3BF1A

Type iii pantothenate kinase from thermotoga maritima complexed with pantothenate and adp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 73
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf1A01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bf1A02
3UKUB 4BGAA 3HZ6A 3BF1A 3EO3A 1RDWX 2FF3B 3ZETA 2Q1NA 3VERA 1NGAA 4QS9A 4JD2A 3ZEUA 1HPMA 2WUSA 1GLCG 2IIRA 3QICA 1P8ZA 1HLUA 2CGKA 4RWTA 1HKBA 4FWPA 4CZLA 5BPLA 1QHAA 3FZLA 4YDUC 4BRQA 2HF4A 1MDUB 3R8EA 1HJOA 4M63C 3RSEA 2P9NB 4CZKA 1U6ZA 3QFPA 4FWQA 4PKIA 5AFUA 1E4FT 1V4SA 1NGIA 3ATVA 3C7NB 3DXKB 4FWRA 2E88A 1NGFA 2YJFA 2FXUA 3WXKA 5JMVA 1U2VB 3M6GA 3VOVA 1ATRA 1GLFO 3U9ZA 1GLBG 1NMDA 3VEYA 3UE5A 5ADXA 1S3XA 1E4GT 2F9TA 3KZBA 1HKGA 5FPNA 3TPQA 3D2FA 2IVPA 2QWPA 5BRFA 2V52B 1H1VA 1RGIA 5AZJA 2OANA 2GWJA 3O1WA 1HUXA 3GDQA 2E2PA 5AQIA 2QWOA 2ZWHA 3KVGA 4FWMA 4FL9A 3SK3A 4B1WB 4K42A 2YJEA 3O6WA 4WQ4C 5AZIB 2ZGYA 2UYTA 3L0QA 5AR0A 1Q18A 2D1KA 3CETA 4H0XB 3U9DA 3MN7A 4F9OA 1BG3A 1V4TA 4FO0A 5AQPA 2QXLA 4BG9A 3MN5A 2Q36A 4EHUA 4M7YA 5E26A 4MLEA 4CBWA 2P9SB 3A0IX 2ASOA 1T6CA 1JCGA 4B1VA 5KQ8A 3WXIA 3DJCA 2DPNA 3LDNA 4CD3A 2QWMA 2KHOA 4BR7A 4BG8A 4LC9B 5AFUH 3R9PA 1D4XA 2PBDA 5EY4A 1NGJA 3WUHA 4PL8A 2NRHA 3FZMA 3CIPA 3ULEA 3VEZA 3EKUA 2P9KA 2FSKA 4FPBA 5AQTA 2E2OA 1BOTO 4K43A 4RCHA 3VENA 3WXLA 1NGGA 4BC3A 1BA1A 1ATNA 5BRDA 4O5FA 4B1ZA 3ZX0A 4BRMA 4BRPA 4EAHD 3O08A 1DGKN 2GWKA 3SMPA 1MA9B 1YAGA 4CBUA 3MCPA 2VWBA 5AQZA 3EKSA 5AQUA 1QZ6A 3LDPA 4FOEA 2QW9A 3VF6A 1TUUA 1G99A 5F2RA 2P9UA 2A42A 1RFQA 2QWRA 4WQ5C 4FOIA 3LM9A 3WT0A 4DCHA 2P9IA 3GOIA 4CZFA 2YCHA 3A8YA 3O8MA 2BUPA 3H45C 4XH1A 3J8AA 2EWSA 2Q0RA 3EZWA 3GG4A 3H1VX 2H3GX 3LM2A 1BUPA 4QS8A 5E84A 1TYQA 2ITMA 1K8KA 4DHYA 2ZF5O 4BRLA 2D4WA 4BVOA 4PKGA 1J6ZA 2YHWA 3A5OC 1BDGA 3BF3A 5AQYA 3DWLA 4E1JA 4B1YB 5AQHA 5AQGA 3S41A 3VESA 1Y64A 3DAWA 3L6QA 4CI6A 4BRFA 4B1XB 3FE1A 4M7XA 1NGCA 5BREA 3F9MA 4QS7A 1NGDA 2FF6A 4BREA 5AQFA 5AQKA 4NB4A 4CJ7A 1X3MA 4A62A 5AQJA 3A5MC 5LJWA 2HMPA 3BEXA 2CH5A 3ENOA 5BN9A 4JHDA 1Z05A 3UKUA 1X3NA 3HI0A 4KBOA 3QBXA 1QZ5A 2QWQA 3I8BA 4H5WA 4CZIA 1ATSA 1DKGD 1HX1A 1BA0A 1TUYA 3D2EA 1NGHA 3EL2A 3HM8A 4FWSA 5BN8A 2GTDA 5AQNA 3BUZB 1ZXOA 2F9WA 4BRCA 4BR2A 1DEJA 4CZHA 3CJ7A 2CH6A 4IWVA 1IG8A 4XH4A 3FGUA 4PKHA 3GBTA 4H5VA 2D0PA 1SAZA 5F0XA 4ISFA 3C7NA 4FWNA 5AQVA 3DXKA 4B9QA 4BR0A 5F1XA 2P9LB 4A61A 5KPTA 4IJAA 4BRAA 3WEEB 2NLXA 1GLDG 4XH5A 1WOQA 5KQDA 4H0PA 4ISEA 4DQ8A 1R59O 4BRDA 4CZJA 1XUPO 3C0BA 4H0OA 4JAXA 2QM1A 1YVNA 2P9PB 1Z6RA 2CGJA 3AARA 4BQZA 5CE3A 1LOTB 3UKRB 4EFHA 3HTVA 3MK6A 1OKJA 2E1YA 2VYPA 3FR0A 4BR4A 5BRHA 3CJ1A 4I6MB 1MWKA 1NM1A 1NLVA 2VCPA 5ELZA 3TU5A 5B8HA 1X9JA 3I33A 1MWMA 3LDLA 3U4LA 4FPAA 5LJVA 4CZMA 2GELA 1C0FA 5AZIA 1KAXA 4H0YB 1GLAG 2P9IB 4IZ9A 5ADXH 5BPMA 3H3OB 2QWLA 4FWOA 5AQSA 2QWNA 3WQTA 3G25A 3ZETB 3EN9A 3H3NO 5TKYA 5EX5A 5FPMA 3UB5A 3QBWA 3ID8A 3O4WA 4JD2B 1QQMA 3ZEUB 1NBWA 3MMVA 2AP1A 3SMSA 1SQKA 1GLLO 2YHXA 3WXJA 1EQYA 4EIAA 1QQNA 4A2AA 4H03B 1NGEA 2A5XA 3FFKB 4K41A 5JICA 3JXUA 3ATUA 2HOEA 4BRNA 2I7NA 3RSEB 5JLFA 3ZX2A 1HKCA 2YI1A 3GE1A 3MN9A 1JCEA 5AQRA 3VGKA 1YXQA 2A40A 2HF3A 5LY3A 3VGLA 3MDQA 3AY9A 1YUWA 1ESVA 4CZGA 3HSCA 3D7EO 4RTFD 4H0TB 4K25A 5JLHA 4JNEA 3O80A 4ISGA 3D2FB 1ZBSA 5BR9A 3VF2A 3D2EB 3B8AX 5AZJB 3QB0A 5AQLA 1GLEG 3DXMA 4BC2A 4CBXA 3FZFA 3LDOA 1IJJA 3W0LA 3L4IA 1ZC6A 4BC5A 3BP8A 3OHRA 3O5BA 5I9EB 3WQUA 1KAZA 3VPZA 4MO4A 2BTFA 4BC4A 5EVZA 3H1QA 2E1ZA 3IUCA 4NO7A 3U8XA 3VEOA 1C0GA 4BRGA 5KPZA 1T44A 2E20A 4HWIA 4IXCA 4L3QA 4BRKA 2FSNA 4CD1A 1BWFO 4FWLA 2P9NA 4H0VB 1NGBA 3ZX3A 3M1FA 2A3ZA 2A41A 4O8KA 3HBTA 2PAVA 3FZKA 1U2VA 4WQ5A 3A5NC 2Q31A 1XQSC 1KAYA 2FLOA 4AM6A 2V7YA 3CQXA 4FSVA 3ULEB 2GEMA 4BR5A 4Y0WA 4MLHA 3W3DA 2P9KB 2D0OA 3VEWA 2CGLA 2IVNA 3VGMA 1WUAA 4BRIA 2AA4A 5EOYA 3LL3A 3CQYA 4BVPA 3LDQA 3CERA 4A2BA 3VETA 3CJCA 4CZEA 3A5LC 3CJAA 3IFRA 3H46O 3VEVA 4BRHA 4MO5A 4H5NA 3JS6A 3P4IA 4YDUA 2FSJA 1T6DA 5AQOA 4J8FA 1BU6O 3CJ9A 2V7ZA 4DB3A 5FPDA 1S22A 3H6EA 2ASPA 2P9UB 2J4RA 2W40A 2YHYA 3VEXA 3GL1A 3M3ZA 1SZ2A 3AAPA 4BGBA 3FZHA 1NWKA 3CHWA 4EHTA 2Q0UA 2P9LA 3R6MA 4PL7A 4JN4A 3CJBA 1GLJO 3VF4A 3WEEA 4WYBA 3O1BA 3KHYA 1BO5O 4HTLA 4BQLA 1TYQB 1K8KB 1KXPA 2W41A 3MN6A 5FPEA 2P9SA 5EXWA 3SLCA 2P9PA 4IO8A 4B1UB 5BPNA 3QFUA 3UKRA 3CI5A 4H5RA 2ASMA 4C23A 2V51B 3QDKA 5KPRA 4H5TA 2NZTA 3AAQA 3ENHA 1LCUA 1JCFA 4AM7A 4GY2B 4Z94A 4I6MA 2E2QA 2Q2RA 3SJHA 2IVOA 2ZGZA 3QMLA 4BR9A 1CZAN 3IMXA 4XEIA 4FWKA 5AQMA 4IJNA 3FLCO 4GNIA 4WQ4A 2A6AA 2Q97A 3IDHA 1QQOA 2GUPA 5AQQA 2E8AA 5AQXA 4BROA 1XC3A 2I7PA 3DXMB 5AQWA 2E2NA 4JHDB
chains in the Genus database with same CATH superfamily
4BGAA 3BF1A 1RDWX 4FJ9A 3ZETA 3L2WA 1RDBA 2ZE2A 2P51A 1HPMA 4M41A 3KTQA 4DR1K 4CEDA 5M1QA 1HKBA 4FWPA 5BPLA 5J2QA 4M3XA 2QXFA 1BISA 3LAMA 1U45A 5HRNA 4CZKA 2P9NB 5HL7L 1U6ZA 4FWQA 4PKIA 2QA4N 1V4SA 3THXA 1NGIA 3VTHA 4E7JA 1O13A 1BIZA 1I3AA 3O3GA 4FJXA 2XY6A 1ATRA 3DLBA 3DOLA 1HNZK 2HHTA 3VEYA 5ADXA 1ZBIA 1L3UA 3HJFA 4E0DA 4OX9K 5FPNA 1XNRK 2IVPA 2QWPA 2WTUA 1H1VA 1BI4B 1QSSA 1EO1A 4DTXA 2OANA 3M8RA 5C24A 1HUXA 3GDQA 1SL2A 4B9SA 3OYDA 2QWOA 2KQ2A 3QESA 3E9LA 3ZT2A 4J2DA 1ASWA 5CZ1A 2IGIA 1JLBA 3TAEA 3CETA 4H0XB 1WSFA 4FJJA 4H4MA 2ATQA 4AHTA 4DV6K 3QNNA 4FO0A 2Y1IA 3L4QA 2XY7A 1E3MA 2VWJA 2HB5A 3VQDA 3WNGA 5E26A 3K5NA 3NF7A 3OBYA 2P9SB 1ASVA 5GAGP 3A0IX 1RBUA 1T6CA 4B1VA 4KHSA 2DPNA 3LDNA 2KW4A 4KH4A 4BG8A 1YT3A 4CJVA 2VGNA 3JAMO 1BCOA 4DU3A 1NGJA 4DQRA 2NRHA 3FZMA 5HP1A 3VEZA 3ALYA 1S1VA 4NXMK 1JXEA 4GKKK 4RCHA 1FXXA 1RBSA 3LALA 1EP4A 1ATNA 3ZX0A 1LW2A 4E1NA 2P1JA 2RN2A 3VN5A 3V9WA 1YAGA 2RF2A 3Q7BA 3K9KA 5AQUA 1TUUA 1G99A 4BWMA 4WQ5C 4RW4A 3HXMA 4FLZA 3WT0A 1KCFA 4CZFA 2PZSA 1NOZA 4MQ3A 1IKWA 4PQUA 2H3GX 2LSNA 1RNHA 2ITMA 1K8KA 2ZF5O 4X64K 4BVOA 4ELTA 4PKGA 3KWIA 5AQYA 2YNGA 4E1JA 1Q81O 4JKEA 4KI4A 3VESA 3THYA 3ITHA 3OYKA 4B1XB 4DLGA 5M1KA 5BREA 2BH1A 5C10A 4BREA 1KQSM 2PYJA 4JRPA 5HRPA 2KZZA 2JWKA 1FJGK 1X3MA 1OVQA 3A5MC 3BEXA 4JHDA 4CHNA 1Z05A 3K2PA 3UKUA 3HI0A 4KBOA 4KV8A 4B3RK 3EL2A 1YJ9N 3HM8A 5KRSA 3PX6A 2HHXA 5BN8A 2GTDA 2YHBA 4V19S 4QAGA 3OYFA 4DTPA 4CZHA 4WE1A 1TK5A 4FLXA 3NF9A 1IG8A 3FGUA 4PKHA 3GBTA 4C8LA 3HM9A 4ISFA 3C7NA 4FWNA 1VQLN 3TSQA 2NNWA 4A61A 5KPTA 4IJAA 4W5NA 3WEEB 3THWA 5LMNK 5C2DA 3O9SA 3T1HK 1YIJN 4H0PA 4ISEA 4DQ8A 4BE2A 1XUPO 4Z4HA 4NCGA 4ID5A 4B9MA 1B9DA 3AARA 1Z6RA 4Z0UA 1LOTB 4AHUA 3HTVA 1BGXT 2VYPA 1FW6A 2WONA 5BRHA 4CVNE 3SUPA 4I6MB 3P1GA 1IBMK 3SQ0A 4CK3A 5ELZA 5B8HA 1MWMA 3U4LA 3QEPA 4CCHA 4FPAA 4KHPK 3P39A 5GIPA 3CMAN 4Q5VA 1RTDA 1SS6A 3E9PA 4E89A 4CIFA 1VSHA 1DTQA 3PX4A 1QS4A 4FJ8A 4IZ9A 5ADXH 1LAVA 2QWNA 4DU4A 3RTVA 4IEEA 5EX5A 3UB5A 1KSPA 2OPSA 1U4BA 1OH8A 3SMSA 5J1EA 1SQKA 2YHXA 4EIAA 3IAYA 3OS0A 3DOKA 2HHVA 3FFKB 2HOEA 4CFDA 4CJEA 3RSEB 4GV6A 4JKBA 3K9JA 2HHSA 3GE1A 1VSMA 1A5VA 5KTQA 1XMOK 3HO1A 1JCEA 2X6SA 4CGFA 4CFBA 4CEOA 1YXQA 4Y1DA 4OLBA 4B8CA 5M1OA 2UUAK 3RMBA 1NMNA 4I9LA 4DV3K 3OVNA 1U47A 3AVGA 1ESVA 4CZGA 3D7EO 1S6QA 4K25A 3VQCA 3KLFA 5K14A 1VQNN 5TKWA 1N33K 3CM6A 1LWEA 4I2QA 4BC2A 2B4JA 3NMUA 4FM1A 4CBXA 3FZFA 3K57A 1ZC6A 2HHWA 3LANA 1IKXA 2NRVA 2Z1JA 1KAZA 4YOYA 3K5MA 3TAFA 5EVZA 3VQPA 3OYBA 4A59A 3G10A 4HCBA 3U8XA 3VEOA 4IXCA 3T1AA 4CJSA 1HJRA 3V1QA 4BRKA 2FSNA 3AVJA 3CG7A 3L2RA 3DI6A 4FWLA 1J5EK 1NK8A 3WXMB 4DR3K 2D0BA 4FJLA 4WQ5A 1IH7A 2IS3A 2G8VA 1XQSC 1S9GA 3CPWM 4NLCA 2GEMA 4DTUA 3W3DA 2D0OA 2IVNA 2VQFK 1WUAA 3CCJN 2HBKA 3SNNA 4DSLA 4DTSA 3V9ZA 3CJCA 4E7HA 1NKEA 4JK7A 3A5LC 3ZSWA 4H5NA 3JS6A 3P4IA 2FSJA 5AQOA 1K6YA 4J8FA 1S72N 3CJ9A 3HSTB 4AHCA 1W0HA 4B9VA 3QO9A 1RDDA 1NJZA 2RKIA 4LH4A 1RT7A 1GLJO 3VF4A 4WYBA 4JI3K 2VQEK 1BO5O 2OZSA 4E3SA 3OS1A 4BQLA 1TYQB 3TAPA 1XC9A 3LAKA 1HQEA 1X9WA 2P9PA 4IO8A 2P5OA 3UKRA 1YTAA 3CI5A 4H5RA 3FFIA 2OYQA 3QDKA 5HRRA 3SJHA 4DKWA 4N76A 4DFMA 1NK4A 2GUIA 4F2SA 4PA1A 3IMXA 4XEIA 3FLCO 4WQ4A 3ZT1A 2O8EB 3D45A 1QQOA 2GUPA 4FVUA 4B3SK 2E8AA 5AQXA 1RDAA 4N47A 1XC3A 1Q86O 3ZSRA 3RWUA 3HZ6A 4B8AB 4DF8A 1LV5A 3G0ZA 4KHWA 1NK0A 3MWTA 4OLAA 4KHNA 4JI1K 1K9MO 2Q3SA 3ZEUA 4DF4A 2WUSA 1GLCG 2OTJN 1ZBUA 3ZSXA 1JLEA 1HLUA 3NAEA 4RWTA 3V1OA 3K5OA 1TGOA 1QHAA 1N5YA 3SBTA 3P83D 4DUYK 1JL2A 3R8EA 1HJOA 4DFPA 4GMJB 4M3WA 1Y97A 4I2PA 5H1SQ 3ATVA 3DXKB 4FWRA 4OO1J 1G15A 2OPRA 1W9HA 2E88A 1LWFA 2NUBA 2FXUA 1T7PA 3WXKA 5JMVA 1GLFO 1KLMA 4KTWA 4E1MA 1QVFM 5J2NA 1NMDA 1S3XA 1YHQN 3K0SA 1RILA 3TPQA 2YNIA 3D2FA 2V52B 4DV0K 4L8RB 3QEVA 2GWJA 3ASMA 4PHTX 5AQIA 1KVAA 4FL9A 3SK3A 3SQ1A 1SL0A 2DFHA 4M3RA 4K42A 3PO4A 3LZJA 2ZGYA 5AR0A 3UIQA 4J2AA 2O8FB 1TK8A 1IG9A 2D1KA 3MN7A 4RW6A 1VQ5N 5AQPA 3PY8A 2D0AA 1BL3A 1GOBA 4B9NA 3DRRA 3LZIA 4EHUA 1YF5L 4FW1A 1Q82O 4FLWA 3PO5A 4DR4K 3K59A 4WFNL 4CJFA 3TAMA 4CF8A 3VMFB 5EU7A 4CD3A 4BR7A 4DG1A 3AA2A 4CEAA 2RHKA 4DSJA 3AO2A 4LC9B 5SZTA 5SWMA 2G8HA 1IV0A 2QKKA 3ULEA 3AGRA 1S1TA 1Q7YO 1SKWA 5LMUK 1RDCA 3VENA 1BOTO 4CJQA 4W5OA 4BE1A 4DTOA 4G1QA 1BA1A 3AA3A 4NCAA 4B1ZA 3AVIA 4BRMA 4BRPA 4EAHD 3O08A 4X65K 1C1AA 1S1UA 4KO0A 4ILHA 4FJMA 3KWGA 2G8KA 1J53A 1BIUA 2QW9A 4LD0A 3LP1A 4M3UA 2P9UA 5C12A 4DQSA 4KHQA 4FOIA 3LM9A 1S5JA 4DCHA 3AO4A 2P9IA 1WB9A 4DLEA 3O8MA 3A8YA 3NF6A 4XH1A 3I0SA 1R0AA 3CCLN 2O8DB 3TWHA 1BUPA 4DU1A 4OKKA 3CCEN 5E84A 4DHYA 3V81A 3PSIA 3DM2A 4BRLA 4G9ZA 2JLEA 1A5WA 2E4LA 1BDGA 3BF3A 5KRTA 5CHIA 3CCUN 1NJWA 5AQGA 4B9TA 3C6HA 1Y64A 3BZKA 3MEEA 1JLCA 3F9MA 4JI7K 1NGDA 3WNFA 3LP0A 1I94K 3RMCA 4NYNA 2KZMA 2YKMA 4CJ7A 2VG7A 2QKBA 2W42A 5A2QO 1MU2A 3ENOA 3NH2A 2CH5A 4DR5K 1LW0A 5GADP 4LH5A 3DLHA 1QZ5A 4JKGA 4CZIA 4JI6K 1DKGD 2ZJRL 5M1PA 1IKYA 3RRGA 4FWSA 4GVEA 1YTUA 4JS5A 2O4IA 3BUZB 2X74A 2F9WA 4BRCA 4BR2A 4CEEA 3KKSA 3AA4A 2WC9A 4IOXA 1GOCA 3NH1A 1L3SA 3VQ5A 2D0PA 3J81O 3OS2A 5F0XA 3HVRA 5LL6Z 3PLAA 2UUCK 4JK9A 4LSLA 4B9QA 4BR0A 4LFBK 5F1XA 2P9LB 4LF6K 4B9UA 5GAEP 2HHHK 2NLXA 4XH5A 5C25A 4JI5K 4CZJA 4DV2K 4H0OA 3KK2A 1YVUA 4MDAA 2QM1A 2VG6A 1QE1A 1YVNA 3AV9A 3O9TA 1XHXA 3AO3A 1YI2N 4BQZA 4FZXC 4CF1A 4FJIA 3FR0A 4DV1K 3BGRA 2NRWA 2GV9A 1FKPA 4IO9L 3NF8A 3LDLA 3AO1A 3QIOA 5LJVA 3ZSQA 4YORA 3OJSA 1HNWK 3MX5A 2OPPA 5AZIA 1DTTA 4CJ4A 2P9IB 3H3OB 2QWLA 4FWOA 2QTDA 3CF5L 5AQSA 3WQTA 3G71N 3CCRN 1S1WA 3E01A 3EN9A 3ZETB 4O5BA 1TL3A 4GV9A 3TI0A 2ZQBA 3O4WA 1C0MA 3PIOL 1IKVA 1NBWA 3MMVA 2AP1A 1VSFA 3WNEA 1HNIA 3ISNC 1F21A 3WXJA 1EQYA 1IO2A 1HRHA 4A2AA 3EZ5A 3M8SA 1JLQA 1NGEA 4CEFA 3CD6N 3JXUA 3ATUA 4BDZA 3ULDA 1HMVA 4ZTFA 4BDYA 5JLFA 1SL1A 3ZX2A 1S1XA 2KFZA 3THXB 3KIOA 5CR4A 1UA0A 2X6NA 4JKAA 4ZHRA 2XRIA 4IG3A 5LY3A 1VSKA 3OYLA 3SAFA 1U49A 4C1NK 4MFBA 1LAWA 3OYAA 5JLHA 3CPEA 2FBYA 4ISGA 4JKGB 5BR8K 1NK5A 2PYLA 5BR9A 3U3YA 4Z4EA 1VQPN 4KH6A 5AQLA 2ZJPL 4DS4A 1RDUA 3TR8A 3V6DA 4IG0A 1KTQA 3LDOA 1IJJA 3EE9A 4EZ6A 4DTJA 4CESA 2HNDA 4UY8O 4MDBA 3S3OA 2G8UA 2HW3A 2BTFA 4CGJA 4FM2A 3HL8A 3H1QA 4CIEA 5J2PA 2E1ZA 3IUCA 1WAFA 5KPZA 1T44A 2E20A 1VSDA 4CD1A 4W5QA 2HNYA 2FBTA 3F9KA 3SUQA 1VSLA 1C6VA 2A3ZA 1HNVA 4JK8A 2PAVA 3FZKA 4KB0A 1TL1A 2E5LK 3C65A 4B9LA 1N36K 3LWMA 3MCAB 4K0KK 4MLHA 4FZZA 3VGMA 3HOTA 4OPJA 2AA4A 3CQYA 4HCCA 4BVPA 4A2BA 3J80O 1D9FA 4JI0K 3ZT0A 4CZEA 3DLLL 2WBNA 3VEVA 3CJAA 3H46O 4BRHA 4MO5A 3IS9A 4JKFA 2G8IA 1BU6O 2V7ZA 1S22A 1WSIA 1Z25A 3H6EA 4LF9K 2O8CA 2J4RA 2W40A 2YHYA 2R7YA 1SZ2A 1NWKA 2BDPA 3RRHA 1BQMA 4PL7A 4JS4A 3NGIA 3O1BA 5IT9O 2HMIA 3OYNA 3AVCA 1K8KB 1KXPA 1VQMN 4KPYA 4KRFA 3DMJA 1L3TA 2W41A 4CFCA 5HOOA 3OYHA 4U67L 4RG8A 4WF9L 2HBMA 3SLCA 3TTCA 4KFBA 4B1UB 3OYEA 1XWLA 2ASMA 2V51B 5KPRA 4H5TA 2NZTA 3AAQA 3CFRA 3ENHA 4DSFA 3AGKA 3THYB 1QHTA 4AM7A 3LPTA 1ILYA 4EP4A 4BR9A 1X9MA 1TKXA 5AQMA 1NJXA 3ZSVA 4E19A 5J2MA 1YITN 4DV5K 1N8RO 3VQ9A 3U6FA 1T03A 2UXBK 4Z4GA 4BROA 1QQCA 3SI6A 2I7PA 5AQWA 2PY5A 4CGGA 2B6AA 1JLGA 4CGIA 4JHDB 4YNQA 3UKUB 1OH6A 3EO3A 2YKNA 3BY5A 1WN7A 3VERA 3SYZA 4QS9A 4IOCL 4JD2A 3ZT3A 3NVMA 4A5AA 5HLFA 4N41A 2WOMA 2IIRA 3V1RA 1CZ9A 1P8ZA 4JKDA 3VA3A 5M1NA 3MXJA 4YDUC 1TKTA 1SKSA 3L3VA 4O0JA 3C95A 1RBRA 4CJKA 3V9SA 3C7NB 4FJNA 1NGFA 2YJFA 4ILGB 3M6GA 3THWB 3CMEN 3AVLA 2D0CA 4ZTJA 1E4GT 4N5SA 3VTIA 3HOSA 2YNFA 1HKGA 1HYVA 3KJVA 3OJUA 3AA5X 3T3FA 2O8BA 5AZJA 5GINA 4F3OA 2ZWHA 3KVGA 5E41A 3AO5A 2RPIA 3PSFA 4R79A 2YJEA 3O6WA 1JL1A 1J54A 3L0QA 3I56N 1CXQA 3MECA 3JYTA 1ZBLA 4DV4K 5DM7L 4W5RA 4K8XA 1BG3A 1V4TA 1K73O 3ZSZA 4BG9A 3MN5A 2Q36A 4OJRA 3QINA 3BDPA 4M7YA 2D5RA 1VRUA 2IAJA 4FLUA 2GBZA 2ASOA 1NK7A 1JCGA 4JKCA 3WXIA 5KGWA 2KHOA 1NU0A 4DMNA 4FK0A 3M8PA 4IBNA 2HVHA 4OPAA 5AFUH 4UQGA 5EY4A 4ID1A 5AJ3K 1NOYA 5GIOA 4F2RA 2PFUA 3WUHA 4PL8A 4WCEL 4CW7B 3CIPA 2YX6A 4DFJA 3EKUA 1BHLA 2P9KA 3SAHA 4W5TA 3CC2N 4FPBA 2E2OA 4K43A 1IBKK 1FKOA 1NGGA 1WBBA 2HHQA 4M3ZA 1W7AA 1DGKN 2GWKA 3SMPA 3U3GA 4CBUA 3CFPA 3MCPA 2VWBA 4J2BA 5AQZA 4QOZB 1M90O 4Z4FA 1B9FA 4YY3K 3I55N 2FBVA 3VF6A 3E9OA 2G8FA 3PX0A 1WLJA 5CYQA 4CJ5A 3OYIA 3S9HA 3SUOA 4CEZA 2F4VK 2YCHA 3QLHA 3H45C 5CYMA 3S3NA 3OYGA 1EWRA 3M8QA 3LM2A 2O4GA 4NLBA 3DLRA 1C1CA 4LF4K 2D4WA 2DTUA 1NKBA 1J6ZA 2YHWA 1TKZA 3A5OC 5I3UA 2VG5A 3ID6A 5AQHA 1D8YA 3RMDA 4DS5A 3C6TA 4O4GA 4R5PA 4IFYA 4X62K 4O44A 4CI6A 1Q9YA 3R1XA 4ELVA 2QEXN 1RBVA 4IKFA 4Z4CA 1NGCA 2FF6A 1RTJA 5AQFA 4RW7A 5AQKA 2HBLA 1RTIA 1RT2A 3O9UA 4A62A 5AQJA 3TABA 4IFEA 1DT9A 5BN9A 3G4SN 4KHYA 4F8RA 1EXQA 3QBXA 2F7TA 2QWQA 3I8BA 4H5WA 3C94A 3ZSYA 1BA0A 1TUYA 3D2EA 3OA9A 1NGHA 3RR7A 1SUQA 3RMAA 4FM0A 4GKJK 1ZXOA 4KKOA 1HYSA 1OH5A 3CJ7A 2CH6A 4H5VA 1C0TA 2HBJA 4YHHK 4K8ZA 5AQVA 3TTDA 3NH0A 3NCIA 5FRMA 4IOAL 4GW6A 1GLDG 4IFVA 1WOQA 1UOCA 1RT1A 2BE2A 3OTOK 3VQAA 4GVMA 4BRDA 4JI4K 3C0BA 1KLNA 4JAXA 2P9PB 2CGJA 1A5XA 4CFAA 5CE3A 3UKRB 5HRSA 1OKJA 2E1YA 1YJNN 3T19A 4AF1A 4CJLA 3MXMA 1NG9A 1BI4A 2A1SA 3KK3A 1KRPA 1NM1A 4YOWA 4F4KA 3H08A 3TU5A 3I33A 4CJWA 3SAGA 3V4IA 3G6EN 1N34K 4JKHA 4CZMA 1KD1O 2GELA 3NBPA 4NXNK 3NFAA 2OPQA 4KI6A 2ZD1A 3B6OA 1KAXA 1QSLA 3AVHA 3T7ZA 3D0PA 1XNQK 4CEQA 1QSYA 4KTQA 5BPMA 3TSPA 3B6PA 2BANA 4CEBA 1JJ2M 4DR6K 1S6PA 4M42A 1U48A 3L2VA 4BY9C 2B5JA 3ZEUB 1HQUA 4FJGA 1GLLO 2F8SA 1QQNA 4CERA 4KHUA 3P5JA 3K5LA 4KH5A 4CHZA 3TARA 3F73A 4BRNA 1B92A 2I7NA 1TKDA 1HKCA 3DLEA 1FK9A 3VGKA 4O55A 3CC4N 3L2UA 2A40A 2HF3A 5KGXA 4FK2A 1X9SA 3VGLA 3MDQA 3SV4A 4Z4IA 3AY9A 3HSCA 4ICLA 4RTFD 1TAUA 3P31A 1TK0A 3DRPA 4DSEA 4A5BA 3DYAA 4JNEA 4CK2A 1ZBHA 3D2FB 3HPGA 4GV3A 1ZBSA 3CYMA 3VF2A 3D2EB 3NDKA 2ZM6K 4CK1A 5JS2A 1WSEA 2VWKA 3MEDA 3W0LA 3E66A 2KTQA 4BC5A 1VSEA 3O4NA 5C2FA 3BP8A 3EYZA 3CFOA 3OHRA 4CJPA 2OCEA 2Z1HA 4DR2K 3J7AP 3O5BA 5I9EB 4XIUA 4C8KA 5CY4A 4MO4A 4BC4A 1JXBA 4H8KA 4HUEA 3MAQA 4NO7A 3CCVN 4JI2K 3LP3A 4BRGA 4N56A 4HWIA 3S3MA 2RE2A 4RW9A 4CJUA 1BWFO 1T3VA 4H0VB 1CXUA 1HNXK 3ZX3A 4E7LA 3M1FA 4KTZA 4O8KA 4M45A 4LY7A 4BACA 3HBTA 3LP2A 2XO7A 1U2VA 2YV0X 1VAZA 3A5NC 5C15A 4DSKA 1LWCA 3KD1E 1QVGM 2OA8A 3KLIA 3K58A 1KAYA 2FLOA 4C1NI 3V9UA 4JYAK 4DR7K 2UXDK 3ULEB 3O3FA 4KREA 1VHXA 5DMRA 3KLEA 5EOYA 5C42A 3LDQA 1VQ7N 4FLTA 1Q8IA 4YOVA 1JLAA 2KKZA 4OPHA 4DB3A 5FPDA 2P9UB 3VEXA 2Y1JA 3FZHA 3CHWA 4EHTA 4BWJA 1BQNA 2G8WA 1WNSA 5FDLA 3F2KA 3VQ4A 3Q7CA 4IEIA 3R6MA 4JN4A 4CGDA 4BE0A 2UU9K 3WEEA 3E1YA 3KHYA 3MWPA 2JGUA 4FW2A 5FROA 4HTLA 4ILJA 2I5JA 4A57A 3NHGA 1C1BA 1RBTA 1VQ6N 1ZBFA 2NRZA 3HP6A 5BPNA 3QFUA 4B3TK 2P5GA 1DLOA 4AQYK 1SKRA 3D6RA 1LCUA 2FC0A 3SQ2A 4CF0A 4I6MA 4DTMA 2E2QA 3QETA 2HSTA 2IVOA 4CECA 1CZAN 1VQ8N 4HUGA 2ETJA 4E7KA 4DSIA 3IDHA 1NKCA 3EY1A 4JRQA 2HHUA 2E2NA 1NJIO 1L3VA 2Z1GA 4H4OA 3AVBA 4CF9A 5FRNA 5FLXO 4YOUA 4C8OA 3O9QA 2FF3B 2Q1NA 3MEGA 4CJRA 1NGAA 3MX2A 3T69A 4CGHA 3TAGA 1N32K 5C0YA 1CLQA 3AVMA 3QICA 4FLYA 2CGKA 4JV5K 3ZYYX 4CZLA 3FZLA 3QIPA 4BRQA 2HF4A 4CJTA 4DV7K 1K8AO 1EETA 1MDUB 1HYZA 4NCBA 1RT6A 4M63C 3RSEA 5AFUA 3QFPA 1TVRA 1E4FT 3A2FA 3TAQA 4J2EA 3BZCA 1TAQA 4HUFA 1WSJA 3SPYA 1U2VB 2EHGA 3VOVA 3U9ZA 1GLBG 3UE5A 4M3YA 2F9TA 3SZ2A 3KZBA 3M5RA 5BRFA 2Z1IA 2XY8A 3EEQA 3OYJA 1VQKN 3L8BA 2KFNA 1TV6A 1RGIA 3I0RA 4DUZK 3O1WA 1JKHA 2E2PA 5I42A 3KLGA 4FWMA 3AVFA 2XY5A 3VQEA 4B1WB 3QERA 4FVMA 4DTRA 4WQ4C 4YFUA 3CQ8A 3KD5E 5AZIB 2UYTA 3NE6A 3HP9A 1Q18A 2VGMA 4HVJA 3U9DA 1RTHA 4F9OA 1UWBA 4LF7K 2QXLA 4EZ9A 2EX3A 5MLCQ 4MLEA 4CBWA 4AILC 1UA1A 4IDHA 3HPHA 3THVA 3O9RA 3OYCA 3PUFA 5CZ2A 1CZBA 5KQ8A 3DJCA 2QWMA 3KLHA 3AVAA 2BGGA 2F96A 3DRSA 1ZYQA 3RR8A 3R9PA 1D4XA 2PBDA 1XI1A 1QTMA 3ZCMA 1KC8O 5HBMA 3TANA 2IOCA 3LPUA 1W97L 4C8MA 1D5AA 2FSKA 5AQTA 3WXLA 1BCMA 3PV8A 1Z26A 4BC3A 3DLKA 5BRDA 4O5FA 2UUBK 1EKEA 1KFSA 3KKRA 1VSJA 5T7BA 1MA9B 2OTLN 3EKSA 3CC7N 3LDSA 1QZ6A 3IKMA 3LDPA 4FOEA 4OGCA 3ZT4A 5F2RA 1M1KO 4LFAK 4CHYA 2A42A 1RFQA 3SPZA 3OYMA 2QWRA 3ZLJA 4OKJA 3VQ6A 1VQ9N 1U04A 1C0UA 3GOIA 2QK9A 1WAJA 2BUPA 4LSNA 3CM5A 3J8AA 2EWSA 2Q0RA 3EZWA 3GG4A 3H1VX 4KB1A 3TSUA 2DFFA 4QS8A 4CHQA 1TYQA 1UAXA 3AVNA 2YNHA 4DFKA 4FCYA 2XHBA 3DWLA 1OVYA 3HVTA 3IRXA 3ZSOA 4B1YB 3S41A 2W6KA 3DAWA 3L6QA 4BRFA 1YJWN 3FE1A 3SUNA 4M7XA 4QS7A 1N6QA 1WSGA 1VSIA 2O8EA 4NB4A 1I39A 4C8NA 4CE9A 3QNOA 4AHSA 3KK1A 5LJWA 2HMPA 1EX4A 3T1YK 2KLAA 1RCHA 4DTNA 1X3NA 5JS1A 4FJ7A 4RW8A 1J5OA 3J7YP 4JEPA 1ATSA 1HX1A 3VQBA 2UXCK 4QCLA 3L2QA 4E7IA 5AQNA 1EWQA 4LF5K 1NJYA 1GOAA 1DEJA 2YHAA 4IWVA 2O8CB 4XH4A 4HHTA 1SAZA 5JVHL 3IG1A 3JSMA 1J9AA 1OH7A 3DXKA 4BRAA 4DWIA 1KVBA 4AHVA 5KQDA 2IC3A 1ITGA 1R59O 1SV5A 3DLGA 2X78A 4X66K 4EFHA 1T8EA 3MK6A 1REVA 1HPZA 4BR4A 4O0IA 3CJ1A 4YOXA 4OPKA 1MWKA 1NLVA 2VCPA 4LF8K 1X9JA 3R3LA 2NRTA 3ENBA 3N4QA 1C0FA 3PIPL 3NVKA 2O8FA 3J7ZO 1ASUA 1GLAG 4H0YB 3CCMN 2JWLA 3HRGA 3G25A 3LWLA 3H3NO 5TKYA 3TTFA 5FPMA 3QEIA 3QBWA 1NNEA 3ID8A 1VRTA 4JD2B 1QQMA 4PWDA 3WNHA 4WFBL 4TSXA 1JLFA 3P38A 4H03B 1T05A 2A5XA 4K41A 5JICA 2OZMA 5D3GA 3I8DA 4PUOA 3CXCM 2YI1A 1X1PA 3MN9A 1XHZA 3VQ7A 5AQRA 3N4PA 3C6UA 4FJHA 4B08A 1RT3A 2FBXA 3C6AA 1VK0A 4M3TA 2DY4A 1YUWA 3VA0A 4H0TB 4PY5A 3HK2A 4WFAL 3O80A 4FJKA 3KK7A 4OKEA 3QEWA 2WFBA 4CHOA 3B8AX 2O8BB 2HVIA 5AZJB 3QB0A 2F8TA 1GLEG 1P90A 4OGEA 4FYDA 3CCQN 4CHPA 3DXMA 4ELUA 1IBLK 2NRRA 2W6LA 3MXIA 4YOTA 3L4IA 4EP5A 4CF2A 5DK5A 1D9DA 2O8DA 2E6LA 2E6MA 4FLVA 3WQUA 3VPZA 4U7BA 3NGZA 4HTUA 5IWAK 2ZJQL 3SJJA 3EE8A 2IDOA 1C0GA 3SBGA 3NGYA 4L3QA 4AH9A 4BDPA 3F5TA 2P9NA 4FJ5A 1NGBA 3HT3A 4FXDA 1O1WA 2A41A 1NK6A 1VQ4N 3CCSN 4F3TA 1KFDA 2Q31A 4CJ3A 3VQQA 1WSHA 2QI2A 4AM6A 2V7YA 3CQXA 5M1FA 4FSVA 3OY9A 4BR5A 4Y0WA 2HNZA 2P9KB 3VEWA 3VQ8A 2CGLA 4JI8K 1L5UA 4BRIA 4LFCK 1Q9XA 3LL3A 1WBDA 4B3OA 3CERA 3VETA 3HPOA 4NYFA 2GX9A 4B3MK 3IFRA 3SV3A 4YDUA 5GAHP 4CIGA 1T6DA 3O3HA 3OW2M 2ASPA 3GL1A 3M3ZA 3AAPA 4BGBA 4KAZA 4DQPA 4IDKA 3O4QA 2Q0UA 4Y1CA 4I7FA 2P9LA 4I9QA 4FZYA 3CJBA 5JVGL 3SQ4A 1HR0K 4Q0BA 3AVKA 2A1RA 3MN6A 4AHRA 5FPEA 4DQQA 1W2BM 2P9SA 5EXWA 3V9XA 2NRXA 1NK9A 5HROA 5DM6L 4C23A 4FK4A 1JCFA 4GY2B 4O8UA 4Z94A 5KI6A 1KVCA 2ITGA 2Q2RA 2ZGZA 3QMLA 3L3UA 1RT5A 2DFEA 1S9EA 4FWKA 4IJNA 4GNIA 3HYFA 3OBWA 2A6AA 2Q97A 1XMQK 5AQQA 4DQIA 1RT4A 3RVCA 1VQON 4OVLA 3DXMB 3QEXA 4JLHA 3SCXA 2AJQA
chains in the Genus database with same CATH topology
3UKUB 4BGAA 3HZ6A 3BF1A 3EO3A 1RDWX 4YOUA 3MWTA 3O9QA 2FF3B 3ZETA 2Q1NA 3VERA 1K9MO 1NGAA 3MX2A 3T69A 4QS9A 5C0YA 4IOCL 4JD2A 4A5AA 3NVMA 3ZEUA 1HPMA 2WUSA 1GLCG 2OTJN 2IIRA 3QICA 1P8ZA 1HLUA 2CGKA 5M1QA 4RWTA 4JKDA 3ZYYX 5M1NA 1HKBA 4FWPA 4CZLA 5BPLA 1QHAA 3FZLA 3SBTA 4YDUC 1K8AO 4BRQA 2HF4A 1MDUB 3R8EA 1HJOA 4M63C 3RSEA 2P9NB 4CZKA 5HL7L 1U6ZA 3QFPA 4FWQA 4PKIA 5AFUA 2QA4N 1E4FT 1V4SA 5H1SQ 1NGIA 3ATVA 3C7NB 3VTHA 3DXKB 1O13A 4FWRA 4OO1J 2E88A 1NGFA 2YJFA 2FXUA 3WXKA 5JMVA 1U2VB 4ILGB 3M6GA 3CMEN 3VOVA 1ATRA 1GLFO 1QVFM 3U9ZA 1GLBG 1NMDA 3VEYA 3UE5A 5ADXA 1S3XA 1E4GT 1YHQN 2F9TA 3VTIA 3HOSA 3KZBA 1HKGA 5FPNA 3TPQA 3M5RA 3D2FA 2IVPA 2QWPA 5BRFA 2V52B 1H1VA 1VQKN 1RGIA 5AZJA 5GINA 1EO1A 2OANA 2GWJA 3O1WA 1HUXA 3GDQA 2E2PA 4PHTX 5AQIA 2QWOA 2ZWHA 3KVGA 4FWMA 4FL9A 3SK3A 4B1WB 4K42A 3E9LA 4R79A 2YJEA 3O6WA 4WQ4C 5AZIB 2ZGYA 2UYTA 3L0QA 5AR0A 3I56N 1Q18A 2VGMA 2D1KA 3CETA 4H0XB 3U9DA 3MN7A 4F9OA 5DM7L 1VQ5N 1BG3A 1V4TA 4FO0A 5AQPA 1K73O 2QXLA 3L4QA 4BG9A 3MN5A 2Q36A 5MLCQ 4EHUA 1YF5L 4M7YA 5E26A 1Q82O 4MLEA 4CBWA 3OBYA 2P9SB 5GAGP 4IDHA 4WFNL 3A0IX 3O9RA 2ASOA 1T6CA 1JCGA 4JKCA 4B1VA 5KQ8A 3WXIA 3DJCA 3VMFB 2DPNA 3LDNA 4CD3A 2QWMA 2KHOA 4BR7A 4KH4A 4BG8A 2RHKA 2VGNA 4LC9B 4OPAA 5AFUH 3R9PA 1D4XA 2PBDA 5EY4A 5GIOA 1NGJA 2PFUA 3WUHA 4PL8A 4WCEL 1KC8O 2NRHA 3FZMA 3CIPA 3ULEA 3AGRA 1W97L 3VEZA 2YX6A 1Q7YO 3EKUA 2P9KA 3SAHA 2FSKA 3CC2N 4FPBA 5AQTA 2E2OA 1BOTO 4K43A 4RCHA 3VENA 3WXLA 1NGGA 4BC3A 1BA1A 1ATNA 5BRDA 4O5FA 4B1ZA 3ZX0A 4BRMA 4BRPA 4EAHD 3O08A 1DGKN 2GWKA 3SMPA 1MA9B 1YAGA 4CBUA 3MCPA 2VWBA 4ILHA 2OTLN 5AQZA 3EKSA 3KWGA 3Q7BA 1M90O 3CC7N 3I55N 3K9KA 5AQUA 1QZ6A 3IKMA 3LDPA 2QW9A 4FOEA 3VF6A 3E9OA 1TUUA 1G99A 5F2RA 1M1KO 2P9UA 2A42A 1RFQA 5C12A 2QWRA 4WQ5C 4FOIA 3LM9A 3WT0A 1VQ9N 4DCHA 2P9IA 3GOIA 4CZFA 2YCHA 3A8YA 3O8MA 2BUPA 3H45C 4XH1A 3J8AA 2EWSA 2Q0RA 3EZWA 3GG4A 3H1VX 3CCLN 2H3GX 3LM2A 4NLBA 3TSUA 1BUPA 3CCEN 4QS8A 5E84A 1TYQA 2ITMA 1K8KA 4DHYA 2ZF5O 4BRLA 2D4WA 4G9ZA 4BVOA 4PKGA 1J6ZA 2YHWA 3KWIA 3A5OC 1BDGA 3BF3A 5AQYA 5CHIA 3ID6A 3DWLA 1OVYA 4E1JA 3CCUN 4B1YB 1Q81O 5AQHA 5AQGA 3S41A 4JKEA 3C6HA 3VESA 1Y64A 3DAWA 3L6QA 4CI6A 4BRFA 3R1XA 1YJWN 4B1XB 3FE1A 2QEXN 4M7XA 5M1KA 1NGCA 5BREA 3F9MA 4QS7A 1NGDA 2BH1A 2FF6A 5C10A 4BREA 1KQSM 5AQFA 5AQKA 4NB4A 2JWKA 2HBLA 4CJ7A 3O9UA 1X3MA 4A62A 5AQJA 3A5MC 4IFEA 1DT9A 5LJWA 2HMPA 3BEXA 2CH5A 3ENOA 5BN9A 2KLAA 4JHDA 1Z05A 3UKUA 5GADP 3G4SN 1X3NA 3HI0A 4KBOA 3QBXA 1QZ5A 2F7TA 2QWQA 3I8BA 4H5WA 4JKGA 4JEPA 4CZIA 1ATSA 1DKGD 1HX1A 1BA0A 1TUYA 3D2EA 3OA9A 1NGHA 3EL2A 2ZJRL 5M1PA 3HM8A 1YJ9N 4FWSA 4GVEA 5BN8A 2GTDA 5AQNA 3BUZB 1ZXOA 2F9WA 4BRCA 4BR2A 1DEJA 4CZHA 2WC9A 3CJ7A 4IOXA 2CH6A 4IWVA 1IG8A 4XH4A 3FGUA 4PKHA 3GBTA 4H5VA 2D0PA 1SAZA 5F0XA 5JVHL 3PLAA 2HBJA 4ISFA 3C7NA 4JK9A 4FWNA 5AQVA 3DXKA 3TTDA 4B9QA 4BR0A 1VQLN 5F1XA 2P9LB 3TSQA 2NNWA 4A61A 5KPTA 4IJAA 4BRAA 5GAEP 3WEEB 4IOAL 2NLXA 1GLDG 4XH5A 5C2DA 1WOQA 3O9SA 5KQDA 1YIJN 4H0PA 4ISEA 4DQ8A 1R59O 4BRDA 4CZJA 1XUPO 3C0BA 4H0OA 4JAXA 4MDAA 2QM1A 1YVNA 3O9TA 2P9PB 1Z6RA 2CGJA 3AARA 4BQZA 5CE3A 1YI2N 1LOTB 3UKRB 4EFHA 3HTVA 3MK6A 1OKJA 2E1YA 1YJNN 4AF1A 2VYPA 3FR0A 4BR4A 5BRHA 2NRWA 3CJ1A 4I6MB 4YOXA 1MWKA 4IO9L 1NM1A 1NLVA 2VCPA 4YOWA 5ELZA 3TU5A 5B8HA 1X9JA 3I33A 1MWMA 3LDLA 3R3LA 2NRTA 3U4LA 3SAGA 4FPAA 3G6EN 3ENBA 3P39A 5LJVA 4JKHA 4CZMA 3N4QA 5GIPA 4YORA 3CMAN 1KD1O 2GELA 1C0FA 3PIPL 3MX5A 5AZIA 1SS6A 3E9PA 3NVKA 1KAXA 4H0YB 1GLAG 3J7ZO 2P9IB 3T7ZA 3CCMN 4IZ9A 5ADXH 5BPMA 3H3OB 2QWLA 4FWOA 2QTDA 3TSPA 3CF5L 5AQSA 2JWLA 1JJ2M 2QWNA 3HRGA 3WQTA 3G25A 3G71N 3CCRN 3ZETB 3EN9A 3H3NO 5TKYA 4IEEA 4GV9A 5EX5A 5FPMA 3TTFA 3UB5A 3QBWA 3ID8A 4BY9C 3O4WA 4JD2B 1QQMA 3ZEUB 1NBWA 3PIOL 3MMVA 2AP1A 4WFBL 3SMSA 1SQKA 1GLLO 2YHXA 3WXJA 1EQYA 4EIAA 1QQNA 3P38A 4A2AA 4H03B 1NGEA 2A5XA 3CD6N 3FFKB 4K41A 4KH5A 3JXUA 3ATUA 5JICA 2HOEA 4BRNA 2I7NA 3RSEB 5JLFA 4GV6A 3CXCM 4JKBA 3K9JA 3ZX2A 1HKCA 2YI1A 3GE1A 3MN9A 5CR4A 1JCEA 3N4PA 5AQRA 3VGKA 3CC4N 1YXQA 4JKAA 2A40A 2HF3A 5M1OA 5LY3A 3C6AA 3VGLA 3MDQA 3SAFA 3AY9A 1YUWA 4C1NK 1ESVA 4CZGA 3HSCA 3D7EO 4RTFD 4H0TB 3P31A 4K25A 3CPEA 5JLHA 4A5BA 4WFAL 4JNEA 3O80A 4ISGA 4JKGB 3D2FB 3KK7A 4GV3A 1ZBSA 5BR9A 1VQNN 2WFBA 3D2EB 3VF2A 3B8AX 1VQPN 5AZJB 3QB0A 5TKWA 4KH6A 5AQLA 1GLEG 2ZJPL 1P90A 1RDUA 3CCQN 3DXMA 4BC2A 3NMUA 2NRRA 4CBXA 3FZFA 3LDOA 1IJJA 3W0LA 3E66A 3EE9A 3L4IA 4YOTA 1ZC6A 4BC5A 5C2FA 3BP8A 3OHRA 4UY8O 2NRVA 3O5BA 4MDBA 3WQUA 5I9EB 1KAZA 3VPZA 4YOYA 4MO4A 4U7BA 2BTFA 4BC4A 5EVZA 2ZJQL 3H1QA 4A59A 2E1ZA 3EE8A 3IUCA 4NO7A 3CCVN 3U8XA 3VEOA 1C0GA 4BRGA 5KPZA 1T44A 2E20A 4HWIA 3SBGA 4IXCA 4L3QA 2RE2A 4BRKA 2FSNA 4CD1A 1BWFO 1T3VA 3F5TA 2P9NA 4FWLA 4H0VB 1NGBA 3ZX3A 3M1FA 2A3ZA 3WXMB 2A41A 4O8KA 4JK8A 1VQ4N 3HBTA 3CCSN 2PAVA 3FZKA 1U2VA 4WQ5A 3A5NC 1VAZA 5C15A 3C65A 2Q31A 1XQSC 1QVGM 2QI2A 1KAYA 2FLOA 4C1NI 4AM6A 2V7YA 3CQXA 5M1FA 4FSVA 3MCAB 3ULEB 3CPWM 4NLCA 2GEMA 4BR5A 4Y0WA 4MLHA 3W3DA 2P9KB 2D0OA 3VEWA 2CGLA 2IVNA 3VGMA 3HOTA 1WUAA 4BRIA 2AA4A 2HBKA 3CCJN 5EOYA 3LL3A 3CQYA 4BVPA 3LDQA 3CERA 4A2BA 3VETA 1VQ7N 4YOVA 3CJCA 4JK7A 4CZEA 2GX9A 3DLLL 2WBNA 3A5LC 3CJAA 3IFRA 3H46O 3VEVA 4BRHA 4MO5A 4H5NA 3JS6A 3P4IA 2KKZA 2FSJA 4OPHA 4YDUA 5GAHP 4JKFA 1T6DA 5AQOA 4J8FA 1BU6O 1S72N 3CJ9A 2V7ZA 4DB3A 5FPDA 1S22A 3H6EA 2ASPA 3OW2M 2P9UB 2J4RA 2W40A 2YHYA 3VEXA 3GL1A 3M3ZA 1SZ2A 3AAPA 4BGBA 3FZHA 1NWKA 3CHWA 4EHTA 2Q0UA 3F2KA 3Q7CA 4IEIA 2P9LA 3R6MA 4PL7A 4JN4A 3CJBA 1GLJO 3VF4A 3WEEA 4WYBA 3E1YA 3KHYA 3O1BA 3MWPA 5JVGL 1BO5O 4HTLA 4ILJA 4BQLA 1TYQB 1K8KB 1KXPA 1VQMN 4A57A 2W41A 3MN6A 5FPEA 5HOOA 1W2BM 2P9SA 4U67L 1VQ6N 4WF9L 2NRZA 2HBMA 5EXWA 3SLCA 2P9PA 4IO8A 3TTCA 4B1UB 3QFUA 5BPNA 2NRXA 3UKRA 5DM6L 3CI5A 4H5RA 2ASMA 4C23A 2V51B 3QDKA 5KPRA 4H5TA 2NZTA 3AAQA 3D6RA 3ENHA 1LCUA 3AGKA 1JCFA 4AM7A 4GY2B 4O8UA 4Z94A 1ILYA 4I6MA 2E2QA 2Q2RA 3SJHA 2HSTA 4DKWA 2IVOA 2ZGZA 3QMLA 4BR9A 1CZAN 3IMXA 4XEIA 4FWKA 5AQMA 1VQ8N 4IJNA 3FLCO 4GNIA 4WQ4A 1YITN 1N8RO 3OBWA 2A6AA 2Q97A 3IDHA 1QQOA 2GUPA 5AQQA 4FVUA 2E8AA 5AQXA 3RVCA 4BROA 1Q86O 1XC3A 1VQON 2I7PA 3DXMB 5AQWA 2E2NA 1NJIO 4JHDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKU B;  4BGA A;  3HZ6 A;  3BF1 A;  3EO3 A;  1RDW X;  2FF3 B;  3ZET A;  2Q1N A;  3VER A;  1NGA A;  4QS9 A;  4JD2 A;  3ZEU A;  1HPM A;  2WUS A;  1GLC G;  2IIR A;  3QIC A;  1P8Z A;  1HLU A;  2CGK A;  4RWT A;  1HKB A;  4FWP A;  4CZL A;  5BPL A;  1QHA A;  3FZL A;  4YDU C;  4BRQ A;  2HF4 A;  1MDU B;  3R8E A;  1HJO A;  4M63 C;  3RSE A;  2P9N B;  4CZK A;  1U6Z A;  3QFP A;  4FWQ A;  4PKI A;  5AFU A;  1E4F T;  1V4S A;  1NGI A;  3ATV A;  3C7N B;  3DXK B;  4FWR A;  2E88 A;  1NGF A;  2YJF A;  2FXU A;  3WXK A;  5JMV A;  1U2V B;  3M6G A;  3VOV A;  1ATR A;  1GLF O;  3U9Z A;  1GLB G;  1NMD A;  3VEY A;  3UE5 A;  5ADX A;  1S3X A;  1E4G T;  2F9T A;  3KZB A;  1HKG A;  5FPN A;  3TPQ A;  3D2F A;  2IVP A;  2QWP A;  5BRF A;  2V52 B;  1H1V A;  1RGI A;  5AZJ A;  2OAN A;  2GWJ A;  3O1W A;  1HUX A;  3GDQ A;  2E2P A;  5AQI A;  2QWO A;  2ZWH A;  3KVG A;  4FWM A;  4FL9 A;  3SK3 A;  4B1W B;  4K42 A;  2YJE A;  3O6W A;  4WQ4 C;  5AZI B;  2ZGY A;  2UYT A;  3L0Q A;  5AR0 A;  1Q18 A;  2D1K A;  3CET A;  4H0X B;  3U9D A;  3MN7 A;  4F9O A;  1BG3 A;  1V4T A;  4FO0 A;  5AQP A;  2QXL A;  4BG9 A;  3MN5 A;  2Q36 A;  4EHU A;  4M7Y A;  5E26 A;  4MLE A;  4CBW A;  2P9S B;  3A0I X;  2ASO A;  1T6C A;  1JCG A;  4B1V A;  5KQ8 A;  3WXI A;  3DJC A;  2DPN A;  3LDN A;  4CD3 A;  2QWM A;  2KHO A;  4BR7 A;  4BG8 A;  4LC9 B;  5AFU H;  3R9P A;  1D4X A;  2PBD A;  5EY4 A;  1NGJ A;  3WUH A;  4PL8 A;  2NRH A;  3FZM A;  3CIP A;  3ULE A;  3VEZ A;  3EKU A;  2P9K A;  2FSK A;  4FPB A;  5AQT A;  2E2O A;  1BOT O;  4K43 A;  4RCH A;  3VEN A;  3WXL A;  1NGG A;  4BC3 A;  1BA1 A;  1ATN A;  5BRD A;  4O5F A;  4B1Z A;  3ZX0 A;  4BRM A;  4BRP A;  4EAH D;  3O08 A;  1DGK N;  2GWK A;  3SMP A;  1MA9 B;  1YAG A;  4CBU A;  3MCP A;  2VWB A;  5AQZ A;  3EKS A;  5AQU A;  1QZ6 A;  3LDP A;  4FOE A;  2QW9 A;  3VF6 A;  1TUU A;  1G99 A;  5F2R A;  2P9U A;  2A42 A;  1RFQ A;  2QWR A;  4WQ5 C;  4FOI A;  3LM9 A;  3WT0 A;  4DCH A;  2P9I A;  3GOI A;  4CZF A;  2YCH A;  3A8Y A;  3O8M A;  2BUP A;  3H45 C;  4XH1 A;  3J8A A;  2EWS A;  2Q0R A;  3EZW A;  3GG4 A;  3H1V X;  2H3G X;  3LM2 A;  1BUP A;  4QS8 A;  5E84 A;  1TYQ A;  2ITM A;  1K8K A;  4DHY A;  2ZF5 O;  4BRL A;  2D4W A;  4BVO A;  4PKG A;  1J6Z A;  2YHW A;  3A5O C;  1BDG A;  3BF3 A;  5AQY A;  3DWL A;  4E1J A;  4B1Y B;  5AQH A;  5AQG A;  3S41 A;  3VES A;  1Y64 A;  3DAW A;  3L6Q A;  4CI6 A;  4BRF A;  4B1X B;  3FE1 A;  4M7X A;  1NGC A;  5BRE A;  3F9M A;  4QS7 A;  1NGD A;  2FF6 A;  4BRE A;  5AQF A;  5AQK A;  4NB4 A;  4CJ7 A;  1X3M A;  4A62 A;  5AQJ A;  3A5M C;  5LJW A;  2HMP A;  3BEX A;  2CH5 A;  3ENO A;  5BN9 A;  4JHD A;  1Z05 A;  3UKU A;  1X3N A;  3HI0 A;  4KBO A;  3QBX A;  1QZ5 A;  2QWQ A;  3I8B A;  4H5W A;  4CZI A;  1ATS A;  1DKG D;  1HX1 A;  1BA0 A;  1TUY A;  3D2E A;  1NGH A;  3EL2 A;  3HM8 A;  4FWS A;  5BN8 A;  2GTD A;  5AQN A;  3BUZ B;  1ZXO A;  2F9W A;  4BRC A;  4BR2 A;  1DEJ A;  4CZH A;  3CJ7 A;  2CH6 A;  4IWV A;  1IG8 A;  4XH4 A;  3FGU A;  4PKH A;  3GBT A;  4H5V A;  2D0P A;  1SAZ A;  5F0X A;  4ISF A;  3C7N A;  4FWN A;  5AQV A;  3DXK A;  4B9Q A;  4BR0 A;  5F1X A;  2P9L B;  4A61 A;  5KPT A;  4IJA A;  4BRA A;  3WEE B;  2NLX A;  1GLD G;  4XH5 A;  1WOQ A;  5KQD A;  4H0P A;  4ISE A;  4DQ8 A;  1R59 O;  4BRD A;  4CZJ A;  1XUP O;  3C0B A;  4H0O A;  4JAX A;  2QM1 A;  1YVN A;  2P9P B;  1Z6R A;  2CGJ A;  3AAR A;  4BQZ A;  5CE3 A;  1LOT B;  3UKR B;  4EFH A;  3HTV A;  3MK6 A;  1OKJ A;  2E1Y A;  2VYP A;  3FR0 A;  4BR4 A;  5BRH A;  3CJ1 A;  4I6M B;  1MWK A;  1NM1 A;  1NLV A;  2VCP A;  5ELZ A;  3TU5 A;  5B8H A;  1X9J A;  3I33 A;  1MWM A;  3LDL A;  3U4L A;  4FPA A;  5LJV A;  4CZM A;  2GEL A;  1C0F A;  5AZI A;  1KAX A;  4H0Y B;  1GLA G;  2P9I B;  4IZ9 A;  5ADX H;  5BPM A;  3H3O B;  2QWL A;  4FWO A;  5AQS A;  2QWN A;  3WQT A;  3G25 A;  3ZET B;  3EN9 A;  3H3N O;  5TKY A;  5EX5 A;  5FPM A;  3UB5 A;  3QBW A;  3ID8 A;  3O4W A;  4JD2 B;  1QQM A;  3ZEU B;  1NBW A;  3MMV A;  2AP1 A;  3SMS A;  1SQK A;  1GLL O;  2YHX A;  3WXJ A;  1EQY A;  4EIA A;  1QQN A;  4A2A A;  4H03 B;  1NGE A;  2A5X A;  3FFK B;  4K41 A;  5JIC A;  3JXU A;  3ATU A;  2HOE A;  4BRN A;  2I7N A;  3RSE B;  5JLF A;  3ZX2 A;  1HKC A;  2YI1 A;  3GE1 A;  3MN9 A;  1JCE A;  5AQR A;  3VGK A;  1YXQ A;  2A40 A;  2HF3 A;  5LY3 A;  3VGL A;  3MDQ A;  3AY9 A;  1YUW A;  1ESV A;  4CZG A;  3HSC A;  3D7E O;  4RTF D;  4H0T B;  4K25 A;  5JLH A;  4JNE A;  3O80 A;  4ISG A;  3D2F B;  1ZBS A;  5BR9 A;  3VF2 A;  3D2E B;  3B8A X;  5AZJ B;  3QB0 A;  5AQL A;  1GLE G;  3DXM A;  4BC2 A;  4CBX A;  3FZF A;  3LDO A;  1IJJ A;  3W0L A;  3L4I A;  1ZC6 A;  4BC5 A;  3BP8 A;  3OHR A;  3O5B A;  5I9E B;  3WQU A;  1KAZ A;  3VPZ A;  4MO4 A;  2BTF A;  4BC4 A;  5EVZ A;  3H1Q A;  2E1Z A;  3IUC A;  4NO7 A;  3U8X A;  3VEO A;  1C0G A;  4BRG A;  5KPZ A;  1T44 A;  2E20 A;  4HWI A;  4IXC A;  4L3Q A;  4BRK A;  2FSN A;  4CD1 A;  1BWF O;  4FWL A;  2P9N A;  4H0V B;  1NGB A;  3ZX3 A;  3M1F A;  2A3Z A;  2A41 A;  4O8K A;  3HBT A;  2PAV A;  3FZK A;  1U2V A;  4WQ5 A;  3A5N C;  2Q31 A;  1XQS C;  1KAY A;  2FLO A;  4AM6 A;  2V7Y A;  3CQX A;  4FSV A;  3ULE B;  2GEM A;  4BR5 A;  4Y0W A;  4MLH A;  3W3D A;  2P9K B;  2D0O A;  3VEW A;  2CGL A;  2IVN A;  3VGM A;  1WUA A;  4BRI A;  2AA4 A;  5EOY A;  3LL3 A;  3CQY A;  4BVP A;  3LDQ A;  3CER A;  4A2B A;  3VET A;  3CJC A;  4CZE A;  3A5L C;  3CJA A;  3IFR A;  3H46 O;  3VEV A;  4BRH A;  4MO5 A;  4H5N A;  3JS6 A;  3P4I A;  4YDU A;  2FSJ A;  1T6D A;  5AQO A;  4J8F A;  1BU6 O;  3CJ9 A;  2V7Z A;  4DB3 A;  5FPD A;  1S22 A;  3H6E A;  2ASP A;  2P9U B;  2J4R A;  2W40 A;  2YHY A;  3VEX A;  3GL1 A;  3M3Z A;  1SZ2 A;  3AAP A;  4BGB A;  3FZH A;  1NWK A;  3CHW A;  4EHT A;  2Q0U A;  2P9L A;  3R6M A;  4PL7 A;  4JN4 A;  3CJB A;  1GLJ O;  3VF4 A;  3WEE A;  4WYB A;  3O1B A;  3KHY A;  1BO5 O;  4HTL A;  4BQL A;  1TYQ B;  1K8K B;  1KXP A;  2W41 A;  3MN6 A;  5FPE A;  2P9S A;  5EXW A;  3SLC A;  2P9P A;  4IO8 A;  4B1U B;  5BPN A;  3QFU A;  3UKR A;  3CI5 A;  4H5R A;  2ASM A;  4C23 A;  2V51 B;  3QDK A;  5KPR A;  4H5T A;  2NZT A;  3AAQ A;  3ENH A;  1LCU A;  1JCF A;  4AM7 A;  4GY2 B;  4Z94 A;  4I6M A;  2E2Q A;  2Q2R A;  3SJH A;  2IVO A;  2ZGZ A;  3QML A;  4BR9 A;  1CZA N;  3IMX A;  4XEI A;  4FWK A;  5AQM A;  4IJN A;  3FLC O;  4GNI A;  4WQ4 A;  2A6A A;  2Q97 A;  3IDH A;  1QQO A;  2GUP A;  5AQQ A;  2E8A A;  5AQX A;  4BRO A;  1XC3 A;  2I7P A;  3DXM B;  5AQW A;  2E2N A;  4JHD B; 
#chains in the Genus database with same CATH topology
 4BGA A;  3BF1 A;  1RDW X;  4FJ9 A;  3ZET A;  3L2W A;  1RDB A;  2ZE2 A;  2P51 A;  1HPM A;  4M41 A;  3KTQ A;  4DR1 K;  4CED A;  5M1Q A;  1HKB A;  4FWP A;  5BPL A;  5J2Q A;  4M3X A;  2QXF A;  1BIS A;  3LAM A;  1U45 A;  5HRN A;  4CZK A;  2P9N B;  5HL7 L;  1U6Z A;  4FWQ A;  4PKI A;  2QA4 N;  1V4S A;  3THX A;  1NGI A;  3VTH A;  4E7J A;  1O13 A;  1BIZ A;  1I3A A;  3O3G A;  4FJX A;  2XY6 A;  1ATR A;  3DLB A;  3DOL A;  1HNZ K;  2HHT A;  3VEY A;  5ADX A;  1ZBI A;  1L3U A;  3HJF A;  4E0D A;  4OX9 K;  5FPN A;  1XNR K;  2IVP A;  2QWP A;  2WTU A;  1H1V A;  1BI4 B;  1QSS A;  1EO1 A;  4DTX A;  2OAN A;  3M8R A;  5C24 A;  1HUX A;  3GDQ A;  1SL2 A;  4B9S A;  3OYD A;  2QWO A;  2KQ2 A;  3QES A;  3E9L A;  3ZT2 A;  4J2D A;  1ASW A;  5CZ1 A;  2IGI A;  1JLB A;  3TAE A;  3CET A;  4H0X B;  1WSF A;  4FJJ A;  4H4M A;  2ATQ A;  4AHT A;  4DV6 K;  3QNN A;  4FO0 A;  2Y1I A;  3L4Q A;  2XY7 A;  1E3M A;  2VWJ A;  2HB5 A;  3VQD A;  3WNG A;  5E26 A;  3K5N A;  3NF7 A;  3OBY A;  2P9S B;  1ASV A;  5GAG P;  3A0I X;  1RBU A;  1T6C A;  4B1V A;  4KHS A;  2DPN A;  3LDN A;  2KW4 A;  4KH4 A;  4BG8 A;  1YT3 A;  4CJV A;  2VGN A;  3JAM O;  1BCO A;  4DU3 A;  1NGJ A;  4DQR A;  2NRH A;  3FZM A;  5HP1 A;  3VEZ A;  3ALY A;  1S1V A;  4NXM K;  1JXE A;  4GKK K;  4RCH A;  1FXX A;  1RBS A;  3LAL A;  1EP4 A;  1ATN A;  3ZX0 A;  1LW2 A;  4E1N A;  2P1J A;  2RN2 A;  3VN5 A;  3V9W A;  1YAG A;  2RF2 A;  3Q7B A;  3K9K A;  5AQU A;  1TUU A;  1G99 A;  4BWM A;  4WQ5 C;  4RW4 A;  3HXM A;  4FLZ A;  3WT0 A;  1KCF A;  4CZF A;  2PZS A;  1NOZ A;  4MQ3 A;  1IKW A;  4PQU A;  2H3G X;  2LSN A;  1RNH A;  2ITM A;  1K8K A;  2ZF5 O;  4X64 K;  4BVO A;  4ELT A;  4PKG A;  3KWI A;  5AQY A;  2YNG A;  4E1J A;  1Q81 O;  4JKE A;  4KI4 A;  3VES A;  3THY A;  3ITH A;  3OYK A;  4B1X B;  4DLG A;  5M1K A;  5BRE A;  2BH1 A;  5C10 A;  4BRE A;  1KQS M;  2PYJ A;  4JRP A;  5HRP A;  2KZZ A;  2JWK A;  1FJG K;  1X3M A;  1OVQ A;  3A5M C;  3BEX A;  4JHD A;  4CHN A;  1Z05 A;  3K2P A;  3UKU A;  3HI0 A;  4KBO A;  4KV8 A;  4B3R K;  3EL2 A;  1YJ9 N;  3HM8 A;  5KRS A;  3PX6 A;  2HHX A;  5BN8 A;  2GTD A;  2YHB A;  4V19 S;  4QAG A;  3OYF A;  4DTP A;  4CZH A;  4WE1 A;  1TK5 A;  4FLX A;  3NF9 A;  1IG8 A;  3FGU A;  4PKH A;  3GBT A;  4C8L A;  3HM9 A;  4ISF A;  3C7N A;  4FWN A;  1VQL N;  3TSQ A;  2NNW A;  4A61 A;  5KPT A;  4IJA A;  4W5N A;  3WEE B;  3THW A;  5LMN K;  5C2D A;  3O9S A;  3T1H K;  1YIJ N;  4H0P A;  4ISE A;  4DQ8 A;  4BE2 A;  1XUP O;  4Z4H A;  4NCG A;  4ID5 A;  4B9M A;  1B9D A;  3AAR A;  1Z6R A;  4Z0U A;  1LOT B;  4AHU A;  3HTV A;  1BGX T;  2VYP A;  1FW6 A;  2WON A;  5BRH A;  4CVN E;  3SUP A;  4I6M B;  3P1G A;  1IBM K;  3SQ0 A;  4CK3 A;  5ELZ A;  5B8H A;  1MWM A;  3U4L A;  3QEP A;  4CCH A;  4FPA A;  4KHP K;  3P39 A;  5GIP A;  3CMA N;  4Q5V A;  1RTD A;  1SS6 A;  3E9P A;  4E89 A;  4CIF A;  1VSH A;  1DTQ A;  3PX4 A;  1QS4 A;  4FJ8 A;  4IZ9 A;  5ADX H;  1LAV A;  2QWN A;  4DU4 A;  3RTV A;  4IEE A;  5EX5 A;  3UB5 A;  1KSP A;  2OPS A;  1U4B A;  1OH8 A;  3SMS A;  5J1E A;  1SQK A;  2YHX A;  4EIA A;  3IAY A;  3OS0 A;  3DOK A;  2HHV A;  3FFK B;  2HOE A;  4CFD A;  4CJE A;  3RSE B;  4GV6 A;  4JKB A;  3K9J A;  2HHS A;  3GE1 A;  1VSM A;  1A5V A;  5KTQ A;  1XMO K;  3HO1 A;  1JCE A;  2X6S A;  4CGF A;  4CFB A;  4CEO A;  1YXQ A;  4Y1D A;  4OLB A;  4B8C A;  5M1O A;  2UUA K;  3RMB A;  1NMN A;  4I9L A;  4DV3 K;  3OVN A;  1U47 A;  3AVG A;  1ESV A;  4CZG A;  3D7E O;  1S6Q A;  4K25 A;  3VQC A;  3KLF A;  5K14 A;  1VQN N;  5TKW A;  1N33 K;  3CM6 A;  1LWE A;  4I2Q A;  4BC2 A;  2B4J A;  3NMU A;  4FM1 A;  4CBX A;  3FZF A;  3K57 A;  1ZC6 A;  2HHW A;  3LAN A;  1IKX A;  2NRV A;  2Z1J A;  1KAZ A;  4YOY A;  3K5M A;  3TAF A;  5EVZ A;  3VQP A;  3OYB A;  4A59 A;  3G10 A;  4HCB A;  3U8X A;  3VEO A;  4IXC A;  3T1A A;  4CJS A;  1HJR A;  3V1Q A;  4BRK A;  2FSN A;  3AVJ A;  3CG7 A;  3L2R A;  3DI6 A;  4FWL A;  1J5E K;  1NK8 A;  3WXM B;  4DR3 K;  2D0B A;  4FJL A;  4WQ5 A;  1IH7 A;  2IS3 A;  2G8V A;  1XQS C;  1S9G A;  3CPW M;  4NLC A;  2GEM A;  4DTU A;  3W3D A;  2D0O A;  2IVN A;  2VQF K;  1WUA A;  3CCJ N;  2HBK A;  3SNN A;  4DSL A;  4DTS A;  3V9Z A;  3CJC A;  4E7H A;  1NKE A;  4JK7 A;  3A5L C;  3ZSW A;  4H5N A;  3JS6 A;  3P4I A;  2FSJ A;  5AQO A;  1K6Y A;  4J8F A;  1S72 N;  3CJ9 A;  3HST B;  4AHC A;  1W0H A;  4B9V A;  3QO9 A;  1RDD A;  1NJZ A;  2RKI A;  4LH4 A;  1RT7 A;  1GLJ O;  3VF4 A;  4WYB A;  4JI3 K;  2VQE K;  1BO5 O;  2OZS A;  4E3S A;  3OS1 A;  4BQL A;  1TYQ B;  3TAP A;  1XC9 A;  3LAK A;  1HQE A;  1X9W A;  2P9P A;  4IO8 A;  2P5O A;  3UKR A;  1YTA A;  3CI5 A;  4H5R A;  3FFI A;  2OYQ A;  3QDK A;  5HRR A;  3SJH A;  4DKW A;  4N76 A;  4DFM A;  1NK4 A;  2GUI A;  4F2S A;  4PA1 A;  3IMX A;  4XEI A;  3FLC O;  4WQ4 A;  3ZT1 A;  2O8E B;  3D45 A;  1QQO A;  2GUP A;  4FVU A;  4B3S K;  2E8A A;  5AQX A;  1RDA A;  4N47 A;  1XC3 A;  1Q86 O;  3ZSR A;  3RWU A;  3HZ6 A;  4B8A B;  4DF8 A;  1LV5 A;  3G0Z A;  4KHW A;  1NK0 A;  3MWT A;  4OLA A;  4KHN A;  4JI1 K;  1K9M O;  2Q3S A;  3ZEU A;  4DF4 A;  2WUS A;  1GLC G;  2OTJ N;  1ZBU A;  3ZSX A;  1JLE A;  1HLU A;  3NAE A;  4RWT A;  3V1O A;  3K5O A;  1TGO A;  1QHA A;  1N5Y A;  3SBT A;  3P83 D;  4DUY K;  1JL2 A;  3R8E A;  1HJO A;  4DFP A;  4GMJ B;  4M3W A;  1Y97 A;  4I2P A;  5H1S Q;  3ATV A;  3DXK B;  4FWR A;  4OO1 J;  1G15 A;  2OPR A;  1W9H A;  2E88 A;  1LWF A;  2NUB A;  2FXU A;  1T7P A;  3WXK A;  5JMV A;  1GLF O;  1KLM A;  4KTW A;  4E1M A;  1QVF M;  5J2N A;  1NMD A;  1S3X A;  1YHQ N;  3K0S A;  1RIL A;  3TPQ A;  2YNI A;  3D2F A;  2V52 B;  4DV0 K;  4L8R B;  3QEV A;  2GWJ A;  3ASM A;  4PHT X;  5AQI A;  1KVA A;  4FL9 A;  3SK3 A;  3SQ1 A;  1SL0 A;  2DFH A;  4M3R A;  4K42 A;  3PO4 A;  3LZJ A;  2ZGY A;  5AR0 A;  3UIQ A;  4J2A A;  2O8F B;  1TK8 A;  1IG9 A;  2D1K A;  3MN7 A;  4RW6 A;  1VQ5 N;  5AQP A;  3PY8 A;  2D0A A;  1BL3 A;  1GOB A;  4B9N A;  3DRR A;  3LZI A;  4EHU A;  1YF5 L;  4FW1 A;  1Q82 O;  4FLW A;  3PO5 A;  4DR4 K;  3K59 A;  4WFN L;  4CJF A;  3TAM A;  4CF8 A;  3VMF B;  5EU7 A;  4CD3 A;  4BR7 A;  4DG1 A;  3AA2 A;  4CEA A;  2RHK A;  4DSJ A;  3AO2 A;  4LC9 B;  5SZT A;  5SWM A;  2G8H A;  1IV0 A;  2QKK A;  3ULE A;  3AGR A;  1S1T A;  1Q7Y O;  1SKW A;  5LMU K;  1RDC A;  3VEN A;  1BOT O;  4CJQ A;  4W5O A;  4BE1 A;  4DTO A;  4G1Q A;  1BA1 A;  3AA3 A;  4NCA A;  4B1Z A;  3AVI A;  4BRM A;  4BRP A;  4EAH D;  3O08 A;  4X65 K;  1C1A A;  1S1U A;  4KO0 A;  4ILH A;  4FJM A;  3KWG A;  2G8K A;  1J53 A;  1BIU A;  2QW9 A;  4LD0 A;  3LP1 A;  4M3U A;  2P9U A;  5C12 A;  4DQS A;  4KHQ A;  4FOI A;  3LM9 A;  1S5J A;  4DCH A;  3AO4 A;  2P9I A;  1WB9 A;  4DLE A;  3O8M A;  3A8Y A;  3NF6 A;  4XH1 A;  3I0S A;  1R0A A;  3CCL N;  2O8D B;  3TWH A;  1BUP A;  4DU1 A;  4OKK A;  3CCE N;  5E84 A;  4DHY A;  3V81 A;  3PSI A;  3DM2 A;  4BRL A;  4G9Z A;  2JLE A;  1A5W A;  2E4L A;  1BDG A;  3BF3 A;  5KRT A;  5CHI A;  3CCU N;  1NJW A;  5AQG A;  4B9T A;  3C6H A;  1Y64 A;  3BZK A;  3MEE A;  1JLC A;  3F9M A;  4JI7 K;  1NGD A;  3WNF A;  3LP0 A;  1I94 K;  3RMC A;  4NYN A;  2KZM A;  2YKM A;  4CJ7 A;  2VG7 A;  2QKB A;  2W42 A;  5A2Q O;  1MU2 A;  3ENO A;  3NH2 A;  2CH5 A;  4DR5 K;  1LW0 A;  5GAD P;  4LH5 A;  3DLH A;  1QZ5 A;  4JKG A;  4CZI A;  4JI6 K;  1DKG D;  2ZJR L;  5M1P A;  1IKY A;  3RRG A;  4FWS A;  4GVE A;  1YTU A;  4JS5 A;  2O4I A;  3BUZ B;  2X74 A;  2F9W A;  4BRC A;  4BR2 A;  4CEE A;  3KKS A;  3AA4 A;  2WC9 A;  4IOX A;  1GOC A;  3NH1 A;  1L3S A;  3VQ5 A;  2D0P A;  3J81 O;  3OS2 A;  5F0X A;  3HVR A;  5LL6 Z;  3PLA A;  2UUC K;  4JK9 A;  4LSL A;  4B9Q A;  4BR0 A;  4LFB K;  5F1X A;  2P9L B;  4LF6 K;  4B9U A;  5GAE P;  2HHH K;  2NLX A;  4XH5 A;  5C25 A;  4JI5 K;  4CZJ A;  4DV2 K;  4H0O A;  3KK2 A;  1YVU A;  4MDA A;  2QM1 A;  2VG6 A;  1QE1 A;  1YVN A;  3AV9 A;  3O9T A;  1XHX A;  3AO3 A;  1YI2 N;  4BQZ A;  4FZX C;  4CF1 A;  4FJI A;  3FR0 A;  4DV1 K;  3BGR A;  2NRW A;  2GV9 A;  1FKP A;  4IO9 L;  3NF8 A;  3LDL A;  3AO1 A;  3QIO A;  5LJV A;  3ZSQ A;  4YOR A;  3OJS A;  1HNW K;  3MX5 A;  2OPP A;  5AZI A;  1DTT A;  4CJ4 A;  2P9I B;  3H3O B;  2QWL A;  4FWO A;  2QTD A;  3CF5 L;  5AQS A;  3WQT A;  3G71 N;  3CCR N;  1S1W A;  3E01 A;  3EN9 A;  3ZET B;  4O5B A;  1TL3 A;  4GV9 A;  3TI0 A;  2ZQB A;  3O4W A;  1C0M A;  3PIO L;  1IKV A;  1NBW A;  3MMV A;  2AP1 A;  1VSF A;  3WNE A;  1HNI A;  3ISN C;  1F21 A;  3WXJ A;  1EQY A;  1IO2 A;  1HRH A;  4A2A A;  3EZ5 A;  3M8S A;  1JLQ A;  1NGE A;  4CEF A;  3CD6 N;  3JXU A;  3ATU A;  4BDZ A;  3ULD A;  1HMV A;  4ZTF A;  4BDY A;  5JLF A;  1SL1 A;  3ZX2 A;  1S1X A;  2KFZ A;  3THX B;  3KIO A;  5CR4 A;  1UA0 A;  2X6N A;  4JKA A;  4ZHR A;  2XRI A;  4IG3 A;  5LY3 A;  1VSK A;  3OYL A;  3SAF A;  1U49 A;  4C1N K;  4MFB A;  1LAW A;  3OYA A;  5JLH A;  3CPE A;  2FBY A;  4ISG A;  4JKG B;  5BR8 K;  1NK5 A;  2PYL A;  5BR9 A;  3U3Y A;  4Z4E A;  1VQP N;  4KH6 A;  5AQL A;  2ZJP L;  4DS4 A;  1RDU A;  3TR8 A;  3V6D A;  4IG0 A;  1KTQ A;  3LDO A;  1IJJ A;  3EE9 A;  4EZ6 A;  4DTJ A;  4CES A;  2HND A;  4UY8 O;  4MDB A;  3S3O A;  2G8U A;  2HW3 A;  2BTF A;  4CGJ A;  4FM2 A;  3HL8 A;  3H1Q A;  4CIE A;  5J2P A;  2E1Z A;  3IUC A;  1WAF A;  5KPZ A;  1T44 A;  2E20 A;  1VSD A;  4CD1 A;  4W5Q A;  2HNY A;  2FBT A;  3F9K A;  3SUQ A;  1VSL A;  1C6V A;  2A3Z A;  1HNV A;  4JK8 A;  2PAV A;  3FZK A;  4KB0 A;  1TL1 A;  2E5L K;  3C65 A;  4B9L A;  1N36 K;  3LWM A;  3MCA B;  4K0K K;  4MLH A;  4FZZ A;  3VGM A;  3HOT A;  4OPJ A;  2AA4 A;  3CQY A;  4HCC A;  4BVP A;  4A2B A;  3J80 O;  1D9F A;  4JI0 K;  3ZT0 A;  4CZE A;  3DLL L;  2WBN A;  3VEV A;  3CJA A;  3H46 O;  4BRH A;  4MO5 A;  3IS9 A;  4JKF A;  2G8I A;  1BU6 O;  2V7Z A;  1S22 A;  1WSI A;  1Z25 A;  3H6E A;  4LF9 K;  2O8C A;  2J4R A;  2W40 A;  2YHY A;  2R7Y A;  1SZ2 A;  1NWK A;  2BDP A;  3RRH A;  1BQM A;  4PL7 A;  4JS4 A;  3NGI A;  3O1B A;  5IT9 O;  2HMI A;  3OYN A;  3AVC A;  1K8K B;  1KXP A;  1VQM N;  4KPY A;  4KRF A;  3DMJ A;  1L3T A;  2W41 A;  4CFC A;  5HOO A;  3OYH A;  4U67 L;  4RG8 A;  4WF9 L;  2HBM A;  3SLC A;  3TTC A;  4KFB A;  4B1U B;  3OYE A;  1XWL A;  2ASM A;  2V51 B;  5KPR A;  4H5T A;  2NZT A;  3AAQ A;  3CFR A;  3ENH A;  4DSF A;  3AGK A;  3THY B;  1QHT A;  4AM7 A;  3LPT A;  1ILY A;  4EP4 A;  4BR9 A;  1X9M A;  1TKX A;  5AQM A;  1NJX A;  3ZSV A;  4E19 A;  5J2M A;  1YIT N;  4DV5 K;  1N8R O;  3VQ9 A;  3U6F A;  1T03 A;  2UXB K;  4Z4G A;  4BRO A;  1QQC A;  3SI6 A;  2I7P A;  5AQW A;  2PY5 A;  4CGG A;  2B6A A;  1JLG A;  4CGI A;  4JHD B;  4YNQ A;  3UKU B;  1OH6 A;  3EO3 A;  2YKN A;  3BY5 A;  1WN7 A;  3VER A;  3SYZ A;  4QS9 A;  4IOC L;  4JD2 A;  3ZT3 A;  3NVM A;  4A5A A;  5HLF A;  4N41 A;  2WOM A;  2IIR A;  3V1R A;  1CZ9 A;  1P8Z A;  4JKD A;  3VA3 A;  5M1N A;  3MXJ A;  4YDU C;  1TKT A;  1SKS A;  3L3V A;  4O0J A;  3C95 A;  1RBR A;  4CJK A;  3V9S A;  3C7N B;  4FJN A;  1NGF A;  2YJF A;  4ILG B;  3M6G A;  3THW B;  3CME N;  3AVL A;  2D0C A;  4ZTJ A;  1E4G T;  4N5S A;  3VTI A;  3HOS A;  2YNF A;  1HKG A;  1HYV A;  3KJV A;  3OJU A;  3AA5 X;  3T3F A;  2O8B A;  5AZJ A;  5GIN A;  4F3O A;  2ZWH A;  3KVG A;  5E41 A;  3AO5 A;  2RPI A;  3PSF A;  4R79 A;  2YJE A;  3O6W A;  1JL1 A;  1J54 A;  3L0Q A;  3I56 N;  1CXQ A;  3MEC A;  3JYT A;  1ZBL A;  4DV4 K;  5DM7 L;  4W5R A;  4K8X A;  1BG3 A;  1V4T A;  1K73 O;  3ZSZ A;  4BG9 A;  3MN5 A;  2Q36 A;  4OJR A;  3QIN A;  3BDP A;  4M7Y A;  2D5R A;  1VRU A;  2IAJ A;  4FLU A;  2GBZ A;  2ASO A;  1NK7 A;  1JCG A;  4JKC A;  3WXI A;  5KGW A;  2KHO A;  1NU0 A;  4DMN A;  4FK0 A;  3M8P A;  4IBN A;  2HVH A;  4OPA A;  5AFU H;  4UQG A;  5EY4 A;  4ID1 A;  5AJ3 K;  1NOY A;  5GIO A;  4F2R A;  2PFU A;  3WUH A;  4PL8 A;  4WCE L;  4CW7 B;  3CIP A;  2YX6 A;  4DFJ A;  3EKU A;  1BHL A;  2P9K A;  3SAH A;  4W5T A;  3CC2 N;  4FPB A;  2E2O A;  4K43 A;  1IBK K;  1FKO A;  1NGG A;  1WBB A;  2HHQ A;  4M3Z A;  1W7A A;  1DGK N;  2GWK A;  3SMP A;  3U3G A;  4CBU A;  3CFP A;  3MCP A;  2VWB A;  4J2B A;  5AQZ A;  4QOZ B;  1M90 O;  4Z4F A;  1B9F A;  4YY3 K;  3I55 N;  2FBV A;  3VF6 A;  3E9O A;  2G8F A;  3PX0 A;  1WLJ A;  5CYQ A;  4CJ5 A;  3OYI A;  3S9H A;  3SUO A;  4CEZ A;  2F4V K;  2YCH A;  3QLH A;  3H45 C;  5CYM A;  3S3N A;  3OYG A;  1EWR A;  3M8Q A;  3LM2 A;  2O4G A;  4NLB A;  3DLR A;  1C1C A;  4LF4 K;  2D4W A;  2DTU A;  1NKB A;  1J6Z A;  2YHW A;  1TKZ A;  3A5O C;  5I3U A;  2VG5 A;  3ID6 A;  5AQH A;  1D8Y A;  3RMD A;  4DS5 A;  3C6T A;  4O4G A;  4R5P A;  4IFY A;  4X62 K;  4O44 A;  4CI6 A;  1Q9Y A;  3R1X A;  4ELV A;  2QEX N;  1RBV A;  4IKF A;  4Z4C A;  1NGC A;  2FF6 A;  1RTJ A;  5AQF A;  4RW7 A;  5AQK A;  2HBL A;  1RTI A;  1RT2 A;  3O9U A;  4A62 A;  5AQJ A;  3TAB A;  4IFE A;  1DT9 A;  5BN9 A;  3G4S N;  4KHY A;  4F8R A;  1EXQ A;  3QBX A;  2F7T A;  2QWQ A;  3I8B A;  4H5W A;  3C94 A;  3ZSY A;  1BA0 A;  1TUY A;  3D2E A;  3OA9 A;  1NGH A;  3RR7 A;  1SUQ A;  3RMA A;  4FM0 A;  4GKJ K;  1ZXO A;  4KKO A;  1HYS A;  1OH5 A;  3CJ7 A;  2CH6 A;  4H5V A;  1C0T A;  2HBJ A;  4YHH K;  4K8Z A;  5AQV A;  3TTD A;  3NH0 A;  3NCI A;  5FRM A;  4IOA L;  4GW6 A;  1GLD G;  4IFV A;  1WOQ A;  1UOC A;  1RT1 A;  2BE2 A;  3OTO K;  3VQA A;  4GVM A;  4BRD A;  4JI4 K;  3C0B A;  1KLN A;  4JAX A;  2P9P B;  2CGJ A;  1A5X A;  4CFA A;  5CE3 A;  3UKR B;  5HRS A;  1OKJ A;  2E1Y A;  1YJN N;  3T19 A;  4AF1 A;  4CJL A;  3MXM A;  1NG9 A;  1BI4 A;  2A1S A;  3KK3 A;  1KRP A;  1NM1 A;  4YOW A;  4F4K A;  3H08 A;  3TU5 A;  3I33 A;  4CJW A;  3SAG A;  3V4I A;  3G6E N;  1N34 K;  4JKH A;  4CZM A;  1KD1 O;  2GEL A;  3NBP A;  4NXN K;  3NFA A;  2OPQ A;  4KI6 A;  2ZD1 A;  3B6O A;  1KAX A;  1QSL A;  3AVH A;  3T7Z A;  3D0P A;  1XNQ K;  4CEQ A;  1QSY A;  4KTQ A;  5BPM A;  3TSP A;  3B6P A;  2BAN A;  4CEB A;  1JJ2 M;  4DR6 K;  1S6P A;  4M42 A;  1U48 A;  3L2V A;  4BY9 C;  2B5J A;  3ZEU B;  1HQU A;  4FJG A;  1GLL O;  2F8S A;  1QQN A;  4CER A;  4KHU A;  3P5J A;  3K5L A;  4KH5 A;  4CHZ A;  3TAR A;  3F73 A;  4BRN A;  1B92 A;  2I7N A;  1TKD A;  1HKC A;  3DLE A;  1FK9 A;  3VGK A;  4O55 A;  3CC4 N;  3L2U A;  2A40 A;  2HF3 A;  5KGX A;  4FK2 A;  1X9S A;  3VGL A;  3MDQ A;  3SV4 A;  4Z4I A;  3AY9 A;  3HSC A;  4ICL A;  4RTF D;  1TAU A;  3P31 A;  1TK0 A;  3DRP A;  4DSE A;  4A5B A;  3DYA A;  4JNE A;  4CK2 A;  1ZBH A;  3D2F B;  3HPG A;  4GV3 A;  1ZBS A;  3CYM A;  3VF2 A;  3D2E B;  3NDK A;  2ZM6 K;  4CK1 A;  5JS2 A;  1WSE A;  2VWK A;  3MED A;  3W0L A;  3E66 A;  2KTQ A;  4BC5 A;  1VSE A;  3O4N A;  5C2F A;  3BP8 A;  3EYZ A;  3CFO A;  3OHR A;  4CJP A;  2OCE A;  2Z1H A;  4DR2 K;  3J7A P;  3O5B A;  5I9E B;  4XIU A;  4C8K A;  5CY4 A;  4MO4 A;  4BC4 A;  1JXB A;  4H8K A;  4HUE A;  3MAQ A;  4NO7 A;  3CCV N;  4JI2 K;  3LP3 A;  4BRG A;  4N56 A;  4HWI A;  3S3M A;  2RE2 A;  4RW9 A;  4CJU A;  1BWF O;  1T3V A;  4H0V B;  1CXU A;  1HNX K;  3ZX3 A;  4E7L A;  3M1F A;  4KTZ A;  4O8K A;  4M45 A;  4LY7 A;  4BAC A;  3HBT A;  3LP2 A;  2XO7 A;  1U2V A;  2YV0 X;  1VAZ A;  3A5N C;  5C15 A;  4DSK A;  1LWC A;  3KD1 E;  1QVG M;  2OA8 A;  3KLI A;  3K58 A;  1KAY A;  2FLO A;  4C1N I;  3V9U A;  4JYA K;  4DR7 K;  2UXD K;  3ULE B;  3O3F A;  4KRE A;  1VHX A;  5DMR A;  3KLE A;  5EOY A;  5C42 A;  3LDQ A;  1VQ7 N;  4FLT A;  1Q8I A;  4YOV A;  1JLA A;  2KKZ A;  4OPH A;  4DB3 A;  5FPD A;  2P9U B;  3VEX A;  2Y1J A;  3FZH A;  3CHW A;  4EHT A;  4BWJ A;  1BQN A;  2G8W A;  1WNS A;  5FDL A;  3F2K A;  3VQ4 A;  3Q7C A;  4IEI A;  3R6M A;  4JN4 A;  4CGD A;  4BE0 A;  2UU9 K;  3WEE A;  3E1Y A;  3KHY A;  3MWP A;  2JGU A;  4FW2 A;  5FRO A;  4HTL A;  4ILJ A;  2I5J A;  4A57 A;  3NHG A;  1C1B A;  1RBT A;  1VQ6 N;  1ZBF A;  2NRZ A;  3HP6 A;  5BPN A;  3QFU A;  4B3T K;  2P5G A;  1DLO A;  4AQY K;  1SKR A;  3D6R A;  1LCU A;  2FC0 A;  3SQ2 A;  4CF0 A;  4I6M A;  4DTM A;  2E2Q A;  3QET A;  2HST A;  2IVO A;  4CEC A;  1CZA N;  1VQ8 N;  4HUG A;  2ETJ A;  4E7K A;  4DSI A;  3IDH A;  1NKC A;  3EY1 A;  4JRQ A;  2HHU A;  2E2N A;  1NJI O;  1L3V A;  2Z1G A;  4H4O A;  3AVB A;  4CF9 A;  5FRN A;  5FLX O;  4YOU A;  4C8O A;  3O9Q A;  2FF3 B;  2Q1N A;  3MEG A;  4CJR A;  1NGA A;  3MX2 A;  3T69 A;  4CGH A;  3TAG A;  1N32 K;  5C0Y A;  1CLQ A;  3AVM A;  3QIC A;  4FLY A;  2CGK A;  4JV5 K;  3ZYY X;  4CZL A;  3FZL A;  3QIP A;  4BRQ A;  2HF4 A;  4CJT A;  4DV7 K;  1K8A O;  1EET A;  1MDU B;  1HYZ A;  4NCB A;  1RT6 A;  4M63 C;  3RSE A;  5AFU A;  3QFP A;  1TVR A;  1E4F T;  3A2F A;  3TAQ A;  4J2E A;  3BZC A;  1TAQ A;  4HUF A;  1WSJ A;  3SPY A;  1U2V B;  2EHG A;  3VOV A;  3U9Z A;  1GLB G;  3UE5 A;  4M3Y A;  2F9T A;  3SZ2 A;  3KZB A;  3M5R A;  5BRF A;  2Z1I A;  2XY8 A;  3EEQ A;  3OYJ A;  1VQK N;  3L8B A;  2KFN A;  1TV6 A;  1RGI A;  3I0R A;  4DUZ K;  3O1W A;  1JKH A;  2E2P A;  5I42 A;  3KLG A;  4FWM A;  3AVF A;  2XY5 A;  3VQE A;  4B1W B;  3QER A;  4FVM A;  4DTR A;  4WQ4 C;  4YFU A;  3CQ8 A;  3KD5 E;  5AZI B;  2UYT A;  3NE6 A;  3HP9 A;  1Q18 A;  2VGM A;  4HVJ A;  3U9D A;  1RTH A;  4F9O A;  1UWB A;  4LF7 K;  2QXL A;  4EZ9 A;  2EX3 A;  5MLC Q;  4MLE A;  4CBW A;  4AIL C;  1UA1 A;  4IDH A;  3HPH A;  3THV A;  3O9R A;  3OYC A;  3PUF A;  5CZ2 A;  1CZB A;  5KQ8 A;  3DJC A;  2QWM A;  3KLH A;  3AVA A;  2BGG A;  2F96 A;  3DRS A;  1ZYQ A;  3RR8 A;  3R9P A;  1D4X A;  2PBD A;  1XI1 A;  1QTM A;  3ZCM A;  1KC8 O;  5HBM A;  3TAN A;  2IOC A;  3LPU A;  1W97 L;  4C8M A;  1D5A A;  2FSK A;  5AQT A;  3WXL A;  1BCM A;  3PV8 A;  1Z26 A;  4BC3 A;  3DLK A;  5BRD A;  4O5F A;  2UUB K;  1EKE A;  1KFS A;  3KKR A;  1VSJ A;  5T7B A;  1MA9 B;  2OTL N;  3EKS A;  3CC7 N;  3LDS A;  1QZ6 A;  3IKM A;  3LDP A;  4FOE A;  4OGC A;  3ZT4 A;  5F2R A;  1M1K O;  4LFA K;  4CHY A;  2A42 A;  1RFQ A;  3SPZ A;  3OYM A;  2QWR A;  3ZLJ A;  4OKJ A;  3VQ6 A;  1VQ9 N;  1U04 A;  1C0U A;  3GOI A;  2QK9 A;  1WAJ A;  2BUP A;  4LSN A;  3CM5 A;  3J8A A;  2EWS A;  2Q0R A;  3EZW A;  3GG4 A;  3H1V X;  4KB1 A;  3TSU A;  2DFF A;  4QS8 A;  4CHQ A;  1TYQ A;  1UAX A;  3AVN A;  2YNH A;  4DFK A;  4FCY A;  2XHB A;  3DWL A;  1OVY A;  3HVT A;  3IRX A;  3ZSO A;  4B1Y B;  3S41 A;  2W6K A;  3DAW A;  3L6Q A;  4BRF A;  1YJW N;  3FE1 A;  3SUN A;  4M7X A;  4QS7 A;  1N6Q A;  1WSG A;  1VSI A;  2O8E A;  4NB4 A;  1I39 A;  4C8N A;  4CE9 A;  3QNO A;  4AHS A;  3KK1 A;  5LJW A;  2HMP A;  1EX4 A;  3T1Y K;  2KLA A;  1RCH A;  4DTN A;  1X3N A;  5JS1 A;  4FJ7 A;  4RW8 A;  1J5O A;  3J7Y P;  4JEP A;  1ATS A;  1HX1 A;  3VQB A;  2UXC K;  4QCL A;  3L2Q A;  4E7I A;  5AQN A;  1EWQ A;  4LF5 K;  1NJY A;  1GOA A;  1DEJ A;  2YHA A;  4IWV A;  2O8C B;  4XH4 A;  4HHT A;  1SAZ A;  5JVH L;  3IG1 A;  3JSM A;  1J9A A;  1OH7 A;  3DXK A;  4BRA A;  4DWI A;  1KVB A;  4AHV A;  5KQD A;  2IC3 A;  1ITG A;  1R59 O;  1SV5 A;  3DLG A;  2X78 A;  4X66 K;  4EFH A;  1T8E A;  3MK6 A;  1REV A;  1HPZ A;  4BR4 A;  4O0I A;  3CJ1 A;  4YOX A;  4OPK A;  1MWK A;  1NLV A;  2VCP A;  4LF8 K;  1X9J A;  3R3L A;  2NRT A;  3ENB A;  3N4Q A;  1C0F A;  3PIP L;  3NVK A;  2O8F A;  3J7Z O;  1ASU A;  1GLA G;  4H0Y B;  3CCM N;  2JWL A;  3HRG A;  3G25 A;  3LWL A;  3H3N O;  5TKY A;  3TTF A;  5FPM A;  3QEI A;  3QBW A;  1NNE A;  3ID8 A;  1VRT A;  4JD2 B;  1QQM A;  4PWD A;  3WNH A;  4WFB L;  4TSX A;  1JLF A;  3P38 A;  4H03 B;  1T05 A;  2A5X A;  4K41 A;  5JIC A;  2OZM A;  5D3G A;  3I8D A;  4PUO A;  3CXC M;  2YI1 A;  1X1P A;  3MN9 A;  1XHZ A;  3VQ7 A;  5AQR A;  3N4P A;  3C6U A;  4FJH A;  4B08 A;  1RT3 A;  2FBX A;  3C6A A;  1VK0 A;  4M3T A;  2DY4 A;  1YUW A;  3VA0 A;  4H0T B;  4PY5 A;  3HK2 A;  4WFA L;  3O80 A;  4FJK A;  3KK7 A;  4OKE A;  3QEW A;  2WFB A;  4CHO A;  3B8A X;  2O8B B;  2HVI A;  5AZJ B;  3QB0 A;  2F8T A;  1GLE G;  1P90 A;  4OGE A;  4FYD A;  3CCQ N;  4CHP A;  3DXM A;  4ELU A;  1IBL K;  2NRR A;  2W6L A;  3MXI A;  4YOT A;  3L4I A;  4EP5 A;  4CF2 A;  5DK5 A;  1D9D A;  2O8D A;  2E6L A;  2E6M A;  4FLV A;  3WQU A;  3VPZ A;  4U7B A;  3NGZ A;  4HTU A;  5IWA K;  2ZJQ L;  3SJJ A;  3EE8 A;  2IDO A;  1C0G A;  3SBG A;  3NGY A;  4L3Q A;  4AH9 A;  4BDP A;  3F5T A;  2P9N A;  4FJ5 A;  1NGB A;  3HT3 A;  4FXD A;  1O1W A;  2A41 A;  1NK6 A;  1VQ4 N;  3CCS N;  4F3T A;  1KFD A;  2Q31 A;  4CJ3 A;  3VQQ A;  1WSH A;  2QI2 A;  4AM6 A;  2V7Y A;  3CQX A;  5M1F A;  4FSV A;  3OY9 A;  4BR5 A;  4Y0W A;  2HNZ A;  2P9K B;  3VEW A;  3VQ8 A;  2CGL A;  4JI8 K;  1L5U A;  4BRI A;  4LFC K;  1Q9X A;  3LL3 A;  1WBD A;  4B3O A;  3CER A;  3VET A;  3HPO A;  4NYF A;  2GX9 A;  4B3M K;  3IFR A;  3SV3 A;  4YDU A;  5GAH P;  4CIG A;  1T6D A;  3O3H A;  3OW2 M;  2ASP A;  3GL1 A;  3M3Z A;  3AAP A;  4BGB A;  4KAZ A;  4DQP A;  4IDK A;  3O4Q A;  2Q0U A;  4Y1C A;  4I7F A;  2P9L A;  4I9Q A;  4FZY A;  3CJB A;  5JVG L;  3SQ4 A;  1HR0 K;  4Q0B A;  3AVK A;  2A1R A;  3MN6 A;  4AHR A;  5FPE A;  4DQQ A;  1W2B M;  2P9S A;  5EXW A;  3V9X A;  2NRX A;  1NK9 A;  5HRO A;  5DM6 L;  4C23 A;  4FK4 A;  1JCF A;  4GY2 B;  4O8U A;  4Z94 A;  5KI6 A;  1KVC A;  2ITG A;  2Q2R A;  2ZGZ A;  3QML A;  3L3U A;  1RT5 A;  2DFE A;  1S9E A;  4FWK A;  4IJN A;  4GNI A;  3HYF A;  3OBW A;  2A6A A;  2Q97 A;  1XMQ K;  5AQQ A;  4DQI A;  1RT4 A;  3RVC A;  1VQO N;  4OVL A;  3DXM B;  3QEX A;  4JLH A;  3SCX A;  2AJQ A; 
#chains in the Genus database with same CATH homology
 3UKU B;  4BGA A;  3HZ6 A;  3BF1 A;  3EO3 A;  1RDW X;  4YOU A;  3MWT A;  3O9Q A;  2FF3 B;  3ZET A;  2Q1N A;  3VER A;  1K9M O;  1NGA A;  3MX2 A;  3T69 A;  4QS9 A;  5C0Y A;  4IOC L;  4JD2 A;  4A5A A;  3NVM A;  3ZEU A;  1HPM A;  2WUS A;  1GLC G;  2OTJ N;  2IIR A;  3QIC A;  1P8Z A;  1HLU A;  2CGK A;  5M1Q A;  4RWT A;  4JKD A;  3ZYY X;  5M1N A;  1HKB A;  4FWP A;  4CZL A;  5BPL A;  1QHA A;  3FZL A;  3SBT A;  4YDU C;  1K8A O;  4BRQ A;  2HF4 A;  1MDU B;  3R8E A;  1HJO A;  4M63 C;  3RSE A;  2P9N B;  4CZK A;  5HL7 L;  1U6Z A;  3QFP A;  4FWQ A;  4PKI A;  5AFU A;  2QA4 N;  1E4F T;  1V4S A;  5H1S Q;  1NGI A;  3ATV A;  3C7N B;  3VTH A;  3DXK B;  1O13 A;  4FWR A;  4OO1 J;  2E88 A;  1NGF A;  2YJF A;  2FXU A;  3WXK A;  5JMV A;  1U2V B;  4ILG B;  3M6G A;  3CME N;  3VOV A;  1ATR A;  1GLF O;  1QVF M;  3U9Z A;  1GLB G;  1NMD A;  3VEY A;  3UE5 A;  5ADX A;  1S3X A;  1E4G T;  1YHQ N;  2F9T A;  3VTI A;  3HOS A;  3KZB A;  1HKG A;  5FPN A;  3TPQ A;  3M5R A;  3D2F A;  2IVP A;  2QWP A;  5BRF A;  2V52 B;  1H1V A;  1VQK N;  1RGI A;  5AZJ A;  5GIN A;  1EO1 A;  2OAN A;  2GWJ A;  3O1W A;  1HUX A;  3GDQ A;  2E2P A;  4PHT X;  5AQI A;  2QWO A;  2ZWH A;  3KVG A;  4FWM A;  4FL9 A;  3SK3 A;  4B1W B;  4K42 A;  3E9L A;  4R79 A;  2YJE A;  3O6W A;  4WQ4 C;  5AZI B;  2ZGY A;  2UYT A;  3L0Q A;  5AR0 A;  3I56 N;  1Q18 A;  2VGM A;  2D1K A;  3CET A;  4H0X B;  3U9D A;  3MN7 A;  4F9O A;  5DM7 L;  1VQ5 N;  1BG3 A;  1V4T A;  4FO0 A;  5AQP A;  1K73 O;  2QXL A;  3L4Q A;  4BG9 A;  3MN5 A;  2Q36 A;  5MLC Q;  4EHU A;  1YF5 L;  4M7Y A;  5E26 A;  1Q82 O;  4MLE A;  4CBW A;  3OBY A;  2P9S B;  5GAG P;  4IDH A;  4WFN L;  3A0I X;  3O9R A;  2ASO A;  1T6C A;  1JCG A;  4JKC A;  4B1V A;  5KQ8 A;  3WXI A;  3DJC A;  3VMF B;  2DPN A;  3LDN A;  4CD3 A;  2QWM A;  2KHO A;  4BR7 A;  4KH4 A;  4BG8 A;  2RHK A;  2VGN A;  4LC9 B;  4OPA A;  5AFU H;  3R9P A;  1D4X A;  2PBD A;  5EY4 A;  5GIO A;  1NGJ A;  2PFU A;  3WUH A;  4PL8 A;  4WCE L;  1KC8 O;  2NRH A;  3FZM A;  3CIP A;  3ULE A;  3AGR A;  1W97 L;  3VEZ A;  2YX6 A;  1Q7Y O;  3EKU A;  2P9K A;  3SAH A;  2FSK A;  3CC2 N;  4FPB A;  5AQT A;  2E2O A;  1BOT O;  4K43 A;  4RCH A;  3VEN A;  3WXL A;  1NGG A;  4BC3 A;  1BA1 A;  1ATN A;  5BRD A;  4O5F A;  4B1Z A;  3ZX0 A;  4BRM A;  4BRP A;  4EAH D;  3O08 A;  1DGK N;  2GWK A;  3SMP A;  1MA9 B;  1YAG A;  4CBU A;  3MCP A;  2VWB A;  4ILH A;  2OTL N;  5AQZ A;  3EKS A;  3KWG A;  3Q7B A;  1M90 O;  3CC7 N;  3I55 N;  3K9K A;  5AQU A;  1QZ6 A;  3IKM A;  3LDP A;  2QW9 A;  4FOE A;  3VF6 A;  3E9O A;  1TUU A;  1G99 A;  5F2R A;  1M1K O;  2P9U A;  2A42 A;  1RFQ A;  5C12 A;  2QWR A;  4WQ5 C;  4FOI A;  3LM9 A;  3WT0 A;  1VQ9 N;  4DCH A;  2P9I A;  3GOI A;  4CZF A;  2YCH A;  3A8Y A;  3O8M A;  2BUP A;  3H45 C;  4XH1 A;  3J8A A;  2EWS A;  2Q0R A;  3EZW A;  3GG4 A;  3H1V X;  3CCL N;  2H3G X;  3LM2 A;  4NLB A;  3TSU A;  1BUP A;  3CCE N;  4QS8 A;  5E84 A;  1TYQ A;  2ITM A;  1K8K A;  4DHY A;  2ZF5 O;  4BRL A;  2D4W A;  4G9Z A;  4BVO A;  4PKG A;  1J6Z A;  2YHW A;  3KWI A;  3A5O C;  1BDG A;  3BF3 A;  5AQY A;  5CHI A;  3ID6 A;  3DWL A;  1OVY A;  4E1J A;  3CCU N;  4B1Y B;  1Q81 O;  5AQH A;  5AQG A;  3S41 A;  4JKE A;  3C6H A;  3VES A;  1Y64 A;  3DAW A;  3L6Q A;  4CI6 A;  4BRF A;  3R1X A;  1YJW N;  4B1X B;  3FE1 A;  2QEX N;  4M7X A;  5M1K A;  1NGC A;  5BRE A;  3F9M A;  4QS7 A;  1NGD A;  2BH1 A;  2FF6 A;  5C10 A;  4BRE A;  1KQS M;  5AQF A;  5AQK A;  4NB4 A;  2JWK A;  2HBL A;  4CJ7 A;  3O9U A;  1X3M A;  4A62 A;  5AQJ A;  3A5M C;  4IFE A;  1DT9 A;  5LJW A;  2HMP A;  3BEX A;  2CH5 A;  3ENO A;  5BN9 A;  2KLA A;  4JHD A;  1Z05 A;  3UKU A;  5GAD P;  3G4S N;  1X3N A;  3HI0 A;  4KBO A;  3QBX A;  1QZ5 A;  2F7T A;  2QWQ A;  3I8B A;  4H5W A;  4JKG A;  4JEP A;  4CZI A;  1ATS A;  1DKG D;  1HX1 A;  1BA0 A;  1TUY A;  3D2E A;  3OA9 A;  1NGH A;  3EL2 A;  2ZJR L;  5M1P A;  3HM8 A;  1YJ9 N;  4FWS A;  4GVE A;  5BN8 A;  2GTD A;  5AQN A;  3BUZ B;  1ZXO A;  2F9W A;  4BRC A;  4BR2 A;  1DEJ A;  4CZH A;  2WC9 A;  3CJ7 A;  4IOX A;  2CH6 A;  4IWV A;  1IG8 A;  4XH4 A;  3FGU A;  4PKH A;  3GBT A;  4H5V A;  2D0P A;  1SAZ A;  5F0X A;  5JVH L;  3PLA A;  2HBJ A;  4ISF A;  3C7N A;  4JK9 A;  4FWN A;  5AQV A;  3DXK A;  3TTD A;  4B9Q A;  4BR0 A;  1VQL N;  5F1X A;  2P9L B;  3TSQ A;  2NNW A;  4A61 A;  5KPT A;  4IJA A;  4BRA A;  5GAE P;  3WEE B;  4IOA L;  2NLX A;  1GLD G;  4XH5 A;  5C2D A;  1WOQ A;  3O9S A;  5KQD A;  1YIJ N;  4H0P A;  4ISE A;  4DQ8 A;  1R59 O;  4BRD A;  4CZJ A;  1XUP O;  3C0B A;  4H0O A;  4JAX A;  4MDA A;  2QM1 A;  1YVN A;  3O9T A;  2P9P B;  1Z6R A;  2CGJ A;  3AAR A;  4BQZ A;  5CE3 A;  1YI2 N;  1LOT B;  3UKR B;  4EFH A;  3HTV A;  3MK6 A;  1OKJ A;  2E1Y A;  1YJN N;  4AF1 A;  2VYP A;  3FR0 A;  4BR4 A;  5BRH A;  2NRW A;  3CJ1 A;  4I6M B;  4YOX A;  1MWK A;  4IO9 L;  1NM1 A;  1NLV A;  2VCP A;  4YOW A;  5ELZ A;  3TU5 A;  5B8H A;  1X9J A;  3I33 A;  1MWM A;  3LDL A;  3R3L A;  2NRT A;  3U4L A;  3SAG A;  4FPA A;  3G6E N;  3ENB A;  3P39 A;  5LJV A;  4JKH A;  4CZM A;  3N4Q A;  5GIP A;  4YOR A;  3CMA N;  1KD1 O;  2GEL A;  1C0F A;  3PIP L;  3MX5 A;  5AZI A;  1SS6 A;  3E9P A;  3NVK A;  1KAX A;  4H0Y B;  1GLA G;  3J7Z O;  2P9I B;  3T7Z A;  3CCM N;  4IZ9 A;  5ADX H;  5BPM A;  3H3O B;  2QWL A;  4FWO A;  2QTD A;  3TSP A;  3CF5 L;  5AQS A;  2JWL A;  1JJ2 M;  2QWN A;  3HRG A;  3WQT A;  3G25 A;  3G71 N;  3CCR N;  3ZET B;  3EN9 A;  3H3N O;  5TKY A;  4IEE A;  4GV9 A;  5EX5 A;  5FPM A;  3TTF A;  3UB5 A;  3QBW A;  3ID8 A;  4BY9 C;  3O4W A;  4JD2 B;  1QQM A;  3ZEU B;  1NBW A;  3PIO L;  3MMV A;  2AP1 A;  4WFB L;  3SMS A;  1SQK A;  1GLL O;  2YHX A;  3WXJ A;  1EQY A;  4EIA A;  1QQN A;  3P38 A;  4A2A A;  4H03 B;  1NGE A;  2A5X A;  3CD6 N;  3FFK B;  4K41 A;  4KH5 A;  3JXU A;  3ATU A;  5JIC A;  2HOE A;  4BRN A;  2I7N A;  3RSE B;  5JLF A;  4GV6 A;  3CXC M;  4JKB A;  3K9J A;  3ZX2 A;  1HKC A;  2YI1 A;  3GE1 A;  3MN9 A;  5CR4 A;  1JCE A;  3N4P A;  5AQR A;  3VGK A;  3CC4 N;  1YXQ A;  4JKA A;  2A40 A;  2HF3 A;  5M1O A;  5LY3 A;  3C6A A;  3VGL A;  3MDQ A;  3SAF A;  3AY9 A;  1YUW A;  4C1N K;  1ESV A;  4CZG A;  3HSC A;  3D7E O;  4RTF D;  4H0T B;  3P31 A;  4K25 A;  3CPE A;  5JLH A;  4A5B A;  4WFA L;  4JNE A;  3O80 A;  4ISG A;  4JKG B;  3D2F B;  3KK7 A;  4GV3 A;  1ZBS A;  5BR9 A;  1VQN N;  2WFB A;  3D2E B;  3VF2 A;  3B8A X;  1VQP N;  5AZJ B;  3QB0 A;  5TKW A;  4KH6 A;  5AQL A;  1GLE G;  2ZJP L;  1P90 A;  1RDU A;  3CCQ N;  3DXM A;  4BC2 A;  3NMU A;  2NRR A;  4CBX A;  3FZF A;  3LDO A;  1IJJ A;  3W0L A;  3E66 A;  3EE9 A;  3L4I A;  4YOT A;  1ZC6 A;  4BC5 A;  5C2F A;  3BP8 A;  3OHR A;  4UY8 O;  2NRV A;  3O5B A;  4MDB A;  3WQU A;  5I9E B;  1KAZ A;  3VPZ A;  4YOY A;  4MO4 A;  4U7B A;  2BTF A;  4BC4 A;  5EVZ A;  2ZJQ L;  3H1Q A;  4A59 A;  2E1Z A;  3EE8 A;  3IUC A;  4NO7 A;  3CCV N;  3U8X A;  3VEO A;  1C0G A;  4BRG A;  5KPZ A;  1T44 A;  2E20 A;  4HWI A;  3SBG A;  4IXC A;  4L3Q A;  2RE2 A;  4BRK A;  2FSN A;  4CD1 A;  1BWF O;  1T3V A;  3F5T A;  2P9N A;  4FWL A;  4H0V B;  1NGB A;  3ZX3 A;  3M1F A;  2A3Z A;  3WXM B;  2A41 A;  4O8K A;  4JK8 A;  1VQ4 N;  3HBT A;  3CCS N;  2PAV A;  3FZK A;  1U2V A;  4WQ5 A;  3A5N C;  1VAZ A;  5C15 A;  3C65 A;  2Q31 A;  1XQS C;  1QVG M;  2QI2 A;  1KAY A;  2FLO A;  4C1N I;  4AM6 A;  2V7Y A;  3CQX A;  5M1F A;  4FSV A;  3MCA B;  3ULE B;  3CPW M;  4NLC A;  2GEM A;  4BR5 A;  4Y0W A;  4MLH A;  3W3D A;  2P9K B;  2D0O A;  3VEW A;  2CGL A;  2IVN A;  3VGM A;  3HOT A;  1WUA A;  4BRI A;  2AA4 A;  2HBK A;  3CCJ N;  5EOY A;  3LL3 A;  3CQY A;  4BVP A;  3LDQ A;  3CER A;  4A2B A;  3VET A;  1VQ7 N;  4YOV A;  3CJC A;  4JK7 A;  4CZE A;  2GX9 A;  3DLL L;  2WBN A;  3A5L C;  3CJA A;  3IFR A;  3H46 O;  3VEV A;  4BRH A;  4MO5 A;  4H5N A;  3JS6 A;  3P4I A;  2KKZ A;  2FSJ A;  4OPH A;  4YDU A;  5GAH P;  4JKF A;  1T6D A;  5AQO A;  4J8F A;  1BU6 O;  1S72 N;  3CJ9 A;  2V7Z A;  4DB3 A;  5FPD A;  1S22 A;  3H6E A;  2ASP A;  3OW2 M;  2P9U B;  2J4R A;  2W40 A;  2YHY A;  3VEX A;  3GL1 A;  3M3Z A;  1SZ2 A;  3AAP A;  4BGB A;  3FZH A;  1NWK A;  3CHW A;  4EHT A;  2Q0U A;  3F2K A;  3Q7C A;  4IEI A;  2P9L A;  3R6M A;  4PL7 A;  4JN4 A;  3CJB A;  1GLJ O;  3VF4 A;  3WEE A;  4WYB A;  3E1Y A;  3KHY A;  3O1B A;  3MWP A;  5JVG L;  1BO5 O;  4HTL A;  4ILJ A;  4BQL A;  1TYQ B;  1K8K B;  1KXP A;  1VQM N;  4A57 A;  2W41 A;  3MN6 A;  5FPE A;  5HOO A;  1W2B M;  2P9S A;  4U67 L;  1VQ6 N;  4WF9 L;  2NRZ A;  2HBM A;  5EXW A;  3SLC A;  2P9P A;  4IO8 A;  3TTC A;  4B1U B;  3QFU A;  5BPN A;  2NRX A;  3UKR A;  5DM6 L;  3CI5 A;  4H5R A;  2ASM A;  4C23 A;  2V51 B;  3QDK A;  5KPR A;  4H5T A;  2NZT A;  3AAQ A;  3D6R A;  3ENH A;  1LCU A;  3AGK A;  1JCF A;  4AM7 A;  4GY2 B;  4O8U A;  4Z94 A;  1ILY A;  4I6M A;  2E2Q A;  2Q2R A;  3SJH A;  2HST A;  4DKW A;  2IVO A;  2ZGZ A;  3QML A;  4BR9 A;  1CZA N;  3IMX A;  4XEI A;  4FWK A;  5AQM A;  1VQ8 N;  4IJN A;  3FLC O;  4GNI A;  4WQ4 A;  1YIT N;  1N8R O;  3OBW A;  2A6A A;  2Q97 A;  3IDH A;  1QQO A;  2GUP A;  5AQQ A;  4FVU A;  2E8A A;  5AQX A;  3RVC A;  4BRO A;  1Q86 O;  1XC3 A;  1VQO N;  2I7P A;  3DXM B;  5AQW A;  2E2N A;  1NJI O;  4JHD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...