3WNHA

Cyclic hexapeptide pkzdnv in complex with hiv-1 integrase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
137
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
molecule keywords Gag-Pol polyprotein
total genus 48
structure length 137
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wnhA00
3OS0A 4HCCA 2GUIA 3PUFA 2KFZA 2E4LA 1WAJA 3RWUA 1ZBIA 3RRHA 4EZ6A 3NF6A 1LWEA 3PY8A 4CGFA 3RR8A 4CJEA 3LP2A 3DI6A 3ZT1A 4CJPA 4C8MA 4EP5A 4N56A 4CF9A 4EP4A 3HO1A 4CJTA 4KO0A 3M8SA 4HUFA 1KSPA 4OGCA 2WONA 1JLFA 3LP0A 2D0BA 4KV8A 1B9DA 1BISA 4JRPA 4FJKA 3KLGA 1N6QA 4CK3A 3HJFA 5KTQA 1RTDA 4LH5A 2XY7A 3OYLA 4DSJA 4FW1A 4ZTFA 1KLNA 2HNYA 4E1NA 3ZT3A 4DTOA 4M3TA 4KREA 4FYDA 3NDKA 4CIFA 5JS1A 4JS4A 1XC9A 4ELUA 1JXEA 2DFHA 4KB0A 3RRGA 3BDPA 2EX3A 2KTQA 3S3OA 3S3MA 2PYLA 1Z26A 4QAGA 5C42A 3VA0A 4FK2A 4B3OA 2HHUA 4CJQA 2PYJA 1C1BA 1VSHA 3HXMA 4J2DA 3SUOA 1KVCA 3NFAA 3KTQA 4CJUA 1XHZA 1RTHA 3RTVA 5HROA 3I0RA 5E41A 3ULDA 1EX4A 2DFEA 3ZSQA 4N5SA 4RW8A 1C1CA 3NGYA 1CZ9A 3ZSYA 3SYZA 3KK3A 3CM5A 4I9LA 2HNZA 3OY9A 4Q0BA 4DTPA 1JL2A 2XY6A 3QIPA 1NK5A 4F2SA 4Z4EA 3LWLA 1NJZA 4RG8A 2Z1JA 4ZTJA 5CZ2A 5FRNA 5C24A 4H8KA 4O4GA 1IG9A 4BDPA 2YHBA 3NHGA 2IDOA 4AH9A 2FBTA 4OKJA 2OZMA 1BHLA 3DRPA 3L3UA 1HRHA 3K2PA 2G8KA 3L2UA 1VK0A 4C8OA 3LPTA 4CEQA 1ZBHA 1HJRA 1ZBLA 3TAMA 3PO4A 1SL1A 2HHSA 4KTZA 3O3GA 1IO2A 3NH2A 3ITHA 2KQ2A 3HK2A 4RW9A 3SQ4A 1RBVA 3FFIA 1WSIA 4IG0A 3V9XA 3QESA 4E7LA 3OYFA 4B9TA 1BIUA 2RKIA 1HYSA 3TR8A 3V9WA 4CJSA 4FJMA 4DSKA 2B4JA 3V81A 5J2NA 4E7IA 3VQ5A 4F2RA 3HVTA 3ZSXA 1TVRA 3OJSA 2HHWA 3V4IA 4F8RA 4Z4HA 1NK4A 4CGJA 3L2QA 1HYZA 4RW4A 4B08A 1XHXA 1VRUA 1S1VA 3K5LA 3QLHA 5CY4A 2A1SA 4I2PA 4CHZA 3OYDA 3G0ZA 2FBYA 1FK9A 3SPYA 1NJXA 3AVHA 3NH1A 1NKEA 5FROA 1U49A 1RDCA 3PX4A 1FKOA 4OGEA 1QTMA 1SKRA 4FZXC 1NKCA 1VSDA 1EETA 4ID5A 1U48A 3VN5A 2KW4A 4N76A 1CZBA 1KLMA 3V1QA 3TWHA 3RMDA 2BGGA 2IS3A 5HRNA 1JLQA 1BQNA 4FJIA 1NK8A 3TAQA 3AO3A 3SQ2A 3QIOA 2RF2A 1TL1A 4DU3A 4CHOA 1TV6A 3THVA 3L3VA 3AA4A 3ALYA 1O1WA 4OPJA 3QEWA 1DTTA 4L8RB 2XHBA 2P5OA 1S1WA 5T7BA 1HYVA 4E1MA 4HTUA 3LP1A 4M41A 3KK1A 2YNGA 4DTJA 2ZD1A 4M3YA 5HBMA 4PY5A 3SQ0A 1S5JA 4JRQA 3VQ9A 3VQPA 4F3TA 3CFRA 3MXIA 4PWDA 4OJRA 3PV8A 2VG5A 4KAZA 1VSLA 3LANA 1BL3A 2OPRA 3U6FA 4E19A 2Z1GA 1ZBFA 2HVHA 4HVJA 3O3FA 2G8VA 3OYMA 4CEAA 1S6PA 3K59A 2YKNA 2KZMA 4CF8A 4LSLA 3DMJA 3V1RA 2HMIA 1IKXA 1VSKA 3D45A 3TI0A 3HL8A 1R0AA 4B9MA 2GV9A 4R5PA 3TAGA 1VRTA 4FJXA 4OKKA 3HPHA 1TK0A 4FK0A 3AO1A 2VWKA 4E7HA 3M8PA 1JL1A 1NOZA 1HPZA 4JS5A 4BDZA 4DSIA 3MAQA 2LSNA 4B9UA 3ZSZA 1YTUA 1QSSA 4Z4IA 3AA2A 4FM2A 1RBRA 1EP4A 2VG6A 4KI4A 3G10A 3RMBA 3KJVA 3M8RA 2W42A 1RDBA 1XI1A 2G8HA 3WNFA 1U47A 4DTRA 4DTNA 3NF8A 4M3WA 4CJFA 4AHTA 1SL2A 3NBPA 2D0CA 5KGXA 1BCMA 3IS9A 2OPPA 4KHSA 4XIUA 4J2BA 3CFPA 3VQ6A 2PY5A 1HQEA 4DG1A 1RNHA 4CEOA 4CFCA 3RMAA 1BQMA 4M42A 4KHWA 4F3OA 3U3YA 4H4MA 4E7KA 2AJQA 3SUPA 1F21A 1RT2A 3HP9A 1IKWA 1WSHA 2DFFA 1NKBA 4C8LA 3TANA 3V9ZA 5I42A 1SL0A 3VQ4A 4ELTA 4F4KA 1YTAA 3SUNA 2F96A 3AVNA 4W5OA 1RTIA 3LDSA 1C1AA 2YV0X 3I8DA 3DLRA 4J2EA 4B8AB 4DU4A 4W5TA 4FLTA 1NK9A 5K14A 1A5VA 2B5JA 3AO2A 3TAPA 4O0JA 4BE0A 4CF2A 4FJLA 5DMRA 1L3VA 1GOAA 4LY7A 4B9SA 2X6NA 1GOBA 4OLBA 1L3SA 4GW6A 4DTSA 1TGOA 4DQQA 3M8QA 2D0AA 3OYCA 1RDAA 2F8SA 4BACA 1X9MA 4CFAA 4C8KA 3L2VA 1HMVA 1REVA 1JXBA 5C25A 1LWFA 3AVBA 3OYIA 1IH7A 1WSGA 4AHVA 3MECA 2IOCA 3OS1A 1NJYA 4QOZB 3ZSWA 3EY1A 2IC3A 4FLYA 1RDDA 4OKEA 4DQIA 2G8UA 3HT3A 4C8NA 3WNHA 4CF1A 4DLGA 4DS5A 4O44A 4HUGA 4CGDA 3E01A 3QERA 3HPGA 3ISNC 3QNNA 4QCLA 1RBSA 3K58A 2FBXA 3LZJA 1S9EA 3VQAA 4CFDA 4KHQA 4IKFA 1S1TA 1Y97A 4W5RA 3OS2A 1KFSA 1NJWA 3QO9A 4CEDA 4AHRA 3LAKA 1LV5A 2G8IA 3QEVA 4J2AA 3AO4A 1WN7A 3HM9A 3LWMA 4KHYA 1KFDA 2KFNA 3V9UA 3AVLA 3I0SA 3ZT0A 3QNOA 1RBTA 1JLGA 1WSJA 2XRIA 3DOLA 3KIOA 4W5QA 2QKKA 1JLCA 1S6QA 2I5JA 4CJWA 2R7YA 2QK9A 2O4IA 3B6PA 3C95A 1VSEA 3OYNA 4FJ7A 3ZCMA 3A2FA 3DOKA 3CYMA 3CQ8A 3QETA 3SZ2A 4FZZA 4E3SA 4FCYA 1RT1A 1D9FA 3RR7A 1UWBA 4CJ4A 2E6MA 1J9AA 3DLKA 1JKHA 1TKZA 1FXXA 4JLHA 1WSFA 1MU2A 3AVMA 4BDYA 5J1EA 3AV9A 5J2MA 4M3XA 4N47A 4IBNA 4DWIA 2OPQA 1IKYA 3JSMA 1VSMA 1QSYA 4N41A 1RBUA 2ZQBA 4IFYA 4LH4A 4CJRA 5J2PA 3CM6A 4DTMA 4LD0A 3QEXA 3QEPA 3WNGA 3SNNA 3TAFA 3ZT2A 1U04A 3QEIA 1RT4A 1U4BA 2KZZA 3EYZA 1TKXA 3NF7A 1X1PA 2EHGA 4FW2A 1J5OA 4FJ9A 4M45A 4WE1A 3OVNA 2O4GA 2QXFA 1T03A 1KVBA 2Q3SA 3SQ1A 1SV5A 3DYAA 1YT3A 3VQDA 5HP1A 3U3GA 4CHNA 3HVRA 4FM0A 3AA3A 1UA0A 3O3HA 4E0DA 4ELVA 4CK2A 4UQGA 3V1OA 4DLEA 4IDKA 5I3UA 1SUQA 3DLBA 1D9DA 4AILC 3MEEA 3ZSVA 1RILA 4CIEA 3KLHA 2YNIA 3P83D 3SJJA 1KTQA 4Z0UA 1TK8A 1NK6A 1DTQA 3K57A 3C6UA 2JLEA 1Q9XA 4OVLA 4KKOA 4ID1A 2YKMA 1C0UA 3LP3A 4AHUA 4CJVA 3OYGA 3PX6A 3TABA 2G8WA 4FZYA 3DRRA 1GOCA 3PO5A 1C0TA 1ZYQA 5CYMA 3HSTB 2HB5A 4B9NA 5SZTA 1Z25A 3KKSA 2OPSA 4BWMA 1LWCA 4FVMA 1A5XA 4MFBA 1TAQA 3T19A 5HRPA 4O5BA 1SKSA 1HNVA 1QHTA 2HNDA 1Q8IA 1C0MA 1I3AA 1WAFA 4LSNA 4RW6A 4TSXA 4ZHRA 1TAUA 3AO5A 1DLOA 4H4OA 2A1RA 4CERA 4NCBA 3OYEA 2P5GA 5FDLA 3OYKA 4FK4A 3S3NA 4Y1CA 5KRTA 3CG7A 3L2WA 2WOMA 3JYTA 2DTUA 3F9KA 3OYAA 4DSEA 3DM2A 1QE1A 5SWMA 4CGIA 1RCHA 2YNFA 4FJGA 4K8ZA 2G8FA 4KB1A 2FBVA 2NUBA 4B9LA 4I7FA 3KD1E 4KFBA 1BGXT 3B6OA 3LPUA 3EZ5A 3MEDA 4YNQA 3ASMA 3SI6A 1ASWA 1T8EA 3UIQA 3TAEA 2Z1IA 3DLHA 5D3GA 1WSEA 2Y1JA 3DRSA 3P1GA 4GVMA 2ATQA 4ICLA 1RT7A 4PA1A 3MEGA 5CZ1A 4BWJA 4CGHA 4CEFA 4FLXA 4YFUA 3P5JA 3S9HA 1UAXA 2IGIA 4FJHA 4KRFA 2ZE2A 4CHPA 4RW7A 4PQUA 3VQ8A 5HRSA 4G1QA 2PZSA 1HQUA 3AVJA 3HPOA 3V6DA 4KTQA 1FKPA 4IG3A 3NGIA 2OYQA 4AHCA 2P1JA 1BI4A 4CEBA 3NAEA 3LZIA 2OZSA 2B6AA 3VQ7A 4CFBA 4DTXA 1TKDA 2ETJA 5EU7A 3LALA 4NYFA 4M3RA 2X74A 4AHSA 1TL3A 1D8YA 2JGUA 2X6SA 4FLWA 3H08A 4PUOA 4I2QA 4IFVA 3KKRA 1LAWA 5KI6A 3DLEA 4CEEA 4CF0A 3NF9A 3V9SA 3VA3A 4DFKA 3OYHA 4E7JA 4FJ8A 5FRMA 2RPIA 3KLIA 1S1XA 1VSJA 3OYJA 1RTJA 1ZBUA 1YVUA 3SUQA 1LW2A 1C6VA 1Q9YA 1EXQA 3C94A 3AVFA 1NK0A 3KLEA 3DLGA 1D5AA 1W0HA 4CGGA 1S9GA 4NYNA 3RMCA 4DQPA 1KCFA 3T3FA 3ZSRA 3ZT4A 4BE2A 4CJLA 3ZSOA 1IKVA 2P51A 4DS4A 2VG7A 4CIGA 1JLBA 3MXJA 3QINA 4HCBA 5CYQA 1WNSA 1CXQA 4FJNA 4Z4GA 2YNHA 4CHYA 4HHTA 1RT5A 1KVAA 1QS4A 2FC0A 4DSFA 1X9WA 1K6YA 2IAJA 4DSLA 3F73A 4DF4A 1NOYA 1T7PA 3TARA 4MQ3A 3PX0A 1CXUA 2XY8A 3IRXA 4CHQA 1JLEA 4DFJA 2VWJA 1S1UA 3VQCA 3NH0A 2Y1IA 2RN2A 3IAYA 2HW3A 3AA5X 2OA8A 3LAMA 3AVCA 1VSFA 2D5RA 4B8CA 1U45A 1BI4B 1RT3A 3AVAA 3SV3A 1L3UA 1ITGA 5KGWA 4BE1A 3AVKA 4FXDA 4CK1A 1I39A 4OPKA 4CJ3A 1VSIA 4DFMA 1HNIA 3SPZA 3OYBA 3C6TA 3KLFA 2XO7A 3BGRA 3HP6A 3KD5E 4K8XA 2QKBA 1W9HA 1RT6A 3WNEA 5DK5A 4E89A 2YHAA 4DMNA 4CEZA 4I9QA 1A5WA 3AVGA 4KTWA 1TK5A 3HYFA 4DF8A 4FLUA 4DU1A 4B9VA 4KI6A 1ASVA 4CJKA 1QQCA 4CECA 4KPYA 3MXMA 5KRSA 3T1AA 1L3TA 4NCAA 4OLAA 4DTUA 5J2QA 4NCGA 4EZ9A 3IG1A 4O55A 3VQEA 4FLZA 4FLVA 4CCHA 2HVIA 3SCXA 2BDPA 1J53A 2HHTA 1T05A 3OJUA 4W5NA 2E6LA 1L5UA 3VQBA 2ITGA 4FM1A 5HLFA 1CLQA 1N5YA 2XY5A 2HHQA 1TKTA 1LW0A 1UA1A 4KHUA 4DQRA 1BIZA 1NK7A 3O4QA 2X78A 3K5MA 3O4NA 4M3ZA 2BANA 3NCIA 1ASUA 4KHNA 4CJ5A 4Z4CA 1JLAA 4CE9A 2BE2A 4FJ5A 1G15A 3L2RA 3SV4A 2DY4A 3CFOA 5JS2A 3NGZA 4DFPA 4DQSA 1SKWA 1X9SA 4Q5VA 4HUEA 1KRPA 1B9FA 4GMJB 4O0IA 2HHVA 1J54A 4Z4FA 3D0PA 4Y1DA 1XWLA 2HHXA 2GBZA 3K5OA 3KK2A 3L8BA 3AVIA 3K5NA 1WLJA 1BCOA 1UOCA 2F8TA 1LAVA 4CESA 3NE6A 1B92A 1EKEA 3VQQA 4FJJA 5HRRA 2Z1HA 4M3UA 1QSLA
chains in the Genus database with same CATH superfamily
3OS0A 2GUIA 3DXKB 3ZYYX 2KKZA 3RRHA 1NGCA 2VWBA 3RR8A 3CJBA 3DI6A 4CJPA 4C8MA 4N56A 2HBKA 3HO1A 4KO0A 4XH4A 1JLFA 4BR2A 2D0BA 4FJKA 1BISA 4FVUA 3HJFA 5KTQA 5AQRA 4DSJA 2QWNA 4FW1A 3O1WA 4DTOA 3TSPA 1NWKA 4CIFA 4NXMK 4E1JA 1NGFA 1VQLN 1GLBG 2NRWA 4BG8A 2KTQA 4WQ5C 5C42A 4K0KK 3UKRA 5FPDA 2P9KB 4CJUA 1XHZA 2W6KA 1Q86O 1IBMK 3ULEB 3ULDA 1RDWX 3CM5A 5KQDA 2HNZA 3QIPA 4DR4K 4F2SA 4Z4EA 4NO7A 4RG8A 3DXKA 5CZ2A 4BDPA 2YHBA 2V7ZA 4AH9A 4X66K 4OKJA 4WFBL 2OZMA 3DRPA 3L3UA 2G8KA 3L2UA 1VK0A 4C8OA 4KH4A 1QZ5A 3FZFA 1ZBHA 1HJRA 3KK7A 2WBNA 2HHSA 1IO2A 3G25A 2KQ2A 4RW9A 2W41A 3U8XA 3CI5A 3OYFA 5M1OA 1OKJA 3AY9A 1BIUA 3TR8A 4FJMA 2HF3A 1X3NA 1VQPN 1VQKN 3V81A 4YOWA 4B1ZA 3VQ5A 3HVTA 3ZSXA 3SBGA 3VEZA 1OH8A 4LFCK 1HYZA 3ULEA 4B08A 4YDUA 2P9NB 3OYDA 3EN9A 3FE1A 2FBYA 5BRDA 1NJXA 4NXNK 2E1ZA 5DM6L 4ID5A 4BRGA 1P8ZA 1J6ZA 4JHDB 3VN5A 3UKUA 1CZBA 3RMDA 4L3QA 2IS3A 2Q1NA 1BQNA 1TL1A 4CJ7A 1W97L 4JKEA 3IUCA 1DKGD 4BRPA 4BRIA 4M3YA 4CD3A 2ZD1A 4DTJA 5HBMA 1QQNA 3PV8A 3CCLN 2OPRA 3AGRA 1ZBFA 3O3FA 3K59A 1S6PA 2KZMA 1IKXA 3TI0A 1R0AA 2GV9A 4B3RK 4FJXA 5LJWA 2HMPA 5C12A 1S72N 1JL1A 3MN7A 1EWRA 3K0SA 1YTUA 3GG4A 4BVPA 1EP4A 3M8RA 2OTJN 5C15A 5JLFA 1U47A 4BRHA 1J5EK 1E3MA 2Q2RA 4CJFA 2Q97A 3NBPA 5KGXA 4WFNL 1LCUA 3CETA 4J2BA 1WUAA 1RNHA 3NVKA 3RMAA 1BQMA 2AJQA 1F21A 1U2VA 3HP9A 1IKWA 1NNEA 3TANA 1YJWN 1YTAA 3A8YA 3AVNA 5BPNA 4W5OA 2O8DA 1YAGA 1C1AA 2P9UA 3MMVA 1A5VA 3TAPA 3GOIA 1TUYA 3VF6A 3H3NO 5ADXH 5DMRA 3LM9A 4BRMA 3WT0A 5AQQA 3OYCA 1QQOA 1RDAA 1NGHA 1ILYA 5C25A 1LWFA 1IH7A 5CE3A 4AHVA 1GLEG 4YDUC 2WC9A 2ZGZA 4DQIA 4DLGA 3QERA 5TKWA 3ISNC 3IFRA 3VQAA 4CFDA 4IKFA 4LFBK 1S1TA 4W5RA 4RCHA 1KFSA 3BF3A 1XMOK 3QEVA 4DV6K 3HM9A 3QFPA 4KHYA 2KFNA 2E2QA 2XRIA 1BWFO 2NRHA 4CJWA 2WFBA 2ITMA 4FJ7A 4WQ4C 3ZCMA 3A2FA 5LL6Z 3CYMA 4R79A 3RR7A 5AQOA 2QI2A 2E6MA 5J1EA 5M1NA 1OVQA 4N47A 4IBNA 3T7ZA 4DWIA 3CM6A 4DTMA 3CCQN 3D2EB 2GTDA 3VETA 2KZZA 2Q31A 2E2OA 1M1KO 1SV5A 3DYAA 1YT3A 5HP1A 4DV7K 3WXIA 1SUQA 3DLBA 3ZSVA 3E9PA 3KLHA 4CZKA 3P83D 4Z0UA 5BN9A 3THXA 1DTQA 1Q9XA 4OVLA 4KKOA 3OYGA 3CCMN 3ZLJA 4B9NA 3W3DA 2P9PA 5SZTA 1N32K 1SKSA 1LWCA 5HRPA 4JI8K 1N33K 4IEIA 2HNDA 1WAFA 3EKSA 1U2VB 4NCBA 2FSJA 1QHAA 2OTLN 5JICA 3DAWA 2NLXA 2P5GA 3LM2A 4BC2A 5KRTA 2A40A 2WOMA 3OYAA 3WXLA 3DM2A 4ILGB 5SWMA 4FJGA 2G8FA 4BRNA 4B9LA 1BGXT 4PKHA 3MEDA 4YNQA 3ASMA 3SI6A 4YOXA 5AZIA 1K8KB 2P9PB 5D3GA 3DRSA 2QK9A 4PA1A 1IBLK 3MEGA 4FLXA 3P5JA 3DJCA 1UAXA 1MDUB 2ZE2A 4G1QA 3V6DA 4FWOA 2FLOA 4AHCA 2P1JA 4CEBA 4JD2A 3GL1A 4V19S 2YJFA 2B6AA 2QEXN 1GLFO 5EU7A 3LALA 4J8FA 4JI1K 4AHSA 3TU5A 1TL3A 2X6SA 4U7BA 3SAHA 2F9TA 1P90A 4IFVA 3KKRA 4X64K 4FJ8A 4M7YA 1SS6A 4ILJA 2RPIA 1VSJA 3OYJA 3O4WA 4LF6K 1LW2A 1NK0A 4CZEA 4CGGA 2YHXA 1KCFA 3ZT4A 5AZJA 3ZSOA 4AQYK 1NG9A 4FWPA 5CYQA 4FJNA 2GWKA 3D2EA 2YNHA 5C2DA 2FC0A 1K6YA 4YY3K 2Q0UA 4DF4A 3TARA 1VAZA 2KHOA 3PX0A 1BU6O 2XY8A 3IRXA 5JVGL 3NH0A 2Y1IA 2UUBK 4B8CA 1VSFA 2D5RA 1YXQA 1RT3A 4JKFA 1IJJA 4GNIA 2QTDA 5KGWA 4YOTA 5JLHA 3CJAA 4FXDA 4OPKA 1WBDA 4LF7K 4CVNE 2YHYA 4YOUA 1JCGA 1OVYA 3MK6A 4K8XA 1W9HA 4X62K 3H45C 5AQKA 3I56N 4I9QA 4KTWA 3FZLA 4DF8A 1ASVA 4CJKA 5F2RA 3MXMA 5KRSA 1L3TA 4NCAA 3GDQA 4BR5A 4DTUA 2A42A 2W40A 3IG1A 4FLVA 3K9JA 4JV5K 1L5UA 5HLFA 1N5YA 1YJ9N 1MWMA 3PLAA 3HOTA 4DQRA 1ATSA 2D1KA 2BANA 4FWLA 3L4QA 5BPMA 1ASUA 1HKGA 2GUPA 2VYPA 1G15A 3L2RA 3UKUB 3CFOA 1SAZA 3NGZA 1XQSC 4FWNA 1SKWA 4WF9L 1T44A 4Z4FA 4Y1DA 1XWLA 1VQ9N 3CJ7A 2HHXA 3K5OA 4H0VB 4DUYK 2FSNA 3UKRB 2AA4A 4B1VA 3NE6A 1EKEA 4FJJA 2NNWA 3MWPA 2Z1HA 4HCCA 3C7NB 3HM8A 4MDAA 4LFAK 2KFZA 1WAJA 4B3TK 3NF6A 4CJEA 4EP5A 2UXBK 3I55N 3D2FA 2NRXA 4CF9A 4EP4A 2ZJQL 1KSPA 4OGCA 4CZIA 4FWSA 4DV0K 1B9DA 4IOAL 3KLGA 4X65K 3CD6N 1N6QA 4CK3A 4HTLA 3OYLA 1VHXA 3CERA 4BR0A 4M3TA 1XC9A 4ELUA 3FZKA 3RRGA 2V51B 3BDPA 2QWRA 3S3OA 2NZTA 4YHHK 5A2QO 1C1BA 3HXMA 4JYAK 1O13A 3KTQA 1E4GT 3ENOA 3I0RA 3QMLA 4RW8A 3LDNA 1CZ9A 1Q81O 3MWTA 3UB5A 3T1YK 3L6QA 3FGUA 3LDOA 1NJZA 3THWB 5GAHP 4ZTJA 5AZIB 5FRNA 1IG9A 4O4GA 1NGAA 2FBTA 3CMAN 2QWLA 2HOEA 3G6EN 3HBTA 2NRRA 3EE8A 3BP8A 1ZBLA 5IT9O 3H1QA 3T69A 3NH2A 3HK2A 2QXLA 3SQ4A 3QESA 4E7LA 4K41A 3DWLA 1HYSA 1Z6RA 3O9TA 3SK3A 2YJEA 4WYBA 4CJSA 1YI2N 4DSKA 5HL7L 4F2RA 3A5OC 5F1XA 1IBKK 3I33A 4JKDA 3V4IA 1TUUA 5AQXA 3JS6A 1NK4A 2GX9A 4CHZA 1YF5L 4Y0WA 5M1PA 2EWSA 1NKEA 3K9KA 3WXJA 1U49A 1QTMA 1SKRA 1NKCA 3V1QA 4DR6K 4FJIA 1NK8A 5AQWA 3VEVA 3IKMA 4IO9L 2NRTA 3L3VA 3AA4A 1O1WA 2YI1A 2E1YA 2P5OA 1S1WA 4FSVA 4JI6K 4E1MA 4M41A 3CC2N 1S5JA 3OBWA 3VQ9A 3MXIA 3MCAB 3VGLA 1YVNA 1BL3A 3LANA 4E19A 2Z1GA 4HVJA 2G8VA 3OYMA 4CEAA 5AQUA 2RE2A 4LSLA 3DMJA 4G9ZA 3VEXA 3OBYA 4B9MA 3O8MA 3OW2M 1KAZA 3TAGA 3HPHA 1TK0A 2VWKA 2P9IB 4E7HA 2QWQA 1NGJA 4JS5A 3MAQA 1K8AO 2A6AA 3CF5L 4Z4IA 3AA2A 4FM2A 3VENA 4H0OA 4KI4A 3G10A 4JKBA 2W42A 1RDBA 2ASOA 2G8HA 3PSFA 4O5FA 4DTNA 4M3WA 1SL2A 2D0CA 1BCMA 3IS9A 1NMNA 2IVNA 4LF5K 2P9SA 1VQ6N 1QQMA 1KD1O 2QM1A 4JAXA 4H5NA 3V9ZA 1SL0A 3SUNA 2F96A 3J7AP 1T3VA 4DV2K 4PHTX 3DLRA 5C0YA 5M1KA 2BUPA 4W5TA 4FLTA 2O8FB 3P38A 1GOAA 4B9SA 2X6NA 1L3SA 4GW6A 4DTSA 4DQQA 2D0AA 2F8SA 4BACA 1HX1A 1X9MA 1XMQK 1REVA 3CC4N 1WSGA 3OS1A 3MECA 2IOCA 4NLCA 1NJYA 4QOZB 3ZSWA 4OKEA 2G8UA 4B9QA 4C8NA 4CF1A 3HT3A 4DS5A 3E01A 3O9UA 2JWKA 1S9EA 4H5WA 1Y97A 2HF4A 3H6EA 1NJWA 1FJGK 3QO9A 3LAKA 4J2AA 2E8AA 3CCJN 3V9UA 3QNOA 1RBTA 3DOLA 4A62A 4W5QA 5TKYA 2DPNA 1X9JA 3C65A 1S6QA 4MO5A 3H46O 3OYNA 3CJCA 3DOKA 1QVFM 3CQ8A 4FZZA 1C0FA 1TKZA 1WSFA 3AVMA 2QA4N 5J2MA 2O4IA 2OPQA 4KBOA 2O8FA 3QEXA 5BPLA 3WNGA 3SNNA 3QEIA 1U04A 1T6CA 1U4BA 3FFKB 4BRCA 1X1PA 1J5OA 3AGKA 3OVNA 4IO8A 1GLCG 2Q0RA 3TTFA 2HBMA 4CHNA 3HVRA 1UA0A 4BQLA 3MN6A 1NJIO 4ELVA 3SJJA 5KPZA 3PIPL 5C10A 3K57A 3O5BA 1NM1A 1WB9A 4ID1A 4AHUA 1C0UA 3TABA 4FO0A 4BR7A 4IJAA 3PO5A 1C0TA 3CHWA 5CYMA 3ENHA 1CZAN 4YORA 1Z25A 3IDHA 2OPSA 4BWMA 5E26A 3T19A 4CZHA 4O5BA 1HNVA 1C0MA 1I3AA 1KXPA 4BVOA 5F0XA 5FPNA 5EX5A 2E2PA 3OYEA 3WUHA 3OYKA 4Y1CA 1BO5O 3CG7A 3VGMA 3L2WA 3JYTA 5ELZA 1NGDA 2YNFA 2I7NA 4K8ZA 4KHPK 3O6WA 3KD1E 3LPUA 4CZMA 5JMVA 3DLHA 2Z1IA 1HUXA 2IIRA 3P1GA 2ATQA 3S9HA 4FJHA 3C7NA 4RW7A 3VQ8A 4LC9B 1KC8O 2CGKA 2PZSA 1HQUA 4PKIA 3FLCO 1FKPA 1U6ZA 1BI4A 3NAEA 2OZSA 4JHDA 1TKDA 1D8YA 2H3GX 1WBBA 2PFUA 4I2QA 5LY3A 5KI6A 4CEEA 3V9SA 3VA3A 4NB4A 3U9DA 4EAHD 1YVUA 1EXQA 3C94A 3AVFA 4EHUA 3ZX2A 1NMDA 3KLEA 1D5AA 1EQYA 4NYNA 2HBJA 3RMCA 3WQUA 1IKVA 2P51A 3U9ZA 5E84A 1QZ6A 4MLEA 1CXQA 4CHYA 4HHTA 4DSFA 1X9WA 2IAJA 4DSLA 1NOYA 3OHRA 2CGLA 4JEPA 1JLEA 2ASMA 1S1UA 4PL7A 3VQCA 3CC7N 3IAYA 2RN2A 5H1SQ 3LAMA 3AVCA 3VOVA 1BI4B 1SQKA 3ZEUA 1L3UA 2PAVA 2VQFK 4DV3K 3SPZA 3KLFA 3BGRA 5FLXO 1VQ8N 2QKBA 3WNEA 3BZCA 4FWKA 3HYFA 4QS9A 4KI6A 4B9VA 4BQZA 1QQCA 4KPYA 4M63C 4H5RA 5J2QA 1VQNN 5KQ8A 4NCGA 4EZ9A 4FLZA 3THYB 1MWKA 2BDPA 1NGEA 1T05A 3OJUA 2GWJA 3A0IX 4FM1A 2ITGA 1CLQA 2XY5A 3TPQA 1LW0A 1X3MA 1NK7A 3O4QA 3O4NA 4IFEA 3B8AX 2QWMA 4JKGB 2E20A 4CJ5A 3C0BA 3J81O 3SV4A 3O9SA 1VQ4N 5JS2A 3HI0A 1X9SA 1KRPA 2P9LB 1J54A 5GIPA 2GBZA 3AVIA 3K5NA 3M5RA 5BRHA 1HLUA 5EOYA 3PIOL 3GBTA 4IOXA 4W5NA 4M3UA 5GAGP 3PUFA 5BREA 3RWUA 1LWEA 3PY8A 4IEEA 3VF4A 3M8SA 4HUFA 4CW7B 2WONA 2YX6A 3LL3A 2XY7A 1GLAG 4OPAA 5EXWA 4ZTFA 4H0YB 3ZT3A 4BGAA 4KREA 5JS1A 4JS4A 3RSEB 5BR8K 2EX3A 3FZMA 2UYTA 4B3MK 3S3MA 4QAGA 4FK2A 2HHUA 4FWMA 4J2DA 3O08A 3SUOA 1KVCA 3NFAA 5DM7L 2O8EA 3RTVA 2QWOA 5E41A 3ATVA 1EX4A 2DFEA 2J4RA 4N5SA 3ZSYA 3EE9A 3SYZA 3KK3A 1XUPO 3LDQA 2HBLA 2F9WA 1NK5A 2OCEA 1YUWA 2Z1JA 3A5LC 4U67L 4H0TB 3F5TA 4XH5A 3S41A 3NHGA 5BR9A 1BHLA 3D6RA 4O8KA 4A2BA 3QDKA 3ID8A 5HOOA 1TYQA 3THYA 3TAMA 1SL1A 4BC3A 3WEEA 3O3GA 3ITHA 4B1YB 1K8KA 4IG0A 3V9XA 4DQ8A 2RKIA 3V9WA 2B4JA 5J2NA 5AQZA 2V52B 4E7IA 3HOSA 1RGIA 2D0OA 2HHWA 5AQNA 3ZX3A 3A5MC 3C6AA 3MX5A 2ASPA 1JCFA 4Z4HA 4CGJA 4RW4A 1XHXA 4NLBA 3K5LA 4RTFD 5AFUH 1FK9A 3SPYA 3AVHA 5FROA 1E4FT 3N4PA 1VSDA 1EETA 1U48A 4ISFA 2ZF5O 2VCPA 4N76A 3TWHA 1HNWK 5HRNA 1JLQA 2E2NA 3SQ2A 3QIOA 1NGIA 1TV6A 4LF9K 4OPJA 3QEWA 4WCEL 2XHBA 5T7BA 1HYVA 3KK1A 4DR5K 2YNGA 4PY5A 3SQ0A 4FPBA 3VQPA 3CFRA 3WEEB 5AQLA 4YOVA 2VG5A 4WFAL 3U6FA 2HVHA 1GLDG 3VEOA 5AR0A 4CZLA 4RWTA 4BR9A 1VSKA 3LDPA 3D45A 3M3ZA 1VRTA 4JKCA 4GVEA 1HNXK 1VQMN 1V4SA 3M8PA 1NOZA 4BDZA 1HPZA 4DSIA 4AM6A 1QSSA 2A3ZA 5GIOA 4Z94A 2VG6A 3J7ZO 3RMBA 3KJVA 1XI1A 3P31A 3WNFA 3J7YP 4DTRA 4AHTA 3KZBA 2IVPA 3WQTA 4ILHA 4XIUA 3CFPA 4KHWA 3E9OA 4M7XA 3U3YA 4H4MA 4E7KA 4F3OA 1JCEA 1HKBA 1RT2A 1NKBA 4C8LA 4ISEA 1Q82O 2GEMA 1V4TA 3VQ4A 4ELTA 4F4KA 5AQPA 3LDLA 1RTIA 3I8DA 4J2EA 4CBUA 4EFHA 2B5JA 3AO2A 4O0JA 4K42A 3VTIA 4BE0A 3QBXA 3SBTA 4LY7A 4K43A 1GOBA 4OLBA 3DLLL 4C8KA 4CFAA 1W7AA 3OYIA 2W6LA 4GV9A 2IC3A 5CHIA 3JXUA 4QCLA 1RBSA 2FBXA 4KHQA 5KPTA 4CD1A 1LV5A 2G8IA 3G71N 1WOQA 1BA1A 1KFDA 4IOCL 3ZT0A 3D2FB 1JLCA 2I5JA 1BOTO 4DCHA 3B6PA 4BRKA 1VSEA 3BZKA 4DR1K 2AP1A 4JI7K 3SZ2A 2FXUA 4JI0K 4FCYA 1D9FA 5AQJA 1JKHA 1FXXA 2P9KA 4BDYA 1HNZK 4M3XA 3BUZB 1IKYA 1VSMA 1RBUA 4LD0A 3QEPA 1EO1A 3H1VX 3TAFA 1RT4A 5AJ3K 3R8EA 4IDHA 1I94K 2EHGA 3C6HA 4FW2A 4WE1A 2O4GA 2QXFA 3AARA 4YOYA 1KVBA 3O9RA 2Q3SA 3SQ1A 3U3GA 1SZ2A 3UE5A 3AA3A 4E0DA 2E88A 4IDKA 3U4LA 4H5VA 1BDGA 4BROA 3E66A 3MEEA 1RILA 2YNIA 1Z05A 3C6UA 2JLEA 2G8WA 3LP3A 1BUPA 4JNEA 4FZYA 3PX6A 3DRRA 1BG3A 3HSTB 4EIAA 4H0PA 3KKSA 4FVMA 4MFBA 3E1YA 4PL8A 3MCPA 4ZHRA 1Q8IA 4TSXA 1TAUA 3AO5A 2WUSA 4CERA 5FDLA 4FWQA 1R59O 2DTUA 3F9KA 1HKCA 5AQSA 1QE1A 3VTHA 4JI2K 1XC3A 4CGIA 1RCHA 2NUBA 5EY4A 3CPEA 4KFBA 3CQYA 2KLAA 4JKAA 3EZ5A 4WQ5A 3UIQA 3QB0A 3VGKA 2Q36A 2PBDA 2Y1JA 3HSCA 4BWJA 1RT7A 5LJVA 5CZ1A 4YFUA 1K9MO 4KRFA 1Q18A 5HRSA 4DR2K 5C2FA 3AVJA 1VQ7N 3R3LA 4IG3A 1RDUA 3NGIA 1C0GA 2OYQA 3BY5A 3JAMO 3AAPA 2ETJA 4MO4A 4NYFA 4ISGA 2JGUA 4FLWA 4PUOA 4WQ4A 1LAWA 4A57A 4CF0A 3DLEA 2ZGYA 4M42A 3NF9A 5FRMA 4E7JA 2YHWA 3KLIA 1S1XA 4OX9K 3R9PA 1W0HA 3ID6A 1S9GA 1S3XA 2GELA 3T3FA 4JD2B 2V7YA 3ZSRA 3THWA 4CJLA 1JLBA 3P39A 2CH6A 1WNSA 5FPMA 4Z4GA 5CR4A 1RT5A 5EVZA 3TSUA 1T7PA 4A5BA 4CHQA 4DFJA 5FPEA 2VWJA 3RVCA 2HW3A 4GV6A 3AA5X 2OA8A 3FR0A 2OANA 1U45A 2ZM6K 3AVAA 3ENBA 3IMXA 4CZJA 1ITGA 2O8DB 3EO3A 4BE1A 3EL2A 1VSIA 1XNQK 4DV4K 1ESVA 3OYBA 4BREA 2XO7A 3O1BA 3CCEN 3KD5E 1YITN 1RT6A 2VGNA 4E89A 2YHAA 4DMNA 4O8UA 3KWIA 4FLUA 4DU1A 2WTUA 4BR4A 4KH6A 1S22A 5AQTA 3J80O 4O55A 3VQEA 1IV0A 4CCHA 2HVIA 4BY9C 1EWQA 4CI6A 1J53A 5B8HA 4GKJK 4B1WB 4HWIA 3CXCM 3VQBA 2ZJRL 2HHQA 1UA1A 4KHUA 1NBWA 3K5MA 2X78A 3KHYA 4M3ZA 3VPZA 3NCIA 4Z4CA 1JLAA 4CE9A 2NRVA 2BE2A 4FJ5A 1KQSM 2DY4A 2ZWHA 3I8BA 3L4IA 4QS8A 4GMJB 5BRFA 3GE1A 3KK2A 3L8BA 1UOCA 3Q7BA 4F9OA 2F8TA 1LAVA 4JI3K 4K25A 1B92A 5HRRA 4PKGA 1QSLA 4MLHA 2E4LA 4A2AA 4AF1A 1ZBIA 3DXMB 4FL9A 4EZ6A 4BRLA 4DUZK 2FSKA 4CGFA 3LP2A 2BH1A 3ZT1A 4IZ9A 3NMUA 3OTOK 2A5XA 4CJTA 4LF4K 3SMPA 3LP0A 4KV8A 4JRPA 1OH6A 1HR0K 2ZJPL 3O9QA 1RTDA 4LH5A 4EHTA 4A59A 4DR3K 1KLNA 2HNYA 4E1NA 3G4SN 4FYDA 3NDKA 4CZFA 2QW9A 1JXEA 5MLCQ 2DFHA 4C1NI 4KB0A 5LMNK 1ZXOA 2PYLA 1Z26A 3VA0A 4B3OA 3EZWA 4CJQA 2PYJA 1VSHA 3MN5A 2UXDK 3SMSA 4XH1A 1RTHA 3CPWM 1N34K 5HROA 3ZSQA 1C1CA 3HRGA 3NGYA 2UXCK 3AAQA 5AQFA 4I9LA 3OY9A 4Q0BA 3P4IA 5I9EB 4DTPA 1JL2A 3SJHA 2XY6A 3LWLA 5AZJB 1KAYA 4GY2B 5C24A 4GKKK 4H8KA 1M90O 2IDOA 4IJNA 3D7EO 1HRHA 3K2PA 3CCRN 5AQVA 3LPTA 4CEQA 4JK9A 3PO4A 4KTZA 4GV3A 1GLJO 4DB3A 1RBVA 3FFIA 1WSIA 5M1QA 4B9TA 4XEIA 5ADXA 1H1VA 3VEYA 1TVRA 2P9IA 3OJSA 1KAXA 3KWGA 3MN9A 4F8RA 1VQ5N 3TSQA 3L2QA 1VRUA 1S1VA 1ZC6A 3QLHA 5CY4A 2A1SA 1MA9B 4I2PA 5AFUA 2RHKA 5AQIA 3TTDA 3TTCA 3NH1A 1RDCA 3PX4A 1FKOA 4OGEA 4JI5K 4FZXC 1NGGA 2KW4A 4H03B 2BGGA 1KLMA 4JI4K 3TAQA 3AO3A 4C23A 2RF2A 4DV5K 4DU3A 1QVGM 4CHOA 1JJ2M 3THVA 1OH5A 3ALYA 1DTTA 4L8RB 4HTUA 3LP1A 3QBWA 3CMEN 5GAEP 4JRQA 3HTVA 4F3TA 3WXKA 4PWDA 4OJRA 4KAZA 3O80A 1VSLA 2VQEK 1YIJN 2YKNA 4CF8A 3Q7CA 1NGBA 3V1RA 3SAFA 3THXB 2HMIA 2D0PA 3HL8A 3CCUN 4R5PA 4DV1K 4OKKA 4FK0A 3CQXA 5AQHA 3AO1A 1ZBSA 1YHQN 2LSNA 4B9UA 3ZSZA 4B3SK 1HPMA 1RBRA 4BRQA 3NF8A 2OPPA 4KHSA 3ZX0A 3VQ6A 2PY5A 1HQEA 4DG1A 4CEOA 4DHYA 4CFCA 3M6GA 3SUPA 3NVMA 1WSHA 2DFFA 5I42A 4BC4A 1DT9A 3LDSA 1T6DA 4MDBA 2YV0X 3HZ6A 4B8AB 4DU4A 1NK9A 5K14A 4FOEA 2F4VK 1IG8A 4CF2A 5LMUK 4FJLA 3ZETB 1L3VA 1TGOA 4LF8K 3M8QA 3H3OB 2P9LA 1TYQB 4H0XB 3L2VA 1HMVA 1JXBA 3AVBA 4DKWA 3CIPA 3EY1A 4FLYA 1RDDA 3MX2A 3WNHA 4O44A 4HUGA 4CGDA 3QNNA 3HPGA 2O8BB 1W2BM 3K58A 3LZJA 3CJ9A 1FW6A 3VERA 4OPHA 3OS2A 2UUCK 4CEDA 4AHRA 3QICA 5BN8A 3J8AA 3AO4A 4B1XB 1WN7A 3LWMA 3AVLA 3I0SA 1WSJA 1JLGA 2YCHA 2QKKA 3KIOA 1YJNN 2R7YA 3C95A 3F9MA 1ATNA 3VF2A 3QETA 4E3SA 1RT1A 4DR7K 1UWBA 1NU0A 4CJ4A 1J9AA 3DLKA 4JLHA 1MU2A 2IVOA 3AV9A 3MDQA 1QSYA 3JSMA 4N41A 4JKHA 2ZQBA 4IFYA 4LH4A 4CJRA 1G99A 5J2PA 3T1HK 1XNRK 3ZT2A 3M1FA 2UU9K 3EYZA 1TKXA 3NF7A 4FJ9A 4M45A 3VMFB 1T03A 2O8EB 3N4QA 3VQDA 4FM0A 1NLVA 3VESA 3O3HA 4CK2A 4UQGA 3V1OA 4DLEA 5I3UA 1D9DA 4AILC 3R1XA 4CIEA 2HHHK 3ATUA 4JK7A 1KTQA 1TK8A 1NK6A 4BRAA 3OA9A 2YKMA 4CJVA 1RFQA 3KVGA 1GOCA 1GLLO 1DGKN 4IXCA 2A41A 1ZYQA 2HB5A 4A61A 1A5XA 1TAQA 3R6MA 1QHTA 4LSNA 4RW6A 3FZHA 1DLOA 4H4OA 2A1RA 1Q7YO 4FK4A 3S3NA 4I6MB 3F2KA 4DSEA 1K73O 4KB1A 2FBVA 2O8CB 4I7FA 3B6OA 4FPAA 1T8EA 1ASWA 3CCSN 3A5NC 3TAEA 5AQGA 4CBXA 1WSEA 4GVMA 4ICLA 4AM7A 3WXMB 4OO1J 4CGHA 4CEFA 4BRFA 2IGIA 2D4WA 3CCVN 4CHPA 5IWAK 4IWVA 4PQUA 2P9UB 5GADP 3HPOA 3DXMA 4KTQA 4QS7A 3LZIA 3ZEUB 1VQON 2FF3B 4C1NK 3VQ7A 3BF1A 4CFBA 3CJ1A 4DTXA 3RSEA 2E5LK 4M3RA 2X74A 2VGMA 3H08A 3E9LA 4BRDA 4KH5A 4DFKA 2BTFA 3OYHA 2FF6A 5AQYA 1RTJA 1ZBUA 3SUQA 1Q9YA 1C6VA 3DLGA 4CZGA 3EEQA 4DQPA 4BE2A 2I7PA 2NRZA 2O8CA 4DS4A 2VG7A 4CIGA 3MXJA 3QINA 4HCBA 4BC5A 3L0QA 1KVAA 1QS4A 1HJOA 3F73A 4JKGA 2P9SB 4MQ3A 1CXUA 5JVHL 4CBWA 5GINA 2CGJA 2QWPA 3SV3A 4BGBA 1Y64A 3AVKA 3BEXA 4CK1A 1N8RO 1I39A 4CJ3A 4DFMA 1HNIA 3C6TA 2CH5A 3HP6A 4UY8O 1ATRA 2HSTA 1D4XA 1N36K 5DK5A 2UUAK 1DEJA 4CEZA 1A5WA 3AVGA 1TK5A 2F7TA 4CECA 3PSIA 4H5TA 4OLAA 3T1AA 2P9NA 1LOTB 3SLCA 4I6MA 3SCXA 2HHTA 3W0LA 2E6LA 4JK8A 1TKTA 4B1UB 1OH7A 1BIZA 2JWLA 5M1FA 3ZETA 4A5AA 4KHNA 3QFUA 4DFPA 3SAGA 5AQMA 4DQSA 4Q5VA 4HUEA 1B9FA 4O0IA 2HHVA 3D0PA 1BA0A 1WLJA 4BG9A 1BCOA 3VEWA 4FOIA 4CESA 3EKUA 4FWRA 3VQQA 5KPRA 3G0ZA 4JN4A 2O8BA
chains in the Genus database with same CATH topology
3OS0A 4HCCA 2GUIA 3PUFA 2KFZA 2E4LA 1WAJA 3RWUA 1ZBIA 3RRHA 4EZ6A 3NF6A 1LWEA 3PY8A 4CGFA 3RR8A 4CJEA 3LP2A 3DI6A 3ZT1A 4CJPA 4C8MA 4EP5A 4N56A 4CF9A 4EP4A 3HO1A 4CJTA 4KO0A 3M8SA 4HUFA 1KSPA 4OGCA 2WONA 1JLFA 3LP0A 2D0BA 4KV8A 1B9DA 1BISA 4JRPA 4FJKA 3KLGA 1N6QA 4CK3A 3HJFA 5KTQA 1RTDA 4LH5A 2XY7A 3OYLA 4DSJA 4FW1A 4ZTFA 1KLNA 2HNYA 4E1NA 3ZT3A 4DTOA 4M3TA 4KREA 4FYDA 3NDKA 4CIFA 5JS1A 4JS4A 1XC9A 4ELUA 1JXEA 2DFHA 4KB0A 3RRGA 3BDPA 2EX3A 2KTQA 3S3OA 3S3MA 2PYLA 1Z26A 4QAGA 5C42A 3VA0A 4FK2A 4B3OA 2HHUA 4CJQA 2PYJA 1C1BA 1VSHA 3HXMA 4J2DA 3SUOA 1KVCA 3NFAA 3KTQA 4CJUA 1XHZA 1RTHA 3RTVA 5HROA 3I0RA 5E41A 3ULDA 1EX4A 2DFEA 3ZSQA 4N5SA 4RW8A 1C1CA 3NGYA 1CZ9A 3ZSYA 3SYZA 3KK3A 3CM5A 4I9LA 2HNZA 3OY9A 4Q0BA 4DTPA 1JL2A 2XY6A 3QIPA 1NK5A 4F2SA 4Z4EA 3LWLA 1NJZA 4RG8A 2Z1JA 4ZTJA 5CZ2A 5FRNA 5C24A 4H8KA 4O4GA 1IG9A 4BDPA 2YHBA 3NHGA 2IDOA 4AH9A 2FBTA 4OKJA 2OZMA 1BHLA 3DRPA 3L3UA 1HRHA 3K2PA 2G8KA 3L2UA 1VK0A 4C8OA 3LPTA 4CEQA 1ZBHA 1HJRA 1ZBLA 3TAMA 3PO4A 1SL1A 2HHSA 4KTZA 3O3GA 1IO2A 3NH2A 3ITHA 2KQ2A 3HK2A 4RW9A 3SQ4A 1RBVA 3FFIA 1WSIA 4IG0A 3V9XA 3QESA 4E7LA 3OYFA 4B9TA 1BIUA 2RKIA 1HYSA 3TR8A 3V9WA 4CJSA 4FJMA 4DSKA 2B4JA 3V81A 5J2NA 4E7IA 3VQ5A 4F2RA 3HVTA 3ZSXA 1TVRA 3OJSA 2HHWA 3V4IA 4F8RA 4Z4HA 1NK4A 4CGJA 3L2QA 1HYZA 4RW4A 4B08A 1XHXA 1VRUA 1S1VA 3K5LA 3QLHA 5CY4A 2A1SA 4I2PA 4CHZA 3OYDA 3G0ZA 2FBYA 1FK9A 3SPYA 1NJXA 3AVHA 3NH1A 1NKEA 5FROA 1U49A 1RDCA 3PX4A 1FKOA 4OGEA 1QTMA 1SKRA 4FZXC 1NKCA 1VSDA 1EETA 4ID5A 1U48A 3VN5A 2KW4A 4N76A 1CZBA 1KLMA 3V1QA 3TWHA 3RMDA 2BGGA 2IS3A 5HRNA 1JLQA 1BQNA 4FJIA 1NK8A 3TAQA 3AO3A 3SQ2A 3QIOA 2RF2A 1TL1A 4DU3A 4CHOA 1TV6A 3THVA 3L3VA 3AA4A 3ALYA 1O1WA 4OPJA 3QEWA 1DTTA 4L8RB 2XHBA 2P5OA 1S1WA 5T7BA 1HYVA 4E1MA 4HTUA 3LP1A 4M41A 3KK1A 2YNGA 4DTJA 2ZD1A 4M3YA 5HBMA 4PY5A 3SQ0A 1S5JA 4JRQA 3VQ9A 3VQPA 4F3TA 3CFRA 3MXIA 4PWDA 4OJRA 3PV8A 2VG5A 4KAZA 1VSLA 3LANA 1BL3A 2OPRA 3U6FA 4E19A 2Z1GA 1ZBFA 2HVHA 4HVJA 3O3FA 2G8VA 3OYMA 4CEAA 1S6PA 3K59A 2YKNA 2KZMA 4CF8A 4LSLA 3DMJA 3V1RA 2HMIA 1IKXA 1VSKA 3D45A 3TI0A 3HL8A 1R0AA 4B9MA 2GV9A 4R5PA 3TAGA 1VRTA 4FJXA 4OKKA 3HPHA 1TK0A 4FK0A 3AO1A 2VWKA 4E7HA 3M8PA 1JL1A 1NOZA 1HPZA 4JS5A 4BDZA 4DSIA 3MAQA 2LSNA 4B9UA 3ZSZA 1YTUA 1QSSA 4Z4IA 3AA2A 4FM2A 1RBRA 1EP4A 2VG6A 4KI4A 3G10A 3RMBA 3KJVA 3M8RA 2W42A 1RDBA 1XI1A 2G8HA 3WNFA 1U47A 4DTRA 4DTNA 3NF8A 4M3WA 4CJFA 4AHTA 1SL2A 3NBPA 2D0CA 5KGXA 1BCMA 3IS9A 2OPPA 4KHSA 4XIUA 4J2BA 3CFPA 3VQ6A 2PY5A 1HQEA 4DG1A 1RNHA 4CEOA 4CFCA 3RMAA 1BQMA 4M42A 4KHWA 4F3OA 3U3YA 4H4MA 4E7KA 2AJQA 3SUPA 1F21A 1RT2A 3HP9A 1IKWA 1WSHA 2DFFA 1NKBA 4C8LA 3TANA 3V9ZA 5I42A 1SL0A 3VQ4A 4ELTA 4F4KA 1YTAA 3SUNA 2F96A 3AVNA 4W5OA 1RTIA 3LDSA 1C1AA 2YV0X 3I8DA 3DLRA 4J2EA 4B8AB 4DU4A 4W5TA 4FLTA 1NK9A 5K14A 1A5VA 2B5JA 3AO2A 3TAPA 4O0JA 4BE0A 4CF2A 4FJLA 5DMRA 1L3VA 1GOAA 4LY7A 4B9SA 2X6NA 1GOBA 4OLBA 1L3SA 4GW6A 4DTSA 1TGOA 4DQQA 3M8QA 2D0AA 3OYCA 1RDAA 2F8SA 4BACA 1X9MA 4CFAA 4C8KA 3L2VA 1HMVA 1REVA 1JXBA 5C25A 1LWFA 3AVBA 3OYIA 1IH7A 1WSGA 4AHVA 3MECA 2IOCA 3OS1A 1NJYA 4QOZB 3ZSWA 3EY1A 2IC3A 4FLYA 1RDDA 4OKEA 4DQIA 2G8UA 3HT3A 4C8NA 3WNHA 4CF1A 4DLGA 4DS5A 4O44A 4HUGA 4CGDA 3E01A 3QERA 3HPGA 3ISNC 3QNNA 4QCLA 1RBSA 3K58A 2FBXA 3LZJA 1S9EA 3VQAA 4CFDA 4KHQA 4IKFA 1S1TA 1Y97A 4W5RA 3OS2A 1KFSA 1NJWA 3QO9A 4CEDA 4AHRA 3LAKA 1LV5A 2G8IA 3QEVA 4J2AA 3AO4A 1WN7A 3HM9A 3LWMA 4KHYA 1KFDA 2KFNA 3V9UA 3AVLA 3I0SA 3ZT0A 3QNOA 1RBTA 1JLGA 1WSJA 2XRIA 3DOLA 3KIOA 4W5QA 2QKKA 1JLCA 1S6QA 2I5JA 4CJWA 2R7YA 2QK9A 2O4IA 3B6PA 3C95A 1VSEA 3OYNA 4FJ7A 3ZCMA 3A2FA 3DOKA 3CYMA 3CQ8A 3QETA 3SZ2A 4FZZA 4E3SA 4FCYA 1RT1A 1D9FA 3RR7A 1UWBA 4CJ4A 2E6MA 1J9AA 3DLKA 1JKHA 1TKZA 1FXXA 4JLHA 1WSFA 1MU2A 3AVMA 4BDYA 5J1EA 3AV9A 5J2MA 4M3XA 4N47A 4IBNA 4DWIA 2OPQA 1IKYA 3JSMA 1VSMA 1QSYA 4N41A 1RBUA 2ZQBA 4IFYA 4LH4A 4CJRA 5J2PA 3CM6A 4DTMA 4LD0A 3QEXA 3QEPA 3WNGA 3SNNA 3TAFA 3ZT2A 1U04A 3QEIA 1RT4A 1U4BA 2KZZA 3EYZA 1TKXA 3NF7A 1X1PA 2EHGA 4FW2A 1J5OA 4FJ9A 4M45A 4WE1A 3OVNA 2O4GA 2QXFA 1T03A 1KVBA 2Q3SA 3SQ1A 1SV5A 3DYAA 1YT3A 3VQDA 5HP1A 3U3GA 4CHNA 3HVRA 4FM0A 3AA3A 1UA0A 3O3HA 4E0DA 4ELVA 4CK2A 4UQGA 3V1OA 4DLEA 4IDKA 5I3UA 1SUQA 3DLBA 1D9DA 4AILC 3MEEA 3ZSVA 1RILA 4CIEA 3KLHA 2YNIA 3P83D 3SJJA 1KTQA 4Z0UA 1TK8A 1NK6A 1DTQA 3K57A 3C6UA 2JLEA 1Q9XA 4OVLA 4KKOA 4ID1A 2YKMA 1C0UA 3LP3A 4AHUA 4CJVA 3OYGA 3PX6A 3TABA 2G8WA 4FZYA 3DRRA 1GOCA 3PO5A 1C0TA 1ZYQA 5CYMA 3HSTB 2HB5A 4B9NA 5SZTA 1Z25A 3KKSA 2OPSA 4BWMA 1LWCA 4FVMA 1A5XA 4MFBA 1TAQA 3T19A 5HRPA 4O5BA 1SKSA 1HNVA 1QHTA 2HNDA 1Q8IA 1C0MA 1I3AA 1WAFA 4LSNA 4RW6A 4TSXA 4ZHRA 1TAUA 3AO5A 1DLOA 4H4OA 2A1RA 4CERA 4NCBA 3OYEA 2P5GA 5FDLA 3OYKA 4FK4A 3S3NA 4Y1CA 5KRTA 3CG7A 3L2WA 2WOMA 3JYTA 2DTUA 3F9KA 3OYAA 4DSEA 3DM2A 1QE1A 5SWMA 4CGIA 1RCHA 2YNFA 4FJGA 4K8ZA 2G8FA 4KB1A 2FBVA 2NUBA 4B9LA 4I7FA 3KD1E 4KFBA 1BGXT 3B6OA 3LPUA 3EZ5A 3MEDA 4YNQA 3ASMA 3SI6A 1ASWA 1T8EA 3UIQA 3TAEA 2Z1IA 3DLHA 5D3GA 1WSEA 2Y1JA 3DRSA 3P1GA 4GVMA 2ATQA 4ICLA 1RT7A 4PA1A 3MEGA 5CZ1A 4BWJA 4CGHA 4CEFA 4FLXA 4YFUA 3P5JA 3S9HA 1UAXA 2IGIA 4FJHA 4KRFA 2ZE2A 4CHPA 4RW7A 4PQUA 3VQ8A 5HRSA 4G1QA 2PZSA 1HQUA 3AVJA 3HPOA 3V6DA 4KTQA 1FKPA 4IG3A 3NGIA 2OYQA 4AHCA 2P1JA 1BI4A 4CEBA 3NAEA 3LZIA 2OZSA 2B6AA 3VQ7A 4CFBA 4DTXA 1TKDA 2ETJA 5EU7A 3LALA 4NYFA 4M3RA 2X74A 4AHSA 1TL3A 1D8YA 2JGUA 2X6SA 4FLWA 3H08A 4PUOA 4I2QA 4IFVA 3KKRA 1LAWA 5KI6A 3DLEA 4CEEA 4CF0A 3NF9A 3V9SA 3VA3A 4DFKA 3OYHA 4E7JA 4FJ8A 5FRMA 2RPIA 3KLIA 1S1XA 1VSJA 3OYJA 1RTJA 1ZBUA 1YVUA 3SUQA 1LW2A 1C6VA 1Q9YA 1EXQA 3C94A 3AVFA 1NK0A 3KLEA 3DLGA 1D5AA 1W0HA 4CGGA 1S9GA 4NYNA 3RMCA 4DQPA 1KCFA 3T3FA 3ZSRA 3ZT4A 4BE2A 4CJLA 3ZSOA 1IKVA 2P51A 4DS4A 2VG7A 4CIGA 1JLBA 3MXJA 3QINA 4HCBA 5CYQA 1WNSA 1CXQA 4FJNA 4Z4GA 2YNHA 4CHYA 4HHTA 1RT5A 1KVAA 1QS4A 2FC0A 4DSFA 1X9WA 1K6YA 2IAJA 4DSLA 3F73A 4DF4A 1NOYA 1T7PA 3TARA 4MQ3A 3PX0A 1CXUA 2XY8A 3IRXA 4CHQA 1JLEA 4DFJA 2VWJA 1S1UA 3VQCA 3NH0A 2Y1IA 2RN2A 3IAYA 2HW3A 3AA5X 2OA8A 3LAMA 3AVCA 1VSFA 2D5RA 4B8CA 1U45A 1BI4B 1RT3A 3AVAA 3SV3A 1L3UA 1ITGA 5KGWA 4BE1A 3AVKA 4FXDA 4CK1A 1I39A 4OPKA 4CJ3A 1VSIA 4DFMA 1HNIA 3SPZA 3OYBA 3C6TA 3KLFA 2XO7A 3BGRA 3HP6A 3KD5E 4K8XA 2QKBA 1W9HA 1RT6A 3WNEA 5DK5A 4E89A 2YHAA 4DMNA 4CEZA 4I9QA 1A5WA 3AVGA 4KTWA 1TK5A 3HYFA 4DF8A 4FLUA 4DU1A 4B9VA 4KI6A 1ASVA 4CJKA 1QQCA 4CECA 4KPYA 3MXMA 5KRSA 3T1AA 1L3TA 4NCAA 4OLAA 4DTUA 5J2QA 4NCGA 4EZ9A 3IG1A 4O55A 3VQEA 4FLZA 4FLVA 4CCHA 2HVIA 3SCXA 2BDPA 1J53A 2HHTA 1T05A 3OJUA 4W5NA 2E6LA 1L5UA 3VQBA 2ITGA 4FM1A 5HLFA 1CLQA 1N5YA 2XY5A 2HHQA 1TKTA 1LW0A 1UA1A 4KHUA 4DQRA 1BIZA 1NK7A 3O4QA 2X78A 3K5MA 3O4NA 4M3ZA 2BANA 3NCIA 1ASUA 4KHNA 4CJ5A 4Z4CA 1JLAA 4CE9A 2BE2A 4FJ5A 1G15A 3L2RA 3SV4A 2DY4A 3CFOA 5JS2A 3NGZA 4DFPA 4DQSA 1SKWA 1X9SA 4Q5VA 4HUEA 1KRPA 1B9FA 4GMJB 4O0IA 2HHVA 1J54A 4Z4FA 3D0PA 4Y1DA 1XWLA 2HHXA 2GBZA 3K5OA 3KK2A 3L8BA 3AVIA 3K5NA 1WLJA 1BCOA 1UOCA 2F8TA 1LAVA 4CESA 3NE6A 1B92A 1EKEA 3VQQA 4FJJA 5HRRA 2Z1HA 4M3UA 1QSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OS0 A;  4HCC A;  2GUI A;  3PUF A;  2KFZ A;  2E4L A;  1WAJ A;  3RWU A;  1ZBI A;  3RRH A;  4EZ6 A;  3NF6 A;  1LWE A;  3PY8 A;  4CGF A;  3RR8 A;  4CJE A;  3LP2 A;  3DI6 A;  3ZT1 A;  4CJP A;  4C8M A;  4EP5 A;  4N56 A;  4CF9 A;  4EP4 A;  3HO1 A;  4CJT A;  4KO0 A;  3M8S A;  4HUF A;  1KSP A;  4OGC A;  2WON A;  1JLF A;  3LP0 A;  2D0B A;  4KV8 A;  1B9D A;  1BIS A;  4JRP A;  4FJK A;  3KLG A;  1N6Q A;  4CK3 A;  3HJF A;  5KTQ A;  1RTD A;  4LH5 A;  2XY7 A;  3OYL A;  4DSJ A;  4FW1 A;  4ZTF A;  1KLN A;  2HNY A;  4E1N A;  3ZT3 A;  4DTO A;  4M3T A;  4KRE A;  4FYD A;  3NDK A;  4CIF A;  5JS1 A;  4JS4 A;  1XC9 A;  4ELU A;  1JXE A;  2DFH A;  4KB0 A;  3RRG A;  3BDP A;  2EX3 A;  2KTQ A;  3S3O A;  3S3M A;  2PYL A;  1Z26 A;  4QAG A;  5C42 A;  3VA0 A;  4FK2 A;  4B3O A;  2HHU A;  4CJQ A;  2PYJ A;  1C1B A;  1VSH A;  3HXM A;  4J2D A;  3SUO A;  1KVC A;  3NFA A;  3KTQ A;  4CJU A;  1XHZ A;  1RTH A;  3RTV A;  5HRO A;  3I0R A;  5E41 A;  3ULD A;  1EX4 A;  2DFE A;  3ZSQ A;  4N5S A;  4RW8 A;  1C1C A;  3NGY A;  1CZ9 A;  3ZSY A;  3SYZ A;  3KK3 A;  3CM5 A;  4I9L A;  2HNZ A;  3OY9 A;  4Q0B A;  4DTP A;  1JL2 A;  2XY6 A;  3QIP A;  1NK5 A;  4F2S A;  4Z4E A;  3LWL A;  1NJZ A;  4RG8 A;  2Z1J A;  4ZTJ A;  5CZ2 A;  5FRN A;  5C24 A;  4H8K A;  4O4G A;  1IG9 A;  4BDP A;  2YHB A;  3NHG A;  2IDO A;  4AH9 A;  2FBT A;  4OKJ A;  2OZM A;  1BHL A;  3DRP A;  3L3U A;  1HRH A;  3K2P A;  2G8K A;  3L2U A;  1VK0 A;  4C8O A;  3LPT A;  4CEQ A;  1ZBH A;  1HJR A;  1ZBL A;  3TAM A;  3PO4 A;  1SL1 A;  2HHS A;  4KTZ A;  3O3G A;  1IO2 A;  3NH2 A;  3ITH A;  2KQ2 A;  3HK2 A;  4RW9 A;  3SQ4 A;  1RBV A;  3FFI A;  1WSI A;  4IG0 A;  3V9X A;  3QES A;  4E7L A;  3OYF A;  4B9T A;  1BIU A;  2RKI A;  1HYS A;  3TR8 A;  3V9W A;  4CJS A;  4FJM A;  4DSK A;  2B4J A;  3V81 A;  5J2N A;  4E7I A;  3VQ5 A;  4F2R A;  3HVT A;  3ZSX A;  1TVR A;  3OJS A;  2HHW A;  3V4I A;  4F8R A;  4Z4H A;  1NK4 A;  4CGJ A;  3L2Q A;  1HYZ A;  4RW4 A;  4B08 A;  1XHX A;  1VRU A;  1S1V A;  3K5L A;  3QLH A;  5CY4 A;  2A1S A;  4I2P A;  4CHZ A;  3OYD A;  3G0Z A;  2FBY A;  1FK9 A;  3SPY A;  1NJX A;  3AVH A;  3NH1 A;  1NKE A;  5FRO A;  1U49 A;  1RDC A;  3PX4 A;  1FKO A;  4OGE A;  1QTM A;  1SKR A;  4FZX C;  1NKC A;  1VSD A;  1EET A;  4ID5 A;  1U48 A;  3VN5 A;  2KW4 A;  4N76 A;  1CZB A;  1KLM A;  3V1Q A;  3TWH A;  3RMD A;  2BGG A;  2IS3 A;  5HRN A;  1JLQ A;  1BQN A;  4FJI A;  1NK8 A;  3TAQ A;  3AO3 A;  3SQ2 A;  3QIO A;  2RF2 A;  1TL1 A;  4DU3 A;  4CHO A;  1TV6 A;  3THV A;  3L3V A;  3AA4 A;  3ALY A;  1O1W A;  4OPJ A;  3QEW A;  1DTT A;  4L8R B;  2XHB A;  2P5O A;  1S1W A;  5T7B A;  1HYV A;  4E1M A;  4HTU A;  3LP1 A;  4M41 A;  3KK1 A;  2YNG A;  4DTJ A;  2ZD1 A;  4M3Y A;  5HBM A;  4PY5 A;  3SQ0 A;  1S5J A;  4JRQ A;  3VQ9 A;  3VQP A;  4F3T A;  3CFR A;  3MXI A;  4PWD A;  4OJR A;  3PV8 A;  2VG5 A;  4KAZ A;  1VSL A;  3LAN A;  1BL3 A;  2OPR A;  3U6F A;  4E19 A;  2Z1G A;  1ZBF A;  2HVH A;  4HVJ A;  3O3F A;  2G8V A;  3OYM A;  4CEA A;  1S6P A;  3K59 A;  2YKN A;  2KZM A;  4CF8 A;  4LSL A;  3DMJ A;  3V1R A;  2HMI A;  1IKX A;  1VSK A;  3D45 A;  3TI0 A;  3HL8 A;  1R0A A;  4B9M A;  2GV9 A;  4R5P A;  3TAG A;  1VRT A;  4FJX A;  4OKK A;  3HPH A;  1TK0 A;  4FK0 A;  3AO1 A;  2VWK A;  4E7H A;  3M8P A;  1JL1 A;  1NOZ A;  1HPZ A;  4JS5 A;  4BDZ A;  4DSI A;  3MAQ A;  2LSN A;  4B9U A;  3ZSZ A;  1YTU A;  1QSS A;  4Z4I A;  3AA2 A;  4FM2 A;  1RBR A;  1EP4 A;  2VG6 A;  4KI4 A;  3G10 A;  3RMB A;  3KJV A;  3M8R A;  2W42 A;  1RDB A;  1XI1 A;  2G8H A;  3WNF A;  1U47 A;  4DTR A;  4DTN A;  3NF8 A;  4M3W A;  4CJF A;  4AHT A;  1SL2 A;  3NBP A;  2D0C A;  5KGX A;  1BCM A;  3IS9 A;  2OPP A;  4KHS A;  4XIU A;  4J2B A;  3CFP A;  3VQ6 A;  2PY5 A;  1HQE A;  4DG1 A;  1RNH A;  4CEO A;  4CFC A;  3RMA A;  1BQM A;  4M42 A;  4KHW A;  4F3O A;  3U3Y A;  4H4M A;  4E7K A;  2AJQ A;  3SUP A;  1F21 A;  1RT2 A;  3HP9 A;  1IKW A;  1WSH A;  2DFF A;  1NKB A;  4C8L A;  3TAN A;  3V9Z A;  5I42 A;  1SL0 A;  3VQ4 A;  4ELT A;  4F4K A;  1YTA A;  3SUN A;  2F96 A;  3AVN A;  4W5O A;  1RTI A;  3LDS A;  1C1A A;  2YV0 X;  3I8D A;  3DLR A;  4J2E A;  4B8A B;  4DU4 A;  4W5T A;  4FLT A;  1NK9 A;  5K14 A;  1A5V A;  2B5J A;  3AO2 A;  3TAP A;  4O0J A;  4BE0 A;  4CF2 A;  4FJL A;  5DMR A;  1L3V A;  1GOA A;  4LY7 A;  4B9S A;  2X6N A;  1GOB A;  4OLB A;  1L3S A;  4GW6 A;  4DTS A;  1TGO A;  4DQQ A;  3M8Q A;  2D0A A;  3OYC A;  1RDA A;  2F8S A;  4BAC A;  1X9M A;  4CFA A;  4C8K A;  3L2V A;  1HMV A;  1REV A;  1JXB A;  5C25 A;  1LWF A;  3AVB A;  3OYI A;  1IH7 A;  1WSG A;  4AHV A;  3MEC A;  2IOC A;  3OS1 A;  1NJY A;  4QOZ B;  3ZSW A;  3EY1 A;  2IC3 A;  4FLY A;  1RDD A;  4OKE A;  4DQI A;  2G8U A;  3HT3 A;  4C8N A;  3WNH A;  4CF1 A;  4DLG A;  4DS5 A;  4O44 A;  4HUG A;  4CGD A;  3E01 A;  3QER A;  3HPG A;  3ISN C;  3QNN A;  4QCL A;  1RBS A;  3K58 A;  2FBX A;  3LZJ A;  1S9E A;  3VQA A;  4CFD A;  4KHQ A;  4IKF A;  1S1T A;  1Y97 A;  4W5R A;  3OS2 A;  1KFS A;  1NJW A;  3QO9 A;  4CED A;  4AHR A;  3LAK A;  1LV5 A;  2G8I A;  3QEV A;  4J2A A;  3AO4 A;  1WN7 A;  3HM9 A;  3LWM A;  4KHY A;  1KFD A;  2KFN A;  3V9U A;  3AVL A;  3I0S A;  3ZT0 A;  3QNO A;  1RBT A;  1JLG A;  1WSJ A;  2XRI A;  3DOL A;  3KIO A;  4W5Q A;  2QKK A;  1JLC A;  1S6Q A;  2I5J A;  4CJW A;  2R7Y A;  2QK9 A;  2O4I A;  3B6P A;  3C95 A;  1VSE A;  3OYN A;  4FJ7 A;  3ZCM A;  3A2F A;  3DOK A;  3CYM A;  3CQ8 A;  3QET A;  3SZ2 A;  4FZZ A;  4E3S A;  4FCY A;  1RT1 A;  1D9F A;  3RR7 A;  1UWB A;  4CJ4 A;  2E6M A;  1J9A A;  3DLK A;  1JKH A;  1TKZ A;  1FXX A;  4JLH A;  1WSF A;  1MU2 A;  3AVM A;  4BDY A;  5J1E A;  3AV9 A;  5J2M A;  4M3X A;  4N47 A;  4IBN A;  4DWI A;  2OPQ A;  1IKY A;  3JSM A;  1VSM A;  1QSY A;  4N41 A;  1RBU A;  2ZQB A;  4IFY A;  4LH4 A;  4CJR A;  5J2P A;  3CM6 A;  4DTM A;  4LD0 A;  3QEX A;  3QEP A;  3WNG A;  3SNN A;  3TAF A;  3ZT2 A;  1U04 A;  3QEI A;  1RT4 A;  1U4B A;  2KZZ A;  3EYZ A;  1TKX A;  3NF7 A;  1X1P A;  2EHG A;  4FW2 A;  1J5O A;  4FJ9 A;  4M45 A;  4WE1 A;  3OVN A;  2O4G A;  2QXF A;  1T03 A;  1KVB A;  2Q3S A;  3SQ1 A;  1SV5 A;  3DYA A;  1YT3 A;  3VQD A;  5HP1 A;  3U3G A;  4CHN A;  3HVR A;  4FM0 A;  3AA3 A;  1UA0 A;  3O3H A;  4E0D A;  4ELV A;  4CK2 A;  4UQG A;  3V1O A;  4DLE A;  4IDK A;  5I3U A;  1SUQ A;  3DLB A;  1D9D A;  4AIL C;  3MEE A;  3ZSV A;  1RIL A;  4CIE A;  3KLH A;  2YNI A;  3P83 D;  3SJJ A;  1KTQ A;  4Z0U A;  1TK8 A;  1NK6 A;  1DTQ A;  3K57 A;  3C6U A;  2JLE A;  1Q9X A;  4OVL A;  4KKO A;  4ID1 A;  2YKM A;  1C0U A;  3LP3 A;  4AHU A;  4CJV A;  3OYG A;  3PX6 A;  3TAB A;  2G8W A;  4FZY A;  3DRR A;  1GOC A;  3PO5 A;  1C0T A;  1ZYQ A;  5CYM A;  3HST B;  2HB5 A;  4B9N A;  5SZT A;  1Z25 A;  3KKS A;  2OPS A;  4BWM A;  1LWC A;  4FVM A;  1A5X A;  4MFB A;  1TAQ A;  3T19 A;  5HRP A;  4O5B A;  1SKS A;  1HNV A;  1QHT A;  2HND A;  1Q8I A;  1C0M A;  1I3A A;  1WAF A;  4LSN A;  4RW6 A;  4TSX A;  4ZHR A;  1TAU A;  3AO5 A;  1DLO A;  4H4O A;  2A1R A;  4CER A;  4NCB A;  3OYE A;  2P5G A;  5FDL A;  3OYK A;  4FK4 A;  3S3N A;  4Y1C A;  5KRT A;  3CG7 A;  3L2W A;  2WOM A;  3JYT A;  2DTU A;  3F9K A;  3OYA A;  4DSE A;  3DM2 A;  1QE1 A;  5SWM A;  4CGI A;  1RCH A;  2YNF A;  4FJG A;  4K8Z A;  2G8F A;  4KB1 A;  2FBV A;  2NUB A;  4B9L A;  4I7F A;  3KD1 E;  4KFB A;  1BGX T;  3B6O A;  3LPU A;  3EZ5 A;  3MED A;  4YNQ A;  3ASM A;  3SI6 A;  1ASW A;  1T8E A;  3UIQ A;  3TAE A;  2Z1I A;  3DLH A;  5D3G A;  1WSE A;  2Y1J A;  3DRS A;  3P1G A;  4GVM A;  2ATQ A;  4ICL A;  1RT7 A;  4PA1 A;  3MEG A;  5CZ1 A;  4BWJ A;  4CGH A;  4CEF A;  4FLX A;  4YFU A;  3P5J A;  3S9H A;  1UAX A;  2IGI A;  4FJH A;  4KRF A;  2ZE2 A;  4CHP A;  4RW7 A;  4PQU A;  3VQ8 A;  5HRS A;  4G1Q A;  2PZS A;  1HQU A;  3AVJ A;  3HPO A;  3V6D A;  4KTQ A;  1FKP A;  4IG3 A;  3NGI A;  2OYQ A;  4AHC A;  2P1J A;  1BI4 A;  4CEB A;  3NAE A;  3LZI A;  2OZS A;  2B6A A;  3VQ7 A;  4CFB A;  4DTX A;  1TKD A;  2ETJ A;  5EU7 A;  3LAL A;  4NYF A;  4M3R A;  2X74 A;  4AHS A;  1TL3 A;  1D8Y A;  2JGU A;  2X6S A;  4FLW A;  3H08 A;  4PUO A;  4I2Q A;  4IFV A;  3KKR A;  1LAW A;  5KI6 A;  3DLE A;  4CEE A;  4CF0 A;  3NF9 A;  3V9S A;  3VA3 A;  4DFK A;  3OYH A;  4E7J A;  4FJ8 A;  5FRM A;  2RPI A;  3KLI A;  1S1X A;  1VSJ A;  3OYJ A;  1RTJ A;  1ZBU A;  1YVU A;  3SUQ A;  1LW2 A;  1C6V A;  1Q9Y A;  1EXQ A;  3C94 A;  3AVF A;  1NK0 A;  3KLE A;  3DLG A;  1D5A A;  1W0H A;  4CGG A;  1S9G A;  4NYN A;  3RMC A;  4DQP A;  1KCF A;  3T3F A;  3ZSR A;  3ZT4 A;  4BE2 A;  4CJL A;  3ZSO A;  1IKV A;  2P51 A;  4DS4 A;  2VG7 A;  4CIG A;  1JLB A;  3MXJ A;  3QIN A;  4HCB A;  5CYQ A;  1WNS A;  1CXQ A;  4FJN A;  4Z4G A;  2YNH A;  4CHY A;  4HHT A;  1RT5 A;  1KVA A;  1QS4 A;  2FC0 A;  4DSF A;  1X9W A;  1K6Y A;  2IAJ A;  4DSL A;  3F73 A;  4DF4 A;  1NOY A;  1T7P A;  3TAR A;  4MQ3 A;  3PX0 A;  1CXU A;  2XY8 A;  3IRX A;  4CHQ A;  1JLE A;  4DFJ A;  2VWJ A;  1S1U A;  3VQC A;  3NH0 A;  2Y1I A;  2RN2 A;  3IAY A;  2HW3 A;  3AA5 X;  2OA8 A;  3LAM A;  3AVC A;  1VSF A;  2D5R A;  4B8C A;  1U45 A;  1BI4 B;  1RT3 A;  3AVA A;  3SV3 A;  1L3U A;  1ITG A;  5KGW A;  4BE1 A;  3AVK A;  4FXD A;  4CK1 A;  1I39 A;  4OPK A;  4CJ3 A;  1VSI A;  4DFM A;  1HNI A;  3SPZ A;  3OYB A;  3C6T A;  3KLF A;  2XO7 A;  3BGR A;  3HP6 A;  3KD5 E;  4K8X A;  2QKB A;  1W9H A;  1RT6 A;  3WNE A;  5DK5 A;  4E89 A;  2YHA A;  4DMN A;  4CEZ A;  4I9Q A;  1A5W A;  3AVG A;  4KTW A;  1TK5 A;  3HYF A;  4DF8 A;  4FLU A;  4DU1 A;  4B9V A;  4KI6 A;  1ASV A;  4CJK A;  1QQC A;  4CEC A;  4KPY A;  3MXM A;  5KRS A;  3T1A A;  1L3T A;  4NCA A;  4OLA A;  4DTU A;  5J2Q A;  4NCG A;  4EZ9 A;  3IG1 A;  4O55 A;  3VQE A;  4FLZ A;  4FLV A;  4CCH A;  2HVI A;  3SCX A;  2BDP A;  1J53 A;  2HHT A;  1T05 A;  3OJU A;  4W5N A;  2E6L A;  1L5U A;  3VQB A;  2ITG A;  4FM1 A;  5HLF A;  1CLQ A;  1N5Y A;  2XY5 A;  2HHQ A;  1TKT A;  1LW0 A;  1UA1 A;  4KHU A;  4DQR A;  1BIZ A;  1NK7 A;  3O4Q A;  2X78 A;  3K5M A;  3O4N A;  4M3Z A;  2BAN A;  3NCI A;  1ASU A;  4KHN A;  4CJ5 A;  4Z4C A;  1JLA A;  4CE9 A;  2BE2 A;  4FJ5 A;  1G15 A;  3L2R A;  3SV4 A;  2DY4 A;  3CFO A;  5JS2 A;  3NGZ A;  4DFP A;  4DQS A;  1SKW A;  1X9S A;  4Q5V A;  4HUE A;  1KRP A;  1B9F A;  4GMJ B;  4O0I A;  2HHV A;  1J54 A;  4Z4F A;  3D0P A;  4Y1D A;  1XWL A;  2HHX A;  2GBZ A;  3K5O A;  3KK2 A;  3L8B A;  3AVI A;  3K5N A;  1WLJ A;  1BCO A;  1UOC A;  2F8T A;  1LAV A;  4CES A;  3NE6 A;  1B92 A;  1EKE A;  3VQQ A;  4FJJ A;  5HRR A;  2Z1H A;  4M3U A;  1QSL A; 
#chains in the Genus database with same CATH topology
 3OS0 A;  2GUI A;  3DXK B;  3ZYY X;  2KKZ A;  3RRH A;  1NGC A;  2VWB A;  3RR8 A;  3CJB A;  3DI6 A;  4CJP A;  4C8M A;  4N56 A;  2HBK A;  3HO1 A;  4KO0 A;  4XH4 A;  1JLF A;  4BR2 A;  2D0B A;  4FJK A;  1BIS A;  4FVU A;  3HJF A;  5KTQ A;  5AQR A;  4DSJ A;  2QWN A;  4FW1 A;  3O1W A;  4DTO A;  3TSP A;  1NWK A;  4CIF A;  4NXM K;  4E1J A;  1NGF A;  1VQL N;  1GLB G;  2NRW A;  4BG8 A;  2KTQ A;  4WQ5 C;  5C42 A;  4K0K K;  3UKR A;  5FPD A;  2P9K B;  4CJU A;  1XHZ A;  2W6K A;  1Q86 O;  1IBM K;  3ULE B;  3ULD A;  1RDW X;  3CM5 A;  5KQD A;  2HNZ A;  3QIP A;  4DR4 K;  4F2S A;  4Z4E A;  4NO7 A;  4RG8 A;  3DXK A;  5CZ2 A;  4BDP A;  2YHB A;  2V7Z A;  4AH9 A;  4X66 K;  4OKJ A;  4WFB L;  2OZM A;  3DRP A;  3L3U A;  2G8K A;  3L2U A;  1VK0 A;  4C8O A;  4KH4 A;  1QZ5 A;  3FZF A;  1ZBH A;  1HJR A;  3KK7 A;  2WBN A;  2HHS A;  1IO2 A;  3G25 A;  2KQ2 A;  4RW9 A;  2W41 A;  3U8X A;  3CI5 A;  3OYF A;  5M1O A;  1OKJ A;  3AY9 A;  1BIU A;  3TR8 A;  4FJM A;  2HF3 A;  1X3N A;  1VQP N;  1VQK N;  3V81 A;  4YOW A;  4B1Z A;  3VQ5 A;  3HVT A;  3ZSX A;  3SBG A;  3VEZ A;  1OH8 A;  4LFC K;  1HYZ A;  3ULE A;  4B08 A;  4YDU A;  2P9N B;  3OYD A;  3EN9 A;  3FE1 A;  2FBY A;  5BRD A;  1NJX A;  4NXN K;  2E1Z A;  5DM6 L;  4ID5 A;  4BRG A;  1P8Z A;  1J6Z A;  4JHD B;  3VN5 A;  3UKU A;  1CZB A;  3RMD A;  4L3Q A;  2IS3 A;  2Q1N A;  1BQN A;  1TL1 A;  4CJ7 A;  1W97 L;  4JKE A;  3IUC A;  1DKG D;  4BRP A;  4BRI A;  4M3Y A;  4CD3 A;  2ZD1 A;  4DTJ A;  5HBM A;  1QQN A;  3PV8 A;  3CCL N;  2OPR A;  3AGR A;  1ZBF A;  3O3F A;  3K59 A;  1S6P A;  2KZM A;  1IKX A;  3TI0 A;  1R0A A;  2GV9 A;  4B3R K;  4FJX A;  5LJW A;  2HMP A;  5C12 A;  1S72 N;  1JL1 A;  3MN7 A;  1EWR A;  3K0S A;  1YTU A;  3GG4 A;  4BVP A;  1EP4 A;  3M8R A;  2OTJ N;  5C15 A;  5JLF A;  1U47 A;  4BRH A;  1J5E K;  1E3M A;  2Q2R A;  4CJF A;  2Q97 A;  3NBP A;  5KGX A;  4WFN L;  1LCU A;  3CET A;  4J2B A;  1WUA A;  1RNH A;  3NVK A;  3RMA A;  1BQM A;  2AJQ A;  1F21 A;  1U2V A;  3HP9 A;  1IKW A;  1NNE A;  3TAN A;  1YJW N;  1YTA A;  3A8Y A;  3AVN A;  5BPN A;  4W5O A;  2O8D A;  1YAG A;  1C1A A;  2P9U A;  3MMV A;  1A5V A;  3TAP A;  3GOI A;  1TUY A;  3VF6 A;  3H3N O;  5ADX H;  5DMR A;  3LM9 A;  4BRM A;  3WT0 A;  5AQQ A;  3OYC A;  1QQO A;  1RDA A;  1NGH A;  1ILY A;  5C25 A;  1LWF A;  1IH7 A;  5CE3 A;  4AHV A;  1GLE G;  4YDU C;  2WC9 A;  2ZGZ A;  4DQI A;  4DLG A;  3QER A;  5TKW A;  3ISN C;  3IFR A;  3VQA A;  4CFD A;  4IKF A;  4LFB K;  1S1T A;  4W5R A;  4RCH A;  1KFS A;  3BF3 A;  1XMO K;  3QEV A;  4DV6 K;  3HM9 A;  3QFP A;  4KHY A;  2KFN A;  2E2Q A;  2XRI A;  1BWF O;  2NRH A;  4CJW A;  2WFB A;  2ITM A;  4FJ7 A;  4WQ4 C;  3ZCM A;  3A2F A;  5LL6 Z;  3CYM A;  4R79 A;  3RR7 A;  5AQO A;  2QI2 A;  2E6M A;  5J1E A;  5M1N A;  1OVQ A;  4N47 A;  4IBN A;  3T7Z A;  4DWI A;  3CM6 A;  4DTM A;  3CCQ N;  3D2E B;  2GTD A;  3VET A;  2KZZ A;  2Q31 A;  2E2O A;  1M1K O;  1SV5 A;  3DYA A;  1YT3 A;  5HP1 A;  4DV7 K;  3WXI A;  1SUQ A;  3DLB A;  3ZSV A;  3E9P A;  3KLH A;  4CZK A;  3P83 D;  4Z0U A;  5BN9 A;  3THX A;  1DTQ A;  1Q9X A;  4OVL A;  4KKO A;  3OYG A;  3CCM N;  3ZLJ A;  4B9N A;  3W3D A;  2P9P A;  5SZT A;  1N32 K;  1SKS A;  1LWC A;  5HRP A;  4JI8 K;  1N33 K;  4IEI A;  2HND A;  1WAF A;  3EKS A;  1U2V B;  4NCB A;  2FSJ A;  1QHA A;  2OTL N;  5JIC A;  3DAW A;  2NLX A;  2P5G A;  3LM2 A;  4BC2 A;  5KRT A;  2A40 A;  2WOM A;  3OYA A;  3WXL A;  3DM2 A;  4ILG B;  5SWM A;  4FJG A;  2G8F A;  4BRN A;  4B9L A;  1BGX T;  4PKH A;  3MED A;  4YNQ A;  3ASM A;  3SI6 A;  4YOX A;  5AZI A;  1K8K B;  2P9P B;  5D3G A;  3DRS A;  2QK9 A;  4PA1 A;  1IBL K;  3MEG A;  4FLX A;  3P5J A;  3DJC A;  1UAX A;  1MDU B;  2ZE2 A;  4G1Q A;  3V6D A;  4FWO A;  2FLO A;  4AHC A;  2P1J A;  4CEB A;  4JD2 A;  3GL1 A;  4V19 S;  2YJF A;  2B6A A;  2QEX N;  1GLF O;  5EU7 A;  3LAL A;  4J8F A;  4JI1 K;  4AHS A;  3TU5 A;  1TL3 A;  2X6S A;  4U7B A;  3SAH A;  2F9T A;  1P90 A;  4IFV A;  3KKR A;  4X64 K;  4FJ8 A;  4M7Y A;  1SS6 A;  4ILJ A;  2RPI A;  1VSJ A;  3OYJ A;  3O4W A;  4LF6 K;  1LW2 A;  1NK0 A;  4CZE A;  4CGG A;  2YHX A;  1KCF A;  3ZT4 A;  5AZJ A;  3ZSO A;  4AQY K;  1NG9 A;  4FWP A;  5CYQ A;  4FJN A;  2GWK A;  3D2E A;  2YNH A;  5C2D A;  2FC0 A;  1K6Y A;  4YY3 K;  2Q0U A;  4DF4 A;  3TAR A;  1VAZ A;  2KHO A;  3PX0 A;  1BU6 O;  2XY8 A;  3IRX A;  5JVG L;  3NH0 A;  2Y1I A;  2UUB K;  4B8C A;  1VSF A;  2D5R A;  1YXQ A;  1RT3 A;  4JKF A;  1IJJ A;  4GNI A;  2QTD A;  5KGW A;  4YOT A;  5JLH A;  3CJA A;  4FXD A;  4OPK A;  1WBD A;  4LF7 K;  4CVN E;  2YHY A;  4YOU A;  1JCG A;  1OVY A;  3MK6 A;  4K8X A;  1W9H A;  4X62 K;  3H45 C;  5AQK A;  3I56 N;  4I9Q A;  4KTW A;  3FZL A;  4DF8 A;  1ASV A;  4CJK A;  5F2R A;  3MXM A;  5KRS A;  1L3T A;  4NCA A;  3GDQ A;  4BR5 A;  4DTU A;  2A42 A;  2W40 A;  3IG1 A;  4FLV A;  3K9J A;  4JV5 K;  1L5U A;  5HLF A;  1N5Y A;  1YJ9 N;  1MWM A;  3PLA A;  3HOT A;  4DQR A;  1ATS A;  2D1K A;  2BAN A;  4FWL A;  3L4Q A;  5BPM A;  1ASU A;  1HKG A;  2GUP A;  2VYP A;  1G15 A;  3L2R A;  3UKU B;  3CFO A;  1SAZ A;  3NGZ A;  1XQS C;  4FWN A;  1SKW A;  4WF9 L;  1T44 A;  4Z4F A;  4Y1D A;  1XWL A;  1VQ9 N;  3CJ7 A;  2HHX A;  3K5O A;  4H0V B;  4DUY K;  2FSN A;  3UKR B;  2AA4 A;  4B1V A;  3NE6 A;  1EKE A;  4FJJ A;  2NNW A;  3MWP A;  2Z1H A;  4HCC A;  3C7N B;  3HM8 A;  4MDA A;  4LFA K;  2KFZ A;  1WAJ A;  4B3T K;  3NF6 A;  4CJE A;  4EP5 A;  2UXB K;  3I55 N;  3D2F A;  2NRX A;  4CF9 A;  4EP4 A;  2ZJQ L;  1KSP A;  4OGC A;  4CZI A;  4FWS A;  4DV0 K;  1B9D A;  4IOA L;  3KLG A;  4X65 K;  3CD6 N;  1N6Q A;  4CK3 A;  4HTL A;  3OYL A;  1VHX A;  3CER A;  4BR0 A;  4M3T A;  1XC9 A;  4ELU A;  3FZK A;  3RRG A;  2V51 B;  3BDP A;  2QWR A;  3S3O A;  2NZT A;  4YHH K;  5A2Q O;  1C1B A;  3HXM A;  4JYA K;  1O13 A;  3KTQ A;  1E4G T;  3ENO A;  3I0R A;  3QML A;  4RW8 A;  3LDN A;  1CZ9 A;  1Q81 O;  3MWT A;  3UB5 A;  3T1Y K;  3L6Q A;  3FGU A;  3LDO A;  1NJZ A;  3THW B;  5GAH P;  4ZTJ A;  5AZI B;  5FRN A;  1IG9 A;  4O4G A;  1NGA A;  2FBT A;  3CMA N;  2QWL A;  2HOE A;  3G6E N;  3HBT A;  2NRR A;  3EE8 A;  3BP8 A;  1ZBL A;  5IT9 O;  3H1Q A;  3T69 A;  3NH2 A;  3HK2 A;  2QXL A;  3SQ4 A;  3QES A;  4E7L A;  4K41 A;  3DWL A;  1HYS A;  1Z6R A;  3O9T A;  3SK3 A;  2YJE A;  4WYB A;  4CJS A;  1YI2 N;  4DSK A;  5HL7 L;  4F2R A;  3A5O C;  5F1X A;  1IBK K;  3I33 A;  4JKD A;  3V4I A;  1TUU A;  5AQX A;  3JS6 A;  1NK4 A;  2GX9 A;  4CHZ A;  1YF5 L;  4Y0W A;  5M1P A;  2EWS A;  1NKE A;  3K9K A;  3WXJ A;  1U49 A;  1QTM A;  1SKR A;  1NKC A;  3V1Q A;  4DR6 K;  4FJI A;  1NK8 A;  5AQW A;  3VEV A;  3IKM A;  4IO9 L;  2NRT A;  3L3V A;  3AA4 A;  1O1W A;  2YI1 A;  2E1Y A;  2P5O A;  1S1W A;  4FSV A;  4JI6 K;  4E1M A;  4M41 A;  3CC2 N;  1S5J A;  3OBW A;  3VQ9 A;  3MXI A;  3MCA B;  3VGL A;  1YVN A;  1BL3 A;  3LAN A;  4E19 A;  2Z1G A;  4HVJ A;  2G8V A;  3OYM A;  4CEA A;  5AQU A;  2RE2 A;  4LSL A;  3DMJ A;  4G9Z A;  3VEX A;  3OBY A;  4B9M A;  3O8M A;  3OW2 M;  1KAZ A;  3TAG A;  3HPH A;  1TK0 A;  2VWK A;  2P9I B;  4E7H A;  2QWQ A;  1NGJ A;  4JS5 A;  3MAQ A;  1K8A O;  2A6A A;  3CF5 L;  4Z4I A;  3AA2 A;  4FM2 A;  3VEN A;  4H0O A;  4KI4 A;  3G10 A;  4JKB A;  2W42 A;  1RDB A;  2ASO A;  2G8H A;  3PSF A;  4O5F A;  4DTN A;  4M3W A;  1SL2 A;  2D0C A;  1BCM A;  3IS9 A;  1NMN A;  2IVN A;  4LF5 K;  2P9S A;  1VQ6 N;  1QQM A;  1KD1 O;  2QM1 A;  4JAX A;  4H5N A;  3V9Z A;  1SL0 A;  3SUN A;  2F96 A;  3J7A P;  1T3V A;  4DV2 K;  4PHT X;  3DLR A;  5C0Y A;  5M1K A;  2BUP A;  4W5T A;  4FLT A;  2O8F B;  3P38 A;  1GOA A;  4B9S A;  2X6N A;  1L3S A;  4GW6 A;  4DTS A;  4DQQ A;  2D0A A;  2F8S A;  4BAC A;  1HX1 A;  1X9M A;  1XMQ K;  1REV A;  3CC4 N;  1WSG A;  3OS1 A;  3MEC A;  2IOC A;  4NLC A;  1NJY A;  4QOZ B;  3ZSW A;  4OKE A;  2G8U A;  4B9Q A;  4C8N A;  4CF1 A;  3HT3 A;  4DS5 A;  3E01 A;  3O9U A;  2JWK A;  1S9E A;  4H5W A;  1Y97 A;  2HF4 A;  3H6E A;  1NJW A;  1FJG K;  3QO9 A;  3LAK A;  4J2A A;  2E8A A;  3CCJ N;  3V9U A;  3QNO A;  1RBT A;  3DOL A;  4A62 A;  4W5Q A;  5TKY A;  2DPN A;  1X9J A;  3C65 A;  1S6Q A;  4MO5 A;  3H46 O;  3OYN A;  3CJC A;  3DOK A;  1QVF M;  3CQ8 A;  4FZZ A;  1C0F A;  1TKZ A;  1WSF A;  3AVM A;  2QA4 N;  5J2M A;  2O4I A;  2OPQ A;  4KBO A;  2O8F A;  3QEX A;  5BPL A;  3WNG A;  3SNN A;  3QEI A;  1U04 A;  1T6C A;  1U4B A;  3FFK B;  4BRC A;  1X1P A;  1J5O A;  3AGK A;  3OVN A;  4IO8 A;  1GLC G;  2Q0R A;  3TTF A;  2HBM A;  4CHN A;  3HVR A;  1UA0 A;  4BQL A;  3MN6 A;  1NJI O;  4ELV A;  3SJJ A;  5KPZ A;  3PIP L;  5C10 A;  3K57 A;  3O5B A;  1NM1 A;  1WB9 A;  4ID1 A;  4AHU A;  1C0U A;  3TAB A;  4FO0 A;  4BR7 A;  4IJA A;  3PO5 A;  1C0T A;  3CHW A;  5CYM A;  3ENH A;  1CZA N;  4YOR A;  1Z25 A;  3IDH A;  2OPS A;  4BWM A;  5E26 A;  3T19 A;  4CZH A;  4O5B A;  1HNV A;  1C0M A;  1I3A A;  1KXP A;  4BVO A;  5F0X A;  5FPN A;  5EX5 A;  2E2P A;  3OYE A;  3WUH A;  3OYK A;  4Y1C A;  1BO5 O;  3CG7 A;  3VGM A;  3L2W A;  3JYT A;  5ELZ A;  1NGD A;  2YNF A;  2I7N A;  4K8Z A;  4KHP K;  3O6W A;  3KD1 E;  3LPU A;  4CZM A;  5JMV A;  3DLH A;  2Z1I A;  1HUX A;  2IIR A;  3P1G A;  2ATQ A;  3S9H A;  4FJH A;  3C7N A;  4RW7 A;  3VQ8 A;  4LC9 B;  1KC8 O;  2CGK A;  2PZS A;  1HQU A;  4PKI A;  3FLC O;  1FKP A;  1U6Z A;  1BI4 A;  3NAE A;  2OZS A;  4JHD A;  1TKD A;  1D8Y A;  2H3G X;  1WBB A;  2PFU A;  4I2Q A;  5LY3 A;  5KI6 A;  4CEE A;  3V9S A;  3VA3 A;  4NB4 A;  3U9D A;  4EAH D;  1YVU A;  1EXQ A;  3C94 A;  3AVF A;  4EHU A;  3ZX2 A;  1NMD A;  3KLE A;  1D5A A;  1EQY A;  4NYN A;  2HBJ A;  3RMC A;  3WQU A;  1IKV A;  2P51 A;  3U9Z A;  5E84 A;  1QZ6 A;  4MLE A;  1CXQ A;  4CHY A;  4HHT A;  4DSF A;  1X9W A;  2IAJ A;  4DSL A;  1NOY A;  3OHR A;  2CGL A;  4JEP A;  1JLE A;  2ASM A;  1S1U A;  4PL7 A;  3VQC A;  3CC7 N;  3IAY A;  2RN2 A;  5H1S Q;  3LAM A;  3AVC A;  3VOV A;  1BI4 B;  1SQK A;  3ZEU A;  1L3U A;  2PAV A;  2VQF K;  4DV3 K;  3SPZ A;  3KLF A;  3BGR A;  5FLX O;  1VQ8 N;  2QKB A;  3WNE A;  3BZC A;  4FWK A;  3HYF A;  4QS9 A;  4KI6 A;  4B9V A;  4BQZ A;  1QQC A;  4KPY A;  4M63 C;  4H5R A;  5J2Q A;  1VQN N;  5KQ8 A;  4NCG A;  4EZ9 A;  4FLZ A;  3THY B;  1MWK A;  2BDP A;  1NGE A;  1T05 A;  3OJU A;  2GWJ A;  3A0I X;  4FM1 A;  2ITG A;  1CLQ A;  2XY5 A;  3TPQ A;  1LW0 A;  1X3M A;  1NK7 A;  3O4Q A;  3O4N A;  4IFE A;  3B8A X;  2QWM A;  4JKG B;  2E20 A;  4CJ5 A;  3C0B A;  3J81 O;  3SV4 A;  3O9S A;  1VQ4 N;  5JS2 A;  3HI0 A;  1X9S A;  1KRP A;  2P9L B;  1J54 A;  5GIP A;  2GBZ A;  3AVI A;  3K5N A;  3M5R A;  5BRH A;  1HLU A;  5EOY A;  3PIO L;  3GBT A;  4IOX A;  4W5N A;  4M3U A;  5GAG P;  3PUF A;  5BRE A;  3RWU A;  1LWE A;  3PY8 A;  4IEE A;  3VF4 A;  3M8S A;  4HUF A;  4CW7 B;  2WON A;  2YX6 A;  3LL3 A;  2XY7 A;  1GLA G;  4OPA A;  5EXW A;  4ZTF A;  4H0Y B;  3ZT3 A;  4BGA A;  4KRE A;  5JS1 A;  4JS4 A;  3RSE B;  5BR8 K;  2EX3 A;  3FZM A;  2UYT A;  4B3M K;  3S3M A;  4QAG A;  4FK2 A;  2HHU A;  4FWM A;  4J2D A;  3O08 A;  3SUO A;  1KVC A;  3NFA A;  5DM7 L;  2O8E A;  3RTV A;  2QWO A;  5E41 A;  3ATV A;  1EX4 A;  2DFE A;  2J4R A;  4N5S A;  3ZSY A;  3EE9 A;  3SYZ A;  3KK3 A;  1XUP O;  3LDQ A;  2HBL A;  2F9W A;  1NK5 A;  2OCE A;  1YUW A;  2Z1J A;  3A5L C;  4U67 L;  4H0T B;  3F5T A;  4XH5 A;  3S41 A;  3NHG A;  5BR9 A;  1BHL A;  3D6R A;  4O8K A;  4A2B A;  3QDK A;  3ID8 A;  5HOO A;  1TYQ A;  3THY A;  3TAM A;  1SL1 A;  4BC3 A;  3WEE A;  3O3G A;  3ITH A;  4B1Y B;  1K8K A;  4IG0 A;  3V9X A;  4DQ8 A;  2RKI A;  3V9W A;  2B4J A;  5J2N A;  5AQZ A;  2V52 B;  4E7I A;  3HOS A;  1RGI A;  2D0O A;  2HHW A;  5AQN A;  3ZX3 A;  3A5M C;  3C6A A;  3MX5 A;  2ASP A;  1JCF A;  4Z4H A;  4CGJ A;  4RW4 A;  1XHX A;  4NLB A;  3K5L A;  4RTF D;  5AFU H;  1FK9 A;  3SPY A;  3AVH A;  5FRO A;  1E4F T;  3N4P A;  1VSD A;  1EET A;  1U48 A;  4ISF A;  2ZF5 O;  2VCP A;  4N76 A;  3TWH A;  1HNW K;  5HRN A;  1JLQ A;  2E2N A;  3SQ2 A;  3QIO A;  1NGI A;  1TV6 A;  4LF9 K;  4OPJ A;  3QEW A;  4WCE L;  2XHB A;  5T7B A;  1HYV A;  3KK1 A;  4DR5 K;  2YNG A;  4PY5 A;  3SQ0 A;  4FPB A;  3VQP A;  3CFR A;  3WEE B;  5AQL A;  4YOV A;  2VG5 A;  4WFA L;  3U6F A;  2HVH A;  1GLD G;  3VEO A;  5AR0 A;  4CZL A;  4RWT A;  4BR9 A;  1VSK A;  3LDP A;  3D45 A;  3M3Z A;  1VRT A;  4JKC A;  4GVE A;  1HNX K;  1VQM N;  1V4S A;  3M8P A;  1NOZ A;  4BDZ A;  1HPZ A;  4DSI A;  4AM6 A;  1QSS A;  2A3Z A;  5GIO A;  4Z94 A;  2VG6 A;  3J7Z O;  3RMB A;  3KJV A;  1XI1 A;  3P31 A;  3WNF A;  3J7Y P;  4DTR A;  4AHT A;  3KZB A;  2IVP A;  3WQT A;  4ILH A;  4XIU A;  3CFP A;  4KHW A;  3E9O A;  4M7X A;  3U3Y A;  4H4M A;  4E7K A;  4F3O A;  1JCE A;  1HKB A;  1RT2 A;  1NKB A;  4C8L A;  4ISE A;  1Q82 O;  2GEM A;  1V4T A;  3VQ4 A;  4ELT A;  4F4K A;  5AQP A;  3LDL A;  1RTI A;  3I8D A;  4J2E A;  4CBU A;  4EFH A;  2B5J A;  3AO2 A;  4O0J A;  4K42 A;  3VTI A;  4BE0 A;  3QBX A;  3SBT A;  4LY7 A;  4K43 A;  1GOB A;  4OLB A;  3DLL L;  4C8K A;  4CFA A;  1W7A A;  3OYI A;  2W6L A;  4GV9 A;  2IC3 A;  5CHI A;  3JXU A;  4QCL A;  1RBS A;  2FBX A;  4KHQ A;  5KPT A;  4CD1 A;  1LV5 A;  2G8I A;  3G71 N;  1WOQ A;  1BA1 A;  1KFD A;  4IOC L;  3ZT0 A;  3D2F B;  1JLC A;  2I5J A;  1BOT O;  4DCH A;  3B6P A;  4BRK A;  1VSE A;  3BZK A;  4DR1 K;  2AP1 A;  4JI7 K;  3SZ2 A;  2FXU A;  4JI0 K;  4FCY A;  1D9F A;  5AQJ A;  1JKH A;  1FXX A;  2P9K A;  4BDY A;  1HNZ K;  4M3X A;  3BUZ B;  1IKY A;  1VSM A;  1RBU A;  4LD0 A;  3QEP A;  1EO1 A;  3H1V X;  3TAF A;  1RT4 A;  5AJ3 K;  3R8E A;  4IDH A;  1I94 K;  2EHG A;  3C6H A;  4FW2 A;  4WE1 A;  2O4G A;  2QXF A;  3AAR A;  4YOY A;  1KVB A;  3O9R A;  2Q3S A;  3SQ1 A;  3U3G A;  1SZ2 A;  3UE5 A;  3AA3 A;  4E0D A;  2E88 A;  4IDK A;  3U4L A;  4H5V A;  1BDG A;  4BRO A;  3E66 A;  3MEE A;  1RIL A;  2YNI A;  1Z05 A;  3C6U A;  2JLE A;  2G8W A;  3LP3 A;  1BUP A;  4JNE A;  4FZY A;  3PX6 A;  3DRR A;  1BG3 A;  3HST B;  4EIA A;  4H0P A;  3KKS A;  4FVM A;  4MFB A;  3E1Y A;  4PL8 A;  3MCP A;  4ZHR A;  1Q8I A;  4TSX A;  1TAU A;  3AO5 A;  2WUS A;  4CER A;  5FDL A;  4FWQ A;  1R59 O;  2DTU A;  3F9K A;  1HKC A;  5AQS A;  1QE1 A;  3VTH A;  4JI2 K;  1XC3 A;  4CGI A;  1RCH A;  2NUB A;  5EY4 A;  3CPE A;  4KFB A;  3CQY A;  2KLA A;  4JKA A;  3EZ5 A;  4WQ5 A;  3UIQ A;  3QB0 A;  3VGK A;  2Q36 A;  2PBD A;  2Y1J A;  3HSC A;  4BWJ A;  1RT7 A;  5LJV A;  5CZ1 A;  4YFU A;  1K9M O;  4KRF A;  1Q18 A;  5HRS A;  4DR2 K;  5C2F A;  3AVJ A;  1VQ7 N;  3R3L A;  4IG3 A;  1RDU A;  3NGI A;  1C0G A;  2OYQ A;  3BY5 A;  3JAM O;  3AAP A;  2ETJ A;  4MO4 A;  4NYF A;  4ISG A;  2JGU A;  4FLW A;  4PUO A;  4WQ4 A;  1LAW A;  4A57 A;  4CF0 A;  3DLE A;  2ZGY A;  4M42 A;  3NF9 A;  5FRM A;  4E7J A;  2YHW A;  3KLI A;  1S1X A;  4OX9 K;  3R9P A;  1W0H A;  3ID6 A;  1S9G A;  1S3X A;  2GEL A;  3T3F A;  4JD2 B;  2V7Y A;  3ZSR A;  3THW A;  4CJL A;  1JLB A;  3P39 A;  2CH6 A;  1WNS A;  5FPM A;  4Z4G A;  5CR4 A;  1RT5 A;  5EVZ A;  3TSU A;  1T7P A;  4A5B A;  4CHQ A;  4DFJ A;  5FPE A;  2VWJ A;  3RVC A;  2HW3 A;  4GV6 A;  3AA5 X;  2OA8 A;  3FR0 A;  2OAN A;  1U45 A;  2ZM6 K;  3AVA A;  3ENB A;  3IMX A;  4CZJ A;  1ITG A;  2O8D B;  3EO3 A;  4BE1 A;  3EL2 A;  1VSI A;  1XNQ K;  4DV4 K;  1ESV A;  3OYB A;  4BRE A;  2XO7 A;  3O1B A;  3CCE N;  3KD5 E;  1YIT N;  1RT6 A;  2VGN A;  4E89 A;  2YHA A;  4DMN A;  4O8U A;  3KWI A;  4FLU A;  4DU1 A;  2WTU A;  4BR4 A;  4KH6 A;  1S22 A;  5AQT A;  3J80 O;  4O55 A;  3VQE A;  1IV0 A;  4CCH A;  2HVI A;  4BY9 C;  1EWQ A;  4CI6 A;  1J53 A;  5B8H A;  4GKJ K;  4B1W B;  4HWI A;  3CXC M;  3VQB A;  2ZJR L;  2HHQ A;  1UA1 A;  4KHU A;  1NBW A;  3K5M A;  2X78 A;  3KHY A;  4M3Z A;  3VPZ A;  3NCI A;  4Z4C A;  1JLA A;  4CE9 A;  2NRV A;  2BE2 A;  4FJ5 A;  1KQS M;  2DY4 A;  2ZWH A;  3I8B A;  3L4I A;  4QS8 A;  4GMJ B;  5BRF A;  3GE1 A;  3KK2 A;  3L8B A;  1UOC A;  3Q7B A;  4F9O A;  2F8T A;  1LAV A;  4JI3 K;  4K25 A;  1B92 A;  5HRR A;  4PKG A;  1QSL A;  4MLH A;  2E4L A;  4A2A A;  4AF1 A;  1ZBI A;  3DXM B;  4FL9 A;  4EZ6 A;  4BRL A;  4DUZ K;  2FSK A;  4CGF A;  3LP2 A;  2BH1 A;  3ZT1 A;  4IZ9 A;  3NMU A;  3OTO K;  2A5X A;  4CJT A;  4LF4 K;  3SMP A;  3LP0 A;  4KV8 A;  4JRP A;  1OH6 A;  1HR0 K;  2ZJP L;  3O9Q A;  1RTD A;  4LH5 A;  4EHT A;  4A59 A;  4DR3 K;  1KLN A;  2HNY A;  4E1N A;  3G4S N;  4FYD A;  3NDK A;  4CZF A;  2QW9 A;  1JXE A;  5MLC Q;  2DFH A;  4C1N I;  4KB0 A;  5LMN K;  1ZXO A;  2PYL A;  1Z26 A;  3VA0 A;  4B3O A;  3EZW A;  4CJQ A;  2PYJ A;  1VSH A;  3MN5 A;  2UXD K;  3SMS A;  4XH1 A;  1RTH A;  3CPW M;  1N34 K;  5HRO A;  3ZSQ A;  1C1C A;  3HRG A;  3NGY A;  2UXC K;  3AAQ A;  5AQF A;  4I9L A;  3OY9 A;  4Q0B A;  3P4I A;  5I9E B;  4DTP A;  1JL2 A;  3SJH A;  2XY6 A;  3LWL A;  5AZJ B;  1KAY A;  4GY2 B;  5C24 A;  4GKK K;  4H8K A;  1M90 O;  2IDO A;  4IJN A;  3D7E O;  1HRH A;  3K2P A;  3CCR N;  5AQV A;  3LPT A;  4CEQ A;  4JK9 A;  3PO4 A;  4KTZ A;  4GV3 A;  1GLJ O;  4DB3 A;  1RBV A;  3FFI A;  1WSI A;  5M1Q A;  4B9T A;  4XEI A;  5ADX A;  1H1V A;  3VEY A;  1TVR A;  2P9I A;  3OJS A;  1KAX A;  3KWG A;  3MN9 A;  4F8R A;  1VQ5 N;  3TSQ A;  3L2Q A;  1VRU A;  1S1V A;  1ZC6 A;  3QLH A;  5CY4 A;  2A1S A;  1MA9 B;  4I2P A;  5AFU A;  2RHK A;  5AQI A;  3TTD A;  3TTC A;  3NH1 A;  1RDC A;  3PX4 A;  1FKO A;  4OGE A;  4JI5 K;  4FZX C;  1NGG A;  2KW4 A;  4H03 B;  2BGG A;  1KLM A;  4JI4 K;  3TAQ A;  3AO3 A;  4C23 A;  2RF2 A;  4DV5 K;  4DU3 A;  1QVG M;  4CHO A;  1JJ2 M;  3THV A;  1OH5 A;  3ALY A;  1DTT A;  4L8R B;  4HTU A;  3LP1 A;  3QBW A;  3CME N;  5GAE P;  4JRQ A;  3HTV A;  4F3T A;  3WXK A;  4PWD A;  4OJR A;  4KAZ A;  3O80 A;  1VSL A;  2VQE K;  1YIJ N;  2YKN A;  4CF8 A;  3Q7C A;  1NGB A;  3V1R A;  3SAF A;  3THX B;  2HMI A;  2D0P A;  3HL8 A;  3CCU N;  4R5P A;  4DV1 K;  4OKK A;  4FK0 A;  3CQX A;  5AQH A;  3AO1 A;  1ZBS A;  1YHQ N;  2LSN A;  4B9U A;  3ZSZ A;  4B3S K;  1HPM A;  1RBR A;  4BRQ A;  3NF8 A;  2OPP A;  4KHS A;  3ZX0 A;  3VQ6 A;  2PY5 A;  1HQE A;  4DG1 A;  4CEO A;  4DHY A;  4CFC A;  3M6G A;  3SUP A;  3NVM A;  1WSH A;  2DFF A;  5I42 A;  4BC4 A;  1DT9 A;  3LDS A;  1T6D A;  4MDB A;  2YV0 X;  3HZ6 A;  4B8A B;  4DU4 A;  1NK9 A;  5K14 A;  4FOE A;  2F4V K;  1IG8 A;  4CF2 A;  5LMU K;  4FJL A;  3ZET B;  1L3V A;  1TGO A;  4LF8 K;  3M8Q A;  3H3O B;  2P9L A;  1TYQ B;  4H0X B;  3L2V A;  1HMV A;  1JXB A;  3AVB A;  4DKW A;  3CIP A;  3EY1 A;  4FLY A;  1RDD A;  3MX2 A;  3WNH A;  4O44 A;  4HUG A;  4CGD A;  3QNN A;  3HPG A;  2O8B B;  1W2B M;  3K58 A;  3LZJ A;  3CJ9 A;  1FW6 A;  3VER A;  4OPH A;  3OS2 A;  2UUC K;  4CED A;  4AHR A;  3QIC A;  5BN8 A;  3J8A A;  3AO4 A;  4B1X B;  1WN7 A;  3LWM A;  3AVL A;  3I0S A;  1WSJ A;  1JLG A;  2YCH A;  2QKK A;  3KIO A;  1YJN N;  2R7Y A;  3C95 A;  3F9M A;  1ATN A;  3VF2 A;  3QET A;  4E3S A;  1RT1 A;  4DR7 K;  1UWB A;  1NU0 A;  4CJ4 A;  1J9A A;  3DLK A;  4JLH A;  1MU2 A;  2IVO A;  3AV9 A;  3MDQ A;  1QSY A;  3JSM A;  4N41 A;  4JKH A;  2ZQB A;  4IFY A;  4LH4 A;  4CJR A;  1G99 A;  5J2P A;  3T1H K;  1XNR K;  3ZT2 A;  3M1F A;  2UU9 K;  3EYZ A;  1TKX A;  3NF7 A;  4FJ9 A;  4M45 A;  3VMF B;  1T03 A;  2O8E B;  3N4Q A;  3VQD A;  4FM0 A;  1NLV A;  3VES A;  3O3H A;  4CK2 A;  4UQG A;  3V1O A;  4DLE A;  5I3U A;  1D9D A;  4AIL C;  3R1X A;  4CIE A;  2HHH K;  3ATU A;  4JK7 A;  1KTQ A;  1TK8 A;  1NK6 A;  4BRA A;  3OA9 A;  2YKM A;  4CJV A;  1RFQ A;  3KVG A;  1GOC A;  1GLL O;  1DGK N;  4IXC A;  2A41 A;  1ZYQ A;  2HB5 A;  4A61 A;  1A5X A;  1TAQ A;  3R6M A;  1QHT A;  4LSN A;  4RW6 A;  3FZH A;  1DLO A;  4H4O A;  2A1R A;  1Q7Y O;  4FK4 A;  3S3N A;  4I6M B;  3F2K A;  4DSE A;  1K73 O;  4KB1 A;  2FBV A;  2O8C B;  4I7F A;  3B6O A;  4FPA A;  1T8E A;  1ASW A;  3CCS N;  3A5N C;  3TAE A;  5AQG A;  4CBX A;  1WSE A;  4GVM A;  4ICL A;  4AM7 A;  3WXM B;  4OO1 J;  4CGH A;  4CEF A;  4BRF A;  2IGI A;  2D4W A;  3CCV N;  4CHP A;  5IWA K;  4IWV A;  4PQU A;  2P9U B;  5GAD P;  3HPO A;  3DXM A;  4KTQ A;  4QS7 A;  3LZI A;  3ZEU B;  1VQO N;  2FF3 B;  4C1N K;  3VQ7 A;  3BF1 A;  4CFB A;  3CJ1 A;  4DTX A;  3RSE A;  2E5L K;  4M3R A;  2X74 A;  2VGM A;  3H08 A;  3E9L A;  4BRD A;  4KH5 A;  4DFK A;  2BTF A;  3OYH A;  2FF6 A;  5AQY A;  1RTJ A;  1ZBU A;  3SUQ A;  1Q9Y A;  1C6V A;  3DLG A;  4CZG A;  3EEQ A;  4DQP A;  4BE2 A;  2I7P A;  2NRZ A;  2O8C A;  4DS4 A;  2VG7 A;  4CIG A;  3MXJ A;  3QIN A;  4HCB A;  4BC5 A;  3L0Q A;  1KVA A;  1QS4 A;  1HJO A;  3F73 A;  4JKG A;  2P9S B;  4MQ3 A;  1CXU A;  5JVH L;  4CBW A;  5GIN A;  2CGJ A;  2QWP A;  3SV3 A;  4BGB A;  1Y64 A;  3AVK A;  3BEX A;  4CK1 A;  1N8R O;  1I39 A;  4CJ3 A;  4DFM A;  1HNI A;  3C6T A;  2CH5 A;  3HP6 A;  4UY8 O;  1ATR A;  2HST A;  1D4X A;  1N36 K;  5DK5 A;  2UUA K;  1DEJ A;  4CEZ A;  1A5W A;  3AVG A;  1TK5 A;  2F7T A;  4CEC A;  3PSI A;  4H5T A;  4OLA A;  3T1A A;  2P9N A;  1LOT B;  3SLC A;  4I6M A;  3SCX A;  2HHT A;  3W0L A;  2E6L A;  4JK8 A;  1TKT A;  4B1U B;  1OH7 A;  1BIZ A;  2JWL A;  5M1F A;  3ZET A;  4A5A A;  4KHN A;  3QFU A;  4DFP A;  3SAG A;  5AQM A;  4DQS A;  4Q5V A;  4HUE A;  1B9F A;  4O0I A;  2HHV A;  3D0P A;  1BA0 A;  1WLJ A;  4BG9 A;  1BCO A;  3VEW A;  4FOI A;  4CES A;  3EKU A;  4FWR A;  3VQQ A;  5KPR A;  3G0Z A;  4JN4 A;  2O8B A; 
#chains in the Genus database with same CATH homology
 3OS0 A;  4HCC A;  2GUI A;  3PUF A;  2KFZ A;  2E4L A;  1WAJ A;  3RWU A;  1ZBI A;  3RRH A;  4EZ6 A;  3NF6 A;  1LWE A;  3PY8 A;  4CGF A;  3RR8 A;  4CJE A;  3LP2 A;  3DI6 A;  3ZT1 A;  4CJP A;  4C8M A;  4EP5 A;  4N56 A;  4CF9 A;  4EP4 A;  3HO1 A;  4CJT A;  4KO0 A;  3M8S A;  4HUF A;  1KSP A;  4OGC A;  2WON A;  1JLF A;  3LP0 A;  2D0B A;  4KV8 A;  1B9D A;  1BIS A;  4JRP A;  4FJK A;  3KLG A;  1N6Q A;  4CK3 A;  3HJF A;  5KTQ A;  1RTD A;  4LH5 A;  2XY7 A;  3OYL A;  4DSJ A;  4FW1 A;  4ZTF A;  1KLN A;  2HNY A;  4E1N A;  3ZT3 A;  4DTO A;  4M3T A;  4KRE A;  4FYD A;  3NDK A;  4CIF A;  5JS1 A;  4JS4 A;  1XC9 A;  4ELU A;  1JXE A;  2DFH A;  4KB0 A;  3RRG A;  3BDP A;  2EX3 A;  2KTQ A;  3S3O A;  3S3M A;  2PYL A;  1Z26 A;  4QAG A;  5C42 A;  3VA0 A;  4FK2 A;  4B3O A;  2HHU A;  4CJQ A;  2PYJ A;  1C1B A;  1VSH A;  3HXM A;  4J2D A;  3SUO A;  1KVC A;  3NFA A;  3KTQ A;  4CJU A;  1XHZ A;  1RTH A;  3RTV A;  5HRO A;  3I0R A;  5E41 A;  3ULD A;  1EX4 A;  2DFE A;  3ZSQ A;  4N5S A;  4RW8 A;  1C1C A;  3NGY A;  1CZ9 A;  3ZSY A;  3SYZ A;  3KK3 A;  3CM5 A;  4I9L A;  2HNZ A;  3OY9 A;  4Q0B A;  4DTP A;  1JL2 A;  2XY6 A;  3QIP A;  1NK5 A;  4F2S A;  4Z4E A;  3LWL A;  1NJZ A;  4RG8 A;  2Z1J A;  4ZTJ A;  5CZ2 A;  5FRN A;  5C24 A;  4H8K A;  4O4G A;  1IG9 A;  4BDP A;  2YHB A;  3NHG A;  2IDO A;  4AH9 A;  2FBT A;  4OKJ A;  2OZM A;  1BHL A;  3DRP A;  3L3U A;  1HRH A;  3K2P A;  2G8K A;  3L2U A;  1VK0 A;  4C8O A;  3LPT A;  4CEQ A;  1ZBH A;  1HJR A;  1ZBL A;  3TAM A;  3PO4 A;  1SL1 A;  2HHS A;  4KTZ A;  3O3G A;  1IO2 A;  3NH2 A;  3ITH A;  2KQ2 A;  3HK2 A;  4RW9 A;  3SQ4 A;  1RBV A;  3FFI A;  1WSI A;  4IG0 A;  3V9X A;  3QES A;  4E7L A;  3OYF A;  4B9T A;  1BIU A;  2RKI A;  1HYS A;  3TR8 A;  3V9W A;  4CJS A;  4FJM A;  4DSK A;  2B4J A;  3V81 A;  5J2N A;  4E7I A;  3VQ5 A;  4F2R A;  3HVT A;  3ZSX A;  1TVR A;  3OJS A;  2HHW A;  3V4I A;  4F8R A;  4Z4H A;  1NK4 A;  4CGJ A;  3L2Q A;  1HYZ A;  4RW4 A;  4B08 A;  1XHX A;  1VRU A;  1S1V A;  3K5L A;  3QLH A;  5CY4 A;  2A1S A;  4I2P A;  4CHZ A;  3OYD A;  3G0Z A;  2FBY A;  1FK9 A;  3SPY A;  1NJX A;  3AVH A;  3NH1 A;  1NKE A;  5FRO A;  1U49 A;  1RDC A;  3PX4 A;  1FKO A;  4OGE A;  1QTM A;  1SKR A;  4FZX C;  1NKC A;  1VSD A;  1EET A;  4ID5 A;  1U48 A;  3VN5 A;  2KW4 A;  4N76 A;  1CZB A;  1KLM A;  3V1Q A;  3TWH A;  3RMD A;  2BGG A;  2IS3 A;  5HRN A;  1JLQ A;  1BQN A;  4FJI A;  1NK8 A;  3TAQ A;  3AO3 A;  3SQ2 A;  3QIO A;  2RF2 A;  1TL1 A;  4DU3 A;  4CHO A;  1TV6 A;  3THV A;  3L3V A;  3AA4 A;  3ALY A;  1O1W A;  4OPJ A;  3QEW A;  1DTT A;  4L8R B;  2XHB A;  2P5O A;  1S1W A;  5T7B A;  1HYV A;  4E1M A;  4HTU A;  3LP1 A;  4M41 A;  3KK1 A;  2YNG A;  4DTJ A;  2ZD1 A;  4M3Y A;  5HBM A;  4PY5 A;  3SQ0 A;  1S5J A;  4JRQ A;  3VQ9 A;  3VQP A;  4F3T A;  3CFR A;  3MXI A;  4PWD A;  4OJR A;  3PV8 A;  2VG5 A;  4KAZ A;  1VSL A;  3LAN A;  1BL3 A;  2OPR A;  3U6F A;  4E19 A;  2Z1G A;  1ZBF A;  2HVH A;  4HVJ A;  3O3F A;  2G8V A;  3OYM A;  4CEA A;  1S6P A;  3K59 A;  2YKN A;  2KZM A;  4CF8 A;  4LSL A;  3DMJ A;  3V1R A;  2HMI A;  1IKX A;  1VSK A;  3D45 A;  3TI0 A;  3HL8 A;  1R0A A;  4B9M A;  2GV9 A;  4R5P A;  3TAG A;  1VRT A;  4FJX A;  4OKK A;  3HPH A;  1TK0 A;  4FK0 A;  3AO1 A;  2VWK A;  4E7H A;  3M8P A;  1JL1 A;  1NOZ A;  1HPZ A;  4JS5 A;  4BDZ A;  4DSI A;  3MAQ A;  2LSN A;  4B9U A;  3ZSZ A;  1YTU A;  1QSS A;  4Z4I A;  3AA2 A;  4FM2 A;  1RBR A;  1EP4 A;  2VG6 A;  4KI4 A;  3G10 A;  3RMB A;  3KJV A;  3M8R A;  2W42 A;  1RDB A;  1XI1 A;  2G8H A;  3WNF A;  1U47 A;  4DTR A;  4DTN A;  3NF8 A;  4M3W A;  4CJF A;  4AHT A;  1SL2 A;  3NBP A;  2D0C A;  5KGX A;  1BCM A;  3IS9 A;  2OPP A;  4KHS A;  4XIU A;  4J2B A;  3CFP A;  3VQ6 A;  2PY5 A;  1HQE A;  4DG1 A;  1RNH A;  4CEO A;  4CFC A;  3RMA A;  1BQM A;  4M42 A;  4KHW A;  4F3O A;  3U3Y A;  4H4M A;  4E7K A;  2AJQ A;  3SUP A;  1F21 A;  1RT2 A;  3HP9 A;  1IKW A;  1WSH A;  2DFF A;  1NKB A;  4C8L A;  3TAN A;  3V9Z A;  5I42 A;  1SL0 A;  3VQ4 A;  4ELT A;  4F4K A;  1YTA A;  3SUN A;  2F96 A;  3AVN A;  4W5O A;  1RTI A;  3LDS A;  1C1A A;  2YV0 X;  3I8D A;  3DLR A;  4J2E A;  4B8A B;  4DU4 A;  4W5T A;  4FLT A;  1NK9 A;  5K14 A;  1A5V A;  2B5J A;  3AO2 A;  3TAP A;  4O0J A;  4BE0 A;  4CF2 A;  4FJL A;  5DMR A;  1L3V A;  1GOA A;  4LY7 A;  4B9S A;  2X6N A;  1GOB A;  4OLB A;  1L3S A;  4GW6 A;  4DTS A;  1TGO A;  4DQQ A;  3M8Q A;  2D0A A;  3OYC A;  1RDA A;  2F8S A;  4BAC A;  1X9M A;  4CFA A;  4C8K A;  3L2V A;  1HMV A;  1REV A;  1JXB A;  5C25 A;  1LWF A;  3AVB A;  3OYI A;  1IH7 A;  1WSG A;  4AHV A;  3MEC A;  2IOC A;  3OS1 A;  1NJY A;  4QOZ B;  3ZSW A;  3EY1 A;  2IC3 A;  4FLY A;  1RDD A;  4OKE A;  4DQI A;  2G8U A;  3HT3 A;  4C8N A;  3WNH A;  4CF1 A;  4DLG A;  4DS5 A;  4O44 A;  4HUG A;  4CGD A;  3E01 A;  3QER A;  3HPG A;  3ISN C;  3QNN A;  4QCL A;  1RBS A;  3K58 A;  2FBX A;  3LZJ A;  1S9E A;  3VQA A;  4CFD A;  4KHQ A;  4IKF A;  1S1T A;  1Y97 A;  4W5R A;  3OS2 A;  1KFS A;  1NJW A;  3QO9 A;  4CED A;  4AHR A;  3LAK A;  1LV5 A;  2G8I A;  3QEV A;  4J2A A;  3AO4 A;  1WN7 A;  3HM9 A;  3LWM A;  4KHY A;  1KFD A;  2KFN A;  3V9U A;  3AVL A;  3I0S A;  3ZT0 A;  3QNO A;  1RBT A;  1JLG A;  1WSJ A;  2XRI A;  3DOL A;  3KIO A;  4W5Q A;  2QKK A;  1JLC A;  1S6Q A;  2I5J A;  4CJW A;  2R7Y A;  2QK9 A;  2O4I A;  3B6P A;  3C95 A;  1VSE A;  3OYN A;  4FJ7 A;  3ZCM A;  3A2F A;  3DOK A;  3CYM A;  3CQ8 A;  3QET A;  3SZ2 A;  4FZZ A;  4E3S A;  4FCY A;  1RT1 A;  1D9F A;  3RR7 A;  1UWB A;  4CJ4 A;  2E6M A;  1J9A A;  3DLK A;  1JKH A;  1TKZ A;  1FXX A;  4JLH A;  1WSF A;  1MU2 A;  3AVM A;  4BDY A;  5J1E A;  3AV9 A;  5J2M A;  4M3X A;  4N47 A;  4IBN A;  4DWI A;  2OPQ A;  1IKY A;  3JSM A;  1VSM A;  1QSY A;  4N41 A;  1RBU A;  2ZQB A;  4IFY A;  4LH4 A;  4CJR A;  5J2P A;  3CM6 A;  4DTM A;  4LD0 A;  3QEX A;  3QEP A;  3WNG A;  3SNN A;  3TAF A;  3ZT2 A;  1U04 A;  3QEI A;  1RT4 A;  1U4B A;  2KZZ A;  3EYZ A;  1TKX A;  3NF7 A;  1X1P A;  2EHG A;  4FW2 A;  1J5O A;  4FJ9 A;  4M45 A;  4WE1 A;  3OVN A;  2O4G A;  2QXF A;  1T03 A;  1KVB A;  2Q3S A;  3SQ1 A;  1SV5 A;  3DYA A;  1YT3 A;  3VQD A;  5HP1 A;  3U3G A;  4CHN A;  3HVR A;  4FM0 A;  3AA3 A;  1UA0 A;  3O3H A;  4E0D A;  4ELV A;  4CK2 A;  4UQG A;  3V1O A;  4DLE A;  4IDK A;  5I3U A;  1SUQ A;  3DLB A;  1D9D A;  4AIL C;  3MEE A;  3ZSV A;  1RIL A;  4CIE A;  3KLH A;  2YNI A;  3P83 D;  3SJJ A;  1KTQ A;  4Z0U A;  1TK8 A;  1NK6 A;  1DTQ A;  3K57 A;  3C6U A;  2JLE A;  1Q9X A;  4OVL A;  4KKO A;  4ID1 A;  2YKM A;  1C0U A;  3LP3 A;  4AHU A;  4CJV A;  3OYG A;  3PX6 A;  3TAB A;  2G8W A;  4FZY A;  3DRR A;  1GOC A;  3PO5 A;  1C0T A;  1ZYQ A;  5CYM A;  3HST B;  2HB5 A;  4B9N A;  5SZT A;  1Z25 A;  3KKS A;  2OPS A;  4BWM A;  1LWC A;  4FVM A;  1A5X A;  4MFB A;  1TAQ A;  3T19 A;  5HRP A;  4O5B A;  1SKS A;  1HNV A;  1QHT A;  2HND A;  1Q8I A;  1C0M A;  1I3A A;  1WAF A;  4LSN A;  4RW6 A;  4TSX A;  4ZHR A;  1TAU A;  3AO5 A;  1DLO A;  4H4O A;  2A1R A;  4CER A;  4NCB A;  3OYE A;  2P5G A;  5FDL A;  3OYK A;  4FK4 A;  3S3N A;  4Y1C A;  5KRT A;  3CG7 A;  3L2W A;  2WOM A;  3JYT A;  2DTU A;  3F9K A;  3OYA A;  4DSE A;  3DM2 A;  1QE1 A;  5SWM A;  4CGI A;  1RCH A;  2YNF A;  4FJG A;  4K8Z A;  2G8F A;  4KB1 A;  2FBV A;  2NUB A;  4B9L A;  4I7F A;  3KD1 E;  4KFB A;  1BGX T;  3B6O A;  3LPU A;  3EZ5 A;  3MED A;  4YNQ A;  3ASM A;  3SI6 A;  1ASW A;  1T8E A;  3UIQ A;  3TAE A;  2Z1I A;  3DLH A;  5D3G A;  1WSE A;  2Y1J A;  3DRS A;  3P1G A;  4GVM A;  2ATQ A;  4ICL A;  1RT7 A;  4PA1 A;  3MEG A;  5CZ1 A;  4BWJ A;  4CGH A;  4CEF A;  4FLX A;  4YFU A;  3P5J A;  3S9H A;  1UAX A;  2IGI A;  4FJH A;  4KRF A;  2ZE2 A;  4CHP A;  4RW7 A;  4PQU A;  3VQ8 A;  5HRS A;  4G1Q A;  2PZS A;  1HQU A;  3AVJ A;  3HPO A;  3V6D A;  4KTQ A;  1FKP A;  4IG3 A;  3NGI A;  2OYQ A;  4AHC A;  2P1J A;  1BI4 A;  4CEB A;  3NAE A;  3LZI A;  2OZS A;  2B6A A;  3VQ7 A;  4CFB A;  4DTX A;  1TKD A;  2ETJ A;  5EU7 A;  3LAL A;  4NYF A;  4M3R A;  2X74 A;  4AHS A;  1TL3 A;  1D8Y A;  2JGU A;  2X6S A;  4FLW A;  3H08 A;  4PUO A;  4I2Q A;  4IFV A;  3KKR A;  1LAW A;  5KI6 A;  3DLE A;  4CEE A;  4CF0 A;  3NF9 A;  3V9S A;  3VA3 A;  4DFK A;  3OYH A;  4E7J A;  4FJ8 A;  5FRM A;  2RPI A;  3KLI A;  1S1X A;  1VSJ A;  3OYJ A;  1RTJ A;  1ZBU A;  1YVU A;  3SUQ A;  1LW2 A;  1C6V A;  1Q9Y A;  1EXQ A;  3C94 A;  3AVF A;  1NK0 A;  3KLE A;  3DLG A;  1D5A A;  1W0H A;  4CGG A;  1S9G A;  4NYN A;  3RMC A;  4DQP A;  1KCF A;  3T3F A;  3ZSR A;  3ZT4 A;  4BE2 A;  4CJL A;  3ZSO A;  1IKV A;  2P51 A;  4DS4 A;  2VG7 A;  4CIG A;  1JLB A;  3MXJ A;  3QIN A;  4HCB A;  5CYQ A;  1WNS A;  1CXQ A;  4FJN A;  4Z4G A;  2YNH A;  4CHY A;  4HHT A;  1RT5 A;  1KVA A;  1QS4 A;  2FC0 A;  4DSF A;  1X9W A;  1K6Y A;  2IAJ A;  4DSL A;  3F73 A;  4DF4 A;  1NOY A;  1T7P A;  3TAR A;  4MQ3 A;  3PX0 A;  1CXU A;  2XY8 A;  3IRX A;  4CHQ A;  1JLE A;  4DFJ A;  2VWJ A;  1S1U A;  3VQC A;  3NH0 A;  2Y1I A;  2RN2 A;  3IAY A;  2HW3 A;  3AA5 X;  2OA8 A;  3LAM A;  3AVC A;  1VSF A;  2D5R A;  4B8C A;  1U45 A;  1BI4 B;  1RT3 A;  3AVA A;  3SV3 A;  1L3U A;  1ITG A;  5KGW A;  4BE1 A;  3AVK A;  4FXD A;  4CK1 A;  1I39 A;  4OPK A;  4CJ3 A;  1VSI A;  4DFM A;  1HNI A;  3SPZ A;  3OYB A;  3C6T A;  3KLF A;  2XO7 A;  3BGR A;  3HP6 A;  3KD5 E;  4K8X A;  2QKB A;  1W9H A;  1RT6 A;  3WNE A;  5DK5 A;  4E89 A;  2YHA A;  4DMN A;  4CEZ A;  4I9Q A;  1A5W A;  3AVG A;  4KTW A;  1TK5 A;  3HYF A;  4DF8 A;  4FLU A;  4DU1 A;  4B9V A;  4KI6 A;  1ASV A;  4CJK A;  1QQC A;  4CEC A;  4KPY A;  3MXM A;  5KRS A;  3T1A A;  1L3T A;  4NCA A;  4OLA A;  4DTU A;  5J2Q A;  4NCG A;  4EZ9 A;  3IG1 A;  4O55 A;  3VQE A;  4FLZ A;  4FLV A;  4CCH A;  2HVI A;  3SCX A;  2BDP A;  1J53 A;  2HHT A;  1T05 A;  3OJU A;  4W5N A;  2E6L A;  1L5U A;  3VQB A;  2ITG A;  4FM1 A;  5HLF A;  1CLQ A;  1N5Y A;  2XY5 A;  2HHQ A;  1TKT A;  1LW0 A;  1UA1 A;  4KHU A;  4DQR A;  1BIZ A;  1NK7 A;  3O4Q A;  2X78 A;  3K5M A;  3O4N A;  4M3Z A;  2BAN A;  3NCI A;  1ASU A;  4KHN A;  4CJ5 A;  4Z4C A;  1JLA A;  4CE9 A;  2BE2 A;  4FJ5 A;  1G15 A;  3L2R A;  3SV4 A;  2DY4 A;  3CFO A;  5JS2 A;  3NGZ A;  4DFP A;  4DQS A;  1SKW A;  1X9S A;  4Q5V A;  4HUE A;  1KRP A;  1B9F A;  4GMJ B;  4O0I A;  2HHV A;  1J54 A;  4Z4F A;  3D0P A;  4Y1D A;  1XWL A;  2HHX A;  2GBZ A;  3K5O A;  3KK2 A;  3L8B A;  3AVI A;  3K5N A;  1WLJ A;  1BCO A;  1UOC A;  2F8T A;  1LAV A;  4CES A;  3NE6 A;  1B92 A;  1EKE A;  3VQQ A;  4FJJ A;  5HRR A;  2Z1H A;  4M3U A;  1QSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...