3WNHA

Cyclic hexapeptide pkzdnv in complex with hiv-1 integrase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
137
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/peptide
molecule keywords Gag-Pol polyprotein
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
total genus 48
structure length 137
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wnhA00
3ISNC 4CFCA 4DU1A 2KW4A 1VRTA 3L2RA 3ITHA 5HP1A 2R7YA 3ZSQA 1TK0A 2I5JA 1LAWA 4Z4GA 1S6QA 4J2EA 1QS4A 2ZD1A 4EP4A 4EZ9A 4F3OA 3K2PA 4CCHA 1I39A 3NCIA 3WNEA 4FJ5A 4CHNA 2Y1JA 5KTQA 1KTQA 3F73A 4FZZA 2YKMA 3QNNA 1JXEA 2IOCA 4LH5A 5CY4A 2OPQA 5KRTA 1BCMA 1X9SA 3SCXA 2G8FA 3ALYA 1A5WA 1RBSA 4FM0A 4DS4A 3AO2A 3TAQA 1FKPA 2G8UA 3ZSZA 4W5NA 1FKOA 3WNFA 4DQSA 4W5OA 1U04A 1WSGA 4Q0BA 4DSEA 3D45A 4C8KA 2G8IA 4CEFA 3VQDA 3CFPA 3NBPA 2BANA 3QETA 1UOCA 2Z1IA 3IG1A 1RTIA 4UQGA 2D0CA 4AHTA 4O0JA 3DYAA 3OYEA 3OYLA 3CM6A 3QEXA 3PUFA 3P83D 2OZSA 1BQNA 2QKBA 5C25A 4ELUA 3JYTA 4FJ9A 3NE6A 4E3SA 1JLGA 1RBVA 2BE2A 3SPZA 2BDPA 4NCBA 3MXMA 4B8CA 3NF7A 1YTAA 1TV6A 2JLEA 4Q5VA 3ULDA 1U48A 3MEDA 3ZSVA 4KI4A 2D5RA 4CJFA 4CJEA 3QEIA 4OLAA 4CGGA 4F2SA 3VQ8A 2A1RA 4CJSA 2G8VA 3AVLA 4CGJA 1LW2A 3QIPA 4RG8A 3HP6A 4JRPA 2HHQA 1RCHA 4CJ4A 5J1EA 2W42A 4DG1A 1WN7A 4B9LA 4B9SA 4DQIA 2PYJA 3LPTA 3OJSA 1NKEA 3OYFA 3MXJA 3CFOA 3HVRA 1XHXA 2DFFA 1IH7A 4HUEA 3RMAA 2O4GA 4E89A 1O1WA 3PX6A 4DFMA 1NK4A 4BDPA 4ELTA 4CJVA 2OPSA 1NJWA 4CFAA 1NOZA 3SQ2A 3SJJA 4M41A 3NF6A 4DTNA 2KQ2A 3HXMA 3UIQA 4FK4A 2YV0X 4CEZA 4DQRA 2ZQBA 1U4BA 3O4QA 1NK9A 4FVMA 1SKRA 4CIGA 1EX4A 1LV5A 3EYZA 3MECA 2DTUA 4TSXA 4M45A 3ZT4A 3K5LA 4DTXA 1EP4A 1Y97A 3KIOA 1QSSA 4Z4EA 2HW3A 3OS0A 4OJRA 1QSYA 3TARA 3KLEA 3NH0A 1VSJA 1Q9XA 4N5SA 4AHUA 2G8KA 1HPZA 3CG7A 2OA8A 4IKFA 3NGYA 1BI4A 1TKXA 2XY8A 3T3FA 1Q8IA 4CK3A 4DLEA 3SV3A 3HM9A 2RPIA 2G8HA 3MEEA 1TAUA 1HJRA 3OYBA 3RMDA 3FFIA 1IKVA 3I0SA 3VQAA 3SV4A 1KRPA 4CJPA 4FM2A 4FW2A 1BQMA 4DQQA 4MFBA 3L3VA 2EX3A 1TVRA 5FDLA 4AHSA 4M3RA 4CHZA 4ELVA 4FJLA 1RILA 2AJQA 4IG3A 2WONA 3DI6A 4DSLA 2YNHA 1L3TA 4FZXC 1TAQA 3DRPA 4AHRA 5JS2A 5HROA 3HL8A 4M3WA 3OYDA 4E1NA 1CXQA 1SUQA 3LWMA 4M3UA 3VA3A 2P51A 1S9GA 1B9DA 4KTZA 3RMBA 2HB5A 4FJJA 4HVJA 1NJZA 2NUBA 5CYQA 4E7IA 3O3HA 1XHZA 4J2AA 4KRFA 4O5BA 3ZT1A 4B9VA 3KD5E 3NH2A 4F8RA 4CJ5A 3L2UA 3DLBA 3V1RA 2PZSA 4OVLA 1W9HA 1NK7A 1JLAA 3V9ZA 2QKKA 3O4NA 1SL2A 1QTMA 1C1AA 2HNZA 4FZYA 3NF8A 4R5PA 4CFDA 1VSHA 3T19A 4I9QA 4IG0A 3OYHA 3HP9A 3KJVA 1RTDA 4C8NA 4N47A 1F21A 1RT2A 4CEDA 3KK3A 5FRMA 4LSNA 4DU4A 3HO1A 4I2QA 4C8OA 4QCLA 4NCGA 1WLJA 3DLRA 3AVHA 1NJYA 2PY5A 1GOCA 2LSNA 3HT3A 4H4OA 1B92A 2HHWA 3PV8A 4HCBA 3O3FA 4KHNA 1DTTA 1U45A 1K6YA 1C1CA 3DLGA 5CYMA 2Z1GA 4E7LA 4CF9A 2P1JA 5DMRA 4FLWA 2G8WA 4QAGA 3AVMA 4PQUA 3C95A 1RT4A 4IFVA 1J54A 1QHTA 3AVIA 1D9DA 3SI6A 1D5AA 3VN5A 3OS2A 3KLIA 4CFBA 4DS5A 1SL1A 3BDPA 1C6VA 1RT1A 4FLTA 3K57A 4RW7A 1ASVA 3WNHA 2OYQA 3G10A 3AV9A 4RW4A 2KFNA 4PY5A 1S9EA 3TANA 1RDDA 3CQ8A 3AVNA 1LW0A 3HSTB 1T03A 1IG9A 3SQ4A 2VG6A 3U3GA 4B08A 3M8RA 4B9UA 2ITGA 3AVBA 2JGUA 4DFKA 2X74A 3AA3A 4CIFA 3ZSWA 1KFSA 3ASMA 3V1OA 3QLHA 4CEEA 4CJTA 4NYFA 1B9FA 1NOYA 3EZ5A 4IFYA 1A5XA 4OPJA 3OS1A 3AO1A 3TAEA 4K8ZA 4Y1DA 3S3MA 1U47A 3KLGA 4CHPA 3OYIA 2X78A 4RW6A 4RW8A 3F9KA 4FJGA 1VSDA 2GV9A 2WOMA 1RDBA 4K8XA 3AA5X 4KI6A 3EY1A 1Z25A 5J2NA 5JS1A 5J2PA 1SL0A 4DTPA 3LZJA 4DSKA 3C6TA 4E0DA 1BIUA 2YHBA 3DMJA 1C0UA 1YTUA 4FJ7A 3KKSA 4CK2A 4CEAA 1KCFA 1QQCA 3BGRA 3VQBA 4F2RA 4BE1A 3PO5A 3HPHA 2VWKA 3QEWA 2XY7A 4BDZA 3MXIA 2KZZA 3LPUA 5J2MA 1S1TA 2BGGA 4B9NA 2FC0A 4KTWA 1S1VA 3OYCA 3OYKA 4O44A 2XY6A 4CJUA 3KK1A 4DSFA 3V9XA 3VQ5A 3OYAA 4O0IA 3RR8A 4OLBA 1RTJA 1EETA 1JLEA 2IDOA 3A2FA 1KVCA 3IS9A 3TAGA 1HYSA 4CF2A 1JLFA 2F96A 4DFJA 3ZSRA 2EHGA 3U6FA 3QEVA 4FK2A 4OPKA 3MAQA 4Z4FA 4FLVA 4HUGA 3PO4A 1WSJA 4OKJA 3LP0A 3AVAA 4J2BA 3L2QA 3OJUA 5CZ1A 3E01A 4M42A 2VWJA 4CK1A 3CYMA 4AHCA 3SUQA 1GOBA 4KFBA 3AVJA 3P5JA 4JS5A 5I3UA 1BIZA 4I9LA 1J53A 1ASUA 4RW9A 1TGOA 4YNQA 3KLFA 4BDYA 2D0AA 5KGXA 4E7JA 1A5VA 2P5OA 3V1QA 4DTSA 1TKZA 4M3YA 1QSLA 1XI1A 2P5GA 4DWIA 1UA0A 2YNFA 4B9TA 3RWUA 4DTRA 2Q3SA 3AO4A 3LALA 1VRUA 4GMJB 3VQPA 1C1BA 1DTQA 5HRPA 3QESA 5I42A 3TWHA 1N6QA 3KD1E 4HCCA 1CXUA 4OKEA 3SQ0A 5KI6A 1S1XA 1RDAA 1SKSA 2VG5A 1Z26A 4CJRA 3L2WA 3NFAA 4DTOA 1T05A 1JLCA 3OYJA 1UAXA 3KK2A 2D0BA 4KKOA 4CEBA 1ASWA 4Y1CA 4FLXA 4DTJA 1REVA 1SV5A 3LP3A 3AVCA 4CF0A 1EXQA 3RRHA 2XHBA 4CECA 4KHWA 1KVBA 5KRSA 1XC9A 1KSPA 1S5JA 2GBZA 1NJXA 4OGCA 1RT3A 4LH4A 4FCYA 4W5TA 1WSHA 1KLNA 2HMIA 2HHUA 3ZT2A 3LAKA 3RRGA 4PA1A 2OZMA 5HBMA 4CJKA 1QE1A 4Z4CA 1S6PA 3TABA 5C24A 3AA4A 5HRNA 3AVKA 2KZMA 1X1PA 1TL1A 1VK0A 4IDKA 2A1SA 1MU2A 4I2PA 3ZSOA 3RTVA 1LWCA 1L3VA 2VG7A 4CIEA 4KAZA 4FJNA 2IC3A 2IS3A 4LY7A 1HMVA 1N5YA 5HLFA 5SWMA 3ZCMA 3QNOA 1UA1A 3PX4A 3DRRA 1WNSA 1KLMA 4N76A 1IO2A 5D3GA 4FXDA 1ZBIA 4BACA 4F3TA 3ZT0A 4CJQA 3D0PA 4E7HA 1IKXA 1ZBUA 3B6OA 3AO5A 3AA2A 4E19A 3AO3A 4OKKA 3DLEA 4EP5A 5HRSA 1VSLA 3L3UA 4M3TA 1SKWA 1LWFA 1RT5A 4FLUA 3VA0A 4DLGA 2QK9A 4W5RA 3V9UA 4KHSA 1ZBLA 4DTUA 3V9WA 1JLBA 1FK9A 3C94A 3MEGA 3SNNA 3I8DA 1TL3A 2RKIA 4BWMA 1ZYQA 2RF2A 1ZBFA 1JLQA 2HNYA 1JXBA 2ATQA 4ID1A 3TR8A 3HYFA 4CF1A 2E6MA 4CHYA 4W5QA 1NKCA 2HHVA 1TK5A 1I3AA 1YT3A 3M8QA 4H8KA 3ZSYA 4OGEA 5EU7A 3LDSA 3SZ2A 4B9MA 1JKHA 4DQPA 5FRNA 3VQ9A 2F8TA 4CE9A 2KTQA 4B3OA 5E41A 3K5MA 4FJXA 3SUNA 1L3SA 3SUPA 1ITGA 4FJ8A 3IAYA 3S9HA 3LAMA 4ID5A 5J2QA 3LP2A 1X9WA 3KTQA 2DY4A 3DLHA 4AH9A 4HUFA 4B8AB 1WSEA 3S3NA 1DLOA 4JLHA 4BWJA 1RT6A 4O55A 1L5UA 3AVGA 4DTMA 1G15A 1JL2A 3DOKA 3TAFA 3QIOA 3THVA 1TKDA 1NK0A 1S1WA 4F4KA 4NYNA 2O4IA 4N56A 1HQUA 3H08A 5HRRA 1HRHA 3NGIA 3G0ZA 4Z4HA 4KREA 1D9FA 3NDKA 4PUOA 3HPGA 1HNVA 3M8SA 4KB1A 1EKEA 4GW6A 1RTHA 3NHGA 3B6PA 4I7FA 3V6DA 4CGDA 3OVNA 1CZBA 3ZSXA 1X9MA 1YVUA 2B4JA 2IGIA 4FJHA 4CHOA 3DM2A 3QINA 3RMCA 3LP1A 4LD0A 1T7PA 3HK2A 4KHYA 4DMNA 4CESA 1HNIA 4JRQA 1BGXT 4FW1A 2DFHA 1WSFA 3VQCA 4XIUA 4ICLA 3ZT3A 4AILC 4CEOA 3O3GA 4YFUA 4DU3A 1NK6A 2YNGA 4CGHA 4C8MA 1C0TA 4KO0A 4JS4A 4BE0A 5KGWA 4CEQA 4DSIA 4N41A 1T8EA 2PYLA 4DF8A 1NK8A 2X6NA 2GUIA 3SYZA 3AVFA 1Q9YA 2HVIA 3PX0A 4PWDA 1VSFA 2KFZA 2Z1HA 1C0MA 4ZHRA 4GVMA 2XRIA 4H4MA 4G1QA 4CGFA 1BHLA 3OY9A 3DLKA 4M3ZA 4HTUA 3LWLA 4O4GA 4EZ6A 4KHQA 3PY8A 3RR7A 3NGZA 4CJWA 4HHTA 2E6LA 3IRXA 1WSIA 1RNHA 3K5OA 3DOLA 1CZ9A 2HHSA 3T1AA 4BE2A 3KKRA 3M8PA 5C42A 3TI0A 1D8YA 3TAMA 1J9AA 4CF8A 2YKNA 1JL1A 3VQQA 1VSEA 4C8LA 3VQ6A 3VQ4A 3QO9A 3V9SA 2F8SA 4ZTFA 2FBTA 4L8RB 1CLQA 1UWBA 1ZBHA 1BL3A 3OYGA 1VSKA 4FJMA 2XO7A 4QOZB 2E4LA 2OPPA 5CZ2A 2OPRA 4ZTJA 4M3XA 1W0HA 2FBVA 3SPYA 1WAJA 1FXXA 5DK5A 1RDCA 3OYMA 4DF4A 2DFEA 2HVHA 1L3UA 4KHUA 3CFRA 2HHTA 4KV8A 3I0RA 3L2VA 3VQ7A 3HJFA 1BISA 5K14A 4CHQA 2Y1IA 2QXFA 2X6SA 2HNDA 3NH1A 3QERA 4FJIA 4IBNA 3P1GA 3K59A 1IKYA 4LSLA 3NAEA 4FLZA 4FJKA 1BCOA 1LWEA 1GOAA 5FROA 2XY5A 3CM5A 1BI4B 4DFPA 1TK8A 4J2DA 2YNIA 4CGIA 2B6AA 4WE1A 4CJ3A 1J5OA 1KFDA 4FYDA 3V4IA 1TKTA 3OYNA 2Z1JA 1XWLA 4KPYA 3L8BA 1LAVA 1HYVA 4CJLA 4MQ3A 2YHAA 3JSMA 1RBTA 1HQEA 3LZIA 3S3OA 2IAJA 3TAPA 1U49A 1NKBA 1RBUA 2HHXA 3NF9A 4E1MA 3HPOA 3K58A 1HYZA 4E7KA 4NCAA 1S1UA 3WNGA 5SZTA 3K5NA 3SQ1A 2RN2A 3QEPA 1RT7A 1VSIA 4CERA 3VQEA 1RBRA 3LANA 4FLYA 4DSJA 2ETJA 2ZE2A 1IKWA 3HVTA 2FBXA 3KLHA 1R0AA 1NK5A 4KB0A 1VSMA 5T7BA 1KVAA 4Z0UA 4FK0A 3V81A 1WAFA 2B5JA 2FBYA 3C6UA 3SUOA 4KTQA 3DRSA 4Z4IA 4FM1A 3U3YA 4AHVA
chains in the Genus database with same CATH superfamily
3ISNC 4CFCA 1D4XA 1VQMN 3ITHA 5HP1A 3ZSQA 3O6WA 4FOIA 4Z4GA 1QS4A 4EZ9A 3K2PA 2ASOA 3R9PA 1HKBA 4DR5K 1KXPA 2YKMA 1BDGA 1JXEA 5MLCQ 4YHHK 2OTJN 3SJHA 1RBSA 2HSTA 4BREA 3AO2A 4FWMA 3WNFA 4DQSA 3J80O 3QETA 2Z1IA 1L3SA 1RTIA 4UQGA 3OYLA 1NGHA 3P83D 3PUFA 5C25A 4U7BA 3NE6A 2BE2A 3MXMA 3N4PA 2JLEA 3CMEN 2BUPA 3WQUA 4DKWA 1VQ8N 4CZIA 4F2SA 2HHQA 1LW2A 2GX9A 5J1EA 1N33K 1NGGA 4B9SA 4JEPA 5AZIB 3OYFA 3CFOA 1XHXA 2DFFA 1IH7A 1Q82O 3VENA 4B1ZA 4YORA 3SQ2A 1NOZA 4M41A 1DT9A 2RE2A 3HI0A 4CEZA 4DQRA 3A5NC 5C2FA 1N34K 2DTUA 4KHPK 3VEVA 3K5LA 1QSSA 4BRNA 4Z4EA 1HNWK 3OS0A 1QSYA 2O8FA 3NH0A 1VSJA 1HPZA 3CG7A 5CE3A 1BI4A 3A5MC 2XY8A 1Q8IA 2GTDA 4CK3A 4DLEA 3CI5A 2UXBK 1XQSC 3OYBA 1GLFO 1BQMA 2EX3A 2ZGZA 4BR7A 5FDLA 4ISEA 4ELVA 3FLCO 4H5NA 4DSLA 1QVGM 1L3TA 1TAQA 3DRPA 1IBMK 4WFNL 1RDUA 3EEQA 3LWMA 4M3UA 3VA3A 5JMVA 1MWKA 3EKUA 2NUBA 5CYQA 3HSCA 1OH5A 4G9ZA 4CJ5A 3DLBA 3V1RA 3H1QA 4H0TB 2PZSA 3EKSA 1VQ5N 1NK7A 1JLAA 4ILJA 1SL2A 1QTMA 2HNZA 4BRPA 4IG0A 1RTDA 3HP9A 4N47A 3O4WA 4KBOA 2CGJA 1VQ6N 3BP8A 4YDUC 4NCGA 2HF3A 3FZMA 3M6GA 3CJBA 3DLRA 2ITMA 1NJYA 2PY5A 1GOCA 3HT3A 3GBTA 4JI8K 3FE1A 3FGUA 4MDAA 1HX1A 1M90O 2PBDA 4FLWA 3AVMA 3MWTA 5AQXA 3AVIA 1D9DA 2P9NB 3TSPA 3AAPA 4BC5A 3OS2A 4CFBA 4DS5A 4AF1A 1C6VA 3LL3A 1C0FA 3G10A 3AVNA 4WFBL 3SQ4A 4DUZK 3M8RA 4B9UA 2ITGA 1P90A 5M1QA 2X74A 3HRGA 1KFSA 3QDKA 3V1OA 3QLHA 5M1KA 1RFQA 1B9FA 3EZ5A 3H46O 2Q36A 1Z6RA 3OS1A 4GV6A 4K8ZA 2H3GX 1U47A 4RWTA 4A5BA 4RW6A 3UB5A 4RW8A 3CC2N 5M1OA 5J2NA 5J2PA 4DSKA 3C6TA 5GAHP 4E0DA 3E9LA 3OTOK 1KCFA 3BGRA 4F2RA 4BE1A 2GEMA 1O13A 4BDZA 4DV6K 2FC0A 1S1VA 2F4VK 4B3SK 2XY6A 3VQ5A 3DAWA 1NNEA 3A2FA 1HYSA 2NRHA 4CF2A 3QEVA 3MAQA 4Z4FA 4FLVA 2FF6A 4DV1K 3OJUA 1S3XA 3LM2A 2CGKA 3L4QA 4B3RK 4JK9A 3CCQN 4GKKK 3P5JA 4YNQA 4M3TA 3PIOL 1A5VA 3VOVA 4M3YA 1XI1A 1SAZA 2OTLN 3AARA 3RWUA 1EO1A 3HOTA 2P9LB 3LALA 4J8FA 3VQPA 3QESA 5HRPA 3THYA 3CCEN 4ISFA 4LFBK 2VG5A 1Z26A 4DTOA 3KK2A 2D0BA 3HBTA 1HUXA 1ASWA 5FPNA 5AQPA 4DTJA 1REVA 3LP3A 4JI0K 1K9MO 3U4LA 2XHBA 3GDQA 4CZHA 1XC9A 2GBZA 3P31A 3U9DA 4LH4A 2P9NA 1E4FT 4FCYA 1YITN 4FL9A 3LAKA 2OZMA 4FOEA 2W6LA 5C24A 2HBJA 4BVOA 4IFEA 4IDKA 2A1SA 3O1WA 5AQNA 3RTVA 1MA9B 3CCVN 1IJJA 4KAZA 2IS3A 2FF3B 3FFKB 3ZCMA 3O1BA 5FPDA 3TTCA 1WNSA 1KLMA 3ENHA 4FXDA 1ZBIA 3VESA 3ZT0A 4QS7A 5AQIA 1XMQK 4E7HA 3AA2A 2QWNA 1VSLA 1SKWA 3W3DA 1RT5A 4IJAA 4FLUA 3VA0A 2QK9A 2W41A 4W5RA 3V9UA 4KHSA 1ZBLA 4DTUA 1BA1A 3O9TA 4JV5K 1XUPO 4DV5K 2E6MA 4CHYA 1NGJA 1YT3A 4DQPA 5EU7A 4CE9A 1Q81O 3K5MA 1ITGA 3S9HA 3LAMA 1YI2N 4ID5A 3FR0A 1WSEA 3VGLA 3S3NA 4JLHA 2ASPA 1XMOK 1NGFA 1L5UA 4IO8A 3IMXA 4DTMA 3DOKA 1JL2A 1ATRA 4JKFA 3EZWA 4OPHA 4YOVA 1HNXK 5LJVA 4N56A 5BN9A 3G0ZA 3AAQA 4KREA 1D9FA 3NDKA 3ATVA 1YJNN 2NLXA 4PKIA 4CGDA 3OVNA 5GADP 3ZSXA 2ASMA 4CHOA 3RMCA 4LD0A 2P9LA 4KHYA 4DMNA 3MN5A 5M1NA 3LDOA 3HOSA 1BGXT 1NWKA 3MCPA 3VQCA 4BR0A 4XIUA 4ICLA 1NK6A 2JWLA 4DU3A 2YNGA 4BE0A 4KO0A 4YOXA 3C6AA 1T8EA 2PYLA 2AP1A 4DF8A 3AVFA 1CZAN 1VSFA 2KFZA 4GVMA 1OKJA 4H4MA 5AQQA 3Q7CA 4M7YA 4EZ6A 3PSIA 4DHYA 3BEXA 4BRDA 1BU6O 4CZFA 1WSIA 3K5OA 2HHSA 2HOEA 3M8PA 2YKNA 4C8LA 1WBBA 3V9SA 5BRDA 2F8SA 2FBTA 2YCHA 1CLQA 1VSKA 4FJMA 2IVPA 1NMDA 2FBVA 2KLAA 3SPYA 1FXXA 3OYMA 4B9QA 3L4IA 2QM1A 3QFUA 4H5TA 4CHQA 3A5OC 3L6QA 2QXFA 1YJ9N 4CD1A 3NH1A 3WXIA 4IBNA 4BG9A 3J7AP 1ATSA 1C0GA 5BR8K 4NO7A 4FWKA 1GLCG 5GIOA 1BCOA 1LWEA 1GOAA 3UKRB 2XY5A 3CM5A 2B6AA 1J5OA 4K0KK 1TKTA 1QZ5A 2YHAA 2IAJA 3TAPA 1RBUA 5AQUA 2E2PA 3HPOA 1HYZA 3O9QA 2A41A 3WNGA 3K5NA 3SQ1A 3LDQA 3VQEA 3EE8A 3B8AX 4DSJA 3I56N 2KZZA 2ZE2A 1R0AA 4KB0A 1NK5A 4JN4A 4B1YB 3PIPL 4Z0UA 2HF4A 4KTQA 2FBYA 2HBKA 4JKHA 4AHVA 1OH6A 5DM6L 1XNQK 1I94K 1S6QA 2ZD1A 1X9JA 4PKHA 3NCIA 4IOAL 1J6ZA 2OPQA 1BCMA 3SCXA 5A2QO 3EO3A 2G8UA 1ATNA 4LF4K 3NMUA 4W5OA 4CZKA 4DSEA 4C8KA 3W0LA 3J7ZO 2G8IA 3DXMB 4JKAA 3NBPA 5EOYA 3MDQA 4NB4A 4AHTA 4O0JA 3DYAA 1VHXA 1MWMA 2O8EB 2OZSA 1BQNA 2GUPA 4YDUA 1N8RO 3VERA 1YIJN 3JYTA 4NXMK 3LDLA 5AQRA 3SPZA 3IUCA 4B8CA 4BRAA 3ULDA 1NM1A 3MEDA 2D5RA 1BA0A 4CGGA 5JLFA 2A1RA 4CJSA 2G8VA 4RG8A 3A5LC 5TKWA 1RCHA 4DQIA 3LPTA 1ZC6A 3MXJA 4GV3A 2IVOA 4YY3K 3T69A 3I8BA 5BR9A 3PX6A 2A3ZA 4CJVA 4XEIA 4DUYK 2UYTA 3UIQA 1Z05A 2KQ2A 3ATUA 3TSUA 3CCSN 2YV0X 3DWLA 4WQ4C 4H5RA 1NK9A 4DR7K 3ID6A 4FVMA 3WEEB 1SKRA 5JVHL 1EX4A 5AFUA 4JK7A 1FW6A 4M45A 4GVEA 3ZT4A 1EP4A 1U6ZA 1ILYA 2HW3A 3TARA 4BQZA 4PKGA 4AHUA 2WBNA 2OA8A 4AQYK 3NGYA 3UE5A 5BREA 3MEEA 3C7NB 3RMDA 3O08A 4NXNK 3VQAA 1W97L 4HWIA 2ZJQL 4AHSA 3G71N 4DV2K 4CHZA 1NGEA 4FJLA 1RILA 4IG3A 2WONA 3DI6A 4B1WB 2YNHA 4FZXC 4AHRA 5JS2A 5HROA 3CJ7A 2IIRA 1B9DA 1HJOA 3RMBA 4FJJA 4HVJA 1WB9A 4JYAK 3L2UA 4BGAA 4GNIA 3SK3A 1W9HA 3V9ZA 3LDPA 3P39A 1C1AA 2Q0RA 3NF8A 4R5PA 4CFDA 3T19A 3OYHA 4BC4A 1F21A 3T1HK 3E9PA 3HO1A 4DU4A 4KH5A 3L0QA 4JD2B 4C8OA 4QCLA 3KVGA 3AVHA 2GWJA 4K43A 3PV8A 4H0VB 4A5AA 1S22A 4MLEA 3O3FA 4KHNA 2VYPA 3DLGA 4CF9A 2E8AA 4M63C 2O8EA 4H5WA 4PQUA 3WXJA 2VQEK 2YHYA 1YHQN 1QHTA 1KAXA 3N4QA 3KLIA 3CF5L 4YOYA 1RT1A 5LY3A 1SZ2A 2ZF5O 4RW7A 1ASVA 3DLLL 4CBXA 1KAYA 3ENBA 1TUYA 3CQ8A 4DV0K 2NNWA 3ZX0A 2VG6A 2JGUA 3O9RA 4DFKA 3ZSWA 3G4SN 1NU0A 3OHRA 4CJTA 1NOYA 3THXB 4IFYA 4WYBA 3TAEA 4Y1DA 4CZMA 1IG8A 4ILGB 3WEEA 2WOMA 4KI6A 2I7NA 1SL0A 3LZJA 4YOTA 4RTFD 2YHBA 1C0UA 1BO5O 1LCUA 3KKSA 4QS9A 4CEAA 3MWPA 3QEWA 2VWKA 1OH8A 3H6EA 5J2MA 2QWRA 3C7NA 3OYAA 1JLEA 2IDOA 3IS9A 5AQJA 3SBTA 4HUGA 3AVAA 1VQON 4X64K 4CJ7A 5AZJB 4M42A 1EQYA 4BY9C 4FSVA 1BIZA 4I9LA 5LMNK 4FJKA 1TGOA 4E7JA 3DJCA 1NGDA 3V1QA 3KK7A 1JJ2M 1TKZA 3J81O 4FVUA 2YNFA 4B9TA 4DTRA 3RVCA 4WF9L 4IO9L 1VRUA 5F2RA 1DTQA 3KD1E 3QBWA 1MDUB 3TWHA 4HCCA 2UU9K 1CXUA 2I7PA 3SQ0A 1RDAA 4JD2A 3AY9A 3NFAA 1JLCA 4KKOA 3D2EA 4Y1CA 1JCFA 1SV5A 3FZFA 2Q31A 1N32K 2F9TA 3A8YA 3BUZB 3ZT2A 5KPRA 3THYB 3AA4A 2KHOA 3AVKA 1X1PA 2HMPA 3IKMA 1EWQA 4IXCA 5JVGL 3CCLN 3ZSOA 2AA4A 1L3VA 4FJNA 2RHKA 4LY7A 1HMVA 1N5YA 5HLFA 1V4SA 3QNOA 2CGLA 4CD3A 1UA1A 5KQDA 3THXA 4F3TA 3D0PA 4GY2B 1ZBUA 1IV0A 5AQMA 3AO3A 4OKKA 4EP5A 5HRSA 1LWFA 4IOCL 4DR2K 4BR2A 2ZWHA 2QI2A 4C23A 3C94A 5FLXO 4JKBA 2RF2A 4ID1A 1JLQA 1KSPA 2ATQA 3LDSA 3ZSYA 4B9MA 5FRNA 1JKHA 3BZKA 3VQ9A 2KTQA 4B3OA 4CBWA 1YJWN 4B1XB 2HHHK 3IAYA 3LP2A 1X9WA 3KTQA 1DLOA 3CXCM 1RT6A 3D2FB 2NRTA 3AVGA 4A62A 1NK0A 5AZJA 1S1WA 4NYNA 3HM8A 2O4IA 1HQUA 1YF5L 5HRRA 2FSJA 2P9SB 4Z4HA 2Q2RA 1NG9A 2O8DB 3B6PA 1CZBA 1YVUA 3R1XA 4FJHA 3DM2A 3CERA 4BR5A 4LF9K 1VQNN 3EE9A 2GELA 2DFHA 1WSFA 4AILC 4AM7A 4CGHA 1C0TA 3C65A 3QMLA 4V19S 2WTUA 4DSIA 3JS6A 3SMPA 3JAMO 1NK8A 2X6NA 3VPZA 1Q9YA 3PX0A 5CHIA 3OY9A 4O8UA 2YI1A 3K0SA 3RR7A 3QICA 5TKYA 1KD1O 3DOLA 1CZ9A 1K8KA 3T1AA 4MDBA 3KKRA 3RSEB 5C42A 4BE2A 1D8YA 3F2KA 4CF8A 2UUAK 1VSEA 2NRWA 5HOOA 2UXCK 5C0YA 4BR4A 3VQ4A 3QO9A 2D0PA 4BVPA 3OBYA 4L8RB 1UWBA 2XO7A 4QOZB 4BRLA 5GAEP 4M7XA 4M3XA 5DK5A 5LMUK 1YAGA 2DFEA 1L3UA 2HHTA 4RCHA 4KV8A 3I0RA 3P38A 3MCAB 3QERA 4MO4A 3ZLJA 4FJIA 3P1GA 3NAEA 1IKYA 4WQ4A 4FLZA 4H0OA 4K41A 1N36K 2PFUA 1KFDA 3HTVA 3OYNA 1RDWX 3L8BA 1LAVA 4CJLA 3JSMA 1HQEA 4AM6A 3UKUA 4BRGA 3D2FA 5E26A 4EHUA 3I33A 4EFHA 4YOWA 3QEPA 4LF8K 1RT7A 1VSIA 4LC9B 4CERA 2HBMA 1JCGA 1IKWA 5KPZA 1WAFA 4BRCA 3DRSA 1SS6A 2P9SA 4BG8A 3L2RA 5AQOA 2O8DA 4H0XB 2R7YA 4H5VA 1JCEA 4EP4A 4F3OA 1I39A 5C2DA 3WNEA 3VF6A 2Y1JA 4FJ5A 5KTQA 1KTQA 3VEWA 4FZZA 5AFUH 3VF2A 2QW9A 2IOCA 4LH5A 5CY4A 1GLLO 3ALYA 4FM0A 3TAQA 4W5NA 2WC9A 3ZSZA 3CETA 3G6EN 1FKOA 1WSGA 4CEFA 2IVNA 3VQDA 2UUBK 4JHDB 3IG1A 3VEOA 3CM6A 3ZX3A 4GV9A 2QKBA 3CJCA 3GOIA 4ELUA 4FJ9A 1NBWA 5AQTA 4E3SA 2D1KA 4MO5A 4NCBA 5BN8A 1TV6A 3ID8A 1U48A 3ZSVA 4KI4A 4CJFA 3U9ZA 4CJEA 3QEIA 2DPNA 3RSEA 3AVLA 3HP6A 3QIPA 2P9PB 1T44A 4JRPA 2W42A 1NKEA 3R6MA 3HVRA 3HZ6A 1BOTO 5BPLA 2QA4N 3BF1A 1X3MA 4DFMA 1NK4A 4ELTA 2OPSA 1NJWA 4CFAA 4CBUA 4DTNA 3NF6A 3HXMA 5ADXH 4FK4A 4CZEA 3O4QA 5F1XA 4PL7A 2QEXN 4TSXA 3NVMA 5BRHA 4DTXA 5AQSA 1VQLN 3CCMN 4OJRA 1GLDG 4DV3K 3KLEA 1Q9XA 2G8KA 4N5SA 3SLCA 4IKFA 2Q0UA 1TKXA 3T3FA 3SV3A 2F9WA 3VTHA 3FFIA 1KRPA 4FM2A 4QS8A 3L3VA 4EAHD 4JNEA 2YJFA 4M3RA 2E2OA 5GIPA 3HL8A 2YHXA 2W40A 4E1NA 1SUQA 4KTZA 2HB5A 5AJ3K 1S72N 4KRFA 4J2AA 4O5BA 4F8RA 3CD6N 4PL8A 3CMAN 4OVLA 2QKKA 3FZKA 4FZYA 1VSHA 4I9QA 5FPMA 1NGAA 4C8NA 4LSNA 3OA9A 4I2QA 1ZXOA 3GL1A 1GLBG 3O80A 4H4OA 2D4WA 2HHWA 2VCPA 1DTTA 4FPBA 4JHDA 1K6YA 1C1CA 5CYMA 1U45A 3CQYA 3CPWM 3C95A 3JXUA 3T7ZA 4IFVA 2YHWA 2VGNA 3SI6A 2NRRA 1WUAA 4IWVA 4FLTA 2V52B 2V7YA 3K57A 4HTLA 5HL7L 2OYQA 2P9PA 3AV9A 4RW4A 4PY5A 1T6DA 1TYQB 1RDDA 1QZ6A 1LW0A 3HSTB 1IG9A 3H3NO 3U3GA 4B08A 2D0OA 4CIFA 3ASMA 3SAFA 1BG3A 3O9UA 3F9MA 1BUPA 3AO1A 3ENOA 3AGRA 3KZBA 5BRFA 3S3MA 1T6CA 4CZJA 1YUWA 3LM9A 3OYIA 2X78A 4FJGA 3F9KA 3IDHA 1VSDA 2GV9A 4K8XA 3AA5X 4EHTA 2J4RA 5JS1A 3DMJA 1YTUA 4FJ7A 4CK2A 5KQ8A 2NRXA 1QQCA 4FWNA 3HPHA 2XY7A 1ZBSA 1GLEG 1S1TA 2BGGA 4B9NA 2E20A 2OCEA 4KTWA 3O5BA 4Y0WA 3OYCA 4O44A 4DSFA 4JKGB 3ZEUB 3V9XA 4O0IA 1EETA 2QWLA 1JLFA 2F96A 3ZSRA 2EHGA 4FK2A 2E2QA 4IDHA 1NMNA 3F5TA 3E01A 5JICA 3TU5A 4DR3K 2VWJA 4AHCA 1GOBA 1K8AO 4JS5A 5I3UA 2BDPA 4RW9A 5I9EB 1ASUA 3KLFA 4BDYA 5KGXA 1QSLA 5AQFA 3THWB 2WFBA 1HNZK 1KC8O 2Q3SA 3P4IA 5I42A 1C1BA 1N6QA 4OKEA 1S1XA 4JI3K 4CJRA 4OO1J 3OYJA 3K9JA 4CEBA 3CJ9A 3KWGA 4FLXA 2P9UB 1VAZA 3RRHA 3AVCA 1XC3A 1EXQA 5LL6Z 1KVBA 5KRSA 3C6HA 1S5JA 2VQFK 1NJXA 4OGCA 1RT3A 2YJEA 1G99A 2FLOA 4W5TA 1WSHA 2HHUA 3RRGA 1V4TA 4JI4K 5HBMA 5ADXA 4CJKA 4Z4CA 1VK0A 3BY5A 1TYQA 5C10A 4X66K 4I2PA 4A57A 1LWCA 5C15A 2VG7A 4XH4A 2V51B 3J7YP 3D2EB 2WUSA 5SWMA 5E84A 2CH6A 3PX4A 4LF5K 4BACA 3CJAA 4CJQA 5M1FA 4BC3A 3B6OA 4DV7K 3VTIA 3VMFB 3D6RA 3G25A 1VQKN 1NGCA 4DLGA 2P9IB 2KKZA 2V7ZA 1FK9A 4IJNA 3TTFA 3I8DA 1TL3A 1ZYQA 1ZBFA 4H0PA 3TR8A 4CF1A 5GINA 2HHVA 2FSNA 3M8QA 3SZ2A 1K73O 2F8TA 5BPNA 2P9KB 4FJXA 2NRZA 4JKGA 3ZEUA 4FJ8A 4R79A 5J2QA 3WXMB 4HUFA 1RGIA 4BWJA 4O55A 1G15A 3THVA 3VEZA 4FWQA 4DR4K 1E3MA 1NGBA 3H08A 3ZETB 2UXDK 1HRHA 1TUUA 2ZJRL 5IWAK 4PUOA 3HPGA 1HNVA 3M8SA 4KB1A 4GW6A 1RTHA 2QTDA 4O8KA 4DV4K 3THWA 5GAGP 1X9MA 1T7PA 3HK2A 5AQZA 3TTDA 4IZ9A 4FW1A 2A40A 5FRMA 2E1YA 3ZT3A 4FO0A 3O3GA 2NRVA 4C8MA 4CEQA 2P9UA 5M1PA 3KHYA 2GUIA 5AR0A 4PWDA 1C0MA 4ZHRA 4G1QA 4CGFA 4XH1A 3DLKA 3M3ZA 4M3ZA 4FWSA 4JK8A 4O4GA 4KHQA 3PY8A 5LJWA 4HHTA 4CJWA 3R8EA 3TI0A 1IBLK 2A5XA 1J9AA 3R3LA 5B8HA 1JL1A 3VQQA 4B3MK 4LFCK 4ZTFA 3CIPA 5AQVA 1ZBHA 3OYGA 1Q7YO 3VETA 2E4LA 4ZTJA 2O8CA 1WAJA 1RDCA 1Q18A 1QHAA 4KHUA 2P9IA 5IT9O 3VQ7A 1K8KB 4IOXA 3HJFA 5K14A 2HNDA 3M5RA 3K59A 4LSLA 3J8AA 2Q1NA 5FROA 1TK8A 4DFPA 2YNIA 2P9KA 4WE1A 3QFPA 4CJ3A 3V4IA 3AGKA 3FZLA 3VEYA 3I55N 4KPYA 4DR1K 1HYVA 1RBTA 3CCJN 3E9OA 1VQ4N 4NCAA 3MX2A 5SZTA 2RN2A 3LANA 2ETJA 4N76A 3Q7BA 5JLHA 1J5EK 1OVQA 5T7BA 1KVAA 4JI5K 4FK0A 1W7AA 3ZETA 1HLUA 3C6UA 3MMVA 3SUOA 1NLVA 3U3YA 3WQTA 1DGKN 4DU1A 2KW4A 4BRHA 1VRTA 5EVZA 1VQPN 1TK0A 2I5JA 1LAWA 4IEIA 4J2EA 4CCHA 4KH6A 4CHNA 3D7EO 3F73A 1KAZA 3UKUB 3QNNA 5KRTA 2G8FA 1X9SA 2QWQA 1A5WA 4DS4A 1FKPA 4Q0BA 3WXLA 1U04A 5AZIA 3D45A 4MLHA 3S41A 3CFPA 2BANA 1UOCA 4JS4A 1XNRK 2D0CA 3OYEA 2ZM6K 3QEXA 3DXKB 4UY8O 1JLGA 1RBVA 3NF7A 1YTAA 1QQNA 4Q5VA 3BZCA 4CZGA 4OLAA 3VQ8A 3TSQA 4CGJA 5BPMA 4FM1A 4CJ4A 4DG1A 1WN7A 4B9LA 2PYJA 3OJSA 4K25A 1WBDA 4L3QA 4HUEA 3RMAA 3MK6A 2O4GA 4E89A 1O1WA 4BDPA 3SJJA 2ZQBA 1U4BA 4X65K 4CIGA 1LV5A 3EYZA 3MECA 4CW7B 3MN7A 2UUCK 4JKCA 3OBWA 2BTFA 3KIOA 1Y97A 5AQYA 1X3NA 3WT0A 4JI7K 3E1YA 2OANA 3HM9A 2RPIA 2G8HA 1TAUA 3M1FA 1HJRA 4WQ5C 3SMSA 1IKVA 3FZHA 3ZX2A 3I0SA 3MN9A 4BRKA 3SV4A 4CJPA 1BWFO 4FW2A 2FSKA 4DQQA 4MFBA 4JI2K 1TVRA 4XH5A 4I6MB 2HBLA 2JWKA 2AJQA 4M3WA 3OYDA 1E4GT 1CXQA 2P51A 1S9GA 2E88A 1NJZA 5CR4A 4E7IA 1XHZA 3O3HA 4B9VA 3ZT1A 3KD5E 3NH2A 1QVFM 5EX5A 3O4NA 5AQHA 3KJVA 5D3GA 4CEDA 2E1ZA 1RT2A 4BQLA 3KK3A 3SAGA 3SBGA 1HKCA 1WLJA 2LSNA 5AQKA 1B92A 4K42A 1QQOA 4HCBA 4C1NK 1HPMA 1YXQA 2Z1GA 4E7LA 2PAVA 2CH5A 3DXKA 2P1JA 5DMRA 4E1JA 2G8WA 4QAGA 3NVKA 1RT4A 1VQ7N 1J54A 3VEXA 1D5AA 3VN5A 1SL1A 3BDPA 4EIAA 3WNHA 2KFNA 1S9EA 4BROA 3TANA 1T03A 5C12A 3AVBA 3CHWA 1IBKK 3AA3A 4CEEA 4NYFA 4BRQA 5F0XA 1A5XA 4OPJA 3CPEA 3BF3A 1Y64A 4FWRA 4CHPA 3KLGA 5EXWA 4F9OA 1RDBA 4A2BA 4FWLA 3EY1A 1Z25A 3EL2A 4KH4A 4DTPA 4LF7K 3PSFA 1BIUA 2GWKA 3VQBA 4O5FA 3PO5A 3MXIA 3LPUA 4ISGA 3OYKA 4CJUA 3KK1A 4OLBA 3RR8A 1P8ZA 4FPAA 1RTJA 4CZLA 3TAGA 1KVCA 3U8XA 4DFJA 4I6MA 3U6FA 4OPKA 3VGMA 3E66A 3PO4A 1WSJA 1DEJA 4OKJA 3LP0A 4X62K 2QWMA 4J2BA 3L2QA 5CZ1A 4BRIA 4BR9A 4CK1A 3CYMA 3SUQA 2QWOA 4KFBA 3AVJA 4BRFA 5FPEA 1J53A 1QQMA 3IFRA 2P5OA 2ZGYA 2D0AA 1OVYA 4JAXA 3WUHA 4LF6K 4DTSA 2P5GA 4DWIA 1UA0A 5DM7L 3AO4A 3H1VX 4GMJB 3CC7N 5KI6A 1SKSA 2E2NA 3L2WA 1T05A 1UAXA 3T1YK 4OX9K 5AQWA 4CF0A 4DR6K 4BRMA 4CECA 4KHWA 3WXKA 2VGMA 4U67L 3VF4A 1KLNA 2HMIA 2NZTA 4PA1A 3CQXA 4A59A 1QE1A 4GKJK 1S6PA 3TABA 5HRNA 1YVNA 4Z94A 2KZMA 1TL1A 1MU2A 1HKGA 3CCUN 4CIEA 2IC3A 3DRRA 1U2VB 4DCHA 1IO2A 3CC4N 2O8BB 4NLBA 1IKXA 3QB0A 3AO5A 4E19A 3DLEA 5EY4A 3L3UA 4B1VA 3CJ1A 3PLAA 4LFAK 3V9WA 1JLBA 3SNNA 3EN9A 3MEGA 2RKIA 4BWMA 1M1KO 2HNYA 1JXBA 4W5QA 1NKCA 1SQKA 3HYFA 1TK5A 1I3AA 4H8KA 3C0BA 4OGEA 3OW2M 4JKEA 5E41A 3SUNA 3SUPA 5H1SQ 4WFAL 3SAHA 1OH7A 2DY4A 3DLHA 4AH9A 4B8AB 4CVNE 3ULEB 3TAFA 3QIOA 1TKDA 2ZJPL 4F4KA 1NGIA 3NGIA 3H45C 1HR0K 4BC2A 2Q97A 1NJIO 2YX6A 3MN6A 1KQSM 1EKEA 3KWIA 3NHGA 1R59O 4I7FA 3V6DA 3GG4A 2FXUA 4A61A 3TPQA 2B4JA 2IGIA 3QINA 3LP1A 2QXLA 4IEEA 4CESA 1HNIA 4JRQA 3A0IX 3VGKA 4CEOA 4YFUA 3K9KA 4B3TK 5ELZA 5KGWA 2A42A 4N41A 4A2AA 3O8MA 3SYZA 2HVIA 2Z1HA 2XRIA 4PHTX 1GLAG 1BHLA 1GLJO 4HTUA 3LWLA 4FWOA 5KPTA 2E5LK 4FWPA 3H3OB 4NLCA 3NGZA 2E6LA 3IRXA 4JI6K 1RNHA 2VWBA 4WCEL 5AQGA 3TAMA 3ZYYX 1W2BM 2EWSA 1EWRA 3VQ6A 4CI6A 3UKRA 1U2VA 1ESVA 1LOTB 2O8BA 4JKDA 1BL3A 4B1UB 2F7TA 1Q86O 4C1NI 2OPPA 5CZ2A 2OPRA 3LDNA 4OPAA 1W0HA 2A6AA 4DF4A 2HVHA 3O9SA 3CFRA 3L2VA 3CCRN 1BISA 2Y1IA 4DB3A 2X6SA 2O8FB 3GE1A 4DQ8A 4J2DA 1BI4B 1DKGD 4CGIA 4FYDA 1H1VA 4ILHA 2Z1JA 1XWLA 4BGBA 4MQ3A 1U49A 3S3OA 4H0YB 3LZIA 4YOUA 1NKBA 2HHXA 1T3VA 3NF9A 4E1MA 3K58A 4E7KA 4H03B 1VQ9N 2O8CB 1S1UA 3QBXA 3ULEA 1WOQA 2W6KA 4WQ5A 2BH1A 1RBRA 4FLYA 3MX5A 4JI1K 3KLHA 3HVTA 2FBXA 1VSMA 1FJGK 3DXMA 3V81A 2B5JA 4Z4IA 5AQLA 2QWPA
chains in the Genus database with same CATH topology
3ISNC 4CFCA 4DU1A 2KW4A 1VRTA 3L2RA 3ITHA 5HP1A 2R7YA 3ZSQA 1TK0A 2I5JA 1LAWA 4Z4GA 1S6QA 4J2EA 1QS4A 2ZD1A 4EP4A 4EZ9A 4F3OA 3K2PA 4CCHA 1I39A 3NCIA 3WNEA 4FJ5A 4CHNA 2Y1JA 5KTQA 1KTQA 3F73A 4FZZA 2YKMA 3QNNA 1JXEA 2IOCA 4LH5A 5CY4A 2OPQA 5KRTA 1BCMA 1X9SA 3SCXA 2G8FA 3ALYA 1A5WA 1RBSA 4FM0A 4DS4A 3AO2A 3TAQA 1FKPA 2G8UA 3ZSZA 4W5NA 1FKOA 3WNFA 4DQSA 4W5OA 1U04A 1WSGA 4Q0BA 4DSEA 3D45A 4C8KA 2G8IA 4CEFA 3VQDA 3CFPA 3NBPA 2BANA 3QETA 1UOCA 2Z1IA 3IG1A 1RTIA 4UQGA 2D0CA 4AHTA 4O0JA 3DYAA 3OYEA 3OYLA 3CM6A 3QEXA 3PUFA 3P83D 2OZSA 1BQNA 2QKBA 5C25A 4ELUA 3JYTA 4FJ9A 3NE6A 4E3SA 1JLGA 1RBVA 2BE2A 3SPZA 2BDPA 4NCBA 3MXMA 4B8CA 3NF7A 1YTAA 1TV6A 2JLEA 4Q5VA 3ULDA 1U48A 3MEDA 3ZSVA 4KI4A 2D5RA 4CJFA 4CJEA 3QEIA 4OLAA 4CGGA 4F2SA 3VQ8A 2A1RA 4CJSA 2G8VA 3AVLA 4CGJA 1LW2A 3QIPA 4RG8A 3HP6A 4JRPA 2HHQA 1RCHA 4CJ4A 5J1EA 2W42A 4DG1A 1WN7A 4B9LA 4B9SA 4DQIA 2PYJA 3LPTA 3OJSA 1NKEA 3OYFA 3MXJA 3CFOA 3HVRA 1XHXA 2DFFA 1IH7A 4HUEA 3RMAA 2O4GA 4E89A 1O1WA 3PX6A 4DFMA 1NK4A 4BDPA 4ELTA 4CJVA 2OPSA 1NJWA 4CFAA 1NOZA 3SQ2A 3SJJA 4M41A 3NF6A 4DTNA 2KQ2A 3HXMA 3UIQA 4FK4A 2YV0X 4CEZA 4DQRA 2ZQBA 1U4BA 3O4QA 1NK9A 4FVMA 1SKRA 4CIGA 1EX4A 1LV5A 3EYZA 3MECA 2DTUA 4TSXA 4M45A 3ZT4A 3K5LA 4DTXA 1EP4A 1Y97A 3KIOA 1QSSA 4Z4EA 2HW3A 3OS0A 4OJRA 1QSYA 3TARA 3KLEA 3NH0A 1VSJA 1Q9XA 4N5SA 4AHUA 2G8KA 1HPZA 3CG7A 2OA8A 4IKFA 3NGYA 1BI4A 1TKXA 2XY8A 3T3FA 1Q8IA 4CK3A 4DLEA 3SV3A 3HM9A 2RPIA 2G8HA 3MEEA 1TAUA 1HJRA 3OYBA 3RMDA 3FFIA 1IKVA 3I0SA 3VQAA 3SV4A 1KRPA 4CJPA 4FM2A 4FW2A 1BQMA 4DQQA 4MFBA 3L3VA 2EX3A 1TVRA 5FDLA 4AHSA 4M3RA 4CHZA 4ELVA 4FJLA 1RILA 2AJQA 4IG3A 2WONA 3DI6A 4DSLA 2YNHA 1L3TA 4FZXC 1TAQA 3DRPA 4AHRA 5JS2A 5HROA 3HL8A 4M3WA 3OYDA 4E1NA 1CXQA 1SUQA 3LWMA 4M3UA 3VA3A 2P51A 1S9GA 1B9DA 4KTZA 3RMBA 2HB5A 4FJJA 4HVJA 1NJZA 2NUBA 5CYQA 4E7IA 3O3HA 1XHZA 4J2AA 4KRFA 4O5BA 3ZT1A 4B9VA 3KD5E 3NH2A 4F8RA 4CJ5A 3L2UA 3DLBA 3V1RA 2PZSA 4OVLA 1W9HA 1NK7A 1JLAA 3V9ZA 2QKKA 3O4NA 1SL2A 1QTMA 1C1AA 2HNZA 4FZYA 3NF8A 4R5PA 4CFDA 1VSHA 3T19A 4I9QA 4IG0A 3OYHA 3HP9A 3KJVA 1RTDA 4C8NA 4N47A 1F21A 1RT2A 4CEDA 3KK3A 5FRMA 4LSNA 4DU4A 3HO1A 4I2QA 4C8OA 4QCLA 4NCGA 1WLJA 3DLRA 3AVHA 1NJYA 2PY5A 1GOCA 2LSNA 3HT3A 4H4OA 1B92A 2HHWA 3PV8A 4HCBA 3O3FA 4KHNA 1DTTA 1U45A 1K6YA 1C1CA 3DLGA 5CYMA 2Z1GA 4E7LA 4CF9A 2P1JA 5DMRA 4FLWA 2G8WA 4QAGA 3AVMA 4PQUA 3C95A 1RT4A 4IFVA 1J54A 1QHTA 3AVIA 1D9DA 3SI6A 1D5AA 3VN5A 3OS2A 3KLIA 4CFBA 4DS5A 1SL1A 3BDPA 1C6VA 1RT1A 4FLTA 3K57A 4RW7A 1ASVA 3WNHA 2OYQA 3G10A 3AV9A 4RW4A 2KFNA 4PY5A 1S9EA 3TANA 1RDDA 3CQ8A 3AVNA 1LW0A 3HSTB 1T03A 1IG9A 3SQ4A 2VG6A 3U3GA 4B08A 3M8RA 4B9UA 2ITGA 3AVBA 2JGUA 4DFKA 2X74A 3AA3A 4CIFA 3ZSWA 1KFSA 3ASMA 3V1OA 3QLHA 4CEEA 4CJTA 4NYFA 1B9FA 1NOYA 3EZ5A 4IFYA 1A5XA 4OPJA 3OS1A 3AO1A 3TAEA 4K8ZA 4Y1DA 3S3MA 1U47A 3KLGA 4CHPA 3OYIA 2X78A 4RW6A 4RW8A 3F9KA 4FJGA 1VSDA 2GV9A 2WOMA 1RDBA 4K8XA 3AA5X 4KI6A 3EY1A 1Z25A 5J2NA 5JS1A 5J2PA 1SL0A 4DTPA 3LZJA 4DSKA 3C6TA 4E0DA 1BIUA 2YHBA 3DMJA 1C0UA 1YTUA 4FJ7A 3KKSA 4CK2A 4CEAA 1KCFA 1QQCA 3BGRA 3VQBA 4F2RA 4BE1A 3PO5A 3HPHA 2VWKA 3QEWA 2XY7A 4BDZA 3MXIA 2KZZA 3LPUA 5J2MA 1S1TA 2BGGA 4B9NA 2FC0A 4KTWA 1S1VA 3OYCA 3OYKA 4O44A 2XY6A 4CJUA 3KK1A 4DSFA 3V9XA 3VQ5A 3OYAA 4O0IA 3RR8A 4OLBA 1RTJA 1EETA 1JLEA 2IDOA 3A2FA 1KVCA 3IS9A 3TAGA 1HYSA 4CF2A 1JLFA 2F96A 4DFJA 3ZSRA 2EHGA 3U6FA 3QEVA 4FK2A 4OPKA 3MAQA 4Z4FA 4FLVA 4HUGA 3PO4A 1WSJA 4OKJA 3LP0A 3AVAA 4J2BA 3L2QA 3OJUA 5CZ1A 3E01A 4M42A 2VWJA 4CK1A 3CYMA 4AHCA 3SUQA 1GOBA 4KFBA 3AVJA 3P5JA 4JS5A 5I3UA 1BIZA 4I9LA 1J53A 1ASUA 4RW9A 1TGOA 4YNQA 3KLFA 4BDYA 2D0AA 5KGXA 4E7JA 1A5VA 2P5OA 3V1QA 4DTSA 1TKZA 4M3YA 1QSLA 1XI1A 2P5GA 4DWIA 1UA0A 2YNFA 4B9TA 3RWUA 4DTRA 2Q3SA 3AO4A 3LALA 1VRUA 4GMJB 3VQPA 1C1BA 1DTQA 5HRPA 3QESA 5I42A 3TWHA 1N6QA 3KD1E 4HCCA 1CXUA 4OKEA 3SQ0A 5KI6A 1S1XA 1RDAA 1SKSA 2VG5A 1Z26A 4CJRA 3L2WA 3NFAA 4DTOA 1T05A 1JLCA 3OYJA 1UAXA 3KK2A 2D0BA 4KKOA 4CEBA 1ASWA 4Y1CA 4FLXA 4DTJA 1REVA 1SV5A 3LP3A 3AVCA 4CF0A 1EXQA 3RRHA 2XHBA 4CECA 4KHWA 1KVBA 5KRSA 1XC9A 1KSPA 1S5JA 2GBZA 1NJXA 4OGCA 1RT3A 4LH4A 4FCYA 4W5TA 1WSHA 1KLNA 2HMIA 2HHUA 3ZT2A 3LAKA 3RRGA 4PA1A 2OZMA 5HBMA 4CJKA 1QE1A 4Z4CA 1S6PA 3TABA 5C24A 3AA4A 5HRNA 3AVKA 2KZMA 1X1PA 1TL1A 1VK0A 4IDKA 2A1SA 1MU2A 4I2PA 3ZSOA 3RTVA 1LWCA 1L3VA 2VG7A 4CIEA 4KAZA 4FJNA 2IC3A 2IS3A 4LY7A 1HMVA 1N5YA 5HLFA 5SWMA 3ZCMA 3QNOA 1UA1A 3PX4A 3DRRA 1WNSA 1KLMA 4N76A 1IO2A 5D3GA 4FXDA 1ZBIA 4BACA 4F3TA 3ZT0A 4CJQA 3D0PA 4E7HA 1IKXA 1ZBUA 3B6OA 3AO5A 3AA2A 4E19A 3AO3A 4OKKA 3DLEA 4EP5A 5HRSA 1VSLA 3L3UA 4M3TA 1SKWA 1LWFA 1RT5A 4FLUA 3VA0A 4DLGA 2QK9A 4W5RA 3V9UA 4KHSA 1ZBLA 4DTUA 3V9WA 1JLBA 1FK9A 3C94A 3MEGA 3SNNA 3I8DA 1TL3A 2RKIA 4BWMA 1ZYQA 2RF2A 1ZBFA 1JLQA 2HNYA 1JXBA 2ATQA 4ID1A 3TR8A 3HYFA 4CF1A 2E6MA 4CHYA 4W5QA 1NKCA 2HHVA 1TK5A 1I3AA 1YT3A 3M8QA 4H8KA 3ZSYA 4OGEA 5EU7A 3LDSA 3SZ2A 4B9MA 1JKHA 4DQPA 5FRNA 3VQ9A 2F8TA 4CE9A 2KTQA 4B3OA 5E41A 3K5MA 4FJXA 3SUNA 1L3SA 3SUPA 1ITGA 4FJ8A 3IAYA 3S9HA 3LAMA 4ID5A 5J2QA 3LP2A 1X9WA 3KTQA 2DY4A 3DLHA 4AH9A 4HUFA 4B8AB 1WSEA 3S3NA 1DLOA 4JLHA 4BWJA 1RT6A 4O55A 1L5UA 3AVGA 4DTMA 1G15A 1JL2A 3DOKA 3TAFA 3QIOA 3THVA 1TKDA 1NK0A 1S1WA 4F4KA 4NYNA 2O4IA 4N56A 1HQUA 3H08A 5HRRA 1HRHA 3NGIA 3G0ZA 4Z4HA 4KREA 1D9FA 3NDKA 4PUOA 3HPGA 1HNVA 3M8SA 4KB1A 1EKEA 4GW6A 1RTHA 3NHGA 3B6PA 4I7FA 3V6DA 4CGDA 3OVNA 1CZBA 3ZSXA 1X9MA 1YVUA 2B4JA 2IGIA 4FJHA 4CHOA 3DM2A 3QINA 3RMCA 3LP1A 4LD0A 1T7PA 3HK2A 4KHYA 4DMNA 4CESA 1HNIA 4JRQA 1BGXT 4FW1A 2DFHA 1WSFA 3VQCA 4XIUA 4ICLA 3ZT3A 4AILC 4CEOA 3O3GA 4YFUA 4DU3A 1NK6A 2YNGA 4CGHA 4C8MA 1C0TA 4KO0A 4JS4A 4BE0A 5KGWA 4CEQA 4DSIA 4N41A 1T8EA 2PYLA 4DF8A 1NK8A 2X6NA 2GUIA 3SYZA 3AVFA 1Q9YA 2HVIA 3PX0A 4PWDA 1VSFA 2KFZA 2Z1HA 1C0MA 4ZHRA 4GVMA 2XRIA 4H4MA 4G1QA 4CGFA 1BHLA 3OY9A 3DLKA 4M3ZA 4HTUA 3LWLA 4O4GA 4EZ6A 4KHQA 3PY8A 3RR7A 3NGZA 4CJWA 4HHTA 2E6LA 3IRXA 1WSIA 1RNHA 3K5OA 3DOLA 1CZ9A 2HHSA 3T1AA 4BE2A 3KKRA 3M8PA 5C42A 3TI0A 1D8YA 3TAMA 1J9AA 4CF8A 2YKNA 1JL1A 3VQQA 1VSEA 4C8LA 3VQ6A 3VQ4A 3QO9A 3V9SA 2F8SA 4ZTFA 2FBTA 4L8RB 1CLQA 1UWBA 1ZBHA 1BL3A 3OYGA 1VSKA 4FJMA 2XO7A 4QOZB 2E4LA 2OPPA 5CZ2A 2OPRA 4ZTJA 4M3XA 1W0HA 2FBVA 3SPYA 1WAJA 1FXXA 5DK5A 1RDCA 3OYMA 4DF4A 2DFEA 2HVHA 1L3UA 4KHUA 3CFRA 2HHTA 4KV8A 3I0RA 3L2VA 3VQ7A 3HJFA 1BISA 5K14A 4CHQA 2Y1IA 2QXFA 2X6SA 2HNDA 3NH1A 3QERA 4FJIA 4IBNA 3P1GA 3K59A 1IKYA 4LSLA 3NAEA 4FLZA 4FJKA 1BCOA 1LWEA 1GOAA 5FROA 2XY5A 3CM5A 1BI4B 4DFPA 1TK8A 4J2DA 2YNIA 4CGIA 2B6AA 4WE1A 4CJ3A 1J5OA 1KFDA 4FYDA 3V4IA 1TKTA 3OYNA 2Z1JA 1XWLA 4KPYA 3L8BA 1LAVA 1HYVA 4CJLA 4MQ3A 2YHAA 3JSMA 1RBTA 1HQEA 3LZIA 3S3OA 2IAJA 3TAPA 1U49A 1NKBA 1RBUA 2HHXA 3NF9A 4E1MA 3HPOA 3K58A 1HYZA 4E7KA 4NCAA 1S1UA 3WNGA 5SZTA 3K5NA 3SQ1A 2RN2A 3QEPA 1RT7A 1VSIA 4CERA 3VQEA 1RBRA 3LANA 4FLYA 4DSJA 2ETJA 2ZE2A 1IKWA 3HVTA 2FBXA 3KLHA 1R0AA 1NK5A 4KB0A 1VSMA 5T7BA 1KVAA 4Z0UA 4FK0A 3V81A 1WAFA 2B5JA 2FBYA 3C6UA 3SUOA 4KTQA 3DRSA 4Z4IA 4FM1A 3U3YA 4AHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISN C;  4CFC A;  4DU1 A;  2KW4 A;  1VRT A;  3L2R A;  3ITH A;  5HP1 A;  2R7Y A;  3ZSQ A;  1TK0 A;  2I5J A;  1LAW A;  4Z4G A;  1S6Q A;  4J2E A;  1QS4 A;  2ZD1 A;  4EP4 A;  4EZ9 A;  4F3O A;  3K2P A;  4CCH A;  1I39 A;  3NCI A;  3WNE A;  4FJ5 A;  4CHN A;  2Y1J A;  5KTQ A;  1KTQ A;  3F73 A;  4FZZ A;  2YKM A;  3QNN A;  1JXE A;  2IOC A;  4LH5 A;  5CY4 A;  2OPQ A;  5KRT A;  1BCM A;  1X9S A;  3SCX A;  2G8F A;  3ALY A;  1A5W A;  1RBS A;  4FM0 A;  4DS4 A;  3AO2 A;  3TAQ A;  1FKP A;  2G8U A;  3ZSZ A;  4W5N A;  1FKO A;  3WNF A;  4DQS A;  4W5O A;  1U04 A;  1WSG A;  4Q0B A;  4DSE A;  3D45 A;  4C8K A;  2G8I A;  4CEF A;  3VQD A;  3CFP A;  3NBP A;  2BAN A;  3QET A;  1UOC A;  2Z1I A;  3IG1 A;  1RTI A;  4UQG A;  2D0C A;  4AHT A;  4O0J A;  3DYA A;  3OYE A;  3OYL A;  3CM6 A;  3QEX A;  3PUF A;  3P83 D;  2OZS A;  1BQN A;  2QKB A;  5C25 A;  4ELU A;  3JYT A;  4FJ9 A;  3NE6 A;  4E3S A;  1JLG A;  1RBV A;  2BE2 A;  3SPZ A;  2BDP A;  4NCB A;  3MXM A;  4B8C A;  3NF7 A;  1YTA A;  1TV6 A;  2JLE A;  4Q5V A;  3ULD A;  1U48 A;  3MED A;  3ZSV A;  4KI4 A;  2D5R A;  4CJF A;  4CJE A;  3QEI A;  4OLA A;  4CGG A;  4F2S A;  3VQ8 A;  2A1R A;  4CJS A;  2G8V A;  3AVL A;  4CGJ A;  1LW2 A;  3QIP A;  4RG8 A;  3HP6 A;  4JRP A;  2HHQ A;  1RCH A;  4CJ4 A;  5J1E A;  2W42 A;  4DG1 A;  1WN7 A;  4B9L A;  4B9S A;  4DQI A;  2PYJ A;  3LPT A;  3OJS A;  1NKE A;  3OYF A;  3MXJ A;  3CFO A;  3HVR A;  1XHX A;  2DFF A;  1IH7 A;  4HUE A;  3RMA A;  2O4G A;  4E89 A;  1O1W A;  3PX6 A;  4DFM A;  1NK4 A;  4BDP A;  4ELT A;  4CJV A;  2OPS A;  1NJW A;  4CFA A;  1NOZ A;  3SQ2 A;  3SJJ A;  4M41 A;  3NF6 A;  4DTN A;  2KQ2 A;  3HXM A;  3UIQ A;  4FK4 A;  2YV0 X;  4CEZ A;  4DQR A;  2ZQB A;  1U4B A;  3O4Q A;  1NK9 A;  4FVM A;  1SKR A;  4CIG A;  1EX4 A;  1LV5 A;  3EYZ A;  3MEC A;  2DTU A;  4TSX A;  4M45 A;  3ZT4 A;  3K5L A;  4DTX A;  1EP4 A;  1Y97 A;  3KIO A;  1QSS A;  4Z4E A;  2HW3 A;  3OS0 A;  4OJR A;  1QSY A;  3TAR A;  3KLE A;  3NH0 A;  1VSJ A;  1Q9X A;  4N5S A;  4AHU A;  2G8K A;  1HPZ A;  3CG7 A;  2OA8 A;  4IKF A;  3NGY A;  1BI4 A;  1TKX A;  2XY8 A;  3T3F A;  1Q8I A;  4CK3 A;  4DLE A;  3SV3 A;  3HM9 A;  2RPI A;  2G8H A;  3MEE A;  1TAU A;  1HJR A;  3OYB A;  3RMD A;  3FFI A;  1IKV A;  3I0S A;  3VQA A;  3SV4 A;  1KRP A;  4CJP A;  4FM2 A;  4FW2 A;  1BQM A;  4DQQ A;  4MFB A;  3L3V A;  2EX3 A;  1TVR A;  5FDL A;  4AHS A;  4M3R A;  4CHZ A;  4ELV A;  4FJL A;  1RIL A;  2AJQ A;  4IG3 A;  2WON A;  3DI6 A;  4DSL A;  2YNH A;  1L3T A;  4FZX C;  1TAQ A;  3DRP A;  4AHR A;  5JS2 A;  5HRO A;  3HL8 A;  4M3W A;  3OYD A;  4E1N A;  1CXQ A;  1SUQ A;  3LWM A;  4M3U A;  3VA3 A;  2P51 A;  1S9G A;  1B9D A;  4KTZ A;  3RMB A;  2HB5 A;  4FJJ A;  4HVJ A;  1NJZ A;  2NUB A;  5CYQ A;  4E7I A;  3O3H A;  1XHZ A;  4J2A A;  4KRF A;  4O5B A;  3ZT1 A;  4B9V A;  3KD5 E;  3NH2 A;  4F8R A;  4CJ5 A;  3L2U A;  3DLB A;  3V1R A;  2PZS A;  4OVL A;  1W9H A;  1NK7 A;  1JLA A;  3V9Z A;  2QKK A;  3O4N A;  1SL2 A;  1QTM A;  1C1A A;  2HNZ A;  4FZY A;  3NF8 A;  4R5P A;  4CFD A;  1VSH A;  3T19 A;  4I9Q A;  4IG0 A;  3OYH A;  3HP9 A;  3KJV A;  1RTD A;  4C8N A;  4N47 A;  1F21 A;  1RT2 A;  4CED A;  3KK3 A;  5FRM A;  4LSN A;  4DU4 A;  3HO1 A;  4I2Q A;  4C8O A;  4QCL A;  4NCG A;  1WLJ A;  3DLR A;  3AVH A;  1NJY A;  2PY5 A;  1GOC A;  2LSN A;  3HT3 A;  4H4O A;  1B92 A;  2HHW A;  3PV8 A;  4HCB A;  3O3F A;  4KHN A;  1DTT A;  1U45 A;  1K6Y A;  1C1C A;  3DLG A;  5CYM A;  2Z1G A;  4E7L A;  4CF9 A;  2P1J A;  5DMR A;  4FLW A;  2G8W A;  4QAG A;  3AVM A;  4PQU A;  3C95 A;  1RT4 A;  4IFV A;  1J54 A;  1QHT A;  3AVI A;  1D9D A;  3SI6 A;  1D5A A;  3VN5 A;  3OS2 A;  3KLI A;  4CFB A;  4DS5 A;  1SL1 A;  3BDP A;  1C6V A;  1RT1 A;  4FLT A;  3K57 A;  4RW7 A;  1ASV A;  3WNH A;  2OYQ A;  3G10 A;  3AV9 A;  4RW4 A;  2KFN A;  4PY5 A;  1S9E A;  3TAN A;  1RDD A;  3CQ8 A;  3AVN A;  1LW0 A;  3HST B;  1T03 A;  1IG9 A;  3SQ4 A;  2VG6 A;  3U3G A;  4B08 A;  3M8R A;  4B9U A;  2ITG A;  3AVB A;  2JGU A;  4DFK A;  2X74 A;  3AA3 A;  4CIF A;  3ZSW A;  1KFS A;  3ASM A;  3V1O A;  3QLH A;  4CEE A;  4CJT A;  4NYF A;  1B9F A;  1NOY A;  3EZ5 A;  4IFY A;  1A5X A;  4OPJ A;  3OS1 A;  3AO1 A;  3TAE A;  4K8Z A;  4Y1D A;  3S3M A;  1U47 A;  3KLG A;  4CHP A;  3OYI A;  2X78 A;  4RW6 A;  4RW8 A;  3F9K A;  4FJG A;  1VSD A;  2GV9 A;  2WOM A;  1RDB A;  4K8X A;  3AA5 X;  4KI6 A;  3EY1 A;  1Z25 A;  5J2N A;  5JS1 A;  5J2P A;  1SL0 A;  4DTP A;  3LZJ A;  4DSK A;  3C6T A;  4E0D A;  1BIU A;  2YHB A;  3DMJ A;  1C0U A;  1YTU A;  4FJ7 A;  3KKS A;  4CK2 A;  4CEA A;  1KCF A;  1QQC A;  3BGR A;  3VQB A;  4F2R A;  4BE1 A;  3PO5 A;  3HPH A;  2VWK A;  3QEW A;  2XY7 A;  4BDZ A;  3MXI A;  2KZZ A;  3LPU A;  5J2M A;  1S1T A;  2BGG A;  4B9N A;  2FC0 A;  4KTW A;  1S1V A;  3OYC A;  3OYK A;  4O44 A;  2XY6 A;  4CJU A;  3KK1 A;  4DSF A;  3V9X A;  3VQ5 A;  3OYA A;  4O0I A;  3RR8 A;  4OLB A;  1RTJ A;  1EET A;  1JLE A;  2IDO A;  3A2F A;  1KVC A;  3IS9 A;  3TAG A;  1HYS A;  4CF2 A;  1JLF A;  2F96 A;  4DFJ A;  3ZSR A;  2EHG A;  3U6F A;  3QEV A;  4FK2 A;  4OPK A;  3MAQ A;  4Z4F A;  4FLV A;  4HUG A;  3PO4 A;  1WSJ A;  4OKJ A;  3LP0 A;  3AVA A;  4J2B A;  3L2Q A;  3OJU A;  5CZ1 A;  3E01 A;  4M42 A;  2VWJ A;  4CK1 A;  3CYM A;  4AHC A;  3SUQ A;  1GOB A;  4KFB A;  3AVJ A;  3P5J A;  4JS5 A;  5I3U A;  1BIZ A;  4I9L A;  1J53 A;  1ASU A;  4RW9 A;  1TGO A;  4YNQ A;  3KLF A;  4BDY A;  2D0A A;  5KGX A;  4E7J A;  1A5V A;  2P5O A;  3V1Q A;  4DTS A;  1TKZ A;  4M3Y A;  1QSL A;  1XI1 A;  2P5G A;  4DWI A;  1UA0 A;  2YNF A;  4B9T A;  3RWU A;  4DTR A;  2Q3S A;  3AO4 A;  3LAL A;  1VRU A;  4GMJ B;  3VQP A;  1C1B A;  1DTQ A;  5HRP A;  3QES A;  5I42 A;  3TWH A;  1N6Q A;  3KD1 E;  4HCC A;  1CXU A;  4OKE A;  3SQ0 A;  5KI6 A;  1S1X A;  1RDA A;  1SKS A;  2VG5 A;  1Z26 A;  4CJR A;  3L2W A;  3NFA A;  4DTO A;  1T05 A;  1JLC A;  3OYJ A;  1UAX A;  3KK2 A;  2D0B A;  4KKO A;  4CEB A;  1ASW A;  4Y1C A;  4FLX A;  4DTJ A;  1REV A;  1SV5 A;  3LP3 A;  3AVC A;  4CF0 A;  1EXQ A;  3RRH A;  2XHB A;  4CEC A;  4KHW A;  1KVB A;  5KRS A;  1XC9 A;  1KSP A;  1S5J A;  2GBZ A;  1NJX A;  4OGC A;  1RT3 A;  4LH4 A;  4FCY A;  4W5T A;  1WSH A;  1KLN A;  2HMI A;  2HHU A;  3ZT2 A;  3LAK A;  3RRG A;  4PA1 A;  2OZM A;  5HBM A;  4CJK A;  1QE1 A;  4Z4C A;  1S6P A;  3TAB A;  5C24 A;  3AA4 A;  5HRN A;  3AVK A;  2KZM A;  1X1P A;  1TL1 A;  1VK0 A;  4IDK A;  2A1S A;  1MU2 A;  4I2P A;  3ZSO A;  3RTV A;  1LWC A;  1L3V A;  2VG7 A;  4CIE A;  4KAZ A;  4FJN A;  2IC3 A;  2IS3 A;  4LY7 A;  1HMV A;  1N5Y A;  5HLF A;  5SWM A;  3ZCM A;  3QNO A;  1UA1 A;  3PX4 A;  3DRR A;  1WNS A;  1KLM A;  4N76 A;  1IO2 A;  5D3G A;  4FXD A;  1ZBI A;  4BAC A;  4F3T A;  3ZT0 A;  4CJQ A;  3D0P A;  4E7H A;  1IKX A;  1ZBU A;  3B6O A;  3AO5 A;  3AA2 A;  4E19 A;  3AO3 A;  4OKK A;  3DLE A;  4EP5 A;  5HRS A;  1VSL A;  3L3U A;  4M3T A;  1SKW A;  1LWF A;  1RT5 A;  4FLU A;  3VA0 A;  4DLG A;  2QK9 A;  4W5R A;  3V9U A;  4KHS A;  1ZBL A;  4DTU A;  3V9W A;  1JLB A;  1FK9 A;  3C94 A;  3MEG A;  3SNN A;  3I8D A;  1TL3 A;  2RKI A;  4BWM A;  1ZYQ A;  2RF2 A;  1ZBF A;  1JLQ A;  2HNY A;  1JXB A;  2ATQ A;  4ID1 A;  3TR8 A;  3HYF A;  4CF1 A;  2E6M A;  4CHY A;  4W5Q A;  1NKC A;  2HHV A;  1TK5 A;  1I3A A;  1YT3 A;  3M8Q A;  4H8K A;  3ZSY A;  4OGE A;  5EU7 A;  3LDS A;  3SZ2 A;  4B9M A;  1JKH A;  4DQP A;  5FRN A;  3VQ9 A;  2F8T A;  4CE9 A;  2KTQ A;  4B3O A;  5E41 A;  3K5M A;  4FJX A;  3SUN A;  1L3S A;  3SUP A;  1ITG A;  4FJ8 A;  3IAY A;  3S9H A;  3LAM A;  4ID5 A;  5J2Q A;  3LP2 A;  1X9W A;  3KTQ A;  2DY4 A;  3DLH A;  4AH9 A;  4HUF A;  4B8A B;  1WSE A;  3S3N A;  1DLO A;  4JLH A;  4BWJ A;  1RT6 A;  4O55 A;  1L5U A;  3AVG A;  4DTM A;  1G15 A;  1JL2 A;  3DOK A;  3TAF A;  3QIO A;  3THV A;  1TKD A;  1NK0 A;  1S1W A;  4F4K A;  4NYN A;  2O4I A;  4N56 A;  1HQU A;  3H08 A;  5HRR A;  1HRH A;  3NGI A;  3G0Z A;  4Z4H A;  4KRE A;  1D9F A;  3NDK A;  4PUO A;  3HPG A;  1HNV A;  3M8S A;  4KB1 A;  1EKE A;  4GW6 A;  1RTH A;  3NHG A;  3B6P A;  4I7F A;  3V6D A;  4CGD A;  3OVN A;  1CZB A;  3ZSX A;  1X9M A;  1YVU A;  2B4J A;  2IGI A;  4FJH A;  4CHO A;  3DM2 A;  3QIN A;  3RMC A;  3LP1 A;  4LD0 A;  1T7P A;  3HK2 A;  4KHY A;  4DMN A;  4CES A;  1HNI A;  4JRQ A;  1BGX T;  4FW1 A;  2DFH A;  1WSF A;  3VQC A;  4XIU A;  4ICL A;  3ZT3 A;  4AIL C;  4CEO A;  3O3G A;  4YFU A;  4DU3 A;  1NK6 A;  2YNG A;  4CGH A;  4C8M A;  1C0T A;  4KO0 A;  4JS4 A;  4BE0 A;  5KGW A;  4CEQ A;  4DSI A;  4N41 A;  1T8E A;  2PYL A;  4DF8 A;  1NK8 A;  2X6N A;  2GUI A;  3SYZ A;  3AVF A;  1Q9Y A;  2HVI A;  3PX0 A;  4PWD A;  1VSF A;  2KFZ A;  2Z1H A;  1C0M A;  4ZHR A;  4GVM A;  2XRI A;  4H4M A;  4G1Q A;  4CGF A;  1BHL A;  3OY9 A;  3DLK A;  4M3Z A;  4HTU A;  3LWL A;  4O4G A;  4EZ6 A;  4KHQ A;  3PY8 A;  3RR7 A;  3NGZ A;  4CJW A;  4HHT A;  2E6L A;  3IRX A;  1WSI A;  1RNH A;  3K5O A;  3DOL A;  1CZ9 A;  2HHS A;  3T1A A;  4BE2 A;  3KKR A;  3M8P A;  5C42 A;  3TI0 A;  1D8Y A;  3TAM A;  1J9A A;  4CF8 A;  2YKN A;  1JL1 A;  3VQQ A;  1VSE A;  4C8L A;  3VQ6 A;  3VQ4 A;  3QO9 A;  3V9S A;  2F8S A;  4ZTF A;  2FBT A;  4L8R B;  1CLQ A;  1UWB A;  1ZBH A;  1BL3 A;  3OYG A;  1VSK A;  4FJM A;  2XO7 A;  4QOZ B;  2E4L A;  2OPP A;  5CZ2 A;  2OPR A;  4ZTJ A;  4M3X A;  1W0H A;  2FBV A;  3SPY A;  1WAJ A;  1FXX A;  5DK5 A;  1RDC A;  3OYM A;  4DF4 A;  2DFE A;  2HVH A;  1L3U A;  4KHU A;  3CFR A;  2HHT A;  4KV8 A;  3I0R A;  3L2V A;  3VQ7 A;  3HJF A;  1BIS A;  5K14 A;  4CHQ A;  2Y1I A;  2QXF A;  2X6S A;  2HND A;  3NH1 A;  3QER A;  4FJI A;  4IBN A;  3P1G A;  3K59 A;  1IKY A;  4LSL A;  3NAE A;  4FLZ A;  4FJK A;  1BCO A;  1LWE A;  1GOA A;  5FRO A;  2XY5 A;  3CM5 A;  1BI4 B;  4DFP A;  1TK8 A;  4J2D A;  2YNI A;  4CGI A;  2B6A A;  4WE1 A;  4CJ3 A;  1J5O A;  1KFD A;  4FYD A;  3V4I A;  1TKT A;  3OYN A;  2Z1J A;  1XWL A;  4KPY A;  3L8B A;  1LAV A;  1HYV A;  4CJL A;  4MQ3 A;  2YHA A;  3JSM A;  1RBT A;  1HQE A;  3LZI A;  3S3O A;  2IAJ A;  3TAP A;  1U49 A;  1NKB A;  1RBU A;  2HHX A;  3NF9 A;  4E1M A;  3HPO A;  3K58 A;  1HYZ A;  4E7K A;  4NCA A;  1S1U A;  3WNG A;  5SZT A;  3K5N A;  3SQ1 A;  2RN2 A;  3QEP A;  1RT7 A;  1VSI A;  4CER A;  3VQE A;  1RBR A;  3LAN A;  4FLY A;  4DSJ A;  2ETJ A;  2ZE2 A;  1IKW A;  3HVT A;  2FBX A;  3KLH A;  1R0A A;  1NK5 A;  4KB0 A;  1VSM A;  5T7B A;  1KVA A;  4Z0U A;  4FK0 A;  3V81 A;  1WAF A;  2B5J A;  2FBY A;  3C6U A;  3SUO A;  4KTQ A;  3DRS A;  4Z4I A;  4FM1 A;  3U3Y A;  4AHV A; 
#chains in the Genus database with same CATH topology
 3ISN C;  4CFC A;  1D4X A;  1VQM N;  3ITH A;  5HP1 A;  3ZSQ A;  3O6W A;  4FOI A;  4Z4G A;  1QS4 A;  4EZ9 A;  3K2P A;  2ASO A;  3R9P A;  1HKB A;  4DR5 K;  1KXP A;  2YKM A;  1BDG A;  1JXE A;  5MLC Q;  4YHH K;  2OTJ N;  3SJH A;  1RBS A;  2HST A;  4BRE A;  3AO2 A;  4FWM A;  3WNF A;  4DQS A;  3J80 O;  3QET A;  2Z1I A;  1L3S A;  1RTI A;  4UQG A;  3OYL A;  1NGH A;  3P83 D;  3PUF A;  5C25 A;  4U7B A;  3NE6 A;  2BE2 A;  3MXM A;  3N4P A;  2JLE A;  3CME N;  2BUP A;  3WQU A;  4DKW A;  1VQ8 N;  4CZI A;  4F2S A;  2HHQ A;  1LW2 A;  2GX9 A;  5J1E A;  1N33 K;  1NGG A;  4B9S A;  4JEP A;  5AZI B;  3OYF A;  3CFO A;  1XHX A;  2DFF A;  1IH7 A;  1Q82 O;  3VEN A;  4B1Z A;  4YOR A;  3SQ2 A;  1NOZ A;  4M41 A;  1DT9 A;  2RE2 A;  3HI0 A;  4CEZ A;  4DQR A;  3A5N C;  5C2F A;  1N34 K;  2DTU A;  4KHP K;  3VEV A;  3K5L A;  1QSS A;  4BRN A;  4Z4E A;  1HNW K;  3OS0 A;  1QSY A;  2O8F A;  3NH0 A;  1VSJ A;  1HPZ A;  3CG7 A;  5CE3 A;  1BI4 A;  3A5M C;  2XY8 A;  1Q8I A;  2GTD A;  4CK3 A;  4DLE A;  3CI5 A;  2UXB K;  1XQS C;  3OYB A;  1GLF O;  1BQM A;  2EX3 A;  2ZGZ A;  4BR7 A;  5FDL A;  4ISE A;  4ELV A;  3FLC O;  4H5N A;  4DSL A;  1QVG M;  1L3T A;  1TAQ A;  3DRP A;  1IBM K;  4WFN L;  1RDU A;  3EEQ A;  3LWM A;  4M3U A;  3VA3 A;  5JMV A;  1MWK A;  3EKU A;  2NUB A;  5CYQ A;  3HSC A;  1OH5 A;  4G9Z A;  4CJ5 A;  3DLB A;  3V1R A;  3H1Q A;  4H0T B;  2PZS A;  3EKS A;  1VQ5 N;  1NK7 A;  1JLA A;  4ILJ A;  1SL2 A;  1QTM A;  2HNZ A;  4BRP A;  4IG0 A;  1RTD A;  3HP9 A;  4N47 A;  3O4W A;  4KBO A;  2CGJ A;  1VQ6 N;  3BP8 A;  4YDU C;  4NCG A;  2HF3 A;  3FZM A;  3M6G A;  3CJB A;  3DLR A;  2ITM A;  1NJY A;  2PY5 A;  1GOC A;  3HT3 A;  3GBT A;  4JI8 K;  3FE1 A;  3FGU A;  4MDA A;  1HX1 A;  1M90 O;  2PBD A;  4FLW A;  3AVM A;  3MWT A;  5AQX A;  3AVI A;  1D9D A;  2P9N B;  3TSP A;  3AAP A;  4BC5 A;  3OS2 A;  4CFB A;  4DS5 A;  4AF1 A;  1C6V A;  3LL3 A;  1C0F A;  3G10 A;  3AVN A;  4WFB L;  3SQ4 A;  4DUZ K;  3M8R A;  4B9U A;  2ITG A;  1P90 A;  5M1Q A;  2X74 A;  3HRG A;  1KFS A;  3QDK A;  3V1O A;  3QLH A;  5M1K A;  1RFQ A;  1B9F A;  3EZ5 A;  3H46 O;  2Q36 A;  1Z6R A;  3OS1 A;  4GV6 A;  4K8Z A;  2H3G X;  1U47 A;  4RWT A;  4A5B A;  4RW6 A;  3UB5 A;  4RW8 A;  3CC2 N;  5M1O A;  5J2N A;  5J2P A;  4DSK A;  3C6T A;  5GAH P;  4E0D A;  3E9L A;  3OTO K;  1KCF A;  3BGR A;  4F2R A;  4BE1 A;  2GEM A;  1O13 A;  4BDZ A;  4DV6 K;  2FC0 A;  1S1V A;  2F4V K;  4B3S K;  2XY6 A;  3VQ5 A;  3DAW A;  1NNE A;  3A2F A;  1HYS A;  2NRH A;  4CF2 A;  3QEV A;  3MAQ A;  4Z4F A;  4FLV A;  2FF6 A;  4DV1 K;  3OJU A;  1S3X A;  3LM2 A;  2CGK A;  3L4Q A;  4B3R K;  4JK9 A;  3CCQ N;  4GKK K;  3P5J A;  4YNQ A;  4M3T A;  3PIO L;  1A5V A;  3VOV A;  4M3Y A;  1XI1 A;  1SAZ A;  2OTL N;  3AAR A;  3RWU A;  1EO1 A;  3HOT A;  2P9L B;  3LAL A;  4J8F A;  3VQP A;  3QES A;  5HRP A;  3THY A;  3CCE N;  4ISF A;  4LFB K;  2VG5 A;  1Z26 A;  4DTO A;  3KK2 A;  2D0B A;  3HBT A;  1HUX A;  1ASW A;  5FPN A;  5AQP A;  4DTJ A;  1REV A;  3LP3 A;  4JI0 K;  1K9M O;  3U4L A;  2XHB A;  3GDQ A;  4CZH A;  1XC9 A;  2GBZ A;  3P31 A;  3U9D A;  4LH4 A;  2P9N A;  1E4F T;  4FCY A;  1YIT N;  4FL9 A;  3LAK A;  2OZM A;  4FOE A;  2W6L A;  5C24 A;  2HBJ A;  4BVO A;  4IFE A;  4IDK A;  2A1S A;  3O1W A;  5AQN A;  3RTV A;  1MA9 B;  3CCV N;  1IJJ A;  4KAZ A;  2IS3 A;  2FF3 B;  3FFK B;  3ZCM A;  3O1B A;  5FPD A;  3TTC A;  1WNS A;  1KLM A;  3ENH A;  4FXD A;  1ZBI A;  3VES A;  3ZT0 A;  4QS7 A;  5AQI A;  1XMQ K;  4E7H A;  3AA2 A;  2QWN A;  1VSL A;  1SKW A;  3W3D A;  1RT5 A;  4IJA A;  4FLU A;  3VA0 A;  2QK9 A;  2W41 A;  4W5R A;  3V9U A;  4KHS A;  1ZBL A;  4DTU A;  1BA1 A;  3O9T A;  4JV5 K;  1XUP O;  4DV5 K;  2E6M A;  4CHY A;  1NGJ A;  1YT3 A;  4DQP A;  5EU7 A;  4CE9 A;  1Q81 O;  3K5M A;  1ITG A;  3S9H A;  3LAM A;  1YI2 N;  4ID5 A;  3FR0 A;  1WSE A;  3VGL A;  3S3N A;  4JLH A;  2ASP A;  1XMO K;  1NGF A;  1L5U A;  4IO8 A;  3IMX A;  4DTM A;  3DOK A;  1JL2 A;  1ATR A;  4JKF A;  3EZW A;  4OPH A;  4YOV A;  1HNX K;  5LJV A;  4N56 A;  5BN9 A;  3G0Z A;  3AAQ A;  4KRE A;  1D9F A;  3NDK A;  3ATV A;  1YJN N;  2NLX A;  4PKI A;  4CGD A;  3OVN A;  5GAD P;  3ZSX A;  2ASM A;  4CHO A;  3RMC A;  4LD0 A;  2P9L A;  4KHY A;  4DMN A;  3MN5 A;  5M1N A;  3LDO A;  3HOS A;  1BGX T;  1NWK A;  3MCP A;  3VQC A;  4BR0 A;  4XIU A;  4ICL A;  1NK6 A;  2JWL A;  4DU3 A;  2YNG A;  4BE0 A;  4KO0 A;  4YOX A;  3C6A A;  1T8E A;  2PYL A;  2AP1 A;  4DF8 A;  3AVF A;  1CZA N;  1VSF A;  2KFZ A;  4GVM A;  1OKJ A;  4H4M A;  5AQQ A;  3Q7C A;  4M7Y A;  4EZ6 A;  3PSI A;  4DHY A;  3BEX A;  4BRD A;  1BU6 O;  4CZF A;  1WSI A;  3K5O A;  2HHS A;  2HOE A;  3M8P A;  2YKN A;  4C8L A;  1WBB A;  3V9S A;  5BRD A;  2F8S A;  2FBT A;  2YCH A;  1CLQ A;  1VSK A;  4FJM A;  2IVP A;  1NMD A;  2FBV A;  2KLA A;  3SPY A;  1FXX A;  3OYM A;  4B9Q A;  3L4I A;  2QM1 A;  3QFU A;  4H5T A;  4CHQ A;  3A5O C;  3L6Q A;  2QXF A;  1YJ9 N;  4CD1 A;  3NH1 A;  3WXI A;  4IBN A;  4BG9 A;  3J7A P;  1ATS A;  1C0G A;  5BR8 K;  4NO7 A;  4FWK A;  1GLC G;  5GIO A;  1BCO A;  1LWE A;  1GOA A;  3UKR B;  2XY5 A;  3CM5 A;  2B6A A;  1J5O A;  4K0K K;  1TKT A;  1QZ5 A;  2YHA A;  2IAJ A;  3TAP A;  1RBU A;  5AQU A;  2E2P A;  3HPO A;  1HYZ A;  3O9Q A;  2A41 A;  3WNG A;  3K5N A;  3SQ1 A;  3LDQ A;  3VQE A;  3EE8 A;  3B8A X;  4DSJ A;  3I56 N;  2KZZ A;  2ZE2 A;  1R0A A;  4KB0 A;  1NK5 A;  4JN4 A;  4B1Y B;  3PIP L;  4Z0U A;  2HF4 A;  4KTQ A;  2FBY A;  2HBK A;  4JKH A;  4AHV A;  1OH6 A;  5DM6 L;  1XNQ K;  1I94 K;  1S6Q A;  2ZD1 A;  1X9J A;  4PKH A;  3NCI A;  4IOA L;  1J6Z A;  2OPQ A;  1BCM A;  3SCX A;  5A2Q O;  3EO3 A;  2G8U A;  1ATN A;  4LF4 K;  3NMU A;  4W5O A;  4CZK A;  4DSE A;  4C8K A;  3W0L A;  3J7Z O;  2G8I A;  3DXM B;  4JKA A;  3NBP A;  5EOY A;  3MDQ A;  4NB4 A;  4AHT A;  4O0J A;  3DYA A;  1VHX A;  1MWM A;  2O8E B;  2OZS A;  1BQN A;  2GUP A;  4YDU A;  1N8R O;  3VER A;  1YIJ N;  3JYT A;  4NXM K;  3LDL A;  5AQR A;  3SPZ A;  3IUC A;  4B8C A;  4BRA A;  3ULD A;  1NM1 A;  3MED A;  2D5R A;  1BA0 A;  4CGG A;  5JLF A;  2A1R A;  4CJS A;  2G8V A;  4RG8 A;  3A5L C;  5TKW A;  1RCH A;  4DQI A;  3LPT A;  1ZC6 A;  3MXJ A;  4GV3 A;  2IVO A;  4YY3 K;  3T69 A;  3I8B A;  5BR9 A;  3PX6 A;  2A3Z A;  4CJV A;  4XEI A;  4DUY K;  2UYT A;  3UIQ A;  1Z05 A;  2KQ2 A;  3ATU A;  3TSU A;  3CCS N;  2YV0 X;  3DWL A;  4WQ4 C;  4H5R A;  1NK9 A;  4DR7 K;  3ID6 A;  4FVM A;  3WEE B;  1SKR A;  5JVH L;  1EX4 A;  5AFU A;  4JK7 A;  1FW6 A;  4M45 A;  4GVE A;  3ZT4 A;  1EP4 A;  1U6Z A;  1ILY A;  2HW3 A;  3TAR A;  4BQZ A;  4PKG A;  4AHU A;  2WBN A;  2OA8 A;  4AQY K;  3NGY A;  3UE5 A;  5BRE A;  3MEE A;  3C7N B;  3RMD A;  3O08 A;  4NXN K;  3VQA A;  1W97 L;  4HWI A;  2ZJQ L;  4AHS A;  3G71 N;  4DV2 K;  4CHZ A;  1NGE A;  4FJL A;  1RIL A;  4IG3 A;  2WON A;  3DI6 A;  4B1W B;  2YNH A;  4FZX C;  4AHR A;  5JS2 A;  5HRO A;  3CJ7 A;  2IIR A;  1B9D A;  1HJO A;  3RMB A;  4FJJ A;  4HVJ A;  1WB9 A;  4JYA K;  3L2U A;  4BGA A;  4GNI A;  3SK3 A;  1W9H A;  3V9Z A;  3LDP A;  3P39 A;  1C1A A;  2Q0R A;  3NF8 A;  4R5P A;  4CFD A;  3T19 A;  3OYH A;  4BC4 A;  1F21 A;  3T1H K;  3E9P A;  3HO1 A;  4DU4 A;  4KH5 A;  3L0Q A;  4JD2 B;  4C8O A;  4QCL A;  3KVG A;  3AVH A;  2GWJ A;  4K43 A;  3PV8 A;  4H0V B;  4A5A A;  1S22 A;  4MLE A;  3O3F A;  4KHN A;  2VYP A;  3DLG A;  4CF9 A;  2E8A A;  4M63 C;  2O8E A;  4H5W A;  4PQU A;  3WXJ A;  2VQE K;  2YHY A;  1YHQ N;  1QHT A;  1KAX A;  3N4Q A;  3KLI A;  3CF5 L;  4YOY A;  1RT1 A;  5LY3 A;  1SZ2 A;  2ZF5 O;  4RW7 A;  1ASV A;  3DLL L;  4CBX A;  1KAY A;  3ENB A;  1TUY A;  3CQ8 A;  4DV0 K;  2NNW A;  3ZX0 A;  2VG6 A;  2JGU A;  3O9R A;  4DFK A;  3ZSW A;  3G4S N;  1NU0 A;  3OHR A;  4CJT A;  1NOY A;  3THX B;  4IFY A;  4WYB A;  3TAE A;  4Y1D A;  4CZM A;  1IG8 A;  4ILG B;  3WEE A;  2WOM A;  4KI6 A;  2I7N A;  1SL0 A;  3LZJ A;  4YOT A;  4RTF D;  2YHB A;  1C0U A;  1BO5 O;  1LCU A;  3KKS A;  4QS9 A;  4CEA A;  3MWP A;  3QEW A;  2VWK A;  1OH8 A;  3H6E A;  5J2M A;  2QWR A;  3C7N A;  3OYA A;  1JLE A;  2IDO A;  3IS9 A;  5AQJ A;  3SBT A;  4HUG A;  3AVA A;  1VQO N;  4X64 K;  4CJ7 A;  5AZJ B;  4M42 A;  1EQY A;  4BY9 C;  4FSV A;  1BIZ A;  4I9L A;  5LMN K;  4FJK A;  1TGO A;  4E7J A;  3DJC A;  1NGD A;  3V1Q A;  3KK7 A;  1JJ2 M;  1TKZ A;  3J81 O;  4FVU A;  2YNF A;  4B9T A;  4DTR A;  3RVC A;  4WF9 L;  4IO9 L;  1VRU A;  5F2R A;  1DTQ A;  3KD1 E;  3QBW A;  1MDU B;  3TWH A;  4HCC A;  2UU9 K;  1CXU A;  2I7P A;  3SQ0 A;  1RDA A;  4JD2 A;  3AY9 A;  3NFA A;  1JLC A;  4KKO A;  3D2E A;  4Y1C A;  1JCF A;  1SV5 A;  3FZF A;  2Q31 A;  1N32 K;  2F9T A;  3A8Y A;  3BUZ B;  3ZT2 A;  5KPR A;  3THY B;  3AA4 A;  2KHO A;  3AVK A;  1X1P A;  2HMP A;  3IKM A;  1EWQ A;  4IXC A;  5JVG L;  3CCL N;  3ZSO A;  2AA4 A;  1L3V A;  4FJN A;  2RHK A;  4LY7 A;  1HMV A;  1N5Y A;  5HLF A;  1V4S A;  3QNO A;  2CGL A;  4CD3 A;  1UA1 A;  5KQD A;  3THX A;  4F3T A;  3D0P A;  4GY2 B;  1ZBU A;  1IV0 A;  5AQM A;  3AO3 A;  4OKK A;  4EP5 A;  5HRS A;  1LWF A;  4IOC L;  4DR2 K;  4BR2 A;  2ZWH A;  2QI2 A;  4C23 A;  3C94 A;  5FLX O;  4JKB A;  2RF2 A;  4ID1 A;  1JLQ A;  1KSP A;  2ATQ A;  3LDS A;  3ZSY A;  4B9M A;  5FRN A;  1JKH A;  3BZK A;  3VQ9 A;  2KTQ A;  4B3O A;  4CBW A;  1YJW N;  4B1X B;  2HHH K;  3IAY A;  3LP2 A;  1X9W A;  3KTQ A;  1DLO A;  3CXC M;  1RT6 A;  3D2F B;  2NRT A;  3AVG A;  4A62 A;  1NK0 A;  5AZJ A;  1S1W A;  4NYN A;  3HM8 A;  2O4I A;  1HQU A;  1YF5 L;  5HRR A;  2FSJ A;  2P9S B;  4Z4H A;  2Q2R A;  1NG9 A;  2O8D B;  3B6P A;  1CZB A;  1YVU A;  3R1X A;  4FJH A;  3DM2 A;  3CER A;  4BR5 A;  4LF9 K;  1VQN N;  3EE9 A;  2GEL A;  2DFH A;  1WSF A;  4AIL C;  4AM7 A;  4CGH A;  1C0T A;  3C65 A;  3QML A;  4V19 S;  2WTU A;  4DSI A;  3JS6 A;  3SMP A;  3JAM O;  1NK8 A;  2X6N A;  3VPZ A;  1Q9Y A;  3PX0 A;  5CHI A;  3OY9 A;  4O8U A;  2YI1 A;  3K0S A;  3RR7 A;  3QIC A;  5TKY A;  1KD1 O;  3DOL A;  1CZ9 A;  1K8K A;  3T1A A;  4MDB A;  3KKR A;  3RSE B;  5C42 A;  4BE2 A;  1D8Y A;  3F2K A;  4CF8 A;  2UUA K;  1VSE A;  2NRW A;  5HOO A;  2UXC K;  5C0Y A;  4BR4 A;  3VQ4 A;  3QO9 A;  2D0P A;  4BVP A;  3OBY A;  4L8R B;  1UWB A;  2XO7 A;  4QOZ B;  4BRL A;  5GAE P;  4M7X A;  4M3X A;  5DK5 A;  5LMU K;  1YAG A;  2DFE A;  1L3U A;  2HHT A;  4RCH A;  4KV8 A;  3I0R A;  3P38 A;  3MCA B;  3QER A;  4MO4 A;  3ZLJ A;  4FJI A;  3P1G A;  3NAE A;  1IKY A;  4WQ4 A;  4FLZ A;  4H0O A;  4K41 A;  1N36 K;  2PFU A;  1KFD A;  3HTV A;  3OYN A;  1RDW X;  3L8B A;  1LAV A;  4CJL A;  3JSM A;  1HQE A;  4AM6 A;  3UKU A;  4BRG A;  3D2F A;  5E26 A;  4EHU A;  3I33 A;  4EFH A;  4YOW A;  3QEP A;  4LF8 K;  1RT7 A;  1VSI A;  4LC9 B;  4CER A;  2HBM A;  1JCG A;  1IKW A;  5KPZ A;  1WAF A;  4BRC A;  3DRS A;  1SS6 A;  2P9S A;  4BG8 A;  3L2R A;  5AQO A;  2O8D A;  4H0X B;  2R7Y A;  4H5V A;  1JCE A;  4EP4 A;  4F3O A;  1I39 A;  5C2D A;  3WNE A;  3VF6 A;  2Y1J A;  4FJ5 A;  5KTQ A;  1KTQ A;  3VEW A;  4FZZ A;  5AFU H;  3VF2 A;  2QW9 A;  2IOC A;  4LH5 A;  5CY4 A;  1GLL O;  3ALY A;  4FM0 A;  3TAQ A;  4W5N A;  2WC9 A;  3ZSZ A;  3CET A;  3G6E N;  1FKO A;  1WSG A;  4CEF A;  2IVN A;  3VQD A;  2UUB K;  4JHD B;  3IG1 A;  3VEO A;  3CM6 A;  3ZX3 A;  4GV9 A;  2QKB A;  3CJC A;  3GOI A;  4ELU A;  4FJ9 A;  1NBW A;  5AQT A;  4E3S A;  2D1K A;  4MO5 A;  4NCB A;  5BN8 A;  1TV6 A;  3ID8 A;  1U48 A;  3ZSV A;  4KI4 A;  4CJF A;  3U9Z A;  4CJE A;  3QEI A;  2DPN A;  3RSE A;  3AVL A;  3HP6 A;  3QIP A;  2P9P B;  1T44 A;  4JRP A;  2W42 A;  1NKE A;  3R6M A;  3HVR A;  3HZ6 A;  1BOT O;  5BPL A;  2QA4 N;  3BF1 A;  1X3M A;  4DFM A;  1NK4 A;  4ELT A;  2OPS A;  1NJW A;  4CFA A;  4CBU A;  4DTN A;  3NF6 A;  3HXM A;  5ADX H;  4FK4 A;  4CZE A;  3O4Q A;  5F1X A;  4PL7 A;  2QEX N;  4TSX A;  3NVM A;  5BRH A;  4DTX A;  5AQS A;  1VQL N;  3CCM N;  4OJR A;  1GLD G;  4DV3 K;  3KLE A;  1Q9X A;  2G8K A;  4N5S A;  3SLC A;  4IKF A;  2Q0U A;  1TKX A;  3T3F A;  3SV3 A;  2F9W A;  3VTH A;  3FFI A;  1KRP A;  4FM2 A;  4QS8 A;  3L3V A;  4EAH D;  4JNE A;  2YJF A;  4M3R A;  2E2O A;  5GIP A;  3HL8 A;  2YHX A;  2W40 A;  4E1N A;  1SUQ A;  4KTZ A;  2HB5 A;  5AJ3 K;  1S72 N;  4KRF A;  4J2A A;  4O5B A;  4F8R A;  3CD6 N;  4PL8 A;  3CMA N;  4OVL A;  2QKK A;  3FZK A;  4FZY A;  1VSH A;  4I9Q A;  5FPM A;  1NGA A;  4C8N A;  4LSN A;  3OA9 A;  4I2Q A;  1ZXO A;  3GL1 A;  1GLB G;  3O80 A;  4H4O A;  2D4W A;  2HHW A;  2VCP A;  1DTT A;  4FPB A;  4JHD A;  1K6Y A;  1C1C A;  5CYM A;  1U45 A;  3CQY A;  3CPW M;  3C95 A;  3JXU A;  3T7Z A;  4IFV A;  2YHW A;  2VGN A;  3SI6 A;  2NRR A;  1WUA A;  4IWV A;  4FLT A;  2V52 B;  2V7Y A;  3K57 A;  4HTL A;  5HL7 L;  2OYQ A;  2P9P A;  3AV9 A;  4RW4 A;  4PY5 A;  1T6D A;  1TYQ B;  1RDD A;  1QZ6 A;  1LW0 A;  3HST B;  1IG9 A;  3H3N O;  3U3G A;  4B08 A;  2D0O A;  4CIF A;  3ASM A;  3SAF A;  1BG3 A;  3O9U A;  3F9M A;  1BUP A;  3AO1 A;  3ENO A;  3AGR A;  3KZB A;  5BRF A;  3S3M A;  1T6C A;  4CZJ A;  1YUW A;  3LM9 A;  3OYI A;  2X78 A;  4FJG A;  3F9K A;  3IDH A;  1VSD A;  2GV9 A;  4K8X A;  3AA5 X;  4EHT A;  2J4R A;  5JS1 A;  3DMJ A;  1YTU A;  4FJ7 A;  4CK2 A;  5KQ8 A;  2NRX A;  1QQC A;  4FWN A;  3HPH A;  2XY7 A;  1ZBS A;  1GLE G;  1S1T A;  2BGG A;  4B9N A;  2E20 A;  2OCE A;  4KTW A;  3O5B A;  4Y0W A;  3OYC A;  4O44 A;  4DSF A;  4JKG B;  3ZEU B;  3V9X A;  4O0I A;  1EET A;  2QWL A;  1JLF A;  2F96 A;  3ZSR A;  2EHG A;  4FK2 A;  2E2Q A;  4IDH A;  1NMN A;  3F5T A;  3E01 A;  5JIC A;  3TU5 A;  4DR3 K;  2VWJ A;  4AHC A;  1GOB A;  1K8A O;  4JS5 A;  5I3U A;  2BDP A;  4RW9 A;  5I9E B;  1ASU A;  3KLF A;  4BDY A;  5KGX A;  1QSL A;  5AQF A;  3THW B;  2WFB A;  1HNZ K;  1KC8 O;  2Q3S A;  3P4I A;  5I42 A;  1C1B A;  1N6Q A;  4OKE A;  1S1X A;  4JI3 K;  4CJR A;  4OO1 J;  3OYJ A;  3K9J A;  4CEB A;  3CJ9 A;  3KWG A;  4FLX A;  2P9U B;  1VAZ A;  3RRH A;  3AVC A;  1XC3 A;  1EXQ A;  5LL6 Z;  1KVB A;  5KRS A;  3C6H A;  1S5J A;  2VQF K;  1NJX A;  4OGC A;  1RT3 A;  2YJE A;  1G99 A;  2FLO A;  4W5T A;  1WSH A;  2HHU A;  3RRG A;  1V4T A;  4JI4 K;  5HBM A;  5ADX A;  4CJK A;  4Z4C A;  1VK0 A;  3BY5 A;  1TYQ A;  5C10 A;  4X66 K;  4I2P A;  4A57 A;  1LWC A;  5C15 A;  2VG7 A;  4XH4 A;  2V51 B;  3J7Y P;  3D2E B;  2WUS A;  5SWM A;  5E84 A;  2CH6 A;  3PX4 A;  4LF5 K;  4BAC A;  3CJA A;  4CJQ A;  5M1F A;  4BC3 A;  3B6O A;  4DV7 K;  3VTI A;  3VMF B;  3D6R A;  3G25 A;  1VQK N;  1NGC A;  4DLG A;  2P9I B;  2KKZ A;  2V7Z A;  1FK9 A;  4IJN A;  3TTF A;  3I8D A;  1TL3 A;  1ZYQ A;  1ZBF A;  4H0P A;  3TR8 A;  4CF1 A;  5GIN A;  2HHV A;  2FSN A;  3M8Q A;  3SZ2 A;  1K73 O;  2F8T A;  5BPN A;  2P9K B;  4FJX A;  2NRZ A;  4JKG A;  3ZEU A;  4FJ8 A;  4R79 A;  5J2Q A;  3WXM B;  4HUF A;  1RGI A;  4BWJ A;  4O55 A;  1G15 A;  3THV A;  3VEZ A;  4FWQ A;  4DR4 K;  1E3M A;  1NGB A;  3H08 A;  3ZET B;  2UXD K;  1HRH A;  1TUU A;  2ZJR L;  5IWA K;  4PUO A;  3HPG A;  1HNV A;  3M8S A;  4KB1 A;  4GW6 A;  1RTH A;  2QTD A;  4O8K A;  4DV4 K;  3THW A;  5GAG P;  1X9M A;  1T7P A;  3HK2 A;  5AQZ A;  3TTD A;  4IZ9 A;  4FW1 A;  2A40 A;  5FRM A;  2E1Y A;  3ZT3 A;  4FO0 A;  3O3G A;  2NRV A;  4C8M A;  4CEQ A;  2P9U A;  5M1P A;  3KHY A;  2GUI A;  5AR0 A;  4PWD A;  1C0M A;  4ZHR A;  4G1Q A;  4CGF A;  4XH1 A;  3DLK A;  3M3Z A;  4M3Z A;  4FWS A;  4JK8 A;  4O4G A;  4KHQ A;  3PY8 A;  5LJW A;  4HHT A;  4CJW A;  3R8E A;  3TI0 A;  1IBL K;  2A5X A;  1J9A A;  3R3L A;  5B8H A;  1JL1 A;  3VQQ A;  4B3M K;  4LFC K;  4ZTF A;  3CIP A;  5AQV A;  1ZBH A;  3OYG A;  1Q7Y O;  3VET A;  2E4L A;  4ZTJ A;  2O8C A;  1WAJ A;  1RDC A;  1Q18 A;  1QHA A;  4KHU A;  2P9I A;  5IT9 O;  3VQ7 A;  1K8K B;  4IOX A;  3HJF A;  5K14 A;  2HND A;  3M5R A;  3K59 A;  4LSL A;  3J8A A;  2Q1N A;  5FRO A;  1TK8 A;  4DFP A;  2YNI A;  2P9K A;  4WE1 A;  3QFP A;  4CJ3 A;  3V4I A;  3AGK A;  3FZL A;  3VEY A;  3I55 N;  4KPY A;  4DR1 K;  1HYV A;  1RBT A;  3CCJ N;  3E9O A;  1VQ4 N;  4NCA A;  3MX2 A;  5SZT A;  2RN2 A;  3LAN A;  2ETJ A;  4N76 A;  3Q7B A;  5JLH A;  1J5E K;  1OVQ A;  5T7B A;  1KVA A;  4JI5 K;  4FK0 A;  1W7A A;  3ZET A;  1HLU A;  3C6U A;  3MMV A;  3SUO A;  1NLV A;  3U3Y A;  3WQT A;  1DGK N;  4DU1 A;  2KW4 A;  4BRH A;  1VRT A;  5EVZ A;  1VQP N;  1TK0 A;  2I5J A;  1LAW A;  4IEI A;  4J2E A;  4CCH A;  4KH6 A;  4CHN A;  3D7E O;  3F73 A;  1KAZ A;  3UKU B;  3QNN A;  5KRT A;  2G8F A;  1X9S A;  2QWQ A;  1A5W A;  4DS4 A;  1FKP A;  4Q0B A;  3WXL A;  1U04 A;  5AZI A;  3D45 A;  4MLH A;  3S41 A;  3CFP A;  2BAN A;  1UOC A;  4JS4 A;  1XNR K;  2D0C A;  3OYE A;  2ZM6 K;  3QEX A;  3DXK B;  4UY8 O;  1JLG A;  1RBV A;  3NF7 A;  1YTA A;  1QQN A;  4Q5V A;  3BZC A;  4CZG A;  4OLA A;  3VQ8 A;  3TSQ A;  4CGJ A;  5BPM A;  4FM1 A;  4CJ4 A;  4DG1 A;  1WN7 A;  4B9L A;  2PYJ A;  3OJS A;  4K25 A;  1WBD A;  4L3Q A;  4HUE A;  3RMA A;  3MK6 A;  2O4G A;  4E89 A;  1O1W A;  4BDP A;  3SJJ A;  2ZQB A;  1U4B A;  4X65 K;  4CIG A;  1LV5 A;  3EYZ A;  3MEC A;  4CW7 B;  3MN7 A;  2UUC K;  4JKC A;  3OBW A;  2BTF A;  3KIO A;  1Y97 A;  5AQY A;  1X3N A;  3WT0 A;  4JI7 K;  3E1Y A;  2OAN A;  3HM9 A;  2RPI A;  2G8H A;  1TAU A;  3M1F A;  1HJR A;  4WQ5 C;  3SMS A;  1IKV A;  3FZH A;  3ZX2 A;  3I0S A;  3MN9 A;  4BRK A;  3SV4 A;  4CJP A;  1BWF O;  4FW2 A;  2FSK A;  4DQQ A;  4MFB A;  4JI2 K;  1TVR A;  4XH5 A;  4I6M B;  2HBL A;  2JWK A;  2AJQ A;  4M3W A;  3OYD A;  1E4G T;  1CXQ A;  2P51 A;  1S9G A;  2E88 A;  1NJZ A;  5CR4 A;  4E7I A;  1XHZ A;  3O3H A;  4B9V A;  3ZT1 A;  3KD5 E;  3NH2 A;  1QVF M;  5EX5 A;  3O4N A;  5AQH A;  3KJV A;  5D3G A;  4CED A;  2E1Z A;  1RT2 A;  4BQL A;  3KK3 A;  3SAG A;  3SBG A;  1HKC A;  1WLJ A;  2LSN A;  5AQK A;  1B92 A;  4K42 A;  1QQO A;  4HCB A;  4C1N K;  1HPM A;  1YXQ A;  2Z1G A;  4E7L A;  2PAV A;  2CH5 A;  3DXK A;  2P1J A;  5DMR A;  4E1J A;  2G8W A;  4QAG A;  3NVK A;  1RT4 A;  1VQ7 N;  1J54 A;  3VEX A;  1D5A A;  3VN5 A;  1SL1 A;  3BDP A;  4EIA A;  3WNH A;  2KFN A;  1S9E A;  4BRO A;  3TAN A;  1T03 A;  5C12 A;  3AVB A;  3CHW A;  1IBK K;  3AA3 A;  4CEE A;  4NYF A;  4BRQ A;  5F0X A;  1A5X A;  4OPJ A;  3CPE A;  3BF3 A;  1Y64 A;  4FWR A;  4CHP A;  3KLG A;  5EXW A;  4F9O A;  1RDB A;  4A2B A;  4FWL A;  3EY1 A;  1Z25 A;  3EL2 A;  4KH4 A;  4DTP A;  4LF7 K;  3PSF A;  1BIU A;  2GWK A;  3VQB A;  4O5F A;  3PO5 A;  3MXI A;  3LPU A;  4ISG A;  3OYK A;  4CJU A;  3KK1 A;  4OLB A;  3RR8 A;  1P8Z A;  4FPA A;  1RTJ A;  4CZL A;  3TAG A;  1KVC A;  3U8X A;  4DFJ A;  4I6M A;  3U6F A;  4OPK A;  3VGM A;  3E66 A;  3PO4 A;  1WSJ A;  1DEJ A;  4OKJ A;  3LP0 A;  4X62 K;  2QWM A;  4J2B A;  3L2Q A;  5CZ1 A;  4BRI A;  4BR9 A;  4CK1 A;  3CYM A;  3SUQ A;  2QWO A;  4KFB A;  3AVJ A;  4BRF A;  5FPE A;  1J53 A;  1QQM A;  3IFR A;  2P5O A;  2ZGY A;  2D0A A;  1OVY A;  4JAX A;  3WUH A;  4LF6 K;  4DTS A;  2P5G A;  4DWI A;  1UA0 A;  5DM7 L;  3AO4 A;  3H1V X;  4GMJ B;  3CC7 N;  5KI6 A;  1SKS A;  2E2N A;  3L2W A;  1T05 A;  1UAX A;  3T1Y K;  4OX9 K;  5AQW A;  4CF0 A;  4DR6 K;  4BRM A;  4CEC A;  4KHW A;  3WXK A;  2VGM A;  4U67 L;  3VF4 A;  1KLN A;  2HMI A;  2NZT A;  4PA1 A;  3CQX A;  4A59 A;  1QE1 A;  4GKJ K;  1S6P A;  3TAB A;  5HRN A;  1YVN A;  4Z94 A;  2KZM A;  1TL1 A;  1MU2 A;  1HKG A;  3CCU N;  4CIE A;  2IC3 A;  3DRR A;  1U2V B;  4DCH A;  1IO2 A;  3CC4 N;  2O8B B;  4NLB A;  1IKX A;  3QB0 A;  3AO5 A;  4E19 A;  3DLE A;  5EY4 A;  3L3U A;  4B1V A;  3CJ1 A;  3PLA A;  4LFA K;  3V9W A;  1JLB A;  3SNN A;  3EN9 A;  3MEG A;  2RKI A;  4BWM A;  1M1K O;  2HNY A;  1JXB A;  4W5Q A;  1NKC A;  1SQK A;  3HYF A;  1TK5 A;  1I3A A;  4H8K A;  3C0B A;  4OGE A;  3OW2 M;  4JKE A;  5E41 A;  3SUN A;  3SUP A;  5H1S Q;  4WFA L;  3SAH A;  1OH7 A;  2DY4 A;  3DLH A;  4AH9 A;  4B8A B;  4CVN E;  3ULE B;  3TAF A;  3QIO A;  1TKD A;  2ZJP L;  4F4K A;  1NGI A;  3NGI A;  3H45 C;  1HR0 K;  4BC2 A;  2Q97 A;  1NJI O;  2YX6 A;  3MN6 A;  1KQS M;  1EKE A;  3KWI A;  3NHG A;  1R59 O;  4I7F A;  3V6D A;  3GG4 A;  2FXU A;  4A61 A;  3TPQ A;  2B4J A;  2IGI A;  3QIN A;  3LP1 A;  2QXL A;  4IEE A;  4CES A;  1HNI A;  4JRQ A;  3A0I X;  3VGK A;  4CEO A;  4YFU A;  3K9K A;  4B3T K;  5ELZ A;  5KGW A;  2A42 A;  4N41 A;  4A2A A;  3O8M A;  3SYZ A;  2HVI A;  2Z1H A;  2XRI A;  4PHT X;  1GLA G;  1BHL A;  1GLJ O;  4HTU A;  3LWL A;  4FWO A;  5KPT A;  2E5L K;  4FWP A;  3H3O B;  4NLC A;  3NGZ A;  2E6L A;  3IRX A;  4JI6 K;  1RNH A;  2VWB A;  4WCE L;  5AQG A;  3TAM A;  3ZYY X;  1W2B M;  2EWS A;  1EWR A;  3VQ6 A;  4CI6 A;  3UKR A;  1U2V A;  1ESV A;  1LOT B;  2O8B A;  4JKD A;  1BL3 A;  4B1U B;  2F7T A;  1Q86 O;  4C1N I;  2OPP A;  5CZ2 A;  2OPR A;  3LDN A;  4OPA A;  1W0H A;  2A6A A;  4DF4 A;  2HVH A;  3O9S A;  3CFR A;  3L2V A;  3CCR N;  1BIS A;  2Y1I A;  4DB3 A;  2X6S A;  2O8F B;  3GE1 A;  4DQ8 A;  4J2D A;  1BI4 B;  1DKG D;  4CGI A;  4FYD A;  1H1V A;  4ILH A;  2Z1J A;  1XWL A;  4BGB A;  4MQ3 A;  1U49 A;  3S3O A;  4H0Y B;  3LZI A;  4YOU A;  1NKB A;  2HHX A;  1T3V A;  3NF9 A;  4E1M A;  3K58 A;  4E7K A;  4H03 B;  1VQ9 N;  2O8C B;  1S1U A;  3QBX A;  3ULE A;  1WOQ A;  2W6K A;  4WQ5 A;  2BH1 A;  1RBR A;  4FLY A;  3MX5 A;  4JI1 K;  3KLH A;  3HVT A;  2FBX A;  1VSM A;  1FJG K;  3DXM A;  3V81 A;  2B5J A;  4Z4I A;  5AQL A;  2QWP A; 
#chains in the Genus database with same CATH homology
 3ISN C;  4CFC A;  4DU1 A;  2KW4 A;  1VRT A;  3L2R A;  3ITH A;  5HP1 A;  2R7Y A;  3ZSQ A;  1TK0 A;  2I5J A;  1LAW A;  4Z4G A;  1S6Q A;  4J2E A;  1QS4 A;  2ZD1 A;  4EP4 A;  4EZ9 A;  4F3O A;  3K2P A;  4CCH A;  1I39 A;  3NCI A;  3WNE A;  4FJ5 A;  4CHN A;  2Y1J A;  5KTQ A;  1KTQ A;  3F73 A;  4FZZ A;  2YKM A;  3QNN A;  1JXE A;  2IOC A;  4LH5 A;  5CY4 A;  2OPQ A;  5KRT A;  1BCM A;  1X9S A;  3SCX A;  2G8F A;  3ALY A;  1A5W A;  1RBS A;  4FM0 A;  4DS4 A;  3AO2 A;  3TAQ A;  1FKP A;  2G8U A;  3ZSZ A;  4W5N A;  1FKO A;  3WNF A;  4DQS A;  4W5O A;  1U04 A;  1WSG A;  4Q0B A;  4DSE A;  3D45 A;  4C8K A;  2G8I A;  4CEF A;  3VQD A;  3CFP A;  3NBP A;  2BAN A;  3QET A;  1UOC A;  2Z1I A;  3IG1 A;  1RTI A;  4UQG A;  2D0C A;  4AHT A;  4O0J A;  3DYA A;  3OYE A;  3OYL A;  3CM6 A;  3QEX A;  3PUF A;  3P83 D;  2OZS A;  1BQN A;  2QKB A;  5C25 A;  4ELU A;  3JYT A;  4FJ9 A;  3NE6 A;  4E3S A;  1JLG A;  1RBV A;  2BE2 A;  3SPZ A;  2BDP A;  4NCB A;  3MXM A;  4B8C A;  3NF7 A;  1YTA A;  1TV6 A;  2JLE A;  4Q5V A;  3ULD A;  1U48 A;  3MED A;  3ZSV A;  4KI4 A;  2D5R A;  4CJF A;  4CJE A;  3QEI A;  4OLA A;  4CGG A;  4F2S A;  3VQ8 A;  2A1R A;  4CJS A;  2G8V A;  3AVL A;  4CGJ A;  1LW2 A;  3QIP A;  4RG8 A;  3HP6 A;  4JRP A;  2HHQ A;  1RCH A;  4CJ4 A;  5J1E A;  2W42 A;  4DG1 A;  1WN7 A;  4B9L A;  4B9S A;  4DQI A;  2PYJ A;  3LPT A;  3OJS A;  1NKE A;  3OYF A;  3MXJ A;  3CFO A;  3HVR A;  1XHX A;  2DFF A;  1IH7 A;  4HUE A;  3RMA A;  2O4G A;  4E89 A;  1O1W A;  3PX6 A;  4DFM A;  1NK4 A;  4BDP A;  4ELT A;  4CJV A;  2OPS A;  1NJW A;  4CFA A;  1NOZ A;  3SQ2 A;  3SJJ A;  4M41 A;  3NF6 A;  4DTN A;  2KQ2 A;  3HXM A;  3UIQ A;  4FK4 A;  2YV0 X;  4CEZ A;  4DQR A;  2ZQB A;  1U4B A;  3O4Q A;  1NK9 A;  4FVM A;  1SKR A;  4CIG A;  1EX4 A;  1LV5 A;  3EYZ A;  3MEC A;  2DTU A;  4TSX A;  4M45 A;  3ZT4 A;  3K5L A;  4DTX A;  1EP4 A;  1Y97 A;  3KIO A;  1QSS A;  4Z4E A;  2HW3 A;  3OS0 A;  4OJR A;  1QSY A;  3TAR A;  3KLE A;  3NH0 A;  1VSJ A;  1Q9X A;  4N5S A;  4AHU A;  2G8K A;  1HPZ A;  3CG7 A;  2OA8 A;  4IKF A;  3NGY A;  1BI4 A;  1TKX A;  2XY8 A;  3T3F A;  1Q8I A;  4CK3 A;  4DLE A;  3SV3 A;  3HM9 A;  2RPI A;  2G8H A;  3MEE A;  1TAU A;  1HJR A;  3OYB A;  3RMD A;  3FFI A;  1IKV A;  3I0S A;  3VQA A;  3SV4 A;  1KRP A;  4CJP A;  4FM2 A;  4FW2 A;  1BQM A;  4DQQ A;  4MFB A;  3L3V A;  2EX3 A;  1TVR A;  5FDL A;  4AHS A;  4M3R A;  4CHZ A;  4ELV A;  4FJL A;  1RIL A;  2AJQ A;  4IG3 A;  2WON A;  3DI6 A;  4DSL A;  2YNH A;  1L3T A;  4FZX C;  1TAQ A;  3DRP A;  4AHR A;  5JS2 A;  5HRO A;  3HL8 A;  4M3W A;  3OYD A;  4E1N A;  1CXQ A;  1SUQ A;  3LWM A;  4M3U A;  3VA3 A;  2P51 A;  1S9G A;  1B9D A;  4KTZ A;  3RMB A;  2HB5 A;  4FJJ A;  4HVJ A;  1NJZ A;  2NUB A;  5CYQ A;  4E7I A;  3O3H A;  1XHZ A;  4J2A A;  4KRF A;  4O5B A;  3ZT1 A;  4B9V A;  3KD5 E;  3NH2 A;  4F8R A;  4CJ5 A;  3L2U A;  3DLB A;  3V1R A;  2PZS A;  4OVL A;  1W9H A;  1NK7 A;  1JLA A;  3V9Z A;  2QKK A;  3O4N A;  1SL2 A;  1QTM A;  1C1A A;  2HNZ A;  4FZY A;  3NF8 A;  4R5P A;  4CFD A;  1VSH A;  3T19 A;  4I9Q A;  4IG0 A;  3OYH A;  3HP9 A;  3KJV A;  1RTD A;  4C8N A;  4N47 A;  1F21 A;  1RT2 A;  4CED A;  3KK3 A;  5FRM A;  4LSN A;  4DU4 A;  3HO1 A;  4I2Q A;  4C8O A;  4QCL A;  4NCG A;  1WLJ A;  3DLR A;  3AVH A;  1NJY A;  2PY5 A;  1GOC A;  2LSN A;  3HT3 A;  4H4O A;  1B92 A;  2HHW A;  3PV8 A;  4HCB A;  3O3F A;  4KHN A;  1DTT A;  1U45 A;  1K6Y A;  1C1C A;  3DLG A;  5CYM A;  2Z1G A;  4E7L A;  4CF9 A;  2P1J A;  5DMR A;  4FLW A;  2G8W A;  4QAG A;  3AVM A;  4PQU A;  3C95 A;  1RT4 A;  4IFV A;  1J54 A;  1QHT A;  3AVI A;  1D9D A;  3SI6 A;  1D5A A;  3VN5 A;  3OS2 A;  3KLI A;  4CFB A;  4DS5 A;  1SL1 A;  3BDP A;  1C6V A;  1RT1 A;  4FLT A;  3K57 A;  4RW7 A;  1ASV A;  3WNH A;  2OYQ A;  3G10 A;  3AV9 A;  4RW4 A;  2KFN A;  4PY5 A;  1S9E A;  3TAN A;  1RDD A;  3CQ8 A;  3AVN A;  1LW0 A;  3HST B;  1T03 A;  1IG9 A;  3SQ4 A;  2VG6 A;  3U3G A;  4B08 A;  3M8R A;  4B9U A;  2ITG A;  3AVB A;  2JGU A;  4DFK A;  2X74 A;  3AA3 A;  4CIF A;  3ZSW A;  1KFS A;  3ASM A;  3V1O A;  3QLH A;  4CEE A;  4CJT A;  4NYF A;  1B9F A;  1NOY A;  3EZ5 A;  4IFY A;  1A5X A;  4OPJ A;  3OS1 A;  3AO1 A;  3TAE A;  4K8Z A;  4Y1D A;  3S3M A;  1U47 A;  3KLG A;  4CHP A;  3OYI A;  2X78 A;  4RW6 A;  4RW8 A;  3F9K A;  4FJG A;  1VSD A;  2GV9 A;  2WOM A;  1RDB A;  4K8X A;  3AA5 X;  4KI6 A;  3EY1 A;  1Z25 A;  5J2N A;  5JS1 A;  5J2P A;  1SL0 A;  4DTP A;  3LZJ A;  4DSK A;  3C6T A;  4E0D A;  1BIU A;  2YHB A;  3DMJ A;  1C0U A;  1YTU A;  4FJ7 A;  3KKS A;  4CK2 A;  4CEA A;  1KCF A;  1QQC A;  3BGR A;  3VQB A;  4F2R A;  4BE1 A;  3PO5 A;  3HPH A;  2VWK A;  3QEW A;  2XY7 A;  4BDZ A;  3MXI A;  2KZZ A;  3LPU A;  5J2M A;  1S1T A;  2BGG A;  4B9N A;  2FC0 A;  4KTW A;  1S1V A;  3OYC A;  3OYK A;  4O44 A;  2XY6 A;  4CJU A;  3KK1 A;  4DSF A;  3V9X A;  3VQ5 A;  3OYA A;  4O0I A;  3RR8 A;  4OLB A;  1RTJ A;  1EET A;  1JLE A;  2IDO A;  3A2F A;  1KVC A;  3IS9 A;  3TAG A;  1HYS A;  4CF2 A;  1JLF A;  2F96 A;  4DFJ A;  3ZSR A;  2EHG A;  3U6F A;  3QEV A;  4FK2 A;  4OPK A;  3MAQ A;  4Z4F A;  4FLV A;  4HUG A;  3PO4 A;  1WSJ A;  4OKJ A;  3LP0 A;  3AVA A;  4J2B A;  3L2Q A;  3OJU A;  5CZ1 A;  3E01 A;  4M42 A;  2VWJ A;  4CK1 A;  3CYM A;  4AHC A;  3SUQ A;  1GOB A;  4KFB A;  3AVJ A;  3P5J A;  4JS5 A;  5I3U A;  1BIZ A;  4I9L A;  1J53 A;  1ASU A;  4RW9 A;  1TGO A;  4YNQ A;  3KLF A;  4BDY A;  2D0A A;  5KGX A;  4E7J A;  1A5V A;  2P5O A;  3V1Q A;  4DTS A;  1TKZ A;  4M3Y A;  1QSL A;  1XI1 A;  2P5G A;  4DWI A;  1UA0 A;  2YNF A;  4B9T A;  3RWU A;  4DTR A;  2Q3S A;  3AO4 A;  3LAL A;  1VRU A;  4GMJ B;  3VQP A;  1C1B A;  1DTQ A;  5HRP A;  3QES A;  5I42 A;  3TWH A;  1N6Q A;  3KD1 E;  4HCC A;  1CXU A;  4OKE A;  3SQ0 A;  5KI6 A;  1S1X A;  1RDA A;  1SKS A;  2VG5 A;  1Z26 A;  4CJR A;  3L2W A;  3NFA A;  4DTO A;  1T05 A;  1JLC A;  3OYJ A;  1UAX A;  3KK2 A;  2D0B A;  4KKO A;  4CEB A;  1ASW A;  4Y1C A;  4FLX A;  4DTJ A;  1REV A;  1SV5 A;  3LP3 A;  3AVC A;  4CF0 A;  1EXQ A;  3RRH A;  2XHB A;  4CEC A;  4KHW A;  1KVB A;  5KRS A;  1XC9 A;  1KSP A;  1S5J A;  2GBZ A;  1NJX A;  4OGC A;  1RT3 A;  4LH4 A;  4FCY A;  4W5T A;  1WSH A;  1KLN A;  2HMI A;  2HHU A;  3ZT2 A;  3LAK A;  3RRG A;  4PA1 A;  2OZM A;  5HBM A;  4CJK A;  1QE1 A;  4Z4C A;  1S6P A;  3TAB A;  5C24 A;  3AA4 A;  5HRN A;  3AVK A;  2KZM A;  1X1P A;  1TL1 A;  1VK0 A;  4IDK A;  2A1S A;  1MU2 A;  4I2P A;  3ZSO A;  3RTV A;  1LWC A;  1L3V A;  2VG7 A;  4CIE A;  4KAZ A;  4FJN A;  2IC3 A;  2IS3 A;  4LY7 A;  1HMV A;  1N5Y A;  5HLF A;  5SWM A;  3ZCM A;  3QNO A;  1UA1 A;  3PX4 A;  3DRR A;  1WNS A;  1KLM A;  4N76 A;  1IO2 A;  5D3G A;  4FXD A;  1ZBI A;  4BAC A;  4F3T A;  3ZT0 A;  4CJQ A;  3D0P A;  4E7H A;  1IKX A;  1ZBU A;  3B6O A;  3AO5 A;  3AA2 A;  4E19 A;  3AO3 A;  4OKK A;  3DLE A;  4EP5 A;  5HRS A;  1VSL A;  3L3U A;  4M3T A;  1SKW A;  1LWF A;  1RT5 A;  4FLU A;  3VA0 A;  4DLG A;  2QK9 A;  4W5R A;  3V9U A;  4KHS A;  1ZBL A;  4DTU A;  3V9W A;  1JLB A;  1FK9 A;  3C94 A;  3MEG A;  3SNN A;  3I8D A;  1TL3 A;  2RKI A;  4BWM A;  1ZYQ A;  2RF2 A;  1ZBF A;  1JLQ A;  2HNY A;  1JXB A;  2ATQ A;  4ID1 A;  3TR8 A;  3HYF A;  4CF1 A;  2E6M A;  4CHY A;  4W5Q A;  1NKC A;  2HHV A;  1TK5 A;  1I3A A;  1YT3 A;  3M8Q A;  4H8K A;  3ZSY A;  4OGE A;  5EU7 A;  3LDS A;  3SZ2 A;  4B9M A;  1JKH A;  4DQP A;  5FRN A;  3VQ9 A;  2F8T A;  4CE9 A;  2KTQ A;  4B3O A;  5E41 A;  3K5M A;  4FJX A;  3SUN A;  1L3S A;  3SUP A;  1ITG A;  4FJ8 A;  3IAY A;  3S9H A;  3LAM A;  4ID5 A;  5J2Q A;  3LP2 A;  1X9W A;  3KTQ A;  2DY4 A;  3DLH A;  4AH9 A;  4HUF A;  4B8A B;  1WSE A;  3S3N A;  1DLO A;  4JLH A;  4BWJ A;  1RT6 A;  4O55 A;  1L5U A;  3AVG A;  4DTM A;  1G15 A;  1JL2 A;  3DOK A;  3TAF A;  3QIO A;  3THV A;  1TKD A;  1NK0 A;  1S1W A;  4F4K A;  4NYN A;  2O4I A;  4N56 A;  1HQU A;  3H08 A;  5HRR A;  1HRH A;  3NGI A;  3G0Z A;  4Z4H A;  4KRE A;  1D9F A;  3NDK A;  4PUO A;  3HPG A;  1HNV A;  3M8S A;  4KB1 A;  1EKE A;  4GW6 A;  1RTH A;  3NHG A;  3B6P A;  4I7F A;  3V6D A;  4CGD A;  3OVN A;  1CZB A;  3ZSX A;  1X9M A;  1YVU A;  2B4J A;  2IGI A;  4FJH A;  4CHO A;  3DM2 A;  3QIN A;  3RMC A;  3LP1 A;  4LD0 A;  1T7P A;  3HK2 A;  4KHY A;  4DMN A;  4CES A;  1HNI A;  4JRQ A;  1BGX T;  4FW1 A;  2DFH A;  1WSF A;  3VQC A;  4XIU A;  4ICL A;  3ZT3 A;  4AIL C;  4CEO A;  3O3G A;  4YFU A;  4DU3 A;  1NK6 A;  2YNG A;  4CGH A;  4C8M A;  1C0T A;  4KO0 A;  4JS4 A;  4BE0 A;  5KGW A;  4CEQ A;  4DSI A;  4N41 A;  1T8E A;  2PYL A;  4DF8 A;  1NK8 A;  2X6N A;  2GUI A;  3SYZ A;  3AVF A;  1Q9Y A;  2HVI A;  3PX0 A;  4PWD A;  1VSF A;  2KFZ A;  2Z1H A;  1C0M A;  4ZHR A;  4GVM A;  2XRI A;  4H4M A;  4G1Q A;  4CGF A;  1BHL A;  3OY9 A;  3DLK A;  4M3Z A;  4HTU A;  3LWL A;  4O4G A;  4EZ6 A;  4KHQ A;  3PY8 A;  3RR7 A;  3NGZ A;  4CJW A;  4HHT A;  2E6L A;  3IRX A;  1WSI A;  1RNH A;  3K5O A;  3DOL A;  1CZ9 A;  2HHS A;  3T1A A;  4BE2 A;  3KKR A;  3M8P A;  5C42 A;  3TI0 A;  1D8Y A;  3TAM A;  1J9A A;  4CF8 A;  2YKN A;  1JL1 A;  3VQQ A;  1VSE A;  4C8L A;  3VQ6 A;  3VQ4 A;  3QO9 A;  3V9S A;  2F8S A;  4ZTF A;  2FBT A;  4L8R B;  1CLQ A;  1UWB A;  1ZBH A;  1BL3 A;  3OYG A;  1VSK A;  4FJM A;  2XO7 A;  4QOZ B;  2E4L A;  2OPP A;  5CZ2 A;  2OPR A;  4ZTJ A;  4M3X A;  1W0H A;  2FBV A;  3SPY A;  1WAJ A;  1FXX A;  5DK5 A;  1RDC A;  3OYM A;  4DF4 A;  2DFE A;  2HVH A;  1L3U A;  4KHU A;  3CFR A;  2HHT A;  4KV8 A;  3I0R A;  3L2V A;  3VQ7 A;  3HJF A;  1BIS A;  5K14 A;  4CHQ A;  2Y1I A;  2QXF A;  2X6S A;  2HND A;  3NH1 A;  3QER A;  4FJI A;  4IBN A;  3P1G A;  3K59 A;  1IKY A;  4LSL A;  3NAE A;  4FLZ A;  4FJK A;  1BCO A;  1LWE A;  1GOA A;  5FRO A;  2XY5 A;  3CM5 A;  1BI4 B;  4DFP A;  1TK8 A;  4J2D A;  2YNI A;  4CGI A;  2B6A A;  4WE1 A;  4CJ3 A;  1J5O A;  1KFD A;  4FYD A;  3V4I A;  1TKT A;  3OYN A;  2Z1J A;  1XWL A;  4KPY A;  3L8B A;  1LAV A;  1HYV A;  4CJL A;  4MQ3 A;  2YHA A;  3JSM A;  1RBT A;  1HQE A;  3LZI A;  3S3O A;  2IAJ A;  3TAP A;  1U49 A;  1NKB A;  1RBU A;  2HHX A;  3NF9 A;  4E1M A;  3HPO A;  3K58 A;  1HYZ A;  4E7K A;  4NCA A;  1S1U A;  3WNG A;  5SZT A;  3K5N A;  3SQ1 A;  2RN2 A;  3QEP A;  1RT7 A;  1VSI A;  4CER A;  3VQE A;  1RBR A;  3LAN A;  4FLY A;  4DSJ A;  2ETJ A;  2ZE2 A;  1IKW A;  3HVT A;  2FBX A;  3KLH A;  1R0A A;  1NK5 A;  4KB0 A;  1VSM A;  5T7B A;  1KVA A;  4Z0U A;  4FK0 A;  3V81 A;  1WAF A;  2B5J A;  2FBY A;  3C6U A;  3SUO A;  4KTQ A;  3DRS A;  4Z4I A;  4FM1 A;  3U3Y A;  4AHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...