3BF1A

Type iii pantothenate kinase from thermotoga maritima complexed with pantothenate and adp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 73
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf1A01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf1A02
4CD3A 4PL7A 4JN4A 3KVGA 2I7NA 4M7YA 2PAVA 4CZLA 4FWNA 4B1ZA 2P9SA 4GNIA 5BRFA 2HF3A 3M6GA 4YDUA 1MWKA 3S41A 5KQ8A 3FFKB 5F1XA 4FWLA 4FSVA 3EN9A 5BPMA 3CJ1A 3WXLA 3R9PA 3QDKA 4BRAA 5FPNA 4BVOA 2ASMA 4BR4A 3VEOA 3QICA 1HPMA 1GLEG 2QW9A 3DXKA 4QS9A 3OHRA 4CD1A 1T6CA 1DEJA 4HTLA 3AY9A 4H0YB 3HZ6A 1V4TA 1ATRA 2A3ZA 4L3QA 5JICA 5AQMA 3O6WA 2EWSA 2ZWHA 4JNEA 3F9MA 4H0TB 3CETA 4NB4A 3ATUA 3JXUA 1BO5O 4FOIA 2FXUA 3FZFA 4BR5A 4WQ4C 1HJOA 3VEVA 2IVPA 1NGCA 3VF4A 3EKUA 4BRDA 4CI6A 3QB0A 4FWQA 4DCHA 3AARA 3TU5A 2V7YA 3H46O 3R8EA 1YUWA 2IIRA 1NWKA 2BTFA 4BR2A 4Y0WA 1GLDG 5AZIB 2D0OA 5ADXA 3UKUB 4BC2A 4CJ7A 2Q36A 3H3OB 3GL1A 1HLUA 4B9QA 4MLHA 3L4IA 1Y64A 1NGJA 2QXLA 3AAPA 2W40A 3SMSA 3FZHA 4IO8A 3ULEB 5B8HA 3LDPA 1ATSA 2F9WA 3DXMB 1BG3A 3UE5A 1JCEA 5FPMA 1NGAA 1WOQA 5EY4A 3IMXA 5TKYA 4BQZA 3ZETB 3WEEB 3CERA 2V7ZA 1ATNA 1E4FT 4BC5A 3WT0A 3VESA 5AQJA 2ITMA 2NLXA 2E2PA 3CJCA 3VETA 5BRDA 4H5VA 5BREA 4IJNA 4XH1A 2P9PB 4K43A 1MDUB 3FLCO 4JHDB 4IJAA 3VF2A 4PKHA 4J8FA 3GE1A 2OANA 4EHUA 5BPLA 4BRIA 3GBTA 5BN8A 2P9KB 5EX5A 3U9DA 4JAXA 4EHTA 1HKGA 1NGDA 3QFUA 4BC4A 3H1QA 2HMPA 3ENHA 3KZBA 1DKGD 3VGLA 3W0LA 4FPAA 4BR0A 2AP1A 2ASPA 2F9TA 3RSEB 3VENA 2QWQA 2V51B 3D2FA 3HTVA 3MK6A 5AQVA 1QQNA 3VF6A 4RWTA 3L0QA 2QWMA 4A2BA 4IZ9A 3ATVA 3LM2A 3P4IA 4H5NA 5KPZA 3SK3A 1KAXA 2FSJA 4FWOA 2YHWA 4XH4A 3M1FA 4AM6A 2QWLA 3MN7A 3FR0A 4B1YB 2ZF5O 5AZIA 2QM1A 2GWKA 3UKUA 4PKGA 3C7NA 1NGIA 1X3MA 4H5RA 3VEXA 2A6AA 4WQ4A 3MN9A 5FPEA 5KQDA 5JLFA 2HOEA 3BP8A 2P9UA 4BRHA 3U4LA 3D2EB 4NO7A 3ZX0A 2A40A 3QBWA 3ULEA 4IWVA 1ZC6A 5BRHA 3FZKA 3CQYA 1J6ZA 3WEEA 2J4RA 3HBTA 2BUPA 1T6DA 4IXCA 5AQFA 1BU6O 4CZJA 4A61A 2D4WA 2CH6A 2E88A 3LL3A 2YCHA 2VCPA 3H45C 3TPQA 3FZMA 3W3DA 1NBWA 3CJBA 5FPDA 3O8MA 3LDNA 1Q18A 4I6MA 2I7PA 5LJWA 4B1WB 3VGKA 1TUYA 3VGMA 3A5OC 3BUZB 4FOEA 2ZGZA 3KHYA 2P9PA 3IUCA 2AA4A 5E84A 1RDWX 1NLVA 3FGUA 4BGAA 1NGHA 1U2VB 2ZGYA 3DAWA 2FSKA 4JHDA 3ZX2A 3CHWA 2YI1A 1GLJO 1LOTB 1NGGA 4H0OA 2GWJA 3AAQA 3SJHA 1XQSC 5AQZA 1YAGA 3DWLA 1KAYA 3CI5A 4M7XA 2YHXA 1NGFA 5AQTA 5AZJB 5EVZA 4BR9A 3BF3A 4RCHA 1JCGA 2CH5A 4E1JA 2GEMA 1MA9B 1RFQA 2FLOA 1X9JA 4MO5A 5AQGA 2E20A 1Z05A 2FSNA 4CZEA 5AQKA 3J8AA 2P9LA 2E2NA 2Q31A 1ZXOA 1NGBA 2PBDA 3HI0A 3WQTA 3A5LC 1HKCA 4FWKA 3FE1A 1HUXA 5AQOA 2Q2RA 3U8XA 3O5BA 2GUPA 1H1VA 5E26A 4A62A 5CE3A 1Z6RA 2D1KA 4BROA 1S22A 4O8KA 3D2EA 3MCPA 4BRLA 2FF3B 4WQ5A 4K41A 2E2OA 3HSCA 3CIPA 2QWPA 3ZX3A 5AQRA 2D0PA 5AR0A 4FPBA 1LCUA 3EZWA 3BEXA 2KHOA 1NMDA 4FWSA 1E4GT 2YJEA 3ID8A 1HX1A 3EO3A 3CJAA 4GY2B 3SMPA 3LM9A 1TYQB 3O1WA 2VWBA 2IVNA 4K42A 4XH5A 3L6QA 5EXWA 1U6ZA 2E2QA 3MDQA 4M63C 1X3NA 3H1VX 3BF1A 5AQHA 5AQLA 5KPRA 1QZ5A 1OKJA 4DB3A 2ASOA 1V4SA 4WQ5C 3JS6A 5AQYA 1BDGA 2A5XA 1BA0A 3R6MA 4B1UB 4BC3A 3ENOA 1QQOA 3MMVA 2Q97A 2Q0RA 3H3NO 1S3XA 4BVPA 2A42A 4CBXA 5LY3A 2HF4A 4BGBA 4FL9A 3QBXA 4H03B 4F9OA 4ISFA 5AZJA 1XUPO 3O4WA 2E1ZA 3WQUA 3ZEUB 4BG8A 3DXMA 1QHAA 2P9NB 4PKIA 2GELA 3LDOA 3UKRB 4FWMA 3ZETA 2UYTA 3IFRA 4H0XB 4JD2B 4LC9B 2YHYA 1HKBA 2GTDA 2NRHA 3WXJA 2CGJA 1IG8A 2W41A 1GLBG 3O1BA 3VPZA 3VEZA 5AQXA 3CQXA 2QWOA 5BPNA 3MN5A 5F0XA 2FF6A 2P9IB 3I33A 1K8KB 3C0BA 4BG9A 4QS7A 3VEWA 4BRMA 2IVOA 1XC3A 4FWRA 1SQKA 4BRFA 5I9EB 4WYBA 5AFUH 1GLCG 4BRPA 4O5FA 3FZLA 3A0IX 3GOIA 2E8AA 4CBWA 4QS8A 3G25A 3VOVA 3A5MC 3D2FB 1G99A 4YDUC 2P9KA 3D7EO 5ELZA 1IJJA 4H5TA 3GDQA 1C0FA 1BWFO 2A41A 1MWMA 3LDLA 4K25A 1RGIA 1QQMA 4RTFD 4BRQA 5JLHA 5AQUA 3RSEA 1YXQA 3WXKA 3CJ9A 3LDQA 3MN6A 4XEIA 3I8BA 1NM1A 1TYQA 3WUHA 5AQQA 4H5WA 1YVNA 2P9SB 3VERA 5KPTA 1WUAA 1SZ2A 3QFPA 1NGEA 4H0VB 2H3GX 3C7NB 5BN9A 4EFHA 3EL2A 2P9UB 3QMLA 3DXKB 1JCFA 2QWRA 5LJVA 5JMVA 5F2RA 1ESVA 4CZHA 4Z94A 1BA1A 1GLFO 2Q1NA 1KAZA 3ZEUA 4CZKA 1EQYA 2P9NA 4CBUA 3HM8A 4BRKA 3H6EA 1DGKN 4ISEA 3UKRA 4I6MB 3UB5A 3WXIA 3SLCA 3CJ7A 4JD2A 4B1XB 4PL8A 4BREA 1KXPA 1T44A 1TUUA 1CZAN 4CZIA 1BUPA 4CZFA 1ZBSA 3EKSA 4A2AA 5AQWA 5AQIA 3O80A 2YJFA 2VYPA 3GG4A 4AM7A 4MLEA 4EAHD 2P9IA 5AFUA 4HWIA 4DHYA 5AQPA 1K8KA 2DPNA 2E1YA 3VEYA 2QWNA 4KBOA 5EOYA 3M3ZA 4FO0A 4BRGA 2CGKA 4FWPA 4BRNA 1GLLO 4BR7A 4H0PA 2NZTA 1R59O 3B8AX 1U2VA 5ADXH 3DJCA 1P8ZA 1C0GA 5BR9A 4B1VA 1BOTO 3A5NC 4ISGA 2CGLA 4DQ8A 4CZGA 2WUSA 4BQLA 2Q0UA 5AQSA 4MO4A 5AQNA 3U9ZA 4C23A 1D4XA 4BRCA 4EIAA 4CZMA 1QZ6A 3IDHA 3O08A 1GLAG 3A8YA 1SAZA 2V52B 2P9LB
chains in the Genus database with same CATH superfamily
4AHSA 4CD3A 1HNXK 3CCEN 4M7YA 2PAVA 4N56A 2GBZA 4B1ZA 3AGKA 2QKBA 2P9SA 2KFZA 2HF3A 3M6GA 5CY4A 1EKEA 3F5TA 4FSVA 3L2VA 2HNZA 3CJ1A 4OKEA 2O8DA 3R9PA 3VQ5A 3TSPA 4CD1A 3O4QA 5GAEP 1T6CA 4HTLA 2HVIA 1V4TA 2OYQA 2F8TA 4L3QA 2X74A 4H0TB 3CCUN 3WXMB 2WOMA 3ATUA 4DR2K 1LW2A 3JXUA 3F73A 4DTPA 1G15A 2FXUA 3FZFA 4DQQA 3AO4A 1NGCA 5GIPA 4BRDA 4Y1CA 4CI6A 3HVRA 4KTWA 3QB0A 1VQ8N 4MFBA 3AARA 3TU5A 3LP3A 2V7YA 3H46O 4M3RA 1YUWA 4A59A 1S9GA 4W5RA 4BR2A 1IKVA 1LW0A 1KLMA 1OVYA 3O4NA 1QSYA 1VQNN 1HLUA 2XHBA 3ZT1A 3ULDA 1JLFA 1NGJA 2Z1HA 2QXLA 3MWPA 3QIOA 3U3YA 2IS3A 3LDPA 5B8HA 1BG3A 1WBBA 3NGYA 1KRPA 3NAEA 3VQ8A 5EY4A 3IMXA 5TKYA 4CEBA 2LSNA 4DTOA 4KI6A 1S1VA 4OO1J 2OCEA 4OKJA 3CCMN 4BC5A 2QEXN 3VESA 5AQJA 2ITMA 4OJRA 1HYSA 5BRDA 1FKPA 4JKGA 3ZSQA 1LAVA 4FJ9A 3DOLA 1FJGK 3CC4N 3CXCM 3D0PA 4JKCA 2B5JA 3GE1A 2OANA 3AVMA 3SV3A 4KH5A 3MX5A 4JAXA 1N6QA 3PUFA 1HKGA 4KTZA 5SWMA 3MEDA 4FJLA 2AP1A 4CECA 2KFNA 4AHVA 2QWQA 4DSIA 5AQVA 2W6KA 2YHAA 3PIOL 2QWMA 3VTIA 5CYMA 3ATVA 1RILA 2QK9A 1C1AA 3SK3A 2E5LK 4MDAA 1JLEA 2VQEK 4DLEA 4PQUA 1EXQA 5JS2A 4DMNA 4FWOA 2YHWA 1VSFA 4LSLA 4NXNK 5IT9O 4FJJA 2ZF5O 2WONA 2ZQBA 5AZIA 1JL2A 2QM1A 3DRRA 1NMNA 3UKUA 3TTDA 4PKGA 4KHYA 5J1EA 4CGGA 1NGIA 1N32K 1HJRA 1RDAA 1VSIA 2JLEA 4CJ5A 4DFKA 1KFSA 4NO7A 1QVFM 4DUZK 3CCQN 1NJYA 3ULEA 4IWVA 3FZKA 1QSSA 3TAQA 3C6AA 3HOSA 5KGWA 3WEEA 4O0JA 4CEZA 3D6RA 5H1SQ 2BUPA 1KTQA 1T6DA 4JI1K 5AQFA 1WSJA 1ASUA 3AVLA 1MU2A 3DLGA 3FZMA 3W3DA 1LV5A 1NOZA 3VGMA 5C12A 4NLBA 1Q9XA 3KHYA 4B9VA 2P9PA 3RR7A 3C94A 1VQMN 5E84A 1NLVA 1NGHA 4FLZA 1QSLA 2X6NA 4TSXA 2RKIA 3V1RA 5M1QA 1SL2A 4JS4A 3L2UA 3SJHA 4C1NK 5AQZA 3V4IA 4WE1A 1KAYA 4DG1A 2YHXA 2DFEA 5AQTA 5EVZA 3BF3A 4RCHA 3AA5X 4DQPA 2PYLA 2GEMA 1D8YA 1EWRA 5J2NA 3NBPA 1X9JA 3DLRA 5LMUK 4CJRA 1Z05A 4ELUA 3DLKA 3J8AA 1NK4A 2Q31A 2UU9K 2ZD1A 2HHHK 2G8HA 1VQ4N 1NJXA 3PY8A 4E0DA 3A5LC 4Z4IA 3FE1A 2NRRA 2RN2A 3OYFA 3V9WA 1DLOA 1S6QA 3O5BA 1H1VA 4A62A 2O8CA 1XWLA 4A5AA 1XMQK 4O8KA 4BRLA 5J2PA 3ID6A 1RBTA 4RW6A 2E2OA 3ZX3A 3NCIA 3NE6A 5AR0A 3NFAA 4FWSA 4RW8A 3CJAA 4GY2B 3EE9A 2NNWA 4C1NI 4O4GA 2E2QA 4FLUA 1NU0A 5AQHA 5KPRA 1QZ5A 1TL3A 1V4SA 4WQ5C 5LL6Z 4RG8A 3RRHA 2HBKA 2Q97A 3DMJA 3H3NO 3AVGA 3CFOA 2W6LA 3PSFA 4H03B 4LFCK 1U45A 1QHAA 3O9SA 4PKIA 3LDOA 3UIQA 3CF5L 4H0XB 1IBMK 3N4QA 1Z26A 1LWCA 3KJVA 2NRHA 3O1BA 1IG8A 2HB5A 2W41A 4IEIA 3EZ5A 1VSHA 3ZCMA 3MN5A 1A5VA 3KTQA 3K5OA 1YT3A 4B9MA 3T3FA 1TKTA 4E7LA 3M8RA 4WYBA 5AFUH 4HCBA 1BQNA 4O5FA 4QS8A 3G25A 3VOVA 3MXJA 1SL1A 3K5NA 3DLHA 3D2FB 3VQ4A 2P9KA 5KRTA 4HUGA 2HNDA 1RT1A 2YKNA 1BWFO 2A41A 4DTXA 4GV9A 1MWMA 4LF5K 1RGIA 1RT6A 4RTFD 1QVGM 3OYDA 3DLEA 2PY5A 1HYVA 2OPRA 1NM1A 1TYQA 2HBMA 3NF8A 4OVLA 4YHHK 4JKHA 3G71N 3HP9A 1WSGA 1B9FA 1HMVA 4GKKK 1OH6A 4GKJK 2O4IA 1HQEA 5BN9A 2OA8A 4EFHA 2BE2A 3MWTA 3DI6A 1TAQA 3DXKB 4IFEA 4DU1A 3L2QA 1XNQK 1W97L 3BGRA 3K2PA 1NG9A 4LF4K 2XRIA 1K8AO 4FXDA 2ATQA 3AVFA 4IG0A 1KAZA 4CBUA 3O3FA 3HM8A 4BRKA 4JI5K 3P31A 4I6MB 3JAMO 3NF7A 3UB5A 3O9RA 3SLCA 4BREA 3C6UA 3THYB 1KXPA 1CZAN 4CHNA 4CZFA 1CLQA 3HRGA 5AQIA 4B9SA 2VYPA 2F4VK 4KO0A 3J81O 4HWIA 2VG5A 3TSUA 5AQPA 1BI4B 1K8KA 5A2QO 3CG7A 4OPHA 4YY3K 4OGEA 2CGKA 4FWPA 4BR7A 5C25A 3VQPA 2NZTA 4JI8K 2NRZA 1UAXA 3B8AX 1C0GA 4FJ7A 3HVTA 3F2KA 4ISGA 4O55A 1VSDA 3I55N 2WUSA 4CIEA 3ZSWA 3OYHA 5DK5A 5AQSA 2HHSA 3LALA 3IDHA 4GMJB 1LWFA 1JL1A 1GLAG 4KV8A 4BE2A 2P9LB 1RBVA 4CFDA 3O3HA 1TKDA 4CZLA 1HNVA 4E7HA 3CCJN 2UXBK 3CC2N 4CJQA 3EY1A 5BRFA 4CJKA 4F3TA 2O4GA 5KQ8A 1WN7A 5F1XA 3EN9A 4FJXA 5BPMA 1HRHA 3L2RA 3CMEN 1IBLK 4RW7A 3VEOA 1HPMA 1DEJA 4CEDA 4H0YB 3HZ6A 2PYJA 2F7TA 1J5OA 4I2QA 5JICA 2HVHA 5HRRA 4C8LA 2KZZA 2ZWHA 1YI2N 3F9MA 1L5UA 4M3TA 3CMAN 3CETA 4CW7B 1BO5O 4FOIA 3J7ZO 3B6OA 4BR5A 1WSHA 1HJOA 3VEVA 4LSNA 3G6EN 3THWA 3EKUA 4DR1K 1VSKA 4FWQA 3I8DA 4DCHA 2VG6A 4KAZA 4HHTA 4KB1A 1NWKA 3C6HA 3L2WA 4ZTFA 1XHZA 3DM2A 5ADXA 4CJ7A 2EHGA 2GV9A 4BC2A 1S6PA 2Q36A 1WBDA 4B9QA 4LF9K 1Y64A 4X65K 2DFFA 4B9TA 3ZSYA 4BDZA 3NF9A 3FZHA 5E41A 1SUQA 3IS9A 3DXMB 4B8CA 3UE5A 1JCEA 5FPMA 4F2RA 4BQZA 3ZETB 1TV6A 3DYAA 3HOTA 4DV2K 1VSEA 4RW4A 3SPZA 3CCRN 1ATNA 2VWJA 2NRXA 3WT0A 1HPZA 3CJCA 3VETA 5BREA 4XH1A 2NRWA 4CIGA 4GW6A 2OTJN 1BHLA 4K43A 2UUCK 1MDUB 1HYZA 3FLCO 1Q81O 4B3MK 4DSKA 2I5JA 4JHDB 4JI6K 4IJAA 1REVA 2NUBA 3KIOA 4J8FA 4JS5A 5BPLA 4BRIA 3QEVA 3GBTA 1EWQA 1M90O 4H4MA 3U9DA 4E1MA 3RR8A 4DSFA 1NGDA 2HMPA 4AHTA 1DKGD 3IG1A 2F9TA 4JK8A 3RSEB 5HRNA 1K9MO 4L8RB 5C0YA 3MK6A 3K57A 1QQNA 3VF6A 4AHCA 3L0QA 4A2BA 4WFAL 4IZ9A 1Q7YO 1KQSM 4Z0UA 3P4IA 5C24A 3HT3A 5KPZA 4IFVA 1YJ9N 4XH4A 3WNHA 1IBKK 2NRTA 2KLAA 3PSIA 1SKSA 5HLFA 2AJQA 4E7JA 3PO5A 4IKFA 4KHUA 3KWIA 3C7NA 1KLNA 4KHNA 1X3MA 5I3UA 5KQDA 4WQ4A 5JLFA 1GOBA 2P9UA 3CC7N 3D2EB 4H4OA 2A40A 1JLAA 2D0BA 3V9SA 5BRHA 2YNFA 3EYZA 1VHXA 5DM6L 3OS1A 1J6ZA 3DLBA 1IKYA 2J4RA 3QEPA 3SAGA 1X9MA 1BU6O 4CZJA 3D45A 2CH6A 1VQON 3CCLN 1N8RO 1J54A 4G1QA 1L3TA 2VCPA 3H45C 2ETJA 4DTJA 1NBWA 1U47A 5FPDA 3O8MA 3OYJA 4HUFA 2I7PA 3VGKA 3A5OC 3IUCA 1U4BA 2JWLA 3FGUA 2FSKA 3ZX2A 3K58A 2VWKA 1KVAA 1KFDA 3R3LA 3RMAA 3NGIA 4Z4CA 2GWJA 3AAQA 4DV6K 2YNIA 3AVHA 1RT3A 1YITN 4FZYA 1YAGA 3S3NA 4M7XA 1UA0A 3J7AP 1JLBA 1I39A 3O9TA 3M8QA 4KH4A 2CH5A 2YNHA 3LP0A 1Q9YA 3JSMA 1T3VA 1RFQA 2YV0X 5AQGA 4BACA 3OYMA 1B9DA 4N47A 4YFUA 1WSFA 1XNRK 2WFBA 2O8DB 2VG7A 3HI0A 4KFBA 1WNSA 1BIUA 1HKCA 4FWKA 3R1XA 3L8BA 1HUXA 1WAJA 5AQOA 4XIUA 2Q2RA 3T7ZA 2WTUA 4M45A 3U8XA 5FROA 5E26A 5CE3A 2BDPA 3KD5E 4OLAA 1Z6RA 2WBNA 3MCPA 5HP1A 4OX9K 1HNWK 4M3ZA 3V9XA 2FF3B 4DV7K 3V9ZA 1FK9A 3CIPA 5AQRA 1C1BA 2D0PA 3S3OA 4ZHRA 2KHOA 1E4GT 3SCXA 2IGIA 2W42A 4OPKA 4DSLA 3LM9A 1W9HA 2IVNA 4R5PA 5EXWA 1U6ZA 3S3MA 4EZ6A 3BF1A 4ELVA 5EU7A 3QEWA 4C8KA 4CGJA 1OKJA 1T05A 4DB3A 4B8AB 2FBVA 2KZMA 5KI6A 5M1FA 1B92A 1BDGA 4BC3A 1KCFA 3R6MA 4BE0A 3ENOA 3OYLA 4JI2K 2OTLN 4GV3A 3M8PA 4C8MA 1J53A 4BVPA 2X6SA 1T7PA 5LY3A 2G8IA 4F9OA 2XY5A 3THXB 3HYFA 3KK1A 4A57A 3O4WA 3ZEUB 3LZIA 4DFJA 2D5RA 2P9NB 3RMBA 2HBLA 4FWMA 4JKGB 3IFRA 4WFNL 4PUOA 2YHYA 4FK2A 1HKBA 3WXJA 2O8FB 2CGJA 1GLBG 3VPZA 3V1OA 3CQXA 1HNIA 4E7KA 3LAMA 4K8XA 4E7IA 5F0XA 4B9LA 1GOCA 2P9IB 3PIPL 4JKBA 3TANA 3C0BA 4BG9A 4FWRA 3OY9A 4BRFA 3O9QA 1HR0K 2OZSA 4BRPA 3A0IX 4CBWA 3PX4A 2ZE2A 4DWIA 4H8KA 2BH1A 4I2PA 1S5JA 2G8WA 3D7EO 4CEQA 1KC8O 1RCHA 4DV1K 3ZSXA 3GDQA 4F3OA 3TAEA 2IOCA 1ZBUA 4ID5A 5T7BA 4CCHA 3S9HA 4U7BA 5JLHA 1I3AA 1UOCA 3WXKA 3M5RA 1CZBA 1W2BM 4XEIA 3I8BA 2QI2A 4OPAA 4JRQA 2ZJPL 4DTSA 4LFAK 1YVNA 3VERA 1RT2A 5M1PA 1NGEA 2H3GX 4DFPA 4M3WA 1SKWA 1SL0A 2Z1JA 1YVUA 3WNGA 2FC0A 3VQEA 1JCFA 3SAHA 4IDHA 4PHTX 2QWRA 2V52B 5F2RA 1O1WA 1TAUA 3MEEA 3P1GA 1CXUA 4E19A 4PA1A 3QNNA 5C42A 3SUOA 3AVAA 1Q86O 3CQ8A 2Q1NA 1XMOK 1WLJA 3AV9A 2HBJA 3PLAA 1CZ9A 1A5XA 4EZ9A 1VQ6N 4FLYA 4FJ8A 3AO1A 1DT9A 3LANA 1ZBSA 3EKSA 4RW9A 4A2AA 3O80A 4NCGA 2F96A 4AM7A 4MLEA 4EAHD 4F8RA 3E9LA 1IKWA 4CJEA 2XY7A 1VQLN 3VEYA 1FW6A 2QWNA 5EOYA 3M3ZA 4X66K 4FO0A 4CJUA 4DQRA 4YOWA 1GLLO 3TSQA 3HM9A 1U2VA 1TGOA 1RTJA 4O8UA 5BR9A 2FBTA 5GIOA 1BOTO 2YNGA 2CGLA 4CZGA 4BQLA 2Q0UA 4LY7A 3U9ZA 3OJUA 4C23A 1D4XA 5DMRA 4CERA 4DF8A 3OBYA 4O44A 1TKZA 2KW4A 2HNYA 3VTHA 2IC3A 3KVGA 2I7NA 3TTCA 1ITGA 2A1SA 4FWNA 1TVRA 3M8SA 1YIJN 2FBXA 4GNIA 4DU3A 3QLHA 5HBMA 2ITGA 4YDUA 4Z4HA 3SQ4A 4AILC 2FBYA 4YORA 3WXLA 3HK2A 3QDKA 5FPNA 2ASMA 4BR4A 3B6PA 3QICA 2QW9A 3DXKA 4FLWA 3OHRA 3AY9A 1KD1O 1DTTA 1ATRA 2A3ZA 3NMUA 3CFPA 5HOOA 3ZT3A 2UXDK 1XHXA 3PO4A 5AQMA 3O6WA 1DTQA 3NF6A 4CF8A 3P38A 4DFMA 4JI0K 1BGXT 3AVCA 4DKWA 1M1KO 4NB4A 3MEGA 1IV0A 4LF6K 3PV8A 4WQ4C 2QXFA 1A5WA 3VF4A 1Q82O 4JKDA 3THYA 3OVNA 3SV4A 1Z25A 4JV5K 2DY4A 3SNNA 4NLCA 4BDPA 4CHPA 4FVUA 3AVIA 3MAQA 5C2DA 2HHTA 2P5GA 1GLDG 1BI4A 3QIPA 4CJLA 4QCLA 4MLHA 2ZM6K 5SZTA 1T03A 4CFCA 4WCEL 5HL7L 1UA1A 3ZSOA 3SMSA 4IO8A 3SQ0A 1ATSA 2F9WA 1RDCA 3K9KA 4BE1A 1WOQA 1UWBA 1RNHA 3OW2M 5JVHL 4ILJA 4PY5A 2V7ZA 3ZSVA 2VGNA 2BANA 4JLHA 1IKXA 3DLLL 3BZCA 4Q0BA 2NLXA 3HSTB 1NK0A 4H5VA 4AHUA 4M3YA 3QETA 1S1UA 2UUBK 4QOZB 1N5YA 3VF2A 4FM0A 4PKHA 4N41A 4EHUA 4F2SA 4KB0A 4CF9A 3AO5A 5BN8A 2P9KB 3C95A 1BCOA 1EETA 3QFUA 3H1QA 3KZBA 1YJNN 3VGLA 3W0LA 4DV3K 4FPAA 4C8NA 2UUAK 4B08A 3E9PA 3VENA 3DRPA 2V51B 2IDOA 3J7YP 4RWTA 4DSJA 4YNQA 1S72N 4JYAK 4JKEA 5HROA 2Z1GA 4MQ3A 4CEFA 3QERA 4F4KA 1NK9A 3PX6A 2XY6A 3M1FA 3LDSA 4AM6A 4JKFA 3OYBA 2QWLA 3HPOA 4B1YB 2O8EA 1JLQA 2OPSA 4R79A 2D0AA 3ZLJA 1OVQA 4YOUA 3KK7A 4J2AA 1VQ5N 3SUQA 2DTUA 5FPEA 4CGHA 3BP8A 4AQYK 3L4QA 3U4LA 3NHGA 3SJJA 3K5MA 3V1QA 3ZX0A 5FLXO 4CF2A 4X64K 3HXMA 4IOAL 1HNZK 4HTUA 3KLFA 1P90A 4CJWA 2YX6A 4CEOA 1VQ9N 5MLCQ 1IO2A 4I9QA 2RHKA 5GADP 2D4WA 2E88A 2YCHA 4KHPK 4FJ5A 1TUYA 4FJIA 2AA4A 3N4PA 3U3GA 2ZGYA 4JHDA 5JS1A 5CZ2A 5FRMA 1VRTA 4E89A 4H0OA 1NGGA 2KQ2A 3TARA 3KKRA 1XQSC 1J5EK 2E6LA 4J2BA 3DWLA 4N5SA 3E1YA 1RDBA 2Y1IA 2E4LA 5AZJB 1QE1A 4BR9A 3TAMA 3OYKA 1WAFA 5CHIA 4E1JA 3OYEA 5GAHP 4FJKA 1U48A 2FLOA 3IAYA 4IDKA 2E20A 3OA9A 2FSNA 4IEEA 4YOVA 1D5AA 3SQ1A 5AQKA 2E2NA 1S1XA 5FRNA 3WQTA 5C10A 3G0ZA 4DUYK 4K0KK 4FM1A 3WNEA 2YKMA 4LFBK 2HHQA 3T19A 4HVJA 4Z4GA 4CHQA 2GUPA 3NGZA 1RTHA 3OTOK 1IH7A 4LF7K 4CHZA 2D1KA 1S22A 2B6AA 1RT4A 3D2EA 4HUEA 1NK8A 3EEQA 4DTNA 1JLGA 2RF2A 4WQ5A 5CR4A 4K41A 4KHSA 4NCAA 4FM2A 3HSCA 1D9FA 2QWPA 1BISA 3MECA 3TR8A 3THWB 2O8BB 1LCUA 4OPJA 3BEXA 4J2EA 1LAWA 3SZ2A 3ID8A 1HX1A 3EO3A 3OS0A 3CPWM 3RMDA 3CPEA 3O1WA 1HQUA 2VWBA 5KGXA 4K42A 2VQFK 4LH5A 3L6QA 2UXCK 1U04A 5AQLA 3KK2A 4W5QA 3OJSA 3Q7CA 2RE2A 1D9DA 3I56N 2G8KA 3KLIA 5AQYA 3ZYYX 2A5XA 4CIFA 4B3TK 4B1UB 4CEAA 1QQOA 1TK8A 1S3XA 3NH1A 4I9LA 3CCSN 3T1AA 4CBXA 4GVMA 2P5OA 2HF4A 4IBNA 3U6FA 4FL9A 4ISFA 4AF1A 3IRXA 3ZSZA 4V19S 3WQUA 4Q5VA 1R0AA 3P39A 1OH7A 2GELA 1BIZA 3UKRB 1KVCA 1NK6A 1NJIO 4FJMA 4OKKA 4JD2B 2OZMA 4LC9B 4ZTJA 5AQXA 3K59A 1U49A 2QWOA 2XO7A 2BGGA 2FF6A 3DOKA 3TAPA 1OH8A 3I33A 3K0SA 3IKMA 3VEWA 2WC9A 1SQKA 3OYNA 5I9EB 3E01A 3ENBA 1GLCG 3GOIA 1YF5L 2VGMA 3A5MC 3QEXA 4YDUC 2F8SA 3KWGA 4UY8O 5ELZA 4H5TA 5BR8K 1C0FA 5FDLA 4CVNE 4FJGA 1JXEA 3AO3A 3NH2A 4BRQA 3J80O 5AQUA 3CJ9A 4KKOA 3LDQA 3MN6A 4DR7K 3VQBA 3WUHA 4CJSA 3HPGA 5AQQA 3TI0A 1Y97A 4H5WA 1OH5A 2G8VA 2P9SB 5KPTA 1WUAA 3KLGA 3SI6A 3TAGA 3C7NB 3E66A 3EL2A 4IG3A 2P9UB 4DU4A 3LAKA 4KI4A 1RBRA 4A5BA 4B9NA 2X78A 3T1YK 3NVMA 5LJVA 4IOCL 1ESVA 3AVBA 2PFUA 4CGFA 5C2FA 1N36K 1N34K 3THXA 4W5OA 3ZEUA 1EQYA 2P9NA 5CYQA 1RDUA 3SUNA 1DGKN 4ISEA 4ID1A 3SUPA 3LP1A 4Z4EA 3CJ7A 1TUUA 3KKSA 2O8FA 3ZT4A 3NH0A 4M41A 1C0MA 1I94K 3CCVN 1SS6A 1KSPA 3GG4A 4ILHA 1EO1A 3SQ2A 2P9IA 4OLBA 5AFUA 4DR5K 1GOAA 2JGUA 3VQDA 2Q3SA 2DPNA 2E1YA 3CD6N 3KD1E 2PZSA 3AA4A 4W5TA 2JWKA 5ADXH 1TK5A 1F21A 3DJCA 1P8ZA 3SPYA 2HHUA 4DQ8A 3A2FA 1C6VA 4MO4A 2KTQA 4ICLA 4EIAA 1LWEA 1QZ6A 3O08A 3AGRA 3T1HK 3CFRA 4LD0A 2Z1IA 3A8YA 5GINA 4PL7A 4JN4A 4NYNA 2RPIA 1MWKA 3S41A 3FFKB 4CJTA 4FWLA 4FVMA 3VQ6A 1C0UA 3HJFA 3VQCA 3ZSRA 1W0HA 2KKZA 4YOTA 4BRAA 4ILGB 4BVOA 3MXIA 4JEPA 1GLEG 5HRPA 4QS9A 2G8FA 2HSTA 4B9UA 1NK5A 3VA3A 3SBTA 3AA2A 4I7FA 3QO9A 4DV0K 1JXBA 2GX9A 2EWSA 4JNEA 2YHBA 3WNFA 5K14A 4O0IA 1TL1A 4JI7K 4DF4A 1NOYA 2HHWA 2P1JA 3VA0A 2IVPA 1EX4A 4KTQA 4Y1DA 4O5BA 1NKCA 3AO2A 5M1KA 3R8EA 5KRSA 3V6DA 2IIRA 3AA3A 2BTFA 1RT5A 5JVGL 4Y0WA 5AZIB 2D0OA 3UKUB 3G4SN 5TKWA 3H3OB 3GL1A 4FLXA 3L4IA 4CF1A 4CJ4A 5AJ3K 3AAPA 2W40A 3ULEB 3ZT2A 1KVBA 3P5JA 1NGAA 3OBWA 3L3UA 2D0CA 4DR4K 4FZXC 1CXQA 3WEEB 3CERA 2GUIA 3I0RA 4JI4K 4FW1A 1E4FT 4AHRA 4LF8K 2P51A 2E2PA 1N33K 4WFBL 3TWHA 3BY5A 4IJNA 1VK0A 3E9OA 1NKEA 2P9PB 4FJHA 4KHWA 1EP4A 4UQGA 4FCYA 1VSJA 3KK3A 1ZBHA 3LPTA 4B3OA 5EX5A 4EHTA 1S1WA 5GAGP 4BC4A 4FZZA 3ENHA 1VRUA 2HHVA 5M1NA 3LWMA 4LH4A 4BR0A 1RTIA 2ASPA 4FW2A 1BQMA 1WSIA 3D2FA 3HTVA 1ZYQA 2ZJRL 4HCCA 3L3VA 3QINA 3PX0A 3NDKA 4FLVA 3BZKA 1ZBIA 3LM2A 5D3GA 4H5NA 3TABA 1KAXA 2FSJA 1ZBFA 3ASMA 3OYGA 2NRVA 3MN7A 3FR0A 3HL8A 1O13A 4CESA 4DQIA 3SAFA 1X1PA 2GWKA 1VSMA 1RDDA 2O8CB 4H5RA 3VEXA 2A6AA 3MN9A 3RMCA 2HOEA 4DTRA 4BRHA 4E1NA 3QESA 3LWLA 1YTAA 1VQKN 3QBWA 4NYFA 1RT7A 1ZC6A 1XC9A 3CQYA 1VSLA 4C8OA 4CJ3A 1TKXA 3HBTA 4W5NA 3BDPA 4IXCA 4DLGA 3VN5A 4A61A 3LL3A 1L3VA 3DRSA 1K6YA 3TPQA 3CJBA 3LDNA 3AVKA 1Q18A 4I6MA 1NJWA 5LJWA 4B1WB 4KRFA 3BUZB 4FOEA 2ZGZA 1ASVA 1YJWN 1IG9A 1RDWX 4BGAA 1VQ7N 1W7AA 4JI3K 3THVA 1U2VB 3DAWA 3O9UA 4DR3K 3OYCA 4YOXA 4IO9L 3CHWA 2YI1A 3OS2A 1X9SA 1GLJO 1LOTB 3AVNA 3CI5A 4M3UA 1NGFA 4JK7A 1JCGA 4YOYA 3OYIA 4N76A 3AVJA 1MA9B 3ISNC 4MO5A 5J2MA 4FJNA 1RBSA 4PWDA 4CHYA 5KTQA 4CZEA 2P9LA 4DV5K 1ZXOA 1NGBA 2PBDA 1L3UA 4KREA 1ASWA 3EE8A 1Q8IA 3KLEA 3VQ9A 5DM7L 5LMNK 4CK2A 3H08A 1WSEA 4IOXA 5IWAK 4NCBA 4CF0A 4CJFA 1QHTA 4BROA 1QTMA 4WF9L 3C65A 3C6TA 1VAZA 3VMFB 1X9WA 3G10A 4FPBA 3HP6A 3EZWA 1NMDA 2OPQA 2QTDA 2YJEA 3SMPA 1NK7A 1FKOA 1TYQB 3F9KA 5C15A 1J9AA 3HPHA 1RTDA 4XH5A 4M63C 3MDQA 1X3NA 4DR6K 3H1VX 5HRSA 2E6MA 3SBGA 1C0TA 2ASOA 3TAFA 1T8EA 3JYTA 3TTFA 3JS6A 4BY9C 4ELTA 2G8UA 1BA0A 3LP2A 3MMVA 4G9ZA 4GV6A 3Q7BA 4CGIA 2Q0RA 5J2QA 3CM6A 2A42A 3OYAA 4BGBA 4DQSA 3CYMA 3QBXA 4CFAA 4DV4K 3KLHA 2OPPA 4M3XA 5AZJA 1XUPO 4BG8A 2E1ZA 4CHOA 1NKBA 4BDYA 3DXMA 4IFYA 4FK4A 1TK0A 3K5LA 3ZETA 3QEIA 2UYTA 4B3RK 5CZ1A 3SYZA 1S9EA 3K9JA 2GTDA 4NXMK 3VEZA 1JLCA 4CGDA 1E3MA 5BPNA 4K8ZA 1QS4A 4BWMA 3MXMA 4FK0A 1BL3A 4CK3A 1K8KB 4DS5A 4QS7A 4BRMA 2IVOA 1XC3A 4AH9A 3V9UA 1NJZA 4KHQA 1C1CA 4CEEA 3FZLA 2E8AA 4M42A 1ZBLA 4KPYA 4FYDA 2ZJQL 1JJ2M 2DFHA 1G99A 3MCAB 4JRPA 4CK1A 4EP5A 1YTUA 4U67L 1IJJA 2B4JA 3VQQA 3LZJA 3QNOA 4OGCA 1WB9A 3LDLA 4K25A 1QQMA 2HW3A 2O8BA 1SKRA 3RSEA 1YXQA 3O3GA 3VQ7A 4CJVA 4FLTA 2O8EB 3I0SA 1SZ2A 3QFPA 4H0VB 5M1OA 3RRGA 4MDBA 3ALYA 4JKAA 3QMLA 1L3SA 3P83D 2R7YA 2A1RA 5JMVA 2QKKA 2XY8A 1SV5A 4B3SK 1NNEA 4E3SA 4BWJA 4CZHA 4Z94A 4CJPA 3HO1A 3LPUA 1BA1A 1BCMA 4QAGA 1GLFO 4CFBA 3RWUA 1RBUA 4CZKA 1VQPN 5I42A 3H6EA 3FFIA 3UKRA 2IAJA 4Z4FA 3WXIA 4JD2A 3ZT0A 4PL8A 4B1XB 2HMIA 1T44A 4CZIA 4DTUA 1BUPA 3V81A 5AQWA 2YJFA 3RTVA 4DS4A 1K73O 3ITHA 1JKHA 1ILYA 4DHYA 3VQAA 3NVKA 4GVEA 4KBOA 4KH6A 2Y1JA 3RVCA 4BRGA 4BRNA 2QA4N 4J2DA 4H0PA 3T69A 1R59O 4DTMA 4DSEA 4B1VA 3A5NC 1QQCA 4X62K 1XI1A 2EX3A 5AQNA 1S1TA 4JK9A 4BRCA 4CZMA 3MX2A 1YHQN 2HHXA 4EP4A 1SAZA 1FXXA 3CM5A 4CE9A
chains in the Genus database with same CATH topology
4CD3A 3VTHA 5GINA 4PL7A 4JN4A 3CCEN 3KVGA 2I7NA 3TTCA 4M7YA 2PAVA 4CZLA 4FWNA 4B1ZA 3CCJN 1YIJN 3AGKA 3CC2N 2P9SA 4GNIA 5BRFA 2HF3A 3M6GA 4YDUA 1MWKA 3S41A 5KQ8A 3FFKB 3F5TA 5F1XA 4FWLA 4FSVA 3EN9A 4YORA 5BPMA 3CJ1A 3WXLA 2KKZA 3R9PA 4YOTA 3CMEN 3QDKA 3TSPA 4BRAA 4ILGB 5FPNA 4BVOA 2ASMA 4BR4A 3VEOA 3QICA 1HPMA 1GLEG 2QW9A 3DXKA 4JEPA 3OHRA 4QS9A 1T6CA 1DEJA 4CD1A 4HTLA 5GAEP 3AY9A 4H0YB 2HSTA 1KD1O 3HZ6A 1V4TA 1ATRA 2A3ZA 2F7TA 3NMUA 5HOOA 3SBTA 4L3QA 5JICA 5AQMA 2GX9A 3O6WA 2EWSA 2ZWHA 4JNEA 1YI2N 3F9MA 4H0TB 3CCUN 3P38A 3CMAN 4DKWA 3CETA 3WXMB 1M1KO 4NB4A 3ATUA 3JXUA 1BO5O 4FOIA 3J7ZO 2FXUA 3FZFA 4BR5A 4WQ4C 1HJOA 3VEVA 3G6EN 1EO1A 2IVPA 1NGCA 3VF4A 3EKUA 1Q82O 5GIPA 4JKDA 4BRDA 4CI6A 3QB0A 1VQ8N 4FWQA 4DCHA 5M1KA 3AARA 3TU5A 2V7YA 3H46O 3R8EA 1YUWA 2IIRA 4NLCA 4A59A 1NWKA 2BTFA 3C6HA 4FVUA 4BR2A 5C2DA 4Y0WA 5JVGL 1OVYA 1GLDG 5AZIB 2D0OA 5ADXA 3UKUB 4BC2A 4CJ7A 3G4SN 2Q36A 3H3OB 5TKWA 1VQNN 3GL1A 1HLUA 4B9QA 4MLHA 3L4IA 1Y64A 1NGJA 2QXLA 3MWPA 4WCEL 5HL7L 3AAPA 2W40A 3SMSA 3FZHA 4IO8A 3ULEB 5B8HA 3LDPA 1ATSA 2F9WA 3DXMB 1BG3A 3UE5A 1JCEA 5FPMA 3K9KA 1NGAA 1WOQA 5EY4A 3IMXA 5TKYA 4BQZA 3ZETB 3OBWA 3OW2M 3HOTA 5JVHL 3WEEB 3CERA 3CCRN 4ILJA 2V7ZA 1ATNA 4OO1J 1E4FT 3CCMN 2VGNA 4BC5A 2NRXA 2QEXN 3WT0A 3VESA 5AQJA 2ITMA 3DLLL 2NLXA 2E2PA 3CJCA 3VETA 4WFBL 5BRDA 4H5VA 4JKGA 5BREA 4IJNA 4XH1A 2NRWA 3E9OA 2P9PB 2OTJN 4K43A 3CC4N 1MDUB 3CXCM 3FLCO 1Q81O 4JHDB 4IJAA 3VF2A 4PKHA 4JKCA 4J8FA 3GE1A 2OANA 4EHUA 5BPLA 4BRIA 3GBTA 5BN8A 1M90O 2P9KB 4KH5A 3MX5A 5EX5A 3U9DA 4JAXA 4EHTA 1HKGA 5GAGP 1NGDA 3QFUA 4BC4A 3H1QA 2HMPA 3ENHA 3KZBA 1YJNN 1DKGD 3VGLA 3W0LA 5M1NA 4FPAA 4BR0A 2AP1A 4JK8A 2ASPA 2F9TA 3RSEB 3E9PA 3VENA 2QWQA 1K9MO 2V51B 3D2FA 3HTVA 5C0YA 3MK6A 5AQVA 1QQNA 2ZJRL 3VF6A 4RWTA 1S72N 3L0QA 2QWMA 3PIOL 3VTIA 4A2BA 4WFAL 4JKEA 4IZ9A 1Q7YO 3ATVA 1KQSM 3LM2A 3P4IA 4H5NA 5KPZA 3SK3A 4MDAA 1KAXA 2FSJA 4FWOA 2YHWA 1YJ9N 4XH4A 3M1FA 4AM6A 2NRVA 2NRTA 2KLAA 4JKFA 2QWLA 3MN7A 3FR0A 4B1YB 2ZF5O 1O13A 4R79A 5AZIA 3SAFA 2QM1A 2GWKA 3UKUA 4PKGA 3KWIA 3C7NA 3KK7A 4YOUA 3TTDA 1VQ5N 1NGIA 1X3MA 4H5RA 3VEXA 2A6AA 4WQ4A 3MN9A 5FPEA 5KQDA 5JLFA 2HOEA 3BP8A 2P9UA 3CC7N 4BRHA 3L4QA 3U4LA 3D2EB 4NO7A 3ZX0A 2A40A 1QVFM 1VQKN 3QBWA 3CCQN 3ULEA 4IWVA 1ZC6A 4IOAL 5BRHA 3FZKA 3CQYA 5DM6L 3C6AA 1J6ZA 3HOSA 1P90A 2YX6A 3WEEA 1VQ9N 2J4RA 3D6RA 5MLCQ 5H1SQ 3HBTA 2BUPA 1T6DA 3SAGA 2RHKA 4IXCA 1BU6O 5AQFA 5GADP 4CZJA 4A61A 2D4WA 2CH6A 2E88A 3LL3A 1VQON 1N8RO 3CCLN 2YCHA 2VCPA 3H45C 3TPQA 3FZMA 3W3DA 1NBWA 3CJBA 5FPDA 3O8MA 3LDNA 1Q18A 4I6MA 2I7PA 5LJWA 4B1WB 3VGKA 1TUYA 3VGMA 5C12A 3A5OC 3BUZB 4FOEA 2ZGZA 3KHYA 4NLBA 2P9PA 3IUCA 1YJWN 1VQMN 2AA4A 5E84A 2JWLA 1RDWX 1NLVA 3FGUA 3N4PA 4BGAA 1VQ7N 1NGHA 1U2VB 2ZGYA 3DAWA 3O9UA 2FSKA 4JHDA 3ZX2A 3R3LA 4YOXA 4IO9L 3CHWA 2YI1A 5M1QA 1GLJO 1LOTB 1NGGA 4H0OA 2GWJA 3AAQA 3SJHA 4C1NK 1XQSC 5AQZA 1YITN 1YAGA 3DWLA 1KAYA 3CI5A 4M7XA 3E1YA 2YHXA 1NGFA 3O9TA 5AQTA 5AZJB 4JK7A 5EVZA 4BR9A 3BF3A 4RCHA 4KH4A 1JCGA 2CH5A 5CHIA 4YOYA 4E1JA 5GAHP 2GEMA 1MA9B 1T3VA 1RFQA 2FLOA 1X9JA 4MO5A 5AQGA 2E20A 3OA9A 1Z05A 2FSNA 4IEEA 4YOVA 4CZEA 2WFBA 5AQKA 3J8AA 2P9LA 2E2NA 2Q31A 1ZXOA 1NGBA 2PBDA 1VQ4N 3HI0A 3WQTA 5C10A 3A5LC 1HKCA 4FWKA 3R1XA 3FE1A 2NRRA 3EE8A 1HUXA 5DM7L 5AQOA 2Q2RA 3T7ZA 3U8XA 3O5BA 4IOXA 2GUPA 1H1VA 5E26A 4A62A 5CE3A 1Z6RA 4A5AA 2D1KA 2WBNA 4BROA 1S22A 4O8KA 3D2EA 3MCPA 4BRLA 4WF9L 3ID6A 3C65A 2FF3B 1VAZA 5CR4A 4WQ5A 3VMFB 4K41A 2E2OA 3HSCA 3CIPA 2QWPA 3ZX3A 5AQRA 2D0PA 5AR0A 4FPBA 1LCUA 3EZWA 3BEXA 2KHOA 1NMDA 2QTDA 1E4GT 4FWSA 2YJEA 3ID8A 1HX1A 3EO3A 3CJAA 4GY2B 3CPWM 3SMPA 3LM9A 1TYQB 3CPEA 3O1WA 3EE9A 2NNWA 5C15A 2VWBA 4C1NI 2IVNA 4K42A 4XH5A 3L6QA 5EXWA 1U6ZA 2E2QA 3MDQA 4M63C 1X3NA 3H1VX 3BF1A 5AQHA 5AQLA 5KPRA 3SBGA 1QZ5A 1OKJA 4DB3A 2ASOA 2RE2A 1V4SA 3Q7CA 4WQ5C 3I56N 3TTFA 3JS6A 5M1FA 4BY9C 5AQYA 3ZYYX 1BDGA 2A5XA 1BA0A 3R6MA 4B1UB 4BC3A 3ENOA 1QQOA 3MMVA 2OTLN 4G9ZA 2HBKA 4GV3A 4GV6A 2Q97A 3Q7BA 2Q0RA 3H3NO 1S3XA 4BVPA 3CCSN 2A42A 4CBXA 5LY3A 2HF4A 4BGBA 4FL9A 3QBXA 4H03B 4F9OA 4ISFA 4AF1A 5AZJA 1XUPO 4A57A 3O4WA 2E1ZA 3WQUA 3ZEUB 4BG8A 3DXMA 1QHAA 2P9NB 3O9SA 4PKIA 3P39A 2GELA 2HBLA 3LDOA 3UKRB 4FWMA 4JKGB 3ZETA 1NJIO 2UYTA 3CF5L 3IFRA 4H0XB 4WFNL 3N4QA 4JD2B 3K9JA 4LC9B 2YHYA 1HKBA 2GTDA 2NRHA 3WXJA 2CGJA 1IG8A 2W41A 1GLBG 3O1BA 3VPZA 3VEZA 5AQXA 3CQXA 4IEIA 2QWOA 5BPNA 3MN5A 5F0XA 2FF6A 2P9IB 3PIPL 4JKBA 3I33A 1K8KB 3C0BA 4BG9A 4QS7A 3IKMA 3VEWA 4BRMA 2IVOA 1XC3A 4FWRA 2WC9A 1SQKA 3O9QA 4BRFA 5I9EB 4WYBA 5AFUH 3ENBA 1GLCG 4BRPA 4O5FA 3FZLA 3A0IX 3GOIA 2E8AA 4CBWA 4QS8A 1YF5L 2VGMA 3G25A 3VOVA 3A5MC 2BH1A 2ZJQL 1JJ2M 3D2FB 1G99A 3MCAB 4YDUC 2P9KA 3D7EO 3KWGA 1KC8O 4UY8O 5ELZA 4U67L 1IJJA 4H5TA 3GDQA 1C0FA 1BWFO 2A41A 4GV9A 1MWMA 3LDLA 4K25A 1RGIA 1QQMA 4RTFD 4BRQA 4U7BA 5JLHA 1QVGM 5AQUA 3RSEA 1YXQA 3WXKA 3CJ9A 3M5RA 3LDQA 3MN6A 1W2BM 4XEIA 3I8BA 1NM1A 1TYQA 2QI2A 4OPAA 3WUHA 2ZJPL 5AQQA 2HBMA 4H5WA 1YVNA 2P9SB 3VERA 5KPTA 1WUAA 4JKHA 3G71N 1SZ2A 3QFPA 5M1PA 1NGEA 4H0VB 2H3GX 5M1OA 3C7NB 5BN9A 4MDBA 3E66A 4EFHA 3MWTA 3EL2A 4JKAA 2P9UB 3QMLA 3DXKB 4A5BA 1JCFA 4IFEA 3SAHA 4IDHA 4PHTX 2QWRA 3NVMA 5LJVA 5JMVA 4IOCL 5F2RA 1ESVA 2PFUA 5C2FA 4CZHA 1W97L 4Z94A 1BA1A 1K8AO 1Q86O 1GLFO 2Q1NA 1KAZA 3ZEUA 4CZKA 1EQYA 1VQPN 2P9NA 4CBUA 3HM8A 4BRKA 1RDUA 3H6EA 3P31A 1DGKN 2HBJA 4ISEA 3UKRA 4I6MB 3PLAA 3UB5A 3O9RA 1VQ6N 3WXIA 3SLCA 3CJ7A 4JD2A 4B1XB 4PL8A 4BREA 1KXPA 1T44A 1TUUA 1CZAN 4CZIA 1BUPA 1DT9A 4CZFA 1ZBSA 3EKSA 4A2AA 5AQWA 3HRGA 3O80A 2YJFA 5AQIA 3CCVN 1SS6A 2VYPA 3GG4A 4ILHA 4AM7A 4MLEA 4EAHD 1K73O 2P9IA 1ILYA 5AFUA 4HWIA 4DHYA 3TSUA 5AQPA 1K8KA 3E9LA 1VQLN 2DPNA 2E1YA 3NVKA 3VEYA 2QWNA 4GVEA 4KBOA 4OPHA 5EOYA 3M3ZA 4KH6A 3CD6N 4FO0A 3RVCA 4BRGA 2CGKA 4FWPA 4BRNA 4YOWA 1GLLO 4BR7A 4H0PA 2JWKA 2QA4N 3TSQA 2NZTA 3T69A 1R59O 3B8AX 1U2VA 2NRZA 5ADXH 3DJCA 1P8ZA 1C0GA 4O8UA 5BR9A 5GIOA 4B1VA 1BOTO 3A5NC 3F2KA 4ISGA 2CGLA 4DQ8A 4CZGA 3I55N 2WUSA 4BQLA 2Q0UA 5AQSA 4MO4A 5AQNA 3U9ZA 4JK9A 4C23A 1D4XA 4BRCA 4EIAA 4CZMA 1QZ6A 3IDHA 3MX2A 3O08A 1YHQN 3AGRA 3OBYA 1GLAG 3A8YA 1SAZA 2V52B 2P9LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CD3 A;  4PL7 A;  4JN4 A;  3KVG A;  2I7N A;  4M7Y A;  2PAV A;  4CZL A;  4FWN A;  4B1Z A;  2P9S A;  4GNI A;  5BRF A;  2HF3 A;  3M6G A;  4YDU A;  1MWK A;  3S41 A;  5KQ8 A;  3FFK B;  5F1X A;  4FWL A;  4FSV A;  3EN9 A;  5BPM A;  3CJ1 A;  3WXL A;  3R9P A;  3QDK A;  4BRA A;  5FPN A;  4BVO A;  2ASM A;  4BR4 A;  3VEO A;  3QIC A;  1HPM A;  1GLE G;  2QW9 A;  3DXK A;  4QS9 A;  3OHR A;  4CD1 A;  1T6C A;  1DEJ A;  4HTL A;  3AY9 A;  4H0Y B;  3HZ6 A;  1V4T A;  1ATR A;  2A3Z A;  4L3Q A;  5JIC A;  5AQM A;  3O6W A;  2EWS A;  2ZWH A;  4JNE A;  3F9M A;  4H0T B;  3CET A;  4NB4 A;  3ATU A;  3JXU A;  1BO5 O;  4FOI A;  2FXU A;  3FZF A;  4BR5 A;  4WQ4 C;  1HJO A;  3VEV A;  2IVP A;  1NGC A;  3VF4 A;  3EKU A;  4BRD A;  4CI6 A;  3QB0 A;  4FWQ A;  4DCH A;  3AAR A;  3TU5 A;  2V7Y A;  3H46 O;  3R8E A;  1YUW A;  2IIR A;  1NWK A;  2BTF A;  4BR2 A;  4Y0W A;  1GLD G;  5AZI B;  2D0O A;  5ADX A;  3UKU B;  4BC2 A;  4CJ7 A;  2Q36 A;  3H3O B;  3GL1 A;  1HLU A;  4B9Q A;  4MLH A;  3L4I A;  1Y64 A;  1NGJ A;  2QXL A;  3AAP A;  2W40 A;  3SMS A;  3FZH A;  4IO8 A;  3ULE B;  5B8H A;  3LDP A;  1ATS A;  2F9W A;  3DXM B;  1BG3 A;  3UE5 A;  1JCE A;  5FPM A;  1NGA A;  1WOQ A;  5EY4 A;  3IMX A;  5TKY A;  4BQZ A;  3ZET B;  3WEE B;  3CER A;  2V7Z A;  1ATN A;  1E4F T;  4BC5 A;  3WT0 A;  3VES A;  5AQJ A;  2ITM A;  2NLX A;  2E2P A;  3CJC A;  3VET A;  5BRD A;  4H5V A;  5BRE A;  4IJN A;  4XH1 A;  2P9P B;  4K43 A;  1MDU B;  3FLC O;  4JHD B;  4IJA A;  3VF2 A;  4PKH A;  4J8F A;  3GE1 A;  2OAN A;  4EHU A;  5BPL A;  4BRI A;  3GBT A;  5BN8 A;  2P9K B;  5EX5 A;  3U9D A;  4JAX A;  4EHT A;  1HKG A;  1NGD A;  3QFU A;  4BC4 A;  3H1Q A;  2HMP A;  3ENH A;  3KZB A;  1DKG D;  3VGL A;  3W0L A;  4FPA A;  4BR0 A;  2AP1 A;  2ASP A;  2F9T A;  3RSE B;  3VEN A;  2QWQ A;  2V51 B;  3D2F A;  3HTV A;  3MK6 A;  5AQV A;  1QQN A;  3VF6 A;  4RWT A;  3L0Q A;  2QWM A;  4A2B A;  4IZ9 A;  3ATV A;  3LM2 A;  3P4I A;  4H5N A;  5KPZ A;  3SK3 A;  1KAX A;  2FSJ A;  4FWO A;  2YHW A;  4XH4 A;  3M1F A;  4AM6 A;  2QWL A;  3MN7 A;  3FR0 A;  4B1Y B;  2ZF5 O;  5AZI A;  2QM1 A;  2GWK A;  3UKU A;  4PKG A;  3C7N A;  1NGI A;  1X3M A;  4H5R A;  3VEX A;  2A6A A;  4WQ4 A;  3MN9 A;  5FPE A;  5KQD A;  5JLF A;  2HOE A;  3BP8 A;  2P9U A;  4BRH A;  3U4L A;  3D2E B;  4NO7 A;  3ZX0 A;  2A40 A;  3QBW A;  3ULE A;  4IWV A;  1ZC6 A;  5BRH A;  3FZK A;  3CQY A;  1J6Z A;  3WEE A;  2J4R A;  3HBT A;  2BUP A;  1T6D A;  4IXC A;  5AQF A;  1BU6 O;  4CZJ A;  4A61 A;  2D4W A;  2CH6 A;  2E88 A;  3LL3 A;  2YCH A;  2VCP A;  3H45 C;  3TPQ A;  3FZM A;  3W3D A;  1NBW A;  3CJB A;  5FPD A;  3O8M A;  3LDN A;  1Q18 A;  4I6M A;  2I7P A;  5LJW A;  4B1W B;  3VGK A;  1TUY A;  3VGM A;  3A5O C;  3BUZ B;  4FOE A;  2ZGZ A;  3KHY A;  2P9P A;  3IUC A;  2AA4 A;  5E84 A;  1RDW X;  1NLV A;  3FGU A;  4BGA A;  1NGH A;  1U2V B;  2ZGY A;  3DAW A;  2FSK A;  4JHD A;  3ZX2 A;  3CHW A;  2YI1 A;  1GLJ O;  1LOT B;  1NGG A;  4H0O A;  2GWJ A;  3AAQ A;  3SJH A;  1XQS C;  5AQZ A;  1YAG A;  3DWL A;  1KAY A;  3CI5 A;  4M7X A;  2YHX A;  1NGF A;  5AQT A;  5AZJ B;  5EVZ A;  4BR9 A;  3BF3 A;  4RCH A;  1JCG A;  2CH5 A;  4E1J A;  2GEM A;  1MA9 B;  1RFQ A;  2FLO A;  1X9J A;  4MO5 A;  5AQG A;  2E20 A;  1Z05 A;  2FSN A;  4CZE A;  5AQK A;  3J8A A;  2P9L A;  2E2N A;  2Q31 A;  1ZXO A;  1NGB A;  2PBD A;  3HI0 A;  3WQT A;  3A5L C;  1HKC A;  4FWK A;  3FE1 A;  1HUX A;  5AQO A;  2Q2R A;  3U8X A;  3O5B A;  2GUP A;  1H1V A;  5E26 A;  4A62 A;  5CE3 A;  1Z6R A;  2D1K A;  4BRO A;  1S22 A;  4O8K A;  3D2E A;  3MCP A;  4BRL A;  2FF3 B;  4WQ5 A;  4K41 A;  2E2O A;  3HSC A;  3CIP A;  2QWP A;  3ZX3 A;  5AQR A;  2D0P A;  5AR0 A;  4FPB A;  1LCU A;  3EZW A;  3BEX A;  2KHO A;  1NMD A;  4FWS A;  1E4G T;  2YJE A;  3ID8 A;  1HX1 A;  3EO3 A;  3CJA A;  4GY2 B;  3SMP A;  3LM9 A;  1TYQ B;  3O1W A;  2VWB A;  2IVN A;  4K42 A;  4XH5 A;  3L6Q A;  5EXW A;  1U6Z A;  2E2Q A;  3MDQ A;  4M63 C;  1X3N A;  3H1V X;  3BF1 A;  5AQH A;  5AQL A;  5KPR A;  1QZ5 A;  1OKJ A;  4DB3 A;  2ASO A;  1V4S A;  4WQ5 C;  3JS6 A;  5AQY A;  1BDG A;  2A5X A;  1BA0 A;  3R6M A;  4B1U B;  4BC3 A;  3ENO A;  1QQO A;  3MMV A;  2Q97 A;  2Q0R A;  3H3N O;  1S3X A;  4BVP A;  2A42 A;  4CBX A;  5LY3 A;  2HF4 A;  4BGB A;  4FL9 A;  3QBX A;  4H03 B;  4F9O A;  4ISF A;  5AZJ A;  1XUP O;  3O4W A;  2E1Z A;  3WQU A;  3ZEU B;  4BG8 A;  3DXM A;  1QHA A;  2P9N B;  4PKI A;  2GEL A;  3LDO A;  3UKR B;  4FWM A;  3ZET A;  2UYT A;  3IFR A;  4H0X B;  4JD2 B;  4LC9 B;  2YHY A;  1HKB A;  2GTD A;  2NRH A;  3WXJ A;  2CGJ A;  1IG8 A;  2W41 A;  1GLB G;  3O1B A;  3VPZ A;  3VEZ A;  5AQX A;  3CQX A;  2QWO A;  5BPN A;  3MN5 A;  5F0X A;  2FF6 A;  2P9I B;  3I33 A;  1K8K B;  3C0B A;  4BG9 A;  4QS7 A;  3VEW A;  4BRM A;  2IVO A;  1XC3 A;  4FWR A;  1SQK A;  4BRF A;  5I9E B;  4WYB A;  5AFU H;  1GLC G;  4BRP A;  4O5F A;  3FZL A;  3A0I X;  3GOI A;  2E8A A;  4CBW A;  4QS8 A;  3G25 A;  3VOV A;  3A5M C;  3D2F B;  1G99 A;  4YDU C;  2P9K A;  3D7E O;  5ELZ A;  1IJJ A;  4H5T A;  3GDQ A;  1C0F A;  1BWF O;  2A41 A;  1MWM A;  3LDL A;  4K25 A;  1RGI A;  1QQM A;  4RTF D;  4BRQ A;  5JLH A;  5AQU A;  3RSE A;  1YXQ A;  3WXK A;  3CJ9 A;  3LDQ A;  3MN6 A;  4XEI A;  3I8B A;  1NM1 A;  1TYQ A;  3WUH A;  5AQQ A;  4H5W A;  1YVN A;  2P9S B;  3VER A;  5KPT A;  1WUA A;  1SZ2 A;  3QFP A;  1NGE A;  4H0V B;  2H3G X;  3C7N B;  5BN9 A;  4EFH A;  3EL2 A;  2P9U B;  3QML A;  3DXK B;  1JCF A;  2QWR A;  5LJV A;  5JMV A;  5F2R A;  1ESV A;  4CZH A;  4Z94 A;  1BA1 A;  1GLF O;  2Q1N A;  1KAZ A;  3ZEU A;  4CZK A;  1EQY A;  2P9N A;  4CBU A;  3HM8 A;  4BRK A;  3H6E A;  1DGK N;  4ISE A;  3UKR A;  4I6M B;  3UB5 A;  3WXI A;  3SLC A;  3CJ7 A;  4JD2 A;  4B1X B;  4PL8 A;  4BRE A;  1KXP A;  1T44 A;  1TUU A;  1CZA N;  4CZI A;  1BUP A;  4CZF A;  1ZBS A;  3EKS A;  4A2A A;  5AQW A;  5AQI A;  3O80 A;  2YJF A;  2VYP A;  3GG4 A;  4AM7 A;  4MLE A;  4EAH D;  2P9I A;  5AFU A;  4HWI A;  4DHY A;  5AQP A;  1K8K A;  2DPN A;  2E1Y A;  3VEY A;  2QWN A;  4KBO A;  5EOY A;  3M3Z A;  4FO0 A;  4BRG A;  2CGK A;  4FWP A;  4BRN A;  1GLL O;  4BR7 A;  4H0P A;  2NZT A;  1R59 O;  3B8A X;  1U2V A;  5ADX H;  3DJC A;  1P8Z A;  1C0G A;  5BR9 A;  4B1V A;  1BOT O;  3A5N C;  4ISG A;  2CGL A;  4DQ8 A;  4CZG A;  2WUS A;  4BQL A;  2Q0U A;  5AQS A;  4MO4 A;  5AQN A;  3U9Z A;  4C23 A;  1D4X A;  4BRC A;  4EIA A;  4CZM A;  1QZ6 A;  3IDH A;  3O08 A;  1GLA G;  3A8Y A;  1SAZ A;  2V52 B;  2P9L B; 
#chains in the Genus database with same CATH topology
 4AHS A;  4CD3 A;  1HNX K;  3CCE N;  4M7Y A;  2PAV A;  4N56 A;  2GBZ A;  4B1Z A;  3AGK A;  2QKB A;  2P9S A;  2KFZ A;  2HF3 A;  3M6G A;  5CY4 A;  1EKE A;  3F5T A;  4FSV A;  3L2V A;  2HNZ A;  3CJ1 A;  4OKE A;  2O8D A;  3R9P A;  3VQ5 A;  3TSP A;  4CD1 A;  3O4Q A;  5GAE P;  1T6C A;  4HTL A;  2HVI A;  1V4T A;  2OYQ A;  2F8T A;  4L3Q A;  2X74 A;  4H0T B;  3CCU N;  3WXM B;  2WOM A;  3ATU A;  4DR2 K;  1LW2 A;  3JXU A;  3F73 A;  4DTP A;  1G15 A;  2FXU A;  3FZF A;  4DQQ A;  3AO4 A;  1NGC A;  5GIP A;  4BRD A;  4Y1C A;  4CI6 A;  3HVR A;  4KTW A;  3QB0 A;  1VQ8 N;  4MFB A;  3AAR A;  3TU5 A;  3LP3 A;  2V7Y A;  3H46 O;  4M3R A;  1YUW A;  4A59 A;  1S9G A;  4W5R A;  4BR2 A;  1IKV A;  1LW0 A;  1KLM A;  1OVY A;  3O4N A;  1QSY A;  1VQN N;  1HLU A;  2XHB A;  3ZT1 A;  3ULD A;  1JLF A;  1NGJ A;  2Z1H A;  2QXL A;  3MWP A;  3QIO A;  3U3Y A;  2IS3 A;  3LDP A;  5B8H A;  1BG3 A;  1WBB A;  3NGY A;  1KRP A;  3NAE A;  3VQ8 A;  5EY4 A;  3IMX A;  5TKY A;  4CEB A;  2LSN A;  4DTO A;  4KI6 A;  1S1V A;  4OO1 J;  2OCE A;  4OKJ A;  3CCM N;  4BC5 A;  2QEX N;  3VES A;  5AQJ A;  2ITM A;  4OJR A;  1HYS A;  5BRD A;  1FKP A;  4JKG A;  3ZSQ A;  1LAV A;  4FJ9 A;  3DOL A;  1FJG K;  3CC4 N;  3CXC M;  3D0P A;  4JKC A;  2B5J A;  3GE1 A;  2OAN A;  3AVM A;  3SV3 A;  4KH5 A;  3MX5 A;  4JAX A;  1N6Q A;  3PUF A;  1HKG A;  4KTZ A;  5SWM A;  3MED A;  4FJL A;  2AP1 A;  4CEC A;  2KFN A;  4AHV A;  2QWQ A;  4DSI A;  5AQV A;  2W6K A;  2YHA A;  3PIO L;  2QWM A;  3VTI A;  5CYM A;  3ATV A;  1RIL A;  2QK9 A;  1C1A A;  3SK3 A;  2E5L K;  4MDA A;  1JLE A;  2VQE K;  4DLE A;  4PQU A;  1EXQ A;  5JS2 A;  4DMN A;  4FWO A;  2YHW A;  1VSF A;  4LSL A;  4NXN K;  5IT9 O;  4FJJ A;  2ZF5 O;  2WON A;  2ZQB A;  5AZI A;  1JL2 A;  2QM1 A;  3DRR A;  1NMN A;  3UKU A;  3TTD A;  4PKG A;  4KHY A;  5J1E A;  4CGG A;  1NGI A;  1N32 K;  1HJR A;  1RDA A;  1VSI A;  2JLE A;  4CJ5 A;  4DFK A;  1KFS A;  4NO7 A;  1QVF M;  4DUZ K;  3CCQ N;  1NJY A;  3ULE A;  4IWV A;  3FZK A;  1QSS A;  3TAQ A;  3C6A A;  3HOS A;  5KGW A;  3WEE A;  4O0J A;  4CEZ A;  3D6R A;  5H1S Q;  2BUP A;  1KTQ A;  1T6D A;  4JI1 K;  5AQF A;  1WSJ A;  1ASU A;  3AVL A;  1MU2 A;  3DLG A;  3FZM A;  3W3D A;  1LV5 A;  1NOZ A;  3VGM A;  5C12 A;  4NLB A;  1Q9X A;  3KHY A;  4B9V A;  2P9P A;  3RR7 A;  3C94 A;  1VQM N;  5E84 A;  1NLV A;  1NGH A;  4FLZ A;  1QSL A;  2X6N A;  4TSX A;  2RKI A;  3V1R A;  5M1Q A;  1SL2 A;  4JS4 A;  3L2U A;  3SJH A;  4C1N K;  5AQZ A;  3V4I A;  4WE1 A;  1KAY A;  4DG1 A;  2YHX A;  2DFE A;  5AQT A;  5EVZ A;  3BF3 A;  4RCH A;  3AA5 X;  4DQP A;  2PYL A;  2GEM A;  1D8Y A;  1EWR A;  5J2N A;  3NBP A;  1X9J A;  3DLR A;  5LMU K;  4CJR A;  1Z05 A;  4ELU A;  3DLK A;  3J8A A;  1NK4 A;  2Q31 A;  2UU9 K;  2ZD1 A;  2HHH K;  2G8H A;  1VQ4 N;  1NJX A;  3PY8 A;  4E0D A;  3A5L C;  4Z4I A;  3FE1 A;  2NRR A;  2RN2 A;  3OYF A;  3V9W A;  1DLO A;  1S6Q A;  3O5B A;  1H1V A;  4A62 A;  2O8C A;  1XWL A;  4A5A A;  1XMQ K;  4O8K A;  4BRL A;  5J2P A;  3ID6 A;  1RBT A;  4RW6 A;  2E2O A;  3ZX3 A;  3NCI A;  3NE6 A;  5AR0 A;  3NFA A;  4FWS A;  4RW8 A;  3CJA A;  4GY2 B;  3EE9 A;  2NNW A;  4C1N I;  4O4G A;  2E2Q A;  4FLU A;  1NU0 A;  5AQH A;  5KPR A;  1QZ5 A;  1TL3 A;  1V4S A;  4WQ5 C;  5LL6 Z;  4RG8 A;  3RRH A;  2HBK A;  2Q97 A;  3DMJ A;  3H3N O;  3AVG A;  3CFO A;  2W6L A;  3PSF A;  4H03 B;  4LFC K;  1U45 A;  1QHA A;  3O9S A;  4PKI A;  3LDO A;  3UIQ A;  3CF5 L;  4H0X B;  1IBM K;  3N4Q A;  1Z26 A;  1LWC A;  3KJV A;  2NRH A;  3O1B A;  1IG8 A;  2HB5 A;  2W41 A;  4IEI A;  3EZ5 A;  1VSH A;  3ZCM A;  3MN5 A;  1A5V A;  3KTQ A;  3K5O A;  1YT3 A;  4B9M A;  3T3F A;  1TKT A;  4E7L A;  3M8R A;  4WYB A;  5AFU H;  4HCB A;  1BQN A;  4O5F A;  4QS8 A;  3G25 A;  3VOV A;  3MXJ A;  1SL1 A;  3K5N A;  3DLH A;  3D2F B;  3VQ4 A;  2P9K A;  5KRT A;  4HUG A;  2HND A;  1RT1 A;  2YKN A;  1BWF O;  2A41 A;  4DTX A;  4GV9 A;  1MWM A;  4LF5 K;  1RGI A;  1RT6 A;  4RTF D;  1QVG M;  3OYD A;  3DLE A;  2PY5 A;  1HYV A;  2OPR A;  1NM1 A;  1TYQ A;  2HBM A;  3NF8 A;  4OVL A;  4YHH K;  4JKH A;  3G71 N;  3HP9 A;  1WSG A;  1B9F A;  1HMV A;  4GKK K;  1OH6 A;  4GKJ K;  2O4I A;  1HQE A;  5BN9 A;  2OA8 A;  4EFH A;  2BE2 A;  3MWT A;  3DI6 A;  1TAQ A;  3DXK B;  4IFE A;  4DU1 A;  3L2Q A;  1XNQ K;  1W97 L;  3BGR A;  3K2P A;  1NG9 A;  4LF4 K;  2XRI A;  1K8A O;  4FXD A;  2ATQ A;  3AVF A;  4IG0 A;  1KAZ A;  4CBU A;  3O3F A;  3HM8 A;  4BRK A;  4JI5 K;  3P31 A;  4I6M B;  3JAM O;  3NF7 A;  3UB5 A;  3O9R A;  3SLC A;  4BRE A;  3C6U A;  3THY B;  1KXP A;  1CZA N;  4CHN A;  4CZF A;  1CLQ A;  3HRG A;  5AQI A;  4B9S A;  2VYP A;  2F4V K;  4KO0 A;  3J81 O;  4HWI A;  2VG5 A;  3TSU A;  5AQP A;  1BI4 B;  1K8K A;  5A2Q O;  3CG7 A;  4OPH A;  4YY3 K;  4OGE A;  2CGK A;  4FWP A;  4BR7 A;  5C25 A;  3VQP A;  2NZT A;  4JI8 K;  2NRZ A;  1UAX A;  3B8A X;  1C0G A;  4FJ7 A;  3HVT A;  3F2K A;  4ISG A;  4O55 A;  1VSD A;  3I55 N;  2WUS A;  4CIE A;  3ZSW A;  3OYH A;  5DK5 A;  5AQS A;  2HHS A;  3LAL A;  3IDH A;  4GMJ B;  1LWF A;  1JL1 A;  1GLA G;  4KV8 A;  4BE2 A;  2P9L B;  1RBV A;  4CFD A;  3O3H A;  1TKD A;  4CZL A;  1HNV A;  4E7H A;  3CCJ N;  2UXB K;  3CC2 N;  4CJQ A;  3EY1 A;  5BRF A;  4CJK A;  4F3T A;  2O4G A;  5KQ8 A;  1WN7 A;  5F1X A;  3EN9 A;  4FJX A;  5BPM A;  1HRH A;  3L2R A;  3CME N;  1IBL K;  4RW7 A;  3VEO A;  1HPM A;  1DEJ A;  4CED A;  4H0Y B;  3HZ6 A;  2PYJ A;  2F7T A;  1J5O A;  4I2Q A;  5JIC A;  2HVH A;  5HRR A;  4C8L A;  2KZZ A;  2ZWH A;  1YI2 N;  3F9M A;  1L5U A;  4M3T A;  3CMA N;  3CET A;  4CW7 B;  1BO5 O;  4FOI A;  3J7Z O;  3B6O A;  4BR5 A;  1WSH A;  1HJO A;  3VEV A;  4LSN A;  3G6E N;  3THW A;  3EKU A;  4DR1 K;  1VSK A;  4FWQ A;  3I8D A;  4DCH A;  2VG6 A;  4KAZ A;  4HHT A;  4KB1 A;  1NWK A;  3C6H A;  3L2W A;  4ZTF A;  1XHZ A;  3DM2 A;  5ADX A;  4CJ7 A;  2EHG A;  2GV9 A;  4BC2 A;  1S6P A;  2Q36 A;  1WBD A;  4B9Q A;  4LF9 K;  1Y64 A;  4X65 K;  2DFF A;  4B9T A;  3ZSY A;  4BDZ A;  3NF9 A;  3FZH A;  5E41 A;  1SUQ A;  3IS9 A;  3DXM B;  4B8C A;  3UE5 A;  1JCE A;  5FPM A;  4F2R A;  4BQZ A;  3ZET B;  1TV6 A;  3DYA A;  3HOT A;  4DV2 K;  1VSE A;  4RW4 A;  3SPZ A;  3CCR N;  1ATN A;  2VWJ A;  2NRX A;  3WT0 A;  1HPZ A;  3CJC A;  3VET A;  5BRE A;  4XH1 A;  2NRW A;  4CIG A;  4GW6 A;  2OTJ N;  1BHL A;  4K43 A;  2UUC K;  1MDU B;  1HYZ A;  3FLC O;  1Q81 O;  4B3M K;  4DSK A;  2I5J A;  4JHD B;  4JI6 K;  4IJA A;  1REV A;  2NUB A;  3KIO A;  4J8F A;  4JS5 A;  5BPL A;  4BRI A;  3QEV A;  3GBT A;  1EWQ A;  1M90 O;  4H4M A;  3U9D A;  4E1M A;  3RR8 A;  4DSF A;  1NGD A;  2HMP A;  4AHT A;  1DKG D;  3IG1 A;  2F9T A;  4JK8 A;  3RSE B;  5HRN A;  1K9M O;  4L8R B;  5C0Y A;  3MK6 A;  3K57 A;  1QQN A;  3VF6 A;  4AHC A;  3L0Q A;  4A2B A;  4WFA L;  4IZ9 A;  1Q7Y O;  1KQS M;  4Z0U A;  3P4I A;  5C24 A;  3HT3 A;  5KPZ A;  4IFV A;  1YJ9 N;  4XH4 A;  3WNH A;  1IBK K;  2NRT A;  2KLA A;  3PSI A;  1SKS A;  5HLF A;  2AJQ A;  4E7J A;  3PO5 A;  4IKF A;  4KHU A;  3KWI A;  3C7N A;  1KLN A;  4KHN A;  1X3M A;  5I3U A;  5KQD A;  4WQ4 A;  5JLF A;  1GOB A;  2P9U A;  3CC7 N;  3D2E B;  4H4O A;  2A40 A;  1JLA A;  2D0B A;  3V9S A;  5BRH A;  2YNF A;  3EYZ A;  1VHX A;  5DM6 L;  3OS1 A;  1J6Z A;  3DLB A;  1IKY A;  2J4R A;  3QEP A;  3SAG A;  1X9M A;  1BU6 O;  4CZJ A;  3D45 A;  2CH6 A;  1VQO N;  3CCL N;  1N8R O;  1J54 A;  4G1Q A;  1L3T A;  2VCP A;  3H45 C;  2ETJ A;  4DTJ A;  1NBW A;  1U47 A;  5FPD A;  3O8M A;  3OYJ A;  4HUF A;  2I7P A;  3VGK A;  3A5O C;  3IUC A;  1U4B A;  2JWL A;  3FGU A;  2FSK A;  3ZX2 A;  3K58 A;  2VWK A;  1KVA A;  1KFD A;  3R3L A;  3RMA A;  3NGI A;  4Z4C A;  2GWJ A;  3AAQ A;  4DV6 K;  2YNI A;  3AVH A;  1RT3 A;  1YIT N;  4FZY A;  1YAG A;  3S3N A;  4M7X A;  1UA0 A;  3J7A P;  1JLB A;  1I39 A;  3O9T A;  3M8Q A;  4KH4 A;  2CH5 A;  2YNH A;  3LP0 A;  1Q9Y A;  3JSM A;  1T3V A;  1RFQ A;  2YV0 X;  5AQG A;  4BAC A;  3OYM A;  1B9D A;  4N47 A;  4YFU A;  1WSF A;  1XNR K;  2WFB A;  2O8D B;  2VG7 A;  3HI0 A;  4KFB A;  1WNS A;  1BIU A;  1HKC A;  4FWK A;  3R1X A;  3L8B A;  1HUX A;  1WAJ A;  5AQO A;  4XIU A;  2Q2R A;  3T7Z A;  2WTU A;  4M45 A;  3U8X A;  5FRO A;  5E26 A;  5CE3 A;  2BDP A;  3KD5 E;  4OLA A;  1Z6R A;  2WBN A;  3MCP A;  5HP1 A;  4OX9 K;  1HNW K;  4M3Z A;  3V9X A;  2FF3 B;  4DV7 K;  3V9Z A;  1FK9 A;  3CIP A;  5AQR A;  1C1B A;  2D0P A;  3S3O A;  4ZHR A;  2KHO A;  1E4G T;  3SCX A;  2IGI A;  2W42 A;  4OPK A;  4DSL A;  3LM9 A;  1W9H A;  2IVN A;  4R5P A;  5EXW A;  1U6Z A;  3S3M A;  4EZ6 A;  3BF1 A;  4ELV A;  5EU7 A;  3QEW A;  4C8K A;  4CGJ A;  1OKJ A;  1T05 A;  4DB3 A;  4B8A B;  2FBV A;  2KZM A;  5KI6 A;  5M1F A;  1B92 A;  1BDG A;  4BC3 A;  1KCF A;  3R6M A;  4BE0 A;  3ENO A;  3OYL A;  4JI2 K;  2OTL N;  4GV3 A;  3M8P A;  4C8M A;  1J53 A;  4BVP A;  2X6S A;  1T7P A;  5LY3 A;  2G8I A;  4F9O A;  2XY5 A;  3THX B;  3HYF A;  3KK1 A;  4A57 A;  3O4W A;  3ZEU B;  3LZI A;  4DFJ A;  2D5R A;  2P9N B;  3RMB A;  2HBL A;  4FWM A;  4JKG B;  3IFR A;  4WFN L;  4PUO A;  2YHY A;  4FK2 A;  1HKB A;  3WXJ A;  2O8F B;  2CGJ A;  1GLB G;  3VPZ A;  3V1O A;  3CQX A;  1HNI A;  4E7K A;  3LAM A;  4K8X A;  4E7I A;  5F0X A;  4B9L A;  1GOC A;  2P9I B;  3PIP L;  4JKB A;  3TAN A;  3C0B A;  4BG9 A;  4FWR A;  3OY9 A;  4BRF A;  3O9Q A;  1HR0 K;  2OZS A;  4BRP A;  3A0I X;  4CBW A;  3PX4 A;  2ZE2 A;  4DWI A;  4H8K A;  2BH1 A;  4I2P A;  1S5J A;  2G8W A;  3D7E O;  4CEQ A;  1KC8 O;  1RCH A;  4DV1 K;  3ZSX A;  3GDQ A;  4F3O A;  3TAE A;  2IOC A;  1ZBU A;  4ID5 A;  5T7B A;  4CCH A;  3S9H A;  4U7B A;  5JLH A;  1I3A A;  1UOC A;  3WXK A;  3M5R A;  1CZB A;  1W2B M;  4XEI A;  3I8B A;  2QI2 A;  4OPA A;  4JRQ A;  2ZJP L;  4DTS A;  4LFA K;  1YVN A;  3VER A;  1RT2 A;  5M1P A;  1NGE A;  2H3G X;  4DFP A;  4M3W A;  1SKW A;  1SL0 A;  2Z1J A;  1YVU A;  3WNG A;  2FC0 A;  3VQE A;  1JCF A;  3SAH A;  4IDH A;  4PHT X;  2QWR A;  2V52 B;  5F2R A;  1O1W A;  1TAU A;  3MEE A;  3P1G A;  1CXU A;  4E19 A;  4PA1 A;  3QNN A;  5C42 A;  3SUO A;  3AVA A;  1Q86 O;  3CQ8 A;  2Q1N A;  1XMO K;  1WLJ A;  3AV9 A;  2HBJ A;  3PLA A;  1CZ9 A;  1A5X A;  4EZ9 A;  1VQ6 N;  4FLY A;  4FJ8 A;  3AO1 A;  1DT9 A;  3LAN A;  1ZBS A;  3EKS A;  4RW9 A;  4A2A A;  3O80 A;  4NCG A;  2F96 A;  4AM7 A;  4MLE A;  4EAH D;  4F8R A;  3E9L A;  1IKW A;  4CJE A;  2XY7 A;  1VQL N;  3VEY A;  1FW6 A;  2QWN A;  5EOY A;  3M3Z A;  4X66 K;  4FO0 A;  4CJU A;  4DQR A;  4YOW A;  1GLL O;  3TSQ A;  3HM9 A;  1U2V A;  1TGO A;  1RTJ A;  4O8U A;  5BR9 A;  2FBT A;  5GIO A;  1BOT O;  2YNG A;  2CGL A;  4CZG A;  4BQL A;  2Q0U A;  4LY7 A;  3U9Z A;  3OJU A;  4C23 A;  1D4X A;  5DMR A;  4CER A;  4DF8 A;  3OBY A;  4O44 A;  1TKZ A;  2KW4 A;  2HNY A;  3VTH A;  2IC3 A;  3KVG A;  2I7N A;  3TTC A;  1ITG A;  2A1S A;  4FWN A;  1TVR A;  3M8S A;  1YIJ N;  2FBX A;  4GNI A;  4DU3 A;  3QLH A;  5HBM A;  2ITG A;  4YDU A;  4Z4H A;  3SQ4 A;  4AIL C;  2FBY A;  4YOR A;  3WXL A;  3HK2 A;  3QDK A;  5FPN A;  2ASM A;  4BR4 A;  3B6P A;  3QIC A;  2QW9 A;  3DXK A;  4FLW A;  3OHR A;  3AY9 A;  1KD1 O;  1DTT A;  1ATR A;  2A3Z A;  3NMU A;  3CFP A;  5HOO A;  3ZT3 A;  2UXD K;  1XHX A;  3PO4 A;  5AQM A;  3O6W A;  1DTQ A;  3NF6 A;  4CF8 A;  3P38 A;  4DFM A;  4JI0 K;  1BGX T;  3AVC A;  4DKW A;  1M1K O;  4NB4 A;  3MEG A;  1IV0 A;  4LF6 K;  3PV8 A;  4WQ4 C;  2QXF A;  1A5W A;  3VF4 A;  1Q82 O;  4JKD A;  3THY A;  3OVN A;  3SV4 A;  1Z25 A;  4JV5 K;  2DY4 A;  3SNN A;  4NLC A;  4BDP A;  4CHP A;  4FVU A;  3AVI A;  3MAQ A;  5C2D A;  2HHT A;  2P5G A;  1GLD G;  1BI4 A;  3QIP A;  4CJL A;  4QCL A;  4MLH A;  2ZM6 K;  5SZT A;  1T03 A;  4CFC A;  4WCE L;  5HL7 L;  1UA1 A;  3ZSO A;  3SMS A;  4IO8 A;  3SQ0 A;  1ATS A;  2F9W A;  1RDC A;  3K9K A;  4BE1 A;  1WOQ A;  1UWB A;  1RNH A;  3OW2 M;  5JVH L;  4ILJ A;  4PY5 A;  2V7Z A;  3ZSV A;  2VGN A;  2BAN A;  4JLH A;  1IKX A;  3DLL L;  3BZC A;  4Q0B A;  2NLX A;  3HST B;  1NK0 A;  4H5V A;  4AHU A;  4M3Y A;  3QET A;  1S1U A;  2UUB K;  4QOZ B;  1N5Y A;  3VF2 A;  4FM0 A;  4PKH A;  4N41 A;  4EHU A;  4F2S A;  4KB0 A;  4CF9 A;  3AO5 A;  5BN8 A;  2P9K B;  3C95 A;  1BCO A;  1EET A;  3QFU A;  3H1Q A;  3KZB A;  1YJN N;  3VGL A;  3W0L A;  4DV3 K;  4FPA A;  4C8N A;  2UUA K;  4B08 A;  3E9P A;  3VEN A;  3DRP A;  2V51 B;  2IDO A;  3J7Y P;  4RWT A;  4DSJ A;  4YNQ A;  1S72 N;  4JYA K;  4JKE A;  5HRO A;  2Z1G A;  4MQ3 A;  4CEF A;  3QER A;  4F4K A;  1NK9 A;  3PX6 A;  2XY6 A;  3M1F A;  3LDS A;  4AM6 A;  4JKF A;  3OYB A;  2QWL A;  3HPO A;  4B1Y B;  2O8E A;  1JLQ A;  2OPS A;  4R79 A;  2D0A A;  3ZLJ A;  1OVQ A;  4YOU A;  3KK7 A;  4J2A A;  1VQ5 N;  3SUQ A;  2DTU A;  5FPE A;  4CGH A;  3BP8 A;  4AQY K;  3L4Q A;  3U4L A;  3NHG A;  3SJJ A;  3K5M A;  3V1Q A;  3ZX0 A;  5FLX O;  4CF2 A;  4X64 K;  3HXM A;  4IOA L;  1HNZ K;  4HTU A;  3KLF A;  1P90 A;  4CJW A;  2YX6 A;  4CEO A;  1VQ9 N;  5MLC Q;  1IO2 A;  4I9Q A;  2RHK A;  5GAD P;  2D4W A;  2E88 A;  2YCH A;  4KHP K;  4FJ5 A;  1TUY A;  4FJI A;  2AA4 A;  3N4P A;  3U3G A;  2ZGY A;  4JHD A;  5JS1 A;  5CZ2 A;  5FRM A;  1VRT A;  4E89 A;  4H0O A;  1NGG A;  2KQ2 A;  3TAR A;  3KKR A;  1XQS C;  1J5E K;  2E6L A;  4J2B A;  3DWL A;  4N5S A;  3E1Y A;  1RDB A;  2Y1I A;  2E4L A;  5AZJ B;  1QE1 A;  4BR9 A;  3TAM A;  3OYK A;  1WAF A;  5CHI A;  4E1J A;  3OYE A;  5GAH P;  4FJK A;  1U48 A;  2FLO A;  3IAY A;  4IDK A;  2E20 A;  3OA9 A;  2FSN A;  4IEE A;  4YOV A;  1D5A A;  3SQ1 A;  5AQK A;  2E2N A;  1S1X A;  5FRN A;  3WQT A;  5C10 A;  3G0Z A;  4DUY K;  4K0K K;  4FM1 A;  3WNE A;  2YKM A;  4LFB K;  2HHQ A;  3T19 A;  4HVJ A;  4Z4G A;  4CHQ A;  2GUP A;  3NGZ A;  1RTH A;  3OTO K;  1IH7 A;  4LF7 K;  4CHZ A;  2D1K A;  1S22 A;  2B6A A;  1RT4 A;  3D2E A;  4HUE A;  1NK8 A;  3EEQ A;  4DTN A;  1JLG A;  2RF2 A;  4WQ5 A;  5CR4 A;  4K41 A;  4KHS A;  4NCA A;  4FM2 A;  3HSC A;  1D9F A;  2QWP A;  1BIS A;  3MEC A;  3TR8 A;  3THW B;  2O8B B;  1LCU A;  4OPJ A;  3BEX A;  4J2E A;  1LAW A;  3SZ2 A;  3ID8 A;  1HX1 A;  3EO3 A;  3OS0 A;  3CPW M;  3RMD A;  3CPE A;  3O1W A;  1HQU A;  2VWB A;  5KGX A;  4K42 A;  2VQF K;  4LH5 A;  3L6Q A;  2UXC K;  1U04 A;  5AQL A;  3KK2 A;  4W5Q A;  3OJS A;  3Q7C A;  2RE2 A;  1D9D A;  3I56 N;  2G8K A;  3KLI A;  5AQY A;  3ZYY X;  2A5X A;  4CIF A;  4B3T K;  4B1U B;  4CEA A;  1QQO A;  1TK8 A;  1S3X A;  3NH1 A;  4I9L A;  3CCS N;  3T1A A;  4CBX A;  4GVM A;  2P5O A;  2HF4 A;  4IBN A;  3U6F A;  4FL9 A;  4ISF A;  4AF1 A;  3IRX A;  3ZSZ A;  4V19 S;  3WQU A;  4Q5V A;  1R0A A;  3P39 A;  1OH7 A;  2GEL A;  1BIZ A;  3UKR B;  1KVC A;  1NK6 A;  1NJI O;  4FJM A;  4OKK A;  4JD2 B;  2OZM A;  4LC9 B;  4ZTJ A;  5AQX A;  3K59 A;  1U49 A;  2QWO A;  2XO7 A;  2BGG A;  2FF6 A;  3DOK A;  3TAP A;  1OH8 A;  3I33 A;  3K0S A;  3IKM A;  3VEW A;  2WC9 A;  1SQK A;  3OYN A;  5I9E B;  3E01 A;  3ENB A;  1GLC G;  3GOI A;  1YF5 L;  2VGM A;  3A5M C;  3QEX A;  4YDU C;  2F8S A;  3KWG A;  4UY8 O;  5ELZ A;  4H5T A;  5BR8 K;  1C0F A;  5FDL A;  4CVN E;  4FJG A;  1JXE A;  3AO3 A;  3NH2 A;  4BRQ A;  3J80 O;  5AQU A;  3CJ9 A;  4KKO A;  3LDQ A;  3MN6 A;  4DR7 K;  3VQB A;  3WUH A;  4CJS A;  3HPG A;  5AQQ A;  3TI0 A;  1Y97 A;  4H5W A;  1OH5 A;  2G8V A;  2P9S B;  5KPT A;  1WUA A;  3KLG A;  3SI6 A;  3TAG A;  3C7N B;  3E66 A;  3EL2 A;  4IG3 A;  2P9U B;  4DU4 A;  3LAK A;  4KI4 A;  1RBR A;  4A5B A;  4B9N A;  2X78 A;  3T1Y K;  3NVM A;  5LJV A;  4IOC L;  1ESV A;  3AVB A;  2PFU A;  4CGF A;  5C2F A;  1N36 K;  1N34 K;  3THX A;  4W5O A;  3ZEU A;  1EQY A;  2P9N A;  5CYQ A;  1RDU A;  3SUN A;  1DGK N;  4ISE A;  4ID1 A;  3SUP A;  3LP1 A;  4Z4E A;  3CJ7 A;  1TUU A;  3KKS A;  2O8F A;  3ZT4 A;  3NH0 A;  4M41 A;  1C0M A;  1I94 K;  3CCV N;  1SS6 A;  1KSP A;  3GG4 A;  4ILH A;  1EO1 A;  3SQ2 A;  2P9I A;  4OLB A;  5AFU A;  4DR5 K;  1GOA A;  2JGU A;  3VQD A;  2Q3S A;  2DPN A;  2E1Y A;  3CD6 N;  3KD1 E;  2PZS A;  3AA4 A;  4W5T A;  2JWK A;  5ADX H;  1TK5 A;  1F21 A;  3DJC A;  1P8Z A;  3SPY A;  2HHU A;  4DQ8 A;  3A2F A;  1C6V A;  4MO4 A;  2KTQ A;  4ICL A;  4EIA A;  1LWE A;  1QZ6 A;  3O08 A;  3AGR A;  3T1H K;  3CFR A;  4LD0 A;  2Z1I A;  3A8Y A;  5GIN A;  4PL7 A;  4JN4 A;  4NYN A;  2RPI A;  1MWK A;  3S41 A;  3FFK B;  4CJT A;  4FWL A;  4FVM A;  3VQ6 A;  1C0U A;  3HJF A;  3VQC A;  3ZSR A;  1W0H A;  2KKZ A;  4YOT A;  4BRA A;  4ILG B;  4BVO A;  3MXI A;  4JEP A;  1GLE G;  5HRP A;  4QS9 A;  2G8F A;  2HST A;  4B9U A;  1NK5 A;  3VA3 A;  3SBT A;  3AA2 A;  4I7F A;  3QO9 A;  4DV0 K;  1JXB A;  2GX9 A;  2EWS A;  4JNE A;  2YHB A;  3WNF A;  5K14 A;  4O0I A;  1TL1 A;  4JI7 K;  4DF4 A;  1NOY A;  2HHW A;  2P1J A;  3VA0 A;  2IVP A;  1EX4 A;  4KTQ A;  4Y1D A;  4O5B A;  1NKC A;  3AO2 A;  5M1K A;  3R8E A;  5KRS A;  3V6D A;  2IIR A;  3AA3 A;  2BTF A;  1RT5 A;  5JVG L;  4Y0W A;  5AZI B;  2D0O A;  3UKU B;  3G4S N;  5TKW A;  3H3O B;  3GL1 A;  4FLX A;  3L4I A;  4CF1 A;  4CJ4 A;  5AJ3 K;  3AAP A;  2W40 A;  3ULE B;  3ZT2 A;  1KVB A;  3P5J A;  1NGA A;  3OBW A;  3L3U A;  2D0C A;  4DR4 K;  4FZX C;  1CXQ A;  3WEE B;  3CER A;  2GUI A;  3I0R A;  4JI4 K;  4FW1 A;  1E4F T;  4AHR A;  4LF8 K;  2P51 A;  2E2P A;  1N33 K;  4WFB L;  3TWH A;  3BY5 A;  4IJN A;  1VK0 A;  3E9O A;  1NKE A;  2P9P B;  4FJH A;  4KHW A;  1EP4 A;  4UQG A;  4FCY A;  1VSJ A;  3KK3 A;  1ZBH A;  3LPT A;  4B3O A;  5EX5 A;  4EHT A;  1S1W A;  5GAG P;  4BC4 A;  4FZZ A;  3ENH A;  1VRU A;  2HHV A;  5M1N A;  3LWM A;  4LH4 A;  4BR0 A;  1RTI A;  2ASP A;  4FW2 A;  1BQM A;  1WSI A;  3D2F A;  3HTV A;  1ZYQ A;  2ZJR L;  4HCC A;  3L3V A;  3QIN A;  3PX0 A;  3NDK A;  4FLV A;  3BZK A;  1ZBI A;  3LM2 A;  5D3G A;  4H5N A;  3TAB A;  1KAX A;  2FSJ A;  1ZBF A;  3ASM A;  3OYG A;  2NRV A;  3MN7 A;  3FR0 A;  3HL8 A;  1O13 A;  4CES A;  4DQI A;  3SAF A;  1X1P A;  2GWK A;  1VSM A;  1RDD A;  2O8C B;  4H5R A;  3VEX A;  2A6A A;  3MN9 A;  3RMC A;  2HOE A;  4DTR A;  4BRH A;  4E1N A;  3QES A;  3LWL A;  1YTA A;  1VQK N;  3QBW A;  4NYF A;  1RT7 A;  1ZC6 A;  1XC9 A;  3CQY A;  1VSL A;  4C8O A;  4CJ3 A;  1TKX A;  3HBT A;  4W5N A;  3BDP A;  4IXC A;  4DLG A;  3VN5 A;  4A61 A;  3LL3 A;  1L3V A;  3DRS A;  1K6Y A;  3TPQ A;  3CJB A;  3LDN A;  3AVK A;  1Q18 A;  4I6M A;  1NJW A;  5LJW A;  4B1W B;  4KRF A;  3BUZ B;  4FOE A;  2ZGZ A;  1ASV A;  1YJW N;  1IG9 A;  1RDW X;  4BGA A;  1VQ7 N;  1W7A A;  4JI3 K;  3THV A;  1U2V B;  3DAW A;  3O9U A;  4DR3 K;  3OYC A;  4YOX A;  4IO9 L;  3CHW A;  2YI1 A;  3OS2 A;  1X9S A;  1GLJ O;  1LOT B;  3AVN A;  3CI5 A;  4M3U A;  1NGF A;  4JK7 A;  1JCG A;  4YOY A;  3OYI A;  4N76 A;  3AVJ A;  1MA9 B;  3ISN C;  4MO5 A;  5J2M A;  4FJN A;  1RBS A;  4PWD A;  4CHY A;  5KTQ A;  4CZE A;  2P9L A;  4DV5 K;  1ZXO A;  1NGB A;  2PBD A;  1L3U A;  4KRE A;  1ASW A;  3EE8 A;  1Q8I A;  3KLE A;  3VQ9 A;  5DM7 L;  5LMN K;  4CK2 A;  3H08 A;  1WSE A;  4IOX A;  5IWA K;  4NCB A;  4CF0 A;  4CJF A;  1QHT A;  4BRO A;  1QTM A;  4WF9 L;  3C65 A;  3C6T A;  1VAZ A;  3VMF B;  1X9W A;  3G10 A;  4FPB A;  3HP6 A;  3EZW A;  1NMD A;  2OPQ A;  2QTD A;  2YJE A;  3SMP A;  1NK7 A;  1FKO A;  1TYQ B;  3F9K A;  5C15 A;  1J9A A;  3HPH A;  1RTD A;  4XH5 A;  4M63 C;  3MDQ A;  1X3N A;  4DR6 K;  3H1V X;  5HRS A;  2E6M A;  3SBG A;  1C0T A;  2ASO A;  3TAF A;  1T8E A;  3JYT A;  3TTF A;  3JS6 A;  4BY9 C;  4ELT A;  2G8U A;  1BA0 A;  3LP2 A;  3MMV A;  4G9Z A;  4GV6 A;  3Q7B A;  4CGI A;  2Q0R A;  5J2Q A;  3CM6 A;  2A42 A;  3OYA A;  4BGB A;  4DQS A;  3CYM A;  3QBX A;  4CFA A;  4DV4 K;  3KLH A;  2OPP A;  4M3X A;  5AZJ A;  1XUP O;  4BG8 A;  2E1Z A;  4CHO A;  1NKB A;  4BDY A;  3DXM A;  4IFY A;  4FK4 A;  1TK0 A;  3K5L A;  3ZET A;  3QEI A;  2UYT A;  4B3R K;  5CZ1 A;  3SYZ A;  1S9E A;  3K9J A;  2GTD A;  4NXM K;  3VEZ A;  1JLC A;  4CGD A;  1E3M A;  5BPN A;  4K8Z A;  1QS4 A;  4BWM A;  3MXM A;  4FK0 A;  1BL3 A;  4CK3 A;  1K8K B;  4DS5 A;  4QS7 A;  4BRM A;  2IVO A;  1XC3 A;  4AH9 A;  3V9U A;  1NJZ A;  4KHQ A;  1C1C A;  4CEE A;  3FZL A;  2E8A A;  4M42 A;  1ZBL A;  4KPY A;  4FYD A;  2ZJQ L;  1JJ2 M;  2DFH A;  1G99 A;  3MCA B;  4JRP A;  4CK1 A;  4EP5 A;  1YTU A;  4U67 L;  1IJJ A;  2B4J A;  3VQQ A;  3LZJ A;  3QNO A;  4OGC A;  1WB9 A;  3LDL A;  4K25 A;  1QQM A;  2HW3 A;  2O8B A;  1SKR A;  3RSE A;  1YXQ A;  3O3G A;  3VQ7 A;  4CJV A;  4FLT A;  2O8E B;  3I0S A;  1SZ2 A;  3QFP A;  4H0V B;  5M1O A;  3RRG A;  4MDB A;  3ALY A;  4JKA A;  3QML A;  1L3S A;  3P83 D;  2R7Y A;  2A1R A;  5JMV A;  2QKK A;  2XY8 A;  1SV5 A;  4B3S K;  1NNE A;  4E3S A;  4BWJ A;  4CZH A;  4Z94 A;  4CJP A;  3HO1 A;  3LPU A;  1BA1 A;  1BCM A;  4QAG A;  1GLF O;  4CFB A;  3RWU A;  1RBU A;  4CZK A;  1VQP N;  5I42 A;  3H6E A;  3FFI A;  3UKR A;  2IAJ A;  4Z4F A;  3WXI A;  4JD2 A;  3ZT0 A;  4PL8 A;  4B1X B;  2HMI A;  1T44 A;  4CZI A;  4DTU A;  1BUP A;  3V81 A;  5AQW A;  2YJF A;  3RTV A;  4DS4 A;  1K73 O;  3ITH A;  1JKH A;  1ILY A;  4DHY A;  3VQA A;  3NVK A;  4GVE A;  4KBO A;  4KH6 A;  2Y1J A;  3RVC A;  4BRG A;  4BRN A;  2QA4 N;  4J2D A;  4H0P A;  3T69 A;  1R59 O;  4DTM A;  4DSE A;  4B1V A;  3A5N C;  1QQC A;  4X62 K;  1XI1 A;  2EX3 A;  5AQN A;  1S1T A;  4JK9 A;  4BRC A;  4CZM A;  3MX2 A;  1YHQ N;  2HHX A;  4EP4 A;  1SAZ A;  1FXX A;  3CM5 A;  4CE9 A; 
#chains in the Genus database with same CATH homology
 4CD3 A;  3VTH A;  5GIN A;  4PL7 A;  4JN4 A;  3CCE N;  3KVG A;  2I7N A;  3TTC A;  4M7Y A;  2PAV A;  4CZL A;  4FWN A;  4B1Z A;  3CCJ N;  1YIJ N;  3AGK A;  3CC2 N;  2P9S A;  4GNI A;  5BRF A;  2HF3 A;  3M6G A;  4YDU A;  1MWK A;  3S41 A;  5KQ8 A;  3FFK B;  3F5T A;  5F1X A;  4FWL A;  4FSV A;  3EN9 A;  4YOR A;  5BPM A;  3CJ1 A;  3WXL A;  2KKZ A;  3R9P A;  4YOT A;  3CME N;  3QDK A;  3TSP A;  4BRA A;  4ILG B;  5FPN A;  4BVO A;  2ASM A;  4BR4 A;  3VEO A;  3QIC A;  1HPM A;  1GLE G;  2QW9 A;  3DXK A;  4JEP A;  3OHR A;  4QS9 A;  1T6C A;  1DEJ A;  4CD1 A;  4HTL A;  5GAE P;  3AY9 A;  4H0Y B;  2HST A;  1KD1 O;  3HZ6 A;  1V4T A;  1ATR A;  2A3Z A;  2F7T A;  3NMU A;  5HOO A;  3SBT A;  4L3Q A;  5JIC A;  5AQM A;  2GX9 A;  3O6W A;  2EWS A;  2ZWH A;  4JNE A;  1YI2 N;  3F9M A;  4H0T B;  3CCU N;  3P38 A;  3CMA N;  4DKW A;  3CET A;  3WXM B;  1M1K O;  4NB4 A;  3ATU A;  3JXU A;  1BO5 O;  4FOI A;  3J7Z O;  2FXU A;  3FZF A;  4BR5 A;  4WQ4 C;  1HJO A;  3VEV A;  3G6E N;  1EO1 A;  2IVP A;  1NGC A;  3VF4 A;  3EKU A;  1Q82 O;  5GIP A;  4JKD A;  4BRD A;  4CI6 A;  3QB0 A;  1VQ8 N;  4FWQ A;  4DCH A;  5M1K A;  3AAR A;  3TU5 A;  2V7Y A;  3H46 O;  3R8E A;  1YUW A;  2IIR A;  4NLC A;  4A59 A;  1NWK A;  2BTF A;  3C6H A;  4FVU A;  4BR2 A;  5C2D A;  4Y0W A;  5JVG L;  1OVY A;  1GLD G;  5AZI B;  2D0O A;  5ADX A;  3UKU B;  4BC2 A;  4CJ7 A;  3G4S N;  2Q36 A;  3H3O B;  5TKW A;  1VQN N;  3GL1 A;  1HLU A;  4B9Q A;  4MLH A;  3L4I A;  1Y64 A;  1NGJ A;  2QXL A;  3MWP A;  4WCE L;  5HL7 L;  3AAP A;  2W40 A;  3SMS A;  3FZH A;  4IO8 A;  3ULE B;  5B8H A;  3LDP A;  1ATS A;  2F9W A;  3DXM B;  1BG3 A;  3UE5 A;  1JCE A;  5FPM A;  3K9K A;  1NGA A;  1WOQ A;  5EY4 A;  3IMX A;  5TKY A;  4BQZ A;  3ZET B;  3OBW A;  3OW2 M;  3HOT A;  5JVH L;  3WEE B;  3CER A;  3CCR N;  4ILJ A;  2V7Z A;  1ATN A;  4OO1 J;  1E4F T;  3CCM N;  2VGN A;  4BC5 A;  2NRX A;  2QEX N;  3WT0 A;  3VES A;  5AQJ A;  2ITM A;  3DLL L;  2NLX A;  2E2P A;  3CJC A;  3VET A;  4WFB L;  5BRD A;  4H5V A;  4JKG A;  5BRE A;  4IJN A;  4XH1 A;  2NRW A;  3E9O A;  2P9P B;  2OTJ N;  4K43 A;  3CC4 N;  1MDU B;  3CXC M;  3FLC O;  1Q81 O;  4JHD B;  4IJA A;  3VF2 A;  4PKH A;  4JKC A;  4J8F A;  3GE1 A;  2OAN A;  4EHU A;  5BPL A;  4BRI A;  3GBT A;  5BN8 A;  1M90 O;  2P9K B;  4KH5 A;  3MX5 A;  5EX5 A;  3U9D A;  4JAX A;  4EHT A;  1HKG A;  5GAG P;  1NGD A;  3QFU A;  4BC4 A;  3H1Q A;  2HMP A;  3ENH A;  3KZB A;  1YJN N;  1DKG D;  3VGL A;  3W0L A;  5M1N A;  4FPA A;  4BR0 A;  2AP1 A;  4JK8 A;  2ASP A;  2F9T A;  3RSE B;  3E9P A;  3VEN A;  2QWQ A;  1K9M O;  2V51 B;  3D2F A;  3HTV A;  5C0Y A;  3MK6 A;  5AQV A;  1QQN A;  2ZJR L;  3VF6 A;  4RWT A;  1S72 N;  3L0Q A;  2QWM A;  3PIO L;  3VTI A;  4A2B A;  4WFA L;  4JKE A;  4IZ9 A;  1Q7Y O;  3ATV A;  1KQS M;  3LM2 A;  3P4I A;  4H5N A;  5KPZ A;  3SK3 A;  4MDA A;  1KAX A;  2FSJ A;  4FWO A;  2YHW A;  1YJ9 N;  4XH4 A;  3M1F A;  4AM6 A;  2NRV A;  2NRT A;  2KLA A;  4JKF A;  2QWL A;  3MN7 A;  3FR0 A;  4B1Y B;  2ZF5 O;  1O13 A;  4R79 A;  5AZI A;  3SAF A;  2QM1 A;  2GWK A;  3UKU A;  4PKG A;  3KWI A;  3C7N A;  3KK7 A;  4YOU A;  3TTD A;  1VQ5 N;  1NGI A;  1X3M A;  4H5R A;  3VEX A;  2A6A A;  4WQ4 A;  3MN9 A;  5FPE A;  5KQD A;  5JLF A;  2HOE A;  3BP8 A;  2P9U A;  3CC7 N;  4BRH A;  3L4Q A;  3U4L A;  3D2E B;  4NO7 A;  3ZX0 A;  2A40 A;  1QVF M;  1VQK N;  3QBW A;  3CCQ N;  3ULE A;  4IWV A;  1ZC6 A;  4IOA L;  5BRH A;  3FZK A;  3CQY A;  5DM6 L;  3C6A A;  1J6Z A;  3HOS A;  1P90 A;  2YX6 A;  3WEE A;  1VQ9 N;  2J4R A;  3D6R A;  5MLC Q;  5H1S Q;  3HBT A;  2BUP A;  1T6D A;  3SAG A;  2RHK A;  4IXC A;  1BU6 O;  5AQF A;  5GAD P;  4CZJ A;  4A61 A;  2D4W A;  2CH6 A;  2E88 A;  3LL3 A;  1VQO N;  1N8R O;  3CCL N;  2YCH A;  2VCP A;  3H45 C;  3TPQ A;  3FZM A;  3W3D A;  1NBW A;  3CJB A;  5FPD A;  3O8M A;  3LDN A;  1Q18 A;  4I6M A;  2I7P A;  5LJW A;  4B1W B;  3VGK A;  1TUY A;  3VGM A;  5C12 A;  3A5O C;  3BUZ B;  4FOE A;  2ZGZ A;  3KHY A;  4NLB A;  2P9P A;  3IUC A;  1YJW N;  1VQM N;  2AA4 A;  5E84 A;  2JWL A;  1RDW X;  1NLV A;  3FGU A;  3N4P A;  4BGA A;  1VQ7 N;  1NGH A;  1U2V B;  2ZGY A;  3DAW A;  3O9U A;  2FSK A;  4JHD A;  3ZX2 A;  3R3L A;  4YOX A;  4IO9 L;  3CHW A;  2YI1 A;  5M1Q A;  1GLJ O;  1LOT B;  1NGG A;  4H0O A;  2GWJ A;  3AAQ A;  3SJH A;  4C1N K;  1XQS C;  5AQZ A;  1YIT N;  1YAG A;  3DWL A;  1KAY A;  3CI5 A;  4M7X A;  3E1Y A;  2YHX A;  1NGF A;  3O9T A;  5AQT A;  5AZJ B;  4JK7 A;  5EVZ A;  4BR9 A;  3BF3 A;  4RCH A;  4KH4 A;  1JCG A;  2CH5 A;  5CHI A;  4YOY A;  4E1J A;  5GAH P;  2GEM A;  1MA9 B;  1T3V A;  1RFQ A;  2FLO A;  1X9J A;  4MO5 A;  5AQG A;  2E20 A;  3OA9 A;  1Z05 A;  2FSN A;  4IEE A;  4YOV A;  4CZE A;  2WFB A;  5AQK A;  3J8A A;  2P9L A;  2E2N A;  2Q31 A;  1ZXO A;  1NGB A;  2PBD A;  1VQ4 N;  3HI0 A;  3WQT A;  5C10 A;  3A5L C;  1HKC A;  4FWK A;  3R1X A;  3FE1 A;  2NRR A;  3EE8 A;  1HUX A;  5DM7 L;  5AQO A;  2Q2R A;  3T7Z A;  3U8X A;  3O5B A;  4IOX A;  2GUP A;  1H1V A;  5E26 A;  4A62 A;  5CE3 A;  1Z6R A;  4A5A A;  2D1K A;  2WBN A;  4BRO A;  1S22 A;  4O8K A;  3D2E A;  3MCP A;  4BRL A;  4WF9 L;  3ID6 A;  3C65 A;  2FF3 B;  1VAZ A;  5CR4 A;  4WQ5 A;  3VMF B;  4K41 A;  2E2O A;  3HSC A;  3CIP A;  2QWP A;  3ZX3 A;  5AQR A;  2D0P A;  5AR0 A;  4FPB A;  1LCU A;  3EZW A;  3BEX A;  2KHO A;  1NMD A;  2QTD A;  1E4G T;  4FWS A;  2YJE A;  3ID8 A;  1HX1 A;  3EO3 A;  3CJA A;  4GY2 B;  3CPW M;  3SMP A;  3LM9 A;  1TYQ B;  3CPE A;  3O1W A;  3EE9 A;  2NNW A;  5C15 A;  2VWB A;  4C1N I;  2IVN A;  4K42 A;  4XH5 A;  3L6Q A;  5EXW A;  1U6Z A;  2E2Q A;  3MDQ A;  4M63 C;  1X3N A;  3H1V X;  3BF1 A;  5AQH A;  5AQL A;  5KPR A;  3SBG A;  1QZ5 A;  1OKJ A;  4DB3 A;  2ASO A;  2RE2 A;  1V4S A;  3Q7C A;  4WQ5 C;  3I56 N;  3TTF A;  3JS6 A;  5M1F A;  4BY9 C;  5AQY A;  3ZYY X;  1BDG A;  2A5X A;  1BA0 A;  3R6M A;  4B1U B;  4BC3 A;  3ENO A;  1QQO A;  3MMV A;  2OTL N;  4G9Z A;  2HBK A;  4GV3 A;  4GV6 A;  2Q97 A;  3Q7B A;  2Q0R A;  3H3N O;  1S3X A;  4BVP A;  3CCS N;  2A42 A;  4CBX A;  5LY3 A;  2HF4 A;  4BGB A;  4FL9 A;  3QBX A;  4H03 B;  4F9O A;  4ISF A;  4AF1 A;  5AZJ A;  1XUP O;  4A57 A;  3O4W A;  2E1Z A;  3WQU A;  3ZEU B;  4BG8 A;  3DXM A;  1QHA A;  2P9N B;  3O9S A;  4PKI A;  3P39 A;  2GEL A;  2HBL A;  3LDO A;  3UKR B;  4FWM A;  4JKG B;  3ZET A;  1NJI O;  2UYT A;  3CF5 L;  3IFR A;  4H0X B;  4WFN L;  3N4Q A;  4JD2 B;  3K9J A;  4LC9 B;  2YHY A;  1HKB A;  2GTD A;  2NRH A;  3WXJ A;  2CGJ A;  1IG8 A;  2W41 A;  1GLB G;  3O1B A;  3VPZ A;  3VEZ A;  5AQX A;  3CQX A;  4IEI A;  2QWO A;  5BPN A;  3MN5 A;  5F0X A;  2FF6 A;  2P9I B;  3PIP L;  4JKB A;  3I33 A;  1K8K B;  3C0B A;  4BG9 A;  4QS7 A;  3IKM A;  3VEW A;  4BRM A;  2IVO A;  1XC3 A;  4FWR A;  2WC9 A;  1SQK A;  3O9Q A;  4BRF A;  5I9E B;  4WYB A;  5AFU H;  3ENB A;  1GLC G;  4BRP A;  4O5F A;  3FZL A;  3A0I X;  3GOI A;  2E8A A;  4CBW A;  4QS8 A;  1YF5 L;  2VGM A;  3G25 A;  3VOV A;  3A5M C;  2BH1 A;  2ZJQ L;  1JJ2 M;  3D2F B;  1G99 A;  3MCA B;  4YDU C;  2P9K A;  3D7E O;  3KWG A;  1KC8 O;  4UY8 O;  5ELZ A;  4U67 L;  1IJJ A;  4H5T A;  3GDQ A;  1C0F A;  1BWF O;  2A41 A;  4GV9 A;  1MWM A;  3LDL A;  4K25 A;  1RGI A;  1QQM A;  4RTF D;  4BRQ A;  4U7B A;  5JLH A;  1QVG M;  5AQU A;  3RSE A;  1YXQ A;  3WXK A;  3CJ9 A;  3M5R A;  3LDQ A;  3MN6 A;  1W2B M;  4XEI A;  3I8B A;  1NM1 A;  1TYQ A;  2QI2 A;  4OPA A;  3WUH A;  2ZJP L;  5AQQ A;  2HBM A;  4H5W A;  1YVN A;  2P9S B;  3VER A;  5KPT A;  1WUA A;  4JKH A;  3G71 N;  1SZ2 A;  3QFP A;  5M1P A;  1NGE A;  4H0V B;  2H3G X;  5M1O A;  3C7N B;  5BN9 A;  4MDB A;  3E66 A;  4EFH A;  3MWT A;  3EL2 A;  4JKA A;  2P9U B;  3QML A;  3DXK B;  4A5B A;  1JCF A;  4IFE A;  3SAH A;  4IDH A;  4PHT X;  2QWR A;  3NVM A;  5LJV A;  5JMV A;  4IOC L;  5F2R A;  1ESV A;  2PFU A;  5C2F A;  4CZH A;  1W97 L;  4Z94 A;  1BA1 A;  1K8A O;  1Q86 O;  1GLF O;  2Q1N A;  1KAZ A;  3ZEU A;  4CZK A;  1EQY A;  1VQP N;  2P9N A;  4CBU A;  3HM8 A;  4BRK A;  1RDU A;  3H6E A;  3P31 A;  1DGK N;  2HBJ A;  4ISE A;  3UKR A;  4I6M B;  3PLA A;  3UB5 A;  3O9R A;  1VQ6 N;  3WXI A;  3SLC A;  3CJ7 A;  4JD2 A;  4B1X B;  4PL8 A;  4BRE A;  1KXP A;  1T44 A;  1TUU A;  1CZA N;  4CZI A;  1BUP A;  1DT9 A;  4CZF A;  1ZBS A;  3EKS A;  4A2A A;  5AQW A;  3HRG A;  3O80 A;  2YJF A;  5AQI A;  3CCV N;  1SS6 A;  2VYP A;  3GG4 A;  4ILH A;  4AM7 A;  4MLE A;  4EAH D;  1K73 O;  2P9I A;  1ILY A;  5AFU A;  4HWI A;  4DHY A;  3TSU A;  5AQP A;  1K8K A;  3E9L A;  1VQL N;  2DPN A;  2E1Y A;  3NVK A;  3VEY A;  2QWN A;  4GVE A;  4KBO A;  4OPH A;  5EOY A;  3M3Z A;  4KH6 A;  3CD6 N;  4FO0 A;  3RVC A;  4BRG A;  2CGK A;  4FWP A;  4BRN A;  4YOW A;  1GLL O;  4BR7 A;  4H0P A;  2JWK A;  2QA4 N;  3TSQ A;  2NZT A;  3T69 A;  1R59 O;  3B8A X;  1U2V A;  2NRZ A;  5ADX H;  3DJC A;  1P8Z A;  1C0G A;  4O8U A;  5BR9 A;  5GIO A;  4B1V A;  1BOT O;  3A5N C;  3F2K A;  4ISG A;  2CGL A;  4DQ8 A;  4CZG A;  3I55 N;  2WUS A;  4BQL A;  2Q0U A;  5AQS A;  4MO4 A;  5AQN A;  3U9Z A;  4JK9 A;  4C23 A;  1D4X A;  4BRC A;  4EIA A;  4CZM A;  1QZ6 A;  3IDH A;  3MX2 A;  3O08 A;  1YHQ N;  3AGR A;  3OBY A;  1GLA G;  3A8Y A;  1SAZ A;  2V52 B;  2P9L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...