1RTJA

Mechanism of inhibition of hiv-1 reverse transcriptase by non-nucleoside inhibitors
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
543
structure length
542
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Mechanism of inhibition of HIV-1 reverse transcriptase by non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 133
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtjA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtjA05
3KLVA 3IRXB 3TAMB 4J9NA 1JLAB 4NLWA 1TKZB 2BR0A 4OKJA 1QAJA 4FBTA 1BI4A 5K14A 1XR6A 4Y34A 3F9KA 1XR7A 4KO0A 1I6JA 4DQRA 1TP7A 3KKRA 3QINA 4MKAA 2VG6A 4CEAA 4O4RA 2XY7A 4J2DA 4RW8B 3AVJA 2WOMA 4KHQA 4RZRA 1HNVA 3I0RB 2HW3A 3T5HA 1WSFA 3JYTB 1QHTA 5FDLB 1FKPB 3I5BA 5I3UB 3KMQA 3LAMA 1JLFA 4FLYA 2WCXA 2AQ4A 3OYBA 4TQSA 4FM1A 4KAIA 5KRTA 3SUNA 3OYKA 5KG4A 4B8AB 2G8VA 1TVRA 4DTOA 1TL3B 4WFZA 5DQIA 3KK1B 3CJ3A 3H4DA 1JLCB 1DTQB 1T8EA 3DDKA 1WSHA 4CK1A 1RYSA 3LP0A 1N5YB 1SL0A 2HMIB 1S4FA 4C8KA 4PQUB 4CGGA 3RRHA 5HRRA 3V1OA 4O3PA 4GVMA 3H2LA 5HLFA 3VN5A 4CF8A 2IS3A 3LWLA 4HUEA 1VRUA 2YNHB 3ZCMA 4M95A 3RMBA 3HHKA 4R0EA 3AO4A 2UVWA 3PW7A 1L3SA 5J2PB 3V9SA 3HPHA 3UQSA 4FJIA 3LANA 4QAGA 4IH7A 1NJXA 1NKCA 4DU4A 3QGHA 4YR2A 1LW0B 1WNEA 1RYRA 2QXFA 4Q8FA 1JLQB 3TAFA 1SH0A 4B9NA 1C0UA 4KHWA 4I2PA 5J2QB 3M8PB 1TAUA 2E6LA 1Z25A 3OYHA 3RMCA 2YV0X 1DLOA 4YQWA 1YT3A 1C1BA 4DTUA 1FXXA 1WNSA 2QKBA 2F8EX 2IM2A 4O3QA 2EC0A 3T19A 4I2QA 3QIOA 1JIHA 4FBUA 3T1AA 4W5NA 3ZSRA 2ILZA 4RUAA 5J2NB 4ZP8A 2FJVA 1IKYA 4FJ7A 1N56A 5HBMB 4ID5A 3AVGA 1D1UA 1N6QA 4DTRA 4O0JA 4MK9A 1B9FA 1RT4A 3DOLA 2DFEA 1IO2A 4FJ5A 4DEZA 4FZXC 4O3OA 1A5VA 4RNNA 4H4OA 3SFGA 2V0NA 2J6TA 1OS5A 2BDPA 4RW7B 1ZETA 4I9LA 1GOCA 3DLEB 1T05B 4URSA 2UVUA 1SUQA 2I5JA 4DQSA 4CERA 1HNIB 5CYQB 3AVLA 1RDBA 2B5JA 1L5UA 4QPXA 3CFRA 1RT2B 3SJJA 1HARA 1HPZA 2X6SA 3CYMA 4LQ9A 4F4KA 5EWFA 5KFIA 1S1TA 2JC0A 4MK8A 1S0NA 2BE2B 3DRPB 5DG9A 3SPYA 2HNDB 2XY8A 3VQ5A 3FSIA 1T3NA 3HVAA 5JS2A 3G0ZA 2KQ2A 1S6QA 3LP2A 4DS5A 4DU1A 3M9MB 3SUQA 2FVRA 3PR4A 1NK0A 5L1LA 3QYYA 1EX4A 3CDEA 2R2SA 1B92A 1JLGA 1BISA 5CZ1A 4Z4HA 2YKNA 1KSPA 3PW2A 4FW2A 3E01A 3ITHB 4J9RA 3QO9B 4CEZA 1UWBB 1WAJA 4F4XA 1S10A 2GIQA 2C2RA 3DLGA 3SZ2A 3KLFB 3E51A 3ZSOA 4OPKA 4M3XA 4KKOA 3KHGA 4CK2A 4QWDA 4E1MA 1S6PB 2D3ZA 3QEIA 4G3IA 4NCGA 3CJ0A 3TAGA 1D0EA 1TL1A 4BACA 3MFIA 3V1RA 3KHHA 4F2RA 2R7YA 4LSLB 5DG8A 4AH9A 2ASJA 1MU2A 3FFIB 1KFDA 3QETA 3KJVB 1NJWA 3RAQA 2KFNA 1KLMB 4R8UB 2JEGA 3WNGA 2IJNA 2ZE2B 3B6PA 1HQEA 1NHVA 4CJFA 3SQ0A 2XY5A 3FRZA 1A5WA 3LWMA 2FVPA 5DQHA 4FJLA 2XI2A 3IRXA 3HVWA 4NLOA 3TAMA 3LAKA 4CHPA 3S3OA 1UOCA 1JLAA 3BSNA 4FZZA 4KTQA 3K2PA 4DU3A 4O3SA 4CFDA 4KB7A 2HAIA 3OYAA 4OKEA 1KCFA 3CG7A 3VQ4A 1KVAA 3FQLA 4CF2A 4KV8B 1BCMA 4AHCA 3QEXA 2C2EA 4NLTA 5JXSA 1JKHB 4K50A 4FJ9A 4RW8A 2QE5A 3RB3A 4OL8A 3QEPA 5KFYA 4J9LA 3I0RA 3HVRA 2D7SA 4NCBA 3JYTA 4CF1A 5FDLA 5I3UA 4ECSA 1C6VA 1RBTA 4R5PB 3N6LA 1D5AA 3DLKB 5KG0A 3LPUA 4F4WA 5KTQA 2KZMA 3EZ5A 3P1GA 4QW9A 2XC9A 3G10A 1TL3A 4WXOA 1WSGA 4W5QA 1TKDA 3KK1A 3L8BA 1JLCA 4QWBA 1DTQA 2C28A 4EP5A 3O4NA 3V9XA 1IKVB 3SFUA 1WSEA 3MEEB 1N5YA 4IFYB 3O4QA 4PQUA 3MXIA 4XO0A 2GUIA 2WB4A 1LWEB 5KFUA 2IOCA 4TN2A 4E7HA 2D41A 3EPIA 4PWDB 1XHZA 3DMJB 2V9WA 1EETB 2YNHA 3F73A 1ITGA 1HYZA 1W0HA 3KK2B 5J2PA 3OYCA 3G6XA 1IM4A 4Z4IA 2F8TA 4F50A 3NAHA 4FJ8A 3K5OA 4ICLB 1JXLA 4JRQA 3KLHB 1C0MA 1LW0A 4CIGA 4FJHA 1JLQA 4NLYA 4AHSA 1CZBA 3M8PA 4KBIA 3L2WA 4HVJA 4CGHA 3ZT3A 4F8RA 4Q5VA 4EYIB 3PJWA 4ZVHA 4WE1B 2GC8A 4J2BA 4H4OB 3DYAB 4U6PA 3L2QA 3BSCA 4DTXA 5J2NA 4FJNA 2ZKUA 4DSKA 1ZTWA 3GV7B 1C1CB 2ZD1B 5HBMA 4DF4A 1NK5A 1EKEA 3BQ2A 3ZSVA 5F8NA 5E41A 5KT7A 5KG1A 2OZSA 1RT3B 4OGCA 3RB4A 4KHUA 4C8LA 4C8NA 4RW7A 3DLEA 1J53A 1T05A 4J9MA 4E7JA 4MIAA 3OYGA 1XC9A 2R8JA 1HNIA 1RDCA 3T5JA 3V9WA 2WTFA 4YR3A 4XIUA 4CJSA 5CYQA 2UUTA 2G8KA 4CJ4A 1VSHA 2P1JA 3OLAA 4ED0A 5F8MA 3QNOA 1RT2A 3HPGA 4ELTA 2BRLA 4CHQA 1SV5B 4DG1B 4QWCA 4IH5A 4ZPBA 2DFHA 1FK9B 2GBZA 2BE2A 4CEEA 3DRPA 4ID1A 4KFBB 3EYZA 4DFJA 3NGZA 3N6NA 1XHXA 2HNDA 1RDAA 4JS5A 4CE9A 4FW1A 4WZMA 3O3GA 3ULDA 1S9EB 2DY4A 5DG7A 4ZHRB 1HRHA 4B3OB 5KFXA 3CVKA 2Z1IA 3ZT1A 4Q43A 4O3RA 1BGXT 3VQ9A 3AVFA 3ZSZA 1RBSA 3ASMA 2ASDA 3ITHA 3OYDA 2R2RA 3QO9A 3HL8A 1CSJA 1UWBA 5KFEA 3SI6A 5J2MB 2FBVA 3KLFA 1QTMA 4F3OA 1SH3A 4K4WA 4DLGA 5KFLA 4NRTA 2W9BA 1U09A 1T7PA 2PY5A 1S6PA 5KFGA 3WNEA 2V4RA 3IS9B 3MR2A 4H4MB 3B6OA 3PJXA 4Q8EA 4AHRA 1HQUB 1RTJB 3PO5A 4LSLA 4DFPA 3FFIA 3U3YA 3KJVA 1KLMA 4R8UA 4NYFA 2ZE2A 1CZ9A 4ECWA 4ECQA 3LZIA 4ZTJA 3OL8A 1REVB 1SH2A 4E89A 4ZVEA 4KE5A 3H40A 3NKYA 4UQGA 1ZBIA 1RBUA 1VSDA 1ZTTA 1N48A 1EP4A 5EWGA 1RTHB 1N4LA 1S0MA 5HP1B 4KRFA 5KT5A 2NUBA 4NRUA 2VWKA 1TK0A 3OY9A 1RT5B 2AU0A 2RN2A 4O0IA 4ECXA 3MECB 1NJZA 2C22A 2VA3A 3PY8A 3K59A 4KV8A 1X9WA 3P83D 3QNNA 1J54A 3QIPA 1JKHA 2F8SA 5C42A 1IH7A 4X2BA 4PY5A 4CF0A 5F8JA 4KHRA 3IN5A 5KFFA 4IBNA 4HTUA 1R0AB 1SKWA 2AGQA 2VA2A 3H5SA 4E7LA 4R5PA 1S9GB 3DLKA 4CGJA 3IG1B 4BDYA 5DLGA 4RU9A 3M8SA 4Z4CA 4J9SA 4IR9A 2HHQA 1ZBHA 5F8IA 3MXMA 1I3AA 2YNIB 2FBTA 3PW5A 1IKVA 2RDIA 3MAQA 1L3TA 3MEEA 4KHNA 4IFYA 4CJWA 2JLEA 4DL7A 4FJJA 4ECVA 1WAFA 3BQ1A 3OYJA 4KPYA 1JXBA 3KNAA 2ATQA 4QW8A 1LWEA 4RW9B 2B43A 1TK8A 4PWDA 4IH6A 3DMJA 3TAPA 1QS4A 1NK4A 2UUWA 3ICLA 1EETA 3CO9A 3OYFA 3MR3A 3NGYA 4CEQA 4WYWA 3QESA 4YR0A 4HKQA 2B6AB 5KT4A 3KK2A 5HROB 3K5MA 2HHTA 4B08A 3Q8QB 3VQQA 2YNFA 4K4VA 3QERA 3M8QB 3OLBA 4KSEB 3S3NA 5KFHA 4ICLA 2YHBA 4J2EA 3D28A 4H54A 2FJWA 3KLHA 2XCAA 2XCPA 3TABA 1XI1A 1KFSA 3OYIA 5KG3A 1KTQA 1BIUA 4K4TA 3LP1B 3DOKB 1TKXB 3BQ0A 3SYZA 2W9CB 2BRKA 4RG8A 1CXUA 1CLQA 4K8XA 2AJQA 4BDPA 4DLEA 3EY1A 2O5DA 1S1XB 5D3GB 5CYMB 3A2FA 4CEFA 1MMLA 4WE1A 4YMEA 4JRPA 3MR6A 3DYAA 3AO2A 1RDDA 3HVTA 1VSMA 5KGWA 4FM2A 4NLUA 3OHBA 1VRTB 2HNYA 4I7FB 3AO5A 4FLZA 4NLRA 4RNOA 3SQ4A 2YHAA 1C1CA 2DTUA 5KFVA 5L1JA 3CIZA 2ZD1A 3PUFA 2OZMA 4IG3A 2OYQA 4K4XA 4CJRA 4IDKB 3TWHA 2D0CA 3I0SA 4IKAA 2XWYA 5FRNA 4M94A 2OA8A 1K1QA 3TR8A 4C8OA 1LAVA 4CHOA 4KAZA 1BQMB 1LV5A 1RT3A 3DM2B 3PW4A 3P5JA 2OPRB 4JS4A 4DSEA 2QV6A 3H08A 3TVKA 4CJTA 1RTIB 4ZP9A 4O4GB 2W9AA 2JEIA 3CJ5A 4MKBA 3SQ2A 5KFZA 1S1VB 2J6SA 3TQ1A 4K4ZA 4IG0B 4E3SA 3V4IB 5KFWA 5CY4A 1SV5A 3VQ8A 3PVXA 2WONB 3L2UA 1NOYA 2E9TA 5KG5A 4DG1A 3NGIA 1RT6B 2EHGA 1NK9A 1FK9A 4DMNA 4FZYA 4PUOB 4KFBA 4DL6A 3I5CA 1O1WA 4NLDA 2W42A 1S9EA 3U6FA 1HJRA 4ZHRA 1IKWB 2W9BB 4B3OA 4F3TA 1Q9YA 4OPJA 4DQPA 3PV8A 1W25A 3AVBA 3DLBA 2E6MA 3THVA 4KB0A 3V1QA 3HP6A 1LAWA 5KFAA 5L1KA 3VA3A 3NF7A 4DQIA 4HCBA 2IA6A 5J2MA 3AO1A 2D0BA 1NHUA 1LWFB 4LSNB 4QOZB 3L2RA 1RAJA 3GIKA 4J9PA 4XPCA 3CWJA 3M9NB 4DFMA 3SNNA 1EP4B 2IM0A 4KI6A 3RWUA 3IS9A 3D45A 4H4MA 4DTMA 3DI6B 1QAIA 1S1UB 1RT1A 1HQUA 4DL2A 5I42B 3LZJA 1RTJA 3VQBA 4DFKA 4FLUA 3DLHA 3KMSA 1RT7B 3UPFA 2PYLA 2W8KA 3ZSXA 1JX4A 3RAXA 1RCHA 1JLBB 2HHXA 4M3ZA 3HJFA 3QIPB 1REVA 4GC7A 3NAIA 5C42B 5KT2A 1VSJA 4E0DA 4FJGA 4E19A 1RILA 1RTHA 5HP1A 4CJQA 1NKBA 4XPEA 2PZSA 5KG6A 1RT5A 4ED8A 4WFYA 3BGRB 4CIFA 3MECA 3CM6A 3KK3B 2BQRA 4CJUA 4RNMA 4F4YA 3ZT2A 2G8IA 3K57A 1CXQA 2G8UA 2OPQB 4HYKA 1KLNA 4DF8A 1I39A 4ED7A 3H4BA 2BANB 1T03B 4IKFA 4U7CA 3H59A 2HVIA 1R0AA 3ZT4A 2VG5B 4ED3A 3CFOA 3VQDA 1S9GA 3C95A 4CECA 1TAQA 4J9OA 4CJ5A 2FVQA 3EZUA 3SPZA 3IG1A 1RTDB 4CHZA 3V81B 5KFPA 4K4SA 1VSEA 1BQNB 4G1QB 3OS2A 3RB6A 2YNIA 4ELVA 1S48A 3D0PA 2YNFB 4KI4A 3BJYA 1LWCB 1SKRA 2XGPA 5T7BA 1Z26A 1SL1A 3C6UB 3KLIB 4Y1DA 4RW9A 5JS1A 3HPOA 1TKTB 3D5MA 3CDWA 4TY8B 5DMRA 3NF8A 3VQAA 4CIEA 2B6AA 2R2UA 3PHEA 4YFUA 3V6DB 5HROA 3VQCA 4NCAA 1X1PA 4B9LA 4NZ0A 3M8QA 3GIMA 4DL5A 4CJKA 1W9HA 4DTJA 4PA1A 1XWLA 1TQLA 3TAQA 2IBKA 2V4QA 4URGA 3HVTB 5KRSA 4FK2A 4BWMA 3KD1E 2HNYB 5SWMA 4M3TA 2RF2B 4ED2A 3LP1A 2WRMA 3DOKA 4MQ3A 1TKXA 2OPPB 5J1EA 2W9CA 3AVNA 1ASVA 4BE2A 3KOAA 2XO7A 4IG3B 4BDZA 4HCCA 4RW4B 1KHVA 3I0SB 4Z4FA 1S1XA 1NOZA 5D3GA 2BGGA 5CYMA 2AX0A 4FJMA 2J6UA 2A1RA 1S49A 4JV1A 3NGDA 3K5NA 3JSMB 3M9OB 2W7PA 2IDOA 2XY6A 4O3NA 2HWIA 4RW6B 1VRTA 3MR5A 4I7FA 4ZVFA 4O44B 4DS4A 3CDUA 3L3VA 3T5LA 2ITGA 5C24B 2ILYA 3OYNA 5KI6A 3RBDA 4HUFA 2DPJA 3BREA 3QIDA 1C0TB 2HHSA 4IDKA 3SI8A 3UDLA 3OL7A 1YTAA 4Y2CA 3HP9A 2W7OA 3OL9A 2Y1IA 4B9MA 2JEFA 1ZBUA 1BQMA 4TYBA 3DM2A 4ED6A 2OPRA 3T3FA 1L3UA 4LH4A 4DTNA 3VQPA 4KHYA 3I5AA 4CFCA 1RTIA 3KIOA 2D0AA 2HHVA 5KFRA 4NYNA 3ZSWA 4Y2AA 2Y1JA 3TAEA 4O4GA 1S1VA 5EU7A 1U45A 4IG0A 3V4IA 5DK5A 2FVCA 1J5OB 2VG7B 4N76A 4FS2A 4DQQA 5CZ2A 3KLEB 3GV5B 2WONA 2ASLA 4FJXA 4RNHA 5F8GA 4QWAA 5DQGA 1TV6B 1RT6A 1S1WB 3VQ7A 2HWHA 1TK5A 2Z1HA 4JLHA 2ETJA 4FYDA 4PUOA 3C6TB 3OHAA 4J9KA 4FLVA 4NLXA 2XRIA 2AGPA 1Z4UA 3S3MA 4OLAA 1ASUA 3AVKA 1IKWA 3BDPA 4B9UA 1ZBFA 2WHOA 3RMDA 2KZZA 4QCLA 1F21A 1BL3A 1RT1B 1BIZA 3AA2A 1KHWA 3N6MA 4NYZA 3BR9A 1U48A 4KTZA 1ZBLA 3MTKA 3BSOA 4IQXA 2D5RA 1LW2B 3NAEA 3CJ2A 3TI0A 5F8HA 1LWFA 4LSNA 1GOAA 1HYSB 2GIRA 4N47A 2ZQBA 4CCHA 3OSNA 4E7IA 3Q8SB 4CF9A 4FS1A 1FKOB 4E7KA 3DI6A 1S1UA 5KG7A 5I42A 4ECZA 4MIBA 3KHRA 1JL2A 4Q44A 2HNZB 1RT7A 2DFFA 5FROA 3OYLA 5DLFA 1JLBA 2XGQA 4QWEA 5KT3A 2CJQA 5KFCA 3BSAA 4CFBA 1QQCA 4YP3A 4ECTA 1GX6A 4OLBA 3NCIA 4OVLA 3GYNA 3RMAA 4CJEA 3IGNA 3BGRA 4FK0A 4CESA 2X6NA 1YVUA 4KHSA 3KK3A 2YNGB 4Y3CA 3CM5A 4N41A 4WFXA 4ECRA 4BWJA 3OYEA 1NK6A 3IAYA 3NDKA 3PX6A 4CFAA 4I9QA 4CJVA 5KFKA 3RRGA 2OPQA 3SUPA 4J2AA 3LALA 1S9FA 5KFDA 2BANA 1T03A 1XR5A 3GIJA 2HVHA 4LY7A 2R8HA 4ZPCA 1UA1A 2VG5A 3MFHA 4GW6A 1VSKA 4WZQA 3CJ4A 2R8IA 1VSLA 1J9AA 4W5OA 4F2SA 3KHLA 4ZMMA 4CHNA 1RTDA 4DL3A 3V81A 3NHGA 2UVRA 1BQNA 4MH8A 3FDSA 4G1QA 4CJLA 1RA6A 4M3UA 2E9RX 5C25B 3V6HA 3DRSB 3GILA 4K4UA 1LWCA 4LH5A 4O5BA 4ZTFA 2KW4A 4IOBA 3C6UA 4Q0BB 5KFSA 2IC3B 2EX3A 5KG2A 3KLIA 2G8HA 4TY9A 3NFAA 2BQUA 1QSYA 4EBEA 3K5LA 1RDRA 3U3GA 1TKTA 1NNDA 2FBXA 4B9SA 1JXEA 5J1EB 3MEDB 4CJ3A 4TY8A 3M8RA 3SQ1A 4LD0A 3UIQA 5EWEA 3V6DA 2RDJA 3LPTA 4B9VA 3ZSYA 4B8CA 2Z1JA 2HHUA 1S5JA 1RNHA 4YNQA 3DRRB 1Q8IA 2RF2A 2AX1A 3OS1A 1QSLA 2OPPA 4ZVGA 4ZP6A 1S97A 2A1SA 2O4GA 5C5JA 4RW4A 3UR0A 1WN7A 1QE1B 2R2TA 2PYJA 2BQ3A 2FBYA 2P5OA 2HB5A 3NF9A 5KFOA 3RTVA 2I1RA 1RA7A 3L3UA 4C8MA 3JSMA 3OL6A 4Z0UA 4TQRA 1WSJA 3WNHA 4RW6A 4H8KA 4O44A 4CGFA 5C24A 3PX4A 2RPIA 4BE0A 3KLGB 4K4YA 4CGDA 3NE6A 1Y97A 1C0TA 3ISND 3DLRA 3OSPA 3G86A 1VSIA 4Y1CA 4NLGA 3G6VA 4ED1A 2E9ZA 4EZ6A 4CGIA 4DTPA 4MFBB 1HMVB 3L2VA 3VA0A 3QLHB 5L1IA 3I8DA 4DSLA 4ZPAA 4IFVB 3C94A 3TARA 2IAJA 1T94A 2YKMB 4FM0A 3KD5E 4WXWA 2VWJA 3HK2A 4JV0A 5KFMA 4OJRA 4FCYA 3LP3A 3OYMA 1IKXB 1C2PA 2R8GA 3EPGA 1JLEB 1HYVA 2ALZA 1BHLA 3TANA 1J5OA 3MEGB 2ATLA 2VG7A 1C1AA 2IGIA 2OPSB 2RKIB 3KLEA 5DGAA 4BE1A 3HSTB 1TV6A 4K8ZA 1S1WA 1DTTB 3IGVA 3GIIA 3QEVA 3QGIA 4ELUA 3NBPB 4EZ9A 1ASWA 3C6TA 1U4BA 5KFBA 2FC0A 1UAXA 1ZYQA 5F9NA 4FLTA 1BI4B 5K14B 2D3UA 3NMAA 4KO0B 5DGBA 1UA0A 4J9QA 2VG6B 1U49A 5KT6A 4L8RB 2WOMB 3CQ8A 1HNVB 4FXDA 1LW2A 1SKSA 1K6YA 5F9LA 3QGGA 1TGOA 1HYSA 1JLFB 1KRPA 4JV2A 4KHMA 4EO8A 4DSJA 1TKZA 4EO6A 5KFNA 1TVRB 4RNFA 3AA3A 3QZ7A 5JUMA 1FKOA 4FLXA 3OVNA 3FQKA 3H5UA 3KTQA 4NLQA 3OS0A 5KGXA 4DL4A 2IM1A 3KKSA 3V6JA 4DWIA 4ECYA 3LP0B 2HNZA 3HYFA 3HM9A 3T5KA 3QZ8A 5SZTA 5HRSA 3H5YA 4TYAA 3PR5B 1BCOA 2C2DA 4IRKA 4KTWA 4CEBA 1FKPA 3HT3A 1SL2A 4HUGA 4Z4EA 3PW0A 4CK3A 1D8YA 4CJPA 1U47A 4FJKA 5HLFB 2CKWA 1JL1A 3HXMA 1VRUB 2WK4A 3NL0A 4OGEA 1YTUA 4DTSA 3MXJA 2W8LA 4KB1A 4IRDA 3G6YA 5EUHA 4NLVA 2YNGA 4URQU 3SV4A 4FVMA 2HMIA 1QSSA 3ZSQA 3LDSA 4LQ3A 3AA4A 4IRCA 4EP4A 1VK0A 1U04A 1C0UB 4I2PB 2X74A 4IR1A 2FVSA 3RR7A 4O55A 3AVAA 4GC6A 2XHBA 3OJSA 1DLOB 3Q8RB 3O3HA 1C1BB 3GV8B 2IM3A 5F8LA 3V9UA 1GOBA 3HKWA 4AHVA 2KFZA 3RBEA 4ECUA 1NK8A 1NK7A 4Q45A 4CEDA 1K1SA 4I2QB 3K58A 3ZT0A 4B9TA 1YVFA 4KREA 1B9DA 5C25A 3DRSA 1IKYB 4EYHB 3NH0A 2P51A 5J2QA 2OH2A 4W5RA 3NH1A 4Q0BA 4NLSA 2IC3A 4ID5B 3NF6A 1N6QB 4CEOA 2GV9A 3AV9A 3AA5X 2KTQA 1RT4B 2AGOA 3DOLB 4M3RA 2P5GA 2DPIA 3MEDA 4TSXA 4E1NA 4ZPDA 4Z4GA 1A5XA 3PZPA 2Z1GA 3VQSA 1KVCA 1NJYA 3O3FA 3RR8A 2LSNA 2Q3SA 2R8KA 3MF5A 1SUQB 5EDWA 2I5JB 2QK9A 3SUOA 4NLPA 3V6KA 3DRRA 2XI3A 4M41A 5KFQA 1NKEA 2B5JB 1KVBA 3AO3A 3HO1A 3SV3A 4EBDA 1L3VA 2G8WA 2O4IA 4M45A 2JC1A 2IMWP 2B4JA 1QE1A 1EXQA 2HHWA 1HPZB 4EEYA 3VQ6A 1IG9A 5KFTA 2JGUA 4F4ZA 3V9ZA 1S1TB 2JEJA 4WYLA 4DSFA 4HHTA 2IJFA 4MK7A 2FJXA 1G15A 3PO4A 4FK4A 4AHTA 2IAJB 3RB0A 4OKKA 1S6QB 3LP2B 5FRMA 4DSIA 2FLLA 4GMJB 4EBCA 3KLGA 1JLGB 1WLJA 2FLPA 1VSFA 2YKNB 1D9FA 1Q9XA 3S9HA 1D9DA 4N56A 3E01B 3CFPA 4FLWA 3VQEA 4MFBA 1HMVA 3DLGB 2E4LA 3AVCA 3QLHA 3H5XA 4AHUA 3AVHA 4IFVA 4TLRA 2F96A 1X9SA 1X9MA 3AVIA 2G8FA 4JUZA 4KKOB 2YKMA 3ALYA 5L9XA 1S0OA 4RUCA 4NCGB 3PX0A 1QUVA 2AWZA 1GX5A 1TL1B 1IKXA 1JLEA 5T14A 4M3YA 4AILC 3GQCA 3SCXA 3MEGA 4M3WA 4W5TA 1MU2B 2OPSA 2RKIA 4TXSA 3AVMA 3H98A 4ZP7A 3QEWA 1WSIA 3WNFA 3ISNC 3OJUA 4N5SA 1HQEB 2X78A 3NH2A 2UVVA 1DTTA 3Q8PB 2FLNA 5HRNA 2QKKA 3NBPA 5KFJA 1RBRA 5HRPA 1RBVA 4CHYA 4M42A
chains in the Genus database with same CATH superfamily
1JLAB 2LA4A 4NLWA 4OV6A 1TKZB 2XHWA 1QAJA 4DZ6A 3MAAA 3MWTA 3MCSA 2YX7A 1BI4A 2CNNB 1XR6A 3D6MB 4WTYA 2E5IA 1TP7A 3E66A 4AXIA 2VG6A 4RW8B 3NCQA 1IWGA 4KHQA 2WSFC 2NUHA 3M6UA 5FDLB 4LF4F 2H4YB 1FKPB 2Q1NA 2JL9A 3C2PA 2EI5A 1J6ZA 1Q18A 4LIRA 2QIFA 1TL3B 4A59A 3M2VB 2BA9A 4X4TA 2CJAA 3SEOA 1S12A 3GFXA 3I31A 1JLCB 3DDKA 4M63A 4GKJK 2HMIB 5LXYA 3AFGA 3SCIE 5HRRA 2Y0SD 4O3PA 5HQLA 4G1IA 5HLFA 2IS3A 3C15B 3LWLA 4JN4A 5DM7Q 3ZCMA 1HWJA 4USIA 2FDNA 4M95A 1K0TA 4JI6F 3RMBA 1FKAF 5BXIA 5H9EK 2UVWA 3BN7A 1L3SA 3C16B 5ETTA 4RBVA 1H2VZ 2U2FA 3IWLA 3G6ES 4IH7A 4WIIA 2HQ3A 1U6BA 4YR2A 1LW0B 4QBUA 1WNEA 2QXFA 3D1QA 1EKRA 3M7VA 1YHQN 4KHWA 4I2PA 1J5EJ 3CJ7A 1M1KT 2VPXB 5K8OA 3NGTA 4LF5J 4PWUA 2NZTA 4DR1F 1C1BA 3QJPA 2QKBA 2NXUA 2IM2A 5IC6B 4O3QA 4GO7X 3MMJA 4F02A 1JIHA 3HTVA 3T1AA 1Y5LB 5HMWA 2ILZA 2FJVA 3IBCB 4FJ7A 3GR1A 3SQGA 2V2KA 1N56A 4WFNL 4B17A 5HBMB 4ID5A 1D1UA 5B0EA 3BKUA 3ISZA 1RT4A 1HBUA 3H42A 2YVSA 3MX5A 1HL6A 1AB8A 4DEZA 1UJ5A 3J7AP 1M5KC 2BBEA 2WSCC 3DU6A 4H5WA 2N82B 1LXNA 4XDDA 1NGDA 1RBLA 3I4PA 3QMQA 1IBLK 2GAHC 5H1SQ 4KHPJ 1QZ5A 4UY8O 3H20A 5GAEI 2DNMA 4QIEA 3V4MA 5CYQB 4WP8A 1RDBA 3CFRA 1T6CA 2J0XA 3SJJA 4BC4A 1N36F 3LDPA 2OTLN 4F4KA 5EWFA 2NYHA 5KFIA 4CZGA 4MK8A 4KT0C 3DRPB 2MKSA 1LXJA 2HNDB 2XY8A 3VQ5A 4LR8A 4JK7A 5ITHA 3G0ZA 2KQ2A 1S6QA 4E98A 2FGCA 3QYYA 4MKVA 1EX4A 5C2DA 4WQ4A 1BISA 5CZ1A 2YKNA 1KSPA 2Q6BA 4JHDA 4JBCA 3ULHA 3ZZUA 2L9NA 4DB3A 3G2XA 1R0CB 3AOBA 2QWPA 2P5VA 3GG1A 3KHGA 4CK2A 5B7WA 4NCGA 3CJ0A 3TAGA 3EZWA 2BV3A 2W4DA 1KOOA 1HHTP 5G4DA 4BRDA 4LSLB 2EFGA 1VQ9N 1VAZA 3VF2A 2IJNA 1NHVA 4GKKK 4L3QA 1A5WA 1HI1A 5EX0A 2FVPA 2MY8A 1VIXA 3CMES 3HVWA 3VGVA 1UOCA 3BSNA 3JSYA 1O13A 4YOEA 1QJHA 1NGGA 4MTPA 3OYAA 2VBXA 1KCFA 3TQEA 3CG7A 3VQ4A 1U1NA 5H9EJ 3FQLA 4CF2A 2YPYA 1NM1A 2OGUA 4NLTA 5JXSA 1U0HA 4K50A 2HKEA 4LBHA 3QEPA 1NAQA 2DHAA 2XZDB 4CZKA 4CF1A 1C0GA 1DT9A 1H38A 1D5AA 5A6PA 2W2QP 2RHKA 3LPUA 4F4WA 2JZ5A 1TUYA 1PJ7A 4PXDA 3KK1A 4GO5X 3O4NA 3D2EA 4OZLA 3CULA 1N5YA 3PRDA 4PQUA 3MXIA 4LUBA 2WB4A 2P9CA 2D4WA 2HHPA 3EPIA 3D54A 3CCQS 4PWDB 3ZYYX 1XHZA 1HJOA 2MY7A 1W0HA 3KK2B 4Z4IA 1YIJS 3EGNA 4ZOSA 3VEXA 3NAHA 3LW5C 1GLLO 3RW7A 1WBDA 4IEIA 3G6EN 3TWZA 3LDOA 1JLQA 1HNXF 1IBLJ 3POTB 3QJLA 1HFEL 4LF2A 5ELZA 5HAOA 4JV5F 1BU6O 4XH1A 4CGHA 3C14A 4YEAA 4HHJA 4ETZA 3T9NA 4F8RA 3QRQA 2VGNA 4NA3A 4WFBQ 4WE1B 5CD4H 2GC8A 4H4OB 3DYAB 1ZZFA 3GG4A 1UEVA 2VKZG 4DTXA 5J2NA 4H4KA 1S77D 3GV7B 2PA8D 3AGRA 4JI0K 1F2GA 1EKEA 3DOMB 3X1LB 2V8PA 1F5BA 3IR6B 1X60A 4NEZA 1UTAA 4DR2J 3FR0A 2AYMA 3RB4A 3FFKB 1FF2A 1B0VA 4RW7A 3CD5A 5HK4A 1W2BR 4J9MA 1VBYA 4E7JA 2E29A 7FDRA 1XC9A 1RAHB 5LMNJ 1KQKA 3MPVA 3V9WA 4M5LA 3A5MC 4YR3A 4XIUA 4WU3A 2E2PA 4CJSA 3RW6A 2XMKA 2BKPA 2MLXA 2PIIA 2CPIA 1E6VB 1NNEA 1JNRB 4ELTA 3P4IA 3LF0A 3ENOA 1AROP 3G87A 4DG1B 4QWCA 2KG0A 1SS6A 4K2JA 4BG8A 4ZPBA 2DR8A 2GBZA 1H7WA 4FKYA 3VTIA 4CEEA 1VHXA 4NXMF 2MZJA 2GJIA 2VD3A 1S9EB 2DY4A 4ZHRB 1S72S 1ZOTA 3BS9A 5KFXA 3CVKA 2ADCA 1Q5VA 3TP2A 4DV0J 2RUGA 3ASMA 1V5VA 3T41A 3A8YA 3ITHA 1VRQC 4ER8A 3QO9A 2CWKA 2GJ2A 1UWBA 2ZOGA 3KLFA 4K4WA 4DLGA 2XEXA 2V8DA 2H9ZA 1U09A 2PY5A 1S6PA 3WNEA 1WHXA 2F7VA 3ADAC 2UV8A 5K20B 2K06A 3B6OA 5M1FA 3PJXA 2R9LA 2P9NB 3OFFA 4P72A 1RTJB 3PO5A 4DFPA 3QT5A 1S3XA 3UKRB 3KJVA 4F26A 4BRPA 2RQ4A 4R8UA 4JEPA 2GGPB 2V8HA 2ZE2A 1OSCA 5M1OA 4LF9F 4R79A 3LZIA 1REVB 1VLOA 1SH2A 4E89A 4KE5A 3ZO7A 3H40A 2VJUA 1RBUA 2OEMA 1VC0A 2IA0A 1VSDA 2Z2YB 4A5BA 1EP4A 2LA6A 1RTHB 1S0MA 5HP1B 1FX2A 4FZVA 4QR1A 4ANCA 4LF4K 2UP1A 1SC6A 4NRUA 2VWKA 1TK0A 2RIJA 1HKCA 1RT5B 3CMEN 3TEHB 3CJRA 4BRNA 1IBKF 3R7SB 3VEOA 4HACA 4ZJOA 2WVEA 1KD1O 4CT8A 4PRFA 4N77A 3ONQA 3S1TA 4V1Ak 3O8MA 2F8SA 4LF6F 1HPMA 4CF0A 4DX5A 1DGKN 1VBZA 5KFFA 1SKWA 3K7RA 4P9SA 4R5PA 1S9GB 1UJ6A 1LK5A 2COLA 5DLGA 4RU9A 1XBWA 3M8SA 1H2TZ 3FEZA 4Z4CA 4JI6K 2QZ8A 2HHQA 3EDRB 2I6WA 1IJJA 1HX1A 1YRUA 2MSSA 1KAYA 1PBUA 3VGUA 4IFYA 1XNRF 3R5BA 4DL7A 2B4OA 2VZ9A 5DO2A 1VJQA 4DV3J 2LVWA 2ATQA 2GWKA 3I82A 3JTOA 1U02A 2WBRA 4IH6A 3SCKE 3DMJA 5C15A 4JI0J 1EETA 2CPDA 3OYFA 4CEQA 3CCQN 4WYWA 2B6AB 3LH2S 2HGNA 3K5MA 2MQ8A 3G71S 5M2UA 3VQQA 2P9SA 2YNFA 4ZVSB 3THTA 3TUJC 4OI0A 3FUYA 1K8KB 3D28A 4H54A 4IWVA 3NXZA 3TABA 6FD1A 5CCLA 4IO8A 5KG3A 5B09A 4K4TA 3OW2R 2E2NA 2BZ2A 1ZC6A 4RG8A 1GK8A 3FZMA 5TKYA 1CXUA 1S4EA 3CF5L 3DFEA 4K5RA 4OX6A 1K73O 5D3GB 1Y10A 3WHIA 3AB4B 2MEWA 5IV4A 2W41A 4JRPA 4W98A 5LJVA 1VSMA 4FM2A 3NVMA 1WI6A 2HAFA 4JI8F 3TSQA 1GQEA 2ZD1A 1OVQA 3PUFA 2OZMA 2MKCA 4KY3A 4ENOA 3IUCA 4IDKB 1QUPA 3TWHA 3QJJA 4IKAA 2QLBB 4UT4A 4M94A 3AA8A 3VAFA 2F1FA 4WPAA 1LAVA 1BQMB 2LLZA 1LV5A 2FJEB 4WFAL 3PW4A 1EQYA 4DSEA 4KH5A 3TVKA 4XH4A 1TL4A 1G4CA 2NRRA 3M2UA 3B54A 8ATCB 3CC2S 4LSZB 2UYTA 3SQ2A 1S1VB 2J6SA 3HZGA 4K4ZA 3D68A 4IG0B 5D4LA 2J8AA 1JK9B 4NYPA 3L2UA 2W2MP 2ZJRL 1RQ0A 2XLIA 1DEJA 1BD6A 2OMOA 4OYBA 1FK9A 5CR4A 1JNZB 2O8BB 2DD8S 1KQSR 4KIAA 4ZPVR 1NDPA 4S0MA 4C8ZA 4NLDA 4F04B 4ZVOB 2XMWA 2VC1A 3US5A 2DGXA 4LF4J 4DV1K 3CJKB 1UEUA 4DR7F 4RWXA 2MYFA 3PV8A 1S72N 3DLBA 2E6MA 1N0UA 1Y11A 3W66A 3VAMA 2DJWA 3L7PA 3HP6A 2RHQB 4BRAA 4HCBA 2BJ7A 3UVJB 3AO1A 1RAJA 1BG3A 3VGMA 4PKGA 3WXLA 3CWJA 3R5GA 3MCNA 3IR7B 4DFMA 3SNNA 2OLWA 2IM0A 3H1VX 4B9QA 1GXLA 3MZIA 3RWUA 2WW4A 1GLEG 3DI6B 1QAIA 4QIVA 1HQUA 4DFKA 4FLUA 3DLHA 2ZJQQ 3UPFA 4AE5A 1CQNA 1JX4A 1VHFA 2PA3A 1YJ7A 4M3ZA 3HJFA 2QL9B 4QR0A 3O80A 1NMEB 3NAIA 3S6EA 1VSJA 2HK3A 2BW2A 1ACMB 3UE2A 4B3TF 2BM1A 3N4WA 2A2CA 5K9FA 5DDOC 2QW9A 3TW0A 3EE3A 2NRWA 2PZSA 5IT4A 4ED8A 3H90A 4PL8A 3A5LC 5GIOA 3MECA 3O9SA 2KXHA 2MZ1A 2FC9A 3EMTA 2V94A 1N5QA 2C3PA 2N4DA 2G8UA 3JTPA 4DF8A 1T03B 5A2QO 3O9UA 2VYPA 4ED3A 4CD3A 4ED5A 1CULA 4JKDA 4LC9B 1MWKA 2FVQA 2NXEA 3W5ZA 3BZKA 5E5NA 1S59A 4FNHA 3RRKA 4RBTA 3EVWA 1TL7B 4YOXA 2XMMA 4M63C 3I8BA 3W2VB 2YNIA 3MM5B 2BUNA 3MD1A 3BJYA 2CQHA 2VQFF 4YB5A 3NGUA 4A8FA 3UW1A 1DY3A 4RW9A 4AUKA 1HNXK 4WTOB 3HPOA 1FNXH 1TKTB 4OX9J 7FD1A 3C7NA 3NF8A 3SSSA 3OXFA 2E5HA 5HROA 3VQCA 1X1PA 1G7CB 3PG9A 1XERA 2YCHA 2CQIA 4IDHA 3G71N 3TAQA 2JFDA 3A8KA 3VQTA 5KQDA 1FD2A 3TUPA 1D3WA 2N3LA 4M3TA 2RF2B 3LP1A 3DOKA 5CZVA 2W9CA 5J1EA 4DV2J 2O1PA 2WVFA 5FLXU 2KLAA 2A6MA 5LJ3Y 4LVOP 2C2KB 1YJUA 4RW4B 2O8FB 1KHVA 4OI3A 2BGGA 5CYMA 3R8YA 3NGDA 1RJJA 2XULA 2IDOA 4O3NA 3PIOQ 2HWIA 4RW6B 3SLCA 4YS2A 1VRTA 2DY1A 1HHQA 1LNQA 4DS4A 2ZGYA 3CDUA 3T5LA 4BC5A 2CNLB 3OYNA 1S76D 3DRYA 2CZVC 5I4MA 2DPJA 5G0RB 1VQON 3GLJA 1C0FA 4EHTA 3TJ8A 3OL7A 4DV1J 4JKGB 1YTAA 4Y2CA 1WEZA 2W7OA 1M1GA 2EPIA 4TYBA 2HZCA 3DM2A 2CYYA 3L3CA 3SSRA 4DTNA 1TUUA 3VQPA 1X5OA 3I5AA 4BC7A 1RTIA 2E1ZA 2D0AA 2NXJA 4BR5A 4NYNA 1TU0B 3ZSWA 4NXMK 1LFPA 3T1YF 1XNQK 3JQKA 4LT6A 1WG4A 1U45A 4Z94A 5ETRA 2FVCA 3PEHA 1J5OB 4FS2A 1SQGA 3PDNA 4DV6F 1X4FA 3BKTA 3Q23A 2ASLA 2L48A 2LEPA 5DQGA 1TV6B 3VQ7A 2HWHA 1TK5A 3FSYA 4FWRA 4CTAA 1FA0A 4NLXA 4YB7A 2AGPA 4DUZF 1SJ3P 4OLAA 3BDEA 2ZH2A 4JKHA 4UQTA 3VAHA 4WQ4C 3RMDA 1EQMA 1WC6A 1RT1B 3AA2A 1RWKB 1AW0A 1Y7PA 2J0WA 1VQKS 4I67A 1ZBLA 3MTKA 2P9KB 2JDJA 4KPCA 5LJ5Y 1LW2B 3TI0A 3MUMP 4LSNA 1VQ7S 4WU2A 4GVLA 1ZM3A 4N47A 1HKBA 3MMBB 4CCHA 2CA9A 3H3NO 2ROEA 3MCMA 1K47A 1FKOB 3CCUS 5KG7A 3A5OC 2GTDA 5I42A 2IBOA 1KR4A 1YRXA 3O3LA 5GAHU 1JL2A 5FROA 3OYLA 1KQGB 2GHVC 5L9NA 4QWEA 5HATA 3BPDA 4LF6K 3LDLA 4CFBA 4DCPB 2JVOA 4Y65A 4ECTA 4OLBA 5A8WB 2A40A 3NCIA 2CADA 4MYTA 3H45C 4C0BA 1PO6A 2UXBF 1HNXJ 1JJ4A 1RUSA 5BYRA 3RMAA 2DISA 4CJEA 3MM8B 5DDPC 4CESA 3V5RA 3KK3A 4FPRA 5AR0A 3O5TB 3BGUA 2KB2A 4I9QA 3A8JA 1N0VC 2ZVIA 3SUPA 3QFWA 1XNRK 1UPPA 4NWBA 1S9FA 2ROGA 4JI7F 5GIPA 3BPSP 1X9JA 3R7NB 4X66F 4LY7A 2G2OA 2R8HA 2QEXS 4J7CA 4J8FA 3CJ4A 1VISA 4OYMA 3Q83A 4Y2MA 4W5OA 5GAGP 1ZAVA 4RLEA 4JAXA 1RTDA 4AL6A 2HF4A 3NHGA 3CPWM 2A18A 2DITA 1YZ7A 1BQNA 3ULEB 4G1QA 3D2FB 3F41A 2XYHB 4CJLA 4QYZK 2E9RX 4M3UA 3SCJE 3F0NA 4K4UA 4DPYA 4ZTFA 2E5GA 3AXKA 5IFMA 3C6UA 4Q0BB 3VF0B 4WCEQ 2G8HA 3SAFA 3K5LA 2XS5A 4C7QA 1VK3A 3HBTA 3U3GA 3UCGA 2FBXA 3VZIA 4LD0A 2ZZTA 3K8VA 1Q78A 5EWEA 3KZBA 2QTDA 2RDJA 3KJFB 3LPTA 1IBMK 5I9EB 5AJ3F 5GADI 4OZNA 3TZWA 3ZSYA 3HSDA 4B8CA 3J7ZT 3MN9A 1T3VA 1UMJA 3PYDA 3OS1A 1FWKA 4DN0A 2FGOA 2MZQA 1F3VA 2Q31A 5CHIA 4ZVGA 2C3YA 1XNQJ 2A1SA 1AZSB 2CRLA 2VKRA 1WN7A 1KP6A 2PYJA 1IR0A 5I3QA 1MDUB 3OBWA 3J81O 1EHWA 2V51B 1Q8BA 4C8MA 1FDBA 4IOAL 4TQRA 1EO1A 1WSJA 3WNHA 3WC2A 4H4KC 4RUHA 3WEEB 4JKFA 4O44A 5ETKA 5FLXY 2YWEA 2GX8A 3F2KA 3PX4A 2RPIA 4UUWA 1MN9A 4CGDA 3NE6A 4X65K 1C0TA 3ISND 4FOEA 1Q82T 3THPA 2CQPA 4AQYJ 3C65A 4USTA 5M1QA 1VSIA 1Q4RA 4Y1CA 4NLGA 2DNKA 4MFBB 1CS4A 1RWMB 5L1IA 2FSKA 1HLUA 1T94A 2YKMB 3Q89A 4LR7A 1VC6A 1BXNA 1YXQA 3VMFB 4DCHA 4IXCA 1WSVA 1W7WA 1U0SA 2A2DA 2E44A 2OI2A 1P27B 3TZZA 3LP3A 3EPGA 1JLEB 1HYVA 2AYGA 5A0YB 3U9DA 2ATLA 2VG7A 2OPSB 4JI5J 5BRFA 3KLEA 4OI4A 2ALYB 1UAWA 3IFRA 4K8ZA 1S1WA 4KQZA 1DTTB 3GIIA 3QEVA 1QQNA 5ADXA 4CYUA 2VV5A 3MURP 1ASWA 3C6TA 1BC6A 1T6DA 4OHWA 2VQEF 1RKIA 1ZA1B 3DXKA 3G96A 4P7TA 3AOAA 4EI2A 4DR6J 1Q16B 3TTFA 4KO0B 4CVNE 4UZBA 1AA1B 4FWPA 4U96A 3HCXA 3MDQA 4U67L 2WOMB 1HNVB 1VQKN 4JKCA 1TGOA 5EOYA 1JLFB 1DQAA 4H5TA 1EWQA 4IO9Q 2P9GA 4KHMA 4A5AA 1TVRB 3AA3A 3SMPA 3RAMA 2HQDA 4FLXA 3VPZA 4NLQA 5D77A 2UV8G 1WHWA 3V6JA 3KFWX 3CCUN 3DCAA 3LPEA 4IO1A 4ISGA 2P9UA 4FWSA 3L9ZA 3T5KA 3GWCA 2IRYA 2J76E 4TYAA 4CEBA 2C2DA 4QYZJ 3HT3A 4HUGA 4FPIA 3G8SA 2DH8A 2D0OA 3OR1B 2HF3A 5C10A 1Q82O 1VRUB 1FJEB 2ERRA 3AAPA 1SC1B 2C3UA 4URQU 5DJBA 5AZIB 1QSSA 3NY0A 2QYCA 1ZZNA 5CQGA 1OMSA 2RVJA 4WIQA 4N7TA 1IBMJ 2BKNA 1EB0A 5KQ8A 1U04A 2LXIA 1HNZF 3EKUA 2O8DB 1X4DA 2VQFK 2F8HA 3PIPL 3ZEUA 4NB4A 2M4MA 4I6MB 4IR1A 2X3GA 2FVSA 4NA2A 1Q7YT 3CI5A 3F9MA 5LL6d 2XHBA 3Q8RB 3O3HA 3V9UA 4CZIA 3HKWA 2QEXN 2DTJA 3MPWA 1ATSA 3WUHA 4B9TA 4I2QB 2ZJPQ 2XO6A 1KEKA 3DRSA 1GNKA 2LXFA 2P51A 2IVYA 2B7CB 4W5RA 3I9ZA 2JOQA 4CBWA 1HWIA 3MTJA 2KTQA 2DPIA 4TSXA 2D3OR 1RCOB 2CH6A 4X65J 4ZPDA 3H8YA 2I38A 2QX0A 2Z1GA 1KVCA 5E7OB 4B1VA 3FBCA 5MAOA 3O3FA 5GAGU 1U1PA 1SQFA 1KNZA 3GYGA 3MF5A 5EDWA 2I5JB 2A41A 3SUOA 5AQFA 4B1ZA 4GV6A 3DRRA 1UZHA 2XI3A 4G6VB 2Z4PA 1WC0A 4C6AA 2UU9F 3A3NB 2ACYA 4EBDA 2Z56B 1X4CA 2IMWP 3BZCA 3OR2A 1QE1A 2B4JA 8RUCA 4KH6A 1U2VB 5KFTA 4RWWA 1ZXOA 1VQPS 3QWUA 3DXBA 1WDDA 3VETA 4OJGA 2FJXA 2ZGZA 2AJ0A 4FK4A 4AHTA 3RB0A 1FEHA 2XSJA 1Q81T 2WVCA 4DSIA 2QLJB 1H73A 4IZ9A 4GMJB 3T1YK 4BC9A 3KLGA 4ES1A 2GZOA 3SQOP 3WXKA 1Q9XA 1HR0F 1D9DA 2YJFA 3NP5A 5KPZA 4DV6K 3DLGB 2E4LA 3S7RA 3H5XA 3O9RA 2RILA 4RX6A 2YI1A 4B3MF 1NPRA 2PO4A 3G8QA 1X9SA 5GAHI 4KKOB 3GG0A 1PAUB 2MGZA 4OYXA 1WORA 1GX5A 4ZCMA 4DUZK 3OXGA 4M3YA 3CGIA 2VJVA 1NUEA 5IOLA 3GQCA 3SCXA 5D0HA 3BF4A 3D0IE 4W5TA 2RKIA 3W65A 3ISNC 4WFAQ 5C2GA 2A10A 2GA7A 7AT1B 3NBPA 1PKUA 4NLBA 1I94K 2KM8B 5HRPA 3ZZPA 4M42A 4O23A 2K2PA 3JXUA 4CP5A 3TAMB 3DU5A 4J9NA 3LUYA 3GTYX 1YG0A 4UY85 1R59O 4JI3F 4OKJA 2V67A 2H54B 3O9QA 3E8OA 4Y34A 2LCWA 2GUPA 2WBNA 3SAHA 3QBXA 1I6JA 1VQNS 4ILLA 3TA0A 4CEAA 4LFAF 1R43A 3AVJA 4BRKA 4U8YA 2EVZA 4OV1A 3GE9A 1MWMA 1WSFA 4BS2A 3JYTB 1WKJA 1WJ9A 2VBWA 4GRSA 3I5BA 5I3UB 1ICEB 3LAMA 3T7ZA 2OKQA 2VQFJ 4FLYA 1APSA 2AQ4A 4TQSA 4FM1A 4KAIA 5KRTA 2D74B 2YH0A 5KG4A 1R8AA 2G8VA 4EAHD 3ZETB 1OO0B 1TZ0A 5DQIA 5DS7A 4DU7A 3SMSA 1DTQB 1U1MA 1T8EA 1CBKA 2YHXA 4LVNP 1Q81O 4FYXB 4DQ8A 3HHEA 2C2MB 4EFAC 5FD1A 2I7PA 3H2LA 4JD2A 5AQUA 4CF8A 4JI7K 2AD9A 4X66K 2YTCA 3HHKA 4R0EA 3AO4A 4EHUA 5MLCV 5J2PB 3V9SA 1QQOA 5DZ7A 4DPUA 3UQSA 2FLOA 4FJIA 3HM8A 1NBEB 3EVMA 3LANA 1NJXA 4QAGA 1FW6A 4CO2A 1YQHA 2HG4A 4TNOA 2IDLA 2R7XA 3Q7BA 1C0UA 4R0JA 4BGAA 3FSXA 4YOVA 2CGKA 3M8PB 1TAUA 3AT1B 2DH7A 5KAKA 4Y0WA 2YV0X 3MD3A 3FGUA 1DLOA 1X4HA 1S7IA 4O8KA 4M5DB 2CJBA 3T19A 2XYPB 3CUNA 4BC2A 2HURA 3QIOA 2KI2A 1XTZA 2UXCF 4RUAA 1WBBA 4ZP8A 2KO1A 5AJ3K 2POKA 4DMZA 2HIQA 4B3RF 1N6QA 2RT3A 2Y8WA 4DTRA 4O0JA 1FXRA 3I6PA 4MK9A 1B9FA 3DOLA 3L7OA 1ILYA 4FZXC 5A8RA 4FPBA 4USUA 3FGVA 4RNNA 1GXTA 4CZMA 4OZ2A 2BJ1A 2MJNA 4I9LA 3DLEB 2KRBA 2R7OA 1SUQA 1WD6A 2AJFE 3R3LA 4DQSA 4F3MA 3D9BA 2DVIA 3PRVA 4QOTA 3AVLA 5DRKA 4YY3F 3C46A 1RT2B 4ES3A 3VEVA 3M30B 3CYMA 4K0KF 3MMCB 1WELA 5LSLA 4X4PA 2JC0A 4FF4A 1S0NA 2BE2B 4H5NA 3DDNA 1FJCA 5JJBA 1I94J 3LP2A 5LXRA 4DU1A 5L1LA 3PYFA 3CDEA 2CVIA 2R2SA 4CBUA 4CQ1A 1JLGA 1GLFO 4NPOA 4FW2A 2I0XA 3E01A 2YWWA 4NXNF 3QRPA 4ZVRB 4CLFA 1VR6A 3B4DA 4AFFA 1S10A 1FFGB 4NO7A 3SZ2A 1SJFA 3TR5A 2FHKA 3D0HE 4ILHA 1BMQB 3I56S 1WUAA 2Z57B 3ZSOA 4OX7A 3G4SS 2FSJA 2FJDB 3OFGA 4E1MA 3IRWP 2PMWA 1RKJA 3CMQA 3CD0A 3IMQJ 4BVPA 1VQ8S 3GSDA 2VQEK 2RD5C 2DNOA 3RYLA 5DG8A 2ASJA 3RAQA 3LTOA 2ZH5A 2A3ZA 5IT0A 4CJFA 2M7SA 1TTHB 4M7YA 1RWWB 2K7JA 4K59A 3LWMA 2G2ZA 2YX4A 1UKUA 2XI2A 1SAZA 2RHSB 4ZVPB 2DIUA 4NLOA 3LAKA 3NRBA 1JLAA 4KTQA 4KB7A 2E1CA 2HAIA 4JI7J 2RH3A 4X66J 4E1JA 3PLAA 1GTHA 1KVAA 1U8SA 4KV8B 2VIHA 4KR0B 4KGMA 5IM0B 2C2EA 2BOAA 2RDDA 1JKHB 4RW8A 2W24A 1Y64A 1HNWF 3RB3A 3U02A 1VQNN 4J9LA 3HVRA 2D7SA 4ETXA 2LQJA 4NCBA 5FDLA 1O8BA 4ECSA 3VGTA 2NS1B 1RBTA 2D69A 1PJ5A 1FWPA 5K8NA 5IQQA 2KZMA 3EN9A 4EUVA 4TU9A 4DR3F 3P1GA 4FWMA 1KTVA 1TL3A 3TVZA 3M2VA 1PYSB 2F4VF 2UUBJ 1FNMA 1JLCA 2L9WA 1IKVB 3SFUA 4ZJQA 3MEEB 3CD6N 1FE0A 1Q1KA 2IIHA 4YDUC 4PKDB 2WVBA 1FJGF 1HD1A 3O4QA 3SDEB 5ETOA 4XO0A 2GUIA 2IOCA 1E4FT 3MM7B 4TN2A 5AJ3J 1RTZA 3QDKA 3C15A 3CCRS 2ZZNA 1OH5A 3MUTP 3HKZD 2ZHOA 3OYCA 3C16A 2F8TA 5A8KB 5IV3A 4F50A 4HDGA 4O5FA 4AL7A 2ASPA 1JXLA 3H7HB 1GLJO 2GIFA 3KLHB 1LW0A 4NLYA 4AHSA 1CZBA 1EQ0A 1VQSA 3L4BC 2EFNA 1CJUB 4CI0B 3M6VA 2JX2A 2UUCF 1ITPA 2W2PP 1T9UA 1GH8A 1DKGD 1EX8A 4Y2KA 2GMJA 3OTOF 2XLJA 4EYIB 3PJWA 3PKMA 3CMAN 4B02A 2OSRA 3CJBA 2HS4A 1CPZA 1W97L 4J2BA 4U6PA 1Q95G 4IJAA 4FJNA 2ZKUA 1ZTWA 4FXWA 4N8NA 4A48A 5B08A 5HBMA 1RB0A 4I6WA 2E20A 2H5JB 2W4PA 2HHHJ 3ZSVA 3CNQP 2B9XA 3BR8A 2UU9K 4TKTA 4WF9L 5KG1A 1X5TA 1X5PA 3QBWA 1J53A 4MIAA 4BR4A 2R8JA 2W1BA 1RDCA 4LF8J 5LT5A 1ZPVA 3OTBA 5CYQA 2N4CA 3CC4N 3I33A 3O08A 4CJ4A 1VSHA 2P1JA 3OFEA 4PXBA 3QNOA 3A8IA 5BR8F 3T9ZA 2FF3B 2ZBCA 4CHQA 3TTCA 1HR0K 1RAEB 1WC3A 2J0SD 3DRPA 4ID1A 2E88A 4PQAA 4KYZA 2WZ1A 3N6NA 1Z05A 2XMTA 2Z2ZA 1XHXA 2HNDA 5AQJA 3ZX0A 4P7VA 4WZMA 3ULDA 2G2YA 2LQBA 4B3MK 2FJAB 2E2OA 2PFFB 4B3OB 3ENHA 2Z1IA 2UUAF 2OSQA 4Q43A 5HJXA 3A4TA 3VQ9A 1YI2N 2ASDA 1S57A 2Q36A 2G0IA 3RSEB 2F63A 1CSJA 1V6HA 3SI6A 2FBVA 4L72B 1A9NB 2HGMA 1QTMA 5FIIA 3A5NC 4F3OA 2XNRA 2W9BA 3P96A 3I56N 1Q0NA 5KFGA 1BWVA 4J37A 4H4MB 1RDUA 1NMDA 4Q8EA 4FSVA 2LQ5A 4JI3K 1VQ8N 4QS8A 4LSLA 3T1HF 1VQMS 3AY9A 3U3YA 3W0LA 4NYFA 2I8EA 2IVMA 3LOUA 3AXMA 1N8RO 4IOCL 1U0HB 4OYWA 4YOUA 2KDOA 4FVUA 5CH7B 3W8PA 1ZTTA 5CA5A 3NOGA 2NPFA 3TA2A 1R8CA 1VQ5N 5KT5A 4DUYF 4I64A 3MM9B 2AU0A 4O0IA 2EXUA 1NJZA 2C22A 4OMFG 2VA3A 3PY8A 3K59A 4U7UD 4ZK7M 3P83D 1J54A 2H48B 5DM6Q 1XIQA 4PY5A 1SB6A 5CXTA 1GFWB 5F8JA 1U2FA 3IN5A 4IBNA 3BGLA 2AGQA 3H5SA 1U1RA 3KUGA 4W92B 2QWMA 2Y9HA 2LP4A 3AGKA 4WFBL 4BDYA 4X4VA 1QD1A 5F8IA 3MXMA 1G6BA 3MXHP 5M1PA 2QMWA 4OI1A 2FBTA 2RDIA 3MAQA 1UVMA 4X62F 4GVBB 4CJWA 4PKIA 4ECVA 1WAFA 3OYJA 2V50A 3LPYA 4ZVQB 4KPYA 1JXBA 2RE2A 1RAFB 5ETMA 1TK8A 2M8HA 2B43A 2VPYB 4NYOA 3RG6A 3Q22A 2DNNA 4PWDA 1IWAA 4QIFA 1QS4A 2UUWA 3MR3A 3C14B 3O2IA 3CCRN 3TOQA 3KK2A 5BN8A 2W2NP 2J9EA 2HHTA 1YJVA 3Q8QB 2O8EB 4OIXA 3OLBA 4L6V3 3O9TA 3S3NA 4JP8A 4OPHA 1HWLA 4J9UE 2FJWA 4CDIA 5MLCQ 2LU2A 1H7XA 4KC5A 3POTA 1NPKA 4CIOA 1TKXB 3BQ0A 4DXLA 4B3RK 4PYAA 1XMOF 3EE8A 3PEJA 1RWXB 4QU6A 2CQ3A 3NS5A 2GVDB 1EJ7L 4DLEA 1S1XB 1TUGB 3MPDA 4FWKA 4CEFA 4PWWA 4WE1A 1HUXA 1IN0A 4CO5A 2KN4A 1REGX 3DYAA 3BF3A 3HVTA 5KGWA 1G99A 3MHYA 2HNYA 4I7FB 1Z2ZA 4FLZA 4NLRA 3TX0A 1IQZA 4OLOA 2P6TA 1IBCB 2DGTA 3UN2A 4IG3A 2DEJA 4JK8A 1XMQJ 2OYQA 4CZCA 5GVQA 3DOMA 4CJRA 3O1LA 3I0SA 4YHHF 5AZJB 2OA8A 1QAXA 3AD9C 4YY3K 4CHOA 3TUZC 3HOSA 2HBMA 3A13A 3MMAB 6FDRA 2OPRB 3UNGC 4K0KK 5K8PA 4OHYA 2QV6A 2CPJA 3ZTPA 1FRLA 5IXUA 4O4GB 3BH7B 2W9AA 2E5JA 2BABA 5F41A 4E3SA 4JI1J 4DHVA 1E6VA 5KFWA 1YK9A 2JH3A 2GS8A 4UOCA 4JK9A 2E9TA 5ADXH 4DG1A 3NGIA 1EKSA 9RUBA 2HBRB 4NXNK 2BH1A 4BC3A 4PUOB 2C2OB 2P6SA 3F56A 3I5CA 2E1RA 1O6XA 1BLUA 2W42A 2UZAA 1S9EA 1NZ8A 4ZHRA 1IKWB 4F3TA 3HI0A 4OPJA 3OHRA 1HKGA 3AVBA 2KT3A 4ZA1A 2Q3PA 4FP9A 2P9LB 5KFAA 5L1KA 3VA3A 2JHEA 3NF7A 3O44A 2KU7A 5JMNA 2R7RA 1W2IA 5AQHA 1VIOA 2V8VA 3D0GE 4DV7F 3M9NB 1N33F 3BBFA 1EP4B 3ET6B 4KI6A 2CPFA 3R1LA 3QFUA 3IFEA 4Q2MA 2PMZD 2C1EB 3N9UC 2CFXA 1X0PA 4DTMA 2V6AA 1S1UB 1FTRA 2P9NA 4DL2A 3N4QA 1RTJA 2HFZA 1SC3B 3UKRA 1RT7B 4M7XA 2GGPA 3ZSXA 2YJEA 1RCHA 1JLBB 3J7YU 1WTFA 4TLQA 3W2WB 3R1HA 2VPZB 1REVA 1H72C 2G0CA 1U1KA 4OI2A 2Z2LA 3EEQA 1RILA 2YQ3A 1RTHA 5HP1A 1YJ9S 1NU0A 4XPEA 1VMBA 3H2UB 1NSKL 1M5OC 4K41A 4K5SA 1RT5A 4A8QA 5JLFA 3IBWA 4WFYA 2HZAA 3BGRB 2B56A 4TU8A 2YQ0A 1RHKB 4QIWD 2B4UA 3OT9A 2BQRA 4DR3K 4BR7A 3MDFA 3C6HA 2F9JA 2G8IA 2F4VK 4CLKA 2OPQB 1V9OA 1KLNA 1FJGK 2BANB 1QDUB 3RBZA 4LRFA 3L95X 1WDTA 1S9GA 5FPDA 3P4UB 2HEKA 1U7LA 4P73A 3W5YA 3M4XA 3V81B 5KFPA 4K4SA 1N5SA 1R0BG 3OS2A 5E3PA 3RB6A 1KVIA 2YNFB 3KWMA 2L08A 3E9LA 1HWKA 2GO8A 2XGPA 4OPAA 4A46A 1SL1A 2NZ4A 3KLIB 3R6LB 1B99A 1QVGM 4AYBD 2MQQA 2E5LK 1XC3A 4BRFA 3ZZYA 1UZDA 2JJ4D 4TY8B 1I51B 2B6AA 2R2UA 3PHEA 4NX9A 3V6DB 2ZBRA 3PM9A 1B0PA 4YY3J 3OTOK 1ZH5A 1YX2A 4P2SA 4NZ0A 4BRLA 3OPKA 4CJKA 3THYB 1W9HA 4P2XA 2I9SA 1TQLA 2IBKA 4URGA 4K0KJ 1RGVA 3KD1E 3NGRA 5SWMA 1H0HB 2QRRA 4F9OA 2WRMA 2OPPB 3ZZ0A 1ASVA 5B0FA 2XO7A 4BDZA 4OJHA 2F9WA 1NLKL 3VVUA 1NGHA 2X7IA 5D3GA 1PYOB 2AX0A 2J6UA 2PI4A 1NEEA 4JV1A 4HEA9 3TSPA 4JI4J 2M5YA 3K5NA 2GMLA 1MROB 3JSMB 3M9OB 4DL0C 4DR5F 2XY6A 3UR3C 1XUPO 3GJRB 1NCLA 2VASA 4HH0A 4C97A 1ZM2A 2E8AA 3EXCX 5EX3A 5C24B 4BVOA 3BREA 3QIDA 3TRGA 2HHSA 4IDKA 3SI8A 1GTEA 3GMGA 3HP9A 2Y1IA 2E1PA 5LSRA 5BR8K 2J9DA 2JEFA 1BQMA 3L4QA 1DAXA 3FMBA 1IV0A 2MZSA 1WOPA 3T3FA 4LH4A 4KHYA 3OQ2A 4CLTA 4RU2A 1FRHA 3TAEA 3VGLA 1S1VA 2KL8A 4H5RA 3ID6A 4IG0A 3HD1A 2XS2A 3RJMB 4N76A 2UUAK 3GV5B 2ZBIA 2ZH8A 2QA1A 5F0UA 1Y5IB 1VI7A 4F0HA 4LFBF 2J0QD 1U26A 3FZKA 4JLHA 4FYDA 2O8BA 4J9KA 2GAGC 4FYWB 2CQ1A 1SXLA 1ASUA 2CNKB 2RQKA 1WWHA 5LMUJ 3TEGA 1RABB 4B9UA 2A6AA 1ZBFA 2NLXA 2WHOA 5JVGL 1F21A 3CJKA 3W63A 1LOTB 4OLPA 2ZM6F 1KHWA 3BR9A 1QAYA 4IQXA 2ITMA 4JI2F 2D5RA 3NAEA 3AD7C 3UVJA 5CE3A 4TU7A 1GOAA 1D9AA 1RHQB 3Q8VA 3Q8SB 1OKJA 2HRYA 3DI6A 1YAGA 1CJKB 2ZZMA 1EZZB 1OPZA 2OD4A 4ECZA 3R9PA 4MIBA 4XAKA 2C2NA 1OY6A 2HNZB 2BXJA 5DLFA 4ZLLA 5KT3A 1FDAA 1YDLA 4PPZA 2Q97A 4BQZA 1PILA 5HL7Q 4OVLA 2E5LJ 3NCPA 1YUWA 3IGNA 2BW7A 3THWB 5ETQA 2JFKA 2X6NA 4KHSA 4USWA 2YNGB 3CM5A 4NOHA 2HFUA 2ACMA 3IAYA 4CFAA 3OTEA 3MOJB 2RU3A 4CJVA 3CCES 3PSIA 3OTOJ 4NEYA 5B0AA 5KFDA 1T03A 2YHYA 3GIJA 2HVHA 3IO1A 5ADZA 1VQLS 1JB0C 3K9JA 3SJHA 4E8UA 2KKZA 4F2SA 3KHLA 4CHNA 5EY4A 4ZN3A 2HZVA 1TL7A 1AFJA 2A3JA 3W2VA 3PIOL 3MM5A 1RA6A 3GL1A 2WB1D 5C25B 3ENVA 3V6HA 2GELA 3GILA 1FWLA 4O5BA 4C11B 3J7AN 2H5IB 4AM6A 1YITN 5KFSA 2V5HG 2IC3B 3I55S 4X64J 1K0VA 4MJKA 3NFAA 2BQUA 1QSYA 4EBEA 2X3DA 1TKTA 2DHGA 1JXEA 5J1EB 3MEDB 1H6KX 3WT0A 4BR0A 1ZS6A 3UIQA 3N79A 2NRVA 2CG8A 3S41A 3AY0A 5BR8J 3M32B 3CSKA 5BYQA 5GMKa 4ZVUB 2NYIA 2Q1LA 1CVJA 2RF2A 2B7BB 2AX1A 2FHJD 2IMOA 3IWXA 2HMPA 2PFUA 3AOCA 3R6GB 4ZP6A 1HIYA 2O4GA 4RW4A 3VESA 1DQ9A 2O8FA 3CCZA 3BBBA 4QR2A 3Q2SC 2J7KA 2HB5A 3NF9A 1X31C 5AQXA 3R9LA 5AQRA 3CEDA 3RTVA 3L3UA 1RA7A 3CQXA 4F36A 3K0JA 1VLYA 4RW6A 2QWNA 2RAQA 4F3QA 4H8KA 1H1VA 1JMTA 4Z7CA 2B9EA 2BJ9A 1YF5L 2VFUA 5G0RA 3LGNA 1XMBA 3DLRA 1Y00A 2DCUB 5IZHA 3G86A 4JKGA 3O6WA 3G6VA 4ED1A 4EZ6A 4DTPA 4M5IA 1HMVB 3VA0A 1PJ6A 4DSLA 2AKWB 2IAJA 3LGMA 4CTAB 3KD5E 2E7XA 2VWJA 3HK2A 4JV0A 3A8EA 3J7YI 3AA9A 3CDAA 3AARA 2KFYA 1K9MT 4CZHA 4BREA 3OYMA 1IKXB 1XJWB 2XG8A 4ZDNA 2R8GA 4CH1A 2IVFB 4H0TB 2FIUA 1BHLA 1J5OA 2DKOB 2N7CA 2BTFA 4WF9Q 1VQ4S 4B3SK 5DGAA 2CUYA 2DGUA 1KQFB 2ASMA 2DGOA 1TV6A 2VDHA 3FK4A 2FF6A 5IWAF 1M1KO 2AEFA 3WIVA 1P90A 1BQXA 1RISA 2EW9A 3HX9A 3GE1A 5AQZA 1B7FA 2ZC4A 4E2FB 4DV7K 3DXSX 2GQCA 1N33K 4MLEA 5D6GA 3O1WA 5K14B 2D3UA 5HVHA 3NMAA 2XWXA 1UA0A 4OZJA 2RS2A 2R7VA 1U49A 1H98A 1R6VA 5D0GA 4GKJJ 2P9KA 4L8RB 1LW2A 1SKSA 4OI6A 1K6YA 3QGGA 1W7AA 4HH1A 4MDAA 3MMBA 4DSJA 2QA2A 4EO6A 3ZTRA 5KFNA 3QZ7A 4BHQA 1FKOA 4DL4A 2IM1A 4ATNA 2RRNA 3KKSA 4NI2B 2VFSA 2GO9A 3CJ1A 4ECYA 3LP0B 3ZNUA 3L09A 5L38A 4K43A 1NGEA 5SZTA 3PR5B 4WCEL 3JQJA 1SL2A 4IRKA 4KTWA 2HOEA 3OUYB 4Z4EA 4PXCA 4CJPA 2HIYA 4JKBA 2CKWA 5A8WA 2E1YA 4M5NA 4OGEA 2HWTA 2CVEA 2BJ8A 1PC5A 4DTSA 4KB1A 1KC8T 3MM8A 1G3OA 3G6YA 2OTJS 1AYEA 4AXJA 4FVMA 3OFHA 2B8QA 3ENQA 4LQ3A 1NJIT 3EX7B 2KHCA 4IOCQ 2GQQA 3R6MA 1FRKA 3CCEN 1YJTA 1XEZA 4IYQA 1URNA 1HBOB 5I3PA 3MWBA 3GV8B 3NGSA 1R27B 4AHVA 3M6XA 3RBEA 4Q45A 1WHVA 2GFFA 3ULEA 3D2FA 1YVFA 1IKYB 3NH0A 5J2QA 4Q0BA 3WXJA 2ZNYA 3DGVA 4CEOA 3FMWA 2GV9A 3AA5X 3I55N 5C0YA 2P5GA 3K5PA 1OWXA 1A5XA 2DR9A 2VH7A 1NJYA 3RBXA 3CC7S 4A8WA 3HT0A 3PKYA 2HBQB 1N34F 1J5EF 2R8KA 2DEIA 5LOQA 4LF5F 4P74A 3BYRA 4Q7AA 2VFTA 2C3OA 4DZDA 4IFEA 2ZUGA 4QU7A 2QL5B 3KNGA 5KFQA 1NKEA 2QLXA 2B5JB 3HMJG 3BV8A 3HO1A 3GJQB 1GAOA 1AZSA 3EL2A 5GAEP 3AODA 2HHWA 1HPZB 4EEYA 4QS9A 1N88A 1WF0A 3VQ6A 4CLUA 3IDHA 4F4ZA 3HJVA 3V9ZA 4B3SJ 1S1TB 4ZJLA 4X4RA 4DSFA 2ADBA 2IJFA 4U8VA 2G13A 3BO3A 1G15A 4K25A 3WEEA 4Z37A 5FRMA 1KC8O 1UWAA 2X1BA 2FLLA 3TPQA 4EBCA 1U6FA 4DV7J 4BR9A 3S9HA 2QWLA 1M90T 1DRZA 3DDIA 1NB7A 3SIPB 4Z7YA 4MFBA 1SJ1A 2DNLA 2QA4S 4AHUA 3D6TB 4GKKJ 3AVHA 3D6RA 4TLRA 1FD8A 1FTCA 5IQ6A 4IO9L 2MZTA 1X9MA 2F96A 2FC8A 4JUZA 2PBDA 1C4AA 4C1NI 2YKMA 1LKZA 1WF2A 4RUCA 4A8YA 5E33A 3K8WA 1QUVA 1Y3JA 4PPDA 2RRAA 1TL1B 3U1LA 2F3JA 2QLFB 1JLEA 5T14A 4JYAF 4AILC 5A0YA 1NGFA 1MU2B 2OPSA 4TXSA 3AVMA 3QEWA 1WSIA 2ZM6K 3DLJA 2QI2A 1HQEB 3NH2A 1M1HA 1DTTA 2PAVA 3SXLA 2L41A 1H3DA 5KFJA 2DGQA 3NCRA 5EX5A 2AF6A 4JI2K 3H46O 3GJSB 4CHYA 2YWFA 2HBJA 1MN7A 3KLVA 3IRXB 4RCHA 4KJIA 2BR0A 2LYVA 2CXEA 4FBTA 1Q5YA 1HLWA 1A6LA 1RAIB 1FO1A 4M5GA 2ASOA 3F9KA 1XR7A 4KO0A 3KKRA 3QINA 2J9DE 3PCOB 4O4RA 2XY7A 4J2DA 2AHOB 2K1RB 2WOMA 4MT1A 4RZRA 1HNVA 3I0RB 1P8GA 3T5HA 2E2QA 2DGSA 1QHTA 4KGKA 1A7GE 1JLFA 1M5HA 1VQ6S 3W62A 4CZEA 3OYBA 1UVLA 5HVFA 3OYKA 1TVRA 3BKFA 1UVNA 3M6WA 4WFZA 4A57A 2VICA 2ZJPL 3FVYA 3H4DA 5LY3A 1RYSA 3IA0A 3BUZB 3J80O 3DWLA 4ILRA 4CGGA 3RRHA 3L4IA 1HI0P 2HFVA 2QYGA 5FLXO 1CEZA 4CO0A 3OR1A 4HWIA 5U47A 4N8OA 3VN5A 4C1NK 1VRUA 3O5BA 3MCAB 2YNHB 2B4PA 3I32A 1M90O 2D1CA 5AQNA 2ZC3A 4IEEA 3PW7A 2HFNA 3BZQA 3WX8A 5AE3A 3HPHA 4HI1A 1XQSC 5AZIA 1HHSA 2OTJN 3QGHA 2WAQD 2B9YA 2GEMA 2O8DA 1IM6A 3O1BA 2M88A 2AT1B 2E6LA 4A47A 4I6MA 3HZEA 1PCAA 1HBNB 2X51A 3IAS9 4YQWA 3WBZA 2ZNZA 4DR1K 3KG1A 1FXXA 1WNSA 2F8EX 2AV5A 4I2QA 1YIJN 4FBUA 2NUUG 4C9DA 4F0KA 2KVIA 3HI9A 1QTNB 5T7LB 4MIWA 4ED4A 3KXDA 1NGBA 2FZGB 2JNJA 2DB1A 3AVGA 2HYIB 1URRA 1LQ9A 4OYIA 2DFEA 1HW9A 2PEHA 4J90A 3GP9A 2OMLA 4O3OA 3OR2B 5HQMA 3GFYA 1A5VA 3M2RB 4I6YA 4K8RA 2BDPA 3ZZZA 1ZETA 3P45B 1GOCA 1T05B 3MM6B 1Z2LA 3CC7N 2H1YA 2I5JA 2MQPA 4CERA 1HNIB 2IRUA 2V9KA 2HGLA 4CLLA 1CC7A 4XH5A 2W4CA 4YDDB 1L5UA 1SC4B 2ZOMA 2YKOA 1CJVB 3FNNA 1QVGR 1U2VA 3D1OA 2CAJA 1N36K 2B51A 5ETVA 3VAIA 5AQMA 2ZM6J 3LL3A 3CXCM 5DG9A 3SPYA 5T41A 4ITSA 4D3GA 3HVAA 4GY2B 5JS2A 4GVEA 2VL1A 4LF7F 4OZ3A 2MGZB 3M9MB 4KBOA 1VC5A 3SUQA 2FVRA 4DR2F 2ZDPA 2R7TA 2FYXA 1KS2A 3OA9A 1OH6A 3CJQA 1BUXA 2R42A 1K44A 5GINA 2M70A 4CEZA 2RUSA 1WAJA 5CABA 3CO0P 4F4XA 2GIQA 5GAEU 3DLGA 1T9TA 5LMNF 3NWRA 3E51A 2PGCA 4YOWA 1VBKA 4OPKA 4M3XA 4KKOA 1EWRA 3QEIA 4G3IA 1D0EA 5LJWA 3MFIA 3V1RA 2F65A 1QZ6A 1LFWA 3KHHA 4F2RA 2XTJP 2R7YA 4AH9A 2OJ3A 1KWMA 3FFIB 3QETA 1NZAA 1KLMB 2JEGA 3WNGA 2CPHA 1KONA 1I5OB 3SQ0A 4NE9C 1YJNS 4YB1P 1NDKA 2O8CB 5DQHA 2DHSA 2E7WA 4P52A 2OEJA 3TAMA 1LK7A 4CHPA 3Q0AA 2PE8A 3R2DJ 3S3OA 4FZZA 4DV0F 4O3SA 4CFDA 4OKEA 1T95A 2EBEA 3VALA 4JI6J 1BCMA 4AHCA 3Q2TC 3QEXA 2WC9A 2G0JA 3BEXA 3M8WA 2QA4G 2B3TB 2NRZA 3OW2M 3DC2A 1GLCG 3JYTA 5I3UA 3BH6B 2E1AA 3N6LA 5K8MA 3DLKB 5KG0A 1SBRA 5KTQA 2VGMA 3EZ5A 4QW9A 3V2UC 3G10A 4WXOA 4FKXA 3ZETA 5JVGQ 1VQ6N 2LQ8A 3JXOA 4DR1J 1IJFB 3L8BA 1DTQA 4EP5A 3V9XA 3C66A 1WSEA 5HOOA 4WBFA 3UKUB 1VGYA 1YHQS 4Z2XA 4A61A 1LWEB 3CIPA 4F25A 4E7HA 5FPNA 4AM7A 4DOZA 4WWSA 4Y00A 1ITGA 2J7UA 5J2PA 3M1VB 3G6XA 1IM4A 1ATNA 1IR2A 5IT9O 1WI8A 4MMOA 4ICLB 2B4VA 4JRQA 1C0MA 4CIGA 4FJHA 1GLBG 2YXLA 2Y1RI 5AQPA 3M8PA 1VK8A 4KBIA 3HLUA 3L2WA 4H0OA 2HQFA 3F5TA 4JV5K 2H5EA 3AAQA 2AZ3A 3QRRA 5HMXA 3ZT3A 1S6UA 4MO5A 4M5DA 4Q5VA 3GCWP 2BJDA 1N36J 1D4XA 1CQMA 2K8GA 4DV3F 4FWQA 1IQTA 4I56A 2P9EA 3DXMB 4DSKA 1C1CB 2XLKA 1N34K 1X4EA 3RU0A 4JI0F 2CJYB 3WZ0A 4DF4A 3W7BA 3A0IX 3GSIA 4CLPA 2KYZA 4OYAA 5E41A 3IWNC 2QFJA 5KT7A 2OTLS 1YZ6A 4X4NA 3THXB 2OZSA 1RT3B 4OGCA 1Q79A 1WEYA 2DO0A 4C8LA 4C8NA 3DLEA 2Z0GA 4B1WB 1UETA 1V3RA 3T5JA 5HMYA 4BRQA 5AXKA 5AQLA 5DZ6A 2VDIA 4QYRA 2UUTA 4W90B 2ASYA 5F8MA 1RT2A 3HPGA 2BRLA 1SV5B 1NU4A 3M30A 2DNZA 2KJVA 3MMCA 1OH8A 1E6YB 2DFHA 2BE2A 3EYZA 4KFBB 4DFJA 3NGZA 4CD1A 1RDAA 5AT1B 1P8ZA 4CE9A 1IXKA 1G2EA 3HULA 3O3GA 3R27A 2HFSA 1HRHA 1SIWB 4Q2LA 4FOIA 3CC2N 2NCKL 4DV5F 3LGHA 4O3RA 1BGXT 3PYEA 1VQ9S 2YH1A 3AVFA 4JYAK 1KN6A 2P9PB 3AJ1A 3UD4P 2R2RA 3J81j 1HBMB 1N54B 2PC6A 4WP3A 2QWQA 1KAXA 5J2MB 5D0EA 2VFRA 1WOOA 5KFLA 2LDIA 2KVQE 2CJ9A 4NRTA 3CCWA 3RZAA 1T7PA 4J5OA 2MZRA 3EM1A 3IS9B 1UEKA 1WKLA 4AHRA 1GLAG 4A62A 3WXMB 1FJ7A 1NGJA 4ECQA 4LF9K 4ZVEA 5AQSA 4UQGA 3NKYA 5A76A 5BPLA 4OZ5A 2EFPA 3VOVA 1N4LA 2Z2MA 2NUBA 1YJNN 1CC8A 3VEYA 1OIAA 3OY9A 4UY8T 4RUBA 3EJMA 2F7TA 3PYGA 4ECXA 1IBKK 3I9V9 3UD5A 3VAJA 2V4JB 4IJNA 4KV8A 3QNNA 2RNEA 4YDUA 3QIPA 5IM0A 1JKHA 2GX9A 5C42A 1N32F 4EK2A 1RHRB 5CYJA 4X2BA 1WC5A 1LOUA 4KHRA 2BM0A 3JB9k 4HTUA 1R0AB 3PXGa 2VA2A 4USHA 2EK1A 4ZVTB 4RJVA 3BF1A 4JV5J 4CGJA 2NRXA 1FCAA 3IG1B 3EZOA 2WSEC 1YJWS 3CD7A 4DN9A 4IR9A 3R7BB 1RADB 3PW5A 1IKVA 1FERA 4J91A 1L3TA 3MEEA 1M5SA 3QGPA 4IUFA 2JLEA 3SDEA 5HI7A 4FJJA 3BQ1A 2DXDA 3DAWA 3KNAA 2OANA 1NXIA 2GHWA 4QW8A 3MM7A 1RE1B 1N34J 1GEHA 3ILLA 2X1FA 2AEJA 1NK4A 1SCJB 3NGYA 2CDQA 4YR0A 3U27A 3FZHA 4HKQA 5KT4A 5A8KA 3C3LA 4K4VA 3BP8A 3QERA 3M8QB 3KWIA 5E3RA 4KH4A 2HS0A 1MMNA 2YHBA 3ZZOA 2DHXA 2QMXA 3KLHA 2XCPA 1EIYB 4CI6A 3OYIA 2BJEA 1MWQA 1CJUA 3SYZA 2BRKA 3UFCX 4PG6A 4K8XA 2HBKA 3VR1A 3GONA 2ROPA 4ZKAA 3EY1A 2O5DA 3JSBA 1V3SA 3UB5A 2EBGA 1SQKA 4ID8A 5C7PA 4A8KA 1MMLA 4YMEA 2VONA 3CHWA 2DH9A 3AO2A 1QVFM 2D0PA 4DJBA 1MG7A 4OO1J 5AQIA 4MO4A 2DTUA 4NXMJ 4JI8K 5KFVA 4CZJA 5L1JA 5BPMA 3TU5A 4OX9F 4I0WA 3IMXA 2C42A 2M0GB 1JWWA 5AXNA 5FRNA 1K1QA 4C8OA 4KAZA 1RI7A 2CPZA 3P5JA 4JYAJ 2Z8QA 4JS4A 3G82B 4CJTA 4DKWA 2OAUA 3LDQA 2YQ1A 3ZZRA 2IVNA 4ZP9A 3R97A 1NRKA 4DV2F 3CJ5A 1FDNA 3ELHA 1RACB 4FYVB 4GV3A 1SJQA 3BBCA 3OTCA 3V4IB 4LF7K 3MN7A 2V69A 3N5FA 4UOFA 2IY5B 4DR2K 2BYCA 3PVXA 2WONB 5KG5A 1RZMA 2BEFA 2XMJA 1RT6B 2H65B 2U1AA 3EICA 2DCLA 4FZYA 5LMNK 4LF9J 1VCTA 2MKIA 1NMNA 3JS6A 1O1WA 1BA0A 4NL5A 3U6FA 2D1KA 1HJRA 2W9BB 3FEXB 4B3OA 2I2YA 3ZX2A 4DV1F 4ZLJA 4WQ5C 4PHTX 4DR7K 4CNZA 3W64A 3THVA 4KB0A 1PAEX 5DM6L 1LAWA 3RSEA 1IBKJ 2O01C 4DQIA 3CT9A 3UCUP 2IA6A 3R5JB 2HK2A 1NHUA 1LWFB 2GVZB 1Q8LA 1ZA2B 3TUIC 3SSQA 3IKMA 4LF6J 2ZH1A 1HQ2A 1BY9A 2JLFA 2P2CB 4H4MA 4CT9A 2X1AA 4DV0K 1QLNA 3MPYA 3J7ZO 3KMSA 3OVBA 2PYLA 1CJTB 3RAXA 3ZNJ1 2NLWA 3TSUA 4GC7A 5BR9A 1UFLA 3NGKA 1GMWD 2F8MA 4E0DA 1KKHA 1XNRJ 4FJGA 2WVDA 4E19A 1RU1A 1VQ7N 4B3TK 4CJQA 1NKBA 1IJEB 5KG6A 4FWNA 3MM9A 1KBRA 1Y4ZB 4ZIWA 3NWGA 4CIFA 2Q6CA 2R3VA 2QFIA 4CJUA 4RNMA 2DXFA 1RSCA 3JAMU 1NO8A 1ZBTA 2F5GA 4YDXA 3H4BA 4QIGA 2M8DB 3H59A 3ZT4A 2VG5B 4Y0FA 1MSWD 3CW2C 3C95A 4CECA 1TAQA 2EWSA 3SAGA 4CJ5A 2P8IA 4NZ6A 4CHZA 5F1XA 2CDRB 2YX1A 2N7YA 4DCOB 3RVCA 1YJWN 4ELVA 1S48A 2H51B 3O6QA 3D7SB 1LWCB 3O4WA 4GVBA 2E7VA 5T7BA 1Z26A 3K9KA 5JS1A 4LRDA 3KJNB 1MMDA 4JI8J 2QLWA 5DMRA 3VQAA 5BPNA 1YWXA 4B9LA 2O8EA 3BM7A 3GIMA 2KYXA 4DL5A 2DPNA 4PA1A 1XWLA 4EWTA 1X4AA 2KHDA 3QICA 4FF2A 4DV3K 3HVTB 5CZXA 2GQ2A 2DNGA 4BWMA 4KGVB 2HNYB 1O51A 1B7YB 4P71A 4ED2A 2Q2RA 1TKXA 2YX6A 3AVNA 4BE2A 4OQJA 5GADP 4IG3B 4K7QA 4HCCA