4OKEA

Structure of rnase as, a polyadenylate-specific exoribonuclease affecting mycobacterial virulence in vivo
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
total genus 52
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okeA00
3T19A 2IDOA 1S1XA 3AA3A 3HVTA 4OVLA 4B9MA 4CEAA 3ITHA 1ASWA 3VQEA 3TAQA 3AVKA 2VG6A 3CYMA 3AVFA 4BWJA 1VSJA 3KKRA 4DTSA 1JLBA 4C8NA 5KGXA 2G8IA 2FBTA 4F8RA 1KVAA 2XRIA 4KB0A 4C8MA 3OYNA 4DTJA 1ASUA 4FLUA 4W5NA 3C95A 3AVLA 5HBMA 4CK1A 3TAEA 1CZ9A 1I39A 2FBVA 5FROA 4BE2A 4FXDA 4FJNA 3AO1A 3TWHA 3AV9A 1YVUA 4DMNA 1RT1A 4M3ZA 4FZZA 4CGJA 3T1AA 4JRPA 2ITGA 4B8CA 3QEIA 4RG8A 4M41A 3NGYA 5HP1A 4GVMA 3S3MA 4F2SA 2DFFA 4DQPA 4CJ4A 4MFBA 3DLGA 4OKEA 3NGIA 4KAZA 3D0PA 1VSMA 1RDDA 5KGWA 1NK0A 2JLEA 4E7LA 4MQ3A 1X9WA 1FK9A 1WSHA 4DTPA 1JLGA 3VQ8A 4ELUA 4KTQA 2G8WA 3P5JA 4W5RA 3K59A 4CF0A 2ZE2A 4Z0UA 4DLGA 1KFDA 2YV0X 1TK8A 2OPRA 2BANA 4RW7A 2GBZA 4IG0A 4CJPA 1VSDA 3ZSYA 1GOBA 3CM6A 4K8ZA 5FRNA 2G8KA 1K6YA 2OA8A 2KFZA 2WONA 3VQ6A 4IDKA 1RTIA 4DF4A 4DTUA 2ZQBA 1DTQA 3VQQA 4BE1A 4FJLA 2HVHA 1LW0A 4NCAA 3RR8A 4CJLA 1T7PA 3G10A 3SQ4A 3TR8A 5J2MA 1L3SA 1LWFA 4CEZA 3QEXA 1CLQA 2ETJA 1RCHA 5CY4A 3NDKA 4FK2A 3SCXA 3K5LA 1JLAA 1QS4A 1WSGA 2I5JA 2G8FA 4OPJA 2XY5A 2Y1JA 1NJXA 3HJFA 3DLBA 5D3GA 2HHQA 4BE0A 1L3VA 3ZSXA 3LP3A 4CHZA 4CJFA 4E7HA 5CZ1A 3E01A 1F21A 4HHTA 4CJ5A 3LZJA 3O4NA 1HQUA 2X74A 1LW2A 4KREA 3SPZA 3PX0A 1ASVA 4DQIA 4KHNA 4N56A 3NF6A 1LAWA 4Y1CA 3AVJA 3RMBA 4FK0A 4FLXA 2QKBA 4FYDA 1T8EA 5KRSA 3KIOA 3FFIA 4FJXA 4FVMA 4C8LA 1RDAA 1BL3A 2HNDA 3MEEA 3DRRA 4CHQA 3ZT0A 3LP2A 3BDPA 4FJ8A 2RF2A 4BDZA 1VSIA 1ZBFA 2YHAA 4E19A 4N76A 1VSHA 1TGOA 1YTAA 4DF8A 1TV6A 1KRPA 4L8RB 4LD0A 1UAXA 1J53A 3KD5E 1J54A 2IGIA 4PA1A 2X78A 1G15A 3DLKA 3K5OA 3AVIA 1HRHA 3MEDA 4FLTA 2P5GA 2G8VA 4KO0A 1TAUA 1IKYA 1HQEA 4CIFA 2E4LA 3V9WA 1Q9YA 4LSLA 2XHBA 4J2EA 1TL3A 1IKWA 1WAJA 3RMAA 4HCCA 5HROA 4ID5A 4NCGA 3VQ4A 1X9MA 4PQUA 3S3NA 4DQQA 2HHUA 3JYTA 3ULDA 2IAJA 3V1OA 3DRPA 1NK5A 4CGIA 4R5PA 3L8BA 3H08A 1S1VA 3IAYA 3K2PA 2BE2A 1ITGA 3AA4A 4OLBA 4HUFA 4F3OA 1ZBHA 4ICLA 3L2UA 3LAMA 4FM0A 4TSXA 1UA0A 3RWUA 4B9SA 1L3UA 4FK4A 1S1UA 3CFOA 5FDLA 3NGZA 4FCYA 4CEQA 4QCLA 1U4BA 1TAQA 4GMJB 5E41A 5I42A 1CZBA 2X6NA 3DLRA 3KLEA 4M3TA 2XO7A 3LAKA 1QQCA 4O4GA 2YNFA 2OPQA 4M3RA 4EP4A 3HT3A 4DFKA 4J2DA 4DFJA 2OYQA 3DYAA 1CXQA 3NBPA 3OYBA 3PO4A 4FJ7A 1ZBIA 1HNIA 3SUQA 1D9DA 1RNHA 1WNSA 3O4QA 1NKCA 4DS4A 1NK7A 4AHUA 1D5AA 1KVCA 3RMDA 4FW1A 3VQ9A 4CJ3A 1RT2A 3AVBA 4OPKA 1YT3A 3HL8A 4IG3A 4I7FA 2F96A 3VA3A 2PYLA 3L2QA 4CHNA 3K57A 4FM1A 4I9QA 3EYZA 4DTMA 1BIZA 4W5QA 3LDSA 1LWCA 1TK0A 4CEEA 1YTUA 4BACA 3SQ2A 4FJIA 1W9HA 1HYVA 1D8YA 4FW2A 4RW6A 2P5OA 4Z4IA 1Y97A 4PWDA 4CJKA 1NK9A 4CEFA 1S6QA 1WSFA 2O4GA 4N5SA 1KLNA 3ZT1A 1XC9A 1IKXA 4FLYA 4FJ9A 3KLHA 3SQ0A 4M3XA 1RT5A 3DOLA 5SWMA 2HNZA 3ZSWA 1NJYA 1XHXA 1SUQA 4CIGA 4KHSA 4O0JA 3DM2A 3KK2A 1IG9A 1HMVA 4W5OA 3VA0A 3OJSA 1VSKA 3LP0A 1NJWA 1QSYA 3KD1E 3BGRA 2QXFA 3OS1A 4JS5A 1C6VA 3AO2A 1XI1A 1A5WA 1ZBUA 3U3YA 1T05A 4DSJA 3P1GA 4DTOA 3S3OA 3LP1A 3NF8A 1VSEA 1BGXT 1VK0A 3QO9A 2YNHA 4FLVA 3LPUA 5SZTA 5FRMA 2Z1HA 2KZMA 3OYHA 4DQSA 5J2NA 1O1WA 4Z4HA 1EX4A 2X6SA 4NYNA 3OYGA 3AVMA 4CGFA 2HVIA 4DU4A 3V9UA 1NOZA 1TL1A 4CFAA 4FLZA 5CYMA 3SV3A 2VG7A 4E7KA 1C1CA 3NE6A 2HW3A 4CHYA 1JXEA 4F4KA 3LPTA 1B92A 4AILC 4M45A 2KZZA 4Z4EA 3OYKA 2KW4A 1T03A 4H8KA 1RTDA 4CJRA 3EZ5A 1R0AA 4KHWA 1RTJA 4LH5A 4CF2A 3RMCA 1N5YA 3ZT4A 4FZXC 4J2BA 4YNQA 4N41A 4M42A 4FJHA 4J2AA 3I0RA 3PX6A 1WSEA 4I2PA 4CERA 2IC3A 2D0BA 1S1TA 1DLOA 3WNGA 3LWLA 3VQAA 1LV5A 3LANA 5DK5A 1JLCA 3ZSQA 5HRPA 1N6QA 3SUOA 2HMIA 3AVCA 4RW4A 1JKHA 2XY7A 2LSNA 4CFCA 4CEOA 4KV8A 1RILA 3WNHA 2IS3A 1IH7A 4DSFA 3V81A 3OVNA 4B9NA 4CCHA 3I8DA 3WNEA 4CJVA 3CM5A 3NH1A 4YFUA 3KK3A 3ISNC 4E89A 1QTMA 3K58A 3KLGA 4KB1A 1UWBA 1U49A 1NKEA 3IS9A 3L2WA 4JS4A 3SYZA 3M8PA 4E7JA 3VQ5A 4CESA 4CK3A 2OZSA 4AHTA 1BCOA 3AA2A 4JRQA 3ASMA 2RKIA 3C6UA 4F2RA 3QEVA 1EP4A 2HB5A 4K8XA 5J2QA 2XY8A 3HPHA 3V1QA 3KKSA 4B9TA 4DG1A 1VSFA 1JLEA 1VSLA 1J9AA 4CGHA 4UQGA 3HVRA 4IFVA 3P83D 4C8KA 2OZMA 2WOMA 4GW6A 3AVGA 3OYCA 4HUGA 4ZHRA 1S5JA 2YHBA 3AVNA 4B8AB 1IO2A 3OYFA 3HK2A 3OYAA 1LWEA 3OYLA 1WLJA 2HHWA 3HXMA 1RDCA 5C24A 3HP6A 1L3TA 3L3UA 3TAFA 2DFEA 2P51A 2GV9A 2OPPA 3C6TA 3HYFA 2BDPA 3KLIA 3KK1A 1U47A 1WN7A 1JLFA 3F9KA 3RRHA 4KI6A 1C0UA 2Z1GA 4CEBA 2B5JA 5T7BA 3QERA 3B6OA 2G8HA 4FJGA 4N47A 4BDYA 4QOZB 4ID1A 3L2VA 3U3GA 3CFPA 4AHRA 4RW9A 1SL1A 2E6LA 1NK4A 4Z4FA 1C1BA 4OJRA 2A1RA 1L5UA 1GOCA 4EZ6A 3ZSOA 2VG5A 2HHSA 4AH9A 3TARA 4CGDA 3OYEA 2D0AA 3LWMA 2VWKA 2DY4A 3KJVA 4CJQA 4AHSA 2FBXA 1TKZA 3SJJA 3RRGA 2BGGA 3AO3A 3DRSA 3AA5X 4KKOA 4DU1A 3RR7A 1REVA 4E7IA 3OJUA 1U04A 1I3AA 3QNNA 5HLFA 4DFMA 1U45A 3THVA 3PY8A 3HSTB 1RBUA 1B9DA 3PO5A 3MXJA 3QESA 4KHQA 3HPOA 1RT4A 1HYZA 4E0DA 2G8UA 3K5NA 4CGGA 1JL1A 2OPSA 3MEGA 5EU7A 2F8TA 3M8RA 3SUPA 1IKVA 1NK6A 3KLFA 4B3OA 2HHXA 4H4MA 4DU3A 3OYMA 2D5RA 5J2PA 3NAEA 3OYDA 3V4IA 2E6MA 4CEDA 1TKDA 2RN2A 4FZYA 2O4IA 4IBNA 2JGUA 4RW8A 1RDBA 3VN5A 4CJEA 2HHVA 2FC0A 2ZD1A 4Q5VA 4DQRA 3B6PA 3OS2A 4KHUA 3ALYA 1Q9XA 4B9VA 4CJUA 3RTVA 4BDPA 4ELVA 4LSNA 3ZSVA 3NFAA 3MXIA 3MXMA 3OYIA 3O3GA 2DFHA 3MAQA 2QKKA 2W42A 2QK9A 4OLAA 3C94A 4AHVA 1BIUA 3V9SA 4OKKA 3PX4A 3ZCMA 4FJKA 1KCFA 1X1PA 1BI4A 4KI4A 1RTHA 4W5TA 4DTXA 5HRRA 4OGCA 3PUFA 5KRTA 2VWJA 3V9XA 3QNOA 1EXQA 1RBSA 4JLHA 1EKEA 3EY1A 1SL0A 3OYJA 2HNYA 4E1NA 2PY5A 2KTQA 4Q0BA 3ZSRA 1D9FA 4M3YA 4PUOA 4KFBA 1HJRA 1TVRA 2A1SA 2D0CA 4O55A 4Y1DA 5HRSA 1SL2A 2F8SA 1W0HA 3ZT3A 3LALA 5JS2A 1WSIA 1WSJA 4AHCA 4HUEA 3QLHA 1HNVA 1MU2A 4CF1A 5J1EA 4F3TA 3TAPA 4Z4GA 4CHPA 1SV5A 3F73A 4E1MA 3AVAA 3NH0A 4FJJA 1QE1A 3WNFA 3LZIA 1RBTA 3PV8A 4B9UA 3TAMA 3QETA 1X9SA 3AVHA 1QHTA 2DTUA 2KFNA 2YKNA 4NCBA 2ATQA 3V6DA 4ZTFA 1JXBA 1TK5A 4B9LA 5KI6A 1KFSA 3CG7A 3VQDA 4NYFA 4PY5A 1RT3A 1WAFA 5JS1A 3VQPA 4EP5A 3SNNA 3U6FA 3MECA 1FKOA 1GOAA 4HCBA 1Z26A 5DMRA 4KTWA 4DFPA 3SI6A 3G0ZA 2KQ2A 1XWLA 3D45A 1BQMA 4CJTA 1UOCA 1BI4B 2YKMA 1U48A 4DSLA 4LY7A 2YNGA 3IRXA 3QIOA 3SV4A 1J5OA 2HHTA 4CJWA 2R7YA 4BWMA 3ZSZA 4ELTA 3M8QA 3O3FA 3DMJA 3NF9A 3M8SA 1BISA 4CF9A 2YNIA 1HPZA 1RBVA 3S9HA 4ZTJA 3SZ2A 3CFRA 3HP9A 3AO4A 3IG1A 1BQNA 1KSPA 2P1JA 1BHLA 1SKSA 4DSKA 4EZ9A 4DSIA 1FKPA 4CJSA 4CF8A 3ZT2A 1RT6A 4DTNA 5C42A 4DWIA 2Y1IA 4O5BA 4B08A 4DS5A 1C1AA 4Z4CA 3V1RA 1TKTA 3T3FA 4IFYA 1BCMA 4WE1A 4CFDA 3SUNA 1UA1A 3VQ7A 2NUBA 3UIQA 4O44A 1HYSA 4FJMA 1NK8A 1C0TA 1LAVA 3DI6A 1B9FA 2FBYA 4LH4A 4DLEA 3QIPA 3V9ZA 3DLEA 1A5XA 3AO5A 4KHYA 1XHZA 1S9GA 2PZSA 1VRUA 2B4JA 3I0SA 1JL2A 4E3SA 3OS0A 3TANA 2Q3SA 4CK2A 1NOYA 4KPYA 2Z1JA 4HVJA 1KTQA 4KTZA 4HTUA 5HRNA 4I9LA 4DSEA 1C0MA 1Z25A 1ZYQA 4QAGA 3L3VA 1EETA 3K5MA 3TABA 4CFBA 3VQCA 1Q8IA 1JLQA 2EX3A 4H4OA 4OKJA 3HM9A 5I3UA 1FXXA 3VQBA 3CQ8A 1SKWA 3DOKA 2Z1IA 5C25A 1VRTA 3NF7A 4M3WA 1NJZA 4CIEA 2B6AA 2XY6A 4OGEA 1TKXA 4CE9A 2EHGA 3SPYA 3NCIA 3TI0A 5K14A 1RT7A 1NKBA 1S1WA 2PYJA 3DLHA 3A2FA 3JSMA 4IKFA 4CECA 4FJ5A 1S6PA 3HO1A 4KRFA 1KVBA 3HPGA 2AJQA 3QINA 1S9EA 3QEPA 4C8OA 5CZ2A 5CYQA 4XIUA 1QSLA 4M3UA 3TAGA 1ZBLA 1SKRA 4FM2A 3O3HA 4CHOA 3NHGA 1QSSA 1CXUA 3OY9A 1DTTA 4DTRA 3QEWA 2IOCA 2GUIA 4I2QA 5KTQA 2RPIA 4FLWA 3KTQA 3SQ1A 1RBRA 3NH2A 3L2RA 1A5VA 4O0IA 1KLMA 4G1QA
chains in the Genus database with same CATH superfamily
4OVLA 1S1XA 3AA3A 4JEPA 4BROA 4B9MA 3TAQA 3SMPA 5AQXA 3CYMA 2G8IA 3VF2A 4F8RA 1YIJN 4DTJA 3TU5A 5HBMA 4CK1A 4BVOA 3DJCA 2NLXA 4FJNA 3AO1A 1YVUA 4DCHA 4DMNA 4M3ZA 4FZZA 4LF5K 3LDLA 3EKSA 3NGYA 4GVMA 4MFBA 3DLGA 3O9SA 3D0PA 1VSMA 1NK0A 1ZXOA 4E7LA 3DXMB 5M1NA 5GAHP 3FR0A 4DTPA 4A62A 2VWBA 1HLUA 3MN5A 2HBKA 3VQ8A 3CC7N 3BZCA 3K59A 1KQSM 3TPQA 1KFDA 4BGBA 1HJOA 4IG0A 1IG8A 1VSDA 3D6RA 3ZSYA 4BRKA 2WONA 3VQ6A 4IDKA 3HBTA 2ZQBA 1BA1A 1DTQA 4R79A 4OPAA 3SLCA 1L3SA 1CLQA 5CR4A 3K5LA 5AFUA 1QS4A 2QWRA 3QDKA 2Y1JA 5A2QO 2HHQA 3DLBA 3BUZB 2YHYA 3N4PA 5GINA 2QM1A 3HOTA 3THXA 1VQ9N 5AQGA 4KHNA 3AVJA 3RMBA 5KRSA 4FWRA 3KIOA 3FFIA 3HI0A 3MEEA 3EEQA 2E2NA 3ZT0A 3RSEB 5KQ8A 3AGKA 4E19A 4N76A 4FWQA 4PL8A 1J54A 5JLHA 4PA1A 2X78A 1NMDA 3K5OA 4FLTA 4KO0A 3CCSN 2E4LA 1Q9YA 5M1PA 3B8AX 4ID5A 4NCGA 1X9MA 2IAJA 2IVPA 3DRPA 4R5PA 4I6MA 5CHIA 3OTOK 1ZBHA 5AZIB 5BRDA 3VEXA 4CD1A 2O8BB 4DV3K 3CERA 2X6NA 4M3TA 4LF7K 4Z94A 3HT3A 4EP4A 4DFKA 2NRRA 1CXQA 4ISFA 3PO4A 4FJ7A 1HNIA 3SUQA 1OKJA 2ZJQL 3O4QA 3WXLA 4CZMA 4H5TA 4AHUA 1KVCA 4ISGA 3RMDA 4FW1A 4OPKA 4YORA 4FPBA 1YT3A 3HL8A 4PKIA 1K73O 1YVNA 4FO0A 3L2QA 4MO4A 1J5EK 4DTMA 1W9HA 1HYVA 4FW2A 4RW6A 4PWDA 1Y97A 1NK9A 4CEFA 3IKMA 1KLNA 3FZLA 3SQ0A 5GAGP 2JWLA 2HNZA 3ZSWA 2RHKA 5ELZA 1XHXA 3VTIA 1YJWN 2A40A 3LP0A 3CIPA 2ZJRL 5FLXO 4IWVA 2BTFA 1ZBUA 3U3YA 3P1GA 1U2VA 2FSJA 3FGUA 4JV5K 3TTFA 4HWIA 2YNHA 5FRMA 4FWOA 4C1NI 4LFBK 2KZMA 4BRCA 5AQFA 4DQSA 2QW9A 5J2NA 1ILYA 2Q0RA 2E2QA 3AVMA 1SZ2A 1XUPO 3SV3A 3CQXA 2VG7A 2FXUA 3AAPA 4CHYA 3LPTA 2KZZA 4M45A 3OYKA 2F9TA 3KHYA 1W97L 4H8KA 3P31A 1VQ8N 3IDHA 4ILJA 4J2BA 3RMCA 1IBLK 4YNQA 4FJHA 2NRTA 4I2PA 3J7ZO 3G4SN 3H45C 4JHDA 3K9KA 3ZSQA 3SUOA 1JCGA 1JKHA 4JNEA 5AQTA 3WNHA 1IH7A 3E9LA 3I8DA 3WNEA 3CM5A 3KLGA 1U49A 1C0GA 2OZSA 4JRQA 3ASMA 1ESVA 3C6UA 1VQNN 4X66K 2QI2A 2XY8A 3HPHA 4ISEA 4B9TA 4FL9A 5AR0A 1JLEA 4DR5K 4U67L 4B1WB 2OZMA 2WOMA 4ZHRA 2YHBA 3HK2A 1TUYA 3OYLA 2HHWA 3HXMA 2DFEA 2HHHK 3C6TA 5ADXA 2BDPA 1WN7A 1C0UA 2G8HA 5JVHL 3U3GA 4RW9A 2UXDK 2E6LA 4DV0K 1NK4A 4B1VA 2VG5A 3OYEA 2VWKA 2UYTA 4CJQA 5LL6Z 2BGGA 4KKOA 4E7IA 1U04A 3T69A 3CCUN 4BQLA 3MWPA 2E88A 2P9NA 2GWKA 1ZBSA 1HYZA 2QWLA 5EU7A 3ZEUA 2HHXA 2FSKA 4H0OA 1YHQN 3R6MA 5J2PA 3OYDA 4IJNA 4OPHA 5AQSA 4CEDA 1TKDA 1N36K 2RN2A 5GADP 4BREA 4F9OA 1HKBA 4RW8A 4B1YB 1RDBA 4M63C 2HHVA 2GX9A 3GDQA 4KHUA 2WFBA 1Q9XA 1T3VA 4B9VA 4LSNA 4YOYA 3UE5A 2QK9A 2DFHA 3MAQA 2QKKA 2W42A 4CZLA 1NGEA 2UU9K 1BIUA 4BRDA 5LY3A 2OTJN 1BI4A 4CBUA 4W5TA 4YDUA 4O5FA 2FLOA 1GLJO 4DKWA 4BRAA 1FJGK 4IOAL 4PUOA 2F8SA 4O55A 2ZJPL 1W0HA 5C15A 5JS2A 3QLHA 4LF6K 4CF1A 4JI2K 4B1ZA 3ENOA 4FJJA 3WNFA 1RBTA 1P90A 2NRHA 4LFAK 3OW2M 4PHTX 1JXBA 5KI6A 4CD3A 2ZF5O 3H3NO 3VQDA 5C12A 1KFSA 4FWSA 3MECA 1FKOA 5DMRA 2VYPA 1HPMA 3DLLL 1MWKA 1BQMA 5FPEA 4WQ5A 2YKMA 1KAYA 5F1XA 4CJWA 4BWMA 1HR0K 3M8QA 3QFUA 2P9SB 4BGAA 1BISA 3O5BA 4CZIA 3VEOA 1RBVA 5BR9A 3SZ2A 4BRQA 1KSPA 1BQNA 4YHHK 2P1JA 3ZX3A 1YUWA 1EWQA 2JWKA 3ZT2A 1RT6A 3KK7A 3W3DA 1HYSA 2NUBA 5AQZA 4O44A 1LAVA 3MK6A 2FBYA 4LH4A 1A5XA 3DLEA 4DR4K 2B4JA 3I0SA 1JL2A 4E3SA 4KPYA 2Z1JA 5BN8A 3KVGA 1YJ9N 4I9LA 3BF1A 3FZMA 3TABA 3CC2N 1CZAN 1JLQA 5I3UA 4OKJA 1GLDG 1SKWA 2QWNA 3DOKA 2WUSA 3NF7A 1DKGD 4M3WA 4YY3K 4JKHA 1NJZA 3ZLJA 2WTUA 2EHGA 3VF6A 2VCPA 2AJQA 3FZKA 3QINA 1S9EA 1XNRK 5CZ2A 4M3UA 3TAGA 1SKRA 3QFPA 3S41A 4CHOA 4DTRA 4A57A 4I2QA 1N34K 3VEZA 3UKRA 1NM1A 3S3NA 3ULDA 1KLMA 4E7JA 3CJCA 3T19A 3PO5A 4B3SK 5HL7L 4LF4K 3G6EN 4B1XB 4BWJA 1VSJA 1JLBA 2WBNA 2FBTA 4JI7K 3J8AA 3I55N 4A61A 2XRIA 3VPZA 2HSTA 3O9RA 4W5NA 3C95A 4H0XB 3AVLA 2YHWA 2FBVA 3TWHA 1WB9A 1QQMA 4B9QA 1RT1A 4CGJA 3T1AA 5HP1A 1BA0A 3E1YA 4DQPA 4FWLA 4CJ4A 4BR0A 3NGIA 1EWRA 4EHUA 1RDDA 5BPNA 2UUCK 4B3TK 3O08A 1JLGA 4KTQA 3HOSA 1XNQK 5DM6L 4DLGA 1TK8A 2D1KA 3EO3A 2BANA 4CZFA 2QTDA 2G8KA 4DF4A 5AQKA 4DTUA 1X9JA 3VQQA 1YITN 3FZFA 3G10A 3TR8A 4O8UA 1HNXK 4DQ8A 5TKYA 2ZM6K 3NDKA 3SCXA 2O8EA 1WSGA 5AQMA 2G8FA 2NRVA 2XY5A 4AQYK 3MN9A 4BRGA 4FSVA 5D3GA 1HX1A 3ZSXA 4CJFA 4CHZA 2P9NB 3CJBA 4X62K 4BQZA 3C0BA 4HHTA 1WBBA 3H46O 1HQUA 3SPZA 3CETA 1ASVA 3F9MA 3PX0A 1WBDA 2HBMA 4EIAA 3C6HA 3NF6A 1LAWA 4Y1CA 1ATRA 3L0QA 5AQHA 1T8EA 4DR2K 3Q7CA 4FJXA 4C8LA 1RDAA 1BL3A 2HNDA 4CJ7A 4PL7A 1OVYA 4BDZA 4GKJK 1NGGA 3M1FA 1YTAA 1KRPA 1TV6A 3FE1A 4GY2B 1J53A 4JYAK 3CCLN 5F2RA 3AVIA 3MEDA 3V9WA 3EKUA 4J2EA 2XHBA 1TL3A 3FLCO 4DV1K 3VQ4A 1E4GT 4V19S 3JYTA 5MLCQ 4CGIA 5BPLA 3K2PA 2BE2A 3AA4A 4LFCK 4HUFA 4E1JA 4A2BA 3L2UA 3C7NA 4FM0A 4B9SA 1L3UA 4FK4A 1S1UA 4CEQA 1HKCA 1U4BA 4GMJB 4CI6A 5E41A 1CZBA 3DLRA 2QWMA 2XO7A 3LAKA 3UKUB 4M3RA 2OYQA 3DYAA 3NBPA 1ZBIA 1WNSA 2YX6A 4DS4A 1NK7A 1E4FT 3O8MA 3J81O 3LM2A 4B1UB 3AVBA 1OH7A 4IG3A 2F96A 4CHNA 5EX5A 3LDSA 1TK0A 4RCHA 4AF1A 4CEEA 3THYB 1GLEG 3SQ2A 5ADXH 1D8YA 3L4QA 4CZHA 4CJKA 1S6QA 1WSFA 2O4GA 2A42A 4FLYA 3EZWA 1BU6O 4EHTA 1XMQK 3M3ZA 1NJYA 1SUQA 3CJ1A 4O0JA 3DM2A 3HZ6A 1HMVA 1NGFA 4W5OA 5FPDA 1NJWA 4BC2A 3KD1E 3SJHA 3P39A 3OS1A 1C6VA 3MWTA 1T05A 4DR1K 1VSEA 1BGXT 4JK9A 4FLVA 3LPUA 5SZTA 2Z1HA 1O1WA 2V7YA 1HUXA 4A5AA 1EX4A 4NYNA 3OYGA 4CGFA 1TL1A 4CFAA 4FLZA 4E7KA 3NE6A 3SMSA 5I9EB 1JXEA 4PKGA 1B92A 4Z4EA 4KHPK 5AQVA 2KW4A 4JKFA 1NG9A 3EZ5A 3BF3A 1R0AA 4KHWA 3WXKA 4FZXC 3IUCA 4CF2A 1N5YA 4N41A 4IOCL 3PX6A 1KAZA 3WQUA 4CERA 1S1TA 1VQPN 1DGKN 1LV5A 5DK5A 1N6QA 2HMIA 4RWTA 3Q7BA 2IS3A 3D7EO 4BRLA 3NH1A 4E89A 4A2AA 1UWBA 1NKEA 3IS9A 3SYZA 4JHDB 4CK3A 4AHTA 3O80A 4WQ4A 3ATUA 2QA4N 4LF9K 5J2QA 3QICA 4RTFD 3KKSA 1VQ7N 3R1XA 3CF5L 4CGHA 4IEEA 4QS8A 3HVRA 2PAVA 3P83D 4GW6A 4H03B 3OYCA 1WLJA 2VQFK 5C24A 1VQLN 3VETA 2GV9A 2Q97A 2Z1GA 3QERA 2B5JA 4FJGA 3B6OA 4N47A 4QOZB 4H0VB 3CFPA 4AHRA 1SL1A 1C1BA 4OJRA 2AA4A 3HTVA 3VENA 1NGJA 4WFAL 2A1RA 1L5UA 2HMPA 4AH9A 4CGDA 3GE1A 2DY4A 4JK7A 1TKZA 3RRGA 3AA5X 3RR7A 1Q7YO 3DAWA 1U45A 1I3AA 3QNNA 3T1HK 1S22A 4DUYK 4JKGA 3MXJA 3QESA 4X64K 3HPOA 3K5NA 2OPSA 3MEGA 1V4SA 3JAMO 4B3OA 2CGJA 3SUPA 2P9IB 4L3QA 3QMLA 2V51B 3CMAN 2ASMA 4FZYA 2O4IA 3VN5A 4CZGA 2ZD1A 4Q5VA 5C2DA 5M1FA 1NMNA 5IT9O 3C94A 4AHVA 3V9SA 4JKAA 1U6ZA 1KCFA 3ENHA 4KI4A 4BR2A 3SBTA 3M5RA 3PUFA 3SAHA 1RBSA 1EXQA 4JLHA 1EKEA 4UY8O 1GLBG 2KTQA 3ZSRA 4LC9B 1Q18A 1TVRA 4Y1DA 2QWQA 4AHCA 4HUEA 1Q86O 3TAPA 4CHPA 1SV5A 4E1MA 2D0PA 3NH0A 2NRWA 4BRPA 2GWJA 3AVHA 3T1YK 2YKNA 2ATQA 3V6DA 3O4WA 5AFUH 1H1VA 1QZ5A 4BC3A 1RT3A 2CH5A 3KZBA 3VQPA 3SNNA 3C7NB 3G0ZA 2UUBK 1BG3A 4EAHD 3J7YP 2P9UB 1DT9A 1U48A 3CI5A 4LY7A 2YNGA 3SV4A 1J5OA 4MO5A 5F0XA 5AQNA 3ZSZA 1Z6RA 3NF9A 4CF9A 1HPZA 4CVNE 4GV9A 2P9PB 1XMOK 3HP9A 1ZC6A 4EZ9A 1BHLA 1JCFA 2HBJA 2E2OA 5C42A 2HBLA 3RVCA 1SQKA 4B08A 3CCQN 4Z4CA 1UA1A 4WE1A 4CFDA 4FJMA 3UKRB 1C0TA 1DEJA 3DI6A 3V9ZA 4YOXA 3LDNA 2P9SA 1NOYA 4K25A 1KTQA 1QQOA 3JXUA 2AP1A 1C0MA 3E9PA 3QBWA 3WXJA 4QAGA 4JI1K 1G99A 3K5MA 3VQCA 1Q8IA 1FXXA 1VRTA 5K14A 1S1WA 2PYJA 4CECA 4KRFA 3HO1A 1KVBA 3HPGA 1Z05A 2F4VK 3QEPA 4C8OA 3TSUA 1ZBLA 2D0OA 3O3HA 2YHXA 1QSSA 2YJFA 5KTQA 3SQ1A 1A5VA 2IDOA 5H1SQ 3HVTA 3EE8A 4BRMA 4CEAA 4FPAA 3KKRA 4C8NA 5KGXA 1T6DA 5GAEP 1S72N 1MDUB 4C8MA 4A59A 3OYNA 5LMUK 2GTDA 3AY9A 5FPMA 3TSPA 3K9JA 4BE2A 5FROA 3D2EB 4JRPA 2ITGA 4JN4A 4B8CA 3QEIA 2E1YA 1BWFO 3S3MA 4F2SA 4OKEA 5LMNK 4XH1A 4KAZA 1X9WA 2NRZA 1WSHA 2G8WA 5AQYA 3P5JA 4W5RA 1Q81O 4C23A 1OH6A 4Z0UA 1HNZK 3MMVA 4RW7A 1GOBA 3CM6A 4LF8K 1QZ6A 1K6YA 2OA8A 3MCPA 2KFZA 3VESA 1M1KO 4FJLA 2HVHA 1LW0A 3VGKA 3RR8A 4CJLA 3SQ4A 3VGLA 3HSCA 1LWFA 5CY4A 1RCHA 4FK2A 1K8AO 2UUAK 1JLAA 3PLAA 4G9ZA 2I5JA 3N4QA 1NJXA 1GLLO 4BE0A 1L3VA 4E7HA 3VOVA 3E01A 2QEXN 4JKGB 3LZJA 3O4NA 3NVMA 2X74A 4KREA 3CCMN 3THWB 2HF4A 4BG8A 5JMVA 3CJAA 2QKBA 4FYDA 3CD6N 2HF3A 2H3GX 2P9LB 4CHQA 3LP2A 3MN7A 5AQOA 2RF2A 3MDQA 1VSHA 1TGOA 2NNWA 4DF8A 4LD0A 2D4WA 2A41A 3KD5E 2IGIA 2RE2A 5JICA 4OO1J 2P5GA 1IKYA 4CIFA 1IKWA 1WAJA 3RMAA 3BZKA 3W0LA 4HCCA 4PQUA 3IAYA 2ZGZA 3L8BA 3H08A 1ITGA 3FFKB 4OLBA 4F3OA 4ICLA 3LAMA 1UA0A 3RWUA 4K42A 4FCYA 3NGZA 2YI1A 1TAQA 2Q36A 4FWMA 5I42A 3KLEA 2IVNA 3O1BA 2OPQA 4JI8K 4DFJA 1D9DA 4DV5K 1RNHA 1NKCA 4I6MB 3MX5A 2PYLA 1NWKA 1LCUA 5EVZA 4I7FA 4HTLA 4JKBA 4FM1A 2KKZA 3EYZA 1YTUA 4WFNL 3KWGA 4ILHA 4BACA 4FJIA 4IOXA 1YXQA 4Z4IA 1R59O 4JKDA 3U9DA 4AM6A 4C1NK 3ZT1A 1XC9A 4NXMK 3VGMA 3KLHA 1RT5A 4BY9C 3P38A 4KHSA 4KH4A 4JI3K 3VA0A 1VSKA 2OANA 1QSYA 5AQLA 3BGRA 1XI1A 4DSJA 2J4RA 1VK0A 3SBGA 3QO9A 4Z4HA 4NXNK 1C1CA 4H0YB 3IMXA 3J80O 4AILC 4XEIA 2W41A 1T03A 3LDPA 4LH5A 3ZT4A 3GG4A 5GIOA 4DR7K 2IC3A 2D0BA 2V52B 1DLOA 3WNGA 1VQKN 1NGIA 2W40A 5AQRA 3PIPL 3VQAA 3LANA 3TTCA 5M1KA 2XY7A 2E20A 3CQYA 1RILA 3V81A 1BO5O 3OVNA 4B9NA 4CCHA 4H0TB 4CJVA 4YFUA 2IVOA 3ISNC 1QTMA 5HOOA 3K58A 4KB1A 5AJ3K 4FWPA 1X3NA 3VQ5A 4CESA 1VQ5N 4ILGB 1BCOA 3AA2A 2RKIA 3QB0A 1EQYA 4F2RA 2VGNA 2HB5A 1EO1A 1N32K 3HM8A 3A8YA 1NGDA 2ASOA 4DG1A 1VSFA 4K41A 4IEIA 1VSLA 4UQGA 1IBMK 3AVGA 4HUGA 4B8AB 3D2EA 3OYFA 3OYAA 5C10A 1RDCA 1GLFO 3HP6A 1L3TA 4NLBA 3E66A 1HNWK 2NRXA 1U47A 4KI6A 3RRHA 2ZWHA 5T7BA 3O9QA 3LM9A 4GKKK 3O9UA 4JI4K 3WXMB 4EZ6A 1GOCA 2YJEA 1NBWA 2HHSA 4CZJA 2P9KB 3TARA 1NGCA 4WQ4C 3SAGA 4AHSA 2FBXA 3SJJA 2W6LA 4DFMA 4BRFA 3HSTB 2I7NA 1YF5L 1B9DA 2PFUA 2O8EB 4KHQA 3VEVA 1WUAA 4CGGA 3A0IX 1JL1A 4JKEA 1NK6A 3KLFA 2PBDA 4KH5A 2D5RA 3A5LC 1NU0A 4JI6K 3AGRA 3NAEA 4JI0K 4H5WA 1U2VB 4IBNA 2JGUA 4WFBL 5FPNA 3NVKA 4DQRA 4JI5K 3AARA 3ALYA 1T44A 4CJUA 1HKGA 2E5LK 1KC8O 3NFAA 4DV4K 3OYIA 3O3GA 1K9MO 4OLAA 4B3RK 3PX4A 4FJKA 3NMUA 4MLEA 2O8DB 1RTHA 5KRTA 2VWJA 3QNOA 1SL0A 3EY1A 2KHOA 4E1NA 4Q0BA 1D9FA 4KFBA 1HJRA 2D0CA 5AQUA 3A5MC 1WSIA 1WSJA 4BC5A 2O8FA 1HNVA 1RFQA 1MU2A 2A6AA 2DPNA 2ASPA 3AVAA 4OX9K 1Y64A 3LZIA 3PV8A 5AQPA 3QETA 3J7AP 1QHTA 2KFNA 4NCBA 4ZTFA 1TK5A 3VERA 4NYFA 4PY5A 1WAFA 3DWLA 4EP5A 4H5RA 1VQ4N 1LOTB 3SI6A 1XWLA 3I33A 4YDUC 4CJTA 1UOCA 5BR8K 2NZTA 4YOTA 2HOEA 3IRXA 3QIOA 2HHTA 3WEEA 2FSNA 4YOWA 3THXB 4DR6K 2FF6A 4ELTA 3O3FA 3M8SA 3DMJA 4H0PA 4DV7K 4ZTJA 2WC9A 3DXKA 4K0KK 4DSKA 4IDHA 3WQTA 4CJSA 4CF8A 3O1WA 4DTNA 3JS6A 2Y1IA 4O5BA 1TYQB 3TTDA 2P9UA 4DS5A 3MX2A 3T3FA 5DM7L 4IFYA 1BCMA 3UIQA 5KQDA 1NK8A 1B9FA 3QIPA 3AO5A 1XHZA 1S9GA 2Q3SA 4CK2A 4HVJA 4BVPA 3WXIA 4KTZA 4HTUA 5HRNA 3CCJN 1Z25A 5TKWA 2F9WA 3CPEA 4YOVA 4CFBA 4DUZK 5JVGL 2EX3A 3HM9A 5AQWA 3VQBA 1IJJA 3CQ8A 3O9TA 2Z1IA 5C25A 3CJ7A 3D2FA 5KPZA 3DXMA 2XY6A 5AZIA 1TKXA 1P8ZA 1GLAG 3SPYA 3TI0A 4DR3K 1OH5A 3DLHA 2IIRA 5B8HA 4IKFA 4FJ5A 1S6PA 3VF4A 1VQON 5EXWA 5CYQA 4XIUA 1TYQA 5JLFA 4FOIA 1DTTA 3QEWA 2IOCA 2GUIA 4CBXA 4H5VA 3LL3A 4FLWA 3KTQA 4G1QA 1N33K 3OHRA 1X3MA 3ITHA 1ASWA 3VQEA 4BG9A 3AVKA 2VG6A 3ZEUB 2QXLA 3AVFA 3U4LA 4DTSA 1FW6A 4MDAA 5E84A 5BRFA 1KVAA 4KB0A 1ASUA 4FLUA 1W2BM 3TAEA 1CZ9A 1I39A 4JD2A 4FXDA 1NGHA 1NLVA 3AV9A 1I94K 5LJVA 3O6WA 4RG8A 4M41A 3IFRA 2DFFA 1RDUA 2F7TA 5KGWA 2JLEA 4MQ3A 1FK9A 1QVFM 4IO9L 5AQJA 4ELUA 3ULEB 4CF0A 2ZE2A 2V7ZA 2O8CB 2YV0X 3F5TA 2OPRA 4XH5A 3CCVN 2GBZA 3PSFA 4CJPA 4DV2K 3BY5A 4WQ5C 1SS6A 1T6CA 4K8ZA 3HRGA 1Q82O 5FRNA 1RTIA 4BE1A 5BREA 2W6KA 4NCAA 4CW7B 1T7PA 2I7PA 5J2MA 4J8FA 2CGLA 1MA9B 4CEZA 3QEXA 2ETJA 4OPJA 3HJFA 1S3XA 3LP3A 3OBWA 3M6GA 5CZ1A 1F21A 4CJ5A 2VQEK 2OTLN 1LW2A 4DQIA 3T7ZA 4IO8A 4BR5A 4N56A 4FK0A 4FLXA 1TUUA 3WUHA 4FVMA 1K8KB 3CXCM 4BRIA 3DRRA 3BDPA 4FJ8A 1VSIA 1ZBFA 2YHAA 1O13A 3MN6A 4L8RB 1KXPA 4WYBA 1NGBA 1UAXA 5C2FA 1XQSC 3ZX2A 2O8FB 4BR4A 1G15A 3DLKA 3L6QA 1HRHA 2G8VA 3L4IA 1TAUA 3SAFA 1HQEA 2O8DA 4LSLA 3VEYA 2E1ZA 5HROA 1IV0A 4BR9A 2Q0UA 4DQQA 3AAQA 3V1OA 1NK5A 3OA9A 1S1VA 4M7YA 4JAXA 2E8AA 2BH1A 3H6EA 1N8RO 5IWAK 4TSXA 4K43A 3CFOA 4CZEA 5FDLA 4QCLA 4GNIA 2P9KA 1QQCA 1QHAA 2YNFA 4O4GA 4J2DA 3P4IA 4A5BA 3OYBA 2Q2RA 4KH6A 3THWA 1D5AA 4CJ3A 3VQ9A 1RT2A 3VA3A 4I9QA 3K57A 1BIZA 4IZ9A 4W5QA 1LWCA 2P5OA 4FJ9A 4N5SA 3LDQA 1IKXA 4M3XA 3DOLA 3H3OB 5SWMA 2P9PA 3A5OC 3C6AA 3MCAB 4GV6A 4CIGA 3KK2A 1IG9A 3OJSA 2GELA 2ITMA 3U9ZA 4JS5A 2QXFA 1NNEA 3AO2A 1A5WA 1C0FA 4DTOA 3S3OA 3LP1A 3NF8A 1KD1O 3CCEN 3OYHA 3WT0A 3GL1A 2X6SA 3E9OA 2HVIA 4DU4A 3V9UA 1NOZA 1JJ2M 5CYMA 1WOQA 2Q31A 2HW3A 4F4KA 5AZJB 5KPTA 3GBTA 1J6ZA 1RTDA 4CJRA 1RTJA 1OVQA 4NLCA 3TSQA 4M42A 4BR7A 4J2AA 3I0RA 4DB3A 1WSEA 5EY4A 2E2PA 2FF3B 4WF9L 5BPMA 2GEMA 4PKHA 4QS7A 1VAZA 1JLCA 5HRPA 3ID8A 1YI2N 2BUPA 3AVCA 3CCRN 4RW4A 1QQNA 2LSNA 4CFCA 4CEOA 4KV8A 4DSFA 3I8BA 1GLCG 5C0YA 1BOTO 3KK3A 4U7BA 2QWOA 3PSIA 3L2WA 4JS4A 3M8PA 4CBWA 2YCHA 3QEVA 1EP4A 1YJNN 1JCEA 4K8XA 4GVEA 3V1QA 1VQ6N 1J9AA 4JD2B 3VTHA 4IFVA 4C8KA 1XC3A 3H1QA 3ZX0A 1S5JA 3AVNA 1IO2A 4IXCA 1LWEA 1IBKK 4YOUA 4BRNA 4GV3A 5GIPA 3L3UA 3TAFA 2P51A 4O8KA 2OPPA 3CC4N 3I56N 3HYFA 3UKUA 3KLIA 3KK1A 1JLFA 3F9KA 3GOIA 4QS9A 4FVUA 4CEBA 4DV6K 2O8CA 4BDYA 4ID1A 3L2VA 4IFEA 4Z4FA 5BN9A 3D2FB 1RDWX 3ZSOA 2D0AA 3LWMA 1NJIO 3KJVA 4FOEA 3AO3A 3DRSA 4DU1A 1REVA 3OJUA 5HLFA 4H5NA 3THVA 3PY8A 1RBUA 3A5NC 1RT4A 1YAGA 4E0DA 2G8UA 2CGKA 1SAZA 2F8TA 3M8RA 1IKVA 2EWSA 4H4MA 4DU3A 3OYMA 5LJWA 3KWIA 4X65K 3V4IA 1ATSA 2E6MA 1BDGA 4FWKA 2UXCK 3R9PA 4CJEA 2FC0A 4WCEL 3B6PA 3OS2A 1M90O 3RTVA 2Q1NA 3ZETB 4BDPA 4ELVA 3F2KA 2CH6A 3ZSVA 3MXIA 3MXMA 3R8EA 3R3LA 1D4XA 2OCEA 5BRHA 4OKKA 3ZCMA 1X1PA 2P9IA 2VGMA 1E3MA 4DTXA 1NGAA 3ATVA 3H1VX 5HRRA 4OGCA 3WEEB 3V9XA 3RSEA 3OYJA 2HNYA 1ATNA 2PY5A 3UB5A 5AQQA 4M7XA 4M3YA 1RGIA 2A1SA 5HRSA 1SL2A 3LDOA 2HHUA 4NO7A 3ZT3A 3LALA 3VMFB 3CJ9A 5EOYA 5M1OA 5J1EA 3OBYA 4F3TA 4Z4GA 5E26A 3ZYYX 3F73A 1QE1A 4B9UA 3TAMA 3ENBA 3EL2A 3C65A 1X9SA 3EN9A 2DTUA 2ZGYA 5CE3A 4B9LA 3CG7A 4MLHA 5JS1A 4HCBA 3U6FA 1GOAA 1Z26A 4KBOA 4KTWA 4DFPA 2O8BA 4DHYA 2KQ2A 4NB4A 5KPRA 3D45A 4BRHA 4BC4A 3CMEN 1QVGM 2A5XA 1BI4B 1V4TA 4DSLA 3THYA 2R7YA 3ZETA 1BUPA 2A3ZA 2YNIA 4JKCA 3S9HA 3G71N 3CFRA 3AO4A 3IG1A 4DSIA 1SKSA 3CHWA 1FKPA 1MWMA 4B3MK 2KLAA 1OH8A 4DWIA 4JK8A 3FZHA 3U8XA 1C1AA 3V1RA 1TKTA 3SUNA 3BEXA 3VQ7A 1K8KA 3PIOL 4DLEA 2UXBK 4KHYA 2PZSA 1VRUA 4IJAA 3TANA 3OS0A 4EFHA 3ID6A 3VEWA 3K0SA 1VHXA 3DXKB 4DSEA 1ZYQA 4AM7A 3L3VA 1EETA 2P9LA 4H4OA 2QWPA 1VQMN 4CIEA 2B6AA 4OGEA 3BP8A 4Y0WA 3EE9A 4CE9A 2GUPA 3NCIA 3CPWM 1RT7A 5AQIA 3SK3A 5AZJA 1NKBA 3A2FA 3JSMA 4CZKA 3QBXA 5M1QA 1KAXA 1QSLA 4FM2A 4MDBA 3G25A 3NHGA 1CXUA 4FWNA 3OY9A 4XH4A 3ULEA 2RPIA 1RBRA 3NH2A 3L2RA 3LWLA 4O0IA 1W7AA
chains in the Genus database with same CATH topology
3T19A 2IDOA 1S1XA 3AA3A 3HVTA 4OVLA 4B9MA 4CEAA 3ITHA 1ASWA 3VQEA 3TAQA 3AVKA 2VG6A 3CYMA 3AVFA 4BWJA 1VSJA 3KKRA 4DTSA 1JLBA 4C8NA 5KGXA 2G8IA 2FBTA 4F8RA 1KVAA 2XRIA 4KB0A 4C8MA 3OYNA 4DTJA 1ASUA 4FLUA 4W5NA 3C95A 3AVLA 5HBMA 4CK1A 3TAEA 1CZ9A 1I39A 2FBVA 5FROA 4BE2A 4FXDA 4FJNA 3AO1A 3TWHA 3AV9A 1YVUA 4DMNA 1RT1A 4M3ZA 4FZZA 4CGJA 3T1AA 4JRPA 2ITGA 4B8CA 3QEIA 4RG8A 4M41A 3NGYA 5HP1A 4GVMA 3S3MA 4F2SA 2DFFA 4DQPA 4CJ4A 4MFBA 3DLGA 4OKEA 3NGIA 4KAZA 3D0PA 1VSMA 1RDDA 5KGWA 1NK0A 2JLEA 4E7LA 4MQ3A 1X9WA 1FK9A 1WSHA 4DTPA 1JLGA 3VQ8A 4ELUA 4KTQA 2G8WA 3P5JA 4W5RA 3K59A 4CF0A 2ZE2A 4Z0UA 4DLGA 1KFDA 2YV0X 1TK8A 2OPRA 2BANA 4RW7A 2GBZA 4IG0A 4CJPA 1VSDA 3ZSYA 1GOBA 3CM6A 4K8ZA 5FRNA 2G8KA 1K6YA 2OA8A 2KFZA 2WONA 3VQ6A 4IDKA 1RTIA 4DF4A 4DTUA 2ZQBA 1DTQA 3VQQA 4BE1A 4FJLA 2HVHA 1LW0A 4NCAA 3RR8A 4CJLA 1T7PA 3G10A 3SQ4A 3TR8A 5J2MA 1L3SA 1LWFA 4CEZA 3QEXA 1CLQA 2ETJA 1RCHA 5CY4A 3NDKA 4FK2A 3SCXA 3K5LA 1JLAA 1QS4A 1WSGA 2I5JA 2G8FA 4OPJA 2XY5A 2Y1JA 1NJXA 3HJFA 3DLBA 5D3GA 2HHQA 4BE0A 1L3VA 3ZSXA 3LP3A 4CHZA 4CJFA 4E7HA 5CZ1A 3E01A 1F21A 4HHTA 4CJ5A 3LZJA 3O4NA 1HQUA 2X74A 1LW2A 4KREA 3SPZA 3PX0A 1ASVA 4DQIA 4KHNA 4N56A 3NF6A 1LAWA 4Y1CA 3AVJA 3RMBA 4FK0A 4FLXA 2QKBA 4FYDA 1T8EA 5KRSA 3KIOA 3FFIA 4FJXA 4FVMA 4C8LA 1RDAA 1BL3A 2HNDA 3MEEA 3DRRA 4CHQA 3ZT0A 3LP2A 3BDPA 4FJ8A 2RF2A 4BDZA 1VSIA 1ZBFA 2YHAA 4E19A 4N76A 1VSHA 1TGOA 1YTAA 4DF8A 1TV6A 1KRPA 4L8RB 4LD0A 1UAXA 1J53A 3KD5E 1J54A 2IGIA 4PA1A 2X78A 1G15A 3DLKA 3K5OA 3AVIA 1HRHA 3MEDA 4FLTA 2P5GA 2G8VA 4KO0A 1TAUA 1IKYA 1HQEA 4CIFA 2E4LA 3V9WA 1Q9YA 4LSLA 2XHBA 4J2EA 1TL3A 1IKWA 1WAJA 3RMAA 4HCCA 5HROA 4ID5A 4NCGA 3VQ4A 1X9MA 4PQUA 3S3NA 4DQQA 2HHUA 3JYTA 3ULDA 2IAJA 3V1OA 3DRPA 1NK5A 4CGIA 4R5PA 3L8BA 3H08A 1S1VA 3IAYA 3K2PA 2BE2A 1ITGA 3AA4A 4OLBA 4HUFA 4F3OA 1ZBHA 4ICLA 3L2UA 3LAMA 4FM0A 4TSXA 1UA0A 3RWUA 4B9SA 1L3UA 4FK4A 1S1UA 3CFOA 5FDLA 3NGZA 4FCYA 4CEQA 4QCLA 1U4BA 1TAQA 4GMJB 5E41A 5I42A 1CZBA 2X6NA 3DLRA 3KLEA 4M3TA 2XO7A 3LAKA 1QQCA 4O4GA 2YNFA 2OPQA 4M3RA 4EP4A 3HT3A 4DFKA 4J2DA 4DFJA 2OYQA 3DYAA 1CXQA 3NBPA 3OYBA 3PO4A 4FJ7A 1ZBIA 1HNIA 3SUQA 1D9DA 1RNHA 1WNSA 3O4QA 1NKCA 4DS4A 1NK7A 4AHUA 1D5AA 1KVCA 3RMDA 4FW1A 3VQ9A 4CJ3A 1RT2A 3AVBA 4OPKA 1YT3A 3HL8A 4IG3A 4I7FA 2F96A 3VA3A 2PYLA 3L2QA 4CHNA 3K57A 4FM1A 4I9QA 3EYZA 4DTMA 1BIZA 4W5QA 3LDSA 1LWCA 1TK0A 4CEEA 1YTUA 4BACA 3SQ2A 4FJIA 1W9HA 1HYVA 1D8YA 4FW2A 4RW6A 2P5OA 4Z4IA 1Y97A 4PWDA 4CJKA 1NK9A 4CEFA 1S6QA 1WSFA 2O4GA 4N5SA 1KLNA 3ZT1A 1XC9A 1IKXA 4FLYA 4FJ9A 3KLHA 3SQ0A 4M3XA 1RT5A 3DOLA 5SWMA 2HNZA 3ZSWA 1NJYA 1XHXA 1SUQA 4CIGA 4KHSA 4O0JA 3DM2A 3KK2A 1IG9A 1HMVA 4W5OA 3VA0A 3OJSA 1VSKA 3LP0A 1NJWA 1QSYA 3KD1E 3BGRA 2QXFA 3OS1A 4JS5A 1C6VA 3AO2A 1XI1A 1A5WA 1ZBUA 3U3YA 1T05A 4DSJA 3P1GA 4DTOA 3S3OA 3LP1A 3NF8A 1VSEA 1BGXT 1VK0A 3QO9A 2YNHA 4FLVA 3LPUA 5SZTA 5FRMA 2Z1HA 2KZMA 3OYHA 4DQSA 5J2NA 1O1WA 4Z4HA 1EX4A 2X6SA 4NYNA 3OYGA 3AVMA 4CGFA 2HVIA 4DU4A 3V9UA 1NOZA 1TL1A 4CFAA 4FLZA 5CYMA 3SV3A 2VG7A 4E7KA 1C1CA 3NE6A 2HW3A 4CHYA 1JXEA 4F4KA 3LPTA 1B92A 4AILC 4M45A 2KZZA 4Z4EA 3OYKA 2KW4A 1T03A 4H8KA 1RTDA 4CJRA 3EZ5A 1R0AA 4KHWA 1RTJA 4LH5A 4CF2A 3RMCA 1N5YA 3ZT4A 4FZXC 4J2BA 4YNQA 4N41A 4M42A 4FJHA 4J2AA 3I0RA 3PX6A 1WSEA 4I2PA 4CERA 2IC3A 2D0BA 1S1TA 1DLOA 3WNGA 3LWLA 3VQAA 1LV5A 3LANA 5DK5A 1JLCA 3ZSQA 5HRPA 1N6QA 3SUOA 2HMIA 3AVCA 4RW4A 1JKHA 2XY7A 2LSNA 4CFCA 4CEOA 4KV8A 1RILA 3WNHA 2IS3A 1IH7A 4DSFA 3V81A 3OVNA 4B9NA 4CCHA 3I8DA 3WNEA 4CJVA 3CM5A 3NH1A 4YFUA 3KK3A 3ISNC 4E89A 1QTMA 3K58A 3KLGA 4KB1A 1UWBA 1U49A 1NKEA 3IS9A 3L2WA 4JS4A 3SYZA 3M8PA 4E7JA 3VQ5A 4CESA 4CK3A 2OZSA 4AHTA 1BCOA 3AA2A 4JRQA 3ASMA 2RKIA 3C6UA 4F2RA 3QEVA 1EP4A 2HB5A 4K8XA 5J2QA 2XY8A 3HPHA 3V1QA 3KKSA 4B9TA 4DG1A 1VSFA 1JLEA 1VSLA 1J9AA 4CGHA 4UQGA 3HVRA 4IFVA 3P83D 4C8KA 2OZMA 2WOMA 4GW6A 3AVGA 3OYCA 4HUGA 4ZHRA 1S5JA 2YHBA 3AVNA 4B8AB 1IO2A 3OYFA 3HK2A 3OYAA 1LWEA 3OYLA 1WLJA 2HHWA 3HXMA 1RDCA 5C24A 3HP6A 1L3TA 3L3UA 3TAFA 2DFEA 2P51A 2GV9A 2OPPA 3C6TA 3HYFA 2BDPA 3KLIA 3KK1A 1U47A 1WN7A 1JLFA 3F9KA 3RRHA 4KI6A 1C0UA 2Z1GA 4CEBA 2B5JA 5T7BA 3QERA 3B6OA 2G8HA 4FJGA 4N47A 4BDYA 4QOZB 4ID1A 3L2VA 3U3GA 3CFPA 4AHRA 4RW9A 1SL1A 2E6LA 1NK4A 4Z4FA 1C1BA 4OJRA 2A1RA 1L5UA 1GOCA 4EZ6A 3ZSOA 2VG5A 2HHSA 4AH9A 3TARA 4CGDA 3OYEA 2D0AA 3LWMA 2VWKA 2DY4A 3KJVA 4CJQA 4AHSA 2FBXA 1TKZA 3SJJA 3RRGA 2BGGA 3AO3A 3DRSA 3AA5X 4KKOA 4DU1A 3RR7A 1REVA 4E7IA 3OJUA 1U04A 1I3AA 3QNNA 5HLFA 4DFMA 1U45A 3THVA 3PY8A 3HSTB 1RBUA 1B9DA 3PO5A 3MXJA 3QESA 4KHQA 3HPOA 1RT4A 1HYZA 4E0DA 2G8UA 3K5NA 4CGGA 1JL1A 2OPSA 3MEGA 5EU7A 2F8TA 3M8RA 3SUPA 1IKVA 1NK6A 3KLFA 4B3OA 2HHXA 4H4MA 4DU3A 3OYMA 2D5RA 5J2PA 3NAEA 3OYDA 3V4IA 2E6MA 4CEDA 1TKDA 2RN2A 4FZYA 2O4IA 4IBNA 2JGUA 4RW8A 1RDBA 3VN5A 4CJEA 2HHVA 2FC0A 2ZD1A 4Q5VA 4DQRA 3B6PA 3OS2A 4KHUA 3ALYA 1Q9XA 4B9VA 4CJUA 3RTVA 4BDPA 4ELVA 4LSNA 3ZSVA 3NFAA 3MXIA 3MXMA 3OYIA 3O3GA 2DFHA 3MAQA 2QKKA 2W42A 2QK9A 4OLAA 3C94A 4AHVA 1BIUA 3V9SA 4OKKA 3PX4A 3ZCMA 4FJKA 1KCFA 1X1PA 1BI4A 4KI4A 1RTHA 4W5TA 4DTXA 5HRRA 4OGCA 3PUFA 5KRTA 2VWJA 3V9XA 3QNOA 1EXQA 1RBSA 4JLHA 1EKEA 3EY1A 1SL0A 3OYJA 2HNYA 4E1NA 2PY5A 2KTQA 4Q0BA 3ZSRA 1D9FA 4M3YA 4PUOA 4KFBA 1HJRA 1TVRA 2A1SA 2D0CA 4O55A 4Y1DA 5HRSA 1SL2A 2F8SA 1W0HA 3ZT3A 3LALA 5JS2A 1WSIA 1WSJA 4AHCA 4HUEA 3QLHA 1HNVA 1MU2A 4CF1A 5J1EA 4F3TA 3TAPA 4Z4GA 4CHPA 1SV5A 3F73A 4E1MA 3AVAA 3NH0A 4FJJA 1QE1A 3WNFA 3LZIA 1RBTA 3PV8A 4B9UA 3TAMA 3QETA 1X9SA 3AVHA 1QHTA 2DTUA 2KFNA 2YKNA 4NCBA 2ATQA 3V6DA 4ZTFA 1JXBA 1TK5A 4B9LA 5KI6A 1KFSA 3CG7A 3VQDA 4NYFA 4PY5A 1RT3A 1WAFA 5JS1A 3VQPA 4EP5A 3SNNA 3U6FA 3MECA 1FKOA 1GOAA 4HCBA 1Z26A 5DMRA 4KTWA 4DFPA 3SI6A 3G0ZA 2KQ2A 1XWLA 3D45A 1BQMA 4CJTA 1UOCA 1BI4B 2YKMA 1U48A 4DSLA 4LY7A 2YNGA 3IRXA 3QIOA 3SV4A 1J5OA 2HHTA 4CJWA 2R7YA 4BWMA 3ZSZA 4ELTA 3M8QA 3O3FA 3DMJA 3NF9A 3M8SA 1BISA 4CF9A 2YNIA 1HPZA 1RBVA 3S9HA 4ZTJA 3SZ2A 3CFRA 3HP9A 3AO4A 3IG1A 1BQNA 1KSPA 2P1JA 1BHLA 1SKSA 4DSKA 4EZ9A 4DSIA 1FKPA 4CJSA 4CF8A 3ZT2A 1RT6A 4DTNA 5C42A 4DWIA 2Y1IA 4O5BA 4B08A 4DS5A 1C1AA 4Z4CA 3V1RA 1TKTA 3T3FA 4IFYA 1BCMA 4WE1A 4CFDA 3SUNA 1UA1A 3VQ7A 2NUBA 3UIQA 4O44A 1HYSA 4FJMA 1NK8A 1C0TA 1LAVA 3DI6A 1B9FA 2FBYA 4LH4A 4DLEA 3QIPA 3V9ZA 3DLEA 1A5XA 3AO5A 4KHYA 1XHZA 1S9GA 2PZSA 1VRUA 2B4JA 3I0SA 1JL2A 4E3SA 3OS0A 3TANA 2Q3SA 4CK2A 1NOYA 4KPYA 2Z1JA 4HVJA 1KTQA 4KTZA 4HTUA 5HRNA 4I9LA 4DSEA 1C0MA 1Z25A 1ZYQA 4QAGA 3L3VA 1EETA 3K5MA 3TABA 4CFBA 3VQCA 1Q8IA 1JLQA 2EX3A 4H4OA 4OKJA 3HM9A 5I3UA 1FXXA 3VQBA 3CQ8A 1SKWA 3DOKA 2Z1IA 5C25A 1VRTA 3NF7A 4M3WA 1NJZA 4CIEA 2B6AA 2XY6A 4OGEA 1TKXA 4CE9A 2EHGA 3SPYA 3NCIA 3TI0A 5K14A 1RT7A 1NKBA 1S1WA 2PYJA 3DLHA 3A2FA 3JSMA 4IKFA 4CECA 4FJ5A 1S6PA 3HO1A 4KRFA 1KVBA 3HPGA 2AJQA 3QINA 1S9EA 3QEPA 4C8OA 5CZ2A 5CYQA 4XIUA 1QSLA 4M3UA 3TAGA 1ZBLA 1SKRA 4FM2A 3O3HA 4CHOA 3NHGA 1QSSA 1CXUA 3OY9A 1DTTA 4DTRA 3QEWA 2IOCA 2GUIA 4I2QA 5KTQA 2RPIA 4FLWA 3KTQA 3SQ1A 1RBRA 3NH2A 3L2RA 1A5VA 4O0IA 1KLMA 4G1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T19 A;  2IDO A;  1S1X A;  3AA3 A;  3HVT A;  4OVL A;  4B9M A;  4CEA A;  3ITH A;  1ASW A;  3VQE A;  3TAQ A;  3AVK A;  2VG6 A;  3CYM A;  3AVF A;  4BWJ A;  1VSJ A;  3KKR A;  4DTS A;  1JLB A;  4C8N A;  5KGX A;  2G8I A;  2FBT A;  4F8R A;  1KVA A;  2XRI A;  4KB0 A;  4C8M A;  3OYN A;  4DTJ A;  1ASU A;  4FLU A;  4W5N A;  3C95 A;  3AVL A;  5HBM A;  4CK1 A;  3TAE A;  1CZ9 A;  1I39 A;  2FBV A;  5FRO A;  4BE2 A;  4FXD A;  4FJN A;  3AO1 A;  3TWH A;  3AV9 A;  1YVU A;  4DMN A;  1RT1 A;  4M3Z A;  4FZZ A;  4CGJ A;  3T1A A;  4JRP A;  2ITG A;  4B8C A;  3QEI A;  4RG8 A;  4M41 A;  3NGY A;  5HP1 A;  4GVM A;  3S3M A;  4F2S A;  2DFF A;  4DQP A;  4CJ4 A;  4MFB A;  3DLG A;  4OKE A;  3NGI A;  4KAZ A;  3D0P A;  1VSM A;  1RDD A;  5KGW A;  1NK0 A;  2JLE A;  4E7L A;  4MQ3 A;  1X9W A;  1FK9 A;  1WSH A;  4DTP A;  1JLG A;  3VQ8 A;  4ELU A;  4KTQ A;  2G8W A;  3P5J A;  4W5R A;  3K59 A;  4CF0 A;  2ZE2 A;  4Z0U A;  4DLG A;  1KFD A;  2YV0 X;  1TK8 A;  2OPR A;  2BAN A;  4RW7 A;  2GBZ A;  4IG0 A;  4CJP A;  1VSD A;  3ZSY A;  1GOB A;  3CM6 A;  4K8Z A;  5FRN A;  2G8K A;  1K6Y A;  2OA8 A;  2KFZ A;  2WON A;  3VQ6 A;  4IDK A;  1RTI A;  4DF4 A;  4DTU A;  2ZQB A;  1DTQ A;  3VQQ A;  4BE1 A;  4FJL A;  2HVH A;  1LW0 A;  4NCA A;  3RR8 A;  4CJL A;  1T7P A;  3G10 A;  3SQ4 A;  3TR8 A;  5J2M A;  1L3S A;  1LWF A;  4CEZ A;  3QEX A;  1CLQ A;  2ETJ A;  1RCH A;  5CY4 A;  3NDK A;  4FK2 A;  3SCX A;  3K5L A;  1JLA A;  1QS4 A;  1WSG A;  2I5J A;  2G8F A;  4OPJ A;  2XY5 A;  2Y1J A;  1NJX A;  3HJF A;  3DLB A;  5D3G A;  2HHQ A;  4BE0 A;  1L3V A;  3ZSX A;  3LP3 A;  4CHZ A;  4CJF A;  4E7H A;  5CZ1 A;  3E01 A;  1F21 A;  4HHT A;  4CJ5 A;  3LZJ A;  3O4N A;  1HQU A;  2X74 A;  1LW2 A;  4KRE A;  3SPZ A;  3PX0 A;  1ASV A;  4DQI A;  4KHN A;  4N56 A;  3NF6 A;  1LAW A;  4Y1C A;  3AVJ A;  3RMB A;  4FK0 A;  4FLX A;  2QKB A;  4FYD A;  1T8E A;  5KRS A;  3KIO A;  3FFI A;  4FJX A;  4FVM A;  4C8L A;  1RDA A;  1BL3 A;  2HND A;  3MEE A;  3DRR A;  4CHQ A;  3ZT0 A;  3LP2 A;  3BDP A;  4FJ8 A;  2RF2 A;  4BDZ A;  1VSI A;  1ZBF A;  2YHA A;  4E19 A;  4N76 A;  1VSH A;  1TGO A;  1YTA A;  4DF8 A;  1TV6 A;  1KRP A;  4L8R B;  4LD0 A;  1UAX A;  1J53 A;  3KD5 E;  1J54 A;  2IGI A;  4PA1 A;  2X78 A;  1G15 A;  3DLK A;  3K5O A;  3AVI A;  1HRH A;  3MED A;  4FLT A;  2P5G A;  2G8V A;  4KO0 A;  1TAU A;  1IKY A;  1HQE A;  4CIF A;  2E4L A;  3V9W A;  1Q9Y A;  4LSL A;  2XHB A;  4J2E A;  1TL3 A;  1IKW A;  1WAJ A;  3RMA A;  4HCC A;  5HRO A;  4ID5 A;  4NCG A;  3VQ4 A;  1X9M A;  4PQU A;  3S3N A;  4DQQ A;  2HHU A;  3JYT A;  3ULD A;  2IAJ A;  3V1O A;  3DRP A;  1NK5 A;  4CGI A;  4R5P A;  3L8B A;  3H08 A;  1S1V A;  3IAY A;  3K2P A;  2BE2 A;  1ITG A;  3AA4 A;  4OLB A;  4HUF A;  4F3O A;  1ZBH A;  4ICL A;  3L2U A;  3LAM A;  4FM0 A;  4TSX A;  1UA0 A;  3RWU A;  4B9S A;  1L3U A;  4FK4 A;  1S1U A;  3CFO A;  5FDL A;  3NGZ A;  4FCY A;  4CEQ A;  4QCL A;  1U4B A;  1TAQ A;  4GMJ B;  5E41 A;  5I42 A;  1CZB A;  2X6N A;  3DLR A;  3KLE A;  4M3T A;  2XO7 A;  3LAK A;  1QQC A;  4O4G A;  2YNF A;  2OPQ A;  4M3R A;  4EP4 A;  3HT3 A;  4DFK A;  4J2D A;  4DFJ A;  2OYQ A;  3DYA A;  1CXQ A;  3NBP A;  3OYB A;  3PO4 A;  4FJ7 A;  1ZBI A;  1HNI A;  3SUQ A;  1D9D A;  1RNH A;  1WNS A;  3O4Q A;  1NKC A;  4DS4 A;  1NK7 A;  4AHU A;  1D5A A;  1KVC A;  3RMD A;  4FW1 A;  3VQ9 A;  4CJ3 A;  1RT2 A;  3AVB A;  4OPK A;  1YT3 A;  3HL8 A;  4IG3 A;  4I7F A;  2F96 A;  3VA3 A;  2PYL A;  3L2Q A;  4CHN A;  3K57 A;  4FM1 A;  4I9Q A;  3EYZ A;  4DTM A;  1BIZ A;  4W5Q A;  3LDS A;  1LWC A;  1TK0 A;  4CEE A;  1YTU A;  4BAC A;  3SQ2 A;  4FJI A;  1W9H A;  1HYV A;  1D8Y A;  4FW2 A;  4RW6 A;  2P5O A;  4Z4I A;  1Y97 A;  4PWD A;  4CJK A;  1NK9 A;  4CEF A;  1S6Q A;  1WSF A;  2O4G A;  4N5S A;  1KLN A;  3ZT1 A;  1XC9 A;  1IKX A;  4FLY A;  4FJ9 A;  3KLH A;  3SQ0 A;  4M3X A;  1RT5 A;  3DOL A;  5SWM A;  2HNZ A;  3ZSW A;  1NJY A;  1XHX A;  1SUQ A;  4CIG A;  4KHS A;  4O0J A;  3DM2 A;  3KK2 A;  1IG9 A;  1HMV A;  4W5O A;  3VA0 A;  3OJS A;  1VSK A;  3LP0 A;  1NJW A;  1QSY A;  3KD1 E;  3BGR A;  2QXF A;  3OS1 A;  4JS5 A;  1C6V A;  3AO2 A;  1XI1 A;  1A5W A;  1ZBU A;  3U3Y A;  1T05 A;  4DSJ A;  3P1G A;  4DTO A;  3S3O A;  3LP1 A;  3NF8 A;  1VSE A;  1BGX T;  1VK0 A;  3QO9 A;  2YNH A;  4FLV A;  3LPU A;  5SZT A;  5FRM A;  2Z1H A;  2KZM A;  3OYH A;  4DQS A;  5J2N A;  1O1W A;  4Z4H A;  1EX4 A;  2X6S A;  4NYN A;  3OYG A;  3AVM A;  4CGF A;  2HVI A;  4DU4 A;  3V9U A;  1NOZ A;  1TL1 A;  4CFA A;  4FLZ A;  5CYM A;  3SV3 A;  2VG7 A;  4E7K A;  1C1C A;  3NE6 A;  2HW3 A;  4CHY A;  1JXE A;  4F4K A;  3LPT A;  1B92 A;  4AIL C;  4M45 A;  2KZZ A;  4Z4E A;  3OYK A;  2KW4 A;  1T03 A;  4H8K A;  1RTD A;  4CJR A;  3EZ5 A;  1R0A A;  4KHW A;  1RTJ A;  4LH5 A;  4CF2 A;  3RMC A;  1N5Y A;  3ZT4 A;  4FZX C;  4J2B A;  4YNQ A;  4N41 A;  4M42 A;  4FJH A;  4J2A A;  3I0R A;  3PX6 A;  1WSE A;  4I2P A;  4CER A;  2IC3 A;  2D0B A;  1S1T A;  1DLO A;  3WNG A;  3LWL A;  3VQA A;  1LV5 A;  3LAN A;  5DK5 A;  1JLC A;  3ZSQ A;  5HRP A;  1N6Q A;  3SUO A;  2HMI A;  3AVC A;  4RW4 A;  1JKH A;  2XY7 A;  2LSN A;  4CFC A;  4CEO A;  4KV8 A;  1RIL A;  3WNH A;  2IS3 A;  1IH7 A;  4DSF A;  3V81 A;  3OVN A;  4B9N A;  4CCH A;  3I8D A;  3WNE A;  4CJV A;  3CM5 A;  3NH1 A;  4YFU A;  3KK3 A;  3ISN C;  4E89 A;  1QTM A;  3K58 A;  3KLG A;  4KB1 A;  1UWB A;  1U49 A;  1NKE A;  3IS9 A;  3L2W A;  4JS4 A;  3SYZ A;  3M8P A;  4E7J A;  3VQ5 A;  4CES A;  4CK3 A;  2OZS A;  4AHT A;  1BCO A;  3AA2 A;  4JRQ A;  3ASM A;  2RKI A;  3C6U A;  4F2R A;  3QEV A;  1EP4 A;  2HB5 A;  4K8X A;  5J2Q A;  2XY8 A;  3HPH A;  3V1Q A;  3KKS A;  4B9T A;  4DG1 A;  1VSF A;  1JLE A;  1VSL A;  1J9A A;  4CGH A;  4UQG A;  3HVR A;  4IFV A;  3P83 D;  4C8K A;  2OZM A;  2WOM A;  4GW6 A;  3AVG A;  3OYC A;  4HUG A;  4ZHR A;  1S5J A;  2YHB A;  3AVN A;  4B8A B;  1IO2 A;  3OYF A;  3HK2 A;  3OYA A;  1LWE A;  3OYL A;  1WLJ A;  2HHW A;  3HXM A;  1RDC A;  5C24 A;  3HP6 A;  1L3T A;  3L3U A;  3TAF A;  2DFE A;  2P51 A;  2GV9 A;  2OPP A;  3C6T A;  3HYF A;  2BDP A;  3KLI A;  3KK1 A;  1U47 A;  1WN7 A;  1JLF A;  3F9K A;  3RRH A;  4KI6 A;  1C0U A;  2Z1G A;  4CEB A;  2B5J A;  5T7B A;  3QER A;  3B6O A;  2G8H A;  4FJG A;  4N47 A;  4BDY A;  4QOZ B;  4ID1 A;  3L2V A;  3U3G A;  3CFP A;  4AHR A;  4RW9 A;  1SL1 A;  2E6L A;  1NK4 A;  4Z4F A;  1C1B A;  4OJR A;  2A1R A;  1L5U A;  1GOC A;  4EZ6 A;  3ZSO A;  2VG5 A;  2HHS A;  4AH9 A;  3TAR A;  4CGD A;  3OYE A;  2D0A A;  3LWM A;  2VWK A;  2DY4 A;  3KJV A;  4CJQ A;  4AHS A;  2FBX A;  1TKZ A;  3SJJ A;  3RRG A;  2BGG A;  3AO3 A;  3DRS A;  3AA5 X;  4KKO A;  4DU1 A;  3RR7 A;  1REV A;  4E7I A;  3OJU A;  1U04 A;  1I3A A;  3QNN A;  5HLF A;  4DFM A;  1U45 A;  3THV A;  3PY8 A;  3HST B;  1RBU A;  1B9D A;  3PO5 A;  3MXJ A;  3QES A;  4KHQ A;  3HPO A;  1RT4 A;  1HYZ A;  4E0D A;  2G8U A;  3K5N A;  4CGG A;  1JL1 A;  2OPS A;  3MEG A;  5EU7 A;  2F8T A;  3M8R A;  3SUP A;  1IKV A;  1NK6 A;  3KLF A;  4B3O A;  2HHX A;  4H4M A;  4DU3 A;  3OYM A;  2D5R A;  5J2P A;  3NAE A;  3OYD A;  3V4I A;  2E6M A;  4CED A;  1TKD A;  2RN2 A;  4FZY A;  2O4I A;  4IBN A;  2JGU A;  4RW8 A;  1RDB A;  3VN5 A;  4CJE A;  2HHV A;  2FC0 A;  2ZD1 A;  4Q5V A;  4DQR A;  3B6P A;  3OS2 A;  4KHU A;  3ALY A;  1Q9X A;  4B9V A;  4CJU A;  3RTV A;  4BDP A;  4ELV A;  4LSN A;  3ZSV A;  3NFA A;  3MXI A;  3MXM A;  3OYI A;  3O3G A;  2DFH A;  3MAQ A;  2QKK A;  2W42 A;  2QK9 A;  4OLA A;  3C94 A;  4AHV A;  1BIU A;  3V9S A;  4OKK A;  3PX4 A;  3ZCM A;  4FJK A;  1KCF A;  1X1P A;  1BI4 A;  4KI4 A;  1RTH A;  4W5T A;  4DTX A;  5HRR A;  4OGC A;  3PUF A;  5KRT A;  2VWJ A;  3V9X A;  3QNO A;  1EXQ A;  1RBS A;  4JLH A;  1EKE A;  3EY1 A;  1SL0 A;  3OYJ A;  2HNY A;  4E1N A;  2PY5 A;  2KTQ A;  4Q0B A;  3ZSR A;  1D9F A;  4M3Y A;  4PUO A;  4KFB A;  1HJR A;  1TVR A;  2A1S A;  2D0C A;  4O55 A;  4Y1D A;  5HRS A;  1SL2 A;  2F8S A;  1W0H A;  3ZT3 A;  3LAL A;  5JS2 A;  1WSI A;  1WSJ A;  4AHC A;  4HUE A;  3QLH A;  1HNV A;  1MU2 A;  4CF1 A;  5J1E A;  4F3T A;  3TAP A;  4Z4G A;  4CHP A;  1SV5 A;  3F73 A;  4E1M A;  3AVA A;  3NH0 A;  4FJJ A;  1QE1 A;  3WNF A;  3LZI A;  1RBT A;  3PV8 A;  4B9U A;  3TAM A;  3QET A;  1X9S A;  3AVH A;  1QHT A;  2DTU A;  2KFN A;  2YKN A;  4NCB A;  2ATQ A;  3V6D A;  4ZTF A;  1JXB A;  1TK5 A;  4B9L A;  5KI6 A;  1KFS A;  3CG7 A;  3VQD A;  4NYF A;  4PY5 A;  1RT3 A;  1WAF A;  5JS1 A;  3VQP A;  4EP5 A;  3SNN A;  3U6F A;  3MEC A;  1FKO A;  1GOA A;  4HCB A;  1Z26 A;  5DMR A;  4KTW A;  4DFP A;  3SI6 A;  3G0Z A;  2KQ2 A;  1XWL A;  3D45 A;  1BQM A;  4CJT A;  1UOC A;  1BI4 B;  2YKM A;  1U48 A;  4DSL A;  4LY7 A;  2YNG A;  3IRX A;  3QIO A;  3SV4 A;  1J5O A;  2HHT A;  4CJW A;  2R7Y A;  4BWM A;  3ZSZ A;  4ELT A;  3M8Q A;  3O3F A;  3DMJ A;  3NF9 A;  3M8S A;  1BIS A;  4CF9 A;  2YNI A;  1HPZ A;  1RBV A;  3S9H A;  4ZTJ A;  3SZ2 A;  3CFR A;  3HP9 A;  3AO4 A;  3IG1 A;  1BQN A;  1KSP A;  2P1J A;  1BHL A;  1SKS A;  4DSK A;  4EZ9 A;  4DSI A;  1FKP A;  4CJS A;  4CF8 A;  3ZT2 A;  1RT6 A;  4DTN A;  5C42 A;  4DWI A;  2Y1I A;  4O5B A;  4B08 A;  4DS5 A;  1C1A A;  4Z4C A;  3V1R A;  1TKT A;  3T3F A;  4IFY A;  1BCM A;  4WE1 A;  4CFD A;  3SUN A;  1UA1 A;  3VQ7 A;  2NUB A;  3UIQ A;  4O44 A;  1HYS A;  4FJM A;  1NK8 A;  1C0T A;  1LAV A;  3DI6 A;  1B9F A;  2FBY A;  4LH4 A;  4DLE A;  3QIP A;  3V9Z A;  3DLE A;  1A5X A;  3AO5 A;  4KHY A;  1XHZ A;  1S9G A;  2PZS A;  1VRU A;  2B4J A;  3I0S A;  1JL2 A;  4E3S A;  3OS0 A;  3TAN A;  2Q3S A;  4CK2 A;  1NOY A;  4KPY A;  2Z1J A;  4HVJ A;  1KTQ A;  4KTZ A;  4HTU A;  5HRN A;  4I9L A;  4DSE A;  1C0M A;  1Z25 A;  1ZYQ A;  4QAG A;  3L3V A;  1EET A;  3K5M A;  3TAB A;  4CFB A;  3VQC A;  1Q8I A;  1JLQ A;  2EX3 A;  4H4O A;  4OKJ A;  3HM9 A;  5I3U A;  1FXX A;  3VQB A;  3CQ8 A;  1SKW A;  3DOK A;  2Z1I A;  5C25 A;  1VRT A;  3NF7 A;  4M3W A;  1NJZ A;  4CIE A;  2B6A A;  2XY6 A;  4OGE A;  1TKX A;  4CE9 A;  2EHG A;  3SPY A;  3NCI A;  3TI0 A;  5K14 A;  1RT7 A;  1NKB A;  1S1W A;  2PYJ A;  3DLH A;  3A2F A;  3JSM A;  4IKF A;  4CEC A;  4FJ5 A;  1S6P A;  3HO1 A;  4KRF A;  1KVB A;  3HPG A;  2AJQ A;  3QIN A;  1S9E A;  3QEP A;  4C8O A;  5CZ2 A;  5CYQ A;  4XIU A;  1QSL A;  4M3U A;  3TAG A;  1ZBL A;  1SKR A;  4FM2 A;  3O3H A;  4CHO A;  3NHG A;  1QSS A;  1CXU A;  3OY9 A;  1DTT A;  4DTR A;  3QEW A;  2IOC A;  2GUI A;  4I2Q A;  5KTQ A;  2RPI A;  4FLW A;  3KTQ A;  3SQ1 A;  1RBR A;  3NH2 A;  3L2R A;  1A5V A;  4O0I A;  1KLM A;  4G1Q A; 
#chains in the Genus database with same CATH topology
 4OVL A;  1S1X A;  3AA3 A;  4JEP A;  4BRO A;  4B9M A;  3TAQ A;  3SMP A;  5AQX A;  3CYM A;  2G8I A;  3VF2 A;  4F8R A;  1YIJ N;  4DTJ A;  3TU5 A;  5HBM A;  4CK1 A;  4BVO A;  3DJC A;  2NLX A;  4FJN A;  3AO1 A;  1YVU A;  4DCH A;  4DMN A;  4M3Z A;  4FZZ A;  4LF5 K;  3LDL A;  3EKS A;  3NGY A;  4GVM A;  4MFB A;  3DLG A;  3O9S A;  3D0P A;  1VSM A;  1NK0 A;  1ZXO A;  4E7L A;  3DXM B;  5M1N A;  5GAH P;  3FR0 A;  4DTP A;  4A62 A;  2VWB A;  1HLU A;  3MN5 A;  2HBK A;  3VQ8 A;  3CC7 N;  3BZC A;  3K59 A;  1KQS M;  3TPQ A;  1KFD A;  4BGB A;  1HJO A;  4IG0 A;  1IG8 A;  1VSD A;  3D6R A;  3ZSY A;  4BRK A;  2WON A;  3VQ6 A;  4IDK A;  3HBT A;  2ZQB A;  1BA1 A;  1DTQ A;  4R79 A;  4OPA A;  3SLC A;  1L3S A;  1CLQ A;  5CR4 A;  3K5L A;  5AFU A;  1QS4 A;  2QWR A;  3QDK A;  2Y1J A;  5A2Q O;  2HHQ A;  3DLB A;  3BUZ B;  2YHY A;  3N4P A;  5GIN A;  2QM1 A;  3HOT A;  3THX A;  1VQ9 N;  5AQG A;  4KHN A;  3AVJ A;  3RMB A;  5KRS A;  4FWR A;  3KIO A;  3FFI A;  3HI0 A;  3MEE A;  3EEQ A;  2E2N A;  3ZT0 A;  3RSE B;  5KQ8 A;  3AGK A;  4E19 A;  4N76 A;  4FWQ A;  4PL8 A;  1J54 A;  5JLH A;  4PA1 A;  2X78 A;  1NMD A;  3K5O A;  4FLT A;  4KO0 A;  3CCS N;  2E4L A;  1Q9Y A;  5M1P A;  3B8A X;  4ID5 A;  4NCG A;  1X9M A;  2IAJ A;  2IVP A;  3DRP A;  4R5P A;  4I6M A;  5CHI A;  3OTO K;  1ZBH A;  5AZI B;  5BRD A;  3VEX A;  4CD1 A;  2O8B B;  4DV3 K;  3CER A;  2X6N A;  4M3T A;  4LF7 K;  4Z94 A;  3HT3 A;  4EP4 A;  4DFK A;  2NRR A;  1CXQ A;  4ISF A;  3PO4 A;  4FJ7 A;  1HNI A;  3SUQ A;  1OKJ A;  2ZJQ L;  3O4Q A;  3WXL A;  4CZM A;  4H5T A;  4AHU A;  1KVC A;  4ISG A;  3RMD A;  4FW1 A;  4OPK A;  4YOR A;  4FPB A;  1YT3 A;  3HL8 A;  4PKI A;  1K73 O;  1YVN A;  4FO0 A;  3L2Q A;  4MO4 A;  1J5E K;  4DTM A;  1W9H A;  1HYV A;  4FW2 A;  4RW6 A;  4PWD A;  1Y97 A;  1NK9 A;  4CEF A;  3IKM A;  1KLN A;  3FZL A;  3SQ0 A;  5GAG P;  2JWL A;  2HNZ A;  3ZSW A;  2RHK A;  5ELZ A;  1XHX A;  3VTI A;  1YJW N;  2A40 A;  3LP0 A;  3CIP A;  2ZJR L;  5FLX O;  4IWV A;  2BTF A;  1ZBU A;  3U3Y A;  3P1G A;  1U2V A;  2FSJ A;  3FGU A;  4JV5 K;  3TTF A;  4HWI A;  2YNH A;  5FRM A;  4FWO A;  4C1N I;  4LFB K;  2KZM A;  4BRC A;  5AQF A;  4DQS A;  2QW9 A;  5J2N A;  1ILY A;  2Q0R A;  2E2Q A;  3AVM A;  1SZ2 A;  1XUP O;  3SV3 A;  3CQX A;  2VG7 A;  2FXU A;  3AAP A;  4CHY A;  3LPT A;  2KZZ A;  4M45 A;  3OYK A;  2F9T A;  3KHY A;  1W97 L;  4H8K A;  3P31 A;  1VQ8 N;  3IDH A;  4ILJ A;  4J2B A;  3RMC A;  1IBL K;  4YNQ A;  4FJH A;  2NRT A;  4I2P A;  3J7Z O;  3G4S N;  3H45 C;  4JHD A;  3K9K A;  3ZSQ A;  3SUO A;  1JCG A;  1JKH A;  4JNE A;  5AQT A;  3WNH A;  1IH7 A;  3E9L A;  3I8D A;  3WNE A;  3CM5 A;  3KLG A;  1U49 A;  1C0G A;  2OZS A;  4JRQ A;  3ASM A;  1ESV A;  3C6U A;  1VQN N;  4X66 K;  2QI2 A;  2XY8 A;  3HPH A;  4ISE A;  4B9T A;  4FL9 A;  5AR0 A;  1JLE A;  4DR5 K;  4U67 L;  4B1W B;  2OZM A;  2WOM A;  4ZHR A;  2YHB A;  3HK2 A;  1TUY A;  3OYL A;  2HHW A;  3HXM A;  2DFE A;  2HHH K;  3C6T A;  5ADX A;  2BDP A;  1WN7 A;  1C0U A;  2G8H A;  5JVH L;  3U3G A;  4RW9 A;  2UXD K;  2E6L A;  4DV0 K;  1NK4 A;  4B1V A;  2VG5 A;  3OYE A;  2VWK A;  2UYT A;  4CJQ A;  5LL6 Z;  2BGG A;  4KKO A;  4E7I A;  1U04 A;  3T69 A;  3CCU N;  4BQL A;  3MWP A;  2E88 A;  2P9N A;  2GWK A;  1ZBS A;  1HYZ A;  2QWL A;  5EU7 A;  3ZEU A;  2HHX A;  2FSK A;  4H0O A;  1YHQ N;  3R6M A;  5J2P A;  3OYD A;  4IJN A;  4OPH A;  5AQS A;  4CED A;  1TKD A;  1N36 K;  2RN2 A;  5GAD P;  4BRE A;  4F9O A;  1HKB A;  4RW8 A;  4B1Y B;  1RDB A;  4M63 C;  2HHV A;  2GX9 A;  3GDQ A;  4KHU A;  2WFB A;  1Q9X A;  1T3V A;  4B9V A;  4LSN A;  4YOY A;  3UE5 A;  2QK9 A;  2DFH A;  3MAQ A;  2QKK A;  2W42 A;  4CZL A;  1NGE A;  2UU9 K;  1BIU A;  4BRD A;  5LY3 A;  2OTJ N;  1BI4 A;  4CBU A;  4W5T A;  4YDU A;  4O5F A;  2FLO A;  1GLJ O;  4DKW A;  4BRA A;  1FJG K;  4IOA L;  4PUO A;  2F8S A;  4O55 A;  2ZJP L;  1W0H A;  5C15 A;  5JS2 A;  3QLH A;  4LF6 K;  4CF1 A;  4JI2 K;  4B1Z A;  3ENO A;  4FJJ A;  3WNF A;  1RBT A;  1P90 A;  2NRH A;  4LFA K;  3OW2 M;  4PHT X;  1JXB A;  5KI6 A;  4CD3 A;  2ZF5 O;  3H3N O;  3VQD A;  5C12 A;  1KFS A;  4FWS A;  3MEC A;  1FKO A;  5DMR A;  2VYP A;  1HPM A;  3DLL L;  1MWK A;  1BQM A;  5FPE A;  4WQ5 A;  2YKM A;  1KAY A;  5F1X A;  4CJW A;  4BWM A;  1HR0 K;  3M8Q A;  3QFU A;  2P9S B;  4BGA A;  1BIS A;  3O5B A;  4CZI A;  3VEO A;  1RBV A;  5BR9 A;  3SZ2 A;  4BRQ A;  1KSP A;  1BQN A;  4YHH K;  2P1J A;  3ZX3 A;  1YUW A;  1EWQ A;  2JWK A;  3ZT2 A;  1RT6 A;  3KK7 A;  3W3D A;  1HYS A;  2NUB A;  5AQZ A;  4O44 A;  1LAV A;  3MK6 A;  2FBY A;  4LH4 A;  1A5X A;  3DLE A;  4DR4 K;  2B4J A;  3I0S A;  1JL2 A;  4E3S A;  4KPY A;  2Z1J A;  5BN8 A;  3KVG A;  1YJ9 N;  4I9L A;  3BF1 A;  3FZM A;  3TAB A;  3CC2 N;  1CZA N;  1JLQ A;  5I3U A;  4OKJ A;  1GLD G;  1SKW A;  2QWN A;  3DOK A;  2WUS A;  3NF7 A;  1DKG D;  4M3W A;  4YY3 K;  4JKH A;  1NJZ A;  3ZLJ A;  2WTU A;  2EHG A;  3VF6 A;  2VCP A;  2AJQ A;  3FZK A;  3QIN A;  1S9E A;  1XNR K;  5CZ2 A;  4M3U A;  3TAG A;  1SKR A;  3QFP A;  3S41 A;  4CHO A;  4DTR A;  4A57 A;  4I2Q A;  1N34 K;  3VEZ A;  3UKR A;  1NM1 A;  3S3N A;  3ULD A;  1KLM A;  4E7J A;  3CJC A;  3T19 A;  3PO5 A;  4B3S K;  5HL7 L;  4LF4 K;  3G6E N;  4B1X B;  4BWJ A;  1VSJ A;  1JLB A;  2WBN A;  2FBT A;  4JI7 K;  3J8A A;  3I55 N;  4A61 A;  2XRI A;  3VPZ A;  2HST A;  3O9R A;  4W5N A;  3C95 A;  4H0X B;  3AVL A;  2YHW A;  2FBV A;  3TWH A;  1WB9 A;  1QQM A;  4B9Q A;  1RT1 A;  4CGJ A;  3T1A A;  5HP1 A;  1BA0 A;  3E1Y A;  4DQP A;  4FWL A;  4CJ4 A;  4BR0 A;  3NGI A;  1EWR A;  4EHU A;  1RDD A;  5BPN A;  2UUC K;  4B3T K;  3O08 A;  1JLG A;  4KTQ A;  3HOS A;  1XNQ K;  5DM6 L;  4DLG A;  1TK8 A;  2D1K A;  3EO3 A;  2BAN A;  4CZF A;  2QTD A;  2G8K A;  4DF4 A;  5AQK A;  4DTU A;  1X9J A;  3VQQ A;  1YIT N;  3FZF A;  3G10 A;  3TR8 A;  4O8U A;  1HNX K;  4DQ8 A;  5TKY A;  2ZM6 K;  3NDK A;  3SCX A;  2O8E A;  1WSG A;  5AQM A;  2G8F A;  2NRV A;  2XY5 A;  4AQY K;  3MN9 A;  4BRG A;  4FSV A;  5D3G A;  1HX1 A;  3ZSX A;  4CJF A;  4CHZ A;  2P9N B;  3CJB A;  4X62 K;  4BQZ A;  3C0B A;  4HHT A;  1WBB A;  3H46 O;  1HQU A;  3SPZ A;  3CET A;  1ASV A;  3F9M A;  3PX0 A;  1WBD A;  2HBM A;  4EIA A;  3C6H A;  3NF6 A;  1LAW A;  4Y1C A;  1ATR A;  3L0Q A;  5AQH A;  1T8E A;  4DR2 K;  3Q7C A;  4FJX A;  4C8L A;  1RDA A;  1BL3 A;  2HND A;  4CJ7 A;  4PL7 A;  1OVY A;  4BDZ A;  4GKJ K;  1NGG A;  3M1F A;  1YTA A;  1KRP A;  1TV6 A;  3FE1 A;  4GY2 B;  1J53 A;  4JYA K;  3CCL N;  5F2R A;  3AVI A;  3MED A;  3V9W A;  3EKU A;  4J2E A;  2XHB A;  1TL3 A;  3FLC O;  4DV1 K;  3VQ4 A;  1E4G T;  4V19 S;  3JYT A;  5MLC Q;  4CGI A;  5BPL A;  3K2P A;  2BE2 A;  3AA4 A;  4LFC K;  4HUF A;  4E1J A;  4A2B A;  3L2U A;  3C7N A;  4FM0 A;  4B9S A;  1L3U A;  4FK4 A;  1S1U A;  4CEQ A;  1HKC A;  1U4B A;  4GMJ B;  4CI6 A;  5E41 A;  1CZB A;  3DLR A;  2QWM A;  2XO7 A;  3LAK A;  3UKU B;  4M3R A;  2OYQ A;  3DYA A;  3NBP A;  1ZBI A;  1WNS A;  2YX6 A;  4DS4 A;  1NK7 A;  1E4F T;  3O8M A;  3J81 O;  3LM2 A;  4B1U B;  3AVB A;  1OH7 A;  4IG3 A;  2F96 A;  4CHN A;  5EX5 A;  3LDS A;  1TK0 A;  4RCH A;  4AF1 A;  4CEE A;  3THY B;  1GLE G;  3SQ2 A;  5ADX H;  1D8Y A;  3L4Q A;  4CZH A;  4CJK A;  1S6Q A;  1WSF A;  2O4G A;  2A42 A;  4FLY A;  3EZW A;  1BU6 O;  4EHT A;  1XMQ K;  3M3Z A;  1NJY A;  1SUQ A;  3CJ1 A;  4O0J A;  3DM2 A;  3HZ6 A;  1HMV A;  1NGF A;  4W5O A;  5FPD A;  1NJW A;  4BC2 A;  3KD1 E;  3SJH A;  3P39 A;  3OS1 A;  1C6V A;  3MWT A;  1T05 A;  4DR1 K;  1VSE A;  1BGX T;  4JK9 A;  4FLV A;  3LPU A;  5SZT A;  2Z1H A;  1O1W A;  2V7Y A;  1HUX A;  4A5A A;  1EX4 A;  4NYN A;  3OYG A;  4CGF A;  1TL1 A;  4CFA A;  4FLZ A;  4E7K A;  3NE6 A;  3SMS A;  5I9E B;  1JXE A;  4PKG A;  1B92 A;  4Z4E A;  4KHP K;  5AQV A;  2KW4 A;  4JKF A;  1NG9 A;  3EZ5 A;  3BF3 A;  1R0A A;  4KHW A;  3WXK A;  4FZX C;  3IUC A;  4CF2 A;  1N5Y A;  4N41 A;  4IOC L;  3PX6 A;  1KAZ A;  3WQU A;  4CER A;  1S1T A;  1VQP N;  1DGK N;  1LV5 A;  5DK5 A;  1N6Q A;  2HMI A;  4RWT A;  3Q7B A;  2IS3 A;  3D7E O;  4BRL A;  3NH1 A;  4E89 A;  4A2A A;  1UWB A;  1NKE A;  3IS9 A;  3SYZ A;  4JHD B;  4CK3 A;  4AHT A;  3O80 A;  4WQ4 A;  3ATU A;  2QA4 N;  4LF9 K;  5J2Q A;  3QIC A;  4RTF D;  3KKS A;  1VQ7 N;  3R1X A;  3CF5 L;  4CGH A;  4IEE A;  4QS8 A;  3HVR A;  2PAV A;  3P83 D;  4GW6 A;  4H03 B;  3OYC A;  1WLJ A;  2VQF K;  5C24 A;  1VQL N;  3VET A;  2GV9 A;  2Q97 A;  2Z1G A;  3QER A;  2B5J A;  4FJG A;  3B6O A;  4N47 A;  4QOZ B;  4H0V B;  3CFP A;  4AHR A;  1SL1 A;  1C1B A;  4OJR A;  2AA4 A;  3HTV A;  3VEN A;  1NGJ A;  4WFA L;  2A1R A;  1L5U A;  2HMP A;  4AH9 A;  4CGD A;  3GE1 A;  2DY4 A;  4JK7 A;  1TKZ A;  3RRG A;  3AA5 X;  3RR7 A;  1Q7Y O;  3DAW A;  1U45 A;  1I3A A;  3QNN A;  3T1H K;  1S22 A;  4DUY K;  4JKG A;  3MXJ A;  3QES A;  4X64 K;  3HPO A;  3K5N A;  2OPS A;  3MEG A;  1V4S A;  3JAM O;  4B3O A;  2CGJ A;  3SUP A;  2P9I B;  4L3Q A;  3QML A;  2V51 B;  3CMA N;  2ASM A;  4FZY A;  2O4I A;  3VN5 A;  4CZG A;  2ZD1 A;  4Q5V A;  5C2D A;  5M1F A;  1NMN A;  5IT9 O;  3C94 A;  4AHV A;  3V9S A;  4JKA A;  1U6Z A;  1KCF A;  3ENH A;  4KI4 A;  4BR2 A;  3SBT A;  3M5R A;  3PUF A;  3SAH A;  1RBS A;  1EXQ A;  4JLH A;  1EKE A;  4UY8 O;  1GLB G;  2KTQ A;  3ZSR A;  4LC9 B;  1Q18 A;  1TVR A;  4Y1D A;  2QWQ A;  4AHC A;  4HUE A;  1Q86 O;  3TAP A;  4CHP A;  1SV5 A;  4E1M A;  2D0P A;  3NH0 A;  2NRW A;  4BRP A;  2GWJ A;  3AVH A;  3T1Y K;  2YKN A;  2ATQ A;  3V6D A;  3O4W A;  5AFU H;  1H1V A;  1QZ5 A;  4BC3 A;  1RT3 A;  2CH5 A;  3KZB A;  3VQP A;  3SNN A;  3C7N B;  3G0Z A;  2UUB K;  1BG3 A;  4EAH D;  3J7Y P;  2P9U B;  1DT9 A;  1U48 A;  3CI5 A;  4LY7 A;  2YNG A;  3SV4 A;  1J5O A;  4MO5 A;  5F0X A;  5AQN A;  3ZSZ A;  1Z6R A;  3NF9 A;  4CF9 A;  1HPZ A;  4CVN E;  4GV9 A;  2P9P B;  1XMO K;  3HP9 A;  1ZC6 A;  4EZ9 A;  1BHL A;  1JCF A;  2HBJ A;  2E2O A;  5C42 A;  2HBL A;  3RVC A;  1SQK A;  4B08 A;  3CCQ N;  4Z4C A;  1UA1 A;  4WE1 A;  4CFD A;  4FJM A;  3UKR B;  1C0T A;  1DEJ A;  3DI6 A;  3V9Z A;  4YOX A;  3LDN A;  2P9S A;  1NOY A;  4K25 A;  1KTQ A;  1QQO A;  3JXU A;  2AP1 A;  1C0M A;  3E9P A;  3QBW A;  3WXJ A;  4QAG A;  4JI1 K;  1G99 A;  3K5M A;  3VQC A;  1Q8I A;  1FXX A;  1VRT A;  5K14 A;  1S1W A;  2PYJ A;  4CEC A;  4KRF A;  3HO1 A;  1KVB A;  3HPG A;  1Z05 A;  2F4V K;  3QEP A;  4C8O A;  3TSU A;  1ZBL A;  2D0O A;  3O3H A;  2YHX A;  1QSS A;  2YJF A;  5KTQ A;  3SQ1 A;  1A5V A;  2IDO A;  5H1S Q;  3HVT A;  3EE8 A;  4BRM A;  4CEA A;  4FPA A;  3KKR A;  4C8N A;  5KGX A;  1T6D A;  5GAE P;  1S72 N;  1MDU B;  4C8M A;  4A59 A;  3OYN A;  5LMU K;  2GTD A;  3AY9 A;  5FPM A;  3TSP A;  3K9J A;  4BE2 A;  5FRO A;  3D2E B;  4JRP A;  2ITG A;  4JN4 A;  4B8C A;  3QEI A;  2E1Y A;  1BWF O;  3S3M A;  4F2S A;  4OKE A;  5LMN K;  4XH1 A;  4KAZ A;  1X9W A;  2NRZ A;  1WSH A;  2G8W A;  5AQY A;  3P5J A;  4W5R A;  1Q81 O;  4C23 A;  1OH6 A;  4Z0U A;  1HNZ K;  3MMV A;  4RW7 A;  1GOB A;  3CM6 A;  4LF8 K;  1QZ6 A;  1K6Y A;  2OA8 A;  3MCP A;  2KFZ A;  3VES A;  1M1K O;  4FJL A;  2HVH A;  1LW0 A;  3VGK A;  3RR8 A;  4CJL A;  3SQ4 A;  3VGL A;  3HSC A;  1LWF A;  5CY4 A;  1RCH A;  4FK2 A;  1K8A O;  2UUA K;  1JLA A;  3PLA A;  4G9Z A;  2I5J A;  3N4Q A;  1NJX A;  1GLL O;  4BE0 A;  1L3V A;  4E7H A;  3VOV A;  3E01 A;  2QEX N;  4JKG B;  3LZJ A;  3O4N A;  3NVM A;  2X74 A;  4KRE A;  3CCM N;  3THW B;  2HF4 A;  4BG8 A;  5JMV A;  3CJA A;  2QKB A;  4FYD A;  3CD6 N;  2HF3 A;  2H3G X;  2P9L B;  4CHQ A;  3LP2 A;  3MN7 A;  5AQO A;  2RF2 A;  3MDQ A;  1VSH A;  1TGO A;  2NNW A;  4DF8 A;  4LD0 A;  2D4W A;  2A41 A;  3KD5 E;  2IGI A;  2RE2 A;  5JIC A;  4OO1 J;  2P5G A;  1IKY A;  4CIF A;  1IKW A;  1WAJ A;  3RMA A;  3BZK A;  3W0L A;  4HCC A;  4PQU A;  3IAY A;  2ZGZ A;  3L8B A;  3H08 A;  1ITG A;  3FFK B;  4OLB A;  4F3O A;  4ICL A;  3LAM A;  1UA0 A;  3RWU A;  4K42 A;  4FCY A;  3NGZ A;  2YI1 A;  1TAQ A;  2Q36 A;  4FWM A;  5I42 A;  3KLE A;  2IVN A;  3O1B A;  2OPQ A;  4JI8 K;  4DFJ A;  1D9D A;  4DV5 K;  1RNH A;  1NKC A;  4I6M B;  3MX5 A;  2PYL A;  1NWK A;  1LCU A;  5EVZ A;  4I7F A;  4HTL A;  4JKB A;  4FM1 A;  2KKZ A;  3EYZ A;  1YTU A;  4WFN L;  3KWG A;  4ILH A;  4BAC A;  4FJI A;  4IOX A;  1YXQ A;  4Z4I A;  1R59 O;  4JKD A;  3U9D A;  4AM6 A;  4C1N K;  3ZT1 A;  1XC9 A;  4NXM K;  3VGM A;  3KLH A;  1RT5 A;  4BY9 C;  3P38 A;  4KHS A;  4KH4 A;  4JI3 K;  3VA0 A;  1VSK A;  2OAN A;  1QSY A;  5AQL A;  3BGR A;  1XI1 A;  4DSJ A;  2J4R A;  1VK0 A;  3SBG A;  3QO9 A;  4Z4H A;  4NXN K;  1C1C A;  4H0Y B;  3IMX A;  3J80 O;  4AIL C;  4XEI A;  2W41 A;  1T03 A;  3LDP A;  4LH5 A;  3ZT4 A;  3GG4 A;  5GIO A;  4DR7 K;  2IC3 A;  2D0B A;  2V52 B;  1DLO A;  3WNG A;  1VQK N;  1NGI A;  2W40 A;  5AQR A;  3PIP L;  3VQA A;  3LAN A;  3TTC A;  5M1K A;  2XY7 A;  2E20 A;  3CQY A;  1RIL A;  3V81 A;  1BO5 O;  3OVN A;  4B9N A;  4CCH A;  4H0T B;  4CJV A;  4YFU A;  2IVO A;  3ISN C;  1QTM A;  5HOO A;  3K58 A;  4KB1 A;  5AJ3 K;  4FWP A;  1X3N A;  3VQ5 A;  4CES A;  1VQ5 N;  4ILG B;  1BCO A;  3AA2 A;  2RKI A;  3QB0 A;  1EQY A;  4F2R A;  2VGN A;  2HB5 A;  1EO1 A;  1N32 K;  3HM8 A;  3A8Y A;  1NGD A;  2ASO A;  4DG1 A;  1VSF A;  4K41 A;  4IEI A;  1VSL A;  4UQG A;  1IBM K;  3AVG A;  4HUG A;  4B8A B;  3D2E A;  3OYF A;  3OYA A;  5C10 A;  1RDC A;  1GLF O;  3HP6 A;  1L3T A;  4NLB A;  3E66 A;  1HNW K;  2NRX A;  1U47 A;  4KI6 A;  3RRH A;  2ZWH A;  5T7B A;  3O9Q A;  3LM9 A;  4GKK K;  3O9U A;  4JI4 K;  3WXM B;  4EZ6 A;  1GOC A;  2YJE A;  1NBW A;  2HHS A;  4CZJ A;  2P9K B;  3TAR A;  1NGC A;  4WQ4 C;  3SAG A;  4AHS A;  2FBX A;  3SJJ A;  2W6L A;  4DFM A;  4BRF A;  3HST B;  2I7N A;  1YF5 L;  1B9D A;  2PFU A;  2O8E B;  4KHQ A;  3VEV A;  1WUA A;  4CGG A;  3A0I X;  1JL1 A;  4JKE A;  1NK6 A;  3KLF A;  2PBD A;  4KH5 A;  2D5R A;  3A5L C;  1NU0 A;  4JI6 K;  3AGR A;  3NAE A;  4JI0 K;  4H5W A;  1U2V B;  4IBN A;  2JGU A;  4WFB L;  5FPN A;  3NVK A;  4DQR A;  4JI5 K;  3AAR A;  3ALY A;  1T44 A;  4CJU A;  1HKG A;  2E5L K;  1KC8 O;  3NFA A;  4DV4 K;  3OYI A;  3O3G A;  1K9M O;  4OLA A;  4B3R K;  3PX4 A;  4FJK A;  3NMU A;  4MLE A;  2O8D B;  1RTH A;  5KRT A;  2VWJ A;  3QNO A;  1SL0 A;  3EY1 A;  2KHO A;  4E1N A;  4Q0B A;  1D9F A;  4KFB A;  1HJR A;  2D0C A;  5AQU A;  3A5M C;  1WSI A;  1WSJ A;  4BC5 A;  2O8F A;  1HNV A;  1RFQ A;  1MU2 A;  2A6A A;  2DPN A;  2ASP A;  3AVA A;  4OX9 K;  1Y64 A;  3LZI A;  3PV8 A;  5AQP A;  3QET A;  3J7A P;  1QHT A;  2KFN A;  4NCB A;  4ZTF A;  1TK5 A;  3VER A;  4NYF A;  4PY5 A;  1WAF A;  3DWL A;  4EP5 A;  4H5R A;  1VQ4 N;  1LOT B;  3SI6 A;  1XWL A;  3I33 A;  4YDU C;  4CJT A;  1UOC A;  5BR8 K;  2NZT A;  4YOT A;  2HOE A;  3IRX A;  3QIO A;  2HHT A;  3WEE A;  2FSN A;  4YOW A;  3THX B;  4DR6 K;  2FF6 A;  4ELT A;  3O3F A;  3M8S A;  3DMJ A;  4H0P A;  4DV7 K;  4ZTJ A;  2WC9 A;  3DXK A;  4K0K K;  4DSK A;  4IDH A;  3WQT A;  4CJS A;  4CF8 A;  3O1W A;  4DTN A;  3JS6 A;  2Y1I A;  4O5B A;  1TYQ B;  3TTD A;  2P9U A;  4DS5 A;  3MX2 A;  3T3F A;  5DM7 L;  4IFY A;  1BCM A;  3UIQ A;  5KQD A;  1NK8 A;  1B9F A;  3QIP A;  3AO5 A;  1XHZ A;  1S9G A;  2Q3S A;  4CK2 A;  4HVJ A;  4BVP A;  3WXI A;  4KTZ A;  4HTU A;  5HRN A;  3CCJ N;  1Z25 A;  5TKW A;  2F9W A;  3CPE A;  4YOV A;  4CFB A;  4DUZ K;  5JVG L;  2EX3 A;  3HM9 A;  5AQW A;  3VQB A;  1IJJ A;  3CQ8 A;  3O9T A;  2Z1I A;  5C25 A;  3CJ7 A;  3D2F A;  5KPZ A;  3DXM A;  2XY6 A;  5AZI A;  1TKX A;  1P8Z A;  1GLA G;  3SPY A;  3TI0 A;  4DR3 K;  1OH5 A;  3DLH A;  2IIR A;  5B8H A;  4IKF A;  4FJ5 A;  1S6P A;  3VF4 A;  1VQO N;  5EXW A;  5CYQ A;  4XIU A;  1TYQ A;  5JLF A;  4FOI A;  1DTT A;  3QEW A;  2IOC A;  2GUI A;  4CBX A;  4H5V A;  3LL3 A;  4FLW A;  3KTQ A;  4G1Q A;  1N33 K;  3OHR A;  1X3M A;  3ITH A;  1ASW A;  3VQE A;  4BG9 A;  3AVK A;  2VG6 A;  3ZEU B;  2QXL A;  3AVF A;  3U4L A;  4DTS A;  1FW6 A;  4MDA A;  5E84 A;  5BRF A;  1KVA A;  4KB0 A;  1ASU A;  4FLU A;  1W2B M;  3TAE A;  1CZ9 A;  1I39 A;  4JD2 A;  4FXD A;  1NGH A;  1NLV A;  3AV9 A;  1I94 K;  5LJV A;  3O6W A;  4RG8 A;  4M41 A;  3IFR A;  2DFF A;  1RDU A;  2F7T A;  5KGW A;  2JLE A;  4MQ3 A;  1FK9 A;  1QVF M;  4IO9 L;  5AQJ A;  4ELU A;  3ULE B;  4CF0 A;  2ZE2 A;  2V7Z A;  2O8C B;  2YV0 X;  3F5T A;  2OPR A;  4XH5 A;  3CCV N;  2GBZ A;  3PSF A;  4CJP A;  4DV2 K;  3BY5 A;  4WQ5 C;  1SS6 A;  1T6C A;  4K8Z A;  3HRG A;  1Q82 O;  5FRN A;  1RTI A;  4BE1 A;  5BRE A;  2W6K A;  4NCA A;  4CW7 B;  1T7P A;  2I7P A;  5J2M A;  4J8F A;  2CGL A;  1MA9 B;  4CEZ A;  3QEX A;  2ETJ A;  4OPJ A;  3HJF A;  1S3X A;  3LP3 A;  3OBW A;  3M6G A;  5CZ1 A;  1F21 A;  4CJ5 A;  2VQE K;  2OTL N;  1LW2 A;  4DQI A;  3T7Z A;  4IO8 A;  4BR5 A;  4N56 A;  4FK0 A;  4FLX A;  1TUU A;  3WUH A;  4FVM A;  1K8K B;  3CXC M;  4BRI A;  3DRR A;  3BDP A;  4FJ8 A;  1VSI A;  1ZBF A;  2YHA A;  1O13 A;  3MN6 A;  4L8R B;  1KXP A;  4WYB A;  1NGB A;  1UAX A;  5C2F A;  1XQS C;  3ZX2 A;  2O8F B;  4BR4 A;  1G15 A;  3DLK A;  3L6Q A;  1HRH A;  2G8V A;  3L4I A;  1TAU A;  3SAF A;  1HQE A;  2O8D A;  4LSL A;  3VEY A;  2E1Z A;  5HRO A;  1IV0 A;  4BR9 A;  2Q0U A;  4DQQ A;  3AAQ A;  3V1O A;  1NK5 A;  3OA9 A;  1S1V A;  4M7Y A;  4JAX A;  2E8A A;  2BH1 A;  3H6E A;  1N8R O;  5IWA K;  4TSX A;  4K43 A;  3CFO A;  4CZE A;  5FDL A;  4QCL A;  4GNI A;  2P9K A;  1QQC A;  1QHA A;  2YNF A;  4O4G A;  4J2D A;  3P4I A;  4A5B A;  3OYB A;  2Q2R A;  4KH6 A;  3THW A;  1D5A A;  4CJ3 A;  3VQ9 A;  1RT2 A;  3VA3 A;  4I9Q A;  3K57 A;  1BIZ A;  4IZ9 A;  4W5Q A;  1LWC A;  2P5O A;  4FJ9 A;  4N5S A;  3LDQ A;  1IKX A;  4M3X A;  3DOL A;  3H3O B;  5SWM A;  2P9P A;  3A5O C;  3C6A A;  3MCA B;  4GV6 A;  4CIG A;  3KK2 A;  1IG9 A;  3OJS A;  2GEL A;  2ITM A;  3U9Z A;  4JS5 A;  2QXF A;  1NNE A;  3AO2 A;  1A5W A;  1C0F A;  4DTO A;  3S3O A;  3LP1 A;  3NF8 A;  1KD1 O;  3CCE N;  3OYH A;  3WT0 A;  3GL1 A;  2X6S A;  3E9O A;  2HVI A;  4DU4 A;  3V9U A;  1NOZ A;  1JJ2 M;  5CYM A;  1WOQ A;  2Q31 A;  2HW3 A;  4F4K A;  5AZJ B;  5KPT A;  3GBT A;  1J6Z A;  1RTD A;  4CJR A;  1RTJ A;  1OVQ A;  4NLC A;  3TSQ A;  4M42 A;  4BR7 A;  4J2A A;  3I0R A;  4DB3 A;  1WSE A;  5EY4 A;  2E2P A;  2FF3 B;  4WF9 L;  5BPM A;  2GEM A;  4PKH A;  4QS7 A;  1VAZ A;  1JLC A;  5HRP A;  3ID8 A;  1YI2 N;  2BUP A;  3AVC A;  3CCR N;  4RW4 A;  1QQN A;  2LSN A;  4CFC A;  4CEO A;  4KV8 A;  4DSF A;  3I8B A;  1GLC G;  5C0Y A;  1BOT O;  3KK3 A;  4U7B A;  2QWO A;  3PSI A;  3L2W A;  4JS4 A;  3M8P A;  4CBW A;  2YCH A;  3QEV A;  1EP4 A;  1YJN N;  1JCE A;  4K8X A;  4GVE A;  3V1Q A;  1VQ6 N;  1J9A A;  4JD2 B;  3VTH A;  4IFV A;  4C8K A;  1XC3 A;  3H1Q A;  3ZX0 A;  1S5J A;  3AVN A;  1IO2 A;  4IXC A;  1LWE A;  1IBK K;  4YOU A;  4BRN A;  4GV3 A;  5GIP A;  3L3U A;  3TAF A;  2P51 A;  4O8K A;  2OPP A;  3CC4 N;  3I56 N;  3HYF A;  3UKU A;  3KLI A;  3KK1 A;  1JLF A;  3F9K A;  3GOI A;  4QS9 A;  4FVU A;  4CEB A;  4DV6 K;  2O8C A;  4BDY A;  4ID1 A;  3L2V A;  4IFE A;  4Z4F A;  5BN9 A;  3D2F B;  1RDW X;  3ZSO A;  2D0A A;  3LWM A;  1NJI O;  3KJV A;  4FOE A;  3AO3 A;  3DRS A;  4DU1 A;  1REV A;  3OJU A;  5HLF A;  4H5N A;  3THV A;  3PY8 A;  1RBU A;  3A5N C;  1RT4 A;  1YAG A;  4E0D A;  2G8U A;  2CGK A;  1SAZ A;  2F8T A;  3M8R A;  1IKV A;  2EWS A;  4H4M A;  4DU3 A;  3OYM A;  5LJW A;  3KWI A;  4X65 K;  3V4I A;  1ATS A;  2E6M A;  1BDG A;  4FWK A;  2UXC K;  3R9P A;  4CJE A;  2FC0 A;  4WCE L;  3B6P A;  3OS2 A;  1M90 O;  3RTV A;  2Q1N A;  3ZET B;  4BDP A;  4ELV A;  3F2K A;  2CH6 A;  3ZSV A;  3MXI A;  3MXM A;  3R8E A;  3R3L A;  1D4X A;  2OCE A;  5BRH A;  4OKK A;  3ZCM A;  1X1P A;  2P9I A;  2VGM A;  1E3M A;  4DTX A;  1NGA A;  3ATV A;  3H1V X;  5HRR A;  4OGC A;  3WEE B;  3V9X A;  3RSE A;  3OYJ A;  2HNY A;  1ATN A;  2PY5 A;  3UB5 A;  5AQQ A;  4M7X A;  4M3Y A;  1RGI A;  2A1S A;  5HRS A;  1SL2 A;  3LDO A;  2HHU A;  4NO7 A;  3ZT3 A;  3LAL A;  3VMF B;  3CJ9 A;  5EOY A;  5M1O A;  5J1E A;  3OBY A;  4F3T A;  4Z4G A;  5E26 A;  3ZYY X;  3F73 A;  1QE1 A;  4B9U A;  3TAM A;  3ENB A;  3EL2 A;  3C65 A;  1X9S A;  3EN9 A;  2DTU A;  2ZGY A;  5CE3 A;  4B9L A;  3CG7 A;  4MLH A;  5JS1 A;  4HCB A;  3U6F A;  1GOA A;  1Z26 A;  4KBO A;  4KTW A;  4DFP A;  2O8B A;  4DHY A;  2KQ2 A;  4NB4 A;  5KPR A;  3D45 A;  4BRH A;  4BC4 A;  3CME N;  1QVG M;  2A5X A;  1BI4 B;  1V4T A;  4DSL A;  3THY A;  2R7Y A;  3ZET A;  1BUP A;  2A3Z A;  2YNI A;  4JKC A;  3S9H A;  3G71 N;  3CFR A;  3AO4 A;  3IG1 A;  4DSI A;  1SKS A;  3CHW A;  1FKP A;  1MWM A;  4B3M K;  2KLA A;  1OH8 A;  4DWI A;  4JK8 A;  3FZH A;  3U8X A;  1C1A A;  3V1R A;  1TKT A;  3SUN A;  3BEX A;  3VQ7 A;  1K8K A;  3PIO L;  4DLE A;  2UXB K;  4KHY A;  2PZS A;  1VRU A;  4IJA A;  3TAN A;  3OS0 A;  4EFH A;  3ID6 A;  3VEW A;  3K0S A;  1VHX A;  3DXK B;  4DSE A;  1ZYQ A;  4AM7 A;  3L3V A;  1EET A;  2P9L A;  4H4O A;  2QWP A;  1VQM N;  4CIE A;  2B6A A;  4OGE A;  3BP8 A;  4Y0W A;  3EE9 A;  4CE9 A;  2GUP A;  3NCI A;  3CPW M;  1RT7 A;  5AQI A;  3SK3 A;  5AZJ A;  1NKB A;  3A2F A;  3JSM A;  4CZK A;  3QBX A;  5M1Q A;  1KAX A;  1QSL A;  4FM2 A;  4MDB A;  3G25 A;  3NHG A;  1CXU A;  4FWN A;  3OY9 A;  4XH4 A;  3ULE A;  2RPI A;  1RBR A;  3NH2 A;  3L2R A;  3LWL A;  4O0I A;  1W7A A; 
#chains in the Genus database with same CATH homology
 3T19 A;  2IDO A;  1S1X A;  3AA3 A;  3HVT A;  4OVL A;  4B9M A;  4CEA A;  3ITH A;  1ASW A;  3VQE A;  3TAQ A;  3AVK A;  2VG6 A;  3CYM A;  3AVF A;  4BWJ A;  1VSJ A;  3KKR A;  4DTS A;  1JLB A;  4C8N A;  5KGX A;  2G8I A;  2FBT A;  4F8R A;  1KVA A;  2XRI A;  4KB0 A;  4C8M A;  3OYN A;  4DTJ A;  1ASU A;  4FLU A;  4W5N A;  3C95 A;  3AVL A;  5HBM A;  4CK1 A;  3TAE A;  1CZ9 A;  1I39 A;  2FBV A;  5FRO A;  4BE2 A;  4FXD A;  4FJN A;  3AO1 A;  3TWH A;  3AV9 A;  1YVU A;  4DMN A;  1RT1 A;  4M3Z A;  4FZZ A;  4CGJ A;  3T1A A;  4JRP A;  2ITG A;  4B8C A;  3QEI A;  4RG8 A;  4M41 A;  3NGY A;  5HP1 A;  4GVM A;  3S3M A;  4F2S A;  2DFF A;  4DQP A;  4CJ4 A;  4MFB A;  3DLG A;  4OKE A;  3NGI A;  4KAZ A;  3D0P A;  1VSM A;  1RDD A;  5KGW A;  1NK0 A;  2JLE A;  4E7L A;  4MQ3 A;  1X9W A;  1FK9 A;  1WSH A;  4DTP A;  1JLG A;  3VQ8 A;  4ELU A;  4KTQ A;  2G8W A;  3P5J A;  4W5R A;  3K59 A;  4CF0 A;  2ZE2 A;  4Z0U A;  4DLG A;  1KFD A;  2YV0 X;  1TK8 A;  2OPR A;  2BAN A;  4RW7 A;  2GBZ A;  4IG0 A;  4CJP A;  1VSD A;  3ZSY A;  1GOB A;  3CM6 A;  4K8Z A;  5FRN A;  2G8K A;  1K6Y A;  2OA8 A;  2KFZ A;  2WON A;  3VQ6 A;  4IDK A;  1RTI A;  4DF4 A;  4DTU A;  2ZQB A;  1DTQ A;  3VQQ A;  4BE1 A;  4FJL A;  2HVH A;  1LW0 A;  4NCA A;  3RR8 A;  4CJL A;  1T7P A;  3G10 A;  3SQ4 A;  3TR8 A;  5J2M A;  1L3S A;  1LWF A;  4CEZ A;  3QEX A;  1CLQ A;  2ETJ A;  1RCH A;  5CY4 A;  3NDK A;  4FK2 A;  3SCX A;  3K5L A;  1JLA A;  1QS4 A;  1WSG A;  2I5J A;  2G8F A;  4OPJ A;  2XY5 A;  2Y1J A;  1NJX A;  3HJF A;  3DLB A;  5D3G A;  2HHQ A;  4BE0 A;  1L3V A;  3ZSX A;  3LP3 A;  4CHZ A;  4CJF A;  4E7H A;  5CZ1 A;  3E01 A;  1F21 A;  4HHT A;  4CJ5 A;  3LZJ A;  3O4N A;  1HQU A;  2X74 A;  1LW2 A;  4KRE A;  3SPZ A;  3PX0 A;  1ASV A;  4DQI A;  4KHN A;  4N56 A;  3NF6 A;  1LAW A;  4Y1C A;  3AVJ A;  3RMB A;  4FK0 A;  4FLX A;  2QKB A;  4FYD A;  1T8E A;  5KRS A;  3KIO A;  3FFI A;  4FJX A;  4FVM A;  4C8L A;  1RDA A;  1BL3 A;  2HND A;  3MEE A;  3DRR A;  4CHQ A;  3ZT0 A;  3LP2 A;  3BDP A;  4FJ8 A;  2RF2 A;  4BDZ A;  1VSI A;  1ZBF A;  2YHA A;  4E19 A;  4N76 A;  1VSH A;  1TGO A;  1YTA A;  4DF8 A;  1TV6 A;  1KRP A;  4L8R B;  4LD0 A;  1UAX A;  1J53 A;  3KD5 E;  1J54 A;  2IGI A;  4PA1 A;  2X78 A;  1G15 A;  3DLK A;  3K5O A;  3AVI A;  1HRH A;  3MED A;  4FLT A;  2P5G A;  2G8V A;  4KO0 A;  1TAU A;  1IKY A;  1HQE A;  4CIF A;  2E4L A;  3V9W A;  1Q9Y A;  4LSL A;  2XHB A;  4J2E A;  1TL3 A;  1IKW A;  1WAJ A;  3RMA A;  4HCC A;  5HRO A;  4ID5 A;  4NCG A;  3VQ4 A;  1X9M A;  4PQU A;  3S3N A;  4DQQ A;  2HHU A;  3JYT A;  3ULD A;  2IAJ A;  3V1O A;  3DRP A;  1NK5 A;  4CGI A;  4R5P A;  3L8B A;  3H08 A;  1S1V A;  3IAY A;  3K2P A;  2BE2 A;  1ITG A;  3AA4 A;  4OLB A;  4HUF A;  4F3O A;  1ZBH A;  4ICL A;  3L2U A;  3LAM A;  4FM0 A;  4TSX A;  1UA0 A;  3RWU A;  4B9S A;  1L3U A;  4FK4 A;  1S1U A;  3CFO A;  5FDL A;  3NGZ A;  4FCY A;  4CEQ A;  4QCL A;  1U4B A;  1TAQ A;  4GMJ B;  5E41 A;  5I42 A;  1CZB A;  2X6N A;  3DLR A;  3KLE A;  4M3T A;  2XO7 A;  3LAK A;  1QQC A;  4O4G A;  2YNF A;  2OPQ A;  4M3R A;  4EP4 A;  3HT3 A;  4DFK A;  4J2D A;  4DFJ A;  2OYQ A;  3DYA A;  1CXQ A;  3NBP A;  3OYB A;  3PO4 A;  4FJ7 A;  1ZBI A;  1HNI A;  3SUQ A;  1D9D A;  1RNH A;  1WNS A;  3O4Q A;  1NKC A;  4DS4 A;  1NK7 A;  4AHU A;  1D5A A;  1KVC A;  3RMD A;  4FW1 A;  3VQ9 A;  4CJ3 A;  1RT2 A;  3AVB A;  4OPK A;  1YT3 A;  3HL8 A;  4IG3 A;  4I7F A;  2F96 A;  3VA3 A;  2PYL A;  3L2Q A;  4CHN A;  3K57 A;  4FM1 A;  4I9Q A;  3EYZ A;  4DTM A;  1BIZ A;  4W5Q A;  3LDS A;  1LWC A;  1TK0 A;  4CEE A;  1YTU A;  4BAC A;  3SQ2 A;  4FJI A;  1W9H A;  1HYV A;  1D8Y A;  4FW2 A;  4RW6 A;  2P5O A;  4Z4I A;  1Y97 A;  4PWD A;  4CJK A;  1NK9 A;  4CEF A;  1S6Q A;  1WSF A;  2O4G A;  4N5S A;  1KLN A;  3ZT1 A;  1XC9 A;  1IKX A;  4FLY A;  4FJ9 A;  3KLH A;  3SQ0 A;  4M3X A;  1RT5 A;  3DOL A;  5SWM A;  2HNZ A;  3ZSW A;  1NJY A;  1XHX A;  1SUQ A;  4CIG A;  4KHS A;  4O0J A;  3DM2 A;  3KK2 A;  1IG9 A;  1HMV A;  4W5O A;  3VA0 A;  3OJS A;  1VSK A;  3LP0 A;  1NJW A;  1QSY A;  3KD1 E;  3BGR A;  2QXF A;  3OS1 A;  4JS5 A;  1C6V A;  3AO2 A;  1XI1 A;  1A5W A;  1ZBU A;  3U3Y A;  1T05 A;  4DSJ A;  3P1G A;  4DTO A;  3S3O A;  3LP1 A;  3NF8 A;  1VSE A;  1BGX T;  1VK0 A;  3QO9 A;  2YNH A;  4FLV A;  3LPU A;  5SZT A;  5FRM A;  2Z1H A;  2KZM A;  3OYH A;  4DQS A;  5J2N A;  1O1W A;  4Z4H A;  1EX4 A;  2X6S A;  4NYN A;  3OYG A;  3AVM A;  4CGF A;  2HVI A;  4DU4 A;  3V9U A;  1NOZ A;  1TL1 A;  4CFA A;  4FLZ A;  5CYM A;  3SV3 A;  2VG7 A;  4E7K A;  1C1C A;  3NE6 A;  2HW3 A;  4CHY A;  1JXE A;  4F4K A;  3LPT A;  1B92 A;  4AIL C;  4M45 A;  2KZZ A;  4Z4E A;  3OYK A;  2KW4 A;  1T03 A;  4H8K A;  1RTD A;  4CJR A;  3EZ5 A;  1R0A A;  4KHW A;  1RTJ A;  4LH5 A;  4CF2 A;  3RMC A;  1N5Y A;  3ZT4 A;  4FZX C;  4J2B A;  4YNQ A;  4N41 A;  4M42 A;  4FJH A;  4J2A A;  3I0R A;  3PX6 A;  1WSE A;  4I2P A;  4CER A;  2IC3 A;  2D0B A;  1S1T A;  1DLO A;  3WNG A;  3LWL A;  3VQA A;  1LV5 A;  3LAN A;  5DK5 A;  1JLC A;  3ZSQ A;  5HRP A;  1N6Q A;  3SUO A;  2HMI A;  3AVC A;  4RW4 A;  1JKH A;  2XY7 A;  2LSN A;  4CFC A;  4CEO A;  4KV8 A;  1RIL A;  3WNH A;  2IS3 A;  1IH7 A;  4DSF A;  3V81 A;  3OVN A;  4B9N A;  4CCH A;  3I8D A;  3WNE A;  4CJV A;  3CM5 A;  3NH1 A;  4YFU A;  3KK3 A;  3ISN C;  4E89 A;  1QTM A;  3K58 A;  3KLG A;  4KB1 A;  1UWB A;  1U49 A;  1NKE A;  3IS9 A;  3L2W A;  4JS4 A;  3SYZ A;  3M8P A;  4E7J A;  3VQ5 A;  4CES A;  4CK3 A;  2OZS A;  4AHT A;  1BCO A;  3AA2 A;  4JRQ A;  3ASM A;  2RKI A;  3C6U A;  4F2R A;  3QEV A;  1EP4 A;  2HB5 A;  4K8X A;  5J2Q A;  2XY8 A;  3HPH A;  3V1Q A;  3KKS A;  4B9T A;  4DG1 A;  1VSF A;  1JLE A;  1VSL A;  1J9A A;  4CGH A;  4UQG A;  3HVR A;  4IFV A;  3P83 D;  4C8K A;  2OZM A;  2WOM A;  4GW6 A;  3AVG A;  3OYC A;  4HUG A;  4ZHR A;  1S5J A;  2YHB A;  3AVN A;  4B8A B;  1IO2 A;  3OYF A;  3HK2 A;  3OYA A;  1LWE A;  3OYL A;  1WLJ A;  2HHW A;  3HXM A;  1RDC A;  5C24 A;  3HP6 A;  1L3T A;  3L3U A;  3TAF A;  2DFE A;  2P51 A;  2GV9 A;  2OPP A;  3C6T A;  3HYF A;  2BDP A;  3KLI A;  3KK1 A;  1U47 A;  1WN7 A;  1JLF A;  3F9K A;  3RRH A;  4KI6 A;  1C0U A;  2Z1G A;  4CEB A;  2B5J A;  5T7B A;  3QER A;  3B6O A;  2G8H A;  4FJG A;  4N47 A;  4BDY A;  4QOZ B;  4ID1 A;  3L2V A;  3U3G A;  3CFP A;  4AHR A;  4RW9 A;  1SL1 A;  2E6L A;  1NK4 A;  4Z4F A;  1C1B A;  4OJR A;  2A1R A;  1L5U A;  1GOC A;  4EZ6 A;  3ZSO A;  2VG5 A;  2HHS A;  4AH9 A;  3TAR A;  4CGD A;  3OYE A;  2D0A A;  3LWM A;  2VWK A;  2DY4 A;  3KJV A;  4CJQ A;  4AHS A;  2FBX A;  1TKZ A;  3SJJ A;  3RRG A;  2BGG A;  3AO3 A;  3DRS A;  3AA5 X;  4KKO A;  4DU1 A;  3RR7 A;  1REV A;  4E7I A;  3OJU A;  1U04 A;  1I3A A;  3QNN A;  5HLF A;  4DFM A;  1U45 A;  3THV A;  3PY8 A;  3HST B;  1RBU A;  1B9D A;  3PO5 A;  3MXJ A;  3QES A;  4KHQ A;  3HPO A;  1RT4 A;  1HYZ A;  4E0D A;  2G8U A;  3K5N A;  4CGG A;  1JL1 A;  2OPS A;  3MEG A;  5EU7 A;  2F8T A;  3M8R A;  3SUP A;  1IKV A;  1NK6 A;  3KLF A;  4B3O A;  2HHX A;  4H4M A;  4DU3 A;  3OYM A;  2D5R A;  5J2P A;  3NAE A;  3OYD A;  3V4I A;  2E6M A;  4CED A;  1TKD A;  2RN2 A;  4FZY A;  2O4I A;  4IBN A;  2JGU A;  4RW8 A;  1RDB A;  3VN5 A;  4CJE A;  2HHV A;  2FC0 A;  2ZD1 A;  4Q5V A;  4DQR A;  3B6P A;  3OS2 A;  4KHU A;  3ALY A;  1Q9X A;  4B9V A;  4CJU A;  3RTV A;  4BDP A;  4ELV A;  4LSN A;  3ZSV A;  3NFA A;  3MXI A;  3MXM A;  3OYI A;  3O3G A;  2DFH A;  3MAQ A;  2QKK A;  2W42 A;  2QK9 A;  4OLA A;  3C94 A;  4AHV A;  1BIU A;  3V9S A;  4OKK A;  3PX4 A;  3ZCM A;  4FJK A;  1KCF A;  1X1P A;  1BI4 A;  4KI4 A;  1RTH A;  4W5T A;  4DTX A;  5HRR A;  4OGC A;  3PUF A;  5KRT A;  2VWJ A;  3V9X A;  3QNO A;  1EXQ A;  1RBS A;  4JLH A;  1EKE A;  3EY1 A;  1SL0 A;  3OYJ A;  2HNY A;  4E1N A;  2PY5 A;  2KTQ A;  4Q0B A;  3ZSR A;  1D9F A;  4M3Y A;  4PUO A;  4KFB A;  1HJR A;  1TVR A;  2A1S A;  2D0C A;  4O55 A;  4Y1D A;  5HRS A;  1SL2 A;  2F8S A;  1W0H A;  3ZT3 A;  3LAL A;  5JS2 A;  1WSI A;  1WSJ A;  4AHC A;  4HUE A;  3QLH A;  1HNV A;  1MU2 A;  4CF1 A;  5J1E A;  4F3T A;  3TAP A;  4Z4G A;  4CHP A;  1SV5 A;  3F73 A;  4E1M A;  3AVA A;  3NH0 A;  4FJJ A;  1QE1 A;  3WNF A;  3LZI A;  1RBT A;  3PV8 A;  4B9U A;  3TAM A;  3QET A;  1X9S A;  3AVH A;  1QHT A;  2DTU A;  2KFN A;  2YKN A;  4NCB A;  2ATQ A;  3V6D A;  4ZTF A;  1JXB A;  1TK5 A;  4B9L A;  5KI6 A;  1KFS A;  3CG7 A;  3VQD A;  4NYF A;  4PY5 A;  1RT3 A;  1WAF A;  5JS1 A;  3VQP A;  4EP5 A;  3SNN A;  3U6F A;  3MEC A;  1FKO A;  1GOA A;  4HCB A;  1Z26 A;  5DMR A;  4KTW A;  4DFP A;  3SI6 A;  3G0Z A;  2KQ2 A;  1XWL A;  3D45 A;  1BQM A;  4CJT A;  1UOC A;  1BI4 B;  2YKM A;  1U48 A;  4DSL A;  4LY7 A;  2YNG A;  3IRX A;  3QIO A;  3SV4 A;  1J5O A;  2HHT A;  4CJW A;  2R7Y A;  4BWM A;  3ZSZ A;  4ELT A;  3M8Q A;  3O3F A;  3DMJ A;  3NF9 A;  3M8S A;  1BIS A;  4CF9 A;  2YNI A;  1HPZ A;  1RBV A;  3S9H A;  4ZTJ A;  3SZ2 A;  3CFR A;  3HP9 A;  3AO4 A;  3IG1 A;  1BQN A;  1KSP A;  2P1J A;  1BHL A;  1SKS A;  4DSK A;  4EZ9 A;  4DSI A;  1FKP A;  4CJS A;  4CF8 A;  3ZT2 A;  1RT6 A;  4DTN A;  5C42 A;  4DWI A;  2Y1I A;  4O5B A;  4B08 A;  4DS5 A;  1C1A A;  4Z4C A;  3V1R A;  1TKT A;  3T3F A;  4IFY A;  1BCM A;  4WE1 A;  4CFD A;  3SUN A;  1UA1 A;  3VQ7 A;  2NUB A;  3UIQ A;  4O44 A;  1HYS A;  4FJM A;  1NK8 A;  1C0T A;  1LAV A;  3DI6 A;  1B9F A;  2FBY A;  4LH4 A;  4DLE A;  3QIP A;  3V9Z A;  3DLE A;  1A5X A;  3AO5 A;  4KHY A;  1XHZ A;  1S9G A;  2PZS A;  1VRU A;  2B4J A;  3I0S A;  1JL2 A;  4E3S A;  3OS0 A;  3TAN A;  2Q3S A;  4CK2 A;  1NOY A;  4KPY A;  2Z1J A;  4HVJ A;  1KTQ A;  4KTZ A;  4HTU A;  5HRN A;  4I9L A;  4DSE A;  1C0M A;  1Z25 A;  1ZYQ A;  4QAG A;  3L3V A;  1EET A;  3K5M A;  3TAB A;  4CFB A;  3VQC A;  1Q8I A;  1JLQ A;  2EX3 A;  4H4O A;  4OKJ A;  3HM9 A;  5I3U A;  1FXX A;  3VQB A;  3CQ8 A;  1SKW A;  3DOK A;  2Z1I A;  5C25 A;  1VRT A;  3NF7 A;  4M3W A;  1NJZ A;  4CIE A;  2B6A A;  2XY6 A;  4OGE A;  1TKX A;  4CE9 A;  2EHG A;  3SPY A;  3NCI A;  3TI0 A;  5K14 A;  1RT7 A;  1NKB A;  1S1W A;  2PYJ A;  3DLH A;  3A2F A;  3JSM A;  4IKF A;  4CEC A;  4FJ5 A;  1S6P A;  3HO1 A;  4KRF A;  1KVB A;  3HPG A;  2AJQ A;  3QIN A;  1S9E A;  3QEP A;  4C8O A;  5CZ2 A;  5CYQ A;  4XIU A;  1QSL A;  4M3U A;  3TAG A;  1ZBL A;  1SKR A;  4FM2 A;  3O3H A;  4CHO A;  3NHG A;  1QSS A;  1CXU A;  3OY9 A;  1DTT A;  4DTR A;  3QEW A;  2IOC A;  2GUI A;  4I2Q A;  5KTQ A;  2RPI A;  4FLW A;  3KTQ A;  3SQ1 A;  1RBR A;  3NH2 A;  3L2R A;  1A5V A;  4O0I A;  1KLM A;  4G1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...