4OKEA

Structure of rnase as, a polyadenylate-specific exoribonuclease affecting mycobacterial virulence in vivo
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
VRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTHVLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALCQLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQLRRFRLITSTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3'-5' exoribonuclease Rv2179c/MT2234.1
publication title Structure and Function of RNase AS, a Polyadenylate-Specific Exoribonuclease Affecting Mycobacterial Virulence In Vivo
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 52
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4okeA00
3AVFA 1J54A 4RW7A 4DQRA 3OYDA 2DY4A 1TK5A 5C25A 4YNQA 1RCHA 4AH9A 4OKKA 2EX3A 1NJYA 4CGGA 3E01A 1KRPA 4F2RA 2O4IA 1CXQA 2FBXA 3SCXA 4N41A 4Y1CA 2YNGA 1JLFA 4MQ3A 4DTOA 4ELVA 4Z4GA 1DTTA 2Z1GA 4ICLA 3SV4A 3KLFA 1J9AA 1T7PA 1JXEA 1Q9XA 2W42A 4FJHA 3I0SA 4O5BA 4CEEA 2PZSA 4FW1A 4I9LA 3CM6A 2HVHA 1WSHA 3ULDA 3RWUA 4W5TA 1WAFA 2XRIA 3I0RA 4KHYA 2RF2A 3TAFA 5E41A 3ZT3A 1UA0A 4Z4HA 2F8SA 3CFPA 4KB1A 4CCHA 4QOZB 1WAJA 5KTQA 3OS2A 2ATQA 5CZ2A 4KHUA 3EZ5A 4HHTA 1MU2A 2HMIA 3G0ZA 1QSSA 4K8XA 3NDKA 3OY9A 4CEOA 3SYZA 1YVUA 1RT2A 3EY1A 4OGCA 3TAGA 4LY7A 4I9QA 5HRPA 4Z4CA 3V1RA 1EP4A 2BE2A 3ISNC 3V4IA 1IKVA 3SI6A 4JS4A 2NUBA 2FBYA 3OYBA 1BQMA 2HNDA 4BE1A 3TAMA 4DTUA 2FBTA 1X9MA 2IC3A 1S6QA 4FJ7A 1BHLA 3WNEA 2YNHA 4DS5A 2G8VA 2IAJA 3AO5A 3KKSA 3K5OA 3C94A 4PUOA 4DQQA 1NK8A 4NCGA 4KV8A 4E89A 4KAZA 3LALA 3ZSYA 1W0HA 4OGEA 5FRMA 1SV5A 1NK9A 2DFEA 3HSTB 1ASUA 1L3TA 2KFNA 4RW9A 3AA4A 1FK9A 3L2UA 3DOKA 3SV3A 4CFDA 4FYDA 1HMVA 5HBMA 1D9FA 4DS4A 4FJNA 4IG0A 3SNNA 3BGRA 3V81A 2OZMA 2AJQA 2D5RA 4FJIA 1X1PA 4XIUA 4FM0A 1NJXA 3WNFA 4N56A 2HHTA 2Y1IA 4CGHA 1QE1A 3L3VA 1J53A 3AO1A 3DRRA 3M8PA 1LAVA 4DTNA 1ASWA 1YTAA 1U4BA 1IKXA 2OZSA 1RBVA 4HCBA 3DYAA 3S9HA 1ZBFA 3AA3A 4HTUA 2EHGA 4RW6A 4IDKA 3HK2A 4LSLA 4M3UA 1JLEA 1TKDA 4Z0UA 4DFJA 3HVRA 4AILC 2OA8A 2XO7A 3RR7A 5SWMA 4OKEA 4FVMA 4DU3A 3TI0A 4IKFA 5FRNA 1RTDA 3P5JA 1YTUA 2KZMA 4CHNA 2DFHA 4H4MA 1TAUA 4R5PA 4JLHA 3AO3A 1BISA 4N5SA 1VRTA 3HPGA 5KRTA 3VQ8A 3SUPA 3QEWA 1W9HA 5I3UA 1WSIA 1EETA 4LH5A 4HUGA 1CLQA 4AHUA 3AO4A 3VQ4A 3QEXA 1S1UA 1TAQA 4CF9A 5T7BA 1B9DA 3MAQA 4K8ZA 2WOMA 1C1CA 3LPUA 3OYLA 2QKBA 3AVJA 4DG1A 1LW2A 4F3TA 1SKSA 3F9KA 4KI6A 1RT6A 3HYFA 3ZSZA 1L3UA 2BDPA 2HVIA 4ZHRA 2HNYA 4E7IA 1RT4A 3KLIA 1HQEA 4LH4A 4B8CA 1EXQA 3LP2A 4W5OA 2HHUA 3AVNA 4C8NA 3SJJA 2OYQA 4FLXA 1WSJA 4CF2A 4CESA 1HYZA 4BACA 5HP1A 1KVBA 4CJPA 1C0UA 4IFVA 1TKXA 4C8OA 3TAPA 4E3SA 4CF8A 3ZSRA 3P1GA 3NGZA 1HNVA 4Z4IA 4B9MA 2GV9A 4FZYA 1TVRA 4KREA 4ZTJA 4M3ZA 1RBSA 4E7KA 2BGGA 1NK4A 3QEPA 4KHNA 4AHCA 2G8HA 5CY4A 2B5JA 1UOCA 3QEIA 4J2AA 1WSFA 4E7HA 4KRFA 4FCYA 4J2EA 5J2PA 4W5QA 4DTPA 4N76A 2A1RA 2HHQA 4RW8A 4KFBA 1QSLA 3PO4A 3LAMA 4B9NA 3IRXA 4FLWA 3V1OA 3RMBA 1QSYA 1ZYQA 2OPSA 1SUQA 1X9SA 2X6NA 1HRHA 1RNHA 3AVMA 1QHTA 1SL1A 1VSLA 1LAWA 3SZ2A 1X9WA 1VSKA 4DLEA 4IG3A 1C1BA 3DRPA 3HO1A 4BDYA 4Z4EA 5J2QA 2RPIA 3K2PA 3OYMA 4TSXA 4FJ5A 4I2QA 1NOZA 3AVHA 4CJLA 3QESA 4OJRA 3HPHA 3MXJA 2Y1JA 3HM9A 5D3GA 4KTZA 3DM2A 1Q9YA 4CJWA 4CK3A 4Q5VA 4M3RA 3CQ8A 4DSFA 4AHVA 1IH7A 4RW4A 4AHSA 1VSDA 4CJ3A 2JGUA 4DMNA 3V9XA 1N6QA 1WNSA 2GUIA 3AVLA 3OYKA 3NE6A 4FLUA 1G15A 3WNHA 4DSEA 3QINA 3VA0A 1KLMA 5K14A 3OYNA 3VQCA 4DU1A 4CERA 3NH2A 1C1AA 2XHBA 4CK2A 1ZBIA 1D5AA 2GBZA 3KLGA 1RT1A 1TK0A 4EP5A 3TANA 4B9TA 3MEEA 4GW6A 3TAQA 5J1EA 1BQNA 3A2FA 3ITHA 4BWMA 1NK5A 4DSIA 4CJVA 1TL3A 2YHBA 4DFKA 1ZBUA 4CEFA 2G8KA 3OYCA 3LWMA 1ITGA 1JXBA 3ALYA 1XWLA 4F2SA 3JSMA 3HJFA 1N5YA 4GMJB 4B9VA 4PQUA 3THVA 5HRSA 4FLZA 1RT3A 3T3FA 3OYEA 3PO5A 3VQ5A 5J2NA 3TARA 4DTRA 1GOCA 1NK6A 3AA2A 4CJQA 3MXIA 4FK4A 3L8BA 1SL2A 3OYJA 1SKWA 2P1JA 5C24A 4E19A 2VG7A 1RDBA 2I5JA 3NF6A 3TABA 1RTHA 4FJ8A 1NKCA 2YKMA 3RTVA 4DTMA 4FJMA 4CF1A 4CEQA 1BI4A 4YFUA 2G8UA 3HP9A 4M3YA 1CZ9A 4O55A 2YKNA 3KK1A 5HLFA 4M3WA 5KGXA 1UA1A 4FJXA 1WLJA 1RBTA 3OJSA 5I42A 2PYJA 1Y97A 2YNFA 3AVAA 1HPZA 2Z1IA 2OPQA 3T1AA 3G10A 3OJUA 3U3YA 3RR8A 1VSJA 3LAKA 3SQ2A 1JLAA 4DFPA 3PX0A 2IS3A 3DI6A 1C0MA 3RMAA 3SPZA 3S3OA 4FK0A 3LP3A 1A5WA 4E7LA 3QLHA 4CE9A 4BDZA 4CHOA 4FZXC 1NK7A 5KI6A 3D0PA 1KSPA 1UAXA 1UWBA 4CJTA 4CIEA 3LP0A 3OYIA 3O3HA 1WN7A 2WONA 4KHSA 3K57A 3OYFA 1RDAA 4CEBA 4Q0BA 4OKJA 3TWHA 3U6FA 3LZIA 1GOBA 3VQDA 3ZCMA 4CFAA 3SUQA 3KD5E 4GVMA 4CJKA 4CEZA 3K5MA 2VG5A 2VWKA 1JL2A 2RN2A 4DLGA 3O3FA 4FJJA 3B6OA 2YHAA 3WNGA 3AVGA 3AVCA 1S9EA 3NHGA 4B08A 3PX6A 1DLOA 4M3TA 4IBNA 1QS4A 4CIGA 1IKWA 4B9UA 3NFAA 1HNIA 3IG1A 1TK8A 1JKHA 3NH0A 1LWEA 4OLAA 4E7JA 4OVLA 3M8QA 1U47A 4KHWA 1QQCA 2FBVA 4QAGA 4H8KA 3PUFA 3RMCA 1NK0A 1L3VA 3CFRA 4DTSA 4AHTA 3ZT2A 3PX4A 4OLBA 3KD1E 2YNIA 4CHPA 1TV6A 1ASVA 3O3GA 3V9ZA 1Z25A 2HHVA 3SQ1A 3BDPA 4Z4FA 1LWFA 2Z1HA 3L2WA 3CM5A 2VG6A 4I7FA 1U49A 4CK1A 4F3OA 4B8AB 2G8FA 4DF4A 3ZT0A 2G8WA 2XY5A 1XHXA 4DFMA 3ZSOA 3QETA 3QEVA 3V6DA 3FFIA 3ZT1A 1QTMA 1D9DA 5EU7A 1JLCA 2XY8A 1CXUA 3CG7A 3K5NA 1BCOA 3ZT4A 3VQ9A 4LSNA 3QERA 3KJVA 3DLEA 3D45A 4KO0A 2HB5A 4UQGA 1L5UA 2KZZA 3NGYA 4KKOA 3VN5A 4CFCA 2P51A 4C8LA 4JRQA 3C6TA 2HW3A 3CYMA 3VQPA 1EX4A 1S1WA 4BDPA 2E4LA 1VSMA 4Y1DA 4CJEA 3OYHA 3MXMA 1B92A 4ZTFA 2LSNA 4EZ6A 1IKYA 1FKOA 1HYVA 3VQEA 4PWDA 1RBUA 2KFZA 1BCMA 4AHRA 1KTQA 4CJ5A 4KB0A 1S1VA 1NJWA 4JS5A 4DWIA 1U45A 2F96A 4FW2A 1RT5A 4I2PA 3ZSXA 4DF8A 4KPYA 4E1NA 3HT3A 4FLYA 3NCIA 1BIUA 1Q8IA 4LD0A 3H08A 4MFBA 2R7YA 1U04A 1J5OA 2B4JA 5C42A 5CYMA 3ZSWA 3M8SA 1T8EA 4DQPA 1VSHA 4PA1A 4FJKA 4FM1A 3SQ0A 4DTXA 1Z26A 4DSKA 3VQ7A 4CIFA 4KHQA 3OVNA 4H4OA 4CGFA 4OPJA 1I3AA 2X78A 3AVBA 4DTJA 3O4NA 5FROA 3QNOA 1XC9A 1HQUA 2O4GA 3RMDA 4F8RA 4CHQA 3HL8A 1BGXT 3NF9A 3OS1A 1S1XA 1RBRA 2PY5A 4N47A 1RILA 3DOLA 1S1TA 4E0DA 3ZSQA 1JLGA 3HP6A 4PY5A 5JS1A 4ELTA 2D0BA 4CGIA 3HXMA 4M42A 3DLKA 3TAEA 2IOCA 3EYZA 4FM2A 4DQSA 2HHSA 4O4GA 1WSGA 1S6PA 4FZZA 3K59A 2RKIA 3S3MA 4B3OA 2KW4A 2ETJA 3MEDA 2D0CA 3F73A 1NJZA 2A1SA 1JLQA 3KK2A 4BE2A 3UIQA 4ID5A 1XI1A 3P83D 4DU4A 3DLHA 2ZE2A 5SZTA 1RDDA 1VSEA 1B9FA 4B9LA 3MEGA 4B9SA 3NAEA 1TGOA 1A5XA 1DTQA 1KCFA 3T19A 3V1QA 3PV8A 3L2RA 1A5VA 4CF0A 4NYNA 4M3XA 3VA3A 2Q3SA 4CJRA 4FJGA 2HNZA 3K5LA 1D8YA 2E6MA 3TR8A 4EP4A 2QK9A 2HHXA 2F8TA 1O1WA 1BL3A 4CJUA 1C6VA 1S9GA 2IDOA 3C95A 4JRPA 3IAYA 4KTWA 1ZBHA 1VSIA 1BIZA 1KFSA 4E1MA 1WSEA 4DQIA 2VWJA 4FLTA 5FDLA 5J2MA 4CJSA 2YV0X 3KKRA 5HRRA 3OS0A 3OYAA 3HVTA 4NCAA 1BI4B 3NF8A 3QO9A 3VQQA 4BWJA 3AV9A 1LV5A 4J2DA 3RRHA 3QIOA 5DMRA 1SL0A 2KQ2A 3S3NA 2Z1JA 5HROA 3KLHA 5HRNA 2DFFA 2FC0A 4C8MA 4HCCA 3L2QA 1JLBA 4CECA 2QKKA 4QCLA 3JYTA 4FJLA 3AO2A 1RTJA 3M8RA 1KLNA 4KI4A 2ZD1A 3NBPA 4CGJA 1KVAA 1XHZA 3SQ4A 2JLEA 3KIOA 3VQ6A 4CJ4A 3RRGA 1YT3A 1S5JA 1ZBLA 3LANA 1RT7A 3V9WA 1CZBA 4RG8A 1FXXA 1GOAA 1U48A 1VK0A 4WE1A 3ASMA 3ZSVA 3B6PA 2ZQBA 4F4KA 2DTUA 4C8KA 1F21A 4O44A 4O0JA 3DLRA 3KTQA 2D0AA 3DLBA 5KRSA 1IO2A 4ID1A 3IS9A 4OPKA 1VSFA 2P5OA 3CFOA 3LZJA 3DMJA 3OYGA 4CHYA 5KGWA 4DSJA 4CEAA 1KVCA 4HUEA 5CZ1A 3LWLA 1SKRA 5JS2A 1NKEA 4CHZA 3AVIA 3DRSA 5DK5A 1HJRA 3I8DA 1NKBA 2E6LA 3VQBA 3NH1A 2KTQA 4ELUA 4L8RB 2OPRA 1HYSA 3SUNA 3DLGA 1T05A 4FJ9A 4W5NA 2PYLA 2HHWA 1JL1A 4W5RA 2QXFA 3HPOA 4HUFA 2G8IA 2B6AA 4M41A 1EKEA 2BANA 3NGIA 3LPTA 2X74A 1KFDA 2OPPA 1LW0A 4CFBA 3L3UA 3AA5X 3KK3A 3O4QA 1TKZA 4CEDA 2X6SA 3C6UA 4CJFA 1I39A 4O0IA 1L3SA 5CYQA 2XY7A 3V9SA 3SUOA 4FXDA 3VQAA 4FLVA 2P5GA 4DSLA 4IFYA 3QIPA 4G1QA 3LP1A 3NF7A 3QNNA 4BE0A 2ITGA 1LWCA 1FKPA 1TKTA 4HVJA 1IG9A 1NOYA 4NCBA 4NYFA 3SPYA 4KTQA 1RDCA 3V9UA 4EZ9A 4J2BA 1C0TA 3PY8A 1TL1A 3U3GA 2XY6A 2IGIA 4FK2A 1R0AA 1T03A 4CGDA 1REVA 1K6YA 3K58A 4M45A 1VRUA 3MECA 3KLEA 3LDSA 3L2VA 3AVKA 1RTIA
chains in the Genus database with same CATH superfamily
4AM6A 3OYDA 4J8FA 1RCHA 4OKKA 2EX3A 3E01A 4Y1CA 1NJIO 1DTTA 4ICLA 3SV4A 4GKJK 1JXEA 3E66A 3I0SA 2PZSA 3OBWA 5AFUH 4YOVA 4FW1A 4I9LA 4XH5A 1X3MA 4GV6A 5AQFA 3G6EN 5AQIA 4QOZB 2QWNA 4KHUA 1MU2A 4A62A 3VEVA 1GLJO 4FOEA 4K8XA 4Y0WA 3SBGA 4OGCA 4BRGA 4CBWA 5HRPA 3I55N 1EP4A 1IJJA 5GIPA 3SI6A 4JS4A 2ZWHA 4JAXA 3RSEB 3F9MA 4OPAA 2G8VA 3AARA 3AO5A 3MN5A 1IBMK 4KHPK 5AQHA 4NCGA 1K9MO 3AAQA 4OGEA 2A5XA 2UXBK 2DFEA 3TTDA 3HSTB 4JHDB 5M1KA 1FK9A 1XC3A 3DOKA 1HMVA 4DR2K 3CCLN 5IWAK 4FJNA 4AQYK 4H0YB 3BGRA 2OZMA 4YOUA 1X1PA 5AZIB 5BR8K 2QA4N 4JI5K 4CGHA 2CGLA 3A0IX 3EE8A 3WEEB 4DV3K 4X62K 2OZSA 3GE1A 4BREA 1H1VA 1OKJA 1MA9B 3AA3A 4HTUA 2EHGA 4M3UA 4Z0UA 3RR7A 5SWMA 4OKEA 4FVMA 4H4MA 1TAUA 4R5PA 4DV4K 3AO3A 2NRXA 1BO5O 1NU0A 1W9HA 5AQTA 4BGBA 3VGKA 4B3TK 4YOWA 4HUGA 1MDUB 1CLQA 3I33A 3VQ4A 1VQ5N 1B9DA 3MAQA 4K8ZA 2QKBA 3AVJA 4DG1A 2HVIA 2P9UB 3I8BA 2H3GX 4FWMA 2HNYA 3LP2A 4WYBA 4IJAA 3SJJA 4FLXA 1WSJA 1WOQA 4BACA 1ATSA 5HP1A 1KVBA 4CJPA 1FW6A 3TAPA 3JAMO 5MLCQ 2GV9A 1TVRA 1RBSA 2JWLA 4E7KA 4AHCA 2G8HA 1UOCA 3QEIA 2HMPA 3HRGA 4J2EA 4W5QA 4N76A 2A1RA 2HHQA 3KVGA 5KPRA 4FLWA 1QSYA 5FPDA 2OPSA 1X9SA 1RNHA 3AVMA 1X9WA 3SZ2A 1VSKA 3M3ZA 4GVEA 1C1BA 4Z94A 2WUSA 5J2QA 1NM1A 5CE3A 2YJFA 1QQMA 4CJLA 2Q2RA 4NXNK 4KTZA 3DM2A 1S3XA 4M3RA 5C10A 1YITN 3H46O 4DMNA 1K8KB 2GUIA 4M7YA 3OYKA 1G15A 3FLCO 3O80A 3QINA 4FVUA 3VA0A 2D0PA 1N33K 4A59A 1IBLK 3VQCA 4DU1A 3NH2A 1C1AA 3BF1A 2XHBA 4DV0K 1RT1A 4EP5A 3TAQA 5H1SQ 3DJCA 1BQNA 3A2FA 1NK5A 4CJVA 5JMVA 1ZBSA 3RVCA 1SZ2A 3ALYA 1JXBA 3ATVA 4GMJB 4CD1A 3T3FA 4BG9A 3VQ5A 5J2NA 3TARA 2UU9K 4KH4A 1VQNN 3CI5A 5JLFA 4CZJA 2P9PA 3L8BA 3OYJA 1SKWA 5C24A 2VG7A 2ZF5O 3TABA 2BTFA 1NG9A 1RTHA 4FJ8A 2IVOA 1NKCA 3VEXA 3CMAN 4CEQA 3ZETB 4YFUA 2G8UA 2WC9A 4I6MA 2O8DB 1YXQA 2I7NA 4O55A 5KGXA 3CCSN 2VGNA 4B1YB 2YNFA 3T1AA 4JI4K 3G10A 1WBDA 2P9SB 3U3YA 3LAKA 2QXLA 2IS3A 1C0MA 3RMAA 2P9NA 2J4RA 3EZWA 4CE9A 4BDZA 3DWLA 3OBYA 4BRAA 1KSPA 3THYB 4JKHA 3U8XA 2WONA 2KFNA 4CEBA 3U6FA 3VQDA 3K5MA 2VG5A 2VWKA 1DGKN 3THWB 5AQKA 3OA9A 5DM6L 3EE9A 5EVZA 1TK8A 1JKHA 2HBJA 4B9QA 4EAHD 4E7JA 4OVLA 2FBVA 3RMCA 1NK0A 3PUFA 4MDBA 4IEEA 4DTSA 4DR3K 1E3MA 3PX4A 3CC2N 2QM1A 3MCPA 2YNIA 2P9IA 3VF6A 5AQWA 3ZX0A 1GLEG 3T69A 2VG6A 4F3OA 1XQSC 2G8WA 4DFMA 3ZT1A 5M1QA 1CXUA 3K5NA 1BCOA 4JD2B 3DLEA 3G71N 4KO0A 1L5UA 5AZJA 2P51A 3C6TA 1EX4A 1N32K 3OYHA 1KD1O 4ZTFA 1VQ6N 5TKYA 4FWLA 3VQEA 4FL9A 1W97L 1RBUA 4PWDA 3HOSA 2KFZA 1KTQA 4KB0A 4QS7A 1NJWA 1RT5A 4KPYA 4FLYA 2P9KB 3H08A 4FOIA 2R7YA 1J5OA 4DQPA 2A6AA 1T8EA 3ZSWA 4FJKA 4DSKA 3VQ7A 4BR0A 4H4OA 3WQUA 4CGFA 3O4NA 3RMDA 2O4GA 4BVOA 4CHQA 3HL8A 3DXMB 1YIJN 3CC4N 1S1XA 4BR2A 4N47A 2PBDA 4C1NK 4X66K 3DOLA 4DR6K 5AQRA 2UUAK 3KK7A 1HNZK 2IOCA 1HKBA 2AA4A 3VOVA 2ETJA 4R79A 2QWPA 1JLQA 3O4WA 1XI1A 4XEIA 4DU4A 3DLHA 2NRVA 1GLCG 1U6ZA 3C6AA 3P31A 3I56N 1TGOA 3T19A 1T3VA 1A5VA 4NYNA 3H6EA 3VA3A 2HNZA 3K5LA 1D8YA 3TR8A 5TKWA 1T6CA 1BL3A 4BRLA 1OH8A 2VYPA 4JRPA 4KTWA 5LJWA 1BIZA 3SK3A 1KFSA 4E1MA 4BR4A 5FDLA 4CJSA 3VGLA 3SMSA 1VQKN 1BI4B 3ENOA 3NF8A 3R8EA 4DB3A 4JI8K 3U4LA 3RRHA 5DMRA 2KQ2A 3KLHA 4GKKK 2FC0A 1JLBA 2QKKA 2QWQA 3M8RA 1RTJA 1KLNA 5E26A 3CCEN 3WT0A 5HL7L 3KIOA 3Q7BA 3G25A 4CJ4A 4JKGB 1IG8A 4K25A 3R9PA 4WE1A 4YY3K 3ZSVA 4BVPA 2P9LB 3UKRA 3LDOA 3DLBA 5KRSA 4ID1A 2P5OA 4CHYA 5KGWA 4DSJA 4CEAA 1SKRA 4HUEA 5AQNA 4K41A 5DK5A 3ZEUA 3I8DA 2KTQA 2E6LA 3VQBA 2OPRA 3DLGA 4A5AA 4W5NA 3P38A 4HUFA 1S22A 2B6AA 4JKDA 1D4XA 1KFDA 3ZX3A 3GOIA 4EFHA 2W40A 3L3UA 1TYQA 3C6UA 1ATNA 4FXDA 2P5GA 4FLVA 1BG3A 1SQKA 2YI1A 1FKPA 4NCBA 4BROA 4J2BA 3L4IA 4JI3K 4BC2A 3L0QA 3U3GA 2XY6A 2IGIA 4E1JA 1REVA 3IDHA 4YDUA 2F7TA 3VEOA 1IO2A 2YJEA 3AVFA 1J54A 1U2VB 4RW7A 3L4QA 2DY4A 5C25A 2O4IA 2E2NA 4F2RA 5M1NA 4DUZK 2YNGA 1JLFA 4MQ3A 4ELVA 2NNWA 4Z4GA 2GEMA 5GADP 3KLFA 1J9AA 2NRZA 1T7PA 4FJHA 2W42A 2HBMA 1WSHA 3RWUA 1QZ6A 3CPEA 2XRIA 4KHYA 2ASMA 3A8YA 1UA0A 4Z4HA 2F8SA 1HNXK 4LC9B 3CCRN 1NGCA 5FLXO 5GINA 3G0ZA 1QSSA 3NDKA 3CHWA 4CEOA 3SYZA 2YHYA 3J7ZO 3EY1A 3CPWM 3V1RA 3EN9A 1QHAA 3V4IA 5AJ3K 3CQXA 2NUBA 3TSQA 5AFUA 4DTUA 2HNDA 1FJGK 3MX2A 1NGDA 4FJ7A 1S6QA 2F9WA 2IAJA 3OTOK 4PUOA 4DQQA 4KAZA 5FRMA 3LALA 3ZSYA 1SV5A 1NK9A 4O8KA 1OH7A 1L3TA 4RW9A 4CFDA 4FYDA 1D9FA 3CXCM 1N36K 5ELZA 5C0YA 4IG0A 3MWPA 3SNNA 3CD6N 3V81A 4XIUA 4FM0A 4IOXA 1NGEA 1QE1A 3L3VA 1J53A 3AO1A 4H5NA 1YTAA 2RHKA 3TTCA 3MDQA 4BC4A 3DYAA 1ZBFA 3K9JA 2CH5A 4RW6A 4IDKA 4LSLA 2O8BA 3HVRA 2XO7A 3TI0A 5EX5A 1RTDA 2DFHA 3TPQA 1BUPA 1RDWX 4LFBK 1O13A 1BISA 4N5SA 3QEWA 1BOTO 1LCUA 2FSJA 4A5BA 3K9KA 3TTFA 4IDHA 4DCHA 3SJHA 1M1KO 1LW2A 4F3TA 4H0VB 1SKSA 3LM2A 1HQEA 2D1KA 4H03B 4W5OA 2HHUA 1HJOA 3SAHA 1C0UA 2OTLN 4EHTA 3O08A 4CF8A 4Z4IA 4FZYA 3MK6A 3O9TA 4YOTA 4ZTJA 4M3ZA 2BGGA 1X3NA 4KHNA 4KRFA 4J2AA 4E7HA 4FCYA 3EKSA 4U7BA 4C1NI 4KFBA 2Q97A 2O8EB 3C7NA 4FSVA 3RMBA 1SUQA 1QHTA 1SL1A 3T7ZA 3CETA 5CHIA 4BDYA 4Z4EA 2RPIA 1DEJA 4FJ5A 4TSXA 3QB0A 1NOZA 3AVHA 1YJ9N 1HPMA 3HPHA 2Y1JA 1KAYA 2GWKA 2HSTA 1Q9YA 4DSFA 2BUPA 4AHVA 1IH7A 4AHSA 5AQOA 4JI2K 2JGUA 3V9XA 4JKBA 1N6QA 3AVLA 3FE1A 3OYNA 4CK2A 3BY5A 2HHHK 3KLGA 1TK0A 3VERA 4BWMA 1TL3A 2YHBA 2Q0UA 1ZBUA 4CEFA 4X65K 4CBUA 1ITGA 3H45C 4F2SA 3HJFA 3JSMA 1N5YA 3BUZB 2YHXA 5HRSA 4FLZA 4JNEA 3CJAA 3OYEA 1HKGA 1GOCA 1P8ZA 5FPEA 3R6MA 3AA2A 4CJQA 3MXIA 4H5RA 2P1JA 4E19A 4BRDA 2FSKA 4FJMA 5C12A 4LFAK 3HP9A 2YKNA 5HLFA 4M3WA 1WLJA 1HNWK 3IFRA 5I42A 1QVGM 3AVAA 4DR4K 3OJUA 2P9PB 1JLAA 3H1VX 2ZM6K 3PX0A 3SPZA 4E7LA 3C6HA 3SBTA 3JXUA 1NK7A 4I6MB 3Q7CA 1UAXA 1C0GA 5AQXA 4CIEA 3CJ9A 1WN7A 3K57A 3TWHA 2ASOA 4GVMA 3OHRA 2YX6A 4CEZA 2RN2A 2YHAA 3WNGA 3AVGA 1JCFA 3PX6A 1VQMN 2E5LK 1IKWA 2P9NB 4LF4K 4LF8K 3IG1A 4B3SK 4KHWA 1L3VA 5I9EB 4FWQA 1NGIA 4YORA 3ZT2A 4BR9A 1TV6A 1ASVA 3V9ZA 3T1HK 3SQ1A 3BDPA 3VTIA 3L2WA 1U49A 4UY8O 4B8AB 4QS8A 2G8FA 3UKUB 4DF4A 4IFEA 1D9DA 1QTMA 5EU7A 2XY8A 4IOAL 3ZT4A 3VQ9A 3KJVA 2HB5A 2E1YA 2P9IB 4CFCA 2HW3A 3FZKA 4EZ6A 3LDNA 3A5OC 1BCMA 1HKCA 1V4TA 4JI1K 4FW2A 1RDUA 4DF8A 1Q8IA 3LM9A 1U04A 3SLCA 1IV0A 5C42A 3M8SA 4F9OA 1N8RO 5AZJB 3SQ0A 1J5EK 4CIFA 4KHQA 3OVNA 2OANA 1I3AA 2X78A 3AVBA 3VPZA 5BRFA 4FPBA 1YUWA 4F8RA 4JI0K 3EO3A 3OS1A 2PY5A 3IKMA 4IJNA 3HP6A 4CZMA 4M42A 1HLUA 5BREA 3AGKA 2RKIA 4B3OA 3QFUA 2KHOA 1R59O 2D0CA 4CZKA 2A1SA 3P83D 2ZE2A 1VSEA 1B9FA 5BRDA 3QDKA 3LL3A 3PV8A 1A5XA 1DTQA 1KCFA 2A42A 3V1QA 2O8CA 4BRKA 4M3XA 4FWNA 2QK9A 2HHXA 4CZLA 4K43A 1WSEA 4DQIA 2VWJA 4RTFD 3BZKA 4AF1A 4NB4A 3KKRA 5HRRA 3HVTA 4ILGB 4NCAA 3QO9A 2OTJN 3J7AP 4AM7A 3S3NA 2Z1JA 5HROA 4C8MA 2QWLA 3L2QA 3MN9A 5F0XA 5EOYA 4H0XB 4FWPA 3VQ6A 5AQQA 1ZBLA 3D2EA 3LANA 4DKWA 3THXA 1CZBA 1FXXA 2QWOA 3WUHA 1U48A 3DXKA 4F4KA 3B6PA 4C8KA 2W6LA 4LF9K 4DQ8A 4JN4A 3CFOA 3LZJA 3OYGA 2RE2A 1KVCA 5JS2A 2IVPA 4HWIA 3AVIA 3DRSA 1WBBA 4ELUA 4L8RB 1HYSA 3SUNA 1T05A 4W5RA 1QVFM 4M41A 3NGIA 2X74A 3UKRB 5BPMA 3ZX2A 2OPPA 3KK3A 3O4QA 2X6SA 4O0IA 3J81O 5CYQA 3GBTA 3VQAA 4IFYA 1XMQK 3CJBA 3NF7A 3ZEUB 1MWMA 1TKTA 1IG9A 1NOYA 1EQYA 4FWKA 4NYFA 1RDCA 1C0TA 3J8AA 4ISGA 4FK2A 1T03A 4CJ7A 3LDSA 1NK4A 2IVNA 3O9SA 1NGHA 1TYQB 4H0PA 4DQRA 1TK5A 4YNQA 4AH9A 4BQZA 3H3OB 1KRPA 1CXQA 4N41A 3ENHA 2Z1GA 4WQ4A 3ULEA 1Q9XA 1NGBA 4O5BA 3IUCA 4JEPA 3ULDA 2A41A 3I0RA 4WFNL 5E41A 4IOCL 4CCHA 1WAJA 4ILHA 3OS2A 5CZ2A 3EZ5A 4HHTA 4JKAA 4BC3A 3OY9A 1GLLO 5ADXH 1YVUA 1RT2A 3TAGA 4LY7A 4DV1K 1I94K 3FZHA 2FBYA 1QQNA 3OYBA 1BQMA 2IIRA 3PSFA 4BE1A 2FBTA 1BHLA 3WNEA 1TUYA 4DS5A 4ISFA 5FPNA 2V51B 1Y64A 2UXDK 1ASUA 3M6GA 2FXUA 3AA4A 3L2UA 5HBMA 4NO7A 5AR0A 4H5VA 4DR5K 2BH1A 4N56A 2HHTA 3FFKB 2Y1IA 4ISEA 3QBXA 3W3DA 1LAVA 4DTNA 1U4BA 3NVMA 1IKXA 3TSUA 2O8FA 3S9HA 5A2QO 4EIAA 5F2RA 3E9OA 3HTVA 1RFQA 1JLEA 4DFJA 2OA8A 1HX1A 3UE5A 4WF9L 4DU3A 4IKFA 3P5JA 1YTUA 4CHNA 3CC7N 4B1UB 4JK7A 1VRTA 2VGMA 5KRTA 3SUPA 4PL7A 1BWFO 5I3UA 1WSIA 4YDUC 1XUPO 4AHUA 1VQ7N 2O8BB 2WOMA 3OYLA 3D2FA 4KI6A 1RT6A 3HYFA 3ZSZA 3DAWA 2BDPA 5C15A 4ZHRA 1RT4A 3KLIA 4LH4A 4B8CA 1EXQA 3AVNA 2OYQA 3BF3A 1KC8O 4CESA 4BRMA 4PKHA 4IFVA 1TKXA 1NLVA 3A5MC 4E3SA 5GAEP 3ZSRA 3P1GA 2NLXA 4WQ5A 3NGZA 1OH5A 3JS6A 3BEXA 3QEPA 2B5JA 4OO1J 4CW7B 3MX5A 3L6QA 4DTPA 2EWSA 3PO4A 3IRXA 5GIOA 3HBTA 1VQ8N 3O8MA 2X6NA 4GV3A 1VSLA 1LAWA 4FWRA 2QWRA 4PKIA 4DLEA 3DRPA 3DXMA 3FZLA 4FWSA 3K2PA 2NRRA 3OYMA 4I2QA 1QQOA 3QESA 4OJRA 2VWBA 3HM9A 5D3GA 4CJWA 4CK3A 4CZIA 4RW4A 4RWTA 4CJ3A 3E9LA 4DV5K 3C7NB 3S41A 3NE6A 4FLUA 3N4PA 4DSEA 1ILYA 3W0LA 1KLMA 4O5FA 4JI6K 4CERA 1ZBIA 5AQVA 2GBZA 3TANA 4B9TA 3MEEA 4GW6A 3VF2A 3ITHA 4WFBL 4DFKA 3A5LC 3LWMA 4M7XA 3H1QA 4MLHA 1XWLA 3BP8A 4K42A 1K73O 3E9PA 4DTRA 1NK6A 4FK4A 1SL2A 1QZ5A 2VQFK 1RDBA 1YF5L 1SAZA 1W7AA 3F5TA 4CF1A 5BN9A 5EXWA 1BI4A 2I7PA 4BY9C 3OJSA 2Q1NA 1HPZA 3K0SA 2OCEA 3RR8A 1VSJA 1K8AO 5KQ8A 4DFPA 3SQ2A 2QI2A 3DI6A 4KBOA 4FK0A 3LP3A 5M1OA 2KLAA 3KHYA 3D0PA 2CH6A 1UWBA 4CJTA 4MLEA 3LP0A 3O3HA 4Q0BA 3OYFA 1RDAA 4OKJA 4CFAA 1W2BM 1SS6A 3U9ZA 3C65A 3O5BA 4FJJA 1VAZA 3B6OA 4H0OA 3NHGA 4B08A 1CZAN 1DLOA 4M3TA 2WTUA 4CIGA 4B9UA 1HNIA 4H5WA 3NH0A 4OLAA 3VMFB 1BA1A 3M5RA 2E8AA 3CQYA 4A57A 3CFRA 1HUXA 5AQSA 4FO0A 5FPMA 1GLBG 3VESA 4CHPA 4M63C 2UUCK 1Z25A 4Z4FA 3CCVN 1N34K 3TU5A 1LWFA 4OPHA 2Z1HA 1YVNA 3FGUA 5M1FA 3ZT0A 2XY5A 3QEVA 2NZTA 4LFCK 3O9UA 4LSNA 3QERA 4UQGA 2KZZA 3HZ6A 4KKOA 4JRQA 3VEWA 3CYMA 3VQPA 5IT9O 4BDPA 2E4LA 4WCEL 4FPAA 3MXMA 1B92A 1FKOA 1HYVA 2E2QA 4AHRA 3EL2A 4CJ5A 1S1VA 4DWIA 1U45A 2F96A 3ZSXA 3KZBA 3HT3A 5JVGL 1BIUA 1E4FT 4MFBA 3CF5L 5KPZA 2UXCK 1VSHA 4PA1A 4DTXA 1Z26A 3G4SN 5C2DA 3HOTA 3O6WA 2D4WA 4OPJA 4CZHA 3DLLL 4DTJA 4LF7K 5FROA 3QNOA 1HQUA 1BGXT 3NF9A 5DM7L 1RILA 1S1TA 5F1XA 4PY5A 5JS1A 2D0BA 4JYAK 3DLKA 4H0TB 3TAEA 4FM2A 4O4GA 4JK9A 1S6PA 1DKGD 1GLAG 3K59A 1VQ9N 4CI6A 1BU6O 3MEDA 1NJZA 4BRIA 4ID5A 1YAGA 3NVKA 4LF6K 5SZTA 1VQON 1RDDA 4BC5A 3QMLA 4B9LA 2ZJQL 4BQLA 3VTHA 3MEGA 2ZGZA 4B9SA 4XH4A 1VQLN 4KH5A 3NAEA 3O1WA 1Z05A 4CF0A 4LF5K 2Q3SA 4CJRA 4BGAA 4DV6K 2E6MA 2F8TA 2ZGYA 1S9GA 3C95A 1GLFO 5LJVA 4FLTA 5J2MA 2YV0X 3OYAA 2O8CB 3LDQA 4MO4A 3VQQA 4QS9A 4BWJA 4J2DA 3QIOA 2UUBK 3GG4A 4HCCA 4CECA 4QCLA 3JYTA 4FJLA 3AO2A 4KI4A 2ZD1A 3NBPA 1KVAA 2JLEA 3RRGA 1S5JA 4NXMK 1TUUA 1RT7A 3V9WA 1GOAA 4L3QA 4IEIA 4NLBA 1VK0A 2ZQBA 1HR0K 1F21A 4O44A 4O0JA 2D0AA 1EWRA 3N4QA 4B3RK 4OPKA 1VSFA 1VQ4N 1EO1A 3O1BA 5LMNK 5CZ1A 1NKEA 4CHZA 1HJRA 3D2EB 3THXB 4FJ9A 1JL1A 3HPOA 3DXKB 2G8IA 5GAHP 1EKEA 4C23A 3QBWA 4CZEA 3LPTA 2WFBA 4CFBA 1LW0A 2D0OA 5EY4A 1T44A 2AP1A 3AA5X 4GNIA 4CJFA 1L3SA 2NRHA 2WBNA 2O8EA 4DSLA 1LOTB 5B8HA 3QNNA 3LP1A 4HVJA 1WUAA 3SMPA 5BRHA 4EZ9A 4JK8A 2A3ZA 3SAGA 3O9RA 1OVQA 3TSPA 1TL1A 1NBWA 4KH6A 5C2FA 3WXKA 1K6YA 4M45A 1OVYA 3MECA 4YHHK 4PHTX 5HOOA 1RTIA 2W6KA 3AY9A 5AQZA 1NJYA 4CGGA 2FBXA 3SCXA 1X9JA 5LY3A 2PAVA 4DTOA 2NRWA 2QW9A 4CEEA 5E84A 1KAZA 3CM6A 2HVHA 4W5TA 1WAFA 3QFPA 2RF2A 3RSEA 3TAFA 3ZT3A 3PSIA 3CFPA 4KB1A 5KTQA 4RCHA 2KKZA 2ATQA 4CD3A 4DHYA 2HMIA 3E1YA 3AGRA 4JHDA 3VGMA 4I9QA 3ULEB 4Z4CA 1VQPN 2BE2A 3ISNC 1IKVA 3TAMA 1X9MA 2IC3A 5AZIA 2YNHA 1XNRK 3KKSA 1YJWN 3K5OA 3C94A 3H3NO 5LL6Z 1NK8A 1JCGA 5AQMA 4KV8A 4BR5A 3WEEA 4E89A 1W0HA 3FZMA 2HF4A 3CCUN 2FF3B 3ZYYX 5ADXA 3SV3A 3R1XA 1Q82O 4DS4A 5AQGA 2CGJA 1JCEA 4A2BA 5AQLA 2AJQA 2D5RA 4FJIA 1NGFA 1NJXA 3WNFA 4BRFA 3DRRA 4CZFA 3M8PA 3PIPL 1ASWA 1RBVA 4HCBA 5BPLA 4V19S 3WQTA 3D6RA 4BRQA 3HK2A 1XNQK 1TKDA 3VF4A 4AILC 1DT9A 1YHQN 3SAFA 5FRNA 2P9UA 3CJ7A 2V7ZA 2KZMA 1ZXOA 4BRNA 4JLHA 4YOXA 1NGAA 1RGIA 3HPGA 5KQDA 3VQ8A 2O8FB 1EETA 1Z6RA 2HOEA 4LH5A 3AO4A 3QEXA 1XMOK 1S1UA 1TAQA 4CF9A 5T7BA 4XH1A 1ESVA 1C1CA 3LPUA 1NGJA 5AQUA 3FR0A 3UKUA 3F9KA 2DPNA 3CCJN 1L3UA 1BDGA 4E7IA 2QTDA 4C8NA 4WQ4C 1GLDG 4CF2A 1HYZA 2PFUA 4B3MK 2FLOA 3C0BA 2CGKA 3CCMN 4C8OA 3WXIA 3HM8A 1HNVA 4B9MA 4KREA 1WB9A 3D2FB 5JICA 5CY4A 4BRCA 1WSFA 3R3LA 4DR1K 4YOYA 5J2PA 2E2PA 3ATUA 3WXLA 4RW8A 1QSLA 4B9NA 3LAMA 3V1OA 1K8KA 1ZYQA 1HRHA 1J6ZA 4IG3A 5JVHL 3HO1A 5AQYA 4PL8A 3MXJA 4Q5VA 2YCHA 3CJ1A 3CQ8A 1S72N 1VSDA 1Q81O 1WNSA 2FF6A 1JJ2M 3WNHA 1NNEA 1T6DA 5K14A 3VETA 3A5NC 1D5AA 4JKCA 1ZC6A 3J7YP 1EWQA 2W41A 5J1EA 1P90A 1NGGA 2E2OA 4DSIA 4OX9K 2G8KA 3ZETA 3OYCA 3ZLJA 3ENBA 2O8DA 3EKUA 4B9VA 4PQUA 3THVA 1RT3A 3U9DA 3B8AX 2ITMA 3PO5A 2P9SA 3MMVA 2GX9A 2I5JA 3NF6A 4U67L 4DUYK 1ATRA 2QEXN 4DV7K 2E88A 2YKMA 3RTVA 4DTMA 3CERA 4M3YA 1CZ9A 3THYA 2V52B 3KK1A 1UA1A 4FJXA 1RBTA 2PYJA 2ZJRL 1Y97A 4B1WB 2Z1IA 2OPQA 1NMNA 4CZGA 3BZCA 3THWA 1NWKA 3S3OA 1Q7YO 1A5WA 3WXJA 3EEQA 3QLHA 1V4SA 4CHOA 4FZXC 5KI6A 2GUPA 3OYIA 4WQ5C 4KHSA 2HHVA 3AAPA 3LZIA 1GOBA 5AQJA 3ZCMA 3SUQA 3KD5E 5BN8A 4CJKA 1NMDA 1JL2A 4DLGA 2HBKA 3O3FA 4ILJA 3AVCA 1S9EA 4IO9L 2ZJPL 3T1YK 4IBNA 4BG8A 4BRHA 1QS4A 1C0FA 3NFAA 4GV9A 3F2KA 2VQEK 1LWEA 3ID8A 1KXPA 3M8QA 4JKEA 1BA0A 1U47A 1QQCA 4H8KA 4QAGA 4AHTA 4JD2A 4OLBA 3KD1E 1YJNN 3O3GA 3O9QA 3P39A 4BRPA 4IWVA 4B1ZA 5AQPA 3CM5A 4I7FA 4CK1A 5BR9A 4PKGA 1XHXA 3ZSOA 3QETA 3MN6A 3V6DA 3FFIA 1MWKA 4BR7A 1JLCA 2P9KA 2A40A 3LDPA 3CG7A 3PIOL 3VENA 3FZFA 3IMXA 4IO8A 3D45A 3CJCA 3NGYA 3VN5A 4C8LA 3ID6A 1S1WA 4A61A 1VSMA 4Y1DA 4CJEA 2LSNA 1IKYA 3HSCA 4NLCA 4JS5A 4I2PA 2HBLA 2Q31A 3HI0A 4E1NA 4O8UA 2E20A 3NCIA 4LD0A 2NRTA 2B4JA 3CIPA 1Q18A 5CYMA 2FSNA 3NMUA 4FM1A 4FWOA 3PLAA 4JKFA 1XC9A 3QICA 4X64K 1RBRA 3LDLA 3P4IA 4E0DA 3ZSQA 1JLGA 4ELTA 4JV5K 4CGIA 3HXMA 1M90O 3EYZA 4DQSA 2HHSA 1G99A 1WSGA 1VHXA 4FZZA 3S3MA 2KW4A 3F73A 3KK2A 2UYTA 4BE2A 1OH6A 3UIQA 4G9ZA 2F9TA 2GELA 1KAXA 3MWTA 3UB5A 4B1XB 3L2RA 4K0KK 3CMEN 4FJGA 2ASPA 2GWJA 4EP4A 4JI7K 1Q86O 1O1WA 4CJUA 2V7YA 3KWGA 5LMUK 1C6VA 2IDOA 3IAYA 1ZBHA 1VSIA 3VEZA 2F4VK 1E4GT 5M1PA 5JLHA 1YI2N 4GY2B 3OS0A 4JKGA 3AV9A 1LV5A 3CCQN 2P9LA 1SL0A 4WFAL 4H5TA 5HRNA 2DFFA 1IBKK 4CGJA 5KPTA 1XHZA 3SQ4A 4IXCA 1YT3A 4RG8A 2GTDA 3ASMA 3OW2M 2Q0RA 2DTUA 3DLRA 3KWIA 3KTQA 4A2AA 3IS9A 3D7EO 5BPNA 3DMJA 4IZ9A 3LWLA 2VCPA 1NKBA 3NH1A 2PYLA 2HHWA 2QXFA 4B1VA 2BANA 4MO5A 4EHUA 3GDQA 1TKZA 4CEDA 1I39A 1KQSM 3MCAB 2XY7A 1U2VA 3M1FA 3V9SA 3GL1A 3SUOA 4CVNE 3MN7A 3QIPA 4DR7K 4G1QA 4BE0A 2ITGA 1LWCA 4HTLA 3WXMB 3SPYA 2HF3A 4KTQA 3V9UA 3PY8A 2Q36A 4CBXA 4MDAA 5GAGP 2YHWA 4CGDA 1R0AA 2QWMA 5CR4A 3K58A 3J80O 2E1ZA 4DV2K 1VRUA 3VEYA 3KLEA 3L2VA 2JWKA 3AVKA
chains in the Genus database with same CATH topology
3AVFA 1J54A 4RW7A 4DQRA 3OYDA 2DY4A 1TK5A 5C25A 4YNQA 1RCHA 4AH9A 4OKKA 2EX3A 1NJYA 4CGGA 3E01A 1KRPA 4F2RA 2O4IA 1CXQA 2FBXA 3SCXA 4N41A 4Y1CA 2YNGA 1JLFA 4MQ3A 4DTOA 4ELVA 4Z4GA 1DTTA 2Z1GA 4ICLA 3SV4A 3KLFA 1J9AA 1T7PA 1JXEA 1Q9XA 2W42A 4FJHA 3I0SA 4O5BA 4CEEA 2PZSA 4FW1A 4I9LA 3CM6A 2HVHA 1WSHA 3ULDA 3RWUA 4W5TA 1WAFA 2XRIA 3I0RA 4KHYA 2RF2A 3TAFA 5E41A 3ZT3A 1UA0A 4Z4HA 2F8SA 3CFPA 4KB1A 4CCHA 4QOZB 1WAJA 5KTQA 3OS2A 2ATQA 5CZ2A 4KHUA 3EZ5A 4HHTA 1MU2A 2HMIA 3G0ZA 1QSSA 4K8XA 3NDKA 3OY9A 4CEOA 3SYZA 1YVUA 1RT2A 3EY1A 4OGCA 3TAGA 4LY7A 4I9QA 5HRPA 4Z4CA 3V1RA 1EP4A 2BE2A 3ISNC 3V4IA 1IKVA 3SI6A 4JS4A 2NUBA 2FBYA 3OYBA 1BQMA 2HNDA 4BE1A 3TAMA 4DTUA 2FBTA 1X9MA 2IC3A 1S6QA 4FJ7A 1BHLA 3WNEA 2YNHA 4DS5A 2G8VA 2IAJA 3AO5A 3KKSA 3K5OA 3C94A 4PUOA 4DQQA 1NK8A 4NCGA 4KV8A 4E89A 4KAZA 3LALA 3ZSYA 1W0HA 4OGEA 5FRMA 1SV5A 1NK9A 2DFEA 3HSTB 1ASUA 1L3TA 2KFNA 4RW9A 3AA4A 1FK9A 3L2UA 3DOKA 3SV3A 4CFDA 4FYDA 1HMVA 5HBMA 1D9FA 4DS4A 4FJNA 4IG0A 3SNNA 3BGRA 3V81A 2OZMA 2AJQA 2D5RA 4FJIA 1X1PA 4XIUA 4FM0A 1NJXA 3WNFA 4N56A 2HHTA 2Y1IA 4CGHA 1QE1A 3L3VA 1J53A 3AO1A 3DRRA 3M8PA 1LAVA 4DTNA 1ASWA 1YTAA 1U4BA 1IKXA 2OZSA 1RBVA 4HCBA 3DYAA 3S9HA 1ZBFA 3AA3A 4HTUA 2EHGA 4RW6A 4IDKA 3HK2A 4LSLA 4M3UA 1JLEA 1TKDA 4Z0UA 4DFJA 3HVRA 4AILC 2OA8A 2XO7A 3RR7A 5SWMA 4OKEA 4FVMA 4DU3A 3TI0A 4IKFA 5FRNA 1RTDA 3P5JA 1YTUA 2KZMA 4CHNA 2DFHA 4H4MA 1TAUA 4R5PA 4JLHA 3AO3A 1BISA 4N5SA 1VRTA 3HPGA 5KRTA 3VQ8A 3SUPA 3QEWA 1W9HA 5I3UA 1WSIA 1EETA 4LH5A 4HUGA 1CLQA 4AHUA 3AO4A 3VQ4A 3QEXA 1S1UA 1TAQA 4CF9A 5T7BA 1B9DA 3MAQA 4K8ZA 2WOMA 1C1CA 3LPUA 3OYLA 2QKBA 3AVJA 4DG1A 1LW2A 4F3TA 1SKSA 3F9KA 4KI6A 1RT6A 3HYFA 3ZSZA 1L3UA 2BDPA 2HVIA 4ZHRA 2HNYA 4E7IA 1RT4A 3KLIA 1HQEA 4LH4A 4B8CA 1EXQA 3LP2A 4W5OA 2HHUA 3AVNA 4C8NA 3SJJA 2OYQA 4FLXA 1WSJA 4CF2A 4CESA 1HYZA 4BACA 5HP1A 1KVBA 4CJPA 1C0UA 4IFVA 1TKXA 4C8OA 3TAPA 4E3SA 4CF8A 3ZSRA 3P1GA 3NGZA 1HNVA 4Z4IA 4B9MA 2GV9A 4FZYA 1TVRA 4KREA 4ZTJA 4M3ZA 1RBSA 4E7KA 2BGGA 1NK4A 3QEPA 4KHNA 4AHCA 2G8HA 5CY4A 2B5JA 1UOCA 3QEIA 4J2AA 1WSFA 4E7HA 4KRFA 4FCYA 4J2EA 5J2PA 4W5QA 4DTPA 4N76A 2A1RA 2HHQA 4RW8A 4KFBA 1QSLA 3PO4A 3LAMA 4B9NA 3IRXA 4FLWA 3V1OA 3RMBA 1QSYA 1ZYQA 2OPSA 1SUQA 1X9SA 2X6NA 1HRHA 1RNHA 3AVMA 1QHTA 1SL1A 1VSLA 1LAWA 3SZ2A 1X9WA 1VSKA 4DLEA 4IG3A 1C1BA 3DRPA 3HO1A 4BDYA 4Z4EA 5J2QA 2RPIA 3K2PA 3OYMA 4TSXA 4FJ5A 4I2QA 1NOZA 3AVHA 4CJLA 3QESA 4OJRA 3HPHA 3MXJA 2Y1JA 3HM9A 5D3GA 4KTZA 3DM2A 1Q9YA 4CJWA 4CK3A 4Q5VA 4M3RA 3CQ8A 4DSFA 4AHVA 1IH7A 4RW4A 4AHSA 1VSDA 4CJ3A 2JGUA 4DMNA 3V9XA 1N6QA 1WNSA 2GUIA 3AVLA 3OYKA 3NE6A 4FLUA 1G15A 3WNHA 4DSEA 3QINA 3VA0A 1KLMA 5K14A 3OYNA 3VQCA 4DU1A 4CERA 3NH2A 1C1AA 2XHBA 4CK2A 1ZBIA 1D5AA 2GBZA 3KLGA 1RT1A 1TK0A 4EP5A 3TANA 4B9TA 3MEEA 4GW6A 3TAQA 5J1EA 1BQNA 3A2FA 3ITHA 4BWMA 1NK5A 4DSIA 4CJVA 1TL3A 2YHBA 4DFKA 1ZBUA 4CEFA 2G8KA 3OYCA 3LWMA 1ITGA 1JXBA 3ALYA 1XWLA 4F2SA 3JSMA 3HJFA 1N5YA 4GMJB 4B9VA 4PQUA 3THVA 5HRSA 4FLZA 1RT3A 3T3FA 3OYEA 3PO5A 3VQ5A 5J2NA 3TARA 4DTRA 1GOCA 1NK6A 3AA2A 4CJQA 3MXIA 4FK4A 3L8BA 1SL2A 3OYJA 1SKWA 2P1JA 5C24A 4E19A 2VG7A 1RDBA 2I5JA 3NF6A 3TABA 1RTHA 4FJ8A 1NKCA 2YKMA 3RTVA 4DTMA 4FJMA 4CF1A 4CEQA 1BI4A 4YFUA 2G8UA 3HP9A 4M3YA 1CZ9A 4O55A 2YKNA 3KK1A 5HLFA 4M3WA 5KGXA 1UA1A 4FJXA 1WLJA 1RBTA 3OJSA 5I42A 2PYJA 1Y97A 2YNFA 3AVAA 1HPZA 2Z1IA 2OPQA 3T1AA 3G10A 3OJUA 3U3YA 3RR8A 1VSJA 3LAKA 3SQ2A 1JLAA 4DFPA 3PX0A 2IS3A 3DI6A 1C0MA 3RMAA 3SPZA 3S3OA 4FK0A 3LP3A 1A5WA 4E7LA 3QLHA 4CE9A 4BDZA 4CHOA 4FZXC 1NK7A 5KI6A 3D0PA 1KSPA 1UAXA 1UWBA 4CJTA 4CIEA 3LP0A 3OYIA 3O3HA 1WN7A 2WONA 4KHSA 3K57A 3OYFA 1RDAA 4CEBA 4Q0BA 4OKJA 3TWHA 3U6FA 3LZIA 1GOBA 3VQDA 3ZCMA 4CFAA 3SUQA 3KD5E 4GVMA 4CJKA 4CEZA 3K5MA 2VG5A 2VWKA 1JL2A 2RN2A 4DLGA 3O3FA 4FJJA 3B6OA 2YHAA 3WNGA 3AVGA 3AVCA 1S9EA 3NHGA 4B08A 3PX6A 1DLOA 4M3TA 4IBNA 1QS4A 4CIGA 1IKWA 4B9UA 3NFAA 1HNIA 3IG1A 1TK8A 1JKHA 3NH0A 1LWEA 4OLAA 4E7JA 4OVLA 3M8QA 1U47A 4KHWA 1QQCA 2FBVA 4QAGA 4H8KA 3PUFA 3RMCA 1NK0A 1L3VA 3CFRA 4DTSA 4AHTA 3ZT2A 3PX4A 4OLBA 3KD1E 2YNIA 4CHPA 1TV6A 1ASVA 3O3GA 3V9ZA 1Z25A 2HHVA 3SQ1A 3BDPA 4Z4FA 1LWFA 2Z1HA 3L2WA 3CM5A 2VG6A 4I7FA 1U49A 4CK1A 4F3OA 4B8AB 2G8FA 4DF4A 3ZT0A 2G8WA 2XY5A 1XHXA 4DFMA 3ZSOA 3QETA 3QEVA 3V6DA 3FFIA 3ZT1A 1QTMA 1D9DA 5EU7A 1JLCA 2XY8A 1CXUA 3CG7A 3K5NA 1BCOA 3ZT4A 3VQ9A 4LSNA 3QERA 3KJVA 3DLEA 3D45A 4KO0A 2HB5A 4UQGA 1L5UA 2KZZA 3NGYA 4KKOA 3VN5A 4CFCA 2P51A 4C8LA 4JRQA 3C6TA 2HW3A 3CYMA 3VQPA 1EX4A 1S1WA 4BDPA 2E4LA 1VSMA 4Y1DA 4CJEA 3OYHA 3MXMA 1B92A 4ZTFA 2LSNA 4EZ6A 1IKYA 1FKOA 1HYVA 3VQEA 4PWDA 1RBUA 2KFZA 1BCMA 4AHRA 1KTQA 4CJ5A 4KB0A 1S1VA 1NJWA 4JS5A 4DWIA 1U45A 2F96A 4FW2A 1RT5A 4I2PA 3ZSXA 4DF8A 4KPYA 4E1NA 3HT3A 4FLYA 3NCIA 1BIUA 1Q8IA 4LD0A 3H08A 4MFBA 2R7YA 1U04A 1J5OA 2B4JA 5C42A 5CYMA 3ZSWA 3M8SA 1T8EA 4DQPA 1VSHA 4PA1A 4FJKA 4FM1A 3SQ0A 4DTXA 1Z26A 4DSKA 3VQ7A 4CIFA 4KHQA 3OVNA 4H4OA 4CGFA 4OPJA 1I3AA 2X78A 3AVBA 4DTJA 3O4NA 5FROA 3QNOA 1XC9A 1HQUA 2O4GA 3RMDA 4F8RA 4CHQA 3HL8A 1BGXT 3NF9A 3OS1A 1S1XA 1RBRA 2PY5A 4N47A 1RILA 3DOLA 1S1TA 4E0DA 3ZSQA 1JLGA 3HP6A 4PY5A 5JS1A 4ELTA 2D0BA 4CGIA 3HXMA 4M42A 3DLKA 3TAEA 2IOCA 3EYZA 4FM2A 4DQSA 2HHSA 4O4GA 1WSGA 1S6PA 4FZZA 3K59A 2RKIA 3S3MA 4B3OA 2KW4A 2ETJA 3MEDA 2D0CA 3F73A 1NJZA 2A1SA 1JLQA 3KK2A 4BE2A 3UIQA 4ID5A 1XI1A 3P83D 4DU4A 3DLHA 2ZE2A 5SZTA 1RDDA 1VSEA 1B9FA 4B9LA 3MEGA 4B9SA 3NAEA 1TGOA 1A5XA 1DTQA 1KCFA 3T19A 3V1QA 3PV8A 3L2RA 1A5VA 4CF0A 4NYNA 4M3XA 3VA3A 2Q3SA 4CJRA 4FJGA 2HNZA 3K5LA 1D8YA 2E6MA 3TR8A 4EP4A 2QK9A 2HHXA 2F8TA 1O1WA 1BL3A 4CJUA 1C6VA 1S9GA 2IDOA 3C95A 4JRPA 3IAYA 4KTWA 1ZBHA 1VSIA 1BIZA 1KFSA 4E1MA 1WSEA 4DQIA 2VWJA 4FLTA 5FDLA 5J2MA 4CJSA 2YV0X 3KKRA 5HRRA 3OS0A 3OYAA 3HVTA 4NCAA 1BI4B 3NF8A 3QO9A 3VQQA 4BWJA 3AV9A 1LV5A 4J2DA 3RRHA 3QIOA 5DMRA 1SL0A 2KQ2A 3S3NA 2Z1JA 5HROA 3KLHA 5HRNA 2DFFA 2FC0A 4C8MA 4HCCA 3L2QA 1JLBA 4CECA 2QKKA 4QCLA 3JYTA 4FJLA 3AO2A 1RTJA 3M8RA 1KLNA 4KI4A 2ZD1A 3NBPA 4CGJA 1KVAA 1XHZA 3SQ4A 2JLEA 3KIOA 3VQ6A 4CJ4A 3RRGA 1YT3A 1S5JA 1ZBLA 3LANA 1RT7A 3V9WA 1CZBA 4RG8A 1FXXA 1GOAA 1U48A 1VK0A 4WE1A 3ASMA 3ZSVA 3B6PA 2ZQBA 4F4KA 2DTUA 4C8KA 1F21A 4O44A 4O0JA 3DLRA 3KTQA 2D0AA 3DLBA 5KRSA 1IO2A 4ID1A 3IS9A 4OPKA 1VSFA 2P5OA 3CFOA 3LZJA 3DMJA 3OYGA 4CHYA 5KGWA 4DSJA 4CEAA 1KVCA 4HUEA 5CZ1A 3LWLA 1SKRA 5JS2A 1NKEA 4CHZA 3AVIA 3DRSA 5DK5A 1HJRA 3I8DA 1NKBA 2E6LA 3VQBA 3NH1A 2KTQA 4ELUA 4L8RB 2OPRA 1HYSA 3SUNA 3DLGA 1T05A 4FJ9A 4W5NA 2PYLA 2HHWA 1JL1A 4W5RA 2QXFA 3HPOA 4HUFA 2G8IA 2B6AA 4M41A 1EKEA 2BANA 3NGIA 3LPTA 2X74A 1KFDA 2OPPA 1LW0A 4CFBA 3L3UA 3AA5X 3KK3A 3O4QA 1TKZA 4CEDA 2X6SA 3C6UA 4CJFA 1I39A 4O0IA 1L3SA 5CYQA 2XY7A 3V9SA 3SUOA 4FXDA 3VQAA 4FLVA 2P5GA 4DSLA 4IFYA 3QIPA 4G1QA 3LP1A 3NF7A 3QNNA 4BE0A 2ITGA 1LWCA 1FKPA 1TKTA 4HVJA 1IG9A 1NOYA 4NCBA 4NYFA 3SPYA 4KTQA 1RDCA 3V9UA 4EZ9A 4J2BA 1C0TA 3PY8A 1TL1A 3U3GA 2XY6A 2IGIA 4FK2A 1R0AA 1T03A 4CGDA 1REVA 1K6YA 3K58A 4M45A 1VRUA 3MECA 3KLEA 3LDSA 3L2VA 3AVKA 1RTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVF A;  1J54 A;  4RW7 A;  4DQR A;  3OYD A;  2DY4 A;  1TK5 A;  5C25 A;  4YNQ A;  1RCH A;  4AH9 A;  4OKK A;  2EX3 A;  1NJY A;  4CGG A;  3E01 A;  1KRP A;  4F2R A;  2O4I A;  1CXQ A;  2FBX A;  3SCX A;  4N41 A;  4Y1C A;  2YNG A;  1JLF A;  4MQ3 A;  4DTO A;  4ELV A;  4Z4G A;  1DTT A;  2Z1G A;  4ICL A;  3SV4 A;  3KLF A;  1J9A A;  1T7P A;  1JXE A;  1Q9X A;  2W42 A;  4FJH A;  3I0S A;  4O5B A;  4CEE A;  2PZS A;  4FW1 A;  4I9L A;  3CM6 A;  2HVH A;  1WSH A;  3ULD A;  3RWU A;  4W5T A;  1WAF A;  2XRI A;  3I0R A;  4KHY A;  2RF2 A;  3TAF A;  5E41 A;  3ZT3 A;  1UA0 A;  4Z4H A;  2F8S A;  3CFP A;  4KB1 A;  4CCH A;  4QOZ B;  1WAJ A;  5KTQ A;  3OS2 A;  2ATQ A;  5CZ2 A;  4KHU A;  3EZ5 A;  4HHT A;  1MU2 A;  2HMI A;  3G0Z A;  1QSS A;  4K8X A;  3NDK A;  3OY9 A;  4CEO A;  3SYZ A;  1YVU A;  1RT2 A;  3EY1 A;  4OGC A;  3TAG A;  4LY7 A;  4I9Q A;  5HRP A;  4Z4C A;  3V1R A;  1EP4 A;  2BE2 A;  3ISN C;  3V4I A;  1IKV A;  3SI6 A;  4JS4 A;  2NUB A;  2FBY A;  3OYB A;  1BQM A;  2HND A;  4BE1 A;  3TAM A;  4DTU A;  2FBT A;  1X9M A;  2IC3 A;  1S6Q A;  4FJ7 A;  1BHL A;  3WNE A;  2YNH A;  4DS5 A;  2G8V A;  2IAJ A;  3AO5 A;  3KKS A;  3K5O A;  3C94 A;  4PUO A;  4DQQ A;  1NK8 A;  4NCG A;  4KV8 A;  4E89 A;  4KAZ A;  3LAL A;  3ZSY A;  1W0H A;  4OGE A;  5FRM A;  1SV5 A;  1NK9 A;  2DFE A;  3HST B;  1ASU A;  1L3T A;  2KFN A;  4RW9 A;  3AA4 A;  1FK9 A;  3L2U A;  3DOK A;  3SV3 A;  4CFD A;  4FYD A;  1HMV A;  5HBM A;  1D9F A;  4DS4 A;  4FJN A;  4IG0 A;  3SNN A;  3BGR A;  3V81 A;  2OZM A;  2AJQ A;  2D5R A;  4FJI A;  1X1P A;  4XIU A;  4FM0 A;  1NJX A;  3WNF A;  4N56 A;  2HHT A;  2Y1I A;  4CGH A;  1QE1 A;  3L3V A;  1J53 A;  3AO1 A;  3DRR A;  3M8P A;  1LAV A;  4DTN A;  1ASW A;  1YTA A;  1U4B A;  1IKX A;  2OZS A;  1RBV A;  4HCB A;  3DYA A;  3S9H A;  1ZBF A;  3AA3 A;  4HTU A;  2EHG A;  4RW6 A;  4IDK A;  3HK2 A;  4LSL A;  4M3U A;  1JLE A;  1TKD A;  4Z0U A;  4DFJ A;  3HVR A;  4AIL C;  2OA8 A;  2XO7 A;  3RR7 A;  5SWM A;  4OKE A;  4FVM A;  4DU3 A;  3TI0 A;  4IKF A;  5FRN A;  1RTD A;  3P5J A;  1YTU A;  2KZM A;  4CHN A;  2DFH A;  4H4M A;  1TAU A;  4R5P A;  4JLH A;  3AO3 A;  1BIS A;  4N5S A;  1VRT A;  3HPG A;  5KRT A;  3VQ8 A;  3SUP A;  3QEW A;  1W9H A;  5I3U A;  1WSI A;  1EET A;  4LH5 A;  4HUG A;  1CLQ A;  4AHU A;  3AO4 A;  3VQ4 A;  3QEX A;  1S1U A;  1TAQ A;  4CF9 A;  5T7B A;  1B9D A;  3MAQ A;  4K8Z A;  2WOM A;  1C1C A;  3LPU A;  3OYL A;  2QKB A;  3AVJ A;  4DG1 A;  1LW2 A;  4F3T A;  1SKS A;  3F9K A;  4KI6 A;  1RT6 A;  3HYF A;  3ZSZ A;  1L3U A;  2BDP A;  2HVI A;  4ZHR A;  2HNY A;  4E7I A;  1RT4 A;  3KLI A;  1HQE A;  4LH4 A;  4B8C A;  1EXQ A;  3LP2 A;  4W5O A;  2HHU A;  3AVN A;  4C8N A;  3SJJ A;  2OYQ A;  4FLX A;  1WSJ A;  4CF2 A;  4CES A;  1HYZ A;  4BAC A;  5HP1 A;  1KVB A;  4CJP A;  1C0U A;  4IFV A;  1TKX A;  4C8O A;  3TAP A;  4E3S A;  4CF8 A;  3ZSR A;  3P1G A;  3NGZ A;  1HNV A;  4Z4I A;  4B9M A;  2GV9 A;  4FZY A;  1TVR A;  4KRE A;  4ZTJ A;  4M3Z A;  1RBS A;  4E7K A;  2BGG A;  1NK4 A;  3QEP A;  4KHN A;  4AHC A;  2G8H A;  5CY4 A;  2B5J A;  1UOC A;  3QEI A;  4J2A A;  1WSF A;  4E7H A;  4KRF A;  4FCY A;  4J2E A;  5J2P A;  4W5Q A;  4DTP A;  4N76 A;  2A1R A;  2HHQ A;  4RW8 A;  4KFB A;  1QSL A;  3PO4 A;  3LAM A;  4B9N A;  3IRX A;  4FLW A;  3V1O A;  3RMB A;  1QSY A;  1ZYQ A;  2OPS A;  1SUQ A;  1X9S A;  2X6N A;  1HRH A;  1RNH A;  3AVM A;  1QHT A;  1SL1 A;  1VSL A;  1LAW A;  3SZ2 A;  1X9W A;  1VSK A;  4DLE A;  4IG3 A;  1C1B A;  3DRP A;  3HO1 A;  4BDY A;  4Z4E A;  5J2Q A;  2RPI A;  3K2P A;  3OYM A;  4TSX A;  4FJ5 A;  4I2Q A;  1NOZ A;  3AVH A;  4CJL A;  3QES A;  4OJR A;  3HPH A;  3MXJ A;  2Y1J A;  3HM9 A;  5D3G A;  4KTZ A;  3DM2 A;  1Q9Y A;  4CJW A;  4CK3 A;  4Q5V A;  4M3R A;  3CQ8 A;  4DSF A;  4AHV A;  1IH7 A;  4RW4 A;  4AHS A;  1VSD A;  4CJ3 A;  2JGU A;  4DMN A;  3V9X A;  1N6Q A;  1WNS A;  2GUI A;  3AVL A;  3OYK A;  3NE6 A;  4FLU A;  1G15 A;  3WNH A;  4DSE A;  3QIN A;  3VA0 A;  1KLM A;  5K14 A;  3OYN A;  3VQC A;  4DU1 A;  4CER A;  3NH2 A;  1C1A A;  2XHB A;  4CK2 A;  1ZBI A;  1D5A A;  2GBZ A;  3KLG A;  1RT1 A;  1TK0 A;  4EP5 A;  3TAN A;  4B9T A;  3MEE A;  4GW6 A;  3TAQ A;  5J1E A;  1BQN A;  3A2F A;  3ITH A;  4BWM A;  1NK5 A;  4DSI A;  4CJV A;  1TL3 A;  2YHB A;  4DFK A;  1ZBU A;  4CEF A;  2G8K A;  3OYC A;  3LWM A;  1ITG A;  1JXB A;  3ALY A;  1XWL A;  4F2S A;  3JSM A;  3HJF A;  1N5Y A;  4GMJ B;  4B9V A;  4PQU A;  3THV A;  5HRS A;  4FLZ A;  1RT3 A;  3T3F A;  3OYE A;  3PO5 A;  3VQ5 A;  5J2N A;  3TAR A;  4DTR A;  1GOC A;  1NK6 A;  3AA2 A;  4CJQ A;  3MXI A;  4FK4 A;  3L8B A;  1SL2 A;  3OYJ A;  1SKW A;  2P1J A;  5C24 A;  4E19 A;  2VG7 A;  1RDB A;  2I5J A;  3NF6 A;  3TAB A;  1RTH A;  4FJ8 A;  1NKC A;  2YKM A;  3RTV A;  4DTM A;  4FJM A;  4CF1 A;  4CEQ A;  1BI4 A;  4YFU A;  2G8U A;  3HP9 A;  4M3Y A;  1CZ9 A;  4O55 A;  2YKN A;  3KK1 A;  5HLF A;  4M3W A;  5KGX A;  1UA1 A;  4FJX A;  1WLJ A;  1RBT A;  3OJS A;  5I42 A;  2PYJ A;  1Y97 A;  2YNF A;  3AVA A;  1HPZ A;  2Z1I A;  2OPQ A;  3T1A A;  3G10 A;  3OJU A;  3U3Y A;  3RR8 A;  1VSJ A;  3LAK A;  3SQ2 A;  1JLA A;  4DFP A;  3PX0 A;  2IS3 A;  3DI6 A;  1C0M A;  3RMA A;  3SPZ A;  3S3O A;  4FK0 A;  3LP3 A;  1A5W A;  4E7L A;  3QLH A;  4CE9 A;  4BDZ A;  4CHO A;  4FZX C;  1NK7 A;  5KI6 A;  3D0P A;  1KSP A;  1UAX A;  1UWB A;  4CJT A;  4CIE A;  3LP0 A;  3OYI A;  3O3H A;  1WN7 A;  2WON A;  4KHS A;  3K57 A;  3OYF A;  1RDA A;  4CEB A;  4Q0B A;  4OKJ A;  3TWH A;  3U6F A;  3LZI A;  1GOB A;  3VQD A;  3ZCM A;  4CFA A;  3SUQ A;  3KD5 E;  4GVM A;  4CJK A;  4CEZ A;  3K5M A;  2VG5 A;  2VWK A;  1JL2 A;  2RN2 A;  4DLG A;  3O3F A;  4FJJ A;  3B6O A;  2YHA A;  3WNG A;  3AVG A;  3AVC A;  1S9E A;  3NHG A;  4B08 A;  3PX6 A;  1DLO A;  4M3T A;  4IBN A;  1QS4 A;  4CIG A;  1IKW A;  4B9U A;  3NFA A;  1HNI A;  3IG1 A;  1TK8 A;  1JKH A;  3NH0 A;  1LWE A;  4OLA A;  4E7J A;  4OVL A;  3M8Q A;  1U47 A;  4KHW A;  1QQC A;  2FBV A;  4QAG A;  4H8K A;  3PUF A;  3RMC A;  1NK0 A;  1L3V A;  3CFR A;  4DTS A;  4AHT A;  3ZT2 A;  3PX4 A;  4OLB A;  3KD1 E;  2YNI A;  4CHP A;  1TV6 A;  1ASV A;  3O3G A;  3V9Z A;  1Z25 A;  2HHV A;  3SQ1 A;  3BDP A;  4Z4F A;  1LWF A;  2Z1H A;  3L2W A;  3CM5 A;  2VG6 A;  4I7F A;  1U49 A;  4CK1 A;  4F3O A;  4B8A B;  2G8F A;  4DF4 A;  3ZT0 A;  2G8W A;  2XY5 A;  1XHX A;  4DFM A;  3ZSO A;  3QET A;  3QEV A;  3V6D A;  3FFI A;  3ZT1 A;  1QTM A;  1D9D A;  5EU7 A;  1JLC A;  2XY8 A;  1CXU A;  3CG7 A;  3K5N A;  1BCO A;  3ZT4 A;  3VQ9 A;  4LSN A;  3QER A;  3KJV A;  3DLE A;  3D45 A;  4KO0 A;  2HB5 A;  4UQG A;  1L5U A;  2KZZ A;  3NGY A;  4KKO A;  3VN5 A;  4CFC A;  2P51 A;  4C8L A;  4JRQ A;  3C6T A;  2HW3 A;  3CYM A;  3VQP A;  1EX4 A;  1S1W A;  4BDP A;  2E4L A;  1VSM A;  4Y1D A;  4CJE A;  3OYH A;  3MXM A;  1B92 A;  4ZTF A;  2LSN A;  4EZ6 A;  1IKY A;  1FKO A;  1HYV A;  3VQE A;  4PWD A;  1RBU A;  2KFZ A;  1BCM A;  4AHR A;  1KTQ A;  4CJ5 A;  4KB0 A;  1S1V A;  1NJW A;  4JS5 A;  4DWI A;  1U45 A;  2F96 A;  4FW2 A;  1RT5 A;  4I2P A;  3ZSX A;  4DF8 A;  4KPY A;  4E1N A;  3HT3 A;  4FLY A;  3NCI A;  1BIU A;  1Q8I A;  4LD0 A;  3H08 A;  4MFB A;  2R7Y A;  1U04 A;  1J5O A;  2B4J A;  5C42 A;  5CYM A;  3ZSW A;  3M8S A;  1T8E A;  4DQP A;  1VSH A;  4PA1 A;  4FJK A;  4FM1 A;  3SQ0 A;  4DTX A;  1Z26 A;  4DSK A;  3VQ7 A;  4CIF A;  4KHQ A;  3OVN A;  4H4O A;  4CGF A;  4OPJ A;  1I3A A;  2X78 A;  3AVB A;  4DTJ A;  3O4N A;  5FRO A;  3QNO A;  1XC9 A;  1HQU A;  2O4G A;  3RMD A;  4F8R A;  4CHQ A;  3HL8 A;  1BGX T;  3NF9 A;  3OS1 A;  1S1X A;  1RBR A;  2PY5 A;  4N47 A;  1RIL A;  3DOL A;  1S1T A;  4E0D A;  3ZSQ A;  1JLG A;  3HP6 A;  4PY5 A;  5JS1 A;  4ELT A;  2D0B A;  4CGI A;  3HXM A;  4M42 A;  3DLK A;  3TAE A;  2IOC A;  3EYZ A;  4FM2 A;  4DQS A;  2HHS A;  4O4G A;  1WSG A;  1S6P A;  4FZZ A;  3K59 A;  2RKI A;  3S3M A;  4B3O A;  2KW4 A;  2ETJ A;  3MED A;  2D0C A;  3F73 A;  1NJZ A;  2A1S A;  1JLQ A;  3KK2 A;  4BE2 A;  3UIQ A;  4ID5 A;  1XI1 A;  3P83 D;  4DU4 A;  3DLH A;  2ZE2 A;  5SZT A;  1RDD A;  1VSE A;  1B9F A;  4B9L A;  3MEG A;  4B9S A;  3NAE A;  1TGO A;  1A5X A;  1DTQ A;  1KCF A;  3T19 A;  3V1Q A;  3PV8 A;  3L2R A;  1A5V A;  4CF0 A;  4NYN A;  4M3X A;  3VA3 A;  2Q3S A;  4CJR A;  4FJG A;  2HNZ A;  3K5L A;  1D8Y A;  2E6M A;  3TR8 A;  4EP4 A;  2QK9 A;  2HHX A;  2F8T A;  1O1W A;  1BL3 A;  4CJU A;  1C6V A;  1S9G A;  2IDO A;  3C95 A;  4JRP A;  3IAY A;  4KTW A;  1ZBH A;  1VSI A;  1BIZ A;  1KFS A;  4E1M A;  1WSE A;  4DQI A;  2VWJ A;  4FLT A;  5FDL A;  5J2M A;  4CJS A;  2YV0 X;  3KKR A;  5HRR A;  3OS0 A;  3OYA A;  3HVT A;  4NCA A;  1BI4 B;  3NF8 A;  3QO9 A;  3VQQ A;  4BWJ A;  3AV9 A;  1LV5 A;  4J2D A;  3RRH A;  3QIO A;  5DMR A;  1SL0 A;  2KQ2 A;  3S3N A;  2Z1J A;  5HRO A;  3KLH A;  5HRN A;  2DFF A;  2FC0 A;  4C8M A;  4HCC A;  3L2Q A;  1JLB A;  4CEC A;  2QKK A;  4QCL A;  3JYT A;  4FJL A;  3AO2 A;  1RTJ A;  3M8R A;  1KLN A;  4KI4 A;  2ZD1 A;  3NBP A;  4CGJ A;  1KVA A;  1XHZ A;  3SQ4 A;  2JLE A;  3KIO A;  3VQ6 A;  4CJ4 A;  3RRG A;  1YT3 A;  1S5J A;  1ZBL A;  3LAN A;  1RT7 A;  3V9W A;  1CZB A;  4RG8 A;  1FXX A;  1GOA A;  1U48 A;  1VK0 A;  4WE1 A;  3ASM A;  3ZSV A;  3B6P A;  2ZQB A;  4F4K A;  2DTU A;  4C8K A;  1F21 A;  4O44 A;  4O0J A;  3DLR A;  3KTQ A;  2D0A A;  3DLB A;  5KRS A;  1IO2 A;  4ID1 A;  3IS9 A;  4OPK A;  1VSF A;  2P5O A;  3CFO A;  3LZJ A;  3DMJ A;  3OYG A;  4CHY A;  5KGW A;  4DSJ A;  4CEA A;  1KVC A;  4HUE A;  5CZ1 A;  3LWL A;  1SKR A;  5JS2 A;  1NKE A;  4CHZ A;  3AVI A;  3DRS A;  5DK5 A;  1HJR A;  3I8D A;  1NKB A;  2E6L A;  3VQB A;  3NH1 A;  2KTQ A;  4ELU A;  4L8R B;  2OPR A;  1HYS A;  3SUN A;  3DLG A;  1T05 A;  4FJ9 A;  4W5N A;  2PYL A;  2HHW A;  1JL1 A;  4W5R A;  2QXF A;  3HPO A;  4HUF A;  2G8I A;  2B6A A;  4M41 A;  1EKE A;  2BAN A;  3NGI A;  3LPT A;  2X74 A;  1KFD A;  2OPP A;  1LW0 A;  4CFB A;  3L3U A;  3AA5 X;  3KK3 A;  3O4Q A;  1TKZ A;  4CED A;  2X6S A;  3C6U A;  4CJF A;  1I39 A;  4O0I A;  1L3S A;  5CYQ A;  2XY7 A;  3V9S A;  3SUO A;  4FXD A;  3VQA A;  4FLV A;  2P5G A;  4DSL A;  4IFY A;  3QIP A;  4G1Q A;  3LP1 A;  3NF7 A;  3QNN A;  4BE0 A;  2ITG A;  1LWC A;  1FKP A;  1TKT A;  4HVJ A;  1IG9 A;  1NOY A;  4NCB A;  4NYF A;  3SPY A;  4KTQ A;  1RDC A;  3V9U A;  4EZ9 A;  4J2B A;  1C0T A;  3PY8 A;  1TL1 A;  3U3G A;  2XY6 A;  2IGI A;  4FK2 A;  1R0A A;  1T03 A;  4CGD A;  1REV A;  1K6Y A;  3K58 A;  4M45 A;  1VRU A;  3MEC A;  3KLE A;  3LDS A;  3L2V A;  3AVK A;  1RTI A; 
#chains in the Genus database with same CATH topology
 4AM6 A;  3OYD A;  4J8F A;  1RCH A;  4OKK A;  2EX3 A;  3E01 A;  4Y1C A;  1NJI O;  1DTT A;  4ICL A;  3SV4 A;  4GKJ K;  1JXE A;  3E66 A;  3I0S A;  2PZS A;  3OBW A;  5AFU H;  4YOV A;  4FW1 A;  4I9L A;  4XH5 A;  1X3M A;  4GV6 A;  5AQF A;  3G6E N;  5AQI A;  4QOZ B;  2QWN A;  4KHU A;  1MU2 A;  4A62 A;  3VEV A;  1GLJ O;  4FOE A;  4K8X A;  4Y0W A;  3SBG A;  4OGC A;  4BRG A;  4CBW A;  5HRP A;  3I55 N;  1EP4 A;  1IJJ A;  5GIP A;  3SI6 A;  4JS4 A;  2ZWH A;  4JAX A;  3RSE B;  3F9M A;  4OPA A;  2G8V A;  3AAR A;  3AO5 A;  3MN5 A;  1IBM K;  4KHP K;  5AQH A;  4NCG A;  1K9M O;  3AAQ A;  4OGE A;  2A5X A;  2UXB K;  2DFE A;  3TTD A;  3HST B;  4JHD B;  5M1K A;  1FK9 A;  1XC3 A;  3DOK A;  1HMV A;  4DR2 K;  3CCL N;  5IWA K;  4FJN A;  4AQY K;  4H0Y B;  3BGR A;  2OZM A;  4YOU A;  1X1P A;  5AZI B;  5BR8 K;  2QA4 N;  4JI5 K;  4CGH A;  2CGL A;  3A0I X;  3EE8 A;  3WEE B;  4DV3 K;  4X62 K;  2OZS A;  3GE1 A;  4BRE A;  1H1V A;  1OKJ A;  1MA9 B;  3AA3 A;  4HTU A;  2EHG A;  4M3U A;  4Z0U A;  3RR7 A;  5SWM A;  4OKE A;  4FVM A;  4H4M A;  1TAU A;  4R5P A;  4DV4 K;  3AO3 A;  2NRX A;  1BO5 O;  1NU0 A;  1W9H A;  5AQT A;  4BGB A;  3VGK A;  4B3T K;  4YOW A;  4HUG A;  1MDU B;  1CLQ A;  3I33 A;  3VQ4 A;  1VQ5 N;  1B9D A;  3MAQ A;  4K8Z A;  2QKB A;  3AVJ A;  4DG1 A;  2HVI A;  2P9U B;  3I8B A;  2H3G X;  4FWM A;  2HNY A;  3LP2 A;  4WYB A;  4IJA A;  3SJJ A;  4FLX A;  1WSJ A;  1WOQ A;  4BAC A;  1ATS A;  5HP1 A;  1KVB A;  4CJP A;  1FW6 A;  3TAP A;  3JAM O;  5MLC Q;  2GV9 A;  1TVR A;  1RBS A;  2JWL A;  4E7K A;  4AHC A;  2G8H A;  1UOC A;  3QEI A;  2HMP A;  3HRG A;  4J2E A;  4W5Q A;  4N76 A;  2A1R A;  2HHQ A;  3KVG A;  5KPR A;  4FLW A;  1QSY A;  5FPD A;  2OPS A;  1X9S A;  1RNH A;  3AVM A;  1X9W A;  3SZ2 A;  1VSK A;  3M3Z A;  4GVE A;  1C1B A;  4Z94 A;  2WUS A;  5J2Q A;  1NM1 A;  5CE3 A;  2YJF A;  1QQM A;  4CJL A;  2Q2R A;  4NXN K;  4KTZ A;  3DM2 A;  1S3X A;  4M3R A;  5C10 A;  1YIT N;  3H46 O;  4DMN A;  1K8K B;  2GUI A;  4M7Y A;  3OYK A;  1G15 A;  3FLC O;  3O80 A;  3QIN A;  4FVU A;  3VA0 A;  2D0P A;  1N33 K;  4A59 A;  1IBL K;  3VQC A;  4DU1 A;  3NH2 A;  1C1A A;  3BF1 A;  2XHB A;  4DV0 K;  1RT1 A;  4EP5 A;  3TAQ A;  5H1S Q;  3DJC A;  1BQN A;  3A2F A;  1NK5 A;  4CJV A;  5JMV A;  1ZBS A;  3RVC A;  1SZ2 A;  3ALY A;  1JXB A;  3ATV A;  4GMJ B;  4CD1 A;  3T3F A;  4BG9 A;  3VQ5 A;  5J2N A;  3TAR A;  2UU9 K;  4KH4 A;  1VQN N;  3CI5 A;  5JLF A;  4CZJ A;  2P9P A;  3L8B A;  3OYJ A;  1SKW A;  5C24 A;  2VG7 A;  2ZF5 O;  3TAB A;  2BTF A;  1NG9 A;  1RTH A;  4FJ8 A;  2IVO A;  1NKC A;  3VEX A;  3CMA N;  4CEQ A;  3ZET B;  4YFU A;  2G8U A;  2WC9 A;  4I6M A;  2O8D B;  1YXQ A;  2I7N A;  4O55 A;  5KGX A;  3CCS N;  2VGN A;  4B1Y B;  2YNF A;  3T1A A;  4JI4 K;  3G10 A;  1WBD A;  2P9S B;  3U3Y A;  3LAK A;  2QXL A;  2IS3 A;  1C0M A;  3RMA A;  2P9N A;  2J4R A;  3EZW A;  4CE9 A;  4BDZ A;  3DWL A;  3OBY A;  4BRA A;  1KSP A;  3THY B;  4JKH A;  3U8X A;  2WON A;  2KFN A;  4CEB A;  3U6F A;  3VQD A;  3K5M A;  2VG5 A;  2VWK A;  1DGK N;  3THW B;  5AQK A;  3OA9 A;  5DM6 L;  3EE9 A;  5EVZ A;  1TK8 A;  1JKH A;  2HBJ A;  4B9Q A;  4EAH D;  4E7J A;  4OVL A;  2FBV A;  3RMC A;  1NK0 A;  3PUF A;  4MDB A;  4IEE A;  4DTS A;  4DR3 K;  1E3M A;  3PX4 A;  3CC2 N;  2QM1 A;  3MCP A;  2YNI A;  2P9I A;  3VF6 A;  5AQW A;  3ZX0 A;  1GLE G;  3T69 A;  2VG6 A;  4F3O A;  1XQS C;  2G8W A;  4DFM A;  3ZT1 A;  5M1Q A;  1CXU A;  3K5N A;  1BCO A;  4JD2 B;  3DLE A;  3G71 N;  4KO0 A;  1L5U A;  5AZJ A;  2P51 A;  3C6T A;  1EX4 A;  1N32 K;  3OYH A;  1KD1 O;  4ZTF A;  1VQ6 N;  5TKY A;  4FWL A;  3VQE A;  4FL9 A;  1W97 L;  1RBU A;  4PWD A;  3HOS A;  2KFZ A;  1KTQ A;  4KB0 A;  4QS7 A;  1NJW A;  1RT5 A;  4KPY A;  4FLY A;  2P9K B;  3H08 A;  4FOI A;  2R7Y A;  1J5O A;  4DQP A;  2A6A A;  1T8E A;  3ZSW A;  4FJK A;  4DSK A;  3VQ7 A;  4BR0 A;  4H4O A;  3WQU A;  4CGF A;  3O4N A;  3RMD A;  2O4G A;  4BVO A;  4CHQ A;  3HL8 A;  3DXM B;  1YIJ N;  3CC4 N;  1S1X A;  4BR2 A;  4N47 A;  2PBD A;  4C1N K;  4X66 K;  3DOL A;  4DR6 K;  5AQR A;  2UUA K;  3KK7 A;  1HNZ K;  2IOC A;  1HKB A;  2AA4 A;  3VOV A;  2ETJ A;  4R79 A;  2QWP A;  1JLQ A;  3O4W A;  1XI1 A;  4XEI A;  4DU4 A;  3DLH A;  2NRV A;  1GLC G;  1U6Z A;  3C6A A;  3P31 A;  3I56 N;  1TGO A;  3T19 A;  1T3V A;  1A5V A;  4NYN A;  3H6E A;  3VA3 A;  2HNZ A;  3K5L A;  1D8Y A;  3TR8 A;  5TKW A;  1T6C A;  1BL3 A;  4BRL A;  1OH8 A;  2VYP A;  4JRP A;  4KTW A;  5LJW A;  1BIZ A;  3SK3 A;  1KFS A;  4E1M A;  4BR4 A;  5FDL A;  4CJS A;  3VGL A;  3SMS A;  1VQK N;  1BI4 B;  3ENO A;  3NF8 A;  3R8E A;  4DB3 A;  4JI8 K;  3U4L A;  3RRH A;  5DMR A;  2KQ2 A;  3KLH A;  4GKK K;  2FC0 A;  1JLB A;  2QKK A;  2QWQ A;  3M8R A;  1RTJ A;  1KLN A;  5E26 A;  3CCE N;  3WT0 A;  5HL7 L;  3KIO A;  3Q7B A;  3G25 A;  4CJ4 A;  4JKG B;  1IG8 A;  4K25 A;  3R9P A;  4WE1 A;  4YY3 K;  3ZSV A;  4BVP A;  2P9L B;  3UKR A;  3LDO A;  3DLB A;  5KRS A;  4ID1 A;  2P5O A;  4CHY A;  5KGW A;  4DSJ A;  4CEA A;  1SKR A;  4HUE A;  5AQN A;  4K41 A;  5DK5 A;  3ZEU A;  3I8D A;  2KTQ A;  2E6L A;  3VQB A;  2OPR A;  3DLG A;  4A5A A;  4W5N A;  3P38 A;  4HUF A;  1S22 A;  2B6A A;  4JKD A;  1D4X A;  1KFD A;  3ZX3 A;  3GOI A;  4EFH A;  2W40 A;  3L3U A;  1TYQ A;  3C6U A;  1ATN A;  4FXD A;  2P5G A;  4FLV A;  1BG3 A;  1SQK A;  2YI1 A;  1FKP A;  4NCB A;  4BRO A;  4J2B A;  3L4I A;  4JI3 K;  4BC2 A;  3L0Q A;  3U3G A;  2XY6 A;  2IGI A;  4E1J A;  1REV A;  3IDH A;  4YDU A;  2F7T A;  3VEO A;  1IO2 A;  2YJE A;  3AVF A;  1J54 A;  1U2V B;  4RW7 A;  3L4Q A;  2DY4 A;  5C25 A;  2O4I A;  2E2N A;  4F2R A;  5M1N A;  4DUZ K;  2YNG A;  1JLF A;  4MQ3 A;  4ELV A;  2NNW A;  4Z4G A;  2GEM A;  5GAD P;  3KLF A;  1J9A A;  2NRZ A;  1T7P A;  4FJH A;  2W42 A;  2HBM A;  1WSH A;  3RWU A;  1QZ6 A;  3CPE A;  2XRI A;  4KHY A;  2ASM A;  3A8Y A;  1UA0 A;  4Z4H A;  2F8S A;  1HNX K;  4LC9 B;  3CCR N;  1NGC A;  5FLX O;  5GIN A;  3G0Z A;  1QSS A;  3NDK A;  3CHW A;  4CEO A;  3SYZ A;  2YHY A;  3J7Z O;  3EY1 A;  3CPW M;  3V1R A;  3EN9 A;  1QHA A;  3V4I A;  5AJ3 K;  3CQX A;  2NUB A;  3TSQ A;  5AFU A;  4DTU A;  2HND A;  1FJG K;  3MX2 A;  1NGD A;  4FJ7 A;  1S6Q A;  2F9W A;  2IAJ A;  3OTO K;  4PUO A;  4DQQ A;  4KAZ A;  5FRM A;  3LAL A;  3ZSY A;  1SV5 A;  1NK9 A;  4O8K A;  1OH7 A;  1L3T A;  4RW9 A;  4CFD A;  4FYD A;  1D9F A;  3CXC M;  1N36 K;  5ELZ A;  5C0Y A;  4IG0 A;  3MWP A;  3SNN A;  3CD6 N;  3V81 A;  4XIU A;  4FM0 A;  4IOX A;  1NGE A;  1QE1 A;  3L3V A;  1J53 A;  3AO1 A;  4H5N A;  1YTA A;  2RHK A;  3TTC A;  3MDQ A;  4BC4 A;  3DYA A;  1ZBF A;  3K9J A;  2CH5 A;  4RW6 A;  4IDK A;  4LSL A;  2O8B A;  3HVR A;  2XO7 A;  3TI0 A;  5EX5 A;  1RTD A;  2DFH A;  3TPQ A;  1BUP A;  1RDW X;  4LFB K;  1O13 A;  1BIS A;  4N5S A;  3QEW A;  1BOT O;  1LCU A;  2FSJ A;  4A5B A;  3K9K A;  3TTF A;  4IDH A;  4DCH A;  3SJH A;  1M1K O;  1LW2 A;  4F3T A;  4H0V B;  1SKS A;  3LM2 A;  1HQE A;  2D1K A;  4H03 B;  4W5O A;  2HHU A;  1HJO A;  3SAH A;  1C0U A;  2OTL N;  4EHT A;  3O08 A;  4CF8 A;  4Z4I A;  4FZY A;  3MK6 A;  3O9T A;  4YOT A;  4ZTJ A;  4M3Z A;  2BGG A;  1X3N A;  4KHN A;  4KRF A;  4J2A A;  4E7H A;  4FCY A;  3EKS A;  4U7B A;  4C1N I;  4KFB A;  2Q97 A;  2O8E B;  3C7N A;  4FSV A;  3RMB A;  1SUQ A;  1QHT A;  1SL1 A;  3T7Z A;  3CET A;  5CHI A;  4BDY A;  4Z4E A;  2RPI A;  1DEJ A;  4FJ5 A;  4TSX A;  3QB0 A;  1NOZ A;  3AVH A;  1YJ9 N;  1HPM A;  3HPH A;  2Y1J A;  1KAY A;  2GWK A;  2HST A;  1Q9Y A;  4DSF A;  2BUP A;  4AHV A;  1IH7 A;  4AHS A;  5AQO A;  4JI2 K;  2JGU A;  3V9X A;  4JKB A;  1N6Q A;  3AVL A;  3FE1 A;  3OYN A;  4CK2 A;  3BY5 A;  2HHH K;  3KLG A;  1TK0 A;  3VER A;  4BWM A;  1TL3 A;  2YHB A;  2Q0U A;  1ZBU A;  4CEF A;  4X65 K;  4CBU A;  1ITG A;  3H45 C;  4F2S A;  3HJF A;  3JSM A;  1N5Y A;  3BUZ B;  2YHX A;  5HRS A;  4FLZ A;  4JNE A;  3CJA A;  3OYE A;  1HKG A;  1GOC A;  1P8Z A;  5FPE A;  3R6M A;  3AA2 A;  4CJQ A;  3MXI A;  4H5R A;  2P1J A;  4E19 A;  4BRD A;  2FSK A;  4FJM A;  5C12 A;  4LFA K;  3HP9 A;  2YKN A;  5HLF A;  4M3W A;  1WLJ A;  1HNW K;  3IFR A;  5I42 A;  1QVG M;  3AVA A;  4DR4 K;  3OJU A;  2P9P B;  1JLA A;  3H1V X;  2ZM6 K;  3PX0 A;  3SPZ A;  4E7L A;  3C6H A;  3SBT A;  3JXU A;  1NK7 A;  4I6M B;  3Q7C A;  1UAX A;  1C0G A;  5AQX A;  4CIE A;  3CJ9 A;  1WN7 A;  3K57 A;  3TWH A;  2ASO A;  4GVM A;  3OHR A;  2YX6 A;  4CEZ A;  2RN2 A;  2YHA A;  3WNG A;  3AVG A;  1JCF A;  3PX6 A;  1VQM N;  2E5L K;  1IKW A;  2P9N B;  4LF4 K;  4LF8 K;  3IG1 A;  4B3S K;  4KHW A;  1L3V A;  5I9E B;  4FWQ A;  1NGI A;  4YOR A;  3ZT2 A;  4BR9 A;  1TV6 A;  1ASV A;  3V9Z A;  3T1H K;  3SQ1 A;  3BDP A;  3VTI A;  3L2W A;  1U49 A;  4UY8 O;  4B8A B;  4QS8 A;  2G8F A;  3UKU B;  4DF4 A;  4IFE A;  1D9D A;  1QTM A;  5EU7 A;  2XY8 A;  4IOA L;  3ZT4 A;  3VQ9 A;  3KJV A;  2HB5 A;  2E1Y A;  2P9I B;  4CFC A;  2HW3 A;  3FZK A;  4EZ6 A;  3LDN A;  3A5O C;  1BCM A;  1HKC A;  1V4T A;  4JI1 K;  4FW2 A;  1RDU A;  4DF8 A;  1Q8I A;  3LM9 A;  1U04 A;  3SLC A;  1IV0 A;  5C42 A;  3M8S A;  4F9O A;  1N8R O;  5AZJ B;  3SQ0 A;  1J5E K;  4CIF A;  4KHQ A;  3OVN A;  2OAN A;  1I3A A;  2X78 A;  3AVB A;  3VPZ A;  5BRF A;  4FPB A;  1YUW A;  4F8R A;  4JI0 K;  3EO3 A;  3OS1 A;  2PY5 A;  3IKM A;  4IJN A;  3HP6 A;  4CZM A;  4M42 A;  1HLU A;  5BRE A;  3AGK A;  2RKI A;  4B3O A;  3QFU A;  2KHO A;  1R59 O;  2D0C A;  4CZK A;  2A1S A;  3P83 D;  2ZE2 A;  1VSE A;  1B9F A;  5BRD A;  3QDK A;  3LL3 A;  3PV8 A;  1A5X A;  1DTQ A;  1KCF A;  2A42 A;  3V1Q A;  2O8C A;  4BRK A;  4M3X A;  4FWN A;  2QK9 A;  2HHX A;  4CZL A;  4K43 A;  1WSE A;  4DQI A;  2VWJ A;  4RTF D;  3BZK A;  4AF1 A;  4NB4 A;  3KKR A;  5HRR A;  3HVT A;  4ILG B;  4NCA A;  3QO9 A;  2OTJ N;  3J7A P;  4AM7 A;  3S3N A;  2Z1J A;  5HRO A;  4C8M A;  2QWL A;  3L2Q A;  3MN9 A;  5F0X A;  5EOY A;  4H0X B;  4FWP A;  3VQ6 A;  5AQQ A;  1ZBL A;  3D2E A;  3LAN A;  4DKW A;  3THX A;  1CZB A;  1FXX A;  2QWO A;  3WUH A;  1U48 A;  3DXK A;  4F4K A;  3B6P A;  4C8K A;  2W6L A;  4LF9 K;  4DQ8 A;  4JN4 A;  3CFO A;  3LZJ A;  3OYG A;  2RE2 A;  1KVC A;  5JS2 A;  2IVP A;  4HWI A;  3AVI A;  3DRS A;  1WBB A;  4ELU A;  4L8R B;  1HYS A;  3SUN A;  1T05 A;  4W5R A;  1QVF M;  4M41 A;  3NGI A;  2X74 A;  3UKR B;  5BPM A;  3ZX2 A;  2OPP A;  3KK3 A;  3O4Q A;  2X6S A;  4O0I A;  3J81 O;  5CYQ A;  3GBT A;  3VQA A;  4IFY A;  1XMQ K;  3CJB A;  3NF7 A;  3ZEU B;  1MWM A;  1TKT A;  1IG9 A;  1NOY A;  1EQY A;  4FWK A;  4NYF A;  1RDC A;  1C0T A;  3J8A A;  4ISG A;  4FK2 A;  1T03 A;  4CJ7 A;  3LDS A;  1NK4 A;  2IVN A;  3O9S A;  1NGH A;  1TYQ B;  4H0P A;  4DQR A;  1TK5 A;  4YNQ A;  4AH9 A;  4BQZ A;  3H3O B;  1KRP A;  1CXQ A;  4N41 A;  3ENH A;  2Z1G A;  4WQ4 A;  3ULE A;  1Q9X A;  1NGB A;  4O5B A;  3IUC A;  4JEP A;  3ULD A;  2A41 A;  3I0R A;  4WFN L;  5E41 A;  4IOC L;  4CCH A;  1WAJ A;  4ILH A;  3OS2 A;  5CZ2 A;  3EZ5 A;  4HHT A;  4JKA A;  4BC3 A;  3OY9 A;  1GLL O;  5ADX H;  1YVU A;  1RT2 A;  3TAG A;  4LY7 A;  4DV1 K;  1I94 K;  3FZH A;  2FBY A;  1QQN A;  3OYB A;  1BQM A;  2IIR A;  3PSF A;  4BE1 A;  2FBT A;  1BHL A;  3WNE A;  1TUY A;  4DS5 A;  4ISF A;  5FPN A;  2V51 B;  1Y64 A;  2UXD K;  1ASU A;  3M6G A;  2FXU A;  3AA4 A;  3L2U A;  5HBM A;  4NO7 A;  5AR0 A;  4H5V A;  4DR5 K;  2BH1 A;  4N56 A;  2HHT A;  3FFK B;  2Y1I A;  4ISE A;  3QBX A;  3W3D A;  1LAV A;  4DTN A;  1U4B A;  3NVM A;  1IKX A;  3TSU A;  2O8F A;  3S9H A;  5A2Q O;  4EIA A;  5F2R A;  3E9O A;  3HTV A;  1RFQ A;  1JLE A;  4DFJ A;  2OA8 A;  1HX1 A;  3UE5 A;  4WF9 L;  4DU3 A;  4IKF A;  3P5J A;  1YTU A;  4CHN A;  3CC7 N;  4B1U B;  4JK7 A;  1VRT A;  2VGM A;  5KRT A;  3SUP A;  4PL7 A;  1BWF O;  5I3U A;  1WSI A;  4YDU C;  1XUP O;  4AHU A;  1VQ7 N;  2O8B B;  2WOM A;  3OYL A;  3D2F A;  4KI6 A;  1RT6 A;  3HYF A;  3ZSZ A;  3DAW A;  2BDP A;  5C15 A;  4ZHR A;  1RT4 A;  3KLI A;  4LH4 A;  4B8C A;  1EXQ A;  3AVN A;  2OYQ A;  3BF3 A;  1KC8 O;  4CES A;  4BRM A;  4PKH A;  4IFV A;  1TKX A;  1NLV A;  3A5M C;  4E3S A;  5GAE P;  3ZSR A;  3P1G A;  2NLX A;  4WQ5 A;  3NGZ A;  1OH5 A;  3JS6 A;  3BEX A;  3QEP A;  2B5J A;  4OO1 J;  4CW7 B;  3MX5 A;  3L6Q A;  4DTP A;  2EWS A;  3PO4 A;  3IRX A;  5GIO A;  3HBT A;  1VQ8 N;  3O8M A;  2X6N A;  4GV3 A;  1VSL A;  1LAW A;  4FWR A;  2QWR A;  4PKI A;  4DLE A;  3DRP A;  3DXM A;  3FZL A;  4FWS A;  3K2P A;  2NRR A;  3OYM A;  4I2Q A;  1QQO A;  3QES A;  4OJR A;  2VWB A;  3HM9 A;  5D3G A;  4CJW A;  4CK3 A;  4CZI A;  4RW4 A;  4RWT A;  4CJ3 A;  3E9L A;  4DV5 K;  3C7N B;  3S41 A;  3NE6 A;  4FLU A;  3N4P A;  4DSE A;  1ILY A;  3W0L A;  1KLM A;  4O5F A;  4JI6 K;  4CER A;  1ZBI A;  5AQV A;  2GBZ A;  3TAN A;  4B9T A;  3MEE A;  4GW6 A;  3VF2 A;  3ITH A;  4WFB L;  4DFK A;  3A5L C;  3LWM A;  4M7X A;  3H1Q A;  4MLH A;  1XWL A;  3BP8 A;  4K42 A;  1K73 O;  3E9P A;  4DTR A;  1NK6 A;  4FK4 A;  1SL2 A;  1QZ5 A;  2VQF K;  1RDB A;  1YF5 L;  1SAZ A;  1W7A A;  3F5T A;  4CF1 A;  5BN9 A;  5EXW A;  1BI4 A;  2I7P A;  4BY9 C;  3OJS A;  2Q1N A;  1HPZ A;  3K0S A;  2OCE A;  3RR8 A;  1VSJ A;  1K8A O;  5KQ8 A;  4DFP A;  3SQ2 A;  2QI2 A;  3DI6 A;  4KBO A;  4FK0 A;  3LP3 A;  5M1O A;  2KLA A;  3KHY A;  3D0P A;  2CH6 A;  1UWB A;  4CJT A;  4MLE A;  3LP0 A;  3O3H A;  4Q0B A;  3OYF A;  1RDA A;  4OKJ A;  4CFA A;  1W2B M;  1SS6 A;  3U9Z A;  3C65 A;  3O5B A;  4FJJ A;  1VAZ A;  3B6O A;  4H0O A;  3NHG A;  4B08 A;  1CZA N;  1DLO A;  4M3T A;  2WTU A;  4CIG A;  4B9U A;  1HNI A;  4H5W A;  3NH0 A;  4OLA A;  3VMF B;  1BA1 A;  3M5R A;  2E8A A;  3CQY A;  4A57 A;  3CFR A;  1HUX A;  5AQS A;  4FO0 A;  5FPM A;  1GLB G;  3VES A;  4CHP A;  4M63 C;  2UUC K;  1Z25 A;  4Z4F A;  3CCV N;  1N34 K;  3TU5 A;  1LWF A;  4OPH A;  2Z1H A;  1YVN A;  3FGU A;  5M1F A;  3ZT0 A;  2XY5 A;  3QEV A;  2NZT A;  4LFC K;  3O9U A;  4LSN A;  3QER A;  4UQG A;  2KZZ A;  3HZ6 A;  4KKO A;  4JRQ A;  3VEW A;  3CYM A;  3VQP A;  5IT9 O;  4BDP A;  2E4L A;  4WCE L;  4FPA A;  3MXM A;  1B92 A;  1FKO A;  1HYV A;  2E2Q A;  4AHR A;  3EL2 A;  4CJ5 A;  1S1V A;  4DWI A;  1U45 A;  2F96 A;  3ZSX A;  3KZB A;  3HT3 A;  5JVG L;  1BIU A;  1E4F T;  4MFB A;  3CF5 L;  5KPZ A;  2UXC K;  1VSH A;  4PA1 A;  4DTX A;  1Z26 A;  3G4S N;  5C2D A;  3HOT A;  3O6W A;  2D4W A;  4OPJ A;  4CZH A;  3DLL L;  4DTJ A;  4LF7 K;  5FRO A;  3QNO A;  1HQU A;  1BGX T;  3NF9 A;  5DM7 L;  1RIL A;  1S1T A;  5F1X A;  4PY5 A;  5JS1 A;  2D0B A;  4JYA K;  3DLK A;  4H0T B;  3TAE A;  4FM2 A;  4O4G A;  4JK9 A;  1S6P A;  1DKG D;  1GLA G;  3K59 A;  1VQ9 N;  4CI6 A;  1BU6 O;  3MED A;  1NJZ A;  4BRI A;  4ID5 A;  1YAG A;  3NVK A;  4LF6 K;  5SZT A;  1VQO N;  1RDD A;  4BC5 A;  3QML A;  4B9L A;  2ZJQ L;  4BQL A;  3VTH A;  3MEG A;  2ZGZ A;  4B9S A;  4XH4 A;  1VQL N;  4KH5 A;  3NAE A;  3O1W A;  1Z05 A;  4CF0 A;  4LF5 K;  2Q3S A;  4CJR A;  4BGA A;  4DV6 K;  2E6M A;  2F8T A;  2ZGY A;  1S9G A;  3C95 A;  1GLF O;  5LJV A;  4FLT A;  5J2M A;  2YV0 X;  3OYA A;  2O8C B;  3LDQ A;  4MO4 A;  3VQQ A;  4QS9 A;  4BWJ A;  4J2D A;  3QIO A;  2UUB K;  3GG4 A;  4HCC A;  4CEC A;  4QCL A;  3JYT A;  4FJL A;  3AO2 A;  4KI4 A;  2ZD1 A;  3NBP A;  1KVA A;  2JLE A;  3RRG A;  1S5J A;  4NXM K;  1TUU A;  1RT7 A;  3V9W A;  1GOA A;  4L3Q A;  4IEI A;  4NLB A;  1VK0 A;  2ZQB A;  1HR0 K;  1F21 A;  4O44 A;  4O0J A;  2D0A A;  1EWR A;  3N4Q A;  4B3R K;  4OPK A;  1VSF A;  1VQ4 N;  1EO1 A;  3O1B A;  5LMN K;  5CZ1 A;  1NKE A;  4CHZ A;  1HJR A;  3D2E B;  3THX B;  4FJ9 A;  1JL1 A;  3HPO A;  3DXK B;  2G8I A;  5GAH P;  1EKE A;  4C23 A;  3QBW A;  4CZE A;  3LPT A;  2WFB A;  4CFB A;  1LW0 A;  2D0O A;  5EY4 A;  1T44 A;  2AP1 A;  3AA5 X;  4GNI A;  4CJF A;  1L3S A;  2NRH A;  2WBN A;  2O8E A;  4DSL A;  1LOT B;  5B8H A;  3QNN A;  3LP1 A;  4HVJ A;  1WUA A;  3SMP A;  5BRH A;  4EZ9 A;  4JK8 A;  2A3Z A;  3SAG A;  3O9R A;  1OVQ A;  3TSP A;  1TL1 A;  1NBW A;  4KH6 A;  5C2F A;  3WXK A;  1K6Y A;  4M45 A;  1OVY A;  3MEC A;  4YHH K;  4PHT X;  5HOO A;  1RTI A;  2W6K A;  3AY9 A;  5AQZ A;  1NJY A;  4CGG A;  2FBX A;  3SCX A;  1X9J A;  5LY3 A;  2PAV A;  4DTO A;  2NRW A;  2QW9 A;  4CEE A;  5E84 A;  1KAZ A;  3CM6 A;  2HVH A;  4W5T A;  1WAF A;  3QFP A;  2RF2 A;  3RSE A;  3TAF A;  3ZT3 A;  3PSI A;  3CFP A;  4KB1 A;  5KTQ A;  4RCH A;  2KKZ A;  2ATQ A;  4CD3 A;  4DHY A;  2HMI A;  3E1Y A;  3AGR A;  4JHD A;  3VGM A;  4I9Q A;  3ULE B;  4Z4C A;  1VQP N;  2BE2 A;  3ISN C;  1IKV A;  3TAM A;  1X9M A;  2IC3 A;  5AZI A;  2YNH A;  1XNR K;  3KKS A;  1YJW N;  3K5O A;  3C94 A;  3H3N O;  5LL6 Z;  1NK8 A;  1JCG A;  5AQM A;  4KV8 A;  4BR5 A;  3WEE A;  4E89 A;  1W0H A;  3FZM A;  2HF4 A;  3CCU N;  2FF3 B;  3ZYY X;  5ADX A;  3SV3 A;  3R1X A;  1Q82 O;  4DS4 A;  5AQG A;  2CGJ A;  1JCE A;  4A2B A;  5AQL A;  2AJQ A;  2D5R A;  4FJI A;  1NGF A;  1NJX A;  3WNF A;  4BRF A;  3DRR A;  4CZF A;  3M8P A;  3PIP L;  1ASW A;  1RBV A;  4HCB A;  5BPL A;  4V19 S;  3WQT A;  3D6R A;  4BRQ A;  3HK2 A;  1XNQ K;  1TKD A;  3VF4 A;  4AIL C;  1DT9 A;  1YHQ N;  3SAF A;  5FRN A;  2P9U A;  3CJ7 A;  2V7Z A;  2KZM A;  1ZXO A;  4BRN A;  4JLH A;  4YOX A;  1NGA A;  1RGI A;  3HPG A;  5KQD A;  3VQ8 A;  2O8F B;  1EET A;  1Z6R A;  2HOE A;  4LH5 A;  3AO4 A;  3QEX A;  1XMO K;  1S1U A;  1TAQ A;  4CF9 A;  5T7B A;  4XH1 A;  1ESV A;  1C1C A;  3LPU A;  1NGJ A;  5AQU A;  3FR0 A;  3UKU A;  3F9K A;  2DPN A;  3CCJ N;  1L3U A;  1BDG A;  4E7I A;  2QTD A;  4C8N A;  4WQ4 C;  1GLD G;  4CF2 A;  1HYZ A;  2PFU A;  4B3M K;  2FLO A;  3C0B A;  2CGK A;  3CCM N;  4C8O A;  3WXI A;  3HM8 A;  1HNV A;  4B9M A;  4KRE A;  1WB9 A;  3D2F B;  5JIC A;  5CY4 A;  4BRC A;  1WSF A;  3R3L A;  4DR1 K;  4YOY A;  5J2P A;  2E2P A;  3ATU A;  3WXL A;  4RW8 A;  1QSL A;  4B9N A;  3LAM A;  3V1O A;  1K8K A;  1ZYQ A;  1HRH A;  1J6Z A;  4IG3 A;  5JVH L;  3HO1 A;  5AQY A;  4PL8 A;  3MXJ A;  4Q5V A;  2YCH A;  3CJ1 A;  3CQ8 A;  1S72 N;  1VSD A;  1Q81 O;  1WNS A;  2FF6 A;  1JJ2 M;  3WNH A;  1NNE A;  1T6D A;  5K14 A;  3VET A;  3A5N C;  1D5A A;  4JKC A;  1ZC6 A;  3J7Y P;  1EWQ A;  2W41 A;  5J1E A;  1P90 A;  1NGG A;  2E2O A;  4DSI A;  4OX9 K;  2G8K A;  3ZET A;  3OYC A;  3ZLJ A;  3ENB A;  2O8D A;  3EKU A;  4B9V A;  4PQU A;  3THV A;  1RT3 A;  3U9D A;  3B8A X;  2ITM A;  3PO5 A;  2P9S A;  3MMV A;  2GX9 A;  2I5J A;  3NF6 A;  4U67 L;  4DUY K;  1ATR A;  2QEX N;  4DV7 K;  2E88 A;  2YKM A;  3RTV A;  4DTM A;  3CER A;  4M3Y A;  1CZ9 A;  3THY A;  2V52 B;  3KK1 A;  1UA1 A;  4FJX A;  1RBT A;  2PYJ A;  2ZJR L;  1Y97 A;  4B1W B;  2Z1I A;  2OPQ A;  1NMN A;  4CZG A;  3BZC A;  3THW A;  1NWK A;  3S3O A;  1Q7Y O;  1A5W A;  3WXJ A;  3EEQ A;  3QLH A;  1V4S A;  4CHO A;  4FZX C;  5KI6 A;  2GUP A;  3OYI A;  4WQ5 C;  4KHS A;  2HHV A;  3AAP A;  3LZI A;  1GOB A;  5AQJ A;  3ZCM A;  3SUQ A;  3KD5 E;  5BN8 A;  4CJK A;  1NMD A;  1JL2 A;  4DLG A;  2HBK A;  3O3F A;  4ILJ A;  3AVC A;  1S9E A;  4IO9 L;  2ZJP L;  3T1Y K;  4IBN A;  4BG8 A;  4BRH A;  1QS4 A;  1C0F A;  3NFA A;  4GV9 A;  3F2K A;  2VQE K;  1LWE A;  3ID8 A;  1KXP A;  3M8Q A;  4JKE A;  1BA0 A;  1U47 A;  1QQC A;  4H8K A;  4QAG A;  4AHT A;  4JD2 A;  4OLB A;  3KD1 E;  1YJN N;  3O3G A;  3O9Q A;  3P39 A;  4BRP A;  4IWV A;  4B1Z A;  5AQP A;  3CM5 A;  4I7F A;  4CK1 A;  5BR9 A;  4PKG A;  1XHX A;  3ZSO A;  3QET A;  3MN6 A;  3V6D A;  3FFI A;  1MWK A;  4BR7 A;  1JLC A;  2P9K A;  2A40 A;  3LDP A;  3CG7 A;  3PIO L;  3VEN A;  3FZF A;  3IMX A;  4IO8 A;  3D45 A;  3CJC A;  3NGY A;  3VN5 A;  4C8L A;  3ID6 A;  1S1W A;  4A61 A;  1VSM A;  4Y1D A;  4CJE A;  2LSN A;  1IKY A;  3HSC A;  4NLC A;  4JS5 A;  4I2P A;  2HBL A;  2Q31 A;  3HI0 A;  4E1N A;  4O8U A;  2E20 A;  3NCI A;  4LD0 A;  2NRT A;  2B4J A;  3CIP A;  1Q18 A;  5CYM A;  2FSN A;  3NMU A;  4FM1 A;  4FWO A;  3PLA A;  4JKF A;  1XC9 A;  3QIC A;  4X64 K;  1RBR A;  3LDL A;  3P4I A;  4E0D A;  3ZSQ A;  1JLG A;  4ELT A;  4JV5 K;  4CGI A;  3HXM A;  1M90 O;  3EYZ A;  4DQS A;  2HHS A;  1G99 A;  1WSG A;  1VHX A;  4FZZ A;  3S3M A;  2KW4 A;  3F73 A;  3KK2 A;  2UYT A;  4BE2 A;  1OH6 A;  3UIQ A;  4G9Z A;  2F9T A;  2GEL A;  1KAX A;  3MWT A;  3UB5 A;  4B1X B;  3L2R A;  4K0K K;  3CME N;  4FJG A;  2ASP A;  2GWJ A;  4EP4 A;  4JI7 K;  1Q86 O;  1O1W A;  4CJU A;  2V7Y A;  3KWG A;  5LMU K;  1C6V A;  2IDO A;  3IAY A;  1ZBH A;  1VSI A;  3VEZ A;  2F4V K;  1E4G T;  5M1P A;  5JLH A;  1YI2 N;  4GY2 B;  3OS0 A;  4JKG A;  3AV9 A;  1LV5 A;  3CCQ N;  2P9L A;  1SL0 A;  4WFA L;  4H5T A;  5HRN A;  2DFF A;  1IBK K;  4CGJ A;  5KPT A;  1XHZ A;  3SQ4 A;  4IXC A;  1YT3 A;  4RG8 A;  2GTD A;  3ASM A;  3OW2 M;  2Q0R A;  2DTU A;  3DLR A;  3KWI A;  3KTQ A;  4A2A A;  3IS9 A;  3D7E O;  5BPN A;  3DMJ A;  4IZ9 A;  3LWL A;  2VCP A;  1NKB A;  3NH1 A;  2PYL A;  2HHW A;  2QXF A;  4B1V A;  2BAN A;  4MO5 A;  4EHU A;  3GDQ A;  1TKZ A;  4CED A;  1I39 A;  1KQS M;  3MCA B;  2XY7 A;  1U2V A;  3M1F A;  3V9S A;  3GL1 A;  3SUO A;  4CVN E;  3MN7 A;  3QIP A;  4DR7 K;  4G1Q A;  4BE0 A;  2ITG A;  1LWC A;  4HTL A;  3WXM B;  3SPY A;  2HF3 A;  4KTQ A;  3V9U A;  3PY8 A;  2Q36 A;  4CBX A;  4MDA A;  5GAG P;  2YHW A;  4CGD A;  1R0A A;  2QWM A;  5CR4 A;  3K58 A;  3J80 O;  2E1Z A;  4DV2 K;  1VRU A;  3VEY A;  3KLE A;  3L2V A;  2JWK A;  3AVK A; 
#chains in the Genus database with same CATH homology
 3AVF A;  1J54 A;  4RW7 A;  4DQR A;  3OYD A;  2DY4 A;  1TK5 A;  5C25 A;  4YNQ A;  1RCH A;  4AH9 A;  4OKK A;  2EX3 A;  1NJY A;  4CGG A;  3E01 A;  1KRP A;  4F2R A;  2O4I A;  1CXQ A;  2FBX A;  3SCX A;  4N41 A;  4Y1C A;  2YNG A;  1JLF A;  4MQ3 A;  4DTO A;  4ELV A;  4Z4G A;  1DTT A;  2Z1G A;  4ICL A;  3SV4 A;  3KLF A;  1J9A A;  1T7P A;  1JXE A;  1Q9X A;  2W42 A;  4FJH A;  3I0S A;  4O5B A;  4CEE A;  2PZS A;  4FW1 A;  4I9L A;  3CM6 A;  2HVH A;  1WSH A;  3ULD A;  3RWU A;  4W5T A;  1WAF A;  2XRI A;  3I0R A;  4KHY A;  2RF2 A;  3TAF A;  5E41 A;  3ZT3 A;  1UA0 A;  4Z4H A;  2F8S A;  3CFP A;  4KB1 A;  4CCH A;  4QOZ B;  1WAJ A;  5KTQ A;  3OS2 A;  2ATQ A;  5CZ2 A;  4KHU A;  3EZ5 A;  4HHT A;  1MU2 A;  2HMI A;  3G0Z A;  1QSS A;  4K8X A;  3NDK A;  3OY9 A;  4CEO A;  3SYZ A;  1YVU A;  1RT2 A;  3EY1 A;  4OGC A;  3TAG A;  4LY7 A;  4I9Q A;  5HRP A;  4Z4C A;  3V1R A;  1EP4 A;  2BE2 A;  3ISN C;  3V4I A;  1IKV A;  3SI6 A;  4JS4 A;  2NUB A;  2FBY A;  3OYB A;  1BQM A;  2HND A;  4BE1 A;  3TAM A;  4DTU A;  2FBT A;  1X9M A;  2IC3 A;  1S6Q A;  4FJ7 A;  1BHL A;  3WNE A;  2YNH A;  4DS5 A;  2G8V A;  2IAJ A;  3AO5 A;  3KKS A;  3K5O A;  3C94 A;  4PUO A;  4DQQ A;  1NK8 A;  4NCG A;  4KV8 A;  4E89 A;  4KAZ A;  3LAL A;  3ZSY A;  1W0H A;  4OGE A;  5FRM A;  1SV5 A;  1NK9 A;  2DFE A;  3HST B;  1ASU A;  1L3T A;  2KFN A;  4RW9 A;  3AA4 A;  1FK9 A;  3L2U A;  3DOK A;  3SV3 A;  4CFD A;  4FYD A;  1HMV A;  5HBM A;  1D9F A;  4DS4 A;  4FJN A;  4IG0 A;  3SNN A;  3BGR A;  3V81 A;  2OZM A;  2AJQ A;  2D5R A;  4FJI A;  1X1P A;  4XIU A;  4FM0 A;  1NJX A;  3WNF A;  4N56 A;  2HHT A;  2Y1I A;  4CGH A;  1QE1 A;  3L3V A;  1J53 A;  3AO1 A;  3DRR A;  3M8P A;  1LAV A;  4DTN A;  1ASW A;  1YTA A;  1U4B A;  1IKX A;  2OZS A;  1RBV A;  4HCB A;  3DYA A;  3S9H A;  1ZBF A;  3AA3 A;  4HTU A;  2EHG A;  4RW6 A;  4IDK A;  3HK2 A;  4LSL A;  4M3U A;  1JLE A;  1TKD A;  4Z0U A;  4DFJ A;  3HVR A;  4AIL C;  2OA8 A;  2XO7 A;  3RR7 A;  5SWM A;  4OKE A;  4FVM A;  4DU3 A;  3TI0 A;  4IKF A;  5FRN A;  1RTD A;  3P5J A;  1YTU A;  2KZM A;  4CHN A;  2DFH A;  4H4M A;  1TAU A;  4R5P A;  4JLH A;  3AO3 A;  1BIS A;  4N5S A;  1VRT A;  3HPG A;  5KRT A;  3VQ8 A;  3SUP A;  3QEW A;  1W9H A;  5I3U A;  1WSI A;  1EET A;  4LH5 A;  4HUG A;  1CLQ A;  4AHU A;  3AO4 A;  3VQ4 A;  3QEX A;  1S1U A;  1TAQ A;  4CF9 A;  5T7B A;  1B9D A;  3MAQ A;  4K8Z A;  2WOM A;  1C1C A;  3LPU A;  3OYL A;  2QKB A;  3AVJ A;  4DG1 A;  1LW2 A;  4F3T A;  1SKS A;  3F9K A;  4KI6 A;  1RT6 A;  3HYF A;  3ZSZ A;  1L3U A;  2BDP A;  2HVI A;  4ZHR A;  2HNY A;  4E7I A;  1RT4 A;  3KLI A;  1HQE A;  4LH4 A;  4B8C A;  1EXQ A;  3LP2 A;  4W5O A;  2HHU A;  3AVN A;  4C8N A;  3SJJ A;  2OYQ A;  4FLX A;  1WSJ A;  4CF2 A;  4CES A;  1HYZ A;  4BAC A;  5HP1 A;  1KVB A;  4CJP A;  1C0U A;  4IFV A;  1TKX A;  4C8O A;  3TAP A;  4E3S A;  4CF8 A;  3ZSR A;  3P1G A;  3NGZ A;  1HNV A;  4Z4I A;  4B9M A;  2GV9 A;  4FZY A;  1TVR A;  4KRE A;  4ZTJ A;  4M3Z A;  1RBS A;  4E7K A;  2BGG A;  1NK4 A;  3QEP A;  4KHN A;  4AHC A;  2G8H A;  5CY4 A;  2B5J A;  1UOC A;  3QEI A;  4J2A A;  1WSF A;  4E7H A;  4KRF A;  4FCY A;  4J2E A;  5J2P A;  4W5Q A;  4DTP A;  4N76 A;  2A1R A;  2HHQ A;  4RW8 A;  4KFB A;  1QSL A;  3PO4 A;  3LAM A;  4B9N A;  3IRX A;  4FLW A;  3V1O A;  3RMB A;  1QSY A;  1ZYQ A;  2OPS A;  1SUQ A;  1X9S A;  2X6N A;  1HRH A;  1RNH A;  3AVM A;  1QHT A;  1SL1 A;  1VSL A;  1LAW A;  3SZ2 A;  1X9W A;  1VSK A;  4DLE A;  4IG3 A;  1C1B A;  3DRP A;  3HO1 A;  4BDY A;  4Z4E A;  5J2Q A;  2RPI A;  3K2P A;  3OYM A;  4TSX A;  4FJ5 A;  4I2Q A;  1NOZ A;  3AVH A;  4CJL A;  3QES A;  4OJR A;  3HPH A;  3MXJ A;  2Y1J A;  3HM9 A;  5D3G A;  4KTZ A;  3DM2 A;  1Q9Y A;  4CJW A;  4CK3 A;  4Q5V A;  4M3R A;  3CQ8 A;  4DSF A;  4AHV A;  1IH7 A;  4RW4 A;  4AHS A;  1VSD A;  4CJ3 A;  2JGU A;  4DMN A;  3V9X A;  1N6Q A;  1WNS A;  2GUI A;  3AVL A;  3OYK A;  3NE6 A;  4FLU A;  1G15 A;  3WNH A;  4DSE A;  3QIN A;  3VA0 A;  1KLM A;  5K14 A;  3OYN A;  3VQC A;  4DU1 A;  4CER A;  3NH2 A;  1C1A A;  2XHB A;  4CK2 A;  1ZBI A;  1D5A A;  2GBZ A;  3KLG A;  1RT1 A;  1TK0 A;  4EP5 A;  3TAN A;  4B9T A;  3MEE A;  4GW6 A;  3TAQ A;  5J1E A;  1BQN A;  3A2F A;  3ITH A;  4BWM A;  1NK5 A;  4DSI A;  4CJV A;  1TL3 A;  2YHB A;  4DFK A;  1ZBU A;  4CEF A;  2G8K A;  3OYC A;  3LWM A;  1ITG A;  1JXB A;  3ALY A;  1XWL A;  4F2S A;  3JSM A;  3HJF A;  1N5Y A;  4GMJ B;  4B9V A;  4PQU A;  3THV A;  5HRS A;  4FLZ A;  1RT3 A;  3T3F A;  3OYE A;  3PO5 A;  3VQ5 A;  5J2N A;  3TAR A;  4DTR A;  1GOC A;  1NK6 A;  3AA2 A;  4CJQ A;  3MXI A;  4FK4 A;  3L8B A;  1SL2 A;  3OYJ A;  1SKW A;  2P1J A;  5C24 A;  4E19 A;  2VG7 A;  1RDB A;  2I5J A;  3NF6 A;  3TAB A;  1RTH A;  4FJ8 A;  1NKC A;  2YKM A;  3RTV A;  4DTM A;  4FJM A;  4CF1 A;  4CEQ A;  1BI4 A;  4YFU A;  2G8U A;  3HP9 A;  4M3Y A;  1CZ9 A;  4O55 A;  2YKN A;  3KK1 A;  5HLF A;  4M3W A;  5KGX A;  1UA1 A;  4FJX A;  1WLJ A;  1RBT A;  3OJS A;  5I42 A;  2PYJ A;  1Y97 A;  2YNF A;  3AVA A;  1HPZ A;  2Z1I A;  2OPQ A;  3T1A A;  3G10 A;  3OJU A;  3U3Y A;  3RR8 A;  1VSJ A;  3LAK A;  3SQ2 A;  1JLA A;  4DFP A;  3PX0 A;  2IS3 A;  3DI6 A;  1C0M A;  3RMA A;  3SPZ A;  3S3O A;  4FK0 A;  3LP3 A;  1A5W A;  4E7L A;  3QLH A;  4CE9 A;  4BDZ A;  4CHO A;  4FZX C;  1NK7 A;  5KI6 A;  3D0P A;  1KSP A;  1UAX A;  1UWB A;  4CJT A;  4CIE A;  3LP0 A;  3OYI A;  3O3H A;  1WN7 A;  2WON A;  4KHS A;  3K57 A;  3OYF A;  1RDA A;  4CEB A;  4Q0B A;  4OKJ A;  3TWH A;  3U6F A;  3LZI A;  1GOB A;  3VQD A;  3ZCM A;  4CFA A;  3SUQ A;  3KD5 E;  4GVM A;  4CJK A;  4CEZ A;  3K5M A;  2VG5 A;  2VWK A;  1JL2 A;  2RN2 A;  4DLG A;  3O3F A;  4FJJ A;  3B6O A;  2YHA A;  3WNG A;  3AVG A;  3AVC A;  1S9E A;  3NHG A;  4B08 A;  3PX6 A;  1DLO A;  4M3T A;  4IBN A;  1QS4 A;  4CIG A;  1IKW A;  4B9U A;  3NFA A;  1HNI A;  3IG1 A;  1TK8 A;  1JKH A;  3NH0 A;  1LWE A;  4OLA A;  4E7J A;  4OVL A;  3M8Q A;  1U47 A;  4KHW A;  1QQC A;  2FBV A;  4QAG A;  4H8K A;  3PUF A;  3RMC A;  1NK0 A;  1L3V A;  3CFR A;  4DTS A;  4AHT A;  3ZT2 A;  3PX4 A;  4OLB A;  3KD1 E;  2YNI A;  4CHP A;  1TV6 A;  1ASV A;  3O3G A;  3V9Z A;  1Z25 A;  2HHV A;  3SQ1 A;  3BDP A;  4Z4F A;  1LWF A;  2Z1H A;  3L2W A;  3CM5 A;  2VG6 A;  4I7F A;  1U49 A;  4CK1 A;  4F3O A;  4B8A B;  2G8F A;  4DF4 A;  3ZT0 A;  2G8W A;  2XY5 A;  1XHX A;  4DFM A;  3ZSO A;  3QET A;  3QEV A;  3V6D A;  3FFI A;  3ZT1 A;  1QTM A;  1D9D A;  5EU7 A;  1JLC A;  2XY8 A;  1CXU A;  3CG7 A;  3K5N A;  1BCO A;  3ZT4 A;  3VQ9 A;  4LSN A;  3QER A;  3KJV A;  3DLE A;  3D45 A;  4KO0 A;  2HB5 A;  4UQG A;  1L5U A;  2KZZ A;  3NGY A;  4KKO A;  3VN5 A;  4CFC A;  2P51 A;  4C8L A;  4JRQ A;  3C6T A;  2HW3 A;  3CYM A;  3VQP A;  1EX4 A;  1S1W A;  4BDP A;  2E4L A;  1VSM A;  4Y1D A;  4CJE A;  3OYH A;  3MXM A;  1B92 A;  4ZTF A;  2LSN A;  4EZ6 A;  1IKY A;  1FKO A;  1HYV A;  3VQE A;  4PWD A;  1RBU A;  2KFZ A;  1BCM A;  4AHR A;  1KTQ A;  4CJ5 A;  4KB0 A;  1S1V A;  1NJW A;  4JS5 A;  4DWI A;  1U45 A;  2F96 A;  4FW2 A;  1RT5 A;  4I2P A;  3ZSX A;  4DF8 A;  4KPY A;  4E1N A;  3HT3 A;  4FLY A;  3NCI A;  1BIU A;  1Q8I A;  4LD0 A;  3H08 A;  4MFB A;  2R7Y A;  1U04 A;  1J5O A;  2B4J A;  5C42 A;  5CYM A;  3ZSW A;  3M8S A;  1T8E A;  4DQP A;  1VSH A;  4PA1 A;  4FJK A;  4FM1 A;  3SQ0 A;  4DTX A;  1Z26 A;  4DSK A;  3VQ7 A;  4CIF A;  4KHQ A;  3OVN A;  4H4O A;  4CGF A;  4OPJ A;  1I3A A;  2X78 A;  3AVB A;  4DTJ A;  3O4N A;  5FRO A;  3QNO A;  1XC9 A;  1HQU A;  2O4G A;  3RMD A;  4F8R A;  4CHQ A;  3HL8 A;  1BGX T;  3NF9 A;  3OS1 A;  1S1X A;  1RBR A;  2PY5 A;  4N47 A;  1RIL A;  3DOL A;  1S1T A;  4E0D A;  3ZSQ A;  1JLG A;  3HP6 A;  4PY5 A;  5JS1 A;  4ELT A;  2D0B A;  4CGI A;  3HXM A;  4M42 A;  3DLK A;  3TAE A;  2IOC A;  3EYZ A;  4FM2 A;  4DQS A;  2HHS A;  4O4G A;  1WSG A;  1S6P A;  4FZZ A;  3K59 A;  2RKI A;  3S3M A;  4B3O A;  2KW4 A;  2ETJ A;  3MED A;  2D0C A;  3F73 A;  1NJZ A;  2A1S A;  1JLQ A;  3KK2 A;  4BE2 A;  3UIQ A;  4ID5 A;  1XI1 A;  3P83 D;  4DU4 A;  3DLH A;  2ZE2 A;  5SZT A;  1RDD A;  1VSE A;  1B9F A;  4B9L A;  3MEG A;  4B9S A;  3NAE A;  1TGO A;  1A5X A;  1DTQ A;  1KCF A;  3T19 A;  3V1Q A;  3PV8 A;  3L2R A;  1A5V A;  4CF0 A;  4NYN A;  4M3X A;  3VA3 A;  2Q3S A;  4CJR A;  4FJG A;  2HNZ A;  3K5L A;  1D8Y A;  2E6M A;  3TR8 A;  4EP4 A;  2QK9 A;  2HHX A;  2F8T A;  1O1W A;  1BL3 A;  4CJU A;  1C6V A;  1S9G A;  2IDO A;  3C95 A;  4JRP A;  3IAY A;  4KTW A;  1ZBH A;  1VSI A;  1BIZ A;  1KFS A;  4E1M A;  1WSE A;  4DQI A;  2VWJ A;  4FLT A;  5FDL A;  5J2M A;  4CJS A;  2YV0 X;  3KKR A;  5HRR A;  3OS0 A;  3OYA A;  3HVT A;  4NCA A;  1BI4 B;  3NF8 A;  3QO9 A;  3VQQ A;  4BWJ A;  3AV9 A;  1LV5 A;  4J2D A;  3RRH A;  3QIO A;  5DMR A;  1SL0 A;  2KQ2 A;  3S3N A;  2Z1J A;  5HRO A;  3KLH A;  5HRN A;  2DFF A;  2FC0 A;  4C8M A;  4HCC A;  3L2Q A;  1JLB A;  4CEC A;  2QKK A;  4QCL A;  3JYT A;  4FJL A;  3AO2 A;  1RTJ A;  3M8R A;  1KLN A;  4KI4 A;  2ZD1 A;  3NBP A;  4CGJ A;  1KVA A;  1XHZ A;  3SQ4 A;  2JLE A;  3KIO A;  3VQ6 A;  4CJ4 A;  3RRG A;  1YT3 A;  1S5J A;  1ZBL A;  3LAN A;  1RT7 A;  3V9W A;  1CZB A;  4RG8 A;  1FXX A;  1GOA A;  1U48 A;  1VK0 A;  4WE1 A;  3ASM A;  3ZSV A;  3B6P A;  2ZQB A;  4F4K A;  2DTU A;  4C8K A;  1F21 A;  4O44 A;  4O0J A;  3DLR A;  3KTQ A;  2D0A A;  3DLB A;  5KRS A;  1IO2 A;  4ID1 A;  3IS9 A;  4OPK A;  1VSF A;  2P5O A;  3CFO A;  3LZJ A;  3DMJ A;  3OYG A;  4CHY A;  5KGW A;  4DSJ A;  4CEA A;  1KVC A;  4HUE A;  5CZ1 A;  3LWL A;  1SKR A;  5JS2 A;  1NKE A;  4CHZ A;  3AVI A;  3DRS A;  5DK5 A;  1HJR A;  3I8D A;  1NKB A;  2E6L A;  3VQB A;  3NH1 A;  2KTQ A;  4ELU A;  4L8R B;  2OPR A;  1HYS A;  3SUN A;  3DLG A;  1T05 A;  4FJ9 A;  4W5N A;  2PYL A;  2HHW A;  1JL1 A;  4W5R A;  2QXF A;  3HPO A;  4HUF A;  2G8I A;  2B6A A;  4M41 A;  1EKE A;  2BAN A;  3NGI A;  3LPT A;  2X74 A;  1KFD A;  2OPP A;  1LW0 A;  4CFB A;  3L3U A;  3AA5 X;  3KK3 A;  3O4Q A;  1TKZ A;  4CED A;  2X6S A;  3C6U A;  4CJF A;  1I39 A;  4O0I A;  1L3S A;  5CYQ A;  2XY7 A;  3V9S A;  3SUO A;  4FXD A;  3VQA A;  4FLV A;  2P5G A;  4DSL A;  4IFY A;  3QIP A;  4G1Q A;  3LP1 A;  3NF7 A;  3QNN A;  4BE0 A;  2ITG A;  1LWC A;  1FKP A;  1TKT A;  4HVJ A;  1IG9 A;  1NOY A;  4NCB A;  4NYF A;  3SPY A;  4KTQ A;  1RDC A;  3V9U A;  4EZ9 A;  4J2B A;  1C0T A;  3PY8 A;  1TL1 A;  3U3G A;  2XY6 A;  2IGI A;  4FK2 A;  1R0A A;  1T03 A;  4CGD A;  1REV A;  1K6Y A;  3K58 A;  4M45 A;  1VRU A;  3MEC A;  3KLE A;  3LDS A;  3L2V A;  3AVK A;  1RTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...