UA 3DM2A 3TAMB 3IG1A 5F8LA 4CHQA 3AVLA 1L3UA 2BQ3A 2VG5A 4TXSA 5C25B 2HHTA 2W42A 4C8OA 5T14A 4LH5A 4KI6A 3KK3A 2VG6B 3UPFA 5F8HA 1RT4B 1SV5A 4HUGA 3PW4A 3V4IB 4DTMA 4CJSA 2WB4A 4TY8A 5C25A 4FLTA 2C28A 5KG0A 3T5HA 3K2PA 2E9RX 3DLHA 2JEFA 1RTJB 4M94A 1HYSA 4YR3A 2V9WA 1KVAA 4IKAA 4IG3A 4CF1A 3I0SA 3RB6A 1C2PA 5KG2A 4F50A 1LAWA 4E7KA 3P5JA 4DWIA 1JL2A 1SKRA 4FJMA 2E9ZA 4KHNA 4ICLB 3FQLA 3S3MA 1N56A 2W9CB 3DOLA 4JV2A 4PUOA 3ZSZA 2YV0X 2BRLA 3DLEA 1S1WA 3F9KA 3NDKA 2GIRA 4HCCA 2YKMA 2ATLA 1F21A 3EY1A 4B9LA 3SFUA 1Z25A 2VG7A 4CJTA 2J6TA 2G8KA 2KFZA 3MECA 2I5JB 4H4MB 3V9SA 3MEGB 1BISA 1RA7A 4WE1B 3NAHA 1TK0A 1S9EA 1TL3A 2CKWA 4O3QA 3OL7A 3NF8A 3S3OA 1DLOA 4B9UA 2WONB 4MK8A 1S1XB 3SUPA 1N6QB 3SV4A 3VQAA 3ZSVA 1SKSA 1HRHA 4U6PA 1VSKA 3GIJA 3NBPA 3TAGA 2BR0A 1IKWA 1ZBHA 3QO9B 4KTZA 4CHZA 3E01A 2I1RA 2XY7A 1C6VA 4DFMA 1QS4A 3T5LA 1IKVA 3GV8B 2AQ4A 1JXBA 3FFIB 1LWCB 1JIHA 3MXIA 3ZSOA 3BSCA 1T8EA 4Z4FA 4RU9A 1U48A 4MK9A 4B3OB 4B8AB 4DSKA 1BQMB 1REVB 4CK1A 1FKPA 4QWCA 1B9DA 4DF8A 4X2BA 4NYZA 5KG1A 3QESA 3GYNA 2NUBA 1NJYA 5KGWA 4JRQA 2W7OA 4KHYA 3KHHA 3OYKA 2DFFA 4NLYA 4E3SA 2HNYB 4LY7A 3LANA 2ALZA 4LSLB 4RW6B 4TYBA 4W5RA 4FJHA 5JUMA 1RNHA 2X6NA 2HNDB 4FVMA 3GV5B 3LZJA 3OLBA 3BGRB 4AHVA 3HM9A 1WNEA 1SL0A 3PHEA 1EETA 2BQRA 4N47A 4CFBA 3OL8A 3AVNA 4RNHA 4J2EA 4F4WA 3LZIA 4K4ZA 2G8VA 2E4LA 1D8YA 2XY5A 2F8EX 4NLWA 3CFRA 1HARA 1IKYA 1YVFA 2D0CA 3C6UA 4FJXA 3G86A 4QCLA 2OPQA 4FJ9A 3L2RA 4Y3CA 4DQSA 1TKTA 3HVTA 3KJVA 5KFBA 3V9ZA 5I42B 4IRCA 1RTDA 4O44B 5J2QB 1WLJA 4O5BA 4Q45A 3VQCA 4HUFA 1VSEA 4YR0A 4O3NA 3B6OA 5I3UB 1QTMA 4Y1CA 5I42A 4K4UA 4MKAA 3RRHA 3OSPA 1HMVA 2RF2A 3HVTB 2KZMA 2R2UA 2GIQA 3C6UB 4KB0A 5F8JA 3SUQA 3NAEA 1U04A 3V6DA 4KV8B 3OYAA 4ECTA 2IA6A 4R5PA 2HMIA 3UIQA 3HKWA 2ILZA 3ZT0A 5DG7A 4Z4CA 4KHQA 1T03B 1Z4UA 4F4XA 4OKJA 2ASDA 3CJ4A 1DTQB 3DMJA 3CO9A 1RILA 2ZE2A 5KFLA 1Y97A 1HNIA 4ID5B 1XR6A 4H4OA 2J6UA 2R7YA 2IM2A 4KHRA 4J9SA 4ELTA 1VSHA 1K1QA 3QIPB 3BREA 5E41A 5KTQA 3V81A 2IC3A 4PWDB 4URSA 3RB0A 5KFJA 3QEWA 2R2SA 4CEZA 5KG4A 3AO2A 4DSEA 4WFZA 3KOAA 1RBVA 1C1CB 1D9FA 4CEEA 1NKBA 4FLUA 3IGNA 1I3AA 4QW9A 3RMDA 4ECUA 3SQ4A 2ASJA 1TKDA 4LSNA 2EHGA 3OYGA 3HPOA 3QETA 3CDWA 3TAPA 2IJNA 5FROA 4AHRA 3TR8A 3LP2A 3LALA 5J2MB 1JX4A 1XR7A 4FZZA 1ZETA 4KAIA 3AA4A 3V9UA 1LWEA 3KHRA 4FS1A 3DLGB 5J2PA 3L2QA 3RBEA 3EZ5A 5D3GB 1UA0A 1J54A 4BACA 3BSNA 3MR5A 5DLFA 4BWJA 3TAEA 4HVJA 4C8KA 5FDLB 1D9DA 1QSYA 3TABA 3G6XA 3O3FA 3MEGA 1BL3A 1TL1B 3GILA 1S5JA 2UUTA 1NK6A 2AX0A 5KT6A 4N5SA 3NH0A 1RT5A 3QZ8A 2OZMA 4C8MA 1U45A 4KPYA 1NK7A 1N5YB 2HHSA 1ASVA 5KFFA 4Z4HA 1IG9A 2XCPA 1G15A 4RNMA 1W0HA 1TAUA 3PVXA 3NGDA 3KNAA 3ZT3A 4NLDA 3HPHA 3PX0A 4PWDA 3CM5A 2KTQA 3HJFA 5EWFA 3V6JA 4ECYA 4ECWA 2VG5B 4M3TA 2QKBA 5J2NB 1JLCA 4WZMA 3VQ7A 1HYZA 2HAIA 3DI6B 1LWFB 1X9WA 3IGVA 4Q0BA 3M9NB 4DL2A 2ZE2B 3BDPA 2JEGA 1ZYQA 3CDEA 3EZUA 3QEPA 3TAQA 2BE2B 1VK0A 4J9RA 4DL4A 5DMRA 1JLFA 4BDPA 2W9BB 2V0NA 3H5UA 4KB1A 2WRMA 1RT1A 4LQ9A 1U09A 2FVPA 5KFDA 4CK3A 1NNDA 3ZSQA 3LPUA 4R5PB 2HMIB 3V6HA 3VQ6A 3DLRA 4QAGA 4NRUA 3V1RA 3DI6A 4ECZA 1UWBA 1QAIA 3JSMA 2AGOA 4CHPA 3KLEB 1LAVA 3AVAA 1VRTA 3CFPA 3QERA 2R8IA 4YR2A 1RT2A 2FLPA 4ZPCA 4Q43A 3RB3A 1RBSA 4Z4IA 3AVBA 2Y1IA 4NLUA 4O4GA 2B43A 1NHUA 3I0RA 1C0TA 3ALYA 1T94A 3SFGA 1S0OA 1N5YA 3HT3A 4RNFA 3NGZA 1BQNB 2FVCA 3OY9A 2YNIA 1KHVA 1LV5A 4CJPA 2HHUA 1HPZB 3ITHB 1FK9A 3K58A 2DFHA 5HLFB 2R8GA 1RDCA 4NLRA 2A1SA 5CYMA 4EBDA 2E6MA 3S3NA 3U3YA 4I9LA 3NCIA 5C24B 5KFSA 5C42A 4YNQA 4CJLA 4IFVB 1J53A 3BSAA 1JXLA 4C8LA 3K5NA 3OS2A 2RKIB 4OVLA 2PY5A 1RT6B 2HWHA 4CFCA 4EYHB 3RWUA 2DPIA 3MEDA 2AX1A 5EDWA 4W5OA 4CFDA 1JLBB 2IJFA 4OPJA 1T05A 2KZZA 1ZBFA 2G8WA 4URQU 2HHXA 2HNZA 4PY5A 4EEYA 1EX4A 1J5OB 1WNSA 1NKEA 4ECQA 1X9MA 4CF8A 3IS9B 1HQUA 4DS5A 4E19A 3KK1A 4OL8A 3AO3A 4HKQA 1EXQA 4UQGA 4LD0A 2D3ZA 4TYAA 3QEXA 4O3OA 4FW2A 5HBMA 1Q8IA 3SJJA 5KFGA 2ETJA 2P1JA 3WNFA 4W5NA 4KAZA 4CEBA 2W7PA 3U3GA 4ECXA 3I5CA 5DG9A 3OJSA 5DQIA 4FM2A 2V4RA 2FBTA 4DTPA 2C2RA 5CY4A 3HP9A 5DK5A 1NK4A 4JV1A 4NLOA 4TQSA 2FJXA 4Z4EA 2X78A 4OKKA 4RW9B 3PX4A 1T05B 1FK9B 1U49A 4FJNA 4DG1A 3B6PA 4WYWA 3MECB 5CYMB 1T7PA 1TKTB 4YQWA 4EZ6A 3M9OB 4CJ3A 2JC1A 4WXOA 2IDOA 3O4NA 4K8XA 2Y1JA 4M3UA 1B9FA 1C1BB 3QIDA 2ZKUA 1C0TB 4CF2A 5I3UA 3SI6A 4K4SA 1LW0A 1VRTB 2W9AA 2R8HA 2ILYA 2E6LA 4DTOA 2ITGA 4ZVHA 4DTNA 4O55A 3VQSA 4FLVA 5KFUA 1CXUA 3ITHA 2RN2A 2O5DA 4CGDA 3NFAA 2GV9A 4CF0A 4JUZA 4HCBA 3NL0A 3RB4A 4IBNA 3F73A 2HW3A 2J6SA 2EX3A 4ZPDA 3PJXA 4RW7A 2E9TA 3VQDA 4KHUA 2UVRA 4CEAA 4IR1A 1J9AA 1S49A 4DL5A 1L3SA 2C2DA 1N4LA 3SCXA 2YKNB 3KLVA 4WYLA 1TAQA 4DSLA 1NK0A 4NCAA 3JSMB 4MK7A 2G8HA 3C6TB 1CZBA 3H4DA 2YNHB 4KBIA 1LWFA 4LSLA 2YNGB 4RW6A 3O3GA 4M3WA 3RBDA 2XY6A 5EUHA 2IOCA 1R0AA 2FC0A 4XIUA 4DS4A 3PV8A 2QK9A 2FJWA 4EBCA 5JS1A 3CJ5A 3NKYA 5KFWA 3DOKB 1JL1A 2IGIA 4RZRA 3QEIA 5J1EB 4OLBA 4KKOB 4RW7B 4QWDA 2GUIA 3ULDA 4Q5VA 1EP4B 4Q0BB 3QINA 4TLRA 4DL6A 1S10A 4K4VA 5F9NA 4ZP9A 1JLCB 4B8CA 5J2NA 3KHLA 3HVRA 2A1RA 1VRUB 1RTHA 1KLMA 4O4RA 3GIIA 4AH9A 4OGCA 2P5OA 3N6NA 5DQHA 2XGPA 1GOAA 3AVJA 4DL3A 4F4ZA 5HP1A 1I39A 4FJLA 1CLQA 4BDZA 1WSGA 3KD1E 1S6QB 1QE1A 1ITGA 4FJ7A 5CYQB 1S1WB 3DLGA 3DRSA 2W9CA 1S1XA 4OPKA 2G8UA 4DF4A 3M8QA 5SWMA 1DLOB 3IRXA 2BANA 3D5MA 4CEQA 3LP2B 5HP1B 1A5WA 4AILC 1A5XA 3SUOA 3I8DA 1XHZA 3M8QB 3MXMA 3KD5E 4CJVA 2GC8A 4EYIB 1WSEA 2I5JA 2B4JA 4ED6A 3N6LA 5KT7A 3ZT1A 3L2VA 5KT4A 4ED3A 4E89A 3PY8A 2O4GA 1VSMA 4DQRA 1KVCA 4HTUA 1RT7B 5D3GA 5F8IA 3FSIA 4FM1A 2VG6A 2Z1IA 5CZ1A 4N76A 3DOKA 4M3ZA 3LPTA 5KFEA 3FQKA 4MH8A 3E51A 3IN5A 4DU1A 3KLEA 3OYCA 4DLGA 1UWBB 4RUCA 4GMJB 4XO0A 2RDIA 4F3OA 1EP4A 2IAJA 4DFKA 2YHBA 3VQ9A 3SNNA 5J1EA 3C6TA 3PJWA 4ED0A 2AGPA 5KFQA 5L1KA 3IS9A 4MIAA 4W5QA 4ZHRB 4CJKA 1KFSA 4ZVGA 3Q8PB 4BE0A 4F3TA 1JXEA 4CGGA 3TWHA 1FKOB 3DRPA 5DQGA 3SQ1A 3HHKA 5KT3A 1R0AB 3V1QA 2PYLA 5KFNA 4DEZA 3VA0A 4ZTFA 3TQ1A 3T19A 3PUFA 3M9MB 4RW4B 2R2TA 3VQ5A 3GV7B 3AA5X 4FJKA 4IFVA 2WOMB 4KTWA 2YKNA 2XI2A 1T03A 3KKRA 3OYEA 1JLQB 3PW5A 3OVNA 2FJVA 1YTAA 2WHOA 4ID1A 1ZBIA 4BDYA 4CJ4A 4NRTA 1EKEA 5C5JA 5JS2A 2VA3A 1HPZA 1RTIB 2Z1HA 2PYJA 1KHWA 4MQ3A 1SUQA 4MKBA 2XI3A 1IH7A 4E7LA 1TL1A 3I5AA 1TKXA 3HP6A 4EP5A 1RCHA 2CJQA 1S9GB 3PR5B 4FLXA 3AVHA 3OYFA 4ECRA 1LW0B 2IBKA 2IM1A 2RDJA 1JLGB 4RW4A 1BCOA 2X74A 1QSSA 2WK4A 4IQXA 1RYSA 1QAJA 3C94A 4FLZA 4J2AA 2OPPA 2RPIA 3O3HA 2G8FA 1VSIA 1L5UA 2UVUA 4ED1A 5KFCA 2XHBA 1WAJA 1DTTA 3D45A 3QGHA 4GC7A 4J9NA 1JLEA 4IOBA 1WAFA 4LH4A 5DLGA 3ASMA 4CJRA 3VQPA 2W9BA 4CHNA 1IKXB 1S48A 2FBVA 4I2QA 2BE2A 3GIMA 1HQUB 1C0MA 4DFPA 2IMWP 2D0AA 3LP3A 1HQEA 3MAQA 4DTRA 4NYNA 1FKPB 3L2WA 3V6KA 3T5JA 4YMEA 1W9HA 4J9MA 1TP7A 1IKVB 3KKSA 3RMBA 4RW8A 1L3TA 1ASWA 4N56A 5DGBA 3LAKA 1BI4A 3BQ1A 3CJ0A 3AO1A 4F4KA 4JS4A 2QE5A 1YVUA 1RT7A 3QLHA 2HWIA 1RT6A 3OS1A 3ICLA 5KFIA 3S9HA 1VSFA 4DSFA 5C24A 4WE1A 1IKXA 1LWCA 2WONA 4QWAA 5KRTA 4DSJA 2VG7B 1U47A 3O4QA 4XPCA 1S0NA 3QO9A 3HPGA 4K4YA 3AVGA 1SH0A 3DLEB 1JLAB 4R0EA 1HMVB 2RF2B 5C42B 4NLTA 4K4WA 2IS3A 2W8LA 4F2RA 4FK2A 1OS5A 4FJ8A 3NE6A 4KO0B 4NCGA 4FJIA 1TL3B 4L8RB 4ICLA 2WCXA 4J2DA 1TKXB 3MF5A 3QGIA 2D41A 4AHTA 2OA8A 2YNIB 4F4YA 4CERA 5KG7A 4B9VA 3KLHB 3CDUA 4CEDA 3OYNA 3TANA 4CCHA 1JKHB 1IKYB 3KIOA 4I9QA 1ASUA 3SPYA 2JEJA 3SI8A 3CM6A 4DQPA 5CYQA 4NLPA 3P83D 4ECVA 3EPGA 1RT1B 4I7FA 4NLGA 4NZ0A 3TI0A 4FBTA 1JLQA 3H08A 4FK4A 1BIZA 4M42A 1KTQA 2WTFA 1S6PA 3V81B 1YT3A 3DLKB 1S1UB 2OZSA 1KLMB 1RTHB 3ZSWA 4LQ3A 2D0BA 4FZXC 3MEEA 3KLFB 4J9PA 2HNYA 1K1SA 3OSNA 2C22A 4FW1A 4DQQA 1XI1A 4NYFA 1QUVA 4Y1DA 4ED2A 4WFXA 1S1UA 4KKOA 4TY8B 2W8KA 3CJ3A 1S6PB 4XPEA 2JC0A 1NOZA 1YTUA 2VWKA 1K6YA 1CXQA 3TVKA 3CFOA 4GW6A 4O0IA 2R8JA 4F8RA 1JLFB 1Q9YA 4YFUA 4ZP6A 4FK0A 2XWYA 2YNGA 5KFXA 1XC9A 2VWJA 1JKHA 2ASLA 3BSOA 5F8GA 3AVCA 4ED8A 1MMLA 5KFOA 4NLSA 4PQUA 4CGHA 1RDDA 2XCAA 3EPIA 2QXFA 2HVIA 3M8PA 1S0MA 4K4XA 5KFKA 1C1BA 4WFYA 1XWLA 1KRPA 2XC9A 4RG8A 3VQBA 1RT5B 3SZ2A 3KLHA 1S1TA 4IFYB 3KJVB 3RMAA 5F9LA 1JLAA 5J2PB 3LAMA 1NHVA 3M8RA 4CGIA 2C2EA 2OPSB 4TQRA 3H98A 4CHYA 4DSIA 4F2SA 4O3SA 1NK9A 3L3VA 4KO0A 4NCGB 1SL1A 3QIOA 3OLAA 1GX6A 2IM0A 2YKMB 3AV9A 4OKEA 3BR9A 3OYMA 2XY8A 3VQQA 4DMNA 2AU0A 3G6YA 3DRSB 3BGRA 4J9LA 3OYHA 2F8SA 4ECSA 4M45A 3V1OA 4TSXA 3NHGA 4IH7A 4QW8A 4ZPBA 3SQ0A 1SL2A 3MR2A 3VQEA 1TV6A 1RBUA 1NK5A 4DG1B 4CJQA 4DTUA 3I0SB 5F8MA 4LSNB 4RW9A 2HHWA 4QPXA 4ZP8A 1TK8A 4B9TA 3NF9A 3H59A 4FZYA 4GC6A 4Z4GA 2D5RA 3MXJA 1HQEB 4Y2CA 5L1JA 4O3PA 3GIKA 4QOZB 3HL8A 1KSPA 5HRPA 5KFPA 1T3NA 3NH2A 4O3RA 1BI4B 1C0UA 4E7HA 4ZVFA 3NMAA 3H5XA 5HBMB 3ZT4A 3KLGA 1X9SA 3E01B 3MEDB 4KV8A 2Q3SA 3AO4A 1NJWA 4IKFA 2YNHA 4TN2A 3EYZA 2JGUA 5L1LA 3H40A 3QZ7A 1HNIB 4ID5A 3DMJB 1KVBA 2Z1JA 1L3VA 1N6QA 3CWJA 1TGOA 3H4BA 3ISND 3K5LA 3TARA 3PO5A 4IR9A 3G6VA 2ZD1A 4IDKB 2HNZB 4MFBB 4ZP7A 4EO8A 3PW2A 3V6DB 5J2QA 1QHTA 4CJWA 2OYQA 1RTDB 5JXSA 4E0DA 1CSJA 4G3IA 4H4MA 2OPPB 2OPSA 1JLBA 3ZSYA 2F8TA 1SUQB 2KW4A 4FS2A 1BQNA 4CF9A 4M3YA 1GOBA 4CEOA 3SV3A 1GX5A 3PX6A 2XGQA 1JLGA 3THVA 3TAFA 4U7CA 4G1QA 4MFBA 3ZCMA 3DOLB 5KFHA 1WSJA 5KFVA 5EU7A 4KI4A 1NKCA 4BWMA 3UDLA 3VQ8A 2UVWA 3QYYA 4IH5A 3NGIA 3SYZA 4IG0A 3MFIA 2FLLA 4G1QB 4KE5A 4M3XA 2FVSA 4K4TA 4RUAA 4O44A 4FM0A 2BDPA 1UAXA 4M41A 1XR5A 5KGXA 4CE9A 2HNDA 3RMCA 4FJ5A 1IO2A 3HYFA 3VN5A 1HYSB 4CK2A 5SZTA 1D1UA 4Q8FA 2OPQB 1GOCA 1D5AA 3I0RB 5HROA 2HVHA 2UVVA 4FJGA 1IM4A 1BGXT 2WOMA 1RT4A 1SV5B 2ZQBA 4JS5A 4FJJA 3HK2A 3MFHA 4ZHRA 3HO1A 1VSDA 1RT2B 4ZPAA 4KREA 3LP0A 5CZ2A 4CJUA 3PO4A 2AWZA 4CIEA 3VA3A 4YP3A 3RRGA 2IAJB 3DLKA 3FFIA 3ZT2A 3LP1A 3OHAA 1UA1A 2UUWA 3KK2A 3QNOA 3LDSA 4B08A 4CHOA 3D28A 1IKWB 1C0UB 4BE2A 3DDKA 3Q8RB 4J9KA 3AVKA 3DYAA 4OJRA 2AGQA 4NLQA 4BE1A 3QEVA 3CG7A 1TVRA
chains in the Genus database with same CATH superfamily
1BUPA 1VRQC 3NGRA 2HS0A 3TUJC 2V2VA 4IEIA 3V9WA 1HL6A 5EWEA 1NG9A 3MR6A 5KT2A 1WG1A 2GO9A 1J6ZA 3AGKA 2GA7A 4URGA 3OYJA 1M1KO 5A8KA 4DV0F 2IHR1 3R3TA 3ZZTA 3WBZA 4KGMA 2DNGA 3ENHA 2KG1A 1AUDA 3IRXB 4WQ5A 1RE1B 3QNNA 2Y0SD 3H5SA 3TA2A 4ZTJA 3FK4A 2ALYB 3GCXP 3A2FA 2MMYA 5DO2A 4NZ7A 3NH1A 3MN5A 5CYJA 4CYUA 4H5VA 1LW2A 4OI2A 2B5JB 4F02A 3VZIA 2F8MA 3J7YI 4DR2J 1EWQA 1R7IA 2BANB 1HI0P 4I6YA 3RAXA 3O1BA 2KQ2A 2P6SA 3RTVA 1O1WA 4G6VB 3F0NA 5L8RC 2OTLS 5BR9A 1I51B 1S1TB 4YS2A 3UD4P 1C1CA 1N5QA 5KFAA 2Z2MA 1FXXA 4TU7A 3UR0A 1KLNA 1RDRA 5AXMA 4X4PA 3O44A 1WSHA 3K5MA 1G4CA 5J2MA 5ITHA 2BJ9A 2EEYA 5GADI 3TAMA 2QMXA 3NCRA 3CDAA 1CJUA 1U6BA 2JVOA 4BRGA 3K57A 3G10A 1ZZNA 2I8EA 3ETOA 4EGLA 2BOAA 5L9XA 3Q89A 2UXCJ 5MLCV 2HG4A 3MN6A 3KK3B 2E1MC 4ZCKA 2E2OA 3J80O 3KHGA 3V4IA 1PBAA 4LFAJ 3D0PA 2BGGA 2QL5B 3KTQA 2B0GA 3MR3A 3VGKA 2AMCB 1X1PA 3HHLD 4NLVA 5KFMA 4DR5K 4CLLA 2F96A 3N0VA 5AQKA 4OZ5A 4ANCA 2V2QA 4XEIA 2UUAF 2QJ3A 3BH7B 1KONA 2MKIA 3AVMA 2VBXA 3Q8UA 2QXLA 4ILRA 3G0ZA 3O9SA 3H46O 3OYIA 4NOHA 2YHWA 3NNHA 2ZJRL 3AA9A 3BJYA 2FLNA 5D4LA 3W2WB 1ZAVA 2X7IA 4DV3K 4EP4A 4X66K 5D4OA 2D7SA 3HVAA 5E3QA 3R7SB 1QUPA 1X60A 2IVOA 4QWEA 1S97A 3HVWA 2DPJA 3KYLA 1FJCA 3P8BB 2B6AA 4IDKA 4DV1J 1C0GA 4HUEA 3SUNA 4O5FA 4F7VA 1FRXA 3RR7A 1HYVA 4JKGA 5FDLA 2ATQA 2BKPA 4E98A 3UN3A 5BR8J 2C2ZB 5JVGL 4WIQA 4J9VA 1NGFA 2GGPB 2A6AA 3DFEA 3CQ8A 4JLHA 3NGYA 2JLGA 3Q8VA 4M5IA 3IR7B 4PG4A 3BQ2A 4WXWA 1FKOA 5A6WA 1S7HA 2VA2A 1FJGF 2DFEA 2WW8A 4NXNF 4OLAA 4LBHA 1E6VA 1RBAA 4AHUA 2DISA 4CH7A 5DG8A 3KK1B 1SQKA 1NJIO 3FRZA 2UXBJ 2UUBF 4DR1K 3ILLA 2ZBCA 2K3KA 5IWAF 3GFHA 2P5GA 3RBXA 4X65F 3GIRA 1S1VB 2CQDA 1J5OA 1D8ZA 2MKSA 1GXTA 1SJFA 4Z94A 5EWGA 1YBAA 1GH8A 1VQPN 4DR5F 4WKRA 3M2VA 2CFXA 3OL6A 3IAYA 2PT0A 3G4SN 2PE8A 3KLIB 3P31A 4ZCMA 1L3KA 5KFRA 4KTQA 4M5KA 4ELVA 4I2QB 3Q2SC 1S9GA 2C42A 4CIGA 3MMJA 4WJBA 4ELUA 1NZAA 1XMBA 5HK4A 4CFAA 3GYGA 2KO1A 2XSJA 4A8KA 3L8BA 4LVNP 3M6VA 4DV2J 1X5SA 1DRZA 4LF5F 2FGCA 3OR2B 2AJQA 5HMZA 4JI1K 4K8RA 4GVBB 1WBDA 3ZLJA 5HMYA 2KFNA 4Z2XA 1NSAA 1Y3JA 2Z1GA 3RAQA 4DLEA 1RBTA 2P51A 4DQ8A 2KYXA 4F3MA 3H0PA 3HXMA 3J7Z5 1S7IA 3H2LA 2GNKA 3JYTA 4DFJA 1YJNN 1RTJA 4CLZA 4FYDA 2O66A 1HBUA 2V4JA 3CJ9A 1R8BA 1SH3A 4B3TF 2RQ4A 4C8ZA 2BQUA 3SPZA 1TU0B 4Y28C 4CZGA 1HBOA 3O80A 1J27A 1EETB 4M5JA 1N48A 1Q53A 1N0VC 3J7ZT 3PZPA 1VJQA 1YITN 4MIBA 5IM0A 1MWKA 3HOTA 2P9NB 4BRAA 4A47A 3DM2A 4KJIA 4TXSA 2RB7A 3ID6A 2KU7A 3ZTOA 4WP8A 3P5BP 2CQPA 1WI6A 3PW4A 1RGIA 3V4IB 3M6UA 3QT8A 1MN9A 3VQTA 1H73A 3EVOA 2DJWA 1K73T 2JEFA 3J8AA 1HYSA 1VQYA 4WFBL 1URNA 4ILJA 4NI2B 3AAWB 3VHQA 1AFJA 2RRAA 3M1FA 2DO4A 1RBOB 4BR7A 2E2NA 5B7WA 3HCXA 2W9CB 2CJYB 4DV5F 3PIPQ 3T1HJ 3NDKA 4B9QA 3CJBA 3CMAS 5KPTA 2YKMA 2ATLA 3SFUA 4DUTA 3M30B 1CZAN 5ELZA 3TYTA 1BISA 3TSUA 3OD2A 4LF2A 2W4CA 2NUUG 1JXVA 1SS6A 2POKA 1DLOA 5BREA 1HIYA 2E1CA 1AUSL 5GAEP 2BYCA 3VQAA 1SKSA 1GNKA 3ZSVA 2VD3A 4DR6J 3NGSA 1M5HA 3H42A 3MXHP 1VSKA 3TAGA 4ETXA 2EG1A 4BR9A 3QO9B 4IOAL 4NA2A 3T5LA 5BPMA 4F4AA 1T44A 4OYOA 4WBFA 1QZ5A 1V3ZA 3BSCA 1SB6A 4TVAB 3M1VA 3HHLB 3O1WA 4Z4FA 4RU9A 1U48A 4CLTA 4B8AB 2OEJA 4F25A 4JI4F 4CJ7A 2GCFA 3ZYYX 2NUBA 3CJ1A 2P5VA 3VF0B 3JQMA 3P45B 1TUVA 3GSIA 4IQMA 2W01A 4OLOA 4C3LA 4JI6K 3VGTA 4KHYA 1IR1A 2DFFA 4E3SA 4PXEA 5U47A 1UEVA 2VB6A 2HNYB 4RW6B 1RP5A 4W5RA 1QAYA 5SUHA 2QX0A 4AQYF 1S79A 3FZLA 4DX6A 3LZJA 4AHVA 3FZ2A 1DGKN 1KQGB 2HBRB 3BDEA 2BQRA 4F4WA 2BW7A 3OT9A 4CBWA 4BROA 2E4LA 1D8YA 4B1ZA 2XY5A 1T9VA 3H1QA 2Z58B 5DZ6A 3CFRA 2GAHC 2EK1A 1S5ZA 4PYDA 3S8SA 3G86A 2ACYA 3W7BA 2OPQA 2GHPA 7AT1B 4I68A 1WF2A 1RACB 1GLBG 4IRCA 1RTDA 5J2QB 4Q45A 1XTZA 2DNMA 2ZZTA 3VQCA 4YR0A 4O3NA 3B6OA 1VHXA 1QTMA 4PABA 3F2KA 4K4UA 2KZMA 3KUHA 3R9PA 4D3HA 5F8JA 3M2UB 5GAGI 1S4EA 4OI0A 2EK6A 2HMIA 2ZH5A 1VCTA 3OW2M 4C2MA 1H7WA 2ILZA 3BV8A 4KHQA 3OTDA 4JYAK 2BV3A 1T03B 2C3UA 4ZVSB 4A8SA 5IT4A 2Q1LA 4DCJB 1IJEB 3CO9A 2D69A 1RILA 2DXEA 2AA4A 4AXIA 2QSFA 2RE1A 2PFFB 1Y97A 5I3PA 1VQ5N 5FLXU 4H4OA 2R7YA 4NEZA 2O8EB 1K1QA 5KTQA 5KFJA 2BKOA 4DSEA 3KOAA 2ASPA 5ADZA 1X0PA 3LDPA 4FLUA 3IGNA 3CJ7A 1TKDA 3SQ4A 1U02A 2DCLA 3OBYA 3TAPA 5HL7L 5FROA 2NPFA 2XMUA 2VGNA 3MCPA 5DJBA 1MDUB 3LP2A 3LALA 2PBDA 4BREA 5J2MB 2O67A 9ATCB 2UUAJ 4JOUA 1ZETA 4KAIA 4JKAA 5HJYA 4FS1A 2FSJA 3DLGB 2QN6B 5D3GB 4KGKA 1UA0A 3E66A 2F40A 2FHJA 1NCLA 3QMQA 3OFEA 1H3DA 2VBWA 5FDLB 1IR2A 1Y11A 4DR4J 1TYQB 2HS4A 3EKUA 1QSYA 5EXWA 2JVRA 5F3TA 3MEGA 1BL3A 2DB1A 2VQFJ 2VFTA 1VBYA 4QYRA 3D2EA 2FJDB 2RS8A 5M1PA 3HJVA 4JI8K 4PZVA 3GR0A 4CLKA 2GX8A 1NK7A 1N5YB 2HRUA 2JHEA 4N8NA 5AZJB 4Z4HA 3T9ZA 2XCPA 5C0YA 3UD3P 2DIUA 1F3FA 2YWEA 4RNMA 3L09A 3CCZA 3ZT3A 4P52A 2LKZA 1YJTA 3V6JA 4FWQA 2U1AA 4QS8A 2BH1A 2CJBA 4LFBK 3DI6B 2XMJA 2ZWOA 3IGVA 4FPIA 3CF5Q 2I0XA 2AV5A 4DL2A 2ZE2B 4G1PA 2FSKA 2O8BB 3BZQA 3CDEA 3MI7X 2BE2B 1VK0A 3I33A 5G0RB 4DL4A 2LU2A 1X9JA 1HFEL 2W9BB 4B1UB 1U09A 1ZM9A 5KFDA 4CK3A 3ZSQA 3QFHA 4JK9A 1VOMA 4PHTX 3F41A 3OTOF 4DR5J 2R7RA 3ZEUA 4QR0A 2MQNA 2ZHBA 3A0IX 1MWYA 3QRPA 4ECZA 3JSMA 5IV3A 1H0HB 1LAVA 1T3OA 3RU0A 4ES3A 1VRTA 3J81j 3CFPA 2NXEA 1CJVA 4FP9A 4MKVA 1RBSA 4E2FB 3CCMN 1HBNA 2QG9B 3SDEA 1U25A 4Z4IA 2LMIA 1V3SA 3P5TL 4HACA 4KC5A 4OMFG 1QQNA 3THXA 2LDYA 2QL7B 1S0OA 1N5YA 3HT3A 4MIWA 2PN6A 2YNIA 1KHVA 1LV5A 4CJPA 3G25A 3N9UC 1UW9A 1T6DA 4Z37A 1FK9A 1GLJO 2VU5A 2MKHA 3WEEA 4M5HA 1S72N 3S01A 1TZ0A 3U3YA 4Y6IA 4JI8F 5KFSA 3A3NB 4YNQA 2CUYA 3CMES 2R7QA 3TUIC 4C8LA 3EGVA 2PY5A 2GVZB 8AT1B 3MEKA 2RQKA 3MAAA 3HHDA 3NS6A 4CFDA 1JLBB 3LDQA 2IJFA 4B1YB 3MM8B 5I9EB 2HHHJ 4OPJA 3T6BA 1ZBFA 4PY5A 1VQOS 1N34K 4MYUA 1NKEA 2MLXA 3GU0A 4ECQA 2Q36A 2M70A 3IS9B 3EKSA 3UCGA 2DO0A 3BPSP 3KUEA 4OL8A 1EKRA 4JKCA 2E88A 5AQHA 4USIA 4TYAA 1F9HA 4FW2A 2VJUA 5HBMA 3OXGA 2DNRA 2ETJA 4OYMA 1Z1ZA 2NNWA 3PFOA 2PMWA 3QPIA 4YDXA 3I5CA 3K9JA 3KZBA 4ETZA 5FD1A 5M1FA 3OR1B 4FM2A 2V4RA 2FBTA 5K8PA 2C2RA 2XMKA 3KWMA 5DK5A 4JV1A 4NLOA 5KPZA 1X5PA 3A4TA 1W2BR 1JJHA 4DJBA 3C6AA 4FJNA 3SQGA 5D0GA 4DG1A 4UUWA 3AXKA 1F6TA 1U6FA 1TKTB 5C10A 4JI6J 4YQWA 4K5SA 3M9OB 2JC1A 5IOLA 2OO4A 2B9YA 4I4BA 3LDLA 4CIOA 3DKDA 4HTJA 3ZNUA 3CUNA 2W6LA 2E6LA 2ITGA 4DTNA 2FHJD 1WKKA 3VQSA 2O5DA 4FF4A 1HWJA 4DUYF 3MM7B 3NFAA 2GV9A 1WEZA 3MPUB 2W24A 4F0HA 1HNZJ 2J6SA 5GAHU 1ELOA 4RW7A 4KHUA 3CC4N 5ADXH 3VF6A 4FF3A 2YCHA 3H6EA 3HD1A 5HAOA 1FESA 4QPTA 3TNVA 3CHWA 1VLYA 4YN3B 2VPYB 3O1LA 4FZVA 2XS7A 3UNYA 2CADA 2G4BA 1RDWX 2YQ1A 6FDRA 4IJAA 4U67Q 3H4DA 2YNHB 2BMBA 3RBDA 2CQ3A 2HBMA 1YJNS 2FC0A 3PV8A 2IOCA 2ZJPL 1EO1A 2D0PA 1ZA2B 2VBZA 5JS1A 4I69A 1W7AA 1O8BA 3MM5B 4OO1J 1UFKA 5KFWA 2IGIA 4DOZA 1SAZA 4RW7B 1OKJA 1ZC6A 3ULDA 1GQEA 1XJWB 4JI0K 4FNIA 4DKWA 1GXUA 5F9NA 3U1MA 2L41A 3U4LA 2A1RA 4O4RA 5H1SQ 2LVWA 1RU2A 3R97A 2YKPA 2P5OA 2WB1D 2ZITA 4DL3A 4F4ZA 3WXMB 4BDZA 4PL8A 1VQ4S 3ENVA 1WSGA 2HVZA 3KD1E 5KQDA 1F1BB 3MTJA 4LFBJ 1UEKA 4O23A 1VQMN 2BM0A 3ILIA 2QRRA 2G8UA 4DF4A 1WJ9A 3M8QA 2MQPA 4JD2B 2YX6A 2DH9A 2I7NA 4JP8A 1A5WA 1VI7A 2M7SA 3PNIA 1RFQA 5AQPA 1SBRA 4OX9F 1WEYA 1W7WA 1BA1A 1WSEA 2I5JA 5AQLA 2DNHA 3JSYA 2D3O1 5F41A 3M8YA 4CM0A 3L2VA 2RHQB 5D3GA 4P72A 5F8IA 1LFPA 3RSEB 3FSIA 5DM6L 2WUSA 2Z1IA 3KUGA 2AJ0A 4M3ZA 4K41A 2K3IA 3IFRA 4BQLA 2NUHA 1NUEA 2VBYA 4JI7F 5E2QA 3E51A 2W40A 1GLCG 5TKYA 3RZAA 4CT9A 5IT9Y 1G6BA 2DNOA 1UWBB 1RAAB 3R1LA 3MM6A 3AODA 1EP4A 2GJIA 3Q86A 4F04B 4WCEQ 2OGUA 3W2VB 5IV4A 4ED0A 3DLJA 4DR7K 3IS9A 4IXCA 3UFCX 4W5QA 1IJFB 4K0KF 1F5AA 4ZHRB 4CJKA 2CPYA 4CI6A 4HHHA 3P49B 1NBEB 1JXEA 4CGGA 3TWHA 4JB8B 3DRPA 5DQGA 2MKJA 3HHKA 4HT7A 2WFBA 5CZXA 2N7CA 2O3DA 1YBTA 2A10A 4JK8A 3SBGA 3PUFA 4C98A 2VWBA 2K1RB 3VQ5A 3GYXB 2DR7A 2WOMB 4KTWA 4ZN3A 3L7PA 2QSWA 1T03A 1QZ6A 3OYEA 2BJDA 3ULEA 2FZKB 4HTLA 3CJCA 1S6OA 3HD2A 1K8AO 3LH2S 4CJ4A 2Q31A 5C5JA 3A5NC 3HX9A 2VA3A 1HPZA 3CJSA 2AT1B 5BR8F 1T6CA 2OELA 3R2DJ 1KHWA 1IG8A 2IIHA 3AARA 3IBWA 1RLCL 1RU1A 2HRTA 2D1KA 4C3MA 2NREA 3PR5B 3LL3A 3AVHA 3VALA 2G0IA 1LW0B 3SDEB 1KD1O 3CPWR 1IBLJ 2E5IA 2NPIA 4BCAA 4CT8A 4HH1A 3HMJG 4IQXA 2IMOA 1WUAA 4WTOB 3C94A 3U9ZA 2W2OP 2MQMA 3QWUA 2MGZA 2G8FA 1HNWF 1VSIA 4ED1A 2KVIA 5KFCA 3WXLA 2VCPA 4JYAF 2WSCC 1FD8A 1JLEA 2GIFA 1SZ2A 2WBRA 4L75A 4P75A 3VQPA 4ZPTR 3CTRA 4I2QA 3WXJA 4CZLA 2BE2A 3GIMA 1U8WA 1HQUB 1C0MA 5BN8A 2QWMA 4RLEA 4F0MA 5DETA 4DV1K 2DT9A 1R8CA 2XMAA 4NYNA 5AJ3K 4NMLA 2QWRA 4J9MA 1TP7A 3HM8A 1AROP 1X4EA 3GBTA 2E20A 1L3TA 3M2VB 9RUBA 2K2PA 4N56A 2UXBF 2GO8A 4H4KA 3IAS9 4NASA 3CJ0A 3A5OC 3MPVA 2LQJA 2W4DA 1RT7A 1DQ8A 3M6WA 4PQAA 2V8VA 1RT6A 5AQTA 5E3AA 2HK3A 5AZJA 5JJBA 3BF3A 4DSFA 3CB4A 1NM2A 4WE1A 4QIVA 2H4YB 1CC7A 3LW5C 2D9PA 3WC2A 1S0NA 3QO9A 5EX0A 2CJAA 3Q83A 1FWPA 2RF2B 4F2RA 1PYTA 4NCGA 1BWFO 4PL7A 4OX6A 4MLHA 3DXBA 3SSQA 5A2QU 4WF9L 3FZMA 3TUZC 5EOYA 2VUGA 3W65A 1WC6A 5FJ4A 5KG7A 1Q5YA 1X5OA 1RWKB 4I9QA 1ASUA 1XMOK 3VVTA 3KG1A 2J0WA 3SI8A 3P83D 1IJJA 4ISEA 1WSRA 4ECVA 2W1BA 3LDOA 4I7FA 3F56A 5E5NA 3IWLA 3TI0A 2M3DA 3A3PB 1BIZA 1KTQA 1VQLS 1S6PA 3OPKA 2O8FA 1NGBA 5AXKA 3DLKB 1S1UB 2DHSA 3ZSWA 1RTHB 4LQ3A 5DDQC 5I4MA 4DV7F 1FRIA 1RWOB 4N7TA 4UOGA 2YH0A 2HNYA 3UDEA 2C22A 1QUVA 2R7SA 1S1UA 5A8WA 2W8KA 3UR3C 4XPEA 1G99A 2MQOA 3VEWA 1YTUA 3CFOA 1X4CA 3VPZA 3L4BC 1MMNA 1JLFB 4ZP6A 4FK0A 2DHXA 2FY1A 1NBWA 2YNGA 3HOSA 4GKJF 1RSCA 5KFXA 1XC9A 2ASLA 1WHWA 4M63A 2NZTA 2HRYA 4J91A 3J7YP 4ZLLA 5D8HB 4AQYK 3D7SB 4UY85 2AEFA 4OV1A 4ED8A 1HI8A 2KN4A 4Q7AA 2QXFA 3M8PA 4DX5A 1S0MA 4K4XA 3QSYB 1NMEB 2BACA 3RSEA 4WFYA 3CXCR 4FPBA 1GMUA 1UZDA 3VQBA 1RT5B 3UN5A 1FFSB 3SZ2A 3KLHA 1S1TA 3KJVB 5F9LA 1JLAA 3CXCM 4M7YA 3M8RA 3O3LA 3W5YA 4CGIA 3MM7A 4DV5J 4X4NA 2CH5A 3HSDA 4H03B 1HLUA 4KO0A 2VDHA 2F4VF 2HLTA 3OLAA 1GX6A 2YKMB 3AV9A 4OKEA 3BR9A 3VQQA 2AU0A 2R7TA 5DM6Q 1FW6A 3DRSB 1S57A 1Q0NA 1VHFA 5T7LA 2F8SA 1Y64A 4ECSA 2UUCK 3V1OA 3SMSA 1HNZF 2Z57B 2HHPA 5E84A 3CC2N 1TV6A 1QHAA 1WB9A 3CCES 4DG1B 1YLXA 4OI1A 1N34F 4DTUA 1NB7A 3TJAA 3I0SB 2B56A 3UWTA 4M5NA 3H59A 2ZJQQ 4CNYA 2D5RA 3CJAA 3CD7A 4Y2CA 4F26A 5B0EA 1Q18A 2DGQA 4RWXA 4JI2J 4NPOA 1C0UA 4JKFA 4ZVFA 1HNXJ 2AIRB 3NMAA 5HBMB 2NS1B 3E01B 3WUHA 4NXMF 2ASMA 1NJWA 2YNHA 3EYZA 1HNIB 4Q2MA 5BYRA 3CT9A 1SIZA 2KXNB 3G6VA 2QLJB 3T41A 4MFBB 2MYFA 3VF2A 4LUBA 2JNJA 4XDDA 3AY9A 3PW2A 2OYQA 1RTDB 5JXSA 2MGZB 4H4MA 4DR1J 2E2QA 1RGVA 4FS2A 4J9UE 1BQNA 3L95X 2V2ZA 2CDQA 3V5RA 4AL5A 1VC6A 4OI4A 1AFIA 3FBEA 5KFHA 2YXLA 3DLLL 5F0UA 5KFVA 3UKRB 2ZGZA 1RAOA 5CH7B 3NGIA 3MFIA 5F0WA 4M3XA 2FVSA 4K4TA 4RUAA 1ITPA 4OX9J 1UAXA 4M41A 3PYGA 1XR5A 4CE9A 1EQYA 3RMCA 1R43A 1HYSB 1Q81O 4BR2A 1KQKA 4WFAL 4DI6A 3I0RB 3CULA 3K5PA 4L74A 2X1AA 2DY9A 4FJJA 1R0CB 2AF6A 4LVOP 2RT3A 3MFHA 3I56N 3M32A 4ZLNA 2IVMA 1SC3B 1XNQJ 3GE9A 3QT5A 3HKZD 3W8PA 4YP3A 4JHDA 5IM0B 4AF1A 4X4UA 4LFCF 2OI2A 2UUWA 2IDLA 2C3YA 1QVFR 4USWA 2QW9A 4BE2A 3DDKA 5AXLA 2P9CA 1CVJA 3DXMA 4KSEB 2HFUA 3GTYX 3FDSA 1A7GE 3OW2R 1VQ9N 1U1PA 2ACMA 4FYYB 3JYTB 1FJGK 5LT5A 3MHYA 3SQ2A 2Q6BA 1VQ6N 3OHBA 1Y5LB 2XULA 2A5XA 4X4VA 2RU9A 2MLZA 4N41A 1F0XA 4AFFA 3CJ2A 2YI1A 4GVMA 2W2PP 4X84A 4DL7A 1U4BA 4DU3A 3RW6A 1S6QA 2OTJN 4QWBA 4ED7A 3UDCA 2H51B 1D0EA 2EC0A 5FLXO 3LWMA 4YOXA 4UUXA 2B5JA 3FCWA 4DR4F 1EIYB 3PKYA 1SH2A 4NLXA 4QS7A 1FJGJ 3LGHA 4DPUA 4I2PA 4AYBD 4ZKAA 3CETA 3HSGA 4FF1A 3Q8SB 4KH4A 1J2VA 4PUOB 3Q24A 3R5AA 4CECA 4CNZA 1W2BM 2V8HA 5HJXA 4B9MA 3R27A 1SQGA 3KLFA 1S1VA 3EN9A 1GEHA 4J9QA 5LJ5Y 1LXJA 3ADAC 4A48A 2FLOA 4BRDA 3WNGA 1OQ3A 4KFBA 1Q8KA 2B9WA 3U02A 1VSLA 1WWHA 3KWIA 3PR4A 2FBYA 2DY4A 4I7FB 3VQ4A 3RAMA 2H1YA 3D0HE 4DV2F 3ZZZA 4NE9C 2KM8C 1DARA 4A59A 4FYWB 5HROB 2ZBRA 2VIHA 3UNGC 2NLWA 5KG5A 2X6SA 3DGVA 4YB1P 3T1AA 1X4DA 3FC9A 3NF7A 2OJ3A 3ZSXA 3ZC4A 1V9OA 5M1OA 4DBQA 1UVLA 3IRWP 4FWMA 1ATSA 4AXJA 3VGSA 1CQNA 3V2UC 4FLYA 3OBIA 3FZHA 1WC1A 5KFZA 3I55N 3IC1A 4JK7A 5AQNA 4RBUA 3CCMS 1UOCA 2BJEA 2ZD1B 1FDNA 1S76D 1WSIA 1PIEA 4DTXA 2M8HA 1BLUA 2FVQA 4CYUB 1OH8A 1ZBTA 1DZ5A 1P1TA 1JCGA 1HLWA 1NK8A 3OR1A 1RA6A 2O8CA 5CCMA 2UUCJ 1RABB 3IMQJ 3CJKA 3K59A 4J8FA 2DTJA 2Q6CA 1VIOA 4H0YB 2ZH6A 3MAHA 2PZSA 4UZCA 1MMDA 4DTSA 2QWLA 4RW8B 2XMVA 1MROB 1HJRA 3HSTB 3WNHA 2DTUA 1KFDA 1ZBLA 2L9DA 2YQ0A 5LY3A 5HRRA 3N4QA 3H1VX 4B3SF 4W5TA 4RNOA 1MLAA 2Y8YA 1CJUB 2YHYA 3EE9A 3CVKA 3PW7A 3WX8A 4X65K 5BRDA 4H4OB 4H0XB 2ZHAA 4L72B 1JJ4A 2OIHA 5DGAA 1YI2S 2GVZA 2E5LF 1QDUB 4ZVEA 4JV0A 1CC8A 5ETSA 3WNEA 4I2PB 4PKDB 2EXUA 3ATUA 2HBQB 1BE4A 3AB4B 2FHOB 1S9EB 1A5VA 4R8UB 2KT5A 1M5KC 2OMLA 3BKFA 1DTTB 2CQIA 4DU4A 3AGRA 4GMKA 1J5EK 1KQSR 4ILHA 1U2CA 4ZJLA 5T41A 3K0SA 4KHMA 5JLHA 1ULRA 1UKUA 2HGNA 1UFLA 2CAJA 4ZCIA 4HHTA 5KG3A 2ZH1A 2JDJA 4RNNA 3HBTA 3IFEA 3CCUS 3KK7A 1HNVB 4H54A 1PSDA 5KG6A 4E1NA 1H2UX 5AT1B 2IYGA 3AD9C 2V9KA 1RTIA 1VSJA 2DHAA 2JEIA 2NCKL 2X51A 4P73A 4O0JA 2IM3A 3KMSA 1UVNA 1TTHB 2N7YA 2GJ2A 5KRSA 3MMVA 1T9YA 3GL1A 4UOFA 1BIUA 2HURA 2HSTA 2OPRA 2KXHA 3C14B 4JI7K 4TY9A 3JB9k 4JI4J 3BR8A 5FRNA 3HDSA 3F44A 1FCAA 3B6BA 2YNFA 3ZEUB 3K9KA 4LRAA 3J81U 2YTCA 1IVZA 2F9JA 3TAMB 3IG1A 1Y5NB 1M5VC 4CHQA 2HPUA 3AY0A 1WG4A 5GMKa 2HHTA 4C8OA 4OPHA 5HQMA 3SMPA 4KRWA 3PHTA 2IFXA 2NRVA 2WB4A 5CQGA 5C25A 4FLTA 3E2EA 3B82A 1SJ1A 3TZWA 4FDFA 3T5HA 4YB6A 4YR3A 1KVAA 1IBKK 1DHMA 4F36A 2ZDPA 2ZNYA 1VQPS 4CF1A 2G13A 3I0SA 3RB6A 4YOUA 5KG2A 1EHWA 3ZZ0A 3FZBA 2R7XA 2YX7A 4KHNA 3J81Y 3FQLA 4BC3A 1ZAXA 1OJ4A 5JVGQ 2E44A 4PRFA 5MLCQ 5FPEA 5CHIA 2C3OA 3F9KA 3S7RA 4LF4K 2GIRA 5B0GA 3GP9A 3SCJE 3EY1A 4B9LA 3D6RA 2VG7A 4MAKA 2QA4S 1FXRA 4H4MB 2W41A 2C2MB 1OSCA 2OD4A 2CKWA 3OL7A 2IJRA 4B9UA 1S1XB 4TU8A 3U27A 2CGJA 3SV4A 1UJ4A 4MTPA 4CH0S 3DXMB 3E9LA 3BP8A 2LXIA 2ZH4A 3NBPA 1ZBHA 3OVAA 1AT1B 4C4WA 1RXOB 3E01A 4ILGB 4YY3F 3D4JA 4RPFA 2XY7A 1OY6A 1QS4A 1IKVA 1BXNA 4ED4A 1F2HA 2H3GX 5TKWA 3MXIA 5MAOA 3L4QA 3ZXWA 2LEPA 5KAKA 4X64K 4MK9A 4B3OB 2AYBA 1PC4A 4A2BA 1BQMB 1BD6A 4CK1A 4DV1F 4X2BA 4NYZA 5KG1A 2XMTA 2BVZA 3DHXA 1NJYA 4PG7A 5KGWA 2V7YA 1NMDA 3KHHA 4CZMA 4NLYA 2E1PA 4PXCA 3MAAB 3LANA 4FJHA 2X6NA 2HNDB 2VC0A 2DITA 4FVMA 3GV5B 2RQCA 1FRLA 1M90T 4QIGA 1E4FT 3L9ZA 2X3DA 3PHEA 1EETA 3TO8A 3AVNA 2Q1NA 2CG4A 1B70B 1LCUA 4L6V3 3DRXA 2Q0RA 3G9CA 2F8EX 2N4DA 1IKYA 2G0CA 5IWAJ 3J7AP 2QM1A 3FZFA 1TKTA 3KJVA 1XMQK 1ICEB 3QAEA 3EEQA 2EFQA 1N36F 3CIMA 1UVKA 4M5GA 4P74A 2HMPA 1YDLA 3K17A 3PG9A 1VQKS 5A76A 3DLLQ 2AP6A 4Y1CA 3MWBA 2HHHK 4YEAA 2RF2A 5E3PA 5IT9O 4P2MA 1AA1B 3CCSS 4M5LA 4K59A 3QJPA 2R2UA 3DHWC 3IAM9 2AJFE 4KB0A 3BGLA 2OCEA 4FVUA 3SUQA 2QA4N 2EKNA 3V6DA 2IA6A 2CYYA 2X1GA 1LOTB 2QIFA 1FNMA 7FD1A 1NGDA 4F4XA 2ASDA 5DRKA 1DEJA 5E26A 3IXQA 2ZKTA 3ID8A 2ZWHA 5DM7Q 2ZE2A 5LSRA 4RKUC 4PKIA 2ZBPA 4WYBA 2BM1A 1KAZA 4CBXA 1MW7A 3TJ8A 4C8YA 4C6AA 3N5BA 3QIPB 3BREA 5E41A 3QEWA 2R2SA 4IZ9A 4CEZA 4IJNA 1D9FA 1RBVA 3AHPA 4P2FA 4PCQA 4QW9A 4ECUA 3TSPA 2CPHA 2V51B 3TTCA 5LL6d 3BO4A 3QETA 3HPOA 3OYGA 1S12A 3CDWA 3TTFA 2IJNA 2HS3A 1XMOJ 4C48A 2RD5C 1RAFB 1R3NA 3VAJA 1RBLA 4JEPA 2BEFA 1XR7A 5H1SV 2J0QD 3M5RA 1KVJA 3AA4A 3V9UA 3L2QA 3RBEA 1I5OB 2EFNA 1NJIT 1XK8A 2VQEK 1NZ8A 2UZAA 3B8AX 3TAEA 5DDPC 4O8UA 3CIPA 4C8KA 4H0PA 3EE3A 2D74B 3TR5A 3G6XA 2A18A 2ROPA 3GILA 4DR4K 3ATVA 2UUTA 2DYAA 4WQ4C 1OYEA 1WC4A 4JI0J 3NH0A 1R8PA 2HWTA 3CNQP 4C8MA 1U45A 1WHYA 4XH4A 2HHSA 5KFFA 3POTB 2PI4A 2UUCF 4B02A 3NGUA 3KNAA 2NXJA 3HPHA 2QYCA 2O8EA 2OANA 2NZCA 4NI2A 2VG5B 2G2OA 1OH5A 1JLCA 4WZMA 2P9NA 1F9FA 5J1PA 1GLAG 3R5DA 4HH0A 3KWGA 4HI2A 3IKMA 2DRBA 1VQ7N 1U26A 4M5MA 4J9RA 2IA0A 5DMRA 1NEEA 1HBOB 3H5UA 2WRMA 1RT1A 5KOXA 3CCQN 2HMIB 1UL3A 3V6HA 3C15B 5E3CA 3VQ6A 1YIJS 5ETNA 3DLRA 4QAGA 4OLPA 1O0PA 3MUMP 2QFIA 1UWBA 1QAIA 2NRZA 2CJ9A 3KLEB 3JS6A 3HF5A 4JKHA 4A8QA 5M1NA 4Q43A 2YKAA 3UE5A 1OQ6A 2ZVIA 2V8DA 3LF0A 4ITSA 3J80U 2XLKA 1KAXA 1NHUA 3VTHA 2VOPA 1QD1A 1TUGB 1BQNB 5HSPA 3OY9A 1U0SA 1HPZB 4EU0A 1UAWA 4DV4K 5K8MA 5HLFB 1ZBSA 3G8QA 4Q2LA 4NLRA 5CYMA 2A1SA 2E6MA 2V63A 5B0DA 3E9OA 3S3NA 1O13A 5C24B 5AXNA 1F60B 3UI3A 4IFVB 1J53A 3H3NO 5HMWA 4DV2K 3LGNA 1GLEG 3OS2A 2C3MA 1RT6B 2HWHA 3WXKA 4CFCA 3MPWA 3ENQA 2DPIA 5ETPA 3JQJA 4W5OA 3ZO7A 4P7TA 5L38A 4FKYA 2GW8A 4URQU 2HHXA 1Y0HA 1OO0B 1TFWA 1J5OB 4GVLA 1B64A 4M5DA 4DV4J 2BTFA 4CF8A 1N34J 2FJBB 1HQUA 4BGAA 3KK1A 1CBKA 3QJLA 3PIOL 2V94A 4P10A 2V34A 4RJVA 1EXQA 3K89A 1VK8A 1RAIB 4I56A 1G1XA 4ZVUB 1IBLK 2NRTA 3BM7A 2ZOMA 5KFGA 1IUJA 2P1JA 4W5NA 2WVFA 4CEBA 2RHSB 2W7PA 2H48B 3O9TA 2XYPB 3BF4A 5LL6Z 4A8MP 3I8BA 2GGPA 2HAFA 5CY4A 5AQZA 4OKKA 4RW9B 4OZNA 4LF7K 3CCTA 5BYQA 4LIWA 3IUCA 2E1AA 4E1JA 1U1MA 3MGJA 1T7PA 3UCZP 3W63A 4DR7F 1QJHA 3CCSN 7FDRA 1C0TB 5CA5A 4X62K 4CF2A 1TL4A 5I3UA 2IBOA 3SI6A 4JAXA 3G96A 1OY8A 3HFZB 2P9SB 4O55A 4JI3J 5KFUA 1CXUA 2RN2A 3BBBA 4IO9Q 1IXKA 3GG1A 4CGDA 2P9UA 2Z2ZA 3D2FB 3EMTA 4DX8H 4FWRA 1FERA 2OSQA 3GJQB 1HKCA 3VQDA 4IR1A 1S49A 3AA8A 2NYIA 5A8WB 1IBKJ 4H5NA 3H90A 2YKNB 5F0XA 1M90O 3PEJA 2D3OR 1NK0A 3SJHA 1Q1KA 3JSMB 2PEHA 2ZH7A 4HDHA 4KBIA 4IFEA 2MHNA 1LWFA 4LSLA 4YOVA 3D3CJ 4EBCA 1JJCB 4XTTA 3DGPA 3DOKB 4DPYA 1YHQN 5GMEA 3W2VA 4NEYA 3UKUA 4KKOB 6FD1A 1ATNA 5AFUA 3QRQA 4UTGA 3DWLA 5ETOA 4K4VA 3I82A 1HKGA 5GAHI 1EWRA 3PIOQ 4B8CA 3VGUA 4AH9A 1KLMA 4OGCA 1U6ZA 3A8IA 2XGPA 5FPNA 1I39A 2YX4A 5CHCB 2R9LA 1P90A 1CLQA 4PG8A 3M6XA 3QSIA 1QE1A 5ETMA 5RUBA 1WC5A 4CZHA 2W9CA 4WF9Q 4Y0FA 2QMUB 1RB0A 3WC0A 3OXLA 5SWMA 3IRXA 2HFVA 3D5MA 3IDHA 2EFVA 2M52A 2VF3A 1I94J 2CPXA 2ZUAA 1A5XA 4DCPB 3M8QB 3N01A 4ZVQB 2GC8A 3FCVA 1KP6A 2B4JA 3J80Y 2QT7A 4NWBA 3DOMA 4ED6A 1MG7A 4EHTA 4CZEA 3PY8A 4DQRA 1KVCA 1RT7B 3W8GA 3DCAA 3D7EO 1LOUA 2AKWB 3QFPA 4N76A 3NMRA 3FEXB 3D6FB 3O9QA 2KI2A 3GZ7A 3OUYB 2RH3A 3FQKA 4MH8A 1R31A 3IN5A 4DU1A 3OYCA 2YWGA 4RUCA 5A8RA 4GMJB 4HHJA 2ZOGA 3GFZA 3IR6B 5L1KA 4J37A 4LF7J 2DGWA 2APOA 4MIAA 1K9MT 5HI7A 4B3SK 3CGIA 3UKUB 5AZIA 3Q8PB 1RKJA 3SK3A 4BE0A 1FKOB 3W3DA 3SQ1A 2QA4G 4JI5J 1KBRA 1YRTA 4CDIA 2Z8QA 4KPCA 3NOCA 1FRKA 1R0AB 1M5PC 4Y00A 2R3VA 2CNNB 4DEZA 4BRIA 2FPHX 3NG8A 2QWQA 3TQ1A 3T19A 1VBXA 1Z2LA 1CEZA 3QATA 4RW4B 2R2TA 4LR9A 3GV7B 3KXDA 3SCIE 5LXRA 4QIFA 1UPMB 4FO0A 1VLOA 5HVGA 3D67A 1DY3A 2ZBIA 1YTAA 2VOOA 1ZBIA 2ZNZA 5LMUF 4BDYA 1O5JA 4NRTA 1TELA 2D0OA 1EKEA 4C0OC 2LFVA 4OJ3A 2ADCA 1X5TA 4E8UA 2NXNA 4DR3K 1SUQA 2DCUB 2XI3A 3JTOA 1IH7A 1WD6A 4E7LA 2UXBK 4AM6A 2K7JA 1TKXA 4EP5A 1S3XA 3MUVP 1S9GB 1YAGA 4FLXA 3OYFA 4ECRA 4NB4A 2MZTA 2IBKA 1BDGA 2IM1A 1T9UA 4RW4A 1BCOA 3W3SA 2ZUGA 1QSSA 2WK4A 1RYSA 1TUYA 4R0JA 2L48A 4JI0F 4ENOA 2Z0GA 2RPIA 3O3HA 1I94K 1VS3A 1UTAA 2UVUA 1XQSC 2MHEA 4USUA 3QGHA 4GC7A 3MZIA 3ASMA 4CJRA 3BBFA 2W9BA 4CHNA 2KJWA 1HR0J 1K47A 1B7YB 4FL9A 1PGZA 4C9DA 4DFPA 3MCAB 3FBFA 1DT9A 3LP3A 3RUBL 4YMEA 2FDNA 4M1KA 2GS8A 4KYZA 3KKSA 1HNXK 3RMBA 2KRRA 4ZVOB 2A2CA 4RW8A 4LF5J 1UW4A 1V4SA 3FRYA 4DUYJ 2MEWA 3CCLS 4JS4A 2QE5A 4USMA 1YVUA 2QFJA 3QLHA 3GPAA 2O8CB 3W9IA 2HWIA 1PILA 5E3RA 2RQMA 5L9NA 2ZOFA 2EFPA 3H2VE 1N32F 1KS2A 1VSFA 3S9HA 1URRA 1T9XA 1IKXA 5KRTA 3PRDA 2VICA 1NPRA 3AB2B 2YWKA 2VG7B 4XPCA 4DV7K 4K4YA 3CCRS 5CXTA 3R2CJ 3AVGA 3QFWA 3DLEB 2RNEA 4R0EA 1FVQA 5HQ8A 1FKAF 4MMOA 2MQQA 1OS5A 3B4DA 4KO0B 3THYB 1TL3B 4HVZA 4ICLA 4L8RB 2FQQB 3MF5A 2DGOA 2YWFA 4YOWA 4I67A 4AHTA 1K9MO 3MMAB 2OA8A 1MWMA 2JJ4D 4BC7A 3KLHB 3W5XA 3J7A1 4I0WA 3CDUA 3TANA 4CEDA 4CCHA 3OYNA 1JKHB 3EVWA 3WZ0A 2VKZG 2NYHA 2KVQE 2JEJA 4DQPA 3KJQB 5CYQA 4NLPA 2OSRA 3EPGA 3ET6B 2HQDA 3VZHA 1NLVA 3P39A 4NZ0A 1CJVB 4X4TA 2F5GA 3V81B 4KHPF 2Q79A 1VJWA 2YY3A 1X0FA 2LQBA 2OZSA 2VPWB 2D0BA 2ZM6K 1VDHA 3KLFB 5F2RA 3G87A 4DQQA 3GFYA 4FW1A 1XI1A 4NYFA 4FPRA 1AXQA 4NXMJ 4TY8B 5H9FJ 3QWPA 1NMNA 2KHCA 2JC0A 1NOZA 2J7KA 1K6YA 1CXQA 3TVKA 4F8RA 4GW6A 2R8JA 4LR7A 3H3OB 3GCWP 4QS9A 3TUPA 3M1VB 3S41A 1XNRF 2WSEC 4PG6A 3BSOA 4U95A 1UZHA 2P9SA 1NHKL 2H5EA 4CGHA 1N8RO 1TUUA 2ASYA 2B3TB 4P6QA 1KWMA 4RG8A 3ONQA 2IPOB 3CC7S 4IFYB 3MCSA 5J2PB 1NHVA 2OPSB 4WKYA 3H98A 4CHYA 1NK9A 3ZNJ1 2CVIA 2NRHA 3L3VA 4NCGB 5HOOA 3QIOA 1N54B 2I6WA 4GVBA 1UMJA 3A3OB 2XY8A 4DMNA 1RHQB 2WAQD 2OTJS 3NCPA 1YBUA 3EL2A 2ZVSA 1SC6A 1WBBA 3NHGA 4IH7A 4QW8A 2KXFA 5HN0A 3VQEA 1B0TA 1BOTO 1WORA 2UV8A 5BRFA 4C97A 1PYSB 4EMDA 1KKHA 1FX4A 4FXWA 4QPXA 2LEBA 1TK8A 4B9TA 2B4VA 4FZYA 2W6KA 2ATCB 3TZZA 3MXJA 4OHVA 1HQEB 4X4SA 2HSEB 1T3NA 2F65A 2A3JA 4WFBQ 1IBLF 2MXYA 3H5XA 4PYAA 1X3MA 3TW0A 3ZT4A 1X9SA 1HW9A 1XNRK 4HWIA 4YDUA 2DGXA 1FXDA 5L1LA 2J9DA 3QZ7A 3DN9A 4ID5A 1GT8A 4GO5X 1R0BG 5EGYA 2HBKA 1Q4RA 4OPAA 1TGOA 4KGVB 5DM7L 5KQ8A 1BC6A 3K5LA 1WDDA 2ZD1A 3D1QA 1YJ7A 1WSVA 4EO8A 4QU6A 3V6DB 5J2QA 1QHTA 4CJWA 3SCLE 3VR1A 4G3IA 1NNEA 2I38A 3H45C 2F8TA 1TR0A 3GJSB 3RVCA 4ZIWA 1HBUB 3CMQA 4LC9B 3FUYA 3QAUA 1GOBA 3OFFA 1U7LA 2KB2A 3FMBA 1G3OA 1GX5A 1JLGA 4DZDA 2BJ1A 3THVA 4WU2A 2XO6A 3V4MA 1Q16B 4MKYA 4K2XA 4MFBA 5D15A 3CF5L 2EG2A 5AFUH 1WSJA 4I1TA 1NKCA 1Q7YT 3QICA 1EKSA 2DKOB 4BWMA 4ID8A 1M5SA 3AAPA 4IH5A 3SYZA 5AQXA 2E7XA 4OYXA 4BRMA 4A2AA 2RUGA 4KQZA 2BDPA 3LOUA 4WP3A 4NXMK 5CZVA 2QO3A 1U2VB 4IO9L 4FJ5A 1IO2A 3BH6B 3VN5A 2MKKA 1KQFB 1D1UA 4Q8FA 3CSKA 1D5AA 2W25A 2KRBA 3D6TB 2XS2A 2UVVA 3CJRA 1BHNA 2CJKA 2WOMA 2F8HA 1RT4A 2ZQBA 2J4RA 3VEZA 3FJ2A 3W61A 4ZPAA 4KREA 2O8BA 3LP0A 3PO4A 2AWZA 4CIEA 3ZETB 2J7WA 2IAJB 2VYPA 3DLKA 5GAEU 4AD6A 3KK2A 1FRHA 3KJFB 3LDSA 2MSTA 2Z30B 1FWKA 2C2KB 2XHCA 2UP1A 4OJRA 2QMWA 2LCWA 4NLQA 2JLFA 2HEKA 3CG7A 2QWPA 1NSQA 4A5AA 4MJKA 2LDIA 3G82B 4OX7A 1OWXA 2ZH8A 1NH7A 4KBOA 4K50A 4GRSA 5HRSA 4ZLPA 3L4IA 5T7BA 4Y0WA 3I56S 2RE2A 2A42A 3OYBA 2E66A 3PW0A 1YJ9S 4DTJA 1ZPVA 4K2JA 2ZEJA 3PYDA 1FE0A 2B9EA 4X65J 3DLBA 1TK5A 3IO1A 2FF3B 1FDDA 4FXDA 4USJC 2J9DE 4DU8A 2J76E 4ZLJA 4YB5A 1Z6RA 3OV7A 4JKGB 3J7ZO 2XEXA 3BEGB 1ZTTA 3FMWA 4CJEA 4HDGA 3AO5A 3TPQA 1WACA 1NGIA 2ZJQL 1RBRA 1NDKA 1LW2B 1VRUA 3JTNA 1Q8LA 1O51A 4FWLA 5BYSA 1VQNN 4J90A 1P27B 2FYXA 1BA0A 3O4WA 1XERA 3B4MA 5BN9A 4M3RA 4OIXA 1RAGB 1S59A 4P71A 5K8OA 2V4QA 4NMXA 2CZ9A 4OYAA 3MK6A 1Z05A 3AVFA 1B3TA 4E7JA 1HWKA 5AQQA 2ZC4A 2AYEA 1TVRB 3HZEA 2Y0BB 2LLZA 1G2EA 3LP0B 2CQ0A 3VGMA 3MMCB 4C1NI 1HI1A 3R7NB 3GOIA 1JLEB 4FWNA 2ZFHA 5EY4A 3DU5A 2PSZA 3K7RA 3ENAA 4EO6A 3FBBA 4R79A 3IG1B 3WQTA 2B8QA 3MEEB 2VKRA 2JOQA 3CD6S 3M8SA 2ABYA 2OPRB 3C14A 2YNFB 2EPIA 2QA1A 4MO4A 3BPDA 1SKWA 2ZM6J 2AD9A 3UKRA 1JNRB 4MLEA 5K14B 2VASA 3ZSRA 4LMZA 4IRKA 3GR1A 1Q9XA 2G8IA 3M7VA 1IV0A 1TL7A 3LO3A 4PPDA 5F8NA 4BR0A 4KB7A 3NY0A 4FCYA 1Q95G 2QKKA 4M95A 3QGGA 3MCNA 1HNVA 1EQMA 4B9NA 4LRBA 3VGLA 2HB5A 5C12A 3TRGA 3PJ9A 1RAJA 4DHYA 3ZTRA 1GMVA 2VC1A 1S4FA 1YIJN 2DK2A 1T9TA 4C11B 5JMVA 2NLXA 2FBXA 4DB3A 3GJTB 2XO7A 5K8NA 2W4PA 4BVOA 4R25A 3P96A 1C4AA 4HLBA 1ATRA 1YWXA 2XTJP 5HRNA 1LWEB 3K5OA 3K2YA 5A8KB 4CO4A 5KT5A 1MU2B 3CYMA 3IA0A 4LRDA 3DRPB 3UE2A 2CGKA 1J5EF 4CGFA 3BQ0A 2KLAA 4KT0C 4Q44A 4OHZA 4ZK7M 1DAXA 4DN9A 4LREA 3OS0A 4I6MA 4BQZA 4RBTA 3AVIA 4OGEA 3Q0AA 3I5BA 3EGZA 1E6VB 4FXVA 4CGJA 4UT4A 4C8NA 4HYKA 1TV6B 1WSFA 3KLGB 2IC3B 1CZ9A 1ILYA 2E2PA 2OH2A 3D6HB 3L2UA 4H5TA 2R8KA 3KMQA 2F3JA 4A57A 2XZTB 3P1GA 3EE8A 2BRKA 4LT6A 5FRMA 4QU7A 4KRFA 3SSRA 2AZ3A 1REVA 4DDFA 1UVMA 2FTRA 3NGTA 1DTQA 4J2BA 2RIJA 1LEOA 2PIIA 4E7IA 4F9OA 3EUNA 5IQQA 1M1HA 4OQJA 2VFUA 1C1AA 3VOVA 1S0VA 2LQ8A 5L1IA 4H8KA 2DVIA 2V8GA 2HF4A 2YJEA 3I87A 1UVJA 3NWGA 4K0KK 2A1BA 4DR6K 4IG0B 4IUFA 2YKOA 3AA3A 4QBUA 2AP1A 4O4GB 3M6GA 3FEYB 3SMZA 4BR5A 4YOTA 2LQ5A 2ROEA 1N33F 4OV6A 4C0HA 2BKNA 4E1MA 3ETMA 2H4WB 1W25A 1IBKF 4IH6A 1ZS6A 1Z26A 1ZBUA 2D3UA 4EZ9A 2NRRA 2DBBA 3N4PA 4CJFA 2JWNA 3MUTP 4ZPVR 1ZTWA 4FBUA 1H1VA 3AOAA 3C95A 3LWLA 3DYAB 5CCLA 1TL7B 1M1KT 3R5JB 3TZYA 1HBMB 1QVFM 1JCFA 5I3QA 4DQIA 3ISNC 5EX3A 4KGZB 3DM2B 1M1GA 1N52B 4AHCA 4J9OA 1YG0A 4IG3B 2DNYA 2VFSA 2O8FB 3L3UA 1EX8A 3EDRB 5F8LA 1FF2A 1RWUA 4LH5A 3KK3A 4CBUA 5F8HA 3R1XA 1SV5A 3NMUA 4DTMA 3ZTSA 2FD2A 3MM9A 1D09B 4I64A 1YJVA 3HFKA 3K2PA 3DLHA 2E9RX 4JI5K 1WI8A 2V9WA 4IKAA 1Q81T 3TWZA 5LMNK 1C2PA 5CABA 4GVEA 4E7KA 3P5JA 3HZ6A 1B7FA 4N8OA 1H7XA 1SKRA 2E9ZA 4ICLB 2D9OA 1W2IA 4ILMA 1N56A 1U1KA 1OY9A 1YF5L 1VAZA 2YVSA 3PLAA 4X64F 1SJRA 3QRRA 1NXIA 3ZSZA 2BRLA 1Y9OA 3DLEA 3NS5A 2QTWA 2UU9F 2QC3A 1F21A 2EWHA 2J6TA 1HWUA 3MECA 1CJTB 3V9SA 3MEGB 4YHHK 1RA7A 4QQBA 1TK0A 3TX8A 2IRUA 1S9EA 5LOQA 1SI9A 5LM7E 4O3QA 3NF8A 3S3OA 1UWAA 3IWXA 3CD6N 2WONB 2NZ4A 1N6QB 1H72C 1HRHA 2E1YA 3C2PA 2KT3A 3GIJA 2BR0A 3A5MC 3H2UB 3NLCA 3HSJA 1Q86O 4CHZA 4AUKA 2I1RA 1SC1B 3PKMA 1C6VA 2AQ4A 2P6TA 1T0TV 4KY3A 1JXBA 5KPRA 3VETA 3ZTPA 1K8KB 4DV6F 2DNZA 1WHVA 3ZSOA 1KQSM 2R7VA 5M2RA 3W62A 1OH7A 2PGCA 4DSKA 1REVB 1FKPA 4QWCA 1B9DA 4CD3A 1VC0A 3QESA 3T1YJ 3LTOA 2B4PA 2W7OA 3OFHA 2Z2YB 3I96A 1XMOF 1RWWB 1Z2ZA 4LSLB 4TYBA 1RNHA 4P2XA 2A0FB 4LBPA 3U7JA 3BGRB 2V6AA 4G65A 5D0RA 2DGSA 4N47A 3AD7C 1NH8A 5AE1A 3UB5A 5AE3A 4J2EA 3R5GA 2HF3A 2Y9HA 4K4ZA 3U1LA 2CH6A 2UXDJ 3SIPB 1FFWB 2GWKA 2RUSA 5GINA 4OYBA 5AJ3F 2K06A 4B3SJ 1YVFA 4FJXA 1Y4ZB 3FEZA 4FJ9A 2DNNA 3D2FA 3W2WA 5KFBA 3V9ZA 3SQGB 3R6GB 4CLPA 3LUYA 4FOIA 4HUFA 3RYLA 1VSEA 1FX2A 3D1OA 5I3UB 2DR5A 4U67L 2BBEA 1UETA 4MKAA 3RRHA 5ETTA 3HVTB 5B0CA 5AQIA 3KNGA 2V50A 3C6UB 1U1OA 2ZJPQ 3NAEA 3VAFA 1U04A 3CCRN 3MDFA 4KV8B 2B7BB 4X66J 4ECTA 4CTAA 4R5PA 3DRYA 3IM9A 2D4WA 3QBWA 3E1YA 4LF9J 1SQFA 5DG7A 2HIYA 4YUDA 1Z4UA 1IM6A 3R8EA 1K44A 4OKJA 3CJ4A 1KEKA 1JCEA 2Y3YA 4JI4K 2Z56B 3A5LC 4ID5B 1RKIA 1XR6A 1IBMK 2IRXA 5EN1A 1WTFA 1I1GA 2J6UA 2IM2A 4KHRA 5A8RB 3AH6A 3W60A 2ERRA 4K5RA 2IC3A 3JXUA 3ULHA 4URSA 4C7QA 3JAMY 3RB0A 3JSRA 1F9EB 1HQ2A 4BGBA 3MN7A 3KVGA 2AYMA 5KG4A 3AO2A 4WFZA 1C1CB 2YJFA 3MX2A 4CEEA 3DOMB 4W90B 3N28A 4BC2A 3RMDA 4WTYA 4LSNA 2EHGA 5A2QO 2YH1A 2XZDB 3PACA 1RHMB 2EW9A 1T11A 4LF8J 3VF4A 1OIAA 5GADP 3CPWM 1LWEA 3GFXA 3KHRA 1YTYA 2XYGB 3EZ5A 1J54A 3BSNA 3MR5A 3ZZOA 2E7WA 2EVZA 5AQUA 2ZGYA 4HVJA 4C11A 2ASOA 3G6ES 2MJUA 3RJMB 3TABA 2CQGA 3M3ZA 4NA3A 1TL1B 4GO7X 3X1LB 2FHMA 2AX0A 5KT6A 5GIOA 1QAXA 4EUVA 2DY1A 1RT5A 3QZ8A 2OZMA 4KPYA 2OMOA 2F9TA 1IG9A 3TSQA 1QVGM 3NNCA 1X8DA 2F9DA 4GKKF 1JK9B 3PVXA 4PWDA 1U2RA 2JSXA 4EWTA 2IVYA 5EWFA 4ECYA 1VMBA 2AW0A 4QR1A 1KAYA 3HULA 2NR0A 4M3TA 1HA1A 5J2NB 1HYZA 2EKYA 4D3GA 2HAIA 4JKBA 1LWFB 2U2FA 4Q0BA 3M9NB 4FPAA 3G82A 5A0YB 2JEGA 1ZYQA 4XH1A 3TAQA 3MPYA 4BDPA 3WDOA 1S77D 3GMGA 1N36K 2XS5A 1RTZA 1T02A 2FVPA 4DR7J 3LPUA 2B9XA 2O8DA 1FT8A 2CNLB 1C4CA 4NRUA 2XNQA 4BRHA 3AVAA 1PJ5A 3SSSA 1EAYC 2JWKA 1RT2A 3ELHA 4ZPCA 2VODA 2IVNA 3CJ8A 4K25A 3AVBA 3A1YG 2Y1IA 3SAHA 2B43A 1WOPA 3GONA 3ALYA 4U9RA 2WTUA 3DNCA 4WWSA 1BWVA 4RNFA 3MMBA 2HHUA 1AYEA 4MDAA 3ITHB 5G4DA 5GAHP 2CRLA 4OZ2A 2R8GA 4LF8K 1S72S 4EBDA 2WVCA 1RWMB 3PXGa 1LQ9A 4I9LA 1Q82T 3NCIA 4G9ZA 1I3OB 4RWTA 3FNNA 2SXLA 4XK8C 3R8YA 3BSAA 3PRBA 1JXLA 3DDIA 3K5NA 2RKIB 4OVLA 2NSCA 1FRMA 4EYHB 2XSJB 3AFGA 2CNKB 2EI5A 3R3LA 4LFBF 4IOCQ 1UP1A 1NDLA 2VV5A 2L08A 2HNZA 3RRKA 4EEYA 1H2TZ 1EX4A 1RAEB 1WNSA 1B99A 1YRXA 1X9MA 1NU4A 3CCJN 1B0VA 3HHLA 3AJDA 1JWWA 1SXLA 2EBGA 4DS5A 2QA2A 3WQPA 1YX2A 3TX0A 1YHQS 4LD0A 1H38A 3QEXA 3SCKE 2LEAA 1Q8IA 4FYVB 1NDCA 2Q0UA 3WNFA 1FE4A 3QBCA 3P4UB 4KAZA 1YZ7A 3ZETA 4OZLA 3U3GA 3G71N 2HIQA 2CZ4A 2B4OA 5DG9A 3OJSA 3OHRA 3ISZA 1WC0A 1NK4A 3HP9A 4Z4EA 1DKGD 3PCOB 2LA6A 2DGVA 3PX4A 1T05B 1X7VA 4OZ0A 1NU0A 3B6PA 3OTCA 5CYMB 1V4TA 3M30A 2CA9A 3HLUA 4K0KJ 4EZ6A 4CJ3A 4CRJA 3O4NA 4M3UA 2KHDA 3N4WA 3MMBB 1VQ6S 3PSFA 3G2XA 3QIDA 3HI9A 2ZKUA 2YPYA 4BLGA 2UU9J 2CQCA 3TEHB 2F4FA 5CD4H 5D4NA 1LW0A 1PC5A 2QGFB 2ILYA 3SLCA 2GFFA 4ZVHA 2N82B 3LM2A 1MN7A 1P1LA 3ITHA 4G1IA 2HQGA 4OX9K 4CO3A 4HCBA 1HR0K 3RB4A 3F73A 4IBNA 2HW3A 2EX3A 1ZAWA 4BRPA 2N3LA 3UW1A 3VEXA 1LK5A 3PJXA 1UCNA 2E9TA 1FHTA 2UVRA 1J9AA 3C15A 4YB7A 1L3SA 4BRNA 1WG5A 1OH6A 3NEKA 1N4LA 1CJKA 2HKEA 3SCXA 1APSA 4U8VA 4LF7F 3DDNA 4I6AA 3LDNA 3KLVA 4WYLA 4NCAA 1H2VZ 2G8HA 3C6TB 3CD0A 2R7OA 4IEEA 1XNQK 1VC5A 4PXBA 3VEOA 4CLFA 1NRKA 2A41A 1Y10A 3BO2A 3CERA 1E3MA 2XY6A 1HHTP 1R0AA 5HVHA 2P9PA 2FJWA 2FC9A 2M5YA 4RL1A 4ERDA 2CQ1A 3FKBA 3NKYA 4RZRA 2XLIA 3CCWA 1VQ5S 2GUIA 4QWDA 1QQOA 2F1FA 1EP4B 2V4JB 3BYPA 4B3MF 4DL6A 4DUZF 1WOQA 4MDBA 3VWSA 1VRUB 2E1ZA 1RUSA 3BZCA