3BF1A

Type iii pantothenate kinase from thermotoga maritima complexed with pantothenate and adp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 73
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf1A01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf1A02
1NM1A 4CZFA 2P9PB 2Q31A 1KAYA 5AQXA 4CZMA 5KQDA 5E26A 2CGKA 3KHYA 4CI6A 3FZMA 4FWKA 2IVNA 1K8KB 1WOQA 2FF3B 1XUPO 3A0IX 5AQPA 2F9WA 2QXLA 3DWLA 4EHTA 2P9LA 2CH6A 4ISFA 1NGFA 5LY3A 4BGBA 1HKBA 2E8AA 4CD1A 2QWPA 2VWBA 4XH1A 1BG3A 3R6MA 5JLFA 3ID8A 1GLDG 4BRHA 4WQ4C 1QHAA 1TUUA 3WXKA 1BO5O 1X9JA 4H0YB 3DXMB 5F2RA 3U4LA 1DKGD 1U2VB 4RTFD 4PKIA 5AQIA 2A5XA 4CD3A 1NGCA 2PBDA 3ZX3A 5AZJA 2ZGZA 1ZXOA 3DAWA 3DXKA 4PKGA 5BN8A 3D2FA 3J8AA 3H1QA 3D7EO 3GE1A 2GUPA 5TKYA 4FWLA 4FWSA 5FPEA 5AQKA 4FSVA 3EO3A 3QICA 5CE3A 2CGLA 1HUXA 3FZFA 3WEEB 1KXPA 3M6GA 4K41A 3QBXA 4M7YA 1J6ZA 1V4SA 4MO4A 1NGIA 2FLOA 1JCEA 4KBOA 1ZBSA 2ASOA 5AQVA 4B1VA 3OHRA 1LOTB 3C0BA 3CERA 5AQJA 4M63C 3VEVA 5BPMA 2QW9A 3CJ7A 3VERA 2HOEA 3VF4A 2D1KA 3MMVA 1LCUA 4BRQA 1WUAA 2YJEA 1C0GA 1ESVA 3LDQA 3MN7A 4RWTA 1MDUB 4FWPA 4H5WA 3FFKB 2UYTA 4BR9A 3O8MA 5AQSA 1YXQA 2A3ZA 2HF4A 1EQYA 4F9OA 2KHOA 4XH4A 4JD2B 3BF3A 3VENA 2NLXA 1ATRA 3EN9A 4H5NA 5EXWA 2YCHA 1Z05A 2P9KB 1SZ2A 3LL3A 4MLHA 4EIAA 3CJ1A 3CETA 1NWKA 3VF6A 4EAHD 4J8FA 2Q36A 2E2OA 1NGDA 2P9SA 5BRHA 1XC3A 3BEXA 3RSEB 2QWMA 2AP1A 1Z6RA 3FGUA 4NO7A 2ITMA 3WUHA 4IJAA 5AFUA 2P9IA 2E2NA 2FF6A 3GG4A 2WUSA 4H03B 1U6ZA 2A41A 4PL8A 4WYBA 3VEOA 2ZGYA 3L0QA 3AARA 2E1ZA 2ASMA 2HF3A 5BN9A 4B1XB 4BRFA 2Q1NA 1NGAA 2VCPA 4YDUA 1OKJA 1TUYA 1NLVA 5FPMA 4NB4A 4FL9A 5B8HA 4L3QA 3ZETA 4CBWA 3ZX0A 1V4TA 2D4WA 3MK6A 2VYPA 3R8EA 4IJNA 1QQNA 2CH5A 3B8AX 3VOVA 1YAGA 5AQTA 4BRLA 4A61A 3FZHA 1QZ6A 5BPLA 1K8KA 5AQOA 4A62A 3F9MA 3CQYA 3O1WA 4XEIA 3WXJA 3ULEA 3ZX2A 1KAZA 4H0TB 3U9DA 4BVPA 5JLHA 1JCFA 3G25A 4CBUA 1S3XA 3U9ZA 3ZEUA 2IVPA 3EL2A 3CJAA 1IJJA 2H3GX 3DXKB 2IIRA 1GLCG 3SJHA 1X3NA 5F1XA 4FPBA 3O6WA 2P9NB 4JHDB 1NGJA 5AQFA 4AM6A 5AQUA 1YUWA 1QQMA 4BC4A 3A5OC 5BRFA 3CI5A 1BU6O 2YHYA 5E84A 5AQGA 3UKUB 3LDNA 3QBWA 4E1JA 4CZKA 2CGJA 4DQ8A 2PAVA 3BF1A 2Q97A 3MN6A 4QS7A 4B1ZA 1NGBA 4DB3A 2YHWA 4AM7A 5KPZA 4H0VB 1NGGA 4DCHA 1Q18A 3C7NB 4BRKA 3QFUA 3AAQA 4BG9A 4BR7A 4A2BA 1T6DA 1TYQA 3O80A 2DPNA 2V7YA 3KVGA 3IMXA 3WQUA 4BRIA 4I6MA 2ZWHA 4GY2B 3H46O 1E4FT 1RGIA 4BC2A 3CJCA 1GLFO 3QB0A 5JMVA 4JN4A 5AR0A 3WT0A 2BTFA 3H45C 3I8BA 3GL1A 2ASPA 5BR9A 4XH5A 4IXCA 2QM1A 3MN9A 4M7XA 3SLCA 3UKRA 5AQMA 5EVZA 3VEWA 2IVOA 3AY9A 4K42A 3GBTA 4HWIA 4CBXA 4JAXA 2GEMA 4BRNA 4BROA 1E4GT 2NZTA 4QS9A 2P9UA 4WQ4A 3VEZA 4ISEA 1CZAN 4PL7A 1BA0A 5KPRA 2I7PA 3MDQA 2P9SB 2EWSA 2P9KA 5AQYA 4BRCA 5AZIA 3HTVA 3DJCA 2QWLA 4LC9B 1MA9B 3D2EA 2Q0UA 5JICA 2QWQA 4FOIA 3EZWA 1MWMA 4Z94A 3M1FA 2GWJA 4RCHA 3VPZA 3O4WA 1KAXA 1NGEA 2P9IB 1SQKA 2D0PA 3SK3A 3M3ZA 4H5TA 1DGKN 4BGAA 4B9QA 4BREA 3CIPA 5F0XA 4MO5A 3HSCA 4PKHA 2A40A 2YJFA 2E2PA 4B1UB 4WQ5C 4ISGA 3FE1A 4BR5A 1GLJO 4IZ9A 5ADXH 4CZHA 4DHYA 1HLUA 1BA1A 1HKGA 3H1VX 2F9TA 3CHWA 3W0LA 3O08A 4H0OA 5KQ8A 3ZETB 1R59O 3LDPA 3MCPA 2P9LB 2P9PA 3TU5A 3VESA 3ATUA 2W41A 4FWRA 2V51B 3IFRA 4FWQA 4K43A 2Q2RA 1G99A 4BQLA 3ENOA 2GTDA 4BRMA 2E88A 3TPQA 3ATVA 1D4XA 2J4RA 5LJVA 3HZ6A 3UE5A 2QWRA 3A5MC 3ULEB 4CZLA 1ATNA 3WQTA 4BVOA 2YI1A 5AQWA 2QWOA 5AZJB 1C0FA 4BC5A 3VGMA 3QMLA 2V52B 3D2FB 3ZEUB 1RDWX 2A42A 3P4IA 4O8KA 3ENHA 3DXMA 4O5FA 1U2VA 4MLEA 5FPNA 4CZEA 2GWKA 3UB5A 1QZ5A 2Q0RA 4IWVA 5BRDA 3H6EA 2A6AA 3QDKA 3BP8A 4H0XB 5FPDA 3QFPA 2E20A 3A5NC 1RFQA 4GNIA 2P9NA 3JXUA 4BR2A 3HI0A 4Y0WA 4JHDA 2FSKA 1BDGA 1X3MA 3WEEA 1Y64A 3CJBA 1IG8A 2V7ZA 5AQZA 4YDUC 3UKUA 1MWKA 4B1YB 3H3OB 5AQRA 3A8YA 1GLLO 2OANA 3KZBA 4B1WB 1YVNA 5AQHA 4H5RA 1TYQB 2W40A 3O5BA 4BR0A 3FZKA 5EX5A 1HKCA 3HM8A 1S22A 1GLEG 4I6MB 3VGLA 4WQ5A 4EFHA 3C7NA 3LM2A 4CZJA 3LDLA 3FZLA 2FXUA 3AAPA 3O1BA 5KPTA 3SMPA 5AQQA 1GLBG 1P8ZA 2GELA 5EOYA 2NRHA 1QQOA 3VEXA 4C23A 1SAZA 3IUCA 3LDOA 2FSJA 4BRGA 3EKSA 3UKRB 5AQNA 3GOIA 3S41A 1HPMA 4FWMA 3GDQA 4FOEA 4BR4A 3L6QA 1H1VA 3BUZB 1XQSC 2I7NA 2HMPA 4HTLA 4IO8A 4JD2A 3CQXA 1NGHA 4K25A 2BUPA 3R9PA 1NBWA 2P9UB 3U8XA 5I9EB 3W3DA 2D0OA 1ATSA 2FSNA 4A2AA 3MN5A 5BPNA 3L4IA 1ZC6A 3WXLA 1JCGA 5AZIB 3HBTA 3VEYA 2YHXA 5EY4A 4BRPA 4FWNA 5BREA 2E1YA 3D2EB 3VF2A 5ELZA 4BRDA 1HJOA 3I33A 4BG8A 3CJ9A 3FLCO 2E2QA 5AQLA 3LM9A 3EKUA 2ZF5O 4JNEA 3RSEA 5AFUH 4FWOA 1NMDA 4FO0A 3FR0A 1GLAG 4BQZA 2AA4A 2QWNA 1BOTO 3JS6A 4CZGA 4H0PA 1BUPA 1T6CA 3H3NO 4FPAA 3VGKA 4QS8A 5LJWA 1T44A 3SMSA 3WXIA 3VETA 4BC3A 1BWFO 4CZIA 1DEJA 5ADXA 4BRAA 4CJ7A 3IDHA 4EHUA 4H5VA 3A5LC 1HX1A
chains in the Genus database with same CATH superfamily
3OS1A 2P9PB 4OGEA 4DG1A 3CM6A 2A1RA 1W7AA 5E26A 2CGKA 1D9DA 4LH4A 3CM5A 1WOQA 5AJ3K 3A0IX 5AQPA 3PY8A 2QXLA 3SNNA 4FJ9A 1U49A 3LAKA 1XI1A 1NGFA 4CESA 4BGBA 1HKBA 4IDHA 2QWPA 4XH1A 1BG3A 5IT9O 3R6MA 3DMJA 3LP1A 3HO1A 3M8SA 3ZCMA 1TUUA 3WXKA 3L3VA 3SJJA 3EY1A 1BIUA 1QQCA 3LP0A 4CEZA 1NGCA 5AZJA 1EWRA 5BN8A 4NLCA 3H1QA 1KVAA 4C8KA 2GUPA 4CGFA 4KH4A 5TKYA 5AQKA 4FSVA 2BANA 1VQ6N 3EO3A 2CGLA 3KK7A 1QSYA 1KXPA 3T1AA 1S1XA 3SAFA 2O4GA 4CERA 1QE1A 2PYLA 3QBXA 3G71N 4FXDA 4RW9A 1J6ZA 4E1MA 1QVGM 1NGIA 2OZSA 3SYZA 4KBOA 2ASOA 4B1VA 3OHRA 3CERA 4I9LA 1K73O 3VERA 2HOEA 3MCAB 5CHIA 3OS2A 1LCUA 4BRQA 3SQ1A 1Q86O 2YJEA 1TKZA 3QETA 4KRFA 3LDQA 3MEDA 3MN7A 4JRPA 2HNDA 2ZJRL 3FFKB 1YF5L 3NH2A 3AA2A 3E01A 1TKTA 1XMOK 3CQ8A 3CPWM 4EP5A 2HF4A 3DLKA 3I0SA 4F9OA 4IBNA 2Y1IA 3LANA 4X65K 1GOBA 4DQSA 1NKBA 2OPQA 3LL3A 4MLHA 2OTJN 4DTPA 1NJXA 3NF7A 1NWKA 3CETA 1C0MA 4DV2K 4J8FA 4C8LA 3QLHA 3CD6N 3OYFA 4A5BA 4CHOA 4FJGA 4LF4K 4DF8A 5FRMA 3BEXA 3ZSOA 2QWMA 4M3ZA 3C6HA 4IFYA 2E2NA 4YOTA 4WFBL 3SQ4A 4HCBA 3VEOA 2ZGYA 4A59A 2ASMA 4CEOA 4JS4A 4GKKK 1OH7A 4FM0A 4DV4K 1TUYA 4DFPA 1NKEA 3DOLA 2UXCK 5B8HA 3NF8A 3HPHA 2JLEA 5DMRA 5GADP 1VRUA 3K59A 2D4WA 3MK6A 3OA9A 4KAZA 1Q8IA 4HVJA 1L3VA 2P5GA 5CYMA 3MECA 3FZHA 3VTIA 5BPLA 4A62A 1VSKA 3F9MA 1HYSA 3ULDA 3DLRA 1C1CA 4H0TB 3U9DA 4BVPA 4M42A 5KGXA 5J2PA 3G25A 2QXFA 1T05A 2H3GX 1RTIA 1YT3A 4FZYA 1C1AA 3SJHA 1X3NA 5F1XA 3AA3A 1XHZA 3NBPA 4CHYA 2O8CA 1RCHA 1HQEA 1I94K 4IKFA 5BRFA 2OTLN 3QNOA 5E84A 3LDNA 3NFAA 2PY5A 1YJ9N 1K6YA 1SS6A 1NGBA 1BCMA 3LPUA 4YNQA 4H0VB 1NGGA 1ZBFA 3VN5A 4DR5K 3G0ZA 4KTZA 2KTQA 4A2BA 2E5LK 1TVRA 2YV0X 4F3TA 4G1QA 4DF4A 1KLMA 1W97L 1N32K 3K5MA 3KLHA 1GLFO 4CIFA 3I55N 1BCOA 1LW2A 5JMVA 3ENBA 2ZJQL 4M3RA 4XH5A 4M7XA 3MN9A 3UKRA 3VQ7A 5J2NA 3AO5A 4LSLA 1JXEA 1K8AO 3GBTA 4DR1K 4JAXA 2GEMA 3SCXA 2HBMA 2FBTA 2KFZA 4YOWA 3KKSA 3SUNA 2JWLA 2P9UA 3VEZA 2BH1A 3K2PA 4B9NA 5GAHP 4FK0A 4JKFA 1T03A 4CHZA 2P9KA 4BRCA 4B9TA 5C15A 3NHGA 3DJCA 2QWLA 1MA9B 1S9EA 4FOIA 3C65A 4W5QA 1TL1A 4RCHA 3VPZA 2G8UA 1KAXA 1NGEA 1IH7A 1S6PA 4WQ5C 2NNWA 1GLJO 5C0YA 1EWQA 1K9MO 3OYBA 1UA0A 1VSEA 5HBMA 4DHYA 1HLUA 1L3SA 2KLAA 3AGRA 1BA1A 1HKGA 3LZJA 5KQ8A 2XY7A 3T1HK 4X62K 3TU5A 3K9KA 2W41A 4WFNL 2VWKA 4FWRA 4DTNA 3IFRA 1KSPA 3HM9A 3MX2A 3THWA 4BRMA 4FM1A 4JI2K 1S1VA 2HVIA 2E88A 3SUPA 4KHUA 1L3UA 3ATVA 1D4XA 3PIPL 5LJVA 4E7KA 2DFEA 4YORA 1WSFA 1RDUA 2Q3SA 1ATNA 3TABA 1MU2A 4OPKA 1C0FA 3QMLA 2V52B 3D2FB 4O8KA 3IG1A 3U6FA 4MLEA 2Q0RA 3VQDA 1XC9A 1SL1A 4DFKA 3V1QA 2O8CB 3J81O 1QHTA 3QDKA 3F2KA 4DUYK 2OPPA 4FJ5A 1N33K 4H0XB 3MWPA 3ITHA 4WCEL 4NXNK 3TARA 3LP2A 3RVCA 4DV6K 3HI0A 1HNZK 2FSKA 3SV3A 1Y64A 3DRSA 4DKWA 3U3YA 3ISNC 4JI5K 2PZSA 1XNQK 1YVNA 3AVJA 2JGUA 3O5BA 3V9UA 3DYAA 3HXMA 2HHSA 3VGLA 4WQ5A 1HJRA 3ZT3A 4JI8K 3C7NA 1VQMN 2DFHA 1NKCA 1NU0A 4DU3A 3LDLA 3FZLA 3CC2N 3CCJN 2FXUA 4DV7K 4JI7K 1TAQA 4G9ZA 3VEXA 1WLJA 3IUCA 1RDCA 4FVUA 3EKSA 3UKRB 3O9RA 4BR4A 3BUZB 3A2FA 2HMPA 1A5VA 4JD2A 4Z4HA 2BUPA 3R9PA 2P9UB 5I9EB 3RTVA 2B4JA 3ID6A 5BPNA 3WXLA 4IEEA 3L8BA 4OJRA 3AVGA 4JKHA 3ZSWA 1DT9A 3LWLA 2NRRA 3L4QA 4ILGB 3PX4A 5BREA 5J2QA 3KD5E 2P5OA 3VQEA 3OYIA 5FROA 2B6AA 2Y1JA 3CJ9A 2D0BA 3FLCO 2E2QA 1YIJN 3CC7N 2XRIA 3LM9A 3K5LA 2ZE2A 2ZF5O 3D45A 4ILHA 4DTXA 4OKKA 3O9UA 4CEEA 3E9PA 1GLAG 3JS6A 2ZJPL 3E9OA 1W2BM 3H3NO 4WFAL 4QS8A 3EE9A 2I5JA 1T44A 3SMSA 4FCYA 3VETA 4KPYA 4FLXA 1DEJA 3M8QA 3K58A 5ADXA 4BRAA 3NAEA 4EHUA 3RMAA 5JLHA 1HX1A 4K8ZA 1NMNA 5AQXA 2RHKA 4CZMA 3KIOA 4CI6A 4M3TA 1K8KB 5C42A 4JI1K 4FVMA 3NGIA 3T7ZA 4EHTA 3SQ0A 1HQUA 1VAZA 4LF7K 2P9LA 4ISFA 3KK3A 5LY3A 4CF9A 4NLBA 1SKWA 1J5OA 1XHXA 1T7PA 3ZYYX 2HHUA 3ID8A 4OLAA 3P31A 1DTTA 3NVMA 4KHYA 4W5TA 1NK0A 4RW7A 3OY9A 3U4LA 1RTDA 4DQQA 1FJGK 4PKIA 5CY4A 2PBDA 1YHQN 3K5OA 3DAWA 1SKRA 4FK2A 4DFMA 3J8AA 2XY8A 3NF9A 1RT2A 3D7EO 3GE1A 4GMJB 2HBKA 4DR7K 4Z0UA 3TAFA 1BQMA 4FWSA 1X1PA 5FPEA 1L3TA 3QICA 4CEAA 5CE3A 3HVRA 2P1JA 4JK8A 1RDBA 1T3VA 3M6GA 5IWAK 4JRQA 1CZ9A 4J2BA 3VQ4A 4B8AB 4BACA 5SZTA 4H8KA 1JCEA 5BR8K 4KO0A 1LOTB 4FJHA 5AQJA 4M63C 3VEVA 5BPMA 2QW9A 3CXCM 3RMCA 3PLAA 1P90A 1WUAA 1Q82O 2KZMA 1C0GA 1D5AA 2KKZA 4TSXA 3DLGA 3KWGA 4BR9A 2X78A 4HUFA 3O8MA 4E7LA 4Y1CA 1NK5A 1YXQA 2ATQA 1QVFM 2A3ZA 4EZ9A 4IFVA 1ASWA 3V4IA 4JD2B 4KI6A 3VENA 3VQ5A 3PO5A 1ATRA 3EN9A 3TTDA 5EXWA 4E1NA 3OJUA 2VGNA 3HT3A 3O4QA 1N5YA 4L8RB 3ZLJA 1VSMA 3JSMA 2Q36A 3CMAN 4KH5A 4BE1A 2E2OA 4DR2K 1VK0A 1OH8A 4ID5A 3QNNA 3VQ8A 2WTUA 3DOKA 2QKKA 4CJFA 1JLEA 4OGCA 4YOUA 3TI0A 3C94A 3O4NA 3MXJA 1CZBA 4HCCA 1Z6RA 1C0TA 4NO7A 5AFUA 3CFPA 4FW2A 2P9IA 4OO1J 3VA3A 3G10A 4PL8A 2LSNA 4WYBA 3EE8A 2UUAK 1NJZA 4KHQA 3P1GA 5BN9A 2Q1NA 4CIEA 1NGAA 1WSIA 5LL6Z 3RR7A 4YDUA 3VQCA 5HP1A 4JKGA 2DFFA 3CCSN 3T1YK 3JYTA 3PSFA 3ZETA 3ZX0A 1V4TA 4B9MA 4RG8A 3KLIA 2VYPA 1R0AA 3EYZA 4JK9A 2CH5A 3B8AX 4AHSA 3PV8A 1QZ6A 1YITN 4O0JA 1IBLK 1IV0A 4DV5K 3TTFA 3MWTA 4E0DA 1J53A 4XEIA 3WXJA 1G15A 4CBUA 3I8DA 3V9ZA 2RN2A 4F2SA 3LALA 4FJKA 3CJAA 1S6QA 2VG5A 3F9KA 4HUGA 2A1SA 4X64K 4FLVA 2D0AA 3O6WA 1JKHA 4JV5K 4U7BA 4JHDB 4AHVA 1NGJA 5AQFA 1VQPN 3ZSYA 1F21A 4FJIA 1QQMA 1OH6A 1Q7YO 4CZKA 2CGJA 4Z4IA 1WAJA 3WNHA 3G6EN 2Q97A 3QIPA 1BL3A 4B1ZA 4DB3A 2YHWA 2GV9A 4DCHA 3SAGA 3CMEN 3QERA 4ZTJA 4YFUA 4BRKA 3V9WA 1TK0A 4CFCA 4BG9A 4BR7A 3MXMA 2W6LA 3OTOK 2HW3A 1FK9A 3OYKA 1TYQA 2YNFA 2BGGA 1N34K 2ZWHA 1OVQA 3AVBA 1KC8O 1RGIA 3E9LA 4IFEA 1IKVA 4RW8A 5MLCQ 3WT0A 3QEWA 3GL1A 2ASPA 4IXCA 3AA5X 3VEWA 4Z4CA 1E3MA 4K42A 4DLGA 4DQRA 1LAWA 4FLYA 4KREA 5M1QA 3HP9A 5M1KA 1Q9XA 1RDAA 4QS9A 4J2EA 4DTOA 5LMUK 1U4BA 4PL7A 4PY5A 5KPRA 2I7PA 3NH1A 3NH0A 2YNIA 4NYFA 1ZBLA 4LC9B 1NK7A 4GVEA 1ZBIA 3EZWA 1JXBA 4CEDA 3M1FA 3ZT1A 3O4WA 2P9IB 2D0PA 3SK3A 3M3ZA 4H5TA 1DGKN 4A5AA 4B9QA 5F0XA 3CIPA 5KTQA 1VQ9N 2UUBK 3P83D 4ELUA 3HSCA 4CJRA 3EEQA 4PKHA 2KFNA 4KFBA 2WOMA 5GIOA 4BR5A 3WNFA 4OPAA 1KTQA 1L5UA 5ADXH 1WSGA 4BWMA 4OPHA 3H1VX 3W0LA 2F9TA 3CHWA 3M8RA 1RT5A 3LAMA 3O08A 4UQGA 3ZETB 3RMBA 4EP4A 3ATUA 4MDAA 4NCGA 2V51B 4FWQA 4CF0A 1G99A 4LFAK 3ENOA 1RBVA 4JKEA 1S9GA 3ZSXA 1LV5A 4DR3K 3VMFB 4IO9L 1SKSA 3UE5A 3HZ6A 5I42A 2G8WA 2HB5A 3WQTA 1JJ2M 4CCHA 4NCAA 4BVOA 2VQFK 3ZSZA 1NK4A 3CCVN 5M1PA 5AZJB 4CHPA 4CHQA 3P4IA 3ENHA 3DXMA 4CZEA 3QESA 3UB5A 1QZ5A 3K57A 3J7AP 3I56N 4X66K 2F4VK 1YJNN 5BRDA 4O4GA 2G8KA 3DI6A 4C8OA 3AO4A 3IRXA 4KI4A 3BP8A 2E20A 4DTMA 3SI6A 1RFQA 3KKRA 4W5OA 2P9NA 5GAGP 4Y0WA 1X3MA 3WEEA 4DSJA 5KGWA 2V7ZA 3UKUA 2YHBA 5H1SQ 3H3OB 2OANA 3KZBA 4H5RA 1TYQB 3O9QA 5DM7L 1TKDA 4KHNA 3HM8A 3QIOA 2Z1GA 3SUOA 5HROA 4ELVA 1LWCA 3O1BA 5KPTA 3AVFA 2OZMA 4ZTFA 3KK1A 4B9SA 3KLFA 2NRHA 3CCRN 4BRGA 3THXA 4CF2A 4LF6K 5A2QO 3S41A 3GOIA 1HPMA 2AJQA 3AVHA 2X74A 3L6QA 1H1VA 2NRTA 5C25A 1XQSC 2I7NA 1NGHA 4A57A 4NXMK 4ICLA 4KHPK 1ATSA 5FLXO 1ZC6A 4I2PA 3HBTA 2W42A 2YHXA 3P38A 2G8HA 5M1FA 4LFCK 2E4LA 3O3HA 4BRDA 1HJOA 3I33A 1RNHA 4E89A 3CCMN 3V6DA 4BDPA 3EKUA 2O4IA 5AFUH 4FWOA 4CJEA 1NMDA 4FO0A 4LY7A 2QWNA 1JL2A 4CK1A 1BOTO 1VRTA 4FLTA 1Z25A 1J9AA 4E3SA 5LJWA 5K14A 1BWFO 3VQBA 4DU1A 1HPZA 4CJ7A 4LFBK 4H5VA 1A5XA 3CCEN 1NM1A 4CZFA 4IOAL 1VHXA 1KAYA 3TAEA 2P51A 4F8RA 5KQDA 3KHYA 2X6SA 4DV3K 3FZMA 4FWKA 2G8FA 2IVNA 2FF3B 3AVKA 1XUPO 2F9WA 1QSSA 4Q0BA 1B92A 1I39A 2VG7A 3DWLA 1HNXK 1TKXA 1NJIO 1KCFA 3LPTA 3OYEA 3K5NA 2CH6A 1ILYA 4QAGA 1TGOA 4FJ7A 2BE2A 1UA1A 2VWBA 1QTMA 5JLFA 4BRHA 5DK5A 4DUZK 4WQ4C 1QHAA 1X9JA 1BIZA 2FBXA 4CEQA 3DXMB 5F2RA 1DKGD 3AO2A 2YNHA 4RTFD 1VQON 5AQIA 5FRNA 2A5XA 1ASVA 1KFSA 4W5NA 4DQPA 3ZX3A 2OYQA 3V1RA 4M41A 4PKGA 3DXKA 3JAMO 3E66A 4M45A 1NK9A 3LWMA 3WEEB 3E1YA 3OW2M 1TK8A 2Z1JA 3PIOL 2UXBK 4K41A 3QINA 4M7YA 2IS3A 1N36K 1DTQA 4MO4A 2YHAA 4AILC 2FLOA 1ZBSA 5AQVA 1VQLN 4FJLA 3TWHA 3C0BA 4CJ3A 2F8SA 4CJ4A 4J2AA 3VF4A 2D1KA 3NF6A 1BQNA 3L3UA 1ESVA 1MDUB 2RE2A 4H5WA 3HSTB 1KQSM 2UYTA 4CE9A 5J2MA 4K8XA 3THXB 3HK2A 5AQSA 3B6OA 1HNIA 1EP4A 3AVMA 1N6QA 5I3UA 3AGKA 1EQYA 2KHOA 4XH4A 2QK9A 4BE0A 4KH6A 4H5NA 3NE6A 2YCHA 2RF2A 1Z05A 2P9KB 1SZ2A 1VQNN 3CJ1A 4M3WA 5KRSA 3VF6A 4EAHD 4OKJA 4DTSA 2O8FA 1YVUA 2QEXN 1XC3A 4AHRA 3OYLA 4CECA 2HMIA 3Q7BA 2NRXA 3SAHA 4F3OA 3I0RA 3FGUA 2ITMA 3WUHA 1I3AA 4IJAA 4AQYK 4IOCL 4OPJA 3FFIA 3HRGA 2FF6A 3GG4A 4H03B 3VQQA 1U6ZA 2VG6A 4PHTX 3RR8A 1IKXA 2E1ZA 2HF3A 3CYMA 1SL0A 3TTCA 4BRFA 3DRRA 1HR0K 2EHGA 2IAJA 1OKJA 1NLVA 2GBZA 5FPMA 4LH5A 4KHWA 3IAYA 1OVYA 3THWB 1LWFA 2ZM6K 3P39A 2G8IA 4CBWA 3ZT4A 1UOCA 4B8CA 1IKYA 3R8EA 1RT6A 3PX0A 4CGIA 1X9SA 2OA8A 3MXIA 3VOVA 1W0HA 1WSEA 3M8PA 1YAGA 5TKWA 4O5BA 3BY5A 5C2FA 4CK2A 2F7TA 1VSJA 4B3RK 1JCFA 1JLGA 1Q9YA 3OYAA 3AVCA 2B5JA 4ID1A 3J7ZO 3U9ZA 4KTQA 1TV6A 3ZEUA 4GV3A 1JLFA 2IVPA 4DSKA 2NRZA 1RBSA 3MEGA 3DXKB 1FW6A 5HL7L 2IIRA 3AVAA 4CJQA 4BDZA 3C95A 2Z1HA 4FPBA 1RTJA 1NJWA 4ELTA 4GKJK 5AQUA 4BC4A 4JI0K 3A5OC 4FJMA 1JL1A 4JKBA 3CCQN 4E1JA 3P5JA 3PO4A 4DQ8A 2PAVA 2VWJA 4CGGA 2OPRA 4QS7A 3SV4A 1NK8A 1WBDA 4AM7A 5KPZA 4IG0A 3CFOA 3C7NB 3QFUA 1JLQA 3WNEA 1HNVA 1SV5A 1T6DA 4R79A 3MEEA 3S3MA 2DPNA 2V7YA 4GY2B 5GAEP 5FDLA 4YOVA 1VQ5N 1E4FT 1A5WA 2GUIA 4BC2A 3CJCA 3QB0A 2IDOA 5AR0A 2YKNA 3J7YP 4YHHK 1ASUA 5BR9A 4KB0A 1SUQA 3MX5A 2OCEA 3VQ6A 5AQMA 5EVZA 2UXDK 3AA4A 2IVOA 4DTJA 2O8DA 4HUEA 3O9SA 4HWIA 4CBXA 4CFBA 1WSJA 4ILJA 3O9TA 4RW6A 4BROA 2NZTA 4JI3K 5CZ2A 4LF8K 1VSIA 4ISEA 2O8FB 1CZAN 3KD1E 3V9SA 4O0IA 3MDQA 5AQYA 4CF8A 4CJVA 3THYA 3HTVA 3OYNA 1RT4A 2EX3A 3D2EA 4OKEA 2O8BA 4F2RA 2QWQA 5CZ1A 4F4KA 1ZBHA 1MWMA 1IG9A 1RBRA 4Z94A 2GWJA 3SPYA 3CC4N 3RRGA 3V1OA 2HVHA 1SQKA 4BGAA 4C8NA 4MO5A 1M90O 2A40A 4CK3A 3FE1A 2QA4N 4CGDA 3QEVA 4IZ9A 4CW7B 4CZHA 3HJFA 3PSIA 1RDDA 3OBWA 1LW0A 3F5TA 3KLEA 3S9HA 4H0OA 2W6KA 3OYMA 3LDPA 2FBVA 2P9LB 2E6MA 4BE2A 5GIPA 1JLBA 2OPSA 2HHTA 2ETJA 1ZBUA 4FW1A 4KKOA 4HHTA 2RPIA 3SBGA 2D0CA 1TAUA 2JWKA 2J4RA 3RMDA 1EO1A 2X6NA 1EX4A 3OYJA 3RRHA 2YI1A 5AQWA 2QWOA 4FZXC 3ZEUB 3QEIA 1BI4A 4CHNA 3HPOA 3F73A 4O5FA 2VQEK 4PWDA 1U2VA 4OVLA 3QEPA 5C12A 3S3NA 2GWKA 1X9WA 1B9DA 1XNRK 3CCLN 4CF1A 1WN7A 3NDKA 3D0PA 3H6EA 4JK7A 3HYFA 4DFJA 2QTDA 3AO1A 3WNGA 5FPDA 3A5NC 1DLOA 3ASMA 2WBNA 3H08A 1BDGA 3R1XA 4E7HA 3BZKA 1QS4A 3HVTA 1U04A 4AHTA 5AQZA 4MDBA 3AO3A 1MWKA 2RKIA 3A8YA 4FJXA 2F96A 1VSDA 1RT3A 2YX6A 4H4OA 5AQHA 4M3YA 4DLEA 3FZKA 5EX5A 1C1BA 1S22A 1GLEG 3RWUA 1HYZA 4DQIA 4CZJA 4DV0K 1IBKK 1RTHA 2GELA 3BDPA 5EOYA 1QQOA 1W9HA 4C23A 4I2QA 3LDOA 2FSJA 4FWMA 3GDQA 2D5RA 3SUQA 2O8DB 4HTUA 3OJSA 2HHHK 4HTLA 4IO8A 4CIGA 2KZZA 3CQXA 4YOXA 4CJWA 3W3DA 2FSNA 1Y97A 2WFBA 4A2AA 4CEBA 4K0KK 4UY8O 1JCGA 2WC9A 4KB1A 3IS9A 3VQPA 4CJKA 3THYB 5EY4A 3DLHA 2E1YA 3D2EB 2O8BB 5ELZA 4N47A 1U45A 5J1EA 4MQ3A 1SL2A 3OBYA 5D3GA 4JNEA 3RSEA 3VA0A 3R3LA 2DY4A 1TL3A 4BQZA 2AA4A 2R7YA 2GX9A 4JI4K 4JKGB 4CZGA 1U48A 3K0SA 4H0PA 1BUPA 1RILA 1T6CA 4FPAA 3VGKA 5DM6L 4KTWA 4B3TK 3WXIA 1N8RO 4FK4A 4WE1A 1VSFA 3IDHA 3A5LC 3CPEA 2Q31A 4EZ6A 5C24A 3M5RA 1GOAA 1FKPA 1FKOA 4JLHA 3L2UA 1C6VA 4Z4GA 3NVKA 2E8AA 4CD1A 4PA1A 4AHCA 2HSTA 1HNWK 2HHQA 4R5PA 1GLDG 4OLBA 4FM2A 5M1OA 1B9FA 3OYGA 4NYNA 1BI4B 1BO5O 2KW4A 1VQ7N 3PX6A 4H0YB 3CFRA 1S1TA 1U2VB 4CD3A 4J2DA 2ZQBA 4CJSA 4IG3A 4DS4A 3TANA 2ZGZA 1ZXOA 2FC0A 3D2FA 4QCLA 3LZIA 4E7JA 4KHSA 3G4SN 4FWLA 1WSHA 3VQ9A 1HUXA 3FZFA 5KRTA 1ITGA 1CXQA 1V4SA 1BHLA 2HHVA 4JKAA 1REVA 5E41A 1BGXT 3CJ7A 4C1NK 3MMVA 2IOCA 4JI6K 4RWTA 4DSLA 4FWPA 4C1NI 3NGYA 1XMQK 1NG9A 1D8YA 1WAFA 3TR8A 2HBJA 3TAMA 1LAVA 5JVHL 5JS1A 3L2VA 1Q81O 5JS2A 5C2DA 5M1NA 1JLCA 4N56A 1U47A 3BF3A 1S1WA 1EKEA 2NLXA 3C6TA 4Z4EA 3TSUA 1VQKN 1UWBA 4JS5A 4EIAA 4BDYA 1J54A 1KVCA 1D9FA 1WBBA 2BDPA 2VGMA 4B3MK 4DR4K 4NCBA 1NGDA 4QOZB 4DSEA 2P9SA 5BRHA 1TK5A 3VTHA 4DSFA 5T7BA 4W5RA 1VSLA 3V9XA 1KRPA 4CJ5A 5JVGL 3RSEB 2AP1A 2WUSA 4FZZA 2A41A 3DLEA 4IOXA 3L0QA 4O8UA 3AARA 1VSHA 4XIUA 4V19S 4B1XB 3DLLL 4JYAK 1NJYA 4CJPA 4YOYA 1X9MA 5GINA 2VCPA 4NB4A 4FL9A 4Q5VA 4L3QA 3T3FA 1IO2A 3S3OA 1RT1A 4H4MA 1HMVA 3VQAA 4IJNA 3DRPA 3ZT0A 1QQNA 4FJJA 3QEXA 5AQTA 4BRLA 4A61A 3ZSRA 4PUOA 4CGHA 1RBTA 1K8KA 5AQOA 2WONA 3CQYA 1NOZA 3B6PA 4CJUA 3O1WA 1EETA 1O13A 3N4PA 3ULEA 1KAZA 3ZX2A 3KWIA 3D6RA 1YI2N 1ZYQA 4I7FA 1S3XA 5HRRA 4LF5K 2UU9K 3EL2A 1IJJA 3L2RA 4MFBA 2O8EA 1GLCG 1QSLA 5EU7A 3BGRA 3T19A 3EZ5A 3L2WA 2P9NB 2HHWA 4FLWA 4WF9L 4AM6A 2XY5A 1YUWA 2NRWA 3OYCA 3CI5A 1WNSA 1BU6O 2YHYA 5AQGA 3UKUB 3J80O 5LMNK 3QBWA 1S5JA 3TSQA 3BF1A 2YKMA 1KD1O 3MN6A 4CJLA 1JLAA 1BISA 3KJVA 3CF5L 1O1WA 1Q18A 3AAQA 1VQ8N 1GOCA 4B9UA 3HOTA 3SPZA 3K9JA 3O80A 3KVGA 3IMXA 4E7IA 3WQUA 4BRIA 4I6MA 3L2QA 3H46O 2HNYA 1NK6A 4M3UA 2IGIA 4JN4A 4FJNA 3SZ2A 2BTFA 3H45C 3I8BA 1KFDA 4GVMA 2QM1A 3OYDA 1YTUA 3SLCA 2NUBA 3AY9A 4M3XA 1CXUA 4BRNA 3AVLA 2E6LA 4PQUA 2YNGA 3NGZA 4AF1A 3OS0A 1E4GT 4WQ4A 4N76A 1EXQA 5CYQA 1UAXA 1BA0A 1YJWN 2P9SB 2EWSA 5AZIA 4B9VA 3PUFA 4GV9A 4DMNA 5HRSA 3TAPA 1M1KO 1Z26A 4CVNE 3TAQA 1HYVA 4N5SA 4IDKA 4RW4A 2Q0UA 5JICA 4JKDA 2NRVA 1NNEA 4LD0A 3LP3A 2HBLA 4BREA 2YJFA 2E2PA 4B1UB 4ISGA 4DS5A 3HP6A 4O55A 5SWMA 3SBTA 2XY6A 3C6AA 3QO9A 1R59O 2PFUA 4AHUA 3LDSA 3MCPA 2P9PA 3VESA 3NMUA 4K43A 2Q2RA 4CFDA 3NCIA 4BQLA 4ZHRA 4U67L 2GTDA 3Q7CA 1RBUA 3CG7A 3ZT2A 3AVIA 3BZCA 2G8VA 3TPQA 2QI2A 4CEFA 4Z4FA 4DTUA 1HRHA 2QWRA 3A5MC 2ITGA 3U3GA 3ULEB 4CZLA 4I9QA 1CLQA 3CCUN 4LSNA 3AV9A 4CJTA 2DTUA 5KI6A 3KTQA 4B9LA 2PYJA 4N41A 3OVNA 4BC5A 3VGMA 1RDWX 2A42A 3IKMA 3KLGA 4JEPA 4O44A 4B08A 2O8EB 3MAQA 1S1UA 4FYDA 5FPNA 2XO7A 4IWVA 4FLZA 1OH5A 5CR4A 2A6AA 2FBYA 3O3FA 1FXXA 4DWIA 4C8MA 2F8TA 3UIQA 4KV8A 1C0UA 3QFPA 4DTRA 4DR6K 4GNIA 2HNZA 3JXUA 4BR2A 4JHDA 4JKCA 3DM2A 3ZSQA 5HLFA 1S72N 3OYHA 3CJBA 4Y1DA 3SQ2A 3HPGA 1IG8A 3N4QA 2XHBA 4YDUC 2QKBA 4B1YB 1KLNA 4GV6A 5AQRA 4DV1K 1GLLO 1YTAA 3AVNA 4B1WB 3TAGA 2W40A 4BR0A 4FLUA 1HKCA 4I6MB 2ZD1A 1RT7A 4EFHA 3LM2A 4LF9K 4DSIA 4FJ8A 3AAPA 3WXMB 3SMPA 5AQQA 4E19A 2HHXA 1GLBG 1P8ZA 1NOYA 2KQ2A 1IKWA 4GW6A 1SAZA 3TSPA 4CGJA 5AQNA 2Z1IA 4FOEA 3V81A 4CFAA 4IEIA 3KK2A 4K25A 1WB9A 1NBWA 3U8XA 2D0OA 3ALYA 1T8EA 4B3OA 3MN5A 4BY9C 3L4IA 5AZIB 3C6UA 3VEYA 1XWLA 4B3SK 4YY3K 4BRPA 4FWNA 3VF2A 4OX9K 4BG8A 3HL8A 4DU4A 5AQLA 4AH9A 5HOOA 3FR0A 5HRPA 3HOSA 2UUCK 3T69A 1VQ4N 3THVA 3DLBA 1KVBA 2IC3A 5C10A 1LWEA 5HRNA 4BC3A 4CZIA 1IBMK 4BWJA 1J5EK 3ZSVA 3O3GA
chains in the Genus database with same CATH topology
1NM1A 4CZFA 2P9PB 2Q31A 4IOAL 1KAYA 5AQXA 2RHKA 3M5RA 4CZMA 5KQDA 5E26A 2CGKA 3KHYA 4CI6A 3FZMA 4FWKA 2IVNA 1K8KB 1WOQA 2FF3B 1XUPO 3A0IX 5AQPA 2F9WA 2QXLA 3T7ZA 3DWLA 4EHTA 1NJIO 1VAZA 1ILYA 2P9LA 2CH6A 3NVKA 4ISFA 1NGFA 5LY3A 4BGBA 1HKBA 4NLBA 2E8AA 4CD1A 4IDHA 2QWPA 2VWBA 4XH1A 1BG3A 2HSTA 3ZYYX 3R6MA 5JLFA 3ID8A 1GLDG 4BRHA 3P31A 3NVMA 5M1OA 4WQ4C 1QHAA 1TUUA 3WXKA 1BO5O 1X9JA 1VQ7N 4H0YB 3DXMB 5F2RA 3U4LA 1DKGD 1U2VB 4RTFD 1VQON 4PKIA 5AQIA 2A5XA 4CD3A 1NGCA 2PBDA 3ZX3A 1YHQN 5AZJA 2ZGZA 1ZXOA 3DAWA 3DXKA 4PKGA 5BN8A 4NLCA 3D2FA 3J8AA 3H1QA 3D7EO 3GE1A 2HBKA 2GUPA 3G4SN 4KH4A 5TKYA 4FWLA 3E66A 4FWSA 5FPEA 5AQKA 4FSVA 1VQ6N 3EO3A 3QICA 5CE3A 2CGLA 4JK8A 1HUXA 3FZFA 3KK7A 3WEEB 1KXPA 3E1YA 3OW2M 3SAFA 3PIOL 1T3VA 3M6GA 4K41A 3QBXA 4M7YA 3G71N 1J6ZA 1V4SA 4MO4A 1QVGM 1NGIA 2FLOA 1JCEA 4KBOA 1ZBSA 2ASOA 5AQVA 1VQLN 4B1VA 3OHRA 1LOTB 3C0BA 3CERA 5AQJA 4JKAA 4M63C 3VEVA 5BPMA 1K73O 2QW9A 3CXCM 3CJ7A 3VERA 2HOEA 3MCAB 3VF4A 2D1KA 4C1NK 5CHIA 3MMVA 1LCUA 4BRQA 3PLAA 1P90A 1Q86O 1WUAA 2YJEA 1Q82O 1C0GA 1ESVA 3LDQA 3MN7A 4RWTA 1MDUB 2RE2A 2KKZA 4FWPA 4H5WA 4C1NI 3FFKB 1YF5L 2ZJRL 1KQSM 2UYTA 3KWGA 4BR9A 3CPWM 3O8MA 2HBJA 5AQSA 5JVHL 1YXQA 1QVFM 1Q81O 2A3ZA 2HF4A 5C2DA 3AGKA 5M1NA 1EQYA 4F9OA 2KHOA 4XH4A 4JD2B 3BF3A 3VENA 2NLXA 4KH6A 1ATRA 3EN9A 3TTDA 4H5NA 5EXWA 2VGNA 2YCHA 1Z05A 3TSUA 2P9KB 1VQKN 1SZ2A 3LL3A 4MLHA 2OTJN 1VQNN 4EIAA 3CJ1A 1NWKA 3CETA 3VF6A 4EAHD 4J8FA 2VGMA 2Q36A 4KH5A 3CMAN 2E2OA 3CD6N 4A5BA 1NGDA 2QEXN 2P9SA 5BRHA 3VTHA 1XC3A 3BEXA 2NRXA 3Q7BA 5JVGL 4YOUA 3RSEB 3SAHA 2QWMA 2AP1A 1Z6RA 3C6HA 3FGUA 4NO7A 2ITMA 3WUHA 4IJAA 5AFUA 4IOCL 2P9IA 2E2NA 4OO1J 3HRGA 4YOTA 2FF6A 3GG4A 2WUSA 4WFBL 4H03B 1U6ZA 2A41A 4IOXA 4PL8A 3EE8A 4WYBA 4PHTX 3VEOA 2ZGYA 3L0QA 4O8UA 3AARA 2E1ZA 4A59A 2ASMA 2HF3A 5BN9A 4B1XB 3DLLL 3TTCA 4BRFA 2Q1NA 1NGAA 4YOYA 5GINA 2VCPA 4YDUA 1OKJA 1TUYA 4JKGA 1NLVA 5FPMA 4NB4A 3CCSN 4FL9A 1OVYA 3CPEA 5B8HA 3P39A 4L3QA 3ZETA 4CBWA 3ZX0A 5GADP 1V4TA 2D4WA 3MK6A 2VYPA 3OA9A 3R8EA 4IJNA 1QQNA 4JK9A 2CH5A 3B8AX 3VOVA 1YAGA 5AQTA 4BRLA 5TKWA 4A61A 3FZHA 5C2FA 1QZ6A 1YITN 3VTIA 5BPLA 1K8KA 5AQOA 4A62A 3F9MA 3TTFA 3CQYA 3O1WA 3MWTA 4XEIA 1O13A 3N4PA 3ULEA 1KAZA 4H0TB 2F7TA 3WXJA 3ZX2A 3KWIA 3U9DA 3D6RA 4BVPA 5JLHA 1YI2N 1JCFA 3G25A 4CBUA 1S3XA 3J7ZO 3U9ZA 3ZEUA 4GV3A 2IVPA 3EL2A 2NRZA 3CJAA 1IJJA 2H3GX 3DXKB 5HL7L 2IIRA 1GLCG 3SJHA 1X3NA 5F1XA 4FPBA 3O6WA 2P9NB 4U7BA 4JHDB 1NGJA 4WF9L 5AQFA 4AM6A 1VQPN 5AQUA 1YUWA 1QQMA 4BC4A 3A5OC 2NRWA 5BRFA 2OTLN 3CI5A 4JKBA 1BU6O 2YHYA 5E84A 5AQGA 3UKUB 3LDNA 3QBWA 4E1JA 3CCQN 1Q7YO 4CZKA 2CGJA 1YJ9N 4DQ8A 3TSQA 2PAVA 1SS6A 3BF1A 3G6EN 2Q97A 1KD1O 3MN6A 4QS7A 4B1ZA 1NGBA 4DB3A 2YHWA 4AM7A 5KPZA 4H0VB 1NGGA 4DCHA 3SAGA 3CF5L 3CMEN 1Q18A 3C7NB 4BRKA 3QFUA 3AAQA 1VQ8N 4BG9A 4BR7A 3HOTA 4A2BA 1T6DA 4R79A 1TYQA 3K9JA 3O80A 2DPNA 2V7YA 3KVGA 3IMXA 3WQUA 4BRIA 4I6MA 1W97L 2ZWHA 4GY2B 5GAEP 4YOVA 3H46O 1VQ5N 1E4FT 1KC8O 1RGIA 4BC2A 3E9LA 3CJCA 1GLFO 3QB0A 4IFEA 3I55N 5JMVA 4JN4A 3ENBA 5AR0A 5MLCQ 3WT0A 2ZJQL 2BTFA 3H45C 3I8BA 3GL1A 2ASPA 5BR9A 3MX5A 4IXCA 4XH5A 2QM1A 3MN9A 4M7XA 3SLCA 3UKRA 5AQMA 5EVZA 3VEWA 2IVOA 3AY9A 4K42A 1K8AO 3GBTA 3O9SA 4HWIA 4CBXA 4JAXA 2GEMA 5M1QA 2HBMA 4BRNA 5M1KA 4ILJA 4YOWA 2JWLA 3O9TA 4AF1A 4BROA 1E4GT 2NZTA 4QS9A 2P9UA 4WQ4A 3VEZA 2BH1A 4ISEA 1CZAN 4PL7A 5GAHP 1BA0A 5KPRA 2I7PA 3MDQA 2P9SB 4JKFA 2EWSA 1YJWN 2P9KA 5AQYA 4BRCA 5AZIA 4GV9A 1M1KO 5C15A 3HTVA 3DJCA 2QWLA 4LC9B 1MA9B 3D2EA 2Q0UA 4GVEA 5JICA 2QWQA 4FOIA 3C65A 3EZWA 1MWMA 4JKDA 2NRVA 3M1FA 2GWJA 4RCHA 3VPZA 4Z94A 3O4WA 1KAXA 3CC4N 1NGEA 2P9IB 1SQKA 2D0PA 3SK3A 3M3ZA 2HBLA 1DGKN 4H5TA 4A5AA 4BGAA 3CIPA 4B9QA 4MO5A 4BREA 1M90O 1VQ9N 3HSCA 4PKHA 2A40A 2YJFA 2E2PA 4B1UB 4WQ5C 5GIOA 4ISGA 3FE1A 2NNWA 1GLJO 4BR5A 2QA4N 5C0YA 4OPAA 1K9MO 4IZ9A 3SBTA 5ADXH 4CZHA 4DHYA 1HLUA 4OPHA 2KLAA 3AGRA 1BA1A 1HKGA 3H1VX 2F9TA 3CHWA 3OBWA 3F5TA 3C6AA 3O08A 4H0OA 3W0LA 5KQ8A 3ZETB 1R59O 2PFUA 3LDPA 3MCPA 2P9LB 2P9PA 3TU5A 3VESA 3K9KA 3ATUA 2W41A 4WFNL 3NMUA 4FWRA 4MDAA 5GIPA 2V51B 3IFRA 4FWQA 4K43A 2Q2RA 3MX2A 1G99A 4BQLA 4U67L 3ENOA 2GTDA 4BRMA 3Q7CA 4JKEA 3SBGA 2E88A 5F0XA 3VMFB 3TPQA 2QI2A 3ATVA 1D4XA 2JWKA 3PIPL 4IO9L 2J4RA 5LJVA 1EO1A 3HZ6A 3UE5A 2QWRA 3A5MC 4YORA 1RDUA 3ULEB 4CZLA 3CCUN 1ATNA 3WQTA 1JJ2M 4BVOA 2YI1A 5AQWA 3CCVN 2QWOA 5AZJB 5M1PA 1C0FA 4BC5A 3VGMA 3QMLA 2V52B 3D2FB 3ZEUB 1RDWX 2A42A 3IKMA 3P4IA 4O8KA 3ENHA 4JEPA 3DXMA 4O5FA 1U2VA 4MLEA 5FPNA 4CZEA 2GWKA 5C12A 3UB5A 1QZ5A 2Q0RA 4IWVA 3I56N 3CCLN 5CR4A 1YJNN 5BRDA 3H6EA 4JK7A 2A6AA 3QDKA 2QTDA 3F2KA 3BP8A 4H0XB 5FPDA 3MWPA 3QFPA 2E20A 3A5NC 4WCEL 1RFQA 4GNIA 3RVCA 2P9NA 3JXUA 2WBNA 4BR2A 5GAGP 3HI0A 4Y0WA 4JHDA 2FSKA 1BDGA 1X3MA 4JKCA 3WEEA 1Y64A 3R1XA 1S72N 3CJBA 1IG8A 2V7ZA 3N4QA 4DKWA 5AQZA 4YDUC 4MDBA 3UKUA 1MWKA 4B1YB 5H1SQ 3H3OB 4GV6A 5AQRA 3A8YA 1GLLO 2OANA 3KZBA 4B1WB 1YVNA 2YX6A 5AQHA 4H5RA 1TYQB 2W40A 3O5BA 4BR0A 3O9QA 5DM7L 3FZKA 5EX5A 1HKCA 3HM8A 1S22A 1GLEG 4I6MB 3VGLA 4WQ5A 4EFHA 3C7NA 3LM2A 1VQMN 4CZJA 3LDLA 3FZLA 3CC2N 3CCJN 2FXUA 3AAPA 3O1BA 3WXMB 5KPTA 3SMPA 5AQQA 1GLBG 1P8ZA 2GELA 5EOYA 2NRHA 3CCRN 4G9ZA 1QQOA 3VEXA 4C23A 1SAZA 3IUCA 3LDOA 2FSJA 3TSPA 4BRGA 4FVUA 3EKSA 3UKRB 5AQNA 3GOIA 3S41A 1HPMA 4FWMA 3GDQA 3O9RA 4FOEA 4BR4A 3L6QA 4IEIA 1H1VA 2NRTA 3BUZB 1XQSC 2I7NA 2HMPA 4HTLA 4IO8A 4JD2A 3CQXA 1NGHA 4K25A 4YOXA 2BUPA 4A57A 3R9PA 1NBWA 2P9UB 3U8XA 5I9EB 3W3DA 2D0OA 3ID6A 1ATSA 2FSNA 2WFBA 4A2AA 3MN5A 5BPNA 3L4IA 1ZC6A 4BY9C 3WXLA 4IEEA 4UY8O 1JCGA 2WC9A 5AZIB 3HBTA 4JKHA 1DT9A 3VEYA 2YHXA 3P38A 2NRRA 5M1FA 5EY4A 3L4QA 4ILGB 4BRPA 4FWNA 5BREA 2E1YA 3D2EB 3VF2A 5ELZA 4BRDA 1HJOA 3I33A 4BG8A 3CJ9A 3FLCO 3OBYA 2E2QA 5AQLA 1YIJN 3CCMN 3CC7N 3LM9A 3EKUA 5HOOA 2ZF5O 4ILHA 4JNEA 3RSEA 5AFUH 4FWOA 3O9UA 3R3LA 1NMDA 4FO0A 3FR0A 3E9PA 1GLAG 4BQZA 3HOSA 2AA4A 2QWNA 2GX9A 1BOTO 3T69A 1VQ4N 3JS6A 4JKGB 4CZGA 2ZJPL 3E9OA 4H0PA 1BUPA 1T6CA 3H3NO 1W2BM 4WFAL 4FPAA 3VGKA 4QS8A 5DM6L 5C10A 3EE9A 5LJWA 1T44A 3SMSA 3WXIA 3VETA 1N8RO 4BC3A 1BWFO 4CZIA 1DEJA 5ADXA 4BRAA 4CJ7A 3IDHA 4EHUA 4H5VA 3A5LC 1HX1A 3CCEN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NM1 A;  4CZF A;  2P9P B;  2Q31 A;  1KAY A;  5AQX A;  4CZM A;  5KQD A;  5E26 A;  2CGK A;  3KHY A;  4CI6 A;  3FZM A;  4FWK A;  2IVN A;  1K8K B;  1WOQ A;  2FF3 B;  1XUP O;  3A0I X;  5AQP A;  2F9W A;  2QXL A;  3DWL A;  4EHT A;  2P9L A;  2CH6 A;  4ISF A;  1NGF A;  5LY3 A;  4BGB A;  1HKB A;  2E8A A;  4CD1 A;  2QWP A;  2VWB A;  4XH1 A;  1BG3 A;  3R6M A;  5JLF A;  3ID8 A;  1GLD G;  4BRH A;  4WQ4 C;  1QHA A;  1TUU A;  3WXK A;  1BO5 O;  1X9J A;  4H0Y B;  3DXM B;  5F2R A;  3U4L A;  1DKG D;  1U2V B;  4RTF D;  4PKI A;  5AQI A;  2A5X A;  4CD3 A;  1NGC A;  2PBD A;  3ZX3 A;  5AZJ A;  2ZGZ A;  1ZXO A;  3DAW A;  3DXK A;  4PKG A;  5BN8 A;  3D2F A;  3J8A A;  3H1Q A;  3D7E O;  3GE1 A;  2GUP A;  5TKY A;  4FWL A;  4FWS A;  5FPE A;  5AQK A;  4FSV A;  3EO3 A;  3QIC A;  5CE3 A;  2CGL A;  1HUX A;  3FZF A;  3WEE B;  1KXP A;  3M6G A;  4K41 A;  3QBX A;  4M7Y A;  1J6Z A;  1V4S A;  4MO4 A;  1NGI A;  2FLO A;  1JCE A;  4KBO A;  1ZBS A;  2ASO A;  5AQV A;  4B1V A;  3OHR A;  1LOT B;  3C0B A;  3CER A;  5AQJ A;  4M63 C;  3VEV A;  5BPM A;  2QW9 A;  3CJ7 A;  3VER A;  2HOE A;  3VF4 A;  2D1K A;  3MMV A;  1LCU A;  4BRQ A;  1WUA A;  2YJE A;  1C0G A;  1ESV A;  3LDQ A;  3MN7 A;  4RWT A;  1MDU B;  4FWP A;  4H5W A;  3FFK B;  2UYT A;  4BR9 A;  3O8M A;  5AQS A;  1YXQ A;  2A3Z A;  2HF4 A;  1EQY A;  4F9O A;  2KHO A;  4XH4 A;  4JD2 B;  3BF3 A;  3VEN A;  2NLX A;  1ATR A;  3EN9 A;  4H5N A;  5EXW A;  2YCH A;  1Z05 A;  2P9K B;  1SZ2 A;  3LL3 A;  4MLH A;  4EIA A;  3CJ1 A;  3CET A;  1NWK A;  3VF6 A;  4EAH D;  4J8F A;  2Q36 A;  2E2O A;  1NGD A;  2P9S A;  5BRH A;  1XC3 A;  3BEX A;  3RSE B;  2QWM A;  2AP1 A;  1Z6R A;  3FGU A;  4NO7 A;  2ITM A;  3WUH A;  4IJA A;  5AFU A;  2P9I A;  2E2N A;  2FF6 A;  3GG4 A;  2WUS A;  4H03 B;  1U6Z A;  2A41 A;  4PL8 A;  4WYB A;  3VEO A;  2ZGY A;  3L0Q A;  3AAR A;  2E1Z A;  2ASM A;  2HF3 A;  5BN9 A;  4B1X B;  4BRF A;  2Q1N A;  1NGA A;  2VCP A;  4YDU A;  1OKJ A;  1TUY A;  1NLV A;  5FPM A;  4NB4 A;  4FL9 A;  5B8H A;  4L3Q A;  3ZET A;  4CBW A;  3ZX0 A;  1V4T A;  2D4W A;  3MK6 A;  2VYP A;  3R8E A;  4IJN A;  1QQN A;  2CH5 A;  3B8A X;  3VOV A;  1YAG A;  5AQT A;  4BRL A;  4A61 A;  3FZH A;  1QZ6 A;  5BPL A;  1K8K A;  5AQO A;  4A62 A;  3F9M A;  3CQY A;  3O1W A;  4XEI A;  3WXJ A;  3ULE A;  3ZX2 A;  1KAZ A;  4H0T B;  3U9D A;  4BVP A;  5JLH A;  1JCF A;  3G25 A;  4CBU A;  1S3X A;  3U9Z A;  3ZEU A;  2IVP A;  3EL2 A;  3CJA A;  1IJJ A;  2H3G X;  3DXK B;  2IIR A;  1GLC G;  3SJH A;  1X3N A;  5F1X A;  4FPB A;  3O6W A;  2P9N B;  4JHD B;  1NGJ A;  5AQF A;  4AM6 A;  5AQU A;  1YUW A;  1QQM A;  4BC4 A;  3A5O C;  5BRF A;  3CI5 A;  1BU6 O;  2YHY A;  5E84 A;  5AQG A;  3UKU B;  3LDN A;  3QBW A;  4E1J A;  4CZK A;  2CGJ A;  4DQ8 A;  2PAV A;  3BF1 A;  2Q97 A;  3MN6 A;  4QS7 A;  4B1Z A;  1NGB A;  4DB3 A;  2YHW A;  4AM7 A;  5KPZ A;  4H0V B;  1NGG A;  4DCH A;  1Q18 A;  3C7N B;  4BRK A;  3QFU A;  3AAQ A;  4BG9 A;  4BR7 A;  4A2B A;  1T6D A;  1TYQ A;  3O80 A;  2DPN A;  2V7Y A;  3KVG A;  3IMX A;  3WQU A;  4BRI A;  4I6M A;  2ZWH A;  4GY2 B;  3H46 O;  1E4F T;  1RGI A;  4BC2 A;  3CJC A;  1GLF O;  3QB0 A;  5JMV A;  4JN4 A;  5AR0 A;  3WT0 A;  2BTF A;  3H45 C;  3I8B A;  3GL1 A;  2ASP A;  5BR9 A;  4XH5 A;  4IXC A;  2QM1 A;  3MN9 A;  4M7X A;  3SLC A;  3UKR A;  5AQM A;  5EVZ A;  3VEW A;  2IVO A;  3AY9 A;  4K42 A;  3GBT A;  4HWI A;  4CBX A;  4JAX A;  2GEM A;  4BRN A;  4BRO A;  1E4G T;  2NZT A;  4QS9 A;  2P9U A;  4WQ4 A;  3VEZ A;  4ISE A;  1CZA N;  4PL7 A;  1BA0 A;  5KPR A;  2I7P A;  3MDQ A;  2P9S B;  2EWS A;  2P9K A;  5AQY A;  4BRC A;  5AZI A;  3HTV A;  3DJC A;  2QWL A;  4LC9 B;  1MA9 B;  3D2E A;  2Q0U A;  5JIC A;  2QWQ A;  4FOI A;  3EZW A;  1MWM A;  4Z94 A;  3M1F A;  2GWJ A;  4RCH A;  3VPZ A;  3O4W A;  1KAX A;  1NGE A;  2P9I B;  1SQK A;  2D0P A;  3SK3 A;  3M3Z A;  4H5T A;  1DGK N;  4BGA A;  4B9Q A;  4BRE A;  3CIP A;  5F0X A;  4MO5 A;  3HSC A;  4PKH A;  2A40 A;  2YJF A;  2E2P A;  4B1U B;  4WQ5 C;  4ISG A;  3FE1 A;  4BR5 A;  1GLJ O;  4IZ9 A;  5ADX H;  4CZH A;  4DHY A;  1HLU A;  1BA1 A;  1HKG A;  3H1V X;  2F9T A;  3CHW A;  3W0L A;  3O08 A;  4H0O A;  5KQ8 A;  3ZET B;  1R59 O;  3LDP A;  3MCP A;  2P9L B;  2P9P A;  3TU5 A;  3VES A;  3ATU A;  2W41 A;  4FWR A;  2V51 B;  3IFR A;  4FWQ A;  4K43 A;  2Q2R A;  1G99 A;  4BQL A;  3ENO A;  2GTD A;  4BRM A;  2E88 A;  3TPQ A;  3ATV A;  1D4X A;  2J4R A;  5LJV A;  3HZ6 A;  3UE5 A;  2QWR A;  3A5M C;  3ULE B;  4CZL A;  1ATN A;  3WQT A;  4BVO A;  2YI1 A;  5AQW A;  2QWO A;  5AZJ B;  1C0F A;  4BC5 A;  3VGM A;  3QML A;  2V52 B;  3D2F B;  3ZEU B;  1RDW X;  2A42 A;  3P4I A;  4O8K A;  3ENH A;  3DXM A;  4O5F A;  1U2V A;  4MLE A;  5FPN A;  4CZE A;  2GWK A;  3UB5 A;  1QZ5 A;  2Q0R A;  4IWV A;  5BRD A;  3H6E A;  2A6A A;  3QDK A;  3BP8 A;  4H0X B;  5FPD A;  3QFP A;  2E20 A;  3A5N C;  1RFQ A;  4GNI A;  2P9N A;  3JXU A;  4BR2 A;  3HI0 A;  4Y0W A;  4JHD A;  2FSK A;  1BDG A;  1X3M A;  3WEE A;  1Y64 A;  3CJB A;  1IG8 A;  2V7Z A;  5AQZ A;  4YDU C;  3UKU A;  1MWK A;  4B1Y B;  3H3O B;  5AQR A;  3A8Y A;  1GLL O;  2OAN A;  3KZB A;  4B1W B;  1YVN A;  5AQH A;  4H5R A;  1TYQ B;  2W40 A;  3O5B A;  4BR0 A;  3FZK A;  5EX5 A;  1HKC A;  3HM8 A;  1S22 A;  1GLE G;  4I6M B;  3VGL A;  4WQ5 A;  4EFH A;  3C7N A;  3LM2 A;  4CZJ A;  3LDL A;  3FZL A;  2FXU A;  3AAP A;  3O1B A;  5KPT A;  3SMP A;  5AQQ A;  1GLB G;  1P8Z A;  2GEL A;  5EOY A;  2NRH A;  1QQO A;  3VEX A;  4C23 A;  1SAZ A;  3IUC A;  3LDO A;  2FSJ A;  4BRG A;  3EKS A;  3UKR B;  5AQN A;  3GOI A;  3S41 A;  1HPM A;  4FWM A;  3GDQ A;  4FOE A;  4BR4 A;  3L6Q A;  1H1V A;  3BUZ B;  1XQS C;  2I7N A;  2HMP A;  4HTL A;  4IO8 A;  4JD2 A;  3CQX A;  1NGH A;  4K25 A;  2BUP A;  3R9P A;  1NBW A;  2P9U B;  3U8X A;  5I9E B;  3W3D A;  2D0O A;  1ATS A;  2FSN A;  4A2A A;  3MN5 A;  5BPN A;  3L4I A;  1ZC6 A;  3WXL A;  1JCG A;  5AZI B;  3HBT A;  3VEY A;  2YHX A;  5EY4 A;  4BRP A;  4FWN A;  5BRE A;  2E1Y A;  3D2E B;  3VF2 A;  5ELZ A;  4BRD A;  1HJO A;  3I33 A;  4BG8 A;  3CJ9 A;  3FLC O;  2E2Q A;  5AQL A;  3LM9 A;  3EKU A;  2ZF5 O;  4JNE A;  3RSE A;  5AFU H;  4FWO A;  1NMD A;  4FO0 A;  3FR0 A;  1GLA G;  4BQZ A;  2AA4 A;  2QWN A;  1BOT O;  3JS6 A;  4CZG A;  4H0P A;  1BUP A;  1T6C A;  3H3N O;  4FPA A;  3VGK A;  4QS8 A;  5LJW A;  1T44 A;  3SMS A;  3WXI A;  3VET A;  4BC3 A;  1BWF O;  4CZI A;  1DEJ A;  5ADX A;  4BRA A;  4CJ7 A;  3IDH A;  4EHU A;  4H5V A;  3A5L C;  1HX1 A; 
#chains in the Genus database with same CATH topology
 3OS1 A;  2P9P B;  4OGE A;  4DG1 A;  3CM6 A;  2A1R A;  1W7A A;  5E26 A;  2CGK A;  1D9D A;  4LH4 A;  3CM5 A;  1WOQ A;  5AJ3 K;  3A0I X;  5AQP A;  3PY8 A;  2QXL A;  3SNN A;  4FJ9 A;  1U49 A;  3LAK A;  1XI1 A;  1NGF A;  4CES A;  4BGB A;  1HKB A;  4IDH A;  2QWP A;  4XH1 A;  1BG3 A;  5IT9 O;  3R6M A;  3DMJ A;  3LP1 A;  3HO1 A;  3M8S A;  3ZCM A;  1TUU A;  3WXK A;  3L3V A;  3SJJ A;  3EY1 A;  1BIU A;  1QQC A;  3LP0 A;  4CEZ A;  1NGC A;  5AZJ A;  1EWR A;  5BN8 A;  4NLC A;  3H1Q A;  1KVA A;  4C8K A;  2GUP A;  4CGF A;  4KH4 A;  5TKY A;  5AQK A;  4FSV A;  2BAN A;  1VQ6 N;  3EO3 A;  2CGL A;  3KK7 A;  1QSY A;  1KXP A;  3T1A A;  1S1X A;  3SAF A;  2O4G A;  4CER A;  1QE1 A;  2PYL A;  3QBX A;  3G71 N;  4FXD A;  4RW9 A;  1J6Z A;  4E1M A;  1QVG M;  1NGI A;  2OZS A;  3SYZ A;  4KBO A;  2ASO A;  4B1V A;  3OHR A;  3CER A;  4I9L A;  1K73 O;  3VER A;  2HOE A;  3MCA B;  5CHI A;  3OS2 A;  1LCU A;  4BRQ A;  3SQ1 A;  1Q86 O;  2YJE A;  1TKZ A;  3QET A;  4KRF A;  3LDQ A;  3MED A;  3MN7 A;  4JRP A;  2HND A;  2ZJR L;  3FFK B;  1YF5 L;  3NH2 A;  3AA2 A;  3E01 A;  1TKT A;  1XMO K;  3CQ8 A;  3CPW M;  4EP5 A;  2HF4 A;  3DLK A;  3I0S A;  4F9O A;  4IBN A;  2Y1I A;  3LAN A;  4X65 K;  1GOB A;  4DQS A;  1NKB A;  2OPQ A;  3LL3 A;  4MLH A;  2OTJ N;  4DTP A;  1NJX A;  3NF7 A;  1NWK A;  3CET A;  1C0M A;  4DV2 K;  4J8F A;  4C8L A;  3QLH A;  3CD6 N;  3OYF A;  4A5B A;  4CHO A;  4FJG A;  4LF4 K;  4DF8 A;  5FRM A;  3BEX A;  3ZSO A;  2QWM A;  4M3Z A;  3C6H A;  4IFY A;  2E2N A;  4YOT A;  4WFB L;  3SQ4 A;  4HCB A;  3VEO A;  2ZGY A;  4A59 A;  2ASM A;  4CEO A;  4JS4 A;  4GKK K;  1OH7 A;  4FM0 A;  4DV4 K;  1TUY A;  4DFP A;  1NKE A;  3DOL A;  2UXC K;  5B8H A;  3NF8 A;  3HPH A;  2JLE A;  5DMR A;  5GAD P;  1VRU A;  3K59 A;  2D4W A;  3MK6 A;  3OA9 A;  4KAZ A;  1Q8I A;  4HVJ A;  1L3V A;  2P5G A;  5CYM A;  3MEC A;  3FZH A;  3VTI A;  5BPL A;  4A62 A;  1VSK A;  3F9M A;  1HYS A;  3ULD A;  3DLR A;  1C1C A;  4H0T B;  3U9D A;  4BVP A;  4M42 A;  5KGX A;  5J2P A;  3G25 A;  2QXF A;  1T05 A;  2H3G X;  1RTI A;  1YT3 A;  4FZY A;  1C1A A;  3SJH A;  1X3N A;  5F1X A;  3AA3 A;  1XHZ A;  3NBP A;  4CHY A;  2O8C A;  1RCH A;  1HQE A;  1I94 K;  4IKF A;  5BRF A;  2OTL N;  3QNO A;  5E84 A;  3LDN A;  3NFA A;  2PY5 A;  1YJ9 N;  1K6Y A;  1SS6 A;  1NGB A;  1BCM A;  3LPU A;  4YNQ A;  4H0V B;  1NGG A;  1ZBF A;  3VN5 A;  4DR5 K;  3G0Z A;  4KTZ A;  2KTQ A;  4A2B A;  2E5L K;  1TVR A;  2YV0 X;  4F3T A;  4G1Q A;  4DF4 A;  1KLM A;  1W97 L;  1N32 K;  3K5M A;  3KLH A;  1GLF O;  4CIF A;  3I55 N;  1BCO A;  1LW2 A;  5JMV A;  3ENB A;  2ZJQ L;  4M3R A;  4XH5 A;  4M7X A;  3MN9 A;  3UKR A;  3VQ7 A;  5J2N A;  3AO5 A;  4LSL A;  1JXE A;  1K8A O;  3GBT A;  4DR1 K;  4JAX A;  2GEM A;  3SCX A;  2HBM A;  2FBT A;  2KFZ A;  4YOW A;  3KKS A;  3SUN A;  2JWL A;  2P9U A;  3VEZ A;  2BH1 A;  3K2P A;  4B9N A;  5GAH P;  4FK0 A;  4JKF A;  1T03 A;  4CHZ A;  2P9K A;  4BRC A;  4B9T A;  5C15 A;  3NHG A;  3DJC A;  2QWL A;  1MA9 B;  1S9E A;  4FOI A;  3C65 A;  4W5Q A;  1TL1 A;  4RCH A;  3VPZ A;  2G8U A;  1KAX A;  1NGE A;  1IH7 A;  1S6P A;  4WQ5 C;  2NNW A;  1GLJ O;  5C0Y A;  1EWQ A;  1K9M O;  3OYB A;  1UA0 A;  1VSE A;  5HBM A;  4DHY A;  1HLU A;  1L3S A;  2KLA A;  3AGR A;  1BA1 A;  1HKG A;  3LZJ A;  5KQ8 A;  2XY7 A;  3T1H K;  4X62 K;  3TU5 A;  3K9K A;  2W41 A;  4WFN L;  2VWK A;  4FWR A;  4DTN A;  3IFR A;  1KSP A;  3HM9 A;  3MX2 A;  3THW A;  4BRM A;  4FM1 A;  4JI2 K;  1S1V A;  2HVI A;  2E88 A;  3SUP A;  4KHU A;  1L3U A;  3ATV A;  1D4X A;  3PIP L;  5LJV A;  4E7K A;  2DFE A;  4YOR A;  1WSF A;  1RDU A;  2Q3S A;  1ATN A;  3TAB A;  1MU2 A;  4OPK A;  1C0F A;  3QML A;  2V52 B;  3D2F B;  4O8K A;  3IG1 A;  3U6F A;  4MLE A;  2Q0R A;  3VQD A;  1XC9 A;  1SL1 A;  4DFK A;  3V1Q A;  2O8C B;  3J81 O;  1QHT A;  3QDK A;  3F2K A;  4DUY K;  2OPP A;  4FJ5 A;  1N33 K;  4H0X B;  3MWP A;  3ITH A;  4WCE L;  4NXN K;  3TAR A;  3LP2 A;  3RVC A;  4DV6 K;  3HI0 A;  1HNZ K;  2FSK A;  3SV3 A;  1Y64 A;  3DRS A;  4DKW A;  3U3Y A;  3ISN C;  4JI5 K;  2PZS A;  1XNQ K;  1YVN A;  3AVJ A;  2JGU A;  3O5B A;  3V9U A;  3DYA A;  3HXM A;  2HHS A;  3VGL A;  4WQ5 A;  1HJR A;  3ZT3 A;  4JI8 K;  3C7N A;  1VQM N;  2DFH A;  1NKC A;  1NU0 A;  4DU3 A;  3LDL A;  3FZL A;  3CC2 N;  3CCJ N;  2FXU A;  4DV7 K;  4JI7 K;  1TAQ A;  4G9Z A;  3VEX A;  1WLJ A;  3IUC A;  1RDC A;  4FVU A;  3EKS A;  3UKR B;  3O9R A;  4BR4 A;  3BUZ B;  3A2F A;  2HMP A;  1A5V A;  4JD2 A;  4Z4H A;  2BUP A;  3R9P A;  2P9U B;  5I9E B;  3RTV A;  2B4J A;  3ID6 A;  5BPN A;  3WXL A;  4IEE A;  3L8B A;  4OJR A;  3AVG A;  4JKH A;  3ZSW A;  1DT9 A;  3LWL A;  2NRR A;  3L4Q A;  4ILG B;  3PX4 A;  5BRE A;  5J2Q A;  3KD5 E;  2P5O A;  3VQE A;  3OYI A;  5FRO A;  2B6A A;  2Y1J A;  3CJ9 A;  2D0B A;  3FLC O;  2E2Q A;  1YIJ N;  3CC7 N;  2XRI A;  3LM9 A;  3K5L A;  2ZE2 A;  2ZF5 O;  3D45 A;  4ILH A;  4DTX A;  4OKK A;  3O9U A;  4CEE A;  3E9P A;  1GLA G;  3JS6 A;  2ZJP L;  3E9O A;  1W2B M;  3H3N O;  4WFA L;  4QS8 A;  3EE9 A;  2I5J A;  1T44 A;  3SMS A;  4FCY A;  3VET A;  4KPY A;  4FLX A;  1DEJ A;  3M8Q A;  3K58 A;  5ADX A;  4BRA A;  3NAE A;  4EHU A;  3RMA A;  5JLH A;  1HX1 A;  4K8Z A;  1NMN A;  5AQX A;  2RHK A;  4CZM A;  3KIO A;  4CI6 A;  4M3T A;  1K8K B;  5C42 A;  4JI1 K;  4FVM A;  3NGI A;  3T7Z A;  4EHT A;  3SQ0 A;  1HQU A;  1VAZ A;  4LF7 K;  2P9L A;  4ISF A;  3KK3 A;  5LY3 A;  4CF9 A;  4NLB A;  1SKW A;  1J5O A;  1XHX A;  1T7P A;  3ZYY X;  2HHU A;  3ID8 A;  4OLA A;  3P31 A;  1DTT A;  3NVM A;  4KHY A;  4W5T A;  1NK0 A;  4RW7 A;  3OY9 A;  3U4L A;  1RTD A;  4DQQ A;  1FJG K;  4PKI A;  5CY4 A;  2PBD A;  1YHQ N;  3K5O A;  3DAW A;  1SKR A;  4FK2 A;  4DFM A;  3J8A A;  2XY8 A;  3NF9 A;  1RT2 A;  3D7E O;  3GE1 A;  4GMJ B;  2HBK A;  4DR7 K;  4Z0U A;  3TAF A;  1BQM A;  4FWS A;  1X1P A;  5FPE A;  1L3T A;  3QIC A;  4CEA A;  5CE3 A;  3HVR A;  2P1J A;  4JK8 A;  1RDB A;  1T3V A;  3M6G A;  5IWA K;  4JRQ A;  1CZ9 A;  4J2B A;  3VQ4 A;  4B8A B;  4BAC A;  5SZT A;  4H8K A;  1JCE A;  5BR8 K;  4KO0 A;  1LOT B;  4FJH A;  5AQJ A;  4M63 C;  3VEV A;  5BPM A;  2QW9 A;  3CXC M;  3RMC A;  3PLA A;  1P90 A;  1WUA A;  1Q82 O;  2KZM A;  1C0G A;  1D5A A;  2KKZ A;  4TSX A;  3DLG A;  3KWG A;  4BR9 A;  2X78 A;  4HUF A;  3O8M A;  4E7L A;  4Y1C A;  1NK5 A;  1YXQ A;  2ATQ A;  1QVF M;  2A3Z A;  4EZ9 A;  4IFV A;  1ASW A;  3V4I A;  4JD2 B;  4KI6 A;  3VEN A;  3VQ5 A;  3PO5 A;  1ATR A;  3EN9 A;  3TTD A;  5EXW A;  4E1N A;  3OJU A;  2VGN A;  3HT3 A;  3O4Q A;  1N5Y A;  4L8R B;  3ZLJ A;  1VSM A;  3JSM A;  2Q36 A;  3CMA N;  4KH5 A;  4BE1 A;  2E2O A;  4DR2 K;  1VK0 A;  1OH8 A;  4ID5 A;  3QNN A;  3VQ8 A;  2WTU A;  3DOK A;  2QKK A;  4CJF A;  1JLE A;  4OGC A;  4YOU A;  3TI0 A;  3C94 A;  3O4N A;  3MXJ A;  1CZB A;  4HCC A;  1Z6R A;  1C0T A;  4NO7 A;  5AFU A;  3CFP A;  4FW2 A;  2P9I A;  4OO1 J;  3VA3 A;  3G10 A;  4PL8 A;  2LSN A;  4WYB A;  3EE8 A;  2UUA K;  1NJZ A;  4KHQ A;  3P1G A;  5BN9 A;  2Q1N A;  4CIE A;  1NGA A;  1WSI A;  5LL6 Z;  3RR7 A;  4YDU A;  3VQC A;  5HP1 A;  4JKG A;  2DFF A;  3CCS N;  3T1Y K;  3JYT A;  3PSF A;  3ZET A;  3ZX0 A;  1V4T A;  4B9M A;  4RG8 A;  3KLI A;  2VYP A;  1R0A A;  3EYZ A;  4JK9 A;  2CH5 A;  3B8A X;  4AHS A;  3PV8 A;  1QZ6 A;  1YIT N;  4O0J A;  1IBL K;  1IV0 A;  4DV5 K;  3TTF A;  3MWT A;  4E0D A;  1J53 A;  4XEI A;  3WXJ A;  1G15 A;  4CBU A;  3I8D A;  3V9Z A;  2RN2 A;  4F2S A;  3LAL A;  4FJK A;  3CJA A;  1S6Q A;  2VG5 A;  3F9K A;  4HUG A;  2A1S A;  4X64 K;  4FLV A;  2D0A A;  3O6W A;  1JKH A;  4JV5 K;  4U7B A;  4JHD B;  4AHV A;  1NGJ A;  5AQF A;  1VQP N;  3ZSY A;  1F21 A;  4FJI A;  1QQM A;  1OH6 A;  1Q7Y O;  4CZK A;  2CGJ A;  4Z4I A;  1WAJ A;  3WNH A;  3G6E N;  2Q97 A;  3QIP A;  1BL3 A;  4B1Z A;  4DB3 A;  2YHW A;  2GV9 A;  4DCH A;  3SAG A;  3CME N;  3QER A;  4ZTJ A;  4YFU A;  4BRK A;  3V9W A;  1TK0 A;  4CFC A;  4BG9 A;  4BR7 A;  3MXM A;  2W6L A;  3OTO K;  2HW3 A;  1FK9 A;  3OYK A;  1TYQ A;  2YNF A;  2BGG A;  1N34 K;  2ZWH A;  1OVQ A;  3AVB A;  1KC8 O;  1RGI A;  3E9L A;  4IFE A;  1IKV A;  4RW8 A;  5MLC Q;  3WT0 A;  3QEW A;  3GL1 A;  2ASP A;  4IXC A;  3AA5 X;  3VEW A;  4Z4C A;  1E3M A;  4K42 A;  4DLG A;  4DQR A;  1LAW A;  4FLY A;  4KRE A;  5M1Q A;  3HP9 A;  5M1K A;  1Q9X A;  1RDA A;  4QS9 A;  4J2E A;  4DTO A;  5LMU K;  1U4B A;  4PL7 A;  4PY5 A;  5KPR A;  2I7P A;  3NH1 A;  3NH0 A;  2YNI A;  4NYF A;  1ZBL A;  4LC9 B;  1NK7 A;  4GVE A;  1ZBI A;  3EZW A;  1JXB A;  4CED A;  3M1F A;  3ZT1 A;  3O4W A;  2P9I B;  2D0P A;  3SK3 A;  3M3Z A;  4H5T A;  1DGK N;  4A5A A;  4B9Q A;  5F0X A;  3CIP A;  5KTQ A;  1VQ9 N;  2UUB K;  3P83 D;  4ELU A;  3HSC A;  4CJR A;  3EEQ A;  4PKH A;  2KFN A;  4KFB A;  2WOM A;  5GIO A;  4BR5 A;  3WNF A;  4OPA A;  1KTQ A;  1L5U A;  5ADX H;  1WSG A;  4BWM A;  4OPH A;  3H1V X;  3W0L A;  2F9T A;  3CHW A;  3M8R A;  1RT5 A;  3LAM A;  3O08 A;  4UQG A;  3ZET B;  3RMB A;  4EP4 A;  3ATU A;  4MDA A;  4NCG A;  2V51 B;  4FWQ A;  4CF0 A;  1G99 A;  4LFA K;  3ENO A;  1RBV A;  4JKE A;  1S9G A;  3ZSX A;  1LV5 A;  4DR3 K;  3VMF B;  4IO9 L;  1SKS A;  3UE5 A;  3HZ6 A;  5I42 A;  2G8W A;  2HB5 A;  3WQT A;  1JJ2 M;  4CCH A;  4NCA A;  4BVO A;  2VQF K;  3ZSZ A;  1NK4 A;  3CCV N;  5M1P A;  5AZJ B;  4CHP A;  4CHQ A;  3P4I A;  3ENH A;  3DXM A;  4CZE A;  3QES A;  3UB5 A;  1QZ5 A;  3K57 A;  3J7A P;  3I56 N;  4X66 K;  2F4V K;  1YJN N;  5BRD A;  4O4G A;  2G8K A;  3DI6 A;  4C8O A;  3AO4 A;  3IRX A;  4KI4 A;  3BP8 A;  2E20 A;  4DTM A;  3SI6 A;  1RFQ A;  3KKR A;  4W5O A;  2P9N A;  5GAG P;  4Y0W A;  1X3M A;  3WEE A;  4DSJ A;  5KGW A;  2V7Z A;  3UKU A;  2YHB A;  5H1S Q;  3H3O B;  2OAN A;  3KZB A;  4H5R A;  1TYQ B;  3O9Q A;  5DM7 L;  1TKD A;  4KHN A;  3HM8 A;  3QIO A;  2Z1G A;  3SUO A;  5HRO A;  4ELV A;  1LWC A;  3O1B A;  5KPT A;  3AVF A;  2OZM A;  4ZTF A;  3KK1 A;  4B9S A;  3KLF A;  2NRH A;  3CCR N;  4BRG A;  3THX A;  4CF2 A;  4LF6 K;  5A2Q O;  3S41 A;  3GOI A;  1HPM A;  2AJQ A;  3AVH A;  2X74 A;  3L6Q A;  1H1V A;  2NRT A;  5C25 A;  1XQS C;  2I7N A;  1NGH A;  4A57 A;  4NXM K;  4ICL A;  4KHP K;  1ATS A;  5FLX O;  1ZC6 A;  4I2P A;  3HBT A;  2W42 A;  2YHX A;  3P38 A;  2G8H A;  5M1F A;  4LFC K;  2E4L A;  3O3H A;  4BRD A;  1HJO A;  3I33 A;  1RNH A;  4E89 A;  3CCM N;  3V6D A;  4BDP A;  3EKU A;  2O4I A;  5AFU H;  4FWO A;  4CJE A;  1NMD A;  4FO0 A;  4LY7 A;  2QWN A;  1JL2 A;  4CK1 A;  1BOT O;  1VRT A;  4FLT A;  1Z25 A;  1J9A A;  4E3S A;  5LJW A;  5K14 A;  1BWF O;  3VQB A;  4DU1 A;  1HPZ A;  4CJ7 A;  4LFB K;  4H5V A;  1A5X A;  3CCE N;  1NM1 A;  4CZF A;  4IOA L;  1VHX A;  1KAY A;  3TAE A;  2P51 A;  4F8R A;  5KQD A;  3KHY A;  2X6S A;  4DV3 K;  3FZM A;  4FWK A;  2G8F A;  2IVN A;  2FF3 B;  3AVK A;  1XUP O;  2F9W A;  1QSS A;  4Q0B A;  1B92 A;  1I39 A;  2VG7 A;  3DWL A;  1HNX K;  1TKX A;  1NJI O;  1KCF A;  3LPT A;  3OYE A;  3K5N A;  2CH6 A;  1ILY A;  4QAG A;  1TGO A;  4FJ7 A;  2BE2 A;  1UA1 A;  2VWB A;  1QTM A;  5JLF A;  4BRH A;  5DK5 A;  4DUZ K;  4WQ4 C;  1QHA A;  1X9J A;  1BIZ A;  2FBX A;  4CEQ A;  3DXM B;  5F2R A;  1DKG D;  3AO2 A;  2YNH A;  4RTF D;  1VQO N;  5AQI A;  5FRN A;  2A5X A;  1ASV A;  1KFS A;  4W5N A;  4DQP A;  3ZX3 A;  2OYQ A;  3V1R A;  4M41 A;  4PKG A;  3DXK A;  3JAM O;  3E66 A;  4M45 A;  1NK9 A;  3LWM A;  3WEE B;  3E1Y A;  3OW2 M;  1TK8 A;  2Z1J A;  3PIO L;  2UXB K;  4K41 A;  3QIN A;  4M7Y A;  2IS3 A;  1N36 K;  1DTQ A;  4MO4 A;  2YHA A;  4AIL C;  2FLO A;  1ZBS A;  5AQV A;  1VQL N;  4FJL A;  3TWH A;  3C0B A;  4CJ3 A;  2F8S A;  4CJ4 A;  4J2A A;  3VF4 A;  2D1K A;  3NF6 A;  1BQN A;  3L3U A;  1ESV A;  1MDU B;  2RE2 A;  4H5W A;  3HST B;  1KQS M;  2UYT A;  4CE9 A;  5J2M A;  4K8X A;  3THX B;  3HK2 A;  5AQS A;  3B6O A;  1HNI A;  1EP4 A;  3AVM A;  1N6Q A;  5I3U A;  3AGK A;  1EQY A;  2KHO A;  4XH4 A;  2QK9 A;  4BE0 A;  4KH6 A;  4H5N A;  3NE6 A;  2YCH A;  2RF2 A;  1Z05 A;  2P9K B;  1SZ2 A;  1VQN N;  3CJ1 A;  4M3W A;  5KRS A;  3VF6 A;  4EAH D;  4OKJ A;  4DTS A;  2O8F A;  1YVU A;  2QEX N;  1XC3 A;  4AHR A;  3OYL A;  4CEC A;  2HMI A;  3Q7B A;  2NRX A;  3SAH A;  4F3O A;  3I0R A;  3FGU A;  2ITM A;  3WUH A;  1I3A A;  4IJA A;  4AQY K;  4IOC L;  4OPJ A;  3FFI A;  3HRG A;  2FF6 A;  3GG4 A;  4H03 B;  3VQQ A;  1U6Z A;  2VG6 A;  4PHT X;  3RR8 A;  1IKX A;  2E1Z A;  2HF3 A;  3CYM A;  1SL0 A;  3TTC A;  4BRF A;  3DRR A;  1HR0 K;  2EHG A;  2IAJ A;  1OKJ A;  1NLV A;  2GBZ A;  5FPM A;  4LH5 A;  4KHW A;  3IAY A;  1OVY A;  3THW B;  1LWF A;  2ZM6 K;  3P39 A;  2G8I A;  4CBW A;  3ZT4 A;  1UOC A;  4B8C A;  1IKY A;  3R8E A;  1RT6 A;  3PX0 A;  4CGI A;  1X9S A;  2OA8 A;  3MXI A;  3VOV A;  1W0H A;  1WSE A;  3M8P A;  1YAG A;  5TKW A;  4O5B A;  3BY5 A;  5C2F A;  4CK2 A;  2F7T A;  1VSJ A;  4B3R K;  1JCF A;  1JLG A;  1Q9Y A;  3OYA A;  3AVC A;  2B5J A;  4ID1 A;  3J7Z O;  3U9Z A;  4KTQ A;  1TV6 A;  3ZEU A;  4GV3 A;  1JLF A;  2IVP A;  4DSK A;  2NRZ A;  1RBS A;  3MEG A;  3DXK B;  1FW6 A;  5HL7 L;  2IIR A;  3AVA A;  4CJQ A;  4BDZ A;  3C95 A;  2Z1H A;  4FPB A;  1RTJ A;  1NJW A;  4ELT A;  4GKJ K;  5AQU A;  4BC4 A;  4JI0 K;  3A5O C;  4FJM A;  1JL1 A;  4JKB A;  3CCQ N;  4E1J A;  3P5J A;  3PO4 A;  4DQ8 A;  2PAV A;  2VWJ A;  4CGG A;  2OPR A;  4QS7 A;  3SV4 A;  1NK8 A;  1WBD A;  4AM7 A;  5KPZ A;  4IG0 A;  3CFO A;  3C7N B;  3QFU A;  1JLQ A;  3WNE A;  1HNV A;  1SV5 A;  1T6D A;  4R79 A;  3MEE A;  3S3M A;  2DPN A;  2V7Y A;  4GY2 B;  5GAE P;  5FDL A;  4YOV A;  1VQ5 N;  1E4F T;  1A5W A;  2GUI A;  4BC2 A;  3CJC A;  3QB0 A;  2IDO A;  5AR0 A;  2YKN A;  3J7Y P;  4YHH K;  1ASU A;  5BR9 A;  4KB0 A;  1SUQ A;  3MX5 A;  2OCE A;  3VQ6 A;  5AQM A;  5EVZ A;  2UXD K;  3AA4 A;  2IVO A;  4DTJ A;  2O8D A;  4HUE A;  3O9S A;  4HWI A;  4CBX A;  4CFB A;  1WSJ A;  4ILJ A;  3O9T A;  4RW6 A;  4BRO A;  2NZT A;  4JI3 K;  5CZ2 A;  4LF8 K;  1VSI A;  4ISE A;  2O8F B;  1CZA N;  3KD1 E;  3V9S A;  4O0I A;  3MDQ A;  5AQY A;  4CF8 A;  4CJV A;  3THY A;  3HTV A;  3OYN A;  1RT4 A;  2EX3 A;  3D2E A;  4OKE A;  2O8B A;  4F2R A;  2QWQ A;  5CZ1 A;  4F4K A;  1ZBH A;  1MWM A;  1IG9 A;  1RBR A;  4Z94 A;  2GWJ A;  3SPY A;  3CC4 N;  3RRG A;  3V1O A;  2HVH A;  1SQK A;  4BGA A;  4C8N A;  4MO5 A;  1M90 O;  2A40 A;  4CK3 A;  3FE1 A;  2QA4 N;  4CGD A;  3QEV A;  4IZ9 A;  4CW7 B;  4CZH A;  3HJF A;  3PSI A;  1RDD A;  3OBW A;  1LW0 A;  3F5T A;  3KLE A;  3S9H A;  4H0O A;  2W6K A;  3OYM A;  3LDP A;  2FBV A;  2P9L B;  2E6M A;  4BE2 A;  5GIP A;  1JLB A;  2OPS A;  2HHT A;  2ETJ A;  1ZBU A;  4FW1 A;  4KKO A;  4HHT A;  2RPI A;  3SBG A;  2D0C A;  1TAU A;  2JWK A;  2J4R A;  3RMD A;  1EO1 A;  2X6N A;  1EX4 A;  3OYJ A;  3RRH A;  2YI1 A;  5AQW A;  2QWO A;  4FZX C;  3ZEU B;  3QEI A;  1BI4 A;  4CHN A;  3HPO A;  3F73 A;  4O5F A;  2VQE K;  4PWD A;  1U2V A;  4OVL A;  3QEP A;  5C12 A;  3S3N A;  2GWK A;  1X9W A;  1B9D A;  1XNR K;  3CCL N;  4CF1 A;  1WN7 A;  3NDK A;  3D0P A;  3H6E A;  4JK7 A;  3HYF A;  4DFJ A;  2QTD A;  3AO1 A;  3WNG A;  5FPD A;  3A5N C;  1DLO A;  3ASM A;  2WBN A;  3H08 A;  1BDG A;  3R1X A;  4E7H A;  3BZK A;  1QS4 A;  3HVT A;  1U04 A;  4AHT A;  5AQZ A;  4MDB A;  3AO3 A;  1MWK A;  2RKI A;  3A8Y A;  4FJX A;  2F96 A;  1VSD A;  1RT3 A;  2YX6 A;  4H4O A;  5AQH A;  4M3Y A;  4DLE A;  3FZK A;  5EX5 A;  1C1B A;  1S22 A;  1GLE G;  3RWU A;  1HYZ A;  4DQI A;  4CZJ A;  4DV0 K;  1IBK K;  1RTH A;  2GEL A;  3BDP A;  5EOY A;  1QQO A;  1W9H A;  4C23 A;  4I2Q A;  3LDO A;  2FSJ A;  4FWM A;  3GDQ A;  2D5R A;  3SUQ A;  2O8D B;  4HTU A;  3OJS A;  2HHH K;  4HTL A;  4IO8 A;  4CIG A;  2KZZ A;  3CQX A;  4YOX A;  4CJW A;  3W3D A;  2FSN A;  1Y97 A;  2WFB A;  4A2A A;  4CEB A;  4K0K K;  4UY8 O;  1JCG A;  2WC9 A;  4KB1 A;  3IS9 A;  3VQP A;  4CJK A;  3THY B;  5EY4 A;  3DLH A;  2E1Y A;  3D2E B;  2O8B B;  5ELZ A;  4N47 A;  1U45 A;  5J1E A;  4MQ3 A;  1SL2 A;  3OBY A;  5D3G A;  4JNE A;  3RSE A;  3VA0 A;  3R3L A;  2DY4 A;  1TL3 A;  4BQZ A;  2AA4 A;  2R7Y A;  2GX9 A;  4JI4 K;  4JKG B;  4CZG A;  1U48 A;  3K0S A;  4H0P A;  1BUP A;  1RIL A;  1T6C A;  4FPA A;  3VGK A;  5DM6 L;  4KTW A;  4B3T K;  3WXI A;  1N8R O;  4FK4 A;  4WE1 A;  1VSF A;  3IDH A;  3A5L C;  3CPE A;  2Q31 A;  4EZ6 A;  5C24 A;  3M5R A;  1GOA A;  1FKP A;  1FKO A;  4JLH A;  3L2U A;  1C6V A;  4Z4G A;  3NVK A;  2E8A A;  4CD1 A;  4PA1 A;  4AHC A;  2HST A;  1HNW K;  2HHQ A;  4R5P A;  1GLD G;  4OLB A;  4FM2 A;  5M1O A;  1B9F A;  3OYG A;  4NYN A;  1BI4 B;  1BO5 O;  2KW4 A;  1VQ7 N;  3PX6 A;  4H0Y B;  3CFR A;  1S1T A;  1U2V B;  4CD3 A;  4J2D A;  2ZQB A;  4CJS A;  4IG3 A;  4DS4 A;  3TAN A;  2ZGZ A;  1ZXO A;  2FC0 A;  3D2F A;  4QCL A;  3LZI A;  4E7J A;  4KHS A;  3G4S N;  4FWL A;  1WSH A;  3VQ9 A;  1HUX A;  3FZF A;  5KRT A;  1ITG A;  1CXQ A;  1V4S A;  1BHL A;  2HHV A;  4JKA A;  1REV A;  5E41 A;  1BGX T;  3CJ7 A;  4C1N K;  3MMV A;  2IOC A;  4JI6 K;  4RWT A;  4DSL A;  4FWP A;  4C1N I;  3NGY A;  1XMQ K;  1NG9 A;  1D8Y A;  1WAF A;  3TR8 A;  2HBJ A;  3TAM A;  1LAV A;  5JVH L;  5JS1 A;  3L2V A;  1Q81 O;  5JS2 A;  5C2D A;  5M1N A;  1JLC A;  4N56 A;  1U47 A;  3BF3 A;  1S1W A;  1EKE A;  2NLX A;  3C6T A;  4Z4E A;  3TSU A;  1VQK N;  1UWB A;  4JS5 A;  4EIA A;  4BDY A;  1J54 A;  1KVC A;  1D9F A;  1WBB A;  2BDP A;  2VGM A;  4B3M K;  4DR4 K;  4NCB A;  1NGD A;  4QOZ B;  4DSE A;  2P9S A;  5BRH A;  1TK5 A;  3VTH A;  4DSF A;  5T7B A;  4W5R A;  1VSL A;  3V9X A;  1KRP A;  4CJ5 A;  5JVG L;  3RSE B;  2AP1 A;  2WUS A;  4FZZ A;  2A41 A;  3DLE A;  4IOX A;  3L0Q A;  4O8U A;  3AAR A;  1VSH A;  4XIU A;  4V19 S;  4B1X B;  3DLL L;  4JYA K;  1NJY A;  4CJP A;  4YOY A;  1X9M A;  5GIN A;  2VCP A;  4NB4 A;  4FL9 A;  4Q5V A;  4L3Q A;  3T3F A;  1IO2 A;  3S3O A;  1RT1 A;  4H4M A;  1HMV A;  3VQA A;  4IJN A;  3DRP A;  3ZT0 A;  1QQN A;  4FJJ A;  3QEX A;  5AQT A;  4BRL A;  4A61 A;  3ZSR A;  4PUO A;  4CGH A;  1RBT A;  1K8K A;  5AQO A;  2WON A;  3CQY A;  1NOZ A;  3B6P A;  4CJU A;  3O1W A;  1EET A;  1O13 A;  3N4P A;  3ULE A;  1KAZ A;  3ZX2 A;  3KWI A;  3D6R A;  1YI2 N;  1ZYQ A;  4I7F A;  1S3X A;  5HRR A;  4LF5 K;  2UU9 K;  3EL2 A;  1IJJ A;  3L2R A;  4MFB A;  2O8E A;  1GLC G;  1QSL A;  5EU7 A;  3BGR A;  3T19 A;  3EZ5 A;  3L2W A;  2P9N B;  2HHW A;  4FLW A;  4WF9 L;  4AM6 A;  2XY5 A;  1YUW A;  2NRW A;  3OYC A;  3CI5 A;  1WNS A;  1BU6 O;  2YHY A;  5AQG A;  3UKU B;  3J80 O;  5LMN K;  3QBW A;  1S5J A;  3TSQ A;  3BF1 A;  2YKM A;  1KD1 O;  3MN6 A;  4CJL A;  1JLA A;  1BIS A;  3KJV A;  3CF5 L;  1O1W A;  1Q18 A;  3AAQ A;  1VQ8 N;  1GOC A;  4B9U A;  3HOT A;  3SPZ A;  3K9J A;  3O80 A;  3KVG A;  3IMX A;  4E7I A;  3WQU A;  4BRI A;  4I6M A;  3L2Q A;  3H46 O;  2HNY A;  1NK6 A;  4M3U A;  2IGI A;  4JN4 A;  4FJN A;  3SZ2 A;  2BTF A;  3H45 C;  3I8B A;  1KFD A;  4GVM A;  2QM1 A;  3OYD A;  1YTU A;  3SLC A;  2NUB A;  3AY9 A;  4M3X A;  1CXU A;  4BRN A;  3AVL A;  2E6L A;  4PQU A;  2YNG A;  3NGZ A;  4AF1 A;  3OS0 A;  1E4G T;  4WQ4 A;  4N76 A;  1EXQ A;  5CYQ A;  1UAX A;  1BA0 A;  1YJW N;  2P9S B;  2EWS A;  5AZI A;  4B9V A;  3PUF A;  4GV9 A;  4DMN A;  5HRS A;  3TAP A;  1M1K O;  1Z26 A;  4CVN E;  3TAQ A;  1HYV A;  4N5S A;  4IDK A;  4RW4 A;  2Q0U A;  5JIC A;  4JKD A;  2NRV A;  1NNE A;  4LD0 A;  3LP3 A;  2HBL A;  4BRE A;  2YJF A;  2E2P A;  4B1U B;  4ISG A;  4DS5 A;  3HP6 A;  4O55 A;  5SWM A;  3SBT A;  2XY6 A;  3C6A A;  3QO9 A;  1R59 O;  2PFU A;  4AHU A;  3LDS A;  3MCP A;  2P9P A;  3VES A;  3NMU A;  4K43 A;  2Q2R A;  4CFD A;  3NCI A;  4BQL A;  4ZHR A;  4U67 L;  2GTD A;  3Q7C A;  1RBU A;  3CG7 A;  3ZT2 A;  3AVI A;  3BZC A;  2G8V A;  3TPQ A;  2QI2 A;  4CEF A;  4Z4F A;  4DTU A;  1HRH A;  2QWR A;  3A5M C;  2ITG A;  3U3G A;  3ULE B;  4CZL A;  4I9Q A;  1CLQ A;  3CCU N;  4LSN A;  3AV9 A;  4CJT A;  2DTU A;  5KI6 A;  3KTQ A;  4B9L A;  2PYJ A;  4N41 A;  3OVN A;  4BC5 A;  3VGM A;  1RDW X;  2A42 A;  3IKM A;  3KLG A;  4JEP A;  4O44 A;  4B08 A;  2O8E B;  3MAQ A;  1S1U A;  4FYD A;  5FPN A;  2XO7 A;  4IWV A;  4FLZ A;  1OH5 A;  5CR4 A;  2A6A A;  2FBY A;  3O3F A;  1FXX A;  4DWI A;  4C8M A;  2F8T A;  3UIQ A;  4KV8 A;  1C0U A;  3QFP A;  4DTR A;  4DR6 K;  4GNI A;  2HNZ A;  3JXU A;  4BR2 A;  4JHD A;  4JKC A;  3DM2 A;  3ZSQ A;  5HLF A;  1S72 N;  3OYH A;  3CJB A;  4Y1D A;  3SQ2 A;  3HPG A;  1IG8 A;  3N4Q A;  2XHB A;  4YDU C;  2QKB A;  4B1Y B;  1KLN A;  4GV6 A;  5AQR A;  4DV1 K;  1GLL O;  1YTA A;  3AVN A;  4B1W B;  3TAG A;  2W40 A;  4BR0 A;  4FLU A;  1HKC A;  4I6M B;  2ZD1 A;  1RT7 A;  4EFH A;  3LM2 A;  4LF9 K;  4DSI A;  4FJ8 A;  3AAP A;  3WXM B;  3SMP A;  5AQQ A;  4E19 A;  2HHX A;  1GLB G;  1P8Z A;  1NOY A;  2KQ2 A;  1IKW A;  4GW6 A;  1SAZ A;  3TSP A;  4CGJ A;  5AQN A;  2Z1I A;  4FOE A;  3V81 A;  4CFA A;  4IEI A;  3KK2 A;  4K25 A;  1WB9 A;  1NBW A;  3U8X A;  2D0O A;  3ALY A;  1T8E A;  4B3O A;  3MN5 A;  4BY9 C;  3L4I A;  5AZI B;  3C6U A;  3VEY A;  1XWL A;  4B3S K;  4YY3 K;  4BRP A;  4FWN A;  3VF2 A;  4OX9 K;  4BG8 A;  3HL8 A;  4DU4 A;  5AQL A;  4AH9 A;  5HOO A;  3FR0 A;  5HRP A;  3HOS A;  2UUC K;  3T69 A;  1VQ4 N;  3THV A;  3DLB A;  1KVB A;  2IC3 A;  5C10 A;  1LWE A;  5HRN A;  4BC3 A;  4CZI A;  1IBM K;  4BWJ A;  1J5E K;  3ZSV A;  3O3G A; 
#chains in the Genus database with same CATH homology
 1NM1 A;  4CZF A;  2P9P B;  2Q31 A;  4IOA L;  1KAY A;  5AQX A;  2RHK A;  3M5R A;  4CZM A;  5KQD A;  5E26 A;  2CGK A;  3KHY A;  4CI6 A;  3FZM A;  4FWK A;  2IVN A;  1K8K B;  1WOQ A;  2FF3 B;  1XUP O;  3A0I X;  5AQP A;  2F9W A;  2QXL A;  3T7Z A;  3DWL A;  4EHT A;  1NJI O;  1VAZ A;  1ILY A;  2P9L A;  2CH6 A;  3NVK A;  4ISF A;  1NGF A;  5LY3 A;  4BGB A;  1HKB A;  4NLB A;  2E8A A;  4CD1 A;  4IDH A;  2QWP A;  2VWB A;  4XH1 A;  1BG3 A;  2HST A;  3ZYY X;  3R6M A;  5JLF A;  3ID8 A;  1GLD G;  4BRH A;  3P31 A;  3NVM A;  5M1O A;  4WQ4 C;  1QHA A;  1TUU A;  3WXK A;  1BO5 O;  1X9J A;  1VQ7 N;  4H0Y B;  3DXM B;  5F2R A;  3U4L A;  1DKG D;  1U2V B;  4RTF D;  1VQO N;  4PKI A;  5AQI A;  2A5X A;  4CD3 A;  1NGC A;  2PBD A;  3ZX3 A;  1YHQ N;  5AZJ A;  2ZGZ A;  1ZXO A;  3DAW A;  3DXK A;  4PKG A;  5BN8 A;  4NLC A;  3D2F A;  3J8A A;  3H1Q A;  3D7E O;  3GE1 A;  2HBK A;  2GUP A;  3G4S N;  4KH4 A;  5TKY A;  4FWL A;  3E66 A;  4FWS A;  5FPE A;  5AQK A;  4FSV A;  1VQ6 N;  3EO3 A;  3QIC A;  5CE3 A;  2CGL A;  4JK8 A;  1HUX A;  3FZF A;  3KK7 A;  3WEE B;  1KXP A;  3E1Y A;  3OW2 M;  3SAF A;  3PIO L;  1T3V A;  3M6G A;  4K41 A;  3QBX A;  4M7Y A;  3G71 N;  1J6Z A;  1V4S A;  4MO4 A;  1QVG M;  1NGI A;  2FLO A;  1JCE A;  4KBO A;  1ZBS A;  2ASO A;  5AQV A;  1VQL N;  4B1V A;  3OHR A;  1LOT B;  3C0B A;  3CER A;  5AQJ A;  4JKA A;  4M63 C;  3VEV A;  5BPM A;  1K73 O;  2QW9 A;  3CXC M;  3CJ7 A;  3VER A;  2HOE A;  3MCA B;  3VF4 A;  2D1K A;  4C1N K;  5CHI A;  3MMV A;  1LCU A;  4BRQ A;  3PLA A;  1P90 A;  1Q86 O;  1WUA A;  2YJE A;  1Q82 O;  1C0G A;  1ESV A;  3LDQ A;  3MN7 A;  4RWT A;  1MDU B;  2RE2 A;  2KKZ A;  4FWP A;  4H5W A;  4C1N I;  3FFK B;  1YF5 L;  2ZJR L;  1KQS M;  2UYT A;  3KWG A;  4BR9 A;  3CPW M;  3O8M A;  2HBJ A;  5AQS A;  5JVH L;  1YXQ A;  1QVF M;  1Q81 O;  2A3Z A;  2HF4 A;  5C2D A;  3AGK A;  5M1N A;  1EQY A;  4F9O A;  2KHO A;  4XH4 A;  4JD2 B;  3BF3 A;  3VEN A;  2NLX A;  4KH6 A;  1ATR A;  3EN9 A;  3TTD A;  4H5N A;  5EXW A;  2VGN A;  2YCH A;  1Z05 A;  3TSU A;  2P9K B;  1VQK N;  1SZ2 A;  3LL3 A;  4MLH A;  2OTJ N;  1VQN N;  4EIA A;  3CJ1 A;  1NWK A;  3CET A;  3VF6 A;  4EAH D;  4J8F A;  2VGM A;  2Q36 A;  4KH5 A;  3CMA N;  2E2O A;  3CD6 N;  4A5B A;  1NGD A;  2QEX N;  2P9S A;  5BRH A;  3VTH A;  1XC3 A;  3BEX A;  2NRX A;  3Q7B A;  5JVG L;  4YOU A;  3RSE B;  3SAH A;  2QWM A;  2AP1 A;  1Z6R A;  3C6H A;  3FGU A;  4NO7 A;  2ITM A;  3WUH A;  4IJA A;  5AFU A;  4IOC L;  2P9I A;  2E2N A;  4OO1 J;  3HRG A;  4YOT A;  2FF6 A;  3GG4 A;  2WUS A;  4WFB L;  4H03 B;  1U6Z A;  2A41 A;  4IOX A;  4PL8 A;  3EE8 A;  4WYB A;  4PHT X;  3VEO A;  2ZGY A;  3L0Q A;  4O8U A;  3AAR A;  2E1Z A;  4A59 A;  2ASM A;  2HF3 A;  5BN9 A;  4B1X B;  3DLL L;  3TTC A;  4BRF A;  2Q1N A;  1NGA A;  4YOY A;  5GIN A;  2VCP A;  4YDU A;  1OKJ A;  1TUY A;  4JKG A;  1NLV A;  5FPM A;  4NB4 A;  3CCS N;  4FL9 A;  1OVY A;  3CPE A;  5B8H A;  3P39 A;  4L3Q A;  3ZET A;  4CBW A;  3ZX0 A;  5GAD P;  1V4T A;  2D4W A;  3MK6 A;  2VYP A;  3OA9 A;  3R8E A;  4IJN A;  1QQN A;  4JK9 A;  2CH5 A;  3B8A X;  3VOV A;  1YAG A;  5AQT A;  4BRL A;  5TKW A;  4A61 A;  3FZH A;  5C2F A;  1QZ6 A;  1YIT N;  3VTI A;  5BPL A;  1K8K A;  5AQO A;  4A62 A;  3F9M A;  3TTF A;  3CQY A;  3O1W A;  3MWT A;  4XEI A;  1O13 A;  3N4P A;  3ULE A;  1KAZ A;  4H0T B;  2F7T A;  3WXJ A;  3ZX2 A;  3KWI A;  3U9D A;  3D6R A;  4BVP A;  5JLH A;  1YI2 N;  1JCF A;  3G25 A;  4CBU A;  1S3X A;  3J7Z O;  3U9Z A;  3ZEU A;  4GV3 A;  2IVP A;  3EL2 A;  2NRZ A;  3CJA A;  1IJJ A;  2H3G X;  3DXK B;  5HL7 L;  2IIR A;  1GLC G;  3SJH A;  1X3N A;  5F1X A;  4FPB A;  3O6W A;  2P9N B;  4U7B A;  4JHD B;  1NGJ A;  4WF9 L;  5AQF A;  4AM6 A;  1VQP N;  5AQU A;  1YUW A;  1QQM A;  4BC4 A;  3A5O C;  2NRW A;  5BRF A;  2OTL N;  3CI5 A;  4JKB A;  1BU6 O;  2YHY A;  5E84 A;  5AQG A;  3UKU B;  3LDN A;  3QBW A;  4E1J A;  3CCQ N;  1Q7Y O;  4CZK A;  2CGJ A;  1YJ9 N;  4DQ8 A;  3TSQ A;  2PAV A;  1SS6 A;  3BF1 A;  3G6E N;  2Q97 A;  1KD1 O;  3MN6 A;  4QS7 A;  4B1Z A;  1NGB A;  4DB3 A;  2YHW A;  4AM7 A;  5KPZ A;  4H0V B;  1NGG A;  4DCH A;  3SAG A;  3CF5 L;  3CME N;  1Q18 A;  3C7N B;  4BRK A;  3QFU A;  3AAQ A;  1VQ8 N;  4BG9 A;  4BR7 A;  3HOT A;  4A2B A;  1T6D A;  4R79 A;  1TYQ A;  3K9J A;  3O80 A;  2DPN A;  2V7Y A;  3KVG A;  3IMX A;  3WQU A;  4BRI A;  4I6M A;  1W97 L;  2ZWH A;  4GY2 B;  5GAE P;  4YOV A;  3H46 O;  1VQ5 N;  1E4F T;  1KC8 O;  1RGI A;  4BC2 A;  3E9L A;  3CJC A;  1GLF O;  3QB0 A;  4IFE A;  3I55 N;  5JMV A;  4JN4 A;  3ENB A;  5AR0 A;  5MLC Q;  3WT0 A;  2ZJQ L;  2BTF A;  3H45 C;  3I8B A;  3GL1 A;  2ASP A;  5BR9 A;  3MX5 A;  4IXC A;  4XH5 A;  2QM1 A;  3MN9 A;  4M7X A;  3SLC A;  3UKR A;  5AQM A;  5EVZ A;  3VEW A;  2IVO A;  3AY9 A;  4K42 A;  1K8A O;  3GBT A;  3O9S A;  4HWI A;  4CBX A;  4JAX A;  2GEM A;  5M1Q A;  2HBM A;  4BRN A;  5M1K A;  4ILJ A;  4YOW A;  2JWL A;  3O9T A;  4AF1 A;  4BRO A;  1E4G T;  2NZT A;  4QS9 A;  2P9U A;  4WQ4 A;  3VEZ A;  2BH1 A;  4ISE A;  1CZA N;  4PL7 A;  5GAH P;  1BA0 A;  5KPR A;  2I7P A;  3MDQ A;  2P9S B;  4JKF A;  2EWS A;  1YJW N;  2P9K A;  5AQY A;  4BRC A;  5AZI A;  4GV9 A;  1M1K O;  5C15 A;  3HTV A;  3DJC A;  2QWL A;  4LC9 B;  1MA9 B;  3D2E A;  2Q0U A;  4GVE A;  5JIC A;  2QWQ A;  4FOI A;  3C65 A;  3EZW A;  1MWM A;  4JKD A;  2NRV A;  3M1F A;  2GWJ A;  4RCH A;  3VPZ A;  4Z94 A;  3O4W A;  1KAX A;  3CC4 N;  1NGE A;  2P9I B;  1SQK A;  2D0P A;  3SK3 A;  3M3Z A;  2HBL A;  1DGK N;  4H5T A;  4A5A A;  4BGA A;  3CIP A;  4B9Q A;  4MO5 A;  4BRE A;  1M90 O;  1VQ9 N;  3HSC A;  4PKH A;  2A40 A;  2YJF A;  2E2P A;  4B1U B;  4WQ5 C;  5GIO A;  4ISG A;  3FE1 A;  2NNW A;  1GLJ O;  4BR5 A;  2QA4 N;  5C0Y A;  4OPA A;  1K9M O;  4IZ9 A;  3SBT A;  5ADX H;  4CZH A;  4DHY A;  1HLU A;  4OPH A;  2KLA A;  3AGR A;  1BA1 A;  1HKG A;  3H1V X;  2F9T A;  3CHW A;  3OBW A;  3F5T A;  3C6A A;  3O08 A;  4H0O A;  3W0L A;  5KQ8 A;  3ZET B;  1R59 O;  2PFU A;  3LDP A;  3MCP A;  2P9L B;  2P9P A;  3TU5 A;  3VES A;  3K9K A;  3ATU A;  2W41 A;  4WFN L;  3NMU A;  4FWR A;  4MDA A;  5GIP A;  2V51 B;  3IFR A;  4FWQ A;  4K43 A;  2Q2R A;  3MX2 A;  1G99 A;  4BQL A;  4U67 L;  3ENO A;  2GTD A;  4BRM A;  3Q7C A;  4JKE A;  3SBG A;  2E88 A;  5F0X A;  3VMF B;  3TPQ A;  2QI2 A;  3ATV A;  1D4X A;  2JWK A;  3PIP L;  4IO9 L;  2J4R A;  5LJV A;  1EO1 A;  3HZ6 A;  3UE5 A;  2QWR A;  3A5M C;  4YOR A;  1RDU A;  3ULE B;  4CZL A;  3CCU N;  1ATN A;  3WQT A;  1JJ2 M;  4BVO A;  2YI1 A;  5AQW A;  3CCV N;  2QWO A;  5AZJ B;  5M1P A;  1C0F A;  4BC5 A;  3VGM A;  3QML A;  2V52 B;  3D2F B;  3ZEU B;  1RDW X;  2A42 A;  3IKM A;  3P4I A;  4O8K A;  3ENH A;  4JEP A;  3DXM A;  4O5F A;  1U2V A;  4MLE A;  5FPN A;  4CZE A;  2GWK A;  5C12 A;  3UB5 A;  1QZ5 A;  2Q0R A;  4IWV A;  3I56 N;  3CCL N;  5CR4 A;  1YJN N;  5BRD A;  3H6E A;  4JK7 A;  2A6A A;  3QDK A;  2QTD A;  3F2K A;  3BP8 A;  4H0X B;  5FPD A;  3MWP A;  3QFP A;  2E20 A;  3A5N C;  4WCE L;  1RFQ A;  4GNI A;  3RVC A;  2P9N A;  3JXU A;  2WBN A;  4BR2 A;  5GAG P;  3HI0 A;  4Y0W A;  4JHD A;  2FSK A;  1BDG A;  1X3M A;  4JKC A;  3WEE A;  1Y64 A;  3R1X A;  1S72 N;  3CJB A;  1IG8 A;  2V7Z A;  3N4Q A;  4DKW A;  5AQZ A;  4YDU C;  4MDB A;  3UKU A;  1MWK A;  4B1Y B;  5H1S Q;  3H3O B;  4GV6 A;  5AQR A;  3A8Y A;  1GLL O;  2OAN A;  3KZB A;  4B1W B;  1YVN A;  2YX6 A;  5AQH A;  4H5R A;  1TYQ B;  2W40 A;  3O5B A;  4BR0 A;  3O9Q A;  5DM7 L;  3FZK A;  5EX5 A;  1HKC A;  3HM8 A;  1S22 A;  1GLE G;  4I6M B;  3VGL A;  4WQ5 A;  4EFH A;  3C7N A;  3LM2 A;  1VQM N;  4CZJ A;  3LDL A;  3FZL A;  3CC2 N;  3CCJ N;  2FXU A;  3AAP A;  3O1B A;  3WXM B;  5KPT A;  3SMP A;  5AQQ A;  1GLB G;  1P8Z A;  2GEL A;  5EOY A;  2NRH A;  3CCR N;  4G9Z A;  1QQO A;  3VEX A;  4C23 A;  1SAZ A;  3IUC A;  3LDO A;  2FSJ A;  3TSP A;  4BRG A;  4FVU A;  3EKS A;  3UKR B;  5AQN A;  3GOI A;  3S41 A;  1HPM A;  4FWM A;  3GDQ A;  3O9R A;  4FOE A;  4BR4 A;  3L6Q A;  4IEI A;  1H1V A;  2NRT A;  3BUZ B;  1XQS C;  2I7N A;  2HMP A;  4HTL A;  4IO8 A;  4JD2 A;  3CQX A;  1NGH A;  4K25 A;  4YOX A;  2BUP A;  4A57 A;  3R9P A;  1NBW A;  2P9U B;  3U8X A;  5I9E B;  3W3D A;  2D0O A;  3ID6 A;  1ATS A;  2FSN A;  2WFB A;  4A2A A;  3MN5 A;  5BPN A;  3L4I A;  1ZC6 A;  4BY9 C;  3WXL A;  4IEE A;  4UY8 O;  1JCG A;  2WC9 A;  5AZI B;  3HBT A;  4JKH A;  1DT9 A;  3VEY A;  2YHX A;  3P38 A;  2NRR A;  5M1F A;  5EY4 A;  3L4Q A;  4ILG B;  4BRP A;  4FWN A;  5BRE A;  2E1Y A;  3D2E B;  3VF2 A;  5ELZ A;  4BRD A;  1HJO A;  3I33 A;  4BG8 A;  3CJ9 A;  3FLC O;  3OBY A;  2E2Q A;  5AQL A;  1YIJ N;  3CCM N;  3CC7 N;  3LM9 A;  3EKU A;  5HOO A;  2ZF5 O;  4ILH A;  4JNE A;  3RSE A;  5AFU H;  4FWO A;  3O9U A;  3R3L A;  1NMD A;  4FO0 A;  3FR0 A;  3E9P A;  1GLA G;  4BQZ A;  3HOS A;  2AA4 A;  2QWN A;  2GX9 A;  1BOT O;  3T69 A;  1VQ4 N;  3JS6 A;  4JKG B;  4CZG A;  2ZJP L;  3E9O A;  4H0P A;  1BUP A;  1T6C A;  3H3N O;  1W2B M;  4WFA L;  4FPA A;  3VGK A;  4QS8 A;  5DM6 L;  5C10 A;  3EE9 A;  5LJW A;  1T44 A;  3SMS A;  3WXI A;  3VET A;  1N8R O;  4BC3 A;  1BWF O;  4CZI A;  1DEJ A;  5ADX A;  4BRA A;  4CJ7 A;  3IDH A;  4EHU A;  4H5V A;  3A5L C;  1HX1 A;  3CCE N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...