3O4NA

Crystal structure of the rous associated virus integrase catalytic domain in mes buffer ph 6.0
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
133
Chain Sequence
b'QIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTQAMVERANRLLKDKIRVLAEGDGFMKRIPASKQGELLAKAMYALNHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords integrase
publication title A crystal structure of the catalytic core domain of an avian sarcoma and leukemia virus integrase suggests an alternate dimeric assembly.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
total genus 47
structure length 133
sequence length 141
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o4nA00
1NK7A 2ETJA 2HHVA 4KV8A 1RT3A 4CGFA 2D0BA 4JS5A 4EZ9A 4QCLA 3NF9A 1RBUA 3SPYA 3V9SA 3DOKA 3OY9A 3UIQA 4JRQA 4IFVA 2DY4A 3HVTA 1Z25A 1U47A 1RCHA 3DLBA 1REVA 4FLWA 3SJJA 5KRTA 3LAKA 1NK5A 1RDDA 3OS1A 4DU4A 4CJKA 4CESA 4RW9A 4CEQA 2HHQA 4HUFA 3TAPA 4DTRA 1IKWA 4FJ8A 3VQ8A 4C8NA 1TV6A 2F8SA 4CEDA 3LP1A 4O0IA 1LAVA 1GOBA 1QSSA 4ELTA 1CZBA 4KREA 3L3UA 2E6MA 5HRRA 4CHPA 4IG0A 3OYGA 3ZT3A 4O4GA 3HVRA 2OZSA 3HT3A 1G15A 3CM5A 2ITGA 1SKSA 1W0HA 1LWCA 3M8RA 1NKEA 4B9SA 4FZZA 3LWLA 4F3TA 4KKOA 1IKXA 5KGWA 4BE0A 3SI6A 4OGCA 3AVGA 5I42A 2OZMA 4FVMA 3DLEA 2XO7A 4IG3A 3P1GA 1CXUA 1EKEA 1HMVA 3AA4A 4DMNA 1RDBA 2QXFA 1X9SA 1DLOA 4CK2A 3RRHA 1RDAA 5CZ1A 3NF8A 1GOCA 3NCIA 3PX4A 1L3SA 1S9EA 4B9TA 1KSPA 3KLGA 3B6PA 3VQ5A 2BGGA 1RTJA 3ZT1A 4ZTJA 1KLNA 3LP0A 2WOMA 4AHTA 1BCMA 4FK4A 1BIUA 4LSNA 5CYMA 4BWJA 5SZTA 2YHAA 1J9AA 4WE1A 5CYQA 1B9FA 4LH4A 1WN7A 2OA8A 3RR8A 1TK0A 4M45A 3V9UA 1Q9YA 3LPTA 4CJVA 2B5JA 2P5GA 1NK0A 2E6LA 3KLHA 4CHZA 4CGIA 3EZ5A 4MFBA 2RF2A 4IFYA 3CQ8A 1BCOA 3QLHA 4FLUA 3QEPA 4J2DA 1Q9XA 3OYBA 1IKVA 2HHXA 4FYDA 5FRMA 4I7FA 4NYNA 4M3XA 3KD1E 4F4KA 2HVIA 2ZQBA 5C42A 3WNEA 3VA3A 1IH7A 4FJ5A 1I3AA 2KFNA 2HNYA 2G8WA 1HJRA 2GBZA 4B8CA 4CF9A 2AJQA 1S1VA 2FBXA 3ZCMA 3WNGA 3SQ2A 1RBVA 2BE2A 4IBNA 1VSFA 4H4MA 4PA1A 4FJMA 1WSGA 1QS4A 1B9DA 3C94A 4M3RA 5EU7A 3ZSQA 3OYCA 3KK1A 4CECA 1KFDA 4DTUA 4OGEA 2BDPA 3EYZA 4AHVA 3OYKA 4CHQA 4BDZA 4AHSA 1N5YA 1QQCA 1UWBA 4CCHA 3MEDA 1QTMA 2KZMA 1RTHA 1JXEA 1NK6A 1L3VA 4RW7A 4PWDA 4BACA 3SUOA 1BQMA 1ZBHA 3OYDA 4W5OA 4CJEA 1HPZA 4C8MA 4CJRA 3RWUA 4FW1A 4CJUA 2OYQA 4Z4EA 4YFUA 4FLYA 4C8OA 3OJSA 3EY1A 2D0AA 4LH5A 4CEEA 3V9XA 4I9LA 3V1OA 4M42A 2YKNA 5DK5A 4CJPA 3AVIA 2VWJA 2LSNA 4M41A 3KTQA 1A5VA 4CEOA 3LP2A 4YNQA 3SV3A 3S3MA 2HVHA 3S9HA 3U3GA 2VWKA 3QIPA 5J1EA 3NE6A 2KW4A 3CM6A 4XIUA 3BDPA 1EX4A 3IG1A 3AVKA 1U04A 4K8XA 4F2SA 2JLEA 4KRFA 3OYJA 1XWLA 3K59A 3VA0A 5K14A 2O4IA 1LWFA 1RTIA 1LWEA 4K8ZA 3ISNC 1LW2A 5HROA 1IO2A 1X1PA 1F21A 3AA2A 1JLQA 1TKDA 2YNIA 2KFZA 4DTNA 4E19A 3QETA 5HLFA 3PO4A 1Q8IA 3NF6A 3QINA 3T1AA 1XHXA 1TK8A 3LP3A 4ZTFA 2XY5A 2D5RA 3AA3A 3O4QA 5JS2A 3NGZA 4QAGA 1WSIA 3DMJA 1VSLA 4HTUA 3K5LA 3C6UA 3NGYA 3CFOA 1L3UA 4O55A 3DRRA 1HYVA 1JLGA 5SWMA 3AVMA 3MEEA 3OYNA 3TAMA 3HSTB 4RG8A 4C8LA 4DSEA 2KTQA 3VQPA 3F9KA 3G10A 1RT7A 2HMIA 2VG5A 4OLAA 2G8VA 3DI6A 4RW4A 1RDCA 3AVAA 4DF4A 3O3HA 1QSYA 4W5TA 3HPOA 3SV4A 2YV0X 4DQIA 3P5JA 2G8UA 4M3WA 1NKCA 3E01A 3SZ2A 4M3YA 1BISA 1EP4A 2IDOA 3L3VA 1HRHA 1ZBFA 2Z1JA 4CJ3A 3NDKA 2P1JA 3K5MA 2PYJA 4OKEA 2XY7A 1JLEA 3NHGA 2IC3A 3WNFA 3T19A 3NBPA 1HNIA 1S1XA 4FLZA 3OYFA 3P83D 1C1CA 3QESA 3QNNA 4CFBA 3CG7A 1A5XA 4BDPA 2WONA 1JLBA 4CFDA 4CHNA 4B9LA 3VQ7A 1CZ9A 1WSEA 3DLRA 3HYFA 4KB1A 1UAXA 4Y1CA 1ZBLA 1T05A 1L5UA 1EETA 2EX3A 3ZSYA 4KHYA 1UA1A 2FBTA 1XC9A 3TAGA 1KRPA 3A2FA 3OS0A 1FKPA 1HNVA 3O4NA 4CJLA 4CIFA 3RTVA 1UOCA 1TK5A 1J54A 1LAWA 4DTOA 2Y1JA 3ZT0A 1JL2A 4NCGA 5C24A 4N5SA 2RKIA 3S3NA 2F8TA 2O4GA 1RILA 4ICLA 2ZD1A 3HXMA 4DS5A 4DTJA 4FJJA 4CJTA 3QO9A 3VQQA 1TL3A 3RMAA 3THVA 3K2PA 2B6AA 4N47A 4FXDA 4G1QA 4KO0A 1BQNA 3NFAA 3M8SA 3TAEA 3DM2A 5I3UA 5FDLA 1U49A 1T03A 1SL2A 1YVUA 4FJGA 4KHQA 3KKSA 4Q5VA 4KI6A 1BGXT 2GUIA 4E7HA 3DLGA 3ZSVA 3HPHA 3TWHA 3U3YA 2PYLA 3IRXA 4NYFA 4E3SA 4DTSA 1XHZA 3KK3A 3NH1A 3JYTA 3TI0A 1BI4A 2I5JA 4I2PA 3QEVA 3V4IA 3TAQA 2RPIA 2X78A 2G8IA 3SQ1A 3MECA 4DFPA 4BDYA 5DMRA 1VSHA 5CY4A 3CFRA 2P51A 1K6YA 5KI6A 2XHBA 3ZSWA 1ZBUA 1TKTA 1RBRA 3B6OA 4FJNA 4OKJA 4Q0BA 2DTUA 4FZYA 4N76A 3HP9A 1D9FA 2G8HA 5KGXA 1LV5A 3ITHA 4E89A 1JL1A 4CJSA 1NK4A 4W5RA 2ATQA 4M3TA 4CEZA 3PV8A 1QSLA 2Z1HA 1WNSA 1VSEA 2VG6A 4CF0A 3SUQA 3SUNA 4PY5A 3M8PA 3AVBA 4KI4A 2HHSA 1JXBA 1RT4A 4EP4A 2GV9A 3DLKA 2IS3A 2A1RA 3HO1A 3VN5A 4PQUA 3LALA 3HK2A 3AV9A 3MXIA 4DG1A 1HYZA 1KVBA 1C6VA 1Z26A 4ID1A 3TR8A 3QEWA 1SL1A 4KTZA 3OS2A 3ZSZA 4DS4A 4E7JA 1J53A 3SPZA 1RT1A 5C25A 4OLBA 1KLMA 5T7BA 3MXMA 1ASWA 2PZSA 3ZT2A 3TANA 1B92A 3LZIA 4FJ9A 4CGGA 3V6DA 4F8RA 4FLVA 3VQ4A 1N6QA 4ELUA 4J2AA 3NF7A 1D5AA 1ASUA 2OPPA 3TARA 3V81A 1YT3A 4FW2A 3PO5A 3OYLA 4KB0A 4KHNA 3LDSA 3SCXA 4CK3A 5HP1A 4FJIA 4QOZB 2HHUA 4OKKA 4B9NA 1A5WA 4I2QA 2B4JA 3AO4A 3K57A 1HQEA 5J2NA 3RRGA 5FRNA 4BE1A 3K58A 1DTQA 3OYIA 4CEFA 5HRPA 3QEXA 3SUPA 3OYHA 3JSMA 3RMDA 3MXJA 1ZYQA 4M3UA 4H8KA 2RN2A 3TAFA 2HW3A 3OVNA 4DF8A 1CLQA 1I39A 1S9GA 3AO2A 4HVJA 5KTQA 4W5QA 1J5OA 3DRPA 1XI1A 1JLCA 1D8YA 4UQGA 2IOCA 3HP6A 1EXQA 1IKYA 4CF2A 4CERA 4I9QA 4DQPA 1ASVA 1WSFA 1SUQA 2D0CA 1NOYA 4M3ZA 4J2EA 2DFEA 1C0TA 2OPSA 4R5PA 4DQRA 1SV5A 4FZXC 4FLTA 4CF1A 1MU2A 1KFSA 2KZZA 5KRSA 1TAUA 4MQ3A 4Z4HA 3D0PA 5JS1A 3ALYA 4AHRA 3NH2A 3LWMA 3AVCA 1RT6A 2EHGA 3U6FA 4AILC 1SL0A 1IG9A 3TABA 4ID5A 3PY8A 4HCBA 3I0SA 1L3TA 2YHBA 4CEBA 4EP5A 2F96A 4O0JA 1HQUA 3O3FA 3ZSRA 2G8FA 4DSKA 1BIZA 1TGOA 3AVNA 5FROA 1KVAA 4OVLA 4FM1A 3AO3A 1VRUA 2XRIA 3ZSOA 3LZJA 4DSJA 3KLFA 5J2MA 3VQDA 2YNFA 2HHTA 3VQ9A 4CJ4A 2Z1GA 3OYEA 2QKKA 4DFKA 1T8EA 1RBTA 3CYMA 4GMJB 4JRPA 3L2VA 4N56A 1S5JA 4KFBA 1UA0A 1KVCA 4CJWA 4Z4CA 1NJYA 3ASMA 2X6NA 4CFAA 4CIGA 1X9WA 4OPKA 4J2BA 3QEIA 1CXQA 5CZ2A 4O5BA 3C6TA 4Y1DA 4LD0A 4DTMA 3SQ4A 1NJXA 1NJWA 1FK9A 3OYMA 3L2RA 2Q3SA 1NK8A 3AVLA 1SKWA 2Z1IA 2PY5A 4KHSA 4W5NA 4FJ7A 1C1BA 3L8BA 3DLHA 1D9DA 3DOLA 1C1AA 3RR7A 2P5OA 1T7PA 1VRTA 1VSJA 4KTWA 3L2WA 2OPQA 4GW6A 2DFHA 4E1NA 4FJLA 4FLXA 1DTTA 4DTPA 4JLHA 4KAZA 3I0RA 4E7LA 3NAEA 2KQ2A 2W42A 1JLAA 1RT2A 3VQBA 4DFMA 3VQEA 3OJUA 4DU1A 3QERA 4F2RA 1WSHA 3LANA 4C8KA 4DSLA 4N41A 4OJRA 2A1SA 1VSIA 3F73A 3CFPA 4CJQA 5HBMA 1VSMA 2QKBA 1X9MA 1TKXA 2ZE2A 3KKRA 3MEGA 5HRNA 4OPJA 4E1MA 4DTXA 3KD5E 1KTQA 3AVHA 4DQQA 2OPRA 3KIOA 1RBSA 3WNHA 4CHYA 4HUEA 1U48A 3K5OA 4DLGA 3SQ0A 1ITGA 1FXXA 5J2PA 2BANA 4CGHA 2X74A 3IS9A 1C0UA 2HNZA 4TSXA 4IKFA 2FBYA 1U45A 1NJZA 1W9HA 2E4LA 1RT5A 3RMCA 4CGDA 2R7YA 3PUFA 4B8AB 1TAQA 1S1WA 3DRSA 4O44A 1ZBIA 1S1UA 4BE2A 3SYZA 3D45A 4B08A 3NH0A 4JS4A 1YTUA 3ZSXA 3K5NA 2G8KA 5J2QA 4AH9A 1LW0A 1S1TA 3KK2A 3C95A 1RNHA 1BHLA 1FKOA 1C0MA 4E0DA 4Z4IA 2FBVA 2IGIA 1WLJA 1BI4B 4B9MA 1O1WA 3ULDA 3AVJA 1WAJA 1U4BA 3QNOA 4FM0A 4HUGA 3L2QA 3AO1A 4NCBA 4CEAA 3V1QA 4Z4GA 3T3FA 3RMBA 1Y97A 2NUBA 3L2UA 3HPGA 4FJHA 3AA5X 3BGRA 4DSIA 4DSFA 4Z0UA 3V1RA 3V9WA 4F3OA 1TVRA 4PUOA 4IDKA 2HNDA 4KPYA 1KCFA 4ZHRA 4B9VA 4DWIA 3VQ6A 4FK2A 4KHUA 4DLEA 4FJXA 3V9ZA 3AO5A 3HM9A 3ZT4A 4FM2A 4CK1A 4KHWA 3HJFA 4E7KA 2DFFA 4NCAA 4GVMA 1NKBA 3HL8A 3KLEA 3MAQA 4DQSA 4H4OA 2X6SA 1NOZA 5HRSA 1QE1A 4L8RB 4DU3A 3PX6A 3VQAA 4AHCA 4CGJA 3KJVA 2XY6A 3SNNA 1JKHA 2HB5A 4CF8A 4ELVA 3G0ZA 4E7IA 3FFIA 4FK0A 2YNHA 1SKRA 3LAMA 4B3OA 1WSJA 1BL3A 4Z4FA 4LSLA 4CJFA 1HYSA 3H08A 2XY8A 4CE9A 1WAFA 4B9UA 4RW8A 3DYAA 2VG7A 1QHTA 2YNGA 1GOAA 4CHOA 1S6PA 1S6QA 2IAJA 3IAYA 1YTAA 4AHUA 3O3GA 4KTQA 3OYAA 2HHWA 4DFJA 2Y1IA 3I8DA 3PX0A 1TL1A 1NK9A 1VSDA 5E41A 1RTDA 4HCCA 1JLFA 3LPUA 2QK9A 3M8QA 1R0AA 2JGUA 4RW6A 4BWMA 4CJ5A 4FJKA 3VQCA 3QIOA 1VK0A 4FCYA 3S3OA 4EZ6A 1VSKA 2FC0A 3KLIA 4CIEA 3AVFA 4LY7A 4CFCA 4HHTA 2YKMA 5D3GA 1TKZA 3NGIA
chains in the Genus database with same CATH superfamily
1HR0K 3ZX3A 1JCEA 4KV8A 1RT3A 3DOKA 3ATUA 4IFVA 4B1YB 3DLBA 3LAKA 3OS1A 4U7BA 4CESA 4M7YA 4DV4K 3MWPA 1QSSA 4ELTA 1CZBA 2E6MA 4IG0A 1C0GA 2OANA 1FW6A 3J80O 1LWCA 3LWLA 3O08A 5I42A 1S22A 4CZGA 2XO7A 4B1WB 4MO4A 2QXFA 5MLCQ 1TUUA 3HZ6A 3NCIA 1L3SA 1I94K 4B9TA 2A42A 1HKBA 3VQ5A 2QM1A 2BGGA 1RTJA 3BZKA 1S3XA 4ZTJA 1KLNA 1DKGD 3I33A 5CYMA 4LSNA 2YHAA 1J9AA 3R3LA 1WN7A 3O6WA 3RR8A 2RE2A 3D2EB 1Q9YA 4NXNK 5M1QA 4CJVA 3QLHA 2ZWHA 1NMNA 4I7FA 4NYNA 2HVIA 3L0QA 3VA3A 4H5VA 3O1BA 4B8CA 5LMNK 3VTHA 1RBVA 4FJMA 3OBYA 3ENOA 1WSGA 1QS4A 1JJ2M 3OYCA 5EU7A 1KFDA 4OGEA 1KAZA 4BDZA 3SLCA 4CHQA 2HHHK 4AHSA 1N5YA 3D6RA 1QTMA 4B3RK 4BC5A 1ZBHA 4W5OA 3DWLA 1HPZA 4C8MA 2GELA 3ID6A 4JI3K 3O9SA 4YY3K 3V9XA 1M90O 4M41A 2HVHA 3LP2A 4YNQA 3S3MA 5EX5A 2HF4A 3U3GA 4DUYK 3QIPA 2KW4A 4XIUA 4PKIA 3IG1A 3K9KA 3ENHA 1WUAA 3N4PA 5K14A 2UUCK 4NO7A 4CZJA 2QWLA 1LWFA 4M63C 4A59A 4K8ZA 4PL8A 4YOUA 1ILYA 4FPAA 1IO2A 1HNZK 2YNIA 4E19A 2YX6A 3QETA 3DXKB 1XHXA 4ZTFA 2XY5A 2QWNA 3EO3A 1YI2N 3DMJA 1OKJA 1GLDG 3C6UA 1LCUA 3DRRA 3VGLA 3MX2A 3OYNA 2Q31A 2KTQA 3ZETA 3G10A 1RT7A 4OLAA 5TKYA 2ZGYA 1RFQA 3C7NA 3DI6A 1ZXOA 4RW4A 2O8EA 3VERA 3HPOA 4DQIA 4IFEA 2G8UA 1HUXA 1BISA 1Q81O 3NDKA 1ZBFA 4CJ3A 3K5MA 2PYJA 1BO5O 2P1JA 4FWPA 5AR0A 4HTLA 3NHGA 3NBPA 1E4FT 3VOVA 3KWGA 5AQYA 3ULEB 2QEXN 4CFBA 3CG7A 1A5XA 4OX9K 5BPMA 4A61A 1BDGA 1CZ9A 1UAXA 2W40A 4M7XA 1EETA 4KHYA 2P9SB 3CI5A 5M1OA 3TAGA 3SBGA 4CJLA 4CIFA 3G71N 1UOCA 3CJ1A 1LAWA 1KAYA 4DTOA 2Y1JA 1JL2A 3GBTA 4NCGA 4WQ5C 4DS5A 4CJTA 3VQQA 3VEWA 5GAEP 1VQON 4A5BA 4YOYA 5I3UA 3M6GA 1SL2A 4KHQA 2D0OA 4KI6A 4H5NA 2GEMA 4JKCA 4CI6A 4PKHA 3IRXA 1XMQK 3KK3A 3QMLA 3NH1A 3K0SA 4I2PA 3V4IA 3SQ1A 4DFPA 1DEJA 3IMXA 3A5OC 5KI6A 1ZBUA 4Q0BA 1OH7A 2G8HA 1LV5A 4W5RA 3NVKA 1K8AO 3SUNA 4KI4A 2HHSA 3SMSA 1RT4A 3MN7A 4Y0WA 2Q2RA 2P9KA 3AV9A 1U4BA 3CJ7A 3TR8A 3CC2N 3QBWA 4DS4A 2OTJN 2PZSA 1X3NA 4F8RA 4FLVA 4JD2A 1D5AA 2NRHA 4FPBA 3TARA 2HHUA 5HL7L 4B9NA 3ID8A 3TSUA 2QWMA 2P9PA 3AO4A 1HQEA 3RRGA 1WOQA 4IOCL 4DR4K 1QZ6A 5HRPA 5FPNA 3RMDA 2FSJA 4M3UA 2JWKA 3CCQN 3U8XA 1HKCA 3OVNA 4JHDB 3MWTA 4ILJA 1J5OA 3T1HK 2YHYA 2IOCA 3Q7CA 1IKYA 3THYB 4FO0A 1NOYA 2QWRA 4DV3K 1C0TA 5C10A 2KHOA 1KFSA 5KRSA 4MQ3A 5JS1A 3NH2A 3TABA 3PY8A 4JAXA 4RWTA 4EP5A 1GLEG 3O3FA 3ZSRA 1TGOA 3AVNA 4OVLA 4JEPA 3WQTA 5J2MA 2YNFA 4CJ4A 3FE1A 2ASMA 4DFKA 1RBTA 3CYMA 1T8EA 4IDHA 4JRPA 4BRQA 3L2VA 3IUCA 3FZFA 3ASMA 4KH6A 1X9WA 5AZJA 1GLCG 3C6TA 4LF7K 3OYMA 1VQKN 4GNIA 4GVEA 4FJ7A 3PLAA 4J8FA 3D2EA 1VRTA 3TTDA 4GW6A 4E1NA 1EWRA 2CH6A 2QI2A 1ATRA 1QHAA 4B3TK 2W42A 3CF5L 3UKRB 4DU1A 3QERA 1WSHA 3SJHA 4RTFD 3CJCA 2QA4N 1VSMA 1XQSC 1NWKA 3MEGA 3KD5E 4CHYA 4BY9C 4JI4K 4DLGA 5AQSA 1FXXA 4PHTX 2BANA 4CGHA 2X74A 3IS9A 4L3QA 1U45A 3RMCA 4DV7K 3TTFA 4CGDA 2R7YA 1QZ5A 4KH5A 4CJ7A 5C2FA 3VGKA 3EN9A 4DUZK 1ZBIA 1S1UA 3A0IX 4BE2A 3E66A 1YTUA 3MX5A 3ZSXA 2P9LB 2V7YA 4AH9A 1LW0A 3C95A 1RNHA 1BHLA 4Z4IA 1BI4B 1TKZA 3AVJA 4FM0A 4HUGA 5GIOA 3AO1A 1HLUA 3V1QA 3J8AA 3RMBA 1Y97A 4DB3A 3J81O 2NRXA 3L2UA 4FJHA 3WEEB 3F5TA 5CE3A 3Q7BA 3DJCA 3V1RA 3H1VX 1KQSM 3DXKA 3FFKB 4XH4A 4FK2A 2YHWA 4GV9A 3AO5A 3ZT4A 4CK1A 4DCHA 4E7KA 2E2NA 5AFUA 4H4OA 1NOZA 1QE1A 3KJVA 1JKHA 2D1KA 2HB5A 4ELVA 1K8KA 3DLLL 3VTIA 2YNHA 4IJAA 3LAMA 4FOIA 4CJFA 3WQUA 2A6AA 3DYAA 3LDOA 1QHTA 3CXCM 2IAJA 3OYAA 1KAXA 4DFJA 2WTUA 3PX0A 3BEXA 4GV6A 5F2RA 3KWIA 5E41A 3HSCA 3M8QA 3ULEA 3P4IA 2OCEA 5AQGA 2KKZA 3S3OA 3AVFA 3PSIA 1W7AA 3I56N 2P9SA 1NK7A 2HHVA 4BQZA 4JS5A 4CGFA 2D0BA 3NF9A 1RBUA 4IXCA 3GL1A 1U47A 2A40A 5FPDA 4FLWA 3SJJA 4RW9A 2HHQA 3MCAB 3TAPA 3KVGA 1GLFO 4FJ8A 3E9PA 3LP1A 4O0IA 1LAVA 1GOBA 4IEIA 2P9NB 3L3UA 5HRRA 3OYGA 4E1JA 4O4GA 3HVRA 4CBXA 4F3TA 4BRAA 1T6DA 3DLEA 4IG3A 1EKEA 3TSQA 4JKEA 4FSVA 3PX4A 2VWBA 4JI7K 3D2FA 1S9EA 3F2KA 3KLGA 4GY2B 1YAGA 3ZT1A 5LJVA 4AHTA 1XNQK 1BIUA 4BWJA 5SZTA 2HOEA 3CD6N 5EXWA 1B9FA 2VGNA 4QS9A 2QXLA 5E26A 2OA8A 3V9UA 3LPTA 2P5GA 2E6LA 3CQ8A 1BCOA 4FLUA 1W97L 1IKVA 3O9QA 4BG9A 4F4KA 2O8FB 4FJ5A 1IH7A 3HM8A 3F9MA 4H0TB 2KFNA 3CC4N 2ZM6K 4LFAK 2AJQA 3CIPA 2FBXA 3ZCMA 2BE2A 1VSFA 3HOTA 4PA1A 3ZSQA 4Z4EA 1B9DA 4CECA 4DTUA 4AHVA 5BPLA 4FL9A 5IWAK 1UWBA 3MEDA 1Y64A 1RTHA 1JXEA 1NK6A 4BACA 3CETA 4JHDA 3SUOA 3OYDA 4CJEA 1FJGK 3SMPA 1BOTO 4FW1A 4CJUA 1OVYA 4KBOA 3OJSA 5KQDA 2D0AA 3THYA 4BRMA 3R6MA 3VF2A 4CJPA 3KTQA 2NRWA 3C65A 1HNXK 4CW7B 3S9HA 1VQLN 2VWKA 5FPEA 5J1EA 3AAQA 3FZHA 4YOXA 1EX4A 5HOOA 3K59A 1XWLA 1H1VA 2O4IA 1NLVA 1RTIA 3P38A 4BG8A 3SAHA 1OH5A 1X1PA 3VEZA 1EQYA 3HI0A 1JLQA 4DTNA 4CBUA 3PO4A 1TK8A 3VENA 4EAHD 3AA3A 5JS2A 3O4QA 4FWNA 4BR2A 3PIOL 1L3UA 4BRDA 1HYVA 3AVMA 1OH8A 4LF8K 3SAGA 3CMAN 2F9WA 4B1VA 1RDCA 2A5XA 4CZKA 4DF4A 1QSYA 4W5TA 4CVNE 1ZBSA 2HBLA 4MLEA 1NKCA 1BUPA 3LDNA 2W41A 4M3YA 2IDOA 2Z1JA 3U4LA 5C15A 1IBMK 3CMEN 3WNFA 4NLCA 1HNIA 1VHXA 3QICA 2WONA 1JLBA 4CZIA 4CHNA 3UKRA 1WSEA 4BGBA 5BPNA 3D7EO 2HF3A 3R1XA 4B1ZA 1J6ZA 3NMUA 1UA1A 1XC9A 2NZTA 3WUHA 3RTVA 1J54A 1NM1A 2RKIA 4LF9K 4H5TA 2O4GA 4ICLA 3HXMA 2ZD1A 4QCLA 4FJJA 1Q7YO 3QO9A 1TL3A 4DV1K 1G99A 4WCEL 1T03A 4QS7A 3IKMA 4NB4A 1NGJA 4F9OA 2P9LA 2UXBK 3HPHA 2PYLA 4NYFA 3THWB 1NG9A 1VQ8N 1BI4A 2I5JA 1Q18A 3TAQA 4X66K 4JKGB 2YHXA 4BDYA 5DMRA 2P51A 1K6YA 2XHBA 4BRKA 1TKTA 4FJNA 4OKJA 5AQIA 3CCUN 4GKKK 5KGXA 3ITHA 4E89A 1JL1A 3WEEA 1DT9A 1ESVA 3PV8A 1QSLA 4M3TA 2D4WA 1WNSA 2VG6A 4PY5A 1JXBA 1KXPA 2UUAK 4BR7A 2IS3A 3VN5A 4DG1A 1HYZA 5LL6Z 4ID1A 4A2AA 4FVUA 3ZSZA 3ENBA 2F4VK 1SAZA 4E7JA 2RHKA 3H1QA 3SPZA 4JKFA 4FWMA 1RT1A 5C25A 4BC3A 4BVPA 4CZMA 4JI5K 3LM9A 2IVNA 1N6QA 1ASUA 3V81A 2FXUA 1VQNN 4I6MB 4JI2K 5IT9O 3O4WA 3P39A 1YJNN 2KLAA 4CEFA 3CPWM 3SUPA 3JSMA 3MXJA 3SBTA 4DF8A 1CLQA 3A5LC 3AO2A 2Q1NA 1JLCA 1D8YA 4BRHA 3HP6A 1ASVA 1WSFA 4M3ZA 3E9LA 4R5PA 4DQRA 1SV5A 2J4RA 4FLTA 3ALYA 4AHRA 3UB5A 3LWMA 4HCBA 4DR6K 2E20A 2FSNA 2F96A 4B1UB 3MMVA 1ZC6A 3MK6A 1BIZA 3CQYA 1VQ4N 1RDUA 4LFBK 3AO3A 3LZJA 2XRIA 2V7ZA 5GAHP 4O5FA 2GWJA 3AGRA 3KHYA 1UA0A 5ADXA 4Z4CA 4CD1A 1WBDA 5JMVA 1NGEA 1O13A 5E84A 4K25A 4OPKA 3QEIA 1CXQA 4BREA 1M1KO 4DTMA 2E8AA 4LD0A 1NJXA 3FZKA 1FK9A 3L2RA 4YDUA 2PY5A 5AQQA 3AVLA 1C1BA 3CCSN 3DLHA 1D9DA 3DOLA 3I55N 3RR7A 2P5OA 3OTOK 1VSJA 3L2WA 2DFHA 5EY4A 1DTTA 1IBLK 4DTPA 2O8FA 1GLJO 1RT2A 3VQEA 2O8BB 4F2RA 1N36K 3LANA 4DSLA 3CFPA 4CJQA 1TKXA 2ITMA 5HRNA 4E1MA 1MA9B 2E2QA 2OPRA 2BH1A 3KIOA 1U48A 1QVGM 3RVCA 4TSXA 2E4LA 1RT5A 1JCFA 4LC9B 1TAQA 3DRSA 1QQMA 4O44A 4DKWA 4B08A 3OBWA 2A3ZA 3KK2A 3VEXA 1C0MA 4QS8A 2FBVA 2IGIA 2FLOA 3JXUA 2I7NA 3QNOA 3ATVA 2Q0RA 4NCBA 1SZ2A 3DAWA 2NUBA 3HPGA 3AA5X 4Z0UA 2VCPA 4F3OA 4PUOA 4ZHRA 3V9ZA 3FZLA 4NCAA 3KLEA 3MAQA 4Z94A 1GLAG 1T44A 4CF8A 5I9EB 4B3OA 1N33K 4IO8A 1V4TA 2XY8A 2W6KA 2YNGA 4CHOA 1TUYA 4AHUA 4KTQA 1BU6O 1TL1A 3MDQA 3CJBA 1U2VB 1RDWX 1WBBA 4BWMA 3VQCA 1NMDA 3CJ9A 4CZFA 2P9IB 3KLIA 4EIAA 1N32K 4HHTA 4DR1K 1VQ9N 1RGIA 2YKMA 3AY9A 5AQFA 2HSTA 3QB0A 3EEQA 4IOAL 4EZ9A 2NNWA 1Z6RA 1SS6A 4OPHA 3OY9A 3H46O 3WXIA 5AJ3K 4RCHA 1Z25A 2Q36A 5JLHA 1QVFM 4WYBA 1REVA 5A2QO 5KRTA 1RDDA 3CC7N 4CJKA 4DTRA 3VQ8A 2CGLA 1TV6A 4A57A 3G6EN 3VEOA 2IVOA 2OZSA 3CM5A 3THWA 3K9JA 4B9SA 1N34K 4FZZA 1IKXA 5KGWA 4BE0A 4OGCA 2HBJA 3AVGA 4JKGA 2OZMA 1CXUA 1HMVA 3AA4A 3MN5A 4C1NI 3RRHA 4H5WA 1RDAA 2CGKA 1GOCA 4DR5K 1KSPA 4ISEA 3LP0A 2WOMA 4K43A 3M1FA 3GE1A 5BRHA 4BRFA 5CYQA 5AQHA 3VF6A 3THXB 4V19S 4LH4A 5AQLA 3KLHA 4CGIA 3QEPA 2RF2A 4IFYA 1Q9XA 2HHXA 3H6EA 1OH6A 4H03B 5FRMA 3VMFB 2ZQBA 5C42A 4X65K 2G8WA 2GBZA 3U9ZA 4CF9A 4IBNA 4H4MA 4M3RA 3C94A 3KK1A 1C0FA 2O8DB 4U67L 4DV0K 3OYKA 1YJ9N 4CCHA 3EL2A 2KZMA 4RW7A 4PWDA 1HJOA 4H5RA 1BQMA 3TPQA 3PIPL 4CEEA 4M42A 5DK5A 3AVIA 2VWJA 1NNEA 4UY8O 5KPZA 3CM6A 3BDPA 4CZLA 3HOSA 4KRFA 3FZMA 3VA0A 3VF4A 1LWEA 2PFUA 4WQ4A 3ISNC 5HROA 3J7YP 5F0XA 1GLBG 3NF6A 3QINA 3T1AA 3IFRA 3LP3A 2D5RA 3B8AX 2YJEA 4BR4A 1WSIA 1VSLA 4HTUA 4IJNA 3K5LA 5M1KA 3CFOA 4O55A 5SWMA 3O9TA 2GUPA 3MEEA 3TAMA 4C8LA 4DSEA 4H0OA 1KD1O 2QTDA 3F9KA 2HMIA 1MWMA 5AQMA 2G8VA 4JK7A 3AVAA 5LJWA 2YCHA 3O3HA 2GX9A 3SV4A 4M3WA 2YJFA 3L3VA 2HBMA 4GKJK 1K9MO 2XY7A 1JLEA 2CGJA 2IC3A 3CPEA 3VEYA 2V51B 4FLZA 3CQXA 3P83D 3QNNA 3R8EA 4CFDA 4B9LA 3VQ7A 3DLRA 4KB1A 4Y1CA 1ZBLA 1T05A 3ZSYA 3ZX0A 1X9JA 4JKBA 3A2FA 4AM6A 3OS0A 1FKPA 1HNVA 3G25A 3LDLA 3O4NA 4EHTA 1TK5A 3C7NB 4N5SA 3EE8A 4DTJA 4YOWA 3RMAA 2B6AA 3E9OA 4G1QA 3BF3A 4KO0A 5AQXA 1BQNA 3NFAA 3DM2A 5FDLA 4Q5VA 5AQKA 5AQOA 2GWKA 3DLGA 3M3ZA 3CERA 4CZHA 1P8ZA 4YDUC 4E3SA 4YOTA 4A2BA 2AP1A 4ISGA 2H3GX 2RPIA 4EFHA 2X78A 2G8IA 3MECA 1VSHA 1BG3A 1NBWA 1VQPN 5CR4A 2NRZA 3ZSWA 3B6OA 2DTUA 1OVQA 5AQUA 2UXCK 1D9FA 1NK4A 4XH5A 4CEZA 3O8MA 2Z1HA 5TKWA 1VSEA 3S41A 3M8PA 3J7AP 3AARA 3MN6A 4EP4A 3C6AA 2GV9A 3EZWA 2A1RA 4AM7A 4PQUA 3LALA 1C6VA 3QEWA 1NGGA 3M5RA 4IOXA 2E1ZA 5AZIB 3KZBA 4OLBA 4KHPK 1KLMA 1VQ5N 5M1PA 1ASWA 1B92A 5AQPA 4BRPA 3V6DA 3VQ4A 4ELUA 4J2AA 3NF7A 4C1NK 2OPPA 2YI1A 1YT3A 2F9TA 4FW2A 3ZYYX 3PO5A 1U6ZA 4KHNA 3LDSA 2JWLA 4ILGB 3K57A 2FF6A 5FRNA 4BE1A 3OYIA 1HX1A 2P9IA 4DV5K 2QWQA 3DXMB 5EOYA 3QFUA 4YOVA 2RN2A 3TAFA 1S9GA 4K42A 4JI1K 5KTQA 4CF2A 2BUPA 4CERA 1Q82O 4I9QA 1SUQA 2D0CA 4FOEA 5C0YA 1MU2A 2KZZA 3GDQA 4Z4HA 1IG9A 3AVCA 4AILC 1HNWK 4ID5A 3I0SA 1L3TA 2YHBA 3TU5A 4O0JA 2ZGZA 1NGFA 5KQ8A 3O5BA 1KC8O 4H0XB 3GG4A 1NGIA 1BA1A 2ZF5O 5M1FA 4DSJA 2Z1GA 3OYEA 1VQ7N 2QKKA 1HPMA 4GMJB 4FWRA 4NXMK 4KFBA 1KVCA 1NJYA 2X6NA 5AFUH 4CIGA 2VQEK 4Y1DA 5BREA 1NGBA 1WB9A 2Q3SA 1NK8A 3E1YA 4KHSA 4W5NA 3THXA 1D4XA 2E1YA 1T7PA 3CJAA 5AQJA 2OPQA 4FJLA 1XMOK 3ZLJA 4DQ8A 4KAZA 3I0RA 2KQ2A 3VQBA 3FLCO 3JS6A 5DM7L 1IJJA 4YHHK 4C8KA 2P9UB 4N41A 1EO1A 5FLXO 3F73A 5HBMA 1Z05A 2D0PA 2QKBA 1X9MA 5AZJB 3KKRA 2ZJRL 1N8RO 3G4SN 2O8DA 1RBSA 3WNHA 3LM2A 4HUEA 3K5OA 3UKUB 1ITGA 2HNZA 1NJZA 1W9HA 4CBWA 3PUFA 4B8AB 3A8YA 1NGDA 1W2BM 2UUBK 4JK9A 3SYZA 3D45A 4JS4A 2G8KA 1YVNA 2NRVA 5KPRA 1FKOA 4E0DA 4BRLA 1WLJA 4B9MA 1O1WA 5ELZA 1WAJA 3ZX2A 1XUPO 3L2QA 3WT0A 1V4SA 3LDQA 3O9UA 4JI0K 3PSFA 2ZJPL 3TTCA 2HNDA 4KPYA 2PBDA 4DWIA 3L4QA 3VQ6A 3AAPA 5KPTA 3HM9A 4FM2A 3HJFA 4BVOA 3HL8A 5CHIA 2X6SA 4AHCA 4CGJA 3SNNA 2XY6A 5F1XA 4JKAA 3FR0A 4E7IA 3FFIA 4FK0A 2VYPA 3BUZB 3ZEUB 1BL3A 1HYSA 4CZEA 1WAFA 3C0BA 4RW8A 2VG7A 1S6PA 1S6QA 3EKUA 4JKDA 2NRTA 2HHWA 2Y1IA 3I8DA 1CZAN 1VSDA 1RTDA 4HCCA 1JLFA 2P9NA 3WXKA 2QK9A 4MDBA 1VK0A 4BRCA 1VSKA 4FWKA 4CFCA 4FWOA 5D3GA 3NGIA 2F7TA 4WQ4C 3CCRN 2ETJA 3SPYA 3UIQA 3V9SA 1K8KB 4JRQA 2DY4A 3HVTA 1RCHA 4GV3A 1NK5A 4DU4A 4ILHA 4O8KA 4DR3K 4MLHA 4CEQA 4HUFA 4BGAA 1IKWA 1S72N 4C8NA 2F8SA 3CCJN 4CEDA 3SAFA 4CHPA 3ZT3A 1QQNA 1VQMN 5DM6L 3HT3A 1G15A 1SKSA 2ITGA 1W0HA 3M8RA 1NKEA 4KKOA 3SI6A 4K41A 4FVMA 3P1GA 4B9QA 4X62K 4DMNA 1RDBA 3I8BA 1X9SA 3MN9A 1DLOA 4CK2A 5GAGP 5CZ1A 3NF8A 3A5MC 5BRDA 1MWKA 3T69A 1MDUB 3B6PA 3HTVA 5C2DA 3RSEB 4FK4A 1BCMA 4JNEA 1LOTB 4WE1A 1NGHA 3OHRA 3QBXA 1TK0A 4M45A 5AZIA 2B5JA 2HBKA 1NK0A 5HP1A 4CHZA 3EZ5A 4MFBA 4J2DA 3OYBA 4FYDA 4M3XA 3KD1E 3WNEA 1I3AA 2O8CB 3T1YK 2HNYA 3D2FB 1HJRA 3CCMN 1S1VA 3BF1A 2E2OA 3WNGA 3SQ2A 1J5EK 4L8RB 4KREA 2BDPA 1SQKA 3EYZA 2W6LA 4LFCK 3DXMA 4BR9A 1QQCA 1P90A 5LMUK 2BTFA 4AF1A 2IIRA 2ZJQL 1L3VA 4BQLA 3HRGA 3BP8A 4H0PA 1X3MA 4CJRA 3RWUA 3O80A 2OYQA 4YFUA 4FLYA 4C8OA 3L4IA 3EY1A 1YXQA 3R9PA 4LH5A 3N4QA 4I9LA 3V1OA 2YKNA 4FWQA 2LSNA 1QQOA 1NGAA 1A5VA 4CEOA 4DV2K 3SV3A 4A5AA 3H3OB 3NE6A 1NJIO 3AVKA 1ATSA 1U04A 4K8XA 4F2SA 2JLEA 2NLXA 4WF9L 3OYJA 4DHYA 1LW2A 5AQTA 1F21A 3AA2A 1TKDA 4B3SK 2UU9K 2KFZA 5HLFA 1Q8IA 2E2PA 1NGCA 3SK3A 3NGZA 4QAGA 2A41A 2IVPA 1IV0A 3NGYA 4X64K 1JLGA 4MO5A 3HSTB 4RG8A 5B8HA 3VQPA 5JLFA 2VG5A 1YJWN 1TYQB 2YV0X 3P5JA 4C23A 3CCEN 3E01A 4H0VB 3SZ2A 1EP4A 4PL7A 1HRHA 4FWSA 4O8UA 2UYTA 3KK7A 3T19A 2CH5A 3CHWA 1S1XA 3W3DA 4BC2A 3OYFA 3NVMA 1VAZA 1C1CA 3QESA 4LF4K 5FPMA 4CD3A 4BDPA 4LF5K 4WFBL 3VEVA 2V52B 3J7ZO 2GTDA 4XH1A 2P9UA 3HYFA 4R79A 4DR7K 1L5UA 2EX3A 1BWFO 2FBTA 4OPAA 3L6QA 2ASOA 1KRPA 2E88A 3S3NA 3ZT0A 5C24A 3UKUA 2F8TA 2AA4A 2OTLN 2FF3B 1RILA 4WFAL 4FXDA 3THVA 3K2PA 4N47A 4AQYK 3M8SA 3TAEA 2WFBA 5M1NA 1U49A 4FJGA 3CCLN 1YVUA 5BRFA 2I7PA 3KKSA 1BGXT 2GUIA 4E7HA 3ZSVA 3TWHA 3U3YA 4DTSA 1XHZA 3QFPA 3JYTA 3TI0A 3QEVA 1HKGA 5C12A 4HWIA 5CY4A 4JN4A 3CFRA 1RBRA 3BZCA 4FZYA 4N76A 3HP9A 1YF5L 4CJSA 2ATQA 2QWOA 4I6MA 4BR0A 5ADXH 4IO9L 4CF0A 3SUQA 3AVBA 3DLKA 1DGKN 1R59O 1EWQA 3HO1A 3T7ZA 3HK2A 3MXIA 1KVBA 1Z26A 5AQVA 1SL1A 4KTZA 3OS2A 3JAMO 1YIJN 1J53A 2VQFK 3O9RA 5T7BA 3AGKA 3MXMA 3ZEUA 3ZT2A 3TANA 2WBNA 1T6CA 4EHUA 3LZIA 4FJ9A 4CGGA 3IDHA 5JVGL 3LL3A 3OYLA 4KB0A 2DPNA 3SCXA 4CK3A 4FJIA 4QOZB 3VESA 3BY5A 4OKKA 5GIPA 1A5WA 4I2QA 2B4JA 5J2NA 4JV5K 3TSPA 3K58A 1DTQA 3MCPA 3GOIA 4DV6K 3QEXA 3W0LA 2VGMA 5BN9A 3OYHA 1ZYQA 2HMPA 4H8KA 3WXLA 2HW3A 3WXMB 3UE5A 5BR9A 4JYAK 1I39A 3OA9A 4BRIA 4HVJA 4W5QA 3LDPA 3DRPA 4B3MK 1XI1A 4UQGA 4FWLA 1EXQA 4DQPA 5AQNA 4J2EA 2DFEA 2OPSA 4FZXC 4BC4A 4CF1A 1TAUA 3H3NO 3D0PA 5H1SQ 3U6FA 4KH4A 2WC9A 1RT6A 2EHGA 1SL0A 4H0YB 4CEBA 4B1XB 1HQUA 4DSKA 2G8FA 3EE9A 5FROA 1KVAA 4FM1A 1VRUA 3ZSOA 4BRNA 3KLFA 3VQDA 2HHTA 3VQ9A 4JK8A 4WQ5A 2O8BA 4JKHA 5EVZA 4N56A 1S5JA 5GINA 4CJWA 4CFAA 4ISFA 2NRRA 3ZETB 4J2BA 5CZ2A 4O5BA 3RSEA 3SQ4A 4MDAA 1T3VA 1NJWA 2O8EB 1SKWA 2Z1IA 5LY3A 3L8BA 4DR2K 1IG8A 1C1AA 4KTWA 2E5LK 3WXJA 4FLXA 4JLHA 4E7LA 3NAEA 1JLAA 4DFMA 1E3MA 4JI8K 3OJUA 5AQRA 2O8CA 1E4GT 5AQWA 1VQ6N 1YUWA 5BR8K 4OJRA 2A1SA 1VSIA 1GLLO 3VPZA 2ZE2A 4DTXA 4OPJA 1KTQA 3AVHA 4DQQA 2EWSA 2QW9A 4IWVA 1BA0A 4YORA 3SQ0A 5J2PA 1XC3A 4BROA 1C0UA 4IKFA 2FBYA 3U9DA 2ASPA 1JCGA 1S1WA 5BN8A 2QWPA 2Q97A 4BR5A 2FSKA 3NH0A 4XEIA 3K5NA 5J2QA 4LF6K 1S1TA 5JICA 1YHQN 3ULDA 1K73O 3OW2M 4PKGA 4CEAA 4Z4GA 3T3FA 3FGUA 5GADP 3BGRA 4DSIA 5JVHL 4DSFA 3V9WA 2UXDK 1TVRA 4JI6K 4IDKA 4BRGA 2WUSA 1U2VA 1KCFA 3QDKA 4B9VA 4KHUA 4DLEA 3C6HA 4FJXA 4K0KK 4G9ZA 1Q86O 4KHWA 2P9KB 2DFFA 1XNRK 4GVMA 1NKBA 4DQSA 2PAVA 5HRSA 4DU3A 3PX6A 3VQAA 3HBTA 3G0ZA 4IZ9A 3VETA 4OO1J 4NLBA 5AQZA 1IBKK 3EKSA 1SKRA 1YITN 1WSJA 4Z4FA 4LSLA 1TYQA 3H08A 4CE9A 4B9UA 3P31A 4JD2B 1GOAA 3IAYA 1ATNA 3A5NC 1YTAA 3O3GA 3H45C 4WFNL 1NK9A 2Q0UA 3LPUA 2P9PB 1R0AA 3O1WA 2JGUA 4RW6A 3VGMA 4CJ5A 4FJKA 4EZ6A 3QIOA 4FCYA 4A62A 1NU0A 2FC0A 4CIEA 4LY7A 4IEEA 3CCVN 4OKEA
chains in the Genus database with same CATH topology
1NK7A 2ETJA 2HHVA 4KV8A 1RT3A 4CGFA 2D0BA 4JS5A 4EZ9A 4QCLA 3NF9A 1RBUA 3SPYA 3V9SA 3DOKA 3OY9A 3UIQA 4JRQA 4IFVA 2DY4A 3HVTA 1Z25A 1U47A 1RCHA 3DLBA 1REVA 4FLWA 3SJJA 5KRTA 3LAKA 1NK5A 1RDDA 3OS1A 4DU4A 4CJKA 4CESA 4RW9A 4CEQA 2HHQA 4HUFA 3TAPA 4DTRA 1IKWA 4FJ8A 3VQ8A 4C8NA 1TV6A 2F8SA 4CEDA 3LP1A 4O0IA 1LAVA 1GOBA 1QSSA 4ELTA 1CZBA 4KREA 3L3UA 2E6MA 5HRRA 4CHPA 4IG0A 3OYGA 3ZT3A 4O4GA 3HVRA 2OZSA 3HT3A 1G15A 3CM5A 2ITGA 1SKSA 1W0HA 1LWCA 3M8RA 1NKEA 4B9SA 4FZZA 3LWLA 4F3TA 4KKOA 1IKXA 5KGWA 4BE0A 3SI6A 4OGCA 3AVGA 5I42A 2OZMA 4FVMA 3DLEA 2XO7A 4IG3A 3P1GA 1CXUA 1EKEA 1HMVA 3AA4A 4DMNA 1RDBA 2QXFA 1X9SA 1DLOA 4CK2A 3RRHA 1RDAA 5CZ1A 3NF8A 1GOCA 3NCIA 3PX4A 1L3SA 1S9EA 4B9TA 1KSPA 3KLGA 3B6PA 3VQ5A 2BGGA 1RTJA 3ZT1A 4ZTJA 1KLNA 3LP0A 2WOMA 4AHTA 1BCMA 4FK4A 1BIUA 4LSNA 5CYMA 4BWJA 5SZTA 2YHAA 1J9AA 4WE1A 5CYQA 1B9FA 4LH4A 1WN7A 2OA8A 3RR8A 1TK0A 4M45A 3V9UA 1Q9YA 3LPTA 4CJVA 2B5JA 2P5GA 1NK0A 2E6LA 3KLHA 4CHZA 4CGIA 3EZ5A 4MFBA 2RF2A 4IFYA 3CQ8A 1BCOA 3QLHA 4FLUA 3QEPA 4J2DA 1Q9XA 3OYBA 1IKVA 2HHXA 4FYDA 5FRMA 4I7FA 4NYNA 4M3XA 3KD1E 4F4KA 2HVIA 2ZQBA 5C42A 3WNEA 3VA3A 1IH7A 4FJ5A 1I3AA 2KFNA 2HNYA 2G8WA 1HJRA 2GBZA 4B8CA 4CF9A 2AJQA 1S1VA 2FBXA 3ZCMA 3WNGA 3SQ2A 1RBVA 2BE2A 4IBNA 1VSFA 4H4MA 4PA1A 4FJMA 1WSGA 1QS4A 1B9DA 3C94A 4M3RA 5EU7A 3ZSQA 3OYCA 3KK1A 4CECA 1KFDA 4DTUA 4OGEA 2BDPA 3EYZA 4AHVA 3OYKA 4CHQA 4BDZA 4AHSA 1N5YA 1QQCA 1UWBA 4CCHA 3MEDA 1QTMA 2KZMA 1RTHA 1JXEA 1NK6A 1L3VA 4RW7A 4PWDA 4BACA 3SUOA 1BQMA 1ZBHA 3OYDA 4W5OA 4CJEA 1HPZA 4C8MA 4CJRA 3RWUA 4FW1A 4CJUA 2OYQA 4Z4EA 4YFUA 4FLYA 4C8OA 3OJSA 3EY1A 2D0AA 4LH5A 4CEEA 3V9XA 4I9LA 3V1OA 4M42A 2YKNA 5DK5A 4CJPA 3AVIA 2VWJA 2LSNA 4M41A 3KTQA 1A5VA 4CEOA 3LP2A 4YNQA 3SV3A 3S3MA 2HVHA 3S9HA 3U3GA 2VWKA 3QIPA 5J1EA 3NE6A 2KW4A 3CM6A 4XIUA 3BDPA 1EX4A 3IG1A 3AVKA 1U04A 4K8XA 4F2SA 2JLEA 4KRFA 3OYJA 1XWLA 3K59A 3VA0A 5K14A 2O4IA 1LWFA 1RTIA 1LWEA 4K8ZA 3ISNC 1LW2A 5HROA 1IO2A 1X1PA 1F21A 3AA2A 1JLQA 1TKDA 2YNIA 2KFZA 4DTNA 4E19A 3QETA 5HLFA 3PO4A 1Q8IA 3NF6A 3QINA 3T1AA 1XHXA 1TK8A 3LP3A 4ZTFA 2XY5A 2D5RA 3AA3A 3O4QA 5JS2A 3NGZA 4QAGA 1WSIA 3DMJA 1VSLA 4HTUA 3K5LA 3C6UA 3NGYA 3CFOA 1L3UA 4O55A 3DRRA 1HYVA 1JLGA 5SWMA 3AVMA 3MEEA 3OYNA 3TAMA 3HSTB 4RG8A 4C8LA 4DSEA 2KTQA 3VQPA 3F9KA 3G10A 1RT7A 2HMIA 2VG5A 4OLAA 2G8VA 3DI6A 4RW4A 1RDCA 3AVAA 4DF4A 3O3HA 1QSYA 4W5TA 3HPOA 3SV4A 2YV0X 4DQIA 3P5JA 2G8UA 4M3WA 1NKCA 3E01A 3SZ2A 4M3YA 1BISA 1EP4A 2IDOA 3L3VA 1HRHA 1ZBFA 2Z1JA 4CJ3A 3NDKA 2P1JA 3K5MA 2PYJA 4OKEA 2XY7A 1JLEA 3NHGA 2IC3A 3WNFA 3T19A 3NBPA 1HNIA 1S1XA 4FLZA 3OYFA 3P83D 1C1CA 3QESA 3QNNA 4CFBA 3CG7A 1A5XA 4BDPA 2WONA 1JLBA 4CFDA 4CHNA 4B9LA 3VQ7A 1CZ9A 1WSEA 3DLRA 3HYFA 4KB1A 1UAXA 4Y1CA 1ZBLA 1T05A 1L5UA 1EETA 2EX3A 3ZSYA 4KHYA 1UA1A 2FBTA 1XC9A 3TAGA 1KRPA 3A2FA 3OS0A 1FKPA 1HNVA 3O4NA 4CJLA 4CIFA 3RTVA 1UOCA 1TK5A 1J54A 1LAWA 4DTOA 2Y1JA 3ZT0A 1JL2A 4NCGA 5C24A 4N5SA 2RKIA 3S3NA 2F8TA 2O4GA 1RILA 4ICLA 2ZD1A 3HXMA 4DS5A 4DTJA 4FJJA 4CJTA 3QO9A 3VQQA 1TL3A 3RMAA 3THVA 3K2PA 2B6AA 4N47A 4FXDA 4G1QA 4KO0A 1BQNA 3NFAA 3M8SA 3TAEA 3DM2A 5I3UA 5FDLA 1U49A 1T03A 1SL2A 1YVUA 4FJGA 4KHQA 3KKSA 4Q5VA 4KI6A 1BGXT 2GUIA 4E7HA 3DLGA 3ZSVA 3HPHA 3TWHA 3U3YA 2PYLA 3IRXA 4NYFA 4E3SA 4DTSA 1XHZA 3KK3A 3NH1A 3JYTA 3TI0A 1BI4A 2I5JA 4I2PA 3QEVA 3V4IA 3TAQA 2RPIA 2X78A 2G8IA 3SQ1A 3MECA 4DFPA 4BDYA 5DMRA 1VSHA 5CY4A 3CFRA 2P51A 1K6YA 5KI6A 2XHBA 3ZSWA 1ZBUA 1TKTA 1RBRA 3B6OA 4FJNA 4OKJA 4Q0BA 2DTUA 4FZYA 4N76A 3HP9A 1D9FA 2G8HA 5KGXA 1LV5A 3ITHA 4E89A 1JL1A 4CJSA 1NK4A 4W5RA 2ATQA 4M3TA 4CEZA 3PV8A 1QSLA 2Z1HA 1WNSA 1VSEA 2VG6A 4CF0A 3SUQA 3SUNA 4PY5A 3M8PA 3AVBA 4KI4A 2HHSA 1JXBA 1RT4A 4EP4A 2GV9A 3DLKA 2IS3A 2A1RA 3HO1A 3VN5A 4PQUA 3LALA 3HK2A 3AV9A 3MXIA 4DG1A 1HYZA 1KVBA 1C6VA 1Z26A 4ID1A 3TR8A 3QEWA 1SL1A 4KTZA 3OS2A 3ZSZA 4DS4A 4E7JA 1J53A 3SPZA 1RT1A 5C25A 4OLBA 1KLMA 5T7BA 3MXMA 1ASWA 2PZSA 3ZT2A 3TANA 1B92A 3LZIA 4FJ9A 4CGGA 3V6DA 4F8RA 4FLVA 3VQ4A 1N6QA 4ELUA 4J2AA 3NF7A 1D5AA 1ASUA 2OPPA 3TARA 3V81A 1YT3A 4FW2A 3PO5A 3OYLA 4KB0A 4KHNA 3LDSA 3SCXA 4CK3A 5HP1A 4FJIA 4QOZB 2HHUA 4OKKA 4B9NA 1A5WA 4I2QA 2B4JA 3AO4A 3K57A 1HQEA 5J2NA 3RRGA 5FRNA 4BE1A 3K58A 1DTQA 3OYIA 4CEFA 5HRPA 3QEXA 3SUPA 3OYHA 3JSMA 3RMDA 3MXJA 1ZYQA 4M3UA 4H8KA 2RN2A 3TAFA 2HW3A 3OVNA 4DF8A 1CLQA 1I39A 1S9GA 3AO2A 4HVJA 5KTQA 4W5QA 1J5OA 3DRPA 1XI1A 1JLCA 1D8YA 4UQGA 2IOCA 3HP6A 1EXQA 1IKYA 4CF2A 4CERA 4I9QA 4DQPA 1ASVA 1WSFA 1SUQA 2D0CA 1NOYA 4M3ZA 4J2EA 2DFEA 1C0TA 2OPSA 4R5PA 4DQRA 1SV5A 4FZXC 4FLTA 4CF1A 1MU2A 1KFSA 2KZZA 5KRSA 1TAUA 4MQ3A 4Z4HA 3D0PA 5JS1A 3ALYA 4AHRA 3NH2A 3LWMA 3AVCA 1RT6A 2EHGA 3U6FA 4AILC 1SL0A 1IG9A 3TABA 4ID5A 3PY8A 4HCBA 3I0SA 1L3TA 2YHBA 4CEBA 4EP5A 2F96A 4O0JA 1HQUA 3O3FA 3ZSRA 2G8FA 4DSKA 1BIZA 1TGOA 3AVNA 5FROA 1KVAA 4OVLA 4FM1A 3AO3A 1VRUA 2XRIA 3ZSOA 3LZJA 4DSJA 3KLFA 5J2MA 3VQDA 2YNFA 2HHTA 3VQ9A 4CJ4A 2Z1GA 3OYEA 2QKKA 4DFKA 1T8EA 1RBTA 3CYMA 4GMJB 4JRPA 3L2VA 4N56A 1S5JA 4KFBA 1UA0A 1KVCA 4CJWA 4Z4CA 1NJYA 3ASMA 2X6NA 4CFAA 4CIGA 1X9WA 4OPKA 4J2BA 3QEIA 1CXQA 5CZ2A 4O5BA 3C6TA 4Y1DA 4LD0A 4DTMA 3SQ4A 1NJXA 1NJWA 1FK9A 3OYMA 3L2RA 2Q3SA 1NK8A 3AVLA 1SKWA 2Z1IA 2PY5A 4KHSA 4W5NA 4FJ7A 1C1BA 3L8BA 3DLHA 1D9DA 3DOLA 1C1AA 3RR7A 2P5OA 1T7PA 1VRTA 1VSJA 4KTWA 3L2WA 2OPQA 4GW6A 2DFHA 4E1NA 4FJLA 4FLXA 1DTTA 4DTPA 4JLHA 4KAZA 3I0RA 4E7LA 3NAEA 2KQ2A 2W42A 1JLAA 1RT2A 3VQBA 4DFMA 3VQEA 3OJUA 4DU1A 3QERA 4F2RA 1WSHA 3LANA 4C8KA 4DSLA 4N41A 4OJRA 2A1SA 1VSIA 3F73A 3CFPA 4CJQA 5HBMA 1VSMA 2QKBA 1X9MA 1TKXA 2ZE2A 3KKRA 3MEGA 5HRNA 4OPJA 4E1MA 4DTXA 3KD5E 1KTQA 3AVHA 4DQQA 2OPRA 3KIOA 1RBSA 3WNHA 4CHYA 4HUEA 1U48A 3K5OA 4DLGA 3SQ0A 1ITGA 1FXXA 5J2PA 2BANA 4CGHA 2X74A 3IS9A 1C0UA 2HNZA 4TSXA 4IKFA 2FBYA 1U45A 1NJZA 1W9HA 2E4LA 1RT5A 3RMCA 4CGDA 2R7YA 3PUFA 4B8AB 1TAQA 1S1WA 3DRSA 4O44A 1ZBIA 1S1UA 4BE2A 3SYZA 3D45A 4B08A 3NH0A 4JS4A 1YTUA 3ZSXA 3K5NA 2G8KA 5J2QA 4AH9A 1LW0A 1S1TA 3KK2A 3C95A 1RNHA 1BHLA 1FKOA 1C0MA 4E0DA 4Z4IA 2FBVA 2IGIA 1WLJA 1BI4B 4B9MA 1O1WA 3ULDA 3AVJA 1WAJA 1U4BA 3QNOA 4FM0A 4HUGA 3L2QA 3AO1A 4NCBA 4CEAA 3V1QA 4Z4GA 3T3FA 3RMBA 1Y97A 2NUBA 3L2UA 3HPGA 4FJHA 3AA5X 3BGRA 4DSIA 4DSFA 4Z0UA 3V1RA 3V9WA 4F3OA 1TVRA 4PUOA 4IDKA 2HNDA 4KPYA 1KCFA 4ZHRA 4B9VA 4DWIA 3VQ6A 4FK2A 4KHUA 4DLEA 4FJXA 3V9ZA 3AO5A 3HM9A 3ZT4A 4FM2A 4CK1A 4KHWA 3HJFA 4E7KA 2DFFA 4NCAA 4GVMA 1NKBA 3HL8A 3KLEA 3MAQA 4DQSA 4H4OA 2X6SA 1NOZA 5HRSA 1QE1A 4L8RB 4DU3A 3PX6A 3VQAA 4AHCA 4CGJA 3KJVA 2XY6A 3SNNA 1JKHA 2HB5A 4CF8A 4ELVA 3G0ZA 4E7IA 3FFIA 4FK0A 2YNHA 1SKRA 3LAMA 4B3OA 1WSJA 1BL3A 4Z4FA 4LSLA 4CJFA 1HYSA 3H08A 2XY8A 4CE9A 1WAFA 4B9UA 4RW8A 3DYAA 2VG7A 1QHTA 2YNGA 1GOAA 4CHOA 1S6PA 1S6QA 2IAJA 3IAYA 1YTAA 4AHUA 3O3GA 4KTQA 3OYAA 2HHWA 4DFJA 2Y1IA 3I8DA 3PX0A 1TL1A 1NK9A 1VSDA 5E41A 1RTDA 4HCCA 1JLFA 3LPUA 2QK9A 3M8QA 1R0AA 2JGUA 4RW6A 4BWMA 4CJ5A 4FJKA 3VQCA 3QIOA 1VK0A 4FCYA 3S3OA 4EZ6A 1VSKA 2FC0A 3KLIA 4CIEA 3AVFA 4LY7A 4CFCA 4HHTA 2YKMA 5D3GA 1TKZA 3NGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK7 A;  2ETJ A;  2HHV A;  4KV8 A;  1RT3 A;  4CGF A;  2D0B A;  4JS5 A;  4EZ9 A;  4QCL A;  3NF9 A;  1RBU A;  3SPY A;  3V9S A;  3DOK A;  3OY9 A;  3UIQ A;  4JRQ A;  4IFV A;  2DY4 A;  3HVT A;  1Z25 A;  1U47 A;  1RCH A;  3DLB A;  1REV A;  4FLW A;  3SJJ A;  5KRT A;  3LAK A;  1NK5 A;  1RDD A;  3OS1 A;  4DU4 A;  4CJK A;  4CES A;  4RW9 A;  4CEQ A;  2HHQ A;  4HUF A;  3TAP A;  4DTR A;  1IKW A;  4FJ8 A;  3VQ8 A;  4C8N A;  1TV6 A;  2F8S A;  4CED A;  3LP1 A;  4O0I A;  1LAV A;  1GOB A;  1QSS A;  4ELT A;  1CZB A;  4KRE A;  3L3U A;  2E6M A;  5HRR A;  4CHP A;  4IG0 A;  3OYG A;  3ZT3 A;  4O4G A;  3HVR A;  2OZS A;  3HT3 A;  1G15 A;  3CM5 A;  2ITG A;  1SKS A;  1W0H A;  1LWC A;  3M8R A;  1NKE A;  4B9S A;  4FZZ A;  3LWL A;  4F3T A;  4KKO A;  1IKX A;  5KGW A;  4BE0 A;  3SI6 A;  4OGC A;  3AVG A;  5I42 A;  2OZM A;  4FVM A;  3DLE A;  2XO7 A;  4IG3 A;  3P1G A;  1CXU A;  1EKE A;  1HMV A;  3AA4 A;  4DMN A;  1RDB A;  2QXF A;  1X9S A;  1DLO A;  4CK2 A;  3RRH A;  1RDA A;  5CZ1 A;  3NF8 A;  1GOC A;  3NCI A;  3PX4 A;  1L3S A;  1S9E A;  4B9T A;  1KSP A;  3KLG A;  3B6P A;  3VQ5 A;  2BGG A;  1RTJ A;  3ZT1 A;  4ZTJ A;  1KLN A;  3LP0 A;  2WOM A;  4AHT A;  1BCM A;  4FK4 A;  1BIU A;  4LSN A;  5CYM A;  4BWJ A;  5SZT A;  2YHA A;  1J9A A;  4WE1 A;  5CYQ A;  1B9F A;  4LH4 A;  1WN7 A;  2OA8 A;  3RR8 A;  1TK0 A;  4M45 A;  3V9U A;  1Q9Y A;  3LPT A;  4CJV A;  2B5J A;  2P5G A;  1NK0 A;  2E6L A;  3KLH A;  4CHZ A;  4CGI A;  3EZ5 A;  4MFB A;  2RF2 A;  4IFY A;  3CQ8 A;  1BCO A;  3QLH A;  4FLU A;  3QEP A;  4J2D A;  1Q9X A;  3OYB A;  1IKV A;  2HHX A;  4FYD A;  5FRM A;  4I7F A;  4NYN A;  4M3X A;  3KD1 E;  4F4K A;  2HVI A;  2ZQB A;  5C42 A;  3WNE A;  3VA3 A;  1IH7 A;  4FJ5 A;  1I3A A;  2KFN A;  2HNY A;  2G8W A;  1HJR A;  2GBZ A;  4B8C A;  4CF9 A;  2AJQ A;  1S1V A;  2FBX A;  3ZCM A;  3WNG A;  3SQ2 A;  1RBV A;  2BE2 A;  4IBN A;  1VSF A;  4H4M A;  4PA1 A;  4FJM A;  1WSG A;  1QS4 A;  1B9D A;  3C94 A;  4M3R A;  5EU7 A;  3ZSQ A;  3OYC A;  3KK1 A;  4CEC A;  1KFD A;  4DTU A;  4OGE A;  2BDP A;  3EYZ A;  4AHV A;  3OYK A;  4CHQ A;  4BDZ A;  4AHS A;  1N5Y A;  1QQC A;  1UWB A;  4CCH A;  3MED A;  1QTM A;  2KZM A;  1RTH A;  1JXE A;  1NK6 A;  1L3V A;  4RW7 A;  4PWD A;  4BAC A;  3SUO A;  1BQM A;  1ZBH A;  3OYD A;  4W5O A;  4CJE A;  1HPZ A;  4C8M A;  4CJR A;  3RWU A;  4FW1 A;  4CJU A;  2OYQ A;  4Z4E A;  4YFU A;  4FLY A;  4C8O A;  3OJS A;  3EY1 A;  2D0A A;  4LH5 A;  4CEE A;  3V9X A;  4I9L A;  3V1O A;  4M42 A;  2YKN A;  5DK5 A;  4CJP A;  3AVI A;  2VWJ A;  2LSN A;  4M41 A;  3KTQ A;  1A5V A;  4CEO A;  3LP2 A;  4YNQ A;  3SV3 A;  3S3M A;  2HVH A;  3S9H A;  3U3G A;  2VWK A;  3QIP A;  5J1E A;  3NE6 A;  2KW4 A;  3CM6 A;  4XIU A;  3BDP A;  1EX4 A;  3IG1 A;  3AVK A;  1U04 A;  4K8X A;  4F2S A;  2JLE A;  4KRF A;  3OYJ A;  1XWL A;  3K59 A;  3VA0 A;  5K14 A;  2O4I A;  1LWF A;  1RTI A;  1LWE A;  4K8Z A;  3ISN C;  1LW2 A;  5HRO A;  1IO2 A;  1X1P A;  1F21 A;  3AA2 A;  1JLQ A;  1TKD A;  2YNI A;  2KFZ A;  4DTN A;  4E19 A;  3QET A;  5HLF A;  3PO4 A;  1Q8I A;  3NF6 A;  3QIN A;  3T1A A;  1XHX A;  1TK8 A;  3LP3 A;  4ZTF A;  2XY5 A;  2D5R A;  3AA3 A;  3O4Q A;  5JS2 A;  3NGZ A;  4QAG A;  1WSI A;  3DMJ A;  1VSL A;  4HTU A;  3K5L A;  3C6U A;  3NGY A;  3CFO A;  1L3U A;  4O55 A;  3DRR A;  1HYV A;  1JLG A;  5SWM A;  3AVM A;  3MEE A;  3OYN A;  3TAM A;  3HST B;  4RG8 A;  4C8L A;  4DSE A;  2KTQ A;  3VQP A;  3F9K A;  3G10 A;  1RT7 A;  2HMI A;  2VG5 A;  4OLA A;  2G8V A;  3DI6 A;  4RW4 A;  1RDC A;  3AVA A;  4DF4 A;  3O3H A;  1QSY A;  4W5T A;  3HPO A;  3SV4 A;  2YV0 X;  4DQI A;  3P5J A;  2G8U A;  4M3W A;  1NKC A;  3E01 A;  3SZ2 A;  4M3Y A;  1BIS A;  1EP4 A;  2IDO A;  3L3V A;  1HRH A;  1ZBF A;  2Z1J A;  4CJ3 A;  3NDK A;  2P1J A;  3K5M A;  2PYJ A;  4OKE A;  2XY7 A;  1JLE A;  3NHG A;  2IC3 A;  3WNF A;  3T19 A;  3NBP A;  1HNI A;  1S1X A;  4FLZ A;  3OYF A;  3P83 D;  1C1C A;  3QES A;  3QNN A;  4CFB A;  3CG7 A;  1A5X A;  4BDP A;  2WON A;  1JLB A;  4CFD A;  4CHN A;  4B9L A;  3VQ7 A;  1CZ9 A;  1WSE A;  3DLR A;  3HYF A;  4KB1 A;  1UAX A;  4Y1C A;  1ZBL A;  1T05 A;  1L5U A;  1EET A;  2EX3 A;  3ZSY A;  4KHY A;  1UA1 A;  2FBT A;  1XC9 A;  3TAG A;  1KRP A;  3A2F A;  3OS0 A;  1FKP A;  1HNV A;  3O4N A;  4CJL A;  4CIF A;  3RTV A;  1UOC A;  1TK5 A;  1J54 A;  1LAW A;  4DTO A;  2Y1J A;  3ZT0 A;  1JL2 A;  4NCG A;  5C24 A;  4N5S A;  2RKI A;  3S3N A;  2F8T A;  2O4G A;  1RIL A;  4ICL A;  2ZD1 A;  3HXM A;  4DS5 A;  4DTJ A;  4FJJ A;  4CJT A;  3QO9 A;  3VQQ A;  1TL3 A;  3RMA A;  3THV A;  3K2P A;  2B6A A;  4N47 A;  4FXD A;  4G1Q A;  4KO0 A;  1BQN A;  3NFA A;  3M8S A;  3TAE A;  3DM2 A;  5I3U A;  5FDL A;  1U49 A;  1T03 A;  1SL2 A;  1YVU A;  4FJG A;  4KHQ A;  3KKS A;  4Q5V A;  4KI6 A;  1BGX T;  2GUI A;  4E7H A;  3DLG A;  3ZSV A;  3HPH A;  3TWH A;  3U3Y A;  2PYL A;  3IRX A;  4NYF A;  4E3S A;  4DTS A;  1XHZ A;  3KK3 A;  3NH1 A;  3JYT A;  3TI0 A;  1BI4 A;  2I5J A;  4I2P A;  3QEV A;  3V4I A;  3TAQ A;  2RPI A;  2X78 A;  2G8I A;  3SQ1 A;  3MEC A;  4DFP A;  4BDY A;  5DMR A;  1VSH A;  5CY4 A;  3CFR A;  2P51 A;  1K6Y A;  5KI6 A;  2XHB A;  3ZSW A;  1ZBU A;  1TKT A;  1RBR A;  3B6O A;  4FJN A;  4OKJ A;  4Q0B A;  2DTU A;  4FZY A;  4N76 A;  3HP9 A;  1D9F A;  2G8H A;  5KGX A;  1LV5 A;  3ITH A;  4E89 A;  1JL1 A;  4CJS A;  1NK4 A;  4W5R A;  2ATQ A;  4M3T A;  4CEZ A;  3PV8 A;  1QSL A;  2Z1H A;  1WNS A;  1VSE A;  2VG6 A;  4CF0 A;  3SUQ A;  3SUN A;  4PY5 A;  3M8P A;  3AVB A;  4KI4 A;  2HHS A;  1JXB A;  1RT4 A;  4EP4 A;  2GV9 A;  3DLK A;  2IS3 A;  2A1R A;  3HO1 A;  3VN5 A;  4PQU A;  3LAL A;  3HK2 A;  3AV9 A;  3MXI A;  4DG1 A;  1HYZ A;  1KVB A;  1C6V A;  1Z26 A;  4ID1 A;  3TR8 A;  3QEW A;  1SL1 A;  4KTZ A;  3OS2 A;  3ZSZ A;  4DS4 A;  4E7J A;  1J53 A;  3SPZ A;  1RT1 A;  5C25 A;  4OLB A;  1KLM A;  5T7B A;  3MXM A;  1ASW A;  2PZS A;  3ZT2 A;  3TAN A;  1B92 A;  3LZI A;  4FJ9 A;  4CGG A;  3V6D A;  4F8R A;  4FLV A;  3VQ4 A;  1N6Q A;  4ELU A;  4J2A A;  3NF7 A;  1D5A A;  1ASU A;  2OPP A;  3TAR A;  3V81 A;  1YT3 A;  4FW2 A;  3PO5 A;  3OYL A;  4KB0 A;  4KHN A;  3LDS A;  3SCX A;  4CK3 A;  5HP1 A;  4FJI A;  4QOZ B;  2HHU A;  4OKK A;  4B9N A;  1A5W A;  4I2Q A;  2B4J A;  3AO4 A;  3K57 A;  1HQE A;  5J2N A;  3RRG A;  5FRN A;  4BE1 A;  3K58 A;  1DTQ A;  3OYI A;  4CEF A;  5HRP A;  3QEX A;  3SUP A;  3OYH A;  3JSM A;  3RMD A;  3MXJ A;  1ZYQ A;  4M3U A;  4H8K A;  2RN2 A;  3TAF A;  2HW3 A;  3OVN A;  4DF8 A;  1CLQ A;  1I39 A;  1S9G A;  3AO2 A;  4HVJ A;  5KTQ A;  4W5Q A;  1J5O A;  3DRP A;  1XI1 A;  1JLC A;  1D8Y A;  4UQG A;  2IOC A;  3HP6 A;  1EXQ A;  1IKY A;  4CF2 A;  4CER A;  4I9Q A;  4DQP A;  1ASV A;  1WSF A;  1SUQ A;  2D0C A;  1NOY A;  4M3Z A;  4J2E A;  2DFE A;  1C0T A;  2OPS A;  4R5P A;  4DQR A;  1SV5 A;  4FZX C;  4FLT A;  4CF1 A;  1MU2 A;  1KFS A;  2KZZ A;  5KRS A;  1TAU A;  4MQ3 A;  4Z4H A;  3D0P A;  5JS1 A;  3ALY A;  4AHR A;  3NH2 A;  3LWM A;  3AVC A;  1RT6 A;  2EHG A;  3U6F A;  4AIL C;  1SL0 A;  1IG9 A;  3TAB A;  4ID5 A;  3PY8 A;  4HCB A;  3I0S A;  1L3T A;  2YHB A;  4CEB A;  4EP5 A;  2F96 A;  4O0J A;  1HQU A;  3O3F A;  3ZSR A;  2G8F A;  4DSK A;  1BIZ A;  1TGO A;  3AVN A;  5FRO A;  1KVA A;  4OVL A;  4FM1 A;  3AO3 A;  1VRU A;  2XRI A;  3ZSO A;  3LZJ A;  4DSJ A;  3KLF A;  5J2M A;  3VQD A;  2YNF A;  2HHT A;  3VQ9 A;  4CJ4 A;  2Z1G A;  3OYE A;  2QKK A;  4DFK A;  1T8E A;  1RBT A;  3CYM A;  4GMJ B;  4JRP A;  3L2V A;  4N56 A;  1S5J A;  4KFB A;  1UA0 A;  1KVC A;  4CJW A;  4Z4C A;  1NJY A;  3ASM A;  2X6N A;  4CFA A;  4CIG A;  1X9W A;  4OPK A;  4J2B A;  3QEI A;  1CXQ A;  5CZ2 A;  4O5B A;  3C6T A;  4Y1D A;  4LD0 A;  4DTM A;  3SQ4 A;  1NJX A;  1NJW A;  1FK9 A;  3OYM A;  3L2R A;  2Q3S A;  1NK8 A;  3AVL A;  1SKW A;  2Z1I A;  2PY5 A;  4KHS A;  4W5N A;  4FJ7 A;  1C1B A;  3L8B A;  3DLH A;  1D9D A;  3DOL A;  1C1A A;  3RR7 A;  2P5O A;  1T7P A;  1VRT A;  1VSJ A;  4KTW A;  3L2W A;  2OPQ A;  4GW6 A;  2DFH A;  4E1N A;  4FJL A;  4FLX A;  1DTT A;  4DTP A;  4JLH A;  4KAZ A;  3I0R A;  4E7L A;  3NAE A;  2KQ2 A;  2W42 A;  1JLA A;  1RT2 A;  3VQB A;  4DFM A;  3VQE A;  3OJU A;  4DU1 A;  3QER A;  4F2R A;  1WSH A;  3LAN A;  4C8K A;  4DSL A;  4N41 A;  4OJR A;  2A1S A;  1VSI A;  3F73 A;  3CFP A;  4CJQ A;  5HBM A;  1VSM A;  2QKB A;  1X9M A;  1TKX A;  2ZE2 A;  3KKR A;  3MEG A;  5HRN A;  4OPJ A;  4E1M A;  4DTX A;  3KD5 E;  1KTQ A;  3AVH A;  4DQQ A;  2OPR A;  3KIO A;  1RBS A;  3WNH A;  4CHY A;  4HUE A;  1U48 A;  3K5O A;  4DLG A;  3SQ0 A;  1ITG A;  1FXX A;  5J2P A;  2BAN A;  4CGH A;  2X74 A;  3IS9 A;  1C0U A;  2HNZ A;  4TSX A;  4IKF A;  2FBY A;  1U45 A;  1NJZ A;  1W9H A;  2E4L A;  1RT5 A;  3RMC A;  4CGD A;  2R7Y A;  3PUF A;  4B8A B;  1TAQ A;  1S1W A;  3DRS A;  4O44 A;  1ZBI A;  1S1U A;  4BE2 A;  3SYZ A;  3D45 A;  4B08 A;  3NH0 A;  4JS4 A;  1YTU A;  3ZSX A;  3K5N A;  2G8K A;  5J2Q A;  4AH9 A;  1LW0 A;  1S1T A;  3KK2 A;  3C95 A;  1RNH A;  1BHL A;  1FKO A;  1C0M A;  4E0D A;  4Z4I A;  2FBV A;  2IGI A;  1WLJ A;  1BI4 B;  4B9M A;  1O1W A;  3ULD A;  3AVJ A;  1WAJ A;  1U4B A;  3QNO A;  4FM0 A;  4HUG A;  3L2Q A;  3AO1 A;  4NCB A;  4CEA A;  3V1Q A;  4Z4G A;  3T3F A;  3RMB A;  1Y97 A;  2NUB A;  3L2U A;  3HPG A;  4FJH A;  3AA5 X;  3BGR A;  4DSI A;  4DSF A;  4Z0U A;  3V1R A;  3V9W A;  4F3O A;  1TVR A;  4PUO A;  4IDK A;  2HND A;  4KPY A;  1KCF A;  4ZHR A;  4B9V A;  4DWI A;  3VQ6 A;  4FK2 A;  4KHU A;  4DLE A;  4FJX A;  3V9Z A;  3AO5 A;  3HM9 A;  3ZT4 A;  4FM2 A;  4CK1 A;  4KHW A;  3HJF A;  4E7K A;  2DFF A;  4NCA A;  4GVM A;  1NKB A;  3HL8 A;  3KLE A;  3MAQ A;  4DQS A;  4H4O A;  2X6S A;  1NOZ A;  5HRS A;  1QE1 A;  4L8R B;  4DU3 A;  3PX6 A;  3VQA A;  4AHC A;  4CGJ A;  3KJV A;  2XY6 A;  3SNN A;  1JKH A;  2HB5 A;  4CF8 A;  4ELV A;  3G0Z A;  4E7I A;  3FFI A;  4FK0 A;  2YNH A;  1SKR A;  3LAM A;  4B3O A;  1WSJ A;  1BL3 A;  4Z4F A;  4LSL A;  4CJF A;  1HYS A;  3H08 A;  2XY8 A;  4CE9 A;  1WAF A;  4B9U A;  4RW8 A;  3DYA A;  2VG7 A;  1QHT A;  2YNG A;  1GOA A;  4CHO A;  1S6P A;  1S6Q A;  2IAJ A;  3IAY A;  1YTA A;  4AHU A;  3O3G A;  4KTQ A;  3OYA A;  2HHW A;  4DFJ A;  2Y1I A;  3I8D A;  3PX0 A;  1TL1 A;  1NK9 A;  1VSD A;  5E41 A;  1RTD A;  4HCC A;  1JLF A;  3LPU A;  2QK9 A;  3M8Q A;  1R0A A;  2JGU A;  4RW6 A;  4BWM A;  4CJ5 A;  4FJK A;  3VQC A;  3QIO A;  1VK0 A;  4FCY A;  3S3O A;  4EZ6 A;  1VSK A;  2FC0 A;  3KLI A;  4CIE A;  3AVF A;  4LY7 A;  4CFC A;  4HHT A;  2YKM A;  5D3G A;  1TKZ A;  3NGI A; 
#chains in the Genus database with same CATH topology
 1HR0 K;  3ZX3 A;  1JCE A;  4KV8 A;  1RT3 A;  3DOK A;  3ATU A;  4IFV A;  4B1Y B;  3DLB A;  3LAK A;  3OS1 A;  4U7B A;  4CES A;  4M7Y A;  4DV4 K;  3MWP A;  1QSS A;  4ELT A;  1CZB A;  2E6M A;  4IG0 A;  1C0G A;  2OAN A;  1FW6 A;  3J80 O;  1LWC A;  3LWL A;  3O08 A;  5I42 A;  1S22 A;  4CZG A;  2XO7 A;  4B1W B;  4MO4 A;  2QXF A;  5MLC Q;  1TUU A;  3HZ6 A;  3NCI A;  1L3S A;  1I94 K;  4B9T A;  2A42 A;  1HKB A;  3VQ5 A;  2QM1 A;  2BGG A;  1RTJ A;  3BZK A;  1S3X A;  4ZTJ A;  1KLN A;  1DKG D;  3I33 A;  5CYM A;  4LSN A;  2YHA A;  1J9A A;  3R3L A;  1WN7 A;  3O6W A;  3RR8 A;  2RE2 A;  3D2E B;  1Q9Y A;  4NXN K;  5M1Q A;  4CJV A;  3QLH A;  2ZWH A;  1NMN A;  4I7F A;  4NYN A;  2HVI A;  3L0Q A;  3VA3 A;  4H5V A;  3O1B A;  4B8C A;  5LMN K;  3VTH A;  1RBV A;  4FJM A;  3OBY A;  3ENO A;  1WSG A;  1QS4 A;  1JJ2 M;  3OYC A;  5EU7 A;  1KFD A;  4OGE A;  1KAZ A;  4BDZ A;  3SLC A;  4CHQ A;  2HHH K;  4AHS A;  1N5Y A;  3D6R A;  1QTM A;  4B3R K;  4BC5 A;  1ZBH A;  4W5O A;  3DWL A;  1HPZ A;  4C8M A;  2GEL A;  3ID6 A;  4JI3 K;  3O9S A;  4YY3 K;  3V9X A;  1M90 O;  4M41 A;  2HVH A;  3LP2 A;  4YNQ A;  3S3M A;  5EX5 A;  2HF4 A;  3U3G A;  4DUY K;  3QIP A;  2KW4 A;  4XIU A;  4PKI A;  3IG1 A;  3K9K A;  3ENH A;  1WUA A;  3N4P A;  5K14 A;  2UUC K;  4NO7 A;  4CZJ A;  2QWL A;  1LWF A;  4M63 C;  4A59 A;  4K8Z A;  4PL8 A;  4YOU A;  1ILY A;  4FPA A;  1IO2 A;  1HNZ K;  2YNI A;  4E19 A;  2YX6 A;  3QET A;  3DXK B;  1XHX A;  4ZTF A;  2XY5 A;  2QWN A;  3EO3 A;  1YI2 N;  3DMJ A;  1OKJ A;  1GLD G;  3C6U A;  1LCU A;  3DRR A;  3VGL A;  3MX2 A;  3OYN A;  2Q31 A;  2KTQ A;  3ZET A;  3G10 A;  1RT7 A;  4OLA A;  5TKY A;  2ZGY A;  1RFQ A;  3C7N A;  3DI6 A;  1ZXO A;  4RW4 A;  2O8E A;  3VER A;  3HPO A;  4DQI A;  4IFE A;  2G8U A;  1HUX A;  1BIS A;  1Q81 O;  3NDK A;  1ZBF A;  4CJ3 A;  3K5M A;  2PYJ A;  1BO5 O;  2P1J A;  4FWP A;  5AR0 A;  4HTL A;  3NHG A;  3NBP A;  1E4F T;  3VOV A;  3KWG A;  5AQY A;  3ULE B;  2QEX N;  4CFB A;  3CG7 A;  1A5X A;  4OX9 K;  5BPM A;  4A61 A;  1BDG A;  1CZ9 A;  1UAX A;  2W40 A;  4M7X A;  1EET A;  4KHY A;  2P9S B;  3CI5 A;  5M1O A;  3TAG A;  3SBG A;  4CJL A;  4CIF A;  3G71 N;  1UOC A;  3CJ1 A;  1LAW A;  1KAY A;  4DTO A;  2Y1J A;  1JL2 A;  3GBT A;  4NCG A;  4WQ5 C;  4DS5 A;  4CJT A;  3VQQ A;  3VEW A;  5GAE P;  1VQO N;  4A5B A;  4YOY A;  5I3U A;  3M6G A;  1SL2 A;  4KHQ A;  2D0O A;  4KI6 A;  4H5N A;  2GEM A;  4JKC A;  4CI6 A;  4PKH A;  3IRX A;  1XMQ K;  3KK3 A;  3QML A;  3NH1 A;  3K0S A;  4I2P A;  3V4I A;  3SQ1 A;  4DFP A;  1DEJ A;  3IMX A;  3A5O C;  5KI6 A;  1ZBU A;  4Q0B A;  1OH7 A;  2G8H A;  1LV5 A;  4W5R A;  3NVK A;  1K8A O;  3SUN A;  4KI4 A;  2HHS A;  3SMS A;  1RT4 A;  3MN7 A;  4Y0W A;  2Q2R A;  2P9K A;  3AV9 A;  1U4B A;  3CJ7 A;  3TR8 A;  3CC2 N;  3QBW A;  4DS4 A;  2OTJ N;  2PZS A;  1X3N A;  4F8R A;  4FLV A;  4JD2 A;  1D5A A;  2NRH A;  4FPB A;  3TAR A;  2HHU A;  5HL7 L;  4B9N A;  3ID8 A;  3TSU A;  2QWM A;  2P9P A;  3AO4 A;  1HQE A;  3RRG A;  1WOQ A;  4IOC L;  4DR4 K;  1QZ6 A;  5HRP A;  5FPN A;  3RMD A;  2FSJ A;  4M3U A;  2JWK A;  3CCQ N;  3U8X A;  1HKC A;  3OVN A;  4JHD B;  3MWT A;  4ILJ A;  1J5O A;  3T1H K;  2YHY A;  2IOC A;  3Q7C A;  1IKY A;  3THY B;  4FO0 A;  1NOY A;  2QWR A;  4DV3 K;  1C0T A;  5C10 A;  2KHO A;  1KFS A;  5KRS A;  4MQ3 A;  5JS1 A;  3NH2 A;  3TAB A;  3PY8 A;  4JAX A;  4RWT A;  4EP5 A;  1GLE G;  3O3F A;  3ZSR A;  1TGO A;  3AVN A;  4OVL A;  4JEP A;  3WQT A;  5J2M A;  2YNF A;  4CJ4 A;  3FE1 A;  2ASM A;  4DFK A;  1RBT A;  3CYM A;  1T8E A;  4IDH A;  4JRP A;  4BRQ A;  3L2V A;  3IUC A;  3FZF A;  3ASM A;  4KH6 A;  1X9W A;  5AZJ A;  1GLC G;  3C6T A;  4LF7 K;  3OYM A;  1VQK N;  4GNI A;  4GVE A;  4FJ7 A;  3PLA A;  4J8F A;  3D2E A;  1VRT A;  3TTD A;  4GW6 A;  4E1N A;  1EWR A;  2CH6 A;  2QI2 A;  1ATR A;  1QHA A;  4B3T K;  2W42 A;  3CF5 L;  3UKR B;  4DU1 A;  3QER A;  1WSH A;  3SJH A;  4RTF D;  3CJC A;  2QA4 N;  1VSM A;  1XQS C;  1NWK A;  3MEG A;  3KD5 E;  4CHY A;  4BY9 C;  4JI4 K;  4DLG A;  5AQS A;  1FXX A;  4PHT X;  2BAN A;  4CGH A;  2X74 A;  3IS9 A;  4L3Q A;  1U45 A;  3RMC A;  4DV7 K;  3TTF A;  4CGD A;  2R7Y A;  1QZ5 A;  4KH5 A;  4CJ7 A;  5C2F A;  3VGK A;  3EN9 A;  4DUZ K;  1ZBI A;  1S1U A;  3A0I X;  4BE2 A;  3E66 A;  1YTU A;  3MX5 A;  3ZSX A;  2P9L B;  2V7Y A;  4AH9 A;  1LW0 A;  3C95 A;  1RNH A;  1BHL A;  4Z4I A;  1BI4 B;  1TKZ A;  3AVJ A;  4FM0 A;  4HUG A;  5GIO A;  3AO1 A;  1HLU A;  3V1Q A;  3J8A A;  3RMB A;  1Y97 A;  4DB3 A;  3J81 O;  2NRX A;  3L2U A;  4FJH A;  3WEE B;  3F5T A;  5CE3 A;  3Q7B A;  3DJC A;  3V1R A;  3H1V X;  1KQS M;  3DXK A;  3FFK B;  4XH4 A;  4FK2 A;  2YHW A;  4GV9 A;  3AO5 A;  3ZT4 A;  4CK1 A;  4DCH A;  4E7K A;  2E2N A;  5AFU A;  4H4O A;  1NOZ A;  1QE1 A;  3KJV A;  1JKH A;  2D1K A;  2HB5 A;  4ELV A;  1K8K A;  3DLL L;  3VTI A;  2YNH A;  4IJA A;  3LAM A;  4FOI A;  4CJF A;  3WQU A;  2A6A A;  3DYA A;  3LDO A;  1QHT A;  3CXC M;  2IAJ A;  3OYA A;  1KAX A;  4DFJ A;  2WTU A;  3PX0 A;  3BEX A;  4GV6 A;  5F2R A;  3KWI A;  5E41 A;  3HSC A;  3M8Q A;  3ULE A;  3P4I A;  2OCE A;  5AQG A;  2KKZ A;  3S3O A;  3AVF A;  3PSI A;  1W7A A;  3I56 N;  2P9S A;  1NK7 A;  2HHV A;  4BQZ A;  4JS5 A;  4CGF A;  2D0B A;  3NF9 A;  1RBU A;  4IXC A;  3GL1 A;  1U47 A;  2A40 A;  5FPD A;  4FLW A;  3SJJ A;  4RW9 A;  2HHQ A;  3MCA B;  3TAP A;  3KVG A;  1GLF O;  4FJ8 A;  3E9P A;  3LP1 A;  4O0I A;  1LAV A;  1GOB A;  4IEI A;  2P9N B;  3L3U A;  5HRR A;  3OYG A;  4E1J A;  4O4G A;  3HVR A;  4CBX A;  4F3T A;  4BRA A;  1T6D A;  3DLE A;  4IG3 A;  1EKE A;  3TSQ A;  4JKE A;  4FSV A;  3PX4 A;  2VWB A;  4JI7 K;  3D2F A;  1S9E A;  3F2K A;  3KLG A;  4GY2 B;  1YAG A;  3ZT1 A;  5LJV A;  4AHT A;  1XNQ K;  1BIU A;  4BWJ A;  5SZT A;  2HOE A;  3CD6 N;  5EXW A;  1B9F A;  2VGN A;  4QS9 A;  2QXL A;  5E26 A;  2OA8 A;  3V9U A;  3LPT A;  2P5G A;  2E6L A;  3CQ8 A;  1BCO A;  4FLU A;  1W97 L;  1IKV A;  3O9Q A;  4BG9 A;  4F4K A;  2O8F B;  4FJ5 A;  1IH7 A;  3HM8 A;  3F9M A;  4H0T B;  2KFN A;  3CC4 N;  2ZM6 K;  4LFA K;  2AJQ A;  3CIP A;  2FBX A;  3ZCM A;  2BE2 A;  1VSF A;  3HOT A;  4PA1 A;  3ZSQ A;  4Z4E A;  1B9D A;  4CEC A;  4DTU A;  4AHV A;  5BPL A;  4FL9 A;  5IWA K;  1UWB A;  3MED A;  1Y64 A;  1RTH A;  1JXE A;  1NK6 A;  4BAC A;  3CET A;  4JHD A;  3SUO A;  3OYD A;  4CJE A;  1FJG K;  3SMP A;  1BOT O;  4FW1 A;  4CJU A;  1OVY A;  4KBO A;  3OJS A;  5KQD A;  2D0A A;  3THY A;  4BRM A;  3R6M A;  3VF2 A;  4CJP A;  3KTQ A;  2NRW A;  3C65 A;  1HNX K;  4CW7 B;  3S9H A;  1VQL N;  2VWK A;  5FPE A;  5J1E A;  3AAQ A;  3FZH A;  4YOX A;  1EX4 A;  5HOO A;  3K59 A;  1XWL A;  1H1V A;  2O4I A;  1NLV A;  1RTI A;  3P38 A;  4BG8 A;  3SAH A;  1OH5 A;  1X1P A;  3VEZ A;  1EQY A;  3HI0 A;  1JLQ A;  4DTN A;  4CBU A;  3PO4 A;  1TK8 A;  3VEN A;  4EAH D;  3AA3 A;  5JS2 A;  3O4Q A;  4FWN A;  4BR2 A;  3PIO L;  1L3U A;  4BRD A;  1HYV A;  3AVM A;  1OH8 A;  4LF8 K;  3SAG A;  3CMA N;  2F9W A;  4B1V A;  1RDC A;  2A5X A;  4CZK A;  4DF4 A;  1QSY A;  4W5T A;  4CVN E;  1ZBS A;  2HBL A;  4MLE A;  1NKC A;  1BUP A;  3LDN A;  2W41 A;  4M3Y A;  2IDO A;  2Z1J A;  3U4L A;  5C15 A;  1IBM K;  3CME N;  3WNF A;  4NLC A;  1HNI A;  1VHX A;  3QIC A;  2WON A;  1JLB A;  4CZI A;  4CHN A;  3UKR A;  1WSE A;  4BGB A;  5BPN A;  3D7E O;  2HF3 A;  3R1X A;  4B1Z A;  1J6Z A;  3NMU A;  1UA1 A;  1XC9 A;  2NZT A;  3WUH A;  3RTV A;  1J54 A;  1NM1 A;  2RKI A;  4LF9 K;  4H5T A;  2O4G A;  4ICL A;  3HXM A;  2ZD1 A;  4QCL A;  4FJJ A;  1Q7Y O;  3QO9 A;  1TL3 A;  4DV1 K;  1G99 A;  4WCE L;  1T03 A;  4QS7 A;  3IKM A;  4NB4 A;  1NGJ A;  4F9O A;  2P9L A;  2UXB K;  3HPH A;  2PYL A;  4NYF A;  3THW B;  1NG9 A;  1VQ8 N;  1BI4 A;  2I5J A;  1Q18 A;  3TAQ A;  4X66 K;  4JKG B;  2YHX A;  4BDY A;  5DMR A;  2P51 A;  1K6Y A;  2XHB A;  4BRK A;  1TKT A;  4FJN A;  4OKJ A;  5AQI A;  3CCU N;  4GKK K;  5KGX A;  3ITH A;  4E89 A;  1JL1 A;  3WEE A;  1DT9 A;  1ESV A;  3PV8 A;  1QSL A;  4M3T A;  2D4W A;  1WNS A;  2VG6 A;  4PY5 A;  1JXB A;  1KXP A;  2UUA K;  4BR7 A;  2IS3 A;  3VN5 A;  4DG1 A;  1HYZ A;  5LL6 Z;  4ID1 A;  4A2A A;  4FVU A;  3ZSZ A;  3ENB A;  2F4V K;  1SAZ A;  4E7J A;  2RHK A;  3H1Q A;  3SPZ A;  4JKF A;  4FWM A;  1RT1 A;  5C25 A;  4BC3 A;  4BVP A;  4CZM A;  4JI5 K;  3LM9 A;  2IVN A;  1N6Q A;  1ASU A;  3V81 A;  2FXU A;  1VQN N;  4I6M B;  4JI2 K;  5IT9 O;  3O4W A;  3P39 A;  1YJN N;  2KLA A;  4CEF A;  3CPW M;  3SUP A;  3JSM A;  3MXJ A;  3SBT A;  4DF8 A;  1CLQ A;  3A5L C;  3AO2 A;  2Q1N A;  1JLC A;  1D8Y A;  4BRH A;  3HP6 A;  1ASV A;  1WSF A;  4M3Z A;  3E9L A;  4R5P A;  4DQR A;  1SV5 A;  2J4R A;  4FLT A;  3ALY A;  4AHR A;  3UB5 A;  3LWM A;  4HCB A;  4DR6 K;  2E20 A;  2FSN A;  2F96 A;  4B1U B;  3MMV A;  1ZC6 A;  3MK6 A;  1BIZ A;  3CQY A;  1VQ4 N;  1RDU A;  4LFB K;  3AO3 A;  3LZJ A;  2XRI A;  2V7Z A;  5GAH P;  4O5F A;  2GWJ A;  3AGR A;  3KHY A;  1UA0 A;  5ADX A;  4Z4C A;  4CD1 A;  1WBD A;  5JMV A;  1NGE A;  1O13 A;  5E84 A;  4K25 A;  4OPK A;  3QEI A;  1CXQ A;  4BRE A;  1M1K O;  4DTM A;  2E8A A;  4LD0 A;  1NJX A;  3FZK A;  1FK9 A;  3L2R A;  4YDU A;  2PY5 A;  5AQQ A;  3AVL A;  1C1B A;  3CCS N;  3DLH A;  1D9D A;  3DOL A;  3I55 N;  3RR7 A;  2P5O A;  3OTO K;  1VSJ A;  3L2W A;  2DFH A;  5EY4 A;  1DTT A;  1IBL K;  4DTP A;  2O8F A;  1GLJ O;  1RT2 A;  3VQE A;  2O8B B;  4F2R A;  1N36 K;  3LAN A;  4DSL A;  3CFP A;  4CJQ A;  1TKX A;  2ITM A;  5HRN A;  4E1M A;  1MA9 B;  2E2Q A;  2OPR A;  2BH1 A;  3KIO A;  1U48 A;  1QVG M;  3RVC A;  4TSX A;  2E4L A;  1RT5 A;  1JCF A;  4LC9 B;  1TAQ A;  3DRS A;  1QQM A;  4O44 A;  4DKW A;  4B08 A;  3OBW A;  2A3Z A;  3KK2 A;  3VEX A;  1C0M A;  4QS8 A;  2FBV A;  2IGI A;  2FLO A;  3JXU A;  2I7N A;  3QNO A;  3ATV A;  2Q0R A;  4NCB A;  1SZ2 A;  3DAW A;  2NUB A;  3HPG A;  3AA5 X;  4Z0U A;  2VCP A;  4F3O A;  4PUO A;  4ZHR A;  3V9Z A;  3FZL A;  4NCA A;  3KLE A;  3MAQ A;  4Z94 A;  1GLA G;  1T44 A;  4CF8 A;  5I9E B;  4B3O A;  1N33 K;  4IO8 A;  1V4T A;  2XY8 A;  2W6K A;  2YNG A;  4CHO A;  1TUY A;  4AHU A;  4KTQ A;  1BU6 O;  1TL1 A;  3MDQ A;  3CJB A;  1U2V B;  1RDW X;  1WBB A;  4BWM A;  3VQC A;  1NMD A;  3CJ9 A;  4CZF A;  2P9I B;  3KLI A;  4EIA A;  1N32 K;  4HHT A;  4DR1 K;  1VQ9 N;  1RGI A;  2YKM A;  3AY9 A;  5AQF A;  2HST A;  3QB0 A;  3EEQ A;  4IOA L;  4EZ9 A;  2NNW A;  1Z6R A;  1SS6 A;  4OPH A;  3OY9 A;  3H46 O;  3WXI A;  5AJ3 K;  4RCH A;  1Z25 A;  2Q36 A;  5JLH A;  1QVF M;  4WYB A;  1REV A;  5A2Q O;  5KRT A;  1RDD A;  3CC7 N;  4CJK A;  4DTR A;  3VQ8 A;  2CGL A;  1TV6 A;  4A57 A;  3G6E N;  3VEO A;  2IVO A;  2OZS A;  3CM5 A;  3THW A;  3K9J A;  4B9S A;  1N34 K;  4FZZ A;  1IKX A;  5KGW A;  4BE0 A;  4OGC A;  2HBJ A;  3AVG A;  4JKG A;  2OZM A;  1CXU A;  1HMV A;  3AA4 A;  3MN5 A;  4C1N I;  3RRH A;  4H5W A;  1RDA A;  2CGK A;  1GOC A;  4DR5 K;  1KSP A;  4ISE A;  3LP0 A;  2WOM A;  4K43 A;  3M1F A;  3GE1 A;  5BRH A;  4BRF A;  5CYQ A;  5AQH A;  3VF6 A;  3THX B;  4V19 S;  4LH4 A;  5AQL A;  3KLH A;  4CGI A;  3QEP A;  2RF2 A;  4IFY A;  1Q9X A;  2HHX A;  3H6E A;  1OH6 A;  4H03 B;  5FRM A;  3VMF B;  2ZQB A;  5C42 A;  4X65 K;  2G8W A;  2GBZ A;  3U9Z A;  4CF9 A;  4IBN A;  4H4M A;  4M3R A;  3C94 A;  3KK1 A;  1C0F A;  2O8D B;  4U67 L;  4DV0 K;  3OYK A;  1YJ9 N;  4CCH A;  3EL2 A;  2KZM A;  4RW7 A;  4PWD A;  1HJO A;  4H5R A;  1BQM A;  3TPQ A;  3PIP L;  4CEE A;  4M42 A;  5DK5 A;  3AVI A;  2VWJ A;  1NNE A;  4UY8 O;  5KPZ A;  3CM6 A;  3BDP A;  4CZL A;  3HOS A;  4KRF A;  3FZM A;  3VA0 A;  3VF4 A;  1LWE A;  2PFU A;  4WQ4 A;  3ISN C;  5HRO A;  3J7Y P;  5F0X A;  1GLB G;  3NF6 A;  3QIN A;  3T1A A;  3IFR A;  3LP3 A;  2D5R A;  3B8A X;  2YJE A;  4BR4 A;  1WSI A;  1VSL A;  4HTU A;  4IJN A;  3K5L A;  5M1K A;  3CFO A;  4O55 A;  5SWM A;  3O9T A;  2GUP A;  3MEE A;  3TAM A;  4C8L A;  4DSE A;  4H0O A;  1KD1 O;  2QTD A;  3F9K A;  2HMI A;  1MWM A;  5AQM A;  2G8V A;  4JK7 A;  3AVA A;  5LJW A;  2YCH A;  3O3H A;  2GX9 A;  3SV4 A;  4M3W A;  2YJF A;  3L3V A;  2HBM A;  4GKJ K;  1K9M O;  2XY7 A;  1JLE A;  2CGJ A;  2IC3 A;  3CPE A;  3VEY A;  2V51 B;  4FLZ A;  3CQX A;  3P83 D;  3QNN A;  3R8E A;  4CFD A;  4B9L A;  3VQ7 A;  3DLR A;  4KB1 A;  4Y1C A;  1ZBL A;  1T05 A;  3ZSY A;  3ZX0 A;  1X9J A;  4JKB A;  3A2F A;  4AM6 A;  3OS0 A;  1FKP A;  1HNV A;  3G25 A;  3LDL A;  3O4N A;  4EHT A;  1TK5 A;  3C7N B;  4N5S A;  3EE8 A;  4DTJ A;  4YOW A;  3RMA A;  2B6A A;  3E9O A;  4G1Q A;  3BF3 A;  4KO0 A;  5AQX A;  1BQN A;  3NFA A;  3DM2 A;  5FDL A;  4Q5V A;  5AQK A;  5AQO A;  2GWK A;  3DLG A;  3M3Z A;  3CER A;  4CZH A;  1P8Z A;  4YDU C;  4E3S A;  4YOT A;  4A2B A;  2AP1 A;  4ISG A;  2H3G X;  2RPI A;  4EFH A;  2X78 A;  2G8I A;  3MEC A;  1VSH A;  1BG3 A;  1NBW A;  1VQP N;  5CR4 A;  2NRZ A;  3ZSW A;  3B6O A;  2DTU A;  1OVQ A;  5AQU A;  2UXC K;  1D9F A;  1NK4 A;  4XH5 A;  4CEZ A;  3O8M A;  2Z1H A;  5TKW A;  1VSE A;  3S41 A;  3M8P A;  3J7A P;  3AAR A;  3MN6 A;  4EP4 A;  3C6A A;  2GV9 A;  3EZW A;  2A1R A;  4AM7 A;  4PQU A;  3LAL A;  1C6V A;  3QEW A;  1NGG A;  3M5R A;  4IOX A;  2E1Z A;  5AZI B;  3KZB A;  4OLB A;  4KHP K;  1KLM A;  1VQ5 N;  5M1P A;  1ASW A;  1B92 A;  5AQP A;  4BRP A;  3V6D A;  3VQ4 A;  4ELU A;  4J2A A;  3NF7 A;  4C1N K;  2OPP A;  2YI1 A;  1YT3 A;  2F9T A;  4FW2 A;  3ZYY X;  3PO5 A;  1U6Z A;  4KHN A;  3LDS A;  2JWL A;  4ILG B;  3K57 A;  2FF6 A;  5FRN A;  4BE1 A;  3OYI A;  1HX1 A;  2P9I A;  4DV5 K;  2QWQ A;  3DXM B;  5EOY A;  3QFU A;  4YOV A;  2RN2 A;  3TAF A;  1S9G A;  4K42 A;  4JI1 K;  5KTQ A;  4CF2 A;  2BUP A;  4CER A;  1Q82 O;  4I9Q A;  1SUQ A;  2D0C A;  4FOE A;  5C0Y A;  1MU2 A;  2KZZ A;  3GDQ A;  4Z4H A;  1IG9 A;  3AVC A;  4AIL C;  1HNW K;  4ID5 A;  3I0S A;  1L3T A;  2YHB A;  3TU5 A;  4O0J A;  2ZGZ A;  1NGF A;  5KQ8 A;  3O5B A;  1KC8 O;  4H0X B;  3GG4 A;  1NGI A;  1BA1 A;  2ZF5 O;  5M1F A;  4DSJ A;  2Z1G A;  3OYE A;  1VQ7 N;  2QKK A;  1HPM A;  4GMJ B;  4FWR A;  4NXM K;  4KFB A;  1KVC A;  1NJY A;  2X6N A;  5AFU H;  4CIG A;  2VQE K;  4Y1D A;  5BRE A;  1NGB A;  1WB9 A;  2Q3S A;  1NK8 A;  3E1Y A;  4KHS A;  4W5N A;  3THX A;  1D4X A;  2E1Y A;  1T7P A;  3CJA A;  5AQJ A;  2OPQ A;  4FJL A;  1XMO K;  3ZLJ A;  4DQ8 A;  4KAZ A;  3I0R A;  2KQ2 A;  3VQB A;  3FLC O;  3JS6 A;  5DM7 L;  1IJJ A;  4YHH K;  4C8K A;  2P9U B;  4N41 A;  1EO1 A;  5FLX O;  3F73 A;  5HBM A;  1Z05 A;  2D0P A;  2QKB A;  1X9M A;  5AZJ B;  3KKR A;  2ZJR L;  1N8R O;  3G4S N;  2O8D A;  1RBS A;  3WNH A;  3LM2 A;  4HUE A;  3K5O A;  3UKU B;  1ITG A;  2HNZ A;  1NJZ A;  1W9H A;  4CBW A;  3PUF A;  4B8A B;  3A8Y A;  1NGD A;  1W2B M;  2UUB K;  4JK9 A;  3SYZ A;  3D45 A;  4JS4 A;  2G8K A;  1YVN A;  2NRV A;  5KPR A;  1FKO A;  4E0D A;  4BRL A;  1WLJ A;  4B9M A;  1O1W A;  5ELZ A;  1WAJ A;  3ZX2 A;  1XUP O;  3L2Q A;  3WT0 A;  1V4S A;  3LDQ A;  3O9U A;  4JI0 K;  3PSF A;  2ZJP L;  3TTC A;  2HND A;  4KPY A;  2PBD A;  4DWI A;  3L4Q A;  3VQ6 A;  3AAP A;  5KPT A;  3HM9 A;  4FM2 A;  3HJF A;  4BVO A;  3HL8 A;  5CHI A;  2X6S A;  4AHC A;  4CGJ A;  3SNN A;  2XY6 A;  5F1X A;  4JKA A;  3FR0 A;  4E7I A;  3FFI A;  4FK0 A;  2VYP A;  3BUZ B;  3ZEU B;  1BL3 A;  1HYS A;  4CZE A;  1WAF A;  3C0B A;  4RW8 A;  2VG7 A;  1S6P A;  1S6Q A;  3EKU A;  4JKD A;  2NRT A;  2HHW A;  2Y1I A;  3I8D A;  1CZA N;  1VSD A;  1RTD A;  4HCC A;  1JLF A;  2P9N A;  3WXK A;  2QK9 A;  4MDB A;  1VK0 A;  4BRC A;  1VSK A;  4FWK A;  4CFC A;  4FWO A;  5D3G A;  3NGI A;  2F7T A;  4WQ4 C;  3CCR N;  2ETJ A;  3SPY A;  3UIQ A;  3V9S A;  1K8K B;  4JRQ A;  2DY4 A;  3HVT A;  1RCH A;  4GV3 A;  1NK5 A;  4DU4 A;  4ILH A;  4O8K A;  4DR3 K;  4MLH A;  4CEQ A;  4HUF A;  4BGA A;  1IKW A;  1S72 N;  4C8N A;  2F8S A;  3CCJ N;  4CED A;  3SAF A;  4CHP A;  3ZT3 A;  1QQN A;  1VQM N;  5DM6 L;  3HT3 A;  1G15 A;  1SKS A;  2ITG A;  1W0H A;  3M8R A;  1NKE A;  4KKO A;  3SI6 A;  4K41 A;  4FVM A;  3P1G A;  4B9Q A;  4X62 K;  4DMN A;  1RDB A;  3I8B A;  1X9S A;  3MN9 A;  1DLO A;  4CK2 A;  5GAG P;  5CZ1 A;  3NF8 A;  3A5M C;  5BRD A;  1MWK A;  3T69 A;  1MDU B;  3B6P A;  3HTV A;  5C2D A;  3RSE B;  4FK4 A;  1BCM A;  4JNE A;  1LOT B;  4WE1 A;  1NGH A;  3OHR A;  3QBX A;  1TK0 A;  4M45 A;  5AZI A;  2B5J A;  2HBK A;  1NK0 A;  5HP1 A;  4CHZ A;  3EZ5 A;  4MFB A;  4J2D A;  3OYB A;  4FYD A;  4M3X A;  3KD1 E;  3WNE A;  1I3A A;  2O8C B;  3T1Y K;  2HNY A;  3D2F B;  1HJR A;  3CCM N;  1S1V A;  3BF1 A;  2E2O A;  3WNG A;  3SQ2 A;  1J5E K;  4L8R B;  4KRE A;  2BDP A;  1SQK A;  3EYZ A;  2W6L A;  4LFC K;  3DXM A;  4BR9 A;  1QQC A;  1P90 A;  5LMU K;  2BTF A;  4AF1 A;  2IIR A;  2ZJQ L;  1L3V A;  4BQL A;  3HRG A;  3BP8 A;  4H0P A;  1X3M A;  4CJR A;  3RWU A;  3O80 A;  2OYQ A;  4YFU A;  4FLY A;  4C8O A;  3L4I A;  3EY1 A;  1YXQ A;  3R9P A;  4LH5 A;  3N4Q A;  4I9L A;  3V1O A;  2YKN A;  4FWQ A;  2LSN A;  1QQO A;  1NGA A;  1A5V A;  4CEO A;  4DV2 K;  3SV3 A;  4A5A A;  3H3O B;  3NE6 A;  1NJI O;  3AVK A;  1ATS A;  1U04 A;  4K8X A;  4F2S A;  2JLE A;  2NLX A;  4WF9 L;  3OYJ A;  4DHY A;  1LW2 A;  5AQT A;  1F21 A;  3AA2 A;  1TKD A;  4B3S K;  2UU9 K;  2KFZ A;  5HLF A;  1Q8I A;  2E2P A;  1NGC A;  3SK3 A;  3NGZ A;  4QAG A;  2A41 A;  2IVP A;  1IV0 A;  3NGY A;  4X64 K;  1JLG A;  4MO5 A;  3HST B;  4RG8 A;  5B8H A;  3VQP A;  5JLF A;  2VG5 A;  1YJW N;  1TYQ B;  2YV0 X;  3P5J A;  4C23 A;  3CCE N;  3E01 A;  4H0V B;  3SZ2 A;  1EP4 A;  4PL7 A;  1HRH A;  4FWS A;  4O8U A;  2UYT A;  3KK7 A;  3T19 A;  2CH5 A;  3CHW A;  1S1X A;  3W3D A;  4BC2 A;  3OYF A;  3NVM A;  1VAZ A;  1C1C A;  3QES A;  4LF4 K;  5FPM A;  4CD3 A;  4BDP A;  4LF5 K;  4WFB L;  3VEV A;  2V52 B;  3J7Z O;  2GTD A;  4XH1 A;  2P9U A;  3HYF A;  4R79 A;  4DR7 K;  1L5U A;  2EX3 A;  1BWF O;  2FBT A;  4OPA A;  3L6Q A;  2ASO A;  1KRP A;  2E88 A;  3S3N A;  3ZT0 A;  5C24 A;  3UKU A;  2F8T A;  2AA4 A;  2OTL N;  2FF3 B;  1RIL A;  4WFA L;  4FXD A;  3THV A;  3K2P A;  4N47 A;  4AQY K;  3M8S A;  3TAE A;  2WFB A;  5M1N A;  1U49 A;  4FJG A;  3CCL N;  1YVU A;  5BRF A;  2I7P A;  3KKS A;  1BGX T;  2GUI A;  4E7H A;  3ZSV A;  3TWH A;  3U3Y A;  4DTS A;  1XHZ A;  3QFP A;  3JYT A;  3TI0 A;  3QEV A;  1HKG A;  5C12 A;  4HWI A;  5CY4 A;  4JN4 A;  3CFR A;  1RBR A;  3BZC A;  4FZY A;  4N76 A;  3HP9 A;  1YF5 L;  4CJS A;  2ATQ A;  2QWO A;  4I6M A;  4BR0 A;  5ADX H;  4IO9 L;  4CF0 A;  3SUQ A;  3AVB A;  3DLK A;  1DGK N;  1R59 O;  1EWQ A;  3HO1 A;  3T7Z A;  3HK2 A;  3MXI A;  1KVB A;  1Z26 A;  5AQV A;  1SL1 A;  4KTZ A;  3OS2 A;  3JAM O;  1YIJ N;  1J53 A;  2VQF K;  3O9R A;  5T7B A;  3AGK A;  3MXM A;  3ZEU A;  3ZT2 A;  3TAN A;  2WBN A;  1T6C A;  4EHU A;  3LZI A;  4FJ9 A;  4CGG A;  3IDH A;  5JVG L;  3LL3 A;  3OYL A;  4KB0 A;  2DPN A;  3SCX A;  4CK3 A;  4FJI A;  4QOZ B;  3VES A;  3BY5 A;  4OKK A;  5GIP A;  1A5W A;  4I2Q A;  2B4J A;  5J2N A;  4JV5 K;  3TSP A;  3K58 A;  1DTQ A;  3MCP A;  3GOI A;  4DV6 K;  3QEX A;  3W0L A;  2VGM A;  5BN9 A;  3OYH A;  1ZYQ A;  2HMP A;  4H8K A;  3WXL A;  2HW3 A;  3WXM B;  3UE5 A;  5BR9 A;  4JYA K;  1I39 A;  3OA9 A;  4BRI A;  4HVJ A;  4W5Q A;  3LDP A;  3DRP A;  4B3M K;  1XI1 A;  4UQG A;  4FWL A;  1EXQ A;  4DQP A;  5AQN A;  4J2E A;  2DFE A;  2OPS A;  4FZX C;  4BC4 A;  4CF1 A;  1TAU A;  3H3N O;  3D0P A;  5H1S Q;  3U6F A;  4KH4 A;  2WC9 A;  1RT6 A;  2EHG A;  1SL0 A;  4H0Y B;  4CEB A;  4B1X B;  1HQU A;  4DSK A;  2G8F A;  3EE9 A;  5FRO A;  1KVA A;  4FM1 A;  1VRU A;  3ZSO A;  4BRN A;  3KLF A;  3VQD A;  2HHT A;  3VQ9 A;  4JK8 A;  4WQ5 A;  2O8B A;  4JKH A;  5EVZ A;  4N56 A;  1S5J A;  5GIN A;  4CJW A;  4CFA A;  4ISF A;  2NRR A;  3ZET B;  4J2B A;  5CZ2 A;  4O5B A;  3RSE A;  3SQ4 A;  4MDA A;  1T3V A;  1NJW A;  2O8E B;  1SKW A;  2Z1I A;  5LY3 A;  3L8B A;  4DR2 K;  1IG8 A;  1C1A A;  4KTW A;  2E5L K;  3WXJ A;  4FLX A;  4JLH A;  4E7L A;  3NAE A;  1JLA A;  4DFM A;  1E3M A;  4JI8 K;  3OJU A;  5AQR A;  2O8C A;  1E4G T;  5AQW A;  1VQ6 N;  1YUW A;  5BR8 K;  4OJR A;  2A1S A;  1VSI A;  1GLL O;  3VPZ A;  2ZE2 A;  4DTX A;  4OPJ A;  1KTQ A;  3AVH A;  4DQQ A;  2EWS A;  2QW9 A;  4IWV A;  1BA0 A;  4YOR A;  3SQ0 A;  5J2P A;  1XC3 A;  4BRO A;  1C0U A;  4IKF A;  2FBY A;  3U9D A;  2ASP A;  1JCG A;  1S1W A;  5BN8 A;  2QWP A;  2Q97 A;  4BR5 A;  2FSK A;  3NH0 A;  4XEI A;  3K5N A;  5J2Q A;  4LF6 K;  1S1T A;  5JIC A;  1YHQ N;  3ULD A;  1K73 O;  3OW2 M;  4PKG A;  4CEA A;  4Z4G A;  3T3F A;  3FGU A;  5GAD P;  3BGR A;  4DSI A;  5JVH L;  4DSF A;  3V9W A;  2UXD K;  1TVR A;  4JI6 K;  4IDK A;  4BRG A;  2WUS A;  1U2V A;  1KCF A;  3QDK A;  4B9V A;  4KHU A;  4DLE A;  3C6H A;  4FJX A;  4K0K K;  4G9Z A;  1Q86 O;  4KHW A;  2P9K B;  2DFF A;  1XNR K;  4GVM A;  1NKB A;  4DQS A;  2PAV A;  5HRS A;  4DU3 A;  3PX6 A;  3VQA A;  3HBT A;  3G0Z A;  4IZ9 A;  3VET A;  4OO1 J;  4NLB A;  5AQZ A;  1IBK K;  3EKS A;  1SKR A;  1YIT N;  1WSJ A;  4Z4F A;  4LSL A;  1TYQ A;  3H08 A;  4CE9 A;  4B9U A;  3P31 A;  4JD2 B;  1GOA A;  3IAY A;  1ATN A;  3A5N C;  1YTA A;  3O3G A;  3H45 C;  4WFN L;  1NK9 A;  2Q0U A;  3LPU A;  2P9P B;  1R0A A;  3O1W A;  2JGU A;  4RW6 A;  3VGM A;  4CJ5 A;  4FJK A;  4EZ6 A;  3QIO A;  4FCY A;  4A62 A;  1NU0 A;  2FC0 A;  4CIE A;  4LY7 A;  4IEE A;  3CCV N;  4OKE A; 
#chains in the Genus database with same CATH homology
 1NK7 A;  2ETJ A;  2HHV A;  4KV8 A;  1RT3 A;  4CGF A;  2D0B A;  4JS5 A;  4EZ9 A;  4QCL A;  3NF9 A;  1RBU A;  3SPY A;  3V9S A;  3DOK A;  3OY9 A;  3UIQ A;  4JRQ A;  4IFV A;  2DY4 A;  3HVT A;  1Z25 A;  1U47 A;  1RCH A;  3DLB A;  1REV A;  4FLW A;  3SJJ A;  5KRT A;  3LAK A;  1NK5 A;  1RDD A;  3OS1 A;  4DU4 A;  4CJK A;  4CES A;  4RW9 A;  4CEQ A;  2HHQ A;  4HUF A;  3TAP A;  4DTR A;  1IKW A;  4FJ8 A;  3VQ8 A;  4C8N A;  1TV6 A;  2F8S A;  4CED A;  3LP1 A;  4O0I A;  1LAV A;  1GOB A;  1QSS A;  4ELT A;  1CZB A;  4KRE A;  3L3U A;  2E6M A;  5HRR A;  4CHP A;  4IG0 A;  3OYG A;  3ZT3 A;  4O4G A;  3HVR A;  2OZS A;  3HT3 A;  1G15 A;  3CM5 A;  2ITG A;  1SKS A;  1W0H A;  1LWC A;  3M8R A;  1NKE A;  4B9S A;  4FZZ A;  3LWL A;  4F3T A;  4KKO A;  1IKX A;  5KGW A;  4BE0 A;  3SI6 A;  4OGC A;  3AVG A;  5I42 A;  2OZM A;  4FVM A;  3DLE A;  2XO7 A;  4IG3 A;  3P1G A;  1CXU A;  1EKE A;  1HMV A;  3AA4 A;  4DMN A;  1RDB A;  2QXF A;  1X9S A;  1DLO A;  4CK2 A;  3RRH A;  1RDA A;  5CZ1 A;  3NF8 A;  1GOC A;  3NCI A;  3PX4 A;  1L3S A;  1S9E A;  4B9T A;  1KSP A;  3KLG A;  3B6P A;  3VQ5 A;  2BGG A;  1RTJ A;  3ZT1 A;  4ZTJ A;  1KLN A;  3LP0 A;  2WOM A;  4AHT A;  1BCM A;  4FK4 A;  1BIU A;  4LSN A;  5CYM A;  4BWJ A;  5SZT A;  2YHA A;  1J9A A;  4WE1 A;  5CYQ A;  1B9F A;  4LH4 A;  1WN7 A;  2OA8 A;  3RR8 A;  1TK0 A;  4M45 A;  3V9U A;  1Q9Y A;  3LPT A;  4CJV A;  2B5J A;  2P5G A;  1NK0 A;  2E6L A;  3KLH A;  4CHZ A;  4CGI A;  3EZ5 A;  4MFB A;  2RF2 A;  4IFY A;  3CQ8 A;  1BCO A;  3QLH A;  4FLU A;  3QEP A;  4J2D A;  1Q9X A;  3OYB A;  1IKV A;  2HHX A;  4FYD A;  5FRM A;  4I7F A;  4NYN A;  4M3X A;  3KD1 E;  4F4K A;  2HVI A;  2ZQB A;  5C42 A;  3WNE A;  3VA3 A;  1IH7 A;  4FJ5 A;  1I3A A;  2KFN A;  2HNY A;  2G8W A;  1HJR A;  2GBZ A;  4B8C A;  4CF9 A;  2AJQ A;  1S1V A;  2FBX A;  3ZCM A;  3WNG A;  3SQ2 A;  1RBV A;  2BE2 A;  4IBN A;  1VSF A;  4H4M A;  4PA1 A;  4FJM A;  1WSG A;  1QS4 A;  1B9D A;  3C94 A;  4M3R A;  5EU7 A;  3ZSQ A;  3OYC A;  3KK1 A;  4CEC A;  1KFD A;  4DTU A;  4OGE A;  2BDP A;  3EYZ A;  4AHV A;  3OYK A;  4CHQ A;  4BDZ A;  4AHS A;  1N5Y A;  1QQC A;  1UWB A;  4CCH A;  3MED A;  1QTM A;  2KZM A;  1RTH A;  1JXE A;  1NK6 A;  1L3V A;  4RW7 A;  4PWD A;  4BAC A;  3SUO A;  1BQM A;  1ZBH A;  3OYD A;  4W5O A;  4CJE A;  1HPZ A;  4C8M A;  4CJR A;  3RWU A;  4FW1 A;  4CJU A;  2OYQ A;  4Z4E A;  4YFU A;  4FLY A;  4C8O A;  3OJS A;  3EY1 A;  2D0A A;  4LH5 A;  4CEE A;  3V9X A;  4I9L A;  3V1O A;  4M42 A;  2YKN A;  5DK5 A;  4CJP A;  3AVI A;  2VWJ A;  2LSN A;  4M41 A;  3KTQ A;  1A5V A;  4CEO A;  3LP2 A;  4YNQ A;  3SV3 A;  3S3M A;  2HVH A;  3S9H A;  3U3G A;  2VWK A;  3QIP A;  5J1E A;  3NE6 A;  2KW4 A;  3CM6 A;  4XIU A;  3BDP A;  1EX4 A;  3IG1 A;  3AVK A;  1U04 A;  4K8X A;  4F2S A;  2JLE A;  4KRF A;  3OYJ A;  1XWL A;  3K59 A;  3VA0 A;  5K14 A;  2O4I A;  1LWF A;  1RTI A;  1LWE A;  4K8Z A;  3ISN C;  1LW2 A;  5HRO A;  1IO2 A;  1X1P A;  1F21 A;  3AA2 A;  1JLQ A;  1TKD A;  2YNI A;  2KFZ A;  4DTN A;  4E19 A;  3QET A;  5HLF A;  3PO4 A;  1Q8I A;  3NF6 A;  3QIN A;  3T1A A;  1XHX A;  1TK8 A;  3LP3 A;  4ZTF A;  2XY5 A;  2D5R A;  3AA3 A;  3O4Q A;  5JS2 A;  3NGZ A;  4QAG A;  1WSI A;  3DMJ A;  1VSL A;  4HTU A;  3K5L A;  3C6U A;  3NGY A;  3CFO A;  1L3U A;  4O55 A;  3DRR A;  1HYV A;  1JLG A;  5SWM A;  3AVM A;  3MEE A;  3OYN A;  3TAM A;  3HST B;  4RG8 A;  4C8L A;  4DSE A;  2KTQ A;  3VQP A;  3F9K A;  3G10 A;  1RT7 A;  2HMI A;  2VG5 A;  4OLA A;  2G8V A;  3DI6 A;  4RW4 A;  1RDC A;  3AVA A;  4DF4 A;  3O3H A;  1QSY A;  4W5T A;  3HPO A;  3SV4 A;  2YV0 X;  4DQI A;  3P5J A;  2G8U A;  4M3W A;  1NKC A;  3E01 A;  3SZ2 A;  4M3Y A;  1BIS A;  1EP4 A;  2IDO A;  3L3V A;  1HRH A;  1ZBF A;  2Z1J A;  4CJ3 A;  3NDK A;  2P1J A;  3K5M A;  2PYJ A;  4OKE A;  2XY7 A;  1JLE A;  3NHG A;  2IC3 A;  3WNF A;  3T19 A;  3NBP A;  1HNI A;  1S1X A;  4FLZ A;  3OYF A;  3P83 D;  1C1C A;  3QES A;  3QNN A;  4CFB A;  3CG7 A;  1A5X A;  4BDP A;  2WON A;  1JLB A;  4CFD A;  4CHN A;  4B9L A;  3VQ7 A;  1CZ9 A;  1WSE A;  3DLR A;  3HYF A;  4KB1 A;  1UAX A;  4Y1C A;  1ZBL A;  1T05 A;  1L5U A;  1EET A;  2EX3 A;  3ZSY A;  4KHY A;  1UA1 A;  2FBT A;  1XC9 A;  3TAG A;  1KRP A;  3A2F A;  3OS0 A;  1FKP A;  1HNV A;  3O4N A;  4CJL A;  4CIF A;  3RTV A;  1UOC A;  1TK5 A;  1J54 A;  1LAW A;  4DTO A;  2Y1J A;  3ZT0 A;  1JL2 A;  4NCG A;  5C24 A;  4N5S A;  2RKI A;  3S3N A;  2F8T A;  2O4G A;  1RIL A;  4ICL A;  2ZD1 A;  3HXM A;  4DS5 A;  4DTJ A;  4FJJ A;  4CJT A;  3QO9 A;  3VQQ A;  1TL3 A;  3RMA A;  3THV A;  3K2P A;  2B6A A;  4N47 A;  4FXD A;  4G1Q A;  4KO0 A;  1BQN A;  3NFA A;  3M8S A;  3TAE A;  3DM2 A;  5I3U A;  5FDL A;  1U49 A;  1T03 A;  1SL2 A;  1YVU A;  4FJG A;  4KHQ A;  3KKS A;  4Q5V A;  4KI6 A;  1BGX T;  2GUI A;  4E7H A;  3DLG A;  3ZSV A;  3HPH A;  3TWH A;  3U3Y A;  2PYL A;  3IRX A;  4NYF A;  4E3S A;  4DTS A;  1XHZ A;  3KK3 A;  3NH1 A;  3JYT A;  3TI0 A;  1BI4 A;  2I5J A;  4I2P A;  3QEV A;  3V4I A;  3TAQ A;  2RPI A;  2X78 A;  2G8I A;  3SQ1 A;  3MEC A;  4DFP A;  4BDY A;  5DMR A;  1VSH A;  5CY4 A;  3CFR A;  2P51 A;  1K6Y A;  5KI6 A;  2XHB A;  3ZSW A;  1ZBU A;  1TKT A;  1RBR A;  3B6O A;  4FJN A;  4OKJ A;  4Q0B A;  2DTU A;  4FZY A;  4N76 A;  3HP9 A;  1D9F A;  2G8H A;  5KGX A;  1LV5 A;  3ITH A;  4E89 A;  1JL1 A;  4CJS A;  1NK4 A;  4W5R A;  2ATQ A;  4M3T A;  4CEZ A;  3PV8 A;  1QSL A;  2Z1H A;  1WNS A;  1VSE A;  2VG6 A;  4CF0 A;  3SUQ A;  3SUN A;  4PY5 A;  3M8P A;  3AVB A;  4KI4 A;  2HHS A;  1JXB A;  1RT4 A;  4EP4 A;  2GV9 A;  3DLK A;  2IS3 A;  2A1R A;  3HO1 A;  3VN5 A;  4PQU A;  3LAL A;  3HK2 A;  3AV9 A;  3MXI A;  4DG1 A;  1HYZ A;  1KVB A;  1C6V A;  1Z26 A;  4ID1 A;  3TR8 A;  3QEW A;  1SL1 A;  4KTZ A;  3OS2 A;  3ZSZ A;  4DS4 A;  4E7J A;  1J53 A;  3SPZ A;  1RT1 A;  5C25 A;  4OLB A;  1KLM A;  5T7B A;  3MXM A;  1ASW A;  2PZS A;  3ZT2 A;  3TAN A;  1B92 A;  3LZI A;  4FJ9 A;  4CGG A;  3V6D A;  4F8R A;  4FLV A;  3VQ4 A;  1N6Q A;  4ELU A;  4J2A A;  3NF7 A;  1D5A A;  1ASU A;  2OPP A;  3TAR A;  3V81 A;  1YT3 A;  4FW2 A;  3PO5 A;  3OYL A;  4KB0 A;  4KHN A;  3LDS A;  3SCX A;  4CK3 A;  5HP1 A;  4FJI A;  4QOZ B;  2HHU A;  4OKK A;  4B9N A;  1A5W A;  4I2Q A;  2B4J A;  3AO4 A;  3K57 A;  1HQE A;  5J2N A;  3RRG A;  5FRN A;  4BE1 A;  3K58 A;  1DTQ A;  3OYI A;  4CEF A;  5HRP A;  3QEX A;  3SUP A;  3OYH A;  3JSM A;  3RMD A;  3MXJ A;  1ZYQ A;  4M3U A;  4H8K A;  2RN2 A;  3TAF A;  2HW3 A;  3OVN A;  4DF8 A;  1CLQ A;  1I39 A;  1S9G A;  3AO2 A;  4HVJ A;  5KTQ A;  4W5Q A;  1J5O A;  3DRP A;  1XI1 A;  1JLC A;  1D8Y A;  4UQG A;  2IOC A;  3HP6 A;  1EXQ A;  1IKY A;  4CF2 A;  4CER A;  4I9Q A;  4DQP A;  1ASV A;  1WSF A;  1SUQ A;  2D0C A;  1NOY A;  4M3Z A;  4J2E A;  2DFE A;  1C0T A;  2OPS A;  4R5P A;  4DQR A;  1SV5 A;  4FZX C;  4FLT A;  4CF1 A;  1MU2 A;  1KFS A;  2KZZ A;  5KRS A;  1TAU A;  4MQ3 A;  4Z4H A;  3D0P A;  5JS1 A;  3ALY A;  4AHR A;  3NH2 A;  3LWM A;  3AVC A;  1RT6 A;  2EHG A;  3U6F A;  4AIL C;  1SL0 A;  1IG9 A;  3TAB A;  4ID5 A;  3PY8 A;  4HCB A;  3I0S A;  1L3T A;  2YHB A;  4CEB A;  4EP5 A;  2F96 A;  4O0J A;  1HQU A;  3O3F A;  3ZSR A;  2G8F A;  4DSK A;  1BIZ A;  1TGO A;  3AVN A;  5FRO A;  1KVA A;  4OVL A;  4FM1 A;  3AO3 A;  1VRU A;  2XRI A;  3ZSO A;  3LZJ A;  4DSJ A;  3KLF A;  5J2M A;  3VQD A;  2YNF A;  2HHT A;  3VQ9 A;  4CJ4 A;  2Z1G A;  3OYE A;  2QKK A;  4DFK A;  1T8E A;  1RBT A;  3CYM A;  4GMJ B;  4JRP A;  3L2V A;  4N56 A;  1S5J A;  4KFB A;  1UA0 A;  1KVC A;  4CJW A;  4Z4C A;  1NJY A;  3ASM A;  2X6N A;  4CFA A;  4CIG A;  1X9W A;  4OPK A;  4J2B A;  3QEI A;  1CXQ A;  5CZ2 A;  4O5B A;  3C6T A;  4Y1D A;  4LD0 A;  4DTM A;  3SQ4 A;  1NJX A;  1NJW A;  1FK9 A;  3OYM A;  3L2R A;  2Q3S A;  1NK8 A;  3AVL A;  1SKW A;  2Z1I A;  2PY5 A;  4KHS A;  4W5N A;  4FJ7 A;  1C1B A;  3L8B A;  3DLH A;  1D9D A;  3DOL A;  1C1A A;  3RR7 A;  2P5O A;  1T7P A;  1VRT A;  1VSJ A;  4KTW A;  3L2W A;  2OPQ A;  4GW6 A;  2DFH A;  4E1N A;  4FJL A;  4FLX A;  1DTT A;  4DTP A;  4JLH A;  4KAZ A;  3I0R A;  4E7L A;  3NAE A;  2KQ2 A;  2W42 A;  1JLA A;  1RT2 A;  3VQB A;  4DFM A;  3VQE A;  3OJU A;  4DU1 A;  3QER A;  4F2R A;  1WSH A;  3LAN A;  4C8K A;  4DSL A;  4N41 A;  4OJR A;  2A1S A;  1VSI A;  3F73 A;  3CFP A;  4CJQ A;  5HBM A;  1VSM A;  2QKB A;  1X9M A;  1TKX A;  2ZE2 A;  3KKR A;  3MEG A;  5HRN A;  4OPJ A;  4E1M A;  4DTX A;  3KD5 E;  1KTQ A;  3AVH A;  4DQQ A;  2OPR A;  3KIO A;  1RBS A;  3WNH A;  4CHY A;  4HUE A;  1U48 A;  3K5O A;  4DLG A;  3SQ0 A;  1ITG A;  1FXX A;  5J2P A;  2BAN A;  4CGH A;  2X74 A;  3IS9 A;  1C0U A;  2HNZ A;  4TSX A;  4IKF A;  2FBY A;  1U45 A;  1NJZ A;  1W9H A;  2E4L A;  1RT5 A;  3RMC A;  4CGD A;  2R7Y A;  3PUF A;  4B8A B;  1TAQ A;  1S1W A;  3DRS A;  4O44 A;  1ZBI A;  1S1U A;  4BE2 A;  3SYZ A;  3D45 A;  4B08 A;  3NH0 A;  4JS4 A;  1YTU A;  3ZSX A;  3K5N A;  2G8K A;  5J2Q A;  4AH9 A;  1LW0 A;  1S1T A;  3KK2 A;  3C95 A;  1RNH A;  1BHL A;  1FKO A;  1C0M A;  4E0D A;  4Z4I A;  2FBV A;  2IGI A;  1WLJ A;  1BI4 B;  4B9M A;  1O1W A;  3ULD A;  3AVJ A;  1WAJ A;  1U4B A;  3QNO A;  4FM0 A;  4HUG A;  3L2Q A;  3AO1 A;  4NCB A;  4CEA A;  3V1Q A;  4Z4G A;  3T3F A;  3RMB A;  1Y97 A;  2NUB A;  3L2U A;  3HPG A;  4FJH A;  3AA5 X;  3BGR A;  4DSI A;  4DSF A;  4Z0U A;  3V1R A;  3V9W A;  4F3O A;  1TVR A;  4PUO A;  4IDK A;  2HND A;  4KPY A;  1KCF A;  4ZHR A;  4B9V A;  4DWI A;  3VQ6 A;  4FK2 A;  4KHU A;  4DLE A;  4FJX A;  3V9Z A;  3AO5 A;  3HM9 A;  3ZT4 A;  4FM2 A;  4CK1 A;  4KHW A;  3HJF A;  4E7K A;  2DFF A;  4NCA A;  4GVM A;  1NKB A;  3HL8 A;  3KLE A;  3MAQ A;  4DQS A;  4H4O A;  2X6S A;  1NOZ A;  5HRS A;  1QE1 A;  4L8R B;  4DU3 A;  3PX6 A;  3VQA A;  4AHC A;  4CGJ A;  3KJV A;  2XY6 A;  3SNN A;  1JKH A;  2HB5 A;  4CF8 A;  4ELV A;  3G0Z A;  4E7I A;  3FFI A;  4FK0 A;  2YNH A;  1SKR A;  3LAM A;  4B3O A;  1WSJ A;  1BL3 A;  4Z4F A;  4LSL A;  4CJF A;  1HYS A;  3H08 A;  2XY8 A;  4CE9 A;  1WAF A;  4B9U A;  4RW8 A;  3DYA A;  2VG7 A;  1QHT A;  2YNG A;  1GOA A;  4CHO A;  1S6P A;  1S6Q A;  2IAJ A;  3IAY A;  1YTA A;  4AHU A;  3O3G A;  4KTQ A;  3OYA A;  2HHW A;  4DFJ A;  2Y1I A;  3I8D A;  3PX0 A;  1TL1 A;  1NK9 A;  1VSD A;  5E41 A;  1RTD A;  4HCC A;  1JLF A;  3LPU A;  2QK9 A;  3M8Q A;  1R0A A;  2JGU A;  4RW6 A;  4BWM A;  4CJ5 A;  4FJK A;  3VQC A;  3QIO A;  1VK0 A;  4FCY A;  3S3O A;  4EZ6 A;  1VSK A;  2FC0 A;  3KLI A;  4CIE A;  3AVF A;  4LY7 A;  4CFC A;  4HHT A;  2YKM A;  5D3G A;  1TKZ A;  3NGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...