3KLHA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to post-translocation aztmp-terminated dna (complex p)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
total genus 129
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klhA05
4OVLA 1S1XA 3AA3A 4B9MA 3TAQA 4RW4B 3NGDA 3CYMA 1RT2B 4O3QA 1JLCB 2G8IA 4F8RA 1S6QB 4Q8FA 3UR0A 4DTJA 5HBMA 1JLEB 4CK1A 3KLGB 3UQSA 4NLXA 4FJNA 3AO1A 4ZVGA 1YVUA 4DMNA 4G1QB 4M3ZA 4FZZA 2R8GA 3M9MB 3NGYA 4GVMA 4K4UA 4MFBA 3DLGA 3CDWA 3D0PA 1VSMA 2B43A 3E51A 1NK0A 4E7LA 5JXSA 4DTPA 3VQ8A 4RW9B 3K59A 4NLQA 4IRDA 1KFDA 1JIHA 4IG0A 4FS2A 1VSDA 3ZSYA 5KFTA 2VG5B 2WONA 3VQ6A 4IDKA 5DQHA 2ZQBA 3QZ8A 4TLRA 1DTQA 4O3PA 1RT3B 1T03B 1L3SA 1RT4B 1CLQA 3K5LA 4TY8A 1QS4A 4LSLB 4H4MB 2Y1JA 5KFHA 2HHQA 2BQ3A 3DLBA 3D28A 4ECYA 4KHNA 3AVJA 3BJYA 3RMBA 5KRSA 3KIOA 3FFIA 3MEEA 3CJ4A 3ZT0A 4E19A 4N76A 5KFAA 4EYIB 3MTKA 4URGA 2FJWA 1J54A 4PA1A 5EDWA 2X78A 4XO0A 3K5OA 4FLTA 4KO0A 1NNDA 2E4LA 1Q9YA 4ID5A 4NCGA 1X9MA 2IAJA 1RAJA 3DRPA 3N6LA 4R5PA 3GILA 1ZBHA 2D3UA 3QLHB 1FKOB 3EPIA 1YVFA 1S1WB 2E9TA 2VG7B 2X6NA 4M3TA 3N6NA 3HT3A 4EP4A 4DFKA 2JC0A 4O3RA 2ILZA 1CXQA 3PO4A 4F50A 4FJ7A 1HNIA 3SUQA 3O4QA 4AHUA 1KVCA 3RMDA 4FW1A 4OPKA 1YT3A 3HL8A 3L2QA 3PW7A 3BGRB 4DTMA 3IGVA 4IR1A 1W9HA 1HYVA 4RW6A 4PWDA 4FW2A 1Y97A 1NK9A 4CEFA 1KLNA 3QO9B 3SQ0A 2CJQA 2HNZA 3DDKA 3ZSWA 3RB0A 5KFFA 1XHXA 2OH2A 1VRUB 3PJWA 3LP0A 2IM0A 3PW5A 2AX1A 1ZBUA 3U3YA 3P1GA 1TKTB 1S1VB 5F8GA 3KLHB 2YNHA 5FRMA 2KZMA 3PW2A 4DQSA 5J2NA 2UUTA 2R8IA 2FVRA 3AVMA 2V9WA 3SV3A 2VG7A 4WYWA 1HNVB 4CHYA 3LPTA 2KZZA 4M45A 3OYKA 1LW0B 1S0OA 4H8KA 2AWZA 1HNIB 3C6TB 3TAMB 4J2BA 4TY9A 3RMCA 4YNQA 4FJHA 3PZPA 3CVKA 4I2PA 1SUQB 4KBIA 2RKIB 3ZSQA 4FBUA 3SUOA 4KE5A 1DTTB 1JKHA 3MR2A 3WNHA 1IH7A 2YKNB 3I8DA 3WNEA 1S0NA 3CM5A 3IRXB 4ED8A 1T3NA 3KLGA 4J9SA 1KHVA 1U49A 2OZSA 1RA7A 4JRQA 3ASMA 3C6UA 3V6KA 5F8MA 3V81B 2XY8A 3HPHA 4B9TA 3HKWA 1JLEA 4DL5A 2OZMA 2WOMA 4ZHRA 2YHBA 3HK2A 4QWAA 3OYLA 3DLKB 2HHWA 3HXMA 4WZMA 2DFEA 3C6TA 2BDPA 5HROB 1WN7A 1C0UA 2G8HA 3U3GA 2J6TA 4RW9A 3ISND 2E6LA 1NK4A 2OPSB 2VG5A 3Q8SB 3IS9B 3OYEA 2VWKA 4CJQA 2BGGA 5D3GB 4KKOA 4NLDA 4E7IA 1U04A 2YNFB 4PUOB 5DQIA 4NLSA 3BQ0A 5KT5A 1HYZA 2VA3A 5EU7A 2HHXA 3OHBA 2GC8A 5J2PA 3GQCA 3OYDA 4CEDA 1TKDA 5KG4A 2RN2A 4RW8A 5KFVA 1RDBA 2GIRA 3KMSA 2HHVA 4KHUA 1Q9XA 4B9VA 5KFSA 4LSNA 2QK9A 4NLRA 2DFHA 3HVAA 3MAQA 2W42A 2QKKA 3H98A 4NYZA 1BIUA 2J6SA 1BI4A 4W5TA 3GIKA 3MEDB 3BR9A 5KT6A 4WE1B 1ZETA 4ED6A 2YNIB 4PUOA 2F8SA 4O55A 3KNAA 1W0HA 5JS2A 3QLHA 4CF1A 3I5BA 4FJJA 3WNFA 1RBTA 2IAJB 2BQRA 4EYHB 3QYYA 4FBTA 3GIMA 1JXBA 5KI6A 1KFSA 3VQDA 3MECA 1FKOA 3KHLA 3MR6A 2V4RA 5DMRA 4O4GB 1BQMA 5F8HA 1QE1B 4RW6B 4PWDB 2RDIA 2YKMA 5DG9A 3BSAA 1C2PA 4CJWA 4BWMA 3V6JA 5J2MB 3M8QA 1BISA 1RBVA 3SZ2A 2ALZA 1KSPA 1BQNA 2P1JA 3ZT2A 1RT6A 4MIAA 4RNOA 3LP2B 3Q8RB 1HYSA 4K4YA 4MK7A 2NUBA 3MEEB 4O44A 4IOBA 1LAVA 3HVWA 2FBYA 3NKYA 4LH4A 3DLEA 1A5XA 1TKXB 2B4JA 3I0SA 1JL2A 4E3SA 4KPYA 2Z1JA 1CSJA 4I9LA 3LP1B 5KG3A 3TABA 4DL6A 1JLQA 5I3UA 4OKJA 5J2NB 1SKWA 2W7OA 3DOKA 3NF7A 4M3WA 4ECTA 1XR6A 4ZPCA 3G6YA 1NJZA 4DL2A 4KHMA 2EHGA 2AJQA 3QINA 1S9EA 5CZ2A 1RT6B 4M3UA 3TAGA 1OS5A 1SKRA 4Y2CA 4CHOA 2AGOA 4DTRA 1XR5A 3M8QB 4I2QA 2IM1A 3G6VA 3S3NA 3ULDA 1KLMA 4E7JA 3PO5A 3T19A 4BWJA 1VSJA 1JLBA 5KFDA 3NL0A 2FBTA 1S49A 2XRIA 4W5NA 3C95A 3AVLA 2FVPA 4TYBA 5DG7A 5L1JA 3RAQA 2ILYA 2FBVA 3TWHA 4O4RA 4WYLA 1RT1A 2OPRB 5JUMA 2WRMA 4CGJA 3T1AA 1TP7A 5HP1A 4DQPA 4CJ4A 4K4XA 2IA6A 2C2DA 1IKXB 2GIQA 3NGIA 4Q0BB 3BQ1A 1RDDA 5KFUA 4F4ZA 1JLGA 4KTQA 4G3IA 4DLGA 1TK8A 3PR4A 2JC1A 2BANA 2G8KA 4DF4A 3FSIA 4DTUA 4TQSA 3VQQA 4KSEB 3G10A 3TR8A 3OSPA 3NDKA 3KJVB 3SCXA 2ZE2B 1WSGA 3IG1B 2G8FA 5KFQA 2XY5A 1S97A 5D3GA 1U09A 3KMQA 3ZSXA 4CHZA 4CJFA 1RTJB 4HHTA 2EC0A 1HQUA 3KOAA 3PX0A 1ASVA 3SPZA 3NF6A 1LAWA 4Y1CA 1T8EA 3MR5A 3RBDA 2BANB 4C8LA 4FJXA 1RDAA 1BL3A 2HNDA 4BDZA 2QV6A 3KK3B 1YTAA 1KRPA 1TV6A 4K4TA 1J53A 2V0NA 2B6AB 1LWFB 2C2RA 3AVIA 3MEDA 4ZHRB 3V9WA 4J2EA 2XHBA 1TL3A 3VQ4A 4IH5A 5CYQB 4DG1B 3JYTA 1NHVA 4CGIA 3PW4A 3K2PA 2BE2A 3AA4A 4HUFA 3L2UA 4FM0A 3MR3A 4B9SA 1L3UA 4FK4A 1S1UA 4CEQA 1U4BA 4GMJB 5E41A 1CZBA 3DLRA 2XO7A 3LAKA 4M3RA 4J9KA 2OYQA 3DYAA 3NBPA 1ZBIA 4ECXA 4EBDA 3MECB 1WNSA 4DS4A 1NK7A 3KK2B 3AVBA 4IG3A 2F96A 3BSNA 4CHNA 4R8UB 4TXSA 4TYAA 4RNMA 3LDSA 1TK0A 4IQXA 4CEEA 3SQ2A 3V4IB 1D8YA 4CJKA 1S6QA 1WSFA 2O4GA 4NLWA 4FLYA 1NJYA 2UVUA 1SUQA 5DGBA 3DM2A 4O0JA 3H5UA 1HMVA 4W5OA 4FS1A 1IKVB 2VA2A 1NJWA 4RUCA 3NMAA 2E9RX 3GV5B 3KD1E 2ASJA 4QW8A 3OS1A 1C6VA 3OL8A 1T05A 1VSEA 2IBKA 1BGXT 5KT2A 4FLVA 3LPUA 5SZTA 1VRTB 2Z1HA 3I0SB 1O1WA 3T5HA 1EX4A 4NYNA 3OYGA 4CGFA 4IH7A 1TL1A 4CFAA 4FLZA 4E7KA 4IG3B 3NE6A 4ED3A 1JXEA 1B92A 4Z4EA 2KW4A 2UVVA 3EZ5A 1R0AA 4KHWA 4FZXC 4CF2A 1N5YA 4N41A 1KHWA 4K4SA 3PX6A 4CERA 1S1TA 2C2EA 4O3SA 1LV5A 5DK5A 2FLNA 1N6QA 2HMIA 4ECSA 4GC6A 4ZP6A 2IS3A 1C0UB 3NH1A 2HWIA 2IJNA 5EWFA 1Z4UA 4E89A 4ED2A 1UWBA 4MH8A 1NKEA 3IS9A 4RUAA 3SYZA 4CK3A 4AHTA 2JEFA 1C1CB 2O5DA 3DRRB 5J2QA 3H5XA 3KKSA 4R5PB 4OL8A 4CGHA 3HVRA 5L1LA 3P83D 5F9LA 5HP1B 3H59A 4GW6A 3OYCA 1IKYB 1S1TB 1WLJA 1EETB 4KO0B 5C24A 2GV9A 4RW8B 1R0AB 2C28A 4H4OB 3CJ3A 1N5YB 2Z1GA 3QERA 2B5JA 4FJGA 3B6OA 4N47A 4QOZB 3CFPA 4AHRA 1SL1A 1C1BA 4OJRA 2A1RA 1L5UA 3KLFB 4ECQA 4AH9A 4CGDA 3PR5B 2DY4A 1TKZA 1ZTWA 3RRGA 5DG8A 4ZP7A 3AA5X 3RR7A 5KFLA 1U45A 1I3AA 3QNNA 3MXJA 3QESA 3RB6A 3HPOA 1SH2A 3K5NA 2OPSA 3MEGA 4NLYA 4MK9A 2I5JB 4B3OA 3SUPA 2C22A 2D41A 4FZYA 3HHKA 2O4IA 3V6DB 3VN5A 2ZD1A 4Q5VA 3QGIA 1HQUB 4KFBB 4NLGA 2WOMB 3C94A 4AHVA 1JX4A 2VG6B 4F4YA 1N4LA 3V9SA 1KCFA 4KI4A 1IKWB 3PUFA 3RBEA 1EXQA 1RBSA 4JLHA 4MFBB 1EKEA 2KTQA 3ZSRA 1TVRA 4Y1DA 4AHCA 2QE5A 4HUEA 3FRZA 4EEYA 3TAPA 4CHPA 1SV5A 4E1MA 3NH0A 2ASDA 3AVHA 1GX6A 3JYTB 2YKNA 3V6DA 2ATQA 2HWHA 1S1UB 1RT3A 3VQPA 3SNNA 4WXWA 4I7FB 3G0ZA 3M8PB 3OLBA 2W7PA 1U48A 4LY7A 2YNGA 1J5OA 3SV4A 3ZSZA 3NF9A 4CF9A 4WFXA 1HPZA 4TY8B 4ED1A 3HP9A 4YMEA 4EZ9A 4MKAA 1QUVA 3OL9A 1BHLA 4O3OA 5C42A 1RYRA 1K1QA 4B08A 3BSCA 2R2RA 3ICLA 4Z4CA 1UA1A 4WE1A 4CFDA 1N56A 1RT5B 1RDRA 1C0TA 4FJMA 3DI6A 3V9ZA 1NOYA 3SFGA 2XCAA 1KTQA 1BQNB 2D3ZA 4WXOA 1C0MA 3NAHA 4QAGA 3K5MA 3VQCA 1JLFB 2W9CB 1Q8IA 3RAXA 4NLTA 1FXXA 4ECVA 1S48A 1VRTA 4J9NA 1FK9B 2R8HA 2BE2B 3H5SA 5K14A 2UUWA 1S1WA 2PYJA 2IC3B 4NLPA 3D5MA 4CECA 4KRFA 3HO1A 1KVBA 3HPGA 5KFYA 3QEPA 4C8OA 1ZBLA 3O3HA 1QSSA 4KB7A 5KTQA 2FVQA 3SQ1A 4MKBA 2WCXA 1A5VA 2IDOA 3HVTA 4CEAA 3KKRA 4C8NA 5KGXA 5KFRA 3GYNA 2W9CA 4C8MA 3OYNA 2XGPA 4I2QB 4BE2A 5FROA 4LSNB 2FLLA 4NLUA 4JRPA 2ITGA 4B8CA 1LWCB 3QEIA 3S3MA 4F2SA 4OKEA 3E01B 4KAZA 1T05B 3M9OB 1X9WA 3MFHA 1WSHA 2G8WA 3P5JA 2W9BA 4W5RA 5C24B 4Z0UA 5CYMB 3HVTB 1S9EB 4RW7A 1K1SA 5KFPA 1GOBA 3CM6A 1K6YA 2OA8A 2KFZA 2BRKA 4MIBA 3G86A 4FJLA 2HVHA 1LW0A 4IRCA 3RR8A 4CJLA 3SQ4A 4I2PB 3BSOA 4YR0A 1LWFA 5CY4A 1RCHA 4FK2A 4ED7A 1JLAA 3UDLA 2I5JA 4B3OB 1NJXA 4BE0A 1L3VA 4E7HA 2WONB 1D0EA 3E01A 4DL7A 3LZJA 3O4NA 2X74A 4KREA 3EPGA 2QKBA 4FYDA 5F8NA 2CKWA 4CHQA 3LP2A 2RF2A 5EUHA 3KLVA 1VSHA 1TGOA 4DF8A 4LD0A 2HNYB 3KD5E 2IGIA 5KFWA 5FDLB 2IM2A 1LWEB 2P5GA 2ATLA 1IKYA 4CIFA 1EP4B 1IKWA 1WAJA 3RMAA 4HCCA 4PQUA 4JV1A 3IAYA 3L8BA 3H08A 1ITGA 3QGGA 4OLBA 1TV6B 4F3OA 4ICLA 3LAMA 1UA0A 3RWUA 5KFEA 4FCYA 3NGZA 1TAQA 4QWCA 5I42A 3KLEA 4EBEA 2OPQA 4RU9A 4ID5B 4NCGB 1SH3A 4DFJA 1D9DA 1RNHA 1NKCA 3GIJA 4ZVHA 1KLMB 2PYLA 5L1IA 4I7FA 4FM1A 4ECUA 4Y2AA 3EYZA 1YTUA 1N48A 3IN5A 4BACA 3DRSB 1TQLA 4FJIA 2WHOA 3QIDA 4Z4IA 2RF2B 1GX5A 3M9NB 3ZT1A 1XC9A 5KFIA 3KLHA 2IM3A 1RT5A 5KFBA 4KHSA 2ASLA 3MFIA 2BQUA 3VA0A 1VSKA 2DPJA 1QSYA 3BGRA 1XI1A 4ZPDA 3RB3A 4DSJA 4NLVA 3FQLA 4K4ZA 4QW9A 1VK0A 3QO9A 4KAIA 5KG6A 2FLPA 4LQ3A 4Z4HA 2DPIA 3DM2B 5F8LA 1RA6A 1C1CA 5KG5A 4AILC 4K4WA 1T03A 5F8IA 3CIZA 2R2UA 3RB4A 4LH5A 3ZT4A 3OL6A 2IC3A 2D0BA 1DLOA 5K14B 3WNGA 4LQ9A 4R8UA 4YP3A 5KG7A 2R8JA 3VQAA 3LANA 4Q8EA 2XY7A 2AGPA 3V81A 1RILA 3OVNA 4B9NA 4CCHA 4CJVA 4YFUA 3ISNC 4MK8A 1QTMA 3K58A 4KB1A 1T94A 3NAIA 3ITHB 3VQ5A 4CESA 1BCOA 3AA2A 2RKIA 2OPPB 4F2RA 2HB5A 4XPCA 4DG1A 1VSFA 1VSLA 4UQGA 3AVGA 4HUGA 4B8AB 3OYFA 3OYAA 1RDCA 5KT4A 3HP6A 1L3TA 1TL3B 5KFZA 2XCPA 5HLFB 4IG0B 1U47A 4KI6A 3RRHA 5T7BA 1S10A 3I5CA 2W9BB 5DQGA 4EZ6A 1GOCA 2HHSA 4ED0A 3TARA 2BRLA 4AHSA 4O3NA 2FBXA 3SJJA 4RZRA 4DFMA 3HSTB 4DEZA 1B9DA 2B5JB 4RNNA 2HNZB 4KHQA 5EWGA 4CGGA 1C1BB 5KFCA 4F4WA 1JL1A 1NK6A 3KLFA 2D5RA 3NAEA 4Y34A 4IBNA 2JGUA 5KT7A 4DQRA 4EO6A 3ALYA 5KFXA 4CJUA 2JEGA 3LP0B 3KHRA 3NFAA 3OYIA 3O3GA 4OLAA 3TQ1A 3PX4A 2HNDB 4FJKA 4QWBA 1FKPB 1RTHA 5KRTA 2VWJA 1HQEB 3QNOA 1SL0A 3OHAA 3EY1A 4E1NA 4Q0BA 1D9FA 2HAIA 4KFBA 1HJRA 2D0CA 5KFGA 2IJFA 4JUZA 1WSIA 1WSJA 1HNVA 1MU2A 4PQUB 3AVAA 3EZUA 3LZIA 3KLEB 3PV8A 2HMIB 4IDKB 3QETA 1QHTA 2KFNA 3CO9A 3I0RB 4NCBA 3H4BA 4ZTFA 1TK5A 1I6JA 4NYFA 3CWJA 4PY5A 2W9AA 1TVRB 1WAFA 4EP5A 3SI6A 1D1UA 1XWLA 3PVXA 4KV8B 1SV5B 4CJTA 1UOCA 3CJ0A 3IRXA 3QIOA 2HHTA 3OLAA 4ELTA 3O3FA 3M8SA 3DMJA 1QAIA 4ZTJA 4Q44A 3C6UB 4U7CA 4DSKA 4CJSA 4CF8A 4DTNA 2Y1IA 4O5BA 2D7SA 1JLQB 5I3UB 4DS5A 3T3FA 4IFYA 1BCMA 3UIQA 3DOKB 1NK8A 2W8LA 4IFVB 4IR9A 1B9FA 3CJ2A 4TQRA 3QIPA 1HMVB 3AO5A 1XHZA 1S9GA 2Q3SA 4CK2A 3N6MA 1HPZB 4HVJA 2WTFA 5KG2A 4KTZA 4ZPAA 4HTUA 5HRNA 1WNEA 1Z25A 5T14A 4CFBA 4K50A 2EX3A 3HM9A 2E9ZA 3VQBA 3CQ8A 5DGAA 2Z1IA 5C25A 4H54A 3UPFA 2XY6A 1TKXA 4URQU 2XWYA 3SPYA 3TI0A 3MEGB 3DLHA 4IKFA 3OL7A 1JLBB 4FJ5A 1S6PA 1TKZB 5J2PB 5CYQA 4XIUA 2UVRA 1RTDB 3H40A 1DTTA 4ZP9A 3QEWA 2IOCA 2GUIA 1S9FA 1IM4A 4FLWA 3KTQA 3DYAB 3CJ5A 4G1QA 3ITHA 1ASWA 4ECRA 3VQEA 3AVKA 2VG6A 3AVFA 4DTSA 3DLGB 4ZPBA 1KVAA 4KB0A 1ASUA 4FLUA 3QGHA 1S9GB 3TAEA 5C25B 1CZ9A 1I39A 4FXDA 3AV9A 5DLFA 3PHEA 4RG8A 4M41A 2V4QA 2DFFA 3JSMB 3FDSA 2R2TA 5KGWA 3I5AA 2JLEA 4MQ3A 1FK9A 4ELUA 4X2BA 2ZE2A 4CF0A 2YV0X 1RT1B 2OPRA 3PW0A 4EO8A 4RNFA 2GBZA 3V6HA 4CJPA 2XC9A 4K8ZA 5FRNA 5KFMA 1RTIA 4BE1A 4NCAA 1T7PA 5J2MA 4CEZA 3QEXA 1QAJA 2ETJA 4URSA 2I1RA 3FFIB 4OPJA 2YKMB 2RDJA 3HJFA 5C42B 3LP3A 5CZ1A 4YR2A 3IGNA 2AQ4A 3BQ2A 1F21A 4CJ5A 1LW2A 4DQIA 1UWBB 4N56A 3GV7B 4FK0A 4FLXA 3G6XA 2XGQA 4FVMA 3DRRA 5EWEA 3BDPA 4FJ8A 3DRPB 5KFKA 1VSIA 1ZBFA 5J2QB 2YHAA 1DTQB 1RYSA 3DOLB 2ZKUA 4L8RB 1UAXA 3DLKA 1G15A 1HRHA 5KFOA 4GC7A 2G8VA 4ZMMA 1TAUA 1HQEA 4LSLA 1XR7A 5J1EB 5HROA 3NBPB 4DQQA 3V1OA 1NK5A 2F8EX 1S1VA 5KT3A 2JEIA 4YQWA 4TSXA 1SH0A 2FVSA 3CFOA 5FDLA 4ZVFA 4QCLA 2WK4A 4Q45A 4RNHA 4O4GA 1QQCA 2YNFA 4J2DA 4K4VA 3OYBA 4NRUA 1D5AA 3MF5A 4F4XA 4CJ3A 3VQ9A 1RT2A 3VA3A 4DL3A 4HKQA 4I9QA 5F8JA 3K57A 3GIIA 1BIZA 4W5QA 1LWCA 1J5OB 3BREA 3T5LA 4KKOB 4Y3CA 5I42B 2P5OA 4J9RA 4FJ9A 4N5SA 1JKHB 1IKXA 4M3XA 3DOLA 5SWMA 3SFUA 4J9QA 2ZD1B 4O44B 4CIGA 3KK2A 4QPXA 4QWEA 1IG9A 1NHUA 2W8KA 3OJSA 4QWDA 4IFYB 4J9MA 4JS5A 2QXFA 4RW7B 4ECWA 3AO2A 1A5WA 4DTOA 3S3OA 3LP1A 3NF8A 3QIPB 3OYHA 3SI8A 2X6SA 2HVIA 4DU4A 3V9UA 3KHGA 1NOZA 3T5JA 4NLOA 5CYMA 4J9OA 2HW3A 4F4KA 1RT7B 4DL4A 4R0EA 1RTDA 4CJRA 3KHHA 1RTJA 3KLIB 3KK1B 4JV2A 4M42A 4J2AA 3I0RA 1WSEA 4IKAA 4WZQA 1JXLA 3Q8PB 1JLCA 5HRPA 3AVCA 4RW4A 2LSNA 4CFCA 4CEOA 4KV8A 4TN2A 1MMLA 4DSFA 2YNGB 5HBMB 3KK3A 4WFZA 2IMWP 1S1XB 3L2WA 4JS4A 3M8PA 1W25A 1REVB 1N6QB 3QEVA 1EP4A 1S4FA 4K8XA 1HYSB 2XI2A 3V1QA 1ZTTA 1HARA 1J9AA 2XI3A 4IFVA 5L1KA 4C8KA 4ICLB 2WB4A 1S5JA 3AVNA 1IO2A 5KG0A 1LWEA 4Q43A 3L3UA 3TAFA 2P51A 2OPPA 2BR0A 3HYFA 3KLIA 3KK1A 1C0TB 1JLFA 3F9KA 4CEBA 4ECZA 4BDYA 4ID1A 3L2VA 4Z4FA 3ZSOA 2D0AA 3LWMA 4ZVEA 3KJVA 3AO3A 3DRSA 4DU1A 1S6PB 2AX0A 1REVA 1RTIB 4IRKA 3OJUA 5HLFA 3THVA 3PY8A 4ZP8A 4M95A 1RBUA 3TVKA 1RT4A 4E0DA 2G8UA 1MU2B 2F8TA 3M8RA 1IKVA 4H4MA 4DU3A 3OYMA 3V4IA 2E6MA 4CJEA 2FC0A 5DLGA 3B6PA 3OS2A 3RTVA 4BDPA 4ELVA 3ZSVA 3MXIA 3MXMA 5KFJA 3CDEA 4J9LA 4OKKA 3ZCMA 1X1PA 5L9XA 4DTXA 5HRRA 4OGCA 2YNHB 3V9XA 5KG1A 3OYJA 2HNYA 4EBCA 2PY5A 3DMJB 4M3YA 2A1SA 5HRSA 1SL2A 2HHUA 3ZT3A 3LALA 1DLOB 5J1EA 3GV8B 4F3TA 4Z4GA 2FVCA 1BQMB 3CDUA 3F73A 1QE1A 4B9UA 3TAMA 1X9SA 2DTUA 2R8KA 4B9LA 3H2LA 3CG7A 5JS1A 4JV0A 4HCBA 2UVWA 3U6FA 1JLAB 1GOAA 1Z26A 4KTWA 4DFPA 2KQ2A 4NZ0A 3D45A 3VQSA 1BI4B 4DSLA 2AGQA 2R7YA 3H4DA 3DLEB 4WFYA 3T5KA 2YNIA 1LW2B 3S9HA 3CFRA 3IG1A 3AO4A 4DSIA 1SKSA 1FKPA 1RTHB 4DWIA 4HYKA 1C1AA 3H5YA 3V1RA 1TKTA 3SUNA 2AU0A 3VQ7A 2JEJA 4YR3A 4DLEA 3Q8QB 4KHYA 2PZSA 1VRUA 4U6PA 3TANA 3OS0A 3OSNA 4DSEA 1ZYQA 4J9PA 3L3VA 1EETA 3QZ7A 4IH6A 4KHRA 1TL1B 4H4OA 4NRTA 2FJVA 2FJXA 3DI6B 4CIEA 3PJXA 2B6AA 4OGEA 3FQKA 1JLGB 4CE9A 3NCIA 5F9NA 5KFNA 5C5JA 1RT7A 1NKBA 3A2FA 3JSMA 2OPQB 1QSLA 4FM2A 3NHGA 4M94A 1CXUA 3OY9A 1S0MA 2R2SA 2RPIA 1RBRA 3NH2A 3L2RA 3LWLA 4O0IA 2J6UA 4XPEA
chains in the Genus database with same CATH superfamily
1S1XA 3AA3A 4B9MA 2CVIA 3SMPA 2CADA 3VF2A 2N7CA 3DC2A 1JLEB 4CK1A 3H25A 1S79A 3Q2TC 4FJNA 3AO1A 3M2VB 3A3OB 2DNZA 2OTJS 2NUUG 3LDLA 2GO9A 4GVBB 5M1NA 5GAHP 3VQ8A 2HBKA 3CC7N 4RW9B 3BZCA 3K59A 3AJDA 1KFDA 1EKSA 4IG0A 5KFTA 2WONA 4IDKA 4E8UA 3QZ8A 1RT3B 1T03B 4DMZA 1L3SA 1CLQA 3TA0A 2MLYA 3K5LA 1FDDA 5AFUA 4QU7A 1I3OB 2QWRA 2G1DA 5BR8F 3WC2A 5A2QO 3DLBA 3BUZB 4NA3A 5JJBA 4LF1A 1VQ9N 3W2WA 3QQCD 5KRSA 4FWRA 3KIOA 1N0UA 3MEEA 2H1YA 2L41A 1MMNA 3RSEB 2LEBA 3MCOA 4E19A 3CCZA 1NMDA 4FPIA 4XAKA 1JB0C 2HBZB 2CNKB 2V2ZA 1X9MA 2OIHA 4USIA 4WJBA 2HRYA 1SJFA 3DRPA 1WI8A 1NDLA 3N6LA 1SIZA 5IT4A 4DV3F 2A2DA 5BRDA 3PFOA 3VEXA 5E3PA 1YVFA 4IQMA 3PIPQ 1QTNB 1HKAA 2E9TA 1HNZJ 2BACA 3N6NA 4Z94A 4DZ6A 3HT3A 4DFKA 4ISFA 4FJ7A 1HNIA 1OKJA 3O4QA 4CZMA 3MM9A 5HATA 4ISGA 3NLCA 4FW1A 4FPBA 3JQKA 1K73O 3L2QA 1SC4B 1J5EK 4DTMA 2UZAA 2EFNA 1BQXA 4RW6A 4PWDA 4LJMA 3IKMA 4XDDA 3SQ0A 3ZSWA 2L08A 3RB0A 3CNQP 2IM0A 2BA9A 4I6YA 3U3YA 2HQ3A 3OTCA 1CJKA 2BE9B 5AQFA 3PW2A 2F4VF 1ILYA 2UUTA 2FVRA 1SZ2A 3OFHA 2AIRB 1F2GA 2FXUA 2VHGA 3OYKA 2W01A 5HMYA 3J7YI 3P31A 4OZNA 1OYDA 4FJHA 2NRTA 3PZPA 3SSQA 3S01A 3J7ZO 3G4SN 2V4JA 2RKIB 2H5EA 1JKHA 2ZZMA 1WUUA 3E9LA 2E5LJ 1T3NA 3ENVA 4CM2A 1U49A 1C0GA 4JRQA 4K5SA 1E6VA 1H7XA 5F8MA 4ZOSA 2XY8A 3HPHA 3CTRA 3HKWA 1Q82T 1RZMA 4ID8A 2NCKL 5H9EJ 4QWAA 2BM1A 2HHWA 3PM9A 3C15A 2NQPA 2YX1A 4WZMA 2RU3A 3C6TA 5ADXA 2CPJA 5AT1B 2BDPA 2L9NA 4DV4J 4NEZA 4JV5J 5JVHL 3HSJA 1B3TA 4JYAF 3ISND 1XIQA 3MWBA 2DY1A 4CO0A 1FRIA 4CJQA 3TEHB 3NS6A 4ERDA 4E7IA 3T69A 2P9NA 2MZ1A 2GWKA 2IMOA 3H2VE 1IBLJ 4LFAJ 2PFDA 3OYDA 4OPHA 4CEDA 3BZQA 5KFVA 1RDBA 2GX9A 3JXOA 3Q8UA 4MYTA 2WFBA 4LSNA 4YOYA 3UE5A 3C14A 2QK9A 4NLRA 5LM7E 3NNAA 2DFHA 2QKKA 2UU9K 1JWWA 4NYZA 1BIUA 2KXHA 1FD2A 4W5TA 3MEDB 4O5FA 8ATCB 4PWWA 4DKWA 1ZETA 2YNIB 4PUOA 5JS2A 1JMTA 3ENOA 4FJJA 1H7WA 2BQRA 4F02A 4LFAK 2ZH9A 1JXBA 2RMLA 1FNXH 1KVKA 2XB2D 3MECA 3KHLA 2XLJA 2V4RA 2CQHA 5DG9A 2E44A 5F1XA 4CJWA 3SCLE 1G1XA 3B82A 2ALZA 4BRQA 1KSPA 4TNOA 2ZH7A 2P1JA 2MKIA 1X4BA 1RUSA 2JWKA 3ZT2A 3U27A 2W2NP 4MIAA 3W3DA 3UN5A 2XMMA 3LP2B 2DRAA 3G87A 3BV8A 1A5XA 1NSKL 4DR4K 2XM3A 3I0SA 2MKKA 1JL2A 4E3SA 3NEKA 3NS7B 2Z1JA 2MQ8A 1CSJA 1NPRA 1R27B 1NDCA 5KG3A 3CC2N 4DL6A 3VCDA 5I3UA 4OKJA 5J2NB 2QWNA 3DOKA 1FO1A 4ZVOB 4JKHA 3THTA 1NJZA 4KHMA 2JFKA 2MKYA 4FXVA 2LDIA 1XNRK 2FJBB 3WBZA 3TAGA 1SKRA 3QFPA 4LF2A 4DTRA 3OTDA 2VUGA 2NLWA 3G6VA 4E7JA 5HL7L 5G0RA 4ZLLA 1N8RT 3MM9B 2JVOA 2LLZA 4B1XB 4BWJA 2DD8S 2GAHC 2M5YA 4A8QA 3NL0A 4JI7K 2I9SA 1UAWA 1NO8A 1S49A 3SQGA 2HSTA 1VQLS 3O9RA 4XTTA 1AFJA 3CO0P 4TYBA 5L1JA 2ILYA 4B9QA 2OPRB 2WRMA 5HP1A 2G0CA 2J0QD 3CPWR 4DQPA 2VU5A 4FWLA 3PCOB 4K4XA 2IVYA 1IKXB 3AODA 1EWRA 4EFAC 3BQ1A 4F4ZA 1JLGA 5F41A 1XNQK 3J80Y 3M6XA 3EO3A 3PR4A 2JC1A 3FEXB 3KYLA 2CNLB 1W7WA 2G8KA 1T02A 3AOCA 1CJUA 4TQSA 1YITN 1GH8A 4O8UA 1RP5A 4DQ8A 3D54A 3O1LA 2X51A 2YKAA 2XY5A 1U1LA 4WK1A 4AQYK 1T9WA 1S97A 4FSVA 3KMQA 2P9NB 2VFTA 3ADAC 1HQUA 2V50A 5IM0A 2AJFE 3C6HA 2ZHAA 3L0QA 2GJIA 4DR2K 4FJXA 3W61A 2HNDA 5H9FK 3NCPA 2CNNB 4GKJK 1NGGA 4OZ2A 3FE1A 1FWLA 2UXDF 3BBCA 3CSKA 3UD3P 2HVEA 1XK8A 3J7Z5 2XHBA 1TL3A 4DV1K 4IH5A 2XYHB 4HT5A 4CGIA 3QFHA 4JI3J 4E1JA 1GXLA 3L2UA 2BUNA 1WC6A 1PJ6A 1L3UA 1HKCA 3QSYB 4GMJB 2XO7A 3LAKA 4Q2LA 4WTOB 2ZUAA 2OYQA 3DYAA 4ECXA 2QA2A 3O8MA 2JJ4D 4B1UB 4CNYA 5F3ZA 3M2RB 2MLZA 4L3NA 1GLEG 3SQ2A 3V4IB 3L4QA 4CZHA 3SCKE 4NLWA 4A48A 4OHWA 1X0PA 1M5PC 3M3ZA 1NJYA 1EKRA 4O0JA 3DM2A 3HZ6A 1YDLA 1NGFA 5FPDA 4WCEQ 2M88A 3KD1E 3N9UC 1VQYA 2IHR1 1YBAA 1T05A 1T9XA 4OHVA 4JK9A 3TJ9A 2YX4A 3LPUA 1VRTB 1NDKA 2V7YA 3QJJA 3OYGA 4ES3A 3HHLA 1RABB 3GFYA 5I9EB 4OYIA 4KHPK 2NPIA 4OQJA 4KHWA 2XNQA 3IUCA 4N41A 4K4SA 3PX6A 3WQUA 2FTRA 1VQPN 2HSEB 2KXFA 1DGKN 4O3SA 5DK5A 4RWTA 2IS3A 3D7EO 4BRLA 1R7IA 4OI6A 3H20A 4LBIA 2VFRA 4ED2A 1UWBA 4MH8A 3R5GA 2HBYB 2JEFA 1C1CB 1QD1A 3CCMS 3DRRB 2QA4N 5J2QA 4ANCA 4RBUA 3CF5L 4OL8A 2W2QP 4CGHA 5L1LA 5F9LA 5HP1B 2Q43A 3H59A 4GW6A 9RUBA 3NG8A 3OYCA 4OZJA 1S1TB 2VQFK 3TNVA 1EETB 4KO0B 4OIXA 3VETA 1APSA 1HR0F 1RISA 2RRAA 4H0VB 2BKOA 2HBQB 3UVJB 2AA4A 3HTVA 1NGJA 4YHHF 3EM1A 4AH9A 4CGDA 3HHDA 4ZP7A 1U45A 1I3AA 3MXJA 3QESA 2F3JA 3RB6A 3HPOA 3UW1A 4LF6J 4FVCA 2OELA 2OPSA 3SCIE 3W5YA 2CGJA 3SUPA 1OY6A 2W4DA 4C2MA 2BW7A 3V6DB 3LPYA 1TUVA 4DR7F 5C2DA 4NLGA 1NMNA 2QTWA 2QYGA 4NYOA 2XQCA 2DHXA 3PACA 4ENOA 4PWUA 2ROEA 2E1CA 4AHVA 2VG6B 5LJ3Y 1IKWB 3M5RA 2V94A 1EXQA 4GVBA 1LOUA 1Z1ZA 3ZSRA 2PIIA 2L9DA 2QE5A 3RAMA 2VBXA 4E1MA 2D0PA 3NH0A 2NRWA 4WIQA 2J7UA 3JYTB 2ATQA 3I6PA 3C7NB 4WXWA 3D67A 4EAHD 3OLBA 2W7PA 2P9UB 1U48A 4MO5A 1PYTA 2RHQB 1JJHA 4LRFA 2A18A 3P49B 1WF1A 5EN1A 1XMOK 2FHMA 4B3TF 5CABA 2XEXA 3L7UA 2OEJA 1WDTA 1RYRA 4CFDA 1N56A 1C0TA 4A8MP 1Q7LB 3TX0A 3LDNA 4LF4J 4J37A 5IZHA 1KTQA 2AP1A 3E9PA 3WXJA 1FDAA 3KJNB 1JLFB 2OFHX 2AD9A 1Q8IA 3VV2B 4N8NA 3EVMA 2BE2B 2PYJA 4NLPA 4DX7A 2V63A 1ZAXA 2CJ9A 5KFYA 2LMIA 3ZZUA 2HFSA 2E5JA 3MGJA 3EJMA 3W8PA 1QSSA 2KL8A 2QT7A 4UT4A 4M1KA 3VR1A 2FVQA 3SQ1A 2WCXA 4A47A 4BRMA 4CEAA 5A8WA 4C8NA 1Q1KA 4R25A 3BPSP 3GYNA 4U95A 1S72N 4ZA1A 1EZZB 4MJKA 2DXFA 2W9CA 4A59A 4QBUA 5FPMA 3TSPA 1V5IB 2FLLA 1J5EF 3PDNA 3R1LA 1WC3A 3QEIA 1Q5VA 4DV1J 1BWFO 3P3DA 1NPKA 2MSTA 4OKEA 3E01B 5LMNK 1FRXA 1YSJA 1QDUB 2HURA 3M9OB 3MFHA 4P72A 2NRZA 3BR8A 5F0WA 2BKPA 1E6YB 3P5JA 2W9BA 4W5RA 4LRCA 4Z0UA 5CYMB 3MHYA 1HNZK 3GLJA 3MMVA 4RW7A 3MXHP 1GOBA 2UP1A 3R5JB 1K6YA 2KFZA 2BRKA 4ZIWA 3GIRA 2LU2A 4DUTA 2XMJA 3VGLA 1FVQA 1K8AO 4ED7A 2UUAK 4ZJLA 3PLAA 1KQGB 1PKUA 1LWXA 2KJWA 1NRKA 2WONB 3VOVA 2QEXN 3A4TA 5CYJA 5GAEU 3LZJA 1WOSA 1FDBA 2HF4A 1J27A 3EPGA 3CJAA 3PHTA 4LF7J 5F8NA 3CD6N 3P5BP 2H3GX 3LP2A 2F63A 1TGOA 2I8EA 5KFWA 3W2WB 1VYAA 3RYLA 5B0GA 3OUYB 4NXMJ 1FE0A 4OI4A 4PQUA 5CD4A 4JV1A 4KGZB 1RHKB 4FN5A 1RK8A 3L8BA 1JJCB 2HBRB 4OLBA 2J8SA 3MPUB 1X4GA 1UA0A 2GV1A 4USUA 4K42A 2P2CB 4FCYA 2HFNA 1TAQA 5GAGI 2Q36A 1HNXF 2IVNA 2OPQA 4NCGB 5A8RB 4K8RA 3J81U 4ZVHA 1MW7A 2DH8A 2DBBA 4FM1A 4Y2AA 3EYZA 4PRFA 4H4KC 3IN5A 1RAFB 3QIDA 1RTZA 2QGFB 5GADU 2RF2B 1RAOA 4CYUA 4AM6A 3RU0A 4NXMK 3KLHA 2IM3A 1T9YA 1YJ9S 2NS1B 4K59A 3P38A 4KHSA 1G3OA 2ASLA 2E1PA 1VSKA 4P2FA 3V2UC 2HZCA 5D15A 2RRBA 4ZPDA 3FQLA 4K4ZA 4UOGA 4KAIA 3KUGA 2FLPA 3T1HF 1C1CA 3CCUS 5HVGA 3ETOA 4ANEA 4XEIA 1T03A 3RB4A 3ZT4A 3UD5A 5GIOA 4N8OA 4DR7K 4M5IA 2V52B 3GWCA 1DLOA 5K14B 1NGIA 4YP3A 2R8JA 3GJTB 2W4CA 1RILA 4HLBA 4JI5J 4H0TB 3UVJA 2IVOA 3ISNC 4KB1A 4X4RA 4C9DA 3CJKB 4FWPA 3ITHB 1IM6A 4CESA 3AXMA 2RKIA 2OPPB 1TL5A 2EW9A 3QB0A 3OXLA 3EWGA 3HM8A 1XQIA 2ASOA 4K41A 2EWHA 4WU2A 3O3LA 3HP6A 4NLBA 5DJBA 2NRXA 3QGPA 4HHHA 3RRHA 2ZWHA 3MMCB 4JI4K 2EFGA 4EZ6A 2HHSA 2CQCA 4CZJA 2P9KB 2GVZA 3ILLA 3TARA 4AHSA 3SJJA 2L3MA 4KHQA 4F0KA 2I38A 1P9YA 3ELHA 4CGGA 4F4WA 4WKRA 6FDRA 1IBKJ 5ITHA 1CVJA 2ZH3A 4ZVTB 3AARA 2VKZG 4CJUA 2ZDOA 2Y1RI 4Y2MA 3TQ1A 3T9ZA 3W7BA 3NMUA 4MLEA 1UCNA 2BM0A 2J0XA 1QVGR 2VWJA 3QNOA 4UW2A 1HBMA 2DHGA 4Q0BA 4KFBA 2D0CA 5AQUA 4JUZA 3A5MC 2RHSB 2O8FA 4A8OA 2ASPA 4PQUB 5ETPA 1ZOTA 2X1AA 4EWTA 3A8KA 3CO9A 3QRRA 1TK5A 2D9PA 3CWJA 1Z2ZA 1TVRB 3DWLA 4H5RA 4X4QA 2WVCA 1D1UA 2MZTA 3I33A 2J76E 3DLLQ 1SV5B 4CJTA 1UOCA 2N3OA 4LREA 1MN9A 2HOEA 3CJ0A 5GAGU 3QIOA 3FGVA 1KQKA 2FSNA 4MKYA 2FF6A 3M8SA 1H38A 4DCJB 4H0PA 2VIHA 1SXLA 2WC9A 3KNGA 2MY7A 4Q44A 3DXKA 3C6UB 2X3GA 4DSKA 3WQTA 4LSZB 2D7SA 3TTDA 5I3PA 4IFYA 3CJQA 4TQRA 4FP9A 1IJEB 2VD3A 4CK2A 4LBHA 3KG1A 5KG2A 3M1VA 4ZPAA 1WNEA 1Z25A 3MPYA 2ADCA 5T14A 3CPEA 2O67A 5JVGL 3S8SA 3CQ8A 1IJJA 2QLBB 1P8GA 2DIUA 1HWLA 4H54A 2PC6A 3D2FA 1VQ9S 5KPZA 3DXMA 2XWYA 4C11B 4USKA 1S6PA 5CYQA 4XIUA 2H4WB 4CH7A 1TYQA 1SJ1A 2QYCA 1DTTA 3QEWA 2GUIA 4H5VA 1X5OA 2HIQA 2FUG9 2Z58B 2IDLA 1N5TA 1X3MA 2ALYB 3ZEUB 2B0GA 1FW6A 1TMMA 2IIHA 4FLUA 3QGHA 1LNQA 4MIWA 5C25B 4FXDA 1I39A 4JD2A 3TWZA 3AV9A 5DLFA 3PHEA 5LJVA 4KGVB 3CC4S 3I5AA 4MQ3A 4ELUA 1ITPA 2GQQA 1RGVA 2O8CB 3QNWB 3F5TA 2OPRA 4RNFA 3V6HA 4CJPA 3BY5A 1T6CA 3PRDA 2ZOMA 3N5FA 2VV5A 4BE1A 3BKTA 4CW7B 4AD6A 3QEXA 1PJ5A 4ZJOA 2RDJA 3M6GA 4X4PA 2AQ4A 4CJ5A 2PDAA 4AE5A 1UWBB 4N56A 4IO8A 5EX0A 3P4UB 3GV7B 1TUUA 3OTBA 2LYVA 2WSEC 4F3QA 1ZBFA 9ATCB 3O44A 1NGBA 2HIYA 1IXKA 1XQSC 4NPOA 3DLKA 1G15A 3L6QA 1HRHA 1TAUA 1KWMA 1VIOA 3VEYA 3ZFVA 1M0SA 4FF3A 5HROA 1MROA 4C0HA 2LQ8A 4DQQA 1NK5A 3OA9A 1DQ8A 1S1VA 2RUSA 3FZ2A 1GXTA 2BH1A 3H6EA 1N8RO 2VQEJ 3LO3A 4UQTA 3HT0A 1SH0A 2FVSA 4CZEA 1FA0A 2CUYA 4GNIA 3BDEA 3MD1A 2MHEA 3A8JA 2Q2RA 2M3DA 1D5AA 4F4XA 3VQ9A 3OFEA 1RT2A 1U02A 4DL3A 4HKQA 2FHJA 4K5RA 4KKOB 3WZ0A 4Y3CA 5I42B 3U1LA 4J9RA 3GR0A 3H3OB 5IS2A 2P9PA 3A5OC 3B8HA 4HHJA 5B7WA 4QPXA 2VQFJ 2GELA 1I51B 4UOCA 4IFYB 3VHQA 1C0FA 5A2QU 3MMAB 1Y3KA 2J8AA 4AL5A 3NF8A 4WPAA 1TFWA 4WKYA 3K2YA 5GMEA 4X84A 3E9OA 3KHGA 1NOZA 4NLOA 2ZH4A 4J9OA 4ZK7M 4K7QA 5AZJB 4LF8F 1J6ZA 4ED4A 4CJRA 1OVQA 4JV2A 3TSQA 3ILJA 4J2AA 3I0RA 4JI5F 1WSEA 4WF9L 1Q5YA 4PKHA 4Z37A 2DGXA 1VAZA 3LGNA 1NSPA 3MPWA 3ID8A 1QQNA 2LSNA 1MMLA 3CJ8A 2YNGB 8RUCA 2IMWP 3M8PA 1W25A 2B7BB 3T1HJ 3QEVA 3OTEA 5CQGA 1ZTTA 4WP8A 2COLA 3X3UA 5L1KA 3H1QA 2X1FA 3KUHA 5GIPA 4M5MA 3THPA 3L3UA 3CC4N 1X4EA 1GK8A 4ECZA 4P73A 3WX8A 1URRA 1VQPS 4PPZA 4K0KF 3ZSOA 1FESA 4C11A 5B0BA 3LWMA 5K8PA 4WBFA 1S6PB 1CJVB 1REVA 2AX0A 1IQTA 4IRKA 5HLFA 3THVA 2EK1A 1XJWB 3LPEA 1U1NA 1RT4A 4LVNP 1GQEA 1O0PA 1HBOB 3M8RA 2F8TA 1IKVA 3IBCB 1PO6A 3KWIA 1ATSA 4JB8B 2X7IA 4WCEL 4ELVA 5KFJA 1D4XA 4OKKA 5DDPC 1X1PA 2C2OB 2RJZA 3EUNA 2VGMA 4YOEA 2LQJA 1E3MA 4DTXA 4D3GA 4ZN1A 4OX7A 2YNHB 2PY5A 3DMJB 5HQLA 4M7XA 1RGIA 2A1SA 4BC9A 1FEEA 1K9MT 3LALA 4QQBA 3VAIA 4X64J 5M1OA 3OBYA 2FVCA 4PABA 4AUKA 3TAMA 3QT8A 4YDDB 2WVBA 2R8KA 1HNWJ 5CE3A 3AHPA 1RBAA 1VQ6S 2EG1A 3H2LA 1U2FA 1QAYA 5DRKA 4NB4A 2E1AA 3D45A 1SPBP 4WIIA 1FJCA 2A5XA 3DHXA 1V4TA 2MGZA 1FEHA 3ZETA 3T5KA 5L39A 4JKCA 1VQMS 3G71N 4DSIA 2CQ4A 4AYBD 1FKPA 3OXFA 4HYKA 1R6VA 4JI2J 3FZHA 3U8XA 2CQ0A 2AF6A 3V1RA 3I55S 3VQ7A 2P6SA 3CDBA 4DLEA 1CJKB 2EFPA 4U6PA 3TANA 4KHPF 1HI1A 4EFHA 3MPDA 2F40A 1Y10A 4DSEA 1JXVA 4RX6A 4AM7A 4KHRA 1A7GE 3TO8A 4CIEA 3K8VA 4OGEA 3EE9A 2GUPA 3NCIA 2HKEA 1NKBA 3BM7A 2A6MA 3OFGA 1XNRF 2OPQB 1CXUA 3OY9A 3L09A 3Q86A 3ZZOA 1RLDA 4TKTA 3L2RA 3MD3A 4LF8K 2J6UA 4U8VA 4JEPA 1YLXA 3CYMA 1RT2B 2RUGA 2JL9A 2B9YA 1YIJN 4DTJA 1WJ9A 3TU5A 5HBMA 1N5SA 3GP9A 4BVOA 3KLGB 1S6OA 4NLXA 3E8OA 5G4DA 4DMNA 2YY3A 2ZOGA 4FYWB 3EGZA 2R8GA 3M9MB 3NGYA 4GVMA 4K4UA 3DLGA 3CDWA 4LF4F 2B43A 1NK0A 4KGMA 1ZXOA 4E7LA 3NOGA 4A62A 1HLUA 1RHUB 4IRDA 3G96A 2CZ4A 4F25A 5DQHA 3SLCA 3O8WA 1FCAA 1KD1T 5CR4A 4TY8A 3MMJA 5CCMA 1HBOA 4GMKA 1EAYC 5KFHA 2HHQA 2BQ3A 3MMBB 2LEPA 1U0HB 3R7BB 2QM1A 1AZSB 4ECYA 4DV3J 5T41A 4ZCKA 3AVJA 1WC5A 3R97A 2HFVA 2ZNZA 3FFIA 3HI0A 2DK2A 4A8XA 5CA5A 2A1BA 1T9VA 3ZT0A 5KQ8A 2K1RB 2OSQA 2PFFB 4N76A 2CPYA 5KFAA 4FWQA 3MTKA 4PA1A 2X78A 2JFDA 1VBXA 1Q9YA 2M2BA 2PMZD 2E29A 3B8AX 4ANDA 2IRUA 1RAJA 4R5PA 2RIJA 4I6MA 4OX8A 1H98A 2FHOB 2FDNA 4DV3K 4HHUA 1TR0A 4NXMF 4OYAA 4FPRA 3B78A 2JC0A 2H65B 2NRRA 2MGZB 1KOOA 1DHMA 3WXLA 4P74A 3WIUA 2QLJB 4AHUA 1KVCA 4OPKA 4FNIA 1YT3A 4PKIA 1WWHA 3IP0A 3PW7A 3IGVA 2CWXA 4IR1A 1W9HA 1Y97A 1ZM4A 3PKMA 1KLNA 3ZC4A 3FZLA 3DDKA 1GAOA 4LVOP 2RHKA 4N7TA 2QEXS 1YJWN 2LU1A 3LP0A 3QPIA 1F3VA 4IWVA 1U2VA 4OI0A 1S1VB 4JV5K 1VK3A 3TTFA 5HJXA 4HWIA 2YNHA 5FRMA 2MKCA 4C1NI 2KZMA 2QW9A 2R8IA 2Q0RA 3W2VB 2E2QA 3AVMA 5U47A 1HWJA 1XUPO 2CJKA 3SV3A 4QR0A 1HHTP 3AAPA 1WELA 3VZIA 5IOLA 3OR2B 2AWZA 4H8KA 1HNIB 3IDHA 4J2BA 4TY9A 3RMCA 4YNQA 2DKOB 4I2PA 1SUQB 4EI2A 3QRPA 1QVFR 2MQLA 4KBIA 3ZSQA 4EGLA 4KE5A 4JNEA 3MR2A 4DV1F 2KYZA 1PBUA 4C3KA 3I8DA 3WNEA 1ACMB 5J1NA 4X64F 1WHWA 3KLGA 4J9SA 2OZSA 1RA7A 1NJIT 3ASMA 3VGVA 3G9CA 4ISEA 4FL9A 5AR0A 1JLEA 4HACB 1S72S 2WOMA 3DN9A 1KVJA 1TUYA 3DLKB 4DPXA 2HHHK 5HROB 1WN7A 1C0UA 3VGSA 4V19J 4RW9A 2OPSB 3CDAA 4B1VA 2MLXA 5B08A 1UZHA 2VWKA 2UYTA 2AEMA 2PGCA 2YNFB 2KVIA 4PUOB 1FRMA 4BQLA 3MWPA 5DQIA 2MYFA 3BQ0A 4OX6A 5EU7A 1AB8A 4PG5A 3ZEUA 1LK7A 2GC8A 3TR5A 4PZVA 2P9CA 5GADP 4RW8A 4KR0B 1URNA 5D0RA 2GIRA 4JI3F 4WFBQ 3VAKA 4KHUA 1Q9XA 4B9VA 5KFSA 3AOAA 1K0VA 3HVAA 1NGEA 1X4DA 1P9QC 4FF4A 4CBUA 3GIKA 4YDUA 3BR9A 2DCLA 2FLOA 2FPHX 5AE3A 2JHEA 4WE1B 1FJGK 2HWTA 2FJEB 4OYBA 2ZJPL 3R9LA 2ZDPA 4LF6K 4CF1A 3I5BA 2MQQA 2CNOB 3WNFA 2H48B 2IAJB 4IYQA 3TZZA 2M9KA 1OYEA 3QYYA 4PHTX 1FFSB 2GVDA 5FIIA 1UFLA 1FKOA 3MR6A 2LKZA 2O01C 2Y8YA 4WQ5A 1QE1B 1WC0A 2RDIA 3KKFA 1HR0K 5J2MB 2OEMA 3JSRA 1SVDA 4CZIA 4HI1A 4F36A 5BR9A 1IWGA 1BQNA 4YHHK 4CLFA 2RS8A 3ZX3A 4S0MA 1YUWA 3R27A 1GMWA 4MK7A 3NKYA 5ETKA 4LH4A 1RAIB 1TKXB 2B4JA 2DNOA 4G1IA 2BJ1A 2OSRA 3KVGA 5BN8A 2DR9A 1G4CA 3TABA 3AT1B 4M5DB 1JLQA 1SKWA 2W7OA 2K06A 4M3WA 1XR6A 4DL2A 1LXJA 4C0OC 4X4UA 2HRTA 1B0TA 1S9EA 3AB4B 3EDQB 3POTA 4CHOA 2CJBA 2AGOA 3OPKA 1RHQB 3M8QB 1T9UA 2AJ0A 3HDSA 4JI2F 1NM1A 4RBTA 2QL7B 3PO5A 2GMHA 4LF4K 2AJ1A 2DB1A 1MWZA 2FBTA 3J8AA 3I55N 2DR8A 2QL9B 4KPCA 1REGX 2OEKA 2GNKA 4H0XB 2FVPA 2YHWA 3GG0A 3TWHA 2FGOA 1RT1A 3BYRA 5HJYA 5GAHU 3E1YA 2IA6A 1HNWF 4Q0BB 2BW2A 1RDDA 5IV4A 2YVSA 3HOSA 2VFUA 2L48A 2D1KA 5G0RB 1YTYA 2QTDA 4CTAB 3FSIA 1AUSL 3VQQA 3FZFA 2IVFB 3G10A 4JBCA 4YY3J 1HNXK 3NDKA 2ZM6K 2O8EA 2ZE2B 1WSGA 1CJTA 5A76A 3IG1B 2G8FA 4LMZA 1HX1A 3ZSXA 3TUIC 4BQZA 1WBBA 2IYGA 3PX0A 1ASVA 4EIAA 2VPWB 1ATRA 5IT0A 3EXYA 3MR5A 3RBDA 2BANB 4C8LA 1RDAA 2Y0SD 3KK3B 1YTAA 4FKXA 1TV6A 1M1KT 4GY2B 4TLQA 5HAOA 1J53A 2V0NA 2B6AB 4CH1A 2R9LA 3AVIA 3DGPA 2QG9B 1E4GT 3JYTA 1GNKA 3PW4A 4LFCK 3H8YA 3BKFA 3TP2A 3C7NA 4I68A 4CEQA 3HHLB 5E41A 3DLRA 2QWMA 2ZHBA 3UKUB 4HEA9 4CNZA 4J9KA 5AJ3J 3N4WA 3IR5B 3ZTQA 3ONQA 4DS4A 1SKUB 3KK2B 4AQYF 1E4FT 2HLUA 3LM2A 2YWGA 3BSNA 3X1LB 1DAXA 4CHNA 1I94F 4TXSA 5EX5A 3LDSA 4IQXA 4AF1A 4CEEA 1RHMB 1D8YA 4NI2A 1S6QA 1WSFA 4MAKA 2A42A 4FLYA 1BU6O 1XERA 2UVUA 4RUBA 1IR2A 5DGBA 4ZLJA 3TRGA 1HMVA 3H5UA 2VA2A 2ZH6A 1NJWA 4BC2A 3NMAA 4NOHA 2E9RX 2DNMA 5DETA 4DR1K 1SC1B 1VSEA 1OJ4A 1BGXT 4FLVA 2Z1HA 4HDGA 3I0SB 1O1WA 1HUXA 4NYNA 3ENWA 4IH7A 1TL1A 4CFAA 4ETXA 4E7KA 4IG3B 3NE6A 3SMSA 2QMWA 4PKGA 1RI7A 2HK2A 1B92A 2NR0A 1NG9A 3EZ5A 4V1Ak 3BF3A 2YTCA 1WG1A 3QSIA 2BMBA 1S1TA 3MUVP 2A3JA 1LV5A 2CQGA 2HMIA 4GC6A 2AEJA 3Q7BA 3IM9A 4LRBA 1PGZA 2Q6CA 3IWLA 1Z4UA 4E89A 4A2AA 5HQMA 3RBZA 4FYVB 3IS9A 1NKEA 3FNNA 4JHDB 1IR1A 1U6FA 3SQOP 3O80A 4WQ4A 3VGUA 2O5DA 1FJGJ 3ATUA 2R7WA 1YJVA 4RTFD 3I4PA 1Y3JA 4DV2F 4IEEA 4QS8A 2PAVA 3P83D 1ULRA 1VJWA 1IKYB 1CULB 3DDNA 2XYPB 2Q97A 1FRJA 5DM6Q 4H4OB 4FJGA 1M5SA 1K0TA 1SL1A 2RNEA 4OYZA 4WFAQ 2A1RA 4WFAL 3AD7C 1ZPVA 3PR5B 4WU3A 4CTAA 4JK7A 1ZTWA 3RRGA 2ZEJA 5FLXU 1H74A 5KFLA 4DUYK 1P1LA 3TZXA 3FBEA 2Z30B 4DX6A 2DT9A 3F44A 1LK5A 4A4JA 3K5NA 3JAMO 4MK9A 2I5JB 2DIVA 2D41A 1LEOA 5M1FA 2WOMB 2KG1A 4OLOA 2O3DA 5HK4A 1JX4A 2MHNA 4JKAA 1KCFA 3ENHA 4BR2A 3SBTA 2RT3A 3PUFA 3D4JA 3SAHA 2BEFA 2EFVA 3J81Y 2XS2A 2KTQA 2B7CB 3BO2A 1TVRA 4CO4A 2W25A 3DGPB 1ZM2A 1PIEA 3FRZA 3VAGA 3AY0A 1SV5A 1Q86T 1GX6A 3T1YK 5A8RA 2YKNA 3AXKA 3V6DA 4E98A 3O4WA 2OUGA 1H1VA 1QZ5A 1S1UB 5JMNA 3FC9A 1KP6A 1CBKA 1VC6A 3J7YP 3J80U 4NI2B 1DT9A 3CI5A 3BKUA 3SV4A 4Q7AA 5F0XA 5AQNA 4WFXA 1HPZA 2ZUGA 1ZC6A 2HBJA 4O3OA 3QT6A 5A6PA 2E2OA 1K1QA 1SQKA 3BSCA 3CEDA 3CCQN 2R2RA 1WHVA 3PIOQ 1RDRA 3OR1A 1M1GA 2HHHF 3V9ZA 4I56A 4YOXA 4HACA 1VLOA 2KVQE 3UDVA 4QOTA 3Q2SC 2AKWB 1QQOA 1WACA 3IAM9 5LMNF 4WXOA 3QBWA 4QAGA 3K5MA 4JI1K 3KDNA 3FEYB 3VQCA 2ACMA 3N0VA 1BXNA 3PEJA 3RAXA 1FXXA 4ECVA 4J9NA 2CQBA 4DR6J 4M5JA 2R8HA 4DV4F 1S1WA 1ZM9A 4FDFA 2IC3B 2FC9A 4KRFA 3HO1A 1KVBA 6AT1B 2N3LA 3MM7B 1NZ8A 1ZBLA 3M30A 2D0OA 3O3HA 2YJFA 2QLWA 1AYEA 3LF0A 4O23A 1NB7A 4MKBA 4MKVA 2Z8QA 2HHPA 2O1PA 3GE9A 2MQNA 1T6DA 4J90A 2V67A 5GAEP 1MDUB 3OYNA 5LMUK 2ZZNA 4C98A 3IBWA 2UUBF 4ZKAA 2XGPA 4I2QB 2DRBA 3ULHA 1ZPWX 4OV1A 1IN0A 2ITGA 3NXZA 4JN4A 2E1YA 4B8CA 2AZ3A 3S3MA 3EDRB 3K5PA 3IO1A 4XH1A 4KAZA 3TA2A 3ENQA 2MY8A 3PYFA 2DGTA 1NXIA 1YJWS 1OH6A 5C24B 2LDYA 1TL7B 1S9EB 5KFPA 1YX2A 2FJDB 3MM6A 3CJRA 3OR2A 3VESA 4M5NA 3VGKA 2ZJQQ 3SQ4A 4O0NA 4I2PB 3WDOA 3C46A 4P6QA 4FK2A 1JLAA 3DRXA 4G9ZA 3N4QA 3OVBA 1Y5IB 1CPZA 4B3SF 1FXRA 1R8PA 1D0EA 4B3RF 1D3WA 3CCMN 4AFFA 2HQGA 3M32A 1JQGA 4YB1P 4U7UD 3PYGA 3AD9C 1F5AA 3SSRA 1E6VB 5EUHA 1W26A 1VC0A 2D4WA 4LD0A 3KD5E 4CO2A 1LWEB 2P5GA 1X31C 3DXSX 4RO0A 3NGTA 3RMAA 3BZKA 3W0LA 4HCCA 2ZJPQ 1XMQJ 1U8WA 3BBFA 3H08A 1ITGA 3R5BA 2DGQA 1RWOB 3LAMA 3A1YG 3OQ2A 4DPTA 5DZ7A 1K44A 3NGZA 5I42A 3BB5A 1RE1B 3O1BA 2H54B 4EUVA 4DFJA 4L75A 4C0BA 3SQGB 3GIJA 4I6MB 1LCUA 3GTYX 4PYAA 5MAOA 1XEZA 2KKZA 4WFNL 4BACA 1TQLA 4IOXA 2WHOA 1YXQA 4Z4IA 1R59O 4C1NK 3U9DA 3M9NB 2V2QA 4OYMA 3ZT1A 3TW0A 5KFBA 4U67Q 4BY9C 4KH4A 4GO5X 2IFXA 1RKIA 3TZWA 1QSYA 3CULA 1KS2A 3BGRA 3NS5A 1N0VC 1KNZA 5T7LB 2J4RA 4OYWA 3SBGA 1EJ7L 1EX8A 1I5OB 4QR1A 4NXNK 4QU6A 4AILC 1SQEA 3M30B 2Y8WA 3GG4A 1CC8A 1R0CB 5E3AA 2IC3A 3WNGA 4I69A 2W40A 3PIPL 3VQAA 5M1KA 2E20A 1NMEB 1BO5O 4B9NA 4LBPA 1GMUA 1QTMA 3U7JA 2JRSA 2JZ5A 1T94A 2BJ9A 4RJVA 1PC5A 4F2RA 1EQYA 2HB5A 3I87A 4XPCA 3TOQA 3B4MA 1VSFA 4IEIA 2B3TB 2HGLA 1CS4B 4B8AB 4DR7J 1WG4A 3OYFA 1OPIA 5I3QA 2OAUA 3D1QA 5KT4A 1GLFO 4OZ1A 1MWQA 1L3TA 2DH7A 5HLFB 2XCPA 1Y4ZB 1U47A 3BBBA 1HBMB 2UU9J 4GKKK 1VHIA 3Q8YA 2W9BB 1KTVA 3FMWA 2YJEA 1NBWA 4ED0A 3Q23A 5KAKA 1IVZA 1NHKL 1WEYA 1AA1B 3SAGA 3IMQJ 3HSZA 2W6LA 1V5VA 4DFMA 4ZPWR 2I7NA 1YF5L 2HNZB 6FD1A 1WUAA 4JKEA 1C1BB 2ZZTA 2GGPA 4J91A 4KH5A 1NU0A 4JI6K 1ZM3A 3AGRA 3NAEA 4JI0K 4Y34A 4KH1B 2UXCF 2V2KA 1ROFA 2R7UA 1N32F 4P9SA 1KC8O 4OLAA 3M2VA 2RB7A 4OYXA 4GKKJ 4B3RK 2HNDB 4QWBA 1M5VC 1RTHA 4I6AA 1WF2A 1H0HB 5KRTA 5EX3A 1SL0A 3EY1A 4RL1A 2KHOA 4E1NA 3M6UA 3UWTA 5KFGA 4OJHA 4QR2A 1WSIA 1WSJA 2OJ3A 1RWWB 1MU2A 1WKJA 2DPNA 4IO9Q 4KRWA 1Y64A 1TL7A 1Y9OA 3KLEB 3PV8A 2M70A 3H42A 2CQ3A 2R42A 4IDKB 4H4KA 4RKUC 2RS2A 1QHTA 2PEBA 2Z56B 2XBPA 3VERA 1I6JA 4CT8A 2BVZA 2W9AA 2HEKA 2MKSA 3SI6A 5MLCV 3PVXA 4GKKF 3IRXA 1UVIA 2MQPA 1VFJA 1ZS6A 3DOMA 4DCPB 1QAIA 3QWUA 3HX9A 2FGCA 2ROGA 3E2EA 4K0KK 2EBEA 4CRJA 4CJSA 4CF8A 3K8WA 3CCVS 1MG7A 4OI1A 2P9UA 5DM7L 4HH1A 3DOKB 4GO7X 4CLPA 2C2ZB 4IFVB 3CJ2A 3UI3A 3AO5A 1S9GA 2CPIA 2VBWA 2HQIA 4HVJA 4BVPA 4JI7J 4NX9A 3FVYA 4KY3A 2KI2A 1Q78A 2W24A 1WOPA 1R89A 2PA8D 3HM9A 1FTRA 3O2IA 2Z1IA 5C25A 2C1EB 3CJ7A 3UPFA 4P7VA 2E1MC 4DJBA 2XY6A 3D6MB 1TKXA 4URQU 1P8ZA 4DR3K 1OH5A 2IIRA 3OL7A 1JLBB 3O6QA 3VF4A 1TKZB 5J2PB 3NGRA 1F0XA 3A3NB 2UVRA 2AV5A 4FOIA 4ZP9A 4NASA 4USTA 3T1YJ 3KTQA 4OZ3A 1N33K 1IR0A 4BHQA 3OHRA 4ECRA 2VG6A 3U4LA 3DLGB 1Q4RA 4ZPBA 3D2WA 2XMKA 2BJ3A 1ASUA 2XS7A 2R7OA 2QA4G 3ZZRA 2NXUA 3HSGA 2K3KA 3R5DA 4NWBA 4PCQA 3FSYA 1X60A 5C2CA 4M41A 3IFRA 2DFFA 1RDUA 4I1TA 4ZVSB 3CT9A 4JI8F 2YWEA 3HJVA 3MM5A 3GR1A 3I31A 2XHCA 4CF0A 2W2PP 2GW8A 1IBMF 1Q8BA 3PW0A 2HFUA 1QM9A 3PSFA 2XC9A 1SS6A 4K8ZA 3HRGA 5KFMA 4KH0B 2W4PA 1RTIA 2I7PA 1B70B 3PYDA 2QN6B 4UZCA 2CGLA 3TUJC 2ETJA 3HFZB 1DZ5A 2MB0B 3DFEA 2Z2YB 1RWPB 1VJQA 4Y6IA 1CC7A 5IQ6A 4FZVA 3H0PA 5IC6B 1MN7A 3LP3A 2F9DA 5CZ1A 3IGNA 4PXDA 1F21A 1VS3A 4DQIA 3T7ZA 1UEKA 4M5GA 4ZLNA 3UFCX 3TUPA 4FK0A 2ERRA 3J7ZT 3NGKA 3IBFB 4JI8J 4FVMA 4BCAA 1K73T 3BDPA 4FJ8A 1O8BA 5J2QB 1O13A 1DTQB 4L8RB 4WYBA 4TVAB 3AA9A 4F4AA 4BR4A 3VQTA 4GC7A 4JP8A 3L4IA 1HQEA 4LSLA 2EVZA 4DV5F 2E1ZA 1IV0A 2Q0UA 3PEHA 2M8HA 1M1HA 1TFYA 2WSCC 4ZVFA 5IC4B 3MMAA 4Q45A 4RNHA 4O4GA 3I9V9 4LFBJ 2YPZA 4J9VA 3EXCX 3US5A 5GADI 1Y11A 1X4CA 5D4PA 1UW4A 3D3CJ 4CJ3A 2W2MP 3D9BA 4I9QA 4KHPJ 4Y00A 3GIIA 4W5QA 3AA8A 3BREA 2P5OA 4USMA 2B51A 4B02A 1JKHB 2GO8A 4O44B 4GV6A 2KYXA 4JS5A 4RW7B 2Z4PA 4C4WA 4DV0J 1U25A 2ZITA 3W5XA 3WT0A 2PN6A 5AJ3F 2X6SA 2HQCA 4DU4A 3T5JA 1JJ2M 1RT7B 2CQ1A 3M8WA 1H3DA 4DDFA 4YUDA 2MZSA 2CXEA 2C3MA 5I4MA 1RAEB 4LRAA 3OVAA 4DB3A 4IUFA 3NMRA 1HQ2A 2FF3B 1VDHA 4QS7A 1KKHA 3HMJG 2G0IA 1YI2N 2AP6A 4RW4A 1FJEB 4CFCA 4CEOA 4TN2A 1S57A 1GLCG 5C0YA 4C3MA 4YB5A 5HBMB 5HN0A 4U7BA 3ZNUA 4WFZA 2JWNA 3PSIA 1AFIA 1S1XB 3L2WA 4JS4A 5BYRA 4CBWA 3PKYA 1REVB 2EFOA 1N6QB 1S4FA 1HYSB 4YEAA 2VC0A 5DDRC 4CDIA 5AE2A 3HLUA 2JNJA 1HARA 1HD1A 1N52B 1VQ6N 1J9AA 4JD2B 4IFVA 2YKOA 3Q22A 2HYIB 4C8KA 3TVYA 1Q81T 3ZX0A 4ICLB 1S5JA 5KG0A 2KKHA 1LWEA 4GV3A 3IA0A 4A46A 4Q43A 2UXCJ 3I96A 1YITS 1ZBTA 2P51A 2DNGA 2OPPA 3BGFA 3UKUA 3W63A 3KLIA 3KK1A 2DNHA 3CCTA 1NB2A 4ID1A 3L2VA 1RXOB 1RDWX 2ZNYA 5K5MA 1NJIO 3KJVA 3NCRA 4FOEA 3AO3A 2CVEA 2IVMA 2V8VA 4H5NA 4LR9A 4M95A 3H2UB 1W2IA 3UCUP 2MQMA 4L72B 3C3LA 1YAGA 4H4MA 2EKYA 4DU3A 3MOZA 4DHVA 3V4IA 1BDGA 3B6PA 3OS2A 1M90O 1UVMA 3RTVA 3ZETB 1EB0A 4OX9F 3FCHA 2CH6A 3R8EA 2OCEA 3VGTA 3JQJA 2ZKTA 3W9JA 1MSWD 4PR6A 2P9IA 3ATVA 4OGCA 1L3KA 4DI6A 4EBCA 1ATNA 4DV7J 4MMOA 3CF5Q 1SL2A 5HRSA 4NO7A 4B3MJ 3CJ9A 1DLOB 2JOQA 2XMTA 4F3TA 5E26A 3ZYYX 2V6AA 3CDUA 2W7AA 4B9UA 1Y7PA 1X9SA 1UJ4A 3EN9A 3TA1A 2FHJD 5JS1A 4JV0A 1PC4A 4HCBA 1Z26A 4KBOA 4KTWA 2J0WA 3BN4A 3SDEA 3RZAA 2Y0BB 1NLKL 3I4HX 4BRHA 4W4MA 3VQSA 4AL6A 3MM8B 4LR7A 4DSLA 2AGQA 3A8EA 1X4HA 2BJ7A 2A3ZA 1R0BG 5B0AA 4DR1F 3IG1A 1SKSA 3QAUA 1RTHB 1MWMA 2KLAA 1NBEB 1OH8A 4JK8A 2PMWA 3H5YA 2KRBA 3BEXA 5HI7A 5E2QA 3K7RA 1VQOS 2YQ1A 2PZSA 1VRUA 3EZOA 5L9NA 3OSNA 1KVIA 3Q89A 1VHXA 1ZYQA 3QBCA 4J9PA 1EETA 5E3RA 5LXYA 1TL1B 2C3OA 3MUMP 4BBYA 1VRQC 2QWPA 1VQMN 5AXKA 3A13A 3OR1B 1U8SA 1JLGB 2XSFA 1YIJS 4CE9A 5LMUF 3SXLA 1RT7A 3SK3A 4CZKA 5M1QA 3OD2A 2XZWA 5A8KA 1QSLA 4MDBA 3G25A 3NHGA 4M94A 4FWNA 1HFEL 4XH4A 3MM5B 2IBOA 2OMOA 4CO1A 2RPIA 2JH3A 2LXUA 2F8MA 2EFQA 4YB7A 1WF0A 4CT9A 4BROA 4DR4J 4YN3B 4RW4B 4O3QA 1JLCB 4B3MF 3RJMB 3MM7A 2ZH1A 2JX2A 1TMJA 2DXEA 1NEEA 1E6YA 1AROP 4F0HA 2NLXA 3DJCA 1IBCB 4WTYA 4ZVGA 1YVUA 3CCRS 4M3ZA 3R3TA 1D8ZA 4ZJQA 4LF5K 4X62J 4MFBA 5GVQA 4OJ3A 3O9SA 2BX6A 3UDEA 1VSMA 3CC7S 3E51A 4ZPVR 5JXSA 2H9ZA 1YBUA 4NLQA 3OBIA 1KQSM 3TPQA 3CB4A 1UFKA 4FS2A 1IG8A 1VSDA 3D6RA 2FYXA 3UO0A 4TLRA 1DTQA 1BA1A 8AT1B 3D0GE 2JVRA 3R2CJ 2QIFA 4LSLB 2E66A 4H4MB 3QDKA 2Y1JA 4K2JA 1VGYA 1RAHB 3N4PA 3KDOA 3OTOJ 3HOTA 1S4EA 1VQKS 2Q6BA 3BJYA 3RMBA 3AQOA 3ZZTA 1P6TA 3B4DA 3EEQA 1WHYA 4WWSA 1Y00A 5IT9Y 3AGKA 4EYIB 2FJWA 1J54A 5JLHA 2F7VA 1VISA 5M2UA 4XO0A 4KO0A 2E4LA 4JV5F 3M4XA 5M1PA 4NCGA 1KOHA 3AAWB 2G1HA 2IVPA 3GILA 5CHIA 1ZBHA 3QLHB 1FKOB 4CD1A 3MMCA 4QIGA 1N36F 2DNLA 3CERA 2VG7B 5JVHQ 2X6NA 5LT5A 3FEZA 4P10A 4I6WA 3C66A 3BEGB 1CXQA 3SUQA 2H4YB 4H5TA 3VALA 3RMDA 4YORA 1YVNA 4FO0A 4FW2A 1NK9A 4CEFA 1WD6A 2D1CA 3QO9B 5H1SV 5GAGP 2JWLA 2CJQA 2CRLA 5ELZA 1XHXA 1VRUB 2MDAA 2QC3A 2A40A 3PW5A 2J5AA 2HHHJ 2ZJRL 1F2HA 4Y28C 1ZBUA 3P1GA 4WP3A 2XO6A 2FSJA 2CJYB 4YY3F 5F8GA 2EK6A 4FWOA 4LFBK 1S77D 5J2NA 5F0UA 1YJTA 3ILIA 1HNVB 3W66A 4CHYA 2DVIA 3LPTA 2KZZA 2F9TA 2ZC3A 2RVJA 1W97L 1LW0B 2ZH8A 1RWMB 4ILJA 1IBLK 1OSCA 2VPYB 3CVKA 1S7IA 4FXWA 1HBUA 3H45C 4JHDA 3CMAS 2RD5C 1ZH5A 4KC5A 3K9KA 3FK4A 3SDEB 1JCGA 1DTTB 3WNHA 2ATCB 2YKNB 4ZS6A 1H2TZ 1S0NA 2RRNA 3IFEA 2CIMA 1KHVA 2F8HA 1Q8KA 5CAAA 1FE4A 3C6UA 1VQNN 4DUYJ 3V81B 4RBVA 4B9TA 4DR5K 2YWHA 1HNZF 4Y2KA 4B1WB 2WVEA 4ZHRA 2YHBA 4J7CA 1UPMB 3HXMA 2F5GA 4WP9A 3U1MA 4LF5F 2G8HA 4F67A 3U3GA 1T0TV 2UXDK 1NK4A 1SJ4P 3Q8SB 3OYEA 2QSFA 2QL5B 5LL6Z 5E0OA 2GHWA 5D3GB 4KKOA 1U04A 4PG6A 1RAAB 1ZBSA 2VA3A 4OYOA 3ET6B 2FSKA 1P27B 1TKDA 3GU0A 5KG4A 4BREA 1HKBA 4M63C 4B17A 3GDQA 2GVDB 4BLGA 1T3VA 4Q2MA 4DPUA 2W42A 4CZLA 2DCUB 2RU9A 5LY3A 5AXLA 2J6SA 2DITA 3R2DJ 4BC7A 1FJGF 5KT6A 1GLJO 4YS2A 2DR6A 4BRAA 4IOAL 3JSYA 3KNAA 3R8YA 1W0HA 5C15A 1B7FA 5K20B 3QLHA 3CD7A 1N34F 1A0OB 1S0VA 4B1ZA 1XNRJ 1QJHA 4OJ1A 1SQFA 3GIMA 3OW2M 4CD3A 1RCXB 5C12A 2VL1A 1FNMA 1HWUA 1HPMA 3N28A 1BQMA 5F8HA 5FPEA 4RW6B 4PWDB 3BH7B 4M5LA 1C2PA 2FJAB 1Q53A 5GAHI 2HK3A 3M8QA 4F0MA 2P9SB 1GTHA 1BISA 1RBVA 2DNQA 2VOOA 2POKA 4RLEA 3UNYA 3MURP 4RNOA 4OX9J 4JI0J 4JI6J 1HYSA 4K4YA 3MEEB 4IOBA 3HVWA 2FBYA 1HI0P 3AH6A 3DLEA 2OFGX 3J81j 2PI4A 4KPYA 1YJ9N 4I9LA 3CCSS 3UCZP 1CZAN 1CJVA 1GLDG 5JVGQ 2WUSA 1DKGD 4ECTA 1HNXJ 4YY3K 3ZLJA 2WTUA 4FYXB 4AQYJ 3VF6A 5GAEI 3VVTA 3EGWB 2VCPA 2CPHA 3V4MA 5CZ2A 2NZ4A 1RT6B 2RSQA 4M3UA 3EGNA 4Y2CA 4USWA 3S41A 1XR5A 5BXIA 4I2QA 1N34K 3VEZA 2IM1A 4OHYA 1T9TA 3UKRA 2CZ9A 3EICA 4CLYA 3ULDA 3G71S 3S3NA 3CJCA 4B3SK 1VQNS 3G6EN 3GFHA 3IM8A 3PRBA 1VSJA 1JLBA 2DO4A 2UUBJ 3BGOP 4A61A 4W90B 3VPZA 4W5NA 5FD1A 2J9CA 3RAQA 2FBVA 1WB9A 1UL3A 3NP5A 4O4RA 4WYLA 3W8GA 3T1AA 1TP7A 4L6V3 3MM6B 2GQ2A 3NGIA 4EHUA 5HANA 5BPNA 4LFCJ 2UUCK 4B3TK 3O08A 4KTQA 4G3IA 1TK8A 2BANA 3CXCR 3GG1A 2VFVA 3GMGA 3C8YA 4DF4A 3TUZC 3TR8A 5E5NA 1RADB 2OO4A 3SCXA 2NRVA 1YZ7A 1NU4A 4BRGA 1U09A 2XWXA 3CJBA 4X62K 1RTJB 4HHTA 3C0BA 2R7VA 2EC0A 2N4DA 3CETA 3NF6A 4Y1CA 5DM7Q 3UN3A 3Q7CA 1BL3A 4MT1A 3G8SA 5KOWA 3LOUA 1XN9A 3MMBA 4LRDA 4PL7A 1OVYA 3VF0B 4BDZA 4K4TA 2C2NA 4UF4A 4JYAK 2ZHOA 4OLPA 3CCLN 1FWPA 3MEDA 3CCWA 3ZZYA 4ILLA 4ZHRB 2ZM6J 3V9WA 4J2EA 3MAHA 2EBGA 3PG9A 3VQ4A 1KC8T 2P5VA 5MLCQ 2LQBA 3IWXA 2DXDA 1VR6A 2BE2A 3AA4A 4HUFA 4A2BA 4FM0A 3MR3A 2PD1A 1DFDA 2CWKA 3LGMA 1XNQJ 3CCJS 1CZBA 1UMJA 2XTJP 2YPYA 1UJ5A 3NBPA 3MECB 4DPOA 5IT9U 3AVBA 1OH7A 4IG3A 2F96A 1TZ0A 4R8UB 4TYAA 4RNMA 4HL9A 4RCHA 4CLUA 3THYB 4CJKA 2O4GA 3HHNB 2VQFF 4U7UK 1HBUB 2NYIA 3ZZ0A 3CJ1A 2AJ4A 3A12A 2VBYA 4I4BA 1IKVB 4FS1A 1ZAVA 2N4CA 3GV5B 1UZDA 4N77A 3SJHA 4QW8A 3OS1A 1C6VA 3MWTA 3OL8A 2FC8A 5IXUA 2IBKA 2PI5A 5SZTA 3J7A1 2B8QA 2ZBCA 4FLZA 4GKJF 2M52A 1JXEA 4ED3A 1NM2A 4F26A 3HULA 2UVVA 4OI2A 3SEOA 1R0AA 3WXKA 4CF2A 4IOCQ 1KHWA 4IOCL 1KAZA 3CCLS 2LEAA 2D69A 1SJ3P 3NH1A 1YK9A 2HWIA 3W9HA 1XMQF 3SYZA 3AFGA 4LF9K 3QICA 2BE7D 4R5PB 3HVRA 1VBKA 2BZ2A 4LT6A 2R3VA 3ET6A 1VQLN 2E7WA 2AJ2A 2C28A 2FZCB 1YJUA 1N5YB 4PQAA 1PAUB 4BS2A 3QERA 3ZTPA 3R6LB 3CFPA 4AHRA 1WC1A 1C1BA 4OJRA 3FCVA 3KLFB 4ECQA 2HMPA 2P9EA 3GE1A 3AA5X 3RR7A 1Q7YO 3DAWA 3T1HK 1S22A 4JKGA 4Y0FA 2FB0A 4X64K 1XMOJ 3BO3A 1SH2A 1X5TA 3MEGA 1V4SA 3EMTA 3LH2S 1N33F 3HSDA 4B3OA 1HWIA 1Q79A 3QMLA 2V51B 3CMAN 2U2FA 4FZYA 3HHKA 4NMXA 4C8YA 3VN5A 4Q5VA 4XDCA 1BWVA 4EK2A 1R8CA 1F6TA 2DGSA 5IT9O 3C94A 3TVZA 4F4YA 3KG0A 1N4LA 5D0GA 3V9SA 4CO5A 4KI4A 2FQQB 1NSQA 3FBBA 1ZZFA 1RBSA 4JLHA 1EKEA 2GX8A 4Y1DA 4AHCA 4HUEA 2QJ3A 3BGUA 5K8MA 2ASDA 4BRPA 2GWJA 1SC6A 3AVHA 1N36J 2HWHA 3L95X 3E3XA 3KZBA 3VQPA 1OSDA 3G0ZA 2OD6A 2B4UA 4G6VB 1J5OA 5DDQC 3GJSB 3M2UA 4CLKA 3NF9A 5D8HB 4TY8B 3N01A 4ED1A 4GV9A 4YMEA 4EZ9A 3V5RA 5EHHA 1QUVA 1VIXA 3KUEA 1RB0A 4QJVA 4X4NA 2HBLA 3RVCA 1CG2A 2ZBIA 4Z4CA 1P1TA 2MZQA 2KB2A 4J9UE 3UKRB 3BGLA 1NOYA 1WORA 2XCAA 4K25A 3JXUA 1BQNB 2D3ZA 1C0MA 1G99A 4U96A 4CM0A 1N54B 2GS8A 1HL6A 4NLTA 5ETMA 2BJDA 2HVZA 1S5ZA 1S48A 3ZXWA 1N5VA 4UUXA 4NE9C 3T6JA 2VPZB 3B6BA 1YRTA 4CECA 1O5JA 1Z05A 3QEPA 4C8OA 3AJ2A 3TSUA 2XG8A 5BYQA 2YHXA 4KB7A 5KTQA 5HO4A 3LGHA 1A5VA 4A8SA 3HVTA 3KKRA 1K8AT 5KFRA 2VC1A 5A8KB 1GT8A 2FZGB 3HCXA 2GTDA 1LFWA 1FXLA 3K9JA 3CD5A 4BE2A 5FROA 4LSNB 5ETTA 2WVDA 2R7XA 4NLUA 2LXIA 4F2SA 1YHQS 2GHVC 1D9AA 2HFZA 1T05B 4ZDNA 3TJ8A 1UW9A 1WSHA 3PYEA 2G8WA 3BS9A 3M32B 1Q81O 3PJ9A 1VK8A 2AZ1A 4LF8J 5H9FJ 3CIMA 2ADBA 4ZIVA 4P7TA 1GMWD 4MIBA 4DUZJ 1M1KO 4FJLA 4CJLA 3HSCA 5LMUJ 5CHCB 2DHSA 3G4SS 4B3OB 1YGYA 4NL5A 1YG0A 4EMDA 1NJXA 1GLLO 4BE0A 1L3VA 4E7HA 1IUJA 4MYUA 2KM8B 5ETRA 4DL7A 4CH0S 3O4NA 2IPOB 2OP5A 3NVMA 4OZ0A 3THWB 4BG8A 5ETVA 2HS3A 2HF3A 2CKWA 2DHAA 4A8YA 1UETA 4CHQA 3H7HB 1KBRA 3L7PA 1VC5A 3MDQA 2VF3A 3QWPA 4DF8A 2NNWA 3Q24A 2HNYB 2CDQA 2MPUA 2IGIA 5JICA 5FDLB 2IM2A 3DU5A 4IOAQ 1EP4B 1WAJA 1N88A 1WG5A 3IRWP 2DNKA 2VQEF 3IAYA 3QGGA 1X5PA 2UUCJ 1TV6B 4F3OA 4ICLA 2YQ0A 1SI9A 3RWUA 5KFEA 3LW5C 2YI1A 4ILMA 4QWCA 4PXEA 2K8GA 2KG0A 4RU9A 5ETNA 1SH3A 2ASYA 2CG8A 1HD0A 2FZKB 2AYGA 2ZOFA 2A2CA 4CQ1A 1NWKA 4I7FA 4HTLA 1N48A 3KWGA 4ILHA 2H51B 3DRSB 4FJIA 1GX5A 1JNRB 3VGMA 3S7RA 2ZBQA 2GA7A 2B8PA 1DURA 1Y5LB 3MUTP 1UJ6A 5IWAF 3MFIA 5HMZA 2BQUA 3VA0A 2OANA 3GFXA 1S6UA 1H2UX 1D09B 5AQLA 1H2VZ 3D3BJ 1XI1A 2CYYA 4NEYA 3RB3A 1WC4A 4NLVA 4DSJA 2C3PA 3QO9A 1HIYA 2GMJA 5KG6A 3ZZPA 4Z4HA 1H72C 1B4SA 1CS4A 5GMDA 2C42A 1AUDA 3JTNA 2HGMA 1YQHA 2AEFA 2W41A <