3BF1A

Type iii pantothenate kinase from thermotoga maritima complexed with pantothenate and adp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Type III pantothenate kinase
total genus 73
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf1A01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf1A02
3GBTA 4HWIA 1TUUA 4FSVA 5AQVA 1NGFA 1SQKA 2F9WA 2FF3B 5AZJB 3UE5A 4DB3A 2A6AA 3AY9A 4CJ7A 4XH4A 3VOVA 5EXWA 5FPEA 2Q31A 1IG8A 3JXUA 4BR4A 1HKCA 2KHOA 4BRPA 4JD2B 1ESVA 3WQTA 2PAVA 3CQXA 5JICA 1LCUA 3DAWA 2YHXA 3H1VX 1CZAN 3DXKA 1Z05A 3CQYA 3IUCA 4FWRA 5ADXA 3IDHA 4HTLA 4MO4A 4KBOA 5F2RA 5AQMA 1P8ZA 4DCHA 3MDQA 2P9IB 4BG8A 1BU6O 2GTDA 3ID8A 2GUPA 3EZWA 3CI5A 3ZEUB 1T6DA 5BRHA 5KQ8A 1YVNA 2GEMA 3O80A 2GWJA 3FZFA 2P9PB 4JD2A 3GDQA 5FPMA 5AQQA 3CHWA 1H1VA 3VGMA 4BRHA 3H6EA 2NRHA 2P9PA 2E2QA 2UYTA 1QQNA 2P9NB 4JN4A 3QMLA 2QM1A 2HF3A 2P9SB 4O8KA 1OKJA 2P9KA 4NB4A 1NWKA 3LDNA 3M6GA 3CJCA 4M63C 4K43A 1RGIA 1J6ZA 2E1YA 2A42A 1NGDA 1R59O 1RFQA 3FZLA 5JLFA 3GG4A 1GLCG 2DPNA 3U9ZA 5I9EB 3BF3A 3BUZB 3FZHA 4A61A 3VETA 4BRMA 3WXLA 5BRFA 2IVPA 3QFUA 5AQGA 1GLDG 4Y0WA 4AM6A 1BWFO 3R6MA 4A2AA 1XQSC 4EFHA 2QWOA 4CBXA 4IJAA 2D1KA 3WQUA 5AQHA 3AAQA 3ZX3A 1GLJO 3UB5A 2QXLA 4RCHA 3ZETA 2FSNA 3EL2A 3I8BA 2HOEA 1G99A 1QQMA 2FLOA 3VENA 4ISEA 1BDGA 1GLAG 2E1ZA 3F9MA 4JHDA 3VESA 2EWSA 3M3ZA 1KAYA 3EKUA 3CJBA 3W3DA 4I6MA 2ASPA 2V7ZA 4H0TB 4PKGA 4CD3A 2P9IA 3DWLA 5AQLA 1HKGA 3BF1A 1X9JA 3JS6A 5E84A 5AQZA 3WEEB 1YUWA 3A5LC 3ULEA 4XH5A 2P9NA 3LDQA 4BR9A 1JCFA 4XEIA 1X3NA 3M1FA 5AQXA 4BC5A 4RWTA 4BR7A 1GLLO 5BN9A 4QS7A 5AQKA 1NGIA 2AA4A 3A5OC 5EOYA 1BG3A 2QWLA 3UKRA 5KQDA 4PL8A 3LDOA 3D2EB 3LM9A 5LJWA 2CGLA 3DXMB 2P9LA 2WUSA 4FPAA 3SLCA 5BPNA 1XUPO 1NGHA 3D2FA 3L6QA 3C7NA 4H0XB 1DGKN 4I6MB 3WT0A 2ASOA 4JAXA 5F1XA 3L4IA 4BRDA 3CETA 1U2VB 2CGKA 4H0YB 4GNIA 1V4TA 2V52B 4BC3A 5TKYA 1Z6RA 1T44A 4DQ8A 2CH5A 3U4LA 2ZGYA 3LM2A 1NLVA 3DXMA 2VCPA 1QHAA 4NO7A 4PKIA 2YCHA 1SZ2A 3MN7A 2QWNA 4L3QA 4B1ZA 4WQ5C 3CJAA 2YJEA 3VEYA 1ZXOA 1KAXA 4ISFA 3U9DA 2GELA 4B1VA 2QW9A 1WUAA 2QWMA 5EY4A 2H3GX 4CZIA 2YHWA 2NLXA 4EHUA 3ATVA 1NGJA 1NGCA 5B8HA 4FL9A 3WXKA 3LDPA 2QWPA 1NGEA 1IJJA 3EO3A 1K8KB 3DXKB 3AARA 1MA9B 3FGUA 4B1XB 2AP1A 3H3OB 2V7YA 1E4GT 1MWKA 4XH1A 4BROA 2A3ZA 1DEJA 2BTFA 4BGBA 5BREA 3D2FB 4CZFA 3FZMA 2ZF5O 5FPDA 4BVPA 3QB0A 2CGJA 4BRIA 1ZC6A 3MN6A 3GL1A 1DKGD 4WQ4C 1BUPA 3S41A 3H1QA 3VEWA 3WXJA 2CH6A 2FSJA 5JMVA 3EKSA 3MN5A 3UKRB 4CBUA 2QWRA 4BRAA 3QICA 4CZKA 3B8AX 4M7YA 2OANA 2GWKA 3LDLA 5AQNA 3P4IA 3H45C 1NMDA 5E26A 5KPZA 4YDUC 1WOQA 3BEXA 4IO8A 4A62A 4EHTA 4C23A 2P9KB 1E4FT 4BC2A 1BO5O 3A0IX 1NGAA 2Q2RA 4QS8A 4CZJA 4EAHD 3G25A 3LL3A 3R8EA 3C0BA 3UKUB 1NM1A 4E1JA 1GLFO 2D4WA 4FWQA 2IVNA 4B1UB 5AQJA 2P9UB 3UKUA 3ZX2A 5KPRA 3VF2A 1TUYA 2HF4A 5AZIB 4CZMA 4H0VB 3VF4A 3HBTA 4BRCA 1TYQA 5F0XA 2VWBA 3J8AA 3VGKA 4ISGA 3VPZA 3VGLA 4IZ9A 3FFKB 2ITMA 5CE3A 3RSEB 2FSKA 3FZKA 3VEOA 2YHYA 4LC9B 3QDKA 3C7NB 3CIPA 1HUXA 3FR0A 4PKHA 3WEEA 4DHYA 1HJOA 4FWOA 4BR5A 2E88A 4IXCA 3W0LA 1SAZA 1TYQB 5EVZA 4JHDB 2A5XA 1HPMA 3WXIA 5AQTA 2E2NA 4H5WA 4BRKA 3HTVA 3MCPA 1NBWA 5BPMA 1Q18A 1HX1A 2IVOA 4CBWA 1T6CA 1LOTB 3O1BA 2Q97A 1QQOA 4BQZA 3FE1A 4WQ4A 3VF6A 1BOTO 3O1WA 1BA1A 3HM8A 4BRFA 4EIAA 5AQPA 1U2VA 4CI6A 3AAPA 5BN8A 3DJCA 2FF6A 3CJ7A 4A2BA 3KZBA 3GE1A 4BRGA 4CZEA 4MO5A 1KAZA 1YXQA 5AQIA 1MDUB 3ULEB 1V4SA 1NGBA 3ENOA 1HLUA 2I7NA 4BQLA 4FPBA 1C0FA 4H5TA 3KVGA 3O8MA 2Q0UA 3A5MC 5AQUA 4BREA 4F9OA 1Y64A 5EX5A 2A41A 4BRLA 3VEVA 1NGGA 2BUPA 2W41A 2D0OA 1S3XA 2D0PA 5AQSA 3ZETB 1BA0A 3MN9A 3QBWA 3H3NO 1HKBA 2Q0RA 3GOIA 2FXUA 3A8YA 4FWMA 3HZ6A 2I7PA 4FWLA 2ASMA 4FO0A 1JCGA 5AQRA 5AR0A 3TU5A 3BP8A 3ZX0A 4BGAA 4RTFD 3MMVA 3O4WA 1X3MA 3CJ1A 4FWKA 3ZEUA 2E2PA 2ZWHA 1ATRA 4H0PA 2A40A 5LJVA 4JNEA 3HI0A 4MLEA 5BR9A 4K25A 4K42A 2HMPA 2YJFA 1U6ZA 1ATSA 4H0OA 4AM7A 4K41A 2P9UA 3WUHA 3H46O 3D7EO 5AFUH 4BRNA 5AQWA 1YAGA 3VERA 3O08A 3ATUA 3CERA 3HSCA 4WYBA 5AFUA 1S22A 2E8AA 4BR2A 1EQYA 4YDUA 2ZGZA 5ELZA 4B1YB 1ZBSA 5AZJA 2F9TA 1ATNA 3A5NC 3QFPA 4H03B 1GLBG 4FWNA 4M7XA 3SJHA 2IIRA 3SK3A 2VYPA 3L0QA 4GY2B 5KPTA 3ENHA 2P9SA 3U8XA 3IFRA 1JCEA 4O5FA 1QZ6A 2E20A 1RDWX 4FOEA 3O5BA 4H5RA 5AZIA 3D2EA 4BVOA 3OHRA 5BRDA 2QWQA 3MK6A 1D4XA 2P9LB 3CJ9A 4BG9A 2PBDA 1C0GA 4CZGA 4IWVA 2NZTA 4FWPA 1QZ5A 4IJNA 5FPNA 4B1WB 4FOIA 3IMXA 5AQYA 2Q36A 2Q1NA 4H5NA 1KXPA 4BRQA 5AQFA 1XC3A 4FWSA 3TPQA 4CD1A 1GLEG 3R9PA 3SMSA 4PL7A 3VEXA 4BR0A 5LY3A 2V51B 4CZLA 2YI1A 3FLCO 3O6WA 3QBXA 2E2OA 4J8FA 3SMPA 4H5VA 5JLHA 4MLHA 3KHYA 5BPLA 3RSEA 3VEZA 3EN9A 3I33A 4B9QA 1MWMA 2W40A 4WQ5A 4CZHA 5AQOA 4Z94A 1K8KA 5ADXH 4QS9A 2J4RA 4BC4A
chains in the Genus database with same CATH superfamily
4HWIA 3PV8A 4FSVA 1SL2A 1K9MO 1NGFA 4BDYA 2YHAA 1IO2A 3UE5A 1LWCA 5CYMA 2A6AA 2ZJQL 4X64K 4X66K 5EXWA 4CW7B 3QINA 3VMFB 1IG8A 3JXUA 1X1PA 1YIJN 3KLIA 2BE2A 4ILJA 3CQXA 1LCUA 1M90O 3AA3A 4KHPK 4GV9A 4CK2A 2HHQA 1Z05A 1OH8A 3IUCA 2P5GA 3IDHA 1P8ZA 3I0RA 3ID8A 3VQPA 2O8EB 1VHXA 5BRHA 1HNXK 1YVNA 1RDUA 3K9KA 4A5BA 3HP9A 4DSJA 2P9PB 4JD2A 3TAQA 3AO1A 3P5JA 3OYNA 3R3LA 5HL7L 1H1VA 2O8FA 2NRHA 3T1YK 2UYTA 4CIFA 2P9NB 3K57A 3QMLA 4DQRA 5FDLA 2P9SB 4YY3K 1OKJA 4FJIA 4KRFA 1TAQA 2FBVA 1NWKA 3DOKA 1ZBIA 1YT3A 4K43A 4BY9C 4I2PA 1NKEA 1TAUA 1GLCG 2O8CB 1ASUA 1NK9A 3VQCA 1T05A 4FM0A 1YHQN 3KK2A 3CC4N 3RR8A 1FKOA 4RW9A 5KRSA 1XQSC 5M1NA 2D1KA 4LF5K 1HNIA 1GLJO 3QNNA 1S9GA 4JKGA 3ZETA 1FK9A 3CCQN 4FM2A 5HP1A 2HOEA 3LP3A 3ZT3A 3HL8A 4QAGA 1BDGA 2E1ZA 2EWSA 1W0HA 4KPYA 3O9TA 1J5OA 4JRQA 2G8VA 4YNQA 4PY5A 3JYTA 4PKGA 3U6FA 1S1WA 3DWLA 3JS6A 4I2QA 1NMNA 5GAHP 2HSTA 4OX9K 3ULEA 3KWIA 3E9LA 3K2PA 4HTUA 1X3NA 1Q86O 1WSEA 2B4JA 5J2QA 1ITGA 3AVCA 5BN9A 4QS7A 5AQKA 4CGJA 5EOYA 1JL1A 1C6VA 4LSLA 1QSLA 2KZMA 3TTDA 4PL8A 3P39A 1SKRA 1VQ8N 2CGLA 3DXMB 2WUSA 4E7IA 4DSEA 3D2FA 3M8SA 2HHVA 5F1XA 3D45A 3CETA 2CGKA 4H0YB 4JI0K 3VQ8A 1Z6RA 2ZGYA 3SBTA 1Y97A 1NLVA 3CFRA 2VCPA 1FXXA 1QHAA 4NO7A 5C42A 3CQ8A 3OYCA 1Q82O 3ASMA 4YOUA 1SZ2A 3LP0A 4DTPA 4DFJA 3VEYA 5I42A 2OYQA 5JS2A 4FJXA 4LF8K 3ZSXA 4CZIA 2YHWA 4B3OA 4EHUA 1HR0K 2PZSA 2HBLA 1QHTA 1EWQA 4GVEA 3WXKA 4DR2K 2QWPA 3NVMA 3VQBA 1IJJA 3EO3A 2F96A 1K8KB 3DXKB 4DLEA 2P5OA 4DSKA 1MA9B 4B1XB 3TTFA 5AJ3K 4B9LA 3OJSA 2V7YA 1JJ2M 3QEVA 2A3ZA 2OZSA 3QB0A 1ZC6A 4WQ4C 1DKGD 4JI3K 1BUPA 1N5YA 3CFOA 3T1AA 2CH6A 3KK3A 3EKSA 1EWRA 5C25A 3CCRN 1W2BM 2VGNA 2QWRA 3ZLJA 1VSHA 4FJLA 4KHNA 4OPJA 3KLFA 1RT1A 4JI6K 4DTJA 1E3MA 3P4IA 4FK4A 5GIOA 3HXMA 4YDUC 3HOSA 1F21A 3CFPA 3THWA 3OA9A 4EHTA 2FC0A 2P9KB 4DQSA 4DMNA 3C94A 2UXBK 1QTMA 1NGAA 5FRNA 4B9TA 3P38A 2W6KA 2X6SA 3LL3A 3QEWA 5IT9O 4E1JA 1GLFO 5AQJA 4CGGA 1J9AA 4AHSA 2ZD1A 3L2RA 3LAMA 1TYQA 5CY4A 4F3OA 4C8NA 2XRIA 4IZ9A 4FLWA 3V9XA 3O9QA 2FSKA 3CC2N 3SQ1A 2YV0X 4CJTA 1WSIA 4YORA 3RRGA 4PKHA 4JKBA 4OKJA 3QESA 1SAZA 4FW1A 2E6MA 4H5WA 3SBGA 1Q81O 1NBWA 5J2NA 2BGGA 1HX1A 4WF9L 1KQSM 1LOTB 4M3ZA 1RTHA 3EEQA 2Q97A 3N4QA 3THYA 1VQON 4W5OA 1NK0A 3VF6A 4BRFA 1BA1A 4M3YA 3S9HA 5AQPA 4I9QA 1JLCA 2FF6A 3CJ7A 3GE1A 2O8BA 3HYFA 3F73A 1YJNN 5AQIA 1MDUB 1HQEA 3AVKA 2OPSA 3ENOA 1S1UA 1NKBA 4FPBA 1C0FA 4OPAA 3O8MA 4PWDA 4CHPA 5AQUA 4BREA 4CJWA 1WAJA 4ID5A 4JYAK 2QK9A 3VTIA 3I0SA 3KD5E 2D0OA 2FBXA 5FLXO 4ICLA 2Y1IA 3K5OA 3ZETB 4JS4A 3MN9A 3A8YA 5HBMA 1VQMN 2I7PA 4M3XA 1JCGA 5AR0A 3TU5A 4BGAA 3S3OA 4I9LA 4FJJA 3G10A 5KGWA 3THXB 1X3MA 2HNYA 4CF9A 4R79A 4H0PA 2A40A 1QVFM 4JNEA 4CGIA 1U6ZA 1L3TA 4AM7A 2YKNA 2OPQA 4IOAL 1IBMK 1NK6A 2UUBK 4F4KA 1B9DA 1A5WA 1LAWA 4OJRA 1HYSA 3OYHA 2OCEA 1YAGA 3O08A 4WYBA 3HSCA 2IDOA 2UU9K 3KLHA 2E8AA 5C24A 4YDUA 3EZ5A 1C0TA 4Z4IA 2F9TA 3A5NC 3J80O 4LFAK 1RILA 2YNFA 4DFKA 1GLBG 4FWNA 3OW2M 1VSFA 3L0QA 4B3MK 5K14A 3IFRA 2F8TA 4C8MA 4K8XA 4L8RB 4FZXC 1RDWX 4TSXA 3TARA 3O5BA 1GOBA 3RMBA 4CFAA 5AZIA 4IFEA 3OHRA 5HROA 5BRDA 1LV5A 3WNEA 1QSYA 3CJ9A 3DRPA 3L8BA 4AHUA 1YF5L 4W5QA 2NZTA 4FWPA 3NH1A 5FPNA 1BQMA 2IS3A 4B1WB 2GUIA 4FOIA 3IMXA 5AQYA 3J7YP 4B9UA 5C2DA 2E6LA 3CG7A 1C0UA 3C65A 5AQFA 4O8UA 4KTWA 3PLAA 4GV3A 5M1PA 1GLEG 3VQAA 2OTLN 3VEXA 4BR0A 3O6WA 2E2OA 2P1JA 1HMVA 1LW2A 4H5VA 2PYJA 1I94K 1DT9A 5JLHA 3AGKA 3AVFA 5BPLA 3TAEA 3CCVN 3CC7N 3LPUA 3EN9A 3I33A 3OYJA 5LMUK 1MWMA 3TAMA 4BDZA 4AHCA 5ADXH 2J4RA 4BC4A 3VQ9A 2HHHK 2KW4A 3KWGA 1S72N 3O3FA 5D3GA 1A5VA 2F9WA 1D9FA 5AZJB 4DB3A 5HRPA 4ZTFA 4IBNA 4IFVA 3QO9A 2Q31A 4NLCA 1S5JA 3AO5A 3F5TA 4CJRA 2O4IA 1ESVA 1WN7A 3WQTA 2PAVA 1SS6A 4JKHA 3DAWA 4JI2K 3OYKA 1CZAN 3DXKA 3E01A 2HBMA 5ADXA 4CFDA 3V9WA 5KI6A 3E9OA 4JKEA 2P9IB 3OYIA 4JI8K 4KTQA 5KQ8A 3ZEUB 4E7HA 1T6DA 4HHTA 4JI7K 3SAHA 4JKCA 4BDPA 3PSIA 1EP4A 3GDQA 4OPKA 5J2MA 3SV4A 3L2WA 1O1WA 3CHWA 4CF1A 3ZT2A 3H6EA 4AHTA 4CVNE 2QA4N 2E2QA 1QQNA 4JN4A 2QM1A 1D9DA 3VQ6A 2HF3A 1VQ9N 2P9KA 4CEEA 2UUCK 3ULDA 3CJCA 5HRRA 1RGIA 1RDDA 3AA4A 3MECA 4GKKK 1JL2A 3KJVA 4BACA 4Z4CA 1NGDA 1SL0A 3FZLA 1CLQA 2DPNA 1DLOA 2HHTA 4CFBA 3BUZB 4A61A 4DR3K 3ZYYX 3WXLA 2IVPA 3QFUA 4DTRA 5AQGA 3MXIA 2BH1A 3F9KA 3UB5A 3K5MA 2QEXN 3HSTB 1Q8IA 2FSNA 3G71N 1QQMA 2FLOA 3LZJA 1UWBA 3VENA 4FJ5A 3C95A 3F2KA 3M3ZA 4DS5A 3EKUA 1VQ6N 4BE1A 4I6MA 3LZIA 4KO0A 2V7ZA 4H0TB 1FJGK 1TVRA 1NJYA 2P9IA 4DR6K 3P83D 5AQLA 1HKGA 3BF1A 1J54A 1X9JA 1LW0A 3PX4A 2HHUA 3A5LC 4XH5A 2P9NA 4OPHA 1NK8A 3THYB 3ITHA 3LDQA 3O9RA 3HO1A 4CK1A 4BC5A 3M1FA 1TK8A 4IOXA 1EXQA 3AVLA 1KTQA 2NNWA 4CHOA 3NFAA 3V4IA 1KFSA 5KQDA 3AO4A 2ZQBA 2QI2A 3LM9A 2P9LA 3N4PA 4JKAA 1KRPA 1YITN 1KLMA 3CMEN 4LF7K 3SLCA 5BPNA 3S3MA 4DR4K 3L6QA 1J5EK 1IBLK 4I6MB 4JAXA 4MFBA 3RMAA 1EX4A 4NYNA 4B9MA 3EE9A 4OGCA 4GNIA 1V4TA 2FBTA 3K9JA 4JKGB 3IRXA 4B3TK 2CH5A 1W9HA 3LM2A 3ZT4A 4WE1A 3ID6A 3LAKA 4CF0A 2F4VK 3CPEA 1ZXOA 4GKJK 1KAXA 4IDKA 3OYAA 4FJKA 3BZKA 4DV4K 3TSPA 4B1VA 2QWMA 1WUAA 3JAMO 1REVA 5EY4A 5C2FA 3SUNA 1VQ5N 4FL9A 3HPOA 3H3OB 1NK7A 2A1RA 4J2AA 3K0SA 1E4GT 1W97L 4BROA 1QS4A 3JSMA 3QEPA 2UXCK 3LDSA 3KTQA 4BVPA 1U04A 2B6AA 3CCMN 3T19A 3S41A 3H1QA 5M1KA 3VEWA 2JWKA 3LANA 3MN5A 4JI1K 4BRAA 3O4QA 1NJIO 4DF4A 1NG9A 5FRMA 4G1QA 3TWHA 4M7YA 2OANA 2GWKA 3LDLA 4K8ZA 1Q9XA 3HJFA 5KPZA 1YI2N 5IWAK 4ELVA 4A62A 4C23A 2VQFK 1E4FT 1U48A 3A0IX 3CCSN 2Q2RA 3E66A 3VN5A 4KB1A 4Y1DA 4UY8O 1BI4A 3G25A 3T69A 1OH7A 3UKUB 3SAFA 3HVRA 2D4WA 4FWQA 2IVNA 5GINA 5KPRA 1Z26A 3UKUA 1RBTA 3VF2A 4W5RA 3EYZA 1TUYA 2HF4A 2RKIA 4IEEA 4M3WA 4N41A 4FJGA 1JLBA 1RBSA 1BCOA 1RBRA 4QOZB 3FFIA 3VA3A 5CE3A 3TABA 2IGIA 1T03A 1BCMA 3QDKA 4FJ9A 3THWB 3CIPA 3FR0A 3A2FA 4HUFA 3AVGA 3C6UA 1NU0A 3HPGA 3NF6A 2OA8A 4V19S 3E1YA 4FJ8A 2A5XA 1HPMA 3WXIA 5AQTA 1BHLA 1I39A 4FVMA 1YVUA 4O55A 4E1NA 3ZT0A 1RT7A 4CGDA 1UA0A 4YOXA 4EP5A 1X9MA 3O1BA 1QQOA 4O0IA 3RMCA 4BQZA 3ISNC 4CE9A 3L2QA 2Q3SA 4WQ4A 4E89A 3O1WA 3QETA 3J7ZO 1RT6A 4I7FA 4ZHRA 4EIAA 1HPZA 3AAPA 4DG1A 5BN8A 3DJCA 2HVHA 3V1RA 3V1QA 4BRGA 1WSJA 1B92A 1KCFA 2YNGA 4DR1K 1BQNA 3ULEB 2VWKA 4BQLA 4AQYK 1NK4A 3K59A 4H5TA 1GOCA 2Q0UA 3A5MC 5HRNA 1Y64A 2W42A 3OY9A 4BRLA 1NGGA 3DM2A 2BUPA 2D0PA 1BA0A 4AH9A 4ID1A 2FXUA 4DQQA 3ENBA 3DMJA 4FO0A 4FLYA 2PYLA 3V9SA 3PUFA 5T7BA 4DV3K 3DLHA 4JK7A 3SZ2A 2F8SA 4AHVA 1JLEA 3CJ1A 1S1TA 1TK5A 2G8IA 4E7JA 2ZWHA 4DU4A 3HI0A 1Z25A 4K25A 4K42A 2R7YA 1HRHA 1ATSA 4F2SA 1VRUA 2RE2A 4DKWA 3I8DA 4X65K 5AFUH 2HNZA 4DQIA 3OYFA 4BRNA 4FZZA 3NHGA 4CGHA 3O3GA 4EZ9A 3C6AA 4CHQA 4B1YB 2G8UA 2ZGZA 1ZBSA 2VG6A 3SQ0A 4CGFA 3RTVA 4BWMA 4FVUA 1NKCA 1KVBA 3SJHA 2IIRA 3BY5A 2VYPA 4LH5A 1D8YA 4GY2B 5CR4A 2XHBA 4KTZA 3QEXA 4CHYA 3G6EN 1OH6A 3MEGA 4M45A 2NRVA 2QWQA 3MK6A 2HMIA 1JLQA 2P9LB 4BG9A 2PBDA 1CXQA 2AJQA 1B9FA 1C0GA 1JLGA 3LP1A 4CZGA 4MQ3A 2RF2A 3CPWM 3RMDA 4IJNA 2Q36A 2Q1NA 2KTQA 1KXPA 4DV6K 3QEIA 2X74A 2FBYA 1XC3A 3TPQA 1RTJA 4ELUA 3R9PA 3SMSA 1N8RO 1NOYA 2YI1A 3QBXA 4J8FA 3SMPA 1S6QA 4MLHA 4YFUA 1VSIA 3RSEA 4DR5K 1M1KO 3SPZA 2PFUA 4M41A 4WQ5A 2W40A 4CJ5A 1N34K 1YTAA 4CEQA 2XY5A 3GBTA 3AO2A 2QKBA 5AQVA 4M42A 3AVAA 2FF3B 3NGZA 4FK0A 1BIUA 1HYZA 5C15A 4Y1CA 2IC3A 4U7BA 2BANA 3ZSOA 4BR4A 3DLLL 2KHOA 4BRPA 1VRTA 4JD2B 5H1SQ 2X78A 3Q7CA 5LMNK 1XI1A 4CEAA 5C10A 2YHXA 4ELTA 4JS5A 1VSEA 2HB5A 3PY8A 3PIOL 4HTLA 1UA1A 1X9WA 4FYDA 4JK9A 5AQMA 5HLFA 3MDQA 4BG8A 4CEBA 1YJWN 4O0JA 3EZWA 3CI5A 4A5AA 1U45A 3O80A 3FZFA 4JV5K 1K6YA 1KFDA 5FPMA 5AQQA 1VSLA 1TKTA 2Y1JA 4KREA 4KHUA 3BDPA 2WFBA 4FJHA 4DTNA 3OYEA 1EO1A 3HPHA 4Q5VA 3OBWA 5LL6Z 3AVHA 3SUOA 2KQ2A 3KLEA 3M6GA 3J7AP 4M63C 2QTDA 4CJFA 2P51A 1RFQA 3AVNA 1EETA 3GG4A 4B8AB 2DFFA 3SQ2A 3O3HA 1YTUA 4Z4EA 4JKDA 3FZHA 3VETA 4BRMA 1XMOK 1K73O 3AVIA 4B9VA 1GLDG 4BE2A 4Y0WA 1BWFO 1L5UA 4EFHA 2QWOA 1ZBFA 4E7LA 5AQHA 1RT3A 4YOWA 3SV3A 2ATQA 4RCHA 4CJUA 1N32K 3K5NA 3EL2A 4CEOA 1G99A 1WSGA 3WXMB 4ISEA 1GLAG 3C6HA 3F9MA 4OLAA 3M5RA 4GMJB 1KAYA 1LAVA 3W3DA 1GOAA 4CD3A 3DLBA 3CD6N 5AQZA 5E84A 1YUWA 2UUAK 4K0KK 3U3YA 4FZYA 4BR9A 2EX3A 2JLEA 4XEIA 5CHIA 3KLGA 2KFZA 3SPYA 1P90A 4ILHA 5GAGP 1NGIA 2AA4A 3A5OC 3OBYA 5DM7L 4DWIA 4MDAA 3UKRA 1EKEA 4M3UA 3BGRA 3D2EB 5DM6L 3PO4A 2DFEA 4JI4K 3CM6A 3SUPA 4X62K 5GIPA 4FPAA 3SCXA 3R1XA 4WFNL 1DGKN 4XIUA 2W6LA 3WT0A 1JKHA 1LWEA 3L4IA 4BRDA 3C6TA 1U2VB 4BC3A 2D0BA 3B6OA 3T7ZA 2O8FB 3DXMA 4FJ7A 4PKIA 3LP2A 3HOTA 1G15A 4WQ5C 4DV5K 2YJEA 1Q7YO 5JVGL 2DY4A 4ISFA 3P31A 1S1XA 3U9DA 5GADP 2O8EA 2GELA 1TL1A 2QW9A 2KFNA 2PY5A 3SJJA 3MX2A 2NUBA 4A59A 4EZ6A 1HJRA 3OVNA 3ATVA 1NGCA 5B8HA 3ZT1A 1QVGM 4J2DA 2HHXA 3CM5A 3LDPA 1NGEA 3WNHA 3O4NA 5JVHL 3AARA 2QKKA 2E4LA 1BGXT 3NF7A 3QERA 3M8RA 1HNZK 3DLEA 3D2FB 2NRWA 4CZFA 2YNIA 2ZF5O 2CGJA 3MN6A 5MLCQ 3SUQA 4DTOA 4RW6A 5C12A 3ZSWA 2OPRA 2FSJA 2XY7A 1XNQK 1ZYQA 2E5LK 5JMVA 1XNRK 3UKRB 5FROA 4DU1A 4PQUA 3SQ4A 3QICA 2HVIA 1RDCA 1IBKK 4CZKA 3VQ7A 2O8CA 1SV5A 4B9SA 2GX9A 5AQNA 2D0CA 4OKKA 1WOQA 3L3VA 4IO8A 4H8KA 1W7AA 3V9UA 1XHZA 4E0DA 3TAFA 2IAJA 4CHNA 4QS8A 3C0BA 1T7PA 3MWTA 4LY7A 4NLBA 4CEFA 5I3UA 1I3AA 2P9UB 3RR7A 4IEIA 1VSJA 2B5JA 4CZMA 4H0VB 1S1VA 4WCEL 4YOTA 4BRCA 5DK5A 2VWBA 3VPZA 4AF1A 4ISGA 3VGKA 1KLNA 4PUOA 1QQCA 2VGMA 3FFKB 1Q9YA 1BL3A 3IG1A 3L2VA 3MAQA 3RSEB 3FZKA 4F2RA 1JXBA 3VEOA 3HP6A 1XC9A 3LWMA 3C7NB 1D5AA 1HUXA 4FJNA 2KZZA 4C8LA 3B6PA 2WC9A 3DLRA 4DHYA 1WAFA 4BR5A 1JLFA 2E88A 2OZMA 2DTUA 1RNHA 4RW4A 3DLGA 4B8CA 4LF4K 1TYQB 3O9UA 5EVZA 4JHDB 4CEDA 1U4BA 2E2NA 3QIPA 3OYGA 4KHQA 4BRKA 1RT5A 1JLAA 3MCPA 3PIPL 3ZSVA 2IVOA 4ZTJA 3P1GA 1TK0A 3MXMA 1VSDA 4CCHA 3IKMA 3FE1A 2VWJA 3S3NA 3Q7BA 4NCAA 4UQGA 5BR8K 1BI4B 2NRTA 4A2BA 3KZBA 4DFPA 4MO5A 4EP4A 4PHTX 3AO3A 4DF8A 3TI0A 1HYVA 1V4SA 1TGOA 4CERA 4DV7K 4N56A 5EX5A 2WONA 4M3TA 3PX0A 4IFYA 2A41A 5M1QA 3VEVA 4O5BA 3DOLA 3PSFA 5AQSA 4LD0A 4G9ZA 5DMRA 2RPIA 2Q0RA 4FWMA 3ZCMA 3OYLA 4GW6A 4LFBK 4FK2A 4FWLA 3SAGA 3BP8A 4CECA 3MMVA 4M3RA 4CJ3A 1SKWA 4W5NA 3OS1A 3ZEUA 4DUYK 1IG9A 1ATRA 4NXMK 3U3GA 5A2QO 4MLEA 4KH4A 2YJFA 2ITGA 4NCGA 3ZSZA 2ZJPL 4FCYA 1S6PA 2P9UA 3WUHA 3H46O 3L4QA 4CF8A 3D7EO 3EY1A 1MU2A 1RBUA 3M8PA 1ASWA 5HRSA 3THVA 2G8KA 3H08A 3ATUA 3CERA 1S22A 1KSPA 4JK8A 3NDKA 4NYFA 1BISA 1XWLA 4JRPA 4FLTA 1CZBA 4Z0UA 3E9PA 4IKFA 3VQDA 1WBDA 3SK3A 4CJQA 2WTUA 5KPTA 2OTJN 3ENHA 3U8XA 1JCEA 3MXJA 1QZ6A 1TKZA 2E20A 4U67L 1OH5A 1VQ4N 3UIQA 3OYBA 3D2EA 1C0MA 2JGUA 3TANA 1VAZA 1D4XA 4KH5A 4IWVA 1R0AA 1L3SA 1KVCA 4FLZA 3QLHA 3J81O 4BE0A 3HVTA 4N47A 4CD1A 2O8DA 1TV6A 2HBJA 5LY3A 2V51B 4CZLA 3FLCO 3DRRA 5E41A 4KAZA 4DV0K 5KGXA 2ZM6K 3K58A 2GV9A 3VEZA 1ZBHA 4RW8A 3VQQA 4PA1A 4JEPA 1FW6A 4QS9A 1C1BA 1N36K 5CZ1A 1K8AO 1T3VA 4LF9K 3ZSRA 1TUUA 1ZBLA 3L3UA 1SQKA 2YNHA 4GVMA 5SZTA 3AY9A 4CJ7A 1N33K 4XH4A 1LWFA 4C8OA 2WOMA 3VOVA 3BZCA 3NGIA 3K5LA 5FPEA 4OVLA 2ZE2A 1HKCA 4JLHA 2WBNA 2G8FA 4E3SA 2XY8A 5JICA 4CESA 3H1VX 4IO9L 3NVKA 1T8EA 4GV6A 4DQPA 3CQYA 4FWRA 4DSIA 4F3TA 4CJ4A 4BWJA 4MO4A 4KBOA 5F2RA 3OYMA 4DCHA 3TAGA 1BU6O 2GTDA 2GUPA 3KIOA 4W5TA 5EU7A 2GEMA 4DS4A 2GWJA 5HOOA 4IOCL 3V6DA 1BIZA 4DFMA 1RDAA 2HNDA 2IOCA 2RN2A 3VGMA 4BRHA 4DTUA 3V1OA 2P9PA 2KKZA 3RVCA 2EHGA 1VQLN 2NRZA 5CYQA 1A5XA 4CEZA 3SYZA 3PO5A 4O8KA 1JXEA 3AGRA 4NB4A 3AVMA 3KKSA 3LDNA 1J6ZA 3KD1E 2E1YA 2A42A 3AA5X 4O44A 1R59O 4IG0A 3D6RA 5JLFA 3U9ZA 5I9EB 1KD1O 1HNVA 4OLBA 1U47A 3BF3A 4DR7K 2D0AA 5BRFA 4H4OA 2ZJRL 3NE6A 4B08A 4AM6A 3NF8A 1RT4A 3R6MA 4A2AA 3QNOA 4KI6A 2F7TA 4CBXA 1VQNN 4IJAA 3DI6A 3WQUA 4AILC 3AAQA 3ZX3A 4RW7A 4KB0A 1CZ9A 2QXLA 4R5PA 4OO1J 3I8BA 4Z4FA 1J53A 1RBVA 3LALA 4DTXA 1QE1A 3HRGA 4JHDA 3VESA 4DLGA 3CJBA 4WFBL 2ASPA 2RHKA 1OVYA 3IS9A 3WEEB 1NK5A 1HNWK 4N5SA 3T1HK 1JCFA 2G8HA 5TKWA 4RWTA 1NOZA 5AQXA 3HM9A 3VQ5A 4BR7A 3HT3A 4CIEA 3OTOK 1GLLO 4HCBA 4E1MA 1BG3A 2QWLA 4LH4A 3AVBA 3LDOA 3EE8A 5LJWA 3NH0A 4J2EA 4JKFA 1XUPO 1NGHA 3CCJN 3C7NA 4H0XB 1TL3A 4NCBA 5M1OA 4DSFA 4CJLA 4A57A 4FLUA 1TKXA 1WLJA 2ASOA 2YHBA 1SL1A 4CJPA 4HCCA 2JWLA 4E19A 2V52B 1KVAA 5TKYA 1T44A 4DQ8A 2HHSA 3VTHA 3U4LA 3TSUA 5J1EA 1S9EA 2O8DB 2YCHA 1WSFA 3MN7A 2LSNA 4B1ZA 2QWNA 4L3QA 4OGEA 4Z4HA 4AHRA 3CJAA 1IKVA 4B3SK 1KC8O 2HBKA 2H3GX 2OPPA 2NLXA 1NGJA 4C1NI 4NXNK 4WFAL 2VG7A 3FGUA 2AP1A 5M1FA 3T3FA 1RCHA 2QXFA 3CCEN 1MWKA 4XH1A 1RT2A 3THXA 2Z1JA 1DEJA 2BTFA 4BGBA 5BREA 3DYAA 3FZMA 5FPDA 3VA0A 1ZBUA 4BRIA 3GL1A 3MX5A 4CF2A 3WXJA 1WB9A 4RG8A 4CHZA 3NMUA 4JI5K 3KK1A 4CBUA 4CJVA 2UXDK 2YX6A 3QIOA 2YKMA 3B8AX 3IAYA 4FW2A 4H4MA 3H45C 1NMDA 5E26A 1C1CA 3BEXA 2A1SA 3VQ4A 4BC2A 2O8BB 1BO5O 4YOYA 4MDBA 2D5RA 4C1NK 3OYDA 3O9SA 1TKDA 3AA2A 4CZJA 4EAHD 3PX6A 3R8EA 3KK7A 1NNEA 4FM1A 3OJUA 1NM1A 1IV0A 3MCAB 1FKPA 4B1UB 4CJSA 1RTIA 3ZX2A 3CMAN 5AZIB 4HVJA 2NRXA 3VF4A 3HBTA 3LPTA 3TR8A 5F0XA 1VQPN 3J8AA 2VQEK 3WNFA 2HHWA 3VGLA 1ASVA 1DTTA 3NCIA 2KLAA 2ITMA 3LWLA 1U49A 3OS0A 1SUQA 2YHYA 4LC9B 5J2PA 1YJ9N 3ZSQA 3VQEA 2I5JA 3WEEA 1WSHA 1HJOA 4FWOA 4CJEA 4CJKA 4YOVA 3G4SN 4FLVA 3NAEA 1XHXA 3OS2A 4IXCA 2XO7A 3MEEA 3W0LA 3TSQA 1IKXA 3AVJA 4CIGA 1WBBA 2DFHA 3HTVA 3V9ZA 4B3RK 5BPMA 1Q18A 1VK0A 4CBWA 1T6CA 4FXDA 1BOTO 3HM8A 4FJMA 1U2VA 4CI6A 4LSNA 1VQKN 4YHHK 4CZEA 4OKEA 1KAZA 4KV8A 1YXQA 2NRRA 1VQ7N 1NGBA 1HLUA 2ETJA 2I7NA 3CXCM 3KVGA 5CZ2A 3SI6A 4C8KA 2Z1HA 4F9OA 4DV1K 4IG3A 3D0PA 4B9NA 1X9SA 2W41A 5JS1A 1S3XA 3CF5L 4J2BA 4E7KA 4N76A 4F8RA 4KH6A 1RDBA 3QBWA 3H3NO 1HKBA 3GOIA 3SNNA 3NBPA 4KFBA 3HZ6A 4Z4GA 1VSMA 1SKSA 2ASMA 5AQRA 3RWUA 3I56N 1OVQA 3ZX0A 3L2UA 2BDPA 4RTFD 3MEDA 4HUGA 3O4WA 4FLXA 4ILGB 1RTDA 5SWMA 3I55N 3TAPA 4FWKA 2E2PA 1NJWA 4IDHA 3DRSA 2X6NA 3M8QA 5LJVA 4DTSA 5BR9A 2HMPA 4CK3A 4DTMA 1VSKA 1C1AA 4H0OA 4LFCK 4K41A 1QSSA 3TTCA 3NH2A 4DSLA 1WNSA 4KHWA 3DLKA 5AQWA 5KRTA 1UAXA 4Q0BA 1IH7A 3VERA 3CCUN 5AFUA 1N6QA 1XMQK 4BR2A 1EQYA 5ELZA 5AZJA 2VG5A 1ATNA 3QFPA 4H03B 1ILYA 4M7XA 4O4GA 3NF9A 2XY6A 4QCLA 2Z1GA 3CCLN 4KI4A 3HK2A 4DU3A 2P9SA 4CFCA 2G8WA 4O5FA 5KTQA 3V81A 4FOEA 4H5RA 1NJZA 4DUZK 4BVOA 2O4GA 4KHSA 1NJXA 4DV2K 1UOCA 1L3VA 2GBZA 1IKYA 1HQUA 5GAEP 1QZ5A 3WNGA 3AV9A 1CXUA 3KKRA 4H5NA 3ZSYA 4BRQA 3RRHA 4FWSA 2HW3A 4KKOA 1L3UA 3NGYA 3ALYA 1IKWA 4PL7A 4KHYA 3KHYA 3MWPA 1DTQA 5C0YA 4B9QA 3CYMA 4CZHA 5AQOA 4Z94A 3G0ZA 1K8KA 1O13A 4LF6K 2Z1IA 4HUEA
chains in the Genus database with same CATH topology
3GBTA 4HWIA 3KWGA 1S72N 1TUUA 4FSVA 5AQVA 1K9MO 1NGFA 1SQKA 2F9WA 2FF3B 5AZJB 3UE5A 4DB3A 2A6AA 3AY9A 4CJ7A 2ZJQL 4XH4A 5C15A 3VOVA 4U7BA 5EXWA 5FPEA 2Q31A 3VMFB 1IG8A 3JXUA 4BR4A 4NLCA 1YIJN 3DLLL 1HKCA 2KHOA 2WBNA 3F5TA 4BRPA 4JD2B 5H1SQ 1ESVA 3Q7CA 4ILJA 2PAVA 3CQXA 1SS6A 4JKHA 1LCUA 3WQTA 3DAWA 5C10A 2YHXA 5JICA 1M90O 3H1VX 1CZAN 3DXKA 4IO9L 4GV9A 3NVKA 4GV6A 1Z05A 3CQYA 3IUCA 2HBMA 4FWRA 5ADXA 3PIOL 3IDHA 4HTLA 4MO4A 4KBOA 5F2RA 4JK9A 3E9OA 5AQMA 1P8ZA 4DCHA 3MDQA 2P9IB 4JKEA 4BG8A 1BU6O 2GTDA 1YJWN 3ID8A 2GUPA 3EZWA 3CI5A 3ZEUB 1T6DA 5BRHA 5KQ8A 1YVNA 1RDUA 4A5AA 3SAHA 3K9KA 4A5BA 2GEMA 3O80A 2GWJA 4JKCA 5HOOA 4IOCL 3FZFA 2P9PB 4JD2A 3GDQA 5FPMA 5AQQA 3R3LA 3CHWA 5HL7L 1H1VA 3VGMA 4BRHA 3H6EA 2NRHA 2QA4N 2P9PA 2E2QA 2UYTA 2KKZA 1QQNA 3RVCA 2P9NB 2WFBA 4JN4A 3QMLA 1VQLN 2QM1A 2NRZA 1EO1A 2HF3A 3OBWA 2P9SB 4O8KA 1VQ9N 1OKJA 2P9KA 3AGRA 4NB4A 1NWKA 3LDNA 3M6GA 3CJCA 4M63C 4K43A 1RGIA 4BY9C 1J6ZA 2QTDA 2E1YA 2A42A 1NGDA 1R59O 1RFQA 3FZLA 3D6RA 5JLFA 1GLCG 2DPNA 3GG4A 3U9ZA 5I9EB 1KD1O 4JKDA 3BF3A 3BUZB 3FZHA 4A61A 3VETA 3ZYYX 3WXLA 4BRMA 5BRFA 2IVPA 3QFUA 1K73O 5AQGA 2ZJRL 1YHQN 1GLDG 3CC4N 4Y0WA 4AM6A 1BWFO 3R6MA 4A2AA 2BH1A 1XQSC 4EFHA 1VQNN 2F7TA 2QWOA 4CBXA 4IJAA 2D1KA 3WQUA 5M1NA 5AQHA 4YOWA 3AAQA 3ZX3A 1GLJO 3UB5A 2QEXN 2QXLA 4RCHA 4JKGA 4OO1J 3ZETA 2FSNA 3EL2A 3I8BA 3G71N 3CCQN 2HOEA 1G99A 1QQMA 2FLOA 3WXMB 3VENA 4ISEA 1BDGA 3C6HA 1GLAG 2E1ZA 3F2KA 3F9MA 3HRGA 4JHDA 3VESA 2EWSA 3M3ZA 3M5RA 1KAYA 3EKUA 3CJBA 3O9TA 3W3DA 1VQ6N 4I6MA 4WFBL 2ASPA 2V7ZA 4H0TB 4PKGA 4CD3A 2RHKA 1OVYA 2P9IA 3DWLA 3CD6N 5AQLA 1HKGA 3BF1A 1X9JA 3JS6A 5E84A 5AQZA 3WEEB 2HSTA 1YUWA 5GAHP 3A5LC 3ULEA 3KWIA 2P9NA 4OPHA 4XH5A 3E9LA 3LDQA 4BR9A 1JCFA 3O9RA 5TKWA 4XEIA 1X3NA 3M1FA 5AQXA 4BC5A 4RWTA 5CHIA 1Q86O 4IOXA 4BR7A 1P90A 1GLLO 5BN9A 4ILHA 2NNWA 4QS7A 5AQKA 5GAGP 1NGIA 2AA4A 3A5OC 3OBYA 5EOYA 5DM7L 4MDAA 1BG3A 2QWLA 3UKRA 5KQDA 3TTDA 4PL8A 3LDOA 2QI2A 3D2EB 3EE8A 3LM9A 3P39A 5LJWA 5DM6L 1VQ8N 2CGLA 3DXMB 2P9LA 3N4PA 5GIPA 2WUSA 4JKAA 4JKFA 4FPAA 1YITN 3CMEN 3SLCA 5BPNA 1XUPO 3R1XA 1NGHA 4WFNL 3D2FA 3L6QA 3CCJN 3C7NA 4H0XB 1DGKN 4I6MB 1K8AO 5M1OA 3WT0A 4A57A 2ASOA 4JAXA 5F1XA 3L4IA 4BRDA 3CETA 3EE9A 1U2VB 2CGKA 2JWLA 4H0YB 4GNIA 1V4TA 2V52B 3K9JA 4BC3A 5TKYA 1Z6RA 4JKGB 1T44A 4DQ8A 3VTHA 3T7ZA 2CH5A 3U4LA 3TSUA 2ZGYA 3LM2A 3SBTA 1NLVA 3DXMA 2VCPA 1QHAA 4NO7A 4PKIA 1Q82O 2YCHA 1SZ2A 3ID6A 2QWNA 3MN7A 4L3QA 4YOUA 4B1ZA 3HOTA 4WQ5C 3CJAA 2YJEA 3CPEA 1ZXOA 3VEYA 1Q7YO 5JVGL 1KAXA 4ISFA 3P31A 3U9DA 3TSPA 1KC8O 5GADP 2HBKA 2GELA 4B1VA 2QW9A 1WUAA 2QWMA 5EY4A 2H3GX 3MX2A 4CZIA 4A59A 5C2FA 2YHWA 2NLXA 4EHUA 3ATVA 1NGJA 1NGCA 5B8HA 2HBLA 1QVGM 1VQ5N 4FL9A 4C1NI 4GVEA 3WXKA 3LDPA 2QWPA 1NGEA 3NVMA 1IJJA 3EO3A 1K8KB 3DXKB 4WFAL 5JVHL 3AARA 1MA9B 3FGUA 4B1XB 2AP1A 3TTFA 5M1FA 3H3OB 2V7YA 1JJ2M 3CCEN 1E4GT 1MWKA 1W97L 4XH1A 4BROA 2A3ZA 1DEJA 2BTFA 4BGBA 5BREA 3D2FB 2NRWA 4CZFA 3FZMA 2ZF5O 5FPDA 4BVPA 3QB0A 2CGJA 4BRIA 1ZC6A 3MN6A 5MLCQ 3GL1A 1DKGD 4WQ4C 3CCMN 3MX5A 1BUPA 3S41A 3H1QA 5C12A 3VEWA 5M1KA 2JWKA 3WXJA 2CH6A 2FSJA 5JMVA 3NMUA 3EKSA 3MN5A 3UKRB 3CCRN 4CBUA 1W2BM 2VGNA 2QWRA 4BRAA 2YX6A 3QICA 1NJIO 4CZKA 3B8AX 4M7YA 2OANA 2GX9A 2GWKA 3LDLA 5AQNA 3P4IA 3H45C 5GIOA 1NMDA 5E26A 5KPZA 4YDUC 3HOSA 1YI2N 1WOQA 3BEXA 3OA9A 4IO8A 4A62A 4EHTA 4C23A 2P9KB 1E4FT 4BC2A 1BO5O 4YOYA 4MDBA 3A0IX 4C1NK 1NGAA 3CCSN 2Q2RA 3E66A 3O9SA 4QS8A 4CZJA 4UY8O 3P38A 4EAHD 3G25A 3LL3A 3R8EA 3KK7A 3C0BA 3T69A 3MWTA 3UKUB 1NM1A 4E1JA 4NLBA 3MCAB 3SAFA 1GLFO 2D4WA 4FWQA 2IVNA 4B1UB 5AQJA 5GINA 2P9UB 3UKUA 3ZX2A 5KPRA 4IEIA 3VF2A 3CMAN 1TUYA 2HF4A 4IEEA 5AZIB 2NRXA 4H0VB 4CZMA 3VF4A 4WCEL 3HBTA 4YOTA 4BRCA 1TYQA 5F0XA 2VWBA 1VQPN 3J8AA 3VGKA 4ISGA 3VPZA 4AF1A 3VGLA 2VGMA 4IZ9A 3FFKB 2KLAA 2ITMA 5CE3A 3O9QA 2FSKA 3FZKA 3RSEB 3CC2N 3VEOA 2YHYA 4LC9B 3QDKA 3C7NB 1YJ9N 3CIPA 1HUXA 4YORA 3FR0A 4PKHA 2WC9A 3WEEA 4DHYA 4JKBA 1HJOA 4FWOA 4BR5A 2E88A 4YOVA 3G4SN 4IXCA 3E1YA 3W0LA 1SAZA 1TYQB 3O9UA 5EVZA 4JHDB 3TSQA 2A5XA 1HPMA 3WXIA 5AQTA 2E2NA 4H5WA 3SBGA 4BRKA 3HTVA 1Q81O 3MCPA 1NBWA 3PIPL 5BPMA 1Q18A 1HX1A 2IVOA 4WF9L 4CBWA 1KQSM 1T6CA 1LOTB 4YOXA 3O1BA 2Q97A 1QQOA 3N4QA 3IKMA 4BQZA 1VQON 3FE1A 4WQ4A 3VF6A 1BOTO 3O1WA 1BA1A 3HM8A 4BRFA 3J7ZO 4EIAA 5AQPA 1U2VA 3Q7BA 4CI6A 3AAPA 5BN8A 1VQKN 3DJCA 2FF6A 2NRTA 3CJ7A 4A2BA 3KZBA 3GE1A 4BRGA 4CZEA 4MO5A 1KAZA 1YJNN 1YXQA 4PHTX 2NRRA 5AQIA 1MDUB 3ULEB 1VQ7N 1V4SA 1NGBA 3ENOA 1HLUA 2I7NA 4BQLA 4FPBA 1C0FA 4H5TA 3KVGA 4OPAA 3O8MA 3CXCM 2Q0UA 3A5MC 5AQUA 4BREA 4F9OA 1Y64A 5EX5A 2A41A 5M1QA 3VEVA 4BRLA 1NGGA 2BUPA 3VTIA 2W41A 2D0OA 1S3XA 2D0PA 5AQSA 3CF5L 4G9ZA 4KH6A 3ZETB 1BA0A 3MN9A 3QBWA 3H3NO 1HKBA 2Q0RA 2FXUA 3GOIA 3A8YA 4FWMA 3HZ6A 3ENBA 1VQMN 2I7PA 4FWLA 2ASMA 4FO0A 1JCGA 5AQRA 3SAGA 5AR0A 3TU5A 3I56N 4JK7A 3BP8A 3ZX0A 4BGAA 4RTFD 3MMVA 3O4WA 4ILGB 3I55N 1X3MA 3CJ1A 4FWKA 3ZEUA 2E2PA 4IDHA 4R79A 2ZWHA 1ATRA 4H0PA 2A40A 5LJVA 4JNEA 3HI0A 1QVFM 4MLEA 5BR9A 4K25A 4K42A 2HMPA 4KH4A 2YJFA 1U6ZA 1ATSA 4H0OA 4AM7A 2ZJPL 2RE2A 4DKWA 4K41A 4IOAL 2P9UA 3WUHA 3H46O 3L4QA 3TTCA 3D7EO 5AFUH 4BRNA 5AQWA 1YAGA 3VERA 3O08A 3ATUA 3CERA 3HSCA 4WYBA 3CCUN 5AFUA 1S22A 2E8AA 3C6AA 4BR2A 1EQYA 4JK8A 2ZGZA 4YDUA 5ELZA 1ZBSA 4B1YB 5AZJA 2F9TA 1ATNA 3A5NC 3QFPA 4H03B 3E9PA 1ILYA 1GLBG 4FWNA 4FVUA 4M7XA 3OW2M 3SJHA 2IIRA 3SK3A 2VYPA 3CCLN 3L0QA 4GY2B 5CR4A 5KPTA 2OTJN 3ENHA 2P9SA 3U8XA 3IFRA 1JCEA 4O5FA 1QZ6A 2E20A 4U67L 3G6EN 1RDWX 4FOEA 3O5BA 4H5RA 1VQ4N 5AZIA 3D2EA 4IFEA 4BVOA 3OHRA 2NRVA 5BRDA 2QWQA 1VAZA 1D4XA 3MK6A 2P9LB 3CJ9A 4BG9A 2PBDA 4KH5A 1C0GA 1YF5L 4IWVA 4CZGA 2NZTA 4FWPA 5GAEP 1QZ5A 3CPWM 4IJNA 5FPNA 4B1WB 4FOIA 3IMXA 5AQYA 2Q36A 2Q1NA 4H5NA 5C2DA 1KXPA 3C65A 4BRQA 5AQFA 1XC3A 4O8UA 4FWSA 3TPQA 4CD1A 3PLAA 4GV3A 5M1PA 1GLEG 3R9PA 3SMSA 1N8RO 2OTLN 4PL7A 3VEXA 4BR0A 2HBJA 5LY3A 2V51B 4CZLA 2YI1A 3FLCO 3O6WA 3QBXA 2E2OA 4J8FA 3SMPA 4H5VA 1DT9A 5JLHA 4MLHA 3AGKA 3KHYA 5BPLA 3CCVN 3RSEA 3MWPA 1M1KO 5C0YA 3CC7N 3VEZA 3EN9A 3I33A 4B9QA 2PFUA 1MWMA 2W40A 4WQ5A 4CZHA 5AQOA 4Z94A 4JEPA 1K8KA 1O13A 5ADXH 4QS9A 2J4RA 4BC4A 1T3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GBT A;  4HWI A;  1TUU A;  4FSV A;  5AQV A;  1NGF A;  1SQK A;  2F9W A;  2FF3 B;  5AZJ B;  3UE5 A;  4DB3 A;  2A6A A;  3AY9 A;  4CJ7 A;  4XH4 A;  3VOV A;  5EXW A;  5FPE A;  2Q31 A;  1IG8 A;  3JXU A;  4BR4 A;  1HKC A;  2KHO A;  4BRP A;  4JD2 B;  1ESV A;  3WQT A;  2PAV A;  3CQX A;  5JIC A;  1LCU A;  3DAW A;  2YHX A;  3H1V X;  1CZA N;  3DXK A;  1Z05 A;  3CQY A;  3IUC A;  4FWR A;  5ADX A;  3IDH A;  4HTL A;  4MO4 A;  4KBO A;  5F2R A;  5AQM A;  1P8Z A;  4DCH A;  3MDQ A;  2P9I B;  4BG8 A;  1BU6 O;  2GTD A;  3ID8 A;  2GUP A;  3EZW A;  3CI5 A;  3ZEU B;  1T6D A;  5BRH A;  5KQ8 A;  1YVN A;  2GEM A;  3O80 A;  2GWJ A;  3FZF A;  2P9P B;  4JD2 A;  3GDQ A;  5FPM A;  5AQQ A;  3CHW A;  1H1V A;  3VGM A;  4BRH A;  3H6E A;  2NRH A;  2P9P A;  2E2Q A;  2UYT A;  1QQN A;  2P9N B;  4JN4 A;  3QML A;  2QM1 A;  2HF3 A;  2P9S B;  4O8K A;  1OKJ A;  2P9K A;  4NB4 A;  1NWK A;  3LDN A;  3M6G A;  3CJC A;  4M63 C;  4K43 A;  1RGI A;  1J6Z A;  2E1Y A;  2A42 A;  1NGD A;  1R59 O;  1RFQ A;  3FZL A;  5JLF A;  3GG4 A;  1GLC G;  2DPN A;  3U9Z A;  5I9E B;  3BF3 A;  3BUZ B;  3FZH A;  4A61 A;  3VET A;  4BRM A;  3WXL A;  5BRF A;  2IVP A;  3QFU A;  5AQG A;  1GLD G;  4Y0W A;  4AM6 A;  1BWF O;  3R6M A;  4A2A A;  1XQS C;  4EFH A;  2QWO A;  4CBX A;  4IJA A;  2D1K A;  3WQU A;  5AQH A;  3AAQ A;  3ZX3 A;  1GLJ O;  3UB5 A;  2QXL A;  4RCH A;  3ZET A;  2FSN A;  3EL2 A;  3I8B A;  2HOE A;  1G99 A;  1QQM A;  2FLO A;  3VEN A;  4ISE A;  1BDG A;  1GLA G;  2E1Z A;  3F9M A;  4JHD A;  3VES A;  2EWS A;  3M3Z A;  1KAY A;  3EKU A;  3CJB A;  3W3D A;  4I6M A;  2ASP A;  2V7Z A;  4H0T B;  4PKG A;  4CD3 A;  2P9I A;  3DWL A;  5AQL A;  1HKG A;  3BF1 A;  1X9J A;  3JS6 A;  5E84 A;  5AQZ A;  3WEE B;  1YUW A;  3A5L C;  3ULE A;  4XH5 A;  2P9N A;  3LDQ A;  4BR9 A;  1JCF A;  4XEI A;  1X3N A;  3M1F A;  5AQX A;  4BC5 A;  4RWT A;  4BR7 A;  1GLL O;  5BN9 A;  4QS7 A;  5AQK A;  1NGI A;  2AA4 A;  3A5O C;  5EOY A;  1BG3 A;  2QWL A;  3UKR A;  5KQD A;  4PL8 A;  3LDO A;  3D2E B;  3LM9 A;  5LJW A;  2CGL A;  3DXM B;  2P9L A;  2WUS A;  4FPA A;  3SLC A;  5BPN A;  1XUP O;  1NGH A;  3D2F A;  3L6Q A;  3C7N A;  4H0X B;  1DGK N;  4I6M B;  3WT0 A;  2ASO A;  4JAX A;  5F1X A;  3L4I A;  4BRD A;  3CET A;  1U2V B;  2CGK A;  4H0Y B;  4GNI A;  1V4T A;  2V52 B;  4BC3 A;  5TKY A;  1Z6R A;  1T44 A;  4DQ8 A;  2CH5 A;  3U4L A;  2ZGY A;  3LM2 A;  1NLV A;  3DXM A;  2VCP A;  1QHA A;  4NO7 A;  4PKI A;  2YCH A;  1SZ2 A;  3MN7 A;  2QWN A;  4L3Q A;  4B1Z A;  4WQ5 C;  3CJA A;  2YJE A;  3VEY A;  1ZXO A;  1KAX A;  4ISF A;  3U9D A;  2GEL A;  4B1V A;  2QW9 A;  1WUA A;  2QWM A;  5EY4 A;  2H3G X;  4CZI A;  2YHW A;  2NLX A;  4EHU A;  3ATV A;  1NGJ A;  1NGC A;  5B8H A;  4FL9 A;  3WXK A;  3LDP A;  2QWP A;  1NGE A;  1IJJ A;  3EO3 A;  1K8K B;  3DXK B;  3AAR A;  1MA9 B;  3FGU A;  4B1X B;  2AP1 A;  3H3O B;  2V7Y A;  1E4G T;  1MWK A;  4XH1 A;  4BRO A;  2A3Z A;  1DEJ A;  2BTF A;  4BGB A;  5BRE A;  3D2F B;  4CZF A;  3FZM A;  2ZF5 O;  5FPD A;  4BVP A;  3QB0 A;  2CGJ A;  4BRI A;  1ZC6 A;  3MN6 A;  3GL1 A;  1DKG D;  4WQ4 C;  1BUP A;  3S41 A;  3H1Q A;  3VEW A;  3WXJ A;  2CH6 A;  2FSJ A;  5JMV A;  3EKS A;  3MN5 A;  3UKR B;  4CBU A;  2QWR A;  4BRA A;  3QIC A;  4CZK A;  3B8A X;  4M7Y A;  2OAN A;  2GWK A;  3LDL A;  5AQN A;  3P4I A;  3H45 C;  1NMD A;  5E26 A;  5KPZ A;  4YDU C;  1WOQ A;  3BEX A;  4IO8 A;  4A62 A;  4EHT A;  4C23 A;  2P9K B;  1E4F T;  4BC2 A;  1BO5 O;  3A0I X;  1NGA A;  2Q2R A;  4QS8 A;  4CZJ A;  4EAH D;  3G25 A;  3LL3 A;  3R8E A;  3C0B A;  3UKU B;  1NM1 A;  4E1J A;  1GLF O;  2D4W A;  4FWQ A;  2IVN A;  4B1U B;  5AQJ A;  2P9U B;  3UKU A;  3ZX2 A;  5KPR A;  3VF2 A;  1TUY A;  2HF4 A;  5AZI B;  4CZM A;  4H0V B;  3VF4 A;  3HBT A;  4BRC A;  1TYQ A;  5F0X A;  2VWB A;  3J8A A;  3VGK A;  4ISG A;  3VPZ A;  3VGL A;  4IZ9 A;  3FFK B;  2ITM A;  5CE3 A;  3RSE B;  2FSK A;  3FZK A;  3VEO A;  2YHY A;  4LC9 B;  3QDK A;  3C7N B;  3CIP A;  1HUX A;  3FR0 A;  4PKH A;  3WEE A;  4DHY A;  1HJO A;  4FWO A;  4BR5 A;  2E88 A;  4IXC A;  3W0L A;  1SAZ A;  1TYQ B;  5EVZ A;  4JHD B;  2A5X A;  1HPM A;  3WXI A;  5AQT A;  2E2N A;  4H5W A;  4BRK A;  3HTV A;  3MCP A;  1NBW A;  5BPM A;  1Q18 A;  1HX1 A;  2IVO A;  4CBW A;  1T6C A;  1LOT B;  3O1B A;  2Q97 A;  1QQO A;  4BQZ A;  3FE1 A;  4WQ4 A;  3VF6 A;  1BOT O;  3O1W A;  1BA1 A;  3HM8 A;  4BRF A;  4EIA A;  5AQP A;  1U2V A;  4CI6 A;  3AAP A;  5BN8 A;  3DJC A;  2FF6 A;  3CJ7 A;  4A2B A;  3KZB A;  3GE1 A;  4BRG A;  4CZE A;  4MO5 A;  1KAZ A;  1YXQ A;  5AQI A;  1MDU B;  3ULE B;  1V4S A;  1NGB A;  3ENO A;  1HLU A;  2I7N A;  4BQL A;  4FPB A;  1C0F A;  4H5T A;  3KVG A;  3O8M A;  2Q0U A;  3A5M C;  5AQU A;  4BRE A;  4F9O A;  1Y64 A;  5EX5 A;  2A41 A;  4BRL A;  3VEV A;  1NGG A;  2BUP A;  2W41 A;  2D0O A;  1S3X A;  2D0P A;  5AQS A;  3ZET B;  1BA0 A;  3MN9 A;  3QBW A;  3H3N O;  1HKB A;  2Q0R A;  3GOI A;  2FXU A;  3A8Y A;  4FWM A;  3HZ6 A;  2I7P A;  4FWL A;  2ASM A;  4FO0 A;  1JCG A;  5AQR A;  5AR0 A;  3TU5 A;  3BP8 A;  3ZX0 A;  4BGA A;  4RTF D;  3MMV A;  3O4W A;  1X3M A;  3CJ1 A;  4FWK A;  3ZEU A;  2E2P A;  2ZWH A;  1ATR A;  4H0P A;  2A40 A;  5LJV A;  4JNE A;  3HI0 A;  4MLE A;  5BR9 A;  4K25 A;  4K42 A;  2HMP A;  2YJF A;  1U6Z A;  1ATS A;  4H0O A;  4AM7 A;  4K41 A;  2P9U A;  3WUH A;  3H46 O;  3D7E O;  5AFU H;  4BRN A;  5AQW A;  1YAG A;  3VER A;  3O08 A;  3ATU A;  3CER A;  3HSC A;  4WYB A;  5AFU A;  1S22 A;  2E8A A;  4BR2 A;  1EQY A;  4YDU A;  2ZGZ A;  5ELZ A;  4B1Y B;  1ZBS A;  5AZJ A;  2F9T A;  1ATN A;  3A5N C;  3QFP A;  4H03 B;  1GLB G;  4FWN A;  4M7X A;  3SJH A;  2IIR A;  3SK3 A;  2VYP A;  3L0Q A;  4GY2 B;  5KPT A;  3ENH A;  2P9S A;  3U8X A;  3IFR A;  1JCE A;  4O5F A;  1QZ6 A;  2E20 A;  1RDW X;  4FOE A;  3O5B A;  4H5R A;  5AZI A;  3D2E A;  4BVO A;  3OHR A;  5BRD A;  2QWQ A;  3MK6 A;  1D4X A;  2P9L B;  3CJ9 A;  4BG9 A;  2PBD A;  1C0G A;  4CZG A;  4IWV A;  2NZT A;  4FWP A;  1QZ5 A;  4IJN A;  5FPN A;  4B1W B;  4FOI A;  3IMX A;  5AQY A;  2Q36 A;  2Q1N A;  4H5N A;  1KXP A;  4BRQ A;  5AQF A;  1XC3 A;  4FWS A;  3TPQ A;  4CD1 A;  1GLE G;  3R9P A;  3SMS A;  4PL7 A;  3VEX A;  4BR0 A;  5LY3 A;  2V51 B;  4CZL A;  2YI1 A;  3FLC O;  3O6W A;  3QBX A;  2E2O A;  4J8F A;  3SMP A;  4H5V A;  5JLH A;  4MLH A;  3KHY A;  5BPL A;  3RSE A;  3VEZ A;  3EN9 A;  3I33 A;  4B9Q A;  1MWM A;  2W40 A;  4WQ5 A;  4CZH A;  5AQO A;  4Z94 A;  1K8K A;  5ADX H;  4QS9 A;  2J4R A;  4BC4 A; 
#chains in the Genus database with same CATH topology
 4HWI A;  3PV8 A;  4FSV A;  1SL2 A;  1K9M O;  1NGF A;  4BDY A;  2YHA A;  1IO2 A;  3UE5 A;  1LWC A;  5CYM A;  2A6A A;  2ZJQ L;  4X64 K;  4X66 K;  5EXW A;  4CW7 B;  3QIN A;  3VMF B;  1IG8 A;  3JXU A;  1X1P A;  1YIJ N;  3KLI A;  2BE2 A;  4ILJ A;  3CQX A;  1LCU A;  1M90 O;  3AA3 A;  4KHP K;  4GV9 A;  4CK2 A;  2HHQ A;  1Z05 A;  1OH8 A;  3IUC A;  2P5G A;  3IDH A;  1P8Z A;  3I0R A;  3ID8 A;  3VQP A;  2O8E B;  1VHX A;  5BRH A;  1HNX K;  1YVN A;  1RDU A;  3K9K A;  4A5B A;  3HP9 A;  4DSJ A;  2P9P B;  4JD2 A;  3TAQ A;  3AO1 A;  3P5J A;  3OYN A;  3R3L A;  5HL7 L;  1H1V A;  2O8F A;  2NRH A;  3T1Y K;  2UYT A;  4CIF A;  2P9N B;  3K57 A;  3QML A;  4DQR A;  5FDL A;  2P9S B;  4YY3 K;  1OKJ A;  4FJI A;  4KRF A;  1TAQ A;  2FBV A;  1NWK A;  3DOK A;  1ZBI A;  1YT3 A;  4K43 A;  4BY9 C;  4I2P A;  1NKE A;  1TAU A;  1GLC G;  2O8C B;  1ASU A;  1NK9 A;  3VQC A;  1T05 A;  4FM0 A;  1YHQ N;  3KK2 A;  3CC4 N;  3RR8 A;  1FKO A;  4RW9 A;  5KRS A;  1XQS C;  5M1N A;  2D1K A;  4LF5 K;  1HNI A;  1GLJ O;  3QNN A;  1S9G A;  4JKG A;  3ZET A;  1FK9 A;  3CCQ N;  4FM2 A;  5HP1 A;  2HOE A;  3LP3 A;  3ZT3 A;  3HL8 A;  4QAG A;  1BDG A;  2E1Z A;  2EWS A;  1W0H A;  4KPY A;  3O9T A;  1J5O A;  4JRQ A;  2G8V A;  4YNQ A;  4PY5 A;  3JYT A;  4PKG A;  3U6F A;  1S1W A;  3DWL A;  3JS6 A;  4I2Q A;  1NMN A;  5GAH P;  2HST A;  4OX9 K;  3ULE A;  3KWI A;  3E9L A;  3K2P A;  4HTU A;  1X3N A;  1Q86 O;  1WSE A;  2B4J A;  5J2Q A;  1ITG A;  3AVC A;  5BN9 A;  4QS7 A;  5AQK A;  4CGJ A;  5EOY A;  1JL1 A;  1C6V A;  4LSL A;  1QSL A;  2KZM A;  3TTD A;  4PL8 A;  3P39 A;  1SKR A;  1VQ8 N;  2CGL A;  3DXM B;  2WUS A;  4E7I A;  4DSE A;  3D2F A;  3M8S A;  2HHV A;  5F1X A;  3D45 A;  3CET A;  2CGK A;  4H0Y B;  4JI0 K;  3VQ8 A;  1Z6R A;  2ZGY A;  3SBT A;  1Y97 A;  1NLV A;  3CFR A;  2VCP A;  1FXX A;  1QHA A;  4NO7 A;  5C42 A;  3CQ8 A;  3OYC A;  1Q82 O;  3ASM A;  4YOU A;  1SZ2 A;  3LP0 A;  4DTP A;  4DFJ A;  3VEY A;  5I42 A;  2OYQ A;  5JS2 A;  4FJX A;  4LF8 K;  3ZSX A;  4CZI A;  2YHW A;  4B3O A;  4EHU A;  1HR0 K;  2PZS A;  2HBL A;  1QHT A;  1EWQ A;  4GVE A;  3WXK A;  4DR2 K;  2QWP A;  3NVM A;  3VQB A;  1IJJ A;  3EO3 A;  2F96 A;  1K8K B;  3DXK B;  4DLE A;  2P5O A;  4DSK A;  1MA9 B;  4B1X B;  3TTF A;  5AJ3 K;  4B9L A;  3OJS A;  2V7Y A;  1JJ2 M;  3QEV A;  2A3Z A;  2OZS A;  3QB0 A;  1ZC6 A;  4WQ4 C;  1DKG D;  4JI3 K;  1BUP A;  1N5Y A;  3CFO A;  3T1A A;  2CH6 A;  3KK3 A;  3EKS A;  1EWR A;  5C25 A;  3CCR N;  1W2B M;  2VGN A;  2QWR A;  3ZLJ A;  1VSH A;  4FJL A;  4KHN A;  4OPJ A;  3KLF A;  1RT1 A;  4JI6 K;  4DTJ A;  1E3M A;  3P4I A;  4FK4 A;  5GIO A;  3HXM A;  4YDU C;  3HOS A;  1F21 A;  3CFP A;  3THW A;  3OA9 A;  4EHT A;  2FC0 A;  2P9K B;  4DQS A;  4DMN A;  3C94 A;  2UXB K;  1QTM A;  1NGA A;  5FRN A;  4B9T A;  3P38 A;  2W6K A;  2X6S A;  3LL3 A;  3QEW A;  5IT9 O;  4E1J A;  1GLF O;  5AQJ A;  4CGG A;  1J9A A;  4AHS A;  2ZD1 A;  3L2R A;  3LAM A;  1TYQ A;  5CY4 A;  4F3O A;  4C8N A;  2XRI A;  4IZ9 A;  4FLW A;  3V9X A;  3O9Q A;  2FSK A;  3CC2 N;  3SQ1 A;  2YV0 X;  4CJT A;  1WSI A;  4YOR A;  3RRG A;  4PKH A;  4JKB A;  4OKJ A;  3QES A;  1SAZ A;  4FW1 A;  2E6M A;  4H5W A;  3SBG A;  1Q81 O;  1NBW A;  5J2N A;  2BGG A;  1HX1 A;  4WF9 L;  1KQS M;  1LOT B;  4M3Z A;  1RTH A;  3EEQ A;  2Q97 A;  3N4Q A;  3THY A;  1VQO N;  4W5O A;  1NK0 A;  3VF6 A;  4BRF A;  1BA1 A;  4M3Y A;  3S9H A;  5AQP A;  4I9Q A;  1JLC A;  2FF6 A;  3CJ7 A;  3GE1 A;  2O8B A;  3HYF A;  3F73 A;  1YJN N;  5AQI A;  1MDU B;  1HQE A;  3AVK A;  2OPS A;  3ENO A;  1S1U A;  1NKB A;  4FPB A;  1C0F A;  4OPA A;  3O8M A;  4PWD A;  4CHP A;  5AQU A;  4BRE A;  4CJW A;  1WAJ A;  4ID5 A;  4JYA K;  2QK9 A;  3VTI A;  3I0S A;  3KD5 E;  2D0O A;  2FBX A;  5FLX O;  4ICL A;  2Y1I A;  3K5O A;  3ZET B;  4JS4 A;  3MN9 A;  3A8Y A;  5HBM A;  1VQM N;  2I7P A;  4M3X A;  1JCG A;  5AR0 A;  3TU5 A;  4BGA A;  3S3O A;  4I9L A;  4FJJ A;  3G10 A;  5KGW A;  3THX B;  1X3M A;  2HNY A;  4CF9 A;  4R79 A;  4H0P A;  2A40 A;  1QVF M;  4JNE A;  4CGI A;  1U6Z A;  1L3T A;  4AM7 A;  2YKN A;  2OPQ A;  4IOA L;  1IBM K;  1NK6 A;  2UUB K;  4F4K A;  1B9D A;  1A5W A;  1LAW A;  4OJR A;  1HYS A;  3OYH A;  2OCE A;  1YAG A;  3O08 A;  4WYB A;  3HSC A;  2IDO A;  2UU9 K;  3KLH A;  2E8A A;  5C24 A;  4YDU A;  3EZ5 A;  1C0T A;  4Z4I A;  2F9T A;  3A5N C;  3J80 O;  4LFA K;  1RIL A;  2YNF A;  4DFK A;  1GLB G;  4FWN A;  3OW2 M;  1VSF A;  3L0Q A;  4B3M K;  5K14 A;  3IFR A;  2F8T A;  4C8M A;  4K8X A;  4L8R B;  4FZX C;  1RDW X;  4TSX A;  3TAR A;  3O5B A;  1GOB A;  3RMB A;  4CFA A;  5AZI A;  4IFE A;  3OHR A;  5HRO A;  5BRD A;  1LV5 A;  3WNE A;  1QSY A;  3CJ9 A;  3DRP A;  3L8B A;  4AHU A;  1YF5 L;  4W5Q A;  2NZT A;  4FWP A;  3NH1 A;  5FPN A;  1BQM A;  2IS3 A;  4B1W B;  2GUI A;  4FOI A;  3IMX A;  5AQY A;  3J7Y P;  4B9U A;  5C2D A;  2E6L A;  3CG7 A;  1C0U A;  3C65 A;  5AQF A;  4O8U A;  4KTW A;  3PLA A;  4GV3 A;  5M1P A;  1GLE G;  3VQA A;  2OTL N;  3VEX A;  4BR0 A;  3O6W A;  2E2O A;  2P1J A;  1HMV A;  1LW2 A;  4H5V A;  2PYJ A;  1I94 K;  1DT9 A;  5JLH A;  3AGK A;  3AVF A;  5BPL A;  3TAE A;  3CCV N;  3CC7 N;  3LPU A;  3EN9 A;  3I33 A;  3OYJ A;  5LMU K;  1MWM A;  3TAM A;  4BDZ A;  4AHC A;  5ADX H;  2J4R A;  4BC4 A;  3VQ9 A;  2HHH K;  2KW4 A;  3KWG A;  1S72 N;  3O3F A;  5D3G A;  1A5V A;  2F9W A;  1D9F A;  5AZJ B;  4DB3 A;  5HRP A;  4ZTF A;  4IBN A;  4IFV A;  3QO9 A;  2Q31 A;  4NLC A;  1S5J A;  3AO5 A;  3F5T A;  4CJR A;  2O4I A;  1ESV A;  1WN7 A;  3WQT A;  2PAV A;  1SS6 A;  4JKH A;  3DAW A;  4JI2 K;  3OYK A;  1CZA N;  3DXK A;  3E01 A;  2HBM A;  5ADX A;  4CFD A;  3V9W A;  5KI6 A;  3E9O A;  4JKE A;  2P9I B;  3OYI A;  4JI8 K;  4KTQ A;  5KQ8 A;  3ZEU B;  4E7H A;  1T6D A;  4HHT A;  4JI7 K;  3SAH A;  4JKC A;  4BDP A;  3PSI A;  1EP4 A;  3GDQ A;  4OPK A;  5J2M A;  3SV4 A;  3L2W A;  1O1W A;  3CHW A;  4CF1 A;  3ZT2 A;  3H6E A;  4AHT A;  4CVN E;  2QA4 N;  2E2Q A;  1QQN A;  4JN4 A;  2QM1 A;  1D9D A;  3VQ6 A;  2HF3 A;  1VQ9 N;  2P9K A;  4CEE A;  2UUC K;  3ULD A;  3CJC A;  5HRR A;  1RGI A;  1RDD A;  3AA4 A;  3MEC A;  4GKK K;  1JL2 A;  3KJV A;  4BAC A;  4Z4C A;  1NGD A;  1SL0 A;  3FZL A;  1CLQ A;  2DPN A;  1DLO A;  2HHT A;  4CFB A;  3BUZ B;  4A61 A;  4DR3 K;  3ZYY X;  3WXL A;  2IVP A;  3QFU A;  4DTR A;  5AQG A;  3MXI A;  2BH1 A;  3F9K A;  3UB5 A;  3K5M A;  2QEX N;  3HST B;  1Q8I A;  2FSN A;  3G71 N;  1QQM A;  2FLO A;  3LZJ A;  1UWB A;  3VEN A;  4FJ5 A;  3C95 A;  3F2K A;  3M3Z A;  4DS5 A;  3EKU A;  1VQ6 N;  4BE1 A;  4I6M A;  3LZI A;  4KO0 A;  2V7Z A;  4H0T B;  1FJG K;  1TVR A;  1NJY A;  2P9I A;  4DR6 K;  3P83 D;  5AQL A;  1HKG A;  3BF1 A;  1J54 A;  1X9J A;  1LW0 A;  3PX4 A;  2HHU A;  3A5L C;  4XH5 A;  2P9N A;  4OPH A;  1NK8 A;  3THY B;  3ITH A;  3LDQ A;  3O9R A;  3HO1 A;  4CK1 A;  4BC5 A;  3M1F A;  1TK8 A;  4IOX A;  1EXQ A;  3AVL A;  1KTQ A;  2NNW A;  4CHO A;  3NFA A;  3V4I A;  1KFS A;  5KQD A;  3AO4 A;  2ZQB A;  2QI2 A;  3LM9 A;  2P9L A;  3N4P A;  4JKA A;  1KRP A;  1YIT N;  1KLM A;  3CME N;  4LF7 K;  3SLC A;  5BPN A;  3S3M A;  4DR4 K;  3L6Q A;  1J5E K;  1IBL K;  4I6M B;  4JAX A;  4MFB A;  3RMA A;  1EX4 A;  4NYN A;  4B9M A;  3EE9 A;  4OGC A;  4GNI A;  1V4T A;  2FBT A;  3K9J A;  4JKG B;  3IRX A;  4B3T K;  2CH5 A;  1W9H A;  3LM2 A;  3ZT4 A;  4WE1 A;  3ID6 A;  3LAK A;  4CF0 A;  2F4V K;  3CPE A;  1ZXO A;  4GKJ K;  1KAX A;  4IDK A;  3OYA A;  4FJK A;  3BZK A;  4DV4 K;  3TSP A;  4B1V A;  2QWM A;  1WUA A;  3JAM O;  1REV A;  5EY4 A;  5C2F A;  3SUN A;  1VQ5 N;  4FL9 A;  3HPO A;  3H3O B;  1NK7 A;  2A1R A;  4J2A A;  3K0S A;  1E4G T;  1W97 L;  4BRO A;  1QS4 A;  3JSM A;  3QEP A;  2UXC K;  3LDS A;  3KTQ A;  4BVP A;  1U04 A;  2B6A A;  3CCM N;  3T19 A;  3S41 A;  3H1Q A;  5M1K A;  3VEW A;  2JWK A;  3LAN A;  3MN5 A;  4JI1 K;  4BRA A;  3O4Q A;  1NJI O;  4DF4 A;  1NG9 A;  5FRM A;  4G1Q A;  3TWH A;  4M7Y A;  2OAN A;  2GWK A;  3LDL A;  4K8Z A;  1Q9X A;  3HJF A;  5KPZ A;  1YI2 N;  5IWA K;  4ELV A;  4A62 A;  4C23 A;  2VQF K;  1E4F T;  1U48 A;  3A0I X;  3CCS N;  2Q2R A;  3E66 A;  3VN5 A;  4KB1 A;  4Y1D A;  4UY8 O;  1BI4 A;  3G25 A;  3T69 A;  1OH7 A;  3UKU B;  3SAF A;  3HVR A;  2D4W A;  4FWQ A;  2IVN A;  5GIN A;  5KPR A;  1Z26 A;  3UKU A;  1RBT A;  3VF2 A;  4W5R A;  3EYZ A;  1TUY A;  2HF4 A;  2RKI A;  4IEE A;  4M3W A;  4N41 A;  4FJG A;  1JLB A;  1RBS A;  1BCO A;  1RBR A;  4QOZ B;  3FFI A;  3VA3 A;  5CE3 A;  3TAB A;  2IGI A;  1T03 A;  1BCM A;  3QDK A;  4FJ9 A;  3THW B;  3CIP A;  3FR0 A;  3A2F A;  4HUF A;  3AVG A;  3C6U A;  1NU0 A;  3HPG A;  3NF6 A;  2OA8 A;  4V19 S;  3E1Y A;  4FJ8 A;  2A5X A;  1HPM A;  3WXI A;  5AQT A;  1BHL A;  1I39 A;  4FVM A;  1YVU A;  4O55 A;  4E1N A;  3ZT0 A;  1RT7 A;  4CGD A;  1UA0 A;  4YOX A;  4EP5 A;  1X9M A;  3O1B A;  1QQO A;  4O0I A;  3RMC A;  4BQZ A;  3ISN C;  4CE9 A;  3L2Q A;  2Q3S A;  4WQ4 A;  4E89 A;  3O1W A;  3QET A;  3J7Z O;  1RT6 A;  4I7F A;  4ZHR A;  4EIA A;  1HPZ A;  3AAP A;  4DG1 A;  5BN8 A;  3DJC A;  2HVH A;  3V1R A;  3V1Q A;  4BRG A;  1WSJ A;  1B92 A;  1KCF A;  2YNG A;  4DR1 K;  1BQN A;  3ULE B;  2VWK A;  4BQL A;  4AQY K;  1NK4 A;  3K59 A;  4H5T A;  1GOC A;  2Q0U A;  3A5M C;  5HRN A;  1Y64 A;  2W42 A;  3OY9 A;  4BRL A;  1NGG A;  3DM2 A;  2BUP A;  2D0P A;  1BA0 A;  4AH9 A;  4ID1 A;  2FXU A;  4DQQ A;  3ENB A;  3DMJ A;  4FO0 A;  4FLY A;  2PYL A;  3V9S A;  3PUF A;  5T7B A;  4DV3 K;  3DLH A;  4JK7 A;  3SZ2 A;  2F8S A;  4AHV A;  1JLE A;  3CJ1 A;  1S1T A;  1TK5 A;  2G8I A;  4E7J A;  2ZWH A;  4DU4 A;  3HI0 A;  1Z25 A;  4K25 A;  4K42 A;  2R7Y A;  1HRH A;  1ATS A;  4F2S A;  1VRU A;  2RE2 A;  4DKW A;  3I8D A;  4X65 K;  5AFU H;  2HNZ A;  4DQI A;  3OYF A;  4BRN A;  4FZZ A;  3NHG A;  4CGH A;  3O3G A;  4EZ9 A;  3C6A A;  4CHQ A;  4B1Y B;  2G8U A;  2ZGZ A;  1ZBS A;  2VG6 A;  3SQ0 A;  4CGF A;  3RTV A;  4BWM A;  4FVU A;  1NKC A;  1KVB A;  3SJH A;  2IIR A;  3BY5 A;  2VYP A;  4LH5 A;  1D8Y A;  4GY2 B;  5CR4 A;  2XHB A;  4KTZ A;  3QEX A;  4CHY A;  3G6E N;  1OH6 A;  3MEG A;  4M45 A;  2NRV A;  2QWQ A;  3MK6 A;  2HMI A;  1JLQ A;  2P9L B;  4BG9 A;  2PBD A;  1CXQ A;  2AJQ A;  1B9F A;  1C0G A;  1JLG A;  3LP1 A;  4CZG A;  4MQ3 A;  2RF2 A;  3CPW M;  3RMD A;  4IJN A;  2Q36 A;  2Q1N A;  2KTQ A;  1KXP A;  4DV6 K;  3QEI A;  2X74 A;  2FBY A;  1XC3 A;  3TPQ A;  1RTJ A;  4ELU A;  3R9P A;  3SMS A;  1N8R O;  1NOY A;  2YI1 A;  3QBX A;  4J8F A;  3SMP A;  1S6Q A;  4MLH A;  4YFU A;  1VSI A;  3RSE A;  4DR5 K;  1M1K O;  3SPZ A;  2PFU A;  4M41 A;  4WQ5 A;  2W40 A;  4CJ5 A;  1N34 K;  1YTA A;  4CEQ A;  2XY5 A;  3GBT A;  3AO2 A;  2QKB A;  5AQV A;  4M42 A;  3AVA A;  2FF3 B;  3NGZ A;  4FK0 A;  1BIU A;  1HYZ A;  5C15 A;  4Y1C A;  2IC3 A;  4U7B A;  2BAN A;  3ZSO A;  4BR4 A;  3DLL L;  2KHO A;  4BRP A;  1VRT A;  4JD2 B;  5H1S Q;  2X78 A;  3Q7C A;  5LMN K;  1XI1 A;  4CEA A;  5C10 A;  2YHX A;  4ELT A;  4JS5 A;  1VSE A;  2HB5 A;  3PY8 A;  3PIO L;  4HTL A;  1UA1 A;  1X9W A;  4FYD A;  4JK9 A;  5AQM A;  5HLF A;  3MDQ A;  4BG8 A;  4CEB A;  1YJW N;  4O0J A;  3EZW A;  3CI5 A;  4A5A A;  1U45 A;  3O80 A;  3FZF A;  4JV5 K;  1K6Y A;  1KFD A;  5FPM A;  5AQQ A;  1VSL A;  1TKT A;  2Y1J A;  4KRE A;  4KHU A;  3BDP A;  2WFB A;  4FJH A;  4DTN A;  3OYE A;  1EO1 A;  3HPH A;  4Q5V A;  3OBW A;  5LL6 Z;  3AVH A;  3SUO A;  2KQ2 A;  3KLE A;  3M6G A;  3J7A P;  4M63 C;  2QTD A;  4CJF A;  2P51 A;  1RFQ A;  3AVN A;  1EET A;  3GG4 A;  4B8A B;  2DFF A;  3SQ2 A;  3O3H A;  1YTU A;  4Z4E A;  4JKD A;  3FZH A;  3VET A;  4BRM A;  1XMO K;  1K73 O;  3AVI A;  4B9V A;  1GLD G;  4BE2 A;  4Y0W A;  1BWF O;  1L5U A;  4EFH A;  2QWO A;  1ZBF A;  4E7L A;  5AQH A;  1RT3 A;  4YOW A;  3SV3 A;  2ATQ A;  4RCH A;  4CJU A;  1N32 K;  3K5N A;  3EL2 A;  4CEO A;  1G99 A;  1WSG A;  3WXM B;  4ISE A;  1GLA G;  3C6H A;  3F9M A;  4OLA A;  3M5R A;  4GMJ B;  1KAY A;  1LAV A;  3W3D A;  1GOA A;  4CD3 A;  3DLB A;  3CD6 N;  5AQZ A;  5E84 A;  1YUW A;  2UUA K;  4K0K K;  3U3Y A;  4FZY A;  4BR9 A;  2EX3 A;  2JLE A;  4XEI A;  5CHI A;  3KLG A;  2KFZ A;  3SPY A;  1P90 A;  4ILH A;  5GAG P;  1NGI A;  2AA4 A;  3A5O C;  3OBY A;  5DM7 L;  4DWI A;  4MDA A;  3UKR A;  1EKE A;  4M3U A;  3BGR A;  3D2E B;  5DM6 L;  3PO4 A;  2DFE A;  4JI4 K;  3CM6 A;  3SUP A;  4X62 K;  5GIP A;  4FPA A;  3SCX A;  3R1X A;  4WFN L;  1DGK N;  4XIU A;  2W6L A;  3WT0 A;  1JKH A;  1LWE A;  3L4I A;  4BRD A;  3C6T A;  1U2V B;  4BC3 A;  2D0B A;  3B6O A;  3T7Z A;  2O8F B;  3DXM A;  4FJ7 A;  4PKI A;  3LP2 A;  3HOT A;  1G15 A;  4WQ5 C;  4DV5 K;  2YJE A;  1Q7Y O;  5JVG L;  2DY4 A;  4ISF A;  3P31 A;  1S1X A;  3U9D A;  5GAD P;  2O8E A;  2GEL A;  1TL1 A;  2QW9 A;  2KFN A;  2PY5 A;  3SJJ A;  3MX2 A;  2NUB A;  4A59 A;  4EZ6 A;  1HJR A;  3OVN A;  3ATV A;  1NGC A;  5B8H A;  3ZT1 A;  1QVG M;  4J2D A;  2HHX A;  3CM5 A;  3LDP A;  1NGE A;  3WNH A;  3O4N A;  5JVH L;  3AAR A;  2QKK A;  2E4L A;  1BGX T;  3NF7 A;  3QER A;  3M8R A;  1HNZ K;  3DLE A;  3D2F B;  2NRW A;  4CZF A;  2YNI A;  2ZF5 O;  2CGJ A;  3MN6 A;  5MLC Q;  3SUQ A;  4DTO A;  4RW6 A;  5C12 A;  3ZSW A;  2OPR A;  2FSJ A;  2XY7 A;  1XNQ K;  1ZYQ A;  2E5L K;  5JMV A;  1XNR K;  3UKR B;  5FRO A;  4DU1 A;  4PQU A;  3SQ4 A;  3QIC A;  2HVI A;  1RDC A;  1IBK K;  4CZK A;  3VQ7 A;  2O8C A;  1SV5 A;  4B9S A;  2GX9 A;  5AQN A;  2D0C A;  4OKK A;  1WOQ A;  3L3V A;  4IO8 A;  4H8K A;  1W7A A;  3V9U A;  1XHZ A;  4E0D A;  3TAF A;  2IAJ A;  4CHN A;  4QS8 A;  3C0B A;  1T7P A;  3MWT A;  4LY7 A;  4NLB A;  4CEF A;  5I3U A;  1I3A A;  2P9U B;  3RR7 A;  4IEI A;  1VSJ A;  2B5J A;  4CZM A;  4H0V B;  1S1V A;  4WCE L;  4YOT A;  4BRC A;  5DK5 A;  2VWB A;  3VPZ A;  4AF1 A;  4ISG A;  3VGK A;  1KLN A;  4PUO A;  1QQC A;  2VGM A;  3FFK B;  1Q9Y A;  1BL3 A;  3IG1 A;  3L2V A;  3MAQ A;  3RSE B;  3FZK A;  4F2R A;  1JXB A;  3VEO A;  3HP6 A;  1XC9 A;  3LWM A;  3C7N B;  1D5A A;  1HUX A;  4FJN A;  2KZZ A;  4C8L A;  3B6P A;  2WC9 A;  3DLR A;  4DHY A;  1WAF A;  4BR5 A;  1JLF A;  2E88 A;  2OZM A;  2DTU A;  1RNH A;  4RW4 A;  3DLG A;  4B8C A;  4LF4 K;  1TYQ B;  3O9U A;  5EVZ A;  4JHD B;  4CED A;  1U4B A;  2E2N A;  3QIP A;  3OYG A;  4KHQ A;  4BRK A;  1RT5 A;  1JLA A;  3MCP A;  3PIP L;  3ZSV A;  2IVO A;  4ZTJ A;  3P1G A;  1TK0 A;  3MXM A;  1VSD A;  4CCH A;  3IKM A;  3FE1 A;  2VWJ A;  3S3N A;  3Q7B A;  4NCA A;  4UQG A;  5BR8 K;  1BI4 B;  2NRT A;  4A2B A;  3KZB A;  4DFP A;  4MO5 A;  4EP4 A;  4PHT X;  3AO3 A;  4DF8 A;  3TI0 A;  1HYV A;  1V4S A;  1TGO A;  4CER A;  4DV7 K;  4N56 A;  5EX5 A;  2WON A;  4M3T A;  3PX0 A;  4IFY A;  2A41 A;  5M1Q A;  3VEV A;  4O5B A;  3DOL A;  3PSF A;  5AQS A;  4LD0 A;  4G9Z A;  5DMR A;  2RPI A;  2Q0R A;  4FWM A;  3ZCM A;  3OYL A;  4GW6 A;  4LFB K;  4FK2 A;  4FWL A;  3SAG A;  3BP8 A;  4CEC A;  3MMV A;  4M3R A;  4CJ3 A;  1SKW A;  4W5N A;  3OS1 A;  3ZEU A;  4DUY K;  1IG9 A;  1ATR A;  4NXM K;  3U3G A;  5A2Q O;  4MLE A;  4KH4 A;  2YJF A;  2ITG A;  4NCG A;  3ZSZ A;  2ZJP L;  4FCY A;  1S6P A;  2P9U A;  3WUH A;  3H46 O;  3L4Q A;  4CF8 A;  3D7E O;  3EY1 A;  1MU2 A;  1RBU A;  3M8P A;  1ASW A;  5HRS A;  3THV A;  2G8K A;  3H08 A;  3ATU A;  3CER A;  1S22 A;  1KSP A;  4JK8 A;  3NDK A;  4NYF A;  1BIS A;  1XWL A;  4JRP A;  4FLT A;  1CZB A;  4Z0U A;  3E9P A;  4IKF A;  3VQD A;  1WBD A;  3SK3 A;  4CJQ A;  2WTU A;  5KPT A;  2OTJ N;  3ENH A;  3U8X A;  1JCE A;  3MXJ A;  1QZ6 A;  1TKZ A;  2E20 A;  4U67 L;  1OH5 A;  1VQ4 N;  3UIQ A;  3OYB A;  3D2E A;  1C0M A;  2JGU A;  3TAN A;  1VAZ A;  1D4X A;  4KH5 A;  4IWV A;  1R0A A;  1L3S A;  1KVC A;  4FLZ A;  3QLH A;  3J81 O;  4BE0 A;  3HVT A;  4N47 A;  4CD1 A;  2O8D A;  1TV6 A;  2HBJ A;  5LY3 A;  2V51 B;  4CZL A;  3FLC O;  3DRR A;  5E41 A;  4KAZ A;  4DV0 K;  5KGX A;  2ZM6 K;  3K58 A;  2GV9 A;  3VEZ A;  1ZBH A;  4RW8 A;  3VQQ A;  4PA1 A;  4JEP A;  1FW6 A;  4QS9 A;  1C1B A;  1N36 K;  5CZ1 A;  1K8A O;  1T3V A;  4LF9 K;  3ZSR A;  1TUU A;  1ZBL A;  3L3U A;  1SQK A;  2YNH A;  4GVM A;  5SZT A;  3AY9 A;  4CJ7 A;  1N33 K;  4XH4 A;  1LWF A;  4C8O A;  2WOM A;  3VOV A;  3BZC A;  3NGI A;  3K5L A;  5FPE A;  4OVL A;  2ZE2 A;  1HKC A;  4JLH A;  2WBN A;  2G8F A;  4E3S A;  2XY8 A;  5JIC A;  4CES A;  3H1V X;  4IO9 L;  3NVK A;  1T8E A;  4GV6 A;  4DQP A;  3CQY A;  4FWR A;  4DSI A;  4F3T A;  4CJ4 A;  4BWJ A;  4MO4 A;  4KBO A;  5F2R A;  3OYM A;  4DCH A;  3TAG A;  1BU6 O;  2GTD A;  2GUP A;  3KIO A;  4W5T A;  5EU7 A;  2GEM A;  4DS4 A;  2GWJ A;  5HOO A;  4IOC L;  3V6D A;  1BIZ A;  4DFM A;  1RDA A;  2HND A;  2IOC A;  2RN2 A;  3VGM A;  4BRH A;  4DTU A;  3V1O A;  2P9P A;  2KKZ A;  3RVC A;  2EHG A;  1VQL N;  2NRZ A;  5CYQ A;  1A5X A;  4CEZ A;  3SYZ A;  3PO5 A;  4O8K A;  1JXE A;  3AGR A;  4NB4 A;  3AVM A;  3KKS A;  3LDN A;  1J6Z A;  3KD1 E;  2E1Y A;  2A42 A;  3AA5 X;  4O44 A;  1R59 O;  4IG0 A;  3D6R A;  5JLF A;  3U9Z A;  5I9E B;  1KD1 O;  1HNV A;  4OLB A;  1U47 A;  3BF3 A;  4DR7 K;  2D0A A;  5BRF A;  4H4O A;  2ZJR L;  3NE6 A;  4B08 A;  4AM6 A;  3NF8 A;  1RT4 A;  3R6M A;  4A2A A;  3QNO A;  4KI6 A;  2F7T A;  4CBX A;  1VQN N;  4IJA A;  3DI6 A;  3WQU A;  4AIL C;  3AAQ A;  3ZX3 A;  4RW7 A;  4KB0 A;  1CZ9 A;  2QXL A;  4R5P A;  4OO1 J;  3I8B A;  4Z4F A;  1J53 A;  1RBV A;  3LAL A;  4DTX A;  1QE1 A;  3HRG A;  4JHD A;  3VES A;  4DLG A;  3CJB A;  4WFB L;  2ASP A;  2RHK A;  1OVY A;  3IS9 A;  3WEE B;  1NK5 A;  1HNW K;  4N5S A;  3T1H K;  1JCF A;  2G8H A;  5TKW A;  4RWT A;  1NOZ A;  5AQX A;  3HM9 A;  3VQ5 A;  4BR7 A;  3HT3 A;  4CIE A;  3OTO K;  1GLL O;  4HCB A;  4E1M A;  1BG3 A;  2QWL A;  4LH4 A;  3AVB A;  3LDO A;  3EE8 A;  5LJW A;  3NH0 A;  4J2E A;  4JKF A;  1XUP O;  1NGH A;  3CCJ N;  3C7N A;  4H0X B;  1TL3 A;  4NCB A;  5M1O A;  4DSF A;  4CJL A;  4A57 A;  4FLU A;  1TKX A;  1WLJ A;  2ASO A;  2YHB A;  1SL1 A;  4CJP A;  4HCC A;  2JWL A;  4E19 A;  2V52 B;  1KVA A;  5TKY A;  1T44 A;  4DQ8 A;  2HHS A;  3VTH A;  3U4L A;  3TSU A;  5J1E A;  1S9E A;  2O8D B;  2YCH A;  1WSF A;  3MN7 A;  2LSN A;  4B1Z A;  2QWN A;  4L3Q A;  4OGE A;  4Z4H A;  4AHR A;  3CJA A;  1IKV A;  4B3S K;  1KC8 O;  2HBK A;  2H3G X;  2OPP A;  2NLX A;  1NGJ A;  4C1N I;  4NXN K;  4WFA L;  2VG7 A;  3FGU A;  2AP1 A;  5M1F A;  3T3F A;  1RCH A;  2QXF A;  3CCE N;  1MWK A;  4XH1 A;  1RT2 A;  3THX A;  2Z1J A;  1DEJ A;  2BTF A;  4BGB A;  5BRE A;  3DYA A;  3FZM A;  5FPD A;  3VA0 A;  1ZBU A;  4BRI A;  3GL1 A;  3MX5 A;  4CF2 A;  3WXJ A;  1WB9 A;  4RG8 A;  4CHZ A;  3NMU A;  4JI5 K;  3KK1 A;  4CBU A;  4CJV A;  2UXD K;  2YX6 A;  3QIO A;  2YKM A;  3B8A X;  3IAY A;  4FW2 A;  4H4M A;  3H45 C;  1NMD A;  5E26 A;  1C1C A;  3BEX A;  2A1S A;  3VQ4 A;  4BC2 A;  2O8B B;  1BO5 O;  4YOY A;  4MDB A;  2D5R A;  4C1N K;  3OYD A;  3O9S A;  1TKD A;  3AA2 A;  4CZJ A;  4EAH D;  3PX6 A;  3R8E A;  3KK7 A;  1NNE A;  4FM1 A;  3OJU A;  1NM1 A;  1IV0 A;  3MCA B;  1FKP A;  4B1U B;  4CJS A;  1RTI A;  3ZX2 A;  3CMA N;  5AZI B;  4HVJ A;  2NRX A;  3VF4 A;  3HBT A;  3LPT A;  3TR8 A;  5F0X A;  1VQP N;  3J8A A;  2VQE K;  3WNF A;  2HHW A;  3VGL A;  1ASV A;  1DTT A;  3NCI A;  2KLA A;  2ITM A;  3LWL A;  1U49 A;  3OS0 A;  1SUQ A;  2YHY A;  4LC9 B;  5J2P A;  1YJ9 N;  3ZSQ A;  3VQE A;  2I5J A;  3WEE A;  1WSH A;  1HJO A;  4FWO A;  4CJE A;  4CJK A;  4YOV A;  3G4S N;  4FLV A;  3NAE A;  1XHX A;  3OS2 A;  4IXC A;  2XO7 A;  3MEE A;  3W0L A;  3TSQ A;  1IKX A;  3AVJ A;  4CIG A;  1WBB A;  2DFH A;  3HTV A;  3V9Z A;  4B3R K;  5BPM A;  1Q18 A;  1VK0 A;  4CBW A;  1T6C A;  4FXD A;  1BOT O;  3HM8 A;  4FJM A;  1U2V A;  4CI6 A;  4LSN A;  1VQK N;  4YHH K;  4CZE A;  4OKE A;  1KAZ A;  4KV8 A;  1YXQ A;  2NRR A;  1VQ7 N;  1NGB A;  1HLU A;  2ETJ A;  2I7N A;  3CXC M;  3KVG A;  5CZ2 A;  3SI6 A;  4C8K A;  2Z1H A;  4F9O A;  4DV1 K;  4IG3 A;  3D0P A;  4B9N A;  1X9S A;  2W41 A;  5JS1 A;  1S3X A;  3CF5 L;  4J2B A;  4E7K A;  4N76 A;  4F8R A;  4KH6 A;  1RDB A;  3QBW A;  3H3N O;  1HKB A;  3GOI A;  3SNN A;  3NBP A;  4KFB A;  3HZ6 A;  4Z4G A;  1VSM A;  1SKS A;  2ASM A;  5AQR A;  3RWU A;  3I56 N;  1OVQ A;  3ZX0 A;  3L2U A;  2BDP A;  4RTF D;  3MED A;  4HUG A;  3O4W A;  4FLX A;  4ILG B;  1RTD A;  5SWM A;  3I55 N;  3TAP A;  4FWK A;  2E2P A;  1NJW A;  4IDH A;  3DRS A;  2X6N A;  3M8Q A;  5LJV A;  4DTS A;  5BR9 A;  2HMP A;  4CK3 A;  4DTM A;  1VSK A;  1C1A A;  4H0O A;  4LFC K;  4K41 A;  1QSS A;  3TTC A;  3NH2 A;  4DSL A;  1WNS A;  4KHW A;  3DLK A;  5AQW A;  5KRT A;  1UAX A;  4Q0B A;  1IH7 A;  3VER A;  3CCU N;  5AFU A;  1N6Q A;  1XMQ K;  4BR2 A;  1EQY A;  5ELZ A;  5AZJ A;  2VG5 A;  1ATN A;  3QFP A;  4H03 B;  1ILY A;  4M7X A;  4O4G A;  3NF9 A;  2XY6 A;  4QCL A;  2Z1G A;  3CCL N;  4KI4 A;  3HK2 A;  4DU3 A;  2P9S A;  4CFC A;  2G8W A;  4O5F A;  5KTQ A;  3V81 A;  4FOE A;  4H5R A;  1NJZ A;  4DUZ K;  4BVO A;  2O4G A;  4KHS A;  1NJX A;  4DV2 K;  1UOC A;  1L3V A;  2GBZ A;  1IKY A;  1HQU A;  5GAE P;  1QZ5 A;  3WNG A;  3AV9 A;  1CXU A;  3KKR A;  4H5N A;  3ZSY A;  4BRQ A;  3RRH A;  4FWS A;  2HW3 A;  4KKO A;  1L3U A;  3NGY A;  3ALY A;  1IKW A;  4PL7 A;  4KHY A;  3KHY A;  3MWP A;  1DTQ A;  5C0Y A;  4B9Q A;  3CYM A;  4CZH A;  5AQO A;  4Z94 A;  3G0Z A;  1K8K A;  1O13 A;  4LF6 K;  2Z1I A;  4HUE A; 
#chains in the Genus database with same CATH homology
 3GBT A;  4HWI A;  3KWG A;  1S72 N;  1TUU A;  4FSV A;  5AQV A;  1K9M O;  1NGF A;  1SQK A;  2F9W A;  2FF3 B;  5AZJ B;  3UE5 A;  4DB3 A;  2A6A A;  3AY9 A;  4CJ7 A;  2ZJQ L;  4XH4 A;  5C15 A;  3VOV A;  4U7B A;  5EXW A;  5FPE A;  2Q31 A;  3VMF B;  1IG8 A;  3JXU A;  4BR4 A;  4NLC A;  1YIJ N;  3DLL L;  1HKC A;  2KHO A;  2WBN A;  3F5T A;  4BRP A;  4JD2 B;  5H1S Q;  1ESV A;  3Q7C A;  4ILJ A;  2PAV A;  3CQX A;  1SS6 A;  4JKH A;  1LCU A;  3WQT A;  3DAW A;  5C10 A;  2YHX A;  5JIC A;  1M90 O;  3H1V X;  1CZA N;  3DXK A;  4IO9 L;  4GV9 A;  3NVK A;  4GV6 A;  1Z05 A;  3CQY A;  3IUC A;  2HBM A;  4FWR A;  5ADX A;  3PIO L;  3IDH A;  4HTL A;  4MO4 A;  4KBO A;  5F2R A;  4JK9 A;  3E9O A;  5AQM A;  1P8Z A;  4DCH A;  3MDQ A;  2P9I B;  4JKE A;  4BG8 A;  1BU6 O;  2GTD A;  1YJW N;  3ID8 A;  2GUP A;  3EZW A;  3CI5 A;  3ZEU B;  1T6D A;  5BRH A;  5KQ8 A;  1YVN A;  1RDU A;  4A5A A;  3SAH A;  3K9K A;  4A5B A;  2GEM A;  3O80 A;  2GWJ A;  4JKC A;  5HOO A;  4IOC L;  3FZF A;  2P9P B;  4JD2 A;  3GDQ A;  5FPM A;  5AQQ A;  3R3L A;  3CHW A;  5HL7 L;  1H1V A;  3VGM A;  4BRH A;  3H6E A;  2NRH A;  2QA4 N;  2P9P A;  2E2Q A;  2UYT A;  2KKZ A;  1QQN A;  3RVC A;  2P9N B;  2WFB A;  4JN4 A;  3QML A;  1VQL N;  2QM1 A;  2NRZ A;  1EO1 A;  2HF3 A;  3OBW A;  2P9S B;  4O8K A;  1VQ9 N;  1OKJ A;  2P9K A;  3AGR A;  4NB4 A;  1NWK A;  3LDN A;  3M6G A;  3CJC A;  4M63 C;  4K43 A;  1RGI A;  4BY9 C;  1J6Z A;  2QTD A;  2E1Y A;  2A42 A;  1NGD A;  1R59 O;  1RFQ A;  3FZL A;  3D6R A;  5JLF A;  1GLC G;  2DPN A;  3GG4 A;  3U9Z A;  5I9E B;  1KD1 O;  4JKD A;  3BF3 A;  3BUZ B;  3FZH A;  4A61 A;  3VET A;  3ZYY X;  3WXL A;  4BRM A;  5BRF A;  2IVP A;  3QFU A;  1K73 O;  5AQG A;  2ZJR L;  1YHQ N;  1GLD G;  3CC4 N;  4Y0W A;  4AM6 A;  1BWF O;  3R6M A;  4A2A A;  2BH1 A;  1XQS C;  4EFH A;  1VQN N;  2F7T A;  2QWO A;  4CBX A;  4IJA A;  2D1K A;  3WQU A;  5M1N A;  5AQH A;  4YOW A;  3AAQ A;  3ZX3 A;  1GLJ O;  3UB5 A;  2QEX N;  2QXL A;  4RCH A;  4JKG A;  4OO1 J;  3ZET A;  2FSN A;  3EL2 A;  3I8B A;  3G71 N;  3CCQ N;  2HOE A;  1G99 A;  1QQM A;  2FLO A;  3WXM B;  3VEN A;  4ISE A;  1BDG A;  3C6H A;  1GLA G;  2E1Z A;  3F2K A;  3F9M A;  3HRG A;  4JHD A;  3VES A;  2EWS A;  3M3Z A;  3M5R A;  1KAY A;  3EKU A;  3CJB A;  3O9T A;  3W3D A;  1VQ6 N;  4I6M A;  4WFB L;  2ASP A;  2V7Z A;  4H0T B;  4PKG A;  4CD3 A;  2RHK A;  1OVY A;  2P9I A;  3DWL A;  3CD6 N;  5AQL A;  1HKG A;  3BF1 A;  1X9J A;  3JS6 A;  5E84 A;  5AQZ A;  3WEE B;  2HST A;  1YUW A;  5GAH P;  3A5L C;  3ULE A;  3KWI A;  2P9N A;  4OPH A;  4XH5 A;  3E9L A;  3LDQ A;  4BR9 A;  1JCF A;  3O9R A;  5TKW A;  4XEI A;  1X3N A;  3M1F A;  5AQX A;  4BC5 A;  4RWT A;  5CHI A;  1Q86 O;  4IOX A;  4BR7 A;  1P90 A;  1GLL O;  5BN9 A;  4ILH A;  2NNW A;  4QS7 A;  5AQK A;  5GAG P;  1NGI A;  2AA4 A;  3A5O C;  3OBY A;  5EOY A;  5DM7 L;  4MDA A;  1BG3 A;  2QWL A;  3UKR A;  5KQD A;  3TTD A;  4PL8 A;  3LDO A;  2QI2 A;  3D2E B;  3EE8 A;  3LM9 A;  3P39 A;  5LJW A;  5DM6 L;  1VQ8 N;  2CGL A;  3DXM B;  2P9L A;  3N4P A;  5GIP A;  2WUS A;  4JKA A;  4JKF A;  4FPA A;  1YIT N;  3CME N;  3SLC A;  5BPN A;  1XUP O;  3R1X A;  1NGH A;  4WFN L;  3D2F A;  3L6Q A;  3CCJ N;  3C7N A;  4H0X B;  1DGK N;  4I6M B;  1K8A O;  5M1O A;  3WT0 A;  4A57 A;  2ASO A;  4JAX A;  5F1X A;  3L4I A;  4BRD A;  3CET A;  3EE9 A;  1U2V B;  2CGK A;  2JWL A;  4H0Y B;  4GNI A;  1V4T A;  2V52 B;  3K9J A;  4BC3 A;  5TKY A;  1Z6R A;  4JKG B;  1T44 A;  4DQ8 A;  3VTH A;  3T7Z A;  2CH5 A;  3U4L A;  3TSU A;  2ZGY A;  3LM2 A;  3SBT A;  1NLV A;  3DXM A;  2VCP A;  1QHA A;  4NO7 A;  4PKI A;  1Q82 O;  2YCH A;  1SZ2 A;  3ID6 A;  2QWN A;  3MN7 A;  4L3Q A;  4YOU A;  4B1Z A;  3HOT A;  4WQ5 C;  3CJA A;  2YJE A;  3CPE A;  1ZXO A;  3VEY A;  1Q7Y O;  5JVG L;  1KAX A;  4ISF A;  3P31 A;  3U9D A;  3TSP A;  1KC8 O;  5GAD P;  2HBK A;  2GEL A;  4B1V A;  2QW9 A;  1WUA A;  2QWM A;  5EY4 A;  2H3G X;  3MX2 A;  4CZI A;  4A59 A;  5C2F A;  2YHW A;  2NLX A;  4EHU A;  3ATV A;  1NGJ A;  1NGC A;  5B8H A;  2HBL A;  1QVG M;  1VQ5 N;  4FL9 A;  4C1N I;  4GVE A;  3WXK A;  3LDP A;  2QWP A;  1NGE A;  3NVM A;  1IJJ A;  3EO3 A;  1K8K B;  3DXK B;  4WFA L;  5JVH L;  3AAR A;  1MA9 B;  3FGU A;  4B1X B;  2AP1 A;  3TTF A;  5M1F A;  3H3O B;  2V7Y A;  1JJ2 M;  3CCE N;  1E4G T;  1MWK A;  1W97 L;  4XH1 A;  4BRO A;  2A3Z A;  1DEJ A;  2BTF A;  4BGB A;  5BRE A;  3D2F B;  2NRW A;  4CZF A;  3FZM A;  2ZF5 O;  5FPD A;  4BVP A;  3QB0 A;  2CGJ A;  4BRI A;  1ZC6 A;  3MN6 A;  5MLC Q;  3GL1 A;  1DKG D;  4WQ4 C;  3CCM N;  3MX5 A;  1BUP A;  3S41 A;  3H1Q A;  5C12 A;  3VEW A;  5M1K A;  2JWK A;  3WXJ A;  2CH6 A;  2FSJ A;  5JMV A;  3NMU A;  3EKS A;  3MN5 A;  3UKR B;  3CCR N;  4CBU A;  1W2B M;  2VGN A;  2QWR A;  4BRA A;  2YX6 A;  3QIC A;  1NJI O;  4CZK A;  3B8A X;  4M7Y A;  2OAN A;  2GX9 A;  2GWK A;  3LDL A;  5AQN A;  3P4I A;  3H45 C;  5GIO A;  1NMD A;  5E26 A;  5KPZ A;  4YDU C;  3HOS A;  1YI2 N;  1WOQ A;  3BEX A;  3OA9 A;  4IO8 A;  4A62 A;  4EHT A;  4C23 A;  2P9K B;  1E4F T;  4BC2 A;  1BO5 O;  4YOY A;  4MDB A;  3A0I X;  4C1N K;  1NGA A;  3CCS N;  2Q2R A;  3E66 A;  3O9S A;  4QS8 A;  4CZJ A;  4UY8 O;  3P38 A;  4EAH D;  3G25 A;  3LL3 A;  3R8E A;  3KK7 A;  3C0B A;  3T69 A;  3MWT A;  3UKU B;  1NM1 A;  4E1J A;  4NLB A;  3MCA B;  3SAF A;  1GLF O;  2D4W A;  4FWQ A;  2IVN A;  4B1U B;  5AQJ A;  5GIN A;  2P9U B;  3UKU A;  3ZX2 A;  5KPR A;  4IEI A;  3VF2 A;  3CMA N;  1TUY A;  2HF4 A;  4IEE A;  5AZI B;  2NRX A;  4H0V B;  4CZM A;  3VF4 A;  4WCE L;  3HBT A;  4YOT A;  4BRC A;  1TYQ A;  5F0X A;  2VWB A;  1VQP N;  3J8A A;  3VGK A;  4ISG A;  3VPZ A;  4AF1 A;  3VGL A;  2VGM A;  4IZ9 A;  3FFK B;  2KLA A;  2ITM A;  5CE3 A;  3O9Q A;  2FSK A;  3FZK A;  3RSE B;  3CC2 N;  3VEO A;  2YHY A;  4LC9 B;  3QDK A;  3C7N B;  1YJ9 N;  3CIP A;  1HUX A;  4YOR A;  3FR0 A;  4PKH A;  2WC9 A;  3WEE A;  4DHY A;  4JKB A;  1HJO A;  4FWO A;  4BR5 A;  2E88 A;  4YOV A;  3G4S N;  4IXC A;  3E1Y A;  3W0L A;  1SAZ A;  1TYQ B;  3O9U A;  5EVZ A;  4JHD B;  3TSQ A;  2A5X A;  1HPM A;  3WXI A;  5AQT A;  2E2N A;  4H5W A;  3SBG A;  4BRK A;  3HTV A;  1Q81 O;  3MCP A;  1NBW A;  3PIP L;  5BPM A;  1Q18 A;  1HX1 A;  2IVO A;  4WF9 L;  4CBW A;  1KQS M;  1T6C A;  1LOT B;  4YOX A;  3O1B A;  2Q97 A;  1QQO A;  3N4Q A;  3IKM A;  4BQZ A;  1VQO N;  3FE1 A;  4WQ4 A;  3VF6 A;  1BOT O;  3O1W A;  1BA1 A;  3HM8 A;  4BRF A;  3J7Z O;  4EIA A;  5AQP A;  1U2V A;  3Q7B A;  4CI6 A;  3AAP A;  5BN8 A;  1VQK N;  3DJC A;  2FF6 A;  2NRT A;  3CJ7 A;  4A2B A;  3KZB A;  3GE1 A;  4BRG A;  4CZE A;  4MO5 A;  1KAZ A;  1YJN N;  1YXQ A;  4PHT X;  2NRR A;  5AQI A;  1MDU B;  3ULE B;  1VQ7 N;  1V4S A;  1NGB A;  3ENO A;  1HLU A;  2I7N A;  4BQL A;  4FPB A;  1C0F A;  4H5T A;  3KVG A;  4OPA A;  3O8M A;  3CXC M;  2Q0U A;  3A5M C;  5AQU A;  4BRE A;  4F9O A;  1Y64 A;  5EX5 A;  2A41 A;  5M1Q A;  3VEV A;  4BRL A;  1NGG A;  2BUP A;  3VTI A;  2W41 A;  2D0O A;  1S3X A;  2D0P A;  5AQS A;  3CF5 L;  4G9Z A;  4KH6 A;  3ZET B;  1BA0 A;  3MN9 A;  3QBW A;  3H3N O;  1HKB A;  2Q0R A;  2FXU A;  3GOI A;  3A8Y A;  4FWM A;  3HZ6 A;  3ENB A;  1VQM N;  2I7P A;  4FWL A;  2ASM A;  4FO0 A;  1JCG A;  5AQR A;  3SAG A;  5AR0 A;  3TU5 A;  3I56 N;  4JK7 A;  3BP8 A;  3ZX0 A;  4BGA A;  4RTF D;  3MMV A;  3O4W A;  4ILG B;  3I55 N;  1X3M A;  3CJ1 A;  4FWK A;  3ZEU A;  2E2P A;  4IDH A;  4R79 A;  2ZWH A;  1ATR A;  4H0P A;  2A40 A;  5LJV A;  4JNE A;  3HI0 A;  1QVF M;  4MLE A;  5BR9 A;  4K25 A;  4K42 A;  2HMP A;  4KH4 A;  2YJF A;  1U6Z A;  1ATS A;  4H0O A;  4AM7 A;  2ZJP L;  2RE2 A;  4DKW A;  4K41 A;  4IOA L;  2P9U A;  3WUH A;  3H46 O;  3L4Q A;  3TTC A;  3D7E O;  5AFU H;  4BRN A;  5AQW A;  1YAG A;  3VER A;  3O08 A;  3ATU A;  3CER A;  3HSC A;  4WYB A;  3CCU N;  5AFU A;  1S22 A;  2E8A A;  3C6A A;  4BR2 A;  1EQY A;  4JK8 A;  2ZGZ A;  4YDU A;  5ELZ A;  1ZBS A;  4B1Y B;  5AZJ A;  2F9T A;  1ATN A;  3A5N C;  3QFP A;  4H03 B;  3E9P A;  1ILY A;  1GLB G;  4FWN A;  4FVU A;  4M7X A;  3OW2 M;  3SJH A;  2IIR A;  3SK3 A;  2VYP A;  3CCL N;  3L0Q A;  4GY2 B;  5CR4 A;  5KPT A;  2OTJ N;  3ENH A;  2P9S A;  3U8X A;  3IFR A;  1JCE A;  4O5F A;  1QZ6 A;  2E20 A;  4U67 L;  3G6E N;  1RDW X;  4FOE A;  3O5B A;  4H5R A;  1VQ4 N;  5AZI A;  3D2E A;  4IFE A;  4BVO A;  3OHR A;  2NRV A;  5BRD A;  2QWQ A;  1VAZ A;  1D4X A;  3MK6 A;  2P9L B;  3CJ9 A;  4BG9 A;  2PBD A;  4KH5 A;  1C0G A;  1YF5 L;  4IWV A;  4CZG A;  2NZT A;  4FWP A;  5GAE P;  1QZ5 A;  3CPW M;  4IJN A;  5FPN A;  4B1W B;  4FOI A;  3IMX A;  5AQY A;  2Q36 A;  2Q1N A;  4H5N A;  5C2D A;  1KXP A;  3C65 A;  4BRQ A;  5AQF A;  1XC3 A;  4O8U A;  4FWS A;  3TPQ A;  4CD1 A;  3PLA A;  4GV3 A;  5M1P A;  1GLE G;  3R9P A;  3SMS A;  1N8R O;  2OTL N;  4PL7 A;  3VEX A;  4BR0 A;  2HBJ A;  5LY3 A;  2V51 B;  4CZL A;  2YI1 A;  3FLC O;  3O6W A;  3QBX A;  2E2O A;  4J8F A;  3SMP A;  4H5V A;  1DT9 A;  5JLH A;  4MLH A;  3AGK A;  3KHY A;  5BPL A;  3CCV N;  3RSE A;  3MWP A;  1M1K O;  5C0Y A;  3CC7 N;  3VEZ A;  3EN9 A;  3I33 A;  4B9Q A;  2PFU A;  1MWM A;  2W40 A;  4WQ5 A;  4CZH A;  5AQO A;  4Z94 A;  4JEP A;  1K8K A;  1O13 A;  5ADX H;  4QS9 A;  2J4R A;  4BC4 A;  1T3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...