3WNHA

Cyclic hexapeptide pkzdnv in complex with hiv-1 integrase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
137
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
total genus 48
structure length 137
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wnhA00
1SKSA 5KRTA 4W5TA 3C6UA 4M3ZA 3KJVA 1B92A 3QO9A 3HL8A 4ELUA 2FC0A 3ZT0A 4CGFA 4FJNA 4C8KA 1WSHA 1I3AA 4CF9A 3VQ9A 3MXJA 1RT5A 4DQRA 4YNQA 3NF7A 1NKEA 3OYKA 1YTUA 4OPJA 1CXQA 3DLGA 4FK4A 3VQBA 2WOMA 4ZHRA 4M3YA 4ELTA 2VWJA 1VSLA 3NGYA 2FBYA 3LP1A 3MXMA 4J2DA 1JXBA 3IRXA 3TABA 4CJ3A 4M3WA 2HHXA 1C0UA 3KK1A 1RILA 4N5SA 3NF6A 4ID5A 4LD0A 1EXQA 1VSFA 4QAGA 3HM9A 1BCMA 1LW0A 1S1WA 1S9EA 2HB5A 4NCAA 2OA8A 3RRHA 2BGGA 2ETJA 3AV9A 3LWLA 5J2QA 3ZSZA 1SKWA 2RF2A 1HYSA 2DY4A 4J2AA 4CEFA 4B9MA 1S1XA 3QNNA 3LWMA 4I2QA 4RG8A 1WAFA 1NOZA 2YHBA 4Z4EA 4OKEA 4KREA 2KW4A 3ZSXA 2DFFA 2IGIA 4CJLA 4DFPA 2XY6A 3H08A 3K5LA 3S3MA 3SJJA 2XRIA 3SYZA 5D3GA 1S6QA 1RCHA 3QEIA 1TV6A 3NF9A 3CFPA 1U47A 1BIUA 4IBNA 3SQ4A 4E7LA 1RNHA 1VSJA 1HQEA 4DTJA 1ZBIA 3K2PA 3L8BA 1BQNA 1BI4A 3IAYA 1TAQA 1CXUA 3VQ7A 4KHNA 2HHVA 3SV3A 3B6PA 3CG7A 1EP4A 1TKDA 3QEWA 3ZCMA 1NK9A 1JLGA 3T1AA 1B9FA 2ZD1A 4KV8A 4DSJA 4MFBA 4IG0A 3V9SA 1S9GA 3LAKA 1JLAA 1TL1A 4N56A 2XHBA 4OLBA 1BL3A 4CEEA 5FRNA 3NAEA 3VQEA 1JKHA 4KHSA 1UOCA 5KGWA 1NK8A 4W5QA 2HNZA 1J9AA 3NH1A 2X74A 4KRFA 1C0TA 4HCCA 3KKSA 1T03A 3PO4A 3LPUA 3AVMA 1RT7A 4DS4A 3O3HA 3I8DA 1HJRA 2A1SA 3PUFA 5FRMA 3D45A 1ZBLA 1FKOA 1KVCA 1TKZA 3TARA 2OPSA 1LWCA 1SL0A 4O55A 4Z4IA 1RBUA 1TGOA 3I0RA 4FJ9A 4CHOA 4DTOA 3QERA 3KLIA 1BISA 1KTQA 4FM0A 4F2SA 4KB0A 1DTTA 4FJMA 2VWKA 2XY8A 1IG9A 4CERA 3HJFA 3MECA 4DFKA 1U45A 4CJFA 5E41A 1X1PA 4FJ7A 1RDBA 4CJTA 1RT4A 3IS9A 4EP5A 3SNNA 4GMJB 3QEPA 2IOCA 1HPZA 4DTPA 3LP3A 3KD5E 2FBVA 4C8NA 1LAVA 1REVA 3AVKA 5J2MA 4DSKA 4IDKA 3KLEA 4CHYA 3ULDA 2VG6A 3AO2A 4QOZB 1RBRA 5KI6A 1C1BA 2QKBA 4CF0A 4CESA 2X6SA 1R0AA 1D8YA 1D9DA 2EX3A 2R7YA 4RW9A 1IH7A 3E01A 4ID1A 3LZJA 1QE1A 3WNEA 1NK6A 1QSLA 1J54A 3VQDA 4N41A 2Q3SA 5J2PA 4DMNA 5KGXA 3S3NA 1ITGA 4K8ZA 4WE1A 5J1EA 4CE9A 4OGCA 4M41A 1VSKA 4CFCA 3SZ2A 1FKPA 2Y1JA 5HP1A 4DTSA 2QK9A 1ZBUA 4DG1A 4DQIA 2KQ2A 4KO0A 5I42A 2D0AA 5C42A 3L2WA 3NHGA 4C8MA 1HMVA 3HVTA 3M8PA 4CEOA 4FCYA 3EZ5A 4AHCA 2HVIA 3HPHA 3L2RA 5CYQA 2PZSA 3V9XA 3AO3A 2YNIA 4E7IA 1XC9A 3ZT1A 1DLOA 3DYAA 4FLWA 4DU1A 4IFYA 2G8VA 4J2EA 3SQ1A 4PUOA 1TAUA 2GUIA 4B9UA 4E0DA 4CJWA 1UWBA 3QETA 3SUNA 2G8UA 4KTZA 2HHSA 2Y1IA 1BGXT 1Y97A 3OYCA 3LANA 4JLHA 4QCLA 4Z4GA 3ZSYA 2AJQA 3V9ZA 4L8RB 2RN2A 1NJWA 5HRSA 1IO2A 2D5RA 4O5BA 2OPRA 4CECA 4CJKA 4FK2A 2F8TA 3O4QA 2E4LA 4CJ4A 3DLBA 1Z25A 4FLZA 3F9KA 2KFZA 1ZYQA 3AVFA 3CFOA 3NH0A 4CFDA 2E6LA 3OVNA 2HMIA 2YNGA 2X78A 3VQ8A 4CGIA 4K8XA 4LSLA 5K14A 1JL2A 4TSXA 1L3TA 3RWUA 1A5WA 1S6PA 1WSIA 1W0HA 4FJKA 3M8RA 1FXXA 4KI6A 3QESA 3PO5A 3OYIA 3KLGA 1D9FA 3QLHA 1WLJA 1WN7A 3OYHA 1UA0A 3WNFA 2HHUA 4DTNA 2RKIA 2XY7A 4CEQA 1VSDA 3DLHA 4KHQA 2FBTA 4E7JA 1S1VA 1JLEA 3CFRA 4DQPA 2DFEA 4CJVA 1YT3A 3ZSWA 2WONA 1LW2A 4F3TA 2O4GA 4ELVA 1X9WA 1HNIA 1L3VA 1MU2A 4B9VA 4DTXA 1KVAA 3NH2A 4CJ5A 3AVCA 4CEZA 4E1MA 4GVMA 4CHPA 3NF8A 4FW1A 4CF1A 4E89A 3EYZA 3ITHA 4DLEA 4CHZA 5FROA 3DRSA 4FW2A 4B9TA 3TANA 2KTQA 3AVAA 3P83D 4RW7A 4W5NA 4KHYA 4BDZA 3HP9A 4N76A 1X9MA 1JLCA 3O3GA 4FJ8A 3DRPA 1VSMA 4CIEA 1C1CA 4Q5VA 4BE2A 3V81A 3ZSVA 4DWIA 5C25A 4CGDA 3RRGA 4FK0A 2KZMA 1IKYA 4E7HA 1CZBA 4I2PA 3NE6A 3HPOA 3SV4A 3VQQA 3AA5X 4HUFA 3NGZA 4AH9A 3OS2A 1NK5A 1T05A 3CM6A 4J2BA 1L3SA 4FZXC 1U04A 1XHXA 3I0SA 3QIPA 2KZZA 4HTUA 1ASVA 1TKTA 1WAJA 3HXMA 2P5GA 1RDDA 4NYNA 4FVMA 3F73A 4ZTJA 1T7PA 2NUBA 4B9NA 4FM1A 4FJ5A 3C95A 2GV9A 3LAMA 4I9QA 1TK8A 4IFVA 1TK5A 3AO1A 3OYMA 1QSYA 1U4BA 2YNHA 3DLKA 4BACA 1QS4A 4HUEA 5CY4A 3AA4A 4FLTA 4M3XA 4M45A 1Q8IA 1KFSA 4Y1DA 3AA2A 4CEAA 3KK3A 5HRRA 1XHZA 3DOLA 1HYVA 4KB1A 4IKFA 3CM5A 4EZ9A 4CJSA 3QINA 5HLFA 1S1UA 4HVJA 3MAQA 3V1QA 4XIUA 3OYNA 3SQ2A 4BDPA 2IDOA 1RBTA 2YKMA 1NKBA 4C8OA 2YHAA 4KPYA 1NK7A 4JS4A 2BE2A 4Q0BA 1BIZA 3AVLA 4RW8A 1RTHA 1N6QA 2KFNA 4KTWA 4O0JA 4B8CA 3VQ5A 1RDCA 4AHRA 4FJJA 1K6YA 1RT2A 3B6OA 1LAWA 1G15A 3ZSQA 4CK1A 3S3OA 4DQSA 1U48A 4M3UA 2OZMA 4Z4FA 1LWEA 3TAGA 1KRPA 3QEXA 3G0ZA 3CYMA 3DM2A 1RT6A 3ZSOA 4CJQA 3OYAA 2FBXA 4JRPA 5CZ1A 4GW6A 3HVRA 4AHTA 3NBPA 3VA0A 4CHQA 3QIOA 3ZT3A 4CFBA 3EY1A 2OPQA 2P51A 4ICLA 3SI6A 1NJZA 4O0IA 4H8KA 3L2UA 3A2FA 3T3FA 3AVHA 3HP6A 1NK4A 2OZSA 4FLYA 5SZTA 2OPPA 3AA3A 2F8SA 1SKRA 1EX4A 4NCGA 4RW4A 4BDYA 4F3OA 4LY7A 1BQMA 4EP4A 3VQ4A 4CF8A 3NFAA 1N5YA 4LH4A 4E7KA 4M42A 3P5JA 3U3YA 2GBZA 3AVJA 3JYTA 1WSGA 1F21A 3VN5A 1U49A 5JS1A 4F4KA 2HHQA 3LDSA 3BDPA 4DTMA 1Q9YA 3U3GA 1KSPA 5KRSA 4CK2A 3AVNA 3HPGA 4OGEA 4BWMA 3K5NA 3S9HA 1BCOA 2G8IA 1VK0A 1X9SA 2YKNA 1RBVA 1VRUA 3OY9A 4HUGA 4LSNA 3V6DA 1NJXA 3LPTA 1KLNA 3G10A 3OYGA 3ISNC 3WNHA 3OYBA 3TI0A 3T19A 3ZT2A 3PV8A 3TAFA 2G8FA 4UQGA 2W42A 2PYLA 1QHTA 4FJXA 2QXFA 4KFBA 3JSMA 4JS5A 4PA1A 4DFMA 3MXIA 2HNDA 1J5OA 4KAZA 1L3UA 4M3TA 4CFAA 1CLQA 2P5OA 4CJEA 2DTUA 1GOAA 1WSJA 1VSHA 3K57A 3V9UA 3PX4A 3OYJA 4E3SA 1C0MA 1YVUA 2B4JA 1NKCA 3AVIA 1TK0A 3NGIA 4EZ6A 3OYFA 5DK5A 3L2QA 2P1JA 4H4OA 5HROA 4HCBA 1ASWA 4OJRA 5JS2A 5T7BA 3OYDA 3RR8A 4W5RA 1SL2A 1YTAA 1HNVA 3L3VA 1BHLA 5HRNA 1EKEA 1GOCA 4Z4CA 1S5JA 5C24A 3UIQA 3VQAA 3KLHA 4B08A 4DQQA 1ZBFA 4BWJA 3PX6A 2QKKA 2G8KA 4FJGA 4FJLA 4KI4A 1Z26A 3P1GA 1DTQA 3TAEA 1I39A 2BDPA 4OVLA 4DSEA 1SL1A 4CGHA 3V9WA 3HYFA 5HRPA 2JLEA 3LALA 3LZIA 4RW6A 1CZ9A 3SPYA 1JLFA 4DSIA 2ITGA 4FZZA 1JXEA 5HBMA 3K5MA 3OS0A 3AO5A 3RTVA 3VQPA 3ZSRA 3LP2A 4G1QA 3C6TA 3QEVA 1RT1A 2VG7A 4N47A 2EHGA 3KD1E 4CCHA 4DF8A 3MEGA 2A1RA 4FLXA 2HVHA 3DOKA 2ZE2A 3ASMA 4KTQA 1KFDA 1KCFA 1UAXA 3SPZA 4CIGA 1NOYA 1QSSA 2PYJA 2LSNA 4H4MA 4CEDA 3O4NA 3THVA 4PQUA 3KKRA 3KK2A 1WNSA 4Z0UA 2IAJA 4PWDA 1FK9A 4CF2A 3RR7A 1VSIA 4CGGA 1C6VA 3K58A 1WSEA 1RTJA 4OKJA 4B3OA 1L5UA 1RTIA 4DFJA 4PY5A 3K5OA 1W9HA 4OKKA 4HHTA 4F8RA 3SQ0A 3OJUA 3DRRA 3OJSA 4FLUA 4AHSA 4AHVA 2HW3A 1EETA 4DSFA 4OPKA 1HRHA 4CJPA 3PX0A 1RBSA 3ZT4A 2YV0X 3KLFA 1XI1A 1KVBA 3SUOA 4M3RA 4FM2A 4IG3A 4CGJA 4E1NA 4BE0A 4DLGA 4DTRA 3U6FA 4CEBA 4AILC 2ZQBA 1HYZA 4FZYA 1O1WA 1ZBHA 1J53A 2Z1IA 1VRTA 2YNFA 4CK3A 1IKWA 4MQ3A 4I9LA 3C94A 1SV5A 3TWHA 1T8EA 4F2RA 1SUQA 4DTUA 5SWMA 1RDAA 3V4IA 3L3UA 2B6AA 2DFHA 4AHUA 4CHNA 1QQCA 3NDKA 1JLBA 3LP0A 4NYFA 3L2VA 3SCXA 1A5XA 5CZ2A 4JRQA 4R5PA 2HHTA 3AO4A 3HSTB 3SUQA 1IKVA 3RMCA 1QTMA 3HO1A 4BE1A 3HT3A 3RMAA 3M8QA 3MEEA 3PY8A 1JLQA 3HK2A 2I5JA 4KHWA 2Z1HA 3V1RA 3K59A 5FDLA 1LWFA 1NJYA 1LV5A 4CJRA 4Z4HA 4DU3A 2PY5A 5I3UA 2JGUA 2XY5A 3TR8A 3DLRA 4O4GA 3D0PA 4NCBA 2RPIA 2X6NA 1B9DA 4LH5A 2B5JA 5CYMA 4B9LA 1GOBA 4YFUA 3CQ8A 4CIFA 2Z1JA 4W5OA 2F96A 3VQ6A 1ASUA 3KTQA 3O3FA 1XWLA 3IG1A 3RMDA 3DLEA 3DMJA 4O44A 2Z1GA 2XO7A 1UA1A 4FJHA 5EU7A 4FYDA 5KTQA 3VA3A 4FLVA 3RMBA 3OYEA 4CJUA 1Q9XA 4KHUA 1KLMA 2IS3A 2HNYA 2G8HA 2G8WA 1A5VA 3AVGA 1TVRA 3KIOA 3V1OA 2VG5A 3WNGA 3OS1A 1RTDA 1WSFA 1JL1A 4DSLA 4DU4A 3M8SA 3SUPA 3TAMA 4Y1CA 2IC3A 1VSEA 3TAPA 1RT3A 4DF4A 2E6MA 3NCIA 4FXDA 1BI4B 4E19A 4B8AB 2OYQA 3FFIA 3VQCA 1IKXA 4C8LA 1S1TA 3MEDA 4B9SA 4DS5A 3ALYA 2BANA 2D0CA 4FJIA 4I7FA 1HQUA 1D5AA 2D0BA 4KKOA 2ATQA 3OYLA 3QNOA 3TAQA 1C1AA 4ZTFA 3BGRA 4OLAA 2O4IA 5J2NA 1NK0A 5DMRA 2HHWA 3AVBA 1TL3A 3DI6A 1TKXA
chains in the Genus database with same CATH superfamily
4CD1A 1FW6A 2E5LK 3FZFA 1KC8O 3C6UA 4GKKK 3KJVA 1B92A 3VF6A 4CZEA 2FC0A 4FWOA 2GWJA 1WSHA 1I3AA 4CF9A 3CF5L 3OHRA 4OPJA 4DQ8A 1CXQA 4FK4A 4M3YA 2V52B 1VSLA 3NGYA 3MXMA 4J2DA 3IRXA 1C0UA 1RILA 4N5SA 3CJ7A 4LD0A 1EXQA 4QAGA 1LW0A 2HB5A 5LMUK 2OA8A 2BGGA 3LWLA 3K0SA 4BRQA 3R8EA 2Q31A 4MDBA 4B9MA 4I2QA 2I7NA 4DR6K 4DFPA 4CJLA 2A5XA 3EN9A 2XRIA 3SYZA 5D3GA 1RCHA 1RFQA 3QEIA 1BWFO 1U47A 4B1WB 1ATSA 1RNHA 3MCAB 3L8BA 1BQNA 2HHVA 2HF3A 3B6PA 1HLUA 3ZCMA 5AQHA 2FSKA 3O9TA 1JLGA 1B9FA 4MFBA 1KAYA 4BGBA 4N56A 1BL3A 4JYAK 2HNZA 2YJEA 1C0TA 3KKSA 1O13A 2QXLA 3AVMA 2A1SA 4DV7K 1FKOA 2OPSA 1TGOA 3ZX2A 3QERA 2QA4N 2VWKA 1X3NA 3L4IA 3HJFA 4DFKA 4JKAA 4NB4A 3ID8A 3IS9A 3ENBA 4K41A 4DTPA 3LP3A 4YORA 1W97L 1REVA 3AVKA 4DSKA 4IDKA 1DEJA 4DKWA 3IFRA 1GLEG 3THWA 5EXWA 4CESA 1D8YA 2EX3A 4ID1A 3WNEA 1IBMK 1N8RO 1J54A 3CCMN 2P9LB 5J1EA 4CE9A 5HP1A 1ATNA 5C42A 4C8MA 1HMVA 4FCYA 4K43A 3HPHA 4BG9A 3L2RA 4XH4A 3V9XA 2YNIA 1X3MA 3ZT1A 3DYAA 4BRCA 4FLWA 4J2EA 3QETA 2G8UA 1JJ2M 1Y97A 3UKUB 4QCLA 4Z4GA 1GLAG 4L8RB 1QVFM 3GBTA 4CZJA 3DWLA 4FK2A 2O8CB 1VQ4N 3O4QA 2E4LA 4C23A 3NH0A 2E6LA 3VQ8A 1JL2A 4TSXA 3BZKA 1CZAN 3CJ9A 4LFCK 1FXXA 3QESA 3PO5A 4BC4A 4A5AA 4LF9K 3VTIA 1NGEA 3K9KA 3BEXA 1X9JA 1VSDA 1K8KA 4BR5A 4U7BA 1JLEA 4DQPA 3ZSWA 2WONA 4F3TA 4H0XB 1NGCA 3LDNA 4DTXA 1KVAA 1MDUB 4E1MA 4CHPA 4FW1A 4DLEA 3THWB 4DR4K 4IOCL 4KHYA 4WQ5C 2GEMA 1X9MA 4FJ8A 5FLXO 1VSMA 2ZM6K 4BE2A 3EL2A 3V81A 4OO1J 5C25A 3TSQA 3FFKB 4LC9B 4BROA 2E1YA 5M1PA 2F8TA 1L3SA 4CJ7A 1U04A 3QIPA 1TKTA 3HXMA 1EQYA 4FM1A 2GV9A 1TK8A 4DHYA 1TK5A 1QSYA 3OYMA 4CD3A 3O9QA 4M45A 1Q8IA 4CEAA 1V4SA 5HRRA 2KKZA 4IKFA 1S1UA 4HVJA 3EO3A 1BA0A 2F9TA 3KZBA 3V1QA 3OYNA 1TUYA 1SS6A 4Z94A 1BIZA 4RW8A 5BREA 1N6QA 1FJGK 4KTWA 4O0JA 1RDCA 4CK1A 1LAWA 4Z4FA 5AJ3K 2OZMA 2ZF5O 2IVPA 3HVRA 2NRXA 4AHTA 4DV4K 4DSIA 1S22A 3CCQN 1NJZA 3L2UA 5SZTA 4DR5K 1EX4A 4RW4A 3BY5A 1XUPO 2V7YA 1BQMA 1VHXA 1E4GT 4E7KA 4BRHA 3PIPL 4M42A 3PSFA 3U3YA 4L3QA 4O5FA 5JS1A 3G25A 4FOEA 4JI6K 3MDQA 3BDPA 4FWQA 4DTMA 1Q9YA 1KSPA 4CK2A 3AVNA 2ZJRL 1Q18A 3K5NA 1VK0A 1X9SA 3V6DA 1KLNA 1V4TA 3WNHA 3OYBA 3FR0A 3TI0A 3ZT2A 1BO5O 2W42A 4KFBA 1VQ5N 3IMXA 4M3TA 1T6CA 1J5EK 1NG9A 3VEWA 3F9MA 3O1WA 3SAHA 2UUBK 3H3NO 3NGIA 1RDUA 4EZ6A 2W6KA 3OYFA 5HROA 2P1JA 1ASWA 5LJWA 1U6ZA 5T7BA 4BRMA 1M1KO 1HNVA 4GKJK 4LF8K 1J6ZA 4Z4CA 5C24A 4JHDA 4WQ4A 5BN9A 3KLHA 4DQQA 3I55N 2G8KA 4CZMA 2BDPA 4BVOA 2HBJA 4CGHA 3HYFA 4RWTA 4DR3K 3LALA 3LZIA 1CZ9A 1JLFA 1JXEA 4JKFA 4PKGA 4B3RK 2E2PA 3FZLA 3ZSRA 2HBLA 3KWGA 3HTVA 1BU6O 2PFUA 4DF8A 4PL8A 3C65A 4FLXA 2HVHA 2ZE2A 1KCFA 2PYJA 3THXB 2LSNA 4GY2B 4H4MA 3O4NA 4BRLA 3THVA 3KKRA 3KK2A 4Z0UA 3MWPA 4MLEA 1VSIA 4MO4A 1QQOA 5JLHA 1W9HA 4HHTA 3OJUA 3DRRA 3WXLA 4BRNA 4DR1K 1P8ZA 3TTDA 1N32K 1ATRA 3KLFA 4O8KA 3CCJN 3SUOA 1KQSM 4RCHA 4BE0A 4DLGA 1VQMN 4B1YB 2ZQBA 3U9DA 4JK8A 4FWMA 4CK3A 4MQ3A 1SV5A 4DUYK 4JEPA 3V4IA 3O8MA 2B6AA 4AHUA 4BR7A 1WB9A 4LF6K 1JLBA 3L2VA 3CC2N 1XNQK 3HSTB 3MN6A 3MEEA 5HOOA 4DV6K 3T1YK 2GTDA 1Q86O 4JHDB 3MX2A 1LWFA 1LV5A 3JAMO 1NGBA 5I3UA 2XY5A 4YDUC 3TR8A 4NCBA 2RPIA 3CJCA 2X6NA 4DB3A 2B5JA 4CW7B 1BUPA 5AQNA 1NM1A 4W5OA 3O5BA 3HRGA 3KTQA 3O3FA 1XWLA 1VQLN 4O44A 4FWSA 5AQPA 4FLVA 4ISEA 3J7ZO 3RMBA 3OYEA 2BTFA 4KHUA 5HL7L 3MN7A 3J8AA 2G8WA 2VG5A 3OS1A 2WFBA 1YVNA 2JWLA 4DV5K 2QWRA 3M8SA 1QQMA 4Y1CA 4E19A 4C8LA 3FFIA 3VQCA 4B9SA 4MLHA 4DS5A 2BANA 2D0CA 3OYLA 3QNOA 3O9RA 2WC9A 3BGRA 3LDPA 4BRFA 1TL3A 3DI6A 5BR8K 5KRTA 3QBWA 1XMQK 3CPWM 4C8KA 1DKGD 1NKEA 2QI2A 3VTHA 3VQBA 3QICA 4BR0A 1YF5L 3PLAA 2HHXA 4BQLA 3THYA 3BP8A 3NF6A 3HM9A 3L4QA 3N4PA 4NCAA 1S9EA 3LDQA 4J2AA 4CEFA 4J8FA 2ZJQL 3LWMA 1KAZA 3H1QA 4B1UB 2KW4A 3ZSXA 3CETA 2CGJA 3O9UA 3WEEA 1BIUA 4IBNA 1VSJA 1HQEA 3K2PA 3TU5A 1BI4A 4KHNA 4IFEA 3SV3A 4JK7A 2E1ZA 3PSIA 1NK9A 1Q81O 3A5MC 3E9OA 4KV8A 4IG0A 3A5NC 4E1JA 1JLAA 1Z6RA 4OLBA 4BRGA 1JKHA 4IOAL 2PBDA 1LOTB 3ZYYX 3NH1A 4KRFA 4HCCA 3EZWA 2AP1A 3W0LA 3PO4A 1RT7A 1HJRA 3C7NA 1OH8A 1KVCA 3TARA 5C0YA 1K9MO 3SBTA 1SL0A 2QW9A 5JICA 3U9ZA 2FLOA 3I0RA 4HWIA 5M1FA 4CHOA 1GLBG 4FJ9A 5BN8A 3ATVA 1K73O 3CXCM 1IG9A 4X66K 2NRZA 3GL1A 3FLCO 1GLCG 5E41A 3DXMB 1RT4A 3QEPA 1LAVA 1IBKK 5J2MA 3KLEA 3VGKA 3ULDA 5KI6A 1VQ8N 1R0AA 4RW9A 1IH7A 1RDWX 1QE1A 3CCRN 1NK6A 3QDKA 3H45C 2E8AA 5J2PA 5KGXA 3S3NA 4LF5K 4WE1A 4OGCA 1YUWA 5AR0A 3WEEB 2O8DB 4M41A 1VSKA 3CERA 3SZ2A 1FKPA 2Y1JA 1NGIA 1T3VA 1ZBUA 4DG1A 4DQIA 4KO0A 5I42A 2D0AA 1EWRA 3NHGA 1ZXOA 4CEOA 3M8PA 4JKGB 2D1KA 5CR4A 3LM9A 1SAZA 5CYQA 4Y0WA 1XC9A 4BC5A 4BRPA 5BRHA 4B9UA 4E0DA 5AQKA 2VQFK 2HHSA 2Y1IA 2KHOA 3ZSYA 2WTUA 3IKMA 1YAGA 5EX5A 2D5RA 4BRKA 2OPRA 5E26A 3C7NB 1Z25A 4FLZA 3CFOA 4CFDA 2HMIA 2X78A 4JNEA 4K8XA 1A5WA 1WSIA 1VAZA 2P9UA 3M8RA 3A0IX 4LF4K 1WUAA 3OYHA 3NVMA 1UA0A 4DTNA 2XY7A 4KBOA 3ZX0A 4E7JA 1S1VA 4U67L 3ZX3A 3CFRA 2DFEA 1YT3A 2P9LA 2VGNA 3CMEN 2O4GA 1X9WA 3NH2A 3NF8A 4QS9A 5KQDA 4CBXA 4CHZA 3AVAA 2YJFA 4N76A 2A6AA 2WUSA 4JD2B 5F2RA 3O3GA 1EWQA 1C1CA 2QWOA 4Q5VA 3M3ZA 3RRGA 3J7YP 4FK0A 2KZMA 3VMFB 5GINA 3NE6A 4E7HA 3UKUA 4BC2A 3NGZA 4AH9A 3OS2A 3TTCA 1GLDG 2P5GA 3M5RA 1RDDA 3FGUA 3F73A 4B9NA 2O8CA 3LAMA 4XH5A 1U4BA 3J81O 4IEIA 4FLTA 4M3XA 1KD1O 4Y1DA 4H0TB 3I33A 2Q0RA 3CI5A 1HYVA 4BC3A 4KB1A 4EZ9A 4CJSA 3QINA 3O80A 1BDGA 4XIUA 4H0OA 4BDPA 3AAPA 1NKBA 4KPYA 2BE2A 3AVLA 1RTHA 5BRFA 4B8CA 2P9UB 4ILHA 1RT2A 3FE1A 4H5NA 3ZSQA 1G15A 3S3OA 1D4XA 4DQSA 3QEXA 3G0ZA 4B1VA 5F0XA 1RT6A 4JI5K 3RWUA 4GW6A 3VA0A 1VQPN 3ZT3A 3EY1A 3SI6A 2P51A 2IVNA 4LH4A 1W7AA 3AVJA 1WSGA 1U49A 4KH4A 4F4KA 2HHQA 3H6EA 4IO9L 3VETA 2WBNA 1MWMA 3HPGA 4BWMA 1QQNA 2YKNA 1N33K 4HUGA 4GNIA 1NJXA 5EOYA 3LPTA 5FPMA 1ZBSA 4UQGA 3OBWA 5AQRA 2PYLA 4FJXA 4CBUA 4JS5A 4KAZA 2HNDA 3UKRA 4CFAA 4CJEA 3K57A 5KPZA 3V9UA 3PX4A 3VEYA 4A57A 2O8EA 2B4JA 4LF7K 1NWKA 3RSEA 4WFNL 4H5RA 4H4OA 4HCBA 4W5RA 1SL2A 3L3VA 2V7ZA 4BR4A 1S5JA 2VWBA 1H1VA 2OCEA 1Z26A 2ZJPL 4K25A 4RW6A 3SPYA 3FZHA 3VF2A 1Y64A 3RTVA 3M6GA 5B8HA 3MEGA 1VQ7N 4KTQA 3D2FA 4CIGA 1QSSA 4MDAA 4CEDA 4PQUA 2OTJN 3VEZA 3GE1A 4CF2A 3RR7A 2FXUA 4B3OA 1L5UA 3QB0A 3EKUA 4OKKA 5AQFA 3SQ0A 4OPHA 1XQSC 1NMNA 4JI2K 4DSFA 4OPKA 2V51B 4CJPA 1RBSA 3ZT4A 1XI1A 1IG8A 3SJHA 4NLCA 4CGJA 4E1NA 4DTRA 4LFAK 4FZYA 3UKRB 3G4SN 2YNFA 3HZ6A 2W40A 5SWMA 2O8EB 4WYBA 4FPBA 3KHYA 3RSEB 4RTFD 1Z05A 5BPNA 3SCXA 4R5PA 4DV2K 3HO1A 3NVKA 3HT3A 3MK6A 1JLQA 3HK2A 2Z1HA 1OH5A 3LM2A 2A3ZA 5AQQA 5FDLA 1MWKA 4DU3A 3THXA 1B9DA 4LH5A 5CYMA 4C1NK 1GOBA 1HNWK 2CH6A 3CQ8A 2HBMA 3RMDA 3DMJA 1UA1A 3D2FB 5EU7A 5KTQA 4QS7A 2O8FB 1Q9XA 2F7TA 1RTDA 3KIOA 3WNGA 3CCSN 2HF4A 4DU4A 2IC3A 1VSEA 4WCEL 4DF4A 3NCIA 3SAGA 5JMVA 2EWSA 4B8AB 1IKXA 3MEDA 4NXNK 4FWLA 3ALYA 1Q82O 3TAQA 2D0BA 1OKJA 3L6QA 4IEEA 2HHWA 3ZSOA 4YY3K 1SKSA 3CMAN 3QO9A 1IJJA 3ZT0A 4CGFA 4FJNA 2CGKA 4BRIA 3CQYA 1N36K 1R59O 3VQ9A 1C0FA 3MXJA 1RT5A 4DQRA 2NZTA 5AQSA 4YNQA 3NF7A 1YTUA 3DLGA 2WOMA 2GUPA 4ELTA 2VWJA 4JKBA 1HNZK 1JXBA 3TABA 4M3WA 4ID5A 1VSFA 1T6DA 1S1WA 3AV9A 3LDOA 3ZSZA 1SKWA 2RF2A 1NNEA 1S1XA 3HM8A 3ENHA 4NLBA 4OKEA 3ATUA 3F2KA 3S3MA 2XY6A 2IGIA 3K5LA 3Q7CA 3VEVA 2NRHA 4KH6A 4E7LA 1ZBIA 3G71N 3IAYA 2UUCK 3VQ7A 3CG7A 5AZIA 1EP4A 3QEWA 2OTLN 3C6AA 1NJIO 3C6HA 4C1NI 4UY8O 3V9SA 1S9GA 1EO1A 3D7EO 4PL7A 4YOXA 2XHBA 4CEEA 3NAEA 1ZC6A 2W6LA 5KGWA 2P9PA 1NK8A 5C12A 5CE3A 1J9AA 1Q7YO 1T03A 4JAXA 3O3HA 1JCEA 2QM1A 5I9EB 4H5TA 2UXCK 2RE2A 1LWCA 4O55A 4DV1K 1RBUA 4M3ZA 4FM0A 4F2SA 4KB0A 4XH1A 5BPLA 2XY8A 1QHAA 4CERA 4CJFA 3C0BA 4FVUA 2A42A 1X1PA 3CIPA 4A5BA 5MLCQ 3T69A 4EP5A 4GMJB 3KD5E 1SZ2A 4C8NA 2PAVA 4CHYA 2W41A 2IVOA 4QOZB 1RBRA 5KPTA 4CF0A 1OH6A 1D9DA 5C2DA 5E84A 2R7YA 3H46O 3E01A 1QSLA 4N41A 3VQDA 3UB5A 4IO8A 1MA9B 4JKDA 2ZWHA 4FWKA 4DCHA 4LFBK 1NBWA 4CFCA 2P9KB 4X62K 1HKBA 2KQ2A 4DV0K 1ILYA 3L2WA 4X64K 1YITN 2Q97A 3L0QA 5CHIA 4AHCA 2HVIA 5AZIB 3MN5A 4CZGA 3HOSA 3AO3A 4IFYA 4PUOA 2GUIA 3ZEUA 4CJWA 4H0VB 2H3GX 1BGXT 3LANA 4JLHA 5AQIA 5AQTA 2P9PB 2AJQA 1G99A 3IUCA 2Q2RA 3J7AP 1IO2A 1YXQA 1YJ9N 3AAQA 3QFUA 3F9KA 2KFZA 3AVFA 3TTFA 1OVYA 1XC3A 2DPNA 3DXMA 4CGIA 4LSLA 2HOEA 1L3TA 3GOIA 4FJKA 1TYQB 3DLLL 4KI6A 1DT9A 3CJAA 3OYIA 4FWRA 1WLJA 3WNFA 2HHUA 4KHQA 5GIPA 5AFUA 1LW2A 1HNXK 2O8DA 1MU2A 4CJ5A 4CEZA 4E89A 4CF1A 4JI0K 5FROA 3TANA 3DXKB 4W5NA 5LMNK 3HP9A 4JKGA 3VENA 4M7YA 3DRPA 3O08A 4ISFA 3VESA 4DWIA 5KPRA 3SMSA 4CZIA 1IKYA 1CZBA 3CQXA 4I2PA 3SV4A 3ZETA 3AA5X 2UXBK 4J2BA 3CM6A 1RGIA 4FZXC 3I0SA 1XHXA 4HTUA 3E66A 4NYNA 4FVMA 4WQ5A 4JK9A 4ZTJA 2NUBA 5LJVA 3C95A 4I9QA 3AO1A 3ZEUB 2P9IB 3WUHA 3DLKA 3FZKA 3OTOK 1WBBA 5CY4A 3AA4A 3KK3A 1OH7A 1XHZA 3DOLA 3CM5A 2F4VK 2RHKA 5HLFA 4BR2A 2P9NB 5ADXA 5FPEA 2IDOA 1RBTA 2YKMA 2YHAA 1NK7A 2FF3B 4IJAA 2KFNA 4FJJA 1K6YA 3P39A 3B6OA 3LL3A 3B8AX 3G6EN 1KRPA 3DM2A 4BY9C 2FBXA 3NBPA 4MO5A 4CHQA 3QIOA 4CFBA 2OPQA 3SAFA 2FSJA 4H8KA 4JD2A 3VGLA 3A2FA 2VYPA 3AVHA 3SBGA 1NK4A 4FPAA 4FLYA 2IIRA 2F8SA 1N34K 4BDYA 4NCGA 4F3OA 1VQON 1P90A 4V19S 5KQ8A 4EP4A 3VQ4A 4FO0A 4CF8A 3NFAA 3P5JA 3JYTA 1F21A 3KVGA 4A59A 3VN5A 5AQLA 4B3SK 4BQZA 1IV0A 2D0PA 3VERA 3CJBA 1YJWN 5KRSA 3WQTA 4OGEA 2O8BA 3S9HA 4I6MB 1BCOA 1RBVA 3OY9A 4LSNA 3ZETB 3G10A 3T19A 3AGKA 5BRDA 2G8FA 1DGKN 1QHTA 2QXFA 1J5OA 3MXIA 4PA1A 3AY9A 1L3UA 2P5OA 2F9WA 3FZMA 4CI6A 3OYJA 3T1HK 3N4QA 2NRTA 1TK0A 2HBKA 3L2QA 5AQYA 4M63C 3P31A 3VPZA 3RR8A 2E20A 3A5OC 4CZLA 1YTAA 5HRNA 3D2EA 1GOCA 2QWPA 3UIQA 3VQAA 2P9SA 2QKKA 5AQJA 3P1GA 3TAEA 4OVLA 4DSEA 1SL1A 4FL9A 2KLAA 2QWNA 3V9WA 2JLEA 1W2BM 2ITGA 3K5MA 3VQPA 3LP2A 4G1QA 3QEVA 1RT1A 2VG7A 4N47A 3KD1E 4CCHA 2A1RA 4NO7A 3ASMA 5H1SQ 1KFDA 3MX5A 3SPZA 4IJNA 4DV3K 3MN9A 2HMPA 1WNSA 4CZFA 5M1QA 3GDQA 1HR0K 3DAWA 4CGGA 1C6VA 1HKCA 1WSEA 3AGRA 2NRWA 3TPQA 4JKHA 4OKJA 1RTIA 4PY5A 3K5OA 4FLUA 4CVNE 4AQYK 4AHSA 2HW3A 1E3MA 2O8BB 3HBTA 2E2QA 3WXKA 1KVBA 3SK3A 4M3RA 4G9ZA 3TSUA 3U6FA 4GVEA 4AILC 1J53A 2Z1IA 1VRTA 3UE5A 1IKWA 1RDAA 4A61A 2DFHA 1QQCA 3NDKA 1S3XA 3LP0A 4K42A 4NYFA 1WOQA 5CZ2A 3IDHA 2QTDA 3SUQA 1IKVA 1XNRK 3RMAA 3D2EB 3M8QA 3PY8A 3P4IA 4CZKA 2OANA 1HPMA 4JN4A 2P9SB 2FSNA 3V1RA 3ID6A 4A2BA 1NJYA 3S41A 4Z4HA 4CJRA 2PY5A 1NU0A 4O4GA 4B9LA 4B3MK 2Z1JA 3VQ6A 1ASUA 2UU9K 3IG1A 3DLEA 3OW2M 4B3TK 3T7ZA 4KHPK 1A5VA 3AVGA 1TVRA 4YDUA 3V1OA 1NGJA 4B1XB 4H0YB 3PIOL 3CC7N 3TAMA 1ESVA 2QWLA 1RT3A 2E6MA 1TUUA 2NLXA 3CCVN 2OYQA 5BR9A 1D5AA 4ELVA 4OLAA 2ATQA 4ZTFA 3VGMA 2O4IA 5J2NA 4EHTA 5DMRA 3AVBA 1O1WA 1TKXA 5LL6Z 3LDLA 4W5TA 4JI1K 2ASPA 4ELUA 3HL8A 1OVQA 4BRDA 4H03B 2Q1NA 3OYKA 4FOIA 3BF1A 5AQVA 2Q0UA 4ZHRA 5BPMA 4CZHA 5AZJA 2FBYA 3LP1A 3JXUA 4CJ3A 3KK1A 4IWVA 3NMUA 1BCMA 5M1NA 3CPEA 3RRHA 2ETJA 5J2QA 1HYSA 2DY4A 4JKEA 3QNNA 4Z4EA 4RG8A 1WAFA 1NOZA 2YHBA 4QS8A 4KREA 2DFFA 3OBYA 3O4WA 5AQGA 3H08A 2O8FA 3SJJA 4FWNA 3CCLN 1S6QA 2VGMA 4H0PA 1TV6A 3NF9A 3CFPA 3SQ4A 4BREA 5DM6L 4DTJA 4GV9A 4WFAL 1U2VA 4OX9K 1TAQA 1CXUA 1HJOA 3BUZB 3P38A 5IT9O 2QEXN 1S72N 1TKDA 4IXCA 3T1AA 3VEXA 2ZD1A 5AQXA 4DSJA 4IOXA 3LAKA 1TL1A 5F1XA 5TKYA 5FRNA 3O6WA 4FWPA 3VQEA 4KHSA 1UOCA 4FSVA 4W5QA 2X74A 3CCUN 2A41A 3LPUA 4DS4A 3I8DA 3PUFA 5FRMA 1YI2N 3D45A 1ZBLA 3GG4A 4WF9L 1TKZA 1VQ6N 4YOTA 1HUXA 2YX6A 4Z4IA 4DTOA 3KLIA 1BISA 1KTQA 3R9PA 3JS6A 1DTTA 3R3LA 3MECA 1NGAA 5JVGL 3EE9A 1U45A 1QZ5A 5AZJB 4FJ7A 1RDBA 4CJTA 4JV5K 3SNNA 2IOCA 1HPZA 5GAEP 2FBVA 2QWMA 3VOVA 3O9SA 5GIOA 2VG6A 3AO2A 1C1BA 3A5LC 3QBXA 5IWAK 2QKBA 2X6SA 4KH5A 3LZJA 5JVHL 2ZGZA 1K8KB 2VQEK 3CC4N 2Q3SA 4DMNA 1ITGA 4K8ZA 1VQNN 4AM7A 4DTSA 2QK9A 1NGGA 1U2VB 1QZ6A 3HVTA 1VQ9N 3EZ5A 2E2NA 2PZSA 5C2FA 4E7IA 1BG3A 3ULEA 1DLOA 2G8VA 4DU1A 1TAUA 3SQ1A 1UWBA 3SUNA 4KTZA 2QWQA 2I7PA 5ELZA 3OYCA 3EE8A 2NRVA 3BZCA 3V9ZA 3SMPA 2RN2A 1NJWA 5HRSA 4O5BA 4CECA 4CJKA 1VQKN 3U8XA 4CJ4A 3DLBA 1JCFA 3WXJA 1ZYQA 5GAHP 3OVNA 2YNGA 3KWIA 1BA1A 3EEQA 1XMOK 4HTLA 5K14A 5AQMA 3A8YA 1S6PA 4B1ZA 4JI7K 2GX9A 1W0HA 4YOYA 2UUAK 4PKIA 5JLFA 1NMDA 3KLGA 1D9FA 3QLHA 4F9OA 1WN7A 3DJCA 3SLCA 2VCPA 4EHUA 3HI0A 5DM7L 2RKIA 4CEQA 3DLHA 2FBTA 3U4LA 5C15A 4CJVA 3QFPA 1HNIA 3WT0A 1L3VA 4B9VA 1JCGA 2P9KA 4JKCA 3AVCA 4GVMA 3CHWA 5AQOA 3EYZA 5AQUA 3ITHA 5AQZA 4B9TA 2KTQA 3DRSA 4FW2A 3P83D 4RW7A 3CCEN 4BDZA 4YHHK 5EY4A 1HX1A 1JLCA 4AM6A 3HSCA 3KK7A 1YIJN 4CIEA 2YHWA 2YCHA 3ZSVA 3O1BA 3EKSA 4CGDA 1YJNN 3RVCA 2HHHK 3HPOA 1IBLK 3VQQA 4PKHA 1QVGM 4HUFA 1NK5A 1T05A 2JWKA 2KZZA 4ISGA 3H3OB 1ASVA 1WAJA 1LCUA 1T7PA 4FJ5A 2BH1A 1BOTO 3ULEB 4IFVA 2YNHA 5FPDA 4BACA 1QS4A 4HUEA 2ASMA 2CGLA 1KFSA 3TSPA 3AA2A 1TYQA 2ASOA 3F5TA 2HSTA 2E88A 5M1OA 3MAQA 1K8AO 4H5VA 1SQKA 3AARA 3SQ2A 4C8OA 4JS4A 4Q0BA 4GV6A 4DUZK 3I8BA 3VQ5A 4AHRA 4M3UA 1U48A 1LWEA 3TAGA 3CYMA 4CJQA 5M1KA 3OYAA 3DXKA 4A62A 4JRPA 5CZ1A 3HOTA 4FJMA 4ICLA 1I94K 4O0IA 2UYTA 2Q36A 4JI4K 4BVPA 3T3FA 3HP6A 2OZSA 3MWTA 3ZLJA 2OPPA 3AA3A 5TKWA 1SKRA 4WFBL 4LY7A 3E1YA 3MMVA 1N5YA 1NGHA 2GBZA 3R6MA 3OA9A 3WQUA 3CJ1A 4XEIA 3QMLA 2UXDK 3U3GA 3M1FA 1WBDA 2P9IA 2G8IA 1NLVA 4ILJA 4JI8K 1VRUA 3W3DA 3WXIA 4EAHD 3OYGA 3ISNC 1GLJO 2YI1A 3PV8A 3TAFA 4CBWA 3K9JA 3JSMA 4DFMA 1YHQN 1CLQA 2P9NA 2DTUA 1GOAA 1WSJA 1VSHA 3Q7BA 4E3SA 1C0MA 1YVUA 1NKCA 2E2OA 4ILGB 3AVIA 2GWKA 5DK5A 1GLFO 4OJRA 5JS2A 3OYDA 5GADP 4BGAA 1E4FT 4GV3A 5GAGP 4X65K 1BHLA 4DR7K 1EKEA 1KAXA 2NRRA 3PX6A 4IZ9A 4B08A 1ZBFA 4BWJA 4YOWA 4FJLA 4KI4A 4FJGA 1DTQA 1I39A 2A40A 4IDHA 4BR9A 3MCPA 5HRPA 5A2QO 4FZZA 2ITMA 5HBMA 3OS0A 3AO5A 4JI3K 3CD6N 3C6TA 4NXMK 4BRAA 5FPNA 2EHGA 1HKGA 3ENOA 3DOKA 1KXPA 2NNWA 1UAXA 4A2AA 1NOYA 4PHTX 4OPAA 4I6MA 1NGDA 2YHYA 2ZGYA 2YHXA 2IAJA 4PWDA 3WXMB 1GLLO 1FK9A 5AFUH 3K58A 4K0KK 1RTJA 3VEOA 4DFJA 3J80O 3BF3A 4F8RA 5LY3A 3OJSA 4AHVA 1EETA 2CH5A 1HRHA 3PX0A 2YV0X 4FM2A 4IG3A 3R1XA 3E9LA 2D0OA 4CEBA 3I56N 1HYZA 4EIAA 1ZBHA 3D6RA 4I9LA 3C94A 3TWHA 1T8EA 4F2RA 1SUQA 4DTUA 3L3UA 4CHNA 2D4WA 4AF1A 1A5XA 4BG8A 4B9QA 4JRQA 2HHTA 3AO4A 3RMCA 4DR2K 1QTMA 4BE1A 2GELA 2J4RA 2AA4A 2I5JA 4KHWA 4H5WA 5AQWA 3K59A 2JGUA 2BUPA 3DLRA 3D0PA 3H1VX 5ADXH 3THYB 5EVZA 4YFUA 5C10A 4CIFA 2F96A 3E9PA 4R79A 4M7XA 1T44A 2Z1GA 2XO7A 4FJHA 1NGFA 4FYDA 3VA3A 2FF6A 4YOVA 4CJUA 1KLMA 2IS3A 2HNYA 2G8HA 1M90O 1WSFA 1JL1A 4DSLA 3SUPA 4EFHA 4O8UA 3TAPA 4FXDA 1BI4B 4WQ4C 3VF4A 1S1TA 4YOUA 1C0GA 4FJIA 4I7FA 1HQUA 4KKOA 1C1AA 1NK0A 3LDSA
chains in the Genus database with same CATH topology
1SKSA 5KRTA 4W5TA 3C6UA 4M3ZA 3KJVA 1B92A 3QO9A 3HL8A 4ELUA 2FC0A 3ZT0A 4CGFA 4FJNA 4C8KA 1WSHA 1I3AA 4CF9A 3VQ9A 3MXJA 1RT5A 4DQRA 4YNQA 3NF7A 1NKEA 3OYKA 1YTUA 4OPJA 1CXQA 3DLGA 4FK4A 3VQBA 2WOMA 4ZHRA 4M3YA 4ELTA 2VWJA 1VSLA 3NGYA 2FBYA 3LP1A 3MXMA 4J2DA 1JXBA 3IRXA 3TABA 4CJ3A 4M3WA 2HHXA 1C0UA 3KK1A 1RILA 4N5SA 3NF6A 4ID5A 4LD0A 1EXQA 1VSFA 4QAGA 3HM9A 1BCMA 1LW0A 1S1WA 1S9EA 2HB5A 4NCAA 2OA8A 3RRHA 2BGGA 2ETJA 3AV9A 3LWLA 5J2QA 3ZSZA 1SKWA 2RF2A 1HYSA 2DY4A 4J2AA 4CEFA 4B9MA 1S1XA 3QNNA 3LWMA 4I2QA 4RG8A 1WAFA 1NOZA 2YHBA 4Z4EA 4OKEA 4KREA 2KW4A 3ZSXA 2DFFA 2IGIA 4CJLA 4DFPA 2XY6A 3H08A 3K5LA 3S3MA 3SJJA 2XRIA 3SYZA 5D3GA 1S6QA 1RCHA 3QEIA 1TV6A 3NF9A 3CFPA 1U47A 1BIUA 4IBNA 3SQ4A 4E7LA 1RNHA 1VSJA 1HQEA 4DTJA 1ZBIA 3K2PA 3L8BA 1BQNA 1BI4A 3IAYA 1TAQA 1CXUA 3VQ7A 4KHNA 2HHVA 3SV3A 3B6PA 3CG7A 1EP4A 1TKDA 3QEWA 3ZCMA 1NK9A 1JLGA 3T1AA 1B9FA 2ZD1A 4KV8A 4DSJA 4MFBA 4IG0A 3V9SA 1S9GA 3LAKA 1JLAA 1TL1A 4N56A 2XHBA 4OLBA 1BL3A 4CEEA 5FRNA 3NAEA 3VQEA 1JKHA 4KHSA 1UOCA 5KGWA 1NK8A 4W5QA 2HNZA 1J9AA 3NH1A 2X74A 4KRFA 1C0TA 4HCCA 3KKSA 1T03A 3PO4A 3LPUA 3AVMA 1RT7A 4DS4A 3O3HA 3I8DA 1HJRA 2A1SA 3PUFA 5FRMA 3D45A 1ZBLA 1FKOA 1KVCA 1TKZA 3TARA 2OPSA 1LWCA 1SL0A 4O55A 4Z4IA 1RBUA 1TGOA 3I0RA 4FJ9A 4CHOA 4DTOA 3QERA 3KLIA 1BISA 1KTQA 4FM0A 4F2SA 4KB0A 1DTTA 4FJMA 2VWKA 2XY8A 1IG9A 4CERA 3HJFA 3MECA 4DFKA 1U45A 4CJFA 5E41A 1X1PA 4FJ7A 1RDBA 4CJTA 1RT4A 3IS9A 4EP5A 3SNNA 4GMJB 3QEPA 2IOCA 1HPZA 4DTPA 3LP3A 3KD5E 2FBVA 4C8NA 1LAVA 1REVA 3AVKA 5J2MA 4DSKA 4IDKA 3KLEA 4CHYA 3ULDA 2VG6A 3AO2A 4QOZB 1RBRA 5KI6A 1C1BA 2QKBA 4CF0A 4CESA 2X6SA 1R0AA 1D8YA 1D9DA 2EX3A 2R7YA 4RW9A 1IH7A 3E01A 4ID1A 3LZJA 1QE1A 3WNEA 1NK6A 1QSLA 1J54A 3VQDA 4N41A 2Q3SA 5J2PA 4DMNA 5KGXA 3S3NA 1ITGA 4K8ZA 4WE1A 5J1EA 4CE9A 4OGCA 4M41A 1VSKA 4CFCA 3SZ2A 1FKPA 2Y1JA 5HP1A 4DTSA 2QK9A 1ZBUA 4DG1A 4DQIA 2KQ2A 4KO0A 5I42A 2D0AA 5C42A 3L2WA 3NHGA 4C8MA 1HMVA 3HVTA 3M8PA 4CEOA 4FCYA 3EZ5A 4AHCA 2HVIA 3HPHA 3L2RA 5CYQA 2PZSA 3V9XA 3AO3A 2YNIA 4E7IA 1XC9A 3ZT1A 1DLOA 3DYAA 4FLWA 4DU1A 4IFYA 2G8VA 4J2EA 3SQ1A 4PUOA 1TAUA 2GUIA 4B9UA 4E0DA 4CJWA 1UWBA 3QETA 3SUNA 2G8UA 4KTZA 2HHSA 2Y1IA 1BGXT 1Y97A 3OYCA 3LANA 4JLHA 4QCLA 4Z4GA 3ZSYA 2AJQA 3V9ZA 4L8RB 2RN2A 1NJWA 5HRSA 1IO2A 2D5RA 4O5BA 2OPRA 4CECA 4CJKA 4FK2A 2F8TA 3O4QA 2E4LA 4CJ4A 3DLBA 1Z25A 4FLZA 3F9KA 2KFZA 1ZYQA 3AVFA 3CFOA 3NH0A 4CFDA 2E6LA 3OVNA 2HMIA 2YNGA 2X78A 3VQ8A 4CGIA 4K8XA 4LSLA 5K14A 1JL2A 4TSXA 1L3TA 3RWUA 1A5WA 1S6PA 1WSIA 1W0HA 4FJKA 3M8RA 1FXXA 4KI6A 3QESA 3PO5A 3OYIA 3KLGA 1D9FA 3QLHA 1WLJA 1WN7A 3OYHA 1UA0A 3WNFA 2HHUA 4DTNA 2RKIA 2XY7A 4CEQA 1VSDA 3DLHA 4KHQA 2FBTA 4E7JA 1S1VA 1JLEA 3CFRA 4DQPA 2DFEA 4CJVA 1YT3A 3ZSWA 2WONA 1LW2A 4F3TA 2O4GA 4ELVA 1X9WA 1HNIA 1L3VA 1MU2A 4B9VA 4DTXA 1KVAA 3NH2A 4CJ5A 3AVCA 4CEZA 4E1MA 4GVMA 4CHPA 3NF8A 4FW1A 4CF1A 4E89A 3EYZA 3ITHA 4DLEA 4CHZA 5FROA 3DRSA 4FW2A 4B9TA 3TANA 2KTQA 3AVAA 3P83D 4RW7A 4W5NA 4KHYA 4BDZA 3HP9A 4N76A 1X9MA 1JLCA 3O3GA 4FJ8A 3DRPA 1VSMA 4CIEA 1C1CA 4Q5VA 4BE2A 3V81A 3ZSVA 4DWIA 5C25A 4CGDA 3RRGA 4FK0A 2KZMA 1IKYA 4E7HA 1CZBA 4I2PA 3NE6A 3HPOA 3SV4A 3VQQA 3AA5X 4HUFA 3NGZA 4AH9A 3OS2A 1NK5A 1T05A 3CM6A 4J2BA 1L3SA 4FZXC 1U04A 1XHXA 3I0SA 3QIPA 2KZZA 4HTUA 1ASVA 1TKTA 1WAJA 3HXMA 2P5GA 1RDDA 4NYNA 4FVMA 3F73A 4ZTJA 1T7PA 2NUBA 4B9NA 4FM1A 4FJ5A 3C95A 2GV9A 3LAMA 4I9QA 1TK8A 4IFVA 1TK5A 3AO1A 3OYMA 1QSYA 1U4BA 2YNHA 3DLKA 4BACA 1QS4A 4HUEA 5CY4A 3AA4A 4FLTA 4M3XA 4M45A 1Q8IA 1KFSA 4Y1DA 3AA2A 4CEAA 3KK3A 5HRRA 1XHZA 3DOLA 1HYVA 4KB1A 4IKFA 3CM5A 4EZ9A 4CJSA 3QINA 5HLFA 1S1UA 4HVJA 3MAQA 3V1QA 4XIUA 3OYNA 3SQ2A 4BDPA 2IDOA 1RBTA 2YKMA 1NKBA 4C8OA 2YHAA 4KPYA 1NK7A 4JS4A 2BE2A 4Q0BA 1BIZA 3AVLA 4RW8A 1RTHA 1N6QA 2KFNA 4KTWA 4O0JA 4B8CA 3VQ5A 1RDCA 4AHRA 4FJJA 1K6YA 1RT2A 3B6OA 1LAWA 1G15A 3ZSQA 4CK1A 3S3OA 4DQSA 1U48A 4M3UA 2OZMA 4Z4FA 1LWEA 3TAGA 1KRPA 3QEXA 3G0ZA 3CYMA 3DM2A 1RT6A 3ZSOA 4CJQA 3OYAA 2FBXA 4JRPA 5CZ1A 4GW6A 3HVRA 4AHTA 3NBPA 3VA0A 4CHQA 3QIOA 3ZT3A 4CFBA 3EY1A 2OPQA 2P51A 4ICLA 3SI6A 1NJZA 4O0IA 4H8KA 3L2UA 3A2FA 3T3FA 3AVHA 3HP6A 1NK4A 2OZSA 4FLYA 5SZTA 2OPPA 3AA3A 2F8SA 1SKRA 1EX4A 4NCGA 4RW4A 4BDYA 4F3OA 4LY7A 1BQMA 4EP4A 3VQ4A 4CF8A 3NFAA 1N5YA 4LH4A 4E7KA 4M42A 3P5JA 3U3YA 2GBZA 3AVJA 3JYTA 1WSGA 1F21A 3VN5A 1U49A 5JS1A 4F4KA 2HHQA 3LDSA 3BDPA 4DTMA 1Q9YA 3U3GA 1KSPA 5KRSA 4CK2A 3AVNA 3HPGA 4OGEA 4BWMA 3K5NA 3S9HA 1BCOA 2G8IA 1VK0A 1X9SA 2YKNA 1RBVA 1VRUA 3OY9A 4HUGA 4LSNA 3V6DA 1NJXA 3LPTA 1KLNA 3G10A 3OYGA 3ISNC 3WNHA 3OYBA 3TI0A 3T19A 3ZT2A 3PV8A 3TAFA 2G8FA 4UQGA 2W42A 2PYLA 1QHTA 4FJXA 2QXFA 4KFBA 3JSMA 4JS5A 4PA1A 4DFMA 3MXIA 2HNDA 1J5OA 4KAZA 1L3UA 4M3TA 4CFAA 1CLQA 2P5OA 4CJEA 2DTUA 1GOAA 1WSJA 1VSHA 3K57A 3V9UA 3PX4A 3OYJA 4E3SA 1C0MA 1YVUA 2B4JA 1NKCA 3AVIA 1TK0A 3NGIA 4EZ6A 3OYFA 5DK5A 3L2QA 2P1JA 4H4OA 5HROA 4HCBA 1ASWA 4OJRA 5JS2A 5T7BA 3OYDA 3RR8A 4W5RA 1SL2A 1YTAA 1HNVA 3L3VA 1BHLA 5HRNA 1EKEA 1GOCA 4Z4CA 1S5JA 5C24A 3UIQA 3VQAA 3KLHA 4B08A 4DQQA 1ZBFA 4BWJA 3PX6A 2QKKA 2G8KA 4FJGA 4FJLA 4KI4A 1Z26A 3P1GA 1DTQA 3TAEA 1I39A 2BDPA 4OVLA 4DSEA 1SL1A 4CGHA 3V9WA 3HYFA 5HRPA 2JLEA 3LALA 3LZIA 4RW6A 1CZ9A 3SPYA 1JLFA 4DSIA 2ITGA 4FZZA 1JXEA 5HBMA 3K5MA 3OS0A 3AO5A 3RTVA 3VQPA 3ZSRA 3LP2A 4G1QA 3C6TA 3QEVA 1RT1A 2VG7A 4N47A 2EHGA 3KD1E 4CCHA 4DF8A 3MEGA 2A1RA 4FLXA 2HVHA 3DOKA 2ZE2A 3ASMA 4KTQA 1KFDA 1KCFA 1UAXA 3SPZA 4CIGA 1NOYA 1QSSA 2PYJA 2LSNA 4H4MA 4CEDA 3O4NA 3THVA 4PQUA 3KKRA 3KK2A 1WNSA 4Z0UA 2IAJA 4PWDA 1FK9A 4CF2A 3RR7A 1VSIA 4CGGA 1C6VA 3K58A 1WSEA 1RTJA 4OKJA 4B3OA 1L5UA 1RTIA 4DFJA 4PY5A 3K5OA 1W9HA 4OKKA 4HHTA 4F8RA 3SQ0A 3OJUA 3DRRA 3OJSA 4FLUA 4AHSA 4AHVA 2HW3A 1EETA 4DSFA 4OPKA 1HRHA 4CJPA 3PX0A 1RBSA 3ZT4A 2YV0X 3KLFA 1XI1A 1KVBA 3SUOA 4M3RA 4FM2A 4IG3A 4CGJA 4E1NA 4BE0A 4DLGA 4DTRA 3U6FA 4CEBA 4AILC 2ZQBA 1HYZA 4FZYA 1O1WA 1ZBHA 1J53A 2Z1IA 1VRTA 2YNFA 4CK3A 1IKWA 4MQ3A 4I9LA 3C94A 1SV5A 3TWHA 1T8EA 4F2RA 1SUQA 4DTUA 5SWMA 1RDAA 3V4IA 3L3UA 2B6AA 2DFHA 4AHUA 4CHNA 1QQCA 3NDKA 1JLBA 3LP0A 4NYFA 3L2VA 3SCXA 1A5XA 5CZ2A 4JRQA 4R5PA 2HHTA 3AO4A 3HSTB 3SUQA 1IKVA 3RMCA 1QTMA 3HO1A 4BE1A 3HT3A 3RMAA 3M8QA 3MEEA 3PY8A 1JLQA 3HK2A 2I5JA 4KHWA 2Z1HA 3V1RA 3K59A 5FDLA 1LWFA 1NJYA 1LV5A 4CJRA 4Z4HA 4DU3A 2PY5A 5I3UA 2JGUA 2XY5A 3TR8A 3DLRA 4O4GA 3D0PA 4NCBA 2RPIA 2X6NA 1B9DA 4LH5A 2B5JA 5CYMA 4B9LA 1GOBA 4YFUA 3CQ8A 4CIFA 2Z1JA 4W5OA 2F96A 3VQ6A 1ASUA 3KTQA 3O3FA 1XWLA 3IG1A 3RMDA 3DLEA 3DMJA 4O44A 2Z1GA 2XO7A 1UA1A 4FJHA 5EU7A 4FYDA 5KTQA 3VA3A 4FLVA 3RMBA 3OYEA 4CJUA 1Q9XA 4KHUA 1KLMA 2IS3A 2HNYA 2G8HA 2G8WA 1A5VA 3AVGA 1TVRA 3KIOA 3V1OA 2VG5A 3WNGA 3OS1A 1RTDA 1WSFA 1JL1A 4DSLA 4DU4A 3M8SA 3SUPA 3TAMA 4Y1CA 2IC3A 1VSEA 3TAPA 1RT3A 4DF4A 2E6MA 3NCIA 4FXDA 1BI4B 4E19A 4B8AB 2OYQA 3FFIA 3VQCA 1IKXA 4C8LA 1S1TA 3MEDA 4B9SA 4DS5A 3ALYA 2BANA 2D0CA 4FJIA 4I7FA 1HQUA 1D5AA 2D0BA 4KKOA 2ATQA 3OYLA 3QNOA 3TAQA 1C1AA 4ZTFA 3BGRA 4OLAA 2O4IA 5J2NA 1NK0A 5DMRA 2HHWA 3AVBA 1TL3A 3DI6A 1TKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKS A;  5KRT A;  4W5T A;  3C6U A;  4M3Z A;  3KJV A;  1B92 A;  3QO9 A;  3HL8 A;  4ELU A;  2FC0 A;  3ZT0 A;  4CGF A;  4FJN A;  4C8K A;  1WSH A;  1I3A A;  4CF9 A;  3VQ9 A;  3MXJ A;  1RT5 A;  4DQR A;  4YNQ A;  3NF7 A;  1NKE A;  3OYK A;  1YTU A;  4OPJ A;  1CXQ A;  3DLG A;  4FK4 A;  3VQB A;  2WOM A;  4ZHR A;  4M3Y A;  4ELT A;  2VWJ A;  1VSL A;  3NGY A;  2FBY A;  3LP1 A;  3MXM A;  4J2D A;  1JXB A;  3IRX A;  3TAB A;  4CJ3 A;  4M3W A;  2HHX A;  1C0U A;  3KK1 A;  1RIL A;  4N5S A;  3NF6 A;  4ID5 A;  4LD0 A;  1EXQ A;  1VSF A;  4QAG A;  3HM9 A;  1BCM A;  1LW0 A;  1S1W A;  1S9E A;  2HB5 A;  4NCA A;  2OA8 A;  3RRH A;  2BGG A;  2ETJ A;  3AV9 A;  3LWL A;  5J2Q A;  3ZSZ A;  1SKW A;  2RF2 A;  1HYS A;  2DY4 A;  4J2A A;  4CEF A;  4B9M A;  1S1X A;  3QNN A;  3LWM A;  4I2Q A;  4RG8 A;  1WAF A;  1NOZ A;  2YHB A;  4Z4E A;  4OKE A;  4KRE A;  2KW4 A;  3ZSX A;  2DFF A;  2IGI A;  4CJL A;  4DFP A;  2XY6 A;  3H08 A;  3K5L A;  3S3M A;  3SJJ A;  2XRI A;  3SYZ A;  5D3G A;  1S6Q A;  1RCH A;  3QEI A;  1TV6 A;  3NF9 A;  3CFP A;  1U47 A;  1BIU A;  4IBN A;  3SQ4 A;  4E7L A;  1RNH A;  1VSJ A;  1HQE A;  4DTJ A;  1ZBI A;  3K2P A;  3L8B A;  1BQN A;  1BI4 A;  3IAY A;  1TAQ A;  1CXU A;  3VQ7 A;  4KHN A;  2HHV A;  3SV3 A;  3B6P A;  3CG7 A;  1EP4 A;  1TKD A;  3QEW A;  3ZCM A;  1NK9 A;  1JLG A;  3T1A A;  1B9F A;  2ZD1 A;  4KV8 A;  4DSJ A;  4MFB A;  4IG0 A;  3V9S A;  1S9G A;  3LAK A;  1JLA A;  1TL1 A;  4N56 A;  2XHB A;  4OLB A;  1BL3 A;  4CEE A;  5FRN A;  3NAE A;  3VQE A;  1JKH A;  4KHS A;  1UOC A;  5KGW A;  1NK8 A;  4W5Q A;  2HNZ A;  1J9A A;  3NH1 A;  2X74 A;  4KRF A;  1C0T A;  4HCC A;  3KKS A;  1T03 A;  3PO4 A;  3LPU A;  3AVM A;  1RT7 A;  4DS4 A;  3O3H A;  3I8D A;  1HJR A;  2A1S A;  3PUF A;  5FRM A;  3D45 A;  1ZBL A;  1FKO A;  1KVC A;  1TKZ A;  3TAR A;  2OPS A;  1LWC A;  1SL0 A;  4O55 A;  4Z4I A;  1RBU A;  1TGO A;  3I0R A;  4FJ9 A;  4CHO A;  4DTO A;  3QER A;  3KLI A;  1BIS A;  1KTQ A;  4FM0 A;  4F2S A;  4KB0 A;  1DTT A;  4FJM A;  2VWK A;  2XY8 A;  1IG9 A;  4CER A;  3HJF A;  3MEC A;  4DFK A;  1U45 A;  4CJF A;  5E41 A;  1X1P A;  4FJ7 A;  1RDB A;  4CJT A;  1RT4 A;  3IS9 A;  4EP5 A;  3SNN A;  4GMJ B;  3QEP A;  2IOC A;  1HPZ A;  4DTP A;  3LP3 A;  3KD5 E;  2FBV A;  4C8N A;  1LAV A;  1REV A;  3AVK A;  5J2M A;  4DSK A;  4IDK A;  3KLE A;  4CHY A;  3ULD A;  2VG6 A;  3AO2 A;  4QOZ B;  1RBR A;  5KI6 A;  1C1B A;  2QKB A;  4CF0 A;  4CES A;  2X6S A;  1R0A A;  1D8Y A;  1D9D A;  2EX3 A;  2R7Y A;  4RW9 A;  1IH7 A;  3E01 A;  4ID1 A;  3LZJ A;  1QE1 A;  3WNE A;  1NK6 A;  1QSL A;  1J54 A;  3VQD A;  4N41 A;  2Q3S A;  5J2P A;  4DMN A;  5KGX A;  3S3N A;  1ITG A;  4K8Z A;  4WE1 A;  5J1E A;  4CE9 A;  4OGC A;  4M41 A;  1VSK A;  4CFC A;  3SZ2 A;  1FKP A;  2Y1J A;  5HP1 A;  4DTS A;  2QK9 A;  1ZBU A;  4DG1 A;  4DQI A;  2KQ2 A;  4KO0 A;  5I42 A;  2D0A A;  5C42 A;  3L2W A;  3NHG A;  4C8M A;  1HMV A;  3HVT A;  3M8P A;  4CEO A;  4FCY A;  3EZ5 A;  4AHC A;  2HVI A;  3HPH A;  3L2R A;  5CYQ A;  2PZS A;  3V9X A;  3AO3 A;  2YNI A;  4E7I A;  1XC9 A;  3ZT1 A;  1DLO A;  3DYA A;  4FLW A;  4DU1 A;  4IFY A;  2G8V A;  4J2E A;  3SQ1 A;  4PUO A;  1TAU A;  2GUI A;  4B9U A;  4E0D A;  4CJW A;  1UWB A;  3QET A;  3SUN A;  2G8U A;  4KTZ A;  2HHS A;  2Y1I A;  1BGX T;  1Y97 A;  3OYC A;  3LAN A;  4JLH A;  4QCL A;  4Z4G A;  3ZSY A;  2AJQ A;  3V9Z A;  4L8R B;  2RN2 A;  1NJW A;  5HRS A;  1IO2 A;  2D5R A;  4O5B A;  2OPR A;  4CEC A;  4CJK A;  4FK2 A;  2F8T A;  3O4Q A;  2E4L A;  4CJ4 A;  3DLB A;  1Z25 A;  4FLZ A;  3F9K A;  2KFZ A;  1ZYQ A;  3AVF A;  3CFO A;  3NH0 A;  4CFD A;  2E6L A;  3OVN A;  2HMI A;  2YNG A;  2X78 A;  3VQ8 A;  4CGI A;  4K8X A;  4LSL A;  5K14 A;  1JL2 A;  4TSX A;  1L3T A;  3RWU A;  1A5W A;  1S6P A;  1WSI A;  1W0H A;  4FJK A;  3M8R A;  1FXX A;  4KI6 A;  3QES A;  3PO5 A;  3OYI A;  3KLG A;  1D9F A;  3QLH A;  1WLJ A;  1WN7 A;  3OYH A;  1UA0 A;  3WNF A;  2HHU A;  4DTN A;  2RKI A;  2XY7 A;  4CEQ A;  1VSD A;  3DLH A;  4KHQ A;  2FBT A;  4E7J A;  1S1V A;  1JLE A;  3CFR A;  4DQP A;  2DFE A;  4CJV A;  1YT3 A;  3ZSW A;  2WON A;  1LW2 A;  4F3T A;  2O4G A;  4ELV A;  1X9W A;  1HNI A;  1L3V A;  1MU2 A;  4B9V A;  4DTX A;  1KVA A;  3NH2 A;  4CJ5 A;  3AVC A;  4CEZ A;  4E1M A;  4GVM A;  4CHP A;  3NF8 A;  4FW1 A;  4CF1 A;  4E89 A;  3EYZ A;  3ITH A;  4DLE A;  4CHZ A;  5FRO A;  3DRS A;  4FW2 A;  4B9T A;  3TAN A;  2KTQ A;  3AVA A;  3P83 D;  4RW7 A;  4W5N A;  4KHY A;  4BDZ A;  3HP9 A;  4N76 A;  1X9M A;  1JLC A;  3O3G A;  4FJ8 A;  3DRP A;  1VSM A;  4CIE A;  1C1C A;  4Q5V A;  4BE2 A;  3V81 A;  3ZSV A;  4DWI A;  5C25 A;  4CGD A;  3RRG A;  4FK0 A;  2KZM A;  1IKY A;  4E7H A;  1CZB A;  4I2P A;  3NE6 A;  3HPO A;  3SV4 A;  3VQQ A;  3AA5 X;  4HUF A;  3NGZ A;  4AH9 A;  3OS2 A;  1NK5 A;  1T05 A;  3CM6 A;  4J2B A;  1L3S A;  4FZX C;  1U04 A;  1XHX A;  3I0S A;  3QIP A;  2KZZ A;  4HTU A;  1ASV A;  1TKT A;  1WAJ A;  3HXM A;  2P5G A;  1RDD A;  4NYN A;  4FVM A;  3F73 A;  4ZTJ A;  1T7P A;  2NUB A;  4B9N A;  4FM1 A;  4FJ5 A;  3C95 A;  2GV9 A;  3LAM A;  4I9Q A;  1TK8 A;  4IFV A;  1TK5 A;  3AO1 A;  3OYM A;  1QSY A;  1U4B A;  2YNH A;  3DLK A;  4BAC A;  1QS4 A;  4HUE A;  5CY4 A;  3AA4 A;  4FLT A;  4M3X A;  4M45 A;  1Q8I A;  1KFS A;  4Y1D A;  3AA2 A;  4CEA A;  3KK3 A;  5HRR A;  1XHZ A;  3DOL A;  1HYV A;  4KB1 A;  4IKF A;  3CM5 A;  4EZ9 A;  4CJS A;  3QIN A;  5HLF A;  1S1U A;  4HVJ A;  3MAQ A;  3V1Q A;  4XIU A;  3OYN A;  3SQ2 A;  4BDP A;  2IDO A;  1RBT A;  2YKM A;  1NKB A;  4C8O A;  2YHA A;  4KPY A;  1NK7 A;  4JS4 A;  2BE2 A;  4Q0B A;  1BIZ A;  3AVL A;  4RW8 A;  1RTH A;  1N6Q A;  2KFN A;  4KTW A;  4O0J A;  4B8C A;  3VQ5 A;  1RDC A;  4AHR A;  4FJJ A;  1K6Y A;  1RT2 A;  3B6O A;  1LAW A;  1G15 A;  3ZSQ A;  4CK1 A;  3S3O A;  4DQS A;  1U48 A;  4M3U A;  2OZM A;  4Z4F A;  1LWE A;  3TAG A;  1KRP A;  3QEX A;  3G0Z A;  3CYM A;  3DM2 A;  1RT6 A;  3ZSO A;  4CJQ A;  3OYA A;  2FBX A;  4JRP A;  5CZ1 A;  4GW6 A;  3HVR A;  4AHT A;  3NBP A;  3VA0 A;  4CHQ A;  3QIO A;  3ZT3 A;  4CFB A;  3EY1 A;  2OPQ A;  2P51 A;  4ICL A;  3SI6 A;  1NJZ A;  4O0I A;  4H8K A;  3L2U A;  3A2F A;  3T3F A;  3AVH A;  3HP6 A;  1NK4 A;  2OZS A;  4FLY A;  5SZT A;  2OPP A;  3AA3 A;  2F8S A;  1SKR A;  1EX4 A;  4NCG A;  4RW4 A;  4BDY A;  4F3O A;  4LY7 A;  1BQM A;  4EP4 A;  3VQ4 A;  4CF8 A;  3NFA A;  1N5Y A;  4LH4 A;  4E7K A;  4M42 A;  3P5J A;  3U3Y A;  2GBZ A;  3AVJ A;  3JYT A;  1WSG A;  1F21 A;  3VN5 A;  1U49 A;  5JS1 A;  4F4K A;  2HHQ A;  3LDS A;  3BDP A;  4DTM A;  1Q9Y A;  3U3G A;  1KSP A;  5KRS A;  4CK2 A;  3AVN A;  3HPG A;  4OGE A;  4BWM A;  3K5N A;  3S9H A;  1BCO A;  2G8I A;  1VK0 A;  1X9S A;  2YKN A;  1RBV A;  1VRU A;  3OY9 A;  4HUG A;  4LSN A;  3V6D A;  1NJX A;  3LPT A;  1KLN A;  3G10 A;  3OYG A;  3ISN C;  3WNH A;  3OYB A;  3TI0 A;  3T19 A;  3ZT2 A;  3PV8 A;  3TAF A;  2G8F A;  4UQG A;  2W42 A;  2PYL A;  1QHT A;  4FJX A;  2QXF A;  4KFB A;  3JSM A;  4JS5 A;  4PA1 A;  4DFM A;  3MXI A;  2HND A;  1J5O A;  4KAZ A;  1L3U A;  4M3T A;  4CFA A;  1CLQ A;  2P5O A;  4CJE A;  2DTU A;  1GOA A;  1WSJ A;  1VSH A;  3K57 A;  3V9U A;  3PX4 A;  3OYJ A;  4E3S A;  1C0M A;  1YVU A;  2B4J A;  1NKC A;  3AVI A;  1TK0 A;  3NGI A;  4EZ6 A;  3OYF A;  5DK5 A;  3L2Q A;  2P1J A;  4H4O A;  5HRO A;  4HCB A;  1ASW A;  4OJR A;  5JS2 A;  5T7B A;  3OYD A;  3RR8 A;  4W5R A;  1SL2 A;  1YTA A;  1HNV A;  3L3V A;  1BHL A;  5HRN A;  1EKE A;  1GOC A;  4Z4C A;  1S5J A;  5C24 A;  3UIQ A;  3VQA A;  3KLH A;  4B08 A;  4DQQ A;  1ZBF A;  4BWJ A;  3PX6 A;  2QKK A;  2G8K A;  4FJG A;  4FJL A;  4KI4 A;  1Z26 A;  3P1G A;  1DTQ A;  3TAE A;  1I39 A;  2BDP A;  4OVL A;  4DSE A;  1SL1 A;  4CGH A;  3V9W A;  3HYF A;  5HRP A;  2JLE A;  3LAL A;  3LZI A;  4RW6 A;  1CZ9 A;  3SPY A;  1JLF A;  4DSI A;  2ITG A;  4FZZ A;  1JXE A;  5HBM A;  3K5M A;  3OS0 A;  3AO5 A;  3RTV A;  3VQP A;  3ZSR A;  3LP2 A;  4G1Q A;  3C6T A;  3QEV A;  1RT1 A;  2VG7 A;  4N47 A;  2EHG A;  3KD1 E;  4CCH A;  4DF8 A;  3MEG A;  2A1R A;  4FLX A;  2HVH A;  3DOK A;  2ZE2 A;  3ASM A;  4KTQ A;  1KFD A;  1KCF A;  1UAX A;  3SPZ A;  4CIG A;  1NOY A;  1QSS A;  2PYJ A;  2LSN A;  4H4M A;  4CED A;  3O4N A;  3THV A;  4PQU A;  3KKR A;  3KK2 A;  1WNS A;  4Z0U A;  2IAJ A;  4PWD A;  1FK9 A;  4CF2 A;  3RR7 A;  1VSI A;  4CGG A;  1C6V A;  3K58 A;  1WSE A;  1RTJ A;  4OKJ A;  4B3O A;  1L5U A;  1RTI A;  4DFJ A;  4PY5 A;  3K5O A;  1W9H A;  4OKK A;  4HHT A;  4F8R A;  3SQ0 A;  3OJU A;  3DRR A;  3OJS A;  4FLU A;  4AHS A;  4AHV A;  2HW3 A;  1EET A;  4DSF A;  4OPK A;  1HRH A;  4CJP A;  3PX0 A;  1RBS A;  3ZT4 A;  2YV0 X;  3KLF A;  1XI1 A;  1KVB A;  3SUO A;  4M3R A;  4FM2 A;  4IG3 A;  4CGJ A;  4E1N A;  4BE0 A;  4DLG A;  4DTR A;  3U6F A;  4CEB A;  4AIL C;  2ZQB A;  1HYZ A;  4FZY A;  1O1W A;  1ZBH A;  1J53 A;  2Z1I A;  1VRT A;  2YNF A;  4CK3 A;  1IKW A;  4MQ3 A;  4I9L A;  3C94 A;  1SV5 A;  3TWH A;  1T8E A;  4F2R A;  1SUQ A;  4DTU A;  5SWM A;  1RDA A;  3V4I A;  3L3U A;  2B6A A;  2DFH A;  4AHU A;  4CHN A;  1QQC A;  3NDK A;  1JLB A;  3LP0 A;  4NYF A;  3L2V A;  3SCX A;  1A5X A;  5CZ2 A;  4JRQ A;  4R5P A;  2HHT A;  3AO4 A;  3HST B;  3SUQ A;  1IKV A;  3RMC A;  1QTM A;  3HO1 A;  4BE1 A;  3HT3 A;  3RMA A;  3M8Q A;  3MEE A;  3PY8 A;  1JLQ A;  3HK2 A;  2I5J A;  4KHW A;  2Z1H A;  3V1R A;  3K59 A;  5FDL A;  1LWF A;  1NJY A;  1LV5 A;  4CJR A;  4Z4H A;  4DU3 A;  2PY5 A;  5I3U A;  2JGU A;  2XY5 A;  3TR8 A;  3DLR A;  4O4G A;  3D0P A;  4NCB A;  2RPI A;  2X6N A;  1B9D A;  4LH5 A;  2B5J A;  5CYM A;  4B9L A;  1GOB A;  4YFU A;  3CQ8 A;  4CIF A;  2Z1J A;  4W5O A;  2F96 A;  3VQ6 A;  1ASU A;  3KTQ A;  3O3F A;  1XWL A;  3IG1 A;  3RMD A;  3DLE A;  3DMJ A;  4O44 A;  2Z1G A;  2XO7 A;  1UA1 A;  4FJH A;  5EU7 A;  4FYD A;  5KTQ A;  3VA3 A;  4FLV A;  3RMB A;  3OYE A;  4CJU A;  1Q9X A;  4KHU A;  1KLM A;  2IS3 A;  2HNY A;  2G8H A;  2G8W A;  1A5V A;  3AVG A;  1TVR A;  3KIO A;  3V1O A;  2VG5 A;  3WNG A;  3OS1 A;  1RTD A;  1WSF A;  1JL1 A;  4DSL A;  4DU4 A;  3M8S A;  3SUP A;  3TAM A;  4Y1C A;  2IC3 A;  1VSE A;  3TAP A;  1RT3 A;  4DF4 A;  2E6M A;  3NCI A;  4FXD A;  1BI4 B;  4E19 A;  4B8A B;  2OYQ A;  3FFI A;  3VQC A;  1IKX A;  4C8L A;  1S1T A;  3MED A;  4B9S A;  4DS5 A;  3ALY A;  2BAN A;  2D0C A;  4FJI A;  4I7F A;  1HQU A;  1D5A A;  2D0B A;  4KKO A;  2ATQ A;  3OYL A;  3QNO A;  3TAQ A;  1C1A A;  4ZTF A;  3BGR A;  4OLA A;  2O4I A;  5J2N A;  1NK0 A;  5DMR A;  2HHW A;  3AVB A;  1TL3 A;  3DI6 A;  1TKX A; 
#chains in the Genus database with same CATH topology
 4CD1 A;  1FW6 A;  2E5L K;  3FZF A;  1KC8 O;  3C6U A;  4GKK K;  3KJV A;  1B92 A;  3VF6 A;  4CZE A;  2FC0 A;  4FWO A;  2GWJ A;  1WSH A;  1I3A A;  4CF9 A;  3CF5 L;  3OHR A;  4OPJ A;  4DQ8 A;  1CXQ A;  4FK4 A;  4M3Y A;  2V52 B;  1VSL A;  3NGY A;  3MXM A;  4J2D A;  3IRX A;  1C0U A;  1RIL A;  4N5S A;  3CJ7 A;  4LD0 A;  1EXQ A;  4QAG A;  1LW0 A;  2HB5 A;  5LMU K;  2OA8 A;  2BGG A;  3LWL A;  3K0S A;  4BRQ A;  3R8E A;  2Q31 A;  4MDB A;  4B9M A;  4I2Q A;  2I7N A;  4DR6 K;  4DFP A;  4CJL A;  2A5X A;  3EN9 A;  2XRI A;  3SYZ A;  5D3G A;  1RCH A;  1RFQ A;  3QEI A;  1BWF O;  1U47 A;  4B1W B;  1ATS A;  1RNH A;  3MCA B;  3L8B A;  1BQN A;  2HHV A;  2HF3 A;  3B6P A;  1HLU A;  3ZCM A;  5AQH A;  2FSK A;  3O9T A;  1JLG A;  1B9F A;  4MFB A;  1KAY A;  4BGB A;  4N56 A;  1BL3 A;  4JYA K;  2HNZ A;  2YJE A;  1C0T A;  3KKS A;  1O13 A;  2QXL A;  3AVM A;  2A1S A;  4DV7 K;  1FKO A;  2OPS A;  1TGO A;  3ZX2 A;  3QER A;  2QA4 N;  2VWK A;  1X3N A;  3L4I A;  3HJF A;  4DFK A;  4JKA A;  4NB4 A;  3ID8 A;  3IS9 A;  3ENB A;  4K41 A;  4DTP A;  3LP3 A;  4YOR A;  1W97 L;  1REV A;  3AVK A;  4DSK A;  4IDK A;  1DEJ A;  4DKW A;  3IFR A;  1GLE G;  3THW A;  5EXW A;  4CES A;  1D8Y A;  2EX3 A;  4ID1 A;  3WNE A;  1IBM K;  1N8R O;  1J54 A;  3CCM N;  2P9L B;  5J1E A;  4CE9 A;  5HP1 A;  1ATN A;  5C42 A;  4C8M A;  1HMV A;  4FCY A;  4K43 A;  3HPH A;  4BG9 A;  3L2R A;  4XH4 A;  3V9X A;  2YNI A;  1X3M A;  3ZT1 A;  3DYA A;  4BRC A;  4FLW A;  4J2E A;  3QET A;  2G8U A;  1JJ2 M;  1Y97 A;  3UKU B;  4QCL A;  4Z4G A;  1GLA G;  4L8R B;  1QVF M;  3GBT A;  4CZJ A;  3DWL A;  4FK2 A;  2O8C B;  1VQ4 N;  3O4Q A;  2E4L A;  4C23 A;  3NH0 A;  2E6L A;  3VQ8 A;  1JL2 A;  4TSX A;  3BZK A;  1CZA N;  3CJ9 A;  4LFC K;  1FXX A;  3QES A;  3PO5 A;  4BC4 A;  4A5A A;  4LF9 K;  3VTI A;  1NGE A;  3K9K A;  3BEX A;  1X9J A;  1VSD A;  1K8K A;  4BR5 A;  4U7B A;  1JLE A;  4DQP A;  3ZSW A;  2WON A;  4F3T A;  4H0X B;  1NGC A;  3LDN A;  4DTX A;  1KVA A;  1MDU B;  4E1M A;  4CHP A;  4FW1 A;  4DLE A;  3THW B;  4DR4 K;  4IOC L;  4KHY A;  4WQ5 C;  2GEM A;  1X9M A;  4FJ8 A;  5FLX O;  1VSM A;  2ZM6 K;  4BE2 A;  3EL2 A;  3V81 A;  4OO1 J;  5C25 A;  3TSQ A;  3FFK B;  4LC9 B;  4BRO A;  2E1Y A;  5M1P A;  2F8T A;  1L3S A;  4CJ7 A;  1U04 A;  3QIP A;  1TKT A;  3HXM A;  1EQY A;  4FM1 A;  2GV9 A;  1TK8 A;  4DHY A;  1TK5 A;  1QSY A;  3OYM A;  4CD3 A;  3O9Q A;  4M45 A;  1Q8I A;  4CEA A;  1V4S A;  5HRR A;  2KKZ A;  4IKF A;  1S1U A;  4HVJ A;  3EO3 A;  1BA0 A;  2F9T A;  3KZB A;  3V1Q A;  3OYN A;  1TUY A;  1SS6 A;  4Z94 A;  1BIZ A;  4RW8 A;  5BRE A;  1N6Q A;  1FJG K;  4KTW A;  4O0J A;  1RDC A;  4CK1 A;  1LAW A;  4Z4F A;  5AJ3 K;  2OZM A;  2ZF5 O;  2IVP A;  3HVR A;  2NRX A;  4AHT A;  4DV4 K;  4DSI A;  1S22 A;  3CCQ N;  1NJZ A;  3L2U A;  5SZT A;  4DR5 K;  1EX4 A;  4RW4 A;  3BY5 A;  1XUP O;  2V7Y A;  1BQM A;  1VHX A;  1E4G T;  4E7K A;  4BRH A;  3PIP L;  4M42 A;  3PSF A;  3U3Y A;  4L3Q A;  4O5F A;  5JS1 A;  3G25 A;  4FOE A;  4JI6 K;  3MDQ A;  3BDP A;  4FWQ A;  4DTM A;  1Q9Y A;  1KSP A;  4CK2 A;  3AVN A;  2ZJR L;  1Q18 A;  3K5N A;  1VK0 A;  1X9S A;  3V6D A;  1KLN A;  1V4T A;  3WNH A;  3OYB A;  3FR0 A;  3TI0 A;  3ZT2 A;  1BO5 O;  2W42 A;  4KFB A;  1VQ5 N;  3IMX A;  4M3T A;  1T6C A;  1J5E K;  1NG9 A;  3VEW A;  3F9M A;  3O1W A;  3SAH A;  2UUB K;  3H3N O;  3NGI A;  1RDU A;  4EZ6 A;  2W6K A;  3OYF A;  5HRO A;  2P1J A;  1ASW A;  5LJW A;  1U6Z A;  5T7B A;  4BRM A;  1M1K O;  1HNV A;  4GKJ K;  4LF8 K;  1J6Z A;  4Z4C A;  5C24 A;  4JHD A;  4WQ4 A;  5BN9 A;  3KLH A;  4DQQ A;  3I55 N;  2G8K A;  4CZM A;  2BDP A;  4BVO A;  2HBJ A;  4CGH A;  3HYF A;  4RWT A;  4DR3 K;  3LAL A;  3LZI A;  1CZ9 A;  1JLF A;  1JXE A;  4JKF A;  4PKG A;  4B3R K;  2E2P A;  3FZL A;  3ZSR A;  2HBL A;  3KWG A;  3HTV A;  1BU6 O;  2PFU A;  4DF8 A;  4PL8 A;  3C65 A;  4FLX A;  2HVH A;  2ZE2 A;  1KCF A;  2PYJ A;  3THX B;  2LSN A;  4GY2 B;  4H4M A;  3O4N A;  4BRL A;  3THV A;  3KKR A;  3KK2 A;  4Z0U A;  3MWP A;  4MLE A;  1VSI A;  4MO4 A;  1QQO A;  5JLH A;  1W9H A;  4HHT A;  3OJU A;  3DRR A;  3WXL A;  4BRN A;  4DR1 K;  1P8Z A;  3TTD A;  1N32 K;  1ATR A;  3KLF A;  4O8K A;  3CCJ N;  3SUO A;  1KQS M;  4RCH A;  4BE0 A;  4DLG A;  1VQM N;  4B1Y B;  2ZQB A;  3U9D A;  4JK8 A;  4FWM A;  4CK3 A;  4MQ3 A;  1SV5 A;  4DUY K;  4JEP A;  3V4I A;  3O8M A;  2B6A A;  4AHU A;  4BR7 A;  1WB9 A;  4LF6 K;  1JLB A;  3L2V A;  3CC2 N;  1XNQ K;  3HST B;  3MN6 A;  3MEE A;  5HOO A;  4DV6 K;  3T1Y K;  2GTD A;  1Q86 O;  4JHD B;  3MX2 A;  1LWF A;  1LV5 A;  3JAM O;  1NGB A;  5I3U A;  2XY5 A;  4YDU C;  3TR8 A;  4NCB A;  2RPI A;  3CJC A;  2X6N A;  4DB3 A;  2B5J A;  4CW7 B;  1BUP A;  5AQN A;  1NM1 A;  4W5O A;  3O5B A;  3HRG A;  3KTQ A;  3O3F A;  1XWL A;  1VQL N;  4O44 A;  4FWS A;  5AQP A;  4FLV A;  4ISE A;  3J7Z O;  3RMB A;  3OYE A;  2BTF A;  4KHU A;  5HL7 L;  3MN7 A;  3J8A A;  2G8W A;  2VG5 A;  3OS1 A;  2WFB A;  1YVN A;  2JWL A;  4DV5 K;  2QWR A;  3M8S A;  1QQM A;  4Y1C A;  4E19 A;  4C8L A;  3FFI A;  3VQC A;  4B9S A;  4MLH A;  4DS5 A;  2BAN A;  2D0C A;  3OYL A;  3QNO A;  3O9R A;  2WC9 A;  3BGR A;  3LDP A;  4BRF A;  1TL3 A;  3DI6 A;  5BR8 K;  5KRT A;  3QBW A;  1XMQ K;  3CPW M;  4C8K A;  1DKG D;  1NKE A;  2QI2 A;  3VTH A;  3VQB A;  3QIC A;  4BR0 A;  1YF5 L;  3PLA A;  2HHX A;  4BQL A;  3THY A;  3BP8 A;  3NF6 A;  3HM9 A;  3L4Q A;  3N4P A;  4NCA A;  1S9E A;  3LDQ A;  4J2A A;  4CEF A;  4J8F A;  2ZJQ L;  3LWM A;  1KAZ A;  3H1Q A;  4B1U B;  2KW4 A;  3ZSX A;  3CET A;  2CGJ A;  3O9U A;  3WEE A;  1BIU A;  4IBN A;  1VSJ A;  1HQE A;  3K2P A;  3TU5 A;  1BI4 A;  4KHN A;  4IFE A;  3SV3 A;  4JK7 A;  2E1Z A;  3PSI A;  1NK9 A;  1Q81 O;  3A5M C;  3E9O A;  4KV8 A;  4IG0 A;  3A5N C;  4E1J A;  1JLA A;  1Z6R A;  4OLB A;  4BRG A;  1JKH A;  4IOA L;  2PBD A;  1LOT B;  3ZYY X;  3NH1 A;  4KRF A;  4HCC A;  3EZW A;  2AP1 A;  3W0L A;  3PO4 A;  1RT7 A;  1HJR A;  3C7N A;  1OH8 A;  1KVC A;  3TAR A;  5C0Y A;  1K9M O;  3SBT A;  1SL0 A;  2QW9 A;  5JIC A;  3U9Z A;  2FLO A;  3I0R A;  4HWI A;  5M1F A;  4CHO A;  1GLB G;  4FJ9 A;  5BN8 A;  3ATV A;  1K73 O;  3CXC M;  1IG9 A;  4X66 K;  2NRZ A;  3GL1 A;  3FLC O;  1GLC G;  5E41 A;  3DXM B;  1RT4 A;  3QEP A;  1LAV A;  1IBK K;  5J2M A;  3KLE A;  3VGK A;  3ULD A;  5KI6 A;  1VQ8 N;  1R0A A;  4RW9 A;  1IH7 A;  1RDW X;  1QE1 A;  3CCR N;  1NK6 A;  3QDK A;  3H45 C;  2E8A A;  5J2P A;  5KGX A;  3S3N A;  4LF5 K;  4WE1 A;  4OGC A;  1YUW A;  5AR0 A;  3WEE B;  2O8D B;  4M41 A;  1VSK A;  3CER A;  3SZ2 A;  1FKP A;  2Y1J A;  1NGI A;  1T3V A;  1ZBU A;  4DG1 A;  4DQI A;  4KO0 A;  5I42 A;  2D0A A;  1EWR A;  3NHG A;  1ZXO A;  4CEO A;  3M8P A;  4JKG B;  2D1K A;  5CR4 A;  3LM9 A;  1SAZ A;  5CYQ A;  4Y0W A;  1XC9 A;  4BC5 A;  4BRP A;  5BRH A;  4B9U A;  4E0D A;  5AQK A;  2VQF K;  2HHS A;  2Y1I A;  2KHO A;  3ZSY A;  2WTU A;  3IKM A;  1YAG A;  5EX5 A;  2D5R A;  4BRK A;  2OPR A;  5E26 A;  3C7N B;  1Z25 A;  4FLZ A;  3CFO A;  4CFD A;  2HMI A;  2X78 A;  4JNE A;  4K8X A;  1A5W A;  1WSI A;  1VAZ A;  2P9U A;  3M8R A;  3A0I X;  4LF4 K;  1WUA A;  3OYH A;  3NVM A;  1UA0 A;  4DTN A;  2XY7 A;  4KBO A;  3ZX0 A;  4E7J A;  1S1V A;  4U67 L;  3ZX3 A;  3CFR A;  2DFE A;  1YT3 A;  2P9L A;  2VGN A;  3CME N;  2O4G A;  1X9W A;  3NH2 A;  3NF8 A;  4QS9 A;  5KQD A;  4CBX A;  4CHZ A;  3AVA A;  2YJF A;  4N76 A;  2A6A A;  2WUS A;  4JD2 B;  5F2R A;  3O3G A;  1EWQ A;  1C1C A;  2QWO A;  4Q5V A;  3M3Z A;  3RRG A;  3J7Y P;  4FK0 A;  2KZM A;  3VMF B;  5GIN A;  3NE6 A;  4E7H A;  3UKU A;  4BC2 A;  3NGZ A;  4AH9 A;  3OS2 A;  3TTC A;  1GLD G;  2P5G A;  3M5R A;  1RDD A;  3FGU A;  3F73 A;  4B9N A;  2O8C A;  3LAM A;  4XH5 A;  1U4B A;  3J81 O;  4IEI A;  4FLT A;  4M3X A;  1KD1 O;  4Y1D A;  4H0T B;  3I33 A;  2Q0R A;  3CI5 A;  1HYV A;  4BC3 A;  4KB1 A;  4EZ9 A;  4CJS A;  3QIN A;  3O80 A;  1BDG A;  4XIU A;  4H0O A;  4BDP A;  3AAP A;  1NKB A;  4KPY A;  2BE2 A;  3AVL A;  1RTH A;  5BRF A;  4B8C A;  2P9U B;  4ILH A;  1RT2 A;  3FE1 A;  4H5N A;  3ZSQ A;  1G15 A;  3S3O A;  1D4X A;  4DQS A;  3QEX A;  3G0Z A;  4B1V A;  5F0X A;  1RT6 A;  4JI5 K;  3RWU A;  4GW6 A;  3VA0 A;  1VQP N;  3ZT3 A;  3EY1 A;  3SI6 A;  2P51 A;  2IVN A;  4LH4 A;  1W7A A;  3AVJ A;  1WSG A;  1U49 A;  4KH4 A;  4F4K A;  2HHQ A;  3H6E A;  4IO9 L;  3VET A;  2WBN A;  1MWM A;  3HPG A;  4BWM A;  1QQN A;  2YKN A;  1N33 K;  4HUG A;  4GNI A;  1NJX A;  5EOY A;  3LPT A;  5FPM A;  1ZBS A;  4UQG A;  3OBW A;  5AQR A;  2PYL A;  4FJX A;  4CBU A;  4JS5 A;  4KAZ A;  2HND A;  3UKR A;  4CFA A;  4CJE A;  3K57 A;  5KPZ A;  3V9U A;  3PX4 A;  3VEY A;  4A57 A;  2O8E A;  2B4J A;  4LF7 K;  1NWK A;  3RSE A;  4WFN L;  4H5R A;  4H4O A;  4HCB A;  4W5R A;  1SL2 A;  3L3V A;  2V7Z A;  4BR4 A;  1S5J A;  2VWB A;  1H1V A;  2OCE A;  1Z26 A;  2ZJP L;  4K25 A;  4RW6 A;  3SPY A;  3FZH A;  3VF2 A;  1Y64 A;  3RTV A;  3M6G A;  5B8H A;  3MEG A;  1VQ7 N;  4KTQ A;  3D2F A;  4CIG A;  1QSS A;  4MDA A;  4CED A;  4PQU A;  2OTJ N;  3VEZ A;  3GE1 A;  4CF2 A;  3RR7 A;  2FXU A;  4B3O A;  1L5U A;  3QB0 A;  3EKU A;  4OKK A;  5AQF A;  3SQ0 A;  4OPH A;  1XQS C;  1NMN A;  4JI2 K;  4DSF A;  4OPK A;  2V51 B;  4CJP A;  1RBS A;  3ZT4 A;  1XI1 A;  1IG8 A;  3SJH A;  4NLC A;  4CGJ A;  4E1N A;  4DTR A;  4LFA K;  4FZY A;  3UKR B;  3G4S N;  2YNF A;  3HZ6 A;  2W40 A;  5SWM A;  2O8E B;  4WYB A;  4FPB A;  3KHY A;  3RSE B;  4RTF D;  1Z05 A;  5BPN A;  3SCX A;  4R5P A;  4DV2 K;  3HO1 A;  3NVK A;  3HT3 A;  3MK6 A;  1JLQ A;  3HK2 A;  2Z1H A;  1OH5 A;  3LM2 A;  2A3Z A;  5AQQ A;  5FDL A;  1MWK A;  4DU3 A;  3THX A;  1B9D A;  4LH5 A;  5CYM A;  4C1N K;  1GOB A;  1HNW K;  2CH6 A;  3CQ8 A;  2HBM A;  3RMD A;  3DMJ A;  1UA1 A;  3D2F B;  5EU7 A;  5KTQ A;  4QS7 A;  2O8F B;  1Q9X A;  2F7T A;  1RTD A;  3KIO A;  3WNG A;  3CCS N;  2HF4 A;  4DU4 A;  2IC3 A;  1VSE A;  4WCE L;  4DF4 A;  3NCI A;  3SAG A;  5JMV A;  2EWS A;  4B8A B;  1IKX A;  3MED A;  4NXN K;  4FWL A;  3ALY A;  1Q82 O;  3TAQ A;  2D0B A;  1OKJ A;  3L6Q A;  4IEE A;  2HHW A;  3ZSO A;  4YY3 K;  1SKS A;  3CMA N;  3QO9 A;  1IJJ A;  3ZT0 A;  4CGF A;  4FJN A;  2CGK A;  4BRI A;  3CQY A;  1N36 K;  1R59 O;  3VQ9 A;  1C0F A;  3MXJ A;  1RT5 A;  4DQR A;  2NZT A;  5AQS A;  4YNQ A;  3NF7 A;  1YTU A;  3DLG A;  2WOM A;  2GUP A;  4ELT A;  2VWJ A;  4JKB A;  1HNZ K;  1JXB A;  3TAB A;  4M3W A;  4ID5 A;  1VSF A;  1T6D A;  1S1W A;  3AV9 A;  3LDO A;  3ZSZ A;  1SKW A;  2RF2 A;  1NNE A;  1S1X A;  3HM8 A;  3ENH A;  4NLB A;  4OKE A;  3ATU A;  3F2K A;  3S3M A;  2XY6 A;  2IGI A;  3K5L A;  3Q7C A;  3VEV A;  2NRH A;  4KH6 A;  4E7L A;  1ZBI A;  3G71 N;  3IAY A;  2UUC K;  3VQ7 A;  3CG7 A;  5AZI A;  1EP4 A;  3QEW A;  2OTL N;  3C6A A;  1NJI O;  3C6H A;  4C1N I;  4UY8 O;  3V9S A;  1S9G A;  1EO1 A;  3D7E O;  4PL7 A;  4YOX A;  2XHB A;  4CEE A;  3NAE A;  1ZC6 A;  2W6L A;  5KGW A;  2P9P A;  1NK8 A;  5C12 A;  5CE3 A;  1J9A A;  1Q7Y O;  1T03 A;  4JAX A;  3O3H A;  1JCE A;  2QM1 A;  5I9E B;  4H5T A;  2UXC K;  2RE2 A;  1LWC A;  4O55 A;  4DV1 K;  1RBU A;  4M3Z A;  4FM0 A;  4F2S A;  4KB0 A;  4XH1 A;  5BPL A;  2XY8 A;  1QHA A;  4CER A;  4CJF A;  3C0B A;  4FVU A;  2A42 A;  1X1P A;  3CIP A;  4A5B A;  5MLC Q;  3T69 A;  4EP5 A;  4GMJ B;  3KD5 E;  1SZ2 A;  4C8N A;  2PAV A;  4CHY A;  2W41 A;  2IVO A;  4QOZ B;  1RBR A;  5KPT A;  4CF0 A;  1OH6 A;  1D9D A;  5C2D A;  5E84 A;  2R7Y A;  3H46 O;  3E01 A;  1QSL A;  4N41 A;  3VQD A;  3UB5 A;  4IO8 A;  1MA9 B;  4JKD A;  2ZWH A;  4FWK A;  4DCH A;  4LFB K;  1NBW A;  4CFC A;  2P9K B;  4X62 K;  1HKB A;  2KQ2 A;  4DV0 K;  1ILY A;  3L2W A;  4X64 K;  1YIT N;  2Q97 A;  3L0Q A;  5CHI A;  4AHC A;  2HVI A;  5AZI B;  3MN5 A;  4CZG A;  3HOS A;  3AO3 A;  4IFY A;  4PUO A;  2GUI A;  3ZEU A;  4CJW A;  4H0V B;  2H3G X;  1BGX T;  3LAN A;  4JLH A;  5AQI A;  5AQT A;  2P9P B;  2AJQ A;  1G99 A;  3IUC A;  2Q2R A;  3J7A P;  1IO2 A;  1YXQ A;  1YJ9 N;  3AAQ A;  3QFU A;  3F9K A;  2KFZ A;  3AVF A;  3TTF A;  1OVY A;  1XC3 A;  2DPN A;  3DXM A;  4CGI A;  4LSL A;  2HOE A;  1L3T A;  3GOI A;  4FJK A;  1TYQ B;  3DLL L;  4KI6 A;  1DT9 A;  3CJA A;  3OYI A;  4FWR A;  1WLJ A;  3WNF A;  2HHU A;  4KHQ A;  5GIP A;  5AFU A;  1LW2 A;  1HNX K;  2O8D A;  1MU2 A;  4CJ5 A;  4CEZ A;  4E89 A;  4CF1 A;  4JI0 K;  5FRO A;  3TAN A;  3DXK B;  4W5N A;  5LMN K;  3HP9 A;  4JKG A;  3VEN A;  4M7Y A;  3DRP A;  3O08 A;  4ISF A;  3VES A;  4DWI A;  5KPR A;  3SMS A;  4CZI A;  1IKY A;  1CZB A;  3CQX A;  4I2P A;  3SV4 A;  3ZET A;  3AA5 X;  2UXB K;  4J2B A;  3CM6 A;  1RGI A;  4FZX C;  3I0S A;  1XHX A;  4HTU A;  3E66 A;  4NYN A;  4FVM A;  4WQ5 A;  4JK9 A;  4ZTJ A;  2NUB A;  5LJV A;  3C95 A;  4I9Q A;  3AO1 A;  3ZEU B;  2P9I B;  3WUH A;  3DLK A;  3FZK A;  3OTO K;  1WBB A;  5CY4 A;  3AA4 A;  3KK3 A;  1OH7 A;  1XHZ A;  3DOL A;  3CM5 A;  2F4V K;  2RHK A;  5HLF A;  4BR2 A;  2P9N B;  5ADX A;  5FPE A;  2IDO A;  1RBT A;  2YKM A;  2YHA A;  1NK7 A;  2FF3 B;  4IJA A;  2KFN A;  4FJJ A;  1K6Y A;  3P39 A;  3B6O A;  3LL3 A;  3B8A X;  3G6E N;  1KRP A;  3DM2 A;  4BY9 C;  2FBX A;  3NBP A;  4MO5 A;  4CHQ A;  3QIO A;  4CFB A;  2OPQ A;  3SAF A;  2FSJ A;  4H8K A;  4JD2 A;  3VGL A;  3A2F A;  2VYP A;  3AVH A;  3SBG A;  1NK4 A;  4FPA A;  4FLY A;  2IIR A;  2F8S A;  1N34 K;  4BDY A;  4NCG A;  4F3O A;  1VQO N;  1P90 A;  4V19 S;  5KQ8 A;  4EP4 A;  3VQ4 A;  4FO0 A;  4CF8 A;  3NFA A;  3P5J A;  3JYT A;  1F21 A;  3KVG A;  4A59 A;  3VN5 A;  5AQL A;  4B3S K;  4BQZ A;  1IV0 A;  2D0P A;  3VER A;  3CJB A;  1YJW N;  5KRS A;  3WQT A;  4OGE A;  2O8B A;  3S9H A;  4I6M B;  1BCO A;  1RBV A;  3OY9 A;  4LSN A;  3ZET B;  3G10 A;  3T19 A;  3AGK A;  5BRD A;  2G8F A;  1DGK N;  1QHT A;  2QXF A;  1J5O A;  3MXI A;  4PA1 A;  3AY9 A;  1L3U A;  2P5O A;  2F9W A;  3FZM A;  4CI6 A;  3OYJ A;  3T1H K;  3N4Q A;  2NRT A;  1TK0 A;  2HBK A;  3L2Q A;  5AQY A;  4M63 C;  3P31 A;  3VPZ A;  3RR8 A;  2E20 A;  3A5O C;  4CZL A;  1YTA A;  5HRN A;  3D2E A;  1GOC A;  2QWP A;  3UIQ A;  3VQA A;  2P9S A;  2QKK A;  5AQJ A;  3P1G A;  3TAE A;  4OVL A;  4DSE A;  1SL1 A;  4FL9 A;  2KLA A;  2QWN A;  3V9W A;  2JLE A;  1W2B M;  2ITG A;  3K5M A;  3VQP A;  3LP2 A;  4G1Q A;  3QEV A;  1RT1 A;  2VG7 A;  4N47 A;  3KD1 E;  4CCH A;  2A1R A;  4NO7 A;  3ASM A;  5H1S Q;  1KFD A;  3MX5 A;  3SPZ A;  4IJN A;  4DV3 K;  3MN9 A;  2HMP A;  1WNS A;  4CZF A;  5M1Q A;  3GDQ A;  1HR0 K;  3DAW A;  4CGG A;  1C6V A;  1HKC A;  1WSE A;  3AGR A;  2NRW A;  3TPQ A;  4JKH A;  4OKJ A;  1RTI A;  4PY5 A;  3K5O A;  4FLU A;  4CVN E;  4AQY K;  4AHS A;  2HW3 A;  1E3M A;  2O8B B;  3HBT A;  2E2Q A;  3WXK A;  1KVB A;  3SK3 A;  4M3R A;  4G9Z A;  3TSU A;  3U6F A;  4GVE A;  4AIL C;  1J53 A;  2Z1I A;  1VRT A;  3UE5 A;  1IKW A;  1RDA A;  4A61 A;  2DFH A;  1QQC A;  3NDK A;  1S3X A;  3LP0 A;  4K42 A;  4NYF A;  1WOQ A;  5CZ2 A;  3IDH A;  2QTD A;  3SUQ A;  1IKV A;  1XNR K;  3RMA A;  3D2E B;  3M8Q A;  3PY8 A;  3P4I A;  4CZK A;  2OAN A;  1HPM A;  4JN4 A;  2P9S B;  2FSN A;  3V1R A;  3ID6 A;  4A2B A;  1NJY A;  3S41 A;  4Z4H A;  4CJR A;  2PY5 A;  1NU0 A;  4O4G A;  4B9L A;  4B3M K;  2Z1J A;  3VQ6 A;  1ASU A;  2UU9 K;  3IG1 A;  3DLE A;  3OW2 M;  4B3T K;  3T7Z A;  4KHP K;  1A5V A;  3AVG A;  1TVR A;  4YDU A;  3V1O A;  1NGJ A;  4B1X B;  4H0Y B;  3PIO L;  3CC7 N;  3TAM A;  1ESV A;  2QWL A;  1RT3 A;  2E6M A;  1TUU A;  2NLX A;  3CCV N;  2OYQ A;  5BR9 A;  1D5A A;  4ELV A;  4OLA A;  2ATQ A;  4ZTF A;  3VGM A;  2O4I A;  5J2N A;  4EHT A;  5DMR A;  3AVB A;  1O1W A;  1TKX A;  5LL6 Z;  3LDL A;  4W5T A;  4JI1 K;  2ASP A;  4ELU A;  3HL8 A;  1OVQ A;  4BRD A;  4H03 B;  2Q1N A;  3OYK A;  4FOI A;  3BF1 A;  5AQV A;  2Q0U A;  4ZHR A;  5BPM A;  4CZH A;  5AZJ A;  2FBY A;  3LP1 A;  3JXU A;  4CJ3 A;  3KK1 A;  4IWV A;  3NMU A;  1BCM A;  5M1N A;  3CPE A;  3RRH A;  2ETJ A;  5J2Q A;  1HYS A;  2DY4 A;  4JKE A;  3QNN A;  4Z4E A;  4RG8 A;  1WAF A;  1NOZ A;  2YHB A;  4QS8 A;  4KRE A;  2DFF A;  3OBY A;  3O4W A;  5AQG A;  3H08 A;  2O8F A;  3SJJ A;  4FWN A;  3CCL N;  1S6Q A;  2VGM A;  4H0P A;  1TV6 A;  3NF9 A;  3CFP A;  3SQ4 A;  4BRE A;  5DM6 L;  4DTJ A;  4GV9 A;  4WFA L;  1U2V A;  4OX9 K;  1TAQ A;  1CXU A;  1HJO A;  3BUZ B;  3P38 A;  5IT9 O;  2QEX N;  1S72 N;  1TKD A;  4IXC A;  3T1A A;  3VEX A;  2ZD1 A;  5AQX A;  4DSJ A;  4IOX A;  3LAK A;  1TL1 A;  5F1X A;  5TKY A;  5FRN A;  3O6W A;  4FWP A;  3VQE A;  4KHS A;  1UOC A;  4FSV A;  4W5Q A;  2X74 A;  3CCU N;  2A41 A;  3LPU A;  4DS4 A;  3I8D A;  3PUF A;  5FRM A;  1YI2 N;  3D45 A;  1ZBL A;  3GG4 A;  4WF9 L;  1TKZ A;  1VQ6 N;  4YOT A;  1HUX A;  2YX6 A;  4Z4I A;  4DTO A;  3KLI A;  1BIS A;  1KTQ A;  3R9P A;  3JS6 A;  1DTT A;  3R3L A;  3MEC A;  1NGA A;  5JVG L;  3EE9 A;  1U45 A;  1QZ5 A;  5AZJ B;  4FJ7 A;  1RDB A;  4CJT A;  4JV5 K;  3SNN A;  2IOC A;  1HPZ A;  5GAE P;  2FBV A;  2QWM A;  3VOV A;  3O9S A;  5GIO A;  2VG6 A;  3AO2 A;  1C1B A;  3A5L C;  3QBX A;  5IWA K;  2QKB A;  2X6S A;  4KH5 A;  3LZJ A;  5JVH L;  2ZGZ A;  1K8K B;  2VQE K;  3CC4 N;  2Q3S A;  4DMN A;  1ITG A;  4K8Z A;  1VQN N;  4AM7 A;  4DTS A;  2QK9 A;  1NGG A;  1U2V B;  1QZ6 A;  3HVT A;  1VQ9 N;  3EZ5 A;  2E2N A;  2PZS A;  5C2F A;  4E7I A;  1BG3 A;  3ULE A;  1DLO A;  2G8V A;  4DU1 A;  1TAU A;  3SQ1 A;  1UWB A;  3SUN A;  4KTZ A;  2QWQ A;  2I7P A;  5ELZ A;  3OYC A;  3EE8 A;  2NRV A;  3BZC A;  3V9Z A;  3SMP A;  2RN2 A;  1NJW A;  5HRS A;  4O5B A;  4CEC A;  4CJK A;  1VQK N;  3U8X A;  4CJ4 A;  3DLB A;  1JCF A;  3WXJ A;  1ZYQ A;  5GAH P;  3OVN A;  2YNG A;  3KWI A;  1BA1 A;  3EEQ A;  1XMO K;  4HTL A;  5K14 A;  5AQM A;  3A8Y A;  1S6P A;  4B1Z A;  4JI7 K;  2GX9 A;  1W0H A;  4YOY A;  2UUA K;  4PKI A;  5JLF A;  1NMD A;  3KLG A;  1D9F A;  3QLH A;  4F9O A;  1WN7 A;  3DJC A;  3SLC A;  2VCP A;  4EHU A;  3HI0 A;  5DM7 L;  2RKI A;  4CEQ A;  3DLH A;  2FBT A;  3U4L A;  5C15 A;  4CJV A;  3QFP A;  1HNI A;  3WT0 A;  1L3V A;  4B9V A;  1JCG A;  2P9K A;  4JKC A;  3AVC A;  4GVM A;  3CHW A;  5AQO A;  3EYZ A;  5AQU A;  3ITH A;  5AQZ A;  4B9T A;  2KTQ A;  3DRS A;  4FW2 A;  3P83 D;  4RW7 A;  3CCE N;  4BDZ A;  4YHH K;  5EY4 A;  1HX1 A;  1JLC A;  4AM6 A;  3HSC A;  3KK7 A;  1YIJ N;  4CIE A;  2YHW A;  2YCH A;  3ZSV A;  3O1B A;  3EKS A;  4CGD A;  1YJN N;  3RVC A;  2HHH K;  3HPO A;  1IBL K;  3VQQ A;  4PKH A;  1QVG M;  4HUF A;  1NK5 A;  1T05 A;  2JWK A;  2KZZ A;  4ISG A;  3H3O B;  1ASV A;  1WAJ A;  1LCU A;  1T7P A;  4FJ5 A;  2BH1 A;  1BOT O;  3ULE B;  4IFV A;  2YNH A;  5FPD A;  4BAC A;  1QS4 A;  4HUE A;  2ASM A;  2CGL A;  1KFS A;  3TSP A;  3AA2 A;  1TYQ A;  2ASO A;  3F5T A;  2HST A;  2E88 A;  5M1O A;  3MAQ A;  1K8A O;  4H5V A;  1SQK A;  3AAR A;  3SQ2 A;  4C8O A;  4JS4 A;  4Q0B A;  4GV6 A;  4DUZ K;  3I8B A;  3VQ5 A;  4AHR A;  4M3U A;  1U48 A;  1LWE A;  3TAG A;  3CYM A;  4CJQ A;  5M1K A;  3OYA A;  3DXK A;  4A62 A;  4JRP A;  5CZ1 A;  3HOT A;  4FJM A;  4ICL A;  1I94 K;  4O0I A;  2UYT A;  2Q36 A;  4JI4 K;  4BVP A;  3T3F A;  3HP6 A;  2OZS A;  3MWT A;  3ZLJ A;  2OPP A;  3AA3 A;  5TKW A;  1SKR A;  4WFB L;  4LY7 A;  3E1Y A;  3MMV A;  1N5Y A;  1NGH A;  2GBZ A;  3R6M A;  3OA9 A;  3WQU A;  3CJ1 A;  4XEI A;  3QML A;  2UXD K;  3U3G A;  3M1F A;  1WBD A;  2P9I A;  2G8I A;  1NLV A;  4ILJ A;  4JI8 K;  1VRU A;  3W3D A;  3WXI A;  4EAH D;  3OYG A;  3ISN C;  1GLJ O;  2YI1 A;  3PV8 A;  3TAF A;  4CBW A;  3K9J A;  3JSM A;  4DFM A;  1YHQ N;  1CLQ A;  2P9N A;  2DTU A;  1GOA A;  1WSJ A;  1VSH A;  3Q7B A;  4E3S A;  1C0M A;  1YVU A;  1NKC A;  2E2O A;  4ILG B;  3AVI A;  2GWK A;  5DK5 A;  1GLF O;  4OJR A;  5JS2 A;  3OYD A;  5GAD P;  4BGA A;  1E4F T;  4GV3 A;  5GAG P;  4X65 K;  1BHL A;  4DR7 K;  1EKE A;  1KAX A;  2NRR A;  3PX6 A;  4IZ9 A;  4B08 A;  1ZBF A;  4BWJ A;  4YOW A;  4FJL A;  4KI4 A;  4FJG A;  1DTQ A;  1I39 A;  2A40 A;  4IDH A;  4BR9 A;  3MCP A;  5HRP A;  5A2Q O;  4FZZ A;  2ITM A;  5HBM A;  3OS0 A;  3AO5 A;  4JI3 K;  3CD6 N;  3C6T A;  4NXM K;  4BRA A;  5FPN A;  2EHG A;  1HKG A;  3ENO A;  3DOK A;  1KXP A;  2NNW A;  1UAX A;  4A2A A;  1NOY A;  4PHT X;  4OPA A;  4I6M A;  1NGD A;  2YHY A;  2ZGY A;  2YHX A;  2IAJ A;  4PWD A;  3WXM B;  1GLL O;  1FK9 A;  5AFU H;  3K58 A;  4K0K K;  1RTJ A;  3VEO A;  4DFJ A;  3J80 O;  3BF3 A;  4F8R A;  5LY3 A;  3OJS A;  4AHV A;  1EET A;  2CH5 A;  1HRH A;  3PX0 A;  2YV0 X;  4FM2 A;  4IG3 A;  3R1X A;  3E9L A;  2D0O A;  4CEB A;  3I56 N;  1HYZ A;  4EIA A;  1ZBH A;  3D6R A;  4I9L A;  3C94 A;  3TWH A;  1T8E A;  4F2R A;  1SUQ A;  4DTU A;  3L3U A;  4CHN A;  2D4W A;  4AF1 A;  1A5X A;  4BG8 A;  4B9Q A;  4JRQ A;  2HHT A;  3AO4 A;  3RMC A;  4DR2 K;  1QTM A;  4BE1 A;  2GEL A;  2J4R A;  2AA4 A;  2I5J A;  4KHW A;  4H5W A;  5AQW A;  3K59 A;  2JGU A;  2BUP A;  3DLR A;  3D0P A;  3H1V X;  5ADX H;  3THY B;  5EVZ A;  4YFU A;  5C10 A;  4CIF A;  2F96 A;  3E9P A;  4R79 A;  4M7X A;  1T44 A;  2Z1G A;  2XO7 A;  4FJH A;  1NGF A;  4FYD A;  3VA3 A;  2FF6 A;  4YOV A;  4CJU A;  1KLM A;  2IS3 A;  2HNY A;  2G8H A;  1M90 O;  1WSF A;  1JL1 A;  4DSL A;  3SUP A;  4EFH A;  4O8U A;  3TAP A;  4FXD A;  1BI4 B;  4WQ4 C;  3VF4 A;  1S1T A;  4YOU A;  1C0G A;  4FJI A;  4I7F A;  1HQU A;  4KKO A;  1C1A A;  1NK0 A;  3LDS A; 
#chains in the Genus database with same CATH homology
 1SKS A;  5KRT A;  4W5T A;  3C6U A;  4M3Z A;  3KJV A;  1B92 A;  3QO9 A;  3HL8 A;  4ELU A;  2FC0 A;  3ZT0 A;  4CGF A;  4FJN A;  4C8K A;  1WSH A;  1I3A A;  4CF9 A;  3VQ9 A;  3MXJ A;  1RT5 A;  4DQR A;  4YNQ A;  3NF7 A;  1NKE A;  3OYK A;  1YTU A;  4OPJ A;  1CXQ A;  3DLG A;  4FK4 A;  3VQB A;  2WOM A;  4ZHR A;  4M3Y A;  4ELT A;  2VWJ A;  1VSL A;  3NGY A;  2FBY A;  3LP1 A;  3MXM A;  4J2D A;  1JXB A;  3IRX A;  3TAB A;  4CJ3 A;  4M3W A;  2HHX A;  1C0U A;  3KK1 A;  1RIL A;  4N5S A;  3NF6 A;  4ID5 A;  4LD0 A;  1EXQ A;  1VSF A;  4QAG A;  3HM9 A;  1BCM A;  1LW0 A;  1S1W A;  1S9E A;  2HB5 A;  4NCA A;  2OA8 A;  3RRH A;  2BGG A;  2ETJ A;  3AV9 A;  3LWL A;  5J2Q A;  3ZSZ A;  1SKW A;  2RF2 A;  1HYS A;  2DY4 A;  4J2A A;  4CEF A;  4B9M A;  1S1X A;  3QNN A;  3LWM A;  4I2Q A;  4RG8 A;  1WAF A;  1NOZ A;  2YHB A;  4Z4E A;  4OKE A;  4KRE A;  2KW4 A;  3ZSX A;  2DFF A;  2IGI A;  4CJL A;  4DFP A;  2XY6 A;  3H08 A;  3K5L A;  3S3M A;  3SJJ A;  2XRI A;  3SYZ A;  5D3G A;  1S6Q A;  1RCH A;  3QEI A;  1TV6 A;  3NF9 A;  3CFP A;  1U47 A;  1BIU A;  4IBN A;  3SQ4 A;  4E7L A;  1RNH A;  1VSJ A;  1HQE A;  4DTJ A;  1ZBI A;  3K2P A;  3L8B A;  1BQN A;  1BI4 A;  3IAY A;  1TAQ A;  1CXU A;  3VQ7 A;  4KHN A;  2HHV A;  3SV3 A;  3B6P A;  3CG7 A;  1EP4 A;  1TKD A;  3QEW A;  3ZCM A;  1NK9 A;  1JLG A;  3T1A A;  1B9F A;  2ZD1 A;  4KV8 A;  4DSJ A;  4MFB A;  4IG0 A;  3V9S A;  1S9G A;  3LAK A;  1JLA A;  1TL1 A;  4N56 A;  2XHB A;  4OLB A;  1BL3 A;  4CEE A;  5FRN A;  3NAE A;  3VQE A;  1JKH A;  4KHS A;  1UOC A;  5KGW A;  1NK8 A;  4W5Q A;  2HNZ A;  1J9A A;  3NH1 A;  2X74 A;  4KRF A;  1C0T A;  4HCC A;  3KKS A;  1T03 A;  3PO4 A;  3LPU A;  3AVM A;  1RT7 A;  4DS4 A;  3O3H A;  3I8D A;  1HJR A;  2A1S A;  3PUF A;  5FRM A;  3D45 A;  1ZBL A;  1FKO A;  1KVC A;  1TKZ A;  3TAR A;  2OPS A;  1LWC A;  1SL0 A;  4O55 A;  4Z4I A;  1RBU A;  1TGO A;  3I0R A;  4FJ9 A;  4CHO A;  4DTO A;  3QER A;  3KLI A;  1BIS A;  1KTQ A;  4FM0 A;  4F2S A;  4KB0 A;  1DTT A;  4FJM A;  2VWK A;  2XY8 A;  1IG9 A;  4CER A;  3HJF A;  3MEC A;  4DFK A;  1U45 A;  4CJF A;  5E41 A;  1X1P A;  4FJ7 A;  1RDB A;  4CJT A;  1RT4 A;  3IS9 A;  4EP5 A;  3SNN A;  4GMJ B;  3QEP A;  2IOC A;  1HPZ A;  4DTP A;  3LP3 A;  3KD5 E;  2FBV A;  4C8N A;  1LAV A;  1REV A;  3AVK A;  5J2M A;  4DSK A;  4IDK A;  3KLE A;  4CHY A;  3ULD A;  2VG6 A;  3AO2 A;  4QOZ B;  1RBR A;  5KI6 A;  1C1B A;  2QKB A;  4CF0 A;  4CES A;  2X6S A;  1R0A A;  1D8Y A;  1D9D A;  2EX3 A;  2R7Y A;  4RW9 A;  1IH7 A;  3E01 A;  4ID1 A;  3LZJ A;  1QE1 A;  3WNE A;  1NK6 A;  1QSL A;  1J54 A;  3VQD A;  4N41 A;  2Q3S A;  5J2P A;  4DMN A;  5KGX A;  3S3N A;  1ITG A;  4K8Z A;  4WE1 A;  5J1E A;  4CE9 A;  4OGC A;  4M41 A;  1VSK A;  4CFC A;  3SZ2 A;  1FKP A;  2Y1J A;  5HP1 A;  4DTS A;  2QK9 A;  1ZBU A;  4DG1 A;  4DQI A;  2KQ2 A;  4KO0 A;  5I42 A;  2D0A A;  5C42 A;  3L2W A;  3NHG A;  4C8M A;  1HMV A;  3HVT A;  3M8P A;  4CEO A;  4FCY A;  3EZ5 A;  4AHC A;  2HVI A;  3HPH A;  3L2R A;  5CYQ A;  2PZS A;  3V9X A;  3AO3 A;  2YNI A;  4E7I A;  1XC9 A;  3ZT1 A;  1DLO A;  3DYA A;  4FLW A;  4DU1 A;  4IFY A;  2G8V A;  4J2E A;  3SQ1 A;  4PUO A;  1TAU A;  2GUI A;  4B9U A;  4E0D A;  4CJW A;  1UWB A;  3QET A;  3SUN A;  2G8U A;  4KTZ A;  2HHS A;  2Y1I A;  1BGX T;  1Y97 A;  3OYC A;  3LAN A;  4JLH A;  4QCL A;  4Z4G A;  3ZSY A;  2AJQ A;  3V9Z A;  4L8R B;  2RN2 A;  1NJW A;  5HRS A;  1IO2 A;  2D5R A;  4O5B A;  2OPR A;  4CEC A;  4CJK A;  4FK2 A;  2F8T A;  3O4Q A;  2E4L A;  4CJ4 A;  3DLB A;  1Z25 A;  4FLZ A;  3F9K A;  2KFZ A;  1ZYQ A;  3AVF A;  3CFO A;  3NH0 A;  4CFD A;  2E6L A;  3OVN A;  2HMI A;  2YNG A;  2X78 A;  3VQ8 A;  4CGI A;  4K8X A;  4LSL A;  5K14 A;  1JL2 A;  4TSX A;  1L3T A;  3RWU A;  1A5W A;  1S6P A;  1WSI A;  1W0H A;  4FJK A;  3M8R A;  1FXX A;  4KI6 A;  3QES A;  3PO5 A;  3OYI A;  3KLG A;  1D9F A;  3QLH A;  1WLJ A;  1WN7 A;  3OYH A;  1UA0 A;  3WNF A;  2HHU A;  4DTN A;  2RKI A;  2XY7 A;  4CEQ A;  1VSD A;  3DLH A;  4KHQ A;  2FBT A;  4E7J A;  1S1V A;  1JLE A;  3CFR A;  4DQP A;  2DFE A;  4CJV A;  1YT3 A;  3ZSW A;  2WON A;  1LW2 A;  4F3T A;  2O4G A;  4ELV A;  1X9W A;  1HNI A;  1L3V A;  1MU2 A;  4B9V A;  4DTX A;  1KVA A;  3NH2 A;  4CJ5 A;  3AVC A;  4CEZ A;  4E1M A;  4GVM A;  4CHP A;  3NF8 A;  4FW1 A;  4CF1 A;  4E89 A;  3EYZ A;  3ITH A;  4DLE A;  4CHZ A;  5FRO A;  3DRS A;  4FW2 A;  4B9T A;  3TAN A;  2KTQ A;  3AVA A;  3P83 D;  4RW7 A;  4W5N A;  4KHY A;  4BDZ A;  3HP9 A;  4N76 A;  1X9M A;  1JLC A;  3O3G A;  4FJ8 A;  3DRP A;  1VSM A;  4CIE A;  1C1C A;  4Q5V A;  4BE2 A;  3V81 A;  3ZSV A;  4DWI A;  5C25 A;  4CGD A;  3RRG A;  4FK0 A;  2KZM A;  1IKY A;  4E7H A;  1CZB A;  4I2P A;  3NE6 A;  3HPO A;  3SV4 A;  3VQQ A;  3AA5 X;  4HUF A;  3NGZ A;  4AH9 A;  3OS2 A;  1NK5 A;  1T05 A;  3CM6 A;  4J2B A;  1L3S A;  4FZX C;  1U04 A;  1XHX A;  3I0S A;  3QIP A;  2KZZ A;  4HTU A;  1ASV A;  1TKT A;  1WAJ A;  3HXM A;  2P5G A;  1RDD A;  4NYN A;  4FVM A;  3F73 A;  4ZTJ A;  1T7P A;  2NUB A;  4B9N A;  4FM1 A;  4FJ5 A;  3C95 A;  2GV9 A;  3LAM A;  4I9Q A;  1TK8 A;  4IFV A;  1TK5 A;  3AO1 A;  3OYM A;  1QSY A;  1U4B A;  2YNH A;  3DLK A;  4BAC A;  1QS4 A;  4HUE A;  5CY4 A;  3AA4 A;  4FLT A;  4M3X A;  4M45 A;  1Q8I A;  1KFS A;  4Y1D A;  3AA2 A;  4CEA A;  3KK3 A;  5HRR A;  1XHZ A;  3DOL A;  1HYV A;  4KB1 A;  4IKF A;  3CM5 A;  4EZ9 A;  4CJS A;  3QIN A;  5HLF A;  1S1U A;  4HVJ A;  3MAQ A;  3V1Q A;  4XIU A;  3OYN A;  3SQ2 A;  4BDP A;  2IDO A;  1RBT A;  2YKM A;  1NKB A;  4C8O A;  2YHA A;  4KPY A;  1NK7 A;  4JS4 A;  2BE2 A;  4Q0B A;  1BIZ A;  3AVL A;  4RW8 A;  1RTH A;  1N6Q A;  2KFN A;  4KTW A;  4O0J A;  4B8C A;  3VQ5 A;  1RDC A;  4AHR A;  4FJJ A;  1K6Y A;  1RT2 A;  3B6O A;  1LAW A;  1G15 A;  3ZSQ A;  4CK1 A;  3S3O A;  4DQS A;  1U48 A;  4M3U A;  2OZM A;  4Z4F A;  1LWE A;  3TAG A;  1KRP A;  3QEX A;  3G0Z A;  3CYM A;  3DM2 A;  1RT6 A;  3ZSO A;  4CJQ A;  3OYA A;  2FBX A;  4JRP A;  5CZ1 A;  4GW6 A;  3HVR A;  4AHT A;  3NBP A;  3VA0 A;  4CHQ A;  3QIO A;  3ZT3 A;  4CFB A;  3EY1 A;  2OPQ A;  2P51 A;  4ICL A;  3SI6 A;  1NJZ A;  4O0I A;  4H8K A;  3L2U A;  3A2F A;  3T3F A;  3AVH A;  3HP6 A;  1NK4 A;  2OZS A;  4FLY A;  5SZT A;  2OPP A;  3AA3 A;  2F8S A;  1SKR A;  1EX4 A;  4NCG A;  4RW4 A;  4BDY A;  4F3O A;  4LY7 A;  1BQM A;  4EP4 A;  3VQ4 A;  4CF8 A;  3NFA A;  1N5Y A;  4LH4 A;  4E7K A;  4M42 A;  3P5J A;  3U3Y A;  2GBZ A;  3AVJ A;  3JYT A;  1WSG A;  1F21 A;  3VN5 A;  1U49 A;  5JS1 A;  4F4K A;  2HHQ A;  3LDS A;  3BDP A;  4DTM A;  1Q9Y A;  3U3G A;  1KSP A;  5KRS A;  4CK2 A;  3AVN A;  3HPG A;  4OGE A;  4BWM A;  3K5N A;  3S9H A;  1BCO A;  2G8I A;  1VK0 A;  1X9S A;  2YKN A;  1RBV A;  1VRU A;  3OY9 A;  4HUG A;  4LSN A;  3V6D A;  1NJX A;  3LPT A;  1KLN A;  3G10 A;  3OYG A;  3ISN C;  3WNH A;  3OYB A;  3TI0 A;  3T19 A;  3ZT2 A;  3PV8 A;  3TAF A;  2G8F A;  4UQG A;  2W42 A;  2PYL A;  1QHT A;  4FJX A;  2QXF A;  4KFB A;  3JSM A;  4JS5 A;  4PA1 A;  4DFM A;  3MXI A;  2HND A;  1J5O A;  4KAZ A;  1L3U A;  4M3T A;  4CFA A;  1CLQ A;  2P5O A;  4CJE A;  2DTU A;  1GOA A;  1WSJ A;  1VSH A;  3K57 A;  3V9U A;  3PX4 A;  3OYJ A;  4E3S A;  1C0M A;  1YVU A;  2B4J A;  1NKC A;  3AVI A;  1TK0 A;  3NGI A;  4EZ6 A;  3OYF A;  5DK5 A;  3L2Q A;  2P1J A;  4H4O A;  5HRO A;  4HCB A;  1ASW A;  4OJR A;  5JS2 A;  5T7B A;  3OYD A;  3RR8 A;  4W5R A;  1SL2 A;  1YTA A;  1HNV A;  3L3V A;  1BHL A;  5HRN A;  1EKE A;  1GOC A;  4Z4C A;  1S5J A;  5C24 A;  3UIQ A;  3VQA A;  3KLH A;  4B08 A;  4DQQ A;  1ZBF A;  4BWJ A;  3PX6 A;  2QKK A;  2G8K A;  4FJG A;  4FJL A;  4KI4 A;  1Z26 A;  3P1G A;  1DTQ A;  3TAE A;  1I39 A;  2BDP A;  4OVL A;  4DSE A;  1SL1 A;  4CGH A;  3V9W A;  3HYF A;  5HRP A;  2JLE A;  3LAL A;  3LZI A;  4RW6 A;  1CZ9 A;  3SPY A;  1JLF A;  4DSI A;  2ITG A;  4FZZ A;  1JXE A;  5HBM A;  3K5M A;  3OS0 A;  3AO5 A;  3RTV A;  3VQP A;  3ZSR A;  3LP2 A;  4G1Q A;  3C6T A;  3QEV A;  1RT1 A;  2VG7 A;  4N47 A;  2EHG A;  3KD1 E;  4CCH A;  4DF8 A;  3MEG A;  2A1R A;  4FLX A;  2HVH A;  3DOK A;  2ZE2 A;  3ASM A;  4KTQ A;  1KFD A;  1KCF A;  1UAX A;  3SPZ A;  4CIG A;  1NOY A;  1QSS A;  2PYJ A;  2LSN A;  4H4M A;  4CED A;  3O4N A;  3THV A;  4PQU A;  3KKR A;  3KK2 A;  1WNS A;  4Z0U A;  2IAJ A;  4PWD A;  1FK9 A;  4CF2 A;  3RR7 A;  1VSI A;  4CGG A;  1C6V A;  3K58 A;  1WSE A;  1RTJ A;  4OKJ A;  4B3O A;  1L5U A;  1RTI A;  4DFJ A;  4PY5 A;  3K5O A;  1W9H A;  4OKK A;  4HHT A;  4F8R A;  3SQ0 A;  3OJU A;  3DRR A;  3OJS A;  4FLU A;  4AHS A;  4AHV A;  2HW3 A;  1EET A;  4DSF A;  4OPK A;  1HRH A;  4CJP A;  3PX0 A;  1RBS A;  3ZT4 A;  2YV0 X;  3KLF A;  1XI1 A;  1KVB A;  3SUO A;  4M3R A;  4FM2 A;  4IG3 A;  4CGJ A;  4E1N A;  4BE0 A;  4DLG A;  4DTR A;  3U6F A;  4CEB A;  4AIL C;  2ZQB A;  1HYZ A;  4FZY A;  1O1W A;  1ZBH A;  1J53 A;  2Z1I A;  1VRT A;  2YNF A;  4CK3 A;  1IKW A;  4MQ3 A;  4I9L A;  3C94 A;  1SV5 A;  3TWH A;  1T8E A;  4F2R A;  1SUQ A;  4DTU A;  5SWM A;  1RDA A;  3V4I A;  3L3U A;  2B6A A;  2DFH A;  4AHU A;  4CHN A;  1QQC A;  3NDK A;  1JLB A;  3LP0 A;  4NYF A;  3L2V A;  3SCX A;  1A5X A;  5CZ2 A;  4JRQ A;  4R5P A;  2HHT A;  3AO4 A;  3HST B;  3SUQ A;  1IKV A;  3RMC A;  1QTM A;  3HO1 A;  4BE1 A;  3HT3 A;  3RMA A;  3M8Q A;  3MEE A;  3PY8 A;  1JLQ A;  3HK2 A;  2I5J A;  4KHW A;  2Z1H A;  3V1R A;  3K59 A;  5FDL A;  1LWF A;  1NJY A;  1LV5 A;  4CJR A;  4Z4H A;  4DU3 A;  2PY5 A;  5I3U A;  2JGU A;  2XY5 A;  3TR8 A;  3DLR A;  4O4G A;  3D0P A;  4NCB A;  2RPI A;  2X6N A;  1B9D A;  4LH5 A;  2B5J A;  5CYM A;  4B9L A;  1GOB A;  4YFU A;  3CQ8 A;  4CIF A;  2Z1J A;  4W5O A;  2F96 A;  3VQ6 A;  1ASU A;  3KTQ A;  3O3F A;  1XWL A;  3IG1 A;  3RMD A;  3DLE A;  3DMJ A;  4O44 A;  2Z1G A;  2XO7 A;  1UA1 A;  4FJH A;  5EU7 A;  4FYD A;  5KTQ A;  3VA3 A;  4FLV A;  3RMB A;  3OYE A;  4CJU A;  1Q9X A;  4KHU A;  1KLM A;  2IS3 A;  2HNY A;  2G8H A;  2G8W A;  1A5V A;  3AVG A;  1TVR A;  3KIO A;  3V1O A;  2VG5 A;  3WNG A;  3OS1 A;  1RTD A;  1WSF A;  1JL1 A;  4DSL A;  4DU4 A;  3M8S A;  3SUP A;  3TAM A;  4Y1C A;  2IC3 A;  1VSE A;  3TAP A;  1RT3 A;  4DF4 A;  2E6M A;  3NCI A;  4FXD A;  1BI4 B;  4E19 A;  4B8A B;  2OYQ A;  3FFI A;  3VQC A;  1IKX A;  4C8L A;  1S1T A;  3MED A;  4B9S A;  4DS5 A;  3ALY A;  2BAN A;  2D0C A;  4FJI A;  4I7F A;  1HQU A;  1D5A A;  2D0B A;  4KKO A;  2ATQ A;  3OYL A;  3QNO A;  3TAQ A;  1C1A A;  4ZTF A;  3BGR A;  4OLA A;  2O4I A;  5J2N A;  1NK0 A;  5DMR A;  2HHW A;  3AVB A;  1TL3 A;  3DI6 A;  1TKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...