4OKEA

Structure of rnase as, a polyadenylate-specific exoribonuclease affecting mycobacterial virulence in vivo
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 52
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okeA00
1ZBUA 4CJ5A 1C0MA 2QKKA 3CM5A 1Q9YA 1N5YA 2QKBA 4OLAA 3V9UA 2ZE2A 3AVGA 3QIOA 2D0BA 2PZSA 4DTOA 3AVJA 1C0TA 1JL1A 2FBYA 3KK1A 3EY1A 2HMIA 4CESA 1LAWA 3VA0A 4HVJA 4QCLA 3OYGA 3DLRA 4OLBA 3S3NA 2Z1IA 3A2FA 3OYBA 1RBRA 3VQDA 4OGCA 3AVNA 2OPQA 3CM6A 3SPYA 4RW8A 4N41A 1U48A 4E89A 3HJFA 3CQ8A 3NGIA 1QTMA 3OS0A 3HP6A 1JLBA 2G8FA 3M8PA 4H4OA 1D5AA 1RDCA 3OJUA 3NE6A 4YFUA 3IAYA 4FJHA 5J2QA 2IAJA 2YNFA 4CJPA 1WSIA 2GV9A 3K5OA 3QLHA 1ZBLA 1RT7A 2G8UA 4HCCA 4DSLA 3SJJA 3M8RA 4M3TA 1LWCA 4KI4A 4C8MA 4CEEA 1MU2A 3VQ8A 1B92A 4HUEA 3SYZA 4FJGA 1YTAA 3T19A 4PA1A 3IG1A 4RW7A 4ZTFA 2NUBA 2ATQA 4E7IA 1VSFA 4B9UA 1KTQA 2G8KA 3AA3A 4AH9A 3M8QA 2RPIA 1ZBFA 2XRIA 3DOKA 4LSLA 4W5TA 2XY5A 4KB0A 3U3GA 2YHBA 3DLHA 4E7HA 3SNNA 1RBSA 3KIOA 1VSKA 4DTPA 3L2VA 3QEXA 4CJ3A 2HB5A 1KCFA 3LPTA 3KK2A 3D45A 4QOZB 4Z4GA 1JLAA 3AVIA 4FLYA 1NOZA 3SQ4A 3ULDA 1RBTA 5I42A 3ZT2A 5HLFA 4DQIA 3ZSXA 4Z4HA 1RDAA 4FLVA 1IKXA 1JLGA 3RWUA 3H08A 3O4QA 2YNIA 4Z4IA 4AHVA 4FVMA 4ELVA 5KRTA 4FJLA 1HRHA 3RMCA 3S3OA 4KRFA 3AVAA 4GMJB 2HHVA 2DTUA 3TANA 1HYVA 2E4LA 2O4GA 3ITHA 2BGGA 1XWLA 2IS3A 4CJEA 3ALYA 2KZZA 4BWMA 1S5JA 4CJWA 1BISA 1JKHA 2BE2A 3CFPA 4DLGA 4EP4A 4O0JA 3V9SA 5K14A 3SI6A 4DQQA 3HPHA 4KKOA 3UIQA 1TAQA 1JLCA 4FLXA 4FJKA 4DWIA 4M3ZA 3D0PA 4LH5A 3AO1A 2A1RA 2KFZA 3PUFA 1XC9A 2G8HA 5FRMA 1VRUA 1C1AA 4CFCA 3VA3A 1SV5A 1C1BA 2OPPA 1X9MA 1RT2A 1UWBA 3NGYA 3JYTA 2D5RA 3P83D 4L8RB 3AO3A 2F8TA 3QETA 3NF7A 3WNGA 2XHBA 5CZ2A 4OKEA 4N47A 3CG7A 3CYMA 4DSKA 1ASVA 3OYFA 1EX4A 4CFAA 4JS5A 2G8IA 4IG3A 1KFSA 2YNGA 4RG8A 3TABA 1X9WA 4I2PA 2P51A 4E1MA 4CJQA 3TWHA 2G8VA 3VQ6A 4FXDA 1RT5A 1Z25A 4DMNA 1LV5A 1NOYA 1TGOA 1FXXA 4FW1A 3VQ9A 3RMBA 1T03A 1TK8A 1BIUA 3AVLA 1RTHA 4YNQA 3P5JA 1KLMA 4FJ7A 3LP1A 4I9QA 3VQ4A 4CJVA 1EETA 3SV4A 2WONA 2QK9A 5CYMA 1GOAA 1Q9XA 3WNFA 3RMAA 4FW2A 2DFFA 1JLEA 3DMJA 3OYHA 5EU7A 4DU3A 1CLQA 4W5NA 1C6VA 2IGIA 1KRPA 3SUPA 4B9TA 4AILC 3TAQA 5CYQA 1WSJA 5I3UA 3FFIA 4CHOA 4KB1A 1BHLA 3OYNA 2VWKA 1U49A 1RTJA 2R7YA 4F3TA 1RT4A 4AHTA 3NH2A 3KLFA 3RMDA 1LWFA 1DLOA 1BCMA 3L2UA 3TR8A 1IKVA 1BI4A 3VQAA 5HRRA 3V1RA 2HHWA 4CFBA 4CK1A 4CECA 4CGFA 1RT6A 1VSIA 1ZBHA 4B08A 3LDSA 3K58A 4FM0A 3VQ5A 1KVBA 2DFHA 4CFDA 1WSHA 3ZSRA 3ISNC 4F3OA 4BWJA 3K5MA 4KO0A 2GUIA 1WSEA 4CEDA 4CJSA 3AVKA 1XHZA 3G0ZA 2A1SA 4IFYA 2YKMA 4E19A 4HHTA 3AA2A 2OZSA 4JRQA 1RTIA 4Z4CA 1C1CA 2B5JA 4MQ3A 4M45A 1ZYQA 4PQUA 4B3OA 4UQGA 1HYSA 4TSXA 1FK9A 1X9SA 4CHQA 4RW9A 1BCOA 3DLKA 3RTVA 1U04A 3ZCMA 4DSJA 3AA5X 1YTUA 2FBTA 2Z1JA 4M3RA 1CXUA 1SKRA 3DLBA 4EZ9A 1QSSA 3KK3A 4FJ8A 3O4NA 4CJLA 3WNHA 4HTUA 3KLIA 1FKPA 3K2PA 2KFNA 3OS1A 3K59A 4DTMA 4J2DA 1S9GA 3O3HA 4FLWA 4W5RA 3PO5A 1J9AA 5C42A 3S3MA 4LY7A 3SQ1A 3PX4A 3OYEA 3NHGA 5C24A 4I7FA 2OPSA 4XIUA 3EZ5A 3ZT4A 3PX0A 3DLGA 1NJZA 1WLJA 2XO7A 3VQBA 5JS2A 3ZT3A 4E3SA 4KTWA 3QIPA 1EP4A 4CEZA 1QE1A 4GW6A 4AHUA 2Z1HA 4FCYA 3LP0A 3MXIA 4Q5VA 3NH0A 3QESA 4CERA 4LSNA 1TK0A 3AO5A 4M41A 1A5VA 4N5SA 5D3GA 4PWDA 4ICLA 4R5PA 1NK9A 4DQPA 4DS4A 3MEEA 3VQQA 4DS5A 3AVFA 3O3GA 3U6FA 1RT3A 1JXEA 3IS9A 3T1AA 4BACA 3PO4A 1S9EA 1SL2A 4CJKA 4DTNA 4FJXA 1HMVA 4RW6A 2HHQA 4H8KA 3HVRA 1C0UA 1KSPA 4CK2A 1TV6A 4CF8A 2P5GA 4M3UA 3OYAA 3AVMA 4KV8A 3F9KA 3ZSZA 4E1NA 1RBVA 2RF2A 1W9HA 4W5OA 2HVIA 1CXQA 2EHGA 2XY8A 3DRRA 1KLNA 4EZ6A 3L2WA 3NBPA 1RBUA 4KHUA 3LANA 4CIGA 3SZ2A 5KI6A 1QS4A 4EP5A 4OGEA 4CGIA 4N56A 3MAQA 2P5OA 4BDZA 1K6YA 1G15A 4E7KA 3S9HA 4JRPA 4H4MA 3KD5E 4O55A 3NCIA 2HHUA 4CIFA 2FBVA 4DFJA 3C94A 2HNDA 3M8SA 3MEDA 3QNOA 3OYCA 3QEPA 4FK2A 4DQSA 3QO9A 3ZSQA 5HROA 1NK6A 1IH7A 3DLEA 4HUGA 1DTTA 1RILA 4CF0A 4KTQA 4LD0A 4CJ4A 4KFBA 4I9LA 4CJRA 3RRHA 4CE9A 5CZ1A 4KHNA 4E0DA 2ZD1A 1BIZA 1S1WA 2YKNA 4KHSA 2FBXA 3NF8A 1SL0A 4NCGA 1L3SA 4C8KA 1BGXT 1VSDA 4KTZA 3KJVA 4ELTA 4ID5A 5J2MA 4FZZA 1J53A 5T7BA 2HHTA 1BQMA 1JL2A 2XY7A 1VSEA 3NF6A 1ITGA 3AO4A 3TAFA 2G8WA 2OZMA 4DLEA 4DU4A 1EKEA 4E7LA 1S1TA 1YT3A 4OPKA 4DSEA 4BE1A 4KI6A 5JS1A 3NAEA 3DOLA 4PUOA 1Y97A 4M3YA 4O44A 4Y1DA 3VQPA 1HNIA 4OPJA 3OYDA 1N6QA 3AA4A 2HHSA 1WAFA 1VSHA 4CHYA 2F8SA 2D0AA 3IRXA 2ITGA 3NF9A 2FC0A 1LW0A 3OYMA 2O4IA 1BI4B 3LP3A 3SUNA 4CHPA 3QEIA 1NKEA 1NK0A 1RTDA 4FK4A 3MECA 3C6UA 4DF4A 4JLHA 4DTSA 3LWMA 3NFAA 3LAKA 4F2RA 1TL1A 2F96A 4M3XA 1TKTA 4E7JA 5FDLA 4O0IA 3TI0A 4FLTA 3CFRA 2EX3A 4IDKA 4CHZA 3PV8A 1LWEA 3HT3A 3OS2A 3LAMA 3BDPA 3DRSA 1HQUA 3TAEA 5HBMA 3ZT0A 1U47A 3AVCA 4O4GA 3AVHA 3DRPA 4DFMA 3HK2A 3NDKA 4MFBA 3AV9A 1UA1A 1D9FA 2DFEA 4KHQA 3VQEA 1TAUA 1LW2A 1WNSA 3O3FA 3L2QA 4DTUA 1L3TA 5HRNA 2BDPA 1XI1A 3MXJA 4N76A 3SQ2A 1TL3A 4FJ5A 2B6AA 3TAGA 2YNHA 2RKIA 3QERA 4B8AB 4HUFA 3V4IA 1EXQA 1X1PA 3AVBA 3OY9A 1BQNA 1L5UA 5KTQA 3ZSYA 1A5WA 3OYKA 3HVTA 3HYFA 4BE0A 1R0AA 2IDOA 1VK0A 4CK3A 3V81A 2HNZA 2Y1IA 4J2AA 4FJJA 4ZTJA 2B4JA 2WOMA 2KQ2A 3G10A 1NJXA 4KREA 2HVHA 1REVA 3HP9A 3L8BA 2KTQA 3RR7A 1GOCA 3DYAA 3SUOA 5FROA 4FZXC 1ASUA 4B8CA 4KHWA 4RW4A 2QXFA 1J5OA 2DY4A 1TKXA 3TAMA 1U4BA 1XHXA 3ZSWA 4FM1A 3PX6A 3NH1A 1NKCA 5HP1A 4GVMA 3THVA 3OJSA 4FJ9A 2E6LA 2KW4A 4NCBA 4BDYA 1NK5A 4IBNA 2RN2A 1RDDA 4DU1A 4DTXA 4ELUA 1UA0A 3SCXA 4JS4A 3E01A 4J2EA 1A5XA 1TK5A 1F21A 3OYJA 3K5LA 4B9MA 1IO2A 4DSIA 1ZBIA 3LZJA 3KKSA 2KZMA 1NK8A 4FJNA 3OYLA 3HPGA 3K5NA 3NGZA 1T8EA 2X6NA 1J54A 3V9XA 4CIEA 4DFKA 2OA8A 3V9ZA 2GBZA 1VSMA 4LH4A 1T7PA 1GOBA 5KRSA 4DTRA 1I39A 4QAGA 4AHCA 1BL3A 5E41A 1RNHA 2YHAA 4DTJA 4CGGA 1YVUA 4CEBA 1NK4A 1L3UA 2LSNA 4F8RA 3OVNA 4F4KA 4FK0A 3K57A 4CEAA 4K8ZA 4G1QA 3QNNA 3DI6A 4AHSA 3RRGA 1B9DA 1CZBA 1D9DA 4KAZA 4FJIA 1SUQA 1KVCA 2E6MA 1B9FA 3C6TA 4I2QA 3EYZA 3QINA 1WAJA 3WNEA 3I0RA 4NCAA 2ZQBA 3BGRA 3SPZA 1SKWA 2PYLA 4W5QA 2HHXA 3F73A 4Y1CA 3P1GA 1HQEA 3ZSVA 4B9VA 2OYQA 2HNYA 4AHRA 4FM2A 1RCHA 3VN5A 4ZHRA 3JSMA 1HJRA 4C8LA 4FJMA 1UOCA 1I3AA 3ASMA 4IG0A 3ZT1A 1S6PA 1UAXA 3HXMA 1TKDA 1WSGA 4DFPA 1D8YA 3HM9A 1Z26A 3LPUA 4FLZA 3V1OA 2JGUA 4NYNA 5KGWA 4FZYA 1O1WA 2OPRA 3U3YA 1L3VA 5HRSA 1QHTA 1HYZA 4OKKA 5DK5A 3VQCA 3B6PA 1RDBA 1S1XA 3C95A 2X6SA 3LALA 1W0HA 1KVAA 4DSFA 2JLEA 4CF1A 4B9SA 4J2BA 3RR8A 4B9LA 3L2RA 3QEVA 3LZIA 3L3VA 4CEQA 2Y1JA 4OJRA 2Q3SA 4CJTA 2W42A 3CFOA 3PY8A 2IC3A 4CJFA 3MXMA 2XY6A 1NK7A 2PY5A 4KPYA 4CEOA 2ETJA 2YV0X 4CEFA 1VSJA 4FLUA 3KKRA 1NKBA 2IOCA 4NYFA 1RT1A 4BDPA 3B6OA 4F2SA 4M3WA 1NJYA 3V6DA 1S6QA 5DMRA 4Z4EA 4WE1A 2VWJA 5J2NA 4DQRA 1S1UA 4FYDA 3T3FA 1CZ9A 1TKZA 2BANA 1ASWA 1S1VA 4CF2A 1IKYA 3QEWA 5HRPA 4OVLA 1IG9A 4IFVA 1JLFA 2P1JA 1HPZA 2VG7A 4B9NA 3SQ0A 4K8XA 4Z4FA 1VRTA 3KLGA 1KFDA 3L3UA 1DTQA 3I0SA 1TVRA 3HSTB 4BE2A 4OKJA 4C8OA 3KD1E 4HCBA 2HW3A 2AJQA 1HNVA 3DM2A 4ID1A 1LAVA 3LWLA 1SL1A 4O5BA 2X74A 4KHYA 1IKWA 3I8DA 5J2PA 3MEGA 1QSLA 4Q0BA 1VSLA 1WSFA 3KTQA 3TARA 5C25A 1Q8IA 2VG6A 2I5JA 4C8NA 2Z1GA 3V1QA 4CGHA 5SWMA 1NJWA 4CCHA 1JLQA 3SV3A 4M42A 4IKFA 3HO1A 1SKSA 5SZTA 2D0CA 4CGJA 3V9WA 5FRNA 2PYJA 4PY5A 2X78A 4DG1A 1FKOA 1QQCA 3HPOA 1U45A 4CF9A 5J1EA 2VG5A 5KGXA 1WN7A 4Z0UA 3OYIA 3KLHA 4CHNA 3LP2A 4DF8A 3SUQA 1T05A 1JXBA 5CY4A 4CGDA 1QSYA 3KLEA 3VQ7A 3AO2A 3TAPA 3ZSOA 3HL8A 4CJUA
chains in the Genus database with same CATH superfamily
3SBGA 1NU0A 2QKKA 1N5YA 3R9PA 5M1QA 2ZE2A 2Q2RA 2PZSA 2O8CA 2FSKA 1C0TA 3HZ6A 3I55N 2FBYA 3KK1A 3EY1A 4WFBL 3DXMB 2ZM6K 2VQEK 4HVJA 4QCLA 3OYGA 3DLRA 3VQDA 3CM6A 3SPYA 4NO7A 3CQ8A 4AQYK 3U4LA 4H4OA 1YHQN 3IAYA 1RDCA 4FJHA 4KHPK 3CQXA 1ZBLA 4GV6A 5A2QO 1RT7A 4DSLA 4CEEA 1MU2A 3T19A 3IG1A 4ZTFA 5ADXH 1VSFA 3LM2A 4AH9A 3M1FA 4JKHA 4DV3K 5AQHA 2QWMA 3U3GA 1RBSA 2A40A 3KIOA 3CPEA 4CJ3A 3D45A 1JLAA 4CZKA 1NOZA 1RDAA 3ATUA 3C7NB 1JLGA 3O4QA 2YNIA 4Z4IA 4AHVA 3CETA 3CMEN 1HRHA 1WBBA 4KRFA 2HHVA 2DTUA 3TANA 1E3MA 2BGGA 4K42A 2IS3A 3ALYA 3THXA 1S5JA 4CJWA 4CI6A 1Q82O 2NZTA 4EP4A 4OO1J 4O0JA 5K14A 3UIQA 4FLXA 4FJKA 3D0PA 2A1RA 5FRMA 3H45C 1C1BA 1Z05A 1N33K 3KWIA 1X9MA 1UWBA 2Q97A 4BC3A 3QETA 2OCEA 2HF4A 2XHBA 5CZ2A 4IZ9A 4CFAA 5LL6Z 2E2PA 4CJQA 2G8VA 2O8EB 3ZETA 1Z25A 1KXPA 3DLLL 1LV5A 4FW1A 1MWMA 1KLMA 3LP1A 2W6LA 3L4IA 4IEEA 1CLQA 2P9IA 4FW2A 3RMAA 3VESA 4CZLA 5EU7A 4W5NA 1C6VA 2YX6A 2E2NA 4ILJA 3UE5A 2OTLN 4AILC 1WSJA 1BHLA 1OKJA 3Q7CA 4F3TA 4AHTA 3NH2A 5AQJA 3KLFA 3TR8A 4CD1A 3CCQN 3V1RA 1BU6O 4MDBA 5KPZA 1QZ6A 3BZKA 1TYQA 4KH5A 4YOWA 3VQ5A 1WB9A 3TTDA 1KVBA 1U2VA 4FWMA 3ISNC 4FWRA 4BWJA 4CEDA 1WSEA 4CJSA 4IWVA 2A1SA 4IFYA 4HHTA 3AA2A 4YOVA 4FL9A 4JKAA 4Z4CA 4BRHA 1LCUA 4FWPA 4MQ3A 1HYSA 4TSXA 1X9SA 4RW9A 1BCOA 1U04A 1BA0A 1SKRA 1CXUA 1QSSA 4JHDA 3R3LA 4CJLA 4H0OA 3KLIA 2GEMA 3K2PA 4QS7A 3EE8A 3O3HA 4FLWA 2KLAA 1ZXOA 3OYEA 4XIUA 4I7FA 1WLJA 3LDPA 5JS2A 1T3VA 4KTWA 3QIPA 2NRVA 5I9EB 1W2BM 4FCYA 4Q5VA 3NH0A 3QESA 5KPTA 1TK0A 3CC2N 1KAZA 3MMVA 4GY2B 4IDHA 3VQQA 5AQFA 1JXEA 4BACA 4CJKA 2P9KB 3CC7N 4CK2A 4M3UA 3G71N 4W5OA 4E1NA 3LDOA 2HF3A 4KHUA 3LANA 3SZ2A 1QS4A 4EP5A 4OGEA 1SAZA 2QW9A 4N56A 3LM9A 4NXMK 4QS9A 1NMDA 4H4MA 3ULEA 3NCIA 1QZ5A 4E1JA 3EKUA 2HNDA 4DV5K 3QEPA 4BGAA 3QNOA 3OYCA 3SK3A 4MO5A 5HROA 3CIPA 4A2AA 4KTQA 4LD0A 4KFBA 4FWSA 4E0DA 3BUZB 3ZX2A 4BRPA 1SL0A 3D6RA 1N36K 3KJVA 3DWLA 4ID5A 3CF5L 4XEIA 1BQMA 1JL2A 1ITGA 2HHHK 2QWOA 4DLEA 4AM6A 4DU4A 1OH8A 3QFPA 1YT3A 3T1YK 4O44A 4Y1DA 1KD1O 4IFEA 4OPJA 3CCSN 2P9UA 4WFNL 1BDGA 1WUAA 4JK8A 1LW0A 2O4IA 3SUNA 4CHPA 1YIJN 1P90A 4FK4A 4FOEA 4DTSA 3WQTA 4FWOA 3ZLJA 5AQKA 3O8MA 4IDKA 3HT3A 4ILGB 3OS2A 4BRDA 3BDPA 1EWRA 2NRXA 3ZT0A 3NDKA 3AV9A 1UA1A 2DFEA 3VF2A 3VQEA 2IVPA 3TTCA 1WNSA 3L2QA 4DTUA 1TAUA 4JV5K 3MXJA 2E2OA 3SQ2A 2UXBK 3DXKA 1YJ9N 4FVUA 3TAGA 4BY9C 4BG8A 4B1ZA 3QERA 4HUFA 3V4IA 4A57A 4JI1K 1L5UA 2QA4N 3OYKA 3TTFA 3V81A 4J2AA 4FJJA 2B4JA 3O80A 2ZWHA 5FROA 1ASUA 2WC9A 4KHWA 2HBLA 5BREA 1GLEG 1XHXA 5AFUH 3NH1A 3PIOL 5HP1A 4IO9L 1MA9B 4FJ9A 4H5NA 4B1WB 4BDYA 3SCXA 3E01A 5DM6L 4B9MA 1IO2A 5JVGL 4ISFA 3LDQA 1T8EA 4CIEA 4M7YA 4CZJA 2V7YA 4LH4A 4A2BA 4JN4A 2RE2A 4QAGA 3QBXA 3W0LA 4AHCA 1RNHA 2YHAA 1YVUA 1NK4A 3OVNA 3K57A 3PIPL 4B3SK 1VHXA 3THYA 3KZBA 1CZBA 4B1VA 3U9ZA 4I2QA 1B9FA 4B9QA 1J6ZA 3BGRA 3EEQA 3MDQA 4BR7A 4Y1CA 3T69A 4YY3K 2D0OA 1HKCA 2NRZA 5E26A 2OANA 4FM2A 2JWLA 1XNQK 3VN5A 4XH1A 1UOCA 1I3AA 3ASMA 3P31A 4M63C 4DFPA 1SZ2A 4K41A 4NYNA 5KGWA 1O1WA 1OH6A 1L3VA 1HLUA 1P8ZA 1GLJO 3ZX3A 4DSFA 1KVAA 4J2BA 4WQ5C 3QEVA 3LZIA 4OJRA 4PL7A 2O8BB 4CJTA 2NLXA 2W42A 4CJFA 3MXMA 2XY6A 4B3TK 1NBWA 3C6AA 3FR0A 4FLUA 4YOXA 4EHTA 1VQ6N 2FF6A 2HSTA 2IOCA 1RT1A 3VOVA 1NG9A 1S6QA 3GL1A 4Z4EA 4FWQA 5J2NA 3O9SA 1CZ9A 4C1NI 1ASWA 3WXIA 3QEWA 5HRPA 5AQSA 1IG9A 1JLFA 2P1JA 3CMAN 4B9NA 1TVRA 3HSTB 4BE2A 2AJQA 2NRHA 3KD1E 1VQ7N 3DM2A 4ID1A 2QM1A 5AQRA 1SL1A 4KHYA 2X74A 2I7NA 3MEGA 1YITN 1RGIA 4JKDA 4Q0BA 3KTQA 1Q8IA 1E4FT 1HNWK 4CGHA 2GUPA 5SWMA 1JLQA 3SV3A 3QICA 3QB0A 5SZTA 3VF4A 3VERA 3M5RA 2X78A 4DG1A 4NXNK 3CJBA 2VG5A 4PKHA 2BTFA 5J1EA 3OYIA 1T05A 3GBTA 1QSYA 3KLEA 1N32K 1JCFA 3AO2A 5B8HA 1KQSM 2ASPA 1ZBUA 3SAHA 4BREA 4KH4A 2Q0RA 4OLAA 3V9UA 2E20A 2ZJQL 3SAFA 3AVJA 2QI2A 4MO4A 2PBDA 3VA0A 5TKYA 5HL7L 4K0KK 3A2FA 2OPQA 3HJFA 5GAGP 1NGEA 1QTMA 1JLBA 3OJUA 1D5AA 4CBWA 1NMNA 1EQYA 4CJPA 2GV9A 3K5OA 5AQOA 4M3TA 4JI8K 5FPDA 4E7IA 5AQWA 3F2KA 2A42A 4W5TA 3M8QA 3DOKA 5LJVA 5IT9O 3MCPA 1VSKA 4LF8K 3EE9A 4QOZB 4DQIA 4JI6K 3R6MA 3RWUA 1IKXA 3H08A 4FVMA 4BVOA 5KRTA 4FJLA 2P9LB 4JAXA 3SAGA 3S41A 4A5AA 1KAYA 2KZZA 4BWMA 3BEXA 1BISA 3CFPA 1VQKN 4IXCA 1YJWN 3V9SA 3FZMA 3HPHA 1QVFM 1TAQA 3G25A 4H0VB 4DWIA 3PUFA 1GLBG 2G8HA 1VRUA 1C1AA 4CFCA 1SV5A 5IWAK 4JI3K 5AR0A 4MLEA 3JYTA 4L8RB 1EO1A 3AO3A 3NF7A 3H46O 4N47A 3CG7A 1ATNA 3OYFA 1IBMK 1EX4A 4JS5A 4DR1K 2YNGA 4RG8A 3TABA 4FO0A 3A5LC 4DV7K 1NOYA 3VQ9A 1BIUA 1RTHA 4YNQA 3O9UA 3VQ4A 4CJVA 3SV4A 2QK9A 5F2RA 2VYPA 5CYMA 1HX1A 3QFUA 1JLEA 4DU3A 1T6CA 4B9TA 4CZEA 3NMUA 5I3UA 3MWPA 4KB1A 2O8FA 1U49A 1U2VB 4FWKA 3CCMN 2E8AA 1RT4A 3E1YA 3RMDA 1LWFA 2VGMA 3AARA 1BCMA 4BRAA 1IKVA 1BI4A 3VQAA 3HSCA 2UUCK 5HRRA 3ID8A 3QBWA 3TPQA 4CFBA 4FPAA 3IDHA 4CGFA 1ZBHA 1VSIA 3K58A 3D2FA 4FM0A 4CZHA 3H3NO 2DFHA 4CFDA 1WSHA 2ITMA 3CPWM 1NGHA 4JHDB 3AVKA 4DUZK 2OZSA 1RTIA 1Y64A 1C1CA 1ZYQA 4UQGA 2P9NB 1IBLK 3GG4A 1Q18A 3C0BA 3KK3A 4FJ8A 3O4NA 1XQSC 3OS1A 1W7AA 1N34K 4J2DA 5AQYA 5M1NA 1VQ8N 3PO5A 2QEXN 4EIAA 5C42A 3SQ1A 3EZ5A 3WXMB 1ATRA 1S3XA 4QS8A 4E3SA 5AQLA 4GW6A 2W40A 3LP0A 2UUAK 1QQMA 1A5VA 4N5SA 3D2EA 4PWDA 4ICLA 3SBTA 1NK9A 4DS5A 3MEEA 3U6FA 4DTNA 4JKGA 2HHQA 1HMVA 3UKRB 4DV0K 4H8KA 2P5GA 1KSPA 5FPEA 3ENHA 1TUUA 3AVMA 3ZSZA 2RF2A 1IBKK 2EHGA 2XY8A 3NBPA 2A3ZA 2UYTA 4DHYA 3WEEA 3MAQA 2P5OA 1OH5A 1K6YA 3S9HA 5C12A 3KD5E 4LF7K 4CIFA 3Q7BA 4DB3A 4DFJA 3C94A 4DQ8A 5BPMA 1CZAN 3MEDA 4FK2A 4DV4K 5AZJB 4DQSA 3QO9A 3ZSQA 1NK6A 1IH7A 1DTTA 4CJRA 3RRHA 4AF1A 1XNRK 1IG8A 4I6MB 4CE9A 3K0SA 3E9PA 3LL3A 1BIZA 1S1WA 5AZIB 2FBXA 3HBTA 4NCGA 4DV2K 1VQLN 4B1YB 5J2MA 2VWBA 4FZZA 5T7BA 2GTDA 1VSEA 2G8WA 3OHRA 1ESVA 1GLCG 4E7LA 4OPKA 4BE1A 4Z94A 3ZEUA 1Y97A 4PUOA 3VQPA 4J8FA 3OYDA 1VSHA 2F8SA 2D0AA 3NF9A 3OYMA 3PSFA 3VEOA 1K8KA 3LP3A 5LMNK 3QEIA 4JD2B 4JLHA 4BC4A 3LAKA 3KHYA 4JI2K 5BN8A 4CHZA 1QQOA 2YCHA 3LAMA 3DRSA 5HBMA 3DRPA 1BA1A 4MFBA 5JICA 4KHQA 4JKBA 3O3FA 2BDPA 1XI1A 1K9MO 1TL3A 1GLLO 2ZF5O 4H5VA 4GV3A 4WQ5A 3A8YA 5KTQA 3UKUB 1MWKA 3HVTA 3HYFA 4OX9K 3J81O 4KREA 2HVHA 3I56N 1REVA 3L8BA 1BOTO 3SUOA 2ZJPL 3RSEA 4FZXC 1J5OA 4FSVA 4O5FA 4B1UB 1U4BA 1NKCA 3ZSWA 4FM1A 3PX6A 5FLXO 5AQVA 2E6LA 4NCBA 3E66A 2RN2A 1RDDA 2WFBA 4ELUA 3IUCA 1UA0A 3K9KA 1F21A 4BQZA 3THWB 3KKSA 4BGBA 1JJ2M 3HPGA 3W3DA 4BR2A 3NGZA 3DXMA 1BO5O 1T7PA 4DTRA 4DCHA 5AQQA 1V4TA 4CEBA 4F8RA 4OPAA 4FK0A 4G1QA 3QNNA 4AHSA 3RRGA 1B9DA 4KAZA 1OVQA 3EYZA 1HNZK 3PLAA 1HKGA 1WAJA 3QINA 2Q1NA 3I0RA 4PL8A 4NCAA 4BRFA 2HHXA 3F73A 1NGJA 3P1GA 2FSNA 1YF5L 2OYQA 2J4RA 2P9PB 3J80O 3JSMA 2QKBA 1HJRA 1M1KO 1D8YA 1TKDA 1UAXA 4BRNA 4FLZA 2RHKA 5DK5A 4DUYK 1FJGK 3C65A 3C7NA 1S1XA 3C95A 1ZC6A 3RR8A 3I33A 5BR9A 2IVNA 2Y1JA 3D7EO 1X3NA 5CR4A 4RWTA 2IC3A 2GWJA 4KPYA 4CEOA 3A5MC 4DR5K 1VSJA 4GKJK 4BDPA 3B6OA 1H1VA 3NVKA 5DMRA 5BPNA 2VWJA 4YOTA 4FYDA 3T7ZA 1S1VA 4CF2A 4IFVA 2VG7A 4MDAA 3FZHA 4K8XA 3CJ1A 3I0SA 3H1QA 4CBUA 4OKJA 2O8EA 1LAVA 1NJIO 4Y0WA 3I8DA 5J2PA 4B1XB 1VSLA 4C8NA 4CCHA 2GELA 3HO1A 1SKSA 3L0QA 2D0CA 2V52B 5FRNA 2PYJA 3ID6A 1FKOA 1QQCA 2DPNA 4CF9A 3KLHA 4Z4GA 1WN7A 3SUQA 4CHNA 5AQUA 5CY4A 1Q86O 5AQGA 5GIPA 3ZSOA 2NRTA 4CJUA 4CJ5A 5AQTA 3ZX0A 4JK7A 4H5WA 4DR6K 3H3OB 1JL1A 4CESA 1LAWA 1WBDA 4KH6A 2W41A 4OLBA 3S3NA 4JI7K 2Z1IA 1RBRA 2FLOA 4OGCA 1NGCA 4RW8A 3ENOA 4WQ4C 2G8FA 3M8PA 2D0PA 1HR0K 3L6QA 2IAJA 2YNFA 1DEJA 2G8UA 1U6ZA 3M8RA 1B92A 2WUSA 4DV1K 1YTUA 1YTAA 4GKKK 4PA1A 1GLDG 2ATQA 4B9UA 1KTQA 3JAMO 2RPIA 1ZBFA 2XRIA 2XY5A 4LSLA 4F9OA 4KB0A 2EWSA 5AQMA 3M6GA 4E7HA 3SNNA 1RDWX 3QEXA 3TSPA 2HB5A 1ATSA 4FWLA 4PHTX 3AVIA 1BWFO 5I42A 5HLFA 3ULDA 1RBTA 3ZT2A 4EHUA 4FLVA 3TSUA 1DGKN 3AAQA 3AGKA 4L3QA 3RMCA 3MCAB 2ZGZA 5AQZA 4LF5K 2W6KA 2E4LA 3IMXA 1QQNA 4CZGA 4CJEA 2BE2A 4DLGA 2P9KA 3MN9A 4DQQA 4IO8A 1C0FA 2KFZA 3J8AA 4IJAA 4LH5A 4M3ZA 4V19S 1XC9A 3H6EA 4DR3K 4H0PA 1NLVA 3WQUA 5F0XA 5JLFA 3ENBA 1RFQA 3CJ7A 4BRIA 1VQON 4BR5A 4NLCA 5HOOA 3CYMA 4DSKA 1ASVA 4JI4K 5AQNA 3HM8A 4IG3A 1KFSA 1LOTB 1X9WA 4I2PA 3VF6A 3KVGA 3TWHA 1YI2N 3VQ6A 1RT5A 4PKGA 1TGOA 3RMBA 1TK8A 4FWNA 4FJ7A 1EETA 2WONA 4JYAK 3OW2M 1W97L 3OYHA 4IOXA 3FE1A 2IGIA 5DM7L 2P9SB 3SUPA 1NGBA 3H1VX 5CYQA 3TAQA 3FFIA 4CHOA 3AAPA 3A0IX 4IJNA 5CE3A 5JMVA 3L2UA 3R1XA 2O8CB 2UUBK 4O8UA 3AGRA 4CK1A 2E1ZA 2VCPA 4B08A 3LDSA 4F3OA 3K5MA 4CW7B 4CZMA 4KO0A 1QVGM 5BRDA 1XHZA 4U7BA 4X62K 2AA4A 2YKMA 4BRGA 2B5JA 4M45A 2WBNA 4CHQA 2Q36A 3RTVA 3ZCMA 5C2FA 3AA5X 2FBTA 2Z1JA 4EZ9A 1WOQA 4BVPA 3P38A 4OPHA 4HTUA 1FKPA 1HJOA 2KFNA 1S9GA 2NRWA 4W5RA 4CJ7A 2ZGYA 1M90O 5ADXA 3NHGA 5C24A 2OPSA 3PX0A 1X3MA 3VQBA 1QE1A 4AHUA 2Z1HA 2Q0UA 4LSNA 4EAHD 2YHYA 3A5NC 5D3GA 4DQPA 3TU5A 4CVNE 3AVFA 3O3GA 3EZWA 4YHHK 3PO4A 3THXB 1S9EA 2WTUA 3M3ZA 4YDUC 4A61A 3OYAA 4KV8A 2QWLA 1W9HA 3DRRA 1KLNA 3L2WA 4CIGA 5KI6A 1MDUB 4CGIA 4BRCA 5BR8K 4JRPA 2CGLA 3MN5A 4O55A 1XMOK 2HHUA 2FBVA 2V51B 3AY9A 2QWNA 4JK9A 4HUGA 3ZETB 1VAZA 4CJ4A 4I9LA 5AQPA 5CZ1A 2CGKA 5EVZA 4KHNA 2ZD1A 4KHSA 4C8KA 1VSDA 3SLCA 4ELTA 1O13A 1XC3A 1J53A 2XY7A 2P9IB 3AO4A 3TAFA 1JCGA 3MK6A 1D4XA 3O1BA 5JS1A 3DOLA 4M3YA 1HNIA 3AA4A 2HHSA 4IEIA 3IRXA 2ITGA 3CQYA 4A5BA 2FC0A 2BH1A 1RTDA 1KC8O 3MECA 4DF4A 3LWMA 3NFAA 2YHWA 4F2RA 1TL1A 1TYQB 3CJ9A 2F96A 1XUPO 4O0IA 4ILHA 4FLTA 3PV8A 1LWEA 3TSQA 3VEYA 1U47A 3AVCA 4O4GA 3AVHA 4FPBA 5M1PA 1LW2A 2GWKA 1L3TA 5HRNA 3VGKA 3MN6A 4N76A 4FJ5A 1N8RO 4LFBK 1VQ5N 1J5EK 4B8AB 2I7PA 5BRFA 2JWKA 1X1PA 3OY9A 1BQNA 2F9TA 3GOIA 3CCJN 4BE0A 1VK0A 2Y1IA 1NGDA 2WOMA 2KQ2A 1NJXA 4R79A 2KTQA 3HP9A 3WXKA 3FGUA 3RR7A 4YORA 2UXCK 4B8CA 3GDQA 3O1WA 3TAMA 4GVMA 3THVA 3OJSA 1K8AO 1HPMA 1YJNN 5JLHA 2E88A 1NK5A 4IBNA 4DTXA 4PKIA 1FW6A 2HBKA 1TK5A 3NVMA 3OYJA 2Q31A 1ZBIA 3BF1A 5F1XA 3LZJA 2KZMA 1HKBA 3EKSA 3K5NA 3CJAA 2X6NA 1J54A 3V9XA 2OA8A 3JS6A 3V9ZA 2GBZA 4FOIA 5ELZA 4K43A 3U9DA 1YXQA 4DTJA 3T1HK 1QHAA 3ULEB 4F4KA 4BQLA 4CEAA 2KKZA 4G9ZA 4FJIA 5EXWA 1KVCA 2E6MA 3C6TA 3EN9A 3WNEA 2ZQBA 2PYLA 5EX5A 2E1YA 1HQEA 3ZSVA 2BUPA 2HNYA 4AHRA 4LFCK 4ZHRA 4FJMA 1E4GT 2GX9A 4IG0A 3ZT1A 3HXMA 2O8DA 5EOYA 1WSGA 2PAVA 2YJEA 2JGUA 3BY5A 2OPRA 3U3YA 1NGIA 3SJHA 5HRSA 1QHTA 1Q7YO 4OKKA 3VQCA 3B6PA 1RDBA 2NRRA 2JLEA 2P9LA 2P9UB 4B9LA 4HWIA 4CEQA 2Q3SA 3HOSA 4WQ4A 3PY8A 3OBWA 4DR2K 2PFUA 1NK7A 3VPZA 1NNEA 5GAEP 4CEFA 3L4QA 2QWRA 1K73O 1NKBA 3CI5A 4NYFA 4M3WA 5AJ3K 3SMSA 1VQNN 4WE1A 5KQ8A 4DQRA 4BRQA 1VQ4N 4CZIA 3LDNA 1T44A 2HOEA 4WCEL 1X9JA 3G4SN 3SQ0A 3DXKB 3KLGA 4HCBA 1DTQA 4GNIA 1HNVA 4HTLA 4LC9B 3LWLA 2QTDA 1QSLA 2HBJA 3TARA 5C25A 1Q81O 2I5JA 3EL2A 4JI0K 1TUYA 1NJWA 2KHOA 4CGJA 4CBXA 2D1KA 3HPOA 5LJWA 4DV6K 5KGXA 3LP2A 4DF8A 4CGDA 3VQ7A 5GADP 3HL8A 1NK0A 3FZFA 1C0MA 3CM5A 1Q9YA 1R59O 5H1SQ 3FLCO 3AVGA 5AFUA 5FPNA 3QIOA 2D0BA 2NNWA 3MX2A 1VQ9N 4DTOA 3HTVA 5C0YA 3CCRN 4YOYA 3LDLA 2F7TA 4EFHA 2HMIA 2YHXA 3OYBA 3AVNA 4N41A 1U48A 4E89A 3FZLA 3NGIA 3OS0A 3HP6A 4BC2A 3NE6A 3THYB 4M7XA 4YFUA 5J2QA 1WSIA 2P9NA 3QLHA 4HCCA 3SJJA 1LWCA 4IOCL 4KI4A 4C8MA 3SYZA 3VQ8A 4HUEA 4FJGA 3B8AX 3IFRA 4RW7A 2NUBA 2OTJN 2ZJRL 2G8KA 2VQFK 3AA3A 2F4VK 1NGGA 2F9WA 2YHBA 3DLHA 2YJFA 3L2VA 3LPTA 1KCFA 3KK2A 3WXLA 4AM7A 3VEWA 4FLYA 3SQ4A 3E9OA 3ZSXA 4Z4HA 2QWPA 4WFAL 4ELVA 5BN9A 3S3OA 3VEZA 4BRLA 1OH7A 3AVAA 4GMJB 1YVNA 3ZYYX 3OA9A 1HYVA 2O4GA 3ITHA 5CHIA 1XWLA 3CERA 1C0GA 3BZCA 1JKHA 3UKRA 3SI6A 3OBYA 4KKOA 1JLCA 3UB5A 3AO1A 3VA3A 5E84A 4JKFA 4JKCA 2OPPA 3CCEN 3CHWA 1RT2A 3NGYA 2F8TA 2D5RA 3P83D 4UY8O 3WNGA 4BR0A 4OKEA 1YUWA 2G8IA 4H0TB 5AZJA 5BPLA 2P51A 1NGFA 4E1MA 4FXDA 3CXCM 4DMNA 3JXUA 4I6MA 4H0YB 1FXXA 1T03A 3AVLA 3P5JA 2A5XA 4I9QA 5GAHP 5AZIA 1VQPN 5GINA 4YDUA 1GOAA 1Q9XA 3WNFA 2DFFA 3DMJA 3HRGA 5JVHL 4RTFD 1KRPA 3WUHA 3OYNA 2VWKA 1RTJA 2R7YA 4JEPA 1DLOA 4X65K 3QMLA 4JD2A 2HHWA 1S72N 3VETA 4CECA 1RT6A 2YI1A 3O4WA 3DJCA 3VMFB 4LF6K 3FZKA 3ZSRA 2H3GX 2GUIA 3G0ZA 3J7ZO 4E19A 4BRKA 1ILYA 4JRQA 3F9MA 4PQUA 4ISEA 4B3OA 1FK9A 4A59A 3F5TA 3DLKA 4DSJA 4M3RA 1VQMN 3DLBA 3SMPA 4RCHA 4YOUA 3BF3A 3O9QA 3WNHA 3I8BA 3K59A 4DTMA 1NM1A 4WF9L 3CCLN 1YAGA 3UKUA 1GLFO 1J9AA 2CGJA 3S3MA 4LY7A 3PX4A 4A62A 1NJZA 3ZT4A 3DLGA 2XO7A 3ZT3A 1EP4A 3RVCA 4CEZA 3MXIA 5C2DA 2FF3B 4CERA 4JNEA 3AO5A 4M41A 3R8EA 1XMQK 2E5LK 4R5PA 3CCUN 4DS4A 5MLCQ 1RT3A 3A5OC 3IS9A 3T1AA 1SL2A 4FJXA 4JI5K 4RW6A 3HVRA 1C0UA 1TV6A 4CF8A 3U8XA 3VEXA 3THWA 3F9KA 1RBVA 2HVIA 1CXQA 1DKGD 1KAXA 4EZ6A 1RBUA 4BC5A 3P39A 4NLBA 5M1FA 4BDZA 4LF4K 4E7KA 1G15A 1G99A 4GV9A 3MN7A 3M8SA 3DLEA 1RILA 4CF0A 4BRMA 1IJJA 5KPRA 3MWTA 2HMPA 2P9PA 2YKNA 3NF8A 1L3SA 5C10A 1BGXT 4KTZA 3O6WA 3HOTA 2HHTA 1OVYA 2AP1A 3K9JA 3NF6A 2OZMA 1EKEA 1S1TA 4KI6A 4DSEA 1BG3A 3BP8A 3NAEA 5C15A 2UXDK 4WYBA 2CH5A 4BR4A 1N6QA 4O8KA 2O8FB 3WXJA 1WAFA 4GVEA 5TKWA 4CHYA 1I94K 3PSIA 4X64K 2FSJA 1ZBSA 4XH4A 1BI4B 1NKEA 3O9RA 3C6UA 4LFAK 2HBMA 2V7ZA 4M3XA 1TKTA 3D2FB 4E7JA 5FDLA 3TI0A 3CFRA 2EX3A 2ASMA 4DR4K 1HQUA 3TAEA 3HK2A 3FFKB 4DFMA 1D9FA 3J7YP 2IVOA 2B6AA 3ATVA 4KBOA 3EO3A 2E2QA 2YNHA 2RKIA 1EXQA 3AVBA 3ZSYA 1A5WA 1BUPA 5LY3A 1HUXA 1R0AA 2IDOA 4CK3A 2HNZA 4IOAL 5GIOA 2VGNA 3VGLA 4C23A 4ZTJA 3G10A 4CZFA 1GOCA 3DYAA 4X66K 1HNXK 2IIRA 4RW4A 2QXFA 4BR9A 2A41A 2FXUA 2DY4A 1TKXA 3D2EB 4XH5A 1Z6RA 1V4SA 5FPMA 2A6AA 4C1NK 2KW4A 5AQXA 4DU1A 4JKGB 3VTHA 4JS4A 4J2EA 1A5XA 3K5LA 4K25A 4DSIA 3VENA 3CC4N 1NK8A 4FJNA 3OYLA 3WT0A 4NB4A 3MX5A 1JCEA 3WEEB 4DFKA 1IV0A 1VSMA 3VEVA 1GOBA 5KRSA 1I39A 1BL3A 5E41A 3N4PA 3CCVN 4CGGA 1L3UA 3J7AP 2LSNA 1SS6A 3CD6N 4K8ZA 1NWKA 2UU9K 2QXLA 3DI6A 1D9DA 2D4WA 2O8DB 3CJCA 1SUQA 4H5TA 1S22A 1SQKA 3SPZA 1SKWA 4W5QA 2CH6A 5AQIA 3O5BA 4B9VA 4BROA 4H03B 5LMUK 1RCHA 1T6DA 3KWGA 4C8LA 5KQDA 3G6EN 1S6PA 4JKEA 2ASOA 3HM9A 1Z26A 3KK7A 2QWQA 3LPUA 3V1OA 4FZYA 4DKWA 1EWQA 3DAWA 5M1OA 3HI0A 1HYZA 4LF9K 3ZEUB 2X6SA 3O08A 3LALA 1W0HA 4CF1A 4B9SA 3L2RA 4MLHA 1GLAG 3L3VA 3QDKA 5M1KA 3CFOA 1K8KB 2PY5A 2ETJA 4H5RA 2YV0X 3VGMA 3KKRA 4F2SA 2O8BA 4BG9A 1NJYA 3V6DA 4ISGA 1DT9A 3N4QA 1S1UA 3T3FA 1TKZA 2BANA 3IKMA 1IKYA 5EY4A 1NGAA 4OVLA 1HPZA 4Z4FA 1VRTA 1KFDA 3L3UA 4C8OA 2HW3A 3GE1A 4O5BA 1IKWA 3VTIA 4CD3A 4U67L 5BRHA 1WSFA 2VG6A 3E9LA 3O9TA 3P4IA 2Z1GA 3V1QA 3OTOK 4M42A 4IKFA 1RDUA 3V9WA 4DR7K 4PY5A 3RSEB 3C6HA 1U45A 4Z0UA 4B3MK 4B3RK 4H0XB 1JXBA 2P9SA 4DTPA 3TAPA
chains in the Genus database with same CATH topology
1ZBUA 4CJ5A 1C0MA 2QKKA 3CM5A 1Q9YA 1N5YA 2QKBA 4OLAA 3V9UA 2ZE2A 3AVGA 3QIOA 2D0BA 2PZSA 4DTOA 3AVJA 1C0TA 1JL1A 2FBYA 3KK1A 3EY1A 2HMIA 4CESA 1LAWA 3VA0A 4HVJA 4QCLA 3OYGA 3DLRA 4OLBA 3S3NA 2Z1IA 3A2FA 3OYBA 1RBRA 3VQDA 4OGCA 3AVNA 2OPQA 3CM6A 3SPYA 4RW8A 4N41A 1U48A 4E89A 3HJFA 3CQ8A 3NGIA 1QTMA 3OS0A 3HP6A 1JLBA 2G8FA 3M8PA 4H4OA 1D5AA 1RDCA 3OJUA 3NE6A 4YFUA 3IAYA 4FJHA 5J2QA 2IAJA 2YNFA 4CJPA 1WSIA 2GV9A 3K5OA 3QLHA 1ZBLA 1RT7A 2G8UA 4HCCA 4DSLA 3SJJA 3M8RA 4M3TA 1LWCA 4KI4A 4C8MA 4CEEA 1MU2A 3VQ8A 1B92A 4HUEA 3SYZA 4FJGA 1YTAA 3T19A 4PA1A 3IG1A 4RW7A 4ZTFA 2NUBA 2ATQA 4E7IA 1VSFA 4B9UA 1KTQA 2G8KA 3AA3A 4AH9A 3M8QA 2RPIA 1ZBFA 2XRIA 3DOKA 4LSLA 4W5TA 2XY5A 4KB0A 3U3GA 2YHBA 3DLHA 4E7HA 3SNNA 1RBSA 3KIOA 1VSKA 4DTPA 3L2VA 3QEXA 4CJ3A 2HB5A 1KCFA 3LPTA 3KK2A 3D45A 4QOZB 4Z4GA 1JLAA 3AVIA 4FLYA 1NOZA 3SQ4A 3ULDA 1RBTA 5I42A 3ZT2A 5HLFA 4DQIA 3ZSXA 4Z4HA 1RDAA 4FLVA 1IKXA 1JLGA 3RWUA 3H08A 3O4QA 2YNIA 4Z4IA 4AHVA 4FVMA 4ELVA 5KRTA 4FJLA 1HRHA 3RMCA 3S3OA 4KRFA 3AVAA 4GMJB 2HHVA 2DTUA 3TANA 1HYVA 2E4LA 2O4GA 3ITHA 2BGGA 1XWLA 2IS3A 4CJEA 3ALYA 2KZZA 4BWMA 1S5JA 4CJWA 1BISA 1JKHA 2BE2A 3CFPA 4DLGA 4EP4A 4O0JA 3V9SA 5K14A 3SI6A 4DQQA 3HPHA 4KKOA 3UIQA 1TAQA 1JLCA 4FLXA 4FJKA 4DWIA 4M3ZA 3D0PA 4LH5A 3AO1A 2A1RA 2KFZA 3PUFA 1XC9A 2G8HA 5FRMA 1VRUA 1C1AA 4CFCA 3VA3A 1SV5A 1C1BA 2OPPA 1X9MA 1RT2A 1UWBA 3NGYA 3JYTA 2D5RA 3P83D 4L8RB 3AO3A 2F8TA 3QETA 3NF7A 3WNGA 2XHBA 5CZ2A 4OKEA 4N47A 3CG7A 3CYMA 4DSKA 1ASVA 3OYFA 1EX4A 4CFAA 4JS5A 2G8IA 4IG3A 1KFSA 2YNGA 4RG8A 3TABA 1X9WA 4I2PA 2P51A 4E1MA 4CJQA 3TWHA 2G8VA 3VQ6A 4FXDA 1RT5A 1Z25A 4DMNA 1LV5A 1NOYA 1TGOA 1FXXA 4FW1A 3VQ9A 3RMBA 1T03A 1TK8A 1BIUA 3AVLA 1RTHA 4YNQA 3P5JA 1KLMA 4FJ7A 3LP1A 4I9QA 3VQ4A 4CJVA 1EETA 3SV4A 2WONA 2QK9A 5CYMA 1GOAA 1Q9XA 3WNFA 3RMAA 4FW2A 2DFFA 1JLEA 3DMJA 3OYHA 5EU7A 4DU3A 1CLQA 4W5NA 1C6VA 2IGIA 1KRPA 3SUPA 4B9TA 4AILC 3TAQA 5CYQA 1WSJA 5I3UA 3FFIA 4CHOA 4KB1A 1BHLA 3OYNA 2VWKA 1U49A 1RTJA 2R7YA 4F3TA 1RT4A 4AHTA 3NH2A 3KLFA 3RMDA 1LWFA 1DLOA 1BCMA 3L2UA 3TR8A 1IKVA 1BI4A 3VQAA 5HRRA 3V1RA 2HHWA 4CFBA 4CK1A 4CECA 4CGFA 1RT6A 1VSIA 1ZBHA 4B08A 3LDSA 3K58A 4FM0A 3VQ5A 1KVBA 2DFHA 4CFDA 1WSHA 3ZSRA 3ISNC 4F3OA 4BWJA 3K5MA 4KO0A 2GUIA 1WSEA 4CEDA 4CJSA 3AVKA 1XHZA 3G0ZA 2A1SA 4IFYA 2YKMA 4E19A 4HHTA 3AA2A 2OZSA 4JRQA 1RTIA 4Z4CA 1C1CA 2B5JA 4MQ3A 4M45A 1ZYQA 4PQUA 4B3OA 4UQGA 1HYSA 4TSXA 1FK9A 1X9SA 4CHQA 4RW9A 1BCOA 3DLKA 3RTVA 1U04A 3ZCMA 4DSJA 3AA5X 1YTUA 2FBTA 2Z1JA 4M3RA 1CXUA 1SKRA 3DLBA 4EZ9A 1QSSA 3KK3A 4FJ8A 3O4NA 4CJLA 3WNHA 4HTUA 3KLIA 1FKPA 3K2PA 2KFNA 3OS1A 3K59A 4DTMA 4J2DA 1S9GA 3O3HA 4FLWA 4W5RA 3PO5A 1J9AA 5C42A 3S3MA 4LY7A 3SQ1A 3PX4A 3OYEA 3NHGA 5C24A 4I7FA 2OPSA 4XIUA 3EZ5A 3ZT4A 3PX0A 3DLGA 1NJZA 1WLJA 2XO7A 3VQBA 5JS2A 3ZT3A 4E3SA 4KTWA 3QIPA 1EP4A 4CEZA 1QE1A 4GW6A 4AHUA 2Z1HA 4FCYA 3LP0A 3MXIA 4Q5VA 3NH0A 3QESA 4CERA 4LSNA 1TK0A 3AO5A 4M41A 1A5VA 4N5SA 5D3GA 4PWDA 4ICLA 4R5PA 1NK9A 4DQPA 4DS4A 3MEEA 3VQQA 4DS5A 3AVFA 3O3GA 3U6FA 1RT3A 1JXEA 3IS9A 3T1AA 4BACA 3PO4A 1S9EA 1SL2A 4CJKA 4DTNA 4FJXA 1HMVA 4RW6A 2HHQA 4H8KA 3HVRA 1C0UA 1KSPA 4CK2A 1TV6A 4CF8A 2P5GA 4M3UA 3OYAA 3AVMA 4KV8A 3F9KA 3ZSZA 4E1NA 1RBVA 2RF2A 1W9HA 4W5OA 2HVIA 1CXQA 2EHGA 2XY8A 3DRRA 1KLNA 4EZ6A 3L2WA 3NBPA 1RBUA 4KHUA 3LANA 4CIGA 3SZ2A 5KI6A 1QS4A 4EP5A 4OGEA 4CGIA 4N56A 3MAQA 2P5OA 4BDZA 1K6YA 1G15A 4E7KA 3S9HA 4JRPA 4H4MA 3KD5E 4O55A 3NCIA 2HHUA 4CIFA 2FBVA 4DFJA 3C94A 2HNDA 3M8SA 3MEDA 3QNOA 3OYCA 3QEPA 4FK2A 4DQSA 3QO9A 3ZSQA 5HROA 1NK6A 1IH7A 3DLEA 4HUGA 1DTTA 1RILA 4CF0A 4KTQA 4LD0A 4CJ4A 4KFBA 4I9LA 4CJRA 3RRHA 4CE9A 5CZ1A 4KHNA 4E0DA 2ZD1A 1BIZA 1S1WA 2YKNA 4KHSA 2FBXA 3NF8A 1SL0A 4NCGA 1L3SA 4C8KA 1BGXT 1VSDA 4KTZA 3KJVA 4ELTA 4ID5A 5J2MA 4FZZA 1J53A 5T7BA 2HHTA 1BQMA 1JL2A 2XY7A 1VSEA 3NF6A 1ITGA 3AO4A 3TAFA 2G8WA 2OZMA 4DLEA 4DU4A 1EKEA 4E7LA 1S1TA 1YT3A 4OPKA 4DSEA 4BE1A 4KI6A 5JS1A 3NAEA 3DOLA 4PUOA 1Y97A 4M3YA 4O44A 4Y1DA 3VQPA 1HNIA 4OPJA 3OYDA 1N6QA 3AA4A 2HHSA 1WAFA 1VSHA 4CHYA 2F8SA 2D0AA 3IRXA 2ITGA 3NF9A 2FC0A 1LW0A 3OYMA 2O4IA 1BI4B 3LP3A 3SUNA 4CHPA 3QEIA 1NKEA 1NK0A 1RTDA 4FK4A 3MECA 3C6UA 4DF4A 4JLHA 4DTSA 3LWMA 3NFAA 3LAKA 4F2RA 1TL1A 2F96A 4M3XA 1TKTA 4E7JA 5FDLA 4O0IA 3TI0A 4FLTA 3CFRA 2EX3A 4IDKA 4CHZA 3PV8A 1LWEA 3HT3A 3OS2A 3LAMA 3BDPA 3DRSA 1HQUA 3TAEA 5HBMA 3ZT0A 1U47A 3AVCA 4O4GA 3AVHA 3DRPA 4DFMA 3HK2A 3NDKA 4MFBA 3AV9A 1UA1A 1D9FA 2DFEA 4KHQA 3VQEA 1TAUA 1LW2A 1WNSA 3O3FA 3L2QA 4DTUA 1L3TA 5HRNA 2BDPA 1XI1A 3MXJA 4N76A 3SQ2A 1TL3A 4FJ5A 2B6AA 3TAGA 2YNHA 2RKIA 3QERA 4B8AB 4HUFA 3V4IA 1EXQA 1X1PA 3AVBA 3OY9A 1BQNA 1L5UA 5KTQA 3ZSYA 1A5WA 3OYKA 3HVTA 3HYFA 4BE0A 1R0AA 2IDOA 1VK0A 4CK3A 3V81A 2HNZA 2Y1IA 4J2AA 4FJJA 4ZTJA 2B4JA 2WOMA 2KQ2A 3G10A 1NJXA 4KREA 2HVHA 1REVA 3HP9A 3L8BA 2KTQA 3RR7A 1GOCA 3DYAA 3SUOA 5FROA 4FZXC 1ASUA 4B8CA 4KHWA 4RW4A 2QXFA 1J5OA 2DY4A 1TKXA 3TAMA 1U4BA 1XHXA 3ZSWA 4FM1A 3PX6A 3NH1A 1NKCA 5HP1A 4GVMA 3THVA 3OJSA 4FJ9A 2E6LA 2KW4A 4NCBA 4BDYA 1NK5A 4IBNA 2RN2A 1RDDA 4DU1A 4DTXA 4ELUA 1UA0A 3SCXA 4JS4A 3E01A 4J2EA 1A5XA 1TK5A 1F21A 3OYJA 3K5LA 4B9MA 1IO2A 4DSIA 1ZBIA 3LZJA 3KKSA 2KZMA 1NK8A 4FJNA 3OYLA 3HPGA 3K5NA 3NGZA 1T8EA 2X6NA 1J54A 3V9XA 4CIEA 4DFKA 2OA8A 3V9ZA 2GBZA 1VSMA 4LH4A 1T7PA 1GOBA 5KRSA 4DTRA 1I39A 4QAGA 4AHCA 1BL3A 5E41A 1RNHA 2YHAA 4DTJA 4CGGA 1YVUA 4CEBA 1NK4A 1L3UA 2LSNA 4F8RA 3OVNA 4F4KA 4FK0A 3K57A 4CEAA 4K8ZA 4G1QA 3QNNA 3DI6A 4AHSA 3RRGA 1B9DA 1CZBA 1D9DA 4KAZA 4FJIA 1SUQA 1KVCA 2E6MA 1B9FA 3C6TA 4I2QA 3EYZA 3QINA 1WAJA 3WNEA 3I0RA 4NCAA 2ZQBA 3BGRA 3SPZA 1SKWA 2PYLA 4W5QA 2HHXA 3F73A 4Y1CA 3P1GA 1HQEA 3ZSVA 4B9VA 2OYQA 2HNYA 4AHRA 4FM2A 1RCHA 3VN5A 4ZHRA 3JSMA 1HJRA 4C8LA 4FJMA 1UOCA 1I3AA 3ASMA 4IG0A 3ZT1A 1S6PA 1UAXA 3HXMA 1TKDA 1WSGA 4DFPA 1D8YA 3HM9A 1Z26A 3LPUA 4FLZA 3V1OA 2JGUA 4NYNA 5KGWA 4FZYA 1O1WA 2OPRA 3U3YA 1L3VA 5HRSA 1QHTA 1HYZA 4OKKA 5DK5A 3VQCA 3B6PA 1RDBA 1S1XA 3C95A 2X6SA 3LALA 1W0HA 1KVAA 4DSFA 2JLEA 4CF1A 4B9SA 4J2BA 3RR8A 4B9LA 3L2RA 3QEVA 3LZIA 3L3VA 4CEQA 2Y1JA 4OJRA 2Q3SA 4CJTA 2W42A 3CFOA 3PY8A 2IC3A 4CJFA 3MXMA 2XY6A 1NK7A 2PY5A 4KPYA 4CEOA 2ETJA 2YV0X 4CEFA 1VSJA 4FLUA 3KKRA 1NKBA 2IOCA 4NYFA 1RT1A 4BDPA 3B6OA 4F2SA 4M3WA 1NJYA 3V6DA 1S6QA 5DMRA 4Z4EA 4WE1A 2VWJA 5J2NA 4DQRA 1S1UA 4FYDA 3T3FA 1CZ9A 1TKZA 2BANA 1ASWA 1S1VA 4CF2A 1IKYA 3QEWA 5HRPA 4OVLA 1IG9A 4IFVA 1JLFA 2P1JA 1HPZA 2VG7A 4B9NA 3SQ0A 4K8XA 4Z4FA 1VRTA 3KLGA 1KFDA 3L3UA 1DTQA 3I0SA 1TVRA 3HSTB 4BE2A 4OKJA 4C8OA 3KD1E 4HCBA 2HW3A 2AJQA 1HNVA 3DM2A 4ID1A 1LAVA 3LWLA 1SL1A 4O5BA 2X74A 4KHYA 1IKWA 3I8DA 5J2PA 3MEGA 1QSLA 4Q0BA 1VSLA 1WSFA 3KTQA 3TARA 5C25A 1Q8IA 2VG6A 2I5JA 4C8NA 2Z1GA 3V1QA 4CGHA 5SWMA 1NJWA 4CCHA 1JLQA 3SV3A 4M42A 4IKFA 3HO1A 1SKSA 5SZTA 2D0CA 4CGJA 3V9WA 5FRNA 2PYJA 4PY5A 2X78A 4DG1A 1FKOA 1QQCA 3HPOA 1U45A 4CF9A 5J1EA 2VG5A 5KGXA 1WN7A 4Z0UA 3OYIA 3KLHA 4CHNA 3LP2A 4DF8A 3SUQA 1T05A 1JXBA 5CY4A 4CGDA 1QSYA 3KLEA 3VQ7A 3AO2A 3TAPA 3ZSOA 3HL8A 4CJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBU A;  4CJ5 A;  1C0M A;  2QKK A;  3CM5 A;  1Q9Y A;  1N5Y A;  2QKB A;  4OLA A;  3V9U A;  2ZE2 A;  3AVG A;  3QIO A;  2D0B A;  2PZS A;  4DTO A;  3AVJ A;  1C0T A;  1JL1 A;  2FBY A;  3KK1 A;  3EY1 A;  2HMI A;  4CES A;  1LAW A;  3VA0 A;  4HVJ A;  4QCL A;  3OYG A;  3DLR A;  4OLB A;  3S3N A;  2Z1I A;  3A2F A;  3OYB A;  1RBR A;  3VQD A;  4OGC A;  3AVN A;  2OPQ A;  3CM6 A;  3SPY A;  4RW8 A;  4N41 A;  1U48 A;  4E89 A;  3HJF A;  3CQ8 A;  3NGI A;  1QTM A;  3OS0 A;  3HP6 A;  1JLB A;  2G8F A;  3M8P A;  4H4O A;  1D5A A;  1RDC A;  3OJU A;  3NE6 A;  4YFU A;  3IAY A;  4FJH A;  5J2Q A;  2IAJ A;  2YNF A;  4CJP A;  1WSI A;  2GV9 A;  3K5O A;  3QLH A;  1ZBL A;  1RT7 A;  2G8U A;  4HCC A;  4DSL A;  3SJJ A;  3M8R A;  4M3T A;  1LWC A;  4KI4 A;  4C8M A;  4CEE A;  1MU2 A;  3VQ8 A;  1B92 A;  4HUE A;  3SYZ A;  4FJG A;  1YTA A;  3T19 A;  4PA1 A;  3IG1 A;  4RW7 A;  4ZTF A;  2NUB A;  2ATQ A;  4E7I A;  1VSF A;  4B9U A;  1KTQ A;  2G8K A;  3AA3 A;  4AH9 A;  3M8Q A;  2RPI A;  1ZBF A;  2XRI A;  3DOK A;  4LSL A;  4W5T A;  2XY5 A;  4KB0 A;  3U3G A;  2YHB A;  3DLH A;  4E7H A;  3SNN A;  1RBS A;  3KIO A;  1VSK A;  4DTP A;  3L2V A;  3QEX A;  4CJ3 A;  2HB5 A;  1KCF A;  3LPT A;  3KK2 A;  3D45 A;  4QOZ B;  4Z4G A;  1JLA A;  3AVI A;  4FLY A;  1NOZ A;  3SQ4 A;  3ULD A;  1RBT A;  5I42 A;  3ZT2 A;  5HLF A;  4DQI A;  3ZSX A;  4Z4H A;  1RDA A;  4FLV A;  1IKX A;  1JLG A;  3RWU A;  3H08 A;  3O4Q A;  2YNI A;  4Z4I A;  4AHV A;  4FVM A;  4ELV A;  5KRT A;  4FJL A;  1HRH A;  3RMC A;  3S3O A;  4KRF A;  3AVA A;  4GMJ B;  2HHV A;  2DTU A;  3TAN A;  1HYV A;  2E4L A;  2O4G A;  3ITH A;  2BGG A;  1XWL A;  2IS3 A;  4CJE A;  3ALY A;  2KZZ A;  4BWM A;  1S5J A;  4CJW A;  1BIS A;  1JKH A;  2BE2 A;  3CFP A;  4DLG A;  4EP4 A;  4O0J A;  3V9S A;  5K14 A;  3SI6 A;  4DQQ A;  3HPH A;  4KKO A;  3UIQ A;  1TAQ A;  1JLC A;  4FLX A;  4FJK A;  4DWI A;  4M3Z A;  3D0P A;  4LH5 A;  3AO1 A;  2A1R A;  2KFZ A;  3PUF A;  1XC9 A;  2G8H A;  5FRM A;  1VRU A;  1C1A A;  4CFC A;  3VA3 A;  1SV5 A;  1C1B A;  2OPP A;  1X9M A;  1RT2 A;  1UWB A;  3NGY A;  3JYT A;  2D5R A;  3P83 D;  4L8R B;  3AO3 A;  2F8T A;  3QET A;  3NF7 A;  3WNG A;  2XHB A;  5CZ2 A;  4OKE A;  4N47 A;  3CG7 A;  3CYM A;  4DSK A;  1ASV A;  3OYF A;  1EX4 A;  4CFA A;  4JS5 A;  2G8I A;  4IG3 A;  1KFS A;  2YNG A;  4RG8 A;  3TAB A;  1X9W A;  4I2P A;  2P51 A;  4E1M A;  4CJQ A;  3TWH A;  2G8V A;  3VQ6 A;  4FXD A;  1RT5 A;  1Z25 A;  4DMN A;  1LV5 A;  1NOY A;  1TGO A;  1FXX A;  4FW1 A;  3VQ9 A;  3RMB A;  1T03 A;  1TK8 A;  1BIU A;  3AVL A;  1RTH A;  4YNQ A;  3P5J A;  1KLM A;  4FJ7 A;  3LP1 A;  4I9Q A;  3VQ4 A;  4CJV A;  1EET A;  3SV4 A;  2WON A;  2QK9 A;  5CYM A;  1GOA A;  1Q9X A;  3WNF A;  3RMA A;  4FW2 A;  2DFF A;  1JLE A;  3DMJ A;  3OYH A;  5EU7 A;  4DU3 A;  1CLQ A;  4W5N A;  1C6V A;  2IGI A;  1KRP A;  3SUP A;  4B9T A;  4AIL C;  3TAQ A;  5CYQ A;  1WSJ A;  5I3U A;  3FFI A;  4CHO A;  4KB1 A;  1BHL A;  3OYN A;  2VWK A;  1U49 A;  1RTJ A;  2R7Y A;  4F3T A;  1RT4 A;  4AHT A;  3NH2 A;  3KLF A;  3RMD A;  1LWF A;  1DLO A;  1BCM A;  3L2U A;  3TR8 A;  1IKV A;  1BI4 A;  3VQA A;  5HRR A;  3V1R A;  2HHW A;  4CFB A;  4CK1 A;  4CEC A;  4CGF A;  1RT6 A;  1VSI A;  1ZBH A;  4B08 A;  3LDS A;  3K58 A;  4FM0 A;  3VQ5 A;  1KVB A;  2DFH A;  4CFD A;  1WSH A;  3ZSR A;  3ISN C;  4F3O A;  4BWJ A;  3K5M A;  4KO0 A;  2GUI A;  1WSE A;  4CED A;  4CJS A;  3AVK A;  1XHZ A;  3G0Z A;  2A1S A;  4IFY A;  2YKM A;  4E19 A;  4HHT A;  3AA2 A;  2OZS A;  4JRQ A;  1RTI A;  4Z4C A;  1C1C A;  2B5J A;  4MQ3 A;  4M45 A;  1ZYQ A;  4PQU A;  4B3O A;  4UQG A;  1HYS A;  4TSX A;  1FK9 A;  1X9S A;  4CHQ A;  4RW9 A;  1BCO A;  3DLK A;  3RTV A;  1U04 A;  3ZCM A;  4DSJ A;  3AA5 X;  1YTU A;  2FBT A;  2Z1J A;  4M3R A;  1CXU A;  1SKR A;  3DLB A;  4EZ9 A;  1QSS A;  3KK3 A;  4FJ8 A;  3O4N A;  4CJL A;  3WNH A;  4HTU A;  3KLI A;  1FKP A;  3K2P A;  2KFN A;  3OS1 A;  3K59 A;  4DTM A;  4J2D A;  1S9G A;  3O3H A;  4FLW A;  4W5R A;  3PO5 A;  1J9A A;  5C42 A;  3S3M A;  4LY7 A;  3SQ1 A;  3PX4 A;  3OYE A;  3NHG A;  5C24 A;  4I7F A;  2OPS A;  4XIU A;  3EZ5 A;  3ZT4 A;  3PX0 A;  3DLG A;  1NJZ A;  1WLJ A;  2XO7 A;  3VQB A;  5JS2 A;  3ZT3 A;  4E3S A;  4KTW A;  3QIP A;  1EP4 A;  4CEZ A;  1QE1 A;  4GW6 A;  4AHU A;  2Z1H A;  4FCY A;  3LP0 A;  3MXI A;  4Q5V A;  3NH0 A;  3QES A;  4CER A;  4LSN A;  1TK0 A;  3AO5 A;  4M41 A;  1A5V A;  4N5S A;  5D3G A;  4PWD A;  4ICL A;  4R5P A;  1NK9 A;  4DQP A;  4DS4 A;  3MEE A;  3VQQ A;  4DS5 A;  3AVF A;  3O3G A;  3U6F A;  1RT3 A;  1JXE A;  3IS9 A;  3T1A A;  4BAC A;  3PO4 A;  1S9E A;  1SL2 A;  4CJK A;  4DTN A;  4FJX A;  1HMV A;  4RW6 A;  2HHQ A;  4H8K A;  3HVR A;  1C0U A;  1KSP A;  4CK2 A;  1TV6 A;  4CF8 A;  2P5G A;  4M3U A;  3OYA A;  3AVM A;  4KV8 A;  3F9K A;  3ZSZ A;  4E1N A;  1RBV A;  2RF2 A;  1W9H A;  4W5O A;  2HVI A;  1CXQ A;  2EHG A;  2XY8 A;  3DRR A;  1KLN A;  4EZ6 A;  3L2W A;  3NBP A;  1RBU A;  4KHU A;  3LAN A;  4CIG A;  3SZ2 A;  5KI6 A;  1QS4 A;  4EP5 A;  4OGE A;  4CGI A;  4N56 A;  3MAQ A;  2P5O A;  4BDZ A;  1K6Y A;  1G15 A;  4E7K A;  3S9H A;  4JRP A;  4H4M A;  3KD5 E;  4O55 A;  3NCI A;  2HHU A;  4CIF A;  2FBV A;  4DFJ A;  3C94 A;  2HND A;  3M8S A;  3MED A;  3QNO A;  3OYC A;  3QEP A;  4FK2 A;  4DQS A;  3QO9 A;  3ZSQ A;  5HRO A;  1NK6 A;  1IH7 A;  3DLE A;  4HUG A;  1DTT A;  1RIL A;  4CF0 A;  4KTQ A;  4LD0 A;  4CJ4 A;  4KFB A;  4I9L A;  4CJR A;  3RRH A;  4CE9 A;  5CZ1 A;  4KHN A;  4E0D A;  2ZD1 A;  1BIZ A;  1S1W A;  2YKN A;  4KHS A;  2FBX A;  3NF8 A;  1SL0 A;  4NCG A;  1L3S A;  4C8K A;  1BGX T;  1VSD A;  4KTZ A;  3KJV A;  4ELT A;  4ID5 A;  5J2M A;  4FZZ A;  1J53 A;  5T7B A;  2HHT A;  1BQM A;  1JL2 A;  2XY7 A;  1VSE A;  3NF6 A;  1ITG A;  3AO4 A;  3TAF A;  2G8W A;  2OZM A;  4DLE A;  4DU4 A;  1EKE A;  4E7L A;  1S1T A;  1YT3 A;  4OPK A;  4DSE A;  4BE1 A;  4KI6 A;  5JS1 A;  3NAE A;  3DOL A;  4PUO A;  1Y97 A;  4M3Y A;  4O44 A;  4Y1D A;  3VQP A;  1HNI A;  4OPJ A;  3OYD A;  1N6Q A;  3AA4 A;  2HHS A;  1WAF A;  1VSH A;  4CHY A;  2F8S A;  2D0A A;  3IRX A;  2ITG A;  3NF9 A;  2FC0 A;  1LW0 A;  3OYM A;  2O4I A;  1BI4 B;  3LP3 A;  3SUN A;  4CHP A;  3QEI A;  1NKE A;  1NK0 A;  1RTD A;  4FK4 A;  3MEC A;  3C6U A;  4DF4 A;  4JLH A;  4DTS A;  3LWM A;  3NFA A;  3LAK A;  4F2R A;  1TL1 A;  2F96 A;  4M3X A;  1TKT A;  4E7J A;  5FDL A;  4O0I A;  3TI0 A;  4FLT A;  3CFR A;  2EX3 A;  4IDK A;  4CHZ A;  3PV8 A;  1LWE A;  3HT3 A;  3OS2 A;  3LAM A;  3BDP A;  3DRS A;  1HQU A;  3TAE A;  5HBM A;  3ZT0 A;  1U47 A;  3AVC A;  4O4G A;  3AVH A;  3DRP A;  4DFM A;  3HK2 A;  3NDK A;  4MFB A;  3AV9 A;  1UA1 A;  1D9F A;  2DFE A;  4KHQ A;  3VQE A;  1TAU A;  1LW2 A;  1WNS A;  3O3F A;  3L2Q A;  4DTU A;  1L3T A;  5HRN A;  2BDP A;  1XI1 A;  3MXJ A;  4N76 A;  3SQ2 A;  1TL3 A;  4FJ5 A;  2B6A A;  3TAG A;  2YNH A;  2RKI A;  3QER A;  4B8A B;  4HUF A;  3V4I A;  1EXQ A;  1X1P A;  3AVB A;  3OY9 A;  1BQN A;  1L5U A;  5KTQ A;  3ZSY A;  1A5W A;  3OYK A;  3HVT A;  3HYF A;  4BE0 A;  1R0A A;  2IDO A;  1VK0 A;  4CK3 A;  3V81 A;  2HNZ A;  2Y1I A;  4J2A A;  4FJJ A;  4ZTJ A;  2B4J A;  2WOM A;  2KQ2 A;  3G10 A;  1NJX A;  4KRE A;  2HVH A;  1REV A;  3HP9 A;  3L8B A;  2KTQ A;  3RR7 A;  1GOC A;  3DYA A;  3SUO A;  5FRO A;  4FZX C;  1ASU A;  4B8C A;  4KHW A;  4RW4 A;  2QXF A;  1J5O A;  2DY4 A;  1TKX A;  3TAM A;  1U4B A;  1XHX A;  3ZSW A;  4FM1 A;  3PX6 A;  3NH1 A;  1NKC A;  5HP1 A;  4GVM A;  3THV A;  3OJS A;  4FJ9 A;  2E6L A;  2KW4 A;  4NCB A;  4BDY A;  1NK5 A;  4IBN A;  2RN2 A;  1RDD A;  4DU1 A;  4DTX A;  4ELU A;  1UA0 A;  3SCX A;  4JS4 A;  3E01 A;  4J2E A;  1A5X A;  1TK5 A;  1F21 A;  3OYJ A;  3K5L A;  4B9M A;  1IO2 A;  4DSI A;  1ZBI A;  3LZJ A;  3KKS A;  2KZM A;  1NK8 A;  4FJN A;  3OYL A;  3HPG A;  3K5N A;  3NGZ A;  1T8E A;  2X6N A;  1J54 A;  3V9X A;  4CIE A;  4DFK A;  2OA8 A;  3V9Z A;  2GBZ A;  1VSM A;  4LH4 A;  1T7P A;  1GOB A;  5KRS A;  4DTR A;  1I39 A;  4QAG A;  4AHC A;  1BL3 A;  5E41 A;  1RNH A;  2YHA A;  4DTJ A;  4CGG A;  1YVU A;  4CEB A;  1NK4 A;  1L3U A;  2LSN A;  4F8R A;  3OVN A;  4F4K A;  4FK0 A;  3K57 A;  4CEA A;  4K8Z A;  4G1Q A;  3QNN A;  3DI6 A;  4AHS A;  3RRG A;  1B9D A;  1CZB A;  1D9D A;  4KAZ A;  4FJI A;  1SUQ A;  1KVC A;  2E6M A;  1B9F A;  3C6T A;  4I2Q A;  3EYZ A;  3QIN A;  1WAJ A;  3WNE A;  3I0R A;  4NCA A;  2ZQB A;  3BGR A;  3SPZ A;  1SKW A;  2PYL A;  4W5Q A;  2HHX A;  3F73 A;  4Y1C A;  3P1G A;  1HQE A;  3ZSV A;  4B9V A;  2OYQ A;  2HNY A;  4AHR A;  4FM2 A;  1RCH A;  3VN5 A;  4ZHR A;  3JSM A;  1HJR A;  4C8L A;  4FJM A;  1UOC A;  1I3A A;  3ASM A;  4IG0 A;  3ZT1 A;  1S6P A;  1UAX A;  3HXM A;  1TKD A;  1WSG A;  4DFP A;  1D8Y A;  3HM9 A;  1Z26 A;  3LPU A;  4FLZ A;  3V1O A;  2JGU A;  4NYN A;  5KGW A;  4FZY A;  1O1W A;  2OPR A;  3U3Y A;  1L3V A;  5HRS A;  1QHT A;  1HYZ A;  4OKK A;  5DK5 A;  3VQC A;  3B6P A;  1RDB A;  1S1X A;  3C95 A;  2X6S A;  3LAL A;  1W0H A;  1KVA A;  4DSF A;  2JLE A;  4CF1 A;  4B9S A;  4J2B A;  3RR8 A;  4B9L A;  3L2R A;  3QEV A;  3LZI A;  3L3V A;  4CEQ A;  2Y1J A;  4OJR A;  2Q3S A;  4CJT A;  2W42 A;  3CFO A;  3PY8 A;  2IC3 A;  4CJF A;  3MXM A;  2XY6 A;  1NK7 A;  2PY5 A;  4KPY A;  4CEO A;  2ETJ A;  2YV0 X;  4CEF A;  1VSJ A;  4FLU A;  3KKR A;  1NKB A;  2IOC A;  4NYF A;  1RT1 A;  4BDP A;  3B6O A;  4F2S A;  4M3W A;  1NJY A;  3V6D A;  1S6Q A;  5DMR A;  4Z4E A;  4WE1 A;  2VWJ A;  5J2N A;  4DQR A;  1S1U A;  4FYD A;  3T3F A;  1CZ9 A;  1TKZ A;  2BAN A;  1ASW A;  1S1V A;  4CF2 A;  1IKY A;  3QEW A;  5HRP A;  4OVL A;  1IG9 A;  4IFV A;  1JLF A;  2P1J A;  1HPZ A;  2VG7 A;  4B9N A;  3SQ0 A;  4K8X A;  4Z4F A;  1VRT A;  3KLG A;  1KFD A;  3L3U A;  1DTQ A;  3I0S A;  1TVR A;  3HST B;  4BE2 A;  4OKJ A;  4C8O A;  3KD1 E;  4HCB A;  2HW3 A;  2AJQ A;  1HNV A;  3DM2 A;  4ID1 A;  1LAV A;  3LWL A;  1SL1 A;  4O5B A;  2X74 A;  4KHY A;  1IKW A;  3I8D A;  5J2P A;  3MEG A;  1QSL A;  4Q0B A;  1VSL A;  1WSF A;  3KTQ A;  3TAR A;  5C25 A;  1Q8I A;  2VG6 A;  2I5J A;  4C8N A;  2Z1G A;  3V1Q A;  4CGH A;  5SWM A;  1NJW A;  4CCH A;  1JLQ A;  3SV3 A;  4M42 A;  4IKF A;  3HO1 A;  1SKS A;  5SZT A;  2D0C A;  4CGJ A;  3V9W A;  5FRN A;  2PYJ A;  4PY5 A;  2X78 A;  4DG1 A;  1FKO A;  1QQC A;  3HPO A;  1U45 A;  4CF9 A;  5J1E A;  2VG5 A;  5KGX A;  1WN7 A;  4Z0U A;  3OYI A;  3KLH A;  4CHN A;  3LP2 A;  4DF8 A;  3SUQ A;  1T05 A;  1JXB A;  5CY4 A;  4CGD A;  1QSY A;  3KLE A;  3VQ7 A;  3AO2 A;  3TAP A;  3ZSO A;  3HL8 A;  4CJU A; 
#chains in the Genus database with same CATH topology
 3SBG A;  1NU0 A;  2QKK A;  1N5Y A;  3R9P A;  5M1Q A;  2ZE2 A;  2Q2R A;  2PZS A;  2O8C A;  2FSK A;  1C0T A;  3HZ6 A;  3I55 N;  2FBY A;  3KK1 A;  3EY1 A;  4WFB L;  3DXM B;  2ZM6 K;  2VQE K;  4HVJ A;  4QCL A;  3OYG A;  3DLR A;  3VQD A;  3CM6 A;  3SPY A;  4NO7 A;  3CQ8 A;  4AQY K;  3U4L A;  4H4O A;  1YHQ N;  3IAY A;  1RDC A;  4FJH A;  4KHP K;  3CQX A;  1ZBL A;  4GV6 A;  5A2Q O;  1RT7 A;  4DSL A;  4CEE A;  1MU2 A;  3T19 A;  3IG1 A;  4ZTF A;  5ADX H;  1VSF A;  3LM2 A;  4AH9 A;  3M1F A;  4JKH A;  4DV3 K;  5AQH A;  2QWM A;  3U3G A;  1RBS A;  2A40 A;  3KIO A;  3CPE A;  4CJ3 A;  3D45 A;  1JLA A;  4CZK A;  1NOZ A;  1RDA A;  3ATU A;  3C7N B;  1JLG A;  3O4Q A;  2YNI A;  4Z4I A;  4AHV A;  3CET A;  3CME N;  1HRH A;  1WBB A;  4KRF A;  2HHV A;  2DTU A;  3TAN A;  1E3M A;  2BGG A;  4K42 A;  2IS3 A;  3ALY A;  3THX A;  1S5J A;  4CJW A;  4CI6 A;  1Q82 O;  2NZT A;  4EP4 A;  4OO1 J;  4O0J A;  5K14 A;  3UIQ A;  4FLX A;  4FJK A;  3D0P A;  2A1R A;  5FRM A;  3H45 C;  1C1B A;  1Z05 A;  1N33 K;  3KWI A;  1X9M A;  1UWB A;  2Q97 A;  4BC3 A;  3QET A;  2OCE A;  2HF4 A;  2XHB A;  5CZ2 A;  4IZ9 A;  4CFA A;  5LL6 Z;  2E2P A;  4CJQ A;  2G8V A;  2O8E B;  3ZET A;  1Z25 A;  1KXP A;  3DLL L;  1LV5 A;  4FW1 A;  1MWM A;  1KLM A;  3LP1 A;  2W6L A;  3L4I A;  4IEE A;  1CLQ A;  2P9I A;  4FW2 A;  3RMA A;  3VES A;  4CZL A;  5EU7 A;  4W5N A;  1C6V A;  2YX6 A;  2E2N A;  4ILJ A;  3UE5 A;  2OTL N;  4AIL C;  1WSJ A;  1BHL A;  1OKJ A;  3Q7C A;  4F3T A;  4AHT A;  3NH2 A;  5AQJ A;  3KLF A;  3TR8 A;  4CD1 A;  3CCQ N;  3V1R A;  1BU6 O;  4MDB A;  5KPZ A;  1QZ6 A;  3BZK A;  1TYQ A;  4KH5 A;  4YOW A;  3VQ5 A;  1WB9 A;  3TTD A;  1KVB A;  1U2V A;  4FWM A;  3ISN C;  4FWR A;  4BWJ A;  4CED A;  1WSE A;  4CJS A;  4IWV A;  2A1S A;  4IFY A;  4HHT A;  3AA2 A;  4YOV A;  4FL9 A;  4JKA A;  4Z4C A;  4BRH A;  1LCU A;  4FWP A;  4MQ3 A;  1HYS A;  4TSX A;  1X9S A;  4RW9 A;  1BCO A;  1U04 A;  1BA0 A;  1SKR A;  1CXU A;  1QSS A;  4JHD A;  3R3L A;  4CJL A;  4H0O A;  3KLI A;  2GEM A;  3K2P A;  4QS7 A;  3EE8 A;  3O3H A;  4FLW A;  2KLA A;  1ZXO A;  3OYE A;  4XIU A;  4I7F A;  1WLJ A;  3LDP A;  5JS2 A;  1T3V A;  4KTW A;  3QIP A;  2NRV A;  5I9E B;  1W2B M;  4FCY A;  4Q5V A;  3NH0 A;  3QES A;  5KPT A;  1TK0 A;  3CC2 N;  1KAZ A;  3MMV A;  4GY2 B;  4IDH A;  3VQQ A;  5AQF A;  1JXE A;  4BAC A;  4CJK A;  2P9K B;  3CC7 N;  4CK2 A;  4M3U A;  3G71 N;  4W5O A;  4E1N A;  3LDO A;  2HF3 A;  4KHU A;  3LAN A;  3SZ2 A;  1QS4 A;  4EP5 A;  4OGE A;  1SAZ A;  2QW9 A;  4N56 A;  3LM9 A;  4NXM K;  4QS9 A;  1NMD A;  4H4M A;  3ULE A;  3NCI A;  1QZ5 A;  4E1J A;  3EKU A;  2HND A;  4DV5 K;  3QEP A;  4BGA A;  3QNO A;  3OYC A;  3SK3 A;  4MO5 A;  5HRO A;  3CIP A;  4A2A A;  4KTQ A;  4LD0 A;  4KFB A;  4FWS A;  4E0D A;  3BUZ B;  3ZX2 A;  4BRP A;  1SL0 A;  3D6R A;  1N36 K;  3KJV A;  3DWL A;  4ID5 A;  3CF5 L;  4XEI A;  1BQM A;  1JL2 A;  1ITG A;  2HHH K;  2QWO A;  4DLE A;  4AM6 A;  4DU4 A;  1OH8 A;  3QFP A;  1YT3 A;  3T1Y K;  4O44 A;  4Y1D A;  1KD1 O;  4IFE A;  4OPJ A;  3CCS N;  2P9U A;  4WFN L;  1BDG A;  1WUA A;  4JK8 A;  1LW0 A;  2O4I A;  3SUN A;  4CHP A;  1YIJ N;  1P90 A;  4FK4 A;  4FOE A;  4DTS A;  3WQT A;  4FWO A;  3ZLJ A;  5AQK A;  3O8M A;  4IDK A;  3HT3 A;  4ILG B;  3OS2 A;  4BRD A;  3BDP A;  1EWR A;  2NRX A;  3ZT0 A;  3NDK A;  3AV9 A;  1UA1 A;  2DFE A;  3VF2 A;  3VQE A;  2IVP A;  3TTC A;  1WNS A;  3L2Q A;  4DTU A;  1TAU A;  4JV5 K;  3MXJ A;  2E2O A;  3SQ2 A;  2UXB K;  3DXK A;  1YJ9 N;  4FVU A;  3TAG A;  4BY9 C;  4BG8 A;  4B1Z A;  3QER A;  4HUF A;  3V4I A;  4A57 A;  4JI1 K;  1L5U A;  2QA4 N;  3OYK A;  3TTF A;  3V81 A;  4J2A A;  4FJJ A;  2B4J A;  3O80 A;  2ZWH A;  5FRO A;  1ASU A;  2WC9 A;  4KHW A;  2HBL A;  5BRE A;  1GLE G;  1XHX A;  5AFU H;  3NH1 A;  3PIO L;  5HP1 A;  4IO9 L;  1MA9 B;  4FJ9 A;  4H5N A;  4B1W B;  4BDY A;  3SCX A;  3E01 A;  5DM6 L;  4B9M A;  1IO2 A;  5JVG L;  4ISF A;  3LDQ A;  1T8E A;  4CIE A;  4M7Y A;  4CZJ A;  2V7Y A;  4LH4 A;  4A2B A;  4JN4 A;  2RE2 A;  4QAG A;  3QBX A;  3W0L A;  4AHC A;  1RNH A;  2YHA A;  1YVU A;  1NK4 A;  3OVN A;  3K57 A;  3PIP L;  4B3S K;  1VHX A;  3THY A;  3KZB A;  1CZB A;  4B1V A;  3U9Z A;  4I2Q A;  1B9F A;  4B9Q A;  1J6Z A;  3BGR A;  3EEQ A;  3MDQ A;  4BR7 A;  4Y1C A;  3T69 A;  4YY3 K;  2D0O A;  1HKC A;  2NRZ A;  5E26 A;  2OAN A;  4FM2 A;  2JWL A;  1XNQ K;  3VN5 A;  4XH1 A;  1UOC A;  1I3A A;  3ASM A;  3P31 A;  4M63 C;  4DFP A;  1SZ2 A;  4K41 A;  4NYN A;  5KGW A;  1O1W A;  1OH6 A;  1L3V A;  1HLU A;  1P8Z A;  1GLJ O;  3ZX3 A;  4DSF A;  1KVA A;  4J2B A;  4WQ5 C;  3QEV A;  3LZI A;  4OJR A;  4PL7 A;  2O8B B;  4CJT A;  2NLX A;  2W42 A;  4CJF A;  3MXM A;  2XY6 A;  4B3T K;  1NBW A;  3C6A A;  3FR0 A;  4FLU A;  4YOX A;  4EHT A;  1VQ6 N;  2FF6 A;  2HST A;  2IOC A;  1RT1 A;  3VOV A;  1NG9 A;  1S6Q A;  3GL1 A;  4Z4E A;  4FWQ A;  5J2N A;  3O9S A;  1CZ9 A;  4C1N I;  1ASW A;  3WXI A;  3QEW A;  5HRP A;  5AQS A;  1IG9 A;  1JLF A;  2P1J A;  3CMA N;  4B9N A;  1TVR A;  3HST B;  4BE2 A;  2AJQ A;  2NRH A;  3KD1 E;  1VQ7 N;  3DM2 A;  4ID1 A;  2QM1 A;  5AQR A;  1SL1 A;  4KHY A;  2X74 A;  2I7N A;  3MEG A;  1YIT N;  1RGI A;  4JKD A;  4Q0B A;  3KTQ A;  1Q8I A;  1E4F T;  1HNW K;  4CGH A;  2GUP A;  5SWM A;  1JLQ A;  3SV3 A;  3QIC A;  3QB0 A;  5SZT A;  3VF4 A;  3VER A;  3M5R A;  2X78 A;  4DG1 A;  4NXN K;  3CJB A;  2VG5 A;  4PKH A;  2BTF A;  5J1E A;  3OYI A;  1T05 A;  3GBT A;  1QSY A;  3KLE A;  1N32 K;  1JCF A;  3AO2 A;  5B8H A;  1KQS M;  2ASP A;  1ZBU A;  3SAH A;  4BRE A;  4KH4 A;  2Q0R A;  4OLA A;  3V9U A;  2E20 A;  2ZJQ L;  3SAF A;  3AVJ A;  2QI2 A;  4MO4 A;  2PBD A;  3VA0 A;  5TKY A;  5HL7 L;  4K0K K;  3A2F A;  2OPQ A;  3HJF A;  5GAG P;  1NGE A;  1QTM A;  1JLB A;  3OJU A;  1D5A A;  4CBW A;  1NMN A;  1EQY A;  4CJP A;  2GV9 A;  3K5O A;  5AQO A;  4M3T A;  4JI8 K;  5FPD A;  4E7I A;  5AQW A;  3F2K A;  2A42 A;  4W5T A;  3M8Q A;  3DOK A;  5LJV A;  5IT9 O;  3MCP A;  1VSK A;  4LF8 K;  3EE9 A;  4QOZ B;  4DQI A;  4JI6 K;  3R6M A;  3RWU A;  1IKX A;  3H08 A;  4FVM A;  4BVO A;  5KRT A;  4FJL A;  2P9L B;  4JAX A;  3SAG A;  3S41 A;  4A5A A;  1KAY A;  2KZZ A;  4BWM A;  3BEX A;  1BIS A;  3CFP A;  1VQK N;  4IXC A;  1YJW N;  3V9S A;  3FZM A;  3HPH A;  1QVF M;  1TAQ A;  3G25 A;  4H0V B;  4DWI A;  3PUF A;  1GLB G;  2G8H A;  1VRU A;  1C1A A;  4CFC A;  1SV5 A;  5IWA K;  4JI3 K;  5AR0 A;  4MLE A;  3JYT A;  4L8R B;  1EO1 A;  3AO3 A;  3NF7 A;  3H46 O;  4N47 A;  3CG7 A;  1ATN A;  3OYF A;  1IBM K;  1EX4 A;  4JS5 A;  4DR1 K;  2YNG A;  4RG8 A;  3TAB A;  4FO0 A;  3A5L C;  4DV7 K;  1NOY A;  3VQ9 A;  1BIU A;  1RTH A;  4YNQ A;  3O9U A;  3VQ4 A;  4CJV A;  3SV4 A;  2QK9 A;  5F2R A;  2VYP A;  5CYM A;  1HX1 A;  3QFU A;  1JLE A;  4DU3 A;  1T6C A;  4B9T A;  4CZE A;  3NMU A;  5I3U A;  3MWP A;  4KB1 A;  2O8F A;  1U49 A;  1U2V B;  4FWK A;  3CCM N;  2E8A A;  1RT4 A;  3E1Y A;  3RMD A;  1LWF A;  2VGM A;  3AAR A;  1BCM A;  4BRA A;  1IKV A;  1BI4 A;  3VQA A;  3HSC A;  2UUC K;  5HRR A;  3ID8 A;  3QBW A;  3TPQ A;  4CFB A;  4FPA A;  3IDH A;  4CGF A;  1ZBH A;  1VSI A;  3K58 A;  3D2F A;  4FM0 A;  4CZH A;  3H3N O;  2DFH A;  4CFD A;  1WSH A;  2ITM A;  3CPW M;  1NGH A;  4JHD B;  3AVK A;  4DUZ K;  2OZS A;  1RTI A;  1Y64 A;  1C1C A;  1ZYQ A;  4UQG A;  2P9N B;  1IBL K;  3GG4 A;  1Q18 A;  3C0B A;  3KK3 A;  4FJ8 A;  3O4N A;  1XQS C;  3OS1 A;  1W7A A;  1N34 K;  4J2D A;  5AQY A;  5M1N A;  1VQ8 N;  3PO5 A;  2QEX N;  4EIA A;  5C42 A;  3SQ1 A;  3EZ5 A;  3WXM B;  1ATR A;  1S3X A;  4QS8 A;  4E3S A;  5AQL A;  4GW6 A;  2W40 A;  3LP0 A;  2UUA K;  1QQM A;  1A5V A;  4N5S A;  3D2E A;  4PWD A;  4ICL A;  3SBT A;  1NK9 A;  4DS5 A;  3MEE A;  3U6F A;  4DTN A;  4JKG A;  2HHQ A;  1HMV A;  3UKR B;  4DV0 K;  4H8K A;  2P5G A;  1KSP A;  5FPE A;  3ENH A;  1TUU A;  3AVM A;  3ZSZ A;  2RF2 A;  1IBK K;  2EHG A;  2XY8 A;  3NBP A;  2A3Z A;  2UYT A;  4DHY A;  3WEE A;  3MAQ A;  2P5O A;  1OH5 A;  1K6Y A;  3S9H A;  5C12 A;  3KD5 E;  4LF7 K;  4CIF A;  3Q7B A;  4DB3 A;  4DFJ A;  3C94 A;  4DQ8 A;  5BPM A;  1CZA N;  3MED A;  4FK2 A;  4DV4 K;  5AZJ B;  4DQS A;  3QO9 A;  3ZSQ A;  1NK6 A;  1IH7 A;  1DTT A;  4CJR A;  3RRH A;  4AF1 A;  1XNR K;  1IG8 A;  4I6M B;  4CE9 A;  3K0S A;  3E9P A;  3LL3 A;  1BIZ A;  1S1W A;  5AZI B;  2FBX A;  3HBT A;  4NCG A;  4DV2 K;  1VQL N;  4B1Y B;  5J2M A;  2VWB A;  4FZZ A;  5T7B A;  2GTD A;  1VSE A;  2G8W A;  3OHR A;  1ESV A;  1GLC G;  4E7L A;  4OPK A;  4BE1 A;  4Z94 A;  3ZEU A;  1Y97 A;  4PUO A;  3VQP A;  4J8F A;  3OYD A;  1VSH A;  2F8S A;  2D0A A;  3NF9 A;  3OYM A;  3PSF A;  3VEO A;  1K8K A;  3LP3 A;  5LMN K;  3QEI A;  4JD2 B;  4JLH A;  4BC4 A;  3LAK A;  3KHY A;  4JI2 K;  5BN8 A;  4CHZ A;  1QQO A;  2YCH A;  3LAM A;  3DRS A;  5HBM A;  3DRP A;  1BA1 A;  4MFB A;  5JIC A;  4KHQ A;  4JKB A;  3O3F A;  2BDP A;  1XI1 A;  1K9M O;  1TL3 A;  1GLL O;  2ZF5 O;  4H5V A;  4GV3 A;  4WQ5 A;  3A8Y A;  5KTQ A;  3UKU B;  1MWK A;  3HVT A;  3HYF A;  4OX9 K;  3J81 O;  4KRE A;  2HVH A;  3I56 N;  1REV A;  3L8B A;  1BOT O;  3SUO A;  2ZJP L;  3RSE A;  4FZX C;  1J5O A;  4FSV A;  4O5F A;  4B1U B;  1U4B A;  1NKC A;  3ZSW A;  4FM1 A;  3PX6 A;  5FLX O;  5AQV A;  2E6L A;  4NCB A;  3E66 A;  2RN2 A;  1RDD A;  2WFB A;  4ELU A;  3IUC A;  1UA0 A;  3K9K A;  1F21 A;  4BQZ A;  3THW B;  3KKS A;  4BGB A;  1JJ2 M;  3HPG A;  3W3D A;  4BR2 A;  3NGZ A;  3DXM A;  1BO5 O;  1T7P A;  4DTR A;  4DCH A;  5AQQ A;  1V4T A;  4CEB A;  4F8R A;  4OPA A;  4FK0 A;  4G1Q A;  3QNN A;  4AHS A;  3RRG A;  1B9D A;  4KAZ A;  1OVQ A;  3EYZ A;  1HNZ K;  3PLA A;  1HKG A;  1WAJ A;  3QIN A;  2Q1N A;  3I0R A;  4PL8 A;  4NCA A;  4BRF A;  2HHX A;  3F73 A;  1NGJ A;  3P1G A;  2FSN A;  1YF5 L;  2OYQ A;  2J4R A;  2P9P B;  3J80 O;  3JSM A;  2QKB A;  1HJR A;  1M1K O;  1D8Y A;  1TKD A;  1UAX A;  4BRN A;  4FLZ A;  2RHK A;  5DK5 A;  4DUY K;  1FJG K;  3C65 A;  3C7N A;  1S1X A;  3C95 A;  1ZC6 A;  3RR8 A;  3I33 A;  5BR9 A;  2IVN A;  2Y1J A;  3D7E O;  1X3N A;  5CR4 A;  4RWT A;  2IC3 A;  2GWJ A;  4KPY A;  4CEO A;  3A5M C;  4DR5 K;  1VSJ A;  4GKJ K;  4BDP A;  3B6O A;  1H1V A;  3NVK A;  5DMR A;  5BPN A;  2VWJ A;  4YOT A;  4FYD A;  3T7Z A;  1S1V A;  4CF2 A;  4IFV A;  2VG7 A;  4MDA A;  3FZH A;  4K8X A;  3CJ1 A;  3I0S A;  3H1Q A;  4CBU A;  4OKJ A;  2O8E A;  1LAV A;  1NJI O;  4Y0W A;  3I8D A;  5J2P A;  4B1X B;  1VSL A;  4C8N A;  4CCH A;  2GEL A;  3HO1 A;  1SKS A;  3L0Q A;  2D0C A;  2V52 B;  5FRN A;  2PYJ A;  3ID6 A;  1FKO A;  1QQC A;  2DPN A;  4CF9 A;  3KLH A;  4Z4G A;  1WN7 A;  3SUQ A;  4CHN A;  5AQU A;  5CY4 A;  1Q86 O;  5AQG A;  5GIP A;  3ZSO A;  2NRT A;  4CJU A;  4CJ5 A;  5AQT A;  3ZX0 A;  4JK7 A;  4H5W A;  4DR6 K;  3H3O B;  1JL1 A;  4CES A;  1LAW A;  1WBD A;  4KH6 A;  2W41 A;  4OLB A;  3S3N A;  4JI7 K;  2Z1I A;  1RBR A;  2FLO A;  4OGC A;  1NGC A;  4RW8 A;  3ENO A;  4WQ4 C;  2G8F A;  3M8P A;  2D0P A;  1HR0 K;  3L6Q A;  2IAJ A;  2YNF A;  1DEJ A;  2G8U A;  1U6Z A;  3M8R A;  1B92 A;  2WUS A;  4DV1 K;  1YTU A;  1YTA A;  4GKK K;  4PA1 A;  1GLD G;  2ATQ A;  4B9U A;  1KTQ A;  3JAM O;  2RPI A;  1ZBF A;  2XRI A;  2XY5 A;  4LSL A;  4F9O A;  4KB0 A;  2EWS A;  5AQM A;  3M6G A;  4E7H A;  3SNN A;  1RDW X;  3QEX A;  3TSP A;  2HB5 A;  1ATS A;  4FWL A;  4PHT X;  3AVI A;  1BWF O;  5I42 A;  5HLF A;  3ULD A;  1RBT A;  3ZT2 A;  4EHU A;  4FLV A;  3TSU A;  1DGK N;  3AAQ A;  3AGK A;  4L3Q A;  3RMC A;  3MCA B;  2ZGZ A;  5AQZ A;  4LF5 K;  2W6K A;  2E4L A;  3IMX A;  1QQN A;  4CZG A;  4CJE A;  2BE2 A;  4DLG A;  2P9K A;  3MN9 A;  4DQQ A;  4IO8 A;  1C0F A;  2KFZ A;  3J8A A;  4IJA A;  4LH5 A;  4M3Z A;  4V19 S;  1XC9 A;  3H6E A;  4DR3 K;  4H0P A;  1NLV A;  3WQU A;  5F0X A;  5JLF A;  3ENB A;  1RFQ A;  3CJ7 A;  4BRI A;  1VQO N;  4BR5 A;  4NLC A;  5HOO A;  3CYM A;  4DSK A;  1ASV A;  4JI4 K;  5AQN A;  3HM8 A;  4IG3 A;  1KFS A;  1LOT B;  1X9W A;  4I2P A;  3VF6 A;  3KVG A;  3TWH A;  1YI2 N;  3VQ6 A;  1RT5 A;  4PKG A;  1TGO A;  3RMB A;  1TK8 A;  4FWN A;  4FJ7 A;  1EET A;  2WON A;  4JYA K;  3OW2 M;  1W97 L;  3OYH A;  4IOX A;  3FE1 A;  2IGI A;  5DM7 L;  2P9S B;  3SUP A;  1NGB A;  3H1V X;  5CYQ A;  3TAQ A;  3FFI A;  4CHO A;  3AAP A;  3A0I X;  4IJN A;  5CE3 A;  5JMV A;  3L2U A;  3R1X A;  2O8C B;  2UUB K;  4O8U A;  3AGR A;  4CK1 A;  2E1Z A;  2VCP A;  4B08 A;  3LDS A;  4F3O A;  3K5M A;  4CW7 B;  4CZM A;  4KO0 A;  1QVG M;  5BRD A;  1XHZ A;  4U7B A;  4X62 K;  2AA4 A;  2YKM A;  4BRG A;  2B5J A;  4M45 A;  2WBN A;  4CHQ A;  2Q36 A;  3RTV A;  3ZCM A;  5C2F A;  3AA5 X;  2FBT A;  2Z1J A;  4EZ9 A;  1WOQ A;  4BVP A;  3P38 A;  4OPH A;  4HTU A;  1FKP A;  1HJO A;  2KFN A;  1S9G A;  2NRW A;  4W5R A;  4CJ7 A;  2ZGY A;  1M90 O;  5ADX A;  3NHG A;  5C24 A;  2OPS A;  3PX0 A;  1X3M A;  3VQB A;  1QE1 A;  4AHU A;  2Z1H A;  2Q0U A;  4LSN A;  4EAH D;  2YHY A;  3A5N C;  5D3G A;  4DQP A;  3TU5 A;  4CVN E;  3AVF A;  3O3G A;  3EZW A;  4YHH K;  3PO4 A;  3THX B;  1S9E A;  2WTU A;  3M3Z A;  4YDU C;  4A61 A;  3OYA A;  4KV8 A;  2QWL A;  1W9H A;  3DRR A;  1KLN A;  3L2W A;  4CIG A;  5KI6 A;  1MDU B;  4CGI A;  4BRC A;  5BR8 K;  4JRP A;  2CGL A;  3MN5 A;  4O55 A;  1XMO K;  2HHU A;  2FBV A;  2V51 B;  3AY9 A;  2QWN A;  4JK9 A;  4HUG A;  3ZET B;  1VAZ A;  4CJ4 A;  4I9L A;  5AQP A;  5CZ1 A;  2CGK A;  5EVZ A;  4KHN A;  2ZD1 A;  4KHS A;  4C8K A;  1VSD A;  3SLC A;  4ELT A;  1O13 A;  1XC3 A;  1J53 A;  2XY7 A;  2P9I B;  3AO4 A;  3TAF A;  1JCG A;  3MK6 A;  1D4X A;  3O1B A;  5JS1 A;  3DOL A;  4M3Y A;  1HNI A;  3AA4 A;  2HHS A;  4IEI A;  3IRX A;  2ITG A;  3CQY A;  4A5B A;  2FC0 A;  2BH1 A;  1RTD A;  1KC8 O;  3MEC A;  4DF4 A;  3LWM A;  3NFA A;  2YHW A;  4F2R A;  1TL1 A;  1TYQ B;  3CJ9 A;  2F96 A;  1XUP O;  4O0I A;  4ILH A;  4FLT A;  3PV8 A;  1LWE A;  3TSQ A;  3VEY A;  1U47 A;  3AVC A;  4O4G A;  3AVH A;  4FPB A;  5M1P A;  1LW2 A;  2GWK A;  1L3T A;  5HRN A;  3VGK A;  3MN6 A;  4N76 A;  4FJ5 A;  1N8R O;  4LFB K;  1VQ5 N;  1J5E K;  4B8A B;  2I7P A;  5BRF A;  2JWK A;  1X1P A;  3OY9 A;  1BQN A;  2F9T A;  3GOI A;  3CCJ N;  4BE0 A;  1VK0 A;  2Y1I A;  1NGD A;  2WOM A;  2KQ2 A;  1NJX A;  4R79 A;  2KTQ A;  3HP9 A;  3WXK A;  3FGU A;  3RR7 A;  4YOR A;  2UXC K;  4B8C A;  3GDQ A;  3O1W A;  3TAM A;  4GVM A;  3THV A;  3OJS A;  1K8A O;  1HPM A;  1YJN N;  5JLH A;  2E88 A;  1NK5 A;  4IBN A;  4DTX A;  4PKI A;  1FW6 A;  2HBK A;  1TK5 A;  3NVM A;  3OYJ A;  2Q31 A;  1ZBI A;  3BF1 A;  5F1X A;  3LZJ A;  2KZM A;  1HKB A;  3EKS A;  3K5N A;  3CJA A;  2X6N A;  1J54 A;  3V9X A;  2OA8 A;  3JS6 A;  3V9Z A;  2GBZ A;  4FOI A;  5ELZ A;  4K43 A;  3U9D A;  1YXQ A;  4DTJ A;  3T1H K;  1QHA A;  3ULE B;  4F4K A;  4BQL A;  4CEA A;  2KKZ A;  4G9Z A;  4FJI A;  5EXW A;  1KVC A;  2E6M A;  3C6T A;  3EN9 A;  3WNE A;  2ZQB A;  2PYL A;  5EX5 A;  2E1Y A;  1HQE A;  3ZSV A;  2BUP A;  2HNY A;  4AHR A;  4LFC K;  4ZHR A;  4FJM A;  1E4G T;  2GX9 A;  4IG0 A;  3ZT1 A;  3HXM A;  2O8D A;  5EOY A;  1WSG A;  2PAV A;  2YJE A;  2JGU A;  3BY5 A;  2OPR A;  3U3Y A;  1NGI A;  3SJH A;  5HRS A;  1QHT A;  1Q7Y O;  4OKK A;  3VQC A;  3B6P A;  1RDB A;  2NRR A;  2JLE A;  2P9L A;  2P9U B;  4B9L A;  4HWI A;  4CEQ A;  2Q3S A;  3HOS A;  4WQ4 A;  3PY8 A;  3OBW A;  4DR2 K;  2PFU A;  1NK7 A;  3VPZ A;  1NNE A;  5GAE P;  4CEF A;  3L4Q A;  2QWR A;  1K73 O;  1NKB A;  3CI5 A;  4NYF A;  4M3W A;  5AJ3 K;  3SMS A;  1VQN N;  4WE1 A;  5KQ8 A;  4DQR A;  4BRQ A;  1VQ4 N;  4CZI A;  3LDN A;  1T44 A;  2HOE A;  4WCE L;  1X9J A;  3G4S N;  3SQ0 A;  3DXK B;  3KLG A;  4HCB A;  1DTQ A;  4GNI A;  1HNV A;  4HTL A;  4LC9 B;  3LWL A;  2QTD A;  1QSL A;  2HBJ A;  3TAR A;  5C25 A;  1Q81 O;  2I5J A;  3EL2 A;  4JI0 K;  1TUY A;  1NJW A;  2KHO A;  4CGJ A;  4CBX A;  2D1K A;  3HPO A;  5LJW A;  4DV6 K;  5KGX A;  3LP2 A;  4DF8 A;  4CGD A;  3VQ7 A;  5GAD P;  3HL8 A;  1NK0 A;  3FZF A;  1C0M A;  3CM5 A;  1Q9Y A;  1R59 O;  5H1S Q;  3FLC O;  3AVG A;  5AFU A;  5FPN A;  3QIO A;  2D0B A;  2NNW A;  3MX2 A;  1VQ9 N;  4DTO A;  3HTV A;  5C0Y A;  3CCR N;  4YOY A;  3LDL A;  2F7T A;  4EFH A;  2HMI A;  2YHX A;  3OYB A;  3AVN A;  4N41 A;  1U48 A;  4E89 A;  3FZL A;  3NGI A;  3OS0 A;  3HP6 A;  4BC2 A;  3NE6 A;  3THY B;  4M7X A;  4YFU A;  5J2Q A;  1WSI A;  2P9N A;  3QLH A;  4HCC A;  3SJJ A;  1LWC A;  4IOC L;  4KI4 A;  4C8M A;  3SYZ A;  3VQ8 A;  4HUE A;  4FJG A;  3B8A X;  3IFR A;  4RW7 A;  2NUB A;  2OTJ N;  2ZJR L;  2G8K A;  2VQF K;  3AA3 A;  2F4V K;  1NGG A;  2F9W A;  2YHB A;  3DLH A;  2YJF A;  3L2V A;  3LPT A;  1KCF A;  3KK2 A;  3WXL A;  4AM7 A;  3VEW A;  4FLY A;  3SQ4 A;  3E9O A;  3ZSX A;  4Z4H A;  2QWP A;  4WFA L;  4ELV A;  5BN9 A;  3S3O A;  3VEZ A;  4BRL A;  1OH7 A;  3AVA A;  4GMJ B;  1YVN A;  3ZYY X;  3OA9 A;  1HYV A;  2O4G A;  3ITH A;  5CHI A;  1XWL A;  3CER A;  1C0G A;  3BZC A;  1JKH A;  3UKR A;  3SI6 A;  3OBY A;  4KKO A;  1JLC A;  3UB5 A;  3AO1 A;  3VA3 A;  5E84 A;  4JKF A;  4JKC A;  2OPP A;  3CCE N;  3CHW A;  1RT2 A;  3NGY A;  2F8T A;  2D5R A;  3P83 D;  4UY8 O;  3WNG A;  4BR0 A;  4OKE A;  1YUW A;  2G8I A;  4H0T B;  5AZJ A;  5BPL A;  2P51 A;  1NGF A;  4E1M A;  4FXD A;  3CXC M;  4DMN A;  3JXU A;  4I6M A;  4H0Y B;  1FXX A;  1T03 A;  3AVL A;  3P5J A;  2A5X A;  4I9Q A;  5GAH P;  5AZI A;  1VQP N;  5GIN A;  4YDU A;  1GOA A;  1Q9X A;  3WNF A;  2DFF A;  3DMJ A;  3HRG A;  5JVH L;  4RTF D;  1KRP A;  3WUH A;  3OYN A;  2VWK A;  1RTJ A;  2R7Y A;  4JEP A;  1DLO A;  4X65 K;  3QML A;  4JD2 A;  2HHW A;  1S72 N;  3VET A;  4CEC A;  1RT6 A;  2YI1 A;  3O4W A;  3DJC A;  3VMF B;  4LF6 K;  3FZK A;  3ZSR A;  2H3G X;  2GUI A;  3G0Z A;  3J7Z O;  4E19 A;  4BRK A;  1ILY A;  4JRQ A;  3F9M A;  4PQU A;  4ISE A;  4B3O A;  1FK9 A;  4A59 A;  3F5T A;  3DLK A;  4DSJ A;  4M3R A;  1VQM N;  3DLB A;  3SMP A;  4RCH A;  4YOU A;  3BF3 A;  3O9Q A;  3WNH A;  3I8B A;  3K59 A;  4DTM A;  1NM1 A;  4WF9 L;  3CCL N;  1YAG A;  3UKU A;  1GLF O;  1J9A A;  2CGJ A;  3S3M A;  4LY7 A;  3PX4 A;  4A62 A;  1NJZ A;  3ZT4 A;  3DLG A;  2XO7 A;  3ZT3 A;  1EP4 A;  3RVC A;  4CEZ A;  3MXI A;  5C2D A;  2FF3 B;  4CER A;  4JNE A;  3AO5 A;  4M41 A;  3R8E A;  1XMQ K;  2E5L K;  4R5P A;  3CCU N;  4DS4 A;  5MLC Q;  1RT3 A;  3A5O C;  3IS9 A;  3T1A A;  1SL2 A;  4FJX A;  4JI5 K;  4RW6 A;  3HVR A;  1C0U A;  1TV6 A;  4CF8 A;  3U8X A;  3VEX A;  3THW A;  3F9K A;  1RBV A;  2HVI A;  1CXQ A;  1DKG D;  1KAX A;  4EZ6 A;  1RBU A;  4BC5 A;  3P39 A;  4NLB A;  5M1F A;  4BDZ A;  4LF4 K;  4E7K A;  1G15 A;  1G99 A;  4GV9 A;  3MN7 A;  3M8S A;  3DLE A;  1RIL A;  4CF0 A;  4BRM A;  1IJJ A;  5KPR A;  3MWT A;  2HMP A;  2P9P A;  2YKN A;  3NF8 A;  1L3S A;  5C10 A;  1BGX T;  4KTZ A;  3O6W A;  3HOT A;  2HHT A;  1OVY A;  2AP1 A;  3K9J A;  3NF6 A;  2OZM A;  1EKE A;  1S1T A;  4KI6 A;  4DSE A;  1BG3 A;  3BP8 A;  3NAE A;  5C15 A;  2UXD K;  4WYB A;  2CH5 A;  4BR4 A;  1N6Q A;  4O8K A;  2O8F B;  3WXJ A;  1WAF A;  4GVE A;  5TKW A;  4CHY A;  1I94 K;  3PSI A;  4X64 K;  2FSJ A;  1ZBS A;  4XH4 A;  1BI4 B;  1NKE A;  3O9R A;  3C6U A;  4LFA K;  2HBM A;  2V7Z A;  4M3X A;  1TKT A;  3D2F B;  4E7J A;  5FDL A;  3TI0 A;  3CFR A;  2EX3 A;  2ASM A;  4DR4 K;  1HQU A;  3TAE A;  3HK2 A;  3FFK B;  4DFM A;  1D9F A;  3J7Y P;  2IVO A;  2B6A A;  3ATV A;  4KBO A;  3EO3 A;  2E2Q A;  2YNH A;  2RKI A;  1EXQ A;  3AVB A;  3ZSY A;  1A5W A;  1BUP A;  5LY3 A;  1HUX A;  1R0A A;  2IDO A;  4CK3 A;  2HNZ A;  4IOA L;  5GIO A;  2VGN A;  3VGL A;  4C23 A;  4ZTJ A;  3G10 A;  4CZF A;  1GOC A;  3DYA A;  4X66 K;  1HNX K;  2IIR A;  4RW4 A;  2QXF A;  4BR9 A;  2A41 A;  2FXU A;  2DY4 A;  1TKX A;  3D2E B;  4XH5 A;  1Z6R A;  1V4S A;  5FPM A;  2A6A A;  4C1N K;  2KW4 A;  5AQX A;  4DU1 A;  4JKG B;  3VTH A;  4JS4 A;  4J2E A;  1A5X A;  3K5L A;  4K25 A;  4DSI A;  3VEN A;  3CC4 N;  1NK8 A;  4FJN A;  3OYL A;  3WT0 A;  4NB4 A;  3MX5 A;  1JCE A;  3WEE B;  4DFK A;  1IV0 A;  1VSM A;  3VEV A;  1GOB A;  5KRS A;  1I39 A;  1BL3 A;  5E41 A;  3N4P A;  3CCV N;  4CGG A;  1L3U A;  3J7A P;  2LSN A;  1SS6 A;  3CD6 N;  4K8Z A;  1NWK A;  2UU9 K;  2QXL A;  3DI6 A;  1D9D A;  2D4W A;  2O8D B;  3CJC A;  1SUQ A;  4H5T A;  1S22 A;  1SQK A;  3SPZ A;  1SKW A;  4W5Q A;  2CH6 A;  5AQI A;  3O5B A;  4B9V A;  4BRO A;  4H03 B;  5LMU K;  1RCH A;  1T6D A;  3KWG A;  4C8L A;  5KQD A;  3G6E N;  1S6P A;  4JKE A;  2ASO A;  3HM9 A;  1Z26 A;  3KK7 A;  2QWQ A;  3LPU A;  3V1O A;  4FZY A;  4DKW A;  1EWQ A;  3DAW A;  5M1O A;  3HI0 A;  1HYZ A;  4LF9 K;  3ZEU B;  2X6S A;  3O08 A;  3LAL A;  1W0H A;  4CF1 A;  4B9S A;  3L2R A;  4MLH A;  1GLA G;  3L3V A;  3QDK A;  5M1K A;  3CFO A;  1K8K B;  2PY5 A;  2ETJ A;  4H5R A;  2YV0 X;  3VGM A;  3KKR A;  4F2S A;  2O8B A;  4BG9 A;  1NJY A;  3V6D A;  4ISG A;  1DT9 A;  3N4Q A;  1S1U A;  3T3F A;  1TKZ A;  2BAN A;  3IKM A;  1IKY A;  5EY4 A;  1NGA A;  4OVL A;  1HPZ A;  4Z4F A;  1VRT A;  1KFD A;  3L3U A;  4C8O A;  2HW3 A;  3GE1 A;  4O5B A;  1IKW A;  3VTI A;  4CD3 A;  4U67 L;  5BRH A;  1WSF A;  2VG6 A;  3E9L A;  3O9T A;  3P4I A;  2Z1G A;  3V1Q A;  3OTO K;  4M42 A;  4IKF A;  1RDU A;  3V9W A;  4DR7 K;  4PY5 A;  3RSE B;  3C6H A;  1U45 A;  4Z0U A;  4B3M K;  4B3R K;  4H0X B;  1JXB A;  2P9S A;  4DTP A;  3TAP A; 
#chains in the Genus database with same CATH homology
 1ZBU A;  4CJ5 A;  1C0M A;  2QKK A;  3CM5 A;  1Q9Y A;  1N5Y A;  2QKB A;  4OLA A;  3V9U A;  2ZE2 A;  3AVG A;  3QIO A;  2D0B A;  2PZS A;  4DTO A;  3AVJ A;  1C0T A;  1JL1 A;  2FBY A;  3KK1 A;  3EY1 A;  2HMI A;  4CES A;  1LAW A;  3VA0 A;  4HVJ A;  4QCL A;  3OYG A;  3DLR A;  4OLB A;  3S3N A;  2Z1I A;  3A2F A;  3OYB A;  1RBR A;  3VQD A;  4OGC A;  3AVN A;  2OPQ A;  3CM6 A;  3SPY A;  4RW8 A;  4N41 A;  1U48 A;  4E89 A;  3HJF A;  3CQ8 A;  3NGI A;  1QTM A;  3OS0 A;  3HP6 A;  1JLB A;  2G8F A;  3M8P A;  4H4O A;  1D5A A;  1RDC A;  3OJU A;  3NE6 A;  4YFU A;  3IAY A;  4FJH A;  5J2Q A;  2IAJ A;  2YNF A;  4CJP A;  1WSI A;  2GV9 A;  3K5O A;  3QLH A;  1ZBL A;  1RT7 A;  2G8U A;  4HCC A;  4DSL A;  3SJJ A;  3M8R A;  4M3T A;  1LWC A;  4KI4 A;  4C8M A;  4CEE A;  1MU2 A;  3VQ8 A;  1B92 A;  4HUE A;  3SYZ A;  4FJG A;  1YTA A;  3T19 A;  4PA1 A;  3IG1 A;  4RW7 A;  4ZTF A;  2NUB A;  2ATQ A;  4E7I A;  1VSF A;  4B9U A;  1KTQ A;  2G8K A;  3AA3 A;  4AH9 A;  3M8Q A;  2RPI A;  1ZBF A;  2XRI A;  3DOK A;  4LSL A;  4W5T A;  2XY5 A;  4KB0 A;  3U3G A;  2YHB A;  3DLH A;  4E7H A;  3SNN A;  1RBS A;  3KIO A;  1VSK A;  4DTP A;  3L2V A;  3QEX A;  4CJ3 A;  2HB5 A;  1KCF A;  3LPT A;  3KK2 A;  3D45 A;  4QOZ B;  4Z4G A;  1JLA A;  3AVI A;  4FLY A;  1NOZ A;  3SQ4 A;  3ULD A;  1RBT A;  5I42 A;  3ZT2 A;  5HLF A;  4DQI A;  3ZSX A;  4Z4H A;  1RDA A;  4FLV A;  1IKX A;  1JLG A;  3RWU A;  3H08 A;  3O4Q A;  2YNI A;  4Z4I A;  4AHV A;  4FVM A;  4ELV A;  5KRT A;  4FJL A;  1HRH A;  3RMC A;  3S3O A;  4KRF A;  3AVA A;  4GMJ B;  2HHV A;  2DTU A;  3TAN A;  1HYV A;  2E4L A;  2O4G A;  3ITH A;  2BGG A;  1XWL A;  2IS3 A;  4CJE A;  3ALY A;  2KZZ A;  4BWM A;  1S5J A;  4CJW A;  1BIS A;  1JKH A;  2BE2 A;  3CFP A;  4DLG A;  4EP4 A;  4O0J A;  3V9S A;  5K14 A;  3SI6 A;  4DQQ A;  3HPH A;  4KKO A;  3UIQ A;  1TAQ A;  1JLC A;  4FLX A;  4FJK A;  4DWI A;  4M3Z A;  3D0P A;  4LH5 A;  3AO1 A;  2A1R A;  2KFZ A;  3PUF A;  1XC9 A;  2G8H A;  5FRM A;  1VRU A;  1C1A A;  4CFC A;  3VA3 A;  1SV5 A;  1C1B A;  2OPP A;  1X9M A;  1RT2 A;  1UWB A;  3NGY A;  3JYT A;  2D5R A;  3P83 D;  4L8R B;  3AO3 A;  2F8T A;  3QET A;  3NF7 A;  3WNG A;  2XHB A;  5CZ2 A;  4OKE A;  4N47 A;  3CG7 A;  3CYM A;  4DSK A;  1ASV A;  3OYF A;  1EX4 A;  4CFA A;  4JS5 A;  2G8I A;  4IG3 A;  1KFS A;  2YNG A;  4RG8 A;  3TAB A;  1X9W A;  4I2P A;  2P51 A;  4E1M A;  4CJQ A;  3TWH A;  2G8V A;  3VQ6 A;  4FXD A;  1RT5 A;  1Z25 A;  4DMN A;  1LV5 A;  1NOY A;  1TGO A;  1FXX A;  4FW1 A;  3VQ9 A;  3RMB A;  1T03 A;  1TK8 A;  1BIU A;  3AVL A;  1RTH A;  4YNQ A;  3P5J A;  1KLM A;  4FJ7 A;  3LP1 A;  4I9Q A;  3VQ4 A;  4CJV A;  1EET A;  3SV4 A;  2WON A;  2QK9 A;  5CYM A;  1GOA A;  1Q9X A;  3WNF A;  3RMA A;  4FW2 A;  2DFF A;  1JLE A;  3DMJ A;  3OYH A;  5EU7 A;  4DU3 A;  1CLQ A;  4W5N A;  1C6V A;  2IGI A;  1KRP A;  3SUP A;  4B9T A;  4AIL C;  3TAQ A;  5CYQ A;  1WSJ A;  5I3U A;  3FFI A;  4CHO A;  4KB1 A;  1BHL A;  3OYN A;  2VWK A;  1U49 A;  1RTJ A;  2R7Y A;  4F3T A;  1RT4 A;  4AHT A;  3NH2 A;  3KLF A;  3RMD A;  1LWF A;  1DLO A;  1BCM A;  3L2U A;  3TR8 A;  1IKV A;  1BI4 A;  3VQA A;  5HRR A;  3V1R A;  2HHW A;  4CFB A;  4CK1 A;  4CEC A;  4CGF A;  1RT6 A;  1VSI A;  1ZBH A;  4B08 A;  3LDS A;  3K58 A;  4FM0 A;  3VQ5 A;  1KVB A;  2DFH A;  4CFD A;  1WSH A;  3ZSR A;  3ISN C;  4F3O A;  4BWJ A;  3K5M A;  4KO0 A;  2GUI A;  1WSE A;  4CED A;  4CJS A;  3AVK A;  1XHZ A;  3G0Z A;  2A1S A;  4IFY A;  2YKM A;  4E19 A;  4HHT A;  3AA2 A;  2OZS A;  4JRQ A;  1RTI A;  4Z4C A;  1C1C A;  2B5J A;  4MQ3 A;  4M45 A;  1ZYQ A;  4PQU A;  4B3O A;  4UQG A;  1HYS A;  4TSX A;  1FK9 A;  1X9S A;  4CHQ A;  4RW9 A;  1BCO A;  3DLK A;  3RTV A;  1U04 A;  3ZCM A;  4DSJ A;  3AA5 X;  1YTU A;  2FBT A;  2Z1J A;  4M3R A;  1CXU A;  1SKR A;  3DLB A;  4EZ9 A;  1QSS A;  3KK3 A;  4FJ8 A;  3O4N A;  4CJL A;  3WNH A;  4HTU A;  3KLI A;  1FKP A;  3K2P A;  2KFN A;  3OS1 A;  3K59 A;  4DTM A;  4J2D A;  1S9G A;  3O3H A;  4FLW A;  4W5R A;  3PO5 A;  1J9A A;  5C42 A;  3S3M A;  4LY7 A;  3SQ1 A;  3PX4 A;  3OYE A;  3NHG A;  5C24 A;  4I7F A;  2OPS A;  4XIU A;  3EZ5 A;  3ZT4 A;  3PX0 A;  3DLG A;  1NJZ A;  1WLJ A;  2XO7 A;  3VQB A;  5JS2 A;  3ZT3 A;  4E3S A;  4KTW A;  3QIP A;  1EP4 A;  4CEZ A;  1QE1 A;  4GW6 A;  4AHU A;  2Z1H A;  4FCY A;  3LP0 A;  3MXI A;  4Q5V A;  3NH0 A;  3QES A;  4CER A;  4LSN A;  1TK0 A;  3AO5 A;  4M41 A;  1A5V A;  4N5S A;  5D3G A;  4PWD A;  4ICL A;  4R5P A;  1NK9 A;  4DQP A;  4DS4 A;  3MEE A;  3VQQ A;  4DS5 A;  3AVF A;  3O3G A;  3U6F A;  1RT3 A;  1JXE A;  3IS9 A;  3T1A A;  4BAC A;  3PO4 A;  1S9E A;  1SL2 A;  4CJK A;  4DTN A;  4FJX A;  1HMV A;  4RW6 A;  2HHQ A;  4H8K A;  3HVR A;  1C0U A;  1KSP A;  4CK2 A;  1TV6 A;  4CF8 A;  2P5G A;  4M3U A;  3OYA A;  3AVM A;  4KV8 A;  3F9K A;  3ZSZ A;  4E1N A;  1RBV A;  2RF2 A;  1W9H A;  4W5O A;  2HVI A;  1CXQ A;  2EHG A;  2XY8 A;  3DRR A;  1KLN A;  4EZ6 A;  3L2W A;  3NBP A;  1RBU A;  4KHU A;  3LAN A;  4CIG A;  3SZ2 A;  5KI6 A;  1QS4 A;  4EP5 A;  4OGE A;  4CGI A;  4N56 A;  3MAQ A;  2P5O A;  4BDZ A;  1K6Y A;  1G15 A;  4E7K A;  3S9H A;  4JRP A;  4H4M A;  3KD5 E;  4O55 A;  3NCI A;  2HHU A;  4CIF A;  2FBV A;  4DFJ A;  3C94 A;  2HND A;  3M8S A;  3MED A;  3QNO A;  3OYC A;  3QEP A;  4FK2 A;  4DQS A;  3QO9 A;  3ZSQ A;  5HRO A;  1NK6 A;  1IH7 A;  3DLE A;  4HUG A;  1DTT A;  1RIL A;  4CF0 A;  4KTQ A;  4LD0 A;  4CJ4 A;  4KFB A;  4I9L A;  4CJR A;  3RRH A;  4CE9 A;  5CZ1 A;  4KHN A;  4E0D A;  2ZD1 A;  1BIZ A;  1S1W A;  2YKN A;  4KHS A;  2FBX A;  3NF8 A;  1SL0 A;  4NCG A;  1L3S A;  4C8K A;  1BGX T;  1VSD A;  4KTZ A;  3KJV A;  4ELT A;  4ID5 A;  5J2M A;  4FZZ A;  1J53 A;  5T7B A;  2HHT A;  1BQM A;  1JL2 A;  2XY7 A;  1VSE A;  3NF6 A;  1ITG A;  3AO4 A;  3TAF A;  2G8W A;  2OZM A;  4DLE A;  4DU4 A;  1EKE A;  4E7L A;  1S1T A;  1YT3 A;  4OPK A;  4DSE A;  4BE1 A;  4KI6 A;  5JS1 A;  3NAE A;  3DOL A;  4PUO A;  1Y97 A;  4M3Y A;  4O44 A;  4Y1D A;  3VQP A;  1HNI A;  4OPJ A;  3OYD A;  1N6Q A;  3AA4 A;  2HHS A;  1WAF A;  1VSH A;  4CHY A;  2F8S A;  2D0A A;  3IRX A;  2ITG A;  3NF9 A;  2FC0 A;  1LW0 A;  3OYM A;  2O4I A;  1BI4 B;  3LP3 A;  3SUN A;  4CHP A;  3QEI A;  1NKE A;  1NK0 A;  1RTD A;  4FK4 A;  3MEC A;  3C6U A;  4DF4 A;  4JLH A;  4DTS A;  3LWM A;  3NFA A;  3LAK A;  4F2R A;  1TL1 A;  2F96 A;  4M3X A;  1TKT A;  4E7J A;  5FDL A;  4O0I A;  3TI0 A;  4FLT A;  3CFR A;  2EX3 A;  4IDK A;  4CHZ A;  3PV8 A;  1LWE A;  3HT3 A;  3OS2 A;  3LAM A;  3BDP A;  3DRS A;  1HQU A;  3TAE A;  5HBM A;  3ZT0 A;  1U47 A;  3AVC A;  4O4G A;  3AVH A;  3DRP A;  4DFM A;  3HK2 A;  3NDK A;  4MFB A;  3AV9 A;  1UA1 A;  1D9F A;  2DFE A;  4KHQ A;  3VQE A;  1TAU A;  1LW2 A;  1WNS A;  3O3F A;  3L2Q A;  4DTU A;  1L3T A;  5HRN A;  2BDP A;  1XI1 A;  3MXJ A;  4N76 A;  3SQ2 A;  1TL3 A;  4FJ5 A;  2B6A A;  3TAG A;  2YNH A;  2RKI A;  3QER A;  4B8A B;  4HUF A;  3V4I A;  1EXQ A;  1X1P A;  3AVB A;  3OY9 A;  1BQN A;  1L5U A;  5KTQ A;  3ZSY A;  1A5W A;  3OYK A;  3HVT A;  3HYF A;  4BE0 A;  1R0A A;  2IDO A;  1VK0 A;  4CK3 A;  3V81 A;  2HNZ A;  2Y1I A;  4J2A A;  4FJJ A;  4ZTJ A;  2B4J A;  2WOM A;  2KQ2 A;  3G10 A;  1NJX A;  4KRE A;  2HVH A;  1REV A;  3HP9 A;  3L8B A;  2KTQ A;  3RR7 A;  1GOC A;  3DYA A;  3SUO A;  5FRO A;  4FZX C;  1ASU A;  4B8C A;  4KHW A;  4RW4 A;  2QXF A;  1J5O A;  2DY4 A;  1TKX A;  3TAM A;  1U4B A;  1XHX A;  3ZSW A;  4FM1 A;  3PX6 A;  3NH1 A;  1NKC A;  5HP1 A;  4GVM A;  3THV A;  3OJS A;  4FJ9 A;  2E6L A;  2KW4 A;  4NCB A;  4BDY A;  1NK5 A;  4IBN A;  2RN2 A;  1RDD A;  4DU1 A;  4DTX A;  4ELU A;  1UA0 A;  3SCX A;  4JS4 A;  3E01 A;  4J2E A;  1A5X A;  1TK5 A;  1F21 A;  3OYJ A;  3K5L A;  4B9M A;  1IO2 A;  4DSI A;  1ZBI A;  3LZJ A;  3KKS A;  2KZM A;  1NK8 A;  4FJN A;  3OYL A;  3HPG A;  3K5N A;  3NGZ A;  1T8E A;  2X6N A;  1J54 A;  3V9X A;  4CIE A;  4DFK A;  2OA8 A;  3V9Z A;  2GBZ A;  1VSM A;  4LH4 A;  1T7P A;  1GOB A;  5KRS A;  4DTR A;  1I39 A;  4QAG A;  4AHC A;  1BL3 A;  5E41 A;  1RNH A;  2YHA A;  4DTJ A;  4CGG A;  1YVU A;  4CEB A;  1NK4 A;  1L3U A;  2LSN A;  4F8R A;  3OVN A;  4F4K A;  4FK0 A;  3K57 A;  4CEA A;  4K8Z A;  4G1Q A;  3QNN A;  3DI6 A;  4AHS A;  3RRG A;  1B9D A;  1CZB A;  1D9D A;  4KAZ A;  4FJI A;  1SUQ A;  1KVC A;  2E6M A;  1B9F A;  3C6T A;  4I2Q A;  3EYZ A;  3QIN A;  1WAJ A;  3WNE A;  3I0R A;  4NCA A;  2ZQB A;  3BGR A;  3SPZ A;  1SKW A;  2PYL A;  4W5Q A;  2HHX A;  3F73 A;  4Y1C A;  3P1G A;  1HQE A;  3ZSV A;  4B9V A;  2OYQ A;  2HNY A;  4AHR A;  4FM2 A;  1RCH A;  3VN5 A;  4ZHR A;  3JSM A;  1HJR A;  4C8L A;  4FJM A;  1UOC A;  1I3A A;  3ASM A;  4IG0 A;  3ZT1 A;  1S6P A;  1UAX A;  3HXM A;  1TKD A;  1WSG A;  4DFP A;  1D8Y A;  3HM9 A;  1Z26 A;  3LPU A;  4FLZ A;  3V1O A;  2JGU A;  4NYN A;  5KGW A;  4FZY A;  1O1W A;  2OPR A;  3U3Y A;  1L3V A;  5HRS A;  1QHT A;  1HYZ A;  4OKK A;  5DK5 A;  3VQC A;  3B6P A;  1RDB A;  1S1X A;  3C95 A;  2X6S A;  3LAL A;  1W0H A;  1KVA A;  4DSF A;  2JLE A;  4CF1 A;  4B9S A;  4J2B A;  3RR8 A;  4B9L A;  3L2R A;  3QEV A;  3LZI A;  3L3V A;  4CEQ A;  2Y1J A;  4OJR A;  2Q3S A;  4CJT A;  2W42 A;  3CFO A;  3PY8 A;  2IC3 A;  4CJF A;  3MXM A;  2XY6 A;  1NK7 A;  2PY5 A;  4KPY A;  4CEO A;  2ETJ A;  2YV0 X;  4CEF A;  1VSJ A;  4FLU A;  3KKR A;  1NKB A;  2IOC A;  4NYF A;  1RT1 A;  4BDP A;  3B6O A;  4F2S A;  4M3W A;  1NJY A;  3V6D A;  1S6Q A;  5DMR A;  4Z4E A;  4WE1 A;  2VWJ A;  5J2N A;  4DQR A;  1S1U A;  4FYD A;  3T3F A;  1CZ9 A;  1TKZ A;  2BAN A;  1ASW A;  1S1V A;  4CF2 A;  1IKY A;  3QEW A;  5HRP A;  4OVL A;  1IG9 A;  4IFV A;  1JLF A;  2P1J A;  1HPZ A;  2VG7 A;  4B9N A;  3SQ0 A;  4K8X A;  4Z4F A;  1VRT A;  3KLG A;  1KFD A;  3L3U A;  1DTQ A;  3I0S A;  1TVR A;  3HST B;  4BE2 A;  4OKJ A;  4C8O A;  3KD1 E;  4HCB A;  2HW3 A;  2AJQ A;  1HNV A;  3DM2 A;  4ID1 A;  1LAV A;  3LWL A;  1SL1 A;  4O5B A;  2X74 A;  4KHY A;  1IKW A;  3I8D A;  5J2P A;  3MEG A;  1QSL A;  4Q0B A;  1VSL A;  1WSF A;  3KTQ A;  3TAR A;  5C25 A;  1Q8I A;  2VG6 A;  2I5J A;  4C8N A;  2Z1G A;  3V1Q A;  4CGH A;  5SWM A;  1NJW A;  4CCH A;  1JLQ A;  3SV3 A;  4M42 A;  4IKF A;  3HO1 A;  1SKS A;  5SZT A;  2D0C A;  4CGJ A;  3V9W A;  5FRN A;  2PYJ A;  4PY5 A;  2X78 A;  4DG1 A;  1FKO A;  1QQC A;  3HPO A;  1U45 A;  4CF9 A;  5J1E A;  2VG5 A;  5KGX A;  1WN7 A;  4Z0U A;  3OYI A;  3KLH A;  4CHN A;  3LP2 A;  4DF8 A;  3SUQ A;  1T05 A;  1JXB A;  5CY4 A;  4CGD A;  1QSY A;  3KLE A;  3VQ7 A;  3AO2 A;  3TAP A;  3ZSO A;  3HL8 A;  4CJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...