3O4NA

Crystal structure of the rous associated virus integrase catalytic domain in mes buffer ph 6.0
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
133
Chain Sequence
QIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTQAMVERANRLLKDKIRVLAEGDGFMKRIPASKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords integrase
publication title A crystal structure of the catalytic core domain of an avian sarcoma and leukemia virus integrase suggests an alternate dimeric assembly.
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 47
structure length 133
sequence length 141
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o4nA00
2FBVA 3OYKA 3VQEA 4F8RA 3G10A 3NDKA 1GOAA 3LAMA 3ZT4A 4HHTA 1J9AA 3SUOA 4B9MA 4L8RB 1TAUA 3KK2A 3OYJA 4PQUA 4E89A 4BDZA 4M45A 4BE1A 4DS5A 5HP1A 1S1TA 2R7YA 4CIGA 5KGXA 4B9LA 4GVMA 2AJQA 2Q3SA 4M3RA 3O3HA 5FRNA 3OYDA 1NK8A 4KHUA 3S3NA 4CFAA 4CHOA 3KLEA 3LWMA 1TL1A 4B8CA 1VSHA 3NGYA 1JLQA 5HRRA 1UOCA 3RTVA 4DQQA 4LH5A 4FLZA 3NH0A 1NK4A 4BE0A 3CFOA 5EU7A 1UA1A 2KFZA 4IKFA 4CGHA 3IRXA 1VSMA 3C6UA 3P5JA 3RMDA 3NF8A 3P83D 1NOZA 3SUPA 3QEVA 4E7JA 4CF0A 1BIUA 3NF6A 5DK5A 3NF7A 1NKCA 1KLNA 1RT2A 3VA0A 1RT7A 2RN2A 2QKBA 4N47A 4RW4A 2XY7A 4FM0A 3HVTA 3L2QA 1X9MA 1L3TA 4DQIA 1VSJA 3HPHA 3K2PA 1S6PA 3MAQA 4M3ZA 3CYMA 3HSTB 5JS2A 2HVIA 3AO5A 3V1OA 3AVAA 4Z4IA 3V6DA 4PWDA 3KLFA 2Z1JA 3TAFA 5C42A 1RT1A 1BHLA 2EHGA 4E3SA 4AHVA 3TANA 1SKRA 4C8OA 4DQRA 4OLAA 1RDBA 3KLGA 1A5WA 2ITGA 3LP0A 4J2EA 3T19A 3RWUA 2RPIA 5HROA 1L3VA 4W5RA 2G8HA 4CJQA 3AO1A 1WSIA 4ID1A 1CXUA 1VSFA 1UAXA 1RT4A 3M8PA 4CHQA 1ZBHA 3PX4A 3PV8A 4RW7A 3HT3A 4DSLA 3TWHA 1NJXA 1NK5A 2G8WA 2RKIA 4FK2A 1LWCA 3OY9A 1Z25A 3QEIA 1J54A 4DSKA 4OKEA 1N6QA 4DQPA 3ASMA 3WNGA 4AHTA 4UQGA 4Z4FA 3PX0A 4DWIA 3M8QA 5J2PA 1KSPA 1J53A 2X6SA 4K8XA 4LD0A 3G0ZA 3K5OA 3RMCA 2ZD1A 2WOMA 3OVNA 2Y1JA 1TK0A 3OYIA 2PZSA 1CLQA 3QESA 4NCGA 3KLIA 1KFDA 4AH9A 4B8AB 2G8FA 1EX4A 2NUBA 3LPTA 1Q9YA 3AA5X 4FK0A 2GBZA 3SQ2A 4ICLA 4ELTA 2IC3A 4FJMA 3I8DA 2KZZA 1T05A 3VQDA 3OJUA 5HRNA 4HUEA 1LWEA 2FBXA 4DTMA 1QTMA 2HNDA 1SL0A 1VSKA 1QE1A 4ID5A 2IDOA 3MECA 3QNOA 1JLCA 1CZ9A 4CEBA 4HCBA 4CFBA 2ETJA 1KCFA 1KVBA 1X1PA 4CJUA 1RBSA 1MU2A 1KTQA 3MEEA 4FJ9A 1QS4A 3D45A 3DLBA 3QEWA 4DF8A 2XY8A 4CJLA 1NK6A 4E7HA 4DSIA 2YNFA 3SYZA 1IKWA 2HHVA 3RR8A 4CHNA 4ELVA 4Q5VA 3AA4A 1NOYA 2VG7A 1WLJA 3TI0A 1WSFA 1JLAA 3ULDA 2G8VA 2PYJA 4MFBA 3VQ5A 4Q0BA 3IAYA 2ZE2A 4IDKA 1WSJA 4JS5A 4BACA 1J5OA 4FZYA 1FXXA 4AHCA 3K5MA 3MEDA 1F21A 4CEAA 1B92A 1O1WA 2F96A 4CJFA 3PX6A 3O4NA 4FLYA 3RRGA 4DU4A 2XHBA 5I42A 3ZSYA 3DOKA 4LY7A 1JLBA 3CM6A 4CF2A 4LSLA 3EYZA 3QETA 1NJYA 4J2BA 4OLBA 1RTJA 5KI6A 3EY1A 3RRHA 3RMAA 3TAQA 1QSSA 1VSIA 4O0JA 4Z4CA 3QERA 2YNIA 3BGRA 3ISNC 4I9LA 3SCXA 1TKTA 2IS3A 4CJPA 3V4IA 3CFRA 1EKEA 2YV0X 2HHQA 2XRIA 2WONA 3ZT0A 5E41A 1RDCA 2X74A 2X78A 3LP2A 3ZT2A 1HPZA 4CJTA 3QNNA 1U4BA 1TK5A 4FM1A 5SZTA 1L5UA 1BQMA 3ZSZA 1C0UA 3NHGA 4HUGA 4CGFA 4FLUA 3SPYA 2DFFA 5CYMA 4CF1A 4DU3A 4F4KA 4BDYA 1A5VA 1S1VA 1IH7A 4DTSA 3OYLA 1TAQA 5KRTA 1NJWA 3L2RA 4KB0A 2B5JA 1RT6A 5D3GA 3NGZA 2XY5A 4CK3A 1U49A 2HVHA 1ITGA 1WSEA 4CJ5A 3VQBA 1LW0A 4B08A 3V9UA 2YNGA 1XHXA 4CEFA 1S6QA 3T1AA 3ZSOA 3QIPA 3AVFA 1TV6A 3V9ZA 4N56A 3O3GA 4E0DA 4DTOA 2DY4A 3OYMA 5J2QA 1I39A 3VQAA 4FM2A 5HLFA 1HRHA 2F8TA 3H08A 3ZSVA 1ASUA 4CGGA 3AVIA 2QKKA 3BDPA 4CK1A 1D9DA 4KI6A 4W5NA 5CY4A 3AVCA 3QLHA 3HPOA 4J2AA 4KI4A 4KPYA 1WAJA 4IFYA 1S1WA 3U6FA 1BQNA 4CERA 1FKPA 3QINA 3VQ7A 4AHUA 1JL2A 1NJZA 2HHUA 1JKHA 3DRPA 2BANA 4FW2A 4HTUA 4B9NA 4FLXA 4OGEA 4EZ6A 1G15A 1B9FA 4M41A 4O4GA 3ZSQA 1NK0A 3NCIA 4CEDA 1DTTA 5FROA 4M3UA 3AVMA 3AVGA 4DLEA 1HYSA 1D5AA 4FJKA 3KK3A 3PY8A 4FLVA 1IO2A 3LP1A 4I7FA 3QO9A 4EP5A 3K58A 1KFSA 3TR8A 2BGGA 2JGUA 4CIFA 3SI6A 4EZ9A 1T7PA 5JS1A 3LZIA 1YTUA 3SQ1A 2VG6A 4FJJA 3OYGA 4FXDA 4GMJB 1RBRA 1S9EA 4J2DA 3OJSA 1GOBA 5J1EA 4DTUA 4FZXC 1VRUA 1RILA 3PUFA 2E6MA 3ZT1A 3V9XA 2KFNA 4JRPA 3CFPA 4OKJA 4N41A 1LW2A 3CM5A 3TAEA 3SQ4A 5I3UA 4K8ZA 3LAKA 1WAFA 4OGCA 1TL3A 4Y1DA 4BWJA 4ZHRA 3HP6A 3S9HA 4C8MA 5FDLA 1ASVA 3F73A 2FC0A 3LZJA 1XWLA 4Z4HA 1QSYA 4DSJA 1WSHA 4R5PA 3CQ8A 5HRSA 3LWLA 2Z1HA 4DU1A 4B9SA 4RW8A 4Y1CA 2OZMA 3SQ0A 3L2WA 1WN7A 3LPUA 1S1XA 4E7KA 4PY5A 1SUQA 3I0SA 2VG5A 2O4IA 1NKBA 1S5JA 2P5OA 1HQEA 4I9QA 3OS0A 2X6NA 1SKWA 3AVHA 3AVKA 1HNIA 3KKSA 3QIOA 4OVLA 3KD1E 2HNZA 3VA3A 2B4JA 3AO2A 1N5YA 1EXQA 3DLKA 3DOLA 4H4OA 2P5GA 1HYZA 4FJGA 4FJ5A 1C0MA 4KO0A 1TK8A 3A2FA 3HVRA 1SL2A 1D9FA 2G8KA 2KZMA 2A1RA 2OYQA 3FFIA 4E1MA 4KKOA 2Z1GA 2DTUA 4DG1A 1LV5A 2O4GA 1YT3A 2FBTA 3HL8A 1BCOA 2W42A 1XC9A 2YHAA 1L3UA 1JLEA 3NE6A 1U48A 4M3WA 5KTQA 3KKRA 4FJNA 3AO3A 2YHBA 1A5XA 4YFUA 4YNQA 4BDPA 5C25A 4CJ3A 4FJXA 1JXEA 1SL1A 1CZBA 4DTJA 3JSMA 4KTQA 3SV3A 4E1NA 4W5QA 2HNYA 3M8SA 4KAZA 4TSXA 4KHNA 4FJ8A 1TGOA 3WNHA 3L3VA 3I0RA 4WE1A 1C0TA 1U04A 4NYFA 1TKZA 3KJVA 4ELUA 1Z26A 2RF2A 3C94A 4CJ4A 1JL1A 1ZYQA 2HHSA 3T3FA 3SNNA 4CEOA 4NCBA 4CF9A 1X9WA 5CYQA 4FJ7A 3OYNA 3OYEA 1GOCA 4CFDA 4KHWA 1IKYA 4M3TA 2LSNA 4IBNA 4PUOA 3U3YA 1TKXA 4QCLA 2KQ2A 4C8LA 2EX3A 4F3TA 1HJRA 3MXJA 1Y97A 2YKNA 5DMRA 1RNHA 3VQ4A 4O0IA 3L2VA 3U3GA 3THVA 2PY5A 4DF4A 4CHYA 2G8UA 3VQ9A 3LDSA 2D0AA 3LALA 3IG1A 4FVMA 1B9DA 4I2PA 3JYTA 1UA0A 3OYCA 4ZTJA 3AA3A 1IG9A 1C1CA 4Z4EA 3V9SA 1W9HA 2VWJA 4HUFA 2KTQA 3SZ2A 1LAVA 1ASWA 1EP4A 4KTZA 4NCAA 5KRSA 3HPGA 2I5JA 2VWKA 2HW3A 4RW9A 2HB5A 3ZSXA 2OPRA 4RG8A 2Z1IA 3V1QA 4DFPA 4CJEA 3DLEA 1Q8IA 4RW6A 3PO5A 4F3OA 1SKSA 3L3UA 1RT5A 3VQQA 3VN5A 1T8EA 1ZBFA 4HCCA 3NBPA 1U45A 1T03A 3HYFA 3NF9A 4KREA 3NAEA 2GV9A 4DTRA 1Q9XA 4CEZA 1FKOA 4OJRA 3DMJA 1KLMA 5K14A 3ZT3A 4CCHA 3SUQA 2KW4A 4FK4A 1ZBIA 1REVA 1VSLA 3OS2A 3E01A 3WNFA 4CGJA 3PO4A 2DFEA 3ITHA 4M3YA 4E19A 4C8NA 1KRPA 2FBYA 3P1GA 3EZ5A 2YKMA 3AV9A 3WNEA 1UWBA 4CE9A 3F9KA 3TAGA 3DRSA 1IKVA 4O5BA 2IGIA 1L3SA 4DS4A 1S1UA 4OPJA 1TVRA 3OYHA 1BL3A 1ZBUA 1DLOA 3AA2A 3O4QA 4F2RA 2HMIA 1RBUA 1C6VA 1KVCA 4CGIA 3S3OA 1LWFA 1NK7A 1RTDA 4KB1A 4Z4GA 4KFBA 2BE2A 3AVJA 4PA1A 5CZ2A 5T7BA 4CEEA 3M8RA 1X9SA 1QHTA 3B6PA 4LSNA 3HM9A 3OS1A 4DSEA 2BDPA 2F8SA 4KV8A 3ZCMA 2XY6A 3QEPA 2OZSA 1RTHA 2HHTA 2HHWA 3MXMA 1IKXA 4FW1A 4FJIA 3S3MA 1HNVA 4GW6A 4IFVA 4CJVA 4DFJA 1R0AA 3HK2A 1WNSA 3C6TA 3RMBA 3B6OA 1RDDA 2IAJA 4FLWA 5J2NA 3HXMA 3L8BA 3K5LA 5KGWA 4DTNA 1D8YA 2E6LA 3NH1A 4B9TA 1QQCA 4DMNA 3K57A 4H4MA 2ZQBA 3D0PA 3V1RA 4CJKA 1K6YA 5HRPA 4W5OA 5FRMA 4CECA 4IG3A 1JLGA 4IG0A 3DM2A 1FK9A 4G1QA 1BISA 3K5NA 4EP4A 4E7IA 3SPZA 3HP9A 3V81A 2YNHA 1RBVA 3AO4A 1BGXT 1U47A 1RDAA 3MEGA 1HMVA 2G8IA 1VSEA 3AVNA 1EETA 4XIUA 4OPKA 3CG7A 1C1BA 1VK0A 4CFCA 4FJHA 4Z0UA 2PYLA 4CJSA 3VQCA 3TAMA 4ZTFA 2D0CA 3DRRA 3DYAA 4JS4A 3C95A 2JLEA 1JLFA 3LP3A 4CEQA 2GUIA 3OYBA 1BCMA 2XO7A 4KHQA 1VSDA 1C1AA 3KTQA 4BWMA 5CZ1A 3ZSRA 4DFMA 4B9VA 2ATQA 5J2MA 1RT3A 5C24A 4AHRA 1RBTA 1KVAA 3OYAA 4F2SA 4DTPA 3VQPA 3LANA 3AVLA 3SV4A 2DFHA 4DLGA 3TAPA 2D5RA 4M3XA 2D0BA 3DI6A 4KHYA 1XHZA 1NKEA 2OA8A 3V9WA 3SUNA 3KK1A 3AVBA 4CGDA 3TARA 4OKKA 4LH4A 4O55A 4CJRA 4CHZA 4CESA 1DTQA 2QXFA 3IS9A 4N5SA 4KHSA 2A1SA 3DLHA 3KLHA 2B6AA 3OYFA 1JXBA 2QK9A 3ZSWA 3RR7A 4FJLA 5HBMA 4JLHA 2Y1IA 1XI1A 3KD5E 4KTWA 4HVJA 4W5TA 4FLTA 1CXQA 1TKDA 1RTIA 3UIQA 1RCHA 4MQ3A 3QEXA 2HHXA 4KRFA 1SV5A 1ZBLA 4FYDA 3VQ6A 4QAGA 4E7LA 2OPPA 1W0HA 4CK2A 1BI4A 4N76A 4DFKA 2OPSA 3DLRA 3NH2A 1YTAA 2IOCA 3HJFA 1HYVA 4CF8A 4AHSA 2E4LA 4DSFA 5SWMA 3O3FA 4DTXA 3TABA 3DLGA 3NFAA 3ALYA 4CIEA 3HO1A 1LAWA 3NGIA 4AILC 3KIOA 1BI4B 3MXIA 1QSLA 4M42A 1VRTA 1I3AA 1HQUA 4FZZA 4H8KA 1S9GA 2P51A 4BE2A 4C8KA 1WSGA 4CJWA 3K59A 4I2QA 1BIZA 4NYNA 3L2UA 4DQSA 4B3OA 4O44A 4QOZB 2P1JA 4FCYA 1NK9A 2OPQA 4CHPA 4JRQA 4B9UA 3VQ8A 3SJJA 1YVUA
chains in the Genus database with same CATH superfamily
3OYKA 3G10A 4CZEA 3NDKA 3CMEN 3OYJA 5HL7L 4JD2A 4PQUA 1S1TA 2R7YA 3F2KA 4B9LA 2Q3SA 4DR7K 2YX6A 5E84A 4H5TA 3OYDA 4A59A 4CFAA 3C6HA 4JI6K 3SAHA 1VSHA 1JLQA 5HRRA 4BRPA 4H5WA 1NK4A 4BE0A 3D6RA 2KFZA 4DUZK 4IKFA 5AQSA 3C6UA 3RMDA 3NF8A 1ZC6A 3QEVA 4JI7K 2E1ZA 4N47A 2PBDA 4QS8A 1X9MA 4DQIA 4XH4A 3K2PA 3MAQA 1NLVA 2EWSA 5JS2A 4DV3K 2E20A 3KLFA 2GWJA 5C42A 4AHVA 4PKGA 4QS7A 3CJ1A 1FJGK 1NMNA 3KLGA 1XMQK 3GDQA 3T19A 4W5RA 3MDQA 1CXUA 1VSFA 1ZBHA 2FXUA 4CBXA 3I55N 1KXPA 4FOIA 2G8WA 2RKIA 2IVPA 1LWCA 3OY9A 3O5BA 4OKEA 3VMFB 3ASMA 4UQGA 1VAZA 4Z4FA 5J2PA 1J53A 2X6SA 4K8XA 3THWA 3G0ZA 2Y1JA 3OVNA 2A3ZA 1CLQA 3CCSN 3FZHA 1KFDA 2NRWA 2NUBA 1EWRA 3LPTA 1JCFA 1Q9YA 3AA5X 4CBUA 2JWKA 3VQDA 4HUEA 3UE5A 3FE1A 2HHHK 1OH7A 1QE1A 1JLCA 3MX5A 3DLBA 2D1KA 4DSIA 1E3MA 4WFBL 4C23A 3RR8A 3TI0A 1WSFA 1JLAA 3ULDA 4Q0BA 3IAYA 4IDKA 4ILGB 4DCHA 4FZYA 2QW9A 1MWKA 4FLYA 4DU4A 2V52B 2XHBA 1NMDA 3FGUA 2VGMA 3DOKA 2ZJPL 3CM6A 4J2BA 3CI5A 3QETA 3KK7A 2O8CA 1VSIA 5JLHA 5AQLA 2YNIA 3BGRA 3SCXA 5KQDA 2IS3A 5GIPA 2P9PA 4WYBA 3ZT0A 2X74A 3LP2A 4DV7K 1TK5A 3ZSZA 1K8AO 1C0UA 3I33A 5EOYA 3RVCA 3EKUA 3TU5A 4LF7K 2P9KA 3OBWA 1A5VA 1S1VA 3BZCA 1IH7A 4BVPA 5M1FA 5KRTA 3G25A 4CK3A 4IJNA 4CJ5A 1BA0A 3CJBA 4CEFA 3T1AA 2DY4A 1TV6A 3OYMA 1HRHA 3FR0A 5BRFA 4CGGA 1ASUA 3AVIA 5C2DA 4CK1A 4V19S 4R79A 3QLHA 4GV9A 1HNZK 1S1WA 1GLEG 2HF3A 4DV2K 5GINA 4B1VA 4CZHA 1JCEA 2HHUA 1B9FA 3ZSQA 2VWBA 4CEDA 5AQXA 3GOIA 4DV5K 1IO2A 4A2AA 2H3GX 4CIFA 3LZIA 2O8DA 3SQ1A 2VG6A 4O8UA 1RBRA 4IJAA 3OJSA 4DTUA 4FZXC 1RILA 4LFBK 4N41A 4JI1K 3R1XA 1P8ZA 4ZHRA 2QWNA 3H1QA 3O4WA 2ASMA 4B1ZA 1WSHA 3LWLA 5DM7L 4DU1A 4IWVA 4ILJA 2VG5A 2P5OA 3L4IA 1NM1A 3AVHA 2NLXA 3QIOA 4OVLA 3CQXA 1NGDA 5M1PA 1N5YA 4YOVA 4FJ5A 3WQTA 4CJ7A 4FJGA 5LJVA 4KH6A 2G8KA 3ZETB 2KZMA 2OYQA 3FFIA 4A5BA 4KKOA 3CF5L 4DG1A 1LV5A 2O4GA 1YT3A 2FBTA 1RDWX 2HF4A 5IT9O 2W42A 4BGAA 3NE6A 4IOCL 4FJNA 3AO3A 4DUYK 3D2FA 2IVNA 4YNQA 4CJ3A 3HZ6A 4BR2A 1SL1A 1J5EK 4CZGA 1U2VB 4KAZA 3L3VA 3VPZA 1NGJA 1TKZA 2RF2A 4CBWA 1JL1A 3MCPA 2Q2RA 4CEOA 3MMVA 5CYQA 3CQYA 4KHWA 3OYEA 4CFDA 5KPTA 4IBNA 4QCLA 2HMPA 2KQ2A 3H1VX 3VQ4A 2O8CB 2PY5A 3OHRA 2UXDK 3QBXA 1VQ5N 3I56N 1B9DA 4I2PA 3CPEA 4BRCA 1UA0A 2NRHA 3AA3A 4Z4EA 1W9HA 2KTQA 1ILYA 3M6GA 4NCAA 4M7YA 1QQMA 5KRSA 2VWKA 2HW3A 1DKGD 3DLEA 1DEJA 4RW6A 4F3OA 5AQWA 5EVZA 1RT5A 2ASPA 4FPBA 3VQQA 3VN5A 4C1NI 1T03A 4CEZA 1FKOA 3DMJA 5C15A 4CCHA 3SUQA 4FK4A 1REVA 5B8HA 3OS2A 3E01A 3T69A 3WNFA 3ITHA 2O8FA 4M3YA 4E19A 2E2NA 4C8NA 4RTFD 3P1GA 3EZ5A 3LDOA 4O5BA 2IGIA 2VQEK 1S1UA 4OPJA 4KHPK 4CVNE 2A42A 3I8BA 1DLOA 3AA2A 1C6VA 4KB1A 1RTDA 4KFBA 3AVJA 4PA1A 5CZ2A 5T7BA 3M8RA 1X9SA 5GAGP 4EFHA 3QEPA 3QDKA 1RTHA 3BF1A 5GAHP 2E2PA 4GW6A 3TPQA 4CJVA 4DFJA 1R0AA 3C6TA 3RMBA 1HNXK 1RDDA 4FLWA 2O8DB 1BOTO 3L8BA 4DTNA 3NH1A 4B9TA 4MLHA 4EAHD 5FRMA 4CECA 1FK9A 4E7IA 3NMUA 5AZJA 1YHQN 4C1NK 1NGBA 5BR8K 3AAPA 1U47A 3O9UA 1VQLN 1HMVA 2G8IA 1VSEA 3VF4A 1C1BA 3HM8A 4FJHA 4ZTFA 3DRRA 3C0BA 4FOEA 4IEIA 2E88A 1GLFO 3A5LC 1VSDA 2VGNA 2ATQA 1RT3A 3KVGA 5C24A 1KVAA 3SMPA 3OYAA 4DTPA 1T6DA 4DLGA 3W0LA 2D5RA 3KHYA 1NKEA 2P9LA 2OA8A 3AVBA 4O55A 4GKKK 1DTQA 3MWPA 3UKRB 4N5SA 2GELA 3KLHA 3VOVA 3R9PA 3D2FB 5HBMA 4JLHA 4KTWA 1RTIA 3C7NB 4H5NA 1SV5A 4JHDB 4JAXA 4O8KA 1ZBLA 4QAGA 5M1KA 4BC2A 4MDAA 3NH2A 3DLRA 5ADXH 1VQKN 4NB4A 4CF8A 4DSFA 2UYTA 3DLGA 3ALYA 2OTLN 2UUBK 4A5AA 3NGIA 3MXIA 1QSLA 4H8KA 2P51A 3LM2A 1WSGA 1MWMA 4CJWA 4I2QA 4LF8K 4B3OA 4O44A 1OH8A 4B9UA 1C0GA 3SJJA 1VQON 3SAGA 3ULEB 3VQEA 3LAMA 1RDUA 3KK2A 1GLBG 3ID6A 1VQ4N 4E89A 4DS5A 4BE1A 5HP1A 4CIGA 5KGXA 4JI0K 3O3HA 1QVFM 4BR7A 3S3NA 4KHUA 5A2QO 3LWMA 3AY9A 3O80A 3NGYA 5CR4A 3IDHA 4LH5A 3NH0A 3IRXA 4FSVA 5AQJA 3NF7A 1YITN 1RT2A 3VA0A 2QKBA 4JI8K 1NNEA 3L2QA 4BC5A 1VSJA 4IDHA 3CYMA 1QQNA 3V1OA 4IXCA 3AVAA 3V6DA 3THYB 2EHGA 1SKRA 2W41A 4J2EA 3RWUA 5HROA 2G8HA 5AQKA 1WSIA 3BZKA 4BRAA 3M8PA 1S3XA 3PIPL 1NJXA 4DV1K 2J4RA 2PFUA 1J54A 3EN9A 4JKEA 2FF3B 3QEIA 4K41A 3PX0A 4DWIA 1FW6A 3CCEN 1SZ2A 2ZD1A 5M1NA 4K0KK 4YOXA 1IJJA 4NCGA 4BR5A 3KLIA 4KH5A 1BU6O 2GBZA 1OVYA 2KZZA 1T05A 2FBXA 4DTMA 2W40A 1HKCA 3CCUN 4JI2K 2KHOA 3MECA 4FWPA 1CZ9A 5TKWA 1YIJN 4JV5K 1KCFA 3TTCA 1RBSA 2WUSA 1MU2A 1WUAA 4FJ9A 3D45A 4YDUA 5GIOA 4CZMA 3FZFA 4CHNA 4B3RK 1NOYA 2Q1NA 1WLJA 2PYJA 2ZE2A 1WSJA 4AHCA 4DV6K 4CEAA 4EHUA 4CJFA 1O1WA 2F96A 3O4NA 1Q82O 5I42A 1JLBA 1XNQK 1NJYA 4LSLA 3EY1A 3RRHA 5F1XA 3CJ7A 3WXKA 4Z4CA 3CC2N 1SAZA 4CJPA 3V4IA 3CFRA 4GVEA 4LC9B 2X78A 3AAQA 3P39A 4YOWA 4FLUA 2QM1A 2DFFA 1YUWA 2A41A 4DTSA 3OYLA 4PHTX 3OA9A 1BWFO 2B5JA 1HJOA 1ATRA 1RT6A 3NGZA 1U49A 1WSEA 3VQBA 1LW0A 1XHXA 1WBDA 4N56A 1I39A 2VCPA 4DR2K 4B3MK 3BDPA 3GG4A 3U9DA 2O8EA 4KI6A 3AVCA 3CMAN 4J2AA 4KI4A 4IFEA 1OKJA 4IOAL 1BQNA 4WF9L 3VQ7A 1HNWK 3VTHA 3M5RA 4B9NA 4OGEA 5AJ3K 1G15A 4O4GA 3NCIA 4LFAK 4DLEA 1D5AA 4FLVA 3LP1A 3HSCA 3C65A 3OYGA 1S9EA 3CETA 1GOBA 4H5RA 3ENBA 2E6MA 3ZT1A 2KFNA 3CFPA 1LW2A 3CM5A 1NWKA 5I3UA 1IBMK 4Y1DA 1WAFA 1TL3A 3HP6A 4GV6A 4C8MA 3F73A 3CPWM 2HBKA 3LZJA 5AQFA 5HRSA 4RW8A 4Y1CA 1OH6A 3SQ0A 1N8RO 1WN7A 3LPUA 4E7KA 4BR4A 3ZETA 4FWNA 2O4IA 1NKBA 5IWAK 4BRFA 2X6NA 1SKWA 3AVKA 1HNIA 3KKSA 3KD1E 3AO2A 3RSEB 3DOLA 1C0MA 4KO0A 3HVRA 1SL2A 2Z1GA 2DTUA 3SBTA 1U2VA 3HBTA 2YHAA 1U48A 3KKRA 4DV0K 1A5XA 3F9MA 4FJXA 3R6MA 3K9JA 2FLOA 1T3VA 1XC3A 1MA9B 4W5QA 3M8SA 2GX9A 1KAZA 4B3TK 4RCHA 4FJ8A 4WE1A 3N4PA 1HKGA 4BC3A 3CJCA 3W3DA 4NCBA 3O9SA 4CF9A 3AGRA 1X9WA 4DR6K 4FJ7A 3OYNA 1DGKN 1IKYA 2LSNA 3U3YA 1TKXA 2NRTA 4C8LA 5DMRA 1Y64A 2YKNA 1Q7YO 1LOTB 3O6WA 3U3GA 3WXLA 3L2VA 3TTDA 4CHYA 3VQ9A 3LDSA 1T6CA 2D0AA 3IG1A 5AQIA 4FVMA 3VGMA 1RGIA 2Q97A 4HUFA 1LAVA 4KTZA 3HPGA 4NLBA 2ZWHA 3PLAA 2HB5A 2Z1IA 2ITMA 4CJEA 1WBBA 3WEEB 3MK6A 2YHWA 1T8EA 2D0PA 2E2QA 1U45A 2GWKA 3H3OB 2QXLA 3NF9A 3NAEA 4KREA 4CZJA 4OJRA 3E9PA 4ISGA 1KLMA 3T1HK 1YJWN 3BEXA 1JJ2M 1K8KB 5AQHA 2DFEA 1KRPA 4YORA 2O8EB 2FBYA 3P38A 3AV9A 3WNEA 1UWBA 3DRSA 1JCGA 4DS4A 2ZJQL 4BRNA 3AGKA 1TVRA 2I7PA 1BL3A 1ZBUA 2HMIA 1KVCA 3VEWA 4X66K 5BPLA 3B8AX 4JKFA 4KV8A 3ZCMA 3CCQN 4J8FA 1R59O 3MXMA 4FW1A 4FJIA 1HNVA 4IFVA 3HK2A 4A57A 3WXIA 4GV3A 1XMOK 3B6OA 5J2NA 3A5OC 3H45C 1S72N 4JK7A 2ZQBA 3V1RA 2FF6A 4W5OA 4IG3A 1JLGA 1BISA 4EP4A 3AO4A 5LMUK 3AVNA 1Q86O 1VK0A 5BPNA 3VQCA 3TAMA 3MWTA 3LDQA 3DYAA 5LMNK 3C95A 2OTJN 3VEOA 2GUIA 3UKRA 5J2MA 4F2SA 2D0BA 3DI6A 3C7NA 4FWMA 3V9WA 3TARA 4OKKA 4JHDA 1W97L 4WQ4A 4YHHK 2AA4A 5E26A 1BUPA 2A1SA 4NXNK 3A8YA 2QK9A 3HRGA 4WQ5A 3ZSWA 3KD5E 3EE9A 4RWTA 3CCRN 2Q36A 3R8EA 2E1YA 4FYDA 2P9IB 2P9SB 4CK2A 4DFKA 4OPHA 5ADXA 4AHSA 5AQNA 3VGLA 3IFRA 3HO1A 1WOQA 5C2FA 5AQMA 3ULEA 1EWQA 3A0IX 3QFUA 1VHXA 3KIOA 3M1FA 4M42A 1VRTA 1I3AA 1HQUA 4FZZA 4C8KA 1S9GA 4CZLA 3K59A 4DQSA 3ENHA 1E4GT 2P1JA 1NK9A 2OPQA 4CHPA 3VQ8A 1YVUA 2FBVA 3U9ZA 3FZKA 4L8RB 3ZT4A 4PKHA 4B9MA 3SUOA 2F9TA 1TUUA 5EX5A 4M45A 5C0YA 2RE2A 4GVMA 4H0PA 2I7NA 4M3RA 2AJQA 3H6EA 5FRNA 1EO1A 1TL1A 3WQUA 3GE1A 5GAEP 5EU7A 1UA1A 3T7ZA 4CGHA 4GNIA 3S41A 3P5JA 1VSMA 4CI6A 3BUZB 4B3SK 1NOZA 3SUPA 1NGAA 3FFKB 3IUCA 4FPAA 4CF0A 4E7JA 3THYA 1NKCA 1KLNA 3BF3A 4MDBA 1X3NA 4RW4A 1K73O 4FM0A 3HVTA 3CCLN 3O08A 2HVIA 4FWSA 3AO5A 3P4IA 4FWQA 1XQSC 1RT1A 1BHLA 3VEVA 1X3MA 1GLCG 1RDBA 3E9OA 4BRIA 4OLAA 3CERA 1NGHA 2RPIA 4LF5K 3O9TA 4CJQA 3OTOK 1RT4A 3PX4A 2GUPA 3PV8A 4RW7A 2CGKA 3TWHA 4FK2A 1Z25A 4DSKA 2NRZA 4AM7A 1N6QA 4DQPA 3MN5A 4AHTA 4HTLA 4A61A 1QZ6A 3R3LA 3SK3A 3RMCA 4AM6A 5AFUH 2WOMA 3OYIA 2P9UB 3CCVN 2BH1A 4MLEA 2QTDA 1EX4A 1QVGM 1VQ8N 3ZEUA 2D4WA 3FLCO 4ELTA 4FJMA 3I8DA 2YCHA 1LWEA 1Z6RA 2HNDA 5AQPA 1SL0A 4BG8A 1KTQA 5AQQA 1U6ZA 2XY8A 4CJLA 1NK6A 1N36K 3DWLA 2HHVA 1NGCA 3JXUA 4ELVA 2G8VA 3VQ5A 5EY4A 4BRGA 1J5OA 4JS5A 4BACA 4CD1A 5H1SQ 3K5MA 3MN9A 1F21A 4BGBA 4JKGA 1B92A 4B1UB 3PX6A 4A62A 3RRGA 4WFNL 3ZLJA 3N4QA 4LY7A 3EYZA 1RTJA 3RMAA 5JMVA 4O0JA 2OANA 3LM9A 3ISNC 1TKTA 2QEXN 2HHQA 2QI2A 2WONA 3QNNA 1HPZA 4CJTA 5CE3A 4FM1A 5SZTA 3ATUA 1BQMA 3SBGA 3NHGA 4CGFA 3SPYA 2V7ZA 4CF1A 4DU3A 4F4KA 1TAQA 1VQ9N 3L2RA 2YI1A 4LF6K 2HVHA 1ITGA 4B08A 2NRXA 2YNGA 3V9UA 3DAWA 1S6QA 3E9LA 3ZSOA 3QIPA 3V9ZA 4E0DA 2YHXA 2HHWA 3O3GA 5AQOA 4DTOA 4FM2A 1GLDG 5HLFA 2F8TA 3ZSVA 4X65K 2Q0UA 4H03B 5CY4A 2JWLA 4JYAK 3O9RA 4IFYA 4WCEL 4E1JA 4CERA 3QINA 4AHUA 1NJZA 3DXKB 4FWRA 1JKHA 1SS6A 2BANA 3DRPA 4FW2A 3L4QA 4FLXA 4EZ6A 3EZWA 4M41A 4B1WB 1DTTA 2QWPA 2QWMA 3WXMB 3VEXA 3AVMA 4FO0A 3O1WA 3ZX3A 3K58A 3TR8A 2BGGA 1YJNN 4ISFA 4EZ9A 3SI6A 1T7PA 2Q0RA 2KKZA 3SLCA 4J2DA 3PUFA 3HOSA 3V9XA 1TYQA 2CH6A 3Q7BA 3G71N 4JRPA 3TAEA 3SQ4A 1VQ6N 2RHKA 4BWJA 3S9HA 5FLXO 3LDPA 1ASVA 2V51B 2FC0A 1XWLA 4Z4HA 4DSJA 1VQMN 4R5PA 2Z1HA 4DKWA 3QMLA 3RSEA 4PKIA 3VEZA 5AQVA 5AQUA 2NNWA 1S1XA 4PY5A 1SUQA 3KWIA 1S5JA 1HQEA 4I9QA 3OS0A 4LF4K 4I6MB 2HNZA 3TTFA 3VA3A 4G9ZA 1EXQA 3DLKA 2P5GA 2UU9K 3ZEUB 2A1RA 2HBLA 1ESVA 2BUPA 1ATNA 3VENA 4BRHA 3CD6N 3ENOA 4IZ9A 1BCOA 3QB0A 3G6EN 1L3UA 3ATVA 5KTQA 4CD3A 2YHBA 4YFUA 3DLLL 4BDPA 4A2BA 3SAFA 1JXEA 1CZBA 4DTJA 3JSMA 5FPEA 4KHNA 1TGOA 3WNHA 1C0TA 3UKUB 4Z94A 3C94A 3D2EB 4H0YB 3O1BA 2HHSA 3SNNA 2NRRA 3HI0A 5BN8A 2WC9A 4JKGB 4MO5A 3NVKA 2A40A 1GOCA 3J81O 4M3TA 4XEIA 4F3TA 3EE8A 3MXJA 4O0IA 2ZGZA 2G8UA 3C6AA 4H5VA 3LALA 5JLFA 3JYTA 3WEEA 3OYCA 4BQLA 1IG9A 1C1CA 3V9SA 2VWJA 4BQZA 5AZIA 1V4TA 3LDNA 3CC4N 1EP4A 2ZGYA 3DXMA 4ISEA 1GLLO 4H0XB 4JI3K 3WXJA 2OPRA 4L3QA 4RG8A 4DFPA 3THXA 4UY8O 1Q8IA 3PO5A 3J8AA 1RFQA 1K8KA 1ZBFA 4HCCA 3NBPA 4B1YB 3HYFA 5BR9A 2GV9A 3EKSA 3ZT3A 2P9NB 5C10A 4JI4K 2FSNA 4CE9A 5MLCQ 3TAGA 1IKVA 1KAYA 1G99A 1VQPN 4O5FA 4JKCA 3PSFA 3OYHA 3E66A 1XUPO 4F2RA 4CGIA 3S3OA 2E8AA 1NK7A 2V7YA 4CEEA 2BDPA 3HM9A 3OS1A 2XY6A 3EO3A 2OZSA 2HHTA 3CJAA 1N33K 4BC4A 1YJ9N 3AARA 4PL7A 4JEPA 2IAJA 1D8YA 3K5LA 5KGWA 2E6LA 1QQCA 2F9WA 4DMNA 4JKAA 3K57A 2YJEA 4H4MA 1K6YA 1TYQB 4IG0A 3DM2A 4G1QA 3HP9A 2DPNA 2YNHA 1BGXT 4XIUA 4CZKA 3CG7A 4CFCA 1LCUA 2PYLA 2D0CA 4IO8A 4KH4A 2XO7A 1BCMA 3G4SN 4KHQA 2HBJA 1C1AA 3KTQA 4BWMA 5CZ1A 3ZSRA 3LANA 3AVLA 3SV4A 2DFHA 3TAPA 5BRDA 3A5MC 4KHYA 1ZXOA 1XHZA 2UUAK 2O8BB 4CGDA 4BR9A 3ZX2A 3L0QA 4CJRA 1NGEA 4CESA 2P9IA 2P9SA 2QXFA 2VYPA 3IS9A 3LL3A 3Q7CA 2HSTA 4KHSA 5AQZA 3DLHA 1ZBSA 3MCAB 3OYFA 3RR7A 2CGJA 3PSIA 4FJLA 1XI1A 4HVJA 3K9KA 4FLTA 3UIQA 1CXQA 2HHXA 4KBOA 1RCHA 2OPPA 4H0OA 4YDUC 3QICA 4N76A 2OPSA 1YTAA 2IOCA 3JS6A 4YOYA 3HJFA 2E4LA 4DTXA 1Q81O 4XH5A 2HOEA 3TABA 1LAWA 1BI4B 3U4LA 4BR0A 1BO5O 4BE2A 2QWRA 5BN9A 3J7YP 5GADP 3DJCA 1BIZA 4NLCA 5FPMA 3VF6A 4FCYA 2UXBK 5FPNA 3MN6A 4F8RA 2QWOA 2UUCK 5DM6L 1GOAA 4HHTA 1TAUA 1J9AA 4DQ8A 5AZIB 2YHYA 3TSPA 3HOTA 3DXMB 5EXWA 4BDZA 4QS9A 3THXB 1VQ7N 1NK8A 4CHOA 3KLEA 4OPAA 4B8CA 3RTVA 1HLUA 5KPZA 1UOCA 4DQQA 4FLZA 4JD2B 2HBMA 3CFOA 5M1OA 3O9QA 4H0TB 3P83D 1QHAA 1BIUA 3NF6A 5DK5A 4U7BA 1RT7A 2RN2A 4BRQA 3FZLA 2XY7A 1L3TA 5JVGL 2GEMA 3HPHA 5AQRA 1S6PA 4M3ZA 3HSTB 1NBWA 2ZJRL 4Z4IA 4PWDA 3TAFA 2Z1JA 1O13A 4E3SA 2NZTA 3TANA 4C8OA 1EQYA 3BY5A 3VERA 4DQRA 5JICA 2Q31A 1A5WA 5HOOA 2ITGA 3LP0A 1L3VA 5LJWA 4DR4K 3AO1A 4ID1A 4JKDA 1N32K 3H3NO 1UAXA 4CHQA 1KC8O 3F5TA 2W6KA 5M1QA 5F0XA 3J7ZO 3HT3A 4DSLA 3GL1A 1NK5A 2OCEA 4LF9K 2F7TA 3HTVA 2P9UA 3WNGA 1BA1A 3M8QA 4JK8A 4EIAA 1KSPA 3VETA 4LD0A 3K5OA 1YVNA 3FZMA 5AQGA 5AFUA 3VF2A 1TK0A 2PZSA 4H0VB 4WFAL 3QESA 4AH9A 4B8AB 2G8FA 1VQNN 3MN7A 3VTIA 4FK0A 3SQ2A 3THWB 1OH5A 3OBYA 4ICLA 2IC3A 2A5XA 3OJUA 5HRNA 4CZFA 4AF1A 1GLAG 1QTMA 4OO1J 1VSKA 3LDLA 4ID5A 2IDOA 3QNOA 3OW2M 4CEBA 4HCBA 4CFBA 2ETJA 1KVBA 1W7AA 1X1PA 4CJUA 3MEEA 1QS4A 3QEWA 4DF8A 1Z05A 4E7HA 5FPDA 2YNFA 3SYZA 1IKWA 4Q5VA 3AA4A 2VG7A 2IVOA 4MFBA 3CCMN 2F4VK 1FXXA 3MEDA 5TKYA 2GTDA 4IEEA 2PAVA 3ZSYA 4XH1A 4CF2A 4OLBA 5KI6A 3TAQA 1BDGA 1QSSA 4DV4K 1K9MO 3QERA 4I9LA 3E1YA 1EKEA 2YV0X 4B9QA 2XRIA 5E41A 4CW7B 1RDCA 3ZT2A 1U4BA 1L5UA 3H46O 1BG3A 4HUGA 5CHIA 5CYMA 2P9PB 4BDYA 1NJWA 1WB9A 4KB0A 5D3GA 2XY5A 2WTUA 2UXCK 2E5LK 3AVFA 2P9KB 1DT9A 1IBKK 3BP8A 3EEQA 4PL8A 3VQAA 5BPMA 5J2QA 3H08A 2QKKA 3DXKA 1MDUB 3WUHA 4X64K 3ZX0A 1NJIO 1D9DA 4W5NA 3HPOA 1KD1O 4KPYA 1WAJA 4NO7A 2YJFA 3U6FA 1W2BM 4Y0WA 1FKPA 3CHWA 1JL2A 4HTUA 3K0SA 1NK0A 1HX1A 3IKMA 5FROA 4M3UA 3AVGA 1HYSA 4FJKA 3KK3A 3PY8A 4B1XB 4X62K 4EP5A 4I7FA 1Q18A 3QO9A 4YOTA 4BROA 1KFSA 2JGUA 5JS1A 1YTUA 4FJJA 4FXDA 4GMJB 3WT0A 5J1EA 4DHYA 1VRUA 4K25A 4OKJA 4K8ZA 3LAKA 4OGCA 2ZM6K 1IBLK 5FDLA 4FL9A 3P31A 5C12A 4BRDA 1QSYA 3CQ8A 4I6MA 4M7XA 4B9SA 2OZMA 3L2WA 3I0SA 4NXMK 1C0FA 3KZBA 1NU0A 4GKJK 5LY3A 2B4JA 4H4OA 1HYZA 1TK8A 3A2FA 4F9OA 1D9FA 3KWGA 4E1MA 2QA4N 2NRVA 5BREA 4IO9L 3HL8A 1XC9A 1JLEA 4M3WA 4IOXA 2QWQA 2ZF5O 5AR0A 3UKUA 5C25A 3D2EA 1NG9A 4KTQA 3SV3A 1ATSA 4E1NA 2HNYA 4TSXA 4WQ4C 4CZIA 3I0RA 4DR5K 3T1YK 1U04A 1M90O 4NYFA 1YXQA 3KJVA 2CH5A 2VQFK 3UB5A 4YY3K 1Z26A 1HUXA 4ELUA 4CJ4A 4WQ5C 1ZYQA 1M1KO 5LL6Z 2W6LA 3T3FA 4YOUA 5JVHL 3CC7N 4PUOA 2EX3A 3TSUA 1HJRA 5BRHA 3A5NC 1Y97A 1RNHA 4FWKA 4DR3K 3THVA 4DF4A 1XNRK 2WFBA 3VEYA 3SJHA 4BRLA 4ZTJA 1CZAN 3L6QA 4BG9A 3QBWA 4DR1K 3SZ2A 1ASWA 1J6ZA 3PIOL 2I5JA 4RW9A 3ZSXA 2P9NA 3V1QA 1NGFA 1SKSA 3L3UA 1HPMA 4JNEA 4BVOA 1YAGA 4HWIA 5KQ8A 4LFCK 4DTRA 1Q9XA 1HKBA 4JKBA 1KAXA 2CGLA 5K14A 3M3ZA 4FVUA 4JI5K 2KW4A 3CCJN 1ZBIA 1D4XA 1VSLA 4CGJA 3PO4A 1N34K 4MO4A 1IV0A 3ID8A 5AQYA 2YKMA 3F9KA 3O8MA 1L3SA 3GBTA 4BREA 3JAMO 2BTFA 3QFPA 1GLJO 3O4QA 4EHTA 2O8FB 1RBUA 4Z4GA 1LWFA 2A6AA 2BE2A 1NGGA 1QHTA 3B6PA 4LSNA 4DSEA 2F8SA 3VESA 5I9EB 1IKXA 2ASOA 1HR0K 3S3MA 3CIPA 1WNSA 4BRKA 4DB3A 3HXMA 1E4FT 3VGKA 3D0PA 4CJKA 5HRPA 4JK9A 1TUYA 3K5NA 3SPZA 3SMSA 3IMXA 3V81A 1RBVA 4K42A 3ZYYX 1RDAA 3MEGA 4JN4A 1EETA 2WBNA 4OPKA 3J80O 1V4SA 1QZ5A 4Z0UA 4CJSA 3D7EO 4JS4A 1IG8A 5AZJB 2JLEA 1JLFA 2O8BA 3LP3A 4CEQA 3OYBA 1SQKA 2KLAA 4FWOA 1P90A 4BRMA 4B9VA 4DFMA 4M63C 3CXCM 5ELZA 4AHRA 1RBTA 3VQPA 4M3XA 2FSJA 3EL2A 3SUNA 3KK1A 3TSQA 4LH4A 2FSKA 4AQYK 1KQSM 4CHZA 3J7AP 4U67L 4BY9C 1OVQA 3MX2A 2B6AA 1JXBA 3CJ9A 1T44A 2Y1IA 2IIRA 4W5TA 1NGIA 1TKDA 3NVMA 2P9LB 4MQ3A 4FWLA 5KPRA 3QEXA 4KRFA 5F2RA 2E2OA 4OX9K 3VQ6A 4E7LA 1W0HA 1BI4A 4JKHA 1YF5L 1QQOA 3U8XA 1HYVA 2D0OA 5SWMA 3O3FA 2QWLA 1I94K 3NFAA 4CIEA 1YI2N 4GY2B 1H1VA 4AILC 1X9JA 4K43A 2AP1A 4NYNA 3L2UA 1S22A 4QOZB 4ILHA 4JRQA 5AQTA
chains in the Genus database with same CATH topology
2FBVA 3OYKA 3VQEA 4F8RA 3G10A 3NDKA 1GOAA 3LAMA 3ZT4A 4HHTA 1J9AA 3SUOA 4B9MA 4L8RB 1TAUA 3KK2A 3OYJA 4PQUA 4E89A 4BDZA 4M45A 4BE1A 4DS5A 5HP1A 1S1TA 2R7YA 4CIGA 5KGXA 4B9LA 4GVMA 2AJQA 2Q3SA 4M3RA 3O3HA 5FRNA 3OYDA 1NK8A 4KHUA 3S3NA 4CFAA 4CHOA 3KLEA 3LWMA 1TL1A 4B8CA 1VSHA 3NGYA 1JLQA 5HRRA 1UOCA 3RTVA 4DQQA 4LH5A 4FLZA 3NH0A 1NK4A 4BE0A 3CFOA 5EU7A 1UA1A 2KFZA 4IKFA 4CGHA 3IRXA 1VSMA 3C6UA 3P5JA 3RMDA 3NF8A 3P83D 1NOZA 3SUPA 3QEVA 4E7JA 4CF0A 1BIUA 3NF6A 5DK5A 3NF7A 1NKCA 1KLNA 1RT2A 3VA0A 1RT7A 2RN2A 2QKBA 4N47A 4RW4A 2XY7A 4FM0A 3HVTA 3L2QA 1X9MA 1L3TA 4DQIA 1VSJA 3HPHA 3K2PA 1S6PA 3MAQA 4M3ZA 3CYMA 3HSTB 5JS2A 2HVIA 3AO5A 3V1OA 3AVAA 4Z4IA 3V6DA 4PWDA 3KLFA 2Z1JA 3TAFA 5C42A 1RT1A 1BHLA 2EHGA 4E3SA 4AHVA 3TANA 1SKRA 4C8OA 4DQRA 4OLAA 1RDBA 3KLGA 1A5WA 2ITGA 3LP0A 4J2EA 3T19A 3RWUA 2RPIA 5HROA 1L3VA 4W5RA 2G8HA 4CJQA 3AO1A 1WSIA 4ID1A 1CXUA 1VSFA 1UAXA 1RT4A 3M8PA 4CHQA 1ZBHA 3PX4A 3PV8A 4RW7A 3HT3A 4DSLA 3TWHA 1NJXA 1NK5A 2G8WA 2RKIA 4FK2A 1LWCA 3OY9A 1Z25A 3QEIA 1J54A 4DSKA 4OKEA 1N6QA 4DQPA 3ASMA 3WNGA 4AHTA 4UQGA 4Z4FA 3PX0A 4DWIA 3M8QA 5J2PA 1KSPA 1J53A 2X6SA 4K8XA 4LD0A 3G0ZA 3K5OA 3RMCA 2ZD1A 2WOMA 3OVNA 2Y1JA 1TK0A 3OYIA 2PZSA 1CLQA 3QESA 4NCGA 3KLIA 1KFDA 4AH9A 4B8AB 2G8FA 1EX4A 2NUBA 3LPTA 1Q9YA 3AA5X 4FK0A 2GBZA 3SQ2A 4ICLA 4ELTA 2IC3A 4FJMA 3I8DA 2KZZA 1T05A 3VQDA 3OJUA 5HRNA 4HUEA 1LWEA 2FBXA 4DTMA 1QTMA 2HNDA 1SL0A 1VSKA 1QE1A 4ID5A 2IDOA 3MECA 3QNOA 1JLCA 1CZ9A 4CEBA 4HCBA 4CFBA 2ETJA 1KCFA 1KVBA 1X1PA 4CJUA 1RBSA 1MU2A 1KTQA 3MEEA 4FJ9A 1QS4A 3D45A 3DLBA 3QEWA 4DF8A 2XY8A 4CJLA 1NK6A 4E7HA 4DSIA 2YNFA 3SYZA 1IKWA 2HHVA 3RR8A 4CHNA 4ELVA 4Q5VA 3AA4A 1NOYA 2VG7A 1WLJA 3TI0A 1WSFA 1JLAA 3ULDA 2G8VA 2PYJA 4MFBA 3VQ5A 4Q0BA 3IAYA 2ZE2A 4IDKA 1WSJA 4JS5A 4BACA 1J5OA 4FZYA 1FXXA 4AHCA 3K5MA 3MEDA 1F21A 4CEAA 1B92A 1O1WA 2F96A 4CJFA 3PX6A 3O4NA 4FLYA 3RRGA 4DU4A 2XHBA 5I42A 3ZSYA 3DOKA 4LY7A 1JLBA 3CM6A 4CF2A 4LSLA 3EYZA 3QETA 1NJYA 4J2BA 4OLBA 1RTJA 5KI6A 3EY1A 3RRHA 3RMAA 3TAQA 1QSSA 1VSIA 4O0JA 4Z4CA 3QERA 2YNIA 3BGRA 3ISNC 4I9LA 3SCXA 1TKTA 2IS3A 4CJPA 3V4IA 3CFRA 1EKEA 2YV0X 2HHQA 2XRIA 2WONA 3ZT0A 5E41A 1RDCA 2X74A 2X78A 3LP2A 3ZT2A 1HPZA 4CJTA 3QNNA 1U4BA 1TK5A 4FM1A 5SZTA 1L5UA 1BQMA 3ZSZA 1C0UA 3NHGA 4HUGA 4CGFA 4FLUA 3SPYA 2DFFA 5CYMA 4CF1A 4DU3A 4F4KA 4BDYA 1A5VA 1S1VA 1IH7A 4DTSA 3OYLA 1TAQA 5KRTA 1NJWA 3L2RA 4KB0A 2B5JA 1RT6A 5D3GA 3NGZA 2XY5A 4CK3A 1U49A 2HVHA 1ITGA 1WSEA 4CJ5A 3VQBA 1LW0A 4B08A 3V9UA 2YNGA 1XHXA 4CEFA 1S6QA 3T1AA 3ZSOA 3QIPA 3AVFA 1TV6A 3V9ZA 4N56A 3O3GA 4E0DA 4DTOA 2DY4A 3OYMA 5J2QA 1I39A 3VQAA 4FM2A 5HLFA 1HRHA 2F8TA 3H08A 3ZSVA 1ASUA 4CGGA 3AVIA 2QKKA 3BDPA 4CK1A 1D9DA 4KI6A 4W5NA 5CY4A 3AVCA 3QLHA 3HPOA 4J2AA 4KI4A 4KPYA 1WAJA 4IFYA 1S1WA 3U6FA 1BQNA 4CERA 1FKPA 3QINA 3VQ7A 4AHUA 1JL2A 1NJZA 2HHUA 1JKHA 3DRPA 2BANA 4FW2A 4HTUA 4B9NA 4FLXA 4OGEA 4EZ6A 1G15A 1B9FA 4M41A 4O4GA 3ZSQA 1NK0A 3NCIA 4CEDA 1DTTA 5FROA 4M3UA 3AVMA 3AVGA 4DLEA 1HYSA 1D5AA 4FJKA 3KK3A 3PY8A 4FLVA 1IO2A 3LP1A 4I7FA 3QO9A 4EP5A 3K58A 1KFSA 3TR8A 2BGGA 2JGUA 4CIFA 3SI6A 4EZ9A 1T7PA 5JS1A 3LZIA 1YTUA 3SQ1A 2VG6A 4FJJA 3OYGA 4FXDA 4GMJB 1RBRA 1S9EA 4J2DA 3OJSA 1GOBA 5J1EA 4DTUA 4FZXC 1VRUA 1RILA 3PUFA 2E6MA 3ZT1A 3V9XA 2KFNA 4JRPA 3CFPA 4OKJA 4N41A 1LW2A 3CM5A 3TAEA 3SQ4A 5I3UA 4K8ZA 3LAKA 1WAFA 4OGCA 1TL3A 4Y1DA 4BWJA 4ZHRA 3HP6A 3S9HA 4C8MA 5FDLA 1ASVA 3F73A 2FC0A 3LZJA 1XWLA 4Z4HA 1QSYA 4DSJA 1WSHA 4R5PA 3CQ8A 5HRSA 3LWLA 2Z1HA 4DU1A 4B9SA 4RW8A 4Y1CA 2OZMA 3SQ0A 3L2WA 1WN7A 3LPUA 1S1XA 4E7KA 4PY5A 1SUQA 3I0SA 2VG5A 2O4IA 1NKBA 1S5JA 2P5OA 1HQEA 4I9QA 3OS0A 2X6NA 1SKWA 3AVHA 3AVKA 1HNIA 3KKSA 3QIOA 4OVLA 3KD1E 2HNZA 3VA3A 2B4JA 3AO2A 1N5YA 1EXQA 3DLKA 3DOLA 4H4OA 2P5GA 1HYZA 4FJGA 4FJ5A 1C0MA 4KO0A 1TK8A 3A2FA 3HVRA 1SL2A 1D9FA 2G8KA 2KZMA 2A1RA 2OYQA 3FFIA 4E1MA 4KKOA 2Z1GA 2DTUA 4DG1A 1LV5A 2O4GA 1YT3A 2FBTA 3HL8A 1BCOA 2W42A 1XC9A 2YHAA 1L3UA 1JLEA 3NE6A 1U48A 4M3WA 5KTQA 3KKRA 4FJNA 3AO3A 2YHBA 1A5XA 4YFUA 4YNQA 4BDPA 5C25A 4CJ3A 4FJXA 1JXEA 1SL1A 1CZBA 4DTJA 3JSMA 4KTQA 3SV3A 4E1NA 4W5QA 2HNYA 3M8SA 4KAZA 4TSXA 4KHNA 4FJ8A 1TGOA 3WNHA 3L3VA 3I0RA 4WE1A 1C0TA 1U04A 4NYFA 1TKZA 3KJVA 4ELUA 1Z26A 2RF2A 3C94A 4CJ4A 1JL1A 1ZYQA 2HHSA 3T3FA 3SNNA 4CEOA 4NCBA 4CF9A 1X9WA 5CYQA 4FJ7A 3OYNA 3OYEA 1GOCA 4CFDA 4KHWA 1IKYA 4M3TA 2LSNA 4IBNA 4PUOA 3U3YA 1TKXA 4QCLA 2KQ2A 4C8LA 2EX3A 4F3TA 1HJRA 3MXJA 1Y97A 2YKNA 5DMRA 1RNHA 3VQ4A 4O0IA 3L2VA 3U3GA 3THVA 2PY5A 4DF4A 4CHYA 2G8UA 3VQ9A 3LDSA 2D0AA 3LALA 3IG1A 4FVMA 1B9DA 4I2PA 3JYTA 1UA0A 3OYCA 4ZTJA 3AA3A 1IG9A 1C1CA 4Z4EA 3V9SA 1W9HA 2VWJA 4HUFA 2KTQA 3SZ2A 1LAVA 1ASWA 1EP4A 4KTZA 4NCAA 5KRSA 3HPGA 2I5JA 2VWKA 2HW3A 4RW9A 2HB5A 3ZSXA 2OPRA 4RG8A 2Z1IA 3V1QA 4DFPA 4CJEA 3DLEA 1Q8IA 4RW6A 3PO5A 4F3OA 1SKSA 3L3UA 1RT5A 3VQQA 3VN5A 1T8EA 1ZBFA 4HCCA 3NBPA 1U45A 1T03A 3HYFA 3NF9A 4KREA 3NAEA 2GV9A 4DTRA 1Q9XA 4CEZA 1FKOA 4OJRA 3DMJA 1KLMA 5K14A 3ZT3A 4CCHA 3SUQA 2KW4A 4FK4A 1ZBIA 1REVA 1VSLA 3OS2A 3E01A 3WNFA 4CGJA 3PO4A 2DFEA 3ITHA 4M3YA 4E19A 4C8NA 1KRPA 2FBYA 3P1GA 3EZ5A 2YKMA 3AV9A 3WNEA 1UWBA 4CE9A 3F9KA 3TAGA 3DRSA 1IKVA 4O5BA 2IGIA 1L3SA 4DS4A 1S1UA 4OPJA 1TVRA 3OYHA 1BL3A 1ZBUA 1DLOA 3AA2A 3O4QA 4F2RA 2HMIA 1RBUA 1C6VA 1KVCA 4CGIA 3S3OA 1LWFA 1NK7A 1RTDA 4KB1A 4Z4GA 4KFBA 2BE2A 3AVJA 4PA1A 5CZ2A 5T7BA 4CEEA 3M8RA 1X9SA 1QHTA 3B6PA 4LSNA 3HM9A 3OS1A 4DSEA 2BDPA 2F8SA 4KV8A 3ZCMA 2XY6A 3QEPA 2OZSA 1RTHA 2HHTA 2HHWA 3MXMA 1IKXA 4FW1A 4FJIA 3S3MA 1HNVA 4GW6A 4IFVA 4CJVA 4DFJA 1R0AA 3HK2A 1WNSA 3C6TA 3RMBA 3B6OA 1RDDA 2IAJA 4FLWA 5J2NA 3HXMA 3L8BA 3K5LA 5KGWA 4DTNA 1D8YA 2E6LA 3NH1A 4B9TA 1QQCA 4DMNA 3K57A 4H4MA 2ZQBA 3D0PA 3V1RA 4CJKA 1K6YA 5HRPA 4W5OA 5FRMA 4CECA 4IG3A 1JLGA 4IG0A 3DM2A 1FK9A 4G1QA 1BISA 3K5NA 4EP4A 4E7IA 3SPZA 3HP9A 3V81A 2YNHA 1RBVA 3AO4A 1BGXT 1U47A 1RDAA 3MEGA 1HMVA 2G8IA 1VSEA 3AVNA 1EETA 4XIUA 4OPKA 3CG7A 1C1BA 1VK0A 4CFCA 4FJHA 4Z0UA 2PYLA 4CJSA 3VQCA 3TAMA 4ZTFA 2D0CA 3DRRA 3DYAA 4JS4A 3C95A 2JLEA 1JLFA 3LP3A 4CEQA 2GUIA 3OYBA 1BCMA 2XO7A 4KHQA 1VSDA 1C1AA 3KTQA 4BWMA 5CZ1A 3ZSRA 4DFMA 4B9VA 2ATQA 5J2MA 1RT3A 5C24A 4AHRA 1RBTA 1KVAA 3OYAA 4F2SA 4DTPA 3VQPA 3LANA 3AVLA 3SV4A 2DFHA 4DLGA 3TAPA 2D5RA 4M3XA 2D0BA 3DI6A 4KHYA 1XHZA 1NKEA 2OA8A 3V9WA 3SUNA 3KK1A 3AVBA 4CGDA 3TARA 4OKKA 4LH4A 4O55A 4CJRA 4CHZA 4CESA 1DTQA 2QXFA 3IS9A 4N5SA 4KHSA 2A1SA 3DLHA 3KLHA 2B6AA 3OYFA 1JXBA 2QK9A 3ZSWA 3RR7A 4FJLA 5HBMA 4JLHA 2Y1IA 1XI1A 3KD5E 4KTWA 4HVJA 4W5TA 4FLTA 1CXQA 1TKDA 1RTIA 3UIQA 1RCHA 4MQ3A 3QEXA 2HHXA 4KRFA 1SV5A 1ZBLA 4FYDA 3VQ6A 4QAGA 4E7LA 2OPPA 1W0HA 4CK2A 1BI4A 4N76A 4DFKA 2OPSA 3DLRA 3NH2A 1YTAA 2IOCA 3HJFA 1HYVA 4CF8A 4AHSA 2E4LA 4DSFA 5SWMA 3O3FA 4DTXA 3TABA 3DLGA 3NFAA 3ALYA 4CIEA 3HO1A 1LAWA 3NGIA 4AILC 3KIOA 1BI4B 3MXIA 1QSLA 4M42A 1VRTA 1I3AA 1HQUA 4FZZA 4H8KA 1S9GA 2P51A 4BE2A 4C8KA 1WSGA 4CJWA 3K59A 4I2QA 1BIZA 4NYNA 3L2UA 4DQSA 4B3OA 4O44A 4QOZB 2P1JA 4FCYA 1NK9A 2OPQA 4CHPA 4JRQA 4B9UA 3VQ8A 3SJJA 1YVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBV A;  3OYK A;  3VQE A;  4F8R A;  3G10 A;  3NDK A;  1GOA A;  3LAM A;  3ZT4 A;  4HHT A;  1J9A A;  3SUO A;  4B9M A;  4L8R B;  1TAU A;  3KK2 A;  3OYJ A;  4PQU A;  4E89 A;  4BDZ A;  4M45 A;  4BE1 A;  4DS5 A;  5HP1 A;  1S1T A;  2R7Y A;  4CIG A;  5KGX A;  4B9L A;  4GVM A;  2AJQ A;  2Q3S A;  4M3R A;  3O3H A;  5FRN A;  3OYD A;  1NK8 A;  4KHU A;  3S3N A;  4CFA A;  4CHO A;  3KLE A;  3LWM A;  1TL1 A;  4B8C A;  1VSH A;  3NGY A;  1JLQ A;  5HRR A;  1UOC A;  3RTV A;  4DQQ A;  4LH5 A;  4FLZ A;  3NH0 A;  1NK4 A;  4BE0 A;  3CFO A;  5EU7 A;  1UA1 A;  2KFZ A;  4IKF A;  4CGH A;  3IRX A;  1VSM A;  3C6U A;  3P5J A;  3RMD A;  3NF8 A;  3P83 D;  1NOZ A;  3SUP A;  3QEV A;  4E7J A;  4CF0 A;  1BIU A;  3NF6 A;  5DK5 A;  3NF7 A;  1NKC A;  1KLN A;  1RT2 A;  3VA0 A;  1RT7 A;  2RN2 A;  2QKB A;  4N47 A;  4RW4 A;  2XY7 A;  4FM0 A;  3HVT A;  3L2Q A;  1X9M A;  1L3T A;  4DQI A;  1VSJ A;  3HPH A;  3K2P A;  1S6P A;  3MAQ A;  4M3Z A;  3CYM A;  3HST B;  5JS2 A;  2HVI A;  3AO5 A;  3V1O A;  3AVA A;  4Z4I A;  3V6D A;  4PWD A;  3KLF A;  2Z1J A;  3TAF A;  5C42 A;  1RT1 A;  1BHL A;  2EHG A;  4E3S A;  4AHV A;  3TAN A;  1SKR A;  4C8O A;  4DQR A;  4OLA A;  1RDB A;  3KLG A;  1A5W A;  2ITG A;  3LP0 A;  4J2E A;  3T19 A;  3RWU A;  2RPI A;  5HRO A;  1L3V A;  4W5R A;  2G8H A;  4CJQ A;  3AO1 A;  1WSI A;  4ID1 A;  1CXU A;  1VSF A;  1UAX A;  1RT4 A;  3M8P A;  4CHQ A;  1ZBH A;  3PX4 A;  3PV8 A;  4RW7 A;  3HT3 A;  4DSL A;  3TWH A;  1NJX A;  1NK5 A;  2G8W A;  2RKI A;  4FK2 A;  1LWC A;  3OY9 A;  1Z25 A;  3QEI A;  1J54 A;  4DSK A;  4OKE A;  1N6Q A;  4DQP A;  3ASM A;  3WNG A;  4AHT A;  4UQG A;  4Z4F A;  3PX0 A;  4DWI A;  3M8Q A;  5J2P A;  1KSP A;  1J53 A;  2X6S A;  4K8X A;  4LD0 A;  3G0Z A;  3K5O A;  3RMC A;  2ZD1 A;  2WOM A;  3OVN A;  2Y1J A;  1TK0 A;  3OYI A;  2PZS A;  1CLQ A;  3QES A;  4NCG A;  3KLI A;  1KFD A;  4AH9 A;  4B8A B;  2G8F A;  1EX4 A;  2NUB A;  3LPT A;  1Q9Y A;  3AA5 X;  4FK0 A;  2GBZ A;  3SQ2 A;  4ICL A;  4ELT A;  2IC3 A;  4FJM A;  3I8D A;  2KZZ A;  1T05 A;  3VQD A;  3OJU A;  5HRN A;  4HUE A;  1LWE A;  2FBX A;  4DTM A;  1QTM A;  2HND A;  1SL0 A;  1VSK A;  1QE1 A;  4ID5 A;  2IDO A;  3MEC A;  3QNO A;  1JLC A;  1CZ9 A;  4CEB A;  4HCB A;  4CFB A;  2ETJ A;  1KCF A;  1KVB A;  1X1P A;  4CJU A;  1RBS A;  1MU2 A;  1KTQ A;  3MEE A;  4FJ9 A;  1QS4 A;  3D45 A;  3DLB A;  3QEW A;  4DF8 A;  2XY8 A;  4CJL A;  1NK6 A;  4E7H A;  4DSI A;  2YNF A;  3SYZ A;  1IKW A;  2HHV A;  3RR8 A;  4CHN A;  4ELV A;  4Q5V A;  3AA4 A;  1NOY A;  2VG7 A;  1WLJ A;  3TI0 A;  1WSF A;  1JLA A;  3ULD A;  2G8V A;  2PYJ A;  4MFB A;  3VQ5 A;  4Q0B A;  3IAY A;  2ZE2 A;  4IDK A;  1WSJ A;  4JS5 A;  4BAC A;  1J5O A;  4FZY A;  1FXX A;  4AHC A;  3K5M A;  3MED A;  1F21 A;  4CEA A;  1B92 A;  1O1W A;  2F96 A;  4CJF A;  3PX6 A;  3O4N A;  4FLY A;  3RRG A;  4DU4 A;  2XHB A;  5I42 A;  3ZSY A;  3DOK A;  4LY7 A;  1JLB A;  3CM6 A;  4CF2 A;  4LSL A;  3EYZ A;  3QET A;  1NJY A;  4J2B A;  4OLB A;  1RTJ A;  5KI6 A;  3EY1 A;  3RRH A;  3RMA A;  3TAQ A;  1QSS A;  1VSI A;  4O0J A;  4Z4C A;  3QER A;  2YNI A;  3BGR A;  3ISN C;  4I9L A;  3SCX A;  1TKT A;  2IS3 A;  4CJP A;  3V4I A;  3CFR A;  1EKE A;  2YV0 X;  2HHQ A;  2XRI A;  2WON A;  3ZT0 A;  5E41 A;  1RDC A;  2X74 A;  2X78 A;  3LP2 A;  3ZT2 A;  1HPZ A;  4CJT A;  3QNN A;  1U4B A;  1TK5 A;  4FM1 A;  5SZT A;  1L5U A;  1BQM A;  3ZSZ A;  1C0U A;  3NHG A;  4HUG A;  4CGF A;  4FLU A;  3SPY A;  2DFF A;  5CYM A;  4CF1 A;  4DU3 A;  4F4K A;  4BDY A;  1A5V A;  1S1V A;  1IH7 A;  4DTS A;  3OYL A;  1TAQ A;  5KRT A;  1NJW A;  3L2R A;  4KB0 A;  2B5J A;  1RT6 A;  5D3G A;  3NGZ A;  2XY5 A;  4CK3 A;  1U49 A;  2HVH A;  1ITG A;  1WSE A;  4CJ5 A;  3VQB A;  1LW0 A;  4B08 A;  3V9U A;  2YNG A;  1XHX A;  4CEF A;  1S6Q A;  3T1A A;  3ZSO A;  3QIP A;  3AVF A;  1TV6 A;  3V9Z A;  4N56 A;  3O3G A;  4E0D A;  4DTO A;  2DY4 A;  3OYM A;  5J2Q A;  1I39 A;  3VQA A;  4FM2 A;  5HLF A;  1HRH A;  2F8T A;  3H08 A;  3ZSV A;  1ASU A;  4CGG A;  3AVI A;  2QKK A;  3BDP A;  4CK1 A;  1D9D A;  4KI6 A;  4W5N A;  5CY4 A;  3AVC A;  3QLH A;  3HPO A;  4J2A A;  4KI4 A;  4KPY A;  1WAJ A;  4IFY A;  1S1W A;  3U6F A;  1BQN A;  4CER A;  1FKP A;  3QIN A;  3VQ7 A;  4AHU A;  1JL2 A;  1NJZ A;  2HHU A;  1JKH A;  3DRP A;  2BAN A;  4FW2 A;  4HTU A;  4B9N A;  4FLX A;  4OGE A;  4EZ6 A;  1G15 A;  1B9F A;  4M41 A;  4O4G A;  3ZSQ A;  1NK0 A;  3NCI A;  4CED A;  1DTT A;  5FRO A;  4M3U A;  3AVM A;  3AVG A;  4DLE A;  1HYS A;  1D5A A;  4FJK A;  3KK3 A;  3PY8 A;  4FLV A;  1IO2 A;  3LP1 A;  4I7F A;  3QO9 A;  4EP5 A;  3K58 A;  1KFS A;  3TR8 A;  2BGG A;  2JGU A;  4CIF A;  3SI6 A;  4EZ9 A;  1T7P A;  5JS1 A;  3LZI A;  1YTU A;  3SQ1 A;  2VG6 A;  4FJJ A;  3OYG A;  4FXD A;  4GMJ B;  1RBR A;  1S9E A;  4J2D A;  3OJS A;  1GOB A;  5J1E A;  4DTU A;  4FZX C;  1VRU A;  1RIL A;  3PUF A;  2E6M A;  3ZT1 A;  3V9X A;  2KFN A;  4JRP A;  3CFP A;  4OKJ A;  4N41 A;  1LW2 A;  3CM5 A;  3TAE A;  3SQ4 A;  5I3U A;  4K8Z A;  3LAK A;  1WAF A;  4OGC A;  1TL3 A;  4Y1D A;  4BWJ A;  4ZHR A;  3HP6 A;  3S9H A;  4C8M A;  5FDL A;  1ASV A;  3F73 A;  2FC0 A;  3LZJ A;  1XWL A;  4Z4H A;  1QSY A;  4DSJ A;  1WSH A;  4R5P A;  3CQ8 A;  5HRS A;  3LWL A;  2Z1H A;  4DU1 A;  4B9S A;  4RW8 A;  4Y1C A;  2OZM A;  3SQ0 A;  3L2W A;  1WN7 A;  3LPU A;  1S1X A;  4E7K A;  4PY5 A;  1SUQ A;  3I0S A;  2VG5 A;  2O4I A;  1NKB A;  1S5J A;  2P5O A;  1HQE A;  4I9Q A;  3OS0 A;  2X6N A;  1SKW A;  3AVH A;  3AVK A;  1HNI A;  3KKS A;  3QIO A;  4OVL A;  3KD1 E;  2HNZ A;  3VA3 A;  2B4J A;  3AO2 A;  1N5Y A;  1EXQ A;  3DLK A;  3DOL A;  4H4O A;  2P5G A;  1HYZ A;  4FJG A;  4FJ5 A;  1C0M A;  4KO0 A;  1TK8 A;  3A2F A;  3HVR A;  1SL2 A;  1D9F A;  2G8K A;  2KZM A;  2A1R A;  2OYQ A;  3FFI A;  4E1M A;  4KKO A;  2Z1G A;  2DTU A;  4DG1 A;  1LV5 A;  2O4G A;  1YT3 A;  2FBT A;  3HL8 A;  1BCO A;  2W42 A;  1XC9 A;  2YHA A;  1L3U A;  1JLE A;  3NE6 A;  1U48 A;  4M3W A;  5KTQ A;  3KKR A;  4FJN A;  3AO3 A;  2YHB A;  1A5X A;  4YFU A;  4YNQ A;  4BDP A;  5C25 A;  4CJ3 A;  4FJX A;  1JXE A;  1SL1 A;  1CZB A;  4DTJ A;  3JSM A;  4KTQ A;  3SV3 A;  4E1N A;  4W5Q A;  2HNY A;  3M8S A;  4KAZ A;  4TSX A;  4KHN A;  4FJ8 A;  1TGO A;  3WNH A;  3L3V A;  3I0R A;  4WE1 A;  1C0T A;  1U04 A;  4NYF A;  1TKZ A;  3KJV A;  4ELU A;  1Z26 A;  2RF2 A;  3C94 A;  4CJ4 A;  1JL1 A;  1ZYQ A;  2HHS A;  3T3F A;  3SNN A;  4CEO A;  4NCB A;  4CF9 A;  1X9W A;  5CYQ A;  4FJ7 A;  3OYN A;  3OYE A;  1GOC A;  4CFD A;  4KHW A;  1IKY A;  4M3T A;  2LSN A;  4IBN A;  4PUO A;  3U3Y A;  1TKX A;  4QCL A;  2KQ2 A;  4C8L A;  2EX3 A;  4F3T A;  1HJR A;  3MXJ A;  1Y97 A;  2YKN A;  5DMR A;  1RNH A;  3VQ4 A;  4O0I A;  3L2V A;  3U3G A;  3THV A;  2PY5 A;  4DF4 A;  4CHY A;  2G8U A;  3VQ9 A;  3LDS A;  2D0A A;  3LAL A;  3IG1 A;  4FVM A;  1B9D A;  4I2P A;  3JYT A;  1UA0 A;  3OYC A;  4ZTJ A;  3AA3 A;  1IG9 A;  1C1C A;  4Z4E A;  3V9S A;  1W9H A;  2VWJ A;  4HUF A;  2KTQ A;  3SZ2 A;  1LAV A;  1ASW A;  1EP4 A;  4KTZ A;  4NCA A;  5KRS A;  3HPG A;  2I5J A;  2VWK A;  2HW3 A;  4RW9 A;  2HB5 A;  3ZSX A;  2OPR A;  4RG8 A;  2Z1I A;  3V1Q A;  4DFP A;  4CJE A;  3DLE A;  1Q8I A;  4RW6 A;  3PO5 A;  4F3O A;  1SKS A;  3L3U A;  1RT5 A;  3VQQ A;  3VN5 A;  1T8E A;  1ZBF A;  4HCC A;  3NBP A;  1U45 A;  1T03 A;  3HYF A;  3NF9 A;  4KRE A;  3NAE A;  2GV9 A;  4DTR A;  1Q9X A;  4CEZ A;  1FKO A;  4OJR A;  3DMJ A;  1KLM A;  5K14 A;  3ZT3 A;  4CCH A;  3SUQ A;  2KW4 A;  4FK4 A;  1ZBI A;  1REV A;  1VSL A;  3OS2 A;  3E01 A;  3WNF A;  4CGJ A;  3PO4 A;  2DFE A;  3ITH A;  4M3Y A;  4E19 A;  4C8N A;  1KRP A;  2FBY A;  3P1G A;  3EZ5 A;  2YKM A;  3AV9 A;  3WNE A;  1UWB A;  4CE9 A;  3F9K A;  3TAG A;  3DRS A;  1IKV A;  4O5B A;  2IGI A;  1L3S A;  4DS4 A;  1S1U A;  4OPJ A;  1TVR A;  3OYH A;  1BL3 A;  1ZBU A;  1DLO A;  3AA2 A;  3O4Q A;  4F2R A;  2HMI A;  1RBU A;  1C6V A;  1KVC A;  4CGI A;  3S3O A;  1LWF A;  1NK7 A;  1RTD A;  4KB1 A;  4Z4G A;  4KFB A;  2BE2 A;  3AVJ A;  4PA1 A;  5CZ2 A;  5T7B A;  4CEE A;  3M8R A;  1X9S A;  1QHT A;  3B6P A;  4LSN A;  3HM9 A;  3OS1 A;  4DSE A;  2BDP A;  2F8S A;  4KV8 A;  3ZCM A;  2XY6 A;  3QEP A;  2OZS A;  1RTH A;  2HHT A;  2HHW A;  3MXM A;  1IKX A;  4FW1 A;  4FJI A;  3S3M A;  1HNV A;  4GW6 A;  4IFV A;  4CJV A;  4DFJ A;  1R0A A;  3HK2 A;  1WNS A;  3C6T A;  3RMB A;  3B6O A;  1RDD A;  2IAJ A;  4FLW A;  5J2N A;  3HXM A;  3L8B A;  3K5L A;  5KGW A;  4DTN A;  1D8Y A;  2E6L A;  3NH1 A;  4B9T A;  1QQC A;  4DMN A;  3K57 A;  4H4M A;  2ZQB A;  3D0P A;  3V1R A;  4CJK A;  1K6Y A;  5HRP A;  4W5O A;  5FRM A;  4CEC A;  4IG3 A;  1JLG A;  4IG0 A;  3DM2 A;  1FK9 A;  4G1Q A;  1BIS A;  3K5N A;  4EP4 A;  4E7I A;  3SPZ A;  3HP9 A;  3V81 A;  2YNH A;  1RBV A;  3AO4 A;  1BGX T;  1U47 A;  1RDA A;  3MEG A;  1HMV A;  2G8I A;  1VSE A;  3AVN A;  1EET A;  4XIU A;  4OPK A;  3CG7 A;  1C1B A;  1VK0 A;  4CFC A;  4FJH A;  4Z0U A;  2PYL A;  4CJS A;  3VQC A;  3TAM A;  4ZTF A;  2D0C A;  3DRR A;  3DYA A;  4JS4 A;  3C95 A;  2JLE A;  1JLF A;  3LP3 A;  4CEQ A;  2GUI A;  3OYB A;  1BCM A;  2XO7 A;  4KHQ A;  1VSD A;  1C1A A;  3KTQ A;  4BWM A;  5CZ1 A;  3ZSR A;  4DFM A;  4B9V A;  2ATQ A;  5J2M A;  1RT3 A;  5C24 A;  4AHR A;  1RBT A;  1KVA A;  3OYA A;  4F2S A;  4DTP A;  3VQP A;  3LAN A;  3AVL A;  3SV4 A;  2DFH A;  4DLG A;  3TAP A;  2D5R A;  4M3X A;  2D0B A;  3DI6 A;  4KHY A;  1XHZ A;  1NKE A;  2OA8 A;  3V9W A;  3SUN A;  3KK1 A;  3AVB A;  4CGD A;  3TAR A;  4OKK A;  4LH4 A;  4O55 A;  4CJR A;  4CHZ A;  4CES A;  1DTQ A;  2QXF A;  3IS9 A;  4N5S A;  4KHS A;  2A1S A;  3DLH A;  3KLH A;  2B6A A;  3OYF A;  1JXB A;  2QK9 A;  3ZSW A;  3RR7 A;  4FJL A;  5HBM A;  4JLH A;  2Y1I A;  1XI1 A;  3KD5 E;  4KTW A;  4HVJ A;  4W5T A;  4FLT A;  1CXQ A;  1TKD A;  1RTI A;  3UIQ A;  1RCH A;  4MQ3 A;  3QEX A;  2HHX A;  4KRF A;  1SV5 A;  1ZBL A;  4FYD A;  3VQ6 A;  4QAG A;  4E7L A;  2OPP A;  1W0H A;  4CK2 A;  1BI4 A;  4N76 A;  4DFK A;  2OPS A;  3DLR A;  3NH2 A;  1YTA A;  2IOC A;  3HJF A;  1HYV A;  4CF8 A;  4AHS A;  2E4L A;  4DSF A;  5SWM A;  3O3F A;  4DTX A;  3TAB A;  3DLG A;  3NFA A;  3ALY A;  4CIE A;  3HO1 A;  1LAW A;  3NGI A;  4AIL C;  3KIO A;  1BI4 B;  3MXI A;  1QSL A;  4M42 A;  1VRT A;  1I3A A;  1HQU A;  4FZZ A;  4H8K A;  1S9G A;  2P51 A;  4BE2 A;  4C8K A;  1WSG A;  4CJW A;  3K59 A;  4I2Q A;  1BIZ A;  4NYN A;  3L2U A;  4DQS A;  4B3O A;  4O44 A;  4QOZ B;  2P1J A;  4FCY A;  1NK9 A;  2OPQ A;  4CHP A;  4JRQ A;  4B9U A;  3VQ8 A;  3SJJ A;  1YVU A; 
#chains in the Genus database with same CATH topology
 3OYK A;  3G10 A;  4CZE A;  3NDK A;  3CME N;  3OYJ A;  5HL7 L;  4JD2 A;  4PQU A;  1S1T A;  2R7Y A;  3F2K A;  4B9L A;  2Q3S A;  4DR7 K;  2YX6 A;  5E84 A;  4H5T A;  3OYD A;  4A59 A;  4CFA A;  3C6H A;  4JI6 K;  3SAH A;  1VSH A;  1JLQ A;  5HRR A;  4BRP A;  4H5W A;  1NK4 A;  4BE0 A;  3D6R A;  2KFZ A;  4DUZ K;  4IKF A;  5AQS A;  3C6U A;  3RMD A;  3NF8 A;  1ZC6 A;  3QEV A;  4JI7 K;  2E1Z A;  4N47 A;  2PBD A;  4QS8 A;  1X9M A;  4DQI A;  4XH4 A;  3K2P A;  3MAQ A;  1NLV A;  2EWS A;  5JS2 A;  4DV3 K;  2E20 A;  3KLF A;  2GWJ A;  5C42 A;  4AHV A;  4PKG A;  4QS7 A;  3CJ1 A;  1FJG K;  1NMN A;  3KLG A;  1XMQ K;  3GDQ A;  3T19 A;  4W5R A;  3MDQ A;  1CXU A;  1VSF A;  1ZBH A;  2FXU A;  4CBX A;  3I55 N;  1KXP A;  4FOI A;  2G8W A;  2RKI A;  2IVP A;  1LWC A;  3OY9 A;  3O5B A;  4OKE A;  3VMF B;  3ASM A;  4UQG A;  1VAZ A;  4Z4F A;  5J2P A;  1J53 A;  2X6S A;  4K8X A;  3THW A;  3G0Z A;  2Y1J A;  3OVN A;  2A3Z A;  1CLQ A;  3CCS N;  3FZH A;  1KFD A;  2NRW A;  2NUB A;  1EWR A;  3LPT A;  1JCF A;  1Q9Y A;  3AA5 X;  4CBU A;  2JWK A;  3VQD A;  4HUE A;  3UE5 A;  3FE1 A;  2HHH K;  1OH7 A;  1QE1 A;  1JLC A;  3MX5 A;  3DLB A;  2D1K A;  4DSI A;  1E3M A;  4WFB L;  4C23 A;  3RR8 A;  3TI0 A;  1WSF A;  1JLA A;  3ULD A;  4Q0B A;  3IAY A;  4IDK A;  4ILG B;  4DCH A;  4FZY A;  2QW9 A;  1MWK A;  4FLY A;  4DU4 A;  2V52 B;  2XHB A;  1NMD A;  3FGU A;  2VGM A;  3DOK A;  2ZJP L;  3CM6 A;  4J2B A;  3CI5 A;  3QET A;  3KK7 A;  2O8C A;  1VSI A;  5JLH A;  5AQL A;  2YNI A;  3BGR A;  3SCX A;  5KQD A;  2IS3 A;  5GIP A;  2P9P A;  4WYB A;  3ZT0 A;  2X74 A;  3LP2 A;  4DV7 K;  1TK5 A;  3ZSZ A;  1K8A O;  1C0U A;  3I33 A;  5EOY A;  3RVC A;  3EKU A;  3TU5 A;  4LF7 K;  2P9K A;  3OBW A;  1A5V A;  1S1V A;  3BZC A;  1IH7 A;  4BVP A;  5M1F A;  5KRT A;  3G25 A;  4CK3 A;  4IJN A;  4CJ5 A;  1BA0 A;  3CJB A;  4CEF A;  3T1A A;  2DY4 A;  1TV6 A;  3OYM A;  1HRH A;  3FR0 A;  5BRF A;  4CGG A;  1ASU A;  3AVI A;  5C2D A;  4CK1 A;  4V19 S;  4R79 A;  3QLH A;  4GV9 A;  1HNZ K;  1S1W A;  1GLE G;  2HF3 A;  4DV2 K;  5GIN A;  4B1V A;  4CZH A;  1JCE A;  2HHU A;  1B9F A;  3ZSQ A;  2VWB A;  4CED A;  5AQX A;  3GOI A;  4DV5 K;  1IO2 A;  4A2A A;  2H3G X;  4CIF A;  3LZI A;  2O8D A;  3SQ1 A;  2VG6 A;  4O8U A;  1RBR A;  4IJA A;  3OJS A;  4DTU A;  4FZX C;  1RIL A;  4LFB K;  4N41 A;  4JI1 K;  3R1X A;  1P8Z A;  4ZHR A;  2QWN A;  3H1Q A;  3O4W A;  2ASM A;  4B1Z A;  1WSH A;  3LWL A;  5DM7 L;  4DU1 A;  4IWV A;  4ILJ A;  2VG5 A;  2P5O A;  3L4I A;  1NM1 A;  3AVH A;  2NLX A;  3QIO A;  4OVL A;  3CQX A;  1NGD A;  5M1P A;  1N5Y A;  4YOV A;  4FJ5 A;  3WQT A;  4CJ7 A;  4FJG A;  5LJV A;  4KH6 A;  2G8K A;  3ZET B;  2KZM A;  2OYQ A;  3FFI A;  4A5B A;  4KKO A;  3CF5 L;  4DG1 A;  1LV5 A;  2O4G A;  1YT3 A;  2FBT A;  1RDW X;  2HF4 A;  5IT9 O;  2W42 A;  4BGA A;  3NE6 A;  4IOC L;  4FJN A;  3AO3 A;  4DUY K;  3D2F A;  2IVN A;  4YNQ A;  4CJ3 A;  3HZ6 A;  4BR2 A;  1SL1 A;  1J5E K;  4CZG A;  1U2V B;  4KAZ A;  3L3V A;  3VPZ A;  1NGJ A;  1TKZ A;  2RF2 A;  4CBW A;  1JL1 A;  3MCP A;  2Q2R A;  4CEO A;  3MMV A;  5CYQ A;  3CQY A;  4KHW A;  3OYE A;  4CFD A;  5KPT A;  4IBN A;  4QCL A;  2HMP A;  2KQ2 A;  3H1V X;  3VQ4 A;  2O8C B;  2PY5 A;  3OHR A;  2UXD K;  3QBX A;  1VQ5 N;  3I56 N;  1B9D A;  4I2P A;  3CPE A;  4BRC A;  1UA0 A;  2NRH A;  3AA3 A;  4Z4E A;  1W9H A;  2KTQ A;  1ILY A;  3M6G A;  4NCA A;  4M7Y A;  1QQM A;  5KRS A;  2VWK A;  2HW3 A;  1DKG D;  3DLE A;  1DEJ A;  4RW6 A;  4F3O A;  5AQW A;  5EVZ A;  1RT5 A;  2ASP A;  4FPB A;  3VQQ A;  3VN5 A;  4C1N I;  1T03 A;  4CEZ A;  1FKO A;  3DMJ A;  5C15 A;  4CCH A;  3SUQ A;  4FK4 A;  1REV A;  5B8H A;  3OS2 A;  3E01 A;  3T69 A;  3WNF A;  3ITH A;  2O8F A;  4M3Y A;  4E19 A;  2E2N A;  4C8N A;  4RTF D;  3P1G A;  3EZ5 A;  3LDO A;  4O5B A;  2IGI A;  2VQE K;  1S1U A;  4OPJ A;  4KHP K;  4CVN E;  2A42 A;  3I8B A;  1DLO A;  3AA2 A;  1C6V A;  4KB1 A;  1RTD A;  4KFB A;  3AVJ A;  4PA1 A;  5CZ2 A;  5T7B A;  3M8R A;  1X9S A;  5GAG P;  4EFH A;  3QEP A;  3QDK A;  1RTH A;  3BF1 A;  5GAH P;  2E2P A;  4GW6 A;  3TPQ A;  4CJV A;  4DFJ A;  1R0A A;  3C6T A;  3RMB A;  1HNX K;  1RDD A;  4FLW A;  2O8D B;  1BOT O;  3L8B A;  4DTN A;  3NH1 A;  4B9T A;  4MLH A;  4EAH D;  5FRM A;  4CEC A;  1FK9 A;  4E7I A;  3NMU A;  5AZJ A;  1YHQ N;  4C1N K;  1NGB A;  5BR8 K;  3AAP A;  1U47 A;  3O9U A;  1VQL N;  1HMV A;  2G8I A;  1VSE A;  3VF4 A;  1C1B A;  3HM8 A;  4FJH A;  4ZTF A;  3DRR A;  3C0B A;  4FOE A;  4IEI A;  2E88 A;  1GLF O;  3A5L C;  1VSD A;  2VGN A;  2ATQ A;  1RT3 A;  3KVG A;  5C24 A;  1KVA A;  3SMP A;  3OYA A;  4DTP A;  1T6D A;  4DLG A;  3W0L A;  2D5R A;  3KHY A;  1NKE A;  2P9L A;  2OA8 A;  3AVB A;  4O55 A;  4GKK K;  1DTQ A;  3MWP A;  3UKR B;  4N5S A;  2GEL A;  3KLH A;  3VOV A;  3R9P A;  3D2F B;  5HBM A;  4JLH A;  4KTW A;  1RTI A;  3C7N B;  4H5N A;  1SV5 A;  4JHD B;  4JAX A;  4O8K A;  1ZBL A;  4QAG A;  5M1K A;  4BC2 A;  4MDA A;  3NH2 A;  3DLR A;  5ADX H;  1VQK N;  4NB4 A;  4CF8 A;  4DSF A;  2UYT A;  3DLG A;  3ALY A;  2OTL N;  2UUB K;  4A5A A;  3NGI A;  3MXI A;  1QSL A;  4H8K A;  2P51 A;  3LM2 A;  1WSG A;  1MWM A;  4CJW A;  4I2Q A;  4LF8 K;  4B3O A;  4O44 A;  1OH8 A;  4B9U A;  1C0G A;  3SJJ A;  1VQO N;  3SAG A;  3ULE B;  3VQE A;  3LAM A;  1RDU A;  3KK2 A;  1GLB G;  3ID6 A;  1VQ4 N;  4E89 A;  4DS5 A;  4BE1 A;  5HP1 A;  4CIG A;  5KGX A;  4JI0 K;  3O3H A;  1QVF M;  4BR7 A;  3S3N A;  4KHU A;  5A2Q O;  3LWM A;  3AY9 A;  3O80 A;  3NGY A;  5CR4 A;  3IDH A;  4LH5 A;  3NH0 A;  3IRX A;  4FSV A;  5AQJ A;  3NF7 A;  1YIT N;  1RT2 A;  3VA0 A;  2QKB A;  4JI8 K;  1NNE A;  3L2Q A;  4BC5 A;  1VSJ A;  4IDH A;  3CYM A;  1QQN A;  3V1O A;  4IXC A;  3AVA A;  3V6D A;  3THY B;  2EHG A;  1SKR A;  2W41 A;  4J2E A;  3RWU A;  5HRO A;  2G8H A;  5AQK A;  1WSI A;  3BZK A;  4BRA A;  3M8P A;  1S3X A;  3PIP L;  1NJX A;  4DV1 K;  2J4R A;  2PFU A;  1J54 A;  3EN9 A;  4JKE A;  2FF3 B;  3QEI A;  4K41 A;  3PX0 A;  4DWI A;  1FW6 A;  3CCE N;  1SZ2 A;  2ZD1 A;  5M1N A;  4K0K K;  4YOX A;  1IJJ A;  4NCG A;  4BR5 A;  3KLI A;  4KH5 A;  1BU6 O;  2GBZ A;  1OVY A;  2KZZ A;  1T05 A;  2FBX A;  4DTM A;  2W40 A;  1HKC A;  3CCU N;  4JI2 K;  2KHO A;  3MEC A;  4FWP A;  1CZ9 A;  5TKW A;  1YIJ N;  4JV5 K;  1KCF A;  3TTC A;  1RBS A;  2WUS A;  1MU2 A;  1WUA A;  4FJ9 A;  3D45 A;  4YDU A;  5GIO A;  4CZM A;  3FZF A;  4CHN A;  4B3R K;  1NOY A;  2Q1N A;  1WLJ A;  2PYJ A;  2ZE2 A;  1WSJ A;  4AHC A;  4DV6 K;  4CEA A;  4EHU A;  4CJF A;  1O1W A;  2F96 A;  3O4N A;  1Q82 O;  5I42 A;  1JLB A;  1XNQ K;  1NJY A;  4LSL A;  3EY1 A;  3RRH A;  5F1X A;  3CJ7 A;  3WXK A;  4Z4C A;  3CC2 N;  1SAZ A;  4CJP A;  3V4I A;  3CFR A;  4GVE A;  4LC9 B;  2X78 A;  3AAQ A;  3P39 A;  4YOW A;  4FLU A;  2QM1 A;  2DFF A;  1YUW A;  2A41 A;  4DTS A;  3OYL A;  4PHT X;  3OA9 A;  1BWF O;  2B5J A;  1HJO A;  1ATR A;  1RT6 A;  3NGZ A;  1U49 A;  1WSE A;  3VQB A;  1LW0 A;  1XHX A;  1WBD A;  4N56 A;  1I39 A;  2VCP A;  4DR2 K;  4B3M K;  3BDP A;  3GG4 A;  3U9D A;  2O8E A;  4KI6 A;  3AVC A;  3CMA N;  4J2A A;  4KI4 A;  4IFE A;  1OKJ A;  4IOA L;  1BQN A;  4WF9 L;  3VQ7 A;  1HNW K;  3VTH A;  3M5R A;  4B9N A;  4OGE A;  5AJ3 K;  1G15 A;  4O4G A;  3NCI A;  4LFA K;  4DLE A;  1D5A A;  4FLV A;  3LP1 A;  3HSC A;  3C65 A;  3OYG A;  1S9E A;  3CET A;  1GOB A;  4H5R A;  3ENB A;  2E6M A;  3ZT1 A;  2KFN A;  3CFP A;  1LW2 A;  3CM5 A;  1NWK A;  5I3U A;  1IBM K;  4Y1D A;  1WAF A;  1TL3 A;  3HP6 A;  4GV6 A;  4C8M A;  3F73 A;  3CPW M;  2HBK A;  3LZJ A;  5AQF A;  5HRS A;  4RW8 A;  4Y1C A;  1OH6 A;  3SQ0 A;  1N8R O;  1WN7 A;  3LPU A;  4E7K A;  4BR4 A;  3ZET A;  4FWN A;  2O4I A;  1NKB A;  5IWA K;  4BRF A;  2X6N A;  1SKW A;  3AVK A;  1HNI A;  3KKS A;  3KD1 E;  3AO2 A;  3RSE B;  3DOL A;  1C0M A;  4KO0 A;  3HVR A;  1SL2 A;  2Z1G A;  2DTU A;  3SBT A;  1U2V A;  3HBT A;  2YHA A;  1U48 A;  3KKR A;  4DV0 K;  1A5X A;  3F9M A;  4FJX A;  3R6M A;  3K9J A;  2FLO A;  1T3V A;  1XC3 A;  1MA9 B;  4W5Q A;  3M8S A;  2GX9 A;  1KAZ A;  4B3T K;  4RCH A;  4FJ8 A;  4WE1 A;  3N4P A;  1HKG A;  4BC3 A;  3CJC A;  3W3D A;  4NCB A;  3O9S A;  4CF9 A;  3AGR A;  1X9W A;  4DR6 K;  4FJ7 A;  3OYN A;  1DGK N;  1IKY A;  2LSN A;  3U3Y A;  1TKX A;  2NRT A;  4C8L A;  5DMR A;  1Y64 A;  2YKN A;  1Q7Y O;  1LOT B;  3O6W A;  3U3G A;  3WXL A;  3L2V A;  3TTD A;  4CHY A;  3VQ9 A;  3LDS A;  1T6C A;  2D0A A;  3IG1 A;  5AQI A;  4FVM A;  3VGM A;  1RGI A;  2Q97 A;  4HUF A;  1LAV A;  4KTZ A;  3HPG A;  4NLB A;  2ZWH A;  3PLA A;  2HB5 A;  2Z1I A;  2ITM A;  4CJE A;  1WBB A;  3WEE B;  3MK6 A;  2YHW A;  1T8E A;  2D0P A;  2E2Q A;  1U45 A;  2GWK A;  3H3O B;  2QXL A;  3NF9 A;  3NAE A;  4KRE A;  4CZJ A;  4OJR A;  3E9P A;  4ISG A;  1KLM A;  3T1H K;  1YJW N;  3BEX A;  1JJ2 M;  1K8K B;  5AQH A;  2DFE A;  1KRP A;  4YOR A;  2O8E B;  2FBY A;  3P38 A;  3AV9 A;  3WNE A;  1UWB A;  3DRS A;  1JCG A;  4DS4 A;  2ZJQ L;  4BRN A;  3AGK A;  1TVR A;  2I7P A;  1BL3 A;  1ZBU A;  2HMI A;  1KVC A;  3VEW A;  4X66 K;  5BPL A;  3B8A X;  4JKF A;  4KV8 A;  3ZCM A;  3CCQ N;  4J8F A;  1R59 O;  3MXM A;  4FW1 A;  4FJI A;  1HNV A;  4IFV A;  3HK2 A;  4A57 A;  3WXI A;  4GV3 A;  1XMO K;  3B6O A;  5J2N A;  3A5O C;  3H45 C;  1S72 N;  4JK7 A;  2ZQB A;  3V1R A;  2FF6 A;  4W5O A;  4IG3 A;  1JLG A;  1BIS A;  4EP4 A;  3AO4 A;  5LMU K;  3AVN A;  1Q86 O;  1VK0 A;  5BPN A;  3VQC A;  3TAM A;  3MWT A;  3LDQ A;  3DYA A;  5LMN K;  3C95 A;  2OTJ N;  3VEO A;  2GUI A;  3UKR A;  5J2M A;  4F2S A;  2D0B A;  3DI6 A;  3C7N A;  4FWM A;  3V9W A;  3TAR A;  4OKK A;  4JHD A;  1W97 L;  4WQ4 A;  4YHH K;  2AA4 A;  5E26 A;  1BUP A;  2A1S A;  4NXN K;  3A8Y A;  2QK9 A;  3HRG A;  4WQ5 A;  3ZSW A;  3KD5 E;  3EE9 A;  4RWT A;  3CCR N;  2Q36 A;  3R8E A;  2E1Y A;  4FYD A;  2P9I B;  2P9S B;  4CK2 A;  4DFK A;  4OPH A;  5ADX A;  4AHS A;  5AQN A;  3VGL A;  3IFR A;  3HO1 A;  1WOQ A;  5C2F A;  5AQM A;  3ULE A;  1EWQ A;  3A0I X;  3QFU A;  1VHX A;  3KIO A;  3M1F A;  4M42 A;  1VRT A;  1I3A A;  1HQU A;  4FZZ A;  4C8K A;  1S9G A;  4CZL A;  3K59 A;  4DQS A;  3ENH A;  1E4G T;  2P1J A;  1NK9 A;  2OPQ A;  4CHP A;  3VQ8 A;  1YVU A;  2FBV A;  3U9Z A;  3FZK A;  4L8R B;  3ZT4 A;  4PKH A;  4B9M A;  3SUO A;  2F9T A;  1TUU A;  5EX5 A;  4M45 A;  5C0Y A;  2RE2 A;  4GVM A;  4H0P A;  2I7N A;  4M3R A;  2AJQ A;  3H6E A;  5FRN A;  1EO1 A;  1TL1 A;  3WQU A;  3GE1 A;  5GAE P;  5EU7 A;  1UA1 A;  3T7Z A;  4CGH A;  4GNI A;  3S41 A;  3P5J A;  1VSM A;  4CI6 A;  3BUZ B;  4B3S K;  1NOZ A;  3SUP A;  1NGA A;  3FFK B;  3IUC A;  4FPA A;  4CF0 A;  4E7J A;  3THY A;  1NKC A;  1KLN A;  3BF3 A;  4MDB A;  1X3N A;  4RW4 A;  1K73 O;  4FM0 A;  3HVT A;  3CCL N;  3O08 A;  2HVI A;  4FWS A;  3AO5 A;  3P4I A;  4FWQ A;  1XQS C;  1RT1 A;  1BHL A;  3VEV A;  1X3M A;  1GLC G;  1RDB A;  3E9O A;  4BRI A;  4OLA A;  3CER A;  1NGH A;  2RPI A;  4LF5 K;  3O9T A;  4CJQ A;  3OTO K;  1RT4 A;  3PX4 A;  2GUP A;  3PV8 A;  4RW7 A;  2CGK A;  3TWH A;  4FK2 A;  1Z25 A;  4DSK A;  2NRZ A;  4AM7 A;  1N6Q A;  4DQP A;  3MN5 A;  4AHT A;  4HTL A;  4A61 A;  1QZ6 A;  3R3L A;  3SK3 A;  3RMC A;  4AM6 A;  5AFU H;  2WOM A;  3OYI A;  2P9U B;  3CCV N;  2BH1 A;  4MLE A;  2QTD A;  1EX4 A;  1QVG M;  1VQ8 N;  3ZEU A;  2D4W A;  3FLC O;  4ELT A;  4FJM A;  3I8D A;  2YCH A;  1LWE A;  1Z6R A;  2HND A;  5AQP A;  1SL0 A;  4BG8 A;  1KTQ A;  5AQQ A;  1U6Z A;  2XY8 A;  4CJL A;  1NK6 A;  1N36 K;  3DWL A;  2HHV A;  1NGC A;  3JXU A;  4ELV A;  2G8V A;  3VQ5 A;  5EY4 A;  4BRG A;  1J5O A;  4JS5 A;  4BAC A;  4CD1 A;  5H1S Q;  3K5M A;  3MN9 A;  1F21 A;  4BGB A;  4JKG A;  1B92 A;  4B1U B;  3PX6 A;  4A62 A;  3RRG A;  4WFN L;  3ZLJ A;  3N4Q A;  4LY7 A;  3EYZ A;  1RTJ A;  3RMA A;  5JMV A;  4O0J A;  2OAN A;  3LM9 A;  3ISN C;  1TKT A;  2QEX N;  2HHQ A;  2QI2 A;  2WON A;  3QNN A;  1HPZ A;  4CJT A;  5CE3 A;  4FM1 A;  5SZT A;  3ATU A;  1BQM A;  3SBG A;  3NHG A;  4CGF A;  3SPY A;  2V7Z A;  4CF1 A;  4DU3 A;  4F4K A;  1TAQ A;  1VQ9 N;  3L2R A;  2YI1 A;  4LF6 K;  2HVH A;  1ITG A;  4B08 A;  2NRX A;  2YNG A;  3V9U A;  3DAW A;  1S6Q A;  3E9L A;  3ZSO A;  3QIP A;  3V9Z A;  4E0D A;  2YHX A;  2HHW A;  3O3G A;  5AQO A;  4DTO A;  4FM2 A;  1GLD G;  5HLF A;  2F8T A;  3ZSV A;  4X65 K;  2Q0U A;  4H03 B;  5CY4 A;  2JWL A;  4JYA K;  3O9R A;  4IFY A;  4WCE L;  4E1J A;  4CER A;  3QIN A;  4AHU A;  1NJZ A;  3DXK B;  4FWR A;  1JKH A;  1SS6 A;  2BAN A;  3DRP A;  4FW2 A;  3L4Q A;  4FLX A;  4EZ6 A;  3EZW A;  4M41 A;  4B1W B;  1DTT A;  2QWP A;  2QWM A;  3WXM B;  3VEX A;  3AVM A;  4FO0 A;  3O1W A;  3ZX3 A;  3K58 A;  3TR8 A;  2BGG A;  1YJN N;  4ISF A;  4EZ9 A;  3SI6 A;  1T7P A;  2Q0R A;  2KKZ A;  3SLC A;  4J2D A;  3PUF A;  3HOS A;  3V9X A;  1TYQ A;  2CH6 A;  3Q7B A;  3G71 N;  4JRP A;  3TAE A;  3SQ4 A;  1VQ6 N;  2RHK A;  4BWJ A;  3S9H A;  5FLX O;  3LDP A;  1ASV A;  2V51 B;  2FC0 A;  1XWL A;  4Z4H A;  4DSJ A;  1VQM N;  4R5P A;  2Z1H A;  4DKW A;  3QML A;  3RSE A;  4PKI A;  3VEZ A;  5AQV A;  5AQU A;  2NNW A;  1S1X A;  4PY5 A;  1SUQ A;  3KWI A;  1S5J A;  1HQE A;  4I9Q A;  3OS0 A;  4LF4 K;  4I6M B;  2HNZ A;  3TTF A;  3VA3 A;  4G9Z A;  1EXQ A;  3DLK A;  2P5G A;  2UU9 K;  3ZEU B;  2A1R A;  2HBL A;  1ESV A;  2BUP A;  1ATN A;  3VEN A;  4BRH A;  3CD6 N;  3ENO A;  4IZ9 A;  1BCO A;  3QB0 A;  3G6E N;  1L3U A;  3ATV A;  5KTQ A;  4CD3 A;  2YHB A;  4YFU A;  3DLL L;  4BDP A;  4A2B A;  3SAF A;  1JXE A;  1CZB A;  4DTJ A;  3JSM A;  5FPE A;  4KHN A;  1TGO A;  3WNH A;  1C0T A;  3UKU B;  4Z94 A;  3C94 A;  3D2E B;  4H0Y B;  3O1B A;  2HHS A;  3SNN A;  2NRR A;  3HI0 A;  5BN8 A;  2WC9 A;  4JKG B;  4MO5 A;  3NVK A;  2A40 A;  1GOC A;  3J81 O;  4M3T A;  4XEI A;  4F3T A;  3EE8 A;  3MXJ A;  4O0I A;  2ZGZ A;  2G8U A;  3C6A A;  4H5V A;  3LAL A;  5JLF A;  3JYT A;  3WEE A;  3OYC A;  4BQL A;  1IG9 A;  1C1C A;  3V9S A;  2VWJ A;  4BQZ A;  5AZI A;  1V4T A;  3LDN A;  3CC4 N;  1EP4 A;  2ZGY A;  3DXM A;  4ISE A;  1GLL O;  4H0X B;  4JI3 K;  3WXJ A;  2OPR A;  4L3Q A;  4RG8 A;  4DFP A;  3THX A;  4UY8 O;  1Q8I A;  3PO5 A;  3J8A A;  1RFQ A;  1K8K A;  1ZBF A;  4HCC A;  3NBP A;  4B1Y B;  3HYF A;  5BR9 A;  2GV9 A;  3EKS A;  3ZT3 A;  2P9N B;  5C10 A;  4JI4 K;  2FSN A;  4CE9 A;  5MLC Q;  3TAG A;  1IKV A;  1KAY A;  1G99 A;  1VQP N;  4O5F A;  4JKC A;  3PSF A;  3OYH A;  3E66 A;  1XUP O;  4F2R A;  4CGI A;  3S3O A;  2E8A A;  1NK7 A;  2V7Y A;  4CEE A;  2BDP A;  3HM9 A;  3OS1 A;  2XY6 A;  3EO3 A;  2OZS A;  2HHT A;  3CJA A;  1N33 K;  4BC4 A;  1YJ9 N;  3AAR A;  4PL7 A;  4JEP A;  2IAJ A;  1D8Y A;  3K5L A;  5KGW A;  2E6L A;  1QQC A;  2F9W A;  4DMN A;  4JKA A;  3K57 A;  2YJE A;  4H4M A;  1K6Y A;  1TYQ B;  4IG0 A;  3DM2 A;  4G1Q A;  3HP9 A;  2DPN A;  2YNH A;  1BGX T;  4XIU A;  4CZK A;  3CG7 A;  4CFC A;  1LCU A;  2PYL A;  2D0C A;  4IO8 A;  4KH4 A;  2XO7 A;  1BCM A;  3G4S N;  4KHQ A;  2HBJ A;  1C1A A;  3KTQ A;  4BWM A;  5CZ1 A;  3ZSR A;  3LAN A;  3AVL A;  3SV4 A;  2DFH A;  3TAP A;  5BRD A;  3A5M C;  4KHY A;  1ZXO A;  1XHZ A;  2UUA K;  2O8B B;  4CGD A;  4BR9 A;  3ZX2 A;  3L0Q A;  4CJR A;  1NGE A;  4CES A;  2P9I A;  2P9S A;  2QXF A;  2VYP A;  3IS9 A;  3LL3 A;  3Q7C A;  2HST A;  4KHS A;  5AQZ A;  3DLH A;  1ZBS A;  3MCA B;  3OYF A;  3RR7 A;  2CGJ A;  3PSI A;  4FJL A;  1XI1 A;  4HVJ A;  3K9K A;  4FLT A;  3UIQ A;  1CXQ A;  2HHX A;  4KBO A;  1RCH A;  2OPP A;  4H0O A;  4YDU C;  3QIC A;  4N76 A;  2OPS A;  1YTA A;  2IOC A;  3JS6 A;  4YOY A;  3HJF A;  2E4L A;  4DTX A;  1Q81 O;  4XH5 A;  2HOE A;  3TAB A;  1LAW A;  1BI4 B;  3U4L A;  4BR0 A;  1BO5 O;  4BE2 A;  2QWR A;  5BN9 A;  3J7Y P;  5GAD P;  3DJC A;  1BIZ A;  4NLC A;  5FPM A;  3VF6 A;  4FCY A;  2UXB K;  5FPN A;  3MN6 A;  4F8R A;  2QWO A;  2UUC K;  5DM6 L;  1GOA A;  4HHT A;  1TAU A;  1J9A A;  4DQ8 A;  5AZI B;  2YHY A;  3TSP A;  3HOT A;  3DXM B;  5EXW A;  4BDZ A;  4QS9 A;  3THX B;  1VQ7 N;  1NK8 A;  4CHO A;  3KLE A;  4OPA A;  4B8C A;  3RTV A;  1HLU A;  5KPZ A;  1UOC A;  4DQQ A;  4FLZ A;  4JD2 B;  2HBM A;  3CFO A;  5M1O A;  3O9Q A;  4H0T B;  3P83 D;  1QHA A;  1BIU A;  3NF6 A;  5DK5 A;  4U7B A;  1RT7 A;  2RN2 A;  4BRQ A;  3FZL A;  2XY7 A;  1L3T A;  5JVG L;  2GEM A;  3HPH A;  5AQR A;  1S6P A;  4M3Z A;  3HST B;  1NBW A;  2ZJR L;  4Z4I A;  4PWD A;  3TAF A;  2Z1J A;  1O13 A;  4E3S A;  2NZT A;  3TAN A;  4C8O A;  1EQY A;  3BY5 A;  3VER A;  4DQR A;  5JIC A;  2Q31 A;  1A5W A;  5HOO A;  2ITG A;  3LP0 A;  1L3V A;  5LJW A;  4DR4 K;  3AO1 A;  4ID1 A;  4JKD A;  1N32 K;  3H3N O;  1UAX A;  4CHQ A;  1KC8 O;  3F5T A;  2W6K A;  5M1Q A;  5F0X A;  3J7Z O;  3HT3 A;  4DSL A;  3GL1 A;  1NK5 A;  2OCE A;  4LF9 K;  2F7T A;  3HTV A;  2P9U A;  3WNG A;  1BA1 A;  3M8Q A;  4JK8 A;  4EIA A;  1KSP A;  3VET A;  4LD0 A;  3K5O A;  1YVN A;  3FZM A;  5AQG A;  5AFU A;  3VF2 A;  1TK0 A;  2PZS A;  4H0V B;  4WFA L;  3QES A;  4AH9 A;  4B8A B;  2G8F A;  1VQN N;  3MN7 A;  3VTI A;  4FK0 A;  3SQ2 A;  3THW B;  1OH5 A;  3OBY A;  4ICL A;  2IC3 A;  2A5X A;  3OJU A;  5HRN A;  4CZF A;  4AF1 A;  1GLA G;  1QTM A;  4OO1 J;  1VSK A;  3LDL A;  4ID5 A;  2IDO A;  3QNO A;  3OW2 M;  4CEB A;  4HCB A;  4CFB A;  2ETJ A;  1KVB A;  1W7A A;  1X1P A;  4CJU A;  3MEE A;  1QS4 A;  3QEW A;  4DF8 A;  1Z05 A;  4E7H A;  5FPD A;  2YNF A;  3SYZ A;  1IKW A;  4Q5V A;  3AA4 A;  2VG7 A;  2IVO A;  4MFB A;  3CCM N;  2F4V K;  1FXX A;  3MED A;  5TKY A;  2GTD A;  4IEE A;  2PAV A;  3ZSY A;  4XH1 A;  4CF2 A;  4OLB A;  5KI6 A;  3TAQ A;  1BDG A;  1QSS A;  4DV4 K;  1K9M O;  3QER A;  4I9L A;  3E1Y A;  1EKE A;  2YV0 X;  4B9Q A;  2XRI A;  5E41 A;  4CW7 B;  1RDC A;  3ZT2 A;  1U4B A;  1L5U A;  3H46 O;  1BG3 A;  4HUG A;  5CHI A;  5CYM A;  2P9P B;  4BDY A;  1NJW A;  1WB9 A;  4KB0 A;  5D3G A;  2XY5 A;  2WTU A;  2UXC K;  2E5L K;  3AVF A;  2P9K B;  1DT9 A;  1IBK K;  3BP8 A;  3EEQ A;  4PL8 A;  3VQA A;  5BPM A;  5J2Q A;  3H08 A;  2QKK A;  3DXK A;  1MDU B;  3WUH A;  4X64 K;  3ZX0 A;  1NJI O;  1D9D A;  4W5N A;  3HPO A;  1KD1 O;  4KPY A;  1WAJ A;  4NO7 A;  2YJF A;  3U6F A;  1W2B M;  4Y0W A;  1FKP A;  3CHW A;  1JL2 A;  4HTU A;  3K0S A;  1NK0 A;  1HX1 A;  3IKM A;  5FRO A;  4M3U A;  3AVG A;  1HYS A;  4FJK A;  3KK3 A;  3PY8 A;  4B1X B;  4X62 K;  4EP5 A;  4I7F A;  1Q18 A;  3QO9 A;  4YOT A;  4BRO A;  1KFS A;  2JGU A;  5JS1 A;  1YTU A;  4FJJ A;  4FXD A;  4GMJ B;  3WT0 A;  5J1E A;  4DHY A;  1VRU A;  4K25 A;  4OKJ A;  4K8Z A;  3LAK A;  4OGC A;  2ZM6 K;  1IBL K;  5FDL A;  4FL9 A;  3P31 A;  5C12 A;  4BRD A;  1QSY A;  3CQ8 A;  4I6M A;  4M7X A;  4B9S A;  2OZM A;  3L2W A;  3I0S A;  4NXM K;  1C0F A;  3KZB A;  1NU0 A;  4GKJ K;  5LY3 A;  2B4J A;  4H4O A;  1HYZ A;  1TK8 A;  3A2F A;  4F9O A;  1D9F A;  3KWG A;  4E1M A;  2QA4 N;  2NRV A;  5BRE A;  4IO9 L;  3HL8 A;  1XC9 A;  1JLE A;  4M3W A;  4IOX A;  2QWQ A;  2ZF5 O;  5AR0 A;  3UKU A;  5C25 A;  3D2E A;  1NG9 A;  4KTQ A;  3SV3 A;  1ATS A;  4E1N A;  2HNY A;  4TSX A;  4WQ4 C;  4CZI A;  3I0R A;  4DR5 K;  3T1Y K;  1U04 A;  1M90 O;  4NYF A;  1YXQ A;  3KJV A;  2CH5 A;  2VQF K;  3UB5 A;  4YY3 K;  1Z26 A;  1HUX A;  4ELU A;  4CJ4 A;  4WQ5 C;  1ZYQ A;  1M1K O;  5LL6 Z;  2W6L A;  3T3F A;  4YOU A;  5JVH L;  3CC7 N;  4PUO A;  2EX3 A;  3TSU A;  1HJR A;  5BRH A;  3A5N C;  1Y97 A;  1RNH A;  4FWK A;  4DR3 K;  3THV A;  4DF4 A;  1XNR K;  2WFB A;  3VEY A;  3SJH A;  4BRL A;  4ZTJ A;  1CZA N;  3L6Q A;  4BG9 A;  3QBW A;  4DR1 K;  3SZ2 A;  1ASW A;  1J6Z A;  3PIO L;  2I5J A;  4RW9 A;  3ZSX A;  2P9N A;  3V1Q A;  1NGF A;  1SKS A;  3L3U A;  1HPM A;  4JNE A;  4BVO A;  1YAG A;  4HWI A;  5KQ8 A;  4LFC K;  4DTR A;  1Q9X A;  1HKB A;  4JKB A;  1KAX A;  2CGL A;  5K14 A;  3M3Z A;  4FVU A;  4JI5 K;  2KW4 A;  3CCJ N;  1ZBI A;  1D4X A;  1VSL A;  4CGJ A;  3PO4 A;  1N34 K;  4MO4 A;  1IV0 A;  3ID8 A;  5AQY A;  2YKM A;  3F9K A;  3O8M A;  1L3S A;  3GBT A;  4BRE A;  3JAM O;  2BTF A;  3QFP A;  1GLJ O;  3O4Q A;  4EHT A;  2O8F B;  1RBU A;  4Z4G A;  1LWF A;  2A6A A;  2BE2 A;  1NGG A;  1QHT A;  3B6P A;  4LSN A;  4DSE A;  2F8S A;  3VES A;  5I9E B;  1IKX A;  2ASO A;  1HR0 K;  3S3M A;  3CIP A;  1WNS A;  4BRK A;  4DB3 A;  3HXM A;  1E4F T;  3VGK A;  3D0P A;  4CJK A;  5HRP A;  4JK9 A;  1TUY A;  3K5N A;  3SPZ A;  3SMS A;  3IMX A;  3V81 A;  1RBV A;  4K42 A;  3ZYY X;  1RDA A;  3MEG A;  4JN4 A;  1EET A;  2WBN A;  4OPK A;  3J80 O;  1V4S A;  1QZ5 A;  4Z0U A;  4CJS A;  3D7E O;  4JS4 A;  1IG8 A;  5AZJ B;  2JLE A;  1JLF A;  2O8B A;  3LP3 A;  4CEQ A;  3OYB A;  1SQK A;  2KLA A;  4FWO A;  1P90 A;  4BRM A;  4B9V A;  4DFM A;  4M63 C;  3CXC M;  5ELZ A;  4AHR A;  1RBT A;  3VQP A;  4M3X A;  2FSJ A;  3EL2 A;  3SUN A;  3KK1 A;  3TSQ A;  4LH4 A;  2FSK A;  4AQY K;  1KQS M;  4CHZ A;  3J7A P;  4U67 L;  4BY9 C;  1OVQ A;  3MX2 A;  2B6A A;  1JXB A;  3CJ9 A;  1T44 A;  2Y1I A;  2IIR A;  4W5T A;  1NGI A;  1TKD A;  3NVM A;  2P9L B;  4MQ3 A;  4FWL A;  5KPR A;  3QEX A;  4KRF A;  5F2R A;  2E2O A;  4OX9 K;  3VQ6 A;  4E7L A;  1W0H A;  1BI4 A;  4JKH A;  1YF5 L;  1QQO A;  3U8X A;  1HYV A;  2D0O A;  5SWM A;  3O3F A;  2QWL A;  1I94 K;  3NFA A;  4CIE A;  1YI2 N;  4GY2 B;  1H1V A;  4AIL C;  1X9J A;  4K43 A;  2AP1 A;  4NYN A;  3L2U A;  1S22 A;  4QOZ B;  4ILH A;  4JRQ A;  5AQT A; 
#chains in the Genus database with same CATH homology
 2FBV A;  3OYK A;  3VQE A;  4F8R A;  3G10 A;  3NDK A;  1GOA A;  3LAM A;  3ZT4 A;  4HHT A;  1J9A A;  3SUO A;  4B9M A;  4L8R B;  1TAU A;  3KK2 A;  3OYJ A;  4PQU A;  4E89 A;  4BDZ A;  4M45 A;  4BE1 A;  4DS5 A;  5HP1 A;  1S1T A;  2R7Y A;  4CIG A;  5KGX A;  4B9L A;  4GVM A;  2AJQ A;  2Q3S A;  4M3R A;  3O3H A;  5FRN A;  3OYD A;  1NK8 A;  4KHU A;  3S3N A;  4CFA A;  4CHO A;  3KLE A;  3LWM A;  1TL1 A;  4B8C A;  1VSH A;  3NGY A;  1JLQ A;  5HRR A;  1UOC A;  3RTV A;  4DQQ A;  4LH5 A;  4FLZ A;  3NH0 A;  1NK4 A;  4BE0 A;  3CFO A;  5EU7 A;  1UA1 A;  2KFZ A;  4IKF A;  4CGH A;  3IRX A;  1VSM A;  3C6U A;  3P5J A;  3RMD A;  3NF8 A;  3P83 D;  1NOZ A;  3SUP A;  3QEV A;  4E7J A;  4CF0 A;  1BIU A;  3NF6 A;  5DK5 A;  3NF7 A;  1NKC A;  1KLN A;  1RT2 A;  3VA0 A;  1RT7 A;  2RN2 A;  2QKB A;  4N47 A;  4RW4 A;  2XY7 A;  4FM0 A;  3HVT A;  3L2Q A;  1X9M A;  1L3T A;  4DQI A;  1VSJ A;  3HPH A;  3K2P A;  1S6P A;  3MAQ A;  4M3Z A;  3CYM A;  3HST B;  5JS2 A;  2HVI A;  3AO5 A;  3V1O A;  3AVA A;  4Z4I A;  3V6D A;  4PWD A;  3KLF A;  2Z1J A;  3TAF A;  5C42 A;  1RT1 A;  1BHL A;  2EHG A;  4E3S A;  4AHV A;  3TAN A;  1SKR A;  4C8O A;  4DQR A;  4OLA A;  1RDB A;  3KLG A;  1A5W A;  2ITG A;  3LP0 A;  4J2E A;  3T19 A;  3RWU A;  2RPI A;  5HRO A;  1L3V A;  4W5R A;  2G8H A;  4CJQ A;  3AO1 A;  1WSI A;  4ID1 A;  1CXU A;  1VSF A;  1UAX A;  1RT4 A;  3M8P A;  4CHQ A;  1ZBH A;  3PX4 A;  3PV8 A;  4RW7 A;  3HT3 A;  4DSL A;  3TWH A;  1NJX A;  1NK5 A;  2G8W A;  2RKI A;  4FK2 A;  1LWC A;  3OY9 A;  1Z25 A;  3QEI A;  1J54 A;  4DSK A;  4OKE A;  1N6Q A;  4DQP A;  3ASM A;  3WNG A;  4AHT A;  4UQG A;  4Z4F A;  3PX0 A;  4DWI A;  3M8Q A;  5J2P A;  1KSP A;  1J53 A;  2X6S A;  4K8X A;  4LD0 A;  3G0Z A;  3K5O A;  3RMC A;  2ZD1 A;  2WOM A;  3OVN A;  2Y1J A;  1TK0 A;  3OYI A;  2PZS A;  1CLQ A;  3QES A;  4NCG A;  3KLI A;  1KFD A;  4AH9 A;  4B8A B;  2G8F A;  1EX4 A;  2NUB A;  3LPT A;  1Q9Y A;  3AA5 X;  4FK0 A;  2GBZ A;  3SQ2 A;  4ICL A;  4ELT A;  2IC3 A;  4FJM A;  3I8D A;  2KZZ A;  1T05 A;  3VQD A;  3OJU A;  5HRN A;  4HUE A;  1LWE A;  2FBX A;  4DTM A;  1QTM A;  2HND A;  1SL0 A;  1VSK A;  1QE1 A;  4ID5 A;  2IDO A;  3MEC A;  3QNO A;  1JLC A;  1CZ9 A;  4CEB A;  4HCB A;  4CFB A;  2ETJ A;  1KCF A;  1KVB A;  1X1P A;  4CJU A;  1RBS A;  1MU2 A;  1KTQ A;  3MEE A;  4FJ9 A;  1QS4 A;  3D45 A;  3DLB A;  3QEW A;  4DF8 A;  2XY8 A;  4CJL A;  1NK6 A;  4E7H A;  4DSI A;  2YNF A;  3SYZ A;  1IKW A;  2HHV A;  3RR8 A;  4CHN A;  4ELV A;  4Q5V A;  3AA4 A;  1NOY A;  2VG7 A;  1WLJ A;  3TI0 A;  1WSF A;  1JLA A;  3ULD A;  2G8V A;  2PYJ A;  4MFB A;  3VQ5 A;  4Q0B A;  3IAY A;  2ZE2 A;  4IDK A;  1WSJ A;  4JS5 A;  4BAC A;  1J5O A;  4FZY A;  1FXX A;  4AHC A;  3K5M A;  3MED A;  1F21 A;  4CEA A;  1B92 A;  1O1W A;  2F96 A;  4CJF A;  3PX6 A;  3O4N A;  4FLY A;  3RRG A;  4DU4 A;  2XHB A;  5I42 A;  3ZSY A;  3DOK A;  4LY7 A;  1JLB A;  3CM6 A;  4CF2 A;  4LSL A;  3EYZ A;  3QET A;  1NJY A;  4J2B A;  4OLB A;  1RTJ A;  5KI6 A;  3EY1 A;  3RRH A;  3RMA A;  3TAQ A;  1QSS A;  1VSI A;  4O0J A;  4Z4C A;  3QER A;  2YNI A;  3BGR A;  3ISN C;  4I9L A;  3SCX A;  1TKT A;  2IS3 A;  4CJP A;  3V4I A;  3CFR A;  1EKE A;  2YV0 X;  2HHQ A;  2XRI A;  2WON A;  3ZT0 A;  5E41 A;  1RDC A;  2X74 A;  2X78 A;  3LP2 A;  3ZT2 A;  1HPZ A;  4CJT A;  3QNN A;  1U4B A;  1TK5 A;  4FM1 A;  5SZT A;  1L5U A;  1BQM A;  3ZSZ A;  1C0U A;  3NHG A;  4HUG A;  4CGF A;  4FLU A;  3SPY A;  2DFF A;  5CYM A;  4CF1 A;  4DU3 A;  4F4K A;  4BDY A;  1A5V A;  1S1V A;  1IH7 A;  4DTS A;  3OYL A;  1TAQ A;  5KRT A;  1NJW A;  3L2R A;  4KB0 A;  2B5J A;  1RT6 A;  5D3G A;  3NGZ A;  2XY5 A;  4CK3 A;  1U49 A;  2HVH A;  1ITG A;  1WSE A;  4CJ5 A;  3VQB A;  1LW0 A;  4B08 A;  3V9U A;  2YNG A;  1XHX A;  4CEF A;  1S6Q A;  3T1A A;  3ZSO A;  3QIP A;  3AVF A;  1TV6 A;  3V9Z A;  4N56 A;  3O3G A;  4E0D A;  4DTO A;  2DY4 A;  3OYM A;  5J2Q A;  1I39 A;  3VQA A;  4FM2 A;  5HLF A;  1HRH A;  2F8T A;  3H08 A;  3ZSV A;  1ASU A;  4CGG A;  3AVI A;  2QKK A;  3BDP A;  4CK1 A;  1D9D A;  4KI6 A;  4W5N A;  5CY4 A;  3AVC A;  3QLH A;  3HPO A;  4J2A A;  4KI4 A;  4KPY A;  1WAJ A;  4IFY A;  1S1W A;  3U6F A;  1BQN A;  4CER A;  1FKP A;  3QIN A;  3VQ7 A;  4AHU A;  1JL2 A;  1NJZ A;  2HHU A;  1JKH A;  3DRP A;  2BAN A;  4FW2 A;  4HTU A;  4B9N A;  4FLX A;  4OGE A;  4EZ6 A;  1G15 A;  1B9F A;  4M41 A;  4O4G A;  3ZSQ A;  1NK0 A;  3NCI A;  4CED A;  1DTT A;  5FRO A;  4M3U A;  3AVM A;  3AVG A;  4DLE A;  1HYS A;  1D5A A;  4FJK A;  3KK3 A;  3PY8 A;  4FLV A;  1IO2 A;  3LP1 A;  4I7F A;  3QO9 A;  4EP5 A;  3K58 A;  1KFS A;  3TR8 A;  2BGG A;  2JGU A;  4CIF A;  3SI6 A;  4EZ9 A;  1T7P A;  5JS1 A;  3LZI A;  1YTU A;  3SQ1 A;  2VG6 A;  4FJJ A;  3OYG A;  4FXD A;  4GMJ B;  1RBR A;  1S9E A;  4J2D A;  3OJS A;  1GOB A;  5J1E A;  4DTU A;  4FZX C;  1VRU A;  1RIL A;  3PUF A;  2E6M A;  3ZT1 A;  3V9X A;  2KFN A;  4JRP A;  3CFP A;  4OKJ A;  4N41 A;  1LW2 A;  3CM5 A;  3TAE A;  3SQ4 A;  5I3U A;  4K8Z A;  3LAK A;  1WAF A;  4OGC A;  1TL3 A;  4Y1D A;  4BWJ A;  4ZHR A;  3HP6 A;  3S9H A;  4C8M A;  5FDL A;  1ASV A;  3F73 A;  2FC0 A;  3LZJ A;  1XWL A;  4Z4H A;  1QSY A;  4DSJ A;  1WSH A;  4R5P A;  3CQ8 A;  5HRS A;  3LWL A;  2Z1H A;  4DU1 A;  4B9S A;  4RW8 A;  4Y1C A;  2OZM A;  3SQ0 A;  3L2W A;  1WN7 A;  3LPU A;  1S1X A;  4E7K A;  4PY5 A;  1SUQ A;  3I0S A;  2VG5 A;  2O4I A;  1NKB A;  1S5J A;  2P5O A;  1HQE A;  4I9Q A;  3OS0 A;  2X6N A;  1SKW A;  3AVH A;  3AVK A;  1HNI A;  3KKS A;  3QIO A;  4OVL A;  3KD1 E;  2HNZ A;  3VA3 A;  2B4J A;  3AO2 A;  1N5Y A;  1EXQ A;  3DLK A;  3DOL A;  4H4O A;  2P5G A;  1HYZ A;  4FJG A;  4FJ5 A;  1C0M A;  4KO0 A;  1TK8 A;  3A2F A;  3HVR A;  1SL2 A;  1D9F A;  2G8K A;  2KZM A;  2A1R A;  2OYQ A;  3FFI A;  4E1M A;  4KKO A;  2Z1G A;  2DTU A;  4DG1 A;  1LV5 A;  2O4G A;  1YT3 A;  2FBT A;  3HL8 A;  1BCO A;  2W42 A;  1XC9 A;  2YHA A;  1L3U A;  1JLE A;  3NE6 A;  1U48 A;  4M3W A;  5KTQ A;  3KKR A;  4FJN A;  3AO3 A;  2YHB A;  1A5X A;  4YFU A;  4YNQ A;  4BDP A;  5C25 A;  4CJ3 A;  4FJX A;  1JXE A;  1SL1 A;  1CZB A;  4DTJ A;  3JSM A;  4KTQ A;  3SV3 A;  4E1N A;  4W5Q A;  2HNY A;  3M8S A;  4KAZ A;  4TSX A;  4KHN A;  4FJ8 A;  1TGO A;  3WNH A;  3L3V A;  3I0R A;  4WE1 A;  1C0T A;  1U04 A;  4NYF A;  1TKZ A;  3KJV A;  4ELU A;  1Z26 A;  2RF2 A;  3C94 A;  4CJ4 A;  1JL1 A;  1ZYQ A;  2HHS A;  3T3F A;  3SNN A;  4CEO A;  4NCB A;  4CF9 A;  1X9W A;  5CYQ A;  4FJ7 A;  3OYN A;  3OYE A;  1GOC A;  4CFD A;  4KHW A;  1IKY A;  4M3T A;  2LSN A;  4IBN A;  4PUO A;  3U3Y A;  1TKX A;  4QCL A;  2KQ2 A;  4C8L A;  2EX3 A;  4F3T A;  1HJR A;  3MXJ A;  1Y97 A;  2YKN A;  5DMR A;  1RNH A;  3VQ4 A;  4O0I A;  3L2V A;  3U3G A;  3THV A;  2PY5 A;  4DF4 A;  4CHY A;  2G8U A;  3VQ9 A;  3LDS A;  2D0A A;  3LAL A;  3IG1 A;  4FVM A;  1B9D A;  4I2P A;  3JYT A;  1UA0 A;  3OYC A;  4ZTJ A;  3AA3 A;  1IG9 A;  1C1C A;  4Z4E A;  3V9S A;  1W9H A;  2VWJ A;  4HUF A;  2KTQ A;  3SZ2 A;  1LAV A;  1ASW A;  1EP4 A;  4KTZ A;  4NCA A;  5KRS A;  3HPG A;  2I5J A;  2VWK A;  2HW3 A;  4RW9 A;  2HB5 A;  3ZSX A;  2OPR A;  4RG8 A;  2Z1I A;  3V1Q A;  4DFP A;  4CJE A;  3DLE A;  1Q8I A;  4RW6 A;  3PO5 A;  4F3O A;  1SKS A;  3L3U A;  1RT5 A;  3VQQ A;  3VN5 A;  1T8E A;  1ZBF A;  4HCC A;  3NBP A;  1U45 A;  1T03 A;  3HYF A;  3NF9 A;  4KRE A;  3NAE A;  2GV9 A;  4DTR A;  1Q9X A;  4CEZ A;  1FKO A;  4OJR A;  3DMJ A;  1KLM A;  5K14 A;  3ZT3 A;  4CCH A;  3SUQ A;  2KW4 A;  4FK4 A;  1ZBI A;  1REV A;  1VSL A;  3OS2 A;  3E01 A;  3WNF A;  4CGJ A;  3PO4 A;  2DFE A;  3ITH A;  4M3Y A;  4E19 A;  4C8N A;  1KRP A;  2FBY A;  3P1G A;  3EZ5 A;  2YKM A;  3AV9 A;  3WNE A;  1UWB A;  4CE9 A;  3F9K A;  3TAG A;  3DRS A;  1IKV A;  4O5B A;  2IGI A;  1L3S A;  4DS4 A;  1S1U A;  4OPJ A;  1TVR A;  3OYH A;  1BL3 A;  1ZBU A;  1DLO A;  3AA2 A;  3O4Q A;  4F2R A;  2HMI A;  1RBU A;  1C6V A;  1KVC A;  4CGI A;  3S3O A;  1LWF A;  1NK7 A;  1RTD A;  4KB1 A;  4Z4G A;  4KFB A;  2BE2 A;  3AVJ A;  4PA1 A;  5CZ2 A;  5T7B A;  4CEE A;  3M8R A;  1X9S A;  1QHT A;  3B6P A;  4LSN A;  3HM9 A;  3OS1 A;  4DSE A;  2BDP A;  2F8S A;  4KV8 A;  3ZCM A;  2XY6 A;  3QEP A;  2OZS A;  1RTH A;  2HHT A;  2HHW A;  3MXM A;  1IKX A;  4FW1 A;  4FJI A;  3S3M A;  1HNV A;  4GW6 A;  4IFV A;  4CJV A;  4DFJ A;  1R0A A;  3HK2 A;  1WNS A;  3C6T A;  3RMB A;  3B6O A;  1RDD A;  2IAJ A;  4FLW A;  5J2N A;  3HXM A;  3L8B A;  3K5L A;  5KGW A;  4DTN A;  1D8Y A;  2E6L A;  3NH1 A;  4B9T A;  1QQC A;  4DMN A;  3K57 A;  4H4M A;  2ZQB A;  3D0P A;  3V1R A;  4CJK A;  1K6Y A;  5HRP A;  4W5O A;  5FRM A;  4CEC A;  4IG3 A;  1JLG A;  4IG0 A;  3DM2 A;  1FK9 A;  4G1Q A;  1BIS A;  3K5N A;  4EP4 A;  4E7I A;  3SPZ A;  3HP9 A;  3V81 A;  2YNH A;  1RBV A;  3AO4 A;  1BGX T;  1U47 A;  1RDA A;  3MEG A;  1HMV A;  2G8I A;  1VSE A;  3AVN A;  1EET A;  4XIU A;  4OPK A;  3CG7 A;  1C1B A;  1VK0 A;  4CFC A;  4FJH A;  4Z0U A;  2PYL A;  4CJS A;  3VQC A;  3TAM A;  4ZTF A;  2D0C A;  3DRR A;  3DYA A;  4JS4 A;  3C95 A;  2JLE A;  1JLF A;  3LP3 A;  4CEQ A;  2GUI A;  3OYB A;  1BCM A;  2XO7 A;  4KHQ A;  1VSD A;  1C1A A;  3KTQ A;  4BWM A;  5CZ1 A;  3ZSR A;  4DFM A;  4B9V A;  2ATQ A;  5J2M A;  1RT3 A;  5C24 A;  4AHR A;  1RBT A;  1KVA A;  3OYA A;  4F2S A;  4DTP A;  3VQP A;  3LAN A;  3AVL A;  3SV4 A;  2DFH A;  4DLG A;  3TAP A;  2D5R A;  4M3X A;  2D0B A;  3DI6 A;  4KHY A;  1XHZ A;  1NKE A;  2OA8 A;  3V9W A;  3SUN A;  3KK1 A;  3AVB A;  4CGD A;  3TAR A;  4OKK A;  4LH4 A;  4O55 A;  4CJR A;  4CHZ A;  4CES A;  1DTQ A;  2QXF A;  3IS9 A;  4N5S A;  4KHS A;  2A1S A;  3DLH A;  3KLH A;  2B6A A;  3OYF A;  1JXB A;  2QK9 A;  3ZSW A;  3RR7 A;  4FJL A;  5HBM A;  4JLH A;  2Y1I A;  1XI1 A;  3KD5 E;  4KTW A;  4HVJ A;  4W5T A;  4FLT A;  1CXQ A;  1TKD A;  1RTI A;  3UIQ A;  1RCH A;  4MQ3 A;  3QEX A;  2HHX A;  4KRF A;  1SV5 A;  1ZBL A;  4FYD A;  3VQ6 A;  4QAG A;  4E7L A;  2OPP A;  1W0H A;  4CK2 A;  1BI4 A;  4N76 A;  4DFK A;  2OPS A;  3DLR A;  3NH2 A;  1YTA A;  2IOC A;  3HJF A;  1HYV A;  4CF8 A;  4AHS A;  2E4L A;  4DSF A;  5SWM A;  3O3F A;  4DTX A;  3TAB A;  3DLG A;  3NFA A;  3ALY A;  4CIE A;  3HO1 A;  1LAW A;  3NGI A;  4AIL C;  3KIO A;  1BI4 B;  3MXI A;  1QSL A;  4M42 A;  1VRT A;  1I3A A;  1HQU A;  4FZZ A;  4H8K A;  1S9G A;  2P51 A;  4BE2 A;  4C8K A;  1WSG A;  4CJW A;  3K59 A;  4I2Q A;  1BIZ A;  4NYN A;  3L2U A;  4DQS A;  4B3O A;  4O44 A;  4QOZ B;  2P1J A;  4FCY A;  1NK9 A;  2OPQ A;  4CHP A;  4JRQ A;  4B9U A;  3VQ8 A;  3SJJ A;  1YVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...