4OKEA

Structure of rnase as, a polyadenylate-specific exoribonuclease affecting mycobacterial virulence in vivo
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 52
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okeA00
3SPYA 1EX4A 1NOYA 3OYCA 3V6DA 2XY7A 2KTQA 3U6FA 2BDPA 1B9DA 1JLAA 1LAVA 1NJXA 4DSFA 3OYJA 3SYZA 4DTUA 2XY5A 4PUOA 2YKNA 2ZE2A 4AHRA 3QLHA 4BWMA 1NJZA 1A5XA 4DF8A 4DU4A 4RW4A 3C6TA 4M3UA 1BCMA 3QERA 3BGRA 1SKSA 2HHTA 5HRNA 1TL1A 2Z1IA 3MEGA 4CGIA 4FM1A 3V1RA 3VQAA 1S1TA 5HRRA 1L3TA 4BWJA 1RDDA 1KLMA 4OVLA 4PA1A 3TAGA 3RMAA 3CQ8A 3IAYA 4F8RA 4FJKA 3ULDA 1HNVA 2EX3A 3HPGA 4ELUA 4F3TA 1D5AA 3SI6A 1NJWA 3M8RA 2FBVA 2O4IA 3F9KA 3DYAA 4FJXA 5FRNA 2KZMA 1SKWA 5FRMA 1RBRA 3KJVA 3ZSRA 4DWIA 5CY4A 3NAEA 4DSKA 1YTUA 1XI1A 3HJFA 1JKHA 2Z1JA 2BANA 2PZSA 3O3GA 2KW4A 3DMJA 4DMNA 1U4BA 4IKFA 2R7YA 3TARA 1JXEA 1TKXA 3K5MA 3QESA 1HRHA 3LPUA 2QKBA 3QINA 1G15A 2OPSA 3ITHA 3KLIA 4CJVA 3PX6A 1ZBIA 3HK2A 4JLHA 1BIZA 1BQNA 1Y97A 1JLCA 2IAJA 4G1QA 3MXIA 2HMIA 4FJ9A 3AVMA 4DU1A 4KHQA 3SCXA 5CYMA 4FZZA 1HQUA 4B9UA 1S9GA 1VSEA 1IO2A 2FBYA 4CJTA 3HP9A 1VSIA 1BGXT 1SL2A 4J2EA 2OPRA 2KFNA 4CEAA 1UOCA 1YT3A 1HYVA 1W9HA 3LAMA 1TV6A 4ID5A 3VQ7A 1B9FA 2DFFA 4CEQA 4CJ3A 3OJUA 1U47A 4KAZA 5J2QA 3TWHA 3LZJA 3OYNA 5I42A 1D9DA 3NGIA 2I5JA 3DLEA 4FJLA 4BE1A 1WSJA 3S9HA 2E6LA 1CZBA 1NK9A 1KRPA 3DRSA 3NCIA 3AA3A 1JLQA 4LH4A 4DLEA 3QEXA 2KZZA 3K59A 4C8NA 3K5NA 4CF9A 1YTAA 1GOCA 3NGZA 3S3OA 2ZQBA 4B8CA 4FLWA 5J2PA 3LP3A 4KV8A 5FDLA 3IS9A 1NK5A 4DQRA 4FJHA 3HL8A 4KHWA 3DLRA 1X9WA 3HVTA 1J5OA 3AVBA 3ZT1A 4EP5A 4CFAA 2XY6A 4FK4A 3KIOA 1YVUA 3OJSA 1JXBA 3JYTA 2F8SA 4DTOA 2D0CA 2Y1IA 1J9AA 3V9SA 1X9SA 2ZD1A 4FJJA 3LAKA 1TAQA 3V9XA 3MEDA 3U3YA 4F4KA 4B3OA 3E01A 3LANA 4NYNA 1LAWA 2YHBA 1KFSA 5SWMA 4KHSA 5HLFA 4NCAA 2YNFA 4OKEA 3FFIA 4N5SA 1D8YA 3SUOA 1S1XA 1TK0A 2X74A 1UA1A 4J2BA 4ELTA 2G8VA 4W5TA 2FC0A 2HHVA 4FLXA 4O44A 3OYIA 4DS5A 4QOZB 4CJQA 2QKKA 1CXQA 2OZMA 2HHSA 4AH9A 3ZSOA 4CEDA 4UQGA 1DLOA 1S1VA 3VQQA 1NK0A 2HVIA 1BL3A 3I8DA 3V9ZA 1RBUA 3DLKA 4FJMA 3AVLA 4FZXC 4KFBA 4E7JA 5KTQA 4PWDA 3L2WA 1QTMA 4HUEA 2G8KA 3SPZA 3AA5X 2P5OA 3MECA 3NF9A 5DK5A 3ZSWA 4DFKA 3C95A 4R5PA 4DSJA 4LD0A 3PV8A 3OYAA 4O5BA 2P5GA 4C8LA 1VSKA 4CEBA 1U45A 5E41A 4E1NA 4AHTA 3DI6A 5J2NA 2XHBA 2HNYA 3MXJA 4B9VA 1NKEA 3KKSA 5FROA 4CJSA 4CEEA 3OYLA 4O55A 1VSLA 3WNEA 4CJKA 4ICLA 2X78A 4LSNA 3AVAA 1FXXA 3K57A 3CFRA 1HMVA 2E4LA 4DTNA 3C6UA 3KD1E 1C0MA 4LH5A 3KLHA 3V9UA 2OA8A 2D0AA 1JLEA 5HRPA 4CESA 1L3SA 2KQ2A 3NH1A 3DM2A 1TKDA 2G8HA 2BGGA 4FM2A 4FLYA 2JLEA 1WAJA 3D45A 4L8RB 4IG0A 1RBTA 1KVCA 1BI4A 3P83D 5DMRA 4ZTJA 4CJ4A 2G8IA 2D5RA 4FM0A 2RPIA 1FKOA 3KK1A 4Y1CA 4DQQA 4CGJA 1X9MA 3RR7A 3PX4A 3NGYA 2ITGA 3LPTA 3HT3A 2IC3A 2F96A 1LWCA 1I39A 1S6QA 3QNNA 1Q8IA 1HYSA 4KTZA 4TSXA 3L2UA 3K5OA 4Q0BA 3SQ2A 2XRIA 3CFOA 3K5LA 3NE6A 2YHAA 3MXMA 1TL3A 3P1GA 4FW1A 5C24A 4ZTFA 1RT5A 3HSTB 4KHUA 4KPYA 5JS2A 2YNIA 4BE0A 3QIPA 4DFMA 1QSLA 1SL1A 1U48A 4CECA 3SQ4A 1KFDA 1BHLA 2KFZA 1JL1A 3OYEA 3V1QA 2VG6A 4E89A 3VQEA 4CF2A 3QEVA 4IBNA 2GBZA 4OKJA 3VQ9A 2B4JA 5C25A 3TAEA 2PYJA 3QEWA 4CF1A 3G10A 1WSGA 4QCLA 4HUFA 1T05A 4AHUA 4W5RA 4YNQA 1CXUA 4CK3A 1TVRA 4CEZA 3JSMA 4LSLA 4AHVA 4RW7A 1XHXA 4W5QA 4BDZA 4FJGA 4OGCA 4OPKA 3VQBA 1QSYA 3OYFA 4DFJA 1GOBA 2EHGA 5CZ2A 4XIUA 4OLAA 4Z4FA 1QS4A 3VN5A 1LW2A 2FBXA 1D9FA 4CHOA 4KB1A 1S1WA 1WSHA 1A5WA 3RRGA 4M3RA 3TANA 4LY7A 3AVFA 1C6VA 3EYZA 1JLBA 4H4OA 4FJ5A 2GUIA 3WNHA 4Q5VA 3PO4A 4DTSA 1ZBUA 1EXQA 3AVGA 3MEEA 3VQDA 3SUNA 1BQMA 3ZSQA 2LSNA 4H4MA 1RBVA 1RTJA 4KKOA 3AVCA 4I7FA 4MFBA 1ASWA 3OYBA 1QHTA 1WLJA 4KO0A 4CIFA 1RCHA 4B9MA 3KLGA 5C42A 3PO5A 3RMDA 3DOKA 2IDOA 3DLGA 1RBSA 3THVA 4BDYA 3PUFA 5KI6A 3SQ0A 1N6QA 1RT4A 3IG1A 1VSFA 3T3FA 4FK2A 4F2SA 4DSLA 3HVRA 3L2VA 4JRQA 4CK2A 1MU2A 1FK9A 1JLFA 1IH7A 1C0TA 2P1JA 1WAFA 4Z0UA 3U3GA 4DQSA 1T03A 3V4IA 3VQCA 4DTXA 4HCCA 4CHPA 2WONA 5I3UA 4ZHRA 3M8QA 5KRSA 4M3TA 3HPHA 3L3UA 2HNZA 3L2RA 4DSEA 1SUQA 3ZCMA 3ZT0A 1LV5A 4K8ZA 4JRPA 4GW6A 2WOMA 1F21A 2QK9A 3SQ1A 1S6PA 1RNHA 2VG5A 3P5JA 3VQ4A 1J54A 3HPOA 3SV3A 4NYFA 1EKEA 1HNIA 1N5YA 4M3WA 3VQPA 2OYQA 4RG8A 1C0UA 3S3MA 4C8OA 3RRHA 1LWFA 3EY1A 4CERA 1JLGA 4M42A 4Y1DA 4M3XA 2VWJA 1RT1A 1TGOA 1IKYA 2ATQA 3VQ8A 5CZ1A 1KLNA 3OYHA 4E7LA 1NK8A 1R0AA 4RW8A 1O1WA 4B8AB 1WSFA 3LP2A 1TAUA 2F8TA 1KVBA 2E6MA 3SNNA 4DTMA 3DRRA 3HM9A 3SZ2A 2FBTA 2Z1HA 3QEPA 3AV9A 3DRPA 4MQ3A 4O4GA 4OPJA 1SL0A 4HCBA 1KVAA 1RT7A 1RT6A 1Z26A 3ZT2A 3TAFA 4CGDA 4ID1A 4BDPA 4GVMA 1VRUA 4CJPA 3NFAA 1NK7A 3F73A 4FJIA 1SKRA 4KHYA 3T19A 3ASMA 1T7PA 3NBPA 3S3NA 5HRSA 4HUGA 4GMJB 3ZSVA 4AHSA 3DOLA 5KGWA 4Z4CA 3VA3A 2G8UA 3L2QA 3V1OA 3KLFA 2A1SA 4WE1A 5EU7A 4DTPA 3SUPA 3L3VA 1NOZA 2HHQA 1WSEA 3TAMA 3TR8A 1KTQA 3CYMA 4AHCA 4CIGA 3RMCA 4HHTA 3QNOA 4CEOA 5HROA 3OYMA 4FJ7A 4C8MA 2RN2A 3ALYA 3ZSZA 1S1UA 1XHZA 4BACA 2ETJA 5KRTA 4F2RA 4E0DA 4CJEA 1VK0A 3A2FA 4CHQA 4E7HA 2A1RA 2G8FA 2HHWA 3QIOA 4M41A 1T8EA 3OYDA 3KLEA 3AVNA 4DS4A 2OZSA 3CG7A 4B9SA 5SZTA 4CK1A 2OPQA 1Q9YA 3AO2A 4E19A 5CYQA 4CGGA 5J2MA 3SJJA 1L5UA 2X6NA 3WNFA 4PY5A 3OY9A 4I2PA 3LDSA 4Z4IA 1J53A 2W42A 1IKWA 3MAQA 4JS5A 1NKCA 4Z4HA 4DTJA 3DLBA 3HYFA 1QE1A 4CHYA 1K6YA 4KI4A 3TAPA 3AA2A 4CCHA 4OJRA 2YV0X 1A5VA 4F3OA 4NCBA 3LZIA 3UIQA 3LWMA 1IG9A 1U49A 4J2DA 3ZT3A 3RTVA 3SV4A 4CFDA 1NK6A 1C1AA 4CJRA 3CM5A 3K2PA 5T7BA 3C94A 1Q9XA 4DQPA 4K8XA 1FKPA 1TKZA 1I3AA 4DF4A 5J1EA 3O3FA 1CZ9A 1HYZA 1IKVA 3M8PA 3I0RA 4HVJA 3NH2A 3CFPA 1TKTA 3AVJA 4HTUA 1TK5A 1C1CA 3M8SA 3PY8A 4Z4GA 4OGEA 4B9LA 2IGIA 1XC9A 3LP1A 2HVHA 2VG7A 3V9WA 3HXMA 4DLGA 3LWLA 3SUQA 4CFBA 3BDPA 4O0JA 3V81A 4W5OA 2G8WA 2HW3A 4FYDA 1REVA 4IFVA 4DSIA 4AILC 1RT3A 3KKRA 3I0SA 4FVMA 4H8KA 3T1AA 1IKXA 4NCGA 3L8BA 3TI0A 2XY8A 2Y1JA 1KSPA 4DQIA 3ZSYA 4BE2A 4FJNA 1U04A 3KTQA 1S5JA 4KHNA 3LALA 3IRXA 4CF8A 1TK8A 1XWLA 1VSHA 3O3HA 3VQ5A 4YFUA 4KTWA 2Q3SA 3QO9A 4C8KA 3NF6A 1B92A 3O4QA 1RDBA 5HBMA 3VA0A 3OYGA 4CF0A 4E7KA 1WSIA 2Z1GA 4DTRA 4B9TA 2PYLA 4KTQA 4FK0A 4OKKA 2XO7A 4FXDA 1JL2A 3AO4A 4DG1A 3HO1A 3OS1A 1WNSA 4CIEA 1SV5A 1DTTA 3NH0A 3AA4A 3D0PA 1GOAA 1VSJA 2DFHA 2GV9A 3EZ5A 1LWEA 3NF7A 2HHXA 1CLQA 5K14A 4CJFA 3RMBA 3DLHA 1ASVA 1RDCA 3ISNC 4RW6A 1KCFA 1VSMA 5KGXA 3RWUA 1BI4B 1BISA 5HP1A 1RTDA 3AVKA 1ZBFA 4EZ6A 4PQUA 4IG3A 4DFPA 4W5NA 1EETA 3H08A 1EP4A 1VRTA 4N56A 1ASUA 4N41A 4ELVA 3NHGA 4J2AA 3B6PA 2IOCA 4N76A 4EZ9A 4FLUA 4CJLA 3OS2A 1ZBHA 5D3GA 1NJYA 1HQEA 4OLBA 3NF8A 2NUBA 2RF2A 1C1BA 2O4GA 1NKBA 4FW2A 3WNGA 5JS1A 3ZSXA 1X1PA 2JGUA 4CHNA 1W0HA 4FLZA 1UA0A 1HJRA 1ZYQA 1L3UA 4M3YA 2YNGA 2QXFA 1DTQA 2RKIA 2BE2A 1ITGA 1UWBA 3O4NA 3HP6A 4I9LA 4E7IA 3OYKA 3KK2A 1WN7A 1QSSA 3TAQA 3CM6A 2DFEA 4I2QA 1S9EA 4M45A 3VQ6A 2HB5A 4FLVA 4B9NA 4M3ZA 4CEFA 1L3VA 1VSDA 4KB0A 1HPZA 4N47A 3K58A 4IFYA 4QAGA 4CGHA 4EP4A 3TABA 4O0IA 1RTIA 3QEIA 2HHUA 2B6AA 2DTUA 4E1MA 1RDAA 3AVIA 2YKMA 2YNHA 2PY5A 4KI6A 4IDKA 4CE9A 3ZT4A 4KRFA 2IS3A 3NDKA 3PX0A 3AO1A 4JS4A 3B6OA 4E3SA 2P51A 3OVNA 1LW0A 4DU3A 3AO3A 2VWKA 3QETA 2X6SA 2D0BA 3AO5A 1ZBLA 4CJWA 4CJUA 4FZYA 3AVHA 4FJ8A 2HNDA 4CHZA 2OPPA 4CGFA 4CJ5A 1NK4A 4I9QA 4KREA 2AJQA 2B5JA 1QQCA 1UAXA 1Z25A 4RW9A 3OS0A 1RT2A 1RILA 4FLTA 1BCOA 3LP0A 3RR8A 2DY4A 3KK3A 1BIUA 3G0ZA 1RTHA 4Z4EA 4CFCA 4B08A 3KD5E 4FCYA
chains in the Genus database with same CATH superfamily
3SPYA 1NOYA 3OYCA 4IEEA 2BDPA 4BGAA 1NJXA 3OYJA 4DTUA 4YOTA 4PUOA 3CMAN 2YKNA 1ATSA 5AQRA 4A61A 5CE3A 4FWNA 4DV7K 4RW4A 1J6ZA 1KD1O 3OBWA 3H46O 4CGIA 3MEGA 2O8EB 3WEEB 4FM1A 4LFBK 4BVOA 3VQAA 1S1TA 4BWJA 4EFHA 3TAGA 4DR2K 5JICA 3IAYA 4B3SK 3ULDA 3CJ1A 3VEWA 3SI6A 4KBOA 3ZSRA 4DWIA 4FOIA 4U67L 5EXWA 1XI1A 1JKHA 3ATUA 4CD3A 4OX9K 3DMJA 5EOYA 1U4BA 2D0PA 1TKXA 3K5MA 3QESA 2OPSA 3ITHA 3HK2A 3DWLA 4JLHA 4G1QA 3VF2A 4FZZA 2H3GX 4YDUA 1M1KO 4B9UA 3VESA 4B3RK 1HNXK 1IO2A 4O8KA 4BRLA 3O80A 2KFNA 3SMPA 2FSNA 3PIPL 2P9KA 4RWTA 1HYVA 1W9HA 2DFFA 4KAZA 3C6HA 4PL7A 4O8UA 3LZJA 3W0LA 3OYNA 5I42A 2RHKA 2I5JA 3AAPA 2E6LA 3O1BA 3NCIA 3AA3A 1JLQA 3K59A 2Q97A 3K5NA 1YTAA 4DV4K 3NGZA 3S3OA 3NVKA 4B8CA 5CHIA 2QWOA 5M1OA 1YXQA 3OW2M 4KV8A 3IS9A 3HL8A 1J5OA 1VQ4N 3AVBA 3A5NC 4EP5A 3THWA 3KIOA 1YVUA 3OJSA 5C2FA 4DTOA 5KQDA 4GVEA 3U3YA 3J80O 1DKGD 4KHSA 5AQHA 4CD1A 4N5SA 1UA1A 4BREA 4CZMA 4ELTA 2G8VA 4EIAA 3CQXA 4FLXA 3OYIA 2QTDA 2HHSA 3QB0A 4UQGA 3VQQA 1NK0A 3V9ZA 1IV0A 1HUXA 2KKZA 4E7JA 3L2WA 3SPZA 2ZJRL 3AA5X 3AGKA 5DK5A 3GG4A 2P9UA 4CEBA 1XC3A 1U45A 5DM6L 1DEJA 4CEEA 1VSLA 3B8AX 4LC9B 4LSNA 3RSEA 1FXXA 3CFRA 4DTNA 2E4LA 3C6UA 2P9LA 1MDUB 2OA8A 2D0AA 4MDAA 1JLEA 5HRPA 3NH1A 1BG3A 3CD6N 4FM2A 3ZX2A 4FLYA 4L8RB 2Q0UA 4IG0A 1KVCA 2FSJA 4FM0A 3LM9A 1FKOA 4Y1CA 3PX4A 3NGYA 3FZHA 2ITGA 3HT3A 2F96A 1Q8IA 4DV6K 3PLAA 3SQ2A 1TL3A 4FW1A 3WXMB 1T6DA 1KXPA 4ZTFA 3HSTB 5AQOA 2YNIA 1QSLA 3CCSN 4OPHA 3AY9A 1KQSM 5C15A 2GUPA 4MLHA 2VG6A 4E89A 3ZETA 5C25A 5KPTA 1CXUA 1TVRA 3G71N 5C12A 2E2PA 1HNZK 3PIOL 1QSYA 2EHGA 4G9ZA 3HRGA 1S1WA 4FWOA 3ZEUB 3SMSA 3O9TA 5FPEA 1JLBA 2NRVA 3WNHA 4DTSA 1ZBUA 1EXQA 3AVGA 3SUNA 2O8FB 2GTDA 1TYQA 2LSNA 1RTJA 4JI6K 4CZFA 4MFBA 3EEQA 1WLJA 4CIFA 2ASMA 3KLGA 5C42A 3DOKA 2A42A 4EHTA 5KI6A 4O5FA 2HMPA 2NRTA 1VAZA 2DPNA 2O8EA 3T69A 3HVRA 3L2VA 2QWNA 4CK2A 1FK9A 2E5LK 1C0TA 2YCHA 4DQSA 4UY8O 5AQYA 4PKHA 4HCCA 5KRSA 3L3UA 4K8ZA 3LM2A 3ZT0A 4JRPA 1HJOA 2NRZA 4GW6A 3T1YK 3P5JA 4M3WA 4YOVA 3A0IX 1C0UA 5BPMA 5BPNA 1TGOA 3VQ8A 5CZ1A 4GNIA 3CJ7A 3VF6A 2VGMA 1E4FT 2F8TA 2KHOA 2E6MA 2UXBK 5C0YA 4CZGA 2Z1HA 1SL0A 5LY3A 1KVAA 3TAFA 4ID1A 4GVMA 1VRUA 4CBXA 4WQ5A 2ZJPL 4DB3A 3ZX3A 3CMEN 2YX6A 4B1VA 4GMJB 4FWKA 3ZSVA 3VA3A 2O8CB 3V1OA 1J5EK 5EU7A 1NOZA 2NLXA 1WSEA 3TAMA 2VQFK 4HHTA 4CEOA 3OYMA 4H0VB 4C8MA 3ZSZA 2A40A 5KRTA 3MN9A 3TSQA 4CHQA 2P9NA 2G8FA 1DT9A 3QIOA 1T8EA 4DS4A 3AARA 5SZTA 2E2NA 3M5RA 1NGIA 2X6NA 3WNFA 4I2PA 5AQFA 2P9SA 2W42A 3MAQA 4JS5A 4Z4HA 3MK6A 3TAPA 5F0XA 4BRQA 4F3OA 1IG9A 5GAEP 3SV4A 2VQEK 3CM5A 3HTVA 4DF4A 2P9IB 5J1EA 1HYZA 4HVJA 2FF3B 3WXKA 3M8SA 3MCPA 3T7ZA 3V9WA 3SUQA 4FWMA 3V81A 5KQ8A 1NLVA 3NMUA 3VERA 3KKRA 1GLEG 3ENOA 2NZTA 4DHYA 3T1AA 3L8BA 3FZKA 4IXCA 3LALA 1XWLA 4RCHA 3QO9A 3LDLA 1RDBA 4YOUA 1NMDA 4CF0A 4BVPA 4KTQA 1YAGA 4OKKA 4FXDA 2QWLA 1K73O 4MDBA 4CIEA 4LF4K 2GV9A 1WUAA 4ILHA 1NGGA 1CLQA 3HBTA 5K14A 1JCGA 3O8MA 3H45C 4RW6A 1ZBFA 5GIPA 4DFPA 4W5NA 1EETA 1GLLO 4J2AA 3WQTA 4N76A 3IUCA 3H1VX 3CPEA 3GE1A 2O4GA 3HM8A 5AQJA 4FW2A 3WNGA 5JS1A 1YJ9N 3MMVA 2HBKA 1ATNA 2F9TA 1ZYQA 4E1JA 1VQON 4E7IA 4I9LA 4NLCA 3LDNA 2GELA 1WBBA 1LCUA 4M45A 4FLVA 1XMQK 1M90O 4M3ZA 4CEFA 1HPZA 3QEIA 4E1MA 3AVIA 5TKWA 1W7AA 4CE9A 1Q86O 3L0QA 3NDKA 2CH5A 3QDKA 3M3ZA 4DU3A 2D0BA 4XH4A 1ZBLA 4FZYA 1VQMN 4KREA 3EZWA 4RW9A 1RILA 2E2QA 3OBYA 3RR8A 1BIUA 3G0ZA 2A6AA 5LJWA 4Z4EA 2CGKA 5AQLA 1EX4A 1MA9B 2KTQA 3AAQA 5C10A 1LAVA 3CJAA 3SYZA 4BWMA 1NJZA 4DU4A 1Q81O 3C6TA 3THWB 2FF6A 2HHTA 5HRNA 4BRCA 1KC8O 5HRRA 1L3TA 1RDDA 1KLMA 3CJCA 5FPNA 3CQ8A 4ELUA 3QFPA 2KZMA 1P8ZA 3F9KA 5FRNA 3BZCA 2QWQA 1RBRA 1Z6RA 4LFAK 3N4PA 3O08A 4DR6K 5MLCQ 5HL7L 2Z1JA 4YDUC 2PZSA 3UB5A 3O3GA 4DMNA 4IKFA 3TARA 4XH5A 3WXIA 3PX6A 2IAJA 3AVMA 4DU1A 5CYMA 3DAWA 1HQUA 4JKDA 4DUZK 1S72N 1S9GA 4A59A 3WXLA 4BRKA 1QZ6A 1VSIA 1SL2A 1UOCA 1YT3A 3EL2A 3LAMA 3OJUA 1B9FA 2E1ZA 2E8AA 3TWHA 5AFUA 1C0FA 5TKYA 4DR5K 1CZBA 1NK9A 2NRHA 3DRSA 4JKFA 2YHYA 5LMUK 2Q1NA 2ZQBA 5J2PA 3LP3A 3P31A 5FDLA 3HOTA 3CCMN 1NK5A 4DQRA 4FJHA 4KHWA 1X9WA 3ZT1A 4FK4A 2GEMA 4PHTX 2F8SA 1ILYA 1X9SA 4FJJA 3FGUA 3V9XA 4BRMA 1KFSA 2YHBA 1GLJO 3FR0A 3ID8A 4OKEA 3SUOA 4ILGB 2X74A 4JK7A 3ZETB 2FC0A 3O9UA 4QOZB 1N36K 2OZMA 1DLOA 1BL3A 3I8DA 2HOEA 5KTQA 4PWDA 2BH1A 4CZEA 3C95A 4DSJA 3JS6A 4O5BA 1SAZA 1VSKA 3VOVA 2HNYA 3C0BA 2UXDK 4O55A 3WNEA 3AVAA 3KD1E 1C0MA 3V9UA 1TYQB 1RDUA 1L3SA 2KQ2A 3DM2A 4I6MA 4K42A 3E9LA 4EHUA 3H6EA 2RE2A 1RBTA 4CJ4A 3HOSA 4CGJA 5JLHA 2A5XA 2IC3A 4JKCA 1I39A 1HYSA 4KTZA 4JI8K 1P90A 3TTFA 3K5LA 1O13A 4GKJK 3J8AA 2BUPA 5JS2A 4DKWA 3L4IA 3VEOA 1BHLA 3GL1A 1HKCA 1GLBG 4FWLA 3V1QA 3UE5A 4CF2A 3ATVA 4OPAA 2GBZA 4OKJA 5AQXA 3CJ9A 2PYJA 3CQYA 4HUFA 1T05A 3MX5A 4AHUA 4BRNA 1X9JA 3JSMA 2UUBK 4OGCA 1NGEA 4BC2A 4BRPA 1GOBA 4XIUA 1QS4A 3VN5A 4IWVA 1VQKN 4QS7A 5F2RA 1C0GA 2Q31A 3QFUA 4IZ9A 3D2FA 3PO4A 1IBMK 2HHHK 1BWFO 3MEEA 3VQDA 3R6MA 1NGDA 3AVCA 5CR4A 4CW7B 3PO5A 2YHXA 2IDOA 3SBGA 4DR7K 3SQ0A 4DQ8A 2P9NB 4WFBL 1RT4A 3T3FA 3G6EN 4DSLA 4JRQA 2E2OA 1MU2A 1JLFA 4Z0UA 3FLCO 2P9SB 1MWKA 3CXCM 2WONA 3L2RA 4DSEA 1SUQA 3G25A 1NNEA 1QQNA 2D1KA 2VG5A 3VQ4A 3HPOA 2OYQA 4K0KK 4IOAL 5E84A 3RRHA 2QWPA 1R59O 1LWFA 4ISFA 3EY1A 1JLGA 1BO5O 4M3XA 3PSIA 2VWJA 4CI6A 1KLNA 4WQ5C 4AM7A 3R9PA 3OYHA 3HI0A 3VPZA 1R0AA 1O1WA 5AQMA 4B8AB 1WSFA 3U8XA 3SZ2A 2FBTA 1NGCA 1IBKK 1JCFA 4HCBA 4OPJA 1Z26A 3ZT2A 4CZKA 4CGDA 4BRDA 1VQPN 4CJPA 2FLOA 3NFAA 1NK7A 4BR0A 4FJIA 4JK9A 4A57A 3ASMA 1T7PA 4FL9A 5AQVA 3S41A 2CGLA 3NBPA 1BDGA 3S3NA 2UU9K 1GLAG 3MWPA 4LF5K 3VTHA 3BF3A 2G8UA 3L2QA 4M63C 3CF5L 4KH4A 3SUPA 3TR8A 4CIGA 5I9EB 3RMCA 3BUZB 4JK8A 4F2RA 2OCEA 3A2FA 2A1RA 4E7HA 3KLEA 2OZSA 3CG7A 3H3NO 2OPQA 3SJJA 4PY5A 3LDSA 1G99A 4Z4IA 1NKCA 3DLBA 4CHYA 1NM1A 4BC5A 4MLEA 3AA2A 4OJRA 1A5VA 1JJ2M 4LF9K 4J2DA 1U49A 3E9OA 1C1AA 4CJRA 3C94A 1FKPA 1TKZA 5AFUH 4B9NA 4F8RA 1TK5A 3AVJA 5DM7L 1C1CA 1QVGM 5BN8A 4DV5K 1NMNA 1KAZA 2Q36A 3HXMA 4CFBA 3BDPA 3J7YP 4FYDA 2A41A 4DSIA 1RT3A 2CH6A 4PL8A 1BA0A 1IKXA 4NCGA 4B3TK 2Y1JA 5M1PA 1W2BM 3CCUN 5AQWA 2ZGYA 4DCHA 3KTQA 2CGJA 4CF8A 3ZX0A 1VSHA 3VQ5A 4C8KA 2JWKA 3NF6A 4CZIA 3L6QA 3EE9A 2PYLA 2E88A 3I55N 3BP8A 4FK0A 4Y0WA 3HO1A 1WNSA 3D0PA 1H1VA 1LWEA 2EWSA 3I56N 3DLHA 3RMBA 3VGMA 5KPZA 3ISNC 5FPMA 1BISA 2D0OA 5HP1A 4EZ6A 2W6LA 1NGJA 4B9QA 1VRTA 3NHGA 1D4XA 3VTIA 2IOCA 3DXMB 1OH7A 3MX2A 3MN6A 4CJLA 5D3GA 4OLBA 1E3MA 2NUBA 1C1BA 1XQSC 4LFCK 2JGUA 4BRFA 4M3YA 2QXFA 4WFAL 2F9WA 3KHYA 1ITGA 1UWBA 3OYKA 1WN7A 1HKGA 4I2QA 1VSDA 1NK8A 4N47A 3O6WA 1RDAA 4U7BA 2YNHA 2HF4A 2PY5A 4KI6A 2HBJA 4IDKA 3ZT4A 2IS3A 3PX0A 2QXLA 3K0SA 3B6OA 2ZJQL 2P51A 4DV1K 2VWKA 3AO5A 3CERA 4FJ8A 4BG8A 4CHZA 4CJ5A 2OPPA 2AJQA 4I9QA 2NNWA 2B5JA 1Z25A 3OS0A 4DR4K 1BCOA 3LP0A 4CFCA 4B08A 3DLLL 3V6DA 2XY7A 3M1FA 3IDHA 1B9DA 1JLAA 3P39A 2ZE2A 3QLHA 3QMLA 1VQ9N 1BCMA 3QERA 3I33A 3BGRA 3R1XA 3O9QA 1TL1A 2QM1A 3O5BA 1NJIO 3V1RA 3BZKA 4FJKA 3WXJA 1HNVA 2EX3A 3HPGA 3TTDA 2O4IA 2FBVA 3DYAA 4FJXA 3CI5A 5FRMA 1YJWN 1YHQN 1NG9A 2JWLA 3NAEA 3HJFA 4BQZA 2BANA 2KW4A 4K25A 4IO8A 1NU0A 1JXEA 1HRHA 3LPUA 4F3TA 3QINA 1G15A 4CJVA 5ADXA 4X66K 1ZBIA 5LL6Z 5EVZA 1Y97A 1BQNA 4FJ9A 2HMIA 5EX5A 1OVYA 2WFBA 4KHQA 2PFUA 3HSCA 4YOXA 3D2EB 2W41A 5AQSA 4XH1A 1FW6A 1BGXT 4YOYA 4XEIA 4PKGA 4CBUA 4FO0A 4ID5A 1TV6A 4JKHA 5KPRA 1U47A 4I6MB 3NGIA 4JYAK 2QWMA 4BE1A 5JVGL 1VQ5N 4LH4A 1WOQA 4FLWA 2V7YA 2GWKA 4H0XB 3HVTA 5AR0A 4CFAA 4X65K 1S22A 3O1WA 2NRRA 2D0CA 1J9AA 4JKBA 2ZD1A 3THYA 3DXKA 3SAHA 1TAQA 4JI3K 4F4KA 3A5OC 3VGKA 3E01A 4B3OA 5HLFA 4NCAA 1TUYA 2YNFA 3FFIA 1D8YA 1TK0A 4W5TA 5M1KA 2YJEA 4AH9A 4CEDA 5BRDA 3OHRA 5AQNA 1BU6O 1RBUA 3PSFA 2ASOA 3AVLA 4FZXC 3F9MA 4KFBA 3UKUA 1QTMA 3VEZA 1T44A 3NF9A 3ZSWA 4N41A 3CIPA 4R5PA 3ZYYX 1K8KB 3PV8A 2P5GA 2Q2RA 3MDQA 4LF8K 2ASPA 4K43A 5E41A 2ITMA 3CC2N 4B9VA 1NKEA 3D2FB 4GV3A 4ICLA 3K57A 1QHAA 3E66A 4LH5A 3WQUA 3KLHA 3U9ZA 3WT0A 1TKDA 2BGGA 3TSPA 3VEVA 1WAJA 3D45A 4IJAA 4C1NK 3KWIA 1SZ2A 5GAGP 4ZTJA 3A5LC 5DMRA 2D5RA 3KK1A 4DQQA 3RR7A 3TSUA 3M6GA 3DXMA 3SAFA 2O8DA 4OO1J 2HF3A 4A62A 1LWCA 4FCYA 4Q0BA 4B1UB 3F2KA 2XRIA 1ZBSA 3CFOA 3NE6A 2YHAA 3MXMA 4CZHA 1VQLN 1RT5A 4KPYA 4JD2A 4BE0A 3N4QA 3QIPA 4ILJA 1SL1A 4A2BA 2QI2A 1KFDA 2KFZA 4H0PA 3VQEA 3QEVA 4IBNA 3VQ9A 2B4JA 3SJHA 3C65A 5FPDA 3TAEA 3RVCA 2QW9A 1WSGA 2WTUA 4YNQA 4CK3A 4ISEA 4PKIA 4FJGA 4IJNA 3VF4A 1VHXA 1LW2A 3CCVN 3P4IA 4CHOA 4NB4A 4IDHA 3HZ6A 3RRGA 4M3RA 1Q18A 4LY7A 3AVFA 1C6VA 4H4OA 2GUIA 1HPMA 4Q5VA 3EE8A 3TPQA 1RBVA 4A2AA 4KKOA 4I7FA 1GLDG 5AQGA 3OYBA 3BF1A 3P38A 1RCHA 5HOOA 3DLGA 1NGHA 1RBSA 5BR8K 3PUFA 4BDYA 2GX9A 1N6QA 1DGKN 3IG1A 4NLBA 3U4LA 4FK2A 4CVNE 4JKGA 3A8YA 2P1JA 1T03A 3VQCA 4CHPA 2AA4A 2IVPA 3M8QA 3HPHA 2HNZA 5AQUA 1LV5A 3EO3A 2QK9A 3SQ1A 1S6PA 1RNHA 1N5YA 5AQZA 4NYFA 1EKEA 1HNIA 1XNRK 1FJGK 2YHWA 4C8OA 4M42A 4Y1DA 3U9DA 1YITN 3SAGA 1IKYA 1VQ7N 4E7LA 4RW8A 5M1QA 3D2EA 3SNNA 4DTMA 3DRRA 4JHDB 4MQ3A 3JAMO 3CCJN 1RT7A 1RT6A 4BDPA 3H3OB 3FFKB 3UKRA 3L4QA 1WB9A 4JI4K 4AF1A 5HRSA 4BR9A 2I7NA 4AHSA 3DOLA 5KGWA 3KLFA 3SLCA 3O4WA 3L3VA 3J81O 4AHCA 1KTQA 2E20A 3CYMA 4FJ7A 4DR1K 3QNOA 5HROA 4GV6A 2RN2A 4FWPA 1BA1A 1XHZA 4JI5K 4H0OA 4BACA 3E9PA 1T6CA 2PBDA 4E0DA 3FZMA 1VK0A 4CJEA 4CJ7A 2HHWA 5ADXH 3JXUA 5AQQA 3OYDA 3AVNA 4B9SA 4B1YB 4E19A 1L5UA 2F7TA 3OY9A 2IVNA 5BRHA 1TUUA 2WBNA 3KZBA 1QE1A 1K6YA 1V4TA 2P9PA 4KI4A 4H5NA 4CCHA 2YV0X 5JLFA 3UIQA 3RTVA 4CFDA 1NK6A 3K2PA 4DQPA 4CBWA 2HSTA 1I3AA 4BROA 3V9SA 4HTUA 1IKVA 1N33K 3I0RA 1TKTA 3PY8A 5LJVA 1HNWK 4B9LA 2IGIA 4DV3K 3TTCA 1IG8A 2YJFA 2WUSA 3LWLA 1K8KA 4O0JA 4W5OA 2F4VK 3F5TA 1RGIA 4IFVA 2UYTA 4V19S 1HLUA 3I0SA 2ZGZA 3FZFA 4CZLA 3TI0A 4DQIA 1KSPA 4F9OA 3ZSYA 4BE2A 4A5AA 4FJNA 1U04A 3IRXA 4BR5A 4M7YA 1ATRA 2V51B 4IFEA 1NGBA 5BREA 4YFUA 5GAHP 5HBMA 1OH6A 3OYGA 4B9TA 2Z1GA 1JL2A 2HBMA 1NGAA 1MWMA 2PAVA 3AA4A 1VSJA 2DFHA 3NF7A 5AJ3K 5GINA 2HHXA 4FWRA 1ASVA 1RDCA 1KCFA 3RWUA 5KGXA 1BI4B 3CETA 3AVKA 4H0TB 4JI0K 4PQUA 1S3XA 4IG3A 4YHHK 3IFRA 3H08A 3KK7A 1ASUA 4WFNL 4ELVA 3B6PA 3GOIA 4H03B 4FLUA 3C7NA 1ZBHA 3FE1A 1NJYA 3NF8A 2AP1A 3ID6A 1NBWA 2RF2A 2V52B 3ZSXA 1X1PA 2D4WA 3H1QA 4CHNA 1W0HA 4FLZA 1L3UA 1HJRA 4BC4A 4LF6K 1DTQA 2RKIA 1WBDA 1EQYA 3O4NA 2VWBA 3KK2A 1QSSA 1ZXOA 3CM6A 3TAQA 2DFEA 2VYPA 1L3VA 4KB0A 4FPAA 1GLFO 2ZM6K 4FWQA 4IFYA 4CGHA 2DTUA 1RTIA 3ULEA 2YKMA 3OA9A 4KRFA 4H5WA 1RFQA 3AO1A 4JS4A 4E3SA 1LW0A 3QETA 2X6SA 3D6RA 4CJWA 3MN7A 5H1SQ 1GLCG 2HNDA 1NK4A 3MN5A 1U2VA 1QQCA 1UAXA 3EKSA 2NRXA 1RT2A 2DY4A 3KK3A 1RTHA 3R8EA 3K9JA 3KD5E 5B8HA 3KVGA 3QBWA 5JMVA 3U6FA 4DSFA 1YIJN 4H5VA 2XY5A 1BUPA 4AHRA 2O8BA 1X3MA 2VCPA 1A5XA 4DF8A 1W97L 5GADP 4M3UA 1SKSA 3R3LA 1K9MO 2Z1IA 4IOCL 4FPBA 3THYB 3DXKB 4OVLA 3RMAA 3IKMA 4PA1A 4QS8A 1NWKA 1D5AA 1NJWA 3M8RA 3GBTA 2QA4N 1SKWA 5FLXO 4MO4A 3KJVA 1VQ6N 5CY4A 5AZIB 4DSKA 1YTUA 1N8RO 4LF7K 1N34K 3AGRA 2J4RA 3K9KA 2R7YA 1YJNN 2QKBA 3KLIA 4IEIA 3UKUB 1K8AO 1YUWA 4JHDA 1BIZA 1JLCA 3MXIA 3THXA 4KH6A 3SCXA 1VSEA 2FBYA 4CJTA 3HP9A 2UUCK 4AM6A 1BOTO 4J2EA 2OPRA 4CEAA 2Q0RA 4CEQA 2VGNA 3VQ7A 4CJ3A 3NVMA 5J2QA 4BR2A 1D9DA 3ZLJA 3DLEA 4FJLA 3CCLN 1WSJA 3S9HA 5AQKA 1KRPA 4DLEA 3QEXA 2KZZA 4C8NA 4CF9A 3QBXA 1GOCA 4ISGA 3BY5A 3SBTA 1QZ5A 2O8DB 1CZAN 3DLRA 4BRGA 4FSVA 2XY6A 3JYTA 1JXBA 2Y1IA 3WEEA 3KWGA 3LAKA 4JD2B 3MEDA 3LANA 4NYNA 1LAWA 5SWMA 4NXNK 4BR7A 1S1XA 4QS9A 4J2BA 2HHVA 4O44A 4DS5A 4CJQA 2QKKA 1CXQA 5C2DA 3D7EO 4DV2K 3ZSOA 1S1VA 2HVIA 3DLKA 4FJMA 2V7ZA 3MWTA 4JAXA 3CPWM 4HUEA 1Y64A 2G8KA 1U6ZA 2P5OA 3MECA 4DFKA 4JI2K 2BTFA 4LD0A 3OYAA 4C8LA 2W40A 3CC4N 4E1NA 4AHTA 3DI6A 5M1NA 2XHBA 5J2NA 3CC7N 2ZF5O 3MXJA 3KKSA 5FROA 4CJSA 3OYLA 1QVFM 4CJKA 3T1HK 2X78A 5AZJB 1HMVA 4CZJA 4CESA 4KH5A 3VENA 2G8HA 4J8FA 5M1FA 2JLEA 1BI4A 3P83D 5AQPA 3SK3A 4C1NI 2UXCK 1Z05A 2G8IA 1EWRA 2RPIA 2I7PA 1X9MA 4JKGB 3LPTA 3LDPA 2W6KA 1S6QA 2HBLA 3QNNA 5A2QO 4TSXA 3L2UA 3K5OA 4GKKK 4H5RA 3MCAB 5BRFA 4DR3K 5C24A 3P1GA 4JKEA 1SQKA 4KHUA 4DFMA 1U48A 4CECA 3SQ4A 1JL1A 3OYEA 4DUYK 3IMXA 3QICA 4BR4A 4HTLA 3WUHA 3QEWA 1T3VA 4CF1A 3G10A 1NGFA 4QCLA 4W5RA 4CEZA 4C23A 4LSLA 4AHVA 4RW7A 1XHXA 4BRAA 4W5QA 4BDZA 4OPKA 3VQBA 3OYFA 4DFJA 5CZ2A 4OLAA 4Z4FA 1HX1A 3W3DA 2FBXA 1D9FA 2IVOA 3Q7BA 1WSHA 4KB1A 1A5WA 5AQTA 1YF5L 3UKRB 4FOEA 3TANA 1Q82O 3EYZA 3OTOK 4FJ5A 4M7XA 1IJJA 1XMOK 4YOWA 1BQMA 3ZSQA 4H4MA 3J7ZO 1OH5A 3LDOA 1ASWA 4B1WB 1QHTA 4KO0A 2OTLN 4B3MK 4B9MA 3RMDA 4WQ4C 2QWRA 3THVA 3CJBA 1VSFA 3J7AP 4F2SA 1KAXA 4RTFD 3I8BA 2WC9A 5I3UA 1IH7A 4BRHA 5F1XA 1WAFA 3U3GA 3V4IA 2KLAA 5BR9A 4H0YB 4DTXA 3E1YA 1YVNA 4ZHRA 4M3TA 5ELZA 2P9PB 3ZCMA 5AZIA 2WOMA 3VETA 1F21A 4BY9C 1VQNN 3CHWA 4AQYK 3ENHA 1J54A 2ZWHA 3O9RA 3SV3A 3VQPA 2UUAK 4RG8A 3BEXA 3S3MA 1HR0K 4CERA 1RT1A 2ATQA 4BQLA 4GY2B 1JCEA 4FWSA 3LP2A 1TAUA 1KVBA 4HWIA 1XUPO 3HM9A 3QEPA 3AV9A 3DRPA 4O4GA 4WF9L 4MO5A 3VEYA 3ZEUA 3F73A 5IT9O 3CCRN 1SKRA 4KHYA 3T19A 4HUGA 2O8FA 4Z4CA 1N32K 2A1SA 2P9KB 4WE1A 3G4SN 4DTPA 2IIRA 1QQMA 2HHQA 4B1XB 4JNEA 3ALYA 2FXUA 1S1UA 4JKAA 1XNQK 2ETJA 4FVUA 4Z94A 4M41A 3EN9A 4CK1A 5JVHL 1Q9YA 3AO2A 1ESVA 5CYQA 4CGGA 5BPLA 5J2MA 1EO1A 3C7NB 1J53A 1IKWA 3VGLA 4DTJA 3HYFA 5GIOA 4IOXA 4BC3A 4NCBA 3LZIA 3LWMA 4X64K 1OKJA 3ZT3A 5LMNK 1IBLK 5T7BA 1Q9XA 3GDQA 4WYBA 4K8XA 4KHPK 3O3FA 1CZ9A 3M8PA 4BGBA 3NH2A 3CFPA 4Z4GA 4OGEA 3Q7CA 1XC9A 3LP1A 1OVQA 2OANA 2VG7A 2HVHA 3ULEB 1SS6A 4DLGA 1YI2N 4JI7K 3VEXA 2G8WA 2HW3A 1LOTB 1REVA 4AILC 4FVMA 4H8KA 2XY8A 4A5BA 3LDQA 5AZJA 1S5JA 4KHNA 1TK8A 3FZLA 5EY4A 2P9UB 2YI1A 3O3HA 4KTWA 2Q3SA 1U2VB 1B92A 3O4QA 3VA0A 4E7KA 2E1YA 1WSIA 4DTRA 2XO7A 3TU5A 4JI1K 3RSEB 3AO4A 4DG1A 3OS1A 2O8CA 1SV5A 2P9LB 1DTTA 5E26A 3NH0A 2OTJN 3LL3A 1GOAA 1KAYA 3EZ5A 2QEXN 4CJFA 4IO9L 1QQOA 3C6AA 5IWAK 2GWJA 4X62K 1V4SA 2O8BB 1VSMA 3A5MC 1RTDA 1X3NA 1EWQA 3VMFB 4WQ4A 1EP4A 4N56A 2A3ZA 4R79A 3O9SA 4EZ9A 4YORA 1ZC6A 4NO7A 3CCEN 3OS2A 1VQ8N 5AQIA 1HQEA 2NRWA 4WCEL 1NKBA 1HKBA 4H5TA 3CCQN 3EKUA 1UA0A 2YNGA 2BE2A 3HP6A 2P9IA 4L3QA 1S9EA 3VQ6A 2HB5A 1OH8A 3K58A 2FSKA 4QAGA 4BRIA 4EP4A 3TABA 4O0IA 4GV9A 2HHUA 2B6AA 3THXB 1I94K 4JEPA 4JV5K 4EAHD 4DV0K 3OVNA 3AO3A 4JN4A 3DJCA 4CJUA 4B1ZA 4NXMK 3AVHA 4CGFA 1E4GT 4BG9A 1RDWX 4FLTA 1Q7YO 4YY3K 4K41A 3ENBA 5BN9A
chains in the Genus database with same CATH topology
3SPYA 1EX4A 1NOYA 3OYCA 3V6DA 2XY7A 2KTQA 3U6FA 2BDPA 1B9DA 1JLAA 1LAVA 1NJXA 4DSFA 3OYJA 3SYZA 4DTUA 2XY5A 4PUOA 2YKNA 2ZE2A 4AHRA 3QLHA 4BWMA 1NJZA 1A5XA 4DF8A 4DU4A 4RW4A 3C6TA 4M3UA 1BCMA 3QERA 3BGRA 1SKSA 2HHTA 5HRNA 1TL1A 2Z1IA 3MEGA 4CGIA 4FM1A 3V1RA 3VQAA 1S1TA 5HRRA 1L3TA 4BWJA 1RDDA 1KLMA 4OVLA 4PA1A 3TAGA 3RMAA 3CQ8A 3IAYA 4F8RA 4FJKA 3ULDA 1HNVA 2EX3A 3HPGA 4ELUA 4F3TA 1D5AA 3SI6A 1NJWA 3M8RA 2FBVA 2O4IA 3F9KA 3DYAA 4FJXA 5FRNA 2KZMA 1SKWA 5FRMA 1RBRA 3KJVA 3ZSRA 4DWIA 5CY4A 3NAEA 4DSKA 1YTUA 1XI1A 3HJFA 1JKHA 2Z1JA 2BANA 2PZSA 3O3GA 2KW4A 3DMJA 4DMNA 1U4BA 4IKFA 2R7YA 3TARA 1JXEA 1TKXA 3K5MA 3QESA 1HRHA 3LPUA 2QKBA 3QINA 1G15A 2OPSA 3ITHA 3KLIA 4CJVA 3PX6A 1ZBIA 3HK2A 4JLHA 1BIZA 1BQNA 1Y97A 1JLCA 2IAJA 4G1QA 3MXIA 2HMIA 4FJ9A 3AVMA 4DU1A 4KHQA 3SCXA 5CYMA 4FZZA 1HQUA 4B9UA 1S9GA 1VSEA 1IO2A 2FBYA 4CJTA 3HP9A 1VSIA 1BGXT 1SL2A 4J2EA 2OPRA 2KFNA 4CEAA 1UOCA 1YT3A 1HYVA 1W9HA 3LAMA 1TV6A 4ID5A 3VQ7A 1B9FA 2DFFA 4CEQA 4CJ3A 3OJUA 1U47A 4KAZA 5J2QA 3TWHA 3LZJA 3OYNA 5I42A 1D9DA 3NGIA 2I5JA 3DLEA 4FJLA 4BE1A 1WSJA 3S9HA 2E6LA 1CZBA 1NK9A 1KRPA 3DRSA 3NCIA 3AA3A 1JLQA 4LH4A 4DLEA 3QEXA 2KZZA 3K59A 4C8NA 3K5NA 4CF9A 1YTAA 1GOCA 3NGZA 3S3OA 2ZQBA 4B8CA 4FLWA 5J2PA 3LP3A 4KV8A 5FDLA 3IS9A 1NK5A 4DQRA 4FJHA 3HL8A 4KHWA 3DLRA 1X9WA 3HVTA 1J5OA 3AVBA 3ZT1A 4EP5A 4CFAA 2XY6A 4FK4A 3KIOA 1YVUA 3OJSA 1JXBA 3JYTA 2F8SA 4DTOA 2D0CA 2Y1IA 1J9AA 3V9SA 1X9SA 2ZD1A 4FJJA 3LAKA 1TAQA 3V9XA 3MEDA 3U3YA 4F4KA 4B3OA 3E01A 3LANA 4NYNA 1LAWA 2YHBA 1KFSA 5SWMA 4KHSA 5HLFA 4NCAA 2YNFA 4OKEA 3FFIA 4N5SA 1D8YA 3SUOA 1S1XA 1TK0A 2X74A 1UA1A 4J2BA 4ELTA 2G8VA 4W5TA 2FC0A 2HHVA 4FLXA 4O44A 3OYIA 4DS5A 4QOZB 4CJQA 2QKKA 1CXQA 2OZMA 2HHSA 4AH9A 3ZSOA 4CEDA 4UQGA 1DLOA 1S1VA 3VQQA 1NK0A 2HVIA 1BL3A 3I8DA 3V9ZA 1RBUA 3DLKA 4FJMA 3AVLA 4FZXC 4KFBA 4E7JA 5KTQA 4PWDA 3L2WA 1QTMA 4HUEA 2G8KA 3SPZA 3AA5X 2P5OA 3MECA 3NF9A 5DK5A 3ZSWA 4DFKA 3C95A 4R5PA 4DSJA 4LD0A 3PV8A 3OYAA 4O5BA 2P5GA 4C8LA 1VSKA 4CEBA 1U45A 5E41A 4E1NA 4AHTA 3DI6A 5J2NA 2XHBA 2HNYA 3MXJA 4B9VA 1NKEA 3KKSA 5FROA 4CJSA 4CEEA 3OYLA 4O55A 1VSLA 3WNEA 4CJKA 4ICLA 2X78A 4LSNA 3AVAA 1FXXA 3K57A 3CFRA 1HMVA 2E4LA 4DTNA 3C6UA 3KD1E 1C0MA 4LH5A 3KLHA 3V9UA 2OA8A 2D0AA 1JLEA 5HRPA 4CESA 1L3SA 2KQ2A 3NH1A 3DM2A 1TKDA 2G8HA 2BGGA 4FM2A 4FLYA 2JLEA 1WAJA 3D45A 4L8RB 4IG0A 1RBTA 1KVCA 1BI4A 3P83D 5DMRA 4ZTJA 4CJ4A 2G8IA 2D5RA 4FM0A 2RPIA 1FKOA 3KK1A 4Y1CA 4DQQA 4CGJA 1X9MA 3RR7A 3PX4A 3NGYA 2ITGA 3LPTA 3HT3A 2IC3A 2F96A 1LWCA 1I39A 1S6QA 3QNNA 1Q8IA 1HYSA 4KTZA 4TSXA 3L2UA 3K5OA 4Q0BA 3SQ2A 2XRIA 3CFOA 3K5LA 3NE6A 2YHAA 3MXMA 1TL3A 3P1GA 4FW1A 5C24A 4ZTFA 1RT5A 3HSTB 4KHUA 4KPYA 5JS2A 2YNIA 4BE0A 3QIPA 4DFMA 1QSLA 1SL1A 1U48A 4CECA 3SQ4A 1KFDA 1BHLA 2KFZA 1JL1A 3OYEA 3V1QA 2VG6A 4E89A 3VQEA 4CF2A 3QEVA 4IBNA 2GBZA 4OKJA 3VQ9A 2B4JA 5C25A 3TAEA 2PYJA 3QEWA 4CF1A 3G10A 1WSGA 4QCLA 4HUFA 1T05A 4AHUA 4W5RA 4YNQA 1CXUA 4CK3A 1TVRA 4CEZA 3JSMA 4LSLA 4AHVA 4RW7A 1XHXA 4W5QA 4BDZA 4FJGA 4OGCA 4OPKA 3VQBA 1QSYA 3OYFA 4DFJA 1GOBA 2EHGA 5CZ2A 4XIUA 4OLAA 4Z4FA 1QS4A 3VN5A 1LW2A 2FBXA 1D9FA 4CHOA 4KB1A 1S1WA 1WSHA 1A5WA 3RRGA 4M3RA 3TANA 4LY7A 3AVFA 1C6VA 3EYZA 1JLBA 4H4OA 4FJ5A 2GUIA 3WNHA 4Q5VA 3PO4A 4DTSA 1ZBUA 1EXQA 3AVGA 3MEEA 3VQDA 3SUNA 1BQMA 3ZSQA 2LSNA 4H4MA 1RBVA 1RTJA 4KKOA 3AVCA 4I7FA 4MFBA 1ASWA 3OYBA 1QHTA 1WLJA 4KO0A 4CIFA 1RCHA 4B9MA 3KLGA 5C42A 3PO5A 3RMDA 3DOKA 2IDOA 3DLGA 1RBSA 3THVA 4BDYA 3PUFA 5KI6A 3SQ0A 1N6QA 1RT4A 3IG1A 1VSFA 3T3FA 4FK2A 4F2SA 4DSLA 3HVRA 3L2VA 4JRQA 4CK2A 1MU2A 1FK9A 1JLFA 1IH7A 1C0TA 2P1JA 1WAFA 4Z0UA 3U3GA 4DQSA 1T03A 3V4IA 3VQCA 4DTXA 4HCCA 4CHPA 2WONA 5I3UA 4ZHRA 3M8QA 5KRSA 4M3TA 3HPHA 3L3UA 2HNZA 3L2RA 4DSEA 1SUQA 3ZCMA 3ZT0A 1LV5A 4K8ZA 4JRPA 4GW6A 2WOMA 1F21A 2QK9A 3SQ1A 1S6PA 1RNHA 2VG5A 3P5JA 3VQ4A 1J54A 3HPOA 3SV3A 4NYFA 1EKEA 1HNIA 1N5YA 4M3WA 3VQPA 2OYQA 4RG8A 1C0UA 3S3MA 4C8OA 3RRHA 1LWFA 3EY1A 4CERA 1JLGA 4M42A 4Y1DA 4M3XA 2VWJA 1RT1A 1TGOA 1IKYA 2ATQA 3VQ8A 5CZ1A 1KLNA 3OYHA 4E7LA 1NK8A 1R0AA 4RW8A 1O1WA 4B8AB 1WSFA 3LP2A 1TAUA 2F8TA 1KVBA 2E6MA 3SNNA 4DTMA 3DRRA 3HM9A 3SZ2A 2FBTA 2Z1HA 3QEPA 3AV9A 3DRPA 4MQ3A 4O4GA 4OPJA 1SL0A 4HCBA 1KVAA 1RT7A 1RT6A 1Z26A 3ZT2A 3TAFA 4CGDA 4ID1A 4BDPA 4GVMA 1VRUA 4CJPA 3NFAA 1NK7A 3F73A 4FJIA 1SKRA 4KHYA 3T19A 3ASMA 1T7PA 3NBPA 3S3NA 5HRSA 4HUGA 4GMJB 3ZSVA 4AHSA 3DOLA 5KGWA 4Z4CA 3VA3A 2G8UA 3L2QA 3V1OA 3KLFA 2A1SA 4WE1A 5EU7A 4DTPA 3SUPA 3L3VA 1NOZA 2HHQA 1WSEA 3TAMA 3TR8A 1KTQA 3CYMA 4AHCA 4CIGA 3RMCA 4HHTA 3QNOA 4CEOA 5HROA 3OYMA 4FJ7A 4C8MA 2RN2A 3ALYA 3ZSZA 1S1UA 1XHZA 4BACA 2ETJA 5KRTA 4F2RA 4E0DA 4CJEA 1VK0A 3A2FA 4CHQA 4E7HA 2A1RA 2G8FA 2HHWA 3QIOA 4M41A 1T8EA 3OYDA 3KLEA 3AVNA 4DS4A 2OZSA 3CG7A 4B9SA 5SZTA 4CK1A 2OPQA 1Q9YA 3AO2A 4E19A 5CYQA 4CGGA 5J2MA 3SJJA 1L5UA 2X6NA 3WNFA 4PY5A 3OY9A 4I2PA 3LDSA 4Z4IA 1J53A 2W42A 1IKWA 3MAQA 4JS5A 1NKCA 4Z4HA 4DTJA 3DLBA 3HYFA 1QE1A 4CHYA 1K6YA 4KI4A 3TAPA 3AA2A 4CCHA 4OJRA 2YV0X 1A5VA 4F3OA 4NCBA 3LZIA 3UIQA 3LWMA 1IG9A 1U49A 4J2DA 3ZT3A 3RTVA 3SV4A 4CFDA 1NK6A 1C1AA 4CJRA 3CM5A 3K2PA 5T7BA 3C94A 1Q9XA 4DQPA 4K8XA 1FKPA 1TKZA 1I3AA 4DF4A 5J1EA 3O3FA 1CZ9A 1HYZA 1IKVA 3M8PA 3I0RA 4HVJA 3NH2A 3CFPA 1TKTA 3AVJA 4HTUA 1TK5A 1C1CA 3M8SA 3PY8A 4Z4GA 4OGEA 4B9LA 2IGIA 1XC9A 3LP1A 2HVHA 2VG7A 3V9WA 3HXMA 4DLGA 3LWLA 3SUQA 4CFBA 3BDPA 4O0JA 3V81A 4W5OA 2G8WA 2HW3A 4FYDA 1REVA 4IFVA 4DSIA 4AILC 1RT3A 3KKRA 3I0SA 4FVMA 4H8KA 3T1AA 1IKXA 4NCGA 3L8BA 3TI0A 2XY8A 2Y1JA 1KSPA 4DQIA 3ZSYA 4BE2A 4FJNA 1U04A 3KTQA 1S5JA 4KHNA 3LALA 3IRXA 4CF8A 1TK8A 1XWLA 1VSHA 3O3HA 3VQ5A 4YFUA 4KTWA 2Q3SA 3QO9A 4C8KA 3NF6A 1B92A 3O4QA 1RDBA 5HBMA 3VA0A 3OYGA 4CF0A 4E7KA 1WSIA 2Z1GA 4DTRA 4B9TA 2PYLA 4KTQA 4FK0A 4OKKA 2XO7A 4FXDA 1JL2A 3AO4A 4DG1A 3HO1A 3OS1A 1WNSA 4CIEA 1SV5A 1DTTA 3NH0A 3AA4A 3D0PA 1GOAA 1VSJA 2DFHA 2GV9A 3EZ5A 1LWEA 3NF7A 2HHXA 1CLQA 5K14A 4CJFA 3RMBA 3DLHA 1ASVA 1RDCA 3ISNC 4RW6A 1KCFA 1VSMA 5KGXA 3RWUA 1BI4B 1BISA 5HP1A 1RTDA 3AVKA 1ZBFA 4EZ6A 4PQUA 4IG3A 4DFPA 4W5NA 1EETA 3H08A 1EP4A 1VRTA 4N56A 1ASUA 4N41A 4ELVA 3NHGA 4J2AA 3B6PA 2IOCA 4N76A 4EZ9A 4FLUA 4CJLA 3OS2A 1ZBHA 5D3GA 1NJYA 1HQEA 4OLBA 3NF8A 2NUBA 2RF2A 1C1BA 2O4GA 1NKBA 4FW2A 3WNGA 5JS1A 3ZSXA 1X1PA 2JGUA 4CHNA 1W0HA 4FLZA 1UA0A 1HJRA 1ZYQA 1L3UA 4M3YA 2YNGA 2QXFA 1DTQA 2RKIA 2BE2A 1ITGA 1UWBA 3O4NA 3HP6A 4I9LA 4E7IA 3OYKA 3KK2A 1WN7A 1QSSA 3TAQA 3CM6A 2DFEA 4I2QA 1S9EA 4M45A 3VQ6A 2HB5A 4FLVA 4B9NA 4M3ZA 4CEFA 1L3VA 1VSDA 4KB0A 1HPZA 4N47A 3K58A 4IFYA 4QAGA 4CGHA 4EP4A 3TABA 4O0IA 1RTIA 3QEIA 2HHUA 2B6AA 2DTUA 4E1MA 1RDAA 3AVIA 2YKMA 2YNHA 2PY5A 4KI6A 4IDKA 4CE9A 3ZT4A 4KRFA 2IS3A 3NDKA 3PX0A 3AO1A 4JS4A 3B6OA 4E3SA 2P51A 3OVNA 1LW0A 4DU3A 3AO3A 2VWKA 3QETA 2X6SA 2D0BA 3AO5A 1ZBLA 4CJWA 4CJUA 4FZYA 3AVHA 4FJ8A 2HNDA 4CHZA 2OPPA 4CGFA 4CJ5A 1NK4A 4I9QA 4KREA 2AJQA 2B5JA 1QQCA 1UAXA 1Z25A 4RW9A 3OS0A 1RT2A 1RILA 4FLTA 1BCOA 3LP0A 3RR8A 2DY4A 3KK3A 1BIUA 3G0ZA 1RTHA 4Z4EA 4CFCA 4B08A 3KD5E 4FCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPY A;  1EX4 A;  1NOY A;  3OYC A;  3V6D A;  2XY7 A;  2KTQ A;  3U6F A;  2BDP A;  1B9D A;  1JLA A;  1LAV A;  1NJX A;  4DSF A;  3OYJ A;  3SYZ A;  4DTU A;  2XY5 A;  4PUO A;  2YKN A;  2ZE2 A;  4AHR A;  3QLH A;  4BWM A;  1NJZ A;  1A5X A;  4DF8 A;  4DU4 A;  4RW4 A;  3C6T A;  4M3U A;  1BCM A;  3QER A;  3BGR A;  1SKS A;  2HHT A;  5HRN A;  1TL1 A;  2Z1I A;  3MEG A;  4CGI A;  4FM1 A;  3V1R A;  3VQA A;  1S1T A;  5HRR A;  1L3T A;  4BWJ A;  1RDD A;  1KLM A;  4OVL A;  4PA1 A;  3TAG A;  3RMA A;  3CQ8 A;  3IAY A;  4F8R A;  4FJK A;  3ULD A;  1HNV A;  2EX3 A;  3HPG A;  4ELU A;  4F3T A;  1D5A A;  3SI6 A;  1NJW A;  3M8R A;  2FBV A;  2O4I A;  3F9K A;  3DYA A;  4FJX A;  5FRN A;  2KZM A;  1SKW A;  5FRM A;  1RBR A;  3KJV A;  3ZSR A;  4DWI A;  5CY4 A;  3NAE A;  4DSK A;  1YTU A;  1XI1 A;  3HJF A;  1JKH A;  2Z1J A;  2BAN A;  2PZS A;  3O3G A;  2KW4 A;  3DMJ A;  4DMN A;  1U4B A;  4IKF A;  2R7Y A;  3TAR A;  1JXE A;  1TKX A;  3K5M A;  3QES A;  1HRH A;  3LPU A;  2QKB A;  3QIN A;  1G15 A;  2OPS A;  3ITH A;  3KLI A;  4CJV A;  3PX6 A;  1ZBI A;  3HK2 A;  4JLH A;  1BIZ A;  1BQN A;  1Y97 A;  1JLC A;  2IAJ A;  4G1Q A;  3MXI A;  2HMI A;  4FJ9 A;  3AVM A;  4DU1 A;  4KHQ A;  3SCX A;  5CYM A;  4FZZ A;  1HQU A;  4B9U A;  1S9G A;  1VSE A;  1IO2 A;  2FBY A;  4CJT A;  3HP9 A;  1VSI A;  1BGX T;  1SL2 A;  4J2E A;  2OPR A;  2KFN A;  4CEA A;  1UOC A;  1YT3 A;  1HYV A;  1W9H A;  3LAM A;  1TV6 A;  4ID5 A;  3VQ7 A;  1B9F A;  2DFF A;  4CEQ A;  4CJ3 A;  3OJU A;  1U47 A;  4KAZ A;  5J2Q A;  3TWH A;  3LZJ A;  3OYN A;  5I42 A;  1D9D A;  3NGI A;  2I5J A;  3DLE A;  4FJL A;  4BE1 A;  1WSJ A;  3S9H A;  2E6L A;  1CZB A;  1NK9 A;  1KRP A;  3DRS A;  3NCI A;  3AA3 A;  1JLQ A;  4LH4 A;  4DLE A;  3QEX A;  2KZZ A;  3K59 A;  4C8N A;  3K5N A;  4CF9 A;  1YTA A;  1GOC A;  3NGZ A;  3S3O A;  2ZQB A;  4B8C A;  4FLW A;  5J2P A;  3LP3 A;  4KV8 A;  5FDL A;  3IS9 A;  1NK5 A;  4DQR A;  4FJH A;  3HL8 A;  4KHW A;  3DLR A;  1X9W A;  3HVT A;  1J5O A;  3AVB A;  3ZT1 A;  4EP5 A;  4CFA A;  2XY6 A;  4FK4 A;  3KIO A;  1YVU A;  3OJS A;  1JXB A;  3JYT A;  2F8S A;  4DTO A;  2D0C A;  2Y1I A;  1J9A A;  3V9S A;  1X9S A;  2ZD1 A;  4FJJ A;  3LAK A;  1TAQ A;  3V9X A;  3MED A;  3U3Y A;  4F4K A;  4B3O A;  3E01 A;  3LAN A;  4NYN A;  1LAW A;  2YHB A;  1KFS A;  5SWM A;  4KHS A;  5HLF A;  4NCA A;  2YNF A;  4OKE A;  3FFI A;  4N5S A;  1D8Y A;  3SUO A;  1S1X A;  1TK0 A;  2X74 A;  1UA1 A;  4J2B A;  4ELT A;  2G8V A;  4W5T A;  2FC0 A;  2HHV A;  4FLX A;  4O44 A;  3OYI A;  4DS5 A;  4QOZ B;  4CJQ A;  2QKK A;  1CXQ A;  2OZM A;  2HHS A;  4AH9 A;  3ZSO A;  4CED A;  4UQG A;  1DLO A;  1S1V A;  3VQQ A;  1NK0 A;  2HVI A;  1BL3 A;  3I8D A;  3V9Z A;  1RBU A;  3DLK A;  4FJM A;  3AVL A;  4FZX C;  4KFB A;  4E7J A;  5KTQ A;  4PWD A;  3L2W A;  1QTM A;  4HUE A;  2G8K A;  3SPZ A;  3AA5 X;  2P5O A;  3MEC A;  3NF9 A;  5DK5 A;  3ZSW A;  4DFK A;  3C95 A;  4R5P A;  4DSJ A;  4LD0 A;  3PV8 A;  3OYA A;  4O5B A;  2P5G A;  4C8L A;  1VSK A;  4CEB A;  1U45 A;  5E41 A;  4E1N A;  4AHT A;  3DI6 A;  5J2N A;  2XHB A;  2HNY A;  3MXJ A;  4B9V A;  1NKE A;  3KKS A;  5FRO A;  4CJS A;  4CEE A;  3OYL A;  4O55 A;  1VSL A;  3WNE A;  4CJK A;  4ICL A;  2X78 A;  4LSN A;  3AVA A;  1FXX A;  3K57 A;  3CFR A;  1HMV A;  2E4L A;  4DTN A;  3C6U A;  3KD1 E;  1C0M A;  4LH5 A;  3KLH A;  3V9U A;  2OA8 A;  2D0A A;  1JLE A;  5HRP A;  4CES A;  1L3S A;  2KQ2 A;  3NH1 A;  3DM2 A;  1TKD A;  2G8H A;  2BGG A;  4FM2 A;  4FLY A;  2JLE A;  1WAJ A;  3D45 A;  4L8R B;  4IG0 A;  1RBT A;  1KVC A;  1BI4 A;  3P83 D;  5DMR A;  4ZTJ A;  4CJ4 A;  2G8I A;  2D5R A;  4FM0 A;  2RPI A;  1FKO A;  3KK1 A;  4Y1C A;  4DQQ A;  4CGJ A;  1X9M A;  3RR7 A;  3PX4 A;  3NGY A;  2ITG A;  3LPT A;  3HT3 A;  2IC3 A;  2F96 A;  1LWC A;  1I39 A;  1S6Q A;  3QNN A;  1Q8I A;  1HYS A;  4KTZ A;  4TSX A;  3L2U A;  3K5O A;  4Q0B A;  3SQ2 A;  2XRI A;  3CFO A;  3K5L A;  3NE6 A;  2YHA A;  3MXM A;  1TL3 A;  3P1G A;  4FW1 A;  5C24 A;  4ZTF A;  1RT5 A;  3HST B;  4KHU A;  4KPY A;  5JS2 A;  2YNI A;  4BE0 A;  3QIP A;  4DFM A;  1QSL A;  1SL1 A;  1U48 A;  4CEC A;  3SQ4 A;  1KFD A;  1BHL A;  2KFZ A;  1JL1 A;  3OYE A;  3V1Q A;  2VG6 A;  4E89 A;  3VQE A;  4CF2 A;  3QEV A;  4IBN A;  2GBZ A;  4OKJ A;  3VQ9 A;  2B4J A;  5C25 A;  3TAE A;  2PYJ A;  3QEW A;  4CF1 A;  3G10 A;  1WSG A;  4QCL A;  4HUF A;  1T05 A;  4AHU A;  4W5R A;  4YNQ A;  1CXU A;  4CK3 A;  1TVR A;  4CEZ A;  3JSM A;  4LSL A;  4AHV A;  4RW7 A;  1XHX A;  4W5Q A;  4BDZ A;  4FJG A;  4OGC A;  4OPK A;  3VQB A;  1QSY A;  3OYF A;  4DFJ A;  1GOB A;  2EHG A;  5CZ2 A;  4XIU A;  4OLA A;  4Z4F A;  1QS4 A;  3VN5 A;  1LW2 A;  2FBX A;  1D9F A;  4CHO A;  4KB1 A;  1S1W A;  1WSH A;  1A5W A;  3RRG A;  4M3R A;  3TAN A;  4LY7 A;  3AVF A;  1C6V A;  3EYZ A;  1JLB A;  4H4O A;  4FJ5 A;  2GUI A;  3WNH A;  4Q5V A;  3PO4 A;  4DTS A;  1ZBU A;  1EXQ A;  3AVG A;  3MEE A;  3VQD A;  3SUN A;  1BQM A;  3ZSQ A;  2LSN A;  4H4M A;  1RBV A;  1RTJ A;  4KKO A;  3AVC A;  4I7F A;  4MFB A;  1ASW A;  3OYB A;  1QHT A;  1WLJ A;  4KO0 A;  4CIF A;  1RCH A;  4B9M A;  3KLG A;  5C42 A;  3PO5 A;  3RMD A;  3DOK A;  2IDO A;  3DLG A;  1RBS A;  3THV A;  4BDY A;  3PUF A;  5KI6 A;  3SQ0 A;  1N6Q A;  1RT4 A;  3IG1 A;  1VSF A;  3T3F A;  4FK2 A;  4F2S A;  4DSL A;  3HVR A;  3L2V A;  4JRQ A;  4CK2 A;  1MU2 A;  1FK9 A;  1JLF A;  1IH7 A;  1C0T A;  2P1J A;  1WAF A;  4Z0U A;  3U3G A;  4DQS A;  1T03 A;  3V4I A;  3VQC A;  4DTX A;  4HCC A;  4CHP A;  2WON A;  5I3U A;  4ZHR A;  3M8Q A;  5KRS A;  4M3T A;  3HPH A;  3L3U A;  2HNZ A;  3L2R A;  4DSE A;  1SUQ A;  3ZCM A;  3ZT0 A;  1LV5 A;  4K8Z A;  4JRP A;  4GW6 A;  2WOM A;  1F21 A;  2QK9 A;  3SQ1 A;  1S6P A;  1RNH A;  2VG5 A;  3P5J A;  3VQ4 A;  1J54 A;  3HPO A;  3SV3 A;  4NYF A;  1EKE A;  1HNI A;  1N5Y A;  4M3W A;  3VQP A;  2OYQ A;  4RG8 A;  1C0U A;  3S3M A;  4C8O A;  3RRH A;  1LWF A;  3EY1 A;  4CER A;  1JLG A;  4M42 A;  4Y1D A;  4M3X A;  2VWJ A;  1RT1 A;  1TGO A;  1IKY A;  2ATQ A;  3VQ8 A;  5CZ1 A;  1KLN A;  3OYH A;  4E7L A;  1NK8 A;  1R0A A;  4RW8 A;  1O1W A;  4B8A B;  1WSF A;  3LP2 A;  1TAU A;  2F8T A;  1KVB A;  2E6M A;  3SNN A;  4DTM A;  3DRR A;  3HM9 A;  3SZ2 A;  2FBT A;  2Z1H A;  3QEP A;  3AV9 A;  3DRP A;  4MQ3 A;  4O4G A;  4OPJ A;  1SL0 A;  4HCB A;  1KVA A;  1RT7 A;  1RT6 A;  1Z26 A;  3ZT2 A;  3TAF A;  4CGD A;  4ID1 A;  4BDP A;  4GVM A;  1VRU A;  4CJP A;  3NFA A;  1NK7 A;  3F73 A;  4FJI A;  1SKR A;  4KHY A;  3T19 A;  3ASM A;  1T7P A;  3NBP A;  3S3N A;  5HRS A;  4HUG A;  4GMJ B;  3ZSV A;  4AHS A;  3DOL A;  5KGW A;  4Z4C A;  3VA3 A;  2G8U A;  3L2Q A;  3V1O A;  3KLF A;  2A1S A;  4WE1 A;  5EU7 A;  4DTP A;  3SUP A;  3L3V A;  1NOZ A;  2HHQ A;  1WSE A;  3TAM A;  3TR8 A;  1KTQ A;  3CYM A;  4AHC A;  4CIG A;  3RMC A;  4HHT A;  3QNO A;  4CEO A;  5HRO A;  3OYM A;  4FJ7 A;  4C8M A;  2RN2 A;  3ALY A;  3ZSZ A;  1S1U A;  1XHZ A;  4BAC A;  2ETJ A;  5KRT A;  4F2R A;  4E0D A;  4CJE A;  1VK0 A;  3A2F A;  4CHQ A;  4E7H A;  2A1R A;  2G8F A;  2HHW A;  3QIO A;  4M41 A;  1T8E A;  3OYD A;  3KLE A;  3AVN A;  4DS4 A;  2OZS A;  3CG7 A;  4B9S A;  5SZT A;  4CK1 A;  2OPQ A;  1Q9Y A;  3AO2 A;  4E19 A;  5CYQ A;  4CGG A;  5J2M A;  3SJJ A;  1L5U A;  2X6N A;  3WNF A;  4PY5 A;  3OY9 A;  4I2P A;  3LDS A;  4Z4I A;  1J53 A;  2W42 A;  1IKW A;  3MAQ A;  4JS5 A;  1NKC A;  4Z4H A;  4DTJ A;  3DLB A;  3HYF A;  1QE1 A;  4CHY A;  1K6Y A;  4KI4 A;  3TAP A;  3AA2 A;  4CCH A;  4OJR A;  2YV0 X;  1A5V A;  4F3O A;  4NCB A;  3LZI A;  3UIQ A;  3LWM A;  1IG9 A;  1U49 A;  4J2D A;  3ZT3 A;  3RTV A;  3SV4 A;  4CFD A;  1NK6 A;  1C1A A;  4CJR A;  3CM5 A;  3K2P A;  5T7B A;  3C94 A;  1Q9X A;  4DQP A;  4K8X A;  1FKP A;  1TKZ A;  1I3A A;  4DF4 A;  5J1E A;  3O3F A;  1CZ9 A;  1HYZ A;  1IKV A;  3M8P A;  3I0R A;  4HVJ A;  3NH2 A;  3CFP A;  1TKT A;  3AVJ A;  4HTU A;  1TK5 A;  1C1C A;  3M8S A;  3PY8 A;  4Z4G A;  4OGE A;  4B9L A;  2IGI A;  1XC9 A;  3LP1 A;  2HVH A;  2VG7 A;  3V9W A;  3HXM A;  4DLG A;  3LWL A;  3SUQ A;  4CFB A;  3BDP A;  4O0J A;  3V81 A;  4W5O A;  2G8W A;  2HW3 A;  4FYD A;  1REV A;  4IFV A;  4DSI A;  4AIL C;  1RT3 A;  3KKR A;  3I0S A;  4FVM A;  4H8K A;  3T1A A;  1IKX A;  4NCG A;  3L8B A;  3TI0 A;  2XY8 A;  2Y1J A;  1KSP A;  4DQI A;  3ZSY A;  4BE2 A;  4FJN A;  1U04 A;  3KTQ A;  1S5J A;  4KHN A;  3LAL A;  3IRX A;  4CF8 A;  1TK8 A;  1XWL A;  1VSH A;  3O3H A;  3VQ5 A;  4YFU A;  4KTW A;  2Q3S A;  3QO9 A;  4C8K A;  3NF6 A;  1B92 A;  3O4Q A;  1RDB A;  5HBM A;  3VA0 A;  3OYG A;  4CF0 A;  4E7K A;  1WSI A;  2Z1G A;  4DTR A;  4B9T A;  2PYL A;  4KTQ A;  4FK0 A;  4OKK A;  2XO7 A;  4FXD A;  1JL2 A;  3AO4 A;  4DG1 A;  3HO1 A;  3OS1 A;  1WNS A;  4CIE A;  1SV5 A;  1DTT A;  3NH0 A;  3AA4 A;  3D0P A;  1GOA A;  1VSJ A;  2DFH A;  2GV9 A;  3EZ5 A;  1LWE A;  3NF7 A;  2HHX A;  1CLQ A;  5K14 A;  4CJF A;  3RMB A;  3DLH A;  1ASV A;  1RDC A;  3ISN C;  4RW6 A;  1KCF A;  1VSM A;  5KGX A;  3RWU A;  1BI4 B;  1BIS A;  5HP1 A;  1RTD A;  3AVK A;  1ZBF A;  4EZ6 A;  4PQU A;  4IG3 A;  4DFP A;  4W5N A;  1EET A;  3H08 A;  1EP4 A;  1VRT A;  4N56 A;  1ASU A;  4N41 A;  4ELV A;  3NHG A;  4J2A A;  3B6P A;  2IOC A;  4N76 A;  4EZ9 A;  4FLU A;  4CJL A;  3OS2 A;  1ZBH A;  5D3G A;  1NJY A;  1HQE A;  4OLB A;  3NF8 A;  2NUB A;  2RF2 A;  1C1B A;  2O4G A;  1NKB A;  4FW2 A;  3WNG A;  5JS1 A;  3ZSX A;  1X1P A;  2JGU A;  4CHN A;  1W0H A;  4FLZ A;  1UA0 A;  1HJR A;  1ZYQ A;  1L3U A;  4M3Y A;  2YNG A;  2QXF A;  1DTQ A;  2RKI A;  2BE2 A;  1ITG A;  1UWB A;  3O4N A;  3HP6 A;  4I9L A;  4E7I A;  3OYK A;  3KK2 A;  1WN7 A;  1QSS A;  3TAQ A;  3CM6 A;  2DFE A;  4I2Q A;  1S9E A;  4M45 A;  3VQ6 A;  2HB5 A;  4FLV A;  4B9N A;  4M3Z A;  4CEF A;  1L3V A;  1VSD A;  4KB0 A;  1HPZ A;  4N47 A;  3K58 A;  4IFY A;  4QAG A;  4CGH A;  4EP4 A;  3TAB A;  4O0I A;  1RTI A;  3QEI A;  2HHU A;  2B6A A;  2DTU A;  4E1M A;  1RDA A;  3AVI A;  2YKM A;  2YNH A;  2PY5 A;  4KI6 A;  4IDK A;  4CE9 A;  3ZT4 A;  4KRF A;  2IS3 A;  3NDK A;  3PX0 A;  3AO1 A;  4JS4 A;  3B6O A;  4E3S A;  2P51 A;  3OVN A;  1LW0 A;  4DU3 A;  3AO3 A;  2VWK A;  3QET A;  2X6S A;  2D0B A;  3AO5 A;  1ZBL A;  4CJW A;  4CJU A;  4FZY A;  3AVH A;  4FJ8 A;  2HND A;  4CHZ A;  2OPP A;  4CGF A;  4CJ5 A;  1NK4 A;  4I9Q A;  4KRE A;  2AJQ A;  2B5J A;  1QQC A;  1UAX A;  1Z25 A;  4RW9 A;  3OS0 A;  1RT2 A;  1RIL A;  4FLT A;  1BCO A;  3LP0 A;  3RR8 A;  2DY4 A;  3KK3 A;  1BIU A;  3G0Z A;  1RTH A;  4Z4E A;  4CFC A;  4B08 A;  3KD5 E;  4FCY A; 
#chains in the Genus database with same CATH topology
 3SPY A;  1NOY A;  3OYC A;  4IEE A;  2BDP A;  4BGA A;  1NJX A;  3OYJ A;  4DTU A;  4YOT A;  4PUO A;  3CMA N;  2YKN A;  1ATS A;  5AQR A;  4A61 A;  5CE3 A;  4FWN A;  4DV7 K;  4RW4 A;  1J6Z A;  1KD1 O;  3OBW A;  3H46 O;  4CGI A;  3MEG A;  2O8E B;  3WEE B;  4FM1 A;  4LFB K;  4BVO A;  3VQA A;  1S1T A;  4BWJ A;  4EFH A;  3TAG A;  4DR2 K;  5JIC A;  3IAY A;  4B3S K;  3ULD A;  3CJ1 A;  3VEW A;  3SI6 A;  4KBO A;  3ZSR A;  4DWI A;  4FOI A;  4U67 L;  5EXW A;  1XI1 A;  1JKH A;  3ATU A;  4CD3 A;  4OX9 K;  3DMJ A;  5EOY A;  1U4B A;  2D0P A;  1TKX A;  3K5M A;  3QES A;  2OPS A;  3ITH A;  3HK2 A;  3DWL A;  4JLH A;  4G1Q A;  3VF2 A;  4FZZ A;  2H3G X;  4YDU A;  1M1K O;  4B9U A;  3VES A;  4B3R K;  1HNX K;  1IO2 A;  4O8K A;  4BRL A;  3O80 A;  2KFN A;  3SMP A;  2FSN A;  3PIP L;  2P9K A;  4RWT A;  1HYV A;  1W9H A;  2DFF A;  4KAZ A;  3C6H A;  4PL7 A;  4O8U A;  3LZJ A;  3W0L A;  3OYN A;  5I42 A;  2RHK A;  2I5J A;  3AAP A;  2E6L A;  3O1B A;  3NCI A;  3AA3 A;  1JLQ A;  3K59 A;  2Q97 A;  3K5N A;  1YTA A;  4DV4 K;  3NGZ A;  3S3O A;  3NVK A;  4B8C A;  5CHI A;  2QWO A;  5M1O A;  1YXQ A;  3OW2 M;  4KV8 A;  3IS9 A;  3HL8 A;  1J5O A;  1VQ4 N;  3AVB A;  3A5N C;  4EP5 A;  3THW A;  3KIO A;  1YVU A;  3OJS A;  5C2F A;  4DTO A;  5KQD A;  4GVE A;  3U3Y A;  3J80 O;  1DKG D;  4KHS A;  5AQH A;  4CD1 A;  4N5S A;  1UA1 A;  4BRE A;  4CZM A;  4ELT A;  2G8V A;  4EIA A;  3CQX A;  4FLX A;  3OYI A;  2QTD A;  2HHS A;  3QB0 A;  4UQG A;  3VQQ A;  1NK0 A;  3V9Z A;  1IV0 A;  1HUX A;  2KKZ A;  4E7J A;  3L2W A;  3SPZ A;  2ZJR L;  3AA5 X;  3AGK A;  5DK5 A;  3GG4 A;  2P9U A;  4CEB A;  1XC3 A;  1U45 A;  5DM6 L;  1DEJ A;  4CEE A;  1VSL A;  3B8A X;  4LC9 B;  4LSN A;  3RSE A;  1FXX A;  3CFR A;  4DTN A;  2E4L A;  3C6U A;  2P9L A;  1MDU B;  2OA8 A;  2D0A A;  4MDA A;  1JLE A;  5HRP A;  3NH1 A;  1BG3 A;  3CD6 N;  4FM2 A;  3ZX2 A;  4FLY A;  4L8R B;  2Q0U A;  4IG0 A;  1KVC A;  2FSJ A;  4FM0 A;  3LM9 A;  1FKO A;  4Y1C A;  3PX4 A;  3NGY A;  3FZH A;  2ITG A;  3HT3 A;  2F96 A;  1Q8I A;  4DV6 K;  3PLA A;  3SQ2 A;  1TL3 A;  4FW1 A;  3WXM B;  1T6D A;  1KXP A;  4ZTF A;  3HST B;  5AQO A;  2YNI A;  1QSL A;  3CCS N;  4OPH A;  3AY9 A;  1KQS M;  5C15 A;  2GUP A;  4MLH A;  2VG6 A;  4E89 A;  3ZET A;  5C25 A;  5KPT A;  1CXU A;  1TVR A;  3G71 N;  5C12 A;  2E2P A;  1HNZ K;  3PIO L;  1QSY A;  2EHG A;  4G9Z A;  3HRG A;  1S1W A;  4FWO A;  3ZEU B;  3SMS A;  3O9T A;  5FPE A;  1JLB A;  2NRV A;  3WNH A;  4DTS A;  1ZBU A;  1EXQ A;  3AVG A;  3SUN A;  2O8F B;  2GTD A;  1TYQ A;  2LSN A;  1RTJ A;  4JI6 K;  4CZF A;  4MFB A;  3EEQ A;  1WLJ A;  4CIF A;  2ASM A;  3KLG A;  5C42 A;  3DOK A;  2A42 A;  4EHT A;  5KI6 A;  4O5F A;  2HMP A;  2NRT A;  1VAZ A;  2DPN A;  2O8E A;  3T69 A;  3HVR A;  3L2V A;  2QWN A;  4CK2 A;  1FK9 A;  2E5L K;  1C0T A;  2YCH A;  4DQS A;  4UY8 O;  5AQY A;  4PKH A;  4HCC A;  5KRS A;  3L3U A;  4K8Z A;  3LM2 A;  3ZT0 A;  4JRP A;  1HJO A;  2NRZ A;  4GW6 A;  3T1Y K;  3P5J A;  4M3W A;  4YOV A;  3A0I X;  1C0U A;  5BPM A;  5BPN A;  1TGO A;  3VQ8 A;  5CZ1 A;  4GNI A;  3CJ7 A;  3VF6 A;  2VGM A;  1E4F T;  2F8T A;  2KHO A;  2E6M A;  2UXB K;  5C0Y A;  4CZG A;  2Z1H A;  1SL0 A;  5LY3 A;  1KVA A;  3TAF A;  4ID1 A;  4GVM A;  1VRU A;  4CBX A;  4WQ5 A;  2ZJP L;  4DB3 A;  3ZX3 A;  3CME N;  2YX6 A;  4B1V A;  4GMJ B;  4FWK A;  3ZSV A;  3VA3 A;  2O8C B;  3V1O A;  1J5E K;  5EU7 A;  1NOZ A;  2NLX A;  1WSE A;  3TAM A;  2VQF K;  4HHT A;  4CEO A;  3OYM A;  4H0V B;  4C8M A;  3ZSZ A;  2A40 A;  5KRT A;  3MN9 A;  3TSQ A;  4CHQ A;  2P9N A;  2G8F A;  1DT9 A;  3QIO A;  1T8E A;  4DS4 A;  3AAR A;  5SZT A;  2E2N A;  3M5R A;  1NGI A;  2X6N A;  3WNF A;  4I2P A;  5AQF A;  2P9S A;  2W42 A;  3MAQ A;  4JS5 A;  4Z4H A;  3MK6 A;  3TAP A;  5F0X A;  4BRQ A;  4F3O A;  1IG9 A;  5GAE P;  3SV4 A;  2VQE K;  3CM5 A;  3HTV A;  4DF4 A;  2P9I B;  5J1E A;  1HYZ A;  4HVJ A;  2FF3 B;  3WXK A;  3M8S A;  3MCP A;  3T7Z A;  3V9W A;  3SUQ A;  4FWM A;  3V81 A;  5KQ8 A;  1NLV A;  3NMU A;  3VER A;  3KKR A;  1GLE G;  3ENO A;  2NZT A;  4DHY A;  3T1A A;  3L8B A;  3FZK A;  4IXC A;  3LAL A;  1XWL A;  4RCH A;  3QO9 A;  3LDL A;  1RDB A;  4YOU A;  1NMD A;  4CF0 A;  4BVP A;  4KTQ A;  1YAG A;  4OKK A;  4FXD A;  2QWL A;  1K73 O;  4MDB A;  4CIE A;  4LF4 K;  2GV9 A;  1WUA A;  4ILH A;  1NGG A;  1CLQ A;  3HBT A;  5K14 A;  1JCG A;  3O8M A;  3H45 C;  4RW6 A;  1ZBF A;  5GIP A;  4DFP A;  4W5N A;  1EET A;  1GLL O;  4J2A A;  3WQT A;  4N76 A;  3IUC A;  3H1V X;  3CPE A;  3GE1 A;  2O4G A;  3HM8 A;  5AQJ A;  4FW2 A;  3WNG A;  5JS1 A;  1YJ9 N;  3MMV A;  2HBK A;  1ATN A;  2F9T A;  1ZYQ A;  4E1J A;  1VQO N;  4E7I A;  4I9L A;  4NLC A;  3LDN A;  2GEL A;  1WBB A;  1LCU A;  4M45 A;  4FLV A;  1XMQ K;  1M90 O;  4M3Z A;  4CEF A;  1HPZ A;  3QEI A;  4E1M A;  3AVI A;  5TKW A;  1W7A A;  4CE9 A;  1Q86 O;  3L0Q A;  3NDK A;  2CH5 A;  3QDK A;  3M3Z A;  4DU3 A;  2D0B A;  4XH4 A;  1ZBL A;  4FZY A;  1VQM N;  4KRE A;  3EZW A;  4RW9 A;  1RIL A;  2E2Q A;  3OBY A;  3RR8 A;  1BIU A;  3G0Z A;  2A6A A;  5LJW A;  4Z4E A;  2CGK A;  5AQL A;  1EX4 A;  1MA9 B;  2KTQ A;  3AAQ A;  5C10 A;  1LAV A;  3CJA A;  3SYZ A;  4BWM A;  1NJZ A;  4DU4 A;  1Q81 O;  3C6T A;  3THW B;  2FF6 A;  2HHT A;  5HRN A;  4BRC A;  1KC8 O;  5HRR A;  1L3T A;  1RDD A;  1KLM A;  3CJC A;  5FPN A;  3CQ8 A;  4ELU A;  3QFP A;  2KZM A;  1P8Z A;  3F9K A;  5FRN A;  3BZC A;  2QWQ A;  1RBR A;  1Z6R A;  4LFA K;  3N4P A;  3O08 A;  4DR6 K;  5MLC Q;  5HL7 L;  2Z1J A;  4YDU C;  2PZS A;  3UB5 A;  3O3G A;  4DMN A;  4IKF A;  3TAR A;  4XH5 A;  3WXI A;  3PX6 A;  2IAJ A;  3AVM A;  4DU1 A;  5CYM A;  3DAW A;  1HQU A;  4JKD A;  4DUZ K;  1S72 N;  1S9G A;  4A59 A;  3WXL A;  4BRK A;  1QZ6 A;  1VSI A;  1SL2 A;  1UOC A;  1YT3 A;  3EL2 A;  3LAM A;  3OJU A;  1B9F A;  2E1Z A;  2E8A A;  3TWH A;  5AFU A;  1C0F A;  5TKY A;  4DR5 K;  1CZB A;  1NK9 A;  2NRH A;  3DRS A;  4JKF A;  2YHY A;  5LMU K;  2Q1N A;  2ZQB A;  5J2P A;  3LP3 A;  3P31 A;  5FDL A;  3HOT A;  3CCM N;  1NK5 A;  4DQR A;  4FJH A;  4KHW A;  1X9W A;  3ZT1 A;  4FK4 A;  2GEM A;  4PHT X;  2F8S A;  1ILY A;  1X9S A;  4FJJ A;  3FGU A;  3V9X A;  4BRM A;  1KFS A;  2YHB A;  1GLJ O;  3FR0 A;  3ID8 A;  4OKE A;  3SUO A;  4ILG B;  2X74 A;  4JK7 A;  3ZET B;  2FC0 A;  3O9U A;  4QOZ B;  1N36 K;  2OZM A;  1DLO A;  1BL3 A;  3I8D A;  2HOE A;  5KTQ A;  4PWD A;  2BH1 A;  4CZE A;  3C95 A;  4DSJ A;  3JS6 A;  4O5B A;  1SAZ A;  1VSK A;  3VOV A;  2HNY A;  3C0B A;  2UXD K;  4O55 A;  3WNE A;  3AVA A;  3KD1 E;  1C0M A;  3V9U A;  1TYQ B;  1RDU A;  1L3S A;  2KQ2 A;  3DM2 A;  4I6M A;  4K42 A;  3E9L A;  4EHU A;  3H6E A;  2RE2 A;  1RBT A;  4CJ4 A;  3HOS A;  4CGJ A;  5JLH A;  2A5X A;  2IC3 A;  4JKC A;  1I39 A;  1HYS A;  4KTZ A;  4JI8 K;  1P90 A;  3TTF A;  3K5L A;  1O13 A;  4GKJ K;  3J8A A;  2BUP A;  5JS2 A;  4DKW A;  3L4I A;  3VEO A;  1BHL A;  3GL1 A;  1HKC A;  1GLB G;  4FWL A;  3V1Q A;  3UE5 A;  4CF2 A;  3ATV A;  4OPA A;  2GBZ A;  4OKJ A;  5AQX A;  3CJ9 A;  2PYJ A;  3CQY A;  4HUF A;  1T05 A;  3MX5 A;  4AHU A;  4BRN A;  1X9J A;  3JSM A;  2UUB K;  4OGC A;  1NGE A;  4BC2 A;  4BRP A;  1GOB A;  4XIU A;  1QS4 A;  3VN5 A;  4IWV A;  1VQK N;  4QS7 A;  5F2R A;  1C0G A;  2Q31 A;  3QFU A;  4IZ9 A;  3D2F A;  3PO4 A;  1IBM K;  2HHH K;  1BWF O;  3MEE A;  3VQD A;  3R6M A;  1NGD A;  3AVC A;  5CR4 A;  4CW7 B;  3PO5 A;  2YHX A;  2IDO A;  3SBG A;  4DR7 K;  3SQ0 A;  4DQ8 A;  2P9N B;  4WFB L;  1RT4 A;  3T3F A;  3G6E N;  4DSL A;  4JRQ A;  2E2O A;  1MU2 A;  1JLF A;  4Z0U A;  3FLC O;  2P9S B;  1MWK A;  3CXC M;  2WON A;  3L2R A;  4DSE A;  1SUQ A;  3G25 A;  1NNE A;  1QQN A;  2D1K A;  2VG5 A;  3VQ4 A;  3HPO A;  2OYQ A;  4K0K K;  4IOA L;  5E84 A;  3RRH A;  2QWP A;  1R59 O;  1LWF A;  4ISF A;  3EY1 A;  1JLG A;  1BO5 O;  4M3X A;  3PSI A;  2VWJ A;  4CI6 A;  1KLN A;  4WQ5 C;  4AM7 A;  3R9P A;  3OYH A;  3HI0 A;  3VPZ A;  1R0A A;  1O1W A;  5AQM A;  4B8A B;  1WSF A;  3U8X A;  3SZ2 A;  2FBT A;  1NGC A;  1IBK K;  1JCF A;  4HCB A;  4OPJ A;  1Z26 A;  3ZT2 A;  4CZK A;  4CGD A;  4BRD A;  1VQP N;  4CJP A;  2FLO A;  3NFA A;  1NK7 A;  4BR0 A;  4FJI A;  4JK9 A;  4A57 A;  3ASM A;  1T7P A;  4FL9 A;  5AQV A;  3S41 A;  2CGL A;  3NBP A;  1BDG A;  3S3N A;  2UU9 K;  1GLA G;  3MWP A;  4LF5 K;  3VTH A;  3BF3 A;  2G8U A;  3L2Q A;  4M63 C;  3CF5 L;  4KH4 A;  3SUP A;  3TR8 A;  4CIG A;  5I9E B;  3RMC A;  3BUZ B;  4JK8 A;  4F2R A;  2OCE A;  3A2F A;  2A1R A;  4E7H A;  3KLE A;  2OZS A;  3CG7 A;  3H3N O;  2OPQ A;  3SJJ A;  4PY5 A;  3LDS A;  1G99 A;  4Z4I A;  1NKC A;  3DLB A;  4CHY A;  1NM1 A;  4BC5 A;  4MLE A;  3AA2 A;  4OJR A;  1A5V A;  1JJ2 M;  4LF9 K;  4J2D A;  1U49 A;  3E9O A;  1C1A A;  4CJR A;  3C94 A;  1FKP A;  1TKZ A;  5AFU H;  4B9N A;  4F8R A;  1TK5 A;  3AVJ A;  5DM7 L;  1C1C A;  1QVG M;  5BN8 A;  4DV5 K;  1NMN A;  1KAZ A;  2Q36 A;  3HXM A;  4CFB A;  3BDP A;  3J7Y P;  4FYD A;  2A41 A;  4DSI A;  1RT3 A;  2CH6 A;  4PL8 A;  1BA0 A;  1IKX A;  4NCG A;  4B3T K;  2Y1J A;  5M1P A;  1W2B M;  3CCU N;  5AQW A;  2ZGY A;  4DCH A;  3KTQ A;  2CGJ A;  4CF8 A;  3ZX0 A;  1VSH A;  3VQ5 A;  4C8K A;  2JWK A;  3NF6 A;  4CZI A;  3L6Q A;  3EE9 A;  2PYL A;  2E88 A;  3I55 N;  3BP8 A;  4FK0 A;  4Y0W A;  3HO1 A;  1WNS A;  3D0P A;  1H1V A;  1LWE A;  2EWS A;  3I56 N;  3DLH A;  3RMB A;  3VGM A;  5KPZ A;  3ISN C;  5FPM A;  1BIS A;  2D0O A;  5HP1 A;  4EZ6 A;  2W6L A;  1NGJ A;  4B9Q A;  1VRT A;  3NHG A;  1D4X A;  3VTI A;  2IOC A;  3DXM B;  1OH7 A;  3MX2 A;  3MN6 A;  4CJL A;  5D3G A;  4OLB A;  1E3M A;  2NUB A;  1C1B A;  1XQS C;  4LFC K;  2JGU A;  4BRF A;  4M3Y A;  2QXF A;  4WFA L;  2F9W A;  3KHY A;  1ITG A;  1UWB A;  3OYK A;  1WN7 A;  1HKG A;  4I2Q A;  1VSD A;  1NK8 A;  4N47 A;  3O6W A;  1RDA A;  4U7B A;  2YNH A;  2HF4 A;  2PY5 A;  4KI6 A;  2HBJ A;  4IDK A;  3ZT4 A;  2IS3 A;  3PX0 A;  2QXL A;  3K0S A;  3B6O A;  2ZJQ L;  2P51 A;  4DV1 K;  2VWK A;  3AO5 A;  3CER A;  4FJ8 A;  4BG8 A;  4CHZ A;  4CJ5 A;  2OPP A;  2AJQ A;  4I9Q A;  2NNW A;  2B5J A;  1Z25 A;  3OS0 A;  4DR4 K;  1BCO A;  3LP0 A;  4CFC A;  4B08 A;  3DLL L;  3V6D A;  2XY7 A;  3M1F A;  3IDH A;  1B9D A;  1JLA A;  3P39 A;  2ZE2 A;  3QLH A;  3QML A;  1VQ9 N;  1BCM A;  3QER A;  3I33 A;  3BGR A;  3R1X A;  3O9Q A;  1TL1 A;  2QM1 A;  3O5B A;  1NJI O;  3V1R A;  3BZK A;  4FJK A;  3WXJ A;  1HNV A;  2EX3 A;  3HPG A;  3TTD A;  2O4I A;  2FBV A;  3DYA A;  4FJX A;  3CI5 A;  5FRM A;  1YJW N;  1YHQ N;  1NG9 A;  2JWL A;  3NAE A;  3HJF A;  4BQZ A;  2BAN A;  2KW4 A;  4K25 A;  4IO8 A;  1NU0 A;  1JXE A;  1HRH A;  3LPU A;  4F3T A;  3QIN A;  1G15 A;  4CJV A;  5ADX A;  4X66 K;  1ZBI A;  5LL6 Z;  5EVZ A;  1Y97 A;  1BQN A;  4FJ9 A;  2HMI A;  5EX5 A;  1OVY A;  2WFB A;  4KHQ A;  2PFU A;  3HSC A;  4YOX A;  3D2E B;  2W41 A;  5AQS A;  4XH1 A;  1FW6 A;  1BGX T;  4YOY A;  4XEI A;  4PKG A;  4CBU A;  4FO0 A;  4ID5 A;  1TV6 A;  4JKH A;  5KPR A;  1U47 A;  4I6M B;  3NGI A;  4JYA K;  2QWM A;  4BE1 A;  5JVG L;  1VQ5 N;  4LH4 A;  1WOQ A;  4FLW A;  2V7Y A;  2GWK A;  4H0X B;  3HVT A;  5AR0 A;  4CFA A;  4X65 K;  1S22 A;  3O1W A;  2NRR A;  2D0C A;  1J9A A;  4JKB A;  2ZD1 A;  3THY A;  3DXK A;  3SAH A;  1TAQ A;  4JI3 K;  4F4K A;  3A5O C;  3VGK A;  3E01 A;  4B3O A;  5HLF A;  4NCA A;  1TUY A;  2YNF A;  3FFI A;  1D8Y A;  1TK0 A;  4W5T A;  5M1K A;  2YJE A;  4AH9 A;  4CED A;  5BRD A;  3OHR A;  5AQN A;  1BU6 O;  1RBU A;  3PSF A;  2ASO A;  3AVL A;  4FZX C;  3F9M A;  4KFB A;  3UKU A;  1QTM A;  3VEZ A;  1T44 A;  3NF9 A;  3ZSW A;  4N41 A;  3CIP A;  4R5P A;  3ZYY X;  1K8K B;  3PV8 A;  2P5G A;  2Q2R A;  3MDQ A;  4LF8 K;  2ASP A;  4K43 A;  5E41 A;  2ITM A;  3CC2 N;  4B9V A;  1NKE A;  3D2F B;  4GV3 A;  4ICL A;  3K57 A;  1QHA A;  3E66 A;  4LH5 A;  3WQU A;  3KLH A;  3U9Z A;  3WT0 A;  1TKD A;  2BGG A;  3TSP A;  3VEV A;  1WAJ A;  3D45 A;  4IJA A;  4C1N K;  3KWI A;  1SZ2 A;  5GAG P;  4ZTJ A;  3A5L C;  5DMR A;  2D5R A;  3KK1 A;  4DQQ A;  3RR7 A;  3TSU A;  3M6G A;  3DXM A;  3SAF A;  2O8D A;  4OO1 J;  2HF3 A;  4A62 A;  1LWC A;  4FCY A;  4Q0B A;  4B1U B;  3F2K A;  2XRI A;  1ZBS A;  3CFO A;  3NE6 A;  2YHA A;  3MXM A;  4CZH A;  1VQL N;  1RT5 A;  4KPY A;  4JD2 A;  4BE0 A;  3N4Q A;  3QIP A;  4ILJ A;  1SL1 A;  4A2B A;  2QI2 A;  1KFD A;  2KFZ A;  4H0P A;  3VQE A;  3QEV A;  4IBN A;  3VQ9 A;  2B4J A;  3SJH A;  3C65 A;  5FPD A;  3TAE A;  3RVC A;  2QW9 A;  1WSG A;  2WTU A;  4YNQ A;  4CK3 A;  4ISE A;  4PKI A;  4FJG A;  4IJN A;  3VF4 A;  1VHX A;  1LW2 A;  3CCV N;  3P4I A;  4CHO A;  4NB4 A;  4IDH A;  3HZ6 A;  3RRG A;  4M3R A;  1Q18 A;  4LY7 A;  3AVF A;  1C6V A;  4H4O A;  2GUI A;  1HPM A;  4Q5V A;  3EE8 A;  3TPQ A;  1RBV A;  4A2A A;  4KKO A;  4I7F A;  1GLD G;  5AQG A;  3OYB A;  3BF1 A;  3P38 A;  1RCH A;  5HOO A;  3DLG A;  1NGH A;  1RBS A;  5BR8 K;  3PUF A;  4BDY A;  2GX9 A;  1N6Q A;  1DGK N;  3IG1 A;  4NLB A;  3U4L A;  4FK2 A;  4CVN E;  4JKG A;  3A8Y A;  2P1J A;  1T03 A;  3VQC A;  4CHP A;  2AA4 A;  2IVP A;  3M8Q A;  3HPH A;  2HNZ A;  5AQU A;  1LV5 A;  3EO3 A;  2QK9 A;  3SQ1 A;  1S6P A;  1RNH A;  1N5Y A;  5AQZ A;  4NYF A;  1EKE A;  1HNI A;  1XNR K;  1FJG K;  2YHW A;  4C8O A;  4M42 A;  4Y1D A;  3U9D A;  1YIT N;  3SAG A;  1IKY A;  1VQ7 N;  4E7L A;  4RW8 A;  5M1Q A;  3D2E A;  3SNN A;  4DTM A;  3DRR A;  4JHD B;  4MQ3 A;  3JAM O;  3CCJ N;  1RT7 A;  1RT6 A;  4BDP A;  3H3O B;  3FFK B;  3UKR A;  3L4Q A;  1WB9 A;  4JI4 K;  4AF1 A;  5HRS A;  4BR9 A;  2I7N A;  4AHS A;  3DOL A;  5KGW A;  3KLF A;  3SLC A;  3O4W A;  3L3V A;  3J81 O;  4AHC A;  1KTQ A;  2E20 A;  3CYM A;  4FJ7 A;  4DR1 K;  3QNO A;  5HRO A;  4GV6 A;  2RN2 A;  4FWP A;  1BA1 A;  1XHZ A;  4JI5 K;  4H0O A;  4BAC A;  3E9P A;  1T6C A;  2PBD A;  4E0D A;  3FZM A;  1VK0 A;  4CJE A;  4CJ7 A;  2HHW A;  5ADX H;  3JXU A;  5AQQ A;  3OYD A;  3AVN A;  4B9S A;  4B1Y B;  4E19 A;  1L5U A;  2F7T A;  3OY9 A;  2IVN A;  5BRH A;  1TUU A;  2WBN A;  3KZB A;  1QE1 A;  1K6Y A;  1V4T A;  2P9P A;  4KI4 A;  4H5N A;  4CCH A;  2YV0 X;  5JLF A;  3UIQ A;  3RTV A;  4CFD A;  1NK6 A;  3K2P A;  4DQP A;  4CBW A;  2HST A;  1I3A A;  4BRO A;  3V9S A;  4HTU A;  1IKV A;  1N33 K;  3I0R A;  1TKT A;  3PY8 A;  5LJV A;  1HNW K;  4B9L A;  2IGI A;  4DV3 K;  3TTC A;  1IG8 A;  2YJF A;  2WUS A;  3LWL A;  1K8K A;  4O0J A;  4W5O A;  2F4V K;  3F5T A;  1RGI A;  4IFV A;  2UYT A;  4V19 S;  1HLU A;  3I0S A;  2ZGZ A;  3FZF A;  4CZL A;  3TI0 A;  4DQI A;  1KSP A;  4F9O A;  3ZSY A;  4BE2 A;  4A5A A;  4FJN A;  1U04 A;  3IRX A;  4BR5 A;  4M7Y A;  1ATR A;  2V51 B;  4IFE A;  1NGB A;  5BRE A;  4YFU A;  5GAH P;  5HBM A;  1OH6 A;  3OYG A;  4B9T A;  2Z1G A;  1JL2 A;  2HBM A;  1NGA A;  1MWM A;  2PAV A;  3AA4 A;  1VSJ A;  2DFH A;  3NF7 A;  5AJ3 K;  5GIN A;  2HHX A;  4FWR A;  1ASV A;  1RDC A;  1KCF A;  3RWU A;  5KGX A;  1BI4 B;  3CET A;  3AVK A;  4H0T B;  4JI0 K;  4PQU A;  1S3X A;  4IG3 A;  4YHH K;  3IFR A;  3H08 A;  3KK7 A;  1ASU A;  4WFN L;  4ELV A;  3B6P A;  3GOI A;  4H03 B;  4FLU A;  3C7N A;  1ZBH A;  3FE1 A;  1NJY A;  3NF8 A;  2AP1 A;  3ID6 A;  1NBW A;  2RF2 A;  2V52 B;  3ZSX A;  1X1P A;  2D4W A;  3H1Q A;  4CHN A;  1W0H A;  4FLZ A;  1L3U A;  1HJR A;  4BC4 A;  4LF6 K;  1DTQ A;  2RKI A;  1WBD A;  1EQY A;  3O4N A;  2VWB A;  3KK2 A;  1QSS A;  1ZXO A;  3CM6 A;  3TAQ A;  2DFE A;  2VYP A;  1L3V A;  4KB0 A;  4FPA A;  1GLF O;  2ZM6 K;  4FWQ A;  4IFY A;  4CGH A;  2DTU A;  1RTI A;  3ULE A;  2YKM A;  3OA9 A;  4KRF A;  4H5W A;  1RFQ A;  3AO1 A;  4JS4 A;  4E3S A;  1LW0 A;  3QET A;  2X6S A;  3D6R A;  4CJW A;  3MN7 A;  5H1S Q;  1GLC G;  2HND A;  1NK4 A;  3MN5 A;  1U2V A;  1QQC A;  1UAX A;  3EKS A;  2NRX A;  1RT2 A;  2DY4 A;  3KK3 A;  1RTH A;  3R8E A;  3K9J A;  3KD5 E;  5B8H A;  3KVG A;  3QBW A;  5JMV A;  3U6F A;  4DSF A;  1YIJ N;  4H5V A;  2XY5 A;  1BUP A;  4AHR A;  2O8B A;  1X3M A;  2VCP A;  1A5X A;  4DF8 A;  1W97 L;  5GAD P;  4M3U A;  1SKS A;  3R3L A;  1K9M O;  2Z1I A;  4IOC L;  4FPB A;  3THY B;  3DXK B;  4OVL A;  3RMA A;  3IKM A;  4PA1 A;  4QS8 A;  1NWK A;  1D5A A;  1NJW A;  3M8R A;  3GBT A;  2QA4 N;  1SKW A;  5FLX O;  4MO4 A;  3KJV A;  1VQ6 N;  5CY4 A;  5AZI B;  4DSK A;  1YTU A;  1N8R O;  4LF7 K;  1N34 K;  3AGR A;  2J4R A;  3K9K A;  2R7Y A;  1YJN N;  2QKB A;  3KLI A;  4IEI A;  3UKU B;  1K8A O;  1YUW A;  4JHD A;  1BIZ A;  1JLC A;  3MXI A;  3THX A;  4KH6 A;  3SCX A;  1VSE A;  2FBY A;  4CJT A;  3HP9 A;  2UUC K;  4AM6 A;  1BOT O;  4J2E A;  2OPR A;  4CEA A;  2Q0R A;  4CEQ A;  2VGN A;  3VQ7 A;  4CJ3 A;  3NVM A;  5J2Q A;  4BR2 A;  1D9D A;  3ZLJ A;  3DLE A;  4FJL A;  3CCL N;  1WSJ A;  3S9H A;  5AQK A;  1KRP A;  4DLE A;  3QEX A;  2KZZ A;  4C8N A;  4CF9 A;  3QBX A;  1GOC A;  4ISG A;  3BY5 A;  3SBT A;  1QZ5 A;  2O8D B;  1CZA N;  3DLR A;  4BRG A;  4FSV A;  2XY6 A;  3JYT A;  1JXB A;  2Y1I A;  3WEE A;  3KWG A;  3LAK A;  4JD2 B;  3MED A;  3LAN A;  4NYN A;  1LAW A;  5SWM A;  4NXN K;  4BR7 A;  1S1X A;  4QS9 A;  4J2B A;  2HHV A;  4O44 A;  4DS5 A;  4CJQ A;  2QKK A;  1CXQ A;  5C2D A;  3D7E O;  4DV2 K;  3ZSO A;  1S1V A;  2HVI A;  3DLK A;  4FJM A;  2V7Z A;  3MWT A;  4JAX A;  3CPW M;  4HUE A;  1Y64 A;  2G8K A;  1U6Z A;  2P5O A;  3MEC A;  4DFK A;  4JI2 K;  2BTF A;  4LD0 A;  3OYA A;  4C8L A;  2W40 A;  3CC4 N;  4E1N A;  4AHT A;  3DI6 A;  5M1N A;  2XHB A;  5J2N A;  3CC7 N;  2ZF5 O;  3MXJ A;  3KKS A;  5FRO A;  4CJS A;  3OYL A;  1QVF M;  4CJK A;  3T1H K;  2X78 A;  5AZJ B;  1HMV A;  4CZJ A;  4CES A;  4KH5 A;  3VEN A;  2G8H A;  4J8F A;  5M1F A;  2JLE A;  1BI4 A;  3P83 D;  5AQP A;  3SK3 A;  4C1N I;  2UXC K;  1Z05 A;  2G8I A;  1EWR A;  2RPI A;  2I7P A;  1X9M A;  4JKG B;  3LPT A;  3LDP A;  2W6K A;  1S6Q A;  2HBL A;  3QNN A;  5A2Q O;  4TSX A;  3L2U A;  3K5O A;  4GKK K;  4H5R A;  3MCA B;  5BRF A;  4DR3 K;  5C24 A;  3P1G A;  4JKE A;  1SQK A;  4KHU A;  4DFM A;  1U48 A;  4CEC A;  3SQ4 A;  1JL1 A;  3OYE A;  4DUY K;  3IMX A;  3QIC A;  4BR4 A;  4HTL A;  3WUH A;  3QEW A;  1T3V A;  4CF1 A;  3G10 A;  1NGF A;  4QCL A;  4W5R A;  4CEZ A;  4C23 A;  4LSL A;  4AHV A;  4RW7 A;  1XHX A;  4BRA A;  4W5Q A;  4BDZ A;  4OPK A;  3VQB A;  3OYF A;  4DFJ A;  5CZ2 A;  4OLA A;  4Z4F A;  1HX1 A;  3W3D A;  2FBX A;  1D9F A;  2IVO A;  3Q7B A;  1WSH A;  4KB1 A;  1A5W A;  5AQT A;  1YF5 L;  3UKR B;  4FOE A;  3TAN A;  1Q82 O;  3EYZ A;  3OTO K;  4FJ5 A;  4M7X A;  1IJJ A;  1XMO K;  4YOW A;  1BQM A;  3ZSQ A;  4H4M A;  3J7Z O;  1OH5 A;  3LDO A;  1ASW A;  4B1W B;  1QHT A;  4KO0 A;  2OTL N;  4B3M K;  4B9M A;  3RMD A;  4WQ4 C;  2QWR A;  3THV A;  3CJB A;  1VSF A;  3J7A P;  4F2S A;  1KAX A;  4RTF D;  3I8B A;  2WC9 A;  5I3U A;  1IH7 A;  4BRH A;  5F1X A;  1WAF A;  3U3G A;  3V4I A;  2KLA A;  5BR9 A;  4H0Y B;  4DTX A;  3E1Y A;  1YVN A;  4ZHR A;  4M3T A;  5ELZ A;  2P9P B;  3ZCM A;  5AZI A;  2WOM A;  3VET A;  1F21 A;  4BY9 C;  1VQN N;  3CHW A;  4AQY K;  3ENH A;  1J54 A;  2ZWH A;  3O9R A;  3SV3 A;  3VQP A;  2UUA K;  4RG8 A;  3BEX A;  3S3M A;  1HR0 K;  4CER A;  1RT1 A;  2ATQ A;  4BQL A;  4GY2 B;  1JCE A;  4FWS A;  3LP2 A;  1TAU A;  1KVB A;  4HWI A;  1XUP O;  3HM9 A;  3QEP A;  3AV9 A;  3DRP A;  4O4G A;  4WF9 L;  4MO5 A;  3VEY A;  3ZEU A;  3F73 A;  5IT9 O;  3CCR N;  1SKR A;  4KHY A;  3T19 A;  4HUG A;  2O8F A;  4Z4C A;  1N32 K;  2A1S A;  2P9K B;  4WE1 A;  3G4S N;  4DTP A;  2IIR A;  1QQM A;  2HHQ A;  4B1X B;  4JNE A;  3ALY A;  2FXU A;  1S1U A;  4JKA A;  1XNQ K;  2ETJ A;  4FVU A;  4Z94 A;  4M41 A;  3EN9 A;  4CK1 A;  5JVH L;  1Q9Y A;  3AO2 A;  1ESV A;  5CYQ A;  4CGG A;  5BPL A;  5J2M A;  1EO1 A;  3C7N B;  1J53 A;  1IKW A;  3VGL A;  4DTJ A;  3HYF A;  5GIO A;  4IOX A;  4BC3 A;  4NCB A;  3LZI A;  3LWM A;  4X64 K;  1OKJ A;  3ZT3 A;  5LMN K;  1IBL K;  5T7B A;  1Q9X A;  3GDQ A;  4WYB A;  4K8X A;  4KHP K;  3O3F A;  1CZ9 A;  3M8P A;  4BGB A;  3NH2 A;  3CFP A;  4Z4G A;  4OGE A;  3Q7C A;  1XC9 A;  3LP1 A;  1OVQ A;  2OAN A;  2VG7 A;  2HVH A;  3ULE B;  1SS6 A;  4DLG A;  1YI2 N;  4JI7 K;  3VEX A;  2G8W A;  2HW3 A;  1LOT B;  1REV A;  4AIL C;  4FVM A;  4H8K A;  2XY8 A;  4A5B A;  3LDQ A;  5AZJ A;  1S5J A;  4KHN A;  1TK8 A;  3FZL A;  5EY4 A;  2P9U B;  2YI1 A;  3O3H A;  4KTW A;  2Q3S A;  1U2V B;  1B92 A;  3O4Q A;  3VA0 A;  4E7K A;  2E1Y A;  1WSI A;  4DTR A;  2XO7 A;  3TU5 A;  4JI1 K;  3RSE B;  3AO4 A;  4DG1 A;  3OS1 A;  2O8C A;  1SV5 A;  2P9L B;  1DTT A;  5E26 A;  3NH0 A;  2OTJ N;  3LL3 A;  1GOA A;  1KAY A;  3EZ5 A;  2QEX N;  4CJF A;  4IO9 L;  1QQO A;  3C6A A;  5IWA K;  2GWJ A;  4X62 K;  1V4S A;  2O8B B;  1VSM A;  3A5M C;  1RTD A;  1X3N A;  1EWQ A;  3VMF B;  4WQ4 A;  1EP4 A;  4N56 A;  2A3Z A;  4R79 A;  3O9S A;  4EZ9 A;  4YOR A;  1ZC6 A;  4NO7 A;  3CCE N;  3OS2 A;  1VQ8 N;  5AQI A;  1HQE A;  2NRW A;  4WCE L;  1NKB A;  1HKB A;  4H5T A;  3CCQ N;  3EKU A;  1UA0 A;  2YNG A;  2BE2 A;  3HP6 A;  2P9I A;  4L3Q A;  1S9E A;  3VQ6 A;  2HB5 A;  1OH8 A;  3K58 A;  2FSK A;  4QAG A;  4BRI A;  4EP4 A;  3TAB A;  4O0I A;  4GV9 A;  2HHU A;  2B6A A;  3THX B;  1I94 K;  4JEP A;  4JV5 K;  4EAH D;  4DV0 K;  3OVN A;  3AO3 A;  4JN4 A;  3DJC A;  4CJU A;  4B1Z A;  4NXM K;  3AVH A;  4CGF A;  1E4G T;  4BG9 A;  1RDW X;  4FLT A;  1Q7Y O;  4YY3 K;  4K41 A;  3ENB A;  5BN9 A; 
#chains in the Genus database with same CATH homology
 3SPY A;  1EX4 A;  1NOY A;  3OYC A;  3V6D A;  2XY7 A;  2KTQ A;  3U6F A;  2BDP A;  1B9D A;  1JLA A;  1LAV A;  1NJX A;  4DSF A;  3OYJ A;  3SYZ A;  4DTU A;  2XY5 A;  4PUO A;  2YKN A;  2ZE2 A;  4AHR A;  3QLH A;  4BWM A;  1NJZ A;  1A5X A;  4DF8 A;  4DU4 A;  4RW4 A;  3C6T A;  4M3U A;  1BCM A;  3QER A;  3BGR A;  1SKS A;  2HHT A;  5HRN A;  1TL1 A;  2Z1I A;  3MEG A;  4CGI A;  4FM1 A;  3V1R A;  3VQA A;  1S1T A;  5HRR A;  1L3T A;  4BWJ A;  1RDD A;  1KLM A;  4OVL A;  4PA1 A;  3TAG A;  3RMA A;  3CQ8 A;  3IAY A;  4F8R A;  4FJK A;  3ULD A;  1HNV A;  2EX3 A;  3HPG A;  4ELU A;  4F3T A;  1D5A A;  3SI6 A;  1NJW A;  3M8R A;  2FBV A;  2O4I A;  3F9K A;  3DYA A;  4FJX A;  5FRN A;  2KZM A;  1SKW A;  5FRM A;  1RBR A;  3KJV A;  3ZSR A;  4DWI A;  5CY4 A;  3NAE A;  4DSK A;  1YTU A;  1XI1 A;  3HJF A;  1JKH A;  2Z1J A;  2BAN A;  2PZS A;  3O3G A;  2KW4 A;  3DMJ A;  4DMN A;  1U4B A;  4IKF A;  2R7Y A;  3TAR A;  1JXE A;  1TKX A;  3K5M A;  3QES A;  1HRH A;  3LPU A;  2QKB A;  3QIN A;  1G15 A;  2OPS A;  3ITH A;  3KLI A;  4CJV A;  3PX6 A;  1ZBI A;  3HK2 A;  4JLH A;  1BIZ A;  1BQN A;  1Y97 A;  1JLC A;  2IAJ A;  4G1Q A;  3MXI A;  2HMI A;  4FJ9 A;  3AVM A;  4DU1 A;  4KHQ A;  3SCX A;  5CYM A;  4FZZ A;  1HQU A;  4B9U A;  1S9G A;  1VSE A;  1IO2 A;  2FBY A;  4CJT A;  3HP9 A;  1VSI A;  1BGX T;  1SL2 A;  4J2E A;  2OPR A;  2KFN A;  4CEA A;  1UOC A;  1YT3 A;  1HYV A;  1W9H A;  3LAM A;  1TV6 A;  4ID5 A;  3VQ7 A;  1B9F A;  2DFF A;  4CEQ A;  4CJ3 A;  3OJU A;  1U47 A;  4KAZ A;  5J2Q A;  3TWH A;  3LZJ A;  3OYN A;  5I42 A;  1D9D A;  3NGI A;  2I5J A;  3DLE A;  4FJL A;  4BE1 A;  1WSJ A;  3S9H A;  2E6L A;  1CZB A;  1NK9 A;  1KRP A;  3DRS A;  3NCI A;  3AA3 A;  1JLQ A;  4LH4 A;  4DLE A;  3QEX A;  2KZZ A;  3K59 A;  4C8N A;  3K5N A;  4CF9 A;  1YTA A;  1GOC A;  3NGZ A;  3S3O A;  2ZQB A;  4B8C A;  4FLW A;  5J2P A;  3LP3 A;  4KV8 A;  5FDL A;  3IS9 A;  1NK5 A;  4DQR A;  4FJH A;  3HL8 A;  4KHW A;  3DLR A;  1X9W A;  3HVT A;  1J5O A;  3AVB A;  3ZT1 A;  4EP5 A;  4CFA A;  2XY6 A;  4FK4 A;  3KIO A;  1YVU A;  3OJS A;  1JXB A;  3JYT A;  2F8S A;  4DTO A;  2D0C A;  2Y1I A;  1J9A A;  3V9S A;  1X9S A;  2ZD1 A;  4FJJ A;  3LAK A;  1TAQ A;  3V9X A;  3MED A;  3U3Y A;  4F4K A;  4B3O A;  3E01 A;  3LAN A;  4NYN A;  1LAW A;  2YHB A;  1KFS A;  5SWM A;  4KHS A;  5HLF A;  4NCA A;  2YNF A;  4OKE A;  3FFI A;  4N5S A;  1D8Y A;  3SUO A;  1S1X A;  1TK0 A;  2X74 A;  1UA1 A;  4J2B A;  4ELT A;  2G8V A;  4W5T A;  2FC0 A;  2HHV A;  4FLX A;  4O44 A;  3OYI A;  4DS5 A;  4QOZ B;  4CJQ A;  2QKK A;  1CXQ A;  2OZM A;  2HHS A;  4AH9 A;  3ZSO A;  4CED A;  4UQG A;  1DLO A;  1S1V A;  3VQQ A;  1NK0 A;  2HVI A;  1BL3 A;  3I8D A;  3V9Z A;  1RBU A;  3DLK A;  4FJM A;  3AVL A;  4FZX C;  4KFB A;  4E7J A;  5KTQ A;  4PWD A;  3L2W A;  1QTM A;  4HUE A;  2G8K A;  3SPZ A;  3AA5 X;  2P5O A;  3MEC A;  3NF9 A;  5DK5 A;  3ZSW A;  4DFK A;  3C95 A;  4R5P A;  4DSJ A;  4LD0 A;  3PV8 A;  3OYA A;  4O5B A;  2P5G A;  4C8L A;  1VSK A;  4CEB A;  1U45 A;  5E41 A;  4E1N A;  4AHT A;  3DI6 A;  5J2N A;  2XHB A;  2HNY A;  3MXJ A;  4B9V A;  1NKE A;  3KKS A;  5FRO A;  4CJS A;  4CEE A;  3OYL A;  4O55 A;  1VSL A;  3WNE A;  4CJK A;  4ICL A;  2X78 A;  4LSN A;  3AVA A;  1FXX A;  3K57 A;  3CFR A;  1HMV A;  2E4L A;  4DTN A;  3C6U A;  3KD1 E;  1C0M A;  4LH5 A;  3KLH A;  3V9U A;  2OA8 A;  2D0A A;  1JLE A;  5HRP A;  4CES A;  1L3S A;  2KQ2 A;  3NH1 A;  3DM2 A;  1TKD A;  2G8H A;  2BGG A;  4FM2 A;  4FLY A;  2JLE A;  1WAJ A;  3D45 A;  4L8R B;  4IG0 A;  1RBT A;  1KVC A;  1BI4 A;  3P83 D;  5DMR A;  4ZTJ A;  4CJ4 A;  2G8I A;  2D5R A;  4FM0 A;  2RPI A;  1FKO A;  3KK1 A;  4Y1C A;  4DQQ A;  4CGJ A;  1X9M A;  3RR7 A;  3PX4 A;  3NGY A;  2ITG A;  3LPT A;  3HT3 A;  2IC3 A;  2F96 A;  1LWC A;  1I39 A;  1S6Q A;  3QNN A;  1Q8I A;  1HYS A;  4KTZ A;  4TSX A;  3L2U A;  3K5O A;  4Q0B A;  3SQ2 A;  2XRI A;  3CFO A;  3K5L A;  3NE6 A;  2YHA A;  3MXM A;  1TL3 A;  3P1G A;  4FW1 A;  5C24 A;  4ZTF A;  1RT5 A;  3HST B;  4KHU A;  4KPY A;  5JS2 A;  2YNI A;  4BE0 A;  3QIP A;  4DFM A;  1QSL A;  1SL1 A;  1U48 A;  4CEC A;  3SQ4 A;  1KFD A;  1BHL A;  2KFZ A;  1JL1 A;  3OYE A;  3V1Q A;  2VG6 A;  4E89 A;  3VQE A;  4CF2 A;  3QEV A;  4IBN A;  2GBZ A;  4OKJ A;  3VQ9 A;  2B4J A;  5C25 A;  3TAE A;  2PYJ A;  3QEW A;  4CF1 A;  3G10 A;  1WSG A;  4QCL A;  4HUF A;  1T05 A;  4AHU A;  4W5R A;  4YNQ A;  1CXU A;  4CK3 A;  1TVR A;  4CEZ A;  3JSM A;  4LSL A;  4AHV A;  4RW7 A;  1XHX A;  4W5Q A;  4BDZ A;  4FJG A;  4OGC A;  4OPK A;  3VQB A;  1QSY A;  3OYF A;  4DFJ A;  1GOB A;  2EHG A;  5CZ2 A;  4XIU A;  4OLA A;  4Z4F A;  1QS4 A;  3VN5 A;  1LW2 A;  2FBX A;  1D9F A;  4CHO A;  4KB1 A;  1S1W A;  1WSH A;  1A5W A;  3RRG A;  4M3R A;  3TAN A;  4LY7 A;  3AVF A;  1C6V A;  3EYZ A;  1JLB A;  4H4O A;  4FJ5 A;  2GUI A;  3WNH A;  4Q5V A;  3PO4 A;  4DTS A;  1ZBU A;  1EXQ A;  3AVG A;  3MEE A;  3VQD A;  3SUN A;  1BQM A;  3ZSQ A;  2LSN A;  4H4M A;  1RBV A;  1RTJ A;  4KKO A;  3AVC A;  4I7F A;  4MFB A;  1ASW A;  3OYB A;  1QHT A;  1WLJ A;  4KO0 A;  4CIF A;  1RCH A;  4B9M A;  3KLG A;  5C42 A;  3PO5 A;  3RMD A;  3DOK A;  2IDO A;  3DLG A;  1RBS A;  3THV A;  4BDY A;  3PUF A;  5KI6 A;  3SQ0 A;  1N6Q A;  1RT4 A;  3IG1 A;  1VSF A;  3T3F A;  4FK2 A;  4F2S A;  4DSL A;  3HVR A;  3L2V A;  4JRQ A;  4CK2 A;  1MU2 A;  1FK9 A;  1JLF A;  1IH7 A;  1C0T A;  2P1J A;  1WAF A;  4Z0U A;  3U3G A;  4DQS A;  1T03 A;  3V4I A;  3VQC A;  4DTX A;  4HCC A;  4CHP A;  2WON A;  5I3U A;  4ZHR A;  3M8Q A;  5KRS A;  4M3T A;  3HPH A;  3L3U A;  2HNZ A;  3L2R A;  4DSE A;  1SUQ A;  3ZCM A;  3ZT0 A;  1LV5 A;  4K8Z A;  4JRP A;  4GW6 A;  2WOM A;  1F21 A;  2QK9 A;  3SQ1 A;  1S6P A;  1RNH A;  2VG5 A;  3P5J A;  3VQ4 A;  1J54 A;  3HPO A;  3SV3 A;  4NYF A;  1EKE A;  1HNI A;  1N5Y A;  4M3W A;  3VQP A;  2OYQ A;  4RG8 A;  1C0U A;  3S3M A;  4C8O A;  3RRH A;  1LWF A;  3EY1 A;  4CER A;  1JLG A;  4M42 A;  4Y1D A;  4M3X A;  2VWJ A;  1RT1 A;  1TGO A;  1IKY A;  2ATQ A;  3VQ8 A;  5CZ1 A;  1KLN A;  3OYH A;  4E7L A;  1NK8 A;  1R0A A;  4RW8 A;  1O1W A;  4B8A B;  1WSF A;  3LP2 A;  1TAU A;  2F8T A;  1KVB A;  2E6M A;  3SNN A;  4DTM A;  3DRR A;  3HM9 A;  3SZ2 A;  2FBT A;  2Z1H A;  3QEP A;  3AV9 A;  3DRP A;  4MQ3 A;  4O4G A;  4OPJ A;  1SL0 A;  4HCB A;  1KVA A;  1RT7 A;  1RT6 A;  1Z26 A;  3ZT2 A;  3TAF A;  4CGD A;  4ID1 A;  4BDP A;  4GVM A;  1VRU A;  4CJP A;  3NFA A;  1NK7 A;  3F73 A;  4FJI A;  1SKR A;  4KHY A;  3T19 A;  3ASM A;  1T7P A;  3NBP A;  3S3N A;  5HRS A;  4HUG A;  4GMJ B;  3ZSV A;  4AHS A;  3DOL A;  5KGW A;  4Z4C A;  3VA3 A;  2G8U A;  3L2Q A;  3V1O A;  3KLF A;  2A1S A;  4WE1 A;  5EU7 A;  4DTP A;  3SUP A;  3L3V A;  1NOZ A;  2HHQ A;  1WSE A;  3TAM A;  3TR8 A;  1KTQ A;  3CYM A;  4AHC A;  4CIG A;  3RMC A;  4HHT A;  3QNO A;  4CEO A;  5HRO A;  3OYM A;  4FJ7 A;  4C8M A;  2RN2 A;  3ALY A;  3ZSZ A;  1S1U A;  1XHZ A;  4BAC A;  2ETJ A;  5KRT A;  4F2R A;  4E0D A;  4CJE A;  1VK0 A;  3A2F A;  4CHQ A;  4E7H A;  2A1R A;  2G8F A;  2HHW A;  3QIO A;  4M41 A;  1T8E A;  3OYD A;  3KLE A;  3AVN A;  4DS4 A;  2OZS A;  3CG7 A;  4B9S A;  5SZT A;  4CK1 A;  2OPQ A;  1Q9Y A;  3AO2 A;  4E19 A;  5CYQ A;  4CGG A;  5J2M A;  3SJJ A;  1L5U A;  2X6N A;  3WNF A;  4PY5 A;  3OY9 A;  4I2P A;  3LDS A;  4Z4I A;  1J53 A;  2W42 A;  1IKW A;  3MAQ A;  4JS5 A;  1NKC A;  4Z4H A;  4DTJ A;  3DLB A;  3HYF A;  1QE1 A;  4CHY A;  1K6Y A;  4KI4 A;  3TAP A;  3AA2 A;  4CCH A;  4OJR A;  2YV0 X;  1A5V A;  4F3O A;  4NCB A;  3LZI A;  3UIQ A;  3LWM A;  1IG9 A;  1U49 A;  4J2D A;  3ZT3 A;  3RTV A;  3SV4 A;  4CFD A;  1NK6 A;  1C1A A;  4CJR A;  3CM5 A;  3K2P A;  5T7B A;  3C94 A;  1Q9X A;  4DQP A;  4K8X A;  1FKP A;  1TKZ A;  1I3A A;  4DF4 A;  5J1E A;  3O3F A;  1CZ9 A;  1HYZ A;  1IKV A;  3M8P A;  3I0R A;  4HVJ A;  3NH2 A;  3CFP A;  1TKT A;  3AVJ A;  4HTU A;  1TK5 A;  1C1C A;  3M8S A;  3PY8 A;  4Z4G A;  4OGE A;  4B9L A;  2IGI A;  1XC9 A;  3LP1 A;  2HVH A;  2VG7 A;  3V9W A;  3HXM A;  4DLG A;  3LWL A;  3SUQ A;  4CFB A;  3BDP A;  4O0J A;  3V81 A;  4W5O A;  2G8W A;  2HW3 A;  4FYD A;  1REV A;  4IFV A;  4DSI A;  4AIL C;  1RT3 A;  3KKR A;  3I0S A;  4FVM A;  4H8K A;  3T1A A;  1IKX A;  4NCG A;  3L8B A;  3TI0 A;  2XY8 A;  2Y1J A;  1KSP A;  4DQI A;  3ZSY A;  4BE2 A;  4FJN A;  1U04 A;  3KTQ A;  1S5J A;  4KHN A;  3LAL A;  3IRX A;  4CF8 A;  1TK8 A;  1XWL A;  1VSH A;  3O3H A;  3VQ5 A;  4YFU A;  4KTW A;  2Q3S A;  3QO9 A;  4C8K A;  3NF6 A;  1B92 A;  3O4Q A;  1RDB A;  5HBM A;  3VA0 A;  3OYG A;  4CF0 A;  4E7K A;  1WSI A;  2Z1G A;  4DTR A;  4B9T A;  2PYL A;  4KTQ A;  4FK0 A;  4OKK A;  2XO7 A;  4FXD A;  1JL2 A;  3AO4 A;  4DG1 A;  3HO1 A;  3OS1 A;  1WNS A;  4CIE A;  1SV5 A;  1DTT A;  3NH0 A;  3AA4 A;  3D0P A;  1GOA A;  1VSJ A;  2DFH A;  2GV9 A;  3EZ5 A;  1LWE A;  3NF7 A;  2HHX A;  1CLQ A;  5K14 A;  4CJF A;  3RMB A;  3DLH A;  1ASV A;  1RDC A;  3ISN C;  4RW6 A;  1KCF A;  1VSM A;  5KGX A;  3RWU A;  1BI4 B;  1BIS A;  5HP1 A;  1RTD A;  3AVK A;  1ZBF A;  4EZ6 A;  4PQU A;  4IG3 A;  4DFP A;  4W5N A;  1EET A;  3H08 A;  1EP4 A;  1VRT A;  4N56 A;  1ASU A;  4N41 A;  4ELV A;  3NHG A;  4J2A A;  3B6P A;  2IOC A;  4N76 A;  4EZ9 A;  4FLU A;  4CJL A;  3OS2 A;  1ZBH A;  5D3G A;  1NJY A;  1HQE A;  4OLB A;  3NF8 A;  2NUB A;  2RF2 A;  1C1B A;  2O4G A;  1NKB A;  4FW2 A;  3WNG A;  5JS1 A;  3ZSX A;  1X1P A;  2JGU A;  4CHN A;  1W0H A;  4FLZ A;  1UA0 A;  1HJR A;  1ZYQ A;  1L3U A;  4M3Y A;  2YNG A;  2QXF A;  1DTQ A;  2RKI A;  2BE2 A;  1ITG A;  1UWB A;  3O4N A;  3HP6 A;  4I9L A;  4E7I A;  3OYK A;  3KK2 A;  1WN7 A;  1QSS A;  3TAQ A;  3CM6 A;  2DFE A;  4I2Q A;  1S9E A;  4M45 A;  3VQ6 A;  2HB5 A;  4FLV A;  4B9N A;  4M3Z A;  4CEF A;  1L3V A;  1VSD A;  4KB0 A;  1HPZ A;  4N47 A;  3K58 A;  4IFY A;  4QAG A;  4CGH A;  4EP4 A;  3TAB A;  4O0I A;  1RTI A;  3QEI A;  2HHU A;  2B6A A;  2DTU A;  4E1M A;  1RDA A;  3AVI A;  2YKM A;  2YNH A;  2PY5 A;  4KI6 A;  4IDK A;  4CE9 A;  3ZT4 A;  4KRF A;  2IS3 A;  3NDK A;  3PX0 A;  3AO1 A;  4JS4 A;  3B6O A;  4E3S A;  2P51 A;  3OVN A;  1LW0 A;  4DU3 A;  3AO3 A;  2VWK A;  3QET A;  2X6S A;  2D0B A;  3AO5 A;  1ZBL A;  4CJW A;  4CJU A;  4FZY A;  3AVH A;  4FJ8 A;  2HND A;  4CHZ A;  2OPP A;  4CGF A;  4CJ5 A;  1NK4 A;  4I9Q A;  4KRE A;  2AJQ A;  2B5J A;  1QQC A;  1UAX A;  1Z25 A;  4RW9 A;  3OS0 A;  1RT2 A;  1RIL A;  4FLT A;  1BCO A;  3LP0 A;  3RR8 A;  2DY4 A;  3KK3 A;  1BIU A;  3G0Z A;  1RTH A;  4Z4E A;  4CFC A;  4B08 A;  3KD5 E;  4FCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...