3O4NA

Crystal structure of the rous associated virus integrase catalytic domain in mes buffer ph 6.0
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
141
structure length
133
Chain Sequence
QIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTQAMVERANRLLKDKIRVLAEGDGFMKRIPASKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A crystal structure of the catalytic core domain of an avian sarcoma and leukemia virus integrase suggests an alternate dimeric assembly.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Dna binding protein
molecule keywords integrase
total genus 47
structure length 133
sequence length 141
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3o4nA00
2BANA 3HSTB 3ZSOA 1TGOA 2YNIA 3MECA 2LSNA 3PUFA 3QIPA 4DTOA 1REVA 1RTIA 3WNEA 5SZTA 1C0MA 4KPYA 4HCBA 3OYCA 3MEGA 4CGJA 1C1AA 1JLAA 1EETA 2XHBA 1MU2A 4CJSA 1RCHA 1NKCA 3OYEA 1R0AA 4M3WA 3TAFA 4E3SA 3BDPA 3VN5A 4BWJA 4FLVA 1S6PA 4I9LA 3EYZA 4KHWA 3AVAA 3OS0A 4GMJB 3JSMA 1NJWA 3HP6A 3LZIA 4MQ3A 1NK8A 4E19A 5DMRA 4I2PA 4BACA 4QOZB 2JLEA 4RW7A 4DU3A 4HTUA 1JLCA 4PQUA 1I39A 5HRSA 1HYSA 3LP3A 2DTUA 1S6QA 2FBYA 3VA3A 1U45A 3ZSZA 4CJRA 1QS4A 2YKMA 3CM5A 5J2PA 1FKPA 2D0AA 3ZSYA 4XIUA 4I7FA 3NH1A 4DTXA 1T05A 1BHLA 1RBUA 4DU1A 4F8RA 1U04A 2G8KA 1DLOA 2IS3A 4DLEA 1EP4A 1S5JA 4CEBA 1CXQA 5KGXA 3K5OA 4DQQA 1U48A 1RDAA 3HPHA 4BE0A 2OPRA 3DLHA 3NHGA 4CIEA 4FJIA 3OYAA 1RBTA 3AO3A 4FZXC 1RBSA 2B6AA 1TAUA 1JLBA 3KKSA 5CZ1A 4CF2A 4OKKA 3NCIA 2G8HA 2XY7A 2DFHA 4LSNA 4CJFA 4N5SA 3AA3A 4DS5A 1JL1A 1BL3A 3L3UA 3S9HA 1X9SA 2HMIA 3IG1A 5KTQA 3K5LA 2RF2A 4FLXA 2GBZA 4FW1A 2X78A 3OYIA 2EHGA 4E1MA 3K5NA 3V9WA 5CYQA 4CEEA 4KAZA 4ZTFA 1QE1A 3DYAA 3U3GA 3DRRA 5C25A 3IAYA 3ZSVA 1VRTA 3T19A 1BI4A 2KW4A 5HP1A 3C95A 3HYFA 4EP5A 2OZSA 4DTMA 4DLGA 2X74A 4O44A 3K59A 4FZZA 1KFDA 2YKNA 3DLGA 3NH0A 1TL1A 3B6OA 4KREA 1D9FA 1WSEA 1I3AA 3RMBA 2HB5A 3AVLA 3VQ7A 1RT2A 3AO5A 4DTUA 4EZ6A 2KZZA 4CF9A 2ZE2A 3CFRA 4DSEA 2IOCA 1O1WA 3C94A 3HM9A 4IKFA 5JS1A 1LW0A 4CHPA 1RT4A 4CHNA 4LD0A 5T7BA 1F21A 2PZSA 3H08A 3HVTA 3KLEA 3ZSRA 4KO0A 4N76A 4ICLA 1HJRA 3KJVA 4FM0A 2XY8A 1NK6A 1L3VA 5FRMA 2D5RA 1NJXA 2HNDA 3AO4A 4FLTA 4CESA 4CGIA 3OYJA 1UA1A 1QSSA 3RMDA 4B9MA 4FZYA 2HW3A 1S9EA 1TAQA 4FJMA 3QEXA 1K6YA 3AVNA 1QQCA 3NF8A 4CK3A 4PY5A 2GV9A 3SJJA 2AJQA 1FK9A 3LWLA 1JXBA 1IH7A 3NFAA 3SQ2A 4M3TA 2WOMA 4FK4A 1B9DA 1WAFA 4CJWA 2BE2A 4JS5A 5E41A 4HVJA 4KB1A 4Q5VA 3TARA 3HJFA 2ZQBA 4FLYA 1SL2A 4J2DA 1Q8IA 3A2FA 3VQ5A 3VQPA 4E7JA 4M3UA 4KTWA 4DF8A 1S1WA 4ZTJA 1VSDA 4JRQA 1KLMA 5CY4A 4FJ5A 4TSXA 2BGGA 5J2NA 3BGRA 4Z4IA 3DMJA 1BCOA 1RTDA 4OJRA 3VQEA 3NGYA 4C8LA 3LANA 3QEWA 4B9VA 4CGGA 3EY1A 1HMVA 1NJYA 1S1UA 1CXUA 4M3RA 2HVIA 1A5XA 3V6DA 2IGIA 4CJTA 1X9WA 4W5QA 4DSFA 2ITGA 1IG9A 5J1EA 4Z4CA 3TAQA 5HRPA 1QSLA 3AO2A 3SUQA 4FJHA 2VG6A 3E01A 4JLHA 1QHTA 4OVLA 4PWDA 3S3MA 1N5YA 2Z1IA 1A5WA 3VQCA 3HPGA 3L2WA 1VSLA 3L3VA 1JXEA 4FM2A 1NOZA 4Z4EA 2X6NA 1C1BA 4E7KA 2QK9A 4PA1A 2HNZA 3RTVA 5FDLA 4CF8A 3WNGA 2B4JA 3KKRA 3SZ2A 1DTTA 4DS4A 4FJJA 4LY7A 4BDYA 3MEEA 4EZ9A 4N41A 1D9DA 2Z1GA 4FJ7A 1GOAA 2DFEA 5J2QA 4B8CA 1JLQA 1D5AA 3JYTA 1SKRA 4CFDA 2OYQA 1W0HA 5C42A 2E4LA 1RDBA 4RW8A 2XO7A 1VRUA 4CEOA 3M8RA 3V9SA 1J5OA 4M3YA 1HQUA 3AVFA 2FBVA 4I2QA 4EP4A 4DWIA 3KLHA 4CERA 3O3FA 3OYDA 1BISA 3AVKA 4FJXA 2HHTA 4B9NA 4IG3A 3ITHA 3NF6A 4CF1A 4DFPA 1KRPA 3ZSWA 4ID1A 4DTSA 2X6SA 1WN7A 5CYMA 1RNHA 5KI6A 1NK4A 3I0SA 2P5OA 4KHYA 3P83D 1Z25A 3LP1A 3NF7A 4HCCA 4CEQA 2KFNA 2KZMA 3PX0A 4F2RA 4JS4A 1LAWA 3T1AA 3LWMA 2Q3SA 3L8BA 2F8SA 4DU4A 4OGCA 3NH2A 4HUFA 4BE1A 4E0DA 2FBTA 5EU7A 4N47A 3HT3A 4DQSA 1SL0A 4CEAA 3KLGA 2YNGA 2P1JA 2EX3A 3KTQA 4DSLA 4FJKA 1C1CA 2DY4A 3QETA 1S1XA 4CF0A 3AVMA 1HRHA 3HO1A 3MXMA 4B8AB 4O55A 4CJ3A 4ELTA 1ZBHA 4F4KA 1BQMA 5HRRA 3TANA 1UAXA 3THVA 3S3NA 3RRHA 1FXXA 5JS2A 3AA5X 3AVIA 4O5BA 1NKEA 3AVHA 3LPUA 4AILC 1Q9XA 1IKWA 3ZT4A 2VWJA 2A1SA 3CG7A 5HBMA 1XHXA 3O4QA 3OJUA 3SQ4A 4DQRA 4OLAA 3OJSA 1T7PA 3SPYA 1SUQA 1IKXA 1YT3A 2XRIA 4AHVA 4CK2A 4CJQA 3TAMA 1TK8A 1KVAA 1Y97A 1S9GA 1GOBA 2YNHA 3ZT3A 4NCBA 1FKOA 2IAJA 3ULDA 4Y1CA 3PO4A 4PUOA 2I5JA 2WONA 5HROA 1ASUA 3SUNA 4ELVA 4M3XA 1IKYA 4IFVA 3UIQA 1Z26A 1ZBFA 1RILA 4O4GA 5J2MA 3K57A 4CJVA 2R7YA 1C0TA 2Z1HA 4FVMA 3TABA 1LWCA 5KGWA 3C6TA 3B6PA 2O4IA 4Y1DA 3OYBA 1ZBIA 4CJKA 1B92A 1N6QA 1RT6A 1WLJA 4W5TA 1TKDA 1JKHA 1XHZA 3U3YA 3DLRA 2RPIA 4CJPA 1IO2A 2F96A 3P5JA 5C24A 5FROA 2OA8A 3QLHA 3LDSA 5FRNA 3TAGA 3AO1A 4YFUA 2PYLA 2QKBA 3V1RA 1Q9YA 2Y1JA 3V81A 4CJEA 4Z4HA 4CEFA 2IC3A 1BIUA 1VSEA 1J9AA 3DRSA 3SV4A 3VQBA 3RWUA 3HL8A 1DTQA 3O3HA 4KHSA 4K8ZA 3WNHA 3PV8A 3NDKA 1NK7A 4Q0BA 3CYMA 4E89A 3KK2A 3M8QA 1LWFA 4GW6A 3C6UA 5SWMA 3OVNA 3OYGA 3L2VA 1NK5A 1RBRA 3AA4A 4FYDA 1YTAA 3ISNC 2RKIA 4AHRA 3PX6A 3SQ0A 1UA0A 3OYLA 3VQQA 1VSMA 3DLEA 1RDCA 4CJ4A 5KRTA 3LZJA 1XI1A 1RBVA 4BDPA 2Z1JA 1A5VA 5KRSA 1RT1A 3O4NA 1J54A 4E7LA 4KB0A 2DFFA 4KRFA 2HHSA 3F9KA 3PY8A 4E7HA 4QAGA 4FJNA 2D0CA 1LV5A 1KTQA 1WSJA 2ZD1A 3MEDA 3ZT0A 3QO9A 2F8TA 3KK1A 2YHBA 4HHTA 3VA0A 4OPJA 1ASWA 1C6VA 3ZT2A 1L3UA 1UOCA 2D0BA 4DTPA 3RMCA 2O4GA 2G8FA 1LAVA 2HHUA 3LP2A 4Z4FA 4LH5A 3HXMA 3AVBA 3VQ9A 2Y1IA 1VSIA 4CGFA 4K8XA 1VSFA 4NCAA 2YHAA 4CE9A 4B3OA 3QEIA 1HQEA 4DF4A 4FW2A 3QNNA 3SCXA 1JLEA 4F3TA 3D45A 4CHQA 1L3SA 4FK0A 4CFCA 3V4IA 3EZ5A 1D8YA 1WSGA 4M41A 2QXFA 3RRGA 4W5OA 1NJZA 1EX4A 2HHVA 4KV8A 3G10A 4E7IA 3K58A 3QIOA 5I3UA 3I0RA 2E6MA 5DK5A 2G8UA 4KI6A 4KFBA 3TAEA 3AVGA 3QESA 2A1RA 4CHYA 1T8EA 1HNIA 2P51A 1CZBA 3AVJA 4DTRA 4B9TA 4W5NA 3SQ1A 3ZSQA 3RR8A 5I42A 4B9LA 3RR7A 3M8PA 4KHUA 3KLIA 1TVRA 3CFPA 1EXQA 4IDKA 4NYNA 1VK0A 4ID5A 4AHCA 2KFZA 4AHSA 1S1VA 2RN2A 1QTMA 3LAMA 4CFAA 1BIZA 2NUBA 1VSKA 3DRPA 3VQDA 3QEPA 1W9HA 2KTQA 4CGHA 3TI0A 3SUOA 1S1TA 3TR8A 3ALYA 4UQGA 2HVHA 3D0PA 4KHQA 3AVCA 2FC0A 4DQIA 4DMNA 4OPKA 1NK0A 2YV0X 3DM2A 4DQPA 4FJGA 4Z4GA 4CIGA 1SKWA 2HHQA 4L8RB 4O0IA 3DLKA 3KD5E 1ITGA 2GUIA 4CECA 3AA2A 4KTZA 2W42A 3SV3A 1BQNA 3G0ZA 4LH4A 4HUEA 5HRNA 2HNYA 4CEDA 1G15A 1RTJA 3MXJA 4DSIA 1TK5A 2JGUA 4CIFA 4KKOA 3KLFA 3CM6A 4E1NA 1VSJA 4RW6A 1TL3A 4CK1A 3ZSXA 3HVRA 1WAJA 4C8MA 3S3OA 4J2AA 1KSPA 4WE1A 4CHOA 2VG5A 4AHUA 1CZ9A 1BCMA 3NE6A 4DFKA 3PO5A 4DSKA 4F3OA 4FJ8A 1NKBA 1KLNA 3AV9A 1WSIA 1JLGA 3SYZA 2FBXA 3OS2A 4KHNA 3TWHA 1YTUA 3NGZA 1QSYA 4QCLA 4DSJA 1JLFA 3OYFA 3K5MA 4KTQA 2OZMA 4AHTA 3CQ8A 4J2EA 4AH9A 4CEZA 4IG0A 4OKEA 3FFIA 4R5PA 1X1PA 4FLUA 2KQ2A 1B9FA 4FCYA 4ELUA 1WNSA 2VWKA 4DFJA 3NGIA 1XC9A 4M45A 1SKSA 1KFSA 4OGEA 4BDZA 2ETJA 3OYHA 3U6FA 1KVBA 3LPTA 3I8DA 2QKKA 1HNVA 3IS9A 4IFYA 1IKVA 3OY9A 3QNOA 3OYMA 4JRPA 2B5JA 3QEVA 3F73A 4RW4A 3VQ8A 1XWLA 4YNQA 1LWEA 4DTNA 1T03A 1SL1A 3IRXA 3NF9A 4B08A 3OYNA 1CLQA 2OPQA 3K2PA 3MXIA 1EKEA 4FJLA 4CHZA 1VSHA 1ZBUA 3CFOA 3V1QA 3VQ4A 4CGDA 4H8KA 4CCHA 3KD1E 4FLWA 4DG1A 3V9ZA 3KK3A 3LP0A 2XY5A 1JL2A 3KIOA 1HYZA 4GVMA 3SI6A 1WSFA 1LW2A 3DI6A 3T3FA 4BE2A 4O0JA 1U4BA 4F2SA 3SPZA 3O3GA 1NK9A 2PY5A 4MFBA 4CJLA 3DLBA 1U47A 4IBNA 1TKZA 3LALA 5K14A 3OS1A 3L2QA 3NAEA 3V9XA 3HP9A 4HUGA 3VQ6A 1U49A 1KCFA 3ZCMA 1NOYA 4B9UA 4M42A 1C0UA 3SUPA 4C8NA 4I9QA 4FJ9A 5D3GA 4FK2A 1KVCA 3QINA 1WSHA 1TKXA 2E6LA 3VQAA 4CJ5A 3L2RA 1L3TA 1RT7A 2OPSA 1YVUA 4G1QA 2YNFA 3NBPA 1ZYQA 4M3ZA 1TKTA 2IDOA 3HPOA 3L2UA 3M8SA 4RW9A 2PYJA 1SV5A 1RDDA 4W5RA 4DFMA 2G8IA 4DTJA 2HHXA 4Z0UA 1UWBA 5HLFA 4FLZA 3QERA 4NYFA 3TAPA 3MAQA 5CZ2A 2OPPA 2G8VA 2P5GA 4J2BA 2G8WA 4B9SA 4H4OA 4LSLA 4FM1A 2XY6A 4RG8A 3PX4A 4CJUA 3OYKA 4ZHRA 4C8KA 3ZT1A 1BGXT 4OKJA 3RMAA 3DOLA 4H4MA 1RT5A 3SNNA 4CFBA 4C8OA 3HK2A 2HHWA 4BWMA 1J53A 1RTHA 1X9MA 1BI4B 1GOCA 1TK0A 4KI4A 3WNFA 4FXDA 2VG7A 3V1OA 1ZBLA 2BDPA 1L5UA 1TV6A 1RT3A 3LAKA 1ASVA 3ASMA 2ATQA 1HYVA 3V9UA 3P1GA 4OLBA 4NCGA 3DOKA 4N56A 1HPZA
chains in the Genus database with same CATH superfamily
3HSTB 3PUFA 3VEXA 1RTIA 3WNEA 3UKRA 3ULEB 4CZIA 1C0MA 1NGIA 4JI5K 2ITMA 1C1AA 1EETA 4K41A 3CQYA 4NXNK 3OYEA 1NG9A 1FW6A 1S6PA 5JVHL 3TTDA 3OS0A 4GMJB 3CMAN 3ZEUA 4QOZB 4BACA 4JK9A 5AQTA 4I6MB 4GV6A 1HYSA 2FBYA 1NGEA 4CZLA 2YKMA 3CM5A 5J2PA 1T05A 2UXCK 4G9ZA 1N33K 2YJFA 2I7NA 1DLOA 4DLEA 2NRTA 3RSEA 5FPEA 1U48A 3HPHA 4BE0A 2OPRA 3DLHA 5EOYA 3NHGA 4CIEA 2B6AA 5CZ1A 3NCIA 2DFHA 4LSNA 4CJFA 4N5SA 3AA3A 4DS5A 3J80O 3QDKA 1X9SA 1WB9A 4JI2K 3K5LA 3JS6A 2RF2A 4L3QA 2WC9A 3K5NA 3V9WA 1QE1A 3T19A 2KW4A 3C95A 4DTMA 4DLGA 2X74A 4FZZA 3SMSA 3ZX0A 4IO9L 1D9FA 3RMBA 3VQ7A 1RT2A 4DTUA 2AP1A 5GIOA 5EXWA 3MWPA 2ZE2A 4DV6K 2IOCA 3ATUA 1O1WA 3C94A 3HM9A 1GLBG 3UKRB 3QBXA 4CHPA 1RT4A 4A62A 2UUBK 3HVTA 3KLEA 3ZSRA 4KO0A 4N76A 4GKKK 3AO4A 4FLTA 1UA1A 3DWLA 3WXMB 1BOTO 3AVNA 3JAMO 4YORA 3SJHA 2E2QA 3CCLN 2UU9K 2AJQA 3LWLA 2A41A 2QEXN 1NLVA 5AQKA 2O8DB 4JS5A 4Q5VA 1XMQK 5LY3A 1LOTB 4J2DA 3VQ5A 1S1WA 1HKBA 2E1YA 4YOWA 3BGRA 3C7NB 1HKGA 1RTDA 3NGYA 3MWTA 3LANA 4B9VA 5GIPA 4CGGA 1C0FA 5AFUH 3EY1A 1S1UA 4M3RA 4BRDA 5AQXA 2IGIA 3QFPA 3V6DA 4QS9A 1X9WA 4Z4CA 3TAQA 2P9IB 1KAYA 3MMVA 4H0OA 1KAXA 4FJHA 2VG6A 3E01A 2PFUA 1N5YA 2F7TA 5H1SQ 3L2WA 3HPGA 4WQ4C 1JXEA 3DXKA 3FZLA 3WNGA 2GUPA 3KKRA 1GLFO 4LY7A 1VQLN 3O6WA 5FPNA 5J2QA 1NM1A 1JLQA 4CFDA 5C42A 3N4PA 2XO7A 4RW8A 1E4FT 4M3YA 3PSIA 2F9WA 4HWIA 4FWQA 3KLHA 2YHWA 1BA1A 2HHTA 4GY2B 4B9NA 4BR4A 4CF1A 4YDUA 2GWKA 4ID1A 5CYMA 5KI6A 1RNHA 1Z25A 1YHQN 4HCCA 3Q7CA 4KH6A 4U67L 3T1AA 3LWMA 3L8BA 2A42A 3D2EA 5AJ3K 4YOXA 5EU7A 4O8UA 4DQSA 2EX3A 3HM8A 1C1CA 4BVPA 1K73O 5TKYA 3QETA 4CF0A 3AVMA 2HF4A 5M1PA 3FZFA 3ULEA 4OPAA 4B8AB 4ELTA 3S3NA 1UAXA 4JK7A 4QS8A 5JS2A 3AVIA 3AVHA 3LPUA 4AILC 1NWKA 3ZT4A 1XHXA 1IG8A 4OLAA 3OJSA 1SS6A 4BC2A 2QWPA 1IKXA 1VHXA 1HLUA 4CJQA 3A8YA 1GOBA 3ZT3A 3ULDA 5GAGP 2E5LK 4JV5K 1YXQA 3R8EA 1QZ6A 2P9LB 5J2MA 3TABA 2V51B 4CJKA 5FPMA 5CE3A 3O1BA 1XHZA 2RPIA 5FRNA 5BR9A 4LC9B 3TAGA 5JLHA 2QKBA 1IV0A 3H6EA 1Z05A 1J9AA 3RWUA 3O3HA 3PV8A 4BQLA 3KK2A 4AM6A 3C6UA 3OYGA 5HL7L 4FYDA 1YTAA 2RKIA 1UA0A 3SQ0A 4XEIA 1HKCA 3OYLA 4CJ4A 1H1VA 3CC7N 3LZJA 1RBVA 4BDPA 2UUAK 4E7LA 1BO5O 1J54A 5AQQA 3F9KA 3K9KA 4QAGA 2W40A 1LV5A 2ZD1A 2QWOA 3EKSA 3R9PA 4BG8A 4OPJA 3MX5A 2O8BB 1L3UA 3D6RA 1Q18A 3TTFA 2YHYA 3CCUN 1N32K 4DTPA 2GTDA 2Q36A 2G8FA 1LAVA 4CJ7A 1WBDA 3AVBA 3G71N 1EO1A 4CGFA 5IWAK 1VSFA 4B3OA 3H3OB 1HQEA 3QEIA 3SCXA 4BG9A 3D45A 4CHQA 5M1OA 1HX1A 1D8YA 1WSGA 2QXFA 1EX4A 2HHVA 4KV8A 3QIOA 2F4VK 1VAZA 4KI6A 4KFBA 4BR5A 3O1WA 3TAEA 1Q86O 3QESA 3LM9A 4FWLA 3RR8A 4KHUA 3CFPA 3HRGA 1EXQA 1VK0A 4CFAA 5AQZA 3VQDA 1W9HA 2HVHA 3CC2N 4DMNA 4OPKA 2GUIA 4CECA 3CC4N 4GV9A 4IFEA 2WFBA 5HRNA 4WFNL 4DSIA 1RTJA 3D2FB 3AGKA 3CM6A 4JKCA 4A2BA 5JVGL 1XUPO 3S3OA 5KPTA 4PHTX 2ZM6K 1KSPA 4WE1A 2VG5A 3NE6A 4F3OA 1XNRK 2QTDA 1NKBA 1WSIA 2FBXA 2IVPA 3FZHA 1VQ5N 3ZLJA 1HPMA 1E3MA 4DSJA 3VGLA 4IOXA 2QW9A 3SK3A 1K8AO 4LFAK 3CQ8A 1KXPA 4AH9A 4R5PA 2GELA 2KQ2A 5GAHP 4DFJA 4M45A 1KFSA 3U6FA 1KVBA 3LPTA 1GLLO 2QKKA 5ADXA 3IS9A 5BPNA 3EZWA 2OTJN 3WUHA 3OYMA 2B5JA 3F73A 4RW4A 4B1ZA 4ISEA 4WQ5A 4DTNA 1T03A 3NF9A 3OYNA 3TSPA 4DR6K 4FJLA 2P9PA 1VSHA 2E2OA 3AAPA 2KKZA 3KD1E 3V9ZA 5MLCQ 1JL2A 5BN8A 4BE2A 1U4BA 3SPZA 2QM1A 3BUZB 3O3GA 2PY5A 3DLBA 1L3VA 3L4QA 4FJ7A 4GKJK 4X64K 3NAEA 3V9XA 1NOYA 3ZCMA 1VQKN 1C0UA 3SUPA 3FZMA 2D0OA 3QINA 4CJ5A 3LDOA 1L3TA 1RT7A 3VPZA 2A6AA 2OPSA 1YVUA 4G1QA 1ZYQA 3J8AA 2IDOA 5AZIB 4RW9A 3P39A 2HBJA 4MLHA 4W5RA 3CJCA 3M5RA 1UWBA 2Q2RA 1GLCG 1X3NA 2OPPA 4J2BA 4C23A 4B9SA 4LF7K 4LSLA 2IIRA 4ZHRA 3EN9A 3ZT1A 3HK2A 4CFBA 3FE1A 1TK0A 1RTHA 4FXDA 3I33A 3WNFA 3THWB 2QWRA 2Q1NA 3O9SA 4B1VA 1HYVA 3O4WA 3U4LA 3P1GA 2JWKA 1YJWN 3IMXA 3WEEA 3DOKA 3GL1A 4N56A 3V81A 3ZSOA 4BREA 4DTOA 1NNEA 1REVA 2O8CB 3ID6A 4FL9A 3FFKB 2P9UA 1XC3A 4HCBA 4JI7K 2YX6A 5GADP 2XHBA 1JLAA 2VQFK 4DV0K 3T69A 4E3SA 3BDPA 4FLVA 4I9LA 2NRXA 3JSMA 1NJWA 3HP6A 3LZIA 4MQ3A 4E19A 4I2PA 4PQUA 3QICA 4RW7A 2NZTA 5HRSA 2DTUA 3LP3A 4JKDA 1LCUA 1U45A 4BR7A 1FKPA 1ZXOA 3NH1A 4I7FA 1BHLA 4F8RA 1U04A 4DV7K 2G8KA 2IS3A 3O8MA 4IEEA 3N4QA 3VGKA 4BRIA 3THYA 5BPLA 4X62K 3OYAA 2W41A 3PSFA 1TAUA 4FZXC 3KKSA 4OKKA 3AGRA 2P9NA 1JL1A 3IG1A 4FLXA 2GBZA 3GG4A 4CEEA 1ESVA 4KAZA 3DYAA 3ZSVA 3BEXA 4DR2K 3HYFA 1TUYA 3L4IA 3LDQA 4O44A 3NH0A 1TL1A 4KREA 1I3AA 4BGAA 3AO5A 3PIPL 4M63C 2J4RA 1IJJA 1TYQA 2ZF5O 3J7AP 1RDUA 2VGMA 3SLCA 1I94K 5JS1A 1DEJA 4LD0A 1N34K 2PZSA 3CCMN 5C2DA 2KLAA 1NJXA 2WUSA 3DJCA 4CESA 2HW3A 1QSSA 3ZX3A 2VCPA 3QEXA 1QQCA 1QZ5A 4PY5A 1FK9A 1JXBA 1IH7A 4ISGA 3LDLA 1WAFA 2YI1A 1MWMA 2ZGZA 4CJWA 4KB1A 1SL2A 4E7JA 4DF8A 1VSDA 4FPAA 4TSXA 2BGGA 1HJOA 2CH5A 4OJRA 4DR7K 4YDUC 5KPZA 1CXUA 2ZJRL 2HVIA 1A5XA 5AQGA 1NBWA 2RHKA 1CZAN 3IFRA 2ITGA 1OVYA 5M1NA 3SUQA 2FSKA 5DM7L 1QHTA 2QWLA 4OVLA 4BRFA 4EIAA 2Z1IA 1BU6O 3TTCA 1QVFM 2X6NA 5FDLA 2B4JA 3SZ2A 3MEEA 4EZ9A 4JI3K 3A5OC 2DFEA 1D5AA 4OO1J 2E4LA 1VRUA 1SQKA 1J5OA 3RSEB 1HQUA 1NU0A 2CGKA 2FBVA 3WT0A 3O3FA 3OYDA 3FZKA 3ENHA 1KC8O 1VQPN 3NF6A 1XNQK 4JKGB 1WN7A 1NK4A 3P83D 4K42A 1N8RO 3NF7A 4CEQA 4DR5K 1HUXA 5IT9O 5JICA 3J7ZO 1ATSA 1EQYA 3GE1A 4DU4A 4BE1A 1NGCA 4MDBA 3IDHA 4N47A 3HT3A 3LDPA 1SL0A 1J5EK 4DSLA 2P1JA 3SAFA 3MXMA 4XH1A 3AARA 5AQHA 3EKUA 5KPRA 4A61A 1FXXA 1VQ6N 1NKEA 1Q9XA 3KHYA 1IKWA 4BY9C 3CG7A 3BZCA 3O4QA 3OJUA 1T7PA 1SUQA 1KVAA 4XH5A 4BRQA 3EO3A 1S72N 3SAGA 4NCBA 1FKOA 4Y1CA 5LMNK 4H5NA 5AQFA 5HROA 1ASUA 3SUNA 1IKYA 3EL2A 4O4GA 2HBMA 3K57A 5E84A 4JAXA 2Q31A 2R7YA 1C0TA 5KGWA 4Y1DA 3A0IX 4WFBL 2P9SB 3OYBA 2UUCK 1JKHA 4ILJA 5C24A 3P5JA 5FROA 4IJAA 3GBTA 1K9MO 4CJEA 1GLDG 5C10A 3SV4A 4Z4GA 1DTQA 4KHSA 4K8ZA 3WNHA 3CPWM 4Q0BA 3CYMA 1DT9A 3M8QA 5SWMA 3CCRN 1RBRA 5B8HA 3AA4A 3ISNC 3PX6A 2O8DA 1RDCA 4QS7A 1KQSM 2Z1JA 5AFUA 1A5VA 1YVNA 1RT1A 1W97L 4JEPA 2V52B 4KB0A 1TYQB 2D0CA 1WSJA 3ZT0A 4GNIA 3QO9A 2YHBA 3BF3A 2KHOA 3ZT2A 1UOCA 3ENOA 3ENBA 4CI6A 2O4GA 2ZJQL 3UB5A 3LP2A 5BPMA 3M6GA 3P31A 2IVNA 3HXMA 4FOEA 1N36K 4FO0A 3HOSA 4NCAA 3VENA 3DXMA 5C0YA 4FW2A 1VQON 4KBOA 3THYB 4FK0A 4CFCA 4RWTA 4W5OA 1NJZA 1XQSC 4CVNE 5AQSA 3CCJN 4E7IA 3K58A 5I3UA 5M1QA 1HNIA 2E2PA 3F5TA 4DTRA 2GWJA 3ZSQA 4LF5K 5I42A 3RR7A 2RN2A 2V7ZA 3LAMA 1NGGA 4FOIA 5C12A 1S1TA 4BC5A 3B8AX 2ZJPL 4DUZK 3AVCA 2ASOA 3DM2A 3W0LA 4FJGA 4CIGA 3DLKA 3KD5E 1BWFO 4KTZA 3P38A 4FSVA 4JKAA 4LH4A 1G15A 1IBKK 5LL6Z 1YITN 2VWBA 4E1NA 3CERA 1VSJA 4RW6A 1TL3A 4CK1A 3HVRA 4CHOA 1CZ9A 1BCMA 2NRZA 4DSKA 4DV3K 3AV9A 5FPDA 3SYZA 3OS2A 3EE9A 2HBLA 4CBWA 3THXA 3OYFA 3K5MA 4PKGA 4J2EA 2A5XA 1Q82O 4FCYA 1WNSA 2VWKA 3NGIA 3HTVA 1QQMA 4BDZA 4IFYA 3C6HA 3QEVA 4JRPA 3WXLA 3VF2A 2UXBK 1CLQA 2OPQA 3K2PA 2FLOA 3MXIA 1EKEA 3D7EO 4A5AA 3CFOA 4H8KA 4CD3A 4DHYA 4FLWA 3U8XA 3KK3A 2XY5A 3KIOA 4GVMA 5M1KA 1WSFA 3DI6A 3T3FA 3CPEA 4CZJA 1GLJO 4F2SA 1NK9A 4MFBA 3A5LC 1TKZA 2D4WA 1KRPA 1K8KA 4Z4FA 1T6CA 4M42A 4B9UA 4DV5K 2FF6A 4I9QA 2FSNA 4IZ9A 5D3GA 1WSHA 1TKXA 3VQAA 1BDGA 3NBPA 3L2UA 2A40A 2E88A 4JKFA 2G8IA 4DFMA 4DTJA 3F9MA 1VQ9N 5C15A 5CZ2A 4CZGA 4JYAK 4H4OA 3OYKA 1BGXT 3RMAA 2O8CA 4AQYK 3CHWA 4C8OA 2HHWA 4BWMA 1J53A 1SAZA 4JI4K 3M1FA 4K25A 1L5UA 2BDPA 4F9OA 5BR8K 4BRCA 1OVQA 1RT3A 3WEEB 2ATQA 4KH5A 3V9UA 2FXUA 3Q7BA 1TGOA 2YNIA 3MECA 1GLEG 2LSNA 3QIPA 5SZTA 5FLXO 4M7XA 3MEGA 3VEOA 4CJSA 4M3WA 3UKUB 1HNWK 5ELZA 4H5RA 4BWJA 4DR3K 3CCVN 5DMRA 4YOVA 4DU3A 3ZYYX 1JLCA 4HTUA 4UY8O 1I39A 2OTLN 2P9NB 1S6QA 3ZSZA 1QS4A 1WUAA 1OKJA 2D0AA 3H3NO 1C0GA 4XIUA 4DTXA 4YY3K 4J8FA 1RBUA 1S5JA 5KGXA 1VQNN 4DQQA 1RDAA 3KK7A 1RBTA 3AO3A 2G8HA 3OW2M 5DM6L 2QA4N 4H0VB 3S9HA 3VETA 3CXCM 2HMIA 1KAZA 4U7BA 2EHGA 4RTFD 3MX2A 1T3VA 1VQ7N 3IAYA 1VRTA 5CR4A 5HP1A 1XMOK 4EP5A 2YKNA 4JNEA 2O8FB 1VQ4N 1T44A 1WSEA 4BRPA 3AVLA 4CF9A 1YI2N 4DSEA 4IKFA 4H0TB 1T6DA 4CHNA 4MLEA 5T7BA 4H03B 3PLAA 3H08A 3BF1A 4ICLA 1HJRA 4IEIA 1NK6A 3O08A 5FRMA 3E1YA 2P9KB 4CGIA 3OYJA 4FZYA 4FJMA 1Z6RA 3NF8A 2GV9A 3G25A 3SJJA 1FJGK 1X9JA 4M3TA 5AQVA 1B9DA 3TU5A 2BE2A 3HJFA 3E9PA 3LM2A 2NLXA 4RCHA 4M3UA 5AZIA 4KTWA 5TKWA 4ZTJA 4JRQA 1KLMA 5CY4A 4FJ5A 1U2VB 5J2NA 4Z4IA 4EHUA 3VQEA 4FWKA 1HMVA 1NGHA 4MDAA 3IKMA 4W5QA 3OBYA 1QSLA 4JD2A 3VEWA 4JI6K 3S3MA 3VQCA 4FM2A 2QWMA 3L3VA 2QK9A 1NOZA 4E7KA 4PA1A 5BN9A 4DS4A 4N41A 1D9DA 1GOAA 4JN4A 4H5VA 4B8CA 4IO8A 3JYTA 2OYQA 1W0HA 3E66A 3CJ1A 3V9SA 2P9KA 3AVFA 4EP4A 1JCGA 3FR0A 4DWIA 3MCPA 1BISA 5F0XA 3QBWA 3AY9A 3ID8A 3K9JA 4IG3A 3ZSWA 4DTSA 3MN5A 2X6SA 3KVGA 3FGUA 2P5OA 3I0SA 4KHYA 3LP1A 2KZMA 3PX0A 4IOAL 4JK8A 3C65A 2F8SA 4HUFA 3QMLA 2FBTA 4WQ4A 4A59A 3PIOL 4CEAA 3F2KA 2YNGA 1J6ZA 3KTQA 4FJKA 5F2RA 1S1XA 4BRGA 1HRHA 3HO1A 3HSCA 4O55A 5JMVA 1BQMA 5HRRA 3TANA 1YAGA 3THVA 4DV1K 3RRHA 3VTHA 4O5BA 2NRWA 2VWJA 2A1SA 4GV3A 4H5TA 4DQRA 3CF5L 1OH8A 3SPYA 3HZ6A 4CK2A 3TAMA 1TK8A 2Q0UA 1VQ8N 1S9GA 2IAJA 1RDWX 3J81O 4ELVA 4M3XA 5LJWA 1Z26A 3O9RA 3QFUA 2P9PB 4CJVA 2Z1HA 4FVMA 3C6TA 4AM7A 3B6PA 4EFHA 4B3TK 1B92A 2QXLA 1RT6A 1WLJA 3WXIA 1QQOA 1N6QA 2VQEK 1OH7A 2F96A 3BY5A 1NGJA 2NRVA 3AO1A 1JCEA 4YFUA 3V1RA 4BRLA 2Y1JA 5A2QO 2P9UB 4Z4HA 2PBDA 2IC3A 1BIUA 1VSEA 3KWGA 3O9QA 3K0SA 2HSTA 4I6MA 2O8EB 2OCEA 1NK7A 5AQOA 1QHAA 4BRAA 4GW6A 4LF8K 3OVNA 1NK5A 4DQ8A 1Q81O 4FVUA 3VQQA 1VSMA 3DLEA 2QI2A 1XI1A 5KRSA 2DFFA 2HHSA 3PY8A 3VOVA 4FJNA 3MEDA 2F8TA 3KK1A 1R59O 4HHTA 2FSJA 1C6VA 3CJBA 3ZX2A 1OH5A 3T1YK 3O9TA 3RMCA 2HHUA 3L0QA 1TUUA 3VQ9A 2Y1IA 2IVOA 1HNXK 1VSIA 1WBBA 4LF6K 4H5WA 1JLEA 4F3TA 3TSUA 3MN9A 3EZ5A 3T1HK 3WQUA 2E6MA 4YOTA 1T8EA 2P51A 1CZBA 1NGFA 5ADXH 4B9TA 4W5NA 3SQ1A 1O13A 2D0PA 4AF1A 4B9LA 3VTIA 4LF4K 3VEZA 2QWNA 4A2AA 1TVRA 3MDQA 2KFZA 4NYNA 4AHCA 4B1YB 1ZC6A 1S1VA 5BRHA 1BG3A 1QTMA 1BIZA 2W6KA 2NUBA 3QEPA 3TI0A 2P9IA 4O5FA 3TR8A 4UQGA 3O5BA 3D0PA 4A57A 1NK0A 5AQPA 2HHQA 4X65K 2HBKA 3GDQA 1MWKA 3CJ9A 5AR0A 1ITGA 3G4SN 2W42A 3G0ZA 2VGNA 3E9LA 3CMEN 4Z94A 4CEDA 3MXJA 1TK5A 4CZHA 2JGUA 4CIFA 4KKOA 3KLFA 4J2AA 5C2FA 2V7YA 4DFKA 3PO5A 1RFQA 5EX5A 5BRFA 5JLFA 3R6MA 4KHNA 3QB0A 4PKHA 4JKBA 4BC4A 2WTUA 3NGZA 1QSYA 1NMDA 4DB3A 4B3SK 3WXKA 4AHTA 1VQMN 4OKEA 3A5NC 3FFIA 3CJ7A 2RE2A 1B9FA 4FLUA 1XC9A 4NB4A 3I8BA 5AZJB 2ETJA 1ATRA 1BUPA 1QVGM 3CETA 3OY9A 3QNOA 1JJ2M 4MO5A 4E1JA 1XWLA 2O8BA 1LWEA 3IRXA 4B08A 1YIJN 4YOUA 3A5MC 1ZBUA 4DCHA 3DXKB 4DG1A 3LP0A 3RVCA 1HYZA 3SI6A 5CHIA 1LW2A 2D1KA 4O0JA 3VEVA 2HMPA 2OANA 4EAHD 4BR0A 1U47A 4IBNA 3LALA 1U49A 3HP9A 3VQ6A 1KCFA 4GVEA 4H0PA 4X66K 4H0XB 4BVOA 3L2RA 4M3ZA 4HTLA 3HOTA 3KZBA 5AQMA 2PYJA 1SV5A 4BRMA 1RDDA 3LL3A 2JWLA 3U9DA 4Z0UA 4CBXA 4FLZA 3TAPA 3MAQA 2G8VA 2P5GA 1SZ2A 2G8WA 4R79A 5GINA 1NJIO 4RG8A 3PX4A 4CJUA 4C8KA 4ILHA 1YF5L 3W3DA 3VF4A 4OKJA 1Q7YO 4H4MA 1RT5A 4DV4K 1BI4B 1P90A 4B1UB 1M90O 1TV6A 1ASVA 3ASMA 4K43A 4OLBA 4IWVA 1GLAG 2BANA 1HPZA 3VA0A 4DR4K 3OBWA 5AQWA 4KPYA 3OYCA 4CGJA 1MU2A 1RCHA 1NKCA 1R0AA 3TAFA 1HR0K 3R1XA 3VN5A 4ISFA 4KHWA 3EYZA 3AVAA 2ZGYA 3AAQA 3H1QA 4WCEL 2JLEA 3M3ZA 3T7ZA 3VA3A 4CJRA 4JKHA 3ZSYA 3VMFB 2NNWA 4BROA 4DU1A 4JI8K 5AQUA 1EP4A 4CEBA 1CXQA 2ZWHA 1EWRA 3E9OA 3K5OA 2VYPA 4BRHA 4FJIA 3S41A 1RBSA 1JLBA 4CF2A 4KH4A 3VESA 2XY7A 1KD1O 4WFAL 4IDHA 1BL3A 1V4SA 3L3UA 5KTQA 2BTFA 4OPHA 3THXB 2GX9A 3UKUA 4FW1A 3OYIA 2X78A 1M1KO 4E1MA 5CYQA 3I56N 4ZTFA 3H46O 3DRRA 3U3GA 5C25A 1BI4A 3L6QA 4IJNA 2O8FA 4NXMK 2NRHA 3SBGA 4B9QA 3JXUA 2OZSA 4CBUA 3OA9A 3K59A 1KFDA 3DLGA 2E20A 3B6OA 2CH6A 2HB5A 1X3MA 4IOCL 4EZ6A 2KZZA 3D2FA 3CFRA 2YCHA 4EHTA 1D4XA 4FWSA 2UXDK 4NLBA 2CGJA 5M1FA 1LW0A 5HOOA 1F21A 1RGIA 5BREA 3KJVA 4FM0A 2XY8A 2D5RA 3FLCO 2HNDA 4B9MA 3RMDA 1S9EA 1ATNA 1TAQA 3CCSN 3THWA 1K6YA 3CD6N 4CK3A 4B1WB 4BR2A 2Q97A 5EVZA 3NFAA 4FK4A 3SQ2A 2WOMA 4B3MK 3LDNA 5E41A 4HVJA 1BA0A 3TARA 3NVMA 2ZQBA 3R3LA 4FLYA 3O9UA 1Y64A 1Q8IA 3A2FA 5AQJA 3VQPA 3OTOK 2AA4A 1G99A 3DMJA 1BCOA 3VEYA 1NMNA 4CZMA 4C8LA 4DKWA 4FWNA 3QEWA 1W2BM 1NJYA 3I55N 1WOQA 4CJTA 4PL7A 2H3GX 2DPNA 4DSFA 1IG9A 5J1EA 4LF9K 3H45C 5HRPA 3AO2A 3CQXA 4JLHA 2HF3A 4PWDA 1U2VA 1A5WA 2KFNA 3ZETA 1NGDA 1VSLA 4Z4EA 1C1BA 2HNZA 3RTVA 4CF8A 1DTTA 4FJJA 4BDYA 5AQIA 2Z1GA 2BH1A 1SKRA 4CD1A 3G6EN 1YUWA 1RDBA 1S3XA 4CEOA 3M8RA 3C0BA 1DKGD 4I2QA 4C1NI 4CERA 3AVKA 4PL8A 3DLLL 4FJXA 3ITHA 4DFPA 3SMPA 3U9ZA 4FWOA 3WXJA 3D2EB 4F2RA 4JS4A 1LAWA 2Q3SA 3BP8A 4V19S 4OGCA 3NH2A 4E0DA 4C1NK 5KQ8A 2BUPA 3EEQA 5LMUK 3KLGA 3ZETB 2DY4A 2A3ZA 4JKEA 4CJ3A 1ZBHA 1IBMK 4F4KA 2NRRA 5E26A 3AA5X 5HBMA 3SQ4A 3BZKA 2O8EA 2XRIA 1YT3A 3TPQA 4AHVA 4JI0K 1Y97A 3MK6A 3HBTA 2YNHA 4PUOA 3PO4A 1W7AA 2I5JA 2WONA 4IFVA 3CCQN 3UIQA 1ZBFA 1RILA 1LWCA 4WF9L 2P9LA 2O4IA 1ZBIA 4BQZA 5F1XA 4W5TA 1TKDA 3TSQA 3U3YA 3DLRA 4CJPA 1IO2A 2W6LA 2OA8A 3QLHA 3LDSA 3C7NA 2PYLA 4O8KA 1Q9YA 3MN6A 3EE8A 4CEFA 2EWSA 2FF3B 3DRSA 4YOYA 3VQBA 4JKGA 3HL8A 5AQNA 4FWRA 3NDKA 4E89A 1LWFA 3L2VA 5AZJA 4AHRA 5KRTA 1DGKN 4XH4A 3O4NA 3CCEN 4KRFA 1S22A 4E7HA 1KTQA 4JHDA 4FWMA 1ASWA 3H1VX 4B1XB 2YJEA 2D0BA 4CW7B 4ILGB 4LH5A 4CZKA 4K8XA 2Q0RA 4DV2K 2YHAA 4CE9A 5GAEP 4DF4A 3QNNA 2HOEA 3VERA 1L3SA 1V4TA 5AQYA 3V4IA 4YHHK 4M41A 3RRGA 4H0YB 2ASPA 3G10A 3I0RA 2G8UA 5DK5A 4BC3A 3AVGA 1MDUB 3HI0A 2A1RA 4CHYA 2P9SA 3AVJA 1NGBA 4MO4A 5BRDA 3M8PA 3KLIA 5KQDA 4IDKA 4ID5A 1P8ZA 4AHSA 3OHRA 3DRPA 1VSKA 2KTQA 4CGHA 1K8KB 3SUOA 3ALYA 4BGBA 4KHQA 2QWQA 5I9EB 2FC0A 4DQIA 4DQPA 2YV0X 3NVKA 1SKWA 4L8RB 4O0IA 1NGAA 3AA2A 3CJAA 3SV3A 4BRNA 1BQNA 4K0KK 4HUEA 2HNYA 1JCFA 2E2NA 2PAVA 5AQLA 1IBLK 3MCAB 3UE5A 3ZSXA 1WAJA 4C8MA 2UYTA 4AHUA 4FJ8A 4JHDB 1KLNA 1JLGA 2ASMA 3TWHA 1YTUA 4OX9K 4QCLA 1YJ9N 2I7PA 1JLFA 4KTQA 2OZMA 2HHHK 3CIPA 3CI5A 3DAWA 4CEZA 1U6ZA 4BR9A 4IG0A 1X1PA 4B3RK 3J7YP 4ELUA 4NLCA 1SKSA 3O80A 4OGEA 3SAHA 3OYHA 4WYBA 3I8DA 1HNVA 2CGLA 1IKVA 3KWIA 3C6AA 3VQ8A 4CZEA 4YNQA 3P4IA 1SL1A 1MA9B 1ZBSA 4A5BA 4CHZA 5LJVA 3V1QA 4CGDA 3VQ4A 3MN7A 4CCHA 1HNZK 2GEMA 4FPBA 3ZEUB 4DUYK 3IUCA 2E1ZA 3WQTA 4JD2B 4CJLA 2E8AA 5K14A 3OS1A 3L2QA 1NK8A 4HUGA 4IXCA 3VGMA 4C8NA 4FJ9A 2F9TA 4FK2A 1KVCA 1E4GT 4PKIA 2E6LA 3SBTA 2YNFA 4M7YA 5EY4A 4FWPA 1TKTA 2YHXA 3HPOA 3M8SA 1QQNA 4JI1K 1OH6A 3VF6A 4BRKA 4WQ5C 4CZFA 4LFCK 2HHXA 5HLFA 3NMUA 3QERA 4NYFA 5AQRA 4FM1A 4Y0WA 2XY6A 1ILYA 1EWQA 3DOLA 3ATVA 3SNNA 4DR1K 4KI4A 1X9MA 1GOCA 3GOIA 2VG7A 3V1OA 1ZBLA 4KHPK 2WBNA 3LAKA 4LFBK 3DXMB 4NO7A 4NCGA 1YJNN
chains in the Genus database with same CATH topology
2BANA 3HSTB 3ZSOA 1TGOA 2YNIA 3MECA 2LSNA 3PUFA 3QIPA 4DTOA 1REVA 1RTIA 3WNEA 5SZTA 1C0MA 4KPYA 4HCBA 3OYCA 3MEGA 4CGJA 1C1AA 1JLAA 1EETA 2XHBA 1MU2A 4CJSA 1RCHA 1NKCA 3OYEA 1R0AA 4M3WA 3TAFA 4E3SA 3BDPA 3VN5A 4BWJA 4FLVA 1S6PA 4I9LA 3EYZA 4KHWA 3AVAA 3OS0A 4GMJB 3JSMA 1NJWA 3HP6A 3LZIA 4MQ3A 1NK8A 4E19A 5DMRA 4I2PA 4BACA 4QOZB 2JLEA 4RW7A 4DU3A 4HTUA 1JLCA 4PQUA 1I39A 5HRSA 1HYSA 3LP3A 2DTUA 1S6QA 2FBYA 3VA3A 1U45A 3ZSZA 4CJRA 1QS4A 2YKMA 3CM5A 5J2PA 1FKPA 2D0AA 3ZSYA 4XIUA 4I7FA 3NH1A 4DTXA 1T05A 1BHLA 1RBUA 4DU1A 4F8RA 1U04A 2G8KA 1DLOA 2IS3A 4DLEA 1EP4A 1S5JA 4CEBA 1CXQA 5KGXA 3K5OA 4DQQA 1U48A 1RDAA 3HPHA 4BE0A 2OPRA 3DLHA 3NHGA 4CIEA 4FJIA 3OYAA 1RBTA 3AO3A 4FZXC 1RBSA 2B6AA 1TAUA 1JLBA 3KKSA 5CZ1A 4CF2A 4OKKA 3NCIA 2G8HA 2XY7A 2DFHA 4LSNA 4CJFA 4N5SA 3AA3A 4DS5A 1JL1A 1BL3A 3L3UA 3S9HA 1X9SA 2HMIA 3IG1A 5KTQA 3K5LA 2RF2A 4FLXA 2GBZA 4FW1A 2X78A 3OYIA 2EHGA 4E1MA 3K5NA 3V9WA 5CYQA 4CEEA 4KAZA 4ZTFA 1QE1A 3DYAA 3U3GA 3DRRA 5C25A 3IAYA 3ZSVA 1VRTA 3T19A 1BI4A 2KW4A 5HP1A 3C95A 3HYFA 4EP5A 2OZSA 4DTMA 4DLGA 2X74A 4O44A 3K59A 4FZZA 1KFDA 2YKNA 3DLGA 3NH0A 1TL1A 3B6OA 4KREA 1D9FA 1WSEA 1I3AA 3RMBA 2HB5A 3AVLA 3VQ7A 1RT2A 3AO5A 4DTUA 4EZ6A 2KZZA 4CF9A 2ZE2A 3CFRA 4DSEA 2IOCA 1O1WA 3C94A 3HM9A 4IKFA 5JS1A 1LW0A 4CHPA 1RT4A 4CHNA 4LD0A 5T7BA 1F21A 2PZSA 3H08A 3HVTA 3KLEA 3ZSRA 4KO0A 4N76A 4ICLA 1HJRA 3KJVA 4FM0A 2XY8A 1NK6A 1L3VA 5FRMA 2D5RA 1NJXA 2HNDA 3AO4A 4FLTA 4CESA 4CGIA 3OYJA 1UA1A 1QSSA 3RMDA 4B9MA 4FZYA 2HW3A 1S9EA 1TAQA 4FJMA 3QEXA 1K6YA 3AVNA 1QQCA 3NF8A 4CK3A 4PY5A 2GV9A 3SJJA 2AJQA 1FK9A 3LWLA 1JXBA 1IH7A 3NFAA 3SQ2A 4M3TA 2WOMA 4FK4A 1B9DA 1WAFA 4CJWA 2BE2A 4JS5A 5E41A 4HVJA 4KB1A 4Q5VA 3TARA 3HJFA 2ZQBA 4FLYA 1SL2A 4J2DA 1Q8IA 3A2FA 3VQ5A 3VQPA 4E7JA 4M3UA 4KTWA 4DF8A 1S1WA 4ZTJA 1VSDA 4JRQA 1KLMA 5CY4A 4FJ5A 4TSXA 2BGGA 5J2NA 3BGRA 4Z4IA 3DMJA 1BCOA 1RTDA 4OJRA 3VQEA 3NGYA 4C8LA 3LANA 3QEWA 4B9VA 4CGGA 3EY1A 1HMVA 1NJYA 1S1UA 1CXUA 4M3RA 2HVIA 1A5XA 3V6DA 2IGIA 4CJTA 1X9WA 4W5QA 4DSFA 2ITGA 1IG9A 5J1EA 4Z4CA 3TAQA 5HRPA 1QSLA 3AO2A 3SUQA 4FJHA 2VG6A 3E01A 4JLHA 1QHTA 4OVLA 4PWDA 3S3MA 1N5YA 2Z1IA 1A5WA 3VQCA 3HPGA 3L2WA 1VSLA 3L3VA 1JXEA 4FM2A 1NOZA 4Z4EA 2X6NA 1C1BA 4E7KA 2QK9A 4PA1A 2HNZA 3RTVA 5FDLA 4CF8A 3WNGA 2B4JA 3KKRA 3SZ2A 1DTTA 4DS4A 4FJJA 4LY7A 4BDYA 3MEEA 4EZ9A 4N41A 1D9DA 2Z1GA 4FJ7A 1GOAA 2DFEA 5J2QA 4B8CA 1JLQA 1D5AA 3JYTA 1SKRA 4CFDA 2OYQA 1W0HA 5C42A 2E4LA 1RDBA 4RW8A 2XO7A 1VRUA 4CEOA 3M8RA 3V9SA 1J5OA 4M3YA 1HQUA 3AVFA 2FBVA 4I2QA 4EP4A 4DWIA 3KLHA 4CERA 3O3FA 3OYDA 1BISA 3AVKA 4FJXA 2HHTA 4B9NA 4IG3A 3ITHA 3NF6A 4CF1A 4DFPA 1KRPA 3ZSWA 4ID1A 4DTSA 2X6SA 1WN7A 5CYMA 1RNHA 5KI6A 1NK4A 3I0SA 2P5OA 4KHYA 3P83D 1Z25A 3LP1A 3NF7A 4HCCA 4CEQA 2KFNA 2KZMA 3PX0A 4F2RA 4JS4A 1LAWA 3T1AA 3LWMA 2Q3SA 3L8BA 2F8SA 4DU4A 4OGCA 3NH2A 4HUFA 4BE1A 4E0DA 2FBTA 5EU7A 4N47A 3HT3A 4DQSA 1SL0A 4CEAA 3KLGA 2YNGA 2P1JA 2EX3A 3KTQA 4DSLA 4FJKA 1C1CA 2DY4A 3QETA 1S1XA 4CF0A 3AVMA 1HRHA 3HO1A 3MXMA 4B8AB 4O55A 4CJ3A 4ELTA 1ZBHA 4F4KA 1BQMA 5HRRA 3TANA 1UAXA 3THVA 3S3NA 3RRHA 1FXXA 5JS2A 3AA5X 3AVIA 4O5BA 1NKEA 3AVHA 3LPUA 4AILC 1Q9XA 1IKWA 3ZT4A 2VWJA 2A1SA 3CG7A 5HBMA 1XHXA 3O4QA 3OJUA 3SQ4A 4DQRA 4OLAA 3OJSA 1T7PA 3SPYA 1SUQA 1IKXA 1YT3A 2XRIA 4AHVA 4CK2A 4CJQA 3TAMA 1TK8A 1KVAA 1Y97A 1S9GA 1GOBA 2YNHA 3ZT3A 4NCBA 1FKOA 2IAJA 3ULDA 4Y1CA 3PO4A 4PUOA 2I5JA 2WONA 5HROA 1ASUA 3SUNA 4ELVA 4M3XA 1IKYA 4IFVA 3UIQA 1Z26A 1ZBFA 1RILA 4O4GA 5J2MA 3K57A 4CJVA 2R7YA 1C0TA 2Z1HA 4FVMA 3TABA 1LWCA 5KGWA 3C6TA 3B6PA 2O4IA 4Y1DA 3OYBA 1ZBIA 4CJKA 1B92A 1N6QA 1RT6A 1WLJA 4W5TA 1TKDA 1JKHA 1XHZA 3U3YA 3DLRA 2RPIA 4CJPA 1IO2A 2F96A 3P5JA 5C24A 5FROA 2OA8A 3QLHA 3LDSA 5FRNA 3TAGA 3AO1A 4YFUA 2PYLA 2QKBA 3V1RA 1Q9YA 2Y1JA 3V81A 4CJEA 4Z4HA 4CEFA 2IC3A 1BIUA 1VSEA 1J9AA 3DRSA 3SV4A 3VQBA 3RWUA 3HL8A 1DTQA 3O3HA 4KHSA 4K8ZA 3WNHA 3PV8A 3NDKA 1NK7A 4Q0BA 3CYMA 4E89A 3KK2A 3M8QA 1LWFA 4GW6A 3C6UA 5SWMA 3OVNA 3OYGA 3L2VA 1NK5A 1RBRA 3AA4A 4FYDA 1YTAA 3ISNC 2RKIA 4AHRA 3PX6A 3SQ0A 1UA0A 3OYLA 3VQQA 1VSMA 3DLEA 1RDCA 4CJ4A 5KRTA 3LZJA 1XI1A 1RBVA 4BDPA 2Z1JA 1A5VA 5KRSA 1RT1A 3O4NA 1J54A 4E7LA 4KB0A 2DFFA 4KRFA 2HHSA 3F9KA 3PY8A 4E7HA 4QAGA 4FJNA 2D0CA 1LV5A 1KTQA 1WSJA 2ZD1A 3MEDA 3ZT0A 3QO9A 2F8TA 3KK1A 2YHBA 4HHTA 3VA0A 4OPJA 1ASWA 1C6VA 3ZT2A 1L3UA 1UOCA 2D0BA 4DTPA 3RMCA 2O4GA 2G8FA 1LAVA 2HHUA 3LP2A 4Z4FA 4LH5A 3HXMA 3AVBA 3VQ9A 2Y1IA 1VSIA 4CGFA 4K8XA 1VSFA 4NCAA 2YHAA 4CE9A 4B3OA 3QEIA 1HQEA 4DF4A 4FW2A 3QNNA 3SCXA 1JLEA 4F3TA 3D45A 4CHQA 1L3SA 4FK0A 4CFCA 3V4IA 3EZ5A 1D8YA 1WSGA 4M41A 2QXFA 3RRGA 4W5OA 1NJZA 1EX4A 2HHVA 4KV8A 3G10A 4E7IA 3K58A 3QIOA 5I3UA 3I0RA 2E6MA 5DK5A 2G8UA 4KI6A 4KFBA 3TAEA 3AVGA 3QESA 2A1RA 4CHYA 1T8EA 1HNIA 2P51A 1CZBA 3AVJA 4DTRA 4B9TA 4W5NA 3SQ1A 3ZSQA 3RR8A 5I42A 4B9LA 3RR7A 3M8PA 4KHUA 3KLIA 1TVRA 3CFPA 1EXQA 4IDKA 4NYNA 1VK0A 4ID5A 4AHCA 2KFZA 4AHSA 1S1VA 2RN2A 1QTMA 3LAMA 4CFAA 1BIZA 2NUBA 1VSKA 3DRPA 3VQDA 3QEPA 1W9HA 2KTQA 4CGHA 3TI0A 3SUOA 1S1TA 3TR8A 3ALYA 4UQGA 2HVHA 3D0PA 4KHQA 3AVCA 2FC0A 4DQIA 4DMNA 4OPKA 1NK0A 2YV0X 3DM2A 4DQPA 4FJGA 4Z4GA 4CIGA 1SKWA 2HHQA 4L8RB 4O0IA 3DLKA 3KD5E 1ITGA 2GUIA 4CECA 3AA2A 4KTZA 2W42A 3SV3A 1BQNA 3G0ZA 4LH4A 4HUEA 5HRNA 2HNYA 4CEDA 1G15A 1RTJA 3MXJA 4DSIA 1TK5A 2JGUA 4CIFA 4KKOA 3KLFA 3CM6A 4E1NA 1VSJA 4RW6A 1TL3A 4CK1A 3ZSXA 3HVRA 1WAJA 4C8MA 3S3OA 4J2AA 1KSPA 4WE1A 4CHOA 2VG5A 4AHUA 1CZ9A 1BCMA 3NE6A 4DFKA 3PO5A 4DSKA 4F3OA 4FJ8A 1NKBA 1KLNA 3AV9A 1WSIA 1JLGA 3SYZA 2FBXA 3OS2A 4KHNA 3TWHA 1YTUA 3NGZA 1QSYA 4QCLA 4DSJA 1JLFA 3OYFA 3K5MA 4KTQA 2OZMA 4AHTA 3CQ8A 4J2EA 4AH9A 4CEZA 4IG0A 4OKEA 3FFIA 4R5PA 1X1PA 4FLUA 2KQ2A 1B9FA 4FCYA 4ELUA 1WNSA 2VWKA 4DFJA 3NGIA 1XC9A 4M45A 1SKSA 1KFSA 4OGEA 4BDZA 2ETJA 3OYHA 3U6FA 1KVBA 3LPTA 3I8DA 2QKKA 1HNVA 3IS9A 4IFYA 1IKVA 3OY9A 3QNOA 3OYMA 4JRPA 2B5JA 3QEVA 3F73A 4RW4A 3VQ8A 1XWLA 4YNQA 1LWEA 4DTNA 1T03A 1SL1A 3IRXA 3NF9A 4B08A 3OYNA 1CLQA 2OPQA 3K2PA 3MXIA 1EKEA 4FJLA 4CHZA 1VSHA 1ZBUA 3CFOA 3V1QA 3VQ4A 4CGDA 4H8KA 4CCHA 3KD1E 4FLWA 4DG1A 3V9ZA 3KK3A 3LP0A 2XY5A 1JL2A 3KIOA 1HYZA 4GVMA 3SI6A 1WSFA 1LW2A 3DI6A 3T3FA 4BE2A 4O0JA 1U4BA 4F2SA 3SPZA 3O3GA 1NK9A 2PY5A 4MFBA 4CJLA 3DLBA 1U47A 4IBNA 1TKZA 3LALA 5K14A 3OS1A 3L2QA 3NAEA 3V9XA 3HP9A 4HUGA 3VQ6A 1U49A 1KCFA 3ZCMA 1NOYA 4B9UA 4M42A 1C0UA 3SUPA 4C8NA 4I9QA 4FJ9A 5D3GA 4FK2A 1KVCA 3QINA 1WSHA 1TKXA 2E6LA 3VQAA 4CJ5A 3L2RA 1L3TA 1RT7A 2OPSA 1YVUA 4G1QA 2YNFA 3NBPA 1ZYQA 4M3ZA 1TKTA 2IDOA 3HPOA 3L2UA 3M8SA 4RW9A 2PYJA 1SV5A 1RDDA 4W5RA 4DFMA 2G8IA 4DTJA 2HHXA 4Z0UA 1UWBA 5HLFA 4FLZA 3QERA 4NYFA 3TAPA 3MAQA 5CZ2A 2OPPA 2G8VA 2P5GA 4J2BA 2G8WA 4B9SA 4H4OA 4LSLA 4FM1A 2XY6A 4RG8A 3PX4A 4CJUA 3OYKA 4ZHRA 4C8KA 3ZT1A 1BGXT 4OKJA 3RMAA 3DOLA 4H4MA 1RT5A 3SNNA 4CFBA 4C8OA 3HK2A 2HHWA 4BWMA 1J53A 1RTHA 1X9MA 1BI4B 1GOCA 1TK0A 4KI4A 3WNFA 4FXDA 2VG7A 3V1OA 1ZBLA 2BDPA 1L5UA 1TV6A 1RT3A 3LAKA 1ASVA 3ASMA 2ATQA 1HYVA 3V9UA 3P1GA 4OLBA 4NCGA 3DOKA 4N56A 1HPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAN A;  3HST B;  3ZSO A;  1TGO A;  2YNI A;  3MEC A;  2LSN A;  3PUF A;  3QIP A;  4DTO A;  1REV A;  1RTI A;  3WNE A;  5SZT A;  1C0M A;  4KPY A;  4HCB A;  3OYC A;  3MEG A;  4CGJ A;  1C1A A;  1JLA A;  1EET A;  2XHB A;  1MU2 A;  4CJS A;  1RCH A;  1NKC A;  3OYE A;  1R0A A;  4M3W A;  3TAF A;  4E3S A;  3BDP A;  3VN5 A;  4BWJ A;  4FLV A;  1S6P A;  4I9L A;  3EYZ A;  4KHW A;  3AVA A;  3OS0 A;  4GMJ B;  3JSM A;  1NJW A;  3HP6 A;  3LZI A;  4MQ3 A;  1NK8 A;  4E19 A;  5DMR A;  4I2P A;  4BAC A;  4QOZ B;  2JLE A;  4RW7 A;  4DU3 A;  4HTU A;  1JLC A;  4PQU A;  1I39 A;  5HRS A;  1HYS A;  3LP3 A;  2DTU A;  1S6Q A;  2FBY A;  3VA3 A;  1U45 A;  3ZSZ A;  4CJR A;  1QS4 A;  2YKM A;  3CM5 A;  5J2P A;  1FKP A;  2D0A A;  3ZSY A;  4XIU A;  4I7F A;  3NH1 A;  4DTX A;  1T05 A;  1BHL A;  1RBU A;  4DU1 A;  4F8R A;  1U04 A;  2G8K A;  1DLO A;  2IS3 A;  4DLE A;  1EP4 A;  1S5J A;  4CEB A;  1CXQ A;  5KGX A;  3K5O A;  4DQQ A;  1U48 A;  1RDA A;  3HPH A;  4BE0 A;  2OPR A;  3DLH A;  3NHG A;  4CIE A;  4FJI A;  3OYA A;  1RBT A;  3AO3 A;  4FZX C;  1RBS A;  2B6A A;  1TAU A;  1JLB A;  3KKS A;  5CZ1 A;  4CF2 A;  4OKK A;  3NCI A;  2G8H A;  2XY7 A;  2DFH A;  4LSN A;  4CJF A;  4N5S A;  3AA3 A;  4DS5 A;  1JL1 A;  1BL3 A;  3L3U A;  3S9H A;  1X9S A;  2HMI A;  3IG1 A;  5KTQ A;  3K5L A;  2RF2 A;  4FLX A;  2GBZ A;  4FW1 A;  2X78 A;  3OYI A;  2EHG A;  4E1M A;  3K5N A;  3V9W A;  5CYQ A;  4CEE A;  4KAZ A;  4ZTF A;  1QE1 A;  3DYA A;  3U3G A;  3DRR A;  5C25 A;  3IAY A;  3ZSV A;  1VRT A;  3T19 A;  1BI4 A;  2KW4 A;  5HP1 A;  3C95 A;  3HYF A;  4EP5 A;  2OZS A;  4DTM A;  4DLG A;  2X74 A;  4O44 A;  3K59 A;  4FZZ A;  1KFD A;  2YKN A;  3DLG A;  3NH0 A;  1TL1 A;  3B6O A;  4KRE A;  1D9F A;  1WSE A;  1I3A A;  3RMB A;  2HB5 A;  3AVL A;  3VQ7 A;  1RT2 A;  3AO5 A;  4DTU A;  4EZ6 A;  2KZZ A;  4CF9 A;  2ZE2 A;  3CFR A;  4DSE A;  2IOC A;  1O1W A;  3C94 A;  3HM9 A;  4IKF A;  5JS1 A;  1LW0 A;  4CHP A;  1RT4 A;  4CHN A;  4LD0 A;  5T7B A;  1F21 A;  2PZS A;  3H08 A;  3HVT A;  3KLE A;  3ZSR A;  4KO0 A;  4N76 A;  4ICL A;  1HJR A;  3KJV A;  4FM0 A;  2XY8 A;  1NK6 A;  1L3V A;  5FRM A;  2D5R A;  1NJX A;  2HND A;  3AO4 A;  4FLT A;  4CES A;  4CGI A;  3OYJ A;  1UA1 A;  1QSS A;  3RMD A;  4B9M A;  4FZY A;  2HW3 A;  1S9E A;  1TAQ A;  4FJM A;  3QEX A;  1K6Y A;  3AVN A;  1QQC A;  3NF8 A;  4CK3 A;  4PY5 A;  2GV9 A;  3SJJ A;  2AJQ A;  1FK9 A;  3LWL A;  1JXB A;  1IH7 A;  3NFA A;  3SQ2 A;  4M3T A;  2WOM A;  4FK4 A;  1B9D A;  1WAF A;  4CJW A;  2BE2 A;  4JS5 A;  5E41 A;  4HVJ A;  4KB1 A;  4Q5V A;  3TAR A;  3HJF A;  2ZQB A;  4FLY A;  1SL2 A;  4J2D A;  1Q8I A;  3A2F A;  3VQ5 A;  3VQP A;  4E7J A;  4M3U A;  4KTW A;  4DF8 A;  1S1W A;  4ZTJ A;  1VSD A;  4JRQ A;  1KLM A;  5CY4 A;  4FJ5 A;  4TSX A;  2BGG A;  5J2N A;  3BGR A;  4Z4I A;  3DMJ A;  1BCO A;  1RTD A;  4OJR A;  3VQE A;  3NGY A;  4C8L A;  3LAN A;  3QEW A;  4B9V A;  4CGG A;  3EY1 A;  1HMV A;  1NJY A;  1S1U A;  1CXU A;  4M3R A;  2HVI A;  1A5X A;  3V6D A;  2IGI A;  4CJT A;  1X9W A;  4W5Q A;  4DSF A;  2ITG A;  1IG9 A;  5J1E A;  4Z4C A;  3TAQ A;  5HRP A;  1QSL A;  3AO2 A;  3SUQ A;  4FJH A;  2VG6 A;  3E01 A;  4JLH A;  1QHT A;  4OVL A;  4PWD A;  3S3M A;  1N5Y A;  2Z1I A;  1A5W A;  3VQC A;  3HPG A;  3L2W A;  1VSL A;  3L3V A;  1JXE A;  4FM2 A;  1NOZ A;  4Z4E A;  2X6N A;  1C1B A;  4E7K A;  2QK9 A;  4PA1 A;  2HNZ A;  3RTV A;  5FDL A;  4CF8 A;  3WNG A;  2B4J A;  3KKR A;  3SZ2 A;  1DTT A;  4DS4 A;  4FJJ A;  4LY7 A;  4BDY A;  3MEE A;  4EZ9 A;  4N41 A;  1D9D A;  2Z1G A;  4FJ7 A;  1GOA A;  2DFE A;  5J2Q A;  4B8C A;  1JLQ A;  1D5A A;  3JYT A;  1SKR A;  4CFD A;  2OYQ A;  1W0H A;  5C42 A;  2E4L A;  1RDB A;  4RW8 A;  2XO7 A;  1VRU A;  4CEO A;  3M8R A;  3V9S A;  1J5O A;  4M3Y A;  1HQU A;  3AVF A;  2FBV A;  4I2Q A;  4EP4 A;  4DWI A;  3KLH A;  4CER A;  3O3F A;  3OYD A;  1BIS A;  3AVK A;  4FJX A;  2HHT A;  4B9N A;  4IG3 A;  3ITH A;  3NF6 A;  4CF1 A;  4DFP A;  1KRP A;  3ZSW A;  4ID1 A;  4DTS A;  2X6S A;  1WN7 A;  5CYM A;  1RNH A;  5KI6 A;  1NK4 A;  3I0S A;  2P5O A;  4KHY A;  3P83 D;  1Z25 A;  3LP1 A;  3NF7 A;  4HCC A;  4CEQ A;  2KFN A;  2KZM A;  3PX0 A;  4F2R A;  4JS4 A;  1LAW A;  3T1A A;  3LWM A;  2Q3S A;  3L8B A;  2F8S A;  4DU4 A;  4OGC A;  3NH2 A;  4HUF A;  4BE1 A;  4E0D A;  2FBT A;  5EU7 A;  4N47 A;  3HT3 A;  4DQS A;  1SL0 A;  4CEA A;  3KLG A;  2YNG A;  2P1J A;  2EX3 A;  3KTQ A;  4DSL A;  4FJK A;  1C1C A;  2DY4 A;  3QET A;  1S1X A;  4CF0 A;  3AVM A;  1HRH A;  3HO1 A;  3MXM A;  4B8A B;  4O55 A;  4CJ3 A;  4ELT A;  1ZBH A;  4F4K A;  1BQM A;  5HRR A;  3TAN A;  1UAX A;  3THV A;  3S3N A;  3RRH A;  1FXX A;  5JS2 A;  3AA5 X;  3AVI A;  4O5B A;  1NKE A;  3AVH A;  3LPU A;  4AIL C;  1Q9X A;  1IKW A;  3ZT4 A;  2VWJ A;  2A1S A;  3CG7 A;  5HBM A;  1XHX A;  3O4Q A;  3OJU A;  3SQ4 A;  4DQR A;  4OLA A;  3OJS A;  1T7P A;  3SPY A;  1SUQ A;  1IKX A;  1YT3 A;  2XRI A;  4AHV A;  4CK2 A;  4CJQ A;  3TAM A;  1TK8 A;  1KVA A;  1Y97 A;  1S9G A;  1GOB A;  2YNH A;  3ZT3 A;  4NCB A;  1FKO A;  2IAJ A;  3ULD A;  4Y1C A;  3PO4 A;  4PUO A;  2I5J A;  2WON A;  5HRO A;  1ASU A;  3SUN A;  4ELV A;  4M3X A;  1IKY A;  4IFV A;  3UIQ A;  1Z26 A;  1ZBF A;  1RIL A;  4O4G A;  5J2M A;  3K57 A;  4CJV A;  2R7Y A;  1C0T A;  2Z1H A;  4FVM A;  3TAB A;  1LWC A;  5KGW A;  3C6T A;  3B6P A;  2O4I A;  4Y1D A;  3OYB A;  1ZBI A;  4CJK A;  1B92 A;  1N6Q A;  1RT6 A;  1WLJ A;  4W5T A;  1TKD A;  1JKH A;  1XHZ A;  3U3Y A;  3DLR A;  2RPI A;  4CJP A;  1IO2 A;  2F96 A;  3P5J A;  5C24 A;  5FRO A;  2OA8 A;  3QLH A;  3LDS A;  5FRN A;  3TAG A;  3AO1 A;  4YFU A;  2PYL A;  2QKB A;  3V1R A;  1Q9Y A;  2Y1J A;  3V81 A;  4CJE A;  4Z4H A;  4CEF A;  2IC3 A;  1BIU A;  1VSE A;  1J9A A;  3DRS A;  3SV4 A;  3VQB A;  3RWU A;  3HL8 A;  1DTQ A;  3O3H A;  4KHS A;  4K8Z A;  3WNH A;  3PV8 A;  3NDK A;  1NK7 A;  4Q0B A;  3CYM A;  4E89 A;  3KK2 A;  3M8Q A;  1LWF A;  4GW6 A;  3C6U A;  5SWM A;  3OVN A;  3OYG A;  3L2V A;  1NK5 A;  1RBR A;  3AA4 A;  4FYD A;  1YTA A;  3ISN C;  2RKI A;  4AHR A;  3PX6 A;  3SQ0 A;  1UA0 A;  3OYL A;  3VQQ A;  1VSM A;  3DLE A;  1RDC A;  4CJ4 A;  5KRT A;  3LZJ A;  1XI1 A;  1RBV A;  4BDP A;  2Z1J A;  1A5V A;  5KRS A;  1RT1 A;  3O4N A;  1J54 A;  4E7L A;  4KB0 A;  2DFF A;  4KRF A;  2HHS A;  3F9K A;  3PY8 A;  4E7H A;  4QAG A;  4FJN A;  2D0C A;  1LV5 A;  1KTQ A;  1WSJ A;  2ZD1 A;  3MED A;  3ZT0 A;  3QO9 A;  2F8T A;  3KK1 A;  2YHB A;  4HHT A;  3VA0 A;  4OPJ A;  1ASW A;  1C6V A;  3ZT2 A;  1L3U A;  1UOC A;  2D0B A;  4DTP A;  3RMC A;  2O4G A;  2G8F A;  1LAV A;  2HHU A;  3LP2 A;  4Z4F A;  4LH5 A;  3HXM A;  3AVB A;  3VQ9 A;  2Y1I A;  1VSI A;  4CGF A;  4K8X A;  1VSF A;  4NCA A;  2YHA A;  4CE9 A;  4B3O A;  3QEI A;  1HQE A;  4DF4 A;  4FW2 A;  3QNN A;  3SCX A;  1JLE A;  4F3T A;  3D45 A;  4CHQ A;  1L3S A;  4FK0 A;  4CFC A;  3V4I A;  3EZ5 A;  1D8Y A;  1WSG A;  4M41 A;  2QXF A;  3RRG A;  4W5O A;  1NJZ A;  1EX4 A;  2HHV A;  4KV8 A;  3G10 A;  4E7I A;  3K58 A;  3QIO A;  5I3U A;  3I0R A;  2E6M A;  5DK5 A;  2G8U A;  4KI6 A;  4KFB A;  3TAE A;  3AVG A;  3QES A;  2A1R A;  4CHY A;  1T8E A;  1HNI A;  2P51 A;  1CZB A;  3AVJ A;  4DTR A;  4B9T A;  4W5N A;  3SQ1 A;  3ZSQ A;  3RR8 A;  5I42 A;  4B9L A;  3RR7 A;  3M8P A;  4KHU A;  3KLI A;  1TVR A;  3CFP A;  1EXQ A;  4IDK A;  4NYN A;  1VK0 A;  4ID5 A;  4AHC A;  2KFZ A;  4AHS A;  1S1V A;  2RN2 A;  1QTM A;  3LAM A;  4CFA A;  1BIZ A;  2NUB A;  1VSK A;  3DRP A;  3VQD A;  3QEP A;  1W9H A;  2KTQ A;  4CGH A;  3TI0 A;  3SUO A;  1S1T A;  3TR8 A;  3ALY A;  4UQG A;  2HVH A;  3D0P A;  4KHQ A;  3AVC A;  2FC0 A;  4DQI A;  4DMN A;  4OPK A;  1NK0 A;  2YV0 X;  3DM2 A;  4DQP A;  4FJG A;  4Z4G A;  4CIG A;  1SKW A;  2HHQ A;  4L8R B;  4O0I A;  3DLK A;  3KD5 E;  1ITG A;  2GUI A;  4CEC A;  3AA2 A;  4KTZ A;  2W42 A;  3SV3 A;  1BQN A;  3G0Z A;  4LH4 A;  4HUE A;  5HRN A;  2HNY A;  4CED A;  1G15 A;  1RTJ A;  3MXJ A;  4DSI A;  1TK5 A;  2JGU A;  4CIF A;  4KKO A;  3KLF A;  3CM6 A;  4E1N A;  1VSJ A;  4RW6 A;  1TL3 A;  4CK1 A;  3ZSX A;  3HVR A;  1WAJ A;  4C8M A;  3S3O A;  4J2A A;  1KSP A;  4WE1 A;  4CHO A;  2VG5 A;  4AHU A;  1CZ9 A;  1BCM A;  3NE6 A;  4DFK A;  3PO5 A;  4DSK A;  4F3O A;  4FJ8 A;  1NKB A;  1KLN A;  3AV9 A;  1WSI A;  1JLG A;  3SYZ A;  2FBX A;  3OS2 A;  4KHN A;  3TWH A;  1YTU A;  3NGZ A;  1QSY A;  4QCL A;  4DSJ A;  1JLF A;  3OYF A;  3K5M A;  4KTQ A;  2OZM A;  4AHT A;  3CQ8 A;  4J2E A;  4AH9 A;  4CEZ A;  4IG0 A;  4OKE A;  3FFI A;  4R5P A;  1X1P A;  4FLU A;  2KQ2 A;  1B9F A;  4FCY A;  4ELU A;  1WNS A;  2VWK A;  4DFJ A;  3NGI A;  1XC9 A;  4M45 A;  1SKS A;  1KFS A;  4OGE A;  4BDZ A;  2ETJ A;  3OYH A;  3U6F A;  1KVB A;  3LPT A;  3I8D A;  2QKK A;  1HNV A;  3IS9 A;  4IFY A;  1IKV A;  3OY9 A;  3QNO A;  3OYM A;  4JRP A;  2B5J A;  3QEV A;  3F73 A;  4RW4 A;  3VQ8 A;  1XWL A;  4YNQ A;  1LWE A;  4DTN A;  1T03 A;  1SL1 A;  3IRX A;  3NF9 A;  4B08 A;  3OYN A;  1CLQ A;  2OPQ A;  3K2P A;  3MXI A;  1EKE A;  4FJL A;  4CHZ A;  1VSH A;  1ZBU A;  3CFO A;  3V1Q A;  3VQ4 A;  4CGD A;  4H8K A;  4CCH A;  3KD1 E;  4FLW A;  4DG1 A;  3V9Z A;  3KK3 A;  3LP0 A;  2XY5 A;  1JL2 A;  3KIO A;  1HYZ A;  4GVM A;  3SI6 A;  1WSF A;  1LW2 A;  3DI6 A;  3T3F A;  4BE2 A;  4O0J A;  1U4B A;  4F2S A;  3SPZ A;  3O3G A;  1NK9 A;  2PY5 A;  4MFB A;  4CJL A;  3DLB A;  1U47 A;  4IBN A;  1TKZ A;  3LAL A;  5K14 A;  3OS1 A;  3L2Q A;  3NAE A;  3V9X A;  3HP9 A;  4HUG A;  3VQ6 A;  1U49 A;  1KCF A;  3ZCM A;  1NOY A;  4B9U A;  4M42 A;  1C0U A;  3SUP A;  4C8N A;  4I9Q A;  4FJ9 A;  5D3G A;  4FK2 A;  1KVC A;  3QIN A;  1WSH A;  1TKX A;  2E6L A;  3VQA A;  4CJ5 A;  3L2R A;  1L3T A;  1RT7 A;  2OPS A;  1YVU A;  4G1Q A;  2YNF A;  3NBP A;  1ZYQ A;  4M3Z A;  1TKT A;  2IDO A;  3HPO A;  3L2U A;  3M8S A;  4RW9 A;  2PYJ A;  1SV5 A;  1RDD A;  4W5R A;  4DFM A;  2G8I A;  4DTJ A;  2HHX A;  4Z0U A;  1UWB A;  5HLF A;  4FLZ A;  3QER A;  4NYF A;  3TAP A;  3MAQ A;  5CZ2 A;  2OPP A;  2G8V A;  2P5G A;  4J2B A;  2G8W A;  4B9S A;  4H4O A;  4LSL A;  4FM1 A;  2XY6 A;  4RG8 A;  3PX4 A;  4CJU A;  3OYK A;  4ZHR A;  4C8K A;  3ZT1 A;  1BGX T;  4OKJ A;  3RMA A;  3DOL A;  4H4M A;  1RT5 A;  3SNN A;  4CFB A;  4C8O A;  3HK2 A;  2HHW A;  4BWM A;  1J53 A;  1RTH A;  1X9M A;  1BI4 B;  1GOC A;  1TK0 A;  4KI4 A;  3WNF A;  4FXD A;  2VG7 A;  3V1O A;  1ZBL A;  2BDP A;  1L5U A;  1TV6 A;  1RT3 A;  3LAK A;  1ASV A;  3ASM A;  2ATQ A;  1HYV A;  3V9U A;  3P1G A;  4OLB A;  4NCG A;  3DOK A;  4N56 A;  1HPZ A; 
#chains in the Genus database with same CATH topology
 3HST B;  3PUF A;  3VEX A;  1RTI A;  3WNE A;  3UKR A;  3ULE B;  4CZI A;  1C0M A;  1NGI A;  4JI5 K;  2ITM A;  1C1A A;  1EET A;  4K41 A;  3CQY A;  4NXN K;  3OYE A;  1NG9 A;  1FW6 A;  1S6P A;  5JVH L;  3TTD A;  3OS0 A;  4GMJ B;  3CMA N;  3ZEU A;  4QOZ B;  4BAC A;  4JK9 A;  5AQT A;  4I6M B;  4GV6 A;  1HYS A;  2FBY A;  1NGE A;  4CZL A;  2YKM A;  3CM5 A;  5J2P A;  1T05 A;  2UXC K;  4G9Z A;  1N33 K;  2YJF A;  2I7N A;  1DLO A;  4DLE A;  2NRT A;  3RSE A;  5FPE A;  1U48 A;  3HPH A;  4BE0 A;  2OPR A;  3DLH A;  5EOY A;  3NHG A;  4CIE A;  2B6A A;  5CZ1 A;  3NCI A;  2DFH A;  4LSN A;  4CJF A;  4N5S A;  3AA3 A;  4DS5 A;  3J80 O;  3QDK A;  1X9S A;  1WB9 A;  4JI2 K;  3K5L A;  3JS6 A;  2RF2 A;  4L3Q A;  2WC9 A;  3K5N A;  3V9W A;  1QE1 A;  3T19 A;  2KW4 A;  3C95 A;  4DTM A;  4DLG A;  2X74 A;  4FZZ A;  3SMS A;  3ZX0 A;  4IO9 L;  1D9F A;  3RMB A;  3VQ7 A;  1RT2 A;  4DTU A;  2AP1 A;  5GIO A;  5EXW A;  3MWP A;  2ZE2 A;  4DV6 K;  2IOC A;  3ATU A;  1O1W A;  3C94 A;  3HM9 A;  1GLB G;  3UKR B;  3QBX A;  4CHP A;  1RT4 A;  4A62 A;  2UUB K;  3HVT A;  3KLE A;  3ZSR A;  4KO0 A;  4N76 A;  4GKK K;  3AO4 A;  4FLT A;  1UA1 A;  3DWL A;  3WXM B;  1BOT O;  3AVN A;  3JAM O;  4YOR A;  3SJH A;  2E2Q A;  3CCL N;  2UU9 K;  2AJQ A;  3LWL A;  2A41 A;  2QEX N;  1NLV A;  5AQK A;  2O8D B;  4JS5 A;  4Q5V A;  1XMQ K;  5LY3 A;  1LOT B;  4J2D A;  3VQ5 A;  1S1W A;  1HKB A;  2E1Y A;  4YOW A;  3BGR A;  3C7N B;  1HKG A;  1RTD A;  3NGY A;  3MWT A;  3LAN A;  4B9V A;  5GIP A;  4CGG A;  1C0F A;  5AFU H;  3EY1 A;  1S1U A;  4M3R A;  4BRD A;  5AQX A;  2IGI A;  3QFP A;  3V6D A;  4QS9 A;  1X9W A;  4Z4C A;  3TAQ A;  2P9I B;  1KAY A;  3MMV A;  4H0O A;  1KAX A;  4FJH A;  2VG6 A;  3E01 A;  2PFU A;  1N5Y A;  2F7T A;  5H1S Q;  3L2W A;  3HPG A;  4WQ4 C;  1JXE A;  3DXK A;  3FZL A;  3WNG A;  2GUP A;  3KKR A;  1GLF O;  4LY7 A;  1VQL N;  3O6W A;  5FPN A;  5J2Q A;  1NM1 A;  1JLQ A;  4CFD A;  5C42 A;  3N4P A;  2XO7 A;  4RW8 A;  1E4F T;  4M3Y A;  3PSI A;  2F9W A;  4HWI A;  4FWQ A;  3KLH A;  2YHW A;  1BA1 A;  2HHT A;  4GY2 B;  4B9N A;  4BR4 A;  4CF1 A;  4YDU A;  2GWK A;  4ID1 A;  5CYM A;  5KI6 A;  1RNH A;  1Z25 A;  1YHQ N;  4HCC A;  3Q7C A;  4KH6 A;  4U67 L;  3T1A A;  3LWM A;  3L8B A;  2A42 A;  3D2E A;  5AJ3 K;  4YOX A;  5EU7 A;  4O8U A;  4DQS A;  2EX3 A;  3HM8 A;  1C1C A;  4BVP A;  1K73 O;  5TKY A;  3QET A;  4CF0 A;  3AVM A;  2HF4 A;  5M1P A;  3FZF A;  3ULE A;  4OPA A;  4B8A B;  4ELT A;  3S3N A;  1UAX A;  4JK7 A;  4QS8 A;  5JS2 A;  3AVI A;  3AVH A;  3LPU A;  4AIL C;  1NWK A;  3ZT4 A;  1XHX A;  1IG8 A;  4OLA A;  3OJS A;  1SS6 A;  4BC2 A;  2QWP A;  1IKX A;  1VHX A;  1HLU A;  4CJQ A;  3A8Y A;  1GOB A;  3ZT3 A;  3ULD A;  5GAG P;  2E5L K;  4JV5 K;  1YXQ A;  3R8E A;  1QZ6 A;  2P9L B;  5J2M A;  3TAB A;  2V51 B;  4CJK A;  5FPM A;  5CE3 A;  3O1B A;  1XHZ A;  2RPI A;  5FRN A;  5BR9 A;  4LC9 B;  3TAG A;  5JLH A;  2QKB A;  1IV0 A;  3H6E A;  1Z05 A;  1J9A A;  3RWU A;  3O3H A;  3PV8 A;  4BQL A;  3KK2 A;  4AM6 A;  3C6U A;  3OYG A;  5HL7 L;  4FYD A;  1YTA A;  2RKI A;  1UA0 A;  3SQ0 A;  4XEI A;  1HKC A;  3OYL A;  4CJ4 A;  1H1V A;  3CC7 N;  3LZJ A;  1RBV A;  4BDP A;  2UUA K;  4E7L A;  1BO5 O;  1J54 A;  5AQQ A;  3F9K A;  3K9K A;  4QAG A;  2W40 A;  1LV5 A;  2ZD1 A;  2QWO A;  3EKS A;  3R9P A;  4BG8 A;  4OPJ A;  3MX5 A;  2O8B B;  1L3U A;  3D6R A;  1Q18 A;  3TTF A;  2YHY A;  3CCU N;  1N32 K;  4DTP A;  2GTD A;  2Q36 A;  2G8F A;  1LAV A;  4CJ7 A;  1WBD A;  3AVB A;  3G71 N;  1EO1 A;  4CGF A;  5IWA K;  1VSF A;  4B3O A;  3H3O B;  1HQE A;  3QEI A;  3SCX A;  4BG9 A;  3D45 A;  4CHQ A;  5M1O A;  1HX1 A;  1D8Y A;  1WSG A;  2QXF A;  1EX4 A;  2HHV A;  4KV8 A;  3QIO A;  2F4V K;  1VAZ A;  4KI6 A;  4KFB A;  4BR5 A;  3O1W A;  3TAE A;  1Q86 O;  3QES A;  3LM9 A;  4FWL A;  3RR8 A;  4KHU A;  3CFP A;  3HRG A;  1EXQ A;  1VK0 A;  4CFA A;  5AQZ A;  3VQD A;  1W9H A;  2HVH A;  3CC2 N;  4DMN A;  4OPK A;  2GUI A;  4CEC A;  3CC4 N;  4GV9 A;  4IFE A;  2WFB A;  5HRN A;  4WFN L;  4DSI A;  1RTJ A;  3D2F B;  3AGK A;  3CM6 A;  4JKC A;  4A2B A;  5JVG L;  1XUP O;  3S3O A;  5KPT A;  4PHT X;  2ZM6 K;  1KSP A;  4WE1 A;  2VG5 A;  3NE6 A;  4F3O A;  1XNR K;  2QTD A;  1NKB A;  1WSI A;  2FBX A;  2IVP A;  3FZH A;  1VQ5 N;  3ZLJ A;  1HPM A;  1E3M A;  4DSJ A;  3VGL A;  4IOX A;  2QW9 A;  3SK3 A;  1K8A O;  4LFA K;  3CQ8 A;  1KXP A;  4AH9 A;  4R5P A;  2GEL A;  2KQ2 A;  5GAH P;  4DFJ A;  4M45 A;  1KFS A;  3U6F A;  1KVB A;  3LPT A;  1GLL O;  2QKK A;  5ADX A;  3IS9 A;  5BPN A;  3EZW A;  2OTJ N;  3WUH A;  3OYM A;  2B5J A;  3F73 A;  4RW4 A;  4B1Z A;  4ISE A;  4WQ5 A;  4DTN A;  1T03 A;  3NF9 A;  3OYN A;  3TSP A;  4DR6 K;  4FJL A;  2P9P A;  1VSH A;  2E2O A;  3AAP A;  2KKZ A;  3KD1 E;  3V9Z A;  5MLC Q;  1JL2 A;  5BN8 A;  4BE2 A;  1U4B A;  3SPZ A;  2QM1 A;  3BUZ B;  3O3G A;  2PY5 A;  3DLB A;  1L3V A;  3L4Q A;  4FJ7 A;  4GKJ K;  4X64 K;  3NAE A;  3V9X A;  1NOY A;  3ZCM A;  1VQK N;  1C0U A;  3SUP A;  3FZM A;  2D0O A;  3QIN A;  4CJ5 A;  3LDO A;  1L3T A;  1RT7 A;  3VPZ A;  2A6A A;  2OPS A;  1YVU A;  4G1Q A;  1ZYQ A;  3J8A A;  2IDO A;  5AZI B;  4RW9 A;  3P39 A;  2HBJ A;  4MLH A;  4W5R A;  3CJC A;  3M5R A;  1UWB A;  2Q2R A;  1GLC G;  1X3N A;  2OPP A;  4J2B A;  4C23 A;  4B9S A;  4LF7 K;  4LSL A;  2IIR A;  4ZHR A;  3EN9 A;  3ZT1 A;  3HK2 A;  4CFB A;  3FE1 A;  1TK0 A;  1RTH A;  4FXD A;  3I33 A;  3WNF A;  3THW B;  2QWR A;  2Q1N A;  3O9S A;  4B1V A;  1HYV A;  3O4W A;  3U4L A;  3P1G A;  2JWK A;  1YJW N;  3IMX A;  3WEE A;  3DOK A;  3GL1 A;  4N56 A;  3V81 A;  3ZSO A;  4BRE A;  4DTO A;  1NNE A;  1REV A;  2O8C B;  3ID6 A;  4FL9 A;  3FFK B;  2P9U A;  1XC3 A;  4HCB A;  4JI7 K;  2YX6 A;  5GAD P;  2XHB A;  1JLA A;  2VQF K;  4DV0 K;  3T69 A;  4E3S A;  3BDP A;  4FLV A;  4I9L A;  2NRX A;  3JSM A;  1NJW A;  3HP6 A;  3LZI A;  4MQ3 A;  4E19 A;  4I2P A;  4PQU A;  3QIC A;  4RW7 A;  2NZT A;  5HRS A;  2DTU A;  3LP3 A;  4JKD A;  1LCU A;  1U45 A;  4BR7 A;  1FKP A;  1ZXO A;  3NH1 A;  4I7F A;  1BHL A;  4F8R A;  1U04 A;  4DV7 K;  2G8K A;  2IS3 A;  3O8M A;  4IEE A;  3N4Q A;  3VGK A;  4BRI A;  3THY A;  5BPL A;  4X62 K;  3OYA A;  2W41 A;  3PSF A;  1TAU A;  4FZX C;  3KKS A;  4OKK A;  3AGR A;  2P9N A;  1JL1 A;  3IG1 A;  4FLX A;  2GBZ A;  3GG4 A;  4CEE A;  1ESV A;  4KAZ A;  3DYA A;  3ZSV A;  3BEX A;  4DR2 K;  3HYF A;  1TUY A;  3L4I A;  3LDQ A;  4O44 A;  3NH0 A;  1TL1 A;  4KRE A;  1I3A A;  4BGA A;  3AO5 A;  3PIP L;  4M63 C;  2J4R A;  1IJJ A;  1TYQ A;  2ZF5 O;  3J7A P;  1RDU A;  2VGM A;  3SLC A;  1I94 K;  5JS1 A;  1DEJ A;  4LD0 A;  1N34 K;  2PZS A;  3CCM N;  5C2D A;  2KLA A;  1NJX A;  2WUS A;  3DJC A;  4CES A;  2HW3 A;  1QSS A;  3ZX3 A;  2VCP A;  3QEX A;  1QQC A;  1QZ5 A;  4PY5 A;  1FK9 A;  1JXB A;  1IH7 A;  4ISG A;  3LDL A;  1WAF A;  2YI1 A;  1MWM A;  2ZGZ A;  4CJW A;  4KB1 A;  1SL2 A;  4E7J A;  4DF8 A;  1VSD A;  4FPA A;  4TSX A;  2BGG A;  1HJO A;  2CH5 A;  4OJR A;  4DR7 K;  4YDU C;  5KPZ A;  1CXU A;  2ZJR L;  2HVI A;  1A5X A;  5AQG A;  1NBW A;  2RHK A;  1CZA N;  3IFR A;  2ITG A;  1OVY A;  5M1N A;  3SUQ A;  2FSK A;  5DM7 L;  1QHT A;  2QWL A;  4OVL A;  4BRF A;  4EIA A;  2Z1I A;  1BU6 O;  3TTC A;  1QVF M;  2X6N A;  5FDL A;  2B4J A;  3SZ2 A;  3MEE A;  4EZ9 A;  4JI3 K;  3A5O C;  2DFE A;  1D5A A;  4OO1 J;  2E4L A;  1VRU A;  1SQK A;  1J5O A;  3RSE B;  1HQU A;  1NU0 A;  2CGK A;  2FBV A;  3WT0 A;  3O3F A;  3OYD A;  3FZK A;  3ENH A;  1KC8 O;  1VQP N;  3NF6 A;  1XNQ K;  4JKG B;  1WN7 A;  1NK4 A;  3P83 D;  4K42 A;  1N8R O;  3NF7 A;  4CEQ A;  4DR5 K;  1HUX A;  5IT9 O;  5JIC A;  3J7Z O;  1ATS A;  1EQY A;  3GE1 A;  4DU4 A;  4BE1 A;  1NGC A;  4MDB A;  3IDH A;  4N47 A;  3HT3 A;  3LDP A;  1SL0 A;  1J5E K;  4DSL A;  2P1J A;  3SAF A;  3MXM A;  4XH1 A;  3AAR A;  5AQH A;  3EKU A;  5KPR A;  4A61 A;  1FXX A;  1VQ6 N;  1NKE A;  1Q9X A;  3KHY A;  1IKW A;  4BY9 C;  3CG7 A;  3BZC A;  3O4Q A;  3OJU A;  1T7P A;  1SUQ A;  1KVA A;  4XH5 A;  4BRQ A;  3EO3 A;  1S72 N;  3SAG A;  4NCB A;  1FKO A;  4Y1C A;  5LMN K;  4H5N A;  5AQF A;  5HRO A;  1ASU A;  3SUN A;  1IKY A;  3EL2 A;  4O4G A;  2HBM A;  3K57 A;  5E84 A;  4JAX A;  2Q31 A;  2R7Y A;  1C0T A;  5KGW A;  4Y1D A;  3A0I X;  4WFB L;  2P9S B;  3OYB A;  2UUC K;  1JKH A;  4ILJ A;  5C24 A;  3P5J A;  5FRO A;  4IJA A;  3GBT A;  1K9M O;  4CJE A;  1GLD G;  5C10 A;  3SV4 A;  4Z4G A;  1DTQ A;  4KHS A;  4K8Z A;  3WNH A;  3CPW M;  4Q0B A;  3CYM A;  1DT9 A;  3M8Q A;  5SWM A;  3CCR N;  1RBR A;  5B8H A;  3AA4 A;  3ISN C;  3PX6 A;  2O8D A;  1RDC A;  4QS7 A;  1KQS M;  2Z1J A;  5AFU A;  1A5V A;  1YVN A;  1RT1 A;  1W97 L;  4JEP A;  2V52 B;  4KB0 A;  1TYQ B;  2D0C A;  1WSJ A;  3ZT0 A;  4GNI A;  3QO9 A;  2YHB A;  3BF3 A;  2KHO A;  3ZT2 A;  1UOC A;  3ENO A;  3ENB A;  4CI6 A;  2O4G A;  2ZJQ L;  3UB5 A;  3LP2 A;  5BPM A;  3M6G A;  3P31 A;  2IVN A;  3HXM A;  4FOE A;  1N36 K;  4FO0 A;  3HOS A;  4NCA A;  3VEN A;  3DXM A;  5C0Y A;  4FW2 A;  1VQO N;  4KBO A;  3THY B;  4FK0 A;  4CFC A;  4RWT A;  4W5O A;  1NJZ A;  1XQS C;  4CVN E;  5AQS A;  3CCJ N;  4E7I A;  3K58 A;  5I3U A;  5M1Q A;  1HNI A;  2E2P A;  3F5T A;  4DTR A;  2GWJ A;  3ZSQ A;  4LF5 K;  5I42 A;  3RR7 A;  2RN2 A;  2V7Z A;  3LAM A;  1NGG A;  4FOI A;  5C12 A;  1S1T A;  4BC5 A;  3B8A X;  2ZJP L;  4DUZ K;  3AVC A;  2ASO A;  3DM2 A;  3W0L A;  4FJG A;  4CIG A;  3DLK A;  3KD5 E;  1BWF O;  4KTZ A;  3P38 A;  4FSV A;  4JKA A;  4LH4 A;  1G15 A;  1IBK K;  5LL6 Z;  1YIT N;  2VWB A;  4E1N A;  3CER A;  1VSJ A;  4RW6 A;  1TL3 A;  4CK1 A;  3HVR A;  4CHO A;  1CZ9 A;  1BCM A;  2NRZ A;  4DSK A;  4DV3 K;  3AV9 A;  5FPD A;  3SYZ A;  3OS2 A;  3EE9 A;  2HBL A;  4CBW A;  3THX A;  3OYF A;  3K5M A;  4PKG A;  4J2E A;  2A5X A;  1Q82 O;  4FCY A;  1WNS A;  2VWK A;  3NGI A;  3HTV A;  1QQM A;  4BDZ A;  4IFY A;  3C6H A;  3QEV A;  4JRP A;  3WXL A;  3VF2 A;  2UXB K;  1CLQ A;  2OPQ A;  3K2P A;  2FLO A;  3MXI A;  1EKE A;  3D7E O;  4A5A A;  3CFO A;  4H8K A;  4CD3 A;  4DHY A;  4FLW A;  3U8X A;  3KK3 A;  2XY5 A;  3KIO A;  4GVM A;  5M1K A;  1WSF A;  3DI6 A;  3T3F A;  3CPE A;  4CZJ A;  1GLJ O;  4F2S A;  1NK9 A;  4MFB A;  3A5L C;  1TKZ A;  2D4W A;  1KRP A;  1K8K A;  4Z4F A;  1T6C A;  4M42 A;  4B9U A;  4DV5 K;  2FF6 A;  4I9Q A;  2FSN A;  4IZ9 A;  5D3G A;  1WSH A;  1TKX A;  3VQA A;  1BDG A;  3NBP A;  3L2U A;  2A40 A;  2E88 A;  4JKF A;  2G8I A;  4DFM A;  4DTJ A;  3F9M A;  1VQ9 N;  5C15 A;  5CZ2 A;  4CZG A;  4JYA K;  4H4O A;  3OYK A;  1BGX T;  3RMA A;  2O8C A;  4AQY K;  3CHW A;  4C8O A;  2HHW A;  4BWM A;  1J53 A;  1SAZ A;  4JI4 K;  3M1F A;  4K25 A;  1L5U A;  2BDP A;  4F9O A;  5BR8 K;  4BRC A;  1OVQ A;  1RT3 A;  3WEE B;  2ATQ A;  4KH5 A;  3V9U A;  2FXU A;  3Q7B A;  1TGO A;  2YNI A;  3MEC A;  1GLE G;  2LSN A;  3QIP A;  5SZT A;  5FLX O;  4M7X A;  3MEG A;  3VEO A;  4CJS A;  4M3W A;  3UKU B;  1HNW K;  5ELZ A;  4H5R A;  4BWJ A;  4DR3 K;  3CCV N;  5DMR A;  4YOV A;  4DU3 A;  3ZYY X;  1JLC A;  4HTU A;  4UY8 O;  1I39 A;  2OTL N;  2P9N B;  1S6Q A;  3ZSZ A;  1QS4 A;  1WUA A;  1OKJ A;  2D0A A;  3H3N O;  1C0G A;  4XIU A;  4DTX A;  4YY3 K;  4J8F A;  1RBU A;  1S5J A;  5KGX A;  1VQN N;  4DQQ A;  1RDA A;  3KK7 A;  1RBT A;  3AO3 A;  2G8H A;  3OW2 M;  5DM6 L;  2QA4 N;  4H0V B;  3S9H A;  3VET A;  3CXC M;  2HMI A;  1KAZ A;  4U7B A;  2EHG A;  4RTF D;  3MX2 A;  1T3V A;  1VQ7 N;  3IAY A;  1VRT A;  5CR4 A;  5HP1 A;  1XMO K;  4EP5 A;  2YKN A;  4JNE A;  2O8F B;  1VQ4 N;  1T44 A;  1WSE A;  4BRP A;  3AVL A;  4CF9 A;  1YI2 N;  4DSE A;  4IKF A;  4H0T B;  1T6D A;  4CHN A;  4MLE A;  5T7B A;  4H03 B;  3PLA A;  3H08 A;  3BF1 A;  4ICL A;  1HJR A;  4IEI A;  1NK6 A;  3O08 A;  5FRM A;  3E1Y A;  2P9K B;  4CGI A;  3OYJ A;  4FZY A;  4FJM A;  1Z6R A;  3NF8 A;  2GV9 A;  3G25 A;  3SJJ A;  1FJG K;  1X9J A;  4M3T A;  5AQV A;  1B9D A;  3TU5 A;  2BE2 A;  3HJF A;  3E9P A;  3LM2 A;  2NLX A;  4RCH A;  4M3U A;  5AZI A;  4KTW A;  5TKW A;  4ZTJ A;  4JRQ A;  1KLM A;  5CY4 A;  4FJ5 A;  1U2V B;  5J2N A;  4Z4I A;  4EHU A;  3VQE A;  4FWK A;  1HMV A;  1NGH A;  4MDA A;  3IKM A;  4W5Q A;  3OBY A;  1QSL A;  4JD2 A;  3VEW A;  4JI6 K;  3S3M A;  3VQC A;  4FM2 A;  2QWM A;  3L3V A;  2QK9 A;  1NOZ A;  4E7K A;  4PA1 A;  5BN9 A;  4DS4 A;  4N41 A;  1D9D A;  1GOA A;  4JN4 A;  4H5V A;  4B8C A;  4IO8 A;  3JYT A;  2OYQ A;  1W0H A;  3E66 A;  3CJ1 A;  3V9S A;  2P9K A;  3AVF A;  4EP4 A;  1JCG A;  3FR0 A;  4DWI A;  3MCP A;  1BIS A;  5F0X A;  3QBW A;  3AY9 A;  3ID8 A;  3K9J A;  4IG3 A;  3ZSW A;  4DTS A;  3MN5 A;  2X6S A;  3KVG A;  3FGU A;  2P5O A;  3I0S A;  4KHY A;  3LP1 A;  2KZM A;  3PX0 A;  4IOA L;  4JK8 A;  3C65 A;  2F8S A;  4HUF A;  3QML A;  2FBT A;  4WQ4 A;  4A59 A;  3PIO L;  4CEA A;  3F2K A;  2YNG A;  1J6Z A;  3KTQ A;  4FJK A;  5F2R A;  1S1X A;  4BRG A;  1HRH A;  3HO1 A;  3HSC A;  4O55 A;  5JMV A;  1BQM A;  5HRR A;  3TAN A;  1YAG A;  3THV A;  4DV1 K;  3RRH A;  3VTH A;  4O5B A;  2NRW A;  2VWJ A;  2A1S A;  4GV3 A;  4H5T A;  4DQR A;  3CF5 L;  1OH8 A;  3SPY A;  3HZ6 A;  4CK2 A;  3TAM A;  1TK8 A;  2Q0U A;  1VQ8 N;  1S9G A;  2IAJ A;  1RDW X;  3J81 O;  4ELV A;  4M3X A;  5LJW A;  1Z26 A;  3O9R A;  3QFU A;  2P9P B;  4CJV A;  2Z1H A;  4FVM A;  3C6T A;  4AM7 A;  3B6P A;  4EFH A;  4B3T K;  1B92 A;  2QXL A;  1RT6 A;  1WLJ A;  3WXI A;  1QQO A;  1N6Q A;  2VQE K;  1OH7 A;  2F96 A;  3BY5 A;  1NGJ A;  2NRV A;  3AO1 A;  1JCE A;  4YFU A;  3V1R A;  4BRL A;  2Y1J A;  5A2Q O;  2P9U B;  4Z4H A;  2PBD A;  2IC3 A;  1BIU A;  1VSE A;  3KWG A;  3O9Q A;  3K0S A;  2HST A;  4I6M A;  2O8E B;  2OCE A;  1NK7 A;  5AQO A;  1QHA A;  4BRA A;  4GW6 A;  4LF8 K;  3OVN A;  1NK5 A;  4DQ8 A;  1Q81 O;  4FVU A;  3VQQ A;  1VSM A;  3DLE A;  2QI2 A;  1XI1 A;  5KRS A;  2DFF A;  2HHS A;  3PY8 A;  3VOV A;  4FJN A;  3MED A;  2F8T A;  3KK1 A;  1R59 O;  4HHT A;  2FSJ A;  1C6V A;  3CJB A;  3ZX2 A;  1OH5 A;  3T1Y K;  3O9T A;  3RMC A;  2HHU A;  3L0Q A;  1TUU A;  3VQ9 A;  2Y1I A;  2IVO A;  1HNX K;  1VSI A;  1WBB A;  4LF6 K;  4H5W A;  1JLE A;  4F3T A;  3TSU A;  3MN9 A;  3EZ5 A;  3T1H K;  3WQU A;  2E6M A;  4YOT A;  1T8E A;  2P51 A;  1CZB A;  1NGF A;  5ADX H;  4B9T A;  4W5N A;  3SQ1 A;  1O13 A;  2D0P A;  4AF1 A;  4B9L A;  3VTI A;  4LF4 K;  3VEZ A;  2QWN A;  4A2A A;  1TVR A;  3MDQ A;  2KFZ A;  4NYN A;  4AHC A;  4B1Y B;  1ZC6 A;  1S1V A;  5BRH A;  1BG3 A;  1QTM A;  1BIZ A;  2W6K A;  2NUB A;  3QEP A;  3TI0 A;  2P9I A;  4O5F A;  3TR8 A;  4UQG A;  3O5B A;  3D0P A;  4A57 A;  1NK0 A;  5AQP A;  2HHQ A;  4X65 K;  2HBK A;  3GDQ A;  1MWK A;  3CJ9 A;  5AR0 A;  1ITG A;  3G4S N;  2W42 A;  3G0Z A;  2VGN A;  3E9L A;  3CME N;  4Z94 A;  4CED A;  3MXJ A;  1TK5 A;  4CZH A;  2JGU A;  4CIF A;  4KKO A;  3KLF A;  4J2A A;  5C2F A;  2V7Y A;  4DFK A;  3PO5 A;  1RFQ A;  5EX5 A;  5BRF A;  5JLF A;  3R6M A;  4KHN A;  3QB0 A;  4PKH A;  4JKB A;  4BC4 A;  2WTU A;  3NGZ A;  1QSY A;  1NMD A;  4DB3 A;  4B3S K;  3WXK A;  4AHT A;  1VQM N;  4OKE A;  3A5N C;  3FFI A;  3CJ7 A;  2RE2 A;  1B9F A;  4FLU A;  1XC9 A;  4NB4 A;  3I8B A;  5AZJ B;  2ETJ A;  1ATR A;  1BUP A;  1QVG M;  3CET A;  3OY9 A;  3QNO A;  1JJ2 M;  4MO5 A;  4E1J A;  1XWL A;  2O8B A;  1LWE A;  3IRX A;  4B08 A;  1YIJ N;  4YOU A;  3A5M C;  1ZBU A;  4DCH A;  3DXK B;  4DG1 A;  3LP0 A;  3RVC A;  1HYZ A;  3SI6 A;  5CHI A;  1LW2 A;  2D1K A;  4O0J A;  3VEV A;  2HMP A;  2OAN A;  4EAH D;  4BR0 A;  1U47 A;  4IBN A;  3LAL A;  1U49 A;  3HP9 A;  3VQ6 A;  1KCF A;  4GVE A;  4H0P A;  4X66 K;  4H0X B;  4BVO A;  3L2R A;  4M3Z A;  4HTL A;  3HOT A;  3KZB A;  5AQM A;  2PYJ A;  1SV5 A;  4BRM A;  1RDD A;  3LL3 A;  2JWL A;  3U9D A;  4Z0U A;  4CBX A;  4FLZ A;  3TAP A;  3MAQ A;  2G8V A;  2P5G A;  1SZ2 A;  2G8W A;  4R79 A;  5GIN A;  1NJI O;  4RG8 A;  3PX4 A;  4CJU A;  4C8K A;  4ILH A;  1YF5 L;  3W3D A;  3VF4 A;  4OKJ A;  1Q7Y O;  4H4M A;  1RT5 A;  4DV4 K;  1BI4 B;  1P90 A;  4B1U B;  1M90 O;  1TV6 A;  1ASV A;  3ASM A;  4K43 A;  4OLB A;  4IWV A;  1GLA G;  2BAN A;  1HPZ A;  3VA0 A;  4DR4 K;  3OBW A;  5AQW A;  4KPY A;  3OYC A;  4CGJ A;  1MU2 A;  1RCH A;  1NKC A;  1R0A A;  3TAF A;  1HR0 K;  3R1X A;  3VN5 A;  4ISF A;  4KHW A;  3EYZ A;  3AVA A;  2ZGY A;  3AAQ A;  3H1Q A;  4WCE L;  2JLE A;  3M3Z A;  3T7Z A;  3VA3 A;  4CJR A;  4JKH A;  3ZSY A;  3VMF B;  2NNW A;  4BRO A;  4DU1 A;  4JI8 K;  5AQU A;  1EP4 A;  4CEB A;  1CXQ A;  2ZWH A;  1EWR A;  3E9O A;  3K5O A;  2VYP A;  4BRH A;  4FJI A;  3S41 A;  1RBS A;  1JLB A;  4CF2 A;  4KH4 A;  3VES A;  2XY7 A;  1KD1 O;  4WFA L;  4IDH A;  1BL3 A;  1V4S A;  3L3U A;  5KTQ A;  2BTF A;  4OPH A;  3THX B;  2GX9 A;  3UKU A;  4FW1 A;  3OYI A;  2X78 A;  1M1K O;  4E1M A;  5CYQ A;  3I56 N;  4ZTF A;  3H46 O;  3DRR A;  3U3G A;  5C25 A;  1BI4 A;  3L6Q A;  4IJN A;  2O8F A;  4NXM K;  2NRH A;  3SBG A;  4B9Q A;  3JXU A;  2OZS A;  4CBU A;  3OA9 A;  3K59 A;  1KFD A;  3DLG A;  2E20 A;  3B6O A;  2CH6 A;  2HB5 A;  1X3M A;  4IOC L;  4EZ6 A;  2KZZ A;  3D2F A;  3CFR A;  2YCH A;  4EHT A;  1D4X A;  4FWS A;  2UXD K;  4NLB A;  2CGJ A;  5M1F A;  1LW0 A;  5HOO A;  1F21 A;  1RGI A;  5BRE A;  3KJV A;  4FM0 A;  2XY8 A;  2D5R A;  3FLC O;  2HND A;  4B9M A;  3RMD A;  1S9E A;  1ATN A;  1TAQ A;  3CCS N;  3THW A;  1K6Y A;  3CD6 N;  4CK3 A;  4B1W B;  4BR2 A;  2Q97 A;  5EVZ A;  3NFA A;  4FK4 A;  3SQ2 A;  2WOM A;  4B3M K;  3LDN A;  5E41 A;  4HVJ A;  1BA0 A;  3TAR A;  3NVM A;  2ZQB A;  3R3L A;  4FLY A;  3O9U A;  1Y64 A;  1Q8I A;  3A2F A;  5AQJ A;  3VQP A;  3OTO K;  2AA4 A;  1G99 A;  3DMJ A;  1BCO A;  3VEY A;  1NMN A;  4CZM A;  4C8L A;  4DKW A;  4FWN A;  3QEW A;  1W2B M;  1NJY A;  3I55 N;  1WOQ A;  4CJT A;  4PL7 A;  2H3G X;  2DPN A;  4DSF A;  1IG9 A;  5J1E A;  4LF9 K;  3H45 C;  5HRP A;  3AO2 A;  3CQX A;  4JLH A;  2HF3 A;  4PWD A;  1U2V A;  1A5W A;  2KFN A;  3ZET A;  1NGD A;  1VSL A;  4Z4E A;  1C1B A;  2HNZ A;  3RTV A;  4CF8 A;  1DTT A;  4FJJ A;  4BDY A;  5AQI A;  2Z1G A;  2BH1 A;  1SKR A;  4CD1 A;  3G6E N;  1YUW A;  1RDB A;  1S3X A;  4CEO A;  3M8R A;  3C0B A;  1DKG D;  4I2Q A;  4C1N I;  4CER A;  3AVK A;  4PL8 A;  3DLL L;  4FJX A;  3ITH A;  4DFP A;  3SMP A;  3U9Z A;  4FWO A;  3WXJ A;  3D2E B;  4F2R A;  4JS4 A;  1LAW A;  2Q3S A;  3BP8 A;  4V19 S;  4OGC A;  3NH2 A;  4E0D A;  4C1N K;  5KQ8 A;  2BUP A;  3EEQ A;  5LMU K;  3KLG A;  3ZET B;  2DY4 A;  2A3Z A;  4JKE A;  4CJ3 A;  1ZBH A;  1IBM K;  4F4K A;  2NRR A;  5E26 A;  3AA5 X;  5HBM A;  3SQ4 A;  3BZK A;  2O8E A;  2XRI A;  1YT3 A;  3TPQ A;  4AHV A;  4JI0 K;  1Y97 A;  3MK6 A;  3HBT A;  2YNH A;  4PUO A;  3PO4 A;  1W7A A;  2I5J A;  2WON A;  4IFV A;  3CCQ N;  3UIQ A;  1ZBF A;  1RIL A;  1LWC A;  4WF9 L;  2P9L A;  2O4I A;  1ZBI A;  4BQZ A;  5F1X A;  4W5T A;  1TKD A;  3TSQ A;  3U3Y A;  3DLR A;  4CJP A;  1IO2 A;  2W6L A;  2OA8 A;  3QLH A;  3LDS A;  3C7N A;  2PYL A;  4O8K A;  1Q9Y A;  3MN6 A;  3EE8 A;  4CEF A;  2EWS A;  2FF3 B;  3DRS A;  4YOY A;  3VQB A;  4JKG A;  3HL8 A;  5AQN A;  4FWR A;  3NDK A;  4E89 A;  1LWF A;  3L2V A;  5AZJ A;  4AHR A;  5KRT A;  1DGK N;  4XH4 A;  3O4N A;  3CCE N;  4KRF A;  1S22 A;  4E7H A;  1KTQ A;  4JHD A;  4FWM A;  1ASW A;  3H1V X;  4B1X B;  2YJE A;  2D0B A;  4CW7 B;  4ILG B;  4LH5 A;  4CZK A;  4K8X A;  2Q0R A;  4DV2 K;  2YHA A;  4CE9 A;  5GAE P;  4DF4 A;  3QNN A;  2HOE A;  3VER A;  1L3S A;  1V4T A;  5AQY A;  3V4I A;  4YHH K;  4M41 A;  3RRG A;  4H0Y B;  2ASP A;  3G10 A;  3I0R A;  2G8U A;  5DK5 A;  4BC3 A;  3AVG A;  1MDU B;  3HI0 A;  2A1R A;  4CHY A;  2P9S A;  3AVJ A;  1NGB A;  4MO4 A;  5BRD A;  3M8P A;  3KLI A;  5KQD A;  4IDK A;  4ID5 A;  1P8Z A;  4AHS A;  3OHR A;  3DRP A;  1VSK A;  2KTQ A;  4CGH A;  1K8K B;  3SUO A;  3ALY A;  4BGB A;  4KHQ A;  2QWQ A;  5I9E B;  2FC0 A;  4DQI A;  4DQP A;  2YV0 X;  3NVK A;  1SKW A;  4L8R B;  4O0I A;  1NGA A;  3AA2 A;  3CJA A;  3SV3 A;  4BRN A;  1BQN A;  4K0K K;  4HUE A;  2HNY A;  1JCF A;  2E2N A;  2PAV A;  5AQL A;  1IBL K;  3MCA B;  3UE5 A;  3ZSX A;  1WAJ A;  4C8M A;  2UYT A;  4AHU A;  4FJ8 A;  4JHD B;  1KLN A;  1JLG A;  2ASM A;  3TWH A;  1YTU A;  4OX9 K;  4QCL A;  1YJ9 N;  2I7P A;  1JLF A;  4KTQ A;  2OZM A;  2HHH K;  3CIP A;  3CI5 A;  3DAW A;  4CEZ A;  1U6Z A;  4BR9 A;  4IG0 A;  1X1P A;  4B3R K;  3J7Y P;  4ELU A;  4NLC A;  1SKS A;  3O80 A;  4OGE A;  3SAH A;  3OYH A;  4WYB A;  3I8D A;  1HNV A;  2CGL A;  1IKV A;  3KWI A;  3C6A A;  3VQ8 A;  4CZE A;  4YNQ A;  3P4I A;  1SL1 A;  1MA9 B;  1ZBS A;  4A5B A;  4CHZ A;  5LJV A;  3V1Q A;  4CGD A;  3VQ4 A;  3MN7 A;  4CCH A;  1HNZ K;  2GEM A;  4FPB A;  3ZEU B;  4DUY K;  3IUC A;  2E1Z A;  3WQT A;  4JD2 B;  4CJL A;  2E8A A;  5K14 A;  3OS1 A;  3L2Q A;  1NK8 A;  4HUG A;  4IXC A;  3VGM A;  4C8N A;  4FJ9 A;  2F9T A;  4FK2 A;  1KVC A;  1E4G T;  4PKI A;  2E6L A;  3SBT A;  2YNF A;  4M7Y A;  5EY4 A;  4FWP A;  1TKT A;  2YHX A;  3HPO A;  3M8S A;  1QQN A;  4JI1 K;  1OH6 A;  3VF6 A;  4BRK A;  4WQ5 C;  4CZF A;  4LFC K;  2HHX A;  5HLF A;  3NMU A;  3QER A;  4NYF A;  5AQR A;  4FM1 A;  4Y0W A;  2XY6 A;  1ILY A;  1EWQ A;  3DOL A;  3ATV A;  3SNN A;  4DR1 K;  4KI4 A;  1X9M A;  1GOC A;  3GOI A;  2VG7 A;  3V1O A;  1ZBL A;  4KHP K;  2WBN A;  3LAK A;  4LFB K;  3DXM B;  4NO7 A;  4NCG A;  1YJN N; 
#chains in the Genus database with same CATH homology
 2BAN A;  3HST B;  3ZSO A;  1TGO A;  2YNI A;  3MEC A;  2LSN A;  3PUF A;  3QIP A;  4DTO A;  1REV A;  1RTI A;  3WNE A;  5SZT A;  1C0M A;  4KPY A;  4HCB A;  3OYC A;  3MEG A;  4CGJ A;  1C1A A;  1JLA A;  1EET A;  2XHB A;  1MU2 A;  4CJS A;  1RCH A;  1NKC A;  3OYE A;  1R0A A;  4M3W A;  3TAF A;  4E3S A;  3BDP A;  3VN5 A;  4BWJ A;  4FLV A;  1S6P A;  4I9L A;  3EYZ A;  4KHW A;  3AVA A;  3OS0 A;  4GMJ B;  3JSM A;  1NJW A;  3HP6 A;  3LZI A;  4MQ3 A;  1NK8 A;  4E19 A;  5DMR A;  4I2P A;  4BAC A;  4QOZ B;  2JLE A;  4RW7 A;  4DU3 A;  4HTU A;  1JLC A;  4PQU A;  1I39 A;  5HRS A;  1HYS A;  3LP3 A;  2DTU A;  1S6Q A;  2FBY A;  3VA3 A;  1U45 A;  3ZSZ A;  4CJR A;  1QS4 A;  2YKM A;  3CM5 A;  5J2P A;  1FKP A;  2D0A A;  3ZSY A;  4XIU A;  4I7F A;  3NH1 A;  4DTX A;  1T05 A;  1BHL A;  1RBU A;  4DU1 A;  4F8R A;  1U04 A;  2G8K A;  1DLO A;  2IS3 A;  4DLE A;  1EP4 A;  1S5J A;  4CEB A;  1CXQ A;  5KGX A;  3K5O A;  4DQQ A;  1U48 A;  1RDA A;  3HPH A;  4BE0 A;  2OPR A;  3DLH A;  3NHG A;  4CIE A;  4FJI A;  3OYA A;  1RBT A;  3AO3 A;  4FZX C;  1RBS A;  2B6A A;  1TAU A;  1JLB A;  3KKS A;  5CZ1 A;  4CF2 A;  4OKK A;  3NCI A;  2G8H A;  2XY7 A;  2DFH A;  4LSN A;  4CJF A;  4N5S A;  3AA3 A;  4DS5 A;  1JL1 A;  1BL3 A;  3L3U A;  3S9H A;  1X9S A;  2HMI A;  3IG1 A;  5KTQ A;  3K5L A;  2RF2 A;  4FLX A;  2GBZ A;  4FW1 A;  2X78 A;  3OYI A;  2EHG A;  4E1M A;  3K5N A;  3V9W A;  5CYQ A;  4CEE A;  4KAZ A;  4ZTF A;  1QE1 A;  3DYA A;  3U3G A;  3DRR A;  5C25 A;  3IAY A;  3ZSV A;  1VRT A;  3T19 A;  1BI4 A;  2KW4 A;  5HP1 A;  3C95 A;  3HYF A;  4EP5 A;  2OZS A;  4DTM A;  4DLG A;  2X74 A;  4O44 A;  3K59 A;  4FZZ A;  1KFD A;  2YKN A;  3DLG A;  3NH0 A;  1TL1 A;  3B6O A;  4KRE A;  1D9F A;  1WSE A;  1I3A A;  3RMB A;  2HB5 A;  3AVL A;  3VQ7 A;  1RT2 A;  3AO5 A;  4DTU A;  4EZ6 A;  2KZZ A;  4CF9 A;  2ZE2 A;  3CFR A;  4DSE A;  2IOC A;  1O1W A;  3C94 A;  3HM9 A;  4IKF A;  5JS1 A;  1LW0 A;  4CHP A;  1RT4 A;  4CHN A;  4LD0 A;  5T7B A;  1F21 A;  2PZS A;  3H08 A;  3HVT A;  3KLE A;  3ZSR A;  4KO0 A;  4N76 A;  4ICL A;  1HJR A;  3KJV A;  4FM0 A;  2XY8 A;  1NK6 A;  1L3V A;  5FRM A;  2D5R A;  1NJX A;  2HND A;  3AO4 A;  4FLT A;  4CES A;  4CGI A;  3OYJ A;  1UA1 A;  1QSS A;  3RMD A;  4B9M A;  4FZY A;  2HW3 A;  1S9E A;  1TAQ A;  4FJM A;  3QEX A;  1K6Y A;  3AVN A;  1QQC A;  3NF8 A;  4CK3 A;  4PY5 A;  2GV9 A;  3SJJ A;  2AJQ A;  1FK9 A;  3LWL A;  1JXB A;  1IH7 A;  3NFA A;  3SQ2 A;  4M3T A;  2WOM A;  4FK4 A;  1B9D A;  1WAF A;  4CJW A;  2BE2 A;  4JS5 A;  5E41 A;  4HVJ A;  4KB1 A;  4Q5V A;  3TAR A;  3HJF A;  2ZQB A;  4FLY A;  1SL2 A;  4J2D A;  1Q8I A;  3A2F A;  3VQ5 A;  3VQP A;  4E7J A;  4M3U A;  4KTW A;  4DF8 A;  1S1W A;  4ZTJ A;  1VSD A;  4JRQ A;  1KLM A;  5CY4 A;  4FJ5 A;  4TSX A;  2BGG A;  5J2N A;  3BGR A;  4Z4I A;  3DMJ A;  1BCO A;  1RTD A;  4OJR A;  3VQE A;  3NGY A;  4C8L A;  3LAN A;  3QEW A;  4B9V A;  4CGG A;  3EY1 A;  1HMV A;  1NJY A;  1S1U A;  1CXU A;  4M3R A;  2HVI A;  1A5X A;  3V6D A;  2IGI A;  4CJT A;  1X9W A;  4W5Q A;  4DSF A;  2ITG A;  1IG9 A;  5J1E A;  4Z4C A;  3TAQ A;  5HRP A;  1QSL A;  3AO2 A;  3SUQ A;  4FJH A;  2VG6 A;  3E01 A;  4JLH A;  1QHT A;  4OVL A;  4PWD A;  3S3M A;  1N5Y A;  2Z1I A;  1A5W A;  3VQC A;  3HPG A;  3L2W A;  1VSL A;  3L3V A;  1JXE A;  4FM2 A;  1NOZ A;  4Z4E A;  2X6N A;  1C1B A;  4E7K A;  2QK9 A;  4PA1 A;  2HNZ A;  3RTV A;  5FDL A;  4CF8 A;  3WNG A;  2B4J A;  3KKR A;  3SZ2 A;  1DTT A;  4DS4 A;  4FJJ A;  4LY7 A;  4BDY A;  3MEE A;  4EZ9 A;  4N41 A;  1D9D A;  2Z1G A;  4FJ7 A;  1GOA A;  2DFE A;  5J2Q A;  4B8C A;  1JLQ A;  1D5A A;  3JYT A;  1SKR A;  4CFD A;  2OYQ A;  1W0H A;  5C42 A;  2E4L A;  1RDB A;  4RW8 A;  2XO7 A;  1VRU A;  4CEO A;  3M8R A;  3V9S A;  1J5O A;  4M3Y A;  1HQU A;  3AVF A;  2FBV A;  4I2Q A;  4EP4 A;  4DWI A;  3KLH A;  4CER A;  3O3F A;  3OYD A;  1BIS A;  3AVK A;  4FJX A;  2HHT A;  4B9N A;  4IG3 A;  3ITH A;  3NF6 A;  4CF1 A;  4DFP A;  1KRP A;  3ZSW A;  4ID1 A;  4DTS A;  2X6S A;  1WN7 A;  5CYM A;  1RNH A;  5KI6 A;  1NK4 A;  3I0S A;  2P5O A;  4KHY A;  3P83 D;  1Z25 A;  3LP1 A;  3NF7 A;  4HCC A;  4CEQ A;  2KFN A;  2KZM A;  3PX0 A;  4F2R A;  4JS4 A;  1LAW A;  3T1A A;  3LWM A;  2Q3S A;  3L8B A;  2F8S A;  4DU4 A;  4OGC A;  3NH2 A;  4HUF A;  4BE1 A;  4E0D A;  2FBT A;  5EU7 A;  4N47 A;  3HT3 A;  4DQS A;  1SL0 A;  4CEA A;  3KLG A;  2YNG A;  2P1J A;  2EX3 A;  3KTQ A;  4DSL A;  4FJK A;  1C1C A;  2DY4 A;  3QET A;  1S1X A;  4CF0 A;  3AVM A;  1HRH A;  3HO1 A;  3MXM A;  4B8A B;  4O55 A;  4CJ3 A;  4ELT A;  1ZBH A;  4F4K A;  1BQM A;  5HRR A;  3TAN A;  1UAX A;  3THV A;  3S3N A;  3RRH A;  1FXX A;  5JS2 A;  3AA5 X;  3AVI A;  4O5B A;  1NKE A;  3AVH A;  3LPU A;  4AIL C;  1Q9X A;  1IKW A;  3ZT4 A;  2VWJ A;  2A1S A;  3CG7 A;  5HBM A;  1XHX A;  3O4Q A;  3OJU A;  3SQ4 A;  4DQR A;  4OLA A;  3OJS A;  1T7P A;  3SPY A;  1SUQ A;  1IKX A;  1YT3 A;  2XRI A;  4AHV A;  4CK2 A;  4CJQ A;  3TAM A;  1TK8 A;  1KVA A;  1Y97 A;  1S9G A;  1GOB A;  2YNH A;  3ZT3 A;  4NCB A;  1FKO A;  2IAJ A;  3ULD A;  4Y1C A;  3PO4 A;  4PUO A;  2I5J A;  2WON A;  5HRO A;  1ASU A;  3SUN A;  4ELV A;  4M3X A;  1IKY A;  4IFV A;  3UIQ A;  1Z26 A;  1ZBF A;  1RIL A;  4O4G A;  5J2M A;  3K57 A;  4CJV A;  2R7Y A;  1C0T A;  2Z1H A;  4FVM A;  3TAB A;  1LWC A;  5KGW A;  3C6T A;  3B6P A;  2O4I A;  4Y1D A;  3OYB A;  1ZBI A;  4CJK A;  1B92 A;  1N6Q A;  1RT6 A;  1WLJ A;  4W5T A;  1TKD A;  1JKH A;  1XHZ A;  3U3Y A;  3DLR A;  2RPI A;  4CJP A;  1IO2 A;  2F96 A;  3P5J A;  5C24 A;  5FRO A;  2OA8 A;  3QLH A;  3LDS A;  5FRN A;  3TAG A;  3AO1 A;  4YFU A;  2PYL A;  2QKB A;  3V1R A;  1Q9Y A;  2Y1J A;  3V81 A;  4CJE A;  4Z4H A;  4CEF A;  2IC3 A;  1BIU A;  1VSE A;  1J9A A;  3DRS A;  3SV4 A;  3VQB A;  3RWU A;  3HL8 A;  1DTQ A;  3O3H A;  4KHS A;  4K8Z A;  3WNH A;  3PV8 A;  3NDK A;  1NK7 A;  4Q0B A;  3CYM A;  4E89 A;  3KK2 A;  3M8Q A;  1LWF A;  4GW6 A;  3C6U A;  5SWM A;  3OVN A;  3OYG A;  3L2V A;  1NK5 A;  1RBR A;  3AA4 A;  4FYD A;  1YTA A;  3ISN C;  2RKI A;  4AHR A;  3PX6 A;  3SQ0 A;  1UA0 A;  3OYL A;  3VQQ A;  1VSM A;  3DLE A;  1RDC A;  4CJ4 A;  5KRT A;  3LZJ A;  1XI1 A;  1RBV A;  4BDP A;  2Z1J A;  1A5V A;  5KRS A;  1RT1 A;  3O4N A;  1J54 A;  4E7L A;  4KB0 A;  2DFF A;  4KRF A;  2HHS A;  3F9K A;  3PY8 A;  4E7H A;  4QAG A;  4FJN A;  2D0C A;  1LV5 A;  1KTQ A;  1WSJ A;  2ZD1 A;  3MED A;  3ZT0 A;  3QO9 A;  2F8T A;  3KK1 A;  2YHB A;  4HHT A;  3VA0 A;  4OPJ A;  1ASW A;  1C6V A;  3ZT2 A;  1L3U A;  1UOC A;  2D0B A;  4DTP A;  3RMC A;  2O4G A;  2G8F A;  1LAV A;  2HHU A;  3LP2 A;  4Z4F A;  4LH5 A;  3HXM A;  3AVB A;  3VQ9 A;  2Y1I A;  1VSI A;  4CGF A;  4K8X A;  1VSF A;  4NCA A;  2YHA A;  4CE9 A;  4B3O A;  3QEI A;  1HQE A;  4DF4 A;  4FW2 A;  3QNN A;  3SCX A;  1JLE A;  4F3T A;  3D45 A;  4CHQ A;  1L3S A;  4FK0 A;  4CFC A;  3V4I A;  3EZ5 A;  1D8Y A;  1WSG A;  4M41 A;  2QXF A;  3RRG A;  4W5O A;  1NJZ A;  1EX4 A;  2HHV A;  4KV8 A;  3G10 A;  4E7I A;  3K58 A;  3QIO A;  5I3U A;  3I0R A;  2E6M A;  5DK5 A;  2G8U A;  4KI6 A;  4KFB A;  3TAE A;  3AVG A;  3QES A;  2A1R A;  4CHY A;  1T8E A;  1HNI A;  2P51 A;  1CZB A;  3AVJ A;  4DTR A;  4B9T A;  4W5N A;  3SQ1 A;  3ZSQ A;  3RR8 A;  5I42 A;  4B9L A;  3RR7 A;  3M8P A;  4KHU A;  3KLI A;  1TVR A;  3CFP A;  1EXQ A;  4IDK A;  4NYN A;  1VK0 A;  4ID5 A;  4AHC A;  2KFZ A;  4AHS A;  1S1V A;  2RN2 A;  1QTM A;  3LAM A;  4CFA A;  1BIZ A;  2NUB A;  1VSK A;  3DRP A;  3VQD A;  3QEP A;  1W9H A;  2KTQ A;  4CGH A;  3TI0 A;  3SUO A;  1S1T A;  3TR8 A;  3ALY A;  4UQG A;  2HVH A;  3D0P A;  4KHQ A;  3AVC A;  2FC0 A;  4DQI A;  4DMN A;  4OPK A;  1NK0 A;  2YV0 X;  3DM2 A;  4DQP A;  4FJG A;  4Z4G A;  4CIG A;  1SKW A;  2HHQ A;  4L8R B;  4O0I A;  3DLK A;  3KD5 E;  1ITG A;  2GUI A;  4CEC A;  3AA2 A;  4KTZ A;  2W42 A;  3SV3 A;  1BQN A;  3G0Z A;  4LH4 A;  4HUE A;  5HRN A;  2HNY A;  4CED A;  1G15 A;  1RTJ A;  3MXJ A;  4DSI A;  1TK5 A;  2JGU A;  4CIF A;  4KKO A;  3KLF A;  3CM6 A;  4E1N A;  1VSJ A;  4RW6 A;  1TL3 A;  4CK1 A;  3ZSX A;  3HVR A;  1WAJ A;  4C8M A;  3S3O A;  4J2A A;  1KSP A;  4WE1 A;  4CHO A;  2VG5 A;  4AHU A;  1CZ9 A;  1BCM A;  3NE6 A;  4DFK A;  3PO5 A;  4DSK A;  4F3O A;  4FJ8 A;  1NKB A;  1KLN A;  3AV9 A;  1WSI A;  1JLG A;  3SYZ A;  2FBX A;  3OS2 A;  4KHN A;  3TWH A;  1YTU A;  3NGZ A;  1QSY A;  4QCL A;  4DSJ A;  1JLF A;  3OYF A;  3K5M A;  4KTQ A;  2OZM A;  4AHT A;  3CQ8 A;  4J2E A;  4AH9 A;  4CEZ A;  4IG0 A;  4OKE A;  3FFI A;  4R5P A;  1X1P A;  4FLU A;  2KQ2 A;  1B9F A;  4FCY A;  4ELU A;  1WNS A;  2VWK A;  4DFJ A;  3NGI A;  1XC9 A;  4M45 A;  1SKS A;  1KFS A;  4OGE A;  4BDZ A;  2ETJ A;  3OYH A;  3U6F A;  1KVB A;  3LPT A;  3I8D A;  2QKK A;  1HNV A;  3IS9 A;  4IFY A;  1IKV A;  3OY9 A;  3QNO A;  3OYM A;  4JRP A;  2B5J A;  3QEV A;  3F73 A;  4RW4 A;  3VQ8 A;  1XWL A;  4YNQ A;  1LWE A;  4DTN A;  1T03 A;  1SL1 A;  3IRX A;  3NF9 A;  4B08 A;  3OYN A;  1CLQ A;  2OPQ A;  3K2P A;  3MXI A;  1EKE A;  4FJL A;  4CHZ A;  1VSH A;  1ZBU A;  3CFO A;  3V1Q A;  3VQ4 A;  4CGD A;  4H8K A;  4CCH A;  3KD1 E;  4FLW A;  4DG1 A;  3V9Z A;  3KK3 A;  3LP0 A;  2XY5 A;  1JL2 A;  3KIO A;  1HYZ A;  4GVM A;  3SI6 A;  1WSF A;  1LW2 A;  3DI6 A;  3T3F A;  4BE2 A;  4O0J A;  1U4B A;  4F2S A;  3SPZ A;  3O3G A;  1NK9 A;  2PY5 A;  4MFB A;  4CJL A;  3DLB A;  1U47 A;  4IBN A;  1TKZ A;  3LAL A;  5K14 A;  3OS1 A;  3L2Q A;  3NAE A;  3V9X A;  3HP9 A;  4HUG A;  3VQ6 A;  1U49 A;  1KCF A;  3ZCM A;  1NOY A;  4B9U A;  4M42 A;  1C0U A;  3SUP A;  4C8N A;  4I9Q A;  4FJ9 A;  5D3G A;  4FK2 A;  1KVC A;  3QIN A;  1WSH A;  1TKX A;  2E6L A;  3VQA A;  4CJ5 A;  3L2R A;  1L3T A;  1RT7 A;  2OPS A;  1YVU A;  4G1Q A;  2YNF A;  3NBP A;  1ZYQ A;  4M3Z A;  1TKT A;  2IDO A;  3HPO A;  3L2U A;  3M8S A;  4RW9 A;  2PYJ A;  1SV5 A;  1RDD A;  4W5R A;  4DFM A;  2G8I A;  4DTJ A;  2HHX A;  4Z0U A;  1UWB A;  5HLF A;  4FLZ A;  3QER A;  4NYF A;  3TAP A;  3MAQ A;  5CZ2 A;  2OPP A;  2G8V A;  2P5G A;  4J2B A;  2G8W A;  4B9S A;  4H4O A;  4LSL A;  4FM1 A;  2XY6 A;  4RG8 A;  3PX4 A;  4CJU A;  3OYK A;  4ZHR A;  4C8K A;  3ZT1 A;  1BGX T;  4OKJ A;  3RMA A;  3DOL A;  4H4M A;  1RT5 A;  3SNN A;  4CFB A;  4C8O A;  3HK2 A;  2HHW A;  4BWM A;  1J53 A;  1RTH A;  1X9M A;  1BI4 B;  1GOC A;  1TK0 A;  4KI4 A;  3WNF A;  4FXD A;  2VG7 A;  3V1O A;  1ZBL A;  2BDP A;  1L5U A;  1TV6 A;  1RT3 A;  3LAK A;  1ASV A;  3ASM A;  2ATQ A;  1HYV A;  3V9U A;  3P1G A;  4OLB A;  4NCG A;  3DOK A;  4N56 A;  1HPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...