1RTJA

Mechanism of inhibition of hiv-1 reverse transcriptase by non-nucleoside inhibitors
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Mechanism of inhibition of HIV-1 reverse transcriptase by non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 133
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtjA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtjA05
2ETJA 3F73A 4AHCA 1RT4B 4CHPA 4ED6A 4FLVA 3EPGA 4KHSA 2WOMA 3KKRA 2W9AA 1I39A 2V4RA 2VG7B 3V6KA 4F3OA 3DRPB 2UVWA 1IKXB 1YT3A 5KFVA 3PZPA 4NCGB 1BISA 4NLYA 4CFAA 3NE6A 3CM6A 2YNHA 3V6HA 2Y1JA 4EO6A 3AVGA 4DL7A 5CZ2A 1KVBA 4CECA 1T05A 3D28A 1SKWA 3RB0A 2IMWP 4M3TA 1GX5A 2WOMB 3L8BA 3TAEA 3KLGB 4F3TA 3NAHA 4ECYA 1S9FA 1NOZA 3KIOA 3KJVA 1J5OB 1Z26A 4JS4A 4K4SA 1WSFA 4C8OA 4IKFA 4HHTA 2HVHA 4NLOA 2GUIA 5KFJA 3H4BA 3PJWA 4M95A 1SL1A 3HKWA 2R8GA 1C6VA 4W5TA 1F21A 1KLMA 2G8WA 3LANA 3AVFA 2OPPA 5FRMA 4LSLB 3QEXA 4FLUA 4TQRA 3BSNA 2ILZA 4BE1A 2KTQA 2Z1JA 4EBEA 4CJ4A 1RBRA 3LP2B 2HNZA 4H4OB 4YR3A 3H5YA 5J2NA 2WB4A 3D0PA 4O0JA 2G8IA 2DFEA 1S5JA 4FJ9A 1JIHA 3MR3A 5F8JA 3GV5B 3Q8PB 1MMLA 3RMCA 2OPPB 4F2RA 1OS5A 3DI6B 3M8QB 2LSNA 2R8IA 1S4FA 1CLQA 2HNZB 5KFMA 1B92A 5T7BA 3K59A 3HPGA 4QPXA 3KMSA 4DLEA 4FZXC 4Z4FA 3AO1A 1C0UA 5KFBA 2FC0A 3NH1A 3V4IB 4M3UA 4XIUA 4F50A 1BGXT 3KTQA 2KFNA 3TVKA 4ZMMA 1HPZA 4DF8A 1S0NA 1VSDA 3I8DA 3SFUA 4ZVHA 3NKYA 1U49A 1S1WA 1IM4A 4E3SA 4WE1B 4RW4A 4QWAA 4KHNA 3H40A 2ATQA 2UVVA 4CJFA 4IG3A 2W42A 3DRSA 3MTKA 4EBDA 4HKQA 2YKNA 1C0UB 4ED7A 4OLBA 5L1JA 4KKOB 4IH6A 3SQ1A 4DQIA 1S6PB 4DG1A 2XI2A 2HW3A 1JLQA 1GOBA 4KTZA 3JYTA 4HVJA 2GIRA 4GC7A 5KFSA 3NGDA 4FZZA 2CJQA 4OL8A 3BQ2A 4PQUA 3RB4A 1RT3A 1RDCA 5KRTA 3P83D 4ECSA 4ED8A 3AVIA 3ZSWA 3C6TB 3CVKA 2IDOA 3MR6A 2RKIB 1QE1A 2HHTA 4CJKA 4EP4A 4KBIA 2C22A 5F8NA 4KFBB 4CJSA 3SUOA 4F2SA 4FJ7A 1JLBA 2BANA 4M3ZA 3CJ3A 3U3YA 1SL2A 3H5UA 3KHGA 3NF6A 1U45A 3PR5B 3OHBA 3MEDA 1X1PA 4QCLA 1TKXA 3AA2A 5I3UB 4HTUA 3QO9B 4PQUB 4FXDA 4CJ3A 4NYNA 2JEIA 3PO4A 4NLVA 4JRQA 4C8LA 1TAQA 4QOZB 3AA5X 4PWDB 1TV6A 4ZPCA 4MIBA 3ULDA 1UA1A 2OPSA 1JLFB 1JLBB 2BANB 3OHAA 1VSFA 1ZBFA 4ZTJA 5F9NA 3BSCA 1TAUA 3K2PA 4XPEA 4AHRA 3OYEA 4EZ9A 1HNIB 3MAQA 2ATLA 1WSJA 4BDPA 3AVKA 1TL1B 1ZTWA 1S6QA 4R5PA 1KCFA 2PY5A 4J9KA 1TVRA 1N48A 1TV6B 2W9BA 4Z4GA 2PZSA 4QWCA 3NGIA 1ITGA 4CIFA 1LWCA 2D0CA 3H4DA 4IFYB 4UQGA 4HUEA 3KK1A 4EO8A 2G8UA 1JL1A 4NLDA 2D5RA 4J2DA 1N6QA 4O0IA 2E4LA 4KHYA 4G1QA 4ELVA 2G8KA 5KFLA 3DYAA 1GOCA 3LZIA 4CESA 3HSTB 4ED0A 3OS1A 1TVRB 1NKCA 4WFXA 4RUCA 4J9PA 4ID5A 2HB5A 3OYCA 3HXMA 1C0TB 5KFQA 2KFZA 5SWMA 5KG6A 5CYQB 2JC0A 3QZ7A 4DS5A 3SFGA 3ITHB 4MFBA 1LW0A 1NHUA 1FKOB 1HYSB 4OKJA 3NBPA 2I5JB 2B43A 1VRTA 1RT2B 1NJWA 4K4XA 5J2MB 2WCXA 3RMBA 2G8VA 4BE0A 5C24A 3KHRA 1B9DA 2HAIA 2IJFA 3CJ4A 3OSPA 2IC3A 3KLIA 4KTQA 4FLWA 3OL9A 1Z4UA 4PA1A 1RTJB 2I1RA 5DK5A 2VG5A 4ID5B 5KFPA 5JS1A 3RRGA 2FBXA 3OYDA 3DLGA 4CJTA 3S9HA 4MFBB 2JEJA 2UVRA 3A2FA 3HVWA 5HRRA 1YTAA 3PX0A 3V9XA 3MR2A 4IR1A 3AVLA 3K58A 3RBDA 4G3IA 1JX4A 2XRIA 1JLEA 2F8SA 2YNGA 3MEEA 4W5OA 2HHQA 2RPIA 3AVNA 1CXUA 1HJRA 3NMAA 4YQWA 2C2DA 4BDZA 3S3NA 2HHVA 4ECQA 1WAFA 5KFNA 4Q0BA 1SH3A 4DEZA 1BQMB 2P5OA 2W7PA 5C42A 3V9UA 3I0RA 1QAIA 4DU1A 2UVUA 2E9RX 3CFOA 3V1RA 3OYKA 2IM0A 1JXBA 4M3WA 1ZBHA 3U6FA 4CF9A 4KAIA 4NCAA 5C5JA 4FJIA 4RU9A 4DQRA 2A1SA 3NL0A 2E9TA 4K8ZA 1SV5B 5J2PA 4KE5A 4MQ3A 4J2BA 1TKZB 4K4UA 4ECZA 2QXFA 5HBMB 5KFHA 1RTHA 4ED2A 1ZYQA 2XGPA 1BHLA 3V81A 3DLRA 4EP5A 1WSGA 1RTDA 4AHUA 3RWUA 4LSNA 3N6MA 4FM0A 1D0EA 1IKYB 1L3UA 3BQ1A 1Y97A 4CEEA 3HT3A 1T8EA 2XCPA 3SV4A 4B9MA 2RF2B 4R8UA 3VQSA 1SUQB 5J2QA 4QWDA 2VG6A 5KFEA 3OYFA 3RTVA 1T03A 4KTWA 2D3ZA 1S1UB 3KOAA 3G0ZA 3NF8A 3PW4A 5EWFA 3V81B 2ZQBA 4DU3A 3GQCA 3M8SA 4CHQA 1RTDB 4X2BA 2WRMA 1Q8IA 3C95A 4M41A 1D8YA 2GIQA 4CFDA 3MR5A 2W8LA 4Y1DA 3VQBA 3DRRB 4O3RA 3LP1A 1LV5A 1JXLA 2BQRA 4RW9A 4ZP8A 1TL3B 3AO2A 5J2QB 4OPKA 1L5UA 3AVAA 1A5VA 1IO2A 3QGIA 2XCAA 4GVMA 4TY8A 3PY8A 1HMVB 2WTFA 3L2UA 1NK5A 2IJNA 1IKWA 3VQAA 5C25A 3DOKA 1LWEA 4FJHA 3ZSVA 3MXMA 4J9MA 3GIKA 2XO7A 3K57A 4O3SA 3OYMA 3SNNA 1S9EB 3LP1B 3TAGA 4CJLA 1X9MA 2HHXA 4ECVA 5HROA 1A5XA 4M3RA 1UOCA 4CEQA 2FBVA 1VSLA 4FJ5A 4RW6A 5EDWA 4K4WA 4DSIA 1RTIA 4CHZA 2W8KA 1U04A 4TY8B 4K4ZA 4ZHRA 1DLOA 4J9OA 3IG1A 1NK7A 3HPHA 1VK0A 5KG5A 2D41A 1UA0A 3G6YA 2RDIA 5F8HA 3BJYA 2WONA 2R8KA 4E1MA 4LQ3A 4RNOA 2WHOA 1BL3A 3RB6A 4CJWA 4F4WA 3PJXA 1QQCA 1REVB 4M45A 4ZP9A 1S0MA 4I7FB 3EZUA 1S1XB 5DMRA 3DLEB 3VQ4A 3LAKA 5KT4A 1VSMA 4FBTA 3E01A 1LWFB 2P5GA 4MK9A 2BGGA 3S3MA 4N41A 3DM2B 5HP1A 2HNDA 4RW7B 3M8PA 1ZTTA 2ASJA 3UPFA 4LY7A 3HVAA 1L3TA 3HVTB 2QKBA 5FRNA 3C6UB 1JLCA 1VSJA 1CZBA 1KTQA 2AJQA 1R0AB 3TI0A 2R7YA 4Y2AA 1DTTA 4HCCA 4DQSA 3O3FA 3HM9A 4RW8A 2V0NA 3KK2B 2PYJA 2FJXA 3K5NA 1BCMA 3TAMB 2Z1IA 4FW2A 2R2RA 3RAXA 4E7KA 1GOAA 2J6TA 4J9LA 4Q5VA 4ECRA 4DTUA 4KHRA 2HHWA 4TLRA 4K50A 1U4BA 1W0HA 3V9SA 3QNOA 4WZQA 2GC8A 1S1TA 1RDBA 3S3OA 2BDPA 3QEIA 4KHQA 4Z4HA 3RRHA 3TARA 4K4YA 1CXQA 3T5HA 5KFGA 4NLSA 4RNFA 1ZBUA 3HK2A 4DWIA 3PW0A 2YNHB 4L8RB 2EHGA 1SH0A 3H59A 3P5JA 3QETA 4IR9A 4ZPDA 4O4GA 1T05B 4FW1A 3ZSOA 1W25A 2XY6A 3VA0A 2GV9A 1QSSA 1S1TB 2FBYA 2JLEA 3KJVB 1KHVA 3KLEA 4FLXA 3QINA 3OYAA 1RDDA 3TAQA 2DY4A 4CK2A 2FLNA 3T5JA 3CG7A 5KG1A 3RB3A 4FLZA 3NF7A 2XI3A 4FS2A 1KLMB 3UDLA 4E89A 3EZ5A 1QTMA 1HQEA 4OKKA 4N56A 5KFTA 1VRUA 3SUQA 3SV3A 3RMAA 2JEFA 1U09A 5J2NB 4CFBA 1C0MA 2IBKA 5KFWA 2C28A 3BQ0A 3IRXA 3O3HA 2R2SA 3ZSQA 4O55A 4K4VA 1X9WA 5K14A 2AGOA 4B9TA 2RN2A 2ZD1A 5KFOA 4JLHA 1EP4A 1RT7A 2KW4A 5DG7A 3CQ8A 3Q8SB 3T19A 5KFYA 3KLHA 4DFKA 2B6AA 2X6SA 4IG0A 4J2AA 4DL3A 2O4GA 5CYMA 1TKTA 4URSA 1ASWA 4I2QA 1K6YA 2B5JA 4URGA 1C2PA 4Q43A 1RBTA 3V1OA 3SQ4A 4BWMA 1J9AA 1DTQA 3L2QA 3AVMA 4J9QA 4IRKA 4CK1A 4DTRA 1N4LA 1HPZB 4DTJA 1ASVA 3KNAA 3LP0A 3T5KA 1JLAA 2OH2A 4HCBA 3OJUA 4WYLA 4RNMA 4H54A 2ALZA 1S1WB 2P1JA 4RW4B 4W5NA 1RBSA 5KFKA 2OZSA 4FBUA 1CZ9A 5KG0A 1W9HA 4WYWA 1JXEA 4I2QB 4IG3B 1S9GA 4DTOA 4H8KA 3DRSB 4K4TA 3AO5A 2YKNB 3SQ2A 3T1AA 4WXOA 3MEGA 4DG1B 1A5WA 1JLQB 3H5SA 3U3GA 2XHBA 4FM2A 3HHKA 3JYTB 1N5YA 1NK9A 3UR0A 1RYSA 5CZ1A 4IOBA 3ZSYA 1RT3B 3ZT3A 3KHHA 1VSIA 3NH0A 3IS9A 4TQSA 4DTMA 4ZTFA 1NK4A 1RT5A 4MK7A 4Q44A 5EU7A 4E1NA 1QE1B 5D3GA 3O4NA 2HMIA 2IA6A 2WK4A 2AGPA 4BE2A 1JLGA 3HPOA 4C8KA 5EWEA 4NLWA 3MEDB 5KG7A 2C2RA 2XC9A 2BQUA 4CJQA 5DLFA 3LWLA 3LDSA 5HLFA 1TKXB 4B3OA 2AGQA 1SL0A 3B6OA 4AH9A 1NJZA 4Q8EA 2YKMA 3ZCMA 1TKDA 3OS2A 5F8GA 4OJRA 4IFVA 2HVIA 3KK3A 3NAIA 2OPSB 3QGHA 3FFIA 4CK3A 3HVRA 5L1KA 4WFZA 1NKEA 3V1QA 1RT6A 2E6LA 3QIPA 5F8IA 1FXXA 1WAJA 1XI1A 3M9NB 5FROA 2JEGA 3QGGA 4ECXA 5JUMA 5KFAA 2FVSA 4EZ6A 1S6QB 4R5PB 1T94A 4ID1A 1D1UA 3QLHA 4FJXA 2JC1A 4N5SA 2W9BB 4KHWA 4Y2CA 2VWKA 4CIGA 1LWCB 1KLNA 3KK1B 3QIPB 1N6QB 4PY5A 3KLVA 4G1QB 1NK6A 4YR0A 1QHTA 3DYAB 4RZRA 3PW7A 2R2UA 4IDKA 2BE2A 1XR7A 4KI4A 3AO4A 2W9CA 3DOLA 4CHNA 4E7IA 4EEYA 2O5DA 5KT3A 3SQ0A 4KRFA 3MECA 4B9SA 1LW0B 1WNSA 4M3XA 4ELUA 4ED3A 4MK8A 5L1LA 2G8FA 3NBPB 4O3QA 4FLTA 1VRTB 5F8MA 5L1IA 3FDSA 2XGQA 4J9SA 5C24B 3DMJA 5KT2A 4U6PA 3SCXA 1RBUA 2IC3B 3KLIB 3QERA 4DU4A 3VN5A 1RA6A 4O44A 2VG5B 4DFJA 1RAJA 3MF5A 3DOLB 3K5LA 2V9WA 3DLBA 1RILA 2FJVA 3DLGB 3MECB 1IG9A 4ECWA 2Z1GA 3NGZA 2D0BA 4C8NA 1S1VA 4WXWA 3WNFA 3BGRA 3DLHA 3PW2A 1JLEB 1NHVA 4WFYA 2YNGB 3ZT0A 3MEEB 3TABA 4NLGA 4DMNA 4O44B 4W5QA 1XHZA 1TP7A 1KFDA 4FLYA 4Q0BB 3DLKA 3IGNA 4M94A 1JL2A 3OL7A 5C42B 3I0RB 5E41A 1IH7A 4KPYA 3KLFA 2Z1HA 4ZPAA 1SKSA 1G15A 3WNHA 3BGRB 4F8RA 3TANA 5DLGA 4YFUA 5J2PB 4NLPA 4RNHA 4QWBA 4DFMA 4O5BA 1UWBA 1RA7A 4MH8A 4FJ8A 3DLKB 2FLLA 3PX4A 1RTHB 1D9FA 4CEAA 1LW2A 3K5MA 2EX3A 1RYRA 4E7LA 3THVA 1EETA 4FK0A 3N6NA 4CGGA 4CJ5A 3ISND 4DL6A 4LSNB 3KD5E 4KB0A 1RT1A 4CERA 2XY7A 1NOYA 1FKPA 3L2RA 5F8LA 3VA3A 4E0DA 4LQ9A 5DGAA 3OVNA 1UWBB 3ZT1A 4R8UB 1ZBLA 4JV0A 3CJ2A 2VG6B 1VSKA 3V9ZA 4Y1CA 4ZP6A 1LW2B 1T03B 3OLBA 3CDEA 3MXIA 4JV1A 3I0SA 4FM1A 4J2EA 3BDPA 4FK2A 3PW5A 1SKRA 2YV0X 4Z4CA 3BSOA 2A1RA 3LPUA 4N47A 2FBTA 2BRLA 1BI4A 2YNFA 3Q8RB 2XY8A 4RW9B 3AVBA 2JGUA 1D5AA 3HP6A 2F8TA 2AWZA 4H4MA 4BACA 1S49A 4Z4EA 2X74A 3KHLA 4I9LA 4DQQA 1BQNA 1WNEA 5J1EA 3AVJA 4W5RA 4F4KA 5KFXA 4B8CA 4CHYA 4E7HA 4DSEA 1YVUA 3VQ7A 4FCYA 1D9DA 3PX6A 4E7JA 1IKWB 3L2WA 5C25B 3DOKB 3TWHA 1LWEB 3FQKA 5T14A 4GMJB 4I2PA 2BR0A 5KT6A 1HYZA 4CGFA 4OGCA 1KFSA 4IRDA 2GBZA 5HROB 2PYLA 3UIQA 2QKKA 3GIMA 4H4MB 2OPRA 5FDLA 1NK8A 3ZSZA 3HL8A 2QE5A 4F4ZA 4RW6B 5J1EB 1RTIB 4Q8FA 1EKEA 4B08A 1UAXA 1IKVA 4QW8A 4CJEA 4ZHRB 1TK5A 3HP9A 1DLOB 3IG1B 3O3GA 1RT4A 5CY4A 3PUFA 1FK9A 3LP3A 1L3VA 4IH5A 4B8AB 5KT5A 2F8EX 2OPRB 3DRPA 4O3NA 2WONB 2XY5A 3QEPA 1IKXA 1RCHA 1XWLA 2VA3A 4DFPA 3SYZA 2ASDA 4O4RA 2DPJA 1RNHA 3AVHA 1IKVB 5DGBA 4CGJA 3ZT2A 1NK0A 4KB1A 3E01B 1Q9YA 1FK9B 2F96A 5HP1B 1HRHA 3KLGA 2HNDB 4YP3A 3M8PB 3GV8B 1J5OA 5EWGA 3AA3A 1BIZA 3NH2A 1JLCB 1HYVA 4FYDA 3C94A 3G10A 2P51A 3SUNA 3G6XA 4JUZA 1N56A 1DTTB 2IM3A 4RW8B 4LH4A 3OYJA 4DS4A 4B9UA 4LSLA 1J54A 3QNNA 1JKHA 4I9QA 1VSEA 5I42A 3V6JA 1XR6A 3QEWA 1K1SA 3LP2A 4H4OA 3NCIA 3H98A 1QSYA 2VWJA 4EBCA 4HYKA 1YTUA 4NYZA 4JRPA 3PR4A 1KSPA 2D0AA 3I5CA 2OA8A 5KFRA 5KGXA 4ZVEA 4ZVFA 3G6VA 5SZTA 4KSEB 4NRUA 4TXSA 3H08A 3EYZA 3N6LA 1I6JA 4CEZA 1TK8A 2IM2A 3L3VA 3CFPA 4M3YA 4JV2A 4BDYA 3DI6A 1JKHB 1TGOA 3M8QA 4E19A 1WLJA 5I42B 4XPCA 3OYHA 3OYBA 4O4GB 4F4XA 1NJYA 3RAQA 2KZZA 4OKEA 4KREA 2AU0A 2RDJA 3HJFA 2FVRA 4IBNA 1HNVA 5F9LA 3AV9A 1VSHA 1WN7A 4Z0UA 3KLEB 3V4IA 3H5XA 3TR8A 3ASMA 5KFCA 1EX4A 3OYNA 4MKBA 2IS3A 3IN5A 3TQ1A 3VQEA 4MKAA 1KHWA 4DSFA 4FJGA 1HQEB 1TK0A 4PUOA 1NJXA 4WE1A 3I5BA 1VRUB 5DQIA 1QS4A 3SUPA 1HNVB 3T3FA 4DLGA 4KKOA 3OYGA 1S6PA 4YMEA 3Q8QB 5HRSA 4F4YA 3IRXB 3GV7B 2E6MA 4FJLA 4HUGA 2D3UA 3ALYA 4CF0A 2BRKA 5K14B 4KV8A 2VA2A 2ZD1B 4CGDA 1QAJA 4PUOB 4DSLA 3C6TA 3FSIA 1EP4B 1RT7B 2BQ3A 2AX0A 2RKIA 2CKWA 5KGWA 3KLHB 4TN2A 2B6AB 2OZMA 4IG0B 2YHAA 4KFBA 5CYMB 1TKTB 4FZYA 4KHMA 4FK4A 4NLUA 3QIDA 2B5JB 1ZETA 3OYLA 2YNIA 4WZMA 5I3UA 3QZ8A 3QO9A 3PHEA 4YR2A 4HUFA 4QWEA 1DTQB 4KV8B 2ASLA 5KTQA 3SJJA 1QSLA 4AHVA 3LP0B 1XC9A 1JLAB 4PWDA 3SPZA 1K1QA 2G8HA 3CDWA 3TAPA 2KZMA 4TY9A 1JLFA 1WSEA 4Q45A 4U7CA 4LD0A 3LWMA 3NDKA 1S9GB 4RNNA 2OYQA 1S0OA 4FS1A 1X9SA 3ZSXA 1KVAA 3MEGB 2YNIB 3D45A 1HNIA 1U48A 2ZKUA 3L3UA 3NF9A 2E9ZA 4CGHA 3EY1A 1TL1A 3VQPA 1N5YB 4CF2A 3RMDA 4LH5A 3SPYA 2XWYA 3EPIA 4DSJA 4KHUA 1TQLA 4KB7A 4AHSA 3IS9B 4CHOA 4EYIB 1GX6A 4B9NA 3E51A 1RT5B 3PO5A 5D3GB 4RUAA 2HMIB 3TAFA 4CEDA 3SI6A 1LAVA 4IFYA 4AHTA 1JLGB 1RDAA 3PVXA 1C1CA 3OS0A 1QUVA 3CJ0A 3D5MA 1HARA 5KG2A 5KFUA 5KFZA 3VQ6A 5HLFB 4B3OB 4CIEA 4Y34A 3M9OB 3T5LA 4J9NA 2YKMB 2NUBA 2HWHA 3H2LA 5KG3A 3VQCA 4ECUA 1C0TA 2ITGA 1U47A 5CYQA 4TYAA 4IFVB 4CE9A 4NYFA 3QYYA 3BREA 3KK3B 4Y3CA 3M9MB 4KAZA 3ITHA 2ILYA 1Q9XA 1I3AA 1FKOA 1HYSA 3ISNC 2I5JA 3FFIB 1C1CB 1NNDA 1RT2A 5KG4A 5J2MA 2D7SA 4ICLA 3NFAA 4EYHB 4FJKA 3P1GA 4FJJA 4DL5A 3CDUA 1RT6B 1CSJA 3RR8A 4DTPA 2FVCA 2R8HA 4IKAA 3CWJA 1RTJA 4IH7A 5HRPA 5KFIA 1MU2A 3QLHB 4OGEA 4NLRA 4MIAA 2OPQA 3HYFA 1ZBIA 4NZ0A 1HQUA 3VQQA 4FJNA 4ICLB 2AX1A 2HHUA 4DL4A 3OY9A 3OL6A 3VQDA 4CCHA 3QEVA 3RBEA 4YNQA 1BIUA 4NRTA 4XO0A 3LALA 3GIJA 4CEOA 2YHBA 4IDKB 1RDRA 1MU2B 5DQGA 2FJWA 4CF8A 2BE2B 2OPQB 4RG8A 2IOCA 3VQ9A 4O3PA 1BQMA 2W9CB 1SH2A 1KVCA 3ICLA 4DTSA 1HQUB 1C1BA 4ED1A 1J53A 4JS5A 4ZP7A 1S10A 1B9FA 4C8MA 1S97A 3MXJA 4DF4A 5JXSA 2ZE2A 3LAMA 4GW6A 2DFFA 1SV5A 3DMJB 3GIIA 1XHXA 2Q3SA 3LPTA 1TKZA 2X78A 3OSNA 3KD1E 3JSMA 2X6NA 5HBMA 1WSHA 2IGIA 3NGYA 5KFFA 3HO1A 3PV8A 1C1BB 4ECTA 1EXQA 3CIZA 2DTUA 3F9KA 4CEFA 2DFHA 4OPJA 2QK9A 4OLAA 1T3NA 1IKYA 3CM5A 3GILA 2ZE2B 1BCOA 4OVLA 4K8XA 1S1VB 5EUHA 3CFRA 3WNGA 2R2TA 2RF2A 3JSMB 1SUQA 1RBVA 1NKBA 3CYMA 1S1UA 1LAWA 4DTNA 2O4IA 2J6UA 4ZPBA 1Z25A 2C2EA 5KRSA 3OL8A 5L9XA 4FJMA 3KLFB 4R0EA 4CGIA 3DRRA 3B6PA 3SZ2A 2HNYA 3ZSRA 1C1AA 4TYBA 3VQ5A 1T7PA 1TL3A 1KRPA 5KI6A 1XR5A 2FLPA 5KFDA 3QIOA 4FVMA 2V4QA 4CJVA 4KI6A 3FQLA 4IRCA 4KO0A 3QESA 3KKSA 2IAJA 3GYNA 1HMVA 4DL2A 3AVCA 5JS2A 1EETB 3I5AA 3V6DA 2QV6A 4URQU 3AA4A 3ZT4A 4AILC 3VQ8A 1S9EA 3OLAA 2HNYB 2FVPA 1RT1B 3OYIA 3NAEA 2UUTA 4B9LA 1FKPB 4NLTA 5DG8A 4DTXA 3CJ5A 5HRNA 3DDKA 4Z4IA 4KO0B 2J6SA 2IAJB 4M42A 4N76A 2AQ4A 3L2VA 3NHGA 3WNEA 3BSAA 2EC0A 4CJRA 2B4JA 4ELTA 5DG9A 3I0SB 3FRZA 3V6DB 3OJSA 3MFHA 4B9VA 1L3SA 2HHSA 2IM1A 3O4QA 4BWJA 1YVFA 2R8JA 4CFCA 4DSKA 3SI8A 2KQ2A 3UQSA 1WSIA 4DQPA 4J9RA 2W7OA 3V9WA 1BI4B 3G86A 2YNFB 3KMQA 1REVA 4I7FA 1S1XA 3DLEA 5DQHA 1BQNB 1O1WA 1LWFA 4CJUA 3MFIA 3K5OA 4NLXA 3DM2A 4RW7A 2Y1IA 3CO9A 4TSXA 4NCBA 2UUWA 3BR9A 3RR7A 4I2PB 3HVTA 3C6UA 4CJPA 1ASUA 1R0AA 4CEBA 3IGVA 3M8RA 2VG7A 4QAGA 4IQXA 5FDLB 4CF1A 5KT7A 4NLQA 3KK2A 2FVQA 4O3OA 3LZJA 4NCGA 2DPIA 3IAYA 4ZVGA 2HWIA 3TAMA 4QW9A 3AO3A 1S48A 4GC6A
chains in the Genus database with same CATH superfamily
4X4OA 2ETJA 3F73A 1RT4B 2NPIA 4IO8A 4KHSA 1VQ4S 3MM9A 3GE9A 5ETPA 2E5LF 5CCMA 2OGUA 3R27A 1RWWB 1WJ9A 4XEIA 2FUG9 1VK3A 4YDUC 4U7UD 4EO6A 2VZ9A 2PT0A 3D28A 1CJVB 1N0VC 1SKWA 2YH1A 2CG8A 3RB0A 2IMWP 3AQOA 3EKSA 2WOMB 1U1KA 4X64K 3TAEA 3MMCA 2ZNYA 4ECYA 2IRYA 1S9FA 1NOZA 2GMHA 3KIOA 3KJVA 2Q1LA 2QW9A 2EFPA 2X3DA 3THYA 5AQNA 2LEPA 4NLOA 2GUIA 2YXLA 2XHWA 2CNNB 3PJWA 1ZS6A 4C97A 3HKWA 3AVFA 3R6MA 3QEXA 3ID8A 4TQRA 3BSNA 1NPRA 1Y3JA 2FC9A 5AXMA 1UZHA 2ILZA 1CC8A 3LTOA 4DV2K 1ZC6A 4MLHA 3LP2B 2M9KA 3I87A 3CC4S 3D0PA 4OMFG 3HHNB 4O0JA 3WIUA 2DBBA 3D66A 3A5LC 2EBEA 4I6MA 3MR3A 1N36J 3M32A 3W3DA 1RBOB 3QJPA 4ZJLA 2DH7A 4F2RA 3DLLQ 4ZVSB 2FSNA 1S4FA 2E5GA 4HI2A 4PWUA 1B92A 2WVDA 2H3EB 1RB0A 4J8FA 3ENVA 1ATNA 1KQFB 1Q1KA 5KFBA 1T3VA 1YX2A 2YY3A 3V4IB 3MAAA 1VQMN 4F50A 3M1VB 4JI4K 3AQPA 3OVBA 2KFNA 1XNQK 3TVKA 2Q0RA 4DF8A 1S0NA 1VSDA 4KH0B 1A9NB 1S1WA 4F0MA 1VHXA 3B4MA 2WVEA 5DJBA 3H40A 2ZHOA 3DRSA 3MTKA 4HKQA 3AJDA 4KJIA 4JI2J 1UKUA 3LO3A 4IH6A 3SQ1A 4OYZA 4ZLLA 4I6AA 2AIRB 1KVKA 3R1XA 5AQQA 1GOBA 4KTZA 2DRAA 1PILA 2GIRA 4FZZA 4B3MF 4OL8A 1WUUA 4UW2A 4PQUA 5AXLA 4ZA1A 3ZO7A 3M05A 1XN9A 3UVJB 3ET6B 2OFGX 3Q23A 5H1SQ 5HMXA 2HMPA 1XIQA 2YKOA 2HHTA 5GAHI 4CVNE 3CPWM 1ICEB 2P9KA 4WTYA 1FE4A 1JLBA 4M3ZA 1SL2A 3KHGA 1RAEB 1U45A 2UUBJ 3OHBA 1WOQA 1PG5B 2XZWA 3AA2A 3TX8A 1G6BA 4H0TB 5B7WA 3ETOA 3PFOA 2C1EB 3JTOA 3J7AN 1V5VA 2F7TA 2ZC3A 4ZPCA 1M90O 3OFEA 3J81U 1UA1A 1GTHA 4BGAA 1GQEA 2BANB 4JI1K 3N4QA 3OHAA 1HFEL 3CSKA 4JHDB 3BYRA 3K2PA 4F04B 4DV6J 4XPEA 4AHRA 4KGXB 3BF1A 1UZDA 3MAQA 1GLLO 4BDPA 4I6WA 3RBZA 4JI4J 5HK4A 1TVRA 3M30A 3M1FA 5BN9A 4FPBA 3SSQA 4DV7F 2P9IB 1O8BA 1ITGA 4CIFA 3GR1A 5ETRA 1MN9A 2N3OA 3S01A 2BV3A 4DR5F 5LY3A 4EO8A 4NLDA 2I7NA 1N6QA 4O0IA 4BR4A 2YWKA 3HHEA 5KFLA 1FXRA 4OIXA 3CIMA 1NU0A 2RMLA 1XBWA 3OS1A 4NEYA 2DHXA 4J9PA 4ID5A 2HB5A 3OYCA 4CO0A 3WXKA 4P6QA 2HLTA 3SFGA 2GHVC 3H3NO 1LW0A 2M88A 1CULA 2E7WA 1VRTA 5LSLA 3RMBA 1IJEB 5C24A 2A3JA 2HAIA 1N0UA 2IC3A 3KLIA 4KTQA 1Z4UA 3W65A 2VKZG 2I1RA 2VG5A 4CLTA 1NWKA 4DCHA 3L0QA 1OQ6A 3RRGA 4P10A 3JXOA 4GO5X 1GFWB 5D0GA 4CJTA 2JEJA 2UVRA 3A2FA 3HVWA 2ZWOA 1EQYA 4IR1A 4JI1J 3K58A 3A8EA 3RBDA 2VC1A 2HHHK 3TUPA 2F8SA 3MMBA 2Q2RA 2HHQA 3FBCA 3ENHA 1DQ9A 4YQWA 2HHVA 1S59A 4FNIA 5KFNA 1RTZA 3CJTA 4ZOSA 2HFNA 4DEZA 4A8MP 1BQMB 2P5OA 5C42A 3ATVA 3OVSA 2UVUA 3VEVA 5EY4A 3UB5A 4M3WA 2RSQA 4CF9A 4X65K 2DHHA 4KAIA 5A8WA 4NYOA 4NCAA 2VFUA 4CZLA 3J81Y 3VGUA 4DPUA 1X4AA 2CQIA 3Q2TC 2FJDB 1IUJA 4ECZA 3C2PA 2FHJD 3OXLA 2QXFA 1UW4A 1GEHA 3O44A 2MKJA 2OEJA 4QR0A 4I56A 2MKIA 2ZGYA 1S5ZA 4HHUA 1D3WA 1BHLA 1P1TA 5DDOC 2XLKA 3W0LA 4AXIA 1Q53A 3VAMA 3ZTSA 1ZAVA 2J7KA 1UW9A 2VFRA 3SEOA 4CEEA 3VTIA 4OI6A 2P5VA 3NGRA 1L3KA 4B9MA 2XMTA 3J7Z5 2WVFA 3ZNUA 3WX4A 1HNZF 4HDGA 1JCEA 2VG6A 2XS2A 1RCOB 1S1UB 4QIVA 3KOAA 3EE8A 3CJQA 3TUJC 5EWFA 5F0XA 2ZQBA 4DU3A 3BV8A 3T41A 1G2EA 2F63A 4PKIA 4X2BA 3O5BA 2WRMA 1Q8IA 3CC2N 2GIQA 1UVLA 4CFDA 3LP1A 1LV5A 4A5BA 2HHHJ 4RW9A 3KHYA 1TL3B 2DNMA 3MZIA 3D2WA 1T9VA 1IO2A 2FY1A 2XCAA 3GCWP 4P71A 3PY8A 1NK5A 2IJNA 2IDEA 3DOKA 2UUAK 2XO7A 3GIKA 3EZWA 3CPEA 3TAGA 1CS4A 4X65J 3LL3A 2DXEA 3VAIA 3D1OA 2MHNA 1KVJA 2BUNA 4RW6A 5EDWA 4DSIA 2BJ7A 4B17A 2N7CA 4TY8B 2FZCB 1X4BA 1DLOA 3W61A 3PSFA 2F4FA 4AF1A 1VK0A 4KPCA 1FFWB 2V68A 2DR6A 3I8BA 3TZWA 3Q89A 2X1FA 1UA0A 4X4VA 2DEIA 3MOZA 2FYXA 1FRJA 3IBWA 4Y2MA 4E1MA 2WHOA 4M63A 3CD7A 1WTFA 3RB6A 1BL3A 4CJWA 2IFXA 3PJXA 5AQYA 2F9JA 3MUTP 1REVB 4ZP9A 2EFOA 2YWEA 2ZITA 5RUBA 5DMRA 3NP5A 4DX6A 4H5NA 2YX6A 3PJ9A 5ETLA 1LWFB 2BGGA 2VD3A 3QT8A 1XEZA 4N41A 4BVOA 3VVTA 3M8PA 1ZTTA 2ASJA 4GKKK 1F5BA 2Q0UA 4HTIA 1L3TA 5FRNA 3OBIA 1JLCA 3HZEA 1VSJA 2AJQA 4BC9A 1HNXK 2CJ9A 3HM9A 4DQSA 2GQQA 4RW8A 3FZLA 2M0GB 4NASA 3TAMB 2LU2A 4JKGB 4OHXA 1V4SA 2VQFK 4E7KA 2J6TA 3G9CA 2GGPA 2FTRA 3T1HJ 3TX0A 5K8OA 3I55S 3OXFA 3E66A 3PG9A 3V9SA 1VQLN 4LF9J 3QNOA 2GC8A 4OYPA 3D9BA 1RHQB 4KHQA 3QATA 2W2OP 4X4RA 4C2MA 3RRHA 3T5HA 3WXMB 3HK2A 1ZBUA 4XDDA 4EFHA 3C7NA 2YNHB 4JKFA 4QYZK 1KP6A 1SH0A 3QETA 3P5JA 4IR9A 2KT2A 1SZ2A 5GIPA 2V8HA 3EX7B 2XLJA 1S72S 2GV9A 1MA9B 5M1QA 2DY9A 4LF5K 2PA3A 3GONA 4FLXA 1EAYC 2ZH5A 2DY4A 4ITSA 3CJ7A 1Y5LB 4CK2A 3CG7A 3RBXA 2CADA 2KN4A 3NF7A 2CPYA 3WXJA 2XI3A 1KLMB 1QTMA 1HQEA 3R8EA 3W63A 2IVNA 2KH9A 4HI1A 1NBWA 3MD1A 4J9UE 3QAUA 3OFGA 4P73A 1IVZA 4GKKJ 3NXZA 3M2VA 4FWLA 1R59O 2CUYA 3ZSQA 4K4VA 2KU7A 1X9WA 2CNKB 2A2CA 3MMVA 5K14A 4B9TA 2RN2A 1FWPA 4WFNQ 4C0HA 1EP4A 2KW4A 1TL5A 3DFEA 3CQ8A 4EHTA 3MUMP 5KFYA 5LMUJ 1S22A 4DFKA 2B6AA 3BY5A 4DL3A 2O4GA 4URSA 1QJHA 3UKUA 4FVUA 4K25A 5K8MA 5AE1A 2VWBA 4Y6IA 4DR6F 2DNKA 1C2PA 3L3CA 3SQ4A 1KBRA 3AD9C 4M5NA 1FD8A 3PIOL 1DQAA 1XMOK 2V94A 1RJJA 1N4LA 1HPZB 4A59A 3KNAA 5HMYA 1AFIA 2RHSB 4RNMA 3U9ZA 2P1JA 1OMSA 2G13A 1ZM4A 1SPBP 5KFKA 1FW6A 1CZ9A 4U67L 4I2QB 1S9GA 4H8KA 1V3SA 4LFBK 4K4TA 1T9XA 1VLOA 2BKOA 4LF5J 1XQSC 3MEGA 2PEHA 1A5WA 1JLQB 4FM2A 1B0VA 5FPEA 3CCTA 4YDDB 3UKRB 5IT9O 4M5HA 3UR0A 5CZ1A 1KWMA 3B4DA 2YQ1A 3ZT3A 3KHHA 1VSIA 3IS9A 1O6XA 4DR3K 3BB5A 2F8MA 3SAHA 1DEJA 3AFGA 4CM0A 4DUYK 1QE1B 4KGMA 3UFCX 2IA6A 4L72B 1VQSA 2GQ2A 3HCXA 4AM6A 3VAFA 5GMDA 2FLOA 3F41A 4UUXA 4Z94A 4CZGA 3MEDB 2C2RA 5ETOA 3LDNA 2BQUA 3LWLA 4O5FA 5HLFA 1TKXB 1LCUA 3CJKB 4BRLA 1VQ7S 4Q8EA 2X51A 4BC2A 4PZVA 1U6FA 2V52B 1YK9A 3NAIA 2XSFA 2ITMA 4ER8A 5AQVA 2OPSB 3QGHA 4FWSA 1C4CA 4ES3A 1SJ1A 4IOXA 3AOCA 4MKVA 2BW2A 1RADB 2EFQA 4WFZA 3TVZA 3V1QA 1NXIA 5F8IA 1FXXA 1XI1A 1T44A 1PJ6A 2JEGA 5JUMA 4DV5F 1M90T 3AJ2A 2X1BA 1LFWA 3B78A 1D1UA 2PA8D 4FJXA 1HBUA 2YX1A 1ZZFA 4KHWA 4OZ3A 5AJ3J 4NA1A 4DR4K 1HQ2A 2GQCA 2WSEC 2XQCA 3KK1B 3KLVA 2DNQA 3HT0A 4BC7A 4L3QA 1QHTA 3DYAB 2B3TB 3U1LA 4UZCA 3AA8A 3VV2B 1SJFA 4M1KA 1HBOB 5AFUH 1T9TA 4E7IA 4EEYA 4OI3A 1FJGF 4DUYJ 3MECA 2APOA 1DY3A 4GV6A 4ED3A 1AUDA 5CXTA 5L1LA 2G8FA 3NBPB 2KJVA 1WEXA 2OSRA 4OYOA 5L1IA 3SCLE 5AQIA 5DETA 2XGQA 3UO0A 5BYQA 5ADXA 1CJUB 4Y65A 5KT2A 4NXNJ 5HAOA 4R79A 1I3OB 3BR8A 4OZ5A 1NU4A 3VN5A 2HSEB 4DFJA 1UL3A 2O8CB 2V9WA 3DLBA 1RILA 4OX9K 1FRLA 1NSKL 3NCPA 3VAKA 2IY5B 4PPZA 5BR8F 2D0BA 1FVSA 5D4NA 3DOMA 3WNFA 3DLHA 2V51B 5M1FA 1JLEB 2YNGB 2HVEA 3MEEB 3QFUA 3TABA 2O8FA 4H5RA 1KFDA 4FLYA 3J7AP 1JL2A 4AM7A 4DCJB 4OLOA 2EXUA 4LRBA 4QZVB 3KLFA 2BX6A 1SKSA 4UUWA 2F5GA 3BGRB 2ZJPL 4F8RA 5DLGA 2LDIA 1T6CA 2E66A 5A6WA 4YFUA 5J2PB 1S6OA 1F0XA 3AXMA 2OTLN 4DFMA 2HIYA 1UWBA 2W2PP 3O8MA 4CEAA 4JV5K 2EX3A 4LBIA 1VIOA 1VQ9S 5AT1B 3FZKA 3CCQN 1EKSA 4CJ5A 4DL6A 4MMOA 4KB0A 4G1IA 1F60B 1WG5A 4OYAA 1NOYA 1NAQA 4LQ9A 2ZVIA 4NLBA 2A6OA 1KNZA 1HI0P 3LDQA 1LK5A 3PEJA 4CZKA 4DCOB 3MXIA 4JV1A 2E5LK 2VF3A 3BDPA 4BRCA 4FK2A 1SKRA 1KTVA 3OA9A 3BSOA 2FBTA 1VQPS 5IC4B 1OPIA 2QWMA 4NMLA 3CO0P 2JGUA 3U4LA 2F8TA 2AWZA 3EXCX 1S49A 2O8EA 1X5SA 3TSQA 2B8PA 3GG1A 1YBAA 3KWIA 1IBKF 4CH7A 3SMSA 5KFXA 4B8CA 1CBKA 4DPOA 4D3HA 5GADP 3L2WA 5C25B 4LF1A 1YZ7A 5T14A 3BO2A 1GNKA 4C3KA 1TUGB 1HYZA 3CGIA 2JL9A 3TWZA 4QS8A 4WF9Q 1NHKL 2V50A 4F4ZA 1EKEA 1UAXA 2JWNA 1NLKL 2KVIA 2V4JB 4ZHRB 1TK5A 4JV5J 4XH5A 3W5YA 1P1LA 1RT4A 4JD2B 4CLKA 3PUFA 1FK9A 2Y1LB 1L3VA 2HRTA 1VQYA 1N52B 2YQ3A 3D2FB 4IH5A 4MAKA 1VQ4N 2AJ2A 5KT5A 2F8EX 4O3NA 2XY5A 3QEPA 1IBLF 1RCHA 1KQKA 2R7RA 2VA3A 3R5BA 1TZ0A 3KXDA 2VBYA 3ISZA 1RNHA 2PDAA 5DGBA 2RQKA 3ZT2A 4LFCK 3N5FA 4RBTA 4OZ1A 4KR0B 1EKRA 1Q9YA 2OTJS 1CJVA 1F5CA 1F2GA 3FVYA 1W26A 3JXUA 1MNEA 2HNDB 4ISEA 1WEZA 3SMPA 2MQLA 4CZJA 1VQ8N 3MOJB 1O5JA 2KVQE 3C94A 1SIZA 5IC6B 4JUZA 1DTTB 5E3AA 2QMXA 4LUBA 1RAFB 3L95X 4XK8C 5C2DA 1NGAA 5AE3A 2C2ZB 5I42A 1U24A 4DCPB 1UVNA 5D77A 5C2GA 1K1SA 3LP2A 3NCIA 3LOUA 2EK6A 3H98A 1QSYA 2H9ZA 4HYKA 2XMWA 1G4CA 3CC4N 5C12A 4B3MK 3OR1A 4RUHA 5KGXA 3CIPA 2VHGA 4CLLA 4KSEB 3O80A 4TXSA 3H08A 3EYZA 1VMBA 3N6LA 4NLCA 1FNXH 2IM2A 3I9V9 5EX3A 1K73O 4M3YA 1OH8A 2IRXA 1JKHB 4E19A 2RQ4A 1FWLA 1DURA 4XPCA 3OYBA 4O4GB 3IRWP 3RAQA 3CJRA 2R42A 4FWNA 3CHWA 3PIPQ 3DC2A 4NWBA 1U2RA 4IBNA 2WSCC 4HHJA 3VALA 3V4IA 2KI2A 3MI7X 7FD1A 3M1VA 3AB2B 3DGPB 2VCPA 1EX4A 2ZKTA 3KZBA 5CCLA 2RJZA 4MKBA 3DDNA 2HAFA 3TQ1A 3GJSB 1DRZA 1R7IA 4FJGA 1Z6RA 4PWWA 2B0GA 3MPVA 3R5DA 1HNVB 3TTCA 3MN5A 3HSZA 3OYGA 1VQ6S 2CPIA 3OQ2A 1E6YB 3FZMA 3QAEA 4F4YA 2ZWHA 1WBDA 1R8BA 1YRUA 2Z4PA 2L3MA 3UVJA 4IZ9A 2ZD1B 4CGDA 3ET6A 4PUOB 4P52A 2K7JA 4CT8A 1RT7B 4JN4A 4ZVPB 2KB2A 4JI0F 2HEKA 2FF6A 1AUSL 3KLHB 5CYMB 4JOUA 1GMWD 2B5JB 3Q8YA 4B3MJ 2OSQA 3ENQA 2ZGZA 2K3IA 2N3LA 2POKA 3QZ8A 3PHEA 2RVJA 1DTQB 2ASLA 3SJJA 1EZZB 2NNWA 1QSLA 3LP0B 2DNYA 3MM6B 2A40A 2KFYA 3CCSS 1F9FA 1WSEA 4ZCMA 4Q45A 3LWMA 3NDKA 5HQ8A 3K17A 4H4KC 1BWFO 1Q7YO 2PBDA 4JHDA 1S0OA 2QA4N 1Q86O 5JLHA 1KVAA 3UDVA 2C2KB 3D45A 5B0CA 3DHWC 2E9ZA 3FBBA 2VICA 3EY1A 3VQPA 1N5YB 4LH5A 1VFJA 4OQJA 2BBEA 2W25A 3NG8A 2R7UA 2EWSA 2P9IA 4NZ6A 3T9ZA 4AHTA 2FSJA 1HARA 3DXMB 2K8GA 4DZDA 5CYJA 3VQ6A 3Q86A 3ZX2A 4JAXA 4Y34A 4DV7J 3T5LA 2YKMB 5KG3A 2H51B 4KH4A 4LBPA 4DR5J 2MJNA 4IFVB 4C23A 3M9MB 4KAZA 4FF3A 2ILYA 1Q9XA 1I3AA 3ISNC 2W7AA 5DM6L 3RVCA 4AL5A 4A46A 1QZ6A 2M4MA 4FJKA 3P1GA 2FQQB 4DJBA 3CEDA 3WXLA 2XMAA 1LKZA 1RE1B 3SMZA 2F3JA 4TLQA 1UETA 1NO8A 3W9IA 3N4WA 3M5RA 4NLRA 3TEGA 5I3PA 2PMWA 3QGPA 4NZ0A 3FZBA 5LL6Z 4DL4A 2M70A 4DV1F 2RD5C 1HNZK 2H3GX 3RBEA 4A8XA 3C66A 5GAEP 2IVYA 3OUYB 2DB1A 5AQLA 4WTOB 5FD1A 3HFKA 2HGLA 2BE2B 4RG8A 3VQ9A 4O3PA 1BQMA 1SH2A 1KVCA 3J81O 2H65B 3ICLA 1S4EA 4JS5A 4JI3F 2E29A 4LC9B 4C8MA 3U1MA 3MXJA 3D6RA 2LEBA 4FNHA 1S77D 3C16A 3DCAA 2UXDF 2CQ3A 1UJ4A 3E9PA 3SQGA 2HVDA 1VC6A 3NGYA 1X9JA 2BE7D 4ECTA 4J5OA 4H0OA 4K8RA 2DFHA 2PE8A 4OI1A 5IZHA 1YJTA 3CUNA 1FX4A 2MY8A 3CM5A 2DHGA 3H42A 2CNOB 1S1VB 4MJKA 4PPDA 3WC0A 2CWXA 3M6UA 3WNGA 2R2TA 3U02A 2H5EA 5JMNA 4IJNA 4YOTA 2BM1A 4USIA 3D4JA 3CMQA 3KFWX 2VPYB 4PG8A 1S1UA 5E5NA 1LAWA 1Z25A 1SIWB 2DXDA 1QQOA 4FJMA 3MCOA 1Q82O 2MB0B 4NXMF 3H8YA 4YB6A 4ZVTB 1HNZJ 5FLXU 3J7ZO 3VQ5A 1TL3A 3GJRB 5CAAA 2HZVA 1XR5A 3CULA 3QIOA 5T7LB 3CCLN 4CJVA 2Q3PA 2QA2A 1SCJB 4KO0A 4CH0S 2IAJA 3M4XA 1C0FA 4ZIWA 1DAXA 5BN8A 2EW9A 5JS2A 2GJIA 2CVEA 5G0RB 3I5AA 5HANA 2QV6A 4URQU 2QLWA 2HNYB 1RT1B 3KWMA 3DAWA 3NAEA 3TZYA 2CPEA 4B9LA 4NLTA 4DTXA 3J7A1 3ZZUA 2CZ9A 4YY3J 3ZLJA 3VEWA 4RL1A 4Z4IA 3C6AA 5DS7A 3J7YP 3L2VA 3WNEA 4HACB 2B4JA 3IAM9 6FD1A 4B9VA 2RRAA 2V2VA 2HHSA 4ILGB 4JB8B 4E8UA 1X31C 1MW7A 4J9RA 3NS5A 1BI4B 3EJMA 1REVA 4LVOP 5L38A 1BQNB 3V2UC 1O1WA 1J2VA 1LWFA 3ILLA 2UUCF 4WFBL 1OH7A 2V5HG 4UT4A 3SBMA 4ERDA 2Y1IA 2MDAA 4C1NI 3BR9A 2VBXA 4I2PB 4ZN3A 1YI2S 2Q66A 4M63C 4CEBA 2VG7A 1R8HA 4IQXA 5KT7A 3VF0B 3IAYA 2HFOA 4ZVGA 3ATUA 3TAMA 1CG2A 1UAWA 3AD8C 3L7UA 1JNRB 4JYAJ 2XMKA 4CHPA 3THPA 1RAOA 3I55N 1JCGA 3T1YK 4LF4F 3IO1A 4FP9A 4DR2F 1NDLA 2YWWA 4CO5A 2XO6A 4F3OA 2KKZA 3DRPB 3SBTA 1IKXB 1YT3A 4NCGB 4OZJA 1T6DA 3M8YA 2QWLA 2YX4A 3NE6A 3A8JA 2MQPA 2YNHA 3CM6A 5DDQC 2Y1JA 4YDUA 5CZ2A 1KVBA 5FLXY 2K06A 1U2CA 2PC6A 5AE2A 4KH5A 3WEEA 2ZF5O 4DR6K 4GVEA 1S72N 1RKJA 3SXLA 3BYPA 1RCXB 2YBVA 2QXLA 1J5OB 2CDRB 2BMBA 3DJCA 5DDRC 1HR0F 1M5SA 3H4BA 5SUHA 1FD2A 1KAYA 2ZUGA 2ASPA 1SL1A 1C6VA 3ZYYX 4A8KA 1KLMA 4JKHA 4FLUA 1RWXB 3FGUA 1WC3A 3K0SA 4H4OB 2HNZA 1Q7LB 2DFEA 1S5JA 2WBNA 3N4PA 1RBAA 1JIHA 2MKYA 4OHVA 3GV5B 4OYBA 5IT4A 1Y3KA 1N36F 1LEOA 1FERA 4BREA 3LH2S 3DI6B 3M8QB 2LSNA 4BQLA 6AT1B 2I2YA 3PRVA 1CLQA 3B82A 5T7BA 3OXGA 2FSKA 2VQEF 1MROB 3HPGA 4FZXC 4DLEA 5AQMA 3I6PA 4Z4FA 2HFSA 4RTFD 4Z7YA 3NH1A 1UFWA 2OD4A 3HTVA 3UNGC 4ZMMA 1HPZA 1V3ZA 3R2CJ 1QDUB 3I8DA 3KDNA 4ZVHA 1U49A 1IM4A 3KG4A 5CR4A 4NOHA 4OYIA 1IR0A 1QVFM 4PEOA 4DR6J 3QMQA 3U9DA 4AE5A 4ZITA 4DQIA 3MX2A 1W7AA 1Q4RA 4JI2F 2HW3A 1JLQA 3CE8A 4HVJA 1RAAB 3UKRA 3NGDA 1FXLA 3PKMA 3WC2A 2CQ0A 1PAUB 2XB2D 2HFZA 2GMLA 3P83D 1XNRJ 3AVIA 4DV0J 3C6TB 3IAS9 4IOCQ 3JB9k 2VOOA 1QE1A 3D67A 2QYCA 2C22A 2HPUA 3CCVS 1KD1T 3CT9A 2ZOGA 3CJ3A 3WZ0A 1JJ2M 3NF6A 3PR5B 3EVOA 1HW8A 3MEDA 1X1PA 4QCLA 1UPPA 1SQFA 2E88A 3P49B 1TKXA 3ULHA 5B0DA 5I3UB 3EXYA 4JKBA 4PQUB 1WF1A 4FXDA 4CJ3A 3DLLL 2JEIA 1EB0A 3PO4A 4A47A 4HTLA 1CJTA 4C8LA 3NEKA 1TAQA 3VOVA 2PO4A 4USJC 3DU5A 3D2EB 1UEVA 4K59A 2OPSA 4ES2A 1U1QA 1JLBB 3Q24A 2NRXA 3SQOP 4BRAA 1IR1A 5F9NA 1U1LA 3BSCA 2KLAA 5EVZA 4LRAA 2P9LB 1YJUA 4CD1A 2LECA 1NG9A 4DV6F 2XS5A 1J27A 1YJNS 2HF3A 1XMBA 3GCXP 3AVKA 1TL1B 1ZTWA 2PI4A 1KCFA 1M5HA 3ONQA 4J9KA 2MZJA 4ISFA 2NRZA 1QUPA 3H20A 3CD6S 3K89A 5BR8K 3VERA 1Q7YT 3R2DJ 4HH0A 3GB0A 1Q81O 4LMZA 4P7TA 3SDEA 4IFYB 1I94K 2XEXA 4OFZA 3KK1A 3LDPA 3HFVA 3AJ1A 1QQMA 2CQPA 4DV5J 4DV4K 3A8KA 4ELVA 3TU5A 3DYAA 1FJCA 2AJFE 4N7TA 4ED0A 1TVRB 3BZQA 3OW2R 2NUHA 1HBOA 3HXMA 5KG6A 3BZCA 4FDFA 2F7VA 4MFBA 1FKOB 2F8HA 3NBPA 2I5JB 2EFVA 3PCOB 1U0HA 4K4XA 1WC4A 2AEMA 5IFMA 1NSPA 2ZJRQ 2BUPA 1CJUA 4JI5F 4CZCA 4O8KA 4ISGA 4PA1A 1HLWA 4ID5B 1FJGJ 5JS1A 1URNA 1VBZA 2FBXA 2Z58B 3S9HA 1RWKB 5AZJB 1SQKA 1Z2ZA 3V9XA 2E7XA 3PXGa 3MR2A 4W4MA 2BM0A 3AVLA 1P8GA 1WHXA 1JX4A 1JLEA 2YNGA 1FRHA 1TL4A 5HMZA 2VJUA 1G7CB 3MEEA 4N8NA 2RPIA 3A3PB 3AVNA 1CXUA 4OHWA 2A3ZA 4OZNA 5B0FA 1EWRA 1WAFA 3DXSX 3GIRA 5BR8J 4A8YA 4DU1A 3CFOA 3V1RA 3F0NA 1SI9A 3E1YA 1ZBHA 4JBCA 4LIWA 4Y2IA 1IBMF 3VPZA 4JI6K 1N88A 1K8AO 2PGCA 4FJIA 4RU9A 4DQRA 3MPDA 3NL0A 1NH8A 2E9TA 4K8ZA 2YJFA 1H3DA 1XJWB 2FGOA 2KXFA 5J2PA 4KE5A 2Q36A 4MQ3A 4J2BA 3KKFA 4OV1A 4CDIA 4DUZF 5HBMB 3MMAB 3OBYA 4Q2MA 1PJ7A 1S7HA 2W4CA 3V81A 4EP5A 3OTBA 1RTDA 4AHUA 3QQCD 3UCUP 1IKYB 1XMQJ 4AL6A 1Y97A 3ZZTA 2OCEA 2XCPA 1N5QA 2IIRA 1I5OB 3VQSA 3NOCA 1SUQB 3OYFA 1NEEA 3RTVA 4KTWA 3F5TA 1MLAA 4YOXA 2RB7A 3CXCR 3GQCA 4WYBA 4M7XA 1IBLK 1D09B 2HK2A 4EMDA 3MR5A 4YHHF 3SAGA 2ACMA 1BXNA 4O3RA 3OTOJ 2YWHA 2M2BA 4Q2LA 1Q79A 4J90A 4OPKA 2NRRA 2IVMA 2VC0A 3NWGA 3GDQA 3QGIA 2K1RB 2E8AA 4GVMA 1D8ZA 1HMVB 2WTFA 5C25A 2HZCA 2UYTA 4FJHA 3MXMA 3J7ZT 3SNNA 1S9EB 3LP1B 4CJLA 2HHXA 1A5XA 2VL1A 4OHZA 1IBKJ 3GFHA 3VMFB 2FBVA 4E98A 2C2NA 2BJ1A 2DYAA 3W1YC 3BN7A 2V4JA 4ZHRA 2CJYB 4WKRA 3ZTPA 4JD2A 3HHDA 2PN6A 4ZVRB 5KG5A 4BRNA 4GVLA 2LQ5A 3K5PA 4BRPA 3OHRA 1CS4B 4FSVA 2RDIA 3MN7A 2ZH9A 4CLSA 2XSJB 4LQ3A 4WFAQ 4F4WA 1QQCA 4M45A 3P38A 3ZX3A 4I7FB 5A76A 1FA0A 3DLEB 1EARA 3VQ4A 4DX5A 4FBTA 4K0KF 3EZOA 2CGJA 5IQ6A 4MK9A 2QWRA 3S3MA 1QTNB 4P72A 2HNDA 3T9NA 2OFHX 1FNOA 1NM1A 3UPFA 3O1LA 4BRGA 3PNIA 2LCWA 4TKTA 2BOAA 3TI0A 2R7YA 4Y2AA 1DTTA 3L7PA 2JRSA 3H2UB 4PL7A 1BCMA 5GIOA 4HR2A 2R2RA 2J9DA 5K8NA 2CGKA 3TJ8A 4DUTA 4ECRA 2C3OA 2EG1A 4JI8F 2HHWA 4BR0A 2DNNA 1NZ8A 1RAHB 4WZQA 5FPMA 1U8WA 1V5IB 1TU0B 5L46A 2B4OA 2BDPA 3S3OA 2C42A 5C15A 1QVGM 3TARA 4MO5A 1IWGA 1VBYA 4L8RB 2EHGA 4Y0WA 3LPEA 4WQ4C 3DDIA 4O4GA 1T05B 2EEYA 3ZSOA 4XAKA 3W64A 4O0NA 4GKJF 1KONA 4OX7A 1F9HA 3NOGA 1KHVA 2A18A 3QINA 2KKHA 3VGTA 2VV5A 3M2UA 2QG9B 3DGPA 2UXBJ 3C7NB 5KG1A 1RBLA 2BTFA 5KPRA 2PFUA 2GV1A 2AV5A 4OKKA 4KQZA 5KFTA 4G6VB 2JSXA 3SV3A 3SAFA 5J2NB 4CFBA 1C0MA 1VQ6N 2A5XA 2LA6A 2IBKA 4ZLNA 1E6YA 3C65A 2MKKA 1R3NA 3O3HA 1PCAA 5E3PA 3HSCA 4O55A 2E2OA 1YQHA 3UD5A 2QJ3A 1WEYA 2ZD1A 5AQKA 1RT7A 2I38A 4U8YA 3AY9A 3T19A 3KLHA 1UVMA 2W40A 3GYGA 5CYMA 3G96A 5LMUF 2MLXA 1ASWA 5ETQA 2B5JA 2GJ2A 2QL9B 4R0JA 5CH7B 1B3TA 1RBTA 2L41A 2HQIA 5A2QU 1DTQA 3AVMA 2RQMA 3KUHA 4JI0J 1Q16B 4QOTA 4DTRA 1ASVA 2DNOA 3LP0A 2GVZB 2WAQD 3MM6A 2ALZA 1PBAA 5CD4A 4GRSA 5AZIB 2GMJA 3CCSN 4W5NA 6FDRA 1H7WA 1RBSA 2HF4A 4IWVA 4FBUA 4DTOA 5KG0A 3EVMA 4WYWA 1JXEA 1W9HA 4IG3B 4FPRA 4F9OA 2YKNB 4X66F 1IV0A 4BBYA 2OHDA 3VF2A 2XHBA 3U3GA 4V19X 4RCHA 4UF4A 3JYTB 1KVIA 1N5YA 4C11A 4ES1A 1NK9A 1RYSA 2JH3A 2QTDA 4TQSA 3PRBA 4DTMA 1YTYA 3SJHA 2RHQB 3ETMA 3DHXA 1RISA 1VQKS 4C8YA 2E2QA 4DV1K 3O4NA 4ZLJA 3CERA 3MCSA 3GMGA 5A8KB 4DKWA 1QY7A 5EWEA 3DXMA 4MYTA 1X4GA 5GADU 4ILRA 3C46A 2ZBPA 4A48A 2PAVA 1TFWA 4WFNL 2YKMA 3OS2A 5F8GA 4JI3K 4IFVA 2KRRA 2KT3A 1FTCA 2HVIA 2HSTA 1XK8A 3HVRA 1GTEA 4ED4A 1BWEA 4N8OA 5F1XA 2UXDK 3O3LA 3L7OA 3A8IA 5FROA 3LM2A 4USWA 1S6QB 4R5PB 1BU6O 2E7VA 1SQEA 2W9BB 1EQ0A 4WU3A 4MO4A 1BO5O 2AHOB 4X4TA 2FHOB 2VWKA 5AJ3F 3DWLA 3THWB 2EI5A 2CPHA 3W66A 2D4WA 2QYGA 3GFXA 4CI6A 1NPKA 3BO4A 1RSCA 3PW7A 2R2UA 3HSJA 3OUYA 1HBUB 1PIEA 2BE2A 4CLPA 4KHPF 3TW0A 4KI4A 3AO4A 3DOLA 4CHNA 5M2PA 5A2QY 3UDCA 5MLCV 4NXMK 5KT3A 4DV1J 3SQ0A 1GXTA 4DV3J 4B9SA 2E2NA 2UP1A 4O3QA 1U2VA 4FLTA 2R7TA 1WKKA 2R7VA 3FDSA 4J9SA 1P9YA 1QAYA 1GMVA 1IJFB 3PSIA 3QERA 3M7VA 4NXNF 2VIHA 4CT9A 4O44A 1RAJA 3MF5A 2GJFA 1R8PA 2FJVA 1WSVA 3DLGB 4JI3J 3MECB 3IXQA 3GPAA 4DZ6A 1IG9A 3NLCA 2V9KA 2Z1GA 1YRTA 4OYXA 5GAHP 5LMNJ 1S1VA 2UXDJ 1DARA 2DKOB 1SQGA 3ZT0A 2IMOA 3PDNA 4LBHA 2EKNA 3S6EA 4U96A 1TP7A 5GINA 4Q0BB 3H2VE 4M94A 4LR8A 3O9RA 1PO6A 2AYEA 3VWSA 2IVOA 4ZPAA 2OO4A 1FKAF 1QM9A 3BM7A 5LL6d 3TANA 3NWRA 2UUCK 2ZNZA 2O8FB 2M3DA 2MSSA 5T7LA 2D1KA 5IS2A 3MPWA 4MH8A 3W2VB 2JLGA 2YKAA 3PX4A 1GLFO 1RTHB 1LW2A 2P9CA 1RAIB 2DGUA 1U7LA 3THVA 5G0RA 2EBGA 1V3RA 2VPXB 2K2PA 1K8AT 3N6NA 4FK0A 3NS6A 2E1PA 3GU0A 3Q7CA 2DHSA 3D68A 3CCES 1RHKB 1WSRA 5C2CA 1RT1A 4CERA 1IQZA 1YAGA 1VGYA 5FPDA 3D6FB 5F8LA 3NMUA 3N28A 1UWBB 4RR5A 4AQYF 3H25A 1ZBLA 4JV0A 4YORA 2FD2A 4Y1CA 4ZP6A 3OLBA 1T03B 4LF4K 4HACA 4DR2K 2CQGA 2ZH6A 5E7OB 3S1TA 2W4DA 4AD6A 4Z2XA 3PW5A 2KYXA 4KH1B 3LPUA 2QMWA 3W7BA 1APSA 1BI4A 3Q8RB 3F56A 2QLFB 3AVBA 4ZJOA 4BACA 1YJ9S 2DNRA 2Z0GA 2C2MB 2X74A 4Y28C 1BQNA 8ATCB 5J1EA 1YIJS 4W5RA 3D1QA 2OIHA 1Z1ZA 1WDDA 5TKYA 5EGYA 1YVUA 3VQ7A 1ZPVA 2D0OA 4E7JA 2Q31A 2PFDA 1HR0K 4I2PA 2V69A 2RU9A 3HD2A 2BR0A 5GVQA 3BZKA 1YI2N 1ZH5A 2GX9A 3ZZPA 1KFSA 5HROB 1NLVA 3UIQA 2QKKA 3ZSZA 4Z37A 2O8EB 2DPNA 3SCIE 1RTIB 3HHLC 4Q8FA 2DTJA 2UV8G 1HUXA 5L39A 1KC8O 5C2FA 2F40A 4QW8A 4CJEA 3EDRB 3O3GA 2FIUA 1KAXA 4IFEA 3VAHA 2N7YA 1UJ6A 1F1BB 3LP3A 4B1UB 2FZKB 3R5GA 2VBWA 1O13A 2WSFC 1J6ZA 1N36K 2DD8S 3IWNC 3DRPA 4L75A 2P9PB 1IKXA 4C0BA 4DFPA 4KH6A 3WQTA 3SYZA 4V1Ak 2ASDA 3LUYA 1T95A 3IFRA 3O08A 2JFKA 1J5EJ 4CGJA 1UMJA 2B7CB 4LF4J 3W5ZA 4RUBA 4DR2J 1FK9B 2CJKA 2UXCF 3HI0A 2F96A 2WUSA 4KGZB 5HP1B 1IJJA 1CJKB 3D3CJ 3I96A 3GV8B 4GVBA 4HVZA 1J5OA 5EWGA 2BW7A 2VKRA 3GSIA 3TR5A 4FYDA 5GAGI 2Y3YA 4B9UA 4DS4A 4LH4A 3D0IE 4HLBA 2G2YA 1FDNA 2ZM6J 2IJRA 5CZVA 1RDUA 4JI2K 3QEWA 5GAEU 4H4OA 1CC7A 1VQ8S 5IM0B 3MR7A 1HR0J 1YTUA 1X5TA 1KSPA 2D0AA 1FFSB 4WF9L 1QD1A 4ZVEA 4ZVFA 5U47A 4NRUA 3AHPA 4EAHD 3GLJA 3G8SA 1TMMA 3L3VA 3CFPA 1NGDA 2MPUA 1IWAA 3DI6A 2KG1A 3M8QA 4C3LA 5I42B 1RK8A 3BGLA 3GG4A 3OYHA 2KZZA 4F4XA 1D9AA 2XLIA 3EL2A 2RDJA 1ZAXA 1MROA 3MX5A 2UUBK 3DU6A 2FVRA 3GSDA 1MWYA 3OR1B 2WBRA 2LQ8A 3P5BP 2OMLA 4Z0UA 1WUAA 3KLEB 1BWVA 3VGKA 2LQ9A 2V2KA 1M0SA 4CO4A 1AROP 3PKYA 5BXIA 3IN5A 5HL7Q 3D7EO 1KHWA 2VQEJ 3HOTA 2QWOA 5HVFA 1TK0A 3PRDA 1VRUB 1OSDA 3EM1A 3TJAA 4ILMA 1QS4A 3SUPA 4DV6K 3VGMA 3G25A 3IRXB 4GV3A 2DIUA 3S7RA 1RU1A 1FTRA 4KIAA 1W2IA 5HSPA 3ALYA 4CF0A 2BRKA 1ZOTA 4F26A 1R43A 1QAJA 3FCHA 4DSLA 1V6HA 3C6TA 3FSIA 4OV6A 2BQ3A 1U1NA 3UN3A 4JNEA 1B0TA 3TTDA 4IG0B 4DB3A 3VEYA 3QBXA 4FZYA 1LXJA 1N8RO 4FK4A 1BMQB 3CCVN 4WP9A 4K42A 3FMWA 2YNIA 3P45B 4WZMA 5I3UA 1LWXA 2RHKA 4HUFA 4OJHA 3IMXA 5KTQA 2HRUA 1JLAB 3SPZA 1K1QA 3D2EA 3IM8A 2G8HA 3QFPA 1CQNA 1TTHB 3KDOA 1YVNA 1LXNA 3PIPL 2ZH8A 3J7YU 2CNLB 2GVDA 2ASYA 4C1NK 1TL7A 4H4KA 3HMJG 2QC3A 3L4BC 2P9LA 5LJ3Y 4FWPA 4PR6A 2FHKA 1FX2A 4CGHA 5JICA 1YJNN 1TL1A 3RMDA 1S7IA 1U1OA 3H46O 4C4WA 2XWYA 1FJEB 2EFGA 3EPIA 4ALZA 1TQLA 2C3MA 4KB7A 3QRQA 4EYIB 2FHJA 4H5TA 3CD6N 1RT5B 4YDXA 4ZK7M 5D3GB 3CMEN 2HMIB 2QA4S 3BEXA 2RUGA 5LXYA 4X4QA 4CEDA 2W01A 4IFYA 1JLGB 3PVXA 1C1CA 1YWXA 2I0XA 1RLDA 2JLFA 3EWGA 2ZBCA 4K2XA 4QU7A 1PGZA 3MN6A 2A1BA 4B3OB 1RWOB 1ULRA 2HWHA 1YDLA 3VQCA 4ECUA 4TYAA 1T11A 1H0HB 2KXNB 3BREA 2HIQA 4QS7A 1FKOA 2WC9A 1CVJA 1F2HA 3AODA 5DM7L 2I5JA 3FFIB 1QQNA 1FRKA 2QRRA 2G9OA 4ICLA 2C3YA 4ZDNA 2XBPA 1UJ5A 1WKJA 4DL5A 1TFYA 3RR8A 4NMXA 4DTPA 5HJXA 2FVCA 4IO1A 4XTTA 2DH8A 4IKAA 4J37A 3NY0A 3TA1A 2GWJA 2F9DA 4OO1J 3QLHB 4OGEA 1NH7A 4ANDA 5AZJA 3X1LB 2GO8A 1KS2A 1Q8KA 3AA9A 4JI5J 1NDKA 2AX1A 2HHUA 3PLAA 3OY9A 3VQDA 1PKUA 1R0CB 2DIVA 2Z30B 3CCRS 4YNQA 1KXPA 3VZHA 2CQDA 4P74A 4CEOA 2YHBA 1IXKA 1YJRA 2DGWA 4V19J 4CP5A 3TVYA 1Y10A 4CF8A 1ZA1B 3B8HA 1KQSR 1VOMA 4OPAA 4YHHK 8AT1B 2NRWA 1C1BA 4ED1A 3CD5A 2H5JB 4KY3A 1J53A 1QZ5A 3WBZA 1HBMB 5LSOA 4BVPA 1S97A 3NVMA 4GMKA 3TSPA 2KJWA 3UE2A 5JJBA 3QSIA 3M6VA 3P4UB 3P3DA 1N5TA 4W98A 2X78A 1YXQA 1Q5VA 1RHUB 3ID6A 3OSNA 2IVPA 3JSMA 2NZTA 2X6NA 5HBMA 2FJBB 2HOEA 3MMAA 1WSHA 2JZ5A 4G65A 5EHHA 3CDAA 5KFFA 1N32J 3O2IA 1KR4A 1VK8A 1EXQA 1IBMJ 2DTUA 9ATCB 5E0OA 4OPJA 2OEKA 4OLAA 1IKYA 1REGX 1BCOA 3D0GE 4OVLA 4DI6A 5EUHA 1JJ2R 3BPDA 2MKSA 4DUZJ 2NR0A 3C16B 1H74A 1WKLA 1N33J 1SUQA 3SQGB 1SC3B 1PYSB 4LR7A 4DTNA 3AAWB 3TOQA 3S8SA 2O4IA 3BGOP 3EGWB 3U7JA 2J8SA 1VCTA 3OL8A 2ZH4A 1T0TV 2QFIA 4R0EA 4CGIA 3E8OA 1AA1B 3B6PA 4OLPA 2KYZA 2ZBQA 1U2FA 4OI0A 3ZSRA 3KVGA 3J81j 1X60A 2FLPA 2PIIA 1DKGD 2V4QA 2HGNA 2K1RA 2Y1RI 3JS9A 1HMVA 4F3QA 2QFJA 4DL2A 4YHHJ 2QO3A 3V6DA 4AILC 1M5PC 4WIQA 1S9EA 3OLAA 1WD6A 2FVPA 3KUEA 2VFTA 2CVIA 2J76E 4PXDA 2O1PA 1FKPB 5DG8A 4FXWA 2JDJA 3CCLS 4ZVUB 4JI8K 4KO0B 4YY3F 2IAJB 3T1HK 3ZEUB 4N76A 2AQ4A 4OJ1A 2NSBA 4A8SA 4USUA 4BR5A 4ELTA 2EC0A 4CJRA 4LF9K 1LOUA 1RWMB 2R8JA 4CFCA 3SI8A 2XSJA 2AJ4A 2LQJA 4BS2A 1F9EB 4FWKA 3PYDA 3CB4A 2WB1D 2W7OA 1IM6A 3KMQA 4I7FA 1FHTA 5AQWA 4R25A 3DLEA 4IDHA 2LXIA 4GKJK 5M2UA 5B09A 1K8KB 4CJUA 3BBBA 3QFWA 3H1VX 3K5OA 3SCJE 2J4RA 4EK2A 4TSXA 5CE3A 1HWKA 4W92B 3RR7A 3IP0A 2OD6A 2F1FA 1SVDA 3R7BB 1NGGA 1VQNS 1WELA 2R9LA 1LOTB 4K0KJ 3ZZRA 5I9EB 3FCWA 1PC4A 2FVQA 1I51B 2MZSA 4WWSA 2HWIA 3AO3A 1S48A 4O23A 3HHLB 1ATRA 3JTNA 4GC6A 1BIZA 1LK7A 1FDAA 4AHCA 2LP4A 4WQ5C 4HDHA 2Q6BA 4JYAF 2LYVA 5JVGQ 4FLVA 4I64A 3KKRA 4HH1A 4QS9A 2W9AA 1I39A 1RFQA 1TMJA 4F3MA 2VG7B 3AH6A 2UVWA 4X4UA 2CPXA 1KC8T 1HHQA 1BISA 3HI9A 1NGCA 4CFAA 4JI8J 4DL7A 3R6LB 5CHCB 3UW1A 5LMUK 1SJQA 4CECA 1T05A 1WC0A 5ADZA 4M3TA 1GX5A 3L8BA 3KLGB 3NAHA 1Z26A 4JS4A 4ZN1A 4K41A 2Q6CA 4IKFA 2HVHA 3CCJS 4EUVA 3AT1B 3ENOA 3M6XA 5KFJA 4M95A 3KK7A 2R8GA 4W5TA 3R6GB 1F21A 2G8WA 2OPPA 4GKJJ 3WEEB 3JTPA 1VQOS 4P9SA 4IEEA 1ZBTA 2KTQA 4BE1A 3IMQJ 2Z1JA 4EBEA 4CJ4A 2GCFA 3A3NB 2D74B 3H5YA 5J2NA 2VDIA 2QWNA 4ANEA 3KYLA 2G8IA 1OYDA 3KG1A 1S99A 5HOOA 2ASMA 2CAJA 4FJ9A 5F8JA 1Z05A 5E3CA 4QPTA 2R8IA 3R1LA 3VENA 2HNZB 4NL5A 2NZ4A 1IBCB 2CYYA 1HNXF 5LJWA 4EIAA 2CH5A 3UCZP 3LPYA 2VQFF 1C0UA 2W6LA 4DX8H 4F67A 4JKCA 4M3UA 3IC1A 4NYPA 2VYPA 4BLGA 3KTQA 5M2RA 3KUGA 3UD3P 2GVZA 3SFUA 2QN6B 3NKYA 1VDHA 4WE1B 4OZLA 3V5RA 5AZIA 3ULEB 3CCMS 4QWAA 4MYUA 1HKCA 4KHNA 2B4UA 2XZDB 2ATQA 4KT0C 4IG3A 2NS1B 2LXFA 4EBDA 2YKNA 3VF4A 4YN3B 1PJ5A 2RNEA 2XI2A 2CJXB 1QHAA 1V4TA 3JYTA 3RAMA 4GC7A 2Z2LA 3VCDA 2CJQA 1VHIA 3BQ2A 1DT9A 5B08A 2DNLA 3EMTA 5KRTA 1S76D 5AJ3K 4ECSA 1TYQA 3ZSWA 3M3ZA 3CVKA 3MR6A 1XNRF 1VQKN 4X66J 4DV0F 1Y5IB 4CJKA 4XH4A 2AEJA 5F8NA 3VEOA 2HBJA 4CJSA 5A8KA 3AY0A 1BUPA 3CJAA 5BPMA 1HWUA 2WW4A 3SIPB 3VZIA 4KHPK 2XWXA 4HTUA 2QTWA 3QO9B 3FZ2A 2ZOFA 5AQFA 1HNWF 4JRQA 1KDNA 4JKAA 2CH6A 4QOZB 1N8RT 1RABB 4PWDB 2VDHA 1TV6A 3CC7S 3PTWA 3BO3A 4YUDA 2GZOA 3M6GA 3HRGA 4TU9A 1YBUA 2CJAA 4ZTJA 3VGSA 1Y4ZB 4NXNK 2IVFB 2JWKA 4BRHA 3Q2SC 2WBMA 4ZKAA 2ATLA 3H1QA 1WSJA 3EUNA 4BRMA 2XG8A 2YVSA 1MG7A 1S6QA 4R5PA 1CJTB 2R3VA 3JQKA 1QVGR 4PKDB 1Q18A 4QJVA 1UWAA 1N48A 2W9BA 4FF2A 4MT1A 5D0EA 2VODA 3THWA 3MM5B 3NS7B 1XMOF 2KL8A 4UQGA 3ENAA 2G8UA 3ADAC 4J2DA 2DCUB 3K0JA 4JI7J 1H7XA 3QNWB 1GOCA 3LZIA 2JFDA 2L9WA 4CESA 3M6WA 5M1PA 4LFBF 4KC5A 1W2BR 3RW7A 3IM9A 4IOCL 2VFVA 1C0TB 5KFQA 1ZM9A 2KFZA 2JC0A 3QZ7A 4DS5A 3ITHB 1OY8A 3SDEB 1NHUA 4OKJA 4QR1A 2W2NP 3E3XA 2X3GA 4LF6F 1RT2B 1NJWA 5J2MB 2IRUA 2WCXA 2ZUAA 3FNNA 2G8VA 1B9DA 3OSPA 4KHPJ 4RU2A 4FLWA 3OL9A 4YOVA 2W41A 2LA4A 3T6BA 2DGVA 2MKHA 3L4QA 4HTJA 3OYDA 3DLGA 1T3OA 2DHAA 4MFBB 2GX8A 4WBFA 5HRRA 1U0HB 3R8YA 1RHRB 3ELHA 3CJ1A 2ZBRA 5E33A 2YKQA 3IDHA 4C48A 9RUBA 3K8VA 1HBNA 3WQPA 2YTCA 4FKYA 1VHFA 3KWGA 1JJCB 3NMAA 4BDZA 3IR6B 1WC1A 4ECQA 4Q0BA 3AGKA 5HI7A 1SH3A 2W7PA 1JCFA 3K9JA 3OYKA 2IM0A 1KEKA 1JXBA 3U6FA 2NYHA 5C5JA 2BKNA 2A1SA 2AYGA 1Z2LA 4DR4F 3H45C 4NI2A 1TKZB 3ZETA 4B3TJ 1R6VA 5EOYA 2OAUA 3W2VA 4C6AA 5KFHA 2NQPA 1RTHA 1ZYQA 2GO9A 2XGPA 3A13A 3DLRA 3TA0A 1WSGA 3JAMO 3GYXB 2LFVA 3RWUA 1PC5A 3CCEN 4FM0A 3MEKA 2ZJRL 1L3UA 3NNAA 1XMQF 3Q22A 1HA1A 3ZZYA 3HT3A 1T8EA 1HHSA 2N4DA 2RF2B 4PXBA 2AMCB 5J2QA 2MQNA 5KFEA 3D6TB 2KG0A 1T03A 1FFGB 2FHMA 2M8DB 3IFEA 2HYIB 4MTPA 3NF8A 2GTDA 3G0ZA 3V81B 3M8SA 2ZJQQ 4I6YA 1RTDB 5E3QA 1NMDA 3MXHP 1G1XA 3I31A 2NRHA 1D8YA 4HL9A 4EFAC 3VQBA 3Q7BA 3DRRB 2Y8WA 5CZXA 4AQYJ 3TJ9A 4LFAF 4FWOA 2DGTA 4ZP8A 3EE3A 3UNYA 1WWHA 3OTOF 1YJ9N 5EX0A 2ASOA 3MDQA 3FRYA 3F2KA 3AVAA 1YIJN 1VR6A 2J0XA 3QJLA 3BPSP 3QBCA 3ZSVA 3ILJA 4J9MA 2JHEA 2DGSA 4O3SA 3TPQA 1X9MA 4ECVA 5HROA 2XMVA 1ZAWA 4M3RA 4PG6A 4MIWA 4CEQA 3E2EA 2GW8A 1U02A 4BQZA 2LMIA 5JVHQ 4FJ5A 1LQ9A 5ETNA 1RTIA 1NPPA 2UU9F 3AAQA 4K4ZA 3C15A 1NK7A 2KHOA 1KN6A 4B1YB 2RU3A 4ANCA 2D41A 4JKDA 3G6YA 5F8HA 2P9PA 4RNOA 1YJVA 3EO3A 3OT9A 1S0MA 3EZUA 1S1XB 4DR7J 2P8IA 1E4GT 3CJ9A 4F02A 1YRXA 5T41A 3RRKA 1LNQA 2P5GA 3GBTA 2EFNA 3DM2B 5HP1A 2Q79A 3NVKA 2H1YA 1SJ3P 4IJAA 1CJKA 5K9FA 2ZBIA 4LY7A 5AQUA 1VIXA 2QZ8A 3HVTB 2QKBA 1GMWA 1HI8A 1OYEA 3AXKA 3D3BJ 3D1HA 5H9FJ 2UZAA 4LSZB 1KTQA 1BUXA 1FI4A 2ZEJA 4HCCA 1X4EA 2XYHB 3O3FA 2V0NA 2PYJA 2UXCJ 3K5NA 1UVJA 2ZH3A 2Z1IA 1OH5A 3UD4P 3RAXA 4CO2A 4YS2A 1GOAA 4OPHA 2MZTA 4J7CA 4DTUA 3AAPA 2MSTA 5M1NA 5IM0A 1U4BA 1W0HA 1WHWA 1S1TA 3QT5A 1RDBA 3FEYB 2I9SA 3EKUA 4Z4HA 1CXQA 3HFZB 3O9QA 4PYDA 1Q0NA 4NLSA 3U27A 1JNZB 4DWIA 1YKWA 3PW0A 2YHXA 3H59A 1GLCG 4ZPDA 4DN9A 4WQ4A 1W25A 5LXRA 1RWUA 3VA0A 3G4SS 3O1WA 2P9GA 1FEHA 1QSSA 2PFFB 1U1RA 2JLEA 3HD1A 1S6UA 2Z8QA 4WFAL 3KLEA 2QA1A 1WB9A 3N0VA 3FSYA 3FR0A 5ELZA 5GAHU 4K2JA 2UXBF 4LRCA 4E89A 3UDLA 2NXJA 2Z57B 3MHYA 4N56A 4F0KA 4WCEL 1VRUA 2MQOA 2MKCA 3POTB 3RMAA 4UY8T 2JEFA 2CA9A 4C98A 4LFCF 2OKQA 2DVIA 2AZ1A 2ZDPA 2XMJA 1X3NA 2B7BB 2C28A 1AYEA 1X0PA 3M2UB 3IRXA 2R2SA 1OO0B 1ESVA 2MY7A 1B7YB 2AGOA 2XULA 3FEZA 4M5GA 2P9EA 4JLHA 4U8VA 3O8WA 5DG7A 2MMYA 3QBWA 1FXDA 1WACA 3CCUS 3UN2A 3IR7B 1MMNA 2X6SA 5CHIA 4IG0A 1N34F 1U25A 2B8QA 4S0MA 3V4MA 5ADXH 1H6KX 1NBEB 1K6YA 4QIEA 4X64J 2VU5A 5D0HA 4CBXA 1H73A 1KD1O 3J80U 4URGA 2LVWA 4Q43A 3V1OA 5AR0A 2B51A 1SC6A 2KHDA 4DV7K 3OBWA 4J9QA 1HKGA 4CK1A 4BR7A 5B0BA 4DR5K 2CXEA 1JLAA 1HL6A 1RWNB 2CIMA 1P27B 3P8BB 2XYGB 4RW4B 2VOPA 1B64A 2OZSA 1CZAN 3SQ2A 4DV2J 4DG1B 2A0FB 1KKHA 2IIHA 3HHKA 3GJQB 4PG5A 4IOBA 5HMWA 1RT3B 3NH0A 3CW2C 1U1MA 4ZTFA 1NK4A 2E5HA 1RT5A 5IWAF 4Q44A 5EU7A 4E1NA 4RBUA 5F3ZA 5D3GA 2HMIA 4JKEA 2QSWA 2MZ1A 2E1ZA 2B9WA 2WK4A 2AGPA 3W8PA 1VBXA 1JLGA 3A5OC 4DR1F 2R4FA 4NLWA 5KG7A 1RAGB 2XC9A 4C11B 5DLFA 2NPFA 3EE9A 2RE1A 4HT7A 1ATSA 4B3OA 4OJ3A 4HEA9 2V8VA 1NJZA 1GK8A 1TKDA 1NDCA 3FBEA 2FXUA 3R97A 1XNQJ 2G4BA 3FBFA 2J0QD 2W2MP 4PKHA 1MSWD 2X1AA 4CZFA 1JK9B 3FFIA 4CK3A 1X3MA 3CMAN 2AZ3A 1NKEA 1F3FA 3HULA 7AT1B 1E6VB 1YHQN 1NCLA 3QIPA 4TNOA 1WAJA 1M5VC 4GNIA 4ECXA 5KFAA 4EZ6A 1YJ7A 1T94A 2CQ2A 3QLHA 3OFHA 3IBFB 2DK2A 1RWVB 3NNCA 2JC1A 4N5SA 3ILIA 4Y2CA 3BH6B 4ID8A 5H9EK 3H7HB 4BRDA 3PM9A 4CIGA 1LWCB 1RI7A 3KJFB 2JWLA 2ZFHA 2MQ8A 2IPOB 3CCRN 3M2RB 4G1QB 5L9NA 5A8RB 4RX6A 5D4LA 3JQMA 4X62F 3DNCA 3FK4A 2PMHA 2KT5A 3J80Y 1XR7A 4ED5A 3W62A 4IOAL 1BY9A 2ZZNA 2O5DA 4KRFA 1WNSA 4M3XA 5AQOA 3I9ZA 2HBYB 2NREA 4DV3F 1HBMA 5H1SV 2YPZA 5F8MA 1SAZA 1BQXA 2D3O1 4U6PA 2UV8A 3NCRA 3G6ES 4DU4A 1FVQA 5B0EA 3QWUA 4PAAA 4QIFA 3DOLB 3K5LA 3FC9A 1IG8A 3UE5A 4Q7AA 4H5VA 1YZ6A 2OMOA 1AFJA 4AFFA 1U2VB 4PKGA 3QWPA 4JK8A 3NGZA 1VJQA 4YY3K 1YJWN 1GH8A 4FOEA 5LMNF 4NA2A 3F9MA 1WC5A 4O44B 3SK3A 1Y9OA 3CTRA 5F3TA 1XHZA 4M5JA 2WVCA 4QIWD 3DLKA 4I4BA 3IGNA 2DISA 1OKJA 3I0RB 5DO2A 2RE2A 5H9EJ 4K43A 3CPWR 2Z1HA 3EICA 2AEFA 1WHVA 2VJVA 3WNHA 1ACMB 5HVHA 3GE1A 3MWBA 4NLPA 4UQTA 4RNHA 4GO7X 3EVWA 4F0HA 1RA7A 3R3TA 2FLLA 2D9OA 1D9FA 2E1RA 1NB7A 1BD6A 4CGGA 4FZVA 5IV3A 1GLAG 3ISND 1T02A 2FF3B 4LSNB 3KD5E 1PYOB 1FKPA 5K5MA 4E0DA 3VA3A