3WNHA

Cyclic hexapeptide pkzdnv in complex with hiv-1 integrase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
137
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
total genus 48
structure length 137
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wnhA00
1ASUA 2NUBA 3B6OA 4E7KA 4AHCA 3SV4A 1HJRA 4H4OA 4M3UA 1HRHA 2BDPA 2ATQA 4QOZB 3HO1A 4I9QA 4M45A 1BL3A 1FK9A 3P83D 4KTZA 3VA3A 4JS5A 4ELVA 3LPUA 3KD1E 4F2SA 4FK0A 1Y97A 3I0RA 1REVA 2DY4A 3KLFA 3OYGA 2HW3A 4KB1A 5I3UA 4KAZA 5FDLA 4Z4CA 3DOKA 1B9FA 1KVBA 2HNYA 1RTJA 3LDSA 2HMIA 4DQIA 1ASVA 4NCBA 1S1TA 4E89A 4W5TA 4XIUA 1RT6A 1SL2A 4DSIA 2BANA 3ZSVA 4DTSA 3HPGA 3S3NA 3LAKA 3QNOA 1BHLA 5SZTA 1XC9A 1SL1A 1N6QA 4CF8A 1JL1A 1GOBA 1S1XA 5J2PA 4I2QA 1JLQA 1CZ9A 3L3UA 4OKJA 4N76A 3M8RA 4Q0BA 1WSIA 3DYAA 3HSTB 1RTDA 3ULDA 1SKWA 3QLHA 1S1UA 3P1GA 3RMBA 4OKKA 3V6DA 2ITGA 3VQ8A 2WOMA 2FBVA 3S3MA 3QEPA 4J2AA 4FJ8A 2KFZA 1S9EA 1O1WA 3DRRA 1ZBLA 1SKSA 4KREA 3HK2A 1A5XA 1I39A 2VG5A 3B6PA 3ZSZA 4OVLA 3L2VA 4DTPA 3HL8A 1YTUA 3VA0A 5KTQA 4FZXC 2YKMA 3ZSQA 4FLXA 3OJSA 4DSEA 5FRNA 4M3YA 4OPJA 4DQRA 4CEZA 1KSPA 3NF9A 4PY5A 1IKWA 4FK4A 4CGJA 5HRRA 1WAJA 3AVLA 1ASWA 3QEVA 3SPYA 4KHQA 4N5SA 3DI6A 3AO3A 2ZQBA 4O5BA 4FJMA 4E3SA 1NK5A 5KRTA 3PX0A 4FLVA 3LALA 5HBMA 1NK6A 3KJVA 3NH1A 1IO2A 4LH5A 4LSNA 3OYDA 4ID5A 2X78A 4CJEA 2PYLA 4CIGA 2IOCA 2KQ2A 1Z25A 3WNGA 2OZMA 1VSEA 4E7LA 1HQEA 3QERA 1JLFA 2YNFA 1EETA 3TR8A 3NF7A 2VWJA 4IFVA 4ELUA 3L8BA 1RT5A 4CJQA 1L5UA 4CE9A 3WNHA 1VSMA 3AVFA 1SL0A 1EP4A 1L3SA 2KTQA 3CM6A 3KIOA 2AJQA 4M3ZA 1J9AA 2E4LA 4CEEA 4FJJA 1JLAA 4WE1A 1RBUA 4DFPA 3O3FA 5CYQA 3T1AA 4JLHA 1EKEA 3ZT3A 2G8FA 1NOYA 4FLZA 1UOCA 1NK9A 3QEXA 4F8RA 3DLRA 3PY8A 1T05A 2G8VA 4ZHRA 1LWFA 3VQ6A 3K5NA 1D9FA 3MEGA 4F3TA 4B9NA 2D0CA 4Z4GA 1Z26A 4ICLA 1C0UA 3OYCA 2A1SA 4OGEA 4O0IA 2IAJA 4M3RA 3ISNC 3NHGA 2A1RA 1RDAA 2IGIA 3KLGA 4JRQA 1LV5A 3K58A 1WAFA 1SUQA 3TANA 3HVTA 4DTMA 3SUQA 1U04A 4Z4FA 3K57A 1YTAA 4PA1A 4FK2A 4DTOA 3K5MA 1WSFA 5DMRA 4AHTA 5K14A 3PV8A 1TKDA 4F3OA 4KO0A 5I42A 3U3GA 4KHUA 1FKPA 2B5JA 3AA3A 3QETA 1W0HA 2P51A 3AVBA 1J5OA 4O44A 2HHXA 1F21A 3AVCA 1TKZA 4EZ6A 1WN7A 1IKXA 4E7JA 4CK1A 4DTJA 5HRPA 1BIUA 1X1PA 2GV9A 1JL2A 4FXDA 1HPZA 2KFNA 3DMJA 4YNQA 4DLEA 2P5GA 4DSLA 1R0AA 4E0DA 2OPPA 3L2UA 1T8EA 1VSFA 4Z4EA 3RWUA 3C94A 4CEFA 3LP0A 4AILC 3QESA 3D45A 2HHUA 4HHTA 3MXJA 4B8AB 3A2FA 5C24A 4JS4A 1L3VA 1TAUA 4B9TA 1C0MA 2BE2A 3U3YA 4MFBA 2YKNA 4DTUA 2HHSA 1UA1A 3QIPA 3KK3A 3SQ4A 3ZSRA 1RILA 4N56A 3IRXA 1U45A 2G8UA 4PUOA 3H08A 4BDZA 4DG1A 4J2BA 4EP4A 4FVMA 4FM2A 3L3VA 1IH7A 2D0AA 4C8NA 3PUFA 4DU3A 4N41A 4FJNA 1BQMA 3IS9A 4CF0A 1DTTA 3K59A 4DQQA 3ALYA 3MXIA 5JS1A 3VQ5A 3SUNA 1TK0A 1JXBA 1Q9XA 1EXQA 1JXEA 3VQ4A 2GUIA 3TAMA 2ETJA 1ITGA 3V1RA 4ZTJA 3QEIA 3VQDA 4CJRA 3SI6A 4FYDA 4DFKA 4CGHA 4EP5A 3V1QA 2Z1JA 1RBSA 1BIZA 2X74A 1NK0A 1LWCA 1Q8IA 1YT3A 4NCAA 1W9HA 3KK1A 5J2MA 3HJFA 3V9XA 3ZT1A 4KHNA 1BISA 1C1CA 1VRTA 4CJLA 4FJ7A 3V4IA 1VSJA 4FJIA 4QCLA 2VG7A 3MECA 3RR7A 3ZT4A 1RT4A 3TWHA 1QQCA 4I7FA 3O4NA 4GVMA 5CZ2A 1CZBA 4AHSA 3NH0A 4LSLA 5J2NA 3NBPA 1C0TA 3LPTA 4KKOA 3VQAA 2O4IA 1WSHA 1DTQA 4KB0A 5KGXA 3LP2A 4GW6A 2E6MA 3HP9A 2ZE2A 3L2WA 3LP1A 4OJRA 3V81A 4O0JA 1A5WA 4KTWA 3SJJA 4KI4A 3OYHA 1UWBA 4B9UA 3G0ZA 2RN2A 2IC3A 3OYKA 1RDDA 2RF2A 3KLHA 3DLHA 1B92A 3VQEA 4W5OA 4KHYA 4CHOA 2XO7A 3AVHA 3AVKA 3HT3A 3TARA 1MU2A 3AA2A 3ASMA 2RKIA 4CF1A 1NKBA 3KTQA 1RTIA 2E6LA 4FCYA 3V9WA 1KCFA 3RRHA 3U6FA 3PX4A 3TAGA 4K8ZA 3C95A 1S1WA 4Z0UA 1KRPA 1BI4A 3UIQA 2Z1IA 4B9VA 3D0PA 3PO4A 3M8SA 4W5RA 3I0SA 3HM9A 3CQ8A 3OYAA 4HVJA 4B3OA 4OGCA 4FW1A 4CIEA 4GMJB 3RMCA 4C8MA 4E19A 4E1MA 2XY7A 1KVCA 3VQPA 1X9MA 4NCGA 2YNIA 4CEDA 4FJLA 1QS4A 2GBZA 4HUGA 3PO5A 1RTHA 4DFMA 1WSGA 4CJ3A 3QNNA 1RBVA 3LWMA 4AHUA 5T7BA 2Z1GA 3NH2A 3QO9A 1FXXA 1RT1A 4IG3A 3K5LA 3S3OA 2I5JA 3JYTA 3TAFA 1YVUA 4I2PA 2XY6A 4CHNA 4DSKA 4IKFA 3EYZA 4ZTFA 4OLBA 3WNFA 4DTNA 2YNHA 1XI1A 4Y1CA 1LWEA 2IDOA 4W5NA 4F4KA 4DQPA 4FLUA 2LSNA 4IBNA 2HVHA 1RT3A 4CECA 1KLMA 4Z4HA 4LY7A 1VSDA 1K6YA 1TL3A 2KZMA 2VWKA 3NCIA 4CJSA 3SQ1A 3TABA 1CLQA 4DLGA 2PZSA 3RRGA 3KKRA 3NGZA 1LAWA 3CFOA 3NGIA 2DTUA 4RW9A 3LP3A 1NKCA 4E7HA 4BWMA 2RPIA 1GOCA 2QXFA 3M8PA 4OKEA 1NK8A 4C8KA 1BCMA 2FBXA 1JKHA 3AO5A 5HRNA 3EY1A 2HNDA 2EX3A 2Y1JA 3LZJA 1QSLA 3DOLA 4DU4A 5SWMA 4ELTA 1X9SA 4FJKA 3AO2A 3SUOA 2HB5A 1VSLA 4FJGA 1S6QA 1IG9A 3KLEA 4E7IA 2XHBA 4H4MA 4DTRA 5CYMA 3KKSA 2F96A 2OPSA 1TL1A 4LH4A 1RNHA 4CEQA 4CF2A 2YHAA 2G8HA 2QK9A 3SQ2A 3SNNA 1QSYA 4KI6A 1XHXA 1JLBA 3OVNA 1N5YA 4CJTA 1BQNA 5KI6A 3JSMA 2F8TA 4CESA 2DFFA 3C6UA 3OYJA 3OYBA 4AH9A 1ZYQA 4CGIA 4QAGA 1QHTA 4CFCA 3ZSXA 2OPQA 4AHRA 4CJ4A 1FKOA 2P5OA 3E01A 1NK4A 3THVA 1WLJA 3DLKA 3CG7A 5CY4A 2Z1HA 2XRIA 4IFYA 4OPKA 3OS2A 4RW6A 4F2RA 1I3AA 1HQUA 4Y1DA 3BDPA 3SQ0A 1VSIA 3NGYA 4CJWA 2FBYA 4BE2A 1HNVA 3AVJA 3F73A 3S9HA 3TAQA 4M3WA 1U48A 4IDKA 3BGRA 4MQ3A 1VSKA 2X6SA 1NOZA 4C8OA 5D3GA 1ZBFA 1RT2A 3MEDA 1RT7A 1T03A 1J53A 4CIFA 4CHQA 4PQUA 1TGOA 1NJZA 1DLOA 4LD0A 3SV3A 1JLCA 4DTXA 5HROA 4KFBA 4AHVA 1S9GA 2P1JA 3NAEA 3OS1A 3HP6A 2G8WA 2Q3SA 2OZSA 4CFDA 3SUPA 2Y1IA 2R7YA 3AO1A 4JRPA 1ZBUA 3V9UA 4CGFA 3OYIA 4CJFA 1RBRA 4R5PA 4DS4A 3ZCMA 5KRSA 1X9WA 4B9LA 4TSXA 4FZYA 4CHYA 2B4JA 1L3UA 1T7PA 1HYSA 1LAVA 4YFUA 3RMDA 5FRMA 1SV5A 4BE0A 4FLTA 3O4QA 1J54A 3MAQA 3AVNA 4L8RB 1JLGA 3HVRA 2XY5A 3LZIA 1BGXT 3VQBA 3VQQA 1HMVA 3AA4A 3DLEA 4DFJA 1Q9YA 3OJUA 3L2RA 3AVMA 5EU7A 1S6PA 4RG8A 1A5VA 3CFPA 3FFIA 3CYMA 1TK8A 3KK2A 1XWLA 2F8SA 1EX4A 2YHBA 2D0BA 3NF8A 4I9LA 4CGDA 4DU1A 3QEWA 1C1AA 1TKTA 4CHPA 2HHWA 4CK3A 2ZD1A 1KFDA 4HTUA 4B08A 4CF9A 2G8KA 3KD5E 3LAMA 4FM1A 2FC0A 4KV8A 1XHZA 1S5JA 2O4GA 3VN5A 1ZBHA 3CFRA 2YNGA 3ITHA 4CJPA 1IKYA 4DSJA 3G10A 3O3HA 3TAEA 1WSEA 5KGWA 3RTVA 3T3FA 1NJXA 1KTQA 2W42A 4M42A 2FBTA 4RW4A 1VRUA 3ZT0A 4HUEA 2HHQA 3ZSYA 2HHVA 3RMAA 5C25A 2WONA 3OYLA 5HRSA 3NDKA 3SYZA 4B9MA 4C8LA 4FJ9A 3NF6A 5CZ1A 4HCCA 4DMNA 3ZSWA 3OYEA 5HLFA 1QTMA 4CGGA 1CXQA 4BACA 5J2QA 3QIOA 4M3TA 4NYNA 3RR8A 1NK7A 4FJHA 1ZBIA 3CM5A 3AA5X 3DM2A 3NFAA 2DFEA 3AVAA 2BGGA 4ID1A 4CJUA 4BDPA 3OYNA 4Z4IA 1B9DA 1RDCA 1D8YA 3QINA 4FZZA 4FJ5A 4DF4A 3HPOA 3T19A 1NJYA 3DLBA 2KW4A 1LW2A 1BCOA 3HYFA 1WNSA 3VQ9A 1C6VA 3ZSOA 3AO4A 1NKEA 2YV0X 4CJVA 3V9ZA 1D5AA 4B8CA 4CJKA 4DS5A 3L2QA 4B9SA 4FJXA 3C6TA 3ZT2A 1NJWA 1KLNA 4UQGA 4CHZA 3LANA 4H8KA 3M8QA 4W5QA 5HP1A 5JS2A 5DK5A 3OYMA 4N47A 1TVRA 3EZ5A 5C42A 3MXMA 1D9DA 2PYJA 3IAYA 4OLAA 1S1VA 3HPHA 1WSJA 3HXMA 4G1QA 4DSFA 3KLIA 1BI4B 4DWIA 4CEOA 3OY9A 1RBTA 1TKXA 4CJ5A 4FM0A 4CFAA 2IS3A 3V9SA 4KPYA 3TI0A 2OYQA 3SZ2A 3MEEA 4CERA 1G15A 4KTQA 1HYVA 2X6NA 4RW7A 3WNEA 4BDYA 1U49A 4CK2A 3I8DA 1UAXA 4KRFA 3AVIA 2EHGA 2DFHA 3V1OA 1KFSA 4K8XA 3OYFA 1TAQA 3VQ7A 4J2DA 4E1NA 2G8IA 4EZ9A 1LW0A 1U47A 4HUFA 3LWLA 3P5JA 2KZZA 3VQCA 3AVGA 3SPZA 2HVIA 1C1BA 1KVAA 4BE1A 1UA0A 3DLGA 2HHTA 2XY8A 4RW8A 1QSSA 1CXUA 1L3TA 3F9KA 4Q5VA 2PY5A 4CEBA 1VK0A 4BWJA 4CEAA 3TAPA 4O55A 4KHWA 4PWDA 4FLWA 2JLEA 4J2EA 1RDBA 4CFBA 2VG6A 1TV6A 3DRSA 3DRPA 3O3GA 1U4BA 1SKRA 1QE1A 4IG0A 1JLEA 4CCHA 3OS0A 2QKBA 4KHSA 4NYFA 4DQSA 4DF8A 1TK5A 4M41A 3NE6A 4FLYA 3AV9A 1GOAA 3PX6A 2JGUA 1VSHA 4FW2A 4M3XA 3K2PA 5FROA 1IKVA 5J1EA 4O4GA 2B6AA 3K5OA 2QKKA 2OPRA 3IG1A 4HCBA 3SCXA 2OA8A 1RCHA 2HNZA 2D5RA 1HNIA 5E41A 1HYZA
chains in the Genus database with same CATH superfamily
1NGFA 3B6OA 4AHCA 4DV2K 4M3UA 4QOZB 4I9QA 3SBTA 3P83D 5AFUA 3GDQA 3VGMA 3LPUA 3SBGA 2JWLA 3I0RA 2DY4A 3CHWA 5IT9O 3FZFA 2UXBK 1Q86O 3GG4A 4KAZA 4FPBA 3G4SN 3PSIA 5FDLA 3DOKA 2F7TA 4H03B 4NCBA 1S1TA 4XIUA 2BANA 1HR0K 3HPGA 1BA1A 3CCMN 1N6QA 2CGKA 5J2PA 1JL1A 1GOBA 4N76A 3M8RA 3CC2N 4Q0BA 3TSPA 3ULDA 3H1VX 4BRCA 1TUUA 3RMBA 1RGIA 3V6DA 2HBJA 5FLXO 2FBVA 3S3MA 4J2AA 2KFZA 5C2FA 1S9EA 3DRRA 3UKUA 1ZBLA 1SKSA 3P31A 1A5XA 1I39A 1HKCA 2VG5A 4KH6A 4JKCA 3L2VA 4DTPA 2YKMA 5EXWA 2RHKA 1VQ7N 4A59A 4OPJA 2F9WA 3Q7BA 4DQRA 1TUYA 1KSPA 4PY5A 3JAMO 4KHQA 1SZ2A 3AO3A 2ZQBA 4FJMA 5CHIA 1WUAA 3FGUA 3PX0A 4AM7A 1MWKA 3H3NO 4LH5A 2YHYA 4WQ4A 5JLHA 1YJ9N 4E7LA 4FWRA 3TR8A 4IFVA 1M90O 2E8AA 3I56N 1L3SA 1IBKK 5LY3A 4M3ZA 2E4LA 4CEEA 3O3FA 3T1AA 4JLHA 1EKEA 2G8FA 1NK9A 1UOCA 1VQMN 4FVUA 5AQJA 4OPHA 4CJ7A 4ZHRA 3AARA 2YI1A 4F3TA 4B9NA 1ZBSA 4ICLA 3OYCA 2A1SA 4O0IA 2IAJA 3N4QA 3CCRN 1VQ4N 1SUQA 5EY4A 4DTMA 3SUQA 4G9ZA 3K57A 4BR0A 1LOTB 4PA1A 3K9JA 5ADXA 3NVKA 2Q0RA 3LDNA 1TKDA 4KO0A 1NGDA 4DCHA 2B5JA 2GUPA 4O44A 1T6CA 1JCEA 4EZ6A 3Q7CA 5KPRA 2HOEA 3EO3A 4BRLA 5AQSA 1HPZA 2YX6A 2P5GA 2E1ZA 3DWLA 1VSFA 1T8EA 4BY9C 3C94A 3LP0A 1Q82O 3MXJA 4LFCK 1DGKN 1X3MA 2KLAA 1L3VA 1C0MA 4MFBA 4DTUA 3QIPA 4IEIA 2G8UA 5AQHA 4DG1A 4CZMA 4EP4A 4FVMA 5H1SQ 5AR0A 4C8NA 2D0AA 3VGLA 3PUFA 4DU3A 2F4VK 3ALYA 1NMNA 3PIOL 3VQ4A 3HTVA 3ENHA 2O8CB 4ZTJA 4H0VB 3VQDA 3D2FA 1Q8IA 3HJFA 5JMVA 1VRTA 4FJ7A 1QQCA 3QESA 5CE3A 1DTQA 3LP2A 4CZHA 3TTCA 3OYHA 1QHAA 2HBKA 2P9PB 2RF2A 3VMFB 2YJEA 4JKEA 4CHOA 4NXMK 3BY5A 2UUCK 3TARA 1MU2A 3ASMA 2RKIA 4CF1A 2AA4A 1RTIA 4B1WB 3PX4A 3MWTA 3WEEA 2NRHA 4B9VA 3H6EA 1X9JA 4UY8O 4W5RA 3I0SA 3HM9A 3OYAA 4B3OA 5LMUK 4E19A 3MDQA 2P9LB 5M1QA 3VQPA 3IMXA 1X9MA 4IO8A 3A5NC 4FJLA 5AQZA 1QS4A 1T6DA 4HUGA 3PO5A 3KHYA 3QB0A 4J8FA 3LWMA 4AHUA 3CPWM 4IG3A 1RT1A 2V7ZA 2I5JA 3TAFA 1YVUA 1YHQN 1BO5O 1YVNA 4OLBA 3ULEA 3LM2A 3EE9A 3CIPA 2HSTA 1YI2N 2IDOA 4W5NA 5I9EB 3KZBA 4FLUA 2LSNA 4IBNA 1KLMA 4Z4HA 3C7NB 4LY7A 1VSDA 1TL3A 4YOUA 2KZMA 4WYBA 4DLGA 2PZSA 3KKRA 3NGZA 1LAWA 3LP3A 1NKCA 1YIJN 3M8PA 4DR4K 3MWPA 1NK8A 1DEJA 4ELTA 5CR4A 3VGKA 2QTDA 1BWFO 1VSLA 4FJGA 1S6QA 3KLEA 3MN7A 4DTRA 4H4MA 3ATUA 5CYMA 4JI1K 2ITMA 2QK9A 2YHAA 2Q2RA 3SNNA 1QSYA 1N5YA 3MK6A 3OVNA 1P8ZA 2QM1A 1BQNA 1DKGD 2BTFA 4CW7B 3HM8A 4PKIA 4AH9A 3THXB 4QAGA 1QHTA 4CFCA 1K8KA 3ZSXA 1HUXA 2OPQA 4AHRA 1FKOA 3THVA 1WLJA 1EO1A 3GL1A 2XRIA 4PHTX 4F2RA 4JYAK 2E5LK 1I3AA 1HQUA 3S9HA 4CJWA 3AVJA 2ZM6K 3BGRA 3G25A 1VSKA 2X6SA 3UKRB 2ASMA 1ZBFA 1RT2A 3BZKA 3MEDA 3L4QA 1HNXK 5BR9A 4O8KA 4FSVA 4CHQA 1DLOA 4LD0A 1HPMA 3NAEA 1S9GA 3E9OA 3OS1A 3I55N 4FPAA 2Q3SA 2HHHK 2O8BA 1NU0A 4CGFA 3FR0A 4DS4A 3ZCMA 5KRSA 4CHYA 1L3UA 1LAVA 5AZIB 5FRMA 5BRHA 2A3ZA 4BE0A 4L8RB 3CD6N 1JLGA 3HVRA 4WFNL 1BGXT 3VQQA 3AA4A 4DR3K 3L2RA 5EU7A 4RG8A 3CFPA 3H3OB 3CJ9A 2OANA 2F8SA 2D0BA 4NLCA 3QEWA 5M1PA 3U9DA 4HTUA 4CF9A 3O6WA 2CGLA 3CFRA 3QFUA 4ILGB 3G10A 3EZWA 4NXNK 3RTVA 2W42A 3WQUA 1VRUA 1EWQA 3P4IA 2BUPA 1FJGK 1Z05A 1N8RO 4B9MA 3O8MA 3EKUA 4DMNA 5AQRA 5HLFA 4BACA 4NYNA 4FJHA 1ATRA 3AA5X 3DM2A 1Q7YO 4CJUA 3O1WA 3CQXA 4ILJA 5FPMA 3HYFA 1LW2A 3VQ9A 1K73O 2QWMA 2YV0X 4CJVA 3UE5A 4B8CA 4DS5A 3DLLL 4WQ5A 2P9IB 3CMEN 3ZT2A 1IBMK 4UQGA 3LANA 3M8QA 1S22A 5JS2A 5DK5A 4A61A 5BR8K 3EZ5A 1D9DA 4G1QA 1BI4B 4FWLA 3OY9A 4H0YB 2IS3A 4KPYA 1NGHA 3TI0A 2OYQA 1OVQA 4GKKK 3MEEA 4CK2A 5FPEA 4XEIA 2EHGA 3VQ7A 2UUBK 3ID6A 4EZ9A 2E1YA 4BGAA 3P5JA 3AVGA 1C1BA 4B1UB 3MN6A 2HHTA 1W97L 4H5TA 4JI7K 3F9KA 3R6MA 4CEBA 1SAZA 4PWDA 2VG6A 3DRSA 3O3GA 1KAXA 1P90A 4CCHA 2O8CA 3OS0A 4NYFA 3GOIA 5F1XA 3IUCA 3NE6A 4HWIA 4ISFA 2OPRA 4M7YA 1BA0A 3DXMA 2P9KA 1RCHA 5E41A 1ASUA 4BRHA 4E7KA 1D4XA 3CJ7A 4RCHA 3SV4A 4H4OA 2BDPA 2ATQA 1BL3A 1FK9A 4LFBK 3VA3A 1VQON 4FK0A 4F2SA 2E2OA 5AQWA 3KLFA 3OYGA 4KB1A 5F0XA 2P9PA 3ZX0A 4Z4CA 1B9FA 1KVBA 4B3TK 2HNYA 3LDSA 1ASVA 5KPTA 5C2DA 4E89A 3TPQA 4K42A 3ZSVA 3S3NA 5GAGP 3QNOA 1BHLA 3SLCA 4IOXA 3MX2A 4OKJA 3P1GA 2P9LA 4OKKA 2ITGA 2WOMA 3CJ1A 3D7EO 3RVCA 1VQ6N 1ZXOA 3E66A 2D0PA 3J7ZO 4KREA 1HX1A 1QQMA 3A5OC 3ZSZA 4Z94A 3B6PA 1M1KO 4OVLA 3ENOA 3ZSQA 4IDHA 4NLBA 4FLXA 5FRNA 4M3YA 5AQTA 3SAHA 4FK4A 4CGJA 5HRRA 1WAJA 3AVLA 3DI6A 3HI0A 4AM6A 1HKBA 3THWB 4E3SA 5KRTA 4GV3A 3LALA 3C7NA 3KWGA 4JKFA 4JI6K 1Z25A 1VSEA 4YORA 3NF7A 1RT5A 1L5UA 4CE9A 2KTQA 3QFPA 3KIOA 1J9AA 4BC2A 2QWPA 4FJJA 4DR5K 3WEEB 4F8RA 3H1QA 4IJAA 2Q0UA 1T05A 3VENA 4ISEA 4L3QA 1RDWX 5AQFA 5AJ3K 3ISNC 4X62K 3NHGA 1VQNN 1RDAA 2IGIA 3KLGA 4X65K 3K58A 3THXA 4CBUA 1U04A 5BPLA 2P9UB 3K5MA 3L6QA 4F3OA 5K14A 4DB3A 3QETA 2ZJRL 2P51A 2HHXA 3AVCA 1TKZA 3UKRA 5BRDA 3VF6A 3JXUA 3B8AX 4X64K 1IKXA 2F9TA 3P39A 4IO9L 1GLFO 1GLEG 1JL2A 1OH6A 4YNQA 1MA9B 1R0AA 4A5AA 3LDOA 4Z4EA 4CEFA 4AILC 3D45A 4LF9K 4B8AB 4YOYA 3A2FA 2EWSA 5C24A 4BRPA 4JKGB 4B9TA 2BE2A 4KBOA 2YKNA 5AQOA 5AZIA 4BVOA 1UA1A 3SQ4A 4N56A 3IRXA 3O9UA 4MDBA 3H08A 1IG8A 4BDZA 3F2KA 2V7YA 4DQQA 5JS1A 1JXBA 2VCPA 1JXEA 2YJFA 4JNEA 3TAMA 3OHRA 1ITGA 1VAZA 2PFUA 1K8KB 3O80A 1NJIO 4DV7K 3FZLA 4EP5A 3F5TA 1YT3A 4NCAA 1W9HA 3KK1A 2D4WA 3ZT1A 4ISGA 1VSJA 3MECA 3RR7A 5JVHL 1VQLN 1RT4A 3O4NA 4GVMA 1CZBA 2Q1NA 4LSLA 1C0TA 3AAQA 3LPTA 1NGAA 3VQAA 1WSHA 4GW6A 5LL6Z 3SMPA 3L2WA 3GBTA 3T7ZA 4O0JA 1A5WA 4KTWA 4KI4A 2O8BB 1UWBA 4E1JA 2RN2A 3OYKA 1K8AO 2ASOA 3KLHA 1KC8O 3VQEA 4BC3A 1NGJA 3AVHA 3AVKA 3D6RA 2P9IA 2NRXA 3AA2A 1NKBA 4WFBL 3GE1A 4K8ZA 1MDUB 2VWBA 1KRPA 1BI4A 4A57A 2QEXN 2JWKA 3QICA 3D0PA 3PO4A 4BG8A 2RE2A 1YF5L 3L4IA 2XY7A 2UXCK 1KVCA 4CZKA 2YNIA 2YHXA 1IV0A 4DHYA 3CJAA 4CJ3A 1QQOA 2FF6A 3WXLA 3QNNA 3NH2A 3K5LA 3JYTA 1YAGA 4DSKA 4LF4K 1VHXA 5DM6L 1NWKA 3WNFA 4DTNA 4H0PA 3CC7N 4DQPA 3VTHA 4CJSA 4JKAA 4PL8A 1CLQA 3PIPL 2DTUA 3NGIA 4BWMA 2QXFA 3NVMA 5BPMA 3AO5A 1XNRK 5HRNA 5GINA 4CI6A 2HNDA 2ZJPL 3AO2A 3SUOA 3DXKB 4E7IA 1YUWA 3K0SA 4DV3K 1QVFM 1JLBA 4CJTA 3L0QA 3JSMA 3CF5L 3O1BA 4GV6A 3C6UA 3OYJA 3G6EN 4B1YB 1Q81O 3CCLN 3KK7A 1YJWN 4CGIA 3J81O 4CJ4A 1C0GA 3E01A 4IFYA 3OS2A 4CZEA 3BDPA 1VSIA 4BE2A 1HNVA 2O8DB 2FXUA 4O8UA 5AZJB 1NOZA 4BR5A 4BRDA 2GTDA 4BRQA 1T03A 2A41A 1NM1A 4PQUA 1HKGA 1JLCA 4DTXA 4BROA 2HMPA 3CI5A 4KFBA 2P1JA 3HP6A 2P9SB 2G8WA 2FF3B 4CFDA 3SUPA 1EQYA 5AQXA 2Y1IA 3AAPA 3V9UA 3DXMB 2P9KB 1RBRA 2W6KA 1CZAN 3MN9A 4BRIA 4K41A 4CJFA 3ZEUB 2B4JA 1T7PA 4YFUA 3THWA 3AVNA 2XY5A 3LZIA 2UXDK 3VEXA 5AQQA 4WF9L 3OJUA 1A5VA 5GADP 3CYMA 2NRRA 4DV0K 1XWLA 4FWSA 5LJVA 4FOIA 4CK3A 3KVGA 3LL3A 5IWAK 5JLFA 1S5JA 2YNGA 3VTIA 1IKYA 4DSJA 3O3HA 5F2RA 4R79A 1WSEA 1QZ6A 2ZF5O 4M42A 3ZT0A 4EHUA 2WONA 3SYZA 4C8LA 4FJ9A 1I94K 4HCCA 4RWTA 4FWMA 1QTMA 1N36K 3OYNA 1Z6RA 4M7XA 2P9UA 1D8YA 2HBLA 3F9MA 2V52B 3T19A 2KW4A 1BCOA 1WNSA 1C6VA 3AO4A 1NKEA 2ZGYA 3TTFA 1WOQA 4MLEA 4CHZA 4H8KA 4W5QA 5HP1A 2PYJA 2FSNA 4DUZK 1TVRA 5C42A 3LM9A 3HPHA 4DWIA 3KLIA 4GNIA 1RBTA 4FM0A 4CZJA 4CFAA 1VQ5N 4CERA 4KTQA 1HYVA 3WNEA 3I8DA 1UAXA 4BRMA 3AVIA 1OH7A 1KFSA 4KRFA 4JKGA 4J2DA 3LDLA 2KZZA 3SPZA 1KVAA 4BE1A 3HZ6A 3DLGA 2J4RA 2XY8A 4FWQA 3A0IX 4Q5VA 1GLDG 2QXLA 4O55A 4FLWA 4J2EA 4GVEA 1TV6A 4FOEA 1QE1A 1JLEA 2QKBA 4KHSA 3TSQA 1TK5A 2E20A 4WFAL 5MLCQ 3AV9A 1VSHA 4FW2A 4PL7A 3K2PA 5FROA 2QKKA 4BRKA 4YOVA 3I8BA 1HNIA 1HJRA 3HO1A 4KTZA 4JS5A 1Y97A 4BQLA 3ZYYX 3C0BA 5GIPA 3SK3A 2HW3A 2FLOA 5I3UA 5AQGA 5E26A 1VQKN 1RTJA 2HMIA 1SL2A 4DSIA 3CXCM 1VQ9N 3LAKA 3AGKA 3SMSA 4U7BA 1XC9A 1SL1A 3O08A 1E4FT 1S1XA 1NGCA 4I2QA 3NMUA 4LF8K 3L3UA 3HSTB 5TKWA 1RTDA 1NG9A 3QLHA 1S1UA 4AQYK 4FJ8A 1O1WA 2V51B 4MO4A 1OH5A 3ZX2A 4QS9A 3HL8A 2FSKA 4DSEA 2IIRA 3NF9A 1IKWA 3SPYA 3QEVA 1ASWA 4N5SA 2VGMA 4IOAL 3BUZB 5DM7L 4FLVA 5HBMA 1VQ8N 3KJVA 4BRGA 1BUPA 4LSNA 3VPZA 4EAHD 2PYLA 3WNGA 3QERA 2VWJA 4ELUA 5BN8A 4CJQA 3WNHA 1VSMA 3AVFA 3VEVA 4M63C 1JLAA 4WE1A 5CYQA 3ZT3A 1U2VA 5EX5A 4LFAK 3DXKA 1NOYA 4FLZA 2CGJA 3VEWA 3BP8A 3DLRA 3PY8A 5C15A 1D9FA 2D0CA 4Z4GA 3U8XA 1C0UA 2I7NA 4M3RA 2A1RA 1LV5A 1WAFA 3ID8A 5AQIA 5EOYA 4Z4FA 1YJNN 1YTAA 4B3RK 1WSFA 5DMRA 4KHUA 1FKPA 3T1YK 2O8DA 5AZJA 4I6MB 4DR1K 4JV5K 2PAVA 2HF3A 1V4TA 2BH1A 2I7PA 4LC9B 1NBWA 4CK1A 1X1PA 2GV9A 4FXDA 4CZFA 2P9SA 4DLEA 5FPNA 2H3GX 3RSEB 3L2UA 4C1NI 3RWUA 3P38A 4BC4A 1RDUA 4JS4A 3ZEUA 4FWNA 3U3YA 5ELZA 2KKZA 4YOXA 1U45A 4A2BA 3QBWA 3PLAA 3EKSA 4J2BA 5TKYA 4FM2A 4B9QA 3L3VA 1IH7A 4N41A 4OPAA 1BQMA 1SS6A 3IS9A 4CF0A 3MXIA 1WBDA 4FJNA 1YXQA 1EXQA 3IFRA 2GWJA 2GUIA 2ETJA 2KHOA 5M1NA 3ZLJA 1OKJA 1OVYA 3QEIA 5GIOA 3SI6A 3O4WA 3SAGA 3V1QA 2FSJA 1RBSA 2X74A 1NK0A 1K9MO 5J2MA 3V9XA 4KHNA 1XUPO 1BISA 3C6HA 4CJLA 3V4IA 4FJIA 4QCLA 2P9NB 3ZT4A 4KH4A 1YTUA 2OTJN 2OA8A 3NH0A 5CZ2A 4AHSA 3I33A 3QBXA 2VYPA 2O4IA 1ATSA 3CETA 3HP9A 3LP1A 4OJRA 3V81A 1GLAG 3SJJA 2VGNA 1QZ5A 2O8EB 1WB9A 1NLVA 2IC3A 4YOTA 1RDDA 4W5OA 4KHYA 5C10A 3RRHA 2E6LA 4FCYA 3V9WA 1KCFA 3U6FA 3J7AP 3C95A 4Z0UA 3UIQA 3M8SA 3R9PA 3CQ8A 4HVJA 4OGCA 1WBBA 2Q31A 4FW1A 4CIEA 4GMJB 3CCQN 3RMCA 3S41A 1T3VA 1JJ2M 4DUYK 1GLCG 5BPNA 2GBZA 1RTHA 3ZETA 1RBVA 4H5WA 4C1NK 1GLJO 2E2QA 5T7BA 4KHPK 1FXXA 5AQVA 4JKDA 1RFQA 2YNHA 4Y1CA 1E4GT 4F4KA 2HVHA 4CECA 3WQTA 3IDHA 5GAEP 4WQ5C 3NCIA 1IJJA 2GX9A 3SQ1A 3LDPA 3RRGA 4QS8A 3CFOA 4RW9A 3OW2M 1GOCA 2E88A 3H46O 4OKEA 2FBXA 2GWKA 3EY1A 1QSLA 3DOLA 1X9SA 5AQPA 3T69A 1MWMA 2XHBA 1N33K 3D2EB 3KKSA 3CCVN 3CCJN 2GELA 4KI6A 3OA9A 4JI5K 3EN9A 2F8TA 4CESA 2DFFA 1XNQK 3OYBA 1KAZA 1ZYQA 3N4PA 1NK4A 5EVZA 3CG7A 5CY4A 5LMNK 2Z1HA 2O8FB 4OPKA 4NO7A 1Q18A 4Y1DA 2WTUA 3VEZA 3SQ0A 2FBYA 3F73A 4M3WA 4IDKA 4MQ3A 3BEXA 1HNZK 1J53A 4CZIA 1TGOA 1NJZA 3SV3A 1HNWK 4BVPA 3O9TA 2R7YA 1ZBUA 1BG3A 4PKHA 1X9WA 4YY3K 4OO1J 4DR2K 3RMDA 4FLTA 3MAQA 3THYB 5M1FA 4DFJA 3DLEA 1S6PA 3MX5A 3WT0A 1TK8A 2CH5A 3A8YA 4I9LA 4BR7A 1J5EK 1G99A 3A5LC 3KD5E 4H0XB 2FC0A 4FL9A 3VN5A 1HJOA 3ITHA 4DV1K 5JICA 1O13A 5KGWA 3O9QA 3MCAB 1KTQA 1NJXA 3EE8A 3ZSYA 2HHVA 3RMAA 5C25A 3OYLA 3CJBA 3H45C 5CZ1A 4A5BA 4FO0A 4CGGA 1NGEA 5J2QA 4M3TA 3CM5A 3KWIA 2DFEA 3AVAA 2BGGA 4ID1A 3A5MC 1NNEA 1RDCA 3FZMA 4IEEA 4FZZA 3MN5A 4FJ5A 3QMLA 3CCUN 3WXKA 4CJKA 4B9SA 3L2QA 3VOVA 4XH5A 4I6MA 1TYQB 3WXIA 2A42A 3W0LA 3IAYA 4OLAA 4IXCA 3HXMA 1TKXA 3M3ZA 4EFHA 3V9SA 4DKWA 3RSEA 4BR2A 4BQZA 2W6LA 4OX9K 2X6NA 3BZCA 1U49A 5A2QO 2OTLN 2DFHA 2NLXA 4XH4A 4YDUC 3HRGA 4K8XA 3OYFA 1TAQA 1DT9A 1LW0A 1U2VB 1U47A 4HUFA 2QW9A 2A6AA 4H5VA 3VQCA 1OH8A 3M5RA 2VQEK 1QSSA 1CXUA 2QWOA 3EEQA 2PY5A 1VK0A 4BWJA 1BOTO 4WCEL 3CCEN 4CFBA 3DRPA 4YHHK 1SKRA 4IG0A 2IVNA 3AY9A 1XMQK 5BREA 3WXJA 4F9OA 4DF8A 4M41A 1GOAA 3PX6A 2JGUA 3R3LA 1GLLO 1E3MA 1IKVA 5J1EA 2B6AA 4JK9A 4HCBA 4GKJK 2P9NA 2HNZA 2ZGZA 4EHTA 1HYZA 2NNWA 2NUBA 4A2AA 1HRHA 3EL2A 4M45A 4ELVA 3KD1E 4H5RA 4JI3K 4X66K 1REVA 2O8EA 3WUHA 4BGBA 4DQIA 1ATNA 4W5TA 5AQNA 1RT6A 4AF1A 4DTSA 1V4SA 5E84A 4V19S 5SZTA 5AQUA 4QS7A 1U6ZA 4CF8A 3M6GA 1EWRA 1JLQA 1CZ9A 1ESVA 3TU5A 4BRFA 4IFEA 1WSIA 3DYAA 4DV5K 4BREA 1HLUA 1SKWA 4JEPA 4JI8K 3VQ8A 4BR9A 3QEPA 3HBTA 2NRZA 4Y0WA 4BC5A 3HK2A 5JVGL 1SQKA 3VA0A 5KTQA 4FZXC 5AFUH 3CERA 3OJSA 4B1VA 3QDKA 4CEZA 4A62A 4CD3A 2NRVA 4JHDB 4CZLA 4O5BA 1NK5A 1NK6A 3NH1A 1IO2A 3OYDA 3W3DA 4ID5A 1ILYA 2X78A 4MLHA 4CJEA 4CIGA 3G71N 1NGIA 2IOCA 2KQ2A 5AQMA 2OZMA 1HQEA 1JLFA 2YNFA 1EETA 3L8BA 4WQ4C 4DQ8A 1SL0A 1EP4A 2AJQA 3CM6A 1RBUA 4DFPA 4JI4K 2W40A 1N32K 3FZKA 3O9SA 3QEXA 4JK7A 3E9LA 3D2EA 2G8VA 3ATVA 1BDGA 1LWFA 3VQ6A 3K5NA 3MEGA 1Z26A 4MO5A 4LF6K 2D0OA 4OGEA 4BRAA 5BRFA 4JRQA 4DV4K 4LF5K 3TANA 1NMDA 5GAHP 4JI2K 3HVTA 4BRNA 4CBXA 3ZETB 4FK2A 3VERA 4DTOA 4AHTA 3PV8A 4CBWA 5I42A 3U3GA 2O8FA 3OTOK 1QQNA 3AA3A 1J5OA 1W0HA 3AVBA 1F21A 2PBDA 3HOTA 5AQYA 1WN7A 4E7JA 2QWRA 4DTJA 5HRPA 3FZHA 1BIUA 2Q36A 4JD2B 4LF7K 3O9RA 2KFNA 3DMJA 5C0YA 4DSLA 1QVGM 1W7AA 2OPPA 4E0DA 1IBLK 4JKBA 5B8HA 4B3SK 3SAFA 2HHUA 4FWOA 2QWNA 4HHTA 4H0OA 1J6ZA 1TAUA 4K43A 3VF4A 2HHSA 3KK3A 3DJCA 1RILA 3ZSRA 3THYA 3OBWA 4PUOA 1LCUA 5ADXH 1Y64A 1DTTA 3K59A 1X3NA 5KQ8A 3FLCO 4DR6K 3VQ5A 3SUNA 1TK0A 3T1HK 1Q9XA 3VF2A 3V1RA 2QI2A 4BG9A 4GY2B 4CJRA 1KAYA 4FYDA 4DFKA 4CGHA 2Z1JA 1BIZA 1LWCA 1FW6A 1C1CA 4FWPA 2VG7A 3TWHA 5J2NA 4I7FA 2XY6A 4ILHA 3NBPA 4KKOA 4KB0A 5KGXA 1JCFA 2E6MA 2ZE2A 3HOSA 4B9UA 3G0ZA 4MDAA 3K9KA 3DLHA 3WXMB 1B92A 3J8AA 1T44A 2XO7A 2QWQA 3HT3A 3MMVA 3KTQA 1TYQA 2Q97A 2ZJQL 3TAGA 1XC3A 1S1WA 4U67L 2Z1IA 2ZWHA 3IKMA 3CQYA 4C8MA 4NB4A 4E1MA 5KQDA 3VESA 5C12A 2NZTA 4NCGA 4CEDA 3UKUB 3C6AA 4DFMA 1WSGA 2Z1GA 3QO9A 2ASPA 2VQFK 3S3OA 1VQPN 4I2PA 4CHNA 3BF3A 3J80O 4IKFA 5AQLA 3EYZA 2E2PA 4ZTFA 1H1VA 5HL7L 4B1ZA 1XI1A 3VETA 1LWEA 3J7YP 4H5NA 1RT3A 1K6YA 3OBYA 2VWKA 4YOWA 2A40A 3HSCA 3TABA 4E7HA 2RPIA 2NRWA 1JCGA 4C8KA 1BCMA 3U9ZA 1JKHA 3C65A 2EX3A 2Y1JA 3LZJA 1KQSM 4FJKA 4DU4A 5SWMA 2HB5A 2YCHA 2DPNA 4JKHA 3CC4N 1IG9A 3LDQA 2UYTA 2F96A 2OPSA 1TL1A 4LH4A 1RNHA 4CEQA 4CF2A 2G8HA 3SQ2A 1XHXA 3CJCA 5KI6A 4XH1A 3M1FA 3E9PA 3FFKB 4CD1A 2P5OA 3ZX3A 2E2NA 4RTFD 3DLKA 4H0TB 1W2BM 1BU6O 1C0FA 4RW6A 3NGYA 3TAQA 1U48A 4C8OA 5D3GA 4JK8A 2HBMA 1RT7A 4PKGA 1S3XA 1XQSC 4CIFA 2W41A 5HROA 3CMAN 4AHVA 4K25A 4BR4A 2OZSA 3AO1A 4JRPA 2D1KA 4CVNE 3OYIA 3AGRA 4R5PA 1NGBA 4IZ9A 4B9LA 4FZYA 4TSXA 1HYSA 4JHDA 1SV5A 3U4LA 3O4QA 1J54A 4K0KK 4HTLA 3VQBA 1HMVA 1Q9YA 2WUSA 5AQKA 3AVMA 4IWVA 3FFIA 2IVOA 1N34K 3ENBA 3KK2A 1EX4A 2YHBA 3NF8A 4DU1A 4CGDA 1C1AA 1TKTA 3VEOA 4CHPA 2HHWA 2ZD1A 1KFDA 4B08A 2G8KA 3LAMA 4FM1A 3JS6A 4KV8A 1XHZA 4KH5A 2O4GA 2HF4A 2WFBA 1ZBHA 4CJPA 3TAEA 3D2FB 3CCSN 2YHWA 4IOCL 2GEMA 3T3FA 1R59O 2FBTA 4RW4A 2CH6A 5KPZA 1ZC6A 3R1XA 5FPDA 4HUEA 2HHQA 2IVPA 4CZGA 3NDKA 2QWLA 5HRSA 4JI0K 3NF6A 3ZSWA 3OYEA 1CXQA 3QIOA 4DV6K 3RR8A 1NK7A 1ZBIA 3NFAA 4EIAA 4BDPA 3VEYA 4Z4IA 3CPEA 1B9DA 4GV9A 3QINA 4DF4A 3HPOA 3UB5A 4IJNA 1NJYA 3DLBA 2QA4N 3ZSOA 3V9ZA 4FJXA 1D5AA 4B3MK 3TTDA 3C6TA 1NJWA 1KLNA 3O5BA 5M1OA 3OYMA 3MXMA 4N47A 1KXPA 4B1XB 1S1VA 1WSJA 4DSFA 1XMOK 4JD2A 4CEOA 3PSFA 4CJ5A 4JN4A 4YDUA 5M1KA 5BN9A 5LJWA 1NGGA 3SZ2A 1S72N 1G15A 2WC9A 3BF1A 4RW7A 4BDYA 3V1OA 3SJHA 2A5XA 1KD1O 3TSUA 4E1NA 5HOOA 2UUAK 2G8IA 4FWKA 3LWLA 4DR7K 4C23A 2HVIA 1UA0A 4JAXA 4RW8A 1L3TA 3ULEB 4CEAA 3TAPA 4KHWA 2JLEA 1RDBA 2OCEA 1U4BA 2NRTA 4O5FA 3MCPA 4DQSA 4FLYA 2AP1A 2UU9K 1YITN 4M3XA 3E1YA 3R8EA 3DAWA 3K5OA 4O4GA 3IG1A 3SCXA 2WBNA 1GLBG 2D5RA 3FE1A
chains in the Genus database with same CATH topology
1ASUA 2NUBA 3B6OA 4E7KA 4AHCA 3SV4A 1HJRA 4H4OA 4M3UA 1HRHA 2BDPA 2ATQA 4QOZB 3HO1A 4I9QA 4M45A 1BL3A 1FK9A 3P83D 4KTZA 3VA3A 4JS5A 4ELVA 3LPUA 3KD1E 4F2SA 4FK0A 1Y97A 3I0RA 1REVA 2DY4A 3KLFA 3OYGA 2HW3A 4KB1A 5I3UA 4KAZA 5FDLA 4Z4CA 3DOKA 1B9FA 1KVBA 2HNYA 1RTJA 3LDSA 2HMIA 4DQIA 1ASVA 4NCBA 1S1TA 4E89A 4W5TA 4XIUA 1RT6A 1SL2A 4DSIA 2BANA 3ZSVA 4DTSA 3HPGA 3S3NA 3LAKA 3QNOA 1BHLA 5SZTA 1XC9A 1SL1A 1N6QA 4CF8A 1JL1A 1GOBA 1S1XA 5J2PA 4I2QA 1JLQA 1CZ9A 3L3UA 4OKJA 4N76A 3M8RA 4Q0BA 1WSIA 3DYAA 3HSTB 1RTDA 3ULDA 1SKWA 3QLHA 1S1UA 3P1GA 3RMBA 4OKKA 3V6DA 2ITGA 3VQ8A 2WOMA 2FBVA 3S3MA 3QEPA 4J2AA 4FJ8A 2KFZA 1S9EA 1O1WA 3DRRA 1ZBLA 1SKSA 4KREA 3HK2A 1A5XA 1I39A 2VG5A 3B6PA 3ZSZA 4OVLA 3L2VA 4DTPA 3HL8A 1YTUA 3VA0A 5KTQA 4FZXC 2YKMA 3ZSQA 4FLXA 3OJSA 4DSEA 5FRNA 4M3YA 4OPJA 4DQRA 4CEZA 1KSPA 3NF9A 4PY5A 1IKWA 4FK4A 4CGJA 5HRRA 1WAJA 3AVLA 1ASWA 3QEVA 3SPYA 4KHQA 4N5SA 3DI6A 3AO3A 2ZQBA 4O5BA 4FJMA 4E3SA 1NK5A 5KRTA 3PX0A 4FLVA 3LALA 5HBMA 1NK6A 3KJVA 3NH1A 1IO2A 4LH5A 4LSNA 3OYDA 4ID5A 2X78A 4CJEA 2PYLA 4CIGA 2IOCA 2KQ2A 1Z25A 3WNGA 2OZMA 1VSEA 4E7LA 1HQEA 3QERA 1JLFA 2YNFA 1EETA 3TR8A 3NF7A 2VWJA 4IFVA 4ELUA 3L8BA 1RT5A 4CJQA 1L5UA 4CE9A 3WNHA 1VSMA 3AVFA 1SL0A 1EP4A 1L3SA 2KTQA 3CM6A 3KIOA 2AJQA 4M3ZA 1J9AA 2E4LA 4CEEA 4FJJA 1JLAA 4WE1A 1RBUA 4DFPA 3O3FA 5CYQA 3T1AA 4JLHA 1EKEA 3ZT3A 2G8FA 1NOYA 4FLZA 1UOCA 1NK9A 3QEXA 4F8RA 3DLRA 3PY8A 1T05A 2G8VA 4ZHRA 1LWFA 3VQ6A 3K5NA 1D9FA 3MEGA 4F3TA 4B9NA 2D0CA 4Z4GA 1Z26A 4ICLA 1C0UA 3OYCA 2A1SA 4OGEA 4O0IA 2IAJA 4M3RA 3ISNC 3NHGA 2A1RA 1RDAA 2IGIA 3KLGA 4JRQA 1LV5A 3K58A 1WAFA 1SUQA 3TANA 3HVTA 4DTMA 3SUQA 1U04A 4Z4FA 3K57A 1YTAA 4PA1A 4FK2A 4DTOA 3K5MA 1WSFA 5DMRA 4AHTA 5K14A 3PV8A 1TKDA 4F3OA 4KO0A 5I42A 3U3GA 4KHUA 1FKPA 2B5JA 3AA3A 3QETA 1W0HA 2P51A 3AVBA 1J5OA 4O44A 2HHXA 1F21A 3AVCA 1TKZA 4EZ6A 1WN7A 1IKXA 4E7JA 4CK1A 4DTJA 5HRPA 1BIUA 1X1PA 2GV9A 1JL2A 4FXDA 1HPZA 2KFNA 3DMJA 4YNQA 4DLEA 2P5GA 4DSLA 1R0AA 4E0DA 2OPPA 3L2UA 1T8EA 1VSFA 4Z4EA 3RWUA 3C94A 4CEFA 3LP0A 4AILC 3QESA 3D45A 2HHUA 4HHTA 3MXJA 4B8AB 3A2FA 5C24A 4JS4A 1L3VA 1TAUA 4B9TA 1C0MA 2BE2A 3U3YA 4MFBA 2YKNA 4DTUA 2HHSA 1UA1A 3QIPA 3KK3A 3SQ4A 3ZSRA 1RILA 4N56A 3IRXA 1U45A 2G8UA 4PUOA 3H08A 4BDZA 4DG1A 4J2BA 4EP4A 4FVMA 4FM2A 3L3VA 1IH7A 2D0AA 4C8NA 3PUFA 4DU3A 4N41A 4FJNA 1BQMA 3IS9A 4CF0A 1DTTA 3K59A 4DQQA 3ALYA 3MXIA 5JS1A 3VQ5A 3SUNA 1TK0A 1JXBA 1Q9XA 1EXQA 1JXEA 3VQ4A 2GUIA 3TAMA 2ETJA 1ITGA 3V1RA 4ZTJA 3QEIA 3VQDA 4CJRA 3SI6A 4FYDA 4DFKA 4CGHA 4EP5A 3V1QA 2Z1JA 1RBSA 1BIZA 2X74A 1NK0A 1LWCA 1Q8IA 1YT3A 4NCAA 1W9HA 3KK1A 5J2MA 3HJFA 3V9XA 3ZT1A 4KHNA 1BISA 1C1CA 1VRTA 4CJLA 4FJ7A 3V4IA 1VSJA 4FJIA 4QCLA 2VG7A 3MECA 3RR7A 3ZT4A 1RT4A 3TWHA 1QQCA 4I7FA 3O4NA 4GVMA 5CZ2A 1CZBA 4AHSA 3NH0A 4LSLA 5J2NA 3NBPA 1C0TA 3LPTA 4KKOA 3VQAA 2O4IA 1WSHA 1DTQA 4KB0A 5KGXA 3LP2A 4GW6A 2E6MA 3HP9A 2ZE2A 3L2WA 3LP1A 4OJRA 3V81A 4O0JA 1A5WA 4KTWA 3SJJA 4KI4A 3OYHA 1UWBA 4B9UA 3G0ZA 2RN2A 2IC3A 3OYKA 1RDDA 2RF2A 3KLHA 3DLHA 1B92A 3VQEA 4W5OA 4KHYA 4CHOA 2XO7A 3AVHA 3AVKA 3HT3A 3TARA 1MU2A 3AA2A 3ASMA 2RKIA 4CF1A 1NKBA 3KTQA 1RTIA 2E6LA 4FCYA 3V9WA 1KCFA 3RRHA 3U6FA 3PX4A 3TAGA 4K8ZA 3C95A 1S1WA 4Z0UA 1KRPA 1BI4A 3UIQA 2Z1IA 4B9VA 3D0PA 3PO4A 3M8SA 4W5RA 3I0SA 3HM9A 3CQ8A 3OYAA 4HVJA 4B3OA 4OGCA 4FW1A 4CIEA 4GMJB 3RMCA 4C8MA 4E19A 4E1MA 2XY7A 1KVCA 3VQPA 1X9MA 4NCGA 2YNIA 4CEDA 4FJLA 1QS4A 2GBZA 4HUGA 3PO5A 1RTHA 4DFMA 1WSGA 4CJ3A 3QNNA 1RBVA 3LWMA 4AHUA 5T7BA 2Z1GA 3NH2A 3QO9A 1FXXA 1RT1A 4IG3A 3K5LA 3S3OA 2I5JA 3JYTA 3TAFA 1YVUA 4I2PA 2XY6A 4CHNA 4DSKA 4IKFA 3EYZA 4ZTFA 4OLBA 3WNFA 4DTNA 2YNHA 1XI1A 4Y1CA 1LWEA 2IDOA 4W5NA 4F4KA 4DQPA 4FLUA 2LSNA 4IBNA 2HVHA 1RT3A 4CECA 1KLMA 4Z4HA 4LY7A 1VSDA 1K6YA 1TL3A 2KZMA 2VWKA 3NCIA 4CJSA 3SQ1A 3TABA 1CLQA 4DLGA 2PZSA 3RRGA 3KKRA 3NGZA 1LAWA 3CFOA 3NGIA 2DTUA 4RW9A 3LP3A 1NKCA 4E7HA 4BWMA 2RPIA 1GOCA 2QXFA 3M8PA 4OKEA 1NK8A 4C8KA 1BCMA 2FBXA 1JKHA 3AO5A 5HRNA 3EY1A 2HNDA 2EX3A 2Y1JA 3LZJA 1QSLA 3DOLA 4DU4A 5SWMA 4ELTA 1X9SA 4FJKA 3AO2A 3SUOA 2HB5A 1VSLA 4FJGA 1S6QA 1IG9A 3KLEA 4E7IA 2XHBA 4H4MA 4DTRA 5CYMA 3KKSA 2F96A 2OPSA 1TL1A 4LH4A 1RNHA 4CEQA 4CF2A 2YHAA 2G8HA 2QK9A 3SQ2A 3SNNA 1QSYA 4KI6A 1XHXA 1JLBA 3OVNA 1N5YA 4CJTA 1BQNA 5KI6A 3JSMA 2F8TA 4CESA 2DFFA 3C6UA 3OYJA 3OYBA 4AH9A 1ZYQA 4CGIA 4QAGA 1QHTA 4CFCA 3ZSXA 2OPQA 4AHRA 4CJ4A 1FKOA 2P5OA 3E01A 1NK4A 3THVA 1WLJA 3DLKA 3CG7A 5CY4A 2Z1HA 2XRIA 4IFYA 4OPKA 3OS2A 4RW6A 4F2RA 1I3AA 1HQUA 4Y1DA 3BDPA 3SQ0A 1VSIA 3NGYA 4CJWA 2FBYA 4BE2A 1HNVA 3AVJA 3F73A 3S9HA 3TAQA 4M3WA 1U48A 4IDKA 3BGRA 4MQ3A 1VSKA 2X6SA 1NOZA 4C8OA 5D3GA 1ZBFA 1RT2A 3MEDA 1RT7A 1T03A 1J53A 4CIFA 4CHQA 4PQUA 1TGOA 1NJZA 1DLOA 4LD0A 3SV3A 1JLCA 4DTXA 5HROA 4KFBA 4AHVA 1S9GA 2P1JA 3NAEA 3OS1A 3HP6A 2G8WA 2Q3SA 2OZSA 4CFDA 3SUPA 2Y1IA 2R7YA 3AO1A 4JRPA 1ZBUA 3V9UA 4CGFA 3OYIA 4CJFA 1RBRA 4R5PA 4DS4A 3ZCMA 5KRSA 1X9WA 4B9LA 4TSXA 4FZYA 4CHYA 2B4JA 1L3UA 1T7PA 1HYSA 1LAVA 4YFUA 3RMDA 5FRMA 1SV5A 4BE0A 4FLTA 3O4QA 1J54A 3MAQA 3AVNA 4L8RB 1JLGA 3HVRA 2XY5A 3LZIA 1BGXT 3VQBA 3VQQA 1HMVA 3AA4A 3DLEA 4DFJA 1Q9YA 3OJUA 3L2RA 3AVMA 5EU7A 1S6PA 4RG8A 1A5VA 3CFPA 3FFIA 3CYMA 1TK8A 3KK2A 1XWLA 2F8SA 1EX4A 2YHBA 2D0BA 3NF8A 4I9LA 4CGDA 4DU1A 3QEWA 1C1AA 1TKTA 4CHPA 2HHWA 4CK3A 2ZD1A 1KFDA 4HTUA 4B08A 4CF9A 2G8KA 3KD5E 3LAMA 4FM1A 2FC0A 4KV8A 1XHZA 1S5JA 2O4GA 3VN5A 1ZBHA 3CFRA 2YNGA 3ITHA 4CJPA 1IKYA 4DSJA 3G10A 3O3HA 3TAEA 1WSEA 5KGWA 3RTVA 3T3FA 1NJXA 1KTQA 2W42A 4M42A 2FBTA 4RW4A 1VRUA 3ZT0A 4HUEA 2HHQA 3ZSYA 2HHVA 3RMAA 5C25A 2WONA 3OYLA 5HRSA 3NDKA 3SYZA 4B9MA 4C8LA 4FJ9A 3NF6A 5CZ1A 4HCCA 4DMNA 3ZSWA 3OYEA 5HLFA 1QTMA 4CGGA 1CXQA 4BACA 5J2QA 3QIOA 4M3TA 4NYNA 3RR8A 1NK7A 4FJHA 1ZBIA 3CM5A 3AA5X 3DM2A 3NFAA 2DFEA 3AVAA 2BGGA 4ID1A 4CJUA 4BDPA 3OYNA 4Z4IA 1B9DA 1RDCA 1D8YA 3QINA 4FZZA 4FJ5A 4DF4A 3HPOA 3T19A 1NJYA 3DLBA 2KW4A 1LW2A 1BCOA 3HYFA 1WNSA 3VQ9A 1C6VA 3ZSOA 3AO4A 1NKEA 2YV0X 4CJVA 3V9ZA 1D5AA 4B8CA 4CJKA 4DS5A 3L2QA 4B9SA 4FJXA 3C6TA 3ZT2A 1NJWA 1KLNA 4UQGA 4CHZA 3LANA 4H8KA 3M8QA 4W5QA 5HP1A 5JS2A 5DK5A 3OYMA 4N47A 1TVRA 3EZ5A 5C42A 3MXMA 1D9DA 2PYJA 3IAYA 4OLAA 1S1VA 3HPHA 1WSJA 3HXMA 4G1QA 4DSFA 3KLIA 1BI4B 4DWIA 4CEOA 3OY9A 1RBTA 1TKXA 4CJ5A 4FM0A 4CFAA 2IS3A 3V9SA 4KPYA 3TI0A 2OYQA 3SZ2A 3MEEA 4CERA 1G15A 4KTQA 1HYVA 2X6NA 4RW7A 3WNEA 4BDYA 1U49A 4CK2A 3I8DA 1UAXA 4KRFA 3AVIA 2EHGA 2DFHA 3V1OA 1KFSA 4K8XA 3OYFA 1TAQA 3VQ7A 4J2DA 4E1NA 2G8IA 4EZ9A 1LW0A 1U47A 4HUFA 3LWLA 3P5JA 2KZZA 3VQCA 3AVGA 3SPZA 2HVIA 1C1BA 1KVAA 4BE1A 1UA0A 3DLGA 2HHTA 2XY8A 4RW8A 1QSSA 1CXUA 1L3TA 3F9KA 4Q5VA 2PY5A 4CEBA 1VK0A 4BWJA 4CEAA 3TAPA 4O55A 4KHWA 4PWDA 4FLWA 2JLEA 4J2EA 1RDBA 4CFBA 2VG6A 1TV6A 3DRSA 3DRPA 3O3GA 1U4BA 1SKRA 1QE1A 4IG0A 1JLEA 4CCHA 3OS0A 2QKBA 4KHSA 4NYFA 4DQSA 4DF8A 1TK5A 4M41A 3NE6A 4FLYA 3AV9A 1GOAA 3PX6A 2JGUA 1VSHA 4FW2A 4M3XA 3K2PA 5FROA 1IKVA 5J1EA 4O4GA 2B6AA 3K5OA 2QKKA 2OPRA 3IG1A 4HCBA 3SCXA 2OA8A 1RCHA 2HNZA 2D5RA 1HNIA 5E41A 1HYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASU A;  2NUB A;  3B6O A;  4E7K A;  4AHC A;  3SV4 A;  1HJR A;  4H4O A;  4M3U A;  1HRH A;  2BDP A;  2ATQ A;  4QOZ B;  3HO1 A;  4I9Q A;  4M45 A;  1BL3 A;  1FK9 A;  3P83 D;  4KTZ A;  3VA3 A;  4JS5 A;  4ELV A;  3LPU A;  3KD1 E;  4F2S A;  4FK0 A;  1Y97 A;  3I0R A;  1REV A;  2DY4 A;  3KLF A;  3OYG A;  2HW3 A;  4KB1 A;  5I3U A;  4KAZ A;  5FDL A;  4Z4C A;  3DOK A;  1B9F A;  1KVB A;  2HNY A;  1RTJ A;  3LDS A;  2HMI A;  4DQI A;  1ASV A;  4NCB A;  1S1T A;  4E89 A;  4W5T A;  4XIU A;  1RT6 A;  1SL2 A;  4DSI A;  2BAN A;  3ZSV A;  4DTS A;  3HPG A;  3S3N A;  3LAK A;  3QNO A;  1BHL A;  5SZT A;  1XC9 A;  1SL1 A;  1N6Q A;  4CF8 A;  1JL1 A;  1GOB A;  1S1X A;  5J2P A;  4I2Q A;  1JLQ A;  1CZ9 A;  3L3U A;  4OKJ A;  4N76 A;  3M8R A;  4Q0B A;  1WSI A;  3DYA A;  3HST B;  1RTD A;  3ULD A;  1SKW A;  3QLH A;  1S1U A;  3P1G A;  3RMB A;  4OKK A;  3V6D A;  2ITG A;  3VQ8 A;  2WOM A;  2FBV A;  3S3M A;  3QEP A;  4J2A A;  4FJ8 A;  2KFZ A;  1S9E A;  1O1W A;  3DRR A;  1ZBL A;  1SKS A;  4KRE A;  3HK2 A;  1A5X A;  1I39 A;  2VG5 A;  3B6P A;  3ZSZ A;  4OVL A;  3L2V A;  4DTP A;  3HL8 A;  1YTU A;  3VA0 A;  5KTQ A;  4FZX C;  2YKM A;  3ZSQ A;  4FLX A;  3OJS A;  4DSE A;  5FRN A;  4M3Y A;  4OPJ A;  4DQR A;  4CEZ A;  1KSP A;  3NF9 A;  4PY5 A;  1IKW A;  4FK4 A;  4CGJ A;  5HRR A;  1WAJ A;  3AVL A;  1ASW A;  3QEV A;  3SPY A;  4KHQ A;  4N5S A;  3DI6 A;  3AO3 A;  2ZQB A;  4O5B A;  4FJM A;  4E3S A;  1NK5 A;  5KRT A;  3PX0 A;  4FLV A;  3LAL A;  5HBM A;  1NK6 A;  3KJV A;  3NH1 A;  1IO2 A;  4LH5 A;  4LSN A;  3OYD A;  4ID5 A;  2X78 A;  4CJE A;  2PYL A;  4CIG A;  2IOC A;  2KQ2 A;  1Z25 A;  3WNG A;  2OZM A;  1VSE A;  4E7L A;  1HQE A;  3QER A;  1JLF A;  2YNF A;  1EET A;  3TR8 A;  3NF7 A;  2VWJ A;  4IFV A;  4ELU A;  3L8B A;  1RT5 A;  4CJQ A;  1L5U A;  4CE9 A;  3WNH A;  1VSM A;  3AVF A;  1SL0 A;  1EP4 A;  1L3S A;  2KTQ A;  3CM6 A;  3KIO A;  2AJQ A;  4M3Z A;  1J9A A;  2E4L A;  4CEE A;  4FJJ A;  1JLA A;  4WE1 A;  1RBU A;  4DFP A;  3O3F A;  5CYQ A;  3T1A A;  4JLH A;  1EKE A;  3ZT3 A;  2G8F A;  1NOY A;  4FLZ A;  1UOC A;  1NK9 A;  3QEX A;  4F8R A;  3DLR A;  3PY8 A;  1T05 A;  2G8V A;  4ZHR A;  1LWF A;  3VQ6 A;  3K5N A;  1D9F A;  3MEG A;  4F3T A;  4B9N A;  2D0C A;  4Z4G A;  1Z26 A;  4ICL A;  1C0U A;  3OYC A;  2A1S A;  4OGE A;  4O0I A;  2IAJ A;  4M3R A;  3ISN C;  3NHG A;  2A1R A;  1RDA A;  2IGI A;  3KLG A;  4JRQ A;  1LV5 A;  3K58 A;  1WAF A;  1SUQ A;  3TAN A;  3HVT A;  4DTM A;  3SUQ A;  1U04 A;  4Z4F A;  3K57 A;  1YTA A;  4PA1 A;  4FK2 A;  4DTO A;  3K5M A;  1WSF A;  5DMR A;  4AHT A;  5K14 A;  3PV8 A;  1TKD A;  4F3O A;  4KO0 A;  5I42 A;  3U3G A;  4KHU A;  1FKP A;  2B5J A;  3AA3 A;  3QET A;  1W0H A;  2P51 A;  3AVB A;  1J5O A;  4O44 A;  2HHX A;  1F21 A;  3AVC A;  1TKZ A;  4EZ6 A;  1WN7 A;  1IKX A;  4E7J A;  4CK1 A;  4DTJ A;  5HRP A;  1BIU A;  1X1P A;  2GV9 A;  1JL2 A;  4FXD A;  1HPZ A;  2KFN A;  3DMJ A;  4YNQ A;  4DLE A;  2P5G A;  4DSL A;  1R0A A;  4E0D A;  2OPP A;  3L2U A;  1T8E A;  1VSF A;  4Z4E A;  3RWU A;  3C94 A;  4CEF A;  3LP0 A;  4AIL C;  3QES A;  3D45 A;  2HHU A;  4HHT A;  3MXJ A;  4B8A B;  3A2F A;  5C24 A;  4JS4 A;  1L3V A;  1TAU A;  4B9T A;  1C0M A;  2BE2 A;  3U3Y A;  4MFB A;  2YKN A;  4DTU A;  2HHS A;  1UA1 A;  3QIP A;  3KK3 A;  3SQ4 A;  3ZSR A;  1RIL A;  4N56 A;  3IRX A;  1U45 A;  2G8U A;  4PUO A;  3H08 A;  4BDZ A;  4DG1 A;  4J2B A;  4EP4 A;  4FVM A;  4FM2 A;  3L3V A;  1IH7 A;  2D0A A;  4C8N A;  3PUF A;  4DU3 A;  4N41 A;  4FJN A;  1BQM A;  3IS9 A;  4CF0 A;  1DTT A;  3K59 A;  4DQQ A;  3ALY A;  3MXI A;  5JS1 A;  3VQ5 A;  3SUN A;  1TK0 A;  1JXB A;  1Q9X A;  1EXQ A;  1JXE A;  3VQ4 A;  2GUI A;  3TAM A;  2ETJ A;  1ITG A;  3V1R A;  4ZTJ A;  3QEI A;  3VQD A;  4CJR A;  3SI6 A;  4FYD A;  4DFK A;  4CGH A;  4EP5 A;  3V1Q A;  2Z1J A;  1RBS A;  1BIZ A;  2X74 A;  1NK0 A;  1LWC A;  1Q8I A;  1YT3 A;  4NCA A;  1W9H A;  3KK1 A;  5J2M A;  3HJF A;  3V9X A;  3ZT1 A;  4KHN A;  1BIS A;  1C1C A;  1VRT A;  4CJL A;  4FJ7 A;  3V4I A;  1VSJ A;  4FJI A;  4QCL A;  2VG7 A;  3MEC A;  3RR7 A;  3ZT4 A;  1RT4 A;  3TWH A;  1QQC A;  4I7F A;  3O4N A;  4GVM A;  5CZ2 A;  1CZB A;  4AHS A;  3NH0 A;  4LSL A;  5J2N A;  3NBP A;  1C0T A;  3LPT A;  4KKO A;  3VQA A;  2O4I A;  1WSH A;  1DTQ A;  4KB0 A;  5KGX A;  3LP2 A;  4GW6 A;  2E6M A;  3HP9 A;  2ZE2 A;  3L2W A;  3LP1 A;  4OJR A;  3V81 A;  4O0J A;  1A5W A;  4KTW A;  3SJJ A;  4KI4 A;  3OYH A;  1UWB A;  4B9U A;  3G0Z A;  2RN2 A;  2IC3 A;  3OYK A;  1RDD A;  2RF2 A;  3KLH A;  3DLH A;  1B92 A;  3VQE A;  4W5O A;  4KHY A;  4CHO A;  2XO7 A;  3AVH A;  3AVK A;  3HT3 A;  3TAR A;  1MU2 A;  3AA2 A;  3ASM A;  2RKI A;  4CF1 A;  1NKB A;  3KTQ A;  1RTI A;  2E6L A;  4FCY A;  3V9W A;  1KCF A;  3RRH A;  3U6F A;  3PX4 A;  3TAG A;  4K8Z A;  3C95 A;  1S1W A;  4Z0U A;  1KRP A;  1BI4 A;  3UIQ A;  2Z1I A;  4B9V A;  3D0P A;  3PO4 A;  3M8S A;  4W5R A;  3I0S A;  3HM9 A;  3CQ8 A;  3OYA A;  4HVJ A;  4B3O A;  4OGC A;  4FW1 A;  4CIE A;  4GMJ B;  3RMC A;  4C8M A;  4E19 A;  4E1M A;  2XY7 A;  1KVC A;  3VQP A;  1X9M A;  4NCG A;  2YNI A;  4CED A;  4FJL A;  1QS4 A;  2GBZ A;  4HUG A;  3PO5 A;  1RTH A;  4DFM A;  1WSG A;  4CJ3 A;  3QNN A;  1RBV A;  3LWM A;  4AHU A;  5T7B A;  2Z1G A;  3NH2 A;  3QO9 A;  1FXX A;  1RT1 A;  4IG3 A;  3K5L A;  3S3O A;  2I5J A;  3JYT A;  3TAF A;  1YVU A;  4I2P A;  2XY6 A;  4CHN A;  4DSK A;  4IKF A;  3EYZ A;  4ZTF A;  4OLB A;  3WNF A;  4DTN A;  2YNH A;  1XI1 A;  4Y1C A;  1LWE A;  2IDO A;  4W5N A;  4F4K A;  4DQP A;  4FLU A;  2LSN A;  4IBN A;  2HVH A;  1RT3 A;  4CEC A;  1KLM A;  4Z4H A;  4LY7 A;  1VSD A;  1K6Y A;  1TL3 A;  2KZM A;  2VWK A;  3NCI A;  4CJS A;  3SQ1 A;  3TAB A;  1CLQ A;  4DLG A;  2PZS A;  3RRG A;  3KKR A;  3NGZ A;  1LAW A;  3CFO A;  3NGI A;  2DTU A;  4RW9 A;  3LP3 A;  1NKC A;  4E7H A;  4BWM A;  2RPI A;  1GOC A;  2QXF A;  3M8P A;  4OKE A;  1NK8 A;  4C8K A;  1BCM A;  2FBX A;  1JKH A;  3AO5 A;  5HRN A;  3EY1 A;  2HND A;  2EX3 A;  2Y1J A;  3LZJ A;  1QSL A;  3DOL A;  4DU4 A;  5SWM A;  4ELT A;  1X9S A;  4FJK A;  3AO2 A;  3SUO A;  2HB5 A;  1VSL A;  4FJG A;  1S6Q A;  1IG9 A;  3KLE A;  4E7I A;  2XHB A;  4H4M A;  4DTR A;  5CYM A;  3KKS A;  2F96 A;  2OPS A;  1TL1 A;  4LH4 A;  1RNH A;  4CEQ A;  4CF2 A;  2YHA A;  2G8H A;  2QK9 A;  3SQ2 A;  3SNN A;  1QSY A;  4KI6 A;  1XHX A;  1JLB A;  3OVN A;  1N5Y A;  4CJT A;  1BQN A;  5KI6 A;  3JSM A;  2F8T A;  4CES A;  2DFF A;  3C6U A;  3OYJ A;  3OYB A;  4AH9 A;  1ZYQ A;  4CGI A;  4QAG A;  1QHT A;  4CFC A;  3ZSX A;  2OPQ A;  4AHR A;  4CJ4 A;  1FKO A;  2P5O A;  3E01 A;  1NK4 A;  3THV A;  1WLJ A;  3DLK A;  3CG7 A;  5CY4 A;  2Z1H A;  2XRI A;  4IFY A;  4OPK A;  3OS2 A;  4RW6 A;  4F2R A;  1I3A A;  1HQU A;  4Y1D A;  3BDP A;  3SQ0 A;  1VSI A;  3NGY A;  4CJW A;  2FBY A;  4BE2 A;  1HNV A;  3AVJ A;  3F73 A;  3S9H A;  3TAQ A;  4M3W A;  1U48 A;  4IDK A;  3BGR A;  4MQ3 A;  1VSK A;  2X6S A;  1NOZ A;  4C8O A;  5D3G A;  1ZBF A;  1RT2 A;  3MED A;  1RT7 A;  1T03 A;  1J53 A;  4CIF A;  4CHQ A;  4PQU A;  1TGO A;  1NJZ A;  1DLO A;  4LD0 A;  3SV3 A;  1JLC A;  4DTX A;  5HRO A;  4KFB A;  4AHV A;  1S9G A;  2P1J A;  3NAE A;  3OS1 A;  3HP6 A;  2G8W A;  2Q3S A;  2OZS A;  4CFD A;  3SUP A;  2Y1I A;  2R7Y A;  3AO1 A;  4JRP A;  1ZBU A;  3V9U A;  4CGF A;  3OYI A;  4CJF A;  1RBR A;  4R5P A;  4DS4 A;  3ZCM A;  5KRS A;  1X9W A;  4B9L A;  4TSX A;  4FZY A;  4CHY A;  2B4J A;  1L3U A;  1T7P A;  1HYS A;  1LAV A;  4YFU A;  3RMD A;  5FRM A;  1SV5 A;  4BE0 A;  4FLT A;  3O4Q A;  1J54 A;  3MAQ A;  3AVN A;  4L8R B;  1JLG A;  3HVR A;  2XY5 A;  3LZI A;  1BGX T;  3VQB A;  3VQQ A;  1HMV A;  3AA4 A;  3DLE A;  4DFJ A;  1Q9Y A;  3OJU A;  3L2R A;  3AVM A;  5EU7 A;  1S6P A;  4RG8 A;  1A5V A;  3CFP A;  3FFI A;  3CYM A;  1TK8 A;  3KK2 A;  1XWL A;  2F8S A;  1EX4 A;  2YHB A;  2D0B A;  3NF8 A;  4I9L A;  4CGD A;  4DU1 A;  3QEW A;  1C1A A;  1TKT A;  4CHP A;  2HHW A;  4CK3 A;  2ZD1 A;  1KFD A;  4HTU A;  4B08 A;  4CF9 A;  2G8K A;  3KD5 E;  3LAM A;  4FM1 A;  2FC0 A;  4KV8 A;  1XHZ A;  1S5J A;  2O4G A;  3VN5 A;  1ZBH A;  3CFR A;  2YNG A;  3ITH A;  4CJP A;  1IKY A;  4DSJ A;  3G10 A;  3O3H A;  3TAE A;  1WSE A;  5KGW A;  3RTV A;  3T3F A;  1NJX A;  1KTQ A;  2W42 A;  4M42 A;  2FBT A;  4RW4 A;  1VRU A;  3ZT0 A;  4HUE A;  2HHQ A;  3ZSY A;  2HHV A;  3RMA A;  5C25 A;  2WON A;  3OYL A;  5HRS A;  3NDK A;  3SYZ A;  4B9M A;  4C8L A;  4FJ9 A;  3NF6 A;  5CZ1 A;  4HCC A;  4DMN A;  3ZSW A;  3OYE A;  5HLF A;  1QTM A;  4CGG A;  1CXQ A;  4BAC A;  5J2Q A;  3QIO A;  4M3T A;  4NYN A;  3RR8 A;  1NK7 A;  4FJH A;  1ZBI A;  3CM5 A;  3AA5 X;  3DM2 A;  3NFA A;  2DFE A;  3AVA A;  2BGG A;  4ID1 A;  4CJU A;  4BDP A;  3OYN A;  4Z4I A;  1B9D A;  1RDC A;  1D8Y A;  3QIN A;  4FZZ A;  4FJ5 A;  4DF4 A;  3HPO A;  3T19 A;  1NJY A;  3DLB A;  2KW4 A;  1LW2 A;  1BCO A;  3HYF A;  1WNS A;  3VQ9 A;  1C6V A;  3ZSO A;  3AO4 A;  1NKE A;  2YV0 X;  4CJV A;  3V9Z A;  1D5A A;  4B8C A;  4CJK A;  4DS5 A;  3L2Q A;  4B9S A;  4FJX A;  3C6T A;  3ZT2 A;  1NJW A;  1KLN A;  4UQG A;  4CHZ A;  3LAN A;  4H8K A;  3M8Q A;  4W5Q A;  5HP1 A;  5JS2 A;  5DK5 A;  3OYM A;  4N47 A;  1TVR A;  3EZ5 A;  5C42 A;  3MXM A;  1D9D A;  2PYJ A;  3IAY A;  4OLA A;  1S1V A;  3HPH A;  1WSJ A;  3HXM A;  4G1Q A;  4DSF A;  3KLI A;  1BI4 B;  4DWI A;  4CEO A;  3OY9 A;  1RBT A;  1TKX A;  4CJ5 A;  4FM0 A;  4CFA A;  2IS3 A;  3V9S A;  4KPY A;  3TI0 A;  2OYQ A;  3SZ2 A;  3MEE A;  4CER A;  1G15 A;  4KTQ A;  1HYV A;  2X6N A;  4RW7 A;  3WNE A;  4BDY A;  1U49 A;  4CK2 A;  3I8D A;  1UAX A;  4KRF A;  3AVI A;  2EHG A;  2DFH A;  3V1O A;  1KFS A;  4K8X A;  3OYF A;  1TAQ A;  3VQ7 A;  4J2D A;  4E1N A;  2G8I A;  4EZ9 A;  1LW0 A;  1U47 A;  4HUF A;  3LWL A;  3P5J A;  2KZZ A;  3VQC A;  3AVG A;  3SPZ A;  2HVI A;  1C1B A;  1KVA A;  4BE1 A;  1UA0 A;  3DLG A;  2HHT A;  2XY8 A;  4RW8 A;  1QSS A;  1CXU A;  1L3T A;  3F9K A;  4Q5V A;  2PY5 A;  4CEB A;  1VK0 A;  4BWJ A;  4CEA A;  3TAP A;  4O55 A;  4KHW A;  4PWD A;  4FLW A;  2JLE A;  4J2E A;  1RDB A;  4CFB A;  2VG6 A;  1TV6 A;  3DRS A;  3DRP A;  3O3G A;  1U4B A;  1SKR A;  1QE1 A;  4IG0 A;  1JLE A;  4CCH A;  3OS0 A;  2QKB A;  4KHS A;  4NYF A;  4DQS A;  4DF8 A;  1TK5 A;  4M41 A;  3NE6 A;  4FLY A;  3AV9 A;  1GOA A;  3PX6 A;  2JGU A;  1VSH A;  4FW2 A;  4M3X A;  3K2P A;  5FRO A;  1IKV A;  5J1E A;  4O4G A;  2B6A A;  3K5O A;  2QKK A;  2OPR A;  3IG1 A;  4HCB A;  3SCX A;  2OA8 A;  1RCH A;  2HNZ A;  2D5R A;  1HNI A;  5E41 A;  1HYZ A; 
#chains in the Genus database with same CATH topology
 1NGF A;  3B6O A;  4AHC A;  4DV2 K;  4M3U A;  4QOZ B;  4I9Q A;  3SBT A;  3P83 D;  5AFU A;  3GDQ A;  3VGM A;  3LPU A;  3SBG A;  2JWL A;  3I0R A;  2DY4 A;  3CHW A;  5IT9 O;  3FZF A;  2UXB K;  1Q86 O;  3GG4 A;  4KAZ A;  4FPB A;  3G4S N;  3PSI A;  5FDL A;  3DOK A;  2F7T A;  4H03 B;  4NCB A;  1S1T A;  4XIU A;  2BAN A;  1HR0 K;  3HPG A;  1BA1 A;  3CCM N;  1N6Q A;  2CGK A;  5J2P A;  1JL1 A;  1GOB A;  4N76 A;  3M8R A;  3CC2 N;  4Q0B A;  3TSP A;  3ULD A;  3H1V X;  4BRC A;  1TUU A;  3RMB A;  1RGI A;  3V6D A;  2HBJ A;  5FLX O;  2FBV A;  3S3M A;  4J2A A;  2KFZ A;  5C2F A;  1S9E A;  3DRR A;  3UKU A;  1ZBL A;  1SKS A;  3P31 A;  1A5X A;  1I39 A;  1HKC A;  2VG5 A;  4KH6 A;  4JKC A;  3L2V A;  4DTP A;  2YKM A;  5EXW A;  2RHK A;  1VQ7 N;  4A59 A;  4OPJ A;  2F9W A;  3Q7B A;  4DQR A;  1TUY A;  1KSP A;  4PY5 A;  3JAM O;  4KHQ A;  1SZ2 A;  3AO3 A;  2ZQB A;  4FJM A;  5CHI A;  1WUA A;  3FGU A;  3PX0 A;  4AM7 A;  1MWK A;  3H3N O;  4LH5 A;  2YHY A;  4WQ4 A;  5JLH A;  1YJ9 N;  4E7L A;  4FWR A;  3TR8 A;  4IFV A;  1M90 O;  2E8A A;  3I56 N;  1L3S A;  1IBK K;  5LY3 A;  4M3Z A;  2E4L A;  4CEE A;  3O3F A;  3T1A A;  4JLH A;  1EKE A;  2G8F A;  1NK9 A;  1UOC A;  1VQM N;  4FVU A;  5AQJ A;  4OPH A;  4CJ7 A;  4ZHR A;  3AAR A;  2YI1 A;  4F3T A;  4B9N A;  1ZBS A;  4ICL A;  3OYC A;  2A1S A;  4O0I A;  2IAJ A;  3N4Q A;  3CCR N;  1VQ4 N;  1SUQ A;  5EY4 A;  4DTM A;  3SUQ A;  4G9Z A;  3K57 A;  4BR0 A;  1LOT B;  4PA1 A;  3K9J A;  5ADX A;  3NVK A;  2Q0R A;  3LDN A;  1TKD A;  4KO0 A;  1NGD A;  4DCH A;  2B5J A;  2GUP A;  4O44 A;  1T6C A;  1JCE A;  4EZ6 A;  3Q7C A;  5KPR A;  2HOE A;  3EO3 A;  4BRL A;  5AQS A;  1HPZ A;  2YX6 A;  2P5G A;  2E1Z A;  3DWL A;  1VSF A;  1T8E A;  4BY9 C;  3C94 A;  3LP0 A;  1Q82 O;  3MXJ A;  4LFC K;  1DGK N;  1X3M A;  2KLA A;  1L3V A;  1C0M A;  4MFB A;  4DTU A;  3QIP A;  4IEI A;  2G8U A;  5AQH A;  4DG1 A;  4CZM A;  4EP4 A;  4FVM A;  5H1S Q;  5AR0 A;  4C8N A;  2D0A A;  3VGL A;  3PUF A;  4DU3 A;  2F4V K;  3ALY A;  1NMN A;  3PIO L;  3VQ4 A;  3HTV A;  3ENH A;  2O8C B;  4ZTJ A;  4H0V B;  3VQD A;  3D2F A;  1Q8I A;  3HJF A;  5JMV A;  1VRT A;  4FJ7 A;  1QQC A;  3QES A;  5CE3 A;  1DTQ A;  3LP2 A;  4CZH A;  3TTC A;  3OYH A;  1QHA A;  2HBK A;  2P9P B;  2RF2 A;  3VMF B;  2YJE A;  4JKE A;  4CHO A;  4NXM K;  3BY5 A;  2UUC K;  3TAR A;  1MU2 A;  3ASM A;  2RKI A;  4CF1 A;  2AA4 A;  1RTI A;  4B1W B;  3PX4 A;  3MWT A;  3WEE A;  2NRH A;  4B9V A;  3H6E A;  1X9J A;  4UY8 O;  4W5R A;  3I0S A;  3HM9 A;  3OYA A;  4B3O A;  5LMU K;  4E19 A;  3MDQ A;  2P9L B;  5M1Q A;  3VQP A;  3IMX A;  1X9M A;  4IO8 A;  3A5N C;  4FJL A;  5AQZ A;  1QS4 A;  1T6D A;  4HUG A;  3PO5 A;  3KHY A;  3QB0 A;  4J8F A;  3LWM A;  4AHU A;  3CPW M;  4IG3 A;  1RT1 A;  2V7Z A;  2I5J A;  3TAF A;  1YVU A;  1YHQ N;  1BO5 O;  1YVN A;  4OLB A;  3ULE A;  3LM2 A;  3EE9 A;  3CIP A;  2HST A;  1YI2 N;  2IDO A;  4W5N A;  5I9E B;  3KZB A;  4FLU A;  2LSN A;  4IBN A;  1KLM A;  4Z4H A;  3C7N B;  4LY7 A;  1VSD A;  1TL3 A;  4YOU A;  2KZM A;  4WYB A;  4DLG A;  2PZS A;  3KKR A;  3NGZ A;  1LAW A;  3LP3 A;  1NKC A;  1YIJ N;  3M8P A;  4DR4 K;  3MWP A;  1NK8 A;  1DEJ A;  4ELT A;  5CR4 A;  3VGK A;  2QTD A;  1BWF O;  1VSL A;  4FJG A;  1S6Q A;  3KLE A;  3MN7 A;  4DTR A;  4H4M A;  3ATU A;  5CYM A;  4JI1 K;  2ITM A;  2QK9 A;  2YHA A;  2Q2R A;  3SNN A;  1QSY A;  1N5Y A;  3MK6 A;  3OVN A;  1P8Z A;  2QM1 A;  1BQN A;  1DKG D;  2BTF A;  4CW7 B;  3HM8 A;  4PKI A;  4AH9 A;  3THX B;  4QAG A;  1QHT A;  4CFC A;  1K8K A;  3ZSX A;  1HUX A;  2OPQ A;  4AHR A;  1FKO A;  3THV A;  1WLJ A;  1EO1 A;  3GL1 A;  2XRI A;  4PHT X;  4F2R A;  4JYA K;  2E5L K;  1I3A A;  1HQU A;  3S9H A;  4CJW A;  3AVJ A;  2ZM6 K;  3BGR A;  3G25 A;  1VSK A;  2X6S A;  3UKR B;  2ASM A;  1ZBF A;  1RT2 A;  3BZK A;  3MED A;  3L4Q A;  1HNX K;  5BR9 A;  4O8K A;  4FSV A;  4CHQ A;  1DLO A;  4LD0 A;  1HPM A;  3NAE A;  1S9G A;  3E9O A;  3OS1 A;  3I55 N;  4FPA A;  2Q3S A;  2HHH K;  2O8B A;  1NU0 A;  4CGF A;  3FR0 A;  4DS4 A;  3ZCM A;  5KRS A;  4CHY A;  1L3U A;  1LAV A;  5AZI B;  5FRM A;  5BRH A;  2A3Z A;  4BE0 A;  4L8R B;  3CD6 N;  1JLG A;  3HVR A;  4WFN L;  1BGX T;  3VQQ A;  3AA4 A;  4DR3 K;  3L2R A;  5EU7 A;  4RG8 A;  3CFP A;  3H3O B;  3CJ9 A;  2OAN A;  2F8S A;  2D0B A;  4NLC A;  3QEW A;  5M1P A;  3U9D A;  4HTU A;  4CF9 A;  3O6W A;  2CGL A;  3CFR A;  3QFU A;  4ILG B;  3G10 A;  3EZW A;  4NXN K;  3RTV A;  2W42 A;  3WQU A;  1VRU A;  1EWQ A;  3P4I A;  2BUP A;  1FJG K;  1Z05 A;  1N8R O;  4B9M A;  3O8M A;  3EKU A;  4DMN A;  5AQR A;  5HLF A;  4BAC A;  4NYN A;  4FJH A;  1ATR A;  3AA5 X;  3DM2 A;  1Q7Y O;  4CJU A;  3O1W A;  3CQX A;  4ILJ A;  5FPM A;  3HYF A;  1LW2 A;  3VQ9 A;  1K73 O;  2QWM A;  2YV0 X;  4CJV A;  3UE5 A;  4B8C A;  4DS5 A;  3DLL L;  4WQ5 A;  2P9I B;  3CME N;  3ZT2 A;  1IBM K;  4UQG A;  3LAN A;  3M8Q A;  1S22 A;  5JS2 A;  5DK5 A;  4A61 A;  5BR8 K;  3EZ5 A;  1D9D A;  4G1Q A;  1BI4 B;  4FWL A;  3OY9 A;  4H0Y B;  2IS3 A;  4KPY A;  1NGH A;  3TI0 A;  2OYQ A;  1OVQ A;  4GKK K;  3MEE A;  4CK2 A;  5FPE A;  4XEI A;  2EHG A;  3VQ7 A;  2UUB K;  3ID6 A;  4EZ9 A;  2E1Y A;  4BGA A;  3P5J A;  3AVG A;  1C1B A;  4B1U B;  3MN6 A;  2HHT A;  1W97 L;  4H5T A;  4JI7 K;  3F9K A;  3R6M A;  4CEB A;  1SAZ A;  4PWD A;  2VG6 A;  3DRS A;  3O3G A;  1KAX A;  1P90 A;  4CCH A;  2O8C A;  3OS0 A;  4NYF A;  3GOI A;  5F1X A;  3IUC A;  3NE6 A;  4HWI A;  4ISF A;  2OPR A;  4M7Y A;  1BA0 A;  3DXM A;  2P9K A;  1RCH A;  5E41 A;  1ASU A;  4BRH A;  4E7K A;  1D4X A;  3CJ7 A;  4RCH A;  3SV4 A;  4H4O A;  2BDP A;  2ATQ A;  1BL3 A;  1FK9 A;  4LFB K;  3VA3 A;  1VQO N;  4FK0 A;  4F2S A;  2E2O A;  5AQW A;  3KLF A;  3OYG A;  4KB1 A;  5F0X A;  2P9P A;  3ZX0 A;  4Z4C A;  1B9F A;  1KVB A;  4B3T K;  2HNY A;  3LDS A;  1ASV A;  5KPT A;  5C2D A;  4E89 A;  3TPQ A;  4K42 A;  3ZSV A;  3S3N A;  5GAG P;  3QNO A;  1BHL A;  3SLC A;  4IOX A;  3MX2 A;  4OKJ A;  3P1G A;  2P9L A;  4OKK A;  2ITG A;  2WOM A;  3CJ1 A;  3D7E O;  3RVC A;  1VQ6 N;  1ZXO A;  3E66 A;  2D0P A;  3J7Z O;  4KRE A;  1HX1 A;  1QQM A;  3A5O C;  3ZSZ A;  4Z94 A;  3B6P A;  1M1K O;  4OVL A;  3ENO A;  3ZSQ A;  4IDH A;  4NLB A;  4FLX A;  5FRN A;  4M3Y A;  5AQT A;  3SAH A;  4FK4 A;  4CGJ A;  5HRR A;  1WAJ A;  3AVL A;  3DI6 A;  3HI0 A;  4AM6 A;  1HKB A;  3THW B;  4E3S A;  5KRT A;  4GV3 A;  3LAL A;  3C7N A;  3KWG A;  4JKF A;  4JI6 K;  1Z25 A;  1VSE A;  4YOR A;  3NF7 A;  1RT5 A;  1L5U A;  4CE9 A;  2KTQ A;  3QFP A;  3KIO A;  1J9A A;  4BC2 A;  2QWP A;  4FJJ A;  4DR5 K;  3WEE B;  4F8R A;  3H1Q A;  4IJA A;  2Q0U A;  1T05 A;  3VEN A;  4ISE A;  4L3Q A;  1RDW X;  5AQF A;  5AJ3 K;  3ISN C;  4X62 K;  3NHG A;  1VQN N;  1RDA A;  2IGI A;  3KLG A;  4X65 K;  3K58 A;  3THX A;  4CBU A;  1U04 A;  5BPL A;  2P9U B;  3K5M A;  3L6Q A;  4F3O A;  5K14 A;  4DB3 A;  3QET A;  2ZJR L;  2P51 A;  2HHX A;  3AVC A;  1TKZ A;  3UKR A;  5BRD A;  3VF6 A;  3JXU A;  3B8A X;  4X64 K;  1IKX A;  2F9T A;  3P39 A;  4IO9 L;  1GLF O;  1GLE G;  1JL2 A;  1OH6 A;  4YNQ A;  1MA9 B;  1R0A A;  4A5A A;  3LDO A;  4Z4E A;  4CEF A;  4AIL C;  3D45 A;  4LF9 K;  4B8A B;  4YOY A;  3A2F A;  2EWS A;  5C24 A;  4BRP A;  4JKG B;  4B9T A;  2BE2 A;  4KBO A;  2YKN A;  5AQO A;  5AZI A;  4BVO A;  1UA1 A;  3SQ4 A;  4N56 A;  3IRX A;  3O9U A;  4MDB A;  3H08 A;  1IG8 A;  4BDZ A;  3F2K A;  2V7Y A;  4DQQ A;  5JS1 A;  1JXB A;  2VCP A;  1JXE A;  2YJF A;  4JNE A;  3TAM A;  3OHR A;  1ITG A;  1VAZ A;  2PFU A;  1K8K B;  3O80 A;  1NJI O;  4DV7 K;  3FZL A;  4EP5 A;  3F5T A;  1YT3 A;  4NCA A;  1W9H A;  3KK1 A;  2D4W A;  3ZT1 A;  4ISG A;  1VSJ A;  3MEC A;  3RR7 A;  5JVH L;  1VQL N;  1RT4 A;  3O4N A;  4GVM A;  1CZB A;  2Q1N A;  4LSL A;  1C0T A;  3AAQ A;  3LPT A;  1NGA A;  3VQA A;  1WSH A;  4GW6 A;  5LL6 Z;  3SMP A;  3L2W A;  3GBT A;  3T7Z A;  4O0J A;  1A5W A;  4KTW A;  4KI4 A;  2O8B B;  1UWB A;  4E1J A;  2RN2 A;  3OYK A;  1K8A O;  2ASO A;  3KLH A;  1KC8 O;  3VQE A;  4BC3 A;  1NGJ A;  3AVH A;  3AVK A;  3D6R A;  2P9I A;  2NRX A;  3AA2 A;  1NKB A;  4WFB L;  3GE1 A;  4K8Z A;  1MDU B;  2VWB A;  1KRP A;  1BI4 A;  4A57 A;  2QEX N;  2JWK A;  3QIC A;  3D0P A;  3PO4 A;  4BG8 A;  2RE2 A;  1YF5 L;  3L4I A;  2XY7 A;  2UXC K;  1KVC A;  4CZK A;  2YNI A;  2YHX A;  1IV0 A;  4DHY A;  3CJA A;  4CJ3 A;  1QQO A;  2FF6 A;  3WXL A;  3QNN A;  3NH2 A;  3K5L A;  3JYT A;  1YAG A;  4DSK A;  4LF4 K;  1VHX A;  5DM6 L;  1NWK A;  3WNF A;  4DTN A;  4H0P A;  3CC7 N;  4DQP A;  3VTH A;  4CJS A;  4JKA A;  4PL8 A;  1CLQ A;  3PIP L;  2DTU A;  3NGI A;  4BWM A;  2QXF A;  3NVM A;  5BPM A;  3AO5 A;  1XNR K;  5HRN A;  5GIN A;  4CI6 A;  2HND A;  2ZJP L;  3AO2 A;  3SUO A;  3DXK B;  4E7I A;  1YUW A;  3K0S A;  4DV3 K;  1QVF M;  1JLB A;  4CJT A;  3L0Q A;  3JSM A;  3CF5 L;  3O1B A;  4GV6 A;  3C6U A;  3OYJ A;  3G6E N;  4B1Y B;  1Q81 O;  3CCL N;  3KK7 A;  1YJW N;  4CGI A;  3J81 O;  4CJ4 A;  1C0G A;  3E01 A;  4IFY A;  3OS2 A;  4CZE A;  3BDP A;  1VSI A;  4BE2 A;  1HNV A;  2O8D B;  2FXU A;  4O8U A;  5AZJ B;  1NOZ A;  4BR5 A;  4BRD A;  2GTD A;  4BRQ A;  1T03 A;  2A41 A;  1NM1 A;  4PQU A;  1HKG A;  1JLC A;  4DTX A;  4BRO A;  2HMP A;  3CI5 A;  4KFB A;  2P1J A;  3HP6 A;  2P9S B;  2G8W A;  2FF3 B;  4CFD A;  3SUP A;  1EQY A;  5AQX A;  2Y1I A;  3AAP A;  3V9U A;  3DXM B;  2P9K B;  1RBR A;  2W6K A;  1CZA N;  3MN9 A;  4BRI A;  4K41 A;  4CJF A;  3ZEU B;  2B4J A;  1T7P A;  4YFU A;  3THW A;  3AVN A;  2XY5 A;  3LZI A;  2UXD K;  3VEX A;  5AQQ A;  4WF9 L;  3OJU A;  1A5V A;  5GAD P;  3CYM A;  2NRR A;  4DV0 K;  1XWL A;  4FWS A;  5LJV A;  4FOI A;  4CK3 A;  3KVG A;  3LL3 A;  5IWA K;  5JLF A;  1S5J A;  2YNG A;  3VTI A;  1IKY A;  4DSJ A;  3O3H A;  5F2R A;  4R79 A;  1WSE A;  1QZ6 A;  2ZF5 O;  4M42 A;  3ZT0 A;  4EHU A;  2WON A;  3SYZ A;  4C8L A;  4FJ9 A;  1I94 K;  4HCC A;  4RWT A;  4FWM A;  1QTM A;  1N36 K;  3OYN A;  1Z6R A;  4M7X A;  2P9U A;  1D8Y A;  2HBL A;  3F9M A;  2V52 B;  3T19 A;  2KW4 A;  1BCO A;  1WNS A;  1C6V A;  3AO4 A;  1NKE A;  2ZGY A;  3TTF A;  1WOQ A;  4MLE A;  4CHZ A;  4H8K A;  4W5Q A;  5HP1 A;  2PYJ A;  2FSN A;  4DUZ K;  1TVR A;  5C42 A;  3LM9 A;  3HPH A;  4DWI A;  3KLI A;  4GNI A;  1RBT A;  4FM0 A;  4CZJ A;  4CFA A;  1VQ5 N;  4CER A;  4KTQ A;  1HYV A;  3WNE A;  3I8D A;  1UAX A;  4BRM A;  3AVI A;  1OH7 A;  1KFS A;  4KRF A;  4JKG A;  4J2D A;  3LDL A;  2KZZ A;  3SPZ A;  1KVA A;  4BE1 A;  3HZ6 A;  3DLG A;  2J4R A;  2XY8 A;  4FWQ A;  3A0I X;  4Q5V A;  1GLD G;  2QXL A;  4O55 A;  4FLW A;  4J2E A;  4GVE A;  1TV6 A;  4FOE A;  1QE1 A;  1JLE A;  2QKB A;  4KHS A;  3TSQ A;  1TK5 A;  2E20 A;  4WFA L;  5MLC Q;  3AV9 A;  1VSH A;  4FW2 A;  4PL7 A;  3K2P A;  5FRO A;  2QKK A;  4BRK A;  4YOV A;  3I8B A;  1HNI A;  1HJR A;  3HO1 A;  4KTZ A;  4JS5 A;  1Y97 A;  4BQL A;  3ZYY X;  3C0B A;  5GIP A;  3SK3 A;  2HW3 A;  2FLO A;  5I3U A;  5AQG A;  5E26 A;  1VQK N;  1RTJ A;  2HMI A;  1SL2 A;  4DSI A;  3CXC M;  1VQ9 N;  3LAK A;  3AGK A;  3SMS A;  4U7B A;  1XC9 A;  1SL1 A;  3O08 A;  1E4F T;  1S1X A;  1NGC A;  4I2Q A;  3NMU A;  4LF8 K;  3L3U A;  3HST B;  5TKW A;  1RTD A;  1NG9 A;  3QLH A;  1S1U A;  4AQY K;  4FJ8 A;  1O1W A;  2V51 B;  4MO4 A;  1OH5 A;  3ZX2 A;  4QS9 A;  3HL8 A;  2FSK A;  4DSE A;  2IIR A;  3NF9 A;  1IKW A;  3SPY A;  3QEV A;  1ASW A;  4N5S A;  2VGM A;  4IOA L;  3BUZ B;  5DM7 L;  4FLV A;  5HBM A;  1VQ8 N;  3KJV A;  4BRG A;  1BUP A;  4LSN A;  3VPZ A;  4EAH D;  2PYL A;  3WNG A;  3QER A;  2VWJ A;  4ELU A;  5BN8 A;  4CJQ A;  3WNH A;  1VSM A;  3AVF A;  3VEV A;  4M63 C;  1JLA A;  4WE1 A;  5CYQ A;  3ZT3 A;  1U2V A;  5EX5 A;  4LFA K;  3DXK A;  1NOY A;  4FLZ A;  2CGJ A;  3VEW A;  3BP8 A;  3DLR A;  3PY8 A;  5C15 A;  1D9F A;  2D0C A;  4Z4G A;  3U8X A;  1C0U A;  2I7N A;  4M3R A;  2A1R A;  1LV5 A;  1WAF A;  3ID8 A;  5AQI A;  5EOY A;  4Z4F A;  1YJN N;  1YTA A;  4B3R K;  1WSF A;  5DMR A;  4KHU A;  1FKP A;  3T1Y K;  2O8D A;  5AZJ A;  4I6M B;  4DR1 K;  4JV5 K;  2PAV A;  2HF3 A;  1V4T A;  2BH1 A;  2I7P A;  4LC9 B;  1NBW A;  4CK1 A;  1X1P A;  2GV9 A;  4FXD A;  4CZF A;  2P9S A;  4DLE A;  5FPN A;  2H3G X;  3RSE B;  3L2U A;  4C1N I;  3RWU A;  3P38 A;  4BC4 A;  1RDU A;  4JS4 A;  3ZEU A;  4FWN A;  3U3Y A;  5ELZ A;  2KKZ A;  4YOX A;  1U45 A;  4A2B A;  3QBW A;  3PLA A;  3EKS A;  4J2B A;  5TKY A;  4FM2 A;  4B9Q A;  3L3V A;  1IH7 A;  4N41 A;  4OPA A;  1BQM A;  1SS6 A;  3IS9 A;  4CF0 A;  3MXI A;  1WBD A;  4FJN A;  1YXQ A;  1EXQ A;  3IFR A;  2GWJ A;  2GUI A;  2ETJ A;  2KHO A;  5M1N A;  3ZLJ A;  1OKJ A;  1OVY A;  3QEI A;  5GIO A;  3SI6 A;  3O4W A;  3SAG A;  3V1Q A;  2FSJ A;  1RBS A;  2X74 A;  1NK0 A;  1K9M O;  5J2M A;  3V9X A;  4KHN A;  1XUP O;  1BIS A;  3C6H A;  4CJL A;  3V4I A;  4FJI A;  4QCL A;  2P9N B;  3ZT4 A;  4KH4 A;  1YTU A;  2OTJ N;  2OA8 A;  3NH0 A;  5CZ2 A;  4AHS A;  3I33 A;  3QBX A;  2VYP A;  2O4I A;  1ATS A;  3CET A;  3HP9 A;  3LP1 A;  4OJR A;  3V81 A;  1GLA G;  3SJJ A;  2VGN A;  1QZ5 A;  2O8E B;  1WB9 A;  1NLV A;  2IC3 A;  4YOT A;  1RDD A;  4W5O A;  4KHY A;  5C10 A;  3RRH A;  2E6L A;  4FCY A;  3V9W A;  1KCF A;  3U6F A;  3J7A P;  3C95 A;  4Z0U A;  3UIQ A;  3M8S A;  3R9P A;  3CQ8 A;  4HVJ A;  4OGC A;  1WBB A;  2Q31 A;  4FW1 A;  4CIE A;  4GMJ B;  3CCQ N;  3RMC A;  3S41 A;  1T3V A;  1JJ2 M;  4DUY K;  1GLC G;  5BPN A;  2GBZ A;  1RTH A;  3ZET A;  1RBV A;  4H5W A;  4C1N K;  1GLJ O;  2E2Q A;  5T7B A;  4KHP K;  1FXX A;  5AQV A;  4JKD A;  1RFQ A;  2YNH A;  4Y1C A;  1E4G T;  4F4K A;  2HVH A;  4CEC A;  3WQT A;  3IDH A;  5GAE P;  4WQ5 C;  3NCI A;  1IJJ A;  2GX9 A;  3SQ1 A;  3LDP A;  3RRG A;  4QS8 A;  3CFO A;  4RW9 A;  3OW2 M;  1GOC A;  2E88 A;  3H46 O;  4OKE A;  2FBX A;  2GWK A;  3EY1 A;  1QSL A;  3DOL A;  1X9S A;  5AQP A;  3T69 A;  1MWM A;  2XHB A;  1N33 K;  3D2E B;  3KKS A;  3CCV N;  3CCJ N;  2GEL A;  4KI6 A;  3OA9 A;  4JI5 K;  3EN9 A;  2F8T A;  4CES A;  2DFF A;  1XNQ K;  3OYB A;  1KAZ A;  1ZYQ A;  3N4P A;  1NK4 A;  5EVZ A;  3CG7 A;  5CY4 A;  5LMN K;  2Z1H A;  2O8F B;  4OPK A;  4NO7 A;  1Q18 A;  4Y1D A;  2WTU A;  3VEZ A;  3SQ0 A;  2FBY A;  3F73 A;  4M3W A;  4IDK A;  4MQ3 A;  3BEX A;  1HNZ K;  1J53 A;  4CZI A;  1TGO A;  1NJZ A;  3SV3 A;  1HNW K;  4BVP A;  3O9T A;  2R7Y A;  1ZBU A;  1BG3 A;  4PKH A;  1X9W A;  4YY3 K;  4OO1 J;  4DR2 K;  3RMD A;  4FLT A;  3MAQ A;  3THY B;  5M1F A;  4DFJ A;  3DLE A;  1S6P A;  3MX5 A;  3WT0 A;  1TK8 A;  2CH5 A;  3A8Y A;  4I9L A;  4BR7 A;  1J5E K;  1G99 A;  3A5L C;  3KD5 E;  4H0X B;  2FC0 A;  4FL9 A;  3VN5 A;  1HJO A;  3ITH A;  4DV1 K;  5JIC A;  1O13 A;  5KGW A;  3O9Q A;  3MCA B;  1KTQ A;  1NJX A;  3EE8 A;  3ZSY A;  2HHV A;  3RMA A;  5C25 A;  3OYL A;  3CJB A;  3H45 C;  5CZ1 A;  4A5B A;  4FO0 A;  4CGG A;  1NGE A;  5J2Q A;  4M3T A;  3CM5 A;  3KWI A;  2DFE A;  3AVA A;  2BGG A;  4ID1 A;  3A5M C;  1NNE A;  1RDC A;  3FZM A;  4IEE A;  4FZZ A;  3MN5 A;  4FJ5 A;  3QML A;  3CCU N;  3WXK A;  4CJK A;  4B9S A;  3L2Q A;  3VOV A;  4XH5 A;  4I6M A;  1TYQ B;  3WXI A;  2A42 A;  3W0L A;  3IAY A;  4OLA A;  4IXC A;  3HXM A;  1TKX A;  3M3Z A;  4EFH A;  3V9S A;  4DKW A;  3RSE A;  4BR2 A;  4BQZ A;  2W6L A;  4OX9 K;  2X6N A;  3BZC A;  1U49 A;  5A2Q O;  2OTL N;  2DFH A;  2NLX A;  4XH4 A;  4YDU C;  3HRG A;  4K8X A;  3OYF A;  1TAQ A;  1DT9 A;  1LW0 A;  1U2V B;  1U47 A;  4HUF A;  2QW9 A;  2A6A A;  4H5V A;  3VQC A;  1OH8 A;  3M5R A;  2VQE K;  1QSS A;  1CXU A;  2QWO A;  3EEQ A;  2PY5 A;  1VK0 A;  4BWJ A;  1BOT O;  4WCE L;  3CCE N;  4CFB A;  3DRP A;  4YHH K;  1SKR A;  4IG0 A;  2IVN A;  3AY9 A;  1XMQ K;  5BRE A;  3WXJ A;  4F9O A;  4DF8 A;  4M41 A;  1GOA A;  3PX6 A;  2JGU A;  3R3L A;  1GLL O;  1E3M A;  1IKV A;  5J1E A;  2B6A A;  4JK9 A;  4HCB A;  4GKJ K;  2P9N A;  2HNZ A;  2ZGZ A;  4EHT A;  1HYZ A;  2NNW A;  2NUB A;  4A2A A;  1HRH A;  3EL2 A;  4M45 A;  4ELV A;  3KD1 E;  4H5R A;  4JI3 K;  4X66 K;  1REV A;  2O8E A;  3WUH A;  4BGB A;  4DQI A;  1ATN A;  4W5T A;  5AQN A;  1RT6 A;  4AF1 A;  4DTS A;  1V4S A;  5E84 A;  4V19 S;  5SZT A;  5AQU A;  4QS7 A;  1U6Z A;  4CF8 A;  3M6G A;  1EWR A;  1JLQ A;  1CZ9 A;  1ESV A;  3TU5 A;  4BRF A;  4IFE A;  1WSI A;  3DYA A;  4DV5 K;  4BRE A;  1HLU A;  1SKW A;  4JEP A;  4JI8 K;  3VQ8 A;  4BR9 A;  3QEP A;  3HBT A;  2NRZ A;  4Y0W A;  4BC5 A;  3HK2 A;  5JVG L;  1SQK A;  3VA0 A;  5KTQ A;  4FZX C;  5AFU H;  3CER A;  3OJS A;  4B1V A;  3QDK A;  4CEZ A;  4A62 A;  4CD3 A;  2NRV A;  4JHD B;  4CZL A;  4O5B A;  1NK5 A;  1NK6 A;  3NH1 A;  1IO2 A;  3OYD A;  3W3D A;  4ID5 A;  1ILY A;  2X78 A;  4MLH A;  4CJE A;  4CIG A;  3G71 N;  1NGI A;  2IOC A;  2KQ2 A;  5AQM A;  2OZM A;  1HQE A;  1JLF A;  2YNF A;  1EET A;  3L8B A;  4WQ4 C;  4DQ8 A;  1SL0 A;  1EP4 A;  2AJQ A;  3CM6 A;  1RBU A;  4DFP A;  4JI4 K;  2W40 A;  1N32 K;  3FZK A;  3O9S A;  3QEX A;  4JK7 A;  3E9L A;  3D2E A;  2G8V A;  3ATV A;  1BDG A;  1LWF A;  3VQ6 A;  3K5N A;  3MEG A;  1Z26 A;  4MO5 A;  4LF6 K;  2D0O A;  4OGE A;  4BRA A;  5BRF A;  4JRQ A;  4DV4 K;  4LF5 K;  3TAN A;  1NMD A;  5GAH P;  4JI2 K;  3HVT A;  4BRN A;  4CBX A;  3ZET B;  4FK2 A;  3VER A;  4DTO A;  4AHT A;  3PV8 A;  4CBW A;  5I42 A;  3U3G A;  2O8F A;  3OTO K;  1QQN A;  3AA3 A;  1J5O A;  1W0H A;  3AVB A;  1F21 A;  2PBD A;  3HOT A;  5AQY A;  1WN7 A;  4E7J A;  2QWR A;  4DTJ A;  5HRP A;  3FZH A;  1BIU A;  2Q36 A;  4JD2 B;  4LF7 K;  3O9R A;  2KFN A;  3DMJ A;  5C0Y A;  4DSL A;  1QVG M;  1W7A A;  2OPP A;  4E0D A;  1IBL K;  4JKB A;  5B8H A;  4B3S K;  3SAF A;  2HHU A;  4FWO A;  2QWN A;  4HHT A;  4H0O A;  1J6Z A;  1TAU A;  4K43 A;  3VF4 A;  2HHS A;  3KK3 A;  3DJC A;  1RIL A;  3ZSR A;  3THY A;  3OBW A;  4PUO A;  1LCU A;  5ADX H;  1Y64 A;  1DTT A;  3K59 A;  1X3N A;  5KQ8 A;  3FLC O;  4DR6 K;  3VQ5 A;  3SUN A;  1TK0 A;  3T1H K;  1Q9X A;  3VF2 A;  3V1R A;  2QI2 A;  4BG9 A;  4GY2 B;  4CJR A;  1KAY A;  4FYD A;  4DFK A;  4CGH A;  2Z1J A;  1BIZ A;  1LWC A;  1FW6 A;  1C1C A;  4FWP A;  2VG7 A;  3TWH A;  5J2N A;  4I7F A;  2XY6 A;  4ILH A;  3NBP A;  4KKO A;  4KB0 A;  5KGX A;  1JCF A;  2E6M A;  2ZE2 A;  3HOS A;  4B9U A;  3G0Z A;  4MDA A;  3K9K A;  3DLH A;  3WXM B;  1B92 A;  3J8A A;  1T44 A;  2XO7 A;  2QWQ A;  3HT3 A;  3MMV A;  3KTQ A;  1TYQ A;  2Q97 A;  2ZJQ L;  3TAG A;  1XC3 A;  1S1W A;  4U67 L;  2Z1I A;  2ZWH A;  3IKM A;  3CQY A;  4C8M A;  4NB4 A;  4E1M A;  5KQD A;  3VES A;  5C12 A;  2NZT A;  4NCG A;  4CED A;  3UKU B;  3C6A A;  4DFM A;  1WSG A;  2Z1G A;  3QO9 A;  2ASP A;  2VQF K;  3S3O A;  1VQP N;  4I2P A;  4CHN A;  3BF3 A;  3J80 O;  4IKF A;  5AQL A;  3EYZ A;  2E2P A;  4ZTF A;  1H1V A;  5HL7 L;  4B1Z A;  1XI1 A;  3VET A;  1LWE A;  3J7Y P;  4H5N A;  1RT3 A;  1K6Y A;  3OBY A;  2VWK A;  4YOW A;  2A40 A;  3HSC A;  3TAB A;  4E7H A;  2RPI A;  2NRW A;  1JCG A;  4C8K A;  1BCM A;  3U9Z A;  1JKH A;  3C65 A;  2EX3 A;  2Y1J A;  3LZJ A;  1KQS M;  4FJK A;  4DU4 A;  5SWM A;  2HB5 A;  2YCH A;  2DPN A;  4JKH A;  3CC4 N;  1IG9 A;  3LDQ A;  2UYT A;  2F96 A;  2OPS A;  1TL1 A;  4LH4 A;  1RNH A;  4CEQ A;  4CF2 A;  2G8H A;  3SQ2 A;  1XHX A;  3CJC A;  5KI6 A;  4XH1 A;  3M1F A;  3E9P A;  3FFK B;  4CD1 A;  2P5O A;  3ZX3 A;  2E2N A;  4RTF D;  3DLK A;  4H0T B;  1W2B M;  1BU6 O;  1C0F A;  4RW6 A;  3NGY A;  3TAQ A;  1U48 A;  4C8O A;  5D3G A;  4JK8 A;  2HBM A;  1RT7 A;  4PKG A;  1S3X A;  1XQS C;  4CIF A;  2W41 A;  5HRO A;  3CMA N;  4AHV A;  4K25 A;  4BR4 A;  2OZS A;  3AO1 A;  4JRP A;  2D1K A;  4CVN E;  3OYI A;  3AGR A;  4R5P A;  1NGB A;  4IZ9 A;  4B9L A;  4FZY A;  4TSX A;  1HYS A;  4JHD A;  1SV5 A;  3U4L A;  3O4Q A;  1J54 A;  4K0K K;  4HTL A;  3VQB A;  1HMV A;  1Q9Y A;  2WUS A;  5AQK A;  3AVM A;  4IWV A;  3FFI A;  2IVO A;  1N34 K;  3ENB A;  3KK2 A;  1EX4 A;  2YHB A;  3NF8 A;  4DU1 A;  4CGD A;  1C1A A;  1TKT A;  3VEO A;  4CHP A;  2HHW A;  2ZD1 A;  1KFD A;  4B08 A;  2G8K A;  3LAM A;  4FM1 A;  3JS6 A;  4KV8 A;  1XHZ A;  4KH5 A;  2O4G A;  2HF4 A;  2WFB A;  1ZBH A;  4CJP A;  3TAE A;  3D2F B;  3CCS N;  2YHW A;  4IOC L;  2GEM A;  3T3F A;  1R59 O;  2FBT A;  4RW4 A;  2CH6 A;  5KPZ A;  1ZC6 A;  3R1X A;  5FPD A;  4HUE A;  2HHQ A;  2IVP A;  4CZG A;  3NDK A;  2QWL A;  5HRS A;  4JI0 K;  3NF6 A;  3ZSW A;  3OYE A;  1CXQ A;  3QIO A;  4DV6 K;  3RR8 A;  1NK7 A;  1ZBI A;  3NFA A;  4EIA A;  4BDP A;  3VEY A;  4Z4I A;  3CPE A;  1B9D A;  4GV9 A;  3QIN A;  4DF4 A;  3HPO A;  3UB5 A;  4IJN A;  1NJY A;  3DLB A;  2QA4 N;  3ZSO A;  3V9Z A;  4FJX A;  1D5A A;  4B3M K;  3TTD A;  3C6T A;  1NJW A;  1KLN A;  3O5B A;  5M1O A;  3OYM A;  3MXM A;  4N47 A;  1KXP A;  4B1X B;  1S1V A;  1WSJ A;  4DSF A;  1XMO K;  4JD2 A;  4CEO A;  3PSF A;  4CJ5 A;  4JN4 A;  4YDU A;  5M1K A;  5BN9 A;  5LJW A;  1NGG A;  3SZ2 A;  1S72 N;  1G15 A;  2WC9 A;  3BF1 A;  4RW7 A;  4BDY A;  3V1O A;  3SJH A;  2A5X A;  1KD1 O;  3TSU A;  4E1N A;  5HOO A;  2UUA K;  2G8I A;  4FWK A;  3LWL A;  4DR7 K;  4C23 A;  2HVI A;  1UA0 A;  4JAX A;  4RW8 A;  1L3T A;  3ULE B;  4CEA A;  3TAP A;  4KHW A;  2JLE A;  1RDB A;  2OCE A;  1U4B A;  2NRT A;  4O5F A;  3MCP A;  4DQS A;  4FLY A;  2AP1 A;  2UU9 K;  1YIT N;  4M3X A;  3E1Y A;  3R8E A;  3DAW A;  3K5O A;  4O4G A;  3IG1 A;  3SCX A;  2WBN A;  1GLB G;  2D5R A;  3FE1 A; 
#chains in the Genus database with same CATH homology
 1ASU A;  2NUB A;  3B6O A;  4E7K A;  4AHC A;  3SV4 A;  1HJR A;  4H4O A;  4M3U A;  1HRH A;  2BDP A;  2ATQ A;  4QOZ B;  3HO1 A;  4I9Q A;  4M45 A;  1BL3 A;  1FK9 A;  3P83 D;  4KTZ A;  3VA3 A;  4JS5 A;  4ELV A;  3LPU A;  3KD1 E;  4F2S A;  4FK0 A;  1Y97 A;  3I0R A;  1REV A;  2DY4 A;  3KLF A;  3OYG A;  2HW3 A;  4KB1 A;  5I3U A;  4KAZ A;  5FDL A;  4Z4C A;  3DOK A;  1B9F A;  1KVB A;  2HNY A;  1RTJ A;  3LDS A;  2HMI A;  4DQI A;  1ASV A;  4NCB A;  1S1T A;  4E89 A;  4W5T A;  4XIU A;  1RT6 A;  1SL2 A;  4DSI A;  2BAN A;  3ZSV A;  4DTS A;  3HPG A;  3S3N A;  3LAK A;  3QNO A;  1BHL A;  5SZT A;  1XC9 A;  1SL1 A;  1N6Q A;  4CF8 A;  1JL1 A;  1GOB A;  1S1X A;  5J2P A;  4I2Q A;  1JLQ A;  1CZ9 A;  3L3U A;  4OKJ A;  4N76 A;  3M8R A;  4Q0B A;  1WSI A;  3DYA A;  3HST B;  1RTD A;  3ULD A;  1SKW A;  3QLH A;  1S1U A;  3P1G A;  3RMB A;  4OKK A;  3V6D A;  2ITG A;  3VQ8 A;  2WOM A;  2FBV A;  3S3M A;  3QEP A;  4J2A A;  4FJ8 A;  2KFZ A;  1S9E A;  1O1W A;  3DRR A;  1ZBL A;  1SKS A;  4KRE A;  3HK2 A;  1A5X A;  1I39 A;  2VG5 A;  3B6P A;  3ZSZ A;  4OVL A;  3L2V A;  4DTP A;  3HL8 A;  1YTU A;  3VA0 A;  5KTQ A;  4FZX C;  2YKM A;  3ZSQ A;  4FLX A;  3OJS A;  4DSE A;  5FRN A;  4M3Y A;  4OPJ A;  4DQR A;  4CEZ A;  1KSP A;  3NF9 A;  4PY5 A;  1IKW A;  4FK4 A;  4CGJ A;  5HRR A;  1WAJ A;  3AVL A;  1ASW A;  3QEV A;  3SPY A;  4KHQ A;  4N5S A;  3DI6 A;  3AO3 A;  2ZQB A;  4O5B A;  4FJM A;  4E3S A;  1NK5 A;  5KRT A;  3PX0 A;  4FLV A;  3LAL A;  5HBM A;  1NK6 A;  3KJV A;  3NH1 A;  1IO2 A;  4LH5 A;  4LSN A;  3OYD A;  4ID5 A;  2X78 A;  4CJE A;  2PYL A;  4CIG A;  2IOC A;  2KQ2 A;  1Z25 A;  3WNG A;  2OZM A;  1VSE A;  4E7L A;  1HQE A;  3QER A;  1JLF A;  2YNF A;  1EET A;  3TR8 A;  3NF7 A;  2VWJ A;  4IFV A;  4ELU A;  3L8B A;  1RT5 A;  4CJQ A;  1L5U A;  4CE9 A;  3WNH A;  1VSM A;  3AVF A;  1SL0 A;  1EP4 A;  1L3S A;  2KTQ A;  3CM6 A;  3KIO A;  2AJQ A;  4M3Z A;  1J9A A;  2E4L A;  4CEE A;  4FJJ A;  1JLA A;  4WE1 A;  1RBU A;  4DFP A;  3O3F A;  5CYQ A;  3T1A A;  4JLH A;  1EKE A;  3ZT3 A;  2G8F A;  1NOY A;  4FLZ A;  1UOC A;  1NK9 A;  3QEX A;  4F8R A;  3DLR A;  3PY8 A;  1T05 A;  2G8V A;  4ZHR A;  1LWF A;  3VQ6 A;  3K5N A;  1D9F A;  3MEG A;  4F3T A;  4B9N A;  2D0C A;  4Z4G A;  1Z26 A;  4ICL A;  1C0U A;  3OYC A;  2A1S A;  4OGE A;  4O0I A;  2IAJ A;  4M3R A;  3ISN C;  3NHG A;  2A1R A;  1RDA A;  2IGI A;  3KLG A;  4JRQ A;  1LV5 A;  3K58 A;  1WAF A;  1SUQ A;  3TAN A;  3HVT A;  4DTM A;  3SUQ A;  1U04 A;  4Z4F A;  3K57 A;  1YTA A;  4PA1 A;  4FK2 A;  4DTO A;  3K5M A;  1WSF A;  5DMR A;  4AHT A;  5K14 A;  3PV8 A;  1TKD A;  4F3O A;  4KO0 A;  5I42 A;  3U3G A;  4KHU A;  1FKP A;  2B5J A;  3AA3 A;  3QET A;  1W0H A;  2P51 A;  3AVB A;  1J5O A;  4O44 A;  2HHX A;  1F21 A;  3AVC A;  1TKZ A;  4EZ6 A;  1WN7 A;  1IKX A;  4E7J A;  4CK1 A;  4DTJ A;  5HRP A;  1BIU A;  1X1P A;  2GV9 A;  1JL2 A;  4FXD A;  1HPZ A;  2KFN A;  3DMJ A;  4YNQ A;  4DLE A;  2P5G A;  4DSL A;  1R0A A;  4E0D A;  2OPP A;  3L2U A;  1T8E A;  1VSF A;  4Z4E A;  3RWU A;  3C94 A;  4CEF A;  3LP0 A;  4AIL C;  3QES A;  3D45 A;  2HHU A;  4HHT A;  3MXJ A;  4B8A B;  3A2F A;  5C24 A;  4JS4 A;  1L3V A;  1TAU A;  4B9T A;  1C0M A;  2BE2 A;  3U3Y A;  4MFB A;  2YKN A;  4DTU A;  2HHS A;  1UA1 A;  3QIP A;  3KK3 A;  3SQ4 A;  3ZSR A;  1RIL A;  4N56 A;  3IRX A;  1U45 A;  2G8U A;  4PUO A;  3H08 A;  4BDZ A;  4DG1 A;  4J2B A;  4EP4 A;  4FVM A;  4FM2 A;  3L3V A;  1IH7 A;  2D0A A;  4C8N A;  3PUF A;  4DU3 A;  4N41 A;  4FJN A;  1BQM A;  3IS9 A;  4CF0 A;  1DTT A;  3K59 A;  4DQQ A;  3ALY A;  3MXI A;  5JS1 A;  3VQ5 A;  3SUN A;  1TK0 A;  1JXB A;  1Q9X A;  1EXQ A;  1JXE A;  3VQ4 A;  2GUI A;  3TAM A;  2ETJ A;  1ITG A;  3V1R A;  4ZTJ A;  3QEI A;  3VQD A;  4CJR A;  3SI6 A;  4FYD A;  4DFK A;  4CGH A;  4EP5 A;  3V1Q A;  2Z1J A;  1RBS A;  1BIZ A;  2X74 A;  1NK0 A;  1LWC A;  1Q8I A;  1YT3 A;  4NCA A;  1W9H A;  3KK1 A;  5J2M A;  3HJF A;  3V9X A;  3ZT1 A;  4KHN A;  1BIS A;  1C1C A;  1VRT A;  4CJL A;  4FJ7 A;  3V4I A;  1VSJ A;  4FJI A;  4QCL A;  2VG7 A;  3MEC A;  3RR7 A;  3ZT4 A;  1RT4 A;  3TWH A;  1QQC A;  4I7F A;  3O4N A;  4GVM A;  5CZ2 A;  1CZB A;  4AHS A;  3NH0 A;  4LSL A;  5J2N A;  3NBP A;  1C0T A;  3LPT A;  4KKO A;  3VQA A;  2O4I A;  1WSH A;  1DTQ A;  4KB0 A;  5KGX A;  3LP2 A;  4GW6 A;  2E6M A;  3HP9 A;  2ZE2 A;  3L2W A;  3LP1 A;  4OJR A;  3V81 A;  4O0J A;  1A5W A;  4KTW A;  3SJJ A;  4KI4 A;  3OYH A;  1UWB A;  4B9U A;  3G0Z A;  2RN2 A;  2IC3 A;  3OYK A;  1RDD A;  2RF2 A;  3KLH A;  3DLH A;  1B92 A;  3VQE A;  4W5O A;  4KHY A;  4CHO A;  2XO7 A;  3AVH A;  3AVK A;  3HT3 A;  3TAR A;  1MU2 A;  3AA2 A;  3ASM A;  2RKI A;  4CF1 A;  1NKB A;  3KTQ A;  1RTI A;  2E6L A;  4FCY A;  3V9W A;  1KCF A;  3RRH A;  3U6F A;  3PX4 A;  3TAG A;  4K8Z A;  3C95 A;  1S1W A;  4Z0U A;  1KRP A;  1BI4 A;  3UIQ A;  2Z1I A;  4B9V A;  3D0P A;  3PO4 A;  3M8S A;  4W5R A;  3I0S A;  3HM9 A;  3CQ8 A;  3OYA A;  4HVJ A;  4B3O A;  4OGC A;  4FW1 A;  4CIE A;  4GMJ B;  3RMC A;  4C8M A;  4E19 A;  4E1M A;  2XY7 A;  1KVC A;  3VQP A;  1X9M A;  4NCG A;  2YNI A;  4CED A;  4FJL A;  1QS4 A;  2GBZ A;  4HUG A;  3PO5 A;  1RTH A;  4DFM A;  1WSG A;  4CJ3 A;  3QNN A;  1RBV A;  3LWM A;  4AHU A;  5T7B A;  2Z1G A;  3NH2 A;  3QO9 A;  1FXX A;  1RT1 A;  4IG3 A;  3K5L A;  3S3O A;  2I5J A;  3JYT A;  3TAF A;  1YVU A;  4I2P A;  2XY6 A;  4CHN A;  4DSK A;  4IKF A;  3EYZ A;  4ZTF A;  4OLB A;  3WNF A;  4DTN A;  2YNH A;  1XI1 A;  4Y1C A;  1LWE A;  2IDO A;  4W5N A;  4F4K A;  4DQP A;  4FLU A;  2LSN A;  4IBN A;  2HVH A;  1RT3 A;  4CEC A;  1KLM A;  4Z4H A;  4LY7 A;  1VSD A;  1K6Y A;  1TL3 A;  2KZM A;  2VWK A;  3NCI A;  4CJS A;  3SQ1 A;  3TAB A;  1CLQ A;  4DLG A;  2PZS A;  3RRG A;  3KKR A;  3NGZ A;  1LAW A;  3CFO A;  3NGI A;  2DTU A;  4RW9 A;  3LP3 A;  1NKC A;  4E7H A;  4BWM A;  2RPI A;  1GOC A;  2QXF A;  3M8P A;  4OKE A;  1NK8 A;  4C8K A;  1BCM A;  2FBX A;  1JKH A;  3AO5 A;  5HRN A;  3EY1 A;  2HND A;  2EX3 A;  2Y1J A;  3LZJ A;  1QSL A;  3DOL A;  4DU4 A;  5SWM A;  4ELT A;  1X9S A;  4FJK A;  3AO2 A;  3SUO A;  2HB5 A;  1VSL A;  4FJG A;  1S6Q A;  1IG9 A;  3KLE A;  4E7I A;  2XHB A;  4H4M A;  4DTR A;  5CYM A;  3KKS A;  2F96 A;  2OPS A;  1TL1 A;  4LH4 A;  1RNH A;  4CEQ A;  4CF2 A;  2YHA A;  2G8H A;  2QK9 A;  3SQ2 A;  3SNN A;  1QSY A;  4KI6 A;  1XHX A;  1JLB A;  3OVN A;  1N5Y A;  4CJT A;  1BQN A;  5KI6 A;  3JSM A;  2F8T A;  4CES A;  2DFF A;  3C6U A;  3OYJ A;  3OYB A;  4AH9 A;  1ZYQ A;  4CGI A;  4QAG A;  1QHT A;  4CFC A;  3ZSX A;  2OPQ A;  4AHR A;  4CJ4 A;  1FKO A;  2P5O A;  3E01 A;  1NK4 A;  3THV A;  1WLJ A;  3DLK A;  3CG7 A;  5CY4 A;  2Z1H A;  2XRI A;  4IFY A;  4OPK A;  3OS2 A;  4RW6 A;  4F2R A;  1I3A A;  1HQU A;  4Y1D A;  3BDP A;  3SQ0 A;  1VSI A;  3NGY A;  4CJW A;  2FBY A;  4BE2 A;  1HNV A;  3AVJ A;  3F73 A;  3S9H A;  3TAQ A;  4M3W A;  1U48 A;  4IDK A;  3BGR A;  4MQ3 A;  1VSK A;  2X6S A;  1NOZ A;  4C8O A;  5D3G A;  1ZBF A;  1RT2 A;  3MED A;  1RT7 A;  1T03 A;  1J53 A;  4CIF A;  4CHQ A;  4PQU A;  1TGO A;  1NJZ A;  1DLO A;  4LD0 A;  3SV3 A;  1JLC A;  4DTX A;  5HRO A;  4KFB A;  4AHV A;  1S9G A;  2P1J A;  3NAE A;  3OS1 A;  3HP6 A;  2G8W A;  2Q3S A;  2OZS A;  4CFD A;  3SUP A;  2Y1I A;  2R7Y A;  3AO1 A;  4JRP A;  1ZBU A;  3V9U A;  4CGF A;  3OYI A;  4CJF A;  1RBR A;  4R5P A;  4DS4 A;  3ZCM A;  5KRS A;  1X9W A;  4B9L A;  4TSX A;  4FZY A;  4CHY A;  2B4J A;  1L3U A;  1T7P A;  1HYS A;  1LAV A;  4YFU A;  3RMD A;  5FRM A;  1SV5 A;  4BE0 A;  4FLT A;  3O4Q A;  1J54 A;  3MAQ A;  3AVN A;  4L8R B;  1JLG A;  3HVR A;  2XY5 A;  3LZI A;  1BGX T;  3VQB A;  3VQQ A;  1HMV A;  3AA4 A;  3DLE A;  4DFJ A;  1Q9Y A;  3OJU A;  3L2R A;  3AVM A;  5EU7 A;  1S6P A;  4RG8 A;  1A5V A;  3CFP A;  3FFI A;  3CYM A;  1TK8 A;  3KK2 A;  1XWL A;  2F8S A;  1EX4 A;  2YHB A;  2D0B A;  3NF8 A;  4I9L A;  4CGD A;  4DU1 A;  3QEW A;  1C1A A;  1TKT A;  4CHP A;  2HHW A;  4CK3 A;  2ZD1 A;  1KFD A;  4HTU A;  4B08 A;  4CF9 A;  2G8K A;  3KD5 E;  3LAM A;  4FM1 A;  2FC0 A;  4KV8 A;  1XHZ A;  1S5J A;  2O4G A;  3VN5 A;  1ZBH A;  3CFR A;  2YNG A;  3ITH A;  4CJP A;  1IKY A;  4DSJ A;  3G10 A;  3O3H A;  3TAE A;  1WSE A;  5KGW A;  3RTV A;  3T3F A;  1NJX A;  1KTQ A;  2W42 A;  4M42 A;  2FBT A;  4RW4 A;  1VRU A;  3ZT0 A;  4HUE A;  2HHQ A;  3ZSY A;  2HHV A;  3RMA A;  5C25 A;  2WON A;  3OYL A;  5HRS A;  3NDK A;  3SYZ A;  4B9M A;  4C8L A;  4FJ9 A;  3NF6 A;  5CZ1 A;  4HCC A;  4DMN A;  3ZSW A;  3OYE A;  5HLF A;  1QTM A;  4CGG A;  1CXQ A;  4BAC A;  5J2Q A;  3QIO A;  4M3T A;  4NYN A;  3RR8 A;  1NK7 A;  4FJH A;  1ZBI A;  3CM5 A;  3AA5 X;  3DM2 A;  3NFA A;  2DFE A;  3AVA A;  2BGG A;  4ID1 A;  4CJU A;  4BDP A;  3OYN A;  4Z4I A;  1B9D A;  1RDC A;  1D8Y A;  3QIN A;  4FZZ A;  4FJ5 A;  4DF4 A;  3HPO A;  3T19 A;  1NJY A;  3DLB A;  2KW4 A;  1LW2 A;  1BCO A;  3HYF A;  1WNS A;  3VQ9 A;  1C6V A;  3ZSO A;  3AO4 A;  1NKE A;  2YV0 X;  4CJV A;  3V9Z A;  1D5A A;  4B8C A;  4CJK A;  4DS5 A;  3L2Q A;  4B9S A;  4FJX A;  3C6T A;  3ZT2 A;  1NJW A;  1KLN A;  4UQG A;  4CHZ A;  3LAN A;  4H8K A;  3M8Q A;  4W5Q A;  5HP1 A;  5JS2 A;  5DK5 A;  3OYM A;  4N47 A;  1TVR A;  3EZ5 A;  5C42 A;  3MXM A;  1D9D A;  2PYJ A;  3IAY A;  4OLA A;  1S1V A;  3HPH A;  1WSJ A;  3HXM A;  4G1Q A;  4DSF A;  3KLI A;  1BI4 B;  4DWI A;  4CEO A;  3OY9 A;  1RBT A;  1TKX A;  4CJ5 A;  4FM0 A;  4CFA A;  2IS3 A;  3V9S A;  4KPY A;  3TI0 A;  2OYQ A;  3SZ2 A;  3MEE A;  4CER A;  1G15 A;  4KTQ A;  1HYV A;  2X6N A;  4RW7 A;  3WNE A;  4BDY A;  1U49 A;  4CK2 A;  3I8D A;  1UAX A;  4KRF A;  3AVI A;  2EHG A;  2DFH A;  3V1O A;  1KFS A;  4K8X A;  3OYF A;  1TAQ A;  3VQ7 A;  4J2D A;  4E1N A;  2G8I A;  4EZ9 A;  1LW0 A;  1U47 A;  4HUF A;  3LWL A;  3P5J A;  2KZZ A;  3VQC A;  3AVG A;  3SPZ A;  2HVI A;  1C1B A;  1KVA A;  4BE1 A;  1UA0 A;  3DLG A;  2HHT A;  2XY8 A;  4RW8 A;  1QSS A;  1CXU A;  1L3T A;  3F9K A;  4Q5V A;  2PY5 A;  4CEB A;  1VK0 A;  4BWJ A;  4CEA A;  3TAP A;  4O55 A;  4KHW A;  4PWD A;  4FLW A;  2JLE A;  4J2E A;  1RDB A;  4CFB A;  2VG6 A;  1TV6 A;  3DRS A;  3DRP A;  3O3G A;  1U4B A;  1SKR A;  1QE1 A;  4IG0 A;  1JLE A;  4CCH A;  3OS0 A;  2QKB A;  4KHS A;  4NYF A;  4DQS A;  4DF8 A;  1TK5 A;  4M41 A;  3NE6 A;  4FLY A;  3AV9 A;  1GOA A;  3PX6 A;  2JGU A;  1VSH A;  4FW2 A;  4M3X A;  3K2P A;  5FRO A;  1IKV A;  5J1E A;  4O4G A;  2B6A A;  3K5O A;  2QKK A;  2OPR A;  3IG1 A;  4HCB A;  3SCX A;  2OA8 A;  1RCH A;  2HNZ A;  2D5R A;  1HNI A;  5E41 A;  1HYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...