3O4NA

Crystal structure of the rous associated virus integrase catalytic domain in mes buffer ph 6.0
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
133
Chain Sequence
QIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTQAMVERANRLLKDKIRVLAEGDGFMKRIPASKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords integrase
publication title A crystal structure of the catalytic core domain of an avian sarcoma and leukemia virus integrase suggests an alternate dimeric assembly.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
total genus 47
structure length 133
sequence length 141
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o4nA00
4CJ4A 4RG8A 2F8SA 3P1GA 3TAGA 1DTQA 5CY4A 4FLZA 4ZHRA 2XRIA 4DQSA 1S6PA 1QSLA 1S1VA 4ELTA 2HVHA 4CIEA 2KFNA 4DMNA 1EXQA 1WSIA 4M3YA 4DG1A 4CGDA 5CZ2A 4CIFA 4CGHA 3SQ0A 3L8BA 3LAMA 4PA1A 3K2PA 2JLEA 3HXMA 1JKHA 3HVTA 5C25A 4LY7A 1RNHA 1RCHA 1S6QA 3DOKA 1YT3A 3CQ8A 4E7IA 1C0TA 3SQ2A 3AV9A 5HBMA 3LWLA 3PX0A 4CFCA 1BI4A 1K6YA 3ZSZA 4N41A 3DI6A 4DQQA 3TARA 4NYFA 4DQPA 4M3RA 2B5JA 3VQ8A 3THVA 4CF2A 1KFDA 1LAVA 3I0RA 1ASWA 4BDZA 3OYNA 3RRGA 1BCMA 3NE6A 4E7KA 1CLQA 1DTTA 3ZT0A 3M8RA 3DRRA 1KCFA 3KKRA 5HRSA 4C8NA 4CJKA 3LZIA 4DTJA 3S9HA 2PYLA 3TWHA 4DWIA 2Q3SA 4BDYA 2FBTA 4E1MA 3B6OA 4CERA 4FLTA 3OYEA 1RT1A 1L3VA 3RWUA 5CYQA 3HO1A 1C6VA 1TVRA 3NH0A 1UA0A 4FJ5A 1C0UA 2OPPA 3QEWA 3OYKA 3RMDA 2HHUA 1HNVA 3V9UA 5HROA 3KKSA 1NJZA 4FCYA 3HYFA 4FJIA 2P1JA 2YHAA 4FLUA 3VQAA 5C42A 3OYAA 4HUEA 4FJXA 1Q8IA 4DTSA 4FLVA 2LSNA 3V1OA 3MECA 5K14A 4CEBA 4DFKA 3MXMA 3AVIA 1W0HA 3QO9A 4E7JA 3UIQA 3DM2A 1RDDA 1KTQA 3EZ5A 4DTMA 4EZ9A 4M42A 3SV3A 4O0IA 4OKKA 3HJFA 4GW6A 4Z4IA 4CJLA 3M8SA 5SZTA 4CJ3A 1CXUA 1NJYA 3DOLA 4K8XA 2HHVA 3NFAA 3AVBA 2GV9A 2O4GA 3AVJA 3M8QA 1RT5A 3ZSXA 3QEIA 1U47A 4ELVA 3G10A 3AO3A 4CESA 1FXXA 3K5OA 2W42A 1C1AA 3NBPA 4RW6A 2B4JA 5KTQA 4BDPA 4C8LA 3HL8A 2HHWA 4W5QA 3VQ5A 3QIOA 3VA3A 2DFEA 4B08A 4IDKA 5KI6A 3QESA 1TK5A 3V1QA 3AA2A 3OYMA 4KTWA 4N76A 5I3UA 3U3GA 3NH2A 4NCAA 1U04A 1HMVA 1KRPA 3WNFA 1RT4A 4CFBA 4H4OA 3LDSA 3BDPA 3I0SA 2VG6A 1WSFA 3QEVA 3DLKA 1TAQA 4MFBA 5SWMA 1TKDA 1RBVA 1IG9A 2Z1IA 3OS1A 4RW9A 1BI4B 1JLGA 2EHGA 4OVLA 4CHYA 1BISA 1EKEA 3KD1E 2QXFA 2KFZA 1G15A 1NJWA 3QLHA 4CEZA 4F3TA 3LPTA 5JS1A 1QE1A 3DRPA 4NCGA 1TL1A 4CHNA 3SJJA 4OGEA 4HTUA 3WNEA 4FJNA 3NGZA 2BE2A 3O4QA 1RT2A 3ZSQA 4M3UA 1VSLA 4DSKA 1C1BA 4RW4A 1XHXA 2KZMA 1CZBA 4E89A 1D9DA 3PO4A 1IH7A 3AA5X 1ZBLA 4FJKA 2QK9A 1DLOA 5HRNA 3DYAA 3V1RA 4I9QA 3LANA 5CZ1A 5DMRA 2OZMA 4ID5A 1HQUA 1HYSA 3ZSRA 5E41A 1A5XA 4Z4CA 2XY6A 3RTVA 4PY5A 5J2PA 1SV5A 4DS4A 1S1WA 1X1PA 1J54A 3HPOA 4ID1A 1TK8A 4IKFA 3G0ZA 1LWFA 1NK4A 1LWCA 5FDLA 3ZSOA 1KLNA 1YVUA 2VWKA 1YTUA 1L3TA 2X6SA 4Z0UA 1HPZA 1Q9YA 3I8DA 2YKNA 3T1AA 1SL0A 3C95A 2D0BA 2IS3A 4ZTJA 1S9GA 3V9WA 3B6PA 1T7PA 4HHTA 2X6NA 3KTQA 4TSXA 3D45A 4LSLA 1R0AA 1RBSA 2IGIA 4HUGA 1RDBA 1S1TA 1QSSA 1GOCA 4FM0A 2XO7A 4YNQA 4O55A 4IG0A 4BACA 1WAFA 1TKXA 4DSFA 2PYJA 4AHUA 1KFSA 3MXIA 3HP6A 1X9MA 4IG3A 3F73A 3CG7A 1LAWA 2XY7A 2E4LA 4Y1CA 3AO2A 4DSLA 3OYIA 4FJGA 3NCIA 2IDOA 4DSEA 4OLBA 4IFYA 4BWJA 3TAEA 4CJSA 4FJJA 1KLMA 4CEEA 2XY5A 4FJHA 4JRQA 4B8AB 1BQMA 1J5OA 1IKYA 3OYCA 3CFPA 1Z25A 4ZTFA 3LPUA 4FM2A 2G8VA 4M3XA 1NOZA 1RTJA 3KIOA 2P5GA 4Z4FA 1JXEA 2F8TA 4LD0A 3OYDA 4FK4A 3HK2A 3D0PA 4DF8A 3PO5A 4CK1A 3O4NA 2ETJA 3SPYA 4B9LA 1U48A 1WSHA 4KTQA 4KHUA 3K5MA 4HUFA 1FKOA 1RT7A 1T8EA 4FZYA 3AO5A 1KVCA 4DQRA 4DTNA 4FJMA 1TK0A 4H4MA 1ZBIA 4FZZA 4FK2A 3TABA 4NCBA 4CF1A 3K5NA 1RBUA 3CM6A 3L2UA 3L2WA 3DLHA 4KHNA 1UA1A 2DTUA 1VSKA 4LH4A 4OPJA 3AA4A 2Y1JA 4CJRA 4JS5A 2HHQA 2I5JA 2WONA 3LAKA 4M45A 1QQCA 4KRFA 4W5NA 3OY9A 3SUPA 1HJRA 2EX3A 3HPGA 1T03A 1VSHA 1B92A 3VQ4A 1Z26A 4OJRA 1XI1A 1LV5A 4CHQA 1VSEA 4DFJA 1BIUA 1NJXA 3AVAA 3TR8A 5HLFA 2WOMA 1A5WA 4ELUA 1KSPA 4CECA 1JLQA 4K8ZA 3OYLA 4RW8A 2G8FA 1X9WA 5FRMA 3NHGA 1RILA 1QS4A 1JL1A 3SZ2A 4CE9A 1A5VA 4CJ5A 4Q0BA 2HMIA 2BGGA 4NYNA 3ISNC 4R5PA 4QAGA 3VA0A 3AO4A 4L8RB 3S3OA 1IKVA 1GOBA 3PX6A 2AJQA 4KO0A 2BDPA 2IAJA 1NK7A 4CJFA 3CM5A 3CYMA 4DS5A 4CEQA 2FBXA 1CXQA 3HT3A 2Y1IA 2OA8A 4CJWA 1W9HA 3L2RA 5J1EA 4AHRA 1NK0A 4I7FA 3OS0A 3V9XA 3JSMA 4DFPA 4DSIA 2IC3A 3V4IA 3VQ7A 1HYZA 3NGIA 2QKKA 4N47A 4E1NA 3V9ZA 4B9NA 1KVAA 1BHLA 4HCCA 4KI4A 3KJVA 2PZSA 5J2MA 2JGUA 4GVMA 2G8HA 4XIUA 3L2VA 1TKZA 1MU2A 2YHBA 4KHSA 1UWBA 4DTPA 1I3AA 4CJQA 4B9TA 1J9AA 2FBVA 1TGOA 5HRPA 3KLIA 1VSMA 3DLRA 3DMJA 3OYJA 3KK1A 1JL2A 1RTIA 4CJTA 2O4IA 2BANA 5C24A 4B9UA 1S1UA 1BIZA 3RRHA 5I42A 3HVRA 3RR7A 4C8MA 3AVFA 3ZSYA 4CF9A 4I9LA 4H8KA 3ZSVA 4KB0A 4B8CA 3AVKA 4CGFA 4C8KA 4KHYA 4HVJA 1L3UA 3PX4A 1D9FA 2HNYA 4KB1A 1WSGA 3KLEA 1ZYQA 4B9VA 4M3TA 3LP3A 4DTOA 4KHQA 1WN7A 1GOAA 3AA3A 4AHVA 3FFIA 3OJUA 2YNIA 3BGRA 3SV4A 4FK0A 2DFFA 2KQ2A 4E3SA 1NK9A 3O3FA 3NDKA 2DY4A 1JXBA 1RT6A 3K59A 1RTHA 3KK2A 4DTUA 3MEDA 1ZBHA 2RKIA 3PUFA 1D5AA 1WAJA 3JYTA 5HP1A 3VQ9A 3T3FA 3TAMA 4BWMA 4BE2A 4I2QA 4F3OA 4CK2A 4EP4A 3SYZA 3HP9A 3QEXA 4FJ9A 1TL3A 4FW2A 1UOCA 1SKSA 2YNHA 4CGGA 2OPQA 5DK5A 4Z4HA 2D0AA 3NF7A 1BL3A 4KI6A 2RPIA 2ATQA 1VSDA 3SPZA 1RBTA 2VG7A 4O4GA 3IAYA 3ZT4A 4EZ6A 1YTAA 2E6MA 1JLFA 1QHTA 1VRTA 3VQDA 3KLFA 1U49A 3MAQA 4CIGA 4FYDA 1T05A 4N56A 2PY5A 3NF6A 4JLHA 3VQBA 5FROA 5J2QA 2Z1JA 4DQIA 2Z1HA 3SI6A 1JLBA 2OYQA 1IKXA 4CF8A 4QOZB 4HCBA 4CEDA 3WNHA 4AHTA 4J2BA 3NGYA 3RMBA 3SUQA 3LWMA 4F8RA 2P51A 4CEOA 4PWDA 3VQCA 4FM1A 4JS4A 1RT3A 3OVNA 3E01A 1C1CA 2GBZA 1BQNA 2KTQA 4OGCA 1WSEA 2YV0X 2X78A 4O0JA 4E19A 2VWJA 4M3ZA 3CFRA 4DU1A 3ULDA 4E0DA 4KPYA 4I2PA 3AVNA 4IBNA 4CGJA 3OYFA 1EX4A 1VK0A 3C6UA 2OPSA 3IRXA 3LP1A 3F9KA 2R7YA 2XHBA 1U45A 3HM9A 1HRHA 4DLGA 1JLEA 1XWLA 3SUOA 3V81A 3T19A 2YKMA 1JLAA 2YNGA 2FC0A 3ZT2A 2A1SA 3L2QA 4FLYA 4F2RA 4YFUA 4Q5VA 4F2SA 4CFDA 3C6TA 3SQ4A 2HNDA 4Z4GA 3ZT3A 5CYMA 1SUQA 2ITGA 1TKTA 3CFOA 3ZT1A 4FZXC 5FRNA 2G8KA 3MEEA 4FVMA 2GUIA 3QIPA 3DLEA 1SKWA 2P5OA 1VRUA 1Q9XA 5KRTA 3PV8A 3QINA 2HB5A 1IKWA 1F21A 2HW3A 4BE1A 5J2NA 3TAQA 4AHSA 4AILC 3V6DA 1QTMA 1S9EA 2X74A 4CEAA 2QKBA 3LP2A 3OYHA 3C94A 1FKPA 5EU7A 3K57A 1WSJA 4CJUA 3EY1A 1SL2A 1WLJA 3SUNA 5HRRA 4DFMA 4EP5A 1XHZA 3RMAA 4OLAA 2Z1GA 4DTRA 3PY8A 1I39A 4CGIA 4O44A 3AVLA 2B6AA 4J2EA 1TAUA 3ALYA 3QETA 1RBRA 3TI0A 3K58A 4CJEA 3EYZA 2D0CA 3SCXA 3NF8A 2HHTA 3P5JA 4DF4A 1HQEA 3NAEA 1NOYA 2KZZA 3OYGA 2HHXA 3AVCA 3HPHA 3IG1A 4ICLA 4CCHA 5KRSA 4PUOA 1EETA 3NH1A 2FBYA 4CJPA 2ZQBA 3TANA 3IS9A 5JS2A 3AVHA 1KVBA 3MEGA 4CHOA 4KAZA 4J2AA 1S5JA 4CHZA 3H08A 3QEPA 4Z4EA 4KV8A 4CFAA 3A2FA 1VSFA 4CEFA 4W5OA 3VQPA 3O3HA 3DLBA 3VQQA 3S3MA 3AVMA 1ZBUA 3DLGA 3M8PA 5KGWA 3L3UA 4CK3A 1EP4A 3ITHA 4Y1DA 3VQEA 3U6FA 1VSJA 1XC9A 2E6LA 2NUBA 4AHCA 3QNOA 4FJLA 4O5BA 1X9SA 4J2DA 1JLCA 3ASMA 3OYBA 1LW2A 5KGXA 3O3GA 1BGXT 4IFVA 3TAFA 1Y97A 3DRSA 4GMJB 4OKJA 4B9SA 2OZSA 3RMCA 1IO2A 2D5RA 3VN5A 1L3SA 1ZBFA 1NK8A 4F4KA 3QERA 3ZCMA 4WE1A 4B3OA 2RN2A 3LALA 3NF9A 1B9DA 1N5YA 3P83D 4LSNA 4E7LA 2HHSA 2G8UA 1SL1A 1RDCA 1RDAA 4FXDA 1S1XA 1RTDA 3L3VA 4QCLA 2A1RA 4FJ7A 3U3YA 1NKCA 4BE0A 2IOCA 3SNNA 1NK5A 2ZD1A 4DLEA 3SQ1A 1ASUA 3WNGA 3QNNA 1NK6A 1N6QA 1LW0A 4FLXA 4MQ3A 4W5TA 1NKBA 3MXJA 4FLWA 3S3NA 1C0MA 2YNFA 1D8YA 4C8OA 4KREA 1BCOA 1SKRA 2ZE2A 4KHWA 4CHPA 1U4BA 1FK9A 3VQ6A 3KK3A 3HSTB 1L5UA 1REVA 1HNIA 3KLHA 1VSIA 2OPRA 4PQUA 2HNZA 4AH9A 3OS2A 4KFBA 3AVGA 4RW7A 3KLGA 4OKEA 5D3GA 1CZ9A 3ZSWA 1WNSA 4W5RA 4FJ8A 1HYVA 4CF0A 4UQGA 3OJSA 4OPKA 4B9MA 4M3WA 2KW4A 2XY8A 2HVIA 1ASVA 1LWEA 4LH5A 1QSYA 4G1QA 1NKEA 1J53A 4DU3A 2G8IA 4E7HA 1B9FA 1O1WA 4KTZA 3RR8A 4KKOA 3LP0A 1UAXA 3KD5E 4FW1A 4DSJA 4N5SA 3V9SA 3K5LA 3TAPA 5T7BA 2F96A 4DTXA 3AO1A 4CJVA 1ITGA 2VG5A 2RF2A 2DFHA 4M41A 4DU4A 1TV6A 3LZJA 2G8WA 4JRPA
chains in the Genus database with same CATH superfamily
1YVNA 4FWNA 4RG8A 3P1GA 1DTQA 5CY4A 2EWSA 1S6PA 3J80O 4M3YA 1EXQA 4CGHA 3SQ0A 3D2EB 3LAMA 3K2PA 2QW9A 4BQLA 3DOKA 1RCHA 5MLCQ 1C0TA 3CQYA 1NJIO 3AV9A 2ASMA 3ID6A 1K6YA 3TARA 3H3NO 3THVA 2ZGZA 2AP1A 4BDZA 1BCMA 3I8BA 3ATVA 5AQMA 3LZIA 1LCUA 2Q3SA 4BDYA 3VF6A 3OYEA 1BDGA 3UB5A 4WYBA 3CCVN 4C1NK 2OPPA 4A2AA 2A6AA 4DUZK 4HUEA 4GNIA 3BEXA 3WXJA 4Y0WA 5K14A 2NRWA 3FFKB 3HRGA 3O80A 4CD3A 4DTMA 2I7PA 3MCAB 2P9UB 4FWMA 4O0IA 3M8SA 2KKZA 2HHVA 1CXUA 2O4GA 3DXMA 3M8QA 1RT5A 5EY4A 3VF2A 4QS7A 3QEIA 2W42A 3Q7BA 1YJ9N 4RW6A 2B4JA 3CQXA 3CCJN 1T6DA 1YF5L 3QIOA 4B08A 1GLFO 3AA2A 4KTWA 5M1QA 4N76A 5I3UA 3NH2A 4NCAA 4CFBA 4JD2B 2VG6A 1SS6A 1TAQA 2IVNA 1TKDA 1ZBSA 1T44A 1EKEA 1G15A 5JS1A 3LPTA 1OKJA 3DRPA 4NCGA 4H0TB 1QZ5A 2P9LB 3SJJA 4BRQA 1C0GA 2Q36A 5BPLA 3WNEA 4KHPK 1YI2N 3O4QA 4K42A 1VSLA 5TKWA 3OTOK 4M3UA 1C1BA 3CF5L 1SZ2A 1XHXA 1CZBA 3VENA 3G6EN 1ZBLA 2QK9A 2P9NB 5HRNA 3DYAA 3V1RA 4JK9A 4H0PA 1BUPA 2QM1A 5CZ1A 1HQUA 1A5XA 4E1JA 3WEEA 4WFAL 2HOEA 4PL8A 3RTVA 1SV5A 1TK8A 4IKFA 4FSVA 4DR1K 1NK4A 1YVUA 2VWKA 3I8DA 3T1AA 3C95A 2D0BA 4ZTJA 3THYA 1GLAG 4TSXA 4LSLA 1N34K 1BA0A 2IGIA 3O9SA 1RDBA 5F0XA 1GOCA 4YNQA 2OCEA 1WAFA 4DSFA 1K73O 2HSTA 3F73A 2AA4A 2QWPA 1LAWA 2XY7A 2ZJRL 3KWGA 3R3LA 4DSEA 4JI6K 1IBKK 4CEEA 5HL7L 1IKYA 3OYCA 1Z25A 3R9PA 2G8VA 5F1XA 5AQWA 2P9KA 2FF3B 2ETJA 4B9LA 1U48A 1MA9B 1RT7A 4DV1K 3U9ZA 3NVKA 2W41A 3O9RA 3L2WA 3DLHA 3HSCA 3AA4A 4WFNL 4OPJA 2P9SB 3RSEA 4M45A 3NMUA 1KD1O 3D2FA 5AQRA 5BN9A 2W6KA 2ZGYA 1XI1A 4CHQA 2ZF5O 3TR8A 3THXB 4ELUA 2NRXA 2G8FA 3CXCM 5FRMA 3H3OB 1RILA 3NHGA 3WT0A 3JXUA 4CJ5A 2HMIA 3JS6A 3VA0A 4L8RB 1IBMK 3LDLA 4CZJA 3CYMA 2ZJPL 4H03B 2BUPA 2HHHK 2WTUA 3L2RA 3V9XA 1NGHA 4DSIA 1HYZA 3VEZA 4X64K 1BHLA 4RWTA 2PZSA 3GE1A 3P38A 4FWQA 1Y64A 2YHBA 4KHSA 3TTFA 4DTPA 1E4GT 3KLIA 3OYJA 3H45C 1JL2A 3H6EA 3C7NB 1S1UA 1HNWK 1BIZA 4GKJK 3RR7A 3A5MC 4C8MA 3S41A 1FW6A 4O8UA 4I9LA 1DKGD 3ZSVA 4B8CA 4CGFA 4HVJA 1E3MA 1D9FA 2VCPA 3KLEA 1VQNN 4FWKA 3AA3A 4AHVA 3FFIA 2YNIA 4Z94A 5AR0A 4E3SA 2DY4A 3KK2A 3WXKA 3MEDA 5FLXO 1ZBHA 4O8KA 1WAJA 3P4IA 3VEOA 3T3FA 4I2QA 4F3OA 1CZAN 4CK2A 3QEXA 3FR0A 1UOCA 3BZCA 2D0AA 3NF7A 1BL3A 1NM1A 3H46O 1VSDA 4LF4K 3ZT4A 2OTLN 2P9UA 5M1PA 3KLFA 5FPNA 4LF7K 3KWIA 1T05A 4BRPA 3NF6A 1Q82O 4FOIA 1DGKN 4PKGA 2A41A 2VGMA 3J8AA 3D7EO 1BQNA 1NGGA 4BVOA 1WSEA 3BF1A 3H1QA 4E0DA 3ULDA 1ESVA 4I2PA 3AVNA 4IBNA 3O5BA 4KHNA 2R7YA 5LY3A 1XWLA 3GDQA 3T19A 2YKMA 2YNGA 2FC0A 2A1SA 4YFUA 3C6TA 4KH5A 4Z4GA 3ZT3A 4DR7K 1SUQA 3CFOA 3DLLL 2G8KA 2GUIA 3HOTA 3MK6A 3PV8A 4GKKK 1HNXK 3IUCA 1OVQA 5J2NA 3TAQA 5FPMA 4AILC 3V6DA 2E88A 4RCHA 3HI0A 3OYHA 3K57A 1FJGK 2O8CB 5AQHA 3ULEA 4MLHA 1WLJA 5LJVA 1SL2A 4DFMA 4EP5A 1XHZA 4BRMA 3RMAA 4DTRA 1I39A 1HKBA 5M1FA 2P9NA 4LFCK 4J2EA 3ALYA 4C1NI 2WBNA 3K58A 2HHTA 1NOYA 3OYGA 3I56N 2HHXA 3AVCA 4PUOA 3H1VX 4H5RA 3AGKA 4CJPA 5JS2A 4KAZA 4CI6A 3CJ7A 4CHZA 4Z4EA 4KV8A 2O8BB 1VSFA 5BREA 4MO5A 4JI8K 1NGIA 3O3HA 3DLGA 1ZBUA 3EE8A 3L3UA 3EN9A 4JNEA 3ITHA 3VQEA 5LL6Z 1IBLK 4JKFA 1XC9A 4O5BA 1VQ4N 1TYQB 4BC3A 4J2DA 4IOXA 1TUUA 2P9IA 4IFVA 3DRSA 3VN5A 1YITN 4F4KA 3ENBA 2F7TA 4JAXA 3NF9A 2Q97A 4JEPA 5AQUA 2G8UA 1SL1A 4FXDA 4QCLA 1NKCA 3SNNA 1K8KB 2E2PA 3CI5A 1NK5A 1Q7YO 2O8DA 3WNGA 3QNNA 4AQYK 4FLXA 1D8YA 4C8OA 4LF6K 1SKRA 3VQ6A 2PBDA 1VSIA 2HNZA 4AH9A 3OS2A 4OKEA 4H0OA 3ZSWA 1V4SA 1WB9A 1HYVA 3OJSA 3SBTA 4M3WA 1ASVA 4I6MB 4CZLA 1QSYA 4G1QA 1NKEA 3CHWA 3FE1A 4KKOA 1UAXA 4FW1A 3VEXA 4DV4K 3V9SA 3TAPA 3KVGA 4CZFA 5BRFA 3AO1A 2RF2A 4M41A 4DU4A 3BP8A 1TV6A 5BN8A 2D4WA 1HKCA 3CPWM 3UKUB 4ISEA 1XQSC 1IJJA 4DQSA 1S1VA 4ELTA 4CIEA 3EKSA 3B8AX 1QVGM 4CGDA 3SLCA 4CIFA 2CGJA 1WBDA 3L8BA 4CD1A 2JLEA 5C25A 3HVTA 4LY7A 1RNHA 1S6QA 1VQON 3T69A 1Q18A 5GADP 3SQ2A 1XMQK 1BI4A 3ZSZA 4N41A 3DI6A 4KBOA 4DQPA 2B5JA 3T7ZA 1LAVA 1ASWA 3RRGA 3OYNA 2VGNA 5AQOA 1CLQA 1XUPO 3VGKA 3ZT0A 3DRRA 1KCFA 3KKRA 4DTJA 4CJKA 2PYLA 3TWHA 1W97L 2FBTA 3B6OA 3RWUA 1L3VA 2ZWHA 1GLCG 3A8YA 1UA0A 3OYKA 3RMDA 2HHUA 1HNVA 3ZX0A 4YORA 3QB0A 3DAWA 3HYFA 2P1JA 3A5OC 4FLUA 3VQAA 5C42A 1Q8IA 3VEWA 4FLVA 2LSNA 3MECA 5EVZA 4CEBA 4IXCA 4BGBA 3OBYA 3MN5A 4EZ9A 3HJFA 2HMPA 4OKKA 4AF1A 3R6MA 4CJLA 4CZEA 1NJYA 3L4QA 4YOUA 4CJ3A 3DOLA 3O8MA 1VHXA 3G10A 3AO3A 3UKRB 1C1AA 3FZLA 3NBPA 4WQ4C 4BDPA 4C8LA 3HL8A 4W5QA 4IDKA 3V1QA 4B3RK 1HMVA 3LDSA 3MWPA 3O4WA 3DLKA 5A2QO 1IG9A 1RBVA 2Z1IA 4RW9A 2EHGA 4CHYA 1BISA 2QXFA 2RHKA 1NJWA 4DV0K 4F3TA 4GY2B 1QE1A 1J5EK 4OGEA 4HTUA 4IEIA 4CJ7A 2WC9A 1I94K 1SQKA 3MMVA 3MX5A 5AQXA 4GV6A 3ZSQA 4DSKA 4JKGB 4RW4A 3E9OA 2KZMA 4E89A 3PO4A 3AA5X 4FJKA 1DLOA 4I9QA 1XNRK 1NMDA 1X9JA 4OPHA 1GLBG 3LANA 5DMRA 4ID5A 3LM2A 3ZSRA 5E41A 4Z4CA 2XY6A 1ATRA 5IT9O 4PY5A 2NRHA 5J2PA 1J54A 4BG9A 4ID1A 1NBWA 1LWFA 5FDLA 3ZSOA 1VQ5N 1L3TA 4Z0UA 5DM7L 2CH5A 4QS8A 3V9WA 3B6PA 5GIOA 2Q31A 4BRGA 2ASOA 1RBSA 4HUGA 1S1TA 4R79A 5C12A 2PYJA 1TYQA 1KFSA 3MXIA 1VQMN 1S22A 2ASPA 4FJGA 3NCIA 4OLBA 4K43A 4IFYA 4BWJA 1WUAA 2KLAA 1KLMA 2XY5A 5I9EB 1NGEA 3CFPA 3EEQA 4ZTFA 4LF5K 4M3XA 1RTJA 3M1FA 2HBKA 4Z4FA 1JXEA 2IVPA 3D0PA 1ATNA 3LDQA 4KHUA 3K5MA 4HUFA 3AO5A 1VQ9N 1ZXOA 3FZKA 1HX1A 1S3XA 1YXQA 3K5NA 1RBUA 3L2UA 2Y1JA 2W40A 4EHUA 2HHQA 1QQCA 4KRFA 1N32K 1VSHA 1B92A 3DXKB 1VSEA 4DFJA 1HPMA 4LFAK 1KSPA 4K8ZA 3FZMA 3LDOA 4FWOA 1X9WA 2P9PB 5BRHA 1JL1A 1NGBA 4CE9A 5M1OA 2BGGA 3ISNC 4R5PA 3IDHA 5BPMA 3S3OA 1GOBA 2IAJA 1NK7A 3C65A 3QBXA 1CXQA 3EE9A 3C0BA 4AHRA 4I7FA 1Z6RA 4DKWA 3JSMA 2IC3A 4B9NA 3V9ZA 4HCCA 3M6GA 4KI4A 3AARA 2VYPA 4PKIA 3PLAA 2NRRA 1I3AA 4B9TA 1J9AA 2FBVA 4KH6A 1TGOA 4A61A 4RTFD 1RTIA 4KH4A 4B1VA 4A5AA 3RRHA 3MN7A 4LF8K 1J6ZA 4JK8A 5JMVA 4C8KA 4KHYA 1L3UA 5C0YA 2HNYA 1MWMA 3TSQA 5GINA 1GOAA 2D1KA 4FK0A 4EFHA 3SV4A 2KQ2A 1NK9A 3O3FA 1OH8A 4DTUA 3BY5A 2JWKA 2YHWA 1ATSA 3JYTA 3TAMA 4BWMA 4BE2A 4BRLA 4EP4A 3HP9A 1TL3A 2YNHA 4CGGA 2OTJN 2OPQA 5M1NA 5DM6L 3FZHA 2RPIA 1RBTA 2VG7A 4O4GA 1BOTO 3VTHA 3CETA 4CIGA 4FYDA 1KXPA 4N56A 5CHIA 2Z1HA 2V7YA 3P39A 3WNHA 4AHTA 3RMBA 1GLLO 4CZIA 3VQCA 3OVNA 4O0JA 4DR4K 4KPYA 1U6ZA 1EX4A 1VK0A 3C6UA 4KHQA 3F9KA 4OPAA 2XHBA 2UU9K 1N8RO 1EWRA 4F2SA 4CFDA 2HNDA 2ITGA 5IWAK 3ZT1A 3KHYA 3MEEA 3OW2M 3QIPA 5JLFA 1JJ2M 1SKWA 2P5OA 1VRUA 1Q9XA 3QINA 4B1WB 3CCLN 4U7BA 4BE1A 2HW3A 1W7AA 4JYAK 4AHSA 3OA9A 5AQKA 4CZMA 1S9EA 5KPTA 3C94A 4OX9K 5EU7A 3ZETA 4BROA 1WSJA 4CJUA 2KHOA 5HRRA 4BR0A 3FGUA 5AQIA 4CGIA 4O44A 3CJCA 2B6AA 1VAZA 5AQNA 4DV5K 1TAUA 4XH5A 3EYZA 2D0CA 3SCXA 5JVHL 5AZIA 2QA4N 4BR2A 4A62A 2KZZA 2PAVA 3HPHA 3IG1A 4CCHA 2E2NA 3TANA 2FBYA 2ZQBA 3IS9A 3O9UA 3AVHA 4CHOA 5C10A 3QEPA 4CZHA 3T1YK 4CEFA 2HBJA 3ZEUB 5M1KA 3VQQA 3THWB 2H3GX 3P31A 1U2VB 3D2EA 4CK3A 1KC8O 3U6FA 1GLJO 2E6LA 4FVUA 1K8AO 4BRAA 2CGLA 3ASMA 3OYBA 4DV2K 1LW2A 1BGXT 1GLEG 4B9SA 2OZSA 3RMCA 1S72N 4BY9C 4A59A 1L3SA 1NK8A 4LC9B 4JI7K 2RN2A 3LALA 1N5YA 3P83D 4LSNA 4DQ8A 1RDAA 1RTDA 3L3VA 2A1RA 4FJ7A 1G99A 5AQQA 1N6QA 4M42A 4MQ3A 2YNFA 1BCOA 2VWBA 3KK3A 5HOOA 3HSTB 3KLHA 1VQ8N 3SAGA 1NGFA 3SBGA 3F2KA 4FJ8A 4AM7A 4M63C 2HVIA 4B9MA 2KW4A 2E1YA 4DV3K 4LH5A 2G8IA 4E7HA 4BRFA 4CVNE 4JKEA 3E66A 3RR8A 4JK7A 4DSJA 4N5SA 2GUPA 1X3NA 2IIRA 3K5LA 3O9TA 2UXDK 2DFHA 2OZMA 4B3TK 5BPNA 4CJ4A 5EX5A 3TAGA 4FPAA 2A40A 4FLZA 4ZHRA 4HTLA 1WSIA 4PKHA 4DG1A 2O8EB 4ILHA 1BA1A 4WFBL 2O8FB 3CCMN 4B3SK 1JKHA 1YT3A 4IZ9A 4JD2A 4E7IA 4J8FA 3VEVA 5HBMA 3LWLA 3VTIA 4BRHA 4DQQA 2P9LA 3TTDA 4CF2A 1KFDA 3I0RA 4DR6K 3K9JA 3NE6A 4E7KA 5HRSA 1NG9A 3K0SA 2NRZA 4A2BA 4CERA 4FLTA 5AQZA 1C6VA 3NH0A 2YX6A 2ITMA 3QEWA 3K9KA 4EAHD 3D6RA 4FCYA 4FJIA 5AQSA 4DTSA 1R59O 5LMUK 3CJ9A 1HKGA 3V1OA 2E2QA 1NMNA 4WQ4A 4DFKA 3SK3A 3MXMA 1W0HA 3QO9A 4BC4A 3EL2A 3UIQA 3DM2A 1RDDA 1KTQA 3RVCA 4Z4IA 1GLDG 3ZX3A 5SZTA 3ZSXA 1H1VA 1VQKN 4CESA 3WXLA 3G4SN 4DV7K 4X62K 1XC3A 2YJFA 2Q0UA 3QESA 3OYMA 2W6LA 3U3GA 4WQ5C 3ZYYX 4IFEA 1KRPA 4JI5K 1RT4A 4H4OA 3I0SA 5AQFA 3QEVA 5SWMA 4MFBA 4XH4A 4OVLA 3KD1E 1YHQN 3QLHA 4CEZA 4CHNA 3VEYA 3L6QA 4FWSA 4BRCA 2P9SA 3NGZA 2BE2A 1RT2A 4NO7A 1D9DA 1IH7A 2QWRA 4H0YB 3MN6A 5BR9A 3THXA 3PIOL 5JICA 5CE3A 3LL3A 5ADXH 2YI1A 1HYSA 4IO8A 1N36K 1EQYA 4AM6A 3WXMB 5KPRA 3CD6N 1S1WA 1X1PA 3HPOA 3OBWA 1LWCA 4HWIA 1HPZA 1Q9YA 4IJAA 2YKNA 1SL0A 4L3QA 1S9GA 4BVPA 1T7PA 3ZEUA 3THWA 3D45A 1R0AA 3SMSA 1QHAA 5EXWA 5KPZA 3I55N 3SJHA 1QSSA 4FM0A 4BACA 1TKXA 4LFBK 4B9QA 3HP6A 1X9MA 3HM8A 1ZC6A 3CG7A 2E5LK 3OYIA 2UUCK 2IDOA 5AZJB 2FF6A 1IV0A 5GIPA 4JRQA 4B8AB 1J5OA 3C7NA 3LPUA 4U67L 3CCEN 2F8TA 4LD0A 1OVYA 3EKUA 3M5RA 4WF9L 1BO5O 4FK4A 3OHRA 1BWFO 4CK1A 4KTQA 1DT9A 1FKOA 4ISGA 1O13A 1KVCA 2E20A 4FJMA 1TK0A 4FK2A 4ILGB 4H5VA 3R1XA 2DTUA 3JAMO 1UA1A 3CCSN 4LH4A 4YOXA 4CJRA 4JS5A 1QZ6A 3LAKA 2WONA 4W5NA 5JLHA 2EX3A 3HPGA 2QWNA 1T03A 3VQ4A 4OJRA 2VQEK 1LV5A 4UY8O 1P8ZA 1NJXA 5HLFA 1NGJA 3L4IA 2WOMA 1A5WA 3QMLA 4BREA 2UUBK 4RW8A 2NZTA 3U8XA 4BRKA 3SMPA 2PFUA 4NLCA 3SZ2A 4Q0BA 2F9TA 4NYNA 5AQLA 4IEEA 5F2RA 1KQSM 3AO4A 5E84A 1IKVA 3PX6A 2AJQA 4KO0A 2BDPA 2FSKA 4CJFA 4DS5A 1NGCA 4FL9A 1WOQA 2Y1IA 3NVMA 4K25A 4CJWA 3TSUA 3OS0A 3J7ZO 4DFPA 5LMNK 4GV9A 4FO0A 1BG3A 2QKKA 4E1NA 1M90O 1KVAA 5J2MA 1KAYA 4XEIA 4XIUA 3L2VA 1MU2A 3SAFA 1UWBA 4CJQA 3TTCA 4G9ZA 4H5TA 3TSPA 5HRPA 3KK1A 3DLRA 3DMJA 1Q86O 4CJTA 5C24A 4B9UA 3MX2A 5I42A 3HVRA 2P9KB 3AVFA 2QI2A 4X65K 1JCEA 4H8KA 3VPZA 3VGLA 1QQOA 4CZGA 3AVKA 4KB0A 2O8CA 4KB1A 3MDQA 1JCGA 1WSGA 4K41A 1ZYQA 3LP3A 3SAHA 3N4PA 2HBLA 3BGRA 2DFFA 4QS9A 5AQJA 3NDKA 3A0IX 2QXLA 3KZBA 3PUFA 1D5AA 3VGMA 2F4VK 3VQ9A 3DJCA 3RSEB 3SYZA 3GBTA 4FW2A 3D2FB 5FPDA 2HBMA 5DK5A 4Z4HA 4KI6A 2O8BA 3HBTA 2ATQA 3CPEA 3SPZA 1NNEA 3IAYA 1YTAA 2E6MA 1JLFA 1VRTA 4M7XA 4BG8A 3G71N 4ILJA 4JLHA 3KK7A 3VQBA 2Z1JA 3HTVA 3CJ1A 4O5FA 4B1XB 1IKXA 2GWJA 4J2BA 4V19S 3NGYA 3SUQA 1ILYA 3LWMA 2P51A 4PWDA 4FM1A 1RT3A 4E19A 4C23A 3CFRA 4FWPA 2OPSA 3IRXA 4JKHA 1YUWA 3A5NC 3HM9A 4DLGA 4CW7B 3U9DA 1JLEA 3QFUA 3V81A 3EZWA 4FLYA 3ZT2A 4Q5VA 1K8KA 3CJAA 2QWOA 4FVMA 2ZM6K 3DLEA 2WUSA 4K0KK 2X74A 4CEAA 3J81O 5BR8K 3LP2A 3LDPA 1FKPA 1YJNN 3EY1A 5KQDA 4I6MA 3SUNA 2GWKA 2WFBA 4OLAA 4CBXA 5AQGA 3AVLA 3ENOA 4JKCA 3QETA 3TI0A 4CJEA 3P5JA 3C6AA 4PL7A 3NAEA 4H5NA 5KRSA 5AQYA 1EETA 3J7AP 3UKUA 1KVBA 3MEGA 3WQUA 2QWMA 1S5JA 4JI1K 4CFAA 3A2FA 4W5OA 3VQPA 1QQNA 3N4QA 3S3MA 3AVMA 3M8PA 5LJWA 5KGWA 4YDUC 4Y1DA 1VSJA 2NUBA 3E1YA 4YOWA 3QNOA 4FJLA 2YHYA 3GL1A 4DCHA 2HF4A 1JLCA 2BTFA 5EOYA 3VOVA 5KGXA 4YOVA 3TAFA 2NLXA 5AZJA 1IO2A 2D5RA 1T3VA 5FPEA 2YJEA 3ZCMA 3L0QA 3M3ZA 1M1KO 1JCFA 4E7LA 1RDCA 1S1XA 3U3YA 4BE0A 3SQ1A 1NK6A 1LW0A 4F8RA 4W5TA 1NKBA 3MXJA 4FLWA 4YHHK 4KREA 3WQTA 2ZE2A 4CHPA 1U4BA 1L5UA 3WXIA 4PQUA 2OPRA 5GAEP 3KLGA 3AVGA 4RW7A 5D3GA 4FWRA 2GX9A 4CF0A 3J7YP 3ULEB 1LWEA 2GTDA 5AJ3K 4KTZA 3LP0A 3QICA 3T1HK 4BGAA 5ADXA 3PSFA 5T7BA 2F96A 4CJVA 3UKRA 3VESA 1V4TA 4JKAA 1MWKA 1YIJN 2F8SA 2XRIA 1QSLA 2HVHA 2KFNA 4DMNA 5C15A 3F5TA 5CZ2A 2Q0RA 4PA1A 4H0XB 3HXMA 3CQ8A 2E1ZA 3PSIA 4H5WA 3BZKA 2FLOA 3PX0A 4CFCA 1OH7A 3E9LA 2P9IB 3W0LA 4NYFA 1DEJA 4M3RA 4BC2A 2E8AA 3VQ8A 2FSJA 1DTTA 3M8RA 4JKDA 3CCUN 4C8NA 3U4LA 3S9HA 4DWIA 2UUAK 4E1MA 3C6HA 3QBWA 3HO1A 1RT1A 4JKGA 2CGKA 5CYQA 2O8DB 1TVRA 4FJ5A 1C0UA 1KAXA 3V9UA 5HROA 3KKSA 1NJZA 3CMEN 2YHAA 3OYAA 4IOCL 4FJXA 2E2OA 3AGRA 3AVIA 4YOTA 4E7JA 4BC5A 3LM9A 3EZ5A 3SV3A 4WQ5A 4JV5K 4GW6A 1VQ6N 1WBBA 4M7YA 1NU0A 2RE2A 4K8XA 3HOSA 3NFAA 3AVBA 2GV9A 3AVJA 1U47A 1VQ7N 1FXXA 3K5OA 4DR2K 3IFRA 4X66K 3QFPA 5KTQA 2HHWA 1NLVA 5AQTA 3VQ5A 5AQPA 3VA3A 2DFEA 5KI6A 1TK5A 1RFQA 5AFUH 1SAZA 3E9PA 1U04A 3WNFA 3BDPA 4BQZA 4YY3K 2QTDA 4FOEA 4IDHA 1WSFA 4NB4A 4NXNK 3OS1A 1HJOA 1BI4B 1LOTB 1T6CA 3BF3A 1JLGA 4OO1J 3EO3A 2KFZA 5H1SQ 3MN9A 1X3MA 1TL1A 2V51B 2NRVA 2DPNA 4FJNA 1E4FT 1QVFM 3O1WA 3ZX2A 3DXKA 2A5XA 3CIPA 2P9PA 3F9MA 4WCEL 4DV6K 1C0FA 1NGDA 4DS4A 4JI2K 3G0ZA 4A57A 1KLNA 1YTUA 3W3DA 2X6SA 4JN4A 2IS3A 4HHTA 2X6NA 3KTQA 1NWKA 3TPQA 2ZJQL 3VERA 2XO7A 4O55A 1RDUA 4IG0A 1HUXA 5TKYA 3O9QA 3CCQN 4AHUA 4H0VB 4IG3A 3CC7N 2GELA 2E4LA 4Y1CA 3AO2A 3FZFA 4DSLA 3TAEA 4CJSA 4FJJA 4FJHA 1BQMA 4FM2A 1NOZA 3KIOA 2F9WA 2P5GA 3OYDA 3HK2A 5GAHP 4DF8A 5CR4A 5KQ8A 3PO5A 3O4NA 3SPYA 4BR4A 1WSHA 3Q7CA 1EWQA 4FZYA 1T8EA 4DTNA 2J4RA 4DQRA 4H4MA 4JI4K 4BR5A 1ZBIA 2QWLA 4JHDB 4FZZA 4IOAL 3TABA 4B1UB 4CF1A 2V52B 3I33A 3CM6A 2JWLA 1VSKA 2I5JA 3OY9A 4XH1A 3SUPA 2D0PA 1HJRA 3CC2N 3CC4N 1XMOK 1Z26A 4GV3A 1TUYA 3O1BA 3O6WA 1BIUA 3AVAA 4CECA 1JLQA 1XNQK 3OYLA 2OANA 3GOIA 1QS4A 4FWLA 1A5VA 3ID8A 3IKMA 4QAGA 1HNZK 4CBWA 3CM5A 3MWTA 4F9OA 4CEQA 2FBXA 2CH6A 4A5BA 3MCPA 3HT3A 4IO9L 4DR3K 2OA8A 1W9HA 4JKBA 5J1EA 1NK0A 4BR7A 3V4IA 3VQ7A 4YOYA 3NGIA 2O4IA 4N47A 3KJVA 2JGUA 4GVMA 2G8HA 5C2DA 1TKZA 4CBUA 2FSNA 1VSMA 1RDWX 4IWVA 3O08A 2BANA 2UYTA 3G25A 1MDUB 4CF9A 3ZSYA 2Q1NA 3FLCO 4JI0K 3PX4A 1BU6O 4B9VA 4M3TA 2UXCK 4DTOA 3AAPA 1WN7A 4IJNA 3OJUA 3A5LC 3R8EA 4LF9K 1JXBA 1RT6A 1QQMA 1RTHA 3K59A 2RKIA 4DHYA 5HP1A 1YAGA 4FJ9A 1SKSA 1NGAA 1Q81O 4B1YB 4FPBA 5B8HA 4EIAA 4EZ6A 3AY9A 1QHTA 3VQDA 4EHTA 1U49A 1U2VA 3MAQA 4NLBA 2PY5A 4JI3K 4ISFA 5J2QA 5FROA 2IVOA 3DXMB 4DQIA 1EO1A 3SI6A 1JLBA 2OYQA 4CF8A 4QOZB 4HCBA 4CEDA 2UXBK 4CEOA 4JS4A 3E01A 1C1CA 2GBZA 2KTQA 4OGCA 2YV0X 2X78A 2VWJA 4M3ZA 4DU1A 1W2BM 4CGJA 3VMFB 2YCHA 3OYFA 1U45A 5JVGL 4ELVA 3LP1A 4NCBA 1HRHA 3WUHA 4PHTX 3SUOA 1JLAA 3LDNA 3L2QA 4F2RA 5C2FA 5AQVA 4BRIA 3SQ4A 5CYMA 4BRNA 1TKTA 4FZXC 5FRNA 4B3MK 5KRTA 2HB5A 1KAZA 1IKWA 1F21A 2VQFK 3HZ6A 1OH5A 1QTMA 3CERA 2QKBA 1Z05A 2Q2RA 3PIPL 2YHXA 1OH6A 3VF4A 4B1ZA 2Z1GA 5ELZA 3PY8A 3BUZB 4YDUA 4CZKA 3GG4A 1VQPN 2D0OA 4MDBA 1RBRA 1HR0K 3DWLA 3WEEB 3NF8A 4DF4A 1HQEA 3CMAN 3AAQA 4ICLA 3NH1A 4J2AA 3H08A 3ZLJA 3THYB 2O8EA 3DLBA 2O8FA 5E26A 4MO4A 1EP4A 2BH1A 2HF3A 4AHCA 1K9MO 4BR9A 4DUYK 2A3ZA 1X9SA 3UE5A 3O3GA 2QEXN 1Y97A 4OKJA 4GMJB 1ZBFA 3QERA 4WE1A 4B3OA 2GEMA 4BRDA 1B9DA 2HHSA 1IG8A 5AFUA 3QDKA 4DB3A 5BRDA 1VQLN 2IOCA 2ZD1A 4DLEA 1ASUA 3S3NA 1C0MA 1RGIA 3CJBA 4JHDA 4KHWA 4DR5K 1YJWN 1FK9A 1REVA 1HNIA 4GVEA 4KFBA 1D4XA 2QWQA 1CZ9A 5GAGP 1P90A 4MDAA 4W5RA 1WNSA 4UQGA 3CCRN 3ATUA 2V7ZA 3ZETB 4OPKA 2XY8A 3TU5A 1J53A 4DU3A 1N33K 1B9FA 1O1WA 2A42A 4MLEA 3KD5E 2I7NA 2FXUA 2NNWA 2NRTA 3ENHA 4DTXA 5AZIB 4NXMK 1ITGA 1HLUA 2VG5A 3VETA 3IMXA 3LZJA 2G8WA 4JRPA
chains in the Genus database with same CATH topology
4CJ4A 4RG8A 2F8SA 3P1GA 3TAGA 1DTQA 5CY4A 4FLZA 4ZHRA 2XRIA 4DQSA 1S6PA 1QSLA 1S1VA 4ELTA 2HVHA 4CIEA 2KFNA 4DMNA 1EXQA 1WSIA 4M3YA 4DG1A 4CGDA 5CZ2A 4CIFA 4CGHA 3SQ0A 3L8BA 3LAMA 4PA1A 3K2PA 2JLEA 3HXMA 1JKHA 3HVTA 5C25A 4LY7A 1RNHA 1RCHA 1S6QA 3DOKA 1YT3A 3CQ8A 4E7IA 1C0TA 3SQ2A 3AV9A 5HBMA 3LWLA 3PX0A 4CFCA 1BI4A 1K6YA 3ZSZA 4N41A 3DI6A 4DQQA 3TARA 4NYFA 4DQPA 4M3RA 2B5JA 3VQ8A 3THVA 4CF2A 1KFDA 1LAVA 3I0RA 1ASWA 4BDZA 3OYNA 3RRGA 1BCMA 3NE6A 4E7KA 1CLQA 1DTTA 3ZT0A 3M8RA 3DRRA 1KCFA 3KKRA 5HRSA 4C8NA 4CJKA 3LZIA 4DTJA 3S9HA 2PYLA 3TWHA 4DWIA 2Q3SA 4BDYA 2FBTA 4E1MA 3B6OA 4CERA 4FLTA 3OYEA 1RT1A 1L3VA 3RWUA 5CYQA 3HO1A 1C6VA 1TVRA 3NH0A 1UA0A 4FJ5A 1C0UA 2OPPA 3QEWA 3OYKA 3RMDA 2HHUA 1HNVA 3V9UA 5HROA 3KKSA 1NJZA 4FCYA 3HYFA 4FJIA 2P1JA 2YHAA 4FLUA 3VQAA 5C42A 3OYAA 4HUEA 4FJXA 1Q8IA 4DTSA 4FLVA 2LSNA 3V1OA 3MECA 5K14A 4CEBA 4DFKA 3MXMA 3AVIA 1W0HA 3QO9A 4E7JA 3UIQA 3DM2A 1RDDA 1KTQA 3EZ5A 4DTMA 4EZ9A 4M42A 3SV3A 4O0IA 4OKKA 3HJFA 4GW6A 4Z4IA 4CJLA 3M8SA 5SZTA 4CJ3A 1CXUA 1NJYA 3DOLA 4K8XA 2HHVA 3NFAA 3AVBA 2GV9A 2O4GA 3AVJA 3M8QA 1RT5A 3ZSXA 3QEIA 1U47A 4ELVA 3G10A 3AO3A 4CESA 1FXXA 3K5OA 2W42A 1C1AA 3NBPA 4RW6A 2B4JA 5KTQA 4BDPA 4C8LA 3HL8A 2HHWA 4W5QA 3VQ5A 3QIOA 3VA3A 2DFEA 4B08A 4IDKA 5KI6A 3QESA 1TK5A 3V1QA 3AA2A 3OYMA 4KTWA 4N76A 5I3UA 3U3GA 3NH2A 4NCAA 1U04A 1HMVA 1KRPA 3WNFA 1RT4A 4CFBA 4H4OA 3LDSA 3BDPA 3I0SA 2VG6A 1WSFA 3QEVA 3DLKA 1TAQA 4MFBA 5SWMA 1TKDA 1RBVA 1IG9A 2Z1IA 3OS1A 4RW9A 1BI4B 1JLGA 2EHGA 4OVLA 4CHYA 1BISA 1EKEA 3KD1E 2QXFA 2KFZA 1G15A 1NJWA 3QLHA 4CEZA 4F3TA 3LPTA 5JS1A 1QE1A 3DRPA 4NCGA 1TL1A 4CHNA 3SJJA 4OGEA 4HTUA 3WNEA 4FJNA 3NGZA 2BE2A 3O4QA 1RT2A 3ZSQA 4M3UA 1VSLA 4DSKA 1C1BA 4RW4A 1XHXA 2KZMA 1CZBA 4E89A 1D9DA 3PO4A 1IH7A 3AA5X 1ZBLA 4FJKA 2QK9A 1DLOA 5HRNA 3DYAA 3V1RA 4I9QA 3LANA 5CZ1A 5DMRA 2OZMA 4ID5A 1HQUA 1HYSA 3ZSRA 5E41A 1A5XA 4Z4CA 2XY6A 3RTVA 4PY5A 5J2PA 1SV5A 4DS4A 1S1WA 1X1PA 1J54A 3HPOA 4ID1A 1TK8A 4IKFA 3G0ZA 1LWFA 1NK4A 1LWCA 5FDLA 3ZSOA 1KLNA 1YVUA 2VWKA 1YTUA 1L3TA 2X6SA 4Z0UA 1HPZA 1Q9YA 3I8DA 2YKNA 3T1AA 1SL0A 3C95A 2D0BA 2IS3A 4ZTJA 1S9GA 3V9WA 3B6PA 1T7PA 4HHTA 2X6NA 3KTQA 4TSXA 3D45A 4LSLA 1R0AA 1RBSA 2IGIA 4HUGA 1RDBA 1S1TA 1QSSA 1GOCA 4FM0A 2XO7A 4YNQA 4O55A 4IG0A 4BACA 1WAFA 1TKXA 4DSFA 2PYJA 4AHUA 1KFSA 3MXIA 3HP6A 1X9MA 4IG3A 3F73A 3CG7A 1LAWA 2XY7A 2E4LA 4Y1CA 3AO2A 4DSLA 3OYIA 4FJGA 3NCIA 2IDOA 4DSEA 4OLBA 4IFYA 4BWJA 3TAEA 4CJSA 4FJJA 1KLMA 4CEEA 2XY5A 4FJHA 4JRQA 4B8AB 1BQMA 1J5OA 1IKYA 3OYCA 3CFPA 1Z25A 4ZTFA 3LPUA 4FM2A 2G8VA 4M3XA 1NOZA 1RTJA 3KIOA 2P5GA 4Z4FA 1JXEA 2F8TA 4LD0A 3OYDA 4FK4A 3HK2A 3D0PA 4DF8A 3PO5A 4CK1A 3O4NA 2ETJA 3SPYA 4B9LA 1U48A 1WSHA 4KTQA 4KHUA 3K5MA 4HUFA 1FKOA 1RT7A 1T8EA 4FZYA 3AO5A 1KVCA 4DQRA 4DTNA 4FJMA 1TK0A 4H4MA 1ZBIA 4FZZA 4FK2A 3TABA 4NCBA 4CF1A 3K5NA 1RBUA 3CM6A 3L2UA 3L2WA 3DLHA 4KHNA 1UA1A 2DTUA 1VSKA 4LH4A 4OPJA 3AA4A 2Y1JA 4CJRA 4JS5A 2HHQA 2I5JA 2WONA 3LAKA 4M45A 1QQCA 4KRFA 4W5NA 3OY9A 3SUPA 1HJRA 2EX3A 3HPGA 1T03A 1VSHA 1B92A 3VQ4A 1Z26A 4OJRA 1XI1A 1LV5A 4CHQA 1VSEA 4DFJA 1BIUA 1NJXA 3AVAA 3TR8A 5HLFA 2WOMA 1A5WA 4ELUA 1KSPA 4CECA 1JLQA 4K8ZA 3OYLA 4RW8A 2G8FA 1X9WA 5FRMA 3NHGA 1RILA 1QS4A 1JL1A 3SZ2A 4CE9A 1A5VA 4CJ5A 4Q0BA 2HMIA 2BGGA 4NYNA 3ISNC 4R5PA 4QAGA 3VA0A 3AO4A 4L8RB 3S3OA 1IKVA 1GOBA 3PX6A 2AJQA 4KO0A 2BDPA 2IAJA 1NK7A 4CJFA 3CM5A 3CYMA 4DS5A 4CEQA 2FBXA 1CXQA 3HT3A 2Y1IA 2OA8A 4CJWA 1W9HA 3L2RA 5J1EA 4AHRA 1NK0A 4I7FA 3OS0A 3V9XA 3JSMA 4DFPA 4DSIA 2IC3A 3V4IA 3VQ7A 1HYZA 3NGIA 2QKKA 4N47A 4E1NA 3V9ZA 4B9NA 1KVAA 1BHLA 4HCCA 4KI4A 3KJVA 2PZSA 5J2MA 2JGUA 4GVMA 2G8HA 4XIUA 3L2VA 1TKZA 1MU2A 2YHBA 4KHSA 1UWBA 4DTPA 1I3AA 4CJQA 4B9TA 1J9AA 2FBVA 1TGOA 5HRPA 3KLIA 1VSMA 3DLRA 3DMJA 3OYJA 3KK1A 1JL2A 1RTIA 4CJTA 2O4IA 2BANA 5C24A 4B9UA 1S1UA 1BIZA 3RRHA 5I42A 3HVRA 3RR7A 4C8MA 3AVFA 3ZSYA 4CF9A 4I9LA 4H8KA 3ZSVA 4KB0A 4B8CA 3AVKA 4CGFA 4C8KA 4KHYA 4HVJA 1L3UA 3PX4A 1D9FA 2HNYA 4KB1A 1WSGA 3KLEA 1ZYQA 4B9VA 4M3TA 3LP3A 4DTOA 4KHQA 1WN7A 1GOAA 3AA3A 4AHVA 3FFIA 3OJUA 2YNIA 3BGRA 3SV4A 4FK0A 2DFFA 2KQ2A 4E3SA 1NK9A 3O3FA 3NDKA 2DY4A 1JXBA 1RT6A 3K59A 1RTHA 3KK2A 4DTUA 3MEDA 1ZBHA 2RKIA 3PUFA 1D5AA 1WAJA 3JYTA 5HP1A 3VQ9A 3T3FA 3TAMA 4BWMA 4BE2A 4I2QA 4F3OA 4CK2A 4EP4A 3SYZA 3HP9A 3QEXA 4FJ9A 1TL3A 4FW2A 1UOCA 1SKSA 2YNHA 4CGGA 2OPQA 5DK5A 4Z4HA 2D0AA 3NF7A 1BL3A 4KI6A 2RPIA 2ATQA 1VSDA 3SPZA 1RBTA 2VG7A 4O4GA 3IAYA 3ZT4A 4EZ6A 1YTAA 2E6MA 1JLFA 1QHTA 1VRTA 3VQDA 3KLFA 1U49A 3MAQA 4CIGA 4FYDA 1T05A 4N56A 2PY5A 3NF6A 4JLHA 3VQBA 5FROA 5J2QA 2Z1JA 4DQIA 2Z1HA 3SI6A 1JLBA 2OYQA 1IKXA 4CF8A 4QOZB 4HCBA 4CEDA 3WNHA 4AHTA 4J2BA 3NGYA 3RMBA 3SUQA 3LWMA 4F8RA 2P51A 4CEOA 4PWDA 3VQCA 4FM1A 4JS4A 1RT3A 3OVNA 3E01A 1C1CA 2GBZA 1BQNA 2KTQA 4OGCA 1WSEA 2YV0X 2X78A 4O0JA 4E19A 2VWJA 4M3ZA 3CFRA 4DU1A 3ULDA 4E0DA 4KPYA 4I2PA 3AVNA 4IBNA 4CGJA 3OYFA 1EX4A 1VK0A 3C6UA 2OPSA 3IRXA 3LP1A 3F9KA 2R7YA 2XHBA 1U45A 3HM9A 1HRHA 4DLGA 1JLEA 1XWLA 3SUOA 3V81A 3T19A 2YKMA 1JLAA 2YNGA 2FC0A 3ZT2A 2A1SA 3L2QA 4FLYA 4F2RA 4YFUA 4Q5VA 4F2SA 4CFDA 3C6TA 3SQ4A 2HNDA 4Z4GA 3ZT3A 5CYMA 1SUQA 2ITGA 1TKTA 3CFOA 3ZT1A 4FZXC 5FRNA 2G8KA 3MEEA 4FVMA 2GUIA 3QIPA 3DLEA 1SKWA 2P5OA 1VRUA 1Q9XA 5KRTA 3PV8A 3QINA 2HB5A 1IKWA 1F21A 2HW3A 4BE1A 5J2NA 3TAQA 4AHSA 4AILC 3V6DA 1QTMA 1S9EA 2X74A 4CEAA 2QKBA 3LP2A 3OYHA 3C94A 1FKPA 5EU7A 3K57A 1WSJA 4CJUA 3EY1A 1SL2A 1WLJA 3SUNA 5HRRA 4DFMA 4EP5A 1XHZA 3RMAA 4OLAA 2Z1GA 4DTRA 3PY8A 1I39A 4CGIA 4O44A 3AVLA 2B6AA 4J2EA 1TAUA 3ALYA 3QETA 1RBRA 3TI0A 3K58A 4CJEA 3EYZA 2D0CA 3SCXA 3NF8A 2HHTA 3P5JA 4DF4A 1HQEA 3NAEA 1NOYA 2KZZA 3OYGA 2HHXA 3AVCA 3HPHA 3IG1A 4ICLA 4CCHA 5KRSA 4PUOA 1EETA 3NH1A 2FBYA 4CJPA 2ZQBA 3TANA 3IS9A 5JS2A 3AVHA 1KVBA 3MEGA 4CHOA 4KAZA 4J2AA 1S5JA 4CHZA 3H08A 3QEPA 4Z4EA 4KV8A 4CFAA 3A2FA 1VSFA 4CEFA 4W5OA 3VQPA 3O3HA 3DLBA 3VQQA 3S3MA 3AVMA 1ZBUA 3DLGA 3M8PA 5KGWA 3L3UA 4CK3A 1EP4A 3ITHA 4Y1DA 3VQEA 3U6FA 1VSJA 1XC9A 2E6LA 2NUBA 4AHCA 3QNOA 4FJLA 4O5BA 1X9SA 4J2DA 1JLCA 3ASMA 3OYBA 1LW2A 5KGXA 3O3GA 1BGXT 4IFVA 3TAFA 1Y97A 3DRSA 4GMJB 4OKJA 4B9SA 2OZSA 3RMCA 1IO2A 2D5RA 3VN5A 1L3SA 1ZBFA 1NK8A 4F4KA 3QERA 3ZCMA 4WE1A 4B3OA 2RN2A 3LALA 3NF9A 1B9DA 1N5YA 3P83D 4LSNA 4E7LA 2HHSA 2G8UA 1SL1A 1RDCA 1RDAA 4FXDA 1S1XA 1RTDA 3L3VA 4QCLA 2A1RA 4FJ7A 3U3YA 1NKCA 4BE0A 2IOCA 3SNNA 1NK5A 2ZD1A 4DLEA 3SQ1A 1ASUA 3WNGA 3QNNA 1NK6A 1N6QA 1LW0A 4FLXA 4MQ3A 4W5TA 1NKBA 3MXJA 4FLWA 3S3NA 1C0MA 2YNFA 1D8YA 4C8OA 4KREA 1BCOA 1SKRA 2ZE2A 4KHWA 4CHPA 1U4BA 1FK9A 3VQ6A 3KK3A 3HSTB 1L5UA 1REVA 1HNIA 3KLHA 1VSIA 2OPRA 4PQUA 2HNZA 4AH9A 3OS2A 4KFBA 3AVGA 4RW7A 3KLGA 4OKEA 5D3GA 1CZ9A 3ZSWA 1WNSA 4W5RA 4FJ8A 1HYVA 4CF0A 4UQGA 3OJSA 4OPKA 4B9MA 4M3WA 2KW4A 2XY8A 2HVIA 1ASVA 1LWEA 4LH5A 1QSYA 4G1QA 1NKEA 1J53A 4DU3A 2G8IA 4E7HA 1B9FA 1O1WA 4KTZA 3RR8A 4KKOA 3LP0A 1UAXA 3KD5E 4FW1A 4DSJA 4N5SA 3V9SA 3K5LA 3TAPA 5T7BA 2F96A 4DTXA 3AO1A 4CJVA 1ITGA 2VG5A 2RF2A 2DFHA 4M41A 4DU4A 1TV6A 3LZJA 2G8WA 4JRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJ4 A;  4RG8 A;  2F8S A;  3P1G A;  3TAG A;  1DTQ A;  5CY4 A;  4FLZ A;  4ZHR A;  2XRI A;  4DQS A;  1S6P A;  1QSL A;  1S1V A;  4ELT A;  2HVH A;  4CIE A;  2KFN A;  4DMN A;  1EXQ A;  1WSI A;  4M3Y A;  4DG1 A;  4CGD A;  5CZ2 A;  4CIF A;  4CGH A;  3SQ0 A;  3L8B A;  3LAM A;  4PA1 A;  3K2P A;  2JLE A;  3HXM A;  1JKH A;  3HVT A;  5C25 A;  4LY7 A;  1RNH A;  1RCH A;  1S6Q A;  3DOK A;  1YT3 A;  3CQ8 A;  4E7I A;  1C0T A;  3SQ2 A;  3AV9 A;  5HBM A;  3LWL A;  3PX0 A;  4CFC A;  1BI4 A;  1K6Y A;  3ZSZ A;  4N41 A;  3DI6 A;  4DQQ A;  3TAR A;  4NYF A;  4DQP A;  4M3R A;  2B5J A;  3VQ8 A;  3THV A;  4CF2 A;  1KFD A;  1LAV A;  3I0R A;  1ASW A;  4BDZ A;  3OYN A;  3RRG A;  1BCM A;  3NE6 A;  4E7K A;  1CLQ A;  1DTT A;  3ZT0 A;  3M8R A;  3DRR A;  1KCF A;  3KKR A;  5HRS A;  4C8N A;  4CJK A;  3LZI A;  4DTJ A;  3S9H A;  2PYL A;  3TWH A;  4DWI A;  2Q3S A;  4BDY A;  2FBT A;  4E1M A;  3B6O A;  4CER A;  4FLT A;  3OYE A;  1RT1 A;  1L3V A;  3RWU A;  5CYQ A;  3HO1 A;  1C6V A;  1TVR A;  3NH0 A;  1UA0 A;  4FJ5 A;  1C0U A;  2OPP A;  3QEW A;  3OYK A;  3RMD A;  2HHU A;  1HNV A;  3V9U A;  5HRO A;  3KKS A;  1NJZ A;  4FCY A;  3HYF A;  4FJI A;  2P1J A;  2YHA A;  4FLU A;  3VQA A;  5C42 A;  3OYA A;  4HUE A;  4FJX A;  1Q8I A;  4DTS A;  4FLV A;  2LSN A;  3V1O A;  3MEC A;  5K14 A;  4CEB A;  4DFK A;  3MXM A;  3AVI A;  1W0H A;  3QO9 A;  4E7J A;  3UIQ A;  3DM2 A;  1RDD A;  1KTQ A;  3EZ5 A;  4DTM A;  4EZ9 A;  4M42 A;  3SV3 A;  4O0I A;  4OKK A;  3HJF A;  4GW6 A;  4Z4I A;  4CJL A;  3M8S A;  5SZT A;  4CJ3 A;  1CXU A;  1NJY A;  3DOL A;  4K8X A;  2HHV A;  3NFA A;  3AVB A;  2GV9 A;  2O4G A;  3AVJ A;  3M8Q A;  1RT5 A;  3ZSX A;  3QEI A;  1U47 A;  4ELV A;  3G10 A;  3AO3 A;  4CES A;  1FXX A;  3K5O A;  2W42 A;  1C1A A;  3NBP A;  4RW6 A;  2B4J A;  5KTQ A;  4BDP A;  4C8L A;  3HL8 A;  2HHW A;  4W5Q A;  3VQ5 A;  3QIO A;  3VA3 A;  2DFE A;  4B08 A;  4IDK A;  5KI6 A;  3QES A;  1TK5 A;  3V1Q A;  3AA2 A;  3OYM A;  4KTW A;  4N76 A;  5I3U A;  3U3G A;  3NH2 A;  4NCA A;  1U04 A;  1HMV A;  1KRP A;  3WNF A;  1RT4 A;  4CFB A;  4H4O A;  3LDS A;  3BDP A;  3I0S A;  2VG6 A;  1WSF A;  3QEV A;  3DLK A;  1TAQ A;  4MFB A;  5SWM A;  1TKD A;  1RBV A;  1IG9 A;  2Z1I A;  3OS1 A;  4RW9 A;  1BI4 B;  1JLG A;  2EHG A;  4OVL A;  4CHY A;  1BIS A;  1EKE A;  3KD1 E;  2QXF A;  2KFZ A;  1G15 A;  1NJW A;  3QLH A;  4CEZ A;  4F3T A;  3LPT A;  5JS1 A;  1QE1 A;  3DRP A;  4NCG A;  1TL1 A;  4CHN A;  3SJJ A;  4OGE A;  4HTU A;  3WNE A;  4FJN A;  3NGZ A;  2BE2 A;  3O4Q A;  1RT2 A;  3ZSQ A;  4M3U A;  1VSL A;  4DSK A;  1C1B A;  4RW4 A;  1XHX A;  2KZM A;  1CZB A;  4E89 A;  1D9D A;  3PO4 A;  1IH7 A;  3AA5 X;  1ZBL A;  4FJK A;  2QK9 A;  1DLO A;  5HRN A;  3DYA A;  3V1R A;  4I9Q A;  3LAN A;  5CZ1 A;  5DMR A;  2OZM A;  4ID5 A;  1HQU A;  1HYS A;  3ZSR A;  5E41 A;  1A5X A;  4Z4C A;  2XY6 A;  3RTV A;  4PY5 A;  5J2P A;  1SV5 A;  4DS4 A;  1S1W A;  1X1P A;  1J54 A;  3HPO A;  4ID1 A;  1TK8 A;  4IKF A;  3G0Z A;  1LWF A;  1NK4 A;  1LWC A;  5FDL A;  3ZSO A;  1KLN A;  1YVU A;  2VWK A;  1YTU A;  1L3T A;  2X6S A;  4Z0U A;  1HPZ A;  1Q9Y A;  3I8D A;  2YKN A;  3T1A A;  1SL0 A;  3C95 A;  2D0B A;  2IS3 A;  4ZTJ A;  1S9G A;  3V9W A;  3B6P A;  1T7P A;  4HHT A;  2X6N A;  3KTQ A;  4TSX A;  3D45 A;  4LSL A;  1R0A A;  1RBS A;  2IGI A;  4HUG A;  1RDB A;  1S1T A;  1QSS A;  1GOC A;  4FM0 A;  2XO7 A;  4YNQ A;  4O55 A;  4IG0 A;  4BAC A;  1WAF A;  1TKX A;  4DSF A;  2PYJ A;  4AHU A;  1KFS A;  3MXI A;  3HP6 A;  1X9M A;  4IG3 A;  3F73 A;  3CG7 A;  1LAW A;  2XY7 A;  2E4L A;  4Y1C A;  3AO2 A;  4DSL A;  3OYI A;  4FJG A;  3NCI A;  2IDO A;  4DSE A;  4OLB A;  4IFY A;  4BWJ A;  3TAE A;  4CJS A;  4FJJ A;  1KLM A;  4CEE A;  2XY5 A;  4FJH A;  4JRQ A;  4B8A B;  1BQM A;  1J5O A;  1IKY A;  3OYC A;  3CFP A;  1Z25 A;  4ZTF A;  3LPU A;  4FM2 A;  2G8V A;  4M3X A;  1NOZ A;  1RTJ A;  3KIO A;  2P5G A;  4Z4F A;  1JXE A;  2F8T A;  4LD0 A;  3OYD A;  4FK4 A;  3HK2 A;  3D0P A;  4DF8 A;  3PO5 A;  4CK1 A;  3O4N A;  2ETJ A;  3SPY A;  4B9L A;  1U48 A;  1WSH A;  4KTQ A;  4KHU A;  3K5M A;  4HUF A;  1FKO A;  1RT7 A;  1T8E A;  4FZY A;  3AO5 A;  1KVC A;  4DQR A;  4DTN A;  4FJM A;  1TK0 A;  4H4M A;  1ZBI A;  4FZZ A;  4FK2 A;  3TAB A;  4NCB A;  4CF1 A;  3K5N A;  1RBU A;  3CM6 A;  3L2U A;  3L2W A;  3DLH A;  4KHN A;  1UA1 A;  2DTU A;  1VSK A;  4LH4 A;  4OPJ A;  3AA4 A;  2Y1J A;  4CJR A;  4JS5 A;  2HHQ A;  2I5J A;  2WON A;  3LAK A;  4M45 A;  1QQC A;  4KRF A;  4W5N A;  3OY9 A;  3SUP A;  1HJR A;  2EX3 A;  3HPG A;  1T03 A;  1VSH A;  1B92 A;  3VQ4 A;  1Z26 A;  4OJR A;  1XI1 A;  1LV5 A;  4CHQ A;  1VSE A;  4DFJ A;  1BIU A;  1NJX A;  3AVA A;  3TR8 A;  5HLF A;  2WOM A;  1A5W A;  4ELU A;  1KSP A;  4CEC A;  1JLQ A;  4K8Z A;  3OYL A;  4RW8 A;  2G8F A;  1X9W A;  5FRM A;  3NHG A;  1RIL A;  1QS4 A;  1JL1 A;  3SZ2 A;  4CE9 A;  1A5V A;  4CJ5 A;  4Q0B A;  2HMI A;  2BGG A;  4NYN A;  3ISN C;  4R5P A;  4QAG A;  3VA0 A;  3AO4 A;  4L8R B;  3S3O A;  1IKV A;  1GOB A;  3PX6 A;  2AJQ A;  4KO0 A;  2BDP A;  2IAJ A;  1NK7 A;  4CJF A;  3CM5 A;  3CYM A;  4DS5 A;  4CEQ A;  2FBX A;  1CXQ A;  3HT3 A;  2Y1I A;  2OA8 A;  4CJW A;  1W9H A;  3L2R A;  5J1E A;  4AHR A;  1NK0 A;  4I7F A;  3OS0 A;  3V9X A;  3JSM A;  4DFP A;  4DSI A;  2IC3 A;  3V4I A;  3VQ7 A;  1HYZ A;  3NGI A;  2QKK A;  4N47 A;  4E1N A;  3V9Z A;  4B9N A;  1KVA A;  1BHL A;  4HCC A;  4KI4 A;  3KJV A;  2PZS A;  5J2M A;  2JGU A;  4GVM A;  2G8H A;  4XIU A;  3L2V A;  1TKZ A;  1MU2 A;  2YHB A;  4KHS A;  1UWB A;  4DTP A;  1I3A A;  4CJQ A;  4B9T A;  1J9A A;  2FBV A;  1TGO A;  5HRP A;  3KLI A;  1VSM A;  3DLR A;  3DMJ A;  3OYJ A;  3KK1 A;  1JL2 A;  1RTI A;  4CJT A;  2O4I A;  2BAN A;  5C24 A;  4B9U A;  1S1U A;  1BIZ A;  3RRH A;  5I42 A;  3HVR A;  3RR7 A;  4C8M A;  3AVF A;  3ZSY A;  4CF9 A;  4I9L A;  4H8K A;  3ZSV A;  4KB0 A;  4B8C A;  3AVK A;  4CGF A;  4C8K A;  4KHY A;  4HVJ A;  1L3U A;  3PX4 A;  1D9F A;  2HNY A;  4KB1 A;  1WSG A;  3KLE A;  1ZYQ A;  4B9V A;  4M3T A;  3LP3 A;  4DTO A;  4KHQ A;  1WN7 A;  1GOA A;  3AA3 A;  4AHV A;  3FFI A;  3OJU A;  2YNI A;  3BGR A;  3SV4 A;  4FK0 A;  2DFF A;  2KQ2 A;  4E3S A;  1NK9 A;  3O3F A;  3NDK A;  2DY4 A;  1JXB A;  1RT6 A;  3K59 A;  1RTH A;  3KK2 A;  4DTU A;  3MED A;  1ZBH A;  2RKI A;  3PUF A;  1D5A A;  1WAJ A;  3JYT A;  5HP1 A;  3VQ9 A;  3T3F A;  3TAM A;  4BWM A;  4BE2 A;  4I2Q A;  4F3O A;  4CK2 A;  4EP4 A;  3SYZ A;  3HP9 A;  3QEX A;  4FJ9 A;  1TL3 A;  4FW2 A;  1UOC A;  1SKS A;  2YNH A;  4CGG A;  2OPQ A;  5DK5 A;  4Z4H A;  2D0A A;  3NF7 A;  1BL3 A;  4KI6 A;  2RPI A;  2ATQ A;  1VSD A;  3SPZ A;  1RBT A;  2VG7 A;  4O4G A;  3IAY A;  3ZT4 A;  4EZ6 A;  1YTA A;  2E6M A;  1JLF A;  1QHT A;  1VRT A;  3VQD A;  3KLF A;  1U49 A;  3MAQ A;  4CIG A;  4FYD A;  1T05 A;  4N56 A;  2PY5 A;  3NF6 A;  4JLH A;  3VQB A;  5FRO A;  5J2Q A;  2Z1J A;  4DQI A;  2Z1H A;  3SI6 A;  1JLB A;  2OYQ A;  1IKX A;  4CF8 A;  4QOZ B;  4HCB A;  4CED A;  3WNH A;  4AHT A;  4J2B A;  3NGY A;  3RMB A;  3SUQ A;  3LWM A;  4F8R A;  2P51 A;  4CEO A;  4PWD A;  3VQC A;  4FM1 A;  4JS4 A;  1RT3 A;  3OVN A;  3E01 A;  1C1C A;  2GBZ A;  1BQN A;  2KTQ A;  4OGC A;  1WSE A;  2YV0 X;  2X78 A;  4O0J A;  4E19 A;  2VWJ A;  4M3Z A;  3CFR A;  4DU1 A;  3ULD A;  4E0D A;  4KPY A;  4I2P A;  3AVN A;  4IBN A;  4CGJ A;  3OYF A;  1EX4 A;  1VK0 A;  3C6U A;  2OPS A;  3IRX A;  3LP1 A;  3F9K A;  2R7Y A;  2XHB A;  1U45 A;  3HM9 A;  1HRH A;  4DLG A;  1JLE A;  1XWL A;  3SUO A;  3V81 A;  3T19 A;  2YKM A;  1JLA A;  2YNG A;  2FC0 A;  3ZT2 A;  2A1S A;  3L2Q A;  4FLY A;  4F2R A;  4YFU A;  4Q5V A;  4F2S A;  4CFD A;  3C6T A;  3SQ4 A;  2HND A;  4Z4G A;  3ZT3 A;  5CYM A;  1SUQ A;  2ITG A;  1TKT A;  3CFO A;  3ZT1 A;  4FZX C;  5FRN A;  2G8K A;  3MEE A;  4FVM A;  2GUI A;  3QIP A;  3DLE A;  1SKW A;  2P5O A;  1VRU A;  1Q9X A;  5KRT A;  3PV8 A;  3QIN A;  2HB5 A;  1IKW A;  1F21 A;  2HW3 A;  4BE1 A;  5J2N A;  3TAQ A;  4AHS A;  4AIL C;  3V6D A;  1QTM A;  1S9E A;  2X74 A;  4CEA A;  2QKB A;  3LP2 A;  3OYH A;  3C94 A;  1FKP A;  5EU7 A;  3K57 A;  1WSJ A;  4CJU A;  3EY1 A;  1SL2 A;  1WLJ A;  3SUN A;  5HRR A;  4DFM A;  4EP5 A;  1XHZ A;  3RMA A;  4OLA A;  2Z1G A;  4DTR A;  3PY8 A;  1I39 A;  4CGI A;  4O44 A;  3AVL A;  2B6A A;  4J2E A;  1TAU A;  3ALY A;  3QET A;  1RBR A;  3TI0 A;  3K58 A;  4CJE A;  3EYZ A;  2D0C A;  3SCX A;  3NF8 A;  2HHT A;  3P5J A;  4DF4 A;  1HQE A;  3NAE A;  1NOY A;  2KZZ A;  3OYG A;  2HHX A;  3AVC A;  3HPH A;  3IG1 A;  4ICL A;  4CCH A;  5KRS A;  4PUO A;  1EET A;  3NH1 A;  2FBY A;  4CJP A;  2ZQB A;  3TAN A;  3IS9 A;  5JS2 A;  3AVH A;  1KVB A;  3MEG A;  4CHO A;  4KAZ A;  4J2A A;  1S5J A;  4CHZ A;  3H08 A;  3QEP A;  4Z4E A;  4KV8 A;  4CFA A;  3A2F A;  1VSF A;  4CEF A;  4W5O A;  3VQP A;  3O3H A;  3DLB A;  3VQQ A;  3S3M A;  3AVM A;  1ZBU A;  3DLG A;  3M8P A;  5KGW A;  3L3U A;  4CK3 A;  1EP4 A;  3ITH A;  4Y1D A;  3VQE A;  3U6F A;  1VSJ A;  1XC9 A;  2E6L A;  2NUB A;  4AHC A;  3QNO A;  4FJL A;  4O5B A;  1X9S A;  4J2D A;  1JLC A;  3ASM A;  3OYB A;  1LW2 A;  5KGX A;  3O3G A;  1BGX T;  4IFV A;  3TAF A;  1Y97 A;  3DRS A;  4GMJ B;  4OKJ A;  4B9S A;  2OZS A;  3RMC A;  1IO2 A;  2D5R A;  3VN5 A;  1L3S A;  1ZBF A;  1NK8 A;  4F4K A;  3QER A;  3ZCM A;  4WE1 A;  4B3O A;  2RN2 A;  3LAL A;  3NF9 A;  1B9D A;  1N5Y A;  3P83 D;  4LSN A;  4E7L A;  2HHS A;  2G8U A;  1SL1 A;  1RDC A;  1RDA A;  4FXD A;  1S1X A;  1RTD A;  3L3V A;  4QCL A;  2A1R A;  4FJ7 A;  3U3Y A;  1NKC A;  4BE0 A;  2IOC A;  3SNN A;  1NK5 A;  2ZD1 A;  4DLE A;  3SQ1 A;  1ASU A;  3WNG A;  3QNN A;  1NK6 A;  1N6Q A;  1LW0 A;  4FLX A;  4MQ3 A;  4W5T A;  1NKB A;  3MXJ A;  4FLW A;  3S3N A;  1C0M A;  2YNF A;  1D8Y A;  4C8O A;  4KRE A;  1BCO A;  1SKR A;  2ZE2 A;  4KHW A;  4CHP A;  1U4B A;  1FK9 A;  3VQ6 A;  3KK3 A;  3HST B;  1L5U A;  1REV A;  1HNI A;  3KLH A;  1VSI A;  2OPR A;  4PQU A;  2HNZ A;  4AH9 A;  3OS2 A;  4KFB A;  3AVG A;  4RW7 A;  3KLG A;  4OKE A;  5D3G A;  1CZ9 A;  3ZSW A;  1WNS A;  4W5R A;  4FJ8 A;  1HYV A;  4CF0 A;  4UQG A;  3OJS A;  4OPK A;  4B9M A;  4M3W A;  2KW4 A;  2XY8 A;  2HVI A;  1ASV A;  1LWE A;  4LH5 A;  1QSY A;  4G1Q A;  1NKE A;  1J53 A;  4DU3 A;  2G8I A;  4E7H A;  1B9F A;  1O1W A;  4KTZ A;  3RR8 A;  4KKO A;  3LP0 A;  1UAX A;  3KD5 E;  4FW1 A;  4DSJ A;  4N5S A;  3V9S A;  3K5L A;  3TAP A;  5T7B A;  2F96 A;  4DTX A;  3AO1 A;  4CJV A;  1ITG A;  2VG5 A;  2RF2 A;  2DFH A;  4M41 A;  4DU4 A;  1TV6 A;  3LZJ A;  2G8W A;  4JRP A; 
#chains in the Genus database with same CATH topology
 1YVN A;  4FWN A;  4RG8 A;  3P1G A;  1DTQ A;  5CY4 A;  2EWS A;  1S6P A;  3J80 O;  4M3Y A;  1EXQ A;  4CGH A;  3SQ0 A;  3D2E B;  3LAM A;  3K2P A;  2QW9 A;  4BQL A;  3DOK A;  1RCH A;  5MLC Q;  1C0T A;  3CQY A;  1NJI O;  3AV9 A;  2ASM A;  3ID6 A;  1K6Y A;  3TAR A;  3H3N O;  3THV A;  2ZGZ A;  2AP1 A;  4BDZ A;  1BCM A;  3I8B A;  3ATV A;  5AQM A;  3LZI A;  1LCU A;  2Q3S A;  4BDY A;  3VF6 A;  3OYE A;  1BDG A;  3UB5 A;  4WYB A;  3CCV N;  4C1N K;  2OPP A;  4A2A A;  2A6A A;  4DUZ K;  4HUE A;  4GNI A;  3BEX A;  3WXJ A;  4Y0W A;  5K14 A;  2NRW A;  3FFK B;  3HRG A;  3O80 A;  4CD3 A;  4DTM A;  2I7P A;  3MCA B;  2P9U B;  4FWM A;  4O0I A;  3M8S A;  2KKZ A;  2HHV A;  1CXU A;  2O4G A;  3DXM A;  3M8Q A;  1RT5 A;  5EY4 A;  3VF2 A;  4QS7 A;  3QEI A;  2W42 A;  3Q7B A;  1YJ9 N;  4RW6 A;  2B4J A;  3CQX A;  3CCJ N;  1T6D A;  1YF5 L;  3QIO A;  4B08 A;  1GLF O;  3AA2 A;  4KTW A;  5M1Q A;  4N76 A;  5I3U A;  3NH2 A;  4NCA A;  4CFB A;  4JD2 B;  2VG6 A;  1SS6 A;  1TAQ A;  2IVN A;  1TKD A;  1ZBS A;  1T44 A;  1EKE A;  1G15 A;  5JS1 A;  3LPT A;  1OKJ A;  3DRP A;  4NCG A;  4H0T B;  1QZ5 A;  2P9L B;  3SJJ A;  4BRQ A;  1C0G A;  2Q36 A;  5BPL A;  3WNE A;  4KHP K;  1YI2 N;  3O4Q A;  4K42 A;  1VSL A;  5TKW A;  3OTO K;  4M3U A;  1C1B A;  3CF5 L;  1SZ2 A;  1XHX A;  1CZB A;  3VEN A;  3G6E N;  1ZBL A;  2QK9 A;  2P9N B;  5HRN A;  3DYA A;  3V1R A;  4JK9 A;  4H0P A;  1BUP A;  2QM1 A;  5CZ1 A;  1HQU A;  1A5X A;  4E1J A;  3WEE A;  4WFA L;  2HOE A;  4PL8 A;  3RTV A;  1SV5 A;  1TK8 A;  4IKF A;  4FSV A;  4DR1 K;  1NK4 A;  1YVU A;  2VWK A;  3I8D A;  3T1A A;  3C95 A;  2D0B A;  4ZTJ A;  3THY A;  1GLA G;  4TSX A;  4LSL A;  1N34 K;  1BA0 A;  2IGI A;  3O9S A;  1RDB A;  5F0X A;  1GOC A;  4YNQ A;  2OCE A;  1WAF A;  4DSF A;  1K73 O;  2HST A;  3F73 A;  2AA4 A;  2QWP A;  1LAW A;  2XY7 A;  2ZJR L;  3KWG A;  3R3L A;  4DSE A;  4JI6 K;  1IBK K;  4CEE A;  5HL7 L;  1IKY A;  3OYC A;  1Z25 A;  3R9P A;  2G8V A;  5F1X A;  5AQW A;  2P9K A;  2FF3 B;  2ETJ A;  4B9L A;  1U48 A;  1MA9 B;  1RT7 A;  4DV1 K;  3U9Z A;  3NVK A;  2W41 A;  3O9R A;  3L2W A;  3DLH A;  3HSC A;  3AA4 A;  4WFN L;  4OPJ A;  2P9S B;  3RSE A;  4M45 A;  3NMU A;  1KD1 O;  3D2F A;  5AQR A;  5BN9 A;  2W6K A;  2ZGY A;  1XI1 A;  4CHQ A;  2ZF5 O;  3TR8 A;  3THX B;  4ELU A;  2NRX A;  2G8F A;  3CXC M;  5FRM A;  3H3O B;  1RIL A;  3NHG A;  3WT0 A;  3JXU A;  4CJ5 A;  2HMI A;  3JS6 A;  3VA0 A;  4L8R B;  1IBM K;  3LDL A;  4CZJ A;  3CYM A;  2ZJP L;  4H03 B;  2BUP A;  2HHH K;  2WTU A;  3L2R A;  3V9X A;  1NGH A;  4DSI A;  1HYZ A;  3VEZ A;  4X64 K;  1BHL A;  4RWT A;  2PZS A;  3GE1 A;  3P38 A;  4FWQ A;  1Y64 A;  2YHB A;  4KHS A;  3TTF A;  4DTP A;  1E4G T;  3KLI A;  3OYJ A;  3H45 C;  1JL2 A;  3H6E A;  3C7N B;  1S1U A;  1HNW K;  1BIZ A;  4GKJ K;  3RR7 A;  3A5M C;  4C8M A;  3S41 A;  1FW6 A;  4O8U A;  4I9L A;  1DKG D;  3ZSV A;  4B8C A;  4CGF A;  4HVJ A;  1E3M A;  1D9F A;  2VCP A;  3KLE A;  1VQN N;  4FWK A;  3AA3 A;  4AHV A;  3FFI A;  2YNI A;  4Z94 A;  5AR0 A;  4E3S A;  2DY4 A;  3KK2 A;  3WXK A;  3MED A;  5FLX O;  1ZBH A;  4O8K A;  1WAJ A;  3P4I A;  3VEO A;  3T3F A;  4I2Q A;  4F3O A;  1CZA N;  4CK2 A;  3QEX A;  3FR0 A;  1UOC A;  3BZC A;  2D0A A;  3NF7 A;  1BL3 A;  1NM1 A;  3H46 O;  1VSD A;  4LF4 K;  3ZT4 A;  2OTL N;  2P9U A;  5M1P A;  3KLF A;  5FPN A;  4LF7 K;  3KWI A;  1T05 A;  4BRP A;  3NF6 A;  1Q82 O;  4FOI A;  1DGK N;  4PKG A;  2A41 A;  2VGM A;  3J8A A;  3D7E O;  1BQN A;  1NGG A;  4BVO A;  1WSE A;  3BF1 A;  3H1Q A;  4E0D A;  3ULD A;  1ESV A;  4I2P A;  3AVN A;  4IBN A;  3O5B A;  4KHN A;  2R7Y A;  5LY3 A;  1XWL A;  3GDQ A;  3T19 A;  2YKM A;  2YNG A;  2FC0 A;  2A1S A;  4YFU A;  3C6T A;  4KH5 A;  4Z4G A;  3ZT3 A;  4DR7 K;  1SUQ A;  3CFO A;  3DLL L;  2G8K A;  2GUI A;  3HOT A;  3MK6 A;  3PV8 A;  4GKK K;  1HNX K;  3IUC A;  1OVQ A;  5J2N A;  3TAQ A;  5FPM A;  4AIL C;  3V6D A;  2E88 A;  4RCH A;  3HI0 A;  3OYH A;  3K57 A;  1FJG K;  2O8C B;  5AQH A;  3ULE A;  4MLH A;  1WLJ A;  5LJV A;  1SL2 A;  4DFM A;  4EP5 A;  1XHZ A;  4BRM A;  3RMA A;  4DTR A;  1I39 A;  1HKB A;  5M1F A;  2P9N A;  4LFC K;  4J2E A;  3ALY A;  4C1N I;  2WBN A;  3K58 A;  2HHT A;  1NOY A;  3OYG A;  3I56 N;  2HHX A;  3AVC A;  4PUO A;  3H1V X;  4H5R A;  3AGK A;  4CJP A;  5JS2 A;  4KAZ A;  4CI6 A;  3CJ7 A;  4CHZ A;  4Z4E A;  4KV8 A;  2O8B B;  1VSF A;  5BRE A;  4MO5 A;  4JI8 K;  1NGI A;  3O3H A;  3DLG A;  1ZBU A;  3EE8 A;  3L3U A;  3EN9 A;  4JNE A;  3ITH A;  3VQE A;  5LL6 Z;  1IBL K;  4JKF A;  1XC9 A;  4O5B A;  1VQ4 N;  1TYQ B;  4BC3 A;  4J2D A;  4IOX A;  1TUU A;  2P9I A;  4IFV A;  3DRS A;  3VN5 A;  1YIT N;  4F4K A;  3ENB A;  2F7T A;  4JAX A;  3NF9 A;  2Q97 A;  4JEP A;  5AQU A;  2G8U A;  1SL1 A;  4FXD A;  4QCL A;  1NKC A;  3SNN A;  1K8K B;  2E2P A;  3CI5 A;  1NK5 A;  1Q7Y O;  2O8D A;  3WNG A;  3QNN A;  4AQY K;  4FLX A;  1D8Y A;  4C8O A;  4LF6 K;  1SKR A;  3VQ6 A;  2PBD A;  1VSI A;  2HNZ A;  4AH9 A;  3OS2 A;  4OKE A;  4H0O A;  3ZSW A;  1V4S A;  1WB9 A;  1HYV A;  3OJS A;  3SBT A;  4M3W A;  1ASV A;  4I6M B;  4CZL A;  1QSY A;  4G1Q A;  1NKE A;  3CHW A;  3FE1 A;  4KKO A;  1UAX A;  4FW1 A;  3VEX A;  4DV4 K;  3V9S A;  3TAP A;  3KVG A;  4CZF A;  5BRF A;  3AO1 A;  2RF2 A;  4M41 A;  4DU4 A;  3BP8 A;  1TV6 A;  5BN8 A;  2D4W A;  1HKC A;  3CPW M;  3UKU B;  4ISE A;  1XQS C;  1IJJ A;  4DQS A;  1S1V A;  4ELT A;  4CIE A;  3EKS A;  3B8A X;  1QVG M;  4CGD A;  3SLC A;  4CIF A;  2CGJ A;  1WBD A;  3L8B A;  4CD1 A;  2JLE A;  5C25 A;  3HVT A;  4LY7 A;  1RNH A;  1S6Q A;  1VQO N;  3T69 A;  1Q18 A;  5GAD P;  3SQ2 A;  1XMQ K;  1BI4 A;  3ZSZ A;  4N41 A;  3DI6 A;  4KBO A;  4DQP A;  2B5J A;  3T7Z A;  1LAV A;  1ASW A;  3RRG A;  3OYN A;  2VGN A;  5AQO A;  1CLQ A;  1XUP O;  3VGK A;  3ZT0 A;  3DRR A;  1KCF A;  3KKR A;  4DTJ A;  4CJK A;  2PYL A;  3TWH A;  1W97 L;  2FBT A;  3B6O A;  3RWU A;  1L3V A;  2ZWH A;  1GLC G;  3A8Y A;  1UA0 A;  3OYK A;  3RMD A;  2HHU A;  1HNV A;  3ZX0 A;  4YOR A;  3QB0 A;  3DAW A;  3HYF A;  2P1J A;  3A5O C;  4FLU A;  3VQA A;  5C42 A;  1Q8I A;  3VEW A;  4FLV A;  2LSN A;  3MEC A;  5EVZ A;  4CEB A;  4IXC A;  4BGB A;  3OBY A;  3MN5 A;  4EZ9 A;  3HJF A;  2HMP A;  4OKK A;  4AF1 A;  3R6M A;  4CJL A;  4CZE A;  1NJY A;  3L4Q A;  4YOU A;  4CJ3 A;  3DOL A;  3O8M A;  1VHX A;  3G10 A;  3AO3 A;  3UKR B;  1C1A A;  3FZL A;  3NBP A;  4WQ4 C;  4BDP A;  4C8L A;  3HL8 A;  4W5Q A;  4IDK A;  3V1Q A;  4B3R K;  1HMV A;  3LDS A;  3MWP A;  3O4W A;  3DLK A;  5A2Q O;  1IG9 A;  1RBV A;  2Z1I A;  4RW9 A;  2EHG A;  4CHY A;  1BIS A;  2QXF A;  2RHK A;  1NJW A;  4DV0 K;  4F3T A;  4GY2 B;  1QE1 A;  1J5E K;  4OGE A;  4HTU A;  4IEI A;  4CJ7 A;  2WC9 A;  1I94 K;  1SQK A;  3MMV A;  3MX5 A;  5AQX A;  4GV6 A;  3ZSQ A;  4DSK A;  4JKG B;  4RW4 A;  3E9O A;  2KZM A;  4E89 A;  3PO4 A;  3AA5 X;  4FJK A;  1DLO A;  4I9Q A;  1XNR K;  1NMD A;  1X9J A;  4OPH A;  1GLB G;  3LAN A;  5DMR A;  4ID5 A;  3LM2 A;  3ZSR A;  5E41 A;  4Z4C A;  2XY6 A;  1ATR A;  5IT9 O;  4PY5 A;  2NRH A;  5J2P A;  1J54 A;  4BG9 A;  4ID1 A;  1NBW A;  1LWF A;  5FDL A;  3ZSO A;  1VQ5 N;  1L3T A;  4Z0U A;  5DM7 L;  2CH5 A;  4QS8 A;  3V9W A;  3B6P A;  5GIO A;  2Q31 A;  4BRG A;  2ASO A;  1RBS A;  4HUG A;  1S1T A;  4R79 A;  5C12 A;  2PYJ A;  1TYQ A;  1KFS A;  3MXI A;  1VQM N;  1S22 A;  2ASP A;  4FJG A;  3NCI A;  4OLB A;  4K43 A;  4IFY A;  4BWJ A;  1WUA A;  2KLA A;  1KLM A;  2XY5 A;  5I9E B;  1NGE A;  3CFP A;  3EEQ A;  4ZTF A;  4LF5 K;  4M3X A;  1RTJ A;  3M1F A;  2HBK A;  4Z4F A;  1JXE A;  2IVP A;  3D0P A;  1ATN A;  3LDQ A;  4KHU A;  3K5M A;  4HUF A;  3AO5 A;  1VQ9 N;  1ZXO A;  3FZK A;  1HX1 A;  1S3X A;  1YXQ A;  3K5N A;  1RBU A;  3L2U A;  2Y1J A;  2W40 A;  4EHU A;  2HHQ A;  1QQC A;  4KRF A;  1N32 K;  1VSH A;  1B92 A;  3DXK B;  1VSE A;  4DFJ A;  1HPM A;  4LFA K;  1KSP A;  4K8Z A;  3FZM A;  3LDO A;  4FWO A;  1X9W A;  2P9P B;  5BRH A;  1JL1 A;  1NGB A;  4CE9 A;  5M1O A;  2BGG A;  3ISN C;  4R5P A;  3IDH A;  5BPM A;  3S3O A;  1GOB A;  2IAJ A;  1NK7 A;  3C65 A;  3QBX A;  1CXQ A;  3EE9 A;  3C0B A;  4AHR A;  4I7F A;  1Z6R A;  4DKW A;  3JSM A;  2IC3 A;  4B9N A;  3V9Z A;  4HCC A;  3M6G A;  4KI4 A;  3AAR A;  2VYP A;  4PKI A;  3PLA A;  2NRR A;  1I3A A;  4B9T A;  1J9A A;  2FBV A;  4KH6 A;  1TGO A;  4A61 A;  4RTF D;  1RTI A;  4KH4 A;  4B1V A;  4A5A A;  3RRH A;  3MN7 A;  4LF8 K;  1J6Z A;  4JK8 A;  5JMV A;  4C8K A;  4KHY A;  1L3U A;  5C0Y A;  2HNY A;  1MWM A;  3TSQ A;  5GIN A;  1GOA A;  2D1K A;  4FK0 A;  4EFH A;  3SV4 A;  2KQ2 A;  1NK9 A;  3O3F A;  1OH8 A;  4DTU A;  3BY5 A;  2JWK A;  2YHW A;  1ATS A;  3JYT A;  3TAM A;  4BWM A;  4BE2 A;  4BRL A;  4EP4 A;  3HP9 A;  1TL3 A;  2YNH A;  4CGG A;  2OTJ N;  2OPQ A;  5M1N A;  5DM6 L;  3FZH A;  2RPI A;  1RBT A;  2VG7 A;  4O4G A;  1BOT O;  3VTH A;  3CET A;  4CIG A;  4FYD A;  1KXP A;  4N56 A;  5CHI A;  2Z1H A;  2V7Y A;  3P39 A;  3WNH A;  4AHT A;  3RMB A;  1GLL O;  4CZI A;  3VQC A;  3OVN A;  4O0J A;  4DR4 K;  4KPY A;  1U6Z A;  1EX4 A;  1VK0 A;  3C6U A;  4KHQ A;  3F9K A;  4OPA A;  2XHB A;  2UU9 K;  1N8R O;  1EWR A;  4F2S A;  4CFD A;  2HND A;  2ITG A;  5IWA K;  3ZT1 A;  3KHY A;  3MEE A;  3OW2 M;  3QIP A;  5JLF A;  1JJ2 M;  1SKW A;  2P5O A;  1VRU A;  1Q9X A;  3QIN A;  4B1W B;  3CCL N;  4U7B A;  4BE1 A;  2HW3 A;  1W7A A;  4JYA K;  4AHS A;  3OA9 A;  5AQK A;  4CZM A;  1S9E A;  5KPT A;  3C94 A;  4OX9 K;  5EU7 A;  3ZET A;  4BRO A;  1WSJ A;  4CJU A;  2KHO A;  5HRR A;  4BR0 A;  3FGU A;  5AQI A;  4CGI A;  4O44 A;  3CJC A;  2B6A A;  1VAZ A;  5AQN A;  4DV5 K;  1TAU A;  4XH5 A;  3EYZ A;  2D0C A;  3SCX A;  5JVH L;  5AZI A;  2QA4 N;  4BR2 A;  4A62 A;  2KZZ A;  2PAV A;  3HPH A;  3IG1 A;  4CCH A;  2E2N A;  3TAN A;  2FBY A;  2ZQB A;  3IS9 A;  3O9U A;  3AVH A;  4CHO A;  5C10 A;  3QEP A;  4CZH A;  3T1Y K;  4CEF A;  2HBJ A;  3ZEU B;  5M1K A;  3VQQ A;  3THW B;  2H3G X;  3P31 A;  1U2V B;  3D2E A;  4CK3 A;  1KC8 O;  3U6F A;  1GLJ O;  2E6L A;  4FVU A;  1K8A O;  4BRA A;  2CGL A;  3ASM A;  3OYB A;  4DV2 K;  1LW2 A;  1BGX T;  1GLE G;  4B9S A;  2OZS A;  3RMC A;  1S72 N;  4BY9 C;  4A59 A;  1L3S A;  1NK8 A;  4LC9 B;  4JI7 K;  2RN2 A;  3LAL A;  1N5Y A;  3P83 D;  4LSN A;  4DQ8 A;  1RDA A;  1RTD A;  3L3V A;  2A1R A;  4FJ7 A;  1G99 A;  5AQQ A;  1N6Q A;  4M42 A;  4MQ3 A;  2YNF A;  1BCO A;  2VWB A;  3KK3 A;  5HOO A;  3HST B;  3KLH A;  1VQ8 N;  3SAG A;  1NGF A;  3SBG A;  3F2K A;  4FJ8 A;  4AM7 A;  4M63 C;  2HVI A;  4B9M A;  2KW4 A;  2E1Y A;  4DV3 K;  4LH5 A;  2G8I A;  4E7H A;  4BRF A;  4CVN E;  4JKE A;  3E66 A;  3RR8 A;  4JK7 A;  4DSJ A;  4N5S A;  2GUP A;  1X3N A;  2IIR A;  3K5L A;  3O9T A;  2UXD K;  2DFH A;  2OZM A;  4B3T K;  5BPN A;  4CJ4 A;  5EX5 A;  3TAG A;  4FPA A;  2A40 A;  4FLZ A;  4ZHR A;  4HTL A;  1WSI A;  4PKH A;  4DG1 A;  2O8E B;  4ILH A;  1BA1 A;  4WFB L;  2O8F B;  3CCM N;  4B3S K;  1JKH A;  1YT3 A;  4IZ9 A;  4JD2 A;  4E7I A;  4J8F A;  3VEV A;  5HBM A;  3LWL A;  3VTI A;  4BRH A;  4DQQ A;  2P9L A;  3TTD A;  4CF2 A;  1KFD A;  3I0R A;  4DR6 K;  3K9J A;  3NE6 A;  4E7K A;  5HRS A;  1NG9 A;  3K0S A;  2NRZ A;  4A2B A;  4CER A;  4FLT A;  5AQZ A;  1C6V A;  3NH0 A;  2YX6 A;  2ITM A;  3QEW A;  3K9K A;  4EAH D;  3D6R A;  4FCY A;  4FJI A;  5AQS A;  4DTS A;  1R59 O;  5LMU K;  3CJ9 A;  1HKG A;  3V1O A;  2E2Q A;  1NMN A;  4WQ4 A;  4DFK A;  3SK3 A;  3MXM A;  1W0H A;  3QO9 A;  4BC4 A;  3EL2 A;  3UIQ A;  3DM2 A;  1RDD A;  1KTQ A;  3RVC A;  4Z4I A;  1GLD G;  3ZX3 A;  5SZT A;  3ZSX A;  1H1V A;  1VQK N;  4CES A;  3WXL A;  3G4S N;  4DV7 K;  4X62 K;  1XC3 A;  2YJF A;  2Q0U A;  3QES A;  3OYM A;  2W6L A;  3U3G A;  4WQ5 C;  3ZYY X;  4IFE A;  1KRP A;  4JI5 K;  1RT4 A;  4H4O A;  3I0S A;  5AQF A;  3QEV A;  5SWM A;  4MFB A;  4XH4 A;  4OVL A;  3KD1 E;  1YHQ N;  3QLH A;  4CEZ A;  4CHN A;  3VEY A;  3L6Q A;  4FWS A;  4BRC A;  2P9S A;  3NGZ A;  2BE2 A;  1RT2 A;  4NO7 A;  1D9D A;  1IH7 A;  2QWR A;  4H0Y B;  3MN6 A;  5BR9 A;  3THX A;  3PIO L;  5JIC A;  5CE3 A;  3LL3 A;  5ADX H;  2YI1 A;  1HYS A;  4IO8 A;  1N36 K;  1EQY A;  4AM6 A;  3WXM B;  5KPR A;  3CD6 N;  1S1W A;  1X1P A;  3HPO A;  3OBW A;  1LWC A;  4HWI A;  1HPZ A;  1Q9Y A;  4IJA A;  2YKN A;  1SL0 A;  4L3Q A;  1S9G A;  4BVP A;  1T7P A;  3ZEU A;  3THW A;  3D45 A;  1R0A A;  3SMS A;  1QHA A;  5EXW A;  5KPZ A;  3I55 N;  3SJH A;  1QSS A;  4FM0 A;  4BAC A;  1TKX A;  4LFB K;  4B9Q A;  3HP6 A;  1X9M A;  3HM8 A;  1ZC6 A;  3CG7 A;  2E5L K;  3OYI A;  2UUC K;  2IDO A;  5AZJ B;  2FF6 A;  1IV0 A;  5GIP A;  4JRQ A;  4B8A B;  1J5O A;  3C7N A;  3LPU A;  4U67 L;  3CCE N;  2F8T A;  4LD0 A;  1OVY A;  3EKU A;  3M5R A;  4WF9 L;  1BO5 O;  4FK4 A;  3OHR A;  1BWF O;  4CK1 A;  4KTQ A;  1DT9 A;  1FKO A;  4ISG A;  1O13 A;  1KVC A;  2E20 A;  4FJM A;  1TK0 A;  4FK2 A;  4ILG B;  4H5V A;  3R1X A;  2DTU A;  3JAM O;  1UA1 A;  3CCS N;  4LH4 A;  4YOX A;  4CJR A;  4JS5 A;  1QZ6 A;  3LAK A;  2WON A;  4W5N A;  5JLH A;  2EX3 A;  3HPG A;  2QWN A;  1T03 A;  3VQ4 A;  4OJR A;  2VQE K;  1LV5 A;  4UY8 O;  1P8Z A;  1NJX A;  5HLF A;  1NGJ A;  3L4I A;  2WOM A;  1A5W A;  3QML A;  4BRE A;  2UUB K;  4RW8 A;  2NZT A;  3U8X A;  4BRK A;  3SMP A;  2PFU A;  4NLC A;  3SZ2 A;  4Q0B A;  2F9T A;  4NYN A;  5AQL A;  4IEE A;  5F2R A;  1KQS M;  3AO4 A;  5E84 A;  1IKV A;  3PX6 A;  2AJQ A;  4KO0 A;  2BDP A;  2FSK A;  4CJF A;  4DS5 A;  1NGC A;  4FL9 A;  1WOQ A;  2Y1I A;  3NVM A;  4K25 A;  4CJW A;  3TSU A;  3OS0 A;  3J7Z O;  4DFP A;  5LMN K;  4GV9 A;  4FO0 A;  1BG3 A;  2QKK A;  4E1N A;  1M90 O;  1KVA A;  5J2M A;  1KAY A;  4XEI A;  4XIU A;  3L2V A;  1MU2 A;  3SAF A;  1UWB A;  4CJQ A;  3TTC A;  4G9Z A;  4H5T A;  3TSP A;  5HRP A;  3KK1 A;  3DLR A;  3DMJ A;  1Q86 O;  4CJT A;  5C24 A;  4B9U A;  3MX2 A;  5I42 A;  3HVR A;  2P9K B;  3AVF A;  2QI2 A;  4X65 K;  1JCE A;  4H8K A;  3VPZ A;  3VGL A;  1QQO A;  4CZG A;  3AVK A;  4KB0 A;  2O8C A;  4KB1 A;  3MDQ A;  1JCG A;  1WSG A;  4K41 A;  1ZYQ A;  3LP3 A;  3SAH A;  3N4P A;  2HBL A;  3BGR A;  2DFF A;  4QS9 A;  5AQJ A;  3NDK A;  3A0I X;  2QXL A;  3KZB A;  3PUF A;  1D5A A;  3VGM A;  2F4V K;  3VQ9 A;  3DJC A;  3RSE B;  3SYZ A;  3GBT A;  4FW2 A;  3D2F B;  5FPD A;  2HBM A;  5DK5 A;  4Z4H A;  4KI6 A;  2O8B A;  3HBT A;  2ATQ A;  3CPE A;  3SPZ A;  1NNE A;  3IAY A;  1YTA A;  2E6M A;  1JLF A;  1VRT A;  4M7X A;  4BG8 A;  3G71 N;  4ILJ A;  4JLH A;  3KK7 A;  3VQB A;  2Z1J A;  3HTV A;  3CJ1 A;  4O5F A;  4B1X B;  1IKX A;  2GWJ A;  4J2B A;  4V19 S;  3NGY A;  3SUQ A;  1ILY A;  3LWM A;  2P51 A;  4PWD A;  4FM1 A;  1RT3 A;  4E19 A;  4C23 A;  3CFR A;  4FWP A;  2OPS A;  3IRX A;  4JKH A;  1YUW A;  3A5N C;  3HM9 A;  4DLG A;  4CW7 B;  3U9D A;  1JLE A;  3QFU A;  3V81 A;  3EZW A;  4FLY A;  3ZT2 A;  4Q5V A;  1K8K A;  3CJA A;  2QWO A;  4FVM A;  2ZM6 K;  3DLE A;  2WUS A;  4K0K K;  2X74 A;  4CEA A;  3J81 O;  5BR8 K;  3LP2 A;  3LDP A;  1FKP A;  1YJN N;  3EY1 A;  5KQD A;  4I6M A;  3SUN A;  2GWK A;  2WFB A;  4OLA A;  4CBX A;  5AQG A;  3AVL A;  3ENO A;  4JKC A;  3QET A;  3TI0 A;  4CJE A;  3P5J A;  3C6A A;  4PL7 A;  3NAE A;  4H5N A;  5KRS A;  5AQY A;  1EET A;  3J7A P;  3UKU A;  1KVB A;  3MEG A;  3WQU A;  2QWM A;  1S5J A;  4JI1 K;  4CFA A;  3A2F A;  4W5O A;  3VQP A;  1QQN A;  3N4Q A;  3S3M A;  3AVM A;  3M8P A;  5LJW A;  5KGW A;  4YDU C;  4Y1D A;  1VSJ A;  2NUB A;  3E1Y A;  4YOW A;  3QNO A;  4FJL A;  2YHY A;  3GL1 A;  4DCH A;  2HF4 A;  1JLC A;  2BTF A;  5EOY A;  3VOV A;  5KGX A;  4YOV A;  3TAF A;  2NLX A;  5AZJ A;  1IO2 A;  2D5R A;  1T3V A;  5FPE A;  2YJE A;  3ZCM A;  3L0Q A;  3M3Z A;  1M1K O;  1JCF A;  4E7L A;  1RDC A;  1S1X A;  3U3Y A;  4BE0 A;  3SQ1 A;  1NK6 A;  1LW0 A;  4F8R A;  4W5T A;  1NKB A;  3MXJ A;  4FLW A;  4YHH K;  4KRE A;  3WQT A;  2ZE2 A;  4CHP A;  1U4B A;  1L5U A;  3WXI A;  4PQU A;  2OPR A;  5GAE P;  3KLG A;  3AVG A;  4RW7 A;  5D3G A;  4FWR A;  2GX9 A;  4CF0 A;  3J7Y P;  3ULE B;  1LWE A;  2GTD A;  5AJ3 K;  4KTZ A;  3LP0 A;  3QIC A;  3T1H K;  4BGA A;  5ADX A;  3PSF A;  5T7B A;  2F96 A;  4CJV A;  3UKR A;  3VES A;  1V4T A;  4JKA A;  1MWK A;  1YIJ N;  2F8S A;  2XRI A;  1QSL A;  2HVH A;  2KFN A;  4DMN A;  5C15 A;  3F5T A;  5CZ2 A;  2Q0R A;  4PA1 A;  4H0X B;  3HXM A;  3CQ8 A;  2E1Z A;  3PSI A;  4H5W A;  3BZK A;  2FLO A;  3PX0 A;  4CFC A;  1OH7 A;  3E9L A;  2P9I B;  3W0L A;  4NYF A;  1DEJ A;  4M3R A;  4BC2 A;  2E8A A;  3VQ8 A;  2FSJ A;  1DTT A;  3M8R A;  4JKD A;  3CCU N;  4C8N A;  3U4L A;  3S9H A;  4DWI A;  2UUA K;  4E1M A;  3C6H A;  3QBW A;  3HO1 A;  1RT1 A;  4JKG A;  2CGK A;  5CYQ A;  2O8D B;  1TVR A;  4FJ5 A;  1C0U A;  1KAX A;  3V9U A;  5HRO A;  3KKS A;  1NJZ A;  3CME N;  2YHA A;  3OYA A;  4IOC L;  4FJX A;  2E2O A;  3AGR A;  3AVI A;  4YOT A;  4E7J A;  4BC5 A;  3LM9 A;  3EZ5 A;  3SV3 A;  4WQ5 A;  4JV5 K;  4GW6 A;  1VQ6 N;  1WBB A;  4M7Y A;  1NU0 A;  2RE2 A;  4K8X A;  3HOS A;  3NFA A;  3AVB A;  2GV9 A;  3AVJ A;  1U47 A;  1VQ7 N;  1FXX A;  3K5O A;  4DR2 K;  3IFR A;  4X66 K;  3QFP A;  5KTQ A;  2HHW A;  1NLV A;  5AQT A;  3VQ5 A;  5AQP A;  3VA3 A;  2DFE A;  5KI6 A;  1TK5 A;  1RFQ A;  5AFU H;  1SAZ A;  3E9P A;  1U04 A;  3WNF A;  3BDP A;  4BQZ A;  4YY3 K;  2QTD A;  4FOE A;  4IDH A;  1WSF A;  4NB4 A;  4NXN K;  3OS1 A;  1HJO A;  1BI4 B;  1LOT B;  1T6C A;  3BF3 A;  1JLG A;  4OO1 J;  3EO3 A;  2KFZ A;  5H1S Q;  3MN9 A;  1X3M A;  1TL1 A;  2V51 B;  2NRV A;  2DPN A;  4FJN A;  1E4F T;  1QVF M;  3O1W A;  3ZX2 A;  3DXK A;  2A5X A;  3CIP A;  2P9P A;  3F9M A;  4WCE L;  4DV6 K;  1C0F A;  1NGD A;  4DS4 A;  4JI2 K;  3G0Z A;  4A57 A;  1KLN A;  1YTU A;  3W3D A;  2X6S A;  4JN4 A;  2IS3 A;  4HHT A;  2X6N A;  3KTQ A;  1NWK A;  3TPQ A;  2ZJQ L;  3VER A;  2XO7 A;  4O55 A;  1RDU A;  4IG0 A;  1HUX A;  5TKY A;  3O9Q A;  3CCQ N;  4AHU A;  4H0V B;  4IG3 A;  3CC7 N;  2GEL A;  2E4L A;  4Y1C A;  3AO2 A;  3FZF A;  4DSL A;  3TAE A;  4CJS A;  4FJJ A;  4FJH A;  1BQM A;  4FM2 A;  1NOZ A;  3KIO A;  2F9W A;  2P5G A;  3OYD A;  3HK2 A;  5GAH P;  4DF8 A;  5CR4 A;  5KQ8 A;  3PO5 A;  3O4N A;  3SPY A;  4BR4 A;  1WSH A;  3Q7C A;  1EWQ A;  4FZY A;  1T8E A;  4DTN A;  2J4R A;  4DQR A;  4H4M A;  4JI4 K;  4BR5 A;  1ZBI A;  2QWL A;  4JHD B;  4FZZ A;  4IOA L;  3TAB A;  4B1U B;  4CF1 A;  2V52 B;  3I33 A;  3CM6 A;  2JWL A;  1VSK A;  2I5J A;  3OY9 A;  4XH1 A;  3SUP A;  2D0P A;  1HJR A;  3CC2 N;  3CC4 N;  1XMO K;  1Z26 A;  4GV3 A;  1TUY A;  3O1B A;  3O6W A;  1BIU A;  3AVA A;  4CEC A;  1JLQ A;  1XNQ K;  3OYL A;  2OAN A;  3GOI A;  1QS4 A;  4FWL A;  1A5V A;  3ID8 A;  3IKM A;  4QAG A;  1HNZ K;  4CBW A;  3CM5 A;  3MWT A;  4F9O A;  4CEQ A;  2FBX A;  2CH6 A;  4A5B A;  3MCP A;  3HT3 A;  4IO9 L;  4DR3 K;  2OA8 A;  1W9H A;  4JKB A;  5J1E A;  1NK0 A;  4BR7 A;  3V4I A;  3VQ7 A;  4YOY A;  3NGI A;  2O4I A;  4N47 A;  3KJV A;  2JGU A;  4GVM A;  2G8H A;  5C2D A;  1TKZ A;  4CBU A;  2FSN A;  1VSM A;  1RDW X;  4IWV A;  3O08 A;  2BAN A;  2UYT A;  3G25 A;  1MDU B;  4CF9 A;  3ZSY A;  2Q1N A;  3FLC O;  4JI0 K;  3PX4 A;  1BU6 O;  4B9V A;  4M3T A;  2UXC K;  4DTO A;  3AAP A;  1WN7 A;  4IJN A;  3OJU A;  3A5L C;  3R8E A;  4LF9 K;  1JXB A;  1RT6 A;  1QQM A;  1RTH A;  3K59 A;  2RKI A;  4DHY A;  5HP1 A;  1YAG A;  4FJ9 A;  1SKS A;  1NGA A;  1Q81 O;  4B1Y B;  4FPB A;  5B8H A;  4EIA A;  4EZ6 A;  3AY9 A;  1QHT A;  3VQD A;  4EHT A;  1U49 A;  1U2V A;  3MAQ A;  4NLB A;  2PY5 A;  4JI3 K;  4ISF A;  5J2Q A;  5FRO A;  2IVO A;  3DXM B;  4DQI A;  1EO1 A;  3SI6 A;  1JLB A;  2OYQ A;  4CF8 A;  4QOZ B;  4HCB A;  4CED A;  2UXB K;  4CEO A;  4JS4 A;  3E01 A;  1C1C A;  2GBZ A;  2KTQ A;  4OGC A;  2YV0 X;  2X78 A;  2VWJ A;  4M3Z A;  4DU1 A;  1W2B M;  4CGJ A;  3VMF B;  2YCH A;  3OYF A;  1U45 A;  5JVG L;  4ELV A;  3LP1 A;  4NCB A;  1HRH A;  3WUH A;  4PHT X;  3SUO A;  1JLA A;  3LDN A;  3L2Q A;  4F2R A;  5C2F A;  5AQV A;  4BRI A;  3SQ4 A;  5CYM A;  4BRN A;  1TKT A;  4FZX C;  5FRN A;  4B3M K;  5KRT A;  2HB5 A;  1KAZ A;  1IKW A;  1F21 A;  2VQF K;  3HZ6 A;  1OH5 A;  1QTM A;  3CER A;  2QKB A;  1Z05 A;  2Q2R A;  3PIP L;  2YHX A;  1OH6 A;  3VF4 A;  4B1Z A;  2Z1G A;  5ELZ A;  3PY8 A;  3BUZ B;  4YDU A;  4CZK A;  3GG4 A;  1VQP N;  2D0O A;  4MDB A;  1RBR A;  1HR0 K;  3DWL A;  3WEE B;  3NF8 A;  4DF4 A;  1HQE A;  3CMA N;  3AAQ A;  4ICL A;  3NH1 A;  4J2A A;  3H08 A;  3ZLJ A;  3THY B;  2O8E A;  3DLB A;  2O8F A;  5E26 A;  4MO4 A;  1EP4 A;  2BH1 A;  2HF3 A;  4AHC A;  1K9M O;  4BR9 A;  4DUY K;  2A3Z A;  1X9S A;  3UE5 A;  3O3G A;  2QEX N;  1Y97 A;  4OKJ A;  4GMJ B;  1ZBF A;  3QER A;  4WE1 A;  4B3O A;  2GEM A;  4BRD A;  1B9D A;  2HHS A;  1IG8 A;  5AFU A;  3QDK A;  4DB3 A;  5BRD A;  1VQL N;  2IOC A;  2ZD1 A;  4DLE A;  1ASU A;  3S3N A;  1C0M A;  1RGI A;  3CJB A;  4JHD A;  4KHW A;  4DR5 K;  1YJW N;  1FK9 A;  1REV A;  1HNI A;  4GVE A;  4KFB A;  1D4X A;  2QWQ A;  1CZ9 A;  5GAG P;  1P90 A;  4MDA A;  4W5R A;  1WNS A;  4UQG A;  3CCR N;  3ATU A;  2V7Z A;  3ZET B;  4OPK A;  2XY8 A;  3TU5 A;  1J53 A;  4DU3 A;  1N33 K;  1B9F A;  1O1W A;  2A42 A;  4MLE A;  3KD5 E;  2I7N A;  2FXU A;  2NNW A;  2NRT A;  3ENH A;  4DTX A;  5AZI B;  4NXM K;  1ITG A;  1HLU A;  2VG5 A;  3VET A;  3IMX A;  3LZJ A;  2G8W A;  4JRP A; 
#chains in the Genus database with same CATH homology
 4CJ4 A;  4RG8 A;  2F8S A;  3P1G A;  3TAG A;  1DTQ A;  5CY4 A;  4FLZ A;  4ZHR A;  2XRI A;  4DQS A;  1S6P A;  1QSL A;  1S1V A;  4ELT A;  2HVH A;  4CIE A;  2KFN A;  4DMN A;  1EXQ A;  1WSI A;  4M3Y A;  4DG1 A;  4CGD A;  5CZ2 A;  4CIF A;  4CGH A;  3SQ0 A;  3L8B A;  3LAM A;  4PA1 A;  3K2P A;  2JLE A;  3HXM A;  1JKH A;  3HVT A;  5C25 A;  4LY7 A;  1RNH A;  1RCH A;  1S6Q A;  3DOK A;  1YT3 A;  3CQ8 A;  4E7I A;  1C0T A;  3SQ2 A;  3AV9 A;  5HBM A;  3LWL A;  3PX0 A;  4CFC A;  1BI4 A;  1K6Y A;  3ZSZ A;  4N41 A;  3DI6 A;  4DQQ A;  3TAR A;  4NYF A;  4DQP A;  4M3R A;  2B5J A;  3VQ8 A;  3THV A;  4CF2 A;  1KFD A;  1LAV A;  3I0R A;  1ASW A;  4BDZ A;  3OYN A;  3RRG A;  1BCM A;  3NE6 A;  4E7K A;  1CLQ A;  1DTT A;  3ZT0 A;  3M8R A;  3DRR A;  1KCF A;  3KKR A;  5HRS A;  4C8N A;  4CJK A;  3LZI A;  4DTJ A;  3S9H A;  2PYL A;  3TWH A;  4DWI A;  2Q3S A;  4BDY A;  2FBT A;  4E1M A;  3B6O A;  4CER A;  4FLT A;  3OYE A;  1RT1 A;  1L3V A;  3RWU A;  5CYQ A;  3HO1 A;  1C6V A;  1TVR A;  3NH0 A;  1UA0 A;  4FJ5 A;  1C0U A;  2OPP A;  3QEW A;  3OYK A;  3RMD A;  2HHU A;  1HNV A;  3V9U A;  5HRO A;  3KKS A;  1NJZ A;  4FCY A;  3HYF A;  4FJI A;  2P1J A;  2YHA A;  4FLU A;  3VQA A;  5C42 A;  3OYA A;  4HUE A;  4FJX A;  1Q8I A;  4DTS A;  4FLV A;  2LSN A;  3V1O A;  3MEC A;  5K14 A;  4CEB A;  4DFK A;  3MXM A;  3AVI A;  1W0H A;  3QO9 A;  4E7J A;  3UIQ A;  3DM2 A;  1RDD A;  1KTQ A;  3EZ5 A;  4DTM A;  4EZ9 A;  4M42 A;  3SV3 A;  4O0I A;  4OKK A;  3HJF A;  4GW6 A;  4Z4I A;  4CJL A;  3M8S A;  5SZT A;  4CJ3 A;  1CXU A;  1NJY A;  3DOL A;  4K8X A;  2HHV A;  3NFA A;  3AVB A;  2GV9 A;  2O4G A;  3AVJ A;  3M8Q A;  1RT5 A;  3ZSX A;  3QEI A;  1U47 A;  4ELV A;  3G10 A;  3AO3 A;  4CES A;  1FXX A;  3K5O A;  2W42 A;  1C1A A;  3NBP A;  4RW6 A;  2B4J A;  5KTQ A;  4BDP A;  4C8L A;  3HL8 A;  2HHW A;  4W5Q A;  3VQ5 A;  3QIO A;  3VA3 A;  2DFE A;  4B08 A;  4IDK A;  5KI6 A;  3QES A;  1TK5 A;  3V1Q A;  3AA2 A;  3OYM A;  4KTW A;  4N76 A;  5I3U A;  3U3G A;  3NH2 A;  4NCA A;  1U04 A;  1HMV A;  1KRP A;  3WNF A;  1RT4 A;  4CFB A;  4H4O A;  3LDS A;  3BDP A;  3I0S A;  2VG6 A;  1WSF A;  3QEV A;  3DLK A;  1TAQ A;  4MFB A;  5SWM A;  1TKD A;  1RBV A;  1IG9 A;  2Z1I A;  3OS1 A;  4RW9 A;  1BI4 B;  1JLG A;  2EHG A;  4OVL A;  4CHY A;  1BIS A;  1EKE A;  3KD1 E;  2QXF A;  2KFZ A;  1G15 A;  1NJW A;  3QLH A;  4CEZ A;  4F3T A;  3LPT A;  5JS1 A;  1QE1 A;  3DRP A;  4NCG A;  1TL1 A;  4CHN A;  3SJJ A;  4OGE A;  4HTU A;  3WNE A;  4FJN A;  3NGZ A;  2BE2 A;  3O4Q A;  1RT2 A;  3ZSQ A;  4M3U A;  1VSL A;  4DSK A;  1C1B A;  4RW4 A;  1XHX A;  2KZM A;  1CZB A;  4E89 A;  1D9D A;  3PO4 A;  1IH7 A;  3AA5 X;  1ZBL A;  4FJK A;  2QK9 A;  1DLO A;  5HRN A;  3DYA A;  3V1R A;  4I9Q A;  3LAN A;  5CZ1 A;  5DMR A;  2OZM A;  4ID5 A;  1HQU A;  1HYS A;  3ZSR A;  5E41 A;  1A5X A;  4Z4C A;  2XY6 A;  3RTV A;  4PY5 A;  5J2P A;  1SV5 A;  4DS4 A;  1S1W A;  1X1P A;  1J54 A;  3HPO A;  4ID1 A;  1TK8 A;  4IKF A;  3G0Z A;  1LWF A;  1NK4 A;  1LWC A;  5FDL A;  3ZSO A;  1KLN A;  1YVU A;  2VWK A;  1YTU A;  1L3T A;  2X6S A;  4Z0U A;  1HPZ A;  1Q9Y A;  3I8D A;  2YKN A;  3T1A A;  1SL0 A;  3C95 A;  2D0B A;  2IS3 A;  4ZTJ A;  1S9G A;  3V9W A;  3B6P A;  1T7P A;  4HHT A;  2X6N A;  3KTQ A;  4TSX A;  3D45 A;  4LSL A;  1R0A A;  1RBS A;  2IGI A;  4HUG A;  1RDB A;  1S1T A;  1QSS A;  1GOC A;  4FM0 A;  2XO7 A;  4YNQ A;  4O55 A;  4IG0 A;  4BAC A;  1WAF A;  1TKX A;  4DSF A;  2PYJ A;  4AHU A;  1KFS A;  3MXI A;  3HP6 A;  1X9M A;  4IG3 A;  3F73 A;  3CG7 A;  1LAW A;  2XY7 A;  2E4L A;  4Y1C A;  3AO2 A;  4DSL A;  3OYI A;  4FJG A;  3NCI A;  2IDO A;  4DSE A;  4OLB A;  4IFY A;  4BWJ A;  3TAE A;  4CJS A;  4FJJ A;  1KLM A;  4CEE A;  2XY5 A;  4FJH A;  4JRQ A;  4B8A B;  1BQM A;  1J5O A;  1IKY A;  3OYC A;  3CFP A;  1Z25 A;  4ZTF A;  3LPU A;  4FM2 A;  2G8V A;  4M3X A;  1NOZ A;  1RTJ A;  3KIO A;  2P5G A;  4Z4F A;  1JXE A;  2F8T A;  4LD0 A;  3OYD A;  4FK4 A;  3HK2 A;  3D0P A;  4DF8 A;  3PO5 A;  4CK1 A;  3O4N A;  2ETJ A;  3SPY A;  4B9L A;  1U48 A;  1WSH A;  4KTQ A;  4KHU A;  3K5M A;  4HUF A;  1FKO A;  1RT7 A;  1T8E A;  4FZY A;  3AO5 A;  1KVC A;  4DQR A;  4DTN A;  4FJM A;  1TK0 A;  4H4M A;  1ZBI A;  4FZZ A;  4FK2 A;  3TAB A;  4NCB A;  4CF1 A;  3K5N A;  1RBU A;  3CM6 A;  3L2U A;  3L2W A;  3DLH A;  4KHN A;  1UA1 A;  2DTU A;  1VSK A;  4LH4 A;  4OPJ A;  3AA4 A;  2Y1J A;  4CJR A;  4JS5 A;  2HHQ A;  2I5J A;  2WON A;  3LAK A;  4M45 A;  1QQC A;  4KRF A;  4W5N A;  3OY9 A;  3SUP A;  1HJR A;  2EX3 A;  3HPG A;  1T03 A;  1VSH A;  1B92 A;  3VQ4 A;  1Z26 A;  4OJR A;  1XI1 A;  1LV5 A;  4CHQ A;  1VSE A;  4DFJ A;  1BIU A;  1NJX A;  3AVA A;  3TR8 A;  5HLF A;  2WOM A;  1A5W A;  4ELU A;  1KSP A;  4CEC A;  1JLQ A;  4K8Z A;  3OYL A;  4RW8 A;  2G8F A;  1X9W A;  5FRM A;  3NHG A;  1RIL A;  1QS4 A;  1JL1 A;  3SZ2 A;  4CE9 A;  1A5V A;  4CJ5 A;  4Q0B A;  2HMI A;  2BGG A;  4NYN A;  3ISN C;  4R5P A;  4QAG A;  3VA0 A;  3AO4 A;  4L8R B;  3S3O A;  1IKV A;  1GOB A;  3PX6 A;  2AJQ A;  4KO0 A;  2BDP A;  2IAJ A;  1NK7 A;  4CJF A;  3CM5 A;  3CYM A;  4DS5 A;  4CEQ A;  2FBX A;  1CXQ A;  3HT3 A;  2Y1I A;  2OA8 A;  4CJW A;  1W9H A;  3L2R A;  5J1E A;  4AHR A;  1NK0 A;  4I7F A;  3OS0 A;  3V9X A;  3JSM A;  4DFP A;  4DSI A;  2IC3 A;  3V4I A;  3VQ7 A;  1HYZ A;  3NGI A;  2QKK A;  4N47 A;  4E1N A;  3V9Z A;  4B9N A;  1KVA A;  1BHL A;  4HCC A;  4KI4 A;  3KJV A;  2PZS A;  5J2M A;  2JGU A;  4GVM A;  2G8H A;  4XIU A;  3L2V A;  1TKZ A;  1MU2 A;  2YHB A;  4KHS A;  1UWB A;  4DTP A;  1I3A A;  4CJQ A;  4B9T A;  1J9A A;  2FBV A;  1TGO A;  5HRP A;  3KLI A;  1VSM A;  3DLR A;  3DMJ A;  3OYJ A;  3KK1 A;  1JL2 A;  1RTI A;  4CJT A;  2O4I A;  2BAN A;  5C24 A;  4B9U A;  1S1U A;  1BIZ A;  3RRH A;  5I42 A;  3HVR A;  3RR7 A;  4C8M A;  3AVF A;  3ZSY A;  4CF9 A;  4I9L A;  4H8K A;  3ZSV A;  4KB0 A;  4B8C A;  3AVK A;  4CGF A;  4C8K A;  4KHY A;  4HVJ A;  1L3U A;  3PX4 A;  1D9F A;  2HNY A;  4KB1 A;  1WSG A;  3KLE A;  1ZYQ A;  4B9V A;  4M3T A;  3LP3 A;  4DTO A;  4KHQ A;  1WN7 A;  1GOA A;  3AA3 A;  4AHV A;  3FFI A;  3OJU A;  2YNI A;  3BGR A;  3SV4 A;  4FK0 A;  2DFF A;  2KQ2 A;  4E3S A;  1NK9 A;  3O3F A;  3NDK A;  2DY4 A;  1JXB A;  1RT6 A;  3K59 A;  1RTH A;  3KK2 A;  4DTU A;  3MED A;  1ZBH A;  2RKI A;  3PUF A;  1D5A A;  1WAJ A;  3JYT A;  5HP1 A;  3VQ9 A;  3T3F A;  3TAM A;  4BWM A;  4BE2 A;  4I2Q A;  4F3O A;  4CK2 A;  4EP4 A;  3SYZ A;  3HP9 A;  3QEX A;  4FJ9 A;  1TL3 A;  4FW2 A;  1UOC A;  1SKS A;  2YNH A;  4CGG A;  2OPQ A;  5DK5 A;  4Z4H A;  2D0A A;  3NF7 A;  1BL3 A;  4KI6 A;  2RPI A;  2ATQ A;  1VSD A;  3SPZ A;  1RBT A;  2VG7 A;  4O4G A;  3IAY A;  3ZT4 A;  4EZ6 A;  1YTA A;  2E6M A;  1JLF A;  1QHT A;  1VRT A;  3VQD A;  3KLF A;  1U49 A;  3MAQ A;  4CIG A;  4FYD A;  1T05 A;  4N56 A;  2PY5 A;  3NF6 A;  4JLH A;  3VQB A;  5FRO A;  5J2Q A;  2Z1J A;  4DQI A;  2Z1H A;  3SI6 A;  1JLB A;  2OYQ A;  1IKX A;  4CF8 A;  4QOZ B;  4HCB A;  4CED A;  3WNH A;  4AHT A;  4J2B A;  3NGY A;  3RMB A;  3SUQ A;  3LWM A;  4F8R A;  2P51 A;  4CEO A;  4PWD A;  3VQC A;  4FM1 A;  4JS4 A;  1RT3 A;  3OVN A;  3E01 A;  1C1C A;  2GBZ A;  1BQN A;  2KTQ A;  4OGC A;  1WSE A;  2YV0 X;  2X78 A;  4O0J A;  4E19 A;  2VWJ A;  4M3Z A;  3CFR A;  4DU1 A;  3ULD A;  4E0D A;  4KPY A;  4I2P A;  3AVN A;  4IBN A;  4CGJ A;  3OYF A;  1EX4 A;  1VK0 A;  3C6U A;  2OPS A;  3IRX A;  3LP1 A;  3F9K A;  2R7Y A;  2XHB A;  1U45 A;  3HM9 A;  1HRH A;  4DLG A;  1JLE A;  1XWL A;  3SUO A;  3V81 A;  3T19 A;  2YKM A;  1JLA A;  2YNG A;  2FC0 A;  3ZT2 A;  2A1S A;  3L2Q A;  4FLY A;  4F2R A;  4YFU A;  4Q5V A;  4F2S A;  4CFD A;  3C6T A;  3SQ4 A;  2HND A;  4Z4G A;  3ZT3 A;  5CYM A;  1SUQ A;  2ITG A;  1TKT A;  3CFO A;  3ZT1 A;  4FZX C;  5FRN A;  2G8K A;  3MEE A;  4FVM A;  2GUI A;  3QIP A;  3DLE A;  1SKW A;  2P5O A;  1VRU A;  1Q9X A;  5KRT A;  3PV8 A;  3QIN A;  2HB5 A;  1IKW A;  1F21 A;  2HW3 A;  4BE1 A;  5J2N A;  3TAQ A;  4AHS A;  4AIL C;  3V6D A;  1QTM A;  1S9E A;  2X74 A;  4CEA A;  2QKB A;  3LP2 A;  3OYH A;  3C94 A;  1FKP A;  5EU7 A;  3K57 A;  1WSJ A;  4CJU A;  3EY1 A;  1SL2 A;  1WLJ A;  3SUN A;  5HRR A;  4DFM A;  4EP5 A;  1XHZ A;  3RMA A;  4OLA A;  2Z1G A;  4DTR A;  3PY8 A;  1I39 A;  4CGI A;  4O44 A;  3AVL A;  2B6A A;  4J2E A;  1TAU A;  3ALY A;  3QET A;  1RBR A;  3TI0 A;  3K58 A;  4CJE A;  3EYZ A;  2D0C A;  3SCX A;  3NF8 A;  2HHT A;  3P5J A;  4DF4 A;  1HQE A;  3NAE A;  1NOY A;  2KZZ A;  3OYG A;  2HHX A;  3AVC A;  3HPH A;  3IG1 A;  4ICL A;  4CCH A;  5KRS A;  4PUO A;  1EET A;  3NH1 A;  2FBY A;  4CJP A;  2ZQB A;  3TAN A;  3IS9 A;  5JS2 A;  3AVH A;  1KVB A;  3MEG A;  4CHO A;  4KAZ A;  4J2A A;  1S5J A;  4CHZ A;  3H08 A;  3QEP A;  4Z4E A;  4KV8 A;  4CFA A;  3A2F A;  1VSF A;  4CEF A;  4W5O A;  3VQP A;  3O3H A;  3DLB A;  3VQQ A;  3S3M A;  3AVM A;  1ZBU A;  3DLG A;  3M8P A;  5KGW A;  3L3U A;  4CK3 A;  1EP4 A;  3ITH A;  4Y1D A;  3VQE A;  3U6F A;  1VSJ A;  1XC9 A;  2E6L A;  2NUB A;  4AHC A;  3QNO A;  4FJL A;  4O5B A;  1X9S A;  4J2D A;  1JLC A;  3ASM A;  3OYB A;  1LW2 A;  5KGX A;  3O3G A;  1BGX T;  4IFV A;  3TAF A;  1Y97 A;  3DRS A;  4GMJ B;  4OKJ A;  4B9S A;  2OZS A;  3RMC A;  1IO2 A;  2D5R A;  3VN5 A;  1L3S A;  1ZBF A;  1NK8 A;  4F4K A;  3QER A;  3ZCM A;  4WE1 A;  4B3O A;  2RN2 A;  3LAL A;  3NF9 A;  1B9D A;  1N5Y A;  3P83 D;  4LSN A;  4E7L A;  2HHS A;  2G8U A;  1SL1 A;  1RDC A;  1RDA A;  4FXD A;  1S1X A;  1RTD A;  3L3V A;  4QCL A;  2A1R A;  4FJ7 A;  3U3Y A;  1NKC A;  4BE0 A;  2IOC A;  3SNN A;  1NK5 A;  2ZD1 A;  4DLE A;  3SQ1 A;  1ASU A;  3WNG A;  3QNN A;  1NK6 A;  1N6Q A;  1LW0 A;  4FLX A;  4MQ3 A;  4W5T A;  1NKB A;  3MXJ A;  4FLW A;  3S3N A;  1C0M A;  2YNF A;  1D8Y A;  4C8O A;  4KRE A;  1BCO A;  1SKR A;  2ZE2 A;  4KHW A;  4CHP A;  1U4B A;  1FK9 A;  3VQ6 A;  3KK3 A;  3HST B;  1L5U A;  1REV A;  1HNI A;  3KLH A;  1VSI A;  2OPR A;  4PQU A;  2HNZ A;  4AH9 A;  3OS2 A;  4KFB A;  3AVG A;  4RW7 A;  3KLG A;  4OKE A;  5D3G A;  1CZ9 A;  3ZSW A;  1WNS A;  4W5R A;  4FJ8 A;  1HYV A;  4CF0 A;  4UQG A;  3OJS A;  4OPK A;  4B9M A;  4M3W A;  2KW4 A;  2XY8 A;  2HVI A;  1ASV A;  1LWE A;  4LH5 A;  1QSY A;  4G1Q A;  1NKE A;  1J53 A;  4DU3 A;  2G8I A;  4E7H A;  1B9F A;  1O1W A;  4KTZ A;  3RR8 A;  4KKO A;  3LP0 A;  1UAX A;  3KD5 E;  4FW1 A;  4DSJ A;  4N5S A;  3V9S A;  3K5L A;  3TAP A;  5T7B A;  2F96 A;  4DTX A;  3AO1 A;  4CJV A;  1ITG A;  2VG5 A;  2RF2 A;  2DFH A;  4M41 A;  4DU4 A;  1TV6 A;  3LZJ A;  2G8W A;  4JRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...