1RTJA

Mechanism of inhibition of hiv-1 reverse transcriptase by non-nucleoside inhibitors
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Mechanism of inhibition of HIV-1 reverse transcriptase by non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 133
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtjA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtjA05
4FZZA 2FLNA 5CYMB 5HLFB 5KG5A 4DQIA 2D7SA 1U09A 4J9NA 2AGOA 1S1XA 4IR1A 3LZIA 4FXDA 4MK7A 1SH0A 1HYSA 2FC0A 4DL2A 1S9EA 1RT5A 4ZP6A 3OYHA 4NCGA 1C0TA 5F8GA 1TK0A 2EHGA 4IR9A 3O3HA 2W8KA 4TXSA 1TAQA 3V6DA 4FLUA 1D8YA 4ECSA 4CF8A 2G8KA 4O4RA 4ZTFA 4ZVHA 1IKXA 1JXBA 4ZP9A 4YFUA 3CIZA 1B92A 3G86A 4URQU 1GOBA 4RW6A 4CEFA 1JKHA 3KNAA 5FRMA 3ZSVA 1RTJA 3BQ2A 1VSIA 1SL1A 4NLGA 4CJSA 4XO0A 3H5XA 1VRUB 2FBXA 3RRHA 3PY8A 4ZP8A 1CXQA 1BI4B 2VG7B 1S1TB 3PJXA 5J1EB 3KHHA 3SNNA 3KKSA 4F4ZA 3VQ6A 4M3TA 4H4MA 3T1AA 2O4GA 4CK3A 2HHTA 3V81A 2R2SA 4NLWA 4YQWA 3IN5A 3AO2A 3OLBA 1T94A 1X1PA 4DS5A 5C42B 5HP1B 4DTXA 3ZT4A 3AO5A 5KFRA 3OYBA 3E01B 3RBDA 3HJFA 4QW8A 2ILZA 4OPKA 1X9SA 2J6TA 4HYKA 3RB0A 4WE1A 4RNFA 5KFQA 2IBKA 5KGXA 2QXFA 1VSDA 3ASMA 2IC3B 2V4QA 4O5BA 3OYMA 1QSYA 1NK0A 1RA6A 4CJKA 4ECXA 4IFYB 5DQHA 4KB1A 4R5PB 5DMRA 3OVNA 1MMLA 3HVRA 1NK9A 1VSEA 1JLEA 3K58A 3M8PB 5J2MA 3KHRA 4CF0A 1FK9A 2BQ3A 3OHAA 4J9LA 5JS2A 3SQ0A 3MECB 4HUFA 1EETA 4Q8EA 3SUOA 2KTQA 3UR0A 3DI6A 3V4IA 2IM0A 3N6LA 4HCCA 2BANB 1YT3A 4CCHA 3G6XA 2B5JA 2C2DA 3H4DA 2WOMA 4HCBA 4F3OA 4KFBB 3QEXA 4FJ7A 3G6YA 4Y34A 2E6LA 2BGGA 4NZ0A 3SUNA 3KLFB 3ZSXA 3RR8A 3MFIA 1Z4UA 4MFBA 2CKWA 3OYJA 1GX6A 1L3UA 3HK2A 4NLOA 4DSEA 2BQUA 1RTHA 3OS2A 4DSIA 1S1UA 4CJ4A 2D3UA 5DG9A 4DFKA 1N5YB 3TANA 3MR3A 3L2RA 2YHAA 5KI6A 3SZ2A 4ED0A 1RBUA 4LD0A 4I9QA 4KHMA 1UAXA 1QQCA 1J5OB 2OZSA 4DQPA 4FJIA 3K5LA 3VA3A 1LW0A 4YMEA 3IRXB 4KO0B 1QSLA 3OYEA 3OL9A 4E89A 2R8GA 3BGRB 1HRHA 1ZBLA 2P1JA 4B9NA 4CECA 3FQKA 4H4OB 1ZTWA 3V1QA 1JXLA 1HYZA 2OPRA 3PX4A 1TV6B 3ITHA 4QAGA 1JLQA 4O3RA 3ICLA 3V9WA 4FJMA 5L9XA 2RDJA 3DLKB 4CHOA 2E9TA 4DFMA 2YV0X 2E6MA 5DK5A 3NHGA 5J2PB 3KJVA 3SYZA 4O3QA 3IGNA 3V9UA 3LZJA 2BRLA 1IH7A 4KREA 1R0AA 3SQ1A 3A2FA 5KFOA 3D0PA 4FJKA 2J6UA 1RA7A 4CE9A 3L8BA 4B9MA 1RT7A 3NGDA 3VQAA 3SI8A 4KHSA 1L3SA 3I0RA 4F4XA 4O44A 3VQQA 1TL1A 2W7PA 4UQGA 1ZBUA 4CEOA 4CGIA 1DTTA 1RBVA 3DRSB 2EX3A 2OH2A 5L1JA 3RMBA 4DSJA 2QKKA 1K6YA 5F8IA 3IG1B 3NF8A 5KFSA 4HUGA 5FDLA 1QE1A 1RTJB 1BIZA 3T19A 2Y1IA 1DTQB 1N4LA 1SH3A 4B3OA 1TK5A 1IKYB 4OVLA 3ZT2A 1JLFA 1IKWA 3KK1B 4ZMMA 3K5NA 4MIBA 3QGHA 4CJPA 4NLUA 3AVAA 4IKAA 2DY4A 4RNNA 1JX4A 1RT2B 3JSMB 3OSPA 3VQEA 4NLTA 2CJQA 4EBEA 3NGIA 4XPCA 1S97A 4I9LA 5F8NA 4KV8B 4RU9A 3U3YA 2VG6B 4IRCA 3AVKA 1C0MA 2HMIB 4DFJA 2W9CA 2F8TA 1TAUA 3OYGA 1I6JA 3KK3B 1LWEA 2XCAA 3GIKA 3DM2B 3L2UA 4PA1A 4DEZA 4CGHA 2FLLA 4PQUB 1S1VB 3IAYA 3MEGA 1D5AA 3MEEA 3O4NA 1U45A 4KRFA 4EP4A 2Q3SA 4IH5A 2G8WA 1LWCB 2RF2A 3VQ9A 3C6TA 4DTRA 3QETA 1FK9B 4DTUA 5FRNA 3CJ3A 4KI4A 4M3ZA 5K14A 3DDKA 1L3TA 2OPQB 2FVPA 1UA0A 4N56A 4PWDB 3JYTB 2WRMA 3DOKA 1RTIA 5KG6A 3V4IB 2YKMB 3GIMA 4N41A 3H08A 4RZRA 4FYDA 4QPXA 3AVGA 2Y1JA 4FK2A 2DPIA 2XI2A 4ZVGA 1NKEA 4EYHB 3D45A 3V1OA 4JUZA 4DF8A 1S6PB 1L3VA 3ZT0A 4EP5A 3CQ8A 2XGPA 3O3FA 3CJ0A 4O3OA 3VQ8A 3VQ4A 2ITGA 4FK4A 5L1LA 4KI6A 1UWBA 4IDKB 3QEIA 1N6QA 3TR8A 2YNIA 3BR9A 4FS1A 1YVUA 3TAMA 3HPOA 2V9WA 3P5JA 5KFWA 2A1RA 3NBPB 2D0CA 5DLFA 1BQMB 2OPSB 2BE2A 5E41A 2FBTA 3C6UB 2QE5A 3SUPA 3OYIA 4MIAA 4FJGA 3QZ7A 2ZD1B 2HNYB 4CIFA 4DMNA 4KTWA 4EZ9A 4DG1B 4KKOA 3PW2A 2PZSA 4M3UA 1T7PA 1HNVA 2R2RA 3AO3A 1TVRB 3QERA 5C25A 5KFVA 4FJHA 2WTFA 1S9GB 3SV3A 2YKNA 2KFNA 3PHEA 1TKXA 3TAFA 1NJWA 4MQ3A 3PR5B 2JEFA 5KG4A 4IKFA 1NK4A 4WYLA 1TP7A 1F21A 3BDPA 4IFVB 3UIQA 1KVAA 3PV8A 1QAJA 3IS9A 3I0SA 3AA5X 1VSLA 4JS4A 2D5RA 3THVA 4DLGA 4R0EA 3LWMA 1TL1B 1BQNB 4KTZA 1FKOA 4ZPDA 3KHGA 5KG2A 3EPGA 3OL7A 1DTTB 3RWUA 3OYLA 2JLEA 2V0NA 4B8AB 1EP4A 1RT6A 3MR5A 2FJXA 4CFAA 5KTQA 3BJYA 1TKTA 3LP0B 4TY9A 2OA8A 5J2QA 4TQRA 4Q5VA 2ASDA 2GV9A 4IRDA 2XHBA 4GMJB 2XY5A 3QO9A 3CDEA 2AJQA 4I2PB 2F8SA 2DFFA 1T03B 2RKIA 1C0UA 4O4GA 4K4WA 2I5JB 4C8NA 2XC9A 3SPYA 1GX5A 4K4YA 3FFIB 3S3OA 1WSFA 2ETJA 5KT4A 2NUBA 3SJJA 4ID1A 3L2QA 2YNHB 3RB6A 4BE2A 4Z4FA 3NCIA 1RT1B 2AX1A 4CGFA 1ASUA 1ASVA 4ECUA 4ZTJA 3U6FA 1CLQA 2EC0A 1XR6A 1IO2A 1XI1A 2HNZA 1JLGB 3HVAA 2HWIA 1ZBIA 3M8QA 3DYAB 4ID5B 5EU7A 4K4UA 3IGVA 3AO4A 1HQEB 2DPJA 3OS1A 1C1CA 3HVTB 4M3YA 3QGGA 1RDAA 4I7FB 1TL3A 3ZT3A 3C95A 4WZQA 3WNGA 4DQQA 1S1WA 2C2EA 3MF5A 1SV5A 3NH2A 4CEQA 3LP2A 1J53A 1LW2A 3KLGB 5SWMA 3KD1E 4CF9A 4Z4GA 1RTDA 2ATQA 2B6AA 3KLVA 4ECYA 4FLZA 4QOZB 3FDSA 4IG3A 4O0JA 3KKRA 3VQSA 1DLOB 1RDRA 2VWJA 5I42B 2DTUA 1S5JA 2UUTA 4GW6A 5HRSA 3GIIA 4IBNA 4PUOB 4CJLA 1JXEA 2JEGA 3RB3A 4KB0A 3NGZA 1S9FA 4R8UB 3DRPA 4NLXA 2GC8A 2R2UA 1HPZB 2VG5B 1LWFA 1RT3A 2YNFA 4AILC 3WNEA 1GOAA 4ELTA 3QNOA 3UPFA 4M42A 3HP6A 2HNDB 4YR2A 2IAJB 5DQGA 1S49A 1WSIA 3ZT1A 1NJXA 3DLEB 3KLHB 1QHTA 1XWLA 2RPIA 2YHBA 4LH4A 2AGQA 5F8HA 2W9AA 3UDLA 3BQ0A 3QLHB 4ICLB 4MKBA 4K4VA 1RDDA 4NCAA 5HROB 1J9AA 1NK5A 2HWHA 4AHTA 4F3TA 3SCXA 1REVA 2ATLA 4DTPA 1JL2A 1Z26A 4O55A 5EWEA 1MU2B 1KLMB 3KLEA 3AVLA 2YNGA 1NKCA 3DOLB 3IS9B 1XR7A 2FVCA 1JLCB 3I0SB 4CJFA 4U7CA 1NOYA 1KLNA 4DF4A 4C8KA 3OJSA 5HBMB 4FJNA 5KT6A 2XRIA 1VRTB 4I2QA 1FKOB 5KG1A 1JLAB 2AX0A 1T8EA 2P5GA 4WFXA 2P51A 1T05B 1SKRA 1W25A 3QIPA 4Q44A 2FLPA 3ZSZA 3NDKA 4E0DA 1U48A 4JV0A 3KHLA 4ED3A 3NF7A 1K1SA 1SUQA 4NLYA 2DFEA 3TABA 1RT4A 4DS4A 1IKVB 1BCOA 4J9OA 4YR3A 2O4IA 5KG3A 3QGIA 4ECRA 3OYDA 4G1QA 5JUMA 4NYZA 3PX0A 1CZBA 1KFDA 3WNHA 2PY5A 4Z4CA 4RNOA 4RW4B 4FLWA 3KLIB 2W42A 1TKZB 1HMVB 3F73A 4O3NA 3E51A 5J2NB 2HHVA 3U3GA 1UA1A 1S4FA 4KPYA 1U47A 4CEAA 4AHVA 2PYLA 4TY8A 4DTJA 3HP9A 1KTQA 3AA2A 4Y3CA 4LSLB 4Z4HA 4CHNA 4RW8B 1BISA 3P83D 3PJWA 4LSNA 4B08A 4CEEA 2E9RX 3GQCA 5DG8A 1RDBA 1K1QA 5F9LA 5DLGA 4CHPA 2GIQA 1G15A 2R8KA 2WONA 3L2VA 3OHBA 4RW7A 5KT5A 4N5SA 1S1XB 3OYCA 5C24A 4CFCA 3ZSRA 2C2RA 3OYKA 4KHYA 3DLGA 4IH6A 1HYSB 1TKDA 2GBZA 1S9EB 1RT5B 3L3VA 2XWYA 4CJUA 4ED7A 4NCGB 3KK2A 1C0TB 1RYSA 4RW9A 1NOZA 4RNMA 3RB4A 4RNHA 4B9UA 5KFLA 4ECTA 4FJJA 3V6DB 4EYIB 3QESA 5HRNA 4K4SA 3HPGA 1IKXB 4DTSA 3AO1A 3CJ4A 1JL1A 1HARA 1C1BA 4M41A 4KAIA 4B9VA 2XY6A 3Q8SB 2ALZA 2X74A 1FKPA 3I5BA 2XGQA 3LDSA 3DRPB 4RW6B 4TN2A 1LV5A 1JKHB 4M95A 3MTKA 1RILA 4QW9A 4FK0A 3RBEA 4ZHRA 4JV1A 1VK0A 1HNIA 1RBSA 3MEDA 4E3SA 4H4MB 3VA0A 4IG0A 3V81B 2HHWA 3NAHA 2UVRA 1NHVA 2O5DA 4DL5A 1C1AA 4NLQA 3N6NA 4YP3A 4HVJA 2JC1A 1VSKA 4AH9A 4DL6A 2ZE2A 4FJ9A 4DU3A 1OS5A 2HW3A 2UVUA 3GYNA 2OPPA 1S6QA 4WE1B 1SL0A 3FQLA 1FXXA 1KHWA 2IJFA 3DRRA 1HQUA 3D28A 4WZMA 1QS4A 1XR5A 1Z25A 3H5SA 3OSNA 3LP1A 2KW4A 1YTUA 1YTAA 3ULDA 5F8JA 3PW7A 4RUAA 3VQDA 1JLEB 1D1UA 5J2MB 1IG9A 5I3UA 3CG7A 2G8FA 3I5CA 4MKAA 4JRPA 3SQ2A 3HO1A 4TSXA 2JEJA 1WAFA 4E7LA 3QNNA 4OJRA 3OS0A 4K8ZA 3NAEA 4CK2A 4AHRA 4KTQA 4CK1A 4CJWA 3V9ZA 3QIOA 3UQSA 1EETB 3NF6A 3SQ4A 3HYFA 3DI6B 2VA2A 1X9MA 1ZYQA 2B5JB 2BQRA 2IM1A 2WOMB 5CYMA 5HLFA 4FZYA 4TYAA 4HHTA 4CGJA 2JC0A 1WNSA 4ECZA 2KZZA 4MFBB 1U4BA 3CFOA 3PZPA 4DL7A 4RUCA 3CWJA 4FLYA 1RBTA 4JRQA 3ZSQA 4Q8FA 3LWLA 4Y1DA 1RTHB 4FLTA 4FM0A 1WSEA 4WXOA 1S1UB 3S9HA 4MH8A 1CXUA 4W5NA 1A5VA 1ZBHA 4JLHA 3KIOA 3EYZA 4FCYA 4NLPA 1BL3A 5KFPA 4ECVA 3PVXA 3CJ2A 4K4ZA 4W5TA 1LW0B 4DLEA 4WYWA 4F8RA 4CHQA 4Z4IA 1VRUA 2QK9A 5KT7A 1BI4A 4FS2A 2OZMA 2VG7A 1S1TA 5J1EA 5KFGA 3MXJA 3SUQA 1TGOA 4M3RA 5KFUA 3LAKA 4LQ9A 4CERA 3P1GA 3I8DA 3H98A 2OPRB 3OLAA 4FVMA 3KD5E 3ITHB 1W0HA 5C42A 5HP1A 4CJQA 1JLQB 4ED8A 3HL8A 1RBRA 1BHLA 1BCMA 4ED6A 1S10A 3E01A 3WNFA 3KJVB 3GIJA 2UVWA 4FW2A 1D9DA 2WB4A 1R0AB 3NMAA 3TQ1A 5KFBA 1TQLA 1KSPA 2IC3A 3VQ7A 4LQ3A 2R8JA 4MK9A 3AVBA 2AU0A 1SL2A 4BE0A 5EWGA 1RT7B 3O3GA 4IFYA 1EKEA 3I0RB 2G8UA 4O44B 4R5PA 5KG7A 3BREA 2FJVA 1O1WA 5L1IA 5KFCA 3M8PA 2VA3A 4F50A 3K57A 2PYJA 2JEIA 2HAIA 2IOCA 4X2BA 2G8VA 4ED1A 1EX4A 3NE6A 1WAJA 2WHOA 2W9BA 4O0IA 2HHSA 4CJ5A 3MECA 5F8LA 4NLRA 1RCHA 2FVQA 5FDLB 5CY4A 1QE1B 2X78A 2BANA 2RDIA 4Q45A 4B3OB 5D3GA 3AVCA 1JLFB 1HNIB 2FVSA 1NK7A 4KFBA 1IKWB 3DMJA 4CIEA 2C28A 4J2AA 3KLFA 4CJVA 3FRZA 3HHKA 5KFAA 4EO6A 4KHUA 3GILA 2G8HA 4F4KA 4H8KA 4U6PA 3LAMA 2HVIA 3AA3A 2IGIA 5T7BA 3NL0A 5CYQA 3M9OB 4AHSA 4LY7A 3ISND 3EZ5A 2E9ZA 4IOBA 1ZETA 4KE5A 2HHXA 2OPPB 2IJNA 3M9NB 1LAVA 2AQ4A 2W9CB 3DLRA 4FW1A 4CFDA 4DSLA 3AVHA 1N5YA 3QEPA 1NK8A 1LWEB 4M94A 3AVFA 1LAWA 1J5OA 2J6SA 4DQSA 1KRPA 4J9QA 3MEGB 1WSHA 3IRXA 4KO0A 3MEEB 3BGRA 4Y2AA 2RF2B 4URSA 3C6TB 3NH1A 3S3MA 4H4OA 1WSJA 2FVRA 5K14B 2W8LA 1TV6A 5KT2A 2GUIA 4FLVA 3DLKA 3DOKB 5J2PA 1RTIB 1B9DA 1WSGA 3AA4A 3QIDA 4NLSA 4NRUA 5KG0A 1BGXT 3PUFA 4DFPA 1C2PA 2X6NA 3TARA 3OYNA 4ELVA 4KSEB 5DQIA 5EUHA 3SPZA 2D0AA 1B9FA 2D41A 3BSOA 3KOAA 2R7YA 1CSJA 4PY5A 3BSNA 1XC9A 2IM3A 4IH7A 4MK8A 4OGEA 3CVKA 4TQSA 3K5OA 1UWBB 3LP3A 3DRSA 3RMCA 1N6QB 5SZTA 3NAIA 2YNIB 4KHQA 3MFHA 4CHYA 3IG1A 2R2TA 4E19A 3ZSWA 4E7JA 3TAMB 2ILYA 4N47A 5KFEA 1DTQA 2R8HA 2BE2B 2WCXA 2RN2A 1IKYA 4DWIA 3Q8RB 2D3ZA 4BDZA 3GV8B 3KK1A 4J9KA 1QSSA 2HHUA 1KCFA 4KKOB 4W5QA 2IMWP 1RAJA 3AV9A 1HNVB 3ISNC 4G3IA 3DLHA 5C25B 1RT2A 3JSMA 4FBTA 4XPEA 4QWBA 1HJRA 3AVNA 2YKNB 4KHWA 1A5XA 4KV8A 3DLBA 1TKXB 2Z1HA 4ZVEA 4KAZA 4DTNA 4O3SA 2VG6A 1T3NA 1X9WA 2HMIA 4AHUA 3CO9A 4Q0BA 3KK3A 1RYRA 3V6JA 4Z4EA 1S48A 4LH5A 3DM2A 4ZPCA 3L3UA 3QYYA 5KFJA 4CJEA 4PQUA 1S1VA 3QZ8A 1TK8A 2UVVA 4Y1CA 1RNHA 3I5AA 4QWCA 5JXSA 3RAQA 3TAEA 3QEWA 1LWCA 3TAQA 1YVFA 2KQ2A 3NGYA 2W9BB 2OPQA 5T14A 1EP4B 2A1SA 1RT6B 3FSIA 4PWDA 3JYTA 1TKTB 3MR2A 5J2QB 5L1KA 4GC7A 4J2EA 2YKMA 3Q8PB 3QO9B 4GVMA 3RRGA 4O3PA 5KFXA 2ZQBA 2XY7A 5D3GB 4GC6A 4H54A 2RKIB 1C0UB 4QCLA 3NH0A 2KFZA 3TWHA 3DMJB 4O4GB 3OJUA 5HRPA 2XO7A 1NK6A 4FJ5A 4J9PA 1L5UA 2LSNA 1Q9YA 4CGDA 3BSAA 5FROA 1S6PA 4J9RA 4DL3A 2IS3A 4BDYA 1RDCA 2X6SA 4TYBA 4CHZA 5CYQB 2FBYA 3VQCA 3K5MA 4OKJA 3V9SA 3ALYA 4IDKA 4F2SA 1U04A 2XI3A 3MAQA 3HPHA 2HNZB 3ZSOA 2QV6A 5JS1A 3M8QB 1XHZA 3NBPA 3SFUA 1BQMA 4Q43A 1C1CB 2OPSA 5CZ1A 3C6UA 1TL3B 3GV5B 3LALA 5KFMA 2ZD1A 2HNYA 1BIUA 4K8XA 4QWEA 1I39A 3BQ1A 4DG1A 3HM9A 1ZBFA 1S1WB 3EPIA 1SV5B 1TVRA 3D5MA 2BR0A 4CF2A 4ECWA 4ZPAA 3V6HA 3LP2B 3PW0A 4NLVA 1S9GA 1LW2B 3OY9A 3SFGA 2FBVA 4FM2A 1RTDB 4CGGA 2B6AB 2Z1JA 2ASJA 3H5YA 4BWMA 4OKEA 1KFSA 4IG3B 5DGAA 4IFVA 3EY1A 2IA6A 1ITGA 3NF9A 1NHUA 2F96A 4E7IA 4J9MA 3OL6A 3RMAA 2KZMA 1D0EA 1N48A 4KBIA 4FJ8A 4W5OA 4DQRA 3VN5A 1SKSA 3RTVA 4DTOA 3PO5A 4BWJA 1BQNA 5KFKA 3TVKA 4JS5A 3RMDA 4K4TA 4YR0A 5C5JA 4QWDA 4EEYA 1W9HA 4OGCA 1VSJA 1LWFB 3T5HA 1RT3B 4DSFA 2YNFB 5KFDA 3M8SA 1JLBA 3QEVA 2HB5A 4B9SA 3LP0A 4OL8A 4EZ6A 1N56A 4E7HA 1ASWA 4KB7A 4JV2A 2D0BA 3HSTB 4FJLA 4I2PA 3V9XA 3PW5A 3O4QA 1T03A 3ZSYA 3GV7B 3KTQA 4DL4A 3VQBA 4OLAA 4ECQA 3CM6A 2I5JA 1VSFA 1HYVA 3FFIA 4FM1A 3H5UA 4FZXC 2YNHA 1WNEA 4L8RB 1RT1A 1NNDA 2DFHA 1UOCA 4EBDA 1C6VA 3G0ZA 4CEBA 1QTMA 1REVB 4DSKA 1NJZA 4C8OA 1JLGA 4Q0BB 3G6VA 3KLEB 3TI0A 4Y2CA 2YNGB 3DYAA 4ID5A 2R8IA 2FJWA 5KFFA 2P5OA 4WFYA 3H4BA 3V6KA 1HQEA 3OYFA 3N6MA 5KFZA 3HVTA 5F9NA 1J54A 4I7FA 1Y97A 3CYMA 2UUWA 1I3AA 4I2QB 1SKWA 4K4XA 4DU1A 3L2WA 4KHRA 1S0MA 1GOCA 3HVWA 2IM2A 3C94A 4K50A 3CM5A 3QIPB 1VSHA 2B4JA 4BDPA 2BRKA 2ZKUA 3LANA 5KT3A 1IM4A 3S3NA 4EBCA 5KFNA 3K2PA 2XY8A 3KLGA 5KRTA 1SUQB 4W5RA 4C8MA 2Z1GA 4N76A 1RT4B 1QAIA 1WLJA 5KFYA 4ED2A 4Z0UA 1DLOA 5I42A 2C22A 4IRKA 4NYNA 3VQ5A 3T5JA 4PUOA 4NRTA 4G1QB 2BDPA 5F8MA 3AVJA 4M3WA 2G8IA 4R8UA 3HXMA 4NCBA 4M3XA 4E1MA 1HPZA 3CFPA 2VG5A 4ZVFA 3TAGA 5DGBA 1KVCA 4B8CA 3RAXA 4BACA 1Q9XA 5CZ2A 4CESA 5DG7A 3VQPA 2AWZA 3M8RA 4WXWA 3LPTA 4J2BA 3SI6A 1JIHA 4CJTA 1WN7A 4TY8B 2QKBA 1NJYA 1ZTTA 3V1RA 2HNDA 3CJ5A 2IAJA 4HKQA 4HUEA 4DU4A 4ELUA 4LSNB 4CEZA 3NFAA 3DLEA 3K59A 2I1RA 3KLHA 3KMQA 1XHXA 1D9FA 3MXIA 2F8EX 3OL8A 2IDOA 4NYFA 3CDWA 4F4WA 2WONB 2WK4A 3QLHA 4RW7B 3M9MB 2W7OA 4ICLA 4F4YA 5C24B 5HROA 3DLGB 4WFZA 3RR7A 4HTUA 3KK2B 1S0NA 4XIUA 3T5LA 1MU2A 4RW9B 4OLBA 5KGWA 1KLMA 3T3FA 4CF1A 2ASLA 4B9TA 3DOLA 1KHVA 1JLCA 3QINA 5HRRA 3H40A 1C1BB 2AGPA 4CJRA 5HBMA 4ZPBA 1VRTA 1FKPB 4OKKA 4E1NA 1JLAA 2GIRA 1T05A 3G10A 3KMSA 4ZHRB 2VWKA 5KFHA 4KHNA 3MEDB 2XCPA 1CZ9A 1JLBB 3SV4A 5KRSA 4IG0B 3HKWA 4B9LA 3H2LA 3ZCMA 3AVMA 3B6PA 3LPUA 3CDUA 4RG8A 4CJ3A 4CFBA 4ZP7A 3NKYA 1SH2A 4E7KA 4C8LA 1IKVA 3BSCA 2HHQA 3T5KA 2ZE2B 4TLRA 4BE1A 1NKBA 3HT3A 3OYAA 3MXMA 2E4LA 4QWAA 4FJXA 5KFTA 1VSMA 1S6QB 4M45A 3MR6A 1Q8IA 3EZUA 3DRRB 1HQUB 3AVIA 3H59A 5EDWA 1EXQA 4DTMA 4EO8A 4FBUA 3LP1B 4CEDA 3F9KA 4J9SA 4RW4A 1A5WA 3KLIA 4OPJA 4AHCA 1TKZA 1QUVA 2JGUA 1HMVA 2HVHA 4J2DA 3PR4A 5J2NA 4CIGA 3CFRA 1S0OA 2V4RA 3Q8QB 5EWFA 5I3UB 4YNQA 1U49A 2Z1IA 3B6OA 4NLDA 3TAPA 2OYQA 4IQXA 3PW4A 5KFIA 3PO4A 4LSLA 4F2RA 4RW8A 1KVBA 4URGA 4FLXA 2B43A 3PX6A
chains in the Genus database with same CATH superfamily
2FLNA 1S72N 1TUWA 5HLFB 2K06A 3AARA 3C16A 1RWXB 1V4TA 3O6WA 5AQSA 3M1FA 3VALA 2E88A 2Q0UA 1ROFA 2RUSA 1Z2LA 4RUBA 1S9EA 1RT5A 4NA1A 2FSNA 4NCGA 2RUGA 5F8GA 4HI1A 3V6DA 5BYSA 3VPZA 1D8YA 1A9NB 5ADZA 1CQNA 4BGAA 4ZTFA 4ZVHA 2BBEA 4QS9A 1IKXA 4YFUA 3UDCA 1GLLO 4I0WA 3OV7A 2X3DA 3EDRB 1RHKB 3POTA 4CEFA 2G9OA 3ZSVA 1UFKA 1VSIA 1WHVA 2FYXA 4NLGA 4CJSA 2OAUA 1X0FA 1M5KC 1CXQA 5HVFA 3ULEA 3CIPA 3DXMA 1NG9A 3SNNA 4OYBA 2WAQD 5FPEA 4CK3A 4EHTA 1QQOA 3F5TA 3AO2A 2HQDA 4YQWA 2IY5B 3DKDA 3BEGB 1GMUA 4F4AA 3UVJB 1RHQB 2VFVA 1X1PA 1T9YA 4OZ1A 3U9ZA 4DTXA 1HHTP 4CBUA 2QLXA 2PC6A 4QW8A 3IBWA 4RNFA 1YXQA 1KS2A 5JLFA 2CH5A 2IC3B 4O5BA 1FFSB 1QSYA 2EG1A 3HOSA 4DMZA 3B8HA 1IR2A 3Q8YA 5DMRA 4QBUA 3ZEUB 2BJEA 1VSEA 3M8PB 4CF0A 4FXVA 4FWLA 5C2CA 4MDAA 4J9LA 3IUCA 1TR0A 2JRSA 1T9UA 2W40A 5BRFA 5HI7A 4UY8T 3HFZB 3SUOA 4DR4F 3UR0A 4HCCA 1YT3A 2B5JA 4EFHA 1VGYA 2Z8QA 2C2DA 4NXNK 4DPOA 4F3OA 3LM2A 4KFBB 2MQLA 2UU9K 3W60A 2BGGA 4U67Q 3R5CA 3HJVA 4YHHF 4NI2B 3CJ8A 3KJNB 4MFBA 3OYJA 4ZCKA 3WZ0A 4DI6A 1GX6A 3CC2N 4NLOA 4AD6A 1AUSL 3FBFA 3OS2A 5HL7Q 3GZ7A 3QNWB 4BRKA 3BGOP 5DG9A 1WOSA 5DDOC 4DFKA 1N5YB 4KGKA 3MR3A 3L2RA 3K17A 3M30B 4L76A 4KHMA 1RK8A 4DQPA 1Q0NA 3K5LA 1N36K 2YHYA 1LW0A 1S6UA 4ZITA 4YMEA 4DKWA 4MTPA 1U0SA 1QSLA 4E89A 4P2SA 2XG8A 4YB6A 1E6VA 4GVLA 1K8KB 2M9KA 1HYZA 3TEHB 3MUTP 1JLQA 2HS0A 4CHOA 4V19X 4I56A 4JI2K 2E6MA 3CJQA 1DGKN 2H4WB 3D0IE 4JKEA 3VEZA 3QMQA 4W4MA 4F25A 5CHIA 3SQ1A 1BUPA 5KFOA 4BRNA 3C3LA 4DQ8A 4NPOA 1PIEA 1S57A 4ITSA 4CE9A 3L8BA 4B9MA 5FLXU 3NGDA 4WQ4A 3ZETA 4KHSA 4H5NA 3I0RA 4WTYA 4F4XA 4OYPA 2JLGA 2RE2A 1M1KT 4KGVB 2K2PA 4WBFA 2Y9HA 1G1XA 1WC4A 4IDHA 4HDGA 1DTTA 4LF4F 1U8SA 2EX3A 1H6KX 3RMBA 3O9RA 1RWUA 3OA9A 2ADCA 5K8NA 3CERA 2OEKA 2HFVA 1VQNN 4A8XA 5FDLA 4QIGA 2Y1IA 4OYXA 4B3MK 4B3OA 1IKYB 4OVLA 4Y2MA 3S1TA 1UJ5A 1X4FA 3Q8VA 1IKWA 3KK1B 4QR2A 2DY4A 3NRBA 5B0EA 4ZVRB 1JX4A 3MM6B 1RT2B 3OSPA 3VQEA 2D9OA 2CJQA 2FHKA 3QICA 3I32A 5FPDA 2HIYA 1S97A 4KV8B 4HT7A 2NLXA 3L4QA 5E26A 3AVKA 5T7LB 2RRNA 3B54A 1HD0A 1I6JA 3KK3B 1MLAA 2HHHJ 4H4KA 4JI2J 4OI2A 5I3QA 4DEZA 2NYHA 1N8RT 3OBWA 1DHMA 3MEGA 1D5AA 1HI8A 2CWKA 4KRFA 4EP4A 2Q3SA 5MAOA 2G8WA 4DPTA 3VQ9A 4DTRA 1VHIA 4KI4A 4CBXA 1L3TA 2R4FA 3FJ2A 4L3QA 4N56A 5ETOA 4DUYF 3V4IB 2AZ3A 4CH0S 3MCMA 4FYDA 1AUDA 1UW9A 2Y1JA 4FK2A 3WQTA 1KVJA 1JNRB 4ZVGA 1NEEA 2VFSA 3HZEA 1T0TV 3D45A 2WBNA 4LF7F 2O66A 4DF8A 2KB2A 3PIOL 4JI8K 4EP5A 3CQ8A 4B3TK 4NE9C 4C8ZA 2XGPA 4DU7A 1PC4A 4OYIA 3VQ4A 3RYLA 4DV3J 3MMAA 3FVYA 2B8PA 2F9JA 3FEXB 4BY9C 3AA8A 3GFZA 2VFUA 4IFEA 1EWQA 1O51A 5KFWA 3NBPB 5HANA 2D0CA 1HBUB 4DV1F 2LU1A 3C6UB 3IWNC 4BREA 3G6EN 4FJGA 4ZS6A 3QZ7A 1X60A 3FR0A 4DMNA 3VAIA 3W8PA 4EZ9A 1SC1B 4DG1B 4KKOA 3I9V9 2R2RA 3QERA 5C25A 1U2RA 2R7TA 3JS6A 2NRRA 4BVPA 2VCPA 1CJTA 5DETA 3PHEA 1TKXA 1WF1A 2FLOA 4MQ3A 1HNXK 5KG4A 4IKFA 1NK4A 1U25A 1KVAA 2MLXA 4CWBA 1YZ7A 3PV8A 4X4RA 3I0SA 3KHYA 3SCJE 4R0EA 3LWMA 3R9LA 1TL1B 4ZK7M 1BQNB 3D66A 4DV2K 5KG2A 5JICA 1ZPWX 1CULA 4C11B 3KJQB 1VBYA 3VMFB 3RWUA 1H2TZ 1OVYA 1R31A 5B0BA 2DJWA 4O8KA 2B8QA 4DV0F 2ATCB 2MSTA 2G1HA 1NBEB 3MR5A 4CFAA 3BKTA 2GO8A 2R7OA 5KTQA 1AZSB 1WI8A 5T41A 3BJYA 4B17A 4MYUA 5J2QA 4FNIA 5F0XA 3F41A 2AJ1A 3CF5Q 4A8FA 1T03B 2YX6A 2E5HA 1X7VA 3I31A 3ZZUA 4K4YA 2G0CA 4X4TA 2YWWA 2NUBA 2MKYA 2HS4A 3RB6A 1U1MA 1OJ4A 3C6AA 4Z4FA 3Q8UA 4FYXB 1RT1B 2KHDA 4CGFA 1NDCA 3IKMA 3O8WA 4Z2XA 2YH1A 3EE8A 2EC0A 1EO1A 3VENA 4WFAQ 3I33A 3EKSA 1OMSA 2EK1A 3LDPA 2Z2LA 2DR6A 3DYAB 2UP1A 4M7YA 4MAKA 4K4UA 3ZO7A 1KOOA 3FCHA 1HNXJ 1YWXA 2XB2D 3THXB 3IM8A 3MN6A 3QGGA 3R8YA 2FZCB 1V6HA 3IAM9 5ITHA 1RBOB 5IXUA 2J0QD 2GTDA 3X1LB 2DR5A 2Z30B 3MPVA 2DXFA 4DQQA 3LGNA 1S1WA 2C2EA 3WXIA 2FJEB 2BYCA 3R9PA 1FXDA 4IOAL 5J1PA 3QT5A 4OQJA 3KLGB 4CF9A 3KLVA 4FLZA 3G4SN 2GZOA 1UPMB 4O0JA 1RDRA 4ILMA 1ELOA 5I42B 2EBGA 3GIIA 4FWOA 2DNYA 4IBNA 4CJLA 4OX6A 5E3QA 2UUCJ 5H9FJ 1WDTA 1Q86O 1GFWB 4R8UB 4NLXA 4CI0B 2BXJA 4L74A 3LM9A 1S4EA 3ZNUA 4KT0C 4AILC 5LMUK 2RQMA 5LSRA 1I94J 3QRRA 2OFHX 2CGKA 2CYYA 2QMUB 4BRGA 5AQTA 3VAJA 2IAJB 4OX8A 3VWSA 3GJRB 1D09B 1WSIA 3DLEB 2ZUGA 1VK3A 2WC9A 1O6XA 2CDRB 2AGQA 1Q5VA 5F8HA 2PIIA 3NWRA 1QQNA 5HROB 3PYGA 1KQGB 1FD2A 4CTAA 3RU0A 4K7QA 2PEBA 1REVA 3JSYA 4YS2A 3KNGA 1MU2B 8RUCA 2YNGA 2FVCA 1XR7A 3B4MA 2UXDJ 4X62F 1NOYA 1KLNA 2E5IA 2MEWA 4USMA 3NS7B 1M5SA 2XMMA 2XRIA 3ENQA 3MMBB 1FKOB 5ETLA 2AX0A 2B4VA 4WFXA 2EFOA 1B7YB 1FTCA 4WJBA 5M2RA 2L48A 3KHLA 4C4WA 3BYPA 4NLYA 4F67A 3C6HA 3TABA 4NA2A 2PA8D 2GCFA 2IMOA 4LVOP 5LMUJ 3SDEB 4ECRA 2XSJA 3M2UB 3J7YP 4UTGA 5HOOA 4LRCA 2OLWA 4JHDB 1K44A 3UW1A 4Z4CA 5EY4A 1QJHA 2O67A 1FWLA 5FJ4A 2LU2A 1VQ8N 2C2NA 3B78A 4O3NA 5J2NB 4QIWD 2UXBK 2JVOA 1R8CA 1Y0HA 2YVSA 4AHVA 2PYLA 1KTQA 3AA2A 4Y3CA 4CRJA 4RW8B 2GS8A 3TWZA 3H45C 4LSNA 3GSIA 4KRWA 4CEEA 2E9RX 1LXNA 4DR1J 5F9LA 4Y28C 2B51A 3QQCD 2GIQA 1G15A 3IBCB 3C16B 2LMIA 5K20B 4CJ7A 3L2VA 3TP2A 2ZH3A 4N5SA 2KH9A 2HFZA 4KHYA 4DBQA 2D4WA 3DLGA 4IH6A 4WU2A 2GBZA 2JFDA 2LVWA 3F56A 4C97A 1S9EB 1RT5B 2XWYA 4NCGB 3D6MB 1XNQK 3MXHP 1NOZA 4QJVA 2VFRA 3V6DB 1DEJA 3QESA 3AGKA 2L9WA 2CQCA 4WKYA 1IKXB 3S8SA 3PNIA 3AO1A 1JL1A 4FYYB 2WVBA 4JV5J 2EFVA 2GMJA 2XGQA 1X5TA 4TN2A 3POTB 4M95A 1NSKL 3MTKA 4JI3K 3KYLA 3BO2A 3RBEA 1VQ4N 1IWAA 3OXLA 1VK0A 3ULEB 3DXMB 1RBSA 3MEDA 4G1PA 1IBKF 1KC8O 5CZVA 1YGYA 4OJHA 3THTA 2O5DA 4JI7K 2WUSA 4DL5A 1C1AA 1FVSA 3VCDA 3MX2A 4XAKA 3W1YC 4OLOA 3C0BA 3OR1A 1X31C 4FJ9A 3IWLA 6AT1B 2UXBJ 4FVUA 4X64J 3VGKA 2M5YA 5C0YA 3ZX2A 4A8MP 3FUYA 1SL0A 3FQLA 3A3OB 5IWAJ 1QS4A 3NMRA 1SAZA 2Y1LB 3LP1A 2QX0A 3A8YA 1YTAA 2R7XA 3CTRA 3PW7A 3O08A 1MWQA 4RPFA 1IG9A 2P9NA 3CG7A 2KLAA 2JEJA 1KXPA 3IMXA 3OS0A 3NAEA 4AHRA 1VQPS 4WP9A 4CJWA 1N34F 2I7NA 3ENVA 4KR0B 3HYFA 1IJEB 2DNQA 2F5GA 2W4CA 3DDIA 2VF3A 2B5JB 4WCEL 1M5HA 2BQRA 4DR5F 3CCUS 4TYAA 1EKRA 3TZYA 3VF4A 5BR8K 4ECZA 5AE3A 2EVZA 1ZA1B 2BM0A 4MFBB 1RE1B 2BJ1A 4ZVOB 3PZPA 4U8VA 4BROA 4FLYA 4JRQA 1V3RA 4Q8FA 4DV5J 1WSEA 4WXOA 2VQFF 4MH8A 1HL6A 4JI7J 3ADAC 1GMWA 4P6QA 2QWRA 2UUAF 4FCYA 4NLPA 3I55N 4ECVA 4K4ZA 4W5TA 1LW0B 1O5JA 4FOEA 4F8RA 4CHQA 4Z4IA 1VRUA 4DJBA 5KT7A 2M7SA 1BI4A 1YRTA 1WC0A 4FWNA 4UW2A 1E6VB 3LAKA 4LQ9A 2PEHA 1VQMS 3P8BB 3H98A 1C4CA 5GIOA 3KD5E 3CCSS 3WQUA 1JLQB 3TO8A 3DLLL 3VZHA 1BCMA 3GBTA 4CD3A 2MGZA 4ED6A 1S10A 3D1QA 4ZLNA 2VZ9A 3W3DA 1HNZK 2Q6BA 3GIJA 4KHPF 4OHXA 5IFMA 3L4IA 3AXKA 4OJ3A 1YBAA 2ZVIA 1MWYA 3GG1A 1UVMA 3NMAA 1DRZA 1N32F 3A5NC 5KFBA 1G4CA 2HHPA 4Y65A 2GFFA 4OFZA 5C15A 4MK9A 3AVBA 2AU0A 3VEOA 4BE0A 2JH3A 1B64A 3ZETB 5AXKA 2VONA 3I0RB 5E3AA 3K57A 4I64A 3CJ1A 4YEAA 1EX4A 5BR8J 3NE6A 1FRLA 2XNQA 1WAJA 2W9BA 3MR7A 3QRPA 1R0CB 2B9XA 2HHSA 5G4DA 3MECA 1LK7A 4WFBQ 5ETMA 5FDLB 5CY4A 4P2XA 3VV2B 2RDIA 5KPRA 2Q3PA 3HSZA 1WB9A 1UW4A 1NO8A 4B3OB 5D3GA 3AVCA 2VUGA 4BQZA 1NK7A 1IKWB 5HJYA 2C28A 1Y64A 3KG4A 4ZVPB 4CJVA 3T6BA 1Y11A 3GE1A 4UY85 4DX6A 4QR0A 3F2KA 2G8HA 4UUWA 3NS6A 3CSKA 2CQGA 2IGIA 2G0JA 3NVKA 3NL0A 4H5VA 4LY7A 2E9ZA 2BMBA 5AQRA 4PG8A 1A6LA 1KD1O 4DHVA 4IQMA 4DSLA 3AVHA 3E2EA 1RUSA 1HNZJ 2J6SA 2VBZA 3MEGB 3DXKA 2HFUA 1HI0P 1BQXA 5CHCB 3PHTA 4URSA 1RCOB 1KQSR 2VBWA 3VGTA 4AQYK 1N0VC 3DLKA 2EI5A 1CPZA 3W7BA 1IV0A 1WSGA 3AA4A 3QIDA 3W2VA 1BGXT 2B9EA 3PUFA 3RVCA 1C2PA 3TTCA 3AOBA 3VEWA 3CMQA 3NGSA 2GX8A 4ZLPA 3IR6B 1G3OA 4TNOA 4ISGA 2V5HG 1OH5A 3FFKB 3O9UA 4WFBL 3CNQP 3FZKA 3CE8A 1WACA 3VHQA 3DOMA 1HIYA 2FC8A 4R25A 3MMAB 3LP3A 1YBUA 1FX4A 1YJWN 3CCJN 2QGFB 1UJ6A 4CHYA 1F9FA 2R2TA 4E19A 2H5JB 2P6TA 1U26A 5FD1A 3U1LA 4CQ1A 5I3PA 2ZEJA 3H8YA 2R8HA 2XHWA 4LFAF 2RN2A 3Q8RB 4JKGB 3O8MA 4BRHA 3D6FB 4J9KA 1FE4A 4KKOB 4AL5A 3AV9A 5LM7E 2RHSB 4G3IA 1CC7A 5C25B 3W2WA 4XPEA 4DUZK 2EK6A 1APSA 1TKXB 2Z1HA 4ZVEA 4KAZA 2Y8WA 2FPHX 3QB0A 2V6AA 4O3SA 1BWVA 1X9WA 1SQGA 2HMIA 3CO9A 3TJAA 4AQYJ 3SMPA 3E1YA 1WHWA 3G8QA 1RAOA 3QYYA 4DR3K 4CJEA 1S1VA 2MKIA 1YITS 1QUPA 3NGTA 3MD3A 1F3VA 4YOXA 3TAEA 2EEYA 5F0UA 2OSQA 1LWCA 1JCEA 4XEIA 1CULB 1H1VA 3TAQA 3CC7S 5JLHA 4K41A 2DHHA 1SJRA 2OGUA 2OPQA 5ETTA 4NXMF 1TFWA 3CXCR 1U1PA 3D0HE 1KTVA 1UVLA 4PWDA 1G99A 5J2QB 4J2EA 2YKMA 1X4HA 2NSCA 3J7YU 3O5BA 4GVMA 4B02A 4J9VA 2CJYB 1HWIA 2GMHA 3N79A 1SZ2A 1WTFA 4H54A 4QCLA 3J7ZO 1L5UA 4CGDA 1WEZA 1S6PA 2GEMA 1YJRA 3P49B 4LF8J 3VQCA 1PJ5A 1JQGA 2E8AA 4OKJA 2YXLA 1YRXA 2ADBA 3ALYA 2B0GA 2X3GA 4DUZJ 2DKOB 4BBYA 3CEDA 3UR3C 3OBYA 1VLOA 4DR6F 1BQMA 2CG8A 3WDOA 2OPSA 4CH1A 1X8DA 5HJXA 1OSCA 5LT5A 3GV5B 3PSIA 2ZD1A 2HNYA 1BIUA 3BQ1A 4JI4K 3MWTA 1S1WB 4DR3J 2BR0A 3D5MA 1YJ7A 3V6HA 3PW0A 3NWGA 4NLVA 1DT9A 2HF4A 2BKNA 2V34A 1RSCA 2Z1JA 3DGVA 3DGPA 4IFVA 2YQ3A 3W9HA 1Q82O 3OL6A 2E5JA 4DR2K 5A8KA 2KZMA 1N48A 4JI5K 3CD6N 2CQPA 2ZWPA 4DTOA 4FWKA 5KFKA 3TVKA 4K4TA 4YR0A 2VC1A 2HPUA 3M8ZA 3R1XA 3AFGA 3D54A 4XK8C 4MDBA 3O6QA 2AIRB 1NGAA 3QFWA 2X51A 3CDBA 1UVKA 3LP0A 2HVDA 4EZ6A 4JI6K 2U2FA 3HSTB 1K47A 4DB3A 3O4QA 2ZBRA 3SIPB 3DNCA 4A8KA 2NRTA 3CM6A 2I5JA 1OH8A 1HYVA 4JI1J 3FFIA 3HSCA 2IRYA 2KU7A 3CCLS 2HZCA 3MOJB 4JYAF 2W01A 2MZTA 4EBDA 5G0RA 1Z05A 4CTAB 3HHLC 2Q2RA 5AQLA 1REVB 5F2RA 4LMZA 1JLGA 3AHPA 4Q0BB 2YNGB 2FJWA 4CO2A 5KFFA 2YKPA 2YX7A 1PJ6A 4K8RA 3NNAA 3HVTA 5F9NA 1IXKA 2C3UA 4DU1A 4KH6A 3C94A 2DY1A 5BREA 3K9KA 2ZDOA 5HVHA 3LDLA 4FPRA 5KT3A 1IM4A 2P9CA 2POKA 3S3NA 2NZ4A 3K2PA 1KNZA 3GG4A 5M2UA 5KRTA 1B0VA 5HK4A 3EX7B 4N76A 1EWRA 5AQJA 8ATCB 1RZMA 1W2IA 4Z0UA 3UCUP 4YHHK 4YDDB 1DLOA 2RJZA 2C22A 3O1LA 1RTZA 3VF6A 3T5JA 2W2MP 2XSJB 3L7PA 2HRYA 2MSSA 3U1NA 4U96A 1NJIT 3KDNA 1ZM4A 2GHVC 4R0JA 3MPWA 4M3XA 4E1MA 4UOHA 3MPDA 1KVCA 3WXJA 4MJKA 1Q9XA 2JL9A 4FVCA 5DG7A 2AWZA 3M8RA 1QVFM 4Y2IA 1JWWA 3LPTA 1TMJA 1S59A 3IO1A 1ZTTA 3CJ5A 4LSNB 2QSFA 2LEAA 2YPZA 3ENBA 1JXVA 3NXZA 5D4NA 2RQ4A 6FD1A 1UP1A 2F8EX 3OL8A 2KG1A 2HBLA 4EMDA 1F2GA 3UN5A 4JI0K 4ICLA 5DJBA 3J81O 3DLGB 2ASMA 3RR7A 2LCWA 4XIUA 3CDAA 4DR4J 5KGWA 3T3FA 1VS3A 2ASLA 4PCQA 1KHVA 3F0NA 4DX7A 1ZXOA 3H40A 5HBMA 1F1BB 4YHHJ 1VRTA 1OQ3A 4H03B 4QIVA 4E1NA 2GIRA 5A0YA 4BG9A 4L3NA 2PAVA 5LL6Z 3IRWP 3SBGA 3CJ7A 3MEDB 2OMOA 3CPWM 1YQHA 3SV4A 4NXNF 1HBOA 4B9LA 3FZFA 4RWWA 2UU9F 2NRZA 3ZCMA 4RG8A 3P5BP 4ZP7A 1SH2A 1IKVA 2HHQA 3OR1B 4BE1A 1E6YA 1NKBA 3OD2A 4M5IA 2E4LA 3FZHA 1UZDA 1VSMA 1MG7A 5EVZA 2GWJA 4LF9K 2E1MC 2VBXA 2JSXA 4FBUA 3MN9A 3LP1B 3F9KA 2FIUA 3BF1A 2B56A 3KLIA 3EXCX 1TKZA 1QUVA 3SBMA 2HVHA 1I1GA 1N36F 4CIGA 3SQGA 1S0OA 2V4RA 5CE3A 5IM0A 4YNQA 2P9NB 4QOTA 2O8CA 4MLHA 3PW4A 2J4RA 4GKKK 2I6WA 2FD2A 4P74A 1WBBA 3EZOA 2FF3B 5GAHI 1S12A 3SAGA 2PI4A 3CCZA 3VOVA 2MZJA 3PX6A 5EX5A 3CCQS 1RHJB 4LT6A 3KFWX 1IWGA 2QYGA 3MAHA 5KG5A 3E8OA 2D7SA 3SK3A 3BZKA 2AGOA 1S1XA 1XQIA 1MWKA 1R0BG 4LF4J 2L9NA 2QL9B 4MK7A 5LMNF 2FC0A 3OHRA 4DL2A 1GXUA 3OYHA 2R7SA 4IR9A 3ZXWA 1TAQA 1ATSA 2LKZA 1GH8A 4O4RA 1PCAA 1P90A 1TL4A 3P3DA 4F02A 2QL7B 4A8OA 1GOBA 1P27B 3AOAA 1JKHA 2EKNA 5FRMA 5B0AA 1ITPA 3QPIA 4HT5A 2XTJP 3GJTB 1VRUB 3PIPQ 1H98A 2FBXA 3RRHA 3CMES 3NP5A 4LF5K 1BI4B 4A2AA 3KHHA 3PJXA 4FWSA 4B3MF 4BQLA 3N0VA 3T1AA 2HHTA 3V81A 2R2SA 3IN5A 2HVZA 4USKA 2BE9B 2ERRA 1LWXA 2AYBA 3LTOA 4PR6A 2IVNA 3ZT4A 1WC3A 3DU5A 2MGZB 1QVGM 4A47A 3H7HB 2ZH4A 3LDOA 3TR5A 1RB0A 2ZBPA 2AF6A 3QAEA 4WE1A 4C7QA 1VQ9S 2QXFA 4HVZA 4V19J 3ASMA 3A8KA 2V4QA 4ISFA 2K3KA 1UL3A 1YI2S 1NK0A 4PG7A 4CJKA 4ECXA 3QFPA 3DRXA 1KQKA 1MMLA 3HVRA 2E20A 1JLEA 1HPMA 4DUYJ 3CJ9A 5J2MA 1VQOS 2BQ3A 2OIHA 1TUGB 2QJ3A 3MECB 4LF7J 2MDAA 1SJ4P 1F9HA 3N6LA 3I4HX 4CCHA 3G6XA 3F9MA 2NXUA 1WTBA 3T1YK 1VQ5N 4Y34A 1BA1A 4NZ0A 3H46O 1TL7A 3RR8A 2FHJA 2YX4A 3OFFA 2IVMA 4Y00A 2NRHA 1L3UA 3EGZA 1RFQA 1S5ZA 2BQUA 4K2XA 4JI8F 2A18A 4B3TF 4DV1J 3J7YI 5AQXA 2E7XA 3U8XA 1XN9A 3SZ2A 3VEYA 1RBUA 3HHLD 1LXJA 2OZSA 1HBNB 1I3OB 4N7TA 3VA3A 1YJNS 2JWKA 3OYEA 3DXKB 3NCRA 2R8GA 3CCVN 4H5TA 1NM1A 1RHMB 2F4VF 4CECA 3JTOA 1VQLN 1OPZA 1RWMB 2O8EA 1QTNB 1JJ2M 4DV6F 1JXLA 3SSQA 2OPRA 3PX4A 3ICLA 5L9XA 3DLKB 1GLJO 1XMBA 4CLLA 4DFMA 2YJEA 5DK5A 3AODA 3W2VB 3IGNA 3LZJA 1IH7A 3MAAA 1HNXF 4FWMA 3D0PA 4BC7A 3AJDA 1LFWA 3OTDA 2J6UA 4FWRA 4A62A 2HYIB 3MUVP 1RT7A 3SI8A 2C2KB 3LW5C 4DV0J 4PKGA 5M1KA 4RKUC 4O44A 1RAEB 2ZWOA 3PRVA 2WBMA 4UQGA 1Y00A 1ZBUA 3DOMB 2OEJA 4H5RA 4DV2F 2D3OR 1RBVA 4C3KA 2ZZTA 1S22A 4MT1A 3B82A 5EX3A 3ZTRA 4JEPA 2NUUG 5KFSA 4HUGA 1QE1A 1RTJB 3J80Y 1U1KA 2E1PA 1KC8T 1X4EA 1FFWB 3ZT2A 1JLFA 3OVSA 2E2QA 3RSEA 3K5NA 4MIBA 3QGHA 4OZ5A 3AVAA 1XTZA 4RNNA 1X4DA 3NCQA 3W2WB 5GAEP 2PD1A 2BKPA 3CC4N 3I8BA 5A8WA 2I0XA 4Q7AA 3P4IA 3MCNA 5A76A 4I9LA 5F8NA 4LF6K 4PYDA 4H5WA 3U3YA 2HK2A 2HMIB 2W9CA 2ZH5A 3OYGA 1LWEA 3MHYA 1WWHA 2N4CA 3M2RA 1S1VB 4ED4A 3MEEA 3O4NA 1M90O 3RBXA 1G7CB 5AXNA 4B1ZA 4USTA 2V2QA 1LWCB 2RF2A 1Q81T 4X62K 2CQ1A 3C6TA 3QETA 1NSAA 1FK9B 2DGTA 1HX1A 2V8PA 3VAFA 2CVEA 2OPQB 3UE2A 2ROEA 4TU9A 3PACA 3TUJC 1UA0A 4PWDB 1RTIA 2YKMB 1AA1B 3H08A 3AAPA 1KVKA 4RZRA 5EXWA 4QPXA 4CZKA 2DPIA 4EYHB 2DNLA 5GMEA 4ZIWA 4JUZA 1BY9A 2OHDA 2L41A 1IQTA 1S6PB 4C0BA 4CI6A 3UCGA 4H0YB 2NRVA 1H2VZ 3LGMA 2HRUA 3O3FA 3W8GA 2E5GA 1HR0K 3T9NA 5L1LA 4KI6A 1HHSA 3QEIA 3Q7BA 1N6QA 2V67A 1U1LA 3TR8A 2YWGA 2FZKB 2YNIA 4F3QA 5D4LA 2IIHA 3HPOA 4F04B 2BJDA 2VH7A 5DLFA 1BQMB 3CCRS 2OPSB 2BE2A 2FBTA 3OYIA 1XJWB 4MIAA 2ZD1B 2HNYB 4CIFA 1ZAVA 4M3UA 3PW2A 1OWXA 3C2PA 4BC9A 2ZGZA 4P7VA 1HKCA 2A0FB 4X62J 1XMQK 2XMVA 2UYTA 3PR5B 3PRDA 2JEFA 3DGPB 4A57A 2R42A 4IFVB 4FYWB 1X5OA 4YDUA 1RWNB 2BTFA 3IS9A 5A8KB 2HS3A 2P9GA 3O2IA 1VSLA 2D5RA 3THVA 3GOIA 1N5VA 4DLGA 4DV4F 3ZNJ1 2Y0SD 4KTZA 3R3LA 1H74A 4ANCA 3UI3A 2M2BA 2J0WA 2OTJS 5DS7A 1UTAA 1ZBSA 2RNEA 2J9DE 2DNMA 3WXMB 2YWFA 1KP6A 2FJXA 3QJJA 4OPAA 5J1NA 3LP0B 4TQRA 2ASDA 4IRDA 3CDEA 3HI0A 1IBKK 2F8SA 4ES2A 3ATVA 2RKIA 1C0UA 1BXNA 4K4WA 2I5JB 4C8NA 2YWEA 2WW8A 5THWA 2XC9A 3QT8A 3I96A 3FFIB 3HFVA 5I4MA 1WSFA 3SJJA 3L2QA 3OFEA 1SIWB 1KD1T 2AX1A 2CG4A 3L4BC 1U02A 1ASUA 3VQTA 5G0RB 3D6TB 1JLGB 4X4PA 2HWIA 1OIAA 2R7WA 2ZJPQ 3U9DA 3IGVA 1S0VA 2LYVA 1C1CA 3HVTB 1SS6A 1D9AA 5KQ8A 3PKYA 3GG0A 5D6GA 1Q1KA 1V9OA 3VEVA 1WG1A 4WZQA 3O1WA 3WNGA 1Z1ZA 2R7RA 2SXLA 5IQ6A 1VBKA 4CEQA 4J9UE 1J53A 3UKUA 1IVZA 3KD1E 3AH6A 1RTDA 4LIWA 5CYJA 4WFNL 3PJ9A 4WF9L 1YJUA 2O01C 2CJAA 3KKRA 3VQSA 1DLOB 5AZIA 2VGMA 4XDDA 2DTUA 3GR0A 1UAWA 3R27A 1XNQF 1DJ0A 3G8SA 2VICA 1IBKJ 3RB3A 2ZH7A 5BYQA 2EWSA 3SJHA 4UQTA 1S9FA 1R6VA 4PWUA 2GC8A 2R2UA 1Y3KA 4RWTA 2DHXA 1WSRA 2HRTA 3RG6A 1S77D 1QZ6A 4JI3F 3BB5A 1KONA 3BEXA 2HF3A 3WNEA 2LEPA 1C0FA 2A41A 3QNOA 1P9QC 5DQGA 3TOQA 3KUGA 3BYRA 2QZ8A 2DK2A 2P9UA 2VD3A 4BR4A 3W3SA 3IXQA 1WC1A 2YHBA 3R6MA 1VR6A 4LRBA 3ZZZA 4ID8A 4B3SK 1GLDG 4ICLB 3LQVA 2NUHA 4K4VA 1RDDA 4RCHA 4EU0A 3BDEA 2IHR1 4X4VA 2KM8B 1U1NA 1URRA 4P2MA 1OY9A 4F3TA 2VPWB 4A8QA 2ATLA 1JL2A 4DTPA 5EWEA 1FTRA 3KLEA 3J8AA 2HBRB 1SJFA 4DN0A 2LFVA 5GAGP 2UUBK 3D3CJ 4C8KA 4H0PA 2VIHA 2EWHA 3V4MA 5HBMB 1W26A 2CQ0A 2ZJQL 1VRTB 4I2QA 5KG1A 1FE0A 1SPBP 2BVZA 1W25A 2HVEA 4CZFA 4TU7A 2AHOB 4Q44A 1U48A 3BY5A 4JV0A 3U02A 2KKHA 5DDRC 4ED3A 2VQFJ 4NASA 3S7RA 1HBOB 4ZVSB 4L73A 2DFEA 2UUAJ 3J7ZT 1SVDA 3HSDA 1UEVA 5BR8F 2AT1B 1IKVB 4X66K 4KIAA 3LUYA 2F1FA 1E6YB 4YR3A 1BHNA 4AM7A 1CS4B 4X4NA 2M8HA 5H9EK 3CW2C 3E9OA 3N28A 1FRIA 2YJFA 2JZ5A 1CZBA 1X0PA 2LQ9A 1QD1A 2AV5A 2HSTA 2VPYB 3ET6A 4HACB 4WP8A 4RNOA 4QQBA 2QWPA 3KLIB 2W42A 4B3RF 1TKZB 2XO6A 2QA1A 4LFBK 4B3SJ 3SQGB 1UA1A 2OUGA 5IM0B 1S4FA 4KHPJ 3H1QA 2MMYA 2O8CB 4A8YA 1FERA 4QIFA 4DTJA 2X1GA 2XSFA 2JLFA 1LNQA 4WK3A 1BISA 3P83D 3PJWA 2F9TA 3R5AA 3GQCA 2ZOFA 1VQ6N 5DG8A 2QL5B 3RAMA 2CUYA 2R8KA 1AFJA 4RW7A 1S1XB 1IG8A 1KBRA 3ZSRA 2COLA 1S7HA 1MN9A 1ESVA 1BLUA 5DM7Q 2KM8C 1Q82T 4CJUA 1H2UX 3RB4A 5K5MA 4ECTA 1SJ3P 1R8PA 1RAIB 3EGWB 2E1AA 3HPGA 2O8BA 2JWNA 1JNZB 1C1BA 3UD4P 4B9VA 4H0VB 2X74A 2GMLA 3DRPB 1JKHB 1H0HB 5GAEU 4JKCA 2CNNB 4AFFA 4FK0A 1HFEL 4PKHA 4ZHRA 4JV1A 1HNIA 4L75A 3EWGA 4E3SA 3VA0A 3EGNA 4IG0A 3V81B 2QM1A 2HHWA 4ZLJA 4LBIA 4LFAK 4DCPB 2D3O1 2B4PA 1NB2A 1FF2A 4OI1A 1AT1B 4OV1A 2WBRA 3N6NA 2VDHA 4YP3A 1K8AO 2JC1A 4CLKA 4AH9A 1NDPA 4DL6A 3OR2A 3AQPA 4DU3A 2V50A 5ETSA 1M5OC 2ZWHA 2OPPA 2ZDPA 3ONQA 2VWBA 4WE1B 1PAUB 1TL5A 1KHWA 1FNXH 2IJFA 4Z94A 3G2XA 1EJ7L 2OTLN 3I56N 2DIUA 3OTEA 1ZM2A 2UXCF 1S6OA 2KW4A 1YTUA 1P1TA 1ZA2B 1T11A 4U7UD 2XHCA 4ZPWR 1JLEB 2OCEA 1RLCL 4BR5A 5J2MB 2G8FA 4MKAA 2XZTB 4A5AA 4BRCA 4TSXA 4E7LA 3VVTA 4OJRA 2BE7D 4CK2A 3QIOA 3UQSA 2QW9A 3DHXA 3U4LA 3UNYA 3N4WA 2VA2A 5GMKa 2H54B 4P72A 2BEFA 1SIZA 4I67A 5CYMA 2DH7A 3PM9A 1DAXA 2FY8A 2VKZG 5F0WA 3R7SB 1EARA 1TL7B 2HMPA 4JKBA 2XWXA 4JKAA 4RUCA 3CWJA 3DWLA 4JKFA 2IYGA 3FE1A 3A4TA 1VIOA 2B9YA 4LFAJ 4U7BA 1EQ0A 1ZBHA 1IJFB 2FY1A 1VI7A 3CJ2A 5D4PA 1B70B 4DLEA 2V9KA 3T69A 4WYWA 4CM0A 4OI4A 1J5EK 4OX9K 4CO0A 3TUIC 4FS2A 1CQMA 2VG7A 1S1TA 2OZMA 5J1EA 4RWXA 1QAXA 2RAQA 2D0OA 5KFUA 3I8DA 3P1GA 2O8EB 3M6WA 3RW6A 2Z2MA 2VDIA 3H2UB 4DOZA 2OPRB 3LH2S 1XEZA 5C42A 5HP1A 1RBRA 3M1VA 1B4SA 4DUZF 3GONA 5HMXA 3R1LA 3MAAB 3TQ1A 3SCIE 3CCEN 1TQLA 1KSPA 2ZHAA 1Q8BA 2IRXA 1VHXA 1SL2A 5EWGA 1RT7B 4ZPTR 2A6MA 3R97A 4NXMJ 2FJBB 4F0HA 2G8UA 4GRSA 1XMOK 4O44B 1UKUA 1Y4ZB 3BREA 2FJVA 4DR3F 4BRFA 2E29A 5KFCA 1RJJA 2PYJA 2V69A 2JEIA 2G8VA 3UN3A 4ED1A 3SCLE 3FZ2A 1H7WA 2WHOA 5LSLA 4GV9A 3MDFA 2CDQA 1H3DA 1U2CA 5BYRA 4CJ5A 2LDYA 2CPYA 3I4PA 1RCHA 5HN0A 2FVQA 1QE1B 2ZH6A 2BANA 4PXEA 3C46A 1JLFB 2FVSA 3VZIA 4OJGA 3RSEB 3DMJA 4CIEA 2FJAB 2ROPA 3FEZA 1ZC6A 3KLFA 4JD2A 2MQOA 4U6PA 5A8WB 3AA3A 5CYQA 3ISND 4PG6A 4DR6J 3EZ5A 3M6VA 1ZETA 4IOBA 3FCVA 2GX9A 1YUWA 2QYCA 2X1FA 5L9NA 4ZOSA 3M9NB 3BZQA 2W9CB 2K7KA 4FW1A 4CFDA 1W2BM 3QEPA 1LWEB 3L7UA 1QHAA 3M2RB 3SMSA 1J5OA 4DQSA 1KRPA 4FF3A 4J9QA 1WSHA 1Y5LB 4KO0A 3MEEB 2N82B 4L6V3 3QSYB 5SUHA 2RF2B 4BRPA 3C6TB 1HI1A 2KHOA 3NEKA 2IVPA 3NH1A 2GELA 1WSJA 5F41A 3C65A 1RLDA 5D4OA 3ILIA 3H42A 5CCLA 4JI4F 5KT2A 4FLVA 4CLPA 3ZLJA 2FSJA 5J2PA 1RTIB 3W63A 2KKZA 4NLSA 3UWTA 1GQEA 4DFPA 1VRQC 4OZJA 1T3OA 5DQIA 3VAKA 3EXYA 4PKDB 2D41A 2QRRA 1GMVA 3QBXA 5GVQA 4DR2F 4PY5A 3BSNA 1P8ZA 1TYQA 4JI5F 4MK8A 1VJWA 4TQSA 4PPZA 2RRAA 3DRSA 2LQJA 5E7OB 3RMCA 1N6QB 3M6UA 2K1RA 5H1SV 3NAIA 2YNIB 1T6CA 3CULA 3C7NA 1NU4A 4M5JA 3IG1A 4TKTA 4AM6A 4OX7A 4CLZA 4L3KA 4E7JA 3QAUA 2Z4PA 5LOQA 2Z2YB 2ILYA 1YG0A 4D3GA 5KFEA 1RDUA 2BE2B 1L3KA 4M5GA 4JYAJ 1GLBG 3UO0A 2ZZNA 4JI6F 2Z56B 4HHHA 2M52A 2RIJA 3KWGA 2HHUA 3NS5A 2H3GX 3W64A 3JSMA 4FBTA 3IP0A 3OQ2A 2DT9A 2W2NP 3AVNA 5GAGU 4RL1A 4OHYA 2Y3YA 3DLBA 3ZX3A 5L46A 3PFOA 4GO7X 5GIPA 3I87A 4C0HA 1W7WA 2KT5A 5C2GA 3S6EA 1JCFA 4LH5A 3L3UA 4IO8A 4PQUA 3QZ8A 4ENOA 3NNHA 3MK6A 4MLEA 3QEWA 2QEXS 1WBDA 4PQAA 4BS2A 5E2QA 1WEYA 4OO1J 2BJ7A 3BUZB 4D3HA 3DXSX 3P38A 1LOUA 2CWXA 2GO9A 3OVBA 3CJAA 3MR2A 1FHTA 5L1KA 1FEEA 2LXFA 2NZTA 2ZKTA 5KFXA 4W98A 1ATNA 3VAGA 1H73A 3R5DA 2RKIB 1C0UB 3TWHA 5BN9A 4KBOA 2XMJA 5GMDA 3A13A 2LSNA 3DFEA 3BSAA 2GGPA 1RDCA 2X6SA 2RQKA 4TYBA 3CUNA 3H1VX 2OKQA 4CHZA 4ZKAA 4A48A 5GADP 2J9CA 4J37A 2UV8A 1DQ9A 2ZJRQ 4A59A 2RU9A 4IDKA 4F2SA 2XI3A 4WP3A 3MAQA 3HPHA 5BJRA 1IR1A 5IZHA 1FKAF 4K25A 1XHZA 4A46A 4OLPA 2RU3A 4MKVA 3FNNA 4Q43A 1C1CB 2LA4A 1HA1A 1EHWA 2HLTA 4BR7A 4RBVA 3J80U 3LALA 1MN7A 5KFMA 4K8XA 4QWEA 1NWKA 3D4JA 1UEKA 2FZGB 2YQ0A 3G87A 5AQNA 3EPIA 1TVRA 3T7ZA 4RU2A 1FWKA 3DJCA 3UKUB 5F1XA 4H0TB 1K73T 1F5BA 4F7VA 4FM2A 1RTDB 1NZAA 3TJ9A 3ILOA 4IJAA 4JI0F 3P31A 4BWMA 4DZDA 4DX5A 1KFSA 5DGAA 3EY1A 2IA6A 3NF9A 2YKQA 5AZIB 1NHUA 1T95A 4YDUC 4J9MA 3RMAA 1RAFB 2CQHA 5LMNK 2ZUAA 4KBIA 3WT0A 2NYIA 4W5OA 5KQDA 1MROA 4NXNJ 3RTVA 4BWJA 1S3XA 2RHQB 1BU6O 3H3OB 4JS5A 2UU9J 5C5JA 1KVIA 4Y2KA 2YHXA 2J8SA 4OGCA 4J7CA 1VSJA 4U67L 3T5HA 1FFGB 4DSFA 5KFDA 2CQDA 1JLBA 5DO2A 2HB5A 2N7CA 2P5VA 2V2ZA 4EK2A 4B9SA 3J7AN 1N56A 5HL7L 4E7HA 1NGHA 2XMUA 1X4AA 3CCTA 4I2PA 3PW5A 2AJ0A 4PL7A 4CZJA 5LXRA 3E3XA 1GTHA 3ZSYA 3GV7B 2P9UB 4J8FA 4DL4A 4K0KK 3VQBA 2OD4A 4ECQA 4FNHA 1PJ7A 1VSFA 1DFDA 1N36J 2HGNA 3OTOK 2QA4S 4DUTA 5CQGA 2E7VA 3H5UA 3TX8A 2YNHA 2PDAA 2DD8S 3PKMA 4LF9F 1LQ9A 5KPZA 1UOCA 1VYAA 4BRDA 4CEBA 1Q78A 1WOOA 1NJZA 1GLCG 4A2BA 3E9LA 3KLEB 3J80O 4UOCA 4TU8A 2IA0A 4ID5A 7FD1A 2R8IA 1NXIA 1M90T 2P5OA 4WFYA 3V6KA 1FJGK 4S0MA 3N6MA 4GKKF 4I7FA 2UUWA 4I2QB 2W2OP 4BGBA 5LY3A 1WKKA 2BABA 2DXDA 4KHRA 1S0MA 4ZCLA 3PSFA 4K50A 5LMNJ 2W4PA 2B4JA 4BDPA 2BRKA 2QXLA 5JJBA 3NGKA 2GJ2A 3AY0A 1KAYA 4KJIA 4ZCMA 2A6OA 4W5RA 4C8MA 4CP5A 2Z1GA 1QAIA 1WLJA 4LRDA 5AQIA 3UDEA 4KGXB 2OFGX 1GXLA 2NRXA 4IRKA 4NYNA 1H7XA 4PUOA 4M8LA 3Q89A 4CM2A 4B3MJ 4A8WA 3AVJA 1SB6A 3K89A 1Y5IB 3HXMA 5LSOA 3ET6B 1NJIO 2ZHOA 2V51B 1Z2ZA 3JB9k 3Q23A 3OTOJ 2VG5A 3J81Y 1QY7A 3WIUA 3RAXA 3VQPA 1WUUA 3ATUA 4LF5F 1ZPVA 3MN7A 4WXWA 2XQCA 2CNLB 4J2BA 1JIHA 1WN7A 3ZZYA 2QKBA 5CABA 1V3ZA 2F4VK 2HNDA 4ELUA 4DPXA 1OH6A 4FOIA 2DBBA 4DV6K 3EICA 3K59A 3KLHA 3MX5A 3TYTA 1N5QA 3KMQA 1XHXA 5IT0A 2VJUA 1EQMA 3NY0A 1D9FA 4UOFA 3CDWA 2WK4A 4RW7B 1CLFA 5AQFA 2XMWA 4WFZA 2DGXA 3T5LA 1KLMA 2AP6A 4CF1A 4M5KA 4B9TA 1JLCA 3D9BA 4UF4A 2O8BB 3BKUA 3QINA 5HRRA 1C1BB 4DXLA 5LXYA 2AGPA 2RB7A 2ZH9A 2LLZA 2N3LA 4OKKA 2WVFA 1T05A 2J7KA 2K3IA 4ZHRB 2VWKA 3VGMA 2RQCA 4C1NI 3UDVA 1FX2A 1CBKA 4JI8J 1CZ9A 4B3TJ 1B99A 4IG0B 1N5SA 5D0GA 2ZNZA 3T1YF 3HKWA 1KKHA 3H2LA 2VL1A 2CH6A 4C8LA 1H38A 3BSCA 3OR2B 3T5KA 2ZC3A 3PLAA 4M5DA 3WQPA 2VOOA 2FTRA 3MR6A 2RRBA 3BGLA 3BN4A 2F4VJ 2XNRA 3EZUA 3AVIA 1EXQA 3J7Z5 4R79A 4DV6J 4BCAA 3GLJA 1JMTA 4EO8A 2NREA 4G9ZA 3QJLA 1HMVA 5L8RC 3PR4A 1U49A 2XMAA 4NLDA 1K8KA 4Q2LA 4IQXA 3OXGA 4LSLA 4F2RA 3L95X 1KVBA 2ZM6F 1HWKA 1U1RA 2B43A 3N4QA 2ALYB 2QFJA 1PC5A 3GE9A 2BJ9A 4FZZA 3L0QA 5CYMB 2ZF5O 3T9ZA 4IOXA 3EUNA 4J9NA 4DV2J 3HULA 2M0GB 4FXDA 2ZHBA 1N33K 3QGPA 3LOUA 4DV7F 1RQ0A 4ZP6A 1C0TA 4CLYA 5AQGA 3O3HA 1QQMA 4TXSA 4FLUA 2G8KA 3CPEA 1U6FA 4IYQA 2NS1B 3DLJA 1JXBA 3ILLA 3MM9A 1R89A 3CIZA 3G86A 2KVQE 2E7WA 3CF5L 4BR2A 1X3MA 4RW6A 3K8WA 3PYFA 5AQVA 5MLCQ 2IJRA 4NYOA 5E84A 4ZP8A 5ETRA 4J5OA 2VG7B 1S1TB 5J1EB 3A12A 2Y8YA 4H4MA 1BWFO 1RP5A 2RDDA 2QWOA 5C2FA 3F44A 5DM6Q 1NCLA 3LGHA 3OLBA 1T94A 4DS5A 5C42B 5D0HA 5HP1B 3DDNA 3M1VB 4WFAL 2CZVC 4IWVA 1X9SA 4KH4A 4HYKA 4WIQA 3HD1A 4LF6F 5KGXA 2IBKA 1VSDA 2F7VA 2PMZD 1B0PA 1KWMA 1LCUA 1RA6A 2YY3A 4YOTA 4USVA 5IT9Y 4H0XB 4KB1A 3OVNA 3JSRA 1YIJS 5AJ3K 3K58A 3O4WA 4DV4K 3OHAA 4J91A 1N33J 1UPPA 4FPAA 5JS2A 1WUAA 3HSJA 1EETA 1BE4A 2OI2A 4KH1B 2KTQA 1XIQA 3V4IA 2BANB 4PEOA 2IBOA 3US5A 1HNWK 5GADU 3KG1A 4FJ7A 3G6YA 4GKJK 4HTJA 1Z6RA 2E6LA 2CPJA 3KLFB 4JD2B 3ZSXA 3L3CA 1ZZFA 2CXEA 1Z4UA 1HWUA 1EX8A 5L38A 4X4QA 3MCPA 3G71N 3HK2A 4DSEA 3FZBA 3MURP 3NOGA 9ATCB 1X4BA 2HQGA 3VTIA 5RUBA 1WF2A 1AXQA 1HR0F 2YX1A 3HCXA 1NMEB 1FRJA 4C3LA 2YHAA 5KI6A 1UAXA 1QQCA 1J5OB 1ZS6A 1RACB 1HW9A 2Q97A 3WXKA 1BOTO 4KO0B 2CQIA 3FEYB 1OPIA 4ZJOA 5AQPA 2W24A 3AD9C 4C23A 1HRHA 1ZBLA 2VPXB 1NGEA 2V8HA 2B9WA 1O13A 1YX2A 4OZ0A 1HUXA 3V5RA 2Q6CA 2VQEF 2XS2A 1OVQA 1ZTWA 1VQKS 3ITHA 4QAGA 2FC9A 2BOAA 4O3RA 3D2WA 3V9WA 3G8TA 2VOPA 2RDJA 4CZGA 4FJMA 2E9TA 4P73A 3W9JA 5E5NA 3NHGA 5J2PB 1ZZNA 5BPNA 3D2EA 4DV4J 1VC5A 4O3QA 3V9UA 1XMQF 5LJWA 2DR8A 3A2FA 3TA2A 4FJKA 4BC5A 3VQAA 2CPIA 1JK9B 4QPTA 3Q7CA 1TL1A 2W7PA 2C2MB 1TYQB 4M5MA 3C14A 1RAHB 3TTFA 1NPRA 4CBWA 4CGIA 3DRSB 1MW7A 3PRBA 2OH2A 1GLFO 2K1RB 3MMCA 3X3UA 4WTOB 4DSJA 4RJVA 3C7NB 3SEOA 5F8IA 3IG1B 3NF8A 3VGSA 1V5IB 2PFDA 4KYZA 4ZPVR 3R5GA 1BIZA 3PYEA 2GW8A 1P1LA 3IMQJ 1VLYA 3SSRA 4PXDA 3AJ1A 4CJPA 4NLUA 3EO3A 3O9QA 4IKAA 1K8AT 3JSMB 4OYWA 4NLTA 1C0GA 4EBEA 3NGIA 1VOMA 4XPCA 2HKEA 2DHAA 2Q31A 3G9CA 4RU9A 2DRBA 4M5HA 1AROP 1C0MA 4DFJA 1TAUA 4M63C 3P45B 1TELA 2XCAA 3GIKA 3B8AX 3L2UA 1VQPN 5JVGQ 1YTYA 3P39A 4CGHA 4PQUB 2EXUA 4JAXA 3RZAA 2BM1A 2NXNA 1U45A 4RUHA 1AW0A 4PG4A 2P9LA 1GLAG 1CJUA 2HQFA 1ICEB 4K5SA 3R7BB 2LQBA 4LIRA 4DTUA 5FRNA 4M3ZA 4PKIA 2C3OA 1Q81O 5E3CA 5B0DA 5BPLA 5BN8A 2X1AA 3QWUA 2YTCA 3ZFVA 2IYIA 2C2OB 1XNQJ 2WRMA 4NZ6A 5AQKA 4YDXA 3DOKA 2JNJA 5KG6A 4GVBA 3GIMA 4N41A 3GR1A 2HGLA 5EN1A 5JMNA 3AVGA 2KJVA 4AUKA 4BRAA 1PYSB 1NKEA 4IO9Q 1XQSC 3V1OA 3W66A 4IEIA 4JI3J 2GGPB 4W90B 3QT6A 2E2NA 4ZJQA 3GU0A 4X4OA 2MKHA 3G82A 1S99A 5ETPA 1RKJA 4O3OA 4DDFA 3VQ8A 3H2VE 2NSBA 1UWBA 1D3WA 4IDKB 5BPMA 1FJCA 3BR9A 1VQMN 4FS1A 1YVUA 1CJKA 1MWMA 5HATA 3TAMA 2NXEA 3CCSN 4ETZA 1Q18A 1IBCB 3K9JA 4B3RK 3P5JA 2A1RA 2LXIA 2LQ5A 3MEKA 3HD2A 5CAAA 5E41A 2QE5A 3SUPA 3ZTOA 2DGOA 4KGZB 1F3FA 2PZSA 2CPFA 1T7PA 1T9TA 1TVRB 5HQ8A 1IBMF 4ILLA 4FJHA 2DISA 2C3MA 3E9PA 2YKNA 2KFNA 1M0SA 4B3SF 1YKWA 4MO4A 3TAFA 2KO1A 1PBUA 3U27A 1TP7A 2A3JA 3UIQA 1NUEA 2QC3A 3P5TL 3K8VA 2HQCA 3OTBA 2K7JA 4YORA 2NPFA 2DNGA 3ULHA 1MROB 2UUBF 3MMBA 1FKOA 5D77A 2A2CA 4LFCF 3EVMA 1DTTB 1HHQA 3EM1A 3OYLA 3JQJA 4B8AB 2F8HA 2XMTA 1RT6A 1FDNA 3MUMP 1VQ7S 3H6EA 2BUPA 4TY9A 2OA8A 4ZLLA 2GA7A 4Q5VA 2GV9A 5AXLA 2XHBA 1R8BA 3M8YA 4I2PB 3CCWA 3EKUA 2DFFA 1RWWB 3GB0A 4Y6IA 3AA9A 4X66F 4B3RJ 3HZGA 1EAYC 2VASA 3S3OA 3M2UA 5KT4A 2BJ3A 2Z58B 2YNHB 3LPEA 1YAGA 4BE2A 4OYMA 2DGWA 3NCIA 2DH8A 4P9SA 3AD8C 4CNZA 4ECUA 1CLQA 3WEEA 3TRGA 1XI1A 1WI6A 3HVAA 4CO4A 2UXCK 3M8QA 4ID5B 3FGUA 4AL7A 5EU7A 4LFBF 2FGOA 1WHXA 5GINA 3OS1A 4FKXA 4M3YA 2IDLA 1U0HA 1N5TA 1RDAA 4I7FB 1NH7A 2DO4A 3AQOA 5LJ5Y 2W41A 3C95A 3CMAN 1Q8KA 4AT1B 4ISEA 3QRQA 1U2FA 2ASPA 4CT9A 1LW2A 3DAWA 3HM8A 2RMLA 1MMDA 4ECYA 1U1OA 4QOZB 2QWMA 3U1MA 3FDSA 4ZVUB 2XZWA 2VWJA 1OSDA 1S72S 3BS9A 2E5LK 1UVIA 4GW6A 1R59O 4CZEA 5HRSA 4JK9A 3KJFB 2ZFHA 1ILYA 4PUOB 3FBEA 4HL9A 1JXEA 1LOTB 4WQ4C 5JVHQ 4CW7B 4KB0A 3NGZA 1U24A 2FGCA 2HLUA 2VG5B 3ISZA 2YNFA 4OZNA 2H5IB 4M5NA 4CT8A 4NL5A 4DR7F 2QIFA 3D7SB 3HX9A 1GOAA 2KJWA 2G2OA 3UPFA 2HNDB 4ZIVA 2UXCJ 3PCOB 3SLCA 3KLHB 2GAGC 4BC3A 2HBJA 4NA3A 1XNRK 1XWLA 1QHTA 3TU5A 2JWLA 4ZVTB 2W9AA 3UDLA 4MKBA 2A1BA 1YITN 2HBZB 1CJTB 3M8WA 1J9AA 1NK5A 2HWHA 2IDEA 4GO5X 3SCXA 2AW0A 2WW4A 4ZCIA 1Z26A 4O55A 3H3NO 5D8HB 3FGVA 2NQPA 1KLMB 3CC7N 2RVJA 5EOYA 1NKCA 2EC2A 1VBZA 1JLCB 3I0SB 4H4KC 3CT9A 3EE3A 1ATRA 4DU8A 1NDKA 3OFHA 5HMYA 5KT6A 1LK5A 2PO4A 2E5LJ 1Q5YA 1T8EA 2FUG9 1ZH5A 2P5GA 4CLTA 5K9FA 1T05B 3AAQA 1SKRA 2XYGB 1X3NA 3O3LA 2KN4A 3D68A 2FLPA 4CZLA 3ZSZA 3NDKA 3VGUA 3GWCA 3TSUA 3SMZA 2ZBQA 3NF7A 5JVHL 1SJ1A 1RT4A 4O0NA 2ITMA 1BCOA 3VTHA 4PZVA 3VAHA 4J9OA 5AE2A 4M5LA 5KG3A 2YBVA 4M5DB 5AQOA 3QGIA 4E1JA 3JXOA 3OYDA 4OZLA 2GHWA 1DQ8A 2RE1A 4G1QA 2Q79A 4NYZA 3PX0A 1KFDA 3GMGA 3WNHA 2PY5A 5GADI 2JJ4D 1VCTA 2R7VA 3CC2S 5HVGA 1XNRJ 2F4FA 4FLWA 1SC6A 2IIRA 3FRYA 1HMVB 1UWAA 3F73A 3U3GA 1J5EF 4C2MA 4OX9F 1M1HA 1E3MA 4KPYA 1U47A 4CEAA 4TY8A 4LSLB 2HHHK 1IBLF 1NZ8A 3VF2A 4CHPA 4DX8H 3CI5A 3NGUA 2W25A 3OTCA 3OHBA 5D0RA 5HO4A 5KT5A 3OYCA 1XK8A 5C24A 2RILA 4CFCA 2GIFA 1MMNA 4NEYA 4ED7A 3KK2A 1EKSA 1C0TB 4RW9A 4B9UA 5KFLA 1XMOF 3AGRA 3ENOA 5HRNA 2P6SA 4K4SA 3VGLA 1D8ZA 3IR7B 4NEZA 3CJ4A 2KI2A 3EGVA 1HARA 3MM9B 4M41A 4KAIA 2DNRA 3Q8SB 1NHKL 2R7UA 3IC1A 1FKPA 4CLWA 2B4OA 3I5BA 3PIOQ 3LDSA 4RW6B 1RILA 1N88A 2QWLA 2ZNYA 1F9EB 1MSWD 3FMBA 3T41A 3IDHA 1YK9A 1R6YA 3MD1A 2PBDA 3NLCA 3FLCO 4NZ7A 5B7WA 3QWPA 2G2ZA 4H4MB 2O1PA 2DTJA 5AFUA 3NAHA 1NHVA 3Q2TC 4DV3K 3I9ZA 3CCLN 4GV3A 3R5BA 3KK7A 2GNKA 1VQNS 2EFQA 2ZE2A 1CZAN 1OS5A 4FWQA 2EFGA 3GYNA 5LL6d 1Q7LB 4JN4A 3DRRA 3D28A 4WZMA 2DCLA 2QLBB 1KQFB 1Z25A 4X84A 4CO1A 3OSNA 2CADA 4JI4J 5F8JA 2QMWA 2DCUB 4ALZA 3VQDA 1D1UA 4QYZK 2G0IA 2AJFE 3I5CA 4JRPA 3J81U 3HO1A 3MM7A 1Q95G 5HMWA 3HBTA 5EGYA 4K8ZA 4KTQA 1RISA 3RJMB 4YY3F 3V9ZA 1PKUA 3C15A 1EETB 2QWNA 1VC0A 3SQ4A 5FLXO 4DR2J 3PYDA 1ZYQA 3P6YC 1R7IA 2IM1A 3CQXA 4OI0A 4JI5J 4CZIA 3A5OC 3MTJA 3GL1A 4FZYA 1M5VC 3AD7C 4JP8A 4CGJA 2BV3A 2NLWA 2JC0A 2KZZA 1HKGA 1S79A 3EVWA 2HEKA 3ZZRA 4DL7A 1T9XA 3ZSQA 5AR0A 4Y1DA 4AE5A 4FLTA 1CXUA 2CQ3A 2DNHA 4JI6J 5EHHA 2BKOA 2LECA 5KFPA 2V7YA 3TJ8A 2QK9A 2CPZA 2NZCA 4JKGA 4Q2MA 5KFGA 1SC3B 3MXJA 3SUQA 3JQKA 4PABA 4M3RA 1VHFA 1VBXA 3HKZD 3OLAA 3E66A 4FVMA 1RAGB 3ITHB 3R1HA 3MDQA 4CJQA 3HL8A 2XULA 2DNPA 2V8VA 4QYZJ 3E01A 1Q53A 3WNFA 3MMJA 4O8UA 3D2EB 1FXLA 2KT2A 3G6ES 1D9DA 2XYPB 3ENHA 2MPUA 2WVCA 3BBFA 3VQ7A 4LQ3A 2ROGA 3CJRA 2NR0A 2R8JA 4BC2A 5K8OA 4IOAQ