1RTJA

Mechanism of inhibition of hiv-1 reverse transcriptase by non-nucleoside inhibitors
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Mechanism of inhibition of HIV-1 reverse transcriptase by non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 133
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtjA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtjA05
3DOKA 2VWKA 2XHBA 3DRRA 1QAJA 2RDJA 4HVJA 3DI6B 3QEIA 4WE1B 2HMIB 1GOCA 4PUOA 4N76A 2B43A 1BQMB 1X9MA 4CEZA 2DFFA 4URSA 2HNZB 4M3TA 4FJJA 3MF5A 1RT3B 3TWHA 2IA6A 4ZTJA 4DTNA 1S6QA 3DRSB 5KFLA 3SCXA 4RW9A 3DLGB 2JC1A 1VSDA 2VG6B 4DL6A 4LSLA 3VQPA 3CDUA 5KFAA 4CF2A 4O3OA 4G3IA 3V6JA 1RTDB 4M41A 1U49A 5J2NB 3VQSA 3MR6A 1KFSA 4J9NA 5E41A 2PYLA 1QQCA 1RNHA 1YT3A 4NRTA 3WNHA 4CIGA 4F4XA 2J6SA 1I6JA 4GVMA 2IC3B 5KG3A 1X9WA 4CECA 1NK6A 4YNQA 1S1VA 1RT2A 1KTQA 4DSKA 3AVMA 3OYBA 2AGOA 3AVFA 3KK2A 4I2PA 1IKYB 1T03A 4B3OB 2RPIA 3OYJA 2KQ2A 4FK2A 3GV7B 3S3NA 3AA5X 1KHVA 4CJEA 3NH2A 4OKEA 4EP4A 1KHWA 5C25A 3KLFA 1HNIB 1S9EB 3G6VA 1N5YA 3IGVA 2GIRA 5JUMA 3VQ7A 3QINA 5K14A 2O4GA 3QYYA 3DLEB 4O3QA 4K4YA 1RT4A 4CEAA 1U04A 1DTTA 4O4GB 4Y1DA 2JC0A 4CGDA 4ED0A 1S0NA 3PO5A 3NAHA 2ZE2B 4DL7A 1WSIA 4Z4EA 1J5OB 3SNNA 1NHVA 4BACA 2DFHA 4FZYA 4RUCA 2I5JB 4HUFA 3ZSXA 3OYEA 4IRCA 4FLYA 2PY5A 3P83D 4TY8A 3EPIA 1D5AA 4CFAA 1Q9XA 3P1GA 1RBSA 4DSJA 2FJVA 4K4SA 4O3RA 2RF2B 1JLQA 4FJLA 1ZBFA 1DLOB 4ID5A 2YKMA 5KFDA 1D9FA 5KFCA 3OYIA 1WSEA 4TQSA 4RW6A 3C94A 1JLGA 4ED2A 4NLTA 1D8YA 3K2PA 4IDKB 3M9OB 2ILZA 4O0IA 3KJVB 3ALYA 3H5XA 3RR7A 4Q45A 4CHZA 2BRLA 4CHYA 4CFDA 4B8AB 4LH4A 1TKXB 2FBXA 5CYQB 1R0AB 3OHBA 3NMAA 3AO5A 4CF9A 1EP4A 4NLQA 3NE6A 1G15A 1HPZA 4EYHB 4CHNA 2OPPA 4FS1A 4BE1A 1WAJA 1S48A 3ULDA 3SUNA 1JLCA 2I1RA 4DF8A 1XWLA 3D0PA 4RUAA 3SQ0A 2G8HA 1RDAA 2A1RA 2PZSA 4TSXA 5T14A 3JSMA 3RBDA 3ZSVA 3SUQA 3HP6A 4NCBA 3QZ7A 3PW5A 5DG9A 1TK5A 4CGJA 1RT5B 3V81A 3HT3A 4B9SA 4Q8FA 4JV1A 4CHQA 2UVWA 3V1QA 3PO4A 5EWGA 1S1XA 4AHSA 1HQEA 4NLDA 4DF4A 3FFIA 3IAYA 3KHGA 2AJQA 2UUTA 3MECB 2XY8A 4DL3A 4DTMA 1EX4A 5J2PA 4RW4A 2V4RA 4CCHA 4K8ZA 2F96A 4E7LA 3DLRA 1A5XA 4K4VA 3BQ0A 4O0JA 1DTQA 3RRHA 5CZ1A 3KHHA 4XO0A 4TXSA 3DI6A 4URQU 4WE1A 3SQ1A 2HMIA 3H4BA 2GBZA 3RAQA 1BQMA 3SQ4A 3OHAA 5I3UB 1BIUA 4CHOA 3MXIA 1TL3B 2HNZA 4KREA 2KTQA 3OLBA 3HYFA 3ITHB 5KFRA 1RT3A 4FS2A 4LQ3A 3HP9A 4CJVA 5KT7A 4DLEA 4KBIA 3DRSA 3DLGA 2VG6A 3K5MA 2IAJB 2V9WA 1VSLA 1RTDA 3ZSQA 1EETB 5KFJA 2D41A 3ICLA 1BGXT 5J2NA 3OL9A 1F21A 3VA3A 2R8IA 4M3XA 4KHNA 3C6UB 3B6OA 4EBEA 2R8KA 4E3SA 4FZXC 1WAFA 3PY8A 4FJHA 3DRPB 2YNGB 4ECSA 4RG8A 2IC3A 4R0EA 3CG7A 2OPRB 4AHCA 3CM6A 3HJFA 4KHWA 2Z1GA 4TYBA 3I8DA 2DPJA 1IKYA 4B3OA 3MTKA 1I39A 1QTMA 4KAIA 2OH2A 4R8UB 4QCLA 4MK8A 1LWCB 3SV3A 3TR8A 4IOBA 1SL1A 3OVNA 3S3MA 3IN5A 4M45A 1HNIA 1S9EA 4FJKA 4O3NA 1C0MA 2HNYB 3V1OA 4EBDA 4F4WA 2W9AA 3DLEA 2E9ZA 4MKBA 4KFBB 3NAEA 4WFXA 4ZVEA 3BGRB 3MAQA 2CKWA 4OJRA 5KG2A 4C8LA 4B08A 2QKBA 4FK0A 3MR3A 2ZE2A 3QETA 2AQ4A 5KGXA 3HSTB 2DTUA 2VWJA 1J5OA 1RBVA 4PY5A 3H5SA 2IBKA 4WXOA 1WNSA 2IGIA 2HHUA 3KLVA 4DTPA 5KFQA 3UQSA 2I5JA 3N6MA 4IH6A 1JKHB 1RBUA 4RNFA 1T8EA 4ZPBA 3K58A 3FQLA 4KV8B 4DS4A 2KW4A 4ZHRB 2KFZA 2RF2A 1DLOA 5HRNA 2HHSA 2DFEA 4X2BA 1U47A 4FBUA 4Z4HA 3OYFA 2GUIA 4GMJB 3BSOA 4HTUA 5KFGA 1EXQA 5DQHA 1BHLA 3OL8A 1VSIA 5EUHA 4J9KA 4M42A 2O5DA 3OYMA 3ZT4A 4M3RA 2X6SA 3N6LA 4IR1A 4IDKA 3RBEA 3QEXA 3I5BA 3Q8QB 3KJVA 3CJ5A 1KFDA 3CYMA 2R8JA 4JUZA 1NNDA 3KLHB 2G8VA 3NKYA 3SV4A 4KO0B 4NLOA 5CYQA 1R0AA 4ZMMA 4N41A 1JLAB 3EY1A 3ISND 4FLZA 1VRUB 3G10A 4ZVHA 4IR9A 4C8OA 4DSLA 5I42B 4CEBA 1QSLA 2R2RA 2UUWA 4RNMA 2IMWP 4CJKA 1JXLA 2B4JA 3DLKB 1U09A 1S1TB 4U7CA 5KFSA 4ED8A 4ED3A 4BDZA 1UA1A 2FVQA 3DMJB 5KFMA 4IFYB 3K5NA 4FLTA 1WSFA 1C2PA 4DMNA 2YNIB 2W42A 3F73A 2ZKUA 3JYTB 4B9TA 2RDIA 3T19A 3TI0A 4NLGA 1RT5A 3HO1A 4ECXA 3CFRA 2BQ3A 3AA4A 3ZT1A 3E01B 5KFVA 4KI4A 3MECA 1TQLA 3V4IB 3LWLA 3TAMB 3L8BA 3V6HA 3BSNA 1CXUA 5HLFB 2XI3A 3L2WA 2R2TA 1T3NA 4BE2A 3CJ2A 4URGA 1GOAA 4FJ9A 4MK7A 3M8QB 4M3WA 4CJFA 3CIZA 3ZT3A 4F4ZA 4YP3A 3HVRA 2IM1A 4DQPA 4JS4A 4FJ8A 3HL8A 3I0SB 1S1UB 4AILC 2GIQA 4QWAA 5I3UA 1Z25A 1U45A 3QNOA 4KHYA 4E7KA 4TY9A 1TL3A 4MK9A 3QO9B 2HWHA 3ITHA 2R2UA 3NBPB 4FJ7A 1W9HA 4ECUA 1YTUA 4IH7A 4KE5A 4NLPA 2E9TA 4LH5A 3N6NA 4E7JA 2AU0A 2IAJA 4B8CA 2XY6A 1XHZA 1WSHA 1VK0A 1HYZA 3KIOA 1EETA 4OL8A 3UPFA 4KHSA 1NJXA 3OY9A 3C6UA 5HROB 5DQIA 3VN5A 4KPYA 3DRPA 4DTJA 3S3OA 2YNGA 2OPRA 1S6PB 1WNEA 1IG9A 4CGHA 3HPOA 4CJRA 2Z1IA 3OYAA 3MXMA 4B9MA 5HBMB 2XY7A 2XGQA 4O5BA 1GX6A 1UAXA 4R8UA 1LWCA 2E4LA 4ED7A 4MH8A 2XCPA 3H2LA 3AVLA 2HNYA 3TVKA 4B9UA 3UDLA 3OS0A 1HYSB 2V0NA 4NLYA 4J9QA 4KFBA 3PJWA 4ECYA 4CF0A 3HK2A 4DS5A 3BGRA 4J2AA 5F8GA 2YKNB 5F8HA 3I5CA 3H59A 4K4ZA 3LP0B 1BCOA 1LWEB 4Y2CA 3KKRA 3DLHA 4AH9A 4ELTA 1FXXA 1Y97A 4KHQA 3CVKA 4E0DA 1JKHA 3AVGA 4F3TA 2QKKA 3TAEA 2E6MA 4KV8A 2XRIA 3PW4A 1YTAA 3QEPA 2FVRA 1NHUA 4ZHRA 5KTQA 3QGGA 3NL0A 4K4UA 4NCGB 4FM1A 1LAVA 2D0BA 4ELVA 3KKSA 1T7PA 4CJWA 3KLIB 3G86A 3SQ2A 4CK2A 3H98A 1KLMB 4CEDA 1Q8IA 1TAUA 2ILYA 3QESA 2P5GA 1BCMA 5KFPA 3KLHA 3C6TB 2WTFA 1C1AA 2BANB 4ZP9A 4CJ3A 4DEZA 4KO0A 1IH7A 5JS2A 1KRPA 1QSYA 3KTQA 1JLAA 2BQUA 1CLQA 1VRUA 2UVVA 4CHPA 5I42A 4CK3A 2DY4A 2C22A 4PQUB 3KLGB 2C2EA 3DLKA 1S1TA 4CEQA 1SV5B 2F8TA 1QAIA 2OA8A 3PZPA 3DMJA 4JRPA 4IFYA 2BR0A 3O4NA 4HUEA 4ED1A 2XWYA 2YNIA 1N4LA 2ATQA 4M3YA 4J9MA 4CIEA 1ITGA 1TK8A 3JYTA 2CJQA 3IRXB 3GIKA 4K4XA 4DFJA 2WRMA 1NK4A 5KT5A 3IG1B 2X74A 4FXDA 2VA2A 1RAJA 3E01A 4OLAA 3PHEA 2KZZA 3MXJA 1L5UA 3RAXA 1ZETA 1S97A 3O3FA 5J1EB 1WSGA 2YHBA 1KVBA 3V4IA 3KD5E 4HHTA 1RTHB 3TAMA 4Z4IA 4IKAA 4RNNA 5HLFA 4ZP7A 1C0UB 1RT7B 1RYRA 3M8QA 3QIOA 3DOLB 2HW3A 1TK0A 2WONB 1RBRA 3I0SA 1S1UA 1HRHA 2YNHB 4HCCA 5KG5A 3NGZA 4J9PA 4O55A 3ZSZA 3QO9A 2VG5B 4YR2A 3WNFA 3NBPA 4K4TA 3VQ9A 2C2DA 1XI1A 3H08A 4TYAA 2XY5A 3HVWA 3AVNA 1HMVB 4OKJA 2FLPA 3SJJA 4FW2A 3B6PA 4MQ3A 4E1MA 5KT3A 3OYKA 5DGAA 1RA6A 4FJ5A 1RYSA 5HROA 3V9XA 2EHGA 1VSHA 4NLVA 2D3UA 4CE9A 1YVFA 2HHWA 5HP1B 1S6PA 4Q5VA 4NYNA 4FLUA 2W7OA 4W5TA 5F8JA 4FM2A 2Y1JA 4CJLA 5HBMA 4ZPAA 2W9BB 3G0ZA 3OYLA 4OKKA 5C5JA 5C24B 5L9XA 3PX4A 3V6DB 3ZCMA 1W25A 3DM2B 4IG0B 1JXBA 2V4QA 3F9KA 1IO2A 1L3TA 3VQ5A 1S0MA 4DQIA 4O4RA 5FDLB 3Q8PB 2IDOA 4FLWA 4KSEB 1HYSA 1HNVB 2BE2B 2HHTA 3I5AA 1D0EA 2FLLA 4BWMA 3BREA 4EEYA 2ZD1B 1NJWA 2YKNA 1S4FA 2C2RA 3T1AA 5F8IA 3LP0A 2W8KA 1ZTTA 4J2DA 4KI6A 1LWEA 2UVUA 4DL5A 1HJRA 4IRDA 4CJUA 3VQBA 2OZMA 5F8LA 1JLEB 3PR4A 3ZT2A 4DU4A 1SKSA 2HB5A 3NFAA 3OS1A 3MEGB 3K5LA 4FLXA 4J2BA 3QERA 5CZ2A 3V9ZA 4E89A 5KRSA 4NCGA 3M8RA 2HNDB 3NHGA 1VSEA 1CSJA 4JV2A 3TAGA 2AGPA 3VQ6A 1Z26A 2OZSA 5KFHA 3KLIA 3OYGA 3MFIA 4MFBB 3NF9A 4DQQA 1KLMA 3QIPB 4I2QB 5DK5A 4N56A 3C6TA 4WFYA 1C0TB 2BANA 5CY4A 4FLVA 1JLFB 4CEEA 1ZTWA 4ICLB 1LW2B 4CGGA 3GQCA 4CGIA 1TP7A 1RCHA 3HHKA 5KG7A 2EX3A 4PQUA 2D0CA 3KLGA 2YNFB 2ATLA 2BQRA 2XI2A 3U6FA 4NLUA 1SV5A 3U3GA 5F8MA 4QPXA 2GV9A 4WXWA 3NF7A 4NLWA 4JV0A 1SL0A 4O4GA 4E7HA 1L3UA 1NK9A 5D3GB 3IRXA 4PA1A 3IGNA 3T5KA 4N5SA 1VSJA 4DTOA 2OPSB 5KFXA 1J54A 3HPHA 3AA3A 4JRQA 3D5MA 1TGOA 4Z0UA 5KG1A 2FBVA 3IG1A 2J6TA 1S9GB 1K1QA 3CDWA 4WFZA 4WZQA 4B9LA 1ZYQA 5J1EA 1JL2A 2GC8A 1RTHA 5FRMA 3VQDA 4KHUA 5EWEA 2FVPA 1GOBA 4ZPDA 2DPIA 3TAQA 1C0UA 1RT7A 3FQKA 3DOLA 3HXMA 2R8GA 2HVHA 3S9HA 1B92A 2WONA 2JEJA 2F8EX 4EYIB 1TKDA 4B9NA 2YNHA 1SH2A 4R5PB 3QZ8A 4EO6A 4KB1A 4DTXA 5JXSA 4C8MA 4CEFA 3BSCA 3NH0A 1XR6A 2HHVA 4H8KA 2VG5A 2EC0A 3HKWA 4TN2A 4EO8A 4RNOA 3SFGA 3BR9A 3DYAB 1WSJA 3PX6A 1TKXA 1FKOB 3OYCA 4FJNA 4HKQA 1S10A 4BDYA 1HMVA 4WYWA 3H5YA 3AVBA 4O44B 3CFOA 4JLHA 1NK7A 2G8KA 4DG1B 1JL1A 3O4QA 3Q8RB 4ZP6A 3RMBA 3SPYA 3OJSA 3GIJA 1LAWA 3SUPA 1CZBA 4KHMA 2XCAA 3CDEA 1RT1B 3RMCA 4FZZA 1LWFB 5HP1A 4E19A 1RDDA 1FK9B 3ISNC 3FRZA 2X6NA 3LPTA 3KHRA 5DQGA 4CJSA 5T7BA 4QWDA 3H5UA 2W9BA 5HRPA 3BDPA 5C24A 1JLBB 3V6DA 2G8UA 2JEGA 4FM0A 4L8RB 2QXFA 3DM2A 4IG0A 4XIUA 1IKWB 3OS2A 4KHRA 1WLJA 3T5HA 2Z1JA 2AWZA 1MMLA 5FDLA 4NLRA 3T5LA 4Q43A 1KCFA 5KG6A 3BJYA 1HNVA 2BE2A 2C28A 3VA0A 4FJGA 5KFKA 1IKXB 2RKIB 4CEOA 1SUQB 2ZD1A 1NOYA 2R7YA 4RW8B 1C1BB 4OPJA 4QAGA 4KAZA 4FJXA 2FBYA 1RT6B 4XPCA 5L1KA 1K6YA 3NGIA 2QK9A 2FJWA 4FW1A 2QV6A 1JLEA 4W5RA 3NGYA 3RTVA 3MEGA 2UVRA 4GC6A 4C8KA 1KVCA 2BDPA 2HNDA 1UWBB 3SZ2A 3VQQA 4QW8A 3AO4A 3ASMA 1S0OA 3QGHA 1T05B 3V9SA 4ELUA 4MFBA 4KTQA 1VSKA 2AX1A 1NJYA 3QIPA 3PX0A 4I2QA 3PJXA 3GV5B 4F3OA 3G6YA 3GILA 1C0TA 1FKPB 4MIBA 5DLFA 5KG4A 5HRRA 1JLFA 3PUFA 4DSFA 3LAMA 1ZBIA 4CJPA 4ECWA 4ICLA 4NCAA 4KB0A 1LW2A 1BISA 4M3UA 2HVIA 3FDSA 4N47A 4YR0A 5KT2A 2B5JB 4AHUA 4EZ9A 2YNFA 1S5JA 1LW0B 3V1RA 3RMDA 4DU3A 3NCIA 4G1QB 4IG3B 3LP2B 2P5OA 4F2RA 4IFVB 3ZT0A 4CJ4A 5D3GA 4IRKA 2VA3A 4RW7B 2JEIA 5J2QB 4CFBA 4CF8A 4H54A 2G8FA 2OPSA 3LZJA 4NYFA 3LDSA 3WNEA 1VSFA 5KFBA 4YMEA 1S9GA 4KB7A 2JLEA 3KHLA 1CXQA 2YHAA 4IKFA 5F9LA 4LD0A 1S9FA 4Y1CA 5KFZA 4MKAA 4J9LA 2VG7B 1UA0A 4DTSA 4FVMA 1BI4B 2Z1HA 2IM0A 4EBCA 1I3AA 1ZBUA 1NKBA 4AHTA 4OGEA 1BL3A 5L1JA 3LP1B 3DDKA 3M8PB 4CIFA 4OGCA 1NK5A 3UIQA 4ECTA 4R5PA 4QWEA 1RDBA 4ZVGA 3PV8A 1MU2B 2D3ZA 3P5JA 4KTWA 3DYAA 3MEDB 4JS5A 1FKOA 1TKZB 4H4MB 4J2EA 3SUOA 3QEVA 3GIMA 4O44A 2FBTA 3KNAA 5KFFA 4DFPA 2HHQA 5KGWA 1HARA 5KFYA 4KTZA 5KI6A 4Q0BB 4CF1A 4DG1A 3KK3B 2WK4A 4DSIA 3AVKA 4I9LA 3LAKA 1VSMA 1D9DA 3HVAA 2OYQA 3DLBA 3AVIA 2E6LA 2A1SA 3L3VA 4W5QA 3L2QA 2Q3SA 1RT1A 5KFNA 1LWFA 2IJNA 3KK1B 4K50A 4LSNB 1SKRA 1QHTA 1FK9A 3OYHA 3MR5A 1JXEA 3O3HA 2QE5A 2W9CB 1U4BA 5C42B 1JLBA 3A2FA 4ZPCA 4LQ9A 4Q44A 3OJUA 3QNNA 2ASDA 1IKWA 4LY7A 2F8SA 2NUBA 3ZSRA 2E9RX 3VQEA 2ASJA 4ID1A 4CERA 3L3UA 4DTRA 2FVSA 5KFOA 2KZMA 4CK1A 4M95A 4K8XA 1SH0A 1QS4A 4ECZA 1IKXA 2RKIA 1SUQA 3C95A 4RW8A 1C1BA 4Q8EA 1N6QB 3BSAA 3MEEB 3QEWA 3CJ3A 3U3YA 3VQAA 4DQSA 1NOZA 1RT6A 4ECVA 2PYJA 5JS1A 1XC9A 3K59A 3AO1A 4J9SA 4KKOB 1SH3A 1ZBLA 3TABA 1VRTB 2IM3A 5F8NA 2XO7A 4H4OB 3I0RB 4EP5A 2R2SA 2BRKA 1X9SA 1UWBA 3E51A 2W7PA 3L2VA 4DSEA 4U6PA 3TAFA 2Y1IA 1T05A 4CESA 2IS3A 1C1CB 1S1WB 1NK0A 1XR7A 3KMSA 4FYDA 2ITGA 1REVB 1ASWA 1S49A 2WOMB 1FKPA 2P1JA 1UOCA 4FBTA 3SI6A 3QLHB 3LP3A 4UQGA 4DWIA 5CYMB 4F8RA 3OL6A 4HCBA 2B5JA 5KT6A 4IQXA 2WB4A 4AHRA 2YV0X 5L1LA 3RB6A 1LW0A 3QGIA 3T5JA 3ZSOA 3KD1E 2XGPA 4G1QA 4IG3A 3LP2A 4F2SA 3KLEB 4IFVA 1QE1B 4GW6A 3LWMA 2ETJA 3PVXA 4DFMA 3OL7A 2OPQB 1LV5A 3RWUA 1YVUA 4RW7A 5J2QA 3OSNA 3RR8A 1GX5A 3AVHA 3RB4A 4Z4GA 4GC7A 2HAIA 4YQWA 3D45A 3THVA 5KFTA 2ZQBA 4AHVA 4OPKA 2FVCA 4PWDB 4OVLA 5DMRA 2VG7A 3SI8A 1RTIB 3HVTB 3TANA 1BI4A 1HQUB 4YFUA 1TV6B 3K5OA 3Q8SB 4NLXA 3OLAA 4E1NA 3IS9B 3RB0A 3TQ1A 4DL2A 1RA7A 3LP1A 4CJTA 3M8PA 4CFCA 2B6AB 3PW2A 2G8WA 1WN7A 3T3FA 4W5NA 3NAIA 3AO2A 3AO3A 4K4WA 4ZP8A 1NKCA 2D7SA 3OYNA 1MU2A 4KRFA 1TKTB 3AVAA 3OSPA 3MEDA 1IKVB 5FROA 4NLSA 1TKZA 4H4MA 1TVRB 2FC0A 1BIZA 3CFPA 1Q9YA 1X1PA 3MR2A 5FRNA 1TL1B 3EZUA 2KFNA 3UR0A 1RTJB 5J2MB 4Q0BA 3KK3A 2BGGA 1Z4UA 3PW0A 3NF8A 4YR3A 4I7FB 1BQNB 3SFUA 4IH5A 4F4KA 4DTUA 4Y2AA 3GIIA 3KK1A 4QW9A 1J9AA 4MIAA 4LSNA 4FCYA 4ECQA 2X78A 5DGBA 2W9CA 1CZ9A 3DOKB 4CGFA 3DRRB 3LANA 5C42A 4Y3CA 4C8NA 4OLBA 1HYVA 2FJXA 4PUOB 2D5RA 3GYNA 4O3SA 1XR5A 4ZVFA 5EWFA 4NRUA 4O3PA 4QWBA 4FK4A 2J6UA 1O1WA 3M8SA 3M9NB 2W8LA 3AV9A 1S6QB 1RBTA 4NYZA 1NJZA 4RZRA 4RW9B 1K1SA 3D28A 4LSLB 1RDCA 2FLNA 3AVJA 1ZBHA 1TAQA 3O3GA 1N6QA 3MEEA 1NKEA 3V6KA 4ECRA 3CQ8A 5SWMA 3L2RA 3WNGA 4M94A 3CO9A 4FJIA 5KFEA 3FSIA 4KKOA 2HHXA 4CJQA 3LALA 1B9DA 1S1VB 1RT2B 1VRTA 4Z4CA 3LZIA 4H4OA 3NDKA 3I0RA 3KK2B 4I2PB 1T03B 3RRGA 2RN2A 3BQ2A 2AGQA 5KFUA 3TARA 1C1CA 5DLGA 1S1WA 4FJMA 5C25B 3KLFB 4EZ6A 1W0HA 1IM4A 1KSPA 4WYLA 1N5YB 1N48A 1EKEA 3VQ8A 1OS5A 5EU7A 4DQRA 1REVA 5K14B 2WOMA 4I9QA 2G8IA 4BE0A 1KVAA 5KFWA 1L3SA 5HRSA 1RT4B 1A5WA 1DTTB 2JEFA 3LPUA 3SYZA 3QLHA 5CYMA 2HWIA 3VQ4A 1XHXA 4TLRA 2ASLA 2JGUA 5SZTA 3K57A 3KOAA 1D1UA 4DLGA 1U48A 4TY8B 3KLEA 1QE1A 3V9UA 2IM2A 2OPQA 3EZ5A 1A5VA 1JLQB 1JX4A 3NH1A 4ID5B 2YKMB 1KLNA 2XC9A 3H4DA 4ED6A 4RNHA 4J9OA 1L3VA 4QOZB 1SKWA 2O4IA 5F9NA 4Z4FA 4RW6B 5KG0A 2R8HA 1J53A 1N56A 1JLGB 3NF6A 3H40A 3AVCA 3ZSYA 4PWDA 3RB3A 4WZMA 3HM9A 1RTIA 3HVTA 2ALZA 3CJ0A 1HQUA 1TV6A 4RU9A 1B9FA 5L1IA 3IS9A 4DL4A 4HUGA 2LSNA 1JIHA 3NGDA 1ASUA 4DU1A 3BQ1A 2B6AA 1NK8A 3QIDA 5DG8A 4M3ZA 3SPZA 1SL2A 1EP4B 1RDRA 1HPZB 3CM5A 3KMQA 4ZTFA 4F50A 2OPPB 1QUVA 4F4YA 3ZSWA 3TAPA 5EDWA 5KT4A 1JLCB 1TKTA 4BDPA 4TQRA 3GV8B 1IKVA 4Y34A 1TVRA 2WCXA 3PR5B 3G6XA 3V9WA 3JSMB 2IOCA 4QWCA 3EPGA 3CJ4A 3PW7A 1RILA 1TL1A 4DFKA 1C6VA 3V81B 1RTJA 5J2MA 5KFIA 3RMAA 3MFHA 2AX0A 5KRTA 5DG7A 2D0AA 3OYDA 1S1XB 4I7FA 4BWJA 4CJ5A 1BQNA 1HQEB 2IJFA 3EYZA 4NZ0A 4XPEA 1T94A 3FFIB 2WHOA 3M9MB 3L2UA 3AA2A 3VQCA 4J9RA 2P51A 1QSSA 3HPGA 1ASVA 4B9VA 4E7IA 5J2PB 4RW4B 4HYKA 4W5OA 3CWJA 4IBNA 1DTQB
chains in the Genus database with same CATH superfamily
1GAOA 2WSCC 3W9HA 4B02A 3SMPA 2XHBA 3DRRA 2Q97A 1SXLA 4WE1B 2HMIB 4PPZA 4HDHA 1X9MA 4JI5J 1VQMN 2FUG9 3WX4A 5ETNA 2DFFA 1S99A 3CCVN 1ZM2A 2HNZB 2E5GA 4FJJA 1P1LA 4X4SA 1N33K 3DRSB 2ZNYA 5HL7Q 3OR1B 2Q3PA 4Y0WA 3VQTA 3DLGB 4DL6A 5LL6d 2R7UA 1K0VA 1HIYA 3CDUA 4NWBA 3KG0A 3I55S 3BZKA 1U49A 4Z7YA 1KFSA 2PYLA 1QQCA 3IBWA 2N3LA 3OUYA 4HH0A 3L7OA 4F4XA 2J6SA 1I6JA 5KG3A 4CECA 2XS5A 4F67A 4ZKAA 4DSKA 2YWWA 3O3LA 3O4WA 4WFNL 1G7CB 1T03A 1DQ8A 1KHVA 1BY9A 4OKEA 3TO8A 1FKAF 4EP4A 5EN1A 3CMAS 4BR0A 2B51A 3IGVA 4LRBA 3VF0B 4F0KA 1B7FA 2O4GA 4DR6K 4Q2LA 4O3QA 3FZBA 4WF9Q 4O4GB 2JC0A 4WQ5C 3CJ9A 1RADB 5A0YA 1VC5A 4L74A 4Z4EA 4N8OA 1SCJB 1IBLK 3SNNA 1NHVA 4U8VA 2DFHA 2XULA 3DOMB 4FZYA 1EZZB 1BUXA 4RUCA 4HUFA 2LU1A 3ZSXA 1HA1A 3OYEA 1WACA 4IRCA 1RWWB 4BR4A 4FLYA 1Q9XA 4L3QA 3P1GA 4DV4J 4PEOA 4DSJA 4O3RA 1S76D 2YHYA 1ZBFA 2PA3A 2J0QD 3CIMA 4Y00A 1MROA 4WCEL 1K47A 4OJ1A 5KFCA 1P1TA 4ALZA 5LMUF 3C94A 1ATRA 5GAGU 4ED2A 1WBBA 1W7WA 3SDEA 4JYAK 3ZZ0A 5F1XA 4IOCL 4DV7K 3EICA 3KJVB 3EGWB 1KXPA 1K9MT 3T9NA 4CHZA 1WF0A 1TKXB 5CYQB 3BGLA 1BLUA 4KC5A 3AO5A 4F9OA 3B8HA 4I69A 3H1VX 2UUBJ 3QATA 3CSKA 2ZBIA 1U1QA 3QICA 2HBZB 3GMGA 3AAPA 5SUHA 4XH1A 1JLCA 2I1RA 4I6AA 4TKTA 3JB9k 5FLXO 4YOUA 1XWLA 1QZ5A 2K3IA 4AD6A 3HI9A 1K8KB 4JI2J 4LF8J 1NGBA 1IM6A 1UVLA 5T14A 3JSMA 3ZSVA 4Y65A 3PW5A 5DG9A 1VBXA 4CBUA 3HT3A 4HL9A 2APOA 4JV1A 4PXEA 4JHDA 4UOHA 4OPAA 3BBCA 1HQEA 1AXQA 4NLDA 3FFIA 3MPDA 1RAAB 3MECB 5BYRA 7AT1B 5D0HA 4DTMA 1CVJA 4RW4A 3AHPA 2V4RA 2FSKA 4GV3A 1VAZA 1X0FA 3W63A 1XMQJ 3RRHA 4OZ0A 3KHHA 1LXJA 4XO0A 2QFJA 3QPIA 4TXSA 4DMZA 4FWNA 2WSEC 4URQU 3H4BA 3ZTPA 3I31A 1BQMA 1Q0NA 2A3JA 3OHAA 2FF3B 1WELA 2QMXA 4J91A 4DPWA 2PA8D 4FO0A 1N0VC 1TU0B 1HI8A 1P6TA 4FF4A 1RT3A 2QO3A 4LQ3A 3HP9A 5GMDA 3HBTA 4KBIA 1EX8A 1U2VA 4DHYA 3HTVA 2VG6A 4J5OA 3VENA 1TL7B 4BRLA 5BPMA 2MSTA 3BZQA 2BJ7A 4USMA 3VALA 4QYZK 1BGXT 1PBUA 5KFJA 1NUEA 2CWXA 3VA3A 2QWOA 4HHHA 4P10A 4KHNA 4KR0B 3C6UB 4JK7A 4USHA 5IFMA 4E3SA 4FJHA 3DRPB 4ECSA 4RG8A 4I6WA 2QYGA 4AHCA 1U0HA 4LRDA 3TP2A 4WIQA 1SI9A 2Z1GA 4NYOA 2ATCB 1IKYA 4YDUA 4B3OA 1V5IB 2MSSA 3R1LA 4R8UB 3BKTA 4MK8A 3MEKA 3TR8A 3OVNA 1PYOB 3JSBA 3IN5A 1S9EA 1VQYA 1SZ2A 1C0MA 2HNYB 1ROFA 4CH0S 3V1OA 2IHR1 3IWXA 4NMLA 3VTHA 4HHJA 2H5JB 2Z56B 2O8EA 4HWIA 3G87A 2J0SD 3BGRB 1Q86T 4LF7F 3WEEA 1VQ9N 2FHJD 1OH8A 5KGXA 1KS2A 3LOUA 5GAHI 4PY5A 1X31C 2OTLN 2IBKA 1NSKL 5FLXU 2GO9A 4CD1A 3AQPA 1FDBA 3M30B 4LVNP 4IH6A 2R3VA 1JKHB 1RBUA 1T8EA 1C0GA 1ZXOA 1T0TV 2RHQB 3FQLA 4H5RA 3J7YI 3OW2M 4DS4A 3AY0A 2RF2A 5HRNA 2HHSA 4PCQA 2YI1A 5AQIA 1ZA1B 5HI7A 2YY3A 4DV2K 1DRZA 1CEZA 1WORA 1EXQA 1XMOJ 3PJ9A 1BHLA 3OL8A 5EUHA 2O5DA 1ULRA 4JV5J 3N6LA 1ZH5A 2RMLA 3I5BA 1D4XA 3CYMA 4JUZA 3KLHB 2A6MA 2G8VA 2CVEA 1R59O 1UVIA 1R0AA 4ZMMA 2AJ1A 2AV5A 3MWTA 4DR4K 4LMZA 1VRUB 5DJBA 3G6EN 3H20A 1H73A 4DSLA 1N8RO 2QA1A 4QIGA 1QSLA 4PABA 4RNMA 1ILYA 2CWKA 4DXLA 5LMNK 4O23A 4NE9C 2H3GX 3A8JA 4U7CA 2ZM6J 4BDZA 3KK7A 1YKWA 2FHMA 1LK5A 2OELA 3BO3A 4DMNA 2W42A 2RDIA 1SJQA 4DN9A 3T19A 3HO1A 2CPEA 2XZTB 1HNWF 3CFRA 2DY1A 3W8GA 3GONA 3ZT1A 2NSBA 1HKGA 5KFVA 4HEA9 4DR2J 1RP5A 3V4IB 3BSNA 2MPUA 3FZHA 1B0VA 2R2TA 2BXJA 1T3NA 1GOAA 2KL8A 3FEZA 2A41A 5LJVA 1YBAA 2WSFC 3UE5A 3HVRA 3U27A 3US5A 5ETTA 3CCES 3HL8A 3I0SB 4E2FB 4AILC 2GIQA 1TTHB 1GLDG 5I3UA 2EI5A 4KH5A 4FWMA 4KHYA 3CMEN 4TY9A 4OX9K 2UXBF 3QO9B 3FSXA 2R2UA 2L9NA 3NBPB 1H2VZ 4ECUA 1YTUA 2EG1A 3T1HJ 3GFHA 4B8CA 1FA0A 3CJ7A 2G1DA 1T44A 2AZ3A 1XHZA 3DGVA 1VK0A 3Q8VA 1XIQA 3T41A 3HJVA 1NJXA 4LFCJ 4CLUA 4DPOA 2OPRA 3SBTA 2FHOB 1IG9A 3HPOA 4CJRA 1WKJA 3TTDA 3OYAA 2HSTA 2RE2A 4B9MA 5HBMB 2XY7A 5C2DA 2XGQA 2Z2ZA 2RQMA 1LWCA 5D0EA 1MWYA 2XCPA 4QR1A 3MTJA 2MYFA 1MMDA 2OFGX 3TVKA 2GCFA 1DQAA 3ZC4A 3CCQS 4KFBA 4DS5A 2VUGA 1RAIB 4YN3B 1F60B 2YKNB 1AB8A 2RU9A 3CF5L 2CDQA 3QGPA 1CG2A 2ZZTA 1G4CA 3ZZOA 5T7LA 4AE5A 3MURP 3RU0A 2AYEA 5LL6Z 4BG8A 3A8KA 1VQ7N 4KHQA 4LF4K 2EFNA 4YY3K 3NMUA 1S12A 3PG9A 2E6MA 4LF9F 3QT5A 2XRIA 2N4CA 1NHUA 5EOYA 3PEJA 1GLAG 2RUGA 4A46A 4DX8H 4ELVA 4BR7A 4L75A 4LRFA 2GIFA 2CGJA 3O9RA 3C19A 2ILYA 2P5GA 1BCMA 4WFAQ 5B0EA 2CJKA 2BANB 2J9DE 4CJ3A 4DEZA 1U0SA 1SC3B 3B4MA 3TZWA 1I94K 3P4UB 1M1KO 3POTB 2ZHOA 5U47A 5M2UA 2C2EA 3HRGA 3DLKA 1S1TA 2CG4A 1SV5B 5CD4H 2F8TA 1QAIA 2BJ3A 4AT1B 3T7ZA 4IFYA 1PIEA 2MXYA 2XWYA 4FPIA 1OVYA 1DHMA 2ATQA 1SJ1A 4DR5F 4M3YA 5A8WA 4CIEA 1ITGA 2CJQA 1DGKN 1YJWS 3BF3A 2ZJQQ 4KHPF 1F5CA 3PIOL 3A8EA 2WRMA 1HPMA 1NK4A 3P45B 1IVZA 1GLCG 2R7OA 3WBZA 1N32F 4M5KA 5C2GA 1L5UA 3RAXA 3UKUB 2DH9A 4K43A 3ZX2A 1N88A 4ANEA 4LT6A 2VQFK 4IKAA 4F0MA 2W2PP 2IIRA 3C3LA 5HLFA 4ZP7A 1MDUB 1RYRA 3JS6A 2PBDA 5AT1B 2WONB 3HI0A 4GO5X 1GLBG 4ES3A 1S1UA 4CT9A 1HRHA 1VQLN 2BABA 2IDLA 2WBNA 3NGZA 1NGGA 2NQPA 3VAHA 4OX7A 1S3XA 3I9V9 3ZSZA 1SJ4P 2HURA 2PSZA 5LSLA 5ETSA 5AQLA 3VQ9A 1X5PA 4ZCIA 4TYAA 3FZLA 5B0DA 1JNRB 1M5KC 2XY5A 2VKZG 3R9LA 2AEMA 3SJJA 2DGXA 2Q2RA 4FPAA 3X3UA 1V3ZA 4NB4A 4E1MA 4DBQA 1Q81O 1T9TA 1RU2A 4CO0A 5DGAA 1DFDA 1Y3KA 2CFXA 3MM9B 1RA6A 4M5NA 5EXWA 5GAGP 5HROA 3GIRA 4CE9A 1ZM9A 1Y4ZB 1RWXB 5D6GA 3MN9A 5HP1B 1S6PA 4Q5VA 1I5OB 1YJUA 3IFRA 5L8RC 3SQOP 2LECA 3DGPA 3JQKA 1S5ZA 2YKPA 3MOZA 2BE9B 2V34A 1HW9A 3ET6B 1HNZF 3OYLA 5C5JA 5L9XA 3JAMU 5J1PA 1J27A 2JFDA 3RZAA 3DM2B 1JXBA 3PRVA 4CNZA 1HBNA 1V4TA 1SJ3P 4YOTA 2A6AA 3D6HB 1UVNA 3TRGA 2ASYA 2DKOB 3U1MA 5D8HB 3OFGA 1EIYB 4O4RA 3EJMA 2EFGA 2IDOA 2YJEA 4KSEB 1HYSA 2BE2B 4UZCA 1B0TA 2NUHA 1HWUA 4EEYA 5F0WA 4NYPA 1NJWA 1S4FA 2V69A 4I1TA 3N4QA 3T1AA 2AIRB 2DGTA 2UVUA 3IRWP 3A3PB 4IRDA 4CJUA 5CA5A 1FXRA 4BRDA 3W1YC 2KVQE 4DU4A 1SKSA 3NFAA 2I7NA 3MEGB 3BBFA 4FLXA 5DZ7A 3QERA 2YX7A 5CZ2A 4NCGA 3OD2A 3NHGA 3MCSA 4QS8A 3KVGA 1CSJA 2QLXA 2P9NB 2L3MA 3MN6A 3FEYB 2HS4A 2AGPA 3VQ6A 3OYGA 3MFIA 2ZBPA 2ZWOA 3C14A 2HYIB 2DTJA 2M4MA 5LJ5Y 4N56A 1AFIA 1C0TB 4FLVA 2G2YA 1NRKA 2FZCB 3GQCA 6AT1B 2OKQA 5KG7A 1VQKS 1O6XA 2W24A 4EFAC 2X3GA 4QPXA 4WXWA 4WQ4C 1H98A 2H5EA 4G65A 3RGIA 2CQCA 3QMLA 4A8WA 1NDPA 1SL0A 4O4GA 1YG0A 1YJ9S 1VQ6S 3CHWA 3IRXA 2FD2A 2EFPA 4LF7J 5KFXA 1IBKF 3WXJA 3D5MA 2X7IA 2FBVA 2JZ5A 2MQQA 4UY8T 1S9GB 4IOAL 3CDWA 2AYBA 5EHHA 4WZQA 1ZYQA 3P5BP 1QY7A 2G0JA 2GC8A 5FRMA 3Q86A 5EWEA 2FVPA 4OHVA 2DPIA 3CXCR 4UT4A 3FQKA 2WVDA 3ZETB 2GNKA 4CJ7A 2W1BA 5FPMA 1W7AA 2F8EX 1FNOA 2XYGB 1T6DA 4NX9A 1SH2A 4DTXA 5JXSA 4CEFA 3NH0A 1XR6A 2HHVA 4L72B 1XNRF 7FDRA 2VG5A 2E5JA 4OZLA 4TN2A 4EO8A 2J0WA 3BR9A 4K2XA 2QRRA 1TKXA 1FKOB 4K41A 3MMAA 1YITS 4HKQA 1MWQA 3WIUA 5ETVA 3G71N 4BR9A 3CFOA 4ZITA 4P2MA 4JLHA 3Q8YA 3BGUA 3CGIA 3MM7A 2DEIA 3THXB 3RMBA 3C2PA 4TU8A 3SPYA 2DGVA 4F04B 4TNOA 2XCAA 2Y0SD 3RMCA 1LOTB 4E19A 5G0RA 1NNEA 1G1XA 1FK9B 3LPTA 4KGMA 3AFGA 2HGNA 4QWDA 3JAMY 1UTAA 3M8YA 4DUZK 3V6DA 2IVPA 1MWKA 3T5HA 2Z1JA 3Q2SC 1YVNA 1CC7A 5IT9O 5FDLA 4OYIA 3T5LA 4Q43A 1KCFA 1KONA 3BJYA 3L3CA 1HNVA 4QYRA 3VA0A 1OKJA 2BVZA 2GWJA 3A8IA 4CEOA 1NOYA 1LFWA 4JD2A 4JKEA 3J80Y 2FBYA 4XPCA 4NXMF 1HWKA 5AQQA 4C6AA 1K6YA 2CGLA 3CEDA 4USJC 2QV6A 3H90A 2XMTA 1WG5A 3I4HX 3NGYA 4GC6A 4BC3A 1HBUA 1KVCA 4EIAA 1YJ7A 3SZ2A 4JI4F 1K73O 3L09A 5B0CA 4QW8A 3IAM9 1F9HA 2ASOA 3HKZD 4WK1A 4X66F 2MQMA 5E7OB 4KTQA 4ZLNA 4CO5A 1YRUA 2OMOA 4A48A 1S57A 2AX1A 3PX0A 2UZAA 3CMAN 1FO1A 1FKPB 4C2MA 5HRRA 2PFDA 3AJ1A 4UW2A 2UU9F 1ZBIA 2CZ9A 4CJPA 4ECWA 4KB0A 1LW2A 4M3UA 2DNKA 1KWMA 4HTJA 4PPDA 4A59A 2V94A 3X1LB 2F8HA 3LF0A 1S5JA 3WXLA 1GQEA 1S7IA 3NCIA 4JI5K 1H72C 4UUWA 4IG3B 3LP2B 4F2RA 3ZT0A 4K0KF 2PC6A 5AE2A 3VVTA 5D3GA 3MCMA 2JEIA 1VLOA 3M4XA 2B9EA 1Q82O 1VSFA 2K1RA 1WB9A 1CC8A 4Z2XA 4YMEA 5LJ3Y 2ZH4A 4DCHA 1N34F 9RUBA 3T1YF 3BO4A 4LD0A 4IJNA 2ZHBA 5KFZA 4K7QA 1UA0A 2YKOA 4DTSA 4FVMA 2Z1HA 4EBCA 4A2AA 2KG1A 1NKBA 2XTJP 4OGEA 3D2FB 4NZ6A 1HBMB 3DXKB 1FJEB 2NREA 3DDKA 4NO7A 2DY9A 4C4WA 5IT9U 1X5TA 2LFVA 2XG8A 2IY5B 2AJ2A 3UCGA 1MU2B 2JRSA 1V6HA 3P5JA 3TA2A 4B1YB 1SQKA 2NXCA 3GIMA 2Y0BB 4O44A 2VASA 3WC0A 2FBTA 4DFPA 2HHQA 1HARA 5KFYA 4KTZA 3FZKA 4DG1A 2WK4A 1VQ8S 3AVKA 3OTEA 4I9LA 4IJAA 2UXCJ 3AVIA 2E6LA 1SC1B 2MKKA 3SCJE 4C0OC 1LWFA 1HUXA 3KK1B 2I0XA 3NMRA 1BG3A 2R42A 3D7SB 3ZZPA 2XMAA 3IUCA 3MM5A 3OYHA 1E6VA 2KXNB 4AXJA 4KHPJ 2KYXA 4PL8A 3JSRA 3THYA 2BBEA 1GXLA 2QXLA 1JLBA 4LUBA 5IWAJ 1DQ9A 4LQ9A 3R7NB 1N32J 2EKNA 2VQEK 3QNNA 2NLXA 1PSDA 4GKKK 1IKWA 4QOTA 4CM0A 2NUBA 3R1XA 3ISZA 2AW0A 2DYAA 2MHEA 2AJ4A 2ASJA 4OZ3A 3FBEA 2DNGA 3HHLB 4CK1A 3BN7A 3BZCA 1A7GE 2N82B 3E9OA 1KQSM 1EWQA 2E1AA 2WVEA 2KHOA 5HN0A 1JWWA 2NRTA 4ED5A 3EGZA 4BCAA 2UUBK 5LJWA 4KKOB 1M5VC 3M2RA 1EKSA 5CR4A 3FC9A 3W0LA 3NOCA 3TABA 2MKIA 1VRTB 2IM3A 5AQMA 1MA9B 4I4BA 3M6UA 3VAIA 1X9SA 5KQDA 2H51B 5M1KA 3LGHA 4JI2K 2PMZD 3TAFA 2YJFA 3DWLA 2Y9HA 3VGLA 2Q6CA 4V19S 4RWTA 2RQKA 1PKUA 4NI2B 3KMSA 3PSIA 1NPKA 3D67A 2F9JA 1FWPA 1HHSA 1B70B 2QYCA 1KQGB 2JHEA 1NGAA 4FBTA 3SI6A 3CJAA 2BEFA 4UQGA 4DWIA 4F8RA 1VQPS 1XMQK 3GJQB 1XQIA 1UFWA 1V3SA 2LVWA 4HR2A 2YV0X 2LEPA 3MUTP 2O01C 2DHSA 2PT0A 1RAFB 4IFVA 4GW6A 3LWMA 2YWFA 4ETZA 3CC7S 2EG2A 2OPQB 1SVDA 2XMVA 3RUBL 4RW7A 3OSNA 2D0OA 1S6OA 3RB4A 2F4VF 2KT2A 3R97A 2ZQBA 3UD4P 4CIOA 2RVJA 1ZBSA 3W61A 5DMRA 1CQNA 3SI8A 3HVTB 3DLLQ 1AZSB 3TANA 1HQUB 4YFUA 1TV6B 1XUPO 1Z05A 1Z6RA 1S72S 5H9FJ 3TJ9A 3IS9B 3SBMA 2BOAA 2KKHA 3LP1A 4LBPA 4B3MF 3D2EA 3CD6N 4USIA 4DU7A 4CFCA 2DVIA 5IT9Y 2C3PA 1O8BA 3TX8A 3NP5A 4EI2A 2BH1A 4W5NA 2HS3A 3AO2A 3GG4A 5D77A 1NKCA 3FVYA 1UEUA 4KRFA 3AVAA 3OSPA 2P9LB 3MEDA 4G1PA 1E4GT 3W66A 2D3OR 1JJ2R 1TVRB 2FC0A 3HHLD 1BIZA 1Q9YA 3FEXB 2XM3A 2GWKA 2RHSB 5DZ6A 3MR2A 5FRNA 3ZZYA 4DV1F 5J2MB 4HACA 3DXSX 1Z4UA 2OFHX 3GJTB 2HRYA 1GEHA 2NPFA 3QBCA 1T3OA 3IM8A 3SFUA 4Z94A 4QW9A 1J9AA 5GADU 4FCYA 4CZIA 2X1GA 5AQFA 2V7ZA 3EE8A 3DOKB 5IC6B 2JDJA 2GGPB 4OLBA 4JKCA 2FJXA 4PUOB 2NRRA 4C8ZA 3GYNA 3CCEN 1XNQK 3W9IA 2CVIA 2WW8A 4Y2IA 3QT7A 1XMOK 4CTAB 3EGVA 2F7TA 4PR6A 1NJZA 5K8PA 3SAGA 4LSLB 2IIHA 1RDCA 3AVJA 1N36J 5E2QA 4LF6J 1N6QA 3GG0A 4C1NK 3ZTOA 4ZVUB 4RLEA 1WBDA 1RDWX 2XO6A 4MO4A 1LK7A 2ABYA 4CJQA 4CZJA 1BHNA 4ES1A 4DV0F 4DHVA 1B9DA 1S1VB 4WU2A 2R7VA 1F0XA 3KK2B 2ALYB 4B3SJ 4CD3A 4H4KC 1UJ4A 4JI8K 2IVYA 2HBKA 2YWEA 1DARA 3IBFB 2A40A 3VGMA 1S1WA 4FJMA 5C25B 4EZ6A 1R6YA 5JJBA 1W0HA 3G25A 3V5RA 3I4PA 4BY9C 2R7TA 5K14B 5M1NA 4HI2A 2LXUA 2E88A 2Z0GA 1DTTB 4OLOA 1A5WA 2DNOA 2Z8QA 1HBOB 1RHJB 4DPYA 4FWLA 4X4OA 2ASLA 5AQSA 5SZTA 3K57A 4X62F 3OTOJ 2F7VA 4JI0F 2YWGA 1NG9A 4TY8B 4CLPA 3KLEA 2KM8B 2R9LA 3V9UA 2DHAA 1RSCA 3PLAA 3L95X 4ID5B 2XC9A 3VAFA 3H4DA 3ID6A 1GLEG 4QOZB 1F5BA 3T1HK 3VV2B 4WKYA 4QIVA 5MLCV 5H1SV 4Z4FA 5KG0A 4Y2MA 1YRXA 5BREA 1N56A 3NF6A 3H40A 4BRMA 2X3DA 1NGEA 5GMKa 3C8YA 4PWDA 2RHKA 2ZH3A 1RTIA 3CJ0A 5A6WA 1YIJS 5BRHA 2NXJA 3BUZB 4RU9A 2XS7A 3J81j 1DY3A 4KH6A 2CNOB 3BQ1A 2B6AA 4GKJF 3ILJA 3O44A 3SPZA 2N3OA 1Q1KA 4X66J 1HPZB 2NRWA 4ILGB 3CM5A 1OPIA 2DR5A 3CQYA 2OPPB 4I56A 3TAPA 5KT4A 2P9KA 3F9MA 1TL5A 3EL2A 1KR4A 2DIVA 4FYWB 2H48B 8AT1B 2OD6A 4DR3F 2WCXA 2EFQA 1Y5NB 4PYAA 2MDAA 1RILA 1FD8A 3DXBA 4DFKA 3D3CJ 1YJWN 2YKQA 1RTJA 3QMQA 4UTGA 4OQJA 3RW6A 1RHUB 2CZ4A 4CYUA 4BWJA 1HNXJ 4CJ5A 1BQNA 4BRAA 3CCUS 3SXLA 1J5EJ 1IUJA 2E5LJ 2P51A 2ZNZA 1HWJA 1UEKA 3HPGA 1ASVA 5J2PB 4CQ1A 1Y0HA 4K0KJ 2XLIA 1VK8A 2CJBA 2OANA 4O8KA 2JLGA 4USVA 1SPBP 2R7QA 1K0TA 4IDHA 2AJ0A 1QAJA 1HW8A 4ZOSA 2MLYA 4CEZA 4EUVA 4ILLA 2XSJB 1GTHA 2JVOA 3OT9A 2W01A 2VBYA 2P9SA 2NRHA 2XBPA 1R8PA 5KFLA 3SCXA 4RW9A 5LXRA 2GVZB 5KFAA 3QQCD 2OP5A 1IQZA 3ELHA 3IWLA 2CPFA 5J2NB 5HVHA 2QI2A 3JTNA 5DDRC 3BS9A 2HQ3A 3EMTA 4NRTA 3R5CA 4GVMA 1RISA 3CC2N 2IC3B 1NK6A 1ICEB 3TUZC 3LA0A 1NAQA 2B9XA 2HVDA 3OYBA 4DV5F 2DXEA 3WXKA 3HFKA 3AVFA 1SC4B 2RPIA 5I9EB 3OYJA 2I9SA 2HQFA 4ZIWA 3MMCA 3KLFA 1HNIB 4X64F 3G6VA 1N5YA 3TJ8A 2EWSA 5AQXA 3QINA 1H74A 2UYTA 3LQVA 4YB7A 3DLEB 3DRXA 3OFHA 1YTYA 1CBKA 3IA0A 1TELA 2U1AA 2Q6BA 1S0NA 3GYXB 4OX6A 2PI5A 3PO5A 2NYHA 3AJDA 1J5OB 2ZH2A 1KD1T 2YTCA 3UN3A 1FRKA 4I6MA 4BACA 3P8BB 3OVAA 3H46O 2C3UA 2I5JB 3NLCA 3FJ2A 5LMUK 3FZ2A 2PY5A 3P83D 1Q79A 1D5AA 1KDNA 4YHHF 2FJVA 4KH0B 1RCOB 1MLAA 2YKMA 5AE3A 5GMEA 4DR1F 2Q31A 3OYIA 4TQSA 1HFEL 4A8MP 4RW6A 2MY8A 1VQMS 3U1NA 2BM0A 5HMYA 1JLGA 3PYGA 2F1FA 4U96A 1D8YA 1K8AO 1H2UX 2I38A 1UFKA 3CCVS 3M9OB 2ILZA 4O0IA 1GMWD 3IP0A 2IPOB 3H5XA 3ADAC 3KDOA 3MCOA 1YUWA 1M5OC 4LH4A 1DT9A 3OHBA 3G96A 2MGZA 4BGBA 3VZHA 4CF9A 3BEXA 1ZAWA 4BQLA 1QVGR 3QSIA 4CHNA 1R7IA 4BE1A 1YRTA 2YQ1A 3JQMA 3QWUA 1YX2A 2P9PA 3SUNA 4DF8A 3C16B 4RUAA 3SQ0A 1RK8A 2PZSA 3CCRS 4TSXA 5LT5A 1NZ8A 1VQ6N 2CZVC 1X7VA 3F56A 1J2VA 5L39A 1RT5B 3V81A 5D15A 1NJIT 4MDAA 3CJ8A 3PO4A 3W2VB 1R8CA 1QAYA 3IAYA 2XY8A 3IAS9 1KVIA 1FX2A 3FFKB 2NLWA 4RBTA 5CZXA 5AJ3J 5EVZA 4K8ZA 5THWA 4FPRA 4WBFA 3BQ0A 5CZ1A 3AOBA 1TYQB 2RUSA 3DI6A 4YOXA 3SQ1A 3TQEA 3SQ4A 1TUWA 3OTDA 3MXIA 4LBIA 3ENBA 2KTQA 4KREA 3HYFA 3ITHB 1JK9B 4JI7F 4WU3A 1GFWB 1PC4A 2QTWA 4DLEA 5AQUA 5EX3A 3VTIA 1SIZA 4J9UE 1NU0A 2IAJB 2GJ2A 1GLFO 4K8RA 1VSLA 2P5VA 2HVEA 3GSDA 1RTDA 3ZSQA 3THWA 2DISA 3ONQA 1F21A 2LCWA 1OY9A 2IRXA 1VBZA 4LR8A 4GRSA 3PY8A 2YNGB 4BC9A 3CG7A 3CM6A 1AUDA 1HLWA 3HJFA 3EXYA 1UFLA 4IO9L 2DPJA 1U24A 2KVIA 2AMCB 1KAYA 1Y00A 2IA0A 3NS7B 2ACYA 4MJKA 1I39A 1QTMA 4KAIA 4KRWA 4OI0A 1SL1A 4DKWA 3W60A 4LF7K 4M45A 5DRKA 5GVQA 3CCJN 2VBXA 4O3NA 4EBDA 3HHLC 1U7LA 4MAKA 5AZJB 4MKBA 2VICA 3OVSA 3GB0A 4WFXA 3W8PA 4OJRA 1R27B 9ATCB 3MR3A 2ZE2A 3QETA 3HSTB 4WFBL 4WXOA 3KLVA 2W2OP 1NZAA 3N6MA 2VV5A 1RHKB 3JS9A 2QA4G 3MHYA 3PRBA 1VIOA 4KV8B 5GADP 2KFZA 2KW4A 2V68A 1DLOA 2OI2A 2DFEA 4LFAF 4Z4HA 4GMJB 4JBCA 5F2RA 2RS2A 5BR8J 1E6YA 3DCAA 1T6CA 3ZTSA 4J9KA 3OYMA 1SQGA 3ZT4A 4M3RA 2W25A 4IDKA 3QFPA 2KG0A 4JKAA 2DNQA 4PRFA 1KFDA 3GE1A 2MB0B 2DGUA 3NKYA 1YSJA 3N4WA 4CO4A 4N41A 1JLAB 4ZVHA 1SKUB 5D78A 4IR9A 5I42B 3W65A 2UUWA 2DEJA 3AD7C 2IMWP 2P6TA 3MPWA 1JXLA 5AQNA 2B4JA 5F3ZA 1U09A 1QM9A 1VFJA 1HNWK 5KFSA 3CTRA 1UA1A 3DMJB 2QJ3A 3DAWA 1TFWA 1VHFA 2VGNA 4FLTA 2YNIB 3TEHB 4R0JA 4X84A 3LM9A 1H1VA 1BOTO 3JYTB 4B9TA 1U1PA 3IMQJ 2LEAA 5D0GA 1FFWB 1NGHA 4OX8A 4OYOA 2LQ5A 3AA4A 3B8AX 5AE1A 1KN6A 3E9LA 3FBCA 4KI4A 3CD5A 3ENVA 3S7RA 4CLLA 2BTFA 3BGFA 3V6HA 3KXDA 4B17A 2DT9A 2UXBK 3F44A 2XI3A 4BE2A 3G8SA 4FJ9A 3M8QB 2RT3A 4CJFA 2V2VA 3O6WA 4TVAB 1Q8BA 2YWHA 1MN9A 3QNOA 4OFZA 4E7KA 1TL3A 1UMJA 3MM8A 1Y9OA 2HWHA 3BV8A 3DLJA 1PO6A 4FJ7A 3I32A 1JJCB 2MKYA 4IH7A 4KE5A 4NLPA 2V63A 1UVMA 2E9TA 3ILIA 5GAEI 2XY6A 4HH1A 1VS3A 3KIOA 2CDRB 2F63A 1EETA 3LPYA 3CDBA 4OL8A 2WTUA 4CH1A 4GV6A 2C3OA 2VB6A 4F3QA 1B7YB 2VH7A 2J7KA 4OYXA 5M1PA 3RW7A 5A6PA 4C1NI 2OD4A 1WNEA 4RKUC 1XN9A 2Z1IA 2KN4A 2GVDB 3HZGA 3NGUA 3U9ZA 4CBWA 2VFVA 1JMTA 3G6ES 4JI3J 3DNCA 2O8CB 2O8BB 1OMSA 2E4LA 1YI2N 2QWMA 3H2LA 3M6WA 4DU8A 3AVLA 2XMJA 5AQOA 2V0NA 5JVGQ 4J9QA 4CF0A 2G2ZA 3UNGC 2FGCA 1Q78A 4LFBJ 3HMJG 4LF9K 4W90B 4BBYA 2HFZA 2PMHA 3M1VB 2R4FA 2J9CA 4C11A 1LWEB 3KKRA 1X9JA 3M32A 2AKWB 3NG8A 3CQXA 1Y97A 4YDXA 2NRXA 5DM6Q 3AVGA 4OO1J 4F3TA 1LXNA 2DITA 4NEZA 3TAEA 3BN4A 2B7BB 4J9VA 4JKGA 1D09B 3PW4A 1YTAA 2FSNA 5KTQA 4ZHRA 4JN4A 1H3DA 1T11A 2E7WA 1X4CA 2D0BA 2G0CA 1UL3A 1WTBA 3CMES 2HMPA 2DHXA 4FF3A 1VIXA 1KLMB 1Q8IA 4AL7A 1WC1A 3MN5A 4PWWA 3QESA 1VI7A 1C1AA 2W6KA 4ZP9A 4KO0A 2E5HA 2DGWA 2MLZA 1IH7A 5JS2A 1AA1B 5M2RA 4CZCA 3SSSA 1P9YA 1OQ3A 2HEKA 5HVGA 4DR5K 4HLBA 1H0HB 2DGSA 4A57A 4KHPK 3KLGB 5ETMA 2A6OA 3BPSP 4CEQA 1R3NA 2CNLB 3PZPA 1N32K 3J81O 4USWA 2BR0A 3O4NA 4M8LA 3TTCA 3CXCM 3TYTA 4IO1A 3O6QA 4QR2A 3EKSA 2P9UA 2ASPA 1TK8A 3KKFA 5C0YA 2G4BA 3C66A 5KT5A 3OXFA 2WBMA 5E33A 4DR7J 1BO5O 4FXDA 2VA2A 1RAJA 3E01A 3MXJA 3GBTA 4ER8A 1KQFB 3O3FA 2YHBA 3HHEA 1KVBA 3D9BA 3E66A 2NS1B 3TAMA 4Z4IA 3MMBB 4YHHJ 4FYVB 1C0UB 1RT7B 2DNPA 3R1HA 4DV4F 2A3ZA 1WSRA 2O8FB 2Q36A 1TK0A 4OHYA 3IR5B 1FXLA 4J37A 3GYGA 2YNHB 4BRQA 3W2WB 2N7YA 2HK3A 5KG5A 3PYDA 1VQ7S 2PN6A 3WNFA 4K4TA 2C2DA 3K9KA 1XI1A 3H08A 4O0NA 3AVNA 3OBIA 3D1QA 1HMVB 2W4DA 1HI0P 4OKJA 4WYBA 2A0FB 2FLPA 1Q16B 1OY8A 1CJKB 3EE9A 3B6PA 2ZFHA 3VOVA 5DETA 2O3DA 1HNZK 1JCEA 2ZVIA 3R5DA 3VEYA 2EHGA 4CZEA 4NLVA 4DV3J 5JMNA 2HHWA 1VQ5N 1XBWA 3H45C 4NYNA 1U8WA 4AYBD 4W5TA 2G2OA 3ULEA 5F8JA 5BXIA 2Y1JA 2AJFE 3TZXA 2W9BB 4LF8F 3G0ZA 3ZX3A 2QZ8A 2CXEA 3D1HA 1W25A 3ZCMA 2BMBA 3F9KA 5HJYA 3L9ZA 1IO2A 2Z30B 5E3RA 1S0MA 3HF5A 1HR0J 2ZH6A 1EARA 2HHTA 2QEXS 2UUAJ 2EBEA 1YGYA 1RUSA 3LP0A 2W8KA 5H9FK 5A8KA 2PO4A 3DXMB 1P8GA 3J81U 1XTZA 5F8LA 1JLEB 3ZT2A 2CQBA 2HB5A 3OS1A 3P5TL 4AL5A 4J2BA 3PIPL 2BV3A 3VEXA 1ZZFA 4KGXB 2HNDB 4B3RJ 1VSEA 1GTEA 2PMWA 3HSDA 3C0BA 1VQLS 2H9ZA 4QU7A 1Z26A 5BPLA 3KLIA 2A2DA 3QNWB 5ETRA 3QIPB 5DK5A 4QIWD 4USTA 3C6TA 4B1UB 4WFYA 2C3YA 1WHVA 4CEEA 4ICLB 2ROEA 2P9GA 1UZDA 1X4HA 5LSRA 2LLZA 4CGIA 4CLWA 3HHKA 2EX3A 4PQUA 4FL9A 2D0CA 2Y1RI 3OTBA 2ATLA 1IBKK 4B1WB 3U6FA 5AXNA 4S0MA 1S79A 4H5VA 4JV0A 2DNMA 3N0VA 3PFOA 1NK9A 4NXNJ 2V67A 1FD2A 4X65J 1FXDA 2OGUA 5LM7E 3IGNA 2CRLA 3AA3A 4JRQA 5F3TA 4C9DA 2CADA 1YQHA 3BDEA 3IG1A 1RB0A 1D8ZA 3MD3A 4FPBA 2GJIA 5J1EA 4RU2A 5J1NA 3CCSN 2DGQA 2Z58B 1RTHA 3VAGA 1XNRK 3RSEB 2JLFA 1YIJN 1NCLA 3DOLA 3HXMA 2IYIA 2A1BA 3A5NC 4LFAJ 2JEJA 4C3LA 2HVZA 3DFEA 4M5LA 4B9NA 2V8HA 1FDNA 1MWMA 2E8AA 3OXGA 5AQGA 3BSCA 2HBLA 4DV6J 3CJCA 4JV5F 2J7WA 2OSQA 3ENOA 2Q0UA 3M2UB 4LBHA 3OYCA 4LR9A 4K5SA 1S10A 4CZMA 3QFUA 5AXMA 2EWHA 4U67L 2VPWB 2RRAA 2KH9A 4RJVA 3SIPB 3CJKB 2G8KA 2F8MA 2C2MB 3O4QA 4A8QA 4ANCA 3SUPA 3GIJA 1HKCA 1LAWA 1E4FT 4YUDA 5CABA 2J9EA 4C23A 1CZBA 1RT1B 2ZM6F 4A4JA 1WC0A 3GCWP 5IM0B 5ETKA 2NZ4A 5HJXA 5DQGA 3NS6A 5T7BA 2VDHA 4M5DA 2YQ0A 4P6QA 5HRPA 3MMVA 2UUCF 5C24A 3KNGA 1U6ZA 2G8UA 2KDOA 2QXFA 4IG0A 2HK2A 2YXLA 5AZIA 1B4SA 1WKLA 1WEXA 2DCLA 1KEKA 4BRCA 1VQ4N 1MMLA 4NXMK 5KG6A 4DR2F 5BPNA 1Y5IB 3TR5A 3MWBA 3G82A 1FNXH 3R5GA 1RFQA 5KFKA 4FJGA 1IKXB 3MM6B 1OIAA 2ZD1A 4NL5A 3AA8A 3CJSA 4RW8B 1C1BB 3AOAA 4OZ5A 4QAGA 4KAZA 3SK3A 1FT8A 2W7AA 1UWAA 5L1KA 4JI4K 4HT5A 4FW1A 4X66K 2KT3A 2NXUA 4F02A 2HFOA 5BRFA 5IZHA 2BDPA 2M2BA 2X1AA 2HQGA 1UWBB 2QWQA 2AEFA 4LVOP 1TL4A 1O5JA 2P9IB 2UXDF 5IQ6A 2UU9K 2UV8A 3OR2A 3SQGB 3CPEA 4MFBA 3KYLA 4HDGA 3WC2A 2GV1A 3GSIA 2CNNB 4LFCF 1XEZA 4I2QA 4F3OA 3MAAA 1IG8A 2PAVA 5DLFA 1JLFA 1N8RT 3PUFA 3G71S 1VCTA 2GMHA 2ZJPL 2DNLA 3ZZZA 5I3PA 2B4UA 4K0KK 1RKJA 4OYPA 2GHVC 3FDSA 4YR0A 5KT2A 4O8UA 4WFNQ 1UAWA 1ZAXA 2GAHC 2GJFA 4AHUA 4U7UD 2YNFA 2QFIA 2VFSA 1QD1A 4GVBB 3HZ6A 3NNAA 3R6LB 4IYQA 1N34K 2GW8A 2P5OA 3T1YK 2KHCA 4C0HA 1U1MA 1IWAA 3DHXA 1Q8LA 1ZPVA 1U6FA 2OPSA 4NYFA 3LDSA 4LF2A 4JKDA 5C15A 4BR5A 4KB7A 1CXQA 1CJTA 4MKAA 4J9LA 1I3AA 1SQEA 5MAOA 1JJ2M 1Y7PA 1BL3A 1FTRA 4MDBA 2C2NA 3M8PB 5ADXA 3BF4A 1NK5A 3FRYA 1CJUA 1M1GA 4ECTA 4R5PA 2V4JB 4WCEQ 3T9ZA 1RDBA 2RNEA 4ZVGA 1I3OB 4LRCA 1MG7A 2D3ZA 5IQQA 4KTWA 3DYAA 3SUOA 3D6RA 4IOCQ 4KGZB 2HQDA 4PKIA 5KFFA 3CCRN 4FWRA 5KI6A 4Q0BB 5GIPA 3CULA 4D3GA 3LAKA 1Y11A 1D9DA 3HVAA 4DL0C 3DLBA 5K20B 3IO1A 3L3VA 4W5QA 4CLZA 2Q3SA 4P7VA 2NXEA 2FTRA 1R43A 1Q95G 1UP1A 1RJJA 3O3HA 5E84A 2QE5A 3G9CA 2HAFA 2DNRA 5C42B 2HZAA 3A2FA 3ZNUA 5A2QO 4DR6J 3AAWB 4LY7A 1W97L 3VQEA 1BE4A 4DPTA 4ID1A 3VGKA 3L3UA 4DTRA 1UEVA 2FVSA 5KFOA 2CAJA 2W40A 1SH0A 1QS4A 4ECZA 3AD8C 2RKIA 2O8DA 1SUQA 2RRNA 2MY7A 3C95A 5E3PA 4Q8EA 4OI6A 3BSAA 4QIEA 1BC6A 1HQ2A 3MEEB 3ZEUB 4WQ5A 3SSRA 4DQSA 1NOZA 3CIPA 1RT6A 4ECVA 4KPCA 4ZPTR 2ZUAA 1UVJA 1TUUA 1XC9A 3DU5A 5GIOA 3AO1A 4J9SA 3UDCA 1SH3A 4NPOA 1AFJA 3QJLA 3GTYX 3TA1A 4JYAJ 2Y8WA 2CPHA 2ZGYA 3E51A 4DV7J 3RRKA 1U2FA 4U6PA 1T05A 4C7QA 2IS3A 2VFUA 1C1CB 2LQBA 5T41A 3THPA 1XR7A 4FKXA 3CJBA 2KO1A 2Q43A 2ITGA 1REVB 2AZ1A 2WOMB 2P1JA 2HGMA 1UOCA 1M90O 1KC8O 1M1KT 5M2PA 2H5IB 2O8BA 2YH0A 1NGDA 3QLHB 3QRQA 3LP3A 4I64A 5CYMB 2V6AA 2B5JA 3D6FB 1GXTA 1N52B 2ACMA 4AHRA 1WWHA 3HSJA 3BKUA 1H7WA 3FMBA 1LW0A 3T6BA 2F4VK 3QGIA 3T5JA 3Q0AA 4G1QA 1IBMF 4F2SA 1C4CA 1RKIA 4ISEA 3PVXA 4DFMA 3OL7A 1YLXA 2FLOA 1LV5A 1YVUA 4LJMA 5J2QA 3CCTA 3C15A 3ID8A 4Z4GA 3JTPA 3D45A 3ENQA 3PYFA 5A76A 4B3MK 4RBUA 3ETOA 4GV9A 4BREA 1CS4A 4JKHA 2VG7A 1NSQA 1R8AA 1BI4A 3NWGA 4NASA 3K5OA 2ZDOA 4NLXA 3A3OB 3SSQA 3OLAA 5A2QU 5ADZA 4E1NA 2W2MP 4B1ZA 1U2CA 1T9YA 3S41A 5E3QA 4XK8C 1A6LA 4OYZA 1WN7A 1RGVA 3NAIA 3DC2A 4DV1K 1CULA 2D7SA 4TU7A 3NCRA 4NOHA 4QYZJ 2CQ0A 1TKTB 2OCEA 3JSYA 5IXUA 3MOJB 5FD1A 1TKZA 4H4MA 1Q81T 2VOOA 3K89A 3ILLA 3CFPA 2DGOA 1RLCL 3Q83A 4LF5J 1QHAA 2KFNA 1YWXA 3UR0A 3KK3A 3PRDA 2BGGA 2VF3A 3UCZP 4YR3A 3C7NB 2RH3A 4Y2AA 1SAZA 4X4UA 4LSZB 2WB1D 4LSNA 3PEHA 4WKRA 1S4EA 3NNCA 4RCHA 5DGBA 2W9CA 2FJBB 1CZ9A 4QJVA 4CGFA 3DRRB 4C8NA 2J8SA 1HYVA 2C2OB 5FPDA 4ZVFA 3NGRA 1CZAN 3I56N 1BXNA 4FK4A 3D7EO 3UDEA 5ETOA 2HQIA 2B8QA 2B4OA 2W8LA 1RBTA 3AA9A 1WI6A 3D28A 3N9UC 4DV0K 3M2VA 2JH3A 1FI4A 1VHXA 3O3GA 1NKEA 2DJWA 4ECRA 3CQ8A 2AYGA 2F9TA 3WNGA 2HLTA 4FJIA 2B4VA 3OUYB 5DDPC 4H5TA 1VOMA 1EAYC 4DV2J 3LPEA 4OZ1A 1NU4A 1F3FA 3WXIA 4Z4CA 1TUVA 1IJFB 4H4OA 3I0RA 2V2QA 4RWWA 5ETQA 1T03B 1T9UA 2V5HG 2RN2A 1UPMB 2ZH7A 3CD6S 5C10A 4N7TA 5B0FA 4I0WA 4OI4A 2QMUB 4CZFA 5F0XA 2FB0A 4ENOA 1KSPA 1N48A 2GX9A 1RWUA 1OS5A 4DR4J 4X62K 3W3SA 3U4LA 1ZM3A 2NZCA 1FRHA 1KVAA 4JI0K 5LMNJ 3LPUA 3SYZA 1TUYA 2GQCA 2HWIA 5A0YB 1XHXA 2UUCJ 4TLRA 1VQNS 3A12A 1OH5A 3R6GB 1D1UA 3UB5A 4MTPA 1U48A 5ETLA 3LDQA 1QE1A 5FJ4A 2IM2A 1YHQN 4D3HA 2CPDA 1JX4A 5CQGA 4RNHA 1MROB 4JNEA 1QVGM 3ZX0A 2Z57B 3SDEB 4GKJK 3AVCA 3MDFA 3CF5Q 2ZC3A 2IRYA 3QAUA 3UI3A 1R0BG 5A2QY 1B9FA 4OLPA 4DL4A 3IKMA 2I7PA 4HUGA 4OX9J 5JVHL 1JIHA 3NGDA 4DU1A 4PZVA 1S7HA 1NK8A 3QIDA 4DR3K 4M3ZA 2UXDJ 1WOOA 3AAQA 4F50A 2HBQB 1QUVA 4F4YA 4EU0A 2BOPA 1JLCB 3GV8B 1IKVA 1R0CB 4GO7X 3GDQA 2F5GA 1T9WA 3O1WA 3JSMB 1X4EA 3PW7A 3RJMB 3LUYA 1TL1A 3SEOA 3RMAA 2POKA 1WEZA 1YJNS 4PKDB 4JHDB 2D0AA 1BWVA 4I7FA 2ZH9A 1HQEB 3EYZA 4NZ0A 1T94A 3FFIB 2WHOA 3M9MB 3L2UA 3AA2A 1QSSA 3KZBA 4E7IA 4RW4B 1X5SA 3CUNA 5EX5A 3DDNA 3CWJA 3SCKE 5CYJA 1HD1A 4AQYF 2ZOGA 1IV0A 2VWKA 2KRRA 2RDJA 2HGLA 5KQ8A 1YF5L 4HVJA 3QEIA 4MO5A 3TZYA 4N77A 2B43A 1BQMB 4N76A 4Y6IA 2OSRA 4UQTA 3UVJA 3MF5A 1RT3B 3OV7A 4CI0B 4ZTJA 3D0IE 1S6QA 1U2VB 1NBWA 2VG6B 3HOTA 2ADCA 4LF4J 4OJGA 4E8UA 4YY3J 4NMXA 4DV5K 2XMUA 4HT7A 3SMZA 4M41A 3VQSA 1BDGA 2Y3YA 2B3TB 5E41A 4J9NA 5JLHA 1YT3A 3KUEA 5FPEA 4H0VB 1X9WA 4YNQA 4X64K 1U0HB 3JAMO 1RT2A 2XWXA 1Q5VA 5CE3A 3UKRA 2AGOA 4IQMA 4I2PA 1IKYB 4B3OB 2V7YA 2KQ2A 4FK2A 2MQNA 3GV7B 3S3NA 3AA5X 4CJEA 3P39A 3NH2A 5A8RA 2VOPA 3FCWA 1S9EB 1D3WA 3BY5A 3DRYA 2GIRA 3CC4N 5JUMA 2UXCF 5GAGI 4ZVPB 1PAUB 3J7ZT 2CJXB 3QYYA 2EK1A 4M7XA 2HF4A 2O8EB 3J80O 2V8DA 2R7XA 1RT4A 4ISFA 5ITHA 2B9WA 2XNRA 2QEXN 4YHHK 3WEEB 3NAHA 4RX6A 1WSIA 4UY85 4DR1K 1LNQA 5IWAF 2WVBA 5HMZA 3EPIA 2GMJA 4H0PA 2D1CA 3KWGA 2RF2B 3AXKA 1JLQA 4FJLA 3GG1A 1VDHA 1D9FA 1PCAA 2E29A 4MKVA 4DUTA 1R6VA 3GPAA 2AA4A 1H7XA 3CJQA 5CXTA 4F26A 1RWNB 3QFHA 2PFFB 2OIHA 1CJVA 2PD1A 4FNHA 2K2PA 3RR7A 2G1HA 4BRKA 1HKAA 4Q45A 4RBVA 2BRLA 3IFEA 4CHYA 4B8AB 3UFCX 2FBXA 1R0AB 3GWCA 2RJZA 3P49B 3UW1A 1EP4A 1PAEX 4CO2A 4EYHB 4PAAA 2JVRA 3O9UA 5E5NA 2HFVA 2VC0A 4X4PA 3ULDA 4LC9B 3UR3C 4QZVB 3CC2S 3D0PA 3VGSA 3S1TA 3DN9A 2G8HA 3N28A 4AM7A 4LIRA 2A1RA 3RBDA 2VZ9A 3HP6A 3QZ7A 2F40A 5KPZA 1TK5A 2A42A 3CCMS 5TKWA 4CHQA 2UVWA 3EDQB 5EWGA 1S1XA 3WZ0A 4B1XB 1WTFA 3KHGA 2AJQA 2RQ4A 4P73A 4DL3A 1IBMJ 1EX4A 1QQNA 3P3DA 4CCHA 1VQSA 2F96A 1A5XA 3Q23A 4JI7K 1DTQA 4OYMA 2CQGA 3MAHA 3K5PA 7FD1A 4WE1A 2HMIA 1FTCA 2GBZA 1ZM4A 2K8GA 4GVEA 2YX6A 5I3UB 4CHOA 1Y5LB 2HNZA 4M1KA 2JWKA 3OLBA 5KFRA 2OO4A 3J80U 4CJVA 5KT7A 4IOAQ 3DRSA 3OR1A 2HPUA 3DLGA 2YX1A 1WG4A 3ATUA 1EQYA 1G6BA 5H9EK 5CZVA 2GQQA 2ZDPA 2W2QP 4JI1F 3KWMA 4L6V3 5DDOC 1FRIA 2R8IA 4P2FA 2CPJA 1OQ6A 3B6OA 4EBEA 2R8KA 5EGYA 4FZXC 1E3MA 1S0VA 2OPRB 3D1OA 3K8WA 2ZWHA 1WHYA 4TYBA 5AQTA 5JLFA 2GQ2A 4QCLA 4RL1A 1LWCB 3SV3A 4IOBA 4AF1A 1WF2A 3CI5A 3EN9A 2HBJA 3N01A 1MWZA 2DK2A 1TFYA 2MQPA 1IQTA 2E9ZA 4KFBB 2DR7A 3MAQA 1JCFA 3VHQA 1SS6A 1LCUA 5KG2A 1P90A 2QKBA 4FK0A 2YQ3A 3FR0A 1S77D 3CJRA 1RBVA 4M5HA 1GT8A 1RAOA 4LFAK 4CM2A 1WNSA 3DOMA 4DTPA 5KFQA 5BRDA 3VAKA 2KI2A 1X0PA 5E3AA 2XSFA 4WQ4A 3BYRA 2N4DA 3K58A 2FF6A 4BS2A 4H0TB 3G4SN 3TUIC 3ATVA 5IS2A 2DH7A 4M63C 2Y1LB 4CNYA 4A2BA 3HSCA 4X2BA 4FBUA 3C6HA 3BSOA 1N36F 4M5MA 4LF6F 1RWMB 1VSIA 5AQYA 3G8QA 1B0PA 3OTCA 2PEBA 3QEXA 3TTFA 3KJVA 4PXBA 1NNDA 1U8SA 3HSZA 4JI6F 4CBXA 4PWUA 3GLJA 5GAHU 3B82A 2FHJA 1BMQB 1ZOTA 5CYQA 2YHXA 3EY1A 5I4MA 4QS7A 4FLZA 1Q7YO 2L9WA 4C8OA 4B3SF 4CEBA 2CPZA 1RACB 1QQOA 4CJKA 3DLKB 3J7YU 1S1TB 3PCOB 3JXUA 2FVQA 2VBZA 5KFMA 2LMIA 4AL6A 4IWVA 4IFYB 1WSFA 4PG7A 2EKYA 1K8KA 3VPZA 5A8WB 4M5GA 3F73A 4NA1A 2ZKUA 2GA7A 5DM7L 1X4FA 2CQIA 4ECXA 2JWNA 2LQJA 3QSYB 2MZ1A 4NA3A 3KJQB 2AHOB 3AB4B 4PL7A 1Z2LA 3CCJS 1FVSA 3MECA 2GMLA 3OTOF 3LWLA 2HBMA 1K44A 1OWXA 4DUZJ 3J7A1 3L8BA 4ZVTB 3GU0A 2IVFB 5HLFB 3ZTRA 4URGA 2V52B 3BBBA 1RTZA 4M3WA 4MIWA 3IM9A 4PKHA 2W41A 4F4ZA 4YP3A 4FJ8A 3U1LA 2M5YA 2MMYA 3FBBA 1S1UB 3HD2A 5DO2A 4QWAA 1Z25A 1U45A 3L4BC 2PDAA 4CLKA 1BWFO 4B3TF 3VESA 4OYAA 5ELZA 3UN5A 4B9QA 1FDAA 2M0GB 2B0GA 4LH5A 4E7JA 1KKHA 1TL7A 4YB6A 2QL9B 4V19X 1FHTA 1HYZA 3PYEA 3EKUA 2ZBQA 4KHSA 3OY9A 3F0NA 3RBXA 3C6UA 2GHWA 4F3MA 3ILOA 5HROB 4WP3A 5DQIA 2BM1A 4KPYA 3DRPA 3S3OA 5AQHA 1Y10A 1KAXA 3KJFB 1S6PB 2RRBA 3HZEA 2ZJRQ 1X4DA 3KG4A 3FSYA 3HT0A 4CGHA 3CCLS 3TNVA 4NLCA 3DGPB 3MXMA 3NWRA 4O5BA 4OI2A 3CJ1A 1YJRA 4R8UA 3EZWA 3IDHA 4ED7A 1C0FA 1HBNB 1LOUA 1WUUA 4B1VA 1OSDA 4FF2A 2HNYA 1KVJA 4B9UA 2XZDB 3UDLA 1HNXF 3OS0A 4MKYA 1J5EF 1EWRA 1HYSB 1KTVA 2E5LF 1FERA 4WTOB 1FRJA 4ZLLA 3BGRA 4AQYJ 3I5CA 1NXIA 4K2JA 4C48A 2HIQA 1BCOA 3NEKA 4Y2CA 1FE0A 4AH9A 3M30A 4E0DA 4JEPA 1JKHA 4N8NA 1NSAA 2VJVA 5ETPA 1U1KA 3WDOA 3QEPA 2FVRA 1N54B 1VJWA 2B56A 4NCGB 3W5ZA 1VK3A 3R7BB 1NDKA 3KKSA 4ZPVR 4CJWA 1NDLA 1FNMA 1LEOA 2QSWA 3G86A 3SQ2A 4CK2A 2P2CB 3G2XA 3C14B 2CUYA 2IVMA 4CEDA 4RR5A 1TAUA 4FWOA 5KFPA 1W2BR 3KLHA 3KG1A 1VC6A 1J6ZA 3TSQA 3C65A 1VRUA 2UVVA 4CK3A 2RAQA 2KKZA 3O08A 3QJJA 2OA8A 4M7YA 2YCHA 4CI6A 2X51A 2J9DA 1FJGF 4HUEA 4H0YB 1M5SA 1N4LA 4CZGA 2MHNA 4J9MA 2VPZB 3IRXB 2P9EA 5IC4B 4JAXA 4BG9A 4K4XA 5D4PA 2LU2A 4DV4K 1FRLA 1YI2S 3PHEA 2KZZA 2G0IA 3TPQA 5HL7L 1WSGA 1N0UA 2E44A 3B78A 1RHQB 2OEKA 3V4IA 1TR0A 1NMNA 1VLYA 3IBCB 5K9FA 2NRVA 1V5VA 2MJUA 2VQEJ 4GKKJ 1OYEA 2HW3A 3CPWR 4L3NA 2OMLA 2D9PA 1X3NA 3KUGA 3K8VA 3I0SA 3H8YA 1TMJA 4P7TA 4HCCA 3WIVA 4PG6A 6FD1A 4O55A 1FDDA 1VC0A 3QO9A 4ILHA 1HD0A 2VG5B 4YR2A 3NBPA 2DO4A 4L76A 5L38A 3MMAB 2OHDA 2BW2A 3FCVA 2FZKB 2GS8A 4FW2A 3E3XA 2QTDA 4MQ3A 3OYKA 1PILA 3MM7B 1APSA 3KWIA 4LF8K 4FOIA 4FJ5A 1RAHB 4RUHA 1JXVA 1RYSA 3QJPA 3MX2A 3V9XA 2D3UA 1YVFA 2H65B 4EAHD 4WF9L 3CE8A 5G0RB 1X8DA 5KPRA 4AUKA 4FM2A 3I33A 1QZ6A 4CJLA 1X60A 2EK6A 5HBMA 2ADBA 1A9NB 2XQCA 3PX4A 3V6DB 3ENAA 3TUJC 1NPRA 2D9OA 2V4QA 2GAGC 3BP8A 4C3KA 3FNNA 4M5JA 3VERA 2AP6A 3VQ5A 4KH4A 2KU7A 5FDLB 3AOCA 4MLEA 4FLWA 1YBTA 1HNVB 1D0EA 2GTDA 4BWMA 3BREA 1XJWB 5AJ3F 1WOSA 3K17A 2YKNA 3BEGB 4JD2B 2C2RA 4G1IA 4MYUA 1ZTTA 2M7SA 4KI6A 2D4WA 1HJRA 2OZMA 5CCLA 3PDNA 4YOEA 4JKBA 2FJAB 3I9ZA 4E98A 3LTOA 1EQMA 4W4MA 3UN2A 4H5NA 4CZHA 3K5LA 1F3VA 4YDUC 3TSUA 2HZCA 3V9ZA 3CJTA 4E89A 1HBUB 5KRSA 3M8RA 1TMMA 4YDDB 2BW7A 5IV3A 1K8AT 2BUNA 4JI1J 5AQPA 4LF5K 4Q7AA 2Q0RA 2OZSA 2BJ1A 3AGKA 2CQ3A 2Q1NA 4ZVOB 5HANA 1FWKA 2BANA 5IV4A 5CY4A 2RS8A 3O1LA 8ATCB 1ZTWA 2FYXA 1SJRA 2V9KA 3D3BJ 4EFHA 2KYZA 1LW2B 4CGGA 1TP7A 1RCHA 2KJVA 3POTA 3QWPA 1VQNN 3CB4A 4NLUA 1SV5A 3U3GA 4ZA1A 1HHQA 3NF7A 2MQOA 1VQ5S 2NZTA 1L3UA 1UCNA 5D3GB 3WQTA 4OHXA 5RUBA 3HPHA 1PBAA 1TGOA 4Z0UA 5KG1A 2Z2MA 2E2QA 2K1RB 2J6TA 2NR0A 1K1QA 2I8EA 3UKUA 4B9LA 3ZTQA 1WDTA 2ZITA 4P72A 4KT0C 3VQDA 3M1FA 4H0XB 4ZPDA 4DCOB 4ITSA 4A8YA 1XNQJ 4JV5K 3A1YG 4MYTA 5E26A 3O2IA 2KJWA 2WONA 4K59A 1RHRB 1EKRA 1TKDA 2FZGB 3QZ8A 4EO6A 2H3EB 1HX1A 1DBDA 2ROGA 4ZDNA 4C8MA 2H54B 5BR8F 1IR1A 2HOEA 2VYPA 1KOHA 3O8MA 3PX6A 1RWOB 4KIAA 1YBUA 4FJNA 1RWKB 3NRBA 4JI6J 4BDYA 2MKSA 4WYWA 4X4RA 3I6PA 3OFEA 2X1FA 2ZM6K 4O44B 3T6JA 2VDIA 2FJEB 4YOVA 4DG1B 2U2FA 3MM9A 1EHWA 4LF1A 4DQ8A